3EE9A

Structure of ns1 effector domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structure of NS1A effector domain from the influenza A/Udorn/72 virus.
pubmed doi rcsb
source organism Influenza a virus (a/udorn/307/1972(h3n2))
molecule tags Viral protein
total genus 33
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ee9A00
3EE9A 3O9QA 2RHKA 3P31A 3O9UA 3O9SA 3P38A 4OPAA 3F5TA 3D6RA 2GX9A 4OPHA 2KKZA 3KWGA 3KWIA 3EE8A 3RVCA 3OA9A 3M5RA 3P39A 3L4QA 3O9RA 3O9TA
chains in the Genus database with same CATH superfamily
4FLZA 3VMFB 4M3YA 1X1PA 2AA4A 4FWRA 3F2KA 3CYMA 3ITHA 3SBGA 4DSIA 1VQNN 4NO7A 4H5TA 4H5VA 1W7AA 2Q36A 4CBXA 1RBVA 1CZAN 2YHAA 2E5LK 2W6KA 2ZF5O 1A5XA 2E20A 1YAGA 3AO1A 1TKTA 1Y97A 1RTIA 4LH4A 4CEAA 4C8OA 3OVNA 4FWQA 4HWIA 4ELUA 5JVHL 4CFBA 3RRHA 4KHPK 3D7EO 4E3SA 2HBLA 3UKUB 4CJFA 1J5OA 3V1RA 3ULEA 3R9PA 4FW1A 1GOBA 4NCBA 2ZJPL 1QTMA 2HB5A 3CCSN 3V9ZA 4W5TA 2OZMA 3O4NA 5ADXA 4FJ9A 2A5XA 4H5RA 3JYTA 4BROA 4BQLA 3PO5A 3R1XA 1Q86O 4BQZA 1Q82O 2QK9A 4B9QA 4FZYA 4O55A 4KFBA 4FWOA 3ZT4A 4DUZK 3NBPA 1C0UA 2O8CA 4CHYA 3AARA 2P9IB 2VGMA 1IKVA 4BY9C 3OYDA 3KLEA 3A5MC 2I5JA 2D5RA 1U45A 3LANA 4CFCA 4O0IA 4A2AA 4BRCA 3H08A 1GLFO 3GOIA 1TYQB 3O4WA 4M41A 1IBKK 2YCHA 3O08A 2CH6A 4I2PA 1YITN 1JCFA 4BC3A 4H4MA 4BR9A 4PKHA 4BRMA 2E88A 1NKEA 1N33K 2QWOA 4IOAL 3HPHA 1NGFA 1SZ2A 4BE1A 5C10A 3UB5A 4BR2A 4LY7A 2YNFA 1NWKA 4WQ4C 4B1VA 1JL2A 2ASPA 1JL1A 1RFQA 2IOCA 1DT9A 3K5NA 3VQ6A 3DI6A 4HVJA 1S1WA 4NYNA 3SJJA 3FE1A 3H1QA 4AHSA 3SPYA 2GX9A 4MO5A 2FF6A 4DU1A 1IKXA 3VQQA 1YVNA 4JRPA 3V1OA 3L4QA 2YNGA 3WNGA 4CCHA 1RGIA 4FJ5A 2HVIA 1XMOK 4DSEA 4DTMA 3DXMA 4EFHA 3THVA 3E01A 4WQ5C 3HPOA 1QSSA 3TR8A 4E1NA 1WAFA 5C0YA 4B9LA 1RT7A 3LM2A 3SLCA 1ASUA 4CHPA 3AO3A 1TKZA 1VQPN 4CF0A 4BRQA 2XY7A 1HQUA 3KK2A 2FBVA 4BRFA 3J80O 2YHYA 4KHYA 2ETJA 2HHVA 2ZD1A 4KTQA 4FLUA 4CGDA 2IGIA 3CJCA 3QETA 1D8YA 4NCAA 1NGBA 5HROA 2WTUA 4FK4A 3SQ4A 1DGKN 3KVGA 2E2OA 4CE9A 2CGJA 2QI2A 3THWA 2X6NA 4FWMA 4FK0A 1S1XA 2HHUA 1JLEA 3ISNC 3TANA 1HKBA 2BUPA 3MXJA 5BRFA 2P1JA 1WUAA 2HF4A 3QEWA 3CXCM 5KQ8A 4AHTA 2PYJA 4LF6K 1K8KA 1IBMK 5KPTA 2XRIA 5JICA 3KK1A 3NDKA 4AQYK 2YX6A 4LH5A 4OPHA 5BPMA 2OPSA 3G71N 4BRAA 3NH2A 2QTDA 1T6CA 1RT2A 3ID6A 4F8RA 5J2PA 4KBOA 4KHUA 4GMJB 4F4KA 3SAFA 3VGMA 4DQSA 3MEGA 3V9UA 1YJ9N 3Q7CA 4B3TK 3O8MA 2AP1A 4KB0A 3OYBA 3QMLA 2A40A 2DTUA 4CJPA 1R59O 1XI1A 1KTQA 3KWIA 3LZJA 1VQKN 1K6YA 2PBDA 4CGIA 3PV8A 1S9EA 4JI4K 1Q7YO 2OPRA 4ZTJA 3WXIA 3A5LC 3CJ7A 1WSGA 4M3RA 1TV6A 3MN6A 3S3OA 1ZXOA 1QZ6A 1SQKA 3FZLA 4KAZA 4H03B 4DTPA 4YNQA 1LW0A 4K8ZA 4KI6A 3KK7A 5M1PA 1I39A 3TPQA 4FLYA 3EZWA 3L4IA 3T7ZA 3O3HA 1ZC6A 2D0OA 3NCIA 1QQMA 4HTLA 5HRPA 1QSYA 4J8FA 3DLBA 1GLJO 4ZHRA 3CCUN 3VQBA 4DFPA 1XC9A 4CJQA 5DM7L 2KHOA 2F7TA 4O4GA 3OYCA 2IC3A 4PWDA 1Z6RA 4LFBK 2KKZA 3VGKA 3WNHA 3NF9A 2RE2A 5BPLA 2A1SA 3TAMA 4I2QA 4JI8K 5CHIA 1TAQA 2BTFA 4Y0WA 3CMEN 4LSNA 4B08A 3MCAB 4L8RB 2HHHK 4YOYA 1REVA 1N8RO 1JXEA 2OANA 1JKHA 1HRHA 2PYLA 3VQ9A 2G8UA 4YY3K 1VSIA 2HVHA 3DLKA 1VQON 1XC3A 4W5RA 4C1NI 4LF7K 1U4BA 3I0SA 1CXQA 4BR0A 3CG7A 3VF2A 2FSJA 4JD2B 1LWEA 1NNEA 4FYDA 4BR5A 3CM5A 4BE2A 4NXNK 4B9NA 3BGRA 3J7AP 2YJEA 3SUNA 1QQCA 1SL0A 3S9HA 1TL1A 2IVNA 1LAWA 4FJKA 4CZFA 5LMUK 4CI6A 2UXBK 2IDOA 3D45A 3DOLA 1QE1A 2HHTA 4B1XB 1JCEA 4CZJA 4AF1A 3THXA 2GTDA 3MEEA 4IOCL 4C23A 3S3NA 1S22A 4DV6K 5AQXA 1EKEA 2Q2RA 4E1MA 1WSIA 4IFVA 3HT3A 4IZ9A 4A61A 3CPEA 1WLJA 3IAYA 3AVHA 2ZQBA 5J2MA 5BPNA 1NLVA 2ZGZA 1GLCG 4JK7A 4IDKA 3K5LA 1FJGK 1HJOA 3O9QA 3HPGA 4BRKA 1X9JA 5AQZA 4QS7A 4CIGA 4JKGB 3LP3A 4K25A 4BGAA 3E9LA 3V6DA 2YHWA 3T1YK 3CCRN 1HPZA 1NGCA 3SQ1A 1ILYA 4CF8A 4WYBA 1XQSC 4GVEA 2HHXA 2O8DA 3EE9A 1Q9YA 4FLWA 4CD3A 1HNWK 3ZYYX 1U04A 4ID1A 3BEXA 2X74A 5F2RA 5LL6Z 3M1FA 2NRZA 4UY8O 1C1CA 3AVIA 1X9MA 1WSFA 1S9GA 4H0TB 4XH4A 4IEEA 1BA1A 3PUFA 1C1AA 5ELZA 3MCPA 2QWNA 4B9UA 3MX5A 1CLQA 4Z4CA 3WQTA 4CK1A 2O8EA 3V9SA 1U2VA 2Q3SA 2WONA 4Q5VA 2XY6A 1NGAA 3TAEA 4LFAK 3MN9A 4BC5A 1O1WA 1S5JA 1Q18A 4BACA 3LDLA 4JI6K 4DR2K 4E7IA 1NK6A 2P9LA 1GLEG 1OVYA 3ALYA 3SYZA 1BCOA 4DB3A 3ZSZA 1A5WA 5JLHA 4PKGA 4GV6A 1HYZA 4CZIA 4CJRA 3VQ8A 4RW6A 2GWJA 4CF1A 3OYKA 1J5EK 2F8TA 1TUUA 4HHTA 4NLCA 2Q0RA 2D1KA 1EQYA 1VQ4N 3VQAA 1SAZA 3VQ5A 4OVLA 3NF6A 5IT9O 4ISEA 2NNWA 4A5AA 4WF9L 2AJQA 4EP4A 4B8CA 3CJ1A 4R79A 2KW4A 4X62K 2PY5A 3IDHA 5EY4A 3R3LA 1Z26A 5JMVA 4CEDA 3CC2N 3NGZA 2YJFA 5SZTA 3V9XA 3KD5E 1KSPA 3CC7N 1YXQA 2ASMA 1T6DA 4U7BA 3NFAA 1YJNN 3HM8A 4KTWA 5FDLA 1DEJA 4HUEA 5JS1A 2W41A 2F4VK 2VGNA 3FFIA 4FVUA 2JWLA 4IDHA 1WBBA 3ULEB 4ILJA 1NM1A 3CCVN 2D0CA 4CGJA 2HMPA 5AQUA 4YHHK 4FVMA 4IWVA 3ZSXA 2O4IA 3MECA 1JXBA 5AQHA 1K9MO 4DKWA 3LAKA 4FLTA 2KFNA 2YHBA 2P9SB 3P83D 2HBKA 4B3SK 3LAMA 1VSFA 2QXFA 2ZE2A 4IO8A 4A59A 3KKRA 1G99A 3AVCA 1NK7A 3VQDA 4BG8A 1TGOA 3L3VA 2UXCK 4Z4IA 3SBTA 2FBXA 4I6MA 1YJWN 2EX3A 4KO0A 5M1KA 5J2QA 3L6QA 3SMPA 4E89A 3NH1A 3OYAA 2HNYA 1QVFM 2ZGYA 4DQIA 3AAPA 1T3VA 4JS4A 3VTHA 1BQMA 1C0FA 4GY2B 4OGCA 3ZSWA 4CEFA 4CESA 5AQYA 3HTVA 3SQ0A 3O80A 2BGGA 4CGFA 1JCGA 3A5NC 3MN5A 1VSKA 3CI5A 2Y1IA 4FM1A 3FLCO 1N34K 4G9ZA 4OKKA 2HHSA 3U3GA 1VSJA 4FJ8A 2IAJA 3V9WA 3LDPA 4JKDA 5K14A 2Q1NA 4AHUA 2WOMA 1RDWX 1KLNA 2QW9A 3VERA 1ZYQA 1BA0A 1JLBA 3OJSA 2XY5A 1HX1A 3T19A 4JKEA 4E0DA 1MWKA 1W0HA 4IO9L 3HJFA 4KHNA 4OPKA 3DRRA 1HYSA 1L3UA 3TWHA 1KRPA 3VQPA 2KQ2A 2YNIA 1ITGA 4B1ZA 3WXMB 4ICLA 1NK5A 1E3MA 2FBYA 4KHQA 3ZX3A 3ENBA 3DXKA 5AQPA 3DXMB 4M7YA 3SAGA 3IG1A 1S6QA 1VSLA 1VQLN 4N56A 3QFPA 3AA2A 2P9PA 4RTFD 3L8BA 1U49A 2F96A 3AVFA 1VK0A 1MDUB 3OBWA 1Z25A 4KHSA 2O8FA 3L2VA 3WNFA 3SZ2A 4OLBA 3GG4A 3E9OA 2B5JA 2GBZA 2GWKA 4V19S 3SUQA 2P5OA 4C8NA 1EWQA 1NJZA 1NGGA 3G10A 2A6AA 3A5OC 1X3MA 3VF4A 4YOXA 3F9MA 4DMNA 5CZ2A 3CFOA 4BRDA 3LWMA 3EKUA 4GNIA 2W6LA 3LPUA 3OS1A 3GDQA 3THWB 3THYA 1EWRA 2P5GA 3AVKA 2I7PA 3S3MA 3VESA 3SUPA 4H0VB 2D4WA 3M8SA 1K8AO 4JI3K 4DU4A 1QQNA 1QQOA 3LDSA 3MWTA 4XH1A 2UUCK 1P90A 4KH6A 1F21A 5H1SQ 1K8KB 4PHTX 3MWPA 3CFRA 4FK2A 3B6PA 4OGEA 4JN4A 4FJ7A 3BUZB 4BRHA 1XWLA 4CK3A 1KD1O 3OA9A 5CR4A 4N47A 3CFPA 4Z0UA 4YOWA 5AQFA 3HRGA 5AQVA 1V4SA 5C2DA 4OPJA 3BZKA 3L2UA 4FZZA 1KFDA 1RT3A 5KQDA 1R0AA 5SWMA 5E84A 5D3GA 3LALA 2XO7A 2Z1HA 3MAQA 4DSLA 3ZETB 3T1AA 3KLIA 4IFYA 4C8LA 1EETA 3OYEA 5FRMA 5EU7A 3A0IX 2WC9A 3M5RA 3HOTA 1M90O 2H3GX 1NK4A 1MU2A 2HW3A 4Q0BA 3O9TA 1GLDG 3RSEB 3CMAN 4PL8A 3B8AX 4B9TA 4ILHA 1T8EA 1KC8O 2PFUA 1L3TA 2G8VA 4B8AB 3I55N 4CJEA 4DFJA 1BOTO 3I0RA 3UIQA 4MDBA 4RW8A 3SV3A 3KK3A 3SAHA 3SPZA 2VG5A 4FXDA 5AQOA 4AM7A 3MK6A 3HXMA 1VHXA 4O8UA 1WB9A 2O8BA 1XHZA 2EHGA 2B4JA 4JNEA 3I8DA 3MN7A 3M8PA 3KHYA 1KVBA 3OJUA 2V51B 3F5TA 3EYZA 2PZSA 2CH5A 1NKBA 4DR6K 3ATVA 2YHXA 1Q8IA 4FM2A 5BR8K 3D2EA 4FJJA 1NGIA 1YVUA 5AQLA 1UWBA 5KGXA 3OHRA 3QIPA 4FPBA 4N76A 4DHYA 4A62A 3L0QA 3CCEN 1TK8A 1J53A 1VSEA 4QS9A 2Z1GA 5BN9A 3NE6A 3TSPA 5A2QO 2V7ZA 2QM1A 4FSVA 1SUQA 3MXIA 2ZM6K 2YKNA 3B6OA 1HNZK 4Y1DA 3FFKB 3LWLA 4O44A 1MA9B 2WFBA 1QHTA 2E2PA 3KD1E 3BP8A 1NOZA 5BR9A 1B92A 5J2NA 3ID8A 3RMDA 4DS4A 3MEDA 2DFFA 5AR0A 3VF6A 3QBXA 2BDPA 4IKFA 2HMIA 3VA0A 2VYPA 4O5FA 4AHRA 3DLGA 4HTUA 5LJVA 3IMXA 4FLXA 1SL2A 4BC4A 4GV3A 3QNOA 4DR7K 4H8KA 1HNVA 2I7NA 5FPEA 4BDYA 4DV1K 4DFMA 3U9ZA 4DV5K 1B9FA 3LDOA 3NF8A 4H0XB 4YOVA 3THXB 4M3WA 1YF5L 5AZIA 2NRRA 1YI2N 3NAEA 3D0PA 1UAXA 4DG1A 3O3GA 1RDAA 1XNQK 1S6PA 5M1QA 1OH5A 4CJTA 2BANA 1LWFA 5AQGA 3AA3A 3AGRA 1GOAA 3L3UA 4B3RK 4ILGB 2UYTA 2HF3A 3CHWA 1NJIO 4ISGA 3R8EA 3SK3A 4BGBA 2VQEK 4GKJK 4M3TA 5AFUH 4DR5K 4CIFA 1C1BA 2UUAK 4FOEA 2E6LA 4X64K 2E1ZA 3DLEA 4IJNA 3D2FA 3KLHA 3LDNA 3WQUA 4CJUA 4EAHD 5AQKA 1XHXA 4CZKA 4DV0K 3CJBA 2HOEA 4M63C 2JGUA 1RBSA 1TL3A 3OY9A 3VEYA 2O8DB 2V7YA 5AQSA 1FK9A 2P9KA 4C1NK 4LC9B 3K59A 5JVGL 1BL3A 4RCHA 3EO3A 4CEQA 2ZJQL 1YTUA 1VAZA 5EXWA 4DR1K 3IKMA 3NVKA 1MWMA 3O6WA 4DQQA 4CEOA 1RT5A 4WCEL 3CPWM 4KREA 1HLUA 2O8EB 1KAXA 1U2VB 1JJ2M 3QFUA 4MFBA 4E1JA 4HCCA 3L2RA 3LP2A 2W42A 4DV2K 2IVPA 5AQQA 2GEMA 4B9SA 3WUHA 1OVQA 1HNXK 4WFAL 1TK0A 4ISFA 1KXPA 1VQMN 3OW2M 4BDZA 5I3UA 5EOYA 2F8SA 4ZTFA 3H3NO 4RW7A 5HOOA 4H4OA 4FJNA 3PX4A 4JS5A 4W5NA 3QO9A 4AHCA 1BGXT 4CBUA 1NMDA 4K41A 4JV5K 3AO5A 1RT6A 1S3XA 4PUOA 2G8FA 3NF7A 2ZJRL 4CGGA 4B3MK 1CXUA 1W9HA 3C65A 5AZJA 3HVTA 2G8IA 1JLCA 2QWRA 3Q7BA 1JLAA 4CF2A 3IFRA 3QBWA 3K2PA 3N4QA 1OH7A 2E4LA 3C6TA 3TU5A 2CGLA 3SV4A 3U8XA 2A3ZA 4PL7A 4K43A 1I3AA 4BWJA 4BR7A 5CY4A 3K5OA 2NRTA 1NMNA 2DPNA 2RN2A 4BVPA 4F2SA 1ASWA 3TAPA 3CM6A 2QA4N 4DTOA 5GIPA 3OS0A 1XUPO 3KTQA 2G8WA 4Z94A 3G4SN 2KZZA 1BU6O 3HP6A 3QLHA 3AVAA 2OYQA 3RMAA 2WBNA 2HNZA 2OPPA 2A41A 4MO4A 2XY8A 5GAHP 3PX6A 3VQ4A 1E4GT 5J1EA 4J2EA 2D0PA 1HPMA 1RT4A 4IEIA 4DV7K 4DSFA 3SNNA 4BC2A 3O9SA 4MLEA 1D9FA 4DV3K 3K57A 1N32K 2VWKA 3AO4A 4E7KA 5BREA 1EP4A 4L3QA 2NUBA 2OA8A 4KH4A 3DJCA 4CEEA 1EO1A 3ZEUA 4RW4A 1W2BM 4I6MB 1UA1A 3P5JA 2Q0UA 3PIOL 4CHQA 1WN7A 5AJ3K 4KI4A 4DFKA 3CC4N 1OH8A 3L2QA 3RR8A 2OZSA 1L3SA 1HQEA 3C7NA 2KZMA 1C6VA 3HOSA 4CZHA 1TAUA 4A5BA 4CZLA 4KPYA 3T3FA 4B9MA 3PIPL 4H5NA 2VWJA 5F1XA 3DWLA 1IKYA 4CGHA 4B1UB 3H6EA 2NRVA 5HLFA 4DQPA 1YT3A 4FO0A 4XEIA 4HUGA 1A5VA 1BDGA 3C6AA 3SI6A 3SUOA 4DSKA 3SCXA 1RDUA 3HSTB 2HHWA 4CJWA 3PSIA 4I9LA 2XHBA 3FZKA 3JAMO 3IRXA 3KLGA 4BRGA 3VEWA 3QEVA 4BRIA 2E1YA 4MQ3A 1CZ9A 4JKGA 3U6FA 4CJ3A 2BH1A 2E8AA 4NB4A 5C24A 5E26A 1N36K 3LL3A 4CFDA 1NK9A 4B1YB 3I8BA 2Z1IA 3AVGA 4CHZA 4CJ7A 3DXKB 3NGYA 4ID5A 3U4LA 3OYHA 1TKDA 1NGEA 3SMSA 4BE0A 4LF8K 2P9NA 1BWFO 4NYFA 2VWBA 1GLBG 2O8FB 4QCLA 1RNHA 4FWNA 3ZCMA 4NCGA 1NG9A 2GUPA 5GIOA 1T05A 1KAZA 3W3DA 1ESVA 3F9KA 3WXLA 3QERA 2EWSA 1T03A 1RBRA 3C0BA 5AQRA 2O8CB 1WAJA 5DMRA 1BUPA 2HSTA 3KJVA 1RTDA 3M6GA 2FSKA 1ZBUA 1C0TA 4JHDA 3QB0A 1RDDA 4DF8A 1SKSA 1LAVA 5FROA 4CZEA 3H1VX 4JK9A 3DRSA 3PX0A 5KRSA 3ZT2A 3C6UA 3GL1A 2A1RA 1VRTA 3CETA 3OTOK 4O0JA 3C95A 2ITGA 5AQIA 3MMVA 3BF3A 5FRNA 3LM9A 3JSMA 1Q81O 1VSHA 1VRUA 4IXCA 1S72N 4J2DA 1NJXA 3JXUA 4QOZB 2HBJA 1ATSA 3VEVA 4YDUA 4FWPA 3T69A 3UKRA 1Y64A 2DFHA 5FPMA 4JI0K 1XMQK 1O13A 4I7FA 3MDQA 3HZ6A 3KLFA 3TAQA 1G15A 3HVRA 4LF5K 5I42A 4ELVA 2ITMA 3U3YA 2FBTA 3EE8A 4CJKA 1BHLA 3RVCA 4DTXA 1CZBA 1NKCA 1VQ7N 2QKKA 3ZT1A 1BIZA 4FPAA 2B6AA 1RCHA 4CEZA 3QEIA 1U48A 5C15A 3WXJA 1T7PA 3QIOA 5KRTA 1P8ZA 1ATRA 3V81A 1IV0A 3AY9A 3CCLN 3HSCA 1FW6A 4DR4K 2QWLA 4JI2K 3NMUA 1S1VA 5AQJA 2P9UA 4KTZA 4CIEA 1QS4A 4KV8A 4DV4K 3FGUA 4AM6A 5C42A 1TVRA 3E66A 3ZX0A 3KWGA 3LZIA 3ASMA 4CJSA 3NH0A 3M8QA 1BI4A 1TUYA 2D0BA 2P9SA 4CJVA 4DTNA 3O1BA 1KVCA 3F73A 1ZBLA 4DTUA 3J8AA 4OX9K 3ZT0A 2IS3A 3AVJA 4JKCA 4WFBL 2Q31A 5LJWA 4FCYA 3P38A 1VSDA 1FXXA 3PO4A 4CZGA 4K0KK 4C8KA 3G6EN 1ATNA 2O8BB 3DLLL 4CJ5A 1V4TA 3VQEA 1RTJA 4K42A 1YTAA 4N5SA 3QDKA 1D9DA 4BWMA 3BY5A 1TKXA 2RPIA 1NJWA 4DCHA 1NOYA 3P31A 3WEEA 4DU3A 3D2EB 2Q97A 3EL2A 4BRLA 1QSLA 4FJXA 4B9VA 1SV5A 4N41A 3RTVA 3R6MA 3V4IA 2O4GA 3HBTA 1GOCA 4O5BA 3CCQN 2QKBA 3MXMA 5IWAK 4CW7B 1LWCA 3H3OB 3K9KA 5C2FA 1WSEA 1VQ8N 3CCMN 2NRHA 4OKJA 4JI1K 3I56N 1U6ZA 2NRWA 4NXMK 3ZSVA 3QEPA 1LCUA 4MDAA 3O4QA 5TKYA 3LP1A 3G0ZA 1Q9XA 1ZBHA 1KVAA 2OTLN 4FJMA 2FF3B 3UKUA 4CEBA 1IH7A 1NGDA 2HNDA 4O8KA 4TSXA 3VGLA 4PQUA 3AO2A 3ZSYA 5AQWA 5BRHA 3CD6N 4M42A 2HBMA 4Z4HA 4W5QA 4OO1J 4KHWA 1TK5A 2FC0A 1KCFA 5BN8A 2NRXA 1LW2A 4JKBA 4E7JA 3AV9A 4BR4A 3J81O 4DF4A 4CZMA 2LSNA 5AZIB 1HKGA 3NGIA 1UA0A 4EIAA 2E6MA 4CJLA 2CGKA 4IG3A 2Y1JA 4MLHA 5TKWA 4B1WB 4FM0A 3OYFA 1S1TA 3N4PA 4OKEA 3TTCA 5LMNK 4OLAA 3QINA 5AQMA 2FXUA 5KTQA 2P9IA 3QICA 5T7BA 4H5WA 4UQGA 4QS8A 1K73O 3KIOA 2GELA 1T44A 5FPDA 4W5OA 1IKWA 5GINA 2YI1A 1L3VA 1TYQA 1RBTA 2J4RA 4F3OA 4CJ4A 3A2FA 4I9QA 3DLHA 2DFEA 1VQ5N 1HR0K 3DMJA 4BVOA 5M1OA 4M3UA 3D2FB 1NU0A 3C6HA 4E7HA 1RTHA 1RT1A 4CHOA 2F9TA 4Y1CA 1KLMA 1X9WA 2P9KB 4LF4K 4GKKK 5HP1A 4M3ZA 2KTQA 3QEXA 5F0XA 2RKIA 3VETA 1I94K 2VQFK 5HRRA 2E2QA 5CZ1A 4PA1A 4DLEA 2VG7A 3AA4A 1B9DA 5E41A 3O9UA 5DM6L 2V52B 4K8XA 4DQ8A 4OPAA 1HNIA 5FLXO 1RDBA 1BO5O 3ENHA 3IUCA 3P1GA 4RG8A 1IG9A 3OYMA 1C0GA 4XIUA 4EZ9A 5DK5A 3P39A 2A42A 3ZETA 4E19A 4JKAA 3ZLJA 3OYGA 2QWPA 3LDQA 1FKPA 3HL8A 3RSEA 4AHVA 3I33A 1RBUA 4U67L 2UU9K 4DUYK 4PKIA 2W40A 2R7YA 1ZBSA 3O1WA 1U47A 2Z1JA 3VTIA 1IO2A 1HKCA 4CBWA 4DQRA 5HRSA 2IVOA 5HRNA 5HBMA 4KH5A 3LP0A 1N5YA 4AH9A 3TAFA 4RWTA 4YOUA 5AZJB 3CF5L 3OBYA 4A57A 4CK2A 1H1VA 4X66K 4FJGA 4EP5A 3CIPA 3RR7A 1LOTB 3AVLA 3VEOA 1W97L 3ENOA 1X3NA 3BZCA 4LD0A 4FJHA 1QZ5A 5GAEP 5EVZA 1NK8A 3VA3A 5HL7L 3DLRA 4FJLA 3O9RA 1L5UA 2UXDK 3UE5A 5EX5A 4YDUC 2NLXA 4J2BA 2ATQA 5GAGP 1OKJA 4M45A 2FSNA 5M1FA 1S1UA 3LPTA 1IJJA 3GBTA 5FPNA 1WSJA 2G8KA 4KB1A 4OJRA 5GADP 3KZBA 1HMVA 1XNRK 1N6QA 1DKGD 3H46O 3TSUA 2BE2A 3DRPA 1IG8A 4F3TA 4X65K 4KRFA 3K58A 2D0AA 1ASVA 3E1YA 4IFEA 3A8YA 3PY8A 1YUWA 3TTDA 4DTJA 4BRPA 3M8RA 4EHTA 4JAXA 4YFUA 3TAGA 3ZEUB 2P9LB 2F9WA 1JLFA 3RRGA 2E2NA 4FOIA 1ZBFA 4DTSA 1SL1A 4EZ6A 3C7NB 1QVGM 3P4IA 1M1KO 1WSHA 3O3FA 4JKFA 1C0MA 4B3OA 4HCBA 3CQ8A 4AILC 4LFCK 4QAGA 4H0OA 4FJIA 3EEQA 4FW2A 5CYQA 2VCPA 4YORA 3WNEA 3ULDA 3D6RA 5AQTA 4H0YB 1BIUA 3DAWA 1Z05A 3U9DA 2VG6A 1RILA 3S41A 1NJYA 2HHQA 4LF9K 2P51A 1IBLK 2YV0X 5I9EB 5KGWA 4F2RA 4WQ4A 3ZSQA 1JLQA 3PLAA 4GV9A 5C25A 3VQ7A 3NHGA 3G25A 1WNSA 4F9OA 5JS2A 1NK0A 4FLVA 3AVNA 1KAYA 1YHQN 2OTJN 4C8MA 4BG9A 3RMBA 5KPRA 3OYNA 1D5AA 3IS9A 3V1QA 4Z4EA 1NGJA 4JKHA 1J54A 2FLOA 4LSLA 3RWUA 3ZSOA 3BDPA 3EN9A 4RW9A 5ADXH 3WXKA 3K9JA 3QNNA 1LV5A 4FZXC 3HO1A 2ASOA 3FZHA 4WQ5A 2P9NB 4JK8A 4JI5K 4IG0A 3JS6A 3O5BA 5CE3A 4JD2A 3TABA 4IOXA 1VSMA 2DY4A 3T1HK 4CFAA 1GLLO 3VEXA 3SJHA 4IBNA 3CCJN 2JWKA 4GVMA 5KI6A 4WFNL 3BF1A 3ZX2A 5B8HA 3AGKA 1KQSM 3RMCA 4CECA 3EKSA 5M1NA 4JHDB 3C94A 3K0SA 1J9AA 2WUSA 1DTTA 3DYAA 1E4FT 1X9SA 4A2BA 1NGHA 1WOQA 4CF9A 4CHNA 4M7XA 3HM9A 1GLAG 2UUBK 1YIJN 2QWQA 4BRNA 4HUFA 3OYJA 3OS2A 2ZWHA 4WE1A 3PSFA 3TTFA 2YKMA 4M3XA 2QEXN 3CQXA 4DS5A 4XH5A 3VQCA 3VEZA 1SKWA 4R5PA 1QHAA 3AVBA 3OYIA 4JYAK 2RHKA 4YOTA 3TI0A 4Z4FA 1WBDA 3EZ5A 4JRQA 2GV9A 4FWKA 2OCEA 1FKOA 1D4XA 3CJ9A 3FZFA 4DR3K 1BISA 4PY5A 3VENA 2KFZA 3CQYA 4BDPA 2KLAA 4H0PA 1HYVA 3UKRB 1JLGA 5AQNA 4CD1A 4GW6A 5AFUA 1ZBIA 5MLCQ 4IJAA 1VQ9N 1NBWA 1OH6A 3AVMA 4FWLA 3H45C 5LY3A 3GE1A 2YNHA 1J6ZA 3K5MA 3J7YP 3W0LA 3DM2A 5JLFA 4JI7K 2P9PB 3AAQA 4DWIA 1DLOA 2GUIA 3HYFA 2G8HA 2PAVA 3VOVA 1BCMA 3NVMA 3EY1A 2P9UB 4JEPA 3TSQA 3KKSA 4KKOA 3AA5X 3VN5A 5C12A 4DLGA 3FZMA 4E7LA 1SS6A 4EHUA 3ZSRA 2IIRA 3CERA 4Z4GA 1BI4B 2QWMA 2RF2A 3MX2A 4CERA 3J7ZO 1EX4A 1DTQA 2NZTA 4BREA 4J2AA 3QESA 3DOKA 3FR0A 5CYMA 1VQ6N 2OPQA 4DSJA 3VPZA 3HK2A 1BG3A 3SQ2A 5KPZA 1UOCA 3THYB 3OYLA 3E9PA 3L2WA 2JLEA 1SKRA 1KFSA 4G1QA 4ELTA 1BQNA 3ATUA 1HUXA 2X6SA 3TARA 3M3ZA 4JLHA 4DTRA 3ZT3A 1EXQA 1RDCA 2QXLA 5BRDA 4FL9A 4NLBA 3HI0A 3WT0A 1HJRA 3HP9A 4CVNE 2X78A 3WEEB 4FWSA 3CJAA
chains in the Genus database with same CATH topology
3VMFB 4FOEA 4OO1J 2AA4A 1NGAA 4FWRA 3F2KA 5BN8A 2NRXA 4JKBA 3MN9A 4BC5A 2E1ZA 4IJNA 3SBGA 3D2FA 4BR4A 1Q18A 3LDNA 1U2VA 3LDLA 3WQUA 4CZMA 4EAHD 1VQNN 5AQKA 1HKGA 5AZIB 4CZKA 4NO7A 3CJBA 4H5TA 2HOEA 2P9LA 4M63C 4EIAA 4H5VA 1GLEG 1OVYA 2Q36A 3VEYA 2CGKA 4CBXA 2V7YA 1CZAN 5AQSA 4MLHA 2P9KA 5TKWA 4LC9B 4C1NK 4DB3A 4B1WB 2ZF5O 4PKGA 5JLHA 3N4PA 2E20A 3TTCA 4CZIA 5JVGL 4GV6A 1YAGA 2GWJA 5AQMA 4RCHA 3EO3A 1TUUA 4NLCA 2FXUA 4FWQA 2ZJQL 4HWIA 2P9IA 3QICA 1VAZA 5EXWA 2Q0RA 2D1KA 4H5WA 1EQYA 3IKMA 5JVHL 1VQ4N 3NVKA 1MWMA 4QS8A 3O6WA 1K73O 1SAZA 2GELA 1T44A 3D7EO 5FPDA 2HBLA 4WCEL 3UKUB 1NJIO 3CPWM 5GINA 2YI1A 1HLUA 3ULEA 1TYQA 3R9PA 4ISEA 2NNWA 4A5AA 4WF9L 1KAXA 1U2VB 2J4RA 1JJ2M 3CJ1A 3QFUA 2ZJPL 3CCSN 4E1JA 4R79A 5ADXA 1VQ5N 2A5XA 3IDHA 4BVOA 5M1OA 5EY4A 4H5RA 3R3LA 3D2FB 2IVPA 3C6HA 2GEMA 5AQQA 5JMVA 4BROA 3WUHA 3CC2N 4BQLA 2YJFA 3R1XA 1Q86O 4WFAL 4BQZA 2F9TA 4ISFA 1Q82O 1KXPA 4B9QA 1VQMN 3CC7N 3OW2M 1YXQA 2ASMA 1T6DA 4FWOA 2P9KB 5EOYA 4U7BA 1YJNN 3H3NO 3HM8A 5HOOA 1DEJA 4CBUA 1NMDA 4K41A 3AARA 5F0XA 2W41A 2P9IB 2VGMA 3VETA 4BY9C 2VGNA 1S3XA 3A5MC 2E2QA 2ZJRL 4FVUA 2JWLA 4IDHA 4A2AA 4BRCA 3C65A 1GLFO 3GOIA 1TYQB 3O4WA 1NM1A 4ILJA 3ULEB 5AZJA 3CCVN 2HMPA 2YCHA 3O9UA 3CD6N 5AQUA 3O08A 5DM6L 2CH6A 2V52B 1YITN 4DQ8A 2QWRA 3Q7BA 4IWVA 4OPAA 1JCFA 3IFRA 1BO5O 4BC3A 3ENHA 3IUCA 3QBWA 5AQHA 4DKWA 1K9MO 2P9SB 2HBKA 4BR9A 1C0GA 4PKHA 4BRMA 2E88A 3N4QA 3P39A 2QWOA 4IO8A 4IOAL 2A42A 4A59A 3TU5A 2CGLA 1NGFA 1G99A 1SZ2A 3U8XA 3ZETA 5C10A 3UB5A 4BG8A 4BR2A 2A3ZA 1NWKA 4JKAA 4WQ4C 4B1VA 2ASPA 4PL7A 1RFQA 4K43A 3SBTA 4BR7A 1DT9A 4I6MA 2QWPA 2NRTA 1YJWN 5M1KA 4BVPA 2DPNA 3LDQA 3L6QA 3SMPA 1QVFM 3RSEA 3I33A 4U67L 2ZGYA 4PKIA 3AAPA 2QA4N 2W40A 5GIPA 3FE1A 3H1QA 1ZBSA 3O1WA 1XUPO 3VTIA 1HKCA 1T3VA 2GX9A 4CBWA 4Z94A 3VTHA 3G4SN 1BU6O 1C0FA 4GY2B 4MO5A 2IVOA 2FF6A 4KH5A 3HTVA 5AQYA 3O80A 1YVNA 1JCGA 2WBNA 3A5NC 3L4QA 2A41A 4MO4A 4RWTA 4YOUA 5AZJB 3MN5A 5GAHP 3CF5L 3OBYA 4A57A 1E4GT 1RGIA 3CI5A 1H1VA 3CIPA 3FLCO 2D0PA 1HPMA 4G9ZA 4IEIA 1LOTB 3DXMA 4EFHA 3VEOA 1W97L 3LDPA 4WQ5C 4BC2A 3ENOA 4JKDA 3O9SA 4MLEA 1X3NA 5C0YA 1QZ5A 2Q1NA 5GAEP 5BREA 5EVZA 4L3QA 1RDWX 2QW9A 3LM2A 4KH4A 3SLCA 1BA0A 3VERA 3DJCA 5HL7L 1EO1A 3ZEUA 1VQPN 1W2BM 4I6MB 4BRQA 2Q0UA 3PIOL 1HX1A 4JKEA 3O9RA 4BRFA 1MWKA 2YHYA 5EX5A 3UE5A 4IO9L 4YDUC 3CC4N 2NLXA 5GAGP 1OKJA 3C7NA 2FSNA 5M1FA 1IJJA 3GBTA 3CJCA 5FPNA 3HOSA 4CZHA 1NGBA 4A5BA 4CZLA 4B1ZA 3WXMB 1DGKN 5GADP 3PIPL 3KZBA 3KVGA 4H5NA 2E2OA 3DWLA 5F1XA 2CGJA 2QI2A 4FWMA 3ZX3A 3ENBA 4B1UB 1DKGD 3H46O 3DXKA 5AQPA 3TSUA 3H6EA 3DXMB 4M7YA 3SAGA 1IG8A 1VQLN 2NRVA 1HKBA 3QFPA 2BUPA 4FO0A 2P9PA 4RTFD 3E1YA 4XEIA 4IFEA 3A8YA 5BRFA 1BDGA 1WUAA 1YUWA 3TTDA 3C6AA 4BRPA 1MDUB 2HF4A 3OBWA 4EHTA 4JAXA 1RDUA 3ZEUB 2P9LB 3GG4A 3E9OA 3FZKA 5KQ8A 2F9WA 3CXCM 4BRGA 1K8KA 2GWKA 3VEWA 5JICA 5KPTA 2E2NA 2YX6A 4BRIA 4FOIA 4OPHA 5BPMA 3G71N 2E1YA 4BRAA 2QTDA 4JKGA 1T6CA 1NGGA 3ID6A 2BH1A 2A6AA 3C7NB 2E8AA 3A5OC 4NB4A 1QVGM 5E26A 1X3MA 3P4IA 3VF4A 1M1KO 4YOXA 3F9MA 4JKFA 3LL3A 4KBOA 4B1YB 4BRDA 3SAFA 3I8BA 3VGMA 3EKUA 4GNIA 1YJ9N 3Q7CA 3GDQA 3O8MA 4H0OA 4CJ7A 2AP1A 2I7PA 3DXKB 2VCPA 3QMLA 2A40A 4YORA 3U4LA 3D6RA 5AQTA 3VESA 4H0VB 1NGEA 3SMSA 2D4WA 4H0YB 1R59O 1K8AO 3KWIA 3DAWA 1VQKN 1Z05A 3U9DA 2PBDA 2P9NA 1BWFO 1QQNA 1QQOA 1Q7YO 3MWTA 4XH1A 2VWBA 1GLBG 3S41A 1P90A 3WXIA 4KH6A 4FWNA 5I9EB 3A5LC 5H1SQ 2GUPA 5GIOA 3CJ7A 4WQ4A 1K8KB 1KAZA 4PHTX 3W3DA 3PLAA 1ESVA 5AQWA 3MN6A 3WXLA 4GV9A 2EWSA 1ZXOA 1QZ6A 3MWPA 3C0BA 1SQKA 3FZLA 3G25A 4H03B 5AQRA 4F9OA 1BUPA 1KAYA 2HSTA 1YHQN 3M6GA 2FSKA 3KK7A 5M1PA 2OTJN 3TPQA 4JN4A 3EZWA 4JHDA 4BG9A 3QB0A 3BUZB 3L4IA 3T7ZA 4BRHA 5KPRA 4CZEA 3H1VX 1KD1O 4JK9A 1ZC6A 2D0OA 3OA9A 1NGJA 1QQMA 4HTLA 4JKHA 5CR4A 2FLOA 4J8FA 3EN9A 5ADXH 3GL1A 1GLJO 3CCUN 3WXKA 3K9JA 3CETA 4YOWA 5AQFA 3HRGA 5AQVA 1V4SA 5AQIA 2ASOA 3FZHA 5DM7L 3MMVA 5C2DA 3BF3A 2KHOA 4WQ5A 2F7TA 2P9NB 3LM9A 1Q81O 4JK8A 3JS6A 3O5BA 5KQDA 5CE3A 5E84A 4JD2A 1Z6RA 4IXCA 4IOXA 1S72N 2KKZA 3VGKA 3ZETB 1GLLO 3VEXA 3A0IX 3JXUA 2WC9A 3M5RA 5BPLA 2HBJA 2RE2A 3SJHA 3HOTA 3CCJN 1ATSA 2H3GX 2JWKA 1M90O 4WFNL 3O9TA 3BF1A 3ZX2A 5CHIA 3VEVA 2BTFA 4Y0WA 5B8HA 1GLDG 3RSEB 3CMEN 3AGKA 3CMAN 4YDUA 3MCAB 1KQSM 4PL8A 4FWPA 3T69A 3B8AX 3UKRA 4YOYA 1Y64A 3EKSA 4ILHA 5FPMA 5M1NA 4JHDB 1O13A 1N8RO 3MDQA 1KC8O 2WUSA 2OANA 3HZ6A 2PFUA 1E4FT 3I55N 1BOTO 4A2BA 1NGHA 1WOQA 4MDBA 4M7XA 1GLAG 1VQON 1XC3A 1YIJN 2QWQA 2ITMA 3SAHA 4BRNA 3EE8A 4C1NI 3RVCA 5AQOA 1VQ7N 4AM7A 3MK6A 2ZWHA 3TTFA 4O8UA 4FPAA 2QEXN 4BR0A 3CQXA 5C15A 3WXJA 4XH5A 3VEZA 1P8ZA 1ATRA 3VF2A 2FSJA 1QHAA 4JNEA 4JD2B 4BR5A 3MN7A 2RHKA 3AY9A 3CCLN 4YOTA 3HSCA 2QWLA 3KHYA 2YJEA 2V51B 3CJ9A 2P9UA 4FWKA 5AQJA 1D4XA 3FZFA 3NMUA 3F5TA 3FGUA 4AM6A 2IVNA 3E66A 2CH5A 3VENA 3CQYA 2KLAA 3ZX0A 3ATVA 2YHXA 3KWGA 4H0PA 3D2EA 3UKRB 4CZFA 1NGIA 5AQLA 5AQNA 3OHRA 4CD1A 4FPBA 1TUYA 4CI6A 5AFUA 2P9SA 4B1XB 1JCEA 4DHYA 4A62A 5MLCQ 4CZJA 3L0QA 4IJAA 1VQ9N 3CCEN 1NBWA 4AF1A 3O1BA 4QS9A 2GTDA 4FWLA 5BN9A 4IOCL 4C23A 3H45C 3J8AA 5LY3A 3GE1A 3TSPA 1S22A 2V7ZA 1J6ZA 2QM1A 4JKCA 4WFBL 4FSVA 2Q31A 5LJWA 5AQXA 3P38A 2Q2RA 3W0LA 4CZGA 5JLFA 3G6EN 3FFKB 1ATNA 1MA9B 2WFBA 2E2PA 2P9PB 3DLLL 3AAQA 4IZ9A 4A61A 3BP8A 5BR9A 1V4TA 3CPEA 3ID8A 4K42A 5BPNA 5AR0A 1NLVA 2ZGZA 3VF6A 1GLCG 2PAVA 4JK7A 3VOVA 3QDKA 3NVMA 3QBXA 2P9UB 4JEPA 1HJOA 3O9QA 3TSQA 2VYPA 4O5FA 5C12A 4BRKA 3IMXA 4DCHA 5LJVA 1X9JA 3FZMA 3P31A 5AQZA 1SS6A 4QS7A 4BC4A 4GV3A 3WEEA 4EHUA 3D2EB 4JKGB 2IIRA 2I7NA 2Q97A 3CERA 3EL2A 4K25A 4BGAA 5FPEA 3E9LA 4BRLA 2QWMA 2YHWA 3MX2A 3U9ZA 3J7ZO 3LDOA 3CCRN 4H0XB 2NZTA 4BREA 4YOVA 3FR0A 3R6MA 1VQ6N 1NGCA 1YF5L 1ILYA 3VPZA 3HBTA 5AZIA 2NRRA 3CCQN 1BG3A 1YI2N 5KPZA 4WYBA 1XQSC 4GVEA 3H3OB 3K9KA 3E9PA 5M1QA 5C2FA 1VQ8N 3EE9A 5AQGA 2NRHA 3CCMN 3I56N 4CD3A 1U6ZA 2NRWA 3ATUA 1HUXA 3AGRA 3ZYYX 3BEXA 3M3ZA 5F2RA 4ILGB 1LCUA 4MDAA 3M1FA 2NRZA 4UY8O 2UYTA 5TKYA 2QXLA 5BRDA 2HF3A 4FL9A 4H0TB 3CHWA 4NLBA 4XH4A 4IEEA 1BA1A 3HI0A 4ISGA 3WT0A 5ELZA 2FF3B 3MCPA 3R8EA 3UKUA 2OTLN 3SK3A 4BGBA 2QWNA 1NGDA 3MX5A 4O8KA 3VGLA 3WQTA 5AFUH 3WEEB 4FWSA 5BRHA 3CJAA 2HBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE9 A;  3O9Q A;  2RHK A;  3P31 A;  3O9U A;  3O9S A;  3P38 A;  4OPA A;  3F5T A;  3D6R A;  2GX9 A;  4OPH A;  2KKZ A;  3KWG A;  3KWI A;  3EE8 A;  3RVC A;  3OA9 A;  3M5R A;  3P39 A;  3L4Q A;  3O9R A;  3O9T A; 
#chains in the Genus database with same CATH topology
 4FLZ A;  3VMF B;  4M3Y A;  1X1P A;  2AA4 A;  4FWR A;  3F2K A;  3CYM A;  3ITH A;  3SBG A;  4DSI A;  1VQN N;  4NO7 A;  4H5T A;  4H5V A;  1W7A A;  2Q36 A;  4CBX A;  1RBV A;  1CZA N;  2YHA A;  2E5L K;  2W6K A;  2ZF5 O;  1A5X A;  2E20 A;  1YAG A;  3AO1 A;  1TKT A;  1Y97 A;  1RTI A;  4LH4 A;  4CEA A;  4C8O A;  3OVN A;  4FWQ A;  4HWI A;  4ELU A;  5JVH L;  4CFB A;  3RRH A;  4KHP K;  3D7E O;  4E3S A;  2HBL A;  3UKU B;  4CJF A;  1J5O A;  3V1R A;  3ULE A;  3R9P A;  4FW1 A;  1GOB A;  4NCB A;  2ZJP L;  1QTM A;  2HB5 A;  3CCS N;  3V9Z A;  4W5T A;  2OZM A;  3O4N A;  5ADX A;  4FJ9 A;  2A5X A;  4H5R A;  3JYT A;  4BRO A;  4BQL A;  3PO5 A;  3R1X A;  1Q86 O;  4BQZ A;  1Q82 O;  2QK9 A;  4B9Q A;  4FZY A;  4O55 A;  4KFB A;  4FWO A;  3ZT4 A;  4DUZ K;  3NBP A;  1C0U A;  2O8C A;  4CHY A;  3AAR A;  2P9I B;  2VGM A;  1IKV A;  4BY9 C;  3OYD A;  3KLE A;  3A5M C;  2I5J A;  2D5R A;  1U45 A;  3LAN A;  4CFC A;  4O0I A;  4A2A A;  4BRC A;  3H08 A;  1GLF O;  3GOI A;  1TYQ B;  3O4W A;  4M41 A;  1IBK K;  2YCH A;  3O08 A;  2CH6 A;  4I2P A;  1YIT N;  1JCF A;  4BC3 A;  4H4M A;  4BR9 A;  4PKH A;  4BRM A;  2E88 A;  1NKE A;  1N33 K;  2QWO A;  4IOA L;  3HPH A;  1NGF A;  1SZ2 A;  4BE1 A;  5C10 A;  3UB5 A;  4BR2 A;  4LY7 A;  2YNF A;  1NWK A;  4WQ4 C;  4B1V A;  1JL2 A;  2ASP A;  1JL1 A;  1RFQ A;  2IOC A;  1DT9 A;  3K5N A;  3VQ6 A;  3DI6 A;  4HVJ A;  1S1W A;  4NYN A;  3SJJ A;  3FE1 A;  3H1Q A;  4AHS A;  3SPY A;  2GX9 A;  4MO5 A;  2FF6 A;  4DU1 A;  1IKX A;  3VQQ A;  1YVN A;  4JRP A;  3V1O A;  3L4Q A;  2YNG A;  3WNG A;  4CCH A;  1RGI A;  4FJ5 A;  2HVI A;  1XMO K;  4DSE A;  4DTM A;  3DXM A;  4EFH A;  3THV A;  3E01 A;  4WQ5 C;  3HPO A;  1QSS A;  3TR8 A;  4E1N A;  1WAF A;  5C0Y A;  4B9L A;  1RT7 A;  3LM2 A;  3SLC A;  1ASU A;  4CHP A;  3AO3 A;  1TKZ A;  1VQP N;  4CF0 A;  4BRQ A;  2XY7 A;  1HQU A;  3KK2 A;  2FBV A;  4BRF A;  3J80 O;  2YHY A;  4KHY A;  2ETJ A;  2HHV A;  2ZD1 A;  4KTQ A;  4FLU A;  4CGD A;  2IGI A;  3CJC A;  3QET A;  1D8Y A;  4NCA A;  1NGB A;  5HRO A;  2WTU A;  4FK4 A;  3SQ4 A;  1DGK N;  3KVG A;  2E2O A;  4CE9 A;  2CGJ A;  2QI2 A;  3THW A;  2X6N A;  4FWM A;  4FK0 A;  1S1X A;  2HHU A;  1JLE A;  3ISN C;  3TAN A;  1HKB A;  2BUP A;  3MXJ A;  5BRF A;  2P1J A;  1WUA A;  2HF4 A;  3QEW A;  3CXC M;  5KQ8 A;  4AHT A;  2PYJ A;  4LF6 K;  1K8K A;  1IBM K;  5KPT A;  2XRI A;  5JIC A;  3KK1 A;  3NDK A;  4AQY K;  2YX6 A;  4LH5 A;  4OPH A;  5BPM A;  2OPS A;  3G71 N;  4BRA A;  3NH2 A;  2QTD A;  1T6C A;  1RT2 A;  3ID6 A;  4F8R A;  5J2P A;  4KBO A;  4KHU A;  4GMJ B;  4F4K A;  3SAF A;  3VGM A;  4DQS A;  3MEG A;  3V9U A;  1YJ9 N;  3Q7C A;  4B3T K;  3O8M A;  2AP1 A;  4KB0 A;  3OYB A;  3QML A;  2A40 A;  2DTU A;  4CJP A;  1R59 O;  1XI1 A;  1KTQ A;  3KWI A;  3LZJ A;  1VQK N;  1K6Y A;  2PBD A;  4CGI A;  3PV8 A;  1S9E A;  4JI4 K;  1Q7Y O;  2OPR A;  4ZTJ A;  3WXI A;  3A5L C;  3CJ7 A;  1WSG A;  4M3R A;  1TV6 A;  3MN6 A;  3S3O A;  1ZXO A;  1QZ6 A;  1SQK A;  3FZL A;  4KAZ A;  4H03 B;  4DTP A;  4YNQ A;  1LW0 A;  4K8Z A;  4KI6 A;  3KK7 A;  5M1P A;  1I39 A;  3TPQ A;  4FLY A;  3EZW A;  3L4I A;  3T7Z A;  3O3H A;  1ZC6 A;  2D0O A;  3NCI A;  1QQM A;  4HTL A;  5HRP A;  1QSY A;  4J8F A;  3DLB A;  1GLJ O;  4ZHR A;  3CCU N;  3VQB A;  4DFP A;  1XC9 A;  4CJQ A;  5DM7 L;  2KHO A;  2F7T A;  4O4G A;  3OYC A;  2IC3 A;  4PWD A;  1Z6R A;  4LFB K;  2KKZ A;  3VGK A;  3WNH A;  3NF9 A;  2RE2 A;  5BPL A;  2A1S A;  3TAM A;  4I2Q A;  4JI8 K;  5CHI A;  1TAQ A;  2BTF A;  4Y0W A;  3CME N;  4LSN A;  4B08 A;  3MCA B;  4L8R B;  2HHH K;  4YOY A;  1REV A;  1N8R O;  1JXE A;  2OAN A;  1JKH A;  1HRH A;  2PYL A;  3VQ9 A;  2G8U A;  4YY3 K;  1VSI A;  2HVH A;  3DLK A;  1VQO N;  1XC3 A;  4W5R A;  4C1N I;  4LF7 K;  1U4B A;  3I0S A;  1CXQ A;  4BR0 A;  3CG7 A;  3VF2 A;  2FSJ A;  4JD2 B;  1LWE A;  1NNE A;  4FYD A;  4BR5 A;  3CM5 A;  4BE2 A;  4NXN K;  4B9N A;  3BGR A;  3J7A P;  2YJE A;  3SUN A;  1QQC A;  1SL0 A;  3S9H A;  1TL1 A;  2IVN A;  1LAW A;  4FJK A;  4CZF A;  5LMU K;  4CI6 A;  2UXB K;  2IDO A;  3D45 A;  3DOL A;  1QE1 A;  2HHT A;  4B1X B;  1JCE A;  4CZJ A;  4AF1 A;  3THX A;  2GTD A;  3MEE A;  4IOC L;  4C23 A;  3S3N A;  1S22 A;  4DV6 K;  5AQX A;  1EKE A;  2Q2R A;  4E1M A;  1WSI A;  4IFV A;  3HT3 A;  4IZ9 A;  4A61 A;  3CPE A;  1WLJ A;  3IAY A;  3AVH A;  2ZQB A;  5J2M A;  5BPN A;  1NLV A;  2ZGZ A;  1GLC G;  4JK7 A;  4IDK A;  3K5L A;  1FJG K;  1HJO A;  3O9Q A;  3HPG A;  4BRK A;  1X9J A;  5AQZ A;  4QS7 A;  4CIG A;  4JKG B;  3LP3 A;  4K25 A;  4BGA A;  3E9L A;  3V6D A;  2YHW A;  3T1Y K;  3CCR N;  1HPZ A;  1NGC A;  3SQ1 A;  1ILY A;  4CF8 A;  4WYB A;  1XQS C;  4GVE A;  2HHX A;  2O8D A;  3EE9 A;  1Q9Y A;  4FLW A;  4CD3 A;  1HNW K;  3ZYY X;  1U04 A;  4ID1 A;  3BEX A;  2X74 A;  5F2R A;  5LL6 Z;  3M1F A;  2NRZ A;  4UY8 O;  1C1C A;  3AVI A;  1X9M A;  1WSF A;  1S9G A;  4H0T B;  4XH4 A;  4IEE A;  1BA1 A;  3PUF A;  1C1A A;  5ELZ A;  3MCP A;  2QWN A;  4B9U A;  3MX5 A;  1CLQ A;  4Z4C A;  3WQT A;  4CK1 A;  2O8E A;  3V9S A;  1U2V A;  2Q3S A;  2WON A;  4Q5V A;  2XY6 A;  1NGA A;  3TAE A;  4LFA K;  3MN9 A;  4BC5 A;  1O1W A;  1S5J A;  1Q18 A;  4BAC A;  3LDL A;  4JI6 K;  4DR2 K;  4E7I A;  1NK6 A;  2P9L A;  1GLE G;  1OVY A;  3ALY A;  3SYZ A;  1BCO A;  4DB3 A;  3ZSZ A;  1A5W A;  5JLH A;  4PKG A;  4GV6 A;  1HYZ A;  4CZI A;  4CJR A;  3VQ8 A;  4RW6 A;  2GWJ A;  4CF1 A;  3OYK A;  1J5E K;  2F8T A;  1TUU A;  4HHT A;  4NLC A;  2Q0R A;  2D1K A;  1EQY A;  1VQ4 N;  3VQA A;  1SAZ A;  3VQ5 A;  4OVL A;  3NF6 A;  5IT9 O;  4ISE A;  2NNW A;  4A5A A;  4WF9 L;  2AJQ A;  4EP4 A;  4B8C A;  3CJ1 A;  4R79 A;  2KW4 A;  4X62 K;  2PY5 A;  3IDH A;  5EY4 A;  3R3L A;  1Z26 A;  5JMV A;  4CED A;  3CC2 N;  3NGZ A;  2YJF A;  5SZT A;  3V9X A;  3KD5 E;  1KSP A;  3CC7 N;  1YXQ A;  2ASM A;  1T6D A;  4U7B A;  3NFA A;  1YJN N;  3HM8 A;  4KTW A;  5FDL A;  1DEJ A;  4HUE A;  5JS1 A;  2W41 A;  2F4V K;  2VGN A;  3FFI A;  4FVU A;  2JWL A;  4IDH A;  1WBB A;  3ULE B;  4ILJ A;  1NM1 A;  3CCV N;  2D0C A;  4CGJ A;  2HMP A;  5AQU A;  4YHH K;  4FVM A;  4IWV A;  3ZSX A;  2O4I A;  3MEC A;  1JXB A;  5AQH A;  1K9M O;  4DKW A;  3LAK A;  4FLT A;  2KFN A;  2YHB A;  2P9S B;  3P83 D;  2HBK A;  4B3S K;  3LAM A;  1VSF A;  2QXF A;  2ZE2 A;  4IO8 A;  4A59 A;  3KKR A;  1G99 A;  3AVC A;  1NK7 A;  3VQD A;  4BG8 A;  1TGO A;  3L3V A;  2UXC K;  4Z4I A;  3SBT A;  2FBX A;  4I6M A;  1YJW N;  2EX3 A;  4KO0 A;  5M1K A;  5J2Q A;  3L6Q A;  3SMP A;  4E89 A;  3NH1 A;  3OYA A;  2HNY A;  1QVF M;  2ZGY A;  4DQI A;  3AAP A;  1T3V A;  4JS4 A;  3VTH A;  1BQM A;  1C0F A;  4GY2 B;  4OGC A;  3ZSW A;  4CEF A;  4CES A;  5AQY A;  3HTV A;  3SQ0 A;  3O80 A;  2BGG A;  4CGF A;  1JCG A;  3A5N C;  3MN5 A;  1VSK A;  3CI5 A;  2Y1I A;  4FM1 A;  3FLC O;  1N34 K;  4G9Z A;  4OKK A;  2HHS A;  3U3G A;  1VSJ A;  4FJ8 A;  2IAJ A;  3V9W A;  3LDP A;  4JKD A;  5K14 A;  2Q1N A;  4AHU A;  2WOM A;  1RDW X;  1KLN A;  2QW9 A;  3VER A;  1ZYQ A;  1BA0 A;  1JLB A;  3OJS A;  2XY5 A;  1HX1 A;  3T19 A;  4JKE A;  4E0D A;  1MWK A;  1W0H A;  4IO9 L;  3HJF A;  4KHN A;  4OPK A;  3DRR A;  1HYS A;  1L3U A;  3TWH A;  1KRP A;  3VQP A;  2KQ2 A;  2YNI A;  1ITG A;  4B1Z A;  3WXM B;  4ICL A;  1NK5 A;  1E3M A;  2FBY A;  4KHQ A;  3ZX3 A;  3ENB A;  3DXK A;  5AQP A;  3DXM B;  4M7Y A;  3SAG A;  3IG1 A;  1S6Q A;  1VSL A;  1VQL N;  4N56 A;  3QFP A;  3AA2 A;  2P9P A;  4RTF D;  3L8B A;  1U49 A;  2F96 A;  3AVF A;  1VK0 A;  1MDU B;  3OBW A;  1Z25 A;  4KHS A;  2O8F A;  3L2V A;  3WNF A;  3SZ2 A;  4OLB A;  3GG4 A;  3E9O A;  2B5J A;  2GBZ A;  2GWK A;  4V19 S;  3SUQ A;  2P5O A;  4C8N A;  1EWQ A;  1NJZ A;  1NGG A;  3G10 A;  2A6A A;  3A5O C;  1X3M A;  3VF4 A;  4YOX A;  3F9M A;  4DMN A;  5CZ2 A;  3CFO A;  4BRD A;  3LWM A;  3EKU A;  4GNI A;  2W6L A;  3LPU A;  3OS1 A;  3GDQ A;  3THW B;  3THY A;  1EWR A;  2P5G A;  3AVK A;  2I7P A;  3S3M A;  3VES A;  3SUP A;  4H0V B;  2D4W A;  3M8S A;  1K8A O;  4JI3 K;  4DU4 A;  1QQN A;  1QQO A;  3LDS A;  3MWT A;  4XH1 A;  2UUC K;  1P90 A;  4KH6 A;  1F21 A;  5H1S Q;  1K8K B;  4PHT X;  3MWP A;  3CFR A;  4FK2 A;  3B6P A;  4OGE A;  4JN4 A;  4FJ7 A;  3BUZ B;  4BRH A;  1XWL A;  4CK3 A;  1KD1 O;  3OA9 A;  5CR4 A;  4N47 A;  3CFP A;  4Z0U A;  4YOW A;  5AQF A;  3HRG A;  5AQV A;  1V4S A;  5C2D A;  4OPJ A;  3BZK A;  3L2U A;  4FZZ A;  1KFD A;  1RT3 A;  5KQD A;  1R0A A;  5SWM A;  5E84 A;  5D3G A;  3LAL A;  2XO7 A;  2Z1H A;  3MAQ A;  4DSL A;  3ZET B;  3T1A A;  3KLI A;  4IFY A;  4C8L A;  1EET A;  3OYE A;  5FRM A;  5EU7 A;  3A0I X;  2WC9 A;  3M5R A;  3HOT A;  1M90 O;  2H3G X;  1NK4 A;  1MU2 A;  2HW3 A;  4Q0B A;  3O9T A;  1GLD G;  3RSE B;  3CMA N;  4PL8 A;  3B8A X;  4B9T A;  4ILH A;  1T8E A;  1KC8 O;  2PFU A;  1L3T A;  2G8V A;  4B8A B;  3I55 N;  4CJE A;  4DFJ A;  1BOT O;  3I0R A;  3UIQ A;  4MDB A;  4RW8 A;  3SV3 A;  3KK3 A;  3SAH A;  3SPZ A;  2VG5 A;  4FXD A;  5AQO A;  4AM7 A;  3MK6 A;  3HXM A;  1VHX A;  4O8U A;  1WB9 A;  2O8B A;  1XHZ A;  2EHG A;  2B4J A;  4JNE A;  3I8D A;  3MN7 A;  3M8P A;  3KHY A;  1KVB A;  3OJU A;  2V51 B;  3F5T A;  3EYZ A;  2PZS A;  2CH5 A;  1NKB A;  4DR6 K;  3ATV A;  2YHX A;  1Q8I A;  4FM2 A;  5BR8 K;  3D2E A;  4FJJ A;  1NGI A;  1YVU A;  5AQL A;  1UWB A;  5KGX A;  3OHR A;  3QIP A;  4FPB A;  4N76 A;  4DHY A;  4A62 A;  3L0Q A;  3CCE N;  1TK8 A;  1J53 A;  1VSE A;  4QS9 A;  2Z1G A;  5BN9 A;  3NE6 A;  3TSP A;  5A2Q O;  2V7Z A;  2QM1 A;  4FSV A;  1SUQ A;  3MXI A;  2ZM6 K;  2YKN A;  3B6O A;  1HNZ K;  4Y1D A;  3FFK B;  3LWL A;  4O44 A;  1MA9 B;  2WFB A;  1QHT A;  2E2P A;  3KD1 E;  3BP8 A;  1NOZ A;  5BR9 A;  1B92 A;  5J2N A;  3ID8 A;  3RMD A;  4DS4 A;  3MED A;  2DFF A;  5AR0 A;  3VF6 A;  3QBX A;  2BDP A;  4IKF A;  2HMI A;  3VA0 A;  2VYP A;  4O5F A;  4AHR A;  3DLG A;  4HTU A;  5LJV A;  3IMX A;  4FLX A;  1SL2 A;  4BC4 A;  4GV3 A;  3QNO A;  4DR7 K;  4H8K A;  1HNV A;  2I7N A;  5FPE A;  4BDY A;  4DV1 K;  4DFM A;  3U9Z A;  4DV5 K;  1B9F A;  3LDO A;  3NF8 A;  4H0X B;  4YOV A;  3THX B;  4M3W A;  1YF5 L;  5AZI A;  2NRR A;  1YI2 N;  3NAE A;  3D0P A;  1UAX A;  4DG1 A;  3O3G A;  1RDA A;  1XNQ K;  1S6P A;  5M1Q A;  1OH5 A;  4CJT A;  2BAN A;  1LWF A;  5AQG A;  3AA3 A;  3AGR A;  1GOA A;  3L3U A;  4B3R K;  4ILG B;  2UYT A;  2HF3 A;  3CHW A;  1NJI O;  4ISG A;  3R8E A;  3SK3 A;  4BGB A;  2VQE K;  4GKJ K;  4M3T A;  5AFU H;  4DR5 K;  4CIF A;  1C1B A;  2UUA K;  4FOE A;  2E6L A;  4X64 K;  2E1Z A;  3DLE A;  4IJN A;  3D2F A;  3KLH A;  3LDN A;  3WQU A;  4CJU A;  4EAH D;  5AQK A;  1XHX A;  4CZK A;  4DV0 K;  3CJB A;  2HOE A;  4M63 C;  2JGU A;  1RBS A;  1TL3 A;  3OY9 A;  3VEY A;  2O8D B;  2V7Y A;  5AQS A;  1FK9 A;  2P9K A;  4C1N K;  4LC9 B;  3K59 A;  5JVG L;  1BL3 A;  4RCH A;  3EO3 A;  4CEQ A;  2ZJQ L;  1YTU A;  1VAZ A;  5EXW A;  4DR1 K;  3IKM A;  3NVK A;  1MWM A;  3O6W A;  4DQQ A;  4CEO A;  1RT5 A;  4WCE L;  3CPW M;  4KRE A;  1HLU A;  2O8E B;  1KAX A;  1U2V B;  1JJ2 M;  3QFU A;  4MFB A;  4E1J A;  4HCC A;  3L2R A;  3LP2 A;  2W42 A;  4DV2 K;  2IVP A;  5AQQ A;  2GEM A;  4B9S A;  3WUH A;  1OVQ A;  1HNX K;  4WFA L;  1TK0 A;  4ISF A;  1KXP A;  1VQM N;  3OW2 M;  4BDZ A;  5I3U A;  5EOY A;  2F8S A;  4ZTF A;  3H3N O;  4RW7 A;  5HOO A;  4H4O A;  4FJN A;  3PX4 A;  4JS5 A;  4W5N A;  3QO9 A;  4AHC A;  1BGX T;  4CBU A;  1NMD A;  4K41 A;  4JV5 K;  3AO5 A;  1RT6 A;  1S3X A;  4PUO A;  2G8F A;  3NF7 A;  2ZJR L;  4CGG A;  4B3M K;  1CXU A;  1W9H A;  3C65 A;  5AZJ A;  3HVT A;  2G8I A;  1JLC A;  2QWR A;  3Q7B A;  1JLA A;  4CF2 A;  3IFR A;  3QBW A;  3K2P A;  3N4Q A;  1OH7 A;  2E4L A;  3C6T A;  3TU5 A;  2CGL A;  3SV4 A;  3U8X A;  2A3Z A;  4PL7 A;  4K43 A;  1I3A A;  4BWJ A;  4BR7 A;  5CY4 A;  3K5O A;  2NRT A;  1NMN A;  2DPN A;  2RN2 A;  4BVP A;  4F2S A;  1ASW A;  3TAP A;  3CM6 A;  2QA4 N;  4DTO A;  5GIP A;  3OS0 A;  1XUP O;  3KTQ A;  2G8W A;  4Z94 A;  3G4S N;  2KZZ A;  1BU6 O;  3HP6 A;  3QLH A;  3AVA A;  2OYQ A;  3RMA A;  2WBN A;  2HNZ A;  2OPP A;  2A41 A;  4MO4 A;  2XY8 A;  5GAH P;  3PX6 A;  3VQ4 A;  1E4G T;  5J1E A;  4J2E A;  2D0P A;  1HPM A;  1RT4 A;  4IEI A;  4DV7 K;  4DSF A;  3SNN A;  4BC2 A;  3O9S A;  4MLE A;  1D9F A;  4DV3 K;  3K57 A;  1N32 K;  2VWK A;  3AO4 A;  4E7K A;  5BRE A;  1EP4 A;  4L3Q A;  2NUB A;  2OA8 A;  4KH4 A;  3DJC A;  4CEE A;  1EO1 A;  3ZEU A;  4RW4 A;  1W2B M;  4I6M B;  1UA1 A;  3P5J A;  2Q0U A;  3PIO L;  4CHQ A;  1WN7 A;  5AJ3 K;  4KI4 A;  4DFK A;  3CC4 N;  1OH8 A;  3L2Q A;  3RR8 A;  2OZS A;  1L3S A;  1HQE A;  3C7N A;  2KZM A;  1C6V A;  3HOS A;  4CZH A;  1TAU A;  4A5B A;  4CZL A;  4KPY A;  3T3F A;  4B9M A;  3PIP L;  4H5N A;  2VWJ A;  5F1X A;  3DWL A;  1IKY A;  4CGH A;  4B1U B;  3H6E A;  2NRV A;  5HLF A;  4DQP A;  1YT3 A;  4FO0 A;  4XEI A;  4HUG A;  1A5V A;  1BDG A;  3C6A A;  3SI6 A;  3SUO A;  4DSK A;  3SCX A;  1RDU A;  3HST B;  2HHW A;  4CJW A;  3PSI A;  4I9L A;  2XHB A;  3FZK A;  3JAM O;  3IRX A;  3KLG A;  4BRG A;  3VEW A;  3QEV A;  4BRI A;  2E1Y A;  4MQ3 A;  1CZ9 A;  4JKG A;  3U6F A;  4CJ3 A;  2BH1 A;  2E8A A;  4NB4 A;  5C24 A;  5E26 A;  1N36 K;  3LL3 A;  4CFD A;  1NK9 A;  4B1Y B;  3I8B A;  2Z1I A;  3AVG A;  4CHZ A;  4CJ7 A;  3DXK B;  3NGY A;  4ID5 A;  3U4L A;  3OYH A;  1TKD A;  1NGE A;  3SMS A;  4BE0 A;  4LF8 K;  2P9N A;  1BWF O;  4NYF A;  2VWB A;  1GLB G;  2O8F B;  4QCL A;  1RNH A;  4FWN A;  3ZCM A;  4NCG A;  1NG9 A;  2GUP A;  5GIO A;  1T05 A;  1KAZ A;  3W3D A;  1ESV A;  3F9K A;  3WXL A;  3QER A;  2EWS A;  1T03 A;  1RBR A;  3C0B A;  5AQR A;  2O8C B;  1WAJ A;  5DMR A;  1BUP A;  2HST A;  3KJV A;  1RTD A;  3M6G A;  2FSK A;  1ZBU A;  1C0T A;  4JHD A;  3QB0 A;  1RDD A;  4DF8 A;  1SKS A;  1LAV A;  5FRO A;  4CZE A;  3H1V X;  4JK9 A;  3DRS A;  3PX0 A;  5KRS A;  3ZT2 A;  3C6U A;  3GL1 A;  2A1R A;  1VRT A;  3CET A;  3OTO K;  4O0J A;  3C95 A;  2ITG A;  5AQI A;  3MMV A;  3BF3 A;  5FRN A;  3LM9 A;  3JSM A;  1Q81 O;  1VSH A;  1VRU A;  4IXC A;  1S72 N;  4J2D A;  1NJX A;  3JXU A;  4QOZ B;  2HBJ A;  1ATS A;  3VEV A;  4YDU A;  4FWP A;  3T69 A;  3UKR A;  1Y64 A;  2DFH A;  5FPM A;  4JI0 K;  1XMQ K;  1O13 A;  4I7F A;  3MDQ A;  3HZ6 A;  3KLF A;  3TAQ A;  1G15 A;  3HVR A;  4LF5 K;  5I42 A;  4ELV A;  2ITM A;  3U3Y A;  2FBT A;  3EE8 A;  4CJK A;  1BHL A;  3RVC A;  4DTX A;  1CZB A;  1NKC A;  1VQ7 N;  2QKK A;  3ZT1 A;  1BIZ A;  4FPA A;  2B6A A;  1RCH A;  4CEZ A;  3QEI A;  1U48 A;  5C15 A;  3WXJ A;  1T7P A;  3QIO A;  5KRT A;  1P8Z A;  1ATR A;  3V81 A;  1IV0 A;  3AY9 A;  3CCL N;  3HSC A;  1FW6 A;  4DR4 K;  2QWL A;  4JI2 K;  3NMU A;  1S1V A;  5AQJ A;  2P9U A;  4KTZ A;  4CIE A;  1QS4 A;  4KV8 A;  4DV4 K;  3FGU A;  4AM6 A;  5C42 A;  1TVR A;  3E66 A;  3ZX0 A;  3KWG A;  3LZI A;  3ASM A;  4CJS A;  3NH0 A;  3M8Q A;  1BI4 A;  1TUY A;  2D0B A;  2P9S A;  4CJV A;  4DTN A;  3O1B A;  1KVC A;  3F73 A;  1ZBL A;  4DTU A;  3J8A A;  4OX9 K;  3ZT0 A;  2IS3 A;  3AVJ A;  4JKC A;  4WFB L;  2Q31 A;  5LJW A;  4FCY A;  3P38 A;  1VSD A;  1FXX A;  3PO4 A;  4CZG A;  4K0K K;  4C8K A;  3G6E N;  1ATN A;  2O8B B;  3DLL L;  4CJ5 A;  1V4T A;  3VQE A;  1RTJ A;  4K42 A;  1YTA A;  4N5S A;  3QDK A;  1D9D A;  4BWM A;  3BY5 A;  1TKX A;  2RPI A;  1NJW A;  4DCH A;  1NOY A;  3P31 A;  3WEE A;  4DU3 A;  3D2E B;  2Q97 A;  3EL2 A;  4BRL A;  1QSL A;  4FJX A;  4B9V A;  1SV5 A;  4N41 A;  3RTV A;  3R6M A;  3V4I A;  2O4G A;  3HBT A;  1GOC A;  4O5B A;  3CCQ N;  2QKB A;  3MXM A;  5IWA K;  4CW7 B;  1LWC A;  3H3O B;  3K9K A;  5C2F A;  1WSE A;  1VQ8 N;  3CCM N;  2NRH A;  4OKJ A;  4JI1 K;  3I56 N;  1U6Z A;  2NRW A;  4NXM K;  3ZSV A;  3QEP A;  1LCU A;  4MDA A;  3O4Q A;  5TKY A;  3LP1 A;  3G0Z A;  1Q9X A;  1ZBH A;  1KVA A;  2OTL N;  4FJM A;  2FF3 B;  3UKU A;  4CEB A;  1IH7 A;  1NGD A;  2HND A;  4O8K A;  4TSX A;  3VGL A;  4PQU A;  3AO2 A;  3ZSY A;  5AQW A;  5BRH A;  3CD6 N;  4M42 A;  2HBM A;  4Z4H A;  4W5Q A;  4OO1 J;  4KHW A;  1TK5 A;  2FC0 A;  1KCF A;  5BN8 A;  2NRX A;  1LW2 A;  4JKB A;  4E7J A;  3AV9 A;  4BR4 A;  3J81 O;  4DF4 A;  4CZM A;  2LSN A;  5AZI B;  1HKG A;  3NGI A;  1UA0 A;  4EIA A;  2E6M A;  4CJL A;  2CGK A;  4IG3 A;  2Y1J A;  4MLH A;  5TKW A;  4B1W B;  4FM0 A;  3OYF A;  1S1T A;  3N4P A;  4OKE A;  3TTC A;  5LMN K;  4OLA A;  3QIN A;  5AQM A;  2FXU A;  5KTQ A;  2P9I A;  3QIC A;  5T7B A;  4H5W A;  4UQG A;  4QS8 A;  1K73 O;  3KIO A;  2GEL A;  1T44 A;  5FPD A;  4W5O A;  1IKW A;  5GIN A;  2YI1 A;  1L3V A;  1TYQ A;  1RBT A;  2J4R A;  4F3O A;  4CJ4 A;  3A2F A;  4I9Q A;  3DLH A;  2DFE A;  1VQ5 N;  1HR0 K;  3DMJ A;  4BVO A;  5M1O A;  4M3U A;  3D2F B;  1NU0 A;  3C6H A;  4E7H A;  1RTH A;  1RT1 A;  4CHO A;  2F9T A;  4Y1C A;  1KLM A;  1X9W A;  2P9K B;  4LF4 K;  4GKK K;  5HP1 A;  4M3Z A;  2KTQ A;  3QEX A;  5F0X A;  2RKI A;  3VET A;  1I94 K;  2VQF K;  5HRR A;  2E2Q A;  5CZ1 A;  4PA1 A;  4DLE A;  2VG7 A;  3AA4 A;  1B9D A;  5E41 A;  3O9U A;  5DM6 L;  2V52 B;  4K8X A;  4DQ8 A;  4OPA A;  1HNI A;  5FLX O;  1RDB A;  1BO5 O;  3ENH A;  3IUC A;  3P1G A;  4RG8 A;  1IG9 A;  3OYM A;  1C0G A;  4XIU A;  4EZ9 A;  5DK5 A;  3P39 A;  2A42 A;  3ZET A;  4E19 A;  4JKA A;  3ZLJ A;  3OYG A;  2QWP A;  3LDQ A;  1FKP A;  3HL8 A;  3RSE A;  4AHV A;  3I33 A;  1RBU A;  4U67 L;  2UU9 K;  4DUY K;  4PKI A;  2W40 A;  2R7Y A;  1ZBS A;  3O1W A;  1U47 A;  2Z1J A;  3VTI A;  1IO2 A;  1HKC A;  4CBW A;  4DQR A;  5HRS A;  2IVO A;  5HRN A;  5HBM A;  4KH5 A;  3LP0 A;  1N5Y A;  4AH9 A;  3TAF A;  4RWT A;  4YOU A;  5AZJ B;  3CF5 L;  3OBY A;  4A57 A;  4CK2 A;  1H1V A;  4X66 K;  4FJG A;  4EP5 A;  3CIP A;  3RR7 A;  1LOT B;  3AVL A;  3VEO A;  1W97 L;  3ENO A;  1X3N A;  3BZC A;  4LD0 A;  4FJH A;  1QZ5 A;  5GAE P;  5EVZ A;  1NK8 A;  3VA3 A;  5HL7 L;  3DLR A;  4FJL A;  3O9R A;  1L5U A;  2UXD K;  3UE5 A;  5EX5 A;  4YDU C;  2NLX A;  4J2B A;  2ATQ A;  5GAG P;  1OKJ A;  4M45 A;  2FSN A;  5M1F A;  1S1U A;  3LPT A;  1IJJ A;  3GBT A;  5FPN A;  1WSJ A;  2G8K A;  4KB1 A;  4OJR A;  5GAD P;  3KZB A;  1HMV A;  1XNR K;  1N6Q A;  1DKG D;  3H46 O;  3TSU A;  2BE2 A;  3DRP A;  1IG8 A;  4F3T A;  4X65 K;  4KRF A;  3K58 A;  2D0A A;  1ASV A;  3E1Y A;  4IFE A;  3A8Y A;  3PY8 A;  1YUW A;  3TTD A;  4DTJ A;  4BRP A;  3M8R A;  4EHT A;  4JAX A;  4YFU A;  3TAG A;  3ZEU B;  2P9L B;  2F9W A;  1JLF A;  3RRG A;  2E2N A;  4FOI A;  1ZBF A;  4DTS A;  1SL1 A;  4EZ6 A;  3C7N B;  1QVG M;  3P4I A;  1M1K O;  1WSH A;  3O3F A;  4JKF A;  1C0M A;  4B3O A;  4HCB A;  3CQ8 A;  4AIL C;  4LFC K;  4QAG A;  4H0O A;  4FJI A;  3EEQ A;  4FW2 A;  5CYQ A;  2VCP A;  4YOR A;  3WNE A;  3ULD A;  3D6R A;  5AQT A;  4H0Y B;  1BIU A;  3DAW A;  1Z05 A;  3U9D A;  2VG6 A;  1RIL A;  3S41 A;  1NJY A;  2HHQ A;  4LF9 K;  2P51 A;  1IBL K;  2YV0 X;  5I9E B;  5KGW A;  4F2R A;  4WQ4 A;  3ZSQ A;  1JLQ A;  3PLA A;  4GV9 A;  5C25 A;  3VQ7 A;  3NHG A;  3G25 A;  1WNS A;  4F9O A;  5JS2 A;  1NK0 A;  4FLV A;  3AVN A;  1KAY A;  1YHQ N;  2OTJ N;  4C8M A;  4BG9 A;  3RMB A;  5KPR A;  3OYN A;  1D5A A;  3IS9 A;  3V1Q A;  4Z4E A;  1NGJ A;  4JKH A;  1J54 A;  2FLO A;  4LSL A;  3RWU A;  3ZSO A;  3BDP A;  3EN9 A;  4RW9 A;  5ADX H;  3WXK A;  3K9J A;  3QNN A;  1LV5 A;  4FZX C;  3HO1 A;  2ASO A;  3FZH A;  4WQ5 A;  2P9N B;  4JK8 A;  4JI5 K;  4IG0 A;  3JS6 A;  3O5B A;  5CE3 A;  4JD2 A;  3TAB A;  4IOX A;  1VSM A;  2DY4 A;  3T1H K;  4CFA A;  1GLL O;  3VEX A;  3SJH A;  4IBN A;  3CCJ N;  2JWK A;  4GVM A;  5KI6 A;  4WFN L;  3BF1 A;  3ZX2 A;  5B8H A;  3AGK A;  1KQS M;  3RMC A;  4CEC A;  3EKS A;  5M1N A;  4JHD B;  3C94 A;  3K0S A;  1J9A A;  2WUS A;  1DTT A;  3DYA A;  1E4F T;  1X9S A;  4A2B A;  1NGH A;  1WOQ A;  4CF9 A;  4CHN A;  4M7X A;  3HM9 A;  1GLA G;  2UUB K;  1YIJ N;  2QWQ A;  4BRN A;  4HUF A;  3OYJ A;  3OS2 A;  2ZWH A;  4WE1 A;  3PSF A;  3TTF A;  2YKM A;  4M3X A;  2QEX N;  3CQX A;  4DS5 A;  4XH5 A;  3VQC A;  3VEZ A;  1SKW A;  4R5P A;  1QHA A;  3AVB A;  3OYI A;  4JYA K;  2RHK A;  4YOT A;  3TI0 A;  4Z4F A;  1WBD A;  3EZ5 A;  4JRQ A;  2GV9 A;  4FWK A;  2OCE A;  1FKO A;  1D4X A;  3CJ9 A;  3FZF A;  4DR3 K;  1BIS A;  4PY5 A;  3VEN A;  2KFZ A;  3CQY A;  4BDP A;  2KLA A;  4H0P A;  1HYV A;  3UKR B;  1JLG A;  5AQN A;  4CD1 A;  4GW6 A;  5AFU A;  1ZBI A;  5MLC Q;  4IJA A;  1VQ9 N;  1NBW A;  1OH6 A;  3AVM A;  4FWL A;  3H45 C;  5LY3 A;  3GE1 A;  2YNH A;  1J6Z A;  3K5M A;  3J7Y P;  3W0L A;  3DM2 A;  5JLF A;  4JI7 K;  2P9P B;  3AAQ A;  4DWI A;  1DLO A;  2GUI A;  3HYF A;  2G8H A;  2PAV A;  3VOV A;  1BCM A;  3NVM A;  3EY1 A;  2P9U B;  4JEP A;  3TSQ A;  3KKS A;  4KKO A;  3AA5 X;  3VN5 A;  5C12 A;  4DLG A;  3FZM A;  4E7L A;  1SS6 A;  4EHU A;  3ZSR A;  2IIR A;  3CER A;  4Z4G A;  1BI4 B;  2QWM A;  2RF2 A;  3MX2 A;  4CER A;  3J7Z O;  1EX4 A;  1DTQ A;  2NZT A;  4BRE A;  4J2A A;  3QES A;  3DOK A;  3FR0 A;  5CYM A;  1VQ6 N;  2OPQ A;  4DSJ A;  3VPZ A;  3HK2 A;  1BG3 A;  3SQ2 A;  5KPZ A;  1UOC A;  3THY B;  3OYL A;  3E9P A;  3L2W A;  2JLE A;  1SKR A;  1KFS A;  4G1Q A;  4ELT A;  1BQN A;  3ATU A;  1HUX A;  2X6S A;  3TAR A;  3M3Z A;  4JLH A;  4DTR A;  3ZT3 A;  1EXQ A;  1RDC A;  2QXL A;  5BRD A;  4FL9 A;  4NLB A;  3HI0 A;  3WT0 A;  1HJR A;  3HP9 A;  4CVN E;  2X78 A;  3WEE B;  4FWS A;  3CJA A; 
#chains in the Genus database with same CATH homology
 3VMF B;  4FOE A;  4OO1 J;  2AA4 A;  1NGA A;  4FWR A;  3F2K A;  5BN8 A;  2NRX A;  4JKB A;  3MN9 A;  4BC5 A;  2E1Z A;  4IJN A;  3SBG A;  3D2F A;  4BR4 A;  1Q18 A;  3LDN A;  1U2V A;  3LDL A;  3WQU A;  4CZM A;  4EAH D;  1VQN N;  5AQK A;  1HKG A;  5AZI B;  4CZK A;  4NO7 A;  3CJB A;  4H5T A;  2HOE A;  2P9L A;  4M63 C;  4EIA A;  4H5V A;  1GLE G;  1OVY A;  2Q36 A;  3VEY A;  2CGK A;  4CBX A;  2V7Y A;  1CZA N;  5AQS A;  4MLH A;  2P9K A;  5TKW A;  4LC9 B;  4C1N K;  4DB3 A;  4B1W B;  2ZF5 O;  4PKG A;  5JLH A;  3N4P A;  2E20 A;  3TTC A;  4CZI A;  5JVG L;  4GV6 A;  1YAG A;  2GWJ A;  5AQM A;  4RCH A;  3EO3 A;  1TUU A;  4NLC A;  2FXU A;  4FWQ A;  2ZJQ L;  4HWI A;  2P9I A;  3QIC A;  1VAZ A;  5EXW A;  2Q0R A;  2D1K A;  4H5W A;  1EQY A;  3IKM A;  5JVH L;  1VQ4 N;  3NVK A;  1MWM A;  4QS8 A;  3O6W A;  1K73 O;  1SAZ A;  2GEL A;  1T44 A;  3D7E O;  5FPD A;  2HBL A;  4WCE L;  3UKU B;  1NJI O;  3CPW M;  5GIN A;  2YI1 A;  1HLU A;  3ULE A;  1TYQ A;  3R9P A;  4ISE A;  2NNW A;  4A5A A;  4WF9 L;  1KAX A;  1U2V B;  2J4R A;  1JJ2 M;  3CJ1 A;  3QFU A;  2ZJP L;  3CCS N;  4E1J A;  4R79 A;  5ADX A;  1VQ5 N;  2A5X A;  3IDH A;  4BVO A;  5M1O A;  5EY4 A;  4H5R A;  3R3L A;  3D2F B;  2IVP A;  3C6H A;  2GEM A;  5AQQ A;  5JMV A;  4BRO A;  3WUH A;  3CC2 N;  4BQL A;  2YJF A;  3R1X A;  1Q86 O;  4WFA L;  4BQZ A;  2F9T A;  4ISF A;  1Q82 O;  1KXP A;  4B9Q A;  1VQM N;  3CC7 N;  3OW2 M;  1YXQ A;  2ASM A;  1T6D A;  4FWO A;  2P9K B;  5EOY A;  4U7B A;  1YJN N;  3H3N O;  3HM8 A;  5HOO A;  1DEJ A;  4CBU A;  1NMD A;  4K41 A;  3AAR A;  5F0X A;  2W41 A;  2P9I B;  2VGM A;  3VET A;  4BY9 C;  2VGN A;  1S3X A;  3A5M C;  2E2Q A;  2ZJR L;  4FVU A;  2JWL A;  4IDH A;  4A2A A;  4BRC A;  3C65 A;  1GLF O;  3GOI A;  1TYQ B;  3O4W A;  1NM1 A;  4ILJ A;  3ULE B;  5AZJ A;  3CCV N;  2HMP A;  2YCH A;  3O9U A;  3CD6 N;  5AQU A;  3O08 A;  5DM6 L;  2CH6 A;  2V52 B;  1YIT N;  4DQ8 A;  2QWR A;  3Q7B A;  4IWV A;  4OPA A;  1JCF A;  3IFR A;  1BO5 O;  4BC3 A;  3ENH A;  3IUC A;  3QBW A;  5AQH A;  4DKW A;  1K9M O;  2P9S B;  2HBK A;  4BR9 A;  1C0G A;  4PKH A;  4BRM A;  2E88 A;  3N4Q A;  3P39 A;  2QWO A;  4IO8 A;  4IOA L;  2A42 A;  4A59 A;  3TU5 A;  2CGL A;  1NGF A;  1G99 A;  1SZ2 A;  3U8X A;  3ZET A;  5C10 A;  3UB5 A;  4BG8 A;  4BR2 A;  2A3Z A;  1NWK A;  4JKA A;  4WQ4 C;  4B1V A;  2ASP A;  4PL7 A;  1RFQ A;  4K43 A;  3SBT A;  4BR7 A;  1DT9 A;  4I6M A;  2QWP A;  2NRT A;  1YJW N;  5M1K A;  4BVP A;  2DPN A;  3LDQ A;  3L6Q A;  3SMP A;  1QVF M;  3RSE A;  3I33 A;  4U67 L;  2ZGY A;  4PKI A;  3AAP A;  2QA4 N;  2W40 A;  5GIP A;  3FE1 A;  3H1Q A;  1ZBS A;  3O1W A;  1XUP O;  3VTI A;  1HKC A;  1T3V A;  2GX9 A;  4CBW A;  4Z94 A;  3VTH A;  3G4S N;  1BU6 O;  1C0F A;  4GY2 B;  4MO5 A;  2IVO A;  2FF6 A;  4KH5 A;  3HTV A;  5AQY A;  3O80 A;  1YVN A;  1JCG A;  2WBN A;  3A5N C;  3L4Q A;  2A41 A;  4MO4 A;  4RWT A;  4YOU A;  5AZJ B;  3MN5 A;  5GAH P;  3CF5 L;  3OBY A;  4A57 A;  1E4G T;  1RGI A;  3CI5 A;  1H1V A;  3CIP A;  3FLC O;  2D0P A;  1HPM A;  4G9Z A;  4IEI A;  1LOT B;  3DXM A;  4EFH A;  3VEO A;  1W97 L;  3LDP A;  4WQ5 C;  4BC2 A;  3ENO A;  4JKD A;  3O9S A;  4MLE A;  1X3N A;  5C0Y A;  1QZ5 A;  2Q1N A;  5GAE P;  5BRE A;  5EVZ A;  4L3Q A;  1RDW X;  2QW9 A;  3LM2 A;  4KH4 A;  3SLC A;  1BA0 A;  3VER A;  3DJC A;  5HL7 L;  1EO1 A;  3ZEU A;  1VQP N;  1W2B M;  4I6M B;  4BRQ A;  2Q0U A;  3PIO L;  1HX1 A;  4JKE A;  3O9R A;  4BRF A;  1MWK A;  2YHY A;  5EX5 A;  3UE5 A;  4IO9 L;  4YDU C;  3CC4 N;  2NLX A;  5GAG P;  1OKJ A;  3C7N A;  2FSN A;  5M1F A;  1IJJ A;  3GBT A;  3CJC A;  5FPN A;  3HOS A;  4CZH A;  1NGB A;  4A5B A;  4CZL A;  4B1Z A;  3WXM B;  1DGK N;  5GAD P;  3PIP L;  3KZB A;  3KVG A;  4H5N A;  2E2O A;  3DWL A;  5F1X A;  2CGJ A;  2QI2 A;  4FWM A;  3ZX3 A;  3ENB A;  4B1U B;  1DKG D;  3H46 O;  3DXK A;  5AQP A;  3TSU A;  3H6E A;  3DXM B;  4M7Y A;  3SAG A;  1IG8 A;  1VQL N;  2NRV A;  1HKB A;  3QFP A;  2BUP A;  4FO0 A;  2P9P A;  4RTF D;  3E1Y A;  4XEI A;  4IFE A;  3A8Y A;  5BRF A;  1BDG A;  1WUA A;  1YUW A;  3TTD A;  3C6A A;  4BRP A;  1MDU B;  2HF4 A;  3OBW A;  4EHT A;  4JAX A;  1RDU A;  3ZEU B;  2P9L B;  3GG4 A;  3E9O A;  3FZK A;  5KQ8 A;  2F9W A;  3CXC M;  4BRG A;  1K8K A;  2GWK A;  3VEW A;  5JIC A;  5KPT A;  2E2N A;  2YX6 A;  4BRI A;  4FOI A;  4OPH A;  5BPM A;  3G71 N;  2E1Y A;  4BRA A;  2QTD A;  4JKG A;  1T6C A;  1NGG A;  3ID6 A;  2BH1 A;  2A6A A;  3C7N B;  2E8A A;  3A5O C;  4NB4 A;  1QVG M;  5E26 A;  1X3M A;  3P4I A;  3VF4 A;  1M1K O;  4YOX A;  3F9M A;  4JKF A;  3LL3 A;  4KBO A;  4B1Y B;  4BRD A;  3SAF A;  3I8B A;  3VGM A;  3EKU A;  4GNI A;  1YJ9 N;  3Q7C A;  3GDQ A;  3O8M A;  4H0O A;  4CJ7 A;  2AP1 A;  2I7P A;  3DXK B;  2VCP A;  3QML A;  2A40 A;  4YOR A;  3U4L A;  3D6R A;  5AQT A;  3VES A;  4H0V B;  1NGE A;  3SMS A;  2D4W A;  4H0Y B;  1R59 O;  1K8A O;  3KWI A;  3DAW A;  1VQK N;  1Z05 A;  3U9D A;  2PBD A;  2P9N A;  1BWF O;  1QQN A;  1QQO A;  1Q7Y O;  3MWT A;  4XH1 A;  2VWB A;  1GLB G;  3S41 A;  1P90 A;  3WXI A;  4KH6 A;  4FWN A;  5I9E B;  3A5L C;  5H1S Q;  2GUP A;  5GIO A;  3CJ7 A;  4WQ4 A;  1K8K B;  1KAZ A;  4PHT X;  3W3D A;  3PLA A;  1ESV A;  5AQW A;  3MN6 A;  3WXL A;  4GV9 A;  2EWS A;  1ZXO A;  1QZ6 A;  3MWP A;  3C0B A;  1SQK A;  3FZL A;  3G25 A;  4H03 B;  5AQR A;  4F9O A;  1BUP A;  1KAY A;  2HST A;  1YHQ N;  3M6G A;  2FSK A;  3KK7 A;  5M1P A;  2OTJ N;  3TPQ A;  4JN4 A;  3EZW A;  4JHD A;  4BG9 A;  3QB0 A;  3BUZ B;  3L4I A;  3T7Z A;  4BRH A;  5KPR A;  4CZE A;  3H1V X;  1KD1 O;  4JK9 A;  1ZC6 A;  2D0O A;  3OA9 A;  1NGJ A;  1QQM A;  4HTL A;  4JKH A;  5CR4 A;  2FLO A;  4J8F A;  3EN9 A;  5ADX H;  3GL1 A;  1GLJ O;  3CCU N;  3WXK A;  3K9J A;  3CET A;  4YOW A;  5AQF A;  3HRG A;  5AQV A;  1V4S A;  5AQI A;  2ASO A;  3FZH A;  5DM7 L;  3MMV A;  5C2D A;  3BF3 A;  2KHO A;  4WQ5 A;  2F7T A;  2P9N B;  3LM9 A;  1Q81 O;  4JK8 A;  3JS6 A;  3O5B A;  5KQD A;  5CE3 A;  5E84 A;  4JD2 A;  1Z6R A;  4IXC A;  4IOX A;  1S72 N;  2KKZ A;  3VGK A;  3ZET B;  1GLL O;  3VEX A;  3A0I X;  3JXU A;  2WC9 A;  3M5R A;  5BPL A;  2HBJ A;  2RE2 A;  3SJH A;  3HOT A;  3CCJ N;  1ATS A;  2H3G X;  2JWK A;  1M90 O;  4WFN L;  3O9T A;  3BF1 A;  3ZX2 A;  5CHI A;  3VEV A;  2BTF A;  4Y0W A;  5B8H A;  1GLD G;  3RSE B;  3CME N;  3AGK A;  3CMA N;  4YDU A;  3MCA B;  1KQS M;  4PL8 A;  4FWP A;  3T69 A;  3B8A X;  3UKR A;  4YOY A;  1Y64 A;  3EKS A;  4ILH A;  5FPM A;  5M1N A;  4JHD B;  1O13 A;  1N8R O;  3MDQ A;  1KC8 O;  2WUS A;  2OAN A;  3HZ6 A;  2PFU A;  1E4F T;  3I55 N;  1BOT O;  4A2B A;  1NGH A;  1WOQ A;  4MDB A;  4M7X A;  1GLA G;  1VQO N;  1XC3 A;  1YIJ N;  2QWQ A;  2ITM A;  3SAH A;  4BRN A;  3EE8 A;  4C1N I;  3RVC A;  5AQO A;  1VQ7 N;  4AM7 A;  3MK6 A;  2ZWH A;  3TTF A;  4O8U A;  4FPA A;  2QEX N;  4BR0 A;  3CQX A;  5C15 A;  3WXJ A;  4XH5 A;  3VEZ A;  1P8Z A;  1ATR A;  3VF2 A;  2FSJ A;  1QHA A;  4JNE A;  4JD2 B;  4BR5 A;  3MN7 A;  2RHK A;  3AY9 A;  3CCL N;  4YOT A;  3HSC A;  2QWL A;  3KHY A;  2YJE A;  2V51 B;  3CJ9 A;  2P9U A;  4FWK A;  5AQJ A;  1D4X A;  3FZF A;  3NMU A;  3F5T A;  3FGU A;  4AM6 A;  2IVN A;  3E66 A;  2CH5 A;  3VEN A;  3CQY A;  2KLA A;  3ZX0 A;  3ATV A;  2YHX A;  3KWG A;  4H0P A;  3D2E A;  3UKR B;  4CZF A;  1NGI A;  5AQL A;  5AQN A;  3OHR A;  4CD1 A;  4FPB A;  1TUY A;  4CI6 A;  5AFU A;  2P9S A;  4B1X B;  1JCE A;  4DHY A;  4A62 A;  5MLC Q;  4CZJ A;  3L0Q A;  4IJA A;  1VQ9 N;  3CCE N;  1NBW A;  4AF1 A;  3O1B A;  4QS9 A;  2GTD A;  4FWL A;  5BN9 A;  4IOC L;  4C23 A;  3H45 C;  3J8A A;  5LY3 A;  3GE1 A;  3TSP A;  1S22 A;  2V7Z A;  1J6Z A;  2QM1 A;  4JKC A;  4WFB L;  4FSV A;  2Q31 A;  5LJW A;  5AQX A;  3P38 A;  2Q2R A;  3W0L A;  4CZG A;  5JLF A;  3G6E N;  3FFK B;  1ATN A;  1MA9 B;  2WFB A;  2E2P A;  2P9P B;  3DLL L;  3AAQ A;  4IZ9 A;  4A61 A;  3BP8 A;  5BR9 A;  1V4T A;  3CPE A;  3ID8 A;  4K42 A;  5BPN A;  5AR0 A;  1NLV A;  2ZGZ A;  3VF6 A;  1GLC G;  2PAV A;  4JK7 A;  3VOV A;  3QDK A;  3NVM A;  3QBX A;  2P9U B;  4JEP A;  1HJO A;  3O9Q A;  3TSQ A;  2VYP A;  4O5F A;  5C12 A;  4BRK A;  3IMX A;  4DCH A;  5LJV A;  1X9J A;  3FZM A;  3P31 A;  5AQZ A;  1SS6 A;  4QS7 A;  4BC4 A;  4GV3 A;  3WEE A;  4EHU A;  3D2E B;  4JKG B;  2IIR A;  2I7N A;  2Q97 A;  3CER A;  3EL2 A;  4K25 A;  4BGA A;  5FPE A;  3E9L A;  4BRL A;  2QWM A;  2YHW A;  3MX2 A;  3U9Z A;  3J7Z O;  3LDO A;  3CCR N;  4H0X B;  2NZT A;  4BRE A;  4YOV A;  3FR0 A;  3R6M A;  1VQ6 N;  1NGC A;  1YF5 L;  1ILY A;  3VPZ A;  3HBT A;  5AZI A;  2NRR A;  3CCQ N;  1BG3 A;  1YI2 N;  5KPZ A;  4WYB A;  1XQS C;  4GVE A;  3H3O B;  3K9K A;  3E9P A;  5M1Q A;  5C2F A;  1VQ8 N;  3EE9 A;  5AQG A;  2NRH A;  3CCM N;  3I56 N;  4CD3 A;  1U6Z A;  2NRW A;  3ATU A;  1HUX A;  3AGR A;  3ZYY X;  3BEX A;  3M3Z A;  5F2R A;  4ILG B;  1LCU A;  4MDA A;  3M1F A;  2NRZ A;  4UY8 O;  2UYT A;  5TKY A;  2QXL A;  5BRD A;  2HF3 A;  4FL9 A;  4H0T B;  3CHW A;  4NLB A;  4XH4 A;  4IEE A;  1BA1 A;  3HI0 A;  4ISG A;  3WT0 A;  5ELZ A;  2FF3 B;  3MCP A;  3R8E A;  3UKU A;  2OTL N;  3SK3 A;  4BGB A;  2QWN A;  1NGD A;  3MX5 A;  4O8K A;  3VGL A;  3WQT A;  5AFU H;  3WEE B;  4FWS A;  5BRH A;  3CJA A;  2HBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...