1VSMA

Asv integrase core domain in citrate buffer ph 5.0
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
b'GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTEGRASE)
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsmA00
3E01A 4I2QA 3ULDA 3LPUA 3SI6A 3SNNA 1KLMA 1SL0A 4HCBA 4HCCA 3P5JA 2YNIA 4CJWA 3AO2A 3VQ9A 3LPTA 2HVIA 3K58A 1EETA 4DQSA 4E3SA 3QIOA 4E7HA 3RMCA 4O55A 3L2QA 1U49A 3KLHA 3IS9A 2DFHA 4CERA 1ZBIA 2O4IA 3S3NA 2HHQA 1FKPA 3ASMA 3PX0A 4JS4A 5HLFA 4KKOA 3OYAA 1U04A 4CF2A 3K5MA 3V81A 3M8SA 1FK9A 1WLJA 1WSEA 3S9HA 2KTQA 2RN2A 5K14A 3ZSVA 2GBZA 3U6FA 4C8OA 4FJ7A 4CF8A 4O0IA 4CGIA 4AHSA 3AO3A 3RMDA 3TABA 1RT5A 3DRRA 4NYNA 3OYJA 3ZSRA 3HO1A 1RTIA 1Y97A 1ZBFA 1RDAA 2Z1IA 4DTRA 4DSLA 4FCYA 3NGIA 3KTQA 2IAJA 1BISA 2HHUA 3NDKA 4CHPA 3L8BA 3SV3A 3QNNA 4HUGA 3SV4A 3JSMA 3VQQA 4CE9A 2QK9A 4E7LA 1TAQA 3KD1E 1C6VA 1S6QA 3NF7A 3PO4A 4OPKA 1YVUA 1LWFA 4JRPA 4OPJA 1D5AA 2Z1GA 4DFJA 1X9SA 1WSJA 2A1SA 1FXXA 4AHRA 3CFPA 3LZIA 4BDZA 4MQ3A 3WNGA 1Q8IA 3IG1A 3MEEA 3B6PA 1VSEA 4DS5A 1VSKA 1YTAA 4DTNA 3IRXA 2PZSA 1T8EA 1C0TA 3CFRA 2LSNA 3L3VA 2I5JA 4FLZA 3KKRA 2X6NA 4CFAA 1KLNA 5SWMA 3ZT2A 4CJ5A 3VQCA 3LANA 4OKKA 2ITGA 2VWJA 4KTWA 4FZZA 4ZHRA 4NCBA 1NJXA 3AO1A 1HNIA 1RBTA 4IDKA 4E1NA 4DTUA 2GV9A 3SUOA 5CYQA 3CFOA 4DG1A 4H4OA 1J54A 1QS4A 1WSGA 1FKOA 4FJGA 1S1XA 3HK2A 1KVBA 3I0RA 5J2PA 3L2WA 3V9WA 1ZBHA 5C42A 2P1JA 4JS5A 2XY7A 4Z4EA 2OPQA 1X1PA 1JLEA 4KHSA 4FXDA 3THVA 2D5RA 2IGIA 4KREA 2EX3A 4RW7A 4HUEA 3DMJA 2D0BA 4CEOA 1JLQA 1KSPA 2DY4A 1HRHA 3OS2A 3O4QA 1N6QA 2OA8A 2FC0A 3L2UA 4B9TA 3WNHA 4LY7A 3OYDA 3AVMA 1HQUA 1B9FA 3LP0A 4M3UA 3SCXA 3TAMA 3CM5A 4ELUA 1XWLA 4Z4IA 5JS2A 1T03A 2G8WA 3RR8A 5HRNA 4M3RA 1QSLA 2HHWA 2XY8A 3SPYA 4AHCA 2PYLA 4B9UA 1WSIA 2XY6A 4C8LA 4M3YA 3SZ2A 4Z4GA 4Z4FA 1A5VA 2AJQA 1L3UA 4CEAA 4UQGA 1BQNA 4BACA 3UIQA 4ICLA 4E1MA 3V9XA 3V9SA 4KHWA 3CG7A 4W5QA 3QEXA 2HMIA 4DSIA 2YNFA 4BE1A 3ZT4A 4CK1A 4HVJA 1J5OA 5SZTA 3TAEA 1D8YA 1W9HA 3O3HA 3NBPA 4LH4A 1XC9A 3D45A 3VQBA 2O4GA 4CEZA 1RILA 3SYZA 5J2QA 1F21A 1ITGA 5CY4A 4FK4A 3V9ZA 3U3GA 3P83D 2B4JA 3HXMA 4NCGA 4BE0A 4PY5A 4KV8A 1C1AA 1LAWA 3QINA 3DLGA 4IFVA 5EU7A 4W5RA 1RDDA 4BDYA 1CZ9A 3OYLA 3AVCA 4IFYA 3NAEA 1WAFA 4FJXA 2OPRA 4FZYA 1CZBA 1NK4A 1S1VA 3QO9A 3MXMA 1X9MA 4B8CA 3PO5A 4MFBA 1EXQA 1LWEA 4CJ3A 4KAZA 1VRTA 3LP2A 1IG9A 1I3AA 3C94A 4FJHA 2BGGA 1YT3A 4FVMA 1RDBA 2BE2A 4CJRA 3OYNA 2HVHA 2RKIA 3NGYA 1IKWA 3TR8A 3ZSYA 3NH0A 1DLOA 1QSSA 4FYDA 4DQRA 4DSFA 1TAUA 1I39A 3BGRA 1LAVA 1TL3A 3H08A 3ZSWA 3SUPA 1HYSA 4CFCA 4FJJA 1HYZA 4CCHA 4CFBA 4Y1CA 4AHVA 4DS4A 4IKFA 5JS1A 1RNHA 3DLRA 4JLHA 3K59A 3V6DA 1NK5A 4Q5VA 4OJRA 1GOCA 3EZ5A 4K8ZA 3QEWA 2P5OA 3S3MA 4OLAA 2XRIA 1SL2A 4DSEA 3G0ZA 2A1RA 2D0AA 3VQ5A 1S1TA 4ELTA 1BIUA 2YKMA 1LW2A 5I3UA 3ZT3A 3DLHA 4LH5A 1L3TA 3TAQA 3TAFA 2HHSA 1QHTA 3AA5X 1NK9A 2XO7A 2VG6A 5J1EA 3NE6A 1IKXA 3ZSQA 4FLYA 1K6YA 2HHXA 1RBVA 3DOLA 2IDOA 2QXFA 2FBYA 1RBUA 2WOMA 3F73A 4W5TA 1NK8A 1N5YA 4F2RA 3HSTB 3DOKA 1GOBA 1A5WA 2ETJA 3AVAA 1B9DA 3FFIA 4DTJA 1UA0A 4FJIA 3JYTA 4PUOA 4F8RA 3AVLA 2QKKA 4J2DA 1S1WA 1BL3A 3DYAA 2DFEA 4AH9A 2FBXA 4DTXA 3LAKA 4IBNA 2OYQA 3NHGA 3AA4A 4M3WA 1RT4A 1VSIA 2F8TA 3MXIA 4LSLA 3LAMA 1EKEA 1TKDA 4KHQA 2HB5A 2NUBA 4FW1A 1A5XA 4KFBA 1NKBA 4FJLA 1WAJA 2KQ2A 4FM1A 1Q9YA 3AVGA 5FRMA 3QLHA 5FRNA 1TK0A 3PUFA 1SKWA 3CQ8A 1L5UA 1TKZA 1KFSA 5DK5A 2Z1JA 1NOYA 4CEBA 3NH1A 4B08A 1NK0A 1U45A 3AVHA 3SQ4A 2ZQBA 4I7FA 3VN5A 1JXEA 4PA1A 3LDSA 2YHBA 1TKXA 2HNDA 4DTOA 2FBVA 3C6UA 3OYMA 3ZCMA 1RBSA 1C0UA 1VSLA 4FZXC 4FJ9A 1VSMA 2YHAA 2X74A 3V9UA 3QEVA 4DSKA 4DQQA 4CGJA 1ZBLA 1EP4A 3VQ6A 1L3SA 3PX6A 3QIPA 3KLFA 1DTTA 2Z1HA 3OYEA 3MAQA 4KTQA 2G8HA 4DF4A 5DMRA 4CEQA 3C95A 4DFPA 3QERA 1J9AA 4AHTA 5C24A 1JL2A 2ATQA 1RTDA 1QE1A 3QEIA 3F9KA 1BCMA 3KK2A 3PY8A 4BE2A 3L2RA 4BDPA 2Y1JA 4I9QA 4IG0A 2QKBA 4F4KA 3LWLA 3OYBA 1RTJA 4NYFA 1XHZA 4DQIA 4RG8A 1HQEA 1GOAA 4O0JA 4QCLA 1IKVA 4C8NA 4LD0A 4L8RB 4KHUA 4Z0UA 4Z4HA 4DWIA 1RT3A 1NK6A 1MU2A 1TKTA 4KHYA 1LW0A 3O4NA 3DLBA 3PX4A 1J53A 4KB0A 4FLUA 4J2EA 3QESA 3CM6A 2X6SA 4B9VA 3ITHA 3DRPA 4OKEA 4M3TA 3OYGA 1ZBUA 4CJLA 2JLEA 1NKCA 2YV0X 3V4IA 1Z25A 2JGUA 4KTZA 3EYZA 3HP9A 5HP1A 3AVKA 2YKNA 3ZSOA 4GMJB 5HRSA 2Q3SA 1WSFA 3VQ4A 4XIUA 4QAGA 2HNZA 4CESA 4DTPA 2P5GA 3L3UA 3OS1A 3VQDA 1LV5A 3BDPA 4CF0A 3A2FA 4GW6A 3HT3A 3KK3A 2E6MA 4AILC 1ZYQA 1Q9XA 1HPZA 3O3GA 1TV6A 1NJWA 4FJMA 3NF8A 1C1BA 3LWMA 4FK2A 3K5OA 3DLEA 2YNGA 2DFFA 2PY5A 4ZTFA 4DU4A 2XY5A 4M3ZA 4DMNA 3HM9A 5CZ1A 3CYMA 1RT6A 4IG3A 4CF9A 3OVNA 4KI4A 5D3GA 3KLIA 4C8MA 2YNHA 1TGOA 4WE1A 3KK1A 2KFZA 4K8XA 2ZE2A 2FBTA 3K2PA 3KD5E 3OJSA 1T05A 4F3TA 3AVFA 1XHXA 4KPYA 3ISNC 2E4LA 4CIGA 4CEEA 3LZJA 4QOZB 2HW3A 3HJFA 3SPZA 5HROA 4RW6A 1RBRA 1R0AA 4FM2A 3U3YA 4N76A 1IO2A 1IKYA 1U48A 4FJ5A 2BANA 3M8PA 4B9MA 5FROA 3OYIA 4M45A 3K57A 4TSXA 1BGXT 4RW4A 4CHNA 3OYKA 3QNOA 2P51A 1W0HA 4E7JA 1B92A 4YFUA 4AHUA 4FLTA 3AO5A 1VSJA 3KKSA 4HHTA 1VSFA 4HUFA 2XHBA 1SKSA 3LALA 2VWKA 5KRTA 1BI4A 4DLEA 1RDCA 3DI6A 4CJVA 4B9SA 4J2AA 4FLWA 3HPHA 4CGHA 2OPPA 4CK3A 4CK2A 4E7KA 1D9DA 1NOZA 3AV9A 3RMBA 4CEDA 4PWDA 1Z26A 2KW4A 3NH2A 1BQMA 1SV5A 4CIEA 1QQCA 4YNQA 2OZSA 1T7PA 3TWHA 4W5NA 3TAPA 4EZ6A 2ZD1A 4FLXA 3HPGA 4DTSA 3V1QA 2DTUA 3RMAA 3T1AA 3DLKA 3EY1A 4CGDA 5J2NA 5HRPA 2G8KA 4N5SA 4EP5A 4OLBA 1YTUA 4CHQA 4N41A 1KVAA 4DLGA 5KGXA 1HMVA 3VA0A 3I8DA 4BWJA 3VQAA 1NJZA 5HBMA 4FLVA 1KCFA 1NJYA 1RCHA 2D0CA 1CXQA 2VG5A 3M8RA 2R7YA 4DQPA 1BCOA 3I0SA 3RWUA 4RW8A 1UAXA 1ASVA 5CYMA 4EZ9A 4F3OA 1VSDA 1U4BA 3OYCA 1HYVA 2B5JA 1REVA 4B8AB 3G10A 3KLEA 5HRRA 3TI0A 3LP1A 4CHYA 1HNVA 4M3XA 4ZTJA 4FK0A 1SUQA 3ZSXA 4M42A 3MECA 1KFDA 3V1OA 1JLGA 2IS3A 4OKJA 5CZ2A 2KZZA 3TAGA 1D9FA 1O1WA 3NFAA 3K5LA 2HHVA 4ID5A 4CJUA 3KLGA 3P1GA 2E6LA 4CJSA 5C25A 1BHLA 3AVBA 4CJFA 4E19A 3OY9A 2IOCA 2VG7A 3HP6A 4I2PA 3PV8A 2X78A 5I42A 3RRGA 1BI4B 3VA3A 4B9NA 4FJKA 1S5JA 3QETA 2G8FA 4FJ8A 3AVIA 4PQUA 4OGCA 3M8QA 2WONA 3RRHA 4DF8A 4GVMA 3ZT0A 4Z4CA 2KZMA 3MEGA 4E89A 3T3FA 3MEDA 4FM0A 3HVTA 1ASWA 1IH7A 3AO4A 4CEFA 4DFKA 1DTQA 3AA2A 2F96A 3B6OA 1LWCA 4CHZA 1JLFA 1G15A 3ALYA 4CGGA 3DRSA 1UWBA 4ELVA 3SQ1A 3HYFA 3DM2A 1UOCA 3RR7A 1RTHA 4O44A 4CJTA 2BDPA 4C8KA 3VQEA 3MXJA 4H8KA 2OPSA 4HTUA 4CJPA 1JLCA 3HL8A 4Q0BA 4KRFA 4LSNA 4EP4A 4KB1A 3HVRA 2GUIA 4B9LA 4N56A 1QSYA 1ASUA 1S9EA 4CHOA 2IC3A 1UA1A 3SQ0A 3AVNA 5E41A 1TK5A 5KI6A 3KJVA 3KIOA 4CJ4A 4N47A 2Y1IA 3RTVA 2G8IA 1WNSA 1TK8A 4E7IA 1X9WA 3AA3A 4DU3A 3ZT1A 2G8VA 1VK0A 2RPIA 4R5PA 3NCIA 1S1UA 3C6TA 4H4MA 4F2SA 5J2MA 2HNYA 3IAYA 3L2VA 2OZMA 1C0MA 3T19A 4CGFA 1L3VA 1HJRA 1JLAA 4G1QA 4DSJA 4FW2A 4CJEA 1SKRA 1VSHA 3S3OA 3LP3A 4KHNA 4B3OA 4OVLA 1C1CA 3OS0A 1JL1A 2HHTA 3V1RA 3OYHA 4DU1A 4I9LA 3O3FA 4JRQA 1NKEA 4CIFA 1NK7A 4RW9A 3VQ8A 5KTQA 2EHGA 4OGEA 5KRSA 1TVRA 1SL1A 4Y1DA 1JXBA 3SUQA 1RT1A 3OYFA 3NF6A 2RF2A 3NGZA 2F8SA 3TANA 3ZSZA 3TARA 1QTMA 4W5OA 1WN7A 3D0PA 2KFNA 4O5BA 1BIZA 3K5NA 4CECA 1RT7A 4NCAA 4O4GA 4CJKA 3VQ7A 1JLBA 4CFDA 4DFMA 2W42A 3NF9A 1VRUA 4ID1A 3HPOA 3SJJA 2B6AA 5KGWA 1XI1A 1U47A 3SQ2A 1RT2A 4KO0A 1EX4A 4KI6A 1KTQA 1S6PA 3AVJA 4DTMA 1CXUA 1TL1A 4J2BA 5T7BA 1CLQA 3OJUA 1KRPA 4M41A 1KVCA 2G8UA 4FJNA 3WNFA 3QEPA 4E0DA 4BWMA 1JKHA 4CF1A 5FDLA 3WNEA 3SUNA 1WSHA 4CJQA 1S9GA 3VQPA 2PYJA
chains in the Genus database with same CATH superfamily
4BR5A 3KVGA 4I2QA 3ULDA 3VQ9A 1K9MO 4JV5K 4JI6K 1EETA 3QIOA 3RMCA 3SK3A 1MWMA 5HLFA 3RRGA 4JK8A 1FK9A 1WLJA 1WSEA 3C6AA 3L4IA 3U6FA 5BRFA 5LJWA 1XMQK 3AO3A 3RMDA 1RT5A 1Y64A 1KAZA 3HO1A 1ZBFA 1Y97A 1ESVA 4NO7A 1RDAA 4ILJA 2QA4N 3NGIA 4WQ5C 2IAJA 3KTQA 2V7YA 4CHPA 3IUCA 3QNNA 4HUGA 1Q7YO 2NRRA 3WXJA 1KC8O 4CE9A 1YJWN 4YOTA 4NLCA 5AQNA 1QVFM 3CFPA 2FSKA 5KPTA 3IG1A 1VSEA 1YTAA 5AJ3K 4BGBA 3A0IX 4X64K 2LSNA 5EY4A 1V4TA 4FWRA 4FLZA 4CFAA 4CJ5A 3SJHA 3VQCA 5C2DA 3U9DA 1NJXA 1SZ2A 4E1NA 4B1XB 2GV9A 2P9LA 5CYQA 5JLHA 4DG1A 1GLLO 4FJGA 1ZBHA 2XY7A 4Z4EA 4BG8A 4BRQA 1X1PA 4FXDA 2IGIA 3CJCA 2DY4A 3O4QA 1S3XA 1N6QA 3R9PA 4B9TA 4LY7A 4LFCK 3AVMA 1HQUA 1ILYA 3LP0A 4M3UA 3CM5A 4LF7K 2XY8A 2PYLA 4BQLA 5AZJA 3QBXA 3SZ2A 2UXCK 4Z4GA 3THXA 1E3MA 4UQGA 1BQNA 4B3MK 4E1MA 3V9SA 4KHWA 5C0YA 4CK1A 4K42A 5SZTA 4O8UA 3AAPA 5DM7L 4H0PA 3VQBA 3J7YP 4JKEA 3VEWA 3SYZA 5J2QA 1F21A 5LMUK 5CY4A 2VYPA 4BR0A 3V9ZA 3U3GA 4A2AA 3QINA 3DLGA 1XC3A 3GG4A 3AVCA 4CZEA 5LL6Z 2UU9K 4FWOA 1WAFA 5GAGP 1DT9A 1SS6A 1T3VA 3JAMO 2BE2A 4CJRA 3OYNA 4FYDA 4DR5K 3SUPA 4KHPK 1MDUB 4CFBA 1RNHA 2ZWHA 1OH6A 3D7EO 3H3OB 3V6DA 4K8ZA 5AZJB 3QEWA 3A5LC 4LFAK 2XRIA 1SL2A 2P9SB 4DSEA 2A1RA 2YJEA 1BIUA 5I3UA 3THWA 1W97L 3HSCA 2IDOA 1NK8A 2UUAK 2QW9A 1WOQA 4PUOA 2QKKA 1S1WA 4BRHA 2DFEA 4DTXA 2F8TA 4LSLA 1TKDA 4KHQA 4X66K 2HB5A 4FJLA 2PBDA 1KQSM 4KH4A 4FM1A 3QLHA 1TK0A 3PUFA 4IXCA 1SKWA 1TKZA 5BPMA 3EZWA 3NH1A 4IEEA 1U45A 3I33A 1YF5L 1U6ZA 3LDSA 2AP1A 1TKXA 3C6UA 3VF2A 3PIOL 1VSLA 5M1QA 4FZXC 1QZ5A 3LDLA 1VSMA 5M1PA 3VQ6A 1L3SA 3GOIA 4K43A 4YY3K 2G8HA 5I9EB 4A61A 4CEQA 4DV5K 4AHTA 2ATQA 3W3DA 1QE1A 3THWB 3F9KA 3OTOK 1BCMA 3ATUA 5ELZA 4BC5A 2Y1JA 2QKBA 4EAHD 5LMNK 3LWLA 4DV2K 4F4KA 4RG8A 1HQEA 4EHTA 5FPEA 4FWPA 2HOEA 4LD0A 4L8RB 4KHUA 4Z0UA 4DWIA 3WXKA 1J5EK 1TKTA 3EL2A 1LW0A 3QBWA 4Z94A 3I56N 3VEYA 4CBXA 3CM6A 2X6SA 1N8RO 4B9VA 3ITHA 3H1QA 4OKEA 1X3MA 4ISGA 1OKJA 2Q36A 1Z25A 4KTZA 3HP9A 3AVKA 4KBOA 4GMJB 2WC9A 5HRSA 3RSEA 3CCQN 4XIUA 3L3UA 3E1YA 2NRXA 4AILC 5AQOA 4IZ9A 5EX5A 1NJWA 3BZCA 4FJMA 1C1BA 3LWMA 2YNGA 1M90O 3ATVA 2DFFA 4LC9B 4ZTFA 3JS6A 3HM8A 4DU4A 2XY5A 1D4XA 5E84A 3HM9A 2YNHA 1TGOA 4C1NI 2KFZA 2ZE2A 2FBTA 1T05A 3AVFA 2E4LA 4YOXA 5CHIA 3SPZA 5C15A 4FM2A 4FJ5A 3OYKA 4RW4A 3QNOA 3G25A 3EEQA 3MX5A 4ILGB 4H5RA 1VSFA 2XHBA 2W40A 3ZYYX 4CK3A 4E7KA 2KKZA 3RMBA 1NGFA 2GTDA 4DR2K 5BN8A 3WEEA 3TWHA 4NXNK 3HPGA 2VQEK 2DTUA 4J8FA 5AQWA 3EY1A 5HRPA 4EP5A 1ATRA 2OTJN 4CHQA 1C0FA 1VQ7N 5GADP 1HMVA 5AQTA 3VA0A 3I8DA 3VQAA 2A41A 4FLVA 1KCFA 1NJYA 1RCHA 2FSNA 3UE5A 2R7YA 1BCOA 1OH8A 3B8AX 3RWUA 5CYMA 3WQTA 3OYCA 2W6KA 4BVOA 1SUQA 3BP8A 5F1XA 1KFDA 2IS3A 3E9OA 2CGJA 3QMLA 5AQSA 1D9FA 3NFAA 3K5LA 3U8XA 4CJUA 3P1GA 2E6LA 4BRKA 4CJFA 3OY9A 2IOCA 1VQKN 2X78A 4B9NA 3VA3A 2G8FA 4PQUA 4DF8A 3MEDA 3AO4A 4CEFA 1Z6RA 4DFKA 1ZBSA 2CH6A 1LWCA 1NM1A 5AQLA 5FPDA 1JLFA 4DR7K 1G15A 3ALYA 3PSIA 4JHDA 3HYFA 3DM2A 4PKHA 1UOCA 4O44A 4CJTA 2YHYA 3DXKA 4H8KA 4HTUA 4CJPA 1JLCA 2NRZA 3BF3A 2GUIA 3D2EB 4N56A 2IC3A 5KI6A 3KJVA 4I6MB 1KD1O 2Y1IA 1TK8A 1X9WA 3A8YA 2RE2A 3ZT1A 2RPIA 3NCIA 1S1UA 4F2SA 4BREA 5J2MA 5BRDA 2YHWA 4WQ4C 4B1UB 4PL7A 3VGLA 4OVLA 3OS0A 1BWFO 2V7ZA 5F2RA 3V1RA 3SMPA 2DPNA 4CZJA 1KXPA 5EVZA 2P9KB 3UKUA 1YVNA 4Y1DA 1NGEA 3SUQA 4BRCA 2GUPA 2E1ZA 4H5TA 2RF2A 2F8SA 3TANA 1QTMA 4DUYK 3TARA 3D0PA 2KFNA 5A2QO 1BIZA 3FZFA 3VQ7A 1JLBA 4CFDA 2W42A 4ID1A 3HPOA 3ID8A 3SJJA 1XI1A 4KO0A 3TTFA 1KTQA 4L3QA 1VQNN 3MWTA 1TL1A 3DXKB 3KHYA 3HRGA 3WNFA 3QEPA 4E0DA 3WNEA 3EN9A 4MLHA 3VQPA 4X62K 4HCBA 5CR4A 1IBMK 4HCCA 4CJWA 3AO2A 3LPTA 4YOWA 3K58A 2HVIA 3IFRA 4E7HA 1U49A 1K8KB 4ILHA 4IO8A 3IS9A 2BTFA 2DFHA 2HHQA 3S3NA 3ENBA 3FLCO 4JS4A 3MN6A 3OHRA 2WTUA 4KKOA 2W6LA 1U04A 3K5MA 3S9HA 2RN2A 4B3SK 1ATNA 4FJ7A 4CF8A 2YHXA 3TABA 3DRRA 3OYJA 4DTRA 1C0GA 3UKUB 3H1VX 1BDGA 3EO3A 1TAQA 3PO4A 3VGKA 1BU6O 4OPKA 2WUSA 4BRNA 4ISFA 5AQIA 1OH5A 1X9SA 5AQPA 3J81O 4AHRA 4BDZA 1NBWA 1Q8IA 4DS5A 1C0TA 1YXQA 1Q81O 1XNQK 3L3VA 4LF9K 3KKRA 1Q86O 2X6NA 1KLNA 1T6DA 4OKKA 2VWJA 4FZZA 3HOSA 2E8AA 3AO1A 4DTUA 4H5VA 4IDKA 1J54A 5CE3A 3WUHA 3HK2A 1KVBA 5M1NA 2OPQA 1JLEA 1DGKN 4KHSA 2O8CB 3THVA 1YI2N 2EX3A 3CD6N 4CEOA 2D0BA 1JLQA 3OS2A 1NU0A 4WYBA 4FL9A 3L2UA 3OYDA 4DQ8A 1B9FA 2FLOA 4NB4A 3TAMA 3SAGA 4AQYK 4ELUA 4Z4IA 2ZJRL 3EKUA 1T03A 2G8WA 5HRNA 4M3RA 4X65K 3O4WA 1HKGA 3SPYA 4B9UA 1XNRK 2JWKA 5FLXO 1BA0A 1TUYA 4CZKA 3VF4A 1GLFO 4Z4FA 1A5VA 4JNEA 1LCUA 2AJQA 4YDUC 2QWLA 3QEXA 2YNFA 3K9KA 1XMOK 4NLBA 4HVJA 3A5OC 1XC9A 3UKRB 4MDBA 1NGDA 2ITMA 1ITGA 2YCHA 2VGMA 2B4JA 4IFVA 3IMXA 1CZ9A 3NAEA 3FR0A 4FZYA 3R8EA 1CZBA 3LM9A 3CCRN 1N34K 4EFHA 4B8CA 4DV4K 4CJ3A 2BUPA 1VRTA 2D1KA 3C94A 1U2VB 1YT3A 4FVMA 4DR4K 1RDBA 3NH0A 3BUZB 1QSSA 4DQRA 1TAUA 3FZMA 3H08A 3TTDA 3CERA 1VHXA 4CFCA 4Y1CA 4IKFA 5JS1A 3DLRA 4JKAA 3K59A 3IKMA 1GOCA 3FE1A 3S3MA 1QHAA 4ELTA 3DLHA 3D6RA 3ZT3A 4LH5A 3A5NC 4Y0WA 1L3TA 1NK9A 3NE6A 2JWLA 4IDHA 2HHXA 3DOLA 2QXFA 4F2RA 1GOBA 1A5WA 1UA0A 3BF1A 3MN7A 4B3TK 3DYAA 4AH9A 3AA4A 1VSIA 3LAMA 4KFBA 4FW1A 1P90A 4IO9L 5FRMA 3AVGA 5FRNA 3CQ8A 2QWMA 5DK5A 4F9OA 4PA1A 1VQ6N 2I7NA 2P9NB 1VQMN 3C65A 1C0UA 3ULEA 1X9JA 4H5WA 4FJ9A 2YHAA 3IDHA 3SLCA 4DQQA 1ZBLA 3OYEA 4KTQA 1OVQA 4DF4A 1I94K 3KK2A 1O13A 3LDQA 4IJNA 3L2RA 4BGAA 4IG0A 1RTJA 4IEIA 4C8NA 1GLAG 2AA4A 1HJOA 2KLAA 1EWRA 4M7XA 2VQFK 3O4NA 2P9SA 3PX4A 1QQMA 4KB0A 2P9UA 3DRPA 4M3TA 3OYGA 1ZBUA 4CJLA 5IWAK 1NKCA 4CW7B 2GWKA 3VGMA 3EYZA 5HP1A 1K73O 4JK7A 5AQXA 3ZSOA 2HSTA 3VQ4A 4CESA 2HNZA 2P5GA 3OS1A 4PHTX 3BDPA 2E6MA 1Q9XA 1HPZA 3N4PA 3O3GA 3ULEB 3CQYA 2OANA 3NVKA 3VEOA 4GNIA 2PY5A 5AQFA 4DMNA 4CF9A 5D3GA 1TUUA 2HBLA 3KK1A 2ZF5O 3R3LA 1IBLK 1XHXA 4KH5A 2HW3A 3PIPL 5HROA 1RBRA 1R0AA 4O5FA 2YI1A 4B9MA 3KWIA 5FROA 4M45A 3K57A 4DV0K 4CHNA 2P51A 3O9SA 4WFNL 3CCVN 1W0HA 4YFUA 3TU5A 2O8EA 2CGKA 3AO5A 5MLCQ 1SKSA 3LALA 2VWKA 1RDCA 4B9SA 4RTFD 3E9LA 4H0TB 2OPPA 5AQJA 2O8FB 4CK2A 1VQ9N 1D9DA 1NOZA 2P9UB 4CEDA 4LF6K 1BQMA 2QI2A 1SV5A 4CIEA 4YNQA 2OZSA 1T7PA 3TAPA 2ZD1A 3O9TA 4FLXA 1SAZA 3DLKA 2G8KA 4JI0K 1RFQA 4YHHK 5B8HA 4WFBL 5EOYA 4OO1J 1QQNA 5HBMA 2O8BB 3T7ZA 2VG5A 3SMSA 4DQPA 3I0SA 4A59A 4K41A 4EZ9A 1ASVA 4F3OA 3FFKB 3C7NB 3KLEA 3TI0A 3G10A 5HRRA 2CH5A 3ZSXA 4M42A 2VCPA 1W2BM 1O1WA 2HHVA 4ID5A 5BR8K 4CJSA 5C25A 3MDQA 1BHLA 3AVBA 4BRPA 2O8EB 4E19A 5I42A 3HP6A 3K9JA 3QB0A 3ID6A 1RDWX 4FJ8A 1NGAA 3M8QA 3MEGA 4IOXA 5KQ8A 1DTQA 2F96A 3MMVA 5C10A 1N36K 4KH6A 4CHZA 4CGGA 4ELVA 3OBYA 3P31A 1CZAN 5F0XA 3RR7A 5DM6L 3MXJA 2ZGZA 2OPSA 3HL8A 3QICA 2D4WA 4EP4A 4KB1A 3HVRA 1NJIO 2V52B 4B9LA 1ASUA 2QWOA 3ZEUA 2J4RA 3FZLA 2E2PA 3KIOA 4CJ4A 5EXWA 3L6QA 4E7IA 4IJAA 4R5PA 2HNYA 3L2VA 4CGFA 4BC4A 4GV3A 3CCUN 4DSJA 3CHWA 4FW2A 4CJEA 1SKRA 3S3OA 4BRGA 4KHNA 3LDPA 1WBDA 4A5BA 3R6MA 3SAHA 3O3FA 1NKEA 4OPAA 1NK7A 4RW9A 3VQ8A 2EHGA 3VEVA 3CETA 4FWLA 3G71N 4LF5K 4QS7A 4CBUA 2Q31A 3TSQA 3NGZA 1WN7A 4MO5A 4BRDA 4O4GA 4CJKA 1JJ2M 5JICA 1VRUA 4BR7A 1Q18A 3O9QA 1MA9B 1ZXOA 3JXUA 1EX4A 3O6WA 4BY9C 1HX1A 3S41A 4J2BA 2UYTA 1KRPA 2G8UA 4CF1A 5FDLA 1WSHA 3SBGA 3E01A 3ZEUB 1SL0A 1W7AA 1KLMA 4EIAA 2ASPA 4A57A 3P5JA 2NNWA 4BRFA 2ZJPL 4E3SA 1WUAA 3L2QA 1VAZA 3KLHA 4CERA 1ZBIA 2O4IA 3J8AA 1FKPA 2QTDA 4H0YB 5JLFA 3OYAA 3V81A 2KTQA 2GEMA 3LM2A 5K14A 2GBZA 4O8KA 4C8OA 2NZTA 3D2EA 4AHSA 2ASOA 5LY3A 4NYNA 5AFUH 3ZSRA 1RTIA 4I6MA 2Z1IA 4DSLA 2HHUA 3NDKA 4JKCA 3L8BA 1HNWK 3SV3A 4WQ5A 3JSMA 1BOTO 3VQQA 4CBWA 3THYA 3KD1E 3Q7CA 4DHYA 4OPJA 2Z1GA 4DFJA 1WSJA 1FXXA 4MQ3A 3WNGA 3B6PA 2F4VK 1VSKA 5AFUA 3CFRA 2P9KA 1FW6A 2FXUA 4B9QA 4CZHA 2I5JA 5AZIA 1J6ZA 3ZX2A 3TPQA 1IBKK 3ZT2A 5FPMA 2UUBK 4JKGB 1N33K 4ZHRA 4NCBA 3SUOA 2E2NA 1QS4A 1FKOA 3I0RA 4GY2B 3V9WA 1IJJA 5C42A 2P1JA 1Q82O 5FPNA 4CZGA 3LL3A 2QWQA 4M63C 4RW7A 3CCLN 3DMJA 3H3NO 4CZLA 3CCSN 2BH1A 1QQOA 2OA8A 5C12A 1EWQA 4JI8K 3SCXA 4DR1K 2OCEA 1K8KA 5JS2A 3RR8A 1QSLA 3THYB 3GDQA 4C8LA 1DKGD 1L3UA 4CEAA 4ICLA 3V9XA 4DV6K 4W5QA 2HMIA 1J5OA 1W9HA 3O3HA 3NBPA 5AZIB 4CEZA 3CF5L 2A3ZA 4FK4A 2D0PA 4JI5K 3HXMA 4BE0A 1LAWA 4W5RA 5EU7A 4IFYA 2OPRA 1NK4A 3VMFB 3QO9A 3MCAB 1X9MA 3MN5A 4MFBA 3PO5A 2Q97A 1LWEA 1KAXA 4JI1K 4KAZA 3LP2A 2Q1NA 1I3AA 4FJHA 2BGGA 4JI4K 1NG9A 2HVHA 4LFBK 2RKIA 3TR8A 4JI2K 3ZSYA 4DSFA 3AARA 3M3ZA 1LAVA 1TL3A 2Q0RA 4B1YB 4FO0A 4FJJA 3ZETA 1HYZA 2VGNA 4JLHA 1NK5A 2NRTA 3LDOA 4Q5VA 4OJRA 4DCHA 3EZ5A 2O8CA 4OLAA 2P5OA 1NGHA 3VQ5A 3T1YK 2FF6A 1HNZK 2YKMA 1LW2A 5BPNA 3TAQA 3TAFA 3AA5X 2VG6A 5J1EA 3J80O 3ZSQA 1K6YA 1RBVA 3CJ1A 2FBYA 1RBUA 1N5YA 3FZHA 3HSTB 3FFIA 1B9DA 4MDAA 4F8RA 1JCEA 1T44A 3CCEN 1VQON 3AVLA 3LDNA 3LAKA 4IBNA 5H1SQ 3NHGA 3CCMN 3VTHA 1WAJA 2KQ2A 1Q9YA 2IVNA 1HKBA 3J7ZO 3UKRA 1IV0A 4E1JA 2Z1JA 1NOYA 4CEBA 4B08A 4HWIA 4WFAL 3AVHA 3SQ4A 4I7FA 2F7TA 1JXEA 3DJCA 4BC2A 3CXCM 5JMVA 3ZCMA 3ENOA 5IT9O 2WBNA 2X74A 3P4IA 3ZETB 3QEVA 4CZMA 4DSKA 4CGJA 1EP4A 3PX6A 1NGJA 3MAQA 2E1YA 4CD1A 2ZJQL 5DMRA 3C95A 4DFPA 2NRHA 5C24A 2GELA 1U2VA 1RTDA 3AGRA 3CIPA 3QEIA 3MK6A 3PY8A 4BE2A 4BDPA 5AQRA 1YITN 1YHQN 3DLLL 1XHZA 1GOAA 3W0LA 4JI7K 4Z4HA 1NK6A 3O1BA 1MU2A 4KHYA 4AF1A 5HOOA 3L0QA 3DLBA 1J53A 3GE1A 1P8ZA 4FLUA 1NGBA 3QESA 4J2EA 4XH1A 4YOYA 3VESA 3Q7BA 1GLCG 3D2FB 2JLEA 2YV0X 4FOIA 3EKSA 3V4IA 3ZLJA 2YKNA 3SAFA 4U7BA 2Q3SA 1QVGM 4QAGA 3K0SA 3VQDA 4JI3K 4CF0A 3A2FA 2RHKA 3HT3A 3KK3A 1ZYQA 1TV6A 3NF8A 4FK2A 3ENHA 1K8AO 2HBJA 4GVEA 4H0OA 1KAYA 4M3ZA 5CZ1A 3CYMA 4IG3A 4KI4A 4WCEL 4C8MA 1MWKA 4K8XA 3OJSA 4KPYA 4CIGA 5BN9A 3LZJA 3HJFA 2Q2RA 4N76A 2P9NA 2QWRA 3M8PA 3OYIA 4JAXA 3CC4N 4E7JA 4FLTA 4WF9L 3KKSA 3UB5A 4HUFA 1LOTB 2HF4A 3H46O 1BI4A 4QS9A 4J2AA 4FLWA 3HPHA 4CGHA 4IOAL 3CJAA 1NGIA 1Z26A 3H45C 2GX9A 4B1WB 3CJ7A 4EZ6A 4JKBA 1OVYA 3KWGA 3RMAA 4IWVA 4OLBA 3F9MA 1KVAA 1OH7A 5KGXA 1E4GT 4BWJA 1NJZA 1HR0K 2E5LK 1VQ8N 3CCJN 1CXQA 4RW8A 1U4BA 1VQ4N 4JD2A 3VENA 1HYVA 2B5JA 1REVA 2E20A 2FSJA 1HNVA 4ZTJA 3SBTA 2IVPA 3MECA 3V1OA 4G9ZA 1JLGA 3WT0A 3DWLA 4OKJA 3KK7A 5M1KA 3TAGA 1JCGA 3KLGA 4U67L 4I2PA 4EHUA 2ZGYA 1BI4B 2PFUA 3KZBA 4OGCA 3RRHA 4GVMA 3CC7N 4Z4CA 2KZMA 3T3FA 4FM0A 1ASWA 1IH7A 3NMUA 4A62A 1HPMA 3MWPA 3AA2A 4BRIA 3QDKA 4HTLA 1ZC6A 5AQUA 3MX2A 3SQ1A 5AQGA 1JCFA 1X3NA 4JKHA 4GV9A 1YAGA 4Q0BA 4KRFA 1GLBG 4YORA 4LSNA 2O8FA 5AQKA 4JEPA 4JN4A 4GKJK 5E41A 3PLAA 1TK5A 2H3GX 3O8MA 5KPRA 4A5AA 4CVNE 4JD2B 3VTIA 5M1FA 4DU3A 3VPZA 3DXMA 4H4MA 2OZMA 1HKCA 1C0MA 3T19A 1HJRA 1JLAA 1VSHA 4WQ4A 4B3OA 1JL1A 2NLXA 2O8BA 4I9LA 2IVOA 4JRQA 4RCHA 3I55N 3VF6A 5KTQA 5KRSA 4BC3A 1TVRA 4FOEA 1JXBA 5TKYA 3VETA 3C6HA 1RT1A 2QWNA 3C7NA 3A5MC 3ZSZA 1BUPA 1RT7A 2E2OA 4CECA 4DFMA 3MCPA 2P9LB 4FWSA 5TKWA 1M1KO 3NF9A 3R1XA 3WXLA 5KGWA 1YJNN 1RT2A 2A6AA 1EO1A 4KI6A 3P39A 1S6PA 4CI6A 4YOUA 5T7BA 2VWBA 4AM6A 5AQVA 4BWMA 1JKHA 3AY9A 5AQYA 3NF7A 3PSFA 1S9GA 1NMNA 3SNNA 3CPWM 1H1VA 3CQXA 3LPUA 5GINA 3SI6A 3O9UA 2YNIA 4DQSA 4O55A 1QZ6A 3DXMB 3ASMA 3PX0A 4BROA 4CF2A 3M8SA 3ZSVA 2WFBA 4CZIA 3THXB 4O0IA 4CGIA 2P9IA 4BRLA 4XH5A 4FCYA 1BISA 5KQDA 4JYAK 3SV4A 2QK9A 4E7LA 2QEXN 2O8DA 1C6VA 1S6QA 1YVUA 2A42A 1LWFA 4JRPA 4UY8O 4B1ZA 1D5AA 2A1SA 3LZIA 5AQHA 3MEEA 4DUZK 3VOVA 4DTNA 2PZSA 3IRXA 1T8EA 4OPHA 3CJ9A 3G6EN 4DR6K 3T1HK 5SWMA 3QFPA 3LANA 2ITGA 3CC2N 4KTWA 3BZKA 4H5NA 3CJBA 3M5RA 1HNIA 1RBTA 3CFOA 4H4OA 1WSGA 2IIRA 1E4FT 1S1XA 5J2PA 3L2WA 4JS5A 4PKGA 3VEZA 1NGGA 1YJ9N 5BR9A 2D5RA 3L4QA 4KREA 4HUEA 1GLDG 1KSPA 2P9IB 1HRHA 2HHHK 2FC0A 2GWJA 3AGKA 3WNHA 3O08A 4YOVA 1XWLA 2A5XA 3WQUA 1VQLN 2HHWA 2O8DB 5BPLA 4AHCA 1WSIA 2XY6A 4FWNA 4M3YA 5GIOA 3BEXA 2UUCK 4BACA 3UIQA 4B3RK 3CG7A 4DSIA 4BE1A 4YDUA 3ZT4A 1NNEA 1D8YA 3TAEA 1TYQA 4LH4A 1WBBA 3D45A 2O4GA 3AAQA 1RILA 4C1NK 3GBTA 3O1WA 4C23A 3P83D 3QFUA 2CGLA 4NCGA 1NGCA 4KV8A 4PY5A 1C1AA 4ISEA 1RDDA 1NWKA 3OYLA 4BDYA 4DV7K 3FZKA 3WXMB 3M6GA 4FJXA 1S1VA 3E66A 3MXMA 4FSVA 1EXQA 3ZX3A 1IG9A 4DKWA 4JKGA 4CJ7A 1ATSA 3NGYA 1IKWA 1DLOA 4FVUA 5HL7L 4BR4A 1I39A 3BGRA 1VQ5N 1HYSA 3ZSWA 4CCHA 4AHVA 4DS4A 3G0ZA 2D0AA 1S1TA 5BRHA 5GIPA 4FWMA 4JK9A 2HHSA 1QHTA 2XO7A 1IKXA 1TYQB 4FLYA 3F73A 3T69A 2WOMA 1XQSC 4BRMA 4H0XB 4W5TA 3RSEB 1DEJA 5M1OA 3DOKA 2ETJA 1R59O 3AVAA 4DTJA 1HLUA 3U9ZA 4FJIA 2QXLA 3JYTA 3C0BA 2E2QA 4NXMK 4J2DA 1BL3A 1IG8A 2FBXA 2OYQA 4M3WA 1RT4A 3MXIA 2F9TA 1EKEA 5E26A 1NKBA 2NUBA 3DAWA 1A5XA 3O80A 3EE9A 1L5UA 1KFSA 1BO5O 3FGUA 1NK0A 1Z05A 5ADXH 2ZQBA 5GAHP 1WB9A 3VN5A 2YHBA 2HNDA 4DTOA 2FBVA 4DB3A 5BREA 3OYMA 1RBSA 3V9UA 3QIPA 4K0KK 3KLFA 1DTTA 2Z1HA 3QERA 1J9AA 5JVHL 2F9WA 1JL2A 2P9PA 5C2FA 5ADXA 4GKKK 2NRVA 4I9QA 1VQPN 3WEEB 3OYBA 4NYFA 4DQIA 1T6CA 4O0JA 4QCLA 1IKVA 1RT3A 2PAVA 3O5BA 4BG9A 1YIJN 4A2BA 4R79A 1NMDA 4V19S 3OA9A 5AQMA 2ASMA 2JGUA 4AM7A 3GL1A 1WSFA 3F2KA 4DTPA 1LV5A 4XH4A 2Q0UA 4GW6A 3CMEN 4BR2A 3K5OA 3DLEA 4DV3K 3RVCA 1RT6A 3OVNA 1N32K 3KLIA 4WE1A 3HZ6A 3K2PA 5KPZA 3KD5E 4F3TA 3ISNC 4CEEA 4QOZB 2P9PB 1SQKA 3E9PA 4RW6A 1FJGK 2HBMA 3U3YA 2D0OA 1IO2A 1IKYA 1U48A 2EWSA 2BANA 4OX9K 2I7PA 2A40A 3EE8A 4TSXA 1BGXT 4BRAA 4JHDB 4H0VB 3OW2M 4LF8K 1B92A 4AHUA 4M7YA 1VSJA 3HTVA 4HHTA 5AQQA 5KRTA 4DLEA 3DI6A 3TTCA 4CJVA 4GV6A 1YUWA 5AR0A 3ZX0A 3J7AP 4DV1K 3M1FA 1GLEG 3AV9A 3H6EA 4PWDA 3BY5A 2KW4A 3NH2A 4JKDA 1QQCA 4W5NA 4DTSA 3V1QA 4QS8A 3T1AA 1HNXK 5J2NA 4CGDA 4N5SA 1YTUA 4N41A 4DLGA 1XUPO 2YX6A 3CPEA 1NLVA 4LF4K 2D0CA 2ZM6K 3M8RA 3D2FA 3G4SN 1UAXA 3HBTA 1VSDA 2UXBK 2KHOA 4B8AB 5GAEP 4M3XA 3LP1A 4CHYA 2OTLN 4FK0A 4H03B 3P38A 5CZ2A 3VEXA 2KZZA 1G99A 1RDUA 4JKFA 2FF3B 3OBWA 2QWPA 4BVPA 2VG7A 3PV8A 4FJKA 1S5JA 4PL8A 3QETA 3AVIA 1RGIA 2WONA 3ZT0A 4PKIA 4E89A 3VERA 3HVTA 4FWKA 3B6OA 3CMAN 3TSUA 3F5TA 3HI0A 2HBKA 3DRSA 1GLJO 1UWBA 3MN9A 3HOTA 2YJFA 1V4SA 4C8KA 1RTHA 2BDPA 3TSPA 3VQEA 5AQZA 3I8BA 3N4QA 1QSYA 1S9EA 4CHOA 3O9RA 1UA1A 3SQ0A 3AVNA 3NVMA 4N47A 3RTVA 4MLEA 2G8IA 1WNSA 3AA3A 4BR9A 2G8VA 1VK0A 5LJVA 3C6TA 5JVGL 2V51B 3IAYA 1BG3A 1L3VA 4G1QA 4XEIA 2W41A 3LP3A 3WXIA 1C1CA 4CZFA 2HHTA 3OYHA 4DU1A 2UXDK 4CIFA 2HMPA 4IFEA 4OGEA 2NRWA 1SL1A 4FWQA 2E88A 4RWTA 3OYFA 3NF6A 3CI5A 4DR3K 4MO4A 4W5OA 4O5BA 4BQZA 3K5NA 4NCAA 2HF3A 3U4LA 4CD3A 1BA1A 1EQYA 4FPAA 1U47A 2B6AA 3SQ2A 4K25A 3AVJA 4DTMA 1CXUA 1CLQA 2QM1A 3OJUA 4M41A 1KVCA 4FPBA 4FJNA 1S72N 4IOCL 3SUNA 1S22A 4CJQA 4B1VA 1HUXA 2PYJA
chains in the Genus database with same CATH topology
3E01A 4I2QA 3ULDA 3LPUA 3SI6A 3SNNA 1KLMA 1SL0A 4HCBA 4HCCA 3P5JA 2YNIA 4CJWA 3AO2A 3VQ9A 3LPTA 2HVIA 3K58A 1EETA 4DQSA 4E3SA 3QIOA 4E7HA 3RMCA 4O55A 3L2QA 1U49A 3KLHA 3IS9A 2DFHA 4CERA 1ZBIA 2O4IA 3S3NA 2HHQA 1FKPA 3ASMA 3PX0A 4JS4A 5HLFA 4KKOA 3OYAA 1U04A 4CF2A 3K5MA 3V81A 3M8SA 1FK9A 1WLJA 1WSEA 3S9HA 2KTQA 2RN2A 5K14A 3ZSVA 2GBZA 3U6FA 4C8OA 4FJ7A 4CF8A 4O0IA 4CGIA 4AHSA 3AO3A 3RMDA 3TABA 1RT5A 3DRRA 4NYNA 3OYJA 3ZSRA 3HO1A 1RTIA 1Y97A 1ZBFA 1RDAA 2Z1IA 4DTRA 4DSLA 4FCYA 3NGIA 3KTQA 2IAJA 1BISA 2HHUA 3NDKA 4CHPA 3L8BA 3SV3A 3QNNA 4HUGA 3SV4A 3JSMA 3VQQA 4CE9A 2QK9A 4E7LA 1TAQA 3KD1E 1C6VA 1S6QA 3NF7A 3PO4A 4OPKA 1YVUA 1LWFA 4JRPA 4OPJA 1D5AA 2Z1GA 4DFJA 1X9SA 1WSJA 2A1SA 1FXXA 4AHRA 3CFPA 3LZIA 4BDZA 4MQ3A 3WNGA 1Q8IA 3IG1A 3MEEA 3B6PA 1VSEA 4DS5A 1VSKA 1YTAA 4DTNA 3IRXA 2PZSA 1T8EA 1C0TA 3CFRA 2LSNA 3L3VA 2I5JA 4FLZA 3KKRA 2X6NA 4CFAA 1KLNA 5SWMA 3ZT2A 4CJ5A 3VQCA 3LANA 4OKKA 2ITGA 2VWJA 4KTWA 4FZZA 4ZHRA 4NCBA 1NJXA 3AO1A 1HNIA 1RBTA 4IDKA 4E1NA 4DTUA 2GV9A 3SUOA 5CYQA 3CFOA 4DG1A 4H4OA 1J54A 1QS4A 1WSGA 1FKOA 4FJGA 1S1XA 3HK2A 1KVBA 3I0RA 5J2PA 3L2WA 3V9WA 1ZBHA 5C42A 2P1JA 4JS5A 2XY7A 4Z4EA 2OPQA 1X1PA 1JLEA 4KHSA 4FXDA 3THVA 2D5RA 2IGIA 4KREA 2EX3A 4RW7A 4HUEA 3DMJA 2D0BA 4CEOA 1JLQA 1KSPA 2DY4A 1HRHA 3OS2A 3O4QA 1N6QA 2OA8A 2FC0A 3L2UA 4B9TA 3WNHA 4LY7A 3OYDA 3AVMA 1HQUA 1B9FA 3LP0A 4M3UA 3SCXA 3TAMA 3CM5A 4ELUA 1XWLA 4Z4IA 5JS2A 1T03A 2G8WA 3RR8A 5HRNA 4M3RA 1QSLA 2HHWA 2XY8A 3SPYA 4AHCA 2PYLA 4B9UA 1WSIA 2XY6A 4C8LA 4M3YA 3SZ2A 4Z4GA 4Z4FA 1A5VA 2AJQA 1L3UA 4CEAA 4UQGA 1BQNA 4BACA 3UIQA 4ICLA 4E1MA 3V9XA 3V9SA 4KHWA 3CG7A 4W5QA 3QEXA 2HMIA 4DSIA 2YNFA 4BE1A 3ZT4A 4CK1A 4HVJA 1J5OA 5SZTA 3TAEA 1D8YA 1W9HA 3O3HA 3NBPA 4LH4A 1XC9A 3D45A 3VQBA 2O4GA 4CEZA 1RILA 3SYZA 5J2QA 1F21A 1ITGA 5CY4A 4FK4A 3V9ZA 3U3GA 3P83D 2B4JA 3HXMA 4NCGA 4BE0A 4PY5A 4KV8A 1C1AA 1LAWA 3QINA 3DLGA 4IFVA 5EU7A 4W5RA 1RDDA 4BDYA 1CZ9A 3OYLA 3AVCA 4IFYA 3NAEA 1WAFA 4FJXA 2OPRA 4FZYA 1CZBA 1NK4A 1S1VA 3QO9A 3MXMA 1X9MA 4B8CA 3PO5A 4MFBA 1EXQA 1LWEA 4CJ3A 4KAZA 1VRTA 3LP2A 1IG9A 1I3AA 3C94A 4FJHA 2BGGA 1YT3A 4FVMA 1RDBA 2BE2A 4CJRA 3OYNA 2HVHA 2RKIA 3NGYA 1IKWA 3TR8A 3ZSYA 3NH0A 1DLOA 1QSSA 4FYDA 4DQRA 4DSFA 1TAUA 1I39A 3BGRA 1LAVA 1TL3A 3H08A 3ZSWA 3SUPA 1HYSA 4CFCA 4FJJA 1HYZA 4CCHA 4CFBA 4Y1CA 4AHVA 4DS4A 4IKFA 5JS1A 1RNHA 3DLRA 4JLHA 3K59A 3V6DA 1NK5A 4Q5VA 4OJRA 1GOCA 3EZ5A 4K8ZA 3QEWA 2P5OA 3S3MA 4OLAA 2XRIA 1SL2A 4DSEA 3G0ZA 2A1RA 2D0AA 3VQ5A 1S1TA 4ELTA 1BIUA 2YKMA 1LW2A 5I3UA 3ZT3A 3DLHA 4LH5A 1L3TA 3TAQA 3TAFA 2HHSA 1QHTA 3AA5X 1NK9A 2XO7A 2VG6A 5J1EA 3NE6A 1IKXA 3ZSQA 4FLYA 1K6YA 2HHXA 1RBVA 3DOLA 2IDOA 2QXFA 2FBYA 1RBUA 2WOMA 3F73A 4W5TA 1NK8A 1N5YA 4F2RA 3HSTB 3DOKA 1GOBA 1A5WA 2ETJA 3AVAA 1B9DA 3FFIA 4DTJA 1UA0A 4FJIA 3JYTA 4PUOA 4F8RA 3AVLA 2QKKA 4J2DA 1S1WA 1BL3A 3DYAA 2DFEA 4AH9A 2FBXA 4DTXA 3LAKA 4IBNA 2OYQA 3NHGA 3AA4A 4M3WA 1RT4A 1VSIA 2F8TA 3MXIA 4LSLA 3LAMA 1EKEA 1TKDA 4KHQA 2HB5A 2NUBA 4FW1A 1A5XA 4KFBA 1NKBA 4FJLA 1WAJA 2KQ2A 4FM1A 1Q9YA 3AVGA 5FRMA 3QLHA 5FRNA 1TK0A 3PUFA 1SKWA 3CQ8A 1L5UA 1TKZA 1KFSA 5DK5A 2Z1JA 1NOYA 4CEBA 3NH1A 4B08A 1NK0A 1U45A 3AVHA 3SQ4A 2ZQBA 4I7FA 3VN5A 1JXEA 4PA1A 3LDSA 2YHBA 1TKXA 2HNDA 4DTOA 2FBVA 3C6UA 3OYMA 3ZCMA 1RBSA 1C0UA 1VSLA 4FZXC 4FJ9A 1VSMA 2YHAA 2X74A 3V9UA 3QEVA 4DSKA 4DQQA 4CGJA 1ZBLA 1EP4A 3VQ6A 1L3SA 3PX6A 3QIPA 3KLFA 1DTTA 2Z1HA 3OYEA 3MAQA 4KTQA 2G8HA 4DF4A 5DMRA 4CEQA 3C95A 4DFPA 3QERA 1J9AA 4AHTA 5C24A 1JL2A 2ATQA 1RTDA 1QE1A 3QEIA 3F9KA 1BCMA 3KK2A 3PY8A 4BE2A 3L2RA 4BDPA 2Y1JA 4I9QA 4IG0A 2QKBA 4F4KA 3LWLA 3OYBA 1RTJA 4NYFA 1XHZA 4DQIA 4RG8A 1HQEA 1GOAA 4O0JA 4QCLA 1IKVA 4C8NA 4LD0A 4L8RB 4KHUA 4Z0UA 4Z4HA 4DWIA 1RT3A 1NK6A 1MU2A 1TKTA 4KHYA 1LW0A 3O4NA 3DLBA 3PX4A 1J53A 4KB0A 4FLUA 4J2EA 3QESA 3CM6A 2X6SA 4B9VA 3ITHA 3DRPA 4OKEA 4M3TA 3OYGA 1ZBUA 4CJLA 2JLEA 1NKCA 2YV0X 3V4IA 1Z25A 2JGUA 4KTZA 3EYZA 3HP9A 5HP1A 3AVKA 2YKNA 3ZSOA 4GMJB 5HRSA 2Q3SA 1WSFA 3VQ4A 4XIUA 4QAGA 2HNZA 4CESA 4DTPA 2P5GA 3L3UA 3OS1A 3VQDA 1LV5A 3BDPA 4CF0A 3A2FA 4GW6A 3HT3A 3KK3A 2E6MA 4AILC 1ZYQA 1Q9XA 1HPZA 3O3GA 1TV6A 1NJWA 4FJMA 3NF8A 1C1BA 3LWMA 4FK2A 3K5OA 3DLEA 2YNGA 2DFFA 2PY5A 4ZTFA 4DU4A 2XY5A 4M3ZA 4DMNA 3HM9A 5CZ1A 3CYMA 1RT6A 4IG3A 4CF9A 3OVNA 4KI4A 5D3GA 3KLIA 4C8MA 2YNHA 1TGOA 4WE1A 3KK1A 2KFZA 4K8XA 2ZE2A 2FBTA 3K2PA 3KD5E 3OJSA 1T05A 4F3TA 3AVFA 1XHXA 4KPYA 3ISNC 2E4LA 4CIGA 4CEEA 3LZJA 4QOZB 2HW3A 3HJFA 3SPZA 5HROA 4RW6A 1RBRA 1R0AA 4FM2A 3U3YA 4N76A 1IO2A 1IKYA 1U48A 4FJ5A 2BANA 3M8PA 4B9MA 5FROA 3OYIA 4M45A 3K57A 4TSXA 1BGXT 4RW4A 4CHNA 3OYKA 3QNOA 2P51A 1W0HA 4E7JA 1B92A 4YFUA 4AHUA 4FLTA 3AO5A 1VSJA 3KKSA 4HHTA 1VSFA 4HUFA 2XHBA 1SKSA 3LALA 2VWKA 5KRTA 1BI4A 4DLEA 1RDCA 3DI6A 4CJVA 4B9SA 4J2AA 4FLWA 3HPHA 4CGHA 2OPPA 4CK3A 4CK2A 4E7KA 1D9DA 1NOZA 3AV9A 3RMBA 4CEDA 4PWDA 1Z26A 2KW4A 3NH2A 1BQMA 1SV5A 4CIEA 1QQCA 4YNQA 2OZSA 1T7PA 3TWHA 4W5NA 3TAPA 4EZ6A 2ZD1A 4FLXA 3HPGA 4DTSA 3V1QA 2DTUA 3RMAA 3T1AA 3DLKA 3EY1A 4CGDA 5J2NA 5HRPA 2G8KA 4N5SA 4EP5A 4OLBA 1YTUA 4CHQA 4N41A 1KVAA 4DLGA 5KGXA 1HMVA 3VA0A 3I8DA 4BWJA 3VQAA 1NJZA 5HBMA 4FLVA 1KCFA 1NJYA 1RCHA 2D0CA 1CXQA 2VG5A 3M8RA 2R7YA 4DQPA 1BCOA 3I0SA 3RWUA 4RW8A 1UAXA 1ASVA 5CYMA 4EZ9A 4F3OA 1VSDA 1U4BA 3OYCA 1HYVA 2B5JA 1REVA 4B8AB 3G10A 3KLEA 5HRRA 3TI0A 3LP1A 4CHYA 1HNVA 4M3XA 4ZTJA 4FK0A 1SUQA 3ZSXA 4M42A 3MECA 1KFDA 3V1OA 1JLGA 2IS3A 4OKJA 5CZ2A 2KZZA 3TAGA 1D9FA 1O1WA 3NFAA 3K5LA 2HHVA 4ID5A 4CJUA 3KLGA 3P1GA 2E6LA 4CJSA 5C25A 1BHLA 3AVBA 4CJFA 4E19A 3OY9A 2IOCA 2VG7A 3HP6A 4I2PA 3PV8A 2X78A 5I42A 3RRGA 1BI4B 3VA3A 4B9NA 4FJKA 1S5JA 3QETA 2G8FA 4FJ8A 3AVIA 4PQUA 4OGCA 3M8QA 2WONA 3RRHA 4DF8A 4GVMA 3ZT0A 4Z4CA 2KZMA 3MEGA 4E89A 3T3FA 3MEDA 4FM0A 3HVTA 1ASWA 1IH7A 3AO4A 4CEFA 4DFKA 1DTQA 3AA2A 2F96A 3B6OA 1LWCA 4CHZA 1JLFA 1G15A 3ALYA 4CGGA 3DRSA 1UWBA 4ELVA 3SQ1A 3HYFA 3DM2A 1UOCA 3RR7A 1RTHA 4O44A 4CJTA 2BDPA 4C8KA 3VQEA 3MXJA 4H8KA 2OPSA 4HTUA 4CJPA 1JLCA 3HL8A 4Q0BA 4KRFA 4LSNA 4EP4A 4KB1A 3HVRA 2GUIA 4B9LA 4N56A 1QSYA 1ASUA 1S9EA 4CHOA 2IC3A 1UA1A 3SQ0A 3AVNA 5E41A 1TK5A 5KI6A 3KJVA 3KIOA 4CJ4A 4N47A 2Y1IA 3RTVA 2G8IA 1WNSA 1TK8A 4E7IA 1X9WA 3AA3A 4DU3A 3ZT1A 2G8VA 1VK0A 2RPIA 4R5PA 3NCIA 1S1UA 3C6TA 4H4MA 4F2SA 5J2MA 2HNYA 3IAYA 3L2VA 2OZMA 1C0MA 3T19A 4CGFA 1L3VA 1HJRA 1JLAA 4G1QA 4DSJA 4FW2A 4CJEA 1SKRA 1VSHA 3S3OA 3LP3A 4KHNA 4B3OA 4OVLA 1C1CA 3OS0A 1JL1A 2HHTA 3V1RA 3OYHA 4DU1A 4I9LA 3O3FA 4JRQA 1NKEA 4CIFA 1NK7A 4RW9A 3VQ8A 5KTQA 2EHGA 4OGEA 5KRSA 1TVRA 1SL1A 4Y1DA 1JXBA 3SUQA 1RT1A 3OYFA 3NF6A 2RF2A 3NGZA 2F8SA 3TANA 3ZSZA 3TARA 1QTMA 4W5OA 1WN7A 3D0PA 2KFNA 4O5BA 1BIZA 3K5NA 4CECA 1RT7A 4NCAA 4O4GA 4CJKA 3VQ7A 1JLBA 4CFDA 4DFMA 2W42A 3NF9A 1VRUA 4ID1A 3HPOA 3SJJA 2B6AA 5KGWA 1XI1A 1U47A 3SQ2A 1RT2A 4KO0A 1EX4A 4KI6A 1KTQA 1S6PA 3AVJA 4DTMA 1CXUA 1TL1A 4J2BA 5T7BA 1CLQA 3OJUA 1KRPA 4M41A 1KVCA 2G8UA 4FJNA 3WNFA 3QEPA 4E0DA 4BWMA 1JKHA 4CF1A 5FDLA 3WNEA 3SUNA 1WSHA 4CJQA 1S9GA 3VQPA 2PYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E01 A;  4I2Q A;  3ULD A;  3LPU A;  3SI6 A;  3SNN A;  1KLM A;  1SL0 A;  4HCB A;  4HCC A;  3P5J A;  2YNI A;  4CJW A;  3AO2 A;  3VQ9 A;  3LPT A;  2HVI A;  3K58 A;  1EET A;  4DQS A;  4E3S A;  3QIO A;  4E7H A;  3RMC A;  4O55 A;  3L2Q A;  1U49 A;  3KLH A;  3IS9 A;  2DFH A;  4CER A;  1ZBI A;  2O4I A;  3S3N A;  2HHQ A;  1FKP A;  3ASM A;  3PX0 A;  4JS4 A;  5HLF A;  4KKO A;  3OYA A;  1U04 A;  4CF2 A;  3K5M A;  3V81 A;  3M8S A;  1FK9 A;  1WLJ A;  1WSE A;  3S9H A;  2KTQ A;  2RN2 A;  5K14 A;  3ZSV A;  2GBZ A;  3U6F A;  4C8O A;  4FJ7 A;  4CF8 A;  4O0I A;  4CGI A;  4AHS A;  3AO3 A;  3RMD A;  3TAB A;  1RT5 A;  3DRR A;  4NYN A;  3OYJ A;  3ZSR A;  3HO1 A;  1RTI A;  1Y97 A;  1ZBF A;  1RDA A;  2Z1I A;  4DTR A;  4DSL A;  4FCY A;  3NGI A;  3KTQ A;  2IAJ A;  1BIS A;  2HHU A;  3NDK A;  4CHP A;  3L8B A;  3SV3 A;  3QNN A;  4HUG A;  3SV4 A;  3JSM A;  3VQQ A;  4CE9 A;  2QK9 A;  4E7L A;  1TAQ A;  3KD1 E;  1C6V A;  1S6Q A;  3NF7 A;  3PO4 A;  4OPK A;  1YVU A;  1LWF A;  4JRP A;  4OPJ A;  1D5A A;  2Z1G A;  4DFJ A;  1X9S A;  1WSJ A;  2A1S A;  1FXX A;  4AHR A;  3CFP A;  3LZI A;  4BDZ A;  4MQ3 A;  3WNG A;  1Q8I A;  3IG1 A;  3MEE A;  3B6P A;  1VSE A;  4DS5 A;  1VSK A;  1YTA A;  4DTN A;  3IRX A;  2PZS A;  1T8E A;  1C0T A;  3CFR A;  2LSN A;  3L3V A;  2I5J A;  4FLZ A;  3KKR A;  2X6N A;  4CFA A;  1KLN A;  5SWM A;  3ZT2 A;  4CJ5 A;  3VQC A;  3LAN A;  4OKK A;  2ITG A;  2VWJ A;  4KTW A;  4FZZ A;  4ZHR A;  4NCB A;  1NJX A;  3AO1 A;  1HNI A;  1RBT A;  4IDK A;  4E1N A;  4DTU A;  2GV9 A;  3SUO A;  5CYQ A;  3CFO A;  4DG1 A;  4H4O A;  1J54 A;  1QS4 A;  1WSG A;  1FKO A;  4FJG A;  1S1X A;  3HK2 A;  1KVB A;  3I0R A;  5J2P A;  3L2W A;  3V9W A;  1ZBH A;  5C42 A;  2P1J A;  4JS5 A;  2XY7 A;  4Z4E A;  2OPQ A;  1X1P A;  1JLE A;  4KHS A;  4FXD A;  3THV A;  2D5R A;  2IGI A;  4KRE A;  2EX3 A;  4RW7 A;  4HUE A;  3DMJ A;  2D0B A;  4CEO A;  1JLQ A;  1KSP A;  2DY4 A;  1HRH A;  3OS2 A;  3O4Q A;  1N6Q A;  2OA8 A;  2FC0 A;  3L2U A;  4B9T A;  3WNH A;  4LY7 A;  3OYD A;  3AVM A;  1HQU A;  1B9F A;  3LP0 A;  4M3U A;  3SCX A;  3TAM A;  3CM5 A;  4ELU A;  1XWL A;  4Z4I A;  5JS2 A;  1T03 A;  2G8W A;  3RR8 A;  5HRN A;  4M3R A;  1QSL A;  2HHW A;  2XY8 A;  3SPY A;  4AHC A;  2PYL A;  4B9U A;  1WSI A;  2XY6 A;  4C8L A;  4M3Y A;  3SZ2 A;  4Z4G A;  4Z4F A;  1A5V A;  2AJQ A;  1L3U A;  4CEA A;  4UQG A;  1BQN A;  4BAC A;  3UIQ A;  4ICL A;  4E1M A;  3V9X A;  3V9S A;  4KHW A;  3CG7 A;  4W5Q A;  3QEX A;  2HMI A;  4DSI A;  2YNF A;  4BE1 A;  3ZT4 A;  4CK1 A;  4HVJ A;  1J5O A;  5SZT A;  3TAE A;  1D8Y A;  1W9H A;  3O3H A;  3NBP A;  4LH4 A;  1XC9 A;  3D45 A;  3VQB A;  2O4G A;  4CEZ A;  1RIL A;  3SYZ A;  5J2Q A;  1F21 A;  1ITG A;  5CY4 A;  4FK4 A;  3V9Z A;  3U3G A;  3P83 D;  2B4J A;  3HXM A;  4NCG A;  4BE0 A;  4PY5 A;  4KV8 A;  1C1A A;  1LAW A;  3QIN A;  3DLG A;  4IFV A;  5EU7 A;  4W5R A;  1RDD A;  4BDY A;  1CZ9 A;  3OYL A;  3AVC A;  4IFY A;  3NAE A;  1WAF A;  4FJX A;  2OPR A;  4FZY A;  1CZB A;  1NK4 A;  1S1V A;  3QO9 A;  3MXM A;  1X9M A;  4B8C A;  3PO5 A;  4MFB A;  1EXQ A;  1LWE A;  4CJ3 A;  4KAZ A;  1VRT A;  3LP2 A;  1IG9 A;  1I3A A;  3C94 A;  4FJH A;  2BGG A;  1YT3 A;  4FVM A;  1RDB A;  2BE2 A;  4CJR A;  3OYN A;  2HVH A;  2RKI A;  3NGY A;  1IKW A;  3TR8 A;  3ZSY A;  3NH0 A;  1DLO A;  1QSS A;  4FYD A;  4DQR A;  4DSF A;  1TAU A;  1I39 A;  3BGR A;  1LAV A;  1TL3 A;  3H08 A;  3ZSW A;  3SUP A;  1HYS A;  4CFC A;  4FJJ A;  1HYZ A;  4CCH A;  4CFB A;  4Y1C A;  4AHV A;  4DS4 A;  4IKF A;  5JS1 A;  1RNH A;  3DLR A;  4JLH A;  3K59 A;  3V6D A;  1NK5 A;  4Q5V A;  4OJR A;  1GOC A;  3EZ5 A;  4K8Z A;  3QEW A;  2P5O A;  3S3M A;  4OLA A;  2XRI A;  1SL2 A;  4DSE A;  3G0Z A;  2A1R A;  2D0A A;  3VQ5 A;  1S1T A;  4ELT A;  1BIU A;  2YKM A;  1LW2 A;  5I3U A;  3ZT3 A;  3DLH A;  4LH5 A;  1L3T A;  3TAQ A;  3TAF A;  2HHS A;  1QHT A;  3AA5 X;  1NK9 A;  2XO7 A;  2VG6 A;  5J1E A;  3NE6 A;  1IKX A;  3ZSQ A;  4FLY A;  1K6Y A;  2HHX A;  1RBV A;  3DOL A;  2IDO A;  2QXF A;  2FBY A;  1RBU A;  2WOM A;  3F73 A;  4W5T A;  1NK8 A;  1N5Y A;  4F2R A;  3HST B;  3DOK A;  1GOB A;  1A5W A;  2ETJ A;  3AVA A;  1B9D A;  3FFI A;  4DTJ A;  1UA0 A;  4FJI A;  3JYT A;  4PUO A;  4F8R A;  3AVL A;  2QKK A;  4J2D A;  1S1W A;  1BL3 A;  3DYA A;  2DFE A;  4AH9 A;  2FBX A;  4DTX A;  3LAK A;  4IBN A;  2OYQ A;  3NHG A;  3AA4 A;  4M3W A;  1RT4 A;  1VSI A;  2F8T A;  3MXI A;  4LSL A;  3LAM A;  1EKE A;  1TKD A;  4KHQ A;  2HB5 A;  2NUB A;  4FW1 A;  1A5X A;  4KFB A;  1NKB A;  4FJL A;  1WAJ A;  2KQ2 A;  4FM1 A;  1Q9Y A;  3AVG A;  5FRM A;  3QLH A;  5FRN A;  1TK0 A;  3PUF A;  1SKW A;  3CQ8 A;  1L5U A;  1TKZ A;  1KFS A;  5DK5 A;  2Z1J A;  1NOY A;  4CEB A;  3NH1 A;  4B08 A;  1NK0 A;  1U45 A;  3AVH A;  3SQ4 A;  2ZQB A;  4I7F A;  3VN5 A;  1JXE A;  4PA1 A;  3LDS A;  2YHB A;  1TKX A;  2HND A;  4DTO A;  2FBV A;  3C6U A;  3OYM A;  3ZCM A;  1RBS A;  1C0U A;  1VSL A;  4FZX C;  4FJ9 A;  1VSM A;  2YHA A;  2X74 A;  3V9U A;  3QEV A;  4DSK A;  4DQQ A;  4CGJ A;  1ZBL A;  1EP4 A;  3VQ6 A;  1L3S A;  3PX6 A;  3QIP A;  3KLF A;  1DTT A;  2Z1H A;  3OYE A;  3MAQ A;  4KTQ A;  2G8H A;  4DF4 A;  5DMR A;  4CEQ A;  3C95 A;  4DFP A;  3QER A;  1J9A A;  4AHT A;  5C24 A;  1JL2 A;  2ATQ A;  1RTD A;  1QE1 A;  3QEI A;  3F9K A;  1BCM A;  3KK2 A;  3PY8 A;  4BE2 A;  3L2R A;  4BDP A;  2Y1J A;  4I9Q A;  4IG0 A;  2QKB A;  4F4K A;  3LWL A;  3OYB A;  1RTJ A;  4NYF A;  1XHZ A;  4DQI A;  4RG8 A;  1HQE A;  1GOA A;  4O0J A;  4QCL A;  1IKV A;  4C8N A;  4LD0 A;  4L8R B;  4KHU A;  4Z0U A;  4Z4H A;  4DWI A;  1RT3 A;  1NK6 A;  1MU2 A;  1TKT A;  4KHY A;  1LW0 A;  3O4N A;  3DLB A;  3PX4 A;  1J53 A;  4KB0 A;  4FLU A;  4J2E A;  3QES A;  3CM6 A;  2X6S A;  4B9V A;  3ITH A;  3DRP A;  4OKE A;  4M3T A;  3OYG A;  1ZBU A;  4CJL A;  2JLE A;  1NKC A;  2YV0 X;  3V4I A;  1Z25 A;  2JGU A;  4KTZ A;  3EYZ A;  3HP9 A;  5HP1 A;  3AVK A;  2YKN A;  3ZSO A;  4GMJ B;  5HRS A;  2Q3S A;  1WSF A;  3VQ4 A;  4XIU A;  4QAG A;  2HNZ A;  4CES A;  4DTP A;  2P5G A;  3L3U A;  3OS1 A;  3VQD A;  1LV5 A;  3BDP A;  4CF0 A;  3A2F A;  4GW6 A;  3HT3 A;  3KK3 A;  2E6M A;  4AIL C;  1ZYQ A;  1Q9X A;  1HPZ A;  3O3G A;  1TV6 A;  1NJW A;  4FJM A;  3NF8 A;  1C1B A;  3LWM A;  4FK2 A;  3K5O A;  3DLE A;  2YNG A;  2DFF A;  2PY5 A;  4ZTF A;  4DU4 A;  2XY5 A;  4M3Z A;  4DMN A;  3HM9 A;  5CZ1 A;  3CYM A;  1RT6 A;  4IG3 A;  4CF9 A;  3OVN A;  4KI4 A;  5D3G A;  3KLI A;  4C8M A;  2YNH A;  1TGO A;  4WE1 A;  3KK1 A;  2KFZ A;  4K8X A;  2ZE2 A;  2FBT A;  3K2P A;  3KD5 E;  3OJS A;  1T05 A;  4F3T A;  3AVF A;  1XHX A;  4KPY A;  3ISN C;  2E4L A;  4CIG A;  4CEE A;  3LZJ A;  4QOZ B;  2HW3 A;  3HJF A;  3SPZ A;  5HRO A;  4RW6 A;  1RBR A;  1R0A A;  4FM2 A;  3U3Y A;  4N76 A;  1IO2 A;  1IKY A;  1U48 A;  4FJ5 A;  2BAN A;  3M8P A;  4B9M A;  5FRO A;  3OYI A;  4M45 A;  3K57 A;  4TSX A;  1BGX T;  4RW4 A;  4CHN A;  3OYK A;  3QNO A;  2P51 A;  1W0H A;  4E7J A;  1B92 A;  4YFU A;  4AHU A;  4FLT A;  3AO5 A;  1VSJ A;  3KKS A;  4HHT A;  1VSF A;  4HUF A;  2XHB A;  1SKS A;  3LAL A;  2VWK A;  5KRT A;  1BI4 A;  4DLE A;  1RDC A;  3DI6 A;  4CJV A;  4B9S A;  4J2A A;  4FLW A;  3HPH A;  4CGH A;  2OPP A;  4CK3 A;  4CK2 A;  4E7K A;  1D9D A;  1NOZ A;  3AV9 A;  3RMB A;  4CED A;  4PWD A;  1Z26 A;  2KW4 A;  3NH2 A;  1BQM A;  1SV5 A;  4CIE A;  1QQC A;  4YNQ A;  2OZS A;  1T7P A;  3TWH A;  4W5N A;  3TAP A;  4EZ6 A;  2ZD1 A;  4FLX A;  3HPG A;  4DTS A;  3V1Q A;  2DTU A;  3RMA A;  3T1A A;  3DLK A;  3EY1 A;  4CGD A;  5J2N A;  5HRP A;  2G8K A;  4N5S A;  4EP5 A;  4OLB A;  1YTU A;  4CHQ A;  4N41 A;  1KVA A;  4DLG A;  5KGX A;  1HMV A;  3VA0 A;  3I8D A;  4BWJ A;  3VQA A;  1NJZ A;  5HBM A;  4FLV A;  1KCF A;  1NJY A;  1RCH A;  2D0C A;  1CXQ A;  2VG5 A;  3M8R A;  2R7Y A;  4DQP A;  1BCO A;  3I0S A;  3RWU A;  4RW8 A;  1UAX A;  1ASV A;  5CYM A;  4EZ9 A;  4F3O A;  1VSD A;  1U4B A;  3OYC A;  1HYV A;  2B5J A;  1REV A;  4B8A B;  3G10 A;  3KLE A;  5HRR A;  3TI0 A;  3LP1 A;  4CHY A;  1HNV A;  4M3X A;  4ZTJ A;  4FK0 A;  1SUQ A;  3ZSX A;  4M42 A;  3MEC A;  1KFD A;  3V1O A;  1JLG A;  2IS3 A;  4OKJ A;  5CZ2 A;  2KZZ A;  3TAG A;  1D9F A;  1O1W A;  3NFA A;  3K5L A;  2HHV A;  4ID5 A;  4CJU A;  3KLG A;  3P1G A;  2E6L A;  4CJS A;  5C25 A;  1BHL A;  3AVB A;  4CJF A;  4E19 A;  3OY9 A;  2IOC A;  2VG7 A;  3HP6 A;  4I2P A;  3PV8 A;  2X78 A;  5I42 A;  3RRG A;  1BI4 B;  3VA3 A;  4B9N A;  4FJK A;  1S5J A;  3QET A;  2G8F A;  4FJ8 A;  3AVI A;  4PQU A;  4OGC A;  3M8Q A;  2WON A;  3RRH A;  4DF8 A;  4GVM A;  3ZT0 A;  4Z4C A;  2KZM A;  3MEG A;  4E89 A;  3T3F A;  3MED A;  4FM0 A;  3HVT A;  1ASW A;  1IH7 A;  3AO4 A;  4CEF A;  4DFK A;  1DTQ A;  3AA2 A;  2F96 A;  3B6O A;  1LWC A;  4CHZ A;  1JLF A;  1G15 A;  3ALY A;  4CGG A;  3DRS A;  1UWB A;  4ELV A;  3SQ1 A;  3HYF A;  3DM2 A;  1UOC A;  3RR7 A;  1RTH A;  4O44 A;  4CJT A;  2BDP A;  4C8K A;  3VQE A;  3MXJ A;  4H8K A;  2OPS A;  4HTU A;  4CJP A;  1JLC A;  3HL8 A;  4Q0B A;  4KRF A;  4LSN A;  4EP4 A;  4KB1 A;  3HVR A;  2GUI A;  4B9L A;  4N56 A;  1QSY A;  1ASU A;  1S9E A;  4CHO A;  2IC3 A;  1UA1 A;  3SQ0 A;  3AVN A;  5E41 A;  1TK5 A;  5KI6 A;  3KJV A;  3KIO A;  4CJ4 A;  4N47 A;  2Y1I A;  3RTV A;  2G8I A;  1WNS A;  1TK8 A;  4E7I A;  1X9W A;  3AA3 A;  4DU3 A;  3ZT1 A;  2G8V A;  1VK0 A;  2RPI A;  4R5P A;  3NCI A;  1S1U A;  3C6T A;  4H4M A;  4F2S A;  5J2M A;  2HNY A;  3IAY A;  3L2V A;  2OZM A;  1C0M A;  3T19 A;  4CGF A;  1L3V A;  1HJR A;  1JLA A;  4G1Q A;  4DSJ A;  4FW2 A;  4CJE A;  1SKR A;  1VSH A;  3S3O A;  3LP3 A;  4KHN A;  4B3O A;  4OVL A;  1C1C A;  3OS0 A;  1JL1 A;  2HHT A;  3V1R A;  3OYH A;  4DU1 A;  4I9L A;  3O3F A;  4JRQ A;  1NKE A;  4CIF A;  1NK7 A;  4RW9 A;  3VQ8 A;  5KTQ A;  2EHG A;  4OGE A;  5KRS A;  1TVR A;  1SL1 A;  4Y1D A;  1JXB A;  3SUQ A;  1RT1 A;  3OYF A;  3NF6 A;  2RF2 A;  3NGZ A;  2F8S A;  3TAN A;  3ZSZ A;  3TAR A;  1QTM A;  4W5O A;  1WN7 A;  3D0P A;  2KFN A;  4O5B A;  1BIZ A;  3K5N A;  4CEC A;  1RT7 A;  4NCA A;  4O4G A;  4CJK A;  3VQ7 A;  1JLB A;  4CFD A;  4DFM A;  2W42 A;  3NF9 A;  1VRU A;  4ID1 A;  3HPO A;  3SJJ A;  2B6A A;  5KGW A;  1XI1 A;  1U47 A;  3SQ2 A;  1RT2 A;  4KO0 A;  1EX4 A;  4KI6 A;  1KTQ A;  1S6P A;  3AVJ A;  4DTM A;  1CXU A;  1TL1 A;  4J2B A;  5T7B A;  1CLQ A;  3OJU A;  1KRP A;  4M41 A;  1KVC A;  2G8U A;  4FJN A;  3WNF A;  3QEP A;  4E0D A;  4BWM A;  1JKH A;  4CF1 A;  5FDL A;  3WNE A;  3SUN A;  1WSH A;  4CJQ A;  1S9G A;  3VQP A;  2PYJ A; 
#chains in the Genus database with same CATH topology
 4BR5 A;  3KVG A;  4I2Q A;  3ULD A;  3VQ9 A;  1K9M O;  4JV5 K;  4JI6 K;  1EET A;  3QIO A;  3RMC A;  3SK3 A;  1MWM A;  5HLF A;  3RRG A;  4JK8 A;  1FK9 A;  1WLJ A;  1WSE A;  3C6A A;  3L4I A;  3U6F A;  5BRF A;  5LJW A;  1XMQ K;  3AO3 A;  3RMD A;  1RT5 A;  1Y64 A;  1KAZ A;  3HO1 A;  1ZBF A;  1Y97 A;  1ESV A;  4NO7 A;  1RDA A;  4ILJ A;  2QA4 N;  3NGI A;  4WQ5 C;  2IAJ A;  3KTQ A;  2V7Y A;  4CHP A;  3IUC A;  3QNN A;  4HUG A;  1Q7Y O;  2NRR A;  3WXJ A;  1KC8 O;  4CE9 A;  1YJW N;  4YOT A;  4NLC A;  5AQN A;  1QVF M;  3CFP A;  2FSK A;  5KPT A;  3IG1 A;  1VSE A;  1YTA A;  5AJ3 K;  4BGB A;  3A0I X;  4X64 K;  2LSN A;  5EY4 A;  1V4T A;  4FWR A;  4FLZ A;  4CFA A;  4CJ5 A;  3SJH A;  3VQC A;  5C2D A;  3U9D A;  1NJX A;  1SZ2 A;  4E1N A;  4B1X B;  2GV9 A;  2P9L A;  5CYQ A;  5JLH A;  4DG1 A;  1GLL O;  4FJG A;  1ZBH A;  2XY7 A;  4Z4E A;  4BG8 A;  4BRQ A;  1X1P A;  4FXD A;  2IGI A;  3CJC A;  2DY4 A;  3O4Q A;  1S3X A;  1N6Q A;  3R9P A;  4B9T A;  4LY7 A;  4LFC K;  3AVM A;  1HQU A;  1ILY A;  3LP0 A;  4M3U A;  3CM5 A;  4LF7 K;  2XY8 A;  2PYL A;  4BQL A;  5AZJ A;  3QBX A;  3SZ2 A;  2UXC K;  4Z4G A;  3THX A;  1E3M A;  4UQG A;  1BQN A;  4B3M K;  4E1M A;  3V9S A;  4KHW A;  5C0Y A;  4CK1 A;  4K42 A;  5SZT A;  4O8U A;  3AAP A;  5DM7 L;  4H0P A;  3VQB A;  3J7Y P;  4JKE A;  3VEW A;  3SYZ A;  5J2Q A;  1F21 A;  5LMU K;  5CY4 A;  2VYP A;  4BR0 A;  3V9Z A;  3U3G A;  4A2A A;  3QIN A;  3DLG A;  1XC3 A;  3GG4 A;  3AVC A;  4CZE A;  5LL6 Z;  2UU9 K;  4FWO A;  1WAF A;  5GAG P;  1DT9 A;  1SS6 A;  1T3V A;  3JAM O;  2BE2 A;  4CJR A;  3OYN A;  4FYD A;  4DR5 K;  3SUP A;  4KHP K;  1MDU B;  4CFB A;  1RNH A;  2ZWH A;  1OH6 A;  3D7E O;  3H3O B;  3V6D A;  4K8Z A;  5AZJ B;  3QEW A;  3A5L C;  4LFA K;  2XRI A;  1SL2 A;  2P9S B;  4DSE A;  2A1R A;  2YJE A;  1BIU A;  5I3U A;  3THW A;  1W97 L;  3HSC A;  2IDO A;  1NK8 A;  2UUA K;  2QW9 A;  1WOQ A;  4PUO A;  2QKK A;  1S1W A;  4BRH A;  2DFE A;  4DTX A;  2F8T A;  4LSL A;  1TKD A;  4KHQ A;  4X66 K;  2HB5 A;  4FJL A;  2PBD A;  1KQS M;  4KH4 A;  4FM1 A;  3QLH A;  1TK0 A;  3PUF A;  4IXC A;  1SKW A;  1TKZ A;  5BPM A;  3EZW A;  3NH1 A;  4IEE A;  1U45 A;  3I33 A;  1YF5 L;  1U6Z A;  3LDS A;  2AP1 A;  1TKX A;  3C6U A;  3VF2 A;  3PIO L;  1VSL A;  5M1Q A;  4FZX C;  1QZ5 A;  3LDL A;  1VSM A;  5M1P A;  3VQ6 A;  1L3S A;  3GOI A;  4K43 A;  4YY3 K;  2G8H A;  5I9E B;  4A61 A;  4CEQ A;  4DV5 K;  4AHT A;  2ATQ A;  3W3D A;  1QE1 A;  3THW B;  3F9K A;  3OTO K;  1BCM A;  3ATU A;  5ELZ A;  4BC5 A;  2Y1J A;  2QKB A;  4EAH D;  5LMN K;  3LWL A;  4DV2 K;  4F4K A;  4RG8 A;  1HQE A;  4EHT A;  5FPE A;  4FWP A;  2HOE A;  4LD0 A;  4L8R B;  4KHU A;  4Z0U A;  4DWI A;  3WXK A;  1J5E K;  1TKT A;  3EL2 A;  1LW0 A;  3QBW A;  4Z94 A;  3I56 N;  3VEY A;  4CBX A;  3CM6 A;  2X6S A;  1N8R O;  4B9V A;  3ITH A;  3H1Q A;  4OKE A;  1X3M A;  4ISG A;  1OKJ A;  2Q36 A;  1Z25 A;  4KTZ A;  3HP9 A;  3AVK A;  4KBO A;  4GMJ B;  2WC9 A;  5HRS A;  3RSE A;  3CCQ N;  4XIU A;  3L3U A;  3E1Y A;  2NRX A;  4AIL C;  5AQO A;  4IZ9 A;  5EX5 A;  1NJW A;  3BZC A;  4FJM A;  1C1B A;  3LWM A;  2YNG A;  1M90 O;  3ATV A;  2DFF A;  4LC9 B;  4ZTF A;  3JS6 A;  3HM8 A;  4DU4 A;  2XY5 A;  1D4X A;  5E84 A;  3HM9 A;  2YNH A;  1TGO A;  4C1N I;  2KFZ A;  2ZE2 A;  2FBT A;  1T05 A;  3AVF A;  2E4L A;  4YOX A;  5CHI A;  3SPZ A;  5C15 A;  4FM2 A;  4FJ5 A;  3OYK A;  4RW4 A;  3QNO A;  3G25 A;  3EEQ A;  3MX5 A;  4ILG B;  4H5R A;  1VSF A;  2XHB A;  2W40 A;  3ZYY X;  4CK3 A;  4E7K A;  2KKZ A;  3RMB A;  1NGF A;  2GTD A;  4DR2 K;  5BN8 A;  3WEE A;  3TWH A;  4NXN K;  3HPG A;  2VQE K;  2DTU A;  4J8F A;  5AQW A;  3EY1 A;  5HRP A;  4EP5 A;  1ATR A;  2OTJ N;  4CHQ A;  1C0F A;  1VQ7 N;  5GAD P;  1HMV A;  5AQT A;  3VA0 A;  3I8D A;  3VQA A;  2A41 A;  4FLV A;  1KCF A;  1NJY A;  1RCH A;  2FSN A;  3UE5 A;  2R7Y A;  1BCO A;  1OH8 A;  3B8A X;  3RWU A;  5CYM A;  3WQT A;  3OYC A;  2W6K A;  4BVO A;  1SUQ A;  3BP8 A;  5F1X A;  1KFD A;  2IS3 A;  3E9O A;  2CGJ A;  3QML A;  5AQS A;  1D9F A;  3NFA A;  3K5L A;  3U8X A;  4CJU A;  3P1G A;  2E6L A;  4BRK A;  4CJF A;  3OY9 A;  2IOC A;  1VQK N;  2X78 A;  4B9N A;  3VA3 A;  2G8F A;  4PQU A;  4DF8 A;  3MED A;  3AO4 A;  4CEF A;  1Z6R A;  4DFK A;  1ZBS A;  2CH6 A;  1LWC A;  1NM1 A;  5AQL A;  5FPD A;  1JLF A;  4DR7 K;  1G15 A;  3ALY A;  3PSI A;  4JHD A;  3HYF A;  3DM2 A;  4PKH A;  1UOC A;  4O44 A;  4CJT A;  2YHY A;  3DXK A;  4H8K A;  4HTU A;  4CJP A;  1JLC A;  2NRZ A;  3BF3 A;  2GUI A;  3D2E B;  4N56 A;  2IC3 A;  5KI6 A;  3KJV A;  4I6M B;  1KD1 O;  2Y1I A;  1TK8 A;  1X9W A;  3A8Y A;  2RE2 A;  3ZT1 A;  2RPI A;  3NCI A;  1S1U A;  4F2S A;  4BRE A;  5J2M A;  5BRD A;  2YHW A;  4WQ4 C;  4B1U B;  4PL7 A;  3VGL A;  4OVL A;  3OS0 A;  1BWF O;  2V7Z A;  5F2R A;  3V1R A;  3SMP A;  2DPN A;  4CZJ A;  1KXP A;  5EVZ A;  2P9K B;  3UKU A;  1YVN A;  4Y1D A;  1NGE A;  3SUQ A;  4BRC A;  2GUP A;  2E1Z A;  4H5T A;  2RF2 A;  2F8S A;  3TAN A;  1QTM A;  4DUY K;  3TAR A;  3D0P A;  2KFN A;  5A2Q O;  1BIZ A;  3FZF A;  3VQ7 A;  1JLB A;  4CFD A;  2W42 A;  4ID1 A;  3HPO A;  3ID8 A;  3SJJ A;  1XI1 A;  4KO0 A;  3TTF A;  1KTQ A;  4L3Q A;  1VQN N;  3MWT A;  1TL1 A;  3DXK B;  3KHY A;  3HRG A;  3WNF A;  3QEP A;  4E0D A;  3WNE A;  3EN9 A;  4MLH A;  3VQP A;  4X62 K;  4HCB A;  5CR4 A;  1IBM K;  4HCC A;  4CJW A;  3AO2 A;  3LPT A;  4YOW A;  3K58 A;  2HVI A;  3IFR A;  4E7H A;  1U49 A;  1K8K B;  4ILH A;  4IO8 A;  3IS9 A;  2BTF A;  2DFH A;  2HHQ A;  3S3N A;  3ENB A;  3FLC O;  4JS4 A;  3MN6 A;  3OHR A;  2WTU A;  4KKO A;  2W6L A;  1U04 A;  3K5M A;  3S9H A;  2RN2 A;  4B3S K;  1ATN A;  4FJ7 A;  4CF8 A;  2YHX A;  3TAB A;  3DRR A;  3OYJ A;  4DTR A;  1C0G A;  3UKU B;  3H1V X;  1BDG A;  3EO3 A;  1TAQ A;  3PO4 A;  3VGK A;  1BU6 O;  4OPK A;  2WUS A;  4BRN A;  4ISF A;  5AQI A;  1OH5 A;  1X9S A;  5AQP A;  3J81 O;  4AHR A;  4BDZ A;  1NBW A;  1Q8I A;  4DS5 A;  1C0T A;  1YXQ A;  1Q81 O;  1XNQ K;  3L3V A;  4LF9 K;  3KKR A;  1Q86 O;  2X6N A;  1KLN A;  1T6D A;  4OKK A;  2VWJ A;  4FZZ A;  3HOS A;  2E8A A;  3AO1 A;  4DTU A;  4H5V A;  4IDK A;  1J54 A;  5CE3 A;  3WUH A;  3HK2 A;  1KVB A;  5M1N A;  2OPQ A;  1JLE A;  1DGK N;  4KHS A;  2O8C B;  3THV A;  1YI2 N;  2EX3 A;  3CD6 N;  4CEO A;  2D0B A;  1JLQ A;  3OS2 A;  1NU0 A;  4WYB A;  4FL9 A;  3L2U A;  3OYD A;  4DQ8 A;  1B9F A;  2FLO A;  4NB4 A;  3TAM A;  3SAG A;  4AQY K;  4ELU A;  4Z4I A;  2ZJR L;  3EKU A;  1T03 A;  2G8W A;  5HRN A;  4M3R A;  4X65 K;  3O4W A;  1HKG A;  3SPY A;  4B9U A;  1XNR K;  2JWK A;  5FLX O;  1BA0 A;  1TUY A;  4CZK A;  3VF4 A;  1GLF O;  4Z4F A;  1A5V A;  4JNE A;  1LCU A;  2AJQ A;  4YDU C;  2QWL A;  3QEX A;  2YNF A;  3K9K A;  1XMO K;  4NLB A;  4HVJ A;  3A5O C;  1XC9 A;  3UKR B;  4MDB A;  1NGD A;  2ITM A;  1ITG A;  2YCH A;  2VGM A;  2B4J A;  4IFV A;  3IMX A;  1CZ9 A;  3NAE A;  3FR0 A;  4FZY A;  3R8E A;  1CZB A;  3LM9 A;  3CCR N;  1N34 K;  4EFH A;  4B8C A;  4DV4 K;  4CJ3 A;  2BUP A;  1VRT A;  2D1K A;  3C94 A;  1U2V B;  1YT3 A;  4FVM A;  4DR4 K;  1RDB A;  3NH0 A;  3BUZ B;  1QSS A;  4DQR A;  1TAU A;  3FZM A;  3H08 A;  3TTD A;  3CER A;  1VHX A;  4CFC A;  4Y1C A;  4IKF A;  5JS1 A;  3DLR A;  4JKA A;  3K59 A;  3IKM A;  1GOC A;  3FE1 A;  3S3M A;  1QHA A;  4ELT A;  3DLH A;  3D6R A;  3ZT3 A;  4LH5 A;  3A5N C;  4Y0W A;  1L3T A;  1NK9 A;  3NE6 A;  2JWL A;  4IDH A;  2HHX A;  3DOL A;  2QXF A;  4F2R A;  1GOB A;  1A5W A;  1UA0 A;  3BF1 A;  3MN7 A;  4B3T K;  3DYA A;  4AH9 A;  3AA4 A;  1VSI A;  3LAM A;  4KFB A;  4FW1 A;  1P90 A;  4IO9 L;  5FRM A;  3AVG A;  5FRN A;  3CQ8 A;  2QWM A;  5DK5 A;  4F9O A;  4PA1 A;  1VQ6 N;  2I7N A;  2P9N B;  1VQM N;  3C65 A;  1C0U A;  3ULE A;  1X9J A;  4H5W A;  4FJ9 A;  2YHA A;  3IDH A;  3SLC A;  4DQQ A;  1ZBL A;  3OYE A;  4KTQ A;  1OVQ A;  4DF4 A;  1I94 K;  3KK2 A;  1O13 A;  3LDQ A;  4IJN A;  3L2R A;  4BGA A;  4IG0 A;  1RTJ A;  4IEI A;  4C8N A;  1GLA G;  2AA4 A;  1HJO A;  2KLA A;  1EWR A;  4M7X A;  2VQF K;  3O4N A;  2P9S A;  3PX4 A;  1QQM A;  4KB0 A;  2P9U A;  3DRP A;  4M3T A;  3OYG A;  1ZBU A;  4CJL A;  5IWA K;  1NKC A;  4CW7 B;  2GWK A;  3VGM A;  3EYZ A;  5HP1 A;  1K73 O;  4JK7 A;  5AQX A;  3ZSO A;  2HST A;  3VQ4 A;  4CES A;  2HNZ A;  2P5G A;  3OS1 A;  4PHT X;  3BDP A;  2E6M A;  1Q9X A;  1HPZ A;  3N4P A;  3O3G A;  3ULE B;  3CQY A;  2OAN A;  3NVK A;  3VEO A;  4GNI A;  2PY5 A;  5AQF A;  4DMN A;  4CF9 A;  5D3G A;  1TUU A;  2HBL A;  3KK1 A;  2ZF5 O;  3R3L A;  1IBL K;  1XHX A;  4KH5 A;  2HW3 A;  3PIP L;  5HRO A;  1RBR A;  1R0A A;  4O5F A;  2YI1 A;  4B9M A;  3KWI A;  5FRO A;  4M45 A;  3K57 A;  4DV0 K;  4CHN A;  2P51 A;  3O9S A;  4WFN L;  3CCV N;  1W0H A;  4YFU A;  3TU5 A;  2O8E A;  2CGK A;  3AO5 A;  5MLC Q;  1SKS A;  3LAL A;  2VWK A;  1RDC A;  4B9S A;  4RTF D;  3E9L A;  4H0T B;  2OPP A;  5AQJ A;  2O8F B;  4CK2 A;  1VQ9 N;  1D9D A;  1NOZ A;  2P9U B;  4CED A;  4LF6 K;  1BQM A;  2QI2 A;  1SV5 A;  4CIE A;  4YNQ A;  2OZS A;  1T7P A;  3TAP A;  2ZD1 A;  3O9T A;  4FLX A;  1SAZ A;  3DLK A;  2G8K A;  4JI0 K;  1RFQ A;  4YHH K;  5B8H A;  4WFB L;  5EOY A;  4OO1 J;  1QQN A;  5HBM A;  2O8B B;  3T7Z A;  2VG5 A;  3SMS A;  4DQP A;  3I0S A;  4A59 A;  4K41 A;  4EZ9 A;  1ASV A;  4F3O A;  3FFK B;  3C7N B;  3KLE A;  3TI0 A;  3G10 A;  5HRR A;  2CH5 A;  3ZSX A;  4M42 A;  2VCP A;  1W2B M;  1O1W A;  2HHV A;  4ID5 A;  5BR8 K;  4CJS A;  5C25 A;  3MDQ A;  1BHL A;  3AVB A;  4BRP A;  2O8E B;  4E19 A;  5I42 A;  3HP6 A;  3K9J A;  3QB0 A;  3ID6 A;  1RDW X;  4FJ8 A;  1NGA A;  3M8Q A;  3MEG A;  4IOX A;  5KQ8 A;  1DTQ A;  2F96 A;  3MMV A;  5C10 A;  1N36 K;  4KH6 A;  4CHZ A;  4CGG A;  4ELV A;  3OBY A;  3P31 A;  1CZA N;  5F0X A;  3RR7 A;  5DM6 L;  3MXJ A;  2ZGZ A;  2OPS A;  3HL8 A;  3QIC A;  2D4W A;  4EP4 A;  4KB1 A;  3HVR A;  1NJI O;  2V52 B;  4B9L A;  1ASU A;  2QWO A;  3ZEU A;  2J4R A;  3FZL A;  2E2P A;  3KIO A;  4CJ4 A;  5EXW A;  3L6Q A;  4E7I A;  4IJA A;  4R5P A;  2HNY A;  3L2V A;  4CGF A;  4BC4 A;  4GV3 A;  3CCU N;  4DSJ A;  3CHW A;  4FW2 A;  4CJE A;  1SKR A;  3S3O A;  4BRG A;  4KHN A;  3LDP A;  1WBD A;  4A5B A;  3R6M A;  3SAH A;  3O3F A;  1NKE A;  4OPA A;  1NK7 A;  4RW9 A;  3VQ8 A;  2EHG A;  3VEV A;  3CET A;  4FWL A;  3G71 N;  4LF5 K;  4QS7 A;  4CBU A;  2Q31 A;  3TSQ A;  3NGZ A;  1WN7 A;  4MO5 A;  4BRD A;  4O4G A;  4CJK A;  1JJ2 M;  5JIC A;  1VRU A;  4BR7 A;  1Q18 A;  3O9Q A;  1MA9 B;  1ZXO A;  3JXU A;  1EX4 A;  3O6W A;  4BY9 C;  1HX1 A;  3S41 A;  4J2B A;  2UYT A;  1KRP A;  2G8U A;  4CF1 A;  5FDL A;  1WSH A;  3SBG A;  3E01 A;  3ZEU B;  1SL0 A;  1W7A A;  1KLM A;  4EIA A;  2ASP A;  4A57 A;  3P5J A;  2NNW A;  4BRF A;  2ZJP L;  4E3S A;  1WUA A;  3L2Q A;  1VAZ A;  3KLH A;  4CER A;  1ZBI A;  2O4I A;  3J8A A;  1FKP A;  2QTD A;  4H0Y B;  5JLF A;  3OYA A;  3V81 A;  2KTQ A;  2GEM A;  3LM2 A;  5K14 A;  2GBZ A;  4O8K A;  4C8O A;  2NZT A;  3D2E A;  4AHS A;  2ASO A;  5LY3 A;  4NYN A;  5AFU H;  3ZSR A;  1RTI A;  4I6M A;  2Z1I A;  4DSL A;  2HHU A;  3NDK A;  4JKC A;  3L8B A;  1HNW K;  3SV3 A;  4WQ5 A;  3JSM A;  1BOT O;  3VQQ A;  4CBW A;  3THY A;  3KD1 E;  3Q7C A;  4DHY A;  4OPJ A;  2Z1G A;  4DFJ A;  1WSJ A;  1FXX A;  4MQ3 A;  3WNG A;  3B6P A;  2F4V K;  1VSK A;  5AFU A;  3CFR A;  2P9K A;  1FW6 A;  2FXU A;  4B9Q A;  4CZH A;  2I5J A;  5AZI A;  1J6Z A;  3ZX2 A;  3TPQ A;  1IBK K;  3ZT2 A;  5FPM A;  2UUB K;  4JKG B;  1N33 K;  4ZHR A;  4NCB A;  3SUO A;  2E2N A;  1QS4 A;  1FKO A;  3I0R A;  4GY2 B;  3V9W A;  1IJJ A;  5C42 A;  2P1J A;  1Q82 O;  5FPN A;  4CZG A;  3LL3 A;  2QWQ A;  4M63 C;  4RW7 A;  3CCL N;  3DMJ A;  3H3N O;  4CZL A;  3CCS N;  2BH1 A;  1QQO A;  2OA8 A;  5C12 A;  1EWQ A;  4JI8 K;  3SCX A;  4DR1 K;  2OCE A;  1K8K A;  5JS2 A;  3RR8 A;  1QSL A;  3THY B;  3GDQ A;  4C8L A;  1DKG D;  1L3U A;  4CEA A;  4ICL A;  3V9X A;  4DV6 K;  4W5Q A;  2HMI A;  1J5O A;  1W9H A;  3O3H A;  3NBP A;  5AZI B;  4CEZ A;  3CF5 L;  2A3Z A;  4FK4 A;  2D0P A;  4JI5 K;  3HXM A;  4BE0 A;  1LAW A;  4W5R A;  5EU7 A;  4IFY A;  2OPR A;  1NK4 A;  3VMF B;  3QO9 A;  3MCA B;  1X9M A;  3MN5 A;  4MFB A;  3PO5 A;  2Q97 A;  1LWE A;  1KAX A;  4JI1 K;  4KAZ A;  3LP2 A;  2Q1N A;  1I3A A;  4FJH A;  2BGG A;  4JI4 K;  1NG9 A;  2HVH A;  4LFB K;  2RKI A;  3TR8 A;  4JI2 K;  3ZSY A;  4DSF A;  3AAR A;  3M3Z A;  1LAV A;  1TL3 A;  2Q0R A;  4B1Y B;  4FO0 A;  4FJJ A;  3ZET A;  1HYZ A;  2VGN A;  4JLH A;  1NK5 A;  2NRT A;  3LDO A;  4Q5V A;  4OJR A;  4DCH A;  3EZ5 A;  2O8C A;  4OLA A;  2P5O A;  1NGH A;  3VQ5 A;  3T1Y K;  2FF6 A;  1HNZ K;  2YKM A;  1LW2 A;  5BPN A;  3TAQ A;  3TAF A;  3AA5 X;  2VG6 A;  5J1E A;  3J80 O;  3ZSQ A;  1K6Y A;  1RBV A;  3CJ1 A;  2FBY A;  1RBU A;  1N5Y A;  3FZH A;  3HST B;  3FFI A;  1B9D A;  4MDA A;  4F8R A;  1JCE A;  1T44 A;  3CCE N;  1VQO N;  3AVL A;  3LDN A;  3LAK A;  4IBN A;  5H1S Q;  3NHG A;  3CCM N;  3VTH A;  1WAJ A;  2KQ2 A;  1Q9Y A;  2IVN A;  1HKB A;  3J7Z O;  3UKR A;  1IV0 A;  4E1J A;  2Z1J A;  1NOY A;  4CEB A;  4B08 A;  4HWI A;  4WFA L;  3AVH A;  3SQ4 A;  4I7F A;  2F7T A;  1JXE A;  3DJC A;  4BC2 A;  3CXC M;  5JMV A;  3ZCM A;  3ENO A;  5IT9 O;  2WBN A;  2X74 A;  3P4I A;  3ZET B;  3QEV A;  4CZM A;  4DSK A;  4CGJ A;  1EP4 A;  3PX6 A;  1NGJ A;  3MAQ A;  2E1Y A;  4CD1 A;  2ZJQ L;  5DMR A;  3C95 A;  4DFP A;  2NRH A;  5C24 A;  2GEL A;  1U2V A;  1RTD A;  3AGR A;  3CIP A;  3QEI A;  3MK6 A;  3PY8 A;  4BE2 A;  4BDP A;  5AQR A;  1YIT N;  1YHQ N;  3DLL L;  1XHZ A;  1GOA A;  3W0L A;  4JI7 K;  4Z4H A;  1NK6 A;  3O1B A;  1MU2 A;  4KHY A;  4AF1 A;  5HOO A;  3L0Q A;  3DLB A;  1J53 A;  3GE1 A;  1P8Z A;  4FLU A;  1NGB A;  3QES A;  4J2E A;  4XH1 A;  4YOY A;  3VES A;  3Q7B A;  1GLC G;  3D2F B;  2JLE A;  2YV0 X;  4FOI A;  3EKS A;  3V4I A;  3ZLJ A;  2YKN A;  3SAF A;  4U7B A;  2Q3S A;  1QVG M;  4QAG A;  3K0S A;  3VQD A;  4JI3 K;  4CF0 A;  3A2F A;  2RHK A;  3HT3 A;  3KK3 A;  1ZYQ A;  1TV6 A;  3NF8 A;  4FK2 A;  3ENH A;  1K8A O;  2HBJ A;  4GVE A;  4H0O A;  1KAY A;  4M3Z A;  5CZ1 A;  3CYM A;  4IG3 A;  4KI4 A;  4WCE L;  4C8M A;  1MWK A;  4K8X A;  3OJS A;  4KPY A;  4CIG A;  5BN9 A;  3LZJ A;  3HJF A;  2Q2R A;  4N76 A;  2P9N A;  2QWR A;  3M8P A;  3OYI A;  4JAX A;  3CC4 N;  4E7J A;  4FLT A;  4WF9 L;  3KKS A;  3UB5 A;  4HUF A;  1LOT B;  2HF4 A;  3H46 O;  1BI4 A;  4QS9 A;  4J2A A;  4FLW A;  3HPH A;  4CGH A;  4IOA L;  3CJA A;  1NGI A;  1Z26 A;  3H45 C;  2GX9 A;  4B1W B;  3CJ7 A;  4EZ6 A;  4JKB A;  1OVY A;  3KWG A;  3RMA A;  4IWV A;  4OLB A;  3F9M A;  1KVA A;  1OH7 A;  5KGX A;  1E4G T;  4BWJ A;  1NJZ A;  1HR0 K;  2E5L K;  1VQ8 N;  3CCJ N;  1CXQ A;  4RW8 A;  1U4B A;  1VQ4 N;  4JD2 A;  3VEN A;  1HYV A;  2B5J A;  1REV A;  2E20 A;  2FSJ A;  1HNV A;  4ZTJ A;  3SBT A;  2IVP A;  3MEC A;  3V1O A;  4G9Z A;  1JLG A;  3WT0 A;  3DWL A;  4OKJ A;  3KK7 A;  5M1K A;  3TAG A;  1JCG A;  3KLG A;  4U67 L;  4I2P A;  4EHU A;  2ZGY A;  1BI4 B;  2PFU A;  3KZB A;  4OGC A;  3RRH A;  4GVM A;  3CC7 N;  4Z4C A;  2KZM A;  3T3F A;  4FM0 A;  1ASW A;  1IH7 A;  3NMU A;  4A62 A;  1HPM A;  3MWP A;  3AA2 A;  4BRI A;  3QDK A;  4HTL A;  1ZC6 A;  5AQU A;  3MX2 A;  3SQ1 A;  5AQG A;  1JCF A;  1X3N A;  4JKH A;  4GV9 A;  1YAG A;  4Q0B A;  4KRF A;  1GLB G;  4YOR A;  4LSN A;  2O8F A;  5AQK A;  4JEP A;  4JN4 A;  4GKJ K;  5E41 A;  3PLA A;  1TK5 A;  2H3G X;  3O8M A;  5KPR A;  4A5A A;  4CVN E;  4JD2 B;  3VTI A;  5M1F A;  4DU3 A;  3VPZ A;  3DXM A;  4H4M A;  2OZM A;  1HKC A;  1C0M A;  3T19 A;  1HJR A;  1JLA A;  1VSH A;  4WQ4 A;  4B3O A;  1JL1 A;  2NLX A;  2O8B A;  4I9L A;  2IVO A;  4JRQ A;  4RCH A;  3I55 N;  3VF6 A;  5KTQ A;  5KRS A;  4BC3 A;  1TVR A;  4FOE A;  1JXB A;  5TKY A;  3VET A;  3C6H A;  1RT1 A;  2QWN A;  3C7N A;  3A5M C;  3ZSZ A;  1BUP A;  1RT7 A;  2E2O A;  4CEC A;  4DFM A;  3MCP A;  2P9L B;  4FWS A;  5TKW A;  1M1K O;  3NF9 A;  3R1X A;  3WXL A;  5KGW A;  1YJN N;  1RT2 A;  2A6A A;  1EO1 A;  4KI6 A;  3P39 A;  1S6P A;  4CI6 A;  4YOU A;  5T7B A;  2VWB A;  4AM6 A;  5AQV A;  4BWM A;  1JKH A;  3AY9 A;  5AQY A;  3NF7 A;  3PSF A;  1S9G A;  1NMN A;  3SNN A;  3CPW M;  1H1V A;  3CQX A;  3LPU A;  5GIN A;  3SI6 A;  3O9U A;  2YNI A;  4DQS A;  4O55 A;  1QZ6 A;  3DXM B;  3ASM A;  3PX0 A;  4BRO A;  4CF2 A;  3M8S A;  3ZSV A;  2WFB A;  4CZI A;  3THX B;  4O0I A;  4CGI A;  2P9I A;  4BRL A;  4XH5 A;  4FCY A;  1BIS A;  5KQD A;  4JYA K;  3SV4 A;  2QK9 A;  4E7L A;  2QEX N;  2O8D A;  1C6V A;  1S6Q A;  1YVU A;  2A42 A;  1LWF A;  4JRP A;  4UY8 O;  4B1Z A;  1D5A A;  2A1S A;  3LZI A;  5AQH A;  3MEE A;  4DUZ K;  3VOV A;  4DTN A;  2PZS A;  3IRX A;  1T8E A;  4OPH A;  3CJ9 A;  3G6E N;  4DR6 K;  3T1H K;  5SWM A;  3QFP A;  3LAN A;  2ITG A;  3CC2 N;  4KTW A;  3BZK A;  4H5N A;  3CJB A;  3M5R A;  1HNI A;  1RBT A;  3CFO A;  4H4O A;  1WSG A;  2IIR A;  1E4F T;  1S1X A;  5J2P A;  3L2W A;  4JS5 A;  4PKG A;  3VEZ A;  1NGG A;  1YJ9 N;  5BR9 A;  2D5R A;  3L4Q A;  4KRE A;  4HUE A;  1GLD G;  1KSP A;  2P9I B;  1HRH A;  2HHH K;  2FC0 A;  2GWJ A;  3AGK A;  3WNH A;  3O08 A;  4YOV A;  1XWL A;  2A5X A;  3WQU A;  1VQL N;  2HHW A;  2O8D B;  5BPL A;  4AHC A;  1WSI A;  2XY6 A;  4FWN A;  4M3Y A;  5GIO A;  3BEX A;  2UUC K;  4BAC A;  3UIQ A;  4B3R K;  3CG7 A;  4DSI A;  4BE1 A;  4YDU A;  3ZT4 A;  1NNE A;  1D8Y A;  3TAE A;  1TYQ A;  4LH4 A;  1WBB A;  3D45 A;  2O4G A;  3AAQ A;  1RIL A;  4C1N K;  3GBT A;  3O1W A;  4C23 A;  3P83 D;  3QFU A;  2CGL A;  4NCG A;  1NGC A;  4KV8 A;  4PY5 A;  1C1A A;  4ISE A;  1RDD A;  1NWK A;  3OYL A;  4BDY A;  4DV7 K;  3FZK A;  3WXM B;  3M6G A;  4FJX A;  1S1V A;  3E66 A;  3MXM A;  4FSV A;  1EXQ A;  3ZX3 A;  1IG9 A;  4DKW A;  4JKG A;  4CJ7 A;  1ATS A;  3NGY A;  1IKW A;  1DLO A;  4FVU A;  5HL7 L;  4BR4 A;  1I39 A;  3BGR A;  1VQ5 N;  1HYS A;  3ZSW A;  4CCH A;  4AHV A;  4DS4 A;  3G0Z A;  2D0A A;  1S1T A;  5BRH A;  5GIP A;  4FWM A;  4JK9 A;  2HHS A;  1QHT A;  2XO7 A;  1IKX A;  1TYQ B;  4FLY A;  3F73 A;  3T69 A;  2WOM A;  1XQS C;  4BRM A;  4H0X B;  4W5T A;  3RSE B;  1DEJ A;  5M1O A;  3DOK A;  2ETJ A;  1R59 O;  3AVA A;  4DTJ A;  1HLU A;  3U9Z A;  4FJI A;  2QXL A;  3JYT A;  3C0B A;  2E2Q A;  4NXM K;  4J2D A;  1BL3 A;  1IG8 A;  2FBX A;  2OYQ A;  4M3W A;  1RT4 A;  3MXI A;  2F9T A;  1EKE A;  5E26 A;  1NKB A;  2NUB A;  3DAW A;  1A5X A;  3O80 A;  3EE9 A;  1L5U A;  1KFS A;  1BO5 O;  3FGU A;  1NK0 A;  1Z05 A;  5ADX H;  2ZQB A;  5GAH P;  1WB9 A;  3VN5 A;  2YHB A;  2HND A;  4DTO A;  2FBV A;  4DB3 A;  5BRE A;  3OYM A;  1RBS A;  3V9U A;  3QIP A;  4K0K K;  3KLF A;  1DTT A;  2Z1H A;  3QER A;  1J9A A;  5JVH L;  2F9W A;  1JL2 A;  2P9P A;  5C2F A;  5ADX A;  4GKK K;  2NRV A;  4I9Q A;  1VQP N;  3WEE B;  3OYB A;  4NYF A;  4DQI A;  1T6C A;  4O0J A;  4QCL A;  1IKV A;  1RT3 A;  2PAV A;  3O5B A;  4BG9 A;  1YIJ N;  4A2B A;  4R79 A;  1NMD A;  4V19 S;  3OA9 A;  5AQM A;  2ASM A;  2JGU A;  4AM7 A;  3GL1 A;  1WSF A;  3F2K A;  4DTP A;  1LV5 A;  4XH4 A;  2Q0U A;  4GW6 A;  3CME N;  4BR2 A;  3K5O A;  3DLE A;  4DV3 K;  3RVC A;  1RT6 A;  3OVN A;  1N32 K;  3KLI A;  4WE1 A;  3HZ6 A;  3K2P A;  5KPZ A;  3KD5 E;  4F3T A;  3ISN C;  4CEE A;  4QOZ B;  2P9P B;  1SQK A;  3E9P A;  4RW6 A;  1FJG K;  2HBM A;  3U3Y A;  2D0O A;  1IO2 A;  1IKY A;  1U48 A;  2EWS A;  2BAN A;  4OX9 K;  2I7P A;  2A40 A;  3EE8 A;  4TSX A;  1BGX T;  4BRA A;  4JHD B;  4H0V B;  3OW2 M;  4LF8 K;  1B92 A;  4AHU A;  4M7Y A;  1VSJ A;  3HTV A;  4HHT A;  5AQQ A;  5KRT A;  4DLE A;  3DI6 A;  3TTC A;  4CJV A;  4GV6 A;  1YUW A;  5AR0 A;  3ZX0 A;  3J7A P;  4DV1 K;  3M1F A;  1GLE G;  3AV9 A;  3H6E A;  4PWD A;  3BY5 A;  2KW4 A;  3NH2 A;  4JKD A;  1QQC A;  4W5N A;  4DTS A;  3V1Q A;  4QS8 A;  3T1A A;  1HNX K;  5J2N A;  4CGD A;  4N5S A;  1YTU A;  4N41 A;  4DLG A;  1XUP O;  2YX6 A;  3CPE A;  1NLV A;  4LF4 K;  2D0C A;  2ZM6 K;  3M8R A;  3D2F A;  3G4S N;  1UAX A;  3HBT A;  1VSD A;  2UXB K;  2KHO A;  4B8A B;  5GAE P;  4M3X A;  3LP1 A;  4CHY A;  2OTL N;  4FK0 A;  4H03 B;  3P38 A;  5CZ2 A;  3VEX A;  2KZZ A;  1G99 A;  1RDU A;  4JKF A;  2FF3 B;  3OBW A;  2QWP A;  4BVP A;  2VG7 A;  3PV8 A;  4FJK A;  1S5J A;  4PL8 A;  3QET A;  3AVI A;  1RGI A;  2WON A;  3ZT0 A;  4PKI A;  4E89 A;  3VER A;  3HVT A;  4FWK A;  3B6O A;  3CMA N;  3TSU A;  3F5T A;  3HI0 A;  2HBK A;  3DRS A;  1GLJ O;  1UWB A;  3MN9 A;  3HOT A;  2YJF A;  1V4S A;  4C8K A;  1RTH A;  2BDP A;  3TSP A;  3VQE A;  5AQZ A;  3I8B A;  3N4Q A;  1QSY A;  1S9E A;  4CHO A;  3O9R A;  1UA1 A;  3SQ0 A;  3AVN A;  3NVM A;  4N47 A;  3RTV A;  4MLE A;  2G8I A;  1WNS A;  3AA3 A;  4BR9 A;  2G8V A;  1VK0 A;  5LJV A;  3C6T A;  5JVG L;  2V51 B;  3IAY A;  1BG3 A;  1L3V A;  4G1Q A;  4XEI A;  2W41 A;  3LP3 A;  3WXI A;  1C1C A;  4CZF A;  2HHT A;  3OYH A;  4DU1 A;  2UXD K;  4CIF A;  2HMP A;  4IFE A;  4OGE A;  2NRW A;  1SL1 A;  4FWQ A;  2E88 A;  4RWT A;  3OYF A;  3NF6 A;  3CI5 A;  4DR3 K;  4MO4 A;  4W5O A;  4O5B A;  4BQZ A;  3K5N A;  4NCA A;  2HF3 A;  3U4L A;  4CD3 A;  1BA1 A;  1EQY A;  4FPA A;  1U47 A;  2B6A A;  3SQ2 A;  4K25 A;  3AVJ A;  4DTM A;  1CXU A;  1CLQ A;  2QM1 A;  3OJU A;  4M41 A;  1KVC A;  4FPB A;  4FJN A;  1S72 N;  4IOC L;  3SUN A;  1S22 A;  4CJQ A;  4B1V A;  1HUX A;  2PYJ A; 
#chains in the Genus database with same CATH homology
 3E01 A;  4I2Q A;  3ULD A;  3LPU A;  3SI6 A;  3SNN A;  1KLM A;  1SL0 A;  4HCB A;  4HCC A;  3P5J A;  2YNI A;  4CJW A;  3AO2 A;  3VQ9 A;  3LPT A;  2HVI A;  3K58 A;  1EET A;  4DQS A;  4E3S A;  3QIO A;  4E7H A;  3RMC A;  4O55 A;  3L2Q A;  1U49 A;  3KLH A;  3IS9 A;  2DFH A;  4CER A;  1ZBI A;  2O4I A;  3S3N A;  2HHQ A;  1FKP A;  3ASM A;  3PX0 A;  4JS4 A;  5HLF A;  4KKO A;  3OYA A;  1U04 A;  4CF2 A;  3K5M A;  3V81 A;  3M8S A;  1FK9 A;  1WLJ A;  1WSE A;  3S9H A;  2KTQ A;  2RN2 A;  5K14 A;  3ZSV A;  2GBZ A;  3U6F A;  4C8O A;  4FJ7 A;  4CF8 A;  4O0I A;  4CGI A;  4AHS A;  3AO3 A;  3RMD A;  3TAB A;  1RT5 A;  3DRR A;  4NYN A;  3OYJ A;  3ZSR A;  3HO1 A;  1RTI A;  1Y97 A;  1ZBF A;  1RDA A;  2Z1I A;  4DTR A;  4DSL A;  4FCY A;  3NGI A;  3KTQ A;  2IAJ A;  1BIS A;  2HHU A;  3NDK A;  4CHP A;  3L8B A;  3SV3 A;  3QNN A;  4HUG A;  3SV4 A;  3JSM A;  3VQQ A;  4CE9 A;  2QK9 A;  4E7L A;  1TAQ A;  3KD1 E;  1C6V A;  1S6Q A;  3NF7 A;  3PO4 A;  4OPK A;  1YVU A;  1LWF A;  4JRP A;  4OPJ A;  1D5A A;  2Z1G A;  4DFJ A;  1X9S A;  1WSJ A;  2A1S A;  1FXX A;  4AHR A;  3CFP A;  3LZI A;  4BDZ A;  4MQ3 A;  3WNG A;  1Q8I A;  3IG1 A;  3MEE A;  3B6P A;  1VSE A;  4DS5 A;  1VSK A;  1YTA A;  4DTN A;  3IRX A;  2PZS A;  1T8E A;  1C0T A;  3CFR A;  2LSN A;  3L3V A;  2I5J A;  4FLZ A;  3KKR A;  2X6N A;  4CFA A;  1KLN A;  5SWM A;  3ZT2 A;  4CJ5 A;  3VQC A;  3LAN A;  4OKK A;  2ITG A;  2VWJ A;  4KTW A;  4FZZ A;  4ZHR A;  4NCB A;  1NJX A;  3AO1 A;  1HNI A;  1RBT A;  4IDK A;  4E1N A;  4DTU A;  2GV9 A;  3SUO A;  5CYQ A;  3CFO A;  4DG1 A;  4H4O A;  1J54 A;  1QS4 A;  1WSG A;  1FKO A;  4FJG A;  1S1X A;  3HK2 A;  1KVB A;  3I0R A;  5J2P A;  3L2W A;  3V9W A;  1ZBH A;  5C42 A;  2P1J A;  4JS5 A;  2XY7 A;  4Z4E A;  2OPQ A;  1X1P A;  1JLE A;  4KHS A;  4FXD A;  3THV A;  2D5R A;  2IGI A;  4KRE A;  2EX3 A;  4RW7 A;  4HUE A;  3DMJ A;  2D0B A;  4CEO A;  1JLQ A;  1KSP A;  2DY4 A;  1HRH A;  3OS2 A;  3O4Q A;  1N6Q A;  2OA8 A;  2FC0 A;  3L2U A;  4B9T A;  3WNH A;  4LY7 A;  3OYD A;  3AVM A;  1HQU A;  1B9F A;  3LP0 A;  4M3U A;  3SCX A;  3TAM A;  3CM5 A;  4ELU A;  1XWL A;  4Z4I A;  5JS2 A;  1T03 A;  2G8W A;  3RR8 A;  5HRN A;  4M3R A;  1QSL A;  2HHW A;  2XY8 A;  3SPY A;  4AHC A;  2PYL A;  4B9U A;  1WSI A;  2XY6 A;  4C8L A;  4M3Y A;  3SZ2 A;  4Z4G A;  4Z4F A;  1A5V A;  2AJQ A;  1L3U A;  4CEA A;  4UQG A;  1BQN A;  4BAC A;  3UIQ A;  4ICL A;  4E1M A;  3V9X A;  3V9S A;  4KHW A;  3CG7 A;  4W5Q A;  3QEX A;  2HMI A;  4DSI A;  2YNF A;  4BE1 A;  3ZT4 A;  4CK1 A;  4HVJ A;  1J5O A;  5SZT A;  3TAE A;  1D8Y A;  1W9H A;  3O3H A;  3NBP A;  4LH4 A;  1XC9 A;  3D45 A;  3VQB A;  2O4G A;  4CEZ A;  1RIL A;  3SYZ A;  5J2Q A;  1F21 A;  1ITG A;  5CY4 A;  4FK4 A;  3V9Z A;  3U3G A;  3P83 D;  2B4J A;  3HXM A;  4NCG A;  4BE0 A;  4PY5 A;  4KV8 A;  1C1A A;  1LAW A;  3QIN A;  3DLG A;  4IFV A;  5EU7 A;  4W5R A;  1RDD A;  4BDY A;  1CZ9 A;  3OYL A;  3AVC A;  4IFY A;  3NAE A;  1WAF A;  4FJX A;  2OPR A;  4FZY A;  1CZB A;  1NK4 A;  1S1V A;  3QO9 A;  3MXM A;  1X9M A;  4B8C A;  3PO5 A;  4MFB A;  1EXQ A;  1LWE A;  4CJ3 A;  4KAZ A;  1VRT A;  3LP2 A;  1IG9 A;  1I3A A;  3C94 A;  4FJH A;  2BGG A;  1YT3 A;  4FVM A;  1RDB A;  2BE2 A;  4CJR A;  3OYN A;  2HVH A;  2RKI A;  3NGY A;  1IKW A;  3TR8 A;  3ZSY A;  3NH0 A;  1DLO A;  1QSS A;  4FYD A;  4DQR A;  4DSF A;  1TAU A;  1I39 A;  3BGR A;  1LAV A;  1TL3 A;  3H08 A;  3ZSW A;  3SUP A;  1HYS A;  4CFC A;  4FJJ A;  1HYZ A;  4CCH A;  4CFB A;  4Y1C A;  4AHV A;  4DS4 A;  4IKF A;  5JS1 A;  1RNH A;  3DLR A;  4JLH A;  3K59 A;  3V6D A;  1NK5 A;  4Q5V A;  4OJR A;  1GOC A;  3EZ5 A;  4K8Z A;  3QEW A;  2P5O A;  3S3M A;  4OLA A;  2XRI A;  1SL2 A;  4DSE A;  3G0Z A;  2A1R A;  2D0A A;  3VQ5 A;  1S1T A;  4ELT A;  1BIU A;  2YKM A;  1LW2 A;  5I3U A;  3ZT3 A;  3DLH A;  4LH5 A;  1L3T A;  3TAQ A;  3TAF A;  2HHS A;  1QHT A;  3AA5 X;  1NK9 A;  2XO7 A;  2VG6 A;  5J1E A;  3NE6 A;  1IKX A;  3ZSQ A;  4FLY A;  1K6Y A;  2HHX A;  1RBV A;  3DOL A;  2IDO A;  2QXF A;  2FBY A;  1RBU A;  2WOM A;  3F73 A;  4W5T A;  1NK8 A;  1N5Y A;  4F2R A;  3HST B;  3DOK A;  1GOB A;  1A5W A;  2ETJ A;  3AVA A;  1B9D A;  3FFI A;  4DTJ A;  1UA0 A;  4FJI A;  3JYT A;  4PUO A;  4F8R A;  3AVL A;  2QKK A;  4J2D A;  1S1W A;  1BL3 A;  3DYA A;  2DFE A;  4AH9 A;  2FBX A;  4DTX A;  3LAK A;  4IBN A;  2OYQ A;  3NHG A;  3AA4 A;  4M3W A;  1RT4 A;  1VSI A;  2F8T A;  3MXI A;  4LSL A;  3LAM A;  1EKE A;  1TKD A;  4KHQ A;  2HB5 A;  2NUB A;  4FW1 A;  1A5X A;  4KFB A;  1NKB A;  4FJL A;  1WAJ A;  2KQ2 A;  4FM1 A;  1Q9Y A;  3AVG A;  5FRM A;  3QLH A;  5FRN A;  1TK0 A;  3PUF A;  1SKW A;  3CQ8 A;  1L5U A;  1TKZ A;  1KFS A;  5DK5 A;  2Z1J A;  1NOY A;  4CEB A;  3NH1 A;  4B08 A;  1NK0 A;  1U45 A;  3AVH A;  3SQ4 A;  2ZQB A;  4I7F A;  3VN5 A;  1JXE A;  4PA1 A;  3LDS A;  2YHB A;  1TKX A;  2HND A;  4DTO A;  2FBV A;  3C6U A;  3OYM A;  3ZCM A;  1RBS A;  1C0U A;  1VSL A;  4FZX C;  4FJ9 A;  1VSM A;  2YHA A;  2X74 A;  3V9U A;  3QEV A;  4DSK A;  4DQQ A;  4CGJ A;  1ZBL A;  1EP4 A;  3VQ6 A;  1L3S A;  3PX6 A;  3QIP A;  3KLF A;  1DTT A;  2Z1H A;  3OYE A;  3MAQ A;  4KTQ A;  2G8H A;  4DF4 A;  5DMR A;  4CEQ A;  3C95 A;  4DFP A;  3QER A;  1J9A A;  4AHT A;  5C24 A;  1JL2 A;  2ATQ A;  1RTD A;  1QE1 A;  3QEI A;  3F9K A;  1BCM A;  3KK2 A;  3PY8 A;  4BE2 A;  3L2R A;  4BDP A;  2Y1J A;  4I9Q A;  4IG0 A;  2QKB A;  4F4K A;  3LWL A;  3OYB A;  1RTJ A;  4NYF A;  1XHZ A;  4DQI A;  4RG8 A;  1HQE A;  1GOA A;  4O0J A;  4QCL A;  1IKV A;  4C8N A;  4LD0 A;  4L8R B;  4KHU A;  4Z0U A;  4Z4H A;  4DWI A;  1RT3 A;  1NK6 A;  1MU2 A;  1TKT A;  4KHY A;  1LW0 A;  3O4N A;  3DLB A;  3PX4 A;  1J53 A;  4KB0 A;  4FLU A;  4J2E A;  3QES A;  3CM6 A;  2X6S A;  4B9V A;  3ITH A;  3DRP A;  4OKE A;  4M3T A;  3OYG A;  1ZBU A;  4CJL A;  2JLE A;  1NKC A;  2YV0 X;  3V4I A;  1Z25 A;  2JGU A;  4KTZ A;  3EYZ A;  3HP9 A;  5HP1 A;  3AVK A;  2YKN A;  3ZSO A;  4GMJ B;  5HRS A;  2Q3S A;  1WSF A;  3VQ4 A;  4XIU A;  4QAG A;  2HNZ A;  4CES A;  4DTP A;  2P5G A;  3L3U A;  3OS1 A;  3VQD A;  1LV5 A;  3BDP A;  4CF0 A;  3A2F A;  4GW6 A;  3HT3 A;  3KK3 A;  2E6M A;  4AIL C;  1ZYQ A;  1Q9X A;  1HPZ A;  3O3G A;  1TV6 A;  1NJW A;  4FJM A;  3NF8 A;  1C1B A;  3LWM A;  4FK2 A;  3K5O A;  3DLE A;  2YNG A;  2DFF A;  2PY5 A;  4ZTF A;  4DU4 A;  2XY5 A;  4M3Z A;  4DMN A;  3HM9 A;  5CZ1 A;  3CYM A;  1RT6 A;  4IG3 A;  4CF9 A;  3OVN A;  4KI4 A;  5D3G A;  3KLI A;  4C8M A;  2YNH A;  1TGO A;  4WE1 A;  3KK1 A;  2KFZ A;  4K8X A;  2ZE2 A;  2FBT A;  3K2P A;  3KD5 E;  3OJS A;  1T05 A;  4F3T A;  3AVF A;  1XHX A;  4KPY A;  3ISN C;  2E4L A;  4CIG A;  4CEE A;  3LZJ A;  4QOZ B;  2HW3 A;  3HJF A;  3SPZ A;  5HRO A;  4RW6 A;  1RBR A;  1R0A A;  4FM2 A;  3U3Y A;  4N76 A;  1IO2 A;  1IKY A;  1U48 A;  4FJ5 A;  2BAN A;  3M8P A;  4B9M A;  5FRO A;  3OYI A;  4M45 A;  3K57 A;  4TSX A;  1BGX T;  4RW4 A;  4CHN A;  3OYK A;  3QNO A;  2P51 A;  1W0H A;  4E7J A;  1B92 A;  4YFU A;  4AHU A;  4FLT A;  3AO5 A;  1VSJ A;  3KKS A;  4HHT A;  1VSF A;  4HUF A;  2XHB A;  1SKS A;  3LAL A;  2VWK A;  5KRT A;  1BI4 A;  4DLE A;  1RDC A;  3DI6 A;  4CJV A;  4B9S A;  4J2A A;  4FLW A;  3HPH A;  4CGH A;  2OPP A;  4CK3 A;  4CK2 A;  4E7K A;  1D9D A;  1NOZ A;  3AV9 A;  3RMB A;  4CED A;  4PWD A;  1Z26 A;  2KW4 A;  3NH2 A;  1BQM A;  1SV5 A;  4CIE A;  1QQC A;  4YNQ A;  2OZS A;  1T7P A;  3TWH A;  4W5N A;  3TAP A;  4EZ6 A;  2ZD1 A;  4FLX A;  3HPG A;  4DTS A;  3V1Q A;  2DTU A;  3RMA A;  3T1A A;  3DLK A;  3EY1 A;  4CGD A;  5J2N A;  5HRP A;  2G8K A;  4N5S A;  4EP5 A;  4OLB A;  1YTU A;  4CHQ A;  4N41 A;  1KVA A;  4DLG A;  5KGX A;  1HMV A;  3VA0 A;  3I8D A;  4BWJ A;  3VQA A;  1NJZ A;  5HBM A;  4FLV A;  1KCF A;  1NJY A;  1RCH A;  2D0C A;  1CXQ A;  2VG5 A;  3M8R A;  2R7Y A;  4DQP A;  1BCO A;  3I0S A;  3RWU A;  4RW8 A;  1UAX A;  1ASV A;  5CYM A;  4EZ9 A;  4F3O A;  1VSD A;  1U4B A;  3OYC A;  1HYV A;  2B5J A;  1REV A;  4B8A B;  3G10 A;  3KLE A;  5HRR A;  3TI0 A;  3LP1 A;  4CHY A;  1HNV A;  4M3X A;  4ZTJ A;  4FK0 A;  1SUQ A;  3ZSX A;  4M42 A;  3MEC A;  1KFD A;  3V1O A;  1JLG A;  2IS3 A;  4OKJ A;  5CZ2 A;  2KZZ A;  3TAG A;  1D9F A;  1O1W A;  3NFA A;  3K5L A;  2HHV A;  4ID5 A;  4CJU A;  3KLG A;  3P1G A;  2E6L A;  4CJS A;  5C25 A;  1BHL A;  3AVB A;  4CJF A;  4E19 A;  3OY9 A;  2IOC A;  2VG7 A;  3HP6 A;  4I2P A;  3PV8 A;  2X78 A;  5I42 A;  3RRG A;  1BI4 B;  3VA3 A;  4B9N A;  4FJK A;  1S5J A;  3QET A;  2G8F A;  4FJ8 A;  3AVI A;  4PQU A;  4OGC A;  3M8Q A;  2WON A;  3RRH A;  4DF8 A;  4GVM A;  3ZT0 A;  4Z4C A;  2KZM A;  3MEG A;  4E89 A;  3T3F A;  3MED A;  4FM0 A;  3HVT A;  1ASW A;  1IH7 A;  3AO4 A;  4CEF A;  4DFK A;  1DTQ A;  3AA2 A;  2F96 A;  3B6O A;  1LWC A;  4CHZ A;  1JLF A;  1G15 A;  3ALY A;  4CGG A;  3DRS A;  1UWB A;  4ELV A;  3SQ1 A;  3HYF A;  3DM2 A;  1UOC A;  3RR7 A;  1RTH A;  4O44 A;  4CJT A;  2BDP A;  4C8K A;  3VQE A;  3MXJ A;  4H8K A;  2OPS A;  4HTU A;  4CJP A;  1JLC A;  3HL8 A;  4Q0B A;  4KRF A;  4LSN A;  4EP4 A;  4KB1 A;  3HVR A;  2GUI A;  4B9L A;  4N56 A;  1QSY A;  1ASU A;  1S9E A;  4CHO A;  2IC3 A;  1UA1 A;  3SQ0 A;  3AVN A;  5E41 A;  1TK5 A;  5KI6 A;  3KJV A;  3KIO A;  4CJ4 A;  4N47 A;  2Y1I A;  3RTV A;  2G8I A;  1WNS A;  1TK8 A;  4E7I A;  1X9W A;  3AA3 A;  4DU3 A;  3ZT1 A;  2G8V A;  1VK0 A;  2RPI A;  4R5P A;  3NCI A;  1S1U A;  3C6T A;  4H4M A;  4F2S A;  5J2M A;  2HNY A;  3IAY A;  3L2V A;  2OZM A;  1C0M A;  3T19 A;  4CGF A;  1L3V A;  1HJR A;  1JLA A;  4G1Q A;  4DSJ A;  4FW2 A;  4CJE A;  1SKR A;  1VSH A;  3S3O A;  3LP3 A;  4KHN A;  4B3O A;  4OVL A;  1C1C A;  3OS0 A;  1JL1 A;  2HHT A;  3V1R A;  3OYH A;  4DU1 A;  4I9L A;  3O3F A;  4JRQ A;  1NKE A;  4CIF A;  1NK7 A;  4RW9 A;  3VQ8 A;  5KTQ A;  2EHG A;  4OGE A;  5KRS A;  1TVR A;  1SL1 A;  4Y1D A;  1JXB A;  3SUQ A;  1RT1 A;  3OYF A;  3NF6 A;  2RF2 A;  3NGZ A;  2F8S A;  3TAN A;  3ZSZ A;  3TAR A;  1QTM A;  4W5O A;  1WN7 A;  3D0P A;  2KFN A;  4O5B A;  1BIZ A;  3K5N A;  4CEC A;  1RT7 A;  4NCA A;  4O4G A;  4CJK A;  3VQ7 A;  1JLB A;  4CFD A;  4DFM A;  2W42 A;  3NF9 A;  1VRU A;  4ID1 A;  3HPO A;  3SJJ A;  2B6A A;  5KGW A;  1XI1 A;  1U47 A;  3SQ2 A;  1RT2 A;  4KO0 A;  1EX4 A;  4KI6 A;  1KTQ A;  1S6P A;  3AVJ A;  4DTM A;  1CXU A;  1TL1 A;  4J2B A;  5T7B A;  1CLQ A;  3OJU A;  1KRP A;  4M41 A;  1KVC A;  2G8U A;  4FJN A;  3WNF A;  3QEP A;  4E0D A;  4BWM A;  1JKH A;  4CF1 A;  5FDL A;  3WNE A;  3SUN A;  1WSH A;  4CJQ A;  1S9G A;  3VQP A;  2PYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...