2CH5A

Crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
347
structure length
344
Chain Sequence
PQFMAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGRAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NAGK PROTEIN
publication title Structures of Human N-Acetylglucosamine Kinase in Two Complexes with N-Acetylglucosamine and with Adp/Glucose: Insights Into Substrate Specificity and Regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 344
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.59: N-acetylglucosamine kinase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch5A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch5A02
4FWMA 3H1VX 1BG3A 4FWPA 1Y64A 3CJ9A 4ISGA 3LDQA 3H3OB 1ZC6A 3CJCA 3DXKA 3J8AA 3VENA 3S41A 5BN8A 3ENOA 4BR7A 4FWQA 5AFUA 1NGGA 3FZKA 4FWLA 4CZEA 3EL2A 4FSVA 4NB4A 4BGBA 4MLHA 3VEYA 3LDOA 5FPMA 3VGMA 4K42A 5KQDA 4BRIA 3IFRA 3RSEA 4A2BA 1KXPA 2ZGZA 3BF3A 1U6ZA 3QFPA 2P9UB 2P9NA 4Y0WA 1BU6O 1NM1A 3UB5A 3FZFA 4WQ5A 4Z94A 5BRFA 2CGKA 4ISEA 2A41A 2HF4A 3L4IA 2DPNA 4IZ9A 5AQVA 5AFUH 1GLEG 3WXJA 4BRCA 4FPBA 1NGEA 3W3DA 1HJOA 3D2EA 5AQRA 4DCHA 4A2AA 3CJ7A 1DEJA 1NGDA 2P9SA 3I33A 1D4XA 2HOEA 3MN9A 3UKUA 3GL1A 1J6ZA 4B1YB 4ISFA 2QWNA 4FOIA 3A5LC 4CD3A 1HUXA 4LC9B 2FF6A 1E4GT 2GTDA 4H0VB 4BRAA 5LJVA 4AM6A 1GLLO 3O80A 3SK3A 1NGBA 4HWIA 3DXMA 3A5NC 5AQHA 3UKRB 1NWKA 2E8AA 3WXKA 3QICA 2QW9A 3O08A 3QB0A 3HBTA 4BRHA 1HX1A 3DWLA 4FOEA 2CGJA 1YAGA 3M1FA 3R9PA 4YDUA 3H6EA 3BP8A 4QS9A 4QS7A 2P9IB 2D1KA 2E88A 5JLFA 2A5XA 4FPAA 3GG4A 4IWVA 4BR4A 3ZX2A 1GLJO 2FSNA 3CETA 4NO7A 5AQQA 2E1YA 4RTFD 3JXUA 3GBTA 2HF3A 2E1ZA 3WXIA 4BG9A 3AY9A 3O1BA 2WUSA 3VEWA 4CJ7A 1C0FA 3VF4A 4PL8A 1HKGA 3QFUA 5BPLA 2A42A 2V52B 3DXKB 3O1WA 2E20A 5AQYA 4BGAA 3CERA 4CZIA 2Q31A 4CI6A 3MK6A 5KPRA 4K25A 5BN9A 3SMSA 2BTFA 1NGCA 1BA0A 2Q1NA 3FE1A 4MO5A 4O5FA 2F9TA 3KVGA 1V4SA 2ASOA 5F0XA 3O6WA 2P9NB 1X9JA 5AQIA 3VF6A 4DB3A 2P9IA 2V51B 3LM9A 1MWMA 3FGUA 3WQUA 3A0IX 3CIPA 3O8MA 3WXLA 1HPMA 3VOVA 3D2EB 1BUPA 2YHWA 2A3ZA 4QS8A 3ATUA 3HSCA 5AZJA 2P9SB 4MLEA 1HKCA 3UKUB 3ULEA 2YJFA 4MO4A 4JD2A 1BA1A 5AQOA 5I9EB 2Q0UA 3LL3A 2VYPA 3BF1A 4JNEA 2ZWHA 1BOTO 2QWPA 2GUPA 1NMDA 4F9OA 1GLFO 3DXMB 3VEOA 3HZ6A 5F1XA 4BROA 3BUZB 1K8KA 1QZ6A 2D4WA 4HTLA 4FO0A 5EVZA 3CI5A 2NLXA 4CZJA 1KAYA 2GELA 4BRQA 2GWKA 4B1VA 1YXQA 2AP1A 3GE1A 4C23A 2P9LA 3A5MC 4M7XA 3U4LA 3SLCA 5ADXA 4M63C 5JLHA 5EY4A 3LDLA 5KPTA 4H0OA 1YUWA 2FXUA 3W0LA 1LCUA 1QHAA 4B1UB 2P9KA 1IJJA 2I7NA 1TYQA 1NBWA 3I8BA 2Q36A 5EOYA 4WQ4C 4H5TA 2ASMA 3KHYA 3OHRA 2YHYA 3AAPA 2YCHA 5AQTA 3CQYA 3QMLA 5ADXH 3TPQA 4CD1A 5AQSA 4FL9A 3FLCO 3FZLA 3A5OC 2GWJA 3C0BA 1E4FT 3HI0A 1ESVA 1H1VA 4BRNA 1NGHA 5E26A 1ZBSA 2QWMA 3CJ1A 4BR0A 4O8KA 5JMVA 2VCPA 4H5RA 4BVOA 3VEZA 2QWOA 5FPDA 4M7YA 3IDHA 4H0PA 4BC4A 2YI1A 2IVPA 2FLOA 2QWQA 3ZEUB 3VERA 1U2VA 4IJAA 5TKYA 3MN6A 1V4TA 2YJEA 3VGKA 4B9QA 1TUUA 2FSKA 2W41A 2EWSA 3WEEA 4WQ5C 4BRMA 3UE5A 2Q0RA 3H45C 1DGKN 5AZIA 4BQLA 5AZJB 1NGJA 1XQSC 1GLAG 3WQTA 4XH5A 3VETA 4BRDA 1C0GA 2E2QA 3ULEB 5AQLA 4BQZA 4IO8A 4JD2B 5AQKA 1T44A 4RCHA 4K41A 4BRPA 3MN7A 4BREA 1ATRA 4JN4A 3TU5A 3WUHA 4BRFA 1WOQA 4BR2A 5EXWA 3IMXA 1K8KB 5AQUA 1SAZA 3ENHA 4CBXA 3QBXA 4EFHA 4EHTA 2E2PA 1EQYA 1SZ2A 3FFKB 3VPZA 4B1XB 1YVNA 2ZF5O 1GLDG 2V7YA 5AQMA 3ZEUA 5BPMA 3SMPA 4PL7A 2P9LB 4IJNA 3DJCA 2OANA 1QQMA 5AQNA 2PAVA 1BO5O 3EO3A 4YDUC 1BDGA 4CBUA 1KAXA 2CH6A 1TUYA 4H5NA 3CJBA 1LOTB 4B1WB 3HM8A 2P9KB 3ID8A 4H03B 1TYQB 5BR9A 3EKSA 2E2OA 3LM2A 5AQJA 3CJAA 3R8EA 4FWOA 3A8YA 4BC3A 4PKHA 3ZX3A 3MN5A 3ATVA 4I6MA 3EZWA 2BUPA 5AQZA 4GY2B 3KZBA 5JICA 3VF2A 3D2FA 1MDUB 3VEVA 4GNIA 4BVPA 5LJWA 5KPZA 5BPNA 3LDPA 4BRGA 4A62A 4FWSA 5CE3A 1QQNA 3B8AX 3L0QA 1WUAA 3D7EO 3AAQA 4H0XB 4JHDB 3FZHA 2QWRA 2F9WA 4CBWA 2FSJA 3AARA 1JCFA 1U2VB 2H3GX 4EHUA 5AQPA 4CZKA 1G99A 4PKIA 4E1JA 4L3QA 4BR5A 1NGAA 2ZGYA 3WEEB 3ZX0A 1NGFA 5AQGA 4XEIA 3EN9A 3FR0A 3DAWA 4PKGA 1HKBA 5AZIB 5BRHA 4RWTA 1DKGD 3L6QA 3C7NA 3MMVA 4FWKA 2Q2RA 4BG8A 3M6GA 3LDNA 3O4WA 1JCGA 4IXCA 1XC3A 5AQFA 4H0YB 4CZFA 2ITMA 1Z05A 1XUPO 1IG8A 1NLVA 2YHXA 3CQXA 4H5WA 3U9ZA 2D0OA 3H46O 4CZGA 1KAZA 4J8FA 1S3XA 3EKUA 5EX5A 1RFQA 2HMPA 3G25A 5AQWA 2CH5A 3H3NO 2VWBA 3MCPA 2QM1A 4JHDA 5FPNA 3JS6A 3U9DA 3R6MA 4CZLA 5AR0A 2CGLA 2IVNA 1HLUA 1ATNA 3GDQA 5BRDA 1QZ5A 3P4IA 4BRKA 4DHYA 5B8HA 2P9UA 4BC2A 2P9PB 3M3ZA 2E2NA 5F2RA 2A6AA 2D0PA 3MDQA 4A61A 2KHOA 4K43A 4CZHA 4EAHD 5LY3A 2A40A 4XH4A 1Q18A 4XH1A 1QQOA 2QWLA 2NRHA 2Q97A 2I7PA 3F9MA 3CHWA 3O5BA 2UYTA 1R59O 2ASPA 3WT0A 4BRLA 1X3NA 2J4RA 1MWKA 1GLBG 2NZTA 4I6MB 3VGLA 4B1ZA 1GLCG 2QXLA 3ZETB 3D2FB 1RGIA 4AM7A 1JCEA 2IVOA 1S22A 4FWNA 3IUCA 3QDKA 3HTVA 3QBWA 4H5VA 3UKRA 4CZMA 3SJHA 4EIAA 4DQ8A 1X3MA 4BC5A 4KBOA 2IIRA 1MA9B 1ZXOA 2P9PA 4WYBA 1P8ZA 5AQXA 1CZAN 1ATSA 1Z6RA 2GEMA 1BWFO 3H1QA 5KQ8A 4H0TB 3RSEB 5E84A 1T6DA 5BREA 2AA4A 3U8XA 4BR9A 3VEXA 3FZMA 3VESA 1T6CA 3C7NB 1RDWX 4WQ4A 2W40A 1OKJA 3GOIA 1SQKA 5ELZA 3ZETA 3BEXA 5FPEA 2V7ZA 2PBDA 1NGIA 4FWRA 2FF3B 4JAXA
chains in the Genus database with same CATH superfamily
4OGCA 4FJMA 1T8EA 3QETA 3RTVA 4BR7A 3I0SA 4AHCA 4FSVA 4Z4FA 3VEYA 3AVBA 5M1QA 1KXPA 4PUOA 3BF3A 1U6ZA 4Z4CA 4CJWA 4WQ5A 1K73O 2A41A 4OX9K 1ZBIA 4KH4A 3BZCA 4E7IA 1IKYA 3AV9A 1VQKN 1GLEG 2RKIA 3WXJA 4FPBA 2VG6A 4FJJA 4DCHA 4A2AA 3CJ7A 3VQPA 1CXQA 1SL2A 3T1HK 1EX4A 4OGEA 3LWMA 3BY5A 1J6ZA 2QWNA 4LC9B 2FF6A 2GTDA 4I9QA 4BRAA 4CF9A 4AM6A 4M3XA 3DOKA 4HWIA 3DXMA 1WAFA 2DFFA 3OBYA 3U3YA 2XY5A 2E8AA 3WNHA 5GADP 5GIPA 2O8FA 2NNWA 4DTXA 3TI0A 1VAZA 4N76A 2JLEA 5HRSA 1YAGA 3C6HA 3KLEA 5CYMA 2OPRA 4QS7A 4YHHK 2P9IB 3ZSQA 3K57A 5JLFA 2A5XA 2OYQA 1HQUA 4KKOA 4NO7A 3C95A 2VWKA 4RG8A 4RTFD 1N33K 4FYDA 4YOUA 2WC9A 4O5BA 2WUSA 5C24A 5FLXO 2RF2A 4DFPA 4PL8A 4DV4K 1R0AA 4DF4A 3QFUA 1VQPN 5BPLA 3CFRA 2IS3A 3O1WA 3O3GA 4KTZA 2HBJA 1ZBFA 4CI6A 4DLGA 4IKFA 1S1WA 3SMSA 2DY4A 5JVGL 1NGCA 1W0HA 2P51A 2ASOA 3T69A 3LP2A 3L2WA 1YHQN 4DB3A 4LSLA 1RDUA 3LM9A 4FJXA 3HOSA 3F73A 3TAPA 1LAWA 4BWMA 3CIPA 2F7TA 3C65A 2YHBA 3O8MA 3NGZA 3D2EB 4FM0A 1DTTA 1VSEA 2A3ZA 3KWIA 1DTQA 3SAFA 1HKCA 3UKUB 3ULEA 4MO4A 4CCHA 2OPQA 2RE2A 3I0RA 5I9EB 4KHYA 3RMBA 2Q0UA 2VYPA 3EE9A 4FJGA 1VSJA 4JNEA 2ZWHA 1RT7A 2O8BB 2QWPA 1NMDA 1GOAA 4F9OA 1GLFO 4JKCA 1FKOA 1K8KA 3ENBA 3R3LA 3CI5A 4BRQA 2GWKA 4B08A 4JKFA 1YXQA 4CGGA 3GE1A 2YNGA 4I2PA 4FLZA 1JLBA 1Q8IA 4AHRA 5ADXA 3CCEN 5JLHA 4CJSA 3PSIA 4ILJA 1VK0A 4IG0A 3ZSZA 1JLEA 1YUWA 2FXUA 1LWEA 3W0LA 4M3TA 1LCUA 1QHAA 3NF9A 4CJFA 4FK2A 3F2KA 5GAGP 1JLCA 4Z4EA 1NBWA 3OYNA 3DLLL 2G8FA 4CJKA 4IDKA 3M8QA 3N4QA 2YHYA 3AA4A 4DFJA 3CQYA 3V6DA 2HHHK 1TKTA 1C0UA 5ADXH 3RMAA 2HW3A 3G71N 4MQ3A 4FL9A 3FLCO 5HRPA 4YY3K 1K8AO 3J7AP 3DM2A 2YKMA 5D3GA 4JYAK 1ESVA 3DLGA 1N5YA 4BRNA 5J2PA 3EZ5A 4NYFA 4O8KA 2VCPA 2HVHA 4OKEA 3VEZA 4PA1A 3PLAA 1QS4A 4FM1A 4KTQA 1NG9A 3VQAA 2F8SA 4H0PA 2YI1A 2IVPA 1SUQA 1JLAA 3KK1A 1O13A 1U2VA 1BCMA 1V4TA 3R1XA 1RTHA 2OA8A 2HHXA 1EWQA 3F9KA 3UE5A 2Q0RA 4FJ5A 3MCAB 5AZIA 1NGJA 3PX0A 4XH5A 2HBMA 1C0GA 5AQLA 4BQZA 4JD2B 1T44A 3V81A 3OJUA 4K41A 4NCAA 4KAZA 1ATRA 4I9LA 3HRGA 2HNZA 3L3UA 1IH7A 2D5RA 3E66A 3K58A 3QBXA 3FFKB 4B1XB 1GLDG 4AQYK 4DSIA 4PL7A 3OYDA 4YFUA 1QVFM 1LW0A 2KFNA 2OANA 4CGDA 3HYFA 4YDUC 1C6VA 3UIQA 3QINA 4TSXA 1J5EK 3F5TA 3HM8A 4X62K 4QAGA 1S5JA 4BE2A 3K2PA 5AQJA 3NGIA 1YT3A 2JWKA 4FWOA 3L2QA 2KLAA 3KJVA 1ZYQA 1IV0A 3ATVA 4CGIA 5AQZA 2D0AA 4GY2B 4CEDA 4OPAA 3EEQA 4ICLA 2D0CA 3VF2A 1FW6A 5LJWA 1WSIA 2AJQA 2O8EA 2IDOA 3AAQA 2Z1GA 4E7KA 1JLGA 2P5OA 5C2FA 3V4IA 4HUEA 3O4NA 1HPZA 4OKKA 4H8KA 5AQPA 4CZKA 4PKIA 4Z0UA 4FLXA 4BR5A 1NGAA 1NGFA 4DUZK 4LY7A 4IOAL 3V9SA 2O8CA 4BACA 4QOZB 5BRHA 3L6QA 3MMVA 5CYQA 4CJLA 4FWKA 3HPHA 4BG8A 4DKWA 4DV6K 3M6GA 2PY5A 1JL2A 4IXCA 3AVFA 4FW2A 4M3WA 1UAXA 2HNYA 1L5UA 3DI6A 5KGWA 3CM5A 4H5WA 4X64K 4BDYA 1CLQA 1VSDA 4YORA 4HHTA 1KAZA 3TAGA 5IT9O 3EKUA 1RFQA 2CH5A 3V9ZA 3H3NO 4JHDA 1IKWA 4JI8K 1B92A 3JS6A 1KCFA 3VMFB 3OYLA 1A5VA 2CGLA 3GDQA 5BRDA 1N8RO 4BRKA 2P9UA 4BC2A 2P9PB 1VQON 5HBMA 4DTNA 3JSMA 1REVA 5C10A 4IEEA 2A40A 4JKHA 4JKEA 1U04A 4KH5A 3QEIA 4JI0K 2QWLA 2NRHA 4LF8K 2WONA 3ZT3A 2I7PA 4DR4K 3PIOL 2B4JA 3O5BA 4M3UA 3RMDA 4EP4A 4BRLA 1C0TA 3TANA 1X3NA 2J4RA 1U45A 2ZJRL 1O1WA 1Q86O 2QXLA 4E1NA 5DMRA 2E6LA 1HNWK 1JCEA 2IVOA 2YNHA 1NK8A 3ULDA 1XNRK 4HUGA 3KLIA 3HTVA 4H5VA 3L3VA 3UKRA 3AVJA 1J5OA 1FKPA 1WSHA 4GMJB 3AO4A 3SJHA 3OS0A 4EIAA 4ELTA 4W5RA 4DS4A 3KLGA 5CHIA 1MA9B 3E9PA 3DLBA 4B3TK 1P8ZA 3ZT0A 3MEGA 3H1QA 1NOYA 3TAFA 4JV5K 1U49A 3SBTA 3U8XA 4CGHA 3FZMA 3VESA 5KTQA 4FK0A 4EP5A 4FJLA 4WQ4A 3MXIA 1HNIA 3O3HA 4JRPA 4YOWA 4LFCK 3ZETA 5FPEA 2V7ZA 3LPUA 4M42A 2PBDA 1NK9A 3NFAA 1C1AA 1WBDA 2OTLN 4LFAK 2JGUA 4DLEA 4ISGA 3RMCA 4JK9A 4CJ4A 2BE2A 3CJCA 3L8BA 3S41A 4IFEA 4FWLA 4DU4A 4NB4A 4BGBA 1SS6A 5FPMA 3VGMA 1JJ2M 1L3SA 5KQDA 3CMAN 1HYSA 3RSEA 1VQ4N 4YOTA 4DSFA 1NM1A 4DF8A 3Q7CA 5BRFA 2CGKA 2G8WA 5AQVA 3W3DA 1IKVA 1HJOA 3SZ2A 1KSPA 1DEJA 4DV1K 4E89A 1X1PA 1D4XA 4Y1CA 3GL1A 1RNHA 4CD3A 1VQ6N 1E4GT 1RT1A 3LP1A 5SZTA 2OCEA 4DR2K 1GLLO 2GV9A 4A59A 1NGBA 3CFPA 4JKGB 3V9XA 4WFBL 3WXKA 4CHQA 1JKHA 4LF5K 3MXMA 1YJNN 3HBTA 1TVRA 4BRHA 4FJ7A 4PQUA 3DWLA 2GBZA 3MWPA 3RRGA 4E1MA 1WSFA 1WLJA 3BP8A 4QS9A 1DT9A 2D1KA 2E88A 5LMNK 2O8DA 1GLJO 3SPZA 2XO7A 4LF7K 2E1YA 4YOYA 3JXUA 2HF3A 4BG9A 3O1BA 4AH9A 1VQNN 5FRNA 4DUYK 3VF4A 4WF9L 1HKGA 3QO9A 1TKXA 2A42A 4HCCA 1J53A 3DXKB 2RPIA 4BGAA 2Q31A 3C6AA 5KPRA 4KHWA 4KHUA 3CD6N 4O44A 3N4PA 1FJGK 2BTFA 4YOXA 4DQSA 3MEEA 1NJWA 3KWGA 3P83D 2Q1NA 4ZTFA 4MO5A 3LZIA 2BGGA 1V4SA 5F0XA 2G8VA 5GINA 2P9NB 3L2VA 2O4GA 1MWMA 1ILYA 1NJYA 3FGUA 2KQ2A 3THYA 1TK0A 5HRNA 2PYJA 5K14A 3WQUA 3SUQA 1S72N 3WXLA 2YHWA 4W5NA 3ZT2A 4QS8A 1VQLN 3HSCA 4JI2K 1JLFA 2P9SB 1VSLA 4CESA 3ZT4A 4W5QA 2VWJA 3THVA 3U3GA 3BF1A 1A5WA 4YNQA 2NRWA 1NNEA 2DTUA 4DV5K 3VEOA 1QSYA 3FFIA 3CCQN 1K9MO 4KHNA 2YKNA 4BROA 2UXBK 4M3RA 1SV5A 3T7ZA 4FO0A 1BL3A 4N56A 2FC0A 3KKSA 1U48A 2AP1A 4OPJA 4RW4A 3ZSVA 1J54A 3A5MC 3B6OA 4IBNA 1N32K 4Z4IA 4C8NA 5C25A 1LV5A 3LDLA 3EYZA 5JVHL 2ETJA 2Q3SA 2IOCA 2P9KA 3QEXA 5M1OA 1TYQA 3HPOA 3TTDA 3I8BA 1KFDA 3EY1A 3KHYA 3TAEA 3KKRA 3T3FA 4CD1A 5AQSA 2VG7A 3OYMA 1YTUA 3LWLA 3KIOA 4BVOA 4YOVA 3IDHA 4BC4A 1EXQA 4CJRA 2F4VK 1RDBA 3OYCA 3VERA 4DQIA 1N36K 4CW7B 1F21A 4BWJA 3NF7A 2W41A 1D9DA 3OYKA 5FROA 3H45C 4IEIA 4DFMA 1DGKN 4BQLA 5AZJB 3D45A 3DYAA 3ZSOA 2DFEA 4AHUA 4BRDA 4FJKA 5GAEP 2E2QA 3LAKA 5T7BA 4ID1A 1ZBHA 1RT3A 3D0PA 1XNQK 5HP1A 4RCHA 4BRPA 3O3FA 3ISNC 3CCSN 3OA9A 1ZBUA 4C1NI 4WFAL 4CK3A 5EXWA 3IMXA 3ENHA 3J7ZO 3KK3A 4EFHA 1SZ2A 3VPZA 2KFZA 3HL8A 5A2QO 1RTIA 5AQMA 3ZEUA 1Z25A 3PUFA 3CCLN 3SV3A 2P9LB 2PFUA 1Y97A 4XIUA 1QQMA 1VSIA 2O4IA 5AQNA 2PAVA 4DSEA 3EO3A 3NHGA 3HT3A 1LWCA 4AHVA 4CBUA 1QSSA 4B1WB 1UA0A 1S6PA 1NK6A 4CJUA 4GVEA 2YV0X 4PKHA 4G9ZA 5J2MA 4I6MA 1M1KO 5C2DA 3WXMB 4B3OA 3KZBA 2RN2A 4NYNA 3SAGA 4DV0K 4JI7K 3HJFA 4BVPA 5KPZA 5LMUK 1T05A 4KFBA 1QQNA 3VQ8A 1WUAA 1T03A 3PIPL 1W7AA 2ZE2A 4JHDB 2QWRA 2NRTA 2OZSA 2F9WA 4LH4A 3THXA 4CBWA 2FSJA 4CF8A 4B9LA 5AJ3K 5FRMA 1U47A 3IG1A 1JCFA 3VQ9A 4FJ8A 4RW6A 4DV7K 1XC9A 2ZGYA 4RW8A 3WEEB 3ZX0A 2FBTA 4OPKA 3EN9A 3NVKA 3TTCA 2KW4A 5C12A 1MU2A 4PKGA 3SPYA 1C1CA 4RWTA 1DKGD 3OVNA 3C7NA 2VG5A 1QQCA 3O4WA 3HP6A 4LF9K 5AQFA 4H0YB 2ITMA 1VSKA 1VRTA 1IG8A 3PX6A 3CQXA 3OYAA 3U9ZA 3H46O 3SCXA 4J8FA 4CIFA 3ZSXA 1ZBLA 1T7PA 5AQWA 4F2SA 4KV8A 1VQMN 4DU1A 3U9DA 5AR0A 4CHZA 3S3OA 4NXNK 4CFBA 1HLUA 2HHQA 1TL1A 3LPTA 1VQ9N 3RR8A 4DHYA 2ZD1A 3OYJA 2ITGA 5SWMA 1JL1A 2KHOA 4K43A 4CZHA 4EAHD 4B9VA 5LY3A 3WNGA 5JS1A 1W97L 4XH1A 2UUBK 4OLAA 2Q97A 2A1SA 1NJZA 2UYTA 2X6SA 3WT0A 4OLBA 2UUAK 4MDAA 4C8KA 2NZTA 1RCHA 2HSTA 3VGLA 1GLCG 3ZETB 2VQFK 3SUPA 3D2FB 4X65K 1RGIA 4C8OA 4CFDA 2XY6A 4FW1A 4FWNA 3C6TA 4JLHA 4CHYA 1SL1A 2B5JA 1SKWA 5CZ2A 2YNFA 2IIRA 5J2QA 4UY8O 4WYBA 4CJQA 5AQXA 3HXMA 2GEMA 3TSPA 4DG1A 4MDBA 1RBVA 3RSEB 1VRUA 1T6DA 4O55A 4JI4K 3VQ5A 1KQSM 4U7BA 4IOCL 3VEXA 5HL7L 1RDCA 4I2QA 4ZTJA 3CXCM 1B9FA 4A5BA 3DOLA 4IOXA 2W40A 4CJ3A 3GOIA 1SQKA 1RTJA 5MLCQ 5ELZA 3ZYYX 4A5AA 2G8HA 3MX5A 4FWRA 4FLYA 4JKBA 4JAXA 1RILA 2E6MA 4NCGA 3SQ4A 4FWMA 3H1VX 1BG3A 4FWPA 1JXBA 4WCEL 2VQEK 3H3OB 1ZC6A 4CEZA 3J8AA 4ZHRA 1LAVA 5AFUA 3KTQA 3FZKA 5CZ1A 2BANA 3EL2A 3J80O 3CCJN 4MLHA 3LDOA 4K42A 3WNFA 3HP9A 3OS1A 4KB0A 1BISA 1NU0A 3K9JA 3E9LA 4A2BA 4K0KK 1IG9A 3TAQA 4KTWA 3UB5A 4Z94A 2B6AA 2XY8A 4ISEA 3P39A 3CPWM 2HF4A 4BDZA 2BDPA 2DPNA 4OPHA 5AFUH 4B8AB 3CCUN 4KI6A 4BRCA 2QK9A 1WSGA 3D2EA 5AQRA 3SBGA 4E7HA 3P1GA 1VHXA 3P38A 4KO0A 3IRXA 3V9WA 3UKUA 3L2UA 4ISFA 3ZCMA 4FOIA 3A5LC 3OYHA 1HUXA 2QI2A 2XRIA 2QEXN 4H0VB 2O8BA 3O80A 4U67L 3SNNA 2WBNA 3A5NC 5HOOA 3AO1A 3QICA 1EKEA 1HJRA 3A2FA 3S3MA 3VN5A 3O4QA 4FOEA 3M1FA 3KLFA 4YDUA 3H6EA 3O9SA 4CEQA 4Z4HA 1TKDA 4GKJK 4FZYA 4Q0BA 1HNXK 4F2RA 1EWRA 3VQEA 4B3SK 5HRRA 4GKKK 4FPAA 3THYB 4GVMA 2QKKA 1S1XA 2FSNA 3CETA 5AQQA 3M8PA 3AO2A 3AY9A 3VEWA 3EE8A 4OKJA 4DSKA 1C0FA 4ID5A 4OO1J 4NLBA 1KVBA 2E20A 4B3MK 3MK6A 5BN9A 3K5OA 1NK5A 1BA0A 1KTQA 1SKRA 1KLMA 4DTSA 3NCIA 3FE1A 4Q5VA 1Q82O 2F9TA 3RRHA 3AO5A 4FXDA 3VQ4A 3O6WA 4KH6A 1X9JA 3VF6A 2YHAA 3TABA 4NCBA 3OYEA 4CERA 4DR6K 4DR5K 3OS2A 3ASMA 1HPMA 3LDSA 4DS5A 3KLHA 1BUPA 3SI6A 4N41A 3P5JA 3SQ1A 4JS5A 3ATUA 1BHLA 4GW6A 4MLEA 4CHNA 3AVIA 3I55N 2ZQBA 3AO3A 2HMIA 4JD2A 1RDAA 3NMUA 4AHSA 1CZBA 4K8ZA 3LL3A 3SAHA 1N6QA 5DM6L 2QXFA 1BOTO 2GUPA 1KRPA 5KGXA 4Z4GA 3DXMB 3HZ6A 5F1XA 4BDPA 4I7FA 1QZ6A 5M1NA 1NKBA 1TAUA 5EVZA 4CZJA 2NLXA 2HHTA 4IG3A 4ILGB 1KAYA 2GELA 3VQDA 2O8FB 1CXUA 4B1VA 3OYIA 3NH1A 3THWA 1S1TA 4IFYA 3TTFA 2EHGA 3J7YP 4M7XA 3U4LA 2F8TA 2NRRA 1S9GA 5KPTA 2EX3A 3AVKA 3NGYA 4O0IA 2HB5A 2YNIA 3TSQA 1IJJA 2BH1A 4CIGA 1WBBA 1QE1A 4DSLA 4H5TA 2ASMA 3AA3A 4W5OA 2G8UA 4R5PA 1GOBA 3QMLA 2NRZA 2OTJN 1TL3A 3SV4A 4K8XA 4DTPA 1KFSA 2GUIA 1NK7A 1E4FT 3HI0A 5E26A 1ZBSA 4BR0A 4H5RA 5J1EA 4JS4A 4M7YA 4ILHA 3K5MA 4DTJA 4AILC 2FLOA 2QWQA 3CC7N 3ZEUB 5GAHP 1NJXA 4IJAA 3RR7A 3MN6A 2YJEA 2F96A 2W42A 1JLQA 2FSKA 2EWSA 4WQ5C 4BE0A 1BI4A 3NF8A 3DRPA 3ID6A 4IFVA 3QIOA 5EU7A 3HK2A 1XQSC 1GLAG 3C6UA 4M41A 3WQTA 4DTMA 3VETA 1X9WA 3ULEB 4IO8A 5AQKA 1JXEA 3RVCA 4DV3K 3PSFA 3MN7A 4CJVA 3TU5A 4GV9A 3WUHA 4HUFA 1WOQA 4BR2A 3HO1A 5I3UA 3DLHA 4CEEA 4J2EA 2Z1IA 1K8KB 1X9SA 5KI6A 4CBXA 1OH5A 3L2RA 2E2PA 4WE1A 2R7YA 2ZF5O 2HBLA 5BPMA 4DQQA 3AVHA 4Y1DA 3SMPA 1YTAA 3IS9A 2IAJA 4DQPA 3AVAA 1BO5O 2W6KA 3THXB 4HTUA 2ATQA 3PY8A 1VQ8N 1TUYA 1RT6A 4B9UA 3ID8A 4H03B 2G8IA 1HMVA 1BQNA 1LWFA 3EKSA 2E2OA 3LM2A 3MEDA 1HRHA 4O0JA 3R8EA 3AVLA 3A8YA 3VQ6A 1NKEA 4BC3A 4ELVA 1X9MA 3MN5A 3CG7A 2HVIA 2BUPA 2QTDA 4DR1K 4M3YA 4C8LA 1KLNA 1MDUB 3O9RA 4GNIA 1D5AA 3AVMA 3QIPA 3LDPA 4BRGA 4FWSA 1IO2A 4F8RA 3B8AX 1YIJN 3D7EO 4H0XB 4RW9A 4KPYA 3FZHA 1Q81O 2KTQA 1HYVA 1W2BM 3KK2A 1KD1O 1I39A 1U2VB 2H3GX 4PY5A 1G99A 4L3QA 4CEBA 2UUCK 4XEIA 3VTHA 3FR0A 1M90O 1HKBA 5AZIB 5H1SQ 3OTOK 3K5LA 2HHWA 3RWUA 3CCMN 1JCGA 1XC3A 1L3UA 4CZFA 4DTOA 1Z05A 1K6YA 4QCLA 1NLVA 4W5TA 1YI2N 2D0OA 4CZGA 4FJ9A 2QA4N 5EX5A 4CEAA 3ZSYA 3G0ZA 3MCPA 2QM1A 1E3MA 1CZ9A 4WFNL 3LAMA 4E7JA 3NF6A 3R6MA 3T1YK 4LF6K 2FBXA 2A1RA 2UXDK 4FK4A 3NBPA 1VSMA 4JI6K 3OJSA 3P4IA 5F2RA 2E2NA 2D0PA 4A61A 3MAQA 4X66K 4KREA 4CVNE 4LSNA 4XH4A 1RDDA 2FBVA 5KRTA 1UOCA 3LZJA 3CHWA 4CFCA 1VSHA 3OYGA 3SQ2A 1MWKA 1B9DA 3BGRA 1GLBG 1TKZA 4B1ZA 2NUBA 1KC8O 3PX4A 4FLWA 1NJIO 3AGRA 3HOTA 3G6EN 1S6QA 2W6LA 3V9UA 2O8EB 3VQ7A 1QSLA 5DK5A 2D0BA 4JK8A 3QBWA 3CC2N 4JKGA 3M8RA 4DQ8A 1X3MA 4BC5A 3I8DA 2P5GA 4G1QA 3M8SA 3MWTA 4GV3A 1XMOK 1ATSA 3SQ0A 1BWFO 4H0TB 4B8CA 4HCBA 5E84A 1L3VA 5BREA 2AA4A 2UU9K 3DRRA 2O8CB 4C8MA 4JI5K 3U6FA 1T6CA 1RDWX 5C42A 4DFKA 3SUOA 1UWBA 3DMJA 5CR4A 1OKJA 3K5NA 1XMQK 3BEXA 1I94K 3V1RA 3K0SA 1NGIA 3CCRN 2FF3B 3VA3A 1Y64A 3CJ9A 3LDQA 3DXKA 3VENA 3SJJA 5BN8A 3ENOA 2X74A 4FWQA 1D9FA 1NGGA 4CGFA 4CJ5A 4CZEA 1ASWA 1IBKK 4CJPA 3HM9A 3O9UA 2IGIA 4LF4K 2Z1HA 4LFBK 2HHSA 4BRIA 1A5XA 3IFRA 2HBKA 3ITHA 4CF1A 3WNEA 1T3VA 1RT4A 2ZGZA 4FZZA 3QFPA 2P9UB 2P9NA 3ZT1A 4E3SA 4Y0WA 1BU6O 1OH6A 1SKSA 1YF5L 3FZFA 3JAMO 1EO1A 3CC4N 3CYMA 4FLTA 3L4IA 4IZ9A 4E19A 4NLCA 1P90A 3HVTA 3PV8A 4CJEA 1NGEA 4B9MA 3QLHA 5CY4A 1Q7YO 4FJIA 1NGDA 2P9SA 3I33A 3TWHA 1SL0A 2HOEA 4AF1A 3MN9A 2PZSA 4FJHA 4PHTX 4JRQA 4B1YB 4FCYA 1Q9XA 3T19A 4ELUA 1RBTA 5LJVA 3DLEA 1TK8A 2PYLA 4DTRA 4JI1K 3SK3A 1IKXA 2XY7A 4F3TA 2WOMA 4O8UA 5AQHA 3UKRB 1FK9A 5BR8K 5DM7L 1NWKA 4UQGA 3AGKA 1WSEA 3MX2A 1ASUA 2QW9A 3O08A 3QB0A 3VQQA 3KD5E 3AVCA 1HX1A 1G15A 2CGJA 3TSUA 2HNDA 3R9PA 1WB9A 3OY9A 3LP0A 1RBRA 3AA2A 2X6NA 3GG4A 4IWVA 4BR4A 3ZX2A 1Z26A 3IKMA 3J81O 4CF2A 5FDLA 3DLRA 3DLKA 3GBTA 3IAYA 2E1ZA 2VGMA 3WXIA 4B9TA 4CJ7A 1WSJA 4LD0A 4B9SA 2V52B 2OPSA 3QEVA 5AQYA 4J2BA 5C15A 3CERA 4CZIA 3NH2A 3QEWA 1NK4A 4K25A 3SYZA 3CFOA 3E01A 1N34K 3S9HA 3PO4A 4O5FA 2QKBA 3KVGA 1FXXA 5AQIA 2P9IA 4B3RK 5HROA 4CHOA 2V51B 2VGNA 1I3AA 4KRFA 3THWB 5M1KA 3A0IX 1VSFA 3QERA 2YX6A 3HSTB 3NAEA 3VOVA 3QNNA 1EETA 1Q9YA 4E0DA 5AZJA 4HVJA 4DU3A 3S3NA 2X78A 2YJFA 2G8KA 1XI1A 3DRSA 1C1BA 1BA1A 1LW2A 3G10A 1S9EA 5AQOA 4BE1A 4DSJA 4O4GA 4KHPK 2I5JA 2Z1JA 1QVGM 3TAMA 3T1AA 1L3TA 3V1QA 3BUZB 1IBMK 4NXMK 4CK2A 2D4WA 4HTLA 3D6RA 4OJRA 1W9HA 1DLOA 1XHZA 1HR0K 1BIUA 4C23A 2ZJPL 1D8YA 1NKCA 2P9LA 4GV6A 3G4SN 5C0YA 4CE9A 3SLCA 1TAQA 2P1JA 4M63C 2RHKA 4RW7A 5EY4A 2O8DB 4H0OA 4JK7A 5J2NA 2Y1IA 2KZZA 3O9QA 4B1UB 4CFAA 1VQ7N 2I7NA 1BI4B 2Q36A 5EOYA 4WQ4C 4JI3K 4J2DA 3ALYA 3OHRA 3AAPA 2YCHA 2NRXA 5AQTA 4CGJA 3TPQA 4FZXC 3OYBA 1QTMA 3FZLA 3O9TA 1VQ5N 3A5OC 2GWJA 4N5SA 3C0BA 3PO5A 4AHTA 5TKWA 1RTDA 4KI4A 1H1VA 3NH0A 1BCOA 1NGHA 2QWMA 3NVMA 3OW2M 3CJ1A 2WTUA 1WAJA 5JMVA 1BGXT 1RT2A 1WNSA 2QWOA 5FPDA 4DWIA 4CECA 2HHUA 1OVQA 4FJNA 2WFBA 1OVYA 1RBUA 3TARA 3MECA 3OYFA 4CK1A 1RT5A 5TKYA 4B9QA 3VQBA 3VGKA 1TUUA 3AVNA 3TR8A 5HLFA 4DTUA 3WEEA 2UXCK 4BRMA 1OH8A 3ZLJA 3M5RA 3K59A 3P31A 4R79A 1J9AA 4FM2A 4CF0A 1S1UA 3CQ8A 4KHQA 3C94A 4CEOA 4DR3K 2ZM6K 4BREA 4JN4A 4BRFA 3BZKA 5AQUA 1SAZA 2ZJQL 2KKZA 1XWLA 4EHTA 1EQYA 1OH7A 1YVNA 2V7YA 3QEPA 2JWLA 3SUNA 1HNVA 2KZMA 4IJNA 3DJCA 3ZSWA 3L4QA 3H08A 1BDGA 1S1VA 1KAXA 2CH6A 4H5NA 4J2AA 2GX9A 3CJBA 4KHSA 4M3ZA 4JKAA 1LOTB 3NE6A 4FLVA 2P9KB 4LH5A 1TYQB 2DFHA 5BR9A 5GIOA 2E4LA 1BQMA 4IO9L 2NRVA 3CJAA 1WN7A 4OVLA 3ZX3A 2FBYA 4FLUA 4JEPA 3EZWA 1ASVA 1YJ9N 5JICA 4DQRA 3D2FA 4C1NK 3QESA 1XHXA 3VEVA 1BIZA 5KRSA 3HVRA 5BPNA 2XHBA 1HYZA 3KK7A 4A62A 4KB1A 5CE3A 4L8RB 4F3OA 3L0QA 3LALA 4CJTA 3NDKA 1U4BA 1EP4A 3E9OA 3LP3A 3AARA 4EHUA 1NMNA 1RBSA 1IBLK 4CEFA 4F4KA 3B6PA 4E1JA 4N47A 4H4MA 5AQGA 1TK5A 1HNZK 3DAWA 2HHVA 2Q2RA 3AA5X 3LDNA 4FVUA 1NOZA 3OBWA 4IDHA 5JS2A 3LANA 3I56N 5M1FA 2Y1JA 1UA1A 1XUPO 1ITGA 2YHXA 1YJWN 2IC3A 1S3XA 4PWDA 2HMPA 3G25A 1YITN 4DR7K 2VWBA 1QHTA 5FPNA 3CMEN 2LSNA 3ZSRA 4CZLA 5E41A 3AVGA 5LL6Z 2IVNA 4FVMA 2OZMA 4V19S 1ATNA 3HPGA 3QNOA 1QZ5A 5B8HA 3M3ZA 3CM6A 1C0MA 2A6AA 3MDQA 1GOCA 3JYTA 3MXJA 4H4OA 3V1OA 3VTIA 1HQEA 4DV2K 4JKDA 1Q18A 3Q7BA 1QQOA 3VQCA 1NK0A 3F9MA 2OPPA 1R59O 2ASPA 4I6MB 5IWAK 4E7LA 4AM7A 1S22A 3IUCA 3QDKA 4CZMA 4M45A 3E1YA 5M1PA 4BY9C 4KBOA 1KVCA 4A57A 4MFBA 1ZXOA 2P9PA 1CZAN 1TV6A 5I42A 3BDPA 1Z6RA 4CHPA 5KQ8A 1YVUA 3KD1E 4EZ9A 1TGOA 4CIEA 3CPEA 4BR9A 4DMNA 3C7NB 3CCVN 3CF5L 4EZ6A 2E5LK 3K9KA 1KVAA 4B9NA 3VA0A
chains in the Genus database with same CATH topology
4FWMA 3H1VX 1BG3A 4FWPA 1Y64A 3CJ9A 4ISGA 3LDQA 4WCEL 4JK9A 3H3OB 1ZC6A 3CJCA 3DXKA 3J8AA 3VENA 3S41A 5BN8A 3ENOA 4IFEA 4BR7A 4FWQA 5AFUA 1NGGA 3FZKA 4FWLA 4CZEA 3EL2A 3O9UA 4FSVA 4NB4A 4BGBA 4MLHA 3CCJN 3VEYA 1SS6A 3LDOA 5FPMA 4K42A 3VGMA 1JJ2M 5KQDA 3CMAN 4BRIA 5M1QA 3IFRA 2HBKA 1T3VA 3K9JA 3E9LA 1KXPA 3RSEA 4A2BA 2ZGZA 3BF3A 1VQ4N 1U6ZA 4JKBA 3QFPA 2P9UB 2P9NA 4YOTA 4Y0WA 1BU6O 1NM1A 3UB5A 3Q7CA 1YF5L 3FZFA 4WQ5A 4Z94A 2CGKA 3P39A 2A41A 2HF4A 3L4IA 4ISEA 4KH4A 5BRFA 2DPNA 4IZ9A 3CC4N 4OPHA 4NLCA 1P90A 5AQVA 1GLEG 5AFUH 1VQKN 3CCUN 3WXJA 4BRCA 4FPBA 1NGEA 3W3DA 1HJOA 3D2EA 5AQRA 3SBGA 4A2AA 4DCHA 3CJ7A 1Q7YO 1DEJA 1NGDA 2P9SA 3I33A 3P38A 1D4XA 2HOEA 4AF1A 3MN9A 3UKUA 3GL1A 4PHTX 1J6ZA 4B1YB 4ISFA 2QWNA 4FOIA 3A5LC 4CD3A 1HUXA 2QI2A 4LC9B 2FF6A 2QEXN 1VQ6N 1E4GT 2GTDA 4H0VB 4BRAA 5LJVA 4AM6A 1GLLO 3O80A 4A59A 4U67L 3SK3A 1NGBA 4HWIA 3DXMA 2WBNA 3A5NC 5HOOA 4O8UA 5AQHA 3OBYA 4JKGB 3UKRB 5DM7L 1NWKA 3AGKA 2E8AA 4WFBL 3WXKA 3MX2A 3QICA 5GADP 2QW9A 5GIPA 3O08A 3QB0A 2NNWA 1YJNN 1VAZA 3HBTA 4BRHA 1HX1A 3DWLA 4FOEA 2CGJA 1YAGA 3M1FA 3MWPA 3R9PA 3TSUA 3C6HA 4YDUA 3H6EA 3BP8A 3O9SA 4QS9A 4QS7A 1DT9A 2P9IB 2D1KA 2E88A 5JLFA 2A5XA 4FPAA 3GG4A 4IWVA 4BR4A 3ZX2A 1GLJO 2FSNA 3CETA 3IKMA 4NO7A 5AQQA 2E1YA 4RTFD 4YOYA 3JXUA 3GBTA 2HF3A 2E1ZA 2VGMA 4YOUA 3WXIA 3AY9A 2WC9A 3O1BA 4BG9A 2WUSA 3VEWA 3EE8A 1VQNN 4CJ7A 1C0FA 3VF4A 4WF9L 4PL8A 1HKGA 3QFUA 1VQPN 5BPLA 4OO1J 2A42A 2V52B 4NLBA 3DXKB 3O1WA 2E20A 5AQYA 5C15A 4BGAA 2HBJA 3CERA 4CZIA 2Q31A 4CI6A 3MK6A 3C6AA 5KPRA 4K25A 3CD6N 3N4PA 5BN9A 3SMSA 2BTFA 4YOXA 5JVGL 1NGCA 3KWGA 1BA0A 2Q1NA 3FE1A 4MO5A 4O5FA 2F9TA 1Q82O 3KVGA 1V4SA 2ASOA 3T69A 5F0XA 5GINA 3O6WA 2P9NB 1X9JA 4KH6A 5AQIA 3VF6A 2P9IA 4DB3A 1YHQN 1RDUA 2V51B 3LM9A 2VGNA 1MWMA 3HOSA 1ILYA 3FGUA 3WQUA 3A0IX 5M1KA 3CIPA 2F7TA 3C65A 3O8MA 1S72N 2YX6A 3WXLA 1HPMA 3VOVA 3D2EB 1BUPA 2YHWA 2A3ZA 4QS8A 3KWIA 1VQLN 3ATUA 3HSCA 5AZJA 2P9SB 3SAFA 4MLEA 3I55N 1HKCA 3UKUB 3ULEA 2YJFA 4MO4A 4JD2A 1BA1A 2RE2A 5AQOA 5I9EB 3NMUA 2Q0UA 3LL3A 2VYPA 3SAHA 5DM6L 1QVGM 3BF1A 3EE9A 4JNEA 2ZWHA 1BOTO 2NRWA 2GUPA 1NMDA 2QWPA 4F9OA 1GLFO 3DXMB 3VEOA 3CCQN 1K9MO 3HZ6A 4JKCA 5F1XA 4BROA 3BUZB 1K8KA 1QZ6A 2D4WA 4HTLA 3ENBA 3R3LA 3D6RA 4FO0A 5EVZA 3CI5A 2NLXA 3T7ZA 4CZJA 4ILGB 1KAYA 2GELA 4BRQA 2GWKA 4JKFA 4B1VA 1YXQA 2AP1A 3GE1A 4C23A 2ZJPL 2P9LA 4GV6A 3CPWM 3G4SN 5C0YA 3TTFA 3A5MC 4M7XA 3U4LA 3SLCA 5ADXA 2NRRA 3CCEN 4M63C 2RHKA 5JLHA 5EY4A 3LDLA 5KPTA 4ILJA 4H0OA 5JVHL 1YUWA 4JK7A 2FXUA 3O9QA 3W0LA 3TSQA 1LCUA 1QHAA 4B1UB 3F2KA 2P9KA 1VQ7N 1IJJA 2I7NA 5M1OA 1TYQA 2BH1A 5GAGP 3TTDA 1NBWA 3I8BA 2Q36A 5EOYA 3DLLL 4WQ4C 4H5TA 2ASMA 3KHYA 3OHRA 3N4QA 2YHYA 3AAPA 2YCHA 2NRXA 5AQTA 3CQYA 3QMLA 2NRZA 3TPQA 5ADXH 4CD1A 2OTJN 5AQSA 3G71N 4FL9A 3FLCO 3FZLA 1K8AO 3O9TA 1VQ5N 3A5OC 2GWJA 3C0BA 1E4FT 5TKWA 3HI0A 1ESVA 1H1VA 4BRNA 1NGHA 5E26A 1ZBSA 2QWMA 3NVMA 3OW2M 3CJ1A 4BR0A 4O8KA 5JMVA 2VCPA 4H5RA 4BVOA 3VEZA 2QWOA 3PLAA 5FPDA 4YOVA 4M7YA 3IDHA 4H0PA 4ILHA 4BC4A 2WFBA 1OVYA 2YI1A 2IVPA 2FLOA 2QWQA 3CC7N 3ZEUB 5GAHP 3VERA 1O13A 1U2VA 4IJAA 5TKYA 3MN6A 1V4TA 2YJEA 3VGKA 4B9QA 3R1XA 1TUUA 2FSKA 2W41A 2EWSA 3WEEA 4WQ5C 4BRMA 3UE5A 2Q0RA 3H45C 4IEIA 3ID6A 3MCAB 1DGKN 5AZIA 4BQLA 5AZJB 1NGJA 1XQSC 1GLAG 3M5RA 3WQTA 3P31A 4XH5A 3VETA 2HBMA 4BRDA 5GAEP 4R79A 1C0GA 2E2QA 3ULEB 5AQLA 4BQZA 4IO8A 4JD2B 5AQKA 1T44A 3RVCA 4RCHA 4K41A 4BRPA 3MN7A 4BREA 3CCSN 3OA9A 4C1NI 1ATRA 4JN4A 3TU5A 4WFAL 3HRGA 4GV9A 3WUHA 4BRFA 1WOQA 4BR2A 5EXWA 3IMXA 1K8KB 5AQUA 1SAZA 3E66A 3ENHA 4CBXA 2ZJQL 3J7ZO 2KKZA 3QBXA 4EFHA 4EHTA 2E2PA 1EQYA 1SZ2A 3FFKB 3VPZA 4B1XB 1YVNA 2ZF5O 1GLDG 2V7YA 5AQMA 3ZEUA 2HBLA 5BPMA 3CCLN 2JWLA 3SMPA 4PL7A 1QVFM 2P9LB 2PFUA 4IJNA 3DJCA 2OANA 1QQMA 3L4QA 5AQNA 2PAVA 1BO5O 3EO3A 4YDUC 1BDGA 1VQ8N 4CBUA 1KAXA 2CH6A 1TUYA 4H5NA 2GX9A 5M1NA 3CJBA 4JKAA 1LOTB 3F5TA 3HM8A 4B1WB 2P9KB 3ID8A 4H03B 1TYQB 5BR9A 5GIOA 3EKSA 2E2OA 3LM2A 5AQJA 2JWKA 4IO9L 2NRVA 3CJAA 4FWOA 4GVEA 3A8YA 3R8EA 4BC3A 2KLAA 4PKHA 3ZX3A 3MN5A 4G9ZA 3ATVA 4JEPA 4I6MA 3EZWA 2BUPA 5AQZA 2QTDA 4GY2B 5C2DA 1M1KO 3WXMB 4OPAA 1YJ9N 3KZBA 5JICA 3VF2A 3SAGA 3D2FA 1MDUB 3O9RA 3VEVA 4GNIA 4C1NK 4BVPA 5LJWA 5KPZA 5BPNA 3LDPA 4BRGA 3KK7A 4A62A 4FWSA 5CE3A 1QQNA 3B8AX 1YIJN 3L0QA 1WUAA 3D7EO 3PIPL 1K73O 3AAQA 4H0XB 4JHDB 3FZHA 2QWRA 2NRTA 1Q81O 2F9WA 1W2BM 3E9OA 5C2FA 4CBWA 2FSJA 1KD1O 3AARA 1JCFA 1U2VB 2H3GX 4EHUA 5AQPA 4CZKA 1G99A 4PKIA 4E1JA 4L3QA 4BR5A 1NGAA 2ZGYA 3WEEB 3ZX0A 1NGFA 5AQGA 4XEIA 3VTHA 3EN9A 3FR0A 3TTCA 3NVKA 4IOAL 5C12A 3DAWA 4PKGA 1HKBA 1M90O 5AZIB 5BRHA 4RWTA 5H1SQ 1DKGD 3L6QA 3C7NA 3MMVA 4FWKA 2Q2RA 4BG8A 4DKWA 3M6GA 3LDNA 3O4WA 3CCMN 1JCGA 4FVUA 3OBWA 4IDHA 4IXCA 1XC3A 5AQFA 4H0YB 4CZFA 2ITMA 1Z05A 3I56N 5M1FA 1XUPO 1IG8A 1NLVA 2YHXA 3CQXA 4H5WA 3U9ZA 1YI2N 2D0OA 3H46O 4YORA 4CZGA 1KAZA 4J8FA 1YJWN 1S3XA 3EKUA 5EX5A 2QA4N 1RFQA 2HMPA 3G25A 5AQWA 2CH5A 1YITN 3H3NO 2VWBA 3MCPA 2QM1A 4JHDA 1VQMN 4WFNL 5FPNA 3JS6A 3CMEN 3VMFB 3U9DA 3R6MA 4CZLA 5AR0A 2CGLA 2IVNA 1HLUA 1ATNA 3GDQA 5BRDA 1QZ5A 1N8RO 1VQ9N 3P4IA 4BRKA 4DHYA 5B8HA 2P9UA 4BC2A 2P9PB 3M3ZA 2E2NA 5F2RA 2A6AA 2D0PA 3MDQA 1VQON 4A61A 2KHOA 4K43A 4CZHA 4EAHD 5C10A 4IEEA 3VTIA 5LY3A 2A40A 4JKHA 4JKEA 4JKDA 4XH4A 1Q18A 4KH5A 1W97L 4XH1A 3Q7BA 1QQOA 2QWLA 2NRHA 2Q97A 2I7PA 3F9MA 3CHWA 3PIOL 3O5BA 2UYTA 1R59O 2ASPA 3WT0A 4BRLA 1X3NA 2J4RA 1MWKA 4MDAA 2ZJRL 1GLBG 2NZTA 1Q86O 4I6MB 2HSTA 3VGLA 4B1ZA 1GLCG 2QXLA 3ZETB 1KC8O 1NJIO 3D2FB 1RGIA 3AGRA 4AM7A 1JCEA 2IVOA 3HOTA 3G6EN 1S22A 4FWNA 3IUCA 3QDKA 3HTVA 3QBWA 4H5VA 4JK8A 3UKRA 4JKGA 4CZMA 3CC2N 3E1YA 3SJHA 5M1PA 1EO1A 4EIAA 4DQ8A 1X3MA 4BC5A 4BY9C 4KBOA 2IIRA 4A57A 5CHIA 4UY8O 1MA9B 1ZXOA 3E9PA 2P9PA 4WYBA 1P8ZA 3MWTA 4GV3A 5AQXA 1CZAN 1ATSA 1Z6RA 2GEMA 1BWFO 3TSPA 3H1QA 5KQ8A 4MDBA 4H0TB 3RSEB 5E84A 1T6DA 5BREA 2AA4A 3SBTA 3CPEA 1KQSM 3U8XA 4U7BA 4BR9A 4IOCL 3VEXA 5HL7L 3FZMA 3CXCM 3VESA 1T6CA 3C7NB 1RDWX 4A5BA 4WQ4A 3CCVN 4IOXA 4YOWA 3CF5L 2W40A 5CR4A 1OKJA 3GOIA 1SQKA 5MLCQ 5ELZA 3ZETA 3ZYYX 3K9KA 4A5AA 3MX5A 3BEXA 5FPEA 2V7ZA 2PBDA 1NGIA 3CCRN 4FWRA 2FF3B 4JAXA 2OTLN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWM A;  3H1V X;  1BG3 A;  4FWP A;  1Y64 A;  3CJ9 A;  4ISG A;  3LDQ A;  3H3O B;  1ZC6 A;  3CJC A;  3DXK A;  3J8A A;  3VEN A;  3S41 A;  5BN8 A;  3ENO A;  4BR7 A;  4FWQ A;  5AFU A;  1NGG A;  3FZK A;  4FWL A;  4CZE A;  3EL2 A;  4FSV A;  4NB4 A;  4BGB A;  4MLH A;  3VEY A;  3LDO A;  5FPM A;  3VGM A;  4K42 A;  5KQD A;  4BRI A;  3IFR A;  3RSE A;  4A2B A;  1KXP A;  2ZGZ A;  3BF3 A;  1U6Z A;  3QFP A;  2P9U B;  2P9N A;  4Y0W A;  1BU6 O;  1NM1 A;  3UB5 A;  3FZF A;  4WQ5 A;  4Z94 A;  5BRF A;  2CGK A;  4ISE A;  2A41 A;  2HF4 A;  3L4I A;  2DPN A;  4IZ9 A;  5AQV A;  5AFU H;  1GLE G;  3WXJ A;  4BRC A;  4FPB A;  1NGE A;  3W3D A;  1HJO A;  3D2E A;  5AQR A;  4DCH A;  4A2A A;  3CJ7 A;  1DEJ A;  1NGD A;  2P9S A;  3I33 A;  1D4X A;  2HOE A;  3MN9 A;  3UKU A;  3GL1 A;  1J6Z A;  4B1Y B;  4ISF A;  2QWN A;  4FOI A;  3A5L C;  4CD3 A;  1HUX A;  4LC9 B;  2FF6 A;  1E4G T;  2GTD A;  4H0V B;  4BRA A;  5LJV A;  4AM6 A;  1GLL O;  3O80 A;  3SK3 A;  1NGB A;  4HWI A;  3DXM A;  3A5N C;  5AQH A;  3UKR B;  1NWK A;  2E8A A;  3WXK A;  3QIC A;  2QW9 A;  3O08 A;  3QB0 A;  3HBT A;  4BRH A;  1HX1 A;  3DWL A;  4FOE A;  2CGJ A;  1YAG A;  3M1F A;  3R9P A;  4YDU A;  3H6E A;  3BP8 A;  4QS9 A;  4QS7 A;  2P9I B;  2D1K A;  2E88 A;  5JLF A;  2A5X A;  4FPA A;  3GG4 A;  4IWV A;  4BR4 A;  3ZX2 A;  1GLJ O;  2FSN A;  3CET A;  4NO7 A;  5AQQ A;  2E1Y A;  4RTF D;  3JXU A;  3GBT A;  2HF3 A;  2E1Z A;  3WXI A;  4BG9 A;  3AY9 A;  3O1B A;  2WUS A;  3VEW A;  4CJ7 A;  1C0F A;  3VF4 A;  4PL8 A;  1HKG A;  3QFU A;  5BPL A;  2A42 A;  2V52 B;  3DXK B;  3O1W A;  2E20 A;  5AQY A;  4BGA A;  3CER A;  4CZI A;  2Q31 A;  4CI6 A;  3MK6 A;  5KPR A;  4K25 A;  5BN9 A;  3SMS A;  2BTF A;  1NGC A;  1BA0 A;  2Q1N A;  3FE1 A;  4MO5 A;  4O5F A;  2F9T A;  3KVG A;  1V4S A;  2ASO A;  5F0X A;  3O6W A;  2P9N B;  1X9J A;  5AQI A;  3VF6 A;  4DB3 A;  2P9I A;  2V51 B;  3LM9 A;  1MWM A;  3FGU A;  3WQU A;  3A0I X;  3CIP A;  3O8M A;  3WXL A;  1HPM A;  3VOV A;  3D2E B;  1BUP A;  2YHW A;  2A3Z A;  4QS8 A;  3ATU A;  3HSC A;  5AZJ A;  2P9S B;  4MLE A;  1HKC A;  3UKU B;  3ULE A;  2YJF A;  4MO4 A;  4JD2 A;  1BA1 A;  5AQO A;  5I9E B;  2Q0U A;  3LL3 A;  2VYP A;  3BF1 A;  4JNE A;  2ZWH A;  1BOT O;  2QWP A;  2GUP A;  1NMD A;  4F9O A;  1GLF O;  3DXM B;  3VEO A;  3HZ6 A;  5F1X A;  4BRO A;  3BUZ B;  1K8K A;  1QZ6 A;  2D4W A;  4HTL A;  4FO0 A;  5EVZ A;  3CI5 A;  2NLX A;  4CZJ A;  1KAY A;  2GEL A;  4BRQ A;  2GWK A;  4B1V A;  1YXQ A;  2AP1 A;  3GE1 A;  4C23 A;  2P9L A;  3A5M C;  4M7X A;  3U4L A;  3SLC A;  5ADX A;  4M63 C;  5JLH A;  5EY4 A;  3LDL A;  5KPT A;  4H0O A;  1YUW A;  2FXU A;  3W0L A;  1LCU A;  1QHA A;  4B1U B;  2P9K A;  1IJJ A;  2I7N A;  1TYQ A;  1NBW A;  3I8B A;  2Q36 A;  5EOY A;  4WQ4 C;  4H5T A;  2ASM A;  3KHY A;  3OHR A;  2YHY A;  3AAP A;  2YCH A;  5AQT A;  3CQY A;  3QML A;  5ADX H;  3TPQ A;  4CD1 A;  5AQS A;  4FL9 A;  3FLC O;  3FZL A;  3A5O C;  2GWJ A;  3C0B A;  1E4F T;  3HI0 A;  1ESV A;  1H1V A;  4BRN A;  1NGH A;  5E26 A;  1ZBS A;  2QWM A;  3CJ1 A;  4BR0 A;  4O8K A;  5JMV A;  2VCP A;  4H5R A;  4BVO A;  3VEZ A;  2QWO A;  5FPD A;  4M7Y A;  3IDH A;  4H0P A;  4BC4 A;  2YI1 A;  2IVP A;  2FLO A;  2QWQ A;  3ZEU B;  3VER A;  1U2V A;  4IJA A;  5TKY A;  3MN6 A;  1V4T A;  2YJE A;  3VGK A;  4B9Q A;  1TUU A;  2FSK A;  2W41 A;  2EWS A;  3WEE A;  4WQ5 C;  4BRM A;  3UE5 A;  2Q0R A;  3H45 C;  1DGK N;  5AZI A;  4BQL A;  5AZJ B;  1NGJ A;  1XQS C;  1GLA G;  3WQT A;  4XH5 A;  3VET A;  4BRD A;  1C0G A;  2E2Q A;  3ULE B;  5AQL A;  4BQZ A;  4IO8 A;  4JD2 B;  5AQK A;  1T44 A;  4RCH A;  4K41 A;  4BRP A;  3MN7 A;  4BRE A;  1ATR A;  4JN4 A;  3TU5 A;  3WUH A;  4BRF A;  1WOQ A;  4BR2 A;  5EXW A;  3IMX A;  1K8K B;  5AQU A;  1SAZ A;  3ENH A;  4CBX A;  3QBX A;  4EFH A;  4EHT A;  2E2P A;  1EQY A;  1SZ2 A;  3FFK B;  3VPZ A;  4B1X B;  1YVN A;  2ZF5 O;  1GLD G;  2V7Y A;  5AQM A;  3ZEU A;  5BPM A;  3SMP A;  4PL7 A;  2P9L B;  4IJN A;  3DJC A;  2OAN A;  1QQM A;  5AQN A;  2PAV A;  1BO5 O;  3EO3 A;  4YDU C;  1BDG A;  4CBU A;  1KAX A;  2CH6 A;  1TUY A;  4H5N A;  3CJB A;  1LOT B;  4B1W B;  3HM8 A;  2P9K B;  3ID8 A;  4H03 B;  1TYQ B;  5BR9 A;  3EKS A;  2E2O A;  3LM2 A;  5AQJ A;  3CJA A;  3R8E A;  4FWO A;  3A8Y A;  4BC3 A;  4PKH A;  3ZX3 A;  3MN5 A;  3ATV A;  4I6M A;  3EZW A;  2BUP A;  5AQZ A;  4GY2 B;  3KZB A;  5JIC A;  3VF2 A;  3D2F A;  1MDU B;  3VEV A;  4GNI A;  4BVP A;  5LJW A;  5KPZ A;  5BPN A;  3LDP A;  4BRG A;  4A62 A;  4FWS A;  5CE3 A;  1QQN A;  3B8A X;  3L0Q A;  1WUA A;  3D7E O;  3AAQ A;  4H0X B;  4JHD B;  3FZH A;  2QWR A;  2F9W A;  4CBW A;  2FSJ A;  3AAR A;  1JCF A;  1U2V B;  2H3G X;  4EHU A;  5AQP A;  4CZK A;  1G99 A;  4PKI A;  4E1J A;  4L3Q A;  4BR5 A;  1NGA A;  2ZGY A;  3WEE B;  3ZX0 A;  1NGF A;  5AQG A;  4XEI A;  3EN9 A;  3FR0 A;  3DAW A;  4PKG A;  1HKB A;  5AZI B;  5BRH A;  4RWT A;  1DKG D;  3L6Q A;  3C7N A;  3MMV A;  4FWK A;  2Q2R A;  4BG8 A;  3M6G A;  3LDN A;  3O4W A;  1JCG A;  4IXC A;  1XC3 A;  5AQF A;  4H0Y B;  4CZF A;  2ITM A;  1Z05 A;  1XUP O;  1IG8 A;  1NLV A;  2YHX A;  3CQX A;  4H5W A;  3U9Z A;  2D0O A;  3H46 O;  4CZG A;  1KAZ A;  4J8F A;  1S3X A;  3EKU A;  5EX5 A;  1RFQ A;  2HMP A;  3G25 A;  5AQW A;  2CH5 A;  3H3N O;  2VWB A;  3MCP A;  2QM1 A;  4JHD A;  5FPN A;  3JS6 A;  3U9D A;  3R6M A;  4CZL A;  5AR0 A;  2CGL A;  2IVN A;  1HLU A;  1ATN A;  3GDQ A;  5BRD A;  1QZ5 A;  3P4I A;  4BRK A;  4DHY A;  5B8H A;  2P9U A;  4BC2 A;  2P9P B;  3M3Z A;  2E2N A;  5F2R A;  2A6A A;  2D0P A;  3MDQ A;  4A61 A;  2KHO A;  4K43 A;  4CZH A;  4EAH D;  5LY3 A;  2A40 A;  4XH4 A;  1Q18 A;  4XH1 A;  1QQO A;  2QWL A;  2NRH A;  2Q97 A;  2I7P A;  3F9M A;  3CHW A;  3O5B A;  2UYT A;  1R59 O;  2ASP A;  3WT0 A;  4BRL A;  1X3N A;  2J4R A;  1MWK A;  1GLB G;  2NZT A;  4I6M B;  3VGL A;  4B1Z A;  1GLC G;  2QXL A;  3ZET B;  3D2F B;  1RGI A;  4AM7 A;  1JCE A;  2IVO A;  1S22 A;  4FWN A;  3IUC A;  3QDK A;  3HTV A;  3QBW A;  4H5V A;  3UKR A;  4CZM A;  3SJH A;  4EIA A;  4DQ8 A;  1X3M A;  4BC5 A;  4KBO A;  2IIR A;  1MA9 B;  1ZXO A;  2P9P A;  4WYB A;  1P8Z A;  5AQX A;  1CZA N;  1ATS A;  1Z6R A;  2GEM A;  1BWF O;  3H1Q A;  5KQ8 A;  4H0T B;  3RSE B;  5E84 A;  1T6D A;  5BRE A;  2AA4 A;  3U8X A;  4BR9 A;  3VEX A;  3FZM A;  3VES A;  1T6C A;  3C7N B;  1RDW X;  4WQ4 A;  2W40 A;  1OKJ A;  3GOI A;  1SQK A;  5ELZ A;  3ZET A;  3BEX A;  5FPE A;  2V7Z A;  2PBD A;  1NGI A;  4FWR A;  2FF3 B;  4JAX A; 
#chains in the Genus database with same CATH topology
 4OGC A;  4FJM A;  1T8E A;  3QET A;  3RTV A;  4BR7 A;  3I0S A;  4AHC A;  4FSV A;  4Z4F A;  3VEY A;  3AVB A;  5M1Q A;  1KXP A;  4PUO A;  3BF3 A;  1U6Z A;  4Z4C A;  4CJW A;  4WQ5 A;  1K73 O;  2A41 A;  4OX9 K;  1ZBI A;  4KH4 A;  3BZC A;  4E7I A;  1IKY A;  3AV9 A;  1VQK N;  1GLE G;  2RKI A;  3WXJ A;  4FPB A;  2VG6 A;  4FJJ A;  4DCH A;  4A2A A;  3CJ7 A;  3VQP A;  1CXQ A;  1SL2 A;  3T1H K;  1EX4 A;  4OGE A;  3LWM A;  3BY5 A;  1J6Z A;  2QWN A;  4LC9 B;  2FF6 A;  2GTD A;  4I9Q A;  4BRA A;  4CF9 A;  4AM6 A;  4M3X A;  3DOK A;  4HWI A;  3DXM A;  1WAF A;  2DFF A;  3OBY A;  3U3Y A;  2XY5 A;  2E8A A;  3WNH A;  5GAD P;  5GIP A;  2O8F A;  2NNW A;  4DTX A;  3TI0 A;  1VAZ A;  4N76 A;  2JLE A;  5HRS A;  1YAG A;  3C6H A;  3KLE A;  5CYM A;  2OPR A;  4QS7 A;  4YHH K;  2P9I B;  3ZSQ A;  3K57 A;  5JLF A;  2A5X A;  2OYQ A;  1HQU A;  4KKO A;  4NO7 A;  3C95 A;  2VWK A;  4RG8 A;  4RTF D;  1N33 K;  4FYD A;  4YOU A;  2WC9 A;  4O5B A;  2WUS A;  5C24 A;  5FLX O;  2RF2 A;  4DFP A;  4PL8 A;  4DV4 K;  1R0A A;  4DF4 A;  3QFU A;  1VQP N;  5BPL A;  3CFR A;  2IS3 A;  3O1W A;  3O3G A;  4KTZ A;  2HBJ A;  1ZBF A;  4CI6 A;  4DLG A;  4IKF A;  1S1W A;  3SMS A;  2DY4 A;  5JVG L;  1NGC A;  1W0H A;  2P51 A;  2ASO A;  3T69 A;  3LP2 A;  3L2W A;  1YHQ N;  4DB3 A;  4LSL A;  1RDU A;  3LM9 A;  4FJX A;  3HOS A;  3F73 A;  3TAP A;  1LAW A;  4BWM A;  3CIP A;  2F7T A;  3C65 A;  2YHB A;  3O8M A;  3NGZ A;  3D2E B;  4FM0 A;  1DTT A;  1VSE A;  2A3Z A;  3KWI A;  1DTQ A;  3SAF A;  1HKC A;  3UKU B;  3ULE A;  4MO4 A;  4CCH A;  2OPQ A;  2RE2 A;  3I0R A;  5I9E B;  4KHY A;  3RMB A;  2Q0U A;  2VYP A;  3EE9 A;  4FJG A;  1VSJ A;  4JNE A;  2ZWH A;  1RT7 A;  2O8B B;  2QWP A;  1NMD A;  1GOA A;  4F9O A;  1GLF O;  4JKC A;  1FKO A;  1K8K A;  3ENB A;  3R3L A;  3CI5 A;  4BRQ A;  2GWK A;  4B08 A;  4JKF A;  1YXQ A;  4CGG A;  3GE1 A;  2YNG A;  4I2P A;  4FLZ A;  1JLB A;  1Q8I A;  4AHR A;  5ADX A;  3CCE N;  5JLH A;  4CJS A;  3PSI A;  4ILJ A;  1VK0 A;  4IG0 A;  3ZSZ A;  1JLE A;  1YUW A;  2FXU A;  1LWE A;  3W0L A;  4M3T A;  1LCU A;  1QHA A;  3NF9 A;  4CJF A;  4FK2 A;  3F2K A;  5GAG P;  1JLC A;  4Z4E A;  1NBW A;  3OYN A;  3DLL L;  2G8F A;  4CJK A;  4IDK A;  3M8Q A;  3N4Q A;  2YHY A;  3AA4 A;  4DFJ A;  3CQY A;  3V6D A;  2HHH K;  1TKT A;  1C0U A;  5ADX H;  3RMA A;  2HW3 A;  3G71 N;  4MQ3 A;  4FL9 A;  3FLC O;  5HRP A;  4YY3 K;  1K8A O;  3J7A P;  3DM2 A;  2YKM A;  5D3G A;  4JYA K;  1ESV A;  3DLG A;  1N5Y A;  4BRN A;  5J2P A;  3EZ5 A;  4NYF A;  4O8K A;  2VCP A;  2HVH A;  4OKE A;  3VEZ A;  4PA1 A;  3PLA A;  1QS4 A;  4FM1 A;  4KTQ A;  1NG9 A;  3VQA A;  2F8S A;  4H0P A;  2YI1 A;  2IVP A;  1SUQ A;  1JLA A;  3KK1 A;  1O13 A;  1U2V A;  1BCM A;  1V4T A;  3R1X A;  1RTH A;  2OA8 A;  2HHX A;  1EWQ A;  3F9K A;  3UE5 A;  2Q0R A;  4FJ5 A;  3MCA B;  5AZI A;  1NGJ A;  3PX0 A;  4XH5 A;  2HBM A;  1C0G A;  5AQL A;  4BQZ A;  4JD2 B;  1T44 A;  3V81 A;  3OJU A;  4K41 A;  4NCA A;  4KAZ A;  1ATR A;  4I9L A;  3HRG A;  2HNZ A;  3L3U A;  1IH7 A;  2D5R A;  3E66 A;  3K58 A;  3QBX A;  3FFK B;  4B1X B;  1GLD G;  4AQY K;  4DSI A;  4PL7 A;  3OYD A;  4YFU A;  1QVF M;  1LW0 A;  2KFN A;  2OAN A;  4CGD A;  3HYF A;  4YDU C;  1C6V A;  3UIQ A;  3QIN A;  4TSX A;  1J5E K;  3F5T A;  3HM8 A;  4X62 K;  4QAG A;  1S5J A;  4BE2 A;  3K2P A;  5AQJ A;  3NGI A;  1YT3 A;  2JWK A;  4FWO A;  3L2Q A;  2KLA A;  3KJV A;  1ZYQ A;  1IV0 A;  3ATV A;  4CGI A;  5AQZ A;  2D0A A;  4GY2 B;  4CED A;  4OPA A;  3EEQ A;  4ICL A;  2D0C A;  3VF2 A;  1FW6 A;  5LJW A;  1WSI A;  2AJQ A;  2O8E A;  2IDO A;  3AAQ A;  2Z1G A;  4E7K A;  1JLG A;  2P5O A;  5C2F A;  3V4I A;  4HUE A;  3O4N A;  1HPZ A;  4OKK A;  4H8K A;  5AQP A;  4CZK A;  4PKI A;  4Z0U A;  4FLX A;  4BR5 A;  1NGA A;  1NGF A;  4DUZ K;  4LY7 A;  4IOA L;  3V9S A;  2O8C A;  4BAC A;  4QOZ B;  5BRH A;  3L6Q A;  3MMV A;  5CYQ A;  4CJL A;  4FWK A;  3HPH A;  4BG8 A;  4DKW A;  4DV6 K;  3M6G A;  2PY5 A;  1JL2 A;  4IXC A;  3AVF A;  4FW2 A;  4M3W A;  1UAX A;  2HNY A;  1L5U A;  3DI6 A;  5KGW A;  3CM5 A;  4H5W A;  4X64 K;  4BDY A;  1CLQ A;  1VSD A;  4YOR A;  4HHT A;  1KAZ A;  3TAG A;  5IT9 O;  3EKU A;  1RFQ A;  2CH5 A;  3V9Z A;  3H3N O;  4JHD A;  1IKW A;  4JI8 K;  1B92 A;  3JS6 A;  1KCF A;  3VMF B;  3OYL A;  1A5V A;  2CGL A;  3GDQ A;  5BRD A;  1N8R O;  4BRK A;  2P9U A;  4BC2 A;  2P9P B;  1VQO N;  5HBM A;  4DTN A;  3JSM A;  1REV A;  5C10 A;  4IEE A;  2A40 A;  4JKH A;  4JKE A;  1U04 A;  4KH5 A;  3QEI A;  4JI0 K;  2QWL A;  2NRH A;  4LF8 K;  2WON A;  3ZT3 A;  2I7P A;  4DR4 K;  3PIO L;  2B4J A;  3O5B A;  4M3U A;  3RMD A;  4EP4 A;  4BRL A;  1C0T A;  3TAN A;  1X3N A;  2J4R A;  1U45 A;  2ZJR L;  1O1W A;  1Q86 O;  2QXL A;  4E1N A;  5DMR A;  2E6L A;  1HNW K;  1JCE A;  2IVO A;  2YNH A;  1NK8 A;  3ULD A;  1XNR K;  4HUG A;  3KLI A;  3HTV A;  4H5V A;  3L3V A;  3UKR A;  3AVJ A;  1J5O A;  1FKP A;  1WSH A;  4GMJ B;  3AO4 A;  3SJH A;  3OS0 A;  4EIA A;  4ELT A;  4W5R A;  4DS4 A;  3KLG A;  5CHI A;  1MA9 B;  3E9P A;  3DLB A;  4B3T K;  1P8Z A;  3ZT0 A;  3MEG A;  3H1Q A;  1NOY A;  3TAF A;  4JV5 K;  1U49 A;  3SBT A;  3U8X A;  4CGH A;  3FZM A;  3VES A;  5KTQ A;  4FK0 A;  4EP5 A;  4FJL A;  4WQ4 A;  3MXI A;  1HNI A;  3O3H A;  4JRP A;  4YOW A;  4LFC K;  3ZET A;  5FPE A;  2V7Z A;  3LPU A;  4M42 A;  2PBD A;  1NK9 A;  3NFA A;  1C1A A;  1WBD A;  2OTL N;  4LFA K;  2JGU A;  4DLE A;  4ISG A;  3RMC A;  4JK9 A;  4CJ4 A;  2BE2 A;  3CJC A;  3L8B A;  3S41 A;  4IFE A;  4FWL A;  4DU4 A;  4NB4 A;  4BGB A;  1SS6 A;  5FPM A;  3VGM A;  1JJ2 M;  1L3S A;  5KQD A;  3CMA N;  1HYS A;  3RSE A;  1VQ4 N;  4YOT A;  4DSF A;  1NM1 A;  4DF8 A;  3Q7C A;  5BRF A;  2CGK A;  2G8W A;  5AQV A;  3W3D A;  1IKV A;  1HJO A;  3SZ2 A;  1KSP A;  1DEJ A;  4DV1 K;  4E89 A;  1X1P A;  1D4X A;  4Y1C A;  3GL1 A;  1RNH A;  4CD3 A;  1VQ6 N;  1E4G T;  1RT1 A;  3LP1 A;  5SZT A;  2OCE A;  4DR2 K;  1GLL O;  2GV9 A;  4A59 A;  1NGB A;  3CFP A;  4JKG B;  3V9X A;  4WFB L;  3WXK A;  4CHQ A;  1JKH A;  4LF5 K;  3MXM A;  1YJN N;  3HBT A;  1TVR A;  4BRH A;  4FJ7 A;  4PQU A;  3DWL A;  2GBZ A;  3MWP A;  3RRG A;  4E1M A;  1WSF A;  1WLJ A;  3BP8 A;  4QS9 A;  1DT9 A;  2D1K A;  2E88 A;  5LMN K;  2O8D A;  1GLJ O;  3SPZ A;  2XO7 A;  4LF7 K;  2E1Y A;  4YOY A;  3JXU A;  2HF3 A;  4BG9 A;  3O1B A;  4AH9 A;  1VQN N;  5FRN A;  4DUY K;  3VF4 A;  4WF9 L;  1HKG A;  3QO9 A;  1TKX A;  2A42 A;  4HCC A;  1J53 A;  3DXK B;  2RPI A;  4BGA A;  2Q31 A;  3C6A A;  5KPR A;  4KHW A;  4KHU A;  3CD6 N;  4O44 A;  3N4P A;  1FJG K;  2BTF A;  4YOX A;  4DQS A;  3MEE A;  1NJW A;  3KWG A;  3P83 D;  2Q1N A;  4ZTF A;  4MO5 A;  3LZI A;  2BGG A;  1V4S A;  5F0X A;  2G8V A;  5GIN A;  2P9N B;  3L2V A;  2O4G A;  1MWM A;  1ILY A;  1NJY A;  3FGU A;  2KQ2 A;  3THY A;  1TK0 A;  5HRN A;  2PYJ A;  5K14 A;  3WQU A;  3SUQ A;  1S72 N;  3WXL A;  2YHW A;  4W5N A;  3ZT2 A;  4QS8 A;  1VQL N;  3HSC A;  4JI2 K;  1JLF A;  2P9S B;  1VSL A;  4CES A;  3ZT4 A;  4W5Q A;  2VWJ A;  3THV A;  3U3G A;  3BF1 A;  1A5W A;  4YNQ A;  2NRW A;  1NNE A;  2DTU A;  4DV5 K;  3VEO A;  1QSY A;  3FFI A;  3CCQ N;  1K9M O;  4KHN A;  2YKN A;  4BRO A;  2UXB K;  4M3R A;  1SV5 A;  3T7Z A;  4FO0 A;  1BL3 A;  4N56 A;  2FC0 A;  3KKS A;  1U48 A;  2AP1 A;  4OPJ A;  4RW4 A;  3ZSV A;  1J54 A;  3A5M C;  3B6O A;  4IBN A;  1N32 K;  4Z4I A;  4C8N A;  5C25 A;  1LV5 A;  3LDL A;  3EYZ A;  5JVH L;  2ETJ A;  2Q3S A;  2IOC A;  2P9K A;  3QEX A;  5M1O A;  1TYQ A;  3HPO A;  3TTD A;  3I8B A;  1KFD A;  3EY1 A;  3KHY A;  3TAE A;  3KKR A;  3T3F A;  4CD1 A;  5AQS A;  2VG7 A;  3OYM A;  1YTU A;  3LWL A;  3KIO A;  4BVO A;  4YOV A;  3IDH A;  4BC4 A;  1EXQ A;  4CJR A;  2F4V K;  1RDB A;  3OYC A;  3VER A;  4DQI A;  1N36 K;  4CW7 B;  1F21 A;  4BWJ A;  3NF7 A;  2W41 A;  1D9D A;  3OYK A;  5FRO A;  3H45 C;  4IEI A;  4DFM A;  1DGK N;  4BQL A;  5AZJ B;  3D45 A;  3DYA A;  3ZSO A;  2DFE A;  4AHU A;  4BRD A;  4FJK A;  5GAE P;  2E2Q A;  3LAK A;  5T7B A;  4ID1 A;  1ZBH A;  1RT3 A;  3D0P A;  1XNQ K;  5HP1 A;  4RCH A;  4BRP A;  3O3F A;  3ISN C;  3CCS N;  3OA9 A;  1ZBU A;  4C1N I;  4WFA L;  4CK3 A;  5EXW A;  3IMX A;  3ENH A;  3J7Z O;  3KK3 A;  4EFH A;  1SZ2 A;  3VPZ A;  2KFZ A;  3HL8 A;  5A2Q O;  1RTI A;  5AQM A;  3ZEU A;  1Z25 A;  3PUF A;  3CCL N;  3SV3 A;  2P9L B;  2PFU A;  1Y97 A;  4XIU A;  1QQM A;  1VSI A;  2O4I A;  5AQN A;  2PAV A;  4DSE A;  3EO3 A;  3NHG A;  3HT3 A;  1LWC A;  4AHV A;  4CBU A;  1QSS A;  4B1W B;  1UA0 A;  1S6P A;  1NK6 A;  4CJU A;  4GVE A;  2YV0 X;  4PKH A;  4G9Z A;  5J2M A;  4I6M A;  1M1K O;  5C2D A;  3WXM B;  4B3O A;  3KZB A;  2RN2 A;  4NYN A;  3SAG A;  4DV0 K;  4JI7 K;  3HJF A;  4BVP A;  5KPZ A;  5LMU K;  1T05 A;  4KFB A;  1QQN A;  3VQ8 A;  1WUA A;  1T03 A;  3PIP L;  1W7A A;  2ZE2 A;  4JHD B;  2QWR A;  2NRT A;  2OZS A;  2F9W A;  4LH4 A;  3THX A;  4CBW A;  2FSJ A;  4CF8 A;  4B9L A;  5AJ3 K;  5FRM A;  1U47 A;  3IG1 A;  1JCF A;  3VQ9 A;  4FJ8 A;  4RW6 A;  4DV7 K;  1XC9 A;  2ZGY A;  4RW8 A;  3WEE B;  3ZX0 A;  2FBT A;  4OPK A;  3EN9 A;  3NVK A;  3TTC A;  2KW4 A;  5C12 A;  1MU2 A;  4PKG A;  3SPY A;  1C1C A;  4RWT A;  1DKG D;  3OVN A;  3C7N A;  2VG5 A;  1QQC A;  3O4W A;  3HP6 A;  4LF9 K;  5AQF A;  4H0Y B;  2ITM A;  1VSK A;  1VRT A;  1IG8 A;  3PX6 A;  3CQX A;  3OYA A;  3U9Z A;  3H46 O;  3SCX A;  4J8F A;  4CIF A;  3ZSX A;  1ZBL A;  1T7P A;  5AQW A;  4F2S A;  4KV8 A;  1VQM N;  4DU1 A;  3U9D A;  5AR0 A;  4CHZ A;  3S3O A;  4NXN K;  4CFB A;  1HLU A;  2HHQ A;  1TL1 A;  3LPT A;  1VQ9 N;  3RR8 A;  4DHY A;  2ZD1 A;  3OYJ A;  2ITG A;  5SWM A;  1JL1 A;  2KHO A;  4K43 A;  4CZH A;  4EAH D;  4B9V A;  5LY3 A;  3WNG A;  5JS1 A;  1W97 L;  4XH1 A;  2UUB K;  4OLA A;  2Q97 A;  2A1S A;  1NJZ A;  2UYT A;  2X6S A;  3WT0 A;  4OLB A;  2UUA K;  4MDA A;  4C8K A;  2NZT A;  1RCH A;  2HST A;  3VGL A;  1GLC G;  3ZET B;  2VQF K;  3SUP A;  3D2F B;  4X65 K;  1RGI A;  4C8O A;  4CFD A;  2XY6 A;  4FW1 A;  4FWN A;  3C6T A;  4JLH A;  4CHY A;  1SL1 A;  2B5J A;  1SKW A;  5CZ2 A;  2YNF A;  2IIR A;  5J2Q A;  4UY8 O;  4WYB A;  4CJQ A;  5AQX A;  3HXM A;  2GEM A;  3TSP A;  4DG1 A;  4MDB A;  1RBV A;  3RSE B;  1VRU A;  1T6D A;  4O55 A;  4JI4 K;  3VQ5 A;  1KQS M;  4U7B A;  4IOC L;  3VEX A;  5HL7 L;  1RDC A;  4I2Q A;  4ZTJ A;  3CXC M;  1B9F A;  4A5B A;  3DOL A;  4IOX A;  2W40 A;  4CJ3 A;  3GOI A;  1SQK A;  1RTJ A;  5MLC Q;  5ELZ A;  3ZYY X;  4A5A A;  2G8H A;  3MX5 A;  4FWR A;  4FLY A;  4JKB A;  4JAX A;  1RIL A;  2E6M A;  4NCG A;  3SQ4 A;  4FWM A;  3H1V X;  1BG3 A;  4FWP A;  1JXB A;  4WCE L;  2VQE K;  3H3O B;  1ZC6 A;  4CEZ A;  3J8A A;  4ZHR A;  1LAV A;  5AFU A;  3KTQ A;  3FZK A;  5CZ1 A;  2BAN A;  3EL2 A;  3J80 O;  3CCJ N;  4MLH A;  3LDO A;  4K42 A;  3WNF A;  3HP9 A;  3OS1 A;  4KB0 A;  1BIS A;  1NU0 A;  3K9J A;  3E9L A;  4A2B A;  4K0K K;  1IG9 A;  3TAQ A;  4KTW A;  3UB5 A;  4Z94 A;  2B6A A;  2XY8 A;  4ISE A;  3P39 A;  3CPW M;  2HF4 A;  4BDZ A;  2BDP A;  2DPN A;  4OPH A;  5AFU H;  4B8A B;  3CCU N;  4KI6 A;  4BRC A;  2QK9 A;  1WSG A;  3D2E A;  5AQR A;  3SBG A;  4E7H A;  3P1G A;  1VHX A;  3P38 A;  4KO0 A;  3IRX A;  3V9W A;  3UKU A;  3L2U A;  4ISF A;  3ZCM A;  4FOI A;  3A5L C;  3OYH A;  1HUX A;  2QI2 A;  2XRI A;  2QEX N;  4H0V B;  2O8B A;  3O80 A;  4U67 L;  3SNN A;  2WBN A;  3A5N C;  5HOO A;  3AO1 A;  3QIC A;  1EKE A;  1HJR A;  3A2F A;  3S3M A;  3VN5 A;  3O4Q A;  4FOE A;  3M1F A;  3KLF A;  4YDU A;  3H6E A;  3O9S A;  4CEQ A;  4Z4H A;  1TKD A;  4GKJ K;  4FZY A;  4Q0B A;  1HNX K;  4F2R A;  1EWR A;  3VQE A;  4B3S K;  5HRR A;  4GKK K;  4FPA A;  3THY B;  4GVM A;  2QKK A;  1S1X A;  2FSN A;  3CET A;  5AQQ A;  3M8P A;  3AO2 A;  3AY9 A;  3VEW A;  3EE8 A;  4OKJ A;  4DSK A;  1C0F A;  4ID5 A;  4OO1 J;  4NLB A;  1KVB A;  2E20 A;  4B3M K;  3MK6 A;  5BN9 A;  3K5O A;  1NK5 A;  1BA0 A;  1KTQ A;  1SKR A;  1KLM A;  4DTS A;  3NCI A;  3FE1 A;  4Q5V A;  1Q82 O;  2F9T A;  3RRH A;  3AO5 A;  4FXD A;  3VQ4 A;  3O6W A;  4KH6 A;  1X9J A;  3VF6 A;  2YHA A;  3TAB A;  4NCB A;  3OYE A;  4CER A;  4DR6 K;  4DR5 K;  3OS2 A;  3ASM A;  1HPM A;  3LDS A;  4DS5 A;  3KLH A;  1BUP A;  3SI6 A;  4N41 A;  3P5J A;  3SQ1 A;  4JS5 A;  3ATU A;  1BHL A;  4GW6 A;  4MLE A;  4CHN A;  3AVI A;  3I55 N;  2ZQB A;  3AO3 A;  2HMI A;  4JD2 A;  1RDA A;  3NMU A;  4AHS A;  1CZB A;  4K8Z A;  3LL3 A;  3SAH A;  1N6Q A;  5DM6 L;  2QXF A;  1BOT O;  2GUP A;  1KRP A;  5KGX A;  4Z4G A;  3DXM B;  3HZ6 A;  5F1X A;  4BDP A;  4I7F A;  1QZ6 A;  5M1N A;  1NKB A;  1TAU A;  5EVZ A;  4CZJ A;  2NLX A;  2HHT A;  4IG3 A;  4ILG B;  1KAY A;  2GEL A;  3VQD A;  2O8F B;  1CXU A;  4B1V A;  3OYI A;  3NH1 A;  3THW A;  1S1T A;  4IFY A;  3TTF A;  2EHG A;  3J7Y P;  4M7X A;  3U4L A;  2F8T A;  2NRR A;  1S9G A;  5KPT A;  2EX3 A;  3AVK A;  3NGY A;  4O0I A;  2HB5 A;  2YNI A;  3TSQ A;  1IJJ A;  2BH1 A;  4CIG A;  1WBB A;  1QE1 A;  4DSL A;  4H5T A;  2ASM A;  3AA3 A;  4W5O A;  2G8U A;  4R5P A;  1GOB A;  3QML A;  2NRZ A;  2OTJ N;  1TL3 A;  3SV4 A;  4K8X A;  4DTP A;  1KFS A;  2GUI A;  1NK7 A;  1E4F T;  3HI0 A;  5E26 A;  1ZBS A;  4BR0 A;  4H5R A;  5J1E A;  4JS4 A;  4M7Y A;  4ILH A;  3K5M A;  4DTJ A;  4AIL C;  2FLO A;  2QWQ A;  3CC7 N;  3ZEU B;  5GAH P;  1NJX A;  4IJA A;  3RR7 A;  3MN6 A;  2YJE A;  2F96 A;  2W42 A;  1JLQ A;  2FSK A;  2EWS A;  4WQ5 C;  4BE0 A;  1BI4 A;  3NF8 A;  3DRP A;  3ID6 A;  4IFV A;  3QIO A;  5EU7 A;  3HK2 A;  1XQS C;  1GLA G;  3C6U A;  4M41 A;  3WQT A;  4DTM A;  3VET A;  1X9W A;  3ULE B;  4IO8 A;  5AQK A;  1JXE A;  3RVC A;  4DV3 K;  3PSF A;  3MN7 A;  4CJV A;  3TU5 A;  4GV9 A;  3WUH A;  4HUF A;  1WOQ A;  4BR2 A;  3HO1 A;  5I3U A;  3DLH A;  4CEE A;  4J2E A;  2Z1I A;  1K8K B;  1X9S A;  5KI6 A;  4CBX A;  1OH5 A;  3L2R A;  2E2P A;  4WE1 A;  2R7Y A;  2ZF5 O;  2HBL A;  5BPM A;  4DQQ A;  3AVH A;  4Y1D A;  3SMP A;  1YTA A;  3IS9 A;  2IAJ A;  4DQP A;  3AVA A;  1BO5 O;  2W6K A;  3THX B;  4HTU A;  2ATQ A;  3PY8 A;  1VQ8 N;  1TUY A;  1RT6 A;  4B9U A;  3ID8 A;  4H03 B;  2G8I A;  1HMV A;  1BQN A;  1LWF A;  3EKS A;  2E2O A;  3LM2 A;  3MED A;  1HRH A;  4O0J A;  3R8E A;  3AVL A;  3A8Y A;  3VQ6 A;  1NKE A;  4BC3 A;  4ELV A;  1X9M A;  3MN5 A;  3CG7 A;  2HVI A;  2BUP A;  2QTD A;  4DR1 K;  4M3Y A;  4C8L A;  1KLN A;  1MDU B;  3O9R A;  4GNI A;  1D5A A;  3AVM A;  3QIP A;  3LDP A;  4BRG A;  4FWS A;  1IO2 A;  4F8R A;  3B8A X;  1YIJ N;  3D7E O;  4H0X B;  4RW9 A;  4KPY A;  3FZH A;  1Q81 O;  2KTQ A;  1HYV A;  1W2B M;  3KK2 A;  1KD1 O;  1I39 A;  1U2V B;  2H3G X;  4PY5 A;  1G99 A;  4L3Q A;  4CEB A;  2UUC K;  4XEI A;  3VTH A;  3FR0 A;  1M90 O;  1HKB A;  5AZI B;  5H1S Q;  3OTO K;  3K5L A;  2HHW A;  3RWU A;  3CCM N;  1JCG A;  1XC3 A;  1L3U A;  4CZF A;  4DTO A;  1Z05 A;  1K6Y A;  4QCL A;  1NLV A;  4W5T A;  1YI2 N;  2D0O A;  4CZG A;  4FJ9 A;  2QA4 N;  5EX5 A;  4CEA A;  3ZSY A;  3G0Z A;  3MCP A;  2QM1 A;  1E3M A;  1CZ9 A;  4WFN L;  3LAM A;  4E7J A;  3NF6 A;  3R6M A;  3T1Y K;  4LF6 K;  2FBX A;  2A1R A;  2UXD K;  4FK4 A;  3NBP A;  1VSM A;  4JI6 K;  3OJS A;  3P4I A;  5F2R A;  2E2N A;  2D0P A;  4A61 A;  3MAQ A;  4X66 K;  4KRE A;  4CVN E;  4LSN A;  4XH4 A;  1RDD A;  2FBV A;  5KRT A;  1UOC A;  3LZJ A;  3CHW A;  4CFC A;  1VSH A;  3OYG A;  3SQ2 A;  1MWK A;  1B9D A;  3BGR A;  1GLB G;  1TKZ A;  4B1Z A;  2NUB A;  1KC8 O;  3PX4 A;  4FLW A;  1NJI O;  3AGR A;  3HOT A;  3G6E N;  1S6Q A;  2W6L A;  3V9U A;  2O8E B;  3VQ7 A;  1QSL A;  5DK5 A;  2D0B A;  4JK8 A;  3QBW A;  3CC2 N;  4JKG A;  3M8R A;  4DQ8 A;  1X3M A;  4BC5 A;  3I8D A;  2P5G A;  4G1Q A;  3M8S A;  3MWT A;  4GV3 A;  1XMO K;  1ATS A;  3SQ0 A;  1BWF O;  4H0T B;  4B8C A;  4HCB A;  5E84 A;  1L3V A;  5BRE A;  2AA4 A;  2UU9 K;  3DRR A;  2O8C B;  4C8M A;  4JI5 K;  3U6F A;  1T6C A;  1RDW X;  5C42 A;  4DFK A;  3SUO A;  1UWB A;  3DMJ A;  5CR4 A;  1OKJ A;  3K5N A;  1XMQ K;  3BEX A;  1I94 K;  3V1R A;  3K0S A;  1NGI A;  3CCR N;  2FF3 B;  3VA3 A;  1Y64 A;  3CJ9 A;  3LDQ A;  3DXK A;  3VEN A;  3SJJ A;  5BN8 A;  3ENO A;  2X74 A;  4FWQ A;  1D9F A;  1NGG A;  4CGF A;  4CJ5 A;  4CZE A;  1ASW A;  1IBK K;  4CJP A;  3HM9 A;  3O9U A;  2IGI A;  4LF4 K;  2Z1H A;  4LFB K;  2HHS A;  4BRI A;  1A5X A;  3IFR A;  2HBK A;  3ITH A;  4CF1 A;  3WNE A;  1T3V A;  1RT4 A;  2ZGZ A;  4FZZ A;  3QFP A;  2P9U B;  2P9N A;  3ZT1 A;  4E3S A;  4Y0W A;  1BU6 O;  1OH6 A;  1SKS A;  1YF5 L;  3FZF A;  3JAM O;  1EO1 A;  3CC4 N;  3CYM A;  4FLT A;  3L4I A;  4IZ9 A;  4E19 A;  4NLC A;  1P90 A;  3HVT A;  3PV8 A;  4CJE A;  1NGE A;  4B9M A;  3QLH A;  5CY4 A;  1Q7Y O;  4FJI A;  1NGD A;  2P9S A;  3I33 A;  3TWH A;  1SL0 A;  2HOE A;  4AF1 A;  3MN9 A;  2PZS A;  4FJH A;  4PHT X;  4JRQ A;  4B1Y B;  4FCY A;  1Q9X A;  3T19 A;  4ELU A;  1RBT A;  5LJV A;  3DLE A;  1TK8 A;  2PYL A;  4DTR A;  4JI1 K;  3SK3 A;  1IKX A;  2XY7 A;  4F3T A;  2WOM A;  4O8U A;  5AQH A;  3UKR B;  1FK9 A;  5BR8 K;  5DM7 L;  1NWK A;  4UQG A;  3AGK A;  1WSE A;  3MX2 A;  1ASU A;  2QW9 A;  3O08 A;  3QB0 A;  3VQQ A;  3KD5 E;  3AVC A;  1HX1 A;  1G15 A;  2CGJ A;  3TSU A;  2HND A;  3R9P A;  1WB9 A;  3OY9 A;  3LP0 A;  1RBR A;  3AA2 A;  2X6N A;  3GG4 A;  4IWV A;  4BR4 A;  3ZX2 A;  1Z26 A;  3IKM A;  3J81 O;  4CF2 A;  5FDL A;  3DLR A;  3DLK A;  3GBT A;  3IAY A;  2E1Z A;  2VGM A;  3WXI A;  4B9T A;  4CJ7 A;  1WSJ A;  4LD0 A;  4B9S A;  2V52 B;  2OPS A;  3QEV A;  5AQY A;  4J2B A;  5C15 A;  3CER A;  4CZI A;  3NH2 A;  3QEW A;  1NK4 A;  4K25 A;  3SYZ A;  3CFO A;  3E01 A;  1N34 K;  3S9H A;  3PO4 A;  4O5F A;  2QKB A;  3KVG A;  1FXX A;  5AQI A;  2P9I A;  4B3R K;  5HRO A;  4CHO A;  2V51 B;  2VGN A;  1I3A A;  4KRF A;  3THW B;  5M1K A;  3A0I X;  1VSF A;  3QER A;  2YX6 A;  3HST B;  3NAE A;  3VOV A;  3QNN A;  1EET A;  1Q9Y A;  4E0D A;  5AZJ A;  4HVJ A;  4DU3 A;  3S3N A;  2X78 A;  2YJF A;  2G8K A;  1XI1 A;  3DRS A;  1C1B A;  1BA1 A;  1LW2 A;  3G10 A;  1S9E A;  5AQO A;  4BE1 A;  4DSJ A;  4O4G A;  4KHP K;  2I5J A;  2Z1J A;  1QVG M;  3TAM A;  3T1A A;  1L3T A;  3V1Q A;  3BUZ B;  1IBM K;  4NXM K;  4CK2 A;  2D4W A;  4HTL A;  3D6R A;  4OJR A;  1W9H A;  1DLO A;  1XHZ A;  1HR0 K;  1BIU A;  4C23 A;  2ZJP L;  1D8Y A;  1NKC A;  2P9L A;  4GV6 A;  3G4S N;  5C0Y A;  4CE9 A;  3SLC A;  1TAQ A;  2P1J A;  4M63 C;  2RHK A;  4RW7 A;  5EY4 A;  2O8D B;  4H0O A;  4JK7 A;  5J2N A;  2Y1I A;  2KZZ A;  3O9Q A;  4B1U B;  4CFA A;  1VQ7 N;  2I7N A;  1BI4 B;  2Q36 A;  5EOY A;  4WQ4 C;  4JI3 K;  4J2D A;  3ALY A;  3OHR A;  3AAP A;  2YCH A;  2NRX A;  5AQT A;  4CGJ A;  3TPQ A;  4FZX C;  3OYB A;  1QTM A;  3FZL A;  3O9T A;  1VQ5 N;  3A5O C;  2GWJ A;  4N5S A;  3C0B A;  3PO5 A;  4AHT A;  5TKW A;  1RTD A;  4KI4 A;  1H1V A;  3NH0 A;  1BCO A;  1NGH A;  2QWM A;  3NVM A;  3OW2 M;  3CJ1 A;  2WTU A;  1WAJ A;  5JMV A;  1BGX T;  1RT2 A;  1WNS A;  2QWO A;  5FPD A;  4DWI A;  4CEC A;  2HHU A;  1OVQ A;  4FJN A;  2WFB A;  1OVY A;  1RBU A;  3TAR A;  3MEC A;  3OYF A;  4CK1 A;  1RT5 A;  5TKY A;  4B9Q A;  3VQB A;  3VGK A;  1TUU A;  3AVN A;  3TR8 A;  5HLF A;  4DTU A;  3WEE A;  2UXC K;  4BRM A;  1OH8 A;  3ZLJ A;  3M5R A;  3K59 A;  3P31 A;  4R79 A;  1J9A A;  4FM2 A;  4CF0 A;  1S1U A;  3CQ8 A;  4KHQ A;  3C94 A;  4CEO A;  4DR3 K;  2ZM6 K;  4BRE A;  4JN4 A;  4BRF A;  3BZK A;  5AQU A;  1SAZ A;  2ZJQ L;  2KKZ A;  1XWL A;  4EHT A;  1EQY A;  1OH7 A;  1YVN A;  2V7Y A;  3QEP A;  2JWL A;  3SUN A;  1HNV A;  2KZM A;  4IJN A;  3DJC A;  3ZSW A;  3L4Q A;  3H08 A;  1BDG A;  1S1V A;  1KAX A;  2CH6 A;  4H5N A;  4J2A A;  2GX9 A;  3CJB A;  4KHS A;  4M3Z A;  4JKA A;  1LOT B;  3NE6 A;  4FLV A;  2P9K B;  4LH5 A;  1TYQ B;  2DFH A;  5BR9 A;  5GIO A;  2E4L A;  1BQM A;  4IO9 L;  2NRV A;  3CJA A;  1WN7 A;  4OVL A;  3ZX3 A;  2FBY A;  4FLU A;  4JEP A;  3EZW A;  1ASV A;  1YJ9 N;  5JIC A;  4DQR A;  3D2F A;  4C1N K;  3QES A;  1XHX A;  3VEV A;  1BIZ A;  5KRS A;  3HVR A;  5BPN A;  2XHB A;  1HYZ A;  3KK7 A;  4A62 A;  4KB1 A;  5CE3 A;  4L8R B;  4F3O A;  3L0Q A;  3LAL A;  4CJT A;  3NDK A;  1U4B A;  1EP4 A;  3E9O A;  3LP3 A;  3AAR A;  4EHU A;  1NMN A;  1RBS A;  1IBL K;  4CEF A;  4F4K A;  3B6P A;  4E1J A;  4N47 A;  4H4M A;  5AQG A;  1TK5 A;  1HNZ K;  3DAW A;  2HHV A;  2Q2R A;  3AA5 X;  3LDN A;  4FVU A;  1NOZ A;  3OBW A;  4IDH A;  5JS2 A;  3LAN A;  3I56 N;  5M1F A;  2Y1J A;  1UA1 A;  1XUP O;  1ITG A;  2YHX A;  1YJW N;  2IC3 A;  1S3X A;  4PWD A;  2HMP A;  3G25 A;  1YIT N;  4DR7 K;  2VWB A;  1QHT A;  5FPN A;  3CME N;  2LSN A;  3ZSR A;  4CZL A;  5E41 A;  3AVG A;  5LL6 Z;  2IVN A;  4FVM A;  2OZM A;  4V19 S;  1ATN A;  3HPG A;  3QNO A;  1QZ5 A;  5B8H A;  3M3Z A;  3CM6 A;  1C0M A;  2A6A A;  3MDQ A;  1GOC A;  3JYT A;  3MXJ A;  4H4O A;  3V1O A;  3VTI A;  1HQE A;  4DV2 K;  4JKD A;  1Q18 A;  3Q7B A;  1QQO A;  3VQC A;  1NK0 A;  3F9M A;  2OPP A;  1R59 O;  2ASP A;  4I6M B;  5IWA K;  4E7L A;  4AM7 A;  1S22 A;  3IUC A;  3QDK A;  4CZM A;  4M45 A;  3E1Y A;  5M1P A;  4BY9 C;  4KBO A;  1KVC A;  4A57 A;  4MFB A;  1ZXO A;  2P9P A;  1CZA N;  1TV6 A;  5I42 A;  3BDP A;  1Z6R A;  4CHP A;  5KQ8 A;  1YVU A;  3KD1 E;  4EZ9 A;  1TGO A;  4CIE A;  3CPE A;  4BR9 A;  4DMN A;  3C7N B;  3CCV N;  3CF5 L;  4EZ6 A;  2E5L K;  3K9K A;  1KVA A;  4B9N A;  3VA0 A; 
#chains in the Genus database with same CATH homology
 4FWM A;  3H1V X;  1BG3 A;  4FWP A;  1Y64 A;  3CJ9 A;  4ISG A;  3LDQ A;  4WCE L;  4JK9 A;  3H3O B;  1ZC6 A;  3CJC A;  3DXK A;  3J8A A;  3VEN A;  3S41 A;  5BN8 A;  3ENO A;  4IFE A;  4BR7 A;  4FWQ A;  5AFU A;  1NGG A;  3FZK A;  4FWL A;  4CZE A;  3EL2 A;  3O9U A;  4FSV A;  4NB4 A;  4BGB A;  4MLH A;  3CCJ N;  3VEY A;  1SS6 A;  3LDO A;  5FPM A;  4K42 A;  3VGM A;  1JJ2 M;  5KQD A;  3CMA N;  4BRI A;  5M1Q A;  3IFR A;  2HBK A;  1T3V A;  3K9J A;  3E9L A;  1KXP A;  3RSE A;  4A2B A;  2ZGZ A;  3BF3 A;  1VQ4 N;  1U6Z A;  4JKB A;  3QFP A;  2P9U B;  2P9N A;  4YOT A;  4Y0W A;  1BU6 O;  1NM1 A;  3UB5 A;  3Q7C A;  1YF5 L;  3FZF A;  4WQ5 A;  4Z94 A;  2CGK A;  3P39 A;  2A41 A;  2HF4 A;  3L4I A;  4ISE A;  4KH4 A;  5BRF A;  2DPN A;  4IZ9 A;  3CC4 N;  4OPH A;  4NLC A;  1P90 A;  5AQV A;  1GLE G;  5AFU H;  1VQK N;  3CCU N;  3WXJ A;  4BRC A;  4FPB A;  1NGE A;  3W3D A;  1HJO A;  3D2E A;  5AQR A;  3SBG A;  4A2A A;  4DCH A;  3CJ7 A;  1Q7Y O;  1DEJ A;  1NGD A;  2P9S A;  3I33 A;  3P38 A;  1D4X A;  2HOE A;  4AF1 A;  3MN9 A;  3UKU A;  3GL1 A;  4PHT X;  1J6Z A;  4B1Y B;  4ISF A;  2QWN A;  4FOI A;  3A5L C;  4CD3 A;  1HUX A;  2QI2 A;  4LC9 B;  2FF6 A;  2QEX N;  1VQ6 N;  1E4G T;  2GTD A;  4H0V B;  4BRA A;  5LJV A;  4AM6 A;  1GLL O;  3O80 A;  4A59 A;  4U67 L;  3SK3 A;  1NGB A;  4HWI A;  3DXM A;  2WBN A;  3A5N C;  5HOO A;  4O8U A;  5AQH A;  3OBY A;  4JKG B;  3UKR B;  5DM7 L;  1NWK A;  3AGK A;  2E8A A;  4WFB L;  3WXK A;  3MX2 A;  3QIC A;  5GAD P;  2QW9 A;  5GIP A;  3O08 A;  3QB0 A;  2NNW A;  1YJN N;  1VAZ A;  3HBT A;  4BRH A;  1HX1 A;  3DWL A;  4FOE A;  2CGJ A;  1YAG A;  3M1F A;  3MWP A;  3R9P A;  3TSU A;  3C6H A;  4YDU A;  3H6E A;  3BP8 A;  3O9S A;  4QS9 A;  4QS7 A;  1DT9 A;  2P9I B;  2D1K A;  2E88 A;  5JLF A;  2A5X A;  4FPA A;  3GG4 A;  4IWV A;  4BR4 A;  3ZX2 A;  1GLJ O;  2FSN A;  3CET A;  3IKM A;  4NO7 A;  5AQQ A;  2E1Y A;  4RTF D;  4YOY A;  3JXU A;  3GBT A;  2HF3 A;  2E1Z A;  2VGM A;  4YOU A;  3WXI A;  3AY9 A;  2WC9 A;  3O1B A;  4BG9 A;  2WUS A;  3VEW A;  3EE8 A;  1VQN N;  4CJ7 A;  1C0F A;  3VF4 A;  4WF9 L;  4PL8 A;  1HKG A;  3QFU A;  1VQP N;  5BPL A;  4OO1 J;  2A42 A;  2V52 B;  4NLB A;  3DXK B;  3O1W A;  2E20 A;  5AQY A;  5C15 A;  4BGA A;  2HBJ A;  3CER A;  4CZI A;  2Q31 A;  4CI6 A;  3MK6 A;  3C6A A;  5KPR A;  4K25 A;  3CD6 N;  3N4P A;  5BN9 A;  3SMS A;  2BTF A;  4YOX A;  5JVG L;  1NGC A;  3KWG A;  1BA0 A;  2Q1N A;  3FE1 A;  4MO5 A;  4O5F A;  2F9T A;  1Q82 O;  3KVG A;  1V4S A;  2ASO A;  3T69 A;  5F0X A;  5GIN A;  3O6W A;  2P9N B;  1X9J A;  4KH6 A;  5AQI A;  3VF6 A;  2P9I A;  4DB3 A;  1YHQ N;  1RDU A;  2V51 B;  3LM9 A;  2VGN A;  1MWM A;  3HOS A;  1ILY A;  3FGU A;  3WQU A;  3A0I X;  5M1K A;  3CIP A;  2F7T A;  3C65 A;  3O8M A;  1S72 N;  2YX6 A;  3WXL A;  1HPM A;  3VOV A;  3D2E B;  1BUP A;  2YHW A;  2A3Z A;  4QS8 A;  3KWI A;  1VQL N;  3ATU A;  3HSC A;  5AZJ A;  2P9S B;  3SAF A;  4MLE A;  3I55 N;  1HKC A;  3UKU B;  3ULE A;  2YJF A;  4MO4 A;  4JD2 A;  1BA1 A;  2RE2 A;  5AQO A;  5I9E B;  3NMU A;  2Q0U A;  3LL3 A;  2VYP A;  3SAH A;  5DM6 L;  1QVG M;  3BF1 A;  3EE9 A;  4JNE A;  2ZWH A;  1BOT O;  2NRW A;  2GUP A;  1NMD A;  2QWP A;  4F9O A;  1GLF O;  3DXM B;  3VEO A;  3CCQ N;  1K9M O;  3HZ6 A;  4JKC A;  5F1X A;  4BRO A;  3BUZ B;  1K8K A;  1QZ6 A;  2D4W A;  4HTL A;  3ENB A;  3R3L A;  3D6R A;  4FO0 A;  5EVZ A;  3CI5 A;  2NLX A;  3T7Z A;  4CZJ A;  4ILG B;  1KAY A;  2GEL A;  4BRQ A;  2GWK A;  4JKF A;  4B1V A;  1YXQ A;  2AP1 A;  3GE1 A;  4C23 A;  2ZJP L;  2P9L A;  4GV6 A;  3CPW M;  3G4S N;  5C0Y A;  3TTF A;  3A5M C;  4M7X A;  3U4L A;  3SLC A;  5ADX A;  2NRR A;  3CCE N;  4M63 C;  2RHK A;  5JLH A;  5EY4 A;  3LDL A;  5KPT A;  4ILJ A;  4H0O A;  5JVH L;  1YUW A;  4JK7 A;  2FXU A;  3O9Q A;  3W0L A;  3TSQ A;  1LCU A;  1QHA A;  4B1U B;  3F2K A;  2P9K A;  1VQ7 N;  1IJJ A;  2I7N A;  5M1O A;  1TYQ A;  2BH1 A;  5GAG P;  3TTD A;  1NBW A;  3I8B A;  2Q36 A;  5EOY A;  3DLL L;  4WQ4 C;  4H5T A;  2ASM A;  3KHY A;  3OHR A;  3N4Q A;  2YHY A;  3AAP A;  2YCH A;  2NRX A;  5AQT A;  3CQY A;  3QML A;  2NRZ A;  3TPQ A;  5ADX H;  4CD1 A;  2OTJ N;  5AQS A;  3G71 N;  4FL9 A;  3FLC O;  3FZL A;  1K8A O;  3O9T A;  1VQ5 N;  3A5O C;  2GWJ A;  3C0B A;  1E4F T;  5TKW A;  3HI0 A;  1ESV A;  1H1V A;  4BRN A;  1NGH A;  5E26 A;  1ZBS A;  2QWM A;  3NVM A;  3OW2 M;  3CJ1 A;  4BR0 A;  4O8K A;  5JMV A;  2VCP A;  4H5R A;  4BVO A;  3VEZ A;  2QWO A;  3PLA A;  5FPD A;  4YOV A;  4M7Y A;  3IDH A;  4H0P A;  4ILH A;  4BC4 A;  2WFB A;  1OVY A;  2YI1 A;  2IVP A;  2FLO A;  2QWQ A;  3CC7 N;  3ZEU B;  5GAH P;  3VER A;  1O13 A;  1U2V A;  4IJA A;  5TKY A;  3MN6 A;  1V4T A;  2YJE A;  3VGK A;  4B9Q A;  3R1X A;  1TUU A;  2FSK A;  2W41 A;  2EWS A;  3WEE A;  4WQ5 C;  4BRM A;  3UE5 A;  2Q0R A;  3H45 C;  4IEI A;  3ID6 A;  3MCA B;  1DGK N;  5AZI A;  4BQL A;  5AZJ B;  1NGJ A;  1XQS C;  1GLA G;  3M5R A;  3WQT A;  3P31 A;  4XH5 A;  3VET A;  2HBM A;  4BRD A;  5GAE P;  4R79 A;  1C0G A;  2E2Q A;  3ULE B;  5AQL A;  4BQZ A;  4IO8 A;  4JD2 B;  5AQK A;  1T44 A;  3RVC A;  4RCH A;  4K41 A;  4BRP A;  3MN7 A;  4BRE A;  3CCS N;  3OA9 A;  4C1N I;  1ATR A;  4JN4 A;  3TU5 A;  4WFA L;  3HRG A;  4GV9 A;  3WUH A;  4BRF A;  1WOQ A;  4BR2 A;  5EXW A;  3IMX A;  1K8K B;  5AQU A;  1SAZ A;  3E66 A;  3ENH A;  4CBX A;  2ZJQ L;  3J7Z O;  2KKZ A;  3QBX A;  4EFH A;  4EHT A;  2E2P A;  1EQY A;  1SZ2 A;  3FFK B;  3VPZ A;  4B1X B;  1YVN A;  2ZF5 O;  1GLD G;  2V7Y A;  5AQM A;  3ZEU A;  2HBL A;  5BPM A;  3CCL N;  2JWL A;  3SMP A;  4PL7 A;  1QVF M;  2P9L B;  2PFU A;  4IJN A;  3DJC A;  2OAN A;  1QQM A;  3L4Q A;  5AQN A;  2PAV A;  1BO5 O;  3EO3 A;  4YDU C;  1BDG A;  1VQ8 N;  4CBU A;  1KAX A;  2CH6 A;  1TUY A;  4H5N A;  2GX9 A;  5M1N A;  3CJB A;  4JKA A;  1LOT B;  3F5T A;  3HM8 A;  4B1W B;  2P9K B;  3ID8 A;  4H03 B;  1TYQ B;  5BR9 A;  5GIO A;  3EKS A;  2E2O A;  3LM2 A;  5AQJ A;  2JWK A;  4IO9 L;  2NRV A;  3CJA A;  4FWO A;  4GVE A;  3A8Y A;  3R8E A;  4BC3 A;  2KLA A;  4PKH A;  3ZX3 A;  3MN5 A;  4G9Z A;  3ATV A;  4JEP A;  4I6M A;  3EZW A;  2BUP A;  5AQZ A;  2QTD A;  4GY2 B;  5C2D A;  1M1K O;  3WXM B;  4OPA A;  1YJ9 N;  3KZB A;  5JIC A;  3VF2 A;  3SAG A;  3D2F A;  1MDU B;  3O9R A;  3VEV A;  4GNI A;  4C1N K;  4BVP A;  5LJW A;  5KPZ A;  5BPN A;  3LDP A;  4BRG A;  3KK7 A;  4A62 A;  4FWS A;  5CE3 A;  1QQN A;  3B8A X;  1YIJ N;  3L0Q A;  1WUA A;  3D7E O;  3PIP L;  1K73 O;  3AAQ A;  4H0X B;  4JHD B;  3FZH A;  2QWR A;  2NRT A;  1Q81 O;  2F9W A;  1W2B M;  3E9O A;  5C2F A;  4CBW A;  2FSJ A;  1KD1 O;  3AAR A;  1JCF A;  1U2V B;  2H3G X;  4EHU A;  5AQP A;  4CZK A;  1G99 A;  4PKI A;  4E1J A;  4L3Q A;  4BR5 A;  1NGA A;  2ZGY A;  3WEE B;  3ZX0 A;  1NGF A;  5AQG A;  4XEI A;  3VTH A;  3EN9 A;  3FR0 A;  3TTC A;  3NVK A;  4IOA L;  5C12 A;  3DAW A;  4PKG A;  1HKB A;  1M90 O;  5AZI B;  5BRH A;  4RWT A;  5H1S Q;  1DKG D;  3L6Q A;  3C7N A;  3MMV A;  4FWK A;  2Q2R A;  4BG8 A;  4DKW A;  3M6G A;  3LDN A;  3O4W A;  3CCM N;  1JCG A;  4FVU A;  3OBW A;  4IDH A;  4IXC A;  1XC3 A;  5AQF A;  4H0Y B;  4CZF A;  2ITM A;  1Z05 A;  3I56 N;  5M1F A;  1XUP O;  1IG8 A;  1NLV A;  2YHX A;  3CQX A;  4H5W A;  3U9Z A;  1YI2 N;  2D0O A;  3H46 O;  4YOR A;  4CZG A;  1KAZ A;  4J8F A;  1YJW N;  1S3X A;  3EKU A;  5EX5 A;  2QA4 N;  1RFQ A;  2HMP A;  3G25 A;  5AQW A;  2CH5 A;  1YIT N;  3H3N O;  2VWB A;  3MCP A;  2QM1 A;  4JHD A;  1VQM N;  4WFN L;  5FPN A;  3JS6 A;  3CME N;  3VMF B;  3U9D A;  3R6M A;  4CZL A;  5AR0 A;  2CGL A;  2IVN A;  1HLU A;  1ATN A;  3GDQ A;  5BRD A;  1QZ5 A;  1N8R O;  1VQ9 N;  3P4I A;  4BRK A;  4DHY A;  5B8H A;  2P9U A;  4BC2 A;  2P9P B;  3M3Z A;  2E2N A;  5F2R A;  2A6A A;  2D0P A;  3MDQ A;  1VQO N;  4A61 A;  2KHO A;  4K43 A;  4CZH A;  4EAH D;  5C10 A;  4IEE A;  3VTI A;  5LY3 A;  2A40 A;  4JKH A;  4JKE A;  4JKD A;  4XH4 A;  1Q18 A;  4KH5 A;  1W97 L;  4XH1 A;  3Q7B A;  1QQO A;  2QWL A;  2NRH A;  2Q97 A;  2I7P A;  3F9M A;  3CHW A;  3PIO L;  3O5B A;  2UYT A;  1R59 O;  2ASP A;  3WT0 A;  4BRL A;  1X3N A;  2J4R A;  1MWK A;  4MDA A;  2ZJR L;  1GLB G;  2NZT A;  1Q86 O;  4I6M B;  2HST A;  3VGL A;  4B1Z A;  1GLC G;  2QXL A;  3ZET B;  1KC8 O;  1NJI O;  3D2F B;  1RGI A;  3AGR A;  4AM7 A;  1JCE A;  2IVO A;  3HOT A;  3G6E N;  1S22 A;  4FWN A;  3IUC A;  3QDK A;  3HTV A;  3QBW A;  4H5V A;  4JK8 A;  3UKR A;  4JKG A;  4CZM A;  3CC2 N;  3E1Y A;  3SJH A;  5M1P A;  1EO1 A;  4EIA A;  4DQ8 A;  1X3M A;  4BC5 A;  4BY9 C;  4KBO A;  2IIR A;  4A57 A;  5CHI A;  4UY8 O;  1MA9 B;  1ZXO A;  3E9P A;  2P9P A;  4WYB A;  1P8Z A;  3MWT A;  4GV3 A;  5AQX A;  1CZA N;  1ATS A;  1Z6R A;  2GEM A;  1BWF O;  3TSP A;  3H1Q A;  5KQ8 A;  4MDB A;  4H0T B;  3RSE B;  5E84 A;  1T6D A;  5BRE A;  2AA4 A;  3SBT A;  3CPE A;  1KQS M;  3U8X A;  4U7B A;  4BR9 A;  4IOC L;  3VEX A;  5HL7 L;  3FZM A;  3CXC M;  3VES A;  1T6C A;  3C7N B;  1RDW X;  4A5B A;  4WQ4 A;  3CCV N;  4IOX A;  4YOW A;  3CF5 L;  2W40 A;  5CR4 A;  1OKJ A;  3GOI A;  1SQK A;  5MLC Q;  5ELZ A;  3ZET A;  3ZYY X;  3K9K A;  4A5A A;  3MX5 A;  3BEX A;  5FPE A;  2V7Z A;  2PBD A;  1NGI A;  3CCR N;  4FWR A;  2FF3 B;  4JAX A;  2OTL N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...