3I0RA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 3
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 146
structure length 545
sequence length 545
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0rA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0rA05
5J2QB 2JC0A 2R2UA 1VSFA 4TY8B 3C6TB 4CJ3A 4URSA 1N6QB 2FBVA 2YNFA 1JLBB 3C95A 3SFUA 3OL8A 1WAFA 1QQCA 4YR0A 3BQ1A 2KFZA 3LP1B 1K6YA 4I2QB 3DRRB 2G8HA 4EBEA 3KKSA 1HYVA 3RMCA 2O5DA 4OPKA 4DL2A 1S6QB 2YHBA 3IGNA 1SUQB 4B9MA 4TQRA 2B5JA 4CEBA 1RT3A 1ITGA 4DL3A 4LQ3A 3QNNA 1BQNB 3BQ2A 4NLRA 3SV4A 4EYHB 1IO2A 4J9NA 4ED7A 4XIUA 4QAGA 3MEEB 1WNSA 5C42A 4CFDA 2AWZA 3K5NA 3VQ7A 4FJ9A 1CSJA 1Z25A 1J54A 2R2RA 3QNOA 3KLIA 4O55A 2OYQA 3I0RA 2OZSA 4KB7A 1J5OB 4OL8A 5D3GB 3CO9A 5DG9A 4KBIA 4M3TA 3SJJA 4IG0B 1GOBA 2ASJA 3DLEA 3T1AA 3OS2A 1CZ9A 3OSNA 1L3UA 1RTHB 2YNIA 3SFGA 2IS3A 2DFEA 1TKZA 3I5AA 3DRPA 3CG7A 3IGVA 4CJFA 3AA3A 2W7OA 4IH7A 4ZP8A 3K5OA 3EPIA 3AA5X 1S9FA 3PUFA 1ZETA 2G8WA 4RW8B 1ASVA 1R0AA 1FK9B 2FVQA 5KFAA 4HHTA 2D41A 4E7LA 1VRTA 2XY7A 4FLYA 1IKXA 4KFBA 4BE2A 4HCCA 3CJ0A 1RDRA 1T3NA 3FFIA 1JXBA 3NH1A 3DDKA 1RT3B 3KK1B 2ASLA 4E19A 4Q5VA 1S4FA 3KLGB 5KFWA 4XPEA 2C28A 4ZP9A 3PX4A 3KTQA 2HWHA 1S0OA 3QO9B 3SPYA 4NRUA 3VQBA 1A5XA 1LWFA 3SQ2A 3PY8A 4IRDA 3D28A 5KFBA 3FDSA 4RW6B 4FLZA 4ELVA 1RDBA 1N5YB 4ZVHA 4KV8A 3KLIB 5DMRA 4Q43A 3I0RB 1HJRA 3K5LA 3M8QA 3P1GA 4IR9A 5JUMA 2HNZA 1C1BB 3NHGA 4ZMMA 2W9BA 1NJZA 4B9VA 2VG7A 4JS4A 2GBZA 5FDLA 2YNIB 1TK5A 4QWAA 3BR9A 4FM2A 4QW9A 4K4YA 1EKEA 4J9MA 1VSMA 1IKYA 4DTRA 1TL1A 4F4XA 1VSHA 2X6SA 1RDDA 1A5WA 4DFPA 3MFHA 4RNHA 4MKAA 4O4GA 4J9KA 3AA4A 4FZYA 4DG1A 3M9MB 3HT3A 4NCAA 2W7PA 4IKFA 2OPQA 3V6DA 3QEPA 3OYIA 3QIOA 1VRTB 4ED8A 4KFBB 3SCXA 4OLAA 4ELTA 3AO4A 3H5UA 2JEGA 2R2SA 3VQAA 4DU1A 4R8UB 4K4XA 4ZVFA 3ZSWA 4ED3A 2E4LA 4FLUA 5KFFA 3K2PA 4ZVEA 2C22A 3CJ5A 3AVFA 1NKBA 1BCOA 4M3RA 1T05A 4FM1A 4ED1A 1S49A 3KHGA 4F4KA 3AO2A 2XY5A 5F8HA 4WE1B 5F8JA 4NCGA 3ZSZA 3GV8B 3M8QB 4Q8FA 2HNZB 1YVFA 1IH7A 5KFHA 2VG7B 4DLGA 5FRNA 3QGGA 3SQ1A 3MFIA 5CYQB 1HARA 5KG6A 3EPGA 3HPOA 5FDLB 3NBPB 1HPZB 3OYNA 1J53A 1S1VA 5SZTA 5DQGA 3AVIA 1IKYB 5KG0A 1TL1B 4QPXA 4ZPCA 3NMAA 1RTJA 4ZP6A 3CM6A 1GX5A 3ITHA 3JYTA 1ASWA 3UIQA 4DG1B 3U3YA 1RYRA 3MXIA 2OPQB 3V6DB 4FYDA 1WNEA 1HRHA 1NJYA 3M9NB 3QLHA 2RN2A 1D9DA 3VQ4A 1X1PA 2F8TA 3ZT2A 3NGDA 4E7JA 2IOCA 2XO7A 4DEZA 2C2EA 2VA2A 1JLAB 1BI4B 1QE1B 5KRSA 1IKVA 1JLCA 3MTKA 1S1UA 4HVJA 3QZ7A 1RT1A 1ASUA 1RT7A 4QWBA 4DQQA 4CHYA 1LWEB 2EHGA 1T05B 4CFBA 4K8ZA 4IG3A 1UA1A 1YTUA 1SL1A 4K8XA 4Z4CA 3N6MA 2BDPA 3DLGA 4I2PA 2FJXA 4CJEA 2JEFA 3QESA 4NCGB 1T7PA 1MMLA 3PW4A 2O4IA 2ZD1A 2WOMB 4MK8A 4ECQA 4AHSA 3V9XA 4DQPA 5HBMB 1N48A 2VG6A 3ZSYA 4O5BA 1Q9YA 3OYAA 1S1VB 4N56A 4YQWA 2PYJA 5HLFA 2Y1IA 3IS9A 3RR8A 3ISND 4LSLA 1S6PA 4C8LA 3DOKA 4AHVA 4CF1A 4NLSA 4URQU 4NYNA 2X78A 3S3NA 1RTJB 3BSAA 3ITHB 3QETA 1RTIA 4PQUB 2UVVA 4F2SA 4Y3CA 4MK7A 1C2PA 4MIBA 5KFEA 4F4WA 2YHAA 4LQ9A 5KFOA 3HKWA 2VA3A 4B9UA 1C0UA 3DLKB 2ZQBA 4FCYA 1B9FA 3K5MA 4CHPA 3LZJA 3N6NA 4RNNA 3UDLA 4CJUA 5I42A 5F9NA 3VQPA 4LSNA 4DFMA 1RT1B 1TV6B 4YFUA 4CF0A 2FLPA 4CEEA 5L1JA 5T7BA 2YNHA 2BQRA 3HVTB 4QW8A 4N47A 2R8KA 3OYJA 3L3UA 3HXMA 1U04A 1VSLA 2WONA 4O3QA 3V9UA 1NHVA 3HPHA 4IDKA 1C6VA 3Q8RB 3H08A 3KK2A 2BR0A 4DFKA 1RA7A 1UAXA 2ZE2A 1QTMA 2VG6B 3MEDA 4JS5A 2AGQA 3AVMA 5EUHA 4KO0B 3NAEA 4E0DA 3IS9B 2XI2A 3U6FA 2JGUA 4QWEA 4LSLB 1S6PB 4FLVA 3KK3A 1JIHA 3FQKA 3OYHA 3KOAA 4NYFA 3HVRA 3NGIA 4MKBA 3LZIA 4ECUA 4B08A 5DLGA 1XI1A 5J2QA 3OYEA 3IG1A 4OGCA 1C0UB 2HMIB 2JC1A 4GC6A 4MH8A 4N41A 1HQEA 1W25A 3OYCA 1N6QA 4CK2A 4DTPA 1DTQB 4FJKA 1HMVA 3WNFA 4CESA 4ICLB 1JLBA 4RW7A 4YR2A 5DG7A 3NH2A 3LP1A 2QV6A 4BDPA 1UWBA 4I2QA 3DRRA 1NK8A 4J2AA 1T94A 4CGIA 3O3FA 4IQXA 3BQ0A 3OJSA 1S6QA 4CIFA 4FW2A 4H8KA 1SUQA 1S0NA 1RT4B 3BJYA 4W5NA 1NK9A 2GV9A 2FBTA 1RBUA 4PY5A 3H59A 1ZBLA 4HCBA 1G15A 1BQNA 2KW4A 3KK2B 4AILC 3RB4A 2UUTA 3MEEA 3T5KA 4LY7A 2EC0A 1WSEA 4J9PA 4IR1A 4E3SA 3QZ8A 4CHQA 1OS5A 1HYSA 2WHOA 2ETJA 2FC0A 4K4WA 2R8JA 3PV8A 1HNIA 3MF5A 3KK3B 4DL4A 3MR2A 1WSGA 4M3WA 1J5OA 3RB3A 1HYZA 3HPGA 3LPTA 4JRPA 4DU4A 1S1WB 1RTHA 3IG1B 4DLEA 2ATQA 4YR3A 2ITGA 2V9WA 1HQEB 3SUOA 2IM1A 2RDJA 1HMVB 3NGZA 5KG7A 1QSYA 4GVMA 4RW7B 3P5JA 4HUEA 3HO1A 3HVAA 5KTQA 1SKRA 2IJNA 1VSKA 2P5OA 2YKMA 4RW8A 2HHTA 1FK9A 5F9LA 1UWBB 1JLGA 5KFDA 5J2NB 2ILZA 4OVLA 2V4QA 2HW3A 4J9LA 3OYLA 1TK0A 3BGRB 3QEIA 4ZVGA 1RA6A 3SUPA 3DLHA 4DSEA 3MXMA 2J6UA 2XGQA 3WNHA 4MIAA 4FK0A 3KK1A 5DGBA 4IFVA 3KLGA 2IGIA 3OS0A 4Q45A 5CY4A 3QO9A 2AX0A 5HRPA 1K1SA 5HROB 4R0EA 3SI8A 2HNYB 1EP4A 1HYSB 4K4SA 4RW6A 4NLTA 3RB6A 1EX4A 4F2RA 1U49A 3EYZA 4FJ7A 1N5YA 3TR8A 1HNIB 1RTDB 3PVXA 3M8SA 1RAJA 1JLEB 5EWGA 4FJJA 2KZMA 3V9WA 4NCBA 3TAMA 1C1BA 1XC9A 2DTUA 1CXUA 4CGJA 1NK6A 4KB0A 2CJQA 3PR5B 4I7FA 5C25B 1S1XA 3OHAA 4EZ9A 2R2TA 2E6LA 3D0PA 1I6JA 1QAJA 3QIDA 4HTUA 3NH0A 4JV2A 2FBXA 3CQ8A 1QUVA 2GIRA 4KE5A 1X9MA 1C0TB 2BRKA 2GUIA 1T8EA 4CHOA 2YKMB 3OHBA 1JLGB 4CK1A 4KHUA 2VG5B 1F21A 4I9LA 3Q8QB 1S9GB 1S1TB 3T5HA 4PA1A 5KFGA 3MR6A 2QXFA 4TLRA 1ZBUA 3VQSA 4HUGA 4GMJB 2ALZA 4IFVB 4R8UA 3RMAA 2GC8A 3CDEA 1RYSA 1KFDA 1KRPA 4ED0A 2IAJB 4CHNA 3L2UA 5KT5A 4EBCA 1EP4B 4CJLA 3LWLA 4FJHA 1YVUA 3JSMA 1I39A 4MQ3A 1NNDA 3BDPA 4C8MA 4WE1A 2V0NA 2HVHA 5CYMB 3L2VA 5F8GA 4BDYA 3TAMB 1TKTB 2GIQA 5DGAA 2YNGB 2BANB 4CJWA 5CYQA 2Q3SA 3SPZA 1NK4A 1RNHA 3NDKA 4J2BA 4RUCA 4I7FB 3NBPA 1HPZA 1S1XB 2HHUA 3VQQA 1RBTA 1CLQA 4KI4A 3NF8A 3K57A 3PW2A 2HHQA 4DTMA 4RW9B 1MU2B 4N76A 5KG3A 3VA3A 3SUNA 2A1SA 1CXQA 1D0EA 1JLFB 2G8FA 3RB0A 4EP4A 2W8KA 3WNEA 2IM2A 3Q8SB 2QKKA 3V6JA 1S48A 4DTJA 3KIOA 4CJ4A 1JKHB 2R8IA 1CZBA 3QERA 4ZHRA 3GIMA 4HKQA 4FJIA 1LW0B 1JLAA 1BI4A 3S3OA 4F4ZA 1QE1A 5J2PA 1K1QA 1ZTWA 2X74A 3OYGA 3HM9A 1KLMB 4OJRA 3AO5A 5CZ2A 1LWEA 5FROA 1RBRA 3DM2B 5DK5A 4KPYA 4KHYA 4LD0A 3DRSB 3JSMB 3GIJA 3OL6A 3CVKA 4YMEA 3AVBA 3P83D 3ZT4A 2KFNA 1LAVA 4IKAA 4CJ5A 3N6LA 4CECA 1SH0A 1D8YA 2WOMA 4FJGA 4OKJA 3RRGA 1BISA 1UA0A 5HBMA 4Y2AA 4NLVA 4KSEB 5J1EA 2W9AA 4EYIB 4G3IA 4Z4EA 3PX0A 5C24B 3U3GA 1FKOA 3KD1E 4TYAA 4E7IA 3M8PB 4RU9A 3MXJA 4I9QA 3OJUA 1VSIA 4R5PB 3H4DA 3CFRA 3KLEB 2FVCA 3G6YA 2CKWA 4PQUA 4IFYA 4CE9A 4IOBA 2VWJA 3KMSA 4CEAA 5KT3A 3C94A 4DU3A 3HJFA 4TQSA 3DLKA 1VK0A 1WN7A 1BGXT 3OYKA 3ULDA 4M3ZA 3NE6A 1YT3A 2KQ2A 3VQ5A 5KG2A 4F50A 3WNGA 2FJVA 1GOAA 4WZMA 1SV5B 4ZHRB 5KGXA 3LP0A 3OL9A 3LP2A 3HP9A 5J2PB 3TAFA 1TV6A 2JLEA 2XCAA 3CFOA 5KFQA 3OLBA 3VQDA 3RTVA 5E41A 4FW1A 3HVTA 4YP3A 3BSOA 3TAGA 1N4LA 3TI0A 4B9SA 1XR7A 3QEXA 4K4UA 1VSEA 1DLOA 3E01A 1JLQB 4H4MB 2J6SA 2UVRA 4NLYA 3M8RA 3E51A 1TKDA 2P5GA 1BIZA 4FZXC 3PJWA 5J1EB 4QCLA 1Q8IA 1QSLA 1S9EB 4KO0A 4BWMA 1SH3A 2IC3A 4PWDB 1FKOB 3PR4A 4DSKA 3TVKA 4AHUA 1JX4A 4Y1CA 3V1OA 3FQLA 3RWUA 3H4BA 3QYYA 4F8RA 4TYBA 4IH6A 5KFIA 3QEVA 4O3RA 3QEWA 1FKPA 3RMDA 3I8DA 3ZSXA 4DQRA 4IFYB 4CCHA 1KVAA 3SZ2A 3HHKA 1RT2B 1U48A 2HMIA 4KKOB 1C1AA 2XHBA 1RDCA 5KFUA 1DTQA 4QOZB 4O44B 2R7YA 4ICLA 1D1UA 2HHWA 1SH2A 1ZYQA 3GV5B 4HUFA 1ZBIA 3OL7A 3LP0B 1J9AA 2VWKA 3T3FA 3LP2B 3AV9A 3SI6A 3CJ2A 3KLVA 4CIEA 4Q0BB 1EXQA 4L8RB 1TQLA 4CK3A 1TGOA 2OH2A 2RKIB 3KNAA 4DMNA 1RT4A 3GIIA 1TP7A 1DLOB 4CEFA 3E01B 1C0MA 4DTXA 2G8UA 4DQSA 1DTTA 5K14B 3TAEA 5L9XA 2UUWA 3HYFA 2I1RA 3NFAA 4WFXA 1LW2A 3HL8A 3S3MA 1BL3A 3V1QA 4U6PA 4FJLA 1RT6B 3FSIA 2IC3B 1VSJA 1L3TA 2PY5A 4DFJA 2D3UA 4WYWA 3TARA 1A5VA 2G8IA 2RPIA 5CZ1A 3AO1A 4E1NA 4ZTJA 2A1RA 4EEYA 1FKPB 5J2MA 1QHTA 2OPSA 5F8IA 1NK0A 4FJMA 2ZKUA 1S1WA 2DPIA 5KGWA 4ED2A 3SUQA 2WRMA 3OYBA 3O4NA 4C8KA 4OGEA 2Y1JA 3EZ5A 4KHNA 1REVB 4ECVA 2UVUA 2XGPA 4J9OA 2OA8A 1BIUA 5EU7A 5JS1A 4RNFA 1WAJA 3EY1A 2HHXA 3ZSOA 4NLGA 4GW6A 3RRHA 1TVRB 5J2NA 1TL3B 4U7CA 4KHWA 4Z4IA 4KTZA 4BWJA 3GIKA 3BGRA 2XWYA 5KFJA 2XC9A 3IAYA 2ATLA 3SQ4A 3H5SA 2IA6A 3EZUA 4F4YA 2C2RA 1SL0A 2FBYA 2Z1HA 3O3HA 4FLXA 2W42A 3TWHA 3DOLB 1DTTB 2IBKA 3HK2A 3KLHB 2FJWA 2HWIA 4O3OA 1LW2B 3PO4A 5HROA 4QWCA 4FJ5A 4FZZA 2HNYA 2D0AA 4WXOA 2F8EX 1GOCA 3LAMA 3C6UA 1RTDA 2ASDA 4C8OA 1JLEA 3CYMA 3G6XA 3TABA 3ZT3A 1SKSA 5J2MB 2LSNA 4NLOA 3V6HA 2OPSB 4M95A 2E9TA 1U45A 3GILA 5SWMA 4ID5A 5C25A 5KT2A 4BE1A 4DTSA 4RW4B 3T19A 3MAQA 4IH5A 5KFMA 4PUOA 4ECTA 4ID1A 1WSFA 4KB1A 4Z0UA 3KLFB 3PHEA 4O3NA 2OZMA 3IRXA 1TKXB 2B6AA 1C0TA 4UQGA 5KFNA 1WLJA 1RBSA 4AHTA 5KFSA 1GX6A 2NUBA 5KG5A 4ZTFA 4KHRA 4FJNA 4DL5A 2VG5A 4NLQA 4O3SA 3I5CA 1S9GA 1S1TA 4WYLA 1KVCA 4ECXA 4J9RA 1HNVA 3H5YA 4CIGA 4CF2A 3QIPB 3ZT0A 3CJ3A 4AHRA 3MECB 1N56A 3V9ZA 2OPPA 2IAJA 4EZ6A 4M41A 5KT7A 1IG9A 4Z4FA 2B43A 4OLBA 4DS5A 4NRTA 1JXEA 4F3OA 3F73A 1IM4A 4Y1DA 5KFYA 3I0SB 4Z4HA 3C6UB 5KFVA 3QINA 4NZ0A 1I3AA 2RF2A 4Y34A 5HRNA 4BE0A 5CYMA 2XRIA 3H40A 3KHHA 5C5JA 1XR6A 1TKTA 4FS2A 3Q8PB 5KFRA 2YNGA 1QAIA 4ECRA 4E1MA 1L3VA 2BANA 1LAWA 4HYKA 4K4VA 4ID5B 4TY9A 2IDOA 3G86A 3DYAB 1W0HA 5KFXA 4PUOB 3AVAA 3TAPA 4KAIA 4RW9A 5HP1B 3IRXB 4Z4GA 1LWCA 1MU2A 1RT5B 3RBEA 3KJVA 4CF8A 2B6AB 1L3SA 2FVPA 4WXWA 3AVGA 2BRLA 3K59A 4EP5A 2D0BA 4B9LA 3DLRA 1JLFA 1XHZA 5F8LA 2R8GA 1ZTTA 1JXLA 3PO5A 4LH4A 3UPFA 3TAQA 1JL2A 2YNFB 3V6KA 3AO3A 2JEIA 3ZSRA 4WZQA 3VN5A 1HNVB 1JKHA 3AVJA 4CEQA 3H5XA 3NGYA 2V4RA 3NAHA 1NK7A 4ZP7A 2EX3A 4EO6A 3HVWA 4TN2A 3VQEA 5KFCA 1LW0A 1X9SA 3GYNA 4W5QA 2PYLA 4M45A 1KLMA 2OPPB 2WB4A 3RBDA 4FK4A 3NL0A 3VQ6A 1Z26A 1KSPA 3DM2A 3TQ1A 4MFBA 4B3OA 2B5JB 1KFSA 1WSIA 3DRSA 2O4GA 3CWJA 2F96A 3L2QA 4DL6A 1XWLA 1B9DA 3B6OA 2BQ3A 2RF2B 1HQUA 3CFPA 3OYFA 1EETA 2XI3A 3OSPA 2IM0A 5C42B 3DLBA 2KTQA 4O0IA 2FLNA 4CJSA 4E7HA 4FLWA 3DI6A 1D5AA 3V1RA 4M94A 3RAXA 3M9OB 5C24A 2WTFA 3NF6A 3ZSQA 4DWIA 4FVMA 3M8PA 3KMQA 4W5TA 4R5PA 4DSIA 1NKCA 4W5OA 3KLEA 4FLTA 1LWCB 1XR5A 4NLPA 1KTQA 3KJVB 3DLEB 1RDAA 1NJXA 5KG4A 4B8CA 2I5JA 5EDWA 4DQIA 1S5JA 3FRZA 4ECSA 1TKZB 3LWMA 3UQSA 1BQMA 3OY9A 3DRPB 4G1QA 4TXSA 5KG1A 1Y97A 4OPJA 2Z1IA 2C2DA 5FRMA 5DLFA 1TAQA 2HVIA 4KHSA 3RAQA 1TAUA 3AVCA 1SV5A 5JS2A 5KFPA 2HAIA 3CDUA 1R0AB 2HNDA 2FVSA 1Q9XA 2E6MA 4JLHA 3LDSA 1IKXB 1RCHA 4KREA 4MFBB 4B3OB 3FFIB 5DQHA 5I3UA 3RR7A 1O1WA 4KI6A 3LAKA 2JEJA 2DY4A 2D7SA 5HRSA 4NLDA 1HQUB 1UOCA 2IM3A 4NLXA 3MEGA 1EETB 1JLQA 3L3VA 5JXSA 4DL7A 3PJXA 2IJFA 2E9RX 3ZCMA 4H4MA 1LWFB 3HP6A 3DI6B 1S10A 3OVNA 4CERA 1S9EA 4ECYA 4PWDA 4ED6A 4CHZA 4KV8B 5F8NA 3KHRA 3V9SA 4NLWA 4M3UA 2W9BB 4FBUA 2AX1A 3GV7B 2UVWA 4DTNA 4J2DA 2IMWP 2R8HA 3O3GA 2I5JB 4Y2CA 4CJTA 4KAZA 1BQMB 3SNNA 4G1QB 1RT2A 4CFAA 3VQ9A 3S9HA 4KKOA 1D9FA 5EWEA 2W9CA 2QE5A 4KTQA 4M42A 4IBNA 4KTWA 4DF4A 4CEOA 3VQ8A 4O44A 1SL2A 4B9NA 4CJPA 4O4GB 4KHQA 2FVRA 3A2FA 2D5RA 2HNDB 3G10A 1KLNA 3GQCA 4OKEA 3OS1A 4J2EA 2AGOA 4URGA 3BSNA 4Q0BA 2W8LA 4OKKA 3MR5A 2G8KA 3ALYA 1ZBFA 2RKIA 4FS1A 1VRUA 2DFFA 3MR3A 5I3UB 5KT4A 4F3TA 4Q44A 3G6VA 3MEGB 3IN5A 1FXXA 5K14A 4FM0A 3AVNA 1NOZA 5L1KA 2AGPA 4DSJA 3B6PA 3QGHA 2G8VA 3AA2A 3NCIA 2BE2A 1RT6A 3PZPA 2XY8A 2F8SA 4GC7A 4X2BA 2HHVA 1NKEA 1S97A 4WFZA 4LH5A 4EO8A 1JL1A 3K58A 5KFTA 3AVLA 1C1CA 2X6NA 4B8AB 4AHCA 4E7KA 1NJWA 5T14A 1IKWA 4M3XA 4JUZA 3T5LA 4XO0A 4Q8EA 4XPCA 2OPRA 1QSSA 3VQCA 3KHLA 1WSJA 1Z4UA 4FBTA 2W9CB 4ZPDA 3OYDA 4FJXA 1L5UA 4YNQA 4DF8A 3OLAA 2RDIA 3BREA 1REVA 4FXDA 2AU0A 4QWDA 1T03A 3BSCA 4MK9A 4DS4A 3V81A 4DTOA 3ZSVA 3JYTB 3D5MA 3LANA 1KCFA 5KFLA 3L2RA 2Z1GA 4O3PA 2KZZA 2E9ZA 3NF9A 4IRCA 1TVRA 3AVHA 1TL3A 3QLHB 4WFYA 2WCXA 2YKNA 4KHMA 3LALA 3SV3A 5KFZA 4RG8A 3NAIA 1VRUB 2B4JA 4RNMA 1NK5A 2AJQA 1YTAA 4CFCA 1NOYA 4O0JA 4EBDA 4CJVA 3DMJA 3KKRA 1IKVB 1JLCB 3VA0A 3LP3A 1S1UB 1RT7B 3DOLA 4K50A 5HRRA 1XHXA 4CJKA 3CM5A 3KLHA 3RMBA 4IG3B 1U09A 2BE2B 3DLGB 4I2PB 1X9WA 3PX6A 1RBVA 4O4RA 3PW0A 4FK2A 3H98A 5KT6A 2ZD1B 3F9KA 3LPUA 4JV0A 4JV1A 3D45A 1C1CB 1S0MA 2XCPA 4J9QA 1QS4A 4CEDA 1U4BA 1IKWB 3AVKA 4ECZA 3UR0A 2OPRB 1TK8A 2BGGA 4H4OA 5KI6A 3ISNC 5HLFB 3QGIA 4RZRA 5KFKA 4KRFA 4RW4A 3DOKB 4K4TA 5DG8A 1KHVA 1T03B 3V81B 3KLFA 2D3ZA 1RTIB 1TKXA 2ILYA 3SQ0A 1B92A 1BHLA 4CGHA 3V4IA 3CJ4A 4TSXA 1WSHA 1LV5A 4FJ8A 1BCMA 4TY8A 3C6TA 5DQIA 1SKWA 4RUAA 2AQ4A 4CJRA 2YKNB 4DSLA 3THVA 3KD5E 3NF7A 5I42B 3ICLA 4IRKA 5F8MA 2QKBA 4ZPBA 3ASMA 4LSNB 3DMJB 3QIPA 4ECWA 3NKYA 1W9HA 4CGFA 2FLLA 4C8NA 1VSDA 3MECA 1KVBA 3L2WA 3CDWA 2PZSA 2P51A 2Z1JA 2YNHB 2D0CA 2DPJA 3O4QA 1U47A 3H2LA 3SYZA 5L1LA 2WONB 4AH9A 4ELUA 2P1JA 3ZT1A 4DTUA 3I0SA 1RILA 1ZBHA 4H54A 2WK4A 4IDKB 4NLUA 2BQUA 4W5RA 4DSFA 4N5SA 3G0ZA 3PW5A 4CGGA 2QK9A 4BDZA 2ZE2B 4ZPAA 5EWFA 2DFHA 5L1IA 3MEDB 4CEZA 3TANA 4CGDA 4NYZA 4E89A 4CF9A 4BACA 1KHWA 4H4OB 4CJQA 2HB5A 3DYAA 3I5BA 2XY6A 3T5JA 1NHUA 4J9SA 3L8BA 2YV0X 4K4ZA 4JRQA 3CIZA 4B9TA 3PW7A 4M3YA 3OYMA 5D3GA 5HP1A 1RT5A 4IG0A 4RNOA 2J6TA 2HHSA 3HSTB 3V4IB 5KRTA
chains in the Genus database with same CATH superfamily
5J2QB 1BY9A 2JWNA 1KAZA 3O8WA 4TY8B 3C6TB 4URSA 1N6QB 1YTYA 4GKKJ 1RAEB 4OX7A 4JHDA 3SQOP 1MWQA 3CCUS 4H0PA 4YR0A 4G1IA 1RAHB 5IM0B 3X3UA 3ZFVA 3AGRA 1VQYA 2FJAB 4C3LA 1RABB 4WFNL 4H4KA 3IO1A 2DIUA 2R7OA 4CH7A 1SAZA 2NPFA 1XC3A 3QNNA 1BQNB 3SV4A 1XNRJ 4PZVA 1IO2A 2BV3A 1VHXA 4XIUA 1NGCA 3MEEB 1FDBA 1SKUB 2K8GA 4A2AA 3N0VA 3M2RB 1J54A 4U96A 1S59A 1FW6A 2C2MB 2R2RA 3QNOA 4O55A 4KB7A 1VQ5N 1WBBA 2DISA 2G0JA 1R8HA 3EXCX 2RAQA 3SJJA 4IG0B 2R7TA 2FHKA 3KG0A 2YNIA 5IT9Y 4PXCA 3SFGA 1VQNS 3IGVA 3CG7A 4CJFA 3AA3A 5AQZA 4ZP8A 5K8PA 1H3DA 5C0YA 3AA5X 4EFAC 3SK3A 1HBOA 4B1WB 1F5BA 4YDXA 2FVQA 1ASVA 2ZITA 3IBWA 3JS9A 1FEEA 1HBMB 2MJNA 4FLYA 2A41A 4KFBA 4ZVUB 5A8RB 2YX4A 5BYQA 2UUCJ 3MMBA 2B56A 3NH1A 1RT3B 3MM5A 2WSEC 1N33J 2N3LA 2HWHA 1S0OA 4F9OA 5E5NA 4NRUA 3SPYA 3MI7X 1ILYA 2BMBA 5AZIB 4UZCA 4JB8B 4A8SA 3N9UC 4BLGA 3D7EO 2NXUA 2UUAK 2QL9B 5IOLA 2XZWA 3I31A 3KLIB 5DMRA 3I0RB 1DKGD 2EPIA 3M8QA 1C1BB 4ZMMA 4UY8O 3HHEA 3ZZZA 2VG7A 4FXVA 1TK5A 4OPAA 1F60B 3QSIA 4QWAA 4FM2A 4QW9A 2B0GA 2MDAA 4QR1A 4JI3J 2PFUA 1VSMA 1EKEA 2BJ1A 1SVDA 1VSHA 3EL2A 1A5WA 3MFHA 4O4GA 2FJBB 5ETMA 4DG1A 4FZYA 5G0RB 5AE2A 3HT3A 3CCSN 2OPQA 4JKGA 3O1BA 3QIOA 2UUBK 5FPMA 2VWBA 3NP5A 4OYPA 2P9PB 1U8WA 4P74A 4EUVA 3WBZA 3VAMA 1PYOB 2CAJA 3K2PA 1FDNA 1BCOA 2MZRA 4FM1A 2PBDA 1R8CA 1S49A 1FNOA 4ED1A 3KHGA 4C98A 2NRHA 2AMCB 4F4KA 3L4QA 3AO2A 1EKRA 4QU6A 2HQFA 1VCTA 2H65B 1SBRA 2HF3A 2ACYA 4WTYA 5ADXA 1KEKA 2OGUA 3QGGA 5CYQB 1HARA 1VQSA 3NBPB 1S1VA 2JX2A 2HFOA 3UE2A 2VGMA 2J9DA 1TL1B 3ZC4A 4ZPCA 4NZ6A 1M90T 3A4TA 3U4LA 1ASWA 3T1YJ 2VDIA 4ZA1A 4E1JA 1T9TA 3V6DB 4WIQA 4JEPA 1HRHA 1NJYA 3M9NB 1D9DA 3VQ4A 4FWLA 3PM9A 1UEUA 4RKUC 2P9IA 3ILOA 2XO7A 2C2EA 2MLXA 3WX4A 1Y9OA 3MTKA 1FE4A 3QZ7A 3ZXWA 3ISZA 4IJNA 1YTUA 1SL1A 2KXFA 4OZLA 1IBKK 1TUVA 4FYYB 2BDPA 2GUPA 4ETXA 5AQNA 4I2PA 2JEFA 2NUUG 4DV5F 2JJ4D 2G9OA 3L4IA 4MK8A 4NXNJ 3V9XA 2CDQA 4DQPA 2HIYA 2ZH6A 5A8WA 5ADXH 4CW7B 4L73A 2XWXA 1O5JA 1BU6O 4N56A 4K8RA 4IOAL 2PYJA 5EVZA 3RYLA 5HLFA 5IQQA 2JSXA 4X65F 3BN7A 2O66A 1CULA 1K8KA 3R1XA 3M4XA 4C8LA 4Z2XA 4AHVA 4CF1A 3RVCA 2FTRA 4FZVA 3MX2A 1RTJB 3MPYA 4IOAQ 4OJ1A 2W1BA 3QETA 2CQ2A 3PSIA 4B3RF 4OLPA 3FCWA 4PQUB 2DGSA 5KPRA 2JRSA 4LFCJ 1WTFA 2KKHA 4MIBA 1XNQJ 3UKUA 1C0UA 1ZOTA 2NSBA 2QXLA 2J9CA 3AXMA 4WP3A 3VF6A 1ZM4A 4FPRA 4P52A 4AUKA 1NBEB 4CJUA 3KG4A 4AE5A 4LSNA 2HFUA 1J5EJ 1R8BA 5AT1B 5K8OA 1HPMA 4OV6A 3JAMO 4CLKA 2V94A 2YNHA 2BQRA 2FGOA 2JFKA 2R8KA 1VSLA 4IEEA 2WONA 4BGAA 2HVZA 3A8JA 1SIWB 3GOIA 2XG8A 3JSRA 4O3QA 3V9UA 4DX8H 3KUGA 4IDKA 2NRZA 3OTOK 3R1LA 3KK2A 2BR0A 1RA7A 3MOJB 2R7XA 3FKBA 2VG6B 3CJ7A 2IRUA 2AGQA 3AVMA 3NAEA 2GVDB 1S6PB 3OVSA 3KK3A 1T9YA 4GVEA 3FQKA 3OYHA 2DPNA 3MPUB 3EGZA 3AT1B 1SJ4P 2CPFA 5K8NA 4B08A 1NLKL 2QEXS 1XI1A 3OYEA 3IG1A 2B4PA 4BR2A 2GVZB 3M32B 4GC6A 4OHXA 2DCLA 1W25A 4FJKA 1HMVA 4ICLB 4H0OA 4KH6A 4N77A 4RWWA 3OHRA 2MLZA 1FT8A 3BZKA 2QV6A 4NA1A 4BDPA 5AQRA 4AM7A 4XH1A 1T94A 4CGIA 4IQXA 1H6KX 3OJSA 1S6QA 4Y65A 3MN6A 1SUQA 1YZ6A 1RT4B 2CQIA 3BJYA 3ZNJ1 1NDLA 4PY5A 2LQBA 5IZHA 1ZBLA 3CTRA 3G6EN 1VJWA 4OYAA 5AQUA 2KW4A 3HRGA 2CPIA 4AILC 4KC5A 1WG1A 1WSEA 1FO1A 3FC9A 1WKJA 3PTWA 1HJOA 4ISEA 2ETJA 1EAYC 2LXFA 2FC0A 4K4WA 4W90B 3PV8A 3EVOA 1Y0HA 3MF5A 3FEZA 3MDFA 3W2WB 3MR2A 1WSGA 4M3WA 1YIJN 3FVYA 3M05A 2V63A 6AT1B 1VQ7N 2WB1D 3DKDA 1WF0A 1RTHA 1KD1O 4DLEA 3VENA 5D15A 4FWSA 1JCGA 2QSFA 3GFXA 4AL7A 2RDJA 1FX2A 4ILJA 4C0OC 4GVMA 4M7YA 2HQGA 1BDGA 1I94F 2UXCK 2XNQA 3CPWR 4JK9A 1IBLJ 1VSKA 5L39A 2YKMA 2HHTA 3OVAA 2DNOA 2FHOB 2ILZA 1NGAA 4OVLA 3ZZUA 4J9LA 4AFFA 1TK0A 1KR4A 4CLTA 5HVFA 2AIRB 3QFUA 4CI0B 3DLHA 2E8AA 5GAEP 3VESA 2XGQA 3WNHA 4FK0A 4U7BA 4DR4J 2ZHAA 3QT7A 3TUJC 2HRUA 4Q45A 2HAFA 2AX0A 3CD5A 5HRPA 2D4WA 1P8GA 4R0EA 1PAUB 1EP4A 3IA0A 1O13A 3QDKA 2ZC3A 4CBUA 4NLTA 1EX4A 2AYBA 1RWPB 1U49A 2W6LA 4B17A 2C3UA 3TR8A 1UWAA 2U2FA 4FN5A 4YY3J 2ZBIA 3CCMN 3M8SA 1RAJA 2O8DA 4NCBA 3N5BA 2O8CB 1VRQC 1XC9A 4A2BA 5AFUA 3R97A 2Q66A 5M1OA 4A59A 1N88A 1OH5A 1PAEX 3PR5B 2B3TB 5LMUJ 1S1XA 5FPDA 1KN6A 2R2TA 2P9NA 1RWXB 1I6JA 1F9HA 4F0MA 2GJ2A 4HTUA 3NH0A 4H0YB 2F9WA 1KC8O 3UVJB 3RG6A 1VGYA 1T8EA 4CHOA 2CYYA 2XZTB 4BRLA 3OHBA 4HACA 2F8MA 1GQEA 1KNZA 4WFAL 3Q8QB 4OYIA 2D3OR 3QWUA 3C8YA 4PA1A 5KFGA 5LMNK 2XSJB 2EW9A 4GMJB 4WFAQ 2V8HA 1O51A 1KDNA 4R8UA 3RMAA 2GC8A 1BO5O 1S72S 3H25A 5EXWA 1KVJA 1YVNA 3CW2C 4CHNA 5KT5A 2Z0GA 2HBLA 1AT1B 3JSMA 1YVUA 3BDPA 5B0BA 1BUXA 1CC8A 1U7LA 1GLLO 3BO3A 5D8HB 2HBJA 4K0KK 3MCAB 1N36J 3TAMB 1BUPA 1X0FA 4O23A 5DGAA 4YOWA 2YNGB 1ZAXA 2W24A 2X7IA 3ENWA 2Q3SA 1NK4A 3AFGA 1RNHA 3SPZA 1FCAA 4RUCA 1AUDA 3GWCA 5AQGA 3JXOA 1XNRF 4A62A 2Q6BA 1Z1ZA 2HQ3A 3NF8A 4U95A 1IR1A 3G4SN 1Y00A 1X4DA 1ROFA 3GTYX 3MUTP 3MM6A 1MWMA 1JLFB 4EP4A 4HT7A 2KXHA 3MMVA 1E6YB 1JKHB 2R8IA 4GVBA 3VV2B 3D3CJ 4JV5K 4H5VA 3CJ9A 1JLAA 1BI4A 3NGTA 3M2VB 1QE1A 3OYGA 4OJRA 4BR9A 5IT9O 2HBQB 3VVUA 2CNKB 3DRSB 4LBPA 5B08A 3RRKA 2ERRA 3AVBA 3ZT4A 3R5CA 4IKAA 4MYTA 4BROA 4OJGA 1SH0A 2VPXB 2WOMA 4OKJA 2IHR1 5HO4A 2CFXA 2UUCF 2GZOA 3H1VX 1WSRA 4WK3A 3PX0A 2RE2A 1N33F 2AJ1A 1U0HB 4B3MK 4TYAA 3D66A 4E7IA 2QM1A 3PACA 1M1KO 1VSIA 3R9PA 1M5PC 1X60A 4J8FA 3QWPA 2C2NA 1Q7YT 1RLCL 2CKWA 1U8SA 2W7AA 4CDIA 3DCAA 3SAGA 4IYQA 2VWJA 3RUBL 3C94A 1HHTP 4DU3A 3DLKA 1VK0A 1HWKA 3WXIA 2EVZA 2GWKA 4MKVA 3WNGA 1MN7A 4ZHRB 1JK9B 3LP0A 2KM8B 2GFFA 4JI3F 2QIFA 3SSSA 1FFGB 4FWKA 3PNIA 3HCXA 2ZH5A 5KFQA 3H46O 3OLBA 1HIYA 3ENBA 4FW1A 5DDRC 2F3JA 4ES3A 2L41A 3IUCA 3HHLB 2H4YB 1VSEA 2YWKA 2VUGA 2MQLA 1W2BR 3EJMA 2X1FA 1JNRB 2MY8A 3E51A 3J7ZO 1K0TA 4FZXC 5J1EB 4QCLA 4A8XA 4K41A 1VQ4N 2A6AA 4BWMA 3WC2A 1JX4A 4BRDA 3RWUA 3H4BA 4KHPK 4X62K 3QJPA 3LA0A 4F8RA 4TYBA 4LRAA 1GXLA 1S79A 2CJBA 3QEWA 1NGHA 3RMDA 2LU2A 4IFYB 3FZBA 3ZETB 5A2QY 1F3VA 4OI3A 4I64A 2XHBA 5CABA 3UN5A 5ITHA 4KBOA 3CMAN 1RDCA 3NS5A 5KFUA 1DTQA 4BC7A 2MSTA 1QVGM 1D1UA 4PYAA 2O8BA 1SH2A 4WP8A 1ZYQA 3I4PA 4HUFA 2O1PA 2G2OA 4FNIA 3VGSA 1CBKA 4CIEA 3D2FB 3HSJA 1EXQA 1H2UX 1TGOA 2M52A 5HVHA 4JNEA 4ZJQA 3KNAA 4DMNA 3T1YF 4Y2KA 3AQPA 4LT6A 4CZFA 2L9WA 2B7CB 4LF8K 1TR0A 1KQKA 4CBWA 4CLSA 4UOCA 2N3OA 3TAEA 5L9XA 4ATNA 2K1RB 4U6PA 5C12A 5CCMA 3SMSA 3FSIA 2QWOA 2IC3B 1W97L 1VSJA 3IP0A 3L09A 2D0PA 4DFJA 3TARA 4G6VB 3NLCA 1VBXA 4NXMJ 5CZ1A 4ZTJA 4L3NA 4PKIA 1TL4A 2OPSA 2LQJA 1DJ0A 2E7XA 5B0CA 3VCDA 2DPIA 4LFBJ 3AY0A 2M5YA 1P8ZA 2G1HA 2E1RA 4JI6J 4OGEA 2Y1JA 2EFGA 4NXNF 2ZVSA 4NEZA 2XGPA 4XK8C 3TZYA 1QY7A 1AA1B 5E3QA 2ZFHA 3CI5A 4FOEA 4ZKAA 2HHXA 3K7RA 3TW0A 3I82A 1WEYA 3RRHA 1TL3B 4U7CA 1T0TV 4KTZA 1NM1A 2CZ4A 1NDKA 2BXJA 1CQMA 4CLFA 3MPWA 4LFCF 3IWNC 1WTBA 3OA9A 4F4YA 2C2RA 2ZOGA 2CH6A 1XNQF 1DFDA 4DCPB 4GKJK 2Z1HA 3O3HA 3C6HA 9RUBA 3TWHA 1C4AA 2MPUA 2GCFA 1WC4A 1M5HA 3HK2A 5HOOA 4RR5A 1FJEB 5BPNA 3SAHA 1LW2B 3CJRA 3D2WA 3H8YA 3OTOJ 5HROA 4FJ5A 1QZ6A 1V3SA 2HNYA 2D0AA 1U1RA 1J5EF 4OZ1A 4WXOA 2NLWA 4C8ZA 3LDLA 5CHCB 1LKZA 3QFWA 1RTDA 3A8KA 2ASDA 4C8OA 1MROB 1JLEA 2RDDA 3G6XA 3ZT3A 1U1QA 4YDUC 1S22A 1SCJB 4USJC 4XTTA 2X1GA 1WWHA 3CETA 3TUIC 4M7XA 3L0QA 5KT2A 1ULRA 2OEJA 3LGHA 4BE1A 4FPAA 3HFKA 2QWMA 4ECTA 3UE5A 2ROEA 1DQAA 2VC0A 3TWZA 3IRXA 1NDPA 3TVZA 2XBPA 5U47A 1C0TA 4UQGA 5KFNA 5KFSA 2HKEA 3O9QA 4P2FA 3G96A 4BS2A 1S9GA 4ECXA 5ETNA 1H7WA 4CIGA 3E9PA 4NYOA 1QUPA 5E26A 4ILMA 1NU0A 1N56A 2YTCA 1YRUA 2LQ9A 3THTA 2YQ0A 5E3CA 4M41A 2I2YA 2MQPA 4Z4FA 3BPSP 2B43A 5HAOA 3L7PA 4OLBA 4NRTA 1JXEA 1H74A 1YJ7A 1I51B 3SLCA 3C6UB 3GJSB 4P9SA 3QINA 2CWKA 2RF2A 5CYMA 2XRIA 4ZS6A 2FY1A 5BR8K 1RISA 4M1KA 4JI7J 3ADAC 2P9LB 3PRVA 1T3OA 4E1MA 2RJZA 2ZBQA 4ID5B 2L9NA 2IDOA 2YCHA 3DYAB 1MNEA 1G6BA 3AAWB 1R8PA 4PUOB 1UMJA 3TAPA 4KAIA 3BUZB 5HP1B 1MU2A 1L3SA 4HI2A 4EP5A 3Q7BA 3W8GA 2D0BA 4B9LA 1YGYA 3CMES 1ZTTA 3V6KA 1D9AA 4JHDB 3VN5A 1GLEG 3H5XA 3NGYA 1NK7A 1RWMB 1GLFO 5KFCA 1X9SA 3GYNA 2PYLA 3EICA 1DEJA 1PJ6A 3BKFA 3FK4A 3MUMP 2AW0A 3M1VA 1KLMA 2OPPB 2LCWA 2D9PA 3TQ1A 4MFBA 4B3OA 1IBLF 2E29A 3VGMA 1NEEA 5IT4A 1S99A 3L2QA 1G7CB 3SDEB 1VFJA 3B6OA 2V4JA 3OSPA 5H1SV 3UDVA 2IDEA 4A5AA 4W98A 2KTQA 4YDUA 1IWGA 4DR4F 3DI6A 1D5AA 1OVQA 3RAXA 4Y00A 5C24A 2WTFA 3FBBA 1CPZA 3NF6A 2OSRA 4W5TA 1R89A 4R5PA 3S7RA 2E66A 1NKCA 3HHNB 4FLTA 2HGMA 1LWCB 1XR5A 4NLPA 4FSVA 3NEKA 2CZVC 4B8CA 4DQIA 4C11A 4ZVOB 3FRZA 4ZIVA 2HS0A 4YY3F 3LWMA 2IVNA 1XBWA 5KG1A 1IUJA 1VQ6N 2DGTA 1FWPA 3RAQA 4WU2A 1SV5A 3HOTA 5LMUF 5IT0A 5KFPA 1ZBTA 4PKDB 4FF2A 1Q9XA 2E6MA 4JLHA 1GTHA 2PI4A 2X1AA 4ZN1A 3JTOA 4JI2K 5AR0A 5CCLA 1M5KC 3TSQA 1QTNB 3LAKA 2JEJA 4B1VA 1HQUB 3SCIE 4QBUA 3KYLA 4H4MA 3HP6A 4OI0A 4KQZA 2IYIA 3IM9A 4CERA 4PWDA 2BJ7A 5F8NA 2YKQA 3EZWA 1AYEA 3R6GB 2V8GA 2UVWA 5HL7L 1Q8LA 3O3GA 4PHTX 2I5JB 4KAZA 1BQMB 5J1NA 4G1QB 4ZVTB 3VQ9A 4KKOA 5HL7Q 1N36F 1ZPVA 3EEQA 3QATA 4O4GB 1WACA 3QBXA 3P6YC 3AA8A 2HNDB 3G10A 1S3XA 4C7QA 1HNWK 1CS4A 1KLNA 3OTDA 3GQCA 4JKGB 2B9EA 4OKEA 4PCQA 4J2EA 2AGOA 4QYZJ 3K2YA 3RSEA 4OKKA 3MR5A 1RHMB 2BABA 1YJRA 3B78A 5I4MA 1K0VA 3UB5A 3SMZA 1S57A 4KR0B 3VGTA 1G99A 2HZCA 3I56N 3CCTA 4DN0A 1F6TA 3MEGB 3O08A 2YQ3A 1PYTA 5G4DA 4ZDNA 3AVNA 1SI9A 5F0XA 2IY5B 4DSJA 2G8VA 3AA2A 1NSQA 3ONQA 1RT6A 1AZSA 3THPA 3PZPA 1RHQB 4GC7A 2HHVA 1FVSA 1NKEA 1NSAA 1TFWA 2JZ5A 4CTAA 4EO8A 1JL1A 4IEIA 3AAQA 5KFTA 4F0KA 4B3MJ 4K7QA 3P96A 3SMPA 5T14A 1IKWA 4M3XA 1QSSA 2HVDA 1VK8A 4O5FA 2POKA 1B99A 3E3XA 3WDOA 8RUCA 2DEIA 5HJXA 3KJFB 4ZPDA 4YNQA 4DF8A 3OLAA 1L3KA 3BREA 1T03A 3V81A 3GG1A 3ZSVA 1TMMA 1Y10A 3ZTPA 5KFLA 3MCSA 1YI2S 3W64A 2E9ZA 3NF9A 4CO4A 4WFYA 2DNRA 1RWKB 3G87A 3LALA 3SV3A 3J81U 1VRUB 2B4JA 1NK5A 4LF5K 4HI1A 1OQ6A 4CJVA 3DMJA 3U8XA 3RW6A 3KKRA 4RWXA 1U1KA 2KH9A 4PRFA 4V19X 3JSYA 1TL7B 3CM5A 2G2YA 3QSYB 4A4JA 4CIOA 3ZZ0A 4YOVA 4DPYA 4B1UB 4GV9A 3J7YI 4I2PB 3ZEUB 3W9JA 1VR6A 4JKEA 4ANDA 1C1CB 3MWBA 1QS4A 4KHPJ 1U4BA 2LDYA 3N79A 4X62J 5A8WB 2OPRB 4HT5A 1TK8A 4H4OA 2I6WA 3AOBA 2DRBA 1AXQA 5HLFB 3KG1A 4RZRA 3H2UB 4RW4A 2YJEA 1DURA 5E7OB 3O9RA 5DG8A 5AXLA 2C42A 1JJ2M 3SQ0A 1BHLA 5F3TA 2FD2A 2LQ5A 1WSHA 2CQ3A 4TY8A 3C6TA 4E2FB 3VR1A 1SKWA 4RUAA 3PLAA 4TLQA 2E2PA 4CJRA 1VI7A 3SCKE 3NF7A 2F9TA 1GK8A 5DRKA 1X4FA 4CO2A 4ZPBA 5H9FK 4LSNB 4QIWD 4WFBL 2QX0A 1LFPA 5IM0A 4C8NA 2FLLA 1VSDA 3ILLA 3MECA 2VODA 3J7YU 2PZSA 4WBFA 2P51A 2Z1JA 4WFBQ 2YNHB 3IXQA 1VIXA 1VYAA 3FFKB 5A2QO 1X4BA 1TMJA 1GLDG 2WONB 3GJRB 3HZEA 1S7IA 4FWPA 3UWTA 4UTGA 4H54A 2ADCA 4USMA 4IDKB 4DSFA 3MM8B 2O8EA 2CNOB 2RT3A 1QVFR 4ZVQB 1VDHA 4OV1A 2ZWPA 1KONA 3ZTQA 5EWFA 3TO8A 3N4PA 2W4DA 3TANA 1LCUA 1KAYA 1DARA 4X4TA 5SUHA 1RHRB 4TU9A 3TX8A 4CJQA 5JLFA 2HB5A 3EO3A 3I5BA 4MMOA 4K4ZA 3NCPA 3OYMA 2EFQA 2QFIA 4IG0A 5KRTA 1GXUA 3QFPA 1VSFA 1FJ7A 1XEZA 3TP2A 4CJ3A 4NXMF 3MOZA 1X5SA 2FBVA 2E20A 2YNFA 1CJUB 5M1NA 1XIQA 4E8UA 2KU7A 4LFBF 1WAFA 2F4VJ 3BQ1A 1K6YA 2R9LA 3POTA 7FD1A 4JI6F 5GAEI 1HBMA 1RWUA 2M2BA 4DL2A 1S6QB 2YHBA 4GKJJ 2D74B 2RSQA 4ZVRB 1SUQB 5LOQA 1YQHA 4B9MA 4LR7A 2MZSA 2RS2A 1RT3A 1WF1A 4DUZF 4NLRA 2DNZA 4EYHB 2EK1A 5C42A 4CFDA 4OMFG 3K5NA 1MMNA 2H54B 1HR0J 5C2CA 2GX9A 3ENOA 3U02A 4F3QA 1KXPA 3KLIA 5BR9A 4AXIA 2OYQA 3M8ZA 3QNWB 2PI5A 3I0RA 2KKZA 3D1OA 1R0CB 3OTOF 4S0MA 5D3GB 2OFGX 3CO9A 5DG9A 2ROGA 2W2NP 2ASJA 3OS2A 3T1AA 1CZ9A 1HWIA 4X64K 5BREA 1RTHB 5IFMA 2DFEA 3I5AA 2IJRA 2LFVA 2HZAA 1MG7A 3CCES 2J0WA 2NLXA 2DY1A 1P1TA 4DV4K 3CGIA 2P9SB 5GAEU 2YWWA 1HHSA 3R5AA 3PUFA 2G8WA 5AE3A 4HHTA 1O8BA 2D41A 3IBCB 4Q7AA 1M0SA 3LW5C 3QMLA 3ELHA 4M5KA 2RVJA 3CJ0A 3CC2S 1JXBA 3C66A 3DDKA 2P9PA 4NO7A 4EFHA 4DV5K 1S4FA 4XPEA 2XMJA 1T9VA 2C28A 4H5WA 4ZP9A 2XMAA 4XDCA 4TU7A 4AF1A 3VQBA 1A5XA 1LWFA 3P49B 1RCXB 4ELVA 4X65K 2EWHA 4CM2A 2AYEA 3AGKA 1HJRA 3K5LA 1CQNA 3NHGA 2CPYA 4FPBA 4JN4A 2W9BA 1ATRA 1UVLA 4OI6A 2K7JA 2QLFB 2GBZA 4OZJA 3DLLL 1GTEA 3D0GE 4DPWA 1S7HA 4OYWA 5FLXO 1REGX 3R7SB 1LXNA 3H3OB 2MKCA 1TL1A 3DLLQ 4JI7F 4UOHA 4V19J 1RXOB 3EM1A 4IKFA 1FHTA 3V6DA 2R4FA 5E84A 3QEPA 2QA4N 1VRTB 4MLHA 4FL9A 2MKIA 4BC5A 2Q3PA 4YS2A 4ELTA 2GS8A 3X1LB 2R2SA 5FD1A 4R8UB 3I55N 2QC3A 4ZVFA 2H4WB 3AVFA 1B7YB 3AQOA 3BGOP 5GMKa 2XY5A 1H73A 5F8JA 3GONA 3GV8B 2IYGA 2HNZB 5H1SQ 1IH7A 1M90O 3VVTA 2UXDK 3A5MC 2OIHA 4DLGA 4IXCA 5AQXA 3ZTSA 3EGWB 5KG6A 4C3KA 3OYNA 1Q95G 5M2PA 4K5RA 5SZTA 5DQGA 3Q0AA 5ETQA 2DNLA 3ETOA 1IKYB 4QPXA 2NPIA 2XMTA 1RTJA 4ZP6A 5CYJA 2A3JA 2QWLA 3TEGA 3U3YA 2FGCA 3MM6B 2HHHJ 2QTDA 2O67A 2DD8S 1KOHA 1WNEA 2DEJA 4A61A 2RN2A 2DHGA 2JWLA 3DU6A 3UCGA 3ZT2A 1FF2A 4RLEA 4E7JA 4BRQA 2W4PA 4DEZA 2VA2A 1JLAB 3CC4S 2AV5A 1BI4B 1HI1A 4OJHA 1YJWN 1QE1B 2ASMA 4DB3A 2PMHA 4HVJA 1ASUA 4LF4J 4QWBA 2RILA 2EHGA 3W5ZA 3K0SA 4IG3A 4DUYJ 4Z4CA 3LGMA 4B9QA 1U24A 5IXUA 4GRSA 3DLGA 4CJEA 3QESA 1PKUA 1MMLA 3PW4A 1T3VA 2WOMB 1YKWA 1N48A 1KS2A 2VG6A 3ZSYA 1RKIA 4O5BA 4LFAK 1SPBP 1ICEB 2AEMA 4CLZA 3OYAA 4USWA 1UVMA 2GVDA 5AQHA 2Y1IA 5C7PA 3A5OC 5F0UA 1S6PA 3NGKA 4MDAA 4NLSA 4URQU 1I94K 1IJEB 2MHNA 1K47A 4F2SA 2FHJD 5KFEA 2I7NA 4F4WA 4LQ9A 2VFTA 3ENAA 4KGZB 1HKBA 4CZMA 3DLKB 1OIAA 5BPLA 1B9FA 3K5MA 2N7YA 4CHPA 1QVGR 4RNNA 3PJ9A 3UDLA 1GLCG 2JVOA 3R8YA 3I4HX 3VQPA 1R43A 2GO8A 5LSLA 4BY9C 5AQPA 4OZ0A 4CZCA 5BN9A 3O5BA 5E0OA 4YFUA 4CEEA 3CERA 5L1JA 4PL8A 2GHVC 4QW8A 4N47A 3OYJA 1U04A 2GQ2A 2K2PA 3KVGA 4CBXA 3C7NA 1DQ9A 2MZJA 1NHVA 3G9CA 3HPHA 2YXLA 4BRHA 5GMDA 2CDRB 4JKCA 4J9UE 4DFKA 3NVKA 3MM7B 4QR0A 2Q31A 1QTMA 4JS5A 2BEFA 1A0OB 5A0YA 2AF6A 4DCOB 4OHZA 5GIPA 1RHUB 1NH7A 3MCOA 4UOFA 3HFZB 4LSLB 3J80O 5IT9U 1JIHA 3PHTA 2PGCA 2G0CA 4NYFA 3HVRA 2VU5A 3LZIA 3MK6A 3O9UA 5DLGA 1TL5A 5L8RC 3O44A 4EU0A 1N34J 1DGKN 3E9LA 4MKYA 4MH8A 2R42A 4B3MF 4CO0A 4N41A 4C0BA 2RUGA 2GJFA 2RQMA 4DTPA 1DTQB 3WNFA 2ZZMA 4YR2A 3NH2A 5L9NA 3EE3A 4MJKA 1E6VA 3DXKB 2AZ1A 4I2QA 3DRRA 2J8AA 4LF5J 4J2AA 3FBFA 4FW2A 5HMXA 3OW2M 4GNIA 2AP1A 2GV9A 2MEWA 1BLUA 3KWGA 1KVIA 3QMQA 3WQPA 4WKRA 2MKJA 2VOOA 2CQCA 3K89A 3ZZYA 3IC1A 1FRXA 1EKSA 3RB4A 3T5KA 4LY7A 4ILRA 4BC3A 4E3SA 4J9PA 3QZ8A 4K2XA 3CJ1A 2DRDA 1XUPO 2C2KB 2CJXB 2B9XA 2HSEB 4DDFA 3FGVA 1N54B 2PD1A 2OSQA 3Q2TC 2WSCC 1RGVA 4DL4A 1ZS6A 1J5OA 4ZCLA 2NRVA 1ELOA 3MZIA 3VAFA 4ZIWA 4DU4A 2NXEA 2CXEA 2IIRA 5LM7E 3SBGA 2ITGA 2V9WA 3WQUA 1HQEB 3SUOA 4KHPF 3AOCA 4DPOA 3NGZA 5KG7A 1NSKL 5EX5A 3HO1A 4HUEA 1N52B 3UVJA 4LVNP 5KTQA 2IJNA 4RW8A 1FK9A 1UWBB 4WIIA 5KFDA 2CQBA 2V4QA 5H9FJ 3IMXA 3H2VE 1HLWA 4R0JA 1B0PA 2MQNA 2J7KA 2B51A 4D3GA 1MDUB 2E1ZA 4RWTA 2JNJA 4DSEA 3ENQA 3MXMA 3VF2A 5D0RA 3MDQA 3KK1A 1WBDA 1RBLA 3KLGA 2IGIA 1IR0A 3GLJA 1DT9A 5CY4A 3QO9A 3D1QA 2VJVA 4RBVA 2M8HA 2ZDPA 5HROB 2BW2A 3SI8A 2HNYB 4ZCIA 3O9TA 1HYSB 4RW6A 1RK8A 2J7UA 3VGLA 2K3IA 2XLIA 4FJ7A 1RTDB 3O5TB 4YOTA 1JLEB 2RU9A 1VQKS 4FYVB 3TAMA 3BH6B 1QLNA 2DTUA 4L75A 3HKZD 3TYTA 4C23A 1VQ9S 3G82A 2CJQA 2F8HA 1OSDA 2DNQA 1VLOA 1Y64A 4B02A 2XB2D 1JWWA 5BPMA 3W3DA 3IFRA 3DRXA 3CQ8A 1QUVA 1C0TB 2BRKA 4JI3K 3FUYA 4V1Ak 4KHUA 2F1FA 1NMEB 1S9GB 4H5TA 1E6YA 3MR6A 2QXFA 4H0XB 2J0SD 2ALZA 4IFVB 2RMLA 2CJ9A 3M2VA 1BWEA 5E33A 4KGKA 4ED0A 3MMAB 5ETSA 3Q22A 2LU1A 4ZVSB 2P9EA 4EBCA 4BR0A 2F4VF 1Y4ZB 3LWLA 4FJHA 3O1LA 3GG0A 5HI7A 2JHEA 2DTJA 2RRNA 4C8MA 1VIOA 5CYMB 4OI1A 3MCMA 4GKJF 2KG1A 2VOPA 1PIEA 3ULEA 3EN9A 4KGMA 4CJWA 2P6TA 1R6YA 2MQOA 1RBTA 1OH8A 4X64J 5CD4H 4KI4A 2UZAA 3DHWC 2ACMA 2HHQA 4DTMA 2VDHA 1HR0F 1MU2B 3QGPA 5D6GA 4XH5A 4DV4J 5KG3A 1VAZA 1Q1KA 2A1SA 4HHJA 2DNYA 4L76A 3A5LC 2XLJA 2Q0UA 4RUHA 1X0PA 3P8BB 3RB0A 4DUTA 2W8KA 3GPAA 4GMKA 4JI1K 3Q8SB 4DTJA 1T9XA 2QGFB 4CJ4A 1JCEA 3M2UA 4U7UK 3GB0A 1NH8A 4JD2A 3SBTA 3UW1A 3QERA 4ZHRA 1EQ0A 1URNA 4HKQA 2HG4A 3GZ7A 2WW4A 4FJIA 1YLXA 4TNOA 5HMZA 4OYOA 2XYHB 2OTLS 2VBYA 4FP9A 1ZTWA 2X74A 2FUG9 1KLMB 2Q79A 1XMOF 2CA9A 3S01A 5FROA 3GSIA 2KHDA 1LFWA 3CJSA 1NGJA 5DK5A 3GIJA 4YMEA 3HHLA 4B3SJ 3AJDA 2V4JB 4C48A 3SJHA 3RRGA 3LOUA 1BISA 2VL1A 1FRMA 3HOSA 1Q7YO 5HBMA 5HMYA 4Y2AA 4NLVA 4ZJLA 2BJDA 2PT0A 5J1EA 3BV8A 4Z4EA 5T7LB 5C24B 4M5LA 4NXNK 2QI2A 1OH7A 1KTVA 5IV4A 1AUSL 4R5PB 5AQKA 3MR7A 3WEEB 5GADP 5DZ7A 2FVCA 3D6FB 4F3MA 2CRLA 4IFYA 4PYDA 3V5RA 2V2VA 1FXRA 4C11B 3JAMY 2F7TA 2RQKA 2J4RA 3AB4B 1Z2LA 5CZXA 3HJFA 1BGXT 3W63A 4ZPTR 2YKAA 5D78A 1YT3A 3NE6A 3VQ5A 4AQYJ 4DR2J 1GOAA 4WZMA 1SV5B 1JJHA 4OO1J 3OL9A 3QRQA 2ZF5O 2GJIA 3OT9A 2HWTA 1ZZFA 1IXKA 3TAFA 2JLEA 2XCAA 2ZHOA 2DO0A 2NZTA 4BBYA 1J5EK 3HVTA 1KAXA 3CJ8A 1RFQA 4IUFA 4YP3A 3IWXA 1FA0A 3TI0A 3QEXA 3ZLJA 1UPPA 4H4MB 1ZM9A 4CH0S 1TKDA 2VFSA 5HQLA 1BIZA 2K1RA 4YUDA 3NCQA 1NWKA 4HL9A 1Q8IA 2MZQA 2PC6A 2KFYA 2UXDJ 4IZ9A 2IC3A 4PWDB 1FKOB 4MDBA 3PR4A 3TVKA 4Y1CA 3V1OA 1T9WA 3GE9A 3LQVA 5KFIA 4LF7J 3QEVA 5DS7A 2BM1A 2IVMA 1IR2A 5CH7B 4CCHA 4LMZA 1KVAA 3NG8A 5C15A 1KQGB 1U48A 2HMIA 4KKOB 4L3QA 4Z94A 2KB2A 2HBMA 1C1AA 4FVCA 4C9DA 4QOZB 1NG9A 2MY7A 3GV5B 4CWBA 2VZ9A 3CO0P 3PKMA 2PMWA 2ROPA 5KOXA 1V6HA 2ZEJA 4USKA 1CS4B 3LP2B 3AV9A 2MTLA 3SI6A 2VPYB 2KG0A 3D6HB 3OBYA 4MO4A 1TQLA 2WZ1A 3RSEB 4FWNA 1VQLN 1BMQB 5BYRA 1OVYA 2F5GA 1CJTB 3GIIA 4JKFA 2HHHF 1VOMA 2AJ2A 3OXLA 3W5XA 2Q2RA 3HYFA 1RSCA 1UL3A 1FWLA 3NFAA 1LW2A 2CH5A 3V1QA 3OBWA 4HH1A 1M1HA 1GNKA 1RT6B 4A47A 1L3TA 4CO5A 2PY5A 3PSFA 4LF4F 4H5RA 4LFAJ 4CTAB 1DRZA 2JLGA 1MROA 3CJTA 2RHQB 2CQGA 4DUYF 3AD7C 3BEGB 1VQ5S 1FKPB 1I1GA 2YJFA 1N5QA 5CZVA 2IIHA 3ZO7A 4A8OA 1NK0A 4FJMA 1WDTA 1S1WA 1U26A 4ED2A 1DY3A 2Z58B 2V8DA 2V8PA 1LK7A 4NL5A 3THXA 4C8KA 1OYEA 3O4NA 1JJ2R 1TFYA 4ECVA 1FTRA 2UVUA 1SZ2A 4J9OA 4OZNA 2OA8A 5B8HA 4UZBA 1WAJA 2DNMA 4Y28C 1V4TA 2EFNA 5J2NA 3MEKA 5DM6L 4KHWA 2XWYA 2XC9A 4I0WA 2CQ0A 1NPPA 2ALYB 2IA6A 2QTWA 4C1NI 2PAVA 4CLYA 5DM6Q 3C3LA 2FBYA 2VKRA 4FLXA 2W42A 4X4RA 1DTTB 5GAHP 2GW8A 4YHHK 3SXLA 1OO0B 1RAOA 4DR4K 4QWCA 1HNXJ 4CZJA 5TKYA 2F8EX 3LAMA 2BVZA 2F4FA 3C6UA 4C1NK 4YOXA 1UAWA 2C1EB 2M9KA 2LQ8A 3HZ6A 1NNEA 2DVIA 1VBYA 2E5HA 2YWEA 2YX6A 2HGNA 2RHKA 2F65A 3PG9A 4NI2A 2GMLA 2E9TA 1U45A 3GILA 2WTUA 5SWMA 4ID5A 5C25A 4DTSA 4RW4B 5KFMA 4PUOA 2Q97A 3MN5A 2ZH2A 3W0LA 1WLJA 5MLCV 3TTFA 3CCSS 4FWQA 4CLPA 2VG5A 4NLQA 3EXYA 4O3SA 3O1WA 2LEPA 3I5CA 1KVCA 4WYLA 4K5SA 3EGVA 1VISA 4USHA 4OI4A 1N34F 1GMVA 1QJHA 3DJCA 3MECB 2QG9B 1UW9A 3A3OB 1YBTA 5JJBA 2OPPA 2QYCA 3HI9A 1PCAA 4BC9A 4IO8A 1WOPA 3MMJA 3HF5A 4KRWA 3F73A 3KDNA 4LRFA 4Y1DA 5KFYA 3QRRA 3SDEA 4LF5F 3CB4A 4Y34A 2O8EB 3BF4A 3P31A 5C5JA 1TKTA 3IKMA 2FZGB 1UZDA 2MQ8A 1HBUB 1Q0NA 4LSZB 3GFYA 3JQKA 3FBEA 1SQKA 4HYKA 3G86A 1N36K 5AQJA 1NU4A 1W0HA 3VZHA 1XMQK 3UCZP 1DAXA 4HEA9 4BRGA 4ZPVR 1VQPN 3EDRB 1WC1A 1YITN 2IRXA 5AJ3J 4RW9A 4JP8A 1LWCA 4K59A 3RBEA 4DI6A 4CF8A 2FVPA 3DLRA 1XHZA 5F8LA 1BOTO 2AD9A 1JXLA 4JK7A 2I9SA 4LH4A 2V6AA 1JL2A 2YNFB 6FD1A 2RB7A 4JOUA 3ZSRA 1HNVB 4DPXA 2D3O1 3NAHA 4EO6A 4RUBA 3HVWA 4TN2A 3POTB 1LW0A 3PFOA 4DZ6A 1FEHA 3SSQA 3R3TA 3RBDA 2DY9A 2BW7A 2XLKA 5D4NA 2PA3A 3MN7A 1KFSA 1WSIA 2YX7A 1E4FT 3PYGA 3H0PA 2F96A 3R5DA 3D68A 4DL6A 1B9DA 2BQ3A 2BACA 2Z8QA 1HQUA 1NRKA 1HKAA 3GU0A 2IM0A 3DC2A 5C42B 2VPWB 3DLBA 1PILA 2H51B 3KWMA 2FLNA 3MMCB 1HKGA 3I6PA 4OX8A 3DWLA 4MTPA 4X4PA 2YY3A 1B0VA 3V1RA 4M94A 1SC4B 3M9OB 4OZ3A 3UN2A 4BRFA 2PEHA 4DWIA 1U1LA 4BC4A 3VEOA 2GAGC 5A2QU 1Q4RA 2A0FB 4WTOB 3KLEA 1NGFA 1GFWB 3KJVB 4FF4A 3V2UC 1NJXA 5KG4A 2I5JA 1S5JA 1P90A 3B8AX 5H9EK 4ZLJA 3UQSA 1BQMA 2NQPA 3OY9A 2Z56B 4G1QA 1VJQA 1E3MA 3CD6N 4QZVB 4BGBA 2Z4PA 2VBWA 4KHSA 3PRDA 4QS9A 2DNKA 3W60A 4PR6A 5JS2A 2P9UB 2VF3A 4DJBA 2QWRA 4CLLA 2HNDA 2YWGA 1FXDA 2OTJN 1WHXA 3GYXB 5FPNA 3BEXA 4ISFA 5EHHA 1Z6RA 4ENOA 4C97A 1O1WA 5HRSA 4I4BA 3ZZPA 1UOCA 3KJNB 3MEGA 1EETB 1NB2A 3L3VA 3O6WA 2E9RX 1PJ7A 1TUYA 1FRJA 1ATNA 1LWFB 3LH2S 5GAGI 3NNHA 3E66A 4WPAA 1S9EA 1RZMA 1GT8A 5J1PA 4AXJA 3ZTOA 1HWJA 1HW8A 3DOMB 2U1AA 2GHWA 1UJ6A 1RAGB 5CXTA 4M3UA 2W9BB 3AJ1A 2IMWP 3OFGA 4Y2CA 5GVQA 2ASYA 3SNNA 1FNXH 1Q5VA 1RT2A 2IMOA 1D9FA 1FRHA 4MO5A 2DH9A 2QE5A 4M42A 3NS7B 3FGUA 4O44A 4JI5K 2PSZA 4JI1J 1ZC6A 4PG8A 4B9NA 1NGBA 4CJPA 3CULA 3R6MA 3SSRA 2O01C 2CVIA 2AYGA 4X64F 4WQ4C 4Q0BA 1Y5LB 3VTHA 2RKIA 2CQ4A 4FS1A 1VRUA 4DV4F 3QT5A 1EO1A 2HK2A 1HLUA 2DFFA 1XTZA 3ZNUA 1F9FA 4UUWA 2CPJA 5GAGU 3OUYB 3G6ES 2PEBA 4PG7A 1FRLA 3G8SA 4DXLA 1RB0A 3TTCA 1TL7A 1NOZA 4DV1F 2GQQA 1NHKL 1WG5A 3B6PA 4Y2MA 2H5EA 4Y2IA 4DBQA 2F8SA 3ZEUA 1U6ZA 1UVNA 4X2BA 2NNWA 4WFZA 4J90A 1C1CA 1AFIA 4NLBA 4AHCA 1YIJS 4OJ3A 3NOCA 1IBCB 2OPRA 1VQ7S 3VQCA 4B3SF 3KHLA 4NXMK 1WSJA 3PIPL 2E5LJ 1AB8A 4KGXB 1YJ9N 2RDIA 5E2QA 2AU0A 2NREA 3BSCA 4MK9A 4BREA 4LFBK 2FB0A 3SEOA 3M1FA 3D5MA 2Q1LA 3PIPQ 2YH1A 4CM0A 1RQ0A 3L4BC 3LDNA 4JI6K 1WOSA 3A1YG 4O3PA 1P9QC 4JI0J 3Q89A 1TVRA 3AVHA 2C2OB 4KHMA 3D4JA 5KFZA 4RG8A 2QL7B 5B09A 3TQEA 3HSGA 4XH4A 2OEKA 4X4SA 4DUZK 1YTAA 1U2VB 3R27A 4CD3A 4ZOSA 2GO9A 3HD2A 1BXNA 3DOLA 4AQYF 1IVZA 4DR2F 3KLHA 5F2RA 3RMBA 4IG3B 2HFZA 2BE2B 1RAFB 3W61A 3DLGB 1FJCA 1RBVA 3PW0A 3Q86A 2GTDA 2DNPA 4M5JA 1EQMA 5KT6A 3TJAA 1EARA 2XNRA 1PGZA 3CCVN 1Y3JA 3CCMS 3ET6B 3LPUA 2A5XA 3MM8A 4J9QA 2G2ZA 2A18A 3DN9A 4DX5A 1X4AA 1RWWB 5KI6A 3HSCA 1FDDA 3VAIA 2I0XA 4Y0WA 1HWLA 1GLAG 4ZITA 4K4TA 1KHVA 1TUUA 4I6MB 5CE3A 4YOYA 2K06A 1TKXA 2UXDF 2ILYA 1HBNB 4WQ4A 3L6QA 1WJ9A 2EK6A 4LF7F 2YKNB 4DHVA 3THVA 2LMIA 1CJUA 2QMWA 2H1YA 3ICLA 5E3RA 4QIVA 2A2DA 1MN9A 4G65A 4KGVB 2DHHA 4BR5A 1KVBA 3F0NA 2VCPA 2QN6B 3CDWA 2UXBJ 3HSDA 3OW2R 3ETMA 2D0CA 2BUNA 1U47A 2EWSA 3H2LA 5DZ6A 4A8KA 3EVWA 4ELUA 3C7NB 3I0SA 3Q7CA 4NLUA 3GSDA 4N5SA 1TUGB 3M6VA 3PW5A 4CGGA 1B70B 3CMQA 2RIJA 4ITSA 5BXIA 2ZNYA 4CGDA 2APOA 4NYZA 5A0YB 4CF9A 2OP5A 3NWGA 2YKPA 3T5JA 4JI7K 3G4SS 3CJAA 4JRQA 4B9TA 5D3GA 1RT5A 2HHSA 2IDLA 4YORA 4G9ZA 5MAOA 2P8IA 3HDSA 2JC0A 2R2UA 3DLJA 1V3ZA 4X4VA 5LL6Z 4LFAF 1D4XA 1T02A 1VC5A 2QMXA 4DPTA 5L38A 3U9ZA 3UKRA 1GMWA 3W2VA 2N4CA 2P9SA 3C95A 3VERA 4DR5J 2KFZA 1E6VB 3D1HA 4I2QB 2QWNA 3DRRB 1N5VA 2CADA 1IBMJ 3DGVA 3KKSA 1HYVA 4OPKA 3GR1A 3I32A 4MLEA 2E7VA 2GMJA 4YHHJ 3HLUA 4TQRA 2CNNB 3IR6B 1MMDA 3L95X 1IM6A 1QM9A 5ETTA 1ITGA 4DL3A 2VFVA 3BQ2A 2GV1A 4J9NA 4ZLPA 1N8RT 5IQ6A 1WNSA 2CVEA 2AWZA 2ZHBA 3VQ7A 1CSJA 4IOCL 5DETA 3WXKA 1CC7A 2BYCA 4IOCQ 3R1HA 2OZSA 4DR1K 3VPZA 2E5GA 4EMDA 1J5OB 1HX1A 5GINA 2DH7A 1HNXF 2AYMA 4KBIA 4M3TA 4Z7CA 3DLEA 3OSNA 1TKZA 2IRYA 4OLOA 2ZOFA 2IBOA 3I8BA 4MAKA 1J6ZA 3EPIA 1S9FA 2WBRA 4FXWA 4RW8B 1R0AA 1FK9B 1PO6A 2G0IA 1X5OA 1QQOA 1VRTA 2XY7A 2F9JA 1IKXA 3Q8VA 3NCRA 3K9KA 4BE2A 4OI2A 3BF1A 1GEHA 1S0VA 1RDRA 3FFIA 4YDDB 3KK1B 2NUHA 2ASLA 4E19A 1MSWD 3KLGB 2NXJA 4K2JA 1LOUA 3PX4A 2F7VA 3QO9B 5LJWA 1LQ9A 2MYFA 1GLBG 4PWWA 3PY8A 4LR8A 1WUAA 4NASA 4H03B 4DX7A 4IRDA 5KFBA 2DNGA 4RW6B 4UOGA 4FLZA 1QZ5A 1WC5A 1KOOA 1VQ4S 4ZVHA 2BBEA 1QDUB 4Q43A 3R7BB 3P1GA 3QB0A 5JUMA 2HNZA 2MGZA 4PXEA 2DJWA 1XMQJ 1SC3B 4QQBA 1NJZA 2EXUA 3CJBA 1WORA 1BHNA 3G82B 4JS4A 5AFUH 5EGYA 3HFVA 2EKNA 2PMZD 2HBYB 2HSTA 4K4YA 3EE8A 1IKYA 3T6JA 4F4XA 3CMAS 2E1MC 3IAS9 4BR7A 2C3OA 1RDDA 3D9BA 3VEXA 3CCQN 5IWAK 4RNHA 1X4GA 5ETVA 3AA4A 2OANA 2W7PA 3TVYA 2J76E 1M5OC 3OYIA 1FKAF 2E7WA 5AJ3F 3VGKA 2BTFA 4OLAA 2N7CA 3Q24A 1WEZA 3AO4A 3H5UA 2DR5A 5A6PA 4QYZK 1RDWX 3CD0A 4DU1A 1UZHA 4Z7YA 4K4XA 3MAHA 4NMXA 4ZVEA 2C22A 3CJ5A 4KH0B 1NKBA 3J8AA 1HD1A 2A3ZA 5F8HA 3M30A 2BOPA 3O3LA 3Q8UA 4PKHA 3ULEB 2DITA 2SXLA 5KFHA 5FRNA 2KT5A 2CPHA 3R5GA 3MFIA 3FZ2A 4PAAA 3TRGA 3HPOA 5FDLB 4KJIA 3TEHB 1J53A 2EG2A 4PG4A 2LKZA 5H9EJ 5THWA 4DV2J 1VMBA 3NMAA 4NYPA 3AY9A 3JYTA 4NPOA 3RAMA 3O4WA 3B6BA 3UIQA 1SJRA 3D6RA 5A6WA 5LXYA 3OR1B 4FYDA 3PYFA 4I6YA 1H2TZ 3OD2A 2VBXA 1X1PA 2F8TA 3M2UB 3M5RA 3NGDA 4JD2B 3G2XA 3CSKA 1I3OB 1X4CA 2IOCA 2A6MA 2QLJB 1IKVA 1JLCA 1RDUA 1HKCA 4U7UD 4CHYA 1T05B 2VQEK 2J0QD 3WQTA 4FNHA 2H3GX 4V19S 3N6MA 2FJXA 1Q7LB 2E2OA 1F2GA 4NCGB 2Y0SD 4X4OA 3HD1A 2ZH7A 2HOEA 4AHSA 3LDPA 5HBMB 1WC6A 3MM7A 2CJKA 1Y3KA 2FSJA 1DZ5A 3T7ZA 1VQ8N 1LXJA 3ISND 4LSLA 2DB1A 2DGOA 1Q86T 3L9ZA 1RCOB 2X78A 3BSAA 3ITHB 2JL9A 5GMEA 4Y3CA 4WCEL 1UVIA 2FSNA 4JI5J 4K25A 4KH4A 2VA3A 4DL0C 2ZQBA 4WCEQ 4ZCKA 4DX6A 4A8MP 5I42A 1Y7PA 4WQ5C 3GYGA 2WVDA 4PXBA 4ILGB 3DXKA 1RT1B 4P2MA 1G1XA 4CF0A 2QLXA 4JI1F 5T7BA 4H4KC 3HVTB 4EHTA 3TU5A 1LWXA 3WIVA 3VEVA 2R7UA 1VLYA 5EX0A 2OUGA 4ES2A 4BG8A 1OSCA 1RBAA 3A8YA 1C6VA 3Q8RB 4CZKA 4QR2A 4YN3B 2HZVA 1UAXA 2ZE2A 3MEDA 3HMJG 2RE1A 2GGPA 4E0DA 4ES1A 2WVFA 3IS9B 4LIRA 3U6FA 2JGUA 2IVFB 4QWEA 1UEKA 4MKBA 4KH5A 1M1GA 4ECUA 3K17A 1G3OA 3P3DA 5C2FA 2MKSA 2CQDA 4E98A 2HMIB 2V2KA 4N7TA 2NYHA 1HQEA 1R31A 4CK2A 4FKXA 1KKHA 1V3RA 1H7XA 1JLBA 2JWKA 2DHSA 4LF9J 5DG7A 1VQON 3OTEA 3BYPA 4UQTA 3LP1A 2XEXA 2E5LF 1RACB 2R3VA 1UWBA 3W66A 4DUZJ 1NK8A 4DV0K 3O3FA 3CT9A 3QAUA 4CIFA 1LNQA 2F4VK 4H8KA 3WX8A 3C19A 5GAHI 1X31C 1S0NA 3EWGA 3W9IA 3WHIA 1B64A 2FBTA 4PPDA 2DIVA 4JI0F 1UJ5A 4HCBA 3WIUA 4B1YB 2OD4A 1YXQA 2WC9A 4JYAK 3OXFA 1XQIA 2KYZA 2ZGYA 2UUTA 4ERDA 2EC0A 4IR1A 1NPRA 1OS5A 3DU5A 5CHIA 1HYSA 1F5AA 3F9MA 2R8JA 1Q16B 5CR4A 1EX8A 1FJGK 2Z57B 1HR0K 1VBKA 3HPGA 4DR7K 3LPTA 3GP9A 4A5BA 4JRPA 2QA4G 1S1WB 1D8ZA 4P10A 2KO1A 2Z2ZA 3N01A 3CQYA 4YR3A 3THXB 4OHVA 2IM1A 1IJJA 3CCRN 1QSYA 1VQ6S 3HM8A 4IDHA 4XEIA 4RW7B 1QD1A 4X66K 4WQ5A 2V51B 1SKRA 3OFHA 2P5OA 3UNGC 2XYGB 5F9LA 5GAHU 4JI8J 2GNKA 2BX6A 1XMOK 5J2NB 4F0HA 3LPEA 2HW3A 3SIPB 3QEIA 4ZVGA 3SUPA 2IVYA 4ZLLA 3MCNA 4WJBA 2GIFA 3C16A 1APSA 4EAHD 1HQ2A 2ZM6J 3MPDA 3OBIA 2J6UA 4MIAA 1X9JA 2ZC4A 4WFNQ 1WSVA 2JDJA 4IFVA 5K8MA 2D1KA 2E88A 3OS0A 2MJUA 3H3NO 3MMAA 4B3TJ 7FDRA 1K1SA 5FLXY 4K4SA 3RB6A 2G4BA 3EYZA 1N5YA 3HJVA 1HNIB 2UP1A 2UXBF 2WSFC 4DV7J 1VHIA 5EWGA 5AXNA 4FJJA 3V9WA 1RBOB 4NI2B 4ED5A 3LF0A 3CCJN 1SXLA 5T41A 1ZXOA 5C25B 1YUWA 3OHAA 5HQMA 2E6LA 3D0PA 3JB9k 1ZAWA 1QAJA 3GMGA 3QIDA 3TTDA 3DRYA 4J5OA 3FRYA 4JV2A 4DQ8A 2LDIA 2CGKA 4HHHA 1X9MA 2GUIA 1WHYA 2P9GA 1JLGB 2H3EB 4CK1A 2IPOB 1MLAA 2VG5B 3LDQA 1OYDA 2P2CB 1YHQN 3T5HA 1TELA 3LO3A 2LYVA 4TLRA 5ETPA 1YWXA 5M1FA 4DR3J 3I56S 1VQMS 1KRPA 5KPTA 2AA4A 2KRRA 3L2UA 4M5DA 1FD8A 1WC0A 2AEFA 4DR5F 2Z2LA 1I39A 3VQTA 1NNDA 4PQAA 1IBMF 2YVSA 1ZBSA 2KHCA 4WE1A 1W26A 2HVHA 5LJ3Y 5F8GA 2YHYA 1H0HB 1TKTB 2EFPA 4YHHF 3U9DA 3PCOB 4DR1J 3J81O 4WK1A 1MWKA 4I7FB 1HPZA 5T7LA 2AP6A 2HHUA 1NUEA 3VQQA 1CLQA 3O2IA 3HBTA 3QJLA 1HA1A 1YJNS 3PW2A 3WEEA 4FPIA 4RW9B 1UJ4A 3CC7N 3F2KA 2KRBA 4LRDA 3VA3A 3CNQP 1CXQA 1D0EA 1RAAB 2G8FA 3WNEA 1TTHB 3VETA 2DBBA 2F9DA 1WUUA 2IM2A 4PKGA 3TSPA 3L7OA 3V6JA 1S48A 2E1AA 3KIOA 3AHPA 1P9YA 2YWFA 2HHHK 3CCUN 4L3KA 1A7GE 2H48B 3GIMA 1LW0B 3MWPA 1X7VA 2KVQE 2QW9A 4BRNA 2WBNA 3P4UB 3AO5A 1LWEA 4HVZA 4DV6K 3C46A 3OQ2A 5M1PA 4LD0A 5ETLA 1RGIA 2L48A 1H38A 3OL6A 4LF4K 4CJ5A 3N6LA 4CECA 3VOVA 4DUYK 1D8YA 1RHKB 4L74A 3OVBA 4AT1B 2OMLA 4JI4J 3BH7B 4KSEB 3AB2B 4G3IA 3U3GA 1FKOA 3AXKA 3KD1E 5M1KA 2NZCA 8AT1B 1DHMA 4JKBA 3KKFA 2M70A 3H4DA 3CFRA 3KLEB 4QIEA 3G6YA 4HR2A 4CE9A 4A8FA 3BYRA 5IWAJ 1VQNN 4CEAA 5KT3A 1WN7A 4NWBA 4X84A 3OYKA 1XMQF 2HQDA 5KG2A 4F50A 4W92B 5FJ4A 1JJCB 3VEWA 3R6LB 3IM8A 1A6LA 3LP2A 1V4SA 1N32K 5J2PB 4P2XA 3BB5A 1TV6A 2B8PA 3CFOA 2ASPA 3RTVA 3PIOL 5E41A 3WZ0A 3RJMB 3J80Y 3BSOA 1CJTA 3TAGA 1N4LA 3UCUP 4B9SA 1XR7A 3PIOQ 1WHVA 2LVWA 2A1BA 2J6SA 3BGUA 3Q83A 3M8RA 6FDRA 2XZDB 4ILLA 4CH1A 3PJWA 3TSUA 2ZGZA 1QSLA 1S9EB 4KO0A 1SH3A 1YJTA 1MWZA 3PXGa 3QYYA 2NRWA 3H7HB 4ID8A 1NB7A 1FKPA 5AQTA 4OX9J 3I8DA 5D4PA 3ZSXA 4HLBA 4O8KA 2VYPA 2KL8A 2QFJA 3HHKA 2YHXA 1RT2B 4NB4A 5AQFA 2J9EA 2B9YA 5KPZA 2X3DA 3I96A 3RU0A 4PL7A 4NMLA 2ZUAA 4O44B 2WVBA 5HMWA 1N34K 2HYIB 4DU8A 2GHPA 3ZX3A 3KXDA 2XO6A 3T3FA 3CJ2A 1Q81T 4L6V3 4NE9C 3KLVA 1ZAVA 4Q0BB 1U25A 4DV2F 2W40A 2OH2A 2RKIB 4J37A 3M7VA 1FWKA 3VZIA 2NSCA 3CJKA 4C2MA 2RQ4A 2W25A 2VQEJ 1JNZB 1DLOB 4C8YA 3E01B 4DTXA 3QT8A 3F41A 1DTTA 4J7CA 2XHWA 1HHQA 2UUWA 1U1MA 2I1RA 3J7YP 1C4CA 4WFXA 2E2QA 3GCXP 3T6BA 2J7WA 3TA0A 1S6OA 5ETKA 1WB9A 5BYSA 2RPIA 1ACMB 3AO1A 2A1RA 1HL6A 3QQCD 4EEYA 3U1MA 4NX9A 1QHTA 4USTA 2ZKUA 3SUQA 4UW2A 2WRMA 4QIFA 4RJVA 3ZX0A 2DKOB 3EZ5A 4KHNA 3HTVA 3R2CJ 1G4CA 2C3YA 2DR9A 5EU7A 4RNFA 2FDNA 1WI6A 3DDIA 3JQMA 3BY5A 4CLWA 1N5SA 1TVRB 2EKYA 2ZBPA 1AW0A 2PA8D 2CGJA 4Z4IA 4BWJA 3GIKA 3BGRA 1IJFB 5KFJA 1K73T 2HHPA 3IAYA 4ZVPB 2B4VA 4JKDA 3H5SA 3EZUA 2QWQA 4JI5F