2CH5A

Crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
347
structure length
344
Chain Sequence
PQFMAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGRAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Human N-Acetylglucosamine Kinase in Two Complexes with N-Acetylglucosamine and with Adp/Glucose: Insights Into Substrate Specificity and Regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NAGK PROTEIN
total genus 113
structure length 344
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.59: N-acetylglucosamine kinase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch5A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch5A02
2GTDA 1ATSA 5AQRA 1NGGA 4ISGA 2GEMA 5AQGA 3H46O 3A5MC 3DXMA 4WQ4A 3ATVA 2AA4A 3SK3A 3UB5A 1WOQA 3HSCA 4BC2A 5TKYA 3WUHA 3HM8A 1V4TA 2E2QA 4H5VA 4BGAA 3TU5A 4BRFA 1NGHA 3FZHA 3VEXA 3AARA 3GOIA 4RTFD 3W0LA 4IO8A 3LDNA 4QS8A 2P9LA 3QMLA 1BA1A 4DCHA 4BR2A 1J6ZA 2A41A 4MO5A 3CHWA 3LDOA 2ZGYA 1GLCG 5FPEA 3LDLA 4B1YB 5EXWA 1S22A 2FF6A 2YHXA 3SMSA 1Z6RA 1MDUB 4FWQA 2YJEA 3VEZA 3VGLA 5FPMA 3BF1A 3GG4A 3QDKA 4H5TA 4QS7A 4PL7A 4Y0WA 1S3XA 5AQJA 5BN8A 4L3QA 3O08A 5BPMA 5ADXA 3ZX3A 2IIRA 3HTVA 1SZ2A 4ISEA 1BUPA 2E2NA 4XH1A 4BRAA 4EAHD 1ESVA 5CE3A 2A40A 2D4WA 3EKUA 1TYQB 3P4IA 3H1QA 4FPBA 1QQOA 2V7ZA 2QWMA 1BU6O 1T6DA 1NMDA 4A2BA 4FOEA 3DJCA 1HX1A 4EHUA 1QZ6A 2YJFA 3KHYA 1QQNA 1V4SA 3VGKA 4BRQA 3WXKA 2QW9A 3CJBA 2YI1A 4YDUC 1RGIA 2Q2RA 2V7YA 1NGIA 1SQKA 3AAPA 4BG8A 4B1XB 3KZBA 5AQXA 5AQNA 3FE1A 4BGBA 2YCHA 2E2OA 4BC5A 4JAXA 2HF3A 3DXKA 4FSVA 4BRHA 5AQMA 2QWOA 3GE1A 5JICA 3VPZA 1XC3A 5E84A 2Q0RA 3ENHA 4PL8A 4BR4A 4CBWA 5KQ8A 4BRMA 1X3NA 3GDQA 5ADXH 3QBWA 4PKIA 3QICA 2A6AA 3H1VX 2CH5A 4O5FA 3MK6A 1NGBA 3WXLA 4BQLA 2YHYA 4K43A 3I8BA 4B1VA 2V52B 2PAVA 1GLJO 3A0IX 2NRHA 3IFRA 3VGMA 5B8HA 4JHDA 4H0YB 1LCUA 5EX5A 1DGKN 4A2AA 3ULEB 1E4GT 3DXMB 2W40A 3ZETB 5BREA 2E20A 1GLAG 1H1VA 3QFPA 2AP1A 2D1KA 3VESA 1P8ZA 1K8KB 1QZ5A 3LDQA 1X3MA 2BTFA 3D2EA 4FWLA 3ZEUB 1Q18A 3H3NO 3VENA 3LDPA 3H3OB 1RDWX 3SLCA 3IDHA 2D0OA 3QB0A 3DWLA 1CZAN 1GLEG 2GWKA 3GL1A 5AQKA 3O6WA 1SAZA 3UKUB 3VF4A 4J8FA 1RFQA 4FO0A 3HI0A 4BRLA 3WQUA 4CI6A 3U9DA 3BF3A 2P9IB 4BC4A 3WT0A 4IXCA 2A42A 1U2VA 1EQYA 4GNIA 2OANA 2IVOA 2P9UB 2GUPA 3WQTA 1DEJA 5EVZA 3WXIA 2E2PA 2P9SA 1NGAA 4BRNA 2ZWHA 2QWRA 4FL9A 4CD3A 1NM1A 4FWOA 1BO5O 4JNEA 2WUSA 3O8MA 5ELZA 5AQYA 4H5NA 5AQVA 2I7NA 2P9KA 1K8KA 2QWLA 2A5XA 2ASPA 3VEVA 4H0PA 2E1ZA 5I9EB 2CGJA 2FLOA 3D2FA 5BPNA 5BRFA 4EHTA 3CJAA 1HKBA 1X9JA 1MA9B 3JS6A 3FZFA 4B1UB 3WXJA 4CZEA 4YDUA 4BQZA 1HPMA 2Q31A 2A3ZA 3B8AX 4XEIA 2E8AA 4FPAA 1G99A 4FWPA 4HWIA 1BA0A 4PKHA 4BVPA 1ZXOA 3CJCA 2ZF5O 4CZIA 3OHRA 3L4IA 4AM7A 3W3DA 2J4RA 3FZLA 2ITMA 1ATRA 3EL2A 3ULEA 2P9IA 3O4WA 3O1WA 3R9PA 2PBDA 1NGEA 1JCEA 4K25A 3CETA 1KAXA 3ZETA 2H3GX 1NGCA 3DXKB 5FPDA 2P9SB 3CQXA 1DKGD 4K41A 3R8EA 5JLHA 3SMPA 2IVNA 3CJ1A 2Q36A 3J8AA 4WYBA 2VCPA 4M63C 2NZTA 5KPZA 3UE5A 2HOEA 3MDQA 4H0OA 5AQSA 3U8XA 5AQOA 3EKSA 4FWRA 2BUPA 2QWNA 3EO3A 4FWKA 4WQ4C 1ZBSA 4WQ5C 1GLDG 3M3ZA 2P9NA 1NBWA 4BROA 4CZJA 4IWVA 3FZKA 3WEEA 5LJWA 2EWSA 3CIPA 3KVGA 1R59O 4CBXA 2P9PB 5AZIB 3LM9A 5F2RA 3FZMA 5AR0A 4GY2B 4LC9B 1TYQA 2GWJA 3C7NB 4H0TB 4H0XB 2ASMA 3D2EB 3LM2A 5AQFA 4BRDA 5F1XA 2P9LB 3CERA 3A5LC 3VF2A 1NWKA 3FFKB 3VETA 5JMVA 1ATNA 5AQHA 1JCFA 3UKRB 3MMVA 2CGKA 2QXLA 1C0GA 4H5RA 1IJJA 3UKUA 4AM6A 3MN6A 4CZHA 2ASOA 3C0BA 4FWNA 4K42A 4NO7A 4B1ZA 3FGUA 1C0FA 4QS9A 4CJ7A 3SJHA 5AZJB 3ZX2A 3M6GA 1JCGA 3VERA 1KAYA 4KBOA 1YUWA 2ZGZA 3VF6A 3AY9A 4B1WB 5LY3A 3U9ZA 3WEEB 4BR5A 3IMXA 3ENOA 1XUPO 3IUCA 5FPNA 1HLUA 4MLEA 2CH6A 4RCHA 1T44A 1MWMA 2P9PA 4FOIA 5AZIA 1GLLO 1MWKA 4BR7A 3CJ9A 3HZ6A 4BRPA 5KQDA 3L0QA 3ATUA 4EIAA 3GBTA 3U4LA 2QWPA 1Y64A 4CZKA 4DHYA 3TPQA 4BC3A 1KAZA 4XH4A 3O5BA 4M7YA 5LJVA 2FF3B 3HBTA 5AQIA 4BR9A 4WQ5A 3QBXA 3VEOA 4B9QA 3BP8A 2Q1NA 1HKCA 1NGDA 2NLXA 4JD2A 3CJ7A 5F0XA 1XQSC 2P9NB 4FWSA 3ZX0A 5AQZA 2E1YA 4IJNA 4I6MB 5KPRA 1BWFO 3JXUA 3O80A 5AQQA 3ZEUA 3R6MA 3C7NA 4A62A 5AFUA 3H6EA 1YAGA 2F9TA 1LOTB 4CZGA 2W41A 4EFHA 3D2FB 1OKJA 4JD2B 1D4XA 4BREA 1WUAA 2VWBA 1YVNA 2DPNA 1BDGA 2Q0UA 3FR0A 3MN7A 1NGJA 5BR9A 2IVPA 4FWMA 3DAWA 5BRHA 5AQWA 4PKGA 4IZ9A 1TUYA 5JLFA 1KXPA 1NLVA 1Z05A 2FXUA 4O8KA 3MN9A 5E26A 5AQLA 1NGFA 3A5NC 5AZJA 5BRDA 3MCPA 3F9MA 2F9WA 3A8YA 5EY4A 2KHOA 1T6CA 1BOTO 5AQUA 4BRIA 2VYPA 3EZWA 1BG3A 2YHWA 5AQTA 3O1BA 4A61A 4CZFA 4IJAA 5BN9A 4MO4A 2D0PA 1HJOA 3CQYA 3VOVA 4CZLA 1HKGA 2P9UA 4BRCA 3VEWA 4H03B 5AQPA 3BEXA 4BRKA 4DQ8A 3I33A 4CD1A 1IG8A 1GLBG 3RSEA 3G25A 5EOYA 3D7EO 4MLHA 1ZC6A 2V51B 4F9OA 1TUUA 2FSKA 3BUZB 3MN5A 4E1JA 4NB4A 4JHDB 2HF4A 2UYTA 1HUXA 4JN4A 3QFUA 1QHAA 3A5OC 2CGLA 4DB3A 4BR0A 4Z94A 4XH5A 4ISFA 2GELA 1YXQA 4M7XA 3RSEB 4HTLA 4BG9A 3CI5A 4I6MA 4BRGA 1GLFO 1U6ZA 4H5WA 2FSNA 2Q97A 3M1FA 1QQMA 4CBUA 2QWQA 5BPLA 4CZMA 4C23A 2E88A 1U2VB 2I7PA 5AFUH 3H45C 3AAQA 2P9KB 3FLCO 3L6QA 2QM1A 3VEYA 3EN9A 5KPTA 2HMPA 3ID8A 3LL3A 4H0VB 2FSJA 3S41A 1E4FT 4RWTA 4BVOA 3UKRA
chains in the Genus database with same CATH superfamily
4Z0UA 4W5QA 1N33K 2KZMA 1ATSA 3O9QA 1XHXA 4ISGA 4N5SA 1YITN 4I9LA 5AQGA 1J9AA 3H46O 3TAQA 3A5MC 1BIZA 1ZBUA 4FJLA 3C65A 2AA4A 4IFEA 2EX3A 4WCEL 5GADP 3RMAA 3KWGA 3L2UA 4IDKA 4H5VA 4BGAA 4WF9L 3NAEA 3KJVA 4Y1CA 3SV3A 4PHTX 2P9LA 1TKDA 1J6ZA 4Z4CA 3CHWA 3DLGA 4IFVA 1GLCG 4KB1A 1S22A 4JI1K 2YHXA 3CQ8A 2A1RA 2YJEA 2QTDA 3VEZA 3G10A 1JLFA 1WSHA 3BF1A 3GG4A 3V9WA 1RNHA 2XY6A 1WAJA 5BN8A 4DLGA 3WNEA 1L3TA 3ZSQA 3I8DA 2ATQA 4DV2K 5CE3A 3EKUA 2NRTA 3SPZA 4FJ8A 3P4IA 4B3SK 1RT5A 4EHUA 3KHYA 1WSFA 4CGHA 2HHTA 3TSQA 2WOMA 2YI1A 4LF9K 2Q2RA 1NGIA 4BG8A 1IKWA 4B9VA 3KZBA 3O9RA 4IG3A 5FDLA 5AQXA 5MLCQ 3S3NA 2E2OA 4JKGB 2HF3A 3DXKA 4FSVA 4JI2K 2QWOA 1NU0A 2YV0X 3GE1A 5JICA 3CCQN 2EHGA 3HJFA 1CZ9A 1CZBA 5E84A 4GV3A 4DSEA 1YI2N 2VQFK 3QBWA 4PKIA 3QICA 1IBLK 3S3MA 3WXLA 2NNWA 3QEPA 2O8DB 2NRHA 3NH2A 4H0YB 2F4VK 4OPHA 3V1OA 4EZ6A 5BREA 2RHKA 1TKXA 4OPAA 1WSEA 1RTDA 4IO9L 2OTLN 3ISNC 3PO5A 1RDWX 4LF5K 2D0OA 1CZAN 3K5MA 3NVMA 3GL1A 3VQ6A 4E19A 3S3OA 3MX5A 1RFQA 3HI0A 1ZBLA 3LAKA 4HCBA 4NXMK 3MXIA 3AVGA 3TTFA 3JAMO 4BC4A 4IXCA 1KC8O 3ZYYX 1HR0K 1KRPA 4AF1A 3WQTA 2IVOA 3VQDA 1QTMA 4CEFA 4BY9C 1NGAA 4FL9A 4ZTFA 1NM1A 4CF9A 2O8EA 1S1VA 3SUPA 4LSLA 1BO5O 3Q7CA 4HUFA 2FBTA 2E1ZA 2CGJA 2FLOA 1EO1A 5C12A 5BPNA 4YORA 4EHTA 3K58A 4DV4K 1E3MA 1MA9B 3JS6A 3FZFA 4X64K 3K5LA 4Q0BA 1HPMA 2GBZA 3KLIA 4XEIA 4DG1A 2E8AA 1G99A 1BA0A 1YVUA 4BVPA 4X65K 1ZXOA 3ID6A 5I3UA 1QE1A 1VSIA 2KW4A 2ZF5O 3BZKA 3NGIA 5DMRA 2J4RA 3FZLA 2ITMA 3B6OA 2RN2A 3ULEA 3HRGA 3VQBA 1S5JA 1QSSA 3NE6A 3IKMA 4K25A 3CETA 2H3GX 4C8OA 2VG5A 2GX9A 2B5JA 3LP0A 3R8EA 1CXQA 2Q36A 4FZYA 3QERA 2NZTA 5KPZA 4BE0A 2HOEA 4NCAA 3U8XA 3R1XA 1Y97A 3ZT2A 4JKCA 3LDSA 3THXB 3SQ1A 2P9NA 4BROA 3RMCA 3AVJA 3KK2A 1NK7A 5AZIB 3KLGA 3LM9A 3T7ZA 4M3UA 2UXCK 2GWJA 2DTUA 2E6LA 4H0TB 3D2EB 3OYCA 4BRDA 3OYHA 3VF2A 1FJGK 1RDBA 3DRSA 3K5OA 2OCEA 4CJRA 1NOYA 4FYDA 3UKUA 3M8PA 4JKEA 4CESA 2ASOA 1LW2A 3RMDA 4CECA 4NO7A 2UXBK 3KD1E 2X78A 4DTPA 4FJXA 2YX6A 1VAZA 4B3RK 1SL1A 1C0FA 4KTZA 3V9SA 3ZX2A 3M6GA 1JCGA 3HPOA 3CCMN 2O8CB 1VQKN 4CERA 3AY9A 3U9ZA 3TAGA 2O8FB 3ENOA 1NK6A 1XUPO 3IS9A 3ZT0A 1K8AO 5M1KA 5FPNA 3KLFA 3SQ4A 3T3FA 4KRFA 1GLLO 3HVTA 2PFUA 5BR8K 3L0QA 1JLQA 4CFDA 4EIAA 2NRVA 3GBTA 1Y64A 4DHYA 4KHYA 4O55A 4H4OA 1KAZA 1ASVA 4RW4A 1X1PA 2FF3B 2YKMA 4BR9A 4B9QA 2I5JA 3AV9A 4CF8A 1S1TA 4CHYA 5HRSA 1XQSC 4U7BA 1JKHA 1REVA 4LFBK 4QCLA 1KVBA 5KPRA 2NRZA 1BWFO 4LH5A 5LL6Z 3CCSN 3D0PA 3AO5A 3ZEUA 5AQQA 3R6MA 3WNHA 3E66A 4LSNA 5E41A 1T3VA 4DTJA 4CJ5A 4ZTJA 1LOTB 1RT3A 2W41A 4CZGA 1QSLA 3D2FB 2VWBA 1YVNA 2DPNA 4GV6A 3MN7A 3CPWM 5BR9A 4Z4FA 1Q9YA 2KTQA 4CJQA 4WFAL 3KIOA 3AVMA 1JLGA 3IAYA 3OYFA 1RBVA 3DLLL 4FJGA 5M1NA 3V1QA 1Z05A 4ID5A 3K59A 3A5NC 3E1YA 3MCPA 3F9MA 2BDPA 2F9WA 2KFZA 4B9UA 2O8CA 2ZJRL 1T6CA 2O4GA 4AHSA 4ID1A 3O4NA 1BOTO 3OYDA 3NH1A 1B9FA 3EZWA 1BIUA 1HJRA 1T7PA 2YHWA 1J5EK 3ZLJA 3O1BA 1ZBIA 4LFAK 4CZFA 3CCEN 4YHHK 4HTUA 3HK2A 1HJOA 3CFRA 3UIQA 4WFBL 3SAFA 4H03B 5AQPA 3EE9A 4Z4IA 4CD1A 5CYQA 4IEEA 4FZXC 3RSEA 5EOYA 4DKWA 3C94A 3D7EO 4MLHA 4A5AA 1W2BM 4DR4K 4EP4A 3MN5A 2B4JA 4V19S 1WBBA 1HUXA 1XI1A 1A5VA 1QHAA 4OVLA 4B9LA 2QXFA 4DB3A 4BR0A 3HL8A 4XH5A 2GELA 2F8TA 3J7AP 3RSEB 4BRGA 4GMJB 4GKKK 2VG7A 1HPZA 4H5WA 2KQ2A 5BPLA 4DTRA 2D0CA 5DM7L 5KTQA 1JL2A 1IG9A 2P9KB 4CVNE 4RW8A 2GUIA 2QI2A 5CHIA 3VEYA 3O3FA 3ZSVA 4NLBA 4CCHA 3S41A 1S6QA 4NCBA 5HRRA 4C8NA 2GTDA 1VSEA 3DI6A 2PYLA 3ULDA 5HRPA 4E7KA 3DXMA 1WB9A 4E0DA 3SK3A 4CF2A 4DLEA 1WOQA 3O9SA 4IDHA 4BC2A 4Y1DA 3CC4N 3CXCM 3AVBA 2E2QA 4ILHA 3DLHA 3VEXA 3GOIA 1J54A 1A5XA 4RTFD 4IO8A 3T1HK 3LDNA 4QS8A 4KI6A 4DCHA 3CCJN 1HRHA 2RE2A 3CCRN 4FM0A 4FVMA 3PIPL 3AVKA 4N41A 4DU3A 5FPEA 5EXWA 3JSMA 1VQ8N 1VSFA 1Z6RA 1MDUB 2VWKA 2RKIA 3VQ9A 4H5TA 4ELTA 4QS7A 2Z1HA 1OH8A 1LV5A 2WBNA 3TAPA 5DM6L 5ADXA 3ZX3A 1VQLN 4IOCL 1TGOA 1SZ2A 4ISEA 2E2NA 2HHQA 3EEQA 1TVRA 4DQPA 5T7BA 4CHNA 1TYQB 3H1QA 4FPBA 4KH4A 3LANA 1QQOA 2V7ZA 5C2DA 2QWMA 3HP6A 1WLJA 4A2BA 4FOEA 1NK0A 3J7YP 1QQNA 1V4SA 3VGKA 4KO0A 3VQAA 1X9SA 4BRQA 1NNEA 4BE1A 1RGIA 3HT3A 3NBPA 1HYSA 3O3GA 3M8RA 4YY3K 2WFBA 4BC5A 4JAXA 5GAEP 4DV1K 3E9PA 2WTUA 1SS6A 3E9LA 4CIFA 1NKEA 2WC9A 1XC3A 2Q0RA 3ENHA 4PL8A 4DS5A 1WBDA 4F3TA 4BRMA 1HQEA 4R5PA 3VQPA 4B9SA 5FRNA 3PSFA 3H1VX 2CH5A 3P83D 4O5FA 3MK6A 3SI6A 4AHVA 4DSFA 2V52B 2HHXA 5CY4A 2PAVA 1GLJO 4JI7K 3A0IX 1BI4B 4CJPA 1U49A 4JHDA 5LMNK 1LCUA 3G4SN 3MCAB 3NF6A 1DGKN 4DSJA 4A2AA 3C6TA 1JLBA 1E4GT 3DXMB 2E20A 3PSIA 3SQ0A 1P8ZA 4HUEA 1U04A 3SYZA 1Q18A 2WONA 4PY5A 3DWLA 4TSXA 1VSLA 4LY7A 3UKUB 4J8FA 3CMAN 4LD0A 4BRLA 1HQUA 4CI6A 2G8IA 3BF3A 2HNZA 3DLRA 4CGDA 2A42A 1U2VA 1Q8IA 1DLOA 1ZYQA 2E4LA 1VSHA 1DEJA 5EVZA 2IDOA 3LP1A 2OPQA 2P9SA 1Q7YO 1HNZK 4CD3A 2HHUA 4FJNA 3THYB 4H5NA 5AQVA 2P9KA 5M1FA 2A5XA 1S1XA 5CR4A 3VEVA 5I9EB 1J53A 3OW2M 5BRFA 2BH1A 3CJAA 3MXJA 4B1UB 3WXJA 3KKRA 3SJJA 1QS4A 4JKBA 4CHPA 4M3ZA 2RPIA 2YNIA 4KHUA 1OVQA 4FWPA 4HWIA 3TAFA 5GIOA 3OYAA 4PKHA 1NJWA 4E3SA 4N76A 1ATRA 1KFSA 1ZBHA 3AO2A 1K6YA 2FBXA 1NGEA 1JCEA 2YKNA 1RBTA 3PX4A 3VTHA 3DXKB 5FPDA 3OYJA 4LH4A 3CQXA 4DQQA 1D8YA 3I55N 1GOAA 2IVNA 3CJ1A 3THYA 3MWPA 3SPYA 1HNIA 2VCPA 4M63C 1IH7A 3OJSA 4M3YA 3MDQA 4H0OA 5AQOA 3EO3A 4IOAL 4WQ4C 4WQ5C 1OVYA 4OKKA 4DV7K 3V9XA 1VHXA 4CHZA 4IWVA 2EWSA 3CIPA 3QIOA 1R59O 4OPJA 1VK0A 3FZMA 4UQGA 3KLHA 3LPTA 4GY2B 4LC9B 3MAQA 4H0XB 4F3OA 2XY8A 1BGXT 5AQFA 5F1XA 2IGIA 1YF5L 5J2PA 2NRXA 3CERA 1WAFA 3MX2A 1BL3A 5AQHA 5M1QA 4FLTA 1NK5A 3K57A 1NG9A 3TTDA 2CGKA 1C0MA 2YHAA 4E7JA 3MECA 4H5RA 4FWNA 4J2DA 2HBLA 4K42A 1FKPA 2ZD1A 4JK8A 4DTXA 4CJKA 3FGUA 2UXDK 1W97L 3SJHA 1LW0A 3TAMA 3VQ7A 4DF8A 4KBOA 1U4BA 2ZGZA 2OYQA 4OJRA 3VF6A 1C1CA 4B1WB 3OA9A 4BR5A 1K9MO 3K2PA 3TAEA 3K9JA 1VQ7N 4FJ5A 4RCHA 4CEEA 1BQNA 4MLEA 1T44A 1MWMA 5AZIA 1MWKA 1FW6A 4CEOA 3O3HA 3HZ6A 4E1MA 1N36K 2Y1JA 1YJ9N 1Z25A 3ATUA 2DY4A 3J7ZO 4CZKA 4X66K 4DTSA 3TPQA 3HM9A 3NMUA 1HMVA 1NMNA 4JYAK 5CZ1A 4XH4A 1ILYA 2BANA 1EKEA 3L8BA 4M7YA 4M42A 3ENBA 3HBTA 1RT7A 4QAGA 1W0HA 4WQ5A 3VEOA 1TAQA 2ZJQL 2Q1NA 1T05A 1NGDA 3OBWA 4JD2A 1HNVA 1QHTA 1RT4A 2P9NB 2W42A 4FJ7A 4DTNA 4I6MB 4OLBA 1NJZA 3C7NA 1RBRA 1QQCA 3H6EA 2D0BA 3ZSOA 1S9GA 4EFHA 4JD2B 4BREA 4DV6K 4CJVA 3OYLA 2Q0UA 1NGJA 4AHUA 1DT9A 3AO1A 4C1NI 4PKGA 2ZJPL 4IZ9A 3TI0A 3F73A 3HOSA 1TUYA 3HP9A 2OPSA 1RT1A 5KRTA 3C6AA 3G71N 2HNDA 3ZSYA 4M41A 1RDCA 1FKOA 2KHOA 3OYIA 4KB0A 1RTJA 3RRHA 4LF4K 2VYPA 1IBKK 4OO1J 4F8RA 1YTAA 3VQCA 3K9KA 3OBYA 5AQTA 4FW1A 1Q81O 1RT2A 1LWFA 4DSIA 3THVA 1VRTA 1HKGA 2LSNA 2P9UA 1YT3A 4A57A 4BWMA 1IO2A 5KRSA 1U48A 1KFDA 4KHQA 3I33A 2Z1IA 1GLBG 2HVHA 3V9ZA 1ZC6A 3AVCA 3ZSWA 5GAHP 3CCLN 3BUZB 2QKKA 2JLEA 3L2QA 4B3OA 1JLAA 4B8CA 2HB5A 4B3TK 3BY5A 1VQMN 2KLAA 2HF4A 2Z1JA 3CD6N 4RW7A 4CIEA 2FC0A 4Z94A 4CF1A 1N34K 4ISFA 4M7XA 4DS4A 1JXEA 3CI5A 3T1AA 2FSNA 1W9HA 2I7PA 1OH7A 1RDAA 4W5RA 3H45C 1BCMA 3L6QA 4CJ3A 1JL1A 2G8WA 3N4PA 1NK4A 3KK7A 4KH6A 1E4FT 1WN7A 4BVOA 3UKRA 1TK5A 4M3XA 4NLCA 2GEMA 1KQSM 1C0TA 2F96A 1LAVA 5KGXA 3ZT3A 3DOLA 4WE1A 1N6QA 4O0JA 3QIPA 3UB5A 4FLUA 3HSCA 2JWLA 3BZCA 1TL3A 3RVCA 1YHQN 3NHGA 5TKYA 1JLCA 3WUHA 1SV5A 1V4TA 1EXQA 4BRFA 3OS0A 4EZ9A 3FZHA 4HHTA 2F7TA 4Z4GA 3AARA 3SCXA 2YHBA 1BA1A 2ITGA 3G6EN 3PY8A 3KKSA 2G8FA 4MO5A 4CE9A 2ZGYA 4M3RA 3CCUN 1SUQA 4PQUA 1SL2A 1KLMA 3SMSA 3DLBA 3LP2A 4FLYA 3PLAA 3VGLA 4FJMA 3QDKA 4PL7A 4KHWA 3AVFA 1S3XA 5AQJA 4L3QA 3EZ5A 1KCFA 4KI4A 3LWMA 3O08A 4G1QA 4CK2A 5TKWA 2XO7A 3HTVA 5FROA 4RG8A 3SUQA 4CEQA 4RW6A 4JRPA 4XH1A 4BRAA 1ESVA 1C1BA 3P31A 1RDUA 4DV3K 4IFYA 1U45A 5KI6A 5KGWA 1VQNN 3OYEA 1BU6O 1Q86O 4DR2K 1KTQA 4CEDA 2R7YA 3DJCA 1HX1A 4KTQA 4Z4HA 1QZ6A 4OKJA 5HBMA 4YOXA 1XMQK 3WXKA 2QW9A 2RF2A 4YDUC 3VQ4A 5LMUK 1SL0A 2V7YA 2HBMA 3P38A 4B1XB 1IKVA 3RTVA 3H08A 3FE1A 5AQNA 4BGBA 2YCHA 1XC9A 1OH6A 1MU2A 1O13A 5SZTA 4BRHA 3P5JA 5AQMA 4CK3A 1WSIA 3M8SA 4BR4A 1FK9A 4CBWA 5KQ8A 4LF6K 3VN5A 4IOXA 4RW9A 5ADXH 2A6AA 3C6HA 1NGBA 1TK0A 3AO3A 1F21A 3F9KA 2X6NA 2B6AA 4C8KA 5HL7L 1N5YA 4CFCA 4J2BA 3E01A 1UAXA 4I2PA 3VGMA 5B8HA 4QOZB 3WXMB 5EX5A 3ULEB 1W7AA 1U47A 2AJQA 2W40A 3ZETB 1GLAG 1H1VA 3QFPA 4NYFA 2AP1A 2D1KA 4FJIA 3VESA 1K8KB 1Q9XA 1QZ5A 3LDQA 1X3MA 1JLEA 1TAUA 4FWLA 4KHSA 4CF0A 3ZEUB 4DF4A 3H3NO 2OZMA 4I2QA 3NDKA 1VQ5N 3LDPA 3QEWA 3R3LA 2UU9K 1GLEG 5AQKA 4J2EA 3O6WA 1SAZA 1L3UA 4MQ3A 3IRXA 3U9DA 2YNGA 1YTUA 1KSPA 2JGUA 4KH5A 3SNNA 3WT0A 3BDPA 1EETA 2QA4N 4GNIA 1EWRA 1D5AA 2F8SA 4GKJK 2GUPA 1D9FA 3WXIA 1GOCA 2ZWHA 2QWRA 1XHZA 4FWOA 4JNEA 2WUSA 5AQYA 2I7NA 1K8KA 3O4QA 2ASPA 3CFOA 4H0PA 3U3YA 1N8RO 3NCIA 1JJ2M 1QSYA 3MEEA 3D2FA 4BWJA 4CEAA 1X9JA 3HXMA 2PYJA 4WFNL 2HSTA 3D45A 4BQZA 4E1NA 4HUGA 3B8AX 4O0IA 4FPAA 2UUCK 4IKFA 1KVAA 4L8RB 3CJCA 4DV5K 4CZIA 3L4IA 4AM7A 3I0RA 1VQON 3EL2A 2OPRA 2P9IA 3O4WA 1BISA 3TANA 4K0KK 2PBDA 3LP3A 2O8BA 1G15A 3ZETA 2QEXN 2A1SA 2BGGA 2E5LK 1DKGD 3KTQA 1VRUA 3SMPA 4DR5K 4GW6A 3J8AA 4WYBA 3MXMA 4FCYA 3VA0A 3P39A 2BUPA 4FWKA 1ZBSA 4OPKA 4DR6K 1P90A 1I94K 3CC2N 3ZSRA 5AJ3K 1R0AA 1GLDG 3L3UA 3M3ZA 1NBWA 4JK7A 4F2SA 3FZKA 5LJWA 2X74A 4FK2A 5HP1A 3KVGA 2P9PB 4IBNA 5F2RA 5J2NA 4O8UA 1EX4A 1S72N 5AR0A 4DMNA 3V4IA 3V6DA 2ASMA 3LM2A 4DR1K 3T1YK 5GINA 4MDBA 2XY5A 3OYGA 2YNFA 4FM2A 3CF5L 3FFKB 4K8XA 3K0SA 3DYAA 3KK1A 1JCFA 3NGYA 2QXLA 3PV8A 4JI4K 4LF8K 1BI4A 4DQRA 2QK9A 2XY7A 4QS9A 4DV0K 3RWUA 2P51A 3SZ2A 2KKZA 3VERA 3QETA 1KAYA 1YUWA 3OTOK 2G8VA 1SKSA 1HLUA 2CH6A 3SV4A 4FOIA 4DSLA 3AVAA 4U67L 1YJNN 2OZSA 4FVUA 5KQDA 3EE8A 4NXNK 2VWJA 3HOTA 3OYBA 3U4LA 3SUOA 4JKFA 2QWPA 1HYVA 4GVEA 4ICLA 3S9HA 4BC3A 2QKBA 1NKCA 3O5BA 4JKGA 4XIUA 4CJEA 1TL1A 3DOKA 5LJVA 3B6PA 1A5WA 3RR8A 3MEDA 5AQIA 3HPHA 3L3VA 3QBXA 1NKBA 1SKWA 3BP8A 2GV9A 4ELUA 3TSPA 4CHQA 4KREA 2NLXA 4JEPA 4MFBA 3CJ7A 5AQZA 4BACA 4DTOA 2E1YA 4IJNA 3OS2A 3G0ZA 1KD1O 4FJHA 3O80A 4F4KA 5IWAK 4C8LA 1I3AA 4PUOA 2F9TA 5HROA 2YNHA 2PY5A 4CK1A 1OKJA 1D4XA 4DU1A 4CIGA 1BDGA 3FR0A 4FWMA 3DAWA 3RRGA 3VA3A 5J2MA 5EU7A 4KTWA 5AQWA 1C1AA 4X62K 4DFPA 4M3WA 5JLFA 1KXPA 1NLVA 2FXUA 4O8KA 3MN9A 4OGCA 1BQMA 1NGFA 4OGEA 4AHTA 5BRDA 5H1SQ 3A8YA 3SBGA 5EY4A 3PO4A 3L2RA 3AGRA 3ITHA 4YFUA 2E6MA 2VGMA 4CW7B 5AQUA 4W5NA 1IV0A 3A2FA 1VQ9N 5C2FA 4FZZA 3WNFA 1RTHA 2O8FA 4BDZA 3M5RA 3AA5X 4A61A 1I39A 4IJAA 5BN9A 4ILJA 4YOVA 3VOVA 3AGKA 4DSKA 4FM1A 2Q3SA 3Q7BA 3VQQA 4JK9A 4E7HA 3EY1A 2V51B 5K14A 4CJWA 1TKZA 4JI5K 1TUUA 2FSKA 1WSJA 4YOUA 4E1JA 4JI8K 4JHDB 4JKHA 1IKXA 1WNSA 4JN4A 2P5GA 2FBYA 1S1WA 2OA8A 2CGLA 3EYZA 3L2WA 2IS3A 1GOBA 4N56A 4DFKA 3NH0A 3DLKA 3LAMA 4AH9A 1GLFO 4CHOA 1U6ZA 2Q97A 3M1FA 1QQMA 4AHRA 3OY9A 2QWQA 4M3TA 4CZMA 3DMJA 2E88A 1U2VB 3CYMA 5AFUH 3QINA 3AAQA 3P1GA 3OYKA 1QVGM 1RTIA 3FLCO 3THWA 1DTTA 3OYNA 3V9UA 5KPTA 3J80O 1KLNA 3ID8A 4H0VB 4RWTA 4R79A 3DLEA 5CYMA 3KK3A 3KLEA 5AQRA 1NGGA 3NVKA 3VQEA 4W5OA 4KFBA 3NF9A 1RDDA 1IKYA 5J1EA 5C42A 4J2AA 5FRMA 4WQ4A 3ATVA 3AA2A 4CGGA 2Y1IA 1S6PA 1M90O 4B3MK 3U3GA 4CEBA 3CG7A 1TK8A 2O8EB 3NF7A 3RR7A 1BHLA 3TTCA 3HM8A 3AA4A 3TU5A 3OS1A 1NGHA 2IC3A 5FLXO 3F2KA 1DTQA 1EWQA 1X9WA 1BCOA 4CJLA 4NCGA 1HNXK 4FLWA 4FJKA 3W0LA 1K73O 3QMLA 2HHSA 4BR2A 2A41A 3LDOA 1VQ4N 3LDLA 4B1YB 2FF6A 3WNGA 4FWQA 5FPMA 3E9OA 1X9MA 4Y0WA 2XRIA 1N32K 3C95A 4H4MA 1ITGA 1RILA 3ZSZA 4FXDA 5BPMA 4I9QA 2IIRA 1HNWK 5HOOA 1BUPA 2P1JA 4EAHD 2A40A 2D4WA 5DK5A 5HRNA 3KWIA 2JWKA 1Z26A 1OH5A 3QNNA 5JS2A 3CC7N 1T6DA 1UA1A 1NMDA 4YOTA 4FK4A 3C6UA 3I0SA 2YJFA 3SQ2A 3OVNA 3QNOA 3CJBA 1SQKA 4DQSA 1B9DA 3AAPA 4B8AB 4JV5K 4PWDA 3QEXA 1VSDA 1HYZA 4JKAA 3VPZA 4OKEA 3L4QA 2UUBK 1NK8A 3AO4A 4KHNA 3AVIA 1NJIO 1X3NA 3GDQA 2HHWA 4OX9K 5C24A 2G8HA 1S1UA 2O4IA 4CGJA 4BQLA 2YHYA 4JLHA 4K43A 3I8BA 4B1VA 4DR7K 2VQEK 3IFRA 3N4QA 3PIOL 4CEZA 4DFMA 1TKTA 1VSMA 2VGNA 3IG1A 2FBVA 3V1RA 5IT9O 1YIJN 5C25A 3QEVA 5HLFA 2HBJA 4A5BA 3TSUA 2BTFA 3D2EA 3NGZA 3RMBA 4CJTA 4MDAA 3LALA 3VENA 1FXXA 3H3OB 3SLCA 3IDHA 4JI6K 2HMIA 3QB0A 2GWKA 2OPPA 1QVFM 4FK0A 3VF4A 5GAGP 4FO0A 4DTMA 2HHVA 1L3VA 4AQYK 3WQUA 4CJFA 2P5OA 2NRWA 4FJJA 1S9EA 2DFHA 2P9IB 4AILC 1D9DA 1M1KO 1EQYA 2IOCA 2OANA 2P9UB 3CM5A 2E2PA 4JKDA 3NF8A 3AVLA 2ZM6K 4BRNA 1RCHA 3OYMA 4FW2A 5M1PA 5ELZA 1YJWN 3O8MA 4FJ9A 3SAHA 4JS5A 2QWLA 2X6SA 3LZJA 4DTUA 1RBSA 3PUFA 3VQ5A 3BGRA 4DWIA 1HKBA 3L2VA 3TABA 1T03A 4CZEA 2D5RA 4DQIA 5JS1A 4YDUA 4KV8A 2Q31A 4ILGB 3MEGA 3QO9A 4C8MA 2A3ZA 4GV9A 2DFEA 3DRPA 4O44A 4E7LA 2HBKA 3OHRA 3W3DA 3ALYA 1CLQA 3AVNA 3O1WA 3R9PA 4BDYA 4CJUA 1Q82O 1KAXA 1O1WA 1ASUA 1ASWA 1NGCA 3THXA 2UUAK 2P9SB 4BE2A 4K41A 5JLHA 5GIPA 2Z1GA 3UE5A 4ELVA 1L3SA 5AQSA 3EKSA 4FWRA 2QWNA 4KKOA 4DUYK 4O5BA 4JS4A 4DFJA 2ETJA 1NK9A 4DUZK 3TWHA 1B92A 2XHBA 4CZJA 1IBMK 5JVHL 3WEEA 3LPUA 3FFIA 3V81A 4CBXA 1J5OA 1ZBFA 1TYQA 3C7NB 3CFPA 4YOWA 3ZCMA 2P9LB 1VSKA 3A5LC 3O9TA 1JXBA 3ZSXA 1NWKA 4KHPK 3VETA 5JMVA 1ATNA 3UKRB 3MMVA 1UWBA 1VQPN 2NRRA 3U6FA 2BE2A 1C0GA 3SUNA 1IJJA 4AM6A 3MN6A 4CZHA 3C0BA 3I56N 4B08A 3PX0A 3ASMA 4B1ZA 2DFFA 1C6VA 1LWEA 3DM2A 4K8ZA 2O8DA 3AA3A 4CJ7A 3MWTA 2HW3A 5AZJB 3SAGA 1VSJA 3QEIA 4UY8O 1VQ6N 2HHHK 4OLAA 5LY3A 3WEEB 3IMXA 2KZZA 1XNRK 4E7IA 3IUCA 4AHCA 2P9PA 4CGFA 3VQ8A 3SBTA 4C1NK 4BDPA 4BR7A 1CXUA 3CJ9A 3JYTA 3J81O 4BRPA 2NUBA 4N47A 5SWMA 3TR8A 3HO1A 3QESA 2ZQBA 5CZ2A 3ZT1A 4CGIA 3PX6A 4NYNA 3OJUA 4Z4EA 1HKCA 1XNQK 5C15A 1NJYA 5F0XA 3ZX0A 4FWSA 2ZE2A 5JVGL 3M8QA 3HSTB 3JXUA 4CFBA 3TARA 4G9ZA 2D0AA 5I42A 1LWCA 2W6KA 5M1OA 4CJ4A 1UA0A 5C0YA 4EP5A 4A62A 4CJSA 1XWLA 5AFUA 2G8KA 4LFCK 3O9UA 1YAGA 3CM6A 4HCCA 4LF7K 4JRQA 4KPYA 1WUAA 3THWB 1TV6A 2IVPA 5C10A 5BRHA 3D6RA 3CPEA 1C0UA 3T69A 5A2QO 3DRRA 4W5TA 2IAJA 2HNYA 4YNQA 4H8KA 5E26A 1LAWA 5AQLA 3CCVN 4IEIA 3ZT4A 5AZJA 1XMOK 1KVCA 4FLVA 2HVIA 2O8BB 4BRIA 3QLHA 4A59A 1BG3A 2PZSA 4GVMA 4CFAA 1RBUA 4MO4A 2D0PA 3CQYA 4CZLA 4PA1A 3AVHA 3CMEN 4BRCA 4B9NA 3VEWA 4F2RA 4B9MA 3LZIA 2G8UA 3BEXA 4BRKA 4JI3K 4DQ8A 3HPGA 4JI0K 2VG6A 1NJXA 1IG8A 1SKRA 4I7FA 4YOYA 3G25A 3KD5E 4F9OA 3NFAA 3VTIA 4NB4A 1L5UA 3HVRA 3T19A 2UYTA 1WSGA 3QFUA 3A5OC 4DU4A 5J2QA 4Q5VA 1EP4A 1YXQA 3VMFB 4HTLA 4BG9A 4I6MA 4FLXA 4E89A 4CBUA 4FLZA 3HYFA 4C23A 2W6LA 3F5TA 3LWLA 2OTJN 1RT6A 4DR3K 2KFNA 2QM1A 1UOCA 4B9TA 3EN9A 5D3GA 1T8EA 2HMPA 3LL3A 4IG0A 4ZHRA 2FSJA 4HVJA 1NOZA 4KAZA 4M45A 3K5NA 4O4GA
chains in the Genus database with same CATH topology
2GTDA 1ATSA 5AQRA 1NGGA 3O9QA 3NVKA 4ISGA 4NLCA 2GEMA 1YITN 1KQSM 5AQGA 3H46O 3A5MC 3DXMA 4WQ4A 3C65A 3ATVA 2AA4A 3SK3A 1M90O 4IFEA 3UB5A 1WOQA 3O9SA 4IDHA 3HSCA 4BC2A 3KWGA 4WCEL 2JWLA 5GADP 3RVCA 3CC4N 1YHQN 5TKYA 3TTCA 3WUHA 3HM8A 3CXCM 1V4TA 2E2QA 4H5VA 4BGAA 3TU5A 4WF9L 4BRFA 1NGHA 3F2KA 3FZHA 4ILHA 3VEXA 2F7TA 3AARA 3GOIA 4RTFD 3W0LA 1K73O 4IO8A 3LDNA 4QS8A 4PHTX 2P9LA 3QMLA 1BA1A 4DCHA 4BR2A 3G6EN 3CCJN 2RE2A 1J6ZA 3CCRN 3PIPL 2A41A 4MO5A 3CHWA 3LDOA 2ZGYA 1VQ4N 1GLCG 5FPEA 3LDLA 3CCUN 4B1YB 5EXWA 1S22A 2FF6A 2YHXA 3SMSA 1Z6RA 1MDUB 4FWQA 1VQ8N 2YJEA 2QTDA 3VEZA 3PLAA 3VGLA 5FPMA 3BF1A 3GG4A 3QDKA 4H5TA 4QS7A 3E9OA 4PL7A 4Y0WA 1S3XA 5AQJA 5BN8A 4L3QA 3O08A 2WBNA 5TKWA 5BPMA 5ADXA 3ZX3A 5DM6L 1VQLN 2IIRA 3HTVA 4IOCL 1SZ2A 5HOOA 4ISEA 1BUPA 2E2NA 4XH1A 4BRAA 4EAHD 1ESVA 5CE3A 2A40A 2D4WA 3EKUA 2NRTA 3P31A 3KWIA 1RDUA 2JWKA 1TYQB 3P4IA 3H1QA 4FPBA 1VQNN 4KH4A 1QQOA 2V7ZA 5C2DA 2QWMA 1Q86O 1BU6O 3CC7N 1T6DA 1NMDA 4A2BA 4FOEA 4YOTA 3DJCA 1HX1A 4EHUA 1QZ6A 2YJFA 1QQNA 1V4SA 3KHYA 3VGKA 4YOXA 4BRQA 3TSQA 3WXKA 2QW9A 3CJBA 2YI1A 4YDUC 1RGIA 2Q2RA 2V7YA 1NGIA 1SQKA 2HBMA 3P38A 3AAPA 4BG8A 4B1XB 3KZBA 3O9RA 5AQXA 5AQNA 3FE1A 4BGBA 5MLCQ 2YCHA 2E2OA 2WFBA 4BC5A 4JAXA 1O13A 5GAEP 4JKGB 2HF3A 3DXKA 3E9PA 4FSVA 4BRHA 1SS6A 5AQMA 2QWOA 3GE1A 3E9LA 5JICA 4JKAA 3CCQN 3VPZA 2WC9A 3L4QA 1XC3A 5E84A 2Q0RA 3ENHA 4PL8A 4BR4A 4GV3A 4CBWA 5KQ8A 4BRMA 1NJIO 1X3NA 3GDQA 4IOXA 5ADXH 1YI2N 3QBWA 4PKIA 3QICA 2A6AA 3H1VX 2CH5A 3C6HA 4O5FA 3MK6A 1NGBA 3WXLA 4BQLA 2YHYA 2NNWA 4K43A 3I8BA 4B1VA 2V52B 5HL7L 2PAVA 1GLJO 3A0IX 2NRHA 3IFRA 3N4QA 3PIOL 3VGMA 5B8HA 4JHDA 4H0YB 1LCUA 3WXMB 3G4SN 3MCAB 5EX5A 1DGKN 4A2AA 3ULEB 2VGNA 4OPHA 1E4GT 3DXMB 2W40A 3ZETB 5BREA 1YIJN 2E20A 1GLAG 1H1VA 3QFPA 2RHKA 2AP1A 2D1KA 3VESA 1P8ZA 1K8KB 4OPAA 1QZ5A 2HBJA 3LDQA 1X3MA 3TSUA 2BTFA 4A5BA 3D2EA 4FWLA 4IO9L 4MDAA 3ZEUB 1Q18A 3H3NO 2OTLN 1VQ5N 3VENA 3LDPA 3H3OB 1RDWX 3SLCA 3IDHA 3R3LA 2D0OA 3QB0A 3DWLA 1CZAN 1GLEG 2GWKA 3GL1A 3NVMA 5AQKA 1QVFM 3O6WA 1SAZA 3UKUB 3VF4A 5GAGP 3MX5A 4J8FA 1RFQA 4FO0A 3CMAN 3HI0A 4BRLA 3WQUA 4CI6A 3TTFA 2NRWA 3U9DA 3BF3A 2P9IB 4BC4A 4KH5A 3WT0A 4IXCA 2A42A 1KC8O 3ZYYX 1M1KO 1U2VA 1EQYA 4GNIA 4AF1A 2QA4N 2OANA 2IVOA 2P9UB 2GUPA 3WQTA 1DEJA 5EVZA 3WXIA 2E2PA 4BY9C 2P9SA 1Q7YO 4JKDA 1NGAA 4BRNA 2ZWHA 2QWRA 4FL9A 4CD3A 1NM1A 5M1PA 4FWOA 1BO5O 4JNEA 2WUSA 3O8MA 5ELZA 3Q7CA 4H5NA 5AQVA 5AQYA 2I7NA 1YJWN 2P9KA 3SAHA 1K8KA 2QWLA 5M1FA 2A5XA 2ASPA 5CR4A 4H0PA 2E1ZA 3VEVA 5I9EB 2CGJA 2FLOA 3OW2M 5C12A 1N8RO 1JJ2M 3D2FA 5BPNA 4YORA 4EHTA 3CJAA 2BH1A 5BRFA 1HKBA 1X9JA 1MA9B 3JS6A 3FZFA 4B1UB 3WXJA 4WFNL 4CZEA 2HSTA 4JKBA 4YDUA 4BQZA 1HPMA 2Q31A 4ILGB 2A3ZA 3B8AX 4XEIA 4GV9A 2E8AA 4FPAA 1G99A 4FWPA 4HWIA 1BA0A 5GIOA 4PKHA 4BVPA 1ZXOA 3CJCA 3ID6A 2HBKA 2ZF5O 4CZIA 3OHRA 3L4IA 4AM7A 3W3DA 2J4RA 3FZLA 2ITMA 1VQON 1ATRA 3EL2A 3HRGA 3ULEA 2P9IA 3O4WA 3O1WA 3R9PA 1Q82O 2PBDA 3IKMA 1NGEA 1JCEA 4K25A 3CETA 1KAXA 3ZETA 2QEXN 2H3GX 3VTHA 1NGCA 3DXKB 5FPDA 2GX9A 2P9SB 3CQXA 1DKGD 4K41A 3R8EA 5JLHA 3SMPA 3I55N 2IVNA 3CJ1A 2Q36A 5GIPA 3MWPA 3J8AA 4WYBA 2VCPA 4M63C 2NZTA 5KPZA 3UE5A 2HOEA 3MDQA 3P39A 4H0OA 5AQSA 3U8XA 3R1XA 5AQOA 3EKSA 4FWRA 2BUPA 2QWNA 3EO3A 4IOAL 4FWKA 4JKCA 4WQ4C 1ZBSA 1P90A 4WQ5C 3CC2N 1OVYA 1GLDG 3M3ZA 2P9NA 1NBWA 4JK7A 4BROA 4CZJA 4IWVA 3FZKA 3WEEA 5JVHL 5LJWA 2EWSA 3CIPA 3KVGA 1R59O 4CBXA 2P9PB 5AZIB 3LM9A 5F2RA 3FZMA 4O8UA 1S72N 3T7ZA 5AR0A 4GY2B 4LC9B 1TYQA 2GWJA 3C7NB 4H0TB 4H0XB 2ASMA 3D2EB 3LM2A 5AQFA 4BRDA 5F1XA 5GINA 4YOWA 4MDBA 1YF5L 2NRXA 2P9LB 3CERA 3O9TA 3A5LC 3VF2A 3CF5L 1NWKA 3FFKB 3VETA 5JMVA 3MX2A 1ATNA 5AQHA 1JCFA 5M1QA 3UKRB 3MMVA 3TTDA 2CGKA 1VQPN 2NRRA 2QXLA 1C0GA 4H5RA 1IJJA 3UKUA 4AM6A 4JKEA 3MN6A 4CZHA 2ASOA 3C0BA 4FWNA 3I56N 2HBLA 4K42A 4NO7A 4JK8A 4B1ZA 2YX6A 1VAZA 3FGUA 1C0FA 1W97L 4QS9A 4CJ7A 3MWTA 3SJHA 5AZJB 3SAGA 3ZX2A 3M6GA 2KKZA 1JCGA 4UY8O 1VQ6N 3VERA 3CCMN 1KAYA 4KBOA 1YUWA 2ZGZA 1VQKN 3VF6A 3AY9A 4B1WB 5LY3A 3U9ZA 3WEEB 3OA9A 4BR5A 3IMXA 1K9MO 3ENOA 1XUPO 3IUCA 3K9JA 1K8AO 5M1KA 1VQ7N 5FPNA 1HLUA 4MLEA 2CH6A 4RCHA 1T44A 1MWMA 2P9PA 4FOIA 5AZIA 1GLLO 1MWKA 3SBTA 4C1NK 4BR7A 4U67L 1YJNN 3CJ9A 4FVUA 2PFUA 3HZ6A 4BRPA 5KQDA 3EE8A 3L0QA 1YJ9N 3ATUA 3HOTA 4EIAA 2NRVA 3GBTA 3J7ZO 3U4LA 4JKFA 2QWPA 1Y64A 4CZKA 4DHYA 3TPQA 4GVEA 4BC3A 3NMUA 1KAZA 1ILYA 4XH4A 3O5BA 4JKGA 4M7YA 5LJVA 2FF3B 3ENBA 3HBTA 5AQIA 4BR9A 4WQ5A 3QBXA 3VEOA 4B9QA 3BP8A 2ZJQL 2Q1NA 1HKCA 3TSPA 1NGDA 5C15A 3OBWA 2NLXA 4JD2A 4JEPA 3CJ7A 5F0XA 1XQSC 2P9NB 4FWSA 3ZX0A 4U7BA 5JVGL 5AQZA 2E1YA 4IJNA 4I6MB 5KPRA 2NRZA 1BWFO 3JXUA 4G9ZA 3CCSN 1KD1O 3O80A 5AQQA 3ZEUA 3R6MA 3C7NA 3E66A 5M1OA 5C0YA 4A62A 5AFUA 1T3VA 3H6EA 3O9UA 1YAGA 2F9TA 1LOTB 4CZGA 2W41A 4EFHA 3D2FB 1OKJA 4JD2B 1D4XA 4BREA 1WUAA 2VWBA 1YVNA 2DPNA 1BDGA 2Q0UA 3FR0A 3MN7A 3CPWM 1NGJA 5BR9A 4GV6A 5C10A 2IVPA 4FWMA 3DAWA 1DT9A 5BRHA 4WFAL 4C1NI 3D6RA 5AQWA 3CPEA 4PKGA 3T69A 2ZJPL 4IZ9A 3DLLL 5M1NA 3HOSA 1TUYA 5JLFA 1KXPA 1NLVA 1Z05A 2FXUA 4O8KA 3MN9A 5E26A 3C6AA 1NGFA 5AQLA 3CCVN 3G71N 3A5NC 3E1YA 4IEIA 5AZJA 5BRDA 3MCPA 5H1SQ 3F9MA 2F9WA 3A8YA 3SBGA 5EY4A 2KHOA 2ZJRL 1T6CA 3AGRA 1BOTO 2VGMA 5AQUA 4BRIA 4A59A 2VYPA 3EZWA 1VQ9N 5C2FA 1BG3A 1EO1A 2YHWA 4OO1J 3K9KA 3OBYA 3O1BA 5AQTA 1Q81O 3M5RA 4A61A 4CZFA 4IJAA 3CCEN 5BN9A 4ILJA 2D0PA 4MO4A 4YOVA 1HJOA 3CQYA 3VOVA 3AGKA 4CZLA 1HKGA 2P9UA 3CMEN 4WFBL 4BRCA 4A57A 3Q7BA 3VEWA 3SAFA 4H03B 5AQPA 3EE9A 3BEXA 4BRKA 4DQ8A 3I33A 4CD1A 4JK9A 1IG8A 4IEEA 1GLBG 3RSEA 3G25A 5EOYA 4DKWA 4YOYA 3D7EO 4MLHA 1ZC6A 2V51B 4A5AA 4F9OA 1W2BM 1TUUA 2FSKA 3BUZB 5GAHP 3CCLN 4YOUA 3MN5A 4E1JA 3VTIA 4NB4A 1VQMN 4JHDB 4JKHA 2KLAA 2HF4A 2UYTA 1HUXA 4JN4A 3QFUA 3CD6N 1QHAA 3A5OC 2CGLA 4DB3A 4BR0A 4Z94A 4XH5A 4ISFA 2GELA 1YXQA 4M7XA 3RSEB 3VMFB 4HTLA 4BG9A 3CI5A 4I6MA 4BRGA 1GLFO 1U6ZA 4H5WA 2FSNA 2Q97A 3M1FA 1QQMA 4CBUA 2QWQA 5BPLA 4CZMA 4C23A 5DM7L 3F5TA 2E88A 2OTJN 1U2VB 2I7PA 5AFUH 3H45C 3AAQA 2P9KB 1QVGM 3FLCO 3L6QA 2QI2A 2QM1A 5CHIA 3VEYA 3EN9A 3N4PA 5KPTA 4NLBA 2HMPA 3ID8A 3LL3A 4H0VB 2FSJA 3KK7A 3S41A 4KH6A 1E4FT 4RWTA 4R79A 4BVOA 3UKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTD A;  1ATS A;  5AQR A;  1NGG A;  4ISG A;  2GEM A;  5AQG A;  3H46 O;  3A5M C;  3DXM A;  4WQ4 A;  3ATV A;  2AA4 A;  3SK3 A;  3UB5 A;  1WOQ A;  3HSC A;  4BC2 A;  5TKY A;  3WUH A;  3HM8 A;  1V4T A;  2E2Q A;  4H5V A;  4BGA A;  3TU5 A;  4BRF A;  1NGH A;  3FZH A;  3VEX A;  3AAR A;  3GOI A;  4RTF D;  3W0L A;  4IO8 A;  3LDN A;  4QS8 A;  2P9L A;  3QML A;  1BA1 A;  4DCH A;  4BR2 A;  1J6Z A;  2A41 A;  4MO5 A;  3CHW A;  3LDO A;  2ZGY A;  1GLC G;  5FPE A;  3LDL A;  4B1Y B;  5EXW A;  1S22 A;  2FF6 A;  2YHX A;  3SMS A;  1Z6R A;  1MDU B;  4FWQ A;  2YJE A;  3VEZ A;  3VGL A;  5FPM A;  3BF1 A;  3GG4 A;  3QDK A;  4H5T A;  4QS7 A;  4PL7 A;  4Y0W A;  1S3X A;  5AQJ A;  5BN8 A;  4L3Q A;  3O08 A;  5BPM A;  5ADX A;  3ZX3 A;  2IIR A;  3HTV A;  1SZ2 A;  4ISE A;  1BUP A;  2E2N A;  4XH1 A;  4BRA A;  4EAH D;  1ESV A;  5CE3 A;  2A40 A;  2D4W A;  3EKU A;  1TYQ B;  3P4I A;  3H1Q A;  4FPB A;  1QQO A;  2V7Z A;  2QWM A;  1BU6 O;  1T6D A;  1NMD A;  4A2B A;  4FOE A;  3DJC A;  1HX1 A;  4EHU A;  1QZ6 A;  2YJF A;  3KHY A;  1QQN A;  1V4S A;  3VGK A;  4BRQ A;  3WXK A;  2QW9 A;  3CJB A;  2YI1 A;  4YDU C;  1RGI A;  2Q2R A;  2V7Y A;  1NGI A;  1SQK A;  3AAP A;  4BG8 A;  4B1X B;  3KZB A;  5AQX A;  5AQN A;  3FE1 A;  4BGB A;  2YCH A;  2E2O A;  4BC5 A;  4JAX A;  2HF3 A;  3DXK A;  4FSV A;  4BRH A;  5AQM A;  2QWO A;  3GE1 A;  5JIC A;  3VPZ A;  1XC3 A;  5E84 A;  2Q0R A;  3ENH A;  4PL8 A;  4BR4 A;  4CBW A;  5KQ8 A;  4BRM A;  1X3N A;  3GDQ A;  5ADX H;  3QBW A;  4PKI A;  3QIC A;  2A6A A;  3H1V X;  2CH5 A;  4O5F A;  3MK6 A;  1NGB A;  3WXL A;  4BQL A;  2YHY A;  4K43 A;  3I8B A;  4B1V A;  2V52 B;  2PAV A;  1GLJ O;  3A0I X;  2NRH A;  3IFR A;  3VGM A;  5B8H A;  4JHD A;  4H0Y B;  1LCU A;  5EX5 A;  1DGK N;  4A2A A;  3ULE B;  1E4G T;  3DXM B;  2W40 A;  3ZET B;  5BRE A;  2E20 A;  1GLA G;  1H1V A;  3QFP A;  2AP1 A;  2D1K A;  3VES A;  1P8Z A;  1K8K B;  1QZ5 A;  3LDQ A;  1X3M A;  2BTF A;  3D2E A;  4FWL A;  3ZEU B;  1Q18 A;  3H3N O;  3VEN A;  3LDP A;  3H3O B;  1RDW X;  3SLC A;  3IDH A;  2D0O A;  3QB0 A;  3DWL A;  1CZA N;  1GLE G;  2GWK A;  3GL1 A;  5AQK A;  3O6W A;  1SAZ A;  3UKU B;  3VF4 A;  4J8F A;  1RFQ A;  4FO0 A;  3HI0 A;  4BRL A;  3WQU A;  4CI6 A;  3U9D A;  3BF3 A;  2P9I B;  4BC4 A;  3WT0 A;  4IXC A;  2A42 A;  1U2V A;  1EQY A;  4GNI A;  2OAN A;  2IVO A;  2P9U B;  2GUP A;  3WQT A;  1DEJ A;  5EVZ A;  3WXI A;  2E2P A;  2P9S A;  1NGA A;  4BRN A;  2ZWH A;  2QWR A;  4FL9 A;  4CD3 A;  1NM1 A;  4FWO A;  1BO5 O;  4JNE A;  2WUS A;  3O8M A;  5ELZ A;  5AQY A;  4H5N A;  5AQV A;  2I7N A;  2P9K A;  1K8K A;  2QWL A;  2A5X A;  2ASP A;  3VEV A;  4H0P A;  2E1Z A;  5I9E B;  2CGJ A;  2FLO A;  3D2F A;  5BPN A;  5BRF A;  4EHT A;  3CJA A;  1HKB A;  1X9J A;  1MA9 B;  3JS6 A;  3FZF A;  4B1U B;  3WXJ A;  4CZE A;  4YDU A;  4BQZ A;  1HPM A;  2Q31 A;  2A3Z A;  3B8A X;  4XEI A;  2E8A A;  4FPA A;  1G99 A;  4FWP A;  4HWI A;  1BA0 A;  4PKH A;  4BVP A;  1ZXO A;  3CJC A;  2ZF5 O;  4CZI A;  3OHR A;  3L4I A;  4AM7 A;  3W3D A;  2J4R A;  3FZL A;  2ITM A;  1ATR A;  3EL2 A;  3ULE A;  2P9I A;  3O4W A;  3O1W A;  3R9P A;  2PBD A;  1NGE A;  1JCE A;  4K25 A;  3CET A;  1KAX A;  3ZET A;  2H3G X;  1NGC A;  3DXK B;  5FPD A;  2P9S B;  3CQX A;  1DKG D;  4K41 A;  3R8E A;  5JLH A;  3SMP A;  2IVN A;  3CJ1 A;  2Q36 A;  3J8A A;  4WYB A;  2VCP A;  4M63 C;  2NZT A;  5KPZ A;  3UE5 A;  2HOE A;  3MDQ A;  4H0O A;  5AQS A;  3U8X A;  5AQO A;  3EKS A;  4FWR A;  2BUP A;  2QWN A;  3EO3 A;  4FWK A;  4WQ4 C;  1ZBS A;  4WQ5 C;  1GLD G;  3M3Z A;  2P9N A;  1NBW A;  4BRO A;  4CZJ A;  4IWV A;  3FZK A;  3WEE A;  5LJW A;  2EWS A;  3CIP A;  3KVG A;  1R59 O;  4CBX A;  2P9P B;  5AZI B;  3LM9 A;  5F2R A;  3FZM A;  5AR0 A;  4GY2 B;  4LC9 B;  1TYQ A;  2GWJ A;  3C7N B;  4H0T B;  4H0X B;  2ASM A;  3D2E B;  3LM2 A;  5AQF A;  4BRD A;  5F1X A;  2P9L B;  3CER A;  3A5L C;  3VF2 A;  1NWK A;  3FFK B;  3VET A;  5JMV A;  1ATN A;  5AQH A;  1JCF A;  3UKR B;  3MMV A;  2CGK A;  2QXL A;  1C0G A;  4H5R A;  1IJJ A;  3UKU A;  4AM6 A;  3MN6 A;  4CZH A;  2ASO A;  3C0B A;  4FWN A;  4K42 A;  4NO7 A;  4B1Z A;  3FGU A;  1C0F A;  4QS9 A;  4CJ7 A;  3SJH A;  5AZJ B;  3ZX2 A;  3M6G A;  1JCG A;  3VER A;  1KAY A;  4KBO A;  1YUW A;  2ZGZ A;  3VF6 A;  3AY9 A;  4B1W B;  5LY3 A;  3U9Z A;  3WEE B;  4BR5 A;  3IMX A;  3ENO A;  1XUP O;  3IUC A;  5FPN A;  1HLU A;  4MLE A;  2CH6 A;  4RCH A;  1T44 A;  1MWM A;  2P9P A;  4FOI A;  5AZI A;  1GLL O;  1MWK A;  4BR7 A;  3CJ9 A;  3HZ6 A;  4BRP A;  5KQD A;  3L0Q A;  3ATU A;  4EIA A;  3GBT A;  3U4L A;  2QWP A;  1Y64 A;  4CZK A;  4DHY A;  3TPQ A;  4BC3 A;  1KAZ A;  4XH4 A;  3O5B A;  4M7Y A;  5LJV A;  2FF3 B;  3HBT A;  5AQI A;  4BR9 A;  4WQ5 A;  3QBX A;  3VEO A;  4B9Q A;  3BP8 A;  2Q1N A;  1HKC A;  1NGD A;  2NLX A;  4JD2 A;  3CJ7 A;  5F0X A;  1XQS C;  2P9N B;  4FWS A;  3ZX0 A;  5AQZ A;  2E1Y A;  4IJN A;  4I6M B;  5KPR A;  1BWF O;  3JXU A;  3O80 A;  5AQQ A;  3ZEU A;  3R6M A;  3C7N A;  4A62 A;  5AFU A;  3H6E A;  1YAG A;  2F9T A;  1LOT B;  4CZG A;  2W41 A;  4EFH A;  3D2F B;  1OKJ A;  4JD2 B;  1D4X A;  4BRE A;  1WUA A;  2VWB A;  1YVN A;  2DPN A;  1BDG A;  2Q0U A;  3FR0 A;  3MN7 A;  1NGJ A;  5BR9 A;  2IVP A;  4FWM A;  3DAW A;  5BRH A;  5AQW A;  4PKG A;  4IZ9 A;  1TUY A;  5JLF A;  1KXP A;  1NLV A;  1Z05 A;  2FXU A;  4O8K A;  3MN9 A;  5E26 A;  5AQL A;  1NGF A;  3A5N C;  5AZJ A;  5BRD A;  3MCP A;  3F9M A;  2F9W A;  3A8Y A;  5EY4 A;  2KHO A;  1T6C A;  1BOT O;  5AQU A;  4BRI A;  2VYP A;  3EZW A;  1BG3 A;  2YHW A;  5AQT A;  3O1B A;  4A61 A;  4CZF A;  4IJA A;  5BN9 A;  4MO4 A;  2D0P A;  1HJO A;  3CQY A;  3VOV A;  4CZL A;  1HKG A;  2P9U A;  4BRC A;  3VEW A;  4H03 B;  5AQP A;  3BEX A;  4BRK A;  4DQ8 A;  3I33 A;  4CD1 A;  1IG8 A;  1GLB G;  3RSE A;  3G25 A;  5EOY A;  3D7E O;  4MLH A;  1ZC6 A;  2V51 B;  4F9O A;  1TUU A;  2FSK A;  3BUZ B;  3MN5 A;  4E1J A;  4NB4 A;  4JHD B;  2HF4 A;  2UYT A;  1HUX A;  4JN4 A;  3QFU A;  1QHA A;  3A5O C;  2CGL A;  4DB3 A;  4BR0 A;  4Z94 A;  4XH5 A;  4ISF A;  2GEL A;  1YXQ A;  4M7X A;  3RSE B;  4HTL A;  4BG9 A;  3CI5 A;  4I6M A;  4BRG A;  1GLF O;  1U6Z A;  4H5W A;  2FSN A;  2Q97 A;  3M1F A;  1QQM A;  4CBU A;  2QWQ A;  5BPL A;  4CZM A;  4C23 A;  2E88 A;  1U2V B;  2I7P A;  5AFU H;  3H45 C;  3AAQ A;  2P9K B;  3FLC O;  3L6Q A;  2QM1 A;  3VEY A;  3EN9 A;  5KPT A;  2HMP A;  3ID8 A;  3LL3 A;  4H0V B;  2FSJ A;  3S41 A;  1E4F T;  4RWT A;  4BVO A;  3UKR A; 
#chains in the Genus database with same CATH topology
 4Z0U A;  4W5Q A;  1N33 K;  2KZM A;  1ATS A;  3O9Q A;  1XHX A;  4ISG A;  4N5S A;  1YIT N;  4I9L A;  5AQG A;  1J9A A;  3H46 O;  3TAQ A;  3A5M C;  1BIZ A;  1ZBU A;  4FJL A;  3C65 A;  2AA4 A;  4IFE A;  2EX3 A;  4WCE L;  5GAD P;  3RMA A;  3KWG A;  3L2U A;  4IDK A;  4H5V A;  4BGA A;  4WF9 L;  3NAE A;  3KJV A;  4Y1C A;  3SV3 A;  4PHT X;  2P9L A;  1TKD A;  1J6Z A;  4Z4C A;  3CHW A;  3DLG A;  4IFV A;  1GLC G;  4KB1 A;  1S22 A;  4JI1 K;  2YHX A;  3CQ8 A;  2A1R A;  2YJE A;  2QTD A;  3VEZ A;  3G10 A;  1JLF A;  1WSH A;  3BF1 A;  3GG4 A;  3V9W A;  1RNH A;  2XY6 A;  1WAJ A;  5BN8 A;  4DLG A;  3WNE A;  1L3T A;  3ZSQ A;  3I8D A;  2ATQ A;  4DV2 K;  5CE3 A;  3EKU A;  2NRT A;  3SPZ A;  4FJ8 A;  3P4I A;  4B3S K;  1RT5 A;  4EHU A;  3KHY A;  1WSF A;  4CGH A;  2HHT A;  3TSQ A;  2WOM A;  2YI1 A;  4LF9 K;  2Q2R A;  1NGI A;  4BG8 A;  1IKW A;  4B9V A;  3KZB A;  3O9R A;  4IG3 A;  5FDL A;  5AQX A;  5MLC Q;  3S3N A;  2E2O A;  4JKG B;  2HF3 A;  3DXK A;  4FSV A;  4JI2 K;  2QWO A;  1NU0 A;  2YV0 X;  3GE1 A;  5JIC A;  3CCQ N;  2EHG A;  3HJF A;  1CZ9 A;  1CZB A;  5E84 A;  4GV3 A;  4DSE A;  1YI2 N;  2VQF K;  3QBW A;  4PKI A;  3QIC A;  1IBL K;  3S3M A;  3WXL A;  2NNW A;  3QEP A;  2O8D B;  2NRH A;  3NH2 A;  4H0Y B;  2F4V K;  4OPH A;  3V1O A;  4EZ6 A;  5BRE A;  2RHK A;  1TKX A;  4OPA A;  1WSE A;  1RTD A;  4IO9 L;  2OTL N;  3ISN C;  3PO5 A;  1RDW X;  4LF5 K;  2D0O A;  1CZA N;  3K5M A;  3NVM A;  3GL1 A;  3VQ6 A;  4E19 A;  3S3O A;  3MX5 A;  1RFQ A;  3HI0 A;  1ZBL A;  3LAK A;  4HCB A;  4NXM K;  3MXI A;  3AVG A;  3TTF A;  3JAM O;  4BC4 A;  4IXC A;  1KC8 O;  3ZYY X;  1HR0 K;  1KRP A;  4AF1 A;  3WQT A;  2IVO A;  3VQD A;  1QTM A;  4CEF A;  4BY9 C;  1NGA A;  4FL9 A;  4ZTF A;  1NM1 A;  4CF9 A;  2O8E A;  1S1V A;  3SUP A;  4LSL A;  1BO5 O;  3Q7C A;  4HUF A;  2FBT A;  2E1Z A;  2CGJ A;  2FLO A;  1EO1 A;  5C12 A;  5BPN A;  4YOR A;  4EHT A;  3K58 A;  4DV4 K;  1E3M A;  1MA9 B;  3JS6 A;  3FZF A;  4X64 K;  3K5L A;  4Q0B A;  1HPM A;  2GBZ A;  3KLI A;  4XEI A;  4DG1 A;  2E8A A;  1G99 A;  1BA0 A;  1YVU A;  4BVP A;  4X65 K;  1ZXO A;  3ID6 A;  5I3U A;  1QE1 A;  1VSI A;  2KW4 A;  2ZF5 O;  3BZK A;  3NGI A;  5DMR A;  2J4R A;  3FZL A;  2ITM A;  3B6O A;  2RN2 A;  3ULE A;  3HRG A;  3VQB A;  1S5J A;  1QSS A;  3NE6 A;  3IKM A;  4K25 A;  3CET A;  2H3G X;  4C8O A;  2VG5 A;  2GX9 A;  2B5J A;  3LP0 A;  3R8E A;  1CXQ A;  2Q36 A;  4FZY A;  3QER A;  2NZT A;  5KPZ A;  4BE0 A;  2HOE A;  4NCA A;  3U8X A;  3R1X A;  1Y97 A;  3ZT2 A;  4JKC A;  3LDS A;  3THX B;  3SQ1 A;  2P9N A;  4BRO A;  3RMC A;  3AVJ A;  3KK2 A;  1NK7 A;  5AZI B;  3KLG A;  3LM9 A;  3T7Z A;  4M3U A;  2UXC K;  2GWJ A;  2DTU A;  2E6L A;  4H0T B;  3D2E B;  3OYC A;  4BRD A;  3OYH A;  3VF2 A;  1FJG K;  1RDB A;  3DRS A;  3K5O A;  2OCE A;  4CJR A;  1NOY A;  4FYD A;  3UKU A;  3M8P A;  4JKE A;  4CES A;  2ASO A;  1LW2 A;  3RMD A;  4CEC A;  4NO7 A;  2UXB K;  3KD1 E;  2X78 A;  4DTP A;  4FJX A;  2YX6 A;  1VAZ A;  4B3R K;  1SL1 A;  1C0F A;  4KTZ A;  3V9S A;  3ZX2 A;  3M6G A;  1JCG A;  3HPO A;  3CCM N;  2O8C B;  1VQK N;  4CER A;  3AY9 A;  3U9Z A;  3TAG A;  2O8F B;  3ENO A;  1NK6 A;  1XUP O;  3IS9 A;  3ZT0 A;  1K8A O;  5M1K A;  5FPN A;  3KLF A;  3SQ4 A;  3T3F A;  4KRF A;  1GLL O;  3HVT A;  2PFU A;  5BR8 K;  3L0Q A;  1JLQ A;  4CFD A;  4EIA A;  2NRV A;  3GBT A;  1Y64 A;  4DHY A;  4KHY A;  4O55 A;  4H4O A;  1KAZ A;  1ASV A;  4RW4 A;  1X1P A;  2FF3 B;  2YKM A;  4BR9 A;  4B9Q A;  2I5J A;  3AV9 A;  4CF8 A;  1S1T A;  4CHY A;  5HRS A;  1XQS C;  4U7B A;  1JKH A;  1REV A;  4LFB K;  4QCL A;  1KVB A;  5KPR A;  2NRZ A;  1BWF O;  4LH5 A;  5LL6 Z;  3CCS N;  3D0P A;  3AO5 A;  3ZEU A;  5AQQ A;  3R6M A;  3WNH A;  3E66 A;  4LSN A;  5E41 A;  1T3V A;  4DTJ A;  4CJ5 A;  4ZTJ A;  1LOT B;  1RT3 A;  2W41 A;  4CZG A;  1QSL A;  3D2F B;  2VWB A;  1YVN A;  2DPN A;  4GV6 A;  3MN7 A;  3CPW M;  5BR9 A;  4Z4F A;  1Q9Y A;  2KTQ A;  4CJQ A;  4WFA L;  3KIO A;  3AVM A;  1JLG A;  3IAY A;  3OYF A;  1RBV A;  3DLL L;  4FJG A;  5M1N A;  3V1Q A;  1Z05 A;  4ID5 A;  3K59 A;  3A5N C;  3E1Y A;  3MCP A;  3F9M A;  2BDP A;  2F9W A;  2KFZ A;  4B9U A;  2O8C A;  2ZJR L;  1T6C A;  2O4G A;  4AHS A;  4ID1 A;  3O4N A;  1BOT O;  3OYD A;  3NH1 A;  1B9F A;  3EZW A;  1BIU A;  1HJR A;  1T7P A;  2YHW A;  1J5E K;  3ZLJ A;  3O1B A;  1ZBI A;  4LFA K;  4CZF A;  3CCE N;  4YHH K;  4HTU A;  3HK2 A;  1HJO A;  3CFR A;  3UIQ A;  4WFB L;  3SAF A;  4H03 B;  5AQP A;  3EE9 A;  4Z4I A;  4CD1 A;  5CYQ A;  4IEE A;  4FZX C;  3RSE A;  5EOY A;  4DKW A;  3C94 A;  3D7E O;  4MLH A;  4A5A A;  1W2B M;  4DR4 K;  4EP4 A;  3MN5 A;  2B4J A;  4V19 S;  1WBB A;  1HUX A;  1XI1 A;  1A5V A;  1QHA A;  4OVL A;  4B9L A;  2QXF A;  4DB3 A;  4BR0 A;  3HL8 A;  4XH5 A;  2GEL A;  2F8T A;  3J7A P;  3RSE B;  4BRG A;  4GMJ B;  4GKK K;  2VG7 A;  1HPZ A;  4H5W A;  2KQ2 A;  5BPL A;  4DTR A;  2D0C A;  5DM7 L;  5KTQ A;  1JL2 A;  1IG9 A;  2P9K B;  4CVN E;  4RW8 A;  2GUI A;  2QI2 A;  5CHI A;  3VEY A;  3O3F A;  3ZSV A;  4NLB A;  4CCH A;  3S41 A;  1S6Q A;  4NCB A;  5HRR A;  4C8N A;  2GTD A;  1VSE A;  3DI6 A;  2PYL A;  3ULD A;  5HRP A;  4E7K A;  3DXM A;  1WB9 A;  4E0D A;  3SK3 A;  4CF2 A;  4DLE A;  1WOQ A;  3O9S A;  4IDH A;  4BC2 A;  4Y1D A;  3CC4 N;  3CXC M;  3AVB A;  2E2Q A;  4ILH A;  3DLH A;  3VEX A;  3GOI A;  1J54 A;  1A5X A;  4RTF D;  4IO8 A;  3T1H K;  3LDN A;  4QS8 A;  4KI6 A;  4DCH A;  3CCJ N;  1HRH A;  2RE2 A;  3CCR N;  4FM0 A;  4FVM A;  3PIP L;  3AVK A;  4N41 A;  4DU3 A;  5FPE A;  5EXW A;  3JSM A;  1VQ8 N;  1VSF A;  1Z6R A;  1MDU B;  2VWK A;  2RKI A;  3VQ9 A;  4H5T A;  4ELT A;  4QS7 A;  2Z1H A;  1OH8 A;  1LV5 A;  2WBN A;  3TAP A;  5DM6 L;  5ADX A;  3ZX3 A;  1VQL N;  4IOC L;  1TGO A;  1SZ2 A;  4ISE A;  2E2N A;  2HHQ A;  3EEQ A;  1TVR A;  4DQP A;  5T7B A;  4CHN A;  1TYQ B;  3H1Q A;  4FPB A;  4KH4 A;  3LAN A;  1QQO A;  2V7Z A;  5C2D A;  2QWM A;  3HP6 A;  1WLJ A;  4A2B A;  4FOE A;  1NK0 A;  3J7Y P;  1QQN A;  1V4S A;  3VGK A;  4KO0 A;  3VQA A;  1X9S A;  4BRQ A;  1NNE A;  4BE1 A;  1RGI A;  3HT3 A;  3NBP A;  1HYS A;  3O3G A;  3M8R A;  4YY3 K;  2WFB A;  4BC5 A;  4JAX A;  5GAE P;  4DV1 K;  3E9P A;  2WTU A;  1SS6 A;  3E9L A;  4CIF A;  1NKE A;  2WC9 A;  1XC3 A;  2Q0R A;  3ENH A;  4PL8 A;  4DS5 A;  1WBD A;  4F3T A;  4BRM A;  1HQE A;  4R5P A;  3VQP A;  4B9S A;  5FRN A;  3PSF A;  3H1V X;  2CH5 A;  3P83 D;  4O5F A;  3MK6 A;  3SI6 A;  4AHV A;  4DSF A;  2V52 B;  2HHX A;  5CY4 A;  2PAV A;  1GLJ O;  4JI7 K;  3A0I X;  1BI4 B;  4CJP A;  1U49 A;  4JHD A;  5LMN K;  1LCU A;  3G4S N;  3MCA B;  3NF6 A;  1DGK N;  4DSJ A;  4A2A A;  3C6T A;  1JLB A;  1E4G T;  3DXM B;  2E20 A;  3PSI A;  3SQ0 A;  1P8Z A;  4HUE A;  1U04 A;  3SYZ A;  1Q18 A;  2WON A;  4PY5 A;  3DWL A;  4TSX A;  1VSL A;  4LY7 A;  3UKU B;  4J8F A;  3CMA N;  4LD0 A;  4BRL A;  1HQU A;  4CI6 A;  2G8I A;  3BF3 A;  2HNZ A;  3DLR A;  4CGD A;  2A42 A;  1U2V A;  1Q8I A;  1DLO A;  1ZYQ A;  2E4L A;  1VSH A;  1DEJ A;  5EVZ A;  2IDO A;  3LP1 A;  2OPQ A;  2P9S A;  1Q7Y O;  1HNZ K;  4CD3 A;  2HHU A;  4FJN A;  3THY B;  4H5N A;  5AQV A;  2P9K A;  5M1F A;  2A5X A;  1S1X A;  5CR4 A;  3VEV A;  5I9E B;  1J53 A;  3OW2 M;  5BRF A;  2BH1 A;  3CJA A;  3MXJ A;  4B1U B;  3WXJ A;  3KKR A;  3SJJ A;  1QS4 A;  4JKB A;  4CHP A;  4M3Z A;  2RPI A;  2YNI A;  4KHU A;  1OVQ A;  4FWP A;  4HWI A;  3TAF A;  5GIO A;  3OYA A;  4PKH A;  1NJW A;  4E3S A;  4N76 A;  1ATR A;  1KFS A;  1ZBH A;  3AO2 A;  1K6Y A;  2FBX A;  1NGE A;  1JCE A;  2YKN A;  1RBT A;  3PX4 A;  3VTH A;  3DXK B;  5FPD A;  3OYJ A;  4LH4 A;  3CQX A;  4DQQ A;  1D8Y A;  3I55 N;  1GOA A;  2IVN A;  3CJ1 A;  3THY A;  3MWP A;  3SPY A;  1HNI A;  2VCP A;  4M63 C;  1IH7 A;  3OJS A;  4M3Y A;  3MDQ A;  4H0O A;  5AQO A;  3EO3 A;  4IOA L;  4WQ4 C;  4WQ5 C;  1OVY A;  4OKK A;  4DV7 K;  3V9X A;  1VHX A;  4CHZ A;  4IWV A;  2EWS A;  3CIP A;  3QIO A;  1R59 O;  4OPJ A;  1VK0 A;  3FZM A;  4UQG A;  3KLH A;  3LPT A;  4GY2 B;  4LC9 B;  3MAQ A;  4H0X B;  4F3O A;  2XY8 A;  1BGX T;  5AQF A;  5F1X A;  2IGI A;  1YF5 L;  5J2P A;  2NRX A;  3CER A;  1WAF A;  3MX2 A;  1BL3 A;  5AQH A;  5M1Q A;  4FLT A;  1NK5 A;  3K57 A;  1NG9 A;  3TTD A;  2CGK A;  1C0M A;  2YHA A;  4E7J A;  3MEC A;  4H5R A;  4FWN A;  4J2D A;  2HBL A;  4K42 A;  1FKP A;  2ZD1 A;  4JK8 A;  4DTX A;  4CJK A;  3FGU A;  2UXD K;  1W97 L;  3SJH A;  1LW0 A;  3TAM A;  3VQ7 A;  4DF8 A;  4KBO A;  1U4B A;  2ZGZ A;  2OYQ A;  4OJR A;  3VF6 A;  1C1C A;  4B1W B;  3OA9 A;  4BR5 A;  1K9M O;  3K2P A;  3TAE A;  3K9J A;  1VQ7 N;  4FJ5 A;  4RCH A;  4CEE A;  1BQN A;  4MLE A;  1T44 A;  1MWM A;  5AZI A;  1MWK A;  1FW6 A;  4CEO A;  3O3H A;  3HZ6 A;  4E1M A;  1N36 K;  2Y1J A;  1YJ9 N;  1Z25 A;  3ATU A;  2DY4 A;  3J7Z O;  4CZK A;  4X66 K;  4DTS A;  3TPQ A;  3HM9 A;  3NMU A;  1HMV A;  1NMN A;  4JYA K;  5CZ1 A;  4XH4 A;  1ILY A;  2BAN A;  1EKE A;  3L8B A;  4M7Y A;  4M42 A;  3ENB A;  3HBT A;  1RT7 A;  4QAG A;  1W0H A;  4WQ5 A;  3VEO A;  1TAQ A;  2ZJQ L;  2Q1N A;  1T05 A;  1NGD A;  3OBW A;  4JD2 A;  1HNV A;  1QHT A;  1RT4 A;  2P9N B;  2W42 A;  4FJ7 A;  4DTN A;  4I6M B;  4OLB A;  1NJZ A;  3C7N A;  1RBR A;  1QQC A;  3H6E A;  2D0B A;  3ZSO A;  1S9G A;  4EFH A;  4JD2 B;  4BRE A;  4DV6 K;  4CJV A;  3OYL A;  2Q0U A;  1NGJ A;  4AHU A;  1DT9 A;  3AO1 A;  4C1N I;  4PKG A;  2ZJP L;  4IZ9 A;  3TI0 A;  3F73 A;  3HOS A;  1TUY A;  3HP9 A;  2OPS A;  1RT1 A;  5KRT A;  3C6A A;  3G71 N;  2HND A;  3ZSY A;  4M41 A;  1RDC A;  1FKO A;  2KHO A;  3OYI A;  4KB0 A;  1RTJ A;  3RRH A;  4LF4 K;  2VYP A;  1IBK K;  4OO1 J;  4F8R A;  1YTA A;  3VQC A;  3K9K A;  3OBY A;  5AQT A;  4FW1 A;  1Q81 O;  1RT2 A;  1LWF A;  4DSI A;  3THV A;  1VRT A;  1HKG A;  2LSN A;  2P9U A;  1YT3 A;  4A57 A;  4BWM A;  1IO2 A;  5KRS A;  1U48 A;  1KFD A;  4KHQ A;  3I33 A;  2Z1I A;  1GLB G;  2HVH A;  3V9Z A;  1ZC6 A;  3AVC A;  3ZSW A;  5GAH P;  3CCL N;  3BUZ B;  2QKK A;  2JLE A;  3L2Q A;  4B3O A;  1JLA A;  4B8C A;  2HB5 A;  4B3T K;  3BY5 A;  1VQM N;  2KLA A;  2HF4 A;  2Z1J A;  3CD6 N;  4RW7 A;  4CIE A;  2FC0 A;  4Z94 A;  4CF1 A;  1N34 K;  4ISF A;  4M7X A;  4DS4 A;  1JXE A;  3CI5 A;  3T1A A;  2FSN A;  1W9H A;  2I7P A;  1OH7 A;  1RDA A;  4W5R A;  3H45 C;  1BCM A;  3L6Q A;  4CJ3 A;  1JL1 A;  2G8W A;  3N4P A;  1NK4 A;  3KK7 A;  4KH6 A;  1E4F T;  1WN7 A;  4BVO A;  3UKR A;  1TK5 A;  4M3X A;  4NLC A;  2GEM A;  1KQS M;  1C0T A;  2F96 A;  1LAV A;  5KGX A;  3ZT3 A;  3DOL A;  4WE1 A;  1N6Q A;  4O0J A;  3QIP A;  3UB5 A;  4FLU A;  3HSC A;  2JWL A;  3BZC A;  1TL3 A;  3RVC A;  1YHQ N;  3NHG A;  5TKY A;  1JLC A;  3WUH A;  1SV5 A;  1V4T A;  1EXQ A;  4BRF A;  3OS0 A;  4EZ9 A;  3FZH A;  4HHT A;  2F7T A;  4Z4G A;  3AAR A;  3SCX A;  2YHB A;  1BA1 A;  2ITG A;  3G6E N;  3PY8 A;  3KKS A;  2G8F A;  4MO5 A;  4CE9 A;  2ZGY A;  4M3R A;  3CCU N;  1SUQ A;  4PQU A;  1SL2 A;  1KLM A;  3SMS A;  3DLB A;  3LP2 A;  4FLY A;  3PLA A;  3VGL A;  4FJM A;  3QDK A;  4PL7 A;  4KHW A;  3AVF A;  1S3X A;  5AQJ A;  4L3Q A;  3EZ5 A;  1KCF A;  4KI4 A;  3LWM A;  3O08 A;  4G1Q A;  4CK2 A;  5TKW A;  2XO7 A;  3HTV A;  5FRO A;  4RG8 A;  3SUQ A;  4CEQ A;  4RW6 A;  4JRP A;  4XH1 A;  4BRA A;  1ESV A;  1C1B A;  3P31 A;  1RDU A;  4DV3 K;  4IFY A;  1U45 A;  5KI6 A;  5KGW A;  1VQN N;  3OYE A;  1BU6 O;  1Q86 O;  4DR2 K;  1KTQ A;  4CED A;  2R7Y A;  3DJC A;  1HX1 A;  4KTQ A;  4Z4H A;  1QZ6 A;  4OKJ A;  5HBM A;  4YOX A;  1XMQ K;  3WXK A;  2QW9 A;  2RF2 A;  4YDU C;  3VQ4 A;  5LMU K;  1SL0 A;  2V7Y A;  2HBM A;  3P38 A;  4B1X B;  1IKV A;  3RTV A;  3H08 A;  3FE1 A;  5AQN A;  4BGB A;  2YCH A;  1XC9 A;  1OH6 A;  1MU2 A;  1O13 A;  5SZT A;  4BRH A;  3P5J A;  5AQM A;  4CK3 A;  1WSI A;  3M8S A;  4BR4 A;  1FK9 A;  4CBW A;  5KQ8 A;  4LF6 K;  3VN5 A;  4IOX A;  4RW9 A;  5ADX H;  2A6A A;  3C6H A;  1NGB A;  1TK0 A;  3AO3 A;  1F21 A;  3F9K A;  2X6N A;  2B6A A;  4C8K A;  5HL7 L;  1N5Y A;  4CFC A;  4J2B A;  3E01 A;  1UAX A;  4I2P A;  3VGM A;  5B8H A;  4QOZ B;  3WXM B;  5EX5 A;  3ULE B;  1W7A A;  1U47 A;  2AJQ A;  2W40 A;  3ZET B;  1GLA G;  1H1V A;  3QFP A;  4NYF A;  2AP1 A;  2D1K A;  4FJI A;  3VES A;  1K8K B;  1Q9X A;  1QZ5 A;  3LDQ A;  1X3M A;  1JLE A;  1TAU A;  4FWL A;  4KHS A;  4CF0 A;  3ZEU B;  4DF4 A;  3H3N O;  2OZM A;  4I2Q A;  3NDK A;  1VQ5 N;  3LDP A;  3QEW A;  3R3L A;  2UU9 K;  1GLE G;  5AQK A;  4J2E A;  3O6W A;  1SAZ A;  1L3U A;  4MQ3 A;  3IRX A;  3U9D A;  2YNG A;  1YTU A;  1KSP A;  2JGU A;  4KH5 A;  3SNN A;  3WT0 A;  3BDP A;  1EET A;  2QA4 N;  4GNI A;  1EWR A;  1D5A A;  2F8S A;  4GKJ K;  2GUP A;  1D9F A;  3WXI A;  1GOC A;  2ZWH A;  2QWR A;  1XHZ A;  4FWO A;  4JNE A;  2WUS A;  5AQY A;  2I7N A;  1K8K A;  3O4Q A;  2ASP A;  3CFO A;  4H0P A;  3U3Y A;  1N8R O;  3NCI A;  1JJ2 M;  1QSY A;  3MEE A;  3D2F A;  4BWJ A;  4CEA A;  1X9J A;  3HXM A;  2PYJ A;  4WFN L;  2HST A;  3D45 A;  4BQZ A;  4E1N A;  4HUG A;  3B8A X;  4O0I A;  4FPA A;  2UUC K;  4IKF A;  1KVA A;  4L8R B;  3CJC A;  4DV5 K;  4CZI A;  3L4I A;  4AM7 A;  3I0R A;  1VQO N;  3EL2 A;  2OPR A;  2P9I A;  3O4W A;  1BIS A;  3TAN A;  4K0K K;  2PBD A;  3LP3 A;  2O8B A;  1G15 A;  3ZET A;  2QEX N;  2A1S A;  2BGG A;  2E5L K;  1DKG D;  3KTQ A;  1VRU A;  3SMP A;  4DR5 K;  4GW6 A;  3J8A A;  4WYB A;  3MXM A;  4FCY A;  3VA0 A;  3P39 A;  2BUP A;  4FWK A;  1ZBS A;  4OPK A;  4DR6 K;  1P90 A;  1I94 K;  3CC2 N;  3ZSR A;  5AJ3 K;  1R0A A;  1GLD G;  3L3U A;  3M3Z A;  1NBW A;  4JK7 A;  4F2S A;  3FZK A;  5LJW A;  2X74 A;  4FK2 A;  5HP1 A;  3KVG A;  2P9P B;  4IBN A;  5F2R A;  5J2N A;  4O8U A;  1EX4 A;  1S72 N;  5AR0 A;  4DMN A;  3V4I A;  3V6D A;  2ASM A;  3LM2 A;  4DR1 K;  3T1Y K;  5GIN A;  4MDB A;  2XY5 A;  3OYG A;  2YNF A;  4FM2 A;  3CF5 L;  3FFK B;  4K8X A;  3K0S A;  3DYA A;  3KK1 A;  1JCF A;  3NGY A;  2QXL A;  3PV8 A;  4JI4 K;  4LF8 K;  1BI4 A;  4DQR A;  2QK9 A;  2XY7 A;  4QS9 A;  4DV0 K;  3RWU A;  2P51 A;  3SZ2 A;  2KKZ A;  3VER A;  3QET A;  1KAY A;  1YUW A;  3OTO K;  2G8V A;  1SKS A;  1HLU A;  2CH6 A;  3SV4 A;  4FOI A;  4DSL A;  3AVA A;  4U67 L;  1YJN N;  2OZS A;  4FVU A;  5KQD A;  3EE8 A;  4NXN K;  2VWJ A;  3HOT A;  3OYB A;  3U4L A;  3SUO A;  4JKF A;  2QWP A;  1HYV A;  4GVE A;  4ICL A;  3S9H A;  4BC3 A;  2QKB A;  1NKC A;  3O5B A;  4JKG A;  4XIU A;  4CJE A;  1TL1 A;  3DOK A;  5LJV A;  3B6P A;  1A5W A;  3RR8 A;  3MED A;  5AQI A;  3HPH A;  3L3V A;  3QBX A;  1NKB A;  1SKW A;  3BP8 A;  2GV9 A;  4ELU A;  3TSP A;  4CHQ A;  4KRE A;  2NLX A;  4JEP A;  4MFB A;  3CJ7 A;  5AQZ A;  4BAC A;  4DTO A;  2E1Y A;  4IJN A;  3OS2 A;  3G0Z A;  1KD1 O;  4FJH A;  3O80 A;  4F4K A;  5IWA K;  4C8L A;  1I3A A;  4PUO A;  2F9T A;  5HRO A;  2YNH A;  2PY5 A;  4CK1 A;  1OKJ A;  1D4X A;  4DU1 A;  4CIG A;  1BDG A;  3FR0 A;  4FWM A;  3DAW A;  3RRG A;  3VA3 A;  5J2M A;  5EU7 A;  4KTW A;  5AQW A;  1C1A A;  4X62 K;  4DFP A;  4M3W A;  5JLF A;  1KXP A;  1NLV A;  2FXU A;  4O8K A;  3MN9 A;  4OGC A;  1BQM A;  1NGF A;  4OGE A;  4AHT A;  5BRD A;  5H1S Q;  3A8Y A;  3SBG A;  5EY4 A;  3PO4 A;  3L2R A;  3AGR A;  3ITH A;  4YFU A;  2E6M A;  2VGM A;  4CW7 B;  5AQU A;  4W5N A;  1IV0 A;  3A2F A;  1VQ9 N;  5C2F A;  4FZZ A;  3WNF A;  1RTH A;  2O8F A;  4BDZ A;  3M5R A;  3AA5 X;  4A61 A;  1I39 A;  4IJA A;  5BN9 A;  4ILJ A;  4YOV A;  3VOV A;  3AGK A;  4DSK A;  4FM1 A;  2Q3S A;  3Q7B A;  3VQQ A;  4JK9 A;  4E7H A;  3EY1 A;  2V51 B;  5K14 A;  4CJW A;  1TKZ A;  4JI5 K;  1TUU A;  2FSK A;  1WSJ A;  4YOU A;  4E1J A;  4JI8 K;  4JHD B;  4JKH A;  1IKX A;  1WNS A;  4JN4 A;  2P5G A;  2FBY A;  1S1W A;  2OA8 A;  2CGL A;  3EYZ A;  3L2W A;  2IS3 A;  1GOB A;  4N56 A;  4DFK A;  3NH0 A;  3DLK A;  3LAM A;  4AH9 A;  1GLF O;  4CHO A;  1U6Z A;  2Q97 A;  3M1F A;  1QQM A;  4AHR A;  3OY9 A;  2QWQ A;  4M3T A;  4CZM A;  3DMJ A;  2E88 A;  1U2V B;  3CYM A;  5AFU H;  3QIN A;  3AAQ A;  3P1G A;  3OYK A;  1QVG M;  1RTI A;  3FLC O;  3THW A;  1DTT A;  3OYN A;  3V9U A;  5KPT A;  3J80 O;  1KLN A;  3ID8 A;  4H0V B;  4RWT A;  4R79 A;  3DLE A;  5CYM A;  3KK3 A;  3KLE A;  5AQR A;  1NGG A;  3NVK A;  3VQE A;  4W5O A;  4KFB A;  3NF9 A;  1RDD A;  1IKY A;  5J1E A;  5C42 A;  4J2A A;  5FRM A;  4WQ4 A;  3ATV A;  3AA2 A;  4CGG A;  2Y1I A;  1S6P A;  1M90 O;  4B3M K;  3U3G A;  4CEB A;  3CG7 A;  1TK8 A;  2O8E B;  3NF7 A;  3RR7 A;  1BHL A;  3TTC A;  3HM8 A;  3AA4 A;  3TU5 A;  3OS1 A;  1NGH A;  2IC3 A;  5FLX O;  3F2K A;  1DTQ A;  1EWQ A;  1X9W A;  1BCO A;  4CJL A;  4NCG A;  1HNX K;  4FLW A;  4FJK A;  3W0L A;  1K73 O;  3QML A;  2HHS A;  4BR2 A;  2A41 A;  3LDO A;  1VQ4 N;  3LDL A;  4B1Y B;  2FF6 A;  3WNG A;  4FWQ A;  5FPM A;  3E9O A;  1X9M A;  4Y0W A;  2XRI A;  1N32 K;  3C95 A;  4H4M A;  1ITG A;  1RIL A;  3ZSZ A;  4FXD A;  5BPM A;  4I9Q A;  2IIR A;  1HNW K;  5HOO A;  1BUP A;  2P1J A;  4EAH D;  2A40 A;  2D4W A;  5DK5 A;  5HRN A;  3KWI A;  2JWK A;  1Z26 A;  1OH5 A;  3QNN A;  5JS2 A;  3CC7 N;  1T6D A;  1UA1 A;  1NMD A;  4YOT A;  4FK4 A;  3C6U A;  3I0S A;  2YJF A;  3SQ2 A;  3OVN A;  3QNO A;  3CJB A;  1SQK A;  4DQS A;  1B9D A;  3AAP A;  4B8A B;  4JV5 K;  4PWD A;  3QEX A;  1VSD A;  1HYZ A;  4JKA A;  3VPZ A;  4OKE A;  3L4Q A;  2UUB K;  1NK8 A;  3AO4 A;  4KHN A;  3AVI A;  1NJI O;  1X3N A;  3GDQ A;  2HHW A;  4OX9 K;  5C24 A;  2G8H A;  1S1U A;  2O4I A;  4CGJ A;  4BQL A;  2YHY A;  4JLH A;  4K43 A;  3I8B A;  4B1V A;  4DR7 K;  2VQE K;  3IFR A;  3N4Q A;  3PIO L;  4CEZ A;  4DFM A;  1TKT A;  1VSM A;  2VGN A;  3IG1 A;  2FBV A;  3V1R A;  5IT9 O;  1YIJ N;  5C25 A;  3QEV A;  5HLF A;  2HBJ A;  4A5B A;  3TSU A;  2BTF A;  3D2E A;  3NGZ A;  3RMB A;  4CJT A;  4MDA A;  3LAL A;  3VEN A;  1FXX A;  3H3O B;  3SLC A;  3IDH A;  4JI6 K;  2HMI A;  3QB0 A;  2GWK A;  2OPP A;  1QVF M;  4FK0 A;  3VF4 A;  5GAG P;  4FO0 A;  4DTM A;  2HHV A;  1L3V A;  4AQY K;  3WQU A;  4CJF A;  2P5O A;  2NRW A;  4FJJ A;  1S9E A;  2DFH A;  2P9I B;  4AIL C;  1D9D A;  1M1K O;  1EQY A;  2IOC A;  2OAN A;  2P9U B;  3CM5 A;  2E2P A;  4JKD A;  3NF8 A;  3AVL A;  2ZM6 K;  4BRN A;  1RCH A;  3OYM A;  4FW2 A;  5M1P A;  5ELZ A;  1YJW N;  3O8M A;  4FJ9 A;  3SAH A;  4JS5 A;  2QWL A;  2X6S A;  3LZJ A;  4DTU A;  1RBS A;  3PUF A;  3VQ5 A;  3BGR A;  4DWI A;  1HKB A;  3L2V A;  3TAB A;  1T03 A;  4CZE A;  2D5R A;  4DQI A;  5JS1 A;  4YDU A;  4KV8 A;  2Q31 A;  4ILG B;  3MEG A;  3QO9 A;  4C8M A;  2A3Z A;  4GV9 A;  2DFE A;  3DRP A;  4O44 A;  4E7L A;  2HBK A;  3OHR A;  3W3D A;  3ALY A;  1CLQ A;  3AVN A;  3O1W A;  3R9P A;  4BDY A;  4CJU A;  1Q82 O;  1KAX A;  1O1W A;  1ASU A;  1ASW A;  1NGC A;  3THX A;  2UUA K;  2P9S B;  4BE2 A;  4K41 A;  5JLH A;  5GIP A;  2Z1G A;  3UE5 A;  4ELV A;  1L3S A;  5AQS A;  3EKS A;  4FWR A;  2QWN A;  4KKO A;  4DUY K;  4O5B A;  4JS4 A;  4DFJ A;  2ETJ A;  1NK9 A;  4DUZ K;  3TWH A;  1B92 A;  2XHB A;  4CZJ A;  1IBM K;  5JVH L;  3WEE A;  3LPU A;  3FFI A;  3V81 A;  4CBX A;  1J5O A;  1ZBF A;  1TYQ A;  3C7N B;  3CFP A;  4YOW A;  3ZCM A;  2P9L B;  1VSK A;  3A5L C;  3O9T A;  1JXB A;  3ZSX A;  1NWK A;  4KHP K;  3VET A;  5JMV A;  1ATN A;  3UKR B;  3MMV A;  1UWB A;  1VQP N;  2NRR A;  3U6F A;  2BE2 A;  1C0G A;  3SUN A;  1IJJ A;  4AM6 A;  3MN6 A;  4CZH A;  3C0B A;  3I56 N;  4B08 A;  3PX0 A;  3ASM A;  4B1Z A;  2DFF A;  1C6V A;  1LWE A;  3DM2 A;  4K8Z A;  2O8D A;  3AA3 A;  4CJ7 A;  3MWT A;  2HW3 A;  5AZJ B;  3SAG A;  1VSJ A;  3QEI A;  4UY8 O;  1VQ6 N;  2HHH K;  4OLA A;  5LY3 A;  3WEE B;  3IMX A;  2KZZ A;  1XNR K;  4E7I A;  3IUC A;  4AHC A;  2P9P A;  4CGF A;  3VQ8 A;  3SBT A;  4C1N K;  4BDP A;  4BR7 A;  1CXU A;  3CJ9 A;  3JYT A;  3J81 O;  4BRP A;  2NUB A;  4N47 A;  5SWM A;  3TR8 A;  3HO1 A;  3QES A;  2ZQB A;  5CZ2 A;  3ZT1 A;  4CGI A;  3PX6 A;  4NYN A;  3OJU A;  4Z4E A;  1HKC A;  1XNQ K;  5C15 A;  1NJY A;  5F0X A;  3ZX0 A;  4FWS A;  2ZE2 A;  5JVG L;  3M8Q A;  3HST B;  3JXU A;  4CFB A;  3TAR A;  4G9Z A;  2D0A A;  5I42 A;  1LWC A;  2W6K A;  5M1O A;  4CJ4 A;  1UA0 A;  5C0Y A;  4EP5 A;  4A62 A;  4CJS A;  1XWL A;  5AFU A;  2G8K A;  4LFC K;  3O9U A;  1YAG A;  3CM6 A;  4HCC A;  4LF7 K;  4JRQ A;  4KPY A;  1WUA A;  3THW B;  1TV6 A;  2IVP A;  5C10 A;  5BRH A;  3D6R A;  3CPE A;  1C0U A;  3T69 A;  5A2Q O;  3DRR A;  4W5T A;  2IAJ A;  2HNY A;  4YNQ A;  4H8K A;  5E26 A;  1LAW A;  5AQL A;  3CCV N;  4IEI A;  3ZT4 A;  5AZJ A;  1XMO K;  1KVC A;  4FLV A;  2HVI A;  2O8B B;  4BRI A;  3QLH A;  4A59 A;  1BG3 A;  2PZS A;  4GVM A;  4CFA A;  1RBU A;  4MO4 A;  2D0P A;  3CQY A;  4CZL A;  4PA1 A;  3AVH A;  3CME N;  4BRC A;  4B9N A;  3VEW A;  4F2R A;  4B9M A;  3LZI A;  2G8U A;  3BEX A;  4BRK A;  4JI3 K;  4DQ8 A;  3HPG A;  4JI0 K;  2VG6 A;  1NJX A;  1IG8 A;  1SKR A;  4I7F A;  4YOY A;  3G25 A;  3KD5 E;  4F9O A;  3NFA A;  3VTI A;  4NB4 A;  1L5U A;  3HVR A;  3T19 A;  2UYT A;  1WSG A;  3QFU A;  3A5O C;  4DU4 A;  5J2Q A;  4Q5V A;  1EP4 A;  1YXQ A;  3VMF B;  4HTL A;  4BG9 A;  4I6M A;  4FLX A;  4E89 A;  4CBU A;  4FLZ A;  3HYF A;  4C23 A;  2W6L A;  3F5T A;  3LWL A;  2OTJ N;  1RT6 A;  4DR3 K;  2KFN A;  2QM1 A;  1UOC A;  4B9T A;  3EN9 A;  5D3G A;  1T8E A;  2HMP A;  3LL3 A;  4IG0 A;  4ZHR A;  2FSJ A;  4HVJ A;  1NOZ A;  4KAZ A;  4M45 A;  3K5N A;  4O4G A; 
#chains in the Genus database with same CATH homology
 2GTD A;  1ATS A;  5AQR A;  1NGG A;  3O9Q A;  3NVK A;  4ISG A;  4NLC A;  2GEM A;  1YIT N;  1KQS M;  5AQG A;  3H46 O;  3A5M C;  3DXM A;  4WQ4 A;  3C65 A;  3ATV A;  2AA4 A;  3SK3 A;  1M90 O;  4IFE A;  3UB5 A;  1WOQ A;  3O9S A;  4IDH A;  3HSC A;  4BC2 A;  3KWG A;  4WCE L;  2JWL A;  5GAD P;  3RVC A;  3CC4 N;  1YHQ N;  5TKY A;  3TTC A;  3WUH A;  3HM8 A;  3CXC M;  1V4T A;  2E2Q A;  4H5V A;  4BGA A;  3TU5 A;  4WF9 L;  4BRF A;  1NGH A;  3F2K A;  3FZH A;  4ILH A;  3VEX A;  2F7T A;  3AAR A;  3GOI A;  4RTF D;  3W0L A;  1K73 O;  4IO8 A;  3LDN A;  4QS8 A;  4PHT X;  2P9L A;  3QML A;  1BA1 A;  4DCH A;  4BR2 A;  3G6E N;  3CCJ N;  2RE2 A;  1J6Z A;  3CCR N;  3PIP L;  2A41 A;  4MO5 A;  3CHW A;  3LDO A;  2ZGY A;  1VQ4 N;  1GLC G;  5FPE A;  3LDL A;  3CCU N;  4B1Y B;  5EXW A;  1S22 A;  2FF6 A;  2YHX A;  3SMS A;  1Z6R A;  1MDU B;  4FWQ A;  1VQ8 N;  2YJE A;  2QTD A;  3VEZ A;  3PLA A;  3VGL A;  5FPM A;  3BF1 A;  3GG4 A;  3QDK A;  4H5T A;  4QS7 A;  3E9O A;  4PL7 A;  4Y0W A;  1S3X A;  5AQJ A;  5BN8 A;  4L3Q A;  3O08 A;  2WBN A;  5TKW A;  5BPM A;  5ADX A;  3ZX3 A;  5DM6 L;  1VQL N;  2IIR A;  3HTV A;  4IOC L;  1SZ2 A;  5HOO A;  4ISE A;  1BUP A;  2E2N A;  4XH1 A;  4BRA A;  4EAH D;  1ESV A;  5CE3 A;  2A40 A;  2D4W A;  3EKU A;  2NRT A;  3P31 A;  3KWI A;  1RDU A;  2JWK A;  1TYQ B;  3P4I A;  3H1Q A;  4FPB A;  1VQN N;  4KH4 A;  1QQO A;  2V7Z A;  5C2D A;  2QWM A;  1Q86 O;  1BU6 O;  3CC7 N;  1T6D A;  1NMD A;  4A2B A;  4FOE A;  4YOT A;  3DJC A;  1HX1 A;  4EHU A;  1QZ6 A;  2YJF A;  1QQN A;  1V4S A;  3KHY A;  3VGK A;  4YOX A;  4BRQ A;  3TSQ A;  3WXK A;  2QW9 A;  3CJB A;  2YI1 A;  4YDU C;  1RGI A;  2Q2R A;  2V7Y A;  1NGI A;  1SQK A;  2HBM A;  3P38 A;  3AAP A;  4BG8 A;  4B1X B;  3KZB A;  3O9R A;  5AQX A;  5AQN A;  3FE1 A;  4BGB A;  5MLC Q;  2YCH A;  2E2O A;  2WFB A;  4BC5 A;  4JAX A;  1O13 A;  5GAE P;  4JKG B;  2HF3 A;  3DXK A;  3E9P A;  4FSV A;  4BRH A;  1SS6 A;  5AQM A;  2QWO A;  3GE1 A;  3E9L A;  5JIC A;  4JKA A;  3CCQ N;  3VPZ A;  2WC9 A;  3L4Q A;  1XC3 A;  5E84 A;  2Q0R A;  3ENH A;  4PL8 A;  4BR4 A;  4GV3 A;  4CBW A;  5KQ8 A;  4BRM A;  1NJI O;  1X3N A;  3GDQ A;  4IOX A;  5ADX H;  1YI2 N;  3QBW A;  4PKI A;  3QIC A;  2A6A A;  3H1V X;  2CH5 A;  3C6H A;  4O5F A;  3MK6 A;  1NGB A;  3WXL A;  4BQL A;  2YHY A;  2NNW A;  4K43 A;  3I8B A;  4B1V A;  2V52 B;  5HL7 L;  2PAV A;  1GLJ O;  3A0I X;  2NRH A;  3IFR A;  3N4Q A;  3PIO L;  3VGM A;  5B8H A;  4JHD A;  4H0Y B;  1LCU A;  3WXM B;  3G4S N;  3MCA B;  5EX5 A;  1DGK N;  4A2A A;  3ULE B;  2VGN A;  4OPH A;  1E4G T;  3DXM B;  2W40 A;  3ZET B;  5BRE A;  1YIJ N;  2E20 A;  1GLA G;  1H1V A;  3QFP A;  2RHK A;  2AP1 A;  2D1K A;  3VES A;  1P8Z A;  1K8K B;  4OPA A;  1QZ5 A;  2HBJ A;  3LDQ A;  1X3M A;  3TSU A;  2BTF A;  4A5B A;  3D2E A;  4FWL A;  4IO9 L;  4MDA A;  3ZEU B;  1Q18 A;  3H3N O;  2OTL N;  1VQ5 N;  3VEN A;  3LDP A;  3H3O B;  1RDW X;  3SLC A;  3IDH A;  3R3L A;  2D0O A;  3QB0 A;  3DWL A;  1CZA N;  1GLE G;  2GWK A;  3GL1 A;  3NVM A;  5AQK A;  1QVF M;  3O6W A;  1SAZ A;  3UKU B;  3VF4 A;  5GAG P;  3MX5 A;  4J8F A;  1RFQ A;  4FO0 A;  3CMA N;  3HI0 A;  4BRL A;  3WQU A;  4CI6 A;  3TTF A;  2NRW A;  3U9D A;  3BF3 A;  2P9I B;  4BC4 A;  4KH5 A;  3WT0 A;  4IXC A;  2A42 A;  1KC8 O;  3ZYY X;  1M1K O;  1U2V A;  1EQY A;  4GNI A;  4AF1 A;  2QA4 N;  2OAN A;  2IVO A;  2P9U B;  2GUP A;  3WQT A;  1DEJ A;  5EVZ A;  3WXI A;  2E2P A;  4BY9 C;  2P9S A;  1Q7Y O;  4JKD A;  1NGA A;  4BRN A;  2ZWH A;  2QWR A;  4FL9 A;  4CD3 A;  1NM1 A;  5M1P A;  4FWO A;  1BO5 O;  4JNE A;  2WUS A;  3O8M A;  5ELZ A;  3Q7C A;  4H5N A;  5AQV A;  5AQY A;  2I7N A;  1YJW N;  2P9K A;  3SAH A;  1K8K A;  2QWL A;  5M1F A;  2A5X A;  2ASP A;  5CR4 A;  4H0P A;  2E1Z A;  3VEV A;  5I9E B;  2CGJ A;  2FLO A;  3OW2 M;  5C12 A;  1N8R O;  1JJ2 M;  3D2F A;  5BPN A;  4YOR A;  4EHT A;  3CJA A;  2BH1 A;  5BRF A;  1HKB A;  1X9J A;  1MA9 B;  3JS6 A;  3FZF A;  4B1U B;  3WXJ A;  4WFN L;  4CZE A;  2HST A;  4JKB A;  4YDU A;  4BQZ A;  1HPM A;  2Q31 A;  4ILG B;  2A3Z A;  3B8A X;  4XEI A;  4GV9 A;  2E8A A;  4FPA A;  1G99 A;  4FWP A;  4HWI A;  1BA0 A;  5GIO A;  4PKH A;  4BVP A;  1ZXO A;  3CJC A;  3ID6 A;  2HBK A;  2ZF5 O;  4CZI A;  3OHR A;  3L4I A;  4AM7 A;  3W3D A;  2J4R A;  3FZL A;  2ITM A;  1VQO N;  1ATR A;  3EL2 A;  3HRG A;  3ULE A;  2P9I A;  3O4W A;  3O1W A;  3R9P A;  1Q82 O;  2PBD A;  3IKM A;  1NGE A;  1JCE A;  4K25 A;  3CET A;  1KAX A;  3ZET A;  2QEX N;  2H3G X;  3VTH A;  1NGC A;  3DXK B;  5FPD A;  2GX9 A;  2P9S B;  3CQX A;  1DKG D;  4K41 A;  3R8E A;  5JLH A;  3SMP A;  3I55 N;  2IVN A;  3CJ1 A;  2Q36 A;  5GIP A;  3MWP A;  3J8A A;  4WYB A;  2VCP A;  4M63 C;  2NZT A;  5KPZ A;  3UE5 A;  2HOE A;  3MDQ A;  3P39 A;  4H0O A;  5AQS A;  3U8X A;  3R1X A;  5AQO A;  3EKS A;  4FWR A;  2BUP A;  2QWN A;  3EO3 A;  4IOA L;  4FWK A;  4JKC A;  4WQ4 C;  1ZBS A;  1P90 A;  4WQ5 C;  3CC2 N;  1OVY A;  1GLD G;  3M3Z A;  2P9N A;  1NBW A;  4JK7 A;  4BRO A;  4CZJ A;  4IWV A;  3FZK A;  3WEE A;  5JVH L;  5LJW A;  2EWS A;  3CIP A;  3KVG A;  1R59 O;  4CBX A;  2P9P B;  5AZI B;  3LM9 A;  5F2R A;  3FZM A;  4O8U A;  1S72 N;  3T7Z A;  5AR0 A;  4GY2 B;  4LC9 B;  1TYQ A;  2GWJ A;  3C7N B;  4H0T B;  4H0X B;  2ASM A;  3D2E B;  3LM2 A;  5AQF A;  4BRD A;  5F1X A;  5GIN A;  4YOW A;  4MDB A;  1YF5 L;  2NRX A;  2P9L B;  3CER A;  3O9T A;  3A5L C;  3VF2 A;  3CF5 L;  1NWK A;  3FFK B;  3VET A;  5JMV A;  3MX2 A;  1ATN A;  5AQH A;  1JCF A;  5M1Q A;  3UKR B;  3MMV A;  3TTD A;  2CGK A;  1VQP N;  2NRR A;  2QXL A;  1C0G A;  4H5R A;  1IJJ A;  3UKU A;  4AM6 A;  4JKE A;  3MN6 A;  4CZH A;  2ASO A;  3C0B A;  4FWN A;  3I56 N;  2HBL A;  4K42 A;  4NO7 A;  4JK8 A;  4B1Z A;  2YX6 A;  1VAZ A;  3FGU A;  1C0F A;  1W97 L;  4QS9 A;  4CJ7 A;  3MWT A;  3SJH A;  5AZJ B;  3SAG A;  3ZX2 A;  3M6G A;  2KKZ A;  1JCG A;  4UY8 O;  1VQ6 N;  3VER A;  3CCM N;  1KAY A;  4KBO A;  1YUW A;  2ZGZ A;  1VQK N;  3VF6 A;  3AY9 A;  4B1W B;  5LY3 A;  3U9Z A;  3WEE B;  3OA9 A;  4BR5 A;  3IMX A;  1K9M O;  3ENO A;  1XUP O;  3IUC A;  3K9J A;  1K8A O;  5M1K A;  1VQ7 N;  5FPN A;  1HLU A;  4MLE A;  2CH6 A;  4RCH A;  1T44 A;  1MWM A;  2P9P A;  4FOI A;  5AZI A;  1GLL O;  1MWK A;  3SBT A;  4C1N K;  4BR7 A;  4U67 L;  1YJN N;  3CJ9 A;  4FVU A;  2PFU A;  3HZ6 A;  4BRP A;  5KQD A;  3EE8 A;  3L0Q A;  1YJ9 N;  3ATU A;  3HOT A;  4EIA A;  2NRV A;  3GBT A;  3J7Z O;  3U4L A;  4JKF A;  2QWP A;  1Y64 A;  4CZK A;  4DHY A;  3TPQ A;  4GVE A;  4BC3 A;  3NMU A;  1KAZ A;  1ILY A;  4XH4 A;  3O5B A;  4JKG A;  4M7Y A;  5LJV A;  2FF3 B;  3ENB A;  3HBT A;  5AQI A;  4BR9 A;  4WQ5 A;  3QBX A;  3VEO A;  4B9Q A;  3BP8 A;  2ZJQ L;  2Q1N A;  1HKC A;  3TSP A;  1NGD A;  5C15 A;  3OBW A;  2NLX A;  4JD2 A;  4JEP A;  3CJ7 A;  5F0X A;  1XQS C;  2P9N B;  4FWS A;  3ZX0 A;  4U7B A;  5JVG L;  5AQZ A;  2E1Y A;  4IJN A;  4I6M B;  5KPR A;  2NRZ A;  1BWF O;  3JXU A;  4G9Z A;  3CCS N;  1KD1 O;  3O80 A;  5AQQ A;  3ZEU A;  3R6M A;  3C7N A;  3E66 A;  5M1O A;  5C0Y A;  4A62 A;  5AFU A;  1T3V A;  3H6E A;  3O9U A;  1YAG A;  2F9T A;  1LOT B;  4CZG A;  2W41 A;  4EFH A;  3D2F B;  1OKJ A;  4JD2 B;  1D4X A;  4BRE A;  1WUA A;  2VWB A;  1YVN A;  2DPN A;  1BDG A;  2Q0U A;  3FR0 A;  3MN7 A;  3CPW M;  1NGJ A;  5BR9 A;  4GV6 A;  5C10 A;  2IVP A;  4FWM A;  3DAW A;  1DT9 A;  5BRH A;  4WFA L;  4C1N I;  3D6R A;  5AQW A;  3CPE A;  4PKG A;  3T69 A;  2ZJP L;  4IZ9 A;  3DLL L;  5M1N A;  3HOS A;  1TUY A;  5JLF A;  1KXP A;  1NLV A;  1Z05 A;  2FXU A;  4O8K A;  3MN9 A;  5E26 A;  3C6A A;  1NGF A;  5AQL A;  3CCV N;  3G71 N;  3A5N C;  3E1Y A;  4IEI A;  5AZJ A;  5BRD A;  3MCP A;  5H1S Q;  3F9M A;  2F9W A;  3A8Y A;  3SBG A;  5EY4 A;  2KHO A;  2ZJR L;  1T6C A;  3AGR A;  1BOT O;  2VGM A;  5AQU A;  4BRI A;  4A59 A;  2VYP A;  3EZW A;  1VQ9 N;  5C2F A;  1BG3 A;  1EO1 A;  2YHW A;  4OO1 J;  3K9K A;  3OBY A;  3O1B A;  5AQT A;  1Q81 O;  3M5R A;  4A61 A;  4CZF A;  4IJA A;  3CCE N;  5BN9 A;  4ILJ A;  2D0P A;  4MO4 A;  4YOV A;  1HJO A;  3CQY A;  3VOV A;  3AGK A;  4CZL A;  1HKG A;  2P9U A;  3CME N;  4WFB L;  4BRC A;  4A57 A;  3Q7B A;  3VEW A;  3SAF A;  4H03 B;  5AQP A;  3EE9 A;  3BEX A;  4BRK A;  4DQ8 A;  3I33 A;  4CD1 A;  4JK9 A;  1IG8 A;  4IEE A;  1GLB G;  3RSE A;  3G25 A;  5EOY A;  4DKW A;  4YOY A;  3D7E O;  4MLH A;  1ZC6 A;  2V51 B;  4A5A A;  4F9O A;  1W2B M;  1TUU A;  2FSK A;  3BUZ B;  5GAH P;  3CCL N;  4YOU A;  3MN5 A;  4E1J A;  3VTI A;  4NB4 A;  1VQM N;  4JHD B;  4JKH A;  2KLA A;  2HF4 A;  2UYT A;  1HUX A;  4JN4 A;  3QFU A;  3CD6 N;  1QHA A;  3A5O C;  2CGL A;  4DB3 A;  4BR0 A;  4Z94 A;  4XH5 A;  4ISF A;  2GEL A;  1YXQ A;  4M7X A;  3RSE B;  3VMF B;  4HTL A;  4BG9 A;  3CI5 A;  4I6M A;  4BRG A;  1GLF O;  1U6Z A;  4H5W A;  2FSN A;  2Q97 A;  3M1F A;  1QQM A;  4CBU A;  2QWQ A;  5BPL A;  4CZM A;  4C23 A;  5DM7 L;  3F5T A;  2E88 A;  2OTJ N;  1U2V B;  2I7P A;  5AFU H;  3H45 C;  3AAQ A;  2P9K B;  1QVG M;  3FLC O;  3L6Q A;  2QI2 A;  2QM1 A;  5CHI A;  3VEY A;  3EN9 A;  3N4P A;  5KPT A;  4NLB A;  2HMP A;  3ID8 A;  3LL3 A;  4H0V B;  2FSJ A;  3KK7 A;  3S41 A;  4KH6 A;  1E4F T;  4RWT A;  4R79 A;  4BVO A;  3UKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...