1BIZA

Hiv-1 integrase core domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
147
Chain Sequence
b'VDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Three new structures of the core domain of HIV-1 integrase: an active site that binds magnesium.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 46
structure length 147
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bizA00
1VK0A 4FVMA 3HYFA 3SUNA 1Y97A 1JXBA 1HMVA 3KKSA 4FJ7A 1TAUA 4OLAA 3RMBA 3ZSRA 2XRIA 1IO2A 1HYVA 2FBVA 4OGCA 1KRPA 1SKSA 1CXUA 2G8HA 1CZ9A 1IG9A 1C0TA 3RMAA 1VSDA 3QEPA 1KVCA 2WONA 1NK6A 2BE2A 2YNGA 3KK3A 2GV9A 3AVKA 3V9WA 4CFBA 3CFPA 4CF2A 2PZSA 2P51A 2R7YA 3KLIA 4Q0BA 4F8RA 4KAZA 4DU4A 1CZBA 2W42A 4CEBA 3SZ2A 2IGIA 4B9UA 1LWCA 4FJ8A 4IFYA 4CEOA 4KHWA 1KTQA 2VG5A 4RG8A 3VA3A 4KI4A 3AVCA 3V9XA 1GOAA 1BL3A 4M3UA 1TK0A 4B9MA 1TKTA 4IG0A 4BDPA 2KFZA 2YHAA 3LWMA 4ELUA 4CERA 4GVMA 3DLKA 1RNHA 3MAQA 3QESA 3RRGA 4C8MA 1HRHA 3G0ZA 3OYIA 3QNOA 3MXMA 3V9UA 3PX4A 4EZ9A 2PYLA 1BIUA 4AH9A 3S3MA 3WNFA 4I9QA 3IRXA 1J54A 1EETA 3DLRA 1RBVA 1ZYQA 4FM2A 1D5AA 1RDCA 1WSHA 3VQ6A 4JLHA 4CK2A 4J2EA 4HUEA 2Y1IA 2DFFA 4M42A 2G8WA 4IDKA 1N5YA 1W0HA 4PA1A 3NE6A 4JRPA 5HP1A 3NHGA 4FJXA 4B9NA 2DFHA 4TSXA 1J9AA 1BIZA 3RMDA 4CGHA 2HHVA 2HHXA 2XY8A 4CEAA 3V1RA 3SQ2A 2YKMA 4N5SA 4H4MA 3LP0A 5HRPA 4Z4FA 1IKWA 3KD5E 1JLQA 1QS4A 5DK5A 2Q3SA 4DTUA 3OJSA 3LZJA 3OVNA 3ZSOA 1X9SA 4C8LA 4FK4A 3HP9A 1WSIA 1WAJA 4GMJB 2A1RA 5JS1A 3WNEA 1IKYA 1QQCA 2B6AA 4B8AB 3LP2A 5I3UA 3ZSZA 3F9KA 1NK4A 1VSIA 4FW2A 2KTQA 2WOMA 4DSFA 1RT5A 3DLBA 3LANA 3WNGA 3KK2A 5CY4A 1S1UA 3VQPA 5HBMA 2HNDA 4M3TA 4ELVA 4DLEA 4ICLA 2JLEA 1WN7A 4Y1CA 3LWLA 4DWIA 1DTQA 2VWKA 3OYAA 4E7LA 1ZBLA 4DTMA 1NK0A 1L5UA 1LW0A 3ZSVA 3TANA 3VQ7A 1RT7A 2GUIA 2LSNA 4FJHA 3OYMA 1JL2A 3OJUA 2YNHA 1T05A 2O4GA 3V9ZA 5HROA 4M3ZA 1UOCA 4KKOA 3ZSWA 4F3TA 2OPSA 3ALYA 1S6QA 3DLEA 3NGYA 3O4NA 1ZBIA 4LD0A 3AVFA 4DTRA 4BWJA 3AVJA 3NH2A 1WNSA 3L2VA 3HM9A 4NCBA 3VQBA 3EZ5A 4DSLA 1J53A 3OS2A 4WE1A 2E6MA 3D0PA 3UIQA 4EP4A 3SYZA 3E01A 4CF8A 4FLWA 2PYJA 1C6VA 4KHQA 3AO5A 2FBYA 1S5JA 1LAVA 2XHBA 4FJ9A 1UA1A 5D3GA 4Z4EA 4JS5A 3T1AA 3PX6A 3ZT0A 1TK5A 1HJRA 3AO4A 1VSKA 4E3SA 4DSEA 1SKRA 2BDPA 3P5JA 2G8UA 3MXIA 4LH4A 3SJJA 1S9EA 2I5JA 1TL3A 1I39A 4HCCA 4IFVA 4O5BA 4B3OA 2OPPA 3O3GA 3OYEA 3QNNA 2F96A 4C8KA 3K57A 2DTUA 2QXFA 4DLGA 2HB5A 1HYZA 3NBPA 4I7FA 5KGWA 1KVBA 3MEDA 4Q5VA 2HHSA 1RTDA 1ZBUA 4Z4IA 3SI6A 3QLHA 3SQ4A 2HW3A 1U49A 3K5NA 1KFSA 3AA2A 1BHLA 1JL1A 2FC0A 2P5GA 4B9SA 4CJ3A 5CZ1A 3KTQA 4CJWA 3LPUA 5C25A 4DFKA 4FXDA 2HHTA 3RWUA 1TK8A 1GOBA 2A1SA 3MXJA 3ZCMA 4RW8A 5C42A 4XIUA 3L2WA 3PY8A 4OLBA 1WSEA 2RPIA 1EXQA 4O55A 1HQEA 1REVA 3BGRA 3LZIA 3I0RA 3NF8A 4FLXA 3K5LA 3VQDA 1FXXA 1RILA 3BDPA 3CQ8A 3O3HA 5J2QA 3KK1A 4KPYA 3AVAA 3OYCA 2DY4A 3A2FA 4FLUA 2OZMA 1EKEA 2DFEA 1RT4A 3PUFA 3VQ8A 4B9TA 1NJZA 3P1GA 4KREA 5E41A 2NUBA 3QEIA 4KTQA 3AA3A 1S9GA 4AHSA 5KGXA 5EU7A 1SV5A 1NK8A 1T8EA 1BQMA 2B4JA 3M8PA 3QO9A 4Z0UA 5KRTA 3OS0A 1LAWA 4CGGA 2KW4A 1VSJA 5HRSA 4KHSA 2P1JA 4FM1A 4FJLA 3NH1A 3I8DA 4F2RA 4CGFA 3LP1A 4DTJA 4CJPA 1U48A 3HP6A 4KB1A 2X6NA 3C6UA 4FK2A 4E19A 1L3UA 1KLMA 4KHYA 2ZQBA 3AO3A 1QE1A 3OYNA 2Z1JA 1KCFA 3HL8A 4OVLA 4CFCA 3TABA 3CM5A 1ZBHA 3NGIA 3WNHA 3CFRA 1RCHA 1Q9YA 4C8OA 4CGJA 2QK9A 3DLHA 3T3FA 4CHOA 3H08A 4CEDA 4CEZA 3V81A 3EY1A 3NDKA 4BE2A 3LAKA 3HO1A 2YHBA 3SNNA 4N56A 4M3WA 2KFNA 4CJVA 3O4QA 4BE0A 1L3TA 2Z1GA 4CFDA 2PY5A 3HVTA 3MECA 3ZSXA 4CIGA 1WSGA 4N47A 4YNQA 4CJTA 3K58A 3O3FA 3V1OA 3TARA 4DQQA 1VSMA 3RMCA 4FLZA 3HSTB 3OYHA 2FBXA 1BGXT 1XHZA 1HNIA 3D45A 3DM2A 4CJ4A 4CHYA 4FJGA 4CJRA 4KTWA 4DTOA 3TR8A 2HHWA 2AJQA 1SL0A 1VRTA 3V1QA 3IS9A 1VSHA 3IG1A 3LP3A 3TAQA 4ZTFA 1HYSA 2ITGA 3AA4A 4Y1DA 3K59A 3SUPA 4I2PA 2HVHA 1SL1A 2HMIA 1JLGA 4BWMA 4E89A 5SZTA 1FK9A 4M45A 4DU3A 2OPRA 3DOLA 3VN5A 4OPKA 3IAYA 3TAGA 4HHTA 3G10A 4DSIA 1VRUA 2Z1IA 4CGIA 2YNFA 2F8TA 4UQGA 2IC3A 3TAMA 1K6YA 3LAMA 2HVIA 4HUGA 2YNIA 3DI6A 1RBTA 4I9LA 4CEFA 1FKPA 4DF8A 1QSLA 1G15A 1S6PA 1RTJA 3ZSYA 5FDLA 3PO4A 3SCXA 2OYQA 3KLFA 3RRHA 4LSNA 4FLTA 2OZSA 3T19A 4AILC 1Q8IA 4KB0A 1BI4A 4ELTA 1RTIA 2IS3A 4FLYA 1JLEA 4NYFA 4CF1A 4OKEA 2Y1JA 3ZT1A 4DQPA 1TVRA 1XWLA 2YKNA 4KO0A 4H4OA 1TGOA 4C8NA 4CJKA 3OYGA 3EYZA 4FM0A 4AHVA 4LY7A 3HPOA 4LSLA 3L8BA 3MEEA 2RKIA 1JLFA 3M8QA 4DF4A 1WAFA 5HRRA 4FJMA 4JRQA 1Q9XA 2Z1HA 4CGDA 3VA0A 3AV9A 3ISNC 2EX3A 4K8XA 3NF7A 4KV8A 4CJEA 1BI4B 1XI1A 2E4LA 1C1CA 5KRSA 4NCAA 3KIOA 3CM6A 2HNYA 3QIOA 3TWHA 2OPQA 3B6PA 4CF9A 2BGGA 1VSFA 2RN2A 3CYMA 1TKXA 1ASVA 3SQ1A 4HCBA 3HPHA 1NJYA 1QTMA 4DSJA 1T03A 1BQNA 4AHCA 1D8YA 3CFOA 1U45A 1RT3A 1HPZA 3AVIA 4CHPA 1NKEA 4FZZA 5CYQA 4M41A 3AVBA 3NFAA 2X74A 1X9MA 1DLOA 5DMRA 3AO1A 4CEQA 4CHZA 4L8RB 4CK1A 2HHQA 1Z26A 5I42A 2BANA 3RR7A 4I2QA 4B8CA 4NCGA 3HVRA 4NYNA 3QETA 1L3SA 4K8ZA 1YTUA 3HPGA 4O0IA 4B08A 1VSLA 1W9HA 2G8KA 1RT2A 3VQAA 4QCLA 3LPTA 4DS5A 1XHXA 1NOYA 1T7PA 3M8RA 3HXMA 1VSEA 4FZXC 1BCOA 3AO2A 3ZT2A 4HTUA 5J2PA 1NJWA 1O1WA 3LDSA 4EZ6A 4F4KA 3QEXA 5KTQA 1IKXA 1Z25A 3DMJA 3OYDA 3THVA 3S9HA 3L2RA 3HJFA 2D0CA 4W5RA 2B5JA 4DU1A 4CJFA 3NF9A 5CYMA 4E7KA 1U4BA 1KSPA 3SPYA 1JLAA 3C6TA 4G1QA 1L3VA 1RDDA 4E1NA 4O44A 1NK9A 3VQ9A 2YV0X 3SV3A 3VQ4A 2QKBA 3DYAA 4J2AA 1LV5A 1NK5A 4CJ5A 3SUQA 3OYKA 1RBUA 1RDBA 3NH0A 4PUOA 1NK7A 3NF6A 4DFMA 3AVMA 3KLGA 3SUOA 4KRFA 2KZZA 2E6LA 1ZBFA 4IBNA 4M3XA 4B9LA 1X1PA 3AVLA 3S3NA 2VG6A 2X78A 3ZT4A 1RBSA 4ID5A 1SUQA 4Z4HA 1JKHA 4CJLA 4DTPA 3U3YA 3TI0A 1IKVA 1A5XA 2XO7A 4KI6A 1HQUA 1B92A 1NOZA 4Z4CA 4M3YA 1B9FA 4HVJA 3M8SA 4J2DA 2QKKA 1KFDA 4OPJA 3OY9A 4DS4A 3PV8A 1JLBA 3P83D 3U6FA 2KQ2A 3KLHA 4BDYA 3HK2A 5SWMA 3L2QA 5J1EA 1LWEA 4DTSA 3V4IA 1C0UA 1XC9A 3PO5A 2KZMA 1WSFA 1IH7A 4CCHA 2XY7A 3QIPA 1C0MA 4DQIA 3AVHA 1D9FA 5FRNA 4Z4GA 4O0JA 1ASUA 2G8IA 5K14A 1S1WA 3ULDA 3SV4A 3JYTA 4OJRA 4O4GA 3QINA 4CHQA 4DFPA 4DTXA 3FFIA 3AVGA 3QEWA 1SL2A 1QSSA 2FBTA 1LW2A 3ITHA 4OKJA 4QAGA 3RTVA 4ZTJA 2P5OA 4FK0A 3NAEA 4N41A 4FLVA 1CLQA 3DLGA 1NJXA 3I0SA 4EP5A 3PX0A 1KLNA 4FYDA 3KJVA 3CG7A 1U04A 1YVUA 4FCYA 2HNZA 3TAFA 4OKKA 4E0DA 4CK3A 5HLFA 4FJJA 1S1VA 5JS2A 2X6SA 3SPZA 4MFBA 1TL1A 2D5RA 4H8KA 1D9DA 4FJNA 1TAQA 3LALA 4PY5A 2VG7A 2ZE2A 4OGEA 1A5VA 4AHTA 4CJSA 1WLJA 5HRNA 4DQRA 2D0BA 1ASWA 4CECA 1RTHA 3L3VA 4AHUA 3KLEA 3JSMA 1UAXA 4F3OA 2G8VA 4N76A 1EX4A 2G8FA 1BISA 2IOCA 1QHTA 3TAEA 2JGUA 1X9WA 3L3UA 2D0AA 3QEVA 4F2SA 3AA5X 5C24A 1UA0A 4J2BA 1RDAA 3ZSQA 3OS1A 1ITGA 4MQ3A 3K5MA 1F21A 3DRSA 4RW6A 4CF0A 4KHNA 4IG3A 4RW7A 2GBZA 1A5WA 3VQCA 4FJIA 2IDOA 4FZYA 4CFAA 4DTNA 5J2NA 4PQUA 2EHGA 4BACA 2ETJA 1SKWA 3RR8A 4E7IA 1R0AA 5FROA 4BE1A 1KVAA 1S1XA 5KI6A 1NKCA 3MEGA 3KD1E 4YFUA 4FJKA 1J5OA 4DSKA 4DQSA 1B9DA 2F8SA 5CZ2A 3C95A 1EP4A 1GOCA 3K2PA 4CIFA 4R5PA 3OYJA 3NGZA 4B9VA 4QOZB 3U3GA 3V9SA 4FJ5A 3B6OA 4DG1A 4GW6A 4E1MA 1C1BA 1C1AA 1DTTA 3VQEA 2HHUA 3OYFA 2IAJA 1RBRA 1JXEA 1YTAA 3V6DA 3S3OA 2OA8A 3NCIA 4LH5A 1HNVA 2XY6A 4BDZA 1FKOA 1QSYA 3DOKA 1CXQA 3ASMA 4KTZA 2O4IA 1S1TA 2ATQA 4W5OA 4W5QA 3TAPA 4M3RA 2XY5A 4ID1A 5J2MA 2RF2A 1UWBA 1WSJA 4RW9A 4DFJA 3HT3A 3DRRA 1I3AA 3KKRA 4CESA 4E7JA 3QERA 5FRMA 1JLCA 3OYBA 1TKZA 4W5NA 1U47A 5T7BA 4KFBA 4JS4A 3K5OA 1NKBA 2VWJA 1N6QA 1MU2A 4HUFA 3L2UA 3F73A 3VQQA 3VQ5A 3C94A 1TKDA 4PWDA 4DMNA 1TV6A 4CJQA 4W5TA 4CE9A 4CJUA 4E7HA 4RW4A 4AHRA 4CIEA 3AVNA 3OYLA 4KHUA 1BCMA 1LWFA 3DRPA 1YT3A 4FW1A 1RT6A 4CHNA 2ZD1A 4ZHRA 4CEEA 4IKFA 3SQ0A 1RT1A 3ZT3A
chains in the Genus database with same CATH superfamily
3SUNA 2E1ZA 1JXBA 2QW9A 3KWGA 3RMBA 1HYVA 2FBVA 4YOVA 1KRPA 3HSCA 5EOYA 1SKSA 1CXUA 1M90O 2A5XA 2HBJA 4QS8A 1C0TA 4RCHA 3BY5A 1KVCA 2ZWHA 1NK6A 2ZJQL 2E2OA 5CHIA 1ZBSA 1W2BM 1CZBA 4CEBA 4FJ8A 4CEOA 4KH6A 1MA9B 2VG5A 4H5RA 4B9MA 4JN4A 4IG0A 4BDPA 2KFZA 1BUPA 5AQRA 1Q18A 3DAWA 3DLKA 1RNHA 1HRHA 3HM8A 1VQKN 2Q36A 2PYLA 1BIUA 4I9QA 3VTIA 3IUCA 4B3SK 1ZYQA 1D5AA 1RDCA 1WSHA 2FSKA 2G8WA 1W0HA 4PA1A 3K9JA 5HP1A 1NG9A 4CGHA 3F5TA 4U7BA 2YKMA 3LP0A 2YHXA 4Z4FA 2E2QA 5DK5A 3OJSA 1BU6O 1X9SA 3SAHA 4FK4A 4PKIA 1YITN 4DB3A 1WAJA 4GMJB 1K8AO 4CBUA 1IKYA 1QQCA 2B6AA 3ZETA 4FW2A 3CJ7A 3KK2A 5M1KA 5CY4A 3VQPA 2HNDA 4QS9A 4PL8A 2Q97A 4ICLA 5KPRA 1WN7A 3LWLA 5CR4A 1ZBLA 2VWKA 4E7LA 1L5UA 5BPLA 3OJUA 5HROA 5LY3A 2OPSA 1ZC6A 1FW6A 4BROA 3CJCA 5MLCQ 5BR9A 4YOWA 3VTHA 3R8EA 3AVJA 3NH2A 4NCBA 3VQBA 3EZ5A 3E01A 1N36K 4JKAA 3EKSA 5F2RA 1UA1A 4BC5A 3CC2N 3DJCA 1TK5A 3AO4A 1VSKA 1K9MO 1VHXA 3MXIA 4LH4A 3SJJA 1NGBA 2I5JA 3A5MC 5C12A 2OPPA 3OYEA 4CZFA 4DLGA 4I7FA 5M1PA 4Z4IA 4NXMK 4JD2B 2W6LA 2WUSA 3LPUA 4DFKA 4FXDA 1YJNN 1TK8A 3CJ9A 3MXJA 4OLBA 3PY8A 1WSEA 4DV7K 1HQEA 4E1JA 3I0RA 3I33A 3K5LA 4IXCA 4DV4K 3CQ8A 2D1KA 3O3HA 1NNEA 3KK1A 2ZF5O 4KPYA 2E20A 3AVAA 4YDUA 3IDHA 3PUFA 5AQIA 1NJZA 3P1GA 4F9OA 3RSEA 3QEIA 4KTQA 4AHSA 4DCHA 4JI5K 1GLJO 3CETA 1SQKA 4CBWA 1BQMA 2B4JA 3M8PA 3J8AA 3OS0A 5GAHP 1T6DA 4CGGA 2KW4A 3AGRA 4FM1A 4FJLA 4JK7A 3U9DA 1X3NA 3J7ZO 3KZBA 2X6NA 4BC2A 4E19A 5IWAK 1L3UA 4A5AA 4KHYA 2ZQBA 3QBXA 1QE1A 3HL8A 3CM5A 3CFRA 1GLAG 2E1YA 2QK9A 3FR0A 4CEDA 2Q0RA 3K9KA 4MO5A 2NNWA 4ILGB 4A57A 5AQLA 3ZEUB 3HVTA 3MWPA 2FXUA 2VQFK 1C0GA 4YNQA 2DPNA 3O3FA 3V1OA 4DR3K 4GV6A 3TARA 3O9SA 4H0PA 4DR4K 4H0XB 3FZHA 1BOTO 1Q82O 4CJ4A 3MN6A 3HRGA 4CHYA 1GLLO 4BRIA 4R79A 4JKCA 4DUYK 5AQHA 1HYSA 1VSHA 3LP3A 3AY9A 4LFBK 2QWLA 4X64K 3K59A 4IOAL 2AA4A 4O5FA 2OPRA 3VN5A 3TAGA 3KVGA 5ADXH 4CGIA 5AQPA 3VETA 1W7AA 2UYTA 1RTJA 2OYQA 2OZSA 1QVGM 4KB0A 3D2FB 2QI2A 1EWRA 3SYZA 3OYGA 1TGOA 4CJKA 1VQON 4FM0A 2CH5A 3L8BA 3E9LA 3MEEA 3BEXA 5GINA 1YXQA 3ISNC 1DGKN 2EX3A 3ZX2A 4CJEA 3BP8A 2E4LA 2HNYA 3B6PA 1YUWA 3CYMA 4HCBA 1ASVA 3HPHA 3WT0A 1NJYA 4AHCA 3AVIA 4M41A 3WXLA 3AVBA 2O8CB 2QWQA 4CHZA 4L8RB 3D7EO 2HHQA 3VERA 4I2QA 3SLCA 3HVRA 3QETA 2O8BA 1NMNA 4B08A 1VSLA 1W9HA 1RT2A 4YHHK 2VQEK 4DS5A 3MCAB 1NOYA 3WXKA 2UXBK 1YVNA 3FZMA 2A6AA 1QVFM 1KXPA 1SAZA 4HTUA 1NJWA 3CCRN 2QA4N 3VGLA 3CCUN 4JI3K 4BVPA 3THVA 4LFCK 3HJFA 4W5RA 2HBKA 3OTOK 1N32K 4Z94A 2OTLN 4BRFA 2EWSA 4E1NA 2OANA 3VQ9A 2YV0X 3SV3A 3VQ4A 3DYAA 4J2AA 3OYKA 5M1OA 3NH0A 1HPMA 1NK7A 3NF6A 5LL6Z 3AVMA 2KZZA 5FPMA 4CJ7A 2E6LA 1NGCA 4B1ZA 1X1PA 4YOUA 4YDUC 4DTPA 3L4IA 1NOZA 3CPEA 1KFDA 3OY9A 4CZEA 2KQ2A 2VGMA 3H1VX 5SWMA 4DTSA 3PO5A 2P9PA 1WSFA 3VGKA 4DQIA 1D9FA 2AP1A 3O1BA 5K14A 2NRWA 2P9LA 4CHQA 3AVGA 4QAGA 4FK0A 5AFUH 3NAEA 3DLGA 1KLNA 5GADP 3KJVA 3CG7A 1GLEG 3TAFA 5HL7L 4A59A 1I94K 4CK3A 4MFBA 2D5RA 1D9DA 5AZIB 4PY5A 3LALA 1XMQK 2RHKA 2RE2A 4CJSA 5HRNA 2D0BA 4LFAK 2O8DB 3L3VA 4F3OA 4YOXA 1EX4A 3C6AA 1X9WA 3L3UA 3QEVA 3N4QA 5C15A 4J2BA 1RDAA 5BREA 1ITGA 2F7TA 1XNRK 1P90A 4IG3A 1IBMK 4PQUA 2EHGA 1IJJA 4Y0WA 5AQQA 1BO5O 3RR8A 2PAVA 5FROA 1KVAA 5GIOA 4DSKA 2W41A 4B9VA 1GOCA 2UUCK 4OX9K 2YJFA 1Q81O 4LC9B 1RBRA 4IDHA 1T3VA 3NCIA 1IV0A 3A5NC 1HNVA 1QSYA 1FKOA 3F2KA 3ASMA 1S1TA 4H5VA 2XY5A 4A5BA 4FWOA 4RW9A 1UWBA 3Q7CA 3DRRA 3KKRA 3HT3A 4PKHA 4KFBA 4JS4A 1LOTB 4WYBA 4YORA 3L2UA 1G99A 3C94A 2A3ZA 1HX1A 4CJQA 4CJUA 3M5RA 4CIEA 3NVKA 3CCQN 3PIPL 1LWFA 3DRPA 1YT3A 1RT6A 4CHNA 4IEEA 2VWBA 2WBNA 1L3SA 1RT1A 3ZT3A 4BRGA 1Y97A 1HMVA 3GBTA 3KKSA 4FJ7A 1TAUA 5AQVA 3ZSRA 3JXUA 1XC3A 1RFQA 1K8KA 2G8HA 1CZ9A 1HNZK 2WONA 2YNGA 3L0QA 3VOVA 4B1VA 3M6GA 4Q0BA 4KAZA 3LM2A 4GKJK 3SBGA 2W42A 2FLOA 3UKRA 1LWCA 4B9UA 3LDPA 4KI4A 5BPMA 3ULEA 1KAZA 1GOAA 1BL3A 3CCEN 4BY9C 2A41A 2YHAA 3LWMA 4ELUA 4GVMA 4BRKA 3OYIA 3MXMA 4AH9A 3WNFA 3DLRA 3QMLA 4JLHA 2IVOA 3P38A 2DFFA 3H3OB 1VQPN 3NE6A 3DLLL 4FJXA 1QQOA 4JKHA 1J9AA 1BIZA 4RWTA 5F1XA 4FOIA 3DWLA 4BRCA 1JLQA 4KH5A 1BA1A 3LDNA 3ZSOA 2I7NA 3B8AX 3CCMN 1R59O 1HKCA 1WSIA 4JNEA 3WNEA 4B8AB 3ZSZA 4EHTA 2WOMA 1HLUA 1RT5A 2QWOA 3DLBA 4M3TA 5BN9A 5AZJA 4ELVA 4FWNA 4HTLA 2HF3A 3OYAA 1NK0A 3VQ7A 2HHHK 1JL2A 1NGGA 1WUAA 4M3ZA 3ZETB 4KKOA 3ZSWA 3NGYA 1ZBIA 2V7ZA 5A2QO 1QHAA 4IJNA 4JI8K 4WE1A 2HMPA 1S5JA 3AO5A 1NMDA 3VF4A 3CCLN 4Z4EA 4JS5A 3PX6A 1HJRA 4BVOA 4IFVA 4O5BA 3O3GA 3QNNA 2DTUA 3SMPA 1RTDA 3QLHA 3SQ4A 3K5NA 2FC0A 4B9SA 3L4QA 4IFEA 1GOBA 2A1SA 4XIUA 5C42A 4RW8A 4BR2A 4O55A 1REVA 3BGRA 3THYA 4MDBA 4FLXA 1FXXA 3DXKA 3THWA 4CZGA 5J2QA 2BUPA 3CJAA 3LDOA 3OYCA 3O80A 4FLUA 2OZMA 4B9TA 3VQ8A 4MLEA 4M63C 4H0YB 3U4LA 2GWKA 5ELZA 5JICA 3QO9A 4Z0UA 3EN9A 1LAWA 4BRHA 1VSJA 3F9MA 4GV3A 4KHSA 3I8DA 4CJPA 3T1HK 3R3LA 4KB1A 3RSEB 1KLMA 5AQKA 3MMVA 3OYNA 4OVLA 3TABA 3NGIA 3EE8A 3WNHA 1GLDG 1Q9YA 4RTFD 3QICA 2KLAA 4CHOA 4JI2K 4CEZA 3V81A 3EY1A 4LF5K 3NDKA 3D6RA 3HO1A 2V51B 4K41A 4N56A 2GTDA 1L3TA 2Z1GA 5KQ8A 3ZSXA 4N47A 1ZXOA 2BH1A 1YI2N 3M3ZA 1VSMA 3RMCA 4FLZA 3OYHA 2FBXA 5GAGP 3D45A 4DR2K 4ISGA 5FLXO 4DTOA 4CBXA 3TR8A 4MO4A 1SL0A 3CF5L 3J81O 1T6CA 1VRTA 4YOTA 3IG1A 4ZTFA 3VF6A 3L6QA 3VF2A 3SUPA 4I2PA 3BZKA 4JKFA 1JLGA 4BWMA 4IOCL 4BREA 4FVUA 2FF3B 1VRUA 3CMEN 2F8TA 4UQGA 2IC3A 3TAMA 4X62K 2HVIA 2YNIA 3DI6A 4I9LA 4DF8A 4CEFA 4V19S 1ESVA 1S6PA 2FF6A 1OH8A 5FDLA 4FLTA 4AILC 4BG9A 4ELTA 1YAGA 2IS3A 4H03B 1JLEA 4FLYA 4CF1A 2Y1JA 3TSUA 4CZMA 1TVRA 1XWLA 2YKNA 4C8NA 4H4OA 1EWQA 4EIAA 4LY7A 3HPOA 4ISEA 4LSLA 2NRXA 4JKGA 3M8QA 2HBLA 1Q9XA 3VA0A 4CGDA 2UUBK 3ENBA 4YOYA 4K8XA 3NF7A 4KV8A 2IVPA 1C1CA 3VEXA 3RVCA 3KIOA 5KRSA 4WFNL 3TSPA 2BGGA 2RN2A 4OPAA 4DV5K 3EE9A 4H5TA 4BRPA 1T03A 2PFUA 3CFOA 5LJVA 1HPZA 1SZ2A 4CHPA 1NKEA 3NFAA 4OPHA 5BRDA 5DMRA 1BWFO 5I42A 5E84A 3C7NA 4NCGA 3O1WA 4NYNA 4DV0K 4K8ZA 4H0TB 1YTUA 4O0IA 3VEOA 2W40A 2G8KA 3HXMA 1N33K 5AQSA 1JCEA 4IOXA 3AO2A 5ADXA 4IO9L 3CC4N 4EZ6A 4F4KA 1Z25A 2O8BB 3L2RA 2D0CA 2B5JA 5BRHA 5CYMA 1U4BA 3ATUA 3SPYA 1JLAA 4G1QA 4O44A 2ASMA 2KKZA 2JWLA 2QKBA 4CJ5A 4A2BA 1RBUA 4NO7A 1RDBA 3U8XA 3KLGA 3SUOA 4M3XA 4JI0K 3S3NA 3ZT4A 4AQYK 1GLFO 3NVMA 1RBSA 4JV5K 3U3YA 2ASPA 3N4PA 2XO7A 3CCVN 4KI6A 1TUYA 1B92A 3M8SA 5JVGL 1JLBA 3P83D 1TUUA 3AAQA 4LF4K 3S41A 1LWEA 4JI7K 3G6EN 2XY7A 4GVEA 1C0MA 5FRNA 1ASUA 1VQ9N 3JYTA 3FFIA 3QEWA 3RTVA 1N8RO 2P5OA 4KBOA 2J4RA 4FLVA 3O9QA 1CLQA 4EP5A 3ZLJA 4FWQA 2VYPA 1U04A 4CZKA 1YVUA 2P9PB 4GNIA 4OKKA 5HLFA 4JEPA 3TTDA 2P9LB 4FJNA 3OBWA 4OGEA 3MN9A 3VEZA 4NB4A 1ASWA 4CECA 5KPTA 1RTHA 4BRMA 1UAXA 4BR5A 3A8YA 2G8FA 1NGFA 3AA5X 3ZSQA 4PKGA 4MQ3A 3K5MA 2VGNA 4BC3A 4RW6A 4CF0A 4IO8A 3CCJN 1A5WA 3VQCA 2IDOA 4FZYA 4CFAA 1Y64A 4JKDA 2YHYA 1NKCA 1S1XA 2JWKA 3KD1E 4YFUA 2NRHA 3DXMA 2F8SA 2ASOA 5CZ2A 5AQJA 3K2PA 4CIFA 3H1QA 3OYJA 1E3MA 4QOZB 3U3GA 3V9SA 1ATSA 4DG1A 1DTTA 2D0PA 1JXEA 3FZKA 1YTAA 2UU9K 3S3OA 3FLCO 4GKKK 4LH5A 4BDZA 3SK3A 3PSFA 2O4IA 3TAPA 4ID1A 4A61A 1QQNA 4CESA 5AFUA 3QERA 5FRMA 3OYBA 2IVNA 4W5NA 3EL2A 3K5OA 2NZTA 1TKDA 1EQYA 4RW4A 3AVNA 3SQ0A 1IH7A 4ZHRA 4CEEA 4XH5A 1VK0A 4FVMA 3HYFA 3EKUA 4LF7K 5EX5A 3GOIA 2XRIA 1BDGA 4OGCA 3QFUA 4CZHA 1KQSM 1IG9A 3RMAA 3KK3A 3WXJA 1NGAA 2GV9A 1XMOK 3V9WA 4GY2B 2PZSA 4M7XA 5LMNK 3CXCM 4LF8K 3HZ6A 3TU5A 3SZ2A 2IGIA 4KHWA 1NLVA 1KTQA 3R6MA 4RG8A 3VA3A 3CI5A 4H5NA 4M3UA 3AARA 1K8KB 3NMUA 4H5WA 5FPEA 3MAQA 3QESA 3V9UA 3PX4A 1DT9A 1RDUA 1U2VB 4JKEA 3S3MA 2QWMA 1J54A 3VESA 4FM2A 2CGJA 3ZEUA 4K25A 3ULEB 3VQ6A 3D2EA 4CK2A 4J2EA 4HUEA 2Y1IA 4M42A 4WCEL 4IDKA 1N5YA 4JRPA 2YI1A 1ILYA 3WQTA 4DR1K 4CVNE 3WXMB 3NHGA 4B9NA 3SBTA 1YJ9N 1QZ5A 2DFHA 3P4IA 4TSXA 3RMDA 2HHVA 2XY8A 5C2FA 3ZX0A 4N5SA 4I6MA 4DHYA 3CMAN 1IKWA 3LZJA 3OVNA 3C6HA 2HBMA 1VQ5N 4K0KK 3O5BA 1DKGD 4CW7B 2HF4A 2P9KA 4AM6A 5BPNA 3F9KA 4DV2K 4DSFA 3LANA 4C1NI 5HBMA 2P9UA 3PIOL 4DLEA 2JLEA 4NXNK 4Y1CA 4DTMA 3ZSVA 1RT7A 2GUIA 4FJHA 1D4XA 4FWPA 2YNHA 1VQMN 3IFRA 1UOCA 4F3TA 3ALYA 3O4NA 3FZFA 3AVFA 2P9IA 5AZJB 4DTRA 4BWJA 3HM9A 1WNSA 2QWNA 3L2VA 4DUZK 5JMVA 4DSLA 1OH7A 3OS2A 2E6MA 1C6VA 4CZLA 4KHQA 1LAVA 2XHBA 3THXA 3WEEA 4WQ5C 1HKBA 1SKRA 1J6ZA 2G8UA 2W6KA 2V52B 3CIPA 4C8KA 2F96A 2P9NA 5AQTA 2QXFA 2HB5A 1HYZA 3NBPA 5KGWA 1KVBA 3MEDA 2HHSA 4FWSA 1ZBUA 2NRTA 2YHWA 1V4TA 1U49A 1BA0A 1Z05A 3AA2A 1BHLA 2P5GA 1HKGA 5AQOA 4CJ3A 1S3XA 5CZ1A 1VQ6N 3RWUA 3ZCMA 3L2WA 2O8FA 2RPIA 3LZIA 1NGDA 3NF8A 4FWLA 4O8UA 3VQDA 2Q0UA 2YJEA 3BDPA 2NRRA 1WOQA 2DY4A 1RT4A 1DEJA 4H0OA 4KREA 2E88A 4BRNA 1TYQA 1S9GA 3THYB 1GLCG 1BG3A 5EU7A 3DXKB 5BN8A 3THWB 3QDKA 5HRSA 3E9PA 2UUAK 5AQZA 4F2RA 4CGFA 4DTJA 1U48A 1YJWN 5KQDA 2WFBA 3O9UA 2Z1JA 1ZBHA 3C0BA 4B1YB 2QM1A 1RCHA 4CGJA 3DLHA 4KH4A 3T3FA 2E5LK 3H08A 5C2DA 4X66K 2ZJRL 4BE2A 3LAKA 1NJIO 2YHBA 5M1QA 5FPDA 2KFNA 3G25A 3O4QA 4CJVA 4CFDA 2PY5A 4DV1K 3MECA 1X3MA 4CJTA 1CZAN 4DQQA 4BR9A 4JYAK 3HSTB 1VQ8N 5M1FA 2A42A 1BGXT 1HNIA 4CJRA 4KTWA 2HHWA 3A5OC 3HTVA 3TAQA 1WBBA 3VEVA 3Q7BA 3AA4A 4M7YA 1SL1A 2HMIA 5SZTA 1FK9A 3KHYA 4M45A 3BZCA 1P8ZA 4OPKA 3CQXA 3IAYA 4HWIA 4HHTA 2ZM6K 4DSIA 3P31A 2Z1IA 4FPBA 1HUXA 1K6YA 1KD1O 1RBTA 1QSLA 1FKPA 1G15A 1H1VA 3PO4A 3ZSYA 3KLFA 3T19A 1Q8IA 1BI4A 3SMSA 1RTIA 4EHUA 4DV6K 1O13A 4KO0A 3EYZA 5C0YA 4FWMA 2RKIA 4BQLA 2F9TA 2E2PA 4DF4A 1RGIA 1WAFA 5AQGA 4FJMA 5CE3A 3E66A 3QB0A 1U6ZA 4WQ4A 4NCAA 4ISFA 3QIOA 2OPQA 1VSFA 3SQ1A 1VQ4N 2I7PA 3O6WA 1QTMA 1D8YA 1U45A 4FZZA 1S22A 5D3GA 3AO1A 3BF3A 2ITMA 4CK1A 1Z26A 5AQFA 4CD1A 3WXIA 4B9QA 4XH1A 1SS6A 3HPGA 3G71N 4PHTX 1XHXA 2NLXA 3FGUA 1S72N 3VMFB 4FZXC 4MLHA 3CD6N 1NBWA 3ZT2A 5J2PA 3C7NB 3LDSA 5JLFA 4B1UB 5AJ3K 3QEXA 1IKXA 4BGBA 4QS7A 3S9HA 2O8EA 4JI4K 3CQYA 2P9SA 4DU1A 1KSPA 1MWMA 3C6TA 1L3VA 2YCHA 5GAEP 4A62A 1W97L 1K73O 1LV5A 4BG8A 1NK5A 3H3NO 3OA9A 4JKBA 4KRFA 1ZBFA 2GEMA 4IBNA 3AVLA 3EEQA 2F9WA 4LF6K 1Q7YO 1JKHA 3IKMA 4CJLA 3TPQA 3UKUA 1IKVA 2Q31A 4H0VB 4Z4CA 4XEIA 4B1WB 3OBYA 4J2DA 2QKKA 1FJGK 4DS4A 5C10A 4BDYA 3KLHA 3HK2A 3L2QA 2ZGZA 5J1EA 3GE1A 1C0UA 2D4WA 4CCHA 4Z4GA 4BR7A 1E4GT 4O0JA 1S1WA 4BRDA 4OJRA 4O4GA 3QINA 4DFPA 1SL2A 2FBTA 4N41A 1E4FT 4A2AA 4BR0A 1NJXA 3I0SA 3O9RA 1WB9A 4FYDA 3GG4A 1KAYA 2PBDA 2Q1NA 2FSJA 4WFBL 4FCYA 1Z6RA 2F4VK 3KWIA 3ENOA 4FJJA 1S1VA 5JS2A 3VENA 2X6SA 3SPZA 1TL1A 4H8KA 3H6EA 3CC7N 4AHTA 4DQRA 3U9ZA 4JK9A 5AQWA 4AHUA 3KLEA 3JSMA 1JJ2M 2G8VA 4MDAA 3JS6A 1BISA 2IOCA 1QHTA 4F2SA 5C24A 1UA0A 1F21A 5AQMA 4KHNA 5GIPA 3AAPA 3ZYYX 4AF1A 4WF9L 4DTNA 5J2NA 4BACA 2ETJA 4BGAA 4E7IA 1R0AA 1MWKA 5KI6A 3MEGA 1J5OA 1B9DA 3C95A 1EP4A 3NGZA 3J7YP 4FJ5A 3UB5A 4GW6A 1KC8O 1C1BA 1C1AA 3VQEA 2HHUA 3OYFA 2IAJA 3V6DA 1CXQA 2H3GX 4JHDA 2ATQA 4W5OA 5J2MA 2RF2A 4DFJA 1WSJA 3TI0A 3DXMB 3H45C 1I3AA 4BRLA 1TKZA 1U47A 5T7BA 1NKBA 1N6QA 2VWJA 4HUFA 3F73A 3VQQA 4KHPK 4PWDA 4DMNA 1TV6A 4W5TA 4E7HA 4CE9A 2BDPA 4KHUA 4AHRA 3HOTA 3OYLA 1BCMA 3SAFA 3T69A 4FW1A 3G4SN 5I9EB 1MDUB 4DR5K 4C23A 3VPZA 4OLAA 1IO2A 3LDLA 5AR0A 5JVHL 4WQ4C 3BUZB 1VSDA 3QEPA 3ID6A 2BE2A 3AVKA 4CFBA 3CJ1A 4O8KA 4CF2A 4X65K 2P51A 3CFPA 3KLIA 2R7YA 4F8RA 3UE5A 4DU4A 4LF9K 4IFYA 1NGIA 1IBKK 3AVCA 2OCEA 3V9XA 1TK0A 1TKTA 4CERA 3RRGA 4C8MA 3G0ZA 3H46O 3QNOA 5IT9O 4EZ9A 3IRXA 3VEWA 1EETA 1RBVA 3M1FA 1OVQA 4XH4A 3JAMO 1NU0A 4CZJA 4G9ZA 1XQSC 2HHXA 4CEAA 3V1RA 1NM1A 2YX6A 3SQ2A 4H4MA 4CZIA 5HRPA 2OTJN 3KD5E 1QS4A 4FO0A 2Q3SA 4DKWA 4DTUA 3D2EB 4C8LA 1NGEA 2CH6A 2QWPA 3HP9A 5JS1A 1ATRA 2A1RA 4WQ5A 3LP2A 3LDQA 1NGJA 3I56N 3I55N 5I3UA 1NK4A 1VSIA 2KTQA 4FSVA 3WQUA 3WNGA 4I6MB 3EO3A 1S1UA 2D0OA 2HSTA 4B1XB 4DWIA 3R1XA 1DTQA 3GDQA 1LW0A 3K0SA 3ATVA 3TANA 2LSNA 3OYMA 1T05A 2O4GA 2P9KB 3PSIA 3V9ZA 3DLEA 1S6QA 3J7AP 4LD0A 4DR7K 2P9UB 5H1SQ 1J5EK 3R9PA 1YF5L 1J53A 3D0PA 1C0FA 3UIQA 4EP4A 4IEIA 4CF8A 4FLWA 2PYJA 1IBLK 2FBYA 3O4WA 4FJ9A 4JD2A 3T1AA 3ZT0A 3OW2M 4E3SA 4DSEA 2P9IB 2V7YA 3P5JA 1S9EA 4HCCA 1TL3A 1I39A 4B3OA 3K57A 4Q5VA 5BRFA 3SI6A 1EO1A 3CJBA 2HW3A 1KFSA 3THXB 3WEEB 1JL1A 5JLHA 3QFPA 5KPZA 3KTQA 4CJWA 5C25A 3E1YA 2UXCK 4FL9A 2P9NB 1EXQA 2NRVA 3CCSN 1RILA 4NLBA 4JK8A 3A2FA 2Q2RA 1EKEA 2DFEA 2GELA 5DM6L 3HOSA 3PLAA 5B8HA 4FWKA 5E41A 2NUBA 5AQUA 3W0LA 2O8FB 3AA3A 5KGXA 1SV5A 1NK8A 1T8EA 5KRTA 1V4SA 2KHOA 3HI0A 5AQXA 4U67L 2P1JA 3NH1A 3LP1A 1NGHA 2GUPA 3HP6A 3C6UA 4FK2A 4AM7A 2BTFA 1TYQB 3AO3A 1RDWX 3UKRB 1KCFA 4CFCA 1KAXA 4EFHA 1VQ7N 4GV9A 3GL1A 3HBTA 4C8OA 3P39A 2WC9A 3LM9A 2IIRA 4IJAA 3SJHA 3FZLA 2CGKA 3I8BA 3SNNA 4M3WA 2GX9A 4BE0A 4CIGA 3O08A 1WSGA 3K58A 3E9OA 4YY3K 2WTUA 4CD3A 1XHZA 3DM2A 4FJGA 2A40A 2AJQA 4B3TK 3V1QA 3IS9A 5EXWA 3FFKB 4DV3K 2ITGA 4ILHA 4Y1DA 2HVHA 2E8AA 4E89A 4JI6K 5LJWA 3D2FA 4DU3A 3DOLA 4JAXA 3W3DA 3G10A 5FPNA 3O9TA 2YNFA 5AQNA 1JCFA 3LAMA 5LMUK 4HUGA 4K42A 4DQ8A 4FPAA 2QWRA 1HNXK 3SCXA 5E26A 3RRHA 4LSNA 2E2NA 3WUHA 4NYFA 4OKEA 3ZT1A 4DQPA 2HOEA 4AHVA 2FSNA 3TTCA 1JLFA 3IMXA 5AQYA 1VQLN 5HRRA 3FE1A 1N34K 4JRQA 2O8CA 1JCGA 2Z1HA 4UY8O 3AV9A 5DM7L 4ILJA 3MK6A 2UXDK 1BI4B 1OH6A 1XI1A 3CM6A 3TWHA 4CF9A 1TKXA 4DSJA 1BQNA 5BR8K 3MWTA 1RT3A 5CYQA 2X74A 1X9MA 1DLOA 4CEQA 2BANA 3RR7A 4B8CA 1OVYA 4BRQA 1OH5A 4QCLA 1XUPO 3VQAA 3BF1A 3LPTA 3MX5A 1T7PA 3M8RA 3CHWA 1VSEA 4IZ9A 3LL3A 1BCOA 4BQZA 1O1WA 3TTFA 1HJOA 5KTQA 3OYDA 3DMJA 4FOEA 3VEYA 5HOOA 4CJFA 3NF9A 4E7KA 4IWVA 4J8FA 1RDDA 3J80O 1NK9A 3C65A 1QZ6A 1U2VA 3SUQA 4PUOA 4L3QA 3T7ZA 1Q86O 4PL7A 4DFMA 2O8EB 2GWJA 2P9SB 3KK7A 4B9LA 3ID8A 4OO1J 2ZJPL 4WFAL 2VG6A 2X78A 3CPWM 1YHQN 1VQNN 4ID5A 1SUQA 4Z4HA 4EAHD 1A5XA 3MCPA 1HQUA 4M3YA 1B9FA 4HVJA 1OKJA 5EY4A 4OPJA 3PV8A 5TKYA 5F0XA 3U6FA 4NLCA 2QXLA 3OHRA 3V4IA 1XC9A 2KZMA 3QIPA 2G8IA 3AVHA 3MDQA 4BR4A 2ZGYA 3ULDA 2VCPA 3SV4A 2QEXN 5AZIA 4DTXA 1QSSA 3A0IX 3ITHA 1LW2A 4OKJA 3A5LC 3UKUB 4ZTJA 2O8DA 3QBWA 4FWRA 3PX0A 4CI6A 2NRZA 3CERA 4BRAA 2HNZA 4E0DA 3ZX3A 4B3RK 1TAQA 2VG7A 2ZE2A 1A5VA 3AGKA 1WLJA 4BC4A 3O8MA 4N76A 1HNWK 3VGMA 3TAEA 2JGUA 1QQMA 4C1NK 2D0AA 3OS1A 1VAZA 3TSQA 3T1YK 1YIJN 3DRSA 4RW7A 2GBZA 1XNQK 4FJIA 4DR6K 3MN5A 1M1KO 1SKWA 4BE1A 1GLBG 3ENHA 3EZWA 4DQSA 1ATNA 4R5PA 1X9JA 1WBDA 3B6OA 4K43A 1HR0K 4E1MA 4JI1K 1NWKA 1LCUA 2QTDA 1T44A 4JKGB 2OA8A 2XY6A 2CGLA 1IG8A 3MN7A 3DOKA 4KTZA 5EVZA 5M1NA 3SAGA 4W5QA 4M3RA 3MX2A 2HHTA 4E7JA 1JLCA 1MU2A 3VQ5A 4B3MK 4FJKA 4JHDB 2ZD1A 4IKFA 5TKWA
chains in the Genus database with same CATH topology
1VK0A 4FVMA 3HYFA 3SUNA 1Y97A 1JXBA 1HMVA 3KKSA 4FJ7A 1TAUA 4OLAA 3RMBA 3ZSRA 2XRIA 1IO2A 1HYVA 2FBVA 4OGCA 1KRPA 1SKSA 1CXUA 2G8HA 1CZ9A 1IG9A 1C0TA 3RMAA 1VSDA 3QEPA 1KVCA 2WONA 1NK6A 2BE2A 2YNGA 3KK3A 2GV9A 3AVKA 3V9WA 4CFBA 3CFPA 4CF2A 2PZSA 2P51A 2R7YA 3KLIA 4Q0BA 4F8RA 4KAZA 4DU4A 1CZBA 2W42A 4CEBA 3SZ2A 2IGIA 4B9UA 1LWCA 4FJ8A 4IFYA 4CEOA 4KHWA 1KTQA 2VG5A 4RG8A 3VA3A 4KI4A 3AVCA 3V9XA 1GOAA 1BL3A 4M3UA 1TK0A 4B9MA 1TKTA 4IG0A 4BDPA 2KFZA 2YHAA 3LWMA 4ELUA 4CERA 4GVMA 3DLKA 1RNHA 3MAQA 3QESA 3RRGA 4C8MA 1HRHA 3G0ZA 3OYIA 3QNOA 3MXMA 3V9UA 3PX4A 4EZ9A 2PYLA 1BIUA 4AH9A 3S3MA 3WNFA 4I9QA 3IRXA 1J54A 1EETA 3DLRA 1RBVA 1ZYQA 4FM2A 1D5AA 1RDCA 1WSHA 3VQ6A 4JLHA 4CK2A 4J2EA 4HUEA 2Y1IA 2DFFA 4M42A 2G8WA 4IDKA 1N5YA 1W0HA 4PA1A 3NE6A 4JRPA 5HP1A 3NHGA 4FJXA 4B9NA 2DFHA 4TSXA 1J9AA 1BIZA 3RMDA 4CGHA 2HHVA 2HHXA 2XY8A 4CEAA 3V1RA 3SQ2A 2YKMA 4N5SA 4H4MA 3LP0A 5HRPA 4Z4FA 1IKWA 3KD5E 1JLQA 1QS4A 5DK5A 2Q3SA 4DTUA 3OJSA 3LZJA 3OVNA 3ZSOA 1X9SA 4C8LA 4FK4A 3HP9A 1WSIA 1WAJA 4GMJB 2A1RA 5JS1A 3WNEA 1IKYA 1QQCA 2B6AA 4B8AB 3LP2A 5I3UA 3ZSZA 3F9KA 1NK4A 1VSIA 4FW2A 2KTQA 2WOMA 4DSFA 1RT5A 3DLBA 3LANA 3WNGA 3KK2A 5CY4A 1S1UA 3VQPA 5HBMA 2HNDA 4M3TA 4ELVA 4DLEA 4ICLA 2JLEA 1WN7A 4Y1CA 3LWLA 4DWIA 1DTQA 2VWKA 3OYAA 4E7LA 1ZBLA 4DTMA 1NK0A 1L5UA 1LW0A 3ZSVA 3TANA 3VQ7A 1RT7A 2GUIA 2LSNA 4FJHA 3OYMA 1JL2A 3OJUA 2YNHA 1T05A 2O4GA 3V9ZA 5HROA 4M3ZA 1UOCA 4KKOA 3ZSWA 4F3TA 2OPSA 3ALYA 1S6QA 3DLEA 3NGYA 3O4NA 1ZBIA 4LD0A 3AVFA 4DTRA 4BWJA 3AVJA 3NH2A 1WNSA 3L2VA 3HM9A 4NCBA 3VQBA 3EZ5A 4DSLA 1J53A 3OS2A 4WE1A 2E6MA 3D0PA 3UIQA 4EP4A 3SYZA 3E01A 4CF8A 4FLWA 2PYJA 1C6VA 4KHQA 3AO5A 2FBYA 1S5JA 1LAVA 2XHBA 4FJ9A 1UA1A 5D3GA 4Z4EA 4JS5A 3T1AA 3PX6A 3ZT0A 1TK5A 1HJRA 3AO4A 1VSKA 4E3SA 4DSEA 1SKRA 2BDPA 3P5JA 2G8UA 3MXIA 4LH4A 3SJJA 1S9EA 2I5JA 1TL3A 1I39A 4HCCA 4IFVA 4O5BA 4B3OA 2OPPA 3O3GA 3OYEA 3QNNA 2F96A 4C8KA 3K57A 2DTUA 2QXFA 4DLGA 2HB5A 1HYZA 3NBPA 4I7FA 5KGWA 1KVBA 3MEDA 4Q5VA 2HHSA 1RTDA 1ZBUA 4Z4IA 3SI6A 3QLHA 3SQ4A 2HW3A 1U49A 3K5NA 1KFSA 3AA2A 1BHLA 1JL1A 2FC0A 2P5GA 4B9SA 4CJ3A 5CZ1A 3KTQA 4CJWA 3LPUA 5C25A 4DFKA 4FXDA 2HHTA 3RWUA 1TK8A 1GOBA 2A1SA 3MXJA 3ZCMA 4RW8A 5C42A 4XIUA 3L2WA 3PY8A 4OLBA 1WSEA 2RPIA 1EXQA 4O55A 1HQEA 1REVA 3BGRA 3LZIA 3I0RA 3NF8A 4FLXA 3K5LA 3VQDA 1FXXA 1RILA 3BDPA 3CQ8A 3O3HA 5J2QA 3KK1A 4KPYA 3AVAA 3OYCA 2DY4A 3A2FA 4FLUA 2OZMA 1EKEA 2DFEA 1RT4A 3PUFA 3VQ8A 4B9TA 1NJZA 3P1GA 4KREA 5E41A 2NUBA 3QEIA 4KTQA 3AA3A 1S9GA 4AHSA 5KGXA 5EU7A 1SV5A 1NK8A 1T8EA 1BQMA 2B4JA 3M8PA 3QO9A 4Z0UA 5KRTA 3OS0A 1LAWA 4CGGA 2KW4A 1VSJA 5HRSA 4KHSA 2P1JA 4FM1A 4FJLA 3NH1A 3I8DA 4F2RA 4CGFA 3LP1A 4DTJA 4CJPA 1U48A 3HP6A 4KB1A 2X6NA 3C6UA 4FK2A 4E19A 1L3UA 1KLMA 4KHYA 2ZQBA 3AO3A 1QE1A 3OYNA 2Z1JA 1KCFA 3HL8A 4OVLA 4CFCA 3TABA 3CM5A 1ZBHA 3NGIA 3WNHA 3CFRA 1RCHA 1Q9YA 4C8OA 4CGJA 2QK9A 3DLHA 3T3FA 4CHOA 3H08A 4CEDA 4CEZA 3V81A 3EY1A 3NDKA 4BE2A 3LAKA 3HO1A 2YHBA 3SNNA 4N56A 4M3WA 2KFNA 4CJVA 3O4QA 4BE0A 1L3TA 2Z1GA 4CFDA 2PY5A 3HVTA 3MECA 3ZSXA 4CIGA 1WSGA 4N47A 4YNQA 4CJTA 3K58A 3O3FA 3V1OA 3TARA 4DQQA 1VSMA 3RMCA 4FLZA 3HSTB 3OYHA 2FBXA 1BGXT 1XHZA 1HNIA 3D45A 3DM2A 4CJ4A 4CHYA 4FJGA 4CJRA 4KTWA 4DTOA 3TR8A 2HHWA 2AJQA 1SL0A 1VRTA 3V1QA 3IS9A 1VSHA 3IG1A 3LP3A 3TAQA 4ZTFA 1HYSA 2ITGA 3AA4A 4Y1DA 3K59A 3SUPA 4I2PA 2HVHA 1SL1A 2HMIA 1JLGA 4BWMA 4E89A 5SZTA 1FK9A 4M45A 4DU3A 2OPRA 3DOLA 3VN5A 4OPKA 3IAYA 3TAGA 4HHTA 3G10A 4DSIA 1VRUA 2Z1IA 4CGIA 2YNFA 2F8TA 4UQGA 2IC3A 3TAMA 1K6YA 3LAMA 2HVIA 4HUGA 2YNIA 3DI6A 1RBTA 4I9LA 4CEFA 1FKPA 4DF8A 1QSLA 1G15A 1S6PA 1RTJA 3ZSYA 5FDLA 3PO4A 3SCXA 2OYQA 3KLFA 3RRHA 4LSNA 4FLTA 2OZSA 3T19A 4AILC 1Q8IA 4KB0A 1BI4A 4ELTA 1RTIA 2IS3A 4FLYA 1JLEA 4NYFA 4CF1A 4OKEA 2Y1JA 3ZT1A 4DQPA 1TVRA 1XWLA 2YKNA 4KO0A 4H4OA 1TGOA 4C8NA 4CJKA 3OYGA 3EYZA 4FM0A 4AHVA 4LY7A 3HPOA 4LSLA 3L8BA 3MEEA 2RKIA 1JLFA 3M8QA 4DF4A 1WAFA 5HRRA 4FJMA 4JRQA 1Q9XA 2Z1HA 4CGDA 3VA0A 3AV9A 3ISNC 2EX3A 4K8XA 3NF7A 4KV8A 4CJEA 1BI4B 1XI1A 2E4LA 1C1CA 5KRSA 4NCAA 3KIOA 3CM6A 2HNYA 3QIOA 3TWHA 2OPQA 3B6PA 4CF9A 2BGGA 1VSFA 2RN2A 3CYMA 1TKXA 1ASVA 3SQ1A 4HCBA 3HPHA 1NJYA 1QTMA 4DSJA 1T03A 1BQNA 4AHCA 1D8YA 3CFOA 1U45A 1RT3A 1HPZA 3AVIA 4CHPA 1NKEA 4FZZA 5CYQA 4M41A 3AVBA 3NFAA 2X74A 1X9MA 1DLOA 5DMRA 3AO1A 4CEQA 4CHZA 4L8RB 4CK1A 2HHQA 1Z26A 5I42A 2BANA 3RR7A 4I2QA 4B8CA 4NCGA 3HVRA 4NYNA 3QETA 1L3SA 4K8ZA 1YTUA 3HPGA 4O0IA 4B08A 1VSLA 1W9HA 2G8KA 1RT2A 3VQAA 4QCLA 3LPTA 4DS5A 1XHXA 1NOYA 1T7PA 3M8RA 3HXMA 1VSEA 4FZXC 1BCOA 3AO2A 3ZT2A 4HTUA 5J2PA 1NJWA 1O1WA 3LDSA 4EZ6A 4F4KA 3QEXA 5KTQA 1IKXA 1Z25A 3DMJA 3OYDA 3THVA 3S9HA 3L2RA 3HJFA 2D0CA 4W5RA 2B5JA 4DU1A 4CJFA 3NF9A 5CYMA 4E7KA 1U4BA 1KSPA 3SPYA 1JLAA 3C6TA 4G1QA 1L3VA 1RDDA 4E1NA 4O44A 1NK9A 3VQ9A 2YV0X 3SV3A 3VQ4A 2QKBA 3DYAA 4J2AA 1LV5A 1NK5A 4CJ5A 3SUQA 3OYKA 1RBUA 1RDBA 3NH0A 4PUOA 1NK7A 3NF6A 4DFMA 3AVMA 3KLGA 3SUOA 4KRFA 2KZZA 2E6LA 1ZBFA 4IBNA 4M3XA 4B9LA 1X1PA 3AVLA 3S3NA 2VG6A 2X78A 3ZT4A 1RBSA 4ID5A 1SUQA 4Z4HA 1JKHA 4CJLA 4DTPA 3U3YA 3TI0A 1IKVA 1A5XA 2XO7A 4KI6A 1HQUA 1B92A 1NOZA 4Z4CA 4M3YA 1B9FA 4HVJA 3M8SA 4J2DA 2QKKA 1KFDA 4OPJA 3OY9A 4DS4A 3PV8A 1JLBA 3P83D 3U6FA 2KQ2A 3KLHA 4BDYA 3HK2A 5SWMA 3L2QA 5J1EA 1LWEA 4DTSA 3V4IA 1C0UA 1XC9A 3PO5A 2KZMA 1WSFA 1IH7A 4CCHA 2XY7A 3QIPA 1C0MA 4DQIA 3AVHA 1D9FA 5FRNA 4Z4GA 4O0JA 1ASUA 2G8IA 5K14A 1S1WA 3ULDA 3SV4A 3JYTA 4OJRA 4O4GA 3QINA 4CHQA 4DFPA 4DTXA 3FFIA 3AVGA 3QEWA 1SL2A 1QSSA 2FBTA 1LW2A 3ITHA 4OKJA 4QAGA 3RTVA 4ZTJA 2P5OA 4FK0A 3NAEA 4N41A 4FLVA 1CLQA 3DLGA 1NJXA 3I0SA 4EP5A 3PX0A 1KLNA 4FYDA 3KJVA 3CG7A 1U04A 1YVUA 4FCYA 2HNZA 3TAFA 4OKKA 4E0DA 4CK3A 5HLFA 4FJJA 1S1VA 5JS2A 2X6SA 3SPZA 4MFBA 1TL1A 2D5RA 4H8KA 1D9DA 4FJNA 1TAQA 3LALA 4PY5A 2VG7A 2ZE2A 4OGEA 1A5VA 4AHTA 4CJSA 1WLJA 5HRNA 4DQRA 2D0BA 1ASWA 4CECA 1RTHA 3L3VA 4AHUA 3KLEA 3JSMA 1UAXA 4F3OA 2G8VA 4N76A 1EX4A 2G8FA 1BISA 2IOCA 1QHTA 3TAEA 2JGUA 1X9WA 3L3UA 2D0AA 3QEVA 4F2SA 3AA5X 5C24A 1UA0A 4J2BA 1RDAA 3ZSQA 3OS1A 1ITGA 4MQ3A 3K5MA 1F21A 3DRSA 4RW6A 4CF0A 4KHNA 4IG3A 4RW7A 2GBZA 1A5WA 3VQCA 4FJIA 2IDOA 4FZYA 4CFAA 4DTNA 5J2NA 4PQUA 2EHGA 4BACA 2ETJA 1SKWA 3RR8A 4E7IA 1R0AA 5FROA 4BE1A 1KVAA 1S1XA 5KI6A 1NKCA 3MEGA 3KD1E 4YFUA 4FJKA 1J5OA 4DSKA 4DQSA 1B9DA 2F8SA 5CZ2A 3C95A 1EP4A 1GOCA 3K2PA 4CIFA 4R5PA 3OYJA 3NGZA 4B9VA 4QOZB 3U3GA 3V9SA 4FJ5A 3B6OA 4DG1A 4GW6A 4E1MA 1C1BA 1C1AA 1DTTA 3VQEA 2HHUA 3OYFA 2IAJA 1RBRA 1JXEA 1YTAA 3V6DA 3S3OA 2OA8A 3NCIA 4LH5A 1HNVA 2XY6A 4BDZA 1FKOA 1QSYA 3DOKA 1CXQA 3ASMA 4KTZA 2O4IA 1S1TA 2ATQA 4W5OA 4W5QA 3TAPA 4M3RA 2XY5A 4ID1A 5J2MA 2RF2A 1UWBA 1WSJA 4RW9A 4DFJA 3HT3A 3DRRA 1I3AA 3KKRA 4CESA 4E7JA 3QERA 5FRMA 1JLCA 3OYBA 1TKZA 4W5NA 1U47A 5T7BA 4KFBA 4JS4A 3K5OA 1NKBA 2VWJA 1N6QA 1MU2A 4HUFA 3L2UA 3F73A 3VQQA 3VQ5A 3C94A 1TKDA 4PWDA 4DMNA 1TV6A 4CJQA 4W5TA 4CE9A 4CJUA 4E7HA 4RW4A 4AHRA 4CIEA 3AVNA 3OYLA 4KHUA 1BCMA 1LWFA 3DRPA 1YT3A 4FW1A 1RT6A 4CHNA 2ZD1A 4ZHRA 4CEEA 4IKFA 3SQ0A 1RT1A 3ZT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VK0 A;  4FVM A;  3HYF A;  3SUN A;  1Y97 A;  1JXB A;  1HMV A;  3KKS A;  4FJ7 A;  1TAU A;  4OLA A;  3RMB A;  3ZSR A;  2XRI A;  1IO2 A;  1HYV A;  2FBV A;  4OGC A;  1KRP A;  1SKS A;  1CXU A;  2G8H A;  1CZ9 A;  1IG9 A;  1C0T A;  3RMA A;  1VSD A;  3QEP A;  1KVC A;  2WON A;  1NK6 A;  2BE2 A;  2YNG A;  3KK3 A;  2GV9 A;  3AVK A;  3V9W A;  4CFB A;  3CFP A;  4CF2 A;  2PZS A;  2P51 A;  2R7Y A;  3KLI A;  4Q0B A;  4F8R A;  4KAZ A;  4DU4 A;  1CZB A;  2W42 A;  4CEB A;  3SZ2 A;  2IGI A;  4B9U A;  1LWC A;  4FJ8 A;  4IFY A;  4CEO A;  4KHW A;  1KTQ A;  2VG5 A;  4RG8 A;  3VA3 A;  4KI4 A;  3AVC A;  3V9X A;  1GOA A;  1BL3 A;  4M3U A;  1TK0 A;  4B9M A;  1TKT A;  4IG0 A;  4BDP A;  2KFZ A;  2YHA A;  3LWM A;  4ELU A;  4CER A;  4GVM A;  3DLK A;  1RNH A;  3MAQ A;  3QES A;  3RRG A;  4C8M A;  1HRH A;  3G0Z A;  3OYI A;  3QNO A;  3MXM A;  3V9U A;  3PX4 A;  4EZ9 A;  2PYL A;  1BIU A;  4AH9 A;  3S3M A;  3WNF A;  4I9Q A;  3IRX A;  1J54 A;  1EET A;  3DLR A;  1RBV A;  1ZYQ A;  4FM2 A;  1D5A A;  1RDC A;  1WSH A;  3VQ6 A;  4JLH A;  4CK2 A;  4J2E A;  4HUE A;  2Y1I A;  2DFF A;  4M42 A;  2G8W A;  4IDK A;  1N5Y A;  1W0H A;  4PA1 A;  3NE6 A;  4JRP A;  5HP1 A;  3NHG A;  4FJX A;  4B9N A;  2DFH A;  4TSX A;  1J9A A;  1BIZ A;  3RMD A;  4CGH A;  2HHV A;  2HHX A;  2XY8 A;  4CEA A;  3V1R A;  3SQ2 A;  2YKM A;  4N5S A;  4H4M A;  3LP0 A;  5HRP A;  4Z4F A;  1IKW A;  3KD5 E;  1JLQ A;  1QS4 A;  5DK5 A;  2Q3S A;  4DTU A;  3OJS A;  3LZJ A;  3OVN A;  3ZSO A;  1X9S A;  4C8L A;  4FK4 A;  3HP9 A;  1WSI A;  1WAJ A;  4GMJ B;  2A1R A;  5JS1 A;  3WNE A;  1IKY A;  1QQC A;  2B6A A;  4B8A B;  3LP2 A;  5I3U A;  3ZSZ A;  3F9K A;  1NK4 A;  1VSI A;  4FW2 A;  2KTQ A;  2WOM A;  4DSF A;  1RT5 A;  3DLB A;  3LAN A;  3WNG A;  3KK2 A;  5CY4 A;  1S1U A;  3VQP A;  5HBM A;  2HND A;  4M3T A;  4ELV A;  4DLE A;  4ICL A;  2JLE A;  1WN7 A;  4Y1C A;  3LWL A;  4DWI A;  1DTQ A;  2VWK A;  3OYA A;  4E7L A;  1ZBL A;  4DTM A;  1NK0 A;  1L5U A;  1LW0 A;  3ZSV A;  3TAN A;  3VQ7 A;  1RT7 A;  2GUI A;  2LSN A;  4FJH A;  3OYM A;  1JL2 A;  3OJU A;  2YNH A;  1T05 A;  2O4G A;  3V9Z A;  5HRO A;  4M3Z A;  1UOC A;  4KKO A;  3ZSW A;  4F3T A;  2OPS A;  3ALY A;  1S6Q A;  3DLE A;  3NGY A;  3O4N A;  1ZBI A;  4LD0 A;  3AVF A;  4DTR A;  4BWJ A;  3AVJ A;  3NH2 A;  1WNS A;  3L2V A;  3HM9 A;  4NCB A;  3VQB A;  3EZ5 A;  4DSL A;  1J53 A;  3OS2 A;  4WE1 A;  2E6M A;  3D0P A;  3UIQ A;  4EP4 A;  3SYZ A;  3E01 A;  4CF8 A;  4FLW A;  2PYJ A;  1C6V A;  4KHQ A;  3AO5 A;  2FBY A;  1S5J A;  1LAV A;  2XHB A;  4FJ9 A;  1UA1 A;  5D3G A;  4Z4E A;  4JS5 A;  3T1A A;  3PX6 A;  3ZT0 A;  1TK5 A;  1HJR A;  3AO4 A;  1VSK A;  4E3S A;  4DSE A;  1SKR A;  2BDP A;  3P5J A;  2G8U A;  3MXI A;  4LH4 A;  3SJJ A;  1S9E A;  2I5J A;  1TL3 A;  1I39 A;  4HCC A;  4IFV A;  4O5B A;  4B3O A;  2OPP A;  3O3G A;  3OYE A;  3QNN A;  2F96 A;  4C8K A;  3K57 A;  2DTU A;  2QXF A;  4DLG A;  2HB5 A;  1HYZ A;  3NBP A;  4I7F A;  5KGW A;  1KVB A;  3MED A;  4Q5V A;  2HHS A;  1RTD A;  1ZBU A;  4Z4I A;  3SI6 A;  3QLH A;  3SQ4 A;  2HW3 A;  1U49 A;  3K5N A;  1KFS A;  3AA2 A;  1BHL A;  1JL1 A;  2FC0 A;  2P5G A;  4B9S A;  4CJ3 A;  5CZ1 A;  3KTQ A;  4CJW A;  3LPU A;  5C25 A;  4DFK A;  4FXD A;  2HHT A;  3RWU A;  1TK8 A;  1GOB A;  2A1S A;  3MXJ A;  3ZCM A;  4RW8 A;  5C42 A;  4XIU A;  3L2W A;  3PY8 A;  4OLB A;  1WSE A;  2RPI A;  1EXQ A;  4O55 A;  1HQE A;  1REV A;  3BGR A;  3LZI A;  3I0R A;  3NF8 A;  4FLX A;  3K5L A;  3VQD A;  1FXX A;  1RIL A;  3BDP A;  3CQ8 A;  3O3H A;  5J2Q A;  3KK1 A;  4KPY A;  3AVA A;  3OYC A;  2DY4 A;  3A2F A;  4FLU A;  2OZM A;  1EKE A;  2DFE A;  1RT4 A;  3PUF A;  3VQ8 A;  4B9T A;  1NJZ A;  3P1G A;  4KRE A;  5E41 A;  2NUB A;  3QEI A;  4KTQ A;  3AA3 A;  1S9G A;  4AHS A;  5KGX A;  5EU7 A;  1SV5 A;  1NK8 A;  1T8E A;  1BQM A;  2B4J A;  3M8P A;  3QO9 A;  4Z0U A;  5KRT A;  3OS0 A;  1LAW A;  4CGG A;  2KW4 A;  1VSJ A;  5HRS A;  4KHS A;  2P1J A;  4FM1 A;  4FJL A;  3NH1 A;  3I8D A;  4F2R A;  4CGF A;  3LP1 A;  4DTJ A;  4CJP A;  1U48 A;  3HP6 A;  4KB1 A;  2X6N A;  3C6U A;  4FK2 A;  4E19 A;  1L3U A;  1KLM A;  4KHY A;  2ZQB A;  3AO3 A;  1QE1 A;  3OYN A;  2Z1J A;  1KCF A;  3HL8 A;  4OVL A;  4CFC A;  3TAB A;  3CM5 A;  1ZBH A;  3NGI A;  3WNH A;  3CFR A;  1RCH A;  1Q9Y A;  4C8O A;  4CGJ A;  2QK9 A;  3DLH A;  3T3F A;  4CHO A;  3H08 A;  4CED A;  4CEZ A;  3V81 A;  3EY1 A;  3NDK A;  4BE2 A;  3LAK A;  3HO1 A;  2YHB A;  3SNN A;  4N56 A;  4M3W A;  2KFN A;  4CJV A;  3O4Q A;  4BE0 A;  1L3T A;  2Z1G A;  4CFD A;  2PY5 A;  3HVT A;  3MEC A;  3ZSX A;  4CIG A;  1WSG A;  4N47 A;  4YNQ A;  4CJT A;  3K58 A;  3O3F A;  3V1O A;  3TAR A;  4DQQ A;  1VSM A;  3RMC A;  4FLZ A;  3HST B;  3OYH A;  2FBX A;  1BGX T;  1XHZ A;  1HNI A;  3D45 A;  3DM2 A;  4CJ4 A;  4CHY A;  4FJG A;  4CJR A;  4KTW A;  4DTO A;  3TR8 A;  2HHW A;  2AJQ A;  1SL0 A;  1VRT A;  3V1Q A;  3IS9 A;  1VSH A;  3IG1 A;  3LP3 A;  3TAQ A;  4ZTF A;  1HYS A;  2ITG A;  3AA4 A;  4Y1D A;  3K59 A;  3SUP A;  4I2P A;  2HVH A;  1SL1 A;  2HMI A;  1JLG A;  4BWM A;  4E89 A;  5SZT A;  1FK9 A;  4M45 A;  4DU3 A;  2OPR A;  3DOL A;  3VN5 A;  4OPK A;  3IAY A;  3TAG A;  4HHT A;  3G10 A;  4DSI A;  1VRU A;  2Z1I A;  4CGI A;  2YNF A;  2F8T A;  4UQG A;  2IC3 A;  3TAM A;  1K6Y A;  3LAM A;  2HVI A;  4HUG A;  2YNI A;  3DI6 A;  1RBT A;  4I9L A;  4CEF A;  1FKP A;  4DF8 A;  1QSL A;  1G15 A;  1S6P A;  1RTJ A;  3ZSY A;  5FDL A;  3PO4 A;  3SCX A;  2OYQ A;  3KLF A;  3RRH A;  4LSN A;  4FLT A;  2OZS A;  3T19 A;  4AIL C;  1Q8I A;  4KB0 A;  1BI4 A;  4ELT A;  1RTI A;  2IS3 A;  4FLY A;  1JLE A;  4NYF A;  4CF1 A;  4OKE A;  2Y1J A;  3ZT1 A;  4DQP A;  1TVR A;  1XWL A;  2YKN A;  4KO0 A;  4H4O A;  1TGO A;  4C8N A;  4CJK A;  3OYG A;  3EYZ A;  4FM0 A;  4AHV A;  4LY7 A;  3HPO A;  4LSL A;  3L8B A;  3MEE A;  2RKI A;  1JLF A;  3M8Q A;  4DF4 A;  1WAF A;  5HRR A;  4FJM A;  4JRQ A;  1Q9X A;  2Z1H A;  4CGD A;  3VA0 A;  3AV9 A;  3ISN C;  2EX3 A;  4K8X A;  3NF7 A;  4KV8 A;  4CJE A;  1BI4 B;  1XI1 A;  2E4L A;  1C1C A;  5KRS A;  4NCA A;  3KIO A;  3CM6 A;  2HNY A;  3QIO A;  3TWH A;  2OPQ A;  3B6P A;  4CF9 A;  2BGG A;  1VSF A;  2RN2 A;  3CYM A;  1TKX A;  1ASV A;  3SQ1 A;  4HCB A;  3HPH A;  1NJY A;  1QTM A;  4DSJ A;  1T03 A;  1BQN A;  4AHC A;  1D8Y A;  3CFO A;  1U45 A;  1RT3 A;  1HPZ A;  3AVI A;  4CHP A;  1NKE A;  4FZZ A;  5CYQ A;  4M41 A;  3AVB A;  3NFA A;  2X74 A;  1X9M A;  1DLO A;  5DMR A;  3AO1 A;  4CEQ A;  4CHZ A;  4L8R B;  4CK1 A;  2HHQ A;  1Z26 A;  5I42 A;  2BAN A;  3RR7 A;  4I2Q A;  4B8C A;  4NCG A;  3HVR A;  4NYN A;  3QET A;  1L3S A;  4K8Z A;  1YTU A;  3HPG A;  4O0I A;  4B08 A;  1VSL A;  1W9H A;  2G8K A;  1RT2 A;  3VQA A;  4QCL A;  3LPT A;  4DS5 A;  1XHX A;  1NOY A;  1T7P A;  3M8R A;  3HXM A;  1VSE A;  4FZX C;  1BCO A;  3AO2 A;  3ZT2 A;  4HTU A;  5J2P A;  1NJW A;  1O1W A;  3LDS A;  4EZ6 A;  4F4K A;  3QEX A;  5KTQ A;  1IKX A;  1Z25 A;  3DMJ A;  3OYD A;  3THV A;  3S9H A;  3L2R A;  3HJF A;  2D0C A;  4W5R A;  2B5J A;  4DU1 A;  4CJF A;  3NF9 A;  5CYM A;  4E7K A;  1U4B A;  1KSP A;  3SPY A;  1JLA A;  3C6T A;  4G1Q A;  1L3V A;  1RDD A;  4E1N A;  4O44 A;  1NK9 A;  3VQ9 A;  2YV0 X;  3SV3 A;  3VQ4 A;  2QKB A;  3DYA A;  4J2A A;  1LV5 A;  1NK5 A;  4CJ5 A;  3SUQ A;  3OYK A;  1RBU A;  1RDB A;  3NH0 A;  4PUO A;  1NK7 A;  3NF6 A;  4DFM A;  3AVM A;  3KLG A;  3SUO A;  4KRF A;  2KZZ A;  2E6L A;  1ZBF A;  4IBN A;  4M3X A;  4B9L A;  1X1P A;  3AVL A;  3S3N A;  2VG6 A;  2X78 A;  3ZT4 A;  1RBS A;  4ID5 A;  1SUQ A;  4Z4H A;  1JKH A;  4CJL A;  4DTP A;  3U3Y A;  3TI0 A;  1IKV A;  1A5X A;  2XO7 A;  4KI6 A;  1HQU A;  1B92 A;  1NOZ A;  4Z4C A;  4M3Y A;  1B9F A;  4HVJ A;  3M8S A;  4J2D A;  2QKK A;  1KFD A;  4OPJ A;  3OY9 A;  4DS4 A;  3PV8 A;  1JLB A;  3P83 D;  3U6F A;  2KQ2 A;  3KLH A;  4BDY A;  3HK2 A;  5SWM A;  3L2Q A;  5J1E A;  1LWE A;  4DTS A;  3V4I A;  1C0U A;  1XC9 A;  3PO5 A;  2KZM A;  1WSF A;  1IH7 A;  4CCH A;  2XY7 A;  3QIP A;  1C0M A;  4DQI A;  3AVH A;  1D9F A;  5FRN A;  4Z4G A;  4O0J A;  1ASU A;  2G8I A;  5K14 A;  1S1W A;  3ULD A;  3SV4 A;  3JYT A;  4OJR A;  4O4G A;  3QIN A;  4CHQ A;  4DFP A;  4DTX A;  3FFI A;  3AVG A;  3QEW A;  1SL2 A;  1QSS A;  2FBT A;  1LW2 A;  3ITH A;  4OKJ A;  4QAG A;  3RTV A;  4ZTJ A;  2P5O A;  4FK0 A;  3NAE A;  4N41 A;  4FLV A;  1CLQ A;  3DLG A;  1NJX A;  3I0S A;  4EP5 A;  3PX0 A;  1KLN A;  4FYD A;  3KJV A;  3CG7 A;  1U04 A;  1YVU A;  4FCY A;  2HNZ A;  3TAF A;  4OKK A;  4E0D A;  4CK3 A;  5HLF A;  4FJJ A;  1S1V A;  5JS2 A;  2X6S A;  3SPZ A;  4MFB A;  1TL1 A;  2D5R A;  4H8K A;  1D9D A;  4FJN A;  1TAQ A;  3LAL A;  4PY5 A;  2VG7 A;  2ZE2 A;  4OGE A;  1A5V A;  4AHT A;  4CJS A;  1WLJ A;  5HRN A;  4DQR A;  2D0B A;  1ASW A;  4CEC A;  1RTH A;  3L3V A;  4AHU A;  3KLE A;  3JSM A;  1UAX A;  4F3O A;  2G8V A;  4N76 A;  1EX4 A;  2G8F A;  1BIS A;  2IOC A;  1QHT A;  3TAE A;  2JGU A;  1X9W A;  3L3U A;  2D0A A;  3QEV A;  4F2S A;  3AA5 X;  5C24 A;  1UA0 A;  4J2B A;  1RDA A;  3ZSQ A;  3OS1 A;  1ITG A;  4MQ3 A;  3K5M A;  1F21 A;  3DRS A;  4RW6 A;  4CF0 A;  4KHN A;  4IG3 A;  4RW7 A;  2GBZ A;  1A5W A;  3VQC A;  4FJI A;  2IDO A;  4FZY A;  4CFA A;  4DTN A;  5J2N A;  4PQU A;  2EHG A;  4BAC A;  2ETJ A;  1SKW A;  3RR8 A;  4E7I A;  1R0A A;  5FRO A;  4BE1 A;  1KVA A;  1S1X A;  5KI6 A;  1NKC A;  3MEG A;  3KD1 E;  4YFU A;  4FJK A;  1J5O A;  4DSK A;  4DQS A;  1B9D A;  2F8S A;  5CZ2 A;  3C95 A;  1EP4 A;  1GOC A;  3K2P A;  4CIF A;  4R5P A;  3OYJ A;  3NGZ A;  4B9V A;  4QOZ B;  3U3G A;  3V9S A;  4FJ5 A;  3B6O A;  4DG1 A;  4GW6 A;  4E1M A;  1C1B A;  1C1A A;  1DTT A;  3VQE A;  2HHU A;  3OYF A;  2IAJ A;  1RBR A;  1JXE A;  1YTA A;  3V6D A;  3S3O A;  2OA8 A;  3NCI A;  4LH5 A;  1HNV A;  2XY6 A;  4BDZ A;  1FKO A;  1QSY A;  3DOK A;  1CXQ A;  3ASM A;  4KTZ A;  2O4I A;  1S1T A;  2ATQ A;  4W5O A;  4W5Q A;  3TAP A;  4M3R A;  2XY5 A;  4ID1 A;  5J2M A;  2RF2 A;  1UWB A;  1WSJ A;  4RW9 A;  4DFJ A;  3HT3 A;  3DRR A;  1I3A A;  3KKR A;  4CES A;  4E7J A;  3QER A;  5FRM A;  1JLC A;  3OYB A;  1TKZ A;  4W5N A;  1U47 A;  5T7B A;  4KFB A;  4JS4 A;  3K5O A;  1NKB A;  2VWJ A;  1N6Q A;  1MU2 A;  4HUF A;  3L2U A;  3F73 A;  3VQQ A;  3VQ5 A;  3C94 A;  1TKD A;  4PWD A;  4DMN A;  1TV6 A;  4CJQ A;  4W5T A;  4CE9 A;  4CJU A;  4E7H A;  4RW4 A;  4AHR A;  4CIE A;  3AVN A;  3OYL A;  4KHU A;  1BCM A;  1LWF A;  3DRP A;  1YT3 A;  4FW1 A;  1RT6 A;  4CHN A;  2ZD1 A;  4ZHR A;  4CEE A;  4IKF A;  3SQ0 A;  1RT1 A;  3ZT3 A; 
#chains in the Genus database with same CATH topology
 3SUN A;  2E1Z A;  1JXB A;  2QW9 A;  3KWG A;  3RMB A;  1HYV A;  2FBV A;  4YOV A;  1KRP A;  3HSC A;  5EOY A;  1SKS A;  1CXU A;  1M90 O;  2A5X A;  2HBJ A;  4QS8 A;  1C0T A;  4RCH A;  3BY5 A;  1KVC A;  2ZWH A;  1NK6 A;  2ZJQ L;  2E2O A;  5CHI A;  1ZBS A;  1W2B M;  1CZB A;  4CEB A;  4FJ8 A;  4CEO A;  4KH6 A;  1MA9 B;  2VG5 A;  4H5R A;  4B9M A;  4JN4 A;  4IG0 A;  4BDP A;  2KFZ A;  1BUP A;  5AQR A;  1Q18 A;  3DAW A;  3DLK A;  1RNH A;  1HRH A;  3HM8 A;  1VQK N;  2Q36 A;  2PYL A;  1BIU A;  4I9Q A;  3VTI A;  3IUC A;  4B3S K;  1ZYQ A;  1D5A A;  1RDC A;  1WSH A;  2FSK A;  2G8W A;  1W0H A;  4PA1 A;  3K9J A;  5HP1 A;  1NG9 A;  4CGH A;  3F5T A;  4U7B A;  2YKM A;  3LP0 A;  2YHX A;  4Z4F A;  2E2Q A;  5DK5 A;  3OJS A;  1BU6 O;  1X9S A;  3SAH A;  4FK4 A;  4PKI A;  1YIT N;  4DB3 A;  1WAJ A;  4GMJ B;  1K8A O;  4CBU A;  1IKY A;  1QQC A;  2B6A A;  3ZET A;  4FW2 A;  3CJ7 A;  3KK2 A;  5M1K A;  5CY4 A;  3VQP A;  2HND A;  4QS9 A;  4PL8 A;  2Q97 A;  4ICL A;  5KPR A;  1WN7 A;  3LWL A;  5CR4 A;  1ZBL A;  2VWK A;  4E7L A;  1L5U A;  5BPL A;  3OJU A;  5HRO A;  5LY3 A;  2OPS A;  1ZC6 A;  1FW6 A;  4BRO A;  3CJC A;  5MLC Q;  5BR9 A;  4YOW A;  3VTH A;  3R8E A;  3AVJ A;  3NH2 A;  4NCB A;  3VQB A;  3EZ5 A;  3E01 A;  1N36 K;  4JKA A;  3EKS A;  5F2R A;  1UA1 A;  4BC5 A;  3CC2 N;  3DJC A;  1TK5 A;  3AO4 A;  1VSK A;  1K9M O;  1VHX A;  3MXI A;  4LH4 A;  3SJJ A;  1NGB A;  2I5J A;  3A5M C;  5C12 A;  2OPP A;  3OYE A;  4CZF A;  4DLG A;  4I7F A;  5M1P A;  4Z4I A;  4NXM K;  4JD2 B;  2W6L A;  2WUS A;  3LPU A;  4DFK A;  4FXD A;  1YJN N;  1TK8 A;  3CJ9 A;  3MXJ A;  4OLB A;  3PY8 A;  1WSE A;  4DV7 K;  1HQE A;  4E1J A;  3I0R A;  3I33 A;  3K5L A;  4IXC A;  4DV4 K;  3CQ8 A;  2D1K A;  3O3H A;  1NNE A;  3KK1 A;  2ZF5 O;  4KPY A;  2E20 A;  3AVA A;  4YDU A;  3IDH A;  3PUF A;  5AQI A;  1NJZ A;  3P1G A;  4F9O A;  3RSE A;  3QEI A;  4KTQ A;  4AHS A;  4DCH A;  4JI5 K;  1GLJ O;  3CET A;  1SQK A;  4CBW A;  1BQM A;  2B4J A;  3M8P A;  3J8A A;  3OS0 A;  5GAH P;  1T6D A;  4CGG A;  2KW4 A;  3AGR A;  4FM1 A;  4FJL A;  4JK7 A;  3U9D A;  1X3N A;  3J7Z O;  3KZB A;  2X6N A;  4BC2 A;  4E19 A;  5IWA K;  1L3U A;  4A5A A;  4KHY A;  2ZQB A;  3QBX A;  1QE1 A;  3HL8 A;  3CM5 A;  3CFR A;  1GLA G;  2E1Y A;  2QK9 A;  3FR0 A;  4CED A;  2Q0R A;  3K9K A;  4MO5 A;  2NNW A;  4ILG B;  4A57 A;  5AQL A;  3ZEU B;  3HVT A;  3MWP A;  2FXU A;  2VQF K;  1C0G A;  4YNQ A;  2DPN A;  3O3F A;  3V1O A;  4DR3 K;  4GV6 A;  3TAR A;  3O9S A;  4H0P A;  4DR4 K;  4H0X B;  3FZH A;  1BOT O;  1Q82 O;  4CJ4 A;  3MN6 A;  3HRG A;  4CHY A;  1GLL O;  4BRI A;  4R79 A;  4JKC A;  4DUY K;  5AQH A;  1HYS A;  1VSH A;  3LP3 A;  3AY9 A;  4LFB K;  2QWL A;  4X64 K;  3K59 A;  4IOA L;  2AA4 A;  4O5F A;  2OPR A;  3VN5 A;  3TAG A;  3KVG A;  5ADX H;  4CGI A;  5AQP A;  3VET A;  1W7A A;  2UYT A;  1RTJ A;  2OYQ A;  2OZS A;  1QVG M;  4KB0 A;  3D2F B;  2QI2 A;  1EWR A;  3SYZ A;  3OYG A;  1TGO A;  4CJK A;  1VQO N;  4FM0 A;  2CH5 A;  3L8B A;  3E9L A;  3MEE A;  3BEX A;  5GIN A;  1YXQ A;  3ISN C;  1DGK N;  2EX3 A;  3ZX2 A;  4CJE A;  3BP8 A;  2E4L A;  2HNY A;  3B6P A;  1YUW A;  3CYM A;  4HCB A;  1ASV A;  3HPH A;  3WT0 A;  1NJY A;  4AHC A;  3AVI A;  4M41 A;  3WXL A;  3AVB A;  2O8C B;  2QWQ A;  4CHZ A;  4L8R B;  3D7E O;  2HHQ A;  3VER A;  4I2Q A;  3SLC A;  3HVR A;  3QET A;  2O8B A;  1NMN A;  4B08 A;  1VSL A;  1W9H A;  1RT2 A;  4YHH K;  2VQE K;  4DS5 A;  3MCA B;  1NOY A;  3WXK A;  2UXB K;  1YVN A;  3FZM A;  2A6A A;  1QVF M;  1KXP A;  1SAZ A;  4HTU A;  1NJW A;  3CCR N;  2QA4 N;  3VGL A;  3CCU N;  4JI3 K;  4BVP A;  3THV A;  4LFC K;  3HJF A;  4W5R A;  2HBK A;  3OTO K;  1N32 K;  4Z94 A;  2OTL N;  4BRF A;  2EWS A;  4E1N A;  2OAN A;  3VQ9 A;  2YV0 X;  3SV3 A;  3VQ4 A;  3DYA A;  4J2A A;  3OYK A;  5M1O A;  3NH0 A;  1HPM A;  1NK7 A;  3NF6 A;  5LL6 Z;  3AVM A;  2KZZ A;  5FPM A;  4CJ7 A;  2E6L A;  1NGC A;  4B1Z A;  1X1P A;  4YOU A;  4YDU C;  4DTP A;  3L4I A;  1NOZ A;  3CPE A;  1KFD A;  3OY9 A;  4CZE A;  2KQ2 A;  2VGM A;  3H1V X;  5SWM A;  4DTS A;  3PO5 A;  2P9P A;  1WSF A;  3VGK A;  4DQI A;  1D9F A;  2AP1 A;  3O1B A;  5K14 A;  2NRW A;  2P9L A;  4CHQ A;  3AVG A;  4QAG A;  4FK0 A;  5AFU H;  3NAE A;  3DLG A;  1KLN A;  5GAD P;  3KJV A;  3CG7 A;  1GLE G;  3TAF A;  5HL7 L;  4A59 A;  1I94 K;  4CK3 A;  4MFB A;  2D5R A;  1D9D A;  5AZI B;  4PY5 A;  3LAL A;  1XMQ K;  2RHK A;  2RE2 A;  4CJS A;  5HRN A;  2D0B A;  4LFA K;  2O8D B;  3L3V A;  4F3O A;  4YOX A;  1EX4 A;  3C6A A;  1X9W A;  3L3U A;  3QEV A;  3N4Q A;  5C15 A;  4J2B A;  1RDA A;  5BRE A;  1ITG A;  2F7T A;  1XNR K;  1P90 A;  4IG3 A;  1IBM K;  4PQU A;  2EHG A;  1IJJ A;  4Y0W A;  5AQQ A;  1BO5 O;  3RR8 A;  2PAV A;  5FRO A;  1KVA A;  5GIO A;  4DSK A;  2W41 A;  4B9V A;  1GOC A;  2UUC K;  4OX9 K;  2YJF A;  1Q81 O;  4LC9 B;  1RBR A;  4IDH A;  1T3V A;  3NCI A;  1IV0 A;  3A5N C;  1HNV A;  1QSY A;  1FKO A;  3F2K A;  3ASM A;  1S1T A;  4H5V A;  2XY5 A;  4A5B A;  4FWO A;  4RW9 A;  1UWB A;  3Q7C A;  3DRR A;  3KKR A;  3HT3 A;  4PKH A;  4KFB A;  4JS4 A;  1LOT B;  4WYB A;  4YOR A;  3L2U A;  1G99 A;  3C94 A;  2A3Z A;  1HX1 A;  4CJQ A;  4CJU A;  3M5R A;  4CIE A;  3NVK A;  3CCQ N;  3PIP L;  1LWF A;  3DRP A;  1YT3 A;  1RT6 A;  4CHN A;  4IEE A;  2VWB A;  2WBN A;  1L3S A;  1RT1 A;  3ZT3 A;  4BRG A;  1Y97 A;  1HMV A;  3GBT A;  3KKS A;  4FJ7 A;  1TAU A;  5AQV A;  3ZSR A;  3JXU A;  1XC3 A;  1RFQ A;  1K8K A;  2G8H A;  1CZ9 A;  1HNZ K;  2WON A;  2YNG A;  3L0Q A;  3VOV A;  4B1V A;  3M6G A;  4Q0B A;  4KAZ A;  3LM2 A;  4GKJ K;  3SBG A;  2W42 A;  2FLO A;  3UKR A;  1LWC A;  4B9U A;  3LDP A;  4KI4 A;  5BPM A;  3ULE A;  1KAZ A;  1GOA A;  1BL3 A;  3CCE N;  4BY9 C;  2A41 A;  2YHA A;  3LWM A;  4ELU A;  4GVM A;  4BRK A;  3OYI A;  3MXM A;  4AH9 A;  3WNF A;  3DLR A;  3QML A;  4JLH A;  2IVO A;  3P38 A;  2DFF A;  3H3O B;  1VQP N;  3NE6 A;  3DLL L;  4FJX A;  1QQO A;  4JKH A;  1J9A A;  1BIZ A;  4RWT A;  5F1X A;  4FOI A;  3DWL A;  4BRC A;  1JLQ A;  4KH5 A;  1BA1 A;  3LDN A;  3ZSO A;  2I7N A;  3B8A X;  3CCM N;  1R59 O;  1HKC A;  1WSI A;  4JNE A;  3WNE A;  4B8A B;  3ZSZ A;  4EHT A;  2WOM A;  1HLU A;  1RT5 A;  2QWO A;  3DLB A;  4M3T A;  5BN9 A;  5AZJ A;  4ELV A;  4FWN A;  4HTL A;  2HF3 A;  3OYA A;  1NK0 A;  3VQ7 A;  2HHH K;  1JL2 A;  1NGG A;  1WUA A;  4M3Z A;  3ZET B;  4KKO A;  3ZSW A;  3NGY A;  1ZBI A;  2V7Z A;  5A2Q O;  1QHA A;  4IJN A;  4JI8 K;  4WE1 A;  2HMP A;  1S5J A;  3AO5 A;  1NMD A;  3VF4 A;  3CCL N;  4Z4E A;  4JS5 A;  3PX6 A;  1HJR A;  4BVO A;  4IFV A;  4O5B A;  3O3G A;  3QNN A;  2DTU A;  3SMP A;  1RTD A;  3QLH A;  3SQ4 A;  3K5N A;  2FC0 A;  4B9S A;  3L4Q A;  4IFE A;  1GOB A;  2A1S A;  4XIU A;  5C42 A;  4RW8 A;  4BR2 A;  4O55 A;  1REV A;  3BGR A;  3THY A;  4MDB A;  4FLX A;  1FXX A;  3DXK A;  3THW A;  4CZG A;  5J2Q A;  2BUP A;  3CJA A;  3LDO A;  3OYC A;  3O80 A;  4FLU A;  2OZM A;  4B9T A;  3VQ8 A;  4MLE A;  4M63 C;  4H0Y B;  3U4L A;  2GWK A;  5ELZ A;  5JIC A;  3QO9 A;  4Z0U A;  3EN9 A;  1LAW A;  4BRH A;  1VSJ A;  3F9M A;  4GV3 A;  4KHS A;  3I8D A;  4CJP A;  3T1H K;  3R3L A;  4KB1 A;  3RSE B;  1KLM A;  5AQK A;  3MMV A;  3OYN A;  4OVL A;  3TAB A;  3NGI A;  3EE8 A;  3WNH A;  1GLD G;  1Q9Y A;  4RTF D;  3QIC A;  2KLA A;  4CHO A;  4JI2 K;  4CEZ A;  3V81 A;  3EY1 A;  4LF5 K;  3NDK A;  3D6R A;  3HO1 A;  2V51 B;  4K41 A;  4N56 A;  2GTD A;  1L3T A;  2Z1G A;  5KQ8 A;  3ZSX A;  4N47 A;  1ZXO A;  2BH1 A;  1YI2 N;  3M3Z A;  1VSM A;  3RMC A;  4FLZ A;  3OYH A;  2FBX A;  5GAG P;  3D45 A;  4DR2 K;  4ISG A;  5FLX O;  4DTO A;  4CBX A;  3TR8 A;  4MO4 A;  1SL0 A;  3CF5 L;  3J81 O;  1T6C A;  1VRT A;  4YOT A;  3IG1 A;  4ZTF A;  3VF6 A;  3L6Q A;  3VF2 A;  3SUP A;  4I2P A;  3BZK A;  4JKF A;  1JLG A;  4BWM A;  4IOC L;  4BRE A;  4FVU A;  2FF3 B;  1VRU A;  3CME N;  2F8T A;  4UQG A;  2IC3 A;  3TAM A;  4X62 K;  2HVI A;  2YNI A;  3DI6 A;  4I9L A;  4DF8 A;  4CEF A;  4V19 S;  1ESV A;  1S6P A;  2FF6 A;  1OH8 A;  5FDL A;  4FLT A;  4AIL C;  4BG9 A;  4ELT A;  1YAG A;  2IS3 A;  4H03 B;  1JLE A;  4FLY A;  4CF1 A;  2Y1J A;  3TSU A;  4CZM A;  1TVR A;  1XWL A;  2YKN A;  4C8N A;  4H4O A;  1EWQ A;  4EIA A;  4LY7 A;  3HPO A;  4ISE A;  4LSL A;  2NRX A;  4JKG A;  3M8Q A;  2HBL A;  1Q9X A;  3VA0 A;  4CGD A;  2UUB K;  3ENB A;  4YOY A;  4K8X A;  3NF7 A;  4KV8 A;  2IVP A;  1C1C A;  3VEX A;  3RVC A;  3KIO A;  5KRS A;  4WFN L;  3TSP A;  2BGG A;  2RN2 A;  4OPA A;  4DV5 K;  3EE9 A;  4H5T A;  4BRP A;  1T03 A;  2PFU A;  3CFO A;  5LJV A;  1HPZ A;  1SZ2 A;  4CHP A;  1NKE A;  3NFA A;  4OPH A;  5BRD A;  5DMR A;  1BWF O;  5I42 A;  5E84 A;  3C7N A;  4NCG A;  3O1W A;  4NYN A;  4DV0 K;  4K8Z A;  4H0T B;  1YTU A;  4O0I A;  3VEO A;  2W40 A;  2G8K A;  3HXM A;  1N33 K;  5AQS A;  1JCE A;  4IOX A;  3AO2 A;  5ADX A;  4IO9 L;  3CC4 N;  4EZ6 A;  4F4K A;  1Z25 A;  2O8B B;  3L2R A;  2D0C A;  2B5J A;  5BRH A;  5CYM A;  1U4B A;  3ATU A;  3SPY A;  1JLA A;  4G1Q A;  4O44 A;  2ASM A;  2KKZ A;  2JWL A;  2QKB A;  4CJ5 A;  4A2B A;  1RBU A;  4NO7 A;  1RDB A;  3U8X A;  3KLG A;  3SUO A;  4M3X A;  4JI0 K;  3S3N A;  3ZT4 A;  4AQY K;  1GLF O;  3NVM A;  1RBS A;  4JV5 K;  3U3Y A;  2ASP A;  3N4P A;  2XO7 A;  3CCV N;  4KI6 A;  1TUY A;  1B92 A;  3M8S A;  5JVG L;  1JLB A;  3P83 D;  1TUU A;  3AAQ A;  4LF4 K;  3S41 A;  1LWE A;  4JI7 K;  3G6E N;  2XY7 A;  4GVE A;  1C0M A;  5FRN A;  1ASU A;  1VQ9 N;  3JYT A;  3FFI A;  3QEW A;  3RTV A;  1N8R O;  2P5O A;  4KBO A;  2J4R A;  4FLV A;  3O9Q A;  1CLQ A;  4EP5 A;  3ZLJ A;  4FWQ A;  2VYP A;  1U04 A;  4CZK A;  1YVU A;  2P9P B;  4GNI A;  4OKK A;  5HLF A;  4JEP A;  3TTD A;  2P9L B;  4FJN A;  3OBW A;  4OGE A;  3MN9 A;  3VEZ A;  4NB4 A;  1ASW A;  4CEC A;  5KPT A;  1RTH A;  4BRM A;  1UAX A;  4BR5 A;  3A8Y A;  2G8F A;  1NGF A;  3AA5 X;  3ZSQ A;  4PKG A;  4MQ3 A;  3K5M A;  2VGN A;  4BC3 A;  4RW6 A;  4CF0 A;  4IO8 A;  3CCJ N;  1A5W A;  3VQC A;  2IDO A;  4FZY A;  4CFA A;  1Y64 A;  4JKD A;  2YHY A;  1NKC A;  1S1X A;  2JWK A;  3KD1 E;  4YFU A;  2NRH A;  3DXM A;  2F8S A;  2ASO A;  5CZ2 A;  5AQJ A;  3K2P A;  4CIF A;  3H1Q A;  3OYJ A;  1E3M A;  4QOZ B;  3U3G A;  3V9S A;  1ATS A;  4DG1 A;  1DTT A;  2D0P A;  1JXE A;  3FZK A;  1YTA A;  2UU9 K;  3S3O A;  3FLC O;  4GKK K;  4LH5 A;  4BDZ A;  3SK3 A;  3PSF A;  2O4I A;  3TAP A;  4ID1 A;  4A61 A;  1QQN A;  4CES A;  5AFU A;  3QER A;  5FRM A;  3OYB A;  2IVN A;  4W5N A;  3EL2 A;  3K5O A;  2NZT A;  1TKD A;  1EQY A;  4RW4 A;  3AVN A;  3SQ0 A;  1IH7 A;  4ZHR A;  4CEE A;  4XH5 A;  1VK0 A;  4FVM A;  3HYF A;  3EKU A;  4LF7 K;  5EX5 A;  3GOI A;  2XRI A;  1BDG A;  4OGC A;  3QFU A;  4CZH A;  1KQS M;  1IG9 A;  3RMA A;  3KK3 A;  3WXJ A;  1NGA A;  2GV9 A;  1XMO K;  3V9W A;  4GY2 B;  2PZS A;  4M7X A;  5LMN K;  3CXC M;  4LF8 K;  3HZ6 A;  3TU5 A;  3SZ2 A;  2IGI A;  4KHW A;  1NLV A;  1KTQ A;  3R6M A;  4RG8 A;  3VA3 A;  3CI5 A;  4H5N A;  4M3U A;  3AAR A;  1K8K B;  3NMU A;  4H5W A;  5FPE A;  3MAQ A;  3QES A;  3V9U A;  3PX4 A;  1DT9 A;  1RDU A;  1U2V B;  4JKE A;  3S3M A;  2QWM A;  1J54 A;  3VES A;  4FM2 A;  2CGJ A;  3ZEU A;  4K25 A;  3ULE B;  3VQ6 A;  3D2E A;  4CK2 A;  4J2E A;  4HUE A;  2Y1I A;  4M42 A;  4WCE L;  4IDK A;  1N5Y A;  4JRP A;  2YI1 A;  1ILY A;  3WQT A;  4DR1 K;  4CVN E;  3WXM B;  3NHG A;  4B9N A;  3SBT A;  1YJ9 N;  1QZ5 A;  2DFH A;  3P4I A;  4TSX A;  3RMD A;  2HHV A;  2XY8 A;  5C2F A;  3ZX0 A;  4N5S A;  4I6M A;  4DHY A;  3CMA N;  1IKW A;  3LZJ A;  3OVN A;  3C6H A;  2HBM A;  1VQ5 N;  4K0K K;  3O5B A;  1DKG D;  4CW7 B;  2HF4 A;  2P9K A;  4AM6 A;  5BPN A;  3F9K A;  4DV2 K;  4DSF A;  3LAN A;  4C1N I;  5HBM A;  2P9U A;  3PIO L;  4DLE A;  2JLE A;  4NXN K;  4Y1C A;  4DTM A;  3ZSV A;  1RT7 A;  2GUI A;  4FJH A;  1D4X A;  4FWP A;  2YNH A;  1VQM N;  3IFR A;  1UOC A;  4F3T A;  3ALY A;  3O4N A;  3FZF A;  3AVF A;  2P9I A;  5AZJ B;  4DTR A;  4BWJ A;  3HM9 A;  1WNS A;  2QWN A;  3L2V A;  4DUZ K;  5JMV A;  4DSL A;  1OH7 A;  3OS2 A;  2E6M A;  1C6V A;  4CZL A;  4KHQ A;  1LAV A;  2XHB A;  3THX A;  3WEE A;  4WQ5 C;  1HKB A;  1SKR A;  1J6Z A;  2G8U A;  2W6K A;  2V52 B;  3CIP A;  4C8K A;  2F96 A;  2P9N A;  5AQT A;  2QXF A;  2HB5 A;  1HYZ A;  3NBP A;  5KGW A;  1KVB A;  3MED A;  2HHS A;  4FWS A;  1ZBU A;  2NRT A;  2YHW A;  1V4T A;  1U49 A;  1BA0 A;  1Z05 A;  3AA2 A;  1BHL A;  2P5G A;  1HKG A;  5AQO A;  4CJ3 A;  1S3X A;  5CZ1 A;  1VQ6 N;  3RWU A;  3ZCM A;  3L2W A;  2O8F A;  2RPI A;  3LZI A;  1NGD A;  3NF8 A;  4FWL A;  4O8U A;  3VQD A;  2Q0U A;  2YJE A;  3BDP A;  2NRR A;  1WOQ A;  2DY4 A;  1RT4 A;  1DEJ A;  4H0O A;  4KRE A;  2E88 A;  4BRN A;  1TYQ A;  1S9G A;  3THY B;  1GLC G;  1BG3 A;  5EU7 A;  3DXK B;  5BN8 A;  3THW B;  3QDK A;  5HRS A;  3E9P A;  2UUA K;  5AQZ A;  4F2R A;  4CGF A;  4DTJ A;  1U48 A;  1YJW N;  5KQD A;  2WFB A;  3O9U A;  2Z1J A;  1ZBH A;  3C0B A;  4B1Y B;  2QM1 A;  1RCH A;  4CGJ A;  3DLH A;  4KH4 A;  3T3F A;  2E5L K;  3H08 A;  5C2D A;  4X66 K;  2ZJR L;  4BE2 A;  3LAK A;  1NJI O;  2YHB A;  5M1Q A;  5FPD A;  2KFN A;  3G25 A;  3O4Q A;  4CJV A;  4CFD A;  2PY5 A;  4DV1 K;  3MEC A;  1X3M A;  4CJT A;  1CZA N;  4DQQ A;  4BR9 A;  4JYA K;  3HST B;  1VQ8 N;  5M1F A;  2A42 A;  1BGX T;  1HNI A;  4CJR A;  4KTW A;  2HHW A;  3A5O C;  3HTV A;  3TAQ A;  1WBB A;  3VEV A;  3Q7B A;  3AA4 A;  4M7Y A;  1SL1 A;  2HMI A;  5SZT A;  1FK9 A;  3KHY A;  4M45 A;  3BZC A;  1P8Z A;  4OPK A;  3CQX A;  3IAY A;  4HWI A;  4HHT A;  2ZM6 K;  4DSI A;  3P31 A;  2Z1I A;  4FPB A;  1HUX A;  1K6Y A;  1KD1 O;  1RBT A;  1QSL A;  1FKP A;  1G15 A;  1H1V A;  3PO4 A;  3ZSY A;  3KLF A;  3T19 A;  1Q8I A;  1BI4 A;  3SMS A;  1RTI A;  4EHU A;  4DV6 K;  1O13 A;  4KO0 A;  3EYZ A;  5C0Y A;  4FWM A;  2RKI A;  4BQL A;  2F9T A;  2E2P A;  4DF4 A;  1RGI A;  1WAF A;  5AQG A;  4FJM A;  5CE3 A;  3E66 A;  3QB0 A;  1U6Z A;  4WQ4 A;  4NCA A;  4ISF A;  3QIO A;  2OPQ A;  1VSF A;  3SQ1 A;  1VQ4 N;  2I7P A;  3O6W A;  1QTM A;  1D8Y A;  1U45 A;  4FZZ A;  1S22 A;  5D3G A;  3AO1 A;  3BF3 A;  2ITM A;  4CK1 A;  1Z26 A;  5AQF A;  4CD1 A;  3WXI A;  4B9Q A;  4XH1 A;  1SS6 A;  3HPG A;  3G71 N;  4PHT X;  1XHX A;  2NLX A;  3FGU A;  1S72 N;  3VMF B;  4FZX C;  4MLH A;  3CD6 N;  1NBW A;  3ZT2 A;  5J2P A;  3C7N B;  3LDS A;  5JLF A;  4B1U B;  5AJ3 K;  3QEX A;  1IKX A;  4BGB A;  4QS7 A;  3S9H A;  2O8E A;  4JI4 K;  3CQY A;  2P9S A;  4DU1 A;  1KSP A;  1MWM A;  3C6T A;  1L3V A;  2YCH A;  5GAE P;  4A62 A;  1W97 L;  1K73 O;  1LV5 A;  4BG8 A;  1NK5 A;  3H3N O;  3OA9 A;  4JKB A;  4KRF A;  1ZBF A;  2GEM A;  4IBN A;  3AVL A;  3EEQ A;  2F9W A;  4LF6 K;  1Q7Y O;  1JKH A;  3IKM A;  4CJL A;  3TPQ A;  3UKU A;  1IKV A;  2Q31 A;  4H0V B;  4Z4C A;  4XEI A;  4B1W B;  3OBY A;  4J2D A;  2QKK A;  1FJG K;  4DS4 A;  5C10 A;  4BDY A;  3KLH A;  3HK2 A;  3L2Q A;  2ZGZ A;  5J1E A;  3GE1 A;  1C0U A;  2D4W A;  4CCH A;  4Z4G A;  4BR7 A;  1E4G T;  4O0J A;  1S1W A;  4BRD A;  4OJR A;  4O4G A;  3QIN A;  4DFP A;  1SL2 A;  2FBT A;  4N41 A;  1E4F T;  4A2A A;  4BR0 A;  1NJX A;  3I0S A;  3O9R A;  1WB9 A;  4FYD A;  3GG4 A;  1KAY A;  2PBD A;  2Q1N A;  2FSJ A;  4WFB L;  4FCY A;  1Z6R A;  2F4V K;  3KWI A;  3ENO A;  4FJJ A;  1S1V A;  5JS2 A;  3VEN A;  2X6S A;  3SPZ A;  1TL1 A;  4H8K A;  3H6E A;  3CC7 N;  4AHT A;  4DQR A;  3U9Z A;  4JK9 A;  5AQW A;  4AHU A;  3KLE A;  3JSM A;  1JJ2 M;  2G8V A;  4MDA A;  3JS6 A;  1BIS A;  2IOC A;  1QHT A;  4F2S A;  5C24 A;  1UA0 A;  1F21 A;  5AQM A;  4KHN A;  5GIP A;  3AAP A;  3ZYY X;  4AF1 A;  4WF9 L;  4DTN A;  5J2N A;  4BAC A;  2ETJ A;  4BGA A;  4E7I A;  1R0A A;  1MWK A;  5KI6 A;  3MEG A;  1J5O A;  1B9D A;  3C95 A;  1EP4 A;  3NGZ A;  3J7Y P;  4FJ5 A;  3UB5 A;  4GW6 A;  1KC8 O;  1C1B A;  1C1A A;  3VQE A;  2HHU A;  3OYF A;  2IAJ A;  3V6D A;  1CXQ A;  2H3G X;  4JHD A;  2ATQ A;  4W5O A;  5J2M A;  2RF2 A;  4DFJ A;  1WSJ A;  3TI0 A;  3DXM B;  3H45 C;  1I3A A;  4BRL A;  1TKZ A;  1U47 A;  5T7B A;  1NKB A;  1N6Q A;  2VWJ A;  4HUF A;  3F73 A;  3VQQ A;  4KHP K;  4PWD A;  4DMN A;  1TV6 A;  4W5T A;  4E7H A;  4CE9 A;  2BDP A;  4KHU A;  4AHR A;  3HOT A;  3OYL A;  1BCM A;  3SAF A;  3T69 A;  4FW1 A;  3G4S N;  5I9E B;  1MDU B;  4DR5 K;  4C23 A;  3VPZ A;  4OLA A;  1IO2 A;  3LDL A;  5AR0 A;  5JVH L;  4WQ4 C;  3BUZ B;  1VSD A;  3QEP A;  3ID6 A;  2BE2 A;  3AVK A;  4CFB A;  3CJ1 A;  4O8K A;  4CF2 A;  4X65 K;  2P51 A;  3CFP A;  3KLI A;  2R7Y A;  4F8R A;  3UE5 A;  4DU4 A;  4LF9 K;  4IFY A;  1NGI A;  1IBK K;  3AVC A;  2OCE A;  3V9X A;  1TK0 A;  1TKT A;  4CER A;  3RRG A;  4C8M A;  3G0Z A;  3H46 O;  3QNO A;  5IT9 O;  4EZ9 A;  3IRX A;  3VEW A;  1EET A;  1RBV A;  3M1F A;  1OVQ A;  4XH4 A;  3JAM O;  1NU0 A;  4CZJ A;  4G9Z A;  1XQS C;  2HHX A;  4CEA A;  3V1R A;  1NM1 A;  2YX6 A;  3SQ2 A;  4H4M A;  4CZI A;  5HRP A;  2OTJ N;  3KD5 E;  1QS4 A;  4FO0 A;  2Q3S A;  4DKW A;  4DTU A;  3D2E B;  4C8L A;  1NGE A;  2CH6 A;  2QWP A;  3HP9 A;  5JS1 A;  1ATR A;  2A1R A;  4WQ5 A;  3LP2 A;  3LDQ A;  1NGJ A;  3I56 N;  3I55 N;  5I3U A;  1NK4 A;  1VSI A;  2KTQ A;  4FSV A;  3WQU A;  3WNG A;  4I6M B;  3EO3 A;  1S1U A;  2D0O A;  2HST A;  4B1X B;  4DWI A;  3R1X A;  1DTQ A;  3GDQ A;  1LW0 A;  3K0S A;  3ATV A;  3TAN A;  2LSN A;  3OYM A;  1T05 A;  2O4G A;  2P9K B;  3PSI A;  3V9Z A;  3DLE A;  1S6Q A;  3J7A P;  4LD0 A;  4DR7 K;  2P9U B;  5H1S Q;  1J5E K;  3R9P A;  1YF5 L;  1J53 A;  3D0P A;  1C0F A;  3UIQ A;  4EP4 A;  4IEI A;  4CF8 A;  4FLW A;  2PYJ A;  1IBL K;  2FBY A;  3O4W A;  4FJ9 A;  4JD2 A;  3T1A A;  3ZT0 A;  3OW2 M;  4E3S A;  4DSE A;  2P9I B;  2V7Y A;  3P5J A;  1S9E A;  4HCC A;  1TL3 A;  1I39 A;  4B3O A;  3K57 A;  4Q5V A;  5BRF A;  3SI6 A;  1EO1 A;  3CJB A;  2HW3 A;  1KFS A;  3THX B;  3WEE B;  1JL1 A;  5JLH A;  3QFP A;  5KPZ A;  3KTQ A;  4CJW A;  5C25 A;  3E1Y A;  2UXC K;  4FL9 A;  2P9N B;  1EXQ A;  2NRV A;  3CCS N;  1RIL A;  4NLB A;  4JK8 A;  3A2F A;  2Q2R A;  1EKE A;  2DFE A;  2GEL A;  5DM6 L;  3HOS A;  3PLA A;  5B8H A;  4FWK A;  5E41 A;  2NUB A;  5AQU A;  3W0L A;  2O8F B;  3AA3 A;  5KGX A;  1SV5 A;  1NK8 A;  1T8E A;  5KRT A;  1V4S A;  2KHO A;  3HI0 A;  5AQX A;  4U67 L;  2P1J A;  3NH1 A;  3LP1 A;  1NGH A;  2GUP A;  3HP6 A;  3C6U A;  4FK2 A;  4AM7 A;  2BTF A;  1TYQ B;  3AO3 A;  1RDW X;  3UKR B;  1KCF A;  4CFC A;  1KAX A;  4EFH A;  1VQ7 N;  4GV9 A;  3GL1 A;  3HBT A;  4C8O A;  3P39 A;  2WC9 A;  3LM9 A;  2IIR A;  4IJA A;  3SJH A;  3FZL A;  2CGK A;  3I8B A;  3SNN A;  4M3W A;  2GX9 A;  4BE0 A;  4CIG A;  3O08 A;  1WSG A;  3K58 A;  3E9O A;  4YY3 K;  2WTU A;  4CD3 A;  1XHZ A;  3DM2 A;  4FJG A;  2A40 A;  2AJQ A;  4B3T K;  3V1Q A;  3IS9 A;  5EXW A;  3FFK B;  4DV3 K;  2ITG A;  4ILH A;  4Y1D A;  2HVH A;  2E8A A;  4E89 A;  4JI6 K;  5LJW A;  3D2F A;  4DU3 A;  3DOL A;  4JAX A;  3W3D A;  3G10 A;  5FPN A;  3O9T A;  2YNF A;  5AQN A;  1JCF A;  3LAM A;  5LMU K;  4HUG A;  4K42 A;  4DQ8 A;  4FPA A;  2QWR A;  1HNX K;  3SCX A;  5E26 A;  3RRH A;  4LSN A;  2E2N A;  3WUH A;  4NYF A;  4OKE A;  3ZT1 A;  4DQP A;  2HOE A;  4AHV A;  2FSN A;  3TTC A;  1JLF A;  3IMX A;  5AQY A;  1VQL N;  5HRR A;  3FE1 A;  1N34 K;  4JRQ A;  2O8C A;  1JCG A;  2Z1H A;  4UY8 O;  3AV9 A;  5DM7 L;  4ILJ A;  3MK6 A;  2UXD K;  1BI4 B;  1OH6 A;  1XI1 A;  3CM6 A;  3TWH A;  4CF9 A;  1TKX A;  4DSJ A;  1BQN A;  5BR8 K;  3MWT A;  1RT3 A;  5CYQ A;  2X74 A;  1X9M A;  1DLO A;  4CEQ A;  2BAN A;  3RR7 A;  4B8C A;  1OVY A;  4BRQ A;  1OH5 A;  4QCL A;  1XUP O;  3VQA A;  3BF1 A;  3LPT A;  3MX5 A;  1T7P A;  3M8R A;  3CHW A;  1VSE A;  4IZ9 A;  3LL3 A;  1BCO A;  4BQZ A;  1O1W A;  3TTF A;  1HJO A;  5KTQ A;  3OYD A;  3DMJ A;  4FOE A;  3VEY A;  5HOO A;  4CJF A;  3NF9 A;  4E7K A;  4IWV A;  4J8F A;  1RDD A;  3J80 O;  1NK9 A;  3C65 A;  1QZ6 A;  1U2V A;  3SUQ A;  4PUO A;  4L3Q A;  3T7Z A;  1Q86 O;  4PL7 A;  4DFM A;  2O8E B;  2GWJ A;  2P9S B;  3KK7 A;  4B9L A;  3ID8 A;  4OO1 J;  2ZJP L;  4WFA L;  2VG6 A;  2X78 A;  3CPW M;  1YHQ N;  1VQN N;  4ID5 A;  1SUQ A;  4Z4H A;  4EAH D;  1A5X A;  3MCP A;  1HQU A;  4M3Y A;  1B9F A;  4HVJ A;  1OKJ A;  5EY4 A;  4OPJ A;  3PV8 A;  5TKY A;  5F0X A;  3U6F A;  4NLC A;  2QXL A;  3OHR A;  3V4I A;  1XC9 A;  2KZM A;  3QIP A;  2G8I A;  3AVH A;  3MDQ A;  4BR4 A;  2ZGY A;  3ULD A;  2VCP A;  3SV4 A;  2QEX N;  5AZI A;  4DTX A;  1QSS A;  3A0I X;  3ITH A;  1LW2 A;  4OKJ A;  3A5L C;  3UKU B;  4ZTJ A;  2O8D A;  3QBW A;  4FWR A;  3PX0 A;  4CI6 A;  2NRZ A;  3CER A;  4BRA A;  2HNZ A;  4E0D A;  3ZX3 A;  4B3R K;  1TAQ A;  2VG7 A;  2ZE2 A;  1A5V A;  3AGK A;  1WLJ A;  4BC4 A;  3O8M A;  4N76 A;  1HNW K;  3VGM A;  3TAE A;  2JGU A;  1QQM A;  4C1N K;  2D0A A;  3OS1 A;  1VAZ A;  3TSQ A;  3T1Y K;  1YIJ N;  3DRS A;  4RW7 A;  2GBZ A;  1XNQ K;  4FJI A;  4DR6 K;  3MN5 A;  1M1K O;  1SKW A;  4BE1 A;  1GLB G;  3ENH A;  3EZW A;  4DQS A;  1ATN A;  4R5P A;  1X9J A;  1WBD A;  3B6O A;  4K43 A;  1HR0 K;  4E1M A;  4JI1 K;  1NWK A;  1LCU A;  2QTD A;  1T44 A;  4JKG B;  2OA8 A;  2XY6 A;  2CGL A;  1IG8 A;  3MN7 A;  3DOK A;  4KTZ A;  5EVZ A;  5M1N A;  3SAG A;  4W5Q A;  4M3R A;  3MX2 A;  2HHT A;  4E7J A;  1JLC A;  1MU2 A;  3VQ5 A;  4B3M K;  4FJK A;  4JHD B;  2ZD1 A;  4IKF A;  5TKW A; 
#chains in the Genus database with same CATH homology
 1VK0 A;  4FVM A;  3HYF A;  3SUN A;  1Y97 A;  1JXB A;  1HMV A;  3KKS A;  4FJ7 A;  1TAU A;  4OLA A;  3RMB A;  3ZSR A;  2XRI A;  1IO2 A;  1HYV A;  2FBV A;  4OGC A;  1KRP A;  1SKS A;  1CXU A;  2G8H A;  1CZ9 A;  1IG9 A;  1C0T A;  3RMA A;  1VSD A;  3QEP A;  1KVC A;  2WON A;  1NK6 A;  2BE2 A;  2YNG A;  3KK3 A;  2GV9 A;  3AVK A;  3V9W A;  4CFB A;  3CFP A;  4CF2 A;  2PZS A;  2P51 A;  2R7Y A;  3KLI A;  4Q0B A;  4F8R A;  4KAZ A;  4DU4 A;  1CZB A;  2W42 A;  4CEB A;  3SZ2 A;  2IGI A;  4B9U A;  1LWC A;  4FJ8 A;  4IFY A;  4CEO A;  4KHW A;  1KTQ A;  2VG5 A;  4RG8 A;  3VA3 A;  4KI4 A;  3AVC A;  3V9X A;  1GOA A;  1BL3 A;  4M3U A;  1TK0 A;  4B9M A;  1TKT A;  4IG0 A;  4BDP A;  2KFZ A;  2YHA A;  3LWM A;  4ELU A;  4CER A;  4GVM A;  3DLK A;  1RNH A;  3MAQ A;  3QES A;  3RRG A;  4C8M A;  1HRH A;  3G0Z A;  3OYI A;  3QNO A;  3MXM A;  3V9U A;  3PX4 A;  4EZ9 A;  2PYL A;  1BIU A;  4AH9 A;  3S3M A;  3WNF A;  4I9Q A;  3IRX A;  1J54 A;  1EET A;  3DLR A;  1RBV A;  1ZYQ A;  4FM2 A;  1D5A A;  1RDC A;  1WSH A;  3VQ6 A;  4JLH A;  4CK2 A;  4J2E A;  4HUE A;  2Y1I A;  2DFF A;  4M42 A;  2G8W A;  4IDK A;  1N5Y A;  1W0H A;  4PA1 A;  3NE6 A;  4JRP A;  5HP1 A;  3NHG A;  4FJX A;  4B9N A;  2DFH A;  4TSX A;  1J9A A;  1BIZ A;  3RMD A;  4CGH A;  2HHV A;  2HHX A;  2XY8 A;  4CEA A;  3V1R A;  3SQ2 A;  2YKM A;  4N5S A;  4H4M A;  3LP0 A;  5HRP A;  4Z4F A;  1IKW A;  3KD5 E;  1JLQ A;  1QS4 A;  5DK5 A;  2Q3S A;  4DTU A;  3OJS A;  3LZJ A;  3OVN A;  3ZSO A;  1X9S A;  4C8L A;  4FK4 A;  3HP9 A;  1WSI A;  1WAJ A;  4GMJ B;  2A1R A;  5JS1 A;  3WNE A;  1IKY A;  1QQC A;  2B6A A;  4B8A B;  3LP2 A;  5I3U A;  3ZSZ A;  3F9K A;  1NK4 A;  1VSI A;  4FW2 A;  2KTQ A;  2WOM A;  4DSF A;  1RT5 A;  3DLB A;  3LAN A;  3WNG A;  3KK2 A;  5CY4 A;  1S1U A;  3VQP A;  5HBM A;  2HND A;  4M3T A;  4ELV A;  4DLE A;  4ICL A;  2JLE A;  1WN7 A;  4Y1C A;  3LWL A;  4DWI A;  1DTQ A;  2VWK A;  3OYA A;  4E7L A;  1ZBL A;  4DTM A;  1NK0 A;  1L5U A;  1LW0 A;  3ZSV A;  3TAN A;  3VQ7 A;  1RT7 A;  2GUI A;  2LSN A;  4FJH A;  3OYM A;  1JL2 A;  3OJU A;  2YNH A;  1T05 A;  2O4G A;  3V9Z A;  5HRO A;  4M3Z A;  1UOC A;  4KKO A;  3ZSW A;  4F3T A;  2OPS A;  3ALY A;  1S6Q A;  3DLE A;  3NGY A;  3O4N A;  1ZBI A;  4LD0 A;  3AVF A;  4DTR A;  4BWJ A;  3AVJ A;  3NH2 A;  1WNS A;  3L2V A;  3HM9 A;  4NCB A;  3VQB A;  3EZ5 A;  4DSL A;  1J53 A;  3OS2 A;  4WE1 A;  2E6M A;  3D0P A;  3UIQ A;  4EP4 A;  3SYZ A;  3E01 A;  4CF8 A;  4FLW A;  2PYJ A;  1C6V A;  4KHQ A;  3AO5 A;  2FBY A;  1S5J A;  1LAV A;  2XHB A;  4FJ9 A;  1UA1 A;  5D3G A;  4Z4E A;  4JS5 A;  3T1A A;  3PX6 A;  3ZT0 A;  1TK5 A;  1HJR A;  3AO4 A;  1VSK A;  4E3S A;  4DSE A;  1SKR A;  2BDP A;  3P5J A;  2G8U A;  3MXI A;  4LH4 A;  3SJJ A;  1S9E A;  2I5J A;  1TL3 A;  1I39 A;  4HCC A;  4IFV A;  4O5B A;  4B3O A;  2OPP A;  3O3G A;  3OYE A;  3QNN A;  2F96 A;  4C8K A;  3K57 A;  2DTU A;  2QXF A;  4DLG A;  2HB5 A;  1HYZ A;  3NBP A;  4I7F A;  5KGW A;  1KVB A;  3MED A;  4Q5V A;  2HHS A;  1RTD A;  1ZBU A;  4Z4I A;  3SI6 A;  3QLH A;  3SQ4 A;  2HW3 A;  1U49 A;  3K5N A;  1KFS A;  3AA2 A;  1BHL A;  1JL1 A;  2FC0 A;  2P5G A;  4B9S A;  4CJ3 A;  5CZ1 A;  3KTQ A;  4CJW A;  3LPU A;  5C25 A;  4DFK A;  4FXD A;  2HHT A;  3RWU A;  1TK8 A;  1GOB A;  2A1S A;  3MXJ A;  3ZCM A;  4RW8 A;  5C42 A;  4XIU A;  3L2W A;  3PY8 A;  4OLB A;  1WSE A;  2RPI A;  1EXQ A;  4O55 A;  1HQE A;  1REV A;  3BGR A;  3LZI A;  3I0R A;  3NF8 A;  4FLX A;  3K5L A;  3VQD A;  1FXX A;  1RIL A;  3BDP A;  3CQ8 A;  3O3H A;  5J2Q A;  3KK1 A;  4KPY A;  3AVA A;  3OYC A;  2DY4 A;  3A2F A;  4FLU A;  2OZM A;  1EKE A;  2DFE A;  1RT4 A;  3PUF A;  3VQ8 A;  4B9T A;  1NJZ A;  3P1G A;  4KRE A;  5E41 A;  2NUB A;  3QEI A;  4KTQ A;  3AA3 A;  1S9G A;  4AHS A;  5KGX A;  5EU7 A;  1SV5 A;  1NK8 A;  1T8E A;  1BQM A;  2B4J A;  3M8P A;  3QO9 A;  4Z0U A;  5KRT A;  3OS0 A;  1LAW A;  4CGG A;  2KW4 A;  1VSJ A;  5HRS A;  4KHS A;  2P1J A;  4FM1 A;  4FJL A;  3NH1 A;  3I8D A;  4F2R A;  4CGF A;  3LP1 A;  4DTJ A;  4CJP A;  1U48 A;  3HP6 A;  4KB1 A;  2X6N A;  3C6U A;  4FK2 A;  4E19 A;  1L3U A;  1KLM A;  4KHY A;  2ZQB A;  3AO3 A;  1QE1 A;  3OYN A;  2Z1J A;  1KCF A;  3HL8 A;  4OVL A;  4CFC A;  3TAB A;  3CM5 A;  1ZBH A;  3NGI A;  3WNH A;  3CFR A;  1RCH A;  1Q9Y A;  4C8O A;  4CGJ A;  2QK9 A;  3DLH A;  3T3F A;  4CHO A;  3H08 A;  4CED A;  4CEZ A;  3V81 A;  3EY1 A;  3NDK A;  4BE2 A;  3LAK A;  3HO1 A;  2YHB A;  3SNN A;  4N56 A;  4M3W A;  2KFN A;  4CJV A;  3O4Q A;  4BE0 A;  1L3T A;  2Z1G A;  4CFD A;  2PY5 A;  3HVT A;  3MEC A;  3ZSX A;  4CIG A;  1WSG A;  4N47 A;  4YNQ A;  4CJT A;  3K58 A;  3O3F A;  3V1O A;  3TAR A;  4DQQ A;  1VSM A;  3RMC A;  4FLZ A;  3HST B;  3OYH A;  2FBX A;  1BGX T;  1XHZ A;  1HNI A;  3D45 A;  3DM2 A;  4CJ4 A;  4CHY A;  4FJG A;  4CJR A;  4KTW A;  4DTO A;  3TR8 A;  2HHW A;  2AJQ A;  1SL0 A;  1VRT A;  3V1Q A;  3IS9 A;  1VSH A;  3IG1 A;  3LP3 A;  3TAQ A;  4ZTF A;  1HYS A;  2ITG A;  3AA4 A;  4Y1D A;  3K59 A;  3SUP A;  4I2P A;  2HVH A;  1SL1 A;  2HMI A;  1JLG A;  4BWM A;  4E89 A;  5SZT A;  1FK9 A;  4M45 A;  4DU3 A;  2OPR A;  3DOL A;  3VN5 A;  4OPK A;  3IAY A;  3TAG A;  4HHT A;  3G10 A;  4DSI A;  1VRU A;  2Z1I A;  4CGI A;  2YNF A;  2F8T A;  4UQG A;  2IC3 A;  3TAM A;  1K6Y A;  3LAM A;  2HVI A;  4HUG A;  2YNI A;  3DI6 A;  1RBT A;  4I9L A;  4CEF A;  1FKP A;  4DF8 A;  1QSL A;  1G15 A;  1S6P A;  1RTJ A;  3ZSY A;  5FDL A;  3PO4 A;  3SCX A;  2OYQ A;  3KLF A;  3RRH A;  4LSN A;  4FLT A;  2OZS A;  3T19 A;  4AIL C;  1Q8I A;  4KB0 A;  1BI4 A;  4ELT A;  1RTI A;  2IS3 A;  4FLY A;  1JLE A;  4NYF A;  4CF1 A;  4OKE A;  2Y1J A;  3ZT1 A;  4DQP A;  1TVR A;  1XWL A;  2YKN A;  4KO0 A;  4H4O A;  1TGO A;  4C8N A;  4CJK A;  3OYG A;  3EYZ A;  4FM0 A;  4AHV A;  4LY7 A;  3HPO A;  4LSL A;  3L8B A;  3MEE A;  2RKI A;  1JLF A;  3M8Q A;  4DF4 A;  1WAF A;  5HRR A;  4FJM A;  4JRQ A;  1Q9X A;  2Z1H A;  4CGD A;  3VA0 A;  3AV9 A;  3ISN C;  2EX3 A;  4K8X A;  3NF7 A;  4KV8 A;  4CJE A;  1BI4 B;  1XI1 A;  2E4L A;  1C1C A;  5KRS A;  4NCA A;  3KIO A;  3CM6 A;  2HNY A;  3QIO A;  3TWH A;  2OPQ A;  3B6P A;  4CF9 A;  2BGG A;  1VSF A;  2RN2 A;  3CYM A;  1TKX A;  1ASV A;  3SQ1 A;  4HCB A;  3HPH A;  1NJY A;  1QTM A;  4DSJ A;  1T03 A;  1BQN A;  4AHC A;  1D8Y A;  3CFO A;  1U45 A;  1RT3 A;  1HPZ A;  3AVI A;  4CHP A;  1NKE A;  4FZZ A;  5CYQ A;  4M41 A;  3AVB A;  3NFA A;  2X74 A;  1X9M A;  1DLO A;  5DMR A;  3AO1 A;  4CEQ A;  4CHZ A;  4L8R B;  4CK1 A;  2HHQ A;  1Z26 A;  5I42 A;  2BAN A;  3RR7 A;  4I2Q A;  4B8C A;  4NCG A;  3HVR A;  4NYN A;  3QET A;  1L3S A;  4K8Z A;  1YTU A;  3HPG A;  4O0I A;  4B08 A;  1VSL A;  1W9H A;  2G8K A;  1RT2 A;  3VQA A;  4QCL A;  3LPT A;  4DS5 A;  1XHX A;  1NOY A;  1T7P A;  3M8R A;  3HXM A;  1VSE A;  4FZX C;  1BCO A;  3AO2 A;  3ZT2 A;  4HTU A;  5J2P A;  1NJW A;  1O1W A;  3LDS A;  4EZ6 A;  4F4K A;  3QEX A;  5KTQ A;  1IKX A;  1Z25 A;  3DMJ A;  3OYD A;  3THV A;  3S9H A;  3L2R A;  3HJF A;  2D0C A;  4W5R A;  2B5J A;  4DU1 A;  4CJF A;  3NF9 A;  5CYM A;  4E7K A;  1U4B A;  1KSP A;  3SPY A;  1JLA A;  3C6T A;  4G1Q A;  1L3V A;  1RDD A;  4E1N A;  4O44 A;  1NK9 A;  3VQ9 A;  2YV0 X;  3SV3 A;  3VQ4 A;  2QKB A;  3DYA A;  4J2A A;  1LV5 A;  1NK5 A;  4CJ5 A;  3SUQ A;  3OYK A;  1RBU A;  1RDB A;  3NH0 A;  4PUO A;  1NK7 A;  3NF6 A;  4DFM A;  3AVM A;  3KLG A;  3SUO A;  4KRF A;  2KZZ A;  2E6L A;  1ZBF A;  4IBN A;  4M3X A;  4B9L A;  1X1P A;  3AVL A;  3S3N A;  2VG6 A;  2X78 A;  3ZT4 A;  1RBS A;  4ID5 A;  1SUQ A;  4Z4H A;  1JKH A;  4CJL A;  4DTP A;  3U3Y A;  3TI0 A;  1IKV A;  1A5X A;  2XO7 A;  4KI6 A;  1HQU A;  1B92 A;  1NOZ A;  4Z4C A;  4M3Y A;  1B9F A;  4HVJ A;  3M8S A;  4J2D A;  2QKK A;  1KFD A;  4OPJ A;  3OY9 A;  4DS4 A;  3PV8 A;  1JLB A;  3P83 D;  3U6F A;  2KQ2 A;  3KLH A;  4BDY A;  3HK2 A;  5SWM A;  3L2Q A;  5J1E A;  1LWE A;  4DTS A;  3V4I A;  1C0U A;  1XC9 A;  3PO5 A;  2KZM A;  1WSF A;  1IH7 A;  4CCH A;  2XY7 A;  3QIP A;  1C0M A;  4DQI A;  3AVH A;  1D9F A;  5FRN A;  4Z4G A;  4O0J A;  1ASU A;  2G8I A;  5K14 A;  1S1W A;  3ULD A;  3SV4 A;  3JYT A;  4OJR A;  4O4G A;  3QIN A;  4CHQ A;  4DFP A;  4DTX A;  3FFI A;  3AVG A;  3QEW A;  1SL2 A;  1QSS A;  2FBT A;  1LW2 A;  3ITH A;  4OKJ A;  4QAG A;  3RTV A;  4ZTJ A;  2P5O A;  4FK0 A;  3NAE A;  4N41 A;  4FLV A;  1CLQ A;  3DLG A;  1NJX A;  3I0S A;  4EP5 A;  3PX0 A;  1KLN A;  4FYD A;  3KJV A;  3CG7 A;  1U04 A;  1YVU A;  4FCY A;  2HNZ A;  3TAF A;  4OKK A;  4E0D A;  4CK3 A;  5HLF A;  4FJJ A;  1S1V A;  5JS2 A;  2X6S A;  3SPZ A;  4MFB A;  1TL1 A;  2D5R A;  4H8K A;  1D9D A;  4FJN A;  1TAQ A;  3LAL A;  4PY5 A;  2VG7 A;  2ZE2 A;  4OGE A;  1A5V A;  4AHT A;  4CJS A;  1WLJ A;  5HRN A;  4DQR A;  2D0B A;  1ASW A;  4CEC A;  1RTH A;  3L3V A;  4AHU A;  3KLE A;  3JSM A;  1UAX A;  4F3O A;  2G8V A;  4N76 A;  1EX4 A;  2G8F A;  1BIS A;  2IOC A;  1QHT A;  3TAE A;  2JGU A;  1X9W A;  3L3U A;  2D0A A;  3QEV A;  4F2S A;  3AA5 X;  5C24 A;  1UA0 A;  4J2B A;  1RDA A;  3ZSQ A;  3OS1 A;  1ITG A;  4MQ3 A;  3K5M A;  1F21 A;  3DRS A;  4RW6 A;  4CF0 A;  4KHN A;  4IG3 A;  4RW7 A;  2GBZ A;  1A5W A;  3VQC A;  4FJI A;  2IDO A;  4FZY A;  4CFA A;  4DTN A;  5J2N A;  4PQU A;  2EHG A;  4BAC A;  2ETJ A;  1SKW A;  3RR8 A;  4E7I A;  1R0A A;  5FRO A;  4BE1 A;  1KVA A;  1S1X A;  5KI6 A;  1NKC A;  3MEG A;  3KD1 E;  4YFU A;  4FJK A;  1J5O A;  4DSK A;  4DQS A;  1B9D A;  2F8S A;  5CZ2 A;  3C95 A;  1EP4 A;  1GOC A;  3K2P A;  4CIF A;  4R5P A;  3OYJ A;  3NGZ A;  4B9V A;  4QOZ B;  3U3G A;  3V9S A;  4FJ5 A;  3B6O A;  4DG1 A;  4GW6 A;  4E1M A;  1C1B A;  1C1A A;  1DTT A;  3VQE A;  2HHU A;  3OYF A;  2IAJ A;  1RBR A;  1JXE A;  1YTA A;  3V6D A;  3S3O A;  2OA8 A;  3NCI A;  4LH5 A;  1HNV A;  2XY6 A;  4BDZ A;  1FKO A;  1QSY A;  3DOK A;  1CXQ A;  3ASM A;  4KTZ A;  2O4I A;  1S1T A;  2ATQ A;  4W5O A;  4W5Q A;  3TAP A;  4M3R A;  2XY5 A;  4ID1 A;  5J2M A;  2RF2 A;  1UWB A;  1WSJ A;  4RW9 A;  4DFJ A;  3HT3 A;  3DRR A;  1I3A A;  3KKR A;  4CES A;  4E7J A;  3QER A;  5FRM A;  1JLC A;  3OYB A;  1TKZ A;  4W5N A;  1U47 A;  5T7B A;  4KFB A;  4JS4 A;  3K5O A;  1NKB A;  2VWJ A;  1N6Q A;  1MU2 A;  4HUF A;  3L2U A;  3F73 A;  3VQQ A;  3VQ5 A;  3C94 A;  1TKD A;  4PWD A;  4DMN A;  1TV6 A;  4CJQ A;  4W5T A;  4CE9 A;  4CJU A;  4E7H A;  4RW4 A;  4AHR A;  4CIE A;  3AVN A;  3OYL A;  4KHU A;  1BCM A;  1LWF A;  3DRP A;  1YT3 A;  4FW1 A;  1RT6 A;  4CHN A;  2ZD1 A;  4ZHR A;  4CEE A;  4IKF A;  3SQ0 A;  1RT1 A;  3ZT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...