1BIZA

Hiv-1 integrase core domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
147
Chain Sequence
VDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna integration
molecule keywords HIV-1 INTEGRASE
publication title Three new structures of the core domain of HIV-1 integrase: an active site that binds magnesium.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 46
structure length 147
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bizA00
4GMJB 4PUOA 3L2VA 4PY5A 2Z1HA 1YT3A 2X6NA 1ZYQA 2XY7A 1JLAA 3CFOA 4ID5A 5KRSA 4FJGA 2HHUA 1TAUA 1EX4A 4CEEA 4B9LA 1C0TA 2FBYA 3NH1A 3QEPA 4DS5A 4W5OA 4O44A 1BI4B 3WNEA 3AA4A 3AVAA 4HUGA 1U45A 3HO1A 4L8RB 2YNIA 4WE1A 1QE1A 4LH5A 2JGUA 2X6SA 1VRTA 3TWHA 5J2PA 1S1UA 3KLFA 3ZCMA 2PZSA 2P51A 2GUIA 1W9HA 5C24A 4KI6A 4DQPA 1ZBHA 2XY8A 1ITGA 2IS3A 3QEXA 4DTRA 3AA5X 1ASUA 1IKXA 3SCXA 3QEVA 4Z4FA 4N5SA 4LSLA 4FLWA 3ASMA 2B6AA 4JS5A 2XHBA 4CJTA 4DF4A 2KW4A 4BDPA 4BE1A 3ALYA 3M8RA 1CZBA 1KVCA 3ZT0A 3HYFA 1ZBUA 4M45A 3G0ZA 4CEOA 4DTUA 3L3VA 4Z0UA 4E19A 3PO4A 4GW6A 4CGJA 1J54A 2DFFA 4CJ3A 3DMJA 4N76A 1G15A 5HRPA 3OYMA 3HK2A 1Q9YA 3BDPA 4HCCA 4O5BA 4CE9A 1TL3A 3CYMA 2FBXA 2JLEA 2Z1JA 3HPHA 3OJUA 4JS4A 2VG5A 4KPYA 1NJXA 3EZ5A 1UWBA 4DSEA 1TAQA 1JLQA 1WSHA 3KK3A 3RMDA 1JL1A 1J9AA 4RG8A 1HJRA 1XWLA 1J53A 4CF8A 3K5MA 3TAGA 3G10A 4FLVA 1T03A 1XHZA 4KRFA 1HNIA 4BWJA 2VWJA 4M3WA 1S1VA 3SQ2A 3CQ8A 3O4QA 4Z4EA 1WSJA 1UAXA 1RT6A 1HRHA 1NOZA 1RT4A 4CK3A 3MAQA 1VSEA 3P83D 1RT5A 1VSLA 1BIUA 2G8UA 1ASWA 4ICLA 5SWMA 3OYKA 1B9DA 3EY1A 3TAEA 2HMIA 1HNVA 1LWEA 1BISA 2X74A 1QS4A 1LW2A 4DF8A 4CFAA 2KFZA 4AHSA 2XY6A 3C94A 4FXDA 2OPQA 3OYGA 4AHTA 4CJ5A 4N41A 3CM5A 4IFYA 2F96A 3KK2A 5DK5A 4DQIA 4RW7A 2YV0X 1TK5A 4B9SA 1I3AA 4DTJA 1N6QA 3ZT3A 4FM1A 2LSNA 4N56A 1TKXA 3K2PA 3QNOA 2HB5A 4OLBA 1RDDA 1BIZA 4GVMA 3LDSA 3VQPA 4CF9A 3I0SA 3TABA 3RMAA 1NK4A 2OA8A 4NCAA 3D0PA 1UA1A 3ZT2A 5D3GA 1RBRA 4N47A 4CFDA 3RMCA 4DSFA 3SQ4A 5HRSA 1Y97A 4FYDA 1C0MA 1S9EA 2HW3A 5J1EA 1SKRA 1XHXA 2OPRA 2PYLA 3S3MA 4DU3A 4CJ4A 4I2PA 4KI4A 3NCIA 3KKRA 3AVFA 1WN7A 3SV3A 4B9MA 1RDAA 3H08A 4JRPA 4F3TA 1MU2A 1WSEA 5FDLA 3T3FA 2PY5A 4HTUA 1TVRA 3ISNC 1WAJA 4OGCA 4DSIA 1NJZA 2IDOA 4OVLA 4HUFA 4ZTJA 2E4LA 3L3UA 3QINA 3NE6A 1NOYA 2I5JA 3WNHA 4CEQA 4JRQA 3AVHA 4M3UA 4M3RA 4E3SA 3TAPA 1EXQA 4CESA 1XC9A 3RMBA 1DTTA 3QLHA 4KHQA 4FLXA 2QKKA 4O4GA 4HUEA 3LP2A 3KD1E 3VQAA 2OZMA 4ELTA 2ETJA 2HHWA 1C6VA 3THVA 4CHZA 4RW8A 3DRSA 3HP6A 4CERA 4QOZB 4DMNA 1X9MA 3DOLA 1JXBA 2DFEA 3C6UA 3NGIA 4FJ8A 3CFPA 4DWIA 4KHSA 1BI4A 3VQ6A 1O1WA 1VK0A 4CF1A 3EYZA 3VQ7A 5EU7A 4CJKA 1VSDA 3ZSXA 2Y1JA 4OKEA 4BDZA 1ASVA 3V9ZA 3SPZA 1JL2A 1QSLA 2HVIA 1BGXT 1RBTA 5KGWA 2OYQA 1ZBIA 2YHAA 3PV8A 4XIUA 4CFCA 3NH0A 2HHQA 2DFHA 1D8YA 1C0UA 4CGGA 4B8CA 4CHPA 3NGZA 4DTNA 4I2QA 3V81A 5I3UA 4QCLA 4FCYA 4IFVA 2A1RA 1JLGA 4FZZA 1NK6A 1U4BA 3OS1A 3AO5A 3CM6A 3ZSOA 3VQCA 3DM2A 5CZ1A 3TAMA 3KKSA 3O3FA 4B3OA 3NAEA 1DLOA 3LP3A 3PY8A 4Q0BA 3DYAA 3TI0A 2RPIA 4M3YA 3ITHA 1WNSA 3TARA 4FJJA 2G8FA 3MEDA 3DLEA 4KB1A 4BE2A 3ULDA 3NGYA 1RTIA 4C8OA 4FJNA 3SQ0A 2F8TA 4FJIA 4CJVA 4KKOA 3VQ4A 3K5LA 1QSSA 3DRPA 5E41A 3HL8A 2B4JA 3RWUA 1LAVA 1L3VA 2G8HA 3AVJA 4B08A 4H8KA 4F4KA 4OKKA 3AVGA 3HP9A 4IBNA 3L2WA 1IKYA 1REVA 3UIQA 3HVRA 3DLGA 3NDKA 3KIOA 3OYLA 2RN2A 4CEBA 4ZTFA 1F21A 4CK2A 3QETA 3CG7A 1VSMA 4FLZA 4KAZA 3OYCA 2G8IA 5CYMA 3MEGA 3NF6A 2GV9A 1SKWA 4CJUA 4O0JA 5FRMA 3DLKA 3HM9A 2P5GA 5HP1A 3DLHA 4BE0A 1S6QA 1IKVA 2BDPA 2ZQBA 4CK1A 4IG3A 4DU4A 4J2EA 1VRUA 1JXEA 3QEWA 1TK8A 1T7PA 4DSJA 4M3ZA 4MFBA 5JS2A 4FLUA 2VG6A 3B6OA 4B8AB 3JSMA 3OS0A 5HLFA 4BWMA 4DFPA 4KHYA 5CY4A 3OYIA 4HHTA 1D9DA 4O55A 1RBUA 1LWCA 3K57A 4DSLA 4HVJA 3HSTB 4FJ5A 3TAFA 1SUQA 1IG9A 2HHSA 4Y1DA 2YKMA 4CHNA 4B9UA 2QK9A 4C8NA 1RTHA 1CXUA 1C1BA 2P1JA 3L2UA 1BCOA 4H4MA 1TGOA 1U48A 1NKBA 1NKCA 4CEZA 1CZ9A 4AH9A 5KTQA 2X78A 1L3TA 1U49A 1IO2A 5CZ2A 3V9WA 4B9VA 3ZSVA 1TL1A 4R5PA 3K59A 1W0HA 3OYBA 2VG7A 1BQNA 3AO3A 3OJSA 3PX6A 3LANA 1VSJA 4DFKA 1C1CA 3C6TA 2HVHA 2D0BA 4Y1CA 5I42A 4IG0A 1TKTA 4ID1A 3VQBA 4FJHA 3RR8A 4KV8A 4CJFA 2R7YA 1YTUA 1RT3A 4YNQA 4FJKA 4M41A 4M3TA 1L3UA 1WSIA 1BHLA 4CJQA 4CHOA 3V1RA 5T7BA 3OS2A 4O0IA 3OY9A 2KFNA 2KQ2A 1ZBLA 4KTZA 4DQSA 4CGIA 3LZJA 4DFMA 3HPGA 4Z4HA 1KLNA 1JLBA 2FBTA 1R0AA 4FJ7A 1YVUA 4LH4A 1UA0A 4CJSA 4EP5A 4E7JA 4OGEA 4CGHA 2Z1IA 3OVNA 4CGDA 3O3GA 4FVMA 3NF8A 4J2DA 4M42A 3K5OA 2DY4A 1HYZA 2EHGA 1NK5A 5C25A 1RT1A 1S6PA 2RKIA 4AHCA 4E1NA 1T8EA 1WSFA 3VQDA 1NKEA 4FJXA 1Z26A 2F8SA 4EP4A 3U3YA 4B9NA 4CJLA 1A5WA 4CJRA 1QSYA 1EETA 3V1OA 1RT7A 3VQ5A 3PO5A 4KHNA 2IAJA 3MXJA 1I39A 4E0DA 1JLEA 1SL2A 4EZ9A 3QERA 2ITGA 4AHUA 4F8RA 3ZSYA 3ZSWA 4KHUA 2ZD1A 1RTJA 3C95A 1HPZA 2Q3SA 2XRIA 1RNHA 4W5TA 2Z1GA 4F2SA 2IC3A 1SV5A 2W42A 4DQQA 2XY5A 3KTQA 2Y1IA 4KB0A 4KREA 2PYJA 3QEIA 4TSXA 4CJWA 1Q9XA 3SPYA 1XI1A 1LW0A 3S3NA 4AHVA 4IKFA 1CLQA 3S3OA 1A5XA 1HQEA 1FK9A 4CF2A 1HYSA 1KVAA 4RW4A 4BACA 2YNFA 3BGRA 3NBPA 2HHVA 1LWFA 3AVMA 1VSHA 1X1PA 1GOAA 1KSPA 1IKWA 2ZE2A 1C1AA 1U04A 3DI6A 3SJJA 1NK8A 3LWLA 1KTQA 4I7FA 3SZ2A 3U6FA 3B6PA 1KRPA 3HVTA 5K14A 2YHBA 3DOKA 3F73A 1BCMA 1UOCA 3O4NA 1CXQA 3PX0A 2G8WA 4J2AA 4FK4A 4LY7A 3FFIA 3LP0A 4RW9A 4FLYA 1A5VA 1RTDA 4G1QA 2O4GA 1X9WA 1TK0A 3AVNA 4LD0A 1S1WA 4CJEA 3P5JA 1Z25A 1JLFA 3T19A 4W5QA 5J2MA 3V1QA 4W5NA 2RF2A 4Z4GA 4CCHA 3WNGA 3RRHA 1HMVA 3T1AA 5KRTA 3AV9A 4CIEA 3TAQA 3A2FA 3VA0A 2OPSA 5KI6A 4OPJA 4DLGA 5J2QA 3QESA 3AO4A 3OYJA 3AO1A 4M3XA 4Z4CA 4HCBA 4I9QA 1BQMA 1FKOA 4FM0A 4PQUA 3WNFA 4AHRA 4J2BA 4FLTA 1JLCA 1RDBA 2G8KA 2O4IA 3VQ8A 4CIFA 4PA1A 2VWKA 4CJPA 5SZTA 3F9KA 3VQEA 1EP4A 4MQ3A 3IG1A 4CEDA 4DTSA 3QNNA 4C8MA 1EKEA 4FW2A 4FW1A 4CGFA 3SUQA 1D9FA 3RRGA 3L2QA 3ZSZA 4FJMA 2GBZA 2HHTA 3KJVA 4ELUA 3V9XA 1L5UA 1WSGA 3MXIA 4FZXC 3D45A 4CIGA 2D0AA 1TKZA 4DTOA 3AVLA 4E7KA 3ZSQA 5DMRA 1VSIA 3V6DA 3I8DA 3SI6A 4FK2A 4NYNA 1Q8IA 1KLMA 4DS4A 4C8KA 4DTXA 3JYTA 3SYZA 3DRRA 4EZ6A 1JKHA 1KCFA 4JLHA 4KFBA 4RW6A 5FRNA 3TANA 4ZHRA 2HNZA 4KHWA 4Z4IA 3L2RA 3PUFA 4CEAA 4CHYA 3KK1A 4FK0A 1KFSA 3OYFA 3NF9A 2G8VA 4NCBA 3MECA 5C42A 1YTAA 1KVBA 3RR7A 5FROA 1J5OA 3OYEA 3VQ9A 1SL0A 2NUBA 1KFDA 4FM2A 5JS1A 1D5AA 4E7LA 1FXXA 2OPPA 4PWDA 4OPKA 1RILA 3LAKA 3K5NA 1NK9A 2QKBA 2IGIA 1SL1A 3HPOA 3LWMA 3V9UA 2QXFA 2BGGA 1RCHA 3AVKA 3M8SA 3OYHA 1ZBFA 1VSKA 4OKJA 1DTQA 1GOCA 3LALA 3M8PA 5KGXA 2OZSA 2FC0A 2KZZA 3KD5E 3AVIA 3QIOA 3S9HA 3LPUA 3SQ1A 1NJWA 1X9SA 4E7IA 4I9LA 4DTMA 1S5JA 3HJFA 2IOCA 3KLHA 2AJQA 1SKSA 4KTWA 2E6MA 3AVCA 2HHXA 5CYQA 3ZSRA 4AILC 3ZT1A 1NK0A 5J2NA 4LSNA 1WLJA 2D0CA 3SUOA 1RBVA 3M8QA 1NJYA 1K6YA 3IS9A 1WAFA 4YFUA 4KO0A 2FBVA 2YNGA 4CF0A 3OYNA 2WOMA 3LAMA 4DU1A 4DFJA 1LV5A 1RDCA 3SUPA 5HBMA 1VSFA 4NCGA 4KTQA 3VA3A 4C8LA 2WONA 3QIPA 1QHTA 3HT3A 2D5RA 2KZMA 2B5JA 4H4OA 1T05A 3CFRA 3I0RA 4E1MA 3SV4A 2E6LA 3NFAA 1TV6A 5HRRA 1RT2A 3OYAA 1IH7A 4BDYA 4CFBA 4E7HA 2HNYA 2P5OA 4K8XA 1BL3A 5HRNA 4IDKA 4DG1A 2YKNA 4UQGA 3RTVA 3MXMA 2EX3A 3NH2A 3U3GA 4FJ9A 4QAGA 4FZYA 1GOBA 1B9FA 1S1XA 2ATQA 4FJLA 4K8ZA 4DQRA 4F2RA 4CHQA 4DLEA 1N5YA 1S1TA 1RBSA 3MEEA 3KLEA 1QTMA 3P1GA 4DSKA 2YNHA 1B92A 4NYFA 4OJRA 3K58A 4F3OA 3L8BA 2DTUA 3AA2A 4CECA 3SNNA 2HNDA 3NHGA 4ELVA 4OLAA 3QO9A 4CEFA 2A1SA 3LZIA 3OYDA 3DLRA 4DTPA 1FKPA 3DLBA 1LAWA 5HROA 3PX4A 3VN5A 1HYVA 1TKDA 3IRXA 4W5RA 3KLIA 3LPTA 1L3SA 3ZT4A 3O3HA 3V4IA 3AA3A 3E01A 4Q5VA 1U47A 2XO7A 2KTQA 3AO2A 3IAYA 3AVBA 3SUNA 3V9SA 1QQCA 2BANA 3TR8A 3KLGA 1S9GA 4E89A 3VQQA 3NF7A 2BE2A 3HXMA 3LP1A 4B9TA 1NK7A 1HQUA
chains in the Genus database with same CATH superfamily
2E1ZA 3QDKA 4PUOA 2KLAA 4JI0K 3O9RA 4H0OA 1XUPO 4B9LA 5C0YA 4W5OA 2VWBA 3WNEA 3AA4A 3QB0A 1U45A 2YNIA 1QE1A 1NMDA 3FZLA 2PZSA 2P51A 2Q36A 2IS3A 3QEXA 3D2EA 3QEVA 3VF2A 4Z4FA 4LSLA 4FLWA 3DXKA 4BRPA 4H0YB 3IKMA 4FPAA 3BEXA 4BDPA 1XMQK 3ALYA 1KVCA 3ZT0A 4CEOA 2ZM6K 1Q7YO 4BQZA 4IO9L 4BRNA 1J54A 3VEOA 3OYMA 2O8EA 2OANA 3F5TA 4O5BA 3HSCA 2JLEA 4JS4A 2QWLA 2P9UA 3EZ5A 1NGGA 4DSEA 1TAQA 1JLQA 1SQKA 3KK3A 3F9MA 1J9AA 3IUCA 4MLEA 2ZJQL 4CF8A 1NGJA 3K5MA 3TAGA 4FLVA 1XHZA 2VWJA 1GLLO 1S1VA 2O8CA 2NRWA 3U9DA 4RCHA 1RT6A 1HRHA 3MAQA 1RT4A 4CK3A 1HNXK 1VSLA 4BC4A 4GKJK 3B8AX 2KFZA 4DV6K 4N41A 2JWKA 3R1XA 5JLFA 3KK2A 5DK5A 4RW7A 4B9SA 5LL6Z 1I3AA 3E9PA 4DTJA 3ZT3A 5AQZA 1K8KA 1ESVA 5HOOA 4N56A 5FPDA 3H3OB 3TABA 1GLJO 2VQFK 1NK4A 3S41A 1UA1A 3ZT2A 4N47A 5M1QA 3TSQA 1C0MA 5J1EA 3N4PA 1XHXA 1SKRA 2OPRA 4I2PA 5CHIA 3NCIA 3SV3A 3AVFA 3H08A 1MU2A 1C0GA 3T3FA 4JKEA 3ISNC 4OGCA 3MWPA 3D7EO 3WNHA 4GNIA 2PBDA 3RMBA 3FZFA 4HUEA 4YY3K 2QI2A 2OZMA 4ELTA 2HHWA 4A5BA 1BWFO 4CERA 4QOZB 5CE3A 3OW2M 3EE8A 3NGIA 3CFPA 3ENOA 4KHSA 1O1WA 1VK0A 3KVGA 4CF1A 3VQ7A 1EO1A 5EU7A 4OKEA 1ASVA 3V9ZA 2ZGZA 2HVIA 1ZBIA 2YHAA 4BC3A 4XIUA 1VQ8N 3I55N 4CZMA 1D8YA 3BF3A 5I3UA 2V51B 3ZEUB 4IFVA 4QS7A 3FZKA 3DM2A 5CZ1A 4K25A 3QBXA 3G71N 3NAEA 1JCEA 4BQLA 3LP3A 3PY8A 4ISFA 1BUPA 1WNSA 1SS6A 2G8FA 1RTIA 1N33K 1QSSA 3RWUA 2B4JA 1LAVA 2AA4A 3E9LA 3IDHA 4HWIA 2ZGYA 4JKCA 3CQYA 1NGAA 4YHHK 4U67L 3HP9A 4K42A 3L2WA 1IKYA 4BRQA 4FO0A 5M1OA 2RN2A 4ZTFA 1BA0A 5FPMA 3CG7A 1VSMA 3UE5A 4CK2A 1OVYA 3J7ZO 2G8IA 2V7YA 3WT0A 3LM2A 1HLUA 1ZC6A 4CZKA 2HF4A 4DU4A 4FVUA 4JI4K 3CJ9A 2VG6A 3B6OA 4QS9A 2QW9A 4HHTA 3DXMB 1D9DA 1LWCA 3K57A 1HNZK 4DSLA 2QTDA 3HSTB 3U9ZA 3J81O 4CHNA 4B9UA 3VGKA 3EEQA 1U48A 1BCOA 3J8AA 1CZ9A 4DUYK 1U49A 1IO2A 4IDHA 4B9VA 2VG7A 3O9QA 5C12A 4DFKA 3OBYA 5I42A 3UKUA 3O9TA 2IVOA 4JKFA 3ENHA 4KV8A 4H5RA 4M41A 3ZX0A 1L3UA 1EWQA 4CJQA 4O0IA 4BRHA 1NGBA 4CGIA 3CCRN 4DFMA 3D6RA 1ILYA 3KZBA 1U2VB 1YVUA 4LH4A 1KD1O 1NNEA 4M42A 4J2DA 4OX9K 1K9MO 1NK5A 1S6PA 5BREA 4E1NA 1Z26A 4H03B 5DM6L 4KHNA 2IAJA 1IBLK 1XMOK 4YDUA 1VQLN 4F8RA 5FPNA 1FJGK 3A5LC 3C95A 5KQDA 1RNHA 2NRHA 4W5TA 4F2SA 3SAFA 2IC3A 3H45C 4TSXA 4CJWA 4AM6A 3SPYA 2WUSA 4KHPK 3S3NA 1CLQA 3ZEUA 4CF2A 3VTIA 1HYSA 4PKGA 3CCSN 5AQOA 3O80A 3CI5A 1KSPA 1IKWA 2ZE2A 2VGMA 3LWLA 3U6FA 1KRPA 3F73A 1BCMA 4J2AA 5FLXO 4RW9A 4G1QA 3GDQA 2QM1A 1OKJA 1R59O 3T19A 4CCHA 3HZ6A 3EN9A 5KRTA 3A2FA 3MX2A 4X65K 5KI6A 4DLGA 5J2QA 1ZXOA 3QESA 4M3XA 3AO1A 4HCBA 1Z05A 3WNFA 3ZX2A 3J7YP 5TKWA 4PA1A 2VWKA 2VQEK 4DTSA 4IZ9A 4O8KA 2O8FB 3QNNA 3H6EA 4C8MA 3SUQA 2P9IB 1GLDG 4GKKK 2HHTA 2QWMA 2GBZA 3DXMA 3V9XA 2GELA 3D45A 1HKBA 2F4VK 4E7KA 3J80O 5DMRA 2IVPA 3V6DA 1TYQB 4FK2A 4DS4A 3SYZA 4BC5A 4JLHA 4RW6A 1OVQA 3THYB 2RE2A 4EHTA 4CEAA 3KK1A 2Q2RA 2GEMA 3O6WA 4BRCA 3IFRA 1FW6A 3VQ9A 1D5AA 1T3VA 4OPKA 2HBJA 1RILA 2P9NB 2IGIA 4DCHA 3LWMA 2BGGA 3M8SA 1VSKA 4OKJA 1YJWN 3LALA 5KGXA 4B1VA 2KZZA 3L6QA 3SQ1A 4V19S 3OBWA 3H3NO 3U4LA 2HHXA 2JWLA 4KH6A 4A57A 4AILC 4EIAA 3ZETB 2UUAK 5I9EB 1NJYA 3IS9A 4YFUA 4KO0A 2FBVA 4CF0A 4FWNA 4KTQA 5TKYA 4C8LA 1X9JA 3QIPA 2KZMA 2B5JA 4H4OA 3TSUA 3I0RA 4BC2A 5GAGP 2E6LA 5HRRA 3OYAA 4PKHA 1IH7A 1ATRA 4OPAA 3RTVA 1QHAA 1GLEG 4X62K 4JI3K 3LDLA 4F2RA 3ZYYX 4WQ4A 2OTJN 1Y64A 2Q0UA 4IEIA 1RBSA 1QTMA 2YNHA 3ATVA 1GLBG 3K9JA 3L8BA 2CH5A 4ELVA 4OLAA 1IV0A 1QZ5A 3DLRA 3MN5A 4PL8A 5AQFA 4DR4K 3VN5A 1L3SA 3IRXA 4W5RA 3LPTA 1NGHA 4IJAA 3O3HA 3V4IA 3TSPA 1YITN 3JS6A 1U47A 2XO7A 2KTQA 5AQVA 2A42A 3IAYA 3AVBA 3V9SA 1QQCA 2Q97A 1ATNA 3TR8A 1S9GA 2FF6A 2BE2A 5AQPA 3CCJN 3L2VA 1NGFA 1HUXA 1ZYQA 2XY7A 4CBUA 2HHUA 3RVCA 1TAUA 2CGKA 2O8FA 2FBYA 4DS5A 2P9IA 4O44A 5JVGL 4BR4A 1XC3A 2ZF5O 1W7AA 4LH5A 2X6SA 3O9UA 3TWHA 1TYQA 3ZCMA 4KI6A 1W9HA 4KH4A 4DQPA 1ZBHA 3TU5A 3C7NA 4DTRA 3AA5X 3UB5A 3SCXA 3THYA 4N5SA 3ASMA 2B6AA 4CJTA 4DF4A 4BE1A 3A0IX 1N32K 4ISGA 3L3VA 4E19A 4BVOA 2HMPA 4GW6A 4FOIA 5HRPA 1Q82O 3BDPA 4FWPA 4CE9A 2P9NA 3OJUA 2VG5A 1E4FT 4U7BA 4GV6A 4LF6K 1XWLA 2O8EB 2W6KA 1T03A 4UY8O 3C6AA 1TUYA 1RFQA 3ZETA 4JV5K 2QXLA 1VSEA 2PFUA 3CJBA 2G8UA 4BRAA 3OYKA 1HNVA 1VQNN 1BISA 2X74A 4BGAA 4NXMK 3OYGA 4F9OA 2FXUA 2WFBA 3CM5A 4IFYA 2WC9A 4EHUA 2LSNA 4H0PA 5GAHP 4E1JA 1TKXA 3QNOA 2HOEA 4ISEA 4CZJA 4OLBA 3LDSA 3CETA 3VQPA 4CF9A 3RMAA 2OA8A 1T6CA 3D0PA 1J5EK 4CFDA 3E66A 2UU9K 2VYPA 5HRSA 1VAZA 2PYLA 3JXUA 3S3MA 5AQTA 2D1KA 3KKRA 4MDBA 1RDAA 1WSEA 5FDLA 1KQSM 1NJZA 4HUFA 4ZTJA 3QINA 1NOYA 4PKIA 4JRQA 3AVHA 3KWIA 4M3RA 4K43A 1EXQA 1S72N 1DTTA 3QLHA 4KHQA 2QKKA 4OPHA 3VQAA 3EL2A 1YAGA 4EFHA 2E5LK 3AAQA 3DOLA 1JXBA 2DFEA 3EKUA 4FJ8A 4PL7A 4DWIA 4FL9A 4YDUC 1JCFA 1VSDA 3ZSXA 4LC9B 2YHYA 3QFPA 4BDZA 3CCQN 2Y1JA 3SPZA 3CCLN 4JI8K 2YI1A 1RBTA 2Q0RA 3PV8A 1IBKK 2HHQA 2DFHA 1C0UA 4CGGA 3M1FA 4CHPA 3NGZA 3V81A 4FCYA 1DT9A 4FZZA 1U4BA 3OS1A 3AO5A 3CM6A 3Q7BA 3VQCA 3KKSA 4B3OA 4YOTA 3DYAA 3PIPL 2RPIA 3ITHA 3VPZA 3CC4N 4IOXA 4KB1A 3P38A 4BE2A 3ULDA 4FJNA 3EO3A 4DR6K 2F8TA 5GAEP 5EOYA 4FJIA 2GWJA 3VQ4A 1YIJN 3HL8A 4AQYK 2G8HA 3AVJA 4H8KA 4JKAA 5AQHA 4OKKA 3PSFA 2YCHA 4DV3K 4JNEA 1T6DA 4FLZA 1LOTB 3MEGA 3E1YA 2GV9A 4CJUA 3D2FB 5FRMA 3VMFB 3HM9A 1VQMN 1LCUA 4CJ7A 4BE0A 1IKVA 4CK1A 4J2EA 1VRUA 4BRIA 1TK8A 1T7PA 4H5NA 4M3ZA 1WBBA 5JS2A 4FLUA 2OCEA 4BWMA 4DFPA 4KHYA 2W41A 1RBUA 4XH5A 4X66K 3SJHA 3TAFA 1SUQA 1IG9A 3HBTA 1RTHA 2P1JA 3I8BA 2X78A 1BU6O 3VERA 3AGRA 1XQSC 1W0HA 3LANA 4DV7K 4IG0A 1TKTA 3VQBA 3WXKA 4CJFA 2R7YA 1RT3A 4JI6K 4BREA 1BHLA 2YX6A 3OS2A 3OY9A 2KQ2A 1ZBLA 3CC2N 5GIOA 4Z4HA 3CXCM 2FBTA 3UKUB 1R0AA 3MK6A 1VQKN 3OVNA 3NF8A 2FLOA 1RT1A 2RKIA 1T8EA 1WSFA 4IWVA 1A5WA 2F9TA 1QSYA 2E20A 3CCMN 3DJCA 3MXJA 4E0DA 4EZ9A 2ITGA 5BPNA 3ZSYA 3ZSWA 4KHUA 4BRDA 4CI6A 4G9ZA 4FWRA 3C65A 2XRIA 2Q3SA 4IJNA 2ZWHA 1SV5A 2W42A 1RDWX 3WXIA 4NLBA 5JVHL 1LW0A 2GUPA 4AHVA 1HQEA 3VGLA 4RW4A 4BACA 2BH1A 2YNFA 4JN4A 1QZ6A 3NBPA 2HHVA 1LWFA 4WQ4C 3EKSA 5BRDA 1U04A 1C1AA 3SJJA 1KTQA 1H1VA 3SZ2A 1YUWA 3HVTA 1UOCA 1CXQA 2G8WA 4JK8A 3LP0A 3ID6A 5LJWA 1A5VA 2FSNA 3VEYA 2YJFA 1OH8A 1NGCA 4WYBA 1S1WA 4NB4A 4HTLA 4JD2B 5J2MA 3F2KA 4Z4GA 4M7XA 1HMVA 3T1AA 3GG4A 4Z4CA 4IOAL 3D2FA 2NRVA 5F2RA 4PQUA 2NNWA 1EQYA 1RDBA 2G8KA 2O4IA 3VQ8A 1IG8A 3LDQA 2YHWA 1VHXA 5SZTA 1EP4A 4MQ3A 3UKRB 1EKEA 4FW2A 4FW1A 4CGFA 1VQ7N 1D9FA 4NO7A 2NRTA 4CZEA 2Q1NA 1L5UA 4FZXC 1GLCG 1YF5L 1TKZA 3AVLA 4Y0WA 5AFUH 4BR5A 1VSIA 3VEWA 4DTXA 3JYTA 5FRNA 1JKHA 4KFBA 2DPNA 3RSEB 3TTCA 4X64K 2HNZA 3TANA 3L2RA 3PUFA 3VOVA 4CHYA 2G8VA 4Z94A 3SAHA 4CZGA 1KVBA 3RR7A 1HKGA 1HKCA 4DHYA 3OYEA 3H46O 5JS1A 4YORA 4PWDA 2OPPA 3LAKA 3K5NA 1SL1A 3HPOA 4GV9A 2AP1A 4FWSA 1GOCA 5ADXH 1BG3A 4I9LA 1S5JA 3NMUA 4R79A 2E6MA 4B3TK 4JI5K 3ZT1A 3T7ZA 1WLJA 3A5NC 3SUOA 1RBVA 3NVMA 3M8QA 4C1NI 3A8YA 2YNGA 4DFJA 4DU1A 2QA4N 3VA3A 2WONA 1QHTA 5LJVA 4K41A 1T05A 3IMXA 5GINA 5AQRA 4E1MA 5M1NA 4B1YB 5BR8K 4IDKA 3MXMA 4UQGA 2EX3A 4QAGA 4FZYA 1GOBA 4RTFD 4FJLA 1NGEA 5C10A 4CHQA 3KLEA 3CMEN 4XH4A 3LM9A 4OJRA 5GADP 4O5FA 4IO8A 1X3NA 1ZBSA 3SNNA 3CCUN 4CEFA 4LF7K 2A1SA 3BF1A 3LZIA 5AQJA 3VTHA 3PX4A 2GX9A 4AF1A 4LFBK 3ZT4A 2HBLA 4JD2A 4DQ8A 3BP8A 1VQ9N 2BANA 3KLGA 4GY2B 3NF7A 3HXMA 3JAMO 4DSKA 1HQUA 4GMJB 4PY5A 2E2QA 2X6NA 3CHWA 4I6MB 4MO5A 4FJGA 5KRSA 2NLXA 3UKRA 1EX4A 3THXB 4CEEA 1C0TA 3A5MC 3MCAB 3QEPA 3P4IA 1BDGA 1BI4B 4WF9L 5KPTA 3G6EN 2E88A 3HO1A 4IXCA 1S1UA 3KLFA 3FLCO 3HI0A 2XY8A 1ITGA 3L4QA 3RSEA 4B9QA 3HOTA 2KW4A 3LDNA 2VGNA 3M8RA 1CZBA 4M45A 3I33A 3PO4A 3CQXA 4CJ3A 3C7NB 4NXNK 4N76A 1G15A 3HK2A 4H5VA 5AQQA 1Q9YA 5BRHA 2WBNA 4HCCA 1G99A 1TL3A 3HPHA 4A59A 4KPYA 1NJXA 4KH5A 3L0QA 4FWMA 3TTFA 4FWLA 4KBOA 1HJRA 4MLHA 3VEXA 3G10A 4ILJA 4BWJA 1NG9A 4M3WA 3U8XA 5KPZA 3CQ8A 4Z4EA 2KHOA 5BPLA 1UAXA 2HHHK 1MWKA 1RT5A 2UXCK 4NLCA 5AQWA 1BIUA 4ICLA 4DV2K 4DF8A 1LW2A 4B1XB 4JEPA 4CFAA 4AHSA 2XY6A 3C94A 4FXDA 4CJ5A 3QFUA 1QVFM 4DQIA 1TK5A 4M7YA 3K2PA 5AZIB 1BIZA 4GVMA 3I0SA 5IT9O 4DSFA 1S9EA 4MO4A 2HW3A 4XH1A 3WXLA 4B9MA 1WN7A 5LY3A 2PAVA 1SZ2A 4JRPA 3P39A 1MWMA 1TVRA 1RDUA 4DSIA 2IDOA 1NWKA 2E4LA 2QEXN 3NE6A 2I5JA 4CEQA 4M3UA 3TAPA 4BVPA 4CESA 1XC9A 2FF3B 3CJAA 2CGJA 3K9KA 2NRZA 3KD1E 5C15A 2ETJA 4A2BA 3THVA 4CHZA 4I6MA 3HP6A 5EVZA 4DMNA 4FOEA 1X9MA 5E26A 3THXA 5ELZA 5BRFA 1KXPA 5AFUA 1HR0K 1NBWA 1SAZA 1BI4A 5DM7L 5H1SQ 3VQ6A 2P9LB 3J7AP 1JL2A 3TTDA 3VF4A 1Q86O 5KGWA 2OYQA 1MA9B 3W0LA 5BN9A 4CFCA 4BROA 3BY5A 4JI1K 3AY9A 4B8CA 1JCGA 4FWQA 4QCLA 2A1RA 3VEVA 3ZSOA 5AQNA 3O3FA 2UUBK 4CZHA 2ASOA 5M1FA 3TI0A 4M3YA 3W3DA 4FJJA 5LMNK 2H3GX 3MEDA 3SQ0A 5LMUK 1U6ZA 1QVGM 4KKOA 3K5LA 1IBMK 3DRPA 5ADXA 1E3MA 4DR2K 4F4KA 3KK7A 3AVGA 2A6AA 1REVA 5AQSA 4WFAL 5M1PA 3KIOA 3OYLA 4CEBA 4B3RK 1VQPN 2NRXA 3QETA 4KAZA 5AQUA 3CPWM 1BOTO 2FSJA 4FPBA 4YOVA 2P5GA 5HP1A 3DLHA 1S6QA 5B8HA 2BDPA 2ZQBA 2ASMA 2V52B 3BUZB 3VENA 3R6MA 4JHDB 4B8AB 3JSMA 3HRGA 3OS0A 5HLFA 4BR0A 5CY4A 3WEEB 4O55A 4BY9C 5E84A 1WBDA 4LF5K 5AZIA 1CXUA 4H4MA 2E2OA 1NKCA 1X3MA 5KTQA 2E8AA 4AH9A 1L3TA 5CZ2A 3V9WA 3ZSVA 1TL1A 4CZFA 4R5PA 3K59A 1BO5O 3OYBA 1BQNA 1Q18A 3AO3A 3OJSA 3CC7N 1C1CA 3LL3A 4JKHA 4Y1CA 3WXJA 3RR8A 1YTUA 4YNQA 4M3TA 1WSIA 5AJ3K 4CHOA 1V4SA 3V1RA 5T7BA 3HOSA 4CD1A 3VF6A 4KTZA 4DQSA 3HPGA 2O8BB 3O1BA 4IEEA 4EP5A 4E7JA 4LF8K 4OGEA 4CGHA 2QWQA 3O3GA 4CGDA 2DY4A 1HYZA 1KAXA 3SK3A 3CIPA 5KQ8A 4FJXA 3U3YA 2QWNA 1YXQA 4LF4K 5BN8A 4CJLA 4CJRA 2D4WA 1EETA 1RT7A 5MLCQ 1SL2A 3SAGA 4MDAA 3WQTA 3QERA 4AHUA 2P9LA 1O13A 3HM8A 2IIRA 1HPZA 2Z1GA 4DQQA 5EXWA 2XY5A 4KB0A 4KREA 2PYJA 5AQKA 2UXBK 1KAYA 1Q9XA 1XI1A 4IKFA 1A5XA 1FK9A 2W40A 3AVMA 1X1PA 3O8MA 1NK8A 4AM7A 3B6PA 3S3OA 4C1NK 3SMSA 3PX0A 1YI2N 5CR4A 1D4XA 4H0TB 4LY7A 4FLYA 1RTDA 1X9WA 2O4GA 3THWB 4A2AA 4LD0A 3P5JA 4W5NA 3V1QA 2RF2A 3WNGA 3RRHA 4WFBL 2V7ZA 4CIEA 3VA0A 3EZWA 3AO4A 3FFKB 3OYJA 4B3SK 3QMLA 1FKOA 3MX5A 4FM0A 1OH6A 3CCEN 2A5XA 4CIFA 3F9KA 3IG1A 4JHDA 3QBWA 2GWKA 2E2PA 3L2QA 3WEEA 2HF3A 3ZSZA 4FJMA 1WSGA 4BRMA 4CIGA 2D0AA 3T69A 2UYTA 3ZSQA 4JI7K 3FR0A 4CW7B 3I8DA 3OTOK 4NYNA 3I56N 5AQLA 2RHKA 4C8KA 4BG9A 3DRRA 4EZ6A 1KCFA 5BPMA 3H1QA 3KWGA 3VESA 2ASPA 4WQ5A 4A5AA 4FK0A 1KFSA 3OYFA 3MN9A 2A41A 3R8EA 4NCBA 2I7NA 3MECA 4H0VB 3MWTA 5C42A 3G25A 1SL0A 4FM2A 3FGUA 4E7LA 3FZHA 1VQ4N 3GBTA 1VQON 1YJNN 3V9UA 2P9KB 2QXFA 2O8BA 1ZBFA 4A62A 3CCVN 2FC0A 5F0XA 3KD5E 3QIOA 1NJWA 1X9SA 2HBMA 2AJQA 2IOCA 3KLHA 1SKSA 3AVCA 3ZSRA 1NK0A 5J2NA 4CD3A 2ZJPL 2D0CA 3ZLJA 1K6YA 1WAFA 1NMNA 3QICA 3DAWA 3OYNA 2WOMA 2IVNA 3ID8A 1DEJA 1VSFA 1C0FA 3AARA 5EY4A 2D0PA 3CFRA 3KHYA 1HX1A 4YOWA 3SV4A 4BDYA 1RT2A 4E7HA 2HNYA 2P5OA 4DR7K 1BL3A 5HRNA 4DG1A 1YVNA 3PSIA 3SBGA 3NH2A 3U3GA 4B1ZA 1B9FA 2ATQA 4K8ZA 4DQRA 4DLEA 1N5YA 1S1TA 3MEEA 4NYFA 3MCPA 2UXDK 1KC8O 1NJIO 4F3OA 2DTUA 3AA2A 3QO9A 4DTPA 1FKPA 3DLBA 3THWA 1LAWA 5HROA 1TKDA 4DV4K 4IFEA 4CBWA 3N4QA 3AA3A 3DLLL 4Q5VA 3ATUA 3AO2A 3SBTA 3SUNA 3T1HK 1DKGD 3VQQA 3LP1A 4LFAK 1NM1A 4JAXA 2Z1HA 4ILHA 4CBXA 1HPMA 1YT3A 3GL1A 1XNQK 3VETA 1JLAA 2F7TA 3CFOA 4ID5A 4CZLA 2A40A 3NVKA 3FZMA 3CMAN 3NH1A 2KKZA 3CPEA 3AVAA 3FE1A 4HUGA 4L8RB 4WE1A 2JGUA 1VRTA 5J2PA 1N8RO 4DV1K 2GUIA 2P9SB 5C24A 2EWSA 4DKWA 1ASUA 1IKXA 5JMVA 3CF5L 3CJ7A 4JS5A 3AAPA 2XHBA 3ULEB 1NGIA 4DTUA 3HYFA 1ZBUA 3G0ZA 4Z0UA 1EWRA 5AQYA 3O5BA 4CGJA 3M3ZA 2DFFA 3DMJA 2FSKA 3CYMA 2FBXA 2Z1JA 3O9SA 2P9KA 4BR2A 1UWBA 4BR9A 1E4GT 3R3LA 1WSHA 3RMDA 1JL1A 4RG8A 1J53A 4KRFA 1HNIA 4DUZK 1M90O 3SQ2A 2QWPA 3O4QA 1WSJA 1NOZA 2E1YA 5KPRA 4RWTA 4H5WA 3P83D 3CJCA 3WUHA 1ASWA 5SWMA 3EY1A 2HMIA 1B9DA 3TAEA 4BRFA 4LF9K 4JYAK 1LWEA 4FSVA 1QS4A 4BR7A 3LDOA 1W2BM 2OPQA 4AHTA 4DR5K 3O08A 2F96A 2YV0X 1P90A 1N6QA 1N34K 1WUAA 4JK7A 4FM1A 2NZTA 2HB5A 1RDDA 4JKBA 4NCAA 1JJ2M 3M6GA 3C0BA 5D3GA 1RBRA 3RMCA 3SQ4A 1Y97A 4FYDA 1HJOA 2W6LA 1NGDA 4DU3A 4CJ4A 4KI4A 3BZKA 4F3TA 3G4SN 3OA9A 4HTUA 2PY5A 3M5RA 1WAJA 4OVLA 3L3UA 3R9PA 3WQUA 4E3SA 2CGLA 3SLCA 4ILGB 1N36K 4FLXA 4O4GA 3LP2A 1C6VA 3L4IA 4RW8A 3DRSA 2P9PB 4OO1J 1XNRK 2HSTA 3C6UA 4J8FA 2CH6A 3EYZA 4CJKA 2WTUA 1QSLA 1BGXT 2P9SA 3NH0A 3O1WA 1I94K 4DTNA 4I2QA 1JLGA 3ULEA 1NK6A 3VEZA 1GLAG 3TAMA 1DLOA 4Q0BA 5AR0A 5JICA 2O8DB 5IWAK 3TARA 3DLEA 5BR9A 3NGYA 4C8OA 5GIPA 4CJVA 5AQMA 4XEIA 5E41A 2UUCK 3CD6N 1L3VA 4B08A 1RGIA 4B1WB 1OH7A 4IBNA 3UIQA 3HVRA 3DLGA 3NDKA 3GE1A 1F21A 3OYCA 3AGKA 5CYMA 3NF6A 1SKWA 4QS8A 4O0JA 3DLKA 4BRKA 4IG3A 1JXEA 2YJEA 4H0XB 3QEWA 4DSJA 4CZIA 4DR3K 4MFBA 4WCEL 4CVNE 4YOXA 1QQNA 3OYIA 4BG8A 4B3MK 5C2DA 1S3XA 4HVJA 4FJ5A 2HHSA 4Y1DA 2YKMA 2QK9A 4C8NA 1C1BA 3L2UA 1NKBA 1TGOA 4DB3A 4CEZA 2VCPA 5AQGA 3P31A 3PX6A 4O8UA 1VSJA 2Q31A 3CERA 3C6TA 2HVHA 1U2VA 2D0BA 4ID1A 1V4TA 4WQ5C 4FJHA 5AQXA 4JKGB 4FJKA 4JK9A 2KFNA 3LDPA 4BRLA 3LZJA 4GV3A 4WFNL 1KLNA 1JLBA 4FJ7A 1UA0A 1WB9A 4CJSA 2F9WA 4FWOA 4BRGA 2Z1IA 4FVMA 3K5OA 2EHGA 4EAHD 5C25A 4AHCA 1NLVA 3VQDA 1NKEA 2F8SA 4EP4A 2P9PA 4B9NA 3VQ5A 3V1OA 3PO5A 1I39A 1JLEA 1IJJA 3EE9A 2ZD1A 1RTJA 5AQIA 4YOYA 3KTQA 2Y1IA 2HBKA 3QEIA 1TUUA 1J6ZA 1KVAA 3BGRA 3C6HA 1VSHA 1YHQN 1GOAA 2O8DA 3DI6A 1GLFO 5AZJB 1K73O 3K0SA 4I7FA 5K14A 2YHBA 3DOKA 3O4NA 4FK4A 3FFIA 1TK0A 3AVNA 4CJEA 1Z25A 1JLFA 4W5QA 4K0KK 3MN6A 3AV9A 3TAQA 2OPSA 4OPJA 2QWRA 4I9QA 1BQMA 4AHRA 4J2BA 4FLTA 1JLCA 4H5TA 4LFCK 3PLAA 4L3QA 4CJPA 3VQEA 3PIOL 4CEDA 4BGBA 5F1XA 1MDUB 3T1YK 1CZAN 3RRGA 3KJVA 4ELUA 3MXIA 4GVEA 4DTOA 3OHRA 4JKDA 5C2FA 3SI6A 4JI2K 1Q8IA 3GOIA 1KLMA 4FWKA 3WXMB 1QQMA 3D2EB 5JLHA 4ZHRA 3DXKB 4KHWA 4Z4IA 3MMVA 5HL7L 1KAZA 2NRRA 3Q7CA 3SMPA 2BUPA 4YOUA 3TPQA 4M63C 3NF9A 1YJ9N 2I7PA 1YTAA 3H1VX 1DGKN 4JKGA 5FROA 1J5OA 2NUBA 1KFDA 4PHTX 1FXXA 1NK9A 2QKBA 4DR1K 1RCHA 3AVKA 2P9UB 3OYHA 1DTQA 3M8PA 1OH5A 2OZSA 3A5OC 2D0OA 4DV5K 3AVIA 3S9HA 3LPUA 4E7IA 5FPEA 4DTMA 1K8AO 3HJFA 3ZX3A 4KTWA 3DWLA 2O8CB 5CYQA 2ZJRL 3HTVA 4LSNA 1VQ5N 1W97L 1P8ZA 2A3ZA 1BA1A 1LV5A 3LAMA 1RDCA 2E2NA 3SUPA 5HBMA 4NCGA 1ATSA 1HNWK 3HT3A 2J4RA 2D5RA 2YHXA 4A61A 4DV0K 1NU0A 3NFAA 1TV6A 4K8XA 4CFBA 3E9OA 1K8KB 2YKNA 1S22A 4IOCL 1Z6RA 1Q81O 4FJ9A 5A2QO 1S1XA 2BTFA 3P1GA 3VGMA 1VQ6N 1B92A 3K58A 5AZJA 2OTLN 4CECA 3MDQA 2HNDA 3NHGA 3CJ1A 5M1KA 3ENBA 4B1UB 3OYDA 1HYVA 3KLIA 2GTDA 3MN7A 1T44A 3E01A 1WOQA 4C23A 3O4WA 4E89A 1QQOA 3BZCA 2QWOA 1M1KO 2ITMA 4B9TA 1NK7A 5EX5A
chains in the Genus database with same CATH topology
4GMJB 4PUOA 3L2VA 4PY5A 2Z1HA 1YT3A 2X6NA 1ZYQA 2XY7A 1JLAA 3CFOA 4ID5A 5KRSA 4FJGA 2HHUA 1TAUA 1EX4A 4CEEA 4B9LA 1C0TA 2FBYA 3NH1A 3QEPA 4DS5A 4W5OA 4O44A 1BI4B 3WNEA 3AA4A 3AVAA 4HUGA 1U45A 3HO1A 4L8RB 2YNIA 4WE1A 1QE1A 4LH5A 2JGUA 2X6SA 1VRTA 3TWHA 5J2PA 1S1UA 3KLFA 3ZCMA 2PZSA 2P51A 2GUIA 1W9HA 5C24A 4KI6A 4DQPA 1ZBHA 2XY8A 1ITGA 2IS3A 3QEXA 4DTRA 3AA5X 1ASUA 1IKXA 3SCXA 3QEVA 4Z4FA 4N5SA 4LSLA 4FLWA 3ASMA 2B6AA 4JS5A 2XHBA 4CJTA 4DF4A 2KW4A 4BDPA 4BE1A 3ALYA 3M8RA 1CZBA 1KVCA 3ZT0A 3HYFA 1ZBUA 4M45A 3G0ZA 4CEOA 4DTUA 3L3VA 4Z0UA 4E19A 3PO4A 4GW6A 4CGJA 1J54A 2DFFA 4CJ3A 3DMJA 4N76A 1G15A 5HRPA 3OYMA 3HK2A 1Q9YA 3BDPA 4HCCA 4O5BA 4CE9A 1TL3A 3CYMA 2FBXA 2JLEA 2Z1JA 3HPHA 3OJUA 4JS4A 2VG5A 4KPYA 1NJXA 3EZ5A 1UWBA 4DSEA 1TAQA 1JLQA 1WSHA 3KK3A 3RMDA 1JL1A 1J9AA 4RG8A 1HJRA 1XWLA 1J53A 4CF8A 3K5MA 3TAGA 3G10A 4FLVA 1T03A 1XHZA 4KRFA 1HNIA 4BWJA 2VWJA 4M3WA 1S1VA 3SQ2A 3CQ8A 3O4QA 4Z4EA 1WSJA 1UAXA 1RT6A 1HRHA 1NOZA 1RT4A 4CK3A 3MAQA 1VSEA 3P83D 1RT5A 1VSLA 1BIUA 2G8UA 1ASWA 4ICLA 5SWMA 3OYKA 1B9DA 3EY1A 3TAEA 2HMIA 1HNVA 1LWEA 1BISA 2X74A 1QS4A 1LW2A 4DF8A 4CFAA 2KFZA 4AHSA 2XY6A 3C94A 4FXDA 2OPQA 3OYGA 4AHTA 4CJ5A 4N41A 3CM5A 4IFYA 2F96A 3KK2A 5DK5A 4DQIA 4RW7A 2YV0X 1TK5A 4B9SA 1I3AA 4DTJA 1N6QA 3ZT3A 4FM1A 2LSNA 4N56A 1TKXA 3K2PA 3QNOA 2HB5A 4OLBA 1RDDA 1BIZA 4GVMA 3LDSA 3VQPA 4CF9A 3I0SA 3TABA 3RMAA 1NK4A 2OA8A 4NCAA 3D0PA 1UA1A 3ZT2A 5D3GA 1RBRA 4N47A 4CFDA 3RMCA 4DSFA 3SQ4A 5HRSA 1Y97A 4FYDA 1C0MA 1S9EA 2HW3A 5J1EA 1SKRA 1XHXA 2OPRA 2PYLA 3S3MA 4DU3A 4CJ4A 4I2PA 4KI4A 3NCIA 3KKRA 3AVFA 1WN7A 3SV3A 4B9MA 1RDAA 3H08A 4JRPA 4F3TA 1MU2A 1WSEA 5FDLA 3T3FA 2PY5A 4HTUA 1TVRA 3ISNC 1WAJA 4OGCA 4DSIA 1NJZA 2IDOA 4OVLA 4HUFA 4ZTJA 2E4LA 3L3UA 3QINA 3NE6A 1NOYA 2I5JA 3WNHA 4CEQA 4JRQA 3AVHA 4M3UA 4M3RA 4E3SA 3TAPA 1EXQA 4CESA 1XC9A 3RMBA 1DTTA 3QLHA 4KHQA 4FLXA 2QKKA 4O4GA 4HUEA 3LP2A 3KD1E 3VQAA 2OZMA 4ELTA 2ETJA 2HHWA 1C6VA 3THVA 4CHZA 4RW8A 3DRSA 3HP6A 4CERA 4QOZB 4DMNA 1X9MA 3DOLA 1JXBA 2DFEA 3C6UA 3NGIA 4FJ8A 3CFPA 4DWIA 4KHSA 1BI4A 3VQ6A 1O1WA 1VK0A 4CF1A 3EYZA 3VQ7A 5EU7A 4CJKA 1VSDA 3ZSXA 2Y1JA 4OKEA 4BDZA 1ASVA 3V9ZA 3SPZA 1JL2A 1QSLA 2HVIA 1BGXT 1RBTA 5KGWA 2OYQA 1ZBIA 2YHAA 3PV8A 4XIUA 4CFCA 3NH0A 2HHQA 2DFHA 1D8YA 1C0UA 4CGGA 4B8CA 4CHPA 3NGZA 4DTNA 4I2QA 3V81A 5I3UA 4QCLA 4FCYA 4IFVA 2A1RA 1JLGA 4FZZA 1NK6A 1U4BA 3OS1A 3AO5A 3CM6A 3ZSOA 3VQCA 3DM2A 5CZ1A 3TAMA 3KKSA 3O3FA 4B3OA 3NAEA 1DLOA 3LP3A 3PY8A 4Q0BA 3DYAA 3TI0A 2RPIA 4M3YA 3ITHA 1WNSA 3TARA 4FJJA 2G8FA 3MEDA 3DLEA 4KB1A 4BE2A 3ULDA 3NGYA 1RTIA 4C8OA 4FJNA 3SQ0A 2F8TA 4FJIA 4CJVA 4KKOA 3VQ4A 3K5LA 1QSSA 3DRPA 5E41A 3HL8A 2B4JA 3RWUA 1LAVA 1L3VA 2G8HA 3AVJA 4B08A 4H8KA 4F4KA 4OKKA 3AVGA 3HP9A 4IBNA 3L2WA 1IKYA 1REVA 3UIQA 3HVRA 3DLGA 3NDKA 3KIOA 3OYLA 2RN2A 4CEBA 4ZTFA 1F21A 4CK2A 3QETA 3CG7A 1VSMA 4FLZA 4KAZA 3OYCA 2G8IA 5CYMA 3MEGA 3NF6A 2GV9A 1SKWA 4CJUA 4O0JA 5FRMA 3DLKA 3HM9A 2P5GA 5HP1A 3DLHA 4BE0A 1S6QA 1IKVA 2BDPA 2ZQBA 4CK1A 4IG3A 4DU4A 4J2EA 1VRUA 1JXEA 3QEWA 1TK8A 1T7PA 4DSJA 4M3ZA 4MFBA 5JS2A 4FLUA 2VG6A 3B6OA 4B8AB 3JSMA 3OS0A 5HLFA 4BWMA 4DFPA 4KHYA 5CY4A 3OYIA 4HHTA 1D9DA 4O55A 1RBUA 1LWCA 3K57A 4DSLA 4HVJA 3HSTB 4FJ5A 3TAFA 1SUQA 1IG9A 2HHSA 4Y1DA 2YKMA 4CHNA 4B9UA 2QK9A 4C8NA 1RTHA 1CXUA 1C1BA 2P1JA 3L2UA 1BCOA 4H4MA 1TGOA 1U48A 1NKBA 1NKCA 4CEZA 1CZ9A 4AH9A 5KTQA 2X78A 1L3TA 1U49A 1IO2A 5CZ2A 3V9WA 4B9VA 3ZSVA 1TL1A 4R5PA 3K59A 1W0HA 3OYBA 2VG7A 1BQNA 3AO3A 3OJSA 3PX6A 3LANA 1VSJA 4DFKA 1C1CA 3C6TA 2HVHA 2D0BA 4Y1CA 5I42A 4IG0A 1TKTA 4ID1A 3VQBA 4FJHA 3RR8A 4KV8A 4CJFA 2R7YA 1YTUA 1RT3A 4YNQA 4FJKA 4M41A 4M3TA 1L3UA 1WSIA 1BHLA 4CJQA 4CHOA 3V1RA 5T7BA 3OS2A 4O0IA 3OY9A 2KFNA 2KQ2A 1ZBLA 4KTZA 4DQSA 4CGIA 3LZJA 4DFMA 3HPGA 4Z4HA 1KLNA 1JLBA 2FBTA 1R0AA 4FJ7A 1YVUA 4LH4A 1UA0A 4CJSA 4EP5A 4E7JA 4OGEA 4CGHA 2Z1IA 3OVNA 4CGDA 3O3GA 4FVMA 3NF8A 4J2DA 4M42A 3K5OA 2DY4A 1HYZA 2EHGA 1NK5A 5C25A 1RT1A 1S6PA 2RKIA 4AHCA 4E1NA 1T8EA 1WSFA 3VQDA 1NKEA 4FJXA 1Z26A 2F8SA 4EP4A 3U3YA 4B9NA 4CJLA 1A5WA 4CJRA 1QSYA 1EETA 3V1OA 1RT7A 3VQ5A 3PO5A 4KHNA 2IAJA 3MXJA 1I39A 4E0DA 1JLEA 1SL2A 4EZ9A 3QERA 2ITGA 4AHUA 4F8RA 3ZSYA 3ZSWA 4KHUA 2ZD1A 1RTJA 3C95A 1HPZA 2Q3SA 2XRIA 1RNHA 4W5TA 2Z1GA 4F2SA 2IC3A 1SV5A 2W42A 4DQQA 2XY5A 3KTQA 2Y1IA 4KB0A 4KREA 2PYJA 3QEIA 4TSXA 4CJWA 1Q9XA 3SPYA 1XI1A 1LW0A 3S3NA 4AHVA 4IKFA 1CLQA 3S3OA 1A5XA 1HQEA 1FK9A 4CF2A 1HYSA 1KVAA 4RW4A 4BACA 2YNFA 3BGRA 3NBPA 2HHVA 1LWFA 3AVMA 1VSHA 1X1PA 1GOAA 1KSPA 1IKWA 2ZE2A 1C1AA 1U04A 3DI6A 3SJJA 1NK8A 3LWLA 1KTQA 4I7FA 3SZ2A 3U6FA 3B6PA 1KRPA 3HVTA 5K14A 2YHBA 3DOKA 3F73A 1BCMA 1UOCA 3O4NA 1CXQA 3PX0A 2G8WA 4J2AA 4FK4A 4LY7A 3FFIA 3LP0A 4RW9A 4FLYA 1A5VA 1RTDA 4G1QA 2O4GA 1X9WA 1TK0A 3AVNA 4LD0A 1S1WA 4CJEA 3P5JA 1Z25A 1JLFA 3T19A 4W5QA 5J2MA 3V1QA 4W5NA 2RF2A 4Z4GA 4CCHA 3WNGA 3RRHA 1HMVA 3T1AA 5KRTA 3AV9A 4CIEA 3TAQA 3A2FA 3VA0A 2OPSA 5KI6A 4OPJA 4DLGA 5J2QA 3QESA 3AO4A 3OYJA 3AO1A 4M3XA 4Z4CA 4HCBA 4I9QA 1BQMA 1FKOA 4FM0A 4PQUA 3WNFA 4AHRA 4J2BA 4FLTA 1JLCA 1RDBA 2G8KA 2O4IA 3VQ8A 4CIFA 4PA1A 2VWKA 4CJPA 5SZTA 3F9KA 3VQEA 1EP4A 4MQ3A 3IG1A 4CEDA 4DTSA 3QNNA 4C8MA 1EKEA 4FW2A 4FW1A 4CGFA 3SUQA 1D9FA 3RRGA 3L2QA 3ZSZA 4FJMA 2GBZA 2HHTA 3KJVA 4ELUA 3V9XA 1L5UA 1WSGA 3MXIA 4FZXC 3D45A 4CIGA 2D0AA 1TKZA 4DTOA 3AVLA 4E7KA 3ZSQA 5DMRA 1VSIA 3V6DA 3I8DA 3SI6A 4FK2A 4NYNA 1Q8IA 1KLMA 4DS4A 4C8KA 4DTXA 3JYTA 3SYZA 3DRRA 4EZ6A 1JKHA 1KCFA 4JLHA 4KFBA 4RW6A 5FRNA 3TANA 4ZHRA 2HNZA 4KHWA 4Z4IA 3L2RA 3PUFA 4CEAA 4CHYA 3KK1A 4FK0A 1KFSA 3OYFA 3NF9A 2G8VA 4NCBA 3MECA 5C42A 1YTAA 1KVBA 3RR7A 5FROA 1J5OA 3OYEA 3VQ9A 1SL0A 2NUBA 1KFDA 4FM2A 5JS1A 1D5AA 4E7LA 1FXXA 2OPPA 4PWDA 4OPKA 1RILA 3LAKA 3K5NA 1NK9A 2QKBA 2IGIA 1SL1A 3HPOA 3LWMA 3V9UA 2QXFA 2BGGA 1RCHA 3AVKA 3M8SA 3OYHA 1ZBFA 1VSKA 4OKJA 1DTQA 1GOCA 3LALA 3M8PA 5KGXA 2OZSA 2FC0A 2KZZA 3KD5E 3AVIA 3QIOA 3S9HA 3LPUA 3SQ1A 1NJWA 1X9SA 4E7IA 4I9LA 4DTMA 1S5JA 3HJFA 2IOCA 3KLHA 2AJQA 1SKSA 4KTWA 2E6MA 3AVCA 2HHXA 5CYQA 3ZSRA 4AILC 3ZT1A 1NK0A 5J2NA 4LSNA 1WLJA 2D0CA 3SUOA 1RBVA 3M8QA 1NJYA 1K6YA 3IS9A 1WAFA 4YFUA 4KO0A 2FBVA 2YNGA 4CF0A 3OYNA 2WOMA 3LAMA 4DU1A 4DFJA 1LV5A 1RDCA 3SUPA 5HBMA 1VSFA 4NCGA 4KTQA 3VA3A 4C8LA 2WONA 3QIPA 1QHTA 3HT3A 2D5RA 2KZMA 2B5JA 4H4OA 1T05A 3CFRA 3I0RA 4E1MA 3SV4A 2E6LA 3NFAA 1TV6A 5HRRA 1RT2A 3OYAA 1IH7A 4BDYA 4CFBA 4E7HA 2HNYA 2P5OA 4K8XA 1BL3A 5HRNA 4IDKA 4DG1A 2YKNA 4UQGA 3RTVA 3MXMA 2EX3A 3NH2A 3U3GA 4FJ9A 4QAGA 4FZYA 1GOBA 1B9FA 1S1XA 2ATQA 4FJLA 4K8ZA 4DQRA 4F2RA 4CHQA 4DLEA 1N5YA 1S1TA 1RBSA 3MEEA 3KLEA 1QTMA 3P1GA 4DSKA 2YNHA 1B92A 4NYFA 4OJRA 3K58A 4F3OA 3L8BA 2DTUA 3AA2A 4CECA 3SNNA 2HNDA 3NHGA 4ELVA 4OLAA 3QO9A 4CEFA 2A1SA 3LZIA 3OYDA 3DLRA 4DTPA 1FKPA 3DLBA 1LAWA 5HROA 3PX4A 3VN5A 1HYVA 1TKDA 3IRXA 4W5RA 3KLIA 3LPTA 1L3SA 3ZT4A 3O3HA 3V4IA 3AA3A 3E01A 4Q5VA 1U47A 2XO7A 2KTQA 3AO2A 3IAYA 3AVBA 3SUNA 3V9SA 1QQCA 2BANA 3TR8A 3KLGA 1S9GA 4E89A 3VQQA 3NF7A 2BE2A 3HXMA 3LP1A 4B9TA 1NK7A 1HQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMJ B;  4PUO A;  3L2V A;  4PY5 A;  2Z1H A;  1YT3 A;  2X6N A;  1ZYQ A;  2XY7 A;  1JLA A;  3CFO A;  4ID5 A;  5KRS A;  4FJG A;  2HHU A;  1TAU A;  1EX4 A;  4CEE A;  4B9L A;  1C0T A;  2FBY A;  3NH1 A;  3QEP A;  4DS5 A;  4W5O A;  4O44 A;  1BI4 B;  3WNE A;  3AA4 A;  3AVA A;  4HUG A;  1U45 A;  3HO1 A;  4L8R B;  2YNI A;  4WE1 A;  1QE1 A;  4LH5 A;  2JGU A;  2X6S A;  1VRT A;  3TWH A;  5J2P A;  1S1U A;  3KLF A;  3ZCM A;  2PZS A;  2P51 A;  2GUI A;  1W9H A;  5C24 A;  4KI6 A;  4DQP A;  1ZBH A;  2XY8 A;  1ITG A;  2IS3 A;  3QEX A;  4DTR A;  3AA5 X;  1ASU A;  1IKX A;  3SCX A;  3QEV A;  4Z4F A;  4N5S A;  4LSL A;  4FLW A;  3ASM A;  2B6A A;  4JS5 A;  2XHB A;  4CJT A;  4DF4 A;  2KW4 A;  4BDP A;  4BE1 A;  3ALY A;  3M8R A;  1CZB A;  1KVC A;  3ZT0 A;  3HYF A;  1ZBU A;  4M45 A;  3G0Z A;  4CEO A;  4DTU A;  3L3V A;  4Z0U A;  4E19 A;  3PO4 A;  4GW6 A;  4CGJ A;  1J54 A;  2DFF A;  4CJ3 A;  3DMJ A;  4N76 A;  1G15 A;  5HRP A;  3OYM A;  3HK2 A;  1Q9Y A;  3BDP A;  4HCC A;  4O5B A;  4CE9 A;  1TL3 A;  3CYM A;  2FBX A;  2JLE A;  2Z1J A;  3HPH A;  3OJU A;  4JS4 A;  2VG5 A;  4KPY A;  1NJX A;  3EZ5 A;  1UWB A;  4DSE A;  1TAQ A;  1JLQ A;  1WSH A;  3KK3 A;  3RMD A;  1JL1 A;  1J9A A;  4RG8 A;  1HJR A;  1XWL A;  1J53 A;  4CF8 A;  3K5M A;  3TAG A;  3G10 A;  4FLV A;  1T03 A;  1XHZ A;  4KRF A;  1HNI A;  4BWJ A;  2VWJ A;  4M3W A;  1S1V A;  3SQ2 A;  3CQ8 A;  3O4Q A;  4Z4E A;  1WSJ A;  1UAX A;  1RT6 A;  1HRH A;  1NOZ A;  1RT4 A;  4CK3 A;  3MAQ A;  1VSE A;  3P83 D;  1RT5 A;  1VSL A;  1BIU A;  2G8U A;  1ASW A;  4ICL A;  5SWM A;  3OYK A;  1B9D A;  3EY1 A;  3TAE A;  2HMI A;  1HNV A;  1LWE A;  1BIS A;  2X74 A;  1QS4 A;  1LW2 A;  4DF8 A;  4CFA A;  2KFZ A;  4AHS A;  2XY6 A;  3C94 A;  4FXD A;  2OPQ A;  3OYG A;  4AHT A;  4CJ5 A;  4N41 A;  3CM5 A;  4IFY A;  2F96 A;  3KK2 A;  5DK5 A;  4DQI A;  4RW7 A;  2YV0 X;  1TK5 A;  4B9S A;  1I3A A;  4DTJ A;  1N6Q A;  3ZT3 A;  4FM1 A;  2LSN A;  4N56 A;  1TKX A;  3K2P A;  3QNO A;  2HB5 A;  4OLB A;  1RDD A;  1BIZ A;  4GVM A;  3LDS A;  3VQP A;  4CF9 A;  3I0S A;  3TAB A;  3RMA A;  1NK4 A;  2OA8 A;  4NCA A;  3D0P A;  1UA1 A;  3ZT2 A;  5D3G A;  1RBR A;  4N47 A;  4CFD A;  3RMC A;  4DSF A;  3SQ4 A;  5HRS A;  1Y97 A;  4FYD A;  1C0M A;  1S9E A;  2HW3 A;  5J1E A;  1SKR A;  1XHX A;  2OPR A;  2PYL A;  3S3M A;  4DU3 A;  4CJ4 A;  4I2P A;  4KI4 A;  3NCI A;  3KKR A;  3AVF A;  1WN7 A;  3SV3 A;  4B9M A;  1RDA A;  3H08 A;  4JRP A;  4F3T A;  1MU2 A;  1WSE A;  5FDL A;  3T3F A;  2PY5 A;  4HTU A;  1TVR A;  3ISN C;  1WAJ A;  4OGC A;  4DSI A;  1NJZ A;  2IDO A;  4OVL A;  4HUF A;  4ZTJ A;  2E4L A;  3L3U A;  3QIN A;  3NE6 A;  1NOY A;  2I5J A;  3WNH A;  4CEQ A;  4JRQ A;  3AVH A;  4M3U A;  4M3R A;  4E3S A;  3TAP A;  1EXQ A;  4CES A;  1XC9 A;  3RMB A;  1DTT A;  3QLH A;  4KHQ A;  4FLX A;  2QKK A;  4O4G A;  4HUE A;  3LP2 A;  3KD1 E;  3VQA A;  2OZM A;  4ELT A;  2ETJ A;  2HHW A;  1C6V A;  3THV A;  4CHZ A;  4RW8 A;  3DRS A;  3HP6 A;  4CER A;  4QOZ B;  4DMN A;  1X9M A;  3DOL A;  1JXB A;  2DFE A;  3C6U A;  3NGI A;  4FJ8 A;  3CFP A;  4DWI A;  4KHS A;  1BI4 A;  3VQ6 A;  1O1W A;  1VK0 A;  4CF1 A;  3EYZ A;  3VQ7 A;  5EU7 A;  4CJK A;  1VSD A;  3ZSX A;  2Y1J A;  4OKE A;  4BDZ A;  1ASV A;  3V9Z A;  3SPZ A;  1JL2 A;  1QSL A;  2HVI A;  1BGX T;  1RBT A;  5KGW A;  2OYQ A;  1ZBI A;  2YHA A;  3PV8 A;  4XIU A;  4CFC A;  3NH0 A;  2HHQ A;  2DFH A;  1D8Y A;  1C0U A;  4CGG A;  4B8C A;  4CHP A;  3NGZ A;  4DTN A;  4I2Q A;  3V81 A;  5I3U A;  4QCL A;  4FCY A;  4IFV A;  2A1R A;  1JLG A;  4FZZ A;  1NK6 A;  1U4B A;  3OS1 A;  3AO5 A;  3CM6 A;  3ZSO A;  3VQC A;  3DM2 A;  5CZ1 A;  3TAM A;  3KKS A;  3O3F A;  4B3O A;  3NAE A;  1DLO A;  3LP3 A;  3PY8 A;  4Q0B A;  3DYA A;  3TI0 A;  2RPI A;  4M3Y A;  3ITH A;  1WNS A;  3TAR A;  4FJJ A;  2G8F A;  3MED A;  3DLE A;  4KB1 A;  4BE2 A;  3ULD A;  3NGY A;  1RTI A;  4C8O A;  4FJN A;  3SQ0 A;  2F8T A;  4FJI A;  4CJV A;  4KKO A;  3VQ4 A;  3K5L A;  1QSS A;  3DRP A;  5E41 A;  3HL8 A;  2B4J A;  3RWU A;  1LAV A;  1L3V A;  2G8H A;  3AVJ A;  4B08 A;  4H8K A;  4F4K A;  4OKK A;  3AVG A;  3HP9 A;  4IBN A;  3L2W A;  1IKY A;  1REV A;  3UIQ A;  3HVR A;  3DLG A;  3NDK A;  3KIO A;  3OYL A;  2RN2 A;  4CEB A;  4ZTF A;  1F21 A;  4CK2 A;  3QET A;  3CG7 A;  1VSM A;  4FLZ A;  4KAZ A;  3OYC A;  2G8I A;  5CYM A;  3MEG A;  3NF6 A;  2GV9 A;  1SKW A;  4CJU A;  4O0J A;  5FRM A;  3DLK A;  3HM9 A;  2P5G A;  5HP1 A;  3DLH A;  4BE0 A;  1S6Q A;  1IKV A;  2BDP A;  2ZQB A;  4CK1 A;  4IG3 A;  4DU4 A;  4J2E A;  1VRU A;  1JXE A;  3QEW A;  1TK8 A;  1T7P A;  4DSJ A;  4M3Z A;  4MFB A;  5JS2 A;  4FLU A;  2VG6 A;  3B6O A;  4B8A B;  3JSM A;  3OS0 A;  5HLF A;  4BWM A;  4DFP A;  4KHY A;  5CY4 A;  3OYI A;  4HHT A;  1D9D A;  4O55 A;  1RBU A;  1LWC A;  3K57 A;  4DSL A;  4HVJ A;  3HST B;  4FJ5 A;  3TAF A;  1SUQ A;  1IG9 A;  2HHS A;  4Y1D A;  2YKM A;  4CHN A;  4B9U A;  2QK9 A;  4C8N A;  1RTH A;  1CXU A;  1C1B A;  2P1J A;  3L2U A;  1BCO A;  4H4M A;  1TGO A;  1U48 A;  1NKB A;  1NKC A;  4CEZ A;  1CZ9 A;  4AH9 A;  5KTQ A;  2X78 A;  1L3T A;  1U49 A;  1IO2 A;  5CZ2 A;  3V9W A;  4B9V A;  3ZSV A;  1TL1 A;  4R5P A;  3K59 A;  1W0H A;  3OYB A;  2VG7 A;  1BQN A;  3AO3 A;  3OJS A;  3PX6 A;  3LAN A;  1VSJ A;  4DFK A;  1C1C A;  3C6T A;  2HVH A;  2D0B A;  4Y1C A;  5I42 A;  4IG0 A;  1TKT A;  4ID1 A;  3VQB A;  4FJH A;  3RR8 A;  4KV8 A;  4CJF A;  2R7Y A;  1YTU A;  1RT3 A;  4YNQ A;  4FJK A;  4M41 A;  4M3T A;  1L3U A;  1WSI A;  1BHL A;  4CJQ A;  4CHO A;  3V1R A;  5T7B A;  3OS2 A;  4O0I A;  3OY9 A;  2KFN A;  2KQ2 A;  1ZBL A;  4KTZ A;  4DQS A;  4CGI A;  3LZJ A;  4DFM A;  3HPG A;  4Z4H A;  1KLN A;  1JLB A;  2FBT A;  1R0A A;  4FJ7 A;  1YVU A;  4LH4 A;  1UA0 A;  4CJS A;  4EP5 A;  4E7J A;  4OGE A;  4CGH A;  2Z1I A;  3OVN A;  4CGD A;  3O3G A;  4FVM A;  3NF8 A;  4J2D A;  4M42 A;  3K5O A;  2DY4 A;  1HYZ A;  2EHG A;  1NK5 A;  5C25 A;  1RT1 A;  1S6P A;  2RKI A;  4AHC A;  4E1N A;  1T8E A;  1WSF A;  3VQD A;  1NKE A;  4FJX A;  1Z26 A;  2F8S A;  4EP4 A;  3U3Y A;  4B9N A;  4CJL A;  1A5W A;  4CJR A;  1QSY A;  1EET A;  3V1O A;  1RT7 A;  3VQ5 A;  3PO5 A;  4KHN A;  2IAJ A;  3MXJ A;  1I39 A;  4E0D A;  1JLE A;  1SL2 A;  4EZ9 A;  3QER A;  2ITG A;  4AHU A;  4F8R A;  3ZSY A;  3ZSW A;  4KHU A;  2ZD1 A;  1RTJ A;  3C95 A;  1HPZ A;  2Q3S A;  2XRI A;  1RNH A;  4W5T A;  2Z1G A;  4F2S A;  2IC3 A;  1SV5 A;  2W42 A;  4DQQ A;  2XY5 A;  3KTQ A;  2Y1I A;  4KB0 A;  4KRE A;  2PYJ A;  3QEI A;  4TSX A;  4CJW A;  1Q9X A;  3SPY A;  1XI1 A;  1LW0 A;  3S3N A;  4AHV A;  4IKF A;  1CLQ A;  3S3O A;  1A5X A;  1HQE A;  1FK9 A;  4CF2 A;  1HYS A;  1KVA A;  4RW4 A;  4BAC A;  2YNF A;  3BGR A;  3NBP A;  2HHV A;  1LWF A;  3AVM A;  1VSH A;  1X1P A;  1GOA A;  1KSP A;  1IKW A;  2ZE2 A;  1C1A A;  1U04 A;  3DI6 A;  3SJJ A;  1NK8 A;  3LWL A;  1KTQ A;  4I7F A;  3SZ2 A;  3U6F A;  3B6P A;  1KRP A;  3HVT A;  5K14 A;  2YHB A;  3DOK A;  3F73 A;  1BCM A;  1UOC A;  3O4N A;  1CXQ A;  3PX0 A;  2G8W A;  4J2A A;  4FK4 A;  4LY7 A;  3FFI A;  3LP0 A;  4RW9 A;  4FLY A;  1A5V A;  1RTD A;  4G1Q A;  2O4G A;  1X9W A;  1TK0 A;  3AVN A;  4LD0 A;  1S1W A;  4CJE A;  3P5J A;  1Z25 A;  1JLF A;  3T19 A;  4W5Q A;  5J2M A;  3V1Q A;  4W5N A;  2RF2 A;  4Z4G A;  4CCH A;  3WNG A;  3RRH A;  1HMV A;  3T1A A;  5KRT A;  3AV9 A;  4CIE A;  3TAQ A;  3A2F A;  3VA0 A;  2OPS A;  5KI6 A;  4OPJ A;  4DLG A;  5J2Q A;  3QES A;  3AO4 A;  3OYJ A;  3AO1 A;  4M3X A;  4Z4C A;  4HCB A;  4I9Q A;  1BQM A;  1FKO A;  4FM0 A;  4PQU A;  3WNF A;  4AHR A;  4J2B A;  4FLT A;  1JLC A;  1RDB A;  2G8K A;  2O4I A;  3VQ8 A;  4CIF A;  4PA1 A;  2VWK A;  4CJP A;  5SZT A;  3F9K A;  3VQE A;  1EP4 A;  4MQ3 A;  3IG1 A;  4CED A;  4DTS A;  3QNN A;  4C8M A;  1EKE A;  4FW2 A;  4FW1 A;  4CGF A;  3SUQ A;  1D9F A;  3RRG A;  3L2Q A;  3ZSZ A;  4FJM A;  2GBZ A;  2HHT A;  3KJV A;  4ELU A;  3V9X A;  1L5U A;  1WSG A;  3MXI A;  4FZX C;  3D45 A;  4CIG A;  2D0A A;  1TKZ A;  4DTO A;  3AVL A;  4E7K A;  3ZSQ A;  5DMR A;  1VSI A;  3V6D A;  3I8D A;  3SI6 A;  4FK2 A;  4NYN A;  1Q8I A;  1KLM A;  4DS4 A;  4C8K A;  4DTX A;  3JYT A;  3SYZ A;  3DRR A;  4EZ6 A;  1JKH A;  1KCF A;  4JLH A;  4KFB A;  4RW6 A;  5FRN A;  3TAN A;  4ZHR A;  2HNZ A;  4KHW A;  4Z4I A;  3L2R A;  3PUF A;  4CEA A;  4CHY A;  3KK1 A;  4FK0 A;  1KFS A;  3OYF A;  3NF9 A;  2G8V A;  4NCB A;  3MEC A;  5C42 A;  1YTA A;  1KVB A;  3RR7 A;  5FRO A;  1J5O A;  3OYE A;  3VQ9 A;  1SL0 A;  2NUB A;  1KFD A;  4FM2 A;  5JS1 A;  1D5A A;  4E7L A;  1FXX A;  2OPP A;  4PWD A;  4OPK A;  1RIL A;  3LAK A;  3K5N A;  1NK9 A;  2QKB A;  2IGI A;  1SL1 A;  3HPO A;  3LWM A;  3V9U A;  2QXF A;  2BGG A;  1RCH A;  3AVK A;  3M8S A;  3OYH A;  1ZBF A;  1VSK A;  4OKJ A;  1DTQ A;  1GOC A;  3LAL A;  3M8P A;  5KGX A;  2OZS A;  2FC0 A;  2KZZ A;  3KD5 E;  3AVI A;  3QIO A;  3S9H A;  3LPU A;  3SQ1 A;  1NJW A;  1X9S A;  4E7I A;  4I9L A;  4DTM A;  1S5J A;  3HJF A;  2IOC A;  3KLH A;  2AJQ A;  1SKS A;  4KTW A;  2E6M A;  3AVC A;  2HHX A;  5CYQ A;  3ZSR A;  4AIL C;  3ZT1 A;  1NK0 A;  5J2N A;  4LSN A;  1WLJ A;  2D0C A;  3SUO A;  1RBV A;  3M8Q A;  1NJY A;  1K6Y A;  3IS9 A;  1WAF A;  4YFU A;  4KO0 A;  2FBV A;  2YNG A;  4CF0 A;  3OYN A;  2WOM A;  3LAM A;  4DU1 A;  4DFJ A;  1LV5 A;  1RDC A;  3SUP A;  5HBM A;  1VSF A;  4NCG A;  4KTQ A;  3VA3 A;  4C8L A;  2WON A;  3QIP A;  1QHT A;  3HT3 A;  2D5R A;  2KZM A;  2B5J A;  4H4O A;  1T05 A;  3CFR A;  3I0R A;  4E1M A;  3SV4 A;  2E6L A;  3NFA A;  1TV6 A;  5HRR A;  1RT2 A;  3OYA A;  1IH7 A;  4BDY A;  4CFB A;  4E7H A;  2HNY A;  2P5O A;  4K8X A;  1BL3 A;  5HRN A;  4IDK A;  4DG1 A;  2YKN A;  4UQG A;  3RTV A;  3MXM A;  2EX3 A;  3NH2 A;  3U3G A;  4FJ9 A;  4QAG A;  4FZY A;  1GOB A;  1B9F A;  1S1X A;  2ATQ A;  4FJL A;  4K8Z A;  4DQR A;  4F2R A;  4CHQ A;  4DLE A;  1N5Y A;  1S1T A;  1RBS A;  3MEE A;  3KLE A;  1QTM A;  3P1G A;  4DSK A;  2YNH A;  1B92 A;  4NYF A;  4OJR A;  3K58 A;  4F3O A;  3L8B A;  2DTU A;  3AA2 A;  4CEC A;  3SNN A;  2HND A;  3NHG A;  4ELV A;  4OLA A;  3QO9 A;  4CEF A;  2A1S A;  3LZI A;  3OYD A;  3DLR A;  4DTP A;  1FKP A;  3DLB A;  1LAW A;  5HRO A;  3PX4 A;  3VN5 A;  1HYV A;  1TKD A;  3IRX A;  4W5R A;  3KLI A;  3LPT A;  1L3S A;  3ZT4 A;  3O3H A;  3V4I A;  3AA3 A;  3E01 A;  4Q5V A;  1U47 A;  2XO7 A;  2KTQ A;  3AO2 A;  3IAY A;  3AVB A;  3SUN A;  3V9S A;  1QQC A;  2BAN A;  3TR8 A;  3KLG A;  1S9G A;  4E89 A;  3VQQ A;  3NF7 A;  2BE2 A;  3HXM A;  3LP1 A;  4B9T A;  1NK7 A;  1HQU A; 
#chains in the Genus database with same CATH topology
 2E1Z A;  3QDK A;  4PUO A;  2KLA A;  4JI0 K;  3O9R A;  4H0O A;  1XUP O;  4B9L A;  5C0Y A;  4W5O A;  2VWB A;  3WNE A;  3AA4 A;  3QB0 A;  1U45 A;  2YNI A;  1QE1 A;  1NMD A;  3FZL A;  2PZS A;  2P51 A;  2Q36 A;  2IS3 A;  3QEX A;  3D2E A;  3QEV A;  3VF2 A;  4Z4F A;  4LSL A;  4FLW A;  3DXK A;  4BRP A;  4H0Y B;  3IKM A;  4FPA A;  3BEX A;  4BDP A;  1XMQ K;  3ALY A;  1KVC A;  3ZT0 A;  4CEO A;  2ZM6 K;  1Q7Y O;  4BQZ A;  4IO9 L;  4BRN A;  1J54 A;  3VEO A;  3OYM A;  2O8E A;  2OAN A;  3F5T A;  4O5B A;  3HSC A;  2JLE A;  4JS4 A;  2QWL A;  2P9U A;  3EZ5 A;  1NGG A;  4DSE A;  1TAQ A;  1JLQ A;  1SQK A;  3KK3 A;  3F9M A;  1J9A A;  3IUC A;  4MLE A;  2ZJQ L;  4CF8 A;  1NGJ A;  3K5M A;  3TAG A;  4FLV A;  1XHZ A;  2VWJ A;  1GLL O;  1S1V A;  2O8C A;  2NRW A;  3U9D A;  4RCH A;  1RT6 A;  1HRH A;  3MAQ A;  1RT4 A;  4CK3 A;  1HNX K;  1VSL A;  4BC4 A;  4GKJ K;  3B8A X;  2KFZ A;  4DV6 K;  4N41 A;  2JWK A;  3R1X A;  5JLF A;  3KK2 A;  5DK5 A;  4RW7 A;  4B9S A;  5LL6 Z;  1I3A A;  3E9P A;  4DTJ A;  3ZT3 A;  5AQZ A;  1K8K A;  1ESV A;  5HOO A;  4N56 A;  5FPD A;  3H3O B;  3TAB A;  1GLJ O;  2VQF K;  1NK4 A;  3S41 A;  1UA1 A;  3ZT2 A;  4N47 A;  5M1Q A;  3TSQ A;  1C0M A;  5J1E A;  3N4P A;  1XHX A;  1SKR A;  2OPR A;  4I2P A;  5CHI A;  3NCI A;  3SV3 A;  3AVF A;  3H08 A;  1MU2 A;  1C0G A;  3T3F A;  4JKE A;  3ISN C;  4OGC A;  3MWP A;  3D7E O;  3WNH A;  4GNI A;  2PBD A;  3RMB A;  3FZF A;  4HUE A;  4YY3 K;  2QI2 A;  2OZM A;  4ELT A;  2HHW A;  4A5B A;  1BWF O;  4CER A;  4QOZ B;  5CE3 A;  3OW2 M;  3EE8 A;  3NGI A;  3CFP A;  3ENO A;  4KHS A;  1O1W A;  1VK0 A;  3KVG A;  4CF1 A;  3VQ7 A;  1EO1 A;  5EU7 A;  4OKE A;  1ASV A;  3V9Z A;  2ZGZ A;  2HVI A;  1ZBI A;  2YHA A;  4BC3 A;  4XIU A;  1VQ8 N;  3I55 N;  4CZM A;  1D8Y A;  3BF3 A;  5I3U A;  2V51 B;  3ZEU B;  4IFV A;  4QS7 A;  3FZK A;  3DM2 A;  5CZ1 A;  4K25 A;  3QBX A;  3G71 N;  3NAE A;  1JCE A;  4BQL A;  3LP3 A;  3PY8 A;  4ISF A;  1BUP A;  1WNS A;  1SS6 A;  2G8F A;  1RTI A;  1N33 K;  1QSS A;  3RWU A;  2B4J A;  1LAV A;  2AA4 A;  3E9L A;  3IDH A;  4HWI A;  2ZGY A;  4JKC A;  3CQY A;  1NGA A;  4YHH K;  4U67 L;  3HP9 A;  4K42 A;  3L2W A;  1IKY A;  4BRQ A;  4FO0 A;  5M1O A;  2RN2 A;  4ZTF A;  1BA0 A;  5FPM A;  3CG7 A;  1VSM A;  3UE5 A;  4CK2 A;  1OVY A;  3J7Z O;  2G8I A;  2V7Y A;  3WT0 A;  3LM2 A;  1HLU A;  1ZC6 A;  4CZK A;  2HF4 A;  4DU4 A;  4FVU A;  4JI4 K;  3CJ9 A;  2VG6 A;  3B6O A;  4QS9 A;  2QW9 A;  4HHT A;  3DXM B;  1D9D A;  1LWC A;  3K57 A;  1HNZ K;  4DSL A;  2QTD A;  3HST B;  3U9Z A;  3J81 O;  4CHN A;  4B9U A;  3VGK A;  3EEQ A;  1U48 A;  1BCO A;  3J8A A;  1CZ9 A;  4DUY K;  1U49 A;  1IO2 A;  4IDH A;  4B9V A;  2VG7 A;  3O9Q A;  5C12 A;  4DFK A;  3OBY A;  5I42 A;  3UKU A;  3O9T A;  2IVO A;  4JKF A;  3ENH A;  4KV8 A;  4H5R A;  4M41 A;  3ZX0 A;  1L3U A;  1EWQ A;  4CJQ A;  4O0I A;  4BRH A;  1NGB A;  4CGI A;  3CCR N;  4DFM A;  3D6R A;  1ILY A;  3KZB A;  1U2V B;  1YVU A;  4LH4 A;  1KD1 O;  1NNE A;  4M42 A;  4J2D A;  4OX9 K;  1K9M O;  1NK5 A;  1S6P A;  5BRE A;  4E1N A;  1Z26 A;  4H03 B;  5DM6 L;  4KHN A;  2IAJ A;  1IBL K;  1XMO K;  4YDU A;  1VQL N;  4F8R A;  5FPN A;  1FJG K;  3A5L C;  3C95 A;  5KQD A;  1RNH A;  2NRH A;  4W5T A;  4F2S A;  3SAF A;  2IC3 A;  3H45 C;  4TSX A;  4CJW A;  4AM6 A;  3SPY A;  2WUS A;  4KHP K;  3S3N A;  1CLQ A;  3ZEU A;  4CF2 A;  3VTI A;  1HYS A;  4PKG A;  3CCS N;  5AQO A;  3O80 A;  3CI5 A;  1KSP A;  1IKW A;  2ZE2 A;  2VGM A;  3LWL A;  3U6F A;  1KRP A;  3F73 A;  1BCM A;  4J2A A;  5FLX O;  4RW9 A;  4G1Q A;  3GDQ A;  2QM1 A;  1OKJ A;  1R59 O;  3T19 A;  4CCH A;  3HZ6 A;  3EN9 A;  5KRT A;  3A2F A;  3MX2 A;  4X65 K;  5KI6 A;  4DLG A;  5J2Q A;  1ZXO A;  3QES A;  4M3X A;  3AO1 A;  4HCB A;  1Z05 A;  3WNF A;  3ZX2 A;  3J7Y P;  5TKW A;  4PA1 A;  2VWK A;  2VQE K;  4DTS A;  4IZ9 A;  4O8K A;  2O8F B;  3QNN A;  3H6E A;  4C8M A;  3SUQ A;  2P9I B;  1GLD G;  4GKK K;  2HHT A;  2QWM A;  2GBZ A;  3DXM A;  3V9X A;  2GEL A;  3D45 A;  1HKB A;  2F4V K;  4E7K A;  3J80 O;  5DMR A;  2IVP A;  3V6D A;  1TYQ B;  4FK2 A;  4DS4 A;  3SYZ A;  4BC5 A;  4JLH A;  4RW6 A;  1OVQ A;  3THY B;  2RE2 A;  4EHT A;  4CEA A;  3KK1 A;  2Q2R A;  2GEM A;  3O6W A;  4BRC A;  3IFR A;  1FW6 A;  3VQ9 A;  1D5A A;  1T3V A;  4OPK A;  2HBJ A;  1RIL A;  2P9N B;  2IGI A;  4DCH A;  3LWM A;  2BGG A;  3M8S A;  1VSK A;  4OKJ A;  1YJW N;  3LAL A;  5KGX A;  4B1V A;  2KZZ A;  3L6Q A;  3SQ1 A;  4V19 S;  3OBW A;  3H3N O;  3U4L A;  2HHX A;  2JWL A;  4KH6 A;  4A57 A;  4AIL C;  4EIA A;  3ZET B;  2UUA K;  5I9E B;  1NJY A;  3IS9 A;  4YFU A;  4KO0 A;  2FBV A;  4CF0 A;  4FWN A;  4KTQ A;  5TKY A;  4C8L A;  1X9J A;  3QIP A;  2KZM A;  2B5J A;  4H4O A;  3TSU A;  3I0R A;  4BC2 A;  5GAG P;  2E6L A;  5HRR A;  3OYA A;  4PKH A;  1IH7 A;  1ATR A;  4OPA A;  3RTV A;  1QHA A;  1GLE G;  4X62 K;  4JI3 K;  3LDL A;  4F2R A;  3ZYY X;  4WQ4 A;  2OTJ N;  1Y64 A;  2Q0U A;  4IEI A;  1RBS A;  1QTM A;  2YNH A;  3ATV A;  1GLB G;  3K9J A;  3L8B A;  2CH5 A;  4ELV A;  4OLA A;  1IV0 A;  1QZ5 A;  3DLR A;  3MN5 A;  4PL8 A;  5AQF A;  4DR4 K;  3VN5 A;  1L3S A;  3IRX A;  4W5R A;  3LPT A;  1NGH A;  4IJA A;  3O3H A;  3V4I A;  3TSP A;  1YIT N;  3JS6 A;  1U47 A;  2XO7 A;  2KTQ A;  5AQV A;  2A42 A;  3IAY A;  3AVB A;  3V9S A;  1QQC A;  2Q97 A;  1ATN A;  3TR8 A;  1S9G A;  2FF6 A;  2BE2 A;  5AQP A;  3CCJ N;  3L2V A;  1NGF A;  1HUX A;  1ZYQ A;  2XY7 A;  4CBU A;  2HHU A;  3RVC A;  1TAU A;  2CGK A;  2O8F A;  2FBY A;  4DS5 A;  2P9I A;  4O44 A;  5JVG L;  4BR4 A;  1XC3 A;  2ZF5 O;  1W7A A;  4LH5 A;  2X6S A;  3O9U A;  3TWH A;  1TYQ A;  3ZCM A;  4KI6 A;  1W9H A;  4KH4 A;  4DQP A;  1ZBH A;  3TU5 A;  3C7N A;  4DTR A;  3AA5 X;  3UB5 A;  3SCX A;  3THY A;  4N5S A;  3ASM A;  2B6A A;  4CJT A;  4DF4 A;  4BE1 A;  3A0I X;  1N32 K;  4ISG A;  3L3V A;  4E19 A;  4BVO A;  2HMP A;  4GW6 A;  4FOI A;  5HRP A;  1Q82 O;  3BDP A;  4FWP A;  4CE9 A;  2P9N A;  3OJU A;  2VG5 A;  1E4F T;  4U7B A;  4GV6 A;  4LF6 K;  1XWL A;  2O8E B;  2W6K A;  1T03 A;  4UY8 O;  3C6A A;  1TUY A;  1RFQ A;  3ZET A;  4JV5 K;  2QXL A;  1VSE A;  2PFU A;  3CJB A;  2G8U A;  4BRA A;  3OYK A;  1HNV A;  1VQN N;  1BIS A;  2X74 A;  4BGA A;  4NXM K;  3OYG A;  4F9O A;  2FXU A;  2WFB A;  3CM5 A;  4IFY A;  2WC9 A;  4EHU A;  2LSN A;  4H0P A;  5GAH P;  4E1J A;  1TKX A;  3QNO A;  2HOE A;  4ISE A;  4CZJ A;  4OLB A;  3LDS A;  3CET A;  3VQP A;  4CF9 A;  3RMA A;  2OA8 A;  1T6C A;  3D0P A;  1J5E K;  4CFD A;  3E66 A;  2UU9 K;  2VYP A;  5HRS A;  1VAZ A;  2PYL A;  3JXU A;  3S3M A;  5AQT A;  2D1K A;  3KKR A;  4MDB A;  1RDA A;  1WSE A;  5FDL A;  1KQS M;  1NJZ A;  4HUF A;  4ZTJ A;  3QIN A;  1NOY A;  4PKI A;  4JRQ A;  3AVH A;  3KWI A;  4M3R A;  4K43 A;  1EXQ A;  1S72 N;  1DTT A;  3QLH A;  4KHQ A;  2QKK A;  4OPH A;  3VQA A;  3EL2 A;  1YAG A;  4EFH A;  2E5L K;  3AAQ A;  3DOL A;  1JXB A;  2DFE A;  3EKU A;  4FJ8 A;  4PL7 A;  4DWI A;  4FL9 A;  4YDU C;  1JCF A;  1VSD A;  3ZSX A;  4LC9 B;  2YHY A;  3QFP A;  4BDZ A;  3CCQ N;  2Y1J A;  3SPZ A;  3CCL N;  4JI8 K;  2YI1 A;  1RBT A;  2Q0R A;  3PV8 A;  1IBK K;  2HHQ A;  2DFH A;  1C0U A;  4CGG A;  3M1F A;  4CHP A;  3NGZ A;  3V81 A;  4FCY A;  1DT9 A;  4FZZ A;  1U4B A;  3OS1 A;  3AO5 A;  3CM6 A;  3Q7B A;  3VQC A;  3KKS A;  4B3O A;  4YOT A;  3DYA A;  3PIP L;  2RPI A;  3ITH A;  3VPZ A;  3CC4 N;  4IOX A;  4KB1 A;  3P38 A;  4BE2 A;  3ULD A;  4FJN A;  3EO3 A;  4DR6 K;  2F8T A;  5GAE P;  5EOY A;  4FJI A;  2GWJ A;  3VQ4 A;  1YIJ N;  3HL8 A;  4AQY K;  2G8H A;  3AVJ A;  4H8K A;  4JKA A;  5AQH A;  4OKK A;  3PSF A;  2YCH A;  4DV3 K;  4JNE A;  1T6D A;  4FLZ A;  1LOT B;  3MEG A;  3E1Y A;  2GV9 A;  4CJU A;  3D2F B;  5FRM A;  3VMF B;  3HM9 A;  1VQM N;  1LCU A;  4CJ7 A;  4BE0 A;  1IKV A;  4CK1 A;  4J2E A;  1VRU A;  4BRI A;  1TK8 A;  1T7P A;  4H5N A;  4M3Z A;  1WBB A;  5JS2 A;  4FLU A;  2OCE A;  4BWM A;  4DFP A;  4KHY A;  2W41 A;  1RBU A;  4XH5 A;  4X66 K;  3SJH A;  3TAF A;  1SUQ A;  1IG9 A;  3HBT A;  1RTH A;  2P1J A;  3I8B A;  2X78 A;  1BU6 O;  3VER A;  3AGR A;  1XQS C;  1W0H A;  3LAN A;  4DV7 K;  4IG0 A;  1TKT A;  3VQB A;  3WXK A;  4CJF A;  2R7Y A;  1RT3 A;  4JI6 K;  4BRE A;  1BHL A;  2YX6 A;  3OS2 A;  3OY9 A;  2KQ2 A;  1ZBL A;  3CC2 N;  5GIO A;  4Z4H A;  3CXC M;  2FBT A;  3UKU B;  1R0A A;  3MK6 A;  1VQK N;  3OVN A;  3NF8 A;  2FLO A;  1RT1 A;  2RKI A;  1T8E A;  1WSF A;  4IWV A;  1A5W A;  2F9T A;  1QSY A;  2E20 A;  3CCM N;  3DJC A;  3MXJ A;  4E0D A;  4EZ9 A;  2ITG A;  5BPN A;  3ZSY A;  3ZSW A;  4KHU A;  4BRD A;  4CI6 A;  4G9Z A;  4FWR A;  3C65 A;  2XRI A;  2Q3S A;  4IJN A;  2ZWH A;  1SV5 A;  2W42 A;  1RDW X;  3WXI A;  4NLB A;  5JVH L;  1LW0 A;  2GUP A;  4AHV A;  1HQE A;  3VGL A;  4RW4 A;  4BAC A;  2BH1 A;  2YNF A;  4JN4 A;  1QZ6 A;  3NBP A;  2HHV A;  1LWF A;  4WQ4 C;  3EKS A;  5BRD A;  1U04 A;  1C1A A;  3SJJ A;  1KTQ A;  1H1V A;  3SZ2 A;  1YUW A;  3HVT A;  1UOC A;  1CXQ A;  2G8W A;  4JK8 A;  3LP0 A;  3ID6 A;  5LJW A;  1A5V A;  2FSN A;  3VEY A;  2YJF A;  1OH8 A;  1NGC A;  4WYB A;  1S1W A;  4NB4 A;  4HTL A;  4JD2 B;  5J2M A;  3F2K A;  4Z4G A;  4M7X A;  1HMV A;  3T1A A;  3GG4 A;  4Z4C A;  4IOA L;  3D2F A;  2NRV A;  5F2R A;  4PQU A;  2NNW A;  1EQY A;  1RDB A;  2G8K A;  2O4I A;  3VQ8 A;  1IG8 A;  3LDQ A;  2YHW A;  1VHX A;  5SZT A;  1EP4 A;  4MQ3 A;  3UKR B;  1EKE A;  4FW2 A;  4FW1 A;  4CGF A;  1VQ7 N;  1D9F A;  4NO7 A;  2NRT A;  4CZE A;  2Q1N A;  1L5U A;  4FZX C;  1GLC G;  1YF5 L;  1TKZ A;  3AVL A;  4Y0W A;  5AFU H;  4BR5 A;  1VSI A;  3VEW A;  4DTX A;  3JYT A;  5FRN A;  1JKH A;  4KFB A;  2DPN A;  3RSE B;  3TTC A;  4X64 K;  2HNZ A;  3TAN A;  3L2R A;  3PUF A;  3VOV A;  4CHY A;  2G8V A;  4Z94 A;  3SAH A;  4CZG A;  1KVB A;  3RR7 A;  1HKG A;  1HKC A;  4DHY A;  3OYE A;  3H46 O;  5JS1 A;  4YOR A;  4PWD A;  2OPP A;  3LAK A;  3K5N A;  1SL1 A;  3HPO A;  4GV9 A;  2AP1 A;  4FWS A;  1GOC A;  5ADX H;  1BG3 A;  4I9L A;  1S5J A;  3NMU A;  4R79 A;  2E6M A;  4B3T K;  4JI5 K;  3ZT1 A;  3T7Z A;  1WLJ A;  3A5N C;  3SUO A;  1RBV A;  3NVM A;  3M8Q A;  4C1N I;  3A8Y A;  2YNG A;  4DFJ A;  4DU1 A;  2QA4 N;  3VA3 A;  2WON A;  1QHT A;  5LJV A;  4K41 A;  1T05 A;  3IMX A;  5GIN A;  5AQR A;  4E1M A;  5M1N A;  4B1Y B;  5BR8 K;  4IDK A;  3MXM A;  4UQG A;  2EX3 A;  4QAG A;  4FZY A;  1GOB A;  4RTF D;  4FJL A;  1NGE A;  5C10 A;  4CHQ A;  3KLE A;  3CME N;  4XH4 A;  3LM9 A;  4OJR A;  5GAD P;  4O5F A;  4IO8 A;  1X3N A;  1ZBS A;  3SNN A;  3CCU N;  4CEF A;  4LF7 K;  2A1S A;  3BF1 A;  3LZI A;  5AQJ A;  3VTH A;  3PX4 A;  2GX9 A;  4AF1 A;  4LFB K;  3ZT4 A;  2HBL A;  4JD2 A;  4DQ8 A;  3BP8 A;  1VQ9 N;  2BAN A;  3KLG A;  4GY2 B;  3NF7 A;  3HXM A;  3JAM O;  4DSK A;  1HQU A;  4GMJ B;  4PY5 A;  2E2Q A;  2X6N A;  3CHW A;  4I6M B;  4MO5 A;  4FJG A;  5KRS A;  2NLX A;  3UKR A;  1EX4 A;  3THX B;  4CEE A;  1C0T A;  3A5M C;  3MCA B;  3QEP A;  3P4I A;  1BDG A;  1BI4 B;  4WF9 L;  5KPT A;  3G6E N;  2E88 A;  3HO1 A;  4IXC A;  1S1U A;  3KLF A;  3FLC O;  3HI0 A;  2XY8 A;  1ITG A;  3L4Q A;  3RSE A;  4B9Q A;  3HOT A;  2KW4 A;  3LDN A;  2VGN A;  3M8R A;  1CZB A;  4M45 A;  3I33 A;  3PO4 A;  3CQX A;  4CJ3 A;  3C7N B;  4NXN K;  4N76 A;  1G15 A;  3HK2 A;  4H5V A;  5AQQ A;  1Q9Y A;  5BRH A;  2WBN A;  4HCC A;  1G99 A;  1TL3 A;  3HPH A;  4A59 A;  4KPY A;  1NJX A;  4KH5 A;  3L0Q A;  4FWM A;  3TTF A;  4FWL A;  4KBO A;  1HJR A;  4MLH A;  3VEX A;  3G10 A;  4ILJ A;  4BWJ A;  1NG9 A;  4M3W A;  3U8X A;  5KPZ A;  3CQ8 A;  4Z4E A;  2KHO A;  5BPL A;  1UAX A;  2HHH K;  1MWK A;  1RT5 A;  2UXC K;  4NLC A;  5AQW A;  1BIU A;  4ICL A;  4DV2 K;  4DF8 A;  1LW2 A;  4B1X B;  4JEP A;  4CFA A;  4AHS A;  2XY6 A;  3C94 A;  4FXD A;  4CJ5 A;  3QFU A;  1QVF M;  4DQI A;  1TK5 A;  4M7Y A;  3K2P A;  5AZI B;  1BIZ A;  4GVM A;  3I0S A;  5IT9 O;  4DSF A;  1S9E A;  4MO4 A;  2HW3 A;  4XH1 A;  3WXL A;  4B9M A;  1WN7 A;  5LY3 A;  2PAV A;  1SZ2 A;  4JRP A;  3P39 A;  1MWM A;  1TVR A;  1RDU A;  4DSI A;  2IDO A;  1NWK A;  2E4L A;  2QEX N;  3NE6 A;  2I5J A;  4CEQ A;  4M3U A;  3TAP A;  4BVP A;  4CES A;  1XC9 A;  2FF3 B;  3CJA A;  2CGJ A;  3K9K A;  2NRZ A;  3KD1 E;  5C15 A;  2ETJ A;  4A2B A;  3THV A;  4CHZ A;  4I6M A;  3HP6 A;  5EVZ A;  4DMN A;  4FOE A;  1X9M A;  5E26 A;  3THX A;  5ELZ A;  5BRF A;  1KXP A;  5AFU A;  1HR0 K;  1NBW A;  1SAZ A;  1BI4 A;  5DM7 L;  5H1S Q;  3VQ6 A;  2P9L B;  3J7A P;  1JL2 A;  3TTD A;  3VF4 A;  1Q86 O;  5KGW A;  2OYQ A;  1MA9 B;  3W0L A;  5BN9 A;  4CFC A;  4BRO A;  3BY5 A;  4JI1 K;  3AY9 A;  4B8C A;  1JCG A;  4FWQ A;  4QCL A;  2A1R A;  3VEV A;  3ZSO A;  5AQN A;  3O3F A;  2UUB K;  4CZH A;  2ASO A;  5M1F A;  3TI0 A;  4M3Y A;  3W3D A;  4FJJ A;  5LMN K;  2H3G X;  3MED A;  3SQ0 A;  5LMU K;  1U6Z A;  1QVG M;  4KKO A;  3K5L A;  1IBM K;  3DRP A;  5ADX A;  1E3M A;  4DR2 K;  4F4K A;  3KK7 A;  3AVG A;  2A6A A;  1REV A;  5AQS A;  4WFA L;  5M1P A;  3KIO A;  3OYL A;  4CEB A;  4B3R K;  1VQP N;  2NRX A;  3QET A;  4KAZ A;  5AQU A;  3CPW M;  1BOT O;  2FSJ A;  4FPB A;  4YOV A;  2P5G A;  5HP1 A;  3DLH A;  1S6Q A;  5B8H A;  2BDP A;  2ZQB A;  2ASM A;  2V52 B;  3BUZ B;  3VEN A;  3R6M A;  4JHD B;  4B8A B;  3JSM A;  3HRG A;  3OS0 A;  5HLF A;  4BR0 A;  5CY4 A;  3WEE B;  4O55 A;  4BY9 C;  5E84 A;  1WBD A;  4LF5 K;  5AZI A;  1CXU A;  4H4M A;  2E2O A;  1NKC A;  1X3M A;  5KTQ A;  2E8A A;  4AH9 A;  1L3T A;  5CZ2 A;  3V9W A;  3ZSV A;  1TL1 A;  4CZF A;  4R5P A;  3K59 A;  1BO5 O;  3OYB A;  1BQN A;  1Q18 A;  3AO3 A;  3OJS A;  3CC7 N;  1C1C A;  3LL3 A;  4JKH A;  4Y1C A;  3WXJ A;  3RR8 A;  1YTU A;  4YNQ A;  4M3T A;  1WSI A;  5AJ3 K;  4CHO A;  1V4S A;  3V1R A;  5T7B A;  3HOS A;  4CD1 A;  3VF6 A;  4KTZ A;  4DQS A;  3HPG A;  2O8B B;  3O1B A;  4IEE A;  4EP5 A;  4E7J A;  4LF8 K;  4OGE A;  4CGH A;  2QWQ A;  3O3G A;  4CGD A;  2DY4 A;  1HYZ A;  1KAX A;  3SK3 A;  3CIP A;  5KQ8 A;  4FJX A;  3U3Y A;  2QWN A;  1YXQ A;  4LF4 K;  5BN8 A;  4CJL A;  4CJR A;  2D4W A;  1EET A;  1RT7 A;  5MLC Q;  1SL2 A;  3SAG A;  4MDA A;  3WQT A;  3QER A;  4AHU A;  2P9L A;  1O13 A;  3HM8 A;  2IIR A;  1HPZ A;  2Z1G A;  4DQQ A;  5EXW A;  2XY5 A;  4KB0 A;  4KRE A;  2PYJ A;  5AQK A;  2UXB K;  1KAY A;  1Q9X A;  1XI1 A;  4IKF A;  1A5X A;  1FK9 A;  2W40 A;  3AVM A;  1X1P A;  3O8M A;  1NK8 A;  4AM7 A;  3B6P A;  3S3O A;  4C1N K;  3SMS A;  3PX0 A;  1YI2 N;  5CR4 A;  1D4X A;  4H0T B;  4LY7 A;  4FLY A;  1RTD A;  1X9W A;  2O4G A;  3THW B;  4A2A A;  4LD0 A;  3P5J A;  4W5N A;  3V1Q A;  2RF2 A;  3WNG A;  3RRH A;  4WFB L;  2V7Z A;  4CIE A;  3VA0 A;  3EZW A;  3AO4 A;  3FFK B;  3OYJ A;  4B3S K;  3QML A;  1FKO A;  3MX5 A;  4FM0 A;  1OH6 A;  3CCE N;  2A5X A;  4CIF A;  3F9K A;  3IG1 A;  4JHD A;  3QBW A;  2GWK A;  2E2P A;  3L2Q A;  3WEE A;  2HF3 A;  3ZSZ A;  4FJM A;  1WSG A;  4BRM A;  4CIG A;  2D0A A;  3T69 A;  2UYT A;  3ZSQ A;  4JI7 K;  3FR0 A;  4CW7 B;  3I8D A;  3OTO K;  4NYN A;  3I56 N;  5AQL A;  2RHK A;  4C8K A;  4BG9 A;  3DRR A;  4EZ6 A;  1KCF A;  5BPM A;  3H1Q A;  3KWG A;  3VES A;  2ASP A;  4WQ5 A;  4A5A A;  4FK0 A;  1KFS A;  3OYF A;  3MN9 A;  2A41 A;  3R8E A;  4NCB A;  2I7N A;  3MEC A;  4H0V B;  3MWT A;  5C42 A;  3G25 A;  1SL0 A;  4FM2 A;  3FGU A;  4E7L A;  3FZH A;  1VQ4 N;  3GBT A;  1VQO N;  1YJN N;  3V9U A;  2P9K B;  2QXF A;  2O8B A;  1ZBF A;  4A62 A;  3CCV N;  2FC0 A;  5F0X A;  3KD5 E;  3QIO A;  1NJW A;  1X9S A;  2HBM A;  2AJQ A;  2IOC A;  3KLH A;  1SKS A;  3AVC A;  3ZSR A;  1NK0 A;  5J2N A;  4CD3 A;  2ZJP L;  2D0C A;  3ZLJ A;  1K6Y A;  1WAF A;  1NMN A;  3QIC A;  3DAW A;  3OYN A;  2WOM A;  2IVN A;  3ID8 A;  1DEJ A;  1VSF A;  1C0F A;  3AAR A;  5EY4 A;  2D0P A;  3CFR A;  3KHY A;  1HX1 A;  4YOW A;  3SV4 A;  4BDY A;  1RT2 A;  4E7H A;  2HNY A;  2P5O A;  4DR7 K;  1BL3 A;  5HRN A;  4DG1 A;  1YVN A;  3PSI A;  3SBG A;  3NH2 A;  3U3G A;  4B1Z A;  1B9F A;  2ATQ A;  4K8Z A;  4DQR A;  4DLE A;  1N5Y A;  1S1T A;  3MEE A;  4NYF A;  3MCP A;  2UXD K;  1KC8 O;  1NJI O;  4F3O A;  2DTU A;  3AA2 A;  3QO9 A;  4DTP A;  1FKP A;  3DLB A;  3THW A;  1LAW A;  5HRO A;  1TKD A;  4DV4 K;  4IFE A;  4CBW A;  3N4Q A;  3AA3 A;  3DLL L;  4Q5V A;  3ATU A;  3AO2 A;  3SBT A;  3SUN A;  3T1H K;  1DKG D;  3VQQ A;  3LP1 A;  4LFA K;  1NM1 A;  4JAX A;  2Z1H A;  4ILH A;  4CBX A;  1HPM A;  1YT3 A;  3GL1 A;  1XNQ K;  3VET A;  1JLA A;  2F7T A;  3CFO A;  4ID5 A;  4CZL A;  2A40 A;  3NVK A;  3FZM A;  3CMA N;  3NH1 A;  2KKZ A;  3CPE A;  3AVA A;  3FE1 A;  4HUG A;  4L8R B;  4WE1 A;  2JGU A;  1VRT A;  5J2P A;  1N8R O;  4DV1 K;  2GUI A;  2P9S B;  5C24 A;  2EWS A;  4DKW A;  1ASU A;  1IKX A;  5JMV A;  3CF5 L;  3CJ7 A;  4JS5 A;  3AAP A;  2XHB A;  3ULE B;  1NGI A;  4DTU A;  3HYF A;  1ZBU A;  3G0Z A;  4Z0U A;  1EWR A;  5AQY A;  3O5B A;  4CGJ A;  3M3Z A;  2DFF A;  3DMJ A;  2FSK A;  3CYM A;  2FBX A;  2Z1J A;  3O9S A;  2P9K A;  4BR2 A;  1UWB A;  4BR9 A;  1E4G T;  3R3L A;  1WSH A;  3RMD A;  1JL1 A;  4RG8 A;  1J53 A;  4KRF A;  1HNI A;  4DUZ K;  1M90 O;  3SQ2 A;  2QWP A;  3O4Q A;  1WSJ A;  1NOZ A;  2E1Y A;  5KPR A;  4RWT A;  4H5W A;  3P83 D;  3CJC A;  3WUH A;  1ASW A;  5SWM A;  3EY1 A;  2HMI A;  1B9D A;  3TAE A;  4BRF A;  4LF9 K;  4JYA K;  1LWE A;  4FSV A;  1QS4 A;  4BR7 A;  3LDO A;  1W2B M;  2OPQ A;  4AHT A;  4DR5 K;  3O08 A;  2F96 A;  2YV0 X;  1P90 A;  1N6Q A;  1N34 K;  1WUA A;  4JK7 A;  4FM1 A;  2NZT A;  2HB5 A;  1RDD A;  4JKB A;  4NCA A;  1JJ2 M;  3M6G A;  3C0B A;  5D3G A;  1RBR A;  3RMC A;  3SQ4 A;  1Y97 A;  4FYD A;  1HJO A;  2W6L A;  1NGD A;  4DU3 A;  4CJ4 A;  4KI4 A;  3BZK A;  4F3T A;  3G4S N;  3OA9 A;  4HTU A;  2PY5 A;  3M5R A;  1WAJ A;  4OVL A;  3L3U A;  3R9P A;  3WQU A;  4E3S A;  2CGL A;  3SLC A;  4ILG B;  1N36 K;  4FLX A;  4O4G A;  3LP2 A;  1C6V A;  3L4I A;  4RW8 A;  3DRS A;  2P9P B;  4OO1 J;  1XNR K;  2HST A;  3C6U A;  4J8F A;  2CH6 A;  3EYZ A;  4CJK A;  2WTU A;  1QSL A;  1BGX T;  2P9S A;  3NH0 A;  3O1W A;  1I94 K;  4DTN A;  4I2Q A;  1JLG A;  3ULE A;  1NK6 A;  3VEZ A;  1GLA G;  3TAM A;  1DLO A;  4Q0B A;  5AR0 A;  5JIC A;  2O8D B;  5IWA K;  3TAR A;  3DLE A;  5BR9 A;  3NGY A;  4C8O A;  5GIP A;  4CJV A;  5AQM A;  4XEI A;  5E41 A;  2UUC K;  3CD6 N;  1L3V A;  4B08 A;  1RGI A;  4B1W B;  1OH7 A;  4IBN A;  3UIQ A;  3HVR A;  3DLG A;  3NDK A;  3GE1 A;  1F21 A;  3OYC A;  3AGK A;  5CYM A;  3NF6 A;  1SKW A;  4QS8 A;  4O0J A;  3DLK A;  4BRK A;  4IG3 A;  1JXE A;  2YJE A;  4H0X B;  3QEW A;  4DSJ A;  4CZI A;  4DR3 K;  4MFB A;  4WCE L;  4CVN E;  4YOX A;  1QQN A;  3OYI A;  4BG8 A;  4B3M K;  5C2D A;  1S3X A;  4HVJ A;  4FJ5 A;  2HHS A;  4Y1D A;  2YKM A;  2QK9 A;  4C8N A;  1C1B A;  3L2U A;  1NKB A;  1TGO A;  4DB3 A;  4CEZ A;  2VCP A;  5AQG A;  3P31 A;  3PX6 A;  4O8U A;  1VSJ A;  2Q31 A;  3CER A;  3C6T A;  2HVH A;  1U2V A;  2D0B A;  4ID1 A;  1V4T A;  4WQ5 C;  4FJH A;  5AQX A;  4JKG B;  4FJK A;  4JK9 A;  2KFN A;  3LDP A;  4BRL A;  3LZJ A;  4GV3 A;  4WFN L;  1KLN A;  1JLB A;  4FJ7 A;  1UA0 A;  1WB9 A;  4CJS A;  2F9W A;  4FWO A;  4BRG A;  2Z1I A;  4FVM A;  3K5O A;  2EHG A;  4EAH D;  5C25 A;  4AHC A;  1NLV A;  3VQD A;  1NKE A;  2F8S A;  4EP4 A;  2P9P A;  4B9N A;  3VQ5 A;  3V1O A;  3PO5 A;  1I39 A;  1JLE A;  1IJJ A;  3EE9 A;  2ZD1 A;  1RTJ A;  5AQI A;  4YOY A;  3KTQ A;  2Y1I A;  2HBK A;  3QEI A;  1TUU A;  1J6Z A;  1KVA A;  3BGR A;  3C6H A;  1VSH A;  1YHQ N;  1GOA A;  2O8D A;  3DI6 A;  1GLF O;  5AZJ B;  1K73 O;  3K0S A;  4I7F A;  5K14 A;  2YHB A;  3DOK A;  3O4N A;  4FK4 A;  3FFI A;  1TK0 A;  3AVN A;  4CJE A;  1Z25 A;  1JLF A;  4W5Q A;  4K0K K;  3MN6 A;  3AV9 A;  3TAQ A;  2OPS A;  4OPJ A;  2QWR A;  4I9Q A;  1BQM A;  4AHR A;  4J2B A;  4FLT A;  1JLC A;  4H5T A;  4LFC K;  3PLA A;  4L3Q A;  4CJP A;  3VQE A;  3PIO L;  4CED A;  4BGB A;  5F1X A;  1MDU B;  3T1Y K;  1CZA N;  3RRG A;  3KJV A;  4ELU A;  3MXI A;  4GVE A;  4DTO A;  3OHR A;  4JKD A;  5C2F A;  3SI6 A;  4JI2 K;  1Q8I A;  3GOI A;  1KLM A;  4FWK A;  3WXM B;  1QQM A;  3D2E B;  5JLH A;  4ZHR A;  3DXK B;  4KHW A;  4Z4I A;  3MMV A;  5HL7 L;  1KAZ A;  2NRR A;  3Q7C A;  3SMP A;  2BUP A;  4YOU A;  3TPQ A;  4M63 C;  3NF9 A;  1YJ9 N;  2I7P A;  1YTA A;  3H1V X;  1DGK N;  4JKG A;  5FRO A;  1J5O A;  2NUB A;  1KFD A;  4PHT X;  1FXX A;  1NK9 A;  2QKB A;  4DR1 K;  1RCH A;  3AVK A;  2P9U B;  3OYH A;  1DTQ A;  3M8P A;  1OH5 A;  2OZS A;  3A5O C;  2D0O A;  4DV5 K;  3AVI A;  3S9H A;  3LPU A;  4E7I A;  5FPE A;  4DTM A;  1K8A O;  3HJF A;  3ZX3 A;  4KTW A;  3DWL A;  2O8C B;  5CYQ A;  2ZJR L;  3HTV A;  4LSN A;  1VQ5 N;  1W97 L;  1P8Z A;  2A3Z A;  1BA1 A;  1LV5 A;  3LAM A;  1RDC A;  2E2N A;  3SUP A;  5HBM A;  4NCG A;  1ATS A;  1HNW K;  3HT3 A;  2J4R A;  2D5R A;  2YHX A;  4A61 A;  4DV0 K;  1NU0 A;  3NFA A;  1TV6 A;  4K8X A;  4CFB A;  3E9O A;  1K8K B;  2YKN A;  1S22 A;  4IOC L;  1Z6R A;  1Q81 O;  4FJ9 A;  5A2Q O;  1S1X A;  2BTF A;  3P1G A;  3VGM A;  1VQ6 N;  1B92 A;  3K58 A;  5AZJ A;  2OTL N;  4CEC A;  3MDQ A;  2HND A;  3NHG A;  3CJ1 A;  5M1K A;  3ENB A;  4B1U B;  3OYD A;  1HYV A;  3KLI A;  2GTD A;  3MN7 A;  1T44 A;  3E01 A;  1WOQ A;  4C23 A;  3O4W A;  4E89 A;  1QQO A;  3BZC A;  2QWO A;  1M1K O;  2ITM A;  4B9T A;  1NK7 A;  5EX5 A; 
#chains in the Genus database with same CATH homology
 4GMJ B;  4PUO A;  3L2V A;  4PY5 A;  2Z1H A;  1YT3 A;  2X6N A;  1ZYQ A;  2XY7 A;  1JLA A;  3CFO A;  4ID5 A;  5KRS A;  4FJG A;  2HHU A;  1TAU A;  1EX4 A;  4CEE A;  4B9L A;  1C0T A;  2FBY A;  3NH1 A;  3QEP A;  4DS5 A;  4W5O A;  4O44 A;  1BI4 B;  3WNE A;  3AA4 A;  3AVA A;  4HUG A;  1U45 A;  3HO1 A;  4L8R B;  2YNI A;  4WE1 A;  1QE1 A;  4LH5 A;  2JGU A;  2X6S A;  1VRT A;  3TWH A;  5J2P A;  1S1U A;  3KLF A;  3ZCM A;  2PZS A;  2P51 A;  2GUI A;  1W9H A;  5C24 A;  4KI6 A;  4DQP A;  1ZBH A;  2XY8 A;  1ITG A;  2IS3 A;  3QEX A;  4DTR A;  3AA5 X;  1ASU A;  1IKX A;  3SCX A;  3QEV A;  4Z4F A;  4N5S A;  4LSL A;  4FLW A;  3ASM A;  2B6A A;  4JS5 A;  2XHB A;  4CJT A;  4DF4 A;  2KW4 A;  4BDP A;  4BE1 A;  3ALY A;  3M8R A;  1CZB A;  1KVC A;  3ZT0 A;  3HYF A;  1ZBU A;  4M45 A;  3G0Z A;  4CEO A;  4DTU A;  3L3V A;  4Z0U A;  4E19 A;  3PO4 A;  4GW6 A;  4CGJ A;  1J54 A;  2DFF A;  4CJ3 A;  3DMJ A;  4N76 A;  1G15 A;  5HRP A;  3OYM A;  3HK2 A;  1Q9Y A;  3BDP A;  4HCC A;  4O5B A;  4CE9 A;  1TL3 A;  3CYM A;  2FBX A;  2JLE A;  2Z1J A;  3HPH A;  3OJU A;  4JS4 A;  2VG5 A;  4KPY A;  1NJX A;  3EZ5 A;  1UWB A;  4DSE A;  1TAQ A;  1JLQ A;  1WSH A;  3KK3 A;  3RMD A;  1JL1 A;  1J9A A;  4RG8 A;  1HJR A;  1XWL A;  1J53 A;  4CF8 A;  3K5M A;  3TAG A;  3G10 A;  4FLV A;  1T03 A;  1XHZ A;  4KRF A;  1HNI A;  4BWJ A;  2VWJ A;  4M3W A;  1S1V A;  3SQ2 A;  3CQ8 A;  3O4Q A;  4Z4E A;  1WSJ A;  1UAX A;  1RT6 A;  1HRH A;  1NOZ A;  1RT4 A;  4CK3 A;  3MAQ A;  1VSE A;  3P83 D;  1RT5 A;  1VSL A;  1BIU A;  2G8U A;  1ASW A;  4ICL A;  5SWM A;  3OYK A;  1B9D A;  3EY1 A;  3TAE A;  2HMI A;  1HNV A;  1LWE A;  1BIS A;  2X74 A;  1QS4 A;  1LW2 A;  4DF8 A;  4CFA A;  2KFZ A;  4AHS A;  2XY6 A;  3C94 A;  4FXD A;  2OPQ A;  3OYG A;  4AHT A;  4CJ5 A;  4N41 A;  3CM5 A;  4IFY A;  2F96 A;  3KK2 A;  5DK5 A;  4DQI A;  4RW7 A;  2YV0 X;  1TK5 A;  4B9S A;  1I3A A;  4DTJ A;  1N6Q A;  3ZT3 A;  4FM1 A;  2LSN A;  4N56 A;  1TKX A;  3K2P A;  3QNO A;  2HB5 A;  4OLB A;  1RDD A;  1BIZ A;  4GVM A;  3LDS A;  3VQP A;  4CF9 A;  3I0S A;  3TAB A;  3RMA A;  1NK4 A;  2OA8 A;  4NCA A;  3D0P A;  1UA1 A;  3ZT2 A;  5D3G A;  1RBR A;  4N47 A;  4CFD A;  3RMC A;  4DSF A;  3SQ4 A;  5HRS A;  1Y97 A;  4FYD A;  1C0M A;  1S9E A;  2HW3 A;  5J1E A;  1SKR A;  1XHX A;  2OPR A;  2PYL A;  3S3M A;  4DU3 A;  4CJ4 A;  4I2P A;  4KI4 A;  3NCI A;  3KKR A;  3AVF A;  1WN7 A;  3SV3 A;  4B9M A;  1RDA A;  3H08 A;  4JRP A;  4F3T A;  1MU2 A;  1WSE A;  5FDL A;  3T3F A;  2PY5 A;  4HTU A;  1TVR A;  3ISN C;  1WAJ A;  4OGC A;  4DSI A;  1NJZ A;  2IDO A;  4OVL A;  4HUF A;  4ZTJ A;  2E4L A;  3L3U A;  3QIN A;  3NE6 A;  1NOY A;  2I5J A;  3WNH A;  4CEQ A;  4JRQ A;  3AVH A;  4M3U A;  4M3R A;  4E3S A;  3TAP A;  1EXQ A;  4CES A;  1XC9 A;  3RMB A;  1DTT A;  3QLH A;  4KHQ A;  4FLX A;  2QKK A;  4O4G A;  4HUE A;  3LP2 A;  3KD1 E;  3VQA A;  2OZM A;  4ELT A;  2ETJ A;  2HHW A;  1C6V A;  3THV A;  4CHZ A;  4RW8 A;  3DRS A;  3HP6 A;  4CER A;  4QOZ B;  4DMN A;  1X9M A;  3DOL A;  1JXB A;  2DFE A;  3C6U A;  3NGI A;  4FJ8 A;  3CFP A;  4DWI A;  4KHS A;  1BI4 A;  3VQ6 A;  1O1W A;  1VK0 A;  4CF1 A;  3EYZ A;  3VQ7 A;  5EU7 A;  4CJK A;  1VSD A;  3ZSX A;  2Y1J A;  4OKE A;  4BDZ A;  1ASV A;  3V9Z A;  3SPZ A;  1JL2 A;  1QSL A;  2HVI A;  1BGX T;  1RBT A;  5KGW A;  2OYQ A;  1ZBI A;  2YHA A;  3PV8 A;  4XIU A;  4CFC A;  3NH0 A;  2HHQ A;  2DFH A;  1D8Y A;  1C0U A;  4CGG A;  4B8C A;  4CHP A;  3NGZ A;  4DTN A;  4I2Q A;  3V81 A;  5I3U A;  4QCL A;  4FCY A;  4IFV A;  2A1R A;  1JLG A;  4FZZ A;  1NK6 A;  1U4B A;  3OS1 A;  3AO5 A;  3CM6 A;  3ZSO A;  3VQC A;  3DM2 A;  5CZ1 A;  3TAM A;  3KKS A;  3O3F A;  4B3O A;  3NAE A;  1DLO A;  3LP3 A;  3PY8 A;  4Q0B A;  3DYA A;  3TI0 A;  2RPI A;  4M3Y A;  3ITH A;  1WNS A;  3TAR A;  4FJJ A;  2G8F A;  3MED A;  3DLE A;  4KB1 A;  4BE2 A;  3ULD A;  3NGY A;  1RTI A;  4C8O A;  4FJN A;  3SQ0 A;  2F8T A;  4FJI A;  4CJV A;  4KKO A;  3VQ4 A;  3K5L A;  1QSS A;  3DRP A;  5E41 A;  3HL8 A;  2B4J A;  3RWU A;  1LAV A;  1L3V A;  2G8H A;  3AVJ A;  4B08 A;  4H8K A;  4F4K A;  4OKK A;  3AVG A;  3HP9 A;  4IBN A;  3L2W A;  1IKY A;  1REV A;  3UIQ A;  3HVR A;  3DLG A;  3NDK A;  3KIO A;  3OYL A;  2RN2 A;  4CEB A;  4ZTF A;  1F21 A;  4CK2 A;  3QET A;  3CG7 A;  1VSM A;  4FLZ A;  4KAZ A;  3OYC A;  2G8I A;  5CYM A;  3MEG A;  3NF6 A;  2GV9 A;  1SKW A;  4CJU A;  4O0J A;  5FRM A;  3DLK A;  3HM9 A;  2P5G A;  5HP1 A;  3DLH A;  4BE0 A;  1S6Q A;  1IKV A;  2BDP A;  2ZQB A;  4CK1 A;  4IG3 A;  4DU4 A;  4J2E A;  1VRU A;  1JXE A;  3QEW A;  1TK8 A;  1T7P A;  4DSJ A;  4M3Z A;  4MFB A;  5JS2 A;  4FLU A;  2VG6 A;  3B6O A;  4B8A B;  3JSM A;  3OS0 A;  5HLF A;  4BWM A;  4DFP A;  4KHY A;  5CY4 A;  3OYI A;  4HHT A;  1D9D A;  4O55 A;  1RBU A;  1LWC A;  3K57 A;  4DSL A;  4HVJ A;  3HST B;  4FJ5 A;  3TAF A;  1SUQ A;  1IG9 A;  2HHS A;  4Y1D A;  2YKM A;  4CHN A;  4B9U A;  2QK9 A;  4C8N A;  1RTH A;  1CXU A;  1C1B A;  2P1J A;  3L2U A;  1BCO A;  4H4M A;  1TGO A;  1U48 A;  1NKB A;  1NKC A;  4CEZ A;  1CZ9 A;  4AH9 A;  5KTQ A;  2X78 A;  1L3T A;  1U49 A;  1IO2 A;  5CZ2 A;  3V9W A;  4B9V A;  3ZSV A;  1TL1 A;  4R5P A;  3K59 A;  1W0H A;  3OYB A;  2VG7 A;  1BQN A;  3AO3 A;  3OJS A;  3PX6 A;  3LAN A;  1VSJ A;  4DFK A;  1C1C A;  3C6T A;  2HVH A;  2D0B A;  4Y1C A;  5I42 A;  4IG0 A;  1TKT A;  4ID1 A;  3VQB A;  4FJH A;  3RR8 A;  4KV8 A;  4CJF A;  2R7Y A;  1YTU A;  1RT3 A;  4YNQ A;  4FJK A;  4M41 A;  4M3T A;  1L3U A;  1WSI A;  1BHL A;  4CJQ A;  4CHO A;  3V1R A;  5T7B A;  3OS2 A;  4O0I A;  3OY9 A;  2KFN A;  2KQ2 A;  1ZBL A;  4KTZ A;  4DQS A;  4CGI A;  3LZJ A;  4DFM A;  3HPG A;  4Z4H A;  1KLN A;  1JLB A;  2FBT A;  1R0A A;  4FJ7 A;  1YVU A;  4LH4 A;  1UA0 A;  4CJS A;  4EP5 A;  4E7J A;  4OGE A;  4CGH A;  2Z1I A;  3OVN A;  4CGD A;  3O3G A;  4FVM A;  3NF8 A;  4J2D A;  4M42 A;  3K5O A;  2DY4 A;  1HYZ A;  2EHG A;  1NK5 A;  5C25 A;  1RT1 A;  1S6P A;  2RKI A;  4AHC A;  4E1N A;  1T8E A;  1WSF A;  3VQD A;  1NKE A;  4FJX A;  1Z26 A;  2F8S A;  4EP4 A;  3U3Y A;  4B9N A;  4CJL A;  1A5W A;  4CJR A;  1QSY A;  1EET A;  3V1O A;  1RT7 A;  3VQ5 A;  3PO5 A;  4KHN A;  2IAJ A;  3MXJ A;  1I39 A;  4E0D A;  1JLE A;  1SL2 A;  4EZ9 A;  3QER A;  2ITG A;  4AHU A;  4F8R A;  3ZSY A;  3ZSW A;  4KHU A;  2ZD1 A;  1RTJ A;  3C95 A;  1HPZ A;  2Q3S A;  2XRI A;  1RNH A;  4W5T A;  2Z1G A;  4F2S A;  2IC3 A;  1SV5 A;  2W42 A;  4DQQ A;  2XY5 A;  3KTQ A;  2Y1I A;  4KB0 A;  4KRE A;  2PYJ A;  3QEI A;  4TSX A;  4CJW A;  1Q9X A;  3SPY A;  1XI1 A;  1LW0 A;  3S3N A;  4AHV A;  4IKF A;  1CLQ A;  3S3O A;  1A5X A;  1HQE A;  1FK9 A;  4CF2 A;  1HYS A;  1KVA A;  4RW4 A;  4BAC A;  2YNF A;  3BGR A;  3NBP A;  2HHV A;  1LWF A;  3AVM A;  1VSH A;  1X1P A;  1GOA A;  1KSP A;  1IKW A;  2ZE2 A;  1C1A A;  1U04 A;  3DI6 A;  3SJJ A;  1NK8 A;  3LWL A;  1KTQ A;  4I7F A;  3SZ2 A;  3U6F A;  3B6P A;  1KRP A;  3HVT A;  5K14 A;  2YHB A;  3DOK A;  3F73 A;  1BCM A;  1UOC A;  3O4N A;  1CXQ A;  3PX0 A;  2G8W A;  4J2A A;  4FK4 A;  4LY7 A;  3FFI A;  3LP0 A;  4RW9 A;  4FLY A;  1A5V A;  1RTD A;  4G1Q A;  2O4G A;  1X9W A;  1TK0 A;  3AVN A;  4LD0 A;  1S1W A;  4CJE A;  3P5J A;  1Z25 A;  1JLF A;  3T19 A;  4W5Q A;  5J2M A;  3V1Q A;  4W5N A;  2RF2 A;  4Z4G A;  4CCH A;  3WNG A;  3RRH A;  1HMV A;  3T1A A;  5KRT A;  3AV9 A;  4CIE A;  3TAQ A;  3A2F A;  3VA0 A;  2OPS A;  5KI6 A;  4OPJ A;  4DLG A;  5J2Q A;  3QES A;  3AO4 A;  3OYJ A;  3AO1 A;  4M3X A;  4Z4C A;  4HCB A;  4I9Q A;  1BQM A;  1FKO A;  4FM0 A;  4PQU A;  3WNF A;  4AHR A;  4J2B A;  4FLT A;  1JLC A;  1RDB A;  2G8K A;  2O4I A;  3VQ8 A;  4CIF A;  4PA1 A;  2VWK A;  4CJP A;  5SZT A;  3F9K A;  3VQE A;  1EP4 A;  4MQ3 A;  3IG1 A;  4CED A;  4DTS A;  3QNN A;  4C8M A;  1EKE A;  4FW2 A;  4FW1 A;  4CGF A;  3SUQ A;  1D9F A;  3RRG A;  3L2Q A;  3ZSZ A;  4FJM A;  2GBZ A;  2HHT A;  3KJV A;  4ELU A;  3V9X A;  1L5U A;  1WSG A;  3MXI A;  4FZX C;  3D45 A;  4CIG A;  2D0A A;  1TKZ A;  4DTO A;  3AVL A;  4E7K A;  3ZSQ A;  5DMR A;  1VSI A;  3V6D A;  3I8D A;  3SI6 A;  4FK2 A;  4NYN A;  1Q8I A;  1KLM A;  4DS4 A;  4C8K A;  4DTX A;  3JYT A;  3SYZ A;  3DRR A;  4EZ6 A;  1JKH A;  1KCF A;  4JLH A;  4KFB A;  4RW6 A;  5FRN A;  3TAN A;  4ZHR A;  2HNZ A;  4KHW A;  4Z4I A;  3L2R A;  3PUF A;  4CEA A;  4CHY A;  3KK1 A;  4FK0 A;  1KFS A;  3OYF A;  3NF9 A;  2G8V A;  4NCB A;  3MEC A;  5C42 A;  1YTA A;  1KVB A;  3RR7 A;  5FRO A;  1J5O A;  3OYE A;  3VQ9 A;  1SL0 A;  2NUB A;  1KFD A;  4FM2 A;  5JS1 A;  1D5A A;  4E7L A;  1FXX A;  2OPP A;  4PWD A;  4OPK A;  1RIL A;  3LAK A;  3K5N A;  1NK9 A;  2QKB A;  2IGI A;  1SL1 A;  3HPO A;  3LWM A;  3V9U A;  2QXF A;  2BGG A;  1RCH A;  3AVK A;  3M8S A;  3OYH A;  1ZBF A;  1VSK A;  4OKJ A;  1DTQ A;  1GOC A;  3LAL A;  3M8P A;  5KGX A;  2OZS A;  2FC0 A;  2KZZ A;  3KD5 E;  3AVI A;  3QIO A;  3S9H A;  3LPU A;  3SQ1 A;  1NJW A;  1X9S A;  4E7I A;  4I9L A;  4DTM A;  1S5J A;  3HJF A;  2IOC A;  3KLH A;  2AJQ A;  1SKS A;  4KTW A;  2E6M A;  3AVC A;  2HHX A;  5CYQ A;  3ZSR A;  4AIL C;  3ZT1 A;  1NK0 A;  5J2N A;  4LSN A;  1WLJ A;  2D0C A;  3SUO A;  1RBV A;  3M8Q A;  1NJY A;  1K6Y A;  3IS9 A;  1WAF A;  4YFU A;  4KO0 A;  2FBV A;  2YNG A;  4CF0 A;  3OYN A;  2WOM A;  3LAM A;  4DU1 A;  4DFJ A;  1LV5 A;  1RDC A;  3SUP A;  5HBM A;  1VSF A;  4NCG A;  4KTQ A;  3VA3 A;  4C8L A;  2WON A;  3QIP A;  1QHT A;  3HT3 A;  2D5R A;  2KZM A;  2B5J A;  4H4O A;  1T05 A;  3CFR A;  3I0R A;  4E1M A;  3SV4 A;  2E6L A;  3NFA A;  1TV6 A;  5HRR A;  1RT2 A;  3OYA A;  1IH7 A;  4BDY A;  4CFB A;  4E7H A;  2HNY A;  2P5O A;  4K8X A;  1BL3 A;  5HRN A;  4IDK A;  4DG1 A;  2YKN A;  4UQG A;  3RTV A;  3MXM A;  2EX3 A;  3NH2 A;  3U3G A;  4FJ9 A;  4QAG A;  4FZY A;  1GOB A;  1B9F A;  1S1X A;  2ATQ A;  4FJL A;  4K8Z A;  4DQR A;  4F2R A;  4CHQ A;  4DLE A;  1N5Y A;  1S1T A;  1RBS A;  3MEE A;  3KLE A;  1QTM A;  3P1G A;  4DSK A;  2YNH A;  1B92 A;  4NYF A;  4OJR A;  3K58 A;  4F3O A;  3L8B A;  2DTU A;  3AA2 A;  4CEC A;  3SNN A;  2HND A;  3NHG A;  4ELV A;  4OLA A;  3QO9 A;  4CEF A;  2A1S A;  3LZI A;  3OYD A;  3DLR A;  4DTP A;  1FKP A;  3DLB A;  1LAW A;  5HRO A;  3PX4 A;  3VN5 A;  1HYV A;  1TKD A;  3IRX A;  4W5R A;  3KLI A;  3LPT A;  1L3S A;  3ZT4 A;  3O3H A;  3V4I A;  3AA3 A;  3E01 A;  4Q5V A;  1U47 A;  2XO7 A;  2KTQ A;  3AO2 A;  3IAY A;  3AVB A;  3SUN A;  3V9S A;  1QQC A;  2BAN A;  3TR8 A;  3KLG A;  1S9G A;  4E89 A;  3VQQ A;  3NF7 A;  2BE2 A;  3HXM A;  3LP1 A;  4B9T A;  1NK7 A;  1HQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...