3EE9A

Structure of ns1 effector domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NS1A effector domain from the influenza A/Udorn/72 virus.
pubmed doi rcsb
source organism Influenza a virus (a/udorn/307/1972(h3n2))
molecule tags Viral protein
molecule keywords Non-structural protein 1
total genus 33
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ee9A00
3OA9A 3O9UA 2GX9A 3EE9A 3KWGA 3D6RA 3P31A 3L4QA 2KKZA 3O9RA 3RVCA 3M5RA 3EE8A 3P38A 4OPHA 4OPAA 3P39A 3O9QA 3O9TA 3O9SA 2RHKA 3KWIA 3F5TA
chains in the Genus database with same CATH superfamily
2VCPA 4FPAA 4F3OA 5CZ2A 4CF2A 1NK0A 4XEIA 4CEOA 1QSYA 3BF3A 4FWQA 4N56A 5GINA 3LDQA 4BR7A 1SL0A 4IFVA 4DF4A 3C95A 3HRGA 3LDNA 4JKAA 1ATNA 4FZXC 3G6EN 1HKBA 5J2PA 3TI0A 2ASOA 1NGIA 5TKYA 3AVJA 3OS2A 1QQMA 5CR4A 3CPEA 4BC2A 3DLLL 2XRIA 2GTDA 1EWQA 4W5OA 3AVGA 3MXMA 1C0UA 5AQSA 3VGKA 5KQDA 4OLAA 4LFBK 4KHUA 3JXUA 3AV9A 4CIFA 4DMNA 4J2BA 1BUPA 1NGAA 4QOZB 3I56N 1C0MA 3O6WA 4NB4A 2WONA 3DYAA 2F9WA 2F7TA 1B92A 3HPHA 3PIOL 1KTQA 3O4NA 4JAXA 4KTWA 4ISFA 4BE0A 3A8YA 3WT0A 2YCHA 1DTTA 2HMPA 1VK0A 1S1XA 3CQ8A 3O9QA 3QBXA 3T7ZA 4BRMA 4RCHA 1E4FT 4DQQA 2FBYA 4OO1J 4F2RA 3AAQA 3O9UA 1C6VA 4WQ4A 1EWRA 1KVAA 2WBNA 4BR5A 1HNIA 4CERA 1QSLA 3AO5A 4ZTJA 2I7NA 4CK2A 3EE8A 4B1XB 2OTLN 3AVMA 2QWQA 3AARA 4BR2A 4HCCA 1BWFO 2HHQA 1NK4A 2PAVA 4CD1A 1WSGA 2PZSA 1JL1A 3LP1A 3UKRA 4O4GA 3UE5A 2YNHA 4GW6A 1B9DA 1XWLA 4Z0UA 1NNEA 4KTZA 3DLEA 2QWLA 4QS9A 1HYSA 4M42A 3ASMA 2W40A 4DS4A 3EO3A 1BISA 3BDPA 4BVPA 1K9MO 3VERA 2NRRA 1RTIA 4NYNA 4FZYA 4H5WA 3F9KA 1ZYQA 4DV5K 4JNEA 4BDYA 1FJGK 3SNNA 4IEIA 1XNRK 1JLAA 5FPMA 2VWKA 2HBJA 3MN6A 4B9VA 3VQPA 2OZMA 3UKUB 4BRQA 4DSFA 3ATVA 1DTQA 4CF1A 1YT3A 4F4KA 4A5AA 1C1BA 4FW1A 3VN5A 4FJLA 1UOCA 1UA1A 5JVGL 3FGUA 4A62A 4FWRA 2QTDA 2B6AA 2HNZA 1K8KA 3ZCMA 4B1VA 1NK5A 1G15A 3L3VA 3AY9A 2P51A 3OW2M 1FXXA 5K14A 3QEWA 3NGYA 1F21A 2RPIA 1XUPO 2CGJA 3SBGA 3GL1A 3DXMB 3HSTB 3MN7A 3H6EA 3P1GA 3QDKA 1MDUB 1J53A 5JICA 3F9MA 4DS5A 4LF4K 5E84A 1LV5A 3SAGA 4JK9A 2BUPA 1JL2A 5JLFA 4KH4A 4ELUA 3VESA 2UU9K 4ISGA 5E26A 1IV0A 1OVYA 4XH5A 4CJKA 3ID8A 3LAMA 4NXMK 5C24A 5H1SQ 4C8MA 3DOLA 2KTQA 4FLZA 2V7ZA 1Q9XA 2YI1A 4DV7K 4KFBA 3FZFA 4KPYA 3O3HA 2DTUA 4N47A 4FPBA 4DSLA 3ENOA 3OHRA 2CH5A 4Z94A 3DXKA 4FJ7A 3THXA 1WSIA 3D0PA 4F2SA 4DF8A 4LFAK 5JVHL 3NAEA 3HOSA 1ASWA 1RT4A 5HROA 1VHXA 4BDPA 4DTOA 3V9UA 1NK7A 4KHQA 3BY5A 3KHYA 3KWGA 2UUCK 2GWKA 2P9UB 5FRNA 3LL3A 4LSNA 5FPDA 3C7NA 5HP1A 4BACA 2Q0UA 3ZX2A 4JI0K 3TAPA 5KI6A 1TAQA 1HKCA 4RW7A 3KLHA 3FZHA 5ELZA 4IJNA 4B8AB 3GBTA 3CCMN 3RMBA 3P83D 3ZSXA 2YNIA 3EKSA 4IJAA 4PKIA 4K0KK 1TK5A 3WNGA 3VQQA 2HVIA 3TU5A 2P9SB 3EZ5A 1ZC6A 4ILGB 1VSEA 1ASVA 3OBYA 3MWPA 5HL7L 2XY6A 1JKHA 4FM2A 4X66K 4LSLA 3CF5L 3IRXA 4CEDA 1EKEA 4FK2A 4K42A 4NCGA 4BRDA 1NOYA 4JKGB 4MFBA 3A2FA 1LAWA 5EXWA 1CLQA 2HHXA 1OH7A 2F8TA 2HHHK 3TPQA 2QEXN 5LJVA 5JS2A 3LP0A 4CF0A 4FL9A 4CZIA 3SQ0A 3HT3A 4IFYA 3ZETB 1NK9A 4B1ZA 1YVNA 2E1YA 5C12A 1OKJA 4L3QA 2HSTA 5HBMA 3VETA 3FFIA 2F96A 3D7EO 2Z1IA 3E1YA 4CE9A 4BY9C 3SAHA 4ILHA 1VSHA 4FLXA 4N41A 1KCFA 1QZ5A 1RTDA 4B9TA 4GNIA 1X9SA 1S6QA 3HM8A 3VOVA 3ZYYX 4X64K 4HUEA 5I9EB 4ILJA 2NRWA 2UYTA 4BRCA 5A2QO 3CJBA 4KB0A 1NGCA 1HNVA 1NJIO 1GLFO 1S1TA 2VWJA 3OYDA 1TKZA 1YTAA 3CMAN 1HMVA 1VQ9N 1GLAG 4R79A 5DMRA 3V9XA 4I2QA 4CEFA 2FXUA 3CM5A 3HVRA 3HZ6A 3CCQN 3OYMA 1Q81O 3TAMA 3CFRA 1JXEA 1DKGD 2JGUA 2Q3SA 2D0PA 1S72N 3QINA 2P9NB 4CJEA 1NKEA 1C0TA 4CF8A 1VQNN 1NGBA 2A40A 2PFUA 2ZF5O 2D0OA 4OJRA 4M3TA 1TKXA 4O0IA 5AQMA 2QWPA 4H5NA 4FJJA 3C6TA 4CHZA 2YJFA 2VG5A 3LP2A 5AJ3K 1JCEA 4C8KA 5HRNA 1LWEA 3VEOA 3W3DA 3VTIA 1KAZA 2E2PA 4EHUA 4DV2K 2UXBK 4E7HA 2Q36A 4CJ5A 2V51B 4KH5A 3TAFA 4DSJA 3ULEA 3QEXA 1WB9A 1XQSC 4DU1A 3T1AA 3C6UA 3VQ8A 1HLUA 2E4LA 2G8KA 4JKHA 4Y1CA 4K8ZA 3K57A 4Q5VA 1SS6A 3KLFA 3S3NA 1Q7YO 5AR0A 4BG8A 2WOMA 2R7YA 3D45A 4HTUA 3MCPA 4OPJA 4CJFA 1WLJA 3NDKA 2A6AA 4PWDA 2UUBK 5EVZA 2A1RA 3WNFA 4W5TA 4FWPA 2W6KA 2LSNA 4JI6K 1LOTB 1JXBA 1ZBIA 3SMPA 1QQNA 1FK9A 3DLRA 4NLCA 4E1NA 2EX3A 4Z4GA 4DTMA 1C0GA 4I2PA 2G8IA 5JS1A 3AVCA 1BQMA 3KIOA 4BRKA 5EOYA 1M1KO 3AVKA 1FW6A 3KWIA 4DR4K 3ZX0A 4I6MB 1SUQA 4I9LA 1JLFA 1ZBSA 3O80A 3T19A 5M1KA 4QS7A 3PSIA 4E7JA 4YOWA 3MECA 3ZT2A 4DTSA 5EX5A 2BTFA 2HNDA 3K9JA 4B9LA 1NGDA 4C1NI 3AA3A 1T03A 3ZSOA 3B8AX 3SV4A 3AO2A 1U47A 5AQTA 3K5MA 4V19S 1N33K 1TUUA 5EU7A 4B8CA 1IBKK 1Q18A 3VGLA 2OZSA 2P9NA 5AZJA 1O1WA 3CD6N 2NRVA 3ZETA 1S1UA 4AHTA 4WQ4C 2E6MA 4IFEA 2IAJA 4ISEA 1MWKA 3DJCA 4CW7B 4UQGA 1K73O 1T7PA 4CHNA 1S22A 3MX2A 2VWBA 2E88A 1BL3A 3S3OA 5CYQA 4H5VA 3SAFA 2EWSA 2E5LK 3CC4N 4FWSA 2GX9A 2NLXA 3C65A 4B9NA 1L3TA 1Z26A 4H0TB 2A42A 4Y1DA 3VTHA 1E4GT 3QFUA 1NMDA 5HRSA 2ZM6K 4IG3A 3CYMA 3D2EB 3IG1A 2PBDA 3ZT1A 4FLTA 1CXUA 2E1ZA 4M3UA 2YNFA 3A5LC 4CBWA 1IBMK 1YTUA 2HVHA 4DV6K 2V7YA 1A5VA 4FLWA 3NGIA 4O8UA 4BR4A 1RILA 4NYFA 4I9QA 2KKZA 3HOTA 3E01A 3BGRA 2XY7A 4UY8O 4DQSA 1CXQA 3E9OA 3D2FA 3THYB 4EZ6A 3OVNA 2PYJA 4OPAA 3VQEA 3SJJA 4R5PA 4Z4IA 1UAXA 3H3OB 4PY5A 4EP4A 1X9MA 4O5BA 5BR8K 4DV1K 4AHCA 4FJGA 2JWKA 4M63C 3OJSA 4J2DA 5HOOA 4JKFA 3HP9A 3THXB 3LZJA 2D0BA 4ICLA 4FJ5A 2BANA 4DFKA 3DLBA 3AVLA 1FKPA 1P90A 1GOCA 3R8EA 3JYTA 1NOZA 1Z25A 5BRDA 4KO0A 3O1BA 3AA5X 1TYQA 2YHXA 4LY7A 4A61A 4I6MA 1T3VA 3M8QA 4FW2A 3O1WA 3V4IA 4JRQA 4JHDB 1S5JA 4BR0A 5CY4A 4B1YB 1L3SA 2Y1JA 5C42A 4CZMA 3UIQA 2HF4A 2GWJA 1RBTA 3KZBA 5BN8A 5KGXA 3CCSN 2OCEA 4E7IA 3JSMA 3QICA 2G8WA 3CFOA 3ZX3A 2JWLA 4E1MA 1R59O 2ASMA 3CCLN 4CGJA 1UWBA 3CFPA 3ENBA 1VRUA 3MEEA 3DXKB 2W6LA 4BWMA 3PX4A 1KC8O 4U67L 3L6QA 4RG8A 3OYIA 3SUNA 3VQAA 3VEZA 1HNWK 4JK7A 3C6HA 2O8BB 2ZWHA 3OYNA 3CCJN 3ZSZA 1S9GA 4AM6A 1EETA 2F8SA 4ELVA 1RBVA 2P9LA 3DLHA 5AQPA 3WXKA 3BZCA 4GMJB 4FO0A 3F73A 3EN9A 3I8BA 5BR9A 3L2RA 1HYZA 2V52B 1OH8A 2WC9A 3CJCA 2W42A 4BVOA 3FE1A 4OGEA 1SV5A 4IBNA 4ELTA 5C25A 3D2EA 3M5RA 1T8EA 1QVGM 3OTOK 3J81O 4M7XA 3TR8A 4H5RA 1IKVA 4JKBA 3V9WA 3C6AA 2GV9A 4JI1K 3I0RA 1SKSA 4JKCA 3OS0A 5GIOA 2QWNA 5GAHP 1QQCA 3P4IA 4KH6A 3NF7A 3CCUN 4YOYA 1GLLO 3NHGA 2QK9A 4YHHK 4MDAA 3N4PA 5BREA 1C1AA 3ZSRA 3CCRN 1ZBLA 4B9UA 3AVHA 4U7BA 1VQPN 5AQFA 1RCHA 5LY3A 1KXPA 3OS1A 1HQEA 2E2OA 2XHBA 2AJQA 4FJHA 3OA9A 3OYAA 5AQVA 1LW0A 1N32K 2O8CB 1X1PA 3U3GA 4QS8A 2G8VA 3V9ZA 1RDCA 1WSHA 4PA1A 1IKYA 1D8YA 5ADXA 1Z6RA 4FCYA 3DM2A 2CH6A 3L3UA 4PHTX 4H0OA 4E19A 3SZ2A 4K8XA 3L0QA 5HLFA 4FJ8A 4FWMA 1RDDA 1GOAA 3M8RA 3WQUA 2ASPA 1VQ7N 3QETA 1D9DA 4DTJA 4OLBA 2HBMA 4W5QA 5KQ8A 4PKHA 1KSPA 5GIPA 1BCOA 4EIAA 1N5YA 3OYGA 3IKMA 5I42A 3NF8A 4FWLA 3O4QA 5C0YA 1TAUA 1S1VA 2Y1IA 1BQNA 4H8KA 2IOCA 5HRRA 1IJJA 1ZXOA 3DLGA 3QBWA 4M41A 3C94A 1BO5O 4CK1A 4GVMA 1KFDA 4KHSA 1SKWA 4IOAL 3HL8A 1WOQA 4LF6K 2FBXA 3AAPA 5AQNA 3QNNA 5T7BA 4FVUA 2KZMA 3KK3A 3V1QA 5F1XA 4CEBA 4M3YA 3M8SA 2FSKA 4B3TK 3CM6A 1O13A 3E9PA 4AHSA 4NXNK 1Y64A 2P9KA 5F2RA 2D5RA 1HJRA 4KB1A 3VF6A 2VG7A 5KPZA 3MEDA 2KZZA 2Q97A 1C0FA 1BA0A 1I39A 3FZKA 4CJ3A 1YJ9N 4X62K 1HJOA 4Z4HA 4AHRA 4CHOA 2GUIA 3BEXA 2QXFA 2FF6A 2VGMA 3P5JA 4PL7A 1CZAN 3TSPA 5M1NA 3SJHA 3RMAA 2KHOA 5MLCQ 1JLBA 4KHPK 3L2UA 1P8ZA 5EY4A 1S9EA 3KK2A 5CE3A 2OYQA 3UB5A 2IVPA 3QIOA 3F5TA 5AZJB 4JV5K 4DR2K 2O8CA 1GLCG 4DKWA 3PLAA 4GV3A 1L5UA 4B1UB 3ULEB 3RR8A 1QE1A 4L8RB 1VQON 1BG3A 2DFHA 4JI5K 2HB5A 4HWIA 4DCHA 1KLNA 2A5XA 3P39A 4LC9B 4FJ9A 1NKBA 1EQYA 1BHLA 1KVCA 3VQ7A 3SLCA 3WXIA 1HR0K 1EX4A 3EE9A 2DPNA 4IOCL 3EEQA 4CECA 2YJEA 1KD1O 4QCLA 3EY1A 1SZ2A 1J5EK 2HHVA 1HKGA 4MO5A 3LWLA 4WYBA 3OYEA 4DR1K 3FZMA 1S3XA 4JHDA 3TSQA 3VPZA 3OYFA 4DTXA 4NCAA 1BI4B 4CGFA 4BG9A 3U9ZA 1YXQA 4H0YB 2VQFK 3RRGA 4AH9A 4YDUA 1ATSA 3O3GA 4BRPA 4KREA 3LALA 4CJLA 1TKDA 1ZBFA 5KTQA 1RBRA 3AO3A 3WUHA 4GKKK 1TK0A 3I55N 4BGBA 3R9PA 3KLGA 4CFBA 3K5OA 1N8RO 4M3WA 3CXCM 1WBBA 4BWJA 1VRTA 3DOKA 4FK4A 4A59A 5BPLA 4MQ3A 5FPNA 5BRHA 4KAZA 1E3MA 1K6YA 3VA3A 4CEEA 3LM2A 3UKRB 1RFQA 4AHVA 4IXCA 3ZT4A 4O5FA 3U4LA 1GLBG 3CERA 3ZEUA 1TYQB 1LWFA 3IS9A 3H3NO 4WF9L 3F2KA 1W2BM 2PY5A 2HF3A 1YIJN 3BZKA 4BC5A 3U8XA 1GLJO 4YOXA 3SBTA 3QMLA 1FKOA 3NF6A 2F4VK 3VEYA 3TARA 1SAZA 1DT9A 4IKFA 3PO5A 3BF1A 3P31A 3G71N 1EO1A 3O5BA 1MWMA 3D2FB 3THYA 1ILYA 2KLAA 3KD1E 3ALYA 1B9FA 4YORA 1QZ6A 1HRHA 4YFUA 4GV9A 3CC2N 2RE2A 3NF9A 1A5XA 3WXMB 1IG9A 1HPMA 2O8BA 1LCUA 1W9HA 3NE6A 1NLVA 4H03B 2HMIA 4K25A 3LDLA 4IZ9A 2FSNA 5B8HA 5F0XA 4ID1A 3O08A 3J7ZO 2X6NA 4YDUC 2X78A 4JRPA 1JLEA 4DHYA 5FLXO 3LM9A 3DI6A 3VQ9A 1YF5L 2I7PA 4BRFA 4FJXA 5BRFA 4CIEA 4B9QA 5BPNA 1D5AA 2AP1A 1YVUA 4FZZA 3M1FA 4EP5A 1XHXA 2X74A 3CHWA 3Q7CA 2O4GA 3L4QA 3VEWA 5LMUK 3WNEA 1LWCA 3B6OA 2YX6A 3TTFA 1RT1A 1NJZA 1JLQA 4WFAL 1T05A 5GADP 1NG9A 3DRSA 2Z1JA 3L2VA 1CZBA 1T6DA 1WAJA 3ZSYA 2NNWA 4O0JA 1OH5A 3HSCA 4XH4A 5AQYA 4LF8K 1NGHA 4JI4K 3TTDA 5HRPA 3QEPA 3O9SA 4JEPA 5DM6L 4OX9K 5TKWA 4DSKA 3MX5A 4MLHA 3KLIA 1RDBA 3S9HA 4JI8K 3RRHA 4BDZA 3SPYA 1VQMN 2OPRA 2HNYA 5M1OA 3R3LA 1NM1A 2B4JA 5AQOA 4WQ5C 2A41A 2Q0RA 4FJIA 3OYKA 4JD2A 1VQ8N 2NRXA 3TABA 2CGLA 2EHGA 1V4SA 3PV8A 5AQQA 3FR0A 3NVMA 1X3MA 4CIGA 5AZIB 5KPRA 2E20A 3OYCA 4A5BA 3KVGA 4IG0A 3AVNA 3PX6A 2HHSA 1VSLA 4ZTFA 1ZBHA 4RW8A 4CK3A 1RDWX 3H08A 3C7NB 2E6LA 1QSSA 4O55A 3QFPA 3AGRA 1NWKA 1I94K 3MN5A 3LDSA 4DSEA 4CHYA 4O44A 2P9PA 4FLVA 1D4XA 4CGGA 1IKXA 1RBSA 3SYZA 1RNHA 1WBDA 2ZJRL 3ID6A 4FLYA 1BDGA 3HVTA 3TAGA 3LANA 1BA1A 3NH2A 2DFFA 1TVRA 1WNSA 1BCMA 4HVJA 3K5NA 3RWUA 1BIZA 1RT6A 2Q1NA 4AILC 1G99A 4YY3K 3DMJA 1ESVA 1TGOA 4EHTA 2O8DB 2FSJA 5J2MA 3T1HK 3VEXA 2ZD1A 4H0XB 3AO1A 4EAHD 3SI6A 3OJUA 2O8EB 3ATUA 1VSFA 3AVIA 4FJMA 2NRZA 4A57A 3MAQA 4CFAA 4DV3K 3K9KA 4AF1A 3J80O 1XHZA 3MK6A 3DXMA 4DTPA 5DM7L 2NZTA 2BH1A 3PO4A 4JS4A 1BOTO 3MDQA 5BPMA 4BREA 2BGGA 3NBPA 5M1PA 2WUSA 4FWKA 3WEEA 5D3GA 3OY9A 3AVBA 4FK0A 2YHAA 3MCAB 3A5MC 4GY2B 5AQHA 5AZIA 4N76A 2P9KB 1J9AA 1NJYA 2IGIA 3J8AA 4C8OA 4CJWA 2HHWA 3O9RA 1TK8A 3PIPL 4BRHA 5GAGP 3RTVA 4CZGA 4KV8A 4CJUA 3C0BA 4DB3A 1J6ZA 1VQKN 3A5OC 5CYMA 3L2WA 2Q31A 3L2QA 3HM9A 4JLHA 4LF7K 3HO1A 3PSFA 2GBZA 1V4TA 3OYHA 3O4WA 3H1VX 3THWA 3HBTA 3O3FA 4F9OA 1BIUA 3D6RA 1RT3A 2NUBA 1IBLK 4F3TA 4PUOA 1QVFM 5DK5A 1LW2A 4JD2B 3OYJA 2OANA 4JI3K 3P38A 4CJQA 4LF9K 4YOVA 3HI0A 4H0VB 4FOEA 4FJKA 5AQIA 4BRIA 3M8PA 2XY5A 1HNZK 1VSJA 4BGAA 3DRRA 1TL1A 4CESA 1U48A 2D4WA 1RTHA 3I0SA 3CIPA 2A3ZA 3M3ZA 1RGIA 4DR7K 4FM0A 3MXIA 2O8FB 4N5SA 2H3GX 1U6ZA 3VF4A 1ATRA 2IC3A 3LPUA 1N36K 1U49A 2FC0A 4HTLA 3VA0A 4E7KA 3ZSWA 5AFUH 2ZGZA 3VGMA 4QAGA 4BR9A 4E3SA 1VQ5N 1QTMA 4FYDA 4XIUA 1U2VB 4DU4A 1VSMA 1HUXA 2AA4A 3KKSA 2O8DA 1D9FA 2FBVA 2IVOA 4CJ7A 4YOUA 2HBLA 1BI4A 3H45C 4Y0WA 3I33A 3EZWA 4LF5K 2YV0X 4DUZK 3IDHA 1SL1A 2YNGA 4OVLA 2WTUA 3LDPA 3O9TA 3OYBA 4CFDA 5AQWA 4BRLA 1HNXK 2QWOA 4HUGA 3FZLA 1HQUA 3SMSA 5IWAK 5KRSA 1VQ4N 5SZTA 5LJWA 3K58A 4K43A 4OPKA 1QHTA 3GG4A 2KW4A 1M90O 2IS3A 3VEVA 3NMUA 4E1JA 3OYLA 3G25A 3PUFA 2ZJPL 3AVFA 3FLCO 3T3FA 3DAWA 1Q8IA 4JS5A 4BQZA 1W97L 1XMQK 4EZ9A 1N34K 4BC3A 3DWLA 3W0LA 3JAMO 1YITN 2FF3B 5SWMA 2YKNA 3ZEUB 3TWHA 3L4IA 2QKKA 4JK8A 3S41A 3K59A 3SUOA 3QEIA 4DUYK 3G4SN 3CQYA 4K41A 1IO2A 4JI7K 4HHTA 4KKOA 4B9MA 1GLDG 3IFRA 3U3YA 1XMOK 4Q0BA 1MA9B 2YHBA 4RW6A 4OPHA 2RN2A 2Z1HA 2YHWA 1K8KB 4ZHRA 3VF2A 2G8HA 1S6PA 2O4IA 3MXJA 2OPPA 4CGHA 4M3ZA 4GV6A 4G9ZA 3IAYA 4LH5A 2DFEA 1L3UA 4GVEA 4DWIA 4ID5A 3V9SA 4W5NA 4LFCK 1QQOA 5CHIA 3DRPA 4AM7A 1NJWA 5J1EA 1SQKA 4CJTA 2IDOA 3VQDA 4DV0K 3GE1A 3LPTA 3CJ7A 2Q2RA 1RT7A 1WSFA 1JJ2M 3CJ1A 4FWOA 3FFKB 4PL8A 4CBUA 3CC7N 2XO7A 1T6CA 1NMNA 4NCBA 1J5OA 1KAYA 1NJXA 1WUAA 3RSEB 3RR7A 1TKTA 4EFHA 4CD3A 3ZLJA 1OVQA 3B6PA 3CJ9A 1VQ6N 4CJ4A 2P9PB 3K5LA 3VQ6A 4C23A 3O8MA 2FBTA 3L8BA 3QIPA 4A2BA 1Z05A 3THWB 4DR6K 4AHUA 4DSIA 4CJVA 1YJWN 5FROA 4DLGA 4CEAA 4WE1A 3MN9A 3S3MA 3K0SA 4DTNA 2GEMA 4FWNA 3SCXA 4DLEA 3QEVA 4NO7A 1VSDA 4BQLA 2GELA 1C1CA 3KJVA 2QA4N 3ZSVA 1A5WA 2P9UA 5J2NA 1KAXA 2J4RA 5LMNK 1NGGA 1W0HA 1W7AA 3GOIA 4DR3K 4M7YA 2UXCK 4CZFA 1IKWA 4IO9L 4WFBL 4RTFD 4FXDA 3HPGA 4X65K 3LAKA 1NK6A 3G0ZA 4CHPA 3K2PA 3A5NC 4W5RA 3KTQA 2ITGA 4CZLA 4FJNA 4BE1A 1VQLN 3SUQA 1U4BA 3NH1A 4H5TA 4JKDA 3CG7A 4BRGA 5AQLA 1KRPA 5JMVA 2ATQA 1IG8A 3I8DA 2WFBA 3R1XA 1I3AA 1RDUA 4M3XA 1U2VA 3WNHA 4A2AA 4KHNA 4IDHA 3H46O 2B5JA 4KI6A 3T69A 4C8NA 4O8KA 2P5GA 5AQGA 4IWVA 1K8AO 1NK8A 1IH7A 1YJNN 4IO8A 3NCIA 2NRHA 4OGCA 4JKGA 2QWMA 2KFNA 3QB0A 5GAEP 1EP4A 3SK3A 2PYLA 1X9WA 1TV6A 3J7AP 4NLBA 3AA4A 4H4OA 1Q9YA 3N4QA 2O8EA 1H1VA 1U45A 1GOBA 5CZ1A 3IUCA 2P9IB 3SV3A 3HPOA 3AVAA 1DGKN 4MDBA 3J7YP 1NU0A 4C1NK 1RT2A 1XNQK 5M1QA 4B3SK 1UA0A 4CJRA 4CHQA 4H4MA 4DQPA 2VG6A 3U6FA 4E0DA 3GDQA 3G10A 1BGXT 2YHYA 3HXMA 1TUYA 3QESA 5C15A 3SQ2A 3NFAA 1T44A 4KTQA 1S1WA 5M1FA 3AA2A 5AQXA 1KVBA 4BC4A 4M45A 1ITGA 2G8UA 4PKGA 4DR5K 2KQ2A 4CF9A 3NGZA 4CJPA 4HCBA 1X3NA 3WXJA 3V6DA 1WN7A 4DU3A 1J54A 3TTCA 2ZQBA 3ZT3A 4DFMA 4DFJA 3JS6A 4LH4A 4MO4A 1HYVA 4PQUA 4DTRA 1WAFA 2BE2A 3ULDA 1JLGA 1XC3A 5FDLA 3ZSQA 4YNQA 3VQCA 1KLMA 2IIRA 5AQKA 4JYAK 4MLEA 4DQIA 2VYPA 2P9LB 4DQ8A 2RF2A 4RW4A 5JLHA 4KHWA 4CZEA 4OKEA 2DY4A 5LL6Z 1KFSA 4J2AA 5BN9A 3CCEN 4KBOA 3A0IX 3V1OA 4CEQA 1QS4A 4YOTA 3HK2A 2XY8A 2Z1GA 3RVCA 5FPEA 5FRMA 4CVNE 3E9LA 5ADXH 4CJSA 3CQXA 3RSEA 2QM1A 1Q82O 3UKUA 3ENHA 2VQEK 2HBKA 1VSKA 2QKBA 3H1QA 2ZE2A 1KQSM 1RBUA 1DEJA 2F9TA 4TSXA 2O8FA 2P1JA 2HOEA 4C8LA 3AO4A 3CCVN 3LZIA 3VQBA 3V1RA 4XH1A 4Z4EA 4B3OA 3NH0A 3VQ4A 4DFPA 1HPZA 2CGKA 1SKRA 4GKJK 3MEGA 1NGJA 4RW9A 1RT5A 3WQTA 2NRTA 3WXLA 1JLCA 2X6SA 1R0AA 2BDPA 2OPQA 5C2FA 3TAQA 5C2DA 4H0PA 3RMDA 1ASUA 1VSIA 4B3MK 1EXQA 1YI2N 1TL3A 2P9IA 4CFCA 1CZ9A 1NGFA 4CZJA 1REVA 4E7LA 3CJAA 4OKJA 4JN4A 1YHQN 2JLEA 2P5OA 1RTJA 1JCGA 3ISNC 4FLUA 2E8AA 3THVA 3HYFA 3MMVA 4OKKA 4B1WB 2OTJN 4DTUA 3PX0A 1NBWA 4WQ5A 4B9SA 4CZKA 2D0AA 2A1SA 3TAEA 3RMCA 3QERA 4CI6A 2ZJQL 4BRNA 4FM1A 3HJFA 4KHYA 4F8RA 2ZGYA 4DV4K 4I7FA 2UUAK 1Y97A 2QWRA 3M6GA 3CETA 1Q86O 1MU2A 2ETJA 1X9JA 4DQRA 4BRAA 5AQUA 1YAGA 3ITHA 3ZT0A 5AQJA 4CEZA 2W41A 3LP3A 1BU6O 3PY8A 2G8FA 2IVNA 3BUZB 2VGNA 5J2QA 2QXLA 3EYZA 1N6QA 4CGIA 1LAVA 2D0CA 3R6MA 4J2EA 3EL2A 3TANA 3DLKA 1YUWA 4HUFA 1NGEA 3LWMA 1U04A 4BE2A 2ITMA 2FLOA 4DG1A 3SQ4A 4WFNL 3NVKA 4CGDA 3EKUA 3MWTA 2HW3A 4E89A 2UXDK 3AGKA 2HHTA 3QLHA 4B08A 3QNOA 3SUPA 5KGWA 5AFUA 3CI5A 2YKMA 1VAZA 2GUPA 3KKRA 4J8FA 1HX1A 3OBWA 4FSVA 3VQ5A 4AQYK 3T1YK 3TSUA 3BP8A 3WEEB 5KRTA 2KFZA 4G1QA 3KK1A 5I3UA 2HHUA 1ZBUA 1XI1A 1SL2A 2P9SA 2QI2A 4IEEA 3SQ1A 4KI4A 3KD5E 3V81A 1WSJA 3HTVA 3KK7A 2D1KA 4RWTA 1GLEG 4FVMA 3U9DA 3SPZA 4KRFA 2E2NA 1DLOA 3VMFB 3E66A 4CZHA 4LD0A 3Q7BA 2I5JA 4JI2K 4CBXA 4IOXA 3CMEN 3LDOA 3KLEA 4Z4FA 3HP6A 2OA8A 2OPSA 4Z4CA 5E41A 2QW9A 3QO9A 5C10A 1JCFA 3IMXA 1XC9A 4BROA 4FOIA 4JKEA 1RDAA 2E2QA 1L3VA 1NKCA 5AQRA 4IDKA 4WCEL 1QHAA 3CPWM 5IT9O 1OH6A 3VENA 4B3RK 2RKIA 5AQZA 4M3RA 4CCHA 2RHKA 1WSEA 5KPTA
chains in the Genus database with same CATH topology
2VCPA 3SMPA 4FPAA 1QQNA 3EE9A 4NLCA 4GV6A 4G9ZA 2DPNA 4IOCL 1C0GA 2YJEA 1KD1O 4GVEA 1SZ2A 1HKGA 4MO5A 4WYBA 3FZMA 1S3XA 4JHDA 3TSQA 3VPZA 4BRKA 1QQOA 4XEIA 5CHIA 4AM7A 5EOYA 3BF3A 1M1KO 4FWQA 5GINA 1SQKA 3LDQA 4BR7A 4BG9A 3U9ZA 1YXQA 3GE1A 4H0YB 1Q7YO 3HRGA 3CJ7A 3LDNA 4YDUA 4JKAA 3KWIA 2Q2RA 1ATNA 3ZX0A 1JJ2M 1ATSA 4I6MB 3CJ1A 3G6EN 1HKBA 4FWOA 3FFKB 4BRPA 1ZBSA 3O80A 4PL8A 4CBUA 5M1KA 3CC7N 1T6CA 2ASOA 1NGIA 5TKYA 4QS7A 3WUHA 1KAYA 4YOWA 1QQMA 5CR4A 3CPEA 4BC2A 3DLLL 1WUAA 3RSEB 3I55N 4BGBA 3R9PA 2GTDA 4EFHA 5EX5A 4CD3A 2BTFA 1N8RO 3CJ9A 3K9JA 1VQ6N 5AQSA 1NGDA 3VGKA 5KQDA 4C1NI 3CXCM 2P9PB 4C23A 3O8MA 3JXUA 4A2BA 1Z05A 4A59A 5BPLA 3B8AX 5BRHA 5FPNA 3LM2A 1BUPA 3UKRB 1RFQA 5AQTA 1YJWN 1NGAA 4IXCA 1TUUA 3I56N 3O6WA 4NB4A 1Q18A 2F9WA 2F7TA 3MN9A 4O5FA 3U4LA 3VGLA 2P9NA 1GLBG 3CERA 3ZEUA 5AZJA 3PIOL 3CD6N 1TYQB 2NRVA 3ZETA 4JAXA 4ISFA 3H3NO 4WF9L 2GEMA 3A8YA 4FWNA 3WT0A 3F2KA 1W2BM 2YCHA 2HF3A 4WQ4C 1YIJN 4NO7A 4IFEA 4BC5A 2HMPA 3U8XA 4BQLA 1GLJO 4ISEA 3SBTA 2GELA 4YOXA 3QMLA 1MWKA 3DJCA 2QA4N 3VEYA 3O9QA 3QBXA 1K73O 2P9UA 3T7ZA 1S22A 3MX2A 2VWBA 2E88A 4RCHA 1KAXA 1E4FT 4BRMA 1SAZA 4H5VA 1DT9A 2EWSA 2J4RA 3AAQA 3SAFA 4OO1J 3O9UA 3CC4N 4FWSA 1NGGA 2GX9A 2NLXA 3BF1A 3C65A 4WQ4A 3P31A 2WBNA 3GOIA 4BR5A 4M7YA 3G71N 4CZFA 4IO9L 1EO1A 4H0TB 3O5BA 2A42A 1MWMA 4WFBL 3D2FB 3VTHA 1E4GT 2KLAA 4RTFD 1ILYA 4YORA 3QFUA 1QZ6A 2I7NA 1NMDA 3EE8A 3A5NC 4B1XB 4GV9A 2OTLN 3CC2N 4CZLA 2QWQA 2RE2A 1VQLN 3AARA 3D2EB 4BR2A 2PBDA 3WXMB 2E1ZA 4H5TA 1BWFO 1HPMA 3A5LC 4JKDA 4CBWA 1LCUA 4BRGA 5AQLA 2PAVA 5JMVA 2V7YA 4CD1A 1NLVA 4H03B 1IG8A 2WFBA 4K25A 3LDLA 3R1XA 3UKRA 1RDUA 3UE5A 4O8UA 4BR4A 4IZ9A 1U2VA 2FSNA 5B8HA 4A2AA 4IDHA 3H46O 2KKZA 3HOTA 5F0XA 3T69A 3O08A 4O8KA 3J7ZO 4UY8O 2QWLA 4YDUC 4IWVA 5AQGA 3E9OA 4QS9A 1K8AO 3D2FA 4DHYA 4OPAA 3LM9A 1YJNN 4IO8A 2W40A 1YF5L 3H3OB 2I7PA 3EO3A 2NRHA 4BRFA 4JKGA 5BRFA 4BVPA 1K9MO 2QWMA 5BPNA 3VERA 4B9QA 2NRRA 2AP1A 3QB0A 5GAEP 2JWKA 3M1FA 3SK3A 4M63C 4H5WA 3CHWA 5HOOA 3Q7CA 4JKFA 4JNEA 4IEIA 4NLBA 3L4QA 3VEWA 3N4QA 5FPMA 1H1VA 2HBJA 3MN6A 2YX6A 3IUCA 2P9IB 3UKUB 3TTFA 4BRQA 3ATVA 1DGKN 4MDBA 4WFAL 1P90A 5GADP 3R8EA 4A5AA 1S72N 5BRDA 4C1NK 5M1QA 3O1BA 1T6DA 2NNWA 1TYQA 2YHXA 3HSCA 4XH4A 5AQYA 4A61A 1NGHA 5JVGL 3FGUA 4I6MA 3TTDA 4A62A 1T3VA 3O9SA 4FWRA 4JEPA 5TKWA 5DM6L 2QTDA 3MX5A 3O1WA 4MLHA 3GDQA 1K8KA 4B1VA 4JHDB 2YHYA 4BR0A 1TUYA 1VQMN 4B1YB 5C15A 5M1OA 1T44A 3R3LA 5M1FA 3AY9A 1NM1A 4CZMA 5AQXA 3OW2M 5AQOA 2HF4A 2GWJA 4BC4A 4WQ5C 2A41A 3KZBA 2Q0RA 5BN8A 4PKGA 4JD2A 1VQ8N 2NRXA 3CCSN 2CGLA 1V4SA 3QICA 1XUPO 2CGJA 5AQQA 3FR0A 3NVMA 1X3MA 1X3NA 3SBGA 3ZX3A 2JWLA 3GL1A 5AZIB 3WXJA 2E20A 3DXMB 3MN7A 4A5BA 1R59O 5KPRA 3H6EA 2ASMA 3KVGA 3QDKA 3TTCA 1MDUB 5JICA 3CCLN 3F9MA 3ENBA 5E84A 3DXKB 1RDWX 3SAGA 3C7NB 4JK9A 3JS6A 3QFPA 3AGRA 4MO4A 2BUPA 1NWKA 3L6QA 4U67L 5JLFA 1KC8O 4KH4A 3MN5A 3VESA 3VEZA 4ISGA 2P9PA 5E26A 4JK7A 1D4XA 1OVYA 3C6HA 2ZWHA 4XH5A 3CCJN 1XC3A 3ID8A 4AM6A 2ZJRL 3ID6A 2P9LA 1BDGA 2IIRA 5AQKA 5AQPA 3WXKA 4MLEA 5H1SQ 2VYPA 1BA1A 2P9LB 4FO0A 3EN9A 3I8BA 4DQ8A 2V7ZA 5JLHA 4CZEA 2YI1A 5BR9A 2Q1NA 1G99A 2V52B 2WC9A 5BN9A 1ESVA 3FZFA 4EHTA 3CJCA 3CCEN 4KBOA 3A0IX 4BVOA 3FE1A 2FSJA 4FPBA 4YOTA 3RVCA 5FPEA 3VEXA 3ENOA 3OHRA 2CH5A 4Z94A 3DXKA 4H0XB 3D2EA 3E9LA 3M5RA 5ADXH 4EAHD 3CQXA 3RSEA 1QVGM 2QM1A 4M7XA 3ATUA 4H5RA 1Q82O 2NRZA 5JVHL 4A57A 3UKUA 4JKBA 3ENHA 3HOSA 3C6AA 3K9KA 2HBKA 4AF1A 3MK6A 3DXMA 5DM7L 3H1QA 2NZTA 2BH1A 4JKCA 1KQSM 1BOTO 3MDQA 5GIOA 3KHYA 5BPMA 3KWGA 4BREA 2QWNA 5GAHP 3P4IA 1DEJA 2F9TA 2WUSA 5M1PA 2GWKA 2P9UB 4FWKA 4KH6A 3LL3A 4YOYA 3CCUN 1GLLO 2HOEA 5FPDA 3C7NA 3CCVN 3WEEA 4MDAA 3N4PA 5BREA 2Q0UA 4XH1A 3ZX2A 3MCAB 1HKCA 3A5MC 3CCRN 3FZHA 5ELZA 4IJNA 4GY2B 5AQHA 5AZIA 4U7BA 2CGKA 3GBTA 3CCMN 1VQPN 5AQFA 1NGJA 5LY3A 1KXPA 3EKSA 2P9KB 3WQTA 4IJAA 2E2OA 4PKIA 2NRTA 3WXLA 3OA9A 3J8AA 3TU5A 5AQVA 2P9SB 5C2FA 1ZC6A 4ILGB 5C2DA 3OBYA 4H0PA 3MWPA 3O9RA 3PIPL 5HL7L 4BRHA 5GAGP 4QS8A 1YI2N 4CZGA 2P9IA 4DB3A 3C0BA 1J6ZA 5ADXA 1VQKN 1Z6RA 1NGFA 3A5OC 4CZJA 2CH6A 4PHTX 3CJAA 1YHQN 4JN4A 3CF5L 4H0OA 4K42A 2Q31A 4BRDA 3L0QA 1JCGA 2E8AA 4FWMA 4JKGB 3WQUA 2ASPA 3MMVA 1VQ7N 1V4TA 5EXWA 3O4WA 3H1VX 4B1WB 2OTJN 3HBTA 1NBWA 2HBMA 4WQ5A 4F9OA 3TPQA 2QEXN 4CZKA 3D6RA 5LJVA 4FL9A 4CZIA 5KQ8A 4PKHA 4CI6A 1QVFM 2ZJQL 4BRNA 5GIPA 4JD2B 3ZETB 4B1ZA 2OANA 4EIAA 3P38A 2ZGYA 1YVNA 2E1YA 3HI0A 3IKMA 4H0VB 4FOEA 5C12A 4YOVA 2QWRA 3M6GA 5AQIA 3CETA 1Q86O 4BRIA 1OKJA 4FWLA 4L3QA 2HSTA 1X9JA 3VETA 4BRAA 5AQUA 1YAGA 4BGAA 5C0YA 3D7EO 3E1YA 5AQJA 4BY9C 2D4WA 4ILHA 3SAHA 1QZ5A 3CIPA 2A3ZA 2W41A 4GNIA 1BU6O 2IVNA 1IJJA 3HM8A 1ZXOA 2VGNA 3BUZB 3M3ZA 3VOVA 3ZYYX 5I9EB 2QXLA 3QBWA 1RGIA 4ILJA 2NRWA 2UYTA 4BRCA 3R6MA 3EL2A 3CJBA 1BO5O 1NGCA 1NJIO 1GLFO 1YUWA 2H3GX 1U6ZA 1NGEA 3VF4A 1ATRA 3CMAN 4IOAL 2ITMA 2FLOA 4HTLA 1WOQA 4WFNL 1VQ9N 1GLAG 3NVKA 5AFUH 4R79A 2ZGZA 3AAPA 5AQNA 4FVUA 3EKUA 3MWTA 3VGMA 4BR9A 3AGKA 2FXUA 5F1XA 1VQ5N 1U2VB 2AA4A 1HUXA 3HZ6A 5AFUA 3CCQN 3CI5A 1Q81O 2IVOA 2FSKA 4CJ7A 4YOUA 2HBLA 1DKGD 1VAZA 2GUPA 2D0PA 1HX1A 3H45C 3OBWA 4FSVA 1O13A 4J8FA 4Y0WA 3TSUA 3BP8A 3I33A 3WEEB 2P9NB 3EZWA 3E9PA 1VQNN 1NGBA 2A40A 1Y64A 2P9KA 2PFUA 2D0OA 2ZF5O 3IDHA 5F2RA 5AQMA 3LDPA 2QWPA 3O9TA 4H5NA 3VF6A 5KPZA 2Q97A 2P9SA 1C0FA 2QI2A 5AQWA 1BA0A 4IEEA 4BRLA 2QWOA 3FZLA 2YJFA 3SMSA 3FZKA 1YJ9N 1VQ4N 1HJOA 5LJWA 1JCEA 3VEOA 3HTVA 3KK7A 4K43A 2D1KA 3BEXA 3W3DA 4RWTA 1GLEG 3VTIA 3U9DA 1KAZA 2E2PA 2E2NA 3GG4A 4EHUA 3VMFB 1M90O 3VEVA 3E66A 3NMUA 2Q36A 4E1JA 2FF6A 2V51B 2VGMA 4KH5A 3G25A 4CZHA 3ULEA 1CZAN 3Q7BA 4PL7A 3TSPA 5M1NA 3SJHA 2ZJPL 3FLCO 2KHOA 4CBXA 1XQSC 3DAWA 4IOXA 5MLCQ 4BQZA 1HLUA 3CMEN 1W97L 3LDOA 1P8ZA 5EY4A 4JKHA 4BC3A 3DWLA 3W0LA 5CE3A 3UB5A 1YITN 2IVPA 2FF3B 3F5TA 5AZJB 3ZEUB 3L4IA 1GLCG 4JK8A 3S41A 1SS6A 3CQYA 4DKWA 4K41A 3G4SN 3PLAA 4GV3A 2QW9A 4B1UB 1GLDG 3IFRA 5AR0A 1JCFA 3IMXA 3ULEB 4BG8A 5C10A 4BROA 4FOIA 1MA9B 4JKEA 1BG3A 3MCPA 1VQON 4HWIA 4OPHA 4DCHA 2E2QA 2A5XA 2YHWA 1K8KB 3VF2A 5AQRA 2A6AA 3P39A 4WCEL 1QHAA 4LC9B 3CPWM 5EVZA 3VENA 1EQYA 5AQZA 4FWPA 3SLCA 2RHKA 3WXIA 1LOTB 5KPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA9 A;  3O9U A;  2GX9 A;  3EE9 A;  3KWG A;  3D6R A;  3P31 A;  3L4Q A;  2KKZ A;  3O9R A;  3RVC A;  3M5R A;  3EE8 A;  3P38 A;  4OPH A;  4OPA A;  3P39 A;  3O9Q A;  3O9T A;  3O9S A;  2RHK A;  3KWI A;  3F5T A; 
#chains in the Genus database with same CATH topology
 2VCP A;  4FPA A;  4F3O A;  5CZ2 A;  4CF2 A;  1NK0 A;  4XEI A;  4CEO A;  1QSY A;  3BF3 A;  4FWQ A;  4N56 A;  5GIN A;  3LDQ A;  4BR7 A;  1SL0 A;  4IFV A;  4DF4 A;  3C95 A;  3HRG A;  3LDN A;  4JKA A;  1ATN A;  4FZX C;  3G6E N;  1HKB A;  5J2P A;  3TI0 A;  2ASO A;  1NGI A;  5TKY A;  3AVJ A;  3OS2 A;  1QQM A;  5CR4 A;  3CPE A;  4BC2 A;  3DLL L;  2XRI A;  2GTD A;  1EWQ A;  4W5O A;  3AVG A;  3MXM A;  1C0U A;  5AQS A;  3VGK A;  5KQD A;  4OLA A;  4LFB K;  4KHU A;  3JXU A;  3AV9 A;  4CIF A;  4DMN A;  4J2B A;  1BUP A;  1NGA A;  4QOZ B;  3I56 N;  1C0M A;  3O6W A;  4NB4 A;  2WON A;  3DYA A;  2F9W A;  2F7T A;  1B92 A;  3HPH A;  3PIO L;  1KTQ A;  3O4N A;  4JAX A;  4KTW A;  4ISF A;  4BE0 A;  3A8Y A;  3WT0 A;  2YCH A;  1DTT A;  2HMP A;  1VK0 A;  1S1X A;  3CQ8 A;  3O9Q A;  3QBX A;  3T7Z A;  4BRM A;  4RCH A;  1E4F T;  4DQQ A;  2FBY A;  4OO1 J;  4F2R A;  3AAQ A;  3O9U A;  1C6V A;  4WQ4 A;  1EWR A;  1KVA A;  2WBN A;  4BR5 A;  1HNI A;  4CER A;  1QSL A;  3AO5 A;  4ZTJ A;  2I7N A;  4CK2 A;  3EE8 A;  4B1X B;  2OTL N;  3AVM A;  2QWQ A;  3AAR A;  4BR2 A;  4HCC A;  1BWF O;  2HHQ A;  1NK4 A;  2PAV A;  4CD1 A;  1WSG A;  2PZS A;  1JL1 A;  3LP1 A;  3UKR A;  4O4G A;  3UE5 A;  2YNH A;  4GW6 A;  1B9D A;  1XWL A;  4Z0U A;  1NNE A;  4KTZ A;  3DLE A;  2QWL A;  4QS9 A;  1HYS A;  4M42 A;  3ASM A;  2W40 A;  4DS4 A;  3EO3 A;  1BIS A;  3BDP A;  4BVP A;  1K9M O;  3VER A;  2NRR A;  1RTI A;  4NYN A;  4FZY A;  4H5W A;  3F9K A;  1ZYQ A;  4DV5 K;  4JNE A;  4BDY A;  1FJG K;  3SNN A;  4IEI A;  1XNR K;  1JLA A;  5FPM A;  2VWK A;  2HBJ A;  3MN6 A;  4B9V A;  3VQP A;  2OZM A;  3UKU B;  4BRQ A;  4DSF A;  3ATV A;  1DTQ A;  4CF1 A;  1YT3 A;  4F4K A;  4A5A A;  1C1B A;  4FW1 A;  3VN5 A;  4FJL A;  1UOC A;  1UA1 A;  5JVG L;  3FGU A;  4A62 A;  4FWR A;  2QTD A;  2B6A A;  2HNZ A;  1K8K A;  3ZCM A;  4B1V A;  1NK5 A;  1G15 A;  3L3V A;  3AY9 A;  2P51 A;  3OW2 M;  1FXX A;  5K14 A;  3QEW A;  3NGY A;  1F21 A;  2RPI A;  1XUP O;  2CGJ A;  3SBG A;  3GL1 A;  3DXM B;  3HST B;  3MN7 A;  3H6E A;  3P1G A;  3QDK A;  1MDU B;  1J53 A;  5JIC A;  3F9M A;  4DS5 A;  4LF4 K;  5E84 A;  1LV5 A;  3SAG A;  4JK9 A;  2BUP A;  1JL2 A;  5JLF A;  4KH4 A;  4ELU A;  3VES A;  2UU9 K;  4ISG A;  5E26 A;  1IV0 A;  1OVY A;  4XH5 A;  4CJK A;  3ID8 A;  3LAM A;  4NXM K;  5C24 A;  5H1S Q;  4C8M A;  3DOL A;  2KTQ A;  4FLZ A;  2V7Z A;  1Q9X A;  2YI1 A;  4DV7 K;  4KFB A;  3FZF A;  4KPY A;  3O3H A;  2DTU A;  4N47 A;  4FPB A;  4DSL A;  3ENO A;  3OHR A;  2CH5 A;  4Z94 A;  3DXK A;  4FJ7 A;  3THX A;  1WSI A;  3D0P A;  4F2S A;  4DF8 A;  4LFA K;  5JVH L;  3NAE A;  3HOS A;  1ASW A;  1RT4 A;  5HRO A;  1VHX A;  4BDP A;  4DTO A;  3V9U A;  1NK7 A;  4KHQ A;  3BY5 A;  3KHY A;  3KWG A;  2UUC K;  2GWK A;  2P9U B;  5FRN A;  3LL3 A;  4LSN A;  5FPD A;  3C7N A;  5HP1 A;  4BAC A;  2Q0U A;  3ZX2 A;  4JI0 K;  3TAP A;  5KI6 A;  1TAQ A;  1HKC A;  4RW7 A;  3KLH A;  3FZH A;  5ELZ A;  4IJN A;  4B8A B;  3GBT A;  3CCM N;  3RMB A;  3P83 D;  3ZSX A;  2YNI A;  3EKS A;  4IJA A;  4PKI A;  4K0K K;  1TK5 A;  3WNG A;  3VQQ A;  2HVI A;  3TU5 A;  2P9S B;  3EZ5 A;  1ZC6 A;  4ILG B;  1VSE A;  1ASV A;  3OBY A;  3MWP A;  5HL7 L;  2XY6 A;  1JKH A;  4FM2 A;  4X66 K;  4LSL A;  3CF5 L;  3IRX A;  4CED A;  1EKE A;  4FK2 A;  4K42 A;  4NCG A;  4BRD A;  1NOY A;  4JKG B;  4MFB A;  3A2F A;  1LAW A;  5EXW A;  1CLQ A;  2HHX A;  1OH7 A;  2F8T A;  2HHH K;  3TPQ A;  2QEX N;  5LJV A;  5JS2 A;  3LP0 A;  4CF0 A;  4FL9 A;  4CZI A;  3SQ0 A;  3HT3 A;  4IFY A;  3ZET B;  1NK9 A;  4B1Z A;  1YVN A;  2E1Y A;  5C12 A;  1OKJ A;  4L3Q A;  2HST A;  5HBM A;  3VET A;  3FFI A;  2F96 A;  3D7E O;  2Z1I A;  3E1Y A;  4CE9 A;  4BY9 C;  3SAH A;  4ILH A;  1VSH A;  4FLX A;  4N41 A;  1KCF A;  1QZ5 A;  1RTD A;  4B9T A;  4GNI A;  1X9S A;  1S6Q A;  3HM8 A;  3VOV A;  3ZYY X;  4X64 K;  4HUE A;  5I9E B;  4ILJ A;  2NRW A;  2UYT A;  4BRC A;  5A2Q O;  3CJB A;  4KB0 A;  1NGC A;  1HNV A;  1NJI O;  1GLF O;  1S1T A;  2VWJ A;  3OYD A;  1TKZ A;  1YTA A;  3CMA N;  1HMV A;  1VQ9 N;  1GLA G;  4R79 A;  5DMR A;  3V9X A;  4I2Q A;  4CEF A;  2FXU A;  3CM5 A;  3HVR A;  3HZ6 A;  3CCQ N;  3OYM A;  1Q81 O;  3TAM A;  3CFR A;  1JXE A;  1DKG D;  2JGU A;  2Q3S A;  2D0P A;  1S72 N;  3QIN A;  2P9N B;  4CJE A;  1NKE A;  1C0T A;  4CF8 A;  1VQN N;  1NGB A;  2A40 A;  2PFU A;  2ZF5 O;  2D0O A;  4OJR A;  4M3T A;  1TKX A;  4O0I A;  5AQM A;  2QWP A;  4H5N A;  4FJJ A;  3C6T A;  4CHZ A;  2YJF A;  2VG5 A;  3LP2 A;  5AJ3 K;  1JCE A;  4C8K A;  5HRN A;  1LWE A;  3VEO A;  3W3D A;  3VTI A;  1KAZ A;  2E2P A;  4EHU A;  4DV2 K;  2UXB K;  4E7H A;  2Q36 A;  4CJ5 A;  2V51 B;  4KH5 A;  3TAF A;  4DSJ A;  3ULE A;  3QEX A;  1WB9 A;  1XQS C;  4DU1 A;  3T1A A;  3C6U A;  3VQ8 A;  1HLU A;  2E4L A;  2G8K A;  4JKH A;  4Y1C A;  4K8Z A;  3K57 A;  4Q5V A;  1SS6 A;  3KLF A;  3S3N A;  1Q7Y O;  5AR0 A;  4BG8 A;  2WOM A;  2R7Y A;  3D45 A;  4HTU A;  3MCP A;  4OPJ A;  4CJF A;  1WLJ A;  3NDK A;  2A6A A;  4PWD A;  2UUB K;  5EVZ A;  2A1R A;  3WNF A;  4W5T A;  4FWP A;  2W6K A;  2LSN A;  4JI6 K;  1LOT B;  1JXB A;  1ZBI A;  3SMP A;  1QQN A;  1FK9 A;  3DLR A;  4NLC A;  4E1N A;  2EX3 A;  4Z4G A;  4DTM A;  1C0G A;  4I2P A;  2G8I A;  5JS1 A;  3AVC A;  1BQM A;  3KIO A;  4BRK A;  5EOY A;  1M1K O;  3AVK A;  1FW6 A;  3KWI A;  4DR4 K;  3ZX0 A;  4I6M B;  1SUQ A;  4I9L A;  1JLF A;  1ZBS A;  3O80 A;  3T19 A;  5M1K A;  4QS7 A;  3PSI A;  4E7J A;  4YOW A;  3MEC A;  3ZT2 A;  4DTS A;  5EX5 A;  2BTF A;  2HND A;  3K9J A;  4B9L A;  1NGD A;  4C1N I;  3AA3 A;  1T03 A;  3ZSO A;  3B8A X;  3SV4 A;  3AO2 A;  1U47 A;  5AQT A;  3K5M A;  4V19 S;  1N33 K;  1TUU A;  5EU7 A;  4B8C A;  1IBK K;  1Q18 A;  3VGL A;  2OZS A;  2P9N A;  5AZJ A;  1O1W A;  3CD6 N;  2NRV A;  3ZET A;  1S1U A;  4AHT A;  4WQ4 C;  2E6M A;  4IFE A;  2IAJ A;  4ISE A;  1MWK A;  3DJC A;  4CW7 B;  4UQG A;  1K73 O;  1T7P A;  4CHN A;  1S22 A;  3MX2 A;  2VWB A;  2E88 A;  1BL3 A;  3S3O A;  5CYQ A;  4H5V A;  3SAF A;  2EWS A;  2E5L K;  3CC4 N;  4FWS A;  2GX9 A;  2NLX A;  3C65 A;  4B9N A;  1L3T A;  1Z26 A;  4H0T B;  2A42 A;  4Y1D A;  3VTH A;  1E4G T;  3QFU A;  1NMD A;  5HRS A;  2ZM6 K;  4IG3 A;  3CYM A;  3D2E B;  3IG1 A;  2PBD A;  3ZT1 A;  4FLT A;  1CXU A;  2E1Z A;  4M3U A;  2YNF A;  3A5L C;  4CBW A;  1IBM K;  1YTU A;  2HVH A;  4DV6 K;  2V7Y A;  1A5V A;  4FLW A;  3NGI A;  4O8U A;  4BR4 A;  1RIL A;  4NYF A;  4I9Q A;  2KKZ A;  3HOT A;  3E01 A;  3BGR A;  2XY7 A;  4UY8 O;  4DQS A;  1CXQ A;  3E9O A;  3D2F A;  3THY B;  4EZ6 A;  3OVN A;  2PYJ A;  4OPA A;  3VQE A;  3SJJ A;  4R5P A;  4Z4I A;  1UAX A;  3H3O B;  4PY5 A;  4EP4 A;  1X9M A;  4O5B A;  5BR8 K;  4DV1 K;  4AHC A;  4FJG A;  2JWK A;  4M63 C;  3OJS A;  4J2D A;  5HOO A;  4JKF A;  3HP9 A;  3THX B;  3LZJ A;  2D0B A;  4ICL A;  4FJ5 A;  2BAN A;  4DFK A;  3DLB A;  3AVL A;  1FKP A;  1P90 A;  1GOC A;  3R8E A;  3JYT A;  1NOZ A;  1Z25 A;  5BRD A;  4KO0 A;  3O1B A;  3AA5 X;  1TYQ A;  2YHX A;  4LY7 A;  4A61 A;  4I6M A;  1T3V A;  3M8Q A;  4FW2 A;  3O1W A;  3V4I A;  4JRQ A;  4JHD B;  1S5J A;  4BR0 A;  5CY4 A;  4B1Y B;  1L3S A;  2Y1J A;  5C42 A;  4CZM A;  3UIQ A;  2HF4 A;  2GWJ A;  1RBT A;  3KZB A;  5BN8 A;  5KGX A;  3CCS N;  2OCE A;  4E7I A;  3JSM A;  3QIC A;  2G8W A;  3CFO A;  3ZX3 A;  2JWL A;  4E1M A;  1R59 O;  2ASM A;  3CCL N;  4CGJ A;  1UWB A;  3CFP A;  3ENB A;  1VRU A;  3MEE A;  3DXK B;  2W6L A;  4BWM A;  3PX4 A;  1KC8 O;  4U67 L;  3L6Q A;  4RG8 A;  3OYI A;  3SUN A;  3VQA A;  3VEZ A;  1HNW K;  4JK7 A;  3C6H A;  2O8B B;  2ZWH A;  3OYN A;  3CCJ N;  3ZSZ A;  1S9G A;  4AM6 A;  1EET A;  2F8S A;  4ELV A;  1RBV A;  2P9L A;  3DLH A;  5AQP A;  3WXK A;  3BZC A;  4GMJ B;  4FO0 A;  3F73 A;  3EN9 A;  3I8B A;  5BR9 A;  3L2R A;  1HYZ A;  2V52 B;  1OH8 A;  2WC9 A;  3CJC A;  2W42 A;  4BVO A;  3FE1 A;  4OGE A;  1SV5 A;  4IBN A;  4ELT A;  5C25 A;  3D2E A;  3M5R A;  1T8E A;  1QVG M;  3OTO K;  3J81 O;  4M7X A;  3TR8 A;  4H5R A;  1IKV A;  4JKB A;  3V9W A;  3C6A A;  2GV9 A;  4JI1 K;  3I0R A;  1SKS A;  4JKC A;  3OS0 A;  5GIO A;  2QWN A;  5GAH P;  1QQC A;  3P4I A;  4KH6 A;  3NF7 A;  3CCU N;  4YOY A;  1GLL O;  3NHG A;  2QK9 A;  4YHH K;  4MDA A;  3N4P A;  5BRE A;  1C1A A;  3ZSR A;  3CCR N;  1ZBL A;  4B9U A;  3AVH A;  4U7B A;  1VQP N;  5AQF A;  1RCH A;  5LY3 A;  1KXP A;  3OS1 A;  1HQE A;  2E2O A;  2XHB A;  2AJQ A;  4FJH A;  3OA9 A;  3OYA A;  5AQV A;  1LW0 A;  1N32 K;  2O8C B;  1X1P A;  3U3G A;  4QS8 A;  2G8V A;  3V9Z A;  1RDC A;  1WSH A;  4PA1 A;  1IKY A;  1D8Y A;  5ADX A;  1Z6R A;  4FCY A;  3DM2 A;  2CH6 A;  3L3U A;  4PHT X;  4H0O A;  4E19 A;  3SZ2 A;  4K8X A;  3L0Q A;  5HLF A;  4FJ8 A;  4FWM A;  1RDD A;  1GOA A;  3M8R A;  3WQU A;  2ASP A;  1VQ7 N;  3QET A;  1D9D A;  4DTJ A;  4OLB A;  2HBM A;  4W5Q A;  5KQ8 A;  4PKH A;  1KSP A;  5GIP A;  1BCO A;  4EIA A;  1N5Y A;  3OYG A;  3IKM A;  5I42 A;  3NF8 A;  4FWL A;  3O4Q A;  5C0Y A;  1TAU A;  1S1V A;  2Y1I A;  1BQN A;  4H8K A;  2IOC A;  5HRR A;  1IJJ A;  1ZXO A;  3DLG A;  3QBW A;  4M41 A;  3C94 A;  1BO5 O;  4CK1 A;  4GVM A;  1KFD A;  4KHS A;  1SKW A;  4IOA L;  3HL8 A;  1WOQ A;  4LF6 K;  2FBX A;  3AAP A;  5AQN A;  3QNN A;  5T7B A;  4FVU A;  2KZM A;  3KK3 A;  3V1Q A;  5F1X A;  4CEB A;  4M3Y A;  3M8S A;  2FSK A;  4B3T K;  3CM6 A;  1O13 A;  3E9P A;  4AHS A;  4NXN K;  1Y64 A;  2P9K A;  5F2R A;  2D5R A;  1HJR A;  4KB1 A;  3VF6 A;  2VG7 A;  5KPZ A;  3MED A;  2KZZ A;  2Q97 A;  1C0F A;  1BA0 A;  1I39 A;  3FZK A;  4CJ3 A;  1YJ9 N;  4X62 K;  1HJO A;  4Z4H A;  4AHR A;  4CHO A;  2GUI A;  3BEX A;  2QXF A;  2FF6 A;  2VGM A;  3P5J A;  4PL7 A;  1CZA N;  3TSP A;  5M1N A;  3SJH A;  3RMA A;  2KHO A;  5MLC Q;  1JLB A;  4KHP K;  3L2U A;  1P8Z A;  5EY4 A;  1S9E A;  3KK2 A;  5CE3 A;  2OYQ A;  3UB5 A;  2IVP A;  3QIO A;  3F5T A;  5AZJ B;  4JV5 K;  4DR2 K;  2O8C A;  1GLC G;  4DKW A;  3PLA A;  4GV3 A;  1L5U A;  4B1U B;  3ULE B;  3RR8 A;  1QE1 A;  4L8R B;  1VQO N;  1BG3 A;  2DFH A;  4JI5 K;  2HB5 A;  4HWI A;  4DCH A;  1KLN A;  2A5X A;  3P39 A;  4LC9 B;  4FJ9 A;  1NKB A;  1EQY A;  1BHL A;  1KVC A;  3VQ7 A;  3SLC A;  3WXI A;  1HR0 K;  1EX4 A;  3EE9 A;  2DPN A;  4IOC L;  3EEQ A;  4CEC A;  2YJE A;  1KD1 O;  4QCL A;  3EY1 A;  1SZ2 A;  1J5E K;  2HHV A;  1HKG A;  4MO5 A;  3LWL A;  4WYB A;  3OYE A;  4DR1 K;  3FZM A;  1S3X A;  4JHD A;  3TSQ A;  3VPZ A;  3OYF A;  4DTX A;  4NCA A;  1BI4 B;  4CGF A;  4BG9 A;  3U9Z A;  1YXQ A;  4H0Y B;  2VQF K;  3RRG A;  4AH9 A;  4YDU A;  1ATS A;  3O3G A;  4BRP A;  4KRE A;  3LAL A;  4CJL A;  1TKD A;  1ZBF A;  5KTQ A;  1RBR A;  3AO3 A;  3WUH A;  4GKK K;  1TK0 A;  3I55 N;  4BGB A;  3R9P A;  3KLG A;  4CFB A;  3K5O A;  1N8R O;  4M3W A;  3CXC M;  1WBB A;  4BWJ A;  1VRT A;  3DOK A;  4FK4 A;  4A59 A;  5BPL A;  4MQ3 A;  5FPN A;  5BRH A;  4KAZ A;  1E3M A;  1K6Y A;  3VA3 A;  4CEE A;  3LM2 A;  3UKR B;  1RFQ A;  4AHV A;  4IXC A;  3ZT4 A;  4O5F A;  3U4L A;  1GLB G;  3CER A;  3ZEU A;  1TYQ B;  1LWF A;  3IS9 A;  3H3N O;  4WF9 L;  3F2K A;  1W2B M;  2PY5 A;  2HF3 A;  1YIJ N;  3BZK A;  4BC5 A;  3U8X A;  1GLJ O;  4YOX A;  3SBT A;  3QML A;  1FKO A;  3NF6 A;  2F4V K;  3VEY A;  3TAR A;  1SAZ A;  1DT9 A;  4IKF A;  3PO5 A;  3BF1 A;  3P31 A;  3G71 N;  1EO1 A;  3O5B A;  1MWM A;  3D2F B;  3THY A;  1ILY A;  2KLA A;  3KD1 E;  3ALY A;  1B9F A;  4YOR A;  1QZ6 A;  1HRH A;  4YFU A;  4GV9 A;  3CC2 N;  2RE2 A;  3NF9 A;  1A5X A;  3WXM B;  1IG9 A;  1HPM A;  2O8B A;  1LCU A;  1W9H A;  3NE6 A;  1NLV A;  4H03 B;  2HMI A;  4K25 A;  3LDL A;  4IZ9 A;  2FSN A;  5B8H A;  5F0X A;  4ID1 A;  3O08 A;  3J7Z O;  2X6N A;  4YDU C;  2X78 A;  4JRP A;  1JLE A;  4DHY A;  5FLX O;  3LM9 A;  3DI6 A;  3VQ9 A;  1YF5 L;  2I7P A;  4BRF A;  4FJX A;  5BRF A;  4CIE A;  4B9Q A;  5BPN A;  1D5A A;  2AP1 A;  1YVU A;  4FZZ A;  3M1F A;  4EP5 A;  1XHX A;  2X74 A;  3CHW A;  3Q7C A;  2O4G A;  3L4Q A;  3VEW A;  5LMU K;  3WNE A;  1LWC A;  3B6O A;  2YX6 A;  3TTF A;  1RT1 A;  1NJZ A;  1JLQ A;  4WFA L;  1T05 A;  5GAD P;  1NG9 A;  3DRS A;  2Z1J A;  3L2V A;  1CZB A;  1T6D A;  1WAJ A;  3ZSY A;  2NNW A;  4O0J A;  1OH5 A;  3HSC A;  4XH4 A;  5AQY A;  4LF8 K;  1NGH A;  4JI4 K;  3TTD A;  5HRP A;  3QEP A;  3O9S A;  4JEP A;  5DM6 L;  4OX9 K;  5TKW A;  4DSK A;  3MX5 A;  4MLH A;  3KLI A;  1RDB A;  3S9H A;  4JI8 K;  3RRH A;  4BDZ A;  3SPY A;  1VQM N;  2OPR A;  2HNY A;  5M1O A;  3R3L A;  1NM1 A;  2B4J A;  5AQO A;  4WQ5 C;  2A41 A;  2Q0R A;  4FJI A;  3OYK A;  4JD2 A;  1VQ8 N;  2NRX A;  3TAB A;  2CGL A;  2EHG A;  1V4S A;  3PV8 A;  5AQQ A;  3FR0 A;  3NVM A;  1X3M A;  4CIG A;  5AZI B;  5KPR A;  2E20 A;  3OYC A;  4A5B A;  3KVG A;  4IG0 A;  3AVN A;  3PX6 A;  2HHS A;  1VSL A;  4ZTF A;  1ZBH A;  4RW8 A;  4CK3 A;  1RDW X;  3H08 A;  3C7N B;  2E6L A;  1QSS A;  4O55 A;  3QFP A;  3AGR A;  1NWK A;  1I94 K;  3MN5 A;  3LDS A;  4DSE A;  4CHY A;  4O44 A;  2P9P A;  4FLV A;  1D4X A;  4CGG A;  1IKX A;  1RBS A;  3SYZ A;  1RNH A;  1WBD A;  2ZJR L;  3ID6 A;  4FLY A;  1BDG A;  3HVT A;  3TAG A;  3LAN A;  1BA1 A;  3NH2 A;  2DFF A;  1TVR A;  1WNS A;  1BCM A;  4HVJ A;  3K5N A;  3RWU A;  1BIZ A;  1RT6 A;  2Q1N A;  4AIL C;  1G99 A;  4YY3 K;  3DMJ A;  1ESV A;  1TGO A;  4EHT A;  2O8D B;  2FSJ A;  5J2M A;  3T1H K;  3VEX A;  2ZD1 A;  4H0X B;  3AO1 A;  4EAH D;  3SI6 A;  3OJU A;  2O8E B;  3ATU A;  1VSF A;  3AVI A;  4FJM A;  2NRZ A;  4A57 A;  3MAQ A;  4CFA A;  4DV3 K;  3K9K A;  4AF1 A;  3J80 O;  1XHZ A;  3MK6 A;  3DXM A;  4DTP A;  5DM7 L;  2NZT A;  2BH1 A;  3PO4 A;  4JS4 A;  1BOT O;  3MDQ A;  5BPM A;  4BRE A;  2BGG A;  3NBP A;  5M1P A;  2WUS A;  4FWK A;  3WEE A;  5D3G A;  3OY9 A;  3AVB A;  4FK0 A;  2YHA A;  3MCA B;  3A5M C;  4GY2 B;  5AQH A;  5AZI A;  4N76 A;  2P9K B;  1J9A A;  1NJY A;  2IGI A;  3J8A A;  4C8O A;  4CJW A;  2HHW A;  3O9R A;  1TK8 A;  3PIP L;  4BRH A;  5GAG P;  3RTV A;  4CZG A;  4KV8 A;  4CJU A;  3C0B A;  4DB3 A;  1J6Z A;  1VQK N;  3A5O C;  5CYM A;  3L2W A;  2Q31 A;  3L2Q A;  3HM9 A;  4JLH A;  4LF7 K;  3HO1 A;  3PSF A;  2GBZ A;  1V4T A;  3OYH A;  3O4W A;  3H1V X;  3THW A;  3HBT A;  3O3F A;  4F9O A;  1BIU A;  3D6R A;  1RT3 A;  2NUB A;  1IBL K;  4F3T A;  4PUO A;  1QVF M;  5DK5 A;  1LW2 A;  4JD2 B;  3OYJ A;  2OAN A;  4JI3 K;  3P38 A;  4CJQ A;  4LF9 K;  4YOV A;  3HI0 A;  4H0V B;  4FOE A;  4FJK A;  5AQI A;  4BRI A;  3M8P A;  2XY5 A;  1HNZ K;  1VSJ A;  4BGA A;  3DRR A;  1TL1 A;  4CES A;  1U48 A;  2D4W A;  1RTH A;  3I0S A;  3CIP A;  2A3Z A;  3M3Z A;  1RGI A;  4DR7 K;  4FM0 A;  3MXI A;  2O8F B;  4N5S A;  2H3G X;  1U6Z A;  3VF4 A;  1ATR A;  2IC3 A;  3LPU A;  1N36 K;  1U49 A;  2FC0 A;  4HTL A;  3VA0 A;  4E7K A;  3ZSW A;  5AFU H;  2ZGZ A;  3VGM A;  4QAG A;  4BR9 A;  4E3S A;  1VQ5 N;  1QTM A;  4FYD A;  4XIU A;  1U2V B;  4DU4 A;  1VSM A;  1HUX A;  2AA4 A;  3KKS A;  2O8D A;  1D9F A;  2FBV A;  2IVO A;  4CJ7 A;  4YOU A;  2HBL A;  1BI4 A;  3H45 C;  4Y0W A;  3I33 A;  3EZW A;  4LF5 K;  2YV0 X;  4DUZ K;  3IDH A;  1SL1 A;  2YNG A;  4OVL A;  2WTU A;  3LDP A;  3O9T A;  3OYB A;  4CFD A;  5AQW A;  4BRL A;  1HNX K;  2QWO A;  4HUG A;  3FZL A;  1HQU A;  3SMS A;  5IWA K;  5KRS A;  1VQ4 N;  5SZT A;  5LJW A;  3K58 A;  4K43 A;  4OPK A;  1QHT A;  3GG4 A;  2KW4 A;  1M90 O;  2IS3 A;  3VEV A;  3NMU A;  4E1J A;  3OYL A;  3G25 A;  3PUF A;  2ZJP L;  3AVF A;  3FLC O;  3T3F A;  3DAW A;  1Q8I A;  4JS5 A;  4BQZ A;  1W97 L;  1XMQ K;  4EZ9 A;  1N34 K;  4BC3 A;  3DWL A;  3W0L A;  3JAM O;  1YIT N;  2FF3 B;  5SWM A;  2YKN A;  3ZEU B;  3TWH A;  3L4I A;  2QKK A;  4JK8 A;  3S41 A;  3K59 A;  3SUO A;  3QEI A;  4DUY K;  3G4S N;  3CQY A;  4K41 A;  1IO2 A;  4JI7 K;  4HHT A;  4KKO A;  4B9M A;  1GLD G;  3IFR A;  3U3Y A;  1XMO K;  4Q0B A;  1MA9 B;  2YHB A;  4RW6 A;  4OPH A;  2RN2 A;  2Z1H A;  2YHW A;  1K8K B;  4ZHR A;  3VF2 A;  2G8H A;  1S6P A;  2O4I A;  3MXJ A;  2OPP A;  4CGH A;  4M3Z A;  4GV6 A;  4G9Z A;  3IAY A;  4LH5 A;  2DFE A;  1L3U A;  4GVE A;  4DWI A;  4ID5 A;  3V9S A;  4W5N A;  4LFC K;  1QQO A;  5CHI A;  3DRP A;  4AM7 A;  1NJW A;  5J1E A;  1SQK A;  4CJT A;  2IDO A;  3VQD A;  4DV0 K;  3GE1 A;  3LPT A;  3CJ7 A;  2Q2R A;  1RT7 A;  1WSF A;  1JJ2 M;  3CJ1 A;  4FWO A;  3FFK B;  4PL8 A;  4CBU A;  3CC7 N;  2XO7 A;  1T6C A;  1NMN A;  4NCB A;  1J5O A;  1KAY A;  1NJX A;  1WUA A;  3RSE B;  3RR7 A;  1TKT A;  4EFH A;  4CD3 A;  3ZLJ A;  1OVQ A;  3B6P A;  3CJ9 A;  1VQ6 N;  4CJ4 A;  2P9P B;  3K5L A;  3VQ6 A;  4C23 A;  3O8M A;  2FBT A;  3L8B A;  3QIP A;  4A2B A;  1Z05 A;  3THW B;  4DR6 K;  4AHU A;  4DSI A;  4CJV A;  1YJW N;  5FRO A;  4DLG A;  4CEA A;  4WE1 A;  3MN9 A;  3S3M A;  3K0S A;  4DTN A;  2GEM A;  4FWN A;  3SCX A;  4DLE A;  3QEV A;  4NO7 A;  1VSD A;  4BQL A;  2GEL A;  1C1C A;  3KJV A;  2QA4 N;  3ZSV A;  1A5W A;  2P9U A;  5J2N A;  1KAX A;  2J4R A;  5LMN K;  1NGG A;  1W0H A;  1W7A A;  3GOI A;  4DR3 K;  4M7Y A;  2UXC K;  4CZF A;  1IKW A;  4IO9 L;  4WFB L;  4RTF D;  4FXD A;  3HPG A;  4X65 K;  3LAK A;  1NK6 A;  3G0Z A;  4CHP A;  3K2P A;  3A5N C;  4W5R A;  3KTQ A;  2ITG A;  4CZL A;  4FJN A;  4BE1 A;  1VQL N;  3SUQ A;  1U4B A;  3NH1 A;  4H5T A;  4JKD A;  3CG7 A;  4BRG A;  5AQL A;  1KRP A;  5JMV A;  2ATQ A;  1IG8 A;  3I8D A;  2WFB A;  3R1X A;  1I3A A;  1RDU A;  4M3X A;  1U2V A;  3WNH A;  4A2A A;  4KHN A;  4IDH A;  3H46 O;  2B5J A;  4KI6 A;  3T69 A;  4C8N A;  4O8K A;  2P5G A;  5AQG A;  4IWV A;  1K8A O;  1NK8 A;  1IH7 A;  1YJN N;  4IO8 A;  3NCI A;  2NRH A;  4OGC A;  4JKG A;  2QWM A;  2KFN A;  3QB0 A;  5GAE P;  1EP4 A;  3SK3 A;  2PYL A;  1X9W A;  1TV6 A;  3J7A P;  4NLB A;  3AA4 A;  4H4O A;  1Q9Y A;  3N4Q A;  2O8E A;  1H1V A;  1U45 A;  1GOB A;  5CZ1 A;  3IUC A;  2P9I B;  3SV3 A;  3HPO A;  3AVA A;  1DGK N;  4MDB A;  3J7Y P;  1NU0 A;  4C1N K;  1RT2 A;  1XNQ K;  5M1Q A;  4B3S K;  1UA0 A;  4CJR A;  4CHQ A;  4H4M A;  4DQP A;  2VG6 A;  3U6F A;  4E0D A;  3GDQ A;  3G10 A;  1BGX T;  2YHY A;  3HXM A;  1TUY A;  3QES A;  5C15 A;  3SQ2 A;  3NFA A;  1T44 A;  4KTQ A;  1S1W A;  5M1F A;  3AA2 A;  5AQX A;  1KVB A;  4BC4 A;  4M45 A;  1ITG A;  2G8U A;  4PKG A;  4DR5 K;  2KQ2 A;  4CF9 A;  3NGZ A;  4CJP A;  4HCB A;  1X3N A;  3WXJ A;  3V6D A;  1WN7 A;  4DU3 A;  1J54 A;  3TTC A;  2ZQB A;  3ZT3 A;  4DFM A;  4DFJ A;  3JS6 A;  4LH4 A;  4MO4 A;  1HYV A;  4PQU A;  4DTR A;  1WAF A;  2BE2 A;  3ULD A;  1JLG A;  1XC3 A;  5FDL A;  3ZSQ A;  4YNQ A;  3VQC A;  1KLM A;  2IIR A;  5AQK A;  4JYA K;  4MLE A;  4DQI A;  2VYP A;  2P9L B;  4DQ8 A;  2RF2 A;  4RW4 A;  5JLH A;  4KHW A;  4CZE A;  4OKE A;  2DY4 A;  5LL6 Z;  1KFS A;  4J2A A;  5BN9 A;  3CCE N;  4KBO A;  3A0I X;  3V1O A;  4CEQ A;  1QS4 A;  4YOT A;  3HK2 A;  2XY8 A;  2Z1G A;  3RVC A;  5FPE A;  5FRM A;  4CVN E;  3E9L A;  5ADX H;  4CJS A;  3CQX A;  3RSE A;  2QM1 A;  1Q82 O;  3UKU A;  3ENH A;  2VQE K;  2HBK A;  1VSK A;  2QKB A;  3H1Q A;  2ZE2 A;  1KQS M;  1RBU A;  1DEJ A;  2F9T A;  4TSX A;  2O8F A;  2P1J A;  2HOE A;  4C8L A;  3AO4 A;  3CCV N;  3LZI A;  3VQB A;  3V1R A;  4XH1 A;  4Z4E A;  4B3O A;  3NH0 A;  3VQ4 A;  4DFP A;  1HPZ A;  2CGK A;  1SKR A;  4GKJ K;  3MEG A;  1NGJ A;  4RW9 A;  1RT5 A;  3WQT A;  2NRT A;  3WXL A;  1JLC A;  2X6S A;  1R0A A;  2BDP A;  2OPQ A;  5C2F A;  3TAQ A;  5C2D A;  4H0P A;  3RMD A;  1ASU A;  1VSI A;  4B3M K;  1EXQ A;  1YI2 N;  1TL3 A;  2P9I A;  4CFC A;  1CZ9 A;  1NGF A;  4CZJ A;  1REV A;  4E7L A;  3CJA A;  4OKJ A;  4JN4 A;  1YHQ N;  2JLE A;  2P5O A;  1RTJ A;  1JCG A;  3ISN C;  4FLU A;  2E8A A;  3THV A;  3HYF A;  3MMV A;  4OKK A;  4B1W B;  2OTJ N;  4DTU A;  3PX0 A;  1NBW A;  4WQ5 A;  4B9S A;  4CZK A;  2D0A A;  2A1S A;  3TAE A;  3RMC A;  3QER A;  4CI6 A;  2ZJQ L;  4BRN A;  4FM1 A;  3HJF A;  4KHY A;  4F8R A;  2ZGY A;  4DV4 K;  4I7F A;  2UUA K;  1Y97 A;  2QWR A;  3M6G A;  3CET A;  1Q86 O;  1MU2 A;  2ETJ A;  1X9J A;  4DQR A;  4BRA A;  5AQU A;  1YAG A;  3ITH A;  3ZT0 A;  5AQJ A;  4CEZ A;  2W41 A;  3LP3 A;  1BU6 O;  3PY8 A;  2G8F A;  2IVN A;  3BUZ B;  2VGN A;  5J2Q A;  2QXL A;  3EYZ A;  1N6Q A;  4CGI A;  1LAV A;  2D0C A;  3R6M A;  4J2E A;  3EL2 A;  3TAN A;  3DLK A;  1YUW A;  4HUF A;  1NGE A;  3LWM A;  1U04 A;  4BE2 A;  2ITM A;  2FLO A;  4DG1 A;  3SQ4 A;  4WFN L;  3NVK A;  4CGD A;  3EKU A;  3MWT A;  2HW3 A;  4E89 A;  2UXD K;  3AGK A;  2HHT A;  3QLH A;  4B08 A;  3QNO A;  3SUP A;  5KGW A;  5AFU A;  3CI5 A;  2YKM A;  1VAZ A;  2GUP A;  3KKR A;  4J8F A;  1HX1 A;  3OBW A;  4FSV A;  3VQ5 A;  4AQY K;  3T1Y K;  3TSU A;  3BP8 A;  3WEE B;  5KRT A;  2KFZ A;  4G1Q A;  3KK1 A;  5I3U A;  2HHU A;  1ZBU A;  1XI1 A;  1SL2 A;  2P9S A;  2QI2 A;  4IEE A;  3SQ1 A;  4KI4 A;  3KD5 E;  3V81 A;  1WSJ A;  3HTV A;  3KK7 A;  2D1K A;  4RWT A;  1GLE G;  4FVM A;  3U9D A;  3SPZ A;  4KRF A;  2E2N A;  1DLO A;  3VMF B;  3E66 A;  4CZH A;  4LD0 A;  3Q7B A;  2I5J A;  4JI2 K;  4CBX A;  4IOX A;  3CME N;  3LDO A;  3KLE A;  4Z4F A;  3HP6 A;  2OA8 A;  2OPS A;  4Z4C A;  5E41 A;  2QW9 A;  3QO9 A;  5C10 A;  1JCF A;  3IMX A;  1XC9 A;  4BRO A;  4FOI A;  4JKE A;  1RDA A;  2E2Q A;  1L3V A;  1NKC A;  5AQR A;  4IDK A;  4WCE L;  1QHA A;  3CPW M;  5IT9 O;  1OH6 A;  3VEN A;  4B3R K;  2RKI A;  5AQZ A;  4M3R A;  4CCH A;  2RHK A;  1WSE A;  5KPT A; 
#chains in the Genus database with same CATH homology
 2VCP A;  3SMP A;  4FPA A;  1QQN A;  3EE9 A;  4NLC A;  4GV6 A;  4G9Z A;  2DPN A;  4IOC L;  1C0G A;  2YJE A;  1KD1 O;  4GVE A;  1SZ2 A;  1HKG A;  4MO5 A;  4WYB A;  3FZM A;  1S3X A;  4JHD A;  3TSQ A;  3VPZ A;  4BRK A;  1QQO A;  4XEI A;  5CHI A;  4AM7 A;  5EOY A;  3BF3 A;  1M1K O;  4FWQ A;  5GIN A;  1SQK A;  3LDQ A;  4BR7 A;  4BG9 A;  3U9Z A;  1YXQ A;  3GE1 A;  4H0Y B;  1Q7Y O;  3HRG A;  3CJ7 A;  3LDN A;  4YDU A;  4JKA A;  3KWI A;  2Q2R A;  1ATN A;  3ZX0 A;  1JJ2 M;  1ATS A;  4I6M B;  3CJ1 A;  3G6E N;  1HKB A;  4FWO A;  3FFK B;  4BRP A;  1ZBS A;  3O80 A;  4PL8 A;  4CBU A;  5M1K A;  3CC7 N;  1T6C A;  2ASO A;  1NGI A;  5TKY A;  4QS7 A;  3WUH A;  1KAY A;  4YOW A;  1QQM A;  5CR4 A;  3CPE A;  4BC2 A;  3DLL L;  1WUA A;  3RSE B;  3I55 N;  4BGB A;  3R9P A;  2GTD A;  4EFH A;  5EX5 A;  4CD3 A;  2BTF A;  1N8R O;  3CJ9 A;  3K9J A;  1VQ6 N;  5AQS A;  1NGD A;  3VGK A;  5KQD A;  4C1N I;  3CXC M;  2P9P B;  4C23 A;  3O8M A;  3JXU A;  4A2B A;  1Z05 A;  4A59 A;  5BPL A;  3B8A X;  5BRH A;  5FPN A;  3LM2 A;  1BUP A;  3UKR B;  1RFQ A;  5AQT A;  1YJW N;  1NGA A;  4IXC A;  1TUU A;  3I56 N;  3O6W A;  4NB4 A;  1Q18 A;  2F9W A;  2F7T A;  3MN9 A;  4O5F A;  3U4L A;  3VGL A;  2P9N A;  1GLB G;  3CER A;  3ZEU A;  5AZJ A;  3PIO L;  3CD6 N;  1TYQ B;  2NRV A;  3ZET A;  4JAX A;  4ISF A;  3H3N O;  4WF9 L;  2GEM A;  3A8Y A;  4FWN A;  3WT0 A;  3F2K A;  1W2B M;  2YCH A;  2HF3 A;  4WQ4 C;  1YIJ N;  4NO7 A;  4IFE A;  4BC5 A;  2HMP A;  3U8X A;  4BQL A;  1GLJ O;  4ISE A;  3SBT A;  2GEL A;  4YOX A;  3QML A;  1MWK A;  3DJC A;  2QA4 N;  3VEY A;  3O9Q A;  3QBX A;  1K73 O;  2P9U A;  3T7Z A;  1S22 A;  3MX2 A;  2VWB A;  2E88 A;  4RCH A;  1KAX A;  1E4F T;  4BRM A;  1SAZ A;  4H5V A;  1DT9 A;  2EWS A;  2J4R A;  3AAQ A;  3SAF A;  4OO1 J;  3O9U A;  3CC4 N;  4FWS A;  1NGG A;  2GX9 A;  2NLX A;  3BF1 A;  3C65 A;  4WQ4 A;  3P31 A;  2WBN A;  3GOI A;  4BR5 A;  4M7Y A;  3G71 N;  4CZF A;  4IO9 L;  1EO1 A;  4H0T B;  3O5B A;  2A42 A;  1MWM A;  4WFB L;  3D2F B;  3VTH A;  1E4G T;  2KLA A;  4RTF D;  1ILY A;  4YOR A;  3QFU A;  1QZ6 A;  2I7N A;  1NMD A;  3EE8 A;  3A5N C;  4B1X B;  4GV9 A;  2OTL N;  3CC2 N;  4CZL A;  2QWQ A;  2RE2 A;  1VQL N;  3AAR A;  3D2E B;  4BR2 A;  2PBD A;  3WXM B;  2E1Z A;  4H5T A;  1BWF O;  1HPM A;  3A5L C;  4JKD A;  4CBW A;  1LCU A;  4BRG A;  5AQL A;  2PAV A;  5JMV A;  2V7Y A;  4CD1 A;  1NLV A;  4H03 B;  1IG8 A;  2WFB A;  4K25 A;  3LDL A;  3R1X A;  3UKR A;  1RDU A;  3UE5 A;  4O8U A;  4BR4 A;  4IZ9 A;  1U2V A;  2FSN A;  5B8H A;  4A2A A;  4IDH A;  3H46 O;  2KKZ A;  3HOT A;  5F0X A;  3T69 A;  3O08 A;  4O8K A;  3J7Z O;  4UY8 O;  2QWL A;  4YDU C;  4IWV A;  5AQG A;  3E9O A;  4QS9 A;  1K8A O;  3D2F A;  4DHY A;  4OPA A;  3LM9 A;  1YJN N;  4IO8 A;  2W40 A;  1YF5 L;  3H3O B;  2I7P A;  3EO3 A;  2NRH A;  4BRF A;  4JKG A;  5BRF A;  4BVP A;  1K9M O;  2QWM A;  5BPN A;  3VER A;  4B9Q A;  2NRR A;  2AP1 A;  3QB0 A;  5GAE P;  2JWK A;  3M1F A;  3SK3 A;  4M63 C;  4H5W A;  3CHW A;  5HOO A;  3Q7C A;  4JKF A;  4JNE A;  4IEI A;  4NLB A;  3L4Q A;  3VEW A;  3N4Q A;  5FPM A;  1H1V A;  2HBJ A;  3MN6 A;  2YX6 A;  3IUC A;  2P9I B;  3UKU B;  3TTF A;  4BRQ A;  3ATV A;  1DGK N;  4MDB A;  4WFA L;  1P90 A;  5GAD P;  3R8E A;  4A5A A;  1S72 N;  5BRD A;  4C1N K;  5M1Q A;  3O1B A;  1T6D A;  2NNW A;  1TYQ A;  2YHX A;  3HSC A;  4XH4 A;  5AQY A;  4A61 A;  1NGH A;  5JVG L;  3FGU A;  4I6M A;  3TTD A;  4A62 A;  1T3V A;  3O9S A;  4FWR A;  4JEP A;  5TKW A;  5DM6 L;  2QTD A;  3MX5 A;  3O1W A;  4MLH A;  3GDQ A;  1K8K A;  4B1V A;  4JHD B;  2YHY A;  4BR0 A;  1TUY A;  1VQM N;  4B1Y B;  5C15 A;  5M1O A;  1T44 A;  3R3L A;  5M1F A;  3AY9 A;  1NM1 A;  4CZM A;  5AQX A;  3OW2 M;  5AQO A;  2HF4 A;  2GWJ A;  4BC4 A;  4WQ5 C;  2A41 A;  3KZB A;  2Q0R A;  5BN8 A;  4PKG A;  4JD2 A;  1VQ8 N;  2NRX A;  3CCS N;  2CGL A;  1V4S A;  3QIC A;  1XUP O;  2CGJ A;  5AQQ A;  3FR0 A;  3NVM A;  1X3M A;  1X3N A;  3SBG A;  3ZX3 A;  2JWL A;  3GL1 A;  5AZI B;  3WXJ A;  2E20 A;  3DXM B;  3MN7 A;  4A5B A;  1R59 O;  5KPR A;  3H6E A;  2ASM A;  3KVG A;  3QDK A;  3TTC A;  1MDU B;  5JIC A;  3CCL N;  3F9M A;  3ENB A;  5E84 A;  3DXK B;  1RDW X;  3SAG A;  3C7N B;  4JK9 A;  3JS6 A;  3QFP A;  3AGR A;  4MO4 A;  2BUP A;  1NWK A;  3L6Q A;  4U67 L;  5JLF A;  1KC8 O;  4KH4 A;  3MN5 A;  3VES A;  3VEZ A;  4ISG A;  2P9P A;  5E26 A;  4JK7 A;  1D4X A;  1OVY A;  3C6H A;  2ZWH A;  4XH5 A;  3CCJ N;  1XC3 A;  3ID8 A;  4AM6 A;  2ZJR L;  3ID6 A;  2P9L A;  1BDG A;  2IIR A;  5AQK A;  5AQP A;  3WXK A;  4MLE A;  5H1S Q;  2VYP A;  1BA1 A;  2P9L B;  4FO0 A;  3EN9 A;  3I8B A;  4DQ8 A;  2V7Z A;  5JLH A;  4CZE A;  2YI1 A;  5BR9 A;  2Q1N A;  1G99 A;  2V52 B;  2WC9 A;  5BN9 A;  1ESV A;  3FZF A;  4EHT A;  3CJC A;  3CCE N;  4KBO A;  3A0I X;  4BVO A;  3FE1 A;  2FSJ A;  4FPB A;  4YOT A;  3RVC A;  5FPE A;  3VEX A;  3ENO A;  3OHR A;  2CH5 A;  4Z94 A;  3DXK A;  4H0X B;  3D2E A;  3E9L A;  3M5R A;  5ADX H;  4EAH D;  3CQX A;  3RSE A;  1QVG M;  2QM1 A;  4M7X A;  3ATU A;  4H5R A;  1Q82 O;  2NRZ A;  5JVH L;  4A57 A;  3UKU A;  4JKB A;  3ENH A;  3HOS A;  3C6A A;  3K9K A;  2HBK A;  4AF1 A;  3MK6 A;  3DXM A;  5DM7 L;  3H1Q A;  2NZT A;  2BH1 A;  4JKC A;  1KQS M;  1BOT O;  3MDQ A;  5GIO A;  3KHY A;  5BPM A;  3KWG A;  4BRE A;  2QWN A;  5GAH P;  3P4I A;  1DEJ A;  2F9T A;  2WUS A;  5M1P A;  2GWK A;  2P9U B;  4FWK A;  4KH6 A;  3LL3 A;  4YOY A;  3CCU N;  1GLL O;  2HOE A;  5FPD A;  3C7N A;  3CCV N;  3WEE A;  4MDA A;  3N4P A;  5BRE A;  2Q0U A;  4XH1 A;  3ZX2 A;  3MCA B;  1HKC A;  3A5M C;  3CCR N;  3FZH A;  5ELZ A;  4IJN A;  4GY2 B;  5AQH A;  5AZI A;  4U7B A;  2CGK A;  3GBT A;  3CCM N;  1VQP N;  5AQF A;  1NGJ A;  5LY3 A;  1KXP A;  3EKS A;  2P9K B;  3WQT A;  4IJA A;  2E2O A;  4PKI A;  2NRT A;  3WXL A;  3OA9 A;  3J8A A;  3TU5 A;  5AQV A;  2P9S B;  5C2F A;  1ZC6 A;  4ILG B;  5C2D A;  3OBY A;  4H0P A;  3MWP A;  3O9R A;  3PIP L;  5HL7 L;  4BRH A;  5GAG P;  4QS8 A;  1YI2 N;  4CZG A;  2P9I A;  4DB3 A;  3C0B A;  1J6Z A;  5ADX A;  1VQK N;  1Z6R A;  1NGF A;  3A5O C;  4CZJ A;  2CH6 A;  4PHT X;  3CJA A;  1YHQ N;  4JN4 A;  3CF5 L;  4H0O A;  4K42 A;  2Q31 A;  4BRD A;  3L0Q A;  1JCG A;  2E8A A;  4FWM A;  4JKG B;  3WQU A;  2ASP A;  3MMV A;  1VQ7 N;  1V4T A;  5EXW A;  3O4W A;  3H1V X;  4B1W B;  2OTJ N;  3HBT A;  1NBW A;  2HBM A;  4WQ5 A;  4F9O A;  3TPQ A;  2QEX N;  4CZK A;  3D6R A;  5LJV A;  4FL9 A;  4CZI A;  5KQ8 A;  4PKH A;  4CI6 A;  1QVF M;  2ZJQ L;  4BRN A;  5GIP A;  4JD2 B;  3ZET B;  4B1Z A;  2OAN A;  4EIA A;  3P38 A;  2ZGY A;  1YVN A;  2E1Y A;  3HI0 A;  3IKM A;  4H0V B;  4FOE A;  5C12 A;  4YOV A;  2QWR A;  3M6G A;  5AQI A;  3CET A;  1Q86 O;  4BRI A;  1OKJ A;  4FWL A;  4L3Q A;  2HST A;  1X9J A;  3VET A;  4BRA A;  5AQU A;  1YAG A;  4BGA A;  5C0Y A;  3D7E O;  3E1Y A;  5AQJ A;  4BY9 C;  2D4W A;  4ILH A;  3SAH A;  1QZ5 A;  3CIP A;  2A3Z A;  2W41 A;  4GNI A;  1BU6 O;  2IVN A;  1IJJ A;  3HM8 A;  1ZXO A;  2VGN A;  3BUZ B;  3M3Z A;  3VOV A;  3ZYY X;  5I9E B;  2QXL A;  3QBW A;  1RGI A;  4ILJ A;  2NRW A;  2UYT A;  4BRC A;  3R6M A;  3EL2 A;  3CJB A;  1BO5 O;  1NGC A;  1NJI O;  1GLF O;  1YUW A;  2H3G X;  1U6Z A;  1NGE A;  3VF4 A;  1ATR A;  3CMA N;  4IOA L;  2ITM A;  2FLO A;  4HTL A;  1WOQ A;  4WFN L;  1VQ9 N;  1GLA G;  3NVK A;  5AFU H;  4R79 A;  2ZGZ A;  3AAP A;  5AQN A;  4FVU A;  3EKU A;  3MWT A;  3VGM A;  4BR9 A;  3AGK A;  2FXU A;  5F1X A;  1VQ5 N;  1U2V B;  2AA4 A;  1HUX A;  3HZ6 A;  5AFU A;  3CCQ N;  3CI5 A;  1Q81 O;  2IVO A;  2FSK A;  4CJ7 A;  4YOU A;  2HBL A;  1DKG D;  1VAZ A;  2GUP A;  2D0P A;  1HX1 A;  3H45 C;  3OBW A;  4FSV A;  1O13 A;  4J8F A;  4Y0W A;  3TSU A;  3BP8 A;  3I33 A;  3WEE B;  2P9N B;  3EZW A;  3E9P A;  1VQN N;  1NGB A;  2A40 A;  1Y64 A;  2P9K A;  2PFU A;  2D0O A;  2ZF5 O;  3IDH A;  5F2R A;  5AQM A;  3LDP A;  2QWP A;  3O9T A;  4H5N A;  3VF6 A;  5KPZ A;  2Q97 A;  2P9S A;  1C0F A;  2QI2 A;  5AQW A;  1BA0 A;  4IEE A;  4BRL A;  2QWO A;  3FZL A;  2YJF A;  3SMS A;  3FZK A;  1YJ9 N;  1VQ4 N;  1HJO A;  5LJW A;  1JCE A;  3VEO A;  3HTV A;  3KK7 A;  4K43 A;  2D1K A;  3BEX A;  3W3D A;  4RWT A;  1GLE G;  3VTI A;  3U9D A;  1KAZ A;  2E2P A;  2E2N A;  3GG4 A;  4EHU A;  3VMF B;  1M90 O;  3VEV A;  3E66 A;  3NMU A;  2Q36 A;  4E1J A;  2FF6 A;  2V51 B;  2VGM A;  4KH5 A;  3G25 A;  4CZH A;  3ULE A;  1CZA N;  3Q7B A;  4PL7 A;  3TSP A;  5M1N A;  3SJH A;  2ZJP L;  3FLC O;  2KHO A;  4CBX A;  1XQS C;  3DAW A;  4IOX A;  5MLC Q;  4BQZ A;  1HLU A;  3CME N;  1W97 L;  3LDO A;  1P8Z A;  5EY4 A;  4JKH A;  4BC3 A;  3DWL A;  3W0L A;  5CE3 A;  3UB5 A;  1YIT N;  2IVP A;  2FF3 B;  3F5T A;  5AZJ B;  3ZEU B;  3L4I A;  1GLC G;  4JK8 A;  3S41 A;  1SS6 A;  3CQY A;  4DKW A;  4K41 A;  3G4S N;  3PLA A;  4GV3 A;  2QW9 A;  4B1U B;  1GLD G;  3IFR A;  5AR0 A;  1JCF A;  3IMX A;  3ULE B;  4BG8 A;  5C10 A;  4BRO A;  4FOI A;  1MA9 B;  4JKE A;  1BG3 A;  3MCP A;  1VQO N;  4HWI A;  4OPH A;  4DCH A;  2E2Q A;  2A5X A;  2YHW A;  1K8K B;  3VF2 A;  5AQR A;  2A6A A;  3P39 A;  4WCE L;  1QHA A;  4LC9 B;  3CPW M;  5EVZ A;  3VEN A;  1EQY A;  5AQZ A;  4FWP A;  3SLC A;  2RHK A;  3WXI A;  1LOT B;  5KPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...