3EE9A

Structure of ns1 effector domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structure of NS1A effector domain from the influenza A/Udorn/72 virus.
pubmed doi rcsb
source organism Influenza a virus (a/udorn/307/1972(h3n2))
molecule tags Viral protein
total genus 33
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ee9A00
3O9TA 3KWIA 3O9UA 4OPAA 3D6RA 3O9RA 3RVCA 4OPHA 3EE9A 3P39A 3O9QA 3P38A 2KKZA 3L4QA 3OA9A 3KWGA 3F5TA 3M5RA 3P31A 2RHKA 3EE8A 3O9SA 2GX9A
chains in the Genus database with same CATH superfamily
2AA4A 4IDKA 3SMPA 1HPMA 4GVMA 3BF1A 3U8XA 4KHYA 4BROA 4FSVA 3VEWA 4AHCA 1EO1A 1Q8IA 5GIPA 1WAJA 4DSKA 5FROA 3HP9A 4X64K 1T3VA 3KWGA 5IT9O 5AQZA 4Z4CA 4CFDA 2ZGYA 4DTRA 3DLEA 4GV9A 5C24A 2F96A 4BY9C 1N6QA 3BY5A 4KB0A 4E1MA 1C0FA 3S41A 3AVBA 2FBTA 2FLOA 3WXMB 1G15A 4CCHA 1NGBA 2CGKA 3NH2A 4JKGA 1OVYA 1YTAA 4XH5A 5EVZA 5J1EA 1WSEA 4GKKK 3CCRN 3D45A 2GV9A 1T05A 1VRUA 2FSJA 1KSPA 4DR6K 5AQHA 2P9KA 4CZFA 5JICA 3NVKA 3AA5X 5AFUH 3ZT1A 4DF8A 5HRNA 2UUCK 4KB1A 3V9UA 4RCHA 3OVNA 4DB3A 1JCGA 3RTVA 3K5OA 1UA1A 3VETA 4AH9A 1DTQA 3D2FB 4FVMA 3C7NA 1NOZA 4BC4A 4QAGA 5GAHP 1VSFA 2X74A 4B08A 4DV4K 2UUAK 1X3MA 4M42A 3DJCA 4ILHA 5M1KA 2E2NA 4M7YA 4A61A 2A5XA 1KTQA 4CF0A 2UXBK 5AQGA 1ZBLA 2QK9A 3T19A 2UYTA 4F2SA 4OGEA 4BQZA 2Q31A 4Z4GA 1YT3A 3KKRA 1Z05A 1HNVA 4LF6K 4G9ZA 2XRIA 4O0JA 1IG8A 4LF8K 2XY5A 3G0ZA 2G8FA 2OCEA 5J2MA 2O8EA 1CXUA 2YHWA 2BUPA 3WEEB 1FKPA 4FOEA 4DG1A 3E1YA 3P39A 4CHNA 4N41A 2FBVA 2F8TA 5JVHL 3VMFB 4ISEA 4JNEA 4CK3A 5KPZA 1YJNN 1SV5A 4JK7A 5C15A 2GUPA 3EE8A 1BIUA 3LWLA 1BCMA 3RRGA 3C6AA 3PLAA 2UXDK 2OTJN 4OVLA 3VQPA 3KKSA 3DOLA 3ATVA 3CJ1A 1RDAA 1RTDA 1TUYA 3THXA 5C0YA 1S9EA 4H0VB 3ASMA 4XH1A 4KHNA 3CCMN 4YOYA 4NO7A 1BG3A 2E2PA 1U2VA 4RW6A 4MQ3A 3LM9A 3I55N 2IGIA 1TVRA 1P90A 2HF3A 4XEIA 3ZX2A 1TYQB 4PL8A 3HOTA 1B9FA 1YVNA 1JLEA 3SCXA 4I6MB 3PSIA 3KLIA 1JLAA 3O1WA 1ZBSA 3I0SA 1RT1A 4X62K 3K5LA 4LF5K 3SQ0A 3QIPA 4CJUA 1C1BA 3CCQN 1RTIA 4EHTA 4CEOA 4B3OA 2XO7A 3EZWA 1NGCA 4IOAL 2FBYA 1NM1A 4CJVA 2HBKA 3F2KA 1K6YA 3UB5A 5GADP 1K73O 4EAHD 3VF4A 4V19S 1QE1A 1BO5O 4DV0K 3RVCA 4B9NA 1VQ4N 1JCEA 3IMXA 4FWOA 4K43A 2JLEA 4BRPA 3C65A 5KQ8A 3VQBA 1RFQA 1LAWA 4DR5K 4BWMA 1NBWA 1GLAG 4DV6K 3UKRA 3VESA 4GY2B 2W41A 2ZF5O 3SUOA 1Q81O 2D5RA 3CMEN 3VOVA 3HXMA 3G10A 3LL3A 2A1SA 2I7NA 3NH1A 1E4GT 4JKEA 3BZKA 2CGLA 3HP6A 3OYBA 4QS7A 3ZSOA 1VSMA 2E8AA 4BRFA 3THWA 2H3GX 1RCHA 4CGDA 1VSDA 4B1YB 1EXQA 2W42A 4DV5K 2IVPA 3FGUA 3CCSN 3FLCO 3PIPL 3M5RA 2E5LK 1OKJA 3DLRA 3DLBA 4J2AA 4CIFA 4C8KA 1JKHA 4LF7K 3VGKA 3SV4A 2PBDA 4FJHA 3NF6A 3DI6A 2BGGA 1QZ5A 3NFAA 2XHBA 5ADXH 3CJ7A 3ZSRA 5BRHA 3O8MA 4NYFA 3WT0A 4AHTA 4Q0BA 3H46O 3MCPA 1Z26A 5KGXA 3O4QA 4FJMA 1XC3A 4FWNA 1YHQN 3NF7A 1SUQA 3AGRA 2YHAA 1ZC6A 5M1NA 3NH0A 1RDUA 3WNGA 1CZBA 1MA9B 5AQPA 3DXMB 5LMUK 4IWVA 4OPKA 4KI4A 1NK5A 5KRTA 4LFBK 1NOYA 1XI1A 4IJNA 3CM5A 2YV0X 4CHPA 3OW2M 2FBXA 3P83D 3KK7A 3U9DA 4ELUA 4C8OA 4Z4FA 4FL9A 3TTCA 3NMUA 3SUNA 1S6QA 3QNNA 4IKFA 3PO5A 2P9UA 4DR7K 2FXUA 1MU2A 3VEYA 5EY4A 5BN8A 1TK0A 3S3MA 3SUPA 4CZEA 3OYAA 4NB4A 4H0XB 4AHVA 2UXCK 3NAEA 3V9WA 2KTQA 4BVPA 1QSLA 3T1AA 3D0PA 3OS1A 3ENOA 1QZ6A 5KRSA 4FWQA 3R8EA 3D2EA 3V9XA 3IG1A 3VQQA 4H5WA 3ZSVA 3VEXA 4BC2A 4BGBA 1XNRK 4EFHA 4IJAA 1J53A 1XNQK 1KAZA 4CJLA 3EKUA 5J2QA 4B1WB 5AQSA 2Z1HA 3KVGA 3QO9A 3HI0A 2B4JA 1ILYA 1JLCA 2NRTA 4H0YB 5AQVA 4DTMA 4B1VA 2ETJA 1CLQA 4H5RA 3R3LA 3QB0A 3FZHA 1VQ9N 1BGXT 2AP1A 4YY3K 1NK7A 1GOBA 4I2PA 2Y1IA 4LFAK 3SBGA 3AV9A 3J7AP 3E9LA 4IO8A 1SKWA 2XY8A 5BRFA 3ZSYA 4DTSA 4AM7A 5SWMA 1QVGM 3TAPA 3O9QA 3L8BA 1DGKN 1J5OA 3QFPA 4F8RA 2KFZA 2EHGA 1U48A 4HVJA 2HW3A 3TAFA 1WAFA 4CJ4A 1BA0A 4W5RA 1RDBA 1WNSA 3VPZA 3OYGA 4FLTA 1EQYA 3QFUA 5A2QO 4N5SA 1YF5L 1YIJN 4DTJA 2ATQA 4HCBA 3ID6A 2HOEA 2HSTA 4C8LA 2ASOA 1HNXK 3ZLJA 1FW6A 3A8YA 4DS5A 3L3UA 3OA9A 4E7KA 5TKYA 3H45C 3LPTA 4QCLA 4JD2A 2GTDA 4MDBA 5CR4A 5AQRA 3O1BA 2NRHA 3M8QA 4CJFA 2P9KB 5HL7L 4OKJA 2E6MA 5ELZA 3D6RA 1YUWA 4DS4A 2ITGA 3NBPA 4CFBA 4DR2K 3LP1A 1BA1A 3Q7BA 4JK8A 3M1FA 3WNFA 1WBDA 3CMAN 4LY7A 3C7NB 1TK5A 2HNYA 4CIEA 4E7JA 1WSGA 5TKWA 4DU3A 5M1OA 1SKSA 2O8BA 4LSLA 3EY1A 4NLCA 2WUSA 1Q86O 1L3SA 5FRNA 3OTOK 1ESVA 4FLYA 2W6LA 4DTNA 4CEAA 3JS6A 4CJKA 2D4WA 3ZT2A 4H5TA 3J7ZO 4CEBA 4BC3A 3SBTA 2Q36A 4DFMA 4BGAA 4Y0WA 3GG4A 2O8EB 3DM2A 4B3MK 4PUOA 2HHQA 2HMPA 3AVHA 3MN9A 4CZGA 3AA3A 3ID8A 1CZ9A 2D0PA 3KTQA 1VSIA 4DQIA 3L4IA 1NGJA 1S1TA 4PHTX 5AFUA 3H3OB 3CYMA 4KPYA 2XY6A 4CW7B 3MX2A 4IFEA 1Z6RA 4WF9L 4IBNA 1YXQA 2RKIA 2P9LA 4DQ8A 1DKGD 1XMQK 2V52B 4F2RA 4CK1A 3R6MA 4L3QA 3THXB 4BDZA 4RW4A 1T6DA 2EX3A 4CEQA 1HQUA 4E19A 3SAFA 2A41A 3K5NA 2D0BA 1VQ6N 4WCEL 1U2VB 5FPMA 4JKDA 4DR3K 2KKZA 4GV3A 3NGIA 1QSYA 1T7PA 3G71N 1GLJO 1TGOA 3ZT3A 4PL7A 4DMNA 4FJJA 2RPIA 4XIUA 4DFJA 3HSCA 1VQPN 3HPGA 4EP4A 3FZLA 4DUYK 5LL6Z 4JAXA 4OPJA 3TANA 1NGGA 5AZIA 4GMJB 1Y64A 1G99A 1BCOA 4H4OA 5KQDA 4DV1K 3U9ZA 4WQ4A 3SYZA 3SNNA 1RT5A 4DSFA 5T7BA 4GVEA 1EETA 1VK0A 1D8YA 3AVIA 1XUPO 3SPZA 1JLBA 3H1QA 4DSEA 3CG7A 1BHLA 1QHTA 2IVOA 3CQXA 4OPAA 4KBOA 3O5BA 3VQ5A 3MEEA 3O3HA 3AY9A 4FCYA 3C95A 3UKRB 4WYBA 5CZ1A 3KD1E 4LSNA 4IFYA 3MN7A 4JI0K 2NRVA 4FM2A 3MWTA 1XMOK 4LFCK 1NJYA 1S1XA 4LF9K 4KV8A 4B3TK 1LWFA 1BL3A 4GNIA 4BRDA 5KPRA 5M1PA 5KTQA 4CJRA 3KK2A 1C0UA 3PO4A 2QWOA 1T03A 1HNZK 4JS5A 4BG9A 3CJCA 4CZLA 5E84A 5GINA 3QETA 3OBYA 2YKNA 3FR0A 2GUIA 3MEDA 4A57A 2HHVA 1VAZA 3CJAA 2Q97A 3OYHA 1WLJA 4N47A 4FOIA 2OYQA 1NWKA 3V81A 4ZTJA 3IDHA 4X66K 2X78A 3ZCMA 3CCLN 1VQMN 2QI2A 4BE0A 3DAWA 4B9SA 3CETA 4M3RA 1C1CA 4FPAA 4NXMK 3CIPA 3TR8A 2GEMA 4E1NA 3LDPA 1MDUB 5LY3A 4J2DA 3ENBA 3ZSZA 1IH7A 1HPZA 3RSEA 3OYMA 4M63C 1KD1O 1JXBA 4B3SK 1OH8A 4CJ3A 4PQUA 1QVFM 2IOCA 4A5AA 3L2UA 4ISFA 3E9PA 1I94K 1QQMA 2PY5A 4MO4A 1K8KA 4CJQA 3L2VA 1BDGA 4FJ7A 3JYTA 3P4IA 2DY4A 1NK4A 4DTUA 2F4VK 3G4SN 2YKMA 4CGJA 2P9UB 3NDKA 3OJUA 3LDQA 4JI6K 4YFUA 3U6FA 1S9GA 2OTLN 4RTFD 3TAQA 4DV7K 4MLHA 3ZYYX 4IOCL 3LDNA 5FLXO 3U3GA 2O8FA 2NUBA 3QEVA 3CCUN 2HF4A 3L6QA 5ADXA 1IKYA 3C94A 2ASMA 2RN2A 4QOZB 1C0TA 1MWMA 1TKZA 4FLVA 4BG8A 4FZXC 3SAHA 1KRPA 3C6UA 1C6VA 1RT4A 2QA4N 2VGNA 4A62A 2CGJA 4IZ9A 2Q2RA 2GX9A 3VEVA 3M8PA 3UKUA 1NK9A 2P1JA 3OYCA 3HPOA 4W5QA 2D0OA 3SUQA 2B5JA 3P1GA 4H03B 4DKWA 4W5TA 3AVJA 3IRXA 1BQMA 4OLBA 3RMBA 3OYNA 4HTLA 2P51A 3B6PA 1VQ7N 1VQNN 2A3ZA 2DTUA 4KHUA 1VQ5N 2O8DA 1T8EA 4BE1A 3VTHA 3E9OA 1VHXA 1NK8A 1ATNA 1RBRA 3SQ2A 2O4IA 2P9NA 3AVAA 1NJZA 4JRPA 4CIGA 1HUXA 4NYNA 4MLEA 1VSHA 1W97L 1NJWA 4M41A 4CK2A 1U47A 4B1ZA 1U4BA 1KQSM 4GKJK 1YJWN 1QHAA 2FSKA 2E2QA 3WQTA 4B9TA 3MDQA 2QTDA 2VG5A 2WC9A 2YI1A 3ISNC 4OLAA 2DFHA 2VYPA 3SPYA 4CGGA 2B6AA 4FM1A 3KD5E 3NVMA 4Z0UA 3GBTA 3BEXA 4JD2B 1Q18A 1HMVA 3L2RA 4PKHA 1P8ZA 5GAEP 3J80O 1XC9A 4K8XA 2HNZA 1R0AA 4J2BA 1EX4A 3HVRA 2P9PA 1NLVA 3S9HA 4CJ5A 3LM2A 4Y1DA 3LAMA 2NLXA 2ZE2A 1HX1A 4KKOA 2HBLA 4CF9A 5CHIA 2GBZA 2G8IA 3VN5A 3ENHA 4BREA 4J2EA 2O8BB 4NCBA 2IAJA 1RDCA 4OGCA 4CHQA 2E1YA 3G25A 1NJXA 4PA1A 1XQSC 2V7ZA 3VA0A 4H4MA 4B8CA 3CC7N 3VA3A 3MX5A 2CH5A 2WONA 3O9RA 1GLCG 3MN5A 3LPUA 1UOCA 2W40A 1IKXA 3F9MA 1KVBA 4JKCA 3N4QA 1GLEG 3VGLA 3CC4N 1KCFA 3ATUA 2VGMA 3CPEA 3F9KA 2JWKA 4C1NK 4M3XA 1TV6A 1UAXA 3OYEA 2IS3A 2P9LB 2ZM6K 3RMAA 2CH6A 2FF3B 4FYDA 5C10A 4G1QA 4IG0A 3LZIA 3DXKA 4CJPA 1TKXA 3ITHA 4CBUA 4CFAA 4AF1A 3H1VX 4DSLA 2NRWA 1FKOA 3A5OC 3IKMA 2QWQA 4YNQA 3LDOA 4R79A 4O5FA 4FJGA 2HBJA 5F2RA 1RBSA 4DFKA 1TAUA 4RG8A 2HMIA 3K2PA 3PX0A 4F9OA 4HTUA 1NKEA 3SLCA 4O55A 3O9SA 5IWAK 2BE2A 5KI6A 1ZXOA 5AZIB 4JI7K 1E3MA 3DLGA 1KFSA 4AM6A 3PSFA 2Z1GA 3CQ8A 3A2FA 3DYAA 4A2AA 5JLFA 3L2QA 3VTIA 5M1FA 3ULDA 2ZJPL 4WFNL 3W3DA 4BE2A 1KAYA 3TWHA 5FRMA 3VQ4A 4I9QA 5K14A 3N4PA 3TSQA 3LDSA 1ITGA 2ZJQL 3RR8A 1FJGK 3BGRA 1Z25A 3T1HK 4BRNA 2Z1IA 2NZTA 3AAQA 3HZ6A 4M3YA 2YNGA 1QS4A 4MFBA 1W2BM 4BACA 4JN4A 3CD6N 4O5BA 2AJQA 2QWMA 3LZJA 4DTXA 1M90O 2E6LA 4LC9B 4ZTFA 4DLEA 1ASVA 4HUGA 1S1VA 3GL1A 3QEPA 5DM6L 3O9TA 3JSMA 4RW7A 1BQNA 4UY8O 3O4NA 1SAZA 2PYJA 2GELA 5EX5A 3CF5L 4RW8A 1SL2A 3NGZA 1JLFA 3WXLA 1W7AA 3H6EA 5HLFA 2IVNA 4BRLA 2DFEA 3TU5A 3R1XA 1N32K 1RBTA 3I56N 4KTWA 2F7TA 3VQAA 1O13A 4IOXA 1JLGA 4JI2K 2HNDA 3DMJA 1B92A 4E7IA 2KZZA 5AJ3K 2Q0UA 2YJEA 2QEXN 3VF6A 2R7YA 3HTVA 3WQUA 4FZZA 4CHOA 4B9VA 3RWUA 1GOAA 4JKGB 3RSEB 2YHYA 1RT6A 2HVHA 1KVCA 3SJJA 4IO9L 5AQKA 2V7YA 3NCIA 4FK4A 3OY9A 2HHUA 2QWPA 1K8KB 4C8NA 4I2QA 4BR7A 4BDPA 1RNHA 1A5XA 3A5MC 2VG7A 4WFBL 3J8AA 5M1QA 4C23A 3SAGA 4DR1K 3O6WA 5FDLA 5B8HA 2NRXA 4CZJA 3QNOA 3L4QA 1LW2A 2O8FB 1GOCA 1JCFA 2WBNA 1EP4A 3E01A 1C1AA 2QWNA 1U6ZA 3M3ZA 5C2FA 3DRSA 1GLDG 4B1XB 1HJRA 4AHSA 3GDQA 1XHXA 1DTTA 2JWLA 1D9DA 5AQUA 2I5JA 5DMRA 4FK0A 5CY4A 3WNHA 3HOSA 2YHBA 2UU9K 4CI6A 5EU7A 3QMLA 4EHUA 1ZBFA 3PUFA 3ALYA 4DU1A 1EWRA 4IDHA 4O44A 4CD3A 4ID5A 1HNWK 4W5NA 5AQNA 3AO2A 2G8KA 3J81O 3L2WA 4RWTA 2PFUA 3A5LC 3TABA 2QWRA 3K57A 1T44A 3AVGA 3V9ZA 1CXQA 4A5BA 1VSKA 4FJNA 1RBVA 5CZ2A 2QKKA 4BR5A 1L3TA 3V4IA 1LW0A 4JKHA 4JKBA 2O8DB 3HSTB 3IS9A 1LWEA 1L3VA 2ZQBA 3F73A 4FJ5A 2P9NB 3V1OA 4BWJA 2V51B 2A1RA 5AQYA 4UQGA 1WOQA 1TAQA 2YCHA 2BH1A 3JAMO 3KLEA 2NRRA 4DU4A 3O4WA 3EYZA 4QS8A 1KLMA 4WE1A 2W6KA 4ELTA 1U49A 3AVCA 2E20A 3H08A 5D3GA 3EO3A 3BF3A 5DK5A 4DSIA 2KLAA 4BDYA 3F5TA 2OPRA 3MK6A 4RW9A 3AGKA 3VQ7A 1J5EK 5AQLA 3C6TA 3FFKB 3OJSA 1HJOA 3C6HA 4KH6A 3HBTA 3HRGA 1E4FT 3HT3A 3WXJA 3SZ2A 3PX4A 4BRMA 1IKVA 3A5NC 5LMNK 4FM0A 4LH4A 3DXMA 1ZBIA 1LAVA 3NE6A 2YHXA 3SQ1A 4EP5A 3FFIA 4H0PA 5HRSA 5HRPA 4HWIA 3VQ9A 2OPPA 4DQPA 2A42A 1YTUA 3P31A 4JLHA 4GW6A 5CE3A 4BRCA 4H0OA 3MECA 3VQEA 4CEDA 1RT7A 3G6EN 3PX6A 2OZSA 3MEGA 4Z4IA 4CZIA 1HKCA 3GOIA 2OPQA 1KFDA 4B9MA 3ZSQA 3ULEA 3NGYA 3U4LA 4FZYA 3QBWA 2VWBA 1KC8O 4DR4K 1I39A 3S3NA 1BU6O 2ZJRL 1ATSA 5HRRA 4AHRA 4DCHA 5J2NA 1HNIA 1S22A 1BI4A 1ZBHA 1DEJA 1HLUA 1I3AA 3I0RA 3RR7A 3RRHA 4YORA 2F8SA 1JXEA 2G8HA 1NK6A 2YNFA 5AQJA 3O80A 4H5VA 5JMVA 1X1PA 4I7FA 1BUPA 3THWB 3HVTA 1RGIA 4CESA 4JHDA 4CHYA 4KFBA 2G8VA 1LOTB 3HPHA 3OYJA 2KQ2A 2QW9A 4K42A 2HHSA 5AQIA 3WNEA 4W5OA 2E2OA 3QIOA 3OYLA 4KHWA 2VWKA 5FPEA 3DLLL 4YHHK 1NGEA 1UA0A 3PY8A 2Q1NA 3FE1A 1ZYQA 1C0MA 2A40A 3SV3A 4FVUA 3I33A 4FW2A 1B9DA 2X6SA 4KI6A 3V9SA 3AO4A 3ZEUA 1NGHA 3SI6A 2XY7A 1DLOA 4KAZA 3PIOL 3DXKB 3I8BA 3DOKA 3DLHA 4F4KA 3OYFA 4U7BA 1IBKK 1NMNA 4YDUA 5J2PA 1N5YA 4B8AB 3AO5A 1WUAA 3K58A 4BRGA 3KWIA 5FPNA 1KXPA 3KLFA 3SQ4A 5JLHA 2YX6A 3MWPA 1WN7A 3AVFA 5AZJA 3THYA 4IFVA 2P9SA 3WXKA 3HL8A 3LANA 4E0DA 2O8CA 1IBLK 5AQMA 3AAPA 4Z4HA 2KFNA 2RF2A 3EKSA 4FJXA 1NU0A 4KO0A 4AHUA 4FK2A 2PZSA 1KAXA 1T6CA 4FLZA 1HKGA 2X6NA 3QEXA 4OJRA 4JI5K 1VRTA 3MMVA 1K8AO 1WSFA 4R5PA 5HP1A 1NG9A 4BRHA 4Z4EA 3QLHA 1VQON 3D2EB 3L0QA 3ZETA 4PWDA 4CF8A 1TKTA 5SZTA 2I7PA 3AA4A 1ATRA 2Q0RA 3S3OA 4HCCA 1V4TA 4KH5A 4Y1CA 2DPNA 3C0BA 4WQ5A 3CJ9A 1BIZA 4M3WA 3AVMA 1BISA 4M3TA 4CEEA 1LCUA 3EEQA 1LWCA 1O1WA 3DLKA 3RMDA 4ICLA 5BPMA 1FK9A 2NNWA 1XWLA 4IEEA 1VSJA 4CE9A 1NGIA 3K0SA 2D0AA 5BPLA 5HROA 1SZ2A 2WOMA 4H8KA 2ZD1A 3CJBA 2GWJA 3CXCM 2KHOA 4OO1J 3KLGA 4FLXA 3AVKA 4CZKA 1D9FA 1WSJA 4O8UA 1D4XA 1X9JA 1J6ZA 3R9PA 5KPTA 3LP3A 3CPWM 3A0IX 1SQKA 3LAKA 1SKRA 1EKEA 3QERA 3TPQA 2KW4A 5KGWA 2F9WA 1K9MO 4PKIA 3FZMA 3LP2A 4BVOA 1JJ2M 1VSEA 1Q82O 2A6AA 3MN6A 4FLWA 2OZMA 2VCPA 3SK3A 5I9EB 1REVA 3KK3A 3DWLA 3E66A 3VQDA 4DLGA 4KTZA 2F9TA 4JKAA 4IEIA 1DT9A 4ID1A 4KRFA 3ZSWA 1X3NA 4JI3K 4QS9A 3AARA 5BR9A 3M8RA 3EZ5A 4E3SA 3BP8A 4O0IA 1GLLO 4EZ9A 4B9UA 1SS6A 1YVUA 3QICA 3TARA 4NXNK 3B6OA 3BZCA 2ZGZA 1YI2N 4YOXA 2IIRA 3CFPA 4ILJA 2J4RA 1NGFA 1RTHA 2OPSA 1J54A 4B1UB 4BRAA 3Q7CA 3VERA 2BDPA 4JI8K 3HO1A 4EIAA 4JK9A 4CGFA 3ZT0A 1NKCA 2HHXA 1RBUA 3VQ8A 4J8FA 2VWJA 3EL2A 3CFRA 3NF8A 2E88A 4NCGA 2P9IA 4DUZK 5C12A 1VQLN 4E7LA 1GLFO 1N33K 3CC2N 4IG3A 3U3YA 1F21A 4FXDA 4KREA 2HHWA 4B9LA 4NCAA 3D7EO 1RDWX 3CCEN 1HR0K 4WQ4C 3ZX0A 3IAYA 3V1RA 1RT3A 4DTOA 4FJIA 1S5JA 1ZBUA 4KHPK 1S1UA 3VGMA 2NRZA 1WSHA 4OX9K 1N36K 1X9WA 4WFAL 2YNIA 3W0LA 4HUFA 1BOTO 1D5AA 3KK1A 4CJTA 1V4SA 3AVLA 2D1KA 4BRQA 4DTPA 3VF2A 4JI4K 3T69A 4DHYA 3HYFA 1TUUA 5LJVA 4FWMA 1U45A 3I8DA 4JKFA 1QQCA 4I9LA 3KIOA 4K25A 5BPNA 2VG6A 4NLBA 3MXMA 1TKDA 3KZBA 4E89A 4DFPA 2E1ZA 3VEOA 3T1YK 4YOTA 4LH5A 3EN9A 3QDKA 1S3XA 4KHSA 3OYKA 4CZHA 3NHGA 3B8AX 5I3UA 2PYLA 3MXIA 1L3UA 1QQOA 4DV2K 3ZT4A 1Q7YO 1Q9XA 1RT2A 4ILGB 4JI1K 5GAGP 3H3NO 3AO3A 5BN9A 3ZX3A 1RILA 5I42A 1BWFO 3OBWA 5C2DA 1X9SA 4FW1A 4FLUA 4A59A 4JS4A 3HM9A 1L5UA 4FJKA 1NGDA 3ULEB 3CI5A 2P5OA 4M45A 4B9QA 3TAEA 2ZWHA 4DQRA 4F3TA 1ASUA 2BTFA 3D2FA 4YDUC 4F3OA 1BI4B 2HBMA 3AA2A 4CJ7A 1OH7A 3TTFA 4O8KA 3TSPA 3AO1A 4FWPA 3OS2A 3EE9A 5E26A 4CERA 4X65K 4Z94A 1U04A 3UIQA 2HHHK 4BRIA 1KLNA 5E41A 5C42A 3M6GA 4JHDB 5C25A 1IG9A 1IO2A 5HOOA 4HUEA 3KLHA 5EOYA 2O4GA 3K9KA 5GIOA 4PKGA 1QTMA 4CFCA 4ZHRA 3LDLA 3V6DA 4YOUA 3T7ZA 1HYZA 1VQ8N 3WEEA 1JL2A 5JVGL 1N8RO 1A5VA 4BQLA 1NJIO 5MLCQ 3ZEUB 4EZ6A 4CGIA 3K59A 3BDPA 4U67L 4YOVA 3THVA 2OA8A 1VQKN 1VSLA 4DV3K 3HK2A 2RE2A 5AQTA 4DSJA 3CHWA 2ITMA 1R59O 4JV5K 4FWKA 1C0GA 1J9AA 3MXJA 5F0XA 1S6PA 3UE5A 4WQ5C 1WSIA 5AQFA 1Y97A 5F1XA 1HYVA 4IXCA 4FJLA 2RHKA 4A2BA 2KZMA 2HHTA 5HBMA 2YJFA 5AZJB 3THYB 2QKBA 2QXLA 2P9SB 3OYDA 2VQFK 3TAGA 4FJ9A 1EWQA 3O9UA 5DM7L 4O4GA 3BUZB 4CBWA 4BR4A 4E7HA 2O8CB 4CD1A 4CF2A 1OH6A 3DRPA 1TL3A 1TYQA 3CFOA 1GLBG 4KH4A 5H1SQ 4JYAK 3P38A 4I6MA 3CCJN 1WBBA 5CYMA 1IBMK 3CERA 1OH5A 5BR8K 4PY5A 5AQQA 3QESA 1KVAA 2QM1A 2OANA 1IV0A 4M7XA 3MCAB 2GWKA 3CQYA 2FF6A 3VENA 3ZETB 1NGAA 4CF1A 2WTUA 1OVQA 4CZMA 3TTDA 4C8MA 4FJ8A 2Z1JA 4CGHA 3NF9A 1W9HA 1YITN 4CHZA 5LJWA 3UKUB 2WFBA 1M1KO 3K5MA 3JXUA 4CJWA 3RMCA 4Q5VA 4ELVA 3OHRA 2FSNA 2G8WA 4CBXA 2Y1JA 1HRHA 4CECA 2LSNA 1N34K 4FO0A 3K9JA 2QWLA 1NMDA 1NK0A 3WXIA 3O3GA 3TSUA 3HM8A 3KJVA 1CZAN 3CCVN 5BREA 4DWIA 3O08A 1NKBA 1TK8A 5CYQA 4H0TB 4FWRA 4ISGA 4CEFA 4TSXA 2P5GA 1JL1A 4CJSA 3FZFA 3V1QA 4OKEA 2PAVA 4BR9A 4MDAA 3IUCA 3PV8A 3J7YP 1Q9YA 3OYIA 5AQXA 4K0KK 2E4LA 4LD0A 1QQNA 3TAMA 3MAQA 2Q3SA 3T3FA 3VQCA 2G8UA 1A5WA 1SL0A 3P5JA 4YOWA 4N76A 5JS2A 4E1JA 1UWBA 2BANA 3QEWA 3DRRA 3L3VA 5AR0A 2UUBK 4B3RK 1ASWA 3CM6A 2IDOA 2YNHA 4CJEA 1HYSA 4KHQA 3O3FA 4DQQA 3WUHA 4BC5A 3VQ6A 1X9MA 1LV5A 3M8SA 3OS0A 3QBXA 1TL1A 1RTJA 4M3UA 4K41A 4FPBA 4JEPA 3HJFA 4OPHA 3VEZA 1WB9A 3LWMA 1YAGA 5AQOA 3LALA 4C1NI 3QEIA 2P9PB 3SMSA 2HB5A 4DQSA 5BRDA 1W0HA 4HHTA 1IJJA 2IC3A 3GE1A 2JGUA 2DFFA 5AQWA 1HKBA 4AQYK 4L8RB 5JS1A 3ZSXA 1RDDA 4OKKA 3IFRA 4GV6A 4K8ZA 2D0CA 4KTQA 2ASPA 3TI0A 1QSSA 4LF4K 1S72N 4FWLA 1S1WA 4CEZA 2FC0A 2QXFA 1XHZA 4M3ZA 3FZKA 4BR2A 3LP0A 4BR0A 4FWSA 3KHYA 4XH4A 1H1VA 1MWKA 4H5NA 1JLQA 2P9IB 5EXWA 3AVNA 4N56A 5FPDA 4BRKA 4CVNE 1YJ9N 1IKWA 1FXXA 4JRQA 1SL1A 3QINA 3SJHA 4AILC 2VQEK 4DF4A 1HQEA 4MO5A 1NNEA 2HVIA 2EWSA
chains in the Genus database with same CATH topology
2AA4A 3CPWM 3A0IX 3SMPA 1SQKA 1HPMA 1ZXOA 3BF1A 5AZIB 4NLCA 2WUSA 1Q86O 3TPQA 3U8XA 1ESVA 2F9WA 4AM6A 4BROA 4FSVA 1K9MO 4PKIA 3VEWA 3FZMA 1EO1A 5GIPA 4A2AA 4BVOA 1JJ2M 5JLFA 3VTIA 3JS6A 2D4WA 1Q82O 2A6AA 3MN6A 5M1FA 4H5TA 3J7ZO 2ZJPL 2VCPA 3SK3A 4BC3A 5I9EB 4WFNL 3SBTA 3DWLA 3W3DA 3E66A 1T3VA 3KWGA 5AQZA 2Q36A 1KAYA 2F9TA 4JKAA 4BGAA 4Y0WA 3GG4A 4IEIA 1DT9A 2ZGYA 4GV9A 3N4PA 3TSQA 1X3NA 2ZJQL 2HMPA 3MN9A 4CZGA 4QS9A 4BRNA 3ID8A 2NZTA 3AAQA 3AARA 3HZ6A 5BR9A 4BY9C 2D0PA 1W2BM 3BP8A 3L4IA 1NGJA 1GLLO 4JN4A 1C0FA 1SS6A 4PHTX 3H3OB 3QICA 5AFUA 3CD6N 3S41A 3MX2A 4IFEA 1Z6RA 4WF9L 1YXQA 2QWMA 1M90O 2FLOA 3WXMB 4LC9B 2ZGZA 1NGBA 2CGKA 2P9LA 4JKGA 1OVYA 4DQ8A 1DKGD 1YI2N 2V52B 3GL1A 4YOXA 2IIRA 3R6MA 4L3QA 4XH5A 4ILJA 5EVZA 5DM6L 3O9TA 2J4RA 1NGFA 3CCRN 4UY8O 1T6DA 1SAZA 4B1UB 4BRAA 3Q7CA 3VERA 2GELA 5EX5A 3CF5L 4EIAA 4JK9A 3SAFA 2A41A 3WXLA 2FSJA 4J8FA 1VQ6N 3EL2A 5AQHA 4WCEL 1U2VB 2P9KA 3H6EA 4CZFA 2IVNA 5FPMA 4BRLA 5JICA 5AFUH 3NVKA 2E88A 3R1XA 3TU5A 4JKDA 2KKZA 2P9IA 4RCHA 3I56N 2F7TA 5C12A 1VQLN 4GV3A 1O13A 1GLFO 4IOXA 3G71N 1GLJO 4DB3A 3CC2N 1JCGA 4PL7A 3VETA 3D2FB 3D7EO 3C7NA 1RDWX 2Q0UA 2YJEA 2QEXN 3VF6A 3CCEN 4BC4A 4WQ4C 3ZX0A 5GAHP 3HSCA 1VQPN 3HTVA 3WQUA 1X3MA 3DJCA 3FZLA 4ILHA 5M1KA 2E2NA 4M7YA 4A61A 4JAXA 2A5XA 1NGGA 5AZIA 1Y64A 1G99A 5KQDA 4JKGB 3RSEB 2YHYA 3VGMA 2NRZA 5AQGA 3U9ZA 2UYTA 4WQ4A 4BQZA 2Q31A 4WFAL 1Z05A 3W0LA 4IO9L 4G9ZA 1BOTO 5AQKA 2V7YA 4GVEA 1V4SA 2QWPA 1IG8A 1K8KB 1XUPO 2D1KA 3H1QA 4BRQA 3VF2A 3CQXA 2IVOA 4OPAA 3T69A 4BR7A 2YHWA 4DHYA 2BUPA 3O5BA 4KBOA 4FOEA 3WEEB 1TUUA 3A5MC 3AY9A 5LJVA 4WFBL 3J8AA 5M1QA 4C23A 4FWMA 3E1YA 3SAGA 3O6WA 4JKFA 3P39A 3UKRB 4WYBA 5B8HA 2NRXA 5JVHL 3VMFB 4K25A 4CZJA 4ISEA 3L4QA 5BPNA 3MN7A 4JNEA 4NLBA 2NRVA 1JCFA 2WBNA 3KZBA 3MWTA 5KPZA 1YJNN 2E1ZA 3VEOA 2QWNA 1U6ZA 4JK7A 4YOTA 5C15A 2GUPA 3EE8A 3M3ZA 3EN9A 5C2FA 3QDKA 3PLAA 3C6AA 4GNIA 4BRDA 1S3XA 2OTJN 1GLDG 4CZHA 5KPRA 4B1XB 3GDQA 5M1PA 3ATVA 2JWLA 3B8AX 3CJ1A 5AQUA 1QQOA 1TUYA 1Q7YO 4ILGB 5GAGP 3H3NO 2QWOA 5C0YA 3HOSA 5BN9A 4BG9A 4H0VB 3ZX3A 3CJCA 4CI6A 4CZLA 1BWFO 3OBWA 3QMLA 4XH1A 5E84A 4EHUA 5C2DA 4A59A 5GINA 3CCMN 4YOYA 4NO7A 3OBYA 1BG3A 2E2PA 1U2VA 3FR0A 4IDHA 4A57A 4CD3A 1VAZA 3CJAA 1NGDA 2Q97A 3ULEB 3CI5A 5AQNA 3LM9A 3I55N 4B9QA 4FOIA 4RWTA 2PFUA 2HF3A 1NWKA 1P90A 2ZWHA 3A5LC 4XEIA 3ZX2A 1TYQB 2QWRA 4PL8A 3HOTA 1YVNA 1T44A 2BTFA 3IDHA 3D2FA 4YDUC 4I6MB 2HBMA 4A5BA 4CJ7A 3TTFA 3CCLN 1VQMN 4O8KA 3O1WA 3TSPA 2QI2A 3DAWA 1ZBSA 3CETA 4FWPA 3EE9A 4FPAA 5E26A 4BR5A 4JKHA 4JKBA 4Z94A 3CIPA 2GEMA 3LDPA 4BRIA 1MDUB 5LY3A 3M6GA 3ENBA 3CCQN 2P9NB 4JHDB 4EHTA 3RSEA 4M63C 1KD1O 2V51B 3EZWA 1NGCA 5AQYA 4IOAL 1NM1A 1WOQA 2HBKA 5HOOA 2YCHA 3F2KA 2BH1A 1QVFM 4A5AA 3UB5A 2NRRA 4ISFA 3E9PA 5EOYA 5GADP 1K73O 3O4WA 4EAHD 3VF4A 1QQMA 4QS8A 3K9KA 1BO5O 4MO4A 1K8KA 3RVCA 5GIOA 1BDGA 1VQ4N 3P4IA 1JCEA 4PKGA 3IMXA 4FWOA 2E20A 4K43A 4BRPA 3G4SN 3C65A 3LDLA 4YOUA 3EO3A 3T7ZA 5KQ8A 1VQ8N 3BF3A 3WEEA 2P9UB 1RFQA 2KLAA 5JVGL 1N8RO 3LDQA 2OTLN 1NBWA 4RTFD 4BQLA 3F5TA 3MK6A 4MLHA 1GLAG 3ZYYX 5MLCQ 3AGKA 3LDNA 3ZEUB 4IOCL 1NJIO 3UKRA 3VESA 4GY2B 2ZF5O 2W41A 5AQLA 3FFKB 1Q81O 1HJOA 3C6HA 4KH6A 3VOVA 3CMEN 3LL3A 3HBTA 3HRGA 4U67L 4YOVA 1E4FT 3CCUN 2I7NA 2HF4A 3WXJA 1VQKN 1E4GT 4JKEA 3L6QA 4BRMA 2CGLA 3A5NC 5ADXA 2ASMA 4QS7A 2E8AA 2RE2A 5AQTA 3CHWA 3DXMA 2ITMA 4BRFA 1R59O 2H3GX 1MWMA 2YHXA 1C0GA 4FWKA 4BG8A 4H0PA 4B1YB 5F0XA 3UE5A 2IVPA 3FGUA 4HWIA 4WQ5C 3SAHA 3CCSN 3FLCO 3PIPL 2QA4N 3M5RA 2A42A 1OKJA 2VGNA 3P31A 5AQFA 2CGJA 4A62A 4IXCA 5F1XA 2RHKA 4IZ9A 4A2BA 2Q2RA 5CE3A 4BRCA 2GX9A 2YJFA 4H0OA 5AZJB 3VEVA 2QXLA 3G6EN 3VGKA 2P9SB 3UKUA 4CZIA 1HKCA 3GOIA 2PBDA 3O9UA 5DM7L 3BUZB 3ULEA 4CBWA 4BR4A 2D0OA 3U4LA 1QZ5A 4CD1A 3QBWA 5ADXH 2VWBA 3CJ7A 1KC8O 1BU6O 4H03B 5BRHA 4DKWA 2ZJRL 1ATSA 1TYQA 3O8MA 3WT0A 1GLBG 4KH4A 5H1SQ 4DCHA 3P38A 4I6MA 3CCJN 3H46O 4HTLA 1S22A 3MCPA 1DEJA 1HLUA 1XC3A 3CERA 4FWNA 1YHQN 1VQ7N 1VQNN 2A3ZA 5AQQA 4YORA 2QM1A 2OANA 3AGRA 1VQ5N 4M7XA 1ZC6A 3MCAB 2GWKA 3CQYA 3O80A 2FF6A 4H5VA 5AQJA 5JMVA 3VTHA 5M1NA 1RDUA 3E9OA 3VENA 1BUPA 1ATNA 1MA9B 3ZETB 5AQPA 1NGAA 3DXMB 1RGIA 2P9NA 4JHDA 1HUXA 1LOTB 4IWVA 2QW9A 4MLEA 4K42A 4CZMA 3TTDA 5AQIA 1W97L 2E2OA 4IJNA 4B1ZA 1KQSM 3OW2M 1YITN 5FPEA 3KK7A 3U9DA 1YJWN 5LJWA 3DLLL 3UKUB 4FL9A 1NGEA 2WFBA 3TTCA 1QHAA 2FSKA 1M1KO 3NMUA 2E2QA 2Q1NA 3FE1A 3JXUA 3WQTA 3OHRA 2A40A 2FSNA 3MDQA 3I33A 4FVUA 2P9UA 2QTDA 4CBXA 2FXUA 2WC9A 2YI1A 3VEYA 2VYPA 5EY4A 5BN8A 3ZEUA 4FO0A 3NVMA 4CZEA 3K9JA 2QWLA 1NMDA 1NGHA 3GBTA 3WXIA 3BEXA 4JD2B 4NB4A 1Q18A 4H0XB 3TSUA 3HM8A 3PIOL 4BVPA 1CZAN 3DXKB 3I8BA 5BREA 3CCVN 3ENOA 1QZ6A 3O08A 4U7BA 4FWQA 4PKHA 4H0TB 1P8ZA 4FWRA 3R8EA 3D2EA 4ISGA 4YDUA 5GAEP 4H5WA 4BC2A 3VEXA 4BGBA 3FZFA 4EFHA 1WUAA 4IJAA 4BRGA 1KAZA 2PAVA 3KWIA 4MDAA 3IUCA 1KXPA 5FPNA 2P9PA 4BR9A 1NLVA 3LM2A 5AQXA 5JLHA 3EKUA 2YX6A 2NLXA 1HX1A 3MWPA 1QQNA 2HBLA 5AZJA 5CHIA 4B1WB 2P9SA 3WXKA 5AQSA 3ENHA 3KVGA 4BREA 3HI0A 1ILYA 4YOWA 5AQMA 3AAPA 4E1JA 2NRTA 4H0YB 2E1YA 3G25A 3EKSA 5AQVA 5AR0A 4B1VA 4H5RA 1XQSC 2V7ZA 1KAXA 1T6CA 3R3LA 1HKGA 3QB0A 3FZHA 1VQ9N 3CC7N 2AP1A 3WUHA 3MMVA 4BC5A 1K8AO 3SBGA 3MX5A 3QBXA 2CH5A 3E9LA 4IO8A 4K41A 3O9RA 4FPBA 4BRHA 1GLCG 5BRFA 4JEPA 3MN5A 4AM7A 4OPHA 1QVGM 1VQON 3D2EB 3L0QA 3ZETA 2W40A 3VEZA 3O9QA 1DGKN 3QFPA 3F9MA 1YAGA 5AQOA 4JKCA 3N4QA 2I7PA 4C1NI 1GLEG 3VGLA 1ATRA 2P9PB 2Q0RA 3CC4N 3SMSA 5BRDA 1BA0A 1V4TA 2VGMA 3ATUA 4KH5A 1IJJA 3VPZA 3CPEA 2DPNA 3GE1A 2JWKA 1EQYA 4C1NK 5AQWA 1HKBA 3C0BA 3QFUA 1YF5L 1YIJN 4WQ5A 3CJ9A 3ID6A 2HOEA 2HSTA 3IFRA 2P9LB 1LCUA 4GV6A 2ASPA 2CH6A 2FF3B 2ASOA 3A8YA 5C10A 3OA9A 5BPMA 5TKYA 3H45C 4FWLA 1S72N 2NNWA 4JD2A 2GTDA 4MDBA 5CR4A 4IEEA 5AQRA 3DXKA 3O1BA 2NRHA 1NGIA 3FZKA 4BR2A 4CBUA 5HL7L 2P9KB 4AF1A 4BR0A 4FWSA 3H1VX 3KHYA 4XH4A 1H1VA 1MWKA 3D6RA 4H5NA 5ELZA 5BPLA 1SZ2A 2P9IB 1YUWA 5EXWA 2NRWA 3IKMA 3A5OC 2QWQA 3CJBA 5FPDA 2GWJA 3CXCM 2KHOA 3LDOA 4OO1J 4R79A 4O5FA 4BRKA 2HBJA 3Q7BA 1BA1A 1YJ9N 4CZKA 4JK8A 3M1FA 5F2RA 3CMAN 3C7NB 4O8UA 3SJHA 5TKWA 1D4XA 5M1OA 1X9JA 1J6ZA 4F9OA 3R9PA 4MO5A 3SLCA 5KPTA 3O9SA 2EWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9T A;  3KWI A;  3O9U A;  4OPA A;  3D6R A;  3O9R A;  3RVC A;  4OPH A;  3EE9 A;  3P39 A;  3O9Q A;  3P38 A;  2KKZ A;  3L4Q A;  3OA9 A;  3KWG A;  3F5T A;  3M5R A;  3P31 A;  2RHK A;  3EE8 A;  3O9S A;  2GX9 A; 
#chains in the Genus database with same CATH topology
 2AA4 A;  4IDK A;  3SMP A;  1HPM A;  4GVM A;  3BF1 A;  3U8X A;  4KHY A;  4BRO A;  4FSV A;  3VEW A;  4AHC A;  1EO1 A;  1Q8I A;  5GIP A;  1WAJ A;  4DSK A;  5FRO A;  3HP9 A;  4X64 K;  1T3V A;  3KWG A;  5IT9 O;  5AQZ A;  4Z4C A;  4CFD A;  2ZGY A;  4DTR A;  3DLE A;  4GV9 A;  5C24 A;  2F96 A;  4BY9 C;  1N6Q A;  3BY5 A;  4KB0 A;  4E1M A;  1C0F A;  3S41 A;  3AVB A;  2FBT A;  2FLO A;  3WXM B;  1G15 A;  4CCH A;  1NGB A;  2CGK A;  3NH2 A;  4JKG A;  1OVY A;  1YTA A;  4XH5 A;  5EVZ A;  5J1E A;  1WSE A;  4GKK K;  3CCR N;  3D45 A;  2GV9 A;  1T05 A;  1VRU A;  2FSJ A;  1KSP A;  4DR6 K;  5AQH A;  2P9K A;  4CZF A;  5JIC A;  3NVK A;  3AA5 X;  5AFU H;  3ZT1 A;  4DF8 A;  5HRN A;  2UUC K;  4KB1 A;  3V9U A;  4RCH A;  3OVN A;  4DB3 A;  1JCG A;  3RTV A;  3K5O A;  1UA1 A;  3VET A;  4AH9 A;  1DTQ A;  3D2F B;  4FVM A;  3C7N A;  1NOZ A;  4BC4 A;  4QAG A;  5GAH P;  1VSF A;  2X74 A;  4B08 A;  4DV4 K;  2UUA K;  1X3M A;  4M42 A;  3DJC A;  4ILH A;  5M1K A;  2E2N A;  4M7Y A;  4A61 A;  2A5X A;  1KTQ A;  4CF0 A;  2UXB K;  5AQG A;  1ZBL A;  2QK9 A;  3T19 A;  2UYT A;  4F2S A;  4OGE A;  4BQZ A;  2Q31 A;  4Z4G A;  1YT3 A;  3KKR A;  1Z05 A;  1HNV A;  4LF6 K;  4G9Z A;  2XRI A;  4O0J A;  1IG8 A;  4LF8 K;  2XY5 A;  3G0Z A;  2G8F A;  2OCE A;  5J2M A;  2O8E A;  1CXU A;  2YHW A;  2BUP A;  3WEE B;  1FKP A;  4FOE A;  4DG1 A;  3E1Y A;  3P39 A;  4CHN A;  4N41 A;  2FBV A;  2F8T A;  5JVH L;  3VMF B;  4ISE A;  4JNE A;  4CK3 A;  5KPZ A;  1YJN N;  1SV5 A;  4JK7 A;  5C15 A;  2GUP A;  3EE8 A;  1BIU A;  3LWL A;  1BCM A;  3RRG A;  3C6A A;  3PLA A;  2UXD K;  2OTJ N;  4OVL A;  3VQP A;  3KKS A;  3DOL A;  3ATV A;  3CJ1 A;  1RDA A;  1RTD A;  1TUY A;  3THX A;  5C0Y A;  1S9E A;  4H0V B;  3ASM A;  4XH1 A;  4KHN A;  3CCM N;  4YOY A;  4NO7 A;  1BG3 A;  2E2P A;  1U2V A;  4RW6 A;  4MQ3 A;  3LM9 A;  3I55 N;  2IGI A;  1TVR A;  1P90 A;  2HF3 A;  4XEI A;  3ZX2 A;  1TYQ B;  4PL8 A;  3HOT A;  1B9F A;  1YVN A;  1JLE A;  3SCX A;  4I6M B;  3PSI A;  3KLI A;  1JLA A;  3O1W A;  1ZBS A;  3I0S A;  1RT1 A;  4X62 K;  3K5L A;  4LF5 K;  3SQ0 A;  3QIP A;  4CJU A;  1C1B A;  3CCQ N;  1RTI A;  4EHT A;  4CEO A;  4B3O A;  2XO7 A;  3EZW A;  1NGC A;  4IOA L;  2FBY A;  1NM1 A;  4CJV A;  2HBK A;  3F2K A;  1K6Y A;  3UB5 A;  5GAD P;  1K73 O;  4EAH D;  3VF4 A;  4V19 S;  1QE1 A;  1BO5 O;  4DV0 K;  3RVC A;  4B9N A;  1VQ4 N;  1JCE A;  3IMX A;  4FWO A;  4K43 A;  2JLE A;  4BRP A;  3C65 A;  5KQ8 A;  3VQB A;  1RFQ A;  1LAW A;  4DR5 K;  4BWM A;  1NBW A;  1GLA G;  4DV6 K;  3UKR A;  3VES A;  4GY2 B;  2W41 A;  2ZF5 O;  3SUO A;  1Q81 O;  2D5R A;  3CME N;  3VOV A;  3HXM A;  3G10 A;  3LL3 A;  2A1S A;  2I7N A;  3NH1 A;  1E4G T;  4JKE A;  3BZK A;  2CGL A;  3HP6 A;  3OYB A;  4QS7 A;  3ZSO A;  1VSM A;  2E8A A;  4BRF A;  3THW A;  2H3G X;  1RCH A;  4CGD A;  1VSD A;  4B1Y B;  1EXQ A;  2W42 A;  4DV5 K;  2IVP A;  3FGU A;  3CCS N;  3FLC O;  3PIP L;  3M5R A;  2E5L K;  1OKJ A;  3DLR A;  3DLB A;  4J2A A;  4CIF A;  4C8K A;  1JKH A;  4LF7 K;  3VGK A;  3SV4 A;  2PBD A;  4FJH A;  3NF6 A;  3DI6 A;  2BGG A;  1QZ5 A;  3NFA A;  2XHB A;  5ADX H;  3CJ7 A;  3ZSR A;  5BRH A;  3O8M A;  4NYF A;  3WT0 A;  4AHT A;  4Q0B A;  3H46 O;  3MCP A;  1Z26 A;  5KGX A;  3O4Q A;  4FJM A;  1XC3 A;  4FWN A;  1YHQ N;  3NF7 A;  1SUQ A;  3AGR A;  2YHA A;  1ZC6 A;  5M1N A;  3NH0 A;  1RDU A;  3WNG A;  1CZB A;  1MA9 B;  5AQP A;  3DXM B;  5LMU K;  4IWV A;  4OPK A;  4KI4 A;  1NK5 A;  5KRT A;  4LFB K;  1NOY A;  1XI1 A;  4IJN A;  3CM5 A;  2YV0 X;  4CHP A;  3OW2 M;  2FBX A;  3P83 D;  3KK7 A;  3U9D A;  4ELU A;  4C8O A;  4Z4F A;  4FL9 A;  3TTC A;  3NMU A;  3SUN A;  1S6Q A;  3QNN A;  4IKF A;  3PO5 A;  2P9U A;  4DR7 K;  2FXU A;  1MU2 A;  3VEY A;  5EY4 A;  5BN8 A;  1TK0 A;  3S3M A;  3SUP A;  4CZE A;  3OYA A;  4NB4 A;  4H0X B;  4AHV A;  2UXC K;  3NAE A;  3V9W A;  2KTQ A;  4BVP A;  1QSL A;  3T1A A;  3D0P A;  3OS1 A;  3ENO A;  1QZ6 A;  5KRS A;  4FWQ A;  3R8E A;  3D2E A;  3V9X A;  3IG1 A;  3VQQ A;  4H5W A;  3ZSV A;  3VEX A;  4BC2 A;  4BGB A;  1XNR K;  4EFH A;  4IJA A;  1J53 A;  1XNQ K;  1KAZ A;  4CJL A;  3EKU A;  5J2Q A;  4B1W B;  5AQS A;  2Z1H A;  3KVG A;  3QO9 A;  3HI0 A;  2B4J A;  1ILY A;  1JLC A;  2NRT A;  4H0Y B;  5AQV A;  4DTM A;  4B1V A;  2ETJ A;  1CLQ A;  4H5R A;  3R3L A;  3QB0 A;  3FZH A;  1VQ9 N;  1BGX T;  2AP1 A;  4YY3 K;  1NK7 A;  1GOB A;  4I2P A;  2Y1I A;  4LFA K;  3SBG A;  3AV9 A;  3J7A P;  3E9L A;  4IO8 A;  1SKW A;  2XY8 A;  5BRF A;  3ZSY A;  4DTS A;  4AM7 A;  5SWM A;  1QVG M;  3TAP A;  3O9Q A;  3L8B A;  1DGK N;  1J5O A;  3QFP A;  4F8R A;  2KFZ A;  2EHG A;  1U48 A;  4HVJ A;  2HW3 A;  3TAF A;  1WAF A;  4CJ4 A;  1BA0 A;  4W5R A;  1RDB A;  1WNS A;  3VPZ A;  3OYG A;  4FLT A;  1EQY A;  3QFU A;  5A2Q O;  4N5S A;  1YF5 L;  1YIJ N;  4DTJ A;  2ATQ A;  4HCB A;  3ID6 A;  2HOE A;  2HST A;  4C8L A;  2ASO A;  1HNX K;  3ZLJ A;  1FW6 A;  3A8Y A;  4DS5 A;  3L3U A;  3OA9 A;  4E7K A;  5TKY A;  3H45 C;  3LPT A;  4QCL A;  4JD2 A;  2GTD A;  4MDB A;  5CR4 A;  5AQR A;  3O1B A;  2NRH A;  3M8Q A;  4CJF A;  2P9K B;  5HL7 L;  4OKJ A;  2E6M A;  5ELZ A;  3D6R A;  1YUW A;  4DS4 A;  2ITG A;  3NBP A;  4CFB A;  4DR2 K;  3LP1 A;  1BA1 A;  3Q7B A;  4JK8 A;  3M1F A;  3WNF A;  1WBD A;  3CMA N;  4LY7 A;  3C7N B;  1TK5 A;  2HNY A;  4CIE A;  4E7J A;  1WSG A;  5TKW A;  4DU3 A;  5M1O A;  1SKS A;  2O8B A;  4LSL A;  3EY1 A;  4NLC A;  2WUS A;  1Q86 O;  1L3S A;  5FRN A;  3OTO K;  1ESV A;  4FLY A;  2W6L A;  4DTN A;  4CEA A;  3JS6 A;  4CJK A;  2D4W A;  3ZT2 A;  4H5T A;  3J7Z O;  4CEB A;  4BC3 A;  3SBT A;  2Q36 A;  4DFM A;  4BGA A;  4Y0W A;  3GG4 A;  2O8E B;  3DM2 A;  4B3M K;  4PUO A;  2HHQ A;  2HMP A;  3AVH A;  3MN9 A;  4CZG A;  3AA3 A;  3ID8 A;  1CZ9 A;  2D0P A;  3KTQ A;  1VSI A;  4DQI A;  3L4I A;  1NGJ A;  1S1T A;  4PHT X;  5AFU A;  3H3O B;  3CYM A;  4KPY A;  2XY6 A;  4CW7 B;  3MX2 A;  4IFE A;  1Z6R A;  4WF9 L;  4IBN A;  1YXQ A;  2RKI A;  2P9L A;  4DQ8 A;  1DKG D;  1XMQ K;  2V52 B;  4F2R A;  4CK1 A;  3R6M A;  4L3Q A;  3THX B;  4BDZ A;  4RW4 A;  1T6D A;  2EX3 A;  4CEQ A;  1HQU A;  4E19 A;  3SAF A;  2A41 A;  3K5N A;  2D0B A;  1VQ6 N;  4WCE L;  1U2V B;  5FPM A;  4JKD A;  4DR3 K;  2KKZ A;  4GV3 A;  3NGI A;  1QSY A;  1T7P A;  3G71 N;  1GLJ O;  1TGO A;  3ZT3 A;  4PL7 A;  4DMN A;  4FJJ A;  2RPI A;  4XIU A;  4DFJ A;  3HSC A;  1VQP N;  3HPG A;  4EP4 A;  3FZL A;  4DUY K;  5LL6 Z;  4JAX A;  4OPJ A;  3TAN A;  1NGG A;  5AZI A;  4GMJ B;  1Y64 A;  1G99 A;  1BCO A;  4H4O A;  5KQD A;  4DV1 K;  3U9Z A;  4WQ4 A;  3SYZ A;  3SNN A;  1RT5 A;  4DSF A;  5T7B A;  4GVE A;  1EET A;  1VK0 A;  1D8Y A;  3AVI A;  1XUP O;  3SPZ A;  1JLB A;  3H1Q A;  4DSE A;  3CG7 A;  1BHL A;  1QHT A;  2IVO A;  3CQX A;  4OPA A;  4KBO A;  3O5B A;  3VQ5 A;  3MEE A;  3O3H A;  3AY9 A;  4FCY A;  3C95 A;  3UKR B;  4WYB A;  5CZ1 A;  3KD1 E;  4LSN A;  4IFY A;  3MN7 A;  4JI0 K;  2NRV A;  4FM2 A;  3MWT A;  1XMO K;  4LFC K;  1NJY A;  1S1X A;  4LF9 K;  4KV8 A;  4B3T K;  1LWF A;  1BL3 A;  4GNI A;  4BRD A;  5KPR A;  5M1P A;  5KTQ A;  4CJR A;  3KK2 A;  1C0U A;  3PO4 A;  2QWO A;  1T03 A;  1HNZ K;  4JS5 A;  4BG9 A;  3CJC A;  4CZL A;  5E84 A;  5GIN A;  3QET A;  3OBY A;  2YKN A;  3FR0 A;  2GUI A;  3MED A;  4A57 A;  2HHV A;  1VAZ A;  3CJA A;  2Q97 A;  3OYH A;  1WLJ A;  4N47 A;  4FOI A;  2OYQ A;  1NWK A;  3V81 A;  4ZTJ A;  3IDH A;  4X66 K;  2X78 A;  3ZCM A;  3CCL N;  1VQM N;  2QI2 A;  4BE0 A;  3DAW A;  4B9S A;  3CET A;  4M3R A;  1C1C A;  4FPA A;  4NXM K;  3CIP A;  3TR8 A;  2GEM A;  4E1N A;  3LDP A;  1MDU B;  5LY3 A;  4J2D A;  3ENB A;  3ZSZ A;  1IH7 A;  1HPZ A;  3RSE A;  3OYM A;  4M63 C;  1KD1 O;  1JXB A;  4B3S K;  1OH8 A;  4CJ3 A;  4PQU A;  1QVF M;  2IOC A;  4A5A A;  3L2U A;  4ISF A;  3E9P A;  1I94 K;  1QQM A;  2PY5 A;  4MO4 A;  1K8K A;  4CJQ A;  3L2V A;  1BDG A;  4FJ7 A;  3JYT A;  3P4I A;  2DY4 A;  1NK4 A;  4DTU A;  2F4V K;  3G4S N;  2YKM A;  4CGJ A;  2P9U B;  3NDK A;  3OJU A;  3LDQ A;  4JI6 K;  4YFU A;  3U6F A;  1S9G A;  2OTL N;  4RTF D;  3TAQ A;  4DV7 K;  4MLH A;  3ZYY X;  4IOC L;  3LDN A;  5FLX O;  3U3G A;  2O8F A;  2NUB A;  3QEV A;  3CCU N;  2HF4 A;  3L6Q A;  5ADX A;  1IKY A;  3C94 A;  2ASM A;  2RN2 A;  4QOZ B;  1C0T A;  1MWM A;  1TKZ A;  4FLV A;  4BG8 A;  4FZX C;  3SAH A;  1KRP A;  3C6U A;  1C6V A;  1RT4 A;  2QA4 N;  2VGN A;  4A62 A;  2CGJ A;  4IZ9 A;  2Q2R A;  2GX9 A;  3VEV A;  3M8P A;  3UKU A;  1NK9 A;  2P1J A;  3OYC A;  3HPO A;  4W5Q A;  2D0O A;  3SUQ A;  2B5J A;  3P1G A;  4H03 B;  4DKW A;  4W5T A;  3AVJ A;  3IRX A;  1BQM A;  4OLB A;  3RMB A;  3OYN A;  4HTL A;  2P51 A;  3B6P A;  1VQ7 N;  1VQN N;  2A3Z A;  2DTU A;  4KHU A;  1VQ5 N;  2O8D A;  1T8E A;  4BE1 A;  3VTH A;  3E9O A;  1VHX A;  1NK8 A;  1ATN A;  1RBR A;  3SQ2 A;  2O4I A;  2P9N A;  3AVA A;  1NJZ A;  4JRP A;  4CIG A;  1HUX A;  4NYN A;  4MLE A;  1VSH A;  1W97 L;  1NJW A;  4M41 A;  4CK2 A;  1U47 A;  4B1Z A;  1U4B A;  1KQS M;  4GKJ K;  1YJW N;  1QHA A;  2FSK A;  2E2Q A;  3WQT A;  4B9T A;  3MDQ A;  2QTD A;  2VG5 A;  2WC9 A;  2YI1 A;  3ISN C;  4OLA A;  2DFH A;  2VYP A;  3SPY A;  4CGG A;  2B6A A;  4FM1 A;  3KD5 E;  3NVM A;  4Z0U A;  3GBT A;  3BEX A;  4JD2 B;  1Q18 A;  1HMV A;  3L2R A;  4PKH A;  1P8Z A;  5GAE P;  3J80 O;  1XC9 A;  4K8X A;  2HNZ A;  1R0A A;  4J2B A;  1EX4 A;  3HVR A;  2P9P A;  1NLV A;  3S9H A;  4CJ5 A;  3LM2 A;  4Y1D A;  3LAM A;  2NLX A;  2ZE2 A;  1HX1 A;  4KKO A;  2HBL A;  4CF9 A;  5CHI A;  2GBZ A;  2G8I A;  3VN5 A;  3ENH A;  4BRE A;  4J2E A;  2O8B B;  4NCB A;  2IAJ A;  1RDC A;  4OGC A;  4CHQ A;  2E1Y A;  3G25 A;  1NJX A;  4PA1 A;  1XQS C;  2V7Z A;  3VA0 A;  4H4M A;  4B8C A;  3CC7 N;  3VA3 A;  3MX5 A;  2CH5 A;  2WON A;  3O9R A;  1GLC G;  3MN5 A;  3LPU A;  1UOC A;  2W40 A;  1IKX A;  3F9M A;  1KVB A;  4JKC A;  3N4Q A;  1GLE G;  3VGL A;  3CC4 N;  1KCF A;  3ATU A;  2VGM A;  3CPE A;  3F9K A;  2JWK A;  4C1N K;  4M3X A;  1TV6 A;  1UAX A;  3OYE A;  2IS3 A;  2P9L B;  2ZM6 K;  3RMA A;  2CH6 A;  2FF3 B;  4FYD A;  5C10 A;  4G1Q A;  4IG0 A;  3LZI A;  3DXK A;  4CJP A;  1TKX A;  3ITH A;  4CBU A;  4CFA A;  4AF1 A;  3H1V X;  4DSL A;  2NRW A;  1FKO A;  3A5O C;  3IKM A;  2QWQ A;  4YNQ A;  3LDO A;  4R79 A;  4O5F A;  4FJG A;  2HBJ A;  5F2R A;  1RBS A;  4DFK A;  1TAU A;  4RG8 A;  2HMI A;  3K2P A;  3PX0 A;  4F9O A;  4HTU A;  1NKE A;  3SLC A;  4O55 A;  3O9S A;  5IWA K;  2BE2 A;  5KI6 A;  1ZXO A;  5AZI B;  4JI7 K;  1E3M A;  3DLG A;  1KFS A;  4AM6 A;  3PSF A;  2Z1G A;  3CQ8 A;  3A2F A;  3DYA A;  4A2A A;  5JLF A;  3L2Q A;  3VTI A;  5M1F A;  3ULD A;  2ZJP L;  4WFN L;  3W3D A;  4BE2 A;  1KAY A;  3TWH A;  5FRM A;  3VQ4 A;  4I9Q A;  5K14 A;  3N4P A;  3TSQ A;  3LDS A;  1ITG A;  2ZJQ L;  3RR8 A;  1FJG K;  3BGR A;  1Z25 A;  3T1H K;  4BRN A;  2Z1I A;  2NZT A;  3AAQ A;  3HZ6 A;  4M3Y A;  2YNG A;  1QS4 A;  4MFB A;  1W2B M;  4BAC A;  4JN4 A;  3CD6 N;  4O5B A;  2AJQ A;  2QWM A;  3LZJ A;  4DTX A;  1M90 O;  2E6L A;  4LC9 B;  4ZTF A;  4DLE A;  1ASV A;  4HUG A;  1S1V A;  3GL1 A;  3QEP A;  5DM6 L;  3O9T A;  3JSM A;  4RW7 A;  1BQN A;  4UY8 O;  3O4N A;  1SAZ A;  2PYJ A;  2GEL A;  5EX5 A;  3CF5 L;  4RW8 A;  1SL2 A;  3NGZ A;  1JLF A;  3WXL A;  1W7A A;  3H6E A;  5HLF A;  2IVN A;  4BRL A;  2DFE A;  3TU5 A;  3R1X A;  1N32 K;  1RBT A;  3I56 N;  4KTW A;  2F7T A;  3VQA A;  1O13 A;  4IOX A;  1JLG A;  4JI2 K;  2HND A;  3DMJ A;  1B92 A;  4E7I A;  2KZZ A;  5AJ3 K;  2Q0U A;  2YJE A;  2QEX N;  3VF6 A;  2R7Y A;  3HTV A;  3WQU A;  4FZZ A;  4CHO A;  4B9V A;  3RWU A;  1GOA A;  4JKG B;  3RSE B;  2YHY A;  1RT6 A;  2HVH A;  1KVC A;  3SJJ A;  4IO9 L;  5AQK A;  2V7Y A;  3NCI A;  4FK4 A;  3OY9 A;  2HHU A;  2QWP A;  1K8K B;  4C8N A;  4I2Q A;  4BR7 A;  4BDP A;  1RNH A;  1A5X A;  3A5M C;  2VG7 A;  4WFB L;  3J8A A;  5M1Q A;  4C23 A;  3SAG A;  4DR1 K;  3O6W A;  5FDL A;  5B8H A;  2NRX A;  4CZJ A;  3QNO A;  3L4Q A;  1LW2 A;  2O8F B;  1GOC A;  1JCF A;  2WBN A;  1EP4 A;  3E01 A;  1C1A A;  2QWN A;  1U6Z A;  3M3Z A;  5C2F A;  3DRS A;  1GLD G;  4B1X B;  1HJR A;  4AHS A;  3GDQ A;  1XHX A;  1DTT A;  2JWL A;  1D9D A;  5AQU A;  2I5J A;  5DMR A;  4FK0 A;  5CY4 A;  3WNH A;  3HOS A;  2YHB A;  2UU9 K;  4CI6 A;  5EU7 A;  3QML A;  4EHU A;  1ZBF A;  3PUF A;  3ALY A;  4DU1 A;  1EWR A;  4IDH A;  4O44 A;  4CD3 A;  4ID5 A;  1HNW K;  4W5N A;  5AQN A;  3AO2 A;  2G8K A;  3J81 O;  3L2W A;  4RWT A;  2PFU A;  3A5L C;  3TAB A;  2QWR A;  3K57 A;  1T44 A;  3AVG A;  3V9Z A;  1CXQ A;  4A5B A;  1VSK A;  4FJN A;  1RBV A;  5CZ2 A;  2QKK A;  4BR5 A;  1L3T A;  3V4I A;  1LW0 A;  4JKH A;  4JKB A;  2O8D B;  3HST B;  3IS9 A;  1LWE A;  1L3V A;  2ZQB A;  3F73 A;  4FJ5 A;  2P9N B;  3V1O A;  4BWJ A;  2V51 B;  2A1R A;  5AQY A;  4UQG A;  1WOQ A;  1TAQ A;  2YCH A;  2BH1 A;  3JAM O;  3KLE A;  2NRR A;  4DU4 A;  3O4W A;  3EYZ A;  4QS8 A;  1KLM A;  4WE1 A;  2W6K A;  4ELT A;  1U49 A;  3AVC A;  2E20 A;  3H08 A;  5D3G A;  3EO3 A;  3BF3 A;  5DK5 A;  4DSI A;  2KLA A;  4BDY A;  3F5T A;  2OPR A;  3MK6 A;  4RW9 A;  3AGK A;  3VQ7 A;  1J5E K;  5AQL A;  3C6T A;  3FFK B;  3OJS A;  1HJO A;  3C6H A;  4KH6 A;  3HBT A;  3HRG A;  1E4F T;  3HT3 A;  3WXJ A;  3SZ2 A;  3PX4 A;  4BRM A;  1IKV A;  3A5N C;  5LMN K;  4FM0 A;  4LH4 A;  3DXM A;  1ZBI A;  1LAV A;  3NE6 A;  2YHX A;  3SQ1 A;  4EP5 A;  3FFI A;  4H0P A;  5HRS A;  5HRP A;  4HWI A;  3VQ9 A;  2OPP A;  4DQP A;  2A42 A;  1YTU A;  3P31 A;  4JLH A;  4GW6 A;  5CE3 A;  4BRC A;  4H0O A;  3MEC A;  3VQE A;  4CED A;  1RT7 A;  3G6E N;  3PX6 A;  2OZS A;  3MEG A;  4Z4I A;  4CZI A;  1HKC A;  3GOI A;  2OPQ A;  1KFD A;  4B9M A;  3ZSQ A;  3ULE A;  3NGY A;  3U4L A;  4FZY A;  3QBW A;  2VWB A;  1KC8 O;  4DR4 K;  1I39 A;  3S3N A;  1BU6 O;  2ZJR L;  1ATS A;  5HRR A;  4AHR A;  4DCH A;  5J2N A;  1HNI A;  1S22 A;  1BI4 A;  1ZBH A;  1DEJ A;  1HLU A;  1I3A A;  3I0R A;  3RR7 A;  3RRH A;  4YOR A;  2F8S A;  1JXE A;  2G8H A;  1NK6 A;  2YNF A;  5AQJ A;  3O80 A;  4H5V A;  5JMV A;  1X1P A;  4I7F A;  1BUP A;  3THW B;  3HVT A;  1RGI A;  4CES A;  4JHD A;  4CHY A;  4KFB A;  2G8V A;  1LOT B;  3HPH A;  3OYJ A;  2KQ2 A;  2QW9 A;  4K42 A;  2HHS A;  5AQI A;  3WNE A;  4W5O A;  2E2O A;  3QIO A;  3OYL A;  4KHW A;  2VWK A;  5FPE A;  3DLL L;  4YHH K;  1NGE A;  1UA0 A;  3PY8 A;  2Q1N A;  3FE1 A;  1ZYQ A;  1C0M A;  2A40 A;  3SV3 A;  4FVU A;  3I33 A;  4FW2 A;  1B9D A;  2X6S A;  4KI6 A;  3V9S A;  3AO4 A;  3ZEU A;  1NGH A;  3SI6 A;  2XY7 A;  1DLO A;  4KAZ A;  3PIO L;  3DXK B;  3I8B A;  3DOK A;  3DLH A;  4F4K A;  3OYF A;  4U7B A;  1IBK K;  1NMN A;  4YDU A;  5J2P A;  1N5Y A;  4B8A B;  3AO5 A;  1WUA A;  3K58 A;  4BRG A;  3KWI A;  5FPN A;  1KXP A;  3KLF A;  3SQ4 A;  5JLH A;  2YX6 A;  3MWP A;  1WN7 A;  3AVF A;  5AZJ A;  3THY A;  4IFV A;  2P9S A;  3WXK A;  3HL8 A;  3LAN A;  4E0D A;  2O8C A;  1IBL K;  5AQM A;  3AAP A;  4Z4H A;  2KFN A;  2RF2 A;  3EKS A;  4FJX A;  1NU0 A;  4KO0 A;  4AHU A;  4FK2 A;  2PZS A;  1KAX A;  1T6C A;  4FLZ A;  1HKG A;  2X6N A;  3QEX A;  4OJR A;  4JI5 K;  1VRT A;  3MMV A;  1K8A O;  1WSF A;  4R5P A;  5HP1 A;  1NG9 A;  4BRH A;  4Z4E A;  3QLH A;  1VQO N;  3D2E B;  3L0Q A;  3ZET A;  4PWD A;  4CF8 A;  1TKT A;  5SZT A;  2I7P A;  3AA4 A;  1ATR A;  2Q0R A;  3S3O A;  4HCC A;  1V4T A;  4KH5 A;  4Y1C A;  2DPN A;  3C0B A;  4WQ5 A;  3CJ9 A;  1BIZ A;  4M3W A;  3AVM A;  1BIS A;  4M3T A;  4CEE A;  1LCU A;  3EEQ A;  1LWC A;  1O1W A;  3DLK A;  3RMD A;  4ICL A;  5BPM A;  1FK9 A;  2NNW A;  1XWL A;  4IEE A;  1VSJ A;  4CE9 A;  1NGI A;  3K0S A;  2D0A A;  5BPL A;  5HRO A;  1SZ2 A;  2WOM A;  4H8K A;  2ZD1 A;  3CJB A;  2GWJ A;  3CXC M;  2KHO A;  4OO1 J;  3KLG A;  4FLX A;  3AVK A;  4CZK A;  1D9F A;  1WSJ A;  4O8U A;  1D4X A;  1X9J A;  1J6Z A;  3R9P A;  5KPT A;  3LP3 A;  3CPW M;  3A0I X;  1SQK A;  3LAK A;  1SKR A;  1EKE A;  3QER A;  3TPQ A;  2KW4 A;  5KGW A;  2F9W A;  1K9M O;  4PKI A;  3FZM A;  3LP2 A;  4BVO A;  1JJ2 M;  1VSE A;  1Q82 O;  2A6A A;  3MN6 A;  4FLW A;  2OZM A;  2VCP A;  3SK3 A;  5I9E B;  1REV A;  3KK3 A;  3DWL A;  3E66 A;  3VQD A;  4DLG A;  4KTZ A;  2F9T A;  4JKA A;  4IEI A;  1DT9 A;  4ID1 A;  4KRF A;  3ZSW A;  1X3N A;  4JI3 K;  4QS9 A;  3AAR A;  5BR9 A;  3M8R A;  3EZ5 A;  4E3S A;  3BP8 A;  4O0I A;  1GLL O;  4EZ9 A;  4B9U A;  1SS6 A;  1YVU A;  3QIC A;  3TAR A;  4NXN K;  3B6O A;  3BZC A;  2ZGZ A;  1YI2 N;  4YOX A;  2IIR A;  3CFP A;  4ILJ A;  2J4R A;  1NGF A;  1RTH A;  2OPS A;  1J54 A;  4B1U B;  4BRA A;  3Q7C A;  3VER A;  2BDP A;  4JI8 K;  3HO1 A;  4EIA A;  4JK9 A;  4CGF A;  3ZT0 A;  1NKC A;  2HHX A;  1RBU A;  3VQ8 A;  4J8F A;  2VWJ A;  3EL2 A;  3CFR A;  3NF8 A;  2E88 A;  4NCG A;  2P9I A;  4DUZ K;  5C12 A;  1VQL N;  4E7L A;  1GLF O;  1N33 K;  3CC2 N;  4IG3 A;  3U3Y A;  1F21 A;  4FXD A;  4KRE A;  2HHW A;  4B9L A;  4NCA A;  3D7E O;  1RDW X;  3CCE N;  1HR0 K;  4WQ4 C;  3ZX0 A;  3IAY A;  3V1R A;  1RT3 A;  4DTO A;  4FJI A;  1S5J A;  1ZBU A;  4KHP K;  1S1U A;  3VGM A;  2NRZ A;  1WSH A;  4OX9 K;  1N36 K;  1X9W A;  4WFA L;  2YNI A;  3W0L A;  4HUF A;  1BOT O;  1D5A A;  3KK1 A;  4CJT A;  1V4S A;  3AVL A;  2D1K A;  4BRQ A;  4DTP A;  3VF2 A;  4JI4 K;  3T69 A;  4DHY A;  3HYF A;  1TUU A;  5LJV A;  4FWM A;  1U45 A;  3I8D A;  4JKF A;  1QQC A;  4I9L A;  3KIO A;  4K25 A;  5BPN A;  2VG6 A;  4NLB A;  3MXM A;  1TKD A;  3KZB A;  4E89 A;  4DFP A;  2E1Z A;  3VEO A;  3T1Y K;  4YOT A;  4LH5 A;  3EN9 A;  3QDK A;  1S3X A;  4KHS A;  3OYK A;  4CZH A;  3NHG A;  3B8A X;  5I3U A;  2PYL A;  3MXI A;  1L3U A;  1QQO A;  4DV2 K;  3ZT4 A;  1Q7Y O;  1Q9X A;  1RT2 A;  4ILG B;  4JI1 K;  5GAG P;  3H3N O;  3AO3 A;  5BN9 A;  3ZX3 A;  1RIL A;  5I42 A;  1BWF O;  3OBW A;  5C2D A;  1X9S A;  4FW1 A;  4FLU A;  4A59 A;  4JS4 A;  3HM9 A;  1L5U A;  4FJK A;  1NGD A;  3ULE B;  3CI5 A;  2P5O A;  4M45 A;  4B9Q A;  3TAE A;  2ZWH A;  4DQR A;  4F3T A;  1ASU A;  2BTF A;  3D2F A;  4YDU C;  4F3O A;  1BI4 B;  2HBM A;  3AA2 A;  4CJ7 A;  1OH7 A;  3TTF A;  4O8K A;  3TSP A;  3AO1 A;  4FWP A;  3OS2 A;  3EE9 A;  5E26 A;  4CER A;  4X65 K;  4Z94 A;  1U04 A;  3UIQ A;  2HHH K;  4BRI A;  1KLN A;  5E41 A;  5C42 A;  3M6G A;  4JHD B;  5C25 A;  1IG9 A;  1IO2 A;  5HOO A;  4HUE A;  3KLH A;  5EOY A;  2O4G A;  3K9K A;  5GIO A;  4PKG A;  1QTM A;  4CFC A;  4ZHR A;  3LDL A;  3V6D A;  4YOU A;  3T7Z A;  1HYZ A;  1VQ8 N;  3WEE A;  1JL2 A;  5JVG L;  1N8R O;  1A5V A;  4BQL A;  1NJI O;  5MLC Q;  3ZEU B;  4EZ6 A;  4CGI A;  3K59 A;  3BDP A;  4U67 L;  4YOV A;  3THV A;  2OA8 A;  1VQK N;  1VSL A;  4DV3 K;  3HK2 A;  2RE2 A;  5AQT A;  4DSJ A;  3CHW A;  2ITM A;  1R59 O;  4JV5 K;  4FWK A;  1C0G A;  1J9A A;  3MXJ A;  5F0X A;  1S6P A;  3UE5 A;  4WQ5 C;  1WSI A;  5AQF A;  1Y97 A;  5F1X A;  1HYV A;  4IXC A;  4FJL A;  2RHK A;  4A2B A;  2KZM A;  2HHT A;  5HBM A;  2YJF A;  5AZJ B;  3THY B;  2QKB A;  2QXL A;  2P9S B;  3OYD A;  2VQF K;  3TAG A;  4FJ9 A;  1EWQ A;  3O9U A;  5DM7 L;  4O4G A;  3BUZ B;  4CBW A;  4BR4 A;  4E7H A;  2O8C B;  4CD1 A;  4CF2 A;  1OH6 A;  3DRP A;  1TL3 A;  1TYQ A;  3CFO A;  1GLB G;  4KH4 A;  5H1S Q;  4JYA K;  3P38 A;  4I6M A;  3CCJ N;  1WBB A;  5CYM A;  1IBM K;  3CER A;  1OH5 A;  5BR8 K;  4PY5 A;  5AQQ A;  3QES A;  1KVA A;  2QM1 A;  2OAN A;  1IV0 A;  4M7X A;  3MCA B;  2GWK A;  3CQY A;  2FF6 A;  3VEN A;  3ZET B;  1NGA A;  4CF1 A;  2WTU A;  1OVQ A;  4CZM A;  3TTD A;  4C8M A;  4FJ8 A;  2Z1J A;  4CGH A;  3NF9 A;  1W9H A;  1YIT N;  4CHZ A;  5LJW A;  3UKU B;  2WFB A;  1M1K O;  3K5M A;  3JXU A;  4CJW A;  3RMC A;  4Q5V A;  4ELV A;  3OHR A;  2FSN A;  2G8W A;  4CBX A;  2Y1J A;  1HRH A;  4CEC A;  2LSN A;  1N34 K;  4FO0 A;  3K9J A;  2QWL A;  1NMD A;  1NK0 A;  3WXI A;  3O3G A;  3TSU A;  3HM8 A;  3KJV A;  1CZA N;  3CCV N;  5BRE A;  4DWI A;  3O08 A;  1NKB A;  1TK8 A;  5CYQ A;  4H0T B;  4FWR A;  4ISG A;  4CEF A;  4TSX A;  2P5G A;  1JL1 A;  4CJS A;  3FZF A;  3V1Q A;  4OKE A;  2PAV A;  4BR9 A;  4MDA A;  3IUC A;  3PV8 A;  3J7Y P;  1Q9Y A;  3OYI A;  5AQX A;  4K0K K;  2E4L A;  4LD0 A;  1QQN A;  3TAM A;  3MAQ A;  2Q3S A;  3T3F A;  3VQC A;  2G8U A;  1A5W A;  1SL0 A;  3P5J A;  4YOW A;  4N76 A;  5JS2 A;  4E1J A;  1UWB A;  2BAN A;  3QEW A;  3DRR A;  3L3V A;  5AR0 A;  2UUB K;  4B3R K;  1ASW A;  3CM6 A;  2IDO A;  2YNH A;  4CJE A;  1HYS A;  4KHQ A;  3O3F A;  4DQQ A;  3WUH A;  4BC5 A;  3VQ6 A;  1X9M A;  1LV5 A;  3M8S A;  3OS0 A;  3QBX A;  1TL1 A;  1RTJ A;  4M3U A;  4K41 A;  4FPB A;  4JEP A;  3HJF A;  4OPH A;  3VEZ A;  1WB9 A;  3LWM A;  1YAG A;  5AQO A;  3LAL A;  4C1N I;  3QEI A;  2P9P B;  3SMS A;  2HB5 A;  4DQS A;  5BRD A;  1W0H A;  4HHT A;  1IJJ A;  2IC3 A;  3GE1 A;  2JGU A;  2DFF A;  5AQW A;  1HKB A;  4AQY K;  4L8R B;  5JS1 A;  3ZSX A;  1RDD A;  4OKK A;  3IFR A;  4GV6 A;  4K8Z A;  2D0C A;  4KTQ A;  2ASP A;  3TI0 A;  1QSS A;  4LF4 K;  1S72 N;  4FWL A;  1S1W A;  4CEZ A;  2FC0 A;  2QXF A;  1XHZ A;  4M3Z A;  3FZK A;  4BR2 A;  3LP0 A;  4BR0 A;  4FWS A;  3KHY A;  4XH4 A;  1H1V A;  1MWK A;  4H5N A;  1JLQ A;  2P9I B;  5EXW A;  3AVN A;  4N56 A;  5FPD A;  4BRK A;  4CVN E;  1YJ9 N;  1IKW A;  1FXX A;  4JRQ A;  1SL1 A;  3QIN A;  3SJH A;  4AIL C;  2VQE K;  4DF4 A;  1HQE A;  4MO5 A;  1NNE A;  2HVI A;  2EWS A; 
#chains in the Genus database with same CATH homology
 2AA4 A;  3CPW M;  3A0I X;  3SMP A;  1SQK A;  1HPM A;  1ZXO A;  3BF1 A;  5AZI B;  4NLC A;  2WUS A;  1Q86 O;  3TPQ A;  3U8X A;  1ESV A;  2F9W A;  4AM6 A;  4BRO A;  4FSV A;  1K9M O;  4PKI A;  3VEW A;  3FZM A;  1EO1 A;  5GIP A;  4A2A A;  4BVO A;  1JJ2 M;  5JLF A;  3VTI A;  3JS6 A;  2D4W A;  1Q82 O;  2A6A A;  3MN6 A;  5M1F A;  4H5T A;  3J7Z O;  2ZJP L;  2VCP A;  3SK3 A;  4BC3 A;  5I9E B;  4WFN L;  3SBT A;  3DWL A;  3W3D A;  3E66 A;  1T3V A;  3KWG A;  5AQZ A;  2Q36 A;  1KAY A;  2F9T A;  4JKA A;  4BGA A;  4Y0W A;  3GG4 A;  4IEI A;  1DT9 A;  2ZGY A;  4GV9 A;  3N4P A;  3TSQ A;  1X3N A;  2ZJQ L;  2HMP A;  3MN9 A;  4CZG A;  4QS9 A;  4BRN A;  3ID8 A;  2NZT A;  3AAQ A;  3AAR A;  3HZ6 A;  5BR9 A;  4BY9 C;  2D0P A;  1W2B M;  3BP8 A;  3L4I A;  1NGJ A;  1GLL O;  4JN4 A;  1C0F A;  1SS6 A;  4PHT X;  3H3O B;  3QIC A;  5AFU A;  3CD6 N;  3S41 A;  3MX2 A;  4IFE A;  1Z6R A;  4WF9 L;  1YXQ A;  2QWM A;  1M90 O;  2FLO A;  3WXM B;  4LC9 B;  2ZGZ A;  1NGB A;  2CGK A;  2P9L A;  4JKG A;  1OVY A;  4DQ8 A;  1DKG D;  1YI2 N;  2V52 B;  3GL1 A;  4YOX A;  2IIR A;  3R6M A;  4L3Q A;  4XH5 A;  4ILJ A;  5EVZ A;  5DM6 L;  3O9T A;  2J4R A;  1NGF A;  3CCR N;  4UY8 O;  1T6D A;  1SAZ A;  4B1U B;  4BRA A;  3Q7C A;  3VER A;  2GEL A;  5EX5 A;  3CF5 L;  4EIA A;  4JK9 A;  3SAF A;  2A41 A;  3WXL A;  2FSJ A;  4J8F A;  1VQ6 N;  3EL2 A;  5AQH A;  4WCE L;  1U2V B;  2P9K A;  3H6E A;  4CZF A;  2IVN A;  5FPM A;  4BRL A;  5JIC A;  5AFU H;  3NVK A;  2E88 A;  3R1X A;  3TU5 A;  4JKD A;  2KKZ A;  2P9I A;  4RCH A;  3I56 N;  2F7T A;  5C12 A;  1VQL N;  4GV3 A;  1O13 A;  1GLF O;  4IOX A;  3G71 N;  1GLJ O;  4DB3 A;  3CC2 N;  1JCG A;  4PL7 A;  3VET A;  3D2F B;  3D7E O;  3C7N A;  1RDW X;  2Q0U A;  2YJE A;  2QEX N;  3VF6 A;  3CCE N;  4BC4 A;  4WQ4 C;  3ZX0 A;  5GAH P;  3HSC A;  1VQP N;  3HTV A;  3WQU A;  1X3M A;  3DJC A;  3FZL A;  4ILH A;  5M1K A;  2E2N A;  4M7Y A;  4A61 A;  4JAX A;  2A5X A;  1NGG A;  5AZI A;  1Y64 A;  1G99 A;  5KQD A;  4JKG B;  3RSE B;  2YHY A;  3VGM A;  2NRZ A;  5AQG A;  3U9Z A;  2UYT A;  4WQ4 A;  4BQZ A;  2Q31 A;  4WFA L;  1Z05 A;  3W0L A;  4IO9 L;  4G9Z A;  1BOT O;  5AQK A;  2V7Y A;  4GVE A;  1V4S A;  2QWP A;  1IG8 A;  1K8K B;  1XUP O;  2D1K A;  3H1Q A;  4BRQ A;  3VF2 A;  3CQX A;  2IVO A;  4OPA A;  3T69 A;  4BR7 A;  2YHW A;  4DHY A;  2BUP A;  3O5B A;  4KBO A;  4FOE A;  3WEE B;  1TUU A;  3A5M C;  3AY9 A;  5LJV A;  4WFB L;  3J8A A;  5M1Q A;  4C23 A;  4FWM A;  3E1Y A;  3SAG A;  3O6W A;  4JKF A;  3P39 A;  3UKR B;  4WYB A;  5B8H A;  2NRX A;  5JVH L;  3VMF B;  4K25 A;  4CZJ A;  4ISE A;  3L4Q A;  5BPN A;  3MN7 A;  4JNE A;  4NLB A;  2NRV A;  1JCF A;  2WBN A;  3KZB A;  3MWT A;  5KPZ A;  1YJN N;  2E1Z A;  3VEO A;  2QWN A;  1U6Z A;  4JK7 A;  4YOT A;  5C15 A;  2GUP A;  3EE8 A;  3M3Z A;  3EN9 A;  5C2F A;  3QDK A;  3PLA A;  3C6A A;  4GNI A;  4BRD A;  1S3X A;  2OTJ N;  1GLD G;  4CZH A;  5KPR A;  4B1X B;  3GDQ A;  5M1P A;  3ATV A;  2JWL A;  3B8A X;  3CJ1 A;  5AQU A;  1QQO A;  1TUY A;  1Q7Y O;  4ILG B;  5GAG P;  3H3N O;  2QWO A;  5C0Y A;  3HOS A;  5BN9 A;  4BG9 A;  4H0V B;  3ZX3 A;  3CJC A;  4CI6 A;  4CZL A;  1BWF O;  3OBW A;  3QML A;  4XH1 A;  5E84 A;  4EHU A;  5C2D A;  4A59 A;  5GIN A;  3CCM N;  4YOY A;  4NO7 A;  3OBY A;  1BG3 A;  2E2P A;  1U2V A;  3FR0 A;  4IDH A;  4A57 A;  4CD3 A;  1VAZ A;  3CJA A;  1NGD A;  2Q97 A;  3ULE B;  3CI5 A;  5AQN A;  3LM9 A;  3I55 N;  4B9Q A;  4FOI A;  4RWT A;  2PFU A;  2HF3 A;  1NWK A;  1P90 A;  2ZWH A;  3A5L C;  4XEI A;  3ZX2 A;  1TYQ B;  2QWR A;  4PL8 A;  3HOT A;  1YVN A;  1T44 A;  2BTF A;  3IDH A;  3D2F A;  4YDU C;  4I6M B;  2HBM A;  4A5B A;  4CJ7 A;  3TTF A;  3CCL N;  1VQM N;  4O8K A;  3O1W A;  3TSP A;  2QI2 A;  3DAW A;  1ZBS A;  3CET A;  4FWP A;  3EE9 A;  4FPA A;  5E26 A;  4BR5 A;  4JKH A;  4JKB A;  4Z94 A;  3CIP A;  2GEM A;  3LDP A;  4BRI A;  1MDU B;  5LY3 A;  3M6G A;  3ENB A;  3CCQ N;  2P9N B;  4JHD B;  4EHT A;  3RSE A;  4M63 C;  1KD1 O;  2V51 B;  3EZW A;  1NGC A;  5AQY A;  4IOA L;  1NM1 A;  1WOQ A;  2HBK A;  5HOO A;  2YCH A;  3F2K A;  2BH1 A;  1QVF M;  4A5A A;  3UB5 A;  2NRR A;  4ISF A;  3E9P A;  5EOY A;  5GAD P;  1K73 O;  3O4W A;  4EAH D;  3VF4 A;  1QQM A;  4QS8 A;  3K9K A;  1BO5 O;  4MO4 A;  1K8K A;  3RVC A;  5GIO A;  1BDG A;  1VQ4 N;  3P4I A;  1JCE A;  4PKG A;  3IMX A;  4FWO A;  2E20 A;  4K43 A;  4BRP A;  3G4S N;  3C65 A;  3LDL A;  4YOU A;  3EO3 A;  3T7Z A;  5KQ8 A;  1VQ8 N;  3BF3 A;  3WEE A;  2P9U B;  1RFQ A;  2KLA A;  5JVG L;  1N8R O;  3LDQ A;  2OTL N;  1NBW A;  4RTF D;  4BQL A;  3F5T A;  3MK6 A;  4MLH A;  1GLA G;  3ZYY X;  5MLC Q;  3AGK A;  3LDN A;  3ZEU B;  4IOC L;  1NJI O;  3UKR A;  3VES A;  4GY2 B;  2ZF5 O;  2W41 A;  5AQL A;  3FFK B;  1Q81 O;  1HJO A;  3C6H A;  4KH6 A;  3VOV A;  3CME N;  3LL3 A;  3HBT A;  3HRG A;  4U67 L;  4YOV A;  1E4F T;  3CCU N;  2I7N A;  2HF4 A;  3WXJ A;  1VQK N;  1E4G T;  4JKE A;  3L6Q A;  4BRM A;  2CGL A;  3A5N C;  5ADX A;  2ASM A;  4QS7 A;  2E8A A;  2RE2 A;  5AQT A;  3CHW A;  3DXM A;  2ITM A;  4BRF A;  1R59 O;  2H3G X;  1MWM A;  2YHX A;  1C0G A;  4FWK A;  4BG8 A;  4H0P A;  4B1Y B;  5F0X A;  3UE5 A;  2IVP A;  3FGU A;  4HWI A;  4WQ5 C;  3SAH A;  3CCS N;  3FLC O;  3PIP L;  2QA4 N;  3M5R A;  2A42 A;  1OKJ A;  2VGN A;  3P31 A;  5AQF A;  2CGJ A;  4A62 A;  4IXC A;  5F1X A;  2RHK A;  4IZ9 A;  4A2B A;  2Q2R A;  5CE3 A;  4BRC A;  2GX9 A;  2YJF A;  4H0O A;  5AZJ B;  3VEV A;  2QXL A;  3G6E N;  3VGK A;  2P9S B;  3UKU A;  4CZI A;  1HKC A;  3GOI A;  2PBD A;  3O9U A;  5DM7 L;  3BUZ B;  3ULE A;  4CBW A;  4BR4 A;  2D0O A;  3U4L A;  1QZ5 A;  4CD1 A;  3QBW A;  5ADX H;  2VWB A;  3CJ7 A;  1KC8 O;  1BU6 O;  4H03 B;  5BRH A;  4DKW A;  2ZJR L;  1ATS A;  1TYQ A;  3O8M A;  3WT0 A;  1GLB G;  4KH4 A;  5H1S Q;  4DCH A;  3P38 A;  4I6M A;  3CCJ N;  3H46 O;  4HTL A;  1S22 A;  3MCP A;  1DEJ A;  1HLU A;  1XC3 A;  3CER A;  4FWN A;  1YHQ N;  1VQ7 N;  1VQN N;  2A3Z A;  5AQQ A;  4YOR A;  2QM1 A;  2OAN A;  3AGR A;  1VQ5 N;  4M7X A;  1ZC6 A;  3MCA B;  2GWK A;  3CQY A;  3O80 A;  2FF6 A;  4H5V A;  5AQJ A;  5JMV A;  3VTH A;  5M1N A;  1RDU A;  3E9O A;  3VEN A;  1BUP A;  1ATN A;  1MA9 B;  3ZET B;  5AQP A;  1NGA A;  3DXM B;  1RGI A;  2P9N A;  4JHD A;  1HUX A;  1LOT B;  4IWV A;  2QW9 A;  4MLE A;  4K42 A;  4CZM A;  3TTD A;  5AQI A;  1W97 L;  2E2O A;  4IJN A;  4B1Z A;  1KQS M;  3OW2 M;  1YIT N;  5FPE A;  3KK7 A;  3U9D A;  1YJW N;  5LJW A;  3DLL L;  3UKU B;  4FL9 A;  1NGE A;  2WFB A;  3TTC A;  1QHA A;  2FSK A;  1M1K O;  3NMU A;  2E2Q A;  2Q1N A;  3FE1 A;  3JXU A;  3WQT A;  3OHR A;  2A40 A;  2FSN A;  3MDQ A;  3I33 A;  4FVU A;  2P9U A;  2QTD A;  4CBX A;  2FXU A;  2WC9 A;  2YI1 A;  3VEY A;  2VYP A;  5EY4 A;  5BN8 A;  3ZEU A;  4FO0 A;  3NVM A;  4CZE A;  3K9J A;  2QWL A;  1NMD A;  1NGH A;  3GBT A;  3WXI A;  3BEX A;  4JD2 B;  4NB4 A;  1Q18 A;  4H0X B;  3TSU A;  3HM8 A;  3PIO L;  4BVP A;  1CZA N;  3DXK B;  3I8B A;  5BRE A;  3CCV N;  3ENO A;  1QZ6 A;  3O08 A;  4U7B A;  4FWQ A;  4PKH A;  4H0T B;  1P8Z A;  4FWR A;  3R8E A;  3D2E A;  4ISG A;  4YDU A;  5GAE P;  4H5W A;  4BC2 A;  3VEX A;  4BGB A;  3FZF A;  4EFH A;  1WUA A;  4IJA A;  4BRG A;  1KAZ A;  2PAV A;  3KWI A;  4MDA A;  3IUC A;  1KXP A;  5FPN A;  2P9P A;  4BR9 A;  1NLV A;  3LM2 A;  5AQX A;  5JLH A;  3EKU A;  2YX6 A;  2NLX A;  1HX1 A;  3MWP A;  1QQN A;  2HBL A;  5AZJ A;  5CHI A;  4B1W B;  2P9S A;  3WXK A;  5AQS A;  3ENH A;  3KVG A;  4BRE A;  3HI0 A;  1ILY A;  4YOW A;  5AQM A;  3AAP A;  4E1J A;  2NRT A;  4H0Y B;  2E1Y A;  3G25 A;  3EKS A;  5AQV A;  5AR0 A;  4B1V A;  4H5R A;  1XQS C;  2V7Z A;  1KAX A;  1T6C A;  3R3L A;  1HKG A;  3QB0 A;  3FZH A;  1VQ9 N;  3CC7 N;  2AP1 A;  3WUH A;  3MMV A;  4BC5 A;  1K8A O;  3SBG A;  3MX5 A;  3QBX A;  2CH5 A;  3E9L A;  4IO8 A;  4K41 A;  3O9R A;  4FPB A;  4BRH A;  1GLC G;  5BRF A;  4JEP A;  3MN5 A;  4AM7 A;  4OPH A;  1QVG M;  1VQO N;  3D2E B;  3L0Q A;  3ZET A;  2W40 A;  3VEZ A;  3O9Q A;  1DGK N;  3QFP A;  3F9M A;  1YAG A;  5AQO A;  4JKC A;  3N4Q A;  2I7P A;  4C1N I;  1GLE G;  3VGL A;  1ATR A;  2P9P B;  2Q0R A;  3CC4 N;  3SMS A;  5BRD A;  1BA0 A;  1V4T A;  2VGM A;  3ATU A;  4KH5 A;  1IJJ A;  3VPZ A;  3CPE A;  2DPN A;  3GE1 A;  2JWK A;  1EQY A;  4C1N K;  5AQW A;  1HKB A;  3C0B A;  3QFU A;  1YF5 L;  1YIJ N;  4WQ5 A;  3CJ9 A;  3ID6 A;  2HOE A;  2HST A;  3IFR A;  2P9L B;  1LCU A;  4GV6 A;  2ASP A;  2CH6 A;  2FF3 B;  2ASO A;  3A8Y A;  5C10 A;  3OA9 A;  5BPM A;  5TKY A;  3H45 C;  4FWL A;  1S72 N;  2NNW A;  4JD2 A;  2GTD A;  4MDB A;  5CR4 A;  4IEE A;  5AQR A;  3DXK A;  3O1B A;  2NRH A;  1NGI A;  3FZK A;  4BR2 A;  4CBU A;  5HL7 L;  2P9K B;  4AF1 A;  4BR0 A;  4FWS A;  3H1V X;  3KHY A;  4XH4 A;  1H1V A;  1MWK A;  3D6R A;  4H5N A;  5ELZ A;  5BPL A;  1SZ2 A;  2P9I B;  1YUW A;  5EXW A;  2NRW A;  3IKM A;  3A5O C;  2QWQ A;  3CJB A;  5FPD A;  2GWJ A;  3CXC M;  2KHO A;  3LDO A;  4OO1 J;  4R79 A;  4O5F A;  4BRK A;  2HBJ A;  3Q7B A;  1BA1 A;  1YJ9 N;  4CZK A;  4JK8 A;  3M1F A;  5F2R A;  3CMA N;  3C7N B;  4O8U A;  3SJH A;  5TKW A;  1D4X A;  5M1O A;  1X9J A;  1J6Z A;  4F9O A;  3R9P A;  4MO5 A;  3SLC A;  5KPT A;  3O9S A;  2EWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...