1VSMA

Asv integrase core domain in citrate buffer ph 5.0
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
molecule keywords PROTEIN (INTEGRASE)
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsmA00
4FJXA 4FLTA 1HQUA 3NH2A 3KIOA 4CECA 4CGDA 2VWJA 2YNGA 3BGRA 2B4JA 3THVA 3MXIA 2XRIA 3LP0A 3LWLA 4CHQA 2E4LA 1RTIA 4FJHA 3AVGA 4YNQA 4DTMA 2ZD1A 3VQ6A 3OYBA 4FJNA 3SYZA 2VG6A 5HLFA 4F8RA 1FKPA 4CJPA 4YFUA 3TAQA 3ZT1A 2QKKA 1QSLA 4ID1A 4I9QA 3OJUA 2IS3A 3AA4A 4Z0UA 3QNOA 1C1BA 1J54A 1RBSA 2YNFA 4MQ3A 1RNHA 3NGYA 2HNDA 1TKTA 4DTOA 3T1AA 3MEDA 1LWFA 4DSJA 1S5JA 4J2EA 4IKFA 3H08A 4CIGA 4Z4EA 4IDKA 3V4IA 3TAPA 3NDKA 1CXUA 5HRSA 4FJ5A 4CEEA 3PX4A 3OYFA 4CHOA 4DTPA 4M3ZA 4KTQA 3MEGA 4LY7A 4PY5A 4HVJA 1QHTA 4CGFA 4DWIA 3SQ4A 4FJIA 4CCHA 4CFBA 3OYCA 3NGIA 3SCXA 2HHXA 2FBVA 4O0IA 4DSKA 1T03A 4MFBA 3ZSWA 4DSFA 4FXDA 3KLIA 2P51A 1LW2A 2LSNA 3AVMA 3I0SA 2OPQA 4CK2A 4CIEA 3TAGA 3U3YA 2G8VA 1HYSA 4CHNA 4E19A 1JL2A 1BIUA 1EETA 3HP6A 4AILC 5FRNA 2HHWA 5HRPA 4OJRA 1B92A 3SUQA 2OYQA 3TAMA 3F73A 1KFSA 3IS9A 1HPZA 2ETJA 4CEBA 1GOAA 4KV8A 4FJ8A 3G10A 4J2AA 1I39A 1TAQA 1WSHA 1RT6A 4RW8A 3LP3A 3VQAA 1T7PA 2HHVA 1RT2A 2OZMA 1NOYA 4CF2A 1BGXT 3QLHA 3PX6A 4RW4A 1SKRA 5KGWA 4CESA 2R7YA 1NJXA 4HTUA 5CZ1A 4DLEA 4DF8A 2DTUA 3HVRA 5FRMA 4QOZB 4CF8A 2XY7A 1TV6A 4IG0A 4KTWA 4ZTFA 1C1CA 3V9ZA 2GUIA 3SV3A 4Z4FA 1QE1A 4CJKA 4F2SA 4M42A 3EZ5A 4NCBA 2D0AA 4OLBA 1ZBHA 1S6QA 3TANA 1TKDA 4HHTA 4CIFA 4AHTA 2QK9A 4CF9A 1HYVA 4KFBA 4CK3A 4HUFA 4KTZA 1WLJA 3CFPA 4ZHRA 4FW2A 3CM6A 1BL3A 3CFOA 4CGJA 4M45A 4BWMA 3KK2A 3OYMA 4EZ6A 4N76A 3LAMA 4HUEA 5HRNA 4OKJA 4CF0A 4ELTA 3VQ8A 1L3TA 3IRXA 3U6FA 3VQPA 4CJWA 4CJRA 1A5XA 1C6VA 4DFMA 3DOLA 1BIZA 3HXMA 3DLGA 4DQRA 3HVTA 1TK5A 4CHPA 1KLNA 3L2RA 3KTQA 4OGEA 1D8YA 3LPUA 3LPTA 4BWJA 1BISA 1NK7A 2HVIA 4LD0A 4FJ9A 4KB0A 4B9LA 3V9XA 1CLQA 1UA1A 4J2BA 1Q8IA 2HW3A 3NBPA 3IAYA 2QKBA 1LW0A 3U3GA 4BE0A 4ICLA 1C1AA 1QS4A 3WNFA 1D9FA 4GW6A 3OYDA 5E41A 3I8DA 1RT3A 1TVRA 3AVJA 3ZSYA 3KD5E 3UIQA 4W5OA 3KLEA 1JKHA 4BE2A 4FVMA 3HJFA 3OVNA 2PYLA 3LDSA 3P83D 3QEXA 1XWLA 1WSEA 3AVCA 4ZTJA 3O3HA 4KO0A 4H8KA 4EP5A 4RW6A 3LP2A 5HRRA 4DMNA 3AO4A 3QEIA 4F4KA 3DRRA 1IKVA 4JS4A 1A5VA 5HROA 5SZTA 1C0MA 5T7BA 3OYGA 3VQCA 3OS1A 4FLZA 1NK6A 2P5OA 1WN7A 5DK5A 4M3RA 3KKSA 1W0HA 2RPIA 3HPHA 2FBXA 1TAUA 3ZT4A 3QEVA 4OVLA 1NJZA 1F21A 1SL2A 1NKEA 1RT7A 2X78A 3V6DA 4O4GA 4QAGA 3HPOA 3AVAA 4I2PA 4N41A 1YTUA 3ALYA 3MAQA 3NGZA 3ASMA 3C6TA 4M3YA 3DM2A 1HYZA 4CGHA 4F3OA 3AO3A 1RDDA 2XY8A 5J2MA 4FJMA 4M3TA 5CZ2A 4E7KA 4R5PA 1ZBUA 1S1UA 3WNGA 3JYTA 1U04A 3RMBA 4LSNA 3DMJA 5C24A 1VSIA 3E01A 3AVBA 3CM5A 3VQ5A 3RMAA 4FJ7A 4IFYA 3OYHA 3CFRA 4CE9A 4RW7A 3SUPA 4G1QA 3C94A 3SQ0A 4B9TA 3MXMA 1FK9A 3AA3A 1SL0A 4AHCA 4WE1A 4FZYA 3EY1A 1IKWA 4FLXA 3SUNA 4CJ4A 3QEPA 1JXBA 3V1RA 4DSLA 2BGGA 1Z26A 2HHQA 5DMRA 4DS4A 4DS5A 3V9UA 3TAEA 1T8EA 4I9LA 1C0TA 1ITGA 3RRHA 4CGIA 4DTSA 4FM0A 1BCMA 4OGCA 4L8RB 2FBTA 2KTQA 5JS2A 4CERA 2A1SA 3LAKA 3ZSOA 2W42A 1KCFA 1SUQA 3M8QA 1YT3A 4JS5A 3L2QA 1JLQA 4JRPA 3ZCMA 1X9SA 1JLCA 1NJWA 4CFAA 4FK0A 4QCLA 4FJLA 4N5SA 5K14A 2HHSA 2EX3A 1ASVA 3KK1A 2NUBA 2HNYA 2VG5A 2E6MA 4CJUA 3EYZA 1CZBA 1S6PA 3LP1A 4M41A 2HVHA 2VG7A 4OLAA 2P1JA 3ISNC 3AVIA 3HP9A 1KVCA 4H4OA 3NF8A 2X6NA 3RWUA 3M8RA 4HUGA 3LZIA 1N5YA 5C42A 4CHYA 3V9SA 2KW4A 1NK5A 1X9WA 1HRHA 1WNSA 3AV9A 4FCYA 3QNNA 3L2VA 4FYDA 1X1PA 4NYNA 1ASWA 1O1WA 1S9GA 3NF7A 3V9WA 3HYFA 2RN2A 1T05A 4DSIA 1HNIA 1UA0A 5J2NA 1VSEA 1VSDA 4Q5VA 4CEDA 1UWBA 2G8UA 4M3XA 4KPYA 4DFKA 5HP1A 4KI4A 5FDLA 1HNVA 2HMIA 4CJSA 1JXEA 4CFDA 1VSLA 3V1QA 3VA0A 1JL1A 2G8HA 4CJ3A 2ZQBA 1L3UA 1KRPA 3HO1A 4KRFA 3ZT2A 1WSJA 5J2PA 3PO5A 4Q0BA 4DG1A 1RTHA 1QQCA 1NK4A 3CYMA 1L3SA 3AVLA 4PQUA 2BDPA 3LWMA 3S3OA 5FROA 4FJJA 5KRSA 4K8ZA 3LANA 3V1OA 4DFJA 1U45A 4C8LA 2JLEA 3OYNA 4B9SA 1B9DA 3QO9A 4FW1A 2YHBA 3NH1A 3CQ8A 4FJGA 2EHGA 2ITGA 2OPPA 2BE2A 2OZSA 3OS2A 1TK8A 1HMVA 5KI6A 3WNHA 3OYLA 4B9MA 1RTJA 1BCOA 1Z25A 1RDAA 1BI4A 1WAFA 3HPGA 4E7IA 4KHNA 4HCCA 1WAJA 1HJRA 4B8AB 3S3MA 1IH7A 3QINA 2AJQA 3ZSVA 3PX0A 5JS1A 3T19A 3QEWA 4Z4GA 3MECA 3ULDA 3K57A 3T3FA 3RMDA 3NE6A 4ELUA 2Z1IA 1YVUA 4UQGA 5I42A 1REVA 4H4MA 5KGXA 4KHYA 1GOCA 1RBRA 1VSMA 3TABA 4ELVA 4C8NA 2RKIA 4B9UA 1ZBLA 3ZT3A 4DSEA 1J5OA 3D45A 1NOZA 1Q9XA 1WSIA 1TGOA 5CYQA 4CJFA 2RF2A 3QIOA 4FM1A 2DFEA 3TWHA 2YNIA 4DF4A 5CY4A 3VQEA 1IG9A 3A2FA 2IOCA 3AO1A 3HT3A 4W5NA 2Y1IA 1RT1A 1X9MA 3DI6A 2KZZA 2HHUA 4FJKA 3QETA 2WOMA 3VQ9A 1TL1A 1LWEA 3MXJA 3ZSRA 4E1MA 4RG8A 2OPRA 2D5RA 1JLFA 4Y1DA 3NF6A 4ID5A 3ZT0A 4GVMA 4B08A 4EZ9A 4DQIA 3DOKA 1S9EA 1SKWA 2Q3SA 4BDYA 1JLAA 5KTQA 4DFPA 3TARA 4AHVA 1WSFA 2YHAA 3SUOA 3OYKA 4JLHA 4AH9A 4CEZA 2BANA 3OYEA 3TAFA 4DTJA 2D0BA 1CZ9A 4CJEA 3NAEA 2ATQA 1RDCA 1CXQA 1ASUA 4CK1A 4Z4HA 1NK8A 3SV4A 3K2PA 3NHGA 3KD1E 3SQ1A 2YKNA 3RRGA 4E7LA 1NKCA 3K58A 2KZMA 5CYMA 2XY5A 1UOCA 3VQDA 3V81A 4LSLA 3L8BA 1SL1A 1I3AA 1U4BA 3F9KA 3AVNA 1VK0A 2O4GA 1BQMA 2KQ2A 3LZJA 3FFIA 4FM2A 4NCGA 3SZ2A 1QSSA 4CGGA 3AO5A 1WSGA 1VRUA 1VSJA 3NF9A 4CJLA 5HBMA 4EP4A 1HQEA 1IKYA 1LAWA 2GV9A 3AVKA 3C95A 3L3UA 3P5JA 4TSXA 3K59A 4DTXA 3NFAA 4OKEA 3ZSQA 3IG1A 4DLGA 4DQPA 4CFCA 4FZZA 1L5UA 4KHSA 1J53A 4DU4A 4AHUA 1RT5A 2IGIA 5J2QA 3OYIA 4FZXC 1J9AA 1D9DA 2Y1JA 4E7HA 3HSTB 1R0AA 4PWDA 2YV0X 2Z1HA 4F2RA 5EU7A 4E3SA 3RR8A 1YTAA 4M3WA 4CJTA 4JRQA 1VSHA 4I2QA 2X74A 3CG7A 1DLOA 1NK9A 4OPKA 4HCBA 4BACA 3O3FA 4B9VA 4BE1A 2OPSA 2IC3A 3S9HA 4AHSA 4CF1A 3KLGA 4CHZA 3HK2A 1DTQA 2VWKA 1RBVA 3DRSA 2G8WA 1G15A 1KVBA 4GMJB 3VQBA 4FLVA 2KFZA 3ZSZA 3K5LA 4LH4A 4J2DA 2OA8A 3B6OA 3I0RA 1EKEA 4Z4IA 2KFNA 4XIUA 1XHZA 3K5OA 4Z4CA 4IFVA 2G8KA 3VN5A 1RBUA 2HNZA 2B6AA 4KKOA 1RDBA 3O4QA 3M8SA 4O55A 4IBNA 2PYJA 3G0ZA 3B6PA 4NCAA 1ZYQA 2HHTA 3L2WA 2DFHA 1EP4A 1JLBA 1QSYA 3VQQA 4IG3A 3AO2A 2F96A 4CJQA 5C25A 1LAVA 3O4NA 1BHLA 2E6LA 3KJVA 4FLYA 3C6UA 4KHWA 2XHBA 3SI6A 1W9HA 3KLHA 3O3GA 3SPZA 1GOBA 3PUFA 2G8FA 3DLEA 1RT4A 1KFDA 3RTVA 4KI6A 4E0DA 4E89A 3DRPA 4KREA 1XHXA 3OS0A 1NK0A 3DLRA 4FK4A 3L3VA 3HM9A 3ZSXA 3SPYA 4K8XA 1IO2A 4W5QA 1S1WA 1U49A 5D3GA 4CEFA 4E1NA 2F8TA 3K5MA 2PZSA 4KAZA 1BQNA 4W5RA 3AVHA 1JLEA 2JGUA 4DTUA 4PA1A 1TL3A 2WONA 4BDPA 2Z1GA 2FBYA 2YKMA 3KK3A 4B9NA 3LALA 1EXQA 3P1GA 2ZE2A 4B8CA 5KRTA 3DLBA 1RTDA 3AVFA 2PY5A 3AA2A 1B9FA 4DQSA 3QIPA 4CEAA 3PO4A 2DY4A 4FK2A 4AHRA 1VRTA 4PUOA 1S1VA 4N56A 2XO7A 3TR8A 4E7JA 1U48A 2G8IA 2GBZA 1TKZA 3AA5X 1ZBFA 2IAJA 2QXFA 4C8MA 3KKRA 3VQ7A 3NCIA 1LWCA 1DTTA 1S1XA 2IDOA 3OJSA 4N47A 4FLUA 1TKXA 1SKSA 3OYJA 4NYFA 1RCHA 3OY9A 1KTQA 1VSKA 3L2UA 3JSMA 4OKKA 1C0UA 1TK0A 4OPJA 3MEEA 4DQQA 4RW9A 3VQ4A 3DYAA 4FLWA 1LV5A 3BDPA 2X6SA 3NH0A 4O44A 3OYAA 4CEOA 2Z1JA 2A1RA 4CEQA 4W5TA 4CJ5A 4KHUA 5I3UA 1U47A 1EX4A 1S1TA 4F3TA 1ZBIA 3TI0A 1Q9YA 3D0PA 2XY6A 1KLMA 2D0CA 3QESA 3WNEA 3DLHA 1KVAA 5SWMA 1XI1A 4C8OA 3PV8A 1QTMA 4KHQA 2DFFA 5J1EA 2I5JA 1RBTA 4C8KA 1JLGA 3S3NA 4DU1A 4O0JA 2F8SA 1BI4B 1RILA 3M8PA 3QERA 3SNNA 4KB1A 4I7FA 1IKXA 4O5BA 3SQ2A 1L3VA 1NKBA 1XC9A 2P5GA 3ITHA 3K5NA 1NJYA 4BDZA 3RMCA 3DLKA 3PY8A 4Y1CA 3SJJA 1K6YA 1SV5A 1VSFA 3HL8A 1N6QA 1A5WA 1Y97A 1MU2A 4DU3A 3RR7A 4M3UA 2HB5A 1D5AA 4CJVA 4B3OA 1FKOA 2B5JA 3VA3A 4DTNA 1KSPA 1UAXA 3KLFA 4DTRA 1FXXA 2FC0A 2YNHA 4LH5A 2O4IA
chains in the Genus database with same CATH superfamily
3ENOA 1S22A 1HQUA 2O8BA 2VWJA 3BGRA 2OTJN 1BWFO 2XRIA 4PL8A 5BPLA 3R1XA 5FPEA 1RTIA 2P9KB 4FJHA 2ZD1A 3VQ6A 4X65K 4B3RK 1Z05A 1W97L 2QKKA 1QSLA 2WFBA 4WYBA 3QNOA 4WFBL 4YOYA 1NMDA 1RNHA 2A6AA 2P9KA 3V4IA 5HRSA 1KAZA 4PY5A 4CHOA 4KTQA 4LY7A 5BPNA 3T69A 3OYCA 3NGIA 3SCXA 2HHXA 2FBVA 4BR5A 4O0IA 4DSKA 1T03A 2NRWA 3ZSWA 3J7AP 4BVPA 2IVOA 4CBWA 3EE8A 3WXIA 3U3YA 2ZGYA 4E19A 5FRNA 2QA4N 1B92A 5AQZA 3IS9A 1HX1A 3CI5A 3G10A 2A41A 4RW8A 5C2FA 1SZ2A 4IJNA 4BC2A 2OZMA 3THWB 1ILYA 3CCJN 2OCEA 1K8AO 4HTUA 4QOZB 4KH4A 4KTWA 4A5BA 1YXQA 3EZ5A 5EY4A 4AHTA 4X64K 1HNXK 4B1UB 3FZLA 4JKGB 3CM6A 4N76A 3CFOA 1KAYA 3LAMA 1L3TA 3IRXA 4BRFA 3WXJA 2P9NB 3DOLA 1BIZA 3DLGA 3HVTA 3KZBA 4CHPA 1KLNA 3I8BA 3KTQA 1D8YA 1JCGA 2HW3A 1HJOA 4OO1J 3N4PA 1QS4A 2F7TA 4GW6A 5E41A 1TVRA 3ZSYA 2Q2RA 3WUHA 4LF4K 4WCEL 4BE2A 3CCSN 3P83D 1XWLA 3ATVA 1WSEA 4KO0A 4EP5A 4JS4A 3BEXA 1C0MA 5T7BA 1M1KO 3VQCA 4FLZA 4M3RA 1W0HA 2RPIA 1WBDA 2D0PA 2O8EB 3HPHA 3VETA 4RCHA 1F21A 3VEOA 1RT7A 1X3NA 3GE1A 3AVAA 4AF1A 3NGZA 3ASMA 3C6TA 1K9MO 4FWQA 3G6EN 1RDDA 3RSEA 2WBNA 1VQON 3L0QA 3RMBA 4LSNA 4M63C 4IFYA 3CFRA 1YI2N 3SUPA 5DM7L 3SQ0A 4JKBA 4BRMA 3MXMA 4B9TA 3EEQA 1SL0A 2YJEA 4FZYA 3EY1A 4FLXA 4DSLA 2BGGA 5DMRA 4BC4A 1C0TA 5AQPA 3CJAA 4DTSA 4OGCA 4L8RB 2KTQA 3WXLA 3HSCA 4BR2A 4BRDA 4DUZK 1YT3A 4BRGA 4I6MB 1JLCA 1NJWA 5C15A 1DEJA 4H0OA 2NUBA 3A5NC 1WBBA 2VG5A 1S6PA 3SAFA 1N32K 2VG7A 3BY5A 3AVIA 1KVCA 5M1NA 4EHUA 2E2PA 4LC9B 4HUGA 5C42A 2KW4A 4MLHA 4BC3A 1YUWA 3QNNA 1X1PA 4NYNA 1ASWA 1S9GA 3NF7A 3V9WA 1NGDA 5BR8K 4WFNL 1UA0A 5J2NA 3EE9A 1SQKA 4KPYA 2YHXA 3I56N 2UUAK 5KPZA 4FWSA 5AQYA 4CFDA 4H0TB 3V1QA 1JL1A 2ZQBA 5LJWA 5J2PA 3PO5A 1HKGA 3CYMA 5DM6L 3AVLA 4B1WB 2BDPA 4FJJA 3MCPA 5A2QO 4K8ZA 3V1OA 3EN9A 1U45A 2AP1A 2YHYA 2ITGA 2E8AA 1RTJA 1XMOK 1RDAA 1BI4A 3S3MA 3QINA 4QS7A 1MA9B 3ZSVA 3PX0A 3M1FA 1TYQB 3T19A 3QEWA 4Z4GA 4BQLA 3K57A 3T3FA 5I42A 1QVFM 5AQJA 1VSMA 5C0YA 1XC3A 4ELVA 2RKIA 3MWPA 4H03B 3AY9A 1ZBLA 3M6GA 3PLAA 1WSIA 1O13A 2D0OA 4H5VA 3NVMA 3QIOA 3QBXA 4FM1A 1IG9A 5CY4A 2IOCA 3AO1A 4B1YB 1TYQA 4YHHK 2ASPA 3E9OA 4FJKA 3ZETA 3ZSRA 3UKUA 2OPRA 1JLFA 1YITN 4EAHD 5AJ3K 4B08A 4EZ9A 3DOKA 5F2RA 2Q3SA 4BDYA 3G4SN 3WXKA 1WSFA 3KK7A 2QM1A 3SUOA 4JLHA 2HMPA 1JJ2M 2P9PA 1YHQN 3SV4A 4DV5K 3J80O 2NRVA 3SQ1A 2YKNA 5AR0A 4E7LA 2YCHA 5FLXO 5CYMA 2XY5A 3VQDA 3V81A 4LSLA 5AZJB 1N33K 1U4BA 1VK0A 1QSSA 3LZJA 4IFEA 4CZFA 1YJ9N 1VQMN 2GTDA 4GV3A 1VRUA 1VSJA 4DFKA 3L3UA 3AVKA 4TSXA 4LF5K 5AQOA 3ZSQA 4DQPA 4FZZA 3O9QA 3LM2A 5I9EB 1RT5A 2Q36A 5KQ8A 5J2QA 3UB5A 1R0AA 4PWDA 4F2RA 1YTAA 1VSHA 1DLOA 1Q81O 2QTDA 3RVCA 3SK3A 4CHZA 3CD6N 1RBVA 2O8CA 1R59O 1G15A 4GMJB 4BRQA 4LH4A 3B6OA 2KFNA 2KHOA 4JI6K 4JV5K 3D6RA 3VN5A 3VGKA 2HNZA 2E20A 2PYJA 3B6PA 1GLJO 3L2WA 4FWOA 1EP4A 3T1HK 4DCHA 3ENBA 3C6AA 5C25A 4DV6K 3J7YP 3UE5A 4JI8K 4YOTA 2YX6A 3C6HA 3SI6A 3Q7BA 2E5LK 3O3GA 4JK8A 3PUFA 1RT4A 4KI6A 2YI1A 1C0GA 3FFKB 5AQXA 3DRPA 4KREA 1XHXA 3VTHA 3DLRA 4FK4A 3L3VA 3HM9A 3ZSXA 1S1WA 1U49A 5D3GA 4CEFA 4K42A 4KAZA 4JYAK 5C10A 4W5RA 3AVHA 3WQTA 2WONA 1QQMA 2FBYA 1EXQA 3SAHA 2ZE2A 4H0PA 4B8CA 3DLBA 3Q7CA 1RTDA 3AA2A 3QIPA 4DR1K 4AHRA 4N56A 2XO7A 3TR8A 4GNIA 1U48A 3MN5A 2GBZA 3U9ZA 5BN8A 3VQ7A 3H46O 1LWCA 1DTTA 1S1XA 2PBDA 1NJIO 1SKSA 3O9SA 3DAWA 3JSMA 4OPJA 1T44A 1N34K 4RW9A 1EWQA 4FLWA 1G99A 4CEQA 1YIJN 4KHUA 1IJJA 1V4SA 3CC7N 1ZBIA 1NU0A 3DLHA 4H0VB 1LCUA 2KKZA 4KHQA 5GADP 1RBTA 3O6WA 1JLGA 1BI4B 1RILA 3VPZA 3QERA 1U6ZA 3SNNA 1JCEA 3CC2N 1GLFO 4I7FA 3ATUA 1L3VA 4ILGB 5IT9O 3P31A 4A61A 1NJYA 3R3LA 3RMCA 1VQ6N 1A5WA 3VF6A 4DU3A 3RR7A 4CJVA 1FKOA 5AQSA 4JKFA 3KLFA 3G71N 4OPHA 3ENHA 1VQ9N 3VESA 2O4IA 2WC9A 3NH2A 5LMNK 1HPMA 4CGDA 2P9UA 2B4JA 2ZWHA 3THVA 3LP0A 4CHQA 2P9IB 2E4LA 2FSJA 4DTMA 4FJNA 4JD2B 1FKPA 5M1PA 4CJPA 4YFUA 2CH5A 3ZT1A 5JLFA 1RGIA 3K9KA 4ID1A 1IV0A 4Z0UA 1C1BA 1J54A 3CHWA 4MQ3A 2W6KA 3MDQA 4WQ5C 2HNDA 1VQ7N 3F5TA 4DSJA 1YJWN 5AQQA 5EX5A 3HZ6A 4DR6K 4IDKA 4JKGA 3OBYA 1CXUA 4FJ5A 4M3ZA 4CEEA 3CMAN 4DTPA 4A5AA 4HVJA 4CCHA 4CFBA 4ILHA 2IVNA 4DSFA 3LL3A 3D2EB 2P9UB 3KLIA 2LSNA 3I0SA 2OPQA 1NMNA 4H5WA 2G8VA 4IJAA 3HP6A 4AILC 2HHWA 4BROA 3F73A 3THYA 2UXCK 1KFSA 2IIRA 4KV8A 4J2AA 1I39A 1TAQA 3H6EA 1RT6A 3LP3A 3O9TA 1ZC6A 1K73O 1BGXT 3PX6A 1ZBSA 3UKUB 4CESA 4GV6A 5CZ1A 4DF8A 2DTUA 3HVRA 5FRMA 1TV6A 1C1CA 3V9ZA 3SV3A 4CJKA 2O8EA 1KXPA 1E4GT 2D0AA 4RTFD 3OW2M 1S6QA 1TKDA 4HHTA 4CIFA 4ISGA 2FXUA 1HYVA 4KFBA 1WLJA 3CFPA 3WEEB 3PIPL 4FW2A 3EKSA 3GOIA 5BPMA 4ISFA 4CJRA 5B8HA 3IUCA 4DQRA 3L2RA 5JMVA 4BRLA 2P9LB 1BISA 3CJ9A 4LD0A 4C23A 4FJ9A 4BGAA 3QB0A 3V9XA 1UA1A 4J2BA 4DR4K 4B1XB 3IAYA 1LW0A 3P39A 3U3GA 4ICLA 5AQWA 3I8DA 3AVJA 5ADXA 4W5OA 2A42A 4LFCK 2QWOA 4FVMA 1FW6A 2PYLA 3P4IA 5AQGA 3QICA 4JKCA 3O3HA 4RW6A 5HRRA 3AGRA 3VF4A 3ZETB 3CIPA 4DV4K 1IKVA 2KLAA 3JS6A 2HSTA 3OS1A 1Q7YO 3KKSA 4K25A 2FBXA 3V6DA 4O4GA 4K43A 4I2PA 4FPAA 3MAQA 4M3YA 3DM2A 3SBTA 4F3OA 3AO3A 5J2MA 1CZAN 4FJMA 4MDAA 2PAVA 3DMJA 4YOVA 3W0LA 3MN6A 4FJ7A 2UXBK 5GAEP 4CE9A 4G1QA 3C94A 4FWKA 3PSFA 4WE1A 1IKWA 1JXBA 1OVQA 3V1RA 5AFUA 3CCLN 5AZIB 4FM0A 1BCMA 2BTFA 2FBTA 5JS2A 1MWMA 4CERA 3LAKA 3ZSOA 1KCFA 1SUQA 3M8QA 3L2QA 1JLQA 3ZCMA 1X9SA 4CFAA 1HNZK 5EVZA 2HOEA 2E6MA 4B3TK 2HVHA 3LP1A 5LL6Z 3CQXA 3S41A 2P1JA 3RWUA 3L4IA 3CCRN 1N5YA 1GLEG 3V9SA 1X9WA 1HRHA 3JAMO 2ZJRL 3AV9A 4FCYA 3L2VA 2P9SA 4FYDA 2YJFA 4YY3K 3VGLA 3H1VX 4DSIA 3CJ7A 5AQVA 3MMVA 4CEDA 1UWBA 4PL7A 3HI0A 5FDLA 3VEXA 1HNVA 2NRZA 2O8DA 4CJSA 2VGNA 1VSLA 3VEVA 1L3UA 4XH5A 4NXMK 4DG1A 4U7BA 3LWMA 3S3OA 5FROA 5KRSA 3BUZB 3LANA 3PSIA 2FF3B 1B9DA 1NGHA 2YHBA 2Q0UA 2OZSA 3OS2A 1TK8A 4A57A 5HL7L 5KI6A 3OYLA 3FGUA 1BCOA 3SAGA 4BR9A 1WAFA 3HPGA 4M7XA 4BR4A 4CZHA 3MCAB 1HJRA 1IH7A 5JS1A 4FO0A 4OPAA 4ELUA 4IDHA 4H4MA 4KHYA 1GOCA 1SAZA 2QWPA 3TABA 2V52B 4B9UA 1C0FA 3ULEB 2RF2A 4FWRA 2DFEA 2YNIA 3A2FA 3HT3A 4W5NA 1OH5A 1RT1A 4Z94A 4HWIA 2NRHA 3VQ9A 4B9NA 3SMPA 3O1BA 4E1MA 1OH7A 2QEXN 4GVMA 4DQIA 1QQNA 3HTVA 3TARA 1LOTB 1K8KA 1VHXA 4JAXA 5GINA 3OYKA 3A5OC 4CEZA 3TAFA 4NXNK 2D0BA 1CZ9A 4CJEA 3VOVA 3NAEA 2ATQA 3T7ZA 1BA0A 1ASUA 1NK8A 4PKIA 1M90O 3K58A 1S3XA 1UOCA 3MWTA 3L8BA 1SL1A 1I3AA 2O4GA 1BQMA 2GX9A 4JI7K 3FFIA 4NCGA 4CGGA 1WSGA 4CJLA 4EP4A 4DQSA 1IKYA 1LAWA 2GV9A 3K59A 2BUPA 4OKEA 2HBJA 4DLGA 4CFCA 2V7ZA 3ZYYX 4AHUA 3PIOL 3CCUN 4DR7K 4FZXC 4H0YB 1D9DA 4CZJA 5ADXH 2A3ZA 2Z1HA 5EU7A 2X74A 2QWLA 3CG7A 3R9PA 4BE1A 2OPSA 3S9HA 1J5EK 4CF1A 1YVNA 1T3VA 1VQ5N 3CERA 3THXB 1P90A 3DRSA 4ISEA 5AQMA 2HBMA 4FLVA 1HLUA 3AAQA 3FZMA 2D4WA 1EKEA 2WTUA 3K5OA 4KKOA 4O55A 4IBNA 2HHTA 3VQQA 3AO2A 3CPEA 3THYB 1LAVA 2NLXA 2E6LA 1FJGK 3KJVA 4FLYA 4FWMA 1W9HA 3KLHA 4IXCA 3SPZA 1GOBA 3J8AA 3TSQA 3RTVA 2UU9K 4DV0K 3OS0A 4XH4A 3IDHA 2WUSA 1JLEA 2H3GX 4PA1A 4BDPA 2Z1GA 3KK3A 5KRTA 3AVFA 1B9FA 3MK6A 3PO4A 2DY4A 2FSNA 2GELA 4E7JA 4BVOA 1TKZA 3AA5X 3AGKA 2QXFA 4C8MA 4H5RA 5BR9A 4LF6K 4JD2A 3OY9A 3L2UA 4O8UA 1LV5A 4BRCA 3NH0A 4O44A 4CEOA 4CJ5A 3HBTA 1EX4A 1S1TA 3MN9A 4E1JA 5M1QA 1KLMA 2D0CA 4JEPA 2Q97A 1KVAA 4C8OA 1XI1A 1QTMA 4C8KA 1HUXA 3J7ZO 3S3NA 2F8SA 3M8PA 4KB1A 4DV1K 2VYPA 1ZXOA 1XC9A 4BDZA 4Y1CA 1VSFA 4BRIA 4LF9K 1Y97A 1MU2A 3G25A 3WT0A 2HB5A 3EZWA 4JHDB 4B3OA 3VA3A 2B5JA 3VERA 4DTRA 2FC0A 2OTLN 2YNHA 4FJXA 4FLTA 3KIOA 4CECA 2Q1NA 2CH6A 3CCQN 3GBTA 4YNQA 5M1KA 2VG6A 3TAQA 3WXMB 4I9QA 5EXWA 1RBSA 3FZFA 2V7YA 1TKTA 3OHRA 2VGMA 3ZX0A 1LWFA 2HF3A 2W40A 4IKFA 4ILJA 3H08A 4Z4EA 3DJCA 4BR7A 3TAPA 4BY9C 1VQPN 3OYFA 3QMLA 1IG8A 5KPTA 3FZKA 3HOTA 3TSUA 3SQ4A 4DWIA 3DXMA 4DV3K 4FJIA 4J8FA 1XUPO 4FXDA 2ZGZA 4CK2A 2ASOA 4GY2B 3VENA 4CHNA 4B1ZA 1JL2A 1BIUA 1EETA 5AQTA 3ZEUB 5HRPA 4OJRA 4JKHA 4B1VA 2OYQA 2ETJA 1QQOA 3ZLJA 3DXMB 3EL2A 1GOAA 3ULEA 1VQLN 4FJ8A 1WSHA 3O5BA 4K0KK 1U2VA 1T7PA 3TTFA 2HHVA 1RT2A 4HTLA 1NOYA 1HKCA 4CF2A 2GWJA 2J4RA 4WF9L 3ZX3A 2O8FB 1NJXA 4BQZA 4CF8A 4IG0A 4ZTFA 1WUAA 2GUIA 4Z4FA 1QE1A 2ZF5O 4KH5A 4NCBA 3DWLA 3VTIA 1IBLK 1ZBHA 4R79A 2QK9A 2V51B 2ZJPL 4HUFA 4KTZA 4EZ6A 3KK2A 4L3QA 4M45A 2VQFK 4HUEA 5HRNA 4OKJA 4ELTA 3A0IX 3VQPA 4CJWA 3U6FA 1A5XA 1C6VA 3HXMA 4JK9A 1TK5A 4OGEA 3CPWM 5IWAK 4BWJA 4CI6A 4PHTX 1NK7A 2JWLA 4B9LA 4YOXA 3AAPA 3NBPA 2QWQA 4JNEA 4BE0A 1D9FA 3OYDA 3UIQA 4H0XB 3KLEA 1JKHA 3HJFA 4FWLA 3OVNA 3LDSA 2VQEK 3QEXA 1TUUA 3AVCA 4ZTJA 3QEIA 3LP2A 2E2QA 4DMNA 4F4KA 1KQSM 3DRRA 1A5VA 3UKRA 3CJBA 3C0BA 2P5OA 1WN7A 1TAUA 4OVLA 4X66K 1NJZA 3CETA 2X78A 2F9TA 4QAGA 1YTUA 4DR3K 3ALYA 1NGIA 4PKGA 4M3TA 2XY8A 4R5PA 1ZBUA 3WNGA 1Z6RA 3JYTA 3SJHA 3SMSA 5C24A 1VSIA 3E01A 3AVBA 3CM5A 4MO5A 3OYHA 2QXLA 1FK9A 1X3MA 4AHCA 1NGCA 3SUNA 3QEPA 1Z26A 4DS4A 5TKWA 4I9LA 3LDNA 4CGIA 4LF8K 2BH1A 4JHDA 2E88A 4JI2K 2A1SA 4RWTA 4JS5A 4JRPA 3JXUA 4FK0A 4QCLA 4CBUA 2EX3A 1ASVA 2FF6A 4JK7A 5E26A 3VEYA 3EYZA 1CZBA 4M41A 4DR2K 3EO3A 3ISNC 2F4VK 3HP9A 2X6NA 4GVEA 3LZIA 4CHYA 1BA1A 5FPDA 5C12A 1S72N 3D2FB 1WNSA 4BC5A 5FPNA 1XQSC 3BF1A 4WQ4A 3HYFA 2RN2A 1T05A 1VSEA 1VSDA 4Q5VA 4CVNE 4M3XA 4KI4A 3O9RA 4CZIA 2PFUA 1JXEA 1KRPA 3OA9A 4CJ3A 1GLBG 2E2NA 4QS9A 3ZT2A 4JI5K 4I6MA 1RTHA 1QQCA 1NK4A 1L3SA 3THWA 4CZKA 3WEEA 1TUYA 3N4QA 1XNQK 3QO9A 3NH1A 4FJGA 2Q0RA 2OPPA 3J81O 2QWNA 3MX5A 2BE2A 3WNHA 3L4QA 4JKEA 1Z25A 3BP8A 4JKAA 4HCCA 1WAJA 3LDOA 3MECA 3F9MA 2Z1IA 4DUYK 2NNWA 5AQUA 4DKWA 3NVKA 4C8NA 3ZT3A 1NOZA 5CYQA 1TGOA 3ID8A 3VQEA 4MDBA 3BF3A 2Y1IA 4EFHA 3CMEN 1X9MA 3DI6A 2KZZA 2HHUA 2YHWA 3QETA 2P9IA 2WOMA 4H5NA 3RRHA 1TL1A 3MXJA 3VEWA 5EOYA 5TKYA 4RG8A 4Y1DA 2D5RA 3NF6A 4ID5A 1KAXA 3ZT0A 3THXA 1SS6A 1S9EA 4IO9L 5AZJA 1JLAA 4DFPA 2P9SB 2YHAA 4AH9A 3A8YA 3OYEA 4WFAL 3FR0A 2NRRA 1RDCA 1JCFA 5CE3A 3RRGA 1NKCA 4WQ5A 4BRHA 4LF7K 4FPBA 3F9KA 3AVNA 4FM2A 2KQ2A 4O5FA 5HBMA 3C95A 4BREA 3P5JA 4DTXA 3B8AX 3E66A 3NFAA 2P9LA 1J53A 2IGIA 4B3SK 3OYIA 4CD1A 4YOUA 1NGAA 1Y64A 3HSTB 3F2KA 3RR8A 2HBLA 4HCBA 5HOOA 4A62A 5BRHA 3BZCA 5BREA 1NNEA 1DTQA 4AM7A 1IBMK 4Y0WA 1DGKN 5MLCQ 3ZSZA 4NB4A 3K5LA 4KH6A 2KFZA 3I0RA 1WOQA 4Z4IA 5C2DA 5GAHP 4IFVA 4BRAA 2G8KA 1RDBA 3O4QA 3QDKA 2F96A 4CJQA 2O8CB 1XNRK 3KWIA 3O4NA 1BU6O 1VQKN 1D4XA 3O4WA 1EWRA 1HNWK 2F9WA 5AFUH 3H3NO 2RE2A 4B3MK 1KFDA 4GKJK 1NK0A 1QVGM 1YF5L 3SPYA 1V4TA 2F8TA 4E1NA 3K5MA 2PZSA 1BQNA 4MO4A 3VMFB 5JVGL 2JGUA 4DTUA 1TL3A 1RDWX 4BRPA 3LDPA 3LALA 3P1GA 5AQNA 1W2BM 4CZLA 5LY3A 3HOSA 2W6LA 1NGJA 2GUPA 5BN9A 1S1VA 2IVPA 2IAJA 3KKRA 4A2BA 2IDOA 2OANA 4N47A 3OYJA 4NYFA 2FLOA 1KTQA 1VSKA 5M1FA 1RDUA 1C0UA 4OKKA 3MEEA 4DQQA 3BDPA 3DYAA 2E1YA 2X6SA 2P9NA 5CR4A 3R8EA 4IEIA 4W5TA 1U47A 4F3TA 3TI0A 1Q9YA 3D0PA 2XY6A 3WNEA 3QBWA 5KPRA 1N36K 2DFFA 4DHYA 5J1EA 3SBGA 1U2VB 3GG4A 4O5BA 3SQ2A 1NM1A 3OTOK 2P5GA 3K5NA 3DLKA 5JVHL 3SJJA 1XMQK 1SV5A 4IOXA 1N6QA 3C7NA 3CC4N 2ASMA 4DTNA 1BOTO 1BG3A 1UAXA 2CGKA 1KD1O 5AQKA 1T6CA 2YNGA 3MXIA 3LWLA 3C7NB 2P9PB 2UYTA 3AVGA 5FPMA 3OYBA 3SYZA 4DB3A 4F8RA 5HLFA 2VWBA 1E3MA 3OJUA 2IS3A 2DPNA 3AA4A 3E9PA 4MLEA 2YNFA 3K0SA 3EKUA 1N8RO 3NGYA 5GIPA 4DTOA 1MDUB 1Q86O 3T1AA 3CJCA 3ZX2A 3MEDA 4J2EA 1S5JA 4XEIA 3GL1A 4CIGA 4K41A 1HR0K 4IO8A 3H45C 4O8KA 3NDKA 3DLLL 2O8DB 3PX4A 4C1NI 3MEGA 1QHTA 4CBXA 4CGFA 3M5RA 2CGJA 4BR0A 3M3ZA 5AQHA 4MFBA 4CZMA 5BRDA 2P51A 1LW2A 3AVMA 4CIEA 3TAGA 5BRFA 1HYSA 4V19S 5AQRA 2Q31A 3LDLA 4FVUA 3SUQA 3TAMA 1HPZA 4CEBA 3VQAA 4JI3K 3D2EA 2HBKA 3KWGA 4EHTA 3QLHA 4RW4A 3VF2A 1SKRA 5AQIA 5KGWA 4QS8A 2R7YA 4DLEA 2HHHK 4DR5K 2XY7A 1X9JA 2QI2A 4F2SA 4M42A 2QWRA 4CJ7A 4OLBA 3HM8A 5AQLA 3TANA 4CF9A 4DV7K 3DXKB 3R6MA 4CK3A 1OH6A 4OX9K 1YJNN 4GKKK 3CF5L 4ZHRA 3RSEB 1NWKA 4AM6A 4CGJA 1BL3A 4BWMA 3NMUA 3OYMA 4CF0A 3VQ8A 1EQYA 3ID6A 4DFMA 2EWSA 4KHPK 3LPUA 3LPTA 4F9OA 3A5LC 4CW7B 2JWKA 2HVIA 4KB0A 1CLQA 1Q8IA 1E4FT 3IFRA 4G9ZA 4GV9A 2QKBA 1C1AA 3WNFA 3O08A 3KD5E 3VEZA 1RT3A 2NZTA 4BRKA 3FE1A 1P8ZA 4H5TA 1BDGA 3CXCM 4H8KA 3AO4A 3ZEUA 5HROA 1Q18A 5SZTA 3OYGA 1W7AA 4IEEA 4X62K 1NK6A 5DK5A 3FLCO 4BG9A 3ZT4A 2ZM6K 3QEVA 1WB9A 3LM9A 1SL2A 1NKEA 5M1OA 1Q82O 3HPOA 4N41A 2ITMA 2A5XA 3TTDA 4WQ4C 3CQYA 4AQYK 1HYZA 4CGHA 3TTCA 4YDUA 5CZ2A 4E7KA 1S1UA 1U04A 5AZIA 3VQ5A 3RMAA 5CHIA 4RW7A 3MX2A 3AA3A 1GLAG 4CJ4A 2HHQA 4DS5A 3TAEA 3V9UA 1T8EA 1ITGA 3TPQA 4JI0K 3L6QA 3K9JA 2W42A 4FJLA 4N5SA 2UXDK 5K14A 2HHSA 3KK1A 1EO1A 3C65A 2HNYA 5F0XA 3GDQA 5H1SQ 4CJUA 3CJ1A 4NO7A 1DKGD 2UUCK 4XH1A 4OLAA 1OVYA 1MWKA 2D1KA 1T6DA 4H4OA 3NF8A 4JKDA 3A5MC 3M8RA 4PKHA 1NK5A 3U8XA 2NRXA 4A59A 5F1XA 3H3OB 1GLDG 4LFBK 1O1WA 2W41A 5LJVA 1HNIA 4FWPA 3U4LA 2G8UA 2VCPA 5HP1A 2GEMA 2GWKA 1RFQA 3KVGA 2HMIA 4FL9A 3HO1A 3VA0A 2G8HA 4KRFA 1WSJA 4KBOA 4Q0BA 4BGBA 5AQFA 2E2OA 4PQUA 1H1VA 1VQNN 4DFJA 4C8LA 2JLEA 2NRTA 3OYNA 4B9SA 4FW1A 3CQ8A 2EHGA 1HMVA 2CGLA 3BZKA 4JI1K 4B9MA 5GAGP 1NG9A 1NGGA 4E7IA 4KHNA 4U67L 4B8AB 3CCVN 2I7NA 4NLCA 3ULDA 4DQ8A 3RMDA 3NE6A 1YVUA 4UQGA 1REVA 5KGXA 3T1YK 1GLCG 1RBRA 2HF4A 4NLBA 2RHKA 4DSEA 4CZEA 1J5OA 3D45A 3D2FA 1Q9XA 4CJFA 3QFUA 3IMXA 3TWHA 4DF4A 5GIOA 1YAGA 3DXKA 1BO5O 1LWEA 3H1QA 2O8FA 4YORA 1NGFA 3D7EO 2QW9A 5JLHA 3LDQA 1SKWA 4BG8A 5KTQA 4AHVA 2BANA 4DTJA 4C1NK 4A2AA 4CK1A 1CXQA 4Z4HA 3FZHA 5E84A 4B9QA 3K2PA 3NHGA 3KD1E 3W3DA 3O80A 2KZMA 4IWVA 1OKJA 3SZ2A 3AO5A 3NF9A 3O1WA 2QWMA 1HQEA 3E9LA 4YOWA 3IG1A 3CCMN 1L5UA 4KHSA 1J6ZA 4DU4A 1J9AA 1VQ4N 4YDUC 2Y1JA 4E7HA 2YV0X 4M3WA 4E3SA 4CJTA 3TSPA 4JRQA 1K8KB 1HKBA 4I2QA 1ATSA 1NGEA 4OPKA 1ATNA 4BACA 3O3FA 4B9VA 2IC3A 4AHSA 2A40A 3KLGA 3QFPA 4FSVA 3HK2A 4CD3A 2VWKA 5JICA 2G8WA 1KVBA 3VQBA 3TU5A 4J2DA 2OA8A 3KHYA 4XIUA 3IKMA 1XHZA 4M7YA 4Z4CA 1ATRA 1RBUA 3M8SA 2B6AA 4NCAA 3G0ZA 1ZYQA 2DFHA 4FOIA 3I33A 1JLBA 3P38A 1QSYA 2E1ZA 4IG3A 2AA4A 1VQ8N 3SLCA 3WQUA 1NBWA 3U9DA 1BHLA 4KHWA 3C6UA 3E1YA 2XHBA 1I94K 3CCEN 2G8FA 3DLEA 4E0DA 4E89A 2AJQA 4K8XA 1IO2A 4W5QA 2I7PA 3I55N 2YKMA 4IZ9A 2PY5A 4LFAK 4FWNA 4CEAA 5LMUK 3HRGA 4FK2A 1VRTA 4PUOA 3OBWA 4UY8O 4DV2K 2G8IA 3NCIA 1ZBFA 1IBKK 1KC8O 3OJSA 4FLUA 1TKXA 4CZGA 3VGMA 4FOEA 1RCHA 1VAZA 3MN7A 1TK0A 3O8MA 4JN4A 3VQ4A 1DT9A 3OYAA 2Z1JA 2O8BB 2A1RA 5I3UA 5ELZA 3QESA 1QZ6A 4JI4K 5SWMA 3PV8A 3UKRB 1GLLO 2ZJQL 2I5JA 4IOCL 3O9UA 4DU1A 4O0JA 1QHAA 4EIAA 1IKXA 1ESVA 1NKBA 3ITHA 1NGBA 3PY8A 1K6YA 3HL8A 1BUPA 4IOAL 1NLVA 1QZ5A 2FSKA 5KQDA 1OH8A 4M3UA 1D5AA 2UUBK 4BRNA 1KSPA 3AARA 1FXXA 1NK9A 4LH5A
chains in the Genus database with same CATH topology
4FJXA 4FLTA 1HQUA 3NH2A 3KIOA 4CECA 4CGDA 2VWJA 2YNGA 3BGRA 2B4JA 3THVA 3MXIA 2XRIA 3LP0A 3LWLA 4CHQA 2E4LA 1RTIA 4FJHA 3AVGA 4YNQA 4DTMA 2ZD1A 3VQ6A 3OYBA 4FJNA 3SYZA 2VG6A 5HLFA 4F8RA 1FKPA 4CJPA 4YFUA 3TAQA 3ZT1A 2QKKA 1QSLA 4ID1A 4I9QA 3OJUA 2IS3A 3AA4A 4Z0UA 3QNOA 1C1BA 1J54A 1RBSA 2YNFA 4MQ3A 1RNHA 3NGYA 2HNDA 1TKTA 4DTOA 3T1AA 3MEDA 1LWFA 4DSJA 1S5JA 4J2EA 4IKFA 3H08A 4CIGA 4Z4EA 4IDKA 3V4IA 3TAPA 3NDKA 1CXUA 5HRSA 4FJ5A 4CEEA 3PX4A 3OYFA 4CHOA 4DTPA 4M3ZA 4KTQA 3MEGA 4LY7A 4PY5A 4HVJA 1QHTA 4CGFA 4DWIA 3SQ4A 4FJIA 4CCHA 4CFBA 3OYCA 3NGIA 3SCXA 2HHXA 2FBVA 4O0IA 4DSKA 1T03A 4MFBA 3ZSWA 4DSFA 4FXDA 3KLIA 2P51A 1LW2A 2LSNA 3AVMA 3I0SA 2OPQA 4CK2A 4CIEA 3TAGA 3U3YA 2G8VA 1HYSA 4CHNA 4E19A 1JL2A 1BIUA 1EETA 3HP6A 4AILC 5FRNA 2HHWA 5HRPA 4OJRA 1B92A 3SUQA 2OYQA 3TAMA 3F73A 1KFSA 3IS9A 1HPZA 2ETJA 4CEBA 1GOAA 4KV8A 4FJ8A 3G10A 4J2AA 1I39A 1TAQA 1WSHA 1RT6A 4RW8A 3LP3A 3VQAA 1T7PA 2HHVA 1RT2A 2OZMA 1NOYA 4CF2A 1BGXT 3QLHA 3PX6A 4RW4A 1SKRA 5KGWA 4CESA 2R7YA 1NJXA 4HTUA 5CZ1A 4DLEA 4DF8A 2DTUA 3HVRA 5FRMA 4QOZB 4CF8A 2XY7A 1TV6A 4IG0A 4KTWA 4ZTFA 1C1CA 3V9ZA 2GUIA 3SV3A 4Z4FA 1QE1A 4CJKA 4F2SA 4M42A 3EZ5A 4NCBA 2D0AA 4OLBA 1ZBHA 1S6QA 3TANA 1TKDA 4HHTA 4CIFA 4AHTA 2QK9A 4CF9A 1HYVA 4KFBA 4CK3A 4HUFA 4KTZA 1WLJA 3CFPA 4ZHRA 4FW2A 3CM6A 1BL3A 3CFOA 4CGJA 4M45A 4BWMA 3KK2A 3OYMA 4EZ6A 4N76A 3LAMA 4HUEA 5HRNA 4OKJA 4CF0A 4ELTA 3VQ8A 1L3TA 3IRXA 3U6FA 3VQPA 4CJWA 4CJRA 1A5XA 1C6VA 4DFMA 3DOLA 1BIZA 3HXMA 3DLGA 4DQRA 3HVTA 1TK5A 4CHPA 1KLNA 3L2RA 3KTQA 4OGEA 1D8YA 3LPUA 3LPTA 4BWJA 1BISA 1NK7A 2HVIA 4LD0A 4FJ9A 4KB0A 4B9LA 3V9XA 1CLQA 1UA1A 4J2BA 1Q8IA 2HW3A 3NBPA 3IAYA 2QKBA 1LW0A 3U3GA 4BE0A 4ICLA 1C1AA 1QS4A 3WNFA 1D9FA 4GW6A 3OYDA 5E41A 3I8DA 1RT3A 1TVRA 3AVJA 3ZSYA 3KD5E 3UIQA 4W5OA 3KLEA 1JKHA 4BE2A 4FVMA 3HJFA 3OVNA 2PYLA 3LDSA 3P83D 3QEXA 1XWLA 1WSEA 3AVCA 4ZTJA 3O3HA 4KO0A 4H8KA 4EP5A 4RW6A 3LP2A 5HRRA 4DMNA 3AO4A 3QEIA 4F4KA 3DRRA 1IKVA 4JS4A 1A5VA 5HROA 5SZTA 1C0MA 5T7BA 3OYGA 3VQCA 3OS1A 4FLZA 1NK6A 2P5OA 1WN7A 5DK5A 4M3RA 3KKSA 1W0HA 2RPIA 3HPHA 2FBXA 1TAUA 3ZT4A 3QEVA 4OVLA 1NJZA 1F21A 1SL2A 1NKEA 1RT7A 2X78A 3V6DA 4O4GA 4QAGA 3HPOA 3AVAA 4I2PA 4N41A 1YTUA 3ALYA 3MAQA 3NGZA 3ASMA 3C6TA 4M3YA 3DM2A 1HYZA 4CGHA 4F3OA 3AO3A 1RDDA 2XY8A 5J2MA 4FJMA 4M3TA 5CZ2A 4E7KA 4R5PA 1ZBUA 1S1UA 3WNGA 3JYTA 1U04A 3RMBA 4LSNA 3DMJA 5C24A 1VSIA 3E01A 3AVBA 3CM5A 3VQ5A 3RMAA 4FJ7A 4IFYA 3OYHA 3CFRA 4CE9A 4RW7A 3SUPA 4G1QA 3C94A 3SQ0A 4B9TA 3MXMA 1FK9A 3AA3A 1SL0A 4AHCA 4WE1A 4FZYA 3EY1A 1IKWA 4FLXA 3SUNA 4CJ4A 3QEPA 1JXBA 3V1RA 4DSLA 2BGGA 1Z26A 2HHQA 5DMRA 4DS4A 4DS5A 3V9UA 3TAEA 1T8EA 4I9LA 1C0TA 1ITGA 3RRHA 4CGIA 4DTSA 4FM0A 1BCMA 4OGCA 4L8RB 2FBTA 2KTQA 5JS2A 4CERA 2A1SA 3LAKA 3ZSOA 2W42A 1KCFA 1SUQA 3M8QA 1YT3A 4JS5A 3L2QA 1JLQA 4JRPA 3ZCMA 1X9SA 1JLCA 1NJWA 4CFAA 4FK0A 4QCLA 4FJLA 4N5SA 5K14A 2HHSA 2EX3A 1ASVA 3KK1A 2NUBA 2HNYA 2VG5A 2E6MA 4CJUA 3EYZA 1CZBA 1S6PA 3LP1A 4M41A 2HVHA 2VG7A 4OLAA 2P1JA 3ISNC 3AVIA 3HP9A 1KVCA 4H4OA 3NF8A 2X6NA 3RWUA 3M8RA 4HUGA 3LZIA 1N5YA 5C42A 4CHYA 3V9SA 2KW4A 1NK5A 1X9WA 1HRHA 1WNSA 3AV9A 4FCYA 3QNNA 3L2VA 4FYDA 1X1PA 4NYNA 1ASWA 1O1WA 1S9GA 3NF7A 3V9WA 3HYFA 2RN2A 1T05A 4DSIA 1HNIA 1UA0A 5J2NA 1VSEA 1VSDA 4Q5VA 4CEDA 1UWBA 2G8UA 4M3XA 4KPYA 4DFKA 5HP1A 4KI4A 5FDLA 1HNVA 2HMIA 4CJSA 1JXEA 4CFDA 1VSLA 3V1QA 3VA0A 1JL1A 2G8HA 4CJ3A 2ZQBA 1L3UA 1KRPA 3HO1A 4KRFA 3ZT2A 1WSJA 5J2PA 3PO5A 4Q0BA 4DG1A 1RTHA 1QQCA 1NK4A 3CYMA 1L3SA 3AVLA 4PQUA 2BDPA 3LWMA 3S3OA 5FROA 4FJJA 5KRSA 4K8ZA 3LANA 3V1OA 4DFJA 1U45A 4C8LA 2JLEA 3OYNA 4B9SA 1B9DA 3QO9A 4FW1A 2YHBA 3NH1A 3CQ8A 4FJGA 2EHGA 2ITGA 2OPPA 2BE2A 2OZSA 3OS2A 1TK8A 1HMVA 5KI6A 3WNHA 3OYLA 4B9MA 1RTJA 1BCOA 1Z25A 1RDAA 1BI4A 1WAFA 3HPGA 4E7IA 4KHNA 4HCCA 1WAJA 1HJRA 4B8AB 3S3MA 1IH7A 3QINA 2AJQA 3ZSVA 3PX0A 5JS1A 3T19A 3QEWA 4Z4GA 3MECA 3ULDA 3K57A 3T3FA 3RMDA 3NE6A 4ELUA 2Z1IA 1YVUA 4UQGA 5I42A 1REVA 4H4MA 5KGXA 4KHYA 1GOCA 1RBRA 1VSMA 3TABA 4ELVA 4C8NA 2RKIA 4B9UA 1ZBLA 3ZT3A 4DSEA 1J5OA 3D45A 1NOZA 1Q9XA 1WSIA 1TGOA 5CYQA 4CJFA 2RF2A 3QIOA 4FM1A 2DFEA 3TWHA 2YNIA 4DF4A 5CY4A 3VQEA 1IG9A 3A2FA 2IOCA 3AO1A 3HT3A 4W5NA 2Y1IA 1RT1A 1X9MA 3DI6A 2KZZA 2HHUA 4FJKA 3QETA 2WOMA 3VQ9A 1TL1A 1LWEA 3MXJA 3ZSRA 4E1MA 4RG8A 2OPRA 2D5RA 1JLFA 4Y1DA 3NF6A 4ID5A 3ZT0A 4GVMA 4B08A 4EZ9A 4DQIA 3DOKA 1S9EA 1SKWA 2Q3SA 4BDYA 1JLAA 5KTQA 4DFPA 3TARA 4AHVA 1WSFA 2YHAA 3SUOA 3OYKA 4JLHA 4AH9A 4CEZA 2BANA 3OYEA 3TAFA 4DTJA 2D0BA 1CZ9A 4CJEA 3NAEA 2ATQA 1RDCA 1CXQA 1ASUA 4CK1A 4Z4HA 1NK8A 3SV4A 3K2PA 3NHGA 3KD1E 3SQ1A 2YKNA 3RRGA 4E7LA 1NKCA 3K58A 2KZMA 5CYMA 2XY5A 1UOCA 3VQDA 3V81A 4LSLA 3L8BA 1SL1A 1I3AA 1U4BA 3F9KA 3AVNA 1VK0A 2O4GA 1BQMA 2KQ2A 3LZJA 3FFIA 4FM2A 4NCGA 3SZ2A 1QSSA 4CGGA 3AO5A 1WSGA 1VRUA 1VSJA 3NF9A 4CJLA 5HBMA 4EP4A 1HQEA 1IKYA 1LAWA 2GV9A 3AVKA 3C95A 3L3UA 3P5JA 4TSXA 3K59A 4DTXA 3NFAA 4OKEA 3ZSQA 3IG1A 4DLGA 4DQPA 4CFCA 4FZZA 1L5UA 4KHSA 1J53A 4DU4A 4AHUA 1RT5A 2IGIA 5J2QA 3OYIA 4FZXC 1J9AA 1D9DA 2Y1JA 4E7HA 3HSTB 1R0AA 4PWDA 2YV0X 2Z1HA 4F2RA 5EU7A 4E3SA 3RR8A 1YTAA 4M3WA 4CJTA 4JRQA 1VSHA 4I2QA 2X74A 3CG7A 1DLOA 1NK9A 4OPKA 4HCBA 4BACA 3O3FA 4B9VA 4BE1A 2OPSA 2IC3A 3S9HA 4AHSA 4CF1A 3KLGA 4CHZA 3HK2A 1DTQA 2VWKA 1RBVA 3DRSA 2G8WA 1G15A 1KVBA 4GMJB 3VQBA 4FLVA 2KFZA 3ZSZA 3K5LA 4LH4A 4J2DA 2OA8A 3B6OA 3I0RA 1EKEA 4Z4IA 2KFNA 4XIUA 1XHZA 3K5OA 4Z4CA 4IFVA 2G8KA 3VN5A 1RBUA 2HNZA 2B6AA 4KKOA 1RDBA 3O4QA 3M8SA 4O55A 4IBNA 2PYJA 3G0ZA 3B6PA 4NCAA 1ZYQA 2HHTA 3L2WA 2DFHA 1EP4A 1JLBA 1QSYA 3VQQA 4IG3A 3AO2A 2F96A 4CJQA 5C25A 1LAVA 3O4NA 1BHLA 2E6LA 3KJVA 4FLYA 3C6UA 4KHWA 2XHBA 3SI6A 1W9HA 3KLHA 3O3GA 3SPZA 1GOBA 3PUFA 2G8FA 3DLEA 1RT4A 1KFDA 3RTVA 4KI6A 4E0DA 4E89A 3DRPA 4KREA 1XHXA 3OS0A 1NK0A 3DLRA 4FK4A 3L3VA 3HM9A 3ZSXA 3SPYA 4K8XA 1IO2A 4W5QA 1S1WA 1U49A 5D3GA 4CEFA 4E1NA 2F8TA 3K5MA 2PZSA 4KAZA 1BQNA 4W5RA 3AVHA 1JLEA 2JGUA 4DTUA 4PA1A 1TL3A 2WONA 4BDPA 2Z1GA 2FBYA 2YKMA 3KK3A 4B9NA 3LALA 1EXQA 3P1GA 2ZE2A 4B8CA 5KRTA 3DLBA 1RTDA 3AVFA 2PY5A 3AA2A 1B9FA 4DQSA 3QIPA 4CEAA 3PO4A 2DY4A 4FK2A 4AHRA 1VRTA 4PUOA 1S1VA 4N56A 2XO7A 3TR8A 4E7JA 1U48A 2G8IA 2GBZA 1TKZA 3AA5X 1ZBFA 2IAJA 2QXFA 4C8MA 3KKRA 3VQ7A 3NCIA 1LWCA 1DTTA 1S1XA 2IDOA 3OJSA 4N47A 4FLUA 1TKXA 1SKSA 3OYJA 4NYFA 1RCHA 3OY9A 1KTQA 1VSKA 3L2UA 3JSMA 4OKKA 1C0UA 1TK0A 4OPJA 3MEEA 4DQQA 4RW9A 3VQ4A 3DYAA 4FLWA 1LV5A 3BDPA 2X6SA 3NH0A 4O44A 3OYAA 4CEOA 2Z1JA 2A1RA 4CEQA 4W5TA 4CJ5A 4KHUA 5I3UA 1U47A 1EX4A 1S1TA 4F3TA 1ZBIA 3TI0A 1Q9YA 3D0PA 2XY6A 1KLMA 2D0CA 3QESA 3WNEA 3DLHA 1KVAA 5SWMA 1XI1A 4C8OA 3PV8A 1QTMA 4KHQA 2DFFA 5J1EA 2I5JA 1RBTA 4C8KA 1JLGA 3S3NA 4DU1A 4O0JA 2F8SA 1BI4B 1RILA 3M8PA 3QERA 3SNNA 4KB1A 4I7FA 1IKXA 4O5BA 3SQ2A 1L3VA 1NKBA 1XC9A 2P5GA 3ITHA 3K5NA 1NJYA 4BDZA 3RMCA 3DLKA 3PY8A 4Y1CA 3SJJA 1K6YA 1SV5A 1VSFA 3HL8A 1N6QA 1A5WA 1Y97A 1MU2A 4DU3A 3RR7A 4M3UA 2HB5A 1D5AA 4CJVA 4B3OA 1FKOA 2B5JA 3VA3A 4DTNA 1KSPA 1UAXA 3KLFA 4DTRA 1FXXA 2FC0A 2YNHA 4LH5A 2O4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJX A;  4FLT A;  1HQU A;  3NH2 A;  3KIO A;  4CEC A;  4CGD A;  2VWJ A;  2YNG A;  3BGR A;  2B4J A;  3THV A;  3MXI A;  2XRI A;  3LP0 A;  3LWL A;  4CHQ A;  2E4L A;  1RTI A;  4FJH A;  3AVG A;  4YNQ A;  4DTM A;  2ZD1 A;  3VQ6 A;  3OYB A;  4FJN A;  3SYZ A;  2VG6 A;  5HLF A;  4F8R A;  1FKP A;  4CJP A;  4YFU A;  3TAQ A;  3ZT1 A;  2QKK A;  1QSL A;  4ID1 A;  4I9Q A;  3OJU A;  2IS3 A;  3AA4 A;  4Z0U A;  3QNO A;  1C1B A;  1J54 A;  1RBS A;  2YNF A;  4MQ3 A;  1RNH A;  3NGY A;  2HND A;  1TKT A;  4DTO A;  3T1A A;  3MED A;  1LWF A;  4DSJ A;  1S5J A;  4J2E A;  4IKF A;  3H08 A;  4CIG A;  4Z4E A;  4IDK A;  3V4I A;  3TAP A;  3NDK A;  1CXU A;  5HRS A;  4FJ5 A;  4CEE A;  3PX4 A;  3OYF A;  4CHO A;  4DTP A;  4M3Z A;  4KTQ A;  3MEG A;  4LY7 A;  4PY5 A;  4HVJ A;  1QHT A;  4CGF A;  4DWI A;  3SQ4 A;  4FJI A;  4CCH A;  4CFB A;  3OYC A;  3NGI A;  3SCX A;  2HHX A;  2FBV A;  4O0I A;  4DSK A;  1T03 A;  4MFB A;  3ZSW A;  4DSF A;  4FXD A;  3KLI A;  2P51 A;  1LW2 A;  2LSN A;  3AVM A;  3I0S A;  2OPQ A;  4CK2 A;  4CIE A;  3TAG A;  3U3Y A;  2G8V A;  1HYS A;  4CHN A;  4E19 A;  1JL2 A;  1BIU A;  1EET A;  3HP6 A;  4AIL C;  5FRN A;  2HHW A;  5HRP A;  4OJR A;  1B92 A;  3SUQ A;  2OYQ A;  3TAM A;  3F73 A;  1KFS A;  3IS9 A;  1HPZ A;  2ETJ A;  4CEB A;  1GOA A;  4KV8 A;  4FJ8 A;  3G10 A;  4J2A A;  1I39 A;  1TAQ A;  1WSH A;  1RT6 A;  4RW8 A;  3LP3 A;  3VQA A;  1T7P A;  2HHV A;  1RT2 A;  2OZM A;  1NOY A;  4CF2 A;  1BGX T;  3QLH A;  3PX6 A;  4RW4 A;  1SKR A;  5KGW A;  4CES A;  2R7Y A;  1NJX A;  4HTU A;  5CZ1 A;  4DLE A;  4DF8 A;  2DTU A;  3HVR A;  5FRM A;  4QOZ B;  4CF8 A;  2XY7 A;  1TV6 A;  4IG0 A;  4KTW A;  4ZTF A;  1C1C A;  3V9Z A;  2GUI A;  3SV3 A;  4Z4F A;  1QE1 A;  4CJK A;  4F2S A;  4M42 A;  3EZ5 A;  4NCB A;  2D0A A;  4OLB A;  1ZBH A;  1S6Q A;  3TAN A;  1TKD A;  4HHT A;  4CIF A;  4AHT A;  2QK9 A;  4CF9 A;  1HYV A;  4KFB A;  4CK3 A;  4HUF A;  4KTZ A;  1WLJ A;  3CFP A;  4ZHR A;  4FW2 A;  3CM6 A;  1BL3 A;  3CFO A;  4CGJ A;  4M45 A;  4BWM A;  3KK2 A;  3OYM A;  4EZ6 A;  4N76 A;  3LAM A;  4HUE A;  5HRN A;  4OKJ A;  4CF0 A;  4ELT A;  3VQ8 A;  1L3T A;  3IRX A;  3U6F A;  3VQP A;  4CJW A;  4CJR A;  1A5X A;  1C6V A;  4DFM A;  3DOL A;  1BIZ A;  3HXM A;  3DLG A;  4DQR A;  3HVT A;  1TK5 A;  4CHP A;  1KLN A;  3L2R A;  3KTQ A;  4OGE A;  1D8Y A;  3LPU A;  3LPT A;  4BWJ A;  1BIS A;  1NK7 A;  2HVI A;  4LD0 A;  4FJ9 A;  4KB0 A;  4B9L A;  3V9X A;  1CLQ A;  1UA1 A;  4J2B A;  1Q8I A;  2HW3 A;  3NBP A;  3IAY A;  2QKB A;  1LW0 A;  3U3G A;  4BE0 A;  4ICL A;  1C1A A;  1QS4 A;  3WNF A;  1D9F A;  4GW6 A;  3OYD A;  5E41 A;  3I8D A;  1RT3 A;  1TVR A;  3AVJ A;  3ZSY A;  3KD5 E;  3UIQ A;  4W5O A;  3KLE A;  1JKH A;  4BE2 A;  4FVM A;  3HJF A;  3OVN A;  2PYL A;  3LDS A;  3P83 D;  3QEX A;  1XWL A;  1WSE A;  3AVC A;  4ZTJ A;  3O3H A;  4KO0 A;  4H8K A;  4EP5 A;  4RW6 A;  3LP2 A;  5HRR A;  4DMN A;  3AO4 A;  3QEI A;  4F4K A;  3DRR A;  1IKV A;  4JS4 A;  1A5V A;  5HRO A;  5SZT A;  1C0M A;  5T7B A;  3OYG A;  3VQC A;  3OS1 A;  4FLZ A;  1NK6 A;  2P5O A;  1WN7 A;  5DK5 A;  4M3R A;  3KKS A;  1W0H A;  2RPI A;  3HPH A;  2FBX A;  1TAU A;  3ZT4 A;  3QEV A;  4OVL A;  1NJZ A;  1F21 A;  1SL2 A;  1NKE A;  1RT7 A;  2X78 A;  3V6D A;  4O4G A;  4QAG A;  3HPO A;  3AVA A;  4I2P A;  4N41 A;  1YTU A;  3ALY A;  3MAQ A;  3NGZ A;  3ASM A;  3C6T A;  4M3Y A;  3DM2 A;  1HYZ A;  4CGH A;  4F3O A;  3AO3 A;  1RDD A;  2XY8 A;  5J2M A;  4FJM A;  4M3T A;  5CZ2 A;  4E7K A;  4R5P A;  1ZBU A;  1S1U A;  3WNG A;  3JYT A;  1U04 A;  3RMB A;  4LSN A;  3DMJ A;  5C24 A;  1VSI A;  3E01 A;  3AVB A;  3CM5 A;  3VQ5 A;  3RMA A;  4FJ7 A;  4IFY A;  3OYH A;  3CFR A;  4CE9 A;  4RW7 A;  3SUP A;  4G1Q A;  3C94 A;  3SQ0 A;  4B9T A;  3MXM A;  1FK9 A;  3AA3 A;  1SL0 A;  4AHC A;  4WE1 A;  4FZY A;  3EY1 A;  1IKW A;  4FLX A;  3SUN A;  4CJ4 A;  3QEP A;  1JXB A;  3V1R A;  4DSL A;  2BGG A;  1Z26 A;  2HHQ A;  5DMR A;  4DS4 A;  4DS5 A;  3V9U A;  3TAE A;  1T8E A;  4I9L A;  1C0T A;  1ITG A;  3RRH A;  4CGI A;  4DTS A;  4FM0 A;  1BCM A;  4OGC A;  4L8R B;  2FBT A;  2KTQ A;  5JS2 A;  4CER A;  2A1S A;  3LAK A;  3ZSO A;  2W42 A;  1KCF A;  1SUQ A;  3M8Q A;  1YT3 A;  4JS5 A;  3L2Q A;  1JLQ A;  4JRP A;  3ZCM A;  1X9S A;  1JLC A;  1NJW A;  4CFA A;  4FK0 A;  4QCL A;  4FJL A;  4N5S A;  5K14 A;  2HHS A;  2EX3 A;  1ASV A;  3KK1 A;  2NUB A;  2HNY A;  2VG5 A;  2E6M A;  4CJU A;  3EYZ A;  1CZB A;  1S6P A;  3LP1 A;  4M41 A;  2HVH A;  2VG7 A;  4OLA A;  2P1J A;  3ISN C;  3AVI A;  3HP9 A;  1KVC A;  4H4O A;  3NF8 A;  2X6N A;  3RWU A;  3M8R A;  4HUG A;  3LZI A;  1N5Y A;  5C42 A;  4CHY A;  3V9S A;  2KW4 A;  1NK5 A;  1X9W A;  1HRH A;  1WNS A;  3AV9 A;  4FCY A;  3QNN A;  3L2V A;  4FYD A;  1X1P A;  4NYN A;  1ASW A;  1O1W A;  1S9G A;  3NF7 A;  3V9W A;  3HYF A;  2RN2 A;  1T05 A;  4DSI A;  1HNI A;  1UA0 A;  5J2N A;  1VSE A;  1VSD A;  4Q5V A;  4CED A;  1UWB A;  2G8U A;  4M3X A;  4KPY A;  4DFK A;  5HP1 A;  4KI4 A;  5FDL A;  1HNV A;  2HMI A;  4CJS A;  1JXE A;  4CFD A;  1VSL A;  3V1Q A;  3VA0 A;  1JL1 A;  2G8H A;  4CJ3 A;  2ZQB A;  1L3U A;  1KRP A;  3HO1 A;  4KRF A;  3ZT2 A;  1WSJ A;  5J2P A;  3PO5 A;  4Q0B A;  4DG1 A;  1RTH A;  1QQC A;  1NK4 A;  3CYM A;  1L3S A;  3AVL A;  4PQU A;  2BDP A;  3LWM A;  3S3O A;  5FRO A;  4FJJ A;  5KRS A;  4K8Z A;  3LAN A;  3V1O A;  4DFJ A;  1U45 A;  4C8L A;  2JLE A;  3OYN A;  4B9S A;  1B9D A;  3QO9 A;  4FW1 A;  2YHB A;  3NH1 A;  3CQ8 A;  4FJG A;  2EHG A;  2ITG A;  2OPP A;  2BE2 A;  2OZS A;  3OS2 A;  1TK8 A;  1HMV A;  5KI6 A;  3WNH A;  3OYL A;  4B9M A;  1RTJ A;  1BCO A;  1Z25 A;  1RDA A;  1BI4 A;  1WAF A;  3HPG A;  4E7I A;  4KHN A;  4HCC A;  1WAJ A;  1HJR A;  4B8A B;  3S3M A;  1IH7 A;  3QIN A;  2AJQ A;  3ZSV A;  3PX0 A;  5JS1 A;  3T19 A;  3QEW A;  4Z4G A;  3MEC A;  3ULD A;  3K57 A;  3T3F A;  3RMD A;  3NE6 A;  4ELU A;  2Z1I A;  1YVU A;  4UQG A;  5I42 A;  1REV A;  4H4M A;  5KGX A;  4KHY A;  1GOC A;  1RBR A;  1VSM A;  3TAB A;  4ELV A;  4C8N A;  2RKI A;  4B9U A;  1ZBL A;  3ZT3 A;  4DSE A;  1J5O A;  3D45 A;  1NOZ A;  1Q9X A;  1WSI A;  1TGO A;  5CYQ A;  4CJF A;  2RF2 A;  3QIO A;  4FM1 A;  2DFE A;  3TWH A;  2YNI A;  4DF4 A;  5CY4 A;  3VQE A;  1IG9 A;  3A2F A;  2IOC A;  3AO1 A;  3HT3 A;  4W5N A;  2Y1I A;  1RT1 A;  1X9M A;  3DI6 A;  2KZZ A;  2HHU A;  4FJK A;  3QET A;  2WOM A;  3VQ9 A;  1TL1 A;  1LWE A;  3MXJ A;  3ZSR A;  4E1M A;  4RG8 A;  2OPR A;  2D5R A;  1JLF A;  4Y1D A;  3NF6 A;  4ID5 A;  3ZT0 A;  4GVM A;  4B08 A;  4EZ9 A;  4DQI A;  3DOK A;  1S9E A;  1SKW A;  2Q3S A;  4BDY A;  1JLA A;  5KTQ A;  4DFP A;  3TAR A;  4AHV A;  1WSF A;  2YHA A;  3SUO A;  3OYK A;  4JLH A;  4AH9 A;  4CEZ A;  2BAN A;  3OYE A;  3TAF A;  4DTJ A;  2D0B A;  1CZ9 A;  4CJE A;  3NAE A;  2ATQ A;  1RDC A;  1CXQ A;  1ASU A;  4CK1 A;  4Z4H A;  1NK8 A;  3SV4 A;  3K2P A;  3NHG A;  3KD1 E;  3SQ1 A;  2YKN A;  3RRG A;  4E7L A;  1NKC A;  3K58 A;  2KZM A;  5CYM A;  2XY5 A;  1UOC A;  3VQD A;  3V81 A;  4LSL A;  3L8B A;  1SL1 A;  1I3A A;  1U4B A;  3F9K A;  3AVN A;  1VK0 A;  2O4G A;  1BQM A;  2KQ2 A;  3LZJ A;  3FFI A;  4FM2 A;  4NCG A;  3SZ2 A;  1QSS A;  4CGG A;  3AO5 A;  1WSG A;  1VRU A;  1VSJ A;  3NF9 A;  4CJL A;  5HBM A;  4EP4 A;  1HQE A;  1IKY A;  1LAW A;  2GV9 A;  3AVK A;  3C95 A;  3L3U A;  3P5J A;  4TSX A;  3K59 A;  4DTX A;  3NFA A;  4OKE A;  3ZSQ A;  3IG1 A;  4DLG A;  4DQP A;  4CFC A;  4FZZ A;  1L5U A;  4KHS A;  1J53 A;  4DU4 A;  4AHU A;  1RT5 A;  2IGI A;  5J2Q A;  3OYI A;  4FZX C;  1J9A A;  1D9D A;  2Y1J A;  4E7H A;  3HST B;  1R0A A;  4PWD A;  2YV0 X;  2Z1H A;  4F2R A;  5EU7 A;  4E3S A;  3RR8 A;  1YTA A;  4M3W A;  4CJT A;  4JRQ A;  1VSH A;  4I2Q A;  2X74 A;  3CG7 A;  1DLO A;  1NK9 A;  4OPK A;  4HCB A;  4BAC A;  3O3F A;  4B9V A;  4BE1 A;  2OPS A;  2IC3 A;  3S9H A;  4AHS A;  4CF1 A;  3KLG A;  4CHZ A;  3HK2 A;  1DTQ A;  2VWK A;  1RBV A;  3DRS A;  2G8W A;  1G15 A;  1KVB A;  4GMJ B;  3VQB A;  4FLV A;  2KFZ A;  3ZSZ A;  3K5L A;  4LH4 A;  4J2D A;  2OA8 A;  3B6O A;  3I0R A;  1EKE A;  4Z4I A;  2KFN A;  4XIU A;  1XHZ A;  3K5O A;  4Z4C A;  4IFV A;  2G8K A;  3VN5 A;  1RBU A;  2HNZ A;  2B6A A;  4KKO A;  1RDB A;  3O4Q A;  3M8S A;  4O55 A;  4IBN A;  2PYJ A;  3G0Z A;  3B6P A;  4NCA A;  1ZYQ A;  2HHT A;  3L2W A;  2DFH A;  1EP4 A;  1JLB A;  1QSY A;  3VQQ A;  4IG3 A;  3AO2 A;  2F96 A;  4CJQ A;  5C25 A;  1LAV A;  3O4N A;  1BHL A;  2E6L A;  3KJV A;  4FLY A;  3C6U A;  4KHW A;  2XHB A;  3SI6 A;  1W9H A;  3KLH A;  3O3G A;  3SPZ A;  1GOB A;  3PUF A;  2G8F A;  3DLE A;  1RT4 A;  1KFD A;  3RTV A;  4KI6 A;  4E0D A;  4E89 A;  3DRP A;  4KRE A;  1XHX A;  3OS0 A;  1NK0 A;  3DLR A;  4FK4 A;  3L3V A;  3HM9 A;  3ZSX A;  3SPY A;  4K8X A;  1IO2 A;  4W5Q A;  1S1W A;  1U49 A;  5D3G A;  4CEF A;  4E1N A;  2F8T A;  3K5M A;  2PZS A;  4KAZ A;  1BQN A;  4W5R A;  3AVH A;  1JLE A;  2JGU A;  4DTU A;  4PA1 A;  1TL3 A;  2WON A;  4BDP A;  2Z1G A;  2FBY A;  2YKM A;  3KK3 A;  4B9N A;  3LAL A;  1EXQ A;  3P1G A;  2ZE2 A;  4B8C A;  5KRT A;  3DLB A;  1RTD A;  3AVF A;  2PY5 A;  3AA2 A;  1B9F A;  4DQS A;  3QIP A;  4CEA A;  3PO4 A;  2DY4 A;  4FK2 A;  4AHR A;  1VRT A;  4PUO A;  1S1V A;  4N56 A;  2XO7 A;  3TR8 A;  4E7J A;  1U48 A;  2G8I A;  2GBZ A;  1TKZ A;  3AA5 X;  1ZBF A;  2IAJ A;  2QXF A;  4C8M A;  3KKR A;  3VQ7 A;  3NCI A;  1LWC A;  1DTT A;  1S1X A;  2IDO A;  3OJS A;  4N47 A;  4FLU A;  1TKX A;  1SKS A;  3OYJ A;  4NYF A;  1RCH A;  3OY9 A;  1KTQ A;  1VSK A;  3L2U A;  3JSM A;  4OKK A;  1C0U A;  1TK0 A;  4OPJ A;  3MEE A;  4DQQ A;  4RW9 A;  3VQ4 A;  3DYA A;  4FLW A;  1LV5 A;  3BDP A;  2X6S A;  3NH0 A;  4O44 A;  3OYA A;  4CEO A;  2Z1J A;  2A1R A;  4CEQ A;  4W5T A;  4CJ5 A;  4KHU A;  5I3U A;  1U47 A;  1EX4 A;  1S1T A;  4F3T A;  1ZBI A;  3TI0 A;  1Q9Y A;  3D0P A;  2XY6 A;  1KLM A;  2D0C A;  3QES A;  3WNE A;  3DLH A;  1KVA A;  5SWM A;  1XI1 A;  4C8O A;  3PV8 A;  1QTM A;  4KHQ A;  2DFF A;  5J1E A;  2I5J A;  1RBT A;  4C8K A;  1JLG A;  3S3N A;  4DU1 A;  4O0J A;  2F8S A;  1BI4 B;  1RIL A;  3M8P A;  3QER A;  3SNN A;  4KB1 A;  4I7F A;  1IKX A;  4O5B A;  3SQ2 A;  1L3V A;  1NKB A;  1XC9 A;  2P5G A;  3ITH A;  3K5N A;  1NJY A;  4BDZ A;  3RMC A;  3DLK A;  3PY8 A;  4Y1C A;  3SJJ A;  1K6Y A;  1SV5 A;  1VSF A;  3HL8 A;  1N6Q A;  1A5W A;  1Y97 A;  1MU2 A;  4DU3 A;  3RR7 A;  4M3U A;  2HB5 A;  1D5A A;  4CJV A;  4B3O A;  1FKO A;  2B5J A;  3VA3 A;  4DTN A;  1KSP A;  1UAX A;  3KLF A;  4DTR A;  1FXX A;  2FC0 A;  2YNH A;  4LH5 A;  2O4I A; 
#chains in the Genus database with same CATH topology
 3ENO A;  1S22 A;  1HQU A;  2O8B A;  2VWJ A;  3BGR A;  2OTJ N;  1BWF O;  2XRI A;  4PL8 A;  5BPL A;  3R1X A;  5FPE A;  1RTI A;  2P9K B;  4FJH A;  2ZD1 A;  3VQ6 A;  4X65 K;  4B3R K;  1Z05 A;  1W97 L;  2QKK A;  1QSL A;  2WFB A;  4WYB A;  3QNO A;  4WFB L;  4YOY A;  1NMD A;  1RNH A;  2A6A A;  2P9K A;  3V4I A;  5HRS A;  1KAZ A;  4PY5 A;  4CHO A;  4KTQ A;  4LY7 A;  5BPN A;  3T69 A;  3OYC A;  3NGI A;  3SCX A;  2HHX A;  2FBV A;  4BR5 A;  4O0I A;  4DSK A;  1T03 A;  2NRW A;  3ZSW A;  3J7A P;  4BVP A;  2IVO A;  4CBW A;  3EE8 A;  3WXI A;  3U3Y A;  2ZGY A;  4E19 A;  5FRN A;  2QA4 N;  1B92 A;  5AQZ A;  3IS9 A;  1HX1 A;  3CI5 A;  3G10 A;  2A41 A;  4RW8 A;  5C2F A;  1SZ2 A;  4IJN A;  4BC2 A;  2OZM A;  3THW B;  1ILY A;  3CCJ N;  2OCE A;  1K8A O;  4HTU A;  4QOZ B;  4KH4 A;  4KTW A;  4A5B A;  1YXQ A;  3EZ5 A;  5EY4 A;  4AHT A;  4X64 K;  1HNX K;  4B1U B;  3FZL A;  4JKG B;  3CM6 A;  4N76 A;  3CFO A;  1KAY A;  3LAM A;  1L3T A;  3IRX A;  4BRF A;  3WXJ A;  2P9N B;  3DOL A;  1BIZ A;  3DLG A;  3HVT A;  3KZB A;  4CHP A;  1KLN A;  3I8B A;  3KTQ A;  1D8Y A;  1JCG A;  2HW3 A;  1HJO A;  4OO1 J;  3N4P A;  1QS4 A;  2F7T A;  4GW6 A;  5E41 A;  1TVR A;  3ZSY A;  2Q2R A;  3WUH A;  4LF4 K;  4WCE L;  4BE2 A;  3CCS N;  3P83 D;  1XWL A;  3ATV A;  1WSE A;  4KO0 A;  4EP5 A;  4JS4 A;  3BEX A;  1C0M A;  5T7B A;  1M1K O;  3VQC A;  4FLZ A;  4M3R A;  1W0H A;  2RPI A;  1WBD A;  2D0P A;  2O8E B;  3HPH A;  3VET A;  4RCH A;  1F21 A;  3VEO A;  1RT7 A;  1X3N A;  3GE1 A;  3AVA A;  4AF1 A;  3NGZ A;  3ASM A;  3C6T A;  1K9M O;  4FWQ A;  3G6E N;  1RDD A;  3RSE A;  2WBN A;  1VQO N;  3L0Q A;  3RMB A;  4LSN A;  4M63 C;  4IFY A;  3CFR A;  1YI2 N;  3SUP A;  5DM7 L;  3SQ0 A;  4JKB A;  4BRM A;  3MXM A;  4B9T A;  3EEQ A;  1SL0 A;  2YJE A;  4FZY A;  3EY1 A;  4FLX A;  4DSL A;  2BGG A;  5DMR A;  4BC4 A;  1C0T A;  5AQP A;  3CJA A;  4DTS A;  4OGC A;  4L8R B;  2KTQ A;  3WXL A;  3HSC A;  4BR2 A;  4BRD A;  4DUZ K;  1YT3 A;  4BRG A;  4I6M B;  1JLC A;  1NJW A;  5C15 A;  1DEJ A;  4H0O A;  2NUB A;  3A5N C;  1WBB A;  2VG5 A;  1S6P A;  3SAF A;  1N32 K;  2VG7 A;  3BY5 A;  3AVI A;  1KVC A;  5M1N A;  4EHU A;  2E2P A;  4LC9 B;  4HUG A;  5C42 A;  2KW4 A;  4MLH A;  4BC3 A;  1YUW A;  3QNN A;  1X1P A;  4NYN A;  1ASW A;  1S9G A;  3NF7 A;  3V9W A;  1NGD A;  5BR8 K;  4WFN L;  1UA0 A;  5J2N A;  3EE9 A;  1SQK A;  4KPY A;  2YHX A;  3I56 N;  2UUA K;  5KPZ A;  4FWS A;  5AQY A;  4CFD A;  4H0T B;  3V1Q A;  1JL1 A;  2ZQB A;  5LJW A;  5J2P A;  3PO5 A;  1HKG A;  3CYM A;  5DM6 L;  3AVL A;  4B1W B;  2BDP A;  4FJJ A;  3MCP A;  5A2Q O;  4K8Z A;  3V1O A;  3EN9 A;  1U45 A;  2AP1 A;  2YHY A;  2ITG A;  2E8A A;  1RTJ A;  1XMO K;  1RDA A;  1BI4 A;  3S3M A;  3QIN A;  4QS7 A;  1MA9 B;  3ZSV A;  3PX0 A;  3M1F A;  1TYQ B;  3T19 A;  3QEW A;  4Z4G A;  4BQL A;  3K57 A;  3T3F A;  5I42 A;  1QVF M;  5AQJ A;  1VSM A;  5C0Y A;  1XC3 A;  4ELV A;  2RKI A;  3MWP A;  4H03 B;  3AY9 A;  1ZBL A;  3M6G A;  3PLA A;  1WSI A;  1O13 A;  2D0O A;  4H5V A;  3NVM A;  3QIO A;  3QBX A;  4FM1 A;  1IG9 A;  5CY4 A;  2IOC A;  3AO1 A;  4B1Y B;  1TYQ A;  4YHH K;  2ASP A;  3E9O A;  4FJK A;  3ZET A;  3ZSR A;  3UKU A;  2OPR A;  1JLF A;  1YIT N;  4EAH D;  5AJ3 K;  4B08 A;  4EZ9 A;  3DOK A;  5F2R A;  2Q3S A;  4BDY A;  3G4S N;  3WXK A;  1WSF A;  3KK7 A;  2QM1 A;  3SUO A;  4JLH A;  2HMP A;  1JJ2 M;  2P9P A;  1YHQ N;  3SV4 A;  4DV5 K;  3J80 O;  2NRV A;  3SQ1 A;  2YKN A;  5AR0 A;  4E7L A;  2YCH A;  5FLX O;  5CYM A;  2XY5 A;  3VQD A;  3V81 A;  4LSL A;  5AZJ B;  1N33 K;  1U4B A;  1VK0 A;  1QSS A;  3LZJ A;  4IFE A;  4CZF A;  1YJ9 N;  1VQM N;  2GTD A;  4GV3 A;  1VRU A;  1VSJ A;  4DFK A;  3L3U A;  3AVK A;  4TSX A;  4LF5 K;  5AQO A;  3ZSQ A;  4DQP A;  4FZZ A;  3O9Q A;  3LM2 A;  5I9E B;  1RT5 A;  2Q36 A;  5KQ8 A;  5J2Q A;  3UB5 A;  1R0A A;  4PWD A;  4F2R A;  1YTA A;  1VSH A;  1DLO A;  1Q81 O;  2QTD A;  3RVC A;  3SK3 A;  4CHZ A;  3CD6 N;  1RBV A;  2O8C A;  1R59 O;  1G15 A;  4GMJ B;  4BRQ A;  4LH4 A;  3B6O A;  2KFN A;  2KHO A;  4JI6 K;  4JV5 K;  3D6R A;  3VN5 A;  3VGK A;  2HNZ A;  2E20 A;  2PYJ A;  3B6P A;  1GLJ O;  3L2W A;  4FWO A;  1EP4 A;  3T1H K;  4DCH A;  3ENB A;  3C6A A;  5C25 A;  4DV6 K;  3J7Y P;  3UE5 A;  4JI8 K;  4YOT A;  2YX6 A;  3C6H A;  3SI6 A;  3Q7B A;  2E5L K;  3O3G A;  4JK8 A;  3PUF A;  1RT4 A;  4KI6 A;  2YI1 A;  1C0G A;  3FFK B;  5AQX A;  3DRP A;  4KRE A;  1XHX A;  3VTH A;  3DLR A;  4FK4 A;  3L3V A;  3HM9 A;  3ZSX A;  1S1W A;  1U49 A;  5D3G A;  4CEF A;  4K42 A;  4KAZ A;  4JYA K;  5C10 A;  4W5R A;  3AVH A;  3WQT A;  2WON A;  1QQM A;  2FBY A;  1EXQ A;  3SAH A;  2ZE2 A;  4H0P A;  4B8C A;  3DLB A;  3Q7C A;  1RTD A;  3AA2 A;  3QIP A;  4DR1 K;  4AHR A;  4N56 A;  2XO7 A;  3TR8 A;  4GNI A;  1U48 A;  3MN5 A;  2GBZ A;  3U9Z A;  5BN8 A;  3VQ7 A;  3H46 O;  1LWC A;  1DTT A;  1S1X A;  2PBD A;  1NJI O;  1SKS A;  3O9S A;  3DAW A;  3JSM A;  4OPJ A;  1T44 A;  1N34 K;  4RW9 A;  1EWQ A;  4FLW A;  1G99 A;  4CEQ A;  1YIJ N;  4KHU A;  1IJJ A;  1V4S A;  3CC7 N;  1ZBI A;  1NU0 A;  3DLH A;  4H0V B;  1LCU A;  2KKZ A;  4KHQ A;  5GAD P;  1RBT A;  3O6W A;  1JLG A;  1BI4 B;  1RIL A;  3VPZ A;  3QER A;  1U6Z A;  3SNN A;  1JCE A;  3CC2 N;  1GLF O;  4I7F A;  3ATU A;  1L3V A;  4ILG B;  5IT9 O;  3P31 A;  4A61 A;  1NJY A;  3R3L A;  3RMC A;  1VQ6 N;  1A5W A;  3VF6 A;  4DU3 A;  3RR7 A;  4CJV A;  1FKO A;  5AQS A;  4JKF A;  3KLF A;  3G71 N;  4OPH A;  3ENH A;  1VQ9 N;  3VES A;  2O4I A;  2WC9 A;  3NH2 A;  5LMN K;  1HPM A;  4CGD A;  2P9U A;  2B4J A;  2ZWH A;  3THV A;  3LP0 A;  4CHQ A;  2P9I B;  2E4L A;  2FSJ A;  4DTM A;  4FJN A;  4JD2 B;  1FKP A;  5M1P A;  4CJP A;  4YFU A;  2CH5 A;  3ZT1 A;  5JLF A;  1RGI A;  3K9K A;  4ID1 A;  1IV0 A;  4Z0U A;  1C1B A;  1J54 A;  3CHW A;  4MQ3 A;  2W6K A;  3MDQ A;  4WQ5 C;  2HND A;  1VQ7 N;  3F5T A;  4DSJ A;  1YJW N;  5AQQ A;  5EX5 A;  3HZ6 A;  4DR6 K;  4IDK A;  4JKG A;  3OBY A;  1CXU A;  4FJ5 A;  4M3Z A;  4CEE A;  3CMA N;  4DTP A;  4A5A A;  4HVJ A;  4CCH A;  4CFB A;  4ILH A;  2IVN A;  4DSF A;  3LL3 A;  3D2E B;  2P9U B;  3KLI A;  2LSN A;  3I0S A;  2OPQ A;  1NMN A;  4H5W A;  2G8V A;  4IJA A;  3HP6 A;  4AIL C;  2HHW A;  4BRO A;  3F73 A;  3THY A;  2UXC K;  1KFS A;  2IIR A;  4KV8 A;  4J2A A;  1I39 A;  1TAQ A;  3H6E A;  1RT6 A;  3LP3 A;  3O9T A;  1ZC6 A;  1K73 O;  1BGX T;  3PX6 A;  1ZBS A;  3UKU B;  4CES A;  4GV6 A;  5CZ1 A;  4DF8 A;  2DTU A;  3HVR A;  5FRM A;  1TV6 A;  1C1C A;  3V9Z A;  3SV3 A;  4CJK A;  2O8E A;  1KXP A;  1E4G T;  2D0A A;  4RTF D;  3OW2 M;  1S6Q A;  1TKD A;  4HHT A;  4CIF A;  4ISG A;  2FXU A;  1HYV A;  4KFB A;  1WLJ A;  3CFP A;  3WEE B;  3PIP L;  4FW2 A;  3EKS A;  3GOI A;  5BPM A;  4ISF A;  4CJR A;  5B8H A;  3IUC A;  4DQR A;  3L2R A;  5JMV A;  4BRL A;  2P9L B;  1BIS A;  3CJ9 A;  4LD0 A;  4C23 A;  4FJ9 A;  4BGA A;  3QB0 A;  3V9X A;  1UA1 A;  4J2B A;  4DR4 K;  4B1X B;  3IAY A;  1LW0 A;  3P39 A;  3U3G A;  4ICL A;  5AQW A;  3I8D A;  3AVJ A;  5ADX A;  4W5O A;  2A42 A;  4LFC K;  2QWO A;  4FVM A;  1FW6 A;  2PYL A;  3P4I A;  5AQG A;  3QIC A;  4JKC A;  3O3H A;  4RW6 A;  5HRR A;  3AGR A;  3VF4 A;  3ZET B;  3CIP A;  4DV4 K;  1IKV A;  2KLA A;  3JS6 A;  2HST A;  3OS1 A;  1Q7Y O;  3KKS A;  4K25 A;  2FBX A;  3V6D A;  4O4G A;  4K43 A;  4I2P A;  4FPA A;  3MAQ A;  4M3Y A;  3DM2 A;  3SBT A;  4F3O A;  3AO3 A;  5J2M A;  1CZA N;  4FJM A;  4MDA A;  2PAV A;  3DMJ A;  4YOV A;  3W0L A;  3MN6 A;  4FJ7 A;  2UXB K;  5GAE P;  4CE9 A;  4G1Q A;  3C94 A;  4FWK A;  3PSF A;  4WE1 A;  1IKW A;  1JXB A;  1OVQ A;  3V1R A;  5AFU A;  3CCL N;  5AZI B;  4FM0 A;  1BCM A;  2BTF A;  2FBT A;  5JS2 A;  1MWM A;  4CER A;  3LAK A;  3ZSO A;  1KCF A;  1SUQ A;  3M8Q A;  3L2Q A;  1JLQ A;  3ZCM A;  1X9S A;  4CFA A;  1HNZ K;  5EVZ A;  2HOE A;  2E6M A;  4B3T K;  2HVH A;  3LP1 A;  5LL6 Z;  3CQX A;  3S41 A;  2P1J A;  3RWU A;  3L4I A;  3CCR N;  1N5Y A;  1GLE G;  3V9S A;  1X9W A;  1HRH A;  3JAM O;  2ZJR L;  3AV9 A;  4FCY A;  3L2V A;  2P9S A;  4FYD A;  2YJF A;  4YY3 K;  3VGL A;  3H1V X;  4DSI A;  3CJ7 A;  5AQV A;  3MMV A;  4CED A;  1UWB A;  4PL7 A;  3HI0 A;  5FDL A;  3VEX A;  1HNV A;  2NRZ A;  2O8D A;  4CJS A;  2VGN A;  1VSL A;  3VEV A;  1L3U A;  4XH5 A;  4NXM K;  4DG1 A;  4U7B A;  3LWM A;  3S3O A;  5FRO A;  5KRS A;  3BUZ B;  3LAN A;  3PSI A;  2FF3 B;  1B9D A;  1NGH A;  2YHB A;  2Q0U A;  2OZS A;  3OS2 A;  1TK8 A;  4A57 A;  5HL7 L;  5KI6 A;  3OYL A;  3FGU A;  1BCO A;  3SAG A;  4BR9 A;  1WAF A;  3HPG A;  4M7X A;  4BR4 A;  4CZH A;  3MCA B;  1HJR A;  1IH7 A;  5JS1 A;  4FO0 A;  4OPA A;  4ELU A;  4IDH A;  4H4M A;  4KHY A;  1GOC A;  1SAZ A;  2QWP A;  3TAB A;  2V52 B;  4B9U A;  1C0F A;  3ULE B;  2RF2 A;  4FWR A;  2DFE A;  2YNI A;  3A2F A;  3HT3 A;  4W5N A;  1OH5 A;  1RT1 A;  4Z94 A;  4HWI A;  2NRH A;  3VQ9 A;  4B9N A;  3SMP A;  3O1B A;  4E1M A;  1OH7 A;  2QEX N;  4GVM A;  4DQI A;  1QQN A;  3HTV A;  3TAR A;  1LOT B;  1K8K A;  1VHX A;  4JAX A;  5GIN A;  3OYK A;  3A5O C;  4CEZ A;  3TAF A;  4NXN K;  2D0B A;  1CZ9 A;  4CJE A;  3VOV A;  3NAE A;  2ATQ A;  3T7Z A;  1BA0 A;  1ASU A;  1NK8 A;  4PKI A;  1M90 O;  3K58 A;  1S3X A;  1UOC A;  3MWT A;  3L8B A;  1SL1 A;  1I3A A;  2O4G A;  1BQM A;  2GX9 A;  4JI7 K;  3FFI A;  4NCG A;  4CGG A;  1WSG A;  4CJL A;  4EP4 A;  4DQS A;  1IKY A;  1LAW A;  2GV9 A;  3K59 A;  2BUP A;  4OKE A;  2HBJ A;  4DLG A;  4CFC A;  2V7Z A;  3ZYY X;  4AHU A;  3PIO L;  3CCU N;  4DR7 K;  4FZX C;  4H0Y B;  1D9D A;  4CZJ A;  5ADX H;  2A3Z A;  2Z1H A;  5EU7 A;  2X74 A;  2QWL A;  3CG7 A;  3R9P A;  4BE1 A;  2OPS A;  3S9H A;  1J5E K;  4CF1 A;  1YVN A;  1T3V A;  1VQ5 N;  3CER A;  3THX B;  1P90 A;  3DRS A;  4ISE A;  5AQM A;  2HBM A;  4FLV A;  1HLU A;  3AAQ A;  3FZM A;  2D4W A;  1EKE A;  2WTU A;  3K5O A;  4KKO A;  4O55 A;  4IBN A;  2HHT A;  3VQQ A;  3AO2 A;  3CPE A;  3THY B;  1LAV A;  2NLX A;  2E6L A;  1FJG K;  3KJV A;  4FLY A;  4FWM A;  1W9H A;  3KLH A;  4IXC A;  3SPZ A;  1GOB A;  3J8A A;  3TSQ A;  3RTV A;  2UU9 K;  4DV0 K;  3OS0 A;  4XH4 A;  3IDH A;  2WUS A;  1JLE A;  2H3G X;  4PA1 A;  4BDP A;  2Z1G A;  3KK3 A;  5KRT A;  3AVF A;  1B9F A;  3MK6 A;  3PO4 A;  2DY4 A;  2FSN A;  2GEL A;  4E7J A;  4BVO A;  1TKZ A;  3AA5 X;  3AGK A;  2QXF A;  4C8M A;  4H5R A;  5BR9 A;  4LF6 K;  4JD2 A;  3OY9 A;  3L2U A;  4O8U A;  1LV5 A;  4BRC A;  3NH0 A;  4O44 A;  4CEO A;  4CJ5 A;  3HBT A;  1EX4 A;  1S1T A;  3MN9 A;  4E1J A;  5M1Q A;  1KLM A;  2D0C A;  4JEP A;  2Q97 A;  1KVA A;  4C8O A;  1XI1 A;  1QTM A;  4C8K A;  1HUX A;  3J7Z O;  3S3N A;  2F8S A;  3M8P A;  4KB1 A;  4DV1 K;  2VYP A;  1ZXO A;  1XC9 A;  4BDZ A;  4Y1C A;  1VSF A;  4BRI A;  4LF9 K;  1Y97 A;  1MU2 A;  3G25 A;  3WT0 A;  2HB5 A;  3EZW A;  4JHD B;  4B3O A;  3VA3 A;  2B5J A;  3VER A;  4DTR A;  2FC0 A;  2OTL N;  2YNH A;  4FJX A;  4FLT A;  3KIO A;  4CEC A;  2Q1N A;  2CH6 A;  3CCQ N;  3GBT A;  4YNQ A;  5M1K A;  2VG6 A;  3TAQ A;  3WXM B;  4I9Q A;  5EXW A;  1RBS A;  3FZF A;  2V7Y A;  1TKT A;  3OHR A;  2VGM A;  3ZX0 A;  1LWF A;  2HF3 A;  2W40 A;  4IKF A;  4ILJ A;  3H08 A;  4Z4E A;  3DJC A;  4BR7 A;  3TAP A;  4BY9 C;  1VQP N;  3OYF A;  3QML A;  1IG8 A;  5KPT A;  3FZK A;  3HOT A;  3TSU A;  3SQ4 A;  4DWI A;  3DXM A;  4DV3 K;  4FJI A;  4J8F A;  1XUP O;  4FXD A;  2ZGZ A;  4CK2 A;  2ASO A;  4GY2 B;  3VEN A;  4CHN A;  4B1Z A;  1JL2 A;  1BIU A;  1EET A;  5AQT A;  3ZEU B;  5HRP A;  4OJR A;  4JKH A;  4B1V A;  2OYQ A;  2ETJ A;  1QQO A;  3ZLJ A;  3DXM B;  3EL2 A;  1GOA A;  3ULE A;  1VQL N;  4FJ8 A;  1WSH A;  3O5B A;  4K0K K;  1U2V A;  1T7P A;  3TTF A;  2HHV A;  1RT2 A;  4HTL A;  1NOY A;  1HKC A;  4CF2 A;  2GWJ A;  2J4R A;  4WF9 L;  3ZX3 A;  2O8F B;  1NJX A;  4BQZ A;  4CF8 A;  4IG0 A;  4ZTF A;  1WUA A;  2GUI A;  4Z4F A;  1QE1 A;  2ZF5 O;  4KH5 A;  4NCB A;  3DWL A;  3VTI A;  1IBL K;  1ZBH A;  4R79 A;  2QK9 A;  2V51 B;  2ZJP L;  4HUF A;  4KTZ A;  4EZ6 A;  3KK2 A;  4L3Q A;  4M45 A;  2VQF K;  4HUE A;  5HRN A;  4OKJ A;  4ELT A;  3A0I X;  3VQP A;  4CJW A;  3U6F A;  1A5X A;  1C6V A;  3HXM A;  4JK9 A;  1TK5 A;  4OGE A;  3CPW M;  5IWA K;  4BWJ A;  4CI6 A;  4PHT X;  1NK7 A;  2JWL A;  4B9L A;  4YOX A;  3AAP A;  3NBP A;  2QWQ A;  4JNE A;  4BE0 A;  1D9F A;  3OYD A;  3UIQ A;  4H0X B;  3KLE A;  1JKH A;  3HJF A;  4FWL A;  3OVN A;  3LDS A;  2VQE K;  3QEX A;  1TUU A;  3AVC A;  4ZTJ A;  3QEI A;  3LP2 A;  2E2Q A;  4DMN A;  4F4K A;  1KQS M;  3DRR A;  1A5V A;  3UKR A;  3CJB A;  3C0B A;  2P5O A;  1WN7 A;  1TAU A;  4OVL A;  4X66 K;  1NJZ A;  3CET A;  2X78 A;  2F9T A;  4QAG A;  1YTU A;  4DR3 K;  3ALY A;  1NGI A;  4PKG A;  4M3T A;  2XY8 A;  4R5P A;  1ZBU A;  3WNG A;  1Z6R A;  3JYT A;  3SJH A;  3SMS A;  5C24 A;  1VSI A;  3E01 A;  3AVB A;  3CM5 A;  4MO5 A;  3OYH A;  2QXL A;  1FK9 A;  1X3M A;  4AHC A;  1NGC A;  3SUN A;  3QEP A;  1Z26 A;  4DS4 A;  5TKW A;  4I9L A;  3LDN A;  4CGI A;  4LF8 K;  2BH1 A;  4JHD A;  2E88 A;  4JI2 K;  2A1S A;  4RWT A;  4JS5 A;  4JRP A;  3JXU A;  4FK0 A;  4QCL A;  4CBU A;  2EX3 A;  1ASV A;  2FF6 A;  4JK7 A;  5E26 A;  3VEY A;  3EYZ A;  1CZB A;  4M41 A;  4DR2 K;  3EO3 A;  3ISN C;  2F4V K;  3HP9 A;  2X6N A;  4GVE A;  3LZI A;  4CHY A;  1BA1 A;  5FPD A;  5C12 A;  1S72 N;  3D2F B;  1WNS A;  4BC5 A;  5FPN A;  1XQS C;  3BF1 A;  4WQ4 A;  3HYF A;  2RN2 A;  1T05 A;  1VSE A;  1VSD A;  4Q5V A;  4CVN E;  4M3X A;  4KI4 A;  3O9R A;  4CZI A;  2PFU A;  1JXE A;  1KRP A;  3OA9 A;  4CJ3 A;  1GLB G;  2E2N A;  4QS9 A;  3ZT2 A;  4JI5 K;  4I6M A;  1RTH A;  1QQC A;  1NK4 A;  1L3S A;  3THW A;  4CZK A;  3WEE A;  1TUY A;  3N4Q A;  1XNQ K;  3QO9 A;  3NH1 A;  4FJG A;  2Q0R A;  2OPP A;  3J81 O;  2QWN A;  3MX5 A;  2BE2 A;  3WNH A;  3L4Q A;  4JKE A;  1Z25 A;  3BP8 A;  4JKA A;  4HCC A;  1WAJ A;  3LDO A;  3MEC A;  3F9M A;  2Z1I A;  4DUY K;  2NNW A;  5AQU A;  4DKW A;  3NVK A;  4C8N A;  3ZT3 A;  1NOZ A;  5CYQ A;  1TGO A;  3ID8 A;  3VQE A;  4MDB A;  3BF3 A;  2Y1I A;  4EFH A;  3CME N;  1X9M A;  3DI6 A;  2KZZ A;  2HHU A;  2YHW A;  3QET A;  2P9I A;  2WOM A;  4H5N A;  3RRH A;  1TL1 A;  3MXJ A;  3VEW A;  5EOY A;  5TKY A;  4RG8 A;  4Y1D A;  2D5R A;  3NF6 A;  4ID5 A;  1KAX A;  3ZT0 A;  3THX A;  1SS6 A;  1S9E A;  4IO9 L;  5AZJ A;  1JLA A;  4DFP A;  2P9S B;  2YHA A;  4AH9 A;  3A8Y A;  3OYE A;  4WFA L;  3FR0 A;  2NRR A;  1RDC A;  1JCF A;  5CE3 A;  3RRG A;  1NKC A;  4WQ5 A;  4BRH A;  4LF7 K;  4FPB A;  3F9K A;  3AVN A;  4FM2 A;  2KQ2 A;  4O5F A;  5HBM A;  3C95 A;  4BRE A;  3P5J A;  4DTX A;  3B8A X;  3E66 A;  3NFA A;  2P9L A;  1J53 A;  2IGI A;  4B3S K;  3OYI A;  4CD1 A;  4YOU A;  1NGA A;  1Y64 A;  3HST B;  3F2K A;  3RR8 A;  2HBL A;  4HCB A;  5HOO A;  4A62 A;  5BRH A;  3BZC A;  5BRE A;  1NNE A;  1DTQ A;  4AM7 A;  1IBM K;  4Y0W A;  1DGK N;  5MLC Q;  3ZSZ A;  4NB4 A;  3K5L A;  4KH6 A;  2KFZ A;  3I0R A;  1WOQ A;  4Z4I A;  5C2D A;  5GAH P;  4IFV A;  4BRA A;  2G8K A;  1RDB A;  3O4Q A;  3QDK A;  2F96 A;  4CJQ A;  2O8C B;  1XNR K;  3KWI A;  3O4N A;  1BU6 O;  1VQK N;  1D4X A;  3O4W A;  1EWR A;  1HNW K;  2F9W A;  5AFU H;  3H3N O;  2RE2 A;  4B3M K;  1KFD A;  4GKJ K;  1NK0 A;  1QVG M;  1YF5 L;  3SPY A;  1V4T A;  2F8T A;  4E1N A;  3K5M A;  2PZS A;  1BQN A;  4MO4 A;  3VMF B;  5JVG L;  2JGU A;  4DTU A;  1TL3 A;  1RDW X;  4BRP A;  3LDP A;  3LAL A;  3P1G A;  5AQN A;  1W2B M;  4CZL A;  5LY3 A;  3HOS A;  2W6L A;  1NGJ A;  2GUP A;  5BN9 A;  1S1V A;  2IVP A;  2IAJ A;  3KKR A;  4A2B A;  2IDO A;  2OAN A;  4N47 A;  3OYJ A;  4NYF A;  2FLO A;  1KTQ A;  1VSK A;  5M1F A;  1RDU A;  1C0U A;  4OKK A;  3MEE A;  4DQQ A;  3BDP A;  3DYA A;  2E1Y A;  2X6S A;  2P9N A;  5CR4 A;  3R8E A;  4IEI A;  4W5T A;  1U47 A;  4F3T A;  3TI0 A;  1Q9Y A;  3D0P A;  2XY6 A;  3WNE A;  3QBW A;  5KPR A;  1N36 K;  2DFF A;  4DHY A;  5J1E A;  3SBG A;  1U2V B;  3GG4 A;  4O5B A;  3SQ2 A;  1NM1 A;  3OTO K;  2P5G A;  3K5N A;  3DLK A;  5JVH L;  3SJJ A;  1XMQ K;  1SV5 A;  4IOX A;  1N6Q A;  3C7N A;  3CC4 N;  2ASM A;  4DTN A;  1BOT O;  1BG3 A;  1UAX A;  2CGK A;  1KD1 O;  5AQK A;  1T6C A;  2YNG A;  3MXI A;  3LWL A;  3C7N B;  2P9P B;  2UYT A;  3AVG A;  5FPM A;  3OYB A;  3SYZ A;  4DB3 A;  4F8R A;  5HLF A;  2VWB A;  1E3M A;  3OJU A;  2IS3 A;  2DPN A;  3AA4 A;  3E9P A;  4MLE A;  2YNF A;  3K0S A;  3EKU A;  1N8R O;  3NGY A;  5GIP A;  4DTO A;  1MDU B;  1Q86 O;  3T1A A;  3CJC A;  3ZX2 A;  3MED A;  4J2E A;  1S5J A;  4XEI A;  3GL1 A;  4CIG A;  4K41 A;  1HR0 K;  4IO8 A;  3H45 C;  4O8K A;  3NDK A;  3DLL L;  2O8D B;  3PX4 A;  4C1N I;  3MEG A;  1QHT A;  4CBX A;  4CGF A;  3M5R A;  2CGJ A;  4BR0 A;  3M3Z A;  5AQH A;  4MFB A;  4CZM A;  5BRD A;  2P51 A;  1LW2 A;  3AVM A;  4CIE A;  3TAG A;  5BRF A;  1HYS A;  4V19 S;  5AQR A;  2Q31 A;  3LDL A;  4FVU A;  3SUQ A;  3TAM A;  1HPZ A;  4CEB A;  3VQA A;  4JI3 K;  3D2E A;  2HBK A;  3KWG A;  4EHT A;  3QLH A;  4RW4 A;  3VF2 A;  1SKR A;  5AQI A;  5KGW A;  4QS8 A;  2R7Y A;  4DLE A;  2HHH K;  4DR5 K;  2XY7 A;  1X9J A;  2QI2 A;  4F2S A;  4M42 A;  2QWR A;  4CJ7 A;  4OLB A;  3HM8 A;  5AQL A;  3TAN A;  4CF9 A;  4DV7 K;  3DXK B;  3R6M A;  4CK3 A;  1OH6 A;  4OX9 K;  1YJN N;  4GKK K;  3CF5 L;  4ZHR A;  3RSE B;  1NWK A;  4AM6 A;  4CGJ A;  1BL3 A;  4BWM A;  3NMU A;  3OYM A;  4CF0 A;  3VQ8 A;  1EQY A;  3ID6 A;  4DFM A;  2EWS A;  4KHP K;  3LPU A;  3LPT A;  4F9O A;  3A5L C;  4CW7 B;  2JWK A;  2HVI A;  4KB0 A;  1CLQ A;  1Q8I A;  1E4F T;  3IFR A;  4G9Z A;  4GV9 A;  2QKB A;  1C1A A;  3WNF A;  3O08 A;  3KD5 E;  3VEZ A;  1RT3 A;  2NZT A;  4BRK A;  3FE1 A;  1P8Z A;  4H5T A;  1BDG A;  3CXC M;  4H8K A;  3AO4 A;  3ZEU A;  5HRO A;  1Q18 A;  5SZT A;  3OYG A;  1W7A A;  4IEE A;  4X62 K;  1NK6 A;  5DK5 A;  3FLC O;  4BG9 A;  3ZT4 A;  2ZM6 K;  3QEV A;  1WB9 A;  3LM9 A;  1SL2 A;  1NKE A;  5M1O A;  1Q82 O;  3HPO A;  4N41 A;  2ITM A;  2A5X A;  3TTD A;  4WQ4 C;  3CQY A;  4AQY K;  1HYZ A;  4CGH A;  3TTC A;  4YDU A;  5CZ2 A;  4E7K A;  1S1U A;  1U04 A;  5AZI A;  3VQ5 A;  3RMA A;  5CHI A;  4RW7 A;  3MX2 A;  3AA3 A;  1GLA G;  4CJ4 A;  2HHQ A;  4DS5 A;  3TAE A;  3V9U A;  1T8E A;  1ITG A;  3TPQ A;  4JI0 K;  3L6Q A;  3K9J A;  2W42 A;  4FJL A;  4N5S A;  2UXD K;  5K14 A;  2HHS A;  3KK1 A;  1EO1 A;  3C65 A;  2HNY A;  5F0X A;  3GDQ A;  5H1S Q;  4CJU A;  3CJ1 A;  4NO7 A;  1DKG D;  2UUC K;  4XH1 A;  4OLA A;  1OVY A;  1MWK A;  2D1K A;  1T6D A;  4H4O A;  3NF8 A;  4JKD A;  3A5M C;  3M8R A;  4PKH A;  1NK5 A;  3U8X A;  2NRX A;  4A59 A;  5F1X A;  3H3O B;  1GLD G;  4LFB K;  1O1W A;  2W41 A;  5LJV A;  1HNI A;  4FWP A;  3U4L A;  2G8U A;  2VCP A;  5HP1 A;  2GEM A;  2GWK A;  1RFQ A;  3KVG A;  2HMI A;  4FL9 A;  3HO1 A;  3VA0 A;  2G8H A;  4KRF A;  1WSJ A;  4KBO A;  4Q0B A;  4BGB A;  5AQF A;  2E2O A;  4PQU A;  1H1V A;  1VQN N;  4DFJ A;  4C8L A;  2JLE A;  2NRT A;  3OYN A;  4B9S A;  4FW1 A;  3CQ8 A;  2EHG A;  1HMV A;  2CGL A;  3BZK A;  4JI1 K;  4B9M A;  5GAG P;  1NG9 A;  1NGG A;  4E7I A;  4KHN A;  4U67 L;  4B8A B;  3CCV N;  2I7N A;  4NLC A;  3ULD A;  4DQ8 A;  3RMD A;  3NE6 A;  1YVU A;  4UQG A;  1REV A;  5KGX A;  3T1Y K;  1GLC G;  1RBR A;  2HF4 A;  4NLB A;  2RHK A;  4DSE A;  4CZE A;  1J5O A;  3D45 A;  3D2F A;  1Q9X A;  4CJF A;  3QFU A;  3IMX A;  3TWH A;  4DF4 A;  5GIO A;  1YAG A;  3DXK A;  1BO5 O;  1LWE A;  3H1Q A;  2O8F A;  4YOR A;  1NGF A;  3D7E O;  2QW9 A;  5JLH A;  3LDQ A;  1SKW A;  4BG8 A;  5KTQ A;  4AHV A;  2BAN A;  4DTJ A;  4C1N K;  4A2A A;  4CK1 A;  1CXQ A;  4Z4H A;  3FZH A;  5E84 A;  4B9Q A;  3K2P A;  3NHG A;  3KD1 E;  3W3D A;  3O80 A;  2KZM A;  4IWV A;  1OKJ A;  3SZ2 A;  3AO5 A;  3NF9 A;  3O1W A;  2QWM A;  1HQE A;  3E9L A;  4YOW A;  3IG1 A;  3CCM N;  1L5U A;  4KHS A;  1J6Z A;  4DU4 A;  1J9A A;  1VQ4 N;  4YDU C;  2Y1J A;  4E7H A;  2YV0 X;  4M3W A;  4E3S A;  4CJT A;  3TSP A;  4JRQ A;  1K8K B;  1HKB A;  4I2Q A;  1ATS A;  1NGE A;  4OPK A;  1ATN A;  4BAC A;  3O3F A;  4B9V A;  2IC3 A;  4AHS A;  2A40 A;  3KLG A;  3QFP A;  4FSV A;  3HK2 A;  4CD3 A;  2VWK A;  5JIC A;  2G8W A;  1KVB A;  3VQB A;  3TU5 A;  4J2D A;  2OA8 A;  3KHY A;  4XIU A;  3IKM A;  1XHZ A;  4M7Y A;  4Z4C A;  1ATR A;  1RBU A;  3M8S A;  2B6A A;  4NCA A;  3G0Z A;  1ZYQ A;  2DFH A;  4FOI A;  3I33 A;  1JLB A;  3P38 A;  1QSY A;  2E1Z A;  4IG3 A;  2AA4 A;  1VQ8 N;  3SLC A;  3WQU A;  1NBW A;  3U9D A;  1BHL A;  4KHW A;  3C6U A;  3E1Y A;  2XHB A;  1I94 K;  3CCE N;  2G8F A;  3DLE A;  4E0D A;  4E89 A;  2AJQ A;  4K8X A;  1IO2 A;  4W5Q A;  2I7P A;  3I55 N;  2YKM A;  4IZ9 A;  2PY5 A;  4LFA K;  4FWN A;  4CEA A;  5LMU K;  3HRG A;  4FK2 A;  1VRT A;  4PUO A;  3OBW A;  4UY8 O;  4DV2 K;  2G8I A;  3NCI A;  1ZBF A;  1IBK K;  1KC8 O;  3OJS A;  4FLU A;  1TKX A;  4CZG A;  3VGM A;  4FOE A;  1RCH A;  1VAZ A;  3MN7 A;  1TK0 A;  3O8M A;  4JN4 A;  3VQ4 A;  1DT9 A;  3OYA A;  2Z1J A;  2O8B B;  2A1R A;  5I3U A;  5ELZ A;  3QES A;  1QZ6 A;  4JI4 K;  5SWM A;  3PV8 A;  3UKR B;  1GLL O;  2ZJQ L;  2I5J A;  4IOC L;  3O9U A;  4DU1 A;  4O0J A;  1QHA A;  4EIA A;  1IKX A;  1ESV A;  1NKB A;  3ITH A;  1NGB A;  3PY8 A;  1K6Y A;  3HL8 A;  1BUP A;  4IOA L;  1NLV A;  1QZ5 A;  2FSK A;  5KQD A;  1OH8 A;  4M3U A;  1D5A A;  2UUB K;  4BRN A;  1KSP A;  3AAR A;  1FXX A;  1NK9 A;  4LH5 A; 
#chains in the Genus database with same CATH homology
 4FJX A;  4FLT A;  1HQU A;  3NH2 A;  3KIO A;  4CEC A;  4CGD A;  2VWJ A;  2YNG A;  3BGR A;  2B4J A;  3THV A;  3MXI A;  2XRI A;  3LP0 A;  3LWL A;  4CHQ A;  2E4L A;  1RTI A;  4FJH A;  3AVG A;  4YNQ A;  4DTM A;  2ZD1 A;  3VQ6 A;  3OYB A;  4FJN A;  3SYZ A;  2VG6 A;  5HLF A;  4F8R A;  1FKP A;  4CJP A;  4YFU A;  3TAQ A;  3ZT1 A;  2QKK A;  1QSL A;  4ID1 A;  4I9Q A;  3OJU A;  2IS3 A;  3AA4 A;  4Z0U A;  3QNO A;  1C1B A;  1J54 A;  1RBS A;  2YNF A;  4MQ3 A;  1RNH A;  3NGY A;  2HND A;  1TKT A;  4DTO A;  3T1A A;  3MED A;  1LWF A;  4DSJ A;  1S5J A;  4J2E A;  4IKF A;  3H08 A;  4CIG A;  4Z4E A;  4IDK A;  3V4I A;  3TAP A;  3NDK A;  1CXU A;  5HRS A;  4FJ5 A;  4CEE A;  3PX4 A;  3OYF A;  4CHO A;  4DTP A;  4M3Z A;  4KTQ A;  3MEG A;  4LY7 A;  4PY5 A;  4HVJ A;  1QHT A;  4CGF A;  4DWI A;  3SQ4 A;  4FJI A;  4CCH A;  4CFB A;  3OYC A;  3NGI A;  3SCX A;  2HHX A;  2FBV A;  4O0I A;  4DSK A;  1T03 A;  4MFB A;  3ZSW A;  4DSF A;  4FXD A;  3KLI A;  2P51 A;  1LW2 A;  2LSN A;  3AVM A;  3I0S A;  2OPQ A;  4CK2 A;  4CIE A;  3TAG A;  3U3Y A;  2G8V A;  1HYS A;  4CHN A;  4E19 A;  1JL2 A;  1BIU A;  1EET A;  3HP6 A;  4AIL C;  5FRN A;  2HHW A;  5HRP A;  4OJR A;  1B92 A;  3SUQ A;  2OYQ A;  3TAM A;  3F73 A;  1KFS A;  3IS9 A;  1HPZ A;  2ETJ A;  4CEB A;  1GOA A;  4KV8 A;  4FJ8 A;  3G10 A;  4J2A A;  1I39 A;  1TAQ A;  1WSH A;  1RT6 A;  4RW8 A;  3LP3 A;  3VQA A;  1T7P A;  2HHV A;  1RT2 A;  2OZM A;  1NOY A;  4CF2 A;  1BGX T;  3QLH A;  3PX6 A;  4RW4 A;  1SKR A;  5KGW A;  4CES A;  2R7Y A;  1NJX A;  4HTU A;  5CZ1 A;  4DLE A;  4DF8 A;  2DTU A;  3HVR A;  5FRM A;  4QOZ B;  4CF8 A;  2XY7 A;  1TV6 A;  4IG0 A;  4KTW A;  4ZTF A;  1C1C A;  3V9Z A;  2GUI A;  3SV3 A;  4Z4F A;  1QE1 A;  4CJK A;  4F2S A;  4M42 A;  3EZ5 A;  4NCB A;  2D0A A;  4OLB A;  1ZBH A;  1S6Q A;  3TAN A;  1TKD A;  4HHT A;  4CIF A;  4AHT A;  2QK9 A;  4CF9 A;  1HYV A;  4KFB A;  4CK3 A;  4HUF A;  4KTZ A;  1WLJ A;  3CFP A;  4ZHR A;  4FW2 A;  3CM6 A;  1BL3 A;  3CFO A;  4CGJ A;  4M45 A;  4BWM A;  3KK2 A;  3OYM A;  4EZ6 A;  4N76 A;  3LAM A;  4HUE A;  5HRN A;  4OKJ A;  4CF0 A;  4ELT A;  3VQ8 A;  1L3T A;  3IRX A;  3U6F A;  3VQP A;  4CJW A;  4CJR A;  1A5X A;  1C6V A;  4DFM A;  3DOL A;  1BIZ A;  3HXM A;  3DLG A;  4DQR A;  3HVT A;  1TK5 A;  4CHP A;  1KLN A;  3L2R A;  3KTQ A;  4OGE A;  1D8Y A;  3LPU A;  3LPT A;  4BWJ A;  1BIS A;  1NK7 A;  2HVI A;  4LD0 A;  4FJ9 A;  4KB0 A;  4B9L A;  3V9X A;  1CLQ A;  1UA1 A;  4J2B A;  1Q8I A;  2HW3 A;  3NBP A;  3IAY A;  2QKB A;  1LW0 A;  3U3G A;  4BE0 A;  4ICL A;  1C1A A;  1QS4 A;  3WNF A;  1D9F A;  4GW6 A;  3OYD A;  5E41 A;  3I8D A;  1RT3 A;  1TVR A;  3AVJ A;  3ZSY A;  3KD5 E;  3UIQ A;  4W5O A;  3KLE A;  1JKH A;  4BE2 A;  4FVM A;  3HJF A;  3OVN A;  2PYL A;  3LDS A;  3P83 D;  3QEX A;  1XWL A;  1WSE A;  3AVC A;  4ZTJ A;  3O3H A;  4KO0 A;  4H8K A;  4EP5 A;  4RW6 A;  3LP2 A;  5HRR A;  4DMN A;  3AO4 A;  3QEI A;  4F4K A;  3DRR A;  1IKV A;  4JS4 A;  1A5V A;  5HRO A;  5SZT A;  1C0M A;  5T7B A;  3OYG A;  3VQC A;  3OS1 A;  4FLZ A;  1NK6 A;  2P5O A;  1WN7 A;  5DK5 A;  4M3R A;  3KKS A;  1W0H A;  2RPI A;  3HPH A;  2FBX A;  1TAU A;  3ZT4 A;  3QEV A;  4OVL A;  1NJZ A;  1F21 A;  1SL2 A;  1NKE A;  1RT7 A;  2X78 A;  3V6D A;  4O4G A;  4QAG A;  3HPO A;  3AVA A;  4I2P A;  4N41 A;  1YTU A;  3ALY A;  3MAQ A;  3NGZ A;  3ASM A;  3C6T A;  4M3Y A;  3DM2 A;  1HYZ A;  4CGH A;  4F3O A;  3AO3 A;  1RDD A;  2XY8 A;  5J2M A;  4FJM A;  4M3T A;  5CZ2 A;  4E7K A;  4R5P A;  1ZBU A;  1S1U A;  3WNG A;  3JYT A;  1U04 A;  3RMB A;  4LSN A;  3DMJ A;  5C24 A;  1VSI A;  3E01 A;  3AVB A;  3CM5 A;  3VQ5 A;  3RMA A;  4FJ7 A;  4IFY A;  3OYH A;  3CFR A;  4CE9 A;  4RW7 A;  3SUP A;  4G1Q A;  3C94 A;  3SQ0 A;  4B9T A;  3MXM A;  1FK9 A;  3AA3 A;  1SL0 A;  4AHC A;  4WE1 A;  4FZY A;  3EY1 A;  1IKW A;  4FLX A;  3SUN A;  4CJ4 A;  3QEP A;  1JXB A;  3V1R A;  4DSL A;  2BGG A;  1Z26 A;  2HHQ A;  5DMR A;  4DS4 A;  4DS5 A;  3V9U A;  3TAE A;  1T8E A;  4I9L A;  1C0T A;  1ITG A;  3RRH A;  4CGI A;  4DTS A;  4FM0 A;  1BCM A;  4OGC A;  4L8R B;  2FBT A;  2KTQ A;  5JS2 A;  4CER A;  2A1S A;  3LAK A;  3ZSO A;  2W42 A;  1KCF A;  1SUQ A;  3M8Q A;  1YT3 A;  4JS5 A;  3L2Q A;  1JLQ A;  4JRP A;  3ZCM A;  1X9S A;  1JLC A;  1NJW A;  4CFA A;  4FK0 A;  4QCL A;  4FJL A;  4N5S A;  5K14 A;  2HHS A;  2EX3 A;  1ASV A;  3KK1 A;  2NUB A;  2HNY A;  2VG5 A;  2E6M A;  4CJU A;  3EYZ A;  1CZB A;  1S6P A;  3LP1 A;  4M41 A;  2HVH A;  2VG7 A;  4OLA A;  2P1J A;  3ISN C;  3AVI A;  3HP9 A;  1KVC A;  4H4O A;  3NF8 A;  2X6N A;  3RWU A;  3M8R A;  4HUG A;  3LZI A;  1N5Y A;  5C42 A;  4CHY A;  3V9S A;  2KW4 A;  1NK5 A;  1X9W A;  1HRH A;  1WNS A;  3AV9 A;  4FCY A;  3QNN A;  3L2V A;  4FYD A;  1X1P A;  4NYN A;  1ASW A;  1O1W A;  1S9G A;  3NF7 A;  3V9W A;  3HYF A;  2RN2 A;  1T05 A;  4DSI A;  1HNI A;  1UA0 A;  5J2N A;  1VSE A;  1VSD A;  4Q5V A;  4CED A;  1UWB A;  2G8U A;  4M3X A;  4KPY A;  4DFK A;  5HP1 A;  4KI4 A;  5FDL A;  1HNV A;  2HMI A;  4CJS A;  1JXE A;  4CFD A;  1VSL A;  3V1Q A;  3VA0 A;  1JL1 A;  2G8H A;  4CJ3 A;  2ZQB A;  1L3U A;  1KRP A;  3HO1 A;  4KRF A;  3ZT2 A;  1WSJ A;  5J2P A;  3PO5 A;  4Q0B A;  4DG1 A;  1RTH A;  1QQC A;  1NK4 A;  3CYM A;  1L3S A;  3AVL A;  4PQU A;  2BDP A;  3LWM A;  3S3O A;  5FRO A;  4FJJ A;  5KRS A;  4K8Z A;  3LAN A;  3V1O A;  4DFJ A;  1U45 A;  4C8L A;  2JLE A;  3OYN A;  4B9S A;  1B9D A;  3QO9 A;  4FW1 A;  2YHB A;  3NH1 A;  3CQ8 A;  4FJG A;  2EHG A;  2ITG A;  2OPP A;  2BE2 A;  2OZS A;  3OS2 A;  1TK8 A;  1HMV A;  5KI6 A;  3WNH A;  3OYL A;  4B9M A;  1RTJ A;  1BCO A;  1Z25 A;  1RDA A;  1BI4 A;  1WAF A;  3HPG A;  4E7I A;  4KHN A;  4HCC A;  1WAJ A;  1HJR A;  4B8A B;  3S3M A;  1IH7 A;  3QIN A;  2AJQ A;  3ZSV A;  3PX0 A;  5JS1 A;  3T19 A;  3QEW A;  4Z4G A;  3MEC A;  3ULD A;  3K57 A;  3T3F A;  3RMD A;  3NE6 A;  4ELU A;  2Z1I A;  1YVU A;  4UQG A;  5I42 A;  1REV A;  4H4M A;  5KGX A;  4KHY A;  1GOC A;  1RBR A;  1VSM A;  3TAB A;  4ELV A;  4C8N A;  2RKI A;  4B9U A;  1ZBL A;  3ZT3 A;  4DSE A;  1J5O A;  3D45 A;  1NOZ A;  1Q9X A;  1WSI A;  1TGO A;  5CYQ A;  4CJF A;  2RF2 A;  3QIO A;  4FM1 A;  2DFE A;  3TWH A;  2YNI A;  4DF4 A;  5CY4 A;  3VQE A;  1IG9 A;  3A2F A;  2IOC A;  3AO1 A;  3HT3 A;  4W5N A;  2Y1I A;  1RT1 A;  1X9M A;  3DI6 A;  2KZZ A;  2HHU A;  4FJK A;  3QET A;  2WOM A;  3VQ9 A;  1TL1 A;  1LWE A;  3MXJ A;  3ZSR A;  4E1M A;  4RG8 A;  2OPR A;  2D5R A;  1JLF A;  4Y1D A;  3NF6 A;  4ID5 A;  3ZT0 A;  4GVM A;  4B08 A;  4EZ9 A;  4DQI A;  3DOK A;  1S9E A;  1SKW A;  2Q3S A;  4BDY A;  1JLA A;  5KTQ A;  4DFP A;  3TAR A;  4AHV A;  1WSF A;  2YHA A;  3SUO A;  3OYK A;  4JLH A;  4AH9 A;  4CEZ A;  2BAN A;  3OYE A;  3TAF A;  4DTJ A;  2D0B A;  1CZ9 A;  4CJE A;  3NAE A;  2ATQ A;  1RDC A;  1CXQ A;  1ASU A;  4CK1 A;  4Z4H A;  1NK8 A;  3SV4 A;  3K2P A;  3NHG A;  3KD1 E;  3SQ1 A;  2YKN A;  3RRG A;  4E7L A;  1NKC A;  3K58 A;  2KZM A;  5CYM A;  2XY5 A;  1UOC A;  3VQD A;  3V81 A;  4LSL A;  3L8B A;  1SL1 A;  1I3A A;  1U4B A;  3F9K A;  3AVN A;  1VK0 A;  2O4G A;  1BQM A;  2KQ2 A;  3LZJ A;  3FFI A;  4FM2 A;  4NCG A;  3SZ2 A;  1QSS A;  4CGG A;  3AO5 A;  1WSG A;  1VRU A;  1VSJ A;  3NF9 A;  4CJL A;  5HBM A;  4EP4 A;  1HQE A;  1IKY A;  1LAW A;  2GV9 A;  3AVK A;  3C95 A;  3L3U A;  3P5J A;  4TSX A;  3K59 A;  4DTX A;  3NFA A;  4OKE A;  3ZSQ A;  3IG1 A;  4DLG A;  4DQP A;  4CFC A;  4FZZ A;  1L5U A;  4KHS A;  1J53 A;  4DU4 A;  4AHU A;  1RT5 A;  2IGI A;  5J2Q A;  3OYI A;  4FZX C;  1J9A A;  1D9D A;  2Y1J A;  4E7H A;  3HST B;  1R0A A;  4PWD A;  2YV0 X;  2Z1H A;  4F2R A;  5EU7 A;  4E3S A;  3RR8 A;  1YTA A;  4M3W A;  4CJT A;  4JRQ A;  1VSH A;  4I2Q A;  2X74 A;  3CG7 A;  1DLO A;  1NK9 A;  4OPK A;  4HCB A;  4BAC A;  3O3F A;  4B9V A;  4BE1 A;  2OPS A;  2IC3 A;  3S9H A;  4AHS A;  4CF1 A;  3KLG A;  4CHZ A;  3HK2 A;  1DTQ A;  2VWK A;  1RBV A;  3DRS A;  2G8W A;  1G15 A;  1KVB A;  4GMJ B;  3VQB A;  4FLV A;  2KFZ A;  3ZSZ A;  3K5L A;  4LH4 A;  4J2D A;  2OA8 A;  3B6O A;  3I0R A;  1EKE A;  4Z4I A;  2KFN A;  4XIU A;  1XHZ A;  3K5O A;  4Z4C A;  4IFV A;  2G8K A;  3VN5 A;  1RBU A;  2HNZ A;  2B6A A;  4KKO A;  1RDB A;  3O4Q A;  3M8S A;  4O55 A;  4IBN A;  2PYJ A;  3G0Z A;  3B6P A;  4NCA A;  1ZYQ A;  2HHT A;  3L2W A;  2DFH A;  1EP4 A;  1JLB A;  1QSY A;  3VQQ A;  4IG3 A;  3AO2 A;  2F96 A;  4CJQ A;  5C25 A;  1LAV A;  3O4N A;  1BHL A;  2E6L A;  3KJV A;  4FLY A;  3C6U A;  4KHW A;  2XHB A;  3SI6 A;  1W9H A;  3KLH A;  3O3G A;  3SPZ A;  1GOB A;  3PUF A;  2G8F A;  3DLE A;  1RT4 A;  1KFD A;  3RTV A;  4KI6 A;  4E0D A;  4E89 A;  3DRP A;  4KRE A;  1XHX A;  3OS0 A;  1NK0 A;  3DLR A;  4FK4 A;  3L3V A;  3HM9 A;  3ZSX A;  3SPY A;  4K8X A;  1IO2 A;  4W5Q A;  1S1W A;  1U49 A;  5D3G A;  4CEF A;  4E1N A;  2F8T A;  3K5M A;  2PZS A;  4KAZ A;  1BQN A;  4W5R A;  3AVH A;  1JLE A;  2JGU A;  4DTU A;  4PA1 A;  1TL3 A;  2WON A;  4BDP A;  2Z1G A;  2FBY A;  2YKM A;  3KK3 A;  4B9N A;  3LAL A;  1EXQ A;  3P1G A;  2ZE2 A;  4B8C A;  5KRT A;  3DLB A;  1RTD A;  3AVF A;  2PY5 A;  3AA2 A;  1B9F A;  4DQS A;  3QIP A;  4CEA A;  3PO4 A;  2DY4 A;  4FK2 A;  4AHR A;  1VRT A;  4PUO A;  1S1V A;  4N56 A;  2XO7 A;  3TR8 A;  4E7J A;  1U48 A;  2G8I A;  2GBZ A;  1TKZ A;  3AA5 X;  1ZBF A;  2IAJ A;  2QXF A;  4C8M A;  3KKR A;  3VQ7 A;  3NCI A;  1LWC A;  1DTT A;  1S1X A;  2IDO A;  3OJS A;  4N47 A;  4FLU A;  1TKX A;  1SKS A;  3OYJ A;  4NYF A;  1RCH A;  3OY9 A;  1KTQ A;  1VSK A;  3L2U A;  3JSM A;  4OKK A;  1C0U A;  1TK0 A;  4OPJ A;  3MEE A;  4DQQ A;  4RW9 A;  3VQ4 A;  3DYA A;  4FLW A;  1LV5 A;  3BDP A;  2X6S A;  3NH0 A;  4O44 A;  3OYA A;  4CEO A;  2Z1J A;  2A1R A;  4CEQ A;  4W5T A;  4CJ5 A;  4KHU A;  5I3U A;  1U47 A;  1EX4 A;  1S1T A;  4F3T A;  1ZBI A;  3TI0 A;  1Q9Y A;  3D0P A;  2XY6 A;  1KLM A;  2D0C A;  3QES A;  3WNE A;  3DLH A;  1KVA A;  5SWM A;  1XI1 A;  4C8O A;  3PV8 A;  1QTM A;  4KHQ A;  2DFF A;  5J1E A;  2I5J A;  1RBT A;  4C8K A;  1JLG A;  3S3N A;  4DU1 A;  4O0J A;  2F8S A;  1BI4 B;  1RIL A;  3M8P A;  3QER A;  3SNN A;  4KB1 A;  4I7F A;  1IKX A;  4O5B A;  3SQ2 A;  1L3V A;  1NKB A;  1XC9 A;  2P5G A;  3ITH A;  3K5N A;  1NJY A;  4BDZ A;  3RMC A;  3DLK A;  3PY8 A;  4Y1C A;  3SJJ A;  1K6Y A;  1SV5 A;  1VSF A;  3HL8 A;  1N6Q A;  1A5W A;  1Y97 A;  1MU2 A;  4DU3 A;  3RR7 A;  4M3U A;  2HB5 A;  1D5A A;  4CJV A;  4B3O A;  1FKO A;  2B5J A;  3VA3 A;  4DTN A;  1KSP A;  1UAX A;  3KLF A;  4DTR A;  1FXX A;  2FC0 A;  2YNH A;  4LH5 A;  2O4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...