1VSMA

Asv integrase core domain in citrate buffer ph 5.0
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (INTEGRASE)
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsmA00
4QCLA 3NDKA 4HUGA 1TK5A 3C6UA 3DLEA 1NK5A 2O4IA 1ASWA 4KHYA 3ZSXA 2ATQA 3QESA 1Q9XA 1RT5A 4DU3A 3B6OA 4AILC 2OZMA 4KHWA 2XRIA 3DMJA 4M45A 3CFRA 1YTUA 5I3UA 2B4JA 1KLNA 3K5MA 1SL2A 4DTRA 4ZTJA 4KPYA 4FLYA 4I7FA 1T05A 4OPKA 3AVBA 3PO4A 4Z4HA 4JLHA 2D5RA 4FZXC 4CJ4A 4KI6A 1S9EA 4CJQA 1HYVA 3QETA 4CFCA 1XHXA 3HK2A 4CK1A 3VQ5A 4CF0A 4K8XA 1S6QA 4JS5A 5C24A 4ID1A 3OYHA 1RT1A 4NCGA 4DQIA 4DS5A 4ZTFA 5EU7A 2FBVA 1ZBIA 1WN7A 2ETJA 1UA0A 4DTSA 3O4QA 3L2UA 1D9DA 3KK3A 3LZJA 2VG5A 3AO4A 3SV4A 4F3OA 3JYTA 3L2QA 1TL3A 1SL0A 4DQRA 4Y1CA 3L2RA 4DTPA 2YNIA 4CJSA 3MEGA 1N6QA 1BIZA 4OPJA 4RW9A 4DFJA 2HNZA 2LSNA 4CESA 1I39A 3LP3A 3OYDA 4DLEA 4OLAA 4FVMA 3IS9A 1BISA 2G8IA 4ELTA 3NAEA 4HCCA 1ZBFA 2AJQA 1WAJA 3NGYA 4HTUA 2DY4A 3MXIA 3ZSVA 5E41A 3DLHA 4KTQA 3P1GA 4BE0A 1LAWA 1KVCA 1LWCA 1WAFA 1YTAA 3AVMA 4BE1A 1NOYA 1LWFA 3OYNA 4N76A 2QK9A 1KCFA 1XC9A 1RBRA 1VSDA 3QO9A 3V4IA 4FJNA 3ZT0A 4H4OA 1T7PA 3M8PA 4FJ9A 3RR7A 3K59A 1TV6A 4NYNA 4O55A 3OS2A 3DRRA 1TL1A 3NFAA 3HVTA 2G8WA 4PUOA 5HROA 3HO1A 5J2PA 3ZT4A 5KRTA 4N41A 4CIGA 1B92A 2GUIA 1ZBHA 1FKOA 3RMDA 3C6TA 3OYEA 1HPZA 4ELVA 3CM6A 1LW0A 3RMBA 1FXXA 3SNNA 4KRFA 2KFZA 1EX4A 1IKXA 5SZTA 3KLEA 4B8CA 3ISNC 4LD0A 1ASVA 3CFOA 4PY5A 2HHXA 1S5JA 4BACA 4FLWA 4HCBA 4QOZB 4DTMA 1KFDA 3ZSYA 4E7KA 4CJEA 1RTJA 3KTQA 3OYAA 4K8ZA 3WNGA 1BGXT 1WSHA 3F9KA 1HQEA 4KO0A 2O4GA 4CGGA 4W5TA 3HSTB 3QEPA 3ASMA 5JS1A 3HM9A 5J1EA 1R0AA 3VQBA 3HXMA 5KTQA 1L3TA 1IG9A 1RTDA 2BE2A 1T8EA 3TAFA 1X9SA 1BI4B 3AA5X 3K5LA 2G8KA 4CEEA 1IO2A 4W5OA 1JLBA 3DLRA 5HLFA 4FJ5A 2FBYA 2QXFA 1F21A 2WONA 4Y1DA 5KI6A 2P51A 3VQ8A 4E3SA 4F2SA 3KK2A 1RTIA 1RBSA 2EHGA 2KQ2A 3DOLA 3KKSA 3VQCA 4RW8A 2VG6A 3KLFA 3TAQA 2XO7A 4C8OA 4CFAA 3NF7A 4CHPA 3CG7A 3OJSA 1U48A 3DOKA 3QEVA 3PV8A 1C1CA 2DTUA 5FRMA 4FW1A 1RDCA 3AVKA 3V9ZA 4CHOA 2Z1JA 2JLEA 1DLOA 1B9DA 4CGJA 2F96A 3K5NA 3L8BA 2YV0X 3RTVA 4E7HA 1JLAA 3PX4A 4FJIA 3KLIA 2HHUA 2KZMA 3L2WA 1S9GA 2YHBA 2YNFA 2KW4A 3SZ2A 2ZQBA 3AV9A 4IBNA 3OY9A 2W42A 3NF9A 4CEDA 4FK4A 1S1XA 2Z1GA 1WLJA 5CYMA 4CERA 3SI6A 3IG1A 3SUQA 2GV9A 2VG7A 4EZ9A 4CK2A 3RMAA 2X74A 1N5YA 4Z4EA 4R5PA 4RW4A 3VQ9A 3ZSQA 4ID5A 1DTTA 4LY7A 1BCMA 2OYQA 3TAMA 4W5QA 1TK8A 4IG0A 4C8NA 4KB0A 3MEDA 5HRNA 3LWMA 1SV5A 4J2BA 5DK5A 3JSMA 1BCOA 5JS2A 1TK0A 4M3UA 3AA2A 4DFKA 2OPRA 4DG1A 1RT3A 3V1RA 5CY4A 3QIOA 4Z0UA 3WNFA 4CEOA 2G8UA 5CZ1A 1BQNA 1HNIA 3AVFA 3OYBA 4Q0BA 4FJXA 3TWHA 1RBTA 3SQ4A 1J53A 1J54A 1S1VA 4GMJB 4CJUA 3VQEA 5HRPA 4BE2A 1L3UA 4O0JA 1S1TA 4BDYA 3NE6A 1C6VA 3D45A 2R7YA 1J5OA 4WE1A 1SKSA 1Q9YA 3DYAA 1L3SA 3I0RA 1S6PA 1QQCA 4M3RA 4YNQA 1C0TA 3NCIA 1NKBA 5J2QA 3HP9A 1VSEA 3SPZA 3CM5A 3HVRA 1WSGA 1G15A 5KGWA 3KD5E 3QIPA 4CHYA 3O3HA 4CGHA 1D5AA 1MU2A 3LP1A 1C1AA 3TAPA 3B6PA 4FJKA 4KTWA 1CZ9A 4FLXA 4FZYA 4M3ZA 3CFPA 1CXUA 3CQ8A 1EP4A 3FFIA 2HHVA 4CJPA 4F8RA 2NUBA 3F73A 5HP1A 4DTUA 1RILA 2FC0A 2YHAA 1SUQA 1JKHA 1YT3A 1T03A 1C0UA 2YNHA 1VSIA 1GOCA 3TAEA 1JLCA 1QHTA 3AVGA 4CJFA 3EY1A 4DTOA 1NJXA 1YVUA 1D9FA 3KLHA 2KTQA 4BWJA 4CIFA 3OYLA 2G8HA 1CLQA 1A5VA 1RT7A 3HT3A 4DF4A 5HBMA 2IS3A 2JGUA 5J2NA 1RDBA 3AO3A 1JLFA 1IH7A 3DRSA 3AVNA 3NGIA 2HMIA 3DLBA 1Q8IA 1RTHA 3P5JA 2DFEA 3MECA 4XIUA 4UQGA 3RRHA 3VQ7A 5KGXA 3HPGA 2HB5A 4OVLA 4DMNA 3NBPA 3QEIA 1X9WA 1A5XA 4LSNA 5FDLA 3PX6A 2P5GA 1JLGA 2D0AA 1QSLA 1NK0A 4CEZA 3O4NA 4KKOA 4CF8A 3LZIA 3QNOA 2P1JA 4GW6A 3MEEA 4L8RB 2XHBA 1L5UA 2IC3A 4MQ3A 3RRGA 3S3OA 1LWEA 4LSLA 4DU1A 2HNDA 2DFFA 4DSEA 2QKKA 3SJJA 4I9QA 4M41A 3SUNA 4IDKA 3S3MA 1ZBLA 5FRNA 4OGEA 1VSLA 4B8AB 4O44A 3LAKA 3AVLA 1RBUA 2X6SA 4GVMA 5C25A 4CJVA 3OS1A 1NJYA 4O0IA 4DFMA 1RT4A 2IAJA 2ZE2A 3THVA 4M3XA 1J9AA 4B9SA 5D3GA 3OS0A 4KTZA 4F4KA 2IGIA 1IKVA 4LH5A 4EZ6A 1EETA 3V1QA 4B9VA 1NK8A 4KV8A 4ICLA 3ZSWA 4AHRA 3VQDA 4FZZA 4CEFA 3KKRA 3LPTA 3TR8A 4CFBA 2FBXA 3UIQA 4FJJA 4O5BA 2EX3A 1WSIA 4AHUA 1NK6A 4J2AA 3V81A 1XI1A 4DTJA 4B3OA 3H08A 1I3AA 3A2FA 1HRHA 4AHSA 1UWBA 1JXBA 1ZBUA 3WNHA 4CJKA 3T1AA 4DSLA 3TARA 3SYZA 1GOAA 4J2DA 4FM0A 3LPUA 3C94A 4CJ3A 4JRPA 4DU4A 1RCHA 1IKYA 4I2PA 3KLGA 1SKWA 1L3VA 4FJ7A 2QKBA 4E7JA 4G1QA 1UAXA 2ZD1A 4W5NA 3V1OA 1W9HA 1QSSA 3K5OA 1NKCA 2A1RA 5I42A 3TAGA 2ITGA 1NK4A 1BI4A 4CEBA 2VWKA 3AVCA 3OJUA 4CJWA 3C95A 3HP6A 3PUFA 1RT6A 4DQQA 2HHTA 4QAGA 4OKJA 2D0BA 3DRPA 4DSIA 4FJHA 3EYZA 5CYQA 3M8SA 2PYLA 4ZHRA 1VK0A 2BGGA 3S3NA 4KHNA 1RBVA 3ZT3A 3EZ5A 3AO1A 2D0CA 1CZBA 4DSFA 3MXJA 4PQUA 4FLVA 1TAUA 1VSJA 2OPQA 4CF9A 4FK2A 4KREA 3KIOA 3ITHA 2Z1HA 5CZ2A 3T19A 3MAQA 1UA1A 2HHWA 2FBTA 4CHNA 3KK1A 5DMRA 3T3FA 1KFSA 3VQQA 3HPOA 4KHSA 2HHSA 4CE9A 3OYMA 1EKEA 2OPPA 3VA3A 1S1WA 1A5WA 1JXEA 1TKZA 1C1BA 2DFHA 3VQAA 3VN5A 3OYIA 1U45A 3NH2A 1QSYA 4Z4FA 3U6FA 2X6NA 3NF8A 3LALA 4BDZA 2XY5A 1U04A 4FJLA 4EP5A 4CHQA 3RWUA 4CEAA 3VA0A 4Z4IA 2RN2A 1ITGA 2BDPA 2RPIA 1RDDA 4NCBA 1XHZA 4M3WA 1S1UA 1HNVA 3DLGA 4B08A 1X9MA 4H8KA 3M8QA 3AVIA 3SPYA 1Z26A 3ZT2A 4AH9A 3L2VA 4B9LA 4OLBA 2WOMA 1D8YA 1TKTA 2B6AA 3HL8A 5KRSA 3NGZA 3LDSA 1U4BA 1JL2A 4B9UA 2OZSA 4IG3A 4ELUA 1WNSA 2G8VA 2XY7A 4FJMA 2E4LA 3AVAA 1JL1A 4M3TA 1REVA 4CEQA 4OJRA 4BWMA 3SUOA 1NKEA 4TSXA 4Z4CA 4B9NA 1IKWA 1UOCA 3BGRA 1U47A 3OYFA 1LW2A 4M42A 3E01A 4E7IA 2HHQA 3LWLA 3K2PA 4IFYA 1KRPA 4F3TA 1TVRA 4J2EA 3ZSOA 3SUPA 4N5SA 3QNNA 4AHVA 3NH0A 1DTQA 3LP0A 4FM1A 4IKFA 3ULDA 4KHQA 3QEWA 5J2MA 1KSPA 4NYFA 3VQ4A 4FLZA 1ASUA 1U49A 3OYCA 3ZT1A 3DM2A 3QEXA 4DSKA 4DLGA 4DF8A 3QLHA 3SQ2A 1VSHA 4CJ5A 3SCXA 4AHTA 3V9UA 3V6DA 3OVNA 1XWLA 2PZSA 2PYJA 4E1MA 1QE1A 1LV5A 4FJ8A 2YKMA 1EXQA 4C8LA 4DTNA 4E0DA 3TABA 4CFDA 2YNGA 4E89A 1KVBA 5HRSA 4DQPA 3V9WA 4CF1A 2B5JA 4CF2A 3SQ1A 4HUEA 1W0HA 2XY8A 3AVJA 3LP2A 2G8FA 1HMVA 1TKDA 2HW3A 1KTQA 4FCYA 1TAQA 2OPSA 4HHTA 4HVJA 1BIUA 1CXQA 2HVHA 4EP4A 4DQSA 3NH1A 4B9MA 1KLMA 2RF2A 3HYFA 4AHCA 1C0MA 4W5RA 1VSKA 1FKPA 1RNHA 4CJRA 3OYJA 1VRUA 4DSJA 1KVAA 4YFUA 1HJRA 5HRRA 3U3GA 2RKIA 4CGFA 4F2RA 3DLKA 1O1WA 3NF6A 3AA4A 1HYSA 1JLQA 3PY8A 4KB1A 4IFVA 4NCAA 1RT2A 1B9FA 4O4GA 4KI4A 2IDOA 1NJWA 2OA8A 2IOCA 3AO2A 4CK3A 2E6MA 1ZYQA 4RW6A 1HQUA 1WSJA 1NK9A 3AVHA 4C8MA 1SKRA 4RW7A 5C42A 2F8TA 4FYDA 4FJGA 3KJVA 2Z1IA 4OKKA 3VQPA 3RMCA 4KHUA 4FXDA 1LAVA 3TANA 3MXMA 2HNYA 1NJZA 4LH4A 2YKNA 3ZSZA 1VSMA 5T7BA 3CYMA 4CHZA 3O3GA 3SQ0A 4Z4GA 4FW2A 3G0ZA 4E19A 3M8RA 1QTMA 4E1NA 3V9SA 4BDPA 1HYZA 4CJLA 4JS4A 3AA3A 3L3UA 2VWJA 3WNEA 1TKXA 1NK7A 1BL3A 3IRXA 3LANA 4OKEA 4RG8A 3D0PA 4B9TA 3IAYA 4HUFA 3OYGA 3P83D 1RDAA 4N47A 1GOBA 1NOZA 4E7LA 1X1PA 4OGCA 3TI0A 3RR8A 2Y1JA 1Z25A 4CCHA 1SL1A 4I2QA 3V9XA 2GBZA 3OYKA 5K14A 3KD1E 3L3VA 3QINA 3I8DA 3HJFA 1K6YA 3LAMA 3S9HA 4N56A 2Y1IA 1VRTA 1JLEA 2PY5A 3O3FA 1WSEA 3ALYA 2P5OA 1FK9A 4KAZA 3I0SA 2KZZA 4M3YA 3SV3A 4I9LA 1VSFA 4CIEA 1WSFA 2HVIA 5SWMA 3K57A 4MFBA 4DS4A 4DFPA 4JRQA 1TGOA 3G10A 4PA1A 3ZCMA 4FK0A 3HPHA 4KFBA 3VQ6A 3K58A 4CGIA 4DWIA 2E6LA 2I5JA 4CGDA 3ZSRA 2Q3SA 3NHGA 2BANA 4C8KA 4DTXA 4FLUA 2A1SA 2F8SA 3BDPA 1BQMA 2XY6A 4CJTA 3QERA 5FROA 3PX0A 3PO5A 4PWDA 3DI6A 4FM2A 4H4MA 1BHLA 1Y97A 2KFNA 4CECA 4FLTA 3AO5A 2X78A 4Q5VA 1QS4A 3U3YA
chains in the Genus database with same CATH superfamily
3NDKA 4HUGA 5FPNA 3DLEA 1NNEA 3ZSXA 4DU3A 3DMJA 4M45A 1YTUA 3CJ9A 3K5MA 4DTRA 1T05A 4XEIA 2D5RA 3PIPL 3QETA 3ATUA 3VQ5A 4K8XA 5LJWA 2ZF5O 4ID1A 1RT1A 4NCGA 5C2FA 5EU7A 2FBVA 2HBKA 3JXUA 5AQUA 1UA0A 4LF8K 3LZJA 3SV4A 3ZX3A 1SL0A 5H1SQ 5AQPA 1OH6A 4CJSA 4OPJA 4RW9A 4DFJA 3CIPA 1S22A 2D1KA 4LC9B 4BC5A 2O8DB 3EE8A 1I39A 4E1JA 1R59O 3ID8A 3NAEA 3LDOA 1ZBFA 5HL7L 3E66A 3ZSVA 4JI1K 1LWCA 3OYNA 4A2AA 3QFUA 3AGRA 1VQ4N 4YHHK 3M8PA 1TV6A 3DRRA 1TL1A 3NFAA 5HROA 1XMQK 2HOEA 4N41A 2UUAK 4OPHA 1ZBHA 3RMBA 1QVFM 1IKXA 1EX4A 3LDPA 3KLEA 2QEXN 3LDNA 3ISNC 4LD0A 1RDWX 4B8CA 4DR2K 3P4IA 4A2BA 2HHXA 4FLWA 4PKHA 4K8ZA 5GAEP 1T6CA 3HSTB 3QEPA 3ASMA 5J1EA 3HXMA 1X9SA 3AA5X 1JJ2M 1IO2A 3DLRA 5HLFA 5BPMA 2P51A 3CJAA 1RTIA 3KLFA 4JHDB 3VQCA 1IJJA 4CBWA 1BA1A 3O4WA 2F9TA 4LF7K 5FRMA 4FW1A 3AVKA 4YY3K 1YIJN 1B9DA 4CGJA 4E7HA 3PX4A 2YV0X 3RTVA 1WUAA 3N4PA 2F7TA 2YHBA 2W42A 2UUCK 4FK4A 3K9KA 5AQXA 2D0PA 3SI6A 3SUQA 2CGKA 3VEZA 1RGIA 2VG7A 3VOVA 2YCHA 4JEPA 4CK2A 2X74A 3SK3A 4R5PA 2HHHK 4ID5A 3FZKA 3TAMA 4BRFA 4CZLA 3ULEB 4IG0A 5M1NA 5HRNA 3LWMA 1SV5A 1KC8O 4WQ5A 2E2PA 1C0FA 2O8CA 5JS2A 3CCRN 5CY4A 4Z0UA 5CZ1A 2QXLA 5F2RA 3AVFA 3OYBA 3SQ4A 1J53A 4GMJB 1YJWN 3I56N 4O0JA 1NGDA 4BRDA 2VQEK 3MK6A 3CHWA 4JK8A 4BR5A 4MDAA 2A6AA 3FZMA 1C0TA 3NCIA 1X9JA 1XNRK 3HP9A 3SPZA 3CM5A 1WSGA 1Q81O 4JNEA 5KGWA 2WTUA 3QIPA 2V52B 1D5AA 3DAWA 1GLAG 2P9KB 4FJKA 3B6PA 3CJ1A 5F1XA 2ITMA 4KTWA 3WEEB 2I7NA 4FLXA 5ELZA 4FZYA 1CXUA 3TSQA 4F8RA 4JKCA 3WXKA 2NUBA 4X65K 1RILA 1SUQA 1T03A 2W6KA 4FOIA 2YNHA 4R79A 3TAEA 1JLCA 1QHTA 3OYLA 1GLCG 5KPTA 3FZFA 1RDBA 1JLFA 3DRSA 1RTHA 2DFEA 2NRWA 4NB4A 4IO8A 3VQ7A 5IT9O 3CCUN 2HB5A 4OVLA 2P9KA 4DMNA 3QEIA 5C2DA 3WXLA 3PX6A 1QSLA 4UY8O 1NK0A 4CEZA 3EKSA 4L3QA 2GELA 5EX5A 4MQ3A 3S3OA 4LSLA 4IDKA 1MA9B 4B8AB 4O44A 1RBUA 4GVMA 3OS1A 3I55N 3O9QA 1RT4A 3U9DA 1JCEA 2P9IB 1IKVA 1EETA 2CGLA 3V1QA 1BU6O 4YOXA 3ZSWA 3VQDA 4CEFA 5GINA 4O5BA 2EX3A 2UXBK 2QWLA 1XI1A 3A2FA 4LF9K 1ZBUA 4CJKA 3MN7A 1GOAA 4FO0A 4CW7B 3BP8A 5AFUH 4DU4A 3C94A 4JRPA 3KLGA 1IKYA 2Q2RA 1SKWA 4JI6K 3E9OA 4BGAA 2JWLA 4ISEA 1NGHA 1W9HA 4FWMA 1QSSA 2UXCK 3UKUB 2A1RA 1Q7YO 1NK4A 3AVCA 1OKJA 1J6ZA 3OJUA 3C95A 1RT6A 2GEMA 3HBTA 4DQQA 2HHTA 4OKJA 3DRPA 3EYZA 5CYQA 4CD3A 1QQMA 1RBVA 2V7ZA 1CZBA 1NMNA 3I8BA 4U7BA 4FK2A 5CZ2A 4RWTA 1UA1A 5DMRA 1KFSA 2QI2A 3HPOA 4DV0K 3C6HA 1EKEA 1A5WA 1JXEA 3VQAA 3F2KA 4BG9A 3U6FA 2X6NA 4BDZA 3RSEA 2XY5A 5AQRA 3ZETB 3RWUA 4DR3K 4CEAA 1YVNA 4EAHD 1ITGA 4WQ4A 2BDPA 2RPIA 1XMOK 4CZJA 3VEOA 1IBMK 2UU9K 3SPYA 3L2VA 4B9LA 1O13A 2B6AA 3HL8A 5KRSA 2QWRA 2OZSA 4IG3A 4ELUA 2E4LA 1V4SA 4OJRA 4E7IA 2HHQA 1NWKA 4F3TA 3ZSOA 4EHUA 3NH0A 2E8AA 3DXMB 3LM9A 3WQUA 1ASUA 1Q18A 3D2EA 4DF8A 4PKIA 4NO7A 3QLHA 3ZEUA 4A57A 4B3SK 3VESA 1XNQK 2PYJA 4E1MA 1EWQA 4BRCA 1QE1A 4IO9L 4FJ8A 4K41A 4DTNA 3PSIA 1DKGD 3DWLA 4E89A 4GV3A 4DQPA 2A3ZA 4CF1A 4IJNA 4HUEA 4JKHA 1W0HA 3THYA 3OA9A 2QM1A 4HVJA 3NH1A 3HYFA 1RNHA 1VRUA 5C0YA 4YFUA 2RKIA 4Z94A 2CH5A 1O1WA 3NF6A 1BOTO 1QZ5A 1JLQA 1SQKA 1TUUA 2PAVA 1T44A 2IOCA 4CK3A 2E2QA 1HQUA 1WSJA 1NK9A 3AVHA 4X62K 4RW7A 3KJVA 4CJ7A 3TSUA 3RMCA 3TANA 1BO5O 2Q31A 2YKNA 1VQ6N 3CYMA 4FW2A 4JN4A 2A5XA 4BRGA 1HYZA 5M1PA 4CJLA 4CBUA 4V19S 1C0GA 1ATRA 3LANA 4B9TA 3IAYA 3OYGA 1RDAA 1GOBA 1NOZA 1X1PA 2ZGZA 3GOIA 2Y1JA 3WXIA 3MN5A 2GBZA 3QINA 3I8DA 1K6YA 3WUHA 3BY5A 4KBOA 4N56A 4RCHA 3QBWA 3CCSN 1JLEA 2Y1IA 4KAZA 3ALYA 1H1VA 5BPLA 4I9LA 2FSNA 3SV3A 1J5EK 3K57A 3VEYA 4FK0A 3HPHA 4BVPA 4CGDA 5JLFA 3NHGA 4DTXA 1OH8A 4FLUA 5FROA 3PO5A 4H4MA 2UUBK 2KFNA 1K8KB 4CECA 5IWAK 3TTFA 2ZM6K 4NLCA 5LJVA 4Q5VA 4BRLA 4QCLA 3C6UA 2ZWHA 4KHYA 3BF3A 2ATQA 1EO1A 2YI1A 1KQSM 5DM7L 2XRIA 1EQYA 5I3UA 1OVQA 4WFNL 4NXNK 4CZKA 3AVBA 4KI6A 1S9EA 3IDHA 1HYVA 4IZ9A 1VHXA 4B1UB 3THWB 4CF0A 3RVCA 4JS5A 3AAQA 5C24A 2P9LB 1YF5L 2P9SB 5AQVA 4DS5A 4ZTFA 3H6EA 4PL7A 4H5WA 2VG5A 3JYTA 2GX9A 4Y1CA 4DTPA 1BIZA 2FF3B 3VPZA 4DLEA 4OLAA 4Y0WA 3THWA 1BISA 1WAJA 2DY4A 1W7AA 3MXIA 5E41A 3FLCO 3DLHA 1P8ZA 5AQIA 2IVNA 1KVCA 1WAFA 1YTAA 5BPNA 1NOYA 1LWFA 2QWPA 3DXKA 2ASOA 3L4IA 3IFRA 1BUPA 4FJNA 3VF6A 4FJ9A 1Y64A 4JI2K 2KKZA 4NYNA 4WF9L 3OS2A 3BZKA 3J81O 5FPEA 3HVTA 4A61A 5J2PA 3Q7BA 1B92A 4FSVA 4ELVA 3CM6A 3L4QA 1WBBA 4KRFA 2KFZA 2OCEA 5SZTA 2D0OA 2GWJA 2E88A 1MWMA 1HNZK 3C65A 2VQFK 3VERA 1ASVA 2CH6A 1S5JA 4HCBA 4QOZB 1KFDA 3ZSYA 4E7KA 3KTQA 1R0AA 2O4GA 1KAYA 3L6QA 3VQBA 4A5BA 5KTQA 3CI5A 1T8EA 1BI4B 2G8KA 1JLBA 1SAZA 2FBYA 4E3SA 5EOYA 3GBTA 4ISFA 1NGIA 3DOLA 3KKSA 5AQHA 4RW8A 1U2VA 2VG6A 3GL1A 2XO7A 2QWNA 4MO4A 3TAQA 3J80O 3MWPA 4CHPA 3PV8A 2KLAA 1RDCA 4LF5K 4CHOA 3K5NA 5DM6L 1NGJA 1S9GA 3K9JA 4CEDA 2Z1GA 3FZHA 1TYQB 4CZFA 3ID6A 3CETA 3RMAA 1VQMN 2IVPA 4XH5A 4LY7A 1JCFA 3CCLN 4C8NA 1OH5A 5DK5A 4H5VA 2YJFA 5TKYA 4WFAL 1TK0A 3AA2A 2OPRA 1GLEG 4H0OA 4DG1A 1RT3A 5AZJA 3WNFA 2G8UA 1BQNA 1HNIA 4Q0BA 4BQLA 1L3UA 5HRPA 4BDYA 3NE6A 1T3VA 1C6VA 3O80A 2R7YA 3CQXA 1NGGA 4JI4K 5CHIA 4ILJA 3VEVA 1SKSA 1NGFA 3DYAA 1NKBA 5AR0A 1VSEA 3LL3A 4H0TB 2HBJA 2GUPA 5JLHA 4JI5K 5A2QO 3UKRB 3F73A 4DTUA 2FC0A 1VQNN 1S72N 3CCEN 3EY1A 4CJFA 3AVGA 1D9FA 1YVUA 4DR7K 4BWJA 1YXQA 1CLQA 5HBMA 2HMIA 1IH7A 4K42A 1Q8IA 2VGMA 4XIUA 1N34K 3WQTA 1KAXA 3NBPA 1X9WA 2P5GA 5C12A 1Q86O 2NLXA 3QNOA 2P1JA 1VAZA 4GW6A 3MEEA 2O8DA 5GADP 2XHBA 2Q36A 2HNDA 2DFFA 4KH5A 4DSEA 4I9QA 4M41A 1ZBLA 3S3MA 4OGEA 1RDUA 2X6SA 3IKMA 3PSFA 5C25A 4CJVA 4DFMA 3THVA 3CQYA 5AZIB 4B9SA 5D3GA 3OS0A 4H03B 4KTZA 4LF6K 2VWBA 3T7ZA 3SLCA 1ESVA 4B9VA 1HNWK 1NK8A 4DUYK 3TR8A 3LPTA 3UIQA 1WSIA 1SS6A 1NK6A 4J2AA 3HZ6A 2O8BB 3EO3A 4DTJA 4BRKA 3H08A 1I3AA 3E1YA 1UWBA 1JXBA 3T1AA 4H5NA 3M3ZA 2J4RA 3KHYA 2O8FB 5AQSA 4JV5K 4CJ3A 5CE3A 3SAHA 4I2PA 1IG8A 3OBYA 3HRGA 4K0KK 4GV6A 4G1QA 3ENOA 3J7AP 4JD2B 3K5OA 1NM1A 4JAXA 4CEBA 4CJWA 4I6MB 4QAGA 4JHDA 5GIPA 3L0QA 2YJEA 2PYLA 3AY9A 3S3NA 3MXJA 4DV7K 2HBLA 4FLVA 1VQKN 4PQUA 2OPQA 2Z1HA 4DKWA 3T19A 1N36K 2FBTA 5M1KA 3CCQN 3OYMA 1U45A 1TKZA 1QSYA 1C1BA 3VN5A 3NH2A 4Z4FA 2QWOA 1U04A 4KH4A 4FJLA 4EP5A 3O1WA 4BG8A 4JK9A 4YOTA 5GAGP 4NCBA 4M3WA 1HNVA 4B08A 1X9MA 5BRFA 1Z26A 3ZT2A 4FVUA 1D8YA 3ULEA 4JYAK 1JL2A 1V4TA 4BR7A 1WNSA 4FJMA 3CJBA 2OANA 1JL1A 4M3TA 1HNXK 4BC4A 4M7XA 4BWMA 1NKEA 4TSXA 4Z4CA 3BGRA 1LW2A 4JKGB 2YHWA 4IFYA 4N5SA 3QNNA 4AHVA 4B3MK 4FM1A 4G9ZA 1QVGM 4BRAA 3QEWA 5J2MA 3J7YP 4FLZA 1U49A 3ZT1A 1NGAA 4DSKA 4DLGA 3SQ2A 4FWLA 3ATVA 3B8AX 3SCXA 4AHTA 4X64K 3OVNA 3W3DA 5E26A 2OTJN 2YKMA 3WEEA 1ATSA 5HRSA 5JVHL 3EEQA 2HW3A 3NVMA 4HHTA 2HVHA 1KLMA 2RF2A 3VEXA 1VSKA 1FKPA 3OYJA 4JKDA 1NJIO 3MDQA 5M1FA 3DLKA 3AA4A 2VGNA 5FPMA 4KB1A 1IBLK 4IFVA 4JKBA 4NCAA 4IFEA 2OA8A 1HLUA 1FJGK 3BF1A 3O9TA 2P9PB 4RW6A 5KPRA 5C42A 4O8UA 1NJZA 4YDUC 1NMDA 1VSMA 5FLXO 1ILYA 5T7BA 4CHZA 3O1BA 2P9IA 4BY9C 4JS4A 3A0IX 1HR0K 4AF1A 1TKXA 3IRXA 4RG8A 1WOQA 1N33K 2IVOA 4EIAA 4N47A 4FWNA 3RR8A 1Z25A 1SL1A 5AFUA 3Q7CA 4DQ8A 3KD1E 3M5RA 1JCGA 2ZJQL 1K73O 3LDLA 3I0SA 2E1YA 1WSFA 4DS4A 4JKFA 4MFBA 2F9WA 4JI7K 4AQYK 3C7NB 4IEIA 3G10A 3TTDA 4KFBA 3GDQA 4IOAL 4CGIA 2I5JA 4X66K 2Q3SA 4C8KA 5CR4A 3UKUA 3LDQA 2F8SA 3ENBA 3QERA 4PWDA 3PX0A 2A41A 1Y97A 5AQOA 4WCEL 2NRRA 1QS4A 3U3YA 3GG4A 3ENHA 3QESA 5AQQA 1RT5A 4KHWA 3B6OA 3R8EA 2P9UB 2F4VK 4U67L 1S3XA 4KPYA 4CZMA 4FLYA 4OPKA 3CPWM 4Z4HA 3F5TA 5KPZA 3FGUA 3ZETA 1XHXA 3HK2A 4CK1A 4DV4K 2RE2A 3R6MA 1S6QA 3O9SA 5EVZA 4DQIA 4DHYA 1IBKK 1ZBIA 1WN7A 3NMUA 2P9NB 3O4QA 3L2UA 1D9DA 2P9UA 3AO4A 4F3OA 1TL3A 3TTCA 3ZYYX 3L2RA 1Z05A 2QA4N 3MEGA 2HNZA 4FPBA 2LSNA 4BR2A 3LP3A 3QMLA 4C1NI 4CD1A 3H3OB 3T1HK 4ELTA 3DXMA 4H0XB 4FWPA 3VTIA 5GIOA 3NGYA 5EY4A 4HTUA 2AJQA 2I7PA 1D4XA 4KTQA 2HMPA 1LAWA 3AVMA 4N76A 2QK9A 1VSDA 3OBWA 4H4OA 4JK7A 3TPQA 3RR7A 4O55A 3H45C 1VQ7N 3BEXA 3HO1A 4B3RK 5M1QA 5KRTA 4K25A 3RMDA 3C6TA 2O8EB 1LW0A 2Q0RA 1FXXA 3SNNA 3R9PA 4QS9A 1VQ8N 5C10A 3KZBA 1Q82O 2PBDA 4DTMA 3FFKB 4LFCK 2V51B 1RTJA 3WNGA 1BGXT 1WSHA 3F9KA 4KO0A 2OTLN 1IG9A 2BE2A 4BRHA 3TAFA 4WYBA 4CEEA 4W5OA 4BGBA 4BR4A 4Y1DA 4LFAK 5BR9A 3K0SA 1X3MA 2KQ2A 2W40A 3IUCA 3BUZB 3CXCM 3EN9A 4C8OA 4CFAA 3OJSA 3DOKA 3QEVA 1C1CA 2NRXA 3G71N 3V9ZA 1YJ9N 4B1WB 3M6GA 3QB0A 2F96A 4FJIA 5I9EB 1JLAA 4BC3A 1ATNA 3KLIA 2HHUA 3L2WA 2Q0UA 3EZWA 4C1NK 2ZQBA 3OY9A 4IBNA 3NF9A 1WLJA 4CERA 2GV9A 4CVNE 4JKAA 4EZ9A 4Z4EA 3CC4N 1KAZA 1TUYA 5LL6Z 1DTTA 3W0LA 3CPEA 1BCMA 1NGCA 4A5AA 5LMNK 4O5FA 3T1YK 4KB0A 3VGLA 5C15A 4J2BA 1HKBA 3EE9A 3JSMA 2AP1A 1W2BM 4DFKA 4DUZK 3QIOA 4CEOA 5ADXH 5B8HA 1YI2N 3TWHA 1S1VA 4CJUA 3VQEA 1IV0A 1K8KA 4WE1A 3JS6A 3H3NO 3G25A 4PL8A 1QQCA 4M3RA 3P31A 5J2QA 3HVRA 1OH7A 3KD5E 4CHYA 5AQKA 4BRPA 2YHXA 1MU2A 1C1AA 5TKWA 4IOCL 1CZ9A 5AQYA 4M3ZA 3D6RA 4WQ5C 3CQ8A 3FFIA 1EWRA 5HP1A 1YT3A 4DTOA 3KLHA 4BC2A 4ILGB 2G8HA 1A5VA 2P9LA 4DF4A 2P9SA 4BRIA 5J2NA 3AO3A 1RFQA 3AVNA 3MECA 1QQNA 3O08A 3HPGA 1HKCA 3E9PA 1A5XA 5FDLA 2D0AA 3CCVN 4CF8A 3LZIA 4FWQA 4A59A 1L5UA 2E20A 2IC3A 2V7YA 2QTDA 3SJJA 4OX9K 3SUNA 1HUXA 1VSLA 3SJHA 4YOWA 3AVLA 4H0YB 3CCMN 2HSTA 3MCPA 3QFPA 2IAJA 3A5NC 4M3XA 4A62A 2IGIA 4LH5A 4EZ6A 5MLCQ 4DR6K 3KKRA 4CFBA 4NLBA 1X3NA 2CGJA 3VF2A 4YOYA 4AHUA 3D2FB 3WXMB 3KWIA 4AHSA 1HRHA 3WNHA 2FF6A 3SYZA 4J2DA 1K8AO 3LPUA 1VQLN 2BUPA 4CZGA 4FJ7A 4E7JA 3THXB 5JVGL 2ZD1A 2VYPA 1NKCA 4LF4K 5I42A 3TAGA 4HWIA 1BI4A 4DB3A 5BR8K 1NG9A 2A40A 2D0BA 4FJHA 1GLFO 1VK0A 2BGGA 3AGKA 2ZJPL 3ZT3A 3AO1A 2D0CA 4BRMA 4KREA 3KIOA 3ITHA 3MAQA 2HHWA 4GY2B 5BN8A 3VQQA 4KHSA 1ZXOA 2HHSA 4H5TA 2VCPA 2OPPA 3SBTA 4BRQA 1Q9YA 3OYIA 3NF8A 3CMEN 4CHQA 1TYQA 4HTLA 2HF3A 3VA0A 4Z4IA 3ZX2A 1XHZA 1S1UA 1NBWA 2W6LA 3T69A 4H8KA 1Z6RA 3AVIA 4AH9A 3VF4A 3NGZA 3LDSA 2G8VA 3P39A 3AVAA 1REVA 4CEQA 1E3MA 5F0XA 1DT9A 3OYFA 3O9RA 2NRVA 3VEWA 4M42A 3A5LC 3E01A 4YORA 1VQ9N 3H1QA 1KRPA 3M1FA 3SUPA 3LP0A 4IKFA 3ULDA 1KSPA 5BREA 1NGEA 4MDBA 3OYCA 1BWFO 4WQ4C 3VTHA 4FOEA 4C23A 4NXMK 1FW6A 2PZSA 1OVYA 1N32K 4JKEA 1LV5A 3MX5A 1N8RO 3TABA 1ZC6A 2B5JA 3UKRA 2ZJRL 2G8FA 3AVJA 3LP2A 5AQLA 1KTQA 2E2OA 1BDGA 1BIUA 1CXQA 4EP4A 4LFBK 4AHCA 1C0MA 3CD6N 3HTVA 2E5LK 3CJCA 2KHOA 4DSJA 3E9LA 2BH1A 1KVAA 1HJRA 5HRRA 4CGFA 1HYSA 3SMPA 3PY8A 5AQTA 1W97L 4KI4A 1B9FA 4O4GA 1DEJA 2IDOA 3CC7N 3O8MA 5FPDA 1ZYQA 2RHKA 4C8MA 3D7EO 1SKRA 4FYDA 4FJGA 2Z1IA 4QS8A 4IDHA 4BREA 2A42A 3MXMA 2HNYA 3MWTA 4LH4A 3ZSZA 5EXWA 3O3GA 4Z4GA 3AAPA 1LCUA 2HBMA 1ZBSA 4WFBL 1SZ2A 3M8RA 5AZIA 2NRHA 4E1NA 3V9SA 4BDPA 4XH4A 5GAHP 3L3UA 2VWJA 3WNEA 4OKEA 4M7YA 2E2NA 5HOOA 4ILHA 4E7LA 1E4GT 4DCHA 1U6ZA 2O8BA 3C6AA 3OYKA 5K14A 3HJFA 4PHTX 4IWVA 3S9HA 2EWSA 2WC9A 2NZTA 3VGMA 1VRTA 2PY5A 2KZZA 3SMSA 1FK9A 2O8FA 1VSFA 2UYTA 5JICA 4DFPA 5LMUK 4JRQA 1TGOA 4PA1A 3ZCMA 4DR5K 2O8CB 2E1ZA 3TU5A 3VQ6A 3K58A 5AQWA 4DWIA 4JD2A 3ZSRA 2BANA 3HSCA 4DV3K 1BQMA 2XY6A 4CJTA 4J8FA 3J7ZO 1KD1O 4I6MA 1DGKN 4FLTA 3AO5A 2X78A 3PLAA 1TK5A 1NK5A 2GTDA 1ASWA 2O4IA 4MLHA 1Q9XA 4B1YB 4AILC 2OZMA 3KK7A 3CFRA 1HX1A 2B4JA 4CZIA 3UB5A 1KLNA 2NNWA 1SL2A 4ZTJA 4JI3K 3H1VX 4I7FA 4K43A 3PO4A 4H0VB 4JLHA 3SAFA 4FZXC 4CJ4A 1VQPN 4GNIA 4YOVA 4CJQA 4O8KA 4CFCA 3OYHA 2ZGYA 4H0PA 3G4SN 2ETJA 4F9OA 4DTSA 3VENA 3KK3A 3WXJA 2FXUA 3L2QA 4DQRA 4B9QA 4CZHA 2YNIA 1N6QA 1BA0A 2QW9A 4JKGA 3F9MA 4CESA 3OYDA 4FVMA 3IS9A 2G8IA 4HCCA 1NLVA 3HM8A 1YITN 1HPMA 3P1GA 3R3LA 4H5RA 2HF4A 4BE0A 4BE1A 2YX6A 1KCFA 1XC9A 1RBRA 2DPNA 3QO9A 3V4IA 3ZT0A 4JI8K 1T7PA 4FL9A 4FWOA 3K59A 3CCJN 4PUOA 2FSKA 3QICA 2G8WA 3ZT4A 1M1KO 4CIGA 1LOTB 2GUIA 3WT0A 1FKOA 4AM6A 3OYEA 1HPZA 4KH6A 4EHTA 3A8YA 3CFOA 4PY5A 1HJOA 4BACA 5AQMA 4CJEA 1YHQN 3OYAA 3N4QA 1HQEA 4CGGA 4W5TA 1P90A 5KQ8A 5JS1A 3HM9A 1L3TA 1RTDA 3ZLJA 3K5LA 4FWSA 4FJ5A 2P9PA 3VQ8A 2QXFA 1F21A 2H3GX 2WONA 5KI6A 4F2SA 3KK2A 1RBSA 2EHGA 4GVEA 4PKGA 4DR4K 2D4WA 2YHYA 3NF7A 3CG7A 1U48A 2IIRA 3O9UA 4B1VA 2DTUA 2Z1JA 2JLEA 1DLOA 3L8BA 3C0BA 4FWRA 2KZMA 2YNFA 4DV2K 2KW4A 3SZ2A 3AV9A 5E84A 3RSEB 1S1XA 5CYMA 3IG1A 3O5BA 4BR0A 1N5YA 2ASMA 4IEEA 4RW4A 3VQ9A 3ZSQA 2OYQA 4W5QA 1TK8A 2JWKA 3MCAB 3MEDA 3C7NA 1BCOA 5AQJA 4M3UA 4CI6A 3V1RA 3G6EN 3FR0A 4FJXA 1RBTA 4QS7A 1J54A 4DV6K 4BE2A 1S1TA 3GE1A 3D45A 1QZ6A 1J5OA 4B3TK 1L3SA 3I0RA 3U8XA 5KQDA 1S6PA 3D2EB 4YNQA 5AQZA 4OO1J 3BZCA 3ZEUB 1G15A 3O3HA 2FLOA 4CGHA 4FPAA 3LP1A 3TAPA 3R1XA 4BRNA 3UE5A 1CZAN 4MLEA 3CFPA 5BN9A 4DR1K 1EP4A 2PFUA 2HHVA 4CJPA 2GWKA 2YHAA 1JKHA 3THYB 3TSPA 1C0UA 3QDKA 4CZEA 3CC2N 1VSIA 1GOCA 1NJXA 2KTQA 5LY3A 3CMAN 4CIFA 1RT7A 3HT3A 2IS3A 2JGUA 3DLBA 3NGIA 3CF5L 4AM7A 3P5JA 2P9NA 4B1XB 4UQGA 3RRHA 5KGXA 4LSNA 4CBXA 1JLGA 3O4NA 4KKOA 1XQSC 3EKUA 5BRDA 4L8RB 3H46O 3RRGA 2QKKA 1LWEA 4DU1A 5FRNA 5AQFA 1YAGA 5AQGA 3LAKA 1NJYA 1I94K 4O0IA 2ZE2A 3J8AA 3P38A 1J9AA 4F4KA 3KVGA 4GKKK 1YUWA 4DV1K 4KV8A 4ICLA 4AHRA 4FZZA 3EL2A 5AQNA 2FBXA 3FZLA 5M1OA 1VQ5N 4IXCA 4FJJA 3O6WA 1YJNN 3CERA 1NU0A 3MN6A 3OTOK 3V81A 4B3OA 2O8EA 1TAUA 4DSLA 4BR9A 2QWQA 3TARA 1QHAA 4ISGA 1WBDA 1GLBG 4FM0A 1VQON 1RCHA 2AA4A 1L3VA 3ZX0A 2QKBA 1UAXA 4W5NA 4MO5A 3V1OA 2WFBA 2Q1NA 2WBNA 2ITGA 2VWKA 2ASPA 3HP6A 3PUFA 4GKJK 3S41A 4DSIA 3M8SA 4ZHRA 3HI0A 4KHNA 3EZ5A 4DSFA 1VSJA 2NRZA 4CF9A 4CHNA 3KK1A 3T3FA 4CE9A 3VA3A 1S1WA 2DFHA 2W41A 4KHPK 3LALA 4RTFD 2RN2A 1RDDA 3IMXA 3DLGA 3M8QA 4B1ZA 4OLBA 2WOMA 1TKTA 1WB9A 4M63C 4B9UA 1U4BA 5ADXA 1XC3A 3QBXA 3HOSA 2XY7A 3HOTA 2Q97A 3SUOA 4B9NA 1IKWA 1UOCA 1U47A 3DLLL 4IJAA 3LWLA 3K2PA 3DJCA 1TVRA 4J2EA 4BQZA 4FWKA 1DTQA 4BVOA 4KHQA 4NYFA 3VQ4A 3QEXA 3DM2A 2QWMA 1MDUB 3VGKA 1VSHA 4CJ5A 3DXKB 4XH1A 3JAMO 3V9UA 3V6DA 3FE1A 1XWLA 1EXQA 4C8LA 4E0DA 1GLLO 4CFDA 2YNGA 3OHRA 1K9MO 1KVBA 3V9WA 3SQ1A 4YDUA 4CF2A 2XY8A 1HMVA 1XUPO 1TKDA 4EFHA 4FCYA 1TAQA 1GLDG 2OPSA 3SAGA 3A5OC 4DQSA 4B9MA 4W5RA 4CJRA 3MX2A 4GV9A 3U3GA 4JI0K 5JMVA 3SBGA 4F2RA 4YOUA 1RT2A 1NJWA 3LM2A 3AO2A 2E6MA 2F8TA 4OPAA 4OKKA 3VQPA 4KHUA 1U2VB 4BROA 3OW2M 4FXDA 1LAVA 1BG3A 3PIOL 1E4FT 3NVKA 3SQ0A 1M90O 1GLJO 3G0ZA 4E19A 1QTMA 3I33A 2UXDK 3AA3A 1NK7A 1BL3A 3D0PA 4HUFA 1HKGA 3P83D 2WUSA 4OGCA 3TI0A 1QQOA 3D2FA 4CCHA 4DV5K 4I2QA 3V9XA 3A5MC 3L3VA 3U4LA 3LAMA 5BRHA 2NRTA 3KWGA 2HVIA 3U9ZA 3VETA 1WSEA 3O3FA 2P5OA 4M3YA 4IOXA 4CIEA 5SWMA 1NGBA 3THXA 1KXPA 5AZJB 2E6LA 3MMVA 1MWKA 2BTFA 3VMFB 2A1SA 1G99A 3AARA 5AJ3K 3BDPA 3DI6A 4FM2A 1BHLA 3CJ7A 2FSJA 3MN9A 1T6DA
chains in the Genus database with same CATH topology
4QCLA 3NDKA 4HUGA 1TK5A 3C6UA 3DLEA 1NK5A 2O4IA 1ASWA 4KHYA 3ZSXA 2ATQA 3QESA 1Q9XA 1RT5A 4DU3A 3B6OA 4AILC 2OZMA 4KHWA 2XRIA 3DMJA 4M45A 3CFRA 1YTUA 5I3UA 2B4JA 1KLNA 3K5MA 1SL2A 4DTRA 4ZTJA 4KPYA 4FLYA 4I7FA 1T05A 4OPKA 3AVBA 3PO4A 4Z4HA 4JLHA 2D5RA 4FZXC 4CJ4A 4KI6A 1S9EA 4CJQA 1HYVA 3QETA 4CFCA 1XHXA 3HK2A 4CK1A 3VQ5A 4CF0A 4K8XA 1S6QA 4JS5A 5C24A 4ID1A 3OYHA 1RT1A 4NCGA 4DQIA 4DS5A 4ZTFA 5EU7A 2FBVA 1ZBIA 1WN7A 2ETJA 1UA0A 4DTSA 3O4QA 3L2UA 1D9DA 3KK3A 3LZJA 2VG5A 3AO4A 3SV4A 4F3OA 3JYTA 3L2QA 1TL3A 1SL0A 4DQRA 4Y1CA 3L2RA 4DTPA 2YNIA 4CJSA 3MEGA 1N6QA 1BIZA 4OPJA 4RW9A 4DFJA 2HNZA 2LSNA 4CESA 1I39A 3LP3A 3OYDA 4DLEA 4OLAA 4FVMA 3IS9A 1BISA 2G8IA 4ELTA 3NAEA 4HCCA 1ZBFA 2AJQA 1WAJA 3NGYA 4HTUA 2DY4A 3MXIA 3ZSVA 5E41A 3DLHA 4KTQA 3P1GA 4BE0A 1LAWA 1KVCA 1LWCA 1WAFA 1YTAA 3AVMA 4BE1A 1NOYA 1LWFA 3OYNA 4N76A 2QK9A 1KCFA 1XC9A 1RBRA 1VSDA 3QO9A 3V4IA 4FJNA 3ZT0A 4H4OA 1T7PA 3M8PA 4FJ9A 3RR7A 3K59A 1TV6A 4NYNA 4O55A 3OS2A 3DRRA 1TL1A 3NFAA 3HVTA 2G8WA 4PUOA 5HROA 3HO1A 5J2PA 3ZT4A 5KRTA 4N41A 4CIGA 1B92A 2GUIA 1ZBHA 1FKOA 3RMDA 3C6TA 3OYEA 1HPZA 4ELVA 3CM6A 1LW0A 3RMBA 1FXXA 3SNNA 4KRFA 2KFZA 1EX4A 1IKXA 5SZTA 3KLEA 4B8CA 3ISNC 4LD0A 1ASVA 3CFOA 4PY5A 2HHXA 1S5JA 4BACA 4FLWA 4HCBA 4QOZB 4DTMA 1KFDA 3ZSYA 4E7KA 4CJEA 1RTJA 3KTQA 3OYAA 4K8ZA 3WNGA 1BGXT 1WSHA 3F9KA 1HQEA 4KO0A 2O4GA 4CGGA 4W5TA 3HSTB 3QEPA 3ASMA 5JS1A 3HM9A 5J1EA 1R0AA 3VQBA 3HXMA 5KTQA 1L3TA 1IG9A 1RTDA 2BE2A 1T8EA 3TAFA 1X9SA 1BI4B 3AA5X 3K5LA 2G8KA 4CEEA 1IO2A 4W5OA 1JLBA 3DLRA 5HLFA 4FJ5A 2FBYA 2QXFA 1F21A 2WONA 4Y1DA 5KI6A 2P51A 3VQ8A 4E3SA 4F2SA 3KK2A 1RTIA 1RBSA 2EHGA 2KQ2A 3DOLA 3KKSA 3VQCA 4RW8A 2VG6A 3KLFA 3TAQA 2XO7A 4C8OA 4CFAA 3NF7A 4CHPA 3CG7A 3OJSA 1U48A 3DOKA 3QEVA 3PV8A 1C1CA 2DTUA 5FRMA 4FW1A 1RDCA 3AVKA 3V9ZA 4CHOA 2Z1JA 2JLEA 1DLOA 1B9DA 4CGJA 2F96A 3K5NA 3L8BA 2YV0X 3RTVA 4E7HA 1JLAA 3PX4A 4FJIA 3KLIA 2HHUA 2KZMA 3L2WA 1S9GA 2YHBA 2YNFA 2KW4A 3SZ2A 2ZQBA 3AV9A 4IBNA 3OY9A 2W42A 3NF9A 4CEDA 4FK4A 1S1XA 2Z1GA 1WLJA 5CYMA 4CERA 3SI6A 3IG1A 3SUQA 2GV9A 2VG7A 4EZ9A 4CK2A 3RMAA 2X74A 1N5YA 4Z4EA 4R5PA 4RW4A 3VQ9A 3ZSQA 4ID5A 1DTTA 4LY7A 1BCMA 2OYQA 3TAMA 4W5QA 1TK8A 4IG0A 4C8NA 4KB0A 3MEDA 5HRNA 3LWMA 1SV5A 4J2BA 5DK5A 3JSMA 1BCOA 5JS2A 1TK0A 4M3UA 3AA2A 4DFKA 2OPRA 4DG1A 1RT3A 3V1RA 5CY4A 3QIOA 4Z0UA 3WNFA 4CEOA 2G8UA 5CZ1A 1BQNA 1HNIA 3AVFA 3OYBA 4Q0BA 4FJXA 3TWHA 1RBTA 3SQ4A 1J53A 1J54A 1S1VA 4GMJB 4CJUA 3VQEA 5HRPA 4BE2A 1L3UA 4O0JA 1S1TA 4BDYA 3NE6A 1C6VA 3D45A 2R7YA 1J5OA 4WE1A 1SKSA 1Q9YA 3DYAA 1L3SA 3I0RA 1S6PA 1QQCA 4M3RA 4YNQA 1C0TA 3NCIA 1NKBA 5J2QA 3HP9A 1VSEA 3SPZA 3CM5A 3HVRA 1WSGA 1G15A 5KGWA 3KD5E 3QIPA 4CHYA 3O3HA 4CGHA 1D5AA 1MU2A 3LP1A 1C1AA 3TAPA 3B6PA 4FJKA 4KTWA 1CZ9A 4FLXA 4FZYA 4M3ZA 3CFPA 1CXUA 3CQ8A 1EP4A 3FFIA 2HHVA 4CJPA 4F8RA 2NUBA 3F73A 5HP1A 4DTUA 1RILA 2FC0A 2YHAA 1SUQA 1JKHA 1YT3A 1T03A 1C0UA 2YNHA 1VSIA 1GOCA 3TAEA 1JLCA 1QHTA 3AVGA 4CJFA 3EY1A 4DTOA 1NJXA 1YVUA 1D9FA 3KLHA 2KTQA 4BWJA 4CIFA 3OYLA 2G8HA 1CLQA 1A5VA 1RT7A 3HT3A 4DF4A 5HBMA 2IS3A 2JGUA 5J2NA 1RDBA 3AO3A 1JLFA 1IH7A 3DRSA 3AVNA 3NGIA 2HMIA 3DLBA 1Q8IA 1RTHA 3P5JA 2DFEA 3MECA 4XIUA 4UQGA 3RRHA 3VQ7A 5KGXA 3HPGA 2HB5A 4OVLA 4DMNA 3NBPA 3QEIA 1X9WA 1A5XA 4LSNA 5FDLA 3PX6A 2P5GA 1JLGA 2D0AA 1QSLA 1NK0A 4CEZA 3O4NA 4KKOA 4CF8A 3LZIA 3QNOA 2P1JA 4GW6A 3MEEA 4L8RB 2XHBA 1L5UA 2IC3A 4MQ3A 3RRGA 3S3OA 1LWEA 4LSLA 4DU1A 2HNDA 2DFFA 4DSEA 2QKKA 3SJJA 4I9QA 4M41A 3SUNA 4IDKA 3S3MA 1ZBLA 5FRNA 4OGEA 1VSLA 4B8AB 4O44A 3LAKA 3AVLA 1RBUA 2X6SA 4GVMA 5C25A 4CJVA 3OS1A 1NJYA 4O0IA 4DFMA 1RT4A 2IAJA 2ZE2A 3THVA 4M3XA 1J9AA 4B9SA 5D3GA 3OS0A 4KTZA 4F4KA 2IGIA 1IKVA 4LH5A 4EZ6A 1EETA 3V1QA 4B9VA 1NK8A 4KV8A 4ICLA 3ZSWA 4AHRA 3VQDA 4FZZA 4CEFA 3KKRA 3LPTA 3TR8A 4CFBA 2FBXA 3UIQA 4FJJA 4O5BA 2EX3A 1WSIA 4AHUA 1NK6A 4J2AA 3V81A 1XI1A 4DTJA 4B3OA 3H08A 1I3AA 3A2FA 1HRHA 4AHSA 1UWBA 1JXBA 1ZBUA 3WNHA 4CJKA 3T1AA 4DSLA 3TARA 3SYZA 1GOAA 4J2DA 4FM0A 3LPUA 3C94A 4CJ3A 4JRPA 4DU4A 1RCHA 1IKYA 4I2PA 3KLGA 1SKWA 1L3VA 4FJ7A 2QKBA 4E7JA 4G1QA 1UAXA 2ZD1A 4W5NA 3V1OA 1W9HA 1QSSA 3K5OA 1NKCA 2A1RA 5I42A 3TAGA 2ITGA 1NK4A 1BI4A 4CEBA 2VWKA 3AVCA 3OJUA 4CJWA 3C95A 3HP6A 3PUFA 1RT6A 4DQQA 2HHTA 4QAGA 4OKJA 2D0BA 3DRPA 4DSIA 4FJHA 3EYZA 5CYQA 3M8SA 2PYLA 4ZHRA 1VK0A 2BGGA 3S3NA 4KHNA 1RBVA 3ZT3A 3EZ5A 3AO1A 2D0CA 1CZBA 4DSFA 3MXJA 4PQUA 4FLVA 1TAUA 1VSJA 2OPQA 4CF9A 4FK2A 4KREA 3KIOA 3ITHA 2Z1HA 5CZ2A 3T19A 3MAQA 1UA1A 2HHWA 2FBTA 4CHNA 3KK1A 5DMRA 3T3FA 1KFSA 3VQQA 3HPOA 4KHSA 2HHSA 4CE9A 3OYMA 1EKEA 2OPPA 3VA3A 1S1WA 1A5WA 1JXEA 1TKZA 1C1BA 2DFHA 3VQAA 3VN5A 3OYIA 1U45A 3NH2A 1QSYA 4Z4FA 3U6FA 2X6NA 3NF8A 3LALA 4BDZA 2XY5A 1U04A 4FJLA 4EP5A 4CHQA 3RWUA 4CEAA 3VA0A 4Z4IA 2RN2A 1ITGA 2BDPA 2RPIA 1RDDA 4NCBA 1XHZA 4M3WA 1S1UA 1HNVA 3DLGA 4B08A 1X9MA 4H8KA 3M8QA 3AVIA 3SPYA 1Z26A 3ZT2A 4AH9A 3L2VA 4B9LA 4OLBA 2WOMA 1D8YA 1TKTA 2B6AA 3HL8A 5KRSA 3NGZA 3LDSA 1U4BA 1JL2A 4B9UA 2OZSA 4IG3A 4ELUA 1WNSA 2G8VA 2XY7A 4FJMA 2E4LA 3AVAA 1JL1A 4M3TA 1REVA 4CEQA 4OJRA 4BWMA 3SUOA 1NKEA 4TSXA 4Z4CA 4B9NA 1IKWA 1UOCA 3BGRA 1U47A 3OYFA 1LW2A 4M42A 3E01A 4E7IA 2HHQA 3LWLA 3K2PA 4IFYA 1KRPA 4F3TA 1TVRA 4J2EA 3ZSOA 3SUPA 4N5SA 3QNNA 4AHVA 3NH0A 1DTQA 3LP0A 4FM1A 4IKFA 3ULDA 4KHQA 3QEWA 5J2MA 1KSPA 4NYFA 3VQ4A 4FLZA 1ASUA 1U49A 3OYCA 3ZT1A 3DM2A 3QEXA 4DSKA 4DLGA 4DF8A 3QLHA 3SQ2A 1VSHA 4CJ5A 3SCXA 4AHTA 3V9UA 3V6DA 3OVNA 1XWLA 2PZSA 2PYJA 4E1MA 1QE1A 1LV5A 4FJ8A 2YKMA 1EXQA 4C8LA 4DTNA 4E0DA 3TABA 4CFDA 2YNGA 4E89A 1KVBA 5HRSA 4DQPA 3V9WA 4CF1A 2B5JA 4CF2A 3SQ1A 4HUEA 1W0HA 2XY8A 3AVJA 3LP2A 2G8FA 1HMVA 1TKDA 2HW3A 1KTQA 4FCYA 1TAQA 2OPSA 4HHTA 4HVJA 1BIUA 1CXQA 2HVHA 4EP4A 4DQSA 3NH1A 4B9MA 1KLMA 2RF2A 3HYFA 4AHCA 1C0MA 4W5RA 1VSKA 1FKPA 1RNHA 4CJRA 3OYJA 1VRUA 4DSJA 1KVAA 4YFUA 1HJRA 5HRRA 3U3GA 2RKIA 4CGFA 4F2RA 3DLKA 1O1WA 3NF6A 3AA4A 1HYSA 1JLQA 3PY8A 4KB1A 4IFVA 4NCAA 1RT2A 1B9FA 4O4GA 4KI4A 2IDOA 1NJWA 2OA8A 2IOCA 3AO2A 4CK3A 2E6MA 1ZYQA 4RW6A 1HQUA 1WSJA 1NK9A 3AVHA 4C8MA 1SKRA 4RW7A 5C42A 2F8TA 4FYDA 4FJGA 3KJVA 2Z1IA 4OKKA 3VQPA 3RMCA 4KHUA 4FXDA 1LAVA 3TANA 3MXMA 2HNYA 1NJZA 4LH4A 2YKNA 3ZSZA 1VSMA 5T7BA 3CYMA 4CHZA 3O3GA 3SQ0A 4Z4GA 4FW2A 3G0ZA 4E19A 3M8RA 1QTMA 4E1NA 3V9SA 4BDPA 1HYZA 4CJLA 4JS4A 3AA3A 3L3UA 2VWJA 3WNEA 1TKXA 1NK7A 1BL3A 3IRXA 3LANA 4OKEA 4RG8A 3D0PA 4B9TA 3IAYA 4HUFA 3OYGA 3P83D 1RDAA 4N47A 1GOBA 1NOZA 4E7LA 1X1PA 4OGCA 3TI0A 3RR8A 2Y1JA 1Z25A 4CCHA 1SL1A 4I2QA 3V9XA 2GBZA 3OYKA 5K14A 3KD1E 3L3VA 3QINA 3I8DA 3HJFA 1K6YA 3LAMA 3S9HA 4N56A 2Y1IA 1VRTA 1JLEA 2PY5A 3O3FA 1WSEA 3ALYA 2P5OA 1FK9A 4KAZA 3I0SA 2KZZA 4M3YA 3SV3A 4I9LA 1VSFA 4CIEA 1WSFA 2HVIA 5SWMA 3K57A 4MFBA 4DS4A 4DFPA 4JRQA 1TGOA 3G10A 4PA1A 3ZCMA 4FK0A 3HPHA 4KFBA 3VQ6A 3K58A 4CGIA 4DWIA 2E6LA 2I5JA 4CGDA 3ZSRA 2Q3SA 3NHGA 2BANA 4C8KA 4DTXA 4FLUA 2A1SA 2F8SA 3BDPA 1BQMA 2XY6A 4CJTA 3QERA 5FROA 3PX0A 3PO5A 4PWDA 3DI6A 4FM2A 4H4MA 1BHLA 1Y97A 2KFNA 4CECA 4FLTA 3AO5A 2X78A 4Q5VA 1QS4A 3U3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QCL A;  3NDK A;  4HUG A;  1TK5 A;  3C6U A;  3DLE A;  1NK5 A;  2O4I A;  1ASW A;  4KHY A;  3ZSX A;  2ATQ A;  3QES A;  1Q9X A;  1RT5 A;  4DU3 A;  3B6O A;  4AIL C;  2OZM A;  4KHW A;  2XRI A;  3DMJ A;  4M45 A;  3CFR A;  1YTU A;  5I3U A;  2B4J A;  1KLN A;  3K5M A;  1SL2 A;  4DTR A;  4ZTJ A;  4KPY A;  4FLY A;  4I7F A;  1T05 A;  4OPK A;  3AVB A;  3PO4 A;  4Z4H A;  4JLH A;  2D5R A;  4FZX C;  4CJ4 A;  4KI6 A;  1S9E A;  4CJQ A;  1HYV A;  3QET A;  4CFC A;  1XHX A;  3HK2 A;  4CK1 A;  3VQ5 A;  4CF0 A;  4K8X A;  1S6Q A;  4JS5 A;  5C24 A;  4ID1 A;  3OYH A;  1RT1 A;  4NCG A;  4DQI A;  4DS5 A;  4ZTF A;  5EU7 A;  2FBV A;  1ZBI A;  1WN7 A;  2ETJ A;  1UA0 A;  4DTS A;  3O4Q A;  3L2U A;  1D9D A;  3KK3 A;  3LZJ A;  2VG5 A;  3AO4 A;  3SV4 A;  4F3O A;  3JYT A;  3L2Q A;  1TL3 A;  1SL0 A;  4DQR A;  4Y1C A;  3L2R A;  4DTP A;  2YNI A;  4CJS A;  3MEG A;  1N6Q A;  1BIZ A;  4OPJ A;  4RW9 A;  4DFJ A;  2HNZ A;  2LSN A;  4CES A;  1I39 A;  3LP3 A;  3OYD A;  4DLE A;  4OLA A;  4FVM A;  3IS9 A;  1BIS A;  2G8I A;  4ELT A;  3NAE A;  4HCC A;  1ZBF A;  2AJQ A;  1WAJ A;  3NGY A;  4HTU A;  2DY4 A;  3MXI A;  3ZSV A;  5E41 A;  3DLH A;  4KTQ A;  3P1G A;  4BE0 A;  1LAW A;  1KVC A;  1LWC A;  1WAF A;  1YTA A;  3AVM A;  4BE1 A;  1NOY A;  1LWF A;  3OYN A;  4N76 A;  2QK9 A;  1KCF A;  1XC9 A;  1RBR A;  1VSD A;  3QO9 A;  3V4I A;  4FJN A;  3ZT0 A;  4H4O A;  1T7P A;  3M8P A;  4FJ9 A;  3RR7 A;  3K59 A;  1TV6 A;  4NYN A;  4O55 A;  3OS2 A;  3DRR A;  1TL1 A;  3NFA A;  3HVT A;  2G8W A;  4PUO A;  5HRO A;  3HO1 A;  5J2P A;  3ZT4 A;  5KRT A;  4N41 A;  4CIG A;  1B92 A;  2GUI A;  1ZBH A;  1FKO A;  3RMD A;  3C6T A;  3OYE A;  1HPZ A;  4ELV A;  3CM6 A;  1LW0 A;  3RMB A;  1FXX A;  3SNN A;  4KRF A;  2KFZ A;  1EX4 A;  1IKX A;  5SZT A;  3KLE A;  4B8C A;  3ISN C;  4LD0 A;  1ASV A;  3CFO A;  4PY5 A;  2HHX A;  1S5J A;  4BAC A;  4FLW A;  4HCB A;  4QOZ B;  4DTM A;  1KFD A;  3ZSY A;  4E7K A;  4CJE A;  1RTJ A;  3KTQ A;  3OYA A;  4K8Z A;  3WNG A;  1BGX T;  1WSH A;  3F9K A;  1HQE A;  4KO0 A;  2O4G A;  4CGG A;  4W5T A;  3HST B;  3QEP A;  3ASM A;  5JS1 A;  3HM9 A;  5J1E A;  1R0A A;  3VQB A;  3HXM A;  5KTQ A;  1L3T A;  1IG9 A;  1RTD A;  2BE2 A;  1T8E A;  3TAF A;  1X9S A;  1BI4 B;  3AA5 X;  3K5L A;  2G8K A;  4CEE A;  1IO2 A;  4W5O A;  1JLB A;  3DLR A;  5HLF A;  4FJ5 A;  2FBY A;  2QXF A;  1F21 A;  2WON A;  4Y1D A;  5KI6 A;  2P51 A;  3VQ8 A;  4E3S A;  4F2S A;  3KK2 A;  1RTI A;  1RBS A;  2EHG A;  2KQ2 A;  3DOL A;  3KKS A;  3VQC A;  4RW8 A;  2VG6 A;  3KLF A;  3TAQ A;  2XO7 A;  4C8O A;  4CFA A;  3NF7 A;  4CHP A;  3CG7 A;  3OJS A;  1U48 A;  3DOK A;  3QEV A;  3PV8 A;  1C1C A;  2DTU A;  5FRM A;  4FW1 A;  1RDC A;  3AVK A;  3V9Z A;  4CHO A;  2Z1J A;  2JLE A;  1DLO A;  1B9D A;  4CGJ A;  2F96 A;  3K5N A;  3L8B A;  2YV0 X;  3RTV A;  4E7H A;  1JLA A;  3PX4 A;  4FJI A;  3KLI A;  2HHU A;  2KZM A;  3L2W A;  1S9G A;  2YHB A;  2YNF A;  2KW4 A;  3SZ2 A;  2ZQB A;  3AV9 A;  4IBN A;  3OY9 A;  2W42 A;  3NF9 A;  4CED A;  4FK4 A;  1S1X A;  2Z1G A;  1WLJ A;  5CYM A;  4CER A;  3SI6 A;  3IG1 A;  3SUQ A;  2GV9 A;  2VG7 A;  4EZ9 A;  4CK2 A;  3RMA A;  2X74 A;  1N5Y A;  4Z4E A;  4R5P A;  4RW4 A;  3VQ9 A;  3ZSQ A;  4ID5 A;  1DTT A;  4LY7 A;  1BCM A;  2OYQ A;  3TAM A;  4W5Q A;  1TK8 A;  4IG0 A;  4C8N A;  4KB0 A;  3MED A;  5HRN A;  3LWM A;  1SV5 A;  4J2B A;  5DK5 A;  3JSM A;  1BCO A;  5JS2 A;  1TK0 A;  4M3U A;  3AA2 A;  4DFK A;  2OPR A;  4DG1 A;  1RT3 A;  3V1R A;  5CY4 A;  3QIO A;  4Z0U A;  3WNF A;  4CEO A;  2G8U A;  5CZ1 A;  1BQN A;  1HNI A;  3AVF A;  3OYB A;  4Q0B A;  4FJX A;  3TWH A;  1RBT A;  3SQ4 A;  1J53 A;  1J54 A;  1S1V A;  4GMJ B;  4CJU A;  3VQE A;  5HRP A;  4BE2 A;  1L3U A;  4O0J A;  1S1T A;  4BDY A;  3NE6 A;  1C6V A;  3D45 A;  2R7Y A;  1J5O A;  4WE1 A;  1SKS A;  1Q9Y A;  3DYA A;  1L3S A;  3I0R A;  1S6P A;  1QQC A;  4M3R A;  4YNQ A;  1C0T A;  3NCI A;  1NKB A;  5J2Q A;  3HP9 A;  1VSE A;  3SPZ A;  3CM5 A;  3HVR A;  1WSG A;  1G15 A;  5KGW A;  3KD5 E;  3QIP A;  4CHY A;  3O3H A;  4CGH A;  1D5A A;  1MU2 A;  3LP1 A;  1C1A A;  3TAP A;  3B6P A;  4FJK A;  4KTW A;  1CZ9 A;  4FLX A;  4FZY A;  4M3Z A;  3CFP A;  1CXU A;  3CQ8 A;  1EP4 A;  3FFI A;  2HHV A;  4CJP A;  4F8R A;  2NUB A;  3F73 A;  5HP1 A;  4DTU A;  1RIL A;  2FC0 A;  2YHA A;  1SUQ A;  1JKH A;  1YT3 A;  1T03 A;  1C0U A;  2YNH A;  1VSI A;  1GOC A;  3TAE A;  1JLC A;  1QHT A;  3AVG A;  4CJF A;  3EY1 A;  4DTO A;  1NJX A;  1YVU A;  1D9F A;  3KLH A;  2KTQ A;  4BWJ A;  4CIF A;  3OYL A;  2G8H A;  1CLQ A;  1A5V A;  1RT7 A;  3HT3 A;  4DF4 A;  5HBM A;  2IS3 A;  2JGU A;  5J2N A;  1RDB A;  3AO3 A;  1JLF A;  1IH7 A;  3DRS A;  3AVN A;  3NGI A;  2HMI A;  3DLB A;  1Q8I A;  1RTH A;  3P5J A;  2DFE A;  3MEC A;  4XIU A;  4UQG A;  3RRH A;  3VQ7 A;  5KGX A;  3HPG A;  2HB5 A;  4OVL A;  4DMN A;  3NBP A;  3QEI A;  1X9W A;  1A5X A;  4LSN A;  5FDL A;  3PX6 A;  2P5G A;  1JLG A;  2D0A A;  1QSL A;  1NK0 A;  4CEZ A;  3O4N A;  4KKO A;  4CF8 A;  3LZI A;  3QNO A;  2P1J A;  4GW6 A;  3MEE A;  4L8R B;  2XHB A;  1L5U A;  2IC3 A;  4MQ3 A;  3RRG A;  3S3O A;  1LWE A;  4LSL A;  4DU1 A;  2HND A;  2DFF A;  4DSE A;  2QKK A;  3SJJ A;  4I9Q A;  4M41 A;  3SUN A;  4IDK A;  3S3M A;  1ZBL A;  5FRN A;  4OGE A;  1VSL A;  4B8A B;  4O44 A;  3LAK A;  3AVL A;  1RBU A;  2X6S A;  4GVM A;  5C25 A;  4CJV A;  3OS1 A;  1NJY A;  4O0I A;  4DFM A;  1RT4 A;  2IAJ A;  2ZE2 A;  3THV A;  4M3X A;  1J9A A;  4B9S A;  5D3G A;  3OS0 A;  4KTZ A;  4F4K A;  2IGI A;  1IKV A;  4LH5 A;  4EZ6 A;  1EET A;  3V1Q A;  4B9V A;  1NK8 A;  4KV8 A;  4ICL A;  3ZSW A;  4AHR A;  3VQD A;  4FZZ A;  4CEF A;  3KKR A;  3LPT A;  3TR8 A;  4CFB A;  2FBX A;  3UIQ A;  4FJJ A;  4O5B A;  2EX3 A;  1WSI A;  4AHU A;  1NK6 A;  4J2A A;  3V81 A;  1XI1 A;  4DTJ A;  4B3O A;  3H08 A;  1I3A A;  3A2F A;  1HRH A;  4AHS A;  1UWB A;  1JXB A;  1ZBU A;  3WNH A;  4CJK A;  3T1A A;  4DSL A;  3TAR A;  3SYZ A;  1GOA A;  4J2D A;  4FM0 A;  3LPU A;  3C94 A;  4CJ3 A;  4JRP A;  4DU4 A;  1RCH A;  1IKY A;  4I2P A;  3KLG A;  1SKW A;  1L3V A;  4FJ7 A;  2QKB A;  4E7J A;  4G1Q A;  1UAX A;  2ZD1 A;  4W5N A;  3V1O A;  1W9H A;  1QSS A;  3K5O A;  1NKC A;  2A1R A;  5I42 A;  3TAG A;  2ITG A;  1NK4 A;  1BI4 A;  4CEB A;  2VWK A;  3AVC A;  3OJU A;  4CJW A;  3C95 A;  3HP6 A;  3PUF A;  1RT6 A;  4DQQ A;  2HHT A;  4QAG A;  4OKJ A;  2D0B A;  3DRP A;  4DSI A;  4FJH A;  3EYZ A;  5CYQ A;  3M8S A;  2PYL A;  4ZHR A;  1VK0 A;  2BGG A;  3S3N A;  4KHN A;  1RBV A;  3ZT3 A;  3EZ5 A;  3AO1 A;  2D0C A;  1CZB A;  4DSF A;  3MXJ A;  4PQU A;  4FLV A;  1TAU A;  1VSJ A;  2OPQ A;  4CF9 A;  4FK2 A;  4KRE A;  3KIO A;  3ITH A;  2Z1H A;  5CZ2 A;  3T19 A;  3MAQ A;  1UA1 A;  2HHW A;  2FBT A;  4CHN A;  3KK1 A;  5DMR A;  3T3F A;  1KFS A;  3VQQ A;  3HPO A;  4KHS A;  2HHS A;  4CE9 A;  3OYM A;  1EKE A;  2OPP A;  3VA3 A;  1S1W A;  1A5W A;  1JXE A;  1TKZ A;  1C1B A;  2DFH A;  3VQA A;  3VN5 A;  3OYI A;  1U45 A;  3NH2 A;  1QSY A;  4Z4F A;  3U6F A;  2X6N A;  3NF8 A;  3LAL A;  4BDZ A;  2XY5 A;  1U04 A;  4FJL A;  4EP5 A;  4CHQ A;  3RWU A;  4CEA A;  3VA0 A;  4Z4I A;  2RN2 A;  1ITG A;  2BDP A;  2RPI A;  1RDD A;  4NCB A;  1XHZ A;  4M3W A;  1S1U A;  1HNV A;  3DLG A;  4B08 A;  1X9M A;  4H8K A;  3M8Q A;  3AVI A;  3SPY A;  1Z26 A;  3ZT2 A;  4AH9 A;  3L2V A;  4B9L A;  4OLB A;  2WOM A;  1D8Y A;  1TKT A;  2B6A A;  3HL8 A;  5KRS A;  3NGZ A;  3LDS A;  1U4B A;  1JL2 A;  4B9U A;  2OZS A;  4IG3 A;  4ELU A;  1WNS A;  2G8V A;  2XY7 A;  4FJM A;  2E4L A;  3AVA A;  1JL1 A;  4M3T A;  1REV A;  4CEQ A;  4OJR A;  4BWM A;  3SUO A;  1NKE A;  4TSX A;  4Z4C A;  4B9N A;  1IKW A;  1UOC A;  3BGR A;  1U47 A;  3OYF A;  1LW2 A;  4M42 A;  3E01 A;  4E7I A;  2HHQ A;  3LWL A;  3K2P A;  4IFY A;  1KRP A;  4F3T A;  1TVR A;  4J2E A;  3ZSO A;  3SUP A;  4N5S A;  3QNN A;  4AHV A;  3NH0 A;  1DTQ A;  3LP0 A;  4FM1 A;  4IKF A;  3ULD A;  4KHQ A;  3QEW A;  5J2M A;  1KSP A;  4NYF A;  3VQ4 A;  4FLZ A;  1ASU A;  1U49 A;  3OYC A;  3ZT1 A;  3DM2 A;  3QEX A;  4DSK A;  4DLG A;  4DF8 A;  3QLH A;  3SQ2 A;  1VSH A;  4CJ5 A;  3SCX A;  4AHT A;  3V9U A;  3V6D A;  3OVN A;  1XWL A;  2PZS A;  2PYJ A;  4E1M A;  1QE1 A;  1LV5 A;  4FJ8 A;  2YKM A;  1EXQ A;  4C8L A;  4DTN A;  4E0D A;  3TAB A;  4CFD A;  2YNG A;  4E89 A;  1KVB A;  5HRS A;  4DQP A;  3V9W A;  4CF1 A;  2B5J A;  4CF2 A;  3SQ1 A;  4HUE A;  1W0H A;  2XY8 A;  3AVJ A;  3LP2 A;  2G8F A;  1HMV A;  1TKD A;  2HW3 A;  1KTQ A;  4FCY A;  1TAQ A;  2OPS A;  4HHT A;  4HVJ A;  1BIU A;  1CXQ A;  2HVH A;  4EP4 A;  4DQS A;  3NH1 A;  4B9M A;  1KLM A;  2RF2 A;  3HYF A;  4AHC A;  1C0M A;  4W5R A;  1VSK A;  1FKP A;  1RNH A;  4CJR A;  3OYJ A;  1VRU A;  4DSJ A;  1KVA A;  4YFU A;  1HJR A;  5HRR A;  3U3G A;  2RKI A;  4CGF A;  4F2R A;  3DLK A;  1O1W A;  3NF6 A;  3AA4 A;  1HYS A;  1JLQ A;  3PY8 A;  4KB1 A;  4IFV A;  4NCA A;  1RT2 A;  1B9F A;  4O4G A;  4KI4 A;  2IDO A;  1NJW A;  2OA8 A;  2IOC A;  3AO2 A;  4CK3 A;  2E6M A;  1ZYQ A;  4RW6 A;  1HQU A;  1WSJ A;  1NK9 A;  3AVH A;  4C8M A;  1SKR A;  4RW7 A;  5C42 A;  2F8T A;  4FYD A;  4FJG A;  3KJV A;  2Z1I A;  4OKK A;  3VQP A;  3RMC A;  4KHU A;  4FXD A;  1LAV A;  3TAN A;  3MXM A;  2HNY A;  1NJZ A;  4LH4 A;  2YKN A;  3ZSZ A;  1VSM A;  5T7B A;  3CYM A;  4CHZ A;  3O3G A;  3SQ0 A;  4Z4G A;  4FW2 A;  3G0Z A;  4E19 A;  3M8R A;  1QTM A;  4E1N A;  3V9S A;  4BDP A;  1HYZ A;  4CJL A;  4JS4 A;  3AA3 A;  3L3U A;  2VWJ A;  3WNE A;  1TKX A;  1NK7 A;  1BL3 A;  3IRX A;  3LAN A;  4OKE A;  4RG8 A;  3D0P A;  4B9T A;  3IAY A;  4HUF A;  3OYG A;  3P83 D;  1RDA A;  4N47 A;  1GOB A;  1NOZ A;  4E7L A;  1X1P A;  4OGC A;  3TI0 A;  3RR8 A;  2Y1J A;  1Z25 A;  4CCH A;  1SL1 A;  4I2Q A;  3V9X A;  2GBZ A;  3OYK A;  5K14 A;  3KD1 E;  3L3V A;  3QIN A;  3I8D A;  3HJF A;  1K6Y A;  3LAM A;  3S9H A;  4N56 A;  2Y1I A;  1VRT A;  1JLE A;  2PY5 A;  3O3F A;  1WSE A;  3ALY A;  2P5O A;  1FK9 A;  4KAZ A;  3I0S A;  2KZZ A;  4M3Y A;  3SV3 A;  4I9L A;  1VSF A;  4CIE A;  1WSF A;  2HVI A;  5SWM A;  3K57 A;  4MFB A;  4DS4 A;  4DFP A;  4JRQ A;  1TGO A;  3G10 A;  4PA1 A;  3ZCM A;  4FK0 A;  3HPH A;  4KFB A;  3VQ6 A;  3K58 A;  4CGI A;  4DWI A;  2E6L A;  2I5J A;  4CGD A;  3ZSR A;  2Q3S A;  3NHG A;  2BAN A;  4C8K A;  4DTX A;  4FLU A;  2A1S A;  2F8S A;  3BDP A;  1BQM A;  2XY6 A;  4CJT A;  3QER A;  5FRO A;  3PX0 A;  3PO5 A;  4PWD A;  3DI6 A;  4FM2 A;  4H4M A;  1BHL A;  1Y97 A;  2KFN A;  4CEC A;  4FLT A;  3AO5 A;  2X78 A;  4Q5V A;  1QS4 A;  3U3Y A; 
#chains in the Genus database with same CATH topology
 3NDK A;  4HUG A;  5FPN A;  3DLE A;  1NNE A;  3ZSX A;  4DU3 A;  3DMJ A;  4M45 A;  1YTU A;  3CJ9 A;  3K5M A;  4DTR A;  1T05 A;  4XEI A;  2D5R A;  3PIP L;  3QET A;  3ATU A;  3VQ5 A;  4K8X A;  5LJW A;  2ZF5 O;  4ID1 A;  1RT1 A;  4NCG A;  5C2F A;  5EU7 A;  2FBV A;  2HBK A;  3JXU A;  5AQU A;  1UA0 A;  4LF8 K;  3LZJ A;  3SV4 A;  3ZX3 A;  1SL0 A;  5H1S Q;  5AQP A;  1OH6 A;  4CJS A;  4OPJ A;  4RW9 A;  4DFJ A;  3CIP A;  1S22 A;  2D1K A;  4LC9 B;  4BC5 A;  2O8D B;  3EE8 A;  1I39 A;  4E1J A;  1R59 O;  3ID8 A;  3NAE A;  3LDO A;  1ZBF A;  5HL7 L;  3E66 A;  3ZSV A;  4JI1 K;  1LWC A;  3OYN A;  4A2A A;  3QFU A;  3AGR A;  1VQ4 N;  4YHH K;  3M8P A;  1TV6 A;  3DRR A;  1TL1 A;  3NFA A;  5HRO A;  1XMQ K;  2HOE A;  4N41 A;  2UUA K;  4OPH A;  1ZBH A;  3RMB A;  1QVF M;  1IKX A;  1EX4 A;  3LDP A;  3KLE A;  2QEX N;  3LDN A;  3ISN C;  4LD0 A;  1RDW X;  4B8C A;  4DR2 K;  3P4I A;  4A2B A;  2HHX A;  4FLW A;  4PKH A;  4K8Z A;  5GAE P;  1T6C A;  3HST B;  3QEP A;  3ASM A;  5J1E A;  3HXM A;  1X9S A;  3AA5 X;  1JJ2 M;  1IO2 A;  3DLR A;  5HLF A;  5BPM A;  2P51 A;  3CJA A;  1RTI A;  3KLF A;  4JHD B;  3VQC A;  1IJJ A;  4CBW A;  1BA1 A;  3O4W A;  2F9T A;  4LF7 K;  5FRM A;  4FW1 A;  3AVK A;  4YY3 K;  1YIJ N;  1B9D A;  4CGJ A;  4E7H A;  3PX4 A;  2YV0 X;  3RTV A;  1WUA A;  3N4P A;  2F7T A;  2YHB A;  2W42 A;  2UUC K;  4FK4 A;  3K9K A;  5AQX A;  2D0P A;  3SI6 A;  3SUQ A;  2CGK A;  3VEZ A;  1RGI A;  2VG7 A;  3VOV A;  2YCH A;  4JEP A;  4CK2 A;  2X74 A;  3SK3 A;  4R5P A;  2HHH K;  4ID5 A;  3FZK A;  3TAM A;  4BRF A;  4CZL A;  3ULE B;  4IG0 A;  5M1N A;  5HRN A;  3LWM A;  1SV5 A;  1KC8 O;  4WQ5 A;  2E2P A;  1C0F A;  2O8C A;  5JS2 A;  3CCR N;  5CY4 A;  4Z0U A;  5CZ1 A;  2QXL A;  5F2R A;  3AVF A;  3OYB A;  3SQ4 A;  1J53 A;  4GMJ B;  1YJW N;  3I56 N;  4O0J A;  1NGD A;  4BRD A;  2VQE K;  3MK6 A;  3CHW A;  4JK8 A;  4BR5 A;  4MDA A;  2A6A A;  3FZM A;  1C0T A;  3NCI A;  1X9J A;  1XNR K;  3HP9 A;  3SPZ A;  3CM5 A;  1WSG A;  1Q81 O;  4JNE A;  5KGW A;  2WTU A;  3QIP A;  2V52 B;  1D5A A;  3DAW A;  1GLA G;  2P9K B;  4FJK A;  3B6P A;  3CJ1 A;  5F1X A;  2ITM A;  4KTW A;  3WEE B;  2I7N A;  4FLX A;  5ELZ A;  4FZY A;  1CXU A;  3TSQ A;  4F8R A;  4JKC A;  3WXK A;  2NUB A;  4X65 K;  1RIL A;  1SUQ A;  1T03 A;  2W6K A;  4FOI A;  2YNH A;  4R79 A;  3TAE A;  1JLC A;  1QHT A;  3OYL A;  1GLC G;  5KPT A;  3FZF A;  1RDB A;  1JLF A;  3DRS A;  1RTH A;  2DFE A;  2NRW A;  4NB4 A;  4IO8 A;  3VQ7 A;  5IT9 O;  3CCU N;  2HB5 A;  4OVL A;  2P9K A;  4DMN A;  3QEI A;  5C2D A;  3WXL A;  3PX6 A;  1QSL A;  4UY8 O;  1NK0 A;  4CEZ A;  3EKS A;  4L3Q A;  2GEL A;  5EX5 A;  4MQ3 A;  3S3O A;  4LSL A;  4IDK A;  1MA9 B;  4B8A B;  4O44 A;  1RBU A;  4GVM A;  3OS1 A;  3I55 N;  3O9Q A;  1RT4 A;  3U9D A;  1JCE A;  2P9I B;  1IKV A;  1EET A;  2CGL A;  3V1Q A;  1BU6 O;  4YOX A;  3ZSW A;  3VQD A;  4CEF A;  5GIN A;  4O5B A;  2EX3 A;  2UXB K;  2QWL A;  1XI1 A;  3A2F A;  4LF9 K;  1ZBU A;  4CJK A;  3MN7 A;  1GOA A;  4FO0 A;  4CW7 B;  3BP8 A;  5AFU H;  4DU4 A;  3C94 A;  4JRP A;  3KLG A;  1IKY A;  2Q2R A;  1SKW A;  4JI6 K;  3E9O A;  4BGA A;  2JWL A;  4ISE A;  1NGH A;  1W9H A;  4FWM A;  1QSS A;  2UXC K;  3UKU B;  2A1R A;  1Q7Y O;  1NK4 A;  3AVC A;  1OKJ A;  1J6Z A;  3OJU A;  3C95 A;  1RT6 A;  2GEM A;  3HBT A;  4DQQ A;  2HHT A;  4OKJ A;  3DRP A;  3EYZ A;  5CYQ A;  4CD3 A;  1QQM A;  1RBV A;  2V7Z A;  1CZB A;  1NMN A;  3I8B A;  4U7B A;  4FK2 A;  5CZ2 A;  4RWT A;  1UA1 A;  5DMR A;  1KFS A;  2QI2 A;  3HPO A;  4DV0 K;  3C6H A;  1EKE A;  1A5W A;  1JXE A;  3VQA A;  3F2K A;  4BG9 A;  3U6F A;  2X6N A;  4BDZ A;  3RSE A;  2XY5 A;  5AQR A;  3ZET B;  3RWU A;  4DR3 K;  4CEA A;  1YVN A;  4EAH D;  1ITG A;  4WQ4 A;  2BDP A;  2RPI A;  1XMO K;  4CZJ A;  3VEO A;  1IBM K;  2UU9 K;  3SPY A;  3L2V A;  4B9L A;  1O13 A;  2B6A A;  3HL8 A;  5KRS A;  2QWR A;  2OZS A;  4IG3 A;  4ELU A;  2E4L A;  1V4S A;  4OJR A;  4E7I A;  2HHQ A;  1NWK A;  4F3T A;  3ZSO A;  4EHU A;  3NH0 A;  2E8A A;  3DXM B;  3LM9 A;  3WQU A;  1ASU A;  1Q18 A;  3D2E A;  4DF8 A;  4PKI A;  4NO7 A;  3QLH A;  3ZEU A;  4A57 A;  4B3S K;  3VES A;  1XNQ K;  2PYJ A;  4E1M A;  1EWQ A;  4BRC A;  1QE1 A;  4IO9 L;  4FJ8 A;  4K41 A;  4DTN A;  3PSI A;  1DKG D;  3DWL A;  4E89 A;  4GV3 A;  4DQP A;  2A3Z A;  4CF1 A;  4IJN A;  4HUE A;  4JKH A;  1W0H A;  3THY A;  3OA9 A;  2QM1 A;  4HVJ A;  3NH1 A;  3HYF A;  1RNH A;  1VRU A;  5C0Y A;  4YFU A;  2RKI A;  4Z94 A;  2CH5 A;  1O1W A;  3NF6 A;  1BOT O;  1QZ5 A;  1JLQ A;  1SQK A;  1TUU A;  2PAV A;  1T44 A;  2IOC A;  4CK3 A;  2E2Q A;  1HQU A;  1WSJ A;  1NK9 A;  3AVH A;  4X62 K;  4RW7 A;  3KJV A;  4CJ7 A;  3TSU A;  3RMC A;  3TAN A;  1BO5 O;  2Q31 A;  2YKN A;  1VQ6 N;  3CYM A;  4FW2 A;  4JN4 A;  2A5X A;  4BRG A;  1HYZ A;  5M1P A;  4CJL A;  4CBU A;  4V19 S;  1C0G A;  1ATR A;  3LAN A;  4B9T A;  3IAY A;  3OYG A;  1RDA A;  1GOB A;  1NOZ A;  1X1P A;  2ZGZ A;  3GOI A;  2Y1J A;  3WXI A;  3MN5 A;  2GBZ A;  3QIN A;  3I8D A;  1K6Y A;  3WUH A;  3BY5 A;  4KBO A;  4N56 A;  4RCH A;  3QBW A;  3CCS N;  1JLE A;  2Y1I A;  4KAZ A;  3ALY A;  1H1V A;  5BPL A;  4I9L A;  2FSN A;  3SV3 A;  1J5E K;  3K57 A;  3VEY A;  4FK0 A;  3HPH A;  4BVP A;  4CGD A;  5JLF A;  3NHG A;  4DTX A;  1OH8 A;  4FLU A;  5FRO A;  3PO5 A;  4H4M A;  2UUB K;  2KFN A;  1K8K B;  4CEC A;  5IWA K;  3TTF A;  2ZM6 K;  4NLC A;  5LJV A;  4Q5V A;  4BRL A;  4QCL A;  3C6U A;  2ZWH A;  4KHY A;  3BF3 A;  2ATQ A;  1EO1 A;  2YI1 A;  1KQS M;  5DM7 L;  2XRI A;  1EQY A;  5I3U A;  1OVQ A;  4WFN L;  4NXN K;  4CZK A;  3AVB A;  4KI6 A;  1S9E A;  3IDH A;  1HYV A;  4IZ9 A;  1VHX A;  4B1U B;  3THW B;  4CF0 A;  3RVC A;  4JS5 A;  3AAQ A;  5C24 A;  2P9L B;  1YF5 L;  2P9S B;  5AQV A;  4DS5 A;  4ZTF A;  3H6E A;  4PL7 A;  4H5W A;  2VG5 A;  3JYT A;  2GX9 A;  4Y1C A;  4DTP A;  1BIZ A;  2FF3 B;  3VPZ A;  4DLE A;  4OLA A;  4Y0W A;  3THW A;  1BIS A;  1WAJ A;  2DY4 A;  1W7A A;  3MXI A;  5E41 A;  3FLC O;  3DLH A;  1P8Z A;  5AQI A;  2IVN A;  1KVC A;  1WAF A;  1YTA A;  5BPN A;  1NOY A;  1LWF A;  2QWP A;  3DXK A;  2ASO A;  3L4I A;  3IFR A;  1BUP A;  4FJN A;  3VF6 A;  4FJ9 A;  1Y64 A;  4JI2 K;  2KKZ A;  4NYN A;  4WF9 L;  3OS2 A;  3BZK A;  3J81 O;  5FPE A;  3HVT A;  4A61 A;  5J2P A;  3Q7B A;  1B92 A;  4FSV A;  4ELV A;  3CM6 A;  3L4Q A;  1WBB A;  4KRF A;  2KFZ A;  2OCE A;  5SZT A;  2D0O A;  2GWJ A;  2E88 A;  1MWM A;  1HNZ K;  3C65 A;  2VQF K;  3VER A;  1ASV A;  2CH6 A;  1S5J A;  4HCB A;  4QOZ B;  1KFD A;  3ZSY A;  4E7K A;  3KTQ A;  1R0A A;  2O4G A;  1KAY A;  3L6Q A;  3VQB A;  4A5B A;  5KTQ A;  3CI5 A;  1T8E A;  1BI4 B;  2G8K A;  1JLB A;  1SAZ A;  2FBY A;  4E3S A;  5EOY A;  3GBT A;  4ISF A;  1NGI A;  3DOL A;  3KKS A;  5AQH A;  4RW8 A;  1U2V A;  2VG6 A;  3GL1 A;  2XO7 A;  2QWN A;  4MO4 A;  3TAQ A;  3J80 O;  3MWP A;  4CHP A;  3PV8 A;  2KLA A;  1RDC A;  4LF5 K;  4CHO A;  3K5N A;  5DM6 L;  1NGJ A;  1S9G A;  3K9J A;  4CED A;  2Z1G A;  3FZH A;  1TYQ B;  4CZF A;  3ID6 A;  3CET A;  3RMA A;  1VQM N;  2IVP A;  4XH5 A;  4LY7 A;  1JCF A;  3CCL N;  4C8N A;  1OH5 A;  5DK5 A;  4H5V A;  2YJF A;  5TKY A;  4WFA L;  1TK0 A;  3AA2 A;  2OPR A;  1GLE G;  4H0O A;  4DG1 A;  1RT3 A;  5AZJ A;  3WNF A;  2G8U A;  1BQN A;  1HNI A;  4Q0B A;  4BQL A;  1L3U A;  5HRP A;  4BDY A;  3NE6 A;  1T3V A;  1C6V A;  3O80 A;  2R7Y A;  3CQX A;  1NGG A;  4JI4 K;  5CHI A;  4ILJ A;  3VEV A;  1SKS A;  1NGF A;  3DYA A;  1NKB A;  5AR0 A;  1VSE A;  3LL3 A;  4H0T B;  2HBJ A;  2GUP A;  5JLH A;  4JI5 K;  5A2Q O;  3UKR B;  3F73 A;  4DTU A;  2FC0 A;  1VQN N;  1S72 N;  3CCE N;  3EY1 A;  4CJF A;  3AVG A;  1D9F A;  1YVU A;  4DR7 K;  4BWJ A;  1YXQ A;  1CLQ A;  5HBM A;  2HMI A;  1IH7 A;  4K42 A;  1Q8I A;  2VGM A;  4XIU A;  1N34 K;  3WQT A;  1KAX A;  3NBP A;  1X9W A;  2P5G A;  5C12 A;  1Q86 O;  2NLX A;  3QNO A;  2P1J A;  1VAZ A;  4GW6 A;  3MEE A;  2O8D A;  5GAD P;  2XHB A;  2Q36 A;  2HND A;  2DFF A;  4KH5 A;  4DSE A;  4I9Q A;  4M41 A;  1ZBL A;  3S3M A;  4OGE A;  1RDU A;  2X6S A;  3IKM A;  3PSF A;  5C25 A;  4CJV A;  4DFM A;  3THV A;  3CQY A;  5AZI B;  4B9S A;  5D3G A;  3OS0 A;  4H03 B;  4KTZ A;  4LF6 K;  2VWB A;  3T7Z A;  3SLC A;  1ESV A;  4B9V A;  1HNW K;  1NK8 A;  4DUY K;  3TR8 A;  3LPT A;  3UIQ A;  1WSI A;  1SS6 A;  1NK6 A;  4J2A A;  3HZ6 A;  2O8B B;  3EO3 A;  4DTJ A;  4BRK A;  3H08 A;  1I3A A;  3E1Y A;  1UWB A;  1JXB A;  3T1A A;  4H5N A;  3M3Z A;  2J4R A;  3KHY A;  2O8F B;  5AQS A;  4JV5 K;  4CJ3 A;  5CE3 A;  3SAH A;  4I2P A;  1IG8 A;  3OBY A;  3HRG A;  4K0K K;  4GV6 A;  4G1Q A;  3ENO A;  3J7A P;  4JD2 B;  3K5O A;  1NM1 A;  4JAX A;  4CEB A;  4CJW A;  4I6M B;  4QAG A;  4JHD A;  5GIP A;  3L0Q A;  2YJE A;  2PYL A;  3AY9 A;  3S3N A;  3MXJ A;  4DV7 K;  2HBL A;  4FLV A;  1VQK N;  4PQU A;  2OPQ A;  2Z1H A;  4DKW A;  3T19 A;  1N36 K;  2FBT A;  5M1K A;  3CCQ N;  3OYM A;  1U45 A;  1TKZ A;  1QSY A;  1C1B A;  3VN5 A;  3NH2 A;  4Z4F A;  2QWO A;  1U04 A;  4KH4 A;  4FJL A;  4EP5 A;  3O1W A;  4BG8 A;  4JK9 A;  4YOT A;  5GAG P;  4NCB A;  4M3W A;  1HNV A;  4B08 A;  1X9M A;  5BRF A;  1Z26 A;  3ZT2 A;  4FVU A;  1D8Y A;  3ULE A;  4JYA K;  1JL2 A;  1V4T A;  4BR7 A;  1WNS A;  4FJM A;  3CJB A;  2OAN A;  1JL1 A;  4M3T A;  1HNX K;  4BC4 A;  4M7X A;  4BWM A;  1NKE A;  4TSX A;  4Z4C A;  3BGR A;  1LW2 A;  4JKG B;  2YHW A;  4IFY A;  4N5S A;  3QNN A;  4AHV A;  4B3M K;  4FM1 A;  4G9Z A;  1QVG M;  4BRA A;  3QEW A;  5J2M A;  3J7Y P;  4FLZ A;  1U49 A;  3ZT1 A;  1NGA A;  4DSK A;  4DLG A;  3SQ2 A;  4FWL A;  3ATV A;  3B8A X;  3SCX A;  4AHT A;  4X64 K;  3OVN A;  3W3D A;  5E26 A;  2OTJ N;  2YKM A;  3WEE A;  1ATS A;  5HRS A;  5JVH L;  3EEQ A;  2HW3 A;  3NVM A;  4HHT A;  2HVH A;  1KLM A;  2RF2 A;  3VEX A;  1VSK A;  1FKP A;  3OYJ A;  4JKD A;  1NJI O;  3MDQ A;  5M1F A;  3DLK A;  3AA4 A;  2VGN A;  5FPM A;  4KB1 A;  1IBL K;  4IFV A;  4JKB A;  4NCA A;  4IFE A;  2OA8 A;  1HLU A;  1FJG K;  3BF1 A;  3O9T A;  2P9P B;  4RW6 A;  5KPR A;  5C42 A;  4O8U A;  1NJZ A;  4YDU C;  1NMD A;  1VSM A;  5FLX O;  1ILY A;  5T7B A;  4CHZ A;  3O1B A;  2P9I A;  4BY9 C;  4JS4 A;  3A0I X;  1HR0 K;  4AF1 A;  1TKX A;  3IRX A;  4RG8 A;  1WOQ A;  1N33 K;  2IVO A;  4EIA A;  4N47 A;  4FWN A;  3RR8 A;  1Z25 A;  1SL1 A;  5AFU A;  3Q7C A;  4DQ8 A;  3KD1 E;  3M5R A;  1JCG A;  2ZJQ L;  1K73 O;  3LDL A;  3I0S A;  2E1Y A;  1WSF A;  4DS4 A;  4JKF A;  4MFB A;  2F9W A;  4JI7 K;  4AQY K;  3C7N B;  4IEI A;  3G10 A;  3TTD A;  4KFB A;  3GDQ A;  4IOA L;  4CGI A;  2I5J A;  4X66 K;  2Q3S A;  4C8K A;  5CR4 A;  3UKU A;  3LDQ A;  2F8S A;  3ENB A;  3QER A;  4PWD A;  3PX0 A;  2A41 A;  1Y97 A;  5AQO A;  4WCE L;  2NRR A;  1QS4 A;  3U3Y A;  3GG4 A;  3ENH A;  3QES A;  5AQQ A;  1RT5 A;  4KHW A;  3B6O A;  3R8E A;  2P9U B;  2F4V K;  4U67 L;  1S3X A;  4KPY A;  4CZM A;  4FLY A;  4OPK A;  3CPW M;  4Z4H A;  3F5T A;  5KPZ A;  3FGU A;  3ZET A;  1XHX A;  3HK2 A;  4CK1 A;  4DV4 K;  2RE2 A;  3R6M A;  1S6Q A;  3O9S A;  5EVZ A;  4DQI A;  4DHY A;  1IBK K;  1ZBI A;  1WN7 A;  3NMU A;  2P9N B;  3O4Q A;  3L2U A;  1D9D A;  2P9U A;  3AO4 A;  4F3O A;  1TL3 A;  3TTC A;  3ZYY X;  3L2R A;  1Z05 A;  2QA4 N;  3MEG A;  2HNZ A;  4FPB A;  2LSN A;  4BR2 A;  3LP3 A;  3QML A;  4C1N I;  4CD1 A;  3H3O B;  3T1H K;  4ELT A;  3DXM A;  4H0X B;  4FWP A;  3VTI A;  5GIO A;  3NGY A;  5EY4 A;  4HTU A;  2AJQ A;  2I7P A;  1D4X A;  4KTQ A;  2HMP A;  1LAW A;  3AVM A;  4N76 A;  2QK9 A;  1VSD A;  3OBW A;  4H4O A;  4JK7 A;  3TPQ A;  3RR7 A;  4O55 A;  3H45 C;  1VQ7 N;  3BEX A;  3HO1 A;  4B3R K;  5M1Q A;  5KRT A;  4K25 A;  3RMD A;  3C6T A;  2O8E B;  1LW0 A;  2Q0R A;  1FXX A;  3SNN A;  3R9P A;  4QS9 A;  1VQ8 N;  5C10 A;  3KZB A;  1Q82 O;  2PBD A;  4DTM A;  3FFK B;  4LFC K;  2V51 B;  1RTJ A;  3WNG A;  1BGX T;  1WSH A;  3F9K A;  4KO0 A;  2OTL N;  1IG9 A;  2BE2 A;  4BRH A;  3TAF A;  4WYB A;  4CEE A;  4W5O A;  4BGB A;  4BR4 A;  4Y1D A;  4LFA K;  5BR9 A;  3K0S A;  1X3M A;  2KQ2 A;  2W40 A;  3IUC A;  3BUZ B;  3CXC M;  3EN9 A;  4C8O A;  4CFA A;  3OJS A;  3DOK A;  3QEV A;  1C1C A;  2NRX A;  3G71 N;  3V9Z A;  1YJ9 N;  4B1W B;  3M6G A;  3QB0 A;  2F96 A;  4FJI A;  5I9E B;  1JLA A;  4BC3 A;  1ATN A;  3KLI A;  2HHU A;  3L2W A;  2Q0U A;  3EZW A;  4C1N K;  2ZQB A;  3OY9 A;  4IBN A;  3NF9 A;  1WLJ A;  4CER A;  2GV9 A;  4CVN E;  4JKA A;  4EZ9 A;  4Z4E A;  3CC4 N;  1KAZ A;  1TUY A;  5LL6 Z;  1DTT A;  3W0L A;  3CPE A;  1BCM A;  1NGC A;  4A5A A;  5LMN K;  4O5F A;  3T1Y K;  4KB0 A;  3VGL A;  5C15 A;  4J2B A;  1HKB A;  3EE9 A;  3JSM A;  2AP1 A;  1W2B M;  4DFK A;  4DUZ K;  3QIO A;  4CEO A;  5ADX H;  5B8H A;  1YI2 N;  3TWH A;  1S1V A;  4CJU A;  3VQE A;  1IV0 A;  1K8K A;  4WE1 A;  3JS6 A;  3H3N O;  3G25 A;  4PL8 A;  1QQC A;  4M3R A;  3P31 A;  5J2Q A;  3HVR A;  1OH7 A;  3KD5 E;  4CHY A;  5AQK A;  4BRP A;  2YHX A;  1MU2 A;  1C1A A;  5TKW A;  4IOC L;  1CZ9 A;  5AQY A;  4M3Z A;  3D6R A;  4WQ5 C;  3CQ8 A;  3FFI A;  1EWR A;  5HP1 A;  1YT3 A;  4DTO A;  3KLH A;  4BC2 A;  4ILG B;  2G8H A;  1A5V A;  2P9L A;  4DF4 A;  2P9S A;  4BRI A;  5J2N A;  3AO3 A;  1RFQ A;  3AVN A;  3MEC A;  1QQN A;  3O08 A;  3HPG A;  1HKC A;  3E9P A;  1A5X A;  5FDL A;  2D0A A;  3CCV N;  4CF8 A;  3LZI A;  4FWQ A;  4A59 A;  1L5U A;  2E20 A;  2IC3 A;  2V7Y A;  2QTD A;  3SJJ A;  4OX9 K;  3SUN A;  1HUX A;  1VSL A;  3SJH A;  4YOW A;  3AVL A;  4H0Y B;  3CCM N;  2HST A;  3MCP A;  3QFP A;  2IAJ A;  3A5N C;  4M3X A;  4A62 A;  2IGI A;  4LH5 A;  4EZ6 A;  5MLC Q;  4DR6 K;  3KKR A;  4CFB A;  4NLB A;  1X3N A;  2CGJ A;  3VF2 A;  4YOY A;  4AHU A;  3D2F B;  3WXM B;  3KWI A;  4AHS A;  1HRH A;  3WNH A;  2FF6 A;  3SYZ A;  4J2D A;  1K8A O;  3LPU A;  1VQL N;  2BUP A;  4CZG A;  4FJ7 A;  4E7J A;  3THX B;  5JVG L;  2ZD1 A;  2VYP A;  1NKC A;  4LF4 K;  5I42 A;  3TAG A;  4HWI A;  1BI4 A;  4DB3 A;  5BR8 K;  1NG9 A;  2A40 A;  2D0B A;  4FJH A;  1GLF O;  1VK0 A;  2BGG A;  3AGK A;  2ZJP L;  3ZT3 A;  3AO1 A;  2D0C A;  4BRM A;  4KRE A;  3KIO A;  3ITH A;  3MAQ A;  2HHW A;  4GY2 B;  5BN8 A;  3VQQ A;  4KHS A;  1ZXO A;  2HHS A;  4H5T A;  2VCP A;  2OPP A;  3SBT A;  4BRQ A;  1Q9Y A;  3OYI A;  3NF8 A;  3CME N;  4CHQ A;  1TYQ A;  4HTL A;  2HF3 A;  3VA0 A;  4Z4I A;  3ZX2 A;  1XHZ A;  1S1U A;  1NBW A;  2W6L A;  3T69 A;  4H8K A;  1Z6R A;  3AVI A;  4AH9 A;  3VF4 A;  3NGZ A;  3LDS A;  2G8V A;  3P39 A;  3AVA A;  1REV A;  4CEQ A;  1E3M A;  5F0X A;  1DT9 A;  3OYF A;  3O9R A;  2NRV A;  3VEW A;  4M42 A;  3A5L C;  3E01 A;  4YOR A;  1VQ9 N;  3H1Q A;  1KRP A;  3M1F A;  3SUP A;  3LP0 A;  4IKF A;  3ULD A;  1KSP A;  5BRE A;  1NGE A;  4MDB A;  3OYC A;  1BWF O;  4WQ4 C;  3VTH A;  4FOE A;  4C23 A;  4NXM K;  1FW6 A;  2PZS A;  1OVY A;  1N32 K;  4JKE A;  1LV5 A;  3MX5 A;  1N8R O;  3TAB A;  1ZC6 A;  2B5J A;  3UKR A;  2ZJR L;  2G8F A;  3AVJ A;  3LP2 A;  5AQL A;  1KTQ A;  2E2O A;  1BDG A;  1BIU A;  1CXQ A;  4EP4 A;  4LFB K;  4AHC A;  1C0M A;  3CD6 N;  3HTV A;  2E5L K;  3CJC A;  2KHO A;  4DSJ A;  3E9L A;  2BH1 A;  1KVA A;  1HJR A;  5HRR A;  4CGF A;  1HYS A;  3SMP A;  3PY8 A;  5AQT A;  1W97 L;  4KI4 A;  1B9F A;  4O4G A;  1DEJ A;  2IDO A;  3CC7 N;  3O8M A;  5FPD A;  1ZYQ A;  2RHK A;  4C8M A;  3D7E O;  1SKR A;  4FYD A;  4FJG A;  2Z1I A;  4QS8 A;  4IDH A;  4BRE A;  2A42 A;  3MXM A;  2HNY A;  3MWT A;  4LH4 A;  3ZSZ A;  5EXW A;  3O3G A;  4Z4G A;  3AAP A;  1LCU A;  2HBM A;  1ZBS A;  4WFB L;  1SZ2 A;  3M8R A;  5AZI A;  2NRH A;  4E1N A;  3V9S A;  4BDP A;  4XH4 A;  5GAH P;  3L3U A;  2VWJ A;  3WNE A;  4OKE A;  4M7Y A;  2E2N A;  5HOO A;  4ILH A;  4E7L A;  1E4G T;  4DCH A;  1U6Z A;  2O8B A;  3C6A A;  3OYK A;  5K14 A;  3HJF A;  4PHT X;  4IWV A;  3S9H A;  2EWS A;  2WC9 A;  2NZT A;  3VGM A;  1VRT A;  2PY5 A;  2KZZ A;  3SMS A;  1FK9 A;  2O8F A;  1VSF A;  2UYT A;  5JIC A;  4DFP A;  5LMU K;  4JRQ A;  1TGO A;  4PA1 A;  3ZCM A;  4DR5 K;  2O8C B;  2E1Z A;  3TU5 A;  3VQ6 A;  3K58 A;  5AQW A;  4DWI A;  4JD2 A;  3ZSR A;  2BAN A;  3HSC A;  4DV3 K;  1BQM A;  2XY6 A;  4CJT A;  4J8F A;  3J7Z O;  1KD1 O;  4I6M A;  1DGK N;  4FLT A;  3AO5 A;  2X78 A;  3PLA A;  1TK5 A;  1NK5 A;  2GTD A;  1ASW A;  2O4I A;  4MLH A;  1Q9X A;  4B1Y B;  4AIL C;  2OZM A;  3KK7 A;  3CFR A;  1HX1 A;  2B4J A;  4CZI A;  3UB5 A;  1KLN A;  2NNW A;  1SL2 A;  4ZTJ A;  4JI3 K;  3H1V X;  4I7F A;  4K43 A;  3PO4 A;  4H0V B;  4JLH A;  3SAF A;  4FZX C;  4CJ4 A;  1VQP N;  4GNI A;  4YOV A;  4CJQ A;  4O8K A;  4CFC A;  3OYH A;  2ZGY A;  4H0P A;  3G4S N;  2ETJ A;  4F9O A;  4DTS A;  3VEN A;  3KK3 A;  3WXJ A;  2FXU A;  3L2Q A;  4DQR A;  4B9Q A;  4CZH A;  2YNI A;  1N6Q A;  1BA0 A;  2QW9 A;  4JKG A;  3F9M A;  4CES A;  3OYD A;  4FVM A;  3IS9 A;  2G8I A;  4HCC A;  1NLV A;  3HM8 A;  1YIT N;  1HPM A;  3P1G A;  3R3L A;  4H5R A;  2HF4 A;  4BE0 A;  4BE1 A;  2YX6 A;  1KCF A;  1XC9 A;  1RBR A;  2DPN A;  3QO9 A;  3V4I A;  3ZT0 A;  4JI8 K;  1T7P A;  4FL9 A;  4FWO A;  3K59 A;  3CCJ N;  4PUO A;  2FSK A;  3QIC A;  2G8W A;  3ZT4 A;  1M1K O;  4CIG A;  1LOT B;  2GUI A;  3WT0 A;  1FKO A;  4AM6 A;  3OYE A;  1HPZ A;  4KH6 A;  4EHT A;  3A8Y A;  3CFO A;  4PY5 A;  1HJO A;  4BAC A;  5AQM A;  4CJE A;  1YHQ N;  3OYA A;  3N4Q A;  1HQE A;  4CGG A;  4W5T A;  1P90 A;  5KQ8 A;  5JS1 A;  3HM9 A;  1L3T A;  1RTD A;  3ZLJ A;  3K5L A;  4FWS A;  4FJ5 A;  2P9P A;  3VQ8 A;  2QXF A;  1F21 A;  2H3G X;  2WON A;  5KI6 A;  4F2S A;  3KK2 A;  1RBS A;  2EHG A;  4GVE A;  4PKG A;  4DR4 K;  2D4W A;  2YHY A;  3NF7 A;  3CG7 A;  1U48 A;  2IIR A;  3O9U A;  4B1V A;  2DTU A;  2Z1J A;  2JLE A;  1DLO A;  3L8B A;  3C0B A;  4FWR A;  2KZM A;  2YNF A;  4DV2 K;  2KW4 A;  3SZ2 A;  3AV9 A;  5E84 A;  3RSE B;  1S1X A;  5CYM A;  3IG1 A;  3O5B A;  4BR0 A;  1N5Y A;  2ASM A;  4IEE A;  4RW4 A;  3VQ9 A;  3ZSQ A;  2OYQ A;  4W5Q A;  1TK8 A;  2JWK A;  3MCA B;  3MED A;  3C7N A;  1BCO A;  5AQJ A;  4M3U A;  4CI6 A;  3V1R A;  3G6E N;  3FR0 A;  4FJX A;  1RBT A;  4QS7 A;  1J54 A;  4DV6 K;  4BE2 A;  1S1T A;  3GE1 A;  3D45 A;  1QZ6 A;  1J5O A;  4B3T K;  1L3S A;  3I0R A;  3U8X A;  5KQD A;  1S6P A;  3D2E B;  4YNQ A;  5AQZ A;  4OO1 J;  3BZC A;  3ZEU B;  1G15 A;  3O3H A;  2FLO A;  4CGH A;  4FPA A;  3LP1 A;  3TAP A;  3R1X A;  4BRN A;  3UE5 A;  1CZA N;  4MLE A;  3CFP A;  5BN9 A;  4DR1 K;  1EP4 A;  2PFU A;  2HHV A;  4CJP A;  2GWK A;  2YHA A;  1JKH A;  3THY B;  3TSP A;  1C0U A;  3QDK A;  4CZE A;  3CC2 N;  1VSI A;  1GOC A;  1NJX A;  2KTQ A;  5LY3 A;  3CMA N;  4CIF A;  1RT7 A;  3HT3 A;  2IS3 A;  2JGU A;  3DLB A;  3NGI A;  3CF5 L;  4AM7 A;  3P5J A;  2P9N A;  4B1X B;  4UQG A;  3RRH A;  5KGX A;  4LSN A;  4CBX A;  1JLG A;  3O4N A;  4KKO A;  1XQS C;  3EKU A;  5BRD A;  4L8R B;  3H46 O;  3RRG A;  2QKK A;  1LWE A;  4DU1 A;  5FRN A;  5AQF A;  1YAG A;  5AQG A;  3LAK A;  1NJY A;  1I94 K;  4O0I A;  2ZE2 A;  3J8A A;  3P38 A;  1J9A A;  4F4K A;  3KVG A;  4GKK K;  1YUW A;  4DV1 K;  4KV8 A;  4ICL A;  4AHR A;  4FZZ A;  3EL2 A;  5AQN A;  2FBX A;  3FZL A;  5M1O A;  1VQ5 N;  4IXC A;  4FJJ A;  3O6W A;  1YJN N;  3CER A;  1NU0 A;  3MN6 A;  3OTO K;  3V81 A;  4B3O A;  2O8E A;  1TAU A;  4DSL A;  4BR9 A;  2QWQ A;  3TAR A;  1QHA A;  4ISG A;  1WBD A;  1GLB G;  4FM0 A;  1VQO N;  1RCH A;  2AA4 A;  1L3V A;  3ZX0 A;  2QKB A;  1UAX A;  4W5N A;  4MO5 A;  3V1O A;  2WFB A;  2Q1N A;  2WBN A;  2ITG A;  2VWK A;  2ASP A;  3HP6 A;  3PUF A;  4GKJ K;  3S41 A;  4DSI A;  3M8S A;  4ZHR A;  3HI0 A;  4KHN A;  3EZ5 A;  4DSF A;  1VSJ A;  2NRZ A;  4CF9 A;  4CHN A;  3KK1 A;  3T3F A;  4CE9 A;  3VA3 A;  1S1W A;  2DFH A;  2W41 A;  4KHP K;  3LAL A;  4RTF D;  2RN2 A;  1RDD A;  3IMX A;  3DLG A;  3M8Q A;  4B1Z A;  4OLB A;  2WOM A;  1TKT A;  1WB9 A;  4M63 C;  4B9U A;  1U4B A;  5ADX A;  1XC3 A;  3QBX A;  3HOS A;  2XY7 A;  3HOT A;  2Q97 A;  3SUO A;  4B9N A;  1IKW A;  1UOC A;  1U47 A;  3DLL L;  4IJA A;  3LWL A;  3K2P A;  3DJC A;  1TVR A;  4J2E A;  4BQZ A;  4FWK A;  1DTQ A;  4BVO A;  4KHQ A;  4NYF A;  3VQ4 A;  3QEX A;  3DM2 A;  2QWM A;  1MDU B;  3VGK A;  1VSH A;  4CJ5 A;  3DXK B;  4XH1 A;  3JAM O;  3V9U A;  3V6D A;  3FE1 A;  1XWL A;  1EXQ A;  4C8L A;  4E0D A;  1GLL O;  4CFD A;  2YNG A;  3OHR A;  1K9M O;  1KVB A;  3V9W A;  3SQ1 A;  4YDU A;  4CF2 A;  2XY8 A;  1HMV A;  1XUP O;  1TKD A;  4EFH A;  4FCY A;  1TAQ A;  1GLD G;  2OPS A;  3SAG A;  3A5O C;  4DQS A;  4B9M A;  4W5R A;  4CJR A;  3MX2 A;  4GV9 A;  3U3G A;  4JI0 K;  5JMV A;  3SBG A;  4F2R A;  4YOU A;  1RT2 A;  1NJW A;  3LM2 A;  3AO2 A;  2E6M A;  2F8T A;  4OPA A;  4OKK A;  3VQP A;  4KHU A;  1U2V B;  4BRO A;  3OW2 M;  4FXD A;  1LAV A;  1BG3 A;  3PIO L;  1E4F T;  3NVK A;  3SQ0 A;  1M90 O;  1GLJ O;  3G0Z A;  4E19 A;  1QTM A;  3I33 A;  2UXD K;  3AA3 A;  1NK7 A;  1BL3 A;  3D0P A;  4HUF A;  1HKG A;  3P83 D;  2WUS A;  4OGC A;  3TI0 A;  1QQO A;  3D2F A;  4CCH A;  4DV5 K;  4I2Q A;  3V9X A;  3A5M C;  3L3V A;  3U4L A;  3LAM A;  5BRH A;  2NRT A;  3KWG A;  2HVI A;  3U9Z A;  3VET A;  1WSE A;  3O3F A;  2P5O A;  4M3Y A;  4IOX A;  4CIE A;  5SWM A;  1NGB A;  3THX A;  1KXP A;  5AZJ B;  2E6L A;  3MMV A;  1MWK A;  2BTF A;  3VMF B;  2A1S A;  1G99 A;  3AAR A;  5AJ3 K;  3BDP A;  3DI6 A;  4FM2 A;  1BHL A;  3CJ7 A;  2FSJ A;  3MN9 A;  1T6D A; 
#chains in the Genus database with same CATH homology
 4QCL A;  3NDK A;  4HUG A;  1TK5 A;  3C6U A;  3DLE A;  1NK5 A;  2O4I A;  1ASW A;  4KHY A;  3ZSX A;  2ATQ A;  3QES A;  1Q9X A;  1RT5 A;  4DU3 A;  3B6O A;  4AIL C;  2OZM A;  4KHW A;  2XRI A;  3DMJ A;  4M45 A;  3CFR A;  1YTU A;  5I3U A;  2B4J A;  1KLN A;  3K5M A;  1SL2 A;  4DTR A;  4ZTJ A;  4KPY A;  4FLY A;  4I7F A;  1T05 A;  4OPK A;  3AVB A;  3PO4 A;  4Z4H A;  4JLH A;  2D5R A;  4FZX C;  4CJ4 A;  4KI6 A;  1S9E A;  4CJQ A;  1HYV A;  3QET A;  4CFC A;  1XHX A;  3HK2 A;  4CK1 A;  3VQ5 A;  4CF0 A;  4K8X A;  1S6Q A;  4JS5 A;  5C24 A;  4ID1 A;  3OYH A;  1RT1 A;  4NCG A;  4DQI A;  4DS5 A;  4ZTF A;  5EU7 A;  2FBV A;  1ZBI A;  1WN7 A;  2ETJ A;  1UA0 A;  4DTS A;  3O4Q A;  3L2U A;  1D9D A;  3KK3 A;  3LZJ A;  2VG5 A;  3AO4 A;  3SV4 A;  4F3O A;  3JYT A;  3L2Q A;  1TL3 A;  1SL0 A;  4DQR A;  4Y1C A;  3L2R A;  4DTP A;  2YNI A;  4CJS A;  3MEG A;  1N6Q A;  1BIZ A;  4OPJ A;  4RW9 A;  4DFJ A;  2HNZ A;  2LSN A;  4CES A;  1I39 A;  3LP3 A;  3OYD A;  4DLE A;  4OLA A;  4FVM A;  3IS9 A;  1BIS A;  2G8I A;  4ELT A;  3NAE A;  4HCC A;  1ZBF A;  2AJQ A;  1WAJ A;  3NGY A;  4HTU A;  2DY4 A;  3MXI A;  3ZSV A;  5E41 A;  3DLH A;  4KTQ A;  3P1G A;  4BE0 A;  1LAW A;  1KVC A;  1LWC A;  1WAF A;  1YTA A;  3AVM A;  4BE1 A;  1NOY A;  1LWF A;  3OYN A;  4N76 A;  2QK9 A;  1KCF A;  1XC9 A;  1RBR A;  1VSD A;  3QO9 A;  3V4I A;  4FJN A;  3ZT0 A;  4H4O A;  1T7P A;  3M8P A;  4FJ9 A;  3RR7 A;  3K59 A;  1TV6 A;  4NYN A;  4O55 A;  3OS2 A;  3DRR A;  1TL1 A;  3NFA A;  3HVT A;  2G8W A;  4PUO A;  5HRO A;  3HO1 A;  5J2P A;  3ZT4 A;  5KRT A;  4N41 A;  4CIG A;  1B92 A;  2GUI A;  1ZBH A;  1FKO A;  3RMD A;  3C6T A;  3OYE A;  1HPZ A;  4ELV A;  3CM6 A;  1LW0 A;  3RMB A;  1FXX A;  3SNN A;  4KRF A;  2KFZ A;  1EX4 A;  1IKX A;  5SZT A;  3KLE A;  4B8C A;  3ISN C;  4LD0 A;  1ASV A;  3CFO A;  4PY5 A;  2HHX A;  1S5J A;  4BAC A;  4FLW A;  4HCB A;  4QOZ B;  4DTM A;  1KFD A;  3ZSY A;  4E7K A;  4CJE A;  1RTJ A;  3KTQ A;  3OYA A;  4K8Z A;  3WNG A;  1BGX T;  1WSH A;  3F9K A;  1HQE A;  4KO0 A;  2O4G A;  4CGG A;  4W5T A;  3HST B;  3QEP A;  3ASM A;  5JS1 A;  3HM9 A;  5J1E A;  1R0A A;  3VQB A;  3HXM A;  5KTQ A;  1L3T A;  1IG9 A;  1RTD A;  2BE2 A;  1T8E A;  3TAF A;  1X9S A;  1BI4 B;  3AA5 X;  3K5L A;  2G8K A;  4CEE A;  1IO2 A;  4W5O A;  1JLB A;  3DLR A;  5HLF A;  4FJ5 A;  2FBY A;  2QXF A;  1F21 A;  2WON A;  4Y1D A;  5KI6 A;  2P51 A;  3VQ8 A;  4E3S A;  4F2S A;  3KK2 A;  1RTI A;  1RBS A;  2EHG A;  2KQ2 A;  3DOL A;  3KKS A;  3VQC A;  4RW8 A;  2VG6 A;  3KLF A;  3TAQ A;  2XO7 A;  4C8O A;  4CFA A;  3NF7 A;  4CHP A;  3CG7 A;  3OJS A;  1U48 A;  3DOK A;  3QEV A;  3PV8 A;  1C1C A;  2DTU A;  5FRM A;  4FW1 A;  1RDC A;  3AVK A;  3V9Z A;  4CHO A;  2Z1J A;  2JLE A;  1DLO A;  1B9D A;  4CGJ A;  2F96 A;  3K5N A;  3L8B A;  2YV0 X;  3RTV A;  4E7H A;  1JLA A;  3PX4 A;  4FJI A;  3KLI A;  2HHU A;  2KZM A;  3L2W A;  1S9G A;  2YHB A;  2YNF A;  2KW4 A;  3SZ2 A;  2ZQB A;  3AV9 A;  4IBN A;  3OY9 A;  2W42 A;  3NF9 A;  4CED A;  4FK4 A;  1S1X A;  2Z1G A;  1WLJ A;  5CYM A;  4CER A;  3SI6 A;  3IG1 A;  3SUQ A;  2GV9 A;  2VG7 A;  4EZ9 A;  4CK2 A;  3RMA A;  2X74 A;  1N5Y A;  4Z4E A;  4R5P A;  4RW4 A;  3VQ9 A;  3ZSQ A;  4ID5 A;  1DTT A;  4LY7 A;  1BCM A;  2OYQ A;  3TAM A;  4W5Q A;  1TK8 A;  4IG0 A;  4C8N A;  4KB0 A;  3MED A;  5HRN A;  3LWM A;  1SV5 A;  4J2B A;  5DK5 A;  3JSM A;  1BCO A;  5JS2 A;  1TK0 A;  4M3U A;  3AA2 A;  4DFK A;  2OPR A;  4DG1 A;  1RT3 A;  3V1R A;  5CY4 A;  3QIO A;  4Z0U A;  3WNF A;  4CEO A;  2G8U A;  5CZ1 A;  1BQN A;  1HNI A;  3AVF A;  3OYB A;  4Q0B A;  4FJX A;  3TWH A;  1RBT A;  3SQ4 A;  1J53 A;  1J54 A;  1S1V A;  4GMJ B;  4CJU A;  3VQE A;  5HRP A;  4BE2 A;  1L3U A;  4O0J A;  1S1T A;  4BDY A;  3NE6 A;  1C6V A;  3D45 A;  2R7Y A;  1J5O A;  4WE1 A;  1SKS A;  1Q9Y A;  3DYA A;  1L3S A;  3I0R A;  1S6P A;  1QQC A;  4M3R A;  4YNQ A;  1C0T A;  3NCI A;  1NKB A;  5J2Q A;  3HP9 A;  1VSE A;  3SPZ A;  3CM5 A;  3HVR A;  1WSG A;  1G15 A;  5KGW A;  3KD5 E;  3QIP A;  4CHY A;  3O3H A;  4CGH A;  1D5A A;  1MU2 A;  3LP1 A;  1C1A A;  3TAP A;  3B6P A;  4FJK A;  4KTW A;  1CZ9 A;  4FLX A;  4FZY A;  4M3Z A;  3CFP A;  1CXU A;  3CQ8 A;  1EP4 A;  3FFI A;  2HHV A;  4CJP A;  4F8R A;  2NUB A;  3F73 A;  5HP1 A;  4DTU A;  1RIL A;  2FC0 A;  2YHA A;  1SUQ A;  1JKH A;  1YT3 A;  1T03 A;  1C0U A;  2YNH A;  1VSI A;  1GOC A;  3TAE A;  1JLC A;  1QHT A;  3AVG A;  4CJF A;  3EY1 A;  4DTO A;  1NJX A;  1YVU A;  1D9F A;  3KLH A;  2KTQ A;  4BWJ A;  4CIF A;  3OYL A;  2G8H A;  1CLQ A;  1A5V A;  1RT7 A;  3HT3 A;  4DF4 A;  5HBM A;  2IS3 A;  2JGU A;  5J2N A;  1RDB A;  3AO3 A;  1JLF A;  1IH7 A;  3DRS A;  3AVN A;  3NGI A;  2HMI A;  3DLB A;  1Q8I A;  1RTH A;  3P5J A;  2DFE A;  3MEC A;  4XIU A;  4UQG A;  3RRH A;  3VQ7 A;  5KGX A;  3HPG A;  2HB5 A;  4OVL A;  4DMN A;  3NBP A;  3QEI A;  1X9W A;  1A5X A;  4LSN A;  5FDL A;  3PX6 A;  2P5G A;  1JLG A;  2D0A A;  1QSL A;  1NK0 A;  4CEZ A;  3O4N A;  4KKO A;  4CF8 A;  3LZI A;  3QNO A;  2P1J A;  4GW6 A;  3MEE A;  4L8R B;  2XHB A;  1L5U A;  2IC3 A;  4MQ3 A;  3RRG A;  3S3O A;  1LWE A;  4LSL A;  4DU1 A;  2HND A;  2DFF A;  4DSE A;  2QKK A;  3SJJ A;  4I9Q A;  4M41 A;  3SUN A;  4IDK A;  3S3M A;  1ZBL A;  5FRN A;  4OGE A;  1VSL A;  4B8A B;  4O44 A;  3LAK A;  3AVL A;  1RBU A;  2X6S A;  4GVM A;  5C25 A;  4CJV A;  3OS1 A;  1NJY A;  4O0I A;  4DFM A;  1RT4 A;  2IAJ A;  2ZE2 A;  3THV A;  4M3X A;  1J9A A;  4B9S A;  5D3G A;  3OS0 A;  4KTZ A;  4F4K A;  2IGI A;  1IKV A;  4LH5 A;  4EZ6 A;  1EET A;  3V1Q A;  4B9V A;  1NK8 A;  4KV8 A;  4ICL A;  3ZSW A;  4AHR A;  3VQD A;  4FZZ A;  4CEF A;  3KKR A;  3LPT A;  3TR8 A;  4CFB A;  2FBX A;  3UIQ A;  4FJJ A;  4O5B A;  2EX3 A;  1WSI A;  4AHU A;  1NK6 A;  4J2A A;  3V81 A;  1XI1 A;  4DTJ A;  4B3O A;  3H08 A;  1I3A A;  3A2F A;  1HRH A;  4AHS A;  1UWB A;  1JXB A;  1ZBU A;  3WNH A;  4CJK A;  3T1A A;  4DSL A;  3TAR A;  3SYZ A;  1GOA A;  4J2D A;  4FM0 A;  3LPU A;  3C94 A;  4CJ3 A;  4JRP A;  4DU4 A;  1RCH A;  1IKY A;  4I2P A;  3KLG A;  1SKW A;  1L3V A;  4FJ7 A;  2QKB A;  4E7J A;  4G1Q A;  1UAX A;  2ZD1 A;  4W5N A;  3V1O A;  1W9H A;  1QSS A;  3K5O A;  1NKC A;  2A1R A;  5I42 A;  3TAG A;  2ITG A;  1NK4 A;  1BI4 A;  4CEB A;  2VWK A;  3AVC A;  3OJU A;  4CJW A;  3C95 A;  3HP6 A;  3PUF A;  1RT6 A;  4DQQ A;  2HHT A;  4QAG A;  4OKJ A;  2D0B A;  3DRP A;  4DSI A;  4FJH A;  3EYZ A;  5CYQ A;  3M8S A;  2PYL A;  4ZHR A;  1VK0 A;  2BGG A;  3S3N A;  4KHN A;  1RBV A;  3ZT3 A;  3EZ5 A;  3AO1 A;  2D0C A;  1CZB A;  4DSF A;  3MXJ A;  4PQU A;  4FLV A;  1TAU A;  1VSJ A;  2OPQ A;  4CF9 A;  4FK2 A;  4KRE A;  3KIO A;  3ITH A;  2Z1H A;  5CZ2 A;  3T19 A;  3MAQ A;  1UA1 A;  2HHW A;  2FBT A;  4CHN A;  3KK1 A;  5DMR A;  3T3F A;  1KFS A;  3VQQ A;  3HPO A;  4KHS A;  2HHS A;  4CE9 A;  3OYM A;  1EKE A;  2OPP A;  3VA3 A;  1S1W A;  1A5W A;  1JXE A;  1TKZ A;  1C1B A;  2DFH A;  3VQA A;  3VN5 A;  3OYI A;  1U45 A;  3NH2 A;  1QSY A;  4Z4F A;  3U6F A;  2X6N A;  3NF8 A;  3LAL A;  4BDZ A;  2XY5 A;  1U04 A;  4FJL A;  4EP5 A;  4CHQ A;  3RWU A;  4CEA A;  3VA0 A;  4Z4I A;  2RN2 A;  1ITG A;  2BDP A;  2RPI A;  1RDD A;  4NCB A;  1XHZ A;  4M3W A;  1S1U A;  1HNV A;  3DLG A;  4B08 A;  1X9M A;  4H8K A;  3M8Q A;  3AVI A;  3SPY A;  1Z26 A;  3ZT2 A;  4AH9 A;  3L2V A;  4B9L A;  4OLB A;  2WOM A;  1D8Y A;  1TKT A;  2B6A A;  3HL8 A;  5KRS A;  3NGZ A;  3LDS A;  1U4B A;  1JL2 A;  4B9U A;  2OZS A;  4IG3 A;  4ELU A;  1WNS A;  2G8V A;  2XY7 A;  4FJM A;  2E4L A;  3AVA A;  1JL1 A;  4M3T A;  1REV A;  4CEQ A;  4OJR A;  4BWM A;  3SUO A;  1NKE A;  4TSX A;  4Z4C A;  4B9N A;  1IKW A;  1UOC A;  3BGR A;  1U47 A;  3OYF A;  1LW2 A;  4M42 A;  3E01 A;  4E7I A;  2HHQ A;  3LWL A;  3K2P A;  4IFY A;  1KRP A;  4F3T A;  1TVR A;  4J2E A;  3ZSO A;  3SUP A;  4N5S A;  3QNN A;  4AHV A;  3NH0 A;  1DTQ A;  3LP0 A;  4FM1 A;  4IKF A;  3ULD A;  4KHQ A;  3QEW A;  5J2M A;  1KSP A;  4NYF A;  3VQ4 A;  4FLZ A;  1ASU A;  1U49 A;  3OYC A;  3ZT1 A;  3DM2 A;  3QEX A;  4DSK A;  4DLG A;  4DF8 A;  3QLH A;  3SQ2 A;  1VSH A;  4CJ5 A;  3SCX A;  4AHT A;  3V9U A;  3V6D A;  3OVN A;  1XWL A;  2PZS A;  2PYJ A;  4E1M A;  1QE1 A;  1LV5 A;  4FJ8 A;  2YKM A;  1EXQ A;  4C8L A;  4DTN A;  4E0D A;  3TAB A;  4CFD A;  2YNG A;  4E89 A;  1KVB A;  5HRS A;  4DQP A;  3V9W A;  4CF1 A;  2B5J A;  4CF2 A;  3SQ1 A;  4HUE A;  1W0H A;  2XY8 A;  3AVJ A;  3LP2 A;  2G8F A;  1HMV A;  1TKD A;  2HW3 A;  1KTQ A;  4FCY A;  1TAQ A;  2OPS A;  4HHT A;  4HVJ A;  1BIU A;  1CXQ A;  2HVH A;  4EP4 A;  4DQS A;  3NH1 A;  4B9M A;  1KLM A;  2RF2 A;  3HYF A;  4AHC A;  1C0M A;  4W5R A;  1VSK A;  1FKP A;  1RNH A;  4CJR A;  3OYJ A;  1VRU A;  4DSJ A;  1KVA A;  4YFU A;  1HJR A;  5HRR A;  3U3G A;  2RKI A;  4CGF A;  4F2R A;  3DLK A;  1O1W A;  3NF6 A;  3AA4 A;  1HYS A;  1JLQ A;  3PY8 A;  4KB1 A;  4IFV A;  4NCA A;  1RT2 A;  1B9F A;  4O4G A;  4KI4 A;  2IDO A;  1NJW A;  2OA8 A;  2IOC A;  3AO2 A;  4CK3 A;  2E6M A;  1ZYQ A;  4RW6 A;  1HQU A;  1WSJ A;  1NK9 A;  3AVH A;  4C8M A;  1SKR A;  4RW7 A;  5C42 A;  2F8T A;  4FYD A;  4FJG A;  3KJV A;  2Z1I A;  4OKK A;  3VQP A;  3RMC A;  4KHU A;  4FXD A;  1LAV A;  3TAN A;  3MXM A;  2HNY A;  1NJZ A;  4LH4 A;  2YKN A;  3ZSZ A;  1VSM A;  5T7B A;  3CYM A;  4CHZ A;  3O3G A;  3SQ0 A;  4Z4G A;  4FW2 A;  3G0Z A;  4E19 A;  3M8R A;  1QTM A;  4E1N A;  3V9S A;  4BDP A;  1HYZ A;  4CJL A;  4JS4 A;  3AA3 A;  3L3U A;  2VWJ A;  3WNE A;  1TKX A;  1NK7 A;  1BL3 A;  3IRX A;  3LAN A;  4OKE A;  4RG8 A;  3D0P A;  4B9T A;  3IAY A;  4HUF A;  3OYG A;  3P83 D;  1RDA A;  4N47 A;  1GOB A;  1NOZ A;  4E7L A;  1X1P A;  4OGC A;  3TI0 A;  3RR8 A;  2Y1J A;  1Z25 A;  4CCH A;  1SL1 A;  4I2Q A;  3V9X A;  2GBZ A;  3OYK A;  5K14 A;  3KD1 E;  3L3V A;  3QIN A;  3I8D A;  3HJF A;  1K6Y A;  3LAM A;  3S9H A;  4N56 A;  2Y1I A;  1VRT A;  1JLE A;  2PY5 A;  3O3F A;  1WSE A;  3ALY A;  2P5O A;  1FK9 A;  4KAZ A;  3I0S A;  2KZZ A;  4M3Y A;  3SV3 A;  4I9L A;  1VSF A;  4CIE A;  1WSF A;  2HVI A;  5SWM A;  3K57 A;  4MFB A;  4DS4 A;  4DFP A;  4JRQ A;  1TGO A;  3G10 A;  4PA1 A;  3ZCM A;  4FK0 A;  3HPH A;  4KFB A;  3VQ6 A;  3K58 A;  4CGI A;  4DWI A;  2E6L A;  2I5J A;  4CGD A;  3ZSR A;  2Q3S A;  3NHG A;  2BAN A;  4C8K A;  4DTX A;  4FLU A;  2A1S A;  2F8S A;  3BDP A;  1BQM A;  2XY6 A;  4CJT A;  3QER A;  5FRO A;  3PX0 A;  3PO5 A;  4PWD A;  3DI6 A;  4FM2 A;  4H4M A;  1BHL A;  1Y97 A;  2KFN A;  4CEC A;  4FLT A;  3AO5 A;  2X78 A;  4Q5V A;  1QS4 A;  3U3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...