3I0RA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 3
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 146
structure length 545
sequence length 545
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0rA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0rA05
2ZE2B 2W42A 2QKBA 4PQUA 3FSIA 4OGEA 3V1OA 3SUQA 4FXDA 4M42A 1JLBB 4E89A 4CEOA 3V6JA 1LAWA 4URSA 4IBNA 4B9NA 5KFDA 2IGIA 4JS5A 5SWMA 4WFZA 4CEZA 3CJ3A 3VQQA 1JKHA 1RTDB 1NKCA 4W5TA 3I0SA 2IM1A 1KVCA 5KG2A 4IG0B 3KLVA 1S6PB 2FVCA 2G8IA 3LAMA 1N4LA 3KK3B 3UR0A 4AHSA 4CGHA 4LSLA 4IFYB 3OVNA 4OLAA 1C0UB 1IKYA 4C8KA 3VQEA 3ALYA 3O3HA 2F8SA 1JLEA 1KVAA 4ELTA 1S1UA 3AO5A 2HHTA 3T5JA 1RT3B 2YNIB 3CDWA 3NGDA 1VRUA 2V9WA 4NLTA 3ICLA 1C1CA 1DLOA 2IM2A 5L1IA 2UUTA 4YR3A 3TAEA 3DYAA 1WAJA 3M9MB 1T7PA 4YNQA 1ZBLA 4CHZA 2XO7A 4FYDA 2E6MA 3DLRA 1NNDA 2YKMB 2FLNA 2AGQA 1U09A 4NLVA 2Z1JA 3AA5X 3WNGA 4E7IA 4CEFA 4KTZA 5KFOA 2DPIA 1MU2B 1SKRA 1KFDA 4DTOA 5CY4A 4DL4A 5I3UA 1U04A 4RNOA 3ITHA 4J2BA 1RT4B 1WSFA 3MF5A 3SYZA 4ZVEA 2HHXA 4F3OA 1TK0A 3MXMA 4M3XA 1WSIA 2HB5A 4CIGA 2WHOA 2HHVA 2GIRA 4CGGA 4ECSA 1JXEA 2QKKA 4DU1A 4ZVFA 4DFMA 2W7OA 1VSKA 3RMDA 4HKQA 3CDEA 5T7BA 1VSFA 3V9WA 4I2QB 2VG5A 2XCAA 4J9QA 2CKWA 3ZSQA 3KMQA 1LW0A 2E9RX 2R8IA 4ZMMA 1F21A 2YNFB 1D5AA 4KBIA 3OSPA 3KLIA 3DLKB 3OY9A 4J9NA 2PYJA 1T03A 4EZ6A 4DU4A 4TSXA 3HP9A 4CIFA 4DL5A 2RF2B 3PX0A 4WZQA 2AGPA 1S0MA 1Q9YA 1Y97A 3M8RA 1S10A 4O3OA 1NK9A 4JV2A 2B6AB 3VA0A 5KT4A 1KSPA 1IKXA 1GOAA 4DTNA 3CO9A 3PX6A 1KLMB 4R5PA 4TLRA 4B9SA 4EZ9A 3MECA 3ZSOA 1VSIA 3V6DB 4K8XA 3ZCMA 4ECZA 4CJVA 4Y2CA 3VQ4A 4CHPA 4FJMA 1NK7A 1R0AA 2BQRA 4CEEA 3TAMA 2FBXA 1XHXA 3QINA 4ICLB 3HKWA 1JXLA 1BQNA 1YT3A 3VQ8A 1TL1A 1HQUA 5DGBA 2ZKUA 3A2FA 3LP2A 1KHVA 3FRZA 5FROA 2YHBA 3DRSB 4E1MA 4IKAA 1RT1A 2BR0A 3HVRA 3RRHA 1RTJA 4E19A 1U48A 5C25A 3QEXA 3QIPA 4CGJA 3T1AA 4DTXA 3RMCA 3CWJA 3SFUA 3ZT0A 3EZUA 2OPSA 4XO0A 3SUNA 1HNVB 2BGGA 4NLGA 1RT2A 5DMRA 3PUFA 3NGIA 4FLWA 5KT3A 4EBDA 3CYMA 1NK6A 4Z4EA 1EXQA 4ECWA 1CXUA 4WFYA 1C2PA 2ATLA 3LP0B 2R2SA 5DG9A 1RA7A 2J6UA 3KHRA 4CJKA 3E01A 2A1RA 5EWFA 5C42B 3VQ7A 4OKEA 3V4IB 4QWAA 1NJXA 3DRPB 1N6QB 4OJRA 4H4OB 4FCYA 3AVLA 3P83D 2GV9A 4ZPDA 4RNFA 4W5OA 1HMVA 4ED3A 1GX6A 2O5DA 1RYSA 3QLHA 3CJ5A 1FKPA 5I42A 4JRQA 3S9HA 1O1WA 4JLHA 3DOKA 3IRXB 2F8EX 4IR1A 4ZTJA 3ZT1A 4K4XA 2W8LA 1IKWB 3IS9B 3KLGB 3ZSXA 4H4MB 4CEDA 3KTQA 2KFNA 3EPIA 4CE9A 4DQIA 3ISNC 4CFAA 5KGXA 1RCHA 1YTUA 3QEVA 3PHEA 5D3GB 5KG4A 3VQ5A 3PY8A 2B5JA 3IG1B 3M8PB 2QE5A 4ZPBA 2X6NA 1W25A 4KHSA 4IH6A 1VRTB 4KB7A 5KRSA 3OYJA 4AHTA 3NAHA 1BI4B 3K5OA 3HVTB 4NLQA 4QAGA 4EP4A 4B9VA 3KK1A 3ZT2A 3MXJA 3O4QA 3TI0A 1UAXA 3RRGA 3AVAA 1RT6A 3M8QB 5F8IA 4RW8B 4CGFA 3OYBA 5KFGA 3HPOA 3EZ5A 1NOYA 5KFRA 1TKZB 1S1VA 4X2BA 1HPZA 3LPTA 3RAQA 3SUPA 5KFAA 4MFBA 2XGPA 2E9ZA 5J2QB 2BQ3A 3WNHA 4DSKA 2VG6A 4ED0A 3FFIA 3SI6A 4F4YA 1S0NA 3KLEB 1HYSB 1UOCA 2G8HA 1S9GB 1JLFA 4PY5A 5CYQB 2WONB 4CJWA 5EWEA 4J2EA 4C8MA 3NFAA 4EYHB 2OPQB 3KOAA 1C1BA 5KFQA 4IRKA 4XIUA 4W5NA 2KFZA 2W9CB 4FJXA 4QW8A 3OYHA 1DTQB 4NCBA 1S1XB 4TYAA 1N5YB 5KFTA 3QETA 2E4LA 4QPXA 5F8LA 4M3TA 4U7CA 5CYMA 4JS4A 4QWDA 3DM2B 3NAEA 3NBPB 4AHRA 3AVKA 1LW2A 3DLHA 1TL3B 4ECVA 4JUZA 2XRIA 2JC1A 4GMJB 3L3UA 1BISA 5C24B 4LD0A 4B8AB 3MEGA 2IC3B 4NLDA 4IRCA 1RTIA 4ZHRA 1EETA 3LANA 3PW4A 3ISND 1RYRA 5C5JA 4RW6A 4ID5A 2Z1GA 3VQDA 3M9OB 3NF9A 3C6TB 4RG8A 1KRPA 4M3RA 4TY9A 5KFCA 4EYIB 2X78A 2I5JA 3H5YA 1JLCB 4F50A 3OYIA 2W8KA 4DLEA 4DFPA 2C28A 3LP1B 4M3WA 1ZYQA 3SV3A 2C22A 4F4KA 3RMAA 4J2AA 4NCAA 4PWDB 1JLGB 3I5CA 4J9PA 4G1QB 1WSJA 3C6UA 3Q8RB 2XY5A 3RB6A 3MAQA 3I8DA 3OL7A 4Q44A 2UVRA 1EP4B 4FLTA 1TKTA 3RBDA 1IO2A 4ZP9A 3E51A 3SFGA 1RDDA 4F3TA 3KJVB 2UVWA 5KFYA 4DFJA 1NOZA 4N76A 1C0TA 4NYFA 2DTUA 1J5OB 1NK0A 3I0RB 1GOBA 1S9FA 1I39A 3PW0A 1TQLA 3CJ0A 3T5HA 4TY8B 3CM6A 4Y34A 3QERA 2XI3A 3PO4A 1RDAA 3DLEA 1GX5A 1KFSA 2KW4A 4NLWA 1JLAA 3SQ2A 3HL8A 4RW4B 1ASWA 3HXMA 3OYMA 4LSNA 3PVXA 3KHGA 4KKOA 2HWIA 3QIDA 1DTTB 3G6XA 3KHHA 4QOZB 3JYTB 1D0EA 4ZPAA 5J2PB 4FBUA 4KREA 3RR7A 5KT7A 1BL3A 4TYBA 4RU9A 1FK9A 2G8FA 1JX4A 1S6QB 5EU7A 4CIEA 1IKVA 4J9RA 1CZBA 3MEEB 3N6LA 3LP3A 5HP1B 2QV6A 4FJIA 5KFLA 1L5UA 3CJ2A 4E1NA 4FM0A 3QGHA 1FKOA 2LSNA 4J9MA 5J2NB 1ZBHA 3L3VA 1QAJA 1S1WB 3SQ4A 4Z4HA 2D0BA 3K2PA 4B9UA 4KRFA 1ZTWA 3DMJB 4BWMA 1JLBA 2VG7B 5KG5A 4FJLA 4I7FB 3NMAA 1RT5A 5FDLB 3KIOA 4QWEA 4FW2A 3OYKA 3KLHB 4Q43A 3DI6B 4OLBA 4FM2A 3DOLB 2AX0A 1QTMA 3BQ1A 3KLFA 4KE5A 1Q8IA 1CLQA 4E7KA 2UVVA 4N5SA 3OYAA 1WSGA 3SQ1A 2D0CA 3L2VA 4IG0A 4EEYA 4O55A 4NLXA 4FJ8A 1MMLA 1QQCA 4PQUB 3ULDA 4PUOA 3HT3A 3O3GA 5KT6A 3BJYA 4EO8A 4O0IA 3SZ2A 4DMNA 4YMEA 3L2RA 3K5LA 2EX3A 4K4YA 3G86A 4CJSA 1D8YA 2V0NA 1SUQA 1JKHB 5KFHA 3L8BA 3I0SB 4FZYA 2YNIA 3AVJA 4FK2A 3QZ7A 2IAJA 4KV8B 4AHVA 2KQ2A 1WLJA 2V4RA 3P1GA 2IM0A 2VA3A 4BACA 4N56A 3MFHA 4FBTA 2PZSA 2G8WA 1QS4A 1VSDA 4N41A 4LSLB 2X74A 4M94A 1FXXA 4NLSA 2OZSA 2ASLA 1ZBIA 3BSAA 1IKYB 4LY7A 2XC9A 2IA6A 1MU2A 2GC8A 1S1UB 3HK2A 4B08A 3DDKA 3GV8B 1VRUB 4DTJA 1C1CB 1DLOB 4DTMA 3L2QA 3RB0A 3DYAB 3OL9A 3H59A 4OL8A 4CF9A 1BCOA 5L1KA 5JUMA 2XCPA 3SPZA 3ZT4A 1Q9XA 3MFIA 1RBSA 2OH2A 2Q3SA 4FZXC 2R2RA 3Q8PB 4JRPA 3O4NA 5HRSA 1S9EA 1SH2A 2ILYA 4B3OA 1LWEA 5DG8A 1J9AA 4Y1DA 4H54A 4RZRA 3TWHA 3SI8A 2FBYA 3D0PA 3GV7B 1BQMA 1RA6A 1QE1A 1L3SA 3T5LA 2YNFA 3BGRA 2DY4A 3T3FA 2HW3A 1TVRA 3WNFA 4ZP6A 4RW7A 1VSJA 1C6VA 1TV6A 3T19A 4RNNA 4CJFA 4ZPCA 4HTUA 2ZQBA 3DLBA 3IN5A 3H40A 3H5SA 2OPPB 1JL2A 2KZZA 4ECRA 4O3RA 2HHSA 1LW0B 1RDRA 4U6PA 2B6AA 3LWLA 4IRDA 1S0OA 1A5VA 3U3GA 3KLIB 4FJNA 2WOMA 1HQEA 3QEIA 4E7LA 4K8ZA 5KG1A 4CECA 4O4RA 4G3IA 3QO9A 1Z4UA 4K4ZA 2QK9A 3KD5E 2G8KA 4M3ZA 2VWKA 5HRNA 4IFVA 1I6JA 3AVCA 3G0ZA 5KGWA 3JSMA 4FS2A 2C2RA 1U4BA 1U49A 2W9BA 2FVSA 3AVGA 2V4QA 4Z4IA 4R5PB 4ED7A 1S1TA 1RNHA 2IDOA 4KB0A 3MECB 1KLNA 3LDSA 2HWHA 2YNHA 4NYZA 4ECQA 1XR6A 4I2PB 1KCFA 1R0AB 2R8KA 3CFPA 2O4IA 4Z4CA 2FBTA 4TQRA 5J2MB 3TAMB 4Q45A 4CJ4A 4IOBA 1ZETA 2FJVA 4DQPA 3ZSVA 4KI6A 2RDJA 1BQNB 1B92A 1TL1B 1HQUB 3CM5A 3LP2B 3QGIA 1TK8A 4O44A 2WTFA 4MQ3A 2A1SA 2G8VA 2FLPA 2B4JA 2E6LA 1LWFA 1RTJB 3D45A 4KO0A 1QSSA 5KFBA 3SJJA 4CF2A 4UQGA 4CF0A 4C8NA 3DRPA 4RNMA 5HRRA 3AA4A 3TR8A 1RBRA 5J1EA 2OPSB 3WNEA 2HAIA 1BIZA 4CJRA 2BE2A 1BGXT 3FQLA 1RT2B 3HPGA 1HRHA 4CJUA 2UUWA 3PR4A 4RW9A 5T14A 4CHQA 4C8OA 5CZ2A 4M41A 5KFEA 2AQ4A 1JLQA 3OYFA 2RDIA 3GIMA 4DQSA 1HYZA 5HROA 1T05A 4NRTA 1XI1A 3BDPA 4FLYA 1LWCA 3AVNA 4CGDA 3QEWA 1RT7A 1HMVB 4HUGA 2BANA 2HHUA 4J9OA 1FKPB 2KZMA 3F9KA 3V9ZA 1X9SA 3MR3A 3DOKB 3DRRA 3U3YA 3DLGA 1NK4A 3SNNA 5F9NA 4OPJA 1WNSA 2PYLA 4YR2A 5SZTA 3D5MA 3N6NA 4MIBA 1CSJA 3QZ8A 4LH5A 3K58A 4ECTA 4FS1A 4R8UA 1ASUA 4TQSA 2JLEA 1TKZA 4CJQA 4CJPA 2B5JB 4Q5VA 3KKRA 3FDSA 4BDYA 5DG7A 4FJ9A 4N47A 2F96A 1K1QA 1D9FA 1IM4A 5L9XA 3QESA 1RTHA 4CJLA 2XY8A 1TKXA 1WSHA 3RTVA 1X9WA 3KK1B 3S3OA 1JIHA 1RT6B 2JEGA 1W0HA 3G6YA 1NK5A 4KB1A 1SV5A 3RR8A 1S1VB 1HPZB 4Z4FA 2OPQA 4ECXA 4MFBB 4MK7A 4YP3A 3I5BA 2W9CA 3AV9A 4KHQA 3F73A 4LQ3A 2VG6B 4O3PA 3FFIB 5KFVA 1HJRA 1XC9A 4B9MA 3OJSA 3SCXA 3BSOA 5KFSA 1JLFB 2R2UA 3VQ9A 1NKBA 1KVBA 4HYKA 3NF7A 1C1BB 3KK2A 4NLOA 1TL3A 5DLFA 3HM9A 4M3YA 4IDKA 1EX4A 1K6YA 3HO1A 3EYZA 4CJEA 3C94A 4OPKA 3BQ2A 4NYNA 4FVMA 4ED2A 5HBMA 3ASMA 4EP5A 2XY6A 4DL6A 1NJWA 4MIAA 4DTSA 2IJNA 3K5MA 1JXBA 2JC0A 3TAGA 5HLFA 4DG1A 4FJKA 4CGIA 4XPEA 4NLUA 2YNGA 1REVA 1LW2B 2NUBA 1S49A 3L2UA 5KFZA 4IG3A 4URGA 1L3VA 3H5UA 3ZSRA 4CHNA 3OYLA 1UWBA 3OJUA 3NGZA 3QYYA 4WYWA 2EC0A 2ASJA 2XI2A 2AU0A 3C95A 4CHYA 4DSEA 3MEGB 2HHQA 4B9TA 5KG7A 3GILA 1EETB 1JLGA 4ZHRB 2XY7A 1VSHA 1TP7A 3U6FA 4HHTA 3NCIA 5KFUA 2W7PA 4ID5B 3H5XA 1WAFA 4HUFA 2UVUA 3AO3A 3EY1A 4K4SA 4LQ9A 1HNIA 4WE1A 2HNDA 5KTQA 3GQCA 2I5JB 4E0DA 4DQQA 4KFBA 3H98A 4WXOA 2RKIB 1J5OA 2G8UA 4O0JA 4O3QA 1W9HA 2HNYB 3PJXA 4K50A 2HMIA 2ITGA 2WCXA 3H4BA 3FQKA 4KHUA 2HNZA 3C6UB 2R2TA 4TY8A 4FK0A 3AVBA 4BE0A 1TKTB 1XR5A 5L1JA 4IR9A 4MK8A 1C0TB 1UA0A 4NLYA 3UIQA 3V81A 2WB4A 4CFBA 1QAIA 2FVQA 4FLZA 4KSEB 1D9DA 3N6MA 4ZVGA 2P5OA 1ASVA 3MEDA 5KFNA 4KAZA 1GOCA 3OS2A 4O4GB 3DLEB 2IBKA 4JV1A 2ZD1A 3PO5A 5KFJA 3NL0A 1NHVA 3RWUA 3IGNA 5K14A 1JLAB 1T3NA 1WNEA 2FC0A 2IJFA 3SPYA 2YKNA 3T5KA 2AJQA 4LSNB 3HHKA 4KKOB 3LAKA 3OL6A 3I5AA 2JEIA 3OYDA 3EPGA 4NCGA 1QHTA 2OPRB 3L2WA 1J53A 1NHUA 3LZJA 2ZE2A 4HVJA 2EHGA 4KPYA 3CFOA 2W9AA 2VG7A 4TXSA 1SKWA 4I7FA 1IKVB 4DL2A 3VA3A 5KFMA 2RN2A 5JS2A 3CDUA 4BE1A 4ID1A 3LWMA 3KD1E 3KHLA 5KFKA 3OHBA 3RAXA 1SH3A 1BCMA 3SQ0A 3LPUA 1TK5A 1RTDA 1SL0A 4Q0BB 4DSJA 1VSLA 5DK5A 1S6PA 4KI4A 1C0MA 3PX4A 3ZSZA 1RT5B 4DLGA 3KK3A 4OVLA 3G6VA 2GIQA 3THVA 1X1PA 4IFYA 3RMBA 4KHYA 1C0UA 1U45A 3KLFB 3GIJA 4DSIA 2R7YA 4CF1A 2D7SA 4KHWA 4KV8A 3V9UA 1RT3A 1CXQA 5F8HA 1IH7A 5KI6A 1NK8A 2FVRA 3V9XA 4PUOB 2C2DA 2ASDA 2CJQA 1K1SA 2YKMA 4QWBA 2P5GA 3PR5B 3AVIA 1XWLA 4J9KA 4CF8A 2C2EA 1SUQB 5DQHA 1HARA 1CZ9A 4DL7A 1JLEB 3HJFA 1A5XA 5KFWA 2IAJB 1C1AA 1ITGA 4F4ZA 1X9MA 2BRKA 3UQSA 1RT4A 3PW7A 3CJ4A 4CJTA 4CFDA 1EKEA 3CVKA 4FM1A 3AO4A 2R8GA 1RBTA 1RILA 4GW6A 1L3UA 2P1JA 5KFXA 4CEAA 1QSYA 3IAYA 4O3NA 3QNOA 3HPHA 4I2QA 1QUVA 3MR6A 5I3UB 4RUAA 3ITHB 4Z0UA 3OS0A 1NKEA 2FJXA 4TN2A 3VQSA 3MTKA 3M9NB 4GC7A 4E7JA 3DLKA 3NF6A 3TAPA 5EWGA 1S97A 1S9EB 2AGOA 5F8JA 2OPPA 4B3OB 1LWEB 2VG5B 4ECYA 5EDWA 4Y3CA 2RF2A 4I9QA 3Q8SB 3BSCA 2O4GA 1BQMB 2Y1IA 1QE1B 3BGRB 3IGVA 3H4DA 3UPFA 3OLAA 1TVRB 4FJ7A 4CESA 1YVFA 4RW7B 5F8NA 2DFHA 3GYNA 1TV6B 4F2SA 2XGQA 3TAFA 1KLMA 1T03B 4KAIA 4FJ5A 4F4WA 4CK3A 3V6DA 2BQUA 4OKJA 4WFXA 1N48A 4NLPA 4R0EA 1VSMA 3VQ6A 2YV0X 2FJWA 1RDBA 1RAJA 5KFFA 4AHUA 4F4XA 1IKXB 2WOMB 1HQEB 3PZPA 4BWJA 5JXSA 4QCLA 3AVHA 4ICLA 4RNHA 3QO9B 4URQU 5KFPA 2D5RA 4EO6A 1VSEA 4NZ0A 1S48A 3DRSA 4Q8FA 4I2PA 1ZBUA 3KKSA 4IQXA 3NF8A 5F9LA 4Y1CA 4IFVB 3ZSYA 4DSFA 5J2MA 3CQ8A 2IM3A 2YHAA 4BE2A 4BDPA 3MR2A 3JSMB 2W9BB 1U47A 1YVUA 1TAQA 4DF8A 4AH9A 3VQBA 4QW9A 1KTQA 3MXIA 4MKAA 4J9SA 1S1TB 1HNVA 4FLXA 2Z1IA 2YNHB 1BHLA 2R8HA 3BSNA 3TQ1A 4FLVA 3PW2A 1RT1B 2X6SA 4J9LA 4FJGA 3LP0A 1WN7A 4CERA 5C25B 4CJ3A 2HVHA 2AX1A 3SUOA 5C42A 3QIPB 3M8SA 3V4IA 4RUCA 4ED1A 2VWJA 1N6QA 2Z1HA 4H4OA 4CEBA 1ZTTA 4DSLA 4L8RB 2F8TA 5KT5A 3BR9A 2OA8A 4EBEA 4O44B 4K4VA 2AWZA 1T94A 3NE6A 1UA1A 4ZP7A 1LWFB 4Y2AA 3IRXA 3QGGA 2PY5A 4IH7A 4KO0B 1B9DA 5KG6A 3NKYA 1IKWA 2OYQA 3IS9A 3E01B 3KLGA 2IMWP 4KHNA 4H4MA 1HYVA 3VN5A 4ELVA 4FJJA 3V6KA 3RB3A 3AO2A 1S4FA 3HP6A 5J1EB 4YFUA 3S3NA 4JV0A 4M45A 4M3UA 4Q8EA 2BE2B 5D3GA 1RDCA 4CCHA 3P5JA 3IG1A 4RW9B 2XWYA 4EBCA 2FBVA 3NH2A 3QLHB 5I42B 3M8PA 1JLQB 4J2DA 1YTAA 3K5NA 4F8RA 1VRTA 4DFKA 4H8KA 4GVMA 5HROB 4K4TA 1T05B 1BI4A 4AHCA 3HVTA 1SL1A 1LWCB 4NRUA 4I9LA 1RT7B 3RB4A 2DFFA 3M8QA 4RW8A 4DF4A 2ATQA 1XHZA 2OZMA 2QXFA 3V1QA 2BANB 5L1LA 3PW5A 3DRRB 5J2QA 3DLGB 4DS5A 5JS1A 4KTQA 4NLRA 3Q8QB 4K4WA 3H08A 5DGAA 2GBZA 4R8UB 4Z4GA 3GV5B 3KLEA 1HYSA 4ZP8A 5KFIA 4M95A 2IOCA 2JEJA 1S9GA 5CYQA 2WONA 2GUIA 3O3FA 3OL8A 4DS4A 3MR5A 1TKDA 5DQGA 4WYLA 4DL3A 3OYEA 1SL2A 2FVPA 3NH0A 4KTWA 5FRMA 3NH1A 2BDPA 3TARA 4ELUA 4ZVHA 4KHRA 4PA1A 4FK4A 2DPJA 3HYFA 3VQPA 4DU3A 4OKKA 1RTHB 1SKSA 1DTQA 4IKFA 1TKXB 1B9FA 3HVAA 3PJWA 1S1XA 3LALA 5KG3A 1N5YA 5CZ1A 4ED6A 2B43A 1BIUA 3B6PA 4DTRA 3TAQA 1KHWA 5KT2A 4E3SA 3QNNA 4HCBA 1SV5B 4O5BA 1RBVA 3CFRA 4KHMA 2ETJA 3DM2A 2J6SA 3NBPA 1XR7A 1JL1A 4BDZA 2JGUA 3TANA 4K4UA 3OSNA 3VQAA 1WSEA 4F2RA 2P51A 3KMSA 2HVIA 1N56A 3B6OA 4MKBA 5C24A 1G15A 2DFEA 2IC3A 3NGYA 3OYGA 4FW1A 5E41A 4W5RA 2D41A 5CYMB 2D3UA 4HUEA 2ILZA 4ECUA 3KK2B 4XPCA 3V1RA 3CIZA 4IDKB 3RBEA 1IG9A 3C6TA 3NDKA 5HBMB 2BRLA 3G10A 4DWIA 1JLCA 4GC6A 2E9TA 3OYNA 3LP1A 3AA2A 1D1UA 4DQRA 2VA2A 2JEFA 5HRPA 5HLFB 4DG1B 4PWDA 5DLGA 1RTIB 2YNGB 1REVB 2ALZA 4G1QA 3OHAA 1ZBFA 4RW6B 3D28A 1QSLA 1EP4A 4CK2A 2KTQA 4IG3B 1J54A 4OGCA 4FLUA 4DTUA 3KJVA 1UWBB 2RKIA 4B9LA 2RPIA 3TABA 4CHOA 2HNYA 3GIKA 4YR0A 5KRTA 4CK1A 3V9SA 3K57A 3I0RA 4C8LA 3QEPA 1NJYA 4WZMA 1SH0A 1RBUA 1OS5A 3TVKA 1T8EA 1HNIB 4WE1B 2Y1JA 2HNDB 4DEZA 4W5QA 1L3TA 3SV4A 1A5WA 1Z26A 4FZZA 5FRNA 5F8MA 4KFBB 5KG0A 3NAIA 3VQCA 3AA3A 3LZIA 3ZT3A 3NHGA 4RW4A 2HMIB 1TGOA 4DTPA 4CFCA 3CG7A 4MK9A 2HNZB 4WXWA 4E7HA 2D3ZA 1DTTA 3JYTA 2IS3A 4ZTFA 3ZSWA 4B8CA 1VK0A 4O4GA 5J2PA 3UDLA 3PV8A 3BQ0A 4FJHA 2R8JA 2J6TA 3GIIA 1S6QA 3HVWA 3V81B 3MEEA 3V6HA 5HP1A 5F8GA 4ED8A 3AVFA 3OYCA 3KNAA 1NJZA 1I3AA 4O3SA 2XHBA 5J2NA 3S3MA 1LV5A 3OLBA 2OPRA 5EUHA 3MEDB 4HCCA 1S1WA 1TAUA 2ZD1B 3H2LA 4IH5A 2FLLA 3HSTB 1FK9B 5K14B 1Z25A 3DMJA 1LAVA 4AILC 3K59A 4CJ5A 4LH4A 5FDLA 2YKNB 4CEQA 2HHWA 3BREA 3AO1A 3KLHA 2D0AA 3DI6A 3OS1A 3QIOA 3DOLA 2I1RA 4MH8A 1S5JA 5DQIA 4NCGB 1FKOB 4YQWA 3AVMA 2WK4A 4Q0BA 4QWCA 2WRMA
chains in the Genus database with same CATH superfamily
5E26A 2QKBA 1RWMB 3KG4A 2ERRA 3V1OA 5A0YB 2KXHA 3MM6B 2UXCF 4M8LA 2IHR1 2XWXA 3N9UC 2OUGA 4URSA 2YTCA 3G87A 4JS5A 3SQGA 3OVSA 1DARA 4PYAA 3CJ3A 2MPUA 1KVIA 4W5TA 2IM1A 1WD6A 2UXCJ 1KVCA 1VHIA 1YVNA 3QWPA 1S6PB 3MCOA 4OI3A 4M7XA 2VPXB 1FEEA 2J0XA 4PZVA 4F67A 2A6MA 3TOQA 4EUVA 1RADB 3L3CA 3GWCA 4LSLA 3SEOA 4IFYB 2YX6A 4OLAA 3AB2B 3W5ZA 2KYXA 4KGVB 2B9YA 2F63A 2P9CA 1NSQA 3HHLC 1KVAA 3LW5C 3DHXA 2YNIB 4NLTA 1FHTA 3CCLN 2IM2A 3IBFB 4YR3A 3M9MB 2NLWA 4CHZA 2XO7A 2E6MA 3UKRB 1NNDA 5BYSA 5D4LA 2Z1JA 2MMYA 5GAHP 4KPCA 4E7IA 1GMWD 3E8OA 2NXNA 1XQSC 4I6AA 5KFOA 1KFDA 3GCWP 2O67A 1ZZNA 3ZETA 3ITHA 3BBCA 3RVCA 1WUAA 4X4RA 1LK7A 5AFUA 4BC9A 2Q97A 4JI8F 3ENOA 2HHVA 3FBFA 2V50A 4CGGA 2PI4A 4C4WA 1NB2A 4F3MA 3CDAA 7FDRA 1QZ5A 4DR3F 2XCAA 2RH3A 2CKWA 4C2MA 3MURP 2IRYA 2R8IA 4BR7A 3QWUA 2XULA 4EU0A 2N7YA 2CPFA 2ZZTA 4KBIA 3O9SA 1X7VA 1Q5VA 4DZDA 3I55S 2RD5C 2Z0GA 2ALYB 1H2TZ 4DU4A 3D68A 2E1PA 4NL5A 3HP9A 4CIFA 3IDHA 4DL5A 2H65B 1SAZA 4WZQA 3JXOA 3OBWA 1Q9YA 1S10A 1HR0J 4QJVA 1O0PA 2P9SA 2CJAA 3QFPA 1YG0A 3VA0A 5KT4A 4OYZA 3TRGA 3R1XA 1IKXA 5LMUF 4DV2F 4R5PA 4K41A 2U2FA 1W7WA 2PEBA 4ECZA 4CJVA 1RWUA 2R3VA 2VDIA 4K7QA 1GT8A 2V7YA 2BQRA 4OZ0A 4EIAA 1LOUA 1P90A 1Q7LB 1YZ7A 2YCHA 4ICLB 1JXLA 2V5HG 4GKKF 1HQUA 2A40A 5DGBA 2ZKUA 1KHVA 2YWKA 3RBZA 4OQJA 2YHBA 3CCMN 4E1MA 2QYGA 2AHOB 2GHWA 2BR0A 1FE0A 1RTJA 3RW6A 4H4KC 4X66J 4JKHA 1KC8T 5AJ3K 4M5JA 3VETA 3SLCA 3EWGA 4B3SF 3VGUA 4GKKJ 2CFXA 2V94A 3RMCA 2QWMA 5FLXY 1T11A 1NRKA 3M32A 1OPIA 3EZUA 4HDGA 4XO0A 3N01A 3D67A 1RT2A 2VQEJ 1VQ4S 3SSSA 2HFVA 2DNHA 2AYMA 4B3SJ 4X4QA 5A8KA 4EBDA 2P9EA 2XYGB 4CM0A 5DG9A 1RA7A 1AYEA 3AOBA 3HFKA 2Q66A 3CJ9A 3ATUA 1HNXF 5EWFA 3G8SA 1H2VZ 2YWGA 3G96A 1DZ5A 1HWUA 1N6QB 4OJRA 4H4OB 3G82A 4EHTA 3ZZOA 5H1SV 4ED3A 1TYQA 4U7UD 1HNXJ 1U1QA 1FKPA 1V6HA 1ZAXA 4JLHA 2F8EX 2ZM6J 5CHIA 3ZT1A 2W8LA 2DHAA 5LSLA 4LF4J 1MA9B 3JSBA 4H4MB 4CEDA 1OY6A 3KTQA 2KM8C 3ISNC 3U1NA 2C3OA 1RCHA 5ETSA 4P74A 3MTJA 4TU7A 3Q8YA 3VQ5A 3C8YA 2UU9J 3PY8A 3HRGA 1JJCB 4OX8A 1JJ2R 4MDBA 2LQ5A 2QE5A 3HTVA 2NPFA 4KHSA 4NYPA 4KB7A 5KRSA 4LFBK 4AHTA 3K5OA 4QAGA 1ESVA 3CD5A 3RUBL 1VLYA 3M8QB 4CGFA 3HPOA 1HNZJ 2BA9A 2P9KB 3EZ5A 1NOYA 5KFRA 3LPTA 4MFBA 2M70A 4CLSA 2MY7A 2V8DA 2XGPA 1MWZA 3IM8A 2FZKB 3DFEA 1AFIA 1WBDA 4P7TA 3SI6A 2K06A 1S0NA 4OX7A 2P9GA 3KLEB 1HYSB 1N36J 2G2YA 2G8HA 4ANDA 4PY5A 3C6HA 4JKAA 4ZA1A 5HI7A 2P9PA 5EWEA 1N32K 4C8MA 1UPPA 3Q0AA 3NFAA 4HL9A 2UXBF 1C1BA 4CZEA 4IRKA 2VONA 5A6WA 1RAEB 1Z1ZA 2QC3A 2IDLA 4QW8A 1GLDG 4I4BA 2HZVA 3GMGA 1DTQB 4DUZK 4HH0A 1E6YB 2UXBJ 5F8LA 4M3TA 2WUSA 3W5YA 5CZXA 4DV6K 3DM2B 4XEIA 1OIAA 1LW2A 1PJ7A 3E2EA 2UUBF 3KFWX 3AJ2A 1AZSA 2RS2A 2VASA 2HVZA 3NS5A 1JB0C 2VFRA 5C24B 1ZPVA 4IO9L 4ZIVA 4IRCA 1RTIA 4Y2KA 1RBAA 1VQ8S 4WTYA 2D9PA 4LRFA 3VPZA 5C5JA 2P9NB 2Z1GA 3ZZUA 4QOTA 4M3RA 5KFCA 3SCLE 3T1HK 1S72S 4C48A 1NSPA 4DFPA 2C28A 2HFSA 3CT9A 3UN3A 1ZYQA 1FEHA 1G7CB 1WWHA 3CCRN 2VQFK 3I5CA 4G1QB 4P7VA 3J7ZT 3MAQA 4FLTA 2VKRA 3HHDA 4B1YB 1RDDA 3KJVB 3QMQA 2DTUA 3VGKA 5IC4B 3M30A 1UJ5A 1LFWA 1IQTA 2YKQA 3DLLL 4DR4F 4DX7A 2CJ9A 4HVZA 2FPHX 3PW0A 1TQLA 3CJ0A 4TY8B 4Y34A 2BJ7A 3WZ0A 1RDAA 2MKKA 2IMOA 1GX5A 1UWAA 2XMTA 4NXNJ 3J81j 1ASWA 3HXMA 2ROPA 1FJEB 1FE4A 3O44A 2HWIA 4QOZB 3VZHA 2LDIA 2QWQA 4ZPAA 2VIHA 4FBUA 4KREA 3RR7A 1BL3A 2DK2A 1UW9A 1FK9A 1S6QB 3VAMA 5EU7A 5F0XA 2FJDB 4J9RA 2L9WA 2CQDA 3MEEB 1GLLO 1NZ8A 1VK3A 1TUUA 5HP1B 1KN6A 1YBTA 4PQAA 2CPXA 5AQXA 5J2NB 1SIWB 2K1RA 1EQMA 4DR2F 3P96A 4CNZA 3SQ4A 1AW0A 4C97A 1WEXA 2D0BA 2LLZA 3H90A 4Y2MA 1K0TA 3PIOQ 4BWMA 3RSEB 1U2FA 4HACB 3ZZZA 3EEQA 3KIOA 2NXEA 4Q43A 3DI6B 3BEGB 2AX0A 2HBJA 4C23A 2QWLA 4KE5A 1Q8IA 3AJ1A 1CLQA 3EE3A 4Z2XA 3JTPA 3OYAA 1XNRF 1MDUB 4EEYA 1H38A 4O55A 4OHVA 3NGSA 4PQUB 2EFPA 1IQZA 4PUOA 5AQHA 3O3GA 4HT7A 4CD1A 3P5TL 2VDHA 4DMNA 4JK9A 3K5LA 3L2RA 3PFEA 1ZZFA 1R27B 3DRYA 2DR7A 2EX3A 4R0JA 4K4YA 2HQIA 1D8YA 3QRPA 1BUPA 3CD7A 4QS7A 4ED4A 3I0SB 2YNIA 3NVKA 1KD1T 1WLJA 1CEZA 3KWIA 3ET6B 3UKRA 4RTFD 2G8WA 1K0VA 3PYEA 2X74A 2JWLA 3CCEN 4NLSA 1ZBIA 4LY7A 4OJ3A 3BO3A 3KKFA 2GC8A 4MJKA 1RU1A 4FWSA 3FLCO 1DLOB 2P9IA 3DYAB 5AQPA 4ILHA 5GAEI 1WEYA 4LFCK 3R6GB 2NREA 4JI7J 2EFNA 4OZLA 1I5OB 4DR5K 2V2VA 4CTAB 1UFLA 2R2RA 3PLAA 3E9OA 2VPWB 3O4NA 2POKA 1S9EA 2ILYA 5DG8A 4EHUA 4Y1DA 2PC6A 1S6OA 4RZRA 2NRXA 3SI8A 3D0PA 4JI4J 3C6AA 2J9DE 3JTNA 1NBEB 1L3SA 3A3PB 5GIPA 5IT9O 4MAKA 3BZCA 1XBWA 2G1DA 3MM8B 1TV6A 1LCUA 2ZQBA 3H5SA 2OPPB 1JQGA 3AAPA 4ECRA 4PKIA 3WIVA 4U6PA 1IWAA 4B3TF 4IRDA 1S0OA 1A5VA 3U3GA 4Z7YA 2FDNA 2RE2A 3KLIB 1C4AA 2WOMA 2DD8S 3EVMA 4WQ5A 5KG1A 1GLFO 4AM6A 1C0GA 2D0OA 4ILGB 4JI6K 3R2DJ 3I87A 4DDFA 2G8KA 5IV3A 2B4OA 2VWKA 1HKAA 4P2SA 4CLZA 4BR4A 3S6EA 2NUHA 1I6JA 5FPNA 4FS2A 2YH1A 2W9BA 4FWQA 1B0PA 2PGCA 1RDUA 4DU8A 1CULA 3H8YA 1RNHA 2IDOA 1U1MA 1KLNA 3CJSA 4NYZA 5A2QY 4LREA 4A4JA 2IY5B 1P1LA 2O4IA 2FBTA 4DV4F 4LSZB 3UN5A 3J80U 4Q45A 4CJ4A 2YX7A 3A3NB 4DQPA 4DV5F 4HR2A 1BQNB 1B92A 1TL1B 3PYGA 2O01C 5GADU 2Z58B 4TU9A 4DV4J 4O44A 2FLPA 2WVDA 2H54B 3VAKA 2AF6A 4DV5J 1RISA 1WG5A 2NSCA 1IR0A 5KFBA 4ALZA 1M90O 4CZCA 5K5MA 1RWWB 4CF2A 4UQGA 1HBMB 3DGPA 4C8NA 2E8AA 1TL7B 5J1EA 2NRRA 2ZHOA 4HHUA 5GAGP 1HRHA 1WUUA 2UUWA 1AA1B 4CHQA 4CH7A 5CZ2A 1IBLJ 1JLQA 4U8YA 2DNRA 1W2BR 3E9LA 2OD6A 3W1YC 3BDPA 4WFBQ 3W2VB 4EMDA 3KJFB 2E2QA 4OLOA 1T02A 5AZJA 2JJ4D 2V2QA 1SQFA 2G1HA 2MQQA 4J9OA 5H1SQ 2KZMA 1QM9A 4NI2A 3DOKB 2Q2RA 4IEEA 3C15B 3DRRA 3I6PA 4YR2A 3VTHA 3D5MA 3ENQA 1TUYA 3N6NA 4LH5A 3K58A 4R8UA 1ASUA 2LU2A 2ZJQL 1UAWA 4TQSA 3P31A 1G3OA 1NPKA 3MUVP 3HI9A 2P9KA 3D6HB 4CP5A 2XLKA 4CJPA 4BGAA 4Q5VA 4BDYA 3MI7X 4FJ9A 2YHWA 4N47A 3ZXWA 2OELA 2F96A 2XLIA 1D9FA 5L9XA 4I6YA 4A46A 2XY8A 1WSHA 3RTVA 2CNKB 1RT6B 2C2NA 2GO9A 4YB6A 3MPDA 4U67L 1NK5A 1YJTA 1X0FA 1WOQA 1HPZB 3MUTP 3MWTA 3JAMY 3MM7A 4OZNA 2RQCA 4MK7A 2KVQE 5K8NA 2VG6B 2K2PA 2Y9HA 4FPRA 3FFIB 4U95A 1HJRA 2E5LK 2C3YA 5T7LA 4B9MA 2PO4A 3BSOA 5KFSA 3OR2B 3KWMA 1HX1A 4LF7J 5ETOA 1NM2A 3VALA 1RHJB 1F60B 3HM9A 1WC5A 3ATVA 2VICA 3WIUA 3BQ2A 1BOTO 4AQYF 4ED2A 3LPYA 1FD8A 4DL6A 1CJVB 1JXBA 3CEDA 3NNCA 1M5PC 3R5BA 3G4SS 2CQPA 4FJKA 4CGIA 1EWRA 1REVA 3DOMA 2N4CA 2YBVA 2ZOGA 1BG3A 3NGRA 2VU5A 5B8HA 4DV1K 3EE9A 4B17A 4URGA 3H5UA 4CHNA 2B4UA 1UWBA 3OJUA 3BYRA 3T1YJ 2ASJA 2V8GA 3KYLA 3PCOB 2XI2A 3MEGB 1DQ9A 3GILA 4ZHRB 2XY7A 5DO2A 1WSRA 3U6FA 3NCIA 1OYEA 2KU7A 3EY1A 3EO3A 2Z2MA 4LQ9A 2ZH5A 3CXCM 2F4VF 4C0OC 4E0DA 3R3LA 2RKIB 3POTA 4CD3A 2X3GA 4K50A 3NS7B 3PJXA 4LVNP 4FWMA 2WCXA 4W92B 1U8SA 3FQKA 4KHUA 2HNZA 4GKJF 1FJGF 4CZIA 4TY8A 3GR0A 1T3OA 1NGHA 1NNEA 3PKYA 3LH2S 3AVBA 1TKTB 1FRMA 3ZFVA 5IC6B 5RUBA 1CJUB 2DGVA 2O8EB 2QXLA 3FZKA 2QWOA 1IJFB 4GKJJ 2H51B 1HBOB 1H73A 2W7AA 2QSWA 1NLVA 3E3XA 4CVNE 5C10A 1IWGA 1EIYB 1D9DA 5HMZA 3N6MA 5L8RC 1FDNA 2P5VA 3MEDA 5KFNA 3W61A 2QWRA 1GOCA 1BMQB 2PIIA 5AXLA 3OS2A 5THWA 3HZ6A 2ZD1A 4CLTA 3NL0A 2GA7A 4PL8A 3FCHA 1IJEB 1MWQA 3SJHA 2IJFA 2AJQA 4A61A 4LSNB 2Q31A 3OL6A 2RHSB 2DEJA 2ROGA 1YJWN 1R89A 5B0EA 2OPRB 5JICA 2AZ3A 2E66A 3O8MA 3RSEA 1BWVA 1FX4A 4DPTA 1IKVB 4DL2A 1X4CA 4BG8A 4Y0FA 2I38A 4FYWB 5IS2A 2CIMA 3CCLS 4MYUA 4BLGA 5KFKA 3OHBA 3RAXA 3FBBA 3MD3A 5E3CA 4B1ZA 3W63A 4PRFA 1TK5A 3C2PA 1NDCA 2HHHF 2W25A 3K9JA 3UD4P 5DK5A 2E1YA 2VV5A 3GU0A 3D9BA 2CPYA 1C0MA 1FWPA 4FWKA 3IUCA 3ZSZA 1U2VA 3KK3A 3VAFA 2I2YA 1X1PA 5B0AA 4DPOA 3C7NB 1XMQK 3KLFB 3GIJA 2WSEC 1FVSA 3CULA 3SMPA 4OZ5A 2X1AA 1VQNS 2BYCA 3V9UA 2OCEA 5F8HA 4WCEQ 1IN0A 1NK8A 2FVRA 2BE9B 2J4RA 2C2DA 1SCJB 1H72C 2CJQA 2QL9B 2YKMA 1Y3KA 3SCJE 4ISFA 3S7RA 3O6WA 2VUGA 1QQOA 3UD3P 4J9KA 4DR6K 1SUQB 3H3OB 4DL7A 1JLEB 1EKRA 5LM7E 2PMZD 3AXKA 2IAJB 4H0TB 3HT0A 2HBYB 3PW7A 3KNGA 2N3OA 3IR6B 1KAYA 1AT1B 5FPEA 1L3UA 1RILA 2Q6BA 1X4DA 2PEHA 5KFXA 2GGPB 4CBUA 2OEJA 2MJNA 3HPHA 1MN9A 4OJ1A 1QUVA 1UW4A 3BGOP 3VENA 3IM9A 4B3RK 4TU8A 3CD0A 3PIPQ 1NKEA 4TN2A 9RUBA 5K8OA 3GTYX 3MHYA 5BR8K 4EGLA 1SXLA 2V4JB 3GG4A 1IBMK 1ATSA 5LY3A 2Q79A 3M6UA 1S97A 2OPPA 2D0PA 3HSZA 5EDWA 5M1FA 4I9QA 2FIUA 1ITPA 2MLXA 2O4GA 1UPMB 4MTPA 2LA6A 3CCMS 3VV2B 3OLAA 4FJ7A 1YVFA 5F8NA 4FWNA 4CI0B 3TAFA 1KLMA 3OXLA 2ZVIA 1T03B 4FJ5A 1KEKA 1G4CA 1JXVA 4F4WA 4B3MJ 4W90B 3A5MC 1UL3A 4WFXA 3MCMA 3AFGA 4NLPA 4R0EA 3VQ6A 2FJWA 2W4DA 5KFFA 2UZAA 4AHUA 2YKPA 3GPAA 4JI2K 3HSGA 4HWIA 1F6TA 4QCLA 3AVHA 4RNHA 3QO9B 5KFPA 5KOXA 2BM0A 1WHXA 4NZ0A 4TLQA 3ZTOA 1CJTA 4GVBA 1XNQK 2IVYA 3AGKA 1GFWB 4FKYA 5F9LA 3ENAA 4Y1CA 3CQ8A 2DH8A 4BDPA 1VBKA 1U47A 1YVUA 2QI2A 2GMLA 4QW9A 3CD6N 1XMBA 2O1PA 1WJ9A 1B4SA 2CQ2A 3TQ1A 4FLVA 3B8HA 3PW2A 2CGJA 4MKYA 4J9LA 3B54A 3EDQB 3WX8A 4F36A 3CQXA 2HQGA 1T44A 4CJ3A 3J7YI 4GV3A 2GNKA 2EWHA 3V4IA 3QICA 3H46O 3ZX0A 2VWJA 2Z1HA 2Z57B 4DV0K 1M1KO 3BR9A 2OA8A 4RX6A 3C0BA 2OEKA 1SC1B 3UVJB 1B9DA 2ZWPA 2HGMA 1IKWA 2EC2A 3IS9A 3W2VA 3KLGA 4KHNA 1VQMS 4ELVA 5B7WA 4LF5K 3RB3A 3AO2A 3HP6A 4DV7F 4ETXA 4JV0A 4M45A 2GVDA 2BE2B 5D3GA 4GY2B 4K2XA 1R8BA 4FPAA 1HBUA 4CCHA 3IG1A 2FBVA 3NH2A 4ZVQB 4QBUA 3TJ9A 1QVFR 3K5NA 2E7XA 2M0GB 1VRTA 4F4AA 2ZBQA 3NEKA 2VB6A 4GVMA 5HROB 4DR1F 3TSQA 1T05B 4AHCA 3HVTA 1YJ7A 3BZQA 3AOCA 2YKOA 4USWA 2JLGA 3C19A 4AF1A 2OGUA 1OH8A 3UDCA 5C2DA 1DRZA 4DF4A 2OZMA 4J9VA 1S76D 2UUCJ 4YS2A 1P8GA 4DR1J 4JKDA 3PW5A 1NLKL 1WSVA 4UW2A 1U1KA 3DLGB 3NWGA 4KTQA 3ZNJ1 4NLRA 3Q8QB 3A13A 5DGAA 3D0HE 5KFIA 1GLJO 2OFHX 4QIFA 2PMHA 2GJFA 5AE2A 5H9EJ 5FJ4A 5CZVA 2MZ1A 2GUIA 3MR5A 3CMES 3NH0A 3HOSA 4CO3A 4KTWA 4H0PA 1T0TV 4C3MA 2BDPA 2V7ZA 4M7YA 3TARA 5JJBA 4PA1A 3ID6A 4DCJB 1SKSA 2WTUA 1B9FA 2H4YB 3PJWA 1S1XA 3J80O 4KQZA 5KG3A 3SMZA 2H5IB 1BC6A 4HCBA 4JOUA 3IBWA 2CJYB 1EQ0A 1Q8LA 3G71N 1IG8A 1WI8A 4XK8C 2YQ0A 5CXTA 1JL1A 4BDZA 3BO4A 5BJRA 3W8PA 4K4UA 3NCQA 2CG8A 2EKYA 3MN6A 2RHQB 3T6JA 3KMSA 2HVIA 1NPRA 3P3DA 1N56A 1HWIA 1U6ZA 4MKBA 2QTDA 1VIOA 2IC3A 3NGYA 3HD1A 2I6WA 4IO8A 2D3UA 3TO8A 2ILZA 3KK2B 1NUEA 3EXYA 4IDKB 3U8XA 3C6TA 4CI6A 4K8RA 2PSZA 2PAVA 5HBMB 2ZEJA 4DWIA 3AOAA 3ILJA 4EWTA 4DCOB 3F44A 1FRKA 5LL6Z 3TJ8A 4ERDA 4DG1B 1EAYC 3MMVA 1NGJA 2EEYA 3HSCA 2JLFA 4RW6B 3D28A 4A8WA 4CK2A 4IG3B 4OGCA 4DTUA 3LDNA 3BO2A 2E7VA 1HWJA 2RKIA 1N52B 3U7JA 4B9LA 3IA0A 2RPIA 3TABA 3UW1A 2A18A 2K3IA 3GIKA 2BOAA 3D2FB 1VQ9N 2MDAA 5KRTA 4CK1A 3K57A 1SBRA 3RAMA 2ZBPA 2HEKA 4JI1K 5GAEU 1I51B 4UF4A 2ASMA 1CJKA 1CLFA 1HNIB 4X4VA 4W5QA 3CO0P 5BRDA 1KAZA 3ULEA 4FZZA 2KN4A 3IFRA 4RO0A 5F8MA 5KG0A 3BGFA 4KT0C 4XH4A 2IYGA 1HBOA 4YDDB 2HMIB 3M2RA 1TGOA 4BQZA 3FMBA 4CFCA 3QAUA 4E7HA 4AXJA 3GL1A 2IS3A 3ZO7A 1PYOB 4B8CA 3PV8A 2CH5A 1F1BB 5CE3A 1C4CA 4FJHA 4LBPA 2CDQA 2J6TA 3CJQA 3R9LA 3QT5A 3HVWA 3D1HA 3M6XA 3V81B 1UKUA 1MROB 5F8GA 3O4WA 3KNAA 3LGMA 4PPZA 4H0XB 3OFGA 1WOPA 2OPRA 5EUHA 4HCCA 1S1WA 3AA8A 4YHHF 2UXDK 2NQPA 2MGZB 3H2LA 4IH5A 2JVOA 4NXMJ 2VH7A 3A8JA 4U7BA 3K59A 3PFOA 4LH4A 1D9AA 4CEQA 3AO1A 3OS1A 4AFFA 3VESA 3QIOA 4YHHJ 4MH8A 2QL7B 3CB4A 4RJVA 1O6XA 1FKOB 3BKUA 2PT0A 2WK4A 1Q82O 1W2IA 2VFVA 2FYXA 3CCES 3QAEA 1NHKL 2F7VA 1TUWA 1X4BA 3FSIA 1P27B 2CAJA 4FWPA 2DO4A 3SUQA 4YOWA 1LWXA 1YSJA 3L95X 3LM2A 4E89A 4JYAK 5HVFA 5CCLA 3FVYA 3B8AX 4CEOA 3V6JA 1LAWA 4B9NA 2KXNB 3R6LB 2QJ3A 5AQTA 4ER8A 1GQEA 3M7VA 4JI3F 3HI0A 4WFZA 3W64A 3BN7A 3MPVA 3QNWB 2W2MP 4IG0B 2WBRA 3CJTA 1NGDA 2MYFA 4GVEA 4JK7A 3OBYA 4JI3J 3I56N 4AHSA 2ZZMA 2LU1A 1C0UB 3ALYA 5A2QU 2AW0A 3D0GE 1JLEA 4EK2A 2MSSA 4ZVPB 1S1UA 1SQGA 3AO5A 2HHTA 3KG1A 3EGZA 5J1PA 1RT3B 3NGDA 3GE1A 3M6GA 5L1IA 3FZBA 4ES3A 4H5VA 2HYIB 3TAEA 1WAJA 3DDIA 4LF2A 3THWA 2Z8QA 2DR9A 3CCVN 3L0QA 1Q78A 2FLNA 3BKTA 4YOUA 1U09A 3UCUP 3A8YA 3Q2TC 3AA5X 3T69A 4ENOA 3WNGA 4R79A 4CEFA 4KTZA 1KQSM 2DPIA 1SS6A 4A8OA 4B02A 1U04A 4X62K 1W26A 1RT4B 1OJ4A 4WP8A 3J7Z5 1Y64A 2YWEA 4ZVEA 2RUGA 4F3OA 5F41A 5GINA 4M3XA 1WSIA 4CIGA 2WHOA 1J5EJ 2CXEA 2CG4A 2DJWA 2WBMA 1WI6A 1JXEA 2QKKA 4DU1A 3SCKE 1V5VA 1VSKA 2D3OR 2HPUA 3ZZRA 2OP5A 4FVUA 3HM8A 2V63A 1MWKA 4J9QA 2M4MA 1WF0A 2XSJB 3BS9A 3V5RA 3KMQA 4YY3F 2XM3A 3RYLA 2BACA 1N34K 3PTWA 3U4LA 1DEJA 1D5AA 3DLKB 4CLFA 1VISA 1V4SA 3DXMB 4WBFA 5IT9Y 1T03A 4RU2A 3MCSA 4EZ6A 2B3TB 2Q43A 2RF2B 3PX0A 3MOJB 1S0MA 1Y97A 2W2PP 1NK9A 4JV2A 3QDKA 1KSPA 3C3LA 2L08A 2LEAA 4CNYA 3PX6A 3FSYA 4OJGA 3P49B 4TLRA 4B9SA 4UTGA 1FXLA 3AGRA 3TVYA 3CIPA 5HL7L 2CNNB 3ZCMA 4Y2CA 2UV8A 4P2XA 2O8BA 3HX9A 1R0AA 5DDOC 3L6QA 2VBXA 2GVZB 1FESA 2CQHA 2XMWA 4OYIA 3VVUA 4F25A 5GIOA 3R5GA 5K20B 3Q24A 3FZ2A 2J7KA 4WK1A 3R8YA 3LP2A 3FRZA 1RKIA 1IV0A 2RUSA 2RU3A 3HVRA 2J7UA 3T1AA 4DTXA 4OV6A 5LOQA 4JI0K 1XERA 1HNVB 1KNZA 2LP4A 4BGBA 4FLWA 5KT3A 4I6WA 1WC1A 4Z4EA 1GK8A 2ZH1A 4ECWA 4WFYA 1EQYA 1D4XA 2J6UA 2ZHBA 1M90T 4P9SA 1QDUB 3VQ7A 3B78A 4UQTA 4OKEA 4L72B 4LRCA 5LMNK 1I94F 2DHGA 4ZOSA 1H2UX 2CNOB 3AVLA 1F2HA 3KUGA 1Q86T 4K2JA 4ZTJA 4EFAC 2Y8YA 3J8AA 5F0WA 2EK1A 3CMQA 2KFNA 4DQIA 4KGKA 1NPPA 4FZVA 1YTUA 1R8CA 3PHEA 3W66A 2XB2D 1M5HA 2B5JA 2AV5A 3M8PB 1WG4A 4FXWA 1W25A 2P2CB 4RPFA 2DITA 4DN9A 3OYJA 1JNRB 3NAHA 3PJ9A 2XZTB 5AJ3F 3MXJA 3O4QA 3TI0A 1Q53A 3AVAA 3SXLA 5BPNA 3OYBA 3CTRA 3BBFA 4DX8H 4DBQA 4I64A 4X2BA 4E1JA 2NZCA 2E9ZA 2FLOA 5AJ3J 3A8IA 5KPTA 4LFAK 3BZKA 4JKGB 1ZM2A 1UOCA 1HKCA 3SIPB 2BKPA 2DNLA 2VHGA 2WONB 4CJWA 4J2EA 3KOAA 2FD2A 4O5FA 2XTJP 2IVMA 2W9CB 4FL9A 4K42A 1U2CA 1WHYA 3M1VB 4LR7A 4JV5F 4TYAA 1N5YB 5KFTA 3Q8UA 4V19X 1V4TA 2KHOA 4MIWA 2E4LA 4QPXA 2ZFHA 5AXMA 3NBPB 2F1FA 3DLHA 4LF8F 1TL3B 2J8SA 1PILA 4BRLA 2YHXA 1FX2A 1JWWA 2HHPA 4JUZA 2XRIA 3UKUA 1MMNA 4HHJA 4LF9F 2VPYB 1QZ6A 4B8AB 4NLDA 4LF8J 4I1TA 3ISND 1RYRA 4RW6A 4XTTA 1VQ6S 4USMA 1KRPA 3G2XA 1ZM4A 4NPOA 3FZMA 2I5JA 2ZH7A 4IJNA 2XG8A 3D2FA 3KJQB 1RI7A 4F4KA 2AEJA 3MM9B 1B99A 1JLGB 4UZBA 2E2OA 4J9PA 4NZ6A 1WSJA 1RBOB 3RB6A 3I8DA 2F3JA 4Q44A 4CLYA 1FWKA 5AQVA 1EP4B 4JD2A 4ZP9A 1LK5A 3MMJA 3R97A 2UXCK 1NOZA 1FDBA 4N76A 1C0TA 3RGIA 1NB7A 1CZAN 3VVTA 2JFDA 1UZHA 1YJWS 4JI5F 2HAFA 2CWKA 4AE5A 4FF1A 1B7YB 4E98A 1FA0A 1FT8A 2B0GA 1GOBA 4QR1A 2CJXB 1I39A 1R6VA 3T5HA 4IOCL 3QERA 4WK3A 3PO4A 2Q0RA 4ILRA 1CQMA 3D1OA 3SBTA 2VKZG 1EHWA 4DV6F 3F56A 4G9ZA 4DUZJ 1JLAA 3VR1A 5JVHL 2RRAA 1U8WA 2BKOA 4Z37A 3OYMA 1MG7A 1KVKA 4KKOA 1DTTB 3G6XA 4X65F 4DV6J 2QG9B 3VAHA 4GO7X 2ZNZA 1DKGD 2KXFA 1XMOF 1X5TA 3I31A 2MGZA 4P6QA 4ILMA 2G8FA 1YKWA 4X65J 4O0NA 4FWOA 1CZBA 3CJRA 3N6LA 1XMOJ 2MKHA 3US5A 4FJIA 2VPZB 3CJ2A 4ZJQA 1FKOA 4J9MA 2DR8A 2QA1A 1QQMA 4BG9A 1ZPWX 2CVEA 4W98A 3T1HJ 1KQFB 4GO5X 3RU0A 2WW8A 3GFHA 1CBKA 3QJPA 2VG7B 4JI8K 3ILIA 3TUPA 4I7FB 1RT5A 1K9MO 2M8DB 5KPZA 1QTMA 4CT8A 2VF3A 4PXCA 4E7KA 1P1TA 4XDCA 4DR3K 4N5SA 4Z7CA 5M1OA 1WSGA 5G0RA 3L2VA 1NJIO 4IG0A 2HZAA 2GMHA 5E3AA 1S7IA 5BRFA 4EAHD 3EGWB 1S22A 1KDNA 2DIUA 4O0IA 3K9KA 3D54A 1BDGA 1M0SA 1U1LA 3G86A 4Y00A 4CJSA 3SQGB 1A6LA 2J0QD 4CZKA 3IC1A 3GBTA 4FK2A 4KV8B 4AHVA 3J7YU 3P1GA 2VA3A 4DJBA 2PZSA 2DKOB 1VCTA 1QS4A 5LMUK 4N41A 4DV2K 4LSLB 3R9PA 4M94A 2V51B 3GCXP 2OZSA 1S0VA 3OUYB 3EM1A 3S8SA 3HK2A 5TKYA 3A5LC 4B08A 1PYSB 1RXOB 2BUPA 2OTJS 5M1PA 2LQ8A 5DM7Q 3P39A 3RB0A 4ZLPA 3OL9A 4OL8A 2V8PA 3SQOP 4DCPB 4C0HA 4XH1A 1PAEX 3OTBA 3UR3C 3BKFA 2IPOB 3ZTQA 8RUCA 5L1KA 2XCPA 1F5CA 3ZT4A 4GKKK 2Q3SA 1YJNN 4FZXC 3MK6A 1FXRA 2EI5A 2E5HA 3OXGA 4B3OA 1LWEA 1J9AA 2QO3A 2EVZA 3ZETB 2PA3A 1K8AT 2IRXA 3LUYA 2PI5A 4M5DB 4PABA 1BQMA 1UVKA 4BR9A 3R5DA 2O8FA 3T3FA 3TA2A 2HW3A 1TVRA 4C3KA 4RW7A 1VSJA 2QW9A 4J5OA 2B7BB 1FKAF 2ASPA 3T19A 4HTUA 4LF6F 2M7SA 1HNXK 3CD6S 2UV8G 3D6MB 3LWLA 5IWAF 1X3NA 2ZWOA 1D09B 3IBCB 4LF6J 5I9EB 1VQON 3QEIA 1F0XA 2J9CA 4K8ZA 4A48A 1OKJA 2FY8A 2QGFB 4CECA 1JJ4A 3MN5A 2CGLA 3QT6A 1YXQA 4BY9C 2MZJA 1KBRA 2P9SB 2D69A 5DRKA 2CQ3A 3AVCA 4A59A 5CR4A 4JEPA 5KGWA 3JSMA 2C2RA 2FVSA 5DDQC 1T9VA 5DM6L 2K7KA 4PXDA 2V4QA 4R5PB 1VK8A 5A2QO 2R7QA 1S1TA 3G8QA 4ECQA 2R8KA 1RGVA 2KT5A 4Z4CA 3CJBA 2B51A 3EJMA 4DR5J 4IOBA 1ZETA 3HFVA 3ZSVA 2DBBA 1UEVA 3L7OA 4FF3A 1HQUB 3F9MA 3CM5A 3I9ZA 4USIA 4X4UA 3OVAA 3QGIA 2AP6A 2WTFA 2DXFA 1Y5LB 4AXIA 4CO2A 3Q23A 3TWZA 3F2KA 2G8VA 2HFUA 1RTJB 3KXDA 2BJ3A 3Q8VA 4F26A 5IM0A 3FBEA 4WFAQ 2CJBA 3SJJA 1WG1A 1AXQA 3BF3A 3ZTRA 1S3XA 4RNMA 1RSCA 3M32B 3AA4A 3B82A 3TR8A 1U25A 1WOSA 3JQJA 3WNEA 4CJRA 2UXBK 1M1KT 1JCEA 3FQLA 3PDNA 1RT2B 5EX0A 3ID8A 2NRZA 3GFZA 3PR4A 4RW9A 5A8KB 5T14A 1WEZA 4M41A 3LM9A 3PYFA 5IV4A 3O5TB 1XK8A 2O8CA 1HYZA 1XI1A 4FLYA 2LXFA 3SDEA 1F3FA 1XC3A 1RT7A 3G82B 1UEUA 3LF0A 2XMMA 4JI6J 1TYQB 1KTVA 4HUGA 2BANA 4BRCA 1FKPB 2UUBK 4BR0A 1RHKB 2FY1A 1WNSA 2XMKA 2Q0UA 3G71S 2W2OP 2QYCA 3IAM9 2EG1A 2QT7A 1URNA 3S01A 5ETLA 1E3MA 3NNAA 4GMKA 4KH4A 3DRXA 2A5XA 1FWLA 1GH8A 3LDOA 2C2KB 3ADAC 3EVWA 1AFJA 1NWKA 2XO6A 3F5TA 3LDQA 1K1QA 1IM4A 2KKHA 3QESA 3NGTA 4CJLA 1X9WA 4A8QA 3OA9A 3CDBA 2JEGA 2E2PA 3HHNB 2HBKA 4P2MA 4WF9Q 4YDUA 1TUVA 4MFBB 2F9DA 2W9CA 3PRBA 2LEBA 4O3PA 4E2FB 2CQBA 3TTDA 4DR4K 5DZ7A 1NGAA 3UE5A 5ITHA 3TR5A 2FZCB 2J9EA 4ZITA 1NGCA 1NH7A 5DZ6A 2P9PB 1NKBA 1RAOA 1KVBA 2QFJA 1FRJA 1ZAVA 1C1BB 4KC5A 3THPA 1VQ9S 4MO5A 1TL3A 1U0HA 2MZRA 3EYZA 1FRIA 1RAAB 1JJ2M 4OPKA 4NYNA 4N7TA 1HA1A 3FEXB 3ASMA 5KPRA 1NJWA 3H6EA 4A8XA 2PD1A 4MIAA 2IJNA 3TAGA 5HLFA 5A8RB 3CCTA 2F65A 1KKHA 2YNGA 4DUYF 2VFTA 1S79A 4X64F 1LW2B 1S49A 3L2UA 2P9UB 4WFNQ 1L3VA 1YWXA 3OYLA 1AZSB 5HSPA 3NGZA 4WYWA 2EC0A 2XMAA 4ES1A 3G8TA 4X64J 1RLCL 2AU0A 5HAOA 2XZWA 1JLGA 4CRJA 3WXIA 1FDDA 1TP7A 4DR2K 4HHTA 4CO5A 4CT9A 1X4GA 3H5XA 1WAFA 3AO3A 4K4SA 3MD1A 3LOUA 1PJ5A 2PMWA 4WE1A 1YK9A 2KLAA 5ETPA 2QX0A 4ES2A 4KFBA 3H98A 4WXOA 2QIFA 2WZ1A 3L7PA 2MZQA 4O0JA 5BN9A 1UMJA 3WUHA 1XNRK 5FD1A 5LJ3Y 4ISEA 4G65A 2ACYA 2R2TA 1E6VA 2JVRA 1XN9A 1N8RO 4BE0A 3A4TA 1X60A 1BA1A 2WBNA 4IR9A 1RWXB 4MK8A 1BXNA 2E5LJ 1OY9A 1UA0A 3M30B 3RBXA 1B3TA 2H5JB 3UIQA 4Z94A 1YI2S 2I7PA 5F3ZA 2GQCA 2WB4A 2DHXA 3SAHA 1X9JA 3A12A 3BV8A 3OT9A 1HPMA 1V5IB 5HANA 3N5BA 2BUNA 2P5OA 1VFJA 4NO7A 5KFJA 3HSDA 1VC5A 1T3NA 3A5NC 3NOGA 4DV1F 1WNEA 2X1FA 4U7UK 3OD2A 4BRPA 2YKNA 2A1BA 2KRRA 3HHKA 1F9FA 4RL1A 3PACA 3I5AA 2JEIA 2UUAK 3EPGA 4NCGA 1MWYA 4KR0B 3M8ZA 3I56S 4WQ4C 4DV1J 5JMVA 1RDWX 3KUHA 2ZE2A 4HVJA 2EHGA 2VG7A 4TXSA 1SKWA 4I7FA 3DXKA 5JS2A 2LMIA 3CDUA 4ID1A 4OYOA 4NMLA 1DBDA 2YPZA 3CCVS 1SH3A 1RHRB 3RJMB 1MNEA 3LPUA 3O1BA 2K1RB 3QB0A 2GWKA 1RTDA 1SL0A 1RAFB 2R7UA 2A6AA 4Q0BB 1KR4A 3CETA 4WWSA 3MPUB 1VSLA 2QLWA 1J6ZA 4KI4A 3QFWA 5AQFA 3FK4A 4PKDB 1WTBA 4DLGA 5HOOA 3BDEA 3G6VA 3PEJA 4KHYA 4DQ8A 1RCXB 2R7YA 2HSEB 4CF1A 3KDOA 4KHWA 4YOEA 4KV8A 1CXQA 1HL6A 2PBDA 3IWNC 4B3TK 3FZHA 1IH7A 5KI6A 3V9XA 4PUOB 3S1TA 1OMSA 1BU6O 1X5SA 3OUYA 4I0WA 1VQSA 4QIEA 3PR5B 3N4PA 4CF8A 2C2EA 1CZ9A 1HARA 3HZGA 1TELA 2GZOA 3THXA 5KFWA 1C1AA 1WHVA 3D3BJ 5E2QA 2C1EB 4F4ZA 3D6RA 2BRKA 4RBUA 2QEXN 2FJAB 2N7CA 1FNMA 1FTRA 1EKEA 4ED5A 2R8GA 4KBOA 4JP8A 4Q2LA 1R8HA 4O3NA 5LJ5Y 4I2QA 3ZZPA 1FW6A 3MPYA 2P9IB 5I3UB 3OFEA 2DNYA 4M5DA 4M5KA 3MMBA 4DV4K 1QTNB 2UP1A 3OS0A 1JK9B 3BBBA 2NRVA 1VQNN 3JQKA 4TVAB 3UCGA 4DV5K 1FI4A 1KP6A 3MTKA 3M9NB 5JVGL 2WW4A 4KY3A 4BHQA 4LRAA 4BC3A 3OV7A 1S9EB 2MJUA 1XMQF 3BSCA 3Q86A 2B4PA 1U1PA 4ZPWR 3GJTB 2FC9A 1XMQJ 2BJDA 1HR0F 4OX9K 4CZLA 2LFVA 1YJ9N 5EX5A 2CADA 3GYNA 1TV6B 4F2SA 1M1HA 2XMVA 4M63A 2V67A 4OZ3A 2KRBA 3OTOF 1R0CB 4DR6F 3V6DA 1RWPB 2L41A 3TQEA 4OKJA 2K8GA 5JMNA 1IR2A 1N48A 1VSMA 2YV0X 4IOXA 3HDSA 5AQLA 1RAJA 3HHLB 2AP1A 3NWRA 4F4XA 3OTOJ 4IDHA 2WOMB 3PZPA 4DR6J 1ICEB 4OMFG 5JXSA 3O2IA 1SB6A 2D5RA 3DC2A 3O08A 4AYBD 4L73A 5LT5A 1S48A 3DRSA 1ZA2B 3DDNA 4XDDA 2G0CA 3NF8A 2RB7A 4BE2A 2YHAA 4B3RF 3MR2A 1KC8O 5AR0A 3TEHB 2W9BB 2R7WA 4X66F 4HEA9 1NM1A 4CZJA 3J7AN 3ZTPA 3OPKA 4AH9A 3VQBA 1CULB 3MXIA 2XS5A 1VYAA 3GR1A 5BR8F 2MTLA 2V8HA 3I4HX 1BHLA 3NGKA 2R8HA 1SJFA 2EFQA 4B3RJ 1RT1B 4ZCLA 2X6SA 4USHA 3LP0A 2VQEF 3QFUA 1NDKA 1WN7A 3TA0A 5C25B 2HVHA 4QR0A 5BR8J 5C42A 2DYAA 1GLBG 1UZDA 1IBMJ 4RUCA 4ED1A 2WSCC 4CLPA 1VHXA 4CEBA 5EY4A 4DSLA 4L8RB 2E1ZA 3D2WA 2F8TA 5HL7Q 2DGOA 3M5RA 2FHJA 1GXTA 5D0HA 4EBEA 4O44B 2AWZA 1T94A 3NE6A 3IRXA 3HD2A 5L9NA 3CCWA 3BN4A 1OH7A 2Y1RI 3E01B 2ZHAA 4AM7A 3NMUA 2ZM6F 2DRAA 3DGPB 3CMAS 5J1EB 4DXLA 4YFUA 4OPAA 4LF4F 3T6BA 1RDCA 3P5JA 4OYWA 4X4SA 2ZVSA 1OY8A 1RWOB 4QPTA 5I42B 3T41A 4AQYK 1JLQB 2HWTA 4J2DA 2UU9F 1YTAA 4F8RA 5KQDA 4LRDA 3I82A 2E5IA 2HZCA 4K4TA 2D3O1 5BRHA 4L76A 4JI2J 1BI4A 1L3KA 1H7WA 4IXCA 4I9LA 3RB4A 2DFFA 5AZJB 4ZJLA 4RW8A 1XHZA 2HBLA 3CI5A 5AQYA 4BRAA 1XNQJ 5L1LA 4NI2B 1HNZF 3DRRB 3FGVA 5J2QA 2RRNA 4DS5A 1R6YA 4K4WA 3NG8A 3H08A 3QRRA 4BS2A 2V6AA 4R8UB 2GBZA 3IO1A 3GV5B 1EB0A 4ZP8A 1H1VA 1FJ7A 3JQMA 1GXUA 3FZFA 1S9GA 2HMPA 5CYQA 2YI1A 1N36F 2VOPA 1VQMN 4DL3A 2VODA 5AQQA 3OFFA 2FVPA 2F4VK 4DB3A 3PM9A 3NH1A 4N8OA 4ZVHA 4FK4A 2DPJA 3QMLA 3CSKA 3HVAA 1M5KC 1W2BM 2ZGYA 4DTRA 4GKJK 2VZ9A 5KT2A 4E3SA 1FJGK 1ZA1B 2GMJA 4DV0J 4A8MP 5AQUA 4A2BA 2GEMA 1TMMA 2E29A 3K0SA 3MM7B 5MAOA 1NO8A 2J6SA 1XR7A 3TANA 1YRXA 2GX9A 4AL6A 1Q5YA 3TPQA 1GMUA 4G6VB 5T7LB 4F2RA 4LF5J 3A5OC 1FNXH 1I1GA 5A8RA 3WXMB 4PR6A 1PYTA 2RILA 1BA0A 4OI1A 3OYGA 3GJSB 1T9YA 3M8WA 1JJHA 4HUEA 5IFMA 3CIZA 5GADP 4OHWA 4OYXA 2P9UA 1IG9A 3NDKA 2HVEA 1RU2A 2BRLA 3G10A 2XSFA 1JLCA 3GYXB 3CMEN 2M88A 3OYNA 3LP1A 1YBUA 3AA2A 4DQRA 2VA2A 4PWUA 5HRPA 2Y1LB 1Q4RA 4P71A 3V4MA 3KG0A 2Q36A 4PWDA 2ZGZA 4NASA 1REVB 3DOMB 2BW7A 2GAHC 3C14B 2R7TA 2NZTA 2QZ8A 3SK3A 1RHMB 1YRUA 3ZZYA 3DJCA 1VHFA 1IBKF 2DNKA 2J0WA 3MMCB 1VQ5N 1UWBB 2G2ZA 3P45B 2AKWB 2DCLA 4CHOA 5KOWA 2IRUA 2V68A 4GV6A 3UN2A 3I0RA 4NEZA 3WEEA 1IBKJ 2HHHK 1N5TA 4C3LA 4WZMA 1RBUA 3CC2N 3SV4A 1A5WA 4LF1A 1SVDA 4IOAQ 4G1IA 3POTB 2Q1NA 3LZIA 3AA3A 1PAUB 3NHGA 4RW4A 1ZBSA 4FNHA 3CC4N 4NXNF 4MK9A 2HNZB 4Y6IA 4B1WB 3JYTA 1UEKA 2G9OA 1VK0A 5J2PA 2BTFA 3M3ZA 2NRWA 5M1NA 3ZC4A 1FTCA 3VAJA 3AVFA 1NJZA 2E44A 1I3AA 5F0UA 2IYIA 3CQYA 2JWKA 3B4DA 2AA4A 3MEDB 4UOCA 3VGLA 1SQEA 2ZD1B 5B0CA 2CZ4A 4MLEA 3DMJA 4OZ1A 5M2PA 2DGSA 5E3QA 5FDLA 3R1LA 3KLHA 1ZOTA 1U26A 3DOLA 1YHQN 4CO1A 2CH6A 4HH1A 3NLCA 2DH9A 4Q0BA 2LCWA 3UB5A 2C2MB 4PG6A 4DZ6A 5G4DA 3OW2R 5HMYA 4OGEA 1OSCA 4M42A 3GSIA 3TSPA 1K9MT 2MQ8A 5EX3A 3PSIA 4WU3A 4IBNA 2K3KA 4NEYA 1Y3JA 3IKMA 3SSRA 4CEZA 3VQQA 1JKHA 4FWRA 5KG2A 3CJKA 3C65A 3KLVA 3THYB 1YJNS 5L38A 2A42A 2HOEA 1CPZA 2GHVC 5CAAA 1U2VB 3BPSP 3LAMA 3KK3B 2OKQA 4CGHA 1VAZA 5HN0A 2YY3A 1Q8KA 3W7BA 1IKYA 3HSJA 4C8KA 3VQEA 3AD9C 2IIHA 2F8SA 3T5JA 1QVGR 1HHSA 2MQNA 1VRUA 1Q7YO 4OI0A 2V9WA 3R3TA 1C1CA 4IWVA 1T7PA 2JX2A 4QU6A 4I6MA 1IVZA 4Q2MA 2QWNA 2YKMB 3QSYB 4C1NK 1ZM3A 2RS8A 5BPLA 4FKXA 4JI7F 1F2GA 3MCPA 5GAHI 1SJ4P 4DN0A 2UXDJ 2IVPA 4DL4A 1ZC6A 4YB5A 1R8PA 5I3UA 1VQOS 4J2BA 3IXQA 4OIXA 1WSFA 3MF5A 2ZOFA 2HHXA 2JDJA 5IXUA 5CA5A 1TK0A 3MXMA 1RACB 3MAHA 4JI4F 4M5IA 1VRQC 1EARA 4ECSA 2W7OA 1UTAA 3RMDA 4HKQA 5T7BA 2VOOA 1VSFA 3V9WA 2ROEA 4UY8O 7FD1A 2X3DA 4S0MA 3ZSQA 1LW0A 2Z30B 2E9RX 5M1KA 4JYAJ 4ZMMA 2JHEA 2OHDA 1F21A 2LXIA 3UDVA 2YNFB 2VD3A 3FCWA 5AZIA 4K5SA 4DMZA 4GRSA 1D3WA 2XNRA 4J9NA 2HLTA 5AE1A 5A8WA 4O8KA 3BM7A 2YKAA 4J37A 2E1CA 3VOVA 2AGPA 2DXEA 2FF3B 3OTEA 4ZVOB 3CPWR 4O3OA 2B6AB 1RGIA 3HHLA 3VF6A 2VGMA 4DV7K 3VTIA 5CD4H 4K59A 4DTNA 3CO9A 4DHVA 1WC0A 1KLMB 2EFOA 2FGCA 5ELZA 3MGJA 4EZ9A 2XYHB 3MECA 1VSIA 3F0NA 3SAGA 4CHPA 4FJMA 1NK7A 3PKMA 4DR1K 3EKSA 2C3PA 3TU5A 3VF0B 1OQ6A 3UO0A 4YOXA 4CEEA 3TAMA 4FYYB 4KGXB 4DX6A 2Q3PA 2F9WA 2PFFB 2FBXA 1XHXA 4WFBL 2AIRB 2M2BA 5DS7A 5LJWA 2DO0A 3VQ8A 1YT3A 1R0BG 4PYDA 3M2VA 3A2FA 2B7CB 4IKAA 1RT1A 1CJTB 2AJ1A 4GVBB 4UOHA 5B0DA 2HVDA 4CJ7A 4E19A 3NOCA 3QT8A 1U48A 5C25A 4I56A 2N3LA 4UT4A 5HQMA 3RZAA 3SFUA 2E5JA 2HRUA 5EOYA 3ZT0A 2ASYA 2OPSA 3JB9k 3SUNA 2BGGA 4QYZJ 4ANCA 3O9UA 1RP5A 4AL5A 4LR9A 3PUFA 1REGX 4RUHA 1NK6A 4FDFA 3O9TA 3CE8A 1C2PA 1VQKN 1DQAA 4XAKA 4ZLLA 3KHRA 3B4MA 3E01A 5DM6Q 1IBLF 5M1QA 1X0PA 2GUPA 3V4IB 1KQKA 2P6TA 3DRPB 2GV9A 4RNFA 4A5BA 2LKZA 5KAKA 4W5OA 1HMVA 1HNWF 1GX6A 4NA3A 2AT1B 1RYSA 3CJ5A 1LEOA 4PG7A 5I42A 4JRQA 4IR1A 2HGLA 1FVQA 1HKBA 1RQ0A 4USTA 2KHCA 4K4XA 1SC6A 1IKWB 3IS9B 4QYRA 3KLGB 3ZSXA 2CQCA 3EPIA 1HNWJ 3EE8A 1R59O 4CFAA 2HIYA 2ZH8A 2PE8A 1Y00A 5KGXA 2GVDB 1H7XA 3QEVA 5D3GB 3O6QA 1AROP 1HBUB 3IG1B 1DT9A 4WP3A 1EWQA 2XS2A 2FHOB 4YOVA 1TU0B 1VRTB 4KH1B 2LXUA 4NA1A 1V3ZA 2QLJB 3AT1B 4F3QA 3HVTB 3DU5A 4NLQA 3GG0A 3KK1A 4IQMA 1UAXA 3MEKA 4H4KA 2AJ4A 2F7TA 3LL3A 4LUBA 1S1VA 1LNQA 4JI0F 1YJUA 3RAQA 3SUPA 5KFAA 2BQ3A 4DSKA 4ED0A 1B7FA 3VGVA 2H5EA 3ENBA 4F4YA 4JI0J 2EBGA 1ZM9A 3P6YC 2BE7D 1JLFA 5F3TA 2YVSA 4C8ZA 2DVIA 3GE9A 1DAXA 1T9WA 4JBCA 5KFQA 1PC5A 4LF7F 3ENVA 4FJXA 3A8KA 5AQWA 1IUJA 5D4NA 2MLZA 4NCBA 1N54B 1QVFM 1S1XB 5LMNJ 1A0OB 3QJLA 4ZPVR 3W62A 3QETA 3L4IA 4U7CA 1YJRA 4JS4A 2R7OA 2U1AA 1R3NA 1WF1A 3NAEA 4AHRA 3AVKA 1NU0A 4PG8A 4WP9A 3CNQP 4KHPF 1APSA 4LVOP 4ECVA 3O3LA 2JC1A 2NXJA 2LDYA 4PXEA 1YX2A 2F8HA 5D4PA 2IC3B 1ACMB 4HI1A 4KHPJ 2KI2A 1EETA 3T1YF 4KH5A 3PW4A 3C14A 4YHHK 4FVCA 4ID5A 2G4BA 2H3GX 3C6TB 3L7UA 3MMCA 4TY9A 2N82B 4CZHA 4OLPA 3H5YA 4F50A 3OYIA 4DLEA 1A7GE 4M3WA 4A47A 2M52A 2EXUA 2AJFE 5EXWA 2DH7A 5IT0A 3RMAA 4NCAA 3CF5L 2HBMA 4J9UE 2GQQA 4U96A 4IZ9A 3C6UA 2FHKA 2UVRA 3AAQA 4LBHA 3RBDA 1IO2A 3E51A 3CCQN 3R6MA 3TEGA 2UVWA 5KFYA 2HS3A 3VGMA 1P9QC 3KK7A 1O8BA 2OMLA 2ZJPQ 1NSAA 4K0KF 4RBVA 1NK0A 2R7VA 4JI3K 2HFNA 4CIOA 4CW7B 2R7SA 2X1BA 1S9FA 3VZIA 3EKUA 1CJKB 2XI3A 1UVMA 4BREA 1BD6A 3QBCA 3DLEA 4K0KJ 1HBNA 3MMAA 1FFWB 2Z2ZA 3ULEB 4NLWA 3J7AP 1WELA 1VQ6N 2EKNA 3SQ2A 5GVQA 3HL8A 3LPEA 1KAXA 3M2RB 1NU4A 4OHXA 3I9V9 1CG2A 3QIDA 2OTLS 3KHHA 5D0RA 4FSVA 1YF5L 2KYZA 3VERA 1D0EA 1SJRA 1AB8A 3J7A1 5JLHA 5KT7A 3QBWA 2ZH4A 4RU9A 1YLXA 4QIVA 5D8HB 4H5RA 4WCEL 2LA4A 5AXNA 3B6BA 2Y0SD 2VJVA 3F41A 3N0VA 5KFLA 3MM5A 3LA0A 4E1NA 2OIHA 1S1WB 3LO3A 4FOEA 4L3QA 3K2PA 2DY1A 3KVGA 1ZTWA 3R5AA 5KG5A 3MDQA 3L4QA 4DV3K 4QWEA 4FW2A 3OYKA 2YXLA 4HTJA 2QEXS 3BQ1A 2UVVA 4DL0C 1JCFA 2PFDA 3SQ1A 1NAQA 4YY3K 1B0VA 1V3SA 3THYA 4FJ8A 1MMLA 1QQCA 3ULDA 2KVIA 3HT3A 4M5LA 3BJYA 4EO8A 3OXFA 2B56A 3LDLA 1RHUB 3UNGC 3FC9A 3VAGA 3W9IA 3U9DA 5CQGA 2DPNA 3PIPL 2CPEA 1Y9OA 1PC4A 1U2RA 2F9JA 4BRQA 4FZYA 1VC0A 5ADXA 3BPDA 3QZ7A 3VEVA 5E3RA 4ZLNA 1BO5O 2P6SA 2V4RA 2IM0A 4WQ5C 4N56A 4FBTA 4F7VA 1R43A 2IIRA 3CCJN 3VWSA 2JOQA 2LQ9A 2IA6A 1HWLA 1S1UB 3C16A 1NGFA 4DI6A 4FWLA 3DDKA 2O3DA 3GV8B 5K8PA 4QZVB 5GAEP 1RWVB 4NOHA 1YJ9S 3THWB 2ZDPA 4WIQA 3H59A 4CF9A 4QU7A 4CO0A 1BCOA 2QWPA 1YITN 5JUMA 4USKA 3OR1A 1Q9XA 3MFIA 4NB4A 1RBLA 6FDRA 2AD9A 5EHHA 1HWKA 1MWMA 2ZNYA 5HRSA 3EGNA 2JL9A 1HUXA 1F5BA 4H54A 4CZMA 5DJBA 2HS4A 1JMTA 2HQDA 3N5FA 4GVLA 4JI8J 2KO1A 2FBYA 2HQCA 3GV7B 1RA6A 1QE1A 3T5LA 2YNFA 3VCDA 3BGRA 3DCAA 3BGLA 3M2UA 2HSTA 4ZP6A 2AZ1A 4DR3J 3TP2A 3EZWA 2VJUA 4M5MA 3DLBA 1HI8A 1JL2A 2LECA 4A8KA 3I32A 4O3RA 3IAS9 2HHSA 2E20A 2D74B 2W24A 1RDRA 2B6AA 3RW7A 2H48B 4B3MF 2OFGX 4OHZA 3CERA 1I94K 2OTJN 1QJHA 1HQEA 3BR8A 1OVQA 4O4RA 4G3IA 2AEMA 1Z4UA 4KYZA 2VBZA 3KD5E 3QFHA 3ZX3A 2DGTA 3DGVA 5LMUJ 4DV2J 3LQVA 1UVLA 5HRNA 3EICA 3EMTA 4IFVA 5JVGQ 1OH6A 2QMXA 1U49A 2G13A 3AVGA 4RLEA 1DY3A 4ED7A 2DTJA 3QRQA 4KB0A 1BWEA 2YNHA 3EDRB 1XR6A 2CQ4A 2O8BB 4I2PB 1KCFA 1R0AB 3QT7A 4YDXA 3CFPA 1WC4A 4ZVTB 4TQRA 5J2MB 4K25A 1GTEA 2WVBA 3TW0A 4KIAA 2RHKA 2M3DA 4KI6A 3SCIE 1UJ4A 1U1OA 2F8MA 2HBZB 5IQ6A 5C7PA 3LP2B 3AXMA 4C8YA 3L9ZA 1TK8A 4MQ3A 4LIRA 2YQ1A 1HQ2A 2E6LA 1LWFA 2CVIA 2L3MA 3D45A 4KO0A 4ITSA 1X4AA 2IJRA 1QSSA 3D7SB 3VEYA 4CO4A 5AQOA 3HBTA 1VOMA 4CF0A 1FF2A 3DRPA 4DCHA 1RBRA 1YIJN 1BGXT 1LXJA 1XIQA 2KJVA 2O8DA 5GAGI 5KFEA 2AQ4A 5FPDA 4CYUB 3A8EA 4JV5K 2DR6A 2HQFA 3GIMA 2BV3A 3NGUA 2HGNA 2NR0A 4NRTA 4ZN1A 1LWCA 1FCAA 1W97L 3AVNA 3DN9A 3QEWA 3WQTA 4LF8K 2E2NA 2HHUA 4KJIA 3F9KA 3A0IX 1N33F 3V9ZA 1ILYA 3MR3A 1IXKA 5HQLA 3U3YA 1NK4A 2UUCF 3SNNA 5F9NA 4LF9K 4PG4A 1QQNA 5I3PA 4MIBA 3QZ8A 2IVFB 4ECTA 2RDDA 4USJC 1T6CA 2JLEA 1N33J 1K8KA 4IJAA 2MB0B 1BWFO 2BXJA 3WC2A 3FGUA 2P9LB 4CJQA 4C0BA 2JNJA 2B5JB 1Y7PA 3CCZA 3KKRA 2J7WA 1GTHA 3FDSA 2XS7A 3I8BA 2Y3YA 2GX8A 3MAAB 1F3VA 2A3JA 1RTHA 4QQBA 1TKXA 4A8FA 2OANA 1VLOA 5EGYA 1W0HA 3G6YA 4NA2A 1SV5A 3RR8A 2W2QP 4CLLA 2W6KA 4OFZA 2GO8A 4LQ3A 2MY8A 1SIZA