2CH5A

Crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
347
structure length
344
Chain Sequence
PQFMAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGRAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAGK PROTEIN
publication title Structures of Human N-Acetylglucosamine Kinase in Two Complexes with N-Acetylglucosamine and with Adp/Glucose: Insights Into Substrate Specificity and Regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 113
structure length 344
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.59: N-acetylglucosamine kinase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch5A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch5A02
1HPMA 2ASMA 4B1YB 5BR9A 3KZBA 1BO5O 3R9PA 3A5NC 1HKCA 3O1BA 4BREA 5FPNA 1KAYA 3O4WA 1GLAG 3KVGA 1XC3A 4C23A 4H03B 5I9EB 5AQGA 4CZMA 4CZLA 5AQRA 3HI0A 2YJFA 1NGCA 2FSJA 3DXMA 4E1JA 3UB5A 2I7NA 3A0IX 2CH5A 3MN5A 1IJJA 1GLDG 1RDWX 3C7NA 3SJHA 3F9MA 1BWFO 3FZMA 3CJBA 5ELZA 5FPEA 4BRIA 5F0XA 3H3OB 2QWQA 2YHWA 2A3ZA 3L6QA 2HF3A 4H0PA 4CZGA 3KHYA 3BEXA 3HM8A 2QWPA 4XH4A 1HJOA 2YCHA 4K42A 2E88A 2AA4A 2Q36A 3IUCA 4FWSA 3WEEA 5AQJA 1X9JA 4XH5A 4JD2B 3QBWA 4AM6A 1V4SA 1YAGA 3HBTA 1LCUA 1NBWA 3HZ6A 3QICA 1GLFO 3DWLA 5LY3A 4PKIA 3ATVA 3ZETB 3R6MA 2P9UB 3FLCO 2F9WA 3EZWA 4DCHA 4FOIA 4PKGA 2FXUA 1CZAN 3WXIA 4YDUC 1TYQA 1C0FA 1NM1A 3C0BA 3LDPA 3CJAA 1BA0A 1SZ2A 3LDQA 4FL9A 2E2OA 5KPZA 3O8MA 3VGKA 3FR0A 4CD3A 1MWKA 4JHDA 4A61A 2NRHA 5AQTA 4BRMA 1QZ5A 2V7YA 1JCEA 1C0GA 2CGKA 3VERA 3GE1A 5AQPA 4H5VA 3O08A 5KQ8A 4WQ4C 4BR7A 3HSCA 3WXJA 4DB3A 3ID8A 3AAPA 5EX5A 3EL2A 5AQOA 2YJEA 2F9TA 1GLJO 2HMPA 4RTFD 4CI6A 3EKSA 4MO4A 1R59O 4RWTA 5ADXH 4PL7A 5AQFA 1ZBSA 3A5MC 3IMXA 4ISGA 4HWIA 4ISFA 4H0VB 1GLEG 1E4FT 1P8ZA 3L4IA 3TPQA 3ULEB 3D2FB 2P9IA 2P9PB 3A5OC 3VF2A 4BRGA 4BR0A 1GLLO 3HTVA 3FGUA 3VEOA 2Q31A 2VCPA 1QHAA 2P9NA 4WQ5C 2QWOA 4B9QA 4FWNA 3BF1A 4FWMA 4A62A 2GELA 3A8YA 5BPLA 3D2EA 3UKUA 3M1FA 3LDLA 3IDHA 3VETA 1U2VA 4FPBA 2V51B 3U4LA 3G25A 4O8KA 2QXLA 1DEJA 3GG4A 4FOEA 2E2PA 3H6EA 3ENOA 3ENHA 2CH6A 2ZWHA 3VEVA 4BQLA 4DHYA 2ZGYA 4IZ9A 4M63C 1NMDA 3MDQA 4BG8A 4BC3A 2D0OA 3LM9A 2Q0RA 3LL3A 4IO8A 4I6MB 2FSNA 2ASPA 3BUZB 1DGKN 3CI5A 4CZKA 1HKBA 4BROA 1Z6RA 1GLBG 4K25A 3MN7A 3BF3A 3AARA 4BRNA 3TU5A 3I8BA 1BOTO 3QDKA 4BRKA 1HX1A 2QWNA 4JN4A 4H5RA 1QZ6A 4FWRA 3VEWA 5JLFA 5BRFA 4IJAA 5CE3A 3EKUA 1QQOA 2AP1A 3R8EA 5AQHA 4IJNA 4B1VA 2VWBA 4FO0A 4BC5A 1MWMA 3JXUA 2I7PA 2P9LB 1TUYA 5BRDA 3FFKB 3QFUA 1GLCG 2QWLA 3ZEUB 4BRPA 1RGIA 1NWKA 3CJ9A 4Y0WA 1NLVA 3MK6A 3WT0A 5AFUA 4WYBA 2FF3B 1BU6O 2IVPA 4O5FA 1HLUA 1K8KB 2Q2RA 4JD2A 1NGJA 4M7YA 2GTDA 3O5BA 3J8AA 5FPDA 3P4IA 3IFRA 4MO5A 2P9LA 2A6AA 3ZETA 4L3QA 2PBDA 2ITMA 2P9UA 5EVZA 1YXQA 4Z94A 2E20A 5AQMA 3DXKB 2D1KA 1T44A 3CIPA 5KPTA 4BG9A 3BP8A 4XEIA 3VEZA 4EHUA 3B8AX 2W41A 2P9KB 2UYTA 2A42A 2V52B 4RCHA 3VGLA 4BRAA 5AQVA 1X3NA 4BGBA 5KQDA 4H0XB 3M3ZA 4ISEA 3ATUA 1T6DA 4MLEA 2FF6A 4AM7A 2HOEA 4IXCA 2GWKA 1NGAA 2YHXA 3W3DA 4CD1A 4CZEA 5E26A 3O80A 1BUPA 3ZX0A 3RSEB 4CBWA 1NGIA 4CZJA 4YDUA 3LDOA 3VENA 3JS6A 4B1WB 1ATNA 2ZGZA 4IWVA 2GEMA 4BRFA 2QW9A 4H0TB 5AZIB 3H46O 5AZJB 3SMSA 1NGHA 4QS7A 2FLOA 4GY2B 1KAXA 4CZFA 5KPRA 3SK3A 2NZTA 4QS8A 5E84A 1T6CA 4BR5A 3UKRB 3UE5A 2EWSA 2FSKA 5FPMA 1EQYA 5BREA 1MA9B 1HUXA 4FWPA 3MN9A 4JNEA 4EAHD 3ULEA 2HF4A 1H1VA 3D2FA 2ZF5O 4WQ4A 4CBUA 2P9PA 2YI1A 1X3MA 1JCFA 2QWRA 1KAZA 1J6ZA 3WQUA 5JLHA 5AQLA 1S3XA 5AQXA 4BQZA 4CZHA 1NGEA 1QQMA 1S22A 1U6ZA 3ZX2A 5BN8A 1OKJA 1NGGA 3DJCA 2H3GX 3GL1A 3U9ZA 5EOYA 3O6WA 3A5LC 3QB0A 5AQKA 5BN9A 3EN9A 4FSVA 4BC4A 1ESVA 4BRLA 5LJVA 3DXMB 1BG3A 5AQZA 4LC9B 4CBXA 5AQIA 5EY4A 3WXLA 4B1UB 5JMVA 1TUUA 5F1XA 3C7NB 4EFHA 3FZFA 3GBTA 2VYPA 3CETA 4WQ5A 4NO7A 3D7EO 4M7XA 1NGDA 1YUWA 2Q0UA 3MN6A 3H1QA 1JCGA 3GOIA 2YHYA 3LDNA 4PKHA 3WEEB 3VEYA 5EXWA 4PL8A 4I6MA 1D4XA 3L0QA 3WUHA 5BRHA 4BR2A 2DPNA 2IIRA 2D0PA 3GDQA 4BGAA 5AQQA 4FWQA 2GUPA 5AQWA 4J8FA 4F9OA 4BRHA 4FWLA 3WXKA 3VESA 3O1WA 1V4TA 1XQSC 4BRCA 4BR4A 1MDUB 5AR0A 4MLHA 2CGJA 4BRQA 1TYQB 5AQUA 1NGFA 3WQTA 3FZHA 2Q1NA 3CJ1A 3VF4A 4H5NA 3CHWA 3FE1A 2ASOA 5LJWA 4BC2A 5F2RA 1BA1A 3M6GA 4JHDB 3ZEUA 4B1ZA 4EHTA 1XUPO 4K41A 2D4WA 3VPZA 2E8AA 3FZLA 2PAVA 3H3NO 3SMPA 2J4RA 1K8KA 1Q18A 4DQ8A 1DKGD 5AFUH 4H5WA 2A41A 1E4GT 2NLXA 3VF6A 4XH1A 5ADXA 3AAQA 2OANA 4HTLA 4A2AA 1KXPA 1RFQA 3CERA 2QWMA 4BVPA 3DAWA 5AQSA 3QBXA 3DXKA 2Q97A 2A5XA 4GNIA 4BRDA 2E1ZA 1LOTB 3CJCA 3OHRA 2E1YA 2W40A 1ZC6A 4H5TA 2P9KA 4JAXA 1SAZA 4B1XB 2BUPA 3ZX3A 1NGBA 3VEXA 2IVOA 5JICA 3H45C 5AQNA 3MMVA 4A2BA 2P9IB 2BTFA 3CQXA 2P9SB 2E2QA 4FPAA 2QM1A 3W0LA 4QS9A 3AY9A 3VGMA 3EO3A 4KBOA 3FZKA 1ATRA 1SQKA 2V7ZA 3U8XA 1QQNA 1Y64A 5BPNA 1WOQA 2P9NB 3S41A 5BPMA 4K43A 3RSEA 1BDGA 3D2EB 3UKUB 4CZIA 3QFPA 3VOVA 4H0OA 1U2VB 1ZXOA 4CJ7A 2P9SA 5AZIA 5AZJA 3MCPA 3QMLA 2A40A 2WUSA 2IVNA 3LM2A 5B8HA 3U9DA 4FWKA 2GWJA 1ATSA 1YVNA 1Z05A 5TKYA 3UKRA 4FWOA 1IG8A 3SLCA 3CJ7A 4EIAA 1HKGA 1G99A 2CGLA 3I33A 2KHOA 3H1VX 4BVOA 1WUAA 2E2NA 4BR9A 3CQYA 5AQYA 4H0YB 4NB4A
chains in the Genus database with same CATH superfamily
2HVHA 1X9MA 4CF8A 5T7BA 1HKCA 3AGKA 1XC3A 5DM7L 5AQGA 4CZMA 4CZLA 1XHZA 3K5NA 4JI6K 4DG1A 3ENBA 3V81A 3NMUA 3ISNC 3OYCA 3V4IA 5C42A 3KLFA 1M90O 3OBYA 4OPAA 4CEFA 4CF2A 5D3GA 1QHTA 4CK3A 4KHQA 1BQMA 3VQ6A 5KTQA 4CZGA 3C6HA 1YI2N 2QWPA 1GOBA 3DRSA 3NHGA 4OLBA 2Q36A 3IUCA 3WEEA 1RT3A 1RTJA 5CHIA 4C8LA 1KVBA 5GADP 2KW4A 1NJXA 1YAGA 1EXQA 2IOCA 1OVYA 3ZSOA 3QICA 2KZZA 3NF7A 3ZETB 3PIOL 1JLAA 1A5WA 4X64K 4DCHA 4FOIA 4PKGA 4Y1CA 3WXIA 2W6KA 1C0FA 4N41A 3CJAA 1SZ2A 3L3UA 3QINA 4J2AA 1QE1A 4CD3A 2UXBK 4JHDA 3O9RA 4A61A 1J5OA 1VSDA 2NRHA 5C2DA 4PQUA 3MXJA 1C0GA 2O8CB 3PSFA 4IFVA 2DFHA 4DB3A 4DV4K 3AAPA 4CGIA 4LF4K 3TAEA 1S6QA 4Y1DA 4PA1A 4FLYA 1IBKK 2HMPA 4CI6A 5C12A 2IAJA 2JGUA 5HBMA 4PL7A 3A5MC 3HRGA 5DMRA 3TAQA 4B9MA 4HWIA 4MDAA 3L4IA 1E4FT 3TPQA 1HYZA 1SL2A 4JI1K 4BR0A 4DR3K 1VSFA 1RTHA 4F3OA 3LP2A 4WQ5C 3ID6A 3CFOA 2QWOA 4B9QA 4HCCA 4A62A 5C25A 3MX5A 5BPLA 1QSSA 3D2EA 3VETA 1S72N 3OYNA 1U2VA 4KAZA 2Z1GA 1S5JA 4ID5A 4YY3K 4O8KA 4M42A 1Z26A 3PX4A 3VQ8A 3TAFA 3AA5X 1N33K 2CH6A 4WFAL 4BQLA 3OYKA 1HRHA 3KKSA 3AVHA 1NMDA 4BG8A 3I8DA 3NFAA 3V9WA 2D0OA 1L3UA 2WBNA 4M41A 1WN7A 4FM2A 1XC9A 4BROA 4H8KA 1Z6RA 1GLBG 2Z1HA 1VSHA 4FZXC 3MN7A 3SQ1A 3TU5A 3JYTA 4CGFA 3QDKA 1UAXA 3HM9A 4BRKA 4JN4A 4FVUA 1IKXA 4JKEA 4O0IA 1FXXA 4DV5K 2HHHK 5CE3A 1QQOA 4ILHA 2GV9A 3R8EA 4IJNA 4FO0A 1OH6A 3IRXA 4JRQA 5KGWA 3FFKB 3QFUA 2QWLA 3ZEUB 3ALYA 4Y0WA 1JKHA 3MK6A 3K9KA 3CM6A 2IVPA 4LFCK 4O5FA 1HLUA 3DRRA 4JD2A 1KTQA 5M1PA 2D0BA 3P4IA 1RBRA 3IFRA 4KPYA 4MO5A 1KVAA 3VA3A 2P9UA 4OVLA 5SZTA 1I3AA 4JI4K 4Z94A 2E20A 3ZT3A 3DXKB 1UOCA 2PFUA 3O9UA 3VEZA 3B8AX 3BY5A 2W41A 4FK0A 3KWIA 2V52B 3VGLA 4ELVA 3O9TA 4BGBA 4H0XB 3HXMA 3SJJA 1S1VA 2A1RA 3FFIA 1TKTA 3AVNA 3RMDA 1NGAA 3W3DA 3LAMA 3S3OA 4YNQA 4JKGB 1WSIA 4HCBA 3HVRA 4CEBA 3OYHA 3VENA 2ITGA 1L3TA 3JS6A 4BE2A 4B8AB 5HROA 4C8NA 5AZJB 3SMSA 3IAYA 3G71N 1NGHA 2JLEA 4GY2B 1KAXA 4Z0UA 1N5YA 2HBJA 3LZJA 3AVJA 2NZTA 3VQ4A 4C1NK 1HUXA 4EAHD 1TK8A 3ULEA 4WQ4A 2YI1A 3VQPA 4F8RA 1KLNA 1XMQK 4NCAA 4DTJA 1VSEA 1KD1O 5AQXA 1U6ZA 2FC0A 5M1KA 4JI2K 3TARA 4B3RK 3O6WA 5BN9A 3THYB 4FLWA 4JI8K 2KZMA 4AHSA 4FSVA 4CGGA 3SAHA 4CFAA 5LMUK 4CF1A 4HUEA 3DXMB 2PZSA 5C24A 1IBLK 5AQZA 2O8EB 5CZ1A 1BCMA 4B1UB 3JSMA 4KHUA 3L2WA 3TANA 2G8WA 3HK2A 5F1XA 2VGNA 4CJPA 3LWMA 3KLGA 3E9LA 1YF5L 1WSFA 3M8QA 2G8KA 3FZFA 1Q9YA 3G6EN 2VYPA 1NJZA 3O4QA 4QAGA 3T19A 5FDLA 3SUPA 4NO7A 3J7AP 1VRTA 4CEAA 3WNEA 4L8RB 4PKHA 5EXWA 2G8IA 3MCAB 4I6MA 1D4XA 2DPNA 3OYMA 3GDQA 4KO0A 3SQ0A 4J8FA 2IGIA 3WXKA 3R3LA 3MWTA 4RW7A 4A59A 1MDUB 5AR0A 3PX0A 1U47A 3OYFA 1NGFA 2X74A 4WFNL 1RDUA 3FZHA 4NYNA 4CEZA 4KH5A 1DTTA 3FE1A 2ASOA 2UU9K 2RF2A 1X9SA 2E6LA 2WONA 1BA1A 3VQ7A 3D6RA 4B1ZA 4ICLA 3WNFA 3FZLA 4M3ZA 4CJFA 3WNGA 5KRSA 1S1XA 1P90A 3O3GA 1EETA 1DKGD 4E7KA 4O0JA 1I39A 4JKCA 4K8ZA 4XH1A 5ADXA 2YHBA 3HJFA 4A5BA 3M8SA 3OYAA 1EP4A 1RBSA 4JKBA 4BWMA 2Q97A 3AA4A 1BCOA 4GNIA 3L2UA 2VGMA 2W40A 3QO9A 4DV1K 1C1AA 4JAXA 2DFFA 3ZSWA 1NGBA 2VWJA 3OYLA 2P9IB 3G0ZA 1A5VA 3T7ZA 3CQXA 2P9SB 2QM1A 1XI1A 4QS9A 3AY9A 3EO3A 4KBOA 1VQMN 4PY5A 2V7ZA 2JWKA 4K43A 3QNOA 4CIEA 1L3SA 3E01A 1QVGM 1RDBA 4LF5K 3UKUB 2QXFA 3EEQA 3KJVA 5HRSA 2P9SA 5AZIA 1C0UA 3MCPA 4HTUA 4CK1A 2NNWA 2WUSA 3AVGA 1RILA 3QNNA 2IVNA 4BWJA 4FWKA 4KHPK 5TKYA 3UKRA 1YTUA 4FWOA 1IG8A 3SLCA 4EIAA 1HKGA 3CC2N 3C95A 1B9FA 4BE0A 3CQYA 5AQYA 4KHYA 4O55A 2O4IA 2ASMA 2YHAA 1ZBFA 5BR9A 3CCUN 1WSEA 3KZBA 4BDZA 4FK2A 5FRMA 3R9PA 4KREA 4V19S 1TVRA 1YJWN 3CCVN 1C1CA 4Z4EA 3DM2A 4H03B 5I9EB 4YOWA 3HI0A 3UB5A 3CCSN 2I7NA 1BI4B 3IG1A 4M3WA 2CH5A 3LALA 3MN5A 3CMAN 1IJJA 3C7NA 1TL3A 1Q9XA 1BQNA 3CJBA 2HHVA 1U4BA 1WNSA 3LP0A 3ZSQA 4BRIA 3H3OB 4CHYA 3L4QA 3L6QA 5F0XA 2HF3A 3ZYYX 4DTUA 4N76A 3E1YA 4XH4A 2YCHA 2F8SA 2AA4A 5AQJA 4XH5A 1V4SA 3K2PA 3KKRA 3NAEA 3HZ6A 5LY3A 1YJNN 1TKXA 3RTVA 2D5RA 4N56A 5K14A 3I0RA 4OGCA 1VHXA 3K59A 2QKKA 1CZAN 2BANA 2P51A 1VQ6N 1BHLA 2QI2A 3OYIA 4FL9A 1BA0A 3LDQA 2QTDA 3QESA 4X62K 1VQ8N 2B4JA 5KPZA 4RW8A 3VGKA 2D0CA 1A5XA 3SAFA 3SAGA 3SV4A 2HBKA 5AQTA 3NGYA 3CPWM 4JLHA 2KKZA 1QZ5A 3HT3A 1JCEA 4FJLA 3DLHA 5KQ8A 2WFBA 1I94K 4WQ4C 4DSKA 3SQ2A 3HSCA 3VQQA 3DMJA 1ZBUA 2F9TA 4KB1A 3EKSA 4MO4A 5GINA 1KFSA 3VMFB 4DR5K 2Q3SA 2G8HA 1T7PA 3CFRA 3VTIA 1W7AA 4IG3A 4DR1K 3TTCA 4FLTA 3G10A 4H0VB 1GLEG 5MLCQ 3D2FB 5EU7A 2QA4N 2NRRA 3CC7N 1GLLO 4ZTJA 4PUOA 3HTVA 4DV7K 3VEOA 4CERA 4Q0BA 3J7YP 3HOSA 1RT5A 4I2PA 4DTRA 1CLQA 4FWNA 2E6MA 2FBTA 3LZIA 2R7YA 3M1FA 3DYAA 4BY9C 3U4LA 3RR7A 1TKZA 4E1NA 4QCLA 4JRPA 3V6DA 2UXDK 2VG6A 4DS4A 2O8FA 3C65A 3KK7A 3QEXA 2HNZA 3VEVA 4NXNK 2ZGYA 4IZ9A 4BC3A 1RBVA 1RTDA 1RTIA 3OYDA 1VK0A 1C0TA 2ASPA 3BUZB 4GMJB 4Z4FA 3KIOA 4U7BA 2O4GA 3I55N 1S1WA 4K25A 4BRNA 3BF3A 3UIQA 2HSTA 3I8BA 1DTQA 3NH0A 1NJYA 4FJ7A 4NXMK 3VEWA 4H5RA 1QZ6A 1WLJA 5CR4A 4IJAA 3EKUA 1JLQA 3WNHA 1VSLA 1KRPA 3LDSA 3SV3A 2VQFK 3SYZA 4B1VA 1MWMA 3QIPA 1T05A 1TUYA 1ZYQA 1WAJA 3K57A 1QVFM 4DKWA 1RGIA 1NJIO 3CJ9A 3WT0A 3PUFA 5AFUA 2W42A 3I56N 1K8KB 1LAWA 4HHTA 4B9LA 1NGJA 4M7YA 5FPDA 1CXQA 2HHTA 3ZETA 1BIUA 2VWKA 1XNRK 5C0YA 3DLLL 3G4SN 3ZT4A 3AV9A 3TABA 3HL8A 4DR6K 3TTFA 3CIPA 5M1QA 5KPTA 4NLBA 4XEIA 3J81O 4DTPA 5J2MA 3PO5A 1MU2A 2UYTA 3DRPA 1T03A 3SUOA 1HQUA 4FJGA 2B6AA 5AQVA 1JLEA 4B9UA 4ISEA 2NRVA 4OKEA 3Q7CA 3PX6A 4KHWA 3AA2A 2O8CA 1DLOA 3C94A 2HOEA 2GWKA 3LP3A 3J80O 1QTMA 1YTAA 4E7JA 4CEEA 4CHQA 4YDUA 2NRZA 3CG7A 3LDOA 1ASUA 4B1WB 2GEMA 4BRFA 2QW9A 3H46O 1NK7A 4CZFA 4JI0K 4DTSA 1Q82O 5E84A 3DLGA 1T6CA 4BR5A 2FSKA 3HPHA 3NF8A 5FPMA 3PSIA 1EQYA 5BREA 5CYMA 3LPUA 4FYDA 1HPZA 4DU4A 3BZKA 4CBUA 3KD5E 3NH1A 3M8RA 3QERA 1LW0A 3SQ4A 1SV5A 4CZHA 2KFNA 1JLCA 5BN8A 3VQCA 1NGGA 2H3GX 3CM5A 3A5LC 2QK9A 4DQSA 5C15A 3VA0A 4BC4A 2EHGA 4LF7K 4FW2A 5AQIA 4CBXA 4DF8A 1NK8A 5JMVA 3OW2M 2G8FA 1TUUA 5HRNA 3LWLA 3QETA 1OH5A 4M3XA 4FLZA 1N34K 4FJNA 1VAZA 4F3TA 3ZSRA 1RT7A 3NGZA 3ZSVA 3D7EO 4M7XA 3K0SA 3MN6A 3VQAA 1TGOA 1FKPA 4E0DA 3VQDA 4FJKA 1BIZA 4PL8A 3WUHA 4E1MA 3HP9A 2Z1IA 2HNDA 4BR2A 3MXMA 1N36K 3S3NA 1NKBA 1NG9A 4AF1A 4F9OA 2A1SA 4W5RA 4R79A 3SCXA 3VESA 3T1YK 1T8EA 1V4TA 3KTQA 1KCFA 4MLHA 3MWPA 3AO4A 4BRQA 4KFBA 1KSPA 1TYQB 5AQUA 4FW1A 2IDOA 1K9MO 1VSJA 3C6UA 4H5NA 3ZT0A 4W5NA 1IKYA 5LJWA 4JK9A 2PYJA 3DLBA 3M6GA 3ZEUA 2KFZA 4JKDA 4K41A 4RG8A 3U6FA 2D4WA 2PAVA 4DSLA 2FBVA 4F2RA 1NKCA 4DQ8A 1RBTA 4E3SA 4EZ9A 3OS2A 3BGRA 1KLMA 4DTOA 1DT9A 1LWCA 5KRTA 1X9WA 2RHKA 5AQSA 1O1WA 2OPSA 3DXKA 4LH4A 4LY7A 2E1ZA 3P83D 2RKIA 4DQQA 2HNYA 4H5TA 2BUPA 1JLFA 1RT2A 2IVOA 4R5PA 4A2BA 2PY5A 1E3MA 3LPTA 3QEIA 5JS1A 3W0LA 5BR8K 3VGMA 2GUIA 4CJVA 1Y64A 3T1HK 1WOQA 2P9NB 3S41A 3EY1A 4JKGA 5BPMA 4DSIA 4OPHA 1WB9A 4CZIA 3CD6N 3MEGA 3VOVA 2XY6A 1VQ9N 5AZJA 4O4GA 3OBWA 3QMLA 3V1QA 1IO2A 3P31A 1ATSA 1F21A 2PYLA 3ZSZA 1Z05A 5E41A 4A57A 3AO5A 3CJ7A 3I33A 1IKVA 3MAQA 1TK0A 1WUAA 2QKBA 4CJ4A 1EO1A 5IT9O 3TSPA 4B1YB 4X66K 1BO5O 4FVMA 4J2BA 3A5NC 2DFEA 4BREA 1ZBLA 5FPNA 1KAYA 3O4WA 3THYA 1WAFA 2EX3A 3KVGA 4KTWA 4BDPA 5AQRA 1O13A 2YJFA 3V1RA 2RPIA 1NGCA 3DXMA 4RW9A 4CJ5A 2O8EA 3VQ5A 3CYMA 3TSUA 4LFBK 3F9MA 3VN5A 2UUCK 3V9SA 5ELZA 2A3ZA 1J9AA 4C8MA 3OA9A 2E5LK 4UQGA 1EWQA 3BEXA 1OVQA 1NK6A 1HJOA 1KVCA 4FWSA 3KK3A 3QBWA 4AM6A 1IBMK 4I9QA 2OZSA 3HBTA 1LCUA 1NBWA 1GLFO 2XY8A 3DWLA 5HP1A 3ATVA 3AGRA 3OYGA 1HNIA 4HUFA 4GKKK 3L8BA 2FXUA 3P1GA 4WCEL 4YDUC 4DV6K 1X1PA 3LDPA 1GOAA 4O5BA 4E7HA 3AO2A 4BACA 3WXMB 2E2OA 3L2RA 4W5OA 4FJ8A 4DFPA 2OPPA 1L5UA 3EYZA 4DFMA 1N32K 3O9QA 1TV6A 3F73A 1WSGA 3GE1A 2NRXA 4H5VA 3O08A 2P1JA 3OYJA 4BR7A 1KFDA 3NGIA 3ID8A 3PY8A 3EL2A 4CJQA 5AQOA 2YJEA 3TSQA 5GAEP 4DUZK 1QQCA 2UUBK 3E66A 4RTFD 4JI3K 5HL7L 1HQEA 4E7IA 3OYBA 2ZJPL 3AO3A 5ADXH 3THWB 3SBGA 3M5RA 4F4KA 3IMXA 4KB0A 1YT3A 4ISFA 1CZBA 4CJLA 4B9SA 4GVMA 1IH7A 3TAGA 2P9IA 3RWUA 2HHWA 2P9PB 3VF2A 1WBDA 2GBZA 4JEPA 4YOXA 4W5TA 2OTLN 1WSHA 4RW6A 3K9JA 4RW4A 4DF4A 2VCPA 3NBPA 3BF1A 2GELA 3SZ2A 3A8YA 2OTJN 3UKUA 1RNHA 3G25A 4FM1A 3LAKA 2QXLA 4K8XA 4DV2K 1TKDA 4NYFA 1TAUA 4CF0A 1VRUA 4FOEA 2NRTA 4KHNA 2E2PA 3H6EA 4ILJA 3ENOA 3PIPL 4KI4A 5JS2A 2E4LA 3KD1E 4J2DA 2ZWHA 4DHYA 4N5SA 4IDHA 4M63C 3MDQA 1RT1A 4FCYA 4DTMA 4B9VA 3LM9A 3LL3A 4DMNA 3SUNA 5H1SQ 4KTQA 3DLKA 4DV3K 1Y97A 2FSNA 1DGKN 4C8KA 4YHHK 1HKBA 5GIOA 1REVA 4GV3A 4B3TK 1FKOA 1BOTO 4JI7K 1XMOK 1BI4A 2QWNA 5JLFA 4FWRA 5BRFA 2AP1A 5KGXA 3DLEA 4GVEA 1W0HA 2VWBA 4BC5A 4X65K 2I7PA 4A5AA 3QEPA 5BRDA 3HP6A 3V1OA 4IDKA 2O8DB 1GLCG 4BRPA 2X6NA 1NWKA 3OS0A 1RCHA 1RDAA 1NLVA 4Z4GA 4WYBA 1BU6O 3NVKA 2Q2RA 4Z4IA 3O5BA 1SL0A 5LMNK 2A6AA 1S9EA 4WFBL 4L3QA 2ITMA 2HHXA 1YXQA 3HPOA 1SKRA 5FROA 2F8TA 4EP4A 4LF6K 3TAPA 4CECA 4MDBA 5CYQA 4BG9A 2AJQA 4EHUA 2P9KB 5SWMA 3THXB 4CW7B 2ATQA 2YV0X 3ZSXA 4DFJA 3RMAA 1X3NA 5KQDA 3CXCM 3QLHA 3ZLJA 3M3ZA 5C2FA 1VSMA 4MLEA 3RMCA 3NF9A 4CFDA 2HB5A 2FF6A 4AM7A 4IXCA 3KWGA 4CZEA 5E26A 1BUPA 3RSEB 3CCEN 1RDCA 1NU0A 4JKFA 3ZCMA 3VQBA 1ATNA 1LAVA 2VG7A 4IWVA 2YNIA 4CJTA 5A2QO 4QS7A 4CHOA 1SL1A 4E19A 5KPRA 3NE6A 3SK3A 4QS8A 5CY4A 5GAGP 1UA0A 3CMEN 3UE5A 2O8BB 2EWSA 4CFCA 3AO1A 3MN9A 4JNEA 1H1VA 3D2FA 2ZF5O 3CCRN 2XHBA 2OCEA 4CEDA 1JCFA 2QWRA 1Z25A 5AJ3K 3OJSA 1J6ZA 2D0AA 5JLHA 5AQLA 1S3XA 4AILC 1NGEA 1QQMA 1S22A 4AHUA 4FJXA 2IC3A 3GL1A 3U9ZA 3NVMA 5EOYA 2G8VA 3QB0A 3SPYA 3EE9A 2HHUA 2ETJA 3P38A 3V9XA 1ESVA 2B5JA 4GV9A 4KH4A 2IS3A 1VQON 1RT6A 5EY4A 3WXLA 4AHTA 4C1NI 1Q86O 3SBTA 3M8PA 3MXIA 3N4QA 1BGXT 3EE8A 3K5OA 4M3TA 2VQEK 1YIJN 5TKWA 1RBUA 1NGDA 3QEVA 1YUWA 4B8CA 1FK9A 2Q0UA 3H1QA 1VQ4N 2ZJRL 2YX6A 5J2QA 1B92A 3JAMO 3WEEB 1EWRA 1VQ7N 5BRHA 1UWBA 2F4VK 5AQWA 4IBNA 1M1KO 4BRHA 1NOZA 3AVBA 4O44A 4KI6A 3LANA 5LL6Z 1FW6A 3O1WA 4W5QA 3H08A 4DWIA 1XQSC 3AVFA 1TK5A 3EZ5A 4BR4A 3ASMA 1VSIA 2XO7A 4B3MK 3PLAA 4K0KK 3AVKA 3U3GA 4LF8K 1NKEA 3WQTA 4M3YA 2Q1NA 1D9FA 3VF4A 1D5AA 1W97L 5F2RA 4JHDB 3N4PA 1XUPO 4CVNE 4JI5K 4U67L 3SUQA 2E8AA 3H3NO 4FJ5A 2J4RA 1K8KA 1Q18A 5FRNA 4I9LA 5HRRA 5AFUH 1E4GT 2NLXA 3VF6A 2JWLA 1K8AO 3AAQA 2OANA 4EZ6A 1SS6A 3CERA 1RFQA 1W2BM 4B08A 4BVPA 5M1OA 2A5XA 1NK9A 3CPEA 4CHNA 3OHRA 4IEEA 5KI6A 4B1XB 5J2PA 2OPQA 4TSXA 3THVA 2RE2A 1HNXK 4ZHRA 5AQNA 3MMVA 1NK5A 4CIFA 2OZMA 2BTFA 2X6SA 1VQKN 2E2QA 2Z1JA 1B9DA 3P39A 2W6LA 1HNVA 3FZKA 2ZD1A 1SQKA 3U8XA 4IOAL 1QQNA 2WC9A 1J53A 1VQNN 1BDGA 3D2EB 4XIUA 1U2VB 1ZBHA 1ZXOA 4I7FA 4FZZA 3PV8A 3U9DA 3AVCA 3O9SA 1YHQN 3TAMA 2BH1A 1W9HA 1K6YA 2I5JA 2GX9A 1G99A 2CGLA 1BISA 2KHOA 3H1VX 4BVOA 4Q5VA 3L3VA 5HRPA 1D9DA 2XY5A 1NMNA 1HPMA 3B6PA 4DTXA 4M3RA 2OPRA 5GIPA 3O1BA 2XY7A 1OH7A 3QIOA 1GLAG 3R1XA 3NF6A 4C23A 4FLXA 2FSJA 4JS4A 4E1JA 3TI0A 2YKNA 1JLBA 3A0IX 3C6AA 4DV0K 4YOUA 4C8OA 1Q7YO 1GLDG 1RDWX 3SJHA 1BWFO 3OVNA 3FZMA 4OO1J 5FPEA 2QWQA 2YHWA 3TR8A 3BZCA 4H0PA 4CE9A 3KHYA 4HVJA 5J1EA 3V9ZA 1YJ9N 4H4OA 3HM8A 4DR4K 4DS5A 1JXBA 2LSNA 2YKMA 4K42A 4B3OA 2E88A 1SUQA 1X9JA 3KLHA 4JD2B 3DLRA 3LP1A 4PKIA 1NK0A 1XHXA 3R6MA 2P9UB 1QSLA 3FLCO 2F9WA 1N8RO 1C1BA 3EZWA 2KLAA 3KLEA 4DR2K 3CC4N 1HYSA 5JVHL 1TYQA 3C0BA 1NM1A 1ITGA 4LH5A 1LWFA 4DSFA 4CJSA 4CGHA 3O8MA 2F96A 4IEIA 3K5LA 3FR0A 1MWKA 3F9KA 4CEOA 4BRMA 2V7YA 1T3VA 3HSTB 1ASWA 2CGKA 3L2QA 3VERA 4ID1A 3J7ZO 5AQPA 3E9OA 3WXJA 4OPKA 3VQ9A 5EX5A 3K5MA 4CFBA 5M1NA 1EX4A 3OTOK 5DK5A 4H4MA 1GLJO 3CFPA 3OJUA 3MEDA 1R59O 4RWTA 1NJWA 5AQFA 1ZBSA 4IOCL 4E7LA 4KH6A 3AVIA 4ISGA 4OLAA 5C10A 4GV6A 4DFKA 1P8ZA 3ULEB 4E89A 3HO1A 3A5OC 3E9PA 4LSNA 3T69A 1VSKA 2HHQA 4PHTX 1RT4A 2YNFA 4BRGA 1S1UA 1VQLN 4DLGA 4CHPA 3FGUA 4LSLA 1NOYA 4GW6A 2Q31A 3TTDA 1QHAA 2P9NA 3B6OA 4FWMA 4M3UA 4FJHA 3LDLA 3IDHA 1WBBA 3C6TA 3CQ8A 4DQRA 4FPBA 1HJRA 2V51B 1KQSM 3NCIA 4UY8O 3RMBA 4KHSA 1YVUA 1DEJA 4JKHA 3GG4A 2HBMA 3L2VA 4CIGA 4CJRA 3ENHA 3AVAA 1L3VA 4IOXA 3AA3A 5GAHP 4NCGA 4YORA 1SKWA 4KTZA 2Q0RA 4CEQA 4KV8A 4IO8A 3NDKA 4I6MB 4ILGB 3T1AA 2NRWA 3CI5A 4CZKA 3NH2A 5HOOA 1CZ9A 2Y1IA 4JYAK 3AVMA 3AARA 3CCMN 5J2NA 2DY4A 2ZJQL 1HX1A 4OGEA 3IS9A 4IFEA 5I42A 4CK2A 1IV0A 5AQHA 2P5OA 3OYEA 1HNWK 3JXUA 2UUAK 4FJ9A 1LWEA 2P9LB 4B9NA 4DUYK 4YOVA 3CF5L 3SI6A 1TAQA 5CZ2A 2FF3B 3D45A 4PWDA 4EP5A 4JV5K 4N47A 2GTDA 3J8AA 4CESA 1HYVA 4ZTFA 2P9LA 2XRIA 1TL1A 2PBDA 4KRFA 5EVZA 3F5TA 4JK8A 3ZSYA 3OY9A 4LF9K 5AQMA 1OH8A 4WE1A 2D1KA 1T44A 4IFYA 4JKAA 3BP8A 1D8YA 5I3UA 2ZM6K 3DI6A 4DSJA 2A42A 4RCHA 4BRAA 3ULDA 3ATUA 4OPJA 1T6DA 4CJ3A 1XNQK 1C0MA 4MQ3A 2YHXA 4CD1A 3O80A 4MFBA 3ZX0A 4AH9A 3HOTA 4CBWA 4F2SA 1NGIA 4CZJA 2G8UA 3O3HA 2ZGZA 4YOTA 4Z4HA 4H0TB 5AZIB 3THWA 2FLOA 1YITN 3RRHA 2HVIA 4IG0A 3UKRB 1IG9A 4FJJA 1MA9B 4FWPA 2ZE2A 2HF4A 2P9PA 2F7TA 4FXDA 1X3MA 4DTNA 3D0PA 3DOKA 1KAZA 2KQ2A 3BDPA 3WQUA 4KKOA 4BQZA 4FM0A 2WOMA 3QEWA 3ZX2A 1OKJA 3DOLA 4FJMA 3DJCA 2BGGA 1Q81O 1QS4A 4LFAK 5AQKA 1KC8O 3EN9A 4CHZA 2BDPA 4FJIA 1XWLA 2WTUA 5DM6L 4OJRA 3HYFA 5IWAK 5JVGL 4BRLA 5LJVA 4OX9K 1BG3A 4NLCA 4LC9B 4I2QA 3ZT2A 4IKFA 1HNZK 1G15A 3C7NB 1JL2A 4B3SK 3K58A 1RDDA 4OKKA 4EFHA 3RRGA 3GBTA 2VG5A 1LW2A 1GOCA 4JS5A 3CETA 4WQ5A 4DU3A 1CXUA 2UXCK 3IKMA 4FLVA 1SKSA 3PO4A 4YFUA 3MEEA 1C6VA 1JCGA 2YHYA 3GOIA 4OKJA 1U04A 4G1QA 3LDNA 4YOYA 4DQIA 1HR0K 3VEYA 2OA8A 1S6PA 2OYQA 3L0QA 2ZQBA 4DLEA 2IIRA 1JL1A 4CJEA 4M45A 3S3MA 1UA1A 2D0PA 4FK4A 4BGAA 5AQQA 4FWQA 2GUPA 4CGDA 1NNEA 2HBLA 4WF9L 4FWLA 4LD0A 3KLIA 4HUGA 3CCJN 4BRCA 3MECA 3HVTA 2CGJA 4CF9A 1ILYA 1VQ5N 4CCHA 3RVCA 4G9ZA 3CJ1A 1EKEA 4IO9L 4CJUA 3SNNA 3CHWA 4O8UA 3KK2A 4ELUA 1IKWA 4BC2A 4Z4CA 1ZBIA 4CJKA 2O8DA 3OS1A 1HMVA 4EHTA 4QOZB 3VPZA 3SMPA 4AHVA 3KK1A 3T3FA 4NCBA 3Q7BA 3ITHA 2YNHA 1NK4A 4H5WA 1Q8IA 2HMIA 2A41A 4ELTA 1U48A 4HTLA 4BDYA 4A2AA 1KXPA 1U49A 4J2EA 2QWMA 3I0SA 3DAWA 1JJ2M 1J54A 2X78A 3U3YA 3QBXA 4AHRA 3TWHA 4FZYA 1ASVA 4BRDA 1LOTB 3CJCA 2E1YA 1ZC6A 4DR7K 3S9HA 2FBYA 2P9KA 2P5GA 1SAZA 3ZX3A 3THXA 2YNGA 5M1FA 2DTUA 1LV5A 3VEXA 5JICA 3H45C 1S1TA 1N6QA 3CCQN 3RR8A 2HW3A 4BE1A 4FPAA 3VTHA 1JLGA 4CGJA 3HPGA 3VQEA 3V9UA 1J5EK 1ATRA 3F2KA 5BPNA 4B9TA 2HHSA 2FBXA 1VQPN 4DQPA 3RSEA 3O3FA 3A2FA 5FLXO 4CJWA 4JK7A 4AQYK 4AHCA 3QFPA 4H0OA 1R0AA 1JXEA 4CJ7A 3CCLN 2RN2A 1QSYA 2A40A 2KTQA 1S9GA 3LM2A 5B8HA 1WSJA 2GWJA 3ZT1A 2QEXN 1YVNA 3AVLA 5HLFA 3SPZA 2O8BA 3O4NA 1FJGK 2BE2A 3MX2A 2O8FB 4GKJK 4FLUA 3P5JA 4DSEA 1U45A 2NUBA 1K73O 2E2NA 1BL3A 4BR9A 2Y1JA 4DU1A 4H0YB 4NB4A
chains in the Genus database with same CATH topology
1HPMA 2ASMA 3TSPA 4B1YB 5BR9A 3CCUN 3KZBA 5GIPA 1BO5O 3R9PA 3A5NC 1HKCA 3O1BA 4BREA 1YJWN 3AGKA 5FPNA 1KAYA 3CCVN 3O4WA 1GLAG 3R1XA 3KVGA 1XC3A 4C23A 4H03B 5DM7L 5I9EB 5AQGA 4CZMA 4YOWA 4CZLA 5AQRA 1O13A 3HI0A 2YJFA 3NMUA 1NGCA 2FSJA 3DXMA 3ENBA 4E1JA 3UB5A 3CCSN 2I7NA 3A0IX 3C6AA 2CH5A 4FVUA 4YOUA 3TSUA 1M90O 3MN5A 3OBYA 4OPAA 1IJJA 1GLDG 1RDWX 3C7NA 3SJHA 3F9MA 3CMAN 1Q7YO 1BWFO 3FZMA 4OO1J 3CJBA 5ELZA 5FPEA 4BRIA 5F0XA 3H3OB 2QWQA 2YHWA 2A3ZA 3L4QA 2HF3A 3L6QA 4H0PA 3ZYYX 4CZGA 3OA9A 3KHYA 3C6HA 1YI2N 1YJ9N 3E1YA 3BEXA 3HM8A 2QWPA 4XH4A 1HJOA 2YCHA 4K42A 2E88A 2AA4A 2Q36A 3IUCA 4FWSA 3WEEA 5AQJA 1X9JA 5CHIA 4XH5A 4JD2B 3QBWA 5GADP 4AM6A 1V4SA 1YAGA 3HBTA 1LCUA 1OVYA 1NBWA 3HZ6A 3QICA 1GLFO 3DWLA 5LY3A 4PKIA 1YJNN 3ATVA 3ZETB 3AGRA 3PIOL 3R6MA 2P9UB 3FLCO 2F9WA 1N8RO 3EZWA 2KLAA 4DCHA 4FOIA 4PKGA 2FXUA 4WCEL 3CC4N 1CZAN 3WXIA 4YDUC 5JVHL 1TYQA 1VQ6N 1C0FA 1NM1A 2QI2A 3C0BA 3LDPA 3CJAA 1BA0A 1SZ2A 3LDQA 4FL9A 2QTDA 3WXMB 2E2OA 1VQ8N 5KPZA 3O8MA 3VGKA 4IEIA 3FR0A 4CD3A 1MWKA 3SAFA 4JHDA 3SAGA 3O9RA 4A61A 2HBKA 2NRHA 5AQTA 3CPWM 5C2DA 2KKZA 3O9QA 1QZ5A 1T3VA 1JCEA 1C0GA 2CGKA 2V7YA 4BRMA 3VERA 3GE1A 2NRXA 5AQPA 3J7ZO 3E9OA 4H5VA 3O08A 5KQ8A 2WFBA 4WQ4C 4BR7A 3HSCA 3WXJA 4DB3A 3ID8A 3AAPA 5EX5A 3EL2A 5AQOA 2YJEA 3TSQA 5M1NA 5GAEP 2F9TA 3E66A 1GLJO 2HMPA 4RTFD 4CI6A 5HL7L 5C12A 3EKSA 4MO4A 2ZJPL 1R59O 4RWTA 5GINA 5ADXH 3VMFB 4PL7A 3SBGA 5AQFA 1ZBSA 3M5RA 4IOCL 3A5MC 3HRGA 3IMXA 4KH6A 4ISGA 3VTIA 4HWIA 5C10A 4MDAA 4GV6A 4ISFA 3TTCA 4H0VB 1GLEG 1E4FT 1P8ZA 3L4IA 3TPQA 5MLCQ 3ULEB 3D2FB 2P9IA 2ZJQL 2P9PB 2QA4N 2NRRA 3A5OC 3E9PA 3VF2A 3T69A 3CC7N 4JEPA 4PHTX 4BRGA 4BR0A 1GLLO 4YOXA 2OTLN 1VQLN 3HTVA 3FGUA 3K9JA 3VEOA 2Q31A 2VCPA 1QHAA 2P9NA 4WQ5C 3TTDA 3HOSA 3ID6A 2QWOA 4B9QA 4FWNA 3BF1A 4FWMA 4A62A 2GELA 3MX5A 3A8YA 5BPLA 3D2EA 2OTJN 3UKUA 3M1FA 3LDLA 3IDHA 3VETA 1S72N 1U2VA 4FPBA 2V51B 4BY9C 3U4LA 3G25A 1KQSM 4O8KA 4UY8O 2QXLA 1DEJA 4JKHA 3GG4A 2HBMA 4FOEA 2NRTA 2E2PA 3H6EA 4ILJA 3ENOA 3PIPL 3ENHA 2CH6A 3C65A 3KK7A 4IOXA 4WFAL 2ZWHA 3VEVA 4BQLA 4DHYA 5GAHP 2ZGYA 4IZ9A 4IDHA 4M63C 1NMDA 3MDQA 4BG8A 4BC3A 4YORA 2D0OA 3LM9A 2Q0RA 2WBNA 3LL3A 4IO8A 5H1SQ 4I6MB 4ILGB 2FSNA 2ASPA 3BUZB 1DGKN 2NRWA 3CI5A 4CZKA 1HKBA 5GIOA 4BROA 5HOOA 1Z6RA 1GLBG 4U7BA 4GV3A 3I55N 4K25A 3MN7A 3BF3A 3AARA 4BRNA 3TU5A 2HSTA 3I8BA 1BOTO 3CCMN 3QDKA 4BRKA 1HX1A 2QWNA 4JN4A 4H5RA 1QZ6A 4FWRA 4JKEA 3VEWA 5JLFA 5BRFA 5CR4A 4IJAA 5CE3A 3EKUA 1QQOA 2AP1A 4ILHA 4IFEA 3R8EA 5AQHA 4IJNA 4GVEA 4B1VA 2VWBA 4FO0A 4BC5A 1MWMA 3JXUA 2I7PA 4A5AA 2P9LB 1TUYA 5BRDA 3FFKB 3QFUA 1GLCG 2QWLA 3ZEUB 4BRPA 4DKWA 1RGIA 1QVFM 4YOVA 1NWKA 1NJIO 3CJ9A 4Y0WA 1NLVA 3K9KA 3MK6A 3WT0A 5AFUA 4WYBA 3CF5L 2FF3B 1BU6O 2IVPA 3I56N 4O5FA 1HLUA 1K8KB 3NVKA 2Q2RA 4JD2A 1NGJA 5M1PA 4M7YA 2GTDA 3O5BA 3J8AA 5FPDA 3P4IA 3IFRA 4MO5A 2P9LA 2A6AA 3ZETA 4WFBL 4L3QA 2PBDA 2ITMA 5C0YA 2P9UA 5EVZA 3G4SN 3F5TA 4JK8A 3DLLL 1YXQA 4Z94A 2E20A 5AQMA 3DXKB 2PFUA 3TTFA 2D1KA 1T44A 3CIPA 4MDBA 5M1QA 3O9UA 4JKAA 4NLBA 4BG9A 3BP8A 4XEIA 5KPTA 3VEZA 4EHUA 3B8AX 2W41A 2P9KB 2UYTA 2A42A 2V52B 3KWIA 4RCHA 3VGLA 4BRAA 3O9TA 1X3NA 5AQVA 4BGBA 5KQDA 3CXCM 4H0XB 3M3ZA 5C2FA 4ISEA 2NRVA 3Q7CA 3ATUA 1T6DA 4MLEA 2FF6A 4AM7A 2HOEA 4IXCA 2GWKA 3KWGA 1NGAA 2YHXA 3W3DA 4CD1A 4CZEA 4JKGB 3O80A 5E26A 1BUPA 3ZX0A 3RSEB 4CBWA 3HOTA 3CCEN 1NGIA 4CZJA 4YDUA 2NRZA 4JKFA 3LDOA 3VENA 3JS6A 4B1WB 1ATNA 2ZGZA 4IWVA 4YOTA 2GEMA 4BRFA 2QW9A 4H0TB 5AZIB 3H46O 5AZJB 3SMSA 3G71N 1NGHA 4QS7A 2FLOA 1YITN 4GY2B 1KAXA 4CZFA 2HBJA 5KPRA 3SK3A 2NZTA 4QS8A 5E84A 1Q82O 1T6CA 4BR5A 5GAGP 3CMEN 3UKRB 3UE5A 2EWSA 2FSKA 5FPMA 1EQYA 5BREA 4C1NK 1MA9B 1HUXA 4FWPA 3MN9A 4JNEA 4EAHD 3ULEA 2HF4A 1H1VA 3D2FA 2ZF5O 4WQ4A 4CBUA 3CCRN 2P9PA 2YI1A 2F7TA 1X3MA 1JCFA 2QWRA 1KAZA 1J6ZA 3WQUA 5JLHA 5AQLA 1S3XA 5AQXA 4BQZA 4CZHA 1NGEA 1KD1O 1QQMA 1S22A 1U6ZA 3ZX2A 5BN8A 1OKJA 1NGGA 5M1KA 3DJCA 2H3GX 3GL1A 3U9ZA 1Q81O 3NVMA 5EOYA 3O6WA 3A5LC 3QB0A 5AQKA 5BN9A 1KC8O 3EE9A 3EN9A 4FSVA 3P38A 5C15A 3SAHA 5DM6L 4BC4A 5JVGL 1ESVA 4BRLA 5LJVA 3DXMB 4GV9A 4KH4A 1BG3A 4NLCA 4LC9B 5AQZA 4CBXA 5AQIA 1VQON 5EY4A 3WXLA 4B1UB 5JMVA 3OW2M 4C1NI 1TUUA 3SBTA 1Q86O 5F1XA 3C7NB 3N4QA 2VGNA 1VAZA 3E9LA 3EE8A 1YF5L 4EFHA 3FZFA 3GBTA 3G6EN 2VYPA 1YIJN 3CETA 5TKWA 4WQ5A 4NO7A 3D7EO 4M7XA 1NGDA 1YUWA 3IKMA 2Q0UA 3MN6A 3H1QA 1VQ4N 1JCGA 3GOIA 2YHYA 2ZJRL 2YX6A 3LDNA 4PKHA 4YOYA 3WEEB 3VEYA 5EXWA 3MCAB 1VQ7N 4PL8A 4I6MA 1D4XA 3L0QA 3WUHA 5BRHA 4BR2A 2DPNA 2IIRA 2D0PA 3GDQA 4BGAA 5AQQA 4FWQA 2GUPA 4AF1A 5AQWA 4J8FA 4F9OA 1M1KO 4BRHA 2HBLA 4WF9L 4FWLA 3WXKA 4R79A 3VESA 3O1WA 1V4TA 3R3LA 3MWTA 3CCJN 1XQSC 4BRCA 4A59A 4BR4A 1MDUB 5AR0A 4MLHA 3MWPA 2CGJA 4BRQA 1ILYA 1TYQB 5AQUA 1NGFA 3PLAA 1VQ5N 1K9MO 3WQTA 4WFNL 1RDUA 3FZHA 3RVCA 4G9ZA 2Q1NA 3CJ1A 3VF4A 4KH5A 4IO9L 4H5NA 3CHWA 3FE1A 4O8UA 2ASOA 5LJWA 4JK9A 1W97L 4BC2A 5F2RA 1BA1A 3M6GA 4JHDB 3D6RA 3ZEUA 4B1ZA 3N4PA 4EHTA 1XUPO 4JKDA 4U67L 4K41A 2D4WA 3VPZA 2E8AA 3FZLA 2PAVA 3H3NO 3SMPA 2J4RA 1K8KA 1Q18A 1P90A 3Q7BA 4DQ8A 1DKGD 5AFUH 4H5WA 2A41A 4JKCA 1E4GT 2NLXA 3VF6A 2JWLA 4XH1A 5ADXA 3AAQA 1K8AO 2OANA 4HTLA 4A5BA 1SS6A 4A2AA 1KXPA 1DT9A 1RFQA 3CERA 2QWMA 1W2BM 4BVPA 5M1OA 3DAWA 1JJ2M 2RHKA 5AQSA 3QBXA 4JKBA 3DXKA 2Q97A 2A5XA 4GNIA 4BRDA 3CPEA 2E1ZA 1LOTB 2VGMA 3CJCA 3OHRA 2E1YA 2W40A 1ZC6A 4IEEA 4H5TA 2P9KA 4JAXA 1SAZA 4B1XB 2BUPA 3ZX3A 5M1FA 1NGBA 2RE2A 2IVOA 3VEXA 5JICA 3H45C 5AQNA 3CCQN 3MMVA 4A2BA 2P9IB 3T7ZA 2BTFA 3CQXA 2P9SB 1VQKN 2E2QA 4FPAA 2QM1A 3VTHA 3W0LA 4QS9A 3P39A 3AY9A 3VGMA 3EO3A 4KBOA 1VQMN 3FZKA 1ATRA 1SQKA 2V7ZA 3U8XA 1QQNA 1Y64A 4IOAL 2WC9A 3F2KA 1WOQA 2JWKA 2P9NB 3S41A 5BPNA 4JKGA 4K43A 5BPMA 1VQPN 3RSEA 1VQNN 1BDGA 1QVGM 4OPHA 3D2EB 4JK7A 3UKUB 4CZIA 3QFPA 3CD6N 3VOVA 4H0OA 1U2VB 1VQ9N 1ZXOA 4CJ7A 2P9SA 3CCLN 5AZIA 5AZJA 3MCPA 3OBWA 3QMLA 2NNWA 2A40A 2WUSA 3P31A 2IVNA 3LM2A 5B8HA 3U9DA 4FWKA 2GWJA 3O9SA 1ATSA 2QEXN 1YVNA 1YHQN 1Z05A 5TKYA 3UKRA 2BH1A 4FWOA 4A57A 1IG8A 3MX2A 3SLCA 3CJ7A 4EIAA 1HKGA 1G99A 2CGLA 2GX9A 3I33A 3CC2N 2KHOA 3H1VX 4BVOA 1WUAA 1K73O 2E2NA 4BR9A 3CQYA 5AQYA 4H0YB 4NB4A 1EO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HPM A;  2ASM A;  4B1Y B;  5BR9 A;  3KZB A;  1BO5 O;  3R9P A;  3A5N C;  1HKC A;  3O1B A;  4BRE A;  5FPN A;  1KAY A;  3O4W A;  1GLA G;  3KVG A;  1XC3 A;  4C23 A;  4H03 B;  5I9E B;  5AQG A;  4CZM A;  4CZL A;  5AQR A;  3HI0 A;  2YJF A;  1NGC A;  2FSJ A;  3DXM A;  4E1J A;  3UB5 A;  2I7N A;  3A0I X;  2CH5 A;  3MN5 A;  1IJJ A;  1GLD G;  1RDW X;  3C7N A;  3SJH A;  3F9M A;  1BWF O;  3FZM A;  3CJB A;  5ELZ A;  5FPE A;  4BRI A;  5F0X A;  3H3O B;  2QWQ A;  2YHW A;  2A3Z A;  3L6Q A;  2HF3 A;  4H0P A;  4CZG A;  3KHY A;  3BEX A;  3HM8 A;  2QWP A;  4XH4 A;  1HJO A;  2YCH A;  4K42 A;  2E88 A;  2AA4 A;  2Q36 A;  3IUC A;  4FWS A;  3WEE A;  5AQJ A;  1X9J A;  4XH5 A;  4JD2 B;  3QBW A;  4AM6 A;  1V4S A;  1YAG A;  3HBT A;  1LCU A;  1NBW A;  3HZ6 A;  3QIC A;  1GLF O;  3DWL A;  5LY3 A;  4PKI A;  3ATV A;  3ZET B;  3R6M A;  2P9U B;  3FLC O;  2F9W A;  3EZW A;  4DCH A;  4FOI A;  4PKG A;  2FXU A;  1CZA N;  3WXI A;  4YDU C;  1TYQ A;  1C0F A;  1NM1 A;  3C0B A;  3LDP A;  3CJA A;  1BA0 A;  1SZ2 A;  3LDQ A;  4FL9 A;  2E2O A;  5KPZ A;  3O8M A;  3VGK A;  3FR0 A;  4CD3 A;  1MWK A;  4JHD A;  4A61 A;  2NRH A;  5AQT A;  4BRM A;  1QZ5 A;  2V7Y A;  1JCE A;  1C0G A;  2CGK A;  3VER A;  3GE1 A;  5AQP A;  4H5V A;  3O08 A;  5KQ8 A;  4WQ4 C;  4BR7 A;  3HSC A;  3WXJ A;  4DB3 A;  3ID8 A;  3AAP A;  5EX5 A;  3EL2 A;  5AQO A;  2YJE A;  2F9T A;  1GLJ O;  2HMP A;  4RTF D;  4CI6 A;  3EKS A;  4MO4 A;  1R59 O;  4RWT A;  5ADX H;  4PL7 A;  5AQF A;  1ZBS A;  3A5M C;  3IMX A;  4ISG A;  4HWI A;  4ISF A;  4H0V B;  1GLE G;  1E4F T;  1P8Z A;  3L4I A;  3TPQ A;  3ULE B;  3D2F B;  2P9I A;  2P9P B;  3A5O C;  3VF2 A;  4BRG A;  4BR0 A;  1GLL O;  3HTV A;  3FGU A;  3VEO A;  2Q31 A;  2VCP A;  1QHA A;  2P9N A;  4WQ5 C;  2QWO A;  4B9Q A;  4FWN A;  3BF1 A;  4FWM A;  4A62 A;  2GEL A;  3A8Y A;  5BPL A;  3D2E A;  3UKU A;  3M1F A;  3LDL A;  3IDH A;  3VET A;  1U2V A;  4FPB A;  2V51 B;  3U4L A;  3G25 A;  4O8K A;  2QXL A;  1DEJ A;  3GG4 A;  4FOE A;  2E2P A;  3H6E A;  3ENO A;  3ENH A;  2CH6 A;  2ZWH A;  3VEV A;  4BQL A;  4DHY A;  2ZGY A;  4IZ9 A;  4M63 C;  1NMD A;  3MDQ A;  4BG8 A;  4BC3 A;  2D0O A;  3LM9 A;  2Q0R A;  3LL3 A;  4IO8 A;  4I6M B;  2FSN A;  2ASP A;  3BUZ B;  1DGK N;  3CI5 A;  4CZK A;  1HKB A;  4BRO A;  1Z6R A;  1GLB G;  4K25 A;  3MN7 A;  3BF3 A;  3AAR A;  4BRN A;  3TU5 A;  3I8B A;  1BOT O;  3QDK A;  4BRK A;  1HX1 A;  2QWN A;  4JN4 A;  4H5R A;  1QZ6 A;  4FWR A;  3VEW A;  5JLF A;  5BRF A;  4IJA A;  5CE3 A;  3EKU A;  1QQO A;  2AP1 A;  3R8E A;  5AQH A;  4IJN A;  4B1V A;  2VWB A;  4FO0 A;  4BC5 A;  1MWM A;  3JXU A;  2I7P A;  2P9L B;  1TUY A;  5BRD A;  3FFK B;  3QFU A;  1GLC G;  2QWL A;  3ZEU B;  4BRP A;  1RGI A;  1NWK A;  3CJ9 A;  4Y0W A;  1NLV A;  3MK6 A;  3WT0 A;  5AFU A;  4WYB A;  2FF3 B;  1BU6 O;  2IVP A;  4O5F A;  1HLU A;  1K8K B;  2Q2R A;  4JD2 A;  1NGJ A;  4M7Y A;  2GTD A;  3O5B A;  3J8A A;  5FPD A;  3P4I A;  3IFR A;  4MO5 A;  2P9L A;  2A6A A;  3ZET A;  4L3Q A;  2PBD A;  2ITM A;  2P9U A;  5EVZ A;  1YXQ A;  4Z94 A;  2E20 A;  5AQM A;  3DXK B;  2D1K A;  1T44 A;  3CIP A;  5KPT A;  4BG9 A;  3BP8 A;  4XEI A;  3VEZ A;  4EHU A;  3B8A X;  2W41 A;  2P9K B;  2UYT A;  2A42 A;  2V52 B;  4RCH A;  3VGL A;  4BRA A;  5AQV A;  1X3N A;  4BGB A;  5KQD A;  4H0X B;  3M3Z A;  4ISE A;  3ATU A;  1T6D A;  4MLE A;  2FF6 A;  4AM7 A;  2HOE A;  4IXC A;  2GWK A;  1NGA A;  2YHX A;  3W3D A;  4CD1 A;  4CZE A;  5E26 A;  3O80 A;  1BUP A;  3ZX0 A;  3RSE B;  4CBW A;  1NGI A;  4CZJ A;  4YDU A;  3LDO A;  3VEN A;  3JS6 A;  4B1W B;  1ATN A;  2ZGZ A;  4IWV A;  2GEM A;  4BRF A;  2QW9 A;  4H0T B;  5AZI B;  3H46 O;  5AZJ B;  3SMS A;  1NGH A;  4QS7 A;  2FLO A;  4GY2 B;  1KAX A;  4CZF A;  5KPR A;  3SK3 A;  2NZT A;  4QS8 A;  5E84 A;  1T6C A;  4BR5 A;  3UKR B;  3UE5 A;  2EWS A;  2FSK A;  5FPM A;  1EQY A;  5BRE A;  1MA9 B;  1HUX A;  4FWP A;  3MN9 A;  4JNE A;  4EAH D;  3ULE A;  2HF4 A;  1H1V A;  3D2F A;  2ZF5 O;  4WQ4 A;  4CBU A;  2P9P A;  2YI1 A;  1X3M A;  1JCF A;  2QWR A;  1KAZ A;  1J6Z A;  3WQU A;  5JLH A;  5AQL A;  1S3X A;  5AQX A;  4BQZ A;  4CZH A;  1NGE A;  1QQM A;  1S22 A;  1U6Z A;  3ZX2 A;  5BN8 A;  1OKJ A;  1NGG A;  3DJC A;  2H3G X;  3GL1 A;  3U9Z A;  5EOY A;  3O6W A;  3A5L C;  3QB0 A;  5AQK A;  5BN9 A;  3EN9 A;  4FSV A;  4BC4 A;  1ESV A;  4BRL A;  5LJV A;  3DXM B;  1BG3 A;  5AQZ A;  4LC9 B;  4CBX A;  5AQI A;  5EY4 A;  3WXL A;  4B1U B;  5JMV A;  1TUU A;  5F1X A;  3C7N B;  4EFH A;  3FZF A;  3GBT A;  2VYP A;  3CET A;  4WQ5 A;  4NO7 A;  3D7E O;  4M7X A;  1NGD A;  1YUW A;  2Q0U A;  3MN6 A;  3H1Q A;  1JCG A;  3GOI A;  2YHY A;  3LDN A;  4PKH A;  3WEE B;  3VEY A;  5EXW A;  4PL8 A;  4I6M A;  1D4X A;  3L0Q A;  3WUH A;  5BRH A;  4BR2 A;  2DPN A;  2IIR A;  2D0P A;  3GDQ A;  4BGA A;  5AQQ A;  4FWQ A;  2GUP A;  5AQW A;  4J8F A;  4F9O A;  4BRH A;  4FWL A;  3WXK A;  3VES A;  3O1W A;  1V4T A;  1XQS C;  4BRC A;  4BR4 A;  1MDU B;  5AR0 A;  4MLH A;  2CGJ A;  4BRQ A;  1TYQ B;  5AQU A;  1NGF A;  3WQT A;  3FZH A;  2Q1N A;  3CJ1 A;  3VF4 A;  4H5N A;  3CHW A;  3FE1 A;  2ASO A;  5LJW A;  4BC2 A;  5F2R A;  1BA1 A;  3M6G A;  4JHD B;  3ZEU A;  4B1Z A;  4EHT A;  1XUP O;  4K41 A;  2D4W A;  3VPZ A;  2E8A A;  3FZL A;  2PAV A;  3H3N O;  3SMP A;  2J4R A;  1K8K A;  1Q18 A;  4DQ8 A;  1DKG D;  5AFU H;  4H5W A;  2A41 A;  1E4G T;  2NLX A;  3VF6 A;  4XH1 A;  5ADX A;  3AAQ A;  2OAN A;  4HTL A;  4A2A A;  1KXP A;  1RFQ A;  3CER A;  2QWM A;  4BVP A;  3DAW A;  5AQS A;  3QBX A;  3DXK A;  2Q97 A;  2A5X A;  4GNI A;  4BRD A;  2E1Z A;  1LOT B;  3CJC A;  3OHR A;  2E1Y A;  2W40 A;  1ZC6 A;  4H5T A;  2P9K A;  4JAX A;  1SAZ A;  4B1X B;  2BUP A;  3ZX3 A;  1NGB A;  3VEX A;  2IVO A;  5JIC A;  3H45 C;  5AQN A;  3MMV A;  4A2B A;  2P9I B;  2BTF A;  3CQX A;  2P9S B;  2E2Q A;  4FPA A;  2QM1 A;  3W0L A;  4QS9 A;  3AY9 A;  3VGM A;  3EO3 A;  4KBO A;  3FZK A;  1ATR A;  1SQK A;  2V7Z A;  3U8X A;  1QQN A;  1Y64 A;  5BPN A;  1WOQ A;  2P9N B;  3S41 A;  5BPM A;  4K43 A;  3RSE A;  1BDG A;  3D2E B;  3UKU B;  4CZI A;  3QFP A;  3VOV A;  4H0O A;  1U2V B;  1ZXO A;  4CJ7 A;  2P9S A;  5AZI A;  5AZJ A;  3MCP A;  3QML A;  2A40 A;  2WUS A;  2IVN A;  3LM2 A;  5B8H A;  3U9D A;  4FWK A;  2GWJ A;  1ATS A;  1YVN A;  1Z05 A;  5TKY A;  3UKR A;  4FWO A;  1IG8 A;  3SLC A;  3CJ7 A;  4EIA A;  1HKG A;  1G99 A;  2CGL A;  3I33 A;  2KHO A;  3H1V X;  4BVO A;  1WUA A;  2E2N A;  4BR9 A;  3CQY A;  5AQY A;  4H0Y B;  4NB4 A; 
#chains in the Genus database with same CATH topology
 2HVH A;  1X9M A;  4CF8 A;  5T7B A;  1HKC A;  3AGK A;  1XC3 A;  5DM7 L;  5AQG A;  4CZM A;  4CZL A;  1XHZ A;  3K5N A;  4JI6 K;  4DG1 A;  3ENB A;  3V81 A;  3NMU A;  3ISN C;  3OYC A;  3V4I A;  5C42 A;  3KLF A;  1M90 O;  3OBY A;  4OPA A;  4CEF A;  4CF2 A;  5D3G A;  1QHT A;  4CK3 A;  4KHQ A;  1BQM A;  3VQ6 A;  5KTQ A;  4CZG A;  3C6H A;  1YI2 N;  2QWP A;  1GOB A;  3DRS A;  3NHG A;  4OLB A;  2Q36 A;  3IUC A;  3WEE A;  1RT3 A;  1RTJ A;  5CHI A;  4C8L A;  1KVB A;  5GAD P;  2KW4 A;  1NJX A;  1YAG A;  1EXQ A;  2IOC A;  1OVY A;  3ZSO A;  3QIC A;  2KZZ A;  3NF7 A;  3ZET B;  3PIO L;  1JLA A;  1A5W A;  4X64 K;  4DCH A;  4FOI A;  4PKG A;  4Y1C A;  3WXI A;  2W6K A;  1C0F A;  4N41 A;  3CJA A;  1SZ2 A;  3L3U A;  3QIN A;  4J2A A;  1QE1 A;  4CD3 A;  2UXB K;  4JHD A;  3O9R A;  4A61 A;  1J5O A;  1VSD A;  2NRH A;  5C2D A;  4PQU A;  3MXJ A;  1C0G A;  2O8C B;  3PSF A;  4IFV A;  2DFH A;  4DB3 A;  4DV4 K;  3AAP A;  4CGI A;  4LF4 K;  3TAE A;  1S6Q A;  4Y1D A;  4PA1 A;  4FLY A;  1IBK K;  2HMP A;  4CI6 A;  5C12 A;  2IAJ A;  2JGU A;  5HBM A;  4PL7 A;  3A5M C;  3HRG A;  5DMR A;  3TAQ A;  4B9M A;  4HWI A;  4MDA A;  3L4I A;  1E4F T;  3TPQ A;  1HYZ A;  1SL2 A;  4JI1 K;  4BR0 A;  4DR3 K;  1VSF A;  1RTH A;  4F3O A;  3LP2 A;  4WQ5 C;  3ID6 A;  3CFO A;  2QWO A;  4B9Q A;  4HCC A;  4A62 A;  5C25 A;  3MX5 A;  5BPL A;  1QSS A;  3D2E A;  3VET A;  1S72 N;  3OYN A;  1U2V A;  4KAZ A;  2Z1G A;  1S5J A;  4ID5 A;  4YY3 K;  4O8K A;  4M42 A;  1Z26 A;  3PX4 A;  3VQ8 A;  3TAF A;  3AA5 X;  1N33 K;  2CH6 A;  4WFA L;  4BQL A;  3OYK A;  1HRH A;  3KKS A;  3AVH A;  1NMD A;  4BG8 A;  3I8D A;  3NFA A;  3V9W A;  2D0O A;  1L3U A;  2WBN A;  4M41 A;  1WN7 A;  4FM2 A;  1XC9 A;  4BRO A;  4H8K A;  1Z6R A;  1GLB G;  2Z1H A;  1VSH A;  4FZX C;  3MN7 A;  3SQ1 A;  3TU5 A;  3JYT A;  4CGF A;  3QDK A;  1UAX A;  3HM9 A;  4BRK A;  4JN4 A;  4FVU A;  1IKX A;  4JKE A;  4O0I A;  1FXX A;  4DV5 K;  2HHH K;  5CE3 A;  1QQO A;  4ILH A;  2GV9 A;  3R8E A;  4IJN A;  4FO0 A;  1OH6 A;  3IRX A;  4JRQ A;  5KGW A;  3FFK B;  3QFU A;  2QWL A;  3ZEU B;  3ALY A;  4Y0W A;  1JKH A;  3MK6 A;  3K9K A;  3CM6 A;  2IVP A;  4LFC K;  4O5F A;  1HLU A;  3DRR A;  4JD2 A;  1KTQ A;  5M1P A;  2D0B A;  3P4I A;  1RBR A;  3IFR A;  4KPY A;  4MO5 A;  1KVA A;  3VA3 A;  2P9U A;  4OVL A;  5SZT A;  1I3A A;  4JI4 K;  4Z94 A;  2E20 A;  3ZT3 A;  3DXK B;  1UOC A;  2PFU A;  3O9U A;  3VEZ A;  3B8A X;  3BY5 A;  2W41 A;  4FK0 A;  3KWI A;  2V52 B;  3VGL A;  4ELV A;  3O9T A;  4BGB A;  4H0X B;  3HXM A;  3SJJ A;  1S1V A;  2A1R A;  3FFI A;  1TKT A;  3AVN A;  3RMD A;  1NGA A;  3W3D A;  3LAM A;  3S3O A;  4YNQ A;  4JKG B;  1WSI A;  4HCB A;  3HVR A;  4CEB A;  3OYH A;  3VEN A;  2ITG A;  1L3T A;  3JS6 A;  4BE2 A;  4B8A B;  5HRO A;  4C8N A;  5AZJ B;  3SMS A;  3IAY A;  3G71 N;  1NGH A;  2JLE A;  4GY2 B;  1KAX A;  4Z0U A;  1N5Y A;  2HBJ A;  3LZJ A;  3AVJ A;  2NZT A;  3VQ4 A;  4C1N K;  1HUX A;  4EAH D;  1TK8 A;  3ULE A;  4WQ4 A;  2YI1 A;  3VQP A;  4F8R A;  1KLN A;  1XMQ K;  4NCA A;  4DTJ A;  1VSE A;  1KD1 O;  5AQX A;  1U6Z A;  2FC0 A;  5M1K A;  4JI2 K;  3TAR A;  4B3R K;  3O6W A;  5BN9 A;  3THY B;  4FLW A;  4JI8 K;  2KZM A;  4AHS A;  4FSV A;  4CGG A;  3SAH A;  4CFA A;  5LMU K;  4CF1 A;  4HUE A;  3DXM B;  2PZS A;  5C24 A;  1IBL K;  5AQZ A;  2O8E B;  5CZ1 A;  1BCM A;  4B1U B;  3JSM A;  4KHU A;  3L2W A;  3TAN A;  2G8W A;  3HK2 A;  5F1X A;  2VGN A;  4CJP A;  3LWM A;  3KLG A;  3E9L A;  1YF5 L;  1WSF A;  3M8Q A;  2G8K A;  3FZF A;  1Q9Y A;  3G6E N;  2VYP A;  1NJZ A;  3O4Q A;  4QAG A;  3T19 A;  5FDL A;  3SUP A;  4NO7 A;  3J7A P;  1VRT A;  4CEA A;  3WNE A;  4L8R B;  4PKH A;  5EXW A;  2G8I A;  3MCA B;  4I6M A;  1D4X A;  2DPN A;  3OYM A;  3GDQ A;  4KO0 A;  3SQ0 A;  4J8F A;  2IGI A;  3WXK A;  3R3L A;  3MWT A;  4RW7 A;  4A59 A;  1MDU B;  5AR0 A;  3PX0 A;  1U47 A;  3OYF A;  1NGF A;  2X74 A;  4WFN L;  1RDU A;  3FZH A;  4NYN A;  4CEZ A;  4KH5 A;  1DTT A;  3FE1 A;  2ASO A;  2UU9 K;  2RF2 A;  1X9S A;  2E6L A;  2WON A;  1BA1 A;  3VQ7 A;  3D6R A;  4B1Z A;  4ICL A;  3WNF A;  3FZL A;  4M3Z A;  4CJF A;  3WNG A;  5KRS A;  1S1X A;  1P90 A;  3O3G A;  1EET A;  1DKG D;  4E7K A;  4O0J A;  1I39 A;  4JKC A;  4K8Z A;  4XH1 A;  5ADX A;  2YHB A;  3HJF A;  4A5B A;  3M8S A;  3OYA A;  1EP4 A;  1RBS A;  4JKB A;  4BWM A;  2Q97 A;  3AA4 A;  1BCO A;  4GNI A;  3L2U A;  2VGM A;  2W40 A;  3QO9 A;  4DV1 K;  1C1A A;  4JAX A;  2DFF A;  3ZSW A;  1NGB A;  2VWJ A;  3OYL A;  2P9I B;  3G0Z A;  1A5V A;  3T7Z A;  3CQX A;  2P9S B;  2QM1 A;  1XI1 A;  4QS9 A;  3AY9 A;  3EO3 A;  4KBO A;  1VQM N;  4PY5 A;  2V7Z A;  2JWK A;  4K43 A;  3QNO A;  4CIE A;  1L3S A;  3E01 A;  1QVG M;  1RDB A;  4LF5 K;  3UKU B;  2QXF A;  3EEQ A;  3KJV A;  5HRS A;  2P9S A;  5AZI A;  1C0U A;  3MCP A;  4HTU A;  4CK1 A;  2NNW A;  2WUS A;  3AVG A;  1RIL A;  3QNN A;  2IVN A;  4BWJ A;  4FWK A;  4KHP K;  5TKY A;  3UKR A;  1YTU A;  4FWO A;  1IG8 A;  3SLC A;  4EIA A;  1HKG A;  3CC2 N;  3C95 A;  1B9F A;  4BE0 A;  3CQY A;  5AQY A;  4KHY A;  4O55 A;  2O4I A;  2ASM A;  2YHA A;  1ZBF A;  5BR9 A;  3CCU N;  1WSE A;  3KZB A;  4BDZ A;  4FK2 A;  5FRM A;  3R9P A;  4KRE A;  4V19 S;  1TVR A;  1YJW N;  3CCV N;  1C1C A;  4Z4E A;  3DM2 A;  4H03 B;  5I9E B;  4YOW A;  3HI0 A;  3UB5 A;  3CCS N;  2I7N A;  1BI4 B;  3IG1 A;  4M3W A;  2CH5 A;  3LAL A;  3MN5 A;  3CMA N;  1IJJ A;  3C7N A;  1TL3 A;  1Q9X A;  1BQN A;  3CJB A;  2HHV A;  1U4B A;  1WNS A;  3LP0 A;  3ZSQ A;  4BRI A;  3H3O B;  4CHY A;  3L4Q A;  3L6Q A;  5F0X A;  2HF3 A;  3ZYY X;  4DTU A;  4N76 A;  3E1Y A;  4XH4 A;  2YCH A;  2F8S A;  2AA4 A;  5AQJ A;  4XH5 A;  1V4S A;  3K2P A;  3KKR A;  3NAE A;  3HZ6 A;  5LY3 A;  1YJN N;  1TKX A;  3RTV A;  2D5R A;  4N56 A;  5K14 A;  3I0R A;  4OGC A;  1VHX A;  3K59 A;  2QKK A;  1CZA N;  2BAN A;  2P51 A;  1VQ6 N;  1BHL A;  2QI2 A;  3OYI A;  4FL9 A;  1BA0 A;  3LDQ A;  2QTD A;  3QES A;  4X62 K;  1VQ8 N;  2B4J A;  5KPZ A;  4RW8 A;  3VGK A;  2D0C A;  1A5X A;  3SAF A;  3SAG A;  3SV4 A;  2HBK A;  5AQT A;  3NGY A;  3CPW M;  4JLH A;  2KKZ A;  1QZ5 A;  3HT3 A;  1JCE A;  4FJL A;  3DLH A;  5KQ8 A;  2WFB A;  1I94 K;  4WQ4 C;  4DSK A;  3SQ2 A;  3HSC A;  3VQQ A;  3DMJ A;  1ZBU A;  2F9T A;  4KB1 A;  3EKS A;  4MO4 A;  5GIN A;  1KFS A;  3VMF B;  4DR5 K;  2Q3S A;  2G8H A;  1T7P A;  3CFR A;  3VTI A;  1W7A A;  4IG3 A;  4DR1 K;  3TTC A;  4FLT A;  3G10 A;  4H0V B;  1GLE G;  5MLC Q;  3D2F B;  5EU7 A;  2QA4 N;  2NRR A;  3CC7 N;  1GLL O;  4ZTJ A;  4PUO A;  3HTV A;  4DV7 K;  3VEO A;  4CER A;  4Q0B A;  3J7Y P;  3HOS A;  1RT5 A;  4I2P A;  4DTR A;  1CLQ A;  4FWN A;  2E6M A;  2FBT A;  3LZI A;  2R7Y A;  3M1F A;  3DYA A;  4BY9 C;  3U4L A;  3RR7 A;  1TKZ A;  4E1N A;  4QCL A;  4JRP A;  3V6D A;  2UXD K;  2VG6 A;  4DS4 A;  2O8F A;  3C65 A;  3KK7 A;  3QEX A;  2HNZ A;  3VEV A;  4NXN K;  2ZGY A;  4IZ9 A;  4BC3 A;  1RBV A;  1RTD A;  1RTI A;  3OYD A;  1VK0 A;  1C0T A;  2ASP A;  3BUZ B;  4GMJ B;  4Z4F A;  3KIO A;  4U7B A;  2O4G A;  3I55 N;  1S1W A;  4K25 A;  4BRN A;  3BF3 A;  3UIQ A;  2HST A;  3I8B A;  1DTQ A;  3NH0 A;  1NJY A;  4FJ7 A;  4NXM K;  3VEW A;  4H5R A;  1QZ6 A;  1WLJ A;  5CR4 A;  4IJA A;  3EKU A;  1JLQ A;  3WNH A;  1VSL A;  1KRP A;  3LDS A;  3SV3 A;  2VQF K;  3SYZ A;  4B1V A;  1MWM A;  3QIP A;  1T05 A;  1TUY A;  1ZYQ A;  1WAJ A;  3K57 A;  1QVF M;  4DKW A;  1RGI A;  1NJI O;  3CJ9 A;  3WT0 A;  3PUF A;  5AFU A;  2W42 A;  3I56 N;  1K8K B;  1LAW A;  4HHT A;  4B9L A;  1NGJ A;  4M7Y A;  5FPD A;  1CXQ A;  2HHT A;  3ZET A;  1BIU A;  2VWK A;  1XNR K;  5C0Y A;  3DLL L;  3G4S N;  3ZT4 A;  3AV9 A;  3TAB A;  3HL8 A;  4DR6 K;  3TTF A;  3CIP A;  5M1Q A;  5KPT A;  4NLB A;  4XEI A;  3J81 O;  4DTP A;  5J2M A;  3PO5 A;  1MU2 A;  2UYT A;  3DRP A;  1T03 A;  3SUO A;  1HQU A;  4FJG A;  2B6A A;  5AQV A;  1JLE A;  4B9U A;  4ISE A;  2NRV A;  4OKE A;  3Q7C A;  3PX6 A;  4KHW A;  3AA2 A;  2O8C A;  1DLO A;  3C94 A;  2HOE A;  2GWK A;  3LP3 A;  3J80 O;  1QTM A;  1YTA A;  4E7J A;  4CEE A;  4CHQ A;  4YDU A;  2NRZ A;  3CG7 A;  3LDO A;  1ASU A;  4B1W B;  2GEM A;  4BRF A;  2QW9 A;  3H46 O;  1NK7 A;  4CZF A;  4JI0 K;  4DTS A;  1Q82 O;  5E84 A;  3DLG A;  1T6C A;  4BR5 A;  2FSK A;  3HPH A;  3NF8 A;  5FPM A;  3PSI A;  1EQY A;  5BRE A;  5CYM A;  3LPU A;  4FYD A;  1HPZ A;  4DU4 A;  3BZK A;  4CBU A;  3KD5 E;  3NH1 A;  3M8R A;  3QER A;  1LW0 A;  3SQ4 A;  1SV5 A;  4CZH A;  2KFN A;  1JLC A;  5BN8 A;  3VQC A;  1NGG A;  2H3G X;  3CM5 A;  3A5L C;  2QK9 A;  4DQS A;  5C15 A;  3VA0 A;  4BC4 A;  2EHG A;  4LF7 K;  4FW2 A;  5AQI A;  4CBX A;  4DF8 A;  1NK8 A;  5JMV A;  3OW2 M;  2G8F A;  1TUU A;  5HRN A;  3LWL A;  3QET A;  1OH5 A;  4M3X A;  4FLZ A;  1N34 K;  4FJN A;  1VAZ A;  4F3T A;  3ZSR A;  1RT7 A;  3NGZ A;  3ZSV A;  3D7E O;  4M7X A;  3K0S A;  3MN6 A;  3VQA A;  1TGO A;  1FKP A;  4E0D A;  3VQD A;  4FJK A;  1BIZ A;  4PL8 A;  3WUH A;  4E1M A;  3HP9 A;  2Z1I A;  2HND A;  4BR2 A;  3MXM A;  1N36 K;  3S3N A;  1NKB A;  1NG9 A;  4AF1 A;  4F9O A;  2A1S A;  4W5R A;  4R79 A;  3SCX A;  3VES A;  3T1Y K;  1T8E A;  1V4T A;  3KTQ A;  1KCF A;  4MLH A;  3MWP A;  3AO4 A;  4BRQ A;  4KFB A;  1KSP A;  1TYQ B;  5AQU A;  4FW1 A;  2IDO A;  1K9M O;  1VSJ A;  3C6U A;  4H5N A;  3ZT0 A;  4W5N A;  1IKY A;  5LJW A;  4JK9 A;  2PYJ A;  3DLB A;  3M6G A;  3ZEU A;  2KFZ A;  4JKD A;  4K41 A;  4RG8 A;  3U6F A;  2D4W A;  2PAV A;  4DSL A;  2FBV A;  4F2R A;  1NKC A;  4DQ8 A;  1RBT A;  4E3S A;  4EZ9 A;  3OS2 A;  3BGR A;  1KLM A;  4DTO A;  1DT9 A;  1LWC A;  5KRT A;  1X9W A;  2RHK A;  5AQS A;  1O1W A;  2OPS A;  3DXK A;  4LH4 A;  4LY7 A;  2E1Z A;  3P83 D;  2RKI A;  4DQQ A;  2HNY A;  4H5T A;  2BUP A;  1JLF A;  1RT2 A;  2IVO A;  4R5P A;  4A2B A;  2PY5 A;  1E3M A;  3LPT A;  3QEI A;  5JS1 A;  3W0L A;  5BR8 K;  3VGM A;  2GUI A;  4CJV A;  1Y64 A;  3T1H K;  1WOQ A;  2P9N B;  3S41 A;  3EY1 A;  4JKG A;  5BPM A;  4DSI A;  4OPH A;  1WB9 A;  4CZI A;  3CD6 N;  3MEG A;  3VOV A;  2XY6 A;  1VQ9 N;  5AZJ A;  4O4G A;  3OBW A;  3QML A;  3V1Q A;  1IO2 A;  3P31 A;  1ATS A;  1F21 A;  2PYL A;  3ZSZ A;  1Z05 A;  5E41 A;  4A57 A;  3AO5 A;  3CJ7 A;  3I33 A;  1IKV A;  3MAQ A;  1TK0 A;  1WUA A;  2QKB A;  4CJ4 A;  1EO1 A;  5IT9 O;  3TSP A;  4B1Y B;  4X66 K;  1BO5 O;  4FVM A;  4J2B A;  3A5N C;  2DFE A;  4BRE A;  1ZBL A;  5FPN A;  1KAY A;  3O4W A;  3THY A;  1WAF A;  2EX3 A;  3KVG A;  4KTW A;  4BDP A;  5AQR A;  1O13 A;  2YJF A;  3V1R A;  2RPI A;  1NGC A;  3DXM A;  4RW9 A;  4CJ5 A;  2O8E A;  3VQ5 A;  3CYM A;  3TSU A;  4LFB K;  3F9M A;  3VN5 A;  2UUC K;  3V9S A;  5ELZ A;  2A3Z A;  1J9A A;  4C8M A;  3OA9 A;  2E5L K;  4UQG A;  1EWQ A;  3BEX A;  1OVQ A;  1NK6 A;  1HJO A;  1KVC A;  4FWS A;  3KK3 A;  3QBW A;  4AM6 A;  1IBM K;  4I9Q A;  2OZS A;  3HBT A;  1LCU A;  1NBW A;  1GLF O;  2XY8 A;  3DWL A;  5HP1 A;  3ATV A;  3AGR A;  3OYG A;  1HNI A;  4HUF A;  4GKK K;  3L8B A;  2FXU A;  3P1G A;  4WCE L;  4YDU C;  4DV6 K;  1X1P A;  3LDP A;  1GOA A;  4O5B A;  4E7H A;  3AO2 A;  4BAC A;  3WXM B;  2E2O A;  3L2R A;  4W5O A;  4FJ8 A;  4DFP A;  2OPP A;  1L5U A;  3EYZ A;  4DFM A;  1N32 K;  3O9Q A;  1TV6 A;  3F73 A;  1WSG A;  3GE1 A;  2NRX A;  4H5V A;  3O08 A;  2P1J A;  3OYJ A;  4BR7 A;  1KFD A;  3NGI A;  3ID8 A;  3PY8 A;  3EL2 A;  4CJQ A;  5AQO A;  2YJE A;  3TSQ A;  5GAE P;  4DUZ K;  1QQC A;  2UUB K;  3E66 A;  4RTF D;  4JI3 K;  5HL7 L;  1HQE A;  4E7I A;  3OYB A;  2ZJP L;  3AO3 A;  5ADX H;  3THW B;  3SBG A;  3M5R A;  4F4K A;  3IMX A;  4KB0 A;  1YT3 A;  4ISF A;  1CZB A;  4CJL A;  4B9S A;  4GVM A;  1IH7 A;  3TAG A;  2P9I A;  3RWU A;  2HHW A;  2P9P B;  3VF2 A;  1WBD A;  2GBZ A;  4JEP A;  4YOX A;  4W5T A;  2OTL N;  1WSH A;  4RW6 A;  3K9J A;  4RW4 A;  4DF4 A;  2VCP A;  3NBP A;  3BF1 A;  2GEL A;  3SZ2 A;  3A8Y A;  2OTJ N;  3UKU A;  1RNH A;  3G25 A;  4FM1 A;  3LAK A;  2QXL A;  4K8X A;  4DV2 K;  1TKD A;  4NYF A;  1TAU A;  4CF0 A;  1VRU A;  4FOE A;  2NRT A;  4KHN A;  2E2P A;  3H6E A;  4ILJ A;  3ENO A;  3PIP L;  4KI4 A;  5JS2 A;  2E4L A;  3KD1 E;  4J2D A;  2ZWH A;  4DHY A;  4N5S A;  4IDH A;  4M63 C;  3MDQ A;  1RT1 A;  4FCY A;  4DTM A;  4B9V A;  3LM9 A;  3LL3 A;  4DMN A;  3SUN A;  5H1S Q;  4KTQ A;  3DLK A;  4DV3 K;  1Y97 A;  2FSN A;  1DGK N;  4C8K A;  4YHH K;  1HKB A;  5GIO A;  1REV A;  4GV3 A;  4B3T K;  1FKO A;  1BOT O;  4JI7 K;  1XMO K;  1BI4 A;  2QWN A;  5JLF A;  4FWR A;  5BRF A;  2AP1 A;  5KGX A;  3DLE A;  4GVE A;  1W0H A;  2VWB A;  4BC5 A;  4X65 K;  2I7P A;  4A5A A;  3QEP A;  5BRD A;  3HP6 A;  3V1O A;  4IDK A;  2O8D B;  1GLC G;  4BRP A;  2X6N A;  1NWK A;  3OS0 A;  1RCH A;  1RDA A;  1NLV A;  4Z4G A;  4WYB A;  1BU6 O;  3NVK A;  2Q2R A;  4Z4I A;  3O5B A;  1SL0 A;  5LMN K;  2A6A A;  1S9E A;  4WFB L;  4L3Q A;  2ITM A;  2HHX A;  1YXQ A;  3HPO A;  1SKR A;  5FRO A;  2F8T A;  4EP4 A;  4LF6 K;  3TAP A;  4CEC A;  4MDB A;  5CYQ A;  4BG9 A;  2AJQ A;  4EHU A;  2P9K B;  5SWM A;  3THX B;  4CW7 B;  2ATQ A;  2YV0 X;  3ZSX A;  4DFJ A;  3RMA A;  1X3N A;  5KQD A;  3CXC M;  3QLH A;  3ZLJ A;  3M3Z A;  5C2F A;  1VSM A;  4MLE A;  3RMC A;  3NF9 A;  4CFD A;  2HB5 A;  2FF6 A;  4AM7 A;  4IXC A;  3KWG A;  4CZE A;  5E26 A;  1BUP A;  3RSE B;  3CCE N;  1RDC A;  1NU0 A;  4JKF A;  3ZCM A;  3VQB A;  1ATN A;  1LAV A;  2VG7 A;  4IWV A;  2YNI A;  4CJT A;  5A2Q O;  4QS7 A;  4CHO A;  1SL1 A;  4E19 A;  5KPR A;  3NE6 A;  3SK3 A;  4QS8 A;  5CY4 A;  5GAG P;  1UA0 A;  3CME N;  3UE5 A;  2O8B B;  2EWS A;  4CFC A;  3AO1 A;  3MN9 A;  4JNE A;  1H1V A;  3D2F A;  2ZF5 O;  3CCR N;  2XHB A;  2OCE A;  4CED A;  1JCF A;  2QWR A;  1Z25 A;  5AJ3 K;  3OJS A;  1J6Z A;  2D0A A;  5JLH A;  5AQL A;  1S3X A;  4AIL C;  1NGE A;  1QQM A;  1S22 A;  4AHU A;  4FJX A;  2IC3 A;  3GL1 A;  3U9Z A;  3NVM A;  5EOY A;  2G8V A;  3QB0 A;  3SPY A;  3EE9 A;  2HHU A;  2ETJ A;  3P38 A;  3V9X A;  1ESV A;  2B5J A;  4GV9 A;  4KH4 A;  2IS3 A;  1VQO N;  1RT6 A;  5EY4 A;  3WXL A;  4AHT A;  4C1N I;  1Q86 O;  3SBT A;  3M8P A;  3MXI A;  3N4Q A;  1BGX T;  3EE8 A;  3K5O A;  4M3T A;  2VQE K;  1YIJ N;  5TKW A;  1RBU A;  1NGD A;  3QEV A;  1YUW A;  4B8C A;  1FK9 A;  2Q0U A;  3H1Q A;  1VQ4 N;  2ZJR L;  2YX6 A;  5J2Q A;  1B92 A;  3JAM O;  3WEE B;  1EWR A;  1VQ7 N;  5BRH A;  1UWB A;  2F4V K;  5AQW A;  4IBN A;  1M1K O;  4BRH A;  1NOZ A;  3AVB A;  4O44 A;  4KI6 A;  3LAN A;  5LL6 Z;  1FW6 A;  3O1W A;  4W5Q A;  3H08 A;  4DWI A;  1XQS C;  3AVF A;  1TK5 A;  3EZ5 A;  4BR4 A;  3ASM A;  1VSI A;  2XO7 A;  4B3M K;  3PLA A;  4K0K K;  3AVK A;  3U3G A;  4LF8 K;  1NKE A;  3WQT A;  4M3Y A;  2Q1N A;  1D9F A;  3VF4 A;  1D5A A;  1W97 L;  5F2R A;  4JHD B;  3N4P A;  1XUP O;  4CVN E;  4JI5 K;  4U67 L;  3SUQ A;  2E8A A;  3H3N O;  4FJ5 A;  2J4R A;  1K8K A;  1Q18 A;  5FRN A;  4I9L A;  5HRR A;  5AFU H;  1E4G T;  2NLX A;  3VF6 A;  2JWL A;  1K8A O;  3AAQ A;  2OAN A;  4EZ6 A;  1SS6 A;  3CER A;  1RFQ A;  1W2B M;  4B08 A;  4BVP A;  5M1O A;  2A5X A;  1NK9 A;  3CPE A;  4CHN A;  3OHR A;  4IEE A;  5KI6 A;  4B1X B;  5J2P A;  2OPQ A;  4TSX A;  3THV A;  2RE2 A;  1HNX K;  4ZHR A;  5AQN A;  3MMV A;  1NK5 A;  4CIF A;  2OZM A;  2BTF A;  2X6S A;  1VQK N;  2E2Q A;  2Z1J A;  1B9D A;  3P39 A;  2W6L A;  1HNV A;  3FZK A;  2ZD1 A;  1SQK A;  3U8X A;  4IOA L;  1QQN A;  2WC9 A;  1J53 A;  1VQN N;  1BDG A;  3D2E B;  4XIU A;  1U2V B;  1ZBH A;  1ZXO A;  4I7F A;  4FZZ A;  3PV8 A;  3U9D A;  3AVC A;  3O9S A;  1YHQ N;  3TAM A;  2BH1 A;  1W9H A;  1K6Y A;  2I5J A;  2GX9 A;  1G99 A;  2CGL A;  1BIS A;  2KHO A;  3H1V X;  4BVO A;  4Q5V A;  3L3V A;  5HRP A;  1D9D A;  2XY5 A;  1NMN A;  1HPM A;  3B6P A;  4DTX A;  4M3R A;  2OPR A;  5GIP A;  3O1B A;  2XY7 A;  1OH7 A;  3QIO A;  1GLA G;  3R1X A;  3NF6 A;  4C23 A;  4FLX A;  2FSJ A;  4JS4 A;  4E1J A;  3TI0 A;  2YKN A;  1JLB A;  3A0I X;  3C6A A;  4DV0 K;  4YOU A;  4C8O A;  1Q7Y O;  1GLD G;  1RDW X;  3SJH A;  1BWF O;  3OVN A;  3FZM A;  4OO1 J;  5FPE A;  2QWQ A;  2YHW A;  3TR8 A;  3BZC A;  4H0P A;  4CE9 A;  3KHY A;  4HVJ A;  5J1E A;  3V9Z A;  1YJ9 N;  4H4O A;  3HM8 A;  4DR4 K;  4DS5 A;  1JXB A;  2LSN A;  2YKM A;  4K42 A;  4B3O A;  2E88 A;  1SUQ A;  1X9J A;  3KLH A;  4JD2 B;  3DLR A;  3LP1 A;  4PKI A;  1NK0 A;  1XHX A;  3R6M A;  2P9U B;  1QSL A;  3FLC O;  2F9W A;  1N8R O;  1C1B A;  3EZW A;  2KLA A;  3KLE A;  4DR2 K;  3CC4 N;  1HYS A;  5JVH L;  1TYQ A;  3C0B A;  1NM1 A;  1ITG A;  4LH5 A;  1LWF A;  4DSF A;  4CJS A;  4CGH A;  3O8M A;  2F96 A;  4IEI A;  3K5L A;  3FR0 A;  1MWK A;  3F9K A;  4CEO A;  4BRM A;  2V7Y A;  1T3V A;  3HST B;  1ASW A;  2CGK A;  3L2Q A;  3VER A;  4ID1 A;  3J7Z O;  5AQP A;  3E9O A;  3WXJ A;  4OPK A;  3VQ9 A;  5EX5 A;  3K5M A;  4CFB A;  5M1N A;  1EX4 A;  3OTO K;  5DK5 A;  4H4M A;  1GLJ O;  3CFP A;  3OJU A;  3MED A;  1R59 O;  4RWT A;  1NJW A;  5AQF A;  1ZBS A;  4IOC L;  4E7L A;  4KH6 A;  3AVI A;  4ISG A;  4OLA A;  5C10 A;  4GV6 A;  4DFK A;  1P8Z A;  3ULE B;  4E89 A;  3HO1 A;  3A5O C;  3E9P A;  4LSN A;  3T69 A;  1VSK A;  2HHQ A;  4PHT X;  1RT4 A;  2YNF A;  4BRG A;  1S1U A;  1VQL N;  4DLG A;  4CHP A;  3FGU A;  4LSL A;  1NOY A;  4GW6 A;  2Q31 A;  3TTD A;  1QHA A;  2P9N A;  3B6O A;  4FWM A;  4M3U A;  4FJH A;  3LDL A;  3IDH A;  1WBB A;  3C6T A;  3CQ8 A;  4DQR A;  4FPB A;  1HJR A;  2V51 B;  1KQS M;  3NCI A;  4UY8 O;  3RMB A;  4KHS A;  1YVU A;  1DEJ A;  4JKH A;  3GG4 A;  2HBM A;  3L2V A;  4CIG A;  4CJR A;  3ENH A;  3AVA A;  1L3V A;  4IOX A;  3AA3 A;  5GAH P;  4NCG A;  4YOR A;  1SKW A;  4KTZ A;  2Q0R A;  4CEQ A;  4KV8 A;  4IO8 A;  3NDK A;  4I6M B;  4ILG B;  3T1A A;  2NRW A;  3CI5 A;  4CZK A;  3NH2 A;  5HOO A;  1CZ9 A;  2Y1I A;  4JYA K;  3AVM A;  3AAR A;  3CCM N;  5J2N A;  2DY4 A;  2ZJQ L;  1HX1 A;  4OGE A;  3IS9 A;  4IFE A;  5I42 A;  4CK2 A;  1IV0 A;  5AQH A;  2P5O A;  3OYE A;  1HNW K;  3JXU A;  2UUA K;  4FJ9 A;  1LWE A;  2P9L B;  4B9N A;  4DUY K;  4YOV A;  3CF5 L;  3SI6 A;  1TAQ A;  5CZ2 A;  2FF3 B;  3D45 A;  4PWD A;  4EP5 A;  4JV5 K;  4N47 A;  2GTD A;  3J8A A;  4CES A;  1HYV A;  4ZTF A;  2P9L A;  2XRI A;  1TL1 A;  2PBD A;  4KRF A;  5EVZ A;  3F5T A;  4JK8 A;  3ZSY A;  3OY9 A;  4LF9 K;  5AQM A;  1OH8 A;  4WE1 A;  2D1K A;  1T44 A;  4IFY A;  4JKA A;  3BP8 A;  1D8Y A;  5I3U A;  2ZM6 K;  3DI6 A;  4DSJ A;  2A42 A;  4RCH A;  4BRA A;  3ULD A;  3ATU A;  4OPJ A;  1T6D A;  4CJ3 A;  1XNQ K;  1C0M A;  4MQ3 A;  2YHX A;  4CD1 A;  3O80 A;  4MFB A;  3ZX0 A;  4AH9 A;  3HOT A;  4CBW A;  4F2S A;  1NGI A;  4CZJ A;  2G8U A;  3O3H A;  2ZGZ A;  4YOT A;  4Z4H A;  4H0T B;  5AZI B;  3THW A;  2FLO A;  1YIT N;  3RRH A;  2HVI A;  4IG0 A;  3UKR B;  1IG9 A;  4FJJ A;  1MA9 B;  4FWP A;  2ZE2 A;  2HF4 A;  2P9P A;  2F7T A;  4FXD A;  1X3M A;  4DTN A;  3D0P A;  3DOK A;  1KAZ A;  2KQ2 A;  3BDP A;  3WQU A;  4KKO A;  4BQZ A;  4FM0 A;  2WOM A;  3QEW A;  3ZX2 A;  1OKJ A;  3DOL A;  4FJM A;  3DJC A;  2BGG A;  1Q81 O;  1QS4 A;  4LFA K;  5AQK A;  1KC8 O;  3EN9 A;  4CHZ A;  2BDP A;  4FJI A;  1XWL A;  2WTU A;  5DM6 L;  4OJR A;  3HYF A;  5IWA K;  5JVG L;  4BRL A;  5LJV A;  4OX9 K;  1BG3 A;  4NLC A;  4LC9 B;  4I2Q A;  3ZT2 A;  4IKF A;  1HNZ K;  1G15 A;  3C7N B;  1JL2 A;  4B3S K;  3K58 A;  1RDD A;  4OKK A;  4EFH A;  3RRG A;  3GBT A;  2VG5 A;  1LW2 A;  1GOC A;  4JS5 A;  3CET A;  4WQ5 A;  4DU3 A;  1CXU A;  2UXC K;  3IKM A;  4FLV A;  1SKS A;  3PO4 A;  4YFU A;  3MEE A;  1C6V A;  1JCG A;  2YHY A;  3GOI A;  4OKJ A;  1U04 A;  4G1Q A;  3LDN A;  4YOY A;  4DQI A;  1HR0 K;  3VEY A;  2OA8 A;  1S6P A;  2OYQ A;  3L0Q A;  2ZQB A;  4DLE A;  2IIR A;  1JL1 A;  4CJE A;  4M45 A;  3S3M A;  1UA1 A;  2D0P A;  4FK4 A;  4BGA A;  5AQQ A;  4FWQ A;  2GUP A;  4CGD A;  1NNE A;  2HBL A;  4WF9 L;  4FWL A;  4LD0 A;  3KLI A;  4HUG A;  3CCJ N;  4BRC A;  3MEC A;  3HVT A;  2CGJ A;  4CF9 A;  1ILY A;  1VQ5 N;  4CCH A;  3RVC A;  4G9Z A;  3CJ1 A;  1EKE A;  4IO9 L;  4CJU A;  3SNN A;  3CHW A;  4O8U A;  3KK2 A;  4ELU A;  1IKW A;  4BC2 A;  4Z4C A;  1ZBI A;  4CJK A;  2O8D A;  3OS1 A;  1HMV A;  4EHT A;  4QOZ B;  3VPZ A;  3SMP A;  4AHV A;  3KK1 A;  3T3F A;  4NCB A;  3Q7B A;  3ITH A;  2YNH A;  1NK4 A;  4H5W A;  1Q8I A;  2HMI A;  2A41 A;  4ELT A;  1U48 A;  4HTL A;  4BDY A;  4A2A A;  1KXP A;  1U49 A;  4J2E A;  2QWM A;  3I0S A;  3DAW A;  1JJ2 M;  1J54 A;  2X78 A;  3U3Y A;  3QBX A;  4AHR A;  3TWH A;  4FZY A;  1ASV A;  4BRD A;  1LOT B;  3CJC A;  2E1Y A;  1ZC6 A;  4DR7 K;  3S9H A;  2FBY A;  2P9K A;  2P5G A;  1SAZ A;  3ZX3 A;  3THX A;  2YNG A;  5M1F A;  2DTU A;  1LV5 A;  3VEX A;  5JIC A;  3H45 C;  1S1T A;  1N6Q A;  3CCQ N;  3RR8 A;  2HW3 A;  4BE1 A;  4FPA A;  3VTH A;  1JLG A;  4CGJ A;  3HPG A;  3VQE A;  3V9U A;  1J5E K;  1ATR A;  3F2K A;  5BPN A;  4B9T A;  2HHS A;  2FBX A;  1VQP N;  4DQP A;  3RSE A;  3O3F A;  3A2F A;  5FLX O;  4CJW A;  4JK7 A;  4AQY K;  4AHC A;  3QFP A;  4H0O A;  1R0A A;  1JXE A;  4CJ7 A;  3CCL N;  2RN2 A;  1QSY A;  2A40 A;  2KTQ A;  1S9G A;  3LM2 A;  5B8H A;  1WSJ A;  2GWJ A;  3ZT1 A;  2QEX N;  1YVN A;  3AVL A;  5HLF A;  3SPZ A;  2O8B A;  3O4N A;  1FJG K;  2BE2 A;  3MX2 A;  2O8F B;  4GKJ K;  4FLU A;  3P5J A;  4DSE A;  1U45 A;  2NUB A;  1K73 O;  2E2N A;  1BL3 A;  4BR9 A;  2Y1J A;  4DU1 A;  4H0Y B;  4NB4 A; 
#chains in the Genus database with same CATH homology
 1HPM A;  2ASM A;  3TSP A;  4B1Y B;  5BR9 A;  3CCU N;  3KZB A;  5GIP A;  1BO5 O;  3R9P A;  3A5N C;  1HKC A;  3O1B A;  4BRE A;  1YJW N;  3AGK A;  5FPN A;  1KAY A;  3CCV N;  3O4W A;  1GLA G;  3R1X A;  3KVG A;  1XC3 A;  4C23 A;  4H03 B;  5DM7 L;  5I9E B;  5AQG A;  4CZM A;  4YOW A;  4CZL A;  5AQR A;  1O13 A;  3HI0 A;  2YJF A;  3NMU A;  1NGC A;  2FSJ A;  3DXM A;  3ENB A;  4E1J A;  3UB5 A;  3CCS N;  2I7N A;  3A0I X;  3C6A A;  2CH5 A;  4FVU A;  4YOU A;  3TSU A;  1M90 O;  3MN5 A;  3OBY A;  4OPA A;  1IJJ A;  1GLD G;  1RDW X;  3C7N A;  3SJH A;  3F9M A;  3CMA N;  1Q7Y O;  1BWF O;  3FZM A;  4OO1 J;  3CJB A;  5ELZ A;  5FPE A;  4BRI A;  5F0X A;  3H3O B;  2QWQ A;  2YHW A;  2A3Z A;  3L4Q A;  2HF3 A;  3L6Q A;  4H0P A;  3ZYY X;  4CZG A;  3OA9 A;  3KHY A;  3C6H A;  1YI2 N;  1YJ9 N;  3E1Y A;  3BEX A;  3HM8 A;  2QWP A;  4XH4 A;  1HJO A;  2YCH A;  4K42 A;  2E88 A;  2AA4 A;  2Q36 A;  3IUC A;  4FWS A;  3WEE A;  5AQJ A;  1X9J A;  5CHI A;  4XH5 A;  4JD2 B;  3QBW A;  5GAD P;  4AM6 A;  1V4S A;  1YAG A;  3HBT A;  1LCU A;  1OVY A;  1NBW A;  3HZ6 A;  3QIC A;  1GLF O;  3DWL A;  5LY3 A;  4PKI A;  1YJN N;  3ATV A;  3ZET B;  3AGR A;  3PIO L;  3R6M A;  2P9U B;  3FLC O;  2F9W A;  1N8R O;  3EZW A;  2KLA A;  4DCH A;  4FOI A;  4PKG A;  2FXU A;  4WCE L;  3CC4 N;  1CZA N;  3WXI A;  4YDU C;  5JVH L;  1TYQ A;  1VQ6 N;  1C0F A;  1NM1 A;  2QI2 A;  3C0B A;  3LDP A;  3CJA A;  1BA0 A;  1SZ2 A;  3LDQ A;  4FL9 A;  2QTD A;  3WXM B;  2E2O A;  1VQ8 N;  5KPZ A;  3O8M A;  3VGK A;  4IEI A;  3FR0 A;  4CD3 A;  1MWK A;  3SAF A;  4JHD A;  3SAG A;  3O9R A;  4A61 A;  2HBK A;  2NRH A;  5AQT A;  3CPW M;  5C2D A;  2KKZ A;  3O9Q A;  1QZ5 A;  1T3V A;  1JCE A;  1C0G A;  2CGK A;  2V7Y A;  4BRM A;  3VER A;  3GE1 A;  2NRX A;  5AQP A;  3J7Z O;  3E9O A;  4H5V A;  3O08 A;  5KQ8 A;  2WFB A;  4WQ4 C;  4BR7 A;  3HSC A;  3WXJ A;  4DB3 A;  3ID8 A;  3AAP A;  5EX5 A;  3EL2 A;  5AQO A;  2YJE A;  3TSQ A;  5M1N A;  5GAE P;  2F9T A;  3E66 A;  1GLJ O;  2HMP A;  4RTF D;  4CI6 A;  5HL7 L;  5C12 A;  3EKS A;  4MO4 A;  2ZJP L;  1R59 O;  4RWT A;  5GIN A;  5ADX H;  3VMF B;  4PL7 A;  3SBG A;  5AQF A;  1ZBS A;  3M5R A;  4IOC L;  3A5M C;  3HRG A;  3IMX A;  4KH6 A;  4ISG A;  3VTI A;  4HWI A;  5C10 A;  4MDA A;  4GV6 A;  4ISF A;  3TTC A;  4H0V B;  1GLE G;  1E4F T;  1P8Z A;  3L4I A;  3TPQ A;  5MLC Q;  3ULE B;  3D2F B;  2P9I A;  2ZJQ L;  2P9P B;  2QA4 N;  2NRR A;  3A5O C;  3E9P A;  3VF2 A;  3T69 A;  3CC7 N;  4JEP A;  4PHT X;  4BRG A;  4BR0 A;  1GLL O;  4YOX A;  2OTL N;  1VQL N;  3HTV A;  3FGU A;  3K9J A;  3VEO A;  2Q31 A;  2VCP A;  1QHA A;  2P9N A;  4WQ5 C;  3TTD A;  3HOS A;  3ID6 A;  2QWO A;  4B9Q A;  4FWN A;  3BF1 A;  4FWM A;  4A62 A;  2GEL A;  3MX5 A;  3A8Y A;  5BPL A;  3D2E A;  2OTJ N;  3UKU A;  3M1F A;  3LDL A;  3IDH A;  3VET A;  1S72 N;  1U2V A;  4FPB A;  2V51 B;  4BY9 C;  3U4L A;  3G25 A;  1KQS M;  4O8K A;  4UY8 O;  2QXL A;  1DEJ A;  4JKH A;  3GG4 A;  2HBM A;  4FOE A;  2NRT A;  2E2P A;  3H6E A;  4ILJ A;  3ENO A;  3PIP L;  3ENH A;  2CH6 A;  3C65 A;  3KK7 A;  4IOX A;  4WFA L;  2ZWH A;  3VEV A;  4BQL A;  4DHY A;  5GAH P;  2ZGY A;  4IZ9 A;  4IDH A;  4M63 C;  1NMD A;  3MDQ A;  4BG8 A;  4BC3 A;  4YOR A;  2D0O A;  3LM9 A;  2Q0R A;  2WBN A;  3LL3 A;  4IO8 A;  5H1S Q;  4I6M B;  4ILG B;  2FSN A;  2ASP A;  3BUZ B;  1DGK N;  2NRW A;  3CI5 A;  4CZK A;  1HKB A;  5GIO A;  4BRO A;  5HOO A;  1Z6R A;  1GLB G;  4U7B A;  4GV3 A;  3I55 N;  4K25 A;  3MN7 A;  3BF3 A;  3AAR A;  4BRN A;  3TU5 A;  2HST A;  3I8B A;  1BOT O;  3CCM N;  3QDK A;  4BRK A;  1HX1 A;  2QWN A;  4JN4 A;  4H5R A;  1QZ6 A;  4FWR A;  4JKE A;  3VEW A;  5JLF A;  5BRF A;  5CR4 A;  4IJA A;  5CE3 A;  3EKU A;  1QQO A;  2AP1 A;  4ILH A;  4IFE A;  3R8E A;  5AQH A;  4IJN A;  4GVE A;  4B1V A;  2VWB A;  4FO0 A;  4BC5 A;  1MWM A;  3JXU A;  2I7P A;  4A5A A;  2P9L B;  1TUY A;  5BRD A;  3FFK B;  3QFU A;  1GLC G;  2QWL A;  3ZEU B;  4BRP A;  4DKW A;  1RGI A;  1QVF M;  4YOV A;  1NWK A;  1NJI O;  3CJ9 A;  4Y0W A;  1NLV A;  3K9K A;  3MK6 A;  3WT0 A;  5AFU A;  4WYB A;  3CF5 L;  2FF3 B;  1BU6 O;  2IVP A;  3I56 N;  4O5F A;  1HLU A;  1K8K B;  3NVK A;  2Q2R A;  4JD2 A;  1NGJ A;  5M1P A;  4M7Y A;  2GTD A;  3O5B A;  3J8A A;  5FPD A;  3P4I A;  3IFR A;  4MO5 A;  2P9L A;  2A6A A;  3ZET A;  4WFB L;  4L3Q A;  2PBD A;  2ITM A;  5C0Y A;  2P9U A;  5EVZ A;  3G4S N;  3F5T A;  4JK8 A;  3DLL L;  1YXQ A;  4Z94 A;  2E20 A;  5AQM A;  3DXK B;  2PFU A;  3TTF A;  2D1K A;  1T44 A;  3CIP A;  4MDB A;  5M1Q A;  3O9U A;  4JKA A;  4NLB A;  4BG9 A;  3BP8 A;  4XEI A;  5KPT A;  3VEZ A;  4EHU A;  3B8A X;  2W41 A;  2P9K B;  2UYT A;  2A42 A;  2V52 B;  3KWI A;  4RCH A;  3VGL A;  4BRA A;  3O9T A;  1X3N A;  5AQV A;  4BGB A;  5KQD A;  3CXC M;  4H0X B;  3M3Z A;  5C2F A;  4ISE A;  2NRV A;  3Q7C A;  3ATU A;  1T6D A;  4MLE A;  2FF6 A;  4AM7 A;  2HOE A;  4IXC A;  2GWK A;  3KWG A;  1NGA A;  2YHX A;  3W3D A;  4CD1 A;  4CZE A;  4JKG B;  3O80 A;  5E26 A;  1BUP A;  3ZX0 A;  3RSE B;  4CBW A;  3HOT A;  3CCE N;  1NGI A;  4CZJ A;  4YDU A;  2NRZ A;  4JKF A;  3LDO A;  3VEN A;  3JS6 A;  4B1W B;  1ATN A;  2ZGZ A;  4IWV A;  4YOT A;  2GEM A;  4BRF A;  2QW9 A;  4H0T B;  5AZI B;  3H46 O;  5AZJ B;  3SMS A;  3G71 N;  1NGH A;  4QS7 A;  2FLO A;  1YIT N;  4GY2 B;  1KAX A;  4CZF A;  2HBJ A;  5KPR A;  3SK3 A;  2NZT A;  4QS8 A;  5E84 A;  1Q82 O;  1T6C A;  4BR5 A;  5GAG P;  3CME N;  3UKR B;  3UE5 A;  2EWS A;  2FSK A;  5FPM A;  1EQY A;  5BRE A;  4C1N K;  1MA9 B;  1HUX A;  4FWP A;  3MN9 A;  4JNE A;  4EAH D;  3ULE A;  2HF4 A;  1H1V A;  3D2F A;  2ZF5 O;  4WQ4 A;  4CBU A;  3CCR N;  2P9P A;  2YI1 A;  2F7T A;  1X3M A;  1JCF A;  2QWR A;  1KAZ A;  1J6Z A;  3WQU A;  5JLH A;  5AQL A;  1S3X A;  5AQX A;  4BQZ A;  4CZH A;  1NGE A;  1KD1 O;  1QQM A;  1S22 A;  1U6Z A;  3ZX2 A;  5BN8 A;  1OKJ A;  1NGG A;  5M1K A;  3DJC A;  2H3G X;  3GL1 A;  3U9Z A;  1Q81 O;  3NVM A;  5EOY A;  3O6W A;  3A5L C;  3QB0 A;  5AQK A;  5BN9 A;  1KC8 O;  3EE9 A;  3EN9 A;  4FSV A;  3P38 A;  5C15 A;  3SAH A;  5DM6 L;  4BC4 A;  5JVG L;  1ESV A;  4BRL A;  5LJV A;  3DXM B;  4GV9 A;  4KH4 A;  1BG3 A;  4NLC A;  4LC9 B;  5AQZ A;  4CBX A;  5AQI A;  1VQO N;  5EY4 A;  3WXL A;  4B1U B;  5JMV A;  3OW2 M;  4C1N I;  1TUU A;  3SBT A;  1Q86 O;  5F1X A;  3C7N B;  3N4Q A;  2VGN A;  1VAZ A;  3E9L A;  3EE8 A;  1YF5 L;  4EFH A;  3FZF A;  3GBT A;  3G6E N;  2VYP A;  1YIJ N;  3CET A;  5TKW A;  4WQ5 A;  4NO7 A;  3D7E O;  4M7X A;  1NGD A;  1YUW A;  3IKM A;  2Q0U A;  3MN6 A;  3H1Q A;  1VQ4 N;  1JCG A;  3GOI A;  2YHY A;  2ZJR L;  2YX6 A;  3LDN A;  4PKH A;  4YOY A;  3WEE B;  3VEY A;  5EXW A;  3MCA B;  1VQ7 N;  4PL8 A;  4I6M A;  1D4X A;  3L0Q A;  3WUH A;  5BRH A;  4BR2 A;  2DPN A;  2IIR A;  2D0P A;  3GDQ A;  4BGA A;  5AQQ A;  4FWQ A;  2GUP A;  4AF1 A;  5AQW A;  4J8F A;  4F9O A;  1M1K O;  4BRH A;  2HBL A;  4WF9 L;  4FWL A;  3WXK A;  4R79 A;  3VES A;  3O1W A;  1V4T A;  3R3L A;  3MWT A;  3CCJ N;  1XQS C;  4BRC A;  4A59 A;  4BR4 A;  1MDU B;  5AR0 A;  4MLH A;  3MWP A;  2CGJ A;  4BRQ A;  1ILY A;  1TYQ B;  5AQU A;  1NGF A;  3PLA A;  1VQ5 N;  1K9M O;  3WQT A;  4WFN L;  1RDU A;  3FZH A;  3RVC A;  4G9Z A;  2Q1N A;  3CJ1 A;  3VF4 A;  4KH5 A;  4IO9 L;  4H5N A;  3CHW A;  3FE1 A;  4O8U A;  2ASO A;  5LJW A;  4JK9 A;  1W97 L;  4BC2 A;  5F2R A;  1BA1 A;  3M6G A;  4JHD B;  3D6R A;  3ZEU A;  4B1Z A;  3N4P A;  4EHT A;  1XUP O;  4JKD A;  4U67 L;  4K41 A;  2D4W A;  3VPZ A;  2E8A A;  3FZL A;  2PAV A;  3H3N O;  3SMP A;  2J4R A;  1K8K A;  1Q18 A;  1P90 A;  3Q7B A;  4DQ8 A;  1DKG D;  5AFU H;  4H5W A;  2A41 A;  4JKC A;  1E4G T;  2NLX A;  3VF6 A;  2JWL A;  4XH1 A;  5ADX A;  3AAQ A;  1K8A O;  2OAN A;  4HTL A;  4A5B A;  1SS6 A;  4A2A A;  1KXP A;  1DT9 A;  1RFQ A;  3CER A;  2QWM A;  1W2B M;  4BVP A;  5M1O A;  3DAW A;  1JJ2 M;  2RHK A;  5AQS A;  3QBX A;  4JKB A;  3DXK A;  2Q97 A;  2A5X A;  4GNI A;  4BRD A;  3CPE A;  2E1Z A;  1LOT B;  2VGM A;  3CJC A;  3OHR A;  2E1Y A;  2W40 A;  1ZC6 A;  4IEE A;  4H5T A;  2P9K A;  4JAX A;  1SAZ A;  4B1X B;  2BUP A;  3ZX3 A;  5M1F A;  1NGB A;  2RE2 A;  2IVO A;  3VEX A;  5JIC A;  3H45 C;  5AQN A;  3CCQ N;  3MMV A;  4A2B A;  2P9I B;  3T7Z A;  2BTF A;  3CQX A;  2P9S B;  1VQK N;  2E2Q A;  4FPA A;  2QM1 A;  3VTH A;  3W0L A;  4QS9 A;  3P39 A;  3AY9 A;  3VGM A;  3EO3 A;  4KBO A;  1VQM N;  3FZK A;  1ATR A;  1SQK A;  2V7Z A;  3U8X A;  1QQN A;  1Y64 A;  4IOA L;  2WC9 A;  3F2K A;  1WOQ A;  2JWK A;  2P9N B;  3S41 A;  5BPN A;  4JKG A;  4K43 A;  5BPM A;  1VQP N;  3RSE A;  1VQN N;  1BDG A;  1QVG M;  4OPH A;  3D2E B;  4JK7 A;  3UKU B;  4CZI A;  3QFP A;  3CD6 N;  3VOV A;  4H0O A;  1U2V B;  1VQ9 N;  1ZXO A;  4CJ7 A;  2P9S A;  3CCL N;  5AZI A;  5AZJ A;  3MCP A;  3OBW A;  3QML A;  2NNW A;  2A40 A;  2WUS A;  3P31 A;  2IVN A;  3LM2 A;  5B8H A;  3U9D A;  4FWK A;  2GWJ A;  3O9S A;  1ATS A;  2QEX N;  1YVN A;  1YHQ N;  1Z05 A;  5TKY A;  3UKR A;  2BH1 A;  4FWO A;  4A57 A;  1IG8 A;  3MX2 A;  3SLC A;  3CJ7 A;  4EIA A;  1HKG A;  1G99 A;  2CGL A;  2GX9 A;  3I33 A;  3CC2 N;  2KHO A;  3H1V X;  4BVO A;  1WUA A;  1K73 O;  2E2N A;  4BR9 A;  3CQY A;  5AQY A;  4H0Y B;  4NB4 A;  1EO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...