1BIZA

Hiv-1 integrase core domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
147
Chain Sequence
VDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Three new structures of the core domain of HIV-1 integrase: an active site that binds magnesium.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 46
structure length 147
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bizA00
3VQAA 4L8RB 5HRNA 2YKMA 4ELTA 5CYMA 3HPOA 3THVA 1BCMA 1A5XA 4FLVA 3ASMA 3V9UA 4OPJA 3PO4A 1TKDA 2DFHA 4KO0A 3QEWA 4JLHA 3AVCA 4FLXA 4B9VA 3CFOA 1RT6A 4LY7A 4CJUA 3AV9A 4M45A 1U45A 1UOCA 3AO3A 4CJSA 4CFBA 3DLBA 4CEDA 1RT7A 3LAKA 4DF4A 3WNEA 3DLRA 1BI4A 5KRSA 1FKPA 1NK7A 3QEXA 1J9AA 1RDBA 1N6QA 3VA3A 5HRRA 5KI6A 1QE1A 4CHZA 4ZHRA 3RMCA 2ITGA 2QK9A 1EP4A 1ZBFA 1HMVA 2I5JA 2P5OA 4CF9A 2P5GA 3L2UA 3OYCA 1ASUA 2D0BA 4CJFA 2KZMA 3DLGA 3DMJA 2ZQBA 3B6OA 2DY4A 4CHOA 4B8CA 5CYQA 1ZBLA 1ZBHA 3MXIA 2G8KA 3S3OA 1Z25A 2LSNA 4W5NA 1FK9A 4CJEA 3QEVA 4B9LA 4CEQA 1RBSA 2F96A 5C42A 3HP6A 3VN5A 4W5TA 5FRMA 1L3TA 4CFAA 1DTTA 1RNHA 1C0MA 3HVRA 5HP1A 2XHBA 1NK4A 1JKHA 3I0RA 3OYEA 4DFJA 3LWMA 4DFMA 2HHSA 3VQBA 4HTUA 4DTUA 4CGDA 1CZBA 1ZBUA 3TARA 3LP3A 3MEGA 3ZSOA 4CJLA 2G8UA 4K8XA 4C8KA 3CFPA 1NJWA 1QSSA 4KFBA 4KTWA 1S1VA 1LWEA 3CFRA 2HHWA 1RT3A 3RR7A 1RTIA 1W9HA 3K5NA 4FZYA 4CJ3A 4FJMA 1S1TA 2HHXA 1CXQA 1FXXA 2E4LA 1HPZA 3QETA 1J53A 1TL1A 4M41A 1G15A 3E01A 3U6FA 3SQ2A 4CIEA 4AILC 4QCLA 4CF8A 1TK5A 2Z1GA 2P1JA 3TAPA 3OS1A 4KAZA 2BANA 3LALA 4DQRA 1D9FA 1WAFA 2VG7A 1D9DA 2HMIA 2OZMA 3AO1A 4M3ZA 4FLWA 4FZXC 4DSFA 3SPZA 1LW0A 4CJQA 1HRHA 2YNGA 4E1NA 4FJJA 2HB5A 2IAJA 4ICLA 1KVAA 3AVBA 3AVMA 3NGYA 1CZ9A 4YFUA 4FXDA 1TK0A 1S1XA 3RRHA 3DLKA 4CEZA 4Z4HA 4E19A 4ELUA 1KVBA 3SUQA 1RDDA 1BQMA 1LAVA 3U3GA 3L3VA 1U04A 2D0AA 3KK2A 4RW7A 2NUBA 3TI0A 4KPYA 1NJXA 2GBZA 3OJUA 4FW1A 1WSEA 4JS4A 3L2WA 4ID1A 5JS1A 5KGXA 4E7LA 1A5WA 4DLEA 4KHQA 3VQQA 1Z26A 1SUQA 3I0SA 4KRFA 1NK8A 3A2FA 2Z1IA 4CJVA 1EX4A 3SUOA 4FW2A 4EZ6A 1RT2A 4KHWA 3NH2A 3KJVA 2YNFA 4DSJA 3V1RA 3HL8A 4CFCA 3PY8A 1CXUA 5FROA 5HRSA 3NCIA 4JS5A 4AHVA 3OVNA 4ZTJA 3MXMA 2YKNA 2IC3A 3O3HA 5D3GA 4F3OA 4GW6A 3AVHA 3H08A 4CJRA 4KHUA 3OYDA 4BE2A 1NKCA 1Q8IA 3IS9A 4E1MA 2GV9A 1ITGA 3MAQA 4CJ4A 2RKIA 1VSIA 3AVLA 2HNDA 2FBYA 3OYBA 1UA1A 3DM2A 4IBNA 4BE1A 3QERA 4Y1CA 3AVNA 3VQ8A 2Y1IA 1XC9A 1U4BA 1NKEA 1KSPA 4Q5VA 2E6MA 2KFNA 2ATQA 1DLOA 3HPHA 1NOZA 2GUIA 4N5SA 4C8OA 2RF2A 4M3UA 3SYZA 3HYFA 4MFBA 3QLHA 1C1CA 1QHTA 3SNNA 3VQ7A 4FJKA 2Q3SA 4CIGA 1EKEA 2XRIA 3QO9A 4FLUA 4OKEA 3HT3A 3HJFA 4CE9A 5FDLA 4RG8A 4N76A 4W5OA 1IKVA 3TAEA 4KREA 3KK1A 1QS4A 3ZSZA 3ZSYA 1LW2A 1J54A 4CK3A 4IFVA 1RCHA 3F9KA 4N56A 3QESA 2HHVA 3AVKA 3SV3A 4IG0A 1IO2A 3KLEA 3L2RA 3D45A 4KKOA 4DSKA 4AHSA 2G8FA 2DFFA 1GOBA 2O4GA 4HCCA 1Q9XA 4QAGA 3MEEA 3SZ2A 3T1AA 3BDPA 4GVMA 1C0UA 3TWHA 3OYFA 2OPPA 4OGCA 1KCFA 4H4OA 1NK9A 4Z4CA 1WAJA 3K58A 1TAQA 5T7BA 3RWUA 3CM5A 1VSKA 4CFDA 4N41A 2HHQA 3LANA 4E3SA 2B4JA 5K14A 3OYHA 1SKSA 4CGIA 4MQ3A 3QNOA 2BE2A 5HBMA 1JL2A 4DTRA 4KI4A 1WSJA 2YNIA 2XY6A 4E7HA 4PUOA 3QNNA 3V81A 3OJSA 4PQUA 3HVTA 4CHQA 1K6YA 2KQ2A 3HPGA 2JGUA 1LAWA 2B5JA 4CF0A 2D0CA 4FJNA 1NK6A 1HNVA 1RBVA 1VSHA 1F21A 3HP9A 4DLGA 1UWBA 2X78A 4BWMA 1VRUA 5DK5A 3ZSRA 4CJPA 3O3FA 1JLCA 3VQ5A 3JYTA 1KRPA 4C8LA 3IAYA 4M3YA 4KTQA 2BGGA 4M3TA 1TV6A 1C1AA 2FBVA 3OYNA 4QOZB 3RR8A 1U49A 4HUFA 3SQ4A 3MXJA 1NJYA 1QTMA 2QKKA 1BQNA 2X74A 1BISA 3K5MA 4DTPA 3DRPA 2HVHA 4C8MA 1IKXA 4DTSA 3TAQA 4DTOA 1XHXA 4CHPA 3D0PA 5HRPA 4DWIA 1W0HA 3G0ZA 4Z4GA 1L3VA 5C25A 3M8QA 4LH5A 4LD0A 4DFKA 2HHUA 3WNFA 3OYLA 4CGGA 2IGIA 3KLGA 3P83D 3TANA 3LZJA 1RBUA 5J2QA 2Y1JA 3RTVA 3V9SA 4J2AA 4DTJA 1RILA 3LZIA 4AHCA 3K59A 5J1EA 4FJIA 4CK1A 1YTAA 4FJ9A 2F8TA 4FJHA 1SKWA 3NBPA 2ZE2A 2R7YA 1TKXA 3C6TA 4B9NA 4FK4A 4JRQA 4OKKA 3M8RA 3B6PA 3HM9A 1I39A 4CHYA 2D5RA 1CLQA 1REVA 1B9FA 4K8ZA 4F3TA 4I7FA 2F8SA 1DTQA 3SUNA 3DLEA 3NGZA 2QXFA 4DQQA 1KTQA 4Y1DA 1B9DA 1BIZA 1I3AA 1RT4A 1ZBIA 3CG7A 3IG1A 4FJXA 1U48A 3I8DA 1IH7A 3AVAA 3HSTB 4ZTFA 4CEEA 4LH4A 4BWJA 1TK8A 4H4MA 3VQEA 1RT5A 3KLIA 3TAGA 1SL2A 2OZSA 4FK0A 3KIOA 1WNSA 4OGEA 2ZD1A 3ZT1A 2WONA 4CERA 3LWLA 1XHZA 1D5AA 1TL3A 1BGXT 3AA5X 3QEPA 3OYJA 1BCOA 4RW4A 1EETA 2X6NA 2VWKA 3K5OA 1FKOA 1VSJA 3MEDA 3ZT3A 4R5PA 1BHLA 4AHUA 3PO5A 4KHSA 2IS3A 5KTQA 4E89A 3L8BA 3ULDA 5KGWA 1R0AA 1C1BA 2IDOA 3AA4A 3LPTA 4IG3A 3LDSA 5I42A 4YNQA 4BE0A 4CEAA 3SV4A 3C94A 2PY5A 4ELVA 4O0JA 1RTDA 4OPKA 3K5LA 5J2MA 1SKRA 1RDCA 4BDZA 4KHYA 2O4IA 1XI1A 1BL3A 3NAEA 3NF8A 1S6PA 3QINA 3QEIA 1KLNA 1C6VA 4CECA 4HUEA 2XY7A 2KFZA 3L2QA 3ITHA 5FRNA 2VG6A 2AJQA 3PX4A 1S5JA 4FZZA 1S9GA 1IG9A 4DQSA 2A1RA 3S3MA 3DI6A 3LPUA 4DU4A 2G8WA 4OLBA 3CYMA 2WOMA 1LWFA 2VG5A 4CJKA 4E0DA 4B3OA 1X9MA 2HHTA 2YNHA 3LP2A 4DQPA 3F73A 4KB1A 3G10A 3NH0A 4E7KA 2PYLA 1TVRA 1KVCA 3DOKA 4FCYA 1X1PA 2A1SA 5HROA 2G8VA 4NYFA 1BIUA 2YV0X 3V6DA 2OPRA 3KD5E 1S1UA 1Y97A 4H8KA 3OYMA 4I2PA 4FLZA 5CZ2A 3VQCA 1NK5A 2Z1HA 4IFYA 1RT1A 3PUFA 4OKJA 3RMBA 3EY1A 3DLHA 1LWCA 3M8SA 4FJ5A 1O1WA 3PX6A 3V4IA 4C8NA 3K57A 4AHTA 4FM2A 4CCHA 4EP4A 4Z0UA 4BDPA 3SPYA 1KFDA 1XWLA 4OVLA 4CIFA 1RDAA 2KTQA 3OY9A 1N5YA 4HCBA 5EU7A 1J5OA 1NKBA 3ALYA 2EHGA 1B92A 4O0IA 3TABA 2B6AA 3O4NA 4B9TA 3EZ5A 3PX0A 1D8YA 3VQDA 4FJGA 1JLAA 4RW9A 3RRGA 4E7IA 1RBTA 4F2SA 3SQ1A 4Z4FA 1KLMA 1NOYA 1VSMA 2KW4A 3LAMA 3U3YA 3SQ0A 4DSIA 1HQEA 1ZYQA 4Z4IA 4JRPA 1TKTA 4KI6A 3KLFA 1WSIA 3OS0A 5HLFA 4WE1A 3TAMA 3NF6A 3SCXA 3OS2A 1HQUA 4UQGA 3P1GA 3TAFA 3TR8A 1VSDA 4O44A 4B08A 3NH1A 3SI6A 4BACA 4KV8A 4HHTA 3AVJA 2G8IA 4M42A 4J2EA 5E41A 3LP1A 3OYIA 1JLGA 1TAUA 2VWJA 1GOCA 3EYZA 4O55A 2XY5A 4DTXA 3ZSXA 4CF2A 3K2PA 1HYZA 4DU1A 1YTUA 4PY5A 2RPIA 4DFPA 1JL1A 1IKYA 5I3UA 4KTZA 3AO2A 4G1QA 3KD1E 3ZT4A 1JLQA 3V1QA 3ZSVA 1T8EA 1L3UA 4W5QA 3VQ4A 2DTUA 1RBRA 4M3XA 3AVFA 2YHBA 4M3RA 4RW8A 4KHNA 2FBTA 2PYJA 4FK2A 2XY8A 3S9HA 3P5JA 3T19A 4DU3A 1YT3A 3CM6A 2HW3A 4NCAA 5C24A 3VQ9A 3OYKA 1JLEA 4J2BA 4IDKA 2P51A 4DMNA 1BI4B 3DYAA 1VSFA 1SL1A 1ASWA 4NCBA 3AA3A 4CJWA 3HXMA 2G8HA 5CZ1A 4B9MA 4DTNA 1EXQA 1WSHA 3NF7A 4W5RA 3ZSWA 3LP0A 4AHRA 4BDYA 1QSLA 1JLBA 2E6LA 3DRRA 4FM1A 1JXEA 3C95A 1JLFA 3OYGA 4DS4A 1WLJA 1HJRA 4AH9A 4DG1A 3QIOA 4O5BA 2OYQA 3NF9A 1KFSA 3AO4A 3L3UA 5DMRA 3WNHA 3ZCMA 1UA0A 2HVIA 2YHAA 3PV8A 4CJTA 1WSGA 3ZT2A 4FVMA 4N47A 1C0TA 3VA0A 1L5UA 4F2RA 4F4KA 4FJ7A 4FLTA 3KKSA 3OYAA 4B9UA 1YVUA 1NJZA 4CEFA 2XO7A 4DS5A 3SUPA 1IKWA 4B9SA 2OA8A 3ZT0A 1S6QA 4EZ9A 4DQIA 3O3GA 2QKBA 1WN7A 3KKRA 3AVIA 4NYNA 3S3NA 3RMDA 4J2DA 1RTJA 3VQPA 2FBXA 4GMJB 4CGJA 1JXBA 3VQ6A 1VRTA 1A5VA 3QIPA 2W42A 3HO1A 4FJLA 3M8PA 2PZSA 1MU2A 1VK0A 2X6SA 1X9WA 4FYDA 3V9WA 4DTMA 1TGOA 5SWMA 4CF1A 1S1WA 3WNGA 4LSNA 3NGIA 4DSEA 3ISNC 1U47A 2ETJA 2RN2A 1L3SA 1WSFA 3NHGA 3AO5A 1HNIA 1GOAA 4OLAA 1QQCA 4HVJA 1T7PA 3FFIA 4DF8A 4I9LA 4CEBA 4FLYA 4CJ5A 4FM0A 4Q0BA 3KTQA 4F8RA 4RW6A 4ID5A 2FC0A 1HYSA 3V1OA 4LSLA 4CESA 3JSMA 4DSLA 2KZZA 3NDKA 5J2NA 3AVGA 4XIUA 5J2PA 1NK0A 4CGHA 3DRSA 2OPQA 4Z4EA 2DFEA 4CHNA 3HK2A 1RTHA 3NFAA 4KB0A 2HNYA 2OPSA 5KRTA 3DOLA 4PWDA 5JS2A 1UAXA 4B8AB 1X9SA 3UIQA 4NCGA 3BGRA 2EX3A 3SJJA 3CQ8A 1LV5A 2Z1JA 4M3WA 2JLEA 4OJRA 4CEOA 1S9EA 3IRXA 1VSLA 1QSYA 1HYVA 4CK2A 3RMAA 4I9QA 1SV5A 2HNZA 2IOCA 3L2VA 3KK3A 4IKFA 3AA2A 1VSEA 4FJ8A 4O4GA 3C6UA 3ZSQA 3V9XA 4EP5A 3O4QA 3NE6A 4I2QA 1T05A 3V9ZA 3T3FA 5CY4A 4CGFA 5SZTA 1ASVA 4HUGA 3KLHA 4TSXA 1T03A 1Q9YA 3MECA 1SL0A 2BDPA 4PA1A 4E7JA 1TKZA
chains in the Genus database with same CATH superfamily
4LFBK 3OHRA 5CYMA 1BCMA 1A5XA 5KPZA 3I55N 3V9UA 3QMLA 3AGRA 2HBJA 3CFOA 2OTLN 4M45A 1MWKA 1U45A 4CFBA 3ATUA 3LAKA 3WNEA 3DLRA 4MO5A 4RWTA 1G99A 2HF3A 3DLGA 1S3XA 2O8BB 4B8CA 5CYQA 4FWPA 4LC9B 3MXIA 3ULEA 4W5NA 5HL7L 4B9LA 2AA4A 3VGMA 2XHBA 3LWMA 4HTUA 1SAZA 3FFKB 2O8DB 1WOQA 2G8UA 4K8XA 4KTWA 3VMFB 4DV6K 4NXMK 2D1KA 2YHWA 1RT3A 1RTIA 4FJMA 4IXCA 5AQVA 4GKJK 3BUZB 1XUPO 4ILHA 3PIOL 1P8ZA 4QCLA 4JV5K 3CMAN 3LALA 4CZMA 3E9LA 3FZFA 5C15A 2CGKA 2VG7A 3VEYA 4M3ZA 1IBLK 4FZXC 2ZM6K 3DAWA 4CJQA 2YNGA 2HB5A 1TYQA 2IAJA 3AVBA 2FSJA 3VF2A 4YFUA 3RRHA 3DLKA 4ELUA 3FZLA 3VETA 1RDDA 3DJCA 1U04A 2D0AA 1K73O 1RDWX 2ASPA 3OTOK 4FW1A 5EY4A 3Q7BA 4WQ5A 3C65A 5E26A 4ID1A 2UUCK 4H5RA 2JWLA 3O1BA 1Z26A 3HZ6A 3IFRA 5AQHA 1VQ9N 5DM6L 5ADXA 4FW2A 4YOTA 4EZ6A 3KJVA 3V1RA 3SK3A 2NRWA 4IZ9A 4ZTJA 2YKNA 4F3OA 4GW6A 4M7XA 3N4QA 3ZYYX 3IS9A 1YJ9N 1GLAG 1VSIA 3IUCA 3WXIA 4IO8A 3DM2A 4IBNA 4BE1A 3AVNA 1U4BA 1XC9A 3E66A 1DLOA 2GUIA 3SYZA 4MFBA 3HBTA 3SNNA 4CIGA 1EKEA 4HWIA 4AM7A 5AQNA 3BZCA 4CE9A 4XEIA 1ZC6A 1IKVA 1HUXA 3TAEA 3ZSZA 1N8RO 1LW2A 1TUUA 3WQUA 1HX1A 4CBWA 3CCEN 3QESA 3N4PA 2HHVA 2NRHA 2ZJQL 3MDQA 1IO2A 3C6HA 3L2RA 3D45A 3CETA 1GOBA 2QWOA 3T1AA 1C0UA 3RSEA 1NK9A 2UUAK 4LF9K 3RWUA 4N41A 4RCHA 1K8AO 2VQFK 4E3SA 3A5LC 1SKSA 3QNOA 4DTRA 4JKFA 2V52B 4EHTA 3OJSA 4PQUA 4JNEA 3HPGA 1HNVA 1JJ2M 1VSHA 4DLGA 2X78A 3CCLN 4C8LA 3JYTA 2HHQA 3C7NB 1TV6A 3BZKA 1C1AA 3SAGA 3O9TA 4QOZB 3CCMN 3K5MA 3MCPA 2HVHA 3O08A 4JI2K 1W0HA 1L3VA 3OYLA 4CGGA 4YOXA 2IGIA 2QWMA 3KLGA 3P83D 2Y1JA 5J1EA 2FLOA 2HBLA 2F8TA 4OO1J 3NBPA 3EEQA 4FPBA 4BR4A 2E2QA 2R7YA 4KH6A 4BRAA 3B6PA 4DR5K 2D5RA 1B9FA 4WFNL 3PIPL 2F8SA 1X3NA 3VEWA 5BREA 4DQQA 1EQYA 1MA9B 2QW9A 4FJXA 3IG1A 3VGLA 2DPNA 2I7PA 3PLAA 3K0SA 4H4MA 3TAGA 4FK0A 3KIOA 4FWQA 3H46O 4CERA 3LWLA 2NRTA 2IVPA 1BCOA 4RW4A 1EETA 2X6NA 4BQLA 1FW6A 5KTQA 3L8BA 5KGWA 1C1BA 4E1JA 4IG3A 4EHUA 5F1XA 5I42A 4O0JA 4BDZA 3KHYA 4KHYA 1Q7YO 5BRHA 1C6VA 3TU5A 1S5JA 2HOEA 3S3MA 4B1YB 3VF4A 4MLHA 4E0DA 5AZJA 3F73A 2QM1A 3G10A 3DOKA 1HLUA 1HPMA 1X1PA 4NYFA 4FO0A 3CIPA 1Y97A 4JK8A 3OYMA 3EE9A 1NK5A 4IFYA 3GE1A 3V4IA 4IWVA 3R3LA 3K57A 4CCHA 3IMXA 4EP4A 4Z0UA 4MDAA 2ZJRL 1KFDA 1XWLA 4YDUA 1RDAA 1NNEA 5EU7A 1NKBA 3ALYA 4CZLA 2B6AA 3WT0A 4BG9A 4A5AA 4H5WA 3RRGA 2WTUA 5BRDA 4U7BA 4IOAL 4DV7K 2KW4A 4DSIA 1ZBSA 4JRPA 1WSIA 3OS2A 3TAFA 3NH1A 1VSDA 4O44A 4B08A 4CD1A 4HHTA 3AVJA 3EL2A 1J6ZA 4J2EA 4M42A 1MWMA 5E41A 1TAUA 2KLAA 2P9IB 5AQTA 4ISGA 1BU6O 3GDQA 2WFBA 4PY5A 3HTVA 1IKYA 5I3UA 4KTZA 1HNZK 1VQ4N 1L3UA 4H5VA 4W5QA 4BRHA 3FLCO 4M3XA 3T7ZA 2YHYA 4M3RA 2FBTA 5AR0A 2PYJA 2XY8A 2FF6A 5C0YA 3P38A 5C24A 3MN5A 2O8CA 2P51A 4BG8A 4B1XB 2ZWHA 4JKAA 5JVGL 5CZ1A 1C0FA 4IDHA 1WSHA 3NF7A 1NWKA 4AHRA 4JYAK 3ID6A 3OYGA 4DS4A 2W6LA 3NF9A 4JK7A 4YHHK 3AO4A 3WNHA 3ZCMA 4CJTA 4CI6A 3VA0A 1L5UA 2GX9A 4A2BA 3KKSA 2P9NB 1YVUA 5KPTA 5EVZA 2XO7A 4RTFD 3SUPA 1NGFA 5AQUA 3ZT0A 2P9UA 1VHXA 4LFCK 3ENOA 2ZF5O 4GMJB 4CGJA 3G25A 4BY9C 2W42A 3DWLA 3M8PA 2PZSA 5KPRA 5SWMA 1WBDA 2P9KA 3SAHA 2FXUA 5ADXH 3WXMB 4DV1K 3NHGA 1QQCA 1BOTO 5BPMA 3TTCA 2GELA 5F2RA 2KZZA 5AJ3K 4DR2K 1WBBA 3QICA 2HMPA 5J2PA 3MWTA 4Z4EA 2DFEA 3CI5A 1T6DA 4WQ4C 4B8AB 4DKWA 3BGRA 5GINA 3J7ZO 4M3WA 3IRXA 2W6KA 3RMAA 3UKRB 1NGHA 2BTFA 2HNZA 4IKFA 1X9JA 1Y64A 1D4XA 1BG3A 4I2QA 3ZETB 5CY4A 3MECA 3VQAA 3CCQN 4L8RB 5HRNA 3HPOA 3THVA 3ASMA 4LF4K 3WEEB 1ZXOA 2DFHA 3AVCA 4LY7A 1W2BM 1BUPA 3DLBA 1RT7A 4DF4A 2CH6A 2F7TA 1OH6A 1BI4A 1J9AA 4GY2B 1QE1A 4CHZA 4ZHRA 2ITGA 1ZBFA 3CJ9A 2I5JA 5AFUH 4KH5A 2P9LA 3M1FA 4CJFA 3G71N 4YORA 1K9MO 2P9PA 1KXPA 1ZBLA 1ZBHA 1QVFM 1SZ2A 1FK9A 4CJEA 3QEVA 3HP6A 3VN5A 5FRMA 1JCFA 1L3TA 4CFAA 3H3NO 3HVRA 5HP1A 3OYEA 4DFJA 2HHSA 3P4IA 4DTUA 4CGDA 3TARA 3LP3A 4U67L 2O8EB 3ZSOA 2IVOA 3W3DA 2Q36A 1QSSA 3WXKA 3E9OA 3CFRA 2HHWA 4PHTX 4G9ZA 5AQLA 1RFQA 1S1TA 4BRDA 1CZAN 1J53A 4M41A 1G15A 3DXMA 2UXCK 3SQ2A 4DV0K 3TAPA 3OS1A 3F5TA 4DQRA 1D9FA 1WAFA 2KKZA 2HMIA 3AO1A 4DSFA 1HRHA 3FZMA 4ICLA 1KVAA 3AVMA 3Q7CA 4FXDA 4NB4A 2NNWA 1VQ7N 4PKIA 1KVBA 3SUQA 1BQMA 3L3VA 3KK2A 3TI0A 4KPYA 1NJXA 4KHPK 5EXWA 3OJUA 5JLHA 1WSEA 5LY3A 4JS4A 3SMPA 4FWLA 1A5WA 4DLEA 4KHQA 4FWKA 3D2FA 3I0SA 4KRFA 4B1UB 1W97L 3U9DA 3SUOA 3CPWM 4KHWA 3NH2A 4F9OA 2P9SB 2E2OA 1CXUA 5FROA 5HRSA 3NCIA 4AHVA 5D3GA 1YF5L 3AVHA 5AQJA 3OYDA 4BE2A 1Q8IA 4E1MA 2GV9A 2RKIA 1DGKN 1Q18A 3OYBA 2HNDA 4J8FA 3VQ8A 2YHXA 2GWKA 2ATQA 3HPHA 4M3UA 3OBWA 2Q0UA 3MK6A 4OPHA 3WXJA 4BC3A 5AQPA 4FLUA 3HJFA 4OKEA 2QTDA 1QVGM 3HSCA 4RG8A 2QI2A 1X3MA 4AF1A 4KREA 4IFVA 1RCHA 3F9KA 4N56A 2OANA 5FPDA 4KKOA 3CERA 1HJOA 4DSKA 4AHSA 2O4GA 5AQYA 4WYBA 3O9SA 4JKCA 1WAJA 2ZGYA 1VSKA 4JKDA 3THWB 4EAHD 4BR0A 4ISEA 1IBMK 4MQ3A 1ATRA 5HBMA 1QQMA 3KVGA 2XY6A 4E7HA 4PUOA 3QNNA 3V81A 2E8AA 3LDLA 3HVTA 4IO9L 4CHQA 1K6YA 2D0CA 3SAFA 1NK6A 5LMUK 4BWMA 1VRUA 5DK5A 1JLCA 3VQ5A 3K9KA 5KQDA 4M3TA 2FBVA 2BUPA 3G6EN 2YJEA 1QTMA 2QKKA 3ENHA 2HSTA 5LL6Z 1T3VA 3OBYA 1LCUA 4JD2A 5BPLA 4DTSA 4DTOA 1XHXA 4YOWA 5HRPA 1Z6RA 5C25A 1WUAA 4K25A 3RTVA 4AHCA 3K59A 3AAPA 2ASMA 3VESA 2ASOA 1KQSM 4FJIA 4FJ9A 2YI1A 2ZE2A 1SS6A 4CZHA 4BRPA 4IFEA 3UE5A 4B9NA 2ZJPL 3CCVN 4JRQA 1Q86O 1VQLN 1I39A 1CLQA 1REVA 4F3TA 4I7FA 3SUNA 3DLEA 2QXFA 4JI0K 2E2NA 1KTQA 4QS8A 4Y1DA 1B9DA 1BIZA 1ZBIA 4FWMA 1OH8A 3AVAA 3HSTB 1ESVA 1RT5A 2VCPA 4FWSA 3CJ1A 4OGEA 3CD6N 3TPQA 1TL3A 2PAVA 3J81O 2VWKA 4R5PA 1FKOA 1BHLA 3SLCA 4AHUA 1R0AA 4BGBA 3ZLJA 4YNQA 4CEAA 3C94A 1RTDA 1KC8O 1SKRA 1RDCA 1BL3A 2RE2A 3QEIA 3QINA 1KLNA 4HUEA 5C12A 2KFZA 4FZZA 4DQSA 4YOUA 3DI6A 4YOYA 1V4TA 3SBTA 1LWFA 1X9MA 2HHTA 2YNHA 3LP2A 4KB1A 1JCGA 2QWNA 2PYLA 2FSKA 4YOVA 3AARA 2G8VA 2OPRA 4DV3K 2VQEK 3LDOA 4BRKA 1NLVA 1IBKK 4DHYA 3M3ZA 1RT1A 4OKJA 5I9EB 3M8SA 4FJ5A 3J7AP 4H0OA 5AQMA 4AHTA 4FM2A 3O9RA 3VF6A 4PKHA 5JMVA 2KTQA 3THYB 1QHAA 1N5YA 1J5OA 1B92A 3LL3A 3PX0A 4NXNK 1JLAA 2YJFA 1N32K 1U6ZA 4Z4FA 3L4QA 1YI2N 1VSMA 4I6MA 3O8MA 3IDHA 4GV3A 3PSFA 3KLFA 5HLFA 4WE1A 5AQIA 1HQUA 4UQGA 4BVOA 3TR8A 2A42A 4BACA 3FE1A 2G8IA 3D2EA 2O8FA 3OYIA 3ZEUA 2Q31A 1GOCA 4O55A 2XY5A 3K2PA 4DU1A 2RPIA 3KD1E 1JLQA 3ZSVA 1T8EA 3VQ4A 2AP1A 1RBRA 4CZJA 2YHBA 5HOOA 4RW8A 3S9HA 4H0XB 3WXLA 4BR2A 1H1VA 2A5XA 4J2BA 4IDKA 3H3OB 1VSFA 4JI7K 1GLDG 3AA3A 4FWRA 4B9MA 5H1SQ 5BN8A 4W5RA 3MMVA 2E6LA 1JXEA 3C95A 1KAXA 1WLJA 1HJRA 4JKGA 4DG1A 4O5BA 2OYQA 3L3UA 5DMRA 2HVIA 2NLXA 2YHAA 1RDUA 4KBOA 3DLLL 3ULEB 3CCUN 4DS5A 5F0XA 4NO7A 4B9SA 2QWRA 3I56N 4DQIA 3O3GA 1WN7A 3AVIA 4CW7B 3RMDA 5FPEA 4LF7K 2FBXA 1XC3A 1JXBA 1A5VA 3MN9A 4XH4A 3HO1A 4FYDA 1VK0A 1X9WA 3V9WA 4CZIA 3K9JA 4CF1A 3OW2M 3WNGA 4LSNA 4DSEA 4GKKK 3VEZA 3GOIA 4CZEA 1P90A 4HVJA 4DF8A 3VEVA 4CJ5A 4FM0A 4Q0BA 2UU9K 2D0PA 4B9QA 5AQFA 4LSLA 4DSLA 1GLLO 3NDKA 5J2NA 1GLJO 3A5OC 3UKUA 3U8XA 1NMNA 1RTHA 3HK2A 4KB0A 1YVNA 1TYQB 5KRTA 1T6CA 5JS2A 3CJBA 1YJWN 4NCGA 3SJJA 2EX3A 5FLXO 1XMQK 3ENBA 2Z1JA 1VSLA 4DR1K 1HYVA 4CK2A 2NRRA 4I9QA 3HRGA 3AA2A 4FJ8A 3ZX2A 1QZ5A 4OX9K 3O4QA 2FF3B 2E20A 2VGMA 4HUGA 1T03A 2F9WA 3S41A 5LJWA 2BDPA 5C10A 4O5FA 2YKMA 3VEOA 2PFUA 3R8EA 4ELTA 2HBKA 3CJAA 4FLVA 4BR7A 1TKDA 4FLXA 1YXQA 4JI4K 3AV9A 1VQON 4FVUA 4CZFA 1UOCA 3LM9A 3AO3A 4CJSA 3VA3A 5HRRA 3RMCA 4IJNA 5BR8K 1Q81O 2QK9A 1EP4A 4WFAL 3L2UA 3JXUA 4GNIA 3DMJA 3NVMA 3B8AX 4BC4A 2G8KA 1Z25A 1HKBA 4JK9A 1RBSA 3PSIA 1Q82O 2F96A 5C42A 3GL1A 3WQTA 5A2QO 1C0MA 2VYPA 1JKHA 3VENA 4CBXA 3VQBA 1BA1A 4IJAA 1CZBA 3RSEB 3EO3A 4H5TA 4C8KA 4JKHA 3CFPA 4K43A 1LWEA 4I6MB 3RR7A 2J4RA 4CJ3A 2HHXA 2Q1NA 1CXQA 2E4LA 4JHDA 3BF3A 3QETA 1TL1A 3E01A 3U6FA 4H0YB 4AILC 4CF8A 2Z1GA 2P1JA 2E88A 1NJIO 3I8BA 2BANA 2OZMA 4FLWA 1LW0A 2CGJA 1HKGA 3DXKA 1CZ9A 3BF1A 4Z4HA 3TSUA 3A5MC 4NLCA 3U3GA 2QXLA 4JKEA 4RW7A 2GBZA 5AQKA 5KGXA 4E7LA 5BPNA 1SUQA 4MDBA 1N34K 4JI6K 3A2FA 2Z1IA 3O9QA 5CE3A 5JVHL 3CHWA 3HL8A 4CFCA 4BRIA 4JS5A 3SBGA 4LFAK 2OCEA 3MXMA 3H08A 4CJRA 5JLFA 1NKCA 1ATNA 1ITGA 4CJ4A 3AVLA 4B9VA 1UA1A 2Y1IA 4Q5VA 2E6MA 2KFNA 1NOZA 2RHKA 1VQ8N 3HYFA 1NGBA 1OKJA 1QHTA 3QLHA 3T69A 4DB3A 4FJKA 2O8BA 2Q3SA 1V4SA 2XRIA 3QO9A 3HT3A 5FDLA 4N76A 3JAMO 3ZSYA 4CK3A 3AVKA 3KLEA 3CCRN 5AQRA 4BREA 2WUSA 3KZBA 1Q9XA 3VPZA 1KAYA 1KAZA 3TWHA 4DV4K 1KCFA 2W41A 5AZJB 4H4OA 4Z4CA 3K58A 5T7BA 2QEXN 1WSJA 4L3QA 4JKBA 3G4SN 3P39A 2JGUA 4CF0A 2B5JA 4WQ4A 3VOVA 4FJNA 3O1WA 1RBVA 2V51B 4M7YA 3AAQA 3HP9A 1NGAA 3SPZA 3PO5A 3ZSRA 3O80A 4PL7A 2A41A 1U49A 3SQ4A 5AQSA 3MXJA 1NJYA 4R79A 1BQNA 2X74A 1BISA 1EO1A 3DRPA 1IKXA 3TSPA 5M1NA 4Z4GA 3M8QA 3WNFA 3QB0A 5LJVA 5J2QA 2HHUA 3V9SA 4A59A 4DTJA 5FPMA 1SKWA 2H3GX 4BRLA 1M1KO 3C6TA 3M8RA 3J8AA 1DTQA 3NGZA 4CBUA 1RT4A 3CG7A 1U48A 3I8DA 1IH7A 4ZTFA 4LH4A 3VQEA 2A6AA 5M1FA 1I94K 1WNSA 3ZT1A 1XHZA 2O8CB 2NZTA 4ILJA 1D5AA 5M1QA 1BGXT 3CMEN 3AA5X 1GLEG 3OYJA 4BC2A 3ZT3A 3K5OA 4K41A 5GIPA 3MEDA 3NVKA 2IS3A 3ULDA 2CGLA 2IDOA 3AA4A 4DR4K 3SV4A 4ELVA 2PY5A 1YITN 4OPKA 3K5LA 5J2MA 3CC2N 4FWNA 4QS9A 3NAEA 3NF8A 1S6PA 4DR6K 1FJGK 4CECA 2VG6A 1S9GA 3LPUA 2G8WA 3CYMA 4JEPA 2WOMA 1VQPN 2P9UB 4CJKA 4DQPA 4E7KA 1SQKA 4BROA 1KVCA 5HROA 2A1SA 3DXKB 3J7YP 4BR9A 5GAGP 3V6DA 3MCAB 4I2PA 4FLZA 5CZ2A 2Z1HA 5IWAK 2P9KB 3PUFA 3H1VX 3DLHA 3EY1A 1LWCA 5BR9A 1O1WA 4C8NA 4BDPA 4OVLA 5LMNK 4CIFA 2EHGA 3C7NA 4B9TA 5AQGA 1YIJN 3EZ5A 3VTHA 4FPAA 4RW9A 1XQSC 1EWQA 4F2SA 1TUYA 1KLMA 1MDUB 3LAMA 4DR3K 3U3YA 3SQ0A 4Z4IA 1YHQN 4KI6A 5KQ8A 3TAMA 3SCXA 3NF6A 4JI5K 3P1GA 3SI6A 1N36K 4V19S 4FL9A 4LF6K 4H0VB 3LP1A 1JLGA 5EX5A 2VWJA 3EYZA 5M1OA 3ZX0A 2YCHA 3ZSXA 1IV0A 1HYZA 1K8KA 1YTUA 3MN7A 4WQ5C 1E3MA 1OH7A 4BGAA 3ZT4A 3HOTA 3V1QA 2DTUA 2WBNA 3AGKA 4JN4A 4BRNA 4H03B 3P5JA 3T19A 3FZHA 4DU3A 3ATVA 3VQ9A 4BQZA 2NRVA 4X66K 1BI4B 3DYAA 5GIOA 4NCBA 2F4VK 4WFBL 4IEEA 2VWBA 3ZSWA 1QSLA 4BDYA 3QDKA 1JLBA 3DRRA 5GAHP 4FM1A 2P9LB 1DEJA 1KFSA 3EKSA 1UA0A 2P9PB 3PV8A 1WSGA 3ZT2A 4FVMA 4BRFA 4FJ7A 2EWSA 4B9UA 4BVPA 3VERA 1IKWA 2OA8A 4BR5A 1S6QA 1QQNA 1N33K 3M6GA 4Y0WA 5CHIA 4J2DA 3W0LA 1VRTA 3QIPA 5TKWA 3THXA 2X6SA 4X65K 3TSQA 4A2AA 4GVEA 2ITMA 5E84A 1NGJA 1LOTB 2ETJA 2RN2A 3O6WA 4QS7A 1L3SA 5M1KA 3T1YK 3AO5A 4OLAA 2Q97A 4I9LA 3DXMB 3HM8A 4FLYA 3KTQA 4F8RA 5BN9A 4CESA 3JSMA 2ZGZA 3AVGA 4XIUA 4FOIA 3DRSA 2OPQA 1DT9A 2HNYA 2OPSA 1JCEA 3DOLA 4ILGB 3T1HK 1UAXA 4B3MK 2HBMA 1LV5A 2JLEA 4CEOA 1GLBG 3HI0A 1BO5O 1QSYA 3L2VA 3EN9A 3KK3A 1VSEA 3CQXA 3V9XA 1NGDA 3C6UA 3NE6A 2UYTA 4CGFA 2NRXA 3GBTA 2P9IA 3KLHA 5ELZA 1SL0A 3D2FB 3LDPA 4CD3A 4E7JA 4DFKA 3CC4N 3J80O 1NGEA 5B8HA 5C2FA 2FSNA 4OPJA 3PO4A 3CC7N 4KO0A 3QEWA 1YUWA 4JLHA 1RT6A 4CJUA 3TTDA 1NG9A 4CEDA 3RVCA 4XH5A 1BA0A 1NM1A 5KRSA 1FKPA 1NK7A 3QEXA 3CXCM 1RDBA 3FR0A 1N6QA 3ZX3A 1U2VA 5KI6A 4PL8A 2HHHK 2P5OA 1HMVA 4CF9A 5CR4A 2P5GA 3OYCA 1ASUA 2D0BA 2KZMA 3E1YA 5TKYA 2ZQBA 3B6OA 1IG8A 5JICA 2DY4A 3FGUA 4CHOA 1YAGA 3S3OA 3QFUA 2LSNA 2P9NA 4CEQA 5AFUA 2VGNA 3LDNA 4W5TA 1DTTA 2IVNA 1RNHA 1XNQK 4DV2K 1NK4A 3I0RA 3R9PA 4DFMA 1ZBUA 3MEGA 3CPEA 1ATSA 4CJLA 1NJWA 4KFBA 1S1VA 1S22A 3GG4A 1W9HA 3L4IA 3K5NA 4FZYA 3U9ZA 1FXXA 1HPZA 4CIEA 3P31A 1TK5A 4NLBA 4KAZA 3KK7A 1HNXK 1D9DA 4CVNE 4CZGA 4B1WB 3QFPA 2QWQA 4E1NA 4FJJA 1K8KB 3NGYA 1OH5A 1TK0A 1S1XA 4CEZA 2A40A 4YDUC 1S72N 4E19A 4JD2B 3H45C 1LAVA 2NRZA 3MX5A 3UKRA 3M5RA 2NUBA 4MLEA 4C23A 4DR7K 3L2WA 2D4WA 2E1ZA 5JS1A 4EFHA 4H0PA 3ZETA 4KH4A 3VQQA 1NK8A 4CJVA 3BP8A 4YY3K 4IEIA 1RT2A 2YNFA 4DSJA 2IIRA 3PY8A 5AZIA 1YJNN 2HF4A 4X62K 3OVNA 3WEEA 1VQ5N 2OTJN 1T44A 2IC3A 3O3HA 4KHUA 2V7ZA 1NBWA 3L0QA 3MAQA 2GTDA 4GV6A 2FBYA 3QERA 4JI8K 4Y1CA 1DKGD 5M1PA 3EKUA 1NGCA 3TTFA 1NKEA 1VQMN 1KSPA 3U4LA 4C8OA 4N5SA 2RF2A 1C1CA 3VQ7A 3THXB 1VQ6N 3VGKA 4HTLA 4W5OA 3KK1A 1QS4A 1J54A 3BEXA 3SV3A 4IG0A 1BWFO 4WF9L 2G8FA 2DFFA 3F9MA 4HCCA 3A8YA 4QAGA 1VAZA 3MEEA 3SZ2A 3BDPA 4GVMA 4B3TK 3OYFA 2O8EA 2OPPA 4OGCA 1TAQA 5AQXA 3CM5A 4CFDA 3LANA 2B4JA 5K14A 3OYHA 4IOXA 4CGIA 3CQYA 2BE2A 1JL2A 4KI4A 5BRFA 4O8UA 3A5NC 3KWIA 2YNIA 1E4GT 2Q2RA 2KQ2A 4BRGA 1LAWA 3HOSA 1F21A 1UWBA 4ISFA 4CJPA 3R6MA 3O3FA 4FSVA 3H6EA 4O8KA 1KRPA 4PKGA 3IAYA 1NMDA 4KTQA 4M3YA 2BGGA 3OYNA 2D0OA 3RR8A 3A0IX 4HUFA 2GWJA 1O13A 4DTPA 4DUYK 4C8MA 3TAQA 3MX2A 5FPNA 4CHPA 2E2PA 3D0PA 1BDGA 4DWIA 3G0ZA 4LH5A 4LD0A 5MLCQ 2QA4N 4H5NA 3TANA 3VTIA 3LZJA 3QBWA 3CCSN 1RBUA 4J2AA 1RILA 2Q0RA 3LZIA 1J5EK 4CK1A 1YTAA 1U2VB 3D2EB 2O8FB 4FJHA 3F2KA 4AM6A 3ZEUB 1TKZA 3MN6A 4K0KK 1TKXA 3I33A 5AQWA 2P9SA 1WB9A 4FK4A 4OKKA 3HM9A 4CHYA 4K8ZA 3FZKA 2BH1A 1HNWK 1I3AA 4EIAA 2KHOA 4MO4A 4CEEA 4BWJA 1TK8A 3R1XA 2QWPA 3KLIA 1SL2A 2OZSA 3UB5A 1ILYA 4IOCL 2ZD1A 2WONA 4C1NK 5GADP 4B1VA 4B1ZA 3QEPA 4XH1A 4KHSA 1VSJA 2A3ZA 3C0BA 5AQZA 4E89A 5GAEP 1NGIA 3LPTA 3LDSA 4BE0A 4JKGB 2O4IA 1XI1A 5EOYA 2XY7A 3L2QA 3ITHA 5FRNA 2AJQA 3PX4A 1IG9A 2A1RA 4DU4A 4OLBA 2UUBK 4OPAA 4A5BA 2VG5A 4B3OA 1XMOK 2GEMA 3NH0A 1TVRA 4FCYA 4K42A 3THWA 3SMSA 4DCHA 1BIUA 2YV0X 1VQKN 3KD5E 1S1UA 4H8KA 3VQCA 4Z94A 4A61A 3RMBA 5C2DA 3PX6A 1M90O 3SPYA 1OVYA 3OY9A 5IT9O 4HCBA 4O0IA 3TABA 3O4NA 1D8YA 4FJGA 3VQDA 2JWKA 2O8DA 3VEXA 3UKUB 4E7IA 1RBTA 2I7NA 5AZIB 3SQ1A 1RGIA 3D6RA 2F9TA 4WCEL 1NOYA 1C0GA 5AQQA 1KD1O 4CJ7A 1HQEA 1ZYQA 3CJ7A 1TKTA 4LF5K 3OS0A 4CZKA 2UXDK 5AQOA 1OVQA 4KV8A 3O9UA 3O5BA 4A62A 4DTXA 4CF2A 2WC9A 3L6QA 3CF5L 4GV9A 4DFPA 1EWRA 1JL1A 4B3RK 3EZWA 3AO2A 3H1QA 4G1QA 4A57A 3CCJN 3AVFA 3OA9A 3QBXA 1QZ6A 3E9PA 4FOEA 4KHNA 2YX6A 4FK2A 1HR0K 1YT3A 1NU0A 3CM6A 2HW3A 4NCAA 3OYKA 4JI3K 1JLEA 1W7AA 4DMNA 1SL1A 1ASWA 4DUZK 3IKMA 4M63C 4CJWA 3HXMA 2G8HA 4FWOA 4DTNA 1EXQA 4X64K 3LP0A 4B3SK 1JLFA 4AH9A 3QIOA 3LDQA 4N47A 1C0TA 4C1NI 1QQOA 4F2RA 4F4KA 2QWLA 4FLTA 1VQNN 4H0TB 3OYAA 1NJZA 4CEFA 1Z05A 2CH5A 2V7YA 4EZ9A 3LM2A 3WUHA 2QKBA 3KKRA 4NYNA 3S3NA 4BRCA 4UY8O 1RTJA 3VQPA 2E1YA 4DQ8A 3VQ6A 2E5LK 4FJLA 1IJJA 1MU2A 4JI1K 4DTMA 1TGOA 3MWPA 1S1WA 3NGIA 3ISNC 1U47A 1E4FT 3C6AA 1WSFA 4BC5A 1HNIA 1GOAA 4BRMA 1GLFO 4JHDB 1T7PA 1XNRK 3FFIA 1GLCG 1NGGA 2GUPA 4CEBA 4BRQA 3THYA 3O4WA 2UXBK 4RW6A 4ID5A 3ID8A 2FC0A 3KWGA 1HYSA 4LF8K 3V1OA 1NK0A 4CGHA 4CHNA 4DV5K 3NFAA 4PWDA 1X9SA 3UIQA 5DM7L 3CQ8A 4OJRA 1S9EA 1HKCA 1SV5A 2IOCA 2W40A 3BY5A 2PBDA 4O4GA 3ZSQA 4AQYK 3JS6A 3AY9A 3CJCA 4EP5A 1T05A 3V9ZA 3T3FA 5SZTA 4JAXA 1ASVA 3D7EO 4TSXA 1Q9YA 3SJHA 3NMUA 1R59O 4PA1A 3EE8A 1EX4A
chains in the Genus database with same CATH topology
3VQAA 4L8RB 5HRNA 2YKMA 4ELTA 5CYMA 3HPOA 3THVA 1BCMA 1A5XA 4FLVA 3ASMA 3V9UA 4OPJA 3PO4A 1TKDA 2DFHA 4KO0A 3QEWA 4JLHA 3AVCA 4FLXA 4B9VA 3CFOA 1RT6A 4LY7A 4CJUA 3AV9A 4M45A 1U45A 1UOCA 3AO3A 4CJSA 4CFBA 3DLBA 4CEDA 1RT7A 3LAKA 4DF4A 3WNEA 3DLRA 1BI4A 5KRSA 1FKPA 1NK7A 3QEXA 1J9AA 1RDBA 1N6QA 3VA3A 5HRRA 5KI6A 1QE1A 4CHZA 4ZHRA 3RMCA 2ITGA 2QK9A 1EP4A 1ZBFA 1HMVA 2I5JA 2P5OA 4CF9A 2P5GA 3L2UA 3OYCA 1ASUA 2D0BA 4CJFA 2KZMA 3DLGA 3DMJA 2ZQBA 3B6OA 2DY4A 4CHOA 4B8CA 5CYQA 1ZBLA 1ZBHA 3MXIA 2G8KA 3S3OA 1Z25A 2LSNA 4W5NA 1FK9A 4CJEA 3QEVA 4B9LA 4CEQA 1RBSA 2F96A 5C42A 3HP6A 3VN5A 4W5TA 5FRMA 1L3TA 4CFAA 1DTTA 1RNHA 1C0MA 3HVRA 5HP1A 2XHBA 1NK4A 1JKHA 3I0RA 3OYEA 4DFJA 3LWMA 4DFMA 2HHSA 3VQBA 4HTUA 4DTUA 4CGDA 1CZBA 1ZBUA 3TARA 3LP3A 3MEGA 3ZSOA 4CJLA 2G8UA 4K8XA 4C8KA 3CFPA 1NJWA 1QSSA 4KFBA 4KTWA 1S1VA 1LWEA 3CFRA 2HHWA 1RT3A 3RR7A 1RTIA 1W9HA 3K5NA 4FZYA 4CJ3A 4FJMA 1S1TA 2HHXA 1CXQA 1FXXA 2E4LA 1HPZA 3QETA 1J53A 1TL1A 4M41A 1G15A 3E01A 3U6FA 3SQ2A 4CIEA 4AILC 4QCLA 4CF8A 1TK5A 2Z1GA 2P1JA 3TAPA 3OS1A 4KAZA 2BANA 3LALA 4DQRA 1D9FA 1WAFA 2VG7A 1D9DA 2HMIA 2OZMA 3AO1A 4M3ZA 4FLWA 4FZXC 4DSFA 3SPZA 1LW0A 4CJQA 1HRHA 2YNGA 4E1NA 4FJJA 2HB5A 2IAJA 4ICLA 1KVAA 3AVBA 3AVMA 3NGYA 1CZ9A 4YFUA 4FXDA 1TK0A 1S1XA 3RRHA 3DLKA 4CEZA 4Z4HA 4E19A 4ELUA 1KVBA 3SUQA 1RDDA 1BQMA 1LAVA 3U3GA 3L3VA 1U04A 2D0AA 3KK2A 4RW7A 2NUBA 3TI0A 4KPYA 1NJXA 2GBZA 3OJUA 4FW1A 1WSEA 4JS4A 3L2WA 4ID1A 5JS1A 5KGXA 4E7LA 1A5WA 4DLEA 4KHQA 3VQQA 1Z26A 1SUQA 3I0SA 4KRFA 1NK8A 3A2FA 2Z1IA 4CJVA 1EX4A 3SUOA 4FW2A 4EZ6A 1RT2A 4KHWA 3NH2A 3KJVA 2YNFA 4DSJA 3V1RA 3HL8A 4CFCA 3PY8A 1CXUA 5FROA 5HRSA 3NCIA 4JS5A 4AHVA 3OVNA 4ZTJA 3MXMA 2YKNA 2IC3A 3O3HA 5D3GA 4F3OA 4GW6A 3AVHA 3H08A 4CJRA 4KHUA 3OYDA 4BE2A 1NKCA 1Q8IA 3IS9A 4E1MA 2GV9A 1ITGA 3MAQA 4CJ4A 2RKIA 1VSIA 3AVLA 2HNDA 2FBYA 3OYBA 1UA1A 3DM2A 4IBNA 4BE1A 3QERA 4Y1CA 3AVNA 3VQ8A 2Y1IA 1XC9A 1U4BA 1NKEA 1KSPA 4Q5VA 2E6MA 2KFNA 2ATQA 1DLOA 3HPHA 1NOZA 2GUIA 4N5SA 4C8OA 2RF2A 4M3UA 3SYZA 3HYFA 4MFBA 3QLHA 1C1CA 1QHTA 3SNNA 3VQ7A 4FJKA 2Q3SA 4CIGA 1EKEA 2XRIA 3QO9A 4FLUA 4OKEA 3HT3A 3HJFA 4CE9A 5FDLA 4RG8A 4N76A 4W5OA 1IKVA 3TAEA 4KREA 3KK1A 1QS4A 3ZSZA 3ZSYA 1LW2A 1J54A 4CK3A 4IFVA 1RCHA 3F9KA 4N56A 3QESA 2HHVA 3AVKA 3SV3A 4IG0A 1IO2A 3KLEA 3L2RA 3D45A 4KKOA 4DSKA 4AHSA 2G8FA 2DFFA 1GOBA 2O4GA 4HCCA 1Q9XA 4QAGA 3MEEA 3SZ2A 3T1AA 3BDPA 4GVMA 1C0UA 3TWHA 3OYFA 2OPPA 4OGCA 1KCFA 4H4OA 1NK9A 4Z4CA 1WAJA 3K58A 1TAQA 5T7BA 3RWUA 3CM5A 1VSKA 4CFDA 4N41A 2HHQA 3LANA 4E3SA 2B4JA 5K14A 3OYHA 1SKSA 4CGIA 4MQ3A 3QNOA 2BE2A 5HBMA 1JL2A 4DTRA 4KI4A 1WSJA 2YNIA 2XY6A 4E7HA 4PUOA 3QNNA 3V81A 3OJSA 4PQUA 3HVTA 4CHQA 1K6YA 2KQ2A 3HPGA 2JGUA 1LAWA 2B5JA 4CF0A 2D0CA 4FJNA 1NK6A 1HNVA 1RBVA 1VSHA 1F21A 3HP9A 4DLGA 1UWBA 2X78A 4BWMA 1VRUA 5DK5A 3ZSRA 4CJPA 3O3FA 1JLCA 3VQ5A 3JYTA 1KRPA 4C8LA 3IAYA 4M3YA 4KTQA 2BGGA 4M3TA 1TV6A 1C1AA 2FBVA 3OYNA 4QOZB 3RR8A 1U49A 4HUFA 3SQ4A 3MXJA 1NJYA 1QTMA 2QKKA 1BQNA 2X74A 1BISA 3K5MA 4DTPA 3DRPA 2HVHA 4C8MA 1IKXA 4DTSA 3TAQA 4DTOA 1XHXA 4CHPA 3D0PA 5HRPA 4DWIA 1W0HA 3G0ZA 4Z4GA 1L3VA 5C25A 3M8QA 4LH5A 4LD0A 4DFKA 2HHUA 3WNFA 3OYLA 4CGGA 2IGIA 3KLGA 3P83D 3TANA 3LZJA 1RBUA 5J2QA 2Y1JA 3RTVA 3V9SA 4J2AA 4DTJA 1RILA 3LZIA 4AHCA 3K59A 5J1EA 4FJIA 4CK1A 1YTAA 4FJ9A 2F8TA 4FJHA 1SKWA 3NBPA 2ZE2A 2R7YA 1TKXA 3C6TA 4B9NA 4FK4A 4JRQA 4OKKA 3M8RA 3B6PA 3HM9A 1I39A 4CHYA 2D5RA 1CLQA 1REVA 1B9FA 4K8ZA 4F3TA 4I7FA 2F8SA 1DTQA 3SUNA 3DLEA 3NGZA 2QXFA 4DQQA 1KTQA 4Y1DA 1B9DA 1BIZA 1I3AA 1RT4A 1ZBIA 3CG7A 3IG1A 4FJXA 1U48A 3I8DA 1IH7A 3AVAA 3HSTB 4ZTFA 4CEEA 4LH4A 4BWJA 1TK8A 4H4MA 3VQEA 1RT5A 3KLIA 3TAGA 1SL2A 2OZSA 4FK0A 3KIOA 1WNSA 4OGEA 2ZD1A 3ZT1A 2WONA 4CERA 3LWLA 1XHZA 1D5AA 1TL3A 1BGXT 3AA5X 3QEPA 3OYJA 1BCOA 4RW4A 1EETA 2X6NA 2VWKA 3K5OA 1FKOA 1VSJA 3MEDA 3ZT3A 4R5PA 1BHLA 4AHUA 3PO5A 4KHSA 2IS3A 5KTQA 4E89A 3L8BA 3ULDA 5KGWA 1R0AA 1C1BA 2IDOA 3AA4A 3LPTA 4IG3A 3LDSA 5I42A 4YNQA 4BE0A 4CEAA 3SV4A 3C94A 2PY5A 4ELVA 4O0JA 1RTDA 4OPKA 3K5LA 5J2MA 1SKRA 1RDCA 4BDZA 4KHYA 2O4IA 1XI1A 1BL3A 3NAEA 3NF8A 1S6PA 3QINA 3QEIA 1KLNA 1C6VA 4CECA 4HUEA 2XY7A 2KFZA 3L2QA 3ITHA 5FRNA 2VG6A 2AJQA 3PX4A 1S5JA 4FZZA 1S9GA 1IG9A 4DQSA 2A1RA 3S3MA 3DI6A 3LPUA 4DU4A 2G8WA 4OLBA 3CYMA 2WOMA 1LWFA 2VG5A 4CJKA 4E0DA 4B3OA 1X9MA 2HHTA 2YNHA 3LP2A 4DQPA 3F73A 4KB1A 3G10A 3NH0A 4E7KA 2PYLA 1TVRA 1KVCA 3DOKA 4FCYA 1X1PA 2A1SA 5HROA 2G8VA 4NYFA 1BIUA 2YV0X 3V6DA 2OPRA 3KD5E 1S1UA 1Y97A 4H8KA 3OYMA 4I2PA 4FLZA 5CZ2A 3VQCA 1NK5A 2Z1HA 4IFYA 1RT1A 3PUFA 4OKJA 3RMBA 3EY1A 3DLHA 1LWCA 3M8SA 4FJ5A 1O1WA 3PX6A 3V4IA 4C8NA 3K57A 4AHTA 4FM2A 4CCHA 4EP4A 4Z0UA 4BDPA 3SPYA 1KFDA 1XWLA 4OVLA 4CIFA 1RDAA 2KTQA 3OY9A 1N5YA 4HCBA 5EU7A 1J5OA 1NKBA 3ALYA 2EHGA 1B92A 4O0IA 3TABA 2B6AA 3O4NA 4B9TA 3EZ5A 3PX0A 1D8YA 3VQDA 4FJGA 1JLAA 4RW9A 3RRGA 4E7IA 1RBTA 4F2SA 3SQ1A 4Z4FA 1KLMA 1NOYA 1VSMA 2KW4A 3LAMA 3U3YA 3SQ0A 4DSIA 1HQEA 1ZYQA 4Z4IA 4JRPA 1TKTA 4KI6A 3KLFA 1WSIA 3OS0A 5HLFA 4WE1A 3TAMA 3NF6A 3SCXA 3OS2A 1HQUA 4UQGA 3P1GA 3TAFA 3TR8A 1VSDA 4O44A 4B08A 3NH1A 3SI6A 4BACA 4KV8A 4HHTA 3AVJA 2G8IA 4M42A 4J2EA 5E41A 3LP1A 3OYIA 1JLGA 1TAUA 2VWJA 1GOCA 3EYZA 4O55A 2XY5A 4DTXA 3ZSXA 4CF2A 3K2PA 1HYZA 4DU1A 1YTUA 4PY5A 2RPIA 4DFPA 1JL1A 1IKYA 5I3UA 4KTZA 3AO2A 4G1QA 3KD1E 3ZT4A 1JLQA 3V1QA 3ZSVA 1T8EA 1L3UA 4W5QA 3VQ4A 2DTUA 1RBRA 4M3XA 3AVFA 2YHBA 4M3RA 4RW8A 4KHNA 2FBTA 2PYJA 4FK2A 2XY8A 3S9HA 3P5JA 3T19A 4DU3A 1YT3A 3CM6A 2HW3A 4NCAA 5C24A 3VQ9A 3OYKA 1JLEA 4J2BA 4IDKA 2P51A 4DMNA 1BI4B 3DYAA 1VSFA 1SL1A 1ASWA 4NCBA 3AA3A 4CJWA 3HXMA 2G8HA 5CZ1A 4B9MA 4DTNA 1EXQA 1WSHA 3NF7A 4W5RA 3ZSWA 3LP0A 4AHRA 4BDYA 1QSLA 1JLBA 2E6LA 3DRRA 4FM1A 1JXEA 3C95A 1JLFA 3OYGA 4DS4A 1WLJA 1HJRA 4AH9A 4DG1A 3QIOA 4O5BA 2OYQA 3NF9A 1KFSA 3AO4A 3L3UA 5DMRA 3WNHA 3ZCMA 1UA0A 2HVIA 2YHAA 3PV8A 4CJTA 1WSGA 3ZT2A 4FVMA 4N47A 1C0TA 3VA0A 1L5UA 4F2RA 4F4KA 4FJ7A 4FLTA 3KKSA 3OYAA 4B9UA 1YVUA 1NJZA 4CEFA 2XO7A 4DS5A 3SUPA 1IKWA 4B9SA 2OA8A 3ZT0A 1S6QA 4EZ9A 4DQIA 3O3GA 2QKBA 1WN7A 3KKRA 3AVIA 4NYNA 3S3NA 3RMDA 4J2DA 1RTJA 3VQPA 2FBXA 4GMJB 4CGJA 1JXBA 3VQ6A 1VRTA 1A5VA 3QIPA 2W42A 3HO1A 4FJLA 3M8PA 2PZSA 1MU2A 1VK0A 2X6SA 1X9WA 4FYDA 3V9WA 4DTMA 1TGOA 5SWMA 4CF1A 1S1WA 3WNGA 4LSNA 3NGIA 4DSEA 3ISNC 1U47A 2ETJA 2RN2A 1L3SA 1WSFA 3NHGA 3AO5A 1HNIA 1GOAA 4OLAA 1QQCA 4HVJA 1T7PA 3FFIA 4DF8A 4I9LA 4CEBA 4FLYA 4CJ5A 4FM0A 4Q0BA 3KTQA 4F8RA 4RW6A 4ID5A 2FC0A 1HYSA 3V1OA 4LSLA 4CESA 3JSMA 4DSLA 2KZZA 3NDKA 5J2NA 3AVGA 4XIUA 5J2PA 1NK0A 4CGHA 3DRSA 2OPQA 4Z4EA 2DFEA 4CHNA 3HK2A 1RTHA 3NFAA 4KB0A 2HNYA 2OPSA 5KRTA 3DOLA 4PWDA 5JS2A 1UAXA 4B8AB 1X9SA 3UIQA 4NCGA 3BGRA 2EX3A 3SJJA 3CQ8A 1LV5A 2Z1JA 4M3WA 2JLEA 4OJRA 4CEOA 1S9EA 3IRXA 1VSLA 1QSYA 1HYVA 4CK2A 3RMAA 4I9QA 1SV5A 2HNZA 2IOCA 3L2VA 3KK3A 4IKFA 3AA2A 1VSEA 4FJ8A 4O4GA 3C6UA 3ZSQA 3V9XA 4EP5A 3O4QA 3NE6A 4I2QA 1T05A 3V9ZA 3T3FA 5CY4A 4CGFA 5SZTA 1ASVA 4HUGA 3KLHA 4TSXA 1T03A 1Q9YA 3MECA 1SL0A 2BDPA 4PA1A 4E7JA 1TKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQA A;  4L8R B;  5HRN A;  2YKM A;  4ELT A;  5CYM A;  3HPO A;  3THV A;  1BCM A;  1A5X A;  4FLV A;  3ASM A;  3V9U A;  4OPJ A;  3PO4 A;  1TKD A;  2DFH A;  4KO0 A;  3QEW A;  4JLH A;  3AVC A;  4FLX A;  4B9V A;  3CFO A;  1RT6 A;  4LY7 A;  4CJU A;  3AV9 A;  4M45 A;  1U45 A;  1UOC A;  3AO3 A;  4CJS A;  4CFB A;  3DLB A;  4CED A;  1RT7 A;  3LAK A;  4DF4 A;  3WNE A;  3DLR A;  1BI4 A;  5KRS A;  1FKP A;  1NK7 A;  3QEX A;  1J9A A;  1RDB A;  1N6Q A;  3VA3 A;  5HRR A;  5KI6 A;  1QE1 A;  4CHZ A;  4ZHR A;  3RMC A;  2ITG A;  2QK9 A;  1EP4 A;  1ZBF A;  1HMV A;  2I5J A;  2P5O A;  4CF9 A;  2P5G A;  3L2U A;  3OYC A;  1ASU A;  2D0B A;  4CJF A;  2KZM A;  3DLG A;  3DMJ A;  2ZQB A;  3B6O A;  2DY4 A;  4CHO A;  4B8C A;  5CYQ A;  1ZBL A;  1ZBH A;  3MXI A;  2G8K A;  3S3O A;  1Z25 A;  2LSN A;  4W5N A;  1FK9 A;  4CJE A;  3QEV A;  4B9L A;  4CEQ A;  1RBS A;  2F96 A;  5C42 A;  3HP6 A;  3VN5 A;  4W5T A;  5FRM A;  1L3T A;  4CFA A;  1DTT A;  1RNH A;  1C0M A;  3HVR A;  5HP1 A;  2XHB A;  1NK4 A;  1JKH A;  3I0R A;  3OYE A;  4DFJ A;  3LWM A;  4DFM A;  2HHS A;  3VQB A;  4HTU A;  4DTU A;  4CGD A;  1CZB A;  1ZBU A;  3TAR A;  3LP3 A;  3MEG A;  3ZSO A;  4CJL A;  2G8U A;  4K8X A;  4C8K A;  3CFP A;  1NJW A;  1QSS A;  4KFB A;  4KTW A;  1S1V A;  1LWE A;  3CFR A;  2HHW A;  1RT3 A;  3RR7 A;  1RTI A;  1W9H A;  3K5N A;  4FZY A;  4CJ3 A;  4FJM A;  1S1T A;  2HHX A;  1CXQ A;  1FXX A;  2E4L A;  1HPZ A;  3QET A;  1J53 A;  1TL1 A;  4M41 A;  1G15 A;  3E01 A;  3U6F A;  3SQ2 A;  4CIE A;  4AIL C;  4QCL A;  4CF8 A;  1TK5 A;  2Z1G A;  2P1J A;  3TAP A;  3OS1 A;  4KAZ A;  2BAN A;  3LAL A;  4DQR A;  1D9F A;  1WAF A;  2VG7 A;  1D9D A;  2HMI A;  2OZM A;  3AO1 A;  4M3Z A;  4FLW A;  4FZX C;  4DSF A;  3SPZ A;  1LW0 A;  4CJQ A;  1HRH A;  2YNG A;  4E1N A;  4FJJ A;  2HB5 A;  2IAJ A;  4ICL A;  1KVA A;  3AVB A;  3AVM A;  3NGY A;  1CZ9 A;  4YFU A;  4FXD A;  1TK0 A;  1S1X A;  3RRH A;  3DLK A;  4CEZ A;  4Z4H A;  4E19 A;  4ELU A;  1KVB A;  3SUQ A;  1RDD A;  1BQM A;  1LAV A;  3U3G A;  3L3V A;  1U04 A;  2D0A A;  3KK2 A;  4RW7 A;  2NUB A;  3TI0 A;  4KPY A;  1NJX A;  2GBZ A;  3OJU A;  4FW1 A;  1WSE A;  4JS4 A;  3L2W A;  4ID1 A;  5JS1 A;  5KGX A;  4E7L A;  1A5W A;  4DLE A;  4KHQ A;  3VQQ A;  1Z26 A;  1SUQ A;  3I0S A;  4KRF A;  1NK8 A;  3A2F A;  2Z1I A;  4CJV A;  1EX4 A;  3SUO A;  4FW2 A;  4EZ6 A;  1RT2 A;  4KHW A;  3NH2 A;  3KJV A;  2YNF A;  4DSJ A;  3V1R A;  3HL8 A;  4CFC A;  3PY8 A;  1CXU A;  5FRO A;  5HRS A;  3NCI A;  4JS5 A;  4AHV A;  3OVN A;  4ZTJ A;  3MXM A;  2YKN A;  2IC3 A;  3O3H A;  5D3G A;  4F3O A;  4GW6 A;  3AVH A;  3H08 A;  4CJR A;  4KHU A;  3OYD A;  4BE2 A;  1NKC A;  1Q8I A;  3IS9 A;  4E1M A;  2GV9 A;  1ITG A;  3MAQ A;  4CJ4 A;  2RKI A;  1VSI A;  3AVL A;  2HND A;  2FBY A;  3OYB A;  1UA1 A;  3DM2 A;  4IBN A;  4BE1 A;  3QER A;  4Y1C A;  3AVN A;  3VQ8 A;  2Y1I A;  1XC9 A;  1U4B A;  1NKE A;  1KSP A;  4Q5V A;  2E6M A;  2KFN A;  2ATQ A;  1DLO A;  3HPH A;  1NOZ A;  2GUI A;  4N5S A;  4C8O A;  2RF2 A;  4M3U A;  3SYZ A;  3HYF A;  4MFB A;  3QLH A;  1C1C A;  1QHT A;  3SNN A;  3VQ7 A;  4FJK A;  2Q3S A;  4CIG A;  1EKE A;  2XRI A;  3QO9 A;  4FLU A;  4OKE A;  3HT3 A;  3HJF A;  4CE9 A;  5FDL A;  4RG8 A;  4N76 A;  4W5O A;  1IKV A;  3TAE A;  4KRE A;  3KK1 A;  1QS4 A;  3ZSZ A;  3ZSY A;  1LW2 A;  1J54 A;  4CK3 A;  4IFV A;  1RCH A;  3F9K A;  4N56 A;  3QES A;  2HHV A;  3AVK A;  3SV3 A;  4IG0 A;  1IO2 A;  3KLE A;  3L2R A;  3D45 A;  4KKO A;  4DSK A;  4AHS A;  2G8F A;  2DFF A;  1GOB A;  2O4G A;  4HCC A;  1Q9X A;  4QAG A;  3MEE A;  3SZ2 A;  3T1A A;  3BDP A;  4GVM A;  1C0U A;  3TWH A;  3OYF A;  2OPP A;  4OGC A;  1KCF A;  4H4O A;  1NK9 A;  4Z4C A;  1WAJ A;  3K58 A;  1TAQ A;  5T7B A;  3RWU A;  3CM5 A;  1VSK A;  4CFD A;  4N41 A;  2HHQ A;  3LAN A;  4E3S A;  2B4J A;  5K14 A;  3OYH A;  1SKS A;  4CGI A;  4MQ3 A;  3QNO A;  2BE2 A;  5HBM A;  1JL2 A;  4DTR A;  4KI4 A;  1WSJ A;  2YNI A;  2XY6 A;  4E7H A;  4PUO A;  3QNN A;  3V81 A;  3OJS A;  4PQU A;  3HVT A;  4CHQ A;  1K6Y A;  2KQ2 A;  3HPG A;  2JGU A;  1LAW A;  2B5J A;  4CF0 A;  2D0C A;  4FJN A;  1NK6 A;  1HNV A;  1RBV A;  1VSH A;  1F21 A;  3HP9 A;  4DLG A;  1UWB A;  2X78 A;  4BWM A;  1VRU A;  5DK5 A;  3ZSR A;  4CJP A;  3O3F A;  1JLC A;  3VQ5 A;  3JYT A;  1KRP A;  4C8L A;  3IAY A;  4M3Y A;  4KTQ A;  2BGG A;  4M3T A;  1TV6 A;  1C1A A;  2FBV A;  3OYN A;  4QOZ B;  3RR8 A;  1U49 A;  4HUF A;  3SQ4 A;  3MXJ A;  1NJY A;  1QTM A;  2QKK A;  1BQN A;  2X74 A;  1BIS A;  3K5M A;  4DTP A;  3DRP A;  2HVH A;  4C8M A;  1IKX A;  4DTS A;  3TAQ A;  4DTO A;  1XHX A;  4CHP A;  3D0P A;  5HRP A;  4DWI A;  1W0H A;  3G0Z A;  4Z4G A;  1L3V A;  5C25 A;  3M8Q A;  4LH5 A;  4LD0 A;  4DFK A;  2HHU A;  3WNF A;  3OYL A;  4CGG A;  2IGI A;  3KLG A;  3P83 D;  3TAN A;  3LZJ A;  1RBU A;  5J2Q A;  2Y1J A;  3RTV A;  3V9S A;  4J2A A;  4DTJ A;  1RIL A;  3LZI A;  4AHC A;  3K59 A;  5J1E A;  4FJI A;  4CK1 A;  1YTA A;  4FJ9 A;  2F8T A;  4FJH A;  1SKW A;  3NBP A;  2ZE2 A;  2R7Y A;  1TKX A;  3C6T A;  4B9N A;  4FK4 A;  4JRQ A;  4OKK A;  3M8R A;  3B6P A;  3HM9 A;  1I39 A;  4CHY A;  2D5R A;  1CLQ A;  1REV A;  1B9F A;  4K8Z A;  4F3T A;  4I7F A;  2F8S A;  1DTQ A;  3SUN A;  3DLE A;  3NGZ A;  2QXF A;  4DQQ A;  1KTQ A;  4Y1D A;  1B9D A;  1BIZ A;  1I3A A;  1RT4 A;  1ZBI A;  3CG7 A;  3IG1 A;  4FJX A;  1U48 A;  3I8D A;  1IH7 A;  3AVA A;  3HST B;  4ZTF A;  4CEE A;  4LH4 A;  4BWJ A;  1TK8 A;  4H4M A;  3VQE A;  1RT5 A;  3KLI A;  3TAG A;  1SL2 A;  2OZS A;  4FK0 A;  3KIO A;  1WNS A;  4OGE A;  2ZD1 A;  3ZT1 A;  2WON A;  4CER A;  3LWL A;  1XHZ A;  1D5A A;  1TL3 A;  1BGX T;  3AA5 X;  3QEP A;  3OYJ A;  1BCO A;  4RW4 A;  1EET A;  2X6N A;  2VWK A;  3K5O A;  1FKO A;  1VSJ A;  3MED A;  3ZT3 A;  4R5P A;  1BHL A;  4AHU A;  3PO5 A;  4KHS A;  2IS3 A;  5KTQ A;  4E89 A;  3L8B A;  3ULD A;  5KGW A;  1R0A A;  1C1B A;  2IDO A;  3AA4 A;  3LPT A;  4IG3 A;  3LDS A;  5I42 A;  4YNQ A;  4BE0 A;  4CEA A;  3SV4 A;  3C94 A;  2PY5 A;  4ELV A;  4O0J A;  1RTD A;  4OPK A;  3K5L A;  5J2M A;  1SKR A;  1RDC A;  4BDZ A;  4KHY A;  2O4I A;  1XI1 A;  1BL3 A;  3NAE A;  3NF8 A;  1S6P A;  3QIN A;  3QEI A;  1KLN A;  1C6V A;  4CEC A;  4HUE A;  2XY7 A;  2KFZ A;  3L2Q A;  3ITH A;  5FRN A;  2VG6 A;  2AJQ A;  3PX4 A;  1S5J A;  4FZZ A;  1S9G A;  1IG9 A;  4DQS A;  2A1R A;  3S3M A;  3DI6 A;  3LPU A;  4DU4 A;  2G8W A;  4OLB A;  3CYM A;  2WOM A;  1LWF A;  2VG5 A;  4CJK A;  4E0D A;  4B3O A;  1X9M A;  2HHT A;  2YNH A;  3LP2 A;  4DQP A;  3F73 A;  4KB1 A;  3G10 A;  3NH0 A;  4E7K A;  2PYL A;  1TVR A;  1KVC A;  3DOK A;  4FCY A;  1X1P A;  2A1S A;  5HRO A;  2G8V A;  4NYF A;  1BIU A;  2YV0 X;  3V6D A;  2OPR A;  3KD5 E;  1S1U A;  1Y97 A;  4H8K A;  3OYM A;  4I2P A;  4FLZ A;  5CZ2 A;  3VQC A;  1NK5 A;  2Z1H A;  4IFY A;  1RT1 A;  3PUF A;  4OKJ A;  3RMB A;  3EY1 A;  3DLH A;  1LWC A;  3M8S A;  4FJ5 A;  1O1W A;  3PX6 A;  3V4I A;  4C8N A;  3K57 A;  4AHT A;  4FM2 A;  4CCH A;  4EP4 A;  4Z0U A;  4BDP A;  3SPY A;  1KFD A;  1XWL A;  4OVL A;  4CIF A;  1RDA A;  2KTQ A;  3OY9 A;  1N5Y A;  4HCB A;  5EU7 A;  1J5O A;  1NKB A;  3ALY A;  2EHG A;  1B92 A;  4O0I A;  3TAB A;  2B6A A;  3O4N A;  4B9T A;  3EZ5 A;  3PX0 A;  1D8Y A;  3VQD A;  4FJG A;  1JLA A;  4RW9 A;  3RRG A;  4E7I A;  1RBT A;  4F2S A;  3SQ1 A;  4Z4F A;  1KLM A;  1NOY A;  1VSM A;  2KW4 A;  3LAM A;  3U3Y A;  3SQ0 A;  4DSI A;  1HQE A;  1ZYQ A;  4Z4I A;  4JRP A;  1TKT A;  4KI6 A;  3KLF A;  1WSI A;  3OS0 A;  5HLF A;  4WE1 A;  3TAM A;  3NF6 A;  3SCX A;  3OS2 A;  1HQU A;  4UQG A;  3P1G A;  3TAF A;  3TR8 A;  1VSD A;  4O44 A;  4B08 A;  3NH1 A;  3SI6 A;  4BAC A;  4KV8 A;  4HHT A;  3AVJ A;  2G8I A;  4M42 A;  4J2E A;  5E41 A;  3LP1 A;  3OYI A;  1JLG A;  1TAU A;  2VWJ A;  1GOC A;  3EYZ A;  4O55 A;  2XY5 A;  4DTX A;  3ZSX A;  4CF2 A;  3K2P A;  1HYZ A;  4DU1 A;  1YTU A;  4PY5 A;  2RPI A;  4DFP A;  1JL1 A;  1IKY A;  5I3U A;  4KTZ A;  3AO2 A;  4G1Q A;  3KD1 E;  3ZT4 A;  1JLQ A;  3V1Q A;  3ZSV A;  1T8E A;  1L3U A;  4W5Q A;  3VQ4 A;  2DTU A;  1RBR A;  4M3X A;  3AVF A;  2YHB A;  4M3R A;  4RW8 A;  4KHN A;  2FBT A;  2PYJ A;  4FK2 A;  2XY8 A;  3S9H A;  3P5J A;  3T19 A;  4DU3 A;  1YT3 A;  3CM6 A;  2HW3 A;  4NCA A;  5C24 A;  3VQ9 A;  3OYK A;  1JLE A;  4J2B A;  4IDK A;  2P51 A;  4DMN A;  1BI4 B;  3DYA A;  1VSF A;  1SL1 A;  1ASW A;  4NCB A;  3AA3 A;  4CJW A;  3HXM A;  2G8H A;  5CZ1 A;  4B9M A;  4DTN A;  1EXQ A;  1WSH A;  3NF7 A;  4W5R A;  3ZSW A;  3LP0 A;  4AHR A;  4BDY A;  1QSL A;  1JLB A;  2E6L A;  3DRR A;  4FM1 A;  1JXE A;  3C95 A;  1JLF A;  3OYG A;  4DS4 A;  1WLJ A;  1HJR A;  4AH9 A;  4DG1 A;  3QIO A;  4O5B A;  2OYQ A;  3NF9 A;  1KFS A;  3AO4 A;  3L3U A;  5DMR A;  3WNH A;  3ZCM A;  1UA0 A;  2HVI A;  2YHA A;  3PV8 A;  4CJT A;  1WSG A;  3ZT2 A;  4FVM A;  4N47 A;  1C0T A;  3VA0 A;  1L5U A;  4F2R A;  4F4K A;  4FJ7 A;  4FLT A;  3KKS A;  3OYA A;  4B9U A;  1YVU A;  1NJZ A;  4CEF A;  2XO7 A;  4DS5 A;  3SUP A;  1IKW A;  4B9S A;  2OA8 A;  3ZT0 A;  1S6Q A;  4EZ9 A;  4DQI A;  3O3G A;  2QKB A;  1WN7 A;  3KKR A;  3AVI A;  4NYN A;  3S3N A;  3RMD A;  4J2D A;  1RTJ A;  3VQP A;  2FBX A;  4GMJ B;  4CGJ A;  1JXB A;  3VQ6 A;  1VRT A;  1A5V A;  3QIP A;  2W42 A;  3HO1 A;  4FJL A;  3M8P A;  2PZS A;  1MU2 A;  1VK0 A;  2X6S A;  1X9W A;  4FYD A;  3V9W A;  4DTM A;  1TGO A;  5SWM A;  4CF1 A;  1S1W A;  3WNG A;  4LSN A;  3NGI A;  4DSE A;  3ISN C;  1U47 A;  2ETJ A;  2RN2 A;  1L3S A;  1WSF A;  3NHG A;  3AO5 A;  1HNI A;  1GOA A;  4OLA A;  1QQC A;  4HVJ A;  1T7P A;  3FFI A;  4DF8 A;  4I9L A;  4CEB A;  4FLY A;  4CJ5 A;  4FM0 A;  4Q0B A;  3KTQ A;  4F8R A;  4RW6 A;  4ID5 A;  2FC0 A;  1HYS A;  3V1O A;  4LSL A;  4CES A;  3JSM A;  4DSL A;  2KZZ A;  3NDK A;  5J2N A;  3AVG A;  4XIU A;  5J2P A;  1NK0 A;  4CGH A;  3DRS A;  2OPQ A;  4Z4E A;  2DFE A;  4CHN A;  3HK2 A;  1RTH A;  3NFA A;  4KB0 A;  2HNY A;  2OPS A;  5KRT A;  3DOL A;  4PWD A;  5JS2 A;  1UAX A;  4B8A B;  1X9S A;  3UIQ A;  4NCG A;  3BGR A;  2EX3 A;  3SJJ A;  3CQ8 A;  1LV5 A;  2Z1J A;  4M3W A;  2JLE A;  4OJR A;  4CEO A;  1S9E A;  3IRX A;  1VSL A;  1QSY A;  1HYV A;  4CK2 A;  3RMA A;  4I9Q A;  1SV5 A;  2HNZ A;  2IOC A;  3L2V A;  3KK3 A;  4IKF A;  3AA2 A;  1VSE A;  4FJ8 A;  4O4G A;  3C6U A;  3ZSQ A;  3V9X A;  4EP5 A;  3O4Q A;  3NE6 A;  4I2Q A;  1T05 A;  3V9Z A;  3T3F A;  5CY4 A;  4CGF A;  5SZT A;  1ASV A;  4HUG A;  3KLH A;  4TSX A;  1T03 A;  1Q9Y A;  3MEC A;  1SL0 A;  2BDP A;  4PA1 A;  4E7J A;  1TKZ A; 
#chains in the Genus database with same CATH topology
 4LFB K;  3OHR A;  5CYM A;  1BCM A;  1A5X A;  5KPZ A;  3I55 N;  3V9U A;  3QML A;  3AGR A;  2HBJ A;  3CFO A;  2OTL N;  4M45 A;  1MWK A;  1U45 A;  4CFB A;  3ATU A;  3LAK A;  3WNE A;  3DLR A;  4MO5 A;  4RWT A;  1G99 A;  2HF3 A;  3DLG A;  1S3X A;  2O8B B;  4B8C A;  5CYQ A;  4FWP A;  4LC9 B;  3MXI A;  3ULE A;  4W5N A;  5HL7 L;  4B9L A;  2AA4 A;  3VGM A;  2XHB A;  3LWM A;  4HTU A;  1SAZ A;  3FFK B;  2O8D B;  1WOQ A;  2G8U A;  4K8X A;  4KTW A;  3VMF B;  4DV6 K;  4NXM K;  2D1K A;  2YHW A;  1RT3 A;  1RTI A;  4FJM A;  4IXC A;  5AQV A;  4GKJ K;  3BUZ B;  1XUP O;  4ILH A;  3PIO L;  1P8Z A;  4QCL A;  4JV5 K;  3CMA N;  3LAL A;  4CZM A;  3E9L A;  3FZF A;  5C15 A;  2CGK A;  2VG7 A;  3VEY A;  4M3Z A;  1IBL K;  4FZX C;  2ZM6 K;  3DAW A;  4CJQ A;  2YNG A;  2HB5 A;  1TYQ A;  2IAJ A;  3AVB A;  2FSJ A;  3VF2 A;  4YFU A;  3RRH A;  3DLK A;  4ELU A;  3FZL A;  3VET A;  1RDD A;  3DJC A;  1U04 A;  2D0A A;  1K73 O;  1RDW X;  2ASP A;  3OTO K;  4FW1 A;  5EY4 A;  3Q7B A;  4WQ5 A;  3C65 A;  5E26 A;  4ID1 A;  2UUC K;  4H5R A;  2JWL A;  3O1B A;  1Z26 A;  3HZ6 A;  3IFR A;  5AQH A;  1VQ9 N;  5DM6 L;  5ADX A;  4FW2 A;  4YOT A;  4EZ6 A;  3KJV A;  3V1R A;  3SK3 A;  2NRW A;  4IZ9 A;  4ZTJ A;  2YKN A;  4F3O A;  4GW6 A;  4M7X A;  3N4Q A;  3ZYY X;  3IS9 A;  1YJ9 N;  1GLA G;  1VSI A;  3IUC A;  3WXI A;  4IO8 A;  3DM2 A;  4IBN A;  4BE1 A;  3AVN A;  1U4B A;  1XC9 A;  3E66 A;  1DLO A;  2GUI A;  3SYZ A;  4MFB A;  3HBT A;  3SNN A;  4CIG A;  1EKE A;  4HWI A;  4AM7 A;  5AQN A;  3BZC A;  4CE9 A;  4XEI A;  1ZC6 A;  1IKV A;  1HUX A;  3TAE A;  3ZSZ A;  1N8R O;  1LW2 A;  1TUU A;  3WQU A;  1HX1 A;  4CBW A;  3CCE N;  3QES A;  3N4P A;  2HHV A;  2NRH A;  2ZJQ L;  3MDQ A;  1IO2 A;  3C6H A;  3L2R A;  3D45 A;  3CET A;  1GOB A;  2QWO A;  3T1A A;  1C0U A;  3RSE A;  1NK9 A;  2UUA K;  4LF9 K;  3RWU A;  4N41 A;  4RCH A;  1K8A O;  2VQF K;  4E3S A;  3A5L C;  1SKS A;  3QNO A;  4DTR A;  4JKF A;  2V52 B;  4EHT A;  3OJS A;  4PQU A;  4JNE A;  3HPG A;  1HNV A;  1JJ2 M;  1VSH A;  4DLG A;  2X78 A;  3CCL N;  4C8L A;  3JYT A;  2HHQ A;  3C7N B;  1TV6 A;  3BZK A;  1C1A A;  3SAG A;  3O9T A;  4QOZ B;  3CCM N;  3K5M A;  3MCP A;  2HVH A;  3O08 A;  4JI2 K;  1W0H A;  1L3V A;  3OYL A;  4CGG A;  4YOX A;  2IGI A;  2QWM A;  3KLG A;  3P83 D;  2Y1J A;  5J1E A;  2FLO A;  2HBL A;  2F8T A;  4OO1 J;  3NBP A;  3EEQ A;  4FPB A;  4BR4 A;  2E2Q A;  2R7Y A;  4KH6 A;  4BRA A;  3B6P A;  4DR5 K;  2D5R A;  1B9F A;  4WFN L;  3PIP L;  2F8S A;  1X3N A;  3VEW A;  5BRE A;  4DQQ A;  1EQY A;  1MA9 B;  2QW9 A;  4FJX A;  3IG1 A;  3VGL A;  2DPN A;  2I7P A;  3PLA A;  3K0S A;  4H4M A;  3TAG A;  4FK0 A;  3KIO A;  4FWQ A;  3H46 O;  4CER A;  3LWL A;  2NRT A;  2IVP A;  1BCO A;  4RW4 A;  1EET A;  2X6N A;  4BQL A;  1FW6 A;  5KTQ A;  3L8B A;  5KGW A;  1C1B A;  4E1J A;  4IG3 A;  4EHU A;  5F1X A;  5I42 A;  4O0J A;  4BDZ A;  3KHY A;  4KHY A;  1Q7Y O;  5BRH A;  1C6V A;  3TU5 A;  1S5J A;  2HOE A;  3S3M A;  4B1Y B;  3VF4 A;  4MLH A;  4E0D A;  5AZJ A;  3F73 A;  2QM1 A;  3G10 A;  3DOK A;  1HLU A;  1HPM A;  1X1P A;  4NYF A;  4FO0 A;  3CIP A;  1Y97 A;  4JK8 A;  3OYM A;  3EE9 A;  1NK5 A;  4IFY A;  3GE1 A;  3V4I A;  4IWV A;  3R3L A;  3K57 A;  4CCH A;  3IMX A;  4EP4 A;  4Z0U A;  4MDA A;  2ZJR L;  1KFD A;  1XWL A;  4YDU A;  1RDA A;  1NNE A;  5EU7 A;  1NKB A;  3ALY A;  4CZL A;  2B6A A;  3WT0 A;  4BG9 A;  4A5A A;  4H5W A;  3RRG A;  2WTU A;  5BRD A;  4U7B A;  4IOA L;  4DV7 K;  2KW4 A;  4DSI A;  1ZBS A;  4JRP A;  1WSI A;  3OS2 A;  3TAF A;  3NH1 A;  1VSD A;  4O44 A;  4B08 A;  4CD1 A;  4HHT A;  3AVJ A;  3EL2 A;  1J6Z A;  4J2E A;  4M42 A;  1MWM A;  5E41 A;  1TAU A;  2KLA A;  2P9I B;  5AQT A;  4ISG A;  1BU6 O;  3GDQ A;  2WFB A;  4PY5 A;  3HTV A;  1IKY A;  5I3U A;  4KTZ A;  1HNZ K;  1VQ4 N;  1L3U A;  4H5V A;  4W5Q A;  4BRH A;  3FLC O;  4M3X A;  3T7Z A;  2YHY A;  4M3R A;  2FBT A;  5AR0 A;  2PYJ A;  2XY8 A;  2FF6 A;  5C0Y A;  3P38 A;  5C24 A;  3MN5 A;  2O8C A;  2P51 A;  4BG8 A;  4B1X B;  2ZWH A;  4JKA A;  5JVG L;  5CZ1 A;  1C0F A;  4IDH A;  1WSH A;  3NF7 A;  1NWK A;  4AHR A;  4JYA K;  3ID6 A;  3OYG A;  4DS4 A;  2W6L A;  3NF9 A;  4JK7 A;  4YHH K;  3AO4 A;  3WNH A;  3ZCM A;  4CJT A;  4CI6 A;  3VA0 A;  1L5U A;  2GX9 A;  4A2B A;  3KKS A;  2P9N B;  1YVU A;  5KPT A;  5EVZ A;  2XO7 A;  4RTF D;  3SUP A;  1NGF A;  5AQU A;  3ZT0 A;  2P9U A;  1VHX A;  4LFC K;  3ENO A;  2ZF5 O;  4GMJ B;  4CGJ A;  3G25 A;  4BY9 C;  2W42 A;  3DWL A;  3M8P A;  2PZS A;  5KPR A;  5SWM A;  1WBD A;  2P9K A;  3SAH A;  2FXU A;  5ADX H;  3WXM B;  4DV1 K;  3NHG A;  1QQC A;  1BOT O;  5BPM A;  3TTC A;  2GEL A;  5F2R A;  2KZZ A;  5AJ3 K;  4DR2 K;  1WBB A;  3QIC A;  2HMP A;  5J2P A;  3MWT A;  4Z4E A;  2DFE A;  3CI5 A;  1T6D A;  4WQ4 C;  4B8A B;  4DKW A;  3BGR A;  5GIN A;  3J7Z O;  4M3W A;  3IRX A;  2W6K A;  3RMA A;  3UKR B;  1NGH A;  2BTF A;  2HNZ A;  4IKF A;  1X9J A;  1Y64 A;  1D4X A;  1BG3 A;  4I2Q A;  3ZET B;  5CY4 A;  3MEC A;  3VQA A;  3CCQ N;  4L8R B;  5HRN A;  3HPO A;  3THV A;  3ASM A;  4LF4 K;  3WEE B;  1ZXO A;  2DFH A;  3AVC A;  4LY7 A;  1W2B M;  1BUP A;  3DLB A;  1RT7 A;  4DF4 A;  2CH6 A;  2F7T A;  1OH6 A;  1BI4 A;  1J9A A;  4GY2 B;  1QE1 A;  4CHZ A;  4ZHR A;  2ITG A;  1ZBF A;  3CJ9 A;  2I5J A;  5AFU H;  4KH5 A;  2P9L A;  3M1F A;  4CJF A;  3G71 N;  4YOR A;  1K9M O;  2P9P A;  1KXP A;  1ZBL A;  1ZBH A;  1QVF M;  1SZ2 A;  1FK9 A;  4CJE A;  3QEV A;  3HP6 A;  3VN5 A;  5FRM A;  1JCF A;  1L3T A;  4CFA A;  3H3N O;  3HVR A;  5HP1 A;  3OYE A;  4DFJ A;  2HHS A;  3P4I A;  4DTU A;  4CGD A;  3TAR A;  3LP3 A;  4U67 L;  2O8E B;  3ZSO A;  2IVO A;  3W3D A;  2Q36 A;  1QSS A;  3WXK A;  3E9O A;  3CFR A;  2HHW A;  4PHT X;  4G9Z A;  5AQL A;  1RFQ A;  1S1T A;  4BRD A;  1CZA N;  1J53 A;  4M41 A;  1G15 A;  3DXM A;  2UXC K;  3SQ2 A;  4DV0 K;  3TAP A;  3OS1 A;  3F5T A;  4DQR A;  1D9F A;  1WAF A;  2KKZ A;  2HMI A;  3AO1 A;  4DSF A;  1HRH A;  3FZM A;  4ICL A;  1KVA A;  3AVM A;  3Q7C A;  4FXD A;  4NB4 A;  2NNW A;  1VQ7 N;  4PKI A;  1KVB A;  3SUQ A;  1BQM A;  3L3V A;  3KK2 A;  3TI0 A;  4KPY A;  1NJX A;  4KHP K;  5EXW A;  3OJU A;  5JLH A;  1WSE A;  5LY3 A;  4JS4 A;  3SMP A;  4FWL A;  1A5W A;  4DLE A;  4KHQ A;  4FWK A;  3D2F A;  3I0S A;  4KRF A;  4B1U B;  1W97 L;  3U9D A;  3SUO A;  3CPW M;  4KHW A;  3NH2 A;  4F9O A;  2P9S B;  2E2O A;  1CXU A;  5FRO A;  5HRS A;  3NCI A;  4AHV A;  5D3G A;  1YF5 L;  3AVH A;  5AQJ A;  3OYD A;  4BE2 A;  1Q8I A;  4E1M A;  2GV9 A;  2RKI A;  1DGK N;  1Q18 A;  3OYB A;  2HND A;  4J8F A;  3VQ8 A;  2YHX A;  2GWK A;  2ATQ A;  3HPH A;  4M3U A;  3OBW A;  2Q0U A;  3MK6 A;  4OPH A;  3WXJ A;  4BC3 A;  5AQP A;  4FLU A;  3HJF A;  4OKE A;  2QTD A;  1QVG M;  3HSC A;  4RG8 A;  2QI2 A;  1X3M A;  4AF1 A;  4KRE A;  4IFV A;  1RCH A;  3F9K A;  4N56 A;  2OAN A;  5FPD A;  4KKO A;  3CER A;  1HJO A;  4DSK A;  4AHS A;  2O4G A;  5AQY A;  4WYB A;  3O9S A;  4JKC A;  1WAJ A;  2ZGY A;  1VSK A;  4JKD A;  3THW B;  4EAH D;  4BR0 A;  4ISE A;  1IBM K;  4MQ3 A;  1ATR A;  5HBM A;  1QQM A;  3KVG A;  2XY6 A;  4E7H A;  4PUO A;  3QNN A;  3V81 A;  2E8A A;  3LDL A;  3HVT A;  4IO9 L;  4CHQ A;  1K6Y A;  2D0C A;  3SAF A;  1NK6 A;  5LMU K;  4BWM A;  1VRU A;  5DK5 A;  1JLC A;  3VQ5 A;  3K9K A;  5KQD A;  4M3T A;  2FBV A;  2BUP A;  3G6E N;  2YJE A;  1QTM A;  2QKK A;  3ENH A;  2HST A;  5LL6 Z;  1T3V A;  3OBY A;  1LCU A;  4JD2 A;  5BPL A;  4DTS A;  4DTO A;  1XHX A;  4YOW A;  5HRP A;  1Z6R A;  5C25 A;  1WUA A;  4K25 A;  3RTV A;  4AHC A;  3K59 A;  3AAP A;  2ASM A;  3VES A;  2ASO A;  1KQS M;  4FJI A;  4FJ9 A;  2YI1 A;  2ZE2 A;  1SS6 A;  4CZH A;  4BRP A;  4IFE A;  3UE5 A;  4B9N A;  2ZJP L;  3CCV N;  4JRQ A;  1Q86 O;  1VQL N;  1I39 A;  1CLQ A;  1REV A;  4F3T A;  4I7F A;  3SUN A;  3DLE A;  2QXF A;  4JI0 K;  2E2N A;  1KTQ A;  4QS8 A;  4Y1D A;  1B9D A;  1BIZ A;  1ZBI A;  4FWM A;  1OH8 A;  3AVA A;  3HST B;  1ESV A;  1RT5 A;  2VCP A;  4FWS A;  3CJ1 A;  4OGE A;  3CD6 N;  3TPQ A;  1TL3 A;  2PAV A;  3J81 O;  2VWK A;  4R5P A;  1FKO A;  1BHL A;  3SLC A;  4AHU A;  1R0A A;  4BGB A;  3ZLJ A;  4YNQ A;  4CEA A;  3C94 A;  1RTD A;  1KC8 O;  1SKR A;  1RDC A;  1BL3 A;  2RE2 A;  3QEI A;  3QIN A;  1KLN A;  4HUE A;  5C12 A;  2KFZ A;  4FZZ A;  4DQS A;  4YOU A;  3DI6 A;  4YOY A;  1V4T A;  3SBT A;  1LWF A;  1X9M A;  2HHT A;  2YNH A;  3LP2 A;  4KB1 A;  1JCG A;  2QWN A;  2PYL A;  2FSK A;  4YOV A;  3AAR A;  2G8V A;  2OPR A;  4DV3 K;  2VQE K;  3LDO A;  4BRK A;  1NLV A;  1IBK K;  4DHY A;  3M3Z A;  1RT1 A;  4OKJ A;  5I9E B;  3M8S A;  4FJ5 A;  3J7A P;  4H0O A;  5AQM A;  4AHT A;  4FM2 A;  3O9R A;  3VF6 A;  4PKH A;  5JMV A;  2KTQ A;  3THY B;  1QHA A;  1N5Y A;  1J5O A;  1B92 A;  3LL3 A;  3PX0 A;  4NXN K;  1JLA A;  2YJF A;  1N32 K;  1U6Z A;  4Z4F A;  3L4Q A;  1YI2 N;  1VSM A;  4I6M A;  3O8M A;  3IDH A;  4GV3 A;  3PSF A;  3KLF A;  5HLF A;  4WE1 A;  5AQI A;  1HQU A;  4UQG A;  4BVO A;  3TR8 A;  2A42 A;  4BAC A;  3FE1 A;  2G8I A;  3D2E A;  2O8F A;  3OYI A;  3ZEU A;  2Q31 A;  1GOC A;  4O55 A;  2XY5 A;  3K2P A;  4DU1 A;  2RPI A;  3KD1 E;  1JLQ A;  3ZSV A;  1T8E A;  3VQ4 A;  2AP1 A;  1RBR A;  4CZJ A;  2YHB A;  5HOO A;  4RW8 A;  3S9H A;  4H0X B;  3WXL A;  4BR2 A;  1H1V A;  2A5X A;  4J2B A;  4IDK A;  3H3O B;  1VSF A;  4JI7 K;  1GLD G;  3AA3 A;  4FWR A;  4B9M A;  5H1S Q;  5BN8 A;  4W5R A;  3MMV A;  2E6L A;  1JXE A;  3C95 A;  1KAX A;  1WLJ A;  1HJR A;  4JKG A;  4DG1 A;  4O5B A;  2OYQ A;  3L3U A;  5DMR A;  2HVI A;  2NLX A;  2YHA A;  1RDU A;  4KBO A;  3DLL L;  3ULE B;  3CCU N;  4DS5 A;  5F0X A;  4NO7 A;  4B9S A;  2QWR A;  3I56 N;  4DQI A;  3O3G A;  1WN7 A;  3AVI A;  4CW7 B;  3RMD A;  5FPE A;  4LF7 K;  2FBX A;  1XC3 A;  1JXB A;  1A5V A;  3MN9 A;  4XH4 A;  3HO1 A;  4FYD A;  1VK0 A;  1X9W A;  3V9W A;  4CZI A;  3K9J A;  4CF1 A;  3OW2 M;  3WNG A;  4LSN A;  4DSE A;  4GKK K;  3VEZ A;  3GOI A;  4CZE A;  1P90 A;  4HVJ A;  4DF8 A;  3VEV A;  4CJ5 A;  4FM0 A;  4Q0B A;  2UU9 K;  2D0P A;  4B9Q A;  5AQF A;  4LSL A;  4DSL A;  1GLL O;  3NDK A;  5J2N A;  1GLJ O;  3A5O C;  3UKU A;  3U8X A;  1NMN A;  1RTH A;  3HK2 A;  4KB0 A;  1YVN A;  1TYQ B;  5KRT A;  1T6C A;  5JS2 A;  3CJB A;  1YJW N;  4NCG A;  3SJJ A;  2EX3 A;  5FLX O;  1XMQ K;  3ENB A;  2Z1J A;  1VSL A;  4DR1 K;  1HYV A;  4CK2 A;  2NRR A;  4I9Q A;  3HRG A;  3AA2 A;  4FJ8 A;  3ZX2 A;  1QZ5 A;  4OX9 K;  3O4Q A;  2FF3 B;  2E20 A;  2VGM A;  4HUG A;  1T03 A;  2F9W A;  3S41 A;  5LJW A;  2BDP A;  5C10 A;  4O5F A;  2YKM A;  3VEO A;  2PFU A;  3R8E A;  4ELT A;  2HBK A;  3CJA A;  4FLV A;  4BR7 A;  1TKD A;  4FLX A;  1YXQ A;  4JI4 K;  3AV9 A;  1VQO N;  4FVU A;  4CZF A;  1UOC A;  3LM9 A;  3AO3 A;  4CJS A;  3VA3 A;  5HRR A;  3RMC A;  4IJN A;  5BR8 K;  1Q81 O;  2QK9 A;  1EP4 A;  4WFA L;  3L2U A;  3JXU A;  4GNI A;  3DMJ A;  3NVM A;  3B8A X;  4BC4 A;  2G8K A;  1Z25 A;  1HKB A;  4JK9 A;  1RBS A;  3PSI A;  1Q82 O;  2F96 A;  5C42 A;  3GL1 A;  3WQT A;  5A2Q O;  1C0M A;  2VYP A;  1JKH A;  3VEN A;  4CBX A;  3VQB A;  1BA1 A;  4IJA A;  1CZB A;  3RSE B;  3EO3 A;  4H5T A;  4C8K A;  4JKH A;  3CFP A;  4K43 A;  1LWE A;  4I6M B;  3RR7 A;  2J4R A;  4CJ3 A;  2HHX A;  2Q1N A;  1CXQ A;  2E4L A;  4JHD A;  3BF3 A;  3QET A;  1TL1 A;  3E01 A;  3U6F A;  4H0Y B;  4AIL C;  4CF8 A;  2Z1G A;  2P1J A;  2E88 A;  1NJI O;  3I8B A;  2BAN A;  2OZM A;  4FLW A;  1LW0 A;  2CGJ A;  1HKG A;  3DXK A;  1CZ9 A;  3BF1 A;  4Z4H A;  3TSU A;  3A5M C;  4NLC A;  3U3G A;  2QXL A;  4JKE A;  4RW7 A;  2GBZ A;  5AQK A;  5KGX A;  4E7L A;  5BPN A;  1SUQ A;  4MDB A;  1N34 K;  4JI6 K;  3A2F A;  2Z1I A;  3O9Q A;  5CE3 A;  5JVH L;  3CHW A;  3HL8 A;  4CFC A;  4BRI A;  4JS5 A;  3SBG A;  4LFA K;  2OCE A;  3MXM A;  3H08 A;  4CJR A;  5JLF A;  1NKC A;  1ATN A;  1ITG A;  4CJ4 A;  3AVL A;  4B9V A;  1UA1 A;  2Y1I A;  4Q5V A;  2E6M A;  2KFN A;  1NOZ A;  2RHK A;  1VQ8 N;  3HYF A;  1NGB A;  1OKJ A;  1QHT A;  3QLH A;  3T69 A;  4DB3 A;  4FJK A;  2O8B A;  2Q3S A;  1V4S A;  2XRI A;  3QO9 A;  3HT3 A;  5FDL A;  4N76 A;  3JAM O;  3ZSY A;  4CK3 A;  3AVK A;  3KLE A;  3CCR N;  5AQR A;  4BRE A;  2WUS A;  3KZB A;  1Q9X A;  3VPZ A;  1KAY A;  1KAZ A;  3TWH A;  4DV4 K;  1KCF A;  2W41 A;  5AZJ B;  4H4O A;  4Z4C A;  3K58 A;  5T7B A;  2QEX N;  1WSJ A;  4L3Q A;  4JKB A;  3G4S N;  3P39 A;  2JGU A;  4CF0 A;  2B5J A;  4WQ4 A;  3VOV A;  4FJN A;  3O1W A;  1RBV A;  2V51 B;  4M7Y A;  3AAQ A;  3HP9 A;  1NGA A;  3SPZ A;  3PO5 A;  3ZSR A;  3O80 A;  4PL7 A;  2A41 A;  1U49 A;  3SQ4 A;  5AQS A;  3MXJ A;  1NJY A;  4R79 A;  1BQN A;  2X74 A;  1BIS A;  1EO1 A;  3DRP A;  1IKX A;  3TSP A;  5M1N A;  4Z4G A;  3M8Q A;  3WNF A;  3QB0 A;  5LJV A;  5J2Q A;  2HHU A;  3V9S A;  4A59 A;  4DTJ A;  5FPM A;  1SKW A;  2H3G X;  4BRL A;  1M1K O;  3C6T A;  3M8R A;  3J8A A;  1DTQ A;  3NGZ A;  4CBU A;  1RT4 A;  3CG7 A;  1U48 A;  3I8D A;  1IH7 A;  4ZTF A;  4LH4 A;  3VQE A;  2A6A A;  5M1F A;  1I94 K;  1WNS A;  3ZT1 A;  1XHZ A;  2O8C B;  2NZT A;  4ILJ A;  1D5A A;  5M1Q A;  1BGX T;  3CME N;  3AA5 X;  1GLE G;  3OYJ A;  4BC2 A;  3ZT3 A;  3K5O A;  4K41 A;  5GIP A;  3MED A;  3NVK A;  2IS3 A;  3ULD A;  2CGL A;  2IDO A;  3AA4 A;  4DR4 K;  3SV4 A;  4ELV A;  2PY5 A;  1YIT N;  4OPK A;  3K5L A;  5J2M A;  3CC2 N;  4FWN A;  4QS9 A;  3NAE A;  3NF8 A;  1S6P A;  4DR6 K;  1FJG K;  4CEC A;  2VG6 A;  1S9G A;  3LPU A;  2G8W A;  3CYM A;  4JEP A;  2WOM A;  1VQP N;  2P9U B;  4CJK A;  4DQP A;  4E7K A;  1SQK A;  4BRO A;  1KVC A;  5HRO A;  2A1S A;  3DXK B;  3J7Y P;  4BR9 A;  5GAG P;  3V6D A;  3MCA B;  4I2P A;  4FLZ A;  5CZ2 A;  2Z1H A;  5IWA K;  2P9K B;  3PUF A;  3H1V X;  3DLH A;  3EY1 A;  1LWC A;  5BR9 A;  1O1W A;  4C8N A;  4BDP A;  4OVL A;  5LMN K;  4CIF A;  2EHG A;  3C7N A;  4B9T A;  5AQG A;  1YIJ N;  3EZ5 A;  3VTH A;  4FPA A;  4RW9 A;  1XQS C;  1EWQ A;  4F2S A;  1TUY A;  1KLM A;  1MDU B;  3LAM A;  4DR3 K;  3U3Y A;  3SQ0 A;  4Z4I A;  1YHQ N;  4KI6 A;  5KQ8 A;  3TAM A;  3SCX A;  3NF6 A;  4JI5 K;  3P1G A;  3SI6 A;  1N36 K;  4V19 S;  4FL9 A;  4LF6 K;  4H0V B;  3LP1 A;  1JLG A;  5EX5 A;  2VWJ A;  3EYZ A;  5M1O A;  3ZX0 A;  2YCH A;  3ZSX A;  1IV0 A;  1HYZ A;  1K8K A;  1YTU A;  3MN7 A;  4WQ5 C;  1E3M A;  1OH7 A;  4BGA A;  3ZT4 A;  3HOT A;  3V1Q A;  2DTU A;  2WBN A;  3AGK A;  4JN4 A;  4BRN A;  4H03 B;  3P5J A;  3T19 A;  3FZH A;  4DU3 A;  3ATV A;  3VQ9 A;  4BQZ A;  2NRV A;  4X66 K;  1BI4 B;  3DYA A;  5GIO A;  4NCB A;  2F4V K;  4WFB L;  4IEE A;  2VWB A;  3ZSW A;  1QSL A;  4BDY A;  3QDK A;  1JLB A;  3DRR A;  5GAH P;  4FM1 A;  2P9L B;  1DEJ A;  1KFS A;  3EKS A;  1UA0 A;  2P9P B;  3PV8 A;  1WSG A;  3ZT2 A;  4FVM A;  4BRF A;  4FJ7 A;  2EWS A;  4B9U A;  4BVP A;  3VER A;  1IKW A;  2OA8 A;  4BR5 A;  1S6Q A;  1QQN A;  1N33 K;  3M6G A;  4Y0W A;  5CHI A;  4J2D A;  3W0L A;  1VRT A;  3QIP A;  5TKW A;  3THX A;  2X6S A;  4X65 K;  3TSQ A;  4A2A A;  4GVE A;  2ITM A;  5E84 A;  1NGJ A;  1LOT B;  2ETJ A;  2RN2 A;  3O6W A;  4QS7 A;  1L3S A;  5M1K A;  3T1Y K;  3AO5 A;  4OLA A;  2Q97 A;  4I9L A;  3DXM B;  3HM8 A;  4FLY A;  3KTQ A;  4F8R A;  5BN9 A;  4CES A;  3JSM A;  2ZGZ A;  3AVG A;  4XIU A;  4FOI A;  3DRS A;  2OPQ A;  1DT9 A;  2HNY A;  2OPS A;  1JCE A;  3DOL A;  4ILG B;  3T1H K;  1UAX A;  4B3M K;  2HBM A;  1LV5 A;  2JLE A;  4CEO A;  1GLB G;  3HI0 A;  1BO5 O;  1QSY A;  3L2V A;  3EN9 A;  3KK3 A;  1VSE A;  3CQX A;  3V9X A;  1NGD A;  3C6U A;  3NE6 A;  2UYT A;  4CGF A;  2NRX A;  3GBT A;  2P9I A;  3KLH A;  5ELZ A;  1SL0 A;  3D2F B;  3LDP A;  4CD3 A;  4E7J A;  4DFK A;  3CC4 N;  3J80 O;  1NGE A;  5B8H A;  5C2F A;  2FSN A;  4OPJ A;  3PO4 A;  3CC7 N;  4KO0 A;  3QEW A;  1YUW A;  4JLH A;  1RT6 A;  4CJU A;  3TTD A;  1NG9 A;  4CED A;  3RVC A;  4XH5 A;  1BA0 A;  1NM1 A;  5KRS A;  1FKP A;  1NK7 A;  3QEX A;  3CXC M;  1RDB A;  3FR0 A;  1N6Q A;  3ZX3 A;  1U2V A;  5KI6 A;  4PL8 A;  2HHH K;  2P5O A;  1HMV A;  4CF9 A;  5CR4 A;  2P5G A;  3OYC A;  1ASU A;  2D0B A;  2KZM A;  3E1Y A;  5TKY A;  2ZQB A;  3B6O A;  1IG8 A;  5JIC A;  2DY4 A;  3FGU A;  4CHO A;  1YAG A;  3S3O A;  3QFU A;  2LSN A;  2P9N A;  4CEQ A;  5AFU A;  2VGN A;  3LDN A;  4W5T A;  1DTT A;  2IVN A;  1RNH A;  1XNQ K;  4DV2 K;  1NK4 A;  3I0R A;  3R9P A;  4DFM A;  1ZBU A;  3MEG A;  3CPE A;  1ATS A;  4CJL A;  1NJW A;  4KFB A;  1S1V A;  1S22 A;  3GG4 A;  1W9H A;  3L4I A;  3K5N A;  4FZY A;  3U9Z A;  1FXX A;  1HPZ A;  4CIE A;  3P31 A;  1TK5 A;  4NLB A;  4KAZ A;  3KK7 A;  1HNX K;  1D9D A;  4CVN E;  4CZG A;  4B1W B;  3QFP A;  2QWQ A;  4E1N A;  4FJJ A;  1K8K B;  3NGY A;  1OH5 A;  1TK0 A;  1S1X A;  4CEZ A;  2A40 A;  4YDU C;  1S72 N;  4E19 A;  4JD2 B;  3H45 C;  1LAV A;  2NRZ A;  3MX5 A;  3UKR A;  3M5R A;  2NUB A;  4MLE A;  4C23 A;  4DR7 K;  3L2W A;  2D4W A;  2E1Z A;  5JS1 A;  4EFH A;  4H0P A;  3ZET A;  4KH4 A;  3VQQ A;  1NK8 A;  4CJV A;  3BP8 A;  4YY3 K;  4IEI A;  1RT2 A;  2YNF A;  4DSJ A;  2IIR A;  3PY8 A;  5AZI A;  1YJN N;  2HF4 A;  4X62 K;  3OVN A;  3WEE A;  1VQ5 N;  2OTJ N;  1T44 A;  2IC3 A;  3O3H A;  4KHU A;  2V7Z A;  1NBW A;  3L0Q A;  3MAQ A;  2GTD A;  4GV6 A;  2FBY A;  3QER A;  4JI8 K;  4Y1C A;  1DKG D;  5M1P A;  3EKU A;  1NGC A;  3TTF A;  1NKE A;  1VQM N;  1KSP A;  3U4L A;  4C8O A;  4N5S A;  2RF2 A;  1C1C A;  3VQ7 A;  3THX B;  1VQ6 N;  3VGK A;  4HTL A;  4W5O A;  3KK1 A;  1QS4 A;  1J54 A;  3BEX A;  3SV3 A;  4IG0 A;  1BWF O;  4WF9 L;  2G8F A;  2DFF A;  3F9M A;  4HCC A;  3A8Y A;  4QAG A;  1VAZ A;  3MEE A;  3SZ2 A;  3BDP A;  4GVM A;  4B3T K;  3OYF A;  2O8E A;  2OPP A;  4OGC A;  1TAQ A;  5AQX A;  3CM5 A;  4CFD A;  3LAN A;  2B4J A;  5K14 A;  3OYH A;  4IOX A;  4CGI A;  3CQY A;  2BE2 A;  1JL2 A;  4KI4 A;  5BRF A;  4O8U A;  3A5N C;  3KWI A;  2YNI A;  1E4G T;  2Q2R A;  2KQ2 A;  4BRG A;  1LAW A;  3HOS A;  1F21 A;  1UWB A;  4ISF A;  4CJP A;  3R6M A;  3O3F A;  4FSV A;  3H6E A;  4O8K A;  1KRP A;  4PKG A;  3IAY A;  1NMD A;  4KTQ A;  4M3Y A;  2BGG A;  3OYN A;  2D0O A;  3RR8 A;  3A0I X;  4HUF A;  2GWJ A;  1O13 A;  4DTP A;  4DUY K;  4C8M A;  3TAQ A;  3MX2 A;  5FPN A;  4CHP A;  2E2P A;  3D0P A;  1BDG A;  4DWI A;  3G0Z A;  4LH5 A;  4LD0 A;  5MLC Q;  2QA4 N;  4H5N A;  3TAN A;  3VTI A;  3LZJ A;  3QBW A;  3CCS N;  1RBU A;  4J2A A;  1RIL A;  2Q0R A;  3LZI A;  1J5E K;  4CK1 A;  1YTA A;  1U2V B;  3D2E B;  2O8F B;  4FJH A;  3F2K A;  4AM6 A;  3ZEU B;  1TKZ A;  3MN6 A;  4K0K K;  1TKX A;  3I33 A;  5AQW A;  2P9S A;  1WB9 A;  4FK4 A;  4OKK A;  3HM9 A;  4CHY A;  4K8Z A;  3FZK A;  2BH1 A;  1HNW K;  1I3A A;  4EIA A;  2KHO A;  4MO4 A;  4CEE A;  4BWJ A;  1TK8 A;  3R1X A;  2QWP A;  3KLI A;  1SL2 A;  2OZS A;  3UB5 A;  1ILY A;  4IOC L;  2ZD1 A;  2WON A;  4C1N K;  5GAD P;  4B1V A;  4B1Z A;  3QEP A;  4XH1 A;  4KHS A;  1VSJ A;  2A3Z A;  3C0B A;  5AQZ A;  4E89 A;  5GAE P;  1NGI A;  3LPT A;  3LDS A;  4BE0 A;  4JKG B;  2O4I A;  1XI1 A;  5EOY A;  2XY7 A;  3L2Q A;  3ITH A;  5FRN A;  2AJQ A;  3PX4 A;  1IG9 A;  2A1R A;  4DU4 A;  4OLB A;  2UUB K;  4OPA A;  4A5B A;  2VG5 A;  4B3O A;  1XMO K;  2GEM A;  3NH0 A;  1TVR A;  4FCY A;  4K42 A;  3THW A;  3SMS A;  4DCH A;  1BIU A;  2YV0 X;  1VQK N;  3KD5 E;  1S1U A;  4H8K A;  3VQC A;  4Z94 A;  4A61 A;  3RMB A;  5C2D A;  3PX6 A;  1M90 O;  3SPY A;  1OVY A;  3OY9 A;  5IT9 O;  4HCB A;  4O0I A;  3TAB A;  3O4N A;  1D8Y A;  4FJG A;  3VQD A;  2JWK A;  2O8D A;  3VEX A;  3UKU B;  4E7I A;  1RBT A;  2I7N A;  5AZI B;  3SQ1 A;  1RGI A;  3D6R A;  2F9T A;  4WCE L;  1NOY A;  1C0G A;  5AQQ A;  1KD1 O;  4CJ7 A;  1HQE A;  1ZYQ A;  3CJ7 A;  1TKT A;  4LF5 K;  3OS0 A;  4CZK A;  2UXD K;  5AQO A;  1OVQ A;  4KV8 A;  3O9U A;  3O5B A;  4A62 A;  4DTX A;  4CF2 A;  2WC9 A;  3L6Q A;  3CF5 L;  4GV9 A;  4DFP A;  1EWR A;  1JL1 A;  4B3R K;  3EZW A;  3AO2 A;  3H1Q A;  4G1Q A;  4A57 A;  3CCJ N;  3AVF A;  3OA9 A;  3QBX A;  1QZ6 A;  3E9P A;  4FOE A;  4KHN A;  2YX6 A;  4FK2 A;  1HR0 K;  1YT3 A;  1NU0 A;  3CM6 A;  2HW3 A;  4NCA A;  3OYK A;  4JI3 K;  1JLE A;  1W7A A;  4DMN A;  1SL1 A;  1ASW A;  4DUZ K;  3IKM A;  4M63 C;  4CJW A;  3HXM A;  2G8H A;  4FWO A;  4DTN A;  1EXQ A;  4X64 K;  3LP0 A;  4B3S K;  1JLF A;  4AH9 A;  3QIO A;  3LDQ A;  4N47 A;  1C0T A;  4C1N I;  1QQO A;  4F2R A;  4F4K A;  2QWL A;  4FLT A;  1VQN N;  4H0T B;  3OYA A;  1NJZ A;  4CEF A;  1Z05 A;  2CH5 A;  2V7Y A;  4EZ9 A;  3LM2 A;  3WUH A;  2QKB A;  3KKR A;  4NYN A;  3S3N A;  4BRC A;  4UY8 O;  1RTJ A;  3VQP A;  2E1Y A;  4DQ8 A;  3VQ6 A;  2E5L K;  4FJL A;  1IJJ A;  1MU2 A;  4JI1 K;  4DTM A;  1TGO A;  3MWP A;  1S1W A;  3NGI A;  3ISN C;  1U47 A;  1E4F T;  3C6A A;  1WSF A;  4BC5 A;  1HNI A;  1GOA A;  4BRM A;  1GLF O;  4JHD B;  1T7P A;  1XNR K;  3FFI A;  1GLC G;  1NGG A;  2GUP A;  4CEB A;  4BRQ A;  3THY A;  3O4W A;  2UXB K;  4RW6 A;  4ID5 A;  3ID8 A;  2FC0 A;  3KWG A;  1HYS A;  4LF8 K;  3V1O A;  1NK0 A;  4CGH A;  4CHN A;  4DV5 K;  3NFA A;  4PWD A;  1X9S A;  3UIQ A;  5DM7 L;  3CQ8 A;  4OJR A;  1S9E A;  1HKC A;  1SV5 A;  2IOC A;  2W40 A;  3BY5 A;  2PBD A;  4O4G A;  3ZSQ A;  4AQY K;  3JS6 A;  3AY9 A;  3CJC A;  4EP5 A;  1T05 A;  3V9Z A;  3T3F A;  5SZT A;  4JAX A;  1ASV A;  3D7E O;  4TSX A;  1Q9Y A;  3SJH A;  3NMU A;  1R59 O;  4PA1 A;  3EE8 A;  1EX4 A; 
#chains in the Genus database with same CATH homology
 3VQA A;  4L8R B;  5HRN A;  2YKM A;  4ELT A;  5CYM A;  3HPO A;  3THV A;  1BCM A;  1A5X A;  4FLV A;  3ASM A;  3V9U A;  4OPJ A;  3PO4 A;  1TKD A;  2DFH A;  4KO0 A;  3QEW A;  4JLH A;  3AVC A;  4FLX A;  4B9V A;  3CFO A;  1RT6 A;  4LY7 A;  4CJU A;  3AV9 A;  4M45 A;  1U45 A;  1UOC A;  3AO3 A;  4CJS A;  4CFB A;  3DLB A;  4CED A;  1RT7 A;  3LAK A;  4DF4 A;  3WNE A;  3DLR A;  1BI4 A;  5KRS A;  1FKP A;  1NK7 A;  3QEX A;  1J9A A;  1RDB A;  1N6Q A;  3VA3 A;  5HRR A;  5KI6 A;  1QE1 A;  4CHZ A;  4ZHR A;  3RMC A;  2ITG A;  2QK9 A;  1EP4 A;  1ZBF A;  1HMV A;  2I5J A;  2P5O A;  4CF9 A;  2P5G A;  3L2U A;  3OYC A;  1ASU A;  2D0B A;  4CJF A;  2KZM A;  3DLG A;  3DMJ A;  2ZQB A;  3B6O A;  2DY4 A;  4CHO A;  4B8C A;  5CYQ A;  1ZBL A;  1ZBH A;  3MXI A;  2G8K A;  3S3O A;  1Z25 A;  2LSN A;  4W5N A;  1FK9 A;  4CJE A;  3QEV A;  4B9L A;  4CEQ A;  1RBS A;  2F96 A;  5C42 A;  3HP6 A;  3VN5 A;  4W5T A;  5FRM A;  1L3T A;  4CFA A;  1DTT A;  1RNH A;  1C0M A;  3HVR A;  5HP1 A;  2XHB A;  1NK4 A;  1JKH A;  3I0R A;  3OYE A;  4DFJ A;  3LWM A;  4DFM A;  2HHS A;  3VQB A;  4HTU A;  4DTU A;  4CGD A;  1CZB A;  1ZBU A;  3TAR A;  3LP3 A;  3MEG A;  3ZSO A;  4CJL A;  2G8U A;  4K8X A;  4C8K A;  3CFP A;  1NJW A;  1QSS A;  4KFB A;  4KTW A;  1S1V A;  1LWE A;  3CFR A;  2HHW A;  1RT3 A;  3RR7 A;  1RTI A;  1W9H A;  3K5N A;  4FZY A;  4CJ3 A;  4FJM A;  1S1T A;  2HHX A;  1CXQ A;  1FXX A;  2E4L A;  1HPZ A;  3QET A;  1J53 A;  1TL1 A;  4M41 A;  1G15 A;  3E01 A;  3U6F A;  3SQ2 A;  4CIE A;  4AIL C;  4QCL A;  4CF8 A;  1TK5 A;  2Z1G A;  2P1J A;  3TAP A;  3OS1 A;  4KAZ A;  2BAN A;  3LAL A;  4DQR A;  1D9F A;  1WAF A;  2VG7 A;  1D9D A;  2HMI A;  2OZM A;  3AO1 A;  4M3Z A;  4FLW A;  4FZX C;  4DSF A;  3SPZ A;  1LW0 A;  4CJQ A;  1HRH A;  2YNG A;  4E1N A;  4FJJ A;  2HB5 A;  2IAJ A;  4ICL A;  1KVA A;  3AVB A;  3AVM A;  3NGY A;  1CZ9 A;  4YFU A;  4FXD A;  1TK0 A;  1S1X A;  3RRH A;  3DLK A;  4CEZ A;  4Z4H A;  4E19 A;  4ELU A;  1KVB A;  3SUQ A;  1RDD A;  1BQM A;  1LAV A;  3U3G A;  3L3V A;  1U04 A;  2D0A A;  3KK2 A;  4RW7 A;  2NUB A;  3TI0 A;  4KPY A;  1NJX A;  2GBZ A;  3OJU A;  4FW1 A;  1WSE A;  4JS4 A;  3L2W A;  4ID1 A;  5JS1 A;  5KGX A;  4E7L A;  1A5W A;  4DLE A;  4KHQ A;  3VQQ A;  1Z26 A;  1SUQ A;  3I0S A;  4KRF A;  1NK8 A;  3A2F A;  2Z1I A;  4CJV A;  1EX4 A;  3SUO A;  4FW2 A;  4EZ6 A;  1RT2 A;  4KHW A;  3NH2 A;  3KJV A;  2YNF A;  4DSJ A;  3V1R A;  3HL8 A;  4CFC A;  3PY8 A;  1CXU A;  5FRO A;  5HRS A;  3NCI A;  4JS5 A;  4AHV A;  3OVN A;  4ZTJ A;  3MXM A;  2YKN A;  2IC3 A;  3O3H A;  5D3G A;  4F3O A;  4GW6 A;  3AVH A;  3H08 A;  4CJR A;  4KHU A;  3OYD A;  4BE2 A;  1NKC A;  1Q8I A;  3IS9 A;  4E1M A;  2GV9 A;  1ITG A;  3MAQ A;  4CJ4 A;  2RKI A;  1VSI A;  3AVL A;  2HND A;  2FBY A;  3OYB A;  1UA1 A;  3DM2 A;  4IBN A;  4BE1 A;  3QER A;  4Y1C A;  3AVN A;  3VQ8 A;  2Y1I A;  1XC9 A;  1U4B A;  1NKE A;  1KSP A;  4Q5V A;  2E6M A;  2KFN A;  2ATQ A;  1DLO A;  3HPH A;  1NOZ A;  2GUI A;  4N5S A;  4C8O A;  2RF2 A;  4M3U A;  3SYZ A;  3HYF A;  4MFB A;  3QLH A;  1C1C A;  1QHT A;  3SNN A;  3VQ7 A;  4FJK A;  2Q3S A;  4CIG A;  1EKE A;  2XRI A;  3QO9 A;  4FLU A;  4OKE A;  3HT3 A;  3HJF A;  4CE9 A;  5FDL A;  4RG8 A;  4N76 A;  4W5O A;  1IKV A;  3TAE A;  4KRE A;  3KK1 A;  1QS4 A;  3ZSZ A;  3ZSY A;  1LW2 A;  1J54 A;  4CK3 A;  4IFV A;  1RCH A;  3F9K A;  4N56 A;  3QES A;  2HHV A;  3AVK A;  3SV3 A;  4IG0 A;  1IO2 A;  3KLE A;  3L2R A;  3D45 A;  4KKO A;  4DSK A;  4AHS A;  2G8F A;  2DFF A;  1GOB A;  2O4G A;  4HCC A;  1Q9X A;  4QAG A;  3MEE A;  3SZ2 A;  3T1A A;  3BDP A;  4GVM A;  1C0U A;  3TWH A;  3OYF A;  2OPP A;  4OGC A;  1KCF A;  4H4O A;  1NK9 A;  4Z4C A;  1WAJ A;  3K58 A;  1TAQ A;  5T7B A;  3RWU A;  3CM5 A;  1VSK A;  4CFD A;  4N41 A;  2HHQ A;  3LAN A;  4E3S A;  2B4J A;  5K14 A;  3OYH A;  1SKS A;  4CGI A;  4MQ3 A;  3QNO A;  2BE2 A;  5HBM A;  1JL2 A;  4DTR A;  4KI4 A;  1WSJ A;  2YNI A;  2XY6 A;  4E7H A;  4PUO A;  3QNN A;  3V81 A;  3OJS A;  4PQU A;  3HVT A;  4CHQ A;  1K6Y A;  2KQ2 A;  3HPG A;  2JGU A;  1LAW A;  2B5J A;  4CF0 A;  2D0C A;  4FJN A;  1NK6 A;  1HNV A;  1RBV A;  1VSH A;  1F21 A;  3HP9 A;  4DLG A;  1UWB A;  2X78 A;  4BWM A;  1VRU A;  5DK5 A;  3ZSR A;  4CJP A;  3O3F A;  1JLC A;  3VQ5 A;  3JYT A;  1KRP A;  4C8L A;  3IAY A;  4M3Y A;  4KTQ A;  2BGG A;  4M3T A;  1TV6 A;  1C1A A;  2FBV A;  3OYN A;  4QOZ B;  3RR8 A;  1U49 A;  4HUF A;  3SQ4 A;  3MXJ A;  1NJY A;  1QTM A;  2QKK A;  1BQN A;  2X74 A;  1BIS A;  3K5M A;  4DTP A;  3DRP A;  2HVH A;  4C8M A;  1IKX A;  4DTS A;  3TAQ A;  4DTO A;  1XHX A;  4CHP A;  3D0P A;  5HRP A;  4DWI A;  1W0H A;  3G0Z A;  4Z4G A;  1L3V A;  5C25 A;  3M8Q A;  4LH5 A;  4LD0 A;  4DFK A;  2HHU A;  3WNF A;  3OYL A;  4CGG A;  2IGI A;  3KLG A;  3P83 D;  3TAN A;  3LZJ A;  1RBU A;  5J2Q A;  2Y1J A;  3RTV A;  3V9S A;  4J2A A;  4DTJ A;  1RIL A;  3LZI A;  4AHC A;  3K59 A;  5J1E A;  4FJI A;  4CK1 A;  1YTA A;  4FJ9 A;  2F8T A;  4FJH A;  1SKW A;  3NBP A;  2ZE2 A;  2R7Y A;  1TKX A;  3C6T A;  4B9N A;  4FK4 A;  4JRQ A;  4OKK A;  3M8R A;  3B6P A;  3HM9 A;  1I39 A;  4CHY A;  2D5R A;  1CLQ A;  1REV A;  1B9F A;  4K8Z A;  4F3T A;  4I7F A;  2F8S A;  1DTQ A;  3SUN A;  3DLE A;  3NGZ A;  2QXF A;  4DQQ A;  1KTQ A;  4Y1D A;  1B9D A;  1BIZ A;  1I3A A;  1RT4 A;  1ZBI A;  3CG7 A;  3IG1 A;  4FJX A;  1U48 A;  3I8D A;  1IH7 A;  3AVA A;  3HST B;  4ZTF A;  4CEE A;  4LH4 A;  4BWJ A;  1TK8 A;  4H4M A;  3VQE A;  1RT5 A;  3KLI A;  3TAG A;  1SL2 A;  2OZS A;  4FK0 A;  3KIO A;  1WNS A;  4OGE A;  2ZD1 A;  3ZT1 A;  2WON A;  4CER A;  3LWL A;  1XHZ A;  1D5A A;  1TL3 A;  1BGX T;  3AA5 X;  3QEP A;  3OYJ A;  1BCO A;  4RW4 A;  1EET A;  2X6N A;  2VWK A;  3K5O A;  1FKO A;  1VSJ A;  3MED A;  3ZT3 A;  4R5P A;  1BHL A;  4AHU A;  3PO5 A;  4KHS A;  2IS3 A;  5KTQ A;  4E89 A;  3L8B A;  3ULD A;  5KGW A;  1R0A A;  1C1B A;  2IDO A;  3AA4 A;  3LPT A;  4IG3 A;  3LDS A;  5I42 A;  4YNQ A;  4BE0 A;  4CEA A;  3SV4 A;  3C94 A;  2PY5 A;  4ELV A;  4O0J A;  1RTD A;  4OPK A;  3K5L A;  5J2M A;  1SKR A;  1RDC A;  4BDZ A;  4KHY A;  2O4I A;  1XI1 A;  1BL3 A;  3NAE A;  3NF8 A;  1S6P A;  3QIN A;  3QEI A;  1KLN A;  1C6V A;  4CEC A;  4HUE A;  2XY7 A;  2KFZ A;  3L2Q A;  3ITH A;  5FRN A;  2VG6 A;  2AJQ A;  3PX4 A;  1S5J A;  4FZZ A;  1S9G A;  1IG9 A;  4DQS A;  2A1R A;  3S3M A;  3DI6 A;  3LPU A;  4DU4 A;  2G8W A;  4OLB A;  3CYM A;  2WOM A;  1LWF A;  2VG5 A;  4CJK A;  4E0D A;  4B3O A;  1X9M A;  2HHT A;  2YNH A;  3LP2 A;  4DQP A;  3F73 A;  4KB1 A;  3G10 A;  3NH0 A;  4E7K A;  2PYL A;  1TVR A;  1KVC A;  3DOK A;  4FCY A;  1X1P A;  2A1S A;  5HRO A;  2G8V A;  4NYF A;  1BIU A;  2YV0 X;  3V6D A;  2OPR A;  3KD5 E;  1S1U A;  1Y97 A;  4H8K A;  3OYM A;  4I2P A;  4FLZ A;  5CZ2 A;  3VQC A;  1NK5 A;  2Z1H A;  4IFY A;  1RT1 A;  3PUF A;  4OKJ A;  3RMB A;  3EY1 A;  3DLH A;  1LWC A;  3M8S A;  4FJ5 A;  1O1W A;  3PX6 A;  3V4I A;  4C8N A;  3K57 A;  4AHT A;  4FM2 A;  4CCH A;  4EP4 A;  4Z0U A;  4BDP A;  3SPY A;  1KFD A;  1XWL A;  4OVL A;  4CIF A;  1RDA A;  2KTQ A;  3OY9 A;  1N5Y A;  4HCB A;  5EU7 A;  1J5O A;  1NKB A;  3ALY A;  2EHG A;  1B92 A;  4O0I A;  3TAB A;  2B6A A;  3O4N A;  4B9T A;  3EZ5 A;  3PX0 A;  1D8Y A;  3VQD A;  4FJG A;  1JLA A;  4RW9 A;  3RRG A;  4E7I A;  1RBT A;  4F2S A;  3SQ1 A;  4Z4F A;  1KLM A;  1NOY A;  1VSM A;  2KW4 A;  3LAM A;  3U3Y A;  3SQ0 A;  4DSI A;  1HQE A;  1ZYQ A;  4Z4I A;  4JRP A;  1TKT A;  4KI6 A;  3KLF A;  1WSI A;  3OS0 A;  5HLF A;  4WE1 A;  3TAM A;  3NF6 A;  3SCX A;  3OS2 A;  1HQU A;  4UQG A;  3P1G A;  3TAF A;  3TR8 A;  1VSD A;  4O44 A;  4B08 A;  3NH1 A;  3SI6 A;  4BAC A;  4KV8 A;  4HHT A;  3AVJ A;  2G8I A;  4M42 A;  4J2E A;  5E41 A;  3LP1 A;  3OYI A;  1JLG A;  1TAU A;  2VWJ A;  1GOC A;  3EYZ A;  4O55 A;  2XY5 A;  4DTX A;  3ZSX A;  4CF2 A;  3K2P A;  1HYZ A;  4DU1 A;  1YTU A;  4PY5 A;  2RPI A;  4DFP A;  1JL1 A;  1IKY A;  5I3U A;  4KTZ A;  3AO2 A;  4G1Q A;  3KD1 E;  3ZT4 A;  1JLQ A;  3V1Q A;  3ZSV A;  1T8E A;  1L3U A;  4W5Q A;  3VQ4 A;  2DTU A;  1RBR A;  4M3X A;  3AVF A;  2YHB A;  4M3R A;  4RW8 A;  4KHN A;  2FBT A;  2PYJ A;  4FK2 A;  2XY8 A;  3S9H A;  3P5J A;  3T19 A;  4DU3 A;  1YT3 A;  3CM6 A;  2HW3 A;  4NCA A;  5C24 A;  3VQ9 A;  3OYK A;  1JLE A;  4J2B A;  4IDK A;  2P51 A;  4DMN A;  1BI4 B;  3DYA A;  1VSF A;  1SL1 A;  1ASW A;  4NCB A;  3AA3 A;  4CJW A;  3HXM A;  2G8H A;  5CZ1 A;  4B9M A;  4DTN A;  1EXQ A;  1WSH A;  3NF7 A;  4W5R A;  3ZSW A;  3LP0 A;  4AHR A;  4BDY A;  1QSL A;  1JLB A;  2E6L A;  3DRR A;  4FM1 A;  1JXE A;  3C95 A;  1JLF A;  3OYG A;  4DS4 A;  1WLJ A;  1HJR A;  4AH9 A;  4DG1 A;  3QIO A;  4O5B A;  2OYQ A;  3NF9 A;  1KFS A;  3AO4 A;  3L3U A;  5DMR A;  3WNH A;  3ZCM A;  1UA0 A;  2HVI A;  2YHA A;  3PV8 A;  4CJT A;  1WSG A;  3ZT2 A;  4FVM A;  4N47 A;  1C0T A;  3VA0 A;  1L5U A;  4F2R A;  4F4K A;  4FJ7 A;  4FLT A;  3KKS A;  3OYA A;  4B9U A;  1YVU A;  1NJZ A;  4CEF A;  2XO7 A;  4DS5 A;  3SUP A;  1IKW A;  4B9S A;  2OA8 A;  3ZT0 A;  1S6Q A;  4EZ9 A;  4DQI A;  3O3G A;  2QKB A;  1WN7 A;  3KKR A;  3AVI A;  4NYN A;  3S3N A;  3RMD A;  4J2D A;  1RTJ A;  3VQP A;  2FBX A;  4GMJ B;  4CGJ A;  1JXB A;  3VQ6 A;  1VRT A;  1A5V A;  3QIP A;  2W42 A;  3HO1 A;  4FJL A;  3M8P A;  2PZS A;  1MU2 A;  1VK0 A;  2X6S A;  1X9W A;  4FYD A;  3V9W A;  4DTM A;  1TGO A;  5SWM A;  4CF1 A;  1S1W A;  3WNG A;  4LSN A;  3NGI A;  4DSE A;  3ISN C;  1U47 A;  2ETJ A;  2RN2 A;  1L3S A;  1WSF A;  3NHG A;  3AO5 A;  1HNI A;  1GOA A;  4OLA A;  1QQC A;  4HVJ A;  1T7P A;  3FFI A;  4DF8 A;  4I9L A;  4CEB A;  4FLY A;  4CJ5 A;  4FM0 A;  4Q0B A;  3KTQ A;  4F8R A;  4RW6 A;  4ID5 A;  2FC0 A;  1HYS A;  3V1O A;  4LSL A;  4CES A;  3JSM A;  4DSL A;  2KZZ A;  3NDK A;  5J2N A;  3AVG A;  4XIU A;  5J2P A;  1NK0 A;  4CGH A;  3DRS A;  2OPQ A;  4Z4E A;  2DFE A;  4CHN A;  3HK2 A;  1RTH A;  3NFA A;  4KB0 A;  2HNY A;  2OPS A;  5KRT A;  3DOL A;  4PWD A;  5JS2 A;  1UAX A;  4B8A B;  1X9S A;  3UIQ A;  4NCG A;  3BGR A;  2EX3 A;  3SJJ A;  3CQ8 A;  1LV5 A;  2Z1J A;  4M3W A;  2JLE A;  4OJR A;  4CEO A;  1S9E A;  3IRX A;  1VSL A;  1QSY A;  1HYV A;  4CK2 A;  3RMA A;  4I9Q A;  1SV5 A;  2HNZ A;  2IOC A;  3L2V A;  3KK3 A;  4IKF A;  3AA2 A;  1VSE A;  4FJ8 A;  4O4G A;  3C6U A;  3ZSQ A;  3V9X A;  4EP5 A;  3O4Q A;  3NE6 A;  4I2Q A;  1T05 A;  3V9Z A;  3T3F A;  5CY4 A;  4CGF A;  5SZT A;  1ASV A;  4HUG A;  3KLH A;  4TSX A;  1T03 A;  1Q9Y A;  3MEC A;  1SL0 A;  2BDP A;  4PA1 A;  4E7J A;  1TKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...