3I0RA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 3
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 146
structure length 545
sequence length 545
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0rA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0rA05
4CJRA 4MIBA 4DL3A 1I3AA 4ELTA 4KKOA 4ZPCA 4FLXA 4HYKA 3OYFA 2DFHA 2I5JA 2QXFA 3WNEA 4EP5A 5C42B 1IKYA 4RW4A 3ZSOA 1LWFB 3HK2A 3HJFA 4I2QB 2YNIB 3FFIA 2A1RA 1S1VB 4ELVA 4O3RA 5I3UA 3Q8PB 4O3SA 4RW9B 1BIUA 1KCFA 1S6PA 2ZE2B 3DI6A 3RTVA 4OL8A 2B43A 3QEVA 4DFJA 2J6UA 1T3NA 3MXJA 4CIEA 1L3TA 3IG1B 2Z1IA 2IAJA 1DTTB 4TQSA 2D5RA 1TV6B 2VG7A 4KBIA 4PWDB 4IRDA 2W42A 3G10A 3DLEA 3HVTB 4QWAA 3AVCA 4ECQA 4BE1A 2W9BB 3C6UA 2W9CB 3CWJA 1L3UA 1NJYA 1NHVA 1G15A 4ZTFA 3OYEA 1HQUB 4KHYA 2B5JA 4J9QA 4OLAA 3VA0A 3MEDA 5JXSA 1KRPA 5DQIA 2AX0A 4CF2A 4KSEB 2P5OA 3P83D 2E9ZA 2IM3A 3CVKA 3E01B 3E01A 5J2PA 2OPSB 4KV8B 3DOKA 4URQU 2C2RA 4CESA 3Q8SB 4R8UA 3TAEA 5F9NA 1REVA 1RTHA 4E3SA 4ECWA 3H4BA 2FBVA 4F2SA 4YFUA 1BQMA 1VSJA 3V1QA 1CLQA 5FDLA 4F4XA 3HPHA 2XI3A 1TQLA 4GC6A 4O44B 2FBXA 3OJUA 1LV5A 2FLNA 5FROA 1NJZA 1RTJB 2OZMA 4KO0A 1YT3A 3CDWA 2HWHA 4TY8A 2RDIA 3DRRB 3HYFA 3V9ZA 1N6QA 4E7KA 3SPYA 4KHWA 4FVMA 5KFTA 1RTJA 1BHLA 4E7JA 4H4OA 2HHSA 4M3UA 1FXXA 4IKAA 2DPJA 5HBMB 2XWYA 2YKNB 3KHHA 1HRHA 4ZP6A 4U6PA 1A5XA 1XR5A 2UVWA 4AHUA 2IMWP 4CJ3A 1JXBA 2KZZA 3T5LA 2C22A 1C0MA 1IKWB 1WSFA 3CJ4A 4ECTA 4IRCA 4MK7A 5KT6A 4DL6A 3ZCMA 3S3OA 3AVJA 2IAJB 3DLHA 1RYRA 2P1JA 4CECA 4CFCA 4URGA 3SQ4A 2FJWA 4RNOA 1ASVA 4DEZA 5KG5A 2DFFA 4M41A 4DLEA 3PW4A 4FLWA 4MKAA 3RMAA 1S9GB 1QSLA 3TVKA 3K5LA 1WSEA 1X1PA 3VQBA 1LAVA 4QW9A 4OPJA 3K58A 4Q0BA 4CJPA 3RWUA 1L3VA 3KTQA 4ELUA 3LANA 1RT5B 4FJHA 1C0UB 4EZ6A 1NK6A 2G8KA 3HO1A 2PYJA 1N4LA 4H8KA 2VG6B 4CF8A 3BGRB 1VSHA 2ZKUA 3AVIA 1BGXT 1QSSA 4NRUA 1ASUA 1C6VA 3GV8B 3KMQA 4CGJA 3LP2B 4QPXA 3KNAA 5C25B 3TAPA 4IFVB 1QS4A 3VQ8A 3O3HA 4DFKA 3AVAA 3OVNA 1S1VA 2R2UA 4TSXA 1QTMA 4I2QA 3TI0A 4CHPA 2B6AA 4O44A 1BIZA 4AILC 5CYMA 3TWHA 3NH1A 4ZPBA 3ZT0A 2RKIB 3KKRA 1TAQA 4FK4A 4DSFA 3UR0A 1RDCA 2E4LA 2WTFA 1KHWA 4Z4CA 2B4JA 4J2DA 4QWEA 3QEIA 1RBSA 1XR6A 3QGHA 1XWLA 4M3WA 4FBTA 1R0AA 4NLDA 3LP0A 1D5AA 4Z4IA 2GIQA 3V4IA 1RYSA 3QNOA 4DTJA 2ZD1B 3FFIB 1K1QA 4CCHA 3RB0A 2BQUA 3SV3A 3HKWA 3V1RA 3DYAA 5I42A 2IM1A 3N6MA 4CHYA 1TKZA 4TN2A 3MFHA 2VWKA 1QAJA 2YNGB 3HP9A 3QIPB 2OPRB 1SH3A 2HWIA 4FJ8A 2F8TA 3MEGB 3AO2A 1GX5A 1NK0A 3RBEA 3KHRA 2IGIA 3G6YA 3NKYA 4TXSA 1S1TA 4F4ZA 4RNNA 4KHUA 1NK8A 4FLUA 4FXDA 5J2NB 3N6NA 3DRRA 4CFAA 4B9UA 1IKXB 1IKXA 4Y1CA 3SI6A 1UWBB 1TGOA 5KFGA 2ASDA 3LP1A 4B3OA 5KT3A 4FJGA 4F3TA 4DQIA 5KG1A 5L9XA 4ICLA 1KTQA 1JLFA 2YNFB 2YHAA 4GC7A 4Z0UA 4O0IA 3EZ5A 4WFZA 4CF9A 4DU3A 1UAXA 1S10A 4BWMA 1JLAB 4F4KA 3KLHB 3GIJA 4DG1A 4KRFA 4I2PA 4KPYA 2B5JB 3PR4A 1VSDA 1J5OB 3CFRA 4I9QA 2PY5A 4W5QA 1Z26A 5CYQB 5CZ2A 3C6UB 3DM2B 1J54A 4M42A 2Z1GA 3RMCA 2X78A 1TP7A 3BREA 4TQRA 2IS3A 4BACA 1DTTA 4IG0B 3CG7A 3MTKA 2E6LA 1MU2B 3KLGA 5HRPA 2FLPA 4ECYA 4ECVA 3BQ2A 4JV2A 1S6PB 2ZE2A 3DI6B 4DQQA 3OS0A 4DS4A 3JYTA 5KFQA 1W0HA 3VQPA 1VRUA 4NLVA 4TYBA 4TY8B 2F8EX 4E7HA 4DTPA 1RT6B 2XY8A 4JUZA 2VG7B 3AVNA 2W9AA 3IS9A 4OGCA 3AV9A 2UUWA 3PW0A 2KW4A 3NL0A 2VG6A 5T7BA 4B9NA 5EU7A 3DDKA 3PJXA 2XC9A 4CHNA 5KFYA 4XIUA 4J9RA 3RR7A 3BSNA 4Q45A 2BGGA 3L8BA 5F8IA 4J2AA 3VN5A 4FM1A 3QYYA 2CJQA 2R8IA 5KFDA 4WFYA 1U45A 1S1XB 2G8WA 4CERA 5CZ1A 1WNEA 2C2DA 3HPGA 4PUOB 4U7CA 3CJ2A 5EDWA 1S97A 1JIHA 4J9LA 4M3YA 3DRPB 1RT6A 5CYQA 4Z4HA 1C0TB 4FJJA 2HNZB 3T5HA 1JLGB 1DLOB 4BE0A 3VQEA 3QZ8A 1C1CA 4NLUA 1S48A 1RT7A 3MEEA 1KVBA 3G86A 4KREA 1YTUA 1LWFA 4B9LA 1ITGA 2WONA 2DPIA 1KSPA 3B6OA 2FJXA 3A2FA 5KRSA 1VSEA 3ZSRA 3GIKA 2FJVA 1TKZB 4Y34A 1N5YB 1QAIA 2J6TA 4B8CA 4E89A 2R8JA 3CQ8A 4Y2AA 4IDKA 1C1BB 3AVKA 4OJRA 3ZT1A 4I2PB 4OKJA 4EZ9A 3NCIA 1FK9A 1HYVA 4Y2CA 1A5VA 1A5WA 4Q43A 4QWCA 4DFMA 4M94A 4W5TA 4CEAA 3DRPA 3CM6A 2J6SA 4YR2A 5KFMA 2HAIA 2HMIA 3M8SA 1EP4A 1KFDA 1ZETA 2WOMB 1Z4UA 3RR8A 1TAUA 4X2BA 3KK1A 4CF1A 4MK8A 3AVGA 2FBTA 4ZHRB 5KI6A 4RW7A 2F96A 4GMJB 4CGHA 1X9SA 2AQ4A 2FVPA 4I7FA 4E7LA 4M3XA 1W9HA 4RW8B 3IRXB 1JXEA 1JX4A 4R5PB 3SUPA 5KT5A 1HARA 4J2EA 3V9WA 3LZIA 3VQ5A 1QUVA 4HHTA 3SCXA 2HHWA 3OYLA 2BE2B 3KMSA 4N5SA 3DRSB 5KFKA 4DTNA 1K6YA 1HMVB 3H98A 1KVAA 3H5YA 1TL3B 5KRTA 4IQXA 4ECRA 2G8IA 4ZPAA 5C5JA 1S1UB 5J2QB 4TYAA 4ED0A 2O4IA 1NK5A 1YTAA 4NZ0A 4F4WA 3IGVA 2RF2A 4BDZA 4NLRA 2OH2A 3VQCA 2OPSA 2OPQB 4EEYA 1S4FA 1RBUA 1RT1B 1QE1B 1J9AA 3PY8A 1MU2A 3KLGB 4GW6A 4B9SA 3QEPA 3H59A 3CM5A 3BJYA 4PQUB 3V6DA 4KAZA 1N6QB 4FZZA 2RDJA 2GC8A 3HVRA 4JS5A 1EETA 1RDAA 2NUBA 4O4GA 5J2MB 4AHTA 4B08A 1U09A 5F8GA 2G8VA 4LSNA 4PUOA 1EP4B 3NBPB 3CJ0A 2IC3A 4XPCA 1DTQA 3QERA 4R0EA 3IAYA 2O5DA 1QQCA 5KFBA 3TR8A 4L8RB 4CHOA 4BE2A 3OJSA 4CEDA 2BRKA 4Q5VA 5E41A 4RUCA 4J9OA 2WB4A 3HM9A 3DMJB 2W7PA 1S9GA 3K2PA 5K14A 3EZUA 4I9LA 3NGIA 3CFOA 2I1RA 2HNDB 1D8YA 1TK8A 4CHZA 4PWDA 2XCAA 1Z25A 3CFPA 3ITHB 3IN5A 3T5KA 3UQSA 1C1BA 2IBKA 1S1XA 3UDLA 2IDOA 3HT3A 1SL0A 2BANA 4ECXA 4ZPDA 4H54A 3IGNA 1RILA 4NLWA 4URSA 3OY9A 4HCBA 1T8EA 2HMIB 1WSHA 1EKEA 4KTWA 3MFIA 3PW5A 3ZSYA 2P51A 3G6VA 3NAHA 1LWCA 5KG4A 4MFBB 3OS1A 2KTQA 3I5AA 4Y3CA 1JLEA 2ITGA 1HYSA 1CZBA 3WNGA 2JC0A 1TL1A 1BI4B 1S5JA 2VG5A 5HRSA 5DLGA 3F73A 3KLIA 1SH2A 5KFEA 3DYAB 4HVJA 3SUOA 3M8PB 2E6MA 3OS2A 1T94A 1EXQA 1ZBLA 3K5OA 3D28A 3GV7B 4RW9A 4FW1A 2AX1A 4KHSA 2FC0A 3SQ2A 3L3UA 1S9EA 3SQ1A 4ID5B 3WNFA 3THVA 1D0EA 3M8RA 1HNIB 2D3UA 3NMAA 1DTQB 4TLRA 2RPIA 4B9VA 4DMNA 4KTQA 4FYDA 4NCGB 1B9DA 4DU4A 4KKOB 1S1WA 5DLFA 3QZ7A 3RRHA 3OYGA 3FQLA 5C42A 2YNHB 3AVMA 2XGQA 4C8KA 2GBZA 1TKXB 3KHLA 3SNNA 4RUAA 1RBVA 3CDUA 2EHGA 3RMBA 4CJWA 4Z4FA 1RT3B 2X6SA 1Q8IA 3LWMA 3OYJA 1SUQA 3KD1E 3AA5X 3ZT2A 1RT1A 3NF9A 2JC1A 4R5PA 1NKBA 4C8MA 4LD0A 2G8HA 4FJ5A 3H4DA 1S1TB 4KFBA 2OPPA 3JSMB 3QO9B 4K50A 3HP6A 1T03A 3ZT4A 2G8UA 4LSNB 2P5GA 2W9BA 5L1LA 4CEZA 1Q9YA 5KFJA 3DLBA 4IRKA 3T3FA 5KFPA 3LPTA 4DFPA 2IJFA 2F8SA 4OKEA 1L3SA 5HLFA 4B3OB 5KG2A 3VA3A 1JLEB 5HBMA 4WZMA 3VQ9A 3AO4A 1C0UA 3O3FA 1LW2B 1U48A 4FJLA 3NF7A 3V1OA 4YR3A 2QKBA 5HROB 1C1CB 3KK3B 4RNMA 1HPZA 4FS1A 3NAEA 1WAFA 4FZYA 2WK4A 2V4QA 4IDKB 1WSGA 2YNIA 2IM2A 4YP3A 5KT2A 2W9CA 3EYZA 3PX0A 2BANB 2GUIA 3DLEB 3D45A 1HNVB 2JEFA 1S9FA 2ATLA 1VSIA 5KFVA 4CK3A 1S1UA 3ITHA 1RA7A 3ULDA 2IJNA 5D3GB 3CDEA 4CFBA 1WAJA 4K4XA 3B6PA 3KOAA 3OYCA 3EPGA 2ZD1A 4CEFA 3OYHA 1RBRA 3K59A 2BR0A 2Z1JA 1SKWA 2OZSA 1FKOA 1JLQB 1ZBUA 3SQ0A 3CYMA 4B9TA 3T19A 4K4SA 3QETA 4F50A 5JS2A 4W5NA 4ZHRA 4DL5A 5FDLB 4IKFA 4MKBA 2OPQA 4ZVEA 3KLIB 2D3ZA 2KZMA 3DOLB 3V6JA 3L2UA 5KT7A 4KE5A 1HYZA 3SUQA 4IG3B 1T7PA 1NNDA 5KFWA 3G6XA 2ASJA 1EETB 2FVSA 2R8GA 2YNGA 3NH2A 1JL1A 1BL3A 5J2NA 3HVAA 3KKSA 3HXMA 4XO0A 3G0ZA 3VQSA 1FKPA 3MXIA 2UVVA 4PQUA 4FLTA 2WRMA 4K8XA 3QGGA 3QLHA 1ZTWA 2IOCA 5DGAA 2BE2A 4DQPA 4DG1B 4BDYA 4CJ4A 5FRNA 1LAWA 2E9TA 4DQSA 5DMRA 4QWDA 3OSNA 3L2QA 1RBTA 5EWGA 3F9KA 3LAKA 4M3RA 2QE5A 2HNZA 5F8HA 4JRPA 3Q8QB 4K4UA 4J2BA 1U4BA 4FJMA 3H2LA 3SUNA 2ALZA 1Q9XA 1RCHA 1LWEB 4CJ5A 1XI1A 1D9FA 3NFAA 2QV6A 4RNFA 4FK2A 1C0TA 1VSKA 3GIMA 3MXMA 1JLAA 3LAMA 1YVFA 3RAQA 3U3GA 5L1IA 1FK9B 3MR6A 4NYNA 1TKDA 5HLFB 3BSCA 3MR2A 3C6TA 2BDPA 3LP2A 4E19A 2IC3B 1RT5A 3PX6A 1NOYA 4JS4A 4DU1A 3OL6A 3C6TB 3RMDA 3KK1B 3FSIA 4O3QA 4FM0A 4EBCA 4K4VA 2WOMA 2V4RA 3OYBA 3MECA 4FJ7A 4NLTA 2ILYA 4KB1A 2HHQA 3K57A 4HKQA 4Q44A 1LWCB 3NHGA 4WXWA 3V9UA 3MECB 4WE1B 4K4TA 5I3UB 2XGPA 3TARA 5DG7A 4J9SA 4B8AB 1NKEA 2VWJA 4DL4A 3TAQA 4CF0A 3T5JA 4KHNA 4NYZA 5L1JA 2OPRA 4E1NA 2ZQBA 3GV5B 3HVTA 3OLAA 3OLBA 1TVRB 4CJKA 2HHVA 4CJQA 4J9NA 3M8QA 1S6QB 1S6QA 3CJ3A 5EWFA 4O55A 4NCGA 1RT4B 1NJXA 2BQ3A 1RNHA 3H08A 3PHEA 4MFBA 3C94A 2W8LA 4JRQA 5F8LA 4LH5A 1F21A 3DLKB 5KGXA 4PY5A 3NE6A 1S0MA 3TANA 1HPZB 1RT3A 3S3NA 3QINA 1WN7A 4FJXA 4XPEA 4E0DA 5KT4A 3LP0B 4GVMA 3PW2A 2C2EA 1JLFB 2YNFA 1GOBA 3VQ6A 3QIPA 4RW8A 3MR5A 4JV0A 3AA4A 4ZP8A 4KHRA 2OPPB 4FZXC 3V9XA 5I42B 4M95A 1YVUA 4OKKA 1SL2A 4DL2A 4DF8A 3DLGA 3KLHA 2RKIA 3OHAA 4O5BA 4CE9A 4NLPA 1S9EB 4CEEA 4CJUA 5KFSA 5KFCA 3H40A 3TAMA 1NK9A 3RAXA 1FKOB 4DTSA 3TAFA 1J53A 5DG9A 3KLVA 1QE1A 4B9MA 3ICLA 3NBPA 5C25A 1D1UA 3K5NA 3LWLA 2CKWA 5DG8A 1TK5A 1N5YA 1X9WA 1LWEA 4WXOA 2FVCA 4HCCA 3AVBA 4K4ZA 3GYNA 2D0CA 4FW2A 1JKHB 5J2MA 3OYKA 5CYMB 3SZ2A 4C8NA 3OL7A 1HJRA 3V6DB 4CEQA 2YV0X 2Y1JA 4H4MB 2E9RX 3Q8RB 2HHUA 3SV4A 4TY9A 1CXUA 2UVUA 1EX4A 5KFHA 4IFYA 4IFYB 4DSJA 2DY4A 4NLOA 3ZSWA 4EO6A 5EWEA 3S3MA 4CK1A 4FS2A 2UVRA 4DTUA 2C28A 4ECZA 3ASMA 4J9MA 3OYDA 4KI4A 4N76A 1SKSA 3O3GA 1RA6A 2ATQA 4G3IA 3I0SB 5KFNA 3VQ4A 3DM2A 3BSAA 3KIOA 4CGIA 3QIOA 1TKTB 5L1KA 1RTHB 1BQNA 4K8ZA 1RT7B 3MEEB 5F8MA 1SL1A 3IG1A 1L5UA 4NLQA 3UPFA 1I6JA 2JGUA 2R2SA 5KFFA 3CO9A 1KHVA 5SWMA 2LSNA 2JEJA 4Q8EA 3SYZA 3IRXA 1U47A 1RT2B 3QGIA 3KK2A 3HHKA 2JEGA 4Z4GA 3K5MA 2YNHA 4NCBA 4QCLA 4LQ9A 1J5OA 2VG5B 3EPIA 4ECUA 2ASLA 1BCOA 4QOZB 4ZP7A 3GIIA 4FJ9A 1NJWA 2HVIA 1HYSB 3ZSVA 3PO5A 5HP1A 4KV8A 3H5UA 3HSTB 1XHXA 1GOAA 3WNHA 2R2TA 3V4IB 3AO3A 2PZSA 3RB4A 1IG9A 2YKMA 5FRMA 3I0RA 1T05A 4AHRA 1OS5A 2OA8A 2IM0A 1WNSA 3OYNA 4HUGA 2A1SA 4F8RA 2BQRA 1S1WB 5KFUA 4M45A 1HMVA 3H5XA 5KG7A 3PJWA 5KFLA 2HNYB 1O1WA 4KB7A 2AGPA 5C24A 3OYAA 2XHBA 2ETJA 4JLHA 3GILA 3CIZA 5DGBA 4FLYA 2KFZA 3SPZA 2JEIA 3KLEB 1JLCA 3D5MA 1QSYA 3TAMB 4F3OA 3KK3A 3RB3A 3UIQA 1VSLA 5HP1B 1IO2A 2EC0A 1CXQA 3FRZA 4ICLB 2R7YA 3KLFA 4KB0A 3LALA 5KG6A 1JKHA 1REVB 4J9PA 2RF2B 1RAJA 1LW0B 3V81B 5F8JA 1VRTA 4QAGA 3PV8A 3NAIA 3I5BA 4DTOA 2HW3A 5KG3A 3TAGA 4F2RA 3NDKA 4RW6B 5J1EA 4ED3A 4ED1A 1KLMB 1R0AB 2HB5A 2AGOA 1HNIA 4RW4B 3TABA 4AH9A 3MAQA 3KJVB 5HROA 5KFZA 3I8DA 1Y97A 3ISND 3I0SA 1LW2A 2AWZA 1BQNB 1TL1B 3CJ5A 1UOCA 4OPKA 3LP1B 1IKVA 4NLXA 2GIRA 4O3PA 3V6KA 2HHTA 5KFOA 2R8HA 3RB6A 3NF8A 1S0OA 2V9WA 1HNVA 1KVCA 2WONB 3SFGA 4ID1A 4IR1A 4BWJA 4CJSA 1T05B 3C95A 4FM2A 4ED6A 1ZBIA 1XR7A 1WLJA 3DOKB 1GX6A 4ZVGA 3AVFA 2QK9A 4MK9A 2UUTA 3QEWA 2OYQA 1BISA 3LPUA 4IG0A 3L2VA 3QLHB 4PA1A 3BQ1A 4DSEA 5DQGA 1D9DA 5C24B 2WHOA 1FKPB 3M8QB 2DTUA 5J2QA 1HQUA 2KQ2A 4DTMA 1UA0A 1RT4A 1ZYQA 4M3TA 1I39A 1U04A 4CGDA 1BCMA 2FLLA 1JXLA 1HQEA 1CSJA 5JS1A 2ILZA 5F8NA 3V9SA 3AVHA 4LSLA 1NK4A 4HUFA 5KFIA 4H4OB 4O3OA 4DSIA 2DFEA 4RNHA 2YHBA 4O4RA 4KI6A 4IG3A 3NGDA 1JL2A 4RW6A 5J1EB 4HTUA 4LQ3A 1XC9A 2XI2A 3DLGB 2YKMB 2FVRA 4DS5A 4YR0A 3QO9A 2YKNA 5DQHA 1RDDA 2XRIA 5F9LA 2O4GA 4NLYA 2Q3SA 3OL8A 4ECSA 4O4GB 1JLCB 3L3VA 3NGZA 2PYLA 5K14B 4EO8A 5KGWA 1S49A 4OVLA 1S0NA 4BDPA 1B92A 3PVXA 4E7IA 4ZVFA 3OSPA 1X9MA 2V0NA 4WYWA 3L2RA 3KHGA 1RTIB 4WYLA 3KLFB 3SFUA 1TV6A 4FCYA 3I0RB 4DTXA 4K4WA 1VRTB 4FBUA 3AO5A 1WSIA 1RT2A 2D41A 1N48A 4NLSA 4RZRA 3IS9B 4ED7A 3RBDA 5KFAA 4WE1A 1XHZA 4ED2A 2R8KA 4Q0BB 4N56A 3PUFA 4IBNA 4NCAA 3KJVA 2XY7A 5HRRA 1RTDA 4ZVHA 2HVHA 1KLMA 1NOZA 1JLGA 4Q8FA 4LSLB 2W7OA 3RRGA 4DTRA 4AHSA 1C2PA 3U3YA 1TKTA 4QW8A 4O3NA 5KG0A 4FLZA 2FBYA 2D0AA 1SV5B 1TK0A 3QNNA 4I7FB 4YQWA 3GQCA 2I5JB 3QIDA 2X6NA 2XY6A 4FJNA 2VA2A 1U49A 1SKRA 2AGQA 3VQDA 4R8UB 1TL3A 1JLBB 1RDRA 3FQKA 2G8FA 3DRSA 3JYTB 3E51A 4QWBA 4CJVA 4FJKA 4RW7B 3EY1A 3PW7A 3BSOA 4RG8A 3N6LA 3MEGA 3M9NB 4UQGA 4G1QB 3OL9A 4CK2A 1B9FA 4FJIA 5DK5A 2WCXA 4YMEA 3S9HA 1UA1A 3O4QA 3BR9A 1LW0A 4N41A 2W8KA 4FK0A 1BQMB 1SH0A 1SV5A 1MMLA 4W5OA 1ZTTA 3JSMA 4CHQA 4EBEA 1UWBA 1RDBA 4LY7A 4IH7A 4CJLA 5KFXA 4CEOA 3HL8A 2D7SA 1GOCA 4IH6A 3P1GA 1C1AA 3ZSQA 4H4MA 2XY5A 1K1SA 4MIAA 3BQ0A 3V81A 4LH4A 3LP3A 1KFSA 1TVRA 4K4YA 3PZPA 3NF6A 4ZP9A 4G1QA 1IKVB 1T03B 3DMJA 3PR5B 1VSMA 4DSKA 3P5JA 4N47A 2KFNA 1W25A 3NGYA 4O0JA 3KLEA 4DWIA 1VSFA 2HNDA 3QEXA 3ALYA 2R2RA 3DLKA 4CJEA 1IM4A 4Y1DA 4CIGA 4ED8A 1IH7A 2QKKA 4IFVA 2B6AB 3I5CA 4CJTA 2IA6A 2HHXA 4E1MA 3OHBA 4DL7A 3DLRA 4AHVA 4NRTA 2XO7A 3BDPA 1IKWA 3SI8A 3U6FA 3ZT3A 2AJQA 3V6HA 4MH8A 3HVWA 1ZBHA 3ZSXA 3BGRA 4M3ZA 4IR9A 2GV9A 4CJFA 4NLGA 5T14A 3M9OB 2AU0A 5CY4A 4ZMMA 1JLQA 5J2PB 5SZTA 3D0PA 4ZTJA 2VA3A 2EX3A 3NH0A 4CIFA 3MEDB 3MR3A 5D3GA 4IOBA 3PX4A 4F4YA 1ASWA 3LZJA 2Y1IA 1ZBFA 4YNQA 3L2WA 3KD5E 2BRLA 3LDSA 4AHCA 3HPOA 4EYHB 4DF4A 4C8LA 1HQEB 3M8PA 1BI4A 3O4NA 2XCPA 3KK2B 5HRNA 1NHUA 1VRUB 2D0BA 3ISNC 2FVQA 5JUMA 4KAIA 3T1AA 4KFBB 2JLEA 4HUEA 1NK7A 4KHQA 3VQQA 3DOLA 5KTQA 1CZ9A 3VQAA 4ID5A 3QESA 4KTZA 4IH5A 4W5RA 4KHMA 4KO0B 3AO1A 4FLVA 1DLOA 4C8OA 1WSJA 5EUHA 3FDSA 1IKYB 4WZQA 1SUQB 1N56A 4OLBA 4DSLA 4DLGA 3VQ7A 3OYIA 4NYFA 4EP4A 4JV1A 3M9MB 3H5SA 1TKXA 3ZSZA 3AA3A 4CGFA 4CEBA 3AA2A 4J9KA 4RU9A 3TQ1A 4CGGA 2Z1HA 2RN2A 1RTIA 4DQRA 4WFXA 3SJJA 4EYIB 1KLNA 4CFDA 3OYMA 3MF5A 1VK0A 1QHTA 4EBDA 1JLBA 3PO4A 5KFRA 1RTDB 4Z4EA 4OGEA 3AVLA 2HNYA 4MQ3A 1NKCA 2X74A
chains in the Genus database with same CATH superfamily
3CC7N 3U9ZA 2FLOA 4ELTA 4KKOA 4HYKA 2F9TA 3T1HJ 2DFHA 2I5JA 3WNEA 1MN9A 1Y00A 4YB7A 3ZSOA 1QVGR 2PMZD 1Y3KA 3W5XA 4H0YB 1RADB 4KQZA 2QYCA 4PG7A 3Q8PB 1YJWS 5F0XA 2GEMA 1S6PA 3H3NO 3TWZA 4OL8A 2EPIA 1FNOA 3MXJA 4CIEA 2UP1A 2Z1IA 2IAJA 1RHJB 2XYHB 2P9GA 2BM1A 4OX6A 2ZZTA 1TV6B 4KBIA 1Y3JA 2W42A 1VBZA 5BREA 2J8SA 1FEEA 3H3OB 1XNRK 4QR1A 1NJYA 1G15A 1HQUB 4KHYA 3W63A 4X66F 4J9QA 2EBGA 1Q8LA 3HFZB 1MWZA 3VA0A 4P2SA 4A47A 3ZZYA 2EFNA 2IM3A 4DCOB 3E01B 4CLYA 4KV8B 4JNEA 3BZKA 4URQU 1V5VA 4CESA 2VV5A 3QFWA 5K8NA 3GPAA 1OPIA 4YFUA 3U8XA 1R8PA 1QHAA 1VQLN 2QA4G 5L9NA 2FBXA 4O44B 5FROA 4KIAA 1NJZA 1RTJB 3CDWA 1X4CA 5AQIA 1UTAA 2RDIA 3V9ZA 1RKJA 4E7KA 4A4JA 2XMUA 5KFTA 2QMXA 1BHLA 5U47A 4DR4K 4F25A 2Z2MA 4DR7K 1OY8A 1I94F 1SBRA 4JBCA 2HQ3A 4ZVPB 2UVWA 1JK9B 4WP9A 2X3GA 5AE1A 4KR0B 3KG1A 2ZJQL 1LOUA 4ECTA 4IRCA 4MK7A 4DL6A 2M8DB 3S3OA 2P1JA 1HJOA 1CPZA 1HBOB 1TUWA 1U8WA 4GKKK 1UPMB 3BF1A 1O0PA 5KG5A 2DFFA 3PW4A 4FLWA 3RMAA 1S9GB 1VK3A 2JWLA 2QWOA 3VQBA 3N4QA 3IKMA 4B1ZA 3OXGA 3IXQA 4QW9A 4EU0A 3VEZA 1WHYA 4ELUA 1RT5B 2P2CB 4FJHA 4J91A 2MZ1A 3DXKB 2VG6B 4XK8C 4CF8A 5JVGL 3EE3A 3B4DA 1N33J 2WUSA 1CEZA 3PDNA 3VENA 4J90A 1JXVA 4CGJA 3LP2B 5LMNF 4DUYJ 1M5SA 1DURA 1Q1KA 4KH6A 4CBXA 2Y3YA 2YH0A 4EFAC 2ZOGA 2XS2A 5CYMA 1TYQA 3I82A 4X62K 2HG4A 1YIJS 4H0VB 1OPZA 4USWA 1KOOA 2JDJA 3OFFA 3GJQB 2HS3A 4JD2A 4HVZA 4KH4A 1RDCA 1X5OA 3O4WA 2R7UA 1FDDA 2B4JA 1YWXA 2E5GA 1VMBA 1RBSA 4YDDB 3QGHA 3K5PA 1XWLA 2QX0A 4KYZA 1YKWA 4HACA 2OJ3A 3HCXA 4FBTA 1R0AA 2IBOA 3HOTA 1FKAF 1D5AA 3DLLQ 4IFEA 3GZ7A 2MYFA 4V19J 3UDCA 2UXCK 3W66A 3QNOA 2ACMA 4Z37A 4WQ4C 4I68A 3JTOA 1C0FA 4RU2A 4UOHA 3L09A 1FJGF 1G4CA 3G4SN 4ZCMA 3D3CJ 3KDOA 4JKAA 4GKJJ 3HFVA 3OW2R 1TKZA 3BEGB 3D6MB 1QAJA 1NEEA 5JMNA 4BRNA 2OPRB 3UKRA 4F0MA 4FJ8A 3MEGB 3O6QA 4BRQA 3AO2A 1NK0A 2V5HG 4L3QA 2IGIA 2RRAA 3G71N 5ETNA 4RNNA 4FLUA 3CJRA 3GE9A 4FXDA 4KPCA 3PSFA 1Q79A 2P9NA 2WVEA 4CFAA 4B9UA 1HA1A 1HUXA 1IKXA 5D8HB 3SI6A 2DXEA 2MZSA 1UWBB 2F1FA 3B54A 2ASDA 3LP1A 4YOTA 2AD9A 1Q8BA 4H0XB 4OYOA 4IWVA 1JLFA 3OHRA 4GC7A 2YKPA 3EZ5A 3ZC4A 1T6CA 4WFZA 4PKIA 5THWA 3E9LA 4WTYA 3M32A 1UAXA 4OX7A 4JI8F 3OUYA 3CCJN 4CJ7A 1RLDA 4X65K 4KRFA 4BC7A 3EWGA 1KVKA 1VSDA 1J5OB 2MQ8A 2PY5A 1WI6A 3GR0A 4W5QA 1CLFA 4ER8A 3CJKA 4TU9A 3G4SS 2V51B 1NMEB 3C6UB 2FGOA 1ZPWX 5M1OA 2HS4A 2YPZA 3BREA 1EARA 1NGFA 4BACA 5A6PA 2UXDJ 1MU2B 2Q6CA 4G65A 2L3MA 2ZNZA 4JV2A 4FPAA 2ZE2A 3DI6B 2FHJA 3ATVA 4WTOB 4DQQA 1WKJA 4CZJA 1FFGB 4DB3A 4OYWA 3S8SA 3VAIA 5KFQA 3V5RA 2FSNA 4TYBA 2F8EX 3THXA 3CJCA 1W2IA 3P4UB 2KW4A 4F36A 5IM0A 3NL0A 3QBCA 4B9NA 4PCQA 3DDKA 1VQ8S 8ATCB 1X7VA 2VKRA 3BP8A 1ZAVA 2FJAB 3PTWA 4M8LA 3I9V9 3BSNA 3HI0A 2BBEA 2OEKA 2BGGA 4LF7K 4LJMA 2CJQA 4KH1B 2VQFJ 1U45A 1T9WA 2G8WA 2DNYA 1EJ7L 3EN9A 1WNEA 2C2DA 1GT8A 3J80O 4Z7CA 3DU6A 1S97A 3MMJA 3TSQA 4FJJA 1C0TB 3PEJA 2HNZB 1DFDA 3PACA 1DLOB 1GH8A 2RVJA 3R5CA 1C1CA 2ZJPQ 1RT7A 3I6PA 3G86A 4KREA 1LWFA 4WCEQ 4B9LA 3MAAB 2K06A 4QJVA 5A8KB 2A3JA 4RL1A 1KSPA 2CQ2A 3DGVA 4DR6K 2UU9J 1IN0A 4JI2J 2ZM6K 1K9MO 2FJVA 1TKZB 3NXZA 1GLBG 4FXVA 2NXJA 2K3KA 2QRRA 3VEYA 1NZ8A 2DHAA 1NLVA 1TZ0A 2WC9A 3KG0A 4OJRA 1QQOA 4EZ9A 4K0KJ 3JSRA 1FK9A 3MPVA 1A5VA 1A5WA 3FLCO 3P5BP 4M94A 5EOYA 1P8ZA 1MWYA 2KI2A 2AJ1A 5GAHP 2J6SA 2KHDA 3DCAA 4YR2A 2HAIA 3M8SA 5FLXO 1ZPVA 3RVCA 1N5VA 4DZ6A 3K9KA 4U7BA 1KFDA 3H20A 1ZETA 1GTHA 3W7BA 2WOMB 1Z4UA 3TRGA 1BA1A 1T9TA 2CQGA 2RHQB 4OI0A 2JFDA 4I6AA 4Y65A 5KI6A 5BPNA 2AQ4A 4FP9A 4ZLJA 4M3XA 4E7LA 1W9HA 1DZ5A 4MLEA 4BRGA 5KT5A 4A8FA 6FD1A 3LZIA 1M5OC 2HHWA 3KUGA 1VK8A 3OA9A 4I6YA 1XMQF 3GFYA 3D9BA 4DV2K 1K6YA 1HMVB 3HTVA 2QWMA 1TL3B 2BABA 4LRAA 4ECRA 2D4WA 3CSKA 4TYAA 3CULA 1NK5A 4NL5A 3TJAA 3IGVA 4MKYA 1FO1A 4MDBA 1XMQJ 3SMPA 2OPSA 3GOIA 2EFPA 1RBUA 3ZETA 1RT1B 1S79A 2ZOFA 5AE2A 3KLGB 2C2KB 3O9SA 2AT1B 4GW6A 4JKEA 3CM5A 4PQUB 5GMKa 1K8AO 3ISZA 3FRYA 4FZZA 3HVRA 3TUZC 3P96A 1RDAA 4DOZA 4XEIA 5J2MB 4AHTA 2LQ8A 4LSNA 4CNZA 3M4XA 4J37A 2KB2A 3A5NC 3CJ0A 1B99A 2E5LJ 5DO2A 2CH6A 2HHPA 4H5TA 2NSBA 2DH9A 3TR8A 2CGKA 1B7YB 4BE2A 2E1PA 5BJRA 2XZDB 4BC5A 2BE9B 3KK7A 4LF9K 5E41A 2H48B 2WB4A 4ANEA 4X4OA 2R7OA 4IJAA 3RW6A 1HHTP 3OFGA 3K17A 1D8YA 1TK8A 4CHZA 1Z25A 3UQSA 1KAZA 1KQGB 2IDOA 2M0GB 5EHHA 3TTCA 1Z05A 2FIUA 2IA0A 3IGNA 1RILA 1YUWA 4URSA 1P1LA 4HCBA 4U95A 3GCXP 3FR0A 2LEBA 3PW5A 5DM6L 2FHKA 1AUSL 1VQ9S 4QS8A 3SBTA 3OS1A 4FKXA 2HBKA 1JLEA 3UDVA 3HJVA 4AQYJ 1CZBA 3IFEA 2YY3A 5K8PA 2EK6A 2JC0A 2HRTA 3MM6B 1FRIA 1SH2A 2D74B 5KFEA 3DYAB 2PMWA 3GYGA 2E6MA 2P9KA 1WB9A 1EXQA 2JZ5A 3D28A 4DBQA 3FSYA 2AX1A 2O1PA 4UY8O 3SQ2A 2NZ4A 2DEIA 2ZUAA 4FPIA 2W2OP 1NPPA 4ID5B 5F41A 3EM1A 1D0EA 5GINA 4DPTA 2MQNA 2FY1A 3LGHA 2DY9A 2FSKA 2RPIA 3GJRB 3KWIA 5DLFA 3RRHA 2OP5A 3FQLA 3C66A 2YNHB 2RDDA 1WG5A 4B1VA 2ASYA 4OHVA 3KHLA 3SNNA 1FJEB 2NXNA 3TUPA 1EKRA 2V63A 1YJ7A 2BXJA 1VYAA 3RMBA 4CJWA 3F9MA 1RT3B 4YOWA 1Q8IA 4UY85 4RWTA 2MTLA 4L72B 1N33K 4W98A 1RT1A 5F3TA 5F1XA 1RWMB 2JC1A 3DOMB 5JJBA 4PXDA 4C8MA 2V8PA 1HNXF 1S1TB 2G0IA 2QA2A 2DNZA 3JSMB 2G8UA 3HP6A 2W4CA 4NX9A 2P5GA 5D0HA 2BA9A 5IXUA 2W9BA 4C6AA 3HHEA 4IRKA 3OV7A 2F8SA 2H3EB 4BVPA 3JS6A 4USUA 4X84A 4OKEA 1NGEA 5H9EK 3IRWP 4WK3A 3BO3A 3VQ9A 1DQ8A 3O3FA 3K0SA 3WXKA 3A12A 2AF6A 2F63A 2H3GX 1WAFA 3OBYA 1X3MA 1M1GA 2AW0A 4IDKB 4ZK7M 2YNIA 4YP3A 4GV3A 2W9CA 1YZ6A 1RAAB 3D45A 4RJVA 1IBMF 1YVNA 4P73A 4CZMA 5KFVA 4CK3A 3P38A 3BO4A 3MCMA 4P72A 4FYWB 2IJNA 3L4IA 5D3GB 5E3RA 4H0PA 2ZITA 4K4XA 1TL7B 1OY6A 3KOAA 3ENAA 1P8GA 4CEFA 4DR6J 1R6YA 2BR0A 3LF0A 1SKWA 3TJ8A 2IVYA 4K4SA 1YF5L 3QETA 1KD1O 2MEWA 3L3CA 4DV6J 5BPMA 4ZHRA 4DL5A 5KQDA 1SJRA 2B9YA 2DISA 4FDFA 2PEBA 4UZBA 2HS0A 3WIVA 4O5FA 2VBXA 4PAAA 2BJ9A 5KT7A 1PO6A 3SCJE 2ZZMA 3CEDA 1RCXB 4WQ4A 4K8RA 2FVSA 1WEYA 2R8GA 3NH2A 3VPZA 2GCFA 2W4PA 4P6QA 4PL7A 4AD6A 1VC0A 1ZTWA 2IOCA 3UD3P 2BE2A 3HSDA 5KAKA 3L2QA 4LF4K 3EGZA 3U1NA 3LAKA 4M3RA 4OFZA 2YQ3A 4JYAJ 2HNZA 5F8HA 3BM7A 3EDQB 1IUJA 4W92B 4K4UA 4F04B 1SKUB 3H2LA 3SUNA 1VQMN 1HI0P 1FNXH 2ERRA 1UVMA 1D9FA 3NFAA 1IBLF 1BWFO 1YJNN 5IWAJ 2A10A 1RHMB 1KONA 1VSKA 3PIPL 2R7XA 4JV5K 3H2VE 5L1IA 4YEAA 1U8SA 3BSCA 1RB0A 1UZDA 2L9WA 2IC3B 1QQNA 3UKUB 1WBDA 3FSXA 4JS4A 1K9MT 3RMDA 3KK1B 3FSIA 4O3QA 1NH8A 4MTPA 3GL1A 1KBRA 2RT3A 3O1WA 2JFKA 1ZZFA 3PFEA 2HFUA 4OMFG 2LQJA 3T1HK 4KB1A 4BY9C 4ZVOB 5IOLA 2W1BA 4HKQA 4Q44A 3R27A 1PSDA 5HJYA 3V9UA 2RE1A 2XGPA 1JJ4A 5DG7A 1B3TA 4QOTA 4LFAJ 1NKEA 4FWLA 4DL4A 2VWJA 1KD1T 3W64A 4E1NA 5A0YA 2BJ3A 2YI1A 3LGNA 2X1BA 2VH7A 5K8OA 2PD1A 4CNYA 1RT4B 3EKUA 2BQ3A 1RNHA 2BH1A 4QBUA 3PHEA 3FBBA 4DQ8A 2W8LA 5F8LA 4K59A 1T02A 2OEJA 3BPDA 3GTYX 3NE6A 1FXLA 2OMLA 1CQMA 3BUZB 2AA4A 3GP9A 2LKZA 1RXOB 4OYIA 1WN7A 4FJXA 4E0DA 3EX7B 3ULHA 3PW2A 2C2EA 5I4MA 2HFOA 5AXNA 1KNZA 4DR7F 3WQPA 1GOBA 3C14A 3VQ6A 4RW8A 2HZVA 3MR5A 2VPXB 2XMJA 4JI8K 1FTCA 5DRKA 2ZH9A 4ZJQA 2UU9K 2B9XA 3TX8A 3AA4A 4ZP8A 2Y8WA 2JNJA 1GLCG 3KLHA 2VBZA 4CE9A 1P9YA 4OQJA 4CEEA 5KFSA 5DZ6A 2E2PA 5FPDA 2HWTA 2JJ4D 5KFCA 2V50A 2I9SA 1XJWB 2CJBA 3L6QA 1Q4RA 3X1LB 2G4BA 4B9MA 1VQ9N 4DR3J 1TK5A 2M52A 4W90B 1X9WA 1V4SA 1LWEA 3MMAB 5AXMA 4IUFA 4K4ZA 1RK8A 3E2EA 1VQKN 4FW2A 1HBUB 3Q89A 3SZ2A 4C8NA 3VZIA 4KBOA 3VTHA 1RBLA 2Y8YA 1NGDA 2E9RX 2HHUA 1VQ7S 3CMAS 3MUTP 2V67A 4JI4J 1HL6A 5KFHA 2E2OA 3FCWA 5C15A 2DY4A 3EXCX 1LQ9A 2RSQA 1HHQA 2JSXA 2C28A 3TA1A 4ZPVR 1S72S 3NNCA 3DXSX 4KI4A 2GWKA 1SKSA 5JVGQ 4G3IA 4CZIA 5KFNA 1VLYA 3BB5A 3KIOA 3CCMS 1BQNA 1PKUA 3L4BC 2VASA 3W65A 1SL1A 1UAWA 3ULEA 2O8EB 1RAGB 2LP4A 3BS9A 5EX3A 4NB4A 2EG1A 3EE8A 4NLQA 3UCGA 4CTAB 1YRUA 2JGUA 3CO9A 1KHVA 1MWMA 5ETPA 2MKHA 1RT2B 2YWEA 2FF6A 4JAXA 3O9QA 2HURA 2RQCA 3IAS9 2SXLA 5LJ5Y 2ASOA 4Z4GA 3J7A1 3EPIA 2ASLA 1BCOA 4R79A 4ZP7A 3GIIA 4ZVUB 4WFAQ 2O8DA 3AT1B 3ZSVA 1F3VA 1LNQA 1VQ5N 3JXUA 2DGWA 2JL9A 3FK4A 3SDEA 3QDKA 4IXCA 2GO9A 3O9RA 3V4IB 1MNEA 1RACB 3D7EO 1IJJA 2G2YA 3U02A 4F0HA 1OS5A 2IM0A 4YOUA 2BQRA 2EXUA 4ES3A 2CGLA 3H5XA 5KG7A 3WX8A 1U1QA 2XYGB 2MKCA 2K7JA 2AGPA 3OYAA 4N77A 1NU0A 4JLHA 4MYUA 1DAXA 4LFAK 4NYOA 1QSYA 3KK3A 3RB3A 5HMYA 3KG4A 4HH1A 1VSLA 4WU2A 2EC0A 2R7YA 1X4EA 4KB0A 3LALA 5KG6A 1JKHA 1VJWA 4CDIA 1REVB 1RAJA 3ENBA 5IT0A 3M1VA 3M2VB 2N4CA 4QAGA 4Y0FA 3RSEB 3NAIA 4DX5A 2PAVA 2YXLA 3MM8B 3NDKA 1BO5O 5M1KA 5J1EA 2QFIA 2OI2A 3MOJB 3A3OB 2HB5A 3L9ZA 4XH4A 2POKA 4RW4B 3MAQA 1X4GA 3D1HA 4NXNJ 2J7WA 1LW2A 2J0QD 4ZN1A 1E6YB 4C3MA 3DXMA 3TQEA 1UOCA 1QZ5A 3SXLA 2GIRA 4O3PA 4USHA 3RB6A 4FF2A 3NF8A 4F4AA 1S0OA 3TYTA 3AAWB 1NXIA 2F4VJ 3C95A 4FM2A 2F8MA 1NSKL 1WLJA 4UOCA 4IOXA 4N8OA 2B4VA 4M5DA 1BISA 1NJIO 2WVCA 3BQ1A 4DSEA 2WHOA 2WTUA 1YAGA 5J2QA 1UA0A 2XG8A 3IWXA 4DR1K 1U04A 4CGDA 1BU6O 5A2QO 1JXLA 5JS1A 3R3TA 2ILZA 2XS5A 2FC8A 5KQ8A 2CQBA 4HUFA 5CXTA 2DHHA 3SAFA 4FF3A 4RNHA 3KZBA 2HVEA 3MD1A 4X62J 4O8KA 3ZZTA 1RLCL 2RRBA 4KI6A 3DXBA 3C6HA 2VODA 5CHCB 1JL2A 3ILOA 5J1EB 4F26A 1HWIA 4LQ3A 5EXWA 2P6TA 2O8CA 3QAUA 3DLGB 3PG9A 2DY1A 3QSIA 2PN6A 2YKMB 3SCIE 4DS5A 3W60A 4B3RF 3CD5A 5DQHA 1RDDA 2D1KA 2J0WA 3EXYA 4ECSA 1ZBTA 3QRRA 5E3CA 2PYLA 5K14B 4EO8A 2VC0A 4BRFA 1S49A 4A59A 1B92A 2EVZA 4LF6F 1VISA 1NBWA 1WSRA 1VCTA 3TZYA 1XK8A 2V0NA 3NS5A 2VICA 3GG4A 2ZHAA 1VQLS 2VDHA 2Q43A 3SFUA 4FCYA 4DTXA 2HQDA 4LFCJ 4TNOA 3AO5A 2E2QA 3R7SB 1URNA 1EAYC 4RZRA 5FD1A 3EO3A 4ED2A 1SZ2A 2RU9A 1NSPA 4LF8F 1FRXA 5HRRA 4FVCA 3QICA 4ZVHA 2CNKB 2Y0SD 4K0KF 3NEKA 4MKVA 2M8HA 3RRGA 1C2PA 3U3YA 4QW8A 5KG0A 2QSFA 5LJWA 2YHXA 3R9LA 3QNNA 4YQWA 3C7NA 2I5JB 1FW6A 1T11A 3QMLA 4FJNA 3UNYA 2G0JA 3Q8UA 2CPIA 2OSRA 4JYAF 5HANA 2CQ4A 5BR8J 1SKRA 3VAMA 3EICA 2UYTA 1HW8A 2E2NA 3VQDA 3W9IA 2CDRB 4GVLA 4H03B 2PA3A 3AH6A 2F3JA 5G0RB 3JYTB 3E51A 4C97A 4QWBA 2B7BB 4RW7B 3PW7A 3BSOA 2AP6A 4BREA 3CMAN 3OL9A 3P45B 1B9FA 3ZZZA 4DV7J 3J7AP 3S9HA 4M5IA 2V94A 3KJFB 4B9QA 1SJFA 2HGMA 1SH0A 3BZQA 5D4NA 3TX0A 4DR4F 1NPRA 4W5OA 1OH5A 4CHQA 1XNRJ 1UWBA 5C2GA 1IBMK 3JAMU 3ZNUA 2GIFA 1RHUB 1UZHA 1C0GA 3QT8A 4IH6A 4DJBA 3HI9A 3AXMA 3SBMA 1T3VA 1R8CA 2FJEB 3ZSQA 4QU7A 1K1SA 3R1LA 3BQ0A 1M5VC 1U26A 3V81A 3PYDA 2Q1NA 1X8DA 1H2UX 4K4YA 3PZPA 1DQ9A 1IVZA 2F4VK 4CI0B 3JTNA 1IR1A 2GQCA 2VPWB 3AB4B 3PR5B 4L6V3 2VC1A 3P5JA 2VQEK 4B1YB 3KLEA 4OZ1A 1T44A 2XBPA 4DWIA 3ALYA 3DLKA 1IM4A 5KPRA 3FUYA 1ROFA 4ED8A 3VF4A 5E33A 2IA6A 2ZHOA 3M7VA 2XZTB 4JK9A 3WDOA 3DJCA 4DPOA 3NVKA 4MIWA 3BDPA 4ZDNA 3SI8A 1TMMA 1WG4A 1CJTA 1HKBA 2E44A 3NGUA 3BGRA 4IR9A 3FJ2A 1GMUA 3LDPA 4AE5A 5J2PB 2RQ4A 2LQBA 2BW2A 3D0PA 5ELZA 2EX3A 3MX2A 4QR2A 4I6WA 3D54A 1V3ZA 3HHLA 1QDUB 1OVYA 5LT5A 2WB1D 3PFOA 1ASWA 3LQVA 4YOEA 4BBYA 1H3DA 4C3LA 2DNKA 4AHCA 1F2GA 1U6BA 2BJ7A 4EYHB 1Q5VA 1YZ7A 3UE5A 3QT7A 4DI6A 2XCPA 5ITHA 1WOSA 1Y9OA 1PC5A 4PYAA 3T1AA 3C7NB 3VQQA 1CZ9A 2YWFA 2LA4A 1OIAA 2K1RA 4QQBA 2FZKB 4DR5F 2XTJP 2LXIA 4IOCQ 2HHHK 4AL6A 5MAOA 5D78A 4FLVA 2GMLA 3QBXA 2AHOB 2DXFA 4CLUA 2NREA 3D7SB 2HIQA 1WSJA 3DU5A 1U02A 3I8BA 1FXDA 2NZCA 4Z94A 4ZPTR 2EWHA 3V2UC 4MT1A 3Q2TC 3MGJA 4GVBA 3ZSZA 4CEBA 4FWNA 2IYGA 2Z1HA 2RN2A 3OR1A 1K8AT 5ETQA 1QHTA 4EBDA 3W9HA 4PR6A 3DOMA 3CMES 4O0NA 1NGGA 4LF1A 4OGEA 2DHXA 3AVLA 2X51A 1SI9A 4MQ3A 1ZA1B 3AA8A 3DKDA 4DL3A 3J81U 1I3AA 4FLXA 3OYFA 1VQ8N 2UUAF 1FHTA 2QXFA 3Q86A 1IKYA 1BOTO 1LWFB 4KHPK 3HJFA 1H74A 3BBCA 4I2QB 2YNIB 3FFIA 4O3RA 3A0IX 5JLHA 4UOFA 2ZE2B 3DI6A 1NCLA 3QEVA 1T3NA 5AR0A 1DTTB 3JAMY 1I5OB 2KYXA 1BG3A 3L7OA 4DMZA 4PWDB 4MDAA 4XH5A 2E5LK 3DLEA 3HVTB 1PGZA 3MPUB 4U9RA 4ECQA 3AVCA 3O1BA 2W9BB 3C6UA 4J9UE 2LFVA 2QG9B 1L3UA 1KAXA 1NHVA 3N5BA 2B5JA 2KRBA 1WJ9A 1BMQB 3OTEA 3MEDA 5JXSA 4BR7A 1KRPA 4KSEB 2G1HA 2E9ZA 3CVKA 4RCHA 4NA3A 3D2FA 2DR5A 1I94K 4DV1F 2C2RA 3MXHP 4CI6A 1DY3A 1ZXOA 4RPFA 4ECWA 3H4BA 2FBVA 3K2YA 1XTZA 1RFQA 1CLQA 4F4XA 1KC8T 2XI3A 1HFEL 4GC6A 3F5TA 4MYTA 3OJUA 5EY4A 2UUBK 2FLNA 3WEEB 2HWHA 4TY8A 1LK7A 3DRRB 3RGIA 4OIXA 4FWQA 4H4OA 2QWQA 4M3UA 1UVNA 1HRHA 3KHHA 3GDQA 4GNIA 3CTRA 1R8AA 1W2BM 3NP5A 2IMWP 3TUJC 1JXBA 2KZZA 4OHYA 1WSFA 5AQQA 3RSEA 3CI5A 5KT6A 1OSCA 1N5QA 3ZCMA 2WVBA 4URGA 3EJMA 4RNOA 1RWKB 4DEZA 2I38A 3PIOL 3TU5A 3D2EA 1QSLA 3TVKA 1QAYA 1U1NA 2Z57B 2PI5A 1SS6A 3MN9A 2J9DE 2QWRA 5LJ3Y 2YKQA 3J7YU 4Q0BA 3K58A 2VJUA 3RWUA 5CABA 2ZH8A 3LANA 1C0UB 1VAZA 5GMDA 2H54B 5IQ6A 2RHSB 3FKBA 3SBGA 3O08A 4H8KA 1VSHA 3MPWA 4OI6A 2E1MC 1G6BA 5AQMA 2KG1A 2MQMA 3GV8B 3KMQA 3C15A 3KNAA 5C25B 3TAPA 2QLWA 2EKYA 4FL9A 3VQ8A 3O3HA 1PJ7A 4TSXA 1QTMA 4GKJF 3TI0A 4JI6J 2B6AA 1PAEX 4YB1P 1NLKL 2B4UA 4YHHK 4KRWA 4PPDA 1KC8O 2RKIB 2JOQA 5A76A 1XIQA 3UR0A 5ETLA 3IBWA 5ADZA 2VKZG 4LFAF 3CC4S 2WTFA 1RTZA 3MWTA 2HK3A 3R2CJ 1XR6A 1R0BG 3FCVA 1H6KX 3NWRA 4FWKA 2RS8A 4NLDA 3LP0A 1WC5A 4DTJA 1FJCA 5BYQA 3TA0A 3B6BA 3CJSA 2ZD1B 3H45C 1H7WA 4JI3F 1K1QA 2YWKA 2BQUA 3MX5A 1RAIB 2LCWA 3V1RA 5AQUA 5I42A 2YWGA 4GMKA 5ETSA 3N6MA 5B0BA 3MFHA 1Y5NB 2ZFHA 2Z58B 3SCLE 4JP8A 2V2KA 2YNGB 1VHIA 3HP9A 5L46A 4B1WB 1TTHB 7FD1A 3PRBA 4JKCA 1SH3A 2HKEA 1YXQA 2HWIA 4RLEA 4CD1A 2M88A 3FBFA 5HSPA 3NKYA 4F4ZA 2KRRA 2CQCA 2F65A 4K43A 5J2NB 3E66A 4KGZB 3DRRA 3US5A 5H1SV 4Y1CA 2N7YA 1GFWB 1OH6A 3C15B 4I1TA 1YBTA 4PL8A 5H9FJ 2HSEB 5KFGA 4V19X 2MKSA 3VAJA 5KT3A 2CFXA 3S1TA 4MO5A 4K2XA 2YNFB 1YIJN 1X0PA 3CCZA 3N9UC 4Z0UA 4X65J 4O0IA 2DGQA 5EVZA 2HZCA 2X1AA 3DHXA 4JKFA 1UL3A 2MQPA 1S10A 1JLAB 1YJTA 4LF4J 3KLHB 2G13A 2CDQA 4DG1A 3O6WA 3WXJA 4NXMK 4BLGA 4KPYA 2NYHA 3M6GA 2B5JB 3PR4A 2QM1A 4QYZK 4I9QA 2CA9A 4UUXA 3FFKB 3VOVA 2FHMA 5CYQB 1W26A 5CZ2A 3DM2B 4LR7A 4X66J 1VBXA 1Q82T 1A6LA 2DNOA 1QLNA 3BZCA 2VOPA 3VGMA 2FYXA 2IS3A 1DTTA 2F9DA 3MEKA 3MTKA 2E6LA 4UZCA 1SIZA 5I9EB 2FLPA 4FKYA 1TYQB 3ZO7A 3BQ2A 4B17A 2J5AA 3G2XA 3U27A 1S6PB 2E88A 3JYTA 3BDEA 2OCEA 1LFPA 1RABB 1HIYA 1AXQA 1W0HA 1YJNS 4L74A 1GLLO 2NPFA 4TY8B 1M5PC 2CNOB 4DTPA 4PWUA 4OPHA 3AVNA 2VBWA 2W9AA 5SUHA 3HSZA 1WKKA 5AQGA 1NUEA 2C3YA 3W8GA 5B08A 2XMAA 5EU7A 1F6TA 4X64K 4M63A 3PJXA 4WP8A 2HLUA 4CHNA 2GGPA 5KFYA 1JCFA 2MLYA 2KKZA 1XUPO 2E1AA 3RR7A 3FEYB 3NCQA 5IWAF 4PKHA 1VRQC 3VEVA 1HI8A 3QYYA 4BR0A 3EGNA 4L73A 1WHVA 4WFYA 1S1XB 1MWKA 4CERA 2LU2A 3QSYB 1Q5YA 3I55S 2Q31A 1Q18A 1CJTB 2QMWA 3CJ2A 5EDWA 2HMPA 4HH0A 1JIHA 3CQXA 5D77A 3DRPB 4CT9A 1M5KC 5CYQA 4Z4HA 1UW9A 2A2CA 1S76D 2ZKTA 3MM7B 2HBMA 4NLUA 5AQRA 1S48A 3MEEA 1U2RA 1KVBA 3CMQA 1MA9B 2G2OA 1Q53A 1XBWA 3O3LA 2N7CA 5KRSA 1VSEA 2OO4A 1UKUA 4FOIA 3GIKA 4Y34A 1UCNA 3ZNJ1 4WK1A 4X4SA 2D9OA 2GMJA 4OKJA 3OTOF 3NCIA 1HYVA 1A0OB 1JNZB 4U96A 2G9OA 4W5TA 3H7HB 3KKFA 3SQGA 5KFMA 2VUGA 4YHHJ 5ETMA 2HEKA 2BJDA 3WZ0A 3PYFA 3UCZP 2RUGA 3KK1A 1IQZA 3VAHA 4RBVA 2YKOA 2F96A 4GMJB 4CGHA 5AQZA 2FVPA 4I7FA 2FC9A 1TELA 1N0VC 1JX4A 1YHQN 3AQOA 2R7VA 4J2EA 1WF0A 1KAYA 4HHTA 3I87A 5AZIB 2WSFC 2DH8A 3KMSA 2C3OA 4DV7K 2DCLA 5DM6Q 2LQ9A 5KRTA 3CC2N 4ZPAA 2E5LF 2F8HA 5J2QB 2ZDOA 3Q23A 4ED0A 2O4IA 3NVMA 4B3RK 1O5JA 4OJ1A 4M5LA 2VIHA 2RF2A 3VQCA 3D4JA 3G8SA 2OPQB 1WORA 1S4FA 2D0PA 2UXCF 1QE1B 2AEJA 1Y11A 5A8WA 1GLAG 4HTLA 2MZQA 4JV5F 2QLXA 1N6QB 1FTRA 1QVFR 4JS5A 3BKTA 2NUBA 2YX4A 2C1EB 4DR2F 4ZN3A 1U09A 2YX7A 5F8GA 2G8VA 1KKHA 1HBMA 3NBPB 4DV1J 3GCWP 2IC3A 3QERA 4R0EA 1AZSA 3IAYA 4DU7A 2GJIA 4ATNA 1QQCA 5KFBA 4YY3F 4Y2KA 2M70A 3OJSA 3AB2B 1I1GA 1BDGA 1P27B 2KKHA 1KP6A 3AXKA 4FNHA 1SJ3P 5K14A 4I9LA 3ID6A 2O01C 2YX1A 4QYZJ 2HNDB 2O8FB 4OZJA 4DX8H 1U1PA 2XCAA 1U25A 4GVBB 1MROB 3IN5A 1C1BA 2HHHF 4AL5A 3LDOA 4OHZA 4LR8A 2K8GA 3DXKA 4A8QA 5GADP 4H54A 3CC2S 4NLWA 4FWMA 1WOPA 3HZ6A 3OY9A 4U8VA 4HACB 3NAHA 1LWCA 5KG4A 3SSRA 2KTQA 1N0UA 4Y3CA 1HYSA 4D3GA 1S5JA 5HO4A 2HLTA 3GYXB 3C2PA 1MG7A 2BOAA 1F9FA 1ZBLA 4B3TK 1RWPB 2CXEA 2M4MA 4RW9A 3QB0A 4JI0F 4KHSA 1JCEA 3SQ1A 2E1CA 2R9LA 1VQPS 2ZWHA 4I4BA 3NMAA 1DTQB 4TLRA 2CPFA 4GO5X 4C48A 4B9VA 2DD8S 3FE1A 4KKOB 1D09B 1S1WA 1T9VA 3OYGA 4OO1J 2XGQA 1IG8A 1TKXB 2RD5C 5CD4H 3PKYA 4WCEL 2EHGA 3OYJA 5DS7A 3OFHA 2YBVA 2CZ9A 4DR4J 1K47A 3MAAA 1KS2A 1BE4A 4BRCA 3MZIA 1XNRF 4KFBA 2OPPA 1T03A 4LSNB 5AQTA 3VTIA 5C7PA 3CF5Q 1ATNA 3W2VA 1WC4A 1Q9YA 1E6VB 3T3FA 4DFPA 3LPTA 4JI7K 2W24A 5ETKA 5KG2A 3B8HA 3VA3A 4PG4A 4JKBA 4WZMA 4PEOA 3OQ2A 3AO4A 1U48A 4FJLA 1AW0A 3NF7A 4FWRA 4CIOA 1C1CB 3MM9A 1P1TA 4JI4K 1T9UA 3KK3B 1KTVA 1PILA 4EK2A 2HQGA 1YG0A 2WK4A 2XNQA 5ETOA 2DR7A 3UFCX 2IM2A 5AQNA 1FWPA 5EX0A 3AOBA 5ADXA 2C2MB 1S9FA 4QR0A 3ULDA 3I4HX 1WAJA 4DCJB 3OYCA 2NRZA 3E9OA 1XQIA 2OZSA 2V34A 1JLQB 3CYMA 4NMXA 4F50A 4LF8J 3JTPA 5FDLB 4EI2A 2OPQA 4RWWA 1V3SA 3L2UA 3CCES 3R8EA 2F7TA 4PHTX 1OMSA 4AXJA 5E5NA 4IG3B 2O3DA 1K73O 1N5SA 4Y00A 4U7UK 1BL3A 4EAHD 1NDPA 2UUCF 3HXMA 3G0ZA 3VQSA 4PQUA 1S0VA 4FLTA 5J1PA 2WRMA 2MDAA 4LFBF 5DGAA 2M2BA 3TP2A 4DG1B 1XC3A 2HSTA 1WDTA 5FRNA 5HQLA 2E9TA 4QWDA 1RBTA 3J81j 1RHKB 2GJFA 3X3UA 2DNHA 1G3OA 3I4PA 5B8HA 5BRFA 4H5NA 1N36J 4J2BA 5B0FA 4FJMA 5IV3A 4NXNK 3CJ1A 2W6LA 1XI1A 3EVMA 4USIA 4RNFA 1L3KA 2W2NP 2BW7A 2UV8A 1C0TA 4DV5K 3MXMA 1JLAA 2E7XA 4CO4A 5AJ3K 2IDLA 4ZVQB 1AFJA 3MR2A 2Y1LB 1WD6A 1LXNA 2DNPA 4DXLA 2ASMA 2XYPB 3VVTA 1NOYA 2GS8A 3C46A 4DCPB 1OQ6A 4I0WA 1E4FT 3I56S 2BYCA 2R4FA 3M1VB 1OY9A 4K4VA 2WOMA 1P6TA 2CPZA 2CWXA 1WC1A 4XDDA 2ZVSA 3SQGB 2V4RA 3MECA 2EEYA 3D68A 1YLXA 4BC4A 3KFWX 4WFNL 2HHQA 4UOGA 3K57A 4MJKA 5D4PA 1Y64A 3NHGA 1NU4A 4DKWA 4KHPJ 4WXWA 4WE1B 4K4TA 5I3UB 3TARA 1U0SA 3CJQA 4DV0K 4RR5A 4ITSA 4J9SA 1VFJA 4OYXA 4DV1K 2OPRA 4WYBA 2ZQBA 3G9CA 3OLBA 2HHVA 2QW9A 5AQVA 4CJQA 4N7TA 4O55A 1S6QA 5EWFA 3B8AX 3H08A 2J7KA 4DUTA 4LF9J 4MFBA 3CCQN 4B3TJ 5EGYA 1MMNA 3UWTA 2PA8D 2NPIA 1HPZB 1WEXA 3IR6B 3O1LA 1EHWA 4IYQA 2N3LA 5LMNJ 1R0CB 2L9NA 1D3WA 3QIPA 3LOUA 4BRLA 2HGLA 2FDNA 3E9PA 3MCAB 1UJ5A 2D1CA 1DJ0A 2YQ0A 1YVUA 1S5ZA 4OKKA 4KH0B 4DL2A 3D3BJ 4DF8A 1Q86O 3TO8A 5AZIA 4BRIA 2AJ0A 3OHAA 2PT0A 2GAGC 1S9EB 3EVWA 3N4PA 2UXDK 3A8EA 1FKOB 2HVZA 1WHWA 4DTSA 1J53A 1DRZA 3KLVA 3FZKA 3H0PA 4BQZA 4CH0S 3ICLA 1NNEA 5C25A 2VGNA 5DG8A 1FVQA 2AIRB 3HM8A 5E26A 3AJ1A 4B1XB 2DIVA 2WZ1A 2D0CA 1JKHB 5J2MA 4BR2A 3OL7A 2GWJA 3V6DB 2QYGA 2Z2YB 3Q8RB 4TY9A 3CCQS 1CXUA 1EX4A 2UVUA 4B02A 3AGKA 4M5NA 1HKAA 4NLOA 1HNZK 4CK1A 2FZCB 4B1UB 5DDPC 2MMYA 4FZVA 1S6OA 2CQDA 1KN6A 2LA6A 3O3GA 3TZZA 2ATQA 4DR2J 2DHGA 7FDRA 3I0SB 2W2MP 2W25A 4N8NA 1OWXA 3FBCA 3MEEB 1SC4B 5F8MA 4I67A 1R59O 3C19A 4DR2K 1JB0C 4P52A 1D9AA 2X1GA 2VCPA 1U47A 3QGIA 1QZ6A 1BA0A 1DHMA 4BG8A 2PEHA 3HHKA 1FDNA 2JEGA 1FDBA 2UV8G 4JI2K 4YDUA 4I64A 2MHNA 4ECUA 2D3OR 2CJKA 1HYSB 3N0VA 5AJ3J 2VGMA 2K2PA 5HP1A 3HKZD 2GGPB 3HSTB 2ZWOA 1FRKA 5A8WB 3A1YG 2O8EA 2HGNA 2I8EA 2PZSA 3RB4A 3IP0A 3OTOK 2LQ5A 3I0RA 1YJ9N 1WNSA 4S0MA 4F8RA 2KVQE 1KDNA 5KFUA 2ASPA 1W7AA 4BRAA 3D67A 4DUYK 2A1BA 3J7AN 2XSJB 4KB7A 3CD7A 5C24A 2ETJA 1YTYA 4P2FA 2KFZA 3CCMN 2QA1A 2JEIA 3U7JA 3TAMB 4ZKAA 1YX2A 1RE1B 1RDWX 3CUNA 1V5IB 4J9PA 4CWBA 2ALYB 2UUBJ 5AQHA 1VRTA 2DT9A 5IT9Y 2Q3PA 3SSQA 4OZLA 4UT4A 1VQYA 4RW6B 2QA4N 4WU3A 2JWKA 3FNNA 4ED1A 1JMTA 2NRRA 4XTTA 3G6EN 1HNIA 1K8KB 2CVIA 4AH9A 5HROA 5KFZA 3I8DA 1WUAA 3CCRN 4ALZA 4V1Ak 3BBFA 2DPNA 2DNGA 1FERA 1TL1B 4C3KA 4OPKA 1Q78A 3T41A 3V6KA 2HHTA 5C2DA 2V9WA 5B0EA 2WONB 3MTJA 4LF6J 5BN9A 4ED6A 1ZBIA 4E98A 4ZVGA 3WXIA 2H4YB 2UUTA 3D6TB 2DGSA 3FEXB 4IG0A 2DIUA 1D9DA 4PXEA 5F3ZA 4F0KA 2XS7A 4TLQA 3M8QB 2DTUA 2VF3A 4MAKA 2NRXA 1RT4A 4USMA 4EUVA 1I39A 2VQFF 3T7ZA 2FLLA 4X4VA 4Y2IA 2VZ9A 4C23A 3AQPA 1NSAA 1RWOB 5F8NA 2GVDA 1NK4A 3VAKA 1GLFO 4DV0J 4H4OB 3SDEB 1WWHA 1AROP 4A62A 3SLCA 3H46O 3LM9A 3BH7B 1JJHA 1SB6A 1U2VA 4O4RA 2IVFB 2V8GA 4IG3A 1QM9A 2QA4S 3R7BB 1N54B 1X5TA 2P5VA 4HTUA 2OSQA 2XI2A 2UXDF 5T7LA 3HD2A 4AM6A 4JK8A 3QO9A 2YKNA 4IQMA 4WPAA 4BCAA 3IR7B 4NLYA 4XH1A 2B0GA 4O4GB 1JLCB 3W1YC 1FESA 2P8IA 3KJNB 2I6WA 2LXFA 3CJ9A 3PLAA 2IMOA 4OVLA 3IC1A 1S0NA 3PXGa 4GKJK 1RP5A 4AYBD 4A8YA 4OX9F 3HHDA 4LFCF 4WYWA 3L2RA 3KHGA 1RTIB 4C11B 1HQ2A 2X7IA 4K4WA 4H4KA 1GEHA 1VRTB 3J7YP 1N48A 4NLSA 2X1FA 5KFAA 4WE1A 4M1KA 4X66K 2R8KA 3QAEA 3NNAA 4Q0BB 4N56A 3PUFA 3KJVA 3DAWA 3R6GB 3L4QA 2AJFE 3OTOJ 4Q8FA 4PG8A 2UUCJ 4LSLB 2W7OA 1U2CA 5AE3A 3CJBA 2ZH6A 4ZIVA 1JJCB 5IZHA 5BR8K 2D0AA 5CZXA 1TK0A 4HEA9 4OZ5A 3GQCA 3R5BA 3IA0A 3WQUA 1KWMA 2VA2A 3NCPA 4JD2B 1IBCB 3W5YA 4X4RA 2AGQA 4NO7A 1VQKS 3VAGA 1P90A 1R3NA 3CGIA 1JLBB 2ZF5O 1RDRA 4X4QA 2E66A 4OHXA 1X4FA 4FJKA 1RWWB 1PIEA 3EY1A 4RG8A 5AZJB 2Z8QA 4OZ2A 2QIFA 5DM7Q 4H5VA 4G1QB 1LWXA 3H42A 3Q7CA 5DK5A 5G4DA 3G82B 4YMEA 3VQTA 4F3MA 1UA1A 3O4QA 5GIPA 3AAQA 3EZWA 4N41A 2GAHC 4HTJA 1LCUA 2H65B 3LDNA 4BR4A 4G9ZA 4RUHA 4RTFD 3JSMA 2GFFA 3PRDA 2ADCA 1WACA 4LY7A 3BY5A 1GMWA 1QY7A 2GUPA 4E2FB 4NXMF 3P1GA 1C1AA 3CCEN 4H4MA 2XY5A 4MIAA 3GR1A 1TL5A 4U8YA 3TW0A 5CA5A 3DWLA 4ISFA 2CADA 3QJJA 4ZP9A 3L7UA 4LRFA 4DV2F 1KQSR 8AT1B 3DMJA 4IO1A 1NWKA 3KJQB 2HNDA 3AA9A 2R2RA 4Y1DA 3QJPA 3BBBA 2B6AB 3I5CA 5AQLA 1J5EK 2HHXA 4E1MA 3DC2A 5FPNA 1HWJA 1RWNB 4DL7A 4KHPF 1NH7A 4NRTA 5I3PA 5BYRA 4FWSA 5GAGP 2CJYB 2WFBA 1X4BA 3OTDA 4Q2LA 3QBWA 2QJ3A 3V6HA 4MH8A 3C16A 1UW4A 3HVWA 1ZBHA 3ZTSA 3GFZA 3VEWA 2GZOA 3M9OB 3I55N 2XB2D 4KY3A 2B51A 3TOQA 2VA3A 1BY9A 4CIFA 4CM0A 1VIXA 2DO4A 4PWWA 3MR3A 1Q86T 4WFAL 2VPZB 3DDNA 2IRUA 4K7QA 3P39A 4ES2A 3LPYA 3LW5C 3O4NA 3KK2B 4CZKA 2OAUA 4YOVA 4KFBB 2JLEA 4CH1A 1NK7A 5KTQA 3M1FA 3VALA 2HYIB 4YY3J 3WIUA 2EI5A 2ZC3A 4CQ1A 2F4FA 2W6KA 4ID5A 3QESA 4KTZA 2GO8A 5D15A 4KHMA 5AQPA 5HN0A 1DLOA 3N28A 3TSPA 1FE0A 3R6LB 1SC3B 2OKQA 2E7VA 2P9EA 5EUHA 1RISA 1IKYB 4WZQA 1EKSA 1N56A 2HHHJ 4CYUB 5L39A 2BKNA 2U1AA 2BM0A 4ZJOA 2CJAA 1TKXA 4J9KA 4RU9A 3SJJA 2UUCK 3VERA 1KLNA 4JV5J 2QXLA 2E5JA 3ZZOA 1X0FA 4K41A 3OYMA 1VK0A 3PO4A 2KFYA 5KFRA 3FMBA 2UXCJ 3B82A 3GFHA 2CJXB 3MM8A 3AARA 1R89A 5LJVA 4JI0K 1NM2A 4Y28C 2HNYA 1CJUB 2GTDA 4MIBA 2H4WB 1XQSC 3G8QA 2XLIA 2BACA 2FTRA 4EP5A 2RILA 2DK2A 3FEZA 2RHKA 4LFCK 1FD2A 1RCOB 1LOTB 3HK2A 3ZZPA 3VGTA 2VBYA 1X4DA 1S1VB 4I56A 4ELVA 2H51B 1BIUA 1KCFA 3RTVA 3QT6A 2WSCC 5AJ3F 4B3MJ 1BWEA 3ZZ0A 2J6UA 3IG1B 3QMQA 3W61A 3ILIA 4TQSA 2QEXN 1X4AA 5EN1A 1O51A 1ZC6A 3W62A 4IRDA 4UQTA 3W0LA 3R1XA 3G10A 3UKRB 2R7SA 2JHEA 2Y9HA 4ZTFA 4A5AA 4OLAA 2OGUA 3GU0A 2P5OA 3P83D 3M6VA 4QS7A 1EO1A 3E01A 2OPSB 1SAZA 4CZGA 4JI5J 2O8DB 2YPYA 2YWHA 1YITN 3ULEB 3Q8SB 4R8UA 2JLFA 5F9NA 4E3SA 4JN4A 3DLJA 2P9KB 1VSJA 3ZZUA 3V1QA 5FDLA 4WQ5C 4DPWA 3HPHA 3EVOA 1F2HA 2D3O1 2WVDA 1LV5A 3GFXA 3G6ES 1YT3A 1YBUA 5AQSA 2HQIA 2ZGYA 1Z2ZA 4KGKA 1YRTA 2P9NB 1N6QA 4KHWA 3SPYA 4FVMA 3W3SA 1IBLJ 1S57A 1FXXA 3HD1A 1E3MA 2DPJA 5HBMB 3M30A 2XWYA 1X31C 2YKNB 3O8WA 4U6PA 5M1NA 1A5XA 1XR5A 1YJWN 4LRCA 4CJ3A 2XMWA 1C0MA 1UWAA 2C22A 1IKWB 2KG0A 1EX8A 4QYRA 3BGOP 2O67A 2JH3A 2EBEA 4FXWA 3AVJA 2IAJB 2I2YA 1ZM9A 3CERA 2VFUA 3MCPA 2FJWA 3NG8A 3NMRA 5E2QA 4OJHA 4M41A 1F1BB 2I7NA 3K5LA 2VB6A 4R0JA 4FNIA 1WSEA 1X1PA 1K8KA 1GLJO 2GX8A 2EFQA 4OPJA 4LSZB 2YJFA 3UKUA 2PYJA 1WC3A 3MURP 1N4LA 4ZCIA 3G71S 3CCSN 3BGRB 4IO9Q 1Y10A 1QSSA 3AVIA 1BHNA 3M05A 4NRUA 2V8VA 4NI2B 1C6VA 1ASUA 5AXLA 4B3MF 5HL7L 2P9IB 3CCLS 1QS4A 4DFKA 3AVAA 1S1VA 4ZCKA 1B0VA 2OTJS 4I6MA 3ZEUA 2NLWA 3D0HE 4CHPA 4O44A 3M8WA 5LXYA 2JRSA 3AY0A 3TNVA 1TAQA 3MUMP 4FK4A 3WC2A 2E4LA 3CXCR 3TVZA 4Z4CA 3NGTA 3QEIA 4JHDB 5B7WA 2GNKA 2RU3A 4LF6K 4M3WA 2VOOA 2XSFA 4ILRA 1PBAA 3V4IA 2ACYA 4M5JA 2E1YA 2WSEC 3HLUA 3RW7A 2DXDA 4CCHA 3RB0A 4K5RA 3SV3A 2NUHA 3HKWA 2RNEA 4IJNA 1T0TV 5AFUH 4CHYA 3T1YJ 4TN2A 4EMDA 2VWKA 2KO1A 3T1HF 1K73T 1N32K 2OTLS 2CQIA 3QIPB 3N01A 1M0SA 4UTGA 4GY2B 2ITMA 2F8TA 3G6YA 4DV6K 1OYEA 2F9WA 3RZAA 4PRFA 1Z2LA 2MPUA 4HI1A 3E1YA 2NLXA 3P4IA 4ZCLA 1IKXB 1RUSA 1F5CA 3G87A 2FUG9 1TGOA 2AYGA 4B3OA 2U2FA 4U7UD 4CLKA 4FJGA 4F3TA 4M63C 4YUDA 5L9XA 3T9ZA 2YHAA 2HFSA 4CF9A 4LREA 3R5AA 4C1NK 4B3SF 1FFWB 4CT8A 1NZAA 3OUYB 4BWMA 2CIMA 3O8MA 3GIJA 2BEFA 3LL3A 3HZEA 4CLPA 3HSCA 4JEPA 3UO0A 3Q0AA 1SQEA 5ETVA 2UXBJ 3A8IA 1Z26A 1UPPA 1CZAN 1X60A 3G96A 3PSIA 1H1VA 1LFWA 3GBTA 1J54A 3CIPA 2MZJA 3GSIA 1Q7YT 2B4OA 4M42A 3QFHA 2Z1GA 3RMCA 3GG0A 2X78A 1KEKA 1TP7A 1WI8A 1FRMA 4DUZJ 3KLGA 2P9UA 1IBKF 3CDAA 4HWIA 4JOUA 2IY5B 4ILGB 1MMDA 2F4VF 3AD7C 3VQPA 4J8FA 4NLVA 4OJGA 2XY8A 4JUZA 2VG7B 2LDYA 1H2VZ 1TR0A 3GJTB 4OGCA 3AV9A 4OZ0A 2HBYB 1CC8A 3PW0A 2CQ3A 1X3NA 2VG6A 5T7BA 3Q22A 4NXNF 1Q7YO 1CJVA 3H2UB 4XIUA 2DTJA 3VCDA 2DB1A 5F2RA 1FJGJ 3I32A 4JB8B 3L8BA 5F8IA 4J2AA 3VN5A 1NDCA 3D2FB 3LTOA 2H5EA 1VQ6S 1OJ4A 3NRBA 4K5SA 2CNNB 1BLUA 2MJNA 3HPGA 4M7XA 4EGLA 4U7CA 3DGPB 1XNQK 1BXNA 5M1PA 2BOPA 1IBKJ 4J9LA 1RT6A 3NY0A 1Z6RA 1JLGB 4KGVB 2CH5A 5BR9A 3TUIC 3POTA 4WFNQ 3BR8A 1M1KT 3TTDA 3KDNA 2Z0GA 4R25A 4E1JA 2DVIA 1ITGA 2MLZA 2WONA 1IV0A 2DPIA 4DV4K 2N3OA 1HBOA 2FJXA 1VQON 6FDRA 3JQKA 2Z2ZA 3ZSRA 3TR5A 1FEHA 4DV3J 1N5YB 3PYEA 5DDRC 5IT9U 1QAIA 1SJ4P 4E89A 2R8JA 2QTDA 3CQ8A 4Y2AA 2KT5A 4NEZA 4IDKA 2ZWPA 1C1BB 3ZT1A 4I2PB 3HDSA 5LMUK 4QWCA 4DFMA 4FPBA 4J9VA 3DRPA 3UN2A 5ETTA 2HMIA 1RWVB 5IC6B 3IWNC 3RR8A 1MWQA 3C8YA 1TAUA 4X2BA 1Q81O 4LMZA 4CF1A 3SMZA 3D6RA 4MK8A 3AVGA 4ZHRB 2W4DA 4RW7A 3HULA 2DGUA 4RW8B 3MMCA 3IRXB 1JXEA 3GB0A 3SUPA 1NMDA 1HARA 3V9WA 2CWKA 2B9EA 3ETMA 3OYLA 3RAMA 1BQXA 5KFKA 4DTNA 5F0UA 3V4MA 4X64F 1JNRB 3THYB 2KM8B 3C16B 3J81Y 3T9NA 5CCLA 1V3RA 1IQTA 5JICA 1ZM4A 4DN0A 4F4WA 3CCTA 2HQFA 1VQOS 4BDZA 4NLRA 3NLCA 1H73A 2Q79A 1HHSA 1VDHA 4Y0WA 2NXEA 4NWBA 1N34J 1MU2A 1TUGB 2W2PP 3CCVN 3MCOA 2NZTA 2PGCA 2RMLA 4B9SA 4DV5F 2D69A 2GQQA 3QEPA 4KAZA 2OTJN 4CRJA 2RDJA 3OPKA 2GC8A 2PFFB 1EETA 2EKNA 2IDEA 2CNLB 4O4GA 1WUUA 1KVIA 3PHTA 1EQ0A 5H1SQ 3A8YA 4B08A 1G99A 1H72C 2KJWA 1DARA 2WVFA 1TFYA 5T7LB 2E20A 4CZLA 3OD2A 2QWPA 1VGYA 1OSDA 1N5TA 1Q8KA 2OIHA 3C65A 1VR6A 2O5DA 4L8RB 3DHWC 4CHOA 4EHUA 2P6SA 3G8TA 2AV5A 2BRKA 1H2TZ 2W7PA 2BV3A 3K2PA 3EZUA 1HNWJ 3CFOA 2I1RA 3MD3A 5CCMA 3ITHB 2ZHBA 3JB9k 3CF5L 4DX7A 3OT9A 1SL0A 2OFHX 4F02A 4ECXA 4ZPDA 3WHIA 4QS9A 1KVJA 4P7TA 1CULA 1UVJA 3BGFA 4BRHA 1NGBA 2BKPA 1EKEA 3MFIA 3MWPA 2RJZA 2B8PA 3O44A 3G6VA 4E8UA 3OVBA 4CH7A 3I5AA 3L95X 3IUCA 5TKYA 5M2PA 2V4JA 3TPQA 1BI4B 1UMJA 4F3QA 5HQ8A 3WQTA 2VG5A 4BR5A 2B3TB 2QGFB 3H1VX 5DLGA 4CVNE 3F73A 3KLIA 1WBBA 4Z2XA 4HVJA 3SUOA 1RAHB 3I33A 1DQAA 3ENQA 4PKGA 3K5OA 3VGSA 1U6FA 2NQPA 2EC2A 2GHWA 3R5GA 4X64J 4FW1A 2O8BB 5AQOA 2QL7B 1RHQB 1S9EA 2DNRA 1PBUA 4HHHA 1HNXK 4YN3B 1OKJA 3M8RA 2D3UA 1I3OB 4CLSA 1NDLA 4DR5J 2FZGB 4BC9A 2ZC4A 4FYDA 2KM8C 4NCGB 1FX4A 3PNIA 4B3MK 1S77D 4LT6A 5E7OB 2J4RA 5CAAA 1RDUA 5C42A 1EIYB 3AVMA 4ZVSB 4XAKA 3MDFA 3G82A 4RUAA 1RBVA 1IJEB 4BVOA 1JWWA 2X6SA 2NS1B 1FVSA 3AA5X 2IYIA 1X5PA 3JSYA 4LR9A 4FJ5A 4LF7F 4DHVA 3CC4N 3QO9B 2ZNYA 3GE1A 3VMFB 3WC0A 3QFUA 4LBPA 4JI1J 3CT9A 3IBFB 3EKSA 5KFPA 3H90A 2IJFA 2HFNA 3ENWA 2CQPA 1L3SA 5HLFA 4DV3K 4AF1A 3TTFA 1JLEB 4KGXB 2WW8A 1BUPA 4LF7J 1C0UA 2Q0RA 3QGPA 1LW2B 4BHQA 2ZDPA 5FLXU 5HROB 4PPZA 5C10A 4H4KC 1ELOA 1VQNS 4FZYA 3CD6S 3BEXA 1Q16B 1HNZJ 4I6MB 4NOHA 3S7RA 2V4QA 1T9YA 1SC1B 1XMBA 5KT2A 3EYZA 3F41A 3PX0A 2A41A 3OR1B 2BANB 2GUIA 3DLEB 4DR7J 1FJ7A 4JI2F 4HLBA 2ATLA 5B0DA 1S1UA 3ITHA 1RA7A 2OUGA 3CDEA 1ZM2A 3B6PA 1ZA2B 3OR2B 3EPGA 1T3OA 2AEFA 4NZ7A 3OYHA 2Z1JA 2VFVA 2CQHA 4GKKJ 3SQ0A 4B9TA 3T19A 2YWWA 4CLWA 2IVPA 4W5NA 3AFGA 3J7ZT 3E8OA 4IKFA 4ZVEA 3UVJA 2D3ZA 3U4LA 1TUUA 2KZMA 5HATA 3A5LC 3CD0A 3V6JA 3MCNA 1FE4A 4M5HA 2W01A 3CCJS 3IM9A 1ITPA 3I31A 1WTBA 1NNDA 3MM6A 2O8CB 3G6XA 1EETB 3LO3A 2YNGA 3ILJA 1NGHA 2DR8A 2ATCB 2H5JB 3HVAA 3KKSA 1FKPA 3QGGA 4DQPA 1LAWA 4DQSA 3EUNA 5DMRA 4X4PA 2KXHA 1N32J 1B64A 5JVHL 5EWGA 3F9KA 2DNNA 3ZTPA 5FPEA 1VHFA 3PM9A 2XHCA 3NNHA 3QT5A 2GX9A 1CC7A 4Q2MA 4CLZA 1FDAA 1Q9XA 3CNQP 2JX2A 2MJUA 3L0QA 1RCHA 1CJKB 2QV6A 3S41A 3CCUN 2L9DA 4FK2A 2Z2LA 1VJQA 2HIYA 1EQYA 2VFRA 3LAMA 4AXIA 3RAQA 3U3GA 2QLJB 3UN3A 1ZOTA 4NA2A 3MR6A 4NYNA 1TKDA 1TU0B 2KJVA 3ID8A 1M90T 1AUDA 3T1YK 1RT5A 3PX6A 3OL6A 4WF9L 4HI2A 2NNWA 3C6TB 1FWLA 2BJ1A 5IFMA 1FRJA 1GXUA 4EBCA 1HNZF 3EMTA 3K7RA 2EFVA 4CYUA 3OYBA 4FJ7A 3CO0P 1H0HB 2QO3A 1QVFM 2CZ4A 3UE2A 1HD1A 1LWCB 4O23A 1F3FA 4C0BA 3MECB 3NGRA 2DGOA 2PIIA 1NGAA 3TAQA 3T5JA 4KHNA 4NYZA 4ISGA 2OLWA 3HVTA 3OLAA 2M7SA 3J7ZO 3THXB 1TVRB 4AL7A 4CJKA 4J9NA 3M8QA 3CJ3A 2F40A 4NCGA