3I0RA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 3
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 146
structure length 545
sequence length 545
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0rA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0rA05
2QKBA 2XGPA 2VWJA 1Z4UA 3KD1E 4EEYA 4DQQA 1BI4B 5D3GA 2JEIA 4FK2A 3RMDA 5KFKA 2FJWA 4FBTA 2HHTA 1LW2B 1J5OB 4K4ZA 4N5SA 5KFBA 1HPZA 4HCCA 3RB0A 3L2VA 2BRLA 1NJZA 3QLHA 3TANA 3PR5B 4B8CA 4KREA 1BIUA 4RNOA 5HP1B 2W7PA 3PW7A 5FRMA 4BDYA 2DPIA 3U3GA 3K5NA 2XY6A 4WYWA 4OJRA 4N76A 3ISNC 2R2UA 3KKRA 3H98A 3H40A 1Q9YA 3F73A 4YR3A 3CM5A 5DG8A 4GC7A 3DLKB 2F96A 1RBSA 5KFSA 3BQ0A 4CGDA 4H8KA 3OYAA 3VQ9A 3L2QA 3NF6A 1R0AB 4YFUA 1NKCA 1KSPA 2ZQBA 4I2QB 1S1UA 4DL3A 4NLPA 2AJQA 4WFZA 4C8LA 1RBRA 1RDDA 2PYJA 4YR2A 3SUNA 1XC9A 3KK1A 2PYLA 5KT4A 2VG5B 5FRNA 2IM3A 3SQ1A 3GV5B 4O3PA 3TR8A 3NE6A 3KD5E 4J9PA 3MR2A 1G15A 4M3RA 3ALYA 1RA7A 4RW8B 4FBUA 3RMAA 4E3SA 3EZUA 1NJXA 4TQRA 1SL0A 4F3TA 4ED0A 1RT1B 4CJKA 4Q8EA 1RT5A 5KFVA 2OPQB 1FKPA 4K4WA 2D3ZA 4JV2A 4DTPA 1JLCB 3MAQA 2KFNA 1B9FA 4EO6A 1IO2A 4AHCA 3OLAA 4RW6A 3MXIA 2BDPA 2AU0A 3IRXB 5DG9A 4NLDA 1S9GA 1YTUA 3DM2B 2RN2A 1IG9A 4O3SA 2VG6B 3AVAA 3BJYA 5JUMA 4ZVEA 1L3VA 2FLLA 3MEDA 3TI0A 2QKKA 3Q8PB 1D9FA 4CEBA 1JLFB 3VQBA 4OLBA 3HJFA 1IKXB 2HHUA 4HKQA 3SUQA 3HP6A 4IFVB 1C0UA 4IG0B 4LSLA 3D0PA 1L3SA 4Y2AA 1QAJA 2BE2A 4PQUB 1RTDA 1TAUA 3BGRB 4C8NA 4J2EA 4CFBA 3KK1B 3ZSWA 3V9ZA 4EO8A 3DOKB 3QIOA 1RT7B 1J53A 3U6FA 4OVLA 3HVTB 2KZZA 1WN7A 4L8RB 3EY1A 1U45A 4DFKA 4JRPA 3LWLA 4PA1A 1T03B 2QV6A 3THVA 1HYVA 3M9NB 4NLXA 2RPIA 1JLCA 4FK4A 4EP5A 2X74A 2YV0X 4O44A 1D9DA 3OYMA 4NLSA 3NMAA 2G8FA 1U49A 1IM4A 4WE1B 3V6KA 3ZCMA 4E19A 2DTUA 4B3OB 4CJ3A 3AA5X 3S3MA 1A5WA 3IN5A 1LW2A 1J5OA 3N6MA 4M94A 4Q45A 5I42A 2VG6A 3GYNA 3T19A 2HWHA 4CF8A 3DI6A 4OPJA 4DTOA 3DOLA 4ZVGA 1GOAA 4J9KA 2XI2A 4Q5VA 4B9UA 3DYAB 2IM1A 1TL3A 4LD0A 2QE5A 1RDRA 1UA0A 3DRSB 1A5XA 2WONB 4FZZA 1I39A 3KHRA 4IFYA 3DLKA 3N6LA 2FVQA 1T94A 5KFDA 2HWIA 5L1LA 3AVKA 3KK2B 1KVCA 2IS3A 4CIEA 2YNFA 2B6AA 3FQLA 2R2RA 3KNAA 2ETJA 1ASUA 1GX6A 2O4IA 5HBMB 2W8LA 3LANA 4B9TA 1X9MA 3ZSQA 4YQWA 4K4VA 3OL8A 3PX6A 3RBEA 1HYSB 3HVWA 4MIBA 2GUIA 5KFWA 1UAXA 1UWBB 1QAIA 3HHKA 2D0AA 1S0MA 2V9WA 1RT2A 2YKNB 3HP9A 3BSCA 3QETA 5CYQB 3K5MA 2C2RA 3Q8SB 4Y1CA 2WK4A 4R0EA 4E1NA 4OGEA 2ASDA 1SV5B 5F9LA 1UWBA 2Y1IA 1GX5A 4CJLA 1SKWA 3P5JA 4F3OA 2VG7A 2XI3A 2IDOA 1VSMA 4JS4A 2ZE2B 4DG1A 4DLEA 2ASLA 4ECYA 3CDUA 1S9EB 3LP0A 1T05B 4W5NA 4M45A 4F2RA 3MXMA 1VK0A 5FDLA 4MKBA 4I7FB 1WSJA 3D45A 3MEEB 3TAGA 4E7JA 2HNZA 1Z25A 2IJFA 4FZYA 3LAKA 5KRSA 4JS5A 4BE1A 4K50A 3LZIA 4C8OA 5KFEA 4YP3A 3OYKA 2FLPA 4CJQA 5F8LA 4E7KA 3U3YA 5D3GB 2C28A 1DTTA 1HYSA 2ILZA 1YVUA 3NF8A 3K5OA 4KAZA 4IH6A 3AVLA 2O5DA 4DL5A 3ASMA 3OYLA 4O4GB 1KTQA 4IRCA 1BQMB 3OSNA 4M42A 3RMCA 3KLHB 3V1QA 3I5CA 4I9LA 3HM9A 3AVHA 4CF1A 1NHUA 2GC8A 4QOZB 5KG1A 2XCPA 2E6MA 3JSMB 4RZRA 4CCHA 2VA3A 3OS0A 1JL1A 3I0RA 3CJ3A 3KK2A 3QGGA 1XR7A 3T5KA 3NH2A 4CJTA 5I3UB 2AX1A 4BACA 4CHZA 1TKDA 3G86A 4F4WA 3SPZA 5DGAA 2D5RA 2JGUA 4PWDA 3EYZA 1SUQB 3DLGA 2XHBA 3WNHA 1HMVA 1QE1A 2HW3A 4DQIA 4FJ8A 4E7HA 1RT2B 1S0NA 3SI6A 4ZVHA 4E7LA 3HPHA 4IRKA 2J6UA 2YNGA 1S10A 3BR9A 2FJXA 4CHPA 4B08A 1VRUA 4RW4B 5EWFA 3MFIA 3QIPB 1RT4B 3OL6A 2KQ2A 1RT3B 3FQKA 1HNIB 3I8DA 3OL9A 3LPUA 3OYFA 1VRTB 1GOCA 1RYRA 4CESA 1REVB 4CGHA 3PY8A 3VQPA 4QCLA 4W5OA 3O3FA 5HLFB 3UIQA 2G8KA 3L8BA 2OPRB 3GV8B 3AO3A 1U09A 1TAQA 3SPYA 2PZSA 5J2NA 2C2DA 4IDKA 5KFAA 4F2SA 2P5GA 3SYZA 3DOKA 3FRZA 5EU7A 3H2LA 5SZTA 5SWMA 4K4TA 5F9NA 3DOLB 5DGBA 2W42A 3PVXA 3SUPA 4ECRA 1EETA 1TKTB 4KB0A 3VN5A 2V4RA 4ZP6A 1CLQA 2P1JA 4Y1DA 4O5BA 3H4DA 2WHOA 4FJKA 1Q8IA 3M8QA 3RB6A 2FLNA 3DLRA 4NRUA 3HL8A 4CK2A 3TWHA 4WFXA 1S1WB 5K14B 4Y34A 1BQNA 3RAQA 3CVKA 4CGIA 2CJQA 1MU2A 4RW8A 4KAIA 1C1AA 2HVIA 4TY8A 3VQ6A 1U48A 1EETB 4CEDA 2VA2A 4CFAA 1L3TA 2YNFB 3V6HA 4CJVA 4KHYA 4CJRA 1D1UA 2UVVA 5F8MA 1KFDA 3CG7A 3CJ5A 3DLBA 4YNQA 3H5UA 3G6VA 4MQ3A 4F4XA 5F8NA 1R0AA 2A1SA 4CE9A 3CWJA 4Q8FA 3T5HA 1RT7A 2WONA 4FJJA 3BQ1A 2XGQA 1KVAA 1BQNB 4JRQA 2OPPB 1C1CA 1ASWA 3BSAA 2Y1JA 1QUVA 3OYDA 1UA1A 2E9ZA 3FDSA 3AVCA 4URQU 4CF0A 1DTTB 1FXXA 1RT4A 4WFYA 5JXSA 1TKTA 1HPZB 4FLTA 2ZKUA 4K4XA 4ECXA 4DU4A 4BDZA 2W7OA 1DTQB 4MFBA 1BI4A 2DY4A 4QWAA 1ZBFA 4ZPDA 4FJLA 3NBPA 4QWEA 4CGGA 5KRTA 5KFNA 4E7IA 5J2NB 3F9KA 4K8XA 1B92A 4ZPCA 4DFMA 2EC0A 1D0EA 3PO4A 4KV8B 4TN2A 4EBEA 4ED3A 2HNYA 2VWKA 2IJNA 1N5YA 2V4QA 4Q0BB 2ALZA 1ZTTA 1ZETA 4CK3A 4B9SA 3AA3A 4O4GA 4DS5A 3HK2A 3NFAA 1JLEB 4LH4A 1X9SA 3B6PA 3QLHB 3OYGA 4Q43A 4ZHRA 1NK4A 2HHSA 4RUCA 4RW4A 1I3AA 1EP4A 3C6UA 3OL7A 4ICLA 1RBTA 3VA0A 4IOBA 5KFHA 3GIKA 1HNVA 4MKAA 4F4YA 3HO1A 1S6PA 3I0RB 3K2PA 3AVJA 4IH5A 1CSJA 5HLFA 4ZHRB 3CYMA 1S1VB 5KFLA 3OS2A 2YNIB 2W9BB 2FBXA 1LW0A 2IA6A 2FC0A 3QESA 2I5JB 3LP1B 2FBTA 1SH3A 2OA8A 3DLHA 4Y2CA 1IKVB 4DEZA 2IBKA 4F4KA 4M3UA 4FM1A 2AQ4A 2VG7B 2OPQA 5KG3A 3PW0A 4H4OA 2JEJA 3QGHA 5DQGA 4KO0A 1VRUB 2GIRA 3CFPA 3CFOA 3DRPB 4CJSA 1RTHB 3AVIA 3IAYA 3QEPA 2F8EX 3OYNA 2ATLA 4FJNA 4J2BA 2QXFA 3EPGA 1KHVA 5DQHA 3KLGB 4PUOA 1EX4A 2J6SA 1JXLA 5KT3A 3RMBA 1L5UA 3VQCA 4ICLB 5KFTA 4W5RA 5KG0A 3KMSA 4CGFA 2KZMA 4RNNA 1TKXB 2HNZB 3AO1A 4BWJA 4KO0B 4CF2A 5CYMA 1S1XA 3KMQA 3K59A 4AILC 3LWMA 1IKYB 3HSTB 3NHGA 2B6AB 1HJRA 4J9MA 3OY9A 3Q8RB 2OPPA 2R8GA 2ZE2A 4DG1B 3S3NA 4IR9A 4CEZA 2RKIA 1RT6A 3CDEA 3BDPA 4KSEB 3RB3A 2C22A 4ECZA 4KKOB 1DLOA 3IS9B 4O3RA 3H5YA 3QEWA 2W9CB 2F8TA 4MK8A 4JUZA 4HVJA 4ECQA 1WAJA 4DTNA 2D3UA 2E4LA 4AH9A 4DFJA 2P51A 3T5JA 3IGVA 3DI6B 5KG2A 3LPTA 3FFIA 4QAGA 3L2WA 1RTHA 4URGA 4EYHB 2Z1HA 4DL6A 1TVRB 1JL2A 5KFUA 4IBNA 4RG8A 4DU1A 3NF9A 4J9LA 4FJ7A 3CFRA 3SUOA 3MR3A 2WB4A 3TAMB 4Z4IA 2RF2B 1NK0A 3DRRA 2F8SA 2OZSA 1RNHA 3TARA 2FVSA 2D7SA 4DSEA 5JS2A 4FS2A 5KG6A 1TL3B 3D28A 1LAVA 2V0NA 4CHQA 3A2FA 1YT3A 3NGDA 5DLFA 3T1AA 3HVTA 4DSJA 2DPJA 3MTKA 3DRSA 1JLBB 3HT3A 4CJ5A 4O0IA 3AVFA 2JC1A 1NNDA 3HPGA 1KLNA 4DSIA 3ZSXA 4ZPBA 5HRPA 4KHNA 2GBZA 4DQRA 2BANA 3PR4A 1K1QA 5I42B 1JLFA 1S1WA 2DFEA 4DU3A 1S4FA 1UOCA 4B3OA 4IR1A 4ED7A 4MK7A 5T14A 3AA4A 3PJWA 4RW7B 3QYYA 3BQ2A 2WTFA 5DMRA 4RW9B 1NKBA 2ZD1A 4KFBB 3IRXA 4O3QA 4RW6B 3VQ7A 1JX4A 2B5JB 3S9HA 4W5TA 4DWIA 3NGIA 2DFFA 4LY7A 4TSXA 1S48A 3V4IB 4DL4A 5KT5A 1RDBA 3KJVA 1JLAA 1N4LA 3OYHA 4NYNA 1KHWA 4DL2A 3NL0A 5J2PA 4IH7A 2HMIA 1EKEA 4RNFA 4JV0A 4M3XA 1RTIB 1BL3A 1IKXA 4WXWA 4GC6A 4FVMA 4FJGA 3GIMA 3SCXA 3ZT1A 4FLWA 3AA2A 1LWCA 5KFGA 3GIIA 4U7CA 3MF5A 3H59A 4XPEA 2NUBA 3K57A 5J2PB 2B4JA 1JLAB 5HROB 4ZMMA 4KTZA 3DMJA 1C1CB 4CHYA 2XY8A 1W0HA 4KPYA 4F50A 1JLBA 3ICLA 4I2QA 1S1UB 3I5AA 1RBVA 1RTJA 5KFZA 2X6SA 4ED8A 1W9HA 2RF2A 3QIDA 3LP2B 3SV3A 1HQUA 1RT6B 3PO5A 2AGOA 1O1WA 4I2PB 3MEGB 1HYZA 3QNNA 3QZ8A 3HXMA 4KHQA 3V81B 1SH0A 4ED6A 3FSIA 5HP1A 1U04A 1HQEB 3IG1B 2YNHB 1LW0B 3V6JA 2O4GA 4XPCA 1RT5B 3QEIA 1RT1A 1YVFA 4KBIA 1TKXA 4NLOA 4KTQA 5KFPA 3RB4A 1F21A 2YNGB 4GW6A 5F8JA 3I0SB 2G8HA 3AVNA 1QSLA 2AWZA 3KKSA 1S5JA 2BQ3A 1HARA 1SUQA 5CZ1A 2AGPA 3SNNA 4DTMA 3AVGA 4LSNB 4Y3CA 5F8IA 4RU9A 3DRRB 1TP7A 1D8YA 3AO5A 4CEEA 4B9VA 1C0MA 3KLIB 4QPXA 3LP3A 2IC3B 3KLEA 4KTWA 1X9WA 3ZT4A 4EBDA 3L3UA 4CJWA 2FVRA 3S3OA 5L1JA 1QHTA 3KLHA 1JLQB 1IKVA 1VRTA 1SL2A 4TY9A 3P83D 4DSLA 1S9EA 3LP0B 1T05A 2I5JA 4LH5A 2ITGA 4J9NA 4XIUA 4DTRA 1NK6A 1RDAA 3OYBA 2IAJB 2C2EA 1BGXT 4NLVA 2HHVA 1TV6B 4DTUA 5DLGA 2HNDB 2D0BA 3QO9B 1WSGA 4H4MB 3OHBA 4NLYA 3L3VA 4CEQA 4J9SA 1VSFA 4HUGA 4FJMA 2CKWA 2Z1IA 4FM0A 2R7YA 3O3GA 4FK0A 2WOMB 5HRRA 2YKNA 2I1RA 3HPOA 2IAJA 3I0SA 3DLEB 4ZVFA 3GILA 3OYEA 1RBUA 2RKIB 3AVMA 4YMEA 4ECUA 4NLGA 5KFMA 3PW4A 5KFFA 2W8KA 4DLGA 3C6TA 3RAXA 4XO0A 3LDSA 4EYIB 1IKYA 5DQIA 3K5LA 2WOMA 4NCGA 4URSA 5J2MA 1TL1A 4Z4FA 2XRIA 4FZXC 4ED2A 5C24A 2OH2A 1J9AA 3QGIA 5KGXA 4K8ZA 3E01A 2OPSB 3LAMA 3OHAA 5J2QA 4PUOB 4MIAA 4NLUA 4ECSA 1Z26A 3TAFA 1CZBA 4FYDA 1JLEA 2FVPA 4DSFA 1FKOA 5J1EA 1C0TA 1X1PA 4ELVA 3PX0A 3QINA 5EWEA 4M3TA 4EP4A 4CF9A 1WNSA 3MXJA 3V9SA 5C25A 3CIZA 1C1BB 5HBMA 2IGIA 4I7FA 4ELUA 1KFSA 5FROA 3PW2A 5DG7A 1ZTWA 3TABA 2BGGA 3BSOA 4NCBA 4KI6A 1RTIA 3MEGA 2YNIA 2W9BA 1WAFA 5CZ2A 3LP1A 3WNEA 1LWEA 1BHLA 2JLEA 2YHAA 5C42A 1BCMA 3KK3B 2YKMA 4FLXA 4QWBA 2R2SA 3H4BA 4CFDA 4BWMA 4BE0A 3OLBA 3DYAA 4KFBA 2XC9A 4E1MA 2HHXA 4B9LA 4OKKA 2G8UA 3ITHA 1NK9A 2PY5A 1S49A 4I9QA 4GMJB 4EZ6A 4BE2A 3RRHA 5L9XA 3OS1A 1RAJA 3BGRA 4CJFA 4NCAA 3N6NA 5KT7A 3SQ2A 4JLHA 4N47A 3AO4A 3M9MB 4GVMA 3P1GA 1FK9A 4I2PA 2KW4A 4ED1A 4IRDA 4KV8A 5KTQA 1K1SA 5C5JA 5DK5A 3OVNA 5KT2A 1HQUB 4CHOA 3MECB 3KJVB 3UQSA 4IG3A 4O4RA 2B43A 3MR6A 1WSIA 3PV8A 2G8WA 3OYJA 3DM2A 2E9RX 3TAMA 3DMJB 2ZD1B 1MMLA 4MFBB 4ZP8A 4Z4EA 1RTJB 1IH7A 3HVRA 3MFHA 3ZSOA 5KG7A 1N48A 4OPKA 4ID1A 4QWDA 3QNOA 2GIQA 2KFZA 3CJ0A 4NYZA 4FCYA 2EHGA 1BQMA 3M8QB 3PUFA 3VQAA 1C0UB 4WZMA 1QQCA 2Q3SA 1C2PA 5KFCA 4LSLB 3PHEA 2XY5A 1ZBIA 1NKEA 5C25B 5E41A 4CJ4A 3RBDA 2FJVA 2ATQA 1TK0A 1C0TB 2G8VA 3HKWA 3O4QA 4HHTA 1U4BA 1CZ9A 3NAIA 2UVWA 1FKOB 5J1EB 3V1OA 3V1RA 2HMIB 2JEFA 1HMVB 3PX4A 1S9GB 1A5VA 4CFCA 1TK5A 3M8SA 1IKWA 2OPRA 4CIGA 4C8MA 3E01B 3L2RA 4RW7A 4IG3B 5EDWA 1VSKA 2XY7A 2YKMB 5KI6A 4Z4GA 5F8HA 3ZSYA 1DLOB 4KKOA 4FXDA 4KHRA 1FKPB 4AHVA 2IM2A 4FW2A 2HVHA 1TKZB 4NZ0A 3ZT0A 2IMWP 1RYSA 5CYMB 3T5LA 4MH8A 2HHWA 5EUHA 5KG5A 1TVRA 3TAQA 1WNEA 3V9XA 3QEXA 3NF7A 3H5SA 3SI8A 1Q9XA 3NH1A 2UVRA 3NAHA 3SFUA 3VQQA 4IG0A 4J9RA 4DSKA 3DLEA 1SH2A 2BANB 2A1RA 1QS4A 4FJ5A 3FFIB 2D0CA 3KHHA 3K58A 4NYFA 4KHSA 1RILA 1OS5A 2R2TA 1BCOA 4TLRA 5EWGA 4KB7A 3RRGA 4DTJA 2W9CA 4IDKB 4Z4CA 4CIFA 3DLGB 3KTQA 3ZSVA 4OKJA 5J2MB 1TK8A 4KRFA 5HRNA 5L1KA 3RR8A 1LWEB 2DFHA 3AVBA 1KLMB 4CGJA 1T3NA 4EBCA 3M8RA 3NGYA 1N6QB 2JC0A 5FDLB 2Z1JA 1VSDA 3O4NA 4M41A 1S6QB 4NLWA 2KTQA 3TVKA 3Q8QB 3E51A 2R8HA 4KB1A 4ZP9A 4TYBA 2UUTA 3V9WA 3SFGA 1S1VA 1TGOA 2BR0A 3QIPA 1XI1A 4HCBA 4CJPA 1ZBUA 1BISA 3KLVA 1T8EA 4G1QA 3OSPA 1NK5A 4HUEA 4BDPA 1NJYA 4Z0UA 3C6UB 3H5XA 4K4UA 5CYQA 3OYCA 2R8IA 4DF8A 1LAWA 2Z1GA 3NH0A 4EZ9A 1JKHB 4FS1A 2OPSA 3TAPA 2BQUA 1WLJA 1EP4B 3KK3A 4G1QB 4J2DA 4NCGB 4R8UB 1RCHA 4Q0BA 1TL1B 4AHUA 1GOBA 4J9OA 2XCAA 1D5AA 2HNYB 4DS4A 4WE1A 1ZYQA 2X78A 2WCXA 4YR0A 4K4YA 3G0ZA 4CEFA 1WSHA 3C6TB 1CXUA 1JLQA 4DL7A 3VQEA 4NLRA 4DF4A 1N6QA 2W9AA 4ZPAA 5F8GA 3SV4A 1S97A 4MK9A 1C1BA 1S1XB 3KOAA 1JKHA 1SL1A 4B9NA 4CJEA 3OYIA 3RWUA 4QWCA 1DTQA 5KFRA 4KHMA 1JXBA 1VSLA 4ZP7A 4OGCA 3CJ2A 1TV6A 3KLGA 5HROA 4IKFA 4K4SA 3G10A 3EPIA 2J6TA 3SQ4A 4FM2A 1LWCB 1S1TB 3OJUA 1N5YB 5KFOA 4TYAA 5KFIA 2R8KA 1HQEA 3IG1A 1LWFB 2ILYA 3PJXA 1ASVA 1I6JA 3VA3A 4IFYB 4CECA 3V81A 4CJUA 4AHRA 1TQLA 4FLVA 1RDCA 1ITGA 2HAIA 2OZMA 4ECWA 1SV5A 2FVCA 1C6VA 2WRMA 3VQSA 4G3IA 4RW9A 3CO9A 3LP2A 3NCIA 3H08A 1K6YA 1BIZA 1QSSA 1S6PB 5CY4A 1SKSA 4OLAA 3M9OB 3OJSA 1SKRA 1FK9B 3JYTA 4H4MA 4Q44A 2E6LA 4M3WA 1S9FA 3VQDA 5KGWA 4E89A 2EX3A 2BE2B 4FJIA 1ZBHA 1L3UA 4PQUA 4J9QA 4RUAA 4CERA 4IFVA 3CM6A 2RDIA 4DTSA 3G6XA 3ITHB 4QW8A 2JEGA 1VSEA 1S0OA 3PW5A 5KG4A 4DFPA 4NLTA 1NJWA 3ZT3A 2HB5A 1T03A 1LV5A 3UPFA 4WYLA 3NBPB 3SQ0A 4O44B 3RTVA 2AGQA 1JXEA 1VSIA 4ECVA 4LSNA 3NKYA 3T3FA 5KT6A 5T7BA 4DMNA 3MR5A 3MECA 3GIJA 4ZTFA 1RTDB 1XR6A 4KHWA 1VSJA 2QK9A 3D5MA 4AHSA 4DQSA 3M8PB 3ZSRA 3TAEA 4TY8B 1LWFA 3KHGA 1RT3A 4CHNA 4HUFA 2AX0A 3KLFA 1U47A 1REVA 5K14A 2XWYA 1CXQA 3ISND 3B6OA 2ASJA 3VQ5A 1HNIA 3V9UA 3RR7A 1T7PA 4KE5A 4FJHA 5KFXA 2BQRA 3M8PA 4NLQA 3I5BA 1XHZA 4PWDB 3VQ8A 4HTUA 3MEDB 2VG5A 4U6PA 3NGZA 4ZTJA 4F8RA 5I3UA 1KRPA 2IM0A 4E0DA 5HRSA 1IKWB 2B5JA 4HYKA 2X6NA 5C42B 4OL8A 4C8KA 2BRKA 4O3NA 4CEOA 4M3ZA 5KFYA 3NDKA 3CQ8A 1NOZA 1XR5A 3IGNA 4ELTA 4FJ9A 3ULDA 4UQGA 1JIHA 2R8JA 4FJXA 1NOYA 1WSFA 1YTAA 4KHUA 1RA6A 1Y97A 1MU2B 3TQ1A 3C95A 4IKAA 1S1TA 4M95A 1B9DA 1NK7A 4LQ9A 3BSNA 3KLFB 1XWLA 1QTMA 4NRTA 3JYTB 1EXQA 4F4ZA 3L2UA 4FLUA 4O0JA 4TQSA 1J54A 3ZT2A 3KHLA 3UR0A 4WZQA 2RDJA 4FW1A 1QE1B 4RNMA 4CK1A 4Z4HA 1NK8A 3V4IA 1HRHA 1N56A 2IOCA 2GV9A 2D41A 4N56A 4QW9A 1KCFA 4LQ3A 4FLZA 2XO7A 1KVBA 1XHXA 3MEEA 3LZJA 2IC3A 3KLEB 3DDKA 5L1IA 4J2AA 3WNGA 4RNHA 4TXSA 4R8UA 2FBYA 4FLYA 3HVAA 3V6DA 4CEAA 2OYQA 2FBVA 3GQCA 4JV1A 1KLMA 4O3OA 4ID5A 3CDWA 3AO2A 1JLGB 4H54A 3QZ7A 4AHTA 3EZ5A 1W25A 3C94A 4B8AB 4IQXA 5J2QB 1ZBLA 5JS1A 3PZPA 1HNVB 3WNFA 4KI4A 4WXOA 1QSYA 5C24B 4DQPA 4M3YA 2HNDA 4B9MA 1WSEA 4R5PB 3QEVA 3QO9A 4OKEA 3IS9A 2UUWA 2P5OA 4ID5B 2YHBA 2E9TA 1JLGA 2HHQA 2UVUA 2YNHA 3QERA 3LALA 3V6DB 3AV9A 3VQ4A 3DRPA 3UDLA 3ZSZA 4PY5A 3JSMA 3KIOA 3SZ2A 5KFQA 5KFJA 4X2BA 3HYFA 4H4OB 3CJ4A 3NAEA 1VSHA 2LSNA 3SJJA 1TKZA 3KLIA 3BREA 4ECTA 1S6QA 4O55A 4DTXA 2G8IA 3G6YA 4N41A 1NHVA 4R5PA 4W5QA 3GV7B 3O3HA
chains in the Genus database with same CATH superfamily
2QKBA 2DBBA 1Z4UA 3D0HE 5EVZA 3GIRA 5D3GA 1WF0A 4UY8O 2V9KA 3PYFA 2WW4A 1M5OC 3K0JA 5KFKA 2FJWA 2IIHA 2HHTA 3J7YU 3CCRS 3GFHA 8ATCB 3QNWB 5KFBA 4CBUA 1PC5A 1HPZA 3E2EA 2J76E 2ZH4A 2UXDK 4WFAL 3NLCA 3VERA 1H74A 2HQGA 4KT0C 4ISEA 4RNOA 3VZIA 2VQFJ 5HP1B 3KG0A 3PYGA 2E7VA 5CHIA 1RAEB 4YDXA 3U3GA 4HT5A 2XY6A 4WYWA 3F9MA 3M1VB 3KKRA 4D3GA 1YZ7A 1Q9YA 3F73A 3J81U 4CGDA 1E6YA 2VYPA 3NF6A 4CM0A 1KSPA 4Z37A 1X31C 3CMQA 4C8LA 4ZJQA 4M5IA 1YBTA 2UUCJ 3KK1A 2PYLA 4OI4A 1GLEG 3TR8A 3NE6A 3C2PA 3TYTA 4J9PA 3MR2A 1KAZA 4FBUA 5IS2A 1QDUB 2XLJA 4P73A 3A8JA 1ESVA 4TQRA 3SAHA 5EGYA 1MMNA 1OJ4A 1RT1B 4CJKA 3EE8A 3UKRB 1SQEA 2WSFC 4B3RJ 2LYVA 3AT1B 1FKPA 1VQYA 1WHXA 2H5IB 3I31A 2PT0A 1JLCB 2KFNA 3ID8A 4DDFA 2MKYA 1R89A 1IO2A 5E26A 2AKWB 3MXIA 3R9LA 2DEJA 1TUVA 1KQSR 4WWSA 4QU7A 2ZVSA 5BPLA 2C42A 1HWUA 1YTUA 3DM2B 2RN2A 2H54B 1V3SA 2V7YA 3BJYA 1RBLA 5AQXA 4ZVEA 3TI0A 2QKKA 3RBZA 4CVNE 4M63C 2B4UA 4OLBA 3BKTA 5K20B 1HWLA 2HBQB 1Z05A 4IFVB 1OYEA 2UUCK 2XB2D 1XNQK 3G71S 4H5TA 4PQUB 1RTDA 5ELZA 2XYGB 3ETOA 1IG8A 3ZSWA 4MO5A 4Z7YA 2GJIA 1LK7A 2RS8A 2L3MA 2R7SA 2VOOA 2GW8A 1IV0A 4HI1A 5D8HB 1HYVA 4FK4A 2X74A 4O44A 4KGKA 4RBUA 2POKA 5E0OA 1YQHA 4LRCA 1RHJB 2JWLA 3HBTA 2UUCF 1U49A 4DV4J 1IM4A 1WKLA 3V6KA 4IOCQ 2HGLA 3ZCMA 5H9EJ 1TL7B 2LA4A 2A40A 3BZQA 3AA5X 1GXTA 1A5WA 5HATA 2EFGA 4Q45A 2OAUA 3MD3A 2OKQA 3AAWB 4M5NA 2HWHA 5CYJA 3QJPA 2GVDA 3EZWA 4DTOA 2YI1A 4ZVGA 2LMIA 2XI2A 2IM1A 2VQFF 2ZOMA 2QGFB 1UA0A 3AJ2A 2ZBCA 4WIQA 2PFDA 3IWNC 2WTUA 5AQIA 1HBUB 2P2CB 4ZJLA 2FVQA 2CVIA 2W2PP 3KK2B 4PXEA 2IS3A 4CIEA 3T1HK 5HL7L 2B6AA 4LBHA 3FJ2A 1GX6A 3WX4A 4B9TA 4BG9A 2AW0A 3V2UC 1X9MA 2UUBF 4PXBA 4DR2F 2AP6A 4X66J 3Q23A 4OHVA 3SQGA 4MIBA 5KFWA 4ES2A 4CDIA 2D0AA 2V9WA 3AY9A 4WU3A 4ZCMA 5LMUK 3OTOJ 3BSCA 3HP9A 3C0BA 3GU0A 4WFBQ 2W24A 4FO0A 4JI6K 2PEHA 1YRXA 1SV5B 2ASDA 1NGJA 5F9LA 2F4VJ 4BRGA 4LMZA 3MX2A 4B1XB 2NQPA 4WYBA 2GQQA 1VBZA 4HDGA 1FFWB 3VGMA 1FRMA 4CZHA 3JSRA 4DV1J 2ZE2B 3LP0A 4W5NA 3DLLQ 2M7SA 1YF5L 4F2RA 2HHHJ 3IR6B 3FLCO 4MKBA 1WSJA 4JKCA 4BQLA 2L9WA 3IXQA 1R7IA 4E7JA 2A3ZA 3P4IA 2IJFA 4ZK7M 4BE1A 2ZHBA 4K50A 3UKUA 5KFEA 4YP3A 2FLPA 4FF4A 3UVJB 3U3YA 1RHMB 1I1GA 1T44A 1DTTA 2ILZA 3H3NO 1YRUA 1UP1A 4CH7A 3R5BA 4IRCA 4CLFA 1BQMB 4KH6A 2K06A 3RMCA 2E5IA 5K5MA 3IP0A 1O8BA 4RO0A 2GA7A 4I9LA 3CSKA 3IBFB 4N7TA 3HM9A 1A6LA 1CULB 3PCOB 4USVA 2ERRA 4QOZB 1MA9B 3JSMB 4RZRA 2G2ZA 2RDDA 1R3NA 1ZXOA 3KK2A 1XR7A 3T5KA 3NH2A 5FJ4A 3CJ8A 5I3UB 3NCPA 4CHZA 1TKDA 3BO2A 5DGAA 3M6WA 4WKRA 4GV3A 3MM7B 1HMVA 4XAKA 3ENBA 4FJ8A 4E7HA 1RT2B 1VLYA 3OTDA 4E7LA 3E9PA 4FNHA 1VCTA 2J6UA 4HACB 4P2XA 3VGLA 1S10A 3BR9A 2FJXA 3TA0A 4RW4B 4K5RA 3QIPB 4HL9A 1SS6A 2YWFA 3OL6A 1JK9B 1HNIB 2OI2A 3MOZA 2Q79A 4ZOSA 1OY9A 1GOCA 2R4FA 3AD8C 1YJRA 2MKSA 2XMTA 4ID8A 1YSJA 5CE3A 3CIMA 3M4XA 4QCLA 4W5OA 4OYAA 3R7NB 3L4IA 3SPYA 2PZSA 5J2NA 3MCOA 2H65B 2C3OA 2P5GA 3FRZA 5EU7A 5LMNF 3H2LA 5SZTA 5DGBA 2FC9A 4J9UE 1TKTB 3B8AX 2E44A 1NM2A 4IYQA 4ZP6A 4O5BA 4IFEA 2NPIA 2PO4A 5KPRA 2WHOA 1SAZA 3RB6A 2FLNA 3DLRA 4NRUA 5LL6Z 4CK2A 4XDDA 3C66A 4CD3A 1BQNA 2ZKTA 4BGBA 2CJQA 4FDFA 2YHWA 2IVNA 1C1AA 3VQ6A 4PABA 4CFAA 3B4MA 2QWQA 4C4WA 4CJVA 4X4SA 2JHEA 5RUBA 1NDLA 4CJRA 5F8MA 2GAHC 1RHQB 1AT1B 3P6YC 4DPWA 1DQ9A 3EUNA 2Z2YB 2VFUA 1N34J 3MPWA 2RU9A 1R0AA 4CE9A 4IDHA 4Q8FA 1RT7A 1RDWX 2WONA 1NCLA 3BP8A 4LRDA 2HHPA 3D6HB 3EXYA 1U2VB 4DB3A 2ZNZA 2Y1JA 1VC6A 2OMOA 5JLHA 3DHXA 3J81Y 3FDSA 3AVCA 2NYHA 5DS7A 4CF0A 1DTTB 1FXXA 4F04B 5JXSA 3AAPA 4B1ZA 1EQ0A 4FLTA 3NGKA 1E4GT 4EHTA 4BDZA 3O80A 1NPKA 4MFBA 2Y0BB 1XUPO 1BI4A 1IVZA 4QWAA 1ZBFA 2VV5A 3NBPA 2UV8A 1B0PA 5TKYA 5KRTA 2V51B 2MKKA 2CQ2A 2BUNA 1KC8O 1DKGD 4AUKA 4DV5F 1PBAA 2KVQE 2EC0A 2RJZA 5A0YB 4KV8B 3OR1B 4EBEA 4ED3A 1RWOB 2VC1A 2KRRA 2V4QA 1ZTTA 1Q8LA 1X60A 5AQPA 1UEUA 3FGUA 4LH4A 1VQ4S 4U96A 4Q43A 4ZCLA 2XZTB 2B51A 1N5VA 2FHKA 4OI6A 4A5AA 5H9EK 1RCXB 3IR7B 4IOBA 3FC9A 2HFSA 1N54B 1S6PA 3I0RB 2NZCA 1BUPA 4AM6A 3P45B 4IH5A 3W5YA 1VQMN 2BW2A 1CSJA 3IMQJ 5HLFA 4ZHRB 3CYMA 4J9VA 3GB0A 2MGZB 5TKWA 2FBXA 1LW0A 4BR4A 2I5JB 2FBTA 2JOQA 5GAGP 3DLHA 1VQ5S 3A5OC 1XMQK 2DH8A 2OPQA 1UAWA 3QGHA 3M8ZA 1R0BG 3NGRA 3VTHA 1VOMA 3CFPA 2CZVC 3AVIA 3IAYA 3LUYA 3J80Y 3QEPA 2ATLA 4DCJB 2BJ9A 3EPGA 2XYPB 1Q8KA 2YQ1A 2JFDA 4X66K 2UXDF 2J6SA 4RKUC 5KT3A 1H7WA 3QPIA 1L5UA 2H4YB 4JI1J 4ICLB 5KG0A 4RBTA 3KYLA 4RNNA 2HNZB 5AQFA 5GIOA 4BWJA 2AZ1A 5CYMA 3KMQA 4YHHJ 4ILGB 4GMKA 3QWPA 4DBQA 4FYWB 1KVKA 1NGCA 3GE9A 2PC6A 3A3PB 4JI6J 1N8RT 3QFHA 3S6EA 4B3TK 1HJRA 4DJBA 2OPPA 3M8WA 4IR9A 3BDPA 2R7QA 4ZLPA 3RB3A 2C22A 3C19A 1D3WA 3IS9B 4KIAA 4O3RA 4YUDA 3H5YA 3CO0P 5B7WA 1W2BR 2F8TA 5IWAJ 1WKKA 2M9KA 3SMZA 4HVJA 5I9EB 2GVDB 2E4LA 4IO1A 1EHWA 5E3PA 2RILA 2P51A 1R8CA 2O8FA 1FVSA 1RSCA 4YY3F 2LQ9A 3SMSA 2ZUAA 3PTWA 3AOAA 2O8EB 5KFUA 2CAJA 3QRQA 3KFWX 1CS4B 3GE1A 4DU1A 2U1AA 3NF9A 1ZM9A 3WIVA 3M1FA 4FJ7A 4B1YB 4WFNQ 2FY1A 2F8SA 1RNHA 2D7SA 4DSEA 5THWA 4FS2A 2W7AA 1XMBA 5B0FA 4LRFA 5IM0A 3A2FA 1YT3A 3HHNB 3HVTA 4H4KA 4B3TJ 4E98A 3TJ9A 4UF4A 3MTKA 2VONA 1VQON 3GONA 4O0IA 3RW6A 3RGIA 2ASYA 4DUYF 3TPQA 2GTDA 8AT1B 2GBZA 3JS6A 3THYA 1OWXA 3VEXA 3QSYB 3NS7B 1UOCA 4DV0J 1H72C 2GS8A 3QYYA 2C1EB 3BQ2A 3Q7BA 1QQOA 1R8BA 4X62K 1BE4A 2WTFA 3MOJB 2C2OB 4RW9B 2ZD1A 3VQ7A 2DD8S 3S9HA 3NGIA 3OXFA 1VQOS 5F3TA 1S7HA 3DKDA 2HGMA 3KJVA 1JLAA 3HHLD 2V68A 1S57A 2HRYA 3ZYYX 4JV0A 5GAEU 1YITS 4GC6A 2CPEA 3CE8A 3HZEA 3SCXA 1LWXA 3GIIA 4C48A 4U7CA 4UW2A 2ASMA 3DXSX 3MF5A 1NPRA 2DGUA 2P9LA 1U6FA 1ATRA 1BWFO 4ILMA 3M3ZA 3CI5A 4AXIA 2LQ5A 1IJFB 4P2SA 1FDNA 2QWNA 4MTPA 4DKWA 3I5AA 2GO8A 1RTJA 1VQ6N 1ULRA 4JI7K 5K8OA 4H5RA 1ZZNA 2RF2A 3O1WA 3BH6B 3W60A 1MN9A 1ZA2B 3SV3A 3LDLA 3G6ES 3HLUA 1HYZA 4P6QA 3BGUA 2UUAF 2BW7A 2JZ5A 4KHQA 4CJ7A 4AXJA 2RT3A 3H46O 1ELOA 1U04A 3IG1B 1HQEB 1HPMA 1HUXA 3V6JA 1SQFA 1RT5B 5B0AA 1AXQA 1YVFA 4NLOA 1SQGA 1XNQJ 4OYXA 4KTQA 5KFPA 5IOLA 2YNGB 2OEMA 5CH7B 2QWRA 1MDUB 4GW6A 3M2RA 4B3SF 2QFIA 3BY5A 3I0SB 2G8HA 2UUBK 2DISA 1S5JA 5AQMA 2BQ3A 2OP5A 1SJ4P 3SNNA 1S6OA 3AVGA 4LSNB 5F8IA 3QGPA 3NNCA 1VYAA 3KLIB 3LP3A 3HD2A 2I7NA 1FD8A 4MDBA 3BS9A 2IC3B 4A8WA 1SZ2A 3DNCA 3MMVA 3L3UA 1VHXA 2P9UB 2PA8D 3C15A 2GVZB 1NHKL 3QT5A 4YOXA 1TTHB 2ITGA 4XIUA 4H4KC 1NK6A 4DV0F 1RDAA 1VQ9N 1NGBA 2UXBK 3VENA 1QM9A 1AFJA 4Y00A 3CJ1A 3GCXP 4LFAJ 4DTUA 1WSGA 3CXCM 1DURA 3L3VA 5GMEA 3ENAA 4FJMA 1X5SA 3GJSB 4IO8A 2HRUA 2WOMB 4RCHA 3DLEB 4ZVFA 4LFCK 4QIVA 3AQPA 4NLGA 3QJLA 2P9NB 4JAXA 3C6TA 4QJVA 3RAXA 2DJWA 2D4WA 3GYXB 1CC8A 4PCQA 1FE0A 4IZ9A 3O4WA 1M5PC 1H3DA 3FUYA 2Z30B 1WHWA 2YX6A 2XRIA 2G13A 3TUPA 1GXUA 5C24A 2D74B 4JD2A 5KGXA 2DXEA 2PMZD 2GJ2A 2HBRB 5J2QA 4WKYA 4FVUA 1Z26A 2IRUA 2FUG9 3TAFA 2DY9A 1IR1A 2FVPA 1X1PA 3M30B 2AD9A 3QINA 2GEMA 4BR9A 4M3TA 4CF9A 1WNSA 3V9SA 2CDRB 1DQAA 4BLGA 2IGIA 4ELUA 3F41A 3SLCA 3D6FB 3F5TA 3TABA 3ZX0A 3KKFA 3BSOA 4NCBA 2SXLA 1X4AA 1S59A 2MGZA 2LLZA 5BN9A 5CZ2A 3OXGA 3WEEA 3CCVS 2JLEA 1Q7YO 1SBRA 1BCMA 4YOUA 4LVNP 3CCLN 1RHKB 1SJQA 4I64A 2DRDA 3H4BA 1RU1A 4CFDA 4CT8A 1YIJN 5E3CA 2DNZA 3CC7N 3ITHA 2DYAA 1NK9A 4YDDB 3UN2A 1BA0A 3GJQB 3BGRA 4XH5A 4CJFA 4NCAA 3N6NA 4AM7A 2YPYA 9RUBA 3L3CA 4JLHA 4JV5F 1M1GA 4BHQA 5HN0A 1FK9A 4ED1A 3ZZPA 1QD1A 5KT2A 2MSSA 2XMUA 1JJHA 4IG3A 2COLA 2OEKA 2EFNA 4JV5J 2B43A 3WX8A 1YJWN 2IVYA 3I9ZA 1MSWD 2F1FA 1JB0C 3DMJB 3ZFVA 4KGXB 4J5OA 4ZP8A 2QJ3A 2X3GA 3MFHA 2YWKA 4MKYA 4OPKA 2RSQA 4BRLA 3HSDA 1UKUA 4IXCA 4U7UD 4FWLA 2DGVA 3BUZB 1PO6A 3AQOA 2XY5A 4ILJA 1NKEA 1W97L 4K59A 4CJ4A 1JCGA 5CZVA 3R5JB 2UP1A 1HKCA 5CA5A 4ETZA 1TK0A 2G8VA 3HKWA 3O4QA 4Q2MA 2UVWA 5J1EB 3V1OA 1DZ5A 3T7ZA 2HMIB 3TVZA 3U1MA 3RUBL 4AT1B 4CFCA 3QQCD 2EVZA 4GKKK 3NP5A 1IKWA 3H6EA 2FF6A 4RW7A 2WW8A 2B4PA 2XY7A 1VSKA 3LTOA 2YKMB 4Z4GA 1WSVA 3QATA 1X5OA 5LXYA 4KHRA 1HHQA 1RFQA 4WQ4A 5CYMB 4ZVPB 3IBCB 4NLBA 3ZZOA 3VAHA 5EUHA 3TAQA 1T3OA 3QEXA 4ENOA 3SI8A 1VQ5N 5JJBA 3NH1A 3SFUA 1NDPA 3DLEA 2A1RA 2D0CA 3UI3A 2P6TA 1BCOA 3I32A 4TLRA 4YB7A 5EWGA 1RKJA 4NXMK 4KB7A 3RRGA 4CIFA 2KKZA 2CQBA 3KTQA 4MAKA 3LGNA 3SCLE 2NZTA 3PM9A 1NXIA 3MUVP 1CJUB 4P2FA 1KLMB 1KD1T 1PG5B 4MKVA 2KVIA 3C7NA 3QB0A 2JLFA 2WVFA 1C0GA 1Y10A 3OFEA 1N34F 2GX9A 1VC5A 4XH1A 2Q0UA 2KTQA 4KB1A 4Z7CA 5GAHP 1NJIO 3VEVA 3BV8A 4K25A 4RWXA 2HZCA 5AJ3J 4MYTA 4CJPA 1P8ZA 2UXCK 1NK5A 1U1NA 1QLNA 4HUEA 2AYGA 4Z0UA 5F0XA 3H5XA 5BRHA 5CYQA 2DB1A 2JH3A 1HNZJ 4DF8A 1Y5LB 4A8KA 2Z1GA 1JKHB 2VFVA 3Q0AA 3AOCA 5I3QA 4U7BA 3LOUA 5ETVA 1IBKF 1WHYA 2LXIA 4J2DA 2QWMA 1RCHA 2CH5A 3A8YA 1GOBA 2XCAA 2ZBIA 3Q24A 2HNYB 2YQ0A 4WE1A 1U1QA 2LQJA 1FRHA 4YR0A 4PG7A 2KU7A 4CEFA 2DITA 3C6TB 1CXUA 3VQEA 1T9YA 4A8FA 3VR1A 3ULEA 4MK9A 1C1BA 1NZ8A 3DOMA 3Q8UA 2KHCA 1JKHA 1RABB 2ZM6F 3KDOA 3OYIA 3RWUA 3VOVA 1RK8A 3FSYA 2RD5C 5KFRA 3EVMA 4YOVA 1NGAA 5M1NA 4BRFA 1JXBA 4CZCA 3FZHA 3A3OB 2J0SD 1RP5A 2R9LA 5HROA 4K4SA 1DFDA 5HK4A 3ZNUA 3D0IE 5CCMA 2VC0A 3SQ4A 4U8YA 3C6AA 3KWMA 2A5XA 3BB5A 1J2VA 3CD0A 1JQGA 5KFIA 4CZGA 2ILYA 3PJXA 4N8NA 1ASVA 4CLWA 4UOHA 1XNQF 1CJVA 5AQKA 1WWHA 1BWEA 3PRDA 4ECWA 1C6VA 4G3IA 2W4PA 3CO9A 2HQFA 2IY5B 5K9FA 1UL3A 2VPYB 1UMJA 3B6BA 3JYTA 4OYOA 1Y11A 1S9FA 3VQDA 5DJBA 2EX3A 2H3GX 1ZBHA 1L3UA 4PQUA 3FE1A 1G3OA 4J9QA 3LW5C 4MMOA 4YHHK 3OXLA 3CM6A 1R31A 5IQQA 5K8PA 4DTSA 3CIPA 3I9V9 4M7XA 4BRCA 3O5TB 1U2FA 2JEGA 1S0OA 4ZA1A 4FWNA 5KG4A 2GVZA 4DUYK 1YLXA 1OMSA 2XG8A 1LV5A 3UPFA 4WYLA 4JKFA 5F0UA 4OZ0A 2QLFB 2VICA 5HANA 3SQ0A 4O44B 5FPEA 4OV1A 3NS5A 4ECVA 1Y5NB 3MECA 3CCSN 5C7PA 1VQ4N 4AHSA 3M8PB 1VJQA 2HEKA 2VFRA 3KHGA 2EFPA 2VF3A 3DXMA 1U47A 5K14A 1CXQA 2XWYA 3EM1A 3ISND 3R5GA 2C3MA 3ZZYA 2RRAA 3B6OA 1NEEA 1WBDA 3VQ5A 2HZVA 4USHA 3UD4P 1HNIA 1S12A 2XWXA 3ZTQA 3HT0A 4YY3K 4FJHA 3I5BA 2B4VA 3VAFA 3BZKA 4ZTJA 4KH5A 3PSFA 3MZIA 1IKWB 2B5JA 7FD1A 1CJKB 1HJOA 3OPKA 4AE5A 1IUJA 2E5GA 2FYXA 2IA0A 3NDKA 1FTCA 3D7EO 3M1VA 4OZLA 3IGNA 4ELTA 1JIHA 2ACYA 4H5WA 1WTFA 2ZZNA 1H38A 2XZWA 1MU2B 3TQ1A 4F3MA 3I8BA 3THXA 4M95A 1VQPS 4M5LA 2KT5A 5KAKA 3DJCA 1NDCA 4OJGA 4PL8A 4FLUA 1SC3B 2LXUA 3KHLA 1X4GA 4EK2A 4RNMA 4LREA 1NK8A 2FZCB 3HHLB 2JL9A 3W7BA 3HJVA 2BKPA 1KCFA 4CW7B 1ROFA 1VHFA 2GGPA 2L08A 4MYUA 4FLZA 1I94F 3ATUA 4C8ZA 3U9DA 2KI2A 1Q5VA 4DR3K 4FYXB 3K5PA 2DEIA 4R8UA 4FWMA 4FKYA 3HVAA 2C2MB 2J0QD 1RQ0A 4BROA 2E1PA 2FBVA 2M8HA 4P10A 4JV1A 1KLMA 4ID5A 2ZH7A 3CDWA 4QS9A 3HHLA 3AO2A 1U1MA 5AQSA 4H54A 3EZ5A 2Y3YA 5J2QB 2QWOA 1OSDA 1QAXA 2AT1B 4LIWA 5C24B 3O9RA 4B9MA 2HNDA 3H2VE 2FJBB 5HVGA 2XMVA 3DU5A 3CPWR 1VMBA 3CCSS 2RUSA 3MTJA 3BF1A 5K8NA 1E6YB 5LSRA 4OYWA 4ID5B 3Q89A 2X1FA 1W2BM 4OJ1A 4LF9F 3QERA 3ZEUA 3LALA 3V6DB 1JWWA 3R1XA 3DRPA 2VIHA 1ZAVA 1KOHA 5KFQA 2NPFA 1KQGB 2Y1LB 1ZOTA 3BREA 2M88A 3CCUS 4DTXA 3KZBA 2DY1A 2QA4G 4N41A 3G4SS 4R5PA 2RE2A 2MJUA 5AQHA 4BRKA 2ASOA 1R0CB 4Y2MA 3HXMA 2ZGZA 3JQMA 3BBBA 2V4JA 2XGPA 3P5BP 2ZOFA 3X1LB 2N82B 2JEIA 3RMDA 1UFLA 1YJVA 4LF9J 5HMZA 2CNOB 1R27B 4DV5J 4K4ZA 2Q31A 2M0GB 2QWLA 2RMLA 4HCCA 1NLVA 4C3MA 2RQMA 4PXDA 2VQEK 4B8CA 1BIUA 3T1YJ 4C0OC 3A1YG 4F02A 2ZJPL 4CLYA 2B7CB 3P39A 3FBEA 4OJRA 1YGYA 4AD6A 2R2UA 1TFWA 3H40A 4AYBD 3HKZD 3W66A 3VQ9A 2XMJA 1NKCA 3ZETB 4PPZA 2ZQBA 3BGFA 4I2QB 2AJQA 1VQSA 1RBRA 1XC9A 3SUNA 4QYZK 3DGPB 2J0XA 4O3PA 3ZZZA 4L3QA 3KD5E 1G15A 3ALYA 3UO0A 1BC6A 3ILOA 5IC6B 4E3SA 3EZUA 2E1RA 2QA4N 1SL0A 1FWKA 1WDDA 4Q8EA 1RT5A 4NYOA 5EX3A 1HFEL 5KFVA 1CPZA 4JV2A 2RIJA 3AY0A 2MQQA 1B9FA 4ATNA 4EO6A 2P6SA 2F8HA 4ZN1A 1HBNB 2BDPA 2AU0A 4KYZA 1S9GA 2BA9A 1IG9A 4USIA 1IBLJ 2FSKA 2VPXB 1YBAA 4OZJA 1BO5O 2VG6B 3AVAA 2XSJA 2PE8A 3H3OB 3CEDA 3VQBA 2QMXA 3HJFA 1IKXB 3SAGA 4HKQA 3EKSA 2AYMA 3J7Z5 4IG0B 1HBMB 4NA2A 2IYGA 3FZBA 4KR0B 2DIUA 4CLLA 3BGRB 4C8NA 2R7RA 3KK1B 3A4TA 3V9ZA 2GHWA 5BYRA 1J53A 4HLBA 2KZZA 3KJFB 4FP9A 2HLUA 4F9OA 4ZN3A 4JYAF 4DFKA 4JRPA 1U1LA 2PSZA 2QV6A 2MHNA 4A48A 1JLCA 4EP5A 2YV0X 1U24A 1D9DA 3VALA 2UUAK 3CJAA 4FWSA 2E5LK 4X4RA 3NMAA 2G8FA 4CO5A 3L7UA 3O1LA 3N5FA 4WE1B 3OFHA 2XMMA 2DTUA 4ITSA 3JSBA 3CF5Q 3BBFA 1J5OA 3NGTA 4B3SJ 5AQJA 4Y0FA 2RH3A 4LUBA 3DI6A 1E6VB 5LL6d 4BR0A 3VWSA 3DOLA 2HKEA 1GOAA 2XSJB 5KOWA 1SJ1A 4ZVUB 3DYAB 1SCJB 1HR0K 4LD0A 3UR3C 3M6VA 1A5XA 1MWMA 1P1TA 4P7VA 1JMTA 1T0TV 2C3YA 1I39A 2ZJQL 3KHRA 3WQTA 3N6LA 9ATCB 5KFDA 2W2OP 4KHPK 2DRBA 1Z2LA 3R1HA 5B0CA 1SIWB 4R25A 1QY7A 5AQVA 1YJTA 5CAAA 2CJXB 3FQLA 2R2RA 5HJYA 5HBMB 4F0MA 4K4VA 2VL1A 3OL8A 4LF5F 3HSZA 3PX6A 1HYSB 2V34A 3FR0A 2DNYA 1D8ZA 3D66A 5E33A 3DLJA 4CWBA 3PFOA 2AJ4A 5IXUA 1S0MA 1OVQA 2E2NA 4A8QA 3QETA 3NMRA 1RE1B 2WK4A 4E1NA 3ZETA 1UWBA 2BH1A 3ZZTA 1IBKJ 1HNXF 2XI3A 1VSMA 1VQPN 2OUGA 3EWGA 4DLEA 3MCSA 1RAGB 2ASLA 1S9EB 3WXKA 3BDEA 3HOTA 4JYAJ 4B17A 3P5TL 5M2PA 2O8CB 1VK0A 4I7FB 5HQLA 1K8AT 2JJ4D 5HAOA 3WXMB 2QT7A 3L4BC 3M8YA 3MWBA 3VTIA 5EOYA 3SMPA 2CQPA 1GXLA 3LAKA 3O3LA 5L38A 1W26A 4C8OA 2KO1A 1VQ6S 8RUCA 3IR5B 1IJEB 1HYSA 3K5OA 4IH6A 3AVLA 4LC9B 2WSCC 4O4GB 5G0RA 2H3EB 3P38A 4KRWA 3GCWP 3OSNA 1T9XA 4M42A 2B9EA 3PJ9A 3BZCA 3I5CA 4FYYB 4QIFA 1T9WA 2XS7A 4WQ5A 1BY9A 3CJTA 5B09A 5KG1A 2XCPA 4CO1A 2Z57B 3S01A 4CCHA 1RGVA 3OS0A 1DRZA 1TL5A 3CJ3A 2QLBB 2O67A 4ZPWR 2AX1A 2CFXA 4F4WA 3SPZA 2VJVA 1FF2A 2JGUA 4BG8A 2HHHK 2K2PA 4DQIA 4KPCA 3KK7A 3SI6A 2VFTA 2YTCA 3Q83A 1F5BA 2HWTA 4IRKA 2FJEB 2LECA 1Y9OA 4B08A 3QMLA 1Z2ZA 4NZ6A 1UVIA 2KQ2A 1RT3B 3E1YA 1UWAA 3O9TA 3OL9A 1Q95G 3LPUA 1VRTB 1RYRA 2KT2A 4K0KJ 2VDHA 1IWAA 4CGHA 4KHPF 3VQPA 1O5JA 3ENVA 3LF0A 1Z6RA 2J7UA 4OI2A 2ZWHA 1AW0A 1ZA1B 1TAQA 3T1YF 4ED4A 4CZIA 2KHOA 1VQ7N 5CZXA 2Y8YA 5AFUH 4LT6A 1GMUA 3SYZA 3DOKA 2MTLA 3DOLB 3SUPA 1FNXH 1EETA 3AHPA 3F2KA 5ADXA 4QQBA 4Y1DA 3R2CJ 2P9LB 3FBBA 3TA1A 4FJKA 2Q97A 3TWHA 1X4HA 3MK6A 3S1TA 5K14B 3EVWA 1HBMA 3RG6A 4C1NK 1IR0A 4A8YA 2DGQA 4EIAA 2VA2A 1L3TA 2YNFB 4KHYA 4DR1K 4AQYK 1D1UA 1SQKA 3DLBA 1HNWF 4JI7F 3GG4A 4PWUA 1GLJO 3BN4A 3T5HA 2NUHA 2B3TB 4IOAL 3BQ1A 3CQYA 1RDUA 1LOTB 1BQNB 4JRQA 2OPPB 1ASWA 4V19X 3UE5A 3BSAA 3OYDA 1Z1ZA 3D6MB 1J27A 3TQEA 2J7WA 4JKBA 1RT4A 4WFYA 1TKTA 3NXZA 3OUYB 2F7TA 2A10A 4CLUA 2MQ8A 2ZKUA 4DU4A 4HI2A 3QBCA 1K73T 2IJRA 3G25A 5T41A 2HK3A 2DY4A 1ACMB 1S5ZA 1XMQJ 4CGGA 4LSZB 2BM0A 3P96A 5KFNA 2OFHX 5J2NB 3F9KA 5EN1A 1I94J 1WOPA 2UXBJ 4DFMA 1LFWA 4X4QA 2ZHOA 3N4QA 2KXHA 1FE4A 4F3QA 3VAMA 2QM1A 2IJNA 2N3OA 5JVGQ 4CK3A 4B9SA 3AA3A 4O4GA 5G0RB 2IPOB 1PYOB 3NFAA 3K0SA 1JLEB 3QLHB 3OYGA 1NK4A 4RUCA 3C65A 1WC3A 3W62A 4JI0K 5IT0A 2D9PA 3R6MA 3C6UA 3OL7A 4ICLA 1KP6A 3VA0A 1EX8A 5KFHA 3G82B 3GP9A 4GY2B 3MHYA 3AVJA 2EFQA 1CC7A 1GLFO 2FC0A 4OLPA 3PIPL 4Q7AA 1NM1A 4Y2CA 1IKVB 1IR2A 1G7CB 4HDHA 2DR6A 2WVDA 2VG7B 5IWAK 5KG3A 3PW0A 2JEJA 5DQGA 2MB0B 1K9MO 4DOZA 1AROP 3DRPB 2D3OR 3OW2M 5EX5A 3CW2C 4DR2K 3OYNA 4J2BA 4P9SA 3BPSP 2Z2ZA 2V8DA 3KLGB 1Q81O 1AZSA 4PUOA 4ED5A 2J4RA 2CNLB 2YX7A 4A46A 5BXIA 1VK8A 1K8AO 3M2RB 3RMBA 1AUDA 4CGFA 2XEXA 4JI0J 1QZ6A 3FSXA 3BF4A 4BR5A 1OH7A 4CF2A 1S1XA 3QSIA 4AILC 3LWMA 4YB5A 3TSQA 3NHGA 3PFEA 3IUCA 1FWLA 4U9RA 5MLCQ 4J9MA 4OYMA 3CT9A 3OY9A 1QTNB 1V6HA 2HQDA 2ZE2A 3OVBA 4CEZA 2RKIA 4J91A 5IT9U 1RT6A 1UJ6A 3UW1A 4ECZA 4KKOB 2KN4A 3VV2B 4DV1K 3QFUA 4IOAQ 3M2VB 2K7KA 4JUZA 3JTNA 2GO9A 3CCQS 2RHKA 4DTNA 2D3UA 4AH9A 2F65A 2M5YA 3QFPA 5KG2A 3LPTA 3FFIA 4QAGA 3ENWA 1B0VA 4W98A 2F9WA 1HQ2A 3ZTRA 3FEYB 4DR3F 2NXNA 1VQNN 2R7XA 2GWJA 4RG8A 5A0YA 4B1WB 1E4FT 4I4BA 2J9EA 4J9LA 3CFRA 1HIYA 3MR3A 2VOPA 2AA4A 2VBWA 3TAMB 4Z4IA 1NK0A 3CCLS 3VGTA 3TARA 2FVSA 3HSGA 4DV7F 3D28A 4CHQA 2V0NA 3NGDA 3CC4S 1FXDA 5F0WA 2AEMA 1JLBB 2ITMA 1RI7A 3AVFA 3PLAA 5AQGA 4FKXA 2ZC4A 5GMDA 2MYFA 4V19S 5HRPA 2HVZA 2BANA 3PR4A 1K1QA 2V63A 4H0XB 1JLFA 4UQTA 3I82A 4I1TA 3RZAA 1ZH5A 1S1WA 2DFEA 2APOA 4B3OA 2VBZA 5FLXY 4ILHA 2ZM6J 1VDHA 4RW7B 1V3ZA 4LVOP 2AF6A 5DMRA 3M32A 1NKBA 3QFWA 3IRXA 4O3QA 4RW6B 3GPAA 1DGKN 1JX4A 2G2OA 4BRPA 1HI1A 4Z2XA 1SJRA 3R27A 4DWIA 2ZOGA 1GLLO 3HFVA 1JCFA 5AE2A 3V4IB 2XLKA 1RDBA 2E1YA 1N4LA 3OYHA 1WG5A 4JN4A 1KHWA 3EJMA 3NL0A 3CJQA 3VAJA 1IBLF 1RTIB 2J9CA 1BL3A 4WXWA 4FJGA 2CZ4A 1VS3A 5DETA 3HHDA 5AZIB 4P75A 3OTOF 5BR9A 2RVJA 3HM8A 5A2QO 3UE2A 5J2PB 2V8PA 4ZMMA 2R7VA 3DMJA 4CHYA 3MAHA 1X4DA 1PBUA 1GLAG 4QOTA 4F50A 1JLBA 2DCUB 4I2QA 3TWZA 1RBVA 3P49B 5KFZA 2X6SA 2LA6A 4QS7A 3LP2B 1IBLK 2NNWA 3PXGa 3FZFA 1T6CA 1EQMA 3MEGB 3CDBA 3QZ8A 2Q1NA 5JLFA 3G8TA 4DX5A 3M6XA 1DQ8A 2C3UA 4J7CA 5HP1A 2DR5A 2FGCA 2BOPA 3W65A 5EXWA 1H2UX 3DGVA 3QEIA 1RT1A 4YOTA 2NXJA 1S72N 2F5GA 1FVQA 1P90A 2UXCF 2WBNA 2WVBA 2HBKA 2UYTA 2O66A 3SEOA 1QSLA 1DAXA 2AWZA 4NA1A 3KKSA 4Y2KA 4RPFA 1SUQA 1NZAA 5CZ1A 1VR6A 4Y3CA 1R59O 1SXLA 4RU9A 4ZIVA 5T7LB 3A8EA 4WK3A 6AT1B 3AJDA 1DEJA 1EWRA 3NY0A 3E3XA 2CQHA 3UDEA 2UXDJ 1X9WA 2K1RB 1N5SA 4CJWA 2FVRA 4DX8H 1AYEA 4OX6A 4GVLA 3I6PA 2NRXA 2VODA 2VQFK 3KLHA 4U7UK 1VRTA 1SL2A 1LOUA 4DSLA 3LP0B 2I5JA 5E84A 4LH5A 2XBPA 4NI2B 2HSEB 1BGXT 4NLVA 5LJVA 4C7QA 1TV6B 5E5NA 2YWWA 2D0BA 5T7LA 3AB4B 2VUGA 1B70B 2J7KA 3HF5A 4L76A 4J9SA 3CNQP 4IUFA 3TU5A 3MXHP 1S76D 2R7YA 1U1OA 5LSOA 4FK0A 3SBMA 2Z58B 2I1RA 3HPOA 1FFSB 3RJMB 5K8MA 3W9IA 3OYEA 3FZMA 2HVEA 4YMEA 3MURP 3L4QA 4JI3F 4ANEA 2W8KA 2Q43A 1UEKA 1BHNA 4XO0A 4RBVA 2MY8A 2O01C 1IKYA 5CCLA 4DL0C 2DNMA 5H1SV 1NH7A 2WOMA 2IBOA 1HNWJ 1GH8A 1Q82T 5CQGA 3GFXA 2E20A 3DXKA 4GV9A 3A13A 3C7NB 2KFYA 4YDUC 4ED2A 2RU3A 2M8DB 4K8ZA 3E01A 2OPSB 3OHAA 1BU6O 1CJTB 3M6UA 5LY3A 2XNRA 1SB6A 1IWGA 4FYDA 2MLYA 1JLEA 4DSFA 2QO3A 5D0GA 5J1EA 1C0TA 5LJ5Y 2Z56B 2VPZB 4EP4A 3FGVA 2C3PA 3CJSA 2LQ8A 3CIZA 2V69A 1PAEX 5HBMA 1U2RA 1Y3KA 3US5A 5FROA 3CCJS 2DNRA 2ABYA 2F9DA 1RTIA 1KQFB 4KI6A 1KQKA 3VVUA 1EO1A 5E3RA 5B08A 1BHLA 2YHAA 3MN6A 1Q16B 4C6AA 1K47A 3HZGA 2FLOA 4QWBA 4P71A 2R2SA 5MLCV 3RSEB 4DV7K 3Q8VA 2NS1B 2XC9A 1R43A 4OKKA 2EWSA 2G8UA 2PEBA 3VF0B 1GAOA 5DDPC 2QG9B 4I9QA 4EZ6A 4DV4K 4BE2A 5FPNA 3RRHA 3OS1A 2U2FA 5KT7A 3SQ2A 4B1UB 4N47A 1BWVA 3M9MB 4I2PA 1K1SA 5DK5A 3OVNA 2A2CA 1HQUB 2ZH5A 4CHOA 5M1KA 2NUUG 2ROPA 3KJVB 3RSEA 3WXLA 4EMDA 1WUUA 4O4RA 3DU6A 1QAYA 1I3OB 2G8WA 5LMNK 5C2DA 2E9RX 4NB4A 5IZHA 5AXKA 4IOCL 5KPTA 2OELA 1RTJB 4ZVOB 2A6AA 3ZSOA 4MT1A 4QWDA 5DZ7A 2GIQA 5DO2A 3CJ0A 2ADBA 4WP9A 4M5KA 4HVZA 2EHGA 4Z94A 1BQMA 3D1OA 4PHTX 4YOYA 3M8QB 3HCXA 3VQAA 5DM6L 2XMKA 1WJ9A 2Q3SA 3GG1A 2NLWA 2A6OA 4WFNL 1NNEA 3RBDA 2ATQA 1C0TB 1F0XA 4DV3K 4HHTA 1U4BA 1CZ9A 3NAIA 3A3NB 1HMVB 3BGOP 1K73O 3DHWC 2K8GA 2YKQA 1A5VA 1TK5A 1HKGA 2O3DA 1FKAF 5DZ6A 3H45C 3U27A 2AJ0A 4C8MA 1KXPA 3MAAA 5F8HA 4DR4F 4KKOA 2HQ3A 1H7XA 4PG5A 2RQKA 3CJ7A 3MEKA 1FKPB 2XMAA 2PN6A 2IM2A 4ERDA 4AHVA 1TKZB 2F8MA 3T5LA 2HHWA 1WC1A 5KG5A 1TVRA 3H5SA 1NSPA 1Q9XA 4P74A 2UVRA 3NAHA 4KJIA 3VQQA 1YJUA 4IG0A 1SH2A 1TFYA 4LF1A 4GO7X 2AIRB 4FJ5A 3KHHA 1X3MA 4NYFA 1ITPA 1ZPWX 3KJNB 1KAYA 1RILA 4DR1J 4AQYJ 3MCMA 1F1BB 3POTB 2N4DA 5D0EA 4LF4J 4Z4CA 2IDLA 3ILLA 1IQZA 1GTHA 3ZSVA 2A18A 2YX4A 4RUHA 1LKZA 5DRKA 3VHQA 2DO0A 1TK8A 1LXNA 5L1KA 3RR8A 3WEEB 5AXMA 4NASA 2FF3B 2DFHA 3AVBA 4JKAA 3OTEA 3VMFB 2ZNYA 2JC0A 5FDLB 3O4NA 4NLWA 3Q8QB 3HHLC 4TYBA 2YWHA 3V9WA 2I2YA 2X3DA 4X65K 2GAGC 2IVMA 4JB8B 1OH5A 3D2FA 3R3LA 2V6AA 4BRDA 2E5JA 3GYGA 1BISA 3CCMS 2D69A 4G1QA 2B9YA 3H7HB 4DV5K 2FIUA 4BDPA 4JP8A 1U2CA 2MQPA 4LIRA 5GAGI 4ZVSB 4JHDA 4C11B 1FO1A 2IDEA 4ZVQB 4EZ9A 2OPSA 2N7CA 3NOGA 3A5NC 3QWUA 1IBMJ 3VQTA 2BQUA 4ZCKA 2G1DA 3AD7C 3J81j 1UVLA 3KK3A 4WU2A 4Q0BA 1PYSB 1ATSA 4AHUA 4J9OA 3EDQB 1X7VA 2KH9A 2LQBA 3HD1A 3NOCA 4IO9Q 4GKJJ 4K4YA 2VQEF 1LK5A 5D6GA 1SPBP 1F6TA 3BKFA 1HNZF 2EK6A 1HR0F 4NLRA 2RRBA 1N6QA 2M52A 2W9AA 4DCOB 2P9UA 4NE9C 1S97A 1M1HA 2LEBA 1OKJA 2BJ3A 4YB6A 2BUPA 2B0GA 5AJ3F 5MAOA 1FT8A 3UNGC 2HHHF 2E1ZA 3UN3A 4QWCA 4OI0A 5GAGU 4L3KA 2QLWA 3VGKA 3GZ7A 4A5BA 2KHDA 1UZHA 4OGCA 4I6MA 3PG9A 4DUYJ 4H0TB 2QLJB 1NMNA 3G10A 3C14B 2VKZG 2W40A 1KONA 2R7WA 4FM2A 3CD7A 3P3DA 2WVEA 2CXEA 4TYAA 5I4MA 2MZTA 4X62F 1HQEA 3IG1A 1I6JA 2K3IA 4CZLA 4IFYB 2ZH1A 1WEXA 2PD1A 3V81A 3TOQA 4Y6IA 4CJUA 2CQ4A 2MDAA 4FLVA 2EEYA 4H0YB 1SV5A 4K8RA 2WRMA 3VQSA 3TO8A 1C0FA 3H08A 2QA1A 1K6YA 1M0SA 1BIZA 2LEAA 3TEHB 4OLAA 2QLXA 1J5EF 4CRJA 1FK9B 1KOOA 4Q44A 4C1NI 5KGWA 4E89A 1G99A 1HWJA 4FJIA 1WEZA 4X65F 3R6GB 2G0JA 3I55N 4IFVA 1B3TA 3CETA 2RDIA 3ITHB 4QW8A 1VSEA 3TEGA 3PW5A 2CJKA 4LF8F 4RL1A 1X4BA 1RWWB 3HRGA 4NLTA 2HB5A 1MLAA 2NZ4A 2J9DA 5E7OB 3UD3P 2NCKL 1NBWA 3SSSA 2G4BA 2JVRA 3FMBA 4JI6F 1H73A 3SCJE 1FX4A 1WDTA 3T3FA 5KT6A 4R0JA 2W4CA 3GIJA 1XR6A 4KHWA 2Z2LA 2H48B 2QK9A 4DQSA 3TAEA 4TY8B 1RT3A 2CQ3A 3QJJA 3OW2R 4F25A 2E1CA 4DR7K 1P8GA 3CGIA 4OX9F 4CLPA 3D9BA 3VF4A 3FMWA 1ZC6A 3MN7A 2IHR1 1T7PA 4KE5A 5KFXA 2BQRA 3M8PA 2AYEA 2GMHA 2K7JA 3MEDB 2VG5A 5IM0B 3OTOK 4F8RA 1VQ9S 3ET6B 4NWBA 4JKHA 3MM8B 3K7RA 4HYKA 5GVQA 4PKGA 2HZAA 3RW7A 4C8KA 3SJHA 2BRKA 2P9KA 5KFYA 1XTZA 5GMKa 4LR9A 3BM7A 3ULDA 3A0IX 1MROA 3T9ZA 1R8HA 3MMBA 1NOYA 4FJXA 1IQTA 3CMAN 2J9DE 4RX6A 4LF6J 2DO4A 1QQMA 4CO2A 3CXCR 4IKAA 1B9DA 1MWYA 4TU9A 3M30A 3DGPA 3KLFB 1EXQA 3L2UA 3D1HA 1FRJA 3ZT2A 3EKUA 2RDJA 3O9SA 4FW1A 4NMLA 4IJAA 2VU5A 4DPXA 1N56A 2IOCA 2D41A 2E7XA 4JI1K 3OFGA 2JLGA 1ZAXA 2LU1A 1WOOA 1XHXA 1O0PA 5A8KA 4C97A 3KLEB 2KT3A 1OVYA 4IJNA 3CCWA 4UOFA 3EMTA 5L1IA 1P9YA 2ASPA 4TXSA 1HLUA 1X3NA 3CCQN 4YS2A 3VAGA 1WORA 4DHVA 2OYQA 4E8UA 4BRQA 3W1YC 2CNKB 2Y8WA 1U6BA 1EKRA 1JLGB 1G1XA 3QZ7A 4CZFA 4IQXA 3GJTB 3PZPA 1HNVB 3G82A 4DQPA 4M3YA 1WSEA 3QO9A 3IS9A 2UUWA 1ATNA 4JI4F 2BJEA 4LBIA 1WI6A 4F0KA 2E9TA 3QBXA 2HHQA 2YNHA 1IM6A 2YJFA 3ZSZA 4H4OB 4A59A 3D3BJ 1HBOB 3M2UA 5L39A 4ILLA 1CULA 4DCHA 3CCTA 1TKZA 4LFAF 4ECTA 1F2GA 2AMCB 1NHVA 3A5LC 3UKUB 1RHRB 1FJGJ 2H5JB 4LF7K 4ZITA 4ZVRB 1OPIA 4FK2A 3D2EA 4DUZK 4FBTA 2OIHA 4DR5K 1J5OB 3O1BA 2CPYA 2BACA 4N5SA 3OUYA 1YDLA 2JSXA 3EX7B 1VBYA 1VK3A 2BRLA 1GT8A 2ZBRA 1FJCA 3CCUN 1SKUB 2P9SB 3G71N 4KREA 1W7AA 2RE1A 4NZ7A 4MJKA 4LJMA 2DPIA 4BDYA 2JVOA 2IRYA 1S99A 5JVHQ 4N76A 3ISNC 4C0HA 1YRTA 2VWBA 1YJNN 5DG8A 4GC7A 5KFSA 3BQ0A 1CZAN 3L2QA 1QUPA 1R0AB 4ZIWA 3L7OA 1QHAA 1S1UA 1VISA 4DL3A 5IT9Y 4BREA 4NLPA 3J7ZT 5ETTA 2ZWPA 3O8WA 1RDDA 2BTFA 2PYJA 3W8GA 3VAIA 5KT4A 5FRNA 1GK8A 1P6TA 3SQ1A 1QJHA 3GV5B 3LM9A 1WOQA 2MSTA 4DPTA 2FXUA 4RW8B 3TZXA 2OMLA 2G2YA 2CG4A 2GQCA 2VDIA 3TR5A 3W63A 4I6YA 2DHGA 4YOEA 3SDEB 1N36K 3DXMB 1YX2A 1RWXB 2P5VA 4BQZA 3W0LA 3W9HA 3MAQA 4LF8K 5BYSA 3PYEA 2MQNA 4U67L 1M5SA 4AHCA 2HYIB 4OPAA 1U0SA 3VGVA 3IRXB 4WFAQ 1O13A 2J0WA 4O3SA 3VETA 1VLOA 3IM9A 3JAMO 4B1VA 3JTPA 5JUMA 3SIPB 3Q8PB 4CTAB 4CEBA 2HHUA 5D4PA 1URNA 3MMCB 4QIEA 3SUQA 3HP6A 4LSLA 3D0PA 1KC8T 3B78A 2A0FB 1TAUA 1Q7YT 4J2EA 3WDOA 3BYRA 3CQXA 3QIOA 1RT7B 4AL5A 5IC4B 3LPYA 3U6FA 3HVTB 5LXRA 4GV6A 3J7YP 1WN7A 1WBBA 3O8MA 3J7AP 4OFZA 3WBZA 2D9OA 4DV1F 3THVA 3M9NB 1WTBA 2A42A 2RS2A 2QL5B 3NCQA 3OYMA 2OTLN 3THWB 2PIIA 5D4OA 4BGAA 4BC7A 3TUIC 4B3TF 4JKGA 4FN5A 4B3OB 1RCOB 1LW2A 3N6MA 3T41A 3CJBA 3JSYA 3PSIA 3GYNA 3T19A 5CR4A 3A5MC 4TLQA 1CG2A 4CF8A 2IRXA 2MZ1A 4OPHA 4DR2J 4C11A 1G2EA 3CCVN 4HTJA 3UVJA 1K44A 4Q5VA 2QE5A 3J7YI 1ZAWA 2R42A 3ZZUA 4Y65A 2J8SA 4ZPVR 3DLKA 5BPNA 4YY3J 1T94A 2PMHA 1OY8A 5AT1B 5L1LA 1WEYA 1Q82O 3IBWA 2YNFA 1X5PA 2KXNB 3FCHA 4M5DB 5IWAF 1ASUA 2WVCA 1WSRA 2O4IA 4TU8A 3ZSQA 1FJGF 2QZ8A 1JJ2R 1Q78A 2X7IA 1XMOK 2GUIA 1T95A 4NEYA 2QSWA 4HACA 4DV3J 1QAIA 4CP5A 2CRLA 3HHKA 4FF3A 4U8VA 1QQNA 4OX8A 3N28A 1N33J 1DY3A 3FK4A 5CYQB 3K5MA 2C2RA 3Q8SB 4OGEA 3KDNA 2QYGA 1UZDA 1BQXA 3LO3A 2Y1IA 4NXNF 5FPDA 5AQQA 1GX5A 4CJLA 2GIFA 1SKWA 4FF2A 3OBIA 1X4EA 1U25A 1XQSC 2HG4A 4JS4A 4DG1A 2W2MP 1T05B 3I4HX 2ZDPA 4M45A 3MXMA 3MM6A 3D6TB 3RRKA 4DV2F 2DXDA 1RLCL 2P9CA 3D45A 3DDIA 1NSAA 2DGTA 3R5CA 3TAGA 1T3VA 4M8LA 1JJ4A 1Z25A 3LDNA 1FW6A 2CGLA 1Q5YA 5KRSA 2H9ZA 3THTA 3LZIA 2VH7A 3OYKA 3KUGA 4BVPA 5F8LA 5D3GB 5D4NA 5BR8F 3I56S 3FVYA 5GADP 1PJ6A 4NA3A 4ZDNA 3NF8A 4DL5A 1C4CA 1FD2A 1EKSA 3OYLA 3HHEA 3OR2B 3KLHB 3V1QA 3MWPA 2GELA 1CQMA 4CLSA 4B02A 3AVHA 4CF1A 4JK8A 1NHUA 2LDIA 2GC8A 1S0VA 2WC9A 1ZBTA 3TX8A 4OZ2A 1Q81T 1K9MT 3W2WA 3QGGA 2EFVA 3VGUA 4CBWA 4BACA 2F9JA 2MXYA 4X4VA 4JYAK 3BO3A 2D5RA 4PWDA 5B0GA 1WI8A 3EYZA 3DLGA 3KJQB 3WNHA 2XHBA 2HW3A 4ALZA 3HPHA 2B9WA 4CH0S 2YNGA 2YHYA 2A6MA 1VRUA 3R7SB 5EWFA 4A2AA 3JQJA 2HF3A 3P8BB 1RT4B 2WBMA 1BLUA 2MLXA 1EARA 2CPFA 3FQKA 3OYFA 1WG1A 2NRWA 4Y28C 2YH0A 3CDAA 5GADU 1REVB 4DPOA 3R2DJ 1HKAA 5C12A 3Q86A 2HSTA 4K5SA 3UDVA 5GIPA 2G8KA 2OPRB 3GV8B 3PHTA 4DR6J 3AO3A 4JI8F 2V67A 3LL3A 3VVTA 1YJ9N 5KFAA 4F2SA 4USTA 2BJ8A 3CD5A 5SWMA 1B7YB 5E3AA 5F9NA 3PVXA 2ZJQQ 4KB0A 2V4RA 2RAQA 3H4DA 3C16A 4KH1B 3W3SA 3TVYA 3HL8A 2FC8A 4WFXA 1S1WB 4I67A 4Y34A 4DX7A 3CVKA 4EGLA 4A8XA 4M5GA 2HMPA 4RW8A 4KAIA 2LEPA 4TY8A 1U48A 4A8OA 2DT9A 3SSQA 2MKJA 2Y0SD 2Q1LA 3MCPA 5A76A 4NO7A 1RBAA 1VQKN 3QT8A 2XYHB 5JVGL 4YNQA 4K42A 2CJYB 2X1BA 2FTRA 4X64K 2XLIA 2A1SA 4BRIA 3CWJA 4QYZJ 4CI6A 4FJJA 2VBXA 2XGQA 2ZFHA 1F5CA 1RAHB 2KJVA 1VQ8S 1NG9A 2E2PA 3BPDA 1C1CA 1PCAA 1QUVA 3QT6A 2MQLA 4A61A 3GWCA 2E9ZA 4CLTA 4CTAA 1KR4A 4K4XA 4LFCF 4M1KA 3F44A 3MR7A 4OJHA 5AXNA 2W7OA 1DTQB 1N32K 3M6GA 4FJLA 1N8RO 1YI2N 1HNXK 4I56A 4E7IA 5M1PA 2QA4S 3JXUA 2ZZTA 2VJUA 1FESA 3F0NA 1D0EA 4WK1A 4PG8A 2BABA 2QL7B 3PO4A 4X4UA 4JK9A 2K1RA 3TUZC 2P9SA 1U6ZA 2VWKA 2HNYA 1N5YA 1FRIA 1ZETA 2GNKA 3ZEUB 3NVMA 3ZTPA 3HK2A 2ZH3A 1G6BA 4PR6A 4DHYA 3M05A 4OV6A 1EP4A 1E3MA 4O23A 4GKJF 1OPZA 4MKAA 2O8DB 2ZJRL 1NB7A 3K2PA 5LM7E 1RKIA 2N3LA 1NGEA 4P52A 1NGDA 1KD1O 4ES3A 3OS2A 2W9BB 2IA6A 2QN6B 2UUAJ 4F4AA 1SH3A 3NGUA 4MDAA 2OA8A 1R8AA 1N32J 3UN5A 1XC3A 4DEZA 4F4KA 4AFFA 2XTJP 2AQ4A 4FM1A 4TNOA 5LMUF 1MW7A 4PEOA 1M1KT 1PYTA 4H4OA 5A8KB 1I5OB 3FZLA 3EE3A 1P27B 1FNMA 2FZKB 3AD9C 3CFOA 4CJSA 3NMUA 1RTHB 3P4UB 4GO5X 4FJNA 1GLBG 5DQHA 1KHVA 3U7JA 3EGZA 3DAWA 1EX4A 1YUWA 2GUPA 2QI2A 1U8WA 4F26A 1JXLA 3VQCA 5HQMA 1UVKA 2BEFA 1TKXB 3TJ8A 3GSDA 4UOCA 1FEEA 4OHXA 1IKYB 4LF4F 3GOIA 3QRPA 4DR1F 4AQYF 4H5VA 4NEZA 3Q8RB 6FDRA 4FWRA 3BN7A 3CDEA 1NU4A 2KDOA 4LR8A 3ZTSA 1DLOA 3IAS9 2ALYB 4V1Ak 4ZVTB 3QT7A 3QEWA 3UCGA 1F3VA 2W9CB 1V9OA 1NGGA 2KL8A 1WG4A 2L41A 4ECQA 1WAJA 4OHYA 4DFJA 1TUUA 3DI6B 5J1NA 1K8KB 4WPAA 4F7VA 1NSKL 2CQIA 1TYQB 1RTHA 4EYHB 1TL7A 3MPUB 4IBNA 3MM9A 3CC7S 3EE9A 4C9DA 4QR0A 1Q79A 2WB4A 4P7TA 3ULHA 2RF2B 3DRRA 2MQOA 1N36F 2QX0A 5HOOA 1Q7LB 5JS2A 2HVDA 5KG6A 1TL3B 1LAVA 1KWMA 2P9KB 3AFGA 1X9JA 3TTDA 2EK1A 3BF3A 1YXQA 3DRSA 2HF4A 3HT3A 2AJFE 2JC1A 1NNDA 4DSIA 2JWNA 4ZPBA 5ETNA 4KHNA 2CNNB 4DQRA 3MMCA 3W2VB 5I42B 4WIIA 5JMNA 2ZH9A 3VF6A 5CD4H 1BA1A 1S4FA 4IR1A 5D15A 3OR1A 3HI9A 2HBMA 4N77A 2IFXA 5IV3A 2W6LA 1U8SA 4KFBB 2B8PA 2B5JB 1HL6A 2DFFA 4TSXA 4RTFD 4KY3A 5HMWA 3EL2A 4U67Q 5HVHA 1NRKA 2XQCA 4NYNA 4DL2A 5J2PA 3TTFA 1EKEA 4RNFA 4YOWA 4M3XA 4DR6K 2V50A 1UETA 1T9TA 3ILJA 1IKXA 2GHVC 4DCPB 1LWCA 5KFGA 2EI5A 2V2VA 1YITN 5B0BA 3H59A 3Q8YA 3K57A 5C15A 2B4JA 1JLAB 2M4MA 1F60B 4KTZA 1YKWA 2YJEA 1C1CB 1UJ5A 2XY8A 5JVHL 1W0HA 2QYCA 3ICLA 4F0HA 1OYDA 4A62A 4YEAA 1S1UB 3VEYA 2P9GA 2C2KB 4ED8A 1W9HA 2B56A 3QIDA 2FJDB 1BOTO 2HS0A 1HQUA 1TMMA 3CTRA 1IBMK 1F5AA 3N4PA 1RT6B 2E7WA 4USWA 2LCWA 2CQGA 3PO5A 4LRAA 2ZM6K 4PKDB 2AGOA 4I2PB 1O1WA 4NOHA 3QNNA 1YI2S 4MIWA 3V81B 3L95X 1SH0A 2M2BA 3FSIA 4GKJK 5D0HA 3JS9A 1TYQA 2YNHB 3EGWB 2HIYA 1HI0P 4BC9A 4OYBA 3T69A 2RHSB 3RB4A 4NL5A 5GAHI 4CI0B 2CQDA 1X8DA 3C14A 3C16B 1FJGK 5FLXU 4OX9J 3GDQA 3FZ2A 2W01A 2DIVA 2OJ3A 3MM7A 4OYZA 3Q22A 3KVGA 4X64J 4DTMA 3WHIA 3ID6A 2WZ1A 2Q3PA 1NB2A 4D3HA 3DRRB 3CCMN 1D8YA 1C0MA 2NXUA 1YVNA 5H9FK 4DU8A 3CC2S 3T6JA 2P9IA 4QYRA 3KLEA 4KTWA 2ADCA 3S3OA 2GMJA 3AOBA 4TY9A 3P83D 1S9EA 3KUEA 1DHMA 1K8KA 4DTRA 2CQ1A 2NRZA 3SBTA 3OYBA 1WELA 2HLTA 3W9JA 2IAJB 2C2EA 4I6MB 2HHVA 5DLGA 4FWKA 4HT7A 3GBTA 2DNLA 1HD1A 4CEQA 3CUNA 2DH9A 1VSFA 3MDFA 5IT9O 4ILRA 3O3GA 1OO0B 2YKNA 2FB0A 3I0SA 2R3VA 3FCVA 1QZ5A 2RKIB 3AVMA 3ULEB 4BRHA 2EBEA 1RUSA 1ZPVA 5KFFA 1VRQC 2ZITA 3AAQA 1N36J 4EYIB 4BR7A 3QRRA 1UEVA 4G6VB 3K5LA 5AZJB 3S7RA 3N79A 4NCGA 4URSA 1MMDA 4FF1A 1TL1A 1HW9A 1VBXA 3NS6A 3TTCA 2HFVA 4JI2J 3QGIA 3ATVA 1GLCG 6FD1A 2V52B 5ETPA 3FEZA 3MDQA 4MIAA 1DT9A 3TZWA