3I0RA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 3
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
b'SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 146
structure length 545
sequence length 545
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0rA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0rA05
4Y2CA 4AHTA 2E6MA 3LP1A 4CCHA 2HHSA 4G3IA 1TL1A 4KV8A 4RNNA 1A5XA 3SPZA 3PW5A 4I2QA 1JLBB 4DL4A 2G8KA 2WRMA 4RW4A 1KRPA 4Z0UA 2DTUA 5C24A 1HQUB 3HPHA 4CGFA 4KHYA 3MTKA 3VQQA 5KTQA 3MR3A 2BR0A 4HUGA 2YNHA 3I5AA 4MK8A 5EWGA 4DTOA 1REVA 3GIKA 3HKWA 4DL7A 4FLYA 3PJXA 2B43A 3AVCA 2FJWA 3NGDA 2BQUA 2FBXA 2R7YA 3ISNC 2I5JB 5HRRA 1NK8A 5KFTA 3RB3A 3LALA 1VRTA 4DTPA 4WE1A 4DLEA 2WOMB 1WN7A 3RRGA 3KMQA 4Q5VA 4GVMA 3UDLA 2IC3A 3DM2A 4IRCA 4W5OA 1JLCA 4IQXA 4FJXA 1RDRA 4KBIA 3OS0A 4FZXC 3KLEA 2R8KA 4ECVA 5J1EA 3C6UB 3TAMA 1RDCA 2BDPA 4C8LA 3LAMA 3LAKA 4J9NA 2D0CA 1UWBB 4BACA 1D8YA 4E7HA 3AA4A 4K4YA 1MMLA 2P5GA 4MK7A 4ZMMA 1J54A 5KFEA 3V6KA 1RT3B 2BE2A 2HNDB 3PW2A 3PY8A 1T94A 2GC8A 1C0TB 4I2PA 1TKDA 2OPPA 3DOLB 4WZMA 1CSJA 3M8QA 4ECZA 4J9QA 1T03B 4M95A 4ZVFA 4RNHA 3JYTA 3LP0B 3SCXA 2UUWA 5FRMA 4RW9A 4FYDA 4DSKA 2W9AA 4FJLA 4CGIA 1WSIA 5KRTA 1TK8A 3AVAA 3M8PB 3ZT2A 4BDPA 1RBSA 3OS2A 1TKZB 3KLIB 4QWAA 1LW0B 2ALZA 4CJTA 3SUQA 4OLAA 4AHUA 4EEYA 2FLLA 2GIRA 1RBUA 2QKBA 4ED3A 4ELTA 3LPTA 2AX1A 3T19A 5D3GB 3HT3A 4TY8A 2RKIA 3OL7A 3VQDA 2YKMB 3E01B 4IRDA 2Z1GA 4DQIA 4CJ5A 3SZ2A 1SV5B 1JLFB 5FDLB 1A5VA 3D45A 4JLHA 4KHQA 4HTUA 2W8LA 1X9MA 1D0EA 4F4XA 4CHZA 2ZD1B 3EY1A 4F3OA 3V1RA 1CLQA 2R8JA 3T5JA 1BIUA 4IDKB 2JC0A 2UVRA 3KK3B 3O3FA 5KFVA 4NRTA 2F8SA 4NRUA 4TY9A 5KFMA 3OVNA 3ZSVA 3EYZA 5HROB 4TSXA 4CEDA 3H4BA 3O4QA 3OL6A 4QW9A 1DTQA 1R0AA 3BSNA 3NH2A 5J2QB 2KZMA 3LDSA 4NZ0A 1VSLA 4OKJA 3KLHB 2JEIA 3NCIA 4OPJA 4KI4A 5KFPA 4CK2A 4I9LA 4FLUA 1L3UA 3P5JA 1TP7A 4YR3A 3D28A 3OL9A 4KSEB 5KFIA 3TAFA 1RTIA 5J2PA 4B3OB 3K5NA 3H5UA 4DSEA 4ZP8A 1U45A 2R2TA 3NF7A 3MECB 2Y1IA 1D5AA 1JKHB 4NLYA 4HHTA 3RTVA 3MEDB 1IKYA 4O3RA 5KFGA 3M8SA 1RT1B 5L1IA 4CEFA 5KFDA 3GQCA 3VQ7A 3MXJA 1RT4A 1S9EA 3QGIA 3C95A 4LSNA 4ED0A 3AA2A 1LAVA 1LW2B 4YNQA 2I1RA 2HB5A 4RNFA 3QO9A 2IM2A 3KLGB 4IKFA 3RB6A 3RAQA 4H4OB 1JXBA 4DTMA 1YTUA 3SYZA 1QAJA 4NCGA 2YKNB 4ECSA 4CHQA 2VWJA 1RCHA 3HVRA 1EP4B 1IKWB 2KW4A 1IH7A 3SI8A 5KFRA 3SI6A 4EO8A 1J53A 3Q8PB 1RNHA 4F4KA 3DRRA 3CM6A 2B4JA 3Q8QB 1FKOA 4R5PB 1ZTTA 2PYLA 5F8HA 4CIEA 3DLKB 1C1CA 1QSYA 4QPXA 3HVAA 3QEXA 1LWFA 3CDEA 3CJ5A 2VWKA 4QWDA 4M3XA 3ZSWA 1WSEA 1XR5A 1S6PB 1IKVA 3DLRA 5HLFB 3MR2A 2LSNA 2IMWP 4Y34A 5KI6A 3T5LA 4ELVA 1EETA 2CKWA 4EBEA 1NHVA 2IDOA 4R0EA 4NLUA 4E7JA 2HWHA 1NK6A 4DL3A 3QEVA 3OLAA 1S0MA 3DLGB 2E4LA 2IM1A 4IKAA 4DTXA 1NKEA 2DFFA 2BQRA 1SKWA 4KAZA 4FJMA 3DLEB 1HPZB 5KG7A 3NGYA 3TI0A 2HW3A 2ASLA 4BE0A 3M9MB 3OYEA 3F73A 3OYIA 1WNSA 4E19A 4O3PA 5KFHA 3L3UA 4MH8A 4IR1A 3ZT1A 2B6AB 5HRSA 3QIPB 3KD1E 1JLQB 3AO4A 4EO6A 3O3HA 3C94A 2XY5A 3BJYA 4LQ9A 3PW7A 2XY8A 2UVWA 2FVCA 3AVLA 4IG3A 3H08A 1YT3A 4WZQA 1HQUA 4NLOA 5KFQA 4KKOB 4FJKA 1S6QA 3SQ4A 1CZBA 4IFYB 3F9KA 3QERA 3MR6A 4HCBA 4ED2A 3IN5A 2AWZA 3VQ6A 4H8KA 3KIOA 4NYFA 3CWJA 3OYCA 3NAIA 2I5JA 3EZ5A 2W9BB 1SH2A 2WOMA 3UR0A 1RYSA 3FDSA 3S9HA 1Q9YA 4YR0A 4C8MA 3RMCA 4NYNA 4BE1A 4K50A 2P1JA 3AVMA 1NOZA 2XCPA 3C6UA 4PQUB 4K8XA 3CFRA 2ATQA 3NDKA 4Z4EA 1XC9A 4FM0A 1QAIA 1NJXA 3ICLA 4J9SA 3SQ1A 4IOBA 1GX5A 1UWBA 2KFNA 1UOCA 4ECRA 1RDAA 4Z4HA 4CK3A 1RT3A 2HNDA 3CYMA 3WNEA 2J6SA 4MKAA 3DOLA 4G1QA 4O4GB 4CF8A 2RDJA 1T03A 1ZBLA 4NLQA 4C8NA 3T1AA 4OLBA 4CJSA 1W25A 3OSPA 1FKPB 2JEGA 3LP0A 4RU9A 2YNFB 4Q8FA 5EU7A 4Q0BB 4B9MA 2JLEA 4H54A 3M8PA 2AQ4A 4HVJA 1TGOA 4W5TA 4F3TA 3LWLA 1TKZA 3KLIA 1J5OB 1LW0A 1K6YA 3ZT0A 3TARA 4CEQA 3VQCA 4O5BA 3QIDA 1I3AA 3G6XA 3IG1B 4DSIA 4O0JA 1Q9XA 4MIAA 3PV8A 1HYVA 5J2NB 3E01A 5DLGA 3ZSRA 5FROA 3L8BA 1SV5A 1JLFA 4J9MA 4DWIA 4CEOA 3AVGA 2F96A 4QWEA 3HXMA 2ZD1A 4BDYA 4ED6A 3TAGA 4DFMA 3OHBA 4KTWA 5HBMA 4IDKA 3KK3A 4OJRA 3WNGA 1SUQA 5HROA 3V1OA 3ZT3A 1BQMA 5L9XA 4F8RA 4RG8A 4ELUA 4CHYA 1UA0A 2E6LA 5J2QA 4FJ8A 3VQEA 3KLHA 2C2EA 2Z1IA 4CECA 1LWEA 1QE1A 4QAGA 2JC1A 3ZCMA 1C1AA 1JLEB 3NF6A 2Z1JA 4DU4A 1QQCA 4DL6A 4DTJA 1TAUA 3VA0A 4Q8EA 3SUNA 4KTZA 3H40A 3V9UA 2G8FA 2QXFA 4DF4A 4ICLB 3KHHA 2C2DA 1NK7A 4OL8A 5DGBA 4R8UB 5L1KA 5F8LA 2E9TA 4FM2A 4B9VA 4IRKA 1N4LA 1CZ9A 5KFXA 4CIGA 3SFUA 5DQIA 2WHOA 1RT1A 1T05B 5SWMA 1BCOA 2D5RA 2ASJA 2G8HA 1HNVB 2KZZA 3PW4A 1X9WA 3KKRA 4ZP9A 4FJHA 3H98A 1RT5A 4YMEA 2DFHA 3THVA 5CYMB 1KFSA 1RBTA 3KLGA 3D5MA 2ZQBA 4CEZA 3DYAB 3NGIA 4H4OA 2HMIB 3GYNA 4LQ3A 3AO1A 5KFWA 3PZPA 4DG1A 3PX0A 2OZSA 4DTUA 4YR2A 3RAXA 4IG0B 3V9WA 1S1UA 4DL2A 1EP4A 4PA1A 4K4UA 4N5SA 3KTQA 1S1XB 3VQ9A 1IKWA 4E89A 3NFAA 1KSPA 3TWHA 2X74A 2BQ3A 3MFHA 1KCFA 1RDBA 4CJPA 5L1LA 3KKSA 4DTNA 3JSMB 2QV6A 5JXSA 3VQSA 1EX4A 3NAHA 1NOYA 3V6DB 1TVRA 1GX6A 5JS1A 1UA1A 3MEEB 3AVBA 3IS9A 1RILA 3S3MA 5T7BA 4RW6B 4IH6A 4J2DA 3TAEA 3LZJA 5DQHA 3OYKA 4FS2A 5DQGA 5HLFA 3CO9A 2RDIA 1RDDA 4KREA 2UUTA 1TKXB 2ZE2A 3BQ2A 3LPUA 3Q8RB 1TL3B 4E1NA 4N56A 1S9GB 4ZVGA 2XGQA 3CG7A 4DSLA 4CFBA 4HKQA 1RA7A 4Y1DA 1S48A 2FLNA 3NBPB 2OH2A 1VSIA 3K5LA 5JS2A 2UVUA 3DOKB 1D9FA 1XR6A 1QSLA 3HP6A 3PX6A 3LZIA 5I42A 1IKXA 2B6AA 4YP3A 1BI4B 3QIPA 2V4QA 4PUOB 4DEZA 3TAPA 3CJ0A 1X1PA 2HHUA 1TK5A 3VQBA 4J2AA 3L2QA 2A1SA 3AO3A 1W9HA 4CFCA 2VG7B 5DG7A 1S0NA 2B5JB 5J2MA 4B9SA 4KKOA 2FC0A 1DTTB 4IFYA 2XI2A 2FBVA 4KHMA 2RF2B 5T14A 4BWMA 4FW2A 1TKTA 3ZSQA 2ATLA 1I6JA 4FW1A 4IH7A 3PO5A 4O3NA 3ITHA 3EPGA 3L3VA 2HHQA 4BDZA 4JRPA 4ZHRB 3N6NA 1MU2A 1HRHA 4CESA 2HNYA 3PJWA 2O5DA 3FSIA 3CIZA 4NLWA 4ED7A 4PQUA 3LP2B 1K1QA 1VSFA 4J9PA 4ZPAA 2HAIA 1C0MA 2O4GA 4KO0B 3C6TA 1LWCB 4CJQA 1VRUB 3CJ2A 3ALYA 2KTQA 4FK2A 3GILA 4DFPA 4WFYA 1BQNB 4RNOA 1B9FA 5KFAA 3L2WA 3D0PA 1WSFA 2X6SA 4M94A 3AO5A 2OA8A 3MEGB 1FKPA 4E0DA 2YNFA 4DS4A 1KLMB 4OGCA 4Q0BA 4YFUA 5F9LA 3V9ZA 3KJVA 2DPJA 4XPCA 4CJUA 3CDWA 4EYIB 3AVIA 3DMJB 3L2RA 3CDUA 4TXSA 3OS1A 1NJYA 1J5OA 2IJFA 4DTRA 1HQEB 4O3OA 4OGEA 4ZP7A 3B6OA 4K4SA 5EDWA 4AHCA 2Y1JA 4FBUA 4DS5A 4MFBB 1KVBA 5KRSA 3VA3A 3HP9A 4KPYA 4XO0A 4EBCA 2IGIA 4I2QB 3OYNA 5J2NA 3BGRB 4RW4B 3V81B 5C25B 1YTAA 1NKBA 2FVQA 2D41A 1VSJA 3RMAA 4UQGA 1T3NA 2YNHB 1KFDA 3ZSXA 1REVB 4W5QA 4NYZA 4CJRA 3DRSB 3MXIA 3NGZA 2UVVA 4CEAA 3B6PA 4H4MB 4DFJA 4M3YA 4CJFA 4LY7A 3SV4A 3M8RA 4ID5A 1JIHA 1VRTB 1RTDA 3NHGA 5I3UB 3HVWA 1S97A 3KOAA 1SH0A 4ZVHA 3N6LA 3VN5A 3AVJA 3PX4A 3S3OA 1JLCB 4Q44A 3O4NA 1K1SA 2NUBA 4DU3A 4EYHB 3KLEB 4ZVEA 1RT7A 2XWYA 5J1EB 3QINA 4JV2A 4WFZA 4BWJA 4WXOA 3G0ZA 2WONB 1JL2A 4J9OA 1JLEA 3HVTB 3QLHA 3I5BA 4AH9A 3OYJA 1FXXA 2J6UA 1YVFA 2ZKUA 3I5CA 5CYQA 5C42B 4KAIA 2VG6B 4OKEA 2BE2B 4RW8A 4W5RA 4I2PB 3K5MA 4GC6A 1VSMA 1S1TB 2OPPB 4M3TA 4DSJA 3OYFA 2FJXA 4AHRA 2W8KA 1YVUA 3NMAA 1N6QB 3M9OB 4TYAA 4B08A 4KFBA 2OZMA 1T05A 4O0IA 4CJLA 2YHBA 4BE2A 4WYWA 1SH3A 3KHGA 4FZZA 2IAJB 1RBVA 1JLBA 4K4XA 4ECTA 4FLTA 1NKCA 3KMSA 4U7CA 3HPGA 1IG9A 5CYMA 3HJFA 4FK4A 1HARA 1QS4A 4FJGA 3TR8A 4URQU 4CF2A 2FVPA 1RBRA 4XIUA 4B8AB 2HMIA 5KFBA 3QEPA 4FLWA 2HNZB 2D3UA 3RB0A 3IGNA 2A1RA 3HL8A 4I7FB 1NNDA 1WSJA 4CFDA 2XO7A 4CGDA 3BQ0A 5FRNA 1IO2A 4EZ9A 2ITGA 4RNMA 4IG0A 3QZ7A 2AU0A 4CJ4A 2V0NA 1S1XA 3VQPA 1GOCA 5KFZA 4E3SA 2P5OA 4FVMA 4AHVA 3L2UA 2HHVA 3JSMA 3HHKA 1BIZA 3V6DA 5KFYA 3AVHA 1BISA 3TAQA 4KHRA 4RW7B 4CJ3A 1WAJA 1DTQB 4FZYA 1R0AB 2D0AA 4Y3CA 1T8EA 4GMJB 1C0TA 5KG6A 3G6YA 1TKXA 3AA5X 3RBEA 3OYGA 4NLXA 1L5UA 1O1WA 4JV1A 4JS5A 2X6NA 1QHTA 3QYYA 2XY6A 3RBDA 3IRXB 4O44B 1WLJA 1J9AA 3V1QA 3WNHA 5J2PB 5KT7A 3BR9A 3NBPA 5KG1A 3DOKA 3FRZA 3FFIB 3AVFA 1JLGB 1LV5A 2W9CB 3MXMA 3HK2A 3I0SB 4B9NA 5D3GA 4PUOA 1HYSB 3CJ4A 4M41A 4Z4IA 3OL8A 4FK0A 4K4TA 2YKMA 1S9EB 5KG2A 2B5JA 2G8UA 5FDLA 1ZTWA 3KLFB 3QO9B 5K14B 1FK9B 5HRPA 2AJQA 4HUFA 4M3RA 2RF2A 4RZRA 4Y2AA 5KG0A 4CFAA 4DSFA 3NE6A 1HMVB 2G8VA 1X9SA 3QGGA 4DQSA 4WYLA 4U6PA 4CHNA 2F8EX 3NF8A 2C28A 1Z25A 4CGHA 5F9NA 1TAQA 4ZHRA 1KLNA 1T7PA 2FBYA 1RT6B 3RRHA 4ECYA 3V9SA 1RAJA 4NLGA 4CK1A 1C6VA 4QOZB 4LSLB 2XI3A 4LH4A 1VSHA 5EWEA 1RT2B 3KK2B 1N5YB 3QNOA 4JUZA 4TQSA 1LWFB 4KO0A 3SQ0A 1C0UB 2KFZA 3SUOA 2BANB 1G15A 1VRUA 3NAEA 4ZPDA 2C22A 1UAXA 1IKVB 4B3OA 1EKEA 3DDKA 4QWBA 2JEJA 4I9QA 4KE5A 3HYFA 3G6VA 1BQNA 4F4WA 1C1BB 4Z4CA 3HSTB 1S1WB 3MECA 2D0BA 2DFEA 4J2BA 3PHEA 1JKHA 1U48A 3TABA 3MEDA 5DGAA 3MEGA 5KGXA 4CGJA 3P83D 3CM5A 4O3SA 1D1UA 2IS3A 1HJRA 4O55A 2R2RA 4KHUA 5C5JA 1N56A 2YNGB 2XRIA 2QK9A 3ISND 2V9WA 1Y97A 4F4ZA 3QETA 3DMJA 1LAWA 2QE5A 3FQKA 1HQEA 3KNAA 4F2RA 1LW2A 1RTJB 1I39A 3SFGA 2IOCA 1JX4A 4MFBA 1S0OA 3I8DA 4NCAA 5F8JA 3DRPB 1ZETA 1ZBUA 4ZP6A 4E7KA 5HRNA 3RB4A 4DFKA 5EUHA 3U6FA 2ILYA 1C2PA 4J9LA 1EXQA 3K59A 4NLPA 4IG3B 3BGRA 3NL0A 3PUFA 2YKNA 3V81A 1NK4A 5C25A 2PZSA 5KG3A 4O4RA 2XC9A 3K58A 1S6QB 1JLAB 1NJWA 1RA6A 2OPRB 3RR7A 2OPQB 4CERA 2CJQA 3AO2A 4ZPCA 3CQ8A 2Q3SA 4JRQA 3DRSA 2YV0X 5KT2A 4H4MA 1SKRA 1VSDA 4CHPA 4FLZA 1S1VB 3NF9A 4R5PA 5KT5A 5I3UA 3DLKA 3KHRA 4K4VA 1JL1A 1ZBHA 4M45A 4DQRA 1N48A 4LD0A 2VA2A 1TV6B 5DK5A 1S6PA 4MK9A 1BCMA 4M3UA 3CJ3A 2WONA 1KVCA 3VQ4A 1S49A 2FBTA 2WTFA 3HVTA 3N6MA 1BL3A 3UIQA 1QSSA 1TQLA 5C42A 3VQ8A 4ZTJA 2PYJA 2VG6A 3CFPA 1HNIB 3DLGA 2D3ZA 2IBKA 3DLEA 1HPZA 4N41A 3G10A 1S1TA 3HM9A 4EZ6A 5F8NA 3QIOA 4QCLA 4B9UA 4G1QB 5KG4A 1JXEA 4FXDA 3V6HA 4KB1A 3GV7B 4OVLA 3CFOA 4TLRA 2XCAA 1N6QA 3AA3A 1JLQA 2WCXA 4C8OA 2VA3A 4DU1A 3EZUA 1NK5A 4HYKA 2IAJA 5KGWA 1XHXA 4HUEA 4ID1A 3OYLA 5KG5A 2W7OA 1W0HA 1ASWA 3OYMA 2IM3A 1L3TA 3BSCA 1D9DA 1BHLA 5CY4A 3MR5A 3ASMA 3KK1B 3TVKA 4EP4A 1DLOB 1U4BA 1ZYQA 3BREA 2V4RA 1VSKA 1RTHB 2YNIB 2XGPA 3TQ1A 3T3FA 3I0RB 2XHBA 2HNZA 4NLVA 4IFVB 2WK4A 4ED8A 4I7FA 4KHSA 1NK0A 3QGHA 1XR7A 2GBZA 4Y1CA 4NCBA 1U49A 2R8GA 2W9BA 3BQ1A 3Q8SB 5E41A 4Z4GA 3OHAA 5CZ2A 5KFFA 1S4FA 3AV9A 4ED1A 3WNFA 3BSOA 1QUVA 4B9LA 5HBMB 5KFNA 1SL2A 5L1JA 2FVRA 2X78A 4CJKA 1U47A 4N76A 4CE9A 4CF1A 3PW0A 4HCCA 3K57A 1SUQB 2OPSB 4FS1A 4J2EA 3GV8B 3OYAA 2BRLA 1BQMB 4RW7A 1BGXT 1KHWA 3SPYA 2FJVA 5KFJA 3SJJA 1LWEB 3MFIA 1QE1B 3DI6B 4E7LA 4XPEA 4O4GA 1IM4A 4Q45A 4QWCA 5KFSA 5F8IA 5KT6A 3NH0A 5HP1B 4DQQA 3IRXA 2JGUA 4O44A 3RMDA 1B92A 4URGA 1S5JA 2YHAA 4GC7A 2VG5B 3FFIA 3V4IB 1JLGA 4NLRA 5KFUA 2W9CA 3I0SA 4WFXA 3SNNA 3PVXA 4PWDB 2GIQA 3IG1A 4F50A 4CF0A 1HYSA 3RMBA 2HVHA 3LP1B 1TL1B 4KV8B 5KFLA 4LH5A 3V6JA 1WSGA 5KFCA 1WAFA 1ZBIA 1RT5B 3OSNA 5C24B 4CJVA 3H5XA 2W42A 1SKSA 3U3YA 3KLFA 4ECWA 5K14A 1FK9A 4YQWA 2AGOA 2O4IA 5F8MA 3MF5A 1Q8IA 3K5OA 4DG1B 4KI6A 1HMVA 4MKBA 1S9FA 4WE1B 2OYQA 3LWMA 1NK9A 1S1UB 4K4WA 1ZBFA 1Z4UA 4J9RA 4CEEA 2JEFA 2IC3B 3DM2B 1RT6A 4DL5A 1HYZA 1VK0A 3T5KA 4LSLA 3TAMB 1F21A 2G8WA 1RT2A 3KK2A 3SUPA 1N5YA 1ASUA 1TVRB 3TANA 3G86A 2R8HA 3IS9B 3H59A 1NHUA 3H4DA 4KB0A 3P1GA 1C0UA 3GIIA 4JS4A 4CJEA 3KD5E 2BANA 2P51A 4ICLA 4EBDA 4R8UA 4ZTFA 1VSEA 4M3ZA 1C1BA 2ZE2B 1S1WA 3M8QB 3M9NB 2HHTA 3AVKA 3GV5B 3JYTB 5DMRA 3V9XA 1SL0A 3SV3A 3RR8A 3DLHA 4RW9B 4RUCA 4CEBA 4CF9A 2AX0A 4AILC 2YNGA 4JV0A 4FLXA 1HNVA 3SQ2A 4ZPBA 2FLPA 3U3GA 4FCYA 4K4ZA 3OYBA 3ZSZA 1NJZA 1RTJA 3ZSOA 5I42B 1IKXB 1GOBA 3RWUA 4TY8B 3DRPA 4OKKA 3DYAA 4KTQA 3IGVA 1U04A 3ZT4A 2RKIB 3GIMA 3HPOA 3UQSA 4FJ7A 3CVKA 4IH5A 3UPFA 4QW8A 5J2MB 1XWLA 1JLAA 4KB7A 5CZ1A 3KLVA 2OPRA 1WNEA 2OPQA 3OY9A 4FJIA 4CIFA 1TKTB 2C2RA 4F4YA 1S1VA 4M3WA 2W7PA 4MIBA 3ITHB 2E9ZA 3H2LA 2E9RX 4NLSA 3EPIA 3A2FA 3MEEA 3KHLA 2RPIA 3NH1A 4RW6A 1MU2B 4W5NA 3PO4A 3HO1A 2HVIA 2HNYB 1TV6A 2WB4A 1KVAA 3MAQA 3ULDA 4FJ5A 2KQ2A 2ASDA 4Q43A 1TL3A 4NLDA 3BSAA 1L3VA 1S9GA 4TYBA 5KFOA 2DPIA 3K2PA 2GUIA 3C6TB 3DLBA 2QKKA 4L8RB 4IR9A 4DQPA 3OLBA 1HNIA 2IM0A 1RYRA 5DG9A 4FBTA 1RTIB 5SZTA 3QZ8A 3T5HA 4DF8A 4ECXA 1GOAA 4FM1A 2HHXA 2RN2A 1IKYB 2IA6A 4C8KA 1BI4A 3KJVB 4URSA 1QTMA 1RT4B 2BGGA 2J6TA 3OYHA 5KT3A 4FLVA 4RUAA 3IAYA 2VG7A 4LSNB 4AHSA 4FJJA 3KK1A 2R2SA 2PY5A 1DLOA 4X2BA 1KTQA 4N47A 1DTTA 1TK0A 1Z26A 4OPKA 1L3SA 5KT4A 2F8TA 4B9TA 2HHWA 4IBNA 3LP3A 4FJNA 3BDPA 2DY4A 1RTHA 2YNIA 4TN2A 2EX3A 4EP5A 1XI1A 4KRFA 3I0RA 4NLTA 3AVNA 4K8ZA 4IFVA 4NCGB 3QEIA 2FVSA 4ECUA 1ASVA 2ETJA 4DMNA 2G8IA 3ZSYA 1B9DA 3GIJA 4F2SA 1JXLA 2R8IA 4M42A 4ECQA 3OJSA 2GV9A 3PR4A 3H5YA 3L2VA 1XHZA 3OJUA 4FJ9A 3VQ5A 4J9KA 1WSHA 4TQRA 4KHNA 3DRRB 1CXUA 4CGGA 4ID5B 3LP2A 1FKOB 1RTDB 3FQLA 1C1CB 2OPSA 5KFKA 3OYDA 3S3NA 4KHWA 1S10A 4DTSA 4MQ3A 1LWCA 3NKYA 4GW6A 4Z4FA 1OS5A 5F8GA 2AGQA 3O3GA 1CXQA 1RT7B 2BRKA 1ITGA 3DI6A 2HWIA 1A5WA 4E1MA 1SL1A 3VQAA 5DLFA 3QLHB 2D7SA 1EETB 5CYQB 3H5SA 4B8CA 4O3QA 5HP1A 2AGPA 4CJWA 4PY5A 2R2UA 2XY7A 3QNNA 1KLMA 4RW8B 3LANA 1U09A 4WXWA 3PR5B 2EHGA 5EWFA 5JUMA 5DG8A 4CHOA 2ILZA 3E51A 1KHVA 2VG5A 3V4IA 3QEWA 2EC0A 2IJNA 4E7IA 3QESA 4KFBB 2Z1HA 4DLGA 4PWDA
chains in the Genus database with same CATH superfamily
4Y2CA 4AHTA 2E6MA 4CCHA 8AT1B 1FNMA 1SI9A 5HMXA 4I2QA 3N01A 1UKUA 3G71N 1GMUA 1HBNB 4ZLJA 1VIXA 1KRPA 2DTUA 1Q53A 4NXNK 4JI5J 3VHQA 3MTKA 1IBKK 3MR3A 3THPA 4DTOA 4LT6A 3HKWA 3D6RA 3PJXA 2M5YA 2FJWA 1FEHA 4ISGA 1URNA 2FBXA 3HOSA 2I5JB 3LALA 4WE1A 1WN7A 2V8HA 2CGKA 4GVMA 3CCVS 2LFVA 5G0RB 1N32J 3UVJA 2RAQA 1JLCA 1RDRA 4P7VA 5B08A 4AL6A 4FZXC 4DV5J 4MO5A 3KLEA 3DGPB 2M7SA 4DCOB 2H3GX 2BDPA 4LFCJ 2AEFA 1L3KA 4J9NA 5GINA 1X5PA 3ZXWA 2OKQA 4PXBA 2IHR1 2DNHA 1XNRK 1QUPA 5KFEA 1DFDA 2BE2A 4G1PA 1VQ6S 2HNDB 1VK8A 2W6KA 1C0TB 2FZKB 2OPPA 2CA9A 1CSJA 2XLKA 1C0FA 1FDDA 1D4XA 4ECZA 1RCOB 2HK3A 2A6AA 1H2UX 3QJLA 3JYTA 2KL8A 3LP0B 4H4KA 2OI2A 1OVQA 3UNYA 2UUWA 5FRMA 4RW9A 1Q86O 2YH0A 3ZT2A 1E6VA 1S72N 3ZZ0A 2VBWA 1CEZA 4OZ2A 4QWAA 4CJTA 1WWHA 2KM8C 1LEOA 4LF5F 2CNKB 3IAM9 2AX1A 5A8RA 1MSWD 3T19A 5HK4A 3ISZA 4A2BA 3BH7B 3ID8A 2DHAA 4JKFA 4OLOA 2V5HG 3R7SB 3OL7A 3VQDA 5D15A 3LM9A 3G6ES 4CJ5A 4C3LA 3TWZA 4USVA 5FDLB 1T95A 2W8LA 1NWKA 1KD1T 2MKYA 4ZJLA 2ZD1B 1RHJB 4F3OA 4WKRA 5D77A 3CCTA 1HA1A 3RVCA 5BR9A 3JTOA 4WFAL 2GZOA 3I87A 3OVNA 3VVTA 4CEDA 1N34K 2J0WA 3J7YI 1DTQA 2YQ3A 4R0JA 4X62F 1S59A 2FY1A 1VSLA 1RQ0A 4DR7K 2QA2A 3NCIA 4OPJA 4AFFA 1U02A 2ALYB 1R27B 2JJ4D 1GT8A 2Y0SD 4FWNA 3P5JA 4OIXA 4KSEB 3EZOA 5KFIA 3SDEB 3K5NA 2E5LF 4ZP8A 4KR0B 2QL7B 5AXKA 2F4VF 3VEWA 4NLYA 2HLUA 2I0XA 2MKSA 2CNNB 3T1HF 4ILLA 4O3RA 1ZAVA 3CCLN 3D1QA 3B8HA 5KFDA 2FJAB 1BUPA 3VQ7A 1HJOA 5IT9U 2UXDJ 3CJ9A 1UJ5A 4NX9A 3Q8YA 1HNWK 4M5GA 3CQXA 1LAVA 3BO3A 4M5IA 1RAIB 2LU2A 1FRMA 2X1AA 1JXBA 1EQMA 3OW2R 4TLQA 3I56S 3LO3A 3O6WA 5AJ3K 2IVOA 2VWJA 3AY9A 3R5JB 1F5AA 2OANA 2ERRA 4PG4A 4WYBA 1IKWB 4JI3K 2KW4A 2GNKA 2I7PA 2VF3A 2LXFA 2H3EB 4F4KA 1XNQK 3IWXA 3HSDA 1NGBA 1FX4A 3Q8QB 2J5AA 3BYRA 5F8HA 4CIEA 1DQAA 3B54A 4QPXA 3QEXA 4ANCA 4EAHD 4H0PA 4M3XA 1WKLA 3CC2S 3CHWA 1YF5L 1GLAG 3PSFA 3W60A 1WSEA 1XR5A 1S6PB 1CJTA 1MROA 2FDNA 1IKVA 3C16A 3THWA 2HS3A 2LSNA 1MN7A 3NWGA 3M6UA 3U1LA 1RU1A 3SCIE 1HI1A 3CI5A 1NHVA 2R7QA 1KTVA 1XMBA 2ZBIA 2HZVA 3QEVA 4FKXA 2E4LA 2IM1A 2ZFHA 4IKAA 1NKEA 2O01C 1SKWA 1S22A 1Y3JA 1NB7A 4LC9B 4GVBB 4Y65A 3M9MB 3OYEA 1BOTO 4BQZA 4X84A 4IEEA 4NLBA 3CD0A 5KFHA 3TP2A 4IR1A 1WSVA 4ZJQA 2B6AB 5HRSA 1SPBP 3WDOA 3GR0A 4EO6A 1OPIA 3C94A 1QJHA 4O0NA 1X0FA 3PW7A 4FKYA 2UVWA 1JCEA 1YT3A 4OYAA 2MZTA 5GAEI 4NA1A 2EW9A 4FJKA 3SQ4A 1CZBA 4IFYB 3QB0A 3W61A 4YOEA 3MR6A 4HCBA 3ZX3A 3IN5A 3MAAA 3UDCA 2AWZA 1UPMB 2OJ3A 1YXQA 5B0GA 1Y9OA 2WW4A 2MGZA 1JJCB 1TMMA 5LOQA 3O3LA 2YXLA 2AJ4A 4MLEA 2MJUA 1RXOB 1PJ5A 1TFWA 4MMOA 3CD5A 1S6OA 4HI2A 3RSEA 2IVMA 4NZ6A 2CQ3A 2P1JA 1WOSA 3QMQA 4LIRA 2XCPA 4PQUB 3M3ZA 3NDKA 3AY0A 3TNVA 5AE3A 1PIEA 1QAIA 4X4PA 1Y5IB 4IOBA 2KFNA 1V3RA 5ETLA 1RDAA 2XLIA 1FWKA 3P6YC 2KKZA 4LF5J 2AJ0A 1WBDA 4FYVB 3WNEA 3QSYB 2BH1A 2B0GA 1T03A 3T1AA 3SBMA 2JEGA 4Q8FA 4B9MA 2QC3A 5A0YB 1U2VB 4HVJA 3U1NA 3FSXA 3LWLA 1TKZA 3ZT0A 4CEQA 3IC1A 3E8OA 1OQ3A 1CJKA 4V19J 4KGMA 3ZLJA 1UJ6A 3JS9A 3Q24A 2QW9A 3IG1B 3H90A 2KT3A 4DSIA 4O0JA 5D78A 3EEQA 4GVLA 3ZSRA 3MMBB 3P38A 4X62J 4DX5A 2CXEA 3C15B 2FPHX 1U1OA 3L7PA 5M1KA 1HUXA 1BLUA 2MSSA 2XMKA 2A40A 4QWEA 1BWVA 4WQ5C 3DU5A 5LXRA 2NZ4A 4IDKA 1U2RA 3VWSA 1NJIT 2QZ8A 3M5RA 1NGGA 2E5LJ 5HROA 5A2QO 2F4VJ 5LSLA 5L9XA 2HBYB 1KC8O 4RG8A 4CHYA 2KM8B 1UA0A 3T1HJ 4JI8F 3Q8UA 2F9TA 2Z1IA 3JSBA 1QE1A 4OFZA 5BYRA 2BKOA 4YHHK 2XO6A 5HAOA 1S57A 3IBFB 3W2VB 3SUNA 1VQ4S 2RRBA 4G1IA 2DYAA 3EKSA 3H40A 4JK7A 5E7OB 1EWRA 2QM1A 5AFUA 3CC7S 5L1KA 3IM9A 2MY8A 4B9VA 4IRKA 5KFXA 4CIGA 4Q2LA 2DISA 1T6DA 1SC4B 4ITSA 4MDAA 4LR9A 3TOQA 1RT1A 1RP5A 5SWMA 3ZTPA 2D5RA 2ASJA 2ZJRL 1VQSA 1BA0A 1OH5A 3MM8A 4FJHA 3AT1B 3H98A 5M1OA 1EARA 2N4DA 5CYMB 5HVHA 4J9UE 1H6KX 4QJVA 3CC4S 2HSTA 3GYNA 1MDUB 4AL7A 2E29A 5KFWA 3PZPA 4DG1A 2WVCA 3PX0A 2EFGA 4PKHA 4DOZA 4YR2A 2OLWA 4HLBA 5GMDA 4LF6F 2LA4A 3KTQA 3M1VB 3GG4A 2J8SA 4N5SA 3FCHA 1G4CA 2MZQA 1P8ZA 1KSPA 5JVGL 3EXYA 4BR4A 2BQ3A 5M1NA 1FD2A 1HD1A 2W4PA 3NLCA 4DTNA 5AQZA 3JSMB 5JXSA 2YHWA 5B0AA 3NAHA 1NOYA 2C3UA 3G8TA 3AVBA 2E1AA 3IFEA 1WUAA 5T7BA 2B8QA 2CPEA 2ZH9A 2XTJP 3NVMA 1X9JA 2NXCA 2VFVA 2M0GB 1VBYA 4NO7A 1U8SA 5J1PA 2AP6A 3EL2A 3UNGC 3Q8RB 4JV5K 4E1NA 2XGQA 3LDQA 4CFBA 4HKQA 1RA7A 1UP1A 2W24A 1Q8LA 4Y1DA 2FLNA 3FSYA 3SSRA 1DAXA 2HBZB 1J5EF 4E8UA 1QSLA 3CJKB 1DHMA 3PX6A 3DOMB 4YP3A 3QIPA 2V4QA 4PUOB 1IR0A 4XH5A 1X1PA 4OX7A 3VQBA 5M2UA 4LFAF 2A1SA 1GLEG 3AO3A 1S12A 4CFCA 2XMTA 1M5PC 1VK3A 1VQLS 1S0NA 5J2MA 2FC0A 5HVGA 4B3RF 1WC3A 4CLTA 2QMWA 4UOFA 3ZSQA 4HHJA 4GO5X 5T41A 3P4IA 2VPYB 3CCRN 4FW1A 4DV0F 2ZH7A 3JS6A 3EJMA 3SCKE 2HHQA 1MU2A 1HRHA 1OIAA 3TZWA 1OKJA 5BR8F 3CCSN 1PAEX 3WT0A 4DPOA 5F2RA 4J9PA 5H9EK 5RUBA 4KO0B 3RUBL 1VRUB 4FK2A 5IM0A 2QWPA 1FT8A 4DFPA 1JJ4A 4WFYA 4WFNQ 4IOXA 1BQNB 4P10A 3L2WA 3D0PA 3T41A 3PCOB 1HBMB 2GQ2A 3AHPA 1WSFA 2JFKA 1OYEA 5B09A 2YNFA 1LQ9A 4OGCA 3J7YU 4Q0BA 4YFUA 5BRFA 4FOEA 2UU9K 3NG8A 3AVIA 4DJBA 1HQEB 5EDWA 4MFBB 1KVBA 4KPYA 4EBCA 3H6EA 4QIFA 1CJUA 4CT8A 1KKHA 5GVQA 3MCSA 4Z2XA 4CBWA 4JI8J 2UZAA 2EXUA 2D41A 3RMAA 4R25A 1YG0A 1JJHA 3IR5B 2DR8A 1JB0C 3ZSXA 1REVB 2B9EA 3BF1A 2YKAA 3MXIA 1WHYA 3PFEA 1IJEB 4ERDA 4DFJA 4M3YA 4LY7A 1TUYA 5C7PA 4ID5A 2AJFE 2R3VA 3VF0B 3PYDA 4QOTA 3KOAA 3VERA 3AVJA 3CPWM 3S3OA 1W2IA 1K1SA 3W2WB 1DEJA 1EHWA 5I3PA 3QINA 4WFZA 2EWSA 4BWJA 4WXOA 1JLEA 1Y00A 3IAS9 4AH9A 2J6UA 2MDAA 3I5CA 2VIHA 5CYQA 1TYQA 3H20A 3TZXA 3VGMA 1U24A 5CHIA 4PWWA 3CCUS 2LDYA 1N33K 3F0NA 3OYFA 3ZTSA 3NMAA 3ZEUB 3FMWA 3ENBA 4UZBA 2E2QA 4WYWA 4LF6J 1WI8A 3VTIA 4LF9K 3FGUA 5A8WB 2AMCB 4FPRA 4FLTA 3LL3A 1K73T 4I68A 2A0FB 2V2KA 4LRFA 4U7CA 1IG9A 3FBEA 2NQPA 3OA9A 1JJ2M 2UUBF 4FJGA 3TR8A 3FEXB 2MKIA 1R0BG 1XMOF 1FKAF 1T02A 5B0EA 4MLHA 2NYIA 3NMRA 3HL8A 4I7FB 2U1AA 3VAMA 4CGDA 1IO2A 2ITGA 4RNMA 2AU0A 5F1XA 1ZM9A 1S1XA 2EEYA 2FXUA 1UFWA 5IFMA 1BHNA 5KFZA 3MM5A 2QTWA 1M90O 1BIZA 5GAEU 4OZ0A 2QSWA 3EMTA 4DV3K 2QLJB 2HS4A 1J5EJ 4CJ3A 4A46A 1B3TA 1HL6A 4CYUB 5MLCV 1T8EA 1OH8A 3G6YA 4BRFA 3M6VA 3TX0A 4LFAJ 3ET6A 3RBEA 3I9ZA 1XQSC 1L5UA 1U6BA 4KC5A 1O1WA 1QHTA 2XY6A 2HFVA 1CBKA 4B3RJ 3PKYA 3BR9A 2VPXB 4IXCA 3NBPA 2RS2A 3OXLA 2GO8A 1IBLF 3DOKA 3FRZA 1KEKA 1JLGB 2CDRB 3IBWA 4UQTA 5D6GA 4DV0J 2CDQA 2W9CB 4F3MA 1N0UA 5IWAF 4LF7F 5E84A 3D6MB 2GO9A 4CZLA 3MX2A 3DXKB 2YKMA 4FWMA 4E98A 2W2NP 4F0MA 5HJYA 5HMZA 4LFBF 3QO9B 5D4NA 1FK9B 2CJBA 4WP9A 1QHAA 4K7QA 4GKJF 1HQ2A 4CRJA 4DSFA 1YJ9N 5AQUA 3D0IE 3KFWX 4H4KC 4USKA 1WC1A 1X9SA 4CHNA 1WG4A 3PDNA 1AZSA 1XUPO 2F8EX 4EK2A 2VFRA 4YDXA 3VR1A 5F9NA 1RT6B 1G2EA 2H5IB 2HQGA 3R6MA 1QD1A 5HI7A 4BRDA 1HW8A 1M1KT 4CH0S 4JUZA 4TQSA 2RQMA 1LWFB 4QU6A 1C0UB 1RHMB 2ZM6F 1G15A 3NAEA 1WG5A 2IBOA 1VRQC 1UAXA 3TJ8A 4RKUC 3WQPA 1EKEA 4QWBA 1HIYA 5LJWA 1PCAA 1C1BB 2Z2ZA 4USJC 4J2BA 1OMSA 1FJGK 2PSZA 4C7QA 2ZF5O 3MM9A 3HT0A 4CGJA 3C6HA 3HD2A 5D4OA 3UI3A 3FBBA 1HJRA 1KAZA 4LF4K 4KHUA 2YKPA 2XRIA 1FRJA 2V9WA 1Y97A 1T3VA 3BKTA 5F0XA 3H1VX 7FD1A 1Y4ZB 3FQKA 4L73A 1I39A 1JX4A 3T7ZA 1DZ5A 2GELA 4I6YA 2KN4A 2CQPA 1ZETA 2YCHA 4ZP6A 4DFKA 1OSDA 4J9LA 4HTLA 3NY0A 1EXQA 4CLWA 4RR5A 1T9VA 3OXGA 2YKNA 1NK4A 1WF0A 4O4RA 1JLAB 4CTAA 3RR7A 3J7A1 2E2OA 3RZAA 2OPQB 4CERA 2KG1A 1PC4A 4JRQA 4XDDA 5K5MA 1MWKA 4ES3A 1SKRA 4X4UA 1HKAA 1R8CA 2P6SA 2W1BA 4B3TK 1S1VB 4HTIA 4R5PA 3M2VB 3GFZA 2XLJA 3WXMB 3DLKA 2HBLA 2ZH3A 1PKUA 4K4VA 1JL1A 1ZBHA 3PLAA 1N48A 4LD0A 3A5NC 2IVYA 3BGUA 4ENOA 3D2EB 2MXYA 4M3UA 4JNEA 1KVCA 3SEOA 2FBTA 1AXQA 3GG0A 1QSSA 1Q86T 4FO0A 2VQEK 3B8AX 2UXBF 2XYHB 5C42A 1GLCG 1V3ZA 3DLGA 3ZZYA 2K1RB 5ELZA 2UUBJ 2D3ZA 3DLEA 2IFXA 1VQ9N 1XMOJ 3G10A 2QLXA 3HM9A 3QIOA 4B9UA 4G1QB 2EKNA 3EM1A 2GS8A 3V6HA 3GV7B 1UCNA 4U7BA 1O6XA 2KI2A 3OPKA 2JVOA 3AA3A 1JLQA 3EZUA 3GJSB 1VQ5S 4OX9J 4ES2A 2COLA 3HD1A 4QR0A 1XHXA 3R1LA 2HFZA 5C15A 5KG5A 1W0HA 3MK6A 2IM3A 1D9DA 3CJQA 2W41A 3KK1B 1U4BA 3AAPA 1N88A 4B3SK 1K9MT 4BR0A 3DGVA 2P9KA 3T3FA 1TU0B 4BRAA 2CG8A 3I0RB 1LWXA 2HNZA 1X5TA 2G0CA 5IT0A 4TU8A 2P9IB 5ADXA 2JSXA 1XR7A 4JKDA 5T7LB 2OEJA 2GEMA 4L74A 3Q8SB 5E41A 2XS2A 4Z4GA 3LPYA 3OHAA 5KFFA 1S4FA 4NXNF 4ED1A 4MKVA 3BSOA 1QUVA 2K7JA 1B7FA 1EQ0A 3SK3A 2OMOA 4DU7A 4HCCA 1SUQB 4J2EA 2IRUA 2NPIA 1IBLJ 3DDIA 1IV0A 1KHWA 3ONQA 2FJVA 3LQVA 1HW9A 1LWEB 5IWAJ 3MFIA 2UP1A 3DI6B 3DHXA 4LF7J 4JD2A 1IM4A 4M5NA 4Q45A 4QWCA 4HHHA 5BRHA 5HP1B 2WSFC 3N0VA 3IRXA 4O44A 2GMJA 2B4OA 4JHDB 2EFVA 1WC5A 1RAGB 4GKJJ 3TSUA 2J0SD 4XAKA 2XS7A 2GHVC 4ZVSB 3FFIA 3ILOA 3BF3A 4KY3A 3G87A 4NLRA 2OTJS 1IR2A 4WFXA 3SNNA 5FPMA 2GIQA 3MUTP 4OI3A 2NZTA 3WQTA 1VQNS 5KFLA 3U02A 4EFHA 3V6JA 3ADAC 2B4UA 1RT5B 2WVEA 5A2QY 4CJVA 3H5XA 2W42A 1SKSA 1HNXF 3NNAA 3KLFA 4NYPA 4OV1A 4CW7B 1NMNA 5F8MA 4UUWA 5BPMA 2BM0A 4ZA1A 1QAXA 2ZM6J 2QN6B 1HMVA 4MKBA 2GGPA 1K0VA 4OX8A 4WE1B 1NK9A 2AYEA 1RGVA 1S1UB 5HN0A 4K4WA 1Z4UA 3SSQA 1TL7A 1WD6A 3UVJB 3POTA 1N5SA 4FYXB 4DR2K 4DR6J 3OQ2A 1HYZA 3W0LA 4LSLA 2G8WA 2CH5A 5LL6d 3TANA 3IS9B 2ZUGA 1K44A 2IIRA 2BANA 5CZXA 1SC3B 4CIOA 2RUSA 4R8UA 1FNOA 3QT6A 1S1WA 5AQLA 3WHIA 3M1FA 1AUSL 3JYTB 3SV3A 3B82A 1G1XA 2FY8A 1V3SA 2ZDPA 4RW9B 4CEBA 3I4PA 1NZ8A 1UFLA 1W7AA 2NRTA 3W7BA 2YNGA 4FLXA 1HNVA 3DHWC 2MQLA 3D68A 3SQGA 2F4FA 2L48A 2W4DA 3ZSZA 4ZVPB 3VQTA 1RTJA 5I42B 1ZPVA 2E5HA 5GADU 4FWKA 3DYAA 2F7TA 3OFHA 4KTQA 1U04A 2VBXA 4BRNA 2HHPA 3UQSA 2V7YA 3UKUA 1ACMB 2YJFA 4ZLLA 4IDHA 4MIWA 3T1YF 1YJUA 1UPPA 2H5JB 5AQVA 1TKTB 3D1OA 2C2RA 3HLUA 1NHKL 4QS7A 4Z7CA 4PQAA 1R8HA 1Q4RA 3HFKA 4DL0C 3MCMA 2XMVA 2E9ZA 2XMWA 2E9RX 4NLSA 2GMHA 2E88A 1BO5O 4RW6A 3FRYA 1TV6A 3MAQA 2B4VA 2WVBA 2AZ3A 2CIMA 2GUPA 4DR5F 4U8VA 4DX7A 2A10A 4LRBA 4BS2A 1S9GA 5KFOA 2IDLA 3DLBA 2XZTB 5DRKA 3OLBA 1NH7A 1XMQK 4DR1K 3FZBA 2H54B 4FBTA 2EBEA 6FDRA 2EFOA 3QZ8A 4DF8A 4LBPA 2QA4N 3ZC4A 4EUVA 4ECXA 4FM1A 3TRGA 4PG7A 5I4MA 1VI7A 3KJVB 1QTMA 3CD6S 4RUAA 2B3TB 4D3GA 2LKZA 3OVBA 4FJJA 1NMEB 2FZGB 5IC6B 3N4QA 3M4XA 1KTQA 4X2BA 4BR5A 2C42A 1L3SA 4B9TA 2HHWA 3D0GE 3BDPA 1W97L 2OTLS 2YNIA 4YOUA 2EK6A 1WUUA 1RSCA 1RBAA 4K2JA 4JKEA 4K8ZA 4IFVA 2UYTA 3RU0A 2J9EA 2FVSA 4JAXA 3ZZPA 4F2SA 3M6XA 4NI2A 1JXLA 2R8IA 1KC8T 5GAHP 4FXVA 4ZDNA 4CNZA 3QBXA 3H5YA 4Y00A 4OPAA 3NCRA 1WSHA 4TQRA 4H0VB 3T6JA 3CJ8A 1BU6O 5GMKa 2M9KA 3M8ZA 3VAJA 4NXMF 1LFWA 1NXIA 1C4CA 2JL9A 5LT5A 4BC4A 1FRKA 3PRBA 1CJTB 1MROB 1N52B 1RT7B 1CXQA 4WFNL 3W1YC 3THWB 4RBVA 2H4WB 3R6LB 4OZ1A 3L09A 2D7SA 1T9XA 3W5YA 4CJWA 5AQJA 4JEPA 1HNXJ 1VQKS 1VQOS 4RW8B 3LANA 2W2MP 2DGSA 4WXWA 2EHGA 5EWFA 2DVIA 1QQNA 3P5TL 3V4IA 5SUHA 2IJNA 4P73A 2BX6A 3QESA 2Z1HA 3WX8A 2KHDA 3CGIA 4PWDA 1U1QA 1TL1A 4KV8A 1KQSM 3QT7A 2CYYA 4RNNA 3ZZZA 3SPZA 1GEHA 3C8YA 4OI6A 1JLBB 2WRMA 3VETA 4RW4A 1LFPA 5CD4A 3HPHA 1A0OB 3H3NO 3VQQA 4HUGA 2BR0A 2MQMA 2YNHA 5BN8A 5EWGA 4A8OA 3GIKA 4NZ7A 4FLYA 1ITPA 4OHYA 4PZVA 3O8MA 3HHEA 3P4UB 2BQUA 4WU3A 5HRRA 7AT1B 4X4TA 2J9DE 2JH3A 4Q5VA 5E3PA 5B7WA 3RSEB 3K9KA 3DM2A 5L9NA 4FJXA 3MN7A 4PEOA 3TAMA 2A18A 3AOAA 3CEDA 4QQBA 4FPBA 3LAMA 2ZH6A 4BACA 2A41A 2ZGYA 4HL9A 4K43A 1MMLA 3EVMA 2E1MC 3PY8A 1T94A 2EG2A 1FRHA 4OYIA 3IR7B 4F02A 1NU0A 2HAFA 3A0IX 3MCPA 2F9JA 1T03B 4ZVFA 1HLWA 1PAUB 4YHHF 3CC7N 4ZPTR 2W9AA 4FJLA 4CGIA 5KRTA 3VAFA 2VJVA 3T1YJ 3MPUB 1CQMA 4FWRA 3OS2A 1TKZB 2O8DA 2ALZA 4OLAA 4AHUA 4EEYA 2BM1A 5HO4A 5JLFA 4LRAA 1B99A 1HKGA 3LPTA 3O80A 1ZC6A 1YBAA 1ZPWX 5C2GA 5D3GB 3HT3A 2XULA 4NA3A 3EX7B 3M6WA 4PKGA 4IRDA 2DXEA 1YJNS 4DQIA 2CZ9A 2QEXS 1A5VA 4DR4K 4KHQA 4HTUA 2O8EA 1YBTA 2EPIA 2RU3A 4PG5A 4DR5J 2KVQE 4NE9C 4DI6A 3BH6B 2U2FA 5LJ5Y 6AT1B 1BIUA 4IDKB 3O3FA 1TUGB 4LR8A 3EYZA 5LJ3Y 5HROB 4TSXA 3VEZA 3H4BA 3CPWR 4U96A 2I2YA 3O4QA 1R0AA 1B0PA 2KZMA 2G9OA 2KDOA 2JEIA 3R27A 5HL7Q 2HIQA 1N5QA 1VLOA 2AP1A 4O8KA 4Y2KA 1I3OB 4CK2A 4FLUA 1SQKA 1FNXH 1TP7A 4YR3A 3C7NA 1EQYA 3MURP 3PYFA 1PO6A 2D3O1 2NRHA 5M2RA 5LXYA 3AD9C 4AQYK 5B0FA 4X64K 1YJWS 1U45A 2R2TA 2CJXB 2LQBA 4HACA 4DUZJ 2Y1IA 1H98A 1JKHB 2Q43A 3MEDB 1IKYA 3S7RA 1PYSB 3M8SA 2O8CA 1RT1B 4CO1A 5L1IA 5F41A 5DDRC 1N36F 4CO2A 3GQCA 2DEJA 1M5VC 2AZ1A 1NBWA 1S9EA 4CLZA 1I5OB 4RWTA 4KHPK 5CR4A 3TO8A 3O2IA 3SCJE 3VCDA 4ER8A 1LW2B 3R5GA 4YNQA 1JJ2R 1HWLA 2P5VA 3GU0A 4RNFA 4BVPA 4NXMJ 1RDWX 3RAQA 2Z57B 5CXTA 3LGNA 5FPDA 4FWQA 4DTMA 3SYZA 3L95X 1YZ6A 1RCHA 2KRRA 4ALZA 2P9LA 3M05A 1HX1A 3IWLA 1IH7A 3BZQA 3BUZB 1NSAA 5KFRA 2FLOA 2HURA 3L7OA 3JAMU 3THYA 1J53A 3Q8PB 3JAMO 4AUKA 1RNHA 3DRRA 2SXLA 2PYLA 4C6AA 1H73A 1MWZA 4QWDA 2R7UA 2G0IA 2I38A 4YB6A 5K8NA 1JWWA 1Y0HA 2RNEA 3MX5A 4Y34A 3T5LA 3VF2A 2IDOA 2P8IA 4DV7F 4HDHA 1A9NB 4AM7A 1NK6A 4DL3A 1DQ8A 4K5RA 2DFFA 2BQRA 4KAZA 2UUCF 3GJTB 1XC3A 3R97A 1UETA 2W2QP 3TUJC 1GTEA 3TI0A 2HW3A 1TL4A 4BE0A 3F73A 2RHQB 1KP6A 3L3UA 3LH2S 3QIPB 2OELA 1UZDA 1SXLA 3AO4A 4CBUA 3O3HA 3SBGA 3BJYA 3AVLA 5DJBA 4B9QA 1CULB 1R8PA 4N7TA 4WZQA 1UEKA 2BW2A 3C3LA 3FEZA 4BC3A 2F40A 2PIIA 4GKKK 3F9KA 4ED2A 2LVWA 1GFWB 3VQ6A 1M90T 1KWMA 4ID8A 3KIOA 2Q6BA 1RBLA 2HHHF 4DPWA 1FESA 2XNQA 3NAIA 3W65A 2W9BB 4N77A 1SH2A 4WFBQ 2WOMA 3BZCA 1LNQA 1Q9YA 3A8IA 2LP4A 5AQQA 4LBHA 2VQFK 1X4DA 4K50A 2VFUA 4YHHJ 4QYRA 2W4CA 3W3SA 3TVYA 2ATQA 1XC9A 4WFAQ 2YHXA 1JCGA 3OUYA 3ICLA 3SQ1A 5HATA 1HPMA 1UWBA 1UOCA 4CZEA 2HLTA 4I64A 5ETQA 1VGYA 2B4PA 2WVFA 2CQDA 2IA0A 3CYMA 3DLLL 2J6SA 5E0OA 3DOLA 3GL1A 3SAGA 2BACA 2K7KA 3QMLA 2RDJA 3CMAS 1ZBLA 4C8NA 5ETOA 4OLBA 1YIJS 2YNFB 5GIOA 5EU7A 5FPEA 4A62A 4Q0BB 3CCUN 3DAWA 3IXQA 3M8PA 2AQ4A 1IWAA 2IIHA 4F3TA 1ZZFA 4JI0F 4BY9C 1LW0A 3M7VA 3TARA 3A8EA 2P9EA 1FCAA 2BYCA 1HI8A 3C2PA 4O5BA 2BUNA 1I3AA 1RAHB 1YITS 1Q9XA 4QBUA 3PV8A 3MHYA 1CJUB 4I69A 3O1LA 5FROA 2W01A 4L72B 1SV5A 1JLFA 3FMBA 1HHTP 3QJJA 2CJAA 4J9MA 4DWIA 1DGKN 4CEOA 3GE9A 3RW7A 1N8RO 4DV2J 2A6MA 4Q7AA 1XTZA 3J7ZO 1G6BA 3PXGa 3VOVA 4EWTA 2VODA 5E33A 4BDYA 4ED6A 3ZX0A 3OHBA 1PBAA 2FF6A 1BMQB 1MA9B 3KWMA 2BE7D 5HBMA 3K7RA 3KK3A 3R5DA 4UUXA 1YAGA 4FP9A 4UY8T 3MM7B 3QSIA 2FHJD 4A5BA 4BRIA 5J1NA 5A6WA 4CLUA 1BQMA 4F8RA 1Q95G 2JRSA 2FZCB 5J2QA 3VQEA 2RRNA 1N36J 2LCWA 2GX9A 2KKHA 2ASPA 4V19X 3H8YA 2DEIA 1JLEB 2OD6A 2ZZTA 4DL6A 4PYDA 4P9SA 3VA0A 3R1XA 3HZ6A 1TYQB 4P71A 3AQOA 2G8FA 2QXFA 1Q5YA 4ICLB 3M8YA 2CG4A 4OL8A 5DGBA 2DRDA 2MQNA 1GXTA 1N4LA 1WACA 4FNIA 4BG9A 3SFUA 5DDQC 3WQUA 5ETNA 5BXIA 2G8HA 1IG8A 1EX8A 5LMUF 2Z56B 2J9DA 4JKBA 4ZP9A 1ZAWA 1WORA 4YMEA 3FZFA 3F9MA 1KFSA 3KLGA 3D5MA 2KT5A 1RWUA 2JLGA 1Q7YO 5JMVA 3NGIA 1FFGB 2MEWA 4X4RA 2OZSA 4DTUA 4P2FA 1KQFB 4YDUA 2FJBB 5AQKA 3RAXA 3V9WA 1HBOB 1S1XB 4E89A 1CS4A 3UFCX 4DV7J 2EBGA 3SLCA 1YK9A 3MFHA 1KCFA 1RDBA 2HFNA 4YN3B 4JI7F 3QT5A 5L1LA 3KKSA 1X4HA 4OJGA 2UUCJ 3FGVA 3BKUA 4J91A 1NGDA 4HT5A 4CO3A 5CYJA 2VHGA 5JS1A 1UA1A 4OZ5A 2VU5A 1X31C 3PJ9A 3SJHA 2CJKA 4J2DA 3OYKA 4H0OA 4B3MK 5DQGA 2HG4A 5B0DA 2PDAA 4KREA 2UUTA 1LXNA 2ZE2A 5C12A 4DV1F 1Y7PA 3LPUA 1TL3B 3ETOA 2Q97A 4ZVGA 1DURA 2CPHA 2WBMA 4QPTA 3AJ2A 3CG7A 2GWJA 4YB1P 3U8XA 3UDVA 4PPDA 2IPOB 1A6LA 3HF5A 2FGCA 1P6TA 3NBPB 2OH2A 4WBFA 1WDTA 5JS2A 3DOKB 1XR6A 2HHHJ 3CCEN 1O13A 1Y5NB 1S99A 3LZIA 3OTOF 4IJAA 5H1SV 4RJVA 3WXJA 3CJ0A 2HHUA 4O23A 4DPXA 5EGYA 2VG7B 1CG2A 5DG7A 4BQLA 2CNOB 4B9SA 4LF4F 4KKOA 3UDEA 1DTTB 3OBYA 4C23A 2XBPA 2ZBQA 4JI5K 4Y28C 4H0XB 4FW2A 3M6GA 3WC2A 2NRWA 2QLWA 3BBBA 2IY5B 1T9YA 1I6JA 2LQJA 4X4QA 4IO9L 3GLJA 2F9WA 3MWTA 3ITHA 1AZSB 3EPGA 3GJRB 4I67A 3IMXA 4KH6A 1YZ7A 3E3XA 1OSCA 1N32K 3FSIA 3CIZA 3G82B 4FNHA 4F26A 2BOPA 3LP2B 2RSQA 3LPEA 3GSDA 2CPYA 4ZPAA 4DV5K 3IMQJ 2YWFA 4JI0J 3D0HE 4LFCK 2O4GA 3C6TA 1LWCB 1NEEA 4CJQA 1O5JA 2KTQA 3CJ1A 4USTA 4X4NA 3CIMA 2EI5A 1PILA 5KPTA 3K89A 2ZWPA 3AO5A 2OA8A 1FKPA 2HK2A 3MM9B 1KLMB 3QT8A 5F9LA 2K3KA 1Q5VA 2P9CA 4ATNA 3AAQA 2OO4A 5C2FA 1YSJA 2VCPA 2LXUA 1GXLA 2O1PA 3CJCA 2RRAA 3J80O 1NGJA 2F63A 3ENWA 4ZP7A 4MYUA 2XSJA 4ZVOB 4W92B 3PHTA 4AHCA 2Y1JA 5KRSA 5D8HB 2DY1A 5BN9A 2QLFB 2VUGA 4JI4F 2ZJRQ 1O51A 3OYNA 4ZN1A 1NPRA 1B0TA 4L3NA 1YTAA 1NKBA 2FVQA 1T3NA 1KFDA 2BABA 3FEYB 2V2ZA 1U26A 3BM7A 4NYZA 3DRXA 3OBWA 2JWNA 5KOWA 3ATVA 4CJFA 5AZIA 3M8RA 3DLJA 4LVNP 1VRTB 1RTDA 4ES1A 1S97A 2DJWA 1SH0A 4ZVHA 3VN5A 3GYGA 4FYWB 2I8EA 4P52A 3GYXB 3DXBA 3W9IA 1FTRA 2NUBA 4DU3A 4EYHB 3BYPA 3O9SA 4DZDA 5J1EB 2OSQA 4JV2A 1A7GE 3HBTA 5LMUJ 1JL2A 1ZZNA 4J9OA 3QLHA 3I5BA 3UKRA 3QBWA 2P9PA 1YVFA 2ZKUA 5C42B 4OKEA 1RK8A 1PJ7A 4X66F 2VICA 2QT7A 2A42A 3PKMA 1J6ZA 4I2PB 4M3TA 2LU1A 4EFAC 4DSJA 2FJXA 4AHRA 4ILJA 1YVUA 4D3HA 2PI5A 1NNEA 4KFBA 2OZMA 1T05A 2NZCA 2YBVA 4BE2A 1SH3A 3VEOA 3BGLA 4FZZA 1RBVA 2ZHOA 4K4XA 4ECTA 2V51B 2F8MA 2UXDK 2XWXA 4JI7J 1JXVA 3KMSA 1QS4A 4C48A 4CF2A 3ZX2A 2CVIA 1U7LA 2X3DA 2L08A 1FVQA 2P9KB 4FLWA 3G4SN 2HNZB 1IXKA 5AQSA 1NNDA 2DIVA 4CFDA 5FRNA 4EZ9A 4TU7A 3QZ7A 3H7HB 2V0NA 4DV1J 3VQPA 3LW5C 3AOBA 1GOCA 2NLXA 2YWWA 4XTTA 4FVMA 4E3SA 1QZ6A 3RG6A 3HRGA 1EIYB 4DN9A 4BCAA 3TA1A 3V6DA 4CDIA 3ATUA 1RLCL 2DRBA 1LKZA 4KHRA 2FSNA 5EHHA 1T0TV 2XHWA 2DT9A 2UXCF 2D0AA 3OTOJ 3CCQS 1C0TA 1Q8KA 2GJIA 5D4LA 3ZNJ1 1HD0A 4BG8A 2YVSA 2HFOA 3Q22A 3RBDA 3HSZA 3IRXB 4O44B 1F2HA 1WLJA 3VAKA 5J2PB 5KT7A 1X4FA 4OYPA 2AIRB 1GMVA 2NUUG 2HRYA 3MPDA 5KG1A 2GHPA 2O67A 3G71S 3FFIB 3HK2A 3OHRA 4YOVA 3JXUA 1KQSR 4Z4IA 4F0HA 2FF3B 2NRVA 3OL8A 2HZAA 4DV6J 4K4TA 2D1CA 5FDLA 3IP0A 3D2FA 1ZTWA 3KLFB 3MR7A 2AJQA 1QQOA 4HUFA 1W26A 3R2DJ 2C2OB 2QSFA 2NSCA 3PNIA 1HMVB 3MMAA 2GGPB 4V1Ak 4H0YB 2A1BA 5LMNJ 1RWPB 1B70B 1Z25A 1TAQA 1TL7B 2PMHA 3NP5A 3MPWA 1U1LA 1NLVA 2KYXA 3RRHA 1U25A 3V9SA 5HANA 1R0CB 4NLGA 3ULEA 2LECA 5DETA 5HL7L 4LSLB 4QOZB 2G0JA 2DCLA 1S3XA 4P74A 3QNOA 2YJEA 1IN0A 1R6VA 1VAZA 3C46A 3SQ0A 2BANB 4ZPDA 2N4CA 3G8QA 4AXJA 1CZAN 2JEJA 1SQFA 2MKHA 4LF5K 4JI4J 1WEYA 3THXA 4F4WA 3HSTB 1S1WB 1Y5LB 1S72S 2DFEA 3PIPQ 2MB0B 1HNZF 4AL5A 1FJ7A 4GV3A 1YJRA 5GAHI 3R9LA 3P83D 4FYYB 3IO1A 4DV4F 2Q0RA 1U0SA 2R2RA 3MGJA 5C0YA 2YNGB 1GMWA 2LA6A 2MZ1A 4F4ZA 4QIGA 1OH6A 1HKBA 3DMJA 3O5TB 1LAWA 1XMQF 4DN0A 3U9ZA 5AQWA 1XERA 3MWPA 2OAUA 1RTJB 1DY3A 1UWAA 1S0OA 3CDAA 4NCAA 3I8DA 4ZVTB 3U6FA 1U1RA 4IG3B 4J9VA 3BGRA 4X4SA 3N4PA 2YX1A 3PUFA 2A2CA 3GFYA 5C25A 1X4CA 2PZSA 1OYDA 3K58A 1S6QB 1RLDA 5AFUH 4X62K 4G6VB 4ZPCA 3CQ8A 3OTEA 2V7ZA 4OX6A 1V4SA 3DRSA 3DRYA 2YV0X 5KT2A 3MN6A 1VSDA 1VS3A 4X66J 1N5VA 4QYZJ 3EDQB 2CRLA 1YUWA 1GK8A 1VMBA 4JI1F 4DQRA 2E5LK 3NCPA 3S6EA 2KJWA 1TV6B 5DK5A 2F4VK 1IQTA 1S6PA 4BRLA 2D3OR 4C0OC 1VC5A 3T1HK 1HKCA 4ETXA 5CH7B 2ASOA 1F5CA 3HVTA 1BL3A 3UIQA 4OYBA 4QZVB 3QQCD 1TQLA 2KYZA 3I55N 3VQ8A 1FTCA 4V19S 2VG6A 2E5GA 3CFPA 3VGUA 2OSRA 1YLXA 3GCXP 2IBKA 3HHDA 2FQQB 4A8WA 3OD2A 4GVBA 3HULA 3I4HX 1WSRA 4EZ6A 4UTGA 2CQ1A 1JXEA 5KG4A 4FXDA 4KB1A 2DNQA 4OVLA 4TLRA 2XCAA 2XMJA 4OYOA 4P2MA 3NOGA 2RIJA 3J7YP 2CQ0A 5DM6Q 2VA3A 2BKNA 2LQ9A 3L4IA 2IAJA 3L6QA 4ID1A 4WTOB 4BRCA 4UOCA 1BHLA 1S0VA 3TVKA 4EP4A 5EY4A 3FCVA 4MT1A 3CMQA 3BN4A 1ZYQA 4NASA 2V4RA 1BWFO 1NAQA 3OTCA 2H9ZA 2YNIB 3O1BA 5DDOC 1HHQA 3TQ1A 4M7XA 2GIFA 2QFIA 3HSGA 4IFVB 1WG1A 2UXCJ 1RJJA 4WFBL 4Y1CA 1U49A 2R8GA 4NI2B 5BREA 1CVJA 4KJIA 2Q1LA 3VEYA 2QG9B 4OJHA 3WNFA 2J0XA 3ILJA 5KFNA 1SL2A 4ILMA 2XB2D 5THWA 2KU7A 5L1JA 2X78A 1NM1A 3DXMA 2GV1A 3GIRA 1T9UA 2ABYA 4UZCA 1XN9A 3TJAA 2BRLA 2DHHA 5F0UA 4RW7A 2IRYA 4S0MA 3DCAA 4FF2A 2VASA 2HFUA 4CVNE 5C2DA 5H9FJ 3V2UC 3L9ZA 2G13A 1FD8A 3X3UA 4E7LA 3IRWP 4X65F 4XPEA 5M1PA 3EE3A 3S41A 3NH0A 4CJ7A 2V8GA 2JGUA 2ATCB 1RDUA 1U1PA 2OEKA 5A0YA 1S5JA 3VALA 2VGMA 2YKQA 1IJFB 1Z6RA 1GXUA 2OP5A 1QLNA 3V4IB 3IDHA 3R3LA 3UO0A 5KFUA 2RMLA 4USUA 3I0SA 4PWDB 3TUIC 3IG1A 4CF0A 2W2OP 3RMBA 5ETRA 1TL1B 4KV8B 4L75A 5LM7E 3U9DA 1WAFA 3C15A 3U3YA 4M1KA 4NYOA 4O8UA 1FX2A 2Q36A 2DCUB 4YQWA 2AGOA 4JI6F 4K8RA 1Q8IA 2CPIA 3FZ2A 4PXDA 4H5TA 3LWMA 3TZZA 2N3OA 1AYEA 2CZ4A 3VF6A 3DM2B 4DR4F 1HNZJ 2R7RA 1VK0A 3NMUA 3I33A 3TAMB 4UOGA 1HWUA 4DV4J 5GAEP 1RT2A 3KK2A 4NEYA 1N5YA 1TVRB 1FE0A 2CADA 4CZIA 2DGQA 3H59A 1NHUA 3W2VA 3H4DA 3GIIA 4JS4A 1SAZA 3MMVA 3O44A 4FVUA 3BGOP 3EDRB 3P39A 3M9NB 2Y8YA 2GX8A 1R59O 3RR8A 4KGVB 4QU7A 1RGIA 5IZHA 3GB0A 4FXWA 4YOYA 1T9WA 4P2SA 2CQ4A 2O8DB 1MN9A 2I9SA 2FLPA 3U3GA 4K4ZA 3OYBA 4HH0A 1I51B 2BJEA 4CO5A 1NJZA 4AQYF 3ZSOA 4JP8A 2CH6A 4QIEA 1IKXB 3VEVA 3RWUA 3TU5A 3DRPA 4JI1J 3ZT4A 1KNZA 1TELA 3CVKA 3UPFA 1K0TA 5CE3A 1RWVB 4WF9Q 1XWLA 2O8EB 2MY7A 2ZWHA 3GOIA 2OPRA 4JI8K 5GAGI 3VAGA 3OY9A 2HVEA 4FJIA 4JYAF 3Q7CA 3W5ZA 3NGSA 3QPIA 3SAFA 5KQ8A 1KVKA 4M3WA 1FJEB 2W7PA 4MIBA 3FZMA 4KYZA 2DITA 1VJQA 2RPIA 3NH1A 2KH9A 1ZM2A 1B4SA 4OZNA 4U9RA 3PO4A 1MW7A 3HO1A 2HNYB 1ROFA 4BRPA 4I6MB 2KQ2A 1H2TZ 4RWWA 4HEA9 2Y1LB 4NLDA 3BSAA 4MTPA 2QKKA 5DDPC 1PBUA 2ZOMA 3HOTA 4YDUC 4RO0A 2IM0A 3C7NB 4KH5A 4JI2F 5DG9A 3CETA 5SZTA 1V9OA 2ADCA 4HACB 3JSRA 3B4DA 1VQ7N 1Q16B 2XYGB 2NS1B 1IKYB 2IA6A 2O8CB 2VFTA 5I9EB 2M4MA 1CJVA 1Z05A 1XEZA 2L3MA 1QVFM 2V94A 3GONA 3A5MC 3OYHA 5KT3A 1VC0A 2V69A 4LF6K 3IAYA 3C14A 1AROP 2QWOA 1N8RT 2P2CB 3J7ZT 2R2SA 3US5A 3G2XA 4IBNA 2DY4A 2ZJQQ 2QMUB 5CABA 2EX3A 4KRFA 3AVNA 1SJFA 3QEIA 1SJ1A 1YDLA 4ECUA 1ASVA 3QFPA 4DMNA 3ZSYA 2C3OA 2OD4A 2HS0A 4M42A 4GV6A 4X65J 2P9LB 2Y1RI 3M2RA 2GV9A 3L2VA 3OJUA 4HT7A 4J9KA 3MUMP 3QRPA 3DRRB 4OHXA 1ULRA 4P7TA 3FQLA 3UCUP 2OPSA 5A2QU 2AW0A 3A1YG 3S3NA 1S10A 5MLCQ 2Q31A 4MQ3A 4Z4FA 5G4DA 2AGQA 3O3GA 4A8XA 2E1CA 2MMYA 3UD5A 3J80Y 1J5EK 2DHSA 2HWIA 1NSKL 4OJ3A 1SL1A 3JSYA 2V2VA 2B9YA 4Y2IA 4O3QA 2AGPA 4LFAK 4WWSA 4LSZB 1SC1B 4PY5A 2R2UA 3VAHA 3QGPA 4C1NK 1KONA 3FLCO 4JI6J 5JUMA 3A12A 4CHOA 5ETMA 2DXDA 2XG8A 2ILZA 4CZCA 4B3RK 4TNOA 5CCMA 1Q7YT 3QEWA 1DBDA 1YIJN 2BJ3A 4E7IA 4K0KK 4DLGA 2K2PA 3MCNA 1WF1A 1VSFA 3LP1A 4DV0K 3FC9A 1A5XA 4PHTX 2RJZA 3A8JA 3PW5A 1REGX 2ZZMA 2PEHA 3QJPA 1I94F 4Z0UA 2O8BB 5C24A 1F5BA 3QICA 1FO1A 5KTQA 5HMWA 3CULA 4MK8A 2QL5B 1REVA 4R79A 4DL7A 4E2FB 1NPPA 1AW0A 2B43A 3AVCA 2W40A 2ZWOA 1ZAXA 3NGDA 1U1NA 3LTOA 3ISNC 3CCSS 4DLEA 2WOMB 3RRGA 4BGBA 1VHFA 5L39A 1NDCA 4OV6A 3HJVA 3UDLA 2IC3A 4IRCA 4IQXA 4KBIA 1UVIA 3OS0A 2WUSA 3NGTA 1RDCA 1BG3A 3LAKA 4LVOP 1AUDA 3ZTRA 1D8YA 1UWBB 2GQQA 3NS7B 4E7HA 2DNNA 5FLXO 3AA4A 4K4YA 4MK7A 3HX9A 2O8FB 3V6KA 3DWLA 5BPLA 3M8WA 3PW2A 2GAHC 1EB0A 1TKDA 2DY9A 3HMJG 3DOLB 3IBCB 1WBBA 3N5FA 4J9QA 2PEBA 2R7TA 4RNHA 4N8NA 5E3QA 4UY85 3GE1A 4DR3F 3GMGA 3SCXA 4FYDA 2YKOA 4DSKA 4A57A 4QR1A 1WSIA 3WXLA 1TK8A 3M8PB 4JYAJ 4BDPA 2MQOA 1RBSA 3T6BA 3QWPA 1U8WA 4AM6A 4OYMA 2V2QA 1LW0B 3SUQA 2DNZA 1X4BA 3TSQA 5E2QA 2B8PA 2FLLA 1W2BM 2FHKA 2QKBA 1F60B 2RQ4A 2IRXA 2BOAA 4TY8A 3WBZA 2RKIA 5ITHA 2Z1GA 4ZPVR 1SV5B 1JLFB 2GW8A 2HPUA 3D45A 2HEKA 1NMDA 2AYGA 1D0EA 1M5SA 4CHZA 3EY1A 3TUZC 1OWXA 1CLQA 2IDEA 2R8JA 1MWMA 5HMYA 2ACMA 3W64A 3KK3B 4QS9A 2UUAF 2F8SA 4NRUA 4TY9A 4JI2J 5KFMA 3W8GA 3ZSVA 3FNNA 5KQDA 1M5HA 2Z2YB 1ZM4A 1J27A 2Z8QA 3BGFA 1DKGD 3OL6A 4BRMA 3KJFB 2MTLA 4CYUA 5J2QB 3LDSA 4OKJA 1J2VA 4F4AA 4YORA 2QYGA 3R2CJ 4KI4A 4HDGA 5GMEA 1KAYA 4X4OA 5BPNA 5KFPA 2R7SA 4I9LA 2G2OA 3BN7A 1L3UA 5AXLA 5ADXH 3D28A 2KXHA 3ZO7A 2RQKA 4K5SA 1RTIA 4B3OB 3H5UA 2MLYA 1C4AA 4NEZA 2YWKA 2UUBK 3SMPA 1ILYA 3LDPA 3MECB 1F1BB 1IBMF 1XMOK 1RAOA 3RTVA 1TR0A 4ZIVA 4DX6A 3K0JA 4F3QA 4A8MP 1F3VA 2R7OA 3MXJA 3H42A 2RT3A 3C95A 4OX9K 4LSNA 1NSPA 3HI0A 2ITMA 3CJTA 2FJDB 2B9WA 1ATNA 2I1RA 2HB5A 3KUHA 3QO9A 3CUNA 1OH7A 3KLGB 5GADP 4IKFA 3TPQA 1SS6A 2UV8A 4GV9A 2IVPA 2PI4A 1YTUA 1QAJA 2NXJA 1BWEA 1YVNA 4ECSA 4Q2MA 2R7VA 4K25A 1ELOA 3QBCA 4CD1A 5M2PA 3KYLA 4OJ1A 4H5VA 4DUYF 4KGZB 3SI8A 4EHUA 4M5LA 4UOHA 1U6ZA 5JLHA 3CMES 5BYSA 4HVZA 3M30A 1FKOA 1RHRB 3ZTQA 4M5DA 1LWFA 2VWKA 3GP9A 1IBCB 1WEZA 3VZIA 1IBLK 3TTFA 2HQ3A 3BEXA 2D69A 3TYTA 3DLRA 3ELHA 2EFNA 3Q83A 4CP5A 5KI6A 2LMIA 5IWAK 3PIPL 2CKWA 4EBEA 2KO1A 2DR5A 2OHDA 1I94J 3DNCA 4NLUA 3MPYA 2HWHA 3NGUA 4PRFA 3OLAA 1S0MA 2J0QD 5AZJA 1WI6A 4DTXA 1TUUA 3KWGA 1RTZA 1HPZB 4LF8F 1Y3KA 1WKKA 1RE1B 2HBMA 3KVGA 2WSEC 2ZHBA 1WNSA 4E19A 4GKJK 4O3PA 3WIUA 2DNLA 1NPKA 4F7VA 4LQ9A 2XY8A 2HQDA 4LMZA 1R7IA 1YJ9S 1NUEA 1HQUA 4NLOA 4KKOB 3FR0A 3AH6A 3VPZA 3O8WA 2X1GA 3BPSP 4JK9A 5AQGA 4WP8A 3PFOA 3FK4A 3CWJA 1RB0A 1UEVA 3OYCA 3SCLE 3EZ5A 2JVRA 3M2VA 1HR0F 2ZM6K 2NXNA 3UR0A 1RYSA 2MSTA 3FDSA 2PE8A 3S9HA 4YR0A 1YI2N 4C8MA 4A8QA 3RMCA 3AGRA 4NYNA 4BE1A 3AVMA 1NOZA 4W90B 4DR3J 2R42A 1VQYA 3ENOA 2BTFA 3A13A 3C6UA 3CFRA 4FM0A 4DR6K 3P5BP 1P1TA 1GX5A 2CWKA 4OYXA 1RWKB 2CPDA 4ECRA 4A8YA 3D9BA 1NU4A 2V4JB 2Y9HA 1WC0A 1D3WA 3KWIA 2K1RA 4G9ZA 4CK3A 1RT3A 4ZOSA 4DZ6A 4BC2A 2ASMA 3LDOA 2V6AA 1MWYA 4G1QA 4O4GB 4ZVQB 4F04B 4CH1A 3C6AA 2QJ3A 4NLQA 2E1PA 3QATA 3OSPA 2MQQA 5DM6L 1FKPB 1P9QC 2KXFA 3V4MA 3VGSA 3H45C 1NDLA 4W5TA 5AT1B 3KLIA 2FYXA 1T6CA 2ZDOA 2D1KA 2XSJB 2UUAJ 2DHXA 4MDBA 2G2YA 4USMA 2GTDA 2P9SB 1IWGA 2PN6A 2FC9A 3E01A 3K9JA 5AQTA 4TKTA 1B0VA 2F65A 5BR8J 3MWBA 3FZHA 2DIUA 3OFEA 2BKPA 3NNHA 4KGKA 5FD1A 2UXDF 2RUGA 3HXMA 2VDHA 2OMLA 3QRRA 3TAGA 3HHLA 4DFMA 1H7XA 2LEAA 4NOHA 5AZIB 1RHKB 4C0HA 4EMDA 4OJRA 3EE8A 3WNGA 1SUQA 3SMZA 3V1OA 3WX4A 3ZT3A 2GJFA 1IBMJ 4IJNA 2CGJA 1WOOA 4FJ8A 1D09B 5A6PA 3TX8A 3JTPA 3KLHA 1LWEA 4YOTA 2JC1A 2M8HA 1VQ9S 4OZ3A 3J8AA 3ZCMA 3OFFA 3MD3A 2DO0A 3NF6A 2NNWA 4YB7A 1QQCA 1NH8A 1TAUA 2P9PB 4Q8EA 4KTZA 2F8HA 3V9UA 4DF4A 3LM2A 3CCQN 1KQKA 2DH9A 4OO1J 1NGFA 1ZS6A 5F8LA 3CCJS 3R6GB 2C2KB 4AYBD 3H25A 3GSIA 1T05B 1BCOA 3TA0A 2E5IA 4M8LA 4DUYJ 4WK1A 4QIVA 2KZZA 1X9WA 1XBWA 3KKRA 1SJRA 4N8OA 1RT5A 2HIYA 2DFHA 3THVA 1WELA 2ZQBA 4H4OA 4LQ3A 1GQEA 4OYZA 4FPAA 4JOUA 4C8ZA 4F36A 2VPWB 1RHQB 4KBOA 1S1UA 1EP4A 4PA1A 4K4UA 4BC7A 3NFAA 3RYLA 1M0SA 1O0PA 3TWHA 3CERA 1VR6A 1XK8A 3OR1A 3R5CA 2YX4A 3NXZA 4LF8J 3V6DB 5IV4A 3JTNA 1GX6A 3MEEB 3IS9A 1RILA 2BMBA 2GWKA 3Q7BA 3S3MA 4IOCQ 3LZJA 5CD4H 3GPAA 5AQRA 5HLFA 3CO9A 2GHWA 2RDIA 1RDDA 1RWMB 2MYFA 2BVZA 3ZETB 2NCKL 1AFJA 5AXMA 4L3QA 1T11A 2ZBPA 2D74B 1S48A 2BA9A 1HNXK 3DLLQ 3K5LA 4L3KA 1D9FA 1R43A 3HP6A 3BY5A 3CNQP 5I42A 4K59A 3Q23A 2AD9A 1BI4B 1HR0J 4DEZA 3P8BB 1P90A 1TK5A 4J2AA 4YY3F 3L2QA 3HI9A 4I4BA 1W9HA 4B1YB 5ADZA 4WF9L 1WTBA 2CQGA 3BDEA 3GFHA 3D6TB 3D2FB 3M32A 2IYIA 2J9CA 2XI2A 4OQJA 2FBVA 3SSSA 3N79A 1FEEA 4FWLA 1WEXA 4B1UB 2F9DA 5T14A 1P27B 4BWMA 1YRTA 3LDNA 2QGFB 1TKTA 3MMJA 4LRCA 2ATLA 2WW8A 1K9MO 2NUHA 3QDKA 3MMAB 1LOUA 4IH7A 3PO5A 3AA9A 5U47A 4O3NA 3SQOP 3U27A 2ZH4A 2RH3A 1DT9A 3L3VA 4BDZA 3B4MA 5ETVA 4JRPA 2HGLA 1GH8A 1IBKF 2D9PA 4IUFA 3ULEB 3ZFVA 3PJWA 2O5DA 3EVOA 4NLWA 2UV8G 3R5AA 4LR7A 2I6WA 2CQBA 2K06A 3CCVN 4PKDB 4A61A 2HAIA 1C0MA 3MMCA 3CJ2A 3ALYA 1K8KA 4ZK7M 2CQIA 3GILA 3L4QA 1RAAB 1UZHA 2DO4A 1WOPA 4LJMA 3THXB 1VBZA 2GVZA 4LIWA 3RBXA 2X1BA 5KFAA 4JKGB 4OI0A 2X6SA 5EXWA 1UL3A 4B1ZA 3LDLA 1ZBSA 4LFBJ 1VQ6N 1RKIA 3KJVA 2DPJA 4XPCA 4QR2A 2VOOA 1E6YA 3CDWA 2RILA 5IT9O 3H2UB 1XNRF 3DMJB 1NJYA 2MHNA 1J5OA 2IJFA 3PG9A 2R9LA 3T1YK 4O3OA 4OGEA 4XH4A 3B6OA 4FBUA 2ZJQL 3HP9A 2ZZNA 4BLGA 3Q2TC 3S1TA 3F56A 2XZDB 4I2QB 5J2NA 4JBCA 3BGRB 3UN5A 5C25B 4AXIA 1FERA 4UQGA 1RBOB 3EKUA 3GR1A 4DR5K 1FW6A 3DRSB 2J76E 2UVVA 4CEAA 3G6EN 1IM6A 1H74A 1NGIA 3QFWA 4USWA 4YOXA 2JLFA 3DN9A 3ZTOA 3N6LA 2YPZA 1VYAA 1JLCB 4DX8H 2NRXA 1FFSB 3KLEB 4ZVEA 1RT7A 4AE5A 5AQFA 2JX2A 1F0XA 3HVTB 5HOOA 3OYJA 2QA4S 2G1DA 1OPZA 3IUCA 3HFVA 5KOXA 2VG6B 2N3LA 2BE2B 1N34F 1SIZA 4RW8A 2AJ2A 4W5RA 3K5MA 3MDQA 1VSMA 2OPPB 3MDFA 4HTJA 1T9TA 3ILIA 4DR7F 4CZHA 3M9OB 4TYAA 4B08A 4DUZK 2F1FA 3TTCA 5IQ6A 2RDDA 4CJLA 4IYQA 2DTJA 4U67Q 3KHGA 5CA5A 1QVFR 2IAJB 1E6VB 4ILGB 1JLBA 1UEUA 2ZKTA 3I96A 4A8FA 3VMFB 1YRUA 4J5OA 3CCZA 2NXUA 4B1XB 3HJFA 4MYTA 3SIPB 1YHQS 4URQU 2E5JA 5A8RB 3B6BA 5IXUA 2FVPA 3QRQA 3N28A 1RBRA 3U1MA 1H7WA 1BDGA 4NXMK 2HMIA 2WFBA 3QEPA 1VQMS 3RB0A 1NM2A 2A1RA 1SVDA 2XO7A 5FLXY 4X4VA 3BQ0A 3JXOA 4CT9A 4IG0A 5AXNA 1HNWF 4WCEQ 4CJ4A 4RX6A 1BUXA 2YI1A 3UN3A 4L76A 1ZH5A 2UXBJ 3I56N 2P5OA 4M63A 3L2UA 2HHVA 3GWCA 3DXMB 2ADBA 5HQLA 4YB5A 2JNJA 4IO9Q 3DFEA 5KFYA 4PPZA 4WIQA 2PFDA 3AVHA 4CZMA 4CNYA 5AJ3F 1BISA 1YJ7A 4RW7B 2QO3A 2OEMA 2DH7A 1WAJA 1DTQB 4FZYA 4Y3CA 4JI3F 5KG6A 1JMTA 3TSPA 2KB2A 1TKXA 3AA5X 4NMLA 4YY3J 5DM7Q 3OYGA 1XNQF 2FSKA 3CC2N 4JS5A 2X6NA 3V1QA 1TZ0A 2NXEA 2HQFA 3IWNC 3I9V9 4NMXA 5L46A 1LV5A 2WB1D 4DDFA 3MXMA 3I0SB 1WF2A