3I0RA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 3
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 146
structure length 545
sequence length 545
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0rA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0rA05
4G3IA 4WE1A 2XGQA 1S1VA 4DL3A 3QO9B 4FS1A 1EP4B 1EXQA 2A1RA 4Y2CA 3IGNA 3U3YA 3DRSA 3QNNA 1QE1A 3MEEA 1TV6A 3KK2B 3HPHA 5FRNA 4C8OA 4CJVA 3WNHA 4CJSA 3MFHA 3M9OB 2D3ZA 3AO4A 1WAFA 4O44B 4M3RA 4NCGA 4DSLA 3DOLB 4FJLA 1QUVA 4CGGA 5KFSA 3MR5A 4DF4A 3FQKA 1LW2B 3EYZA 4E7JA 5DGBA 3PW0A 3CDUA 4OKJA 4LSLB 5HLFB 1S48A 2XGPA 2KFZA 2F8TA 5KFBA 4F4XA 4EO6A 4F3OA 1J5OB 4CF2A 4O5BA 4DG1A 2WB4A 4KV8A 1IKVB 4JRQA 1KLMA 4CEOA 5T7BA 5FROA 1TVRA 5JUMA 1N5YA 4E1NA 4MK9A 2IM3A 1NJYA 1RT2A 5DG9A 3EPIA 3SQ1A 4DLGA 1KTQA 1FKOA 4MIBA 3QGHA 2W7PA 3Q8SB 1ASWA 4FCYA 1WNEA 2ASLA 1BQNA 4FZXC 2ZQBA 1TL1B 3OS0A 3DMJB 1CZ9A 2E9RX 2VG7B 3TAGA 2O4IA 3KLGB 1TKDA 1LWCB 4CEZA 1BGXT 4M3TA 4M45A 2BDPA 3KD5E 2V0NA 3SI8A 4HUGA 1XR7A 5DMRA 2GUIA 1JLFA 4O4GB 4FVMA 4PWDB 4MIAA 1VSFA 3K58A 2ZKUA 2JEJA 3OSPA 3O4QA 3P1GA 4CK2A 4DQRA 2G8IA 1NNDA 4I2PA 1Z4UA 2XO7A 1T7PA 2BQRA 3BQ1A 2XY5A 3SUQA 3LP3A 3DLKB 4WXOA 2HVIA 5KG3A 4F3TA 4FJKA 1JLEB 2OPRA 2B43A 1CXUA 1U47A 3SYZA 2GIQA 3DI6A 4J9LA 4BDYA 4TY9A 3TANA 3V81B 2C2DA 4IG0B 1I6JA 1RT5B 1S9FA 1EX4A 3PUFA 4FBTA 4LQ9A 3V9WA 5D3GA 3GILA 1TKXA 2F8SA 5FRMA 2XI2A 2XWYA 3I5CA 4IRCA 3E01B 3L8BA 3NE6A 2R8JA 1VRUA 1XI1A 2RDIA 3HPGA 3WNGA 2R8HA 2IC3A 3TVKA 3QESA 2ATLA 1NJWA 4F2SA 4CJFA 4DMNA 3V1OA 4M95A 4JS5A 4E7IA 2IM2A 1B9FA 4KTZA 3IS9B 1JLQB 1UAXA 4EO8A 1CXQA 4F8RA 1RAJA 3NGYA 4QWAA 2QV6A 1U45A 1DTQB 1Q9YA 1Z26A 4DSJA 4BWMA 3TAEA 4IDKB 4IRKA 1TL3B 3IGVA 4FM1A 1MU2B 1TAUA 1XHXA 5KFWA 1NK5A 4B3OB 1IM4A 2IM1A 3HXMA 2LSNA 4DTXA 4DEZA 5C24B 2IMWP 4DLEA 1RDDA 1D0EA 2GC8A 2ASDA 2AWZA 3T5JA 3KJVB 4FW1A 5HRRA 5HRNA 2R2TA 3NAIA 5KG5A 3AVIA 4OL8A 4KHSA 4J9QA 3KLIB 1L3VA 2OPQA 1VRTB 4IH6A 4J9OA 4DSIA 1IG9A 1ZBUA 1CLQA 2HHSA 1NKEA 2UVVA 3KIOA 3AA4A 1HMVA 3KLFA 4FJXA 4DTNA 2FVCA 3T1AA 2JC0A 3G86A 1W25A 2HAIA 5K14A 4PQUB 4R5PB 3DM2A 4ZHRA 3M9MB 4FLUA 2J6TA 4KE5A 1REVB 3L2WA 3QLHA 4LY7A 1OS5A 1RTJA 3M8QA 2HHWA 3KD1E 4KPYA 3NBPB 3AO1A 1TKTB 3SQ4A 4J9SA 4DU3A 1SV5B 3GV5B 3K5OA 4KFBA 4MKBA 4FZYA 4R8UA 4K4XA 4N56A 3PHEA 1WLJA 4LH4A 4NLXA 4CF0A 1HNIA 4HCBA 2D5RA 1D8YA 4N76A 1HYVA 3MXIA 4ED6A 4GVMA 4HUFA 5C25A 5KG4A 2R8GA 4DQQA 3ICLA 4KO0B 1S1TA 3PO5A 3G6XA 4DL2A 3C95A 2IGIA 2RF2B 1FKPB 3OYNA 3KHHA 1HRHA 2HNDB 3NGIA 3BSNA 1BI4A 3DRRA 4EBDA 1RNHA 4GC6A 1X1PA 4QWEA 5I42B 4KSEB 2RKIB 3IN5A 4K4ZA 3C6TA 3NF9A 5F9LA 4ECSA 4C8NA 3OYLA 2BE2B 2D41A 1BCOA 4CK3A 4PUOB 4WE1B 4ID5A 4KB7A 4F2RA 1ZBIA 2HNZA 4DTUA 3EY1A 2W42A 3H5UA 3DRSB 4DTJA 1QE1B 3MEEB 2HWIA 2AGOA 4FLXA 1KFSA 4OLAA 3TARA 4TN2A 4FLVA 3RTVA 4RW9A 1SKWA 5C5JA 1JX4A 2E9ZA 4B08A 3CFRA 3C94A 4RZRA 3QGGA 3VQAA 3F73A 1WNSA 3K57A 1BQMB 3AVMA 1QHTA 4CJTA 3LAKA 2ZD1A 2E6LA 4CHOA 3SV4A 2KFNA 3MECA 3JSMA 4DFKA 3LPUA 1NK6A 4FM2A 3PV8A 1XR6A 3P83D 3AA5X 4DG1B 2W7OA 4KV8B 3PO4A 3CFOA 1S1XA 4K4UA 3ZSOA 4E7KA 3EZUA 3OLBA 4O3QA 4U6PA 4F50A 1N5YB 2YKMB 5KRTA 3SV3A 3B6PA 1RBSA 4KHWA 1RT2B 3KLEA 1JLGA 1JLBB 5KG6A 3C6UA 3S3OA 2W9CA 1L3SA 1FKOB 1RA6A 3HYFA 3V1RA 1BQNB 2FLNA 1T03B 3CIZA 4ZVFA 4RG8A 3GIJA 1RT6A 5CYQA 1NKCA 4J2DA 4GC7A 5EU7A 3K5LA 2UVRA 4CF1A 1SH2A 5KFAA 3HM9A 1JLCB 3I0SA 2F8EX 4DSFA 2Y1IA 2FVRA 1JL1A 3AVCA 3HHKA 4KKOB 2IAJA 2X6NA 1K1QA 4G1QA 4FJHA 3HVWA 4CJKA 4XIUA 4Z4CA 4KAZA 3UQSA 1TGOA 2ILZA 1RBUA 4NLOA 3H59A 4TQSA 2OPRB 2BANA 4DSEA 3RMBA 3QEXA 3DI6B 3Q8RB 3NGDA 5KFPA 2IBKA 1Q9XA 3LP1A 5EWGA 4EYIB 1KVAA 1S1WA 4URGA 4OPJA 5KFIA 4W5OA 1VSDA 3DLGB 1GX5A 4ECXA 4DFJA 2OZMA 3SUOA 2KW4A 4TYBA 1YTAA 4DQPA 3I0RA 3BREA 2IC3B 4CEBA 3OYAA 3FQLA 3TR8A 5CZ1A 1KHVA 3SUNA 3SNNA 2YKNA 5L1LA 3A2FA 3CQ8A 5JXSA 5KG0A 5HP1B 1WSJA 2Z1GA 3PVXA 3CYMA 2I1RA 3AO3A 1ZTWA 3QINA 1ZYQA 2G8VA 2HNYB 4ECWA 2BQ3A 2OPPA 3HP9A 3RBDA 3HL8A 2B6AA 3BGRA 3BJYA 1YVUA 2QKBA 1SH3A 4XPCA 1F21A 4FJ8A 4WYWA 1J53A 2FBTA 3KK1A 3KLHA 4WYLA 4ICLB 2HMIB 4KAIA 5E41A 3GIKA 1D9DA 1C0UA 5KT3A 4ED1A 3E51A 5J2PB 3V9SA 5KT7A 4KHNA 2WK4A 1C0MA 1UWBB 2R2RA 2FVQA 4IRDA 4DTRA 2WONB 2PY5A 3GIIA 3V6KA 2OPQB 3SUPA 4NLPA 5SWMA 4IKFA 3NH1A 3M8PB 5KGWA 3H5SA 2R2UA 3ZSQA 1N6QB 1LWFA 1HMVB 2R7YA 4LD0A 4Z4HA 2QK9A 3M9NB 4IQXA 4WZQA 3DLEA 1C6VA 1RTHA 3AA3A 2FLLA 5K14B 4MQ3A 1R0AA 2O4GA 4ZHRB 1KLNA 4U7CA 3MF5A 3HKWA 4FK2A 3OY9A 3QLHB 1SKSA 4Y1DA 1NK8A 3IAYA 4DF8A 3QZ8A 3OL7A 4CHQA 1WAJA 5KFQA 4OJRA 1SL1A 1A5XA 3MFIA 4KFBB 1QSYA 4R8UB 4IFVA 2VA2A 1UA0A 2AQ4A 5J1EA 3QEPA 4J2EA 2B4JA 4KREA 4W5RA 1HNIB 2G8KA 4RW7B 4Z4FA 5I3UA 3T3FA 4RW8A 3OYKA 2IOCA 1K6YA 2E6MA 4IFYA 2XY8A 1GOCA 3CM6A 3ITHA 5HBMB 1RDCA 4MH8A 1S1TB 4J9PA 4JUZA 4E19A 4KI6A 5L1JA 4Q8EA 4BE1A 1N56A 5J2MB 1LW0A 2AX1A 4KTWA 3VQ7A 4JRPA 4EEYA 2JEIA 4BDZA 3O3HA 2BRLA 4Q0BA 4YNQA 3FFIA 3DLRA 5FDLA 3G0ZA 4FW2A 2AX0A 3C6TB 2W8KA 4CHZA 2D7SA 5C42A 3VA0A 3QEWA 4FLYA 5EUHA 4EZ6A 4URQU 3KNAA 3WNEA 3N6MA 3DRPA 4UQGA 1T8EA 3ISND 3EZ5A 1DLOA 4J9MA 1LV5A 4CJLA 5DQHA 4MFBA 2FBYA 3DLHA 4ZPDA 3UR0A 3RB6A 1ZBHA 4E89A 5KFFA 2J6SA 4CJ4A 1S9EA 4DTSA 4B8AB 1EETA 4O55A 3V6HA 4KB1A 1ASUA 4CIFA 4CFAA 2V4RA 3V6DA 2V9WA 2KQ2A 3LP2B 4FLWA 5DG8A 4N47A 4M42A 1S9GA 3NH0A 4URSA 4MK7A 1RT3A 4ECTA 2FC0A 3CJ5A 4DFPA 2ZD1B 4CERA 4YQWA 3AVGA 3OS2A 1TKZB 3QIPA 5DQGA 5L9XA 3MR3A 3MECB 3JSMB 3CJ4A 4IOBA 4NRUA 1NK0A 3KTQA 1RT1A 1BIZA 3V4IA 2OYQA 2YNIA 5KFOA 1JKHB 4YR0A 3D0PA 4ED3A 4H4MB 1QTMA 1S6PB 5J2QA 1KFDA 4M41A 2VG5A 2P51A 1JLGB 4RNNA 1D9FA 3BR9A 4EBEA 3C6UB 1SL0A 2W9CB 1TP7A 1RYSA 1B9DA 1JLAA 3T19A 3KHRA 4DWIA 4NZ0A 4NYZA 5EWEA 3GIMA 4K4VA 5CZ2A 3OYCA 4WFYA 4M3XA 2YHAA 4CESA 3DYAA 2Z1JA 4CJWA 1RT4A 2IAJB 1W0HA 3QIOA 3FDSA 2F96A 4E0DA 3LPTA 4G1QB 3MEGB 3QYYA 4NYNA 5KRSA 1TQLA 4RW4A 3K5MA 4FJ9A 1TK8A 2BANB 2PZSA 1C1CA 4QCLA 2BQUA 4JV0A 4QW9A 2GBZA 4ECUA 4QWCA 2XI3A 3ULDA 4KBIA 3TAMA 2OPSB 3KK3A 1ASVA 1EKEA 3L2RA 3B6OA 1HYZA 3TABA 3CVKA 4W5TA 2YNFA 2IJNA 3CJ0A 1I39A 4B9NA 2UVUA 3MEDA 5DLFA 2YKNB 3CG7A 2ZE2A 3SFUA 5KI6A 3G6VA 3QO9A 4FXDA 5HRPA 2HHVA 3AO5A 5HROB 3MR6A 2O5DA 4ZTJA 2OPPB 3NAEA 3MTKA 3LALA 3KK2A 3GYNA 3BGRB 2B5JB 1NJXA 4AHCA 3DOKB 3MAQA 4IH5A 4BE2A 5KFJA 1U4BA 4I7FA 4CK1A 3KK1B 3CDEA 3O3GA 5KT5A 3GV8B 4C8KA 5HRSA 4O3PA 4GW6A 4IR9A 4H8KA 5J2NA 2P5OA 1LW2A 5KFKA 3TAQA 1HNVA 3THVA 4FLTA 4WZMA 4CJ3A 1U48A 3RMDA 5HLFA 2FVSA 3ZSYA 3LZIA 4Q43A 1IKXB 2OH2A 3V9XA 3HT3A 4K4SA 3MR2A 2W8LA 3PZPA 1J5OA 1LWFB 3Q8QB 3RR7A 3EPGA 4ECVA 4ID1A 1IKVA 3RR8A 3FSIA 4EYHB 3DLEB 3PX0A 3OLAA 3TAPA 4RUCA 1RTIA 2AGPA 4H54A 3OYJA 1SUQA 1S1VB 1R0AB 2BGGA 1S4FA 5KT6A 4NCAA 1D1UA 4BDPA 4J9NA 3AVJA 3CJ2A 2DPIA 3IG1A 4NLTA 1TV6B 3ZSVA 4ZP8A 3RB3A 3RMCA 4M3ZA 3FRZA 4PY5A 3CDWA 3OYEA 4CHPA 2VG7A 3RBEA 4IBNA 4MK8A 1S0MA 4OVLA 3QNOA 3RRGA 1KSPA 4QPXA 2R8IA 3QGIA 3AVKA 1VSHA 3OYBA 1IKYA 4IFVB 4WFZA 4NCGB 4OLBA 1CSJA 4KHMA 5J1EB 1KHWA 4O4GA 4ED2A 4YP3A 2IS3A 1KVCA 4PWDA 3VQCA 5I3UB 3PJXA 1O1WA 3VQDA 3VQPA 2WOMA 3LP0A 2ETJA 1TAQA 3PX6A 4EZ9A 3PW5A 4Q45A 4I9QA 3I5BA 3K2PA 4NLGA 2G8HA 1J9AA 1RBVA 1KLMB 4AHUA 1ZBLA 4TY8A 1TVRB 1LW0B 2QKKA 3PR4A 4FK4A 4Q0BB 1FK9A 2KTQA 4O4RA 1RT5A 3VQSA 4CGJA 3HVRA 2D0BA 3FFIB 2NUBA 5FDLB 4OKEA 3H4BA 1NK9A 4HVJA 2UUWA 3E01A 3G10A 3ZT4A 4RU9A 4TLRA 2DFHA 1JL2A 5KFLA 2HWHA 1NHUA 2HHUA 1DLOB 4ZVGA 3BDPA 4CGIA 4ELUA 4EBCA 1JLFB 4MFBB 2P1JA 3IS9A 1JLQA 4FJIA 3V6JA 2AJQA 3L3VA 5EDWA 5SZTA 4CGFA 3OHBA 2E4LA 1S9EB 4ZP6A 3ZSRA 4IH7A 3S9HA 4I2QA 4I2PB 3NF6A 2I5JA 1RYRA 4IDKA 4CEDA 4ECQA 4YFUA 1MU2A 1S9GB 4AHVA 4B3OA 1RT3B 5KFGA 4DU4A 4O3OA 3UPFA 2G8UA 4OPKA 1NKBA 3QEIA 4CJUA 1LAVA 3NH2A 3KJVA 1IH7A 1BISA 2CKWA 4CGHA 5D3GB 2RDJA 1C0TA 1TKXB 2JEFA 3KLIA 4FLZA 2YNIB 2DFEA 2UVWA 1JIHA 3ISNC 1VRUB 3ALYA 2XY6A 4ZPBA 5J2QB 3SZ2A 4K8ZA 1RBRA 1ZTTA 2HVHA 1DTTA 1RDRA 2VG5B 4J9KA 1MMLA 4J2AA 4CGDA 3CJ3A 3CWJA 4MKAA 4AHTA 4F4WA 3NCIA 4R5PA 4F4ZA 1JLAB 1IO2A 3L2QA 1XR5A 3VQEA 3AO2A 4XPEA 1WSIA 2G8WA 1B92A 4F4KA 4Z4IA 2J6UA 2PYLA 1JXEA 2UUTA 3T5KA 4CF9A 3NKYA 3NBPA 3T5HA 2FLPA 3L2UA 2Z1HA 1X9SA 1GOAA 1VSEA 4XO0A 2YNHA 2CJQA 3T5LA 3O3FA 5KFXA 2FJXA 1WSFA 1UA1A 3OYHA 4Y3CA 3BSOA 4RW4B 1YT3A 4B9MA 2YV0X 4AHSA 4IKAA 4O0JA 4ED7A 2C22A 4CE9A 3U3GA 2ALZA 1RILA 3KLFB 4ZMMA 2RF2A 2PYJA 3AVHA 1G15A 2HNDA 1RDBA 4AILC 2OZSA 4K8XA 3DM2B 1U49A 4JS4A 1TK5A 1NHVA 3OL8A 4WFXA 1RBTA 1FXXA 3BQ2A 5I42A 1RTJB 3M8QB 5KT2A 3S3NA 4FJ5A 1NOYA 3PW4A 4ED0A 1KRPA 1S0NA 2ZE2B 4NLVA 4PUOA 2KZZA 4IG3A 3QIDA 3K59A 3NMAA 3MXMA 2GIRA 3D28A 3H5YA 3VQ4A 2FVPA 1VSMA 1L5UA 4CEAA 1JXLA 4O3NA 4KI4A 2D0AA 4K4WA 4DFMA 5KFUA 3N6NA 4CFDA 4I7FB 3VQ9A 5C25B 5L1KA 2P5GA 3OYDA 2XHBA 3ZT3A 2ATQA 2D3UA 4C8MA 1RTDA 3VQ5A 2KZMA 4O3SA 4KHUA 5J2NB 1BQMA 2ITGA 1HNVB 1IKWA 4Z4GA 3RAXA 1KCFA 2E9TA 1BI4B 2EC0A 3DRRB 2R2SA 4LSNA 1S49A 3QERA 3H5XA 4RW6A 4OGEA 4NRTA 4B9SA 5KGXA 4H4OA 4ZVHA 3JYTA 4CHNA 5T14A 3NHGA 4KHYA 3NF7A 1RTIB 4ID5B 2YKMA 1SUQB 3S3MA 4OGCA 3OJSA 2HNZB 1WSHA 4CFCA 3OYMA 2VG6A 4B8CA 3M8SA 2Q3SA 1JLBA 2IA6A 3AVFA 3IG1B 4K4YA 4YR3A 4J2BA 3KOAA 4CFBA 2DPJA 1BIUA 2HB5A 3VQBA 1T3NA 4AHRA 3V9ZA 4JLHA 3BSAA 2Y1JA 1T03A 2XY7A 1T05A 2IM0A 4RW9B 4K50A 3ASMA 1BCMA 1ITGA 3AVBA 3SI6A 1IKYB 3IRXA 3AVNA 4CJPA 3PJWA 3QEVA 4DL5A 1JLCA 4E1MA 4FM0A 4TXSA 2W9BA 1U04A 2WOMB 1BL3A 4KKOA 4Q5VA 3LP0B 2DTUA 1S6QA 1QQCA 2RN2A 4TSXA 1N48A 3M8RA 4NCBA 3KMQA 4NLRA 1S1XB 2RPIA 2WCXA 4TY8B 5F8MA 4DS5A 5CYMA 1HPZA 4HKQA 1L3UA 4Y34A 1FK9B 3KLEB 4NLUA 3LANA 5KFVA 3NAHA 3WNFA 4FJNA 3SQ0A 2X74A 3DLGA 5KFYA 4ECRA 3OVNA 4AH9A 1HQEA 1LAWA 3UIQA 4ZPCA 5KFZA 4FJ7A 2HW3A 1RT6B 5CYQB 3SPYA 4NLQA 1VSJA 4Z4EA 3VA3A 3ZT0A 3KLVA 5HP1A 5F8HA 5DK5A 4Z0UA 3I0SB 1C1BA 1LWEA 1Y97A 2XCAA 1HYSA 3OYGA 3HP6A 3CFPA 1NOZA 3ZT1A 3KKSA 2HNYA 4CCHA 2HHQA 2GV9A 4I2QB 5F8IA 3I5AA 2I5JB 1HARA 5DGAA 2HHXA 4GMJB 1RT7A 4DQSA 3HVTA 4YR2A 2X6SA 3VN5A 1WN7A 2A1SA 2YNGA 1XHZA 3V1QA 4B9VA 4ICLA 4CEEA 2HMIA 2OA8A 4YMEA 3LP1B 4HYKA 4TYAA 5J2PA 1S1WB 2JEGA 3BSCA 1UWBA 1S1UA 4N5SA 4W5NA 2WONA 1C0TB 1RCHA 1Q8IA 4ECYA 4CJ5A 4CEQA 3QZ7A 3Q8PB 3V9UA 3M8PA 3I0RB 1JXBA 4CF8A 4KRFA 1K1SA 1N6QA 2FJVA 1DTTB 1HQUA 4ELVA 4IR1A 3TI0A 3OL9A 3OSNA 5F8GA 3NF8A 3RB4A 2IJFA 4HTUA 5KG7A 3H2LA 3LWMA 1EP4A 2C2EA 3PW2A 4CJRA 3NL0A 2QXFA 2B6AB 5DG7A 4O3RA 1N4LA 3SQ2A 5KFDA 1VK0A 1T94A 3O4NA 4FBUA 4J9RA 4N41A 4LQ3A 3NFAA 2HHTA 3KLHB 5KG2A 4BACA 2YNHB 1CZBA 2W9AA 4O44A 1W9HA 4FS2A 1HJRA 4KHRA 1C0UB 3DOLA 3ZSXA 4EP5A 3F9KA 1BHLA 4PA1A 3OJUA 2V4QA 1SL2A 4RW7A 4I9LA 3TQ1A 3LDSA 1Z25A 1X9MA 4LSLA 4M3UA 3SPZA 1YTUA 3TWHA 3ZSWA 3RB0A 1QAIA 4ZTFA 4DU1A 5HBMA 5F8NA 3ZT2A 3SCXA 4ED8A 2WHOA 2C28A 5EWFA 4NLYA 2R8KA 4CECA 1RTHB 2DFFA 5J2MA 4NLSA 4CIEA 4M3WA 2ASJA 3RAQA 4Y1CA 4NLWA 3PY8A 1S0OA 1NJZA 4DL7A 3HJFA 2ILYA 3NGZA 3H40A 4Q44A 2QE5A 1SH0A 3H08A 4FYDA 3HO1A 3OL6A 3KHLA 4F4YA 4DQIA 4BE0A 1NK4A 3HVAA 2IDOA 2Z1IA 2EHGA 1TL1A 3D5MA 5L1IA 2G8FA 3DMJA 2FJWA 4IG3B 3SFGA 3KLGA 4QOZB 1LWCA 4LH5A 5KT4A 5KFRA 2D0CA 4QWBA 3RWUA 4HUEA 2WTFA 4KTQA 2WRMA 5KTQA 3OYIA 4B9UA 3HPOA 4RW8B 1L3TA 1XC9A 4IFYB 4CHYA 3H4DA 1A5WA 5KFHA 1J54A 3ITHB 3DLKA 3LP2A 3DDKA 3RMAA 1RTDB 1JLEA 3L3UA 5KFMA 1C1AA 1IKWB 4O0IA 2AGQA 3P5JA 3KKRA 1TKZA 4LSNB 3V81A 4IG0A 4RW6B 4DL4A 3ZSZA 3QETA 4QW8A 1GOBA 3GQCA 4H4OB 3PX4A 4FK0A 1GX6A 2JC1A 1JKHA 3JYTB 5C42B 1VSLA 3OYFA 4DSKA 4H4MA 5F8JA 4CEFA 1QSLA 1S6PA 3RRHA 3SJJA 3DRPB 2VG6B 1QSSA 3AV9A 1YVFA 4TQRA 4C8LA 4FJGA 3I8DA 1QAJA 3UDLA 2X78A 4DL6A 3VQQA 2EX3A 1T05B 4Q8FA 1EETB 4HCCA 5KFCA 1DTQA 4Y2AA 1U09A 3V6DB 4R0EA 3IRXB 3HK2A 5KG1A 1TL3A 3L2VA 4DTPA 3N6LA 5F8LA 4L8RB 1S97A 2W9BB 4FJJA 3BQ0A 4ZP9A 1D5AA 5C24A 3QIPB 1TK0A 3MEGA 4DTMA 1VSIA 1S6QB 2JLEA 4JV2A 3H98A 4B9LA 1RT1B 1QS4A 1S10A 3AVLA 3TAFA 4KHQA 3LAMA 3V4IB 4M94A 1VRTA 4NLDA 5JS2A 1RDAA 1ZETA 5CYMB 1HPZB 5DQIA 1WSGA 2FBVA 2DY4A 3MXJA 2VWJA 4FZZA 4WXWA 4BWJA 2OPSA 4ZVEA 4CJEA 3GV7B 4HHTA 4E7LA 4PQUA 4X2BA 4QWDA 4ECZA 3U6FA 5CY4A 1REVA 2XCPA 1HQEB 4ZP7A 4K4TA 4E7HA 3KHGA 3AA2A 3AVAA 4RNHA 5DLGA 2FBXA 1X9WA 2XC9A 3DYAB 1A5VA 4RNMA 1TKTA 5F9NA 1VSKA 1SV5A 1C1BB 1LWEB 1RT4B 2VA3A 1HYSB 5HROA 4FJMA 1C2PA 3D45A 3K5NA 4DTOA 4B9TA 2VWKA 3ZCMA 2YHBA 2B5JA 5KFEA 3VQ8A 3DOKA 1RT7B 3LZJA 3HVTB 4EP4A 1RA7A 2JGUA 2BRKA 2YNGB 4E3SA 1C1CB 3CM5A 1WSEA 4KO0A 4JV1A 4QAGA 4W5QA 4RNFA 3LWLA 3TAMB 1S1UB 3PR5B 3KK3B 3OHAA 1FKPA 3PW7A 4RUAA 5JS1A 2AU0A 3VQ6A 4KB0A 1KVBA 4CJQA 4ZPAA 4CIGA 1IKXA 5KFTA 1UOCA 1NK7A 4NYFA 3KMSA 1I3AA 3NDKA 3DLBA 3CO9A 2RKIA 2C2RA 2YNFB 3G6YA 1ZBFA 1HQUB 4M3YA 1S5JA 5KFNA 4OKKA 4DS4A 1SKRA 4RNOA 3HSTB 3MEDB 4ELTA 2BR0A 2XRIA 2BE2A 3OS1A 1XWLA
chains in the Genus database with same CATH superfamily
2WW8A 2IFXA 3QO9B 4K2JA 3W64A 2A1RA 1FFGB 4P10A 3AJ1A 1QE1A 1I94J 2Q0RA 1TV6A 3DKDA 3HSJA 3PKYA 4C8OA 1DURA 1P9QC 4CJSA 3ID6A 5CH7B 2CPFA 1KQSR 1XEZA 2DR9A 2BBEA 1XQSC 4LF8K 3J7A1 1TMJA 1U02A 4M3RA 2K06A 3H45C 4FJLA 3FQKA 4WCEL 3QWUA 3PW0A 3MMCB 2UXDJ 5HLFB 1WKKA 2XGPA 2ZJQQ 2ZM6K 2Q79A 2ZH5A 5KFBA 1SIWB 2DHGA 2WB4A 3EGNA 2E44A 2FJBB 3KKFA 4W98A 1MDUB 3CC2N 1KLMA 1OQ3A 1OYDA 3M8YA 2JWNA 4DV7J 3WXLA 3EICA 4ETXA 2QLXA 2K7KA 3ZX3A 4RWWA 4C97A 1KN6A 2P9IB 4DLGA 3D0IE 1VHXA 3POTA 1V5VA 4MIBA 2UUCK 2C3YA 2ZBRA 2ASLA 5GADP 2E5IA 4FZXC 1RWOB 3CEDA 2QI2A 3TSPA 3ZZZA 4JEPA 3TAGA 4QR0A 2O4IA 1LWCB 4CEZA 3TP2A 4IO9Q 3SCIE 2QEXN 4M45A 2DNPA 3SMSA 1F2HA 3I87A 5IFMA 2Y1RI 4XH5A 3FSYA 2ZKUA 2O8BB 3P6YC 1Z4UA 3T1HJ 1OIAA 2BQRA 3BQ1A 5DM6L 3DN9A 4KIAA 1EIYB 4F0MA 2B43A 2YY3A 4OPAA 3K0SA 1VC0A 3KVGA 3SYZA 4HDGA 3DI6A 1DAXA 3AA9A 5M2UA 1GLAG 2X1FA 4I6WA 1V9OA 4IG0B 4WK3A 3PUFA 1Q7YO 3V9WA 4YOTA 2UXBJ 2DNNA 3FK4A 2XI2A 3CMES 3E01B 4KH4A 1XI1A 3HPGA 1M5KC 1VHFA 2YTCA 1MA9B 3QESA 3HHEA 2V7YA 4F2SA 2KG0A 3NGSA 4UY85 1QVFR 4GV9A 1KDNA 2VODA 2B8QA 2AZ1A 3IS9B 4EO8A 3BN4A 3QAUA 3DOMA 4EK2A 3ADAC 4E8UA 5T41A 1KONA 2QV6A 1MWMA 2B56A 4DV1F 4DSJA 1Q86O 3K17A 2O8FA 1MU2B 1TAUA 1MG7A 3MCSA 4B3OB 2XMVA 3WEEA 3MHYA 4DTXA 1PYTA 1A0OB 3IFEA 4QOTA 4LIRA 3SK3A 2X51A 2AWZA 2Q66A 4FW1A 3M5RA 5ETTA 1VK8A 4RUHA 4KHSA 6AT1B 1B3TA 4DR2F 4HI1A 3TQEA 4DSIA 4LF9J 3ZTPA 1CLQA 3AA4A 1HMVA 2W4DA 1PC5A 1BE4A 4DTNA 1HNXJ 1FXDA 3T1AA 2JC0A 1W25A 2XYGB 2G1DA 2V67A 2MQQA 4ZHRA 4OI1A 2KXHA 1REVB 1DRZA 4JI6F 3M8QA 3IAS9 4JI8J 4BY9C 3ET6B 1Q81O 2JHEA 1M5VC 4NB4A 3CQYA 3MM7B 4YB1P 2CWKA 3SQ4A 1YTYA 2HHHF 1SV5B 1IBLK 5B8HA 3VAKA 1FI4A 1SS6A 4FZYA 5ADXH 5EGYA 1WLJA 3EKSA 2ZH6A 1YITN 2CUYA 3VV2B 3SDEB 1B99A 1ZM2A 1FHTA 4ILHA 2PBDA 5C25A 2KG1A 1KS2A 2R8GA 2KT5A 1WORA 1S1TA 3I9V9 4RBUA 3UW1A 4DL2A 1HW9A 1N8RO 4NE9C 2ZJPL 1NMDA 3AGRA 2RF2B 1FKPB 4NXNK 1HRHA 2PMWA 1X1PA 3ENAA 4U8YA 4QWEA 5LT5A 5ETSA 3QSYB 3IN5A 4K4ZA 2V69A 1AUDA 5M1PA 3C6TA 4UZBA 3NF9A 3HT0A 4C8NA 2RSQA 3OHRA 3T9ZA 2D41A 4CK3A 4KB7A 4UY8O 4F2RA 1APSA 1XERA 2G0CA 3EY1A 5I3PA 2W42A 3OQ2A 1UVIA 3MEEB 2B4VA 4YHHJ 4OLAA 4ISEA 4FLVA 5C5JA 2EWHA 4OZ2A 1NXIA 2VZ9A 2AEMA 4B08A 2KYXA 4F7VA 1BO5O 4FL9A 3AQOA 2ZD1A 2E6LA 4CHOA 3PKMA 4GKKJ 2NXCA 5CABA 4DFKA 2VBZA 4FM2A 4ETZA 2VUGA 2W7OA 3PO4A 4DR6K 4FNIA 1S1XA 2R7RA 3OLBA 9ATCB 3VCDA 4U6PA 5KRTA 3SV3A 4USUA 1S7IA 3B6PA 1WWHA 5BRHA 1IG8A 4BR7A 4FF1A 1JLBB 1M1HA 1TUWA 4DUYF 2E5LJ 3MM6B 2E1MC 4U67L 3Q7CA 4Y2MA 3MMBB 1YG0A 1VBXA 3UKUA 3WZ0A 3KJQB 4CT8A 3K5LA 4PYDA 2VQEF 3Q0AA 3G25A 3FGUA 3HM9A 2KL8A 1NJIO 3HHKA 1EB0A 2JSXA 4G1QA 1TYQA 1QQMA 3WXKA 1WJ9A 3L7UA 5BN9A 4HTIA 2Q0UA 4DR1K 3MD3A 1UW4A 4TQSA 2BANA 2UP1A 3TO8A 4DSEA 2XS2A 2V2ZA 4XK8C 1REGX 1RAHB 2KHDA 1KVAA 1S1WA 2J0XA 4X64J 4HL9A 4TU7A 4C11B 5KFIA 3NMRA 2BKNA 2IMOA 2ASOA 1GX5A 2GIFA 2OZMA 1YHQS 2UUAF 1YTAA 4M5HA 3R5AA 2DXEA 2R9LA 1J27A 5I4MA 2V94A 3CCLN 3OYAA 1QZ6A 2H5EA 2YKNA 3SBTA 2ZWHA 2B51A 3AO3A 1BMQB 1UPPA 2BKPA 2PGCA 1E6YB 4LRCA 4ECWA 2GUPA 5AQYA 3BGRA 2PE8A 1YVUA 3UE5A 1SH3A 4PG6A 5BPLA 3L9ZA 4XPCA 4ZJOA 4LF4K 1F21A 4FJ8A 4WYWA 4V19S 3GG0A 3EZOA 4WYLA 3KLHA 2JOQA 4J9UE 3L0QA 3VPZA 1RISA 4KAIA 3P3DA 1T3VA 4L3KA 1C0UA 5KT3A 4IOAQ 4F26A 1G1XA 2RU9A 1IN0A 4KHNA 3HZGA 2H5IB 1C0MA 1UWBB 3R8YA 4ALZA 2CQBA 4IRDA 1BHNA 2PY5A 3GIIA 2XLKA 2R7VA 3SUPA 4AYBD 2HS0A 2ZF5O 5KGWA 4GV6A 3TYTA 2CNLB 1I3OB 1QUPA 2EKYA 2J76E 4AQYF 1RAFB 1HA1A 3W5ZA 3AA3A 4AF1A 5K14B 1WF0A 1KLNA 4RTFD 1PAUB 3HKWA 4PXDA 1VC5A 3O1WA 5M1FA 1NK8A 1V3RA 5D4PA 3FSXA 3QZ8A 3OL7A 4CHQA 4PL7A 1Q8LA 3FBFA 5C10A 2CQ2A 2YXLA 1SL1A 1JJCB 1NDLA 1VR6A 3MFIA 1YJRA 4R8UB 4ILGB 2VA2A 5J1EA 5ADXA 3QEPA 2B4JA 3MMVA 2QX0A 3QATA 5HL7Q 2JX2A 4MIWA 1NGHA 3DXMA 2GFFA 4RW8A 2EBEA 2IOCA 5D0HA 2E6MA 3ONQA 4M5DB 1SJ4P 5H9FK 4JUZA 3J81U 4KI6A 1N56A 5J2MB 2LMIA 3A5LC 2FSNA 1LW0A 3HSDA 4JRPA 5SUHA 2MKKA 4A8QA 3O3HA 4YB7A 3QMQA 3FZKA 1NDCA 2WUSA 3OVSA 1S0VA 2NRTA 2VASA 3G0ZA 4FW2A 5DZ7A 4CHZA 4BQLA 4FYVB 3GL1A 3O80A 5D4LA 1RSCA 1YJUA 3IR5B 3N6MA 2CJAA 5KPZA 3ISND 3EZ5A 3BPDA 3CCRS 1DLOA 4GKJF 1LV5A 1KD1O 4CJLA 3DLHA 1XMQF 2HBKA 1ZBHA 4ES1A 2FXUA 4E89A 3MAAB 2J6SA 1S9EA 2NR0A 1VQ7S 3Q89A 4B8AB 3V6HA 3VAFA 2HRTA 4Y00A 4CFAA 4ILMA 2KQ2A 3LP2B 3O9TA 5DG8A 2DH9A 1MWKA 4URSA 4IJAA 4ECTA 1VQLS 2FC0A 3N4WA 3HOSA 1C4AA 4JYAJ 2QWNA 5DQGA 5L9XA 3MECB 3JSMB 3M6XA 1TUYA 2ABYA 4QU7A 6FD1A 1NK0A 3D2EB 1RT1A 3W2VB 2ATCB 3V4IA 2OYQA 2YNIA 3GFZA 2VFSA 3UKRA 3PIPL 3D0PA 4OLPA 4ED3A 3R1LA 1T9UA 1IJFB 2RDDA 1S4EA 1EARA 1KFDA 2JFKA 2VG5A 1OPIA 3H6EA 4EBEA 5GAEU 3C6UB 3IDHA 1SL0A 1E4FT 4LR9A 1PSDA 1B9DA 3T19A 4DWIA 3PSIA 4O0NA 3GONA 4KH0B 1BXNA 4K4VA 3JSYA 1VYAA 3OYCA 2YHAA 2YQ0A 4CESA 2Z1JA 3VEXA 4ZITA 1KBRA 3KUEA 3TX8A 2WAQD 2ZOGA 4OX9J 1RT4A 3AT1B 4KR0B 1A6LA 4E0DA 3TJAA 1G99A 2AHOB 2YWKA 2E2NA 5HMYA 1W97L 3VAJA 2J5AA 4EMDA 1AB8A 3L4BC 4FJ9A 4DPWA 2PZSA 4LIWA 5BR9A 3CC7N 1IBKF 4JV0A 4QW9A 2GBZA 4QWCA 4DZ6A 4KBIA 3T7ZA 3KK3A 3K0JA 3MN7A 1ASVA 2MQMA 4CBWA 3N79A 3L2RA 3B6OA 3CF5L 3NOGA 2CNKB 3CVKA 2QL7B 4W5TA 4FXWA 4JK8A 1Z2LA 2QRRA 1I39A 2GS8A 3KWGA 2UVUA 1HKAA 4L3QA 5DLFA 3CG7A 3KUGA 4ZDNA 2GCFA 1TL4A 3M3ZA 4IOXA 5HRPA 2HHVA 5B0DA 3AO5A 2OLWA 2QWLA 1NEEA 3UNYA 4DV2K 3BKUA 3KK2A 2HBJA 3CC2S 4NXMK 4MJKA 2FIUA 3OTBA 4BE2A 5GAHP 1RBOB 2XM3A 2PFUA 2ZUAA 2GVDB 2VQFJ 3GV8B 1ZM3A 4ERDA 4O3PA 4IR9A 4H8KA 3ULEA 3P31A 5J2NA 3H0PA 4WF9Q 4DPXA 3FUYA 3Q22A 2VONA 3J7YP 3C15B 4LF7F 1CJUA 4DN0A 4LRBA 2OH2A 2QEXS 5A76A 5C2DA 2KJWA 1ZH5A 2WTUA 1GXUA 2NLWA 3Q8QB 1LWFB 1NGAA 4ID1A 4EYHB 1WEXA 3DLEB 4X4SA 3D2WA 3FR0A 4RUCA 3SBGA 5E3RA 5KT6A 4CLWA 2HZAA 1D1UA 4YOXA 2LA4A 4J9NA 3AVJA 1Y9OA 2DPIA 3IG1A 4NLTA 1TV6B 2JL9A 3RB3A 1W7AA 3HBTA 3A8JA 2EG2A 3A5MC 3OYEA 4CHPA 2VG7A 4OVLA 3RRGA 1CULB 3QNOA 2R8IA 2V2VA 1VSHA 1TZ0A 4YP3A 1KVCA 4WK1A 3M30B 2MGZB 3VQCA 5I3UB 2WOMA 1EAYC 3LP0A 2YX4A 1KKHA 4EZ9A 3PW5A 1K73O 4K0KJ 3QBCA 2L9NA 3K2PA 4M7YA 2DHHA 4WFBL 2UUBJ 1J9AA 1RBVA 1KLMB 2RS8A 3D1OA 3ISZA 3BH7B 2NZ4A 1NU4A 3LGHA 2GVZA 5JMNA 3OTOJ 5KQ8A 4Q0BB 3TWZA 1X4BA 3O2IA 3VQSA 4CGJA 5JLHA 1YJVA 5FDLB 5CHCB 4OKEA 5AQOA 3H4BA 4GV3A 3QPIA 1H98A 3G10A 2DKOB 2NRRA 2FD2A 3TA2A 4A5BA 4CGIA 2P6TA 2VH7A 4EBCA 3FKBA 2BJ9A 2W2QP 1KNZA 4B1UB 3L3VA 5EDWA 2Z2MA 4BQZA 3QT8A 1UFKA 2CJYB 5HQ8A 2CPHA 4CEDA 1I1GA 4ECQA 5AZJB 2VPYB 3THXB 4DR4K 1QHAA 5CD4H 1RT3B 4L76A 2DD8S 4LFCF 1LAVA 1IJEB 3KJVA 2Z56B 2BJDA 4CGHA 3MMJA 3CIMA 2BM1A 4FLZA 3H1VX 4QS9A 1HBNA 3ALYA 2XY6A 2RQKA 4ISGA 2C2NA 1EKSA 1YIJS 1YITS 2D9OA 4MKAA 4AHTA 4F4WA 3NCIA 4EIAA 1JLAB 1V6HA 1XR5A 3VQEA 4RWTA 3C65A 2G8WA 4OYZA 4DV4F 2UUTA 3T5KA 2EK1A 3M32B 2HQGA 2FLPA 4MTPA 3L2UA 1UFWA 4LT6A 1Q7YT 4JI0J 1VSEA 4WFNQ 1R6VA 4IOCQ 5KFXA 3JSRA 4RLEA 1WSFA 2ZJRQ 1UA1A 3J80O 1LKZA 3AOCA 3CXCR 3MOJB 3FMWA 4B1XB 3OW2R 1EWQA 3BF4A 2AD9A 1OH7A 1VS3A 1WTBA 1WUUA 4P2XA 1SC4B 1K0TA 1G15A 4AILC 1Q86T 4K8XA 3ILOA 2GV1A 1FVSA 2HFVA 4JS4A 2O3DA 1VQPN 1Q82O 3QJJA 4WFXA 2YX7A 3D1QA 5I42A 3M8QB 5KT2A 4FWOA 2F1FA 2C3MA 1SI9A 5IC6B 4FF2A 3CCEN 4NEYA 4ED0A 2CH5A 2ZE2B 5LSOA 2G2OA 4IG3A 1HIYA 3BB5A 1HHTP 3UI3A 3MXMA 4LF8F 3OD2A 4WQ4A 1JXLA 1TL7A 2ITMA 4O3NA 1TU0B 2MKYA 4PEOA 3ENOA 4CYUA 3LPEA 3MWTA 1W2BM 4K4WA 1U0HA 3DNCA 5KFUA 3N6NA 4I7FB 5C25B 2PN6A 2ZM6F 3OYDA 3ZT3A 5GVQA 3VQ5A 2ZH4A 2KZMA 1UEKA 4O3SA 3OTDA 4WCEQ 1HNVB 5GMEA 1Q81T 4J8FA 4MKYA 2EC0A 2DHXA 3H5XA 4RW6A 4HEA9 4F02A 5LXRA 2P9KA 3M8ZA 4H4OA 4N7TA 4ZVHA 2QLFB 4LVNP 3EL2A 1H38A 4FWKA 3JYTA 1UEUA 2Q1LA 4KHYA 1GK8A 3N4QA 1RTIB 3LL3A 4AXJA 3IRWP 2PIIA 2FB0A 1SUQB 5C15A 1XNQK 3OJSA 2R7XA 3P8BB 3NNHA 2SXLA 4B8CA 2Q3SA 4XDDA 1IJJA 2ZOFA 2XTJP 2ZBIA 4DR2J 2NSBA 1FO1A 1T3NA 1SJRA 1N8RT 4JLHA 2Y1JA 2BW7A 4K50A 3ASMA 2DRBA 1NGIA 1ITGA 3PYEA 2ZH1A 2XMTA 1X31C 2EWSA 1ZC6A 1IKYB 2MSTA 5BN8A 3BBFA 1VQ6N 2D9PA 3S8SA 1U04A 4JI6J 4KKOA 1X4GA 4HDHA 1S6QA 3CCLS 1MLAA 1QQCA 4UY8T 5EOYA 5BREA 4NCBA 5DM6Q 1HWJA 1P1LA 5IT4A 1S1XB 2B9WA 5F8MA 4ZOSA 5CYMA 5BR8F 4NLUA 4DV6F 3WNFA 2NXUA 4CNZA 4FJNA 3DLGA 2X1AA 4I67A 5KFYA 2J7KA 5ETVA 3P96A 3OVNA 2IIHA 1P8ZA 4CLKA 2HW3A 5A8KB 4F9OA 3EVMA 1Y64A 3BH6B 1VSJA 3GDQA 2MLYA 4DR7F 4NX9A 2ASYA 3KLVA 3A4TA 5F8HA 3CE8A 1SJ3P 4JK9A 4Z0UA 3BZKA 3H25A 2XCAA 2BJ7A 3K9KA 3MAHA 1OVYA 3DLLL 3GJQB 4MKVA 2HNYA 1TYQB 1EO1A 4I2QB 1TR0A 1RHJB 2I5JB 1HARA 2LQ9A 2HHXA 2V8HA 3VVUA 3SCLE 1RT7A 3HVTA 4AL5A 4AD6A 2C42A 1I5OB 3Q2TC 4DI6A 1M5OC 1WN7A 2A1SA 4YOYA 3V1QA 5CD4A 3D68A 2KH9A 1U25A 3UN3A 5LMUK 1S1WB 4P2MA 2VICA 1RDUA 1S1UA 4CO0A 4ZJLA 5IWAK 3CPEA 3QZ7A 3HHNB 2GMHA 1NJIT 4CF8A 4KRFA 1RWPB 3TZZA 2BE7D 2NPFA 1OMSA 4LRAA 3OSNA 1IBMJ 4P2SA 3ZZUA 4UOGA 1IBLF 4RL1A 3ZZRA 3H2LA 3T41A 2KM8B 3PW2A 1OH5A 3T1YJ 5DG7A 3U9DA 3HHLB 2UV8G 2OELA 3SQ2A 3D0HE 4FDFA 1RADB 5B0GA 2V4JB 4DUYJ 2OP5A 3NFAA 2HHTA 3KLHB 3AD9C 1CZBA 4O44A 4JI1J 3TRGA 4FS2A 3MUTP 1C0UB 3ZSXA 3VZIA 1BHLA 4PA1A 1SJ1A 4RW7A 1OJ4A 1HNWJ 3IUCA 1X9MA 2Q36A 5KQDA 1YTUA 2QYCA 1QAIA 2C2OB 2QA1A 3ZT2A 3CMQA 1HHQA 1NHKL 5EWFA 2OHDA 4IFEA 1ZS6A 3WT0A 4BG8A 2ZJPQ 4M3WA 4V19X 5CHIA 1FXRA 2XB2D 2DEIA 4NLWA 3PY8A 1S0OA 1NJZA 4DL7A 3W0LA 4KHPF 3NGZA 2QE5A 3GSIA 3OL6A 4F4YA 1NK4A 1QD1A 3HVAA 1XC3A 5L1IA 4CO5A 2FJWA 2MXYA 2M3DA 2Q6BA 3VQTA 3SIPB 2UUAJ 1HQ2A 4HUEA 4KTQA 1U7LA 2RQMA 2WRMA 1EX8A 1U26A 4B9UA 3DXMB 4RW8B 4PXCA 2A42A 2VC1A 3CERA 1RAEB 1WF2A 4YOEA 2LP4A 2KRRA 3DDKA 2KU7A 1RTDB 4DR6F 1D8ZA 1JNRB 2XMWA 3VVTA 2CJKA 1RLDA 1IKWB 4JKDA 3HJVA 3GR0A 4B3TF 4LSNB 3FMBA 3MPYA 2CAJA 1UP1A 3BS9A 3WXJA 3M6WA 3X3UA 3QETA 2DRDA 4DU7A 1HI0P 1VSLA 4U95A 5AQRA 3OYFA 4H4MA 1IUJA 3HD1A 2RMLA 1QSLA 3VGLA 4ES3A 2LQ8A 3QICA 3SJJA 1A7GE 3GFYA 3VENA 3EE9A 3AV9A 1PKUA 1N5QA 3MPUB 3I8DA 4U67Q 3CC7S 3JSBA 5C2GA 1T05B 4AQYJ 4CTAA 2WB1D 3CJ9A 4Q8FA 5E84A 1DTQA 1U09A 2CDQA 2YHWA 2HFSA 2APOA 2R4FA 5KG1A 1TL3A 2LDYA 4DTPA 3N6LA 5HN0A 1S97A 3BQ0A 2YI1A 5GIPA 3THPA 4PKIA 1TK0A 1VSIA 4KJIA 2GJIA 1LOUA 2XO6A 4B9LA 3TU5A 3VGTA 3WQTA 2A3JA 1RT1B 1QS4A 3TAFA 3V4IB 2DO4A 1KD1T 3UKRB 1XK8A 1VRTA 5JS2A 3WIVA 4LREA 5CXTA 3QFUA 5DQIA 3MK6A 2EFOA 2M70A 2DT9A 1FX4A 3MMAA 3MXJA 2YWWA 4WXWA 3G6EN 3PJ9A 2HK2A 2ZFHA 4I4BA 4L6V3 4FOEA 4CJEA 4O8KA 2V2KA 4Q2LA 1YAGA 5A2QO 4PQUA 3ID8A 4RR5A 3G96A 3BM7A 2NRWA 3U6FA 4WQ5A 1NMEB 1PJ7A 1RB0A 3W9JA 1CS4A 3AVAA 2Q3PA 2Q31A 4RNHA 3HX9A 3T9NA 1A5VA 4RNMA 2KXFA 1C1BB 2GGPA 4DV3F 1RT4B 1DGKN 4IO1A 3MUMP 2MQNA 3ZZYA 3PHTA 3K5NA 1NGDA 4DTOA 2PEHA 2XMUA 2RS2A 2B5JA 5KFEA 3VQ8A 4MO4A 3DOKA 4HVZA 5KOWA 2RIJA 1QM9A 3KG4A 2YX6A 3FNNA 3BV8A 1LFPA 3UDVA 4E3SA 4GKJJ 1B0VA 1WSEA 5C7PA 4KO0A 1XMQJ 4DR3F 1FESA 2GO8A 2NYHA 4QAGA 4W5QA 4BRPA 5K5MA 2HQCA 1OSDA 3KK3B 3GYXB 1ZOTA 2VD3A 4RUAA 2V8GA 1KVBA 3TTCA 5DJBA 1IKXA 1Y11A 2FHKA 1VFJA 5KFTA 1NK7A 2H3EB 2M4MA 2C2RA 2VFUA 4NASA 1HQUB 1F9FA 5KFNA 4C6AA 4BR5A 3ZC4A 1HWUA 2E1PA 3R3LA 4G3IA 2XGQA 2PMZD 4DL3A 3GCWP 4CD3A 4F4AA 1EP4B 2QA4N 1EXQA 3U8XA 3FEXB 4Y2CA 2EEYA 3DRSA 3KK2B 3HPHA 5FRNA 3PYGA 3GCXP 4KH5A 2HG4A 3MFHA 4AL7A 4FOIA 4GMKA 5F0XA 3JQKA 3D2FB 3AO4A 1WAFA 4JI7F 2QN6B 4DSLA 3MR5A 4DF4A 3ULEB 3EYZA 4OYAA 3UCZP 3RVCA 4CP5A 3DFEA 4OKJA 4L74A 1CJUB 3NCQA 4LSLB 1S6OA 2KFZA 2HAFA 2Y9HA 3KDOA 4F4XA 4EO6A 5HANA 4DG1A 4JRQA 5GADI 5T7BA 4X65J 2NLXA 2DHAA 2IM3A 2HBZB 3E1YA 1NJYA 3GU0A 1RT2A 1NUEA 3SQ1A 1PJ6A 4FCYA 1IBKJ 1ASWA 2F7VA 2JVRA 3J80Y 2JFDA 3CCQN 3CD6N 3DMJB 1CZ9A 2E9RX 4K5SA 2VG7B 2MZSA 1BGXT 2MJNA 2NPIA 5LJWA 3KD5E 3Q86A 4UF4A 4A59A 1UAWA 2P9NB 1XR7A 2GUIA 1JLFA 4PRFA 1ZZNA 1HBOA 4B3RK 4QS7A 3CCTA 2BUPA 1VSFA 4A62A 2JEJA 1S59A 3O4QA 2FZKB 3CPWM 4DQRA 1NNDA 4I2PA 4CLUA 2XO7A 4N77A 1T7PA 2XY5A 3SUQA 3DLKB 4WXOA 3AAPA 2ROEA 5KG3A 1ZBSA 4FJKA 1H2VZ 1JLEB 3B4MA 5B0FA 2LDIA 2P9PB 1VLOA 2C2MB 1NPPA 2LEPA 3CCMN 4BDYA 3OXFA 4TY9A 3TANA 3G71N 1MMDA 3V81B 1I6JA 2GA7A 5D0EA 3EN9A 1H1VA 5AQXA 1EX4A 1HHSA 2R42A 4CZHA 1X8DA 4FF3A 4UZCA 1TKXA 1QLNA 2F8SA 2XWYA 3I5CA 4IRCA 8ATCB 3L8BA 3NE6A 5DS7A 3PIPQ 4CH7A 1KWMA 2RDIA 3WNGA 1FD2A 2R8HA 4X4TA 2IC3A 4LFAF 4G1PA 5FJ4A 4CJFA 1RGIA 1BUPA 4DMNA 2HVDA 4LBIA 2LU1A 4E7IA 2IM2A 4LF7J 2ZUGA 4KTZA 2ALYB 1K73T 5LL6Z 2JVOA 2WVBA 3EMTA 2FY8A 3H1QA 2FHOB 1T6CA 1Z26A 1ZXOA 3UN2A 4IRKA 1J5EF 2IVPA 1XHXA 2IRYA 3M2VA 4FNHA 5KFWA 1RWXB 4JKBA 1V4TA 4BREA 1IV0A 2IM1A 2LSNA 1FX2A 2JZ5A 3EE3A 4CD1A 4CZFA 5C24B 3I32A 2IMWP 2MSSA 1X4AA 4DV1K 2F9TA 3KJVB 1U1RA 3CCES 2R7TA 5HRNA 2R2TA 3NAIA 2KHOA 2YH0A 5KG5A 4LF6J 1WSRA 4J9QA 3M4XA 4WKYA 1N36J 4IH6A 1HBNB 3MM5A 1CJTA 2UZAA 5A6PA 2UVVA 3KLFA 4FJXA 4DUZJ 2AYEA 4JI2J 1X3MA 3G86A 2HAIA 4PXBA 5AXMA 2IRUA 3ENHA 3JAMU 2LQJA 1GLLO 3CF5Q 5IQQA 3LA0A 1OS5A 1RTJA 3H8YA 2UU9K 1N32K 4LMZA 4BBYA 2XNQA 5E3CA 4KPYA 2Z58B 3TZWA 4NXMF 2GEMA 1TKTB 4J9SA 5IV4A 4WFAL 3A8IA 5E2QA 3GV5B 1VQ5N 3MM8B 4KFBA 4BRDA 3PHEA 4CF0A 1HNIA 1FJ7A 5BYQA 4WP8A 4N76A 1X4EA 3NMUA 1HYVA 2L41A 2HHHK 3GG4A 2HQDA 3CQXA 4ED6A 2UXCJ 1HFEL 3W65A 4PQAA 1UL3A 3PO5A 1VQKN 2BW2A 3WX4A 4Y0FA 4ZPWR 1XMOF 5H9EK 3MCMA 3KHHA 2I8EA 5AQQA 2ZITA 2IHR1 1ZBTA 2ZDOA 3DRRA 2CG4A 3VETA 3I6PA 1RNHA 5I42B 2N3LA 4BRIA 1VQ6S 3AA8A 3C0BA 3OVAA 1VQYA 3IM9A 5F9LA 1RU1A 1HR0F 3TZXA 1FA0A 2BE2B 1XNRJ 5GAEP 4WE1B 2HNZA 2EFNA 4X66J 5H1SQ 4DTUA 1C4CA 3TNVA 4Y65A 1O0PA 5AJ3F 5K9FA 1JJHA 2F40A 2HWIA 4P7VA 1RHKB 4PG5A 1YF5L 3E66A 5FLXU 3DJCA 1U0HB 4RW9A 4JD2A 2O8CA 1JX4A 3A3PB 2Y3YA 2AP6A 1Q82T 3GIRA 4RZRA 3QGGA 3F73A 3LDOA 1WNSA 1FNOA 4C23A 5D6GA 3K57A 3L09A 4H4KC 3D6HB 4LFBK 3SV4A 4DV4J 2KFNA 4DX7A 2AV5A 1NK6A 5JVGL 1XR6A 3FCHA 3AA5X 4WP3A 3C7NA 2YWEA 4KV8B 2BE9B 4WFBQ 1PO6A 1CPZA 3NWRA 4O3QA 1N5YB 4JKEA 1SQFA 2CRLA 1FTRA 3DRYA 1JLGA 5KG6A 1PJ5A 2W9CA 1FKOB 1RA6A 2M88A 1BQNB 3W5YA 4ZVFA 1GQEA 3I8BA 4RG8A 2GAGC 3GIJA 5KPTA 1NKCA 5CYQA 4J2DA 3D1HA 4PKGA 4GC7A 1FE0A 1RDWX 4TU9A 5EU7A 2GQ2A 2UVRA 4DUYK 3NNCA 1C0GA 4CF1A 3B6BA 5KFAA 4DSFA 2F8EX 3CT9A 4KKOB 2IAJA 3GP9A 1K1QA 4FJHA 1PCAA 4B9QA 4KAZA 5T7LB 2VQEK 1RBUA 4DV0F 1YLXA 4LF8J 2V50A 2OPRB 3A12A 5D0RA 4AL6A 3TX0A 3NGDA 1NLVA 2G1HA 5KFPA 3B82A 2IBKA 3MURP 1U6FA 5EY4A 4FO0A 1Q5YA 4CZCA 3EDRB 4OPJA 3VGSA 4NMLA 2Y8YA 2ZHAA 3SAFA 3DLGB 3AOAA 4ECXA 4M5IA 4DFJA 4JKGB 2ZM6J 3FBBA 3WIUA 1M1GA 2UYTA 4PZVA 1NBWA 1NB2A 3I0RA 2NCKL 5AE3A 4USTA 3TR8A 2W2OP 3SNNA 5L1LA 5KG0A 1AT1B 1YJNS 1ZTWA 2Z2YB 3EO3A 2G8VA 3WX8A 2HNYB 1VC6A 2BQ3A 2UUCJ 3CI5A 2ERRA 1KEKA 4F36A 4LBHA 5AQPA 2LYVA 3R6LB 3KK1A 1NG9A 2D3O1 1N5SA 1YBUA 3V9SA 4OX6A 2FJEB 2WK4A 3MEKA 2FVQA 4OYWA 1VQSA 2MY8A 2CA9A 3V6KA 2ZZNA 3IKMA 2OPQB 2F9JA 1HNZF 3ZSQA 3R1HA 3TUZC 2R7YA 2WVCA 3M9NB 1HKBA 4A2AA 3ILIA 2FLLA 3TUPA 1Y4ZB 1WSVA 2XEXA 3BEGB 4U7CA 4HT5A 3QLHB 1SKSA 1T9XA 3DC2A 3V5RA 2G2ZA 4Y2KA 5KFQA 4X62F 3Q2SC 1A5XA 3UD5A 1IQZA 1Q16B 2O8DA 2O1PA 1X5PA 2ADCA 4IFVA 1WHWA 5E3QA 3WHIA 2PMHA 4ZLJA 2WW4A 5HL7L 4KREA 4BRQA 4RW7B 3EDQB 2G8KA 2KT3A 5A2QY 4QS8A 2WBNA 2QSWA 4J9VA 1RWKB 2FDNA 2O01C 3MPVA 2XZTB 4C7QA 1F5CA 4WQ5C 4V19J 2OTJN 4J9PA 1HLWA 2ZC3A 2CQIA 2IJRA 4Q8EA 4BE1A 1GH8A 2CGKA 1RHQB 4M8LA 2AX1A 2P9EA 4EEYA 5IXUA 2JEIA 4LR7A 2BRLA 2KFYA 1F3VA 3PDNA 4BRCA 4YNQA 3A8EA 3DLRA 3CJBA 3OA9A 2C2KB 2HK3A 5C42A 3VA0A 3CETA 3QEWA 1TTHB 4EZ6A 3VESA 4URQU 3KNAA 5EHHA 5DDPC 2HLTA 1CVJA 1N52B 4UQGA 2MMYA 1Q1KA 4H5TA 4J9MA 1R89A 3EX7B 1VJWA 4DDFA 1YQHA 5DQHA 4BRGA 1SQEA 2NREA 4ZPDA 3N01A 5KFFA 1LCUA 2F9DA 3B4DA 2BOAA 2CJ9A 3BBCA 4KB1A 1ASUA 2V4RA 3V6DA 4IUFA 3G6ES 4N8OA 5GAHU 4GKJK 1IBLJ 1FDNA 2AEFA 3NS5A 4MK7A 1LXJA 2R3VA 2W2NP 3CJ5A 4DFPA 4CERA 3AVGA 1HLUA 2BV3A 2MY7A 4IOBA 1FDAA 4NRUA 3W2WA 1UMJA 4QYZK 4CZJA 5A8WA 3J7YU 3M1VA 2YKAA 2MYFA 2DHSA 5F1XA 2GHPA 3UE2A 5KFOA 4H4MB 5J2QA 2QFIA 4OX7A 2ZDPA 2DGTA 4JHDB 4NXNJ 4OV1A 4MT1A 4RNNA 2P9LA 1D9FA 3VEYA 3BR9A 3KWMA 1SC1B 3MN5A 1TP7A 1Y10A 2GWJA 2W2PP 2N3OA 1RYSA 2M0GB 2YPZA 3KHRA 2MZTA 2MQ8A 2HBYB 3SSSA 1F1BB 1NLKL 1O13A 1WC6A 3R5GA 4WFYA 3L7PA 1WKJA 3DYAA 3M6VA 3TZYA 1D4XA 1V3ZA 1K44A 4K42A 2CIMA 2IYIA 1K8KB 4ZLPA 2F96A 3DLLQ 3D6MB 3R7SB 4FYXB 4TU8A 5KRSA 4ER8A 2E7VA 3O4WA 3IO1A 5HVHA 3UDEA 3OFFA 1TK8A 3GOIA 3ZTRA 2EBGA 2AIRB 3LF0A 4QCLA 2QA4S 2MZRA 1VDHA 2VKRA 4ECUA 1IWGA 3DLJA 4OYXA 4B1YB 1VISA 4RKUC 5A0YB 2I38A 5B08A 3SSQA 4DR6J 3GB0A 2YKPA 4G6VB 2YNFA 2IJNA 4B9NA 4GNIA 2YKQA 5GAHI 1R0CB 2NRVA 1BOTO 3BKTA 1QVGM 2RT3A 2GGPB 3MR6A 3RBXA 3FZFA 3EVOA 1U24A 2OPPB 4KGVB 1MWQA 2B5JB 4NLBA 3DXSX 3DOKB 5TKYA 4DZDA 4IH5A 3M7VA 5KFJA 4DMZA 2GWKA 4CK1A 3C66A 4OFZA 5CZVA 3TAQA 3C3LA 1URRA 2Q97A 3THVA 3CD6S 3ZSYA 1IKXB 3HCXA 4DR1J 3V9XA 3HT3A 4K4SA 4G65A 1UVKA 1BU6O 5MLCV 2W8LA 2CPDA 3Q8VA 4ECVA 2QTDA 1IKVA 3FSIA 3ZXWA 3DDIA 2AGPA 1R0AB 2BGGA 4CZKA 4YDXA 4NCAA 2WVDA 3VWSA 1VRQC 3T69A 3CJ2A 1FJGF 3AH6A 3IM8A 2PDAA 4ZCKA 4PG7A 2WSEC 1MN7A 2DGSA 3FRZA 3IP0A 3CCMS 4IBNA 3G71S 1KSPA 1S3XA 5AQFA 2GHWA 2ASPA 3H3OB 4KT0C 4KHMA 4DHYA 4O4GA 3H46O 1PBUA 4PWDA 3VQDA 3VQPA 4WJBA 2Y1LB 3K7RA 4USVA 2ETJA 1TAQA 2JWKA 2OSRA 4LF4J 1RWMB 3WC2A 4NLGA 2G8HA 5AZIA 3LQVA 3PLAA 5U47A 2ZNZA 3OUYA 1X5TA 5BYSA 5AQZA 4FK4A 4W92B 3UNGC 3BUZB 3HVRA 2OGUA 3FFIB 5B7WA 4HVJA 2UUWA 3RGIA 2EKNA 4TLRA 3G82B 4YUDA 5KFLA 1A9NB 2HWHA 3GBTA 2U2FA 2HHUA 4UOCA 3OTCA 4GVBA 3BDPA 2YHYA 1JLFB 1BD6A 4MFBB 3MXHP 2P1JA 3O5BA 1VK3A 4CGFA 2ZNYA 4ZP6A 3ZSRA 1XMBA 3BGUA 4I2PB 2NXNA 3WUHA 5JVHL 2IIRA 4IDKA 1S9GB 4AHVA 5AQUA 4DU4A 4O3OA 2B4PA 4ID8A 5TKWA 2GW8A 1V3SA 2G8UA 2EFVA 2B4UA 3LUYA 3I4PA 2DRAA 4CJUA 4EU0A 1UTAA 3BO2A 2DH8A 1YVNA 2RDJA 1TKXB 2JEFA 3O9UA 2DFEA 1JIHA 1VQ5S 3ISNC 2HBRB 5H9FJ 4R25A 3VF2A 1VQ7N 1FF2A 5CZXA 4K8ZA 1ZTTA 2HVHA 1S77D 2CYYA 4OI2A 4LFCK 1IR1A 3VGVA 4J9KA 4LF1A 4EI2A 3WC0A 3ZO7A 2CPXA 4JP8A 5BYRA 4OYPA 5IZHA 3HFKA 3MPWA 4BRFA 3AO2A 4XPEA 4K41A 4F4KA 4Z4IA 1VQKS 2J0WA 3GLJA 4EGLA 2EW9A 3OTEA 2NXJA 4OHYA 1X9SA 1GOAA 3W3SA 2YWGA 4XO0A 2CJQA 2XNRA 2LCWA 2ZJRL 4HHUA 2FJXA 2IVMA 2E20A 3BSOA 4RW4B 1YT3A 4B9MA 5E3AA 3U7JA 4JB8B 3ZTQA 3ZZPA 3MM5B 1CJTB 1TELA 4ZA1A 2HQ3A 4P6QA 3KLFB 4FYWB 1FDDA 2AT1B 3E9LA 3TEHB 2HHPA 1LOTB 2HNDA 1VOMA 1NHVA 1ZA1B 1FXXA 4X4NA 1RTJB 4IO8A 3THYB 3VTIA 1WHYA 2Z57B 1ZZFA 3QQCD 2J8SA 4QU6A 4GY2B 4PUOA 3FC9A 3NMAA 4CZEA 2O67A 4DX8H 4M7XA 2GIRA 1B70B 3D28A 3H5YA 3VQ4A 2C3UA 5ADZA 1UVLA 3RSEB 3VF4A 4RO0A 4ANEA 4KI4A 4LFAJ 2VBYA 3MD1A 2HVZA 1T0TV 3ZYYX 3VQ9A 1TFYA 2CPEA 4BGAA 1DQAA 5DO2A 5L1KA 2XHBA 1OPZA 3ETOA 2D3UA 3BYRA 4R79A 2XS7A 2CQHA 2CVIA 5DM7Q 1BQMA 2ITGA 3TUJC 3O08A 3DRRB 2R2SA 1O6XA 3GJTB 2BYCA 3C16A 4HHJA 4DN9A 4F3QA 1CJVA 2DH7A 5T14A 2V8PA 2YKMA 3O9RA 2HQIA 4OGCA 2HNZB 1UETA 4CFCA 2R7OA 3F5TA 2VG6A 1Y0HA 2A5XA 2Y8WA 4PXEA 1CBKA 4B3RF 1RWWB 2EFGA 2HB5A 3QDKA 4OI0A 1NGJA 5BPNA 4RW9B 4JD2B 2O8CB 2AZ3A 3THWA 1IVZA 4I6MA 1V4SA 3IR7B 2AA4A 3IRXA 4KBOA 1U1PA 2KN4A 3AVNA 4CJPA 3PJWA 1JLCA 4FM0A 4TXSA 3LTOA 1OY9A 4DV2J 3TSQA 3VOVA 3O5TB 1UW9A 3R5DA 4PKHA 4NXMJ 2F9WA 2RN2A 4ZN1A 3KMQA 4NLRA 3C7NB 4NPOA 2W7AA 1I94F 2WCXA 3LDQA 1E6VA 4TY8B 3M2RA 4DS5A 1HPZA 3K89A 1L3UA 1FK9B 3IBFB 5LJ3Y 5KFVA 1DEJA 3CJAA 3R3TA 4Z37A 3FZHA 2LXIA 2W4CA 1HBUB 4K59A 3HLUA 2XYHB 4ECRA 3Q23A 2LQ5A 3ZZ0A 4JK7A 3UIQA 4JBCA 4FJ7A 5BR8K 5CYQB 3SPYA 1WG5A 4DV6K 4Z4EA 3A3NB 3ZT0A 5HSPA 3JS9A 1X4CA 2DGOA 1S6UA 1LWEA 1U1KA 3OR1B 1HYSA 3OYGA 3HP6A 2RQ4A 3THTA 2DK2A 2GV9A 3GZ7A 1KQFB 1U1QA 4FYYB 4K5RA 2IYGA 3JTPA 5HATA 4DR7K 4QYRA 4YR2A 5BJRA 3NS6A 3GPAA 1RABB 1X3NA 4RUBA 5AJ3J 4ICLA 2HMIA 3P4UB 5J2PA 4KQZA 3H42A 3BSCA 1KQSM 2VL1A 2WONA 3HZEA 4Y0WA 1C0TB 1RCHA 1EQYA 1Q8IA 4ECYA 2PT0A 2C1EB 2L3MA 3ZNJ1 3Q8PB 3V9UA 2LEAA 3M8PA 3I0RB 1FWPA 1N6QA 2FJVA 2UU9F 1U1MA 1N32F 1DTTB 4ELVA 1PAEX 3TI0A 3EE8A 3T1HF 5F8GA 3NF8A 5RUBA 5FIIA 3HHLD 4HTUA 5ETLA 5CR4A 3HULA 3TVZA 2OTJS 2OANA 1N4LA 3O4NA 1T94A 4FBUA 4J9RA 1NM1A 4WFAQ 3PEHA 1RU2A 2QIFA 5KG2A 2BJ8A 4BACA 2YNHB 2MJUA 1BA1A 4AT1B 2EFQA 4EP5A 4ISFA 1B0PA 3F9KA 3OJUA 2V4QA 3KJFB 4I9LA 1YIJN 3TQ1A 1HD0A 3LDSA 1FE4A 2CH6A 4L75A 2VC0A 2F4VF 2CFXA 1U8WA 3RB0A 5HBMA 4DR4J 1NGFA 2MKJA 5E7OB 2C28A 3EXYA 1YRXA 2DFFA 4CIEA 4NLSA 2YBVA 2VGMA 4UUWA 4Y1CA 1S57A 3IAM9 3Q8YA 2ILYA 4U7UD 5G4DA 1HI1A 3HO1A 2NS1B 1VAZA 3GR1A 2G8FA 4QOZB 1LWCA 4RCHA 5L38A 2M8DB 4LH5A 2D3OR 5KT4A 4R0JA 5KFRA 4KHPK 2DR7A 3W60A 3RWUA 2WTFA 3BYPA 1X0PA 5KTQA 3NGRA 2UV8A 1L3TA 2O8BA 4LFBF 3AY9A 1QVFM 5BRDA 2DR8A 1FKAF 1VMBA 2RUSA 2CQCA 5DRKA 3A5OC 1K9MO 3L3UA 4JI8F 1C1AA 3L3CA 3GMGA 3P5JA 1O8BA 2XSJB 3ZFVA 1WBBA 4ZVSB 2DR5A 4NLCA 4IG0A 1BQXA 3WDOA 3ZSZA 1G6BA 3TPQA 5GMDA 4QW8A 1GOBA 5JVGQ 2RAQA 3OPKA 1T44A 5F2RA 1CQNA 2QA4G 1GX6A 4JAXA 4MDAA 1QQOA 5C42B 2KYZA 1U0SA 4B3TK 1UZDA 4QIVA 1PC4A 3DGVA 4Y6IA 2VWBA 1NH7A 2E88A 1QAJA 4KYZA 3D66A 3UCUP 4DL6A 2EX3A 1QDUB 2P9SA 1FNMA 1CC7A 1QTNB 4HCCA 4FZVA 3IFRA 2BX6A 4DPOA 3V6DB 1GTHA 2E1AA 3D3BJ 5MAOA 2HFZA 2W9BB 4FJJA 3CCZA 3CD5A 4FF4A 2OUGA 4USMA 1D5AA 2ZGYA 4X4RA 1YI2N 4JV2A 1RACB 1Z6RA 3W2WB 2GAHC 3MOZA 1S10A 5A8WB 1X9JA 2E8AA 4L72B 1F6TA 3M1VB 1YDLA 2CVEA 1XUPO 1RWVB 4KH1B 2ASMA 5A8RA 1V5IB 1VQ4N 1ZETA 3DXBA 1Y5NB 1BWEA 1VBYA 1WSGA 2FBVA 1R8BA 1HL6A 4BWJA 2OPSA 1HWKA 3F0NA 3LW5C 3GV7B 4HHTA 4E7LA 2H4YB 2KVIA 4DOZA 5ETKA 1REVA 3CB4A 3OVBA 1HQEB 1S72N 4K4TA 4TKTA 4U7BA 4YDDB 4UOFA 4GKKF 5D8HB 5KPRA 3DYAB 4BG9A 2BACA 3MM7A 2PA3A 1H6KX 1DKGD 4K43A 1VQNN 2F3JA 1XNQJ 3VAMA 1SV5A 4MYTA 2VA3A 4AFFA 5EVZA 3X1LB 2KLAA 4FJMA 1C2PA 3U02A 1GT8A 1R43A 4B9TA 3ZLJA 2WBRA 2JH3A 2WVEA 1RHUB 5HJXA 2YNGB 2E5LF 4DV3K 3VGUA 1HBMB 1HW8A 4I56A 1YX2A 1FKPA 1ULRA 1EKRA 2AU0A 2L48A 3VQ6A 4KB0A 4CJQA 1T95A 2DNLA 8RUCA 1KVKA 2HMPA 5AQWA 1UOCA 3N5BA 3SQGA 3UO0A 4DR3K 2YNFB 3I56S 2K3KA 4M3YA 1S5JA 1SB6A 4OKKA 5ETPA 3UVJB 4RNOA 1SKRA 3HSTB 3CCVN 4I1TA 4TVAB 4ELTA 5LSLA 2I6WA 3M2UB 1S1VA 3AJDA 4JI4K 3JTNA 1NGCA 3IGNA 2X1GA 3NVMA 3MEEA 2QGFB 2QL9B 4OZJA 3WNHA 2W40A 2OJ3A 1Q4RA 4X64F 2EK6A 1IBCB 2OAUA 3QT5A 1GLBG 3DOLB 1GLEG 5LMNK 2MTLA 3TVYA 4BHQA 4E7JA 4NYOA 3CDUA 3MX5A 1FRKA 2JLGA 5ETRA 4JI7K 3O9QA 2F8TA 3VR1A 1RGVA 4O5BA 1IKVB 3AY0A 1BDGA 5BPMA 4FVCA 1W7WA 5JUMA 5LMUJ 1Y00A 3CNQP 4E1NA 1AYEA 2E7XA 5K8PA 3PACA 5DG9A 5IWAJ 2DISA 3EPIA 1KTQA 1FT8A 3MM6A 1T9TA 1GAOA 4OZ5A 1GLCG 1WNEA 1HKGA 3MMBA 3UR3C 2ZQBA 1TL1B 3CJ8A 3OS0A 3L7OA 5LOQA 4OYBA 2D74B 3KLGB 1TKDA 4M3TA 5LL6d 2BDPA 2V0NA 1SQGA 3SI8A 3G87A 3MX2A 7AT1B 4HUGA 4O4GB 1RAGB 1OQ6A 4CO2A 5BXIA 1S22A 1CG2A 4OQJA 4PWDB 3K58A 3OSPA 1RHRB 2Q6CA 2G8IA 1NDKA 3ZTSA 4O23A 3NRBA 2HVIA 2VPWB 1ZA2B 3PYFA 2V5HG 4DL0C 2PA8D 5L46A 3OUYB 1U2RA 2RU3A 3BPSP 5HMXA 5KAKA 2K2PA 2EG1A 3TJ9A 2C2DA 2FHJA 4C11A 4LQ9A 5D3GA 3GILA 1U8SA 4L73A 3M6GA 2R8JA 1XQIA 3AXMA 1VRUA 4QZVB 1T9YA 4JI5K 1NJWA 2QWRA 1NCLA 1RWUA 2E5GA 5DDQC 2H5JB 2P9UB 1MNEA 1UAXA 1CXQA 3CJ7A 4F8RA 3HOTA 1RAJA 4RJVA 3NGYA 3R6MA 1WF1A 1E6YA 4ZIWA 1RHMB 4LFAK 2RHKA 4OI4A 1U45A 1RFQA 2D1KA 1Q9YA 2CQPA 4BWMA 4IDKB 4U96A 4FM1A 2P2CB 1NK5A 5GAGU 1IM4A 3HXMA 5IC4B 3VGKA 5AXLA 2QJ3A 4DLEA 1D0EA 2GC8A 2ASDA 3T5JA 5HRRA 3CCWA 2V63A 1J5EK 1SC3B 3AVIA 5D15A 4JI3K 5E5NA 2JDJA 2J0QD 2HF3A 1L3VA 4OV6A 2E2QA 1HUXA 5E33A 4F04B 4J9OA 1ZBUA 1KAZA 2HHSA 1NKEA 3KIOA 4A8XA 1VI7A 1WHXA 3W8PA 1Q78A 5K14A 3MPDA 3DM2A 4H5VA 4MAKA 3M9MB 1GLDG 1NGEA 2VOPA 2J6TA 2VFTA 1RLCL 3KD1E 3US5A 1CZAN 3U1MA 3UFCX 1OO0B 3H2VE 2H9ZA 4R8UA 1AFJA 2DGWA 5AT1B 3CCJS 4B02A 4H0OA 2WZ1A 4LH4A 1IXKA 2W01A 1SKUB 4NLXA 3BY5A 4C9DA 2D5RA 4YS2A 3JS6A 4BLGA 3PRBA 3MXIA 2BABA 4M5DA 3E8OA 4GVMA 1FRIA 4AXIA 2CPZA 3BZCA 4HUFA 3TUIC 3W62A 1N5VA 2BEFA 5KG4A 3ICLA 1M90O 4M5GA 5GAEI 3OYNA 3DRXA 3AXKA 1T02A 2HNDB 3BSNA 3E9OA 1VBKA 4EBDA 2CQGA 4GC6A 4PKDB 3AARA 4QIGA 4OX9F 5ITHA 1H72C 4KSEB 2MLXA 2RKIB 1SPBP 1NM2A 1XMOK 4ECSA 3OYLA 2MB0B 2GELA 2MKHA 5IT9O 2DB1A 4PUOB 4ID5A 2I7PA 1ZBIA 3DCAA 3KJNB 4DBQA 4OYOA 3H5UA 4P7TA 5CYJA 1QE1B 4BC9A 1RJJA 2Z8QA 1KFSA 4FLXA 1Q7LB 3TARA 1HR0K 4TN2A 1X4HA 4BC5A 1SKWA 1XJWB 4A57A 3P38A 3CD7A 3CFRA 1CJKA 5AJ3K 1FWLA 1VIXA 2J8AA 1BQMB 3AVMA 4CJTA 1U2VA 3ATUA 2D1CA 3MECA 3JSMA 1ZAVA 2JJ4D 4BRLA 3LPUA 3FVYA 1NU0A 4ZIVA 3PV8A 4QQBA 1Y7PA 3W2VA 2VFVA 1WC4A 4E7KA 3EZUA 2YKMB 4QR2A 2GX8A 1RBSA 3AD7C 3KLEA 1NZAA 4XEIA 3C6UA 2VQFF 1ZPWX 3POTB 4CJ7A 3HYFA 3V1RA 2HRUA 3A8YA 2IVOA 2VKZG 3NP5A 1UVNA 1RT6A 3TTFA 1MN9A 1JLCB 3IBWA 2Y1IA 3J7AP 3NXZA 3AVCA 5HO4A 5AQJA 3A1YG 2G2YA 4HTLA 5G0RA 3MN6A 2X6NA 4Q7AA 4Z4CA 4FPRA 3UQSA 5JVHQ 1TMMA 4NLOA 3H59A 3RMBA 2R7SA 3QEXA 3DI6B 1E6VB 1RP5A 3G8TA 3M2RB 1Q9XA 4BR4A 3K8VA 4URGA 4W5OA 1VSDA 4DV0K 3EWGA 4FPIA 2EFPA 2LECA 4HACA 2KW4A 1X5SA 3BZQA 4E1JA 3BREA 3IWXA 4I68A 4CEBA 2CQDA 4XDCA 5CZ1A 1KHVA 3SUNA 3A2FA 3CQ8A 5JXSA 3KG1A 1WSJA 2Z1GA 3ZEUA 3DOMB 2I1RA 4XTTA 1ZYQA 3QINA 3WQUA 2UUBF 4B1WB 3HP9A 4OX8A 3OTOF 1WC5A 4RX6A 1BC6A 2LQBA 2O8FB 2B9XA 4FVUA 2Z0GA 2BKOA 4OJ3A 2N7YA 3WEEB 4ICLB 3U27A 2HMIB 2AJ2A 5E41A 4OZ3A 3HM8A 4B3RJ 3GIKA 3D9BA 1D9DA 4MDBA 3E51A 5M1QA 5J2PB 5KT7A 2H54B 1NNEA 4PHTX 1RAOA 2WONB 4DTRA 2VDIA 1B0TA 3C15A 1TUGB 4NLPA 3NH1A 3UDCA 3M8PB 3H5SA 3TR5A 2R2UA 1N6QB 1LWFA 1HMVB 2G9OA 1FTCA 4LD0A 4Z4HA 2QK9A 2X7IA 4IQXA 2YJFA 3DLEA 1C6VA 1RTHA 2MKSA 2YQ3A 1NB7A 4CLLA 2O4GA 4ZHRB 4FK2A 3OY9A 2C3PA 1J2VA 2J9EA 1HNZK 4P74A 3HI0A 3ZNUA 3IAYA 4NA2A 2ZVSA 4DF8A 1JB0C 1WAJA 2U1AA 2C2ZB 4HR2A 4IYQA 4OJRA 2AYBA 4LRFA 2WBMA 1D09B 1CULA 1K0VA 1QSYA 3B8AX 5B0AA 1UA0A 1AROP 2AQ4A 1N34F 4W5RA 4Z4FA 2V6AA 3M30A 2HFUA 2MGZA 5I3UA 3T3FA 4X62K 3OYKA 4A47A 2RNEA 1K6YA 4EAHD 2A0FB 2DO0A 2CADA 4MMOA 5HBMB 1S1TB 4E2FB 4EHTA 2CG8A 1C0FA 4E19A 3CC4N 1FVQA 3AJ2A 4KTWA 3VQ7A 4ZVPB 4DV1J 2A40A 4BDZA 4Q0BA 3GWCA 4CM0A 4JI0F 1R31A 5FDLA 2D0PA 4CIOA 2BM0A 1GNKA 2AX0A 3C6TB 2W8KA 4BRKA 4H5WA 4TNOA 6FDRA 2DITA 4J90A 2DBBA 4ATNA 3VEOA 1YI2S 1T8EA 4ANCA 3PG9A 3VEVA 3P5BP 3K9JA 5D4NA 3UR0A 1FRHA 2M52A 3GFXA 2UU9J 1N32J 4CBUA 1VQ4S 3CCSN 5CAAA 1EETA 3IWNC 4BC3A 2E5HA 2FJAB 2A6AA 4BC4A 2QLBB 1M1KO 4FLWA 1XIQA 1DZ5A 2IRXA 1ICEB 4WU3A 4G1IA 5D78A 5AZJA 2L9DA 2J9DA 3THXA 4NOHA 4M42A 1RT3A 3AODA 3RG6A 2QW9A 2HS3A 4WP9A 2ZD1B 5B0BA 2E29A 1JWWA 4YQWA 1GLJO 1S72S 3OS2A 3C6HA 4ZKAA 4B17A 3CJ4A 2VHGA 3KTQA 5LJVA 2HHHJ 1BIZA 1NGBA 1VQNS 2DNMA 2NRZA 4PABA 3MTJA 1F5AA 1WUAA 2AJ4A 1QTMA 4Z94A 2HPUA 1FFSB 5H9EJ 1UEVA 3EGVA 5BRFA 3CXCM 2F4VJ 4M5MA 2F5GA 1JLAA 3P49B 1YBTA 4NZ0A 1K9MT 3UKUB 3OW2M 3KG0A 5EWEA 4DCJB 2P9SB 3GIMA 2E1RA 5HAOA 4C4WA 1U1LA 2A2DA 3M32A 2NZCA 2A6OA 1TL5A 1R8HA 1DFDA 3VALA 4CJWA 3J80U 1W0HA 2M8HA 3J7Z5 4G1QB 3RU0A 4NYNA 4L3NA 5L9NA 3CCVS 2ZBCA 1NRKA 3K5MA 5LY3A 2BANB 1TUUA 5A8RB 3R5CA 2POKA 1Q79A 2B0GA 2CQ4A 1AZSA 3LM2A 2XI3A 4LFBJ 2MHNA 2OPSB 1JXVA 1WC3A 4USWA 4IXCA 3IR6B 1EKEA 5C0YA 1ZM9A 4C0BA 4H5NA 3TABA 2BXJA 3O1BA 4KGZB 2XZWA 3CJ0A 2QM1A 1H7XA 2HWTA 1RAAB 4H4KA 3CJRA 2YKNB 3F56A 1HJOA 4IEEA 2Q43A 2ZE2A 3SFUA 5KI6A 5K8NA 3HZ6A 3G6VA 4FXDA 3NS7B 3SXLA 2VIHA 3AOBA 4ZTJA 4A8OA 1J6ZA 3MTKA 1WBDA 3BGRB 1NJXA 4FKXA 2YQ1A 4CT9A 2V9KA 2D0OA 4I7FA 5E3PA 5EXWA 3CDEA 3KYLA 2G0JA 4BRHA 4C2MA 4C8KA 2LFVA 1S12A 5HRSA 2ZH3A 4GW6A 4YY3K 4CZMA 1FXLA 1LW2A 2XWXA 1HNVA 2FGOA 4JKAA 3RMDA 1YJNN 4LVOP 4Q43A 2VQEJ 1Y5LB 3D6TB 4GVLA 3SEOA 5HQMA 2Q2RA 5GIOA 3MR2A 3SQGB 5FPMA 1J5OA 1RBLA 4YOWA 4ZVUB 3OLAA 2HVEA 3TAPA 5ETMA 1RTIA 5HI7A 2DJWA 2QWPA 1SUQA 1S1VB 4ZPTR 1WC1A 2MQLA 3CHWA 5FPDA 1U2FA 2ZZTA 4RBTA 3AHPA 3U1LA 2OFGX 5L39A 3QFWA 4BDPA 4JKCA 3ZSVA 4ANDA 1ITPA 1XBWA 3RMCA 2PSZA 4M3ZA 2W6KA 4LRDA 3S6EA 2J7WA 3RBEA 4MK8A 4A8KA 4CBXA 4QPXA 4KH6A 3CJTA 1IKYA 1FJGK 4OLBA 1CSJA 1R8CA 3AAWB 5J1EB 1KHWA 3W66A 2IS3A 5KOXA 5AQLA 3J7ZO 3PJXA 3W61A 2ACYA 1YZ7A 3W9HA 4ZCIA 3HF5A 1IBMF 3FGVA 1QJHA 4I9QA 4ZVOB 1F9HA 2XMJA 1N0UA 1WEZA 2RB7A 3T1YF 2DR6A 5JICA 1EWRA 4AHUA 4DHVA 1ZBLA 3IWLA 1LW0B 2QKKA 3PR4A 3VZHA 3NVKA 2KTQA 3J81O 1RT5A 3QWPA 2DCLA 4ZVTB 3UWTA 3NNAA 4JI1F 4CVNE 3ZETA 1NK9A 4KY3A 3ZT4A 5F3ZA 2DFHA 1JL2A 3PFOA 2DNHA 1HNWF 5A8KA 2BOPA 5DDRC 3ZX0A 3R8EA 1DLOB 2V8VA 2HKEA 5LM7E 4A2BA 3GYGA 3QT6A 1DY3A 1JLQA 4CDIA 5J1NA 1RXOB 2KB2A 3TEGA 3V6JA 5SZTA 1T6DA 2E4LA 2E1YA 1HWLA 1S9EB 4P72A 4CO1A 3R97A 4I2QA 3NF6A 2I5JA 1RYRA