2CH5A

Crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
347
structure length
344
Chain Sequence
PQFMAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGRAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Human N-Acetylglucosamine Kinase in Two Complexes with N-Acetylglucosamine and with Adp/Glucose: Insights Into Substrate Specificity and Regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NAGK PROTEIN
total genus 113
structure length 344
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.59: N-acetylglucosamine kinase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch5A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch5A02
2FSKA 2AP1A 4FWNA 3EKUA 2P9PA 2QWRA 3O1WA 2A5XA 1HUXA 4B1WB 3IFRA 4BRLA 4BRNA 1T44A 3FZLA 4BRIA 2QWPA 4I6MB 5AQVA 2P9IA 4CZJA 2I7PA 1R59O 4BGBA 2F9WA 2GEMA 1HKCA 2OANA 5AQJA 1RFQA 5ADXH 4FOEA 3FZMA 2CH5A 2NLXA 3MDQA 5KPRA 4KBOA 4BR4A 3WXKA 3FZFA 5AQIA 5LJVA 3H46O 4PKHA 3ZX0A 5AQZA 3I8BA 4BRHA 3C7NB 4BRGA 3U8XA 1DEJA 1TYQB 2FXUA 3ENOA 3ZX3A 4C23A 4BG9A 5KPZA 2E2PA 4IJNA 3HBTA 3VGMA 3R9PA 1TUYA 3IUCA 1BA0A 3LL3A 3IMXA 4IWVA 4YDUA 3O1BA 3JXUA 3QBXA 3DXKA 4XH1A 5FPMA 3EZWA 4JHDA 1LCUA 5JMVA 2ASPA 2QWMA 2KHOA 4GY2B 4O8KA 3FR0A 3H1QA 3VENA 3D7EO 3WXLA 1QZ5A 1BUPA 4CD3A 3QB0A 3H6EA 5BRHA 3CERA 3JS6A 3WEEB 3CJBA 4H5RA 4IZ9A 3B8AX 5BRFA 5LY3A 4BQLA 5AQMA 5BRDA 1SAZA 4K25A 2QXLA 4BR2A 2P9NB 5LJWA 5AQSA 3HTVA 4CJ7A 2V7ZA 3D2FA 1ATSA 1LOTB 4E1JA 4FWSA 1Y64A 5AQNA 2E20A 3DWLA 1MWMA 4LC9B 2V51B 2VCPA 1BWFO 1GLDG 3A8YA 3U9DA 5BPNA 1XQSC 3CQYA 1GLFO 2Q36A 4A61A 4DHYA 4FWRA 2E1YA 3O08A 1GLLO 3ZEUB 1KXPA 2EWSA 1Q18A 3FLCO 2E88A 4HTLA 3RSEB 2ZGYA 1HLUA 3IDHA 3QMLA 2W40A 1YUWA 2P9SB 3H3NO 3FZHA 3VEYA 4EAHD 4BG8A 2IVPA 4XH4A 2YHXA 3MN5A 2YCHA 5AQQA 4K42A 3ATUA 2QM1A 2YHWA 1E4GT 1GLCG 4FWQA 3MCPA 1GLEG 1GLBG 5AFUA 1D4XA 4EHTA 5AQTA 4H5WA 1NGEA 3VGLA 5AZIA 4XEIA 5KPTA 1MA9B 2GWKA 2HMPA 1BOTO 1C0GA 1YVNA 1X3NA 4BREA 4F9OA 4BRFA 1GLAG 1K8KB 3CJ7A 4Z94A 3DAWA 3ZX2A 5FPDA 4JN4A 5EX5A 3VEZA 3SJHA 1J6ZA 2CH6A 1H1VA 3CI5A 4WQ5A 1ATNA 2ITMA 3DXMA 3MN7A 1NGBA 5AFUH 3WXJA 2GUPA 1NGDA 3WXIA 2QW9A 3VEXA 3ZEUA 4L3QA 4M7XA 3EO3A 4RTFD 1NGAA 4H0YB 4CBWA 2H3GX 5TKYA 2GTDA 4CBXA 1E4FT 3L4IA 4PKIA 4XH5A 3O80A 5E26A 3WQUA 4EIAA 4IJAA 4BGAA 3ZETB 3CHWA 2PAVA 2E2OA 2FSNA 5AQYA 1BDGA 2FSJA 3D2EB 2BUPA 4Y0WA 1OKJA 1RGIA 1Z6RA 5AZIB 3HM8A 3MN6A 4BRCA 1IG8A 4H0XB 2HF4A 1MWKA 2FLOA 4BC4A 2E2QA 3R8EA 3LDOA 2D0OA 2P9LB 3QICA 4BRMA 3AAQA 3L0QA 4MO5A 2E1ZA 5AQLA 4HWIA 3MMVA 4BR5A 5BR9A 3UB5A 3CJAA 5KQDA 1U2VA 5B8HA 3FFKB 5JICA 4ISGA 3VF2A 3A5MC 2NZTA 3CETA 4H0OA 4FO0A 5BN9A 4CZLA 4JNEA 1NGFA 4DQ8A 3GDQA 5E84A 1X3MA 1HJOA 2CGKA 4QS9A 4BC3A 5ELZA 2ASOA 1SQKA 5AZJA 2A3ZA 2UYTA 4BRAA 3O5BA 1IJJA 4BRKA 2PBDA 4A2AA 3BF3A 2CGLA 3A5NC 3BEXA 3HZ6A 1QHAA 3GG4A 1GLJO 3QFUA 4H5VA 2GELA 4FWLA 1ZC6A 3CQXA 4EFHA 2P9UB 5EXWA 3VESA 4A62A 2P9IB 4FPBA 4I6MA 1NWKA 3BP8A 1ZXOA 4WQ4A 5F2RA 4K41A 3H3OB 3TPQA 3W3DA 4FWPA 4GNIA 4CZFA 2D4WA 3F9MA 2D0PA 4CZKA 1HKGA 1BO5O 1NGJA 2VWBA 5ADXA 1U2VB 2YHYA 3ULEA 1KAZA 2HOEA 3SMSA 1YAGA 4BVPA 1G99A 5JLHA 3LDNA 4JD2A 2Q0UA 2YI1A 5AQKA 2E2NA 1NBWA 3LM9A 4PL7A 1NGGA 1BU6O 3A0IX 2Q0RA 1X9JA 3GL1A 3MK6A 3VEVA 2NRHA 1C0FA 5AQUA 5AZJB 4RCHA 4CZEA 5F0XA 3ULEB 4PL8A 3C0BA 4QS7A 5FPNA 5AR0A 1U6ZA 1Z05A 3AARA 3LDPA 2QWOA 3VGKA 4FSVA 4B1XB 4H0VB 4MLEA 1P8ZA 1JCEA 1QZ6A 2F9TA 1QQMA 3DXMB 3DJCA 4FWOA 2AA4A 3MN9A 2D1KA 4AM7A 4CBUA 3M1FA 2P9UA 1WUAA 2A40A 1NGIA 5AQRA 4A2BA 4BR7A 4FWKA 4O5FA 2I7NA 3KHYA 3OHRA 2HF3A 1NMDA 3U9ZA 2A42A 4PKGA 1XC3A 3UKUB 3KVGA 1DGKN 4AM6A 4CI6A 4FPAA 3SK3A 3ATVA 3SMPA 2Q1NA 3D2EA 4CZGA 1QQOA 3O4WA 3W0LA 4ISEA 1SZ2A 4ISFA 5CE3A 2W41A 5AQFA 5BPLA 2FF3B 4J8FA 1HPMA 2Q2RA 1V4TA 3G25A 3QBWA 5BN8A 1S3XA 4H5TA 4CZHA 4JAXA 2J4RA 2P9SA 4M7YA 4M63C 4JHDB 4QS8A 4B9QA 3VEWA 1NLVA 1TUUA 5AQPA 4FWMA 1K8KA 3RSEA 2V7YA 1JCFA 5AQHA 1NGCA 4K43A 4BRPA 1HX1A 1MDUB 1WOQA 3GBTA 2A41A 3S41A 3VPZA 4EHUA 3UE5A 4DB3A 1NGHA 1V4SA 2A6AA 2P9LA 3TU5A 1BG3A 1BA1A 3HI0A 3VEOA 3M6GA 3D2FB 3VETA 2IVNA 3R6MA 4NO7A 4BC2A 1KAXA 1YXQA 4RWTA 3HSCA 2P9KB 3BF1A 3LDLA 2QWNA 1EQYA 4BC5A 5F1XA 2IIRA 1CZAN 2DPNA 3LM2A 5EVZA 3U4LA 3A5OC 4FL9A 4CZMA 4BR0A 4NB4A 1KAYA 4BR9A 5AQOA 4DCHA 3P4IA 1XUPO 4WQ4C 3I33A 5EOYA 3A5LC 3GOIA 2ASMA 5I9EB 4H5NA 4BVOA 3CJ1A 3QDKA 3DXKB 3ENHA 2ZF5O 3AY9A 3VF6A 4B1ZA 3UKRB 2WUSA 4BRQA 1JCGA 3GE1A 3J8AA 5JLFA 1ZBSA 3FGUA 3L6QA 4MO4A 2E8AA 1QQNA 1ATRA 4CZIA 4WQ5C 3AAPA 2QWQA 3CJ9A 4BROA 1NM1A 3WUHA 3SLCA 2ZGZA 2P9NA 3H1VX 4IXCA 2QWLA 3ZETA 3ID8A 5BREA 3VF4A 4B1YB 4H0TB 3WQTA 1HKBA 3WEEA 1T6CA 4YDUC 1ESVA 4FOIA 3O6WA 4CD1A 4MLHA 2YJEA 3EN9A 5AQWA 5AQGA 4BRDA 2P9PB 3EL2A 3BUZB 4H03B 3WT0A 5KQ8A 3H45C 2VYPA 3VERA 4WYBA 3C7NA 2P9KA 5FPEA 2CGJA 3FE1A 1S22A 3LDQA 2FF6A 4H0PA 1TYQA 2Q31A 3VOVA 3CIPA 3CJCA 4B1UB 5AQXA 3FZKA 2IVOA 3M3ZA 2V52B 4BQZA 3UKUA 5BPMA 2GWJA 4B1VA 1DKGD 2BTFA 4IO8A 3O8MA 2YJFA 2Q97A 2ZWHA 1RDWX 4JD2B 3KZBA 1T6DA 3EKSA 3QFPA 3UKRA 5EY4A
chains in the Genus database with same CATH superfamily
3JAMO 4B8AB 3CC2N 4FWNA 2OZMA 2QWRA 2KLAA 1HJRA 4B1WB 3FZLA 4I6MB 1TK5A 4CZJA 2I7PA 2OANA 1TVRA 5ADXH 1VSKA 2E6MA 2ZJQL 2DFHA 4BR4A 3FZFA 3CCMN 2HNDA 2QTDA 4JKGB 3AVMA 3ZX3A 1DEJA 1TYQB 2FXUA 3ENOA 4C23A 4BG9A 3LAKA 5KPZA 1DLOA 4LF6K 2HHXA 1HQUA 4KTZA 1D8YA 2YNIA 2GBZA 3R9PA 3PX6A 2VWJA 4IWVA 3JXUA 3G71N 4JKCA 1LAVA 4JHDA 3KD1E 1LCUA 1VSFA 2KHOA 4O8KA 2F8TA 4JK8A 3D7EO 3WXLA 3S3MA 3QB0A 4E19A 4AQYK 3CJBA 4IZ9A 4YOWA 4FZXC 1JLEA 4XIUA 5HROA 3SBGA 3LALA 4DFJA 2NRWA 1T05A 4CJ7A 4KO0A 1LOTB 3V9WA 2P1JA 5KI6A 2RHKA 1MU2A 1NOYA 1Y64A 1XQSC 4B9UA 5HRNA 1RBVA 1YJWN 3Q7BA 1OH8A 1X1PA 3V1QA 4DR4K 1VAZA 2EWSA 1Q18A 3FLCO 1UOCA 3KD5E 3IDHA 3QMLA 2W40A 1YUWA 3H3NO 1JXEA 3E9PA 4CGJA 2UUCK 1Z26A 2GX9A 4Q0BA 2YCHA 4K42A 4Z4GA 2KKZA 4FWQA 3SJJA 4CF2A 1JLCA 1NK0A 3J80O 1T7PA 5AZIA 4DLGA 3AGKA 2GWKA 4JK9A 1BOTO 3IG1A 2XY5A 1C0GA 1VQ6N 4CEFA 3PSFA 3AVAA 3L2RA 3K5OA 2BGGA 1GLAG 5LL6Z 2ZJRL 1H1VA 4WQ5A 3CCSN 2G8UA 3HYFA 1N36K 3AGRA 1NGDA 3WXIA 4CIEA 2YKNA 3D0PA 4H0YB 4LY7A 4CBWA 3OW2M 2F7TA 1JXBA 4J2BA 1E4FT 5GAEP 1JJ2M 3RRGA 1B9DA 2PAVA 4C8OA 3O9UA 2QK9A 1TGOA 1RGIA 4WFBL 2HF4A 3DMJA 1MWKA 4NYNA 4BC4A 3VMFB 1Y97A 1NG9A 3LDOA 4LF8K 3QICA 4BRMA 3LPTA 4CJEA 4G1QA 3SQ0A 2E1ZA 5AQLA 3OS2A 4CGFA 4KI6A 3NGYA 4RW9A 3SBTA 3NF8A 3CC4N 2NRTA 3VQ5A 5KQDA 4BE2A 1U2VA 3FFKB 1VHXA 1A5WA 5JICA 3RMCA 3U6FA 4LF5K 2NZTA 3K58A 4FO0A 4CZLA 4DQ8A 1B9FA 2WFBA 1X3MA 2CGKA 1Q8IA 3Q7CA 4H8KA 4WCEL 3M8RA 1HNZK 5ELZA 1ILYA 3MAQA 3DLBA 3CFPA 2UYTA 5LMNK 4BWJA 4BRAA 3KTQA 4JI6K 1IJJA 3SQ1A 3SCXA 4ID5A 3I8DA 3P83D 4U67L 2UUBK 1E3MA 2BH1A 3SQ4A 1SS6A 3HZ6A 5JVHL 3ZT3A 3VA3A 2JWLA 3QFUA 4DR7K 4N41A 2P9UB 5EXWA 5E41A 1EWQA 3CCUN 1VSHA 2UUAK 2YV0X 4GNIA 3O9RA 3VQ7A 3MXJA 2HHUA 1BO5O 3I56N 3IRXA 2RE2A 5EU7A 4FZZA 3EEQA 1KAZA 3PY8A 1KD1O 4JI0K 3K9JA 4KTWA 3P1GA 4DV3K 1DTTA 3O3HA 4M45A 3OYNA 3V9SA 3A0IX 1BU6O 3THXB 1TK8A 1X9JA 3DLEA 4NLBA 3CCEN 4GVEA 3TAGA 1OH6A 5AZJB 4YFUA 1RDAA 1XNRK 1RT1A 4LFCK 4CJUA 2BANA 5GIOA 1SKSA 1SKWA 3L8BA 3LDPA 3THYB 4H0VB 1P8ZA 4UY8O 3CMEN 3DXMB 4E3SA 1KLNA 2O4GA 4FWOA 3SPYA 1ASVA 1KC8O 3PUFA 2VQFK 2A40A 1ZBFA 5A2QO 5CZ2A 1NK6A 3KHYA 4AHUA 4PKGA 1XC3A 1WNSA 2FBVA 4QCLA 4DV0K 4AF1A 3SK3A 2Q1NA 1I94K 4CZGA 2AJQA 3O4WA 4IOXA 4NLCA 5I42A 1RDBA 1N6QA 4A59A 4W5QA 4DTOA 2FF3B 4FM0A 1S1WA 1GOBA 4I9LA 3IS9A 3M8QA 5BN8A 3WNHA 2XRIA 3WXMB 4M7YA 4DV4K 4JHDB 4B9QA 3OYLA 1S6QA 4B9NA 1NLVA 5AQPA 3RSEA 1K8KA 3AVGA 5AQHA 4BRPA 2NRVA 3CFRA 4M3YA 4DSIA 3OVNA 1NGHA 2FBYA 2A6AA 3UIQA 2KTQA 3V4IA 4DUZK 3HI0A 4E1NA 3DLGA 1IBMK 3TAEA 4E89A 5T7BA 3QINA 1RILA 1IKYA 2IIRA 5EVZA 4CGHA 2PY5A 4FL9A 4J2DA 4NB4A 2Z1GA 2G8KA 3K2PA 1C1AA 3DRRA 4BR9A 2WONA 4DCHA 3QNOA 4WQ4C 3A5LC 3CM6A 3GOIA 2HBLA 3CJ1A 4F8RA 4B3RK 3QDKA 1U4BA 3ENHA 4B1ZA 1NOZA 3HL8A 1JCGA 1RNHA 3EZ5A 1W0HA 3MCAB 1BI4B 5J2QA 2UXDK 1IG9A 4F3TA 5HLFA 1ATRA 4HVJA 4OVLA 3AAPA 3NHGA 4CJPA 4BROA 2KZMA 4FJGA 4KH5A 3V9UA 1DTQA 2Z1JA 3TSUA 4IXCA 2IS3A 5BREA 3HK2A 2JLEA 1KSPA 1BQMA 1VSLA 2YHBA 1P90A 3WQTA 1L3TA 4YDUC 2JGUA 4I2QA 1UA1A 4MLHA 1QVGM 3DOKA 2BDPA 4W5TA 2IOCA 3L4QA 4H03B 5FDLA 3THYA 4OPAA 3H45C 1BL3A 3ZSQA 4AHSA 2KFZA 3S3NA 2O8CA 4KI4A 3C6HA 1A5VA 3FE1A 1S22A 3LDQA 4B3SK 3MXIA 1ZBHA 3L2WA 5CR4A 4H0PA 3HXMA 3KK2A 4AHVA 1BCMA 4DUYK 1NK7A 4DQIA 4BQZA 4B08A 4CGIA 3TAFA 3O8MA 2Q97A 5K14A 3OTOK 2ZWHA 4FCYA 3KZBA 1JL2A 4M3XA 4Y1CA 5H1SQ 4DV2K 3QEWA 1K8AO 2YKMA 3O4QA 3SYZA 4JYAK 1N33K 4E7LA 4C8KA 4GW6A 1HUXA 4BRNA 3ZSRA 3CM5A 4IKFA 4BGBA 4DS5A 1LW2A 2HHTA 1RFQA 1VK0A 3BZKA 5DM7L 3MXMA 4Y1DA 1KRPA 4FOEA 3FZMA 2NLXA 3MDQA 3MX2A 3THWB 4CF9A 5AQIA 4LSLA 4PKHA 3ZX0A 3I8BA 2VGNA 4BRHA 2Q3SA 4BRGA 3WNFA 1BIZA 2Y1IA 2E2PA 3VGMA 4OX9K 1VQMN 4Z0UA 3DRSA 1J53A 4YDUA 3DXKA 2ZM6K 1K73O 4CHPA 3NF6A 5JMVA 1HYSA 2ITGA 4DSEA 1YJ9N 4Q5VA 3AO3A 2QWMA 4GY2B 3H1QA 3L2QA 3CPWM 2FC0A 2GV9A 1DT9A 4BDPA 4NCBA 3NH2A 1BUPA 4EP4A 3PO4A 5BRHA 1NMNA 4CHQA 3WEEB 1X9MA 5KTQA 4H5RA 1R0AA 3SUOA 4BQLA 4J2EA 1SAZA 4K25A 4LF9K 4CHOA 2P9NB 5LJWA 4DR1K 2OA8A 1ATSA 4GVMA 1TV6A 4FYDA 4OPHA 4FM1A 3RMBA 5J2PA 4RG8A 4BWMA 3A8YA 5BPNA 3U9DA 4F2RA 4A61A 2I5JA 3TTFA 2E1YA 2WOMA 2XO7A 3HM9A 5C12A 3O08A 4CK2A 1GLLO 4DV7K 1FXXA 3MEGA 3NF9A 1N5YA 2ZE2A 3CC7N 3V1RA 3VEYA 2YHXA 3MN5A 3ATUA 2YHWA 3MCPA 1D4XA 4I2PA 3LWMA 4ID1A 1NGEA 4HHTA 1JLQA 1WSEA 4IOCL 4NCAA 2JWKA 5C42A 4CJSA 1VQPN 3U3GA 4BRFA 1BI4A 3CJ7A 2YNHA 3DAWA 4JS4A 5EX5A 3VEZA 3SJHA 3TR8A 3VQPA 3DXMA 3MN7A 2DFEA 4OKEA 2GUPA 4I7FA 3WXJA 3L3UA 4BE0A 3PX0A 5C10A 4JI4K 4M7XA 5J2MA 1CLQA 5TKYA 1N8RO 2GTDA 1RCHA 1NKEA 3L4IA 4PKIA 4M3RA 4CJFA 2Z1HA 3BZCA 5HRRA 5M1KA 3WQUA 4CJLA 4EIAA 4KHWA 4IJAA 4BGAA 3ZETB 1LV5A 3TTDA 1XMOK 1BDGA 2FSJA 4KKOA 2BUPA 4RW7A 2B4JA 1Z6RA 2YX6A 3HPGA 5DK5A 4CJVA 1KTQA 2D0CA 3AVJA 3F2KA 1HQEA 1YI2N 1TAUA 3RVCA 4IDKA 3L0QA 3HT3A 4CJKA 3MEDA 5BR9A 4DR3K 4DG1A 3T1YK 1BHLA 3CETA 4H0OA 5BN9A 4JNEA 1NGFA 4M3ZA 1REVA 3V9ZA 2HSTA 3HRGA 3O9TA 1U45A 4QS9A 3NAEA 4E1MA 3VN5A 3KLIA 3VQ6A 1OH5A 4KHPK 2A3ZA 3QEIA 4KREA 3O5BA 4FZYA 4BRKA 2O8BA 4R5PA 1VRTA 2O8CB 1CZ9A 2X78A 3A5NC 1T8EA 4J2AA 3VTHA 4B3OA 4H5VA 1GLJO 1HNIA 1NU0A 3OYMA 1VQ9N 2GELA 4E7IA 4A5AA 3CQXA 4EFHA 4FPBA 4I6MA 1NWKA 3HSTB 1WB9A 1IKVA 4K41A 2W42A 4CZFA 4JKAA 3C95A 4CW7B 3QLHA 3QETA 3OYBA 1RT7A 3SUPA 2VGMA 2VWBA 5ADXA 3KKRA 2YHYA 1VQNN 4X64K 1HPZA 3ZT4A 1X9WA 3SMSA 1G99A 3LDNA 3ZCMA 4DSLA 1VSMA 2Q0UA 2YI1A 4FM2A 1IBLK 5FROA 2D0BA 5KGWA 4DWIA 5LMUK 5M1NA 5GAHP 4N47A 1XI1A 3MK6A 3GL1A 3ZSVA 5C15A 4OO1J 4GKKK 3QEPA 1FKOA 2KQ2A 4LFAK 1RTJA 3RWUA 2PFUA 4LF4K 4CZEA 2XY7A 5FPNA 3C0BA 1U6ZA 3AARA 4B1XB 3VGKA 1NNEA 4DTMA 3LZJA 1YHQN 3DJCA 1VRUA 3C94A 1HRHA 2D1KA 4DV5K 4CGGA 4H4OA 5DMRA 4CE9A 2HF3A 1BIUA 2VWKA 1NJWA 3MECA 3THXA 4DTSA 3KVGA 2G8FA 1YIJN 4ILHA 4AM6A 4C1NI 2G8IA 3HO1A 4ISEA 4ISFA 4O8UA 3LDSA 1QE1A 1YF5L 3ZSZA 1S1TA 5CYQA 3M5RA 3QBWA 2Y1JA 2HHHK 3SZ2A 3AO5A 4KH4A 4QS8A 3VEWA 1U04A 3QIOA 2UXCK 3VQCA 3T69A 1JCFA 4C8MA 5D3GA 1MDUB 1WOQA 1C6VA 2O8DB 1S1VA 4O55A 4KB1A 2G8WA 5CY4A 1EP4A 3KIOA 3VPZA 4JV5K 2O8FA 3UE5A 5HL7L 4FVMA 3PLAA 3VQ4A 4FK4A 3RMDA 3TU5A 1BG3A 3P5JA 3M8PA 3DI6A 3HVTA 4DSFA 4PUOA 2VG7A 1YTUA 5JS1A 3VEOA 4ILJA 4DF4A 4WFAL 3R6MA 5C2FA 4NO7A 1BCOA 3HSCA 2P9KB 3BF1A 4FLTA 4GKJK 1D5AA 1CZAN 4CZMA 1VSDA 1B92A 5C0YA 1KAYA 5AQOA 3P4IA 2QXFA 2YHAA 1SUQA 2YNGA 4F3OA 3TAPA 2HHSA 3AVKA 3QO9A 4BRQA 3T19A 3J8AA 1ZBSA 4X62K 4DMNA 5M1QA 3WNGA 4MO4A 2W6LA 1QHTA 5CZ1A 2UXBK 1NKBA 2HMIA 1IKXA 3TI0A 4LFBK 4FJHA 1NJYA 3WUHA 3KLEA 2ZGZA 2P9NA 4KB0A 2VG6A 1XNQK 2QWLA 3ZETA 3ULDA 4BY9C 4JLHA 4F2SA 3OJSA 3VF4A 4CIGA 3F73A 1ESVA 4JS5A 3RR8A 4CD1A 3EN9A 3SI6A 3EY1A 1NK4A 4BRDA 5HRPA 3PX4A 4DTUA 1EWRA 3SUQA 2HB5A 4FW2A 2B5JA 3OYEA 2VYPA 4O44A 5CHIA 3VERA 3LZIA 3C7NA 3MX5A 2DY4A 4BDYA 1ZBIA 2D5RA 3M8SA 3DYAA 3TARA 2FF6A 4YY3K 4YOYA 2Q31A 3CIPA 4CHNA 4B1UB 3CJCA 1OVYA 3UKUA 4IO9L 3C6AA 3NVMA 3CXCM 2GWJA 4B1VA 3THWA 1DKGD 4OPJA 1RDWX 4JKEA 4CJWA 4JRQA 3DM2A 3I0RA 1N32K 1O13A 3EKSA 1Q7YO 3UKRA 4N76A 3AVIA 3EKUA 2NRXA 3LP2A 3ZYYX 3OY9A 5J1EA 1RT4A 4BRLA 3IFRA 4BDZA 3OYHA 3ZLJA 4JI2K 4BRIA 3AO4A 3KK3A 2QWPA 5AQVA 1R59O 4M41A 2F9WA 3L3VA 2GEMA 5HOOA 5BR8K 4F4KA 4LH4A 4B3TK 4LH5A 3WXKA 3C7NB 1FKPA 3CCLN 2HBJA 4ILGB 4IJNA 3HBTA 3TSPA 2NRRA 3IUCA 1BA0A 3LL3A 3IMXA 5SWMA 1KQSM 1WN7A 2OTJN 3QBXA 3C6TA 4XH1A 1WSIA 4W5NA 4B9LA 4CFDA 4W5RA 3G4SN 4WFNL 3QEVA 1FJGK 5DM6L 3VENA 1BGXT 1QZ5A 4DSKA 4CD3A 1WBDA 3H6EA 4FLZA 3CERA 2FBTA 4LSNA 1T03A 4ZTJA 5LY3A 3B8AX 3P31A 5AQMA 4W5OA 4CIFA 3HTVA 5C2DA 2OPPA 3CD6N 4E1JA 4FWSA 2E20A 4JK7A 2DFFA 3DWLA 1KFDA 5FLXO 2V51B 4Z4EA 1BWFO 1GLFO 4DHYA 3AA2A 4WE1A 2WC9A 1LWFA 1IH7A 4MQ3A 3ZEUB 1KXPA 3RSEB 4E7HA 4RW6A 2UU9K 2P9SB 1Q9XA 4FXDA 1F21A 3FZHA 3NE6A 3LWLA 3E9OA 2IVPA 4XH4A 5AQQA 3KLHA 4L8RB 3SAFA 5FRNA 5MLCQ 2QM1A 3OYDA 1E4GT 1GLEG 1GLBG 4FK0A 5AFUA 2OPSA 4EHTA 4H5WA 3VGLA 4CEQA 2P5OA 4XEIA 1MA9B 1NK5A 4K0KK 2HMPA 3BGRA 1WSGA 3CF5L 2XY6A 1EO1A 4KH6A 4DTJA 4BREA 4F9OA 1I39A 1K8KB 5I3UA 1KVCA 1UAXA 4CJQA 4Z94A 5KRTA 2HBMA 3ZX2A 4CEBA 4PA1A 1WSJA 2CH6A 1QQCA 3CI5A 2ITMA 1ATNA 1JLFA 1NGBA 5AFUH 2QW9A 3IKMA 3B6PA 3EO3A 1NGAA 3DOLA 1C1BA 4FJ8A 4CBXA 2O4IA 3AVNA 1RBTA 4XH5A 1JKHA 3TAQA 5E26A 1TKXA 4K8XA 4DV6K 5AQYA 2FSNA 4DS4A 5AJ3K 4Y0WA 3ZSYA 4BRCA 1NK8A 3HM8A 1T3VA 1IG8A 4H0XB 1WSHA 5GADP 2FLOA 2D0OA 4E0DA 1RT6A 4CHZA 1WBBA 4FJ9A 4HWIA 1HNVA 4OGEA 3UB5A 3CJAA 4OLBA 3O9QA 1ZYQA 1RBRA 1K6YA 4ISGA 4KRFA 3FFIA 1S1XA 2LSNA 4N56A 4FLWA 5E84A 3ALYA 1HJOA 4AH9A 3AVFA 4FLVA 2OPQA 3ZSWA 1SQKA 1QS4A 4JKHA 3AA3A 5AZJA 5HP1A 3NDKA 4DQQA 3HJFA 3ITHA 3T1AA 2NNWA 5KGXA 4YOVA 3DLLL 1VSEA 3C6UA 3P39A 2HVHA 2A1RA 3K59A 2IC3A 1J5EK 1S9GA 3AO2A 3BF3A 1RBSA 2CGLA 4DLEA 3KLGA 4DTPA 3BEXA 4ELVA 4G9ZA 4CFCA 4B9MA 4FWLA 1ZC6A 4CEEA 2F8SA 2P9IB 1ASWA 4RW4A 1RTIA 3BP8A 3V6DA 1ZXOA 2OTLN 4WQ4A 5F2RA 2X6SA 3H3OB 3TPQA 2QI2A 4FWPA 3LAMA 4KHNA 2D4WA 4CZKA 4DTXA 4MDBA 3QIPA 1U2VB 3TABA 3K5NA 1VQKN 2HOEA 1LWCA 2X74A 4BVPA 4JD2A 3K57A 2E2NA 4EZ9A 1NBWA 4PL7A 2O8BB 5M1FA 3NGZA 3OYKA 3HVRA 1TKTA 3HOTA 3NMUA 2NRHA 3TTCA 4KAZA 5GINA 3VA0A 2OYQA 3VQQA 1J5OA 2E4LA 4GV3A 1XHXA 2EHGA 3KJVA 4HUFA 4PL8A 4QS7A 1NJIO 1KVBA 2NRZA 1C0MA 2YNFA 3G6EN 2NUBA 3JYTA 1S5JA 2QWOA 4JKBA 1W9HA 4JI1K 4KV8A 4AHCA 3K5MA 4B3MK 2P5GA 1JCEA 1QZ6A 3AVHA 4MDAA 4U7BA 3NGIA 4HUGA 4CBUA 3M1FA 3CCJN 4DR2K 2P9UA 1WUAA 1NGIA 1D9DA 3MWPA 3K5LA 4A2BA 1VQ8N 4UQGA 4O5FA 1KCFA 4A57A 3B6OA 3J7YP 3OHRA 3K9KA 4FJMA 2A42A 4Z4CA 3UKUB 4B8CA 3CFOA 2HHVA 4JI5K 4FPAA 3ATVA 4B9VA 4IOAL 1QQOA 3U3YA 1EXQA 1SZ2A 5CE3A 2W41A 1XC9A 4M3WA 5M1OA 4CFBA 5BPLA 2P51A 3EE9A 2VG5A 4C1NK 4NCGA 1RDCA 4M3TA 2Q2RA 4I9QA 1V4TA 3DLRA 3S9HA 1S3XA 4CZHA 3I55N 1RDDA 4OJRA 2FBXA 1YT3A 1NK9A 4M63C 3AA5X 3QESA 3DRPA 4FWMA 3G10A 1NGCA 3PIPL 1HX1A 2RF2A 1TL3A 3AVBA 5HRSA 3GBTA 3S41A 3AVCA 2P9LA 4KHYA 3M6GA 1EKEA 3VETA 2IVNA 1L3VA 2QEXN 4BC2A 3LDLA 1EQYA 2HBKA 2XY8A 3J7AP 5F1XA 4KPYA 3U4LA 3LM2A 2HHWA 1JLBA 4LD0A 3PSIA 4QOZB 1QSSA 4PQUA 4CERA 2ASMA 1KLMA 4H5NA 4PHTX 3HOSA 4BVOA 4BE1A 3ID6A 5J2NA 1TKDA 1M1KO 2ZF5O 1QVFM 3VF6A 2ATQA 3UKRB 3NCIA 3AA4A 2WUSA 4BACA 1YTAA 4IDHA 4K8ZA 2IAJA 3SUNA 4O4GA 3FGUA 3DLHA 2E8AA 1CXQA 4WQ5C 3I0SA 3KK1A 3CJ9A 3VQAA 4DFMA 4IG3A 1NM1A 3SLCA 4CEOA 4O5BA 2PZSA 1N34K 1S72N 3ID8A 4B1YB 4H0TB 1HKBA 4ICLA 3WEEA 4Z4FA 1GOAA 5TKWA 3O6WA 4A5BA 1IO2A 1WAFA 5JS2A 4O0IA 2KZZA 5AQGA 3SQ2A 5KRSA 4C8NA 4DF8A 1XHZA 1WSFA 3EL2A 3WT0A 4EP5A 2O8EA 1JL1A 2P9KA 5FPEA 1YITN 1Q86O 4OLAA 1TYQA 3WNEA 3D45A 3N4QA 3FZKA 2IVOA 3M3ZA 1A5XA 2V52B 3KK7A 4PWDA 5BPMA 4JI3K 3N4PA 2BTFA 4CGDA 3CMAN 2YJFA 4JD2B 1O1WA 3VQEA 2XHBA 1SL0A 1T6DA 4Z4HA 3QFPA 2G8HA 1TKZA 2FSKA 3CPEA 1HNWK 2AP1A 1HYVA 2X6NA 3R1XA 2P9PA 2PYJA 4HCBA 2HHQA 3O1WA 4KHSA 3KWGA 2ZD1A 2A5XA 4DU4A 4JKDA 1T44A 4H4MA 3NFAA 4CFAA 2P9IA 5IT9O 3K0SA 1KFSA 3LPUA 1C1CA 1HKCA 5AQJA 3OYAA 1SL2A 4NXNK 2KW4A 4M3UA 1Q82O 4AHTA 1HMVA 2CH5A 4O0JA 4CEZA 5KPRA 4KBOA 4CVNE 3ZT1A 4CEDA 5LJVA 1VQLN 2HW3A 3H46O 1HYZA 3T7ZA 5AQZA 3ZT0A 3RTVA 3U8XA 4YHHK 4IFVA 4OPKA 1NJZA 2OCEA 4C8LA 4YOUA 1TUYA 3CCQN 4CJ5A 4DTRA 4RW8A 5C25A 3O1BA 3VQDA 3VQ8A 1YVUA 5FPMA 3CQ8A 3EZWA 1ITGA 2ASPA 2R7YA 1WLJA 1WAJA 3FR0A 2HNYA 1NKCA 2D0AA 3JS6A 5BRFA 2WTUA 4GMJB 4R79A 3NVKA 5BRDA 3HPHA 1VQ7N 3EE8A 1FW6A 2QXLA 4BR2A 4JKGA 5AQSA 4CESA 2V7ZA 3D2FA 4LF7K 4B9TA 5M1PA 5AQNA 1S9EA 1MWMA 4LC9B 2VCPA 1GLDG 3CQYA 2Q36A 4FWRA 4CJ4A 3DLKA 4IEEA 2GUIA 3JSMA 4B9SA 4IEIA 4OKJA 1C0UA 2E88A 4HTLA 2ZGYA 1HLUA 3IAYA 1HR0K 1W97L 4IFYA 4DTNA 4GV9A 2E5LK 4EAHD 4BG8A 3PIOL 4KHQA 3T3FA 3O3GA 1GLCG 2EX3A 1IBKK 3OBWA 1RTHA 3BDPA 4DQRA 5AQTA 4TSXA 4HCCA 4CK3A 5KPTA 3ISNC 2IGIA 4M42A 1CZBA 1YVNA 1NJXA 1QSYA 1X3NA 4IG0A 1KVAA 3C65A 5FPDA 5IWAK 4JN4A 3SV4A 1J6ZA 3KWIA 1M90O 3E01A 4PY5A 3AV9A 1Q81O 3OS1A 1W7AA 3VEXA 4FJ7A 3ZEUA 1RT3A 4L3QA 3OA9A 4RTFD 1UA0A 2H3GX 1RTDA 3E66A 1EX4A 3F5TA 3T1HK 2RKIA 1FK9A 3L2VA 3O80A 3CHWA 1RBUA 2E2OA 2OZSA 3TAMA 3D2EB 1OKJA 3KKSA 5AZIB 4JEPA 3MN6A 4E7JA 4NXMK 2E2QA 1YJNN 3R8EA 2P9LB 2O8EB 3AAQA 4MO5A 4N5SA 2A1SA 4IBNA 3MMVA 4BR5A 3F9KA 4JRPA 4FJNA 3V81A 3RRHA 1RT2A 5B8HA 3OS0A 3QERA 3CG7A 4CK1A 1IV0A 3VF2A 3NF7A 3KLFA 3TANA 1GOCA 3A5MC 3MWTA 1TAQA 4CEAA 3GDQA 1SKRA 3LANA 3H08A 4YOTA 2G8VA 4FJKA 4X66K 4BC3A 2ASOA 3HPOA 1I3AA 3E9LA 2ZQBA 3OBYA 1L3UA 1SL1A 3CCRN 3VQBA 1L5UA 2PBDA 4A2AA 3OYIA 3OYFA 1QHAA 3GG4A 3R3LA 3VESA 4A62A 4FJJA 4AHRA 4FJIA 3TSQA 3OJUA 1C0TA 2RPIA 4DQPA 3D6RA 3W3DA 4CCHA 4ELTA 4FJLA 1G15A 3F9MA 2D0PA 1HKGA 2F4VK 4Z4IA 1NGJA 4YOXA 1LWEA 2BE2A 3ULEA 1LAWA 1YAGA 5JLHA 1U49A 5AQKA 3SNNA 4OKKA 2E6LA 2KFNA 3LM9A 4CECA 1NGGA 2B6AA 2Q0RA 1LW0A 3VEVA 1ZBUA 1C0FA 3BY5A 1OH7A 1U47A 5AQUA 4NYFA 1OVQA 1TK0A 4RCHA 1S1UA 3ZT2A 1XMQK 3ZSXA 4DSJA 5F0XA 3ULEB 4HUEA 5AR0A 3MEEA 4FJ5A 3RMAA 2PYLA 3SPZA 1Z05A 3HP6A 4FSVA 4MLEA 4ZHRA 4KFBA 5C24A 2F9TA 4HTUA 1QQMA 2AA4A 3MN9A 4AM7A 4CJTA 5AQRA 4BR7A 4FLXA 4FWKA 3A2FA 3THVA 2I7NA 3V9XA 3AO1A 4KTQA 4ELUA 4ZTFA 3EYZA 3NBPA 1NMDA 3U9ZA 5GAGP 2W6KA 2DTUA 3LP1A 1DGKN 4CI6A 4X65K 3SMPA 3D2EA 4JI8K 1Q9YA 3PO5A 3W0LA 4GV6A 5AQFA 1X9SA 5GIPA 3QNNA 4J8FA 2O8FB 1HPMA 3ZSOA 3SAGA 2HVIA 3G25A 4H5TA 1RDUA 3RR7A 5HBMA 3J81O 1RT5A 1UWBA 4JAXA 2J4RA 4CJRA 1EETA 2P9SA 4CF8A 1D9FA 3P38A 4DR5K 4JI7K 1TUUA 2V7YA 4DKWA 4K43A 1W2BM 3ASMA 4YNQA 2A41A 4EHUA 5SZTA 4DB3A 1ASUA 1V4SA 4DV1K 1ZBLA 4DU3A 4E7KA 1BA1A 5JVGL 4OGCA 4DU1A 3D2FB 4RWTA 1KAXA 1YXQA 1QTMA 4DFPA 2QWNA 4BC5A 2O8DA 3HP9A 4MFBA 2DPNA 2WBNA 1SV5A 3A5OC 3CYMA 4BR0A 3L2UA 4FJXA 1K9MO 1VSJA 1XUPO 3I33A 5EOYA 5I9EB 4AILC 3DXKB 3AY9A 1J9AA 3E1YA 3GE1A 3V1OA 5JLFA 2IDOA 3OYGA 1VSIA 4FVUA 4DR6K 3L6QA 4FW1A 1QQNA 4CZIA 4CF1A 1JLAA 2QA4N 4CF0A 4KHUA 3LP3A 1CXUA 2QWQA 3O4NA 1VQON 2ZJPL 4DFKA 3PV8A 3SV3A 3H1VX 3QEXA 4EZ6A 1VQ4N 1QSLA 3NH1A 3G0ZA 4FK2A 4FLUA 3ENBA 3LP0A 4CHYA 2RN2A 1T6CA 1L3SA 1JLGA 4IFEA 4CJ3A 3S3OA 4FOIA 1U48A 2OPRA 1BISA 1XWLA 2YJEA 3NH0A 1J54A 2F96A 3OYCA 5AQWA 1HNXK 2P9PB 4JKFA 2Z1IA 3CCVN 3BUZB 3J7ZO 5KQ8A 2QKKA 4WYBA 3OYJA 3TWHA 2HNZA 3VQ9A 2CGJA 4YORA 4DQSA 4FLYA 3SAHA 3VTIA 4QAGA 3VOVA 1TL1A 1VQ5N 5AQXA 2QKBA 5CYMA 1IKWA 3O9SA 2VQEK 4V19S 4IO8A 4WF9L 2ETJA 1S6PA 3O3FA 1Z25A 5EY4A 3AVLA 5FRMA 1BQNA
chains in the Genus database with same CATH topology
2FSKA 3CPEA 2AP1A 3CC2N 4FWNA 3EKUA 3R1XA 2NRXA 2P9PA 3ZYYX 2QWRA 3O1WA 3KWGA 2KLAA 2A5XA 1HUXA 4B1WB 3IFRA 4BRLA 4BRNA 4JKDA 1T44A 3FZLA 4BRIA 2QWPA 4I6MB 5AQVA 2P9IA 4CZJA 2I7PA 1R59O 4BGBA 2F9WA 2GEMA 5HOOA 1HKCA 2OANA 5AQJA 1RFQA 5ADXH 5DM7L 1Q82O 4FOEA 3FZMA 2ZJQL 2CH5A 2NLXA 3MDQA 5KPRA 3MX2A 4KBOA 4BR4A 3WXKA 3FZFA 5AQIA 5LJVA 3CCMN 3H46O 2QTDA 4JKGB 4PKHA 3T7ZA 5AQZA 3I8BA 3ZX0A 2VGNA 4BRHA 3C7NB 4BRGA 3U8XA 1DEJA 1TYQB 2FXUA 3ENOA 3ZX3A 4C23A 4BG9A 5KPZA 3CCLN 2E2PA 2HBJA 4ILGB 4IJNA 3HBTA 3VGMA 3R9PA 4YOUA 3TSPA 1TUYA 3CCQN 2NRRA 3IUCA 1BA0A 3LL3A 1VQMN 3IMXA 2OTJN 1KQSM 4IWVA 4YDUA 3O1BA 3JXUA 3QBXA 3DXKA 4XH1A 3G71N 5FPMA 4JKCA 1K73O 3EZWA 4JHDA 1LCUA 5JMVA 4BRCA 1YJ9N 2ASPA 4WFNL 3G4SN 2QWMA 2KHOA 4GY2B 4O8KA 3FR0A 3H1QA 5DM6L 3VENA 3CPWM 4JK8A 3D7EO 1DT9A 3WXLA 1QZ5A 1BUPA 4CD3A 3QB0A 3H6EA 5BRHA 3CERA 3JS6A 3WEEB 3CJBA 4H5RA 4IZ9A 3B8AX 3P31A 5BRFA 5LY3A 4YOWA 4R79A 4BQLA 5AQMA 3NVKA 5BRDA 1SAZA 1VQ7N 4K25A 3EE8A 3SBGA 2QXLA 4BR2A 2P9NB 4JKGA 5LJWA 2NRWA 3HTVA 5AQSA 4CJ7A 2V7ZA 3D2FA 5C2DA 1ATSA 1LOTB 3CD6N 4E1JA 2RHKA 4FWSA 5M1PA 1Y64A 5AQNA 2E20A 4JK7A 4OPHA 3DWLA 1MWMA 4LC9B 2V51B 2VCPA 1BWFO 1GLDG 3A8YA 3U9DA 5BPNA 1XQSC 3CQYA 1GLFO 2Q36A 4A61A 4DHYA 4FWRA 3TTFA 2E1YA 2WC9A 1YJWN 3Q7BA 3O08A 5C12A 1GLLO 4IEEA 3ZEUB 4IEIA 1KXPA 1VAZA 1Q18A 2EWSA 2E88A 3FLCO 4HTLA 3RSEB 2ZGYA 1HLUA 3IDHA 3QMLA 2W40A 1YUWA 2P9SB 3H3NO 3CC7N 1W97L 3E9PA 3FZHA 4GV9A 3VEYA 4EAHD 3E9OA 4BG8A 2IVPA 4XH4A 3PIOL 2GX9A 2YHXA 3MN5A 2YCHA 5AQQA 4K42A 3ATUA 3SAFA 5MLCQ 2QM1A 2KKZA 1E4GT 1GLCG 2YHWA 4FWQA 3MCPA 1GLEG 1GLBG 3OBWA 5AFUA 1D4XA 4EHTA 5AQTA 4H5WA 1NGEA 3VGLA 5AZIA 4XEIA 5KPTA 1MA9B 3AGKA 2GWKA 4JK9A 2HMPA 1BOTO 3CF5L 4IOCL 2JWKA 1C0GA 1VQLN 1EO1A 1VQ6N 1YVNA 4KH6A 1VQPN 1X3NA 4BREA 4F9OA 4BRFA 1GLAG 1K8KB 3CJ7A 4Z94A 2HBMA 3DAWA 3ZX2A 3C65A 5FPDA 4JN4A 5EX5A 3VEZA 3SJHA 2ZJRL 1J6ZA 3KWIA 1M90O 2CH6A 1H1VA 3CI5A 4WQ5A 1ATNA 2ITMA 3CCSN 3DXMA 3MN7A 1Q81O 1NGBA 5AFUH 3WXJA 2GUPA 3AGRA 1NGDA 3WXIA 2QW9A 3VEXA 3IKMA 3ZEUA 5C10A 4L3QA 3OA9A 4M7XA 3EO3A 4RTFD 1NGAA 4H0YB 4CBWA 3OW2M 2H3GX 5TKYA 2F7TA 1N8RO 2GTDA 3E66A 4CBXA 1E4FT 3F5TA 3L4IA 4PKIA 4XH5A 5GAEP 5M1KA 3O80A 5E26A 3WQUA 4EIAA 4IJAA 4BGAA 1JJ2M 3ZETB 3CHWA 2PAVA 2E2OA 2FSNA 5AQYA 3TTDA 1BDGA 3O9UA 2FSJA 3D2EB 2BUPA 4Y0WA 1OKJA 1RGIA 1Z6RA 2YX6A 3HM8A 3MN6A 1T3VA 4JEPA 5AZIB 1IG8A 4H0XB 2HF4A 4WFBL 1MWKA 5GADP 2FLOA 4BC4A 2E2QA 3VMFB 3F2KA 3R8EA 1YJNN 3LDOA 2D0OA 2P9LB 3QICA 4BRMA 1YI2N 3RVCA 3AAQA 3L0QA 4MO5A 2E1ZA 5AQLA 4HWIA 3MMVA 4BR5A 5BR9A 3UB5A 3SBTA 3CJAA 3CC4N 2NRTA 3O9QA 5KQDA 1U2VA 5B8HA 3FFKB 5JICA 4ISGA 3VF2A 3A5MC 2NZTA 1VQ5N 3CETA 3MWTA 4H0OA 4FO0A 5BN9A 4CZLA 4JNEA 1NGFA 4DQ8A 2WFBA 3GDQA 5E84A 1X3MA 1HJOA 2HSTA 3HRGA 3O9TA 4YOTA 2CGKA 4QS9A 3Q7CA 4BC3A 4WCEL 5ELZA 2ASOA 1SQKA 3E9LA 1ILYA 4JKHA 3OBYA 5AZJA 2NNWA 4YOVA 2A3ZA 2UYTA 3DLLL 3CCRN 3P39A 4BRAA 3O5BA 1IJJA 4BRKA 2PBDA 4U67L 4A2AA 2BH1A 3BF3A 3A5NC 2CGLA 1SS6A 3BEXA 3HZ6A 5JVHL 4G9ZA 1QHAA 3VTHA 2JWLA 1GLJO 3GG4A 3QFUA 3R3LA 4H5VA 1VQ9N 2GELA 4FWLA 1ZC6A 4A5AA 3CQXA 4EFHA 2P9UB 5EXWA 3VESA 4A62A 2P9IB 4FPBA 4I6MA 3TSQA 1NWKA 3BP8A 1ZXOA 3CCUN 2OTLN 4WQ4A 3D6RA 5F2RA 4K41A 3H3OB 3TPQA 3W3DA 2QI2A 4FWPA 3O9RA 4GNIA 4CZFA 4JKAA 2D4WA 3F9MA 2D0PA 4CZKA 1HKGA 1BO5O 4MDBA 3I56N 1NGJA 2VGMA 2VWBA 5ADXA 2RE2A 1U2VB 4YOXA 2YHYA 1VQKN 1VQNN 3ULEA 1KAZA 1KD1O 2HOEA 3K9JA 3SMSA 1YAGA 4BVPA 1G99A 5JLHA 3LDNA 4JD2A 2Q0UA 2YI1A 5AQKA 2E2NA 1NBWA 3LM9A 4PL7A 5M1NA 1NGGA 1BU6O 3A0IX 5M1FA 5GAHP 2Q0RA 1X9JA 3GL1A 3MK6A 4NLBA 5C15A 3HOTA 3CCEN 3VEVA 3NMUA 2QEXN 4GVEA 4OO1J 2NRHA 1C0FA 3TTCA 5AQUA 5GINA 5AZJB 2PFUA 4RCHA 4GV3A 4CZEA 5F0XA 3ULEB 4PL8A 3C0BA 4QS7A 5FPNA 5AR0A 1U6ZA 2NRZA 1NJIO 5GIOA 1Z05A 3AARA 3G6EN 3LDPA 2QWOA 4JKBA 4FSVA 3VGKA 4H0VB 4B1XB 4MLEA 1P8ZA 1JCEA 1QZ6A 4UY8O 2F9TA 1QQMA 1YHQN 3CMEN 3DXMB 3DJCA 4FWOA 4MDAA 4U7BA 2AA4A 3MN9A 2D1KA 4AM7A 4CBUA 1KC8O 3M1FA 3CCJN 2P9UA 1WUAA 2A40A 1NGIA 5AQRA 3MWPA 4A2BA 4BR7A 4FWKA 1VQ8N 4O5FA 2I7NA 4A57A 3KHYA 3OHRA 3K9KA 2HF3A 1NMDA 3U9ZA 2A42A 4PKGA 1XC3A 5GAGP 3UKUB 3KVGA 1YIJN 1DGKN 4ILHA 4AM6A 4AF1A 4C1NI 4CI6A 4FPAA 3SK3A 3ATVA 3SMPA 2Q1NA 3D2EA 4CZGA 1QQOA 4IOAL 3O4WA 4IOXA 4NLCA 4ISEA 1SZ2A 4ISFA 3W0LA 2W41A 5AQFA 5CE3A 4GV6A 5M1OA 5BPLA 4O8UA 5GIPA 3EE9A 4A59A 4C1NK 2FF3B 4J8FA 1HPMA 1YF5L 2Q2RA 3SAGA 1V4TA 3G25A 3M5RA 3QBWA 1S3XA 4H5TA 4CZHA 5BN8A 3I55N 1RDUA 3WXMB 4JAXA 2J4RA 2P9SA 4KH4A 4M7YA 4M63C 4JHDB 4QS8A 4B9QA 3VEWA 3P38A 1NLVA 1TUUA 5AQPA 4FWMA 1K8KA 3RSEA 2V7YA 1JCFA 5AQHA 1NGCA 4K43A 3T69A 4BRPA 1HX1A 1MDUB 2NRVA 1WOQA 4DKWA 3PIPL 1W2BM 3GBTA 2A41A 3S41A 3VPZA 4EHUA 3UE5A 4DB3A 1NGHA 5HL7L 1V4SA 3PLAA 2A6AA 2P9LA 3TU5A 1BG3A 1BA1A 5JVGL 3HI0A 3VEOA 3M6GA 4ILJA 3D2FB 4WFAL 3VETA 2IVNA 3R6MA 5C2FA 4NO7A 4BC2A 1KAXA 1YXQA 4RWTA 3HSCA 2P9KB 3BF1A 3LDLA 2QWNA 1EQYA 2HBKA 4BC5A 5F1XA 2IIRA 1CZAN 2DPNA 2WBNA 3LM2A 5EVZA 3A5OC 4FL9A 3U4LA 4BR0A 4CZMA 5C0YA 4NB4A 1KAYA 1K9MO 4BR9A 5AQOA 4DCHA 3P4IA 1XUPO 4WQ4C 3I33A 5EOYA 3A5LC 3GOIA 2ASMA 2HBLA 5I9EB 4H5NA 4PHTX 3HOSA 4BVOA 3CJ1A 3ID6A 3QDKA 3DXKB 3ENHA 1M1KO 2ZF5O 3AY9A 1QVFM 3VF6A 4B1ZA 3UKRB 2WUSA 4BRQA 1JCGA 3E1YA 4IDHA 3GE1A 3J8AA 5JLFA 1ZBSA 3MCAB 4FVUA 5M1QA 3FGUA 3L6QA 4MO4A 2E8AA 1QQNA 1ATRA 4CZIA 2QA4N 4WQ5C 3AAPA 2QWQA 3CJ9A 4BROA 1NM1A 3WUHA 1VQON 4KH5A 3SLCA 2ZJPL 3TSUA 2ZGZA 2P9NA 3H1VX 4IXCA 2QWLA 3ZETA 1S72N 3ID8A 5BREA 4BY9C 1VQ4N 3VF4A 1P90A 3ENBA 4H0TB 3WQTA 4B1YB 1HKBA 3WEEA 1T6CA 4YDUC 1ESVA 4IFEA 4FOIA 3O6WA 5TKWA 4CD1A 4MLHA 2YJEA 1QVGM 4A5BA 3EN9A 5AQWA 5AQGA 4BRDA 2P9PB 4JKFA 3EL2A 3CCVN 3L4QA 3BUZB 4H03B 3WT0A 3J7ZO 4OPAA 5KQ8A 3H45C 2VYPA 5CHIA 3VERA 4WYBA 3C7NA 3MX5A 3C6HA 2P9KA 5FPEA 2CGJA 3FE1A 1S22A 4YORA 3LDQA 1YITN 1Q86O 5CR4A 2FF6A 3SAHA 4H0PA 1TYQA 2Q31A 3VOVA 3VTIA 3CIPA 4YOYA 3CJCA 1OVYA 3N4QA 3FZKA 2IVOA 3M3ZA 2V52B 5AQXA 4B1UB 4BQZA 3UKUA 3KK7A 4IO9L 3C6AA 3NVMA 5BPMA 3CXCM 2GWJA 4B1VA 3O9SA 3N4PA 1DKGD 2BTFA 4IO8A 3O8MA 4WF9L 2YJFA 3CMAN 2Q97A 2ZWHA 1RDWX 4JD2B 4JKEA 3KZBA 1O13A 1T6DA 5H1SQ 3EKSA 3QFPA 1Q7YO 3UKRA 5EY4A 1K8AO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FSK A;  2AP1 A;  4FWN A;  3EKU A;  2P9P A;  2QWR A;  3O1W A;  2A5X A;  1HUX A;  4B1W B;  3IFR A;  4BRL A;  4BRN A;  1T44 A;  3FZL A;  4BRI A;  2QWP A;  4I6M B;  5AQV A;  2P9I A;  4CZJ A;  2I7P A;  1R59 O;  4BGB A;  2F9W A;  2GEM A;  1HKC A;  2OAN A;  5AQJ A;  1RFQ A;  5ADX H;  4FOE A;  3FZM A;  2CH5 A;  2NLX A;  3MDQ A;  5KPR A;  4KBO A;  4BR4 A;  3WXK A;  3FZF A;  5AQI A;  5LJV A;  3H46 O;  4PKH A;  3ZX0 A;  5AQZ A;  3I8B A;  4BRH A;  3C7N B;  4BRG A;  3U8X A;  1DEJ A;  1TYQ B;  2FXU A;  3ENO A;  3ZX3 A;  4C23 A;  4BG9 A;  5KPZ A;  2E2P A;  4IJN A;  3HBT A;  3VGM A;  3R9P A;  1TUY A;  3IUC A;  1BA0 A;  3LL3 A;  3IMX A;  4IWV A;  4YDU A;  3O1B A;  3JXU A;  3QBX A;  3DXK A;  4XH1 A;  5FPM A;  3EZW A;  4JHD A;  1LCU A;  5JMV A;  2ASP A;  2QWM A;  2KHO A;  4GY2 B;  4O8K A;  3FR0 A;  3H1Q A;  3VEN A;  3D7E O;  3WXL A;  1QZ5 A;  1BUP A;  4CD3 A;  3QB0 A;  3H6E A;  5BRH A;  3CER A;  3JS6 A;  3WEE B;  3CJB A;  4H5R A;  4IZ9 A;  3B8A X;  5BRF A;  5LY3 A;  4BQL A;  5AQM A;  5BRD A;  1SAZ A;  4K25 A;  2QXL A;  4BR2 A;  2P9N B;  5LJW A;  5AQS A;  3HTV A;  4CJ7 A;  2V7Z A;  3D2F A;  1ATS A;  1LOT B;  4E1J A;  4FWS A;  1Y64 A;  5AQN A;  2E20 A;  3DWL A;  1MWM A;  4LC9 B;  2V51 B;  2VCP A;  1BWF O;  1GLD G;  3A8Y A;  3U9D A;  5BPN A;  1XQS C;  3CQY A;  1GLF O;  2Q36 A;  4A61 A;  4DHY A;  4FWR A;  2E1Y A;  3O08 A;  1GLL O;  3ZEU B;  1KXP A;  2EWS A;  1Q18 A;  3FLC O;  2E88 A;  4HTL A;  3RSE B;  2ZGY A;  1HLU A;  3IDH A;  3QML A;  2W40 A;  1YUW A;  2P9S B;  3H3N O;  3FZH A;  3VEY A;  4EAH D;  4BG8 A;  2IVP A;  4XH4 A;  2YHX A;  3MN5 A;  2YCH A;  5AQQ A;  4K42 A;  3ATU A;  2QM1 A;  2YHW A;  1E4G T;  1GLC G;  4FWQ A;  3MCP A;  1GLE G;  1GLB G;  5AFU A;  1D4X A;  4EHT A;  5AQT A;  4H5W A;  1NGE A;  3VGL A;  5AZI A;  4XEI A;  5KPT A;  1MA9 B;  2GWK A;  2HMP A;  1BOT O;  1C0G A;  1YVN A;  1X3N A;  4BRE A;  4F9O A;  4BRF A;  1GLA G;  1K8K B;  3CJ7 A;  4Z94 A;  3DAW A;  3ZX2 A;  5FPD A;  4JN4 A;  5EX5 A;  3VEZ A;  3SJH A;  1J6Z A;  2CH6 A;  1H1V A;  3CI5 A;  4WQ5 A;  1ATN A;  2ITM A;  3DXM A;  3MN7 A;  1NGB A;  5AFU H;  3WXJ A;  2GUP A;  1NGD A;  3WXI A;  2QW9 A;  3VEX A;  3ZEU A;  4L3Q A;  4M7X A;  3EO3 A;  4RTF D;  1NGA A;  4H0Y B;  4CBW A;  2H3G X;  5TKY A;  2GTD A;  4CBX A;  1E4F T;  3L4I A;  4PKI A;  4XH5 A;  3O80 A;  5E26 A;  3WQU A;  4EIA A;  4IJA A;  4BGA A;  3ZET B;  3CHW A;  2PAV A;  2E2O A;  2FSN A;  5AQY A;  1BDG A;  2FSJ A;  3D2E B;  2BUP A;  4Y0W A;  1OKJ A;  1RGI A;  1Z6R A;  5AZI B;  3HM8 A;  3MN6 A;  4BRC A;  1IG8 A;  4H0X B;  2HF4 A;  1MWK A;  2FLO A;  4BC4 A;  2E2Q A;  3R8E A;  3LDO A;  2D0O A;  2P9L B;  3QIC A;  4BRM A;  3AAQ A;  3L0Q A;  4MO5 A;  2E1Z A;  5AQL A;  4HWI A;  3MMV A;  4BR5 A;  5BR9 A;  3UB5 A;  3CJA A;  5KQD A;  1U2V A;  5B8H A;  3FFK B;  5JIC A;  4ISG A;  3VF2 A;  3A5M C;  2NZT A;  3CET A;  4H0O A;  4FO0 A;  5BN9 A;  4CZL A;  4JNE A;  1NGF A;  4DQ8 A;  3GDQ A;  5E84 A;  1X3M A;  1HJO A;  2CGK A;  4QS9 A;  4BC3 A;  5ELZ A;  2ASO A;  1SQK A;  5AZJ A;  2A3Z A;  2UYT A;  4BRA A;  3O5B A;  1IJJ A;  4BRK A;  2PBD A;  4A2A A;  3BF3 A;  2CGL A;  3A5N C;  3BEX A;  3HZ6 A;  1QHA A;  3GG4 A;  1GLJ O;  3QFU A;  4H5V A;  2GEL A;  4FWL A;  1ZC6 A;  3CQX A;  4EFH A;  2P9U B;  5EXW A;  3VES A;  4A62 A;  2P9I B;  4FPB A;  4I6M A;  1NWK A;  3BP8 A;  1ZXO A;  4WQ4 A;  5F2R A;  4K41 A;  3H3O B;  3TPQ A;  3W3D A;  4FWP A;  4GNI A;  4CZF A;  2D4W A;  3F9M A;  2D0P A;  4CZK A;  1HKG A;  1BO5 O;  1NGJ A;  2VWB A;  5ADX A;  1U2V B;  2YHY A;  3ULE A;  1KAZ A;  2HOE A;  3SMS A;  1YAG A;  4BVP A;  1G99 A;  5JLH A;  3LDN A;  4JD2 A;  2Q0U A;  2YI1 A;  5AQK A;  2E2N A;  1NBW A;  3LM9 A;  4PL7 A;  1NGG A;  1BU6 O;  3A0I X;  2Q0R A;  1X9J A;  3GL1 A;  3MK6 A;  3VEV A;  2NRH A;  1C0F A;  5AQU A;  5AZJ B;  4RCH A;  4CZE A;  5F0X A;  3ULE B;  4PL8 A;  3C0B A;  4QS7 A;  5FPN A;  5AR0 A;  1U6Z A;  1Z05 A;  3AAR A;  3LDP A;  2QWO A;  3VGK A;  4FSV A;  4B1X B;  4H0V B;  4MLE A;  1P8Z A;  1JCE A;  1QZ6 A;  2F9T A;  1QQM A;  3DXM B;  3DJC A;  4FWO A;  2AA4 A;  3MN9 A;  2D1K A;  4AM7 A;  4CBU A;  3M1F A;  2P9U A;  1WUA A;  2A40 A;  1NGI A;  5AQR A;  4A2B A;  4BR7 A;  4FWK A;  4O5F A;  2I7N A;  3KHY A;  3OHR A;  2HF3 A;  1NMD A;  3U9Z A;  2A42 A;  4PKG A;  1XC3 A;  3UKU B;  3KVG A;  1DGK N;  4AM6 A;  4CI6 A;  4FPA A;  3SK3 A;  3ATV A;  3SMP A;  2Q1N A;  3D2E A;  4CZG A;  1QQO A;  3O4W A;  3W0L A;  4ISE A;  1SZ2 A;  4ISF A;  5CE3 A;  2W41 A;  5AQF A;  5BPL A;  2FF3 B;  4J8F A;  1HPM A;  2Q2R A;  1V4T A;  3G25 A;  3QBW A;  5BN8 A;  1S3X A;  4H5T A;  4CZH A;  4JAX A;  2J4R A;  2P9S A;  4M7Y A;  4M63 C;  4JHD B;  4QS8 A;  4B9Q A;  3VEW A;  1NLV A;  1TUU A;  5AQP A;  4FWM A;  1K8K A;  3RSE A;  2V7Y A;  1JCF A;  5AQH A;  1NGC A;  4K43 A;  4BRP A;  1HX1 A;  1MDU B;  1WOQ A;  3GBT A;  2A41 A;  3S41 A;  3VPZ A;  4EHU A;  3UE5 A;  4DB3 A;  1NGH A;  1V4S A;  2A6A A;  2P9L A;  3TU5 A;  1BG3 A;  1BA1 A;  3HI0 A;  3VEO A;  3M6G A;  3D2F B;  3VET A;  2IVN A;  3R6M A;  4NO7 A;  4BC2 A;  1KAX A;  1YXQ A;  4RWT A;  3HSC A;  2P9K B;  3BF1 A;  3LDL A;  2QWN A;  1EQY A;  4BC5 A;  5F1X A;  2IIR A;  1CZA N;  2DPN A;  3LM2 A;  5EVZ A;  3U4L A;  3A5O C;  4FL9 A;  4CZM A;  4BR0 A;  4NB4 A;  1KAY A;  4BR9 A;  5AQO A;  4DCH A;  3P4I A;  1XUP O;  4WQ4 C;  3I33 A;  5EOY A;  3A5L C;  3GOI A;  2ASM A;  5I9E B;  4H5N A;  4BVO A;  3CJ1 A;  3QDK A;  3DXK B;  3ENH A;  2ZF5 O;  3AY9 A;  3VF6 A;  4B1Z A;  3UKR B;  2WUS A;  4BRQ A;  1JCG A;  3GE1 A;  3J8A A;  5JLF A;  1ZBS A;  3FGU A;  3L6Q A;  4MO4 A;  2E8A A;  1QQN A;  1ATR A;  4CZI A;  4WQ5 C;  3AAP A;  2QWQ A;  3CJ9 A;  4BRO A;  1NM1 A;  3WUH A;  3SLC A;  2ZGZ A;  2P9N A;  3H1V X;  4IXC A;  2QWL A;  3ZET A;  3ID8 A;  5BRE A;  3VF4 A;  4B1Y B;  4H0T B;  3WQT A;  1HKB A;  3WEE A;  1T6C A;  4YDU C;  1ESV A;  4FOI A;  3O6W A;  4CD1 A;  4MLH A;  2YJE A;  3EN9 A;  5AQW A;  5AQG A;  4BRD A;  2P9P B;  3EL2 A;  3BUZ B;  4H03 B;  3WT0 A;  5KQ8 A;  3H45 C;  2VYP A;  3VER A;  4WYB A;  3C7N A;  2P9K A;  5FPE A;  2CGJ A;  3FE1 A;  1S22 A;  3LDQ A;  2FF6 A;  4H0P A;  1TYQ A;  2Q31 A;  3VOV A;  3CIP A;  3CJC A;  4B1U B;  5AQX A;  3FZK A;  2IVO A;  3M3Z A;  2V52 B;  4BQZ A;  3UKU A;  5BPM A;  2GWJ A;  4B1V A;  1DKG D;  2BTF A;  4IO8 A;  3O8M A;  2YJF A;  2Q97 A;  2ZWH A;  1RDW X;  4JD2 B;  3KZB A;  1T6D A;  3EKS A;  3QFP A;  3UKR A;  5EY4 A; 
#chains in the Genus database with same CATH topology
 3JAM O;  4B8A B;  3CC2 N;  4FWN A;  2OZM A;  2QWR A;  2KLA A;  1HJR A;  4B1W B;  3FZL A;  4I6M B;  1TK5 A;  4CZJ A;  2I7P A;  2OAN A;  1TVR A;  5ADX H;  1VSK A;  2E6M A;  2ZJQ L;  2DFH A;  4BR4 A;  3FZF A;  3CCM N;  2HND A;  2QTD A;  4JKG B;  3AVM A;  3ZX3 A;  1DEJ A;  1TYQ B;  2FXU A;  3ENO A;  4C23 A;  4BG9 A;  3LAK A;  5KPZ A;  1DLO A;  4LF6 K;  2HHX A;  1HQU A;  4KTZ A;  1D8Y A;  2YNI A;  2GBZ A;  3R9P A;  3PX6 A;  2VWJ A;  4IWV A;  3JXU A;  3G71 N;  4JKC A;  1LAV A;  4JHD A;  3KD1 E;  1LCU A;  1VSF A;  2KHO A;  4O8K A;  2F8T A;  4JK8 A;  3D7E O;  3WXL A;  3S3M A;  3QB0 A;  4E19 A;  4AQY K;  3CJB A;  4IZ9 A;  4YOW A;  4FZX C;  1JLE A;  4XIU A;  5HRO A;  3SBG A;  3LAL A;  4DFJ A;  2NRW A;  1T05 A;  4CJ7 A;  4KO0 A;  1LOT B;  3V9W A;  2P1J A;  5KI6 A;  2RHK A;  1MU2 A;  1NOY A;  1Y64 A;  1XQS C;  4B9U A;  5HRN A;  1RBV A;  1YJW N;  3Q7B A;  1OH8 A;  1X1P A;  3V1Q A;  4DR4 K;  1VAZ A;  2EWS A;  1Q18 A;  3FLC O;  1UOC A;  3KD5 E;  3IDH A;  3QML A;  2W40 A;  1YUW A;  3H3N O;  1JXE A;  3E9P A;  4CGJ A;  2UUC K;  1Z26 A;  2GX9 A;  4Q0B A;  2YCH A;  4K42 A;  4Z4G A;  2KKZ A;  4FWQ A;  3SJJ A;  4CF2 A;  1JLC A;  1NK0 A;  3J80 O;  1T7P A;  5AZI A;  4DLG A;  3AGK A;  2GWK A;  4JK9 A;  1BOT O;  3IG1 A;  2XY5 A;  1C0G A;  1VQ6 N;  4CEF A;  3PSF A;  3AVA A;  3L2R A;  3K5O A;  2BGG A;  1GLA G;  5LL6 Z;  2ZJR L;  1H1V A;  4WQ5 A;  3CCS N;  2G8U A;  3HYF A;  1N36 K;  3AGR A;  1NGD A;  3WXI A;  4CIE A;  2YKN A;  3D0P A;  4H0Y B;  4LY7 A;  4CBW A;  3OW2 M;  2F7T A;  1JXB A;  4J2B A;  1E4F T;  5GAE P;  1JJ2 M;  3RRG A;  1B9D A;  2PAV A;  4C8O A;  3O9U A;  2QK9 A;  1TGO A;  1RGI A;  4WFB L;  2HF4 A;  3DMJ A;  1MWK A;  4NYN A;  4BC4 A;  3VMF B;  1Y97 A;  1NG9 A;  3LDO A;  4LF8 K;  3QIC A;  4BRM A;  3LPT A;  4CJE A;  4G1Q A;  3SQ0 A;  2E1Z A;  5AQL A;  3OS2 A;  4CGF A;  4KI6 A;  3NGY A;  4RW9 A;  3SBT A;  3NF8 A;  3CC4 N;  2NRT A;  3VQ5 A;  5KQD A;  4BE2 A;  1U2V A;  3FFK B;  1VHX A;  1A5W A;  5JIC A;  3RMC A;  3U6F A;  4LF5 K;  2NZT A;  3K58 A;  4FO0 A;  4CZL A;  4DQ8 A;  1B9F A;  2WFB A;  1X3M A;  2CGK A;  1Q8I A;  3Q7C A;  4H8K A;  4WCE L;  3M8R A;  1HNZ K;  5ELZ A;  1ILY A;  3MAQ A;  3DLB A;  3CFP A;  2UYT A;  5LMN K;  4BWJ A;  4BRA A;  3KTQ A;  4JI6 K;  1IJJ A;  3SQ1 A;  3SCX A;  4ID5 A;  3I8D A;  3P83 D;  4U67 L;  2UUB K;  1E3M A;  2BH1 A;  3SQ4 A;  1SS6 A;  3HZ6 A;  5JVH L;  3ZT3 A;  3VA3 A;  2JWL A;  3QFU A;  4DR7 K;  4N41 A;  2P9U B;  5EXW A;  5E41 A;  1EWQ A;  3CCU N;  1VSH A;  2UUA K;  2YV0 X;  4GNI A;  3O9R A;  3VQ7 A;  3MXJ A;  2HHU A;  1BO5 O;  3I56 N;  3IRX A;  2RE2 A;  5EU7 A;  4FZZ A;  3EEQ A;  1KAZ A;  3PY8 A;  1KD1 O;  4JI0 K;  3K9J A;  4KTW A;  3P1G A;  4DV3 K;  1DTT A;  3O3H A;  4M45 A;  3OYN A;  3V9S A;  3A0I X;  1BU6 O;  3THX B;  1TK8 A;  1X9J A;  3DLE A;  4NLB A;  3CCE N;  4GVE A;  3TAG A;  1OH6 A;  5AZJ B;  4YFU A;  1RDA A;  1XNR K;  1RT1 A;  4LFC K;  4CJU A;  2BAN A;  5GIO A;  1SKS A;  1SKW A;  3L8B A;  3LDP A;  3THY B;  4H0V B;  1P8Z A;  4UY8 O;  3CME N;  3DXM B;  4E3S A;  1KLN A;  2O4G A;  4FWO A;  3SPY A;  1ASV A;  1KC8 O;  3PUF A;  2VQF K;  2A40 A;  1ZBF A;  5A2Q O;  5CZ2 A;  1NK6 A;  3KHY A;  4AHU A;  4PKG A;  1XC3 A;  1WNS A;  2FBV A;  4QCL A;  4DV0 K;  4AF1 A;  3SK3 A;  2Q1N A;  1I94 K;  4CZG A;  2AJQ A;  3O4W A;  4IOX A;  4NLC A;  5I42 A;  1RDB A;  1N6Q A;  4A59 A;  4W5Q A;  4DTO A;  2FF3 B;  4FM0 A;  1S1W A;  1GOB A;  4I9L A;  3IS9 A;  3M8Q A;  5BN8 A;  3WNH A;  2XRI A;  3WXM B;  4M7Y A;  4DV4 K;  4JHD B;  4B9Q A;  3OYL A;  1S6Q A;  4B9N A;  1NLV A;  5AQP A;  3RSE A;  1K8K A;  3AVG A;  5AQH A;  4BRP A;  2NRV A;  3CFR A;  4M3Y A;  4DSI A;  3OVN A;  1NGH A;  2FBY A;  2A6A A;  3UIQ A;  2KTQ A;  3V4I A;  4DUZ K;  3HI0 A;  4E1N A;  3DLG A;  1IBM K;  3TAE A;  4E89 A;  5T7B A;  3QIN A;  1RIL A;  1IKY A;  2IIR A;  5EVZ A;  4CGH A;  2PY5 A;  4FL9 A;  4J2D A;  4NB4 A;  2Z1G A;  2G8K A;  3K2P A;  1C1A A;  3DRR A;  4BR9 A;  2WON A;  4DCH A;  3QNO A;  4WQ4 C;  3A5L C;  3CM6 A;  3GOI A;  2HBL A;  3CJ1 A;  4F8R A;  4B3R K;  3QDK A;  1U4B A;  3ENH A;  4B1Z A;  1NOZ A;  3HL8 A;  1JCG A;  1RNH A;  3EZ5 A;  1W0H A;  3MCA B;  1BI4 B;  5J2Q A;  2UXD K;  1IG9 A;  4F3T A;  5HLF A;  1ATR A;  4HVJ A;  4OVL A;  3AAP A;  3NHG A;  4CJP A;  4BRO A;  2KZM A;  4FJG A;  4KH5 A;  3V9U A;  1DTQ A;  2Z1J A;  3TSU A;  4IXC A;  2IS3 A;  5BRE A;  3HK2 A;  2JLE A;  1KSP A;  1BQM A;  1VSL A;  2YHB A;  1P90 A;  3WQT A;  1L3T A;  4YDU C;  2JGU A;  4I2Q A;  1UA1 A;  4MLH A;  1QVG M;  3DOK A;  2BDP A;  4W5T A;  2IOC A;  3L4Q A;  4H03 B;  5FDL A;  3THY A;  4OPA A;  3H45 C;  1BL3 A;  3ZSQ A;  4AHS A;  2KFZ A;  3S3N A;  2O8C A;  4KI4 A;  3C6H A;  1A5V A;  3FE1 A;  1S22 A;  3LDQ A;  4B3S K;  3MXI A;  1ZBH A;  3L2W A;  5CR4 A;  4H0P A;  3HXM A;  3KK2 A;  4AHV A;  1BCM A;  4DUY K;  1NK7 A;  4DQI A;  4BQZ A;  4B08 A;  4CGI A;  3TAF A;  3O8M A;  2Q97 A;  5K14 A;  3OTO K;  2ZWH A;  4FCY A;  3KZB A;  1JL2 A;  4M3X A;  4Y1C A;  5H1S Q;  4DV2 K;  3QEW A;  1K8A O;  2YKM A;  3O4Q A;  3SYZ A;  4JYA K;  1N33 K;  4E7L A;  4C8K A;  4GW6 A;  1HUX A;  4BRN A;  3ZSR A;  3CM5 A;  4IKF A;  4BGB A;  4DS5 A;  1LW2 A;  2HHT A;  1RFQ A;  1VK0 A;  3BZK A;  5DM7 L;  3MXM A;  4Y1D A;  1KRP A;  4FOE A;  3FZM A;  2NLX A;  3MDQ A;  3MX2 A;  3THW B;  4CF9 A;  5AQI A;  4LSL A;  4PKH A;  3ZX0 A;  3I8B A;  2VGN A;  4BRH A;  2Q3S A;  4BRG A;  3WNF A;  1BIZ A;  2Y1I A;  2E2P A;  3VGM A;  4OX9 K;  1VQM N;  4Z0U A;  3DRS A;  1J53 A;  4YDU A;  3DXK A;  2ZM6 K;  1K73 O;  4CHP A;  3NF6 A;  5JMV A;  1HYS A;  2ITG A;  4DSE A;  1YJ9 N;  4Q5V A;  3AO3 A;  2QWM A;  4GY2 B;  3H1Q A;  3L2Q A;  3CPW M;  2FC0 A;  2GV9 A;  1DT9 A;  4BDP A;  4NCB A;  3NH2 A;  1BUP A;  4EP4 A;  3PO4 A;  5BRH A;  1NMN A;  4CHQ A;  3WEE B;  1X9M A;  5KTQ A;  4H5R A;  1R0A A;  3SUO A;  4BQL A;  4J2E A;  1SAZ A;  4K25 A;  4LF9 K;  4CHO A;  2P9N B;  5LJW A;  4DR1 K;  2OA8 A;  1ATS A;  4GVM A;  1TV6 A;  4FYD A;  4OPH A;  4FM1 A;  3RMB A;  5J2P A;  4RG8 A;  4BWM A;  3A8Y A;  5BPN A;  3U9D A;  4F2R A;  4A61 A;  2I5J A;  3TTF A;  2E1Y A;  2WOM A;  2XO7 A;  3HM9 A;  5C12 A;  3O08 A;  4CK2 A;  1GLL O;  4DV7 K;  1FXX A;  3MEG A;  3NF9 A;  1N5Y A;  2ZE2 A;  3CC7 N;  3V1R A;  3VEY A;  2YHX A;  3MN5 A;  3ATU A;  2YHW A;  3MCP A;  1D4X A;  4I2P A;  3LWM A;  4ID1 A;  1NGE A;  4HHT A;  1JLQ A;  1WSE A;  4IOC L;  4NCA A;  2JWK A;  5C42 A;  4CJS A;  1VQP N;  3U3G A;  4BRF A;  1BI4 A;  3CJ7 A;  2YNH A;  3DAW A;  4JS4 A;  5EX5 A;  3VEZ A;  3SJH A;  3TR8 A;  3VQP A;  3DXM A;  3MN7 A;  2DFE A;  4OKE A;  2GUP A;  4I7F A;  3WXJ A;  3L3U A;  4BE0 A;  3PX0 A;  5C10 A;  4JI4 K;  4M7X A;  5J2M A;  1CLQ A;  5TKY A;  1N8R O;  2GTD A;  1RCH A;  1NKE A;  3L4I A;  4PKI A;  4M3R A;  4CJF A;  2Z1H A;  3BZC A;  5HRR A;  5M1K A;  3WQU A;  4CJL A;  4EIA A;  4KHW A;  4IJA A;  4BGA A;  3ZET B;  1LV5 A;  3TTD A;  1XMO K;  1BDG A;  2FSJ A;  4KKO A;  2BUP A;  4RW7 A;  2B4J A;  1Z6R A;  2YX6 A;  3HPG A;  5DK5 A;  4CJV A;  1KTQ A;  2D0C A;  3AVJ A;  3F2K A;  1HQE A;  1YI2 N;  1TAU A;  3RVC A;  4IDK A;  3L0Q A;  3HT3 A;  4CJK A;  3MED A;  5BR9 A;  4DR3 K;  4DG1 A;  3T1Y K;  1BHL A;  3CET A;  4H0O A;  5BN9 A;  4JNE A;  1NGF A;  4M3Z A;  1REV A;  3V9Z A;  2HST A;  3HRG A;  3O9T A;  1U45 A;  4QS9 A;  3NAE A;  4E1M A;  3VN5 A;  3KLI A;  3VQ6 A;  1OH5 A;  4KHP K;  2A3Z A;  3QEI A;  4KRE A;  3O5B A;  4FZY A;  4BRK A;  2O8B A;  4R5P A;  1VRT A;  2O8C B;  1CZ9 A;  2X78 A;  3A5N C;  1T8E A;  4J2A A;  3VTH A;  4B3O A;  4H5V A;  1GLJ O;  1HNI A;  1NU0 A;  3OYM A;  1VQ9 N;  2GEL A;  4E7I A;  4A5A A;  3CQX A;  4EFH A;  4FPB A;  4I6M A;  1NWK A;  3HST B;  1WB9 A;  1IKV A;  4K41 A;  2W42 A;  4CZF A;  4JKA A;  3C95 A;  4CW7 B;  3QLH A;  3QET A;  3OYB A;  1RT7 A;  3SUP A;  2VGM A;  2VWB A;  5ADX A;  3KKR A;  2YHY A;  1VQN N;  4X64 K;  1HPZ A;  3ZT4 A;  1X9W A;  3SMS A;  1G99 A;  3LDN A;  3ZCM A;  4DSL A;  1VSM A;  2Q0U A;  2YI1 A;  4FM2 A;  1IBL K;  5FRO A;  2D0B A;  5KGW A;  4DWI A;  5LMU K;  5M1N A;  5GAH P;  4N47 A;  1XI1 A;  3MK6 A;  3GL1 A;  3ZSV A;  5C15 A;  4OO1 J;  4GKK K;  3QEP A;  1FKO A;  2KQ2 A;  4LFA K;  1RTJ A;  3RWU A;  2PFU A;  4LF4 K;  4CZE A;  2XY7 A;  5FPN A;  3C0B A;  1U6Z A;  3AAR A;  4B1X B;  3VGK A;  1NNE A;  4DTM A;  3LZJ A;  1YHQ N;  3DJC A;  1VRU A;  3C94 A;  1HRH A;  2D1K A;  4DV5 K;  4CGG A;  4H4O A;  5DMR A;  4CE9 A;  2HF3 A;  1BIU A;  2VWK A;  1NJW A;  3MEC A;  3THX A;  4DTS A;  3KVG A;  2G8F A;  1YIJ N;  4ILH A;  4AM6 A;  4C1N I;  2G8I A;  3HO1 A;  4ISE A;  4ISF A;  4O8U A;  3LDS A;  1QE1 A;  1YF5 L;  3ZSZ A;  1S1T A;  5CYQ A;  3M5R A;  3QBW A;  2Y1J A;  2HHH K;  3SZ2 A;  3AO5 A;  4KH4 A;  4QS8 A;  3VEW A;  1U04 A;  3QIO A;  2UXC K;  3VQC A;  3T69 A;  1JCF A;  4C8M A;  5D3G A;  1MDU B;  1WOQ A;  1C6V A;  2O8D B;  1S1V A;  4O55 A;  4KB1 A;  2G8W A;  5CY4 A;  1EP4 A;  3KIO A;  3VPZ A;  4JV5 K;  2O8F A;  3UE5 A;  5HL7 L;  4FVM A;  3PLA A;  3VQ4 A;  4FK4 A;  3RMD A;  3TU5 A;  1BG3 A;  3P5J A;  3M8P A;  3DI6 A;  3HVT A;  4DSF A;  4PUO A;  2VG7 A;  1YTU A;  5JS1 A;  3VEO A;  4ILJ A;  4DF4 A;  4WFA L;  3R6M A;  5C2F A;  4NO7 A;  1BCO A;  3HSC A;  2P9K B;  3BF1 A;  4FLT A;  4GKJ K;  1D5A A;  1CZA N;  4CZM A;  1VSD A;  1B92 A;  5C0Y A;  1KAY A;  5AQO A;  3P4I A;  2QXF A;  2YHA A;  1SUQ A;  2YNG A;  4F3O A;  3TAP A;  2HHS A;  3AVK A;  3QO9 A;  4BRQ A;  3T19 A;  3J8A A;  1ZBS A;  4X62 K;  4DMN A;  5M1Q A;  3WNG A;  4MO4 A;  2W6L A;  1QHT A;  5CZ1 A;  2UXB K;  1NKB A;  2HMI A;  1IKX A;  3TI0 A;  4LFB K;  4FJH A;  1NJY A;  3WUH A;  3KLE A;  2ZGZ A;  2P9N A;  4KB0 A;  2VG6 A;  1XNQ K;  2QWL A;  3ZET A;  3ULD A;  4BY9 C;  4JLH A;  4F2S A;  3OJS A;  3VF4 A;  4CIG A;  3F73 A;  1ESV A;  4JS5 A;  3RR8 A;  4CD1 A;  3EN9 A;  3SI6 A;  3EY1 A;  1NK4 A;  4BRD A;  5HRP A;  3PX4 A;  4DTU A;  1EWR A;  3SUQ A;  2HB5 A;  4FW2 A;  2B5J A;  3OYE A;  2VYP A;  4O44 A;  5CHI A;  3VER A;  3LZI A;  3C7N A;  3MX5 A;  2DY4 A;  4BDY A;  1ZBI A;  2D5R A;  3M8S A;  3DYA A;  3TAR A;  2FF6 A;  4YY3 K;  4YOY A;  2Q31 A;  3CIP A;  4CHN A;  4B1U B;  3CJC A;  1OVY A;  3UKU A;  4IO9 L;  3C6A A;  3NVM A;  3CXC M;  2GWJ A;  4B1V A;  3THW A;  1DKG D;  4OPJ A;  1RDW X;  4JKE A;  4CJW A;  4JRQ A;  3DM2 A;  3I0R A;  1N32 K;  1O13 A;  3EKS A;  1Q7Y O;  3UKR A;  4N76 A;  3AVI A;  3EKU A;  2NRX A;  3LP2 A;  3ZYY X;  3OY9 A;  5J1E A;  1RT4 A;  4BRL A;  3IFR A;  4BDZ A;  3OYH A;  3ZLJ A;  4JI2 K;  4BRI A;  3AO4 A;  3KK3 A;  2QWP A;  5AQV A;  1R59 O;  4M41 A;  2F9W A;  3L3V A;  2GEM A;  5HOO A;  5BR8 K;  4F4K A;  4LH4 A;  4B3T K;  4LH5 A;  3WXK A;  3C7N B;  1FKP A;  3CCL N;  2HBJ A;  4ILG B;  4IJN A;  3HBT A;  3TSP A;  2NRR A;  3IUC A;  1BA0 A;  3LL3 A;  3IMX A;  5SWM A;  1KQS M;  1WN7 A;  2OTJ N;  3QBX A;  3C6T A;  4XH1 A;  1WSI A;  4W5N A;  4B9L A;  4CFD A;  4W5R A;  3G4S N;  4WFN L;  3QEV A;  1FJG K;  5DM6 L;  3VEN A;  1BGX T;  1QZ5 A;  4DSK A;  4CD3 A;  1WBD A;  3H6E A;  4FLZ A;  3CER A;  2FBT A;  4LSN A;  1T03 A;  4ZTJ A;  5LY3 A;  3B8A X;  3P31 A;  5AQM A;  4W5O A;  4CIF A;  3HTV A;  5C2D A;  2OPP A;  3CD6 N;  4E1J A;  4FWS A;  2E20 A;  4JK7 A;  2DFF A;  3DWL A;  1KFD A;  5FLX O;  2V51 B;  4Z4E A;  1BWF O;  1GLF O;  4DHY A;  3AA2 A;  4WE1 A;  2WC9 A;  1LWF A;  1IH7 A;  4MQ3 A;  3ZEU B;  1KXP A;  3RSE B;  4E7H A;  4RW6 A;  2UU9 K;  2P9S B;  1Q9X A;  4FXD A;  1F21 A;  3FZH A;  3NE6 A;  3LWL A;  3E9O A;  2IVP A;  4XH4 A;  5AQQ A;  3KLH A;  4L8R B;  3SAF A;  5FRN A;  5MLC Q;  2QM1 A;  3OYD A;  1E4G T;  1GLE G;  1GLB G;  4FK0 A;  5AFU A;  2OPS A;  4EHT A;  4H5W A;  3VGL A;  4CEQ A;  2P5O A;  4XEI A;  1MA9 B;  1NK5 A;  4K0K K;  2HMP A;  3BGR A;  1WSG A;  3CF5 L;  2XY6 A;  1EO1 A;  4KH6 A;  4DTJ A;  4BRE A;  4F9O A;  1I39 A;  1K8K B;  5I3U A;  1KVC A;  1UAX A;  4CJQ A;  4Z94 A;  5KRT A;  2HBM A;  3ZX2 A;  4CEB A;  4PA1 A;  1WSJ A;  2CH6 A;  1QQC A;  3CI5 A;  2ITM A;  1ATN A;  1JLF A;  1NGB A;  5AFU H;  2QW9 A;  3IKM A;  3B6P A;  3EO3 A;  1NGA A;  3DOL A;  1C1B A;  4FJ8 A;  4CBX A;  2O4I A;  3AVN A;  1RBT A;  4XH5 A;  1JKH A;  3TAQ A;  5E26 A;  1TKX A;  4K8X A;  4DV6 K;  5AQY A;  2FSN A;  4DS4 A;  5AJ3 K;  4Y0W A;  3ZSY A;  4BRC A;  1NK8 A;  3HM8 A;  1T3V A;  1IG8 A;  4H0X B;  1WSH A;  5GAD P;  2FLO A;  2D0O A;  4E0D A;  1RT6 A;  4CHZ A;  1WBB A;  4FJ9 A;  4HWI A;  1HNV A;  4OGE A;  3UB5 A;  3CJA A;  4OLB A;  3O9Q A;  1ZYQ A;  1RBR A;  1K6Y A;  4ISG A;  4KRF A;  3FFI A;  1S1X A;  2LSN A;  4N56 A;  4FLW A;  5E84 A;  3ALY A;  1HJO A;  4AH9 A;  3AVF A;  4FLV A;  2OPQ A;  3ZSW A;  1SQK A;  1QS4 A;  4JKH A;  3AA3 A;  5AZJ A;  5HP1 A;  3NDK A;  4DQQ A;  3HJF A;  3ITH A;  3T1A A;  2NNW A;  5KGX A;  4YOV A;  3DLL L;  1VSE A;  3C6U A;  3P39 A;  2HVH A;  2A1R A;  3K59 A;  2IC3 A;  1J5E K;  1S9G A;  3AO2 A;  3BF3 A;  1RBS A;  2CGL A;  4DLE A;  3KLG A;  4DTP A;  3BEX A;  4ELV A;  4G9Z A;  4CFC A;  4B9M A;  4FWL A;  1ZC6 A;  4CEE A;  2F8S A;  2P9I B;  1ASW A;  4RW4 A;  1RTI A;  3BP8 A;  3V6D A;  1ZXO A;  2OTL N;  4WQ4 A;  5F2R A;  2X6S A;  3H3O B;  3TPQ A;  2QI2 A;  4FWP A;  3LAM A;  4KHN A;  2D4W A;  4CZK A;  4DTX A;  4MDB A;  3QIP A;  1U2V B;  3TAB A;  3K5N A;  1VQK N;  2HOE A;  1LWC A;  2X74 A;  4BVP A;  4JD2 A;  3K57 A;  2E2N A;  4EZ9 A;  1NBW A;  4PL7 A;  2O8B B;  5M1F A;  3NGZ A;  3OYK A;  3HVR A;  1TKT A;  3HOT A;  3NMU A;  2NRH A;  3TTC A;  4KAZ A;  5GIN A;  3VA0 A;  2OYQ A;  3VQQ A;  1J5O A;  2E4L A;  4GV3 A;  1XHX A;  2EHG A;  3KJV A;  4HUF A;  4PL8 A;  4QS7 A;  1NJI O;  1KVB A;  2NRZ A;  1C0M A;  2YNF A;  3G6E N;  2NUB A;  3JYT A;  1S5J A;  2QWO A;  4JKB A;  1W9H A;  4JI1 K;  4KV8 A;  4AHC A;  3K5M A;  4B3M K;  2P5G A;  1JCE A;  1QZ6 A;  3AVH A;  4MDA A;  4U7B A;  3NGI A;  4HUG A;  4CBU A;  3M1F A;  3CCJ N;  4DR2 K;  2P9U A;  1WUA A;  1NGI A;  1D9D A;  3MWP A;  3K5L A;  4A2B A;  1VQ8 N;  4UQG A;  4O5F A;  1KCF A;  4A57 A;  3B6O A;  3J7Y P;  3OHR A;  3K9K A;  4FJM A;  2A42 A;  4Z4C A;  3UKU B;  4B8C A;  3CFO A;  2HHV A;  4JI5 K;  4FPA A;  3ATV A;  4B9V A;  4IOA L;  1QQO A;  3U3Y A;  1EXQ A;  1SZ2 A;  5CE3 A;  2W41 A;  1XC9 A;  4M3W A;  5M1O A;  4CFB A;  5BPL A;  2P51 A;  3EE9 A;  2VG5 A;  4C1N K;  4NCG A;  1RDC A;  4M3T A;  2Q2R A;  4I9Q A;  1V4T A;  3DLR A;  3S9H A;  1S3X A;  4CZH A;  3I55 N;  1RDD A;  4OJR A;  2FBX A;  1YT3 A;  1NK9 A;  4M63 C;  3AA5 X;  3QES A;  3DRP A;  4FWM A;  3G10 A;  1NGC A;  3PIP L;  1HX1 A;  2RF2 A;  1TL3 A;  3AVB A;  5HRS A;  3GBT A;  3S41 A;  3AVC A;  2P9L A;  4KHY A;  3M6G A;  1EKE A;  3VET A;  2IVN A;  1L3V A;  2QEX N;  4BC2 A;  3LDL A;  1EQY A;  2HBK A;  2XY8 A;  3J7A P;  5F1X A;  4KPY A;  3U4L A;  3LM2 A;  2HHW A;  1JLB A;  4LD0 A;  3PSI A;  4QOZ B;  1QSS A;  4PQU A;  4CER A;  2ASM A;  1KLM A;  4H5N A;  4PHT X;  3HOS A;  4BVO A;  4BE1 A;  3ID6 A;  5J2N A;  1TKD A;  1M1K O;  2ZF5 O;  1QVF M;  3VF6 A;  2ATQ A;  3UKR B;  3NCI A;  3AA4 A;  2WUS A;  4BAC A;  1YTA A;  4IDH A;  4K8Z A;  2IAJ A;  3SUN A;  4O4G A;  3FGU A;  3DLH A;  2E8A A;  1CXQ A;  4WQ5 C;  3I0S A;  3KK1 A;  3CJ9 A;  3VQA A;  4DFM A;  4IG3 A;  1NM1 A;  3SLC A;  4CEO A;  4O5B A;  2PZS A;  1N34 K;  1S72 N;  3ID8 A;  4B1Y B;  4H0T B;  1HKB A;  4ICL A;  3WEE A;  4Z4F A;  1GOA A;  5TKW A;  3O6W A;  4A5B A;  1IO2 A;  1WAF A;  5JS2 A;  4O0I A;  2KZZ A;  5AQG A;  3SQ2 A;  5KRS A;  4C8N A;  4DF8 A;  1XHZ A;  1WSF A;  3EL2 A;  3WT0 A;  4EP5 A;  2O8E A;  1JL1 A;  2P9K A;  5FPE A;  1YIT N;  1Q86 O;  4OLA A;  1TYQ A;  3WNE A;  3D45 A;  3N4Q A;  3FZK A;  2IVO A;  3M3Z A;  1A5X A;  2V52 B;  3KK7 A;  4PWD A;  5BPM A;  4JI3 K;  3N4P A;  2BTF A;  4CGD A;  3CMA N;  2YJF A;  4JD2 B;  1O1W A;  3VQE A;  2XHB A;  1SL0 A;  1T6D A;  4Z4H A;  3QFP A;  2G8H A;  1TKZ A;  2FSK A;  3CPE A;  1HNW K;  2AP1 A;  1HYV A;  2X6N A;  3R1X A;  2P9P A;  2PYJ A;  4HCB A;  2HHQ A;  3O1W A;  4KHS A;  3KWG A;  2ZD1 A;  2A5X A;  4DU4 A;  4JKD A;  1T44 A;  4H4M A;  3NFA A;  4CFA A;  2P9I A;  5IT9 O;  3K0S A;  1KFS A;  3LPU A;  1C1C A;  1HKC A;  5AQJ A;  3OYA A;  1SL2 A;  4NXN K;  2KW4 A;  4M3U A;  1Q82 O;  4AHT A;  1HMV A;  2CH5 A;  4O0J A;  4CEZ A;  5KPR A;  4KBO A;  4CVN E;  3ZT1 A;  4CED A;  5LJV A;  1VQL N;  2HW3 A;  3H46 O;  1HYZ A;  3T7Z A;  5AQZ A;  3ZT0 A;  3RTV A;  3U8X A;  4YHH K;  4IFV A;  4OPK A;  1NJZ A;  2OCE A;  4C8L A;  4YOU A;  1TUY A;  3CCQ N;  4CJ5 A;  4DTR A;  4RW8 A;  5C25 A;  3O1B A;  3VQD A;  3VQ8 A;  1YVU A;  5FPM A;  3CQ8 A;  3EZW A;  1ITG A;  2ASP A;  2R7Y A;  1WLJ A;  1WAJ A;  3FR0 A;  2HNY A;  1NKC A;  2D0A A;  3JS6 A;  5BRF A;  2WTU A;  4GMJ B;  4R79 A;  3NVK A;  5BRD A;  3HPH A;  1VQ7 N;  3EE8 A;  1FW6 A;  2QXL A;  4BR2 A;  4JKG A;  5AQS A;  4CES A;  2V7Z A;  3D2F A;  4LF7 K;  4B9T A;  5M1P A;  5AQN A;  1S9E A;  1MWM A;  4LC9 B;  2VCP A;  1GLD G;  3CQY A;  2Q36 A;  4FWR A;  4CJ4 A;  3DLK A;  4IEE A;  2GUI A;  3JSM A;  4B9S A;  4IEI A;  4OKJ A;  1C0U A;  2E88 A;  4HTL A;  2ZGY A;  1HLU A;  3IAY A;  1HR0 K;  1W97 L;  4IFY A;  4DTN A;  4GV9 A;  2E5L K;  4EAH D;  4BG8 A;  3PIO L;  4KHQ A;  3T3F A;  3O3G A;  1GLC G;  2EX3 A;  1IBK K;  3OBW A;  1RTH A;  3BDP A;  4DQR A;  5AQT A;  4TSX A;  4HCC A;  4CK3 A;  5KPT A;  3ISN C;  2IGI A;  4M42 A;  1CZB A;  1YVN A;  1NJX A;  1QSY A;  1X3N A;  4IG0 A;  1KVA A;  3C65 A;  5FPD A;  5IWA K;  4JN4 A;  3SV4 A;  1J6Z A;  3KWI A;  1M90 O;  3E01 A;  4PY5 A;  3AV9 A;  1Q81 O;  3OS1 A;  1W7A A;  3VEX A;  4FJ7 A;  3ZEU A;  1RT3 A;  4L3Q A;  3OA9 A;  4RTF D;  1UA0 A;  2H3G X;  1RTD A;  3E66 A;  1EX4 A;  3F5T A;  3T1H K;  2RKI A;  1FK9 A;  3L2V A;  3O80 A;  3CHW A;  1RBU A;  2E2O A;  2OZS A;  3TAM A;  3D2E B;  1OKJ A;  3KKS A;  5AZI B;  4JEP A;  3MN6 A;  4E7J A;  4NXM K;  2E2Q A;  1YJN N;  3R8E A;  2P9L B;  2O8E B;  3AAQ A;  4MO5 A;  4N5S A;  2A1S A;  4IBN A;  3MMV A;  4BR5 A;  3F9K A;  4JRP A;  4FJN A;  3V81 A;  3RRH A;  1RT2 A;  5B8H A;  3OS0 A;  3QER A;  3CG7 A;  4CK1 A;  1IV0 A;  3VF2 A;  3NF7 A;  3KLF A;  3TAN A;  1GOC A;  3A5M C;  3MWT A;  1TAQ A;  4CEA A;  3GDQ A;  1SKR A;  3LAN A;  3H08 A;  4YOT A;  2G8V A;  4FJK A;  4X66 K;  4BC3 A;  2ASO A;  3HPO A;  1I3A A;  3E9L A;  2ZQB A;  3OBY A;  1L3U A;  1SL1 A;  3CCR N;  3VQB A;  1L5U A;  2PBD A;  4A2A A;  3OYI A;  3OYF A;  1QHA A;  3GG4 A;  3R3L A;  3VES A;  4A62 A;  4FJJ A;  4AHR A;  4FJI A;  3TSQ A;  3OJU A;  1C0T A;  2RPI A;  4DQP A;  3D6R A;  3W3D A;  4CCH A;  4ELT A;  4FJL A;  1G15 A;  3F9M A;  2D0P A;  1HKG A;  2F4V K;  4Z4I A;  1NGJ A;  4YOX A;  1LWE A;  2BE2 A;  3ULE A;  1LAW A;  1YAG A;  5JLH A;  1U49 A;  5AQK A;  3SNN A;  4OKK A;  2E6L A;  2KFN A;  3LM9 A;  4CEC A;  1NGG A;  2B6A A;  2Q0R A;  1LW0 A;  3VEV A;  1ZBU A;  1C0F A;  3BY5 A;  1OH7 A;  1U47 A;  5AQU A;  4NYF A;  1OVQ A;  1TK0 A;  4RCH A;  1S1U A;  3ZT2 A;  1XMQ K;  3ZSX A;  4DSJ A;  5F0X A;  3ULE B;  4HUE A;  5AR0 A;  3MEE A;  4FJ5 A;  3RMA A;  2PYL A;  3SPZ A;  1Z05 A;  3HP6 A;  4FSV A;  4MLE A;  4ZHR A;  4KFB A;  5C24 A;  2F9T A;  4HTU A;  1QQM A;  2AA4 A;  3MN9 A;  4AM7 A;  4CJT A;  5AQR A;  4BR7 A;  4FLX A;  4FWK A;  3A2F A;  3THV A;  2I7N A;  3V9X A;  3AO1 A;  4KTQ A;  4ELU A;  4ZTF A;  3EYZ A;  3NBP A;  1NMD A;  3U9Z A;  5GAG P;  2W6K A;  2DTU A;  3LP1 A;  1DGK N;  4CI6 A;  4X65 K;  3SMP A;  3D2E A;  4JI8 K;  1Q9Y A;  3PO5 A;  3W0L A;  4GV6 A;  5AQF A;  1X9S A;  5GIP A;  3QNN A;  4J8F A;  2O8F B;  1HPM A;  3ZSO A;  3SAG A;  2HVI A;  3G25 A;  4H5T A;  1RDU A;  3RR7 A;  5HBM A;  3J81 O;  1RT5 A;  1UWB A;  4JAX A;  2J4R A;  4CJR A;  1EET A;  2P9S A;  4CF8 A;  1D9F A;  3P38 A;  4DR5 K;  4JI7 K;  1TUU A;  2V7Y A;  4DKW A;  4K43 A;  1W2B M;  3ASM A;  4YNQ A;  2A41 A;  4EHU A;  5SZT A;  4DB3 A;  1ASU A;  1V4S A;  4DV1 K;  1ZBL A;  4DU3 A;  4E7K A;  1BA1 A;  5JVG L;  4OGC A;  4DU1 A;  3D2F B;  4RWT A;  1KAX A;  1YXQ A;  1QTM A;  4DFP A;  2QWN A;  4BC5 A;  2O8D A;  3HP9 A;  4MFB A;  2DPN A;  2WBN A;  1SV5 A;  3A5O C;  3CYM A;  4BR0 A;  3L2U A;  4FJX A;  1K9M O;  1VSJ A;  1XUP O;  3I33 A;  5EOY A;  5I9E B;  4AIL C;  3DXK B;  3AY9 A;  1J9A A;  3E1Y A;  3GE1 A;  3V1O A;  5JLF A;  2IDO A;  3OYG A;  1VSI A;  4FVU A;  4DR6 K;  3L6Q A;  4FW1 A;  1QQN A;  4CZI A;  4CF1 A;  1JLA A;  2QA4 N;  4CF0 A;  4KHU A;  3LP3 A;  1CXU A;  2QWQ A;  3O4N A;  1VQO N;  2ZJP L;  4DFK A;  3PV8 A;  3SV3 A;  3H1V X;  3QEX A;  4EZ6 A;  1VQ4 N;  1QSL A;  3NH1 A;  3G0Z A;  4FK2 A;  4FLU A;  3ENB A;  3LP0 A;  4CHY A;  2RN2 A;  1T6C A;  1L3S A;  1JLG A;  4IFE A;  4CJ3 A;  3S3O A;  4FOI A;  1U48 A;  2OPR A;  1BIS A;  1XWL A;  2YJE A;  3NH0 A;  1J54 A;  2F96 A;  3OYC A;  5AQW A;  1HNX K;  2P9P B;  4JKF A;  2Z1I A;  3CCV N;  3BUZ B;  3J7Z O;  5KQ8 A;  2QKK A;  4WYB A;  3OYJ A;  3TWH A;  2HNZ A;  3VQ9 A;  2CGJ A;  4YOR A;  4DQS A;  4FLY A;  3SAH A;  3VTI A;  4QAG A;  3VOV A;  1TL1 A;  1VQ5 N;  5AQX A;  2QKB A;  5CYM A;  1IKW A;  3O9S A;  2VQE K;  4V19 S;  4IO8 A;  4WF9 L;  2ETJ A;  1S6P A;  3O3F A;  1Z25 A;  5EY4 A;  3AVL A;  5FRM A;  1BQN A; 
#chains in the Genus database with same CATH homology
 2FSK A;  3CPE A;  2AP1 A;  3CC2 N;  4FWN A;  3EKU A;  3R1X A;  2NRX A;  2P9P A;  3ZYY X;  2QWR A;  3O1W A;  3KWG A;  2KLA A;  2A5X A;  1HUX A;  4B1W B;  3IFR A;  4BRL A;  4BRN A;  4JKD A;  1T44 A;  3FZL A;  4BRI A;  2QWP A;  4I6M B;  5AQV A;  2P9I A;  4CZJ A;  2I7P A;  1R59 O;  4BGB A;  2F9W A;  2GEM A;  5HOO A;  1HKC A;  2OAN A;  5AQJ A;  1RFQ A;  5ADX H;  5DM7 L;  1Q82 O;  4FOE A;  3FZM A;  2ZJQ L;  2CH5 A;  2NLX A;  3MDQ A;  5KPR A;  3MX2 A;  4KBO A;  4BR4 A;  3WXK A;  3FZF A;  5AQI A;  5LJV A;  3CCM N;  3H46 O;  2QTD A;  4JKG B;  4PKH A;  3T7Z A;  5AQZ A;  3I8B A;  3ZX0 A;  2VGN A;  4BRH A;  3C7N B;  4BRG A;  3U8X A;  1DEJ A;  1TYQ B;  2FXU A;  3ENO A;  3ZX3 A;  4C23 A;  4BG9 A;  5KPZ A;  3CCL N;  2E2P A;  2HBJ A;  4ILG B;  4IJN A;  3HBT A;  3VGM A;  3R9P A;  4YOU A;  3TSP A;  1TUY A;  3CCQ N;  2NRR A;  3IUC A;  1BA0 A;  3LL3 A;  1VQM N;  3IMX A;  2OTJ N;  1KQS M;  4IWV A;  4YDU A;  3O1B A;  3JXU A;  3QBX A;  3DXK A;  4XH1 A;  3G71 N;  5FPM A;  4JKC A;  1K73 O;  3EZW A;  4JHD A;  1LCU A;  5JMV A;  4BRC A;  1YJ9 N;  2ASP A;  4WFN L;  3G4S N;  2QWM A;  2KHO A;  4GY2 B;  4O8K A;  3FR0 A;  3H1Q A;  5DM6 L;  3VEN A;  3CPW M;  4JK8 A;  3D7E O;  1DT9 A;  3WXL A;  1QZ5 A;  1BUP A;  4CD3 A;  3QB0 A;  3H6E A;  5BRH A;  3CER A;  3JS6 A;  3WEE B;  3CJB A;  4H5R A;  4IZ9 A;  3B8A X;  3P31 A;  5BRF A;  5LY3 A;  4YOW A;  4R79 A;  4BQL A;  5AQM A;  3NVK A;  5BRD A;  1SAZ A;  1VQ7 N;  4K25 A;  3EE8 A;  3SBG A;  2QXL A;  4BR2 A;  2P9N B;  4JKG A;  5LJW A;  2NRW A;  3HTV A;  5AQS A;  4CJ7 A;  2V7Z A;  3D2F A;  5C2D A;  1ATS A;  1LOT B;  3CD6 N;  4E1J A;  2RHK A;  4FWS A;  5M1P A;  1Y64 A;  5AQN A;  2E20 A;  4JK7 A;  4OPH A;  3DWL A;  1MWM A;  4LC9 B;  2V51 B;  2VCP A;  1BWF O;  1GLD G;  3A8Y A;  3U9D A;  5BPN A;  1XQS C;  3CQY A;  1GLF O;  2Q36 A;  4A61 A;  4DHY A;  4FWR A;  3TTF A;  2E1Y A;  2WC9 A;  1YJW N;  3Q7B A;  3O08 A;  5C12 A;  1GLL O;  4IEE A;  3ZEU B;  4IEI A;  1KXP A;  1VAZ A;  1Q18 A;  2EWS A;  2E88 A;  3FLC O;  4HTL A;  3RSE B;  2ZGY A;  1HLU A;  3IDH A;  3QML A;  2W40 A;  1YUW A;  2P9S B;  3H3N O;  3CC7 N;  1W97 L;  3E9P A;  3FZH A;  4GV9 A;  3VEY A;  4EAH D;  3E9O A;  4BG8 A;  2IVP A;  4XH4 A;  3PIO L;  2GX9 A;  2YHX A;  3MN5 A;  2YCH A;  5AQQ A;  4K42 A;  3ATU A;  3SAF A;  5MLC Q;  2QM1 A;  2KKZ A;  1E4G T;  1GLC G;  2YHW A;  4FWQ A;  3MCP A;  1GLE G;  1GLB G;  3OBW A;  5AFU A;  1D4X A;  4EHT A;  5AQT A;  4H5W A;  1NGE A;  3VGL A;  5AZI A;  4XEI A;  5KPT A;  1MA9 B;  3AGK A;  2GWK A;  4JK9 A;  2HMP A;  1BOT O;  3CF5 L;  4IOC L;  2JWK A;  1C0G A;  1VQL N;  1EO1 A;  1VQ6 N;  1YVN A;  4KH6 A;  1VQP N;  1X3N A;  4BRE A;  4F9O A;  4BRF A;  1GLA G;  1K8K B;  3CJ7 A;  4Z94 A;  2HBM A;  3DAW A;  3ZX2 A;  3C65 A;  5FPD A;  4JN4 A;  5EX5 A;  3VEZ A;  3SJH A;  2ZJR L;  1J6Z A;  3KWI A;  1M90 O;  2CH6 A;  1H1V A;  3CI5 A;  4WQ5 A;  1ATN A;  2ITM A;  3CCS N;  3DXM A;  3MN7 A;  1Q81 O;  1NGB A;  5AFU H;  3WXJ A;  2GUP A;  3AGR A;  1NGD A;  3WXI A;  2QW9 A;  3VEX A;  3IKM A;  3ZEU A;  5C10 A;  4L3Q A;  3OA9 A;  4M7X A;  3EO3 A;  4RTF D;  1NGA A;  4H0Y B;  4CBW A;  3OW2 M;  2H3G X;  5TKY A;  2F7T A;  1N8R O;  2GTD A;  3E66 A;  4CBX A;  1E4F T;  3F5T A;  3L4I A;  4PKI A;  4XH5 A;  5GAE P;  5M1K A;  3O80 A;  5E26 A;  3WQU A;  4EIA A;  4IJA A;  4BGA A;  1JJ2 M;  3ZET B;  3CHW A;  2PAV A;  2E2O A;  2FSN A;  5AQY A;  3TTD A;  1BDG A;  3O9U A;  2FSJ A;  3D2E B;  2BUP A;  4Y0W A;  1OKJ A;  1RGI A;  1Z6R A;  2YX6 A;  3HM8 A;  3MN6 A;  1T3V A;  4JEP A;  5AZI B;  1IG8 A;  4H0X B;  2HF4 A;  4WFB L;  1MWK A;  5GAD P;  2FLO A;  4BC4 A;  2E2Q A;  3VMF B;  3F2K A;  3R8E A;  1YJN N;  3LDO A;  2D0O A;  2P9L B;  3QIC A;  4BRM A;  1YI2 N;  3RVC A;  3AAQ A;  3L0Q A;  4MO5 A;  2E1Z A;  5AQL A;  4HWI A;  3MMV A;  4BR5 A;  5BR9 A;  3UB5 A;  3SBT A;  3CJA A;  3CC4 N;  2NRT A;  3O9Q A;  5KQD A;  1U2V A;  5B8H A;  3FFK B;  5JIC A;  4ISG A;  3VF2 A;  3A5M C;  2NZT A;  1VQ5 N;  3CET A;  3MWT A;  4H0O A;  4FO0 A;  5BN9 A;  4CZL A;  4JNE A;  1NGF A;  4DQ8 A;  2WFB A;  3GDQ A;  5E84 A;  1X3M A;  1HJO A;  2HST A;  3HRG A;  3O9T A;  4YOT A;  2CGK A;  4QS9 A;  3Q7C A;  4BC3 A;  4WCE L;  5ELZ A;  2ASO A;  1SQK A;  3E9L A;  1ILY A;  4JKH A;  3OBY A;  5AZJ A;  2NNW A;  4YOV A;  2A3Z A;  2UYT A;  3DLL L;  3CCR N;  3P39 A;  4BRA A;  3O5B A;  1IJJ A;  4BRK A;  2PBD A;  4U67 L;  4A2A A;  2BH1 A;  3BF3 A;  3A5N C;  2CGL A;  1SS6 A;  3BEX A;  3HZ6 A;  5JVH L;  4G9Z A;  1QHA A;  3VTH A;  2JWL A;  1GLJ O;  3GG4 A;  3QFU A;  3R3L A;  4H5V A;  1VQ9 N;  2GEL A;  4FWL A;  1ZC6 A;  4A5A A;  3CQX A;  4EFH A;  2P9U B;  5EXW A;  3VES A;  4A62 A;  2P9I B;  4FPB A;  4I6M A;  3TSQ A;  1NWK A;  3BP8 A;  1ZXO A;  3CCU N;  2OTL N;  4WQ4 A;  3D6R A;  5F2R A;  4K41 A;  3H3O B;  3TPQ A;  3W3D A;  2QI2 A;  4FWP A;  3O9R A;  4GNI A;  4CZF A;  4JKA A;  2D4W A;  3F9M A;  2D0P A;  4CZK A;  1HKG A;  1BO5 O;  4MDB A;  3I56 N;  1NGJ A;  2VGM A;  2VWB A;  5ADX A;  2RE2 A;  1U2V B;  4YOX A;  2YHY A;  1VQK N;  1VQN N;  3ULE A;  1KAZ A;  1KD1 O;  2HOE A;  3K9J A;  3SMS A;  1YAG A;  4BVP A;  1G99 A;  5JLH A;  3LDN A;  4JD2 A;  2Q0U A;  2YI1 A;  5AQK A;  2E2N A;  1NBW A;  3LM9 A;  4PL7 A;  5M1N A;  1NGG A;  1BU6 O;  3A0I X;  5M1F A;  5GAH P;  2Q0R A;  1X9J A;  3GL1 A;  3MK6 A;  4NLB A;  5C15 A;  3HOT A;  3CCE N;  3VEV A;  3NMU A;  2QEX N;  4GVE A;  4OO1 J;  2NRH A;  1C0F A;  3TTC A;  5AQU A;  5GIN A;  5AZJ B;  2PFU A;  4RCH A;  4GV3 A;  4CZE A;  5F0X A;  3ULE B;  4PL8 A;  3C0B A;  4QS7 A;  5FPN A;  5AR0 A;  1U6Z A;  2NRZ A;  1NJI O;  5GIO A;  1Z05 A;  3AAR A;  3G6E N;  3LDP A;  2QWO A;  4JKB A;  4FSV A;  3VGK A;  4H0V B;  4B1X B;  4MLE A;  1P8Z A;  1JCE A;  1QZ6 A;  4UY8 O;  2F9T A;  1QQM A;  1YHQ N;  3CME N;  3DXM B;  3DJC A;  4FWO A;  4MDA A;  4U7B A;  2AA4 A;  3MN9 A;  2D1K A;  4AM7 A;  4CBU A;  1KC8 O;  3M1F A;  3CCJ N;  2P9U A;  1WUA A;  2A40 A;  1NGI A;  5AQR A;  3MWP A;  4A2B A;  4BR7 A;  4FWK A;  1VQ8 N;  4O5F A;  2I7N A;  4A57 A;  3KHY A;  3OHR A;  3K9K A;  2HF3 A;  1NMD A;  3U9Z A;  2A42 A;  4PKG A;  1XC3 A;  5GAG P;  3UKU B;  3KVG A;  1YIJ N;  1DGK N;  4ILH A;  4AM6 A;  4AF1 A;  4C1N I;  4CI6 A;  4FPA A;  3SK3 A;  3ATV A;  3SMP A;  2Q1N A;  3D2E A;  4CZG A;  1QQO A;  4IOA L;  3O4W A;  4IOX A;  4NLC A;  4ISE A;  1SZ2 A;  4ISF A;  3W0L A;  2W41 A;  5AQF A;  5CE3 A;  4GV6 A;  5M1O A;  5BPL A;  4O8U A;  5GIP A;  3EE9 A;  4A59 A;  4C1N K;  2FF3 B;  4J8F A;  1HPM A;  1YF5 L;  2Q2R A;  3SAG A;  1V4T A;  3G25 A;  3M5R A;  3QBW A;  1S3X A;  4H5T A;  4CZH A;  5BN8 A;  3I55 N;  1RDU A;  3WXM B;  4JAX A;  2J4R A;  2P9S A;  4KH4 A;  4M7Y A;  4M63 C;  4JHD B;  4QS8 A;  4B9Q A;  3VEW A;  3P38 A;  1NLV A;  1TUU A;  5AQP A;  4FWM A;  1K8K A;  3RSE A;  2V7Y A;  1JCF A;  5AQH A;  1NGC A;  4K43 A;  3T69 A;  4BRP A;  1HX1 A;  1MDU B;  2NRV A;  1WOQ A;  4DKW A;  3PIP L;  1W2B M;  3GBT A;  2A41 A;  3S41 A;  3VPZ A;  4EHU A;  3UE5 A;  4DB3 A;  1NGH A;  5HL7 L;  1V4S A;  3PLA A;  2A6A A;  2P9L A;  3TU5 A;  1BG3 A;  1BA1 A;  5JVG L;  3HI0 A;  3VEO A;  3M6G A;  4ILJ A;  3D2F B;  4WFA L;  3VET A;  2IVN A;  3R6M A;  5C2F A;  4NO7 A;  4BC2 A;  1KAX A;  1YXQ A;  4RWT A;  3HSC A;  2P9K B;  3BF1 A;  3LDL A;  2QWN A;  1EQY A;  2HBK A;  4BC5 A;  5F1X A;  2IIR A;  1CZA N;  2DPN A;  2WBN A;  3LM2 A;  5EVZ A;  3A5O C;  4FL9 A;  3U4L A;  4BR0 A;  4CZM A;  5C0Y A;  4NB4 A;  1KAY A;  1K9M O;  4BR9 A;  5AQO A;  4DCH A;  3P4I A;  1XUP O;  4WQ4 C;  3I33 A;  5EOY A;  3A5L C;  3GOI A;  2ASM A;  2HBL A;  5I9E B;  4H5N A;  4PHT X;  3HOS A;  4BVO A;  3CJ1 A;  3ID6 A;  3QDK A;  3DXK B;  3ENH A;  1M1K O;  2ZF5 O;  3AY9 A;  1QVF M;  3VF6 A;  4B1Z A;  3UKR B;  2WUS A;  4BRQ A;  1JCG A;  3E1Y A;  4IDH A;  3GE1 A;  3J8A A;  5JLF A;  1ZBS A;  3MCA B;  4FVU A;  5M1Q A;  3FGU A;  3L6Q A;  4MO4 A;  2E8A A;  1QQN A;  1ATR A;  4CZI A;  2QA4 N;  4WQ5 C;  3AAP A;  2QWQ A;  3CJ9 A;  4BRO A;  1NM1 A;  3WUH A;  1VQO N;  4KH5 A;  3SLC A;  2ZJP L;  3TSU A;  2ZGZ A;  2P9N A;  3H1V X;  4IXC A;  2QWL A;  3ZET A;  1S72 N;  3ID8 A;  5BRE A;  4BY9 C;  1VQ4 N;  3VF4 A;  1P90 A;  3ENB A;  4H0T B;  3WQT A;  4B1Y B;  1HKB A;  3WEE A;  1T6C A;  4YDU C;  1ESV A;  4IFE A;  4FOI A;  3O6W A;  5TKW A;  4CD1 A;  4MLH A;  2YJE A;  1QVG M;  4A5B A;  3EN9 A;  5AQW A;  5AQG A;  4BRD A;  2P9P B;  4JKF A;  3EL2 A;  3CCV N;  3L4Q A;  3BUZ B;  4H03 B;  3WT0 A;  3J7Z O;  4OPA A;  5KQ8 A;  3H45 C;  2VYP A;  5CHI A;  3VER A;  4WYB A;  3C7N A;  3MX5 A;  3C6H A;  2P9K A;  5FPE A;  2CGJ A;  3FE1 A;  1S22 A;  4YOR A;  3LDQ A;  1YIT N;  1Q86 O;  5CR4 A;  2FF6 A;  3SAH A;  4H0P A;  1TYQ A;  2Q31 A;  3VOV A;  3VTI A;  3CIP A;  4YOY A;  3CJC A;  1OVY A;  3N4Q A;  3FZK A;  2IVO A;  3M3Z A;  2V52 B;  5AQX A;  4B1U B;  4BQZ A;  3UKU A;  3KK7 A;  4IO9 L;  3C6A A;  3NVM A;  5BPM A;  3CXC M;  2GWJ A;  4B1V A;  3O9S A;  3N4P A;  1DKG D;  2BTF A;  4IO8 A;  3O8M A;  4WF9 L;  2YJF A;  3CMA N;  2Q97 A;  2ZWH A;  1RDW X;  4JD2 B;  4JKE A;  3KZB A;  1O13 A;  1T6D A;  5H1S Q;  3EKS A;  3QFP A;  1Q7Y O;  3UKR A;  5EY4 A;  1K8A O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...