1BIZA

Hiv-1 integrase core domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
147
Chain Sequence
VDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three new structures of the core domain of HIV-1 integrase: an active site that binds magnesium.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
molecule keywords HIV-1 INTEGRASE
total genus 46
structure length 147
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bizA00
3LPTA 3AVFA 3TAMA 4DSJA 4CHNA 3CM6A 4LSLA 1A5VA 1XI1A 1RT4A 1NK9A 3LP3A 1U45A 3ZSXA 1NJZA 3DLKA 2XHBA 4FLUA 3ZT4A 1KSPA 3ZT2A 3O3GA 4CGFA 4CJPA 4AHRA 4FLTA 4EZ6A 1VSLA 2KFNA 1QSYA 1HYVA 3CM5A 4B3OA 3AVAA 3B6PA 1S1XA 3QERA 4FW1A 3PX6A 2P5GA 5K14A 4BE2A 2F96A 1LWCA 1CZ9A 3T1AA 3LP0A 2O4IA 3I0SA 4OKKA 4AHSA 3L2WA 3HVTA 4F4KA 5SWMA 3S3OA 4J2DA 1X9MA 3ZSZA 5D3GA 3U3GA 4DSKA 1U4BA 1WLJA 2WOMA 4YFUA 4FVMA 2GV9A 4KTZA 3AV9A 3WNEA 2KTQA 4DFKA 4FJ7A 4E0DA 4FZXC 1U04A 4FLXA 4M3ZA 2HHSA 4KV8A 1NOZA 2FBVA 3OYLA 3RR7A 4PUOA 4CERA 3DOKA 4OVLA 4KI4A 4M41A 3DLBA 2KZZA 1RT2A 4CFBA 4I2PA 3QO9A 1L3SA 4J2BA 4FYDA 3DYAA 3ZSQA 5KRSA 2QKKA 4C8KA 2X6NA 3OYKA 4CEOA 3NH1A 1SL0A 2IS3A 3CQ8A 3C95A 4NCAA 1S1UA 3HK2A 3LDSA 1REVA 5JS2A 3VQ7A 3LWMA 1U49A 4JRQA 3KLEA 1TK0A 3AVIA 1BQNA 3QLHA 4FJMA 1TAQA 1RT1A 4LH4A 5J2MA 1UA0A 1IG9A 3EY1A 1RBUA 4C8NA 1NKBA 5C24A 3TANA 1SKSA 1KCFA 4CF2A 4OKJA 3PO4A 2DY4A 1BHLA 4PA1A 1QQCA 1RTDA 4CHQA 3ZT3A 3NF7A 2JGUA 4I9QA 4OKEA 4RW4A 2DTUA 3CG7A 2OPSA 3K58A 2GBZA 2RPIA 4CESA 4B9UA 4IG3A 4CEEA 3K5LA 1IKYA 2FBTA 4NYNA 3VQAA 3V9UA 2DFHA 3KLHA 1NK6A 3ZT0A 4ELUA 5E41A 5HBMA 3VA3A 2HHTA 5KGXA 3V1RA 1UA1A 3OYGA 3L3UA 5J1EA 3OVNA 2HW3A 3AVLA 2YNGA 4BE0A 3SZ2A 4IFVA 1HPZA 4HUGA 1J54A 4ELVA 1XC9A 5CY4A 1VSJA 4CJSA 4EP5A 3AVGA 5HRNA 3U3YA 3SUQA 4DQPA 4C8OA 4I7FA 3RTVA 3QNNA 4FJIA 2B4JA 4CEDA 3HXMA 1UOCA 1RTIA 4B8AB 3K5NA 4M42A 3AO4A 1A5XA 4BDYA 3DRSA 4NYFA 1QE1A 3RWUA 2A1SA 3PX4A 1VSIA 4HTUA 3F9KA 4KHNA 1NJXA 4GVMA 1L3TA 4KREA 1VSEA 4Y1CA 3OS2A 3PV8A 1K6YA 4M45A 1T03A 1SKRA 1LV5A 3RRGA 1O1WA 2KQ2A 3TAEA 2BDPA 3VQ9A 1NOYA 3AA5X 1B9FA 4LY7A 4N41A 3PUFA 4B08A 3IS9A 3DI6A 3KJVA 3SYZA 2A1RA 4M3TA 3MEEA 4PWDA 3OYNA 3SQ2A 1C1AA 3V9WA 2W42A 1FKPA 2D0BA 2X78A 4DSEA 3OYFA 3TR8A 5HP1A 3TAFA 4KKOA 2AJQA 3V9ZA 3SV3A 2B6AA 3AO2A 4CF8A 4Q0BA 1JLGA 1WNSA 1XHXA 4DU3A 3KD1E 4E3SA 3KK2A 3TAQA 3SQ4A 2ITGA 1B9DA 4CJQA 3BDPA 1KTQA 4YNQA 1W9HA 5I3UA 4KB1A 3T3FA 4CGGA 1NK7A 1U48A 2YHAA 3OYDA 2Z1IA 4ELTA 2ZE2A 1Q8IA 4AHVA 1LAWA 2IOCA 4O0JA 3LWLA 2XRIA 4DFJA 2RF2A 3DLRA 1T7PA 4FM2A 4CK2A 4DTPA 1RDDA 2G8HA 1NK5A 3VQQA 3LZJA 1WSIA 4CJWA 4CEAA 4F2RA 2F8SA 1IO2A 4HCBA 4PQUA 3A2FA 3VQ6A 3NFAA 4BE1A 3HPOA 2Y1JA 3TARA 1RDBA 2ETJA 4HVJA 3ZCMA 3MECA 4Z4FA 4F2SA 3V1QA 4GW6A 2Z1JA 3WNFA 1S9GA 3E01A 3HO1A 3PY8A 4DG1A 1S6QA 4BACA 3KKSA 2KZMA 3OYIA 4KAZA 3NBPA 1S1TA 4RW9A 1YTAA 4C8LA 1TGOA 4DU4A 4CJ3A 1VK0A 4E89A 5JS1A 1EP4A 4CIEA 1RTHA 4B9VA 4AILC 1UWBA 1TKDA 2HNZA 3CYMA 4DTJA 4CF0A 1HQEA 3K5MA 4H8KA 3VN5A 3NAEA 1HJRA 5HRSA 1D9DA 3L3VA 1C1BA 1DTTA 3VQEA 4W5QA 2HHQA 3NF8A 3DLEA 2OZMA 4NCGA 4IG0A 3LANA 1TL3A 3SCXA 4B9NA 4ICLA 3L2UA 1Q9XA 3G10A 2YHBA 4M3XA 4RW6A 1J53A 4CHOA 3O4QA 3V81A 4Z4EA 1VRTA 4CJKA 2VWJA 3AA3A 1J9AA 4CHPA 3KLGA 4LD0A 1C0MA 4DTRA 4KHYA 3TWHA 3OJUA 3AA4A 1IKWA 4CECA 4R5PA 3F73A 4OLAA 3WNGA 1BQMA 3AVMA 4TSXA 5J2PA 1QTMA 3V4IA 1TAUA 1WAJA 4ZTJA 4CJ5A 4CF9A 1KRPA 4FLZA 1N6QA 2HMIA 1Q9YA 1TKTA 3BGRA 4AHTA 2G8FA 3AO5A 2G8KA 2HVHA 3VQ4A 1XHZA 1RBTA 1QSLA 3MAQA 1VSHA 3EZ5A 4QCLA 3SI6A 1Z25A 4CJ4A 1ZBHA 4WE1A 1C0UA 1RTJA 1JXBA 1WSHA 1RT6A 4N47A 2XY5A 2VG5A 2HHVA 1B92A 3EYZA 2HVIA 2D0AA 4ID5A 3C6TA 3QINA 5CZ2A 4DF4A 1KLNA 3OYBA 4RW7A 3TAPA 1JLAA 4OPJA 5DK5A 3HT3A 3RMCA 4KHWA 1ASWA 4B9LA 1C6VA 4KTQA 4FLWA 3L2VA 3UIQA 1S1WA 4KI6A 1WAFA 2YNHA 4CJUA 3MXJA 1MU2A 4BWMA 1C0TA 3K59A 1KVBA 2XY8A 2FC0A 1CXQA 2I5JA 3CFPA 1RNHA 3O3HA 4FJXA 4FLYA 1L5UA 4N76A 2X74A 3VQ8A 4B9MA 4FXDA 3I0RA 3ULDA 3KTQA 2Z1HA 4FK0A 4E7LA 1NKCA 4M3UA 4DF8A 3TI0A 1EETA 1BGXT 4ID1A 4HUFA 1DTQA 4DS4A 1X9SA 3DMJA 3K57A 3QEPA 4GMJB 4CFAA 4W5OA 3ITHA 4OGEA 4AH9A 4DSFA 4DWIA 3QEXA 1NJWA 3C94A 4BWJA 2OA8A 3NDKA 1HNIA 4Z4HA 3D0PA 3NGZA 2QK9A 1IKXA 4CGJA 4Z4CA 4B8CA 4J2EA 3RR8A 4CJRA 2P1JA 4N56A 3O3FA 2R7YA 1EX4A 5HROA 1IH7A 4CIGA 3L2RA 3QIPA 4O44A 3M8QA 4Y1DA 3SUOA 3DM2A 1T05A 4E7KA 3NF6A 5HRPA 2RKIA 3M8SA 4JS5A 3AVCA 4J2AA 3HPGA 4CJEA 4CHYA 2HHWA 1U47A 3VA0A 1HRHA 4KRFA 3LAKA 3CFRA 1JLFA 2Y1IA 4FM0A 3TAGA 1BIZA 1RDAA 3QEIA 3VQDA 4DTSA 2HHXA 2X6SA 4QOZB 3QESA 1RT3A 4F8RA 3SQ0A 3V9SA 3CFOA 5SZTA 3KKRA 3MXIA 3AA2A 1IKVA 2VG7A 3K2PA 3P83D 2G8WA 1A5WA 2NUBA 5FROA 5C42A 4DQRA 1TL1A 4B9SA 1YVUA 3RMBA 4E7IA 5C25A 2PZSA 2XY6A 3ZSWA 4CEQA 3V9XA 3SQ1A 3HVRA 1TK5A 3LZIA 4DLGA 2IAJA 1KLMA 3LPUA 1N5YA 1C1CA 1L3VA 3ASMA 4OPKA 5T7BA 4HUEA 1CLQA 4CK3A 2BANA 4FJHA 1VSKA 2QKBA 3HYFA 1RBSA 2BE2A 3QIOA 4FM1A 1ITGA 1R0AA 4DSIA 1LWEA 1WN7A 2P5OA 3SPZA 2XO7A 4CJFA 4FJGA 1LWFA 3T19A 3HL8A 1NK4A 4BDPA 1S9EA 3IRXA 2GUIA 4OGCA 4DTUA 2EHGA 4CJTA 4FJKA 3OYJA 1BISA 1KFDA 2YKNA 4LH5A 3SUPA 1GOBA 1L3UA 1ASUA 3HSTB 3KLIA 3NF9A 4E19A 1BCOA 3OS0A 3KLFA 2IC3A 3TABA 3O4NA 3SNNA 1ASVA 1I3AA 1XWLA 3MEDA 1Z26A 5CYMA 4FZZA 5CYQA 3NH2A 1KFSA 2G8VA 1X1PA 3S3NA 2HB5A 3OJSA 3NHGA 1HMVA 1WSGA 1S6PA 4XIUA 5HLFA 1SKWA 2P51A 1VSFA 3DRRA 4IBNA 4FJ5A 3RMAA 1D9FA 4IFYA 3DRPA 1BL3A 1Y97A 3H08A 3OY9A 4E1NA 3D45A 3DLGA 2PY5A 1FKOA 3HM9A 5DMRA 3KIOA 3RMDA 2PYJA 4BDZA 4FZYA 4W5TA 3AVHA 4PY5A 3P1GA 4CJLA 4CF1A 4DTXA 1NK0A 1F21A 2IDOA 3KK3A 4KPYA 5FDLA 4HHTA 3SJJA 3SPYA 1LW2A 3M8PA 3AVNA 4I2QA 1TKXA 2HNDA 1JL2A 3K5OA 4O4GA 4FLVA 4DFMA 1BCMA 3VQBA 1WSFA 1JLBA 4CIFA 4DQSA 4HCCA 1NK8A 3V1OA 3OYAA 2G8IA 5KI6A 4JS4A 1SV5A 1SL2A 2DFEA 3OS1A 3V6DA 2B5JA 2HNYA 3KK1A 3ZSRA 1CXUA 1QS4A 3AVBA 1JLQA 4IDKA 4IKFA 4E1MA 2F8TA 1HQUA 1TKZA 1X9WA 2OPPA 3ZSVA 3ISNC 3OYCA 3HPHA 4NCBA 1RCHA 3JSMA 5KRTA 1HYSA 3NGIA 4MFBA 4KO0A 3ZSYA 3PX0A 2ZQBA 2FBYA 4Z4GA 1D8YA 3NE6A 3VQ5A 3SUNA 1JLCA 1LAVA 1GOAA 1ZBUA 3SV4A 3I8DA 2E6LA 4DFPA 2Z1GA 2LSNA 4CEFA 4DQQA 2D5RA 3HP6A 4E7HA 1RDCA 4W5RA 5EU7A 4ZTFA 4CE9A 3M8RA 3L8BA 2FBXA 4MQ3A 5I42A 1NJYA 1SL1A 4L8RB 4KTWA 1VSDA 2IGIA 1TV6A 4M3WA 4EP4A 1S5JA 3PO5A 1YT3A 1JL1A 1BIUA 3IG1A 1LW0A 4H4MA 5HRRA 4B9TA 1ZBFA 1KVCA 2ATQA 3MEGA 4Q5VA 3NH0A 4DLEA 4N5SA 2YNFA 4DQIA 2ZD1A 1RILA 3ZT1A 2VG6A 3NGYA 3VQCA 3RRHA 3AO1A 5FRMA 3AVJA 2WONA 2YNIA 3LAMA 4CGIA 4Z0UA 3QEWA 4I9LA 4FK4A 1JLEA 1W0HA 1VSMA 4AHUA 5KGWA 4ZHRA 3S3MA 2HHUA 1GOCA 2JLEA 4KFBA 1TVRA 3ALYA 4K8XA 3DLHA 3VQPA 4FK2A 1BI4B 3G0ZA 2RN2A 1SUQA 1UAXA 1G15A 4F3OA 3OYHA 1HNVA 3QNOA 4DTNA 4M3YA 4UQGA 4FJLA 1DLOA 2KFZA 4RW8A 3JYTA 4CFDA 4DTMA 1YTUA 2YKMA 4DTOA 4EZ9A 1NKEA 1WSJA 4FJ9A 4QAGA 1J5OA 1BI4A 2DFFA 1CZBA 2EX3A 1FXXA 4FJJA 2D0CA 3AVKA 4RG8A 4CGHA 4DS5A 2YV0X 4FJNA 3LP2A 1RT5A 2KW4A 4FCYA 4KB0A 4JLHA 1TK8A 1D5AA 4KHQA 4KHUA 2QXFA 1I39A 3LALA 4CEZA 1VRUA 4OLBA 1T8EA 2OPQA 3QEVA 2Q3SA 2E4LA 3QETA 3OYMA 1FK9A 2E6MA 4FJ8A 4F3TA 4G1QA 1JKHA 3ZSOA 4O5BA 4O55A 3FFIA 4CEBA 1ZYQA 2OPRA 4DU1A 1RBVA 4CK1A 3NCIA 3LP1A 4JRPA 1RT7A 1QSSA 1KVAA 4W5NA 5KTQA 4DSLA 1ZBIA 3HJFA 3THVA 1EXQA 2VWKA 2OYQA 4CJVA 3L2QA 4C8MA 1EKEA 3HP9A 3P5JA 4AHCA 3S9HA 5FRNA 5J2NA 2BGGA 3WNHA 4O0IA 4H4OA 4M3RA 4CHZA 2OZSA 4OJRA 2O4GA 1HYZA 4Z4IA 3KD5E 2G8UA 1ZBLA 3DOLA 4KHSA 3B6OA 4K8ZA 4CFCA 1QHTA 3MXMA 1WSEA 4CCHA 4E7JA 4LSNA 1JXEA 1RBRA 2PYLA 4CGDA 4FW2A 3OYEA 3IAYA 3AO3A 4DMNA 1S1VA 2XY7A 3U6FA 5CZ1A 5J2QA 3C6UA
chains in the Genus database with same CATH superfamily
3LPTA 1KAYA 3AVFA 1Q18A 3LDLA 5AQSA 2QM1A 4H03B 3LP3A 3ZSXA 4JKGB 1NJZA 3DLKA 3ZT4A 2UXBK 3O3GA 4CJPA 4H5WA 4B3OA 1S1XA 3PX6A 2P5GA 3NVKA 1R59O 5K14A 3LP0A 4AHSA 3L2WA 3HVTA 1N32K 4KHPK 4JI6K 4XH4A 1WLJA 4YFUA 3CCRN 3ULEA 4DFKA 4ILHA 4FLXA 2WUSA 4FZXC 4CD3A 4CERA 5LJWA 4CFBA 2FLOA 1HPMA 3ULEB 4J2BA 5C15A 2X6NA 3NH1A 2IS3A 4B3RK 1S1UA 3HK2A 3LWMA 3KLEA 1BQNA 3D2EB 1MA9B 3TTCA 1TAQA 1UA0A 5J2MA 3EY1A 4BR0A 4JD2B 4C8NA 4WFNL 1BA1A 4OKJA 2DY4A 2UYTA 4PA1A 1RTDA 3CMAN 2DTUA 2CH5A 4NYNA 2QWPA 4CZIA 5LJVA 3O9SA 1UA1A 1LOTB 5B8HA 3AVLA 4YOXA 2A6AA 1OH6A 2HW3A 5AQHA 4JAXA 1J54A 5CY4A 4CZGA 2P9SB 1GLAG 4I7FA 3RTVA 2B4JA 4B1UB 4CBWA 1YAGA 4M42A 3AO4A 3UKRA 3DRSA 4DV4K 1VSIA 5GAGP 2CGJA 1LV5A 2BDPA 3AA5X 4JK8A 1B9FA 4LY7A 3CCMN 3THXB 4M3TA 3MEEA 2OTJN 1K8KA 4O8UA 2W42A 4AQYK 2D0BA 2KKZA 3TR8A 4BG8A 4CBUA 3TAFA 5HOOA 3V9ZA 2B6AA 4CF8A 5LMUK 1JLGA 1XHXA 4EAHD 4DU3A 4E3SA 3TAQA 3SQ4A 1ZXOA 3J8AA 5KQDA 2VQEK 4HWIA 1U48A 2YHAA 2ZE2A 1Q8IA 3DXMA 1LAWA 3C0BA 2VGMA 3LWLA 2XRIA 4DFJA 1J5EK 4FM2A 1I94K 1RDDA 3O5BA 1NK5A 3VQQA 4GKJK 4PQUA 4LC9B 5FPDA 3A2FA 3VQ6A 3NFAA 4DV5K 3HPOA 4BE1A 2Y1JA 1JJ2M 1VQ5N 4IO8A 1NGDA 4Z4FA 3WXKA 3RSEB 3ZETA 4GW6A 2H3GX 2IVOA 2Z1JA 4FWPA 3PY8A 3KKSA 3EEQA 4DU4A 5JS1A 4E89A 4JI3K 4CIEA 4BRDA 1UWBA 2HNZA 5GINA 4DTJA 3SBGA 5HRSA 1DTTA 3VQEA 4W5QA 1IJJA 2HHQA 4NCGA 2D4WA 2QTDA 4ICLA 2UUBK 3L2UA 3CJ1A 2O8BB 5C2DA 4CHOA 2E2NA 5BPLA 2FF3B 2VWJA 1J9AA 4KH5A 4CHPA 5C10A 4DTRA 4KHYA 5ADXH 3OJUA 3LDPA 3VETA 4CECA 4R5PA 4OLAA 3G4SN 3WNGA 5AQIA 3WXIA 4QS9A 5AQRA 1GLCG 4OO1J 2QW9A 3I8BA 4CF9A 3GDQA 4MLEA 1Q82O 4LF5K 2W6LA 3BGRA 4X65K 3VQ4A 1ESVA 1VSHA 4CW7B 1ZBHA 4WE1A 4MO4A 4YOWA 2HVIA 4YDUC 3OYBA 1JLAA 5DK5A 3HT3A 4UY8O 3RMCA 1ASWA 4JEPA 5FPMA 3K59A 3LDQA 1KVBA 1Q81O 3WUHA 1CXQA 1U2VB 4BR9A 1RNHA 3CFPA 1L5UA 2X74A 3QB0A 4DV6K 3U4LA 3QDKA 4E7LA 4M3UA 4YY3K 1EETA 4HUFA 1EWRA 1VHXA 3DMJA 3QEPA 4OGEA 4AH9A 4FSVA 3C94A 1HNIA 4Z4HA 3D0PA 2JWLA 2NRTA 4B8CA 4J2EA 3O8MA 3FZHA 1QQNA 4CIGA 3M8QA 2P9NA 3ZX0A 1YJNN 2RKIA 3M8SA 3HPGA 4CJEA 5JMVA 1NGJA 4H0YB 4YDUA 2E8AA 3BZKA 4FM0A 4OX9K 1BIZA 1RDAA 3VQDA 2HHXA 2X6SA 3P4IA 4F8RA 3SQ0A 5AQGA 4WQ4C 3K9JA 1IKVA 2VG7A 3P83D 1A5WA 5C42A 3D7EO 3VTIA 1TL1A 3CC4N 4B9SA 3RMBA 4U7BA 5C25A 2XY6A 5AQXA 4NXMK 4CEQA 3V9XA 3SQ1A 3VMFB 5BN9A 4DLGA 2IAJA 4EHUA 1C1CA 3WXJA 3UE5A 1QVFM 1RBSA 4FM1A 4JKGA 3DXMB 4H5RA 2XO7A 3E1YA 1NGEA 1LWFA 2ASMA 2A5XA 4H5NA 3O08A 2E2OA 2GUIA 4OGCA 3MMVA 3OYJA 2RHKA 3DWLA 2YKNA 1N34K 5TKYA 1BCOA 3OS0A 4JV5K 3KLFA 3SNNA 5HL7L 3ZETB 1K73O 1KFSA 3C7NB 1HNXK 4JN4A 3ZX3A 2ZJQL 1DEJA 2G8VA 4IJAA 5F2RA 3NHGA 3OA9A 4B1VA 2HMPA 4XIUA 5HLFA 3O80A 1E4GT 2HOEA 3HBTA 3RMAA 2YI1A 4IFYA 4YOVA 1D9FA 3OY9A 3D45A 4DB3A 3AARA 5AQLA 3ATVA 3KIOA 5BR9A 3JAMO 3P1GA 3CIPA 4YOYA 2I7NA 4CF1A 1NK0A 2QWRA 3AVNA 4DFMA 5TKWA 1WSFA 1JLBA 4DQSA 5AJ3K 4GV6A 3V1OA 5KI6A 4PKGA 2P9KB 2HNYA 3ZSRA 3AVBA 1JLQA 1HQUA 2NRZA 3BUZB 3BZCA 3OYCA 5GIOA 2AA4A 3U9ZA 3OTOK 3ZSYA 2ITMA 3NE6A 3SUNA 1LAVA 5AZIB 3O9TA 1HKCA 4B9QA 3W0LA 3JS6A 3CCVN 3O6WA 2FSKA 3HP6A 4E7HA 1RDCA 4BRKA 5DM7L 4ZTFA 3L8BA 4FWSA 2FBXA 5I9EB 5AQUA 5C2FA 1JL1A 1BIUA 4C8LA 1ZBFA 2ATQA 3NH0A 2ZF5O 3ZT1A 3CCLN 3AVJA 3I56N 3VTHA 4NLBA 3SMPA 4CGIA 3QEWA 3ENBA 4AHUA 1GOCA 3VQPA 1M90O 1UAXA 3OYHA 4JK7A 4UQGA 4FJLA 1DLOA 1QZ5A 4JI7K 1YUWA 5LMNK 1YTUA 1NKEA 1X3MA 4QAGA 3CPEA 2DFFA 4O5FA 3C6AA 4RG8A 2D0CA 3AVKA 4KH4A 3BF1A 4FJNA 2O8CA 4H5VA 4JLHA 4KHQA 2ZJRL 3C65A 5BRFA 3LALA 4A5AA 4AF1A 4OLBA 2OCEA 2OPQA 5C12A 3SJHA 3OYMA 1JKHA 4C1NI 4O55A 2AP1A 4W5NA 4MDAA 4DSLA 3THVA 1EXQA 3L2QA 3P5JA 1OKJA 3R8EA 3ZYYX 3DOLA 1VQON 3GL1A 4K8ZA 1QHTA 3MXMA 4LSNA 2PYLA 3CI5A 2P9IB 4B3SK 3CJ7A 4DMNA 4DV2K 3VESA 3VENA 1YF5L 4DSJA 3MX2A 3VEOA 3CM6A 5JVHL 1HNZK 4LSLA 2UUAK 1A5VA 4FWQA 2HBKA 4FLUA 4EZ6A 3O9RA 4CGFA 1VSLA 1HKBA 3TTFA 3AVAA 3D2EA 3B6PA 1GLEG 2ZGYA 3FZFA 1QQMA 1LWCA 1CZ9A 4GKKK 3I0SA 3FR0A 3S3OA 4J2DA 3ZX2A 5M1QA 3ZSZA 1X9MA 1U4BA 2GV9A 3TTDA 3WNEA 1NG9A 2HHSA 1NOZA 2FBVA 3OYLA 3RR7A 4PUOA 5CE3A 3CCUN 4JK9A 3DOKA 4KI4A 4BR5A 4M41A 1VQ4N 3QBWA 3QO9A 4FYDA 3DYAA 3P38A 4C8KA 3OYKA 4CEOA 3C95A 5BPMA 4NCAA 3LDSA 4DR2K 3VQ7A 4IO9L 3AVIA 3QLHA 3CJCA 1RT1A 2Q2RA 3TANA 1SKSA 1KCFA 3LDOA 2P9UA 3PO4A 3D2FA 4CI6A 3F9MA 4CHQA 3NF7A 4I9QA 3O1BA 3RVCA 3CG7A 2OPSA 2UXDK 4CESA 4B9UA 4CEEA 2FBTA 2CGKA 3WXLA 2ASOA 2YJEA 4OPAA 5IWAK 2YHXA 3EO3A 3ZT0A 3VA3A 4FOEA 3V1RA 1VQ6N 3UKUA 4JHDB 5AQYA 4BE0A 4ELVA 1HPZA 5KPZA 3FZLA 4EP5A 4DQPA 3BY5A 5FPNA 3QNNA 3OHRA 4CEDA 1N36K 1UOCA 5GAEP 3F9KA 3J7AP 4KREA 1VSEA 3RRGA 3PV8A 1K6YA 4FO0A 3LM2A 1O1WA 3VQ9A 2E1ZA 3PUFA 3SYZA 4NB4A 4DV7K 4HTLA 1OH8A 1BU6O 3OYNA 3SQ2A 1KQSM 1FKPA 2X78A 5AQOA 4B3MK 5HP1A 2AJQA 4BC3A 3K9KA 3AO2A 3MX5A 1B9DA 4MLHA 3SK3A 4CJQA 3EKUA 3BDPA 1W9HA 5H1SQ 5I3UA 3T3FA 1NK7A 4GVEA 4JKBA 3I55N 1OH5A 2D0PA 4K25A 4O0JA 3MN6A 2RF2A 3TSPA 4CK2A 2G8HA 3R6MA 3LZJA 4G9ZA 3T1YK 1WUAA 4BQZA 3TARA 2YHWA 5JLHA 2NRHA 3ZCMA 3E9LA 1XUPO 1MWMA 2O8FA 3V1QA 1XNQK 3H1VX 1S9GA 3E01A 4A2BA 3KWIA 3OYIA 4KAZA 3NBPA 4RW9A 4CJ3A 1VK0A 1RFQA 3A5LC 5AZIA 4AILC 3H1QA 3NAEA 3CCEN 3M5RA 1D9DA 3L3VA 1C1BA 2KHOA 3R9PA 2O8CB 3SCXA 2GELA 3G10A 1J53A 1TUUA 3LM9A 3O4QA 5BR8K 3V81A 4CJKA 3KLGA 3TWHA 4ILJA 4H0VB 1IKWA 1BUPA 2HBMA 4CJ7A 4A59A 3AVMA 4TSXA 1MWKA 5J2PA 3V4IA 1WAJA 2P9PB 1KRPA 4M7XA 1Q9YA 3GOIA 4AHTA 2G8FA 4BR7A 4QCLA 4B1WB 3HM8A 4EIAA 2YHYA 1C0UA 1RTJA 2QWOA 2XY5A 4DR3K 2VG5A 3WQTA 3MN9A 1B92A 2D0AA 5BN8A 3QINA 4OPJA 4JI1K 4PL8A 3TSUA 3L2VA 1WAFA 1T6CA 3O1WA 2FC0A 3MK6A 2I5JA 4N76A 4FLYA 4B9MA 3ULDA 3ZEUB 3CF5L 3DLLL 4ID1A 4BR4A 4X66K 4GMJB 4JI4K 4DWIA 5EX5A 1NJWA 2OA8A 4BWJA 2QK9A 1SAZA 3H3NO 4JI0K 4CJRA 2P1JA 5KPTA 4N56A 5JVGL 3J7ZO 1W7AA 3L2RA 3NF6A 2QI2A 4CHYA 3KWGA 2HHWA 1SS6A 1U47A 2F7TA 3VA0A 1HRHA 2V51B 3CFRA 3TAGA 3QEIA 4FOIA 4QOZB 1RT3A 3WQUA 2CGLA 3V9SA 3A0IX 5SZTA 3MXIA 3AA2A 3K2PA 5FROA 4DQRA 5AQFA 4E7IA 4GV9A 3ZSWA 4BRQA 4DR7K 1KAXA 3VF6A 1KLMA 1C0GA 3LPUA 1N5YA 4BVOA 1L3VA 4HUEA 5T7BA 3L4QA 1CLQA 2BANA 4FJHA 3HYFA 1R0AA 2BE2A 3THYA 1LWEA 3E66A 3SAHA 4CJFA 1NK4A 3IRXA 2NRWA 1KFDA 2P9UB 1L3UA 4LFCK 1ASUA 3HSTB 3KLIA 4E19A 1HR0K 3KZBA 3PSFA 1ASVA 1I3AA 1XWLA 1J6ZA 1Z26A 5CYMA 4FZZA 1XMOK 1VQKN 1X1PA 3KK7A 2HB5A 3OJSA 4YOUA 3CJAA 1S6PA 5AFUA 3DRRA 3F5TA 1TUYA 5AQJA 3DLGA 3HM9A 4BDZA 4W5TA 4CJLA 4DTXA 2I7PA 1YI2N 1LW2A 4O4GA 1TKXA 2HNDA 1JL2A 1BCMA 4EFHA 4CIFA 4HCCA 4IEEA 3UKRB 3OYAA 2QEXN 3V6DA 3U8XA 3KK1A 1X3NA 1CXUA 1QS4A 4IDKA 3IKMA 5BRDA 3WXMB 4BRAA 3O4WA 3ZSVA 1LCUA 3NGIA 2PFUA 3FFKB 1D4XA 4CZEA 2E88A 1YVNA 1KD1O 3ZEUA 5KPRA 4K0KK 3SV4A 1CZAN 3I8DA 2O8EA 1GLJO 4W5RA 2V52B 3CJ9A 4JI5K 3M8RA 3B8AX 5I42A 3J7YP 1NJYA 1NJIO 1SL1A 3E9OA 2HF4A 3EZWA 2IVNA 4H4MA 2A40A 5HRRA 2QKBA 3VOVA 2ZD1A 4DQ8A 3RRHA 2VG6A 2P9LA 2YNIA 4IEIA 4Z0UA 3P39A 4CZHA 1NM1A 4ZHRA 3S3MA 1TVRA 3ALYA 5M1KA 2P9PA 1S72N 4FK2A 1BI4B 5M1FA 4BRMA 1SUQA 3HSCA 1G15A 3QNOA 4DTNA 2F4VK 1GLFO 2E2PA 2QA4N 4LF7K 2YKMA 1WSJA 4FJ9A 1BI4A 2EX3A 4MDBA 4FJJA 3OBYA 4CGHA 3FZMA 4M63C 5M1NA 1TK8A 1D5AA 4GV3A 4KHUA 4JKEA 2E4LA 4LF6K 4FJ8A 2E6MA 4IDHA 4F3TA 2VGNA 3FFIA 4IOXA 1T3VA 4BROA 4GY2B 3NCIA 3LP1A 1RT7A 2NLXA 5AQKA 1ZBIA 4CJVA 5BRHA 1E3MA 1NLVA 4BC5A 1HYZA 3E9PA 3LDNA 4CZJA 1ZBLA 3B6OA 4IXCA 3I33A 1WSEA 4CCHA 4FW2A 3OYEA 3AO3A 1NGFA 4PHTX 3EE8A 3VF4A 2P9NB 3G25A 3P31A 1NGIA 4CBXA 4DR5K 3ID8A 1KSPA 3ZT2A 3CXCM 3DJCA 2KFNA 4AHRA 4FLTA 1QSYA 3TSQA 1WBDA 3QERA 4FW1A 5BREA 4BRIA 3T1AA 4DV0K 1IBMK 1DKGD 5D3GA 3J80O 2UUCK 2WOMA 1Z05A 4FVMA 4KTZA 4M3ZA 4FJ7A 4E0DA 1U04A 1YIJN 2FSNA 4OVLA 3DLBA 4WF9L 1RT2A 3M6GA 4I2PA 3IMXA 5KRSA 4BRLA 1REVA 1U49A 4A5BA 1IG9A 1RBUA 1NKBA 4A62A 1BHLA 3ZT3A 2V7ZA 3VGKA 3VF2A 2GBZA 2RPIA 3VEXA 5M1OA 4NXNK 3VQAA 4B1XB 4ELUA 5HBMA 2HHTA 5J1EA 3OVNA 4I6MA 2YNGA 3EKSA 3SZ2A 4IFVA 4CJSA 3U3YA 1GLLO 5KQ8A 3SUQA 4C8OA 4DR4K 4PKHA 4FJIA 3HXMA 3N4PA 3K5NA 1K9MO 4BDYA 2CH6A 3D2FB 1QE1A 2A1SA 4HTUA 3VEWA 4KHNA 4GVMA 1VQMN 4Y1CA 3OS2A 3TAEA 1NOYA 4B08A 3IS9A 3DI6A 4Z94A 3KJVA 2A1RA 1KC8O 4JKDA 4RWTA 3CCJN 2QWLA 5EXWA 3UKUB 4F9OA 3OYFA 1NU0A 3ENHA 3IUCA 4H5TA 3NVMA 5CHIA 4KKOA 1XQSC 1V4TA 5AQWA 3SV3A 2O8DB 4I6MB 1VQLN 1WNSA 4IZ9A 4ISEA 5A2QO 3ZLJA 5AQNA 4ISFA 3IFRA 1KTQA 4YNQA 4Y0WA 3H6EA 2Z1IA 2ZJPL 2P9LB 4AHVA 3AAPA 3HI0A 2W6KA 3DLRA 1T7PA 1DT9A 3MCAB 1WSIA 4CJWA 2D0OA 4F2RA 2F8SA 4ILGB 3GE1A 1RDBA 3U9DA 4WQ5A 4HVJA 3MECA 4F2SA 2A3ZA 4LFAK 3HO1A 3C7NA 3CPWM 4BACA 3AAQA 2KZMA 1YTAA 1S22A 4BG9A 1RTHA 4B9VA 4K43A 4WFAL 4DV1K 1TYQB 1HQEA 3K5MA 4DCHA 3VN5A 1HJRA 3NMUA 3CQXA 2OZMA 3MWTA 1OVQA 1TL3A 2EWSA 4FWLA 5FLXO 4DR1K 2YHBA 4M3XA 5JICA 4Z4EA 4BRHA 4LD0A 4PL7A 1ZBSA 3AA4A 2E2QA 5GIPA 1BQMA 3T69A 1QTMA 1TAUA 4K42A 4ZTJA 4CJ5A 4FLZA 1TKTA 2G8KA 5AR0A 1QSLA 3MAQA 3EL2A 3IDHA 1Z25A 3QFPA 2ZWHA 1JXBA 4H0OA 1RT6A 4N47A 4GNIA 2HBLA 1KLNA 3TAPA 4IWVA 1C6VA 1O13A 4FLWA 3UIQA 3KHYA 2YNHA 3MXJA 1MU2A 4BWMA 2XY8A 3R3LA 3O3HA 3EN9A 4QS7A 5E26A 3I0RA 3CMEN 4FK0A 4DF8A 1BGXT 4DV3K 4DS4A 1DTQA 5AQPA 4CFAA 4W5OA 3ITHA 4DSFA 1NMNA 2GTDA 3QEXA 3NDKA 3NGZA 1IKXA 4Z4CA 1QQOA 1FW6A 1FJGK 3O3FA 1EX4A 5HROA 1IH7A 4Y1DA 3Q7CA 4E7KA 5HRPA 4JS5A 2PAVA 3QICA 2Y1IA 2Q0UA 4BRNA 4JD2A 3QESA 2O8FB 3CFOA 4CZKA 3KKRA 2NUBA 3F2KA 4BRCA 1YVUA 3BEXA 3SAGA 2Q1NA 4FPAA 3LZIA 1YHQN 2BTFA 4XEIA 1NNEA 4CK3A 1VSKA 3QIOA 1NMDA 1ITGA 2O8BA 3SMSA 1WN7A 3SPZA 1BWFO 2E20A 1YJWN 3HL8A 2HF3A 1S9EA 3GG4A 4DTUA 2EHGA 1WOQA 4CJTA 2Q36A 4E1JA 2FSJA 3JXUA 3SUPA 1JCEA 2IC3A 3TABA 3FGUA 3O4NA 2VYPA 3MEDA 1BDGA 5CYQA 3NH2A 3VGMA 3SBTA 3S3NA 1HMVA 1SQKA 1WSGA 4DUZK 4DKWA 4IBNA 4CZFA 4FWNA 4E1NA 1FKOA 3RMDA 2PYJA 3CC2N 4PY5A 3A8YA 3AVHA 4WFBL 3J81O 1W2BM 4KPYA 5FDLA 4R79A 1HKGA 3SPYA 3SJJA 3M8PA 1RDUA 3VQBA 1ATSA 1NK8A 3R1XA 4JS4A 1ATNA 4IOAL 1SL2A 2DFEA 4XH5A 3OS1A 1XNRK 2Q31A 2F8TA 1TKZA 1X9WA 1MDUB 2P9IA 3ISNC 3HPHA 4NCBA 3JSMA 1HYSA 4JKAA 5KRTA 4MFBA 4KO0A 3VPZA 2ZQBA 5GADP 1D8YA 4Z4GA 3VQ5A 2OANA 1JLCA 1GOAA 1ZBUA 3OBWA 2E6LA 4JNEA 1ZC6A 4AM6A 4DFPA 2Z1GA 2LSNA 2D5RA 3QBXA 3HOSA 4MQ3A 1VQ7N 1H1VA 4L8RB 4KTWA 3THXA 3DAWA 1S5JA 1TYQA 1YT3A 1LW0A 3O9UA 4Q5VA 4DLEA 4DQIA 5FRMA 1RILA 3NGYA 4FWOA 3LAMA 1ILYA 2OTLN 2NNWA 4I9LA 4FK4A 1JLEA 5AQVA 3K0SA 1VSMA 1KAZA 2HHUA 2JLEA 3HZ6A 4KFBA 3S41A 3DLHA 4WQ5C 2RN2A 4MO5A 5EVZA 2BH1A 2VWBA 2KFZA 4RW8A 3JYTA 4CFDA 3N4QA 4EZ9A 1NBWA 3O9QA 1CZBA 4KH6A 4BVPA 1FXXA 4BRFA 1G99A 2YV0X 3LP2A 2KW4A 4FCYA 4QS8A 4ISGA 2GEMA 3VEVA 2QXFA 4CEZA 4H0PA 4FWRA 3QEVA 2Q3SA 3PLAA 3QETA 1HX1A 1W97L 1FK9A 5DM6L 4G1QA 3ZSOA 4O5BA 3VEZA 4DU1A 1RBVA 2WTUA 2ZM6K 4JRPA 1KVAA 4YORA 4CZMA 3AGRA 2VWKA 2OYQA 4C8MA 1EKEA 3HP9A 3ID6A 2BGGA 2IVPA 3HOTA 5J2NA 2FF6A 4H4OA 4M3RA 1IV0A 5MLCQ 2O4GA 4Z4IA 4KHSA 1EWQA 1VQ8N 1P8ZA 1JXEA 5ELZA 2XY7A 1S1VA 3U6FA 3TPQA 5J2QA 3C6UA 1BA0A 1IG8A 3PIOL 4FVUA 3G71N 3TAMA 4CHNA 2P9KA 1XMQK 2DPNA 4BY9C 1XI1A 1RT4A 1NK9A 4JKHA 1U45A 2XHBA 1JCGA 2ZGZA 1HYVA 3FE1A 3CM5A 1QHAA 3VERA 4JI2K 4BE2A 1NGCA 2NRXA 2F96A 2O4IA 1N33K 4OKKA 5EOYA 4BQLA 4F4KA 5SWMA 1C0FA 2WC9A 3U3GA 4DSKA 2KTQA 3AV9A 1NGBA 3L0QA 1BO5O 4KV8A 4J8FA 3THWA 5AQZA 2KZZA 2O8EB 2VCPA 4BC4A 1L3SA 3ZSQA 2QKKA 1SL0A 4CD1A 4IOCL 5GAHP 3CQ8A 1RGIA 5JS2A 3VEYA 1YITN 4JRQA 1TK0A 4FJMA 4LH4A 4V19S 3LL3A 4JI8K 1RDWX 5C24A 1YXQA 4CF2A 3MN5A 3CHWA 1QQCA 2F9TA 2JGUA 1KXPA 4OKEA 4RW4A 3K58A 4DHYA 4IG3A 3K5LA 1IKYA 3V9UA 2DFHA 3KLHA 1NK6A 1M1KO 3SLCA 5E41A 4O8KA 5KGXA 3OYGA 3L3UA 5EY4A 1EO1A 4HUGA 3KVGA 3H46O 1XC9A 1VSJA 3CJBA 3AVGA 5HRNA 2O8DA 3L4IA 1RTIA 2A42A 2UXCK 4B8AB 4M7YA 5CR4A 1A5XA 4NYFA 3RWUA 3PX4A 1NJXA 1L3TA 2W40A 1T03A 2QWNA 4M45A 1SKRA 2KQ2A 3AGKA 4N41A 4C1NK 1DGKN 4PWDA 1C1AA 3V9WA 1QZ6A 4DSEA 3THWB 1OVYA 3MDQA 3T7ZA 3Q7BA 4FPBA 4Q0BA 2YX6A 3KD1E 3KK2A 2ITGA 1N8RO 4WCEL 2V7YA 4PKIA 5M1PA 4KB1A 3H45C 4CGGA 3OYDA 3TU5A 4ELTA 2Q0RA 3M1FA 2IOCA 1VQNN 4DTPA 1SZ2A 3A5NC 4CEAA 1IO2A 4HCBA 5F0XA 2ETJA 4BRGA 4JYAK 1IBLK 2E5LK 3WNFA 4DG1A 4LF4K 1S6QA 5E84A 1S1TA 1Q86O 1JCFA 1TGOA 1EP4A 2HHHK 1TKDA 4CVNE 3CYMA 4CF0A 4JHDA 4H8KA 2E1YA 3H3OB 3BP8A 2VQFK 4A61A 3DXKB 3NF8A 4BC2A 3DLEA 3C6HA 4IG0A 3W3DA 3A5MC 3LANA 4B9NA 2WBNA 1Q9XA 4RW6A 1Y64A 1VRTA 2D1KA 3UB5A 3AA3A 5AZJB 1C0MA 4RTFD 2QWQA 5AQTA 1U2VA 5ADXA 3F73A 2IIRA 5LY3A 2Q97A 3MN7A 4BGAA 4NLCA 3CC7N 4B1YB 1N6QA 2HMIA 3AO5A 2HVHA 1XHZA 1RBTA 3EZ5A 5FPEA 3SI6A 3A5OC 4CJ4A 1WSHA 1HLUA 2HHVA 2YCHA 4OPHA 3EYZA 4ID5A 4DF4A 3C6TA 3D6RA 5CZ2A 4L3QA 2NRVA 4RW7A 2GX9A 4KHWA 1VQ9N 4B9LA 4KTQA 3CERA 4KI6A 1S1WA 4CJUA 1C0TA 1IBKK 4EHTA 1VQPN 4FJXA 3VQ8A 5AQQA 3FZKA 4FXDA 3KTQA 2Z1HA 1NKCA 3TI0A 1X9JA 1X9SA 2J4RA 3QFUA 3K57A 4YOTA 3SAFA 1BG3A 4CGJA 3VGLA 3RR8A 2KLAA 3L6QA 2R7YA 1HUXA 3QIPA 4O44A 3SUOA 2UU9K 3DM2A 1T05A 4BREA 3MCPA 3AVCA 4J2AA 4NO7A 2GWKA 2NZTA 4JKCA 4KRFA 3LAKA 1JLFA 2PBDA 5AQMA 4DTSA 4RCHA 3HTVA 3RSEA 1P90A 2NRRA 2G8WA 1OH7A 1K8AO 4C23A 4X62K 2PZSA 1VAZA 3HVRA 1TK5A 3ASMA 4OPKA 4DSIA 1HJOA 2P5OA 4B3TK 3CQYA 4FJGA 2JWKA 3T19A 1WB9A 4BDPA 5C0YA 4A57A 3DXKA 4FJKA 1BISA 4B1ZA 1HNWK 4LH5A 4LF8K 1T6DA 1GOBA 3MWPA 3NF9A 4K41A 3ATUA 3QMLA 4A2AA 2HSTA 3EE9A 3T1HK 5JLFA 4KBOA 4JKFA 5F1XA 4BRPA 4IJNA 2F9WA 4X64K 5BPNA 1YJ9N 4WYBA 2HBJA 4FJ5A 4U67L 1SKWA 2P51A 1VSFA 3DRPA 1BL3A 1Y97A 3H08A 1V4SA 2PY5A 5DMRA 4FZYA 4BR2A 2P9SA 3HRGA 1F21A 2IDOA 3KK3A 4HHTA 4I2QA 4FLVA 3K5OA 3OW2M 2WFBA 3PSIA 2G8IA 1SV5A 1NGGA 2B5JA 2GWJA 2FXUA 2YJFA 2BUPA 5AFUH 4IKFA 4E1MA 3FLCO 2OPPA 1RCHA 3GBTA 4BGBA 3PX0A 4XH1A 2FBYA 1NGHA 1XC3A 2QWMA 4FL9A 1Q7YO 3BF3A 1WBBA 4CEFA 5IT9O 4DQQA 5EU7A 4CE9A 3ENOA 1VSDA 2IGIA 1TV6A 2ASPA 4EP4A 4M3WA 3PO5A 3IG1A 4B9TA 3WT0A 2W41A 3MEGA 1KVCA 5FRNA 4N5SA 2YNFA 3VQCA 3AO1A 2WONA 1EQYA 3CD6N 4WQ4A 1ATRA 1W0HA 1BOTO 5KGWA 2A41A 4FWKA 4K8XA 3CCSN 3WEEA 3G0ZA 4F3OA 1Z6RA 1HNVA 4CZLA 4M3YA 3AY9A 4LF9K 4DTMA 4DTOA 1QVGM 4IFEA 1J5OA 3PIPL 3WEEB 4DUYK 4DS5A 1RT5A 4KB0A 3CETA 4LFBK 1I39A 1E4FT 4H0TB 3CCQN 1VRUA 1T8EA 3THYB 4YHHK 2QXLA 1T44A 4H0XB 3G6EN 4CEBA 1ZYQA 2OPRA 1S3XA 4FWMA 4CK1A 1QSSA 5KTQA 1U6ZA 1GLDG 3HJFA 2RE2A 1NGAA 4AHCA 3S9HA 3WNHA 4O0IA 4CHZA 2OZSA 2GUPA 5AZJA 4OJRA 3KD5E 2G8UA 1NWKA 1K8KB 5LL6Z 4CFCA 4E7JA 3M3ZA 1GLBG 4AM7A 4DR6K 1RBRA 4CGDA 3IAYA 5CZ1A
chains in the Genus database with same CATH topology
3LPTA 3AVFA 3TAMA 4DSJA 4CHNA 3CM6A 4LSLA 1A5VA 1XI1A 1RT4A 1NK9A 3LP3A 1U45A 3ZSXA 1NJZA 3DLKA 2XHBA 4FLUA 3ZT4A 1KSPA 3ZT2A 3O3GA 4CGFA 4CJPA 4AHRA 4FLTA 4EZ6A 1VSLA 2KFNA 1QSYA 1HYVA 3CM5A 4B3OA 3AVAA 3B6PA 1S1XA 3QERA 4FW1A 3PX6A 2P5GA 5K14A 4BE2A 2F96A 1LWCA 1CZ9A 3T1AA 3LP0A 2O4IA 3I0SA 4OKKA 4AHSA 3L2WA 3HVTA 4F4KA 5SWMA 3S3OA 4J2DA 1X9MA 3ZSZA 5D3GA 3U3GA 4DSKA 1U4BA 1WLJA 2WOMA 4YFUA 4FVMA 2GV9A 4KTZA 3AV9A 3WNEA 2KTQA 4DFKA 4FJ7A 4E0DA 4FZXC 1U04A 4FLXA 4M3ZA 2HHSA 4KV8A 1NOZA 2FBVA 3OYLA 3RR7A 4PUOA 4CERA 3DOKA 4OVLA 4KI4A 4M41A 3DLBA 2KZZA 1RT2A 4CFBA 4I2PA 3QO9A 1L3SA 4J2BA 4FYDA 3DYAA 3ZSQA 5KRSA 2QKKA 4C8KA 2X6NA 3OYKA 4CEOA 3NH1A 1SL0A 2IS3A 3CQ8A 3C95A 4NCAA 1S1UA 3HK2A 3LDSA 1REVA 5JS2A 3VQ7A 3LWMA 1U49A 4JRQA 3KLEA 1TK0A 3AVIA 1BQNA 3QLHA 4FJMA 1TAQA 1RT1A 4LH4A 5J2MA 1UA0A 1IG9A 3EY1A 1RBUA 4C8NA 1NKBA 5C24A 3TANA 1SKSA 1KCFA 4CF2A 4OKJA 3PO4A 2DY4A 1BHLA 4PA1A 1QQCA 1RTDA 4CHQA 3ZT3A 3NF7A 2JGUA 4I9QA 4OKEA 4RW4A 2DTUA 3CG7A 2OPSA 3K58A 2GBZA 2RPIA 4CESA 4B9UA 4IG3A 4CEEA 3K5LA 1IKYA 2FBTA 4NYNA 3VQAA 3V9UA 2DFHA 3KLHA 1NK6A 3ZT0A 4ELUA 5E41A 5HBMA 3VA3A 2HHTA 5KGXA 3V1RA 1UA1A 3OYGA 3L3UA 5J1EA 3OVNA 2HW3A 3AVLA 2YNGA 4BE0A 3SZ2A 4IFVA 1HPZA 4HUGA 1J54A 4ELVA 1XC9A 5CY4A 1VSJA 4CJSA 4EP5A 3AVGA 5HRNA 3U3YA 3SUQA 4DQPA 4C8OA 4I7FA 3RTVA 3QNNA 4FJIA 2B4JA 4CEDA 3HXMA 1UOCA 1RTIA 4B8AB 3K5NA 4M42A 3AO4A 1A5XA 4BDYA 3DRSA 4NYFA 1QE1A 3RWUA 2A1SA 3PX4A 1VSIA 4HTUA 3F9KA 4KHNA 1NJXA 4GVMA 1L3TA 4KREA 1VSEA 4Y1CA 3OS2A 3PV8A 1K6YA 4M45A 1T03A 1SKRA 1LV5A 3RRGA 1O1WA 2KQ2A 3TAEA 2BDPA 3VQ9A 1NOYA 3AA5X 1B9FA 4LY7A 4N41A 3PUFA 4B08A 3IS9A 3DI6A 3KJVA 3SYZA 2A1RA 4M3TA 3MEEA 4PWDA 3OYNA 3SQ2A 1C1AA 3V9WA 2W42A 1FKPA 2D0BA 2X78A 4DSEA 3OYFA 3TR8A 5HP1A 3TAFA 4KKOA 2AJQA 3V9ZA 3SV3A 2B6AA 3AO2A 4CF8A 4Q0BA 1JLGA 1WNSA 1XHXA 4DU3A 3KD1E 4E3SA 3KK2A 3TAQA 3SQ4A 2ITGA 1B9DA 4CJQA 3BDPA 1KTQA 4YNQA 1W9HA 5I3UA 4KB1A 3T3FA 4CGGA 1NK7A 1U48A 2YHAA 3OYDA 2Z1IA 4ELTA 2ZE2A 1Q8IA 4AHVA 1LAWA 2IOCA 4O0JA 3LWLA 2XRIA 4DFJA 2RF2A 3DLRA 1T7PA 4FM2A 4CK2A 4DTPA 1RDDA 2G8HA 1NK5A 3VQQA 3LZJA 1WSIA 4CJWA 4CEAA 4F2RA 2F8SA 1IO2A 4HCBA 4PQUA 3A2FA 3VQ6A 3NFAA 4BE1A 3HPOA 2Y1JA 3TARA 1RDBA 2ETJA 4HVJA 3ZCMA 3MECA 4Z4FA 4F2SA 3V1QA 4GW6A 2Z1JA 3WNFA 1S9GA 3E01A 3HO1A 3PY8A 4DG1A 1S6QA 4BACA 3KKSA 2KZMA 3OYIA 4KAZA 3NBPA 1S1TA 4RW9A 1YTAA 4C8LA 1TGOA 4DU4A 4CJ3A 1VK0A 4E89A 5JS1A 1EP4A 4CIEA 1RTHA 4B9VA 4AILC 1UWBA 1TKDA 2HNZA 3CYMA 4DTJA 4CF0A 1HQEA 3K5MA 4H8KA 3VN5A 3NAEA 1HJRA 5HRSA 1D9DA 3L3VA 1C1BA 1DTTA 3VQEA 4W5QA 2HHQA 3NF8A 3DLEA 2OZMA 4NCGA 4IG0A 3LANA 1TL3A 3SCXA 4B9NA 4ICLA 3L2UA 1Q9XA 3G10A 2YHBA 4M3XA 4RW6A 1J53A 4CHOA 3O4QA 3V81A 4Z4EA 1VRTA 4CJKA 2VWJA 3AA3A 1J9AA 4CHPA 3KLGA 4LD0A 1C0MA 4DTRA 4KHYA 3TWHA 3OJUA 3AA4A 1IKWA 4CECA 4R5PA 3F73A 4OLAA 3WNGA 1BQMA 3AVMA 4TSXA 5J2PA 1QTMA 3V4IA 1TAUA 1WAJA 4ZTJA 4CJ5A 4CF9A 1KRPA 4FLZA 1N6QA 2HMIA 1Q9YA 1TKTA 3BGRA 4AHTA 2G8FA 3AO5A 2G8KA 2HVHA 3VQ4A 1XHZA 1RBTA 1QSLA 3MAQA 1VSHA 3EZ5A 4QCLA 3SI6A 1Z25A 4CJ4A 1ZBHA 4WE1A 1C0UA 1RTJA 1JXBA 1WSHA 1RT6A 4N47A 2XY5A 2VG5A 2HHVA 1B92A 3EYZA 2HVIA 2D0AA 4ID5A 3C6TA 3QINA 5CZ2A 4DF4A 1KLNA 3OYBA 4RW7A 3TAPA 1JLAA 4OPJA 5DK5A 3HT3A 3RMCA 4KHWA 1ASWA 4B9LA 1C6VA 4KTQA 4FLWA 3L2VA 3UIQA 1S1WA 4KI6A 1WAFA 2YNHA 4CJUA 3MXJA 1MU2A 4BWMA 1C0TA 3K59A 1KVBA 2XY8A 2FC0A 1CXQA 2I5JA 3CFPA 1RNHA 3O3HA 4FJXA 4FLYA 1L5UA 4N76A 2X74A 3VQ8A 4B9MA 4FXDA 3I0RA 3ULDA 3KTQA 2Z1HA 4FK0A 4E7LA 1NKCA 4M3UA 4DF8A 3TI0A 1EETA 1BGXT 4ID1A 4HUFA 1DTQA 4DS4A 1X9SA 3DMJA 3K57A 3QEPA 4GMJB 4CFAA 4W5OA 3ITHA 4OGEA 4AH9A 4DSFA 4DWIA 3QEXA 1NJWA 3C94A 4BWJA 2OA8A 3NDKA 1HNIA 4Z4HA 3D0PA 3NGZA 2QK9A 1IKXA 4CGJA 4Z4CA 4B8CA 4J2EA 3RR8A 4CJRA 2P1JA 4N56A 3O3FA 2R7YA 1EX4A 5HROA 1IH7A 4CIGA 3L2RA 3QIPA 4O44A 3M8QA 4Y1DA 3SUOA 3DM2A 1T05A 4E7KA 3NF6A 5HRPA 2RKIA 3M8SA 4JS5A 3AVCA 4J2AA 3HPGA 4CJEA 4CHYA 2HHWA 1U47A 3VA0A 1HRHA 4KRFA 3LAKA 3CFRA 1JLFA 2Y1IA 4FM0A 3TAGA 1BIZA 1RDAA 3QEIA 3VQDA 4DTSA 2HHXA 2X6SA 4QOZB 3QESA 1RT3A 4F8RA 3SQ0A 3V9SA 3CFOA 5SZTA 3KKRA 3MXIA 3AA2A 1IKVA 2VG7A 3K2PA 3P83D 2G8WA 1A5WA 2NUBA 5FROA 5C42A 4DQRA 1TL1A 4B9SA 1YVUA 3RMBA 4E7IA 5C25A 2PZSA 2XY6A 3ZSWA 4CEQA 3V9XA 3SQ1A 3HVRA 1TK5A 3LZIA 4DLGA 2IAJA 1KLMA 3LPUA 1N5YA 1C1CA 1L3VA 3ASMA 4OPKA 5T7BA 4HUEA 1CLQA 4CK3A 2BANA 4FJHA 1VSKA 2QKBA 3HYFA 1RBSA 2BE2A 3QIOA 4FM1A 1ITGA 1R0AA 4DSIA 1LWEA 1WN7A 2P5OA 3SPZA 2XO7A 4CJFA 4FJGA 1LWFA 3T19A 3HL8A 1NK4A 4BDPA 1S9EA 3IRXA 2GUIA 4OGCA 4DTUA 2EHGA 4CJTA 4FJKA 3OYJA 1BISA 1KFDA 2YKNA 4LH5A 3SUPA 1GOBA 1L3UA 1ASUA 3HSTB 3KLIA 3NF9A 4E19A 1BCOA 3OS0A 3KLFA 2IC3A 3TABA 3O4NA 3SNNA 1ASVA 1I3AA 1XWLA 3MEDA 1Z26A 5CYMA 4FZZA 5CYQA 3NH2A 1KFSA 2G8VA 1X1PA 3S3NA 2HB5A 3OJSA 3NHGA 1HMVA 1WSGA 1S6PA 4XIUA 5HLFA 1SKWA 2P51A 1VSFA 3DRRA 4IBNA 4FJ5A 3RMAA 1D9FA 4IFYA 3DRPA 1BL3A 1Y97A 3H08A 3OY9A 4E1NA 3D45A 3DLGA 2PY5A 1FKOA 3HM9A 5DMRA 3KIOA 3RMDA 2PYJA 4BDZA 4FZYA 4W5TA 3AVHA 4PY5A 3P1GA 4CJLA 4CF1A 4DTXA 1NK0A 1F21A 2IDOA 3KK3A 4KPYA 5FDLA 4HHTA 3SJJA 3SPYA 1LW2A 3M8PA 3AVNA 4I2QA 1TKXA 2HNDA 1JL2A 3K5OA 4O4GA 4FLVA 4DFMA 1BCMA 3VQBA 1WSFA 1JLBA 4CIFA 4DQSA 4HCCA 1NK8A 3V1OA 3OYAA 2G8IA 5KI6A 4JS4A 1SV5A 1SL2A 2DFEA 3OS1A 3V6DA 2B5JA 2HNYA 3KK1A 3ZSRA 1CXUA 1QS4A 3AVBA 1JLQA 4IDKA 4IKFA 4E1MA 2F8TA 1HQUA 1TKZA 1X9WA 2OPPA 3ZSVA 3ISNC 3OYCA 3HPHA 4NCBA 1RCHA 3JSMA 5KRTA 1HYSA 3NGIA 4MFBA 4KO0A 3ZSYA 3PX0A 2ZQBA 2FBYA 4Z4GA 1D8YA 3NE6A 3VQ5A 3SUNA 1JLCA 1LAVA 1GOAA 1ZBUA 3SV4A 3I8DA 2E6LA 4DFPA 2Z1GA 2LSNA 4CEFA 4DQQA 2D5RA 3HP6A 4E7HA 1RDCA 4W5RA 5EU7A 4ZTFA 4CE9A 3M8RA 3L8BA 2FBXA 4MQ3A 5I42A 1NJYA 1SL1A 4L8RB 4KTWA 1VSDA 2IGIA 1TV6A 4M3WA 4EP4A 1S5JA 3PO5A 1YT3A 1JL1A 1BIUA 3IG1A 1LW0A 4H4MA 5HRRA 4B9TA 1ZBFA 1KVCA 2ATQA 3MEGA 4Q5VA 3NH0A 4DLEA 4N5SA 2YNFA 4DQIA 2ZD1A 1RILA 3ZT1A 2VG6A 3NGYA 3VQCA 3RRHA 3AO1A 5FRMA 3AVJA 2WONA 2YNIA 3LAMA 4CGIA 4Z0UA 3QEWA 4I9LA 4FK4A 1JLEA 1W0HA 1VSMA 4AHUA 5KGWA 4ZHRA 3S3MA 2HHUA 1GOCA 2JLEA 4KFBA 1TVRA 3ALYA 4K8XA 3DLHA 3VQPA 4FK2A 1BI4B 3G0ZA 2RN2A 1SUQA 1UAXA 1G15A 4F3OA 3OYHA 1HNVA 3QNOA 4DTNA 4M3YA 4UQGA 4FJLA 1DLOA 2KFZA 4RW8A 3JYTA 4CFDA 4DTMA 1YTUA 2YKMA 4DTOA 4EZ9A 1NKEA 1WSJA 4FJ9A 4QAGA 1J5OA 1BI4A 2DFFA 1CZBA 2EX3A 1FXXA 4FJJA 2D0CA 3AVKA 4RG8A 4CGHA 4DS5A 2YV0X 4FJNA 3LP2A 1RT5A 2KW4A 4FCYA 4KB0A 4JLHA 1TK8A 1D5AA 4KHQA 4KHUA 2QXFA 1I39A 3LALA 4CEZA 1VRUA 4OLBA 1T8EA 2OPQA 3QEVA 2Q3SA 2E4LA 3QETA 3OYMA 1FK9A 2E6MA 4FJ8A 4F3TA 4G1QA 1JKHA 3ZSOA 4O5BA 4O55A 3FFIA 4CEBA 1ZYQA 2OPRA 4DU1A 1RBVA 4CK1A 3NCIA 3LP1A 4JRPA 1RT7A 1QSSA 1KVAA 4W5NA 5KTQA 4DSLA 1ZBIA 3HJFA 3THVA 1EXQA 2VWKA 2OYQA 4CJVA 3L2QA 4C8MA 1EKEA 3HP9A 3P5JA 4AHCA 3S9HA 5FRNA 5J2NA 2BGGA 3WNHA 4O0IA 4H4OA 4M3RA 4CHZA 2OZSA 4OJRA 2O4GA 1HYZA 4Z4IA 3KD5E 2G8UA 1ZBLA 3DOLA 4KHSA 3B6OA 4K8ZA 4CFCA 1QHTA 3MXMA 1WSEA 4CCHA 4E7JA 4LSNA 1JXEA 1RBRA 2PYLA 4CGDA 4FW2A 3OYEA 3IAYA 3AO3A 4DMNA 1S1VA 2XY7A 3U6FA 5CZ1A 5J2QA 3C6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPT A;  3AVF A;  3TAM A;  4DSJ A;  4CHN A;  3CM6 A;  4LSL A;  1A5V A;  1XI1 A;  1RT4 A;  1NK9 A;  3LP3 A;  1U45 A;  3ZSX A;  1NJZ A;  3DLK A;  2XHB A;  4FLU A;  3ZT4 A;  1KSP A;  3ZT2 A;  3O3G A;  4CGF A;  4CJP A;  4AHR A;  4FLT A;  4EZ6 A;  1VSL A;  2KFN A;  1QSY A;  1HYV A;  3CM5 A;  4B3O A;  3AVA A;  3B6P A;  1S1X A;  3QER A;  4FW1 A;  3PX6 A;  2P5G A;  5K14 A;  4BE2 A;  2F96 A;  1LWC A;  1CZ9 A;  3T1A A;  3LP0 A;  2O4I A;  3I0S A;  4OKK A;  4AHS A;  3L2W A;  3HVT A;  4F4K A;  5SWM A;  3S3O A;  4J2D A;  1X9M A;  3ZSZ A;  5D3G A;  3U3G A;  4DSK A;  1U4B A;  1WLJ A;  2WOM A;  4YFU A;  4FVM A;  2GV9 A;  4KTZ A;  3AV9 A;  3WNE A;  2KTQ A;  4DFK A;  4FJ7 A;  4E0D A;  4FZX C;  1U04 A;  4FLX A;  4M3Z A;  2HHS A;  4KV8 A;  1NOZ A;  2FBV A;  3OYL A;  3RR7 A;  4PUO A;  4CER A;  3DOK A;  4OVL A;  4KI4 A;  4M41 A;  3DLB A;  2KZZ A;  1RT2 A;  4CFB A;  4I2P A;  3QO9 A;  1L3S A;  4J2B A;  4FYD A;  3DYA A;  3ZSQ A;  5KRS A;  2QKK A;  4C8K A;  2X6N A;  3OYK A;  4CEO A;  3NH1 A;  1SL0 A;  2IS3 A;  3CQ8 A;  3C95 A;  4NCA A;  1S1U A;  3HK2 A;  3LDS A;  1REV A;  5JS2 A;  3VQ7 A;  3LWM A;  1U49 A;  4JRQ A;  3KLE A;  1TK0 A;  3AVI A;  1BQN A;  3QLH A;  4FJM A;  1TAQ A;  1RT1 A;  4LH4 A;  5J2M A;  1UA0 A;  1IG9 A;  3EY1 A;  1RBU A;  4C8N A;  1NKB A;  5C24 A;  3TAN A;  1SKS A;  1KCF A;  4CF2 A;  4OKJ A;  3PO4 A;  2DY4 A;  1BHL A;  4PA1 A;  1QQC A;  1RTD A;  4CHQ A;  3ZT3 A;  3NF7 A;  2JGU A;  4I9Q A;  4OKE A;  4RW4 A;  2DTU A;  3CG7 A;  2OPS A;  3K58 A;  2GBZ A;  2RPI A;  4CES A;  4B9U A;  4IG3 A;  4CEE A;  3K5L A;  1IKY A;  2FBT A;  4NYN A;  3VQA A;  3V9U A;  2DFH A;  3KLH A;  1NK6 A;  3ZT0 A;  4ELU A;  5E41 A;  5HBM A;  3VA3 A;  2HHT A;  5KGX A;  3V1R A;  1UA1 A;  3OYG A;  3L3U A;  5J1E A;  3OVN A;  2HW3 A;  3AVL A;  2YNG A;  4BE0 A;  3SZ2 A;  4IFV A;  1HPZ A;  4HUG A;  1J54 A;  4ELV A;  1XC9 A;  5CY4 A;  1VSJ A;  4CJS A;  4EP5 A;  3AVG A;  5HRN A;  3U3Y A;  3SUQ A;  4DQP A;  4C8O A;  4I7F A;  3RTV A;  3QNN A;  4FJI A;  2B4J A;  4CED A;  3HXM A;  1UOC A;  1RTI A;  4B8A B;  3K5N A;  4M42 A;  3AO4 A;  1A5X A;  4BDY A;  3DRS A;  4NYF A;  1QE1 A;  3RWU A;  2A1S A;  3PX4 A;  1VSI A;  4HTU A;  3F9K A;  4KHN A;  1NJX A;  4GVM A;  1L3T A;  4KRE A;  1VSE A;  4Y1C A;  3OS2 A;  3PV8 A;  1K6Y A;  4M45 A;  1T03 A;  1SKR A;  1LV5 A;  3RRG A;  1O1W A;  2KQ2 A;  3TAE A;  2BDP A;  3VQ9 A;  1NOY A;  3AA5 X;  1B9F A;  4LY7 A;  4N41 A;  3PUF A;  4B08 A;  3IS9 A;  3DI6 A;  3KJV A;  3SYZ A;  2A1R A;  4M3T A;  3MEE A;  4PWD A;  3OYN A;  3SQ2 A;  1C1A A;  3V9W A;  2W42 A;  1FKP A;  2D0B A;  2X78 A;  4DSE A;  3OYF A;  3TR8 A;  5HP1 A;  3TAF A;  4KKO A;  2AJQ A;  3V9Z A;  3SV3 A;  2B6A A;  3AO2 A;  4CF8 A;  4Q0B A;  1JLG A;  1WNS A;  1XHX A;  4DU3 A;  3KD1 E;  4E3S A;  3KK2 A;  3TAQ A;  3SQ4 A;  2ITG A;  1B9D A;  4CJQ A;  3BDP A;  1KTQ A;  4YNQ A;  1W9H A;  5I3U A;  4KB1 A;  3T3F A;  4CGG A;  1NK7 A;  1U48 A;  2YHA A;  3OYD A;  2Z1I A;  4ELT A;  2ZE2 A;  1Q8I A;  4AHV A;  1LAW A;  2IOC A;  4O0J A;  3LWL A;  2XRI A;  4DFJ A;  2RF2 A;  3DLR A;  1T7P A;  4FM2 A;  4CK2 A;  4DTP A;  1RDD A;  2G8H A;  1NK5 A;  3VQQ A;  3LZJ A;  1WSI A;  4CJW A;  4CEA A;  4F2R A;  2F8S A;  1IO2 A;  4HCB A;  4PQU A;  3A2F A;  3VQ6 A;  3NFA A;  4BE1 A;  3HPO A;  2Y1J A;  3TAR A;  1RDB A;  2ETJ A;  4HVJ A;  3ZCM A;  3MEC A;  4Z4F A;  4F2S A;  3V1Q A;  4GW6 A;  2Z1J A;  3WNF A;  1S9G A;  3E01 A;  3HO1 A;  3PY8 A;  4DG1 A;  1S6Q A;  4BAC A;  3KKS A;  2KZM A;  3OYI A;  4KAZ A;  3NBP A;  1S1T A;  4RW9 A;  1YTA A;  4C8L A;  1TGO A;  4DU4 A;  4CJ3 A;  1VK0 A;  4E89 A;  5JS1 A;  1EP4 A;  4CIE A;  1RTH A;  4B9V A;  4AIL C;  1UWB A;  1TKD A;  2HNZ A;  3CYM A;  4DTJ A;  4CF0 A;  1HQE A;  3K5M A;  4H8K A;  3VN5 A;  3NAE A;  1HJR A;  5HRS A;  1D9D A;  3L3V A;  1C1B A;  1DTT A;  3VQE A;  4W5Q A;  2HHQ A;  3NF8 A;  3DLE A;  2OZM A;  4NCG A;  4IG0 A;  3LAN A;  1TL3 A;  3SCX A;  4B9N A;  4ICL A;  3L2U A;  1Q9X A;  3G10 A;  2YHB A;  4M3X A;  4RW6 A;  1J53 A;  4CHO A;  3O4Q A;  3V81 A;  4Z4E A;  1VRT A;  4CJK A;  2VWJ A;  3AA3 A;  1J9A A;  4CHP A;  3KLG A;  4LD0 A;  1C0M A;  4DTR A;  4KHY A;  3TWH A;  3OJU A;  3AA4 A;  1IKW A;  4CEC A;  4R5P A;  3F73 A;  4OLA A;  3WNG A;  1BQM A;  3AVM A;  4TSX A;  5J2P A;  1QTM A;  3V4I A;  1TAU A;  1WAJ A;  4ZTJ A;  4CJ5 A;  4CF9 A;  1KRP A;  4FLZ A;  1N6Q A;  2HMI A;  1Q9Y A;  1TKT A;  3BGR A;  4AHT A;  2G8F A;  3AO5 A;  2G8K A;  2HVH A;  3VQ4 A;  1XHZ A;  1RBT A;  1QSL A;  3MAQ A;  1VSH A;  3EZ5 A;  4QCL A;  3SI6 A;  1Z25 A;  4CJ4 A;  1ZBH A;  4WE1 A;  1C0U A;  1RTJ A;  1JXB A;  1WSH A;  1RT6 A;  4N47 A;  2XY5 A;  2VG5 A;  2HHV A;  1B92 A;  3EYZ A;  2HVI A;  2D0A A;  4ID5 A;  3C6T A;  3QIN A;  5CZ2 A;  4DF4 A;  1KLN A;  3OYB A;  4RW7 A;  3TAP A;  1JLA A;  4OPJ A;  5DK5 A;  3HT3 A;  3RMC A;  4KHW A;  1ASW A;  4B9L A;  1C6V A;  4KTQ A;  4FLW A;  3L2V A;  3UIQ A;  1S1W A;  4KI6 A;  1WAF A;  2YNH A;  4CJU A;  3MXJ A;  1MU2 A;  4BWM A;  1C0T A;  3K59 A;  1KVB A;  2XY8 A;  2FC0 A;  1CXQ A;  2I5J A;  3CFP A;  1RNH A;  3O3H A;  4FJX A;  4FLY A;  1L5U A;  4N76 A;  2X74 A;  3VQ8 A;  4B9M A;  4FXD A;  3I0R A;  3ULD A;  3KTQ A;  2Z1H A;  4FK0 A;  4E7L A;  1NKC A;  4M3U A;  4DF8 A;  3TI0 A;  1EET A;  1BGX T;  4ID1 A;  4HUF A;  1DTQ A;  4DS4 A;  1X9S A;  3DMJ A;  3K57 A;  3QEP A;  4GMJ B;  4CFA A;  4W5O A;  3ITH A;  4OGE A;  4AH9 A;  4DSF A;  4DWI A;  3QEX A;  1NJW A;  3C94 A;  4BWJ A;  2OA8 A;  3NDK A;  1HNI A;  4Z4H A;  3D0P A;  3NGZ A;  2QK9 A;  1IKX A;  4CGJ A;  4Z4C A;  4B8C A;  4J2E A;  3RR8 A;  4CJR A;  2P1J A;  4N56 A;  3O3F A;  2R7Y A;  1EX4 A;  5HRO A;  1IH7 A;  4CIG A;  3L2R A;  3QIP A;  4O44 A;  3M8Q A;  4Y1D A;  3SUO A;  3DM2 A;  1T05 A;  4E7K A;  3NF6 A;  5HRP A;  2RKI A;  3M8S A;  4JS5 A;  3AVC A;  4J2A A;  3HPG A;  4CJE A;  4CHY A;  2HHW A;  1U47 A;  3VA0 A;  1HRH A;  4KRF A;  3LAK A;  3CFR A;  1JLF A;  2Y1I A;  4FM0 A;  3TAG A;  1BIZ A;  1RDA A;  3QEI A;  3VQD A;  4DTS A;  2HHX A;  2X6S A;  4QOZ B;  3QES A;  1RT3 A;  4F8R A;  3SQ0 A;  3V9S A;  3CFO A;  5SZT A;  3KKR A;  3MXI A;  3AA2 A;  1IKV A;  2VG7 A;  3K2P A;  3P83 D;  2G8W A;  1A5W A;  2NUB A;  5FRO A;  5C42 A;  4DQR A;  1TL1 A;  4B9S A;  1YVU A;  3RMB A;  4E7I A;  5C25 A;  2PZS A;  2XY6 A;  3ZSW A;  4CEQ A;  3V9X A;  3SQ1 A;  3HVR A;  1TK5 A;  3LZI A;  4DLG A;  2IAJ A;  1KLM A;  3LPU A;  1N5Y A;  1C1C A;  1L3V A;  3ASM A;  4OPK A;  5T7B A;  4HUE A;  1CLQ A;  4CK3 A;  2BAN A;  4FJH A;  1VSK A;  2QKB A;  3HYF A;  1RBS A;  2BE2 A;  3QIO A;  4FM1 A;  1ITG A;  1R0A A;  4DSI A;  1LWE A;  1WN7 A;  2P5O A;  3SPZ A;  2XO7 A;  4CJF A;  4FJG A;  1LWF A;  3T19 A;  3HL8 A;  1NK4 A;  4BDP A;  1S9E A;  3IRX A;  2GUI A;  4OGC A;  4DTU A;  2EHG A;  4CJT A;  4FJK A;  3OYJ A;  1BIS A;  1KFD A;  2YKN A;  4LH5 A;  3SUP A;  1GOB A;  1L3U A;  1ASU A;  3HST B;  3KLI A;  3NF9 A;  4E19 A;  1BCO A;  3OS0 A;  3KLF A;  2IC3 A;  3TAB A;  3O4N A;  3SNN A;  1ASV A;  1I3A A;  1XWL A;  3MED A;  1Z26 A;  5CYM A;  4FZZ A;  5CYQ A;  3NH2 A;  1KFS A;  2G8V A;  1X1P A;  3S3N A;  2HB5 A;  3OJS A;  3NHG A;  1HMV A;  1WSG A;  1S6P A;  4XIU A;  5HLF A;  1SKW A;  2P51 A;  1VSF A;  3DRR A;  4IBN A;  4FJ5 A;  3RMA A;  1D9F A;  4IFY A;  3DRP A;  1BL3 A;  1Y97 A;  3H08 A;  3OY9 A;  4E1N A;  3D45 A;  3DLG A;  2PY5 A;  1FKO A;  3HM9 A;  5DMR A;  3KIO A;  3RMD A;  2PYJ A;  4BDZ A;  4FZY A;  4W5T A;  3AVH A;  4PY5 A;  3P1G A;  4CJL A;  4CF1 A;  4DTX A;  1NK0 A;  1F21 A;  2IDO A;  3KK3 A;  4KPY A;  5FDL A;  4HHT A;  3SJJ A;  3SPY A;  1LW2 A;  3M8P A;  3AVN A;  4I2Q A;  1TKX A;  2HND A;  1JL2 A;  3K5O A;  4O4G A;  4FLV A;  4DFM A;  1BCM A;  3VQB A;  1WSF A;  1JLB A;  4CIF A;  4DQS A;  4HCC A;  1NK8 A;  3V1O A;  3OYA A;  2G8I A;  5KI6 A;  4JS4 A;  1SV5 A;  1SL2 A;  2DFE A;  3OS1 A;  3V6D A;  2B5J A;  2HNY A;  3KK1 A;  3ZSR A;  1CXU A;  1QS4 A;  3AVB A;  1JLQ A;  4IDK A;  4IKF A;  4E1M A;  2F8T A;  1HQU A;  1TKZ A;  1X9W A;  2OPP A;  3ZSV A;  3ISN C;  3OYC A;  3HPH A;  4NCB A;  1RCH A;  3JSM A;  5KRT A;  1HYS A;  3NGI A;  4MFB A;  4KO0 A;  3ZSY A;  3PX0 A;  2ZQB A;  2FBY A;  4Z4G A;  1D8Y A;  3NE6 A;  3VQ5 A;  3SUN A;  1JLC A;  1LAV A;  1GOA A;  1ZBU A;  3SV4 A;  3I8D A;  2E6L A;  4DFP A;  2Z1G A;  2LSN A;  4CEF A;  4DQQ A;  2D5R A;  3HP6 A;  4E7H A;  1RDC A;  4W5R A;  5EU7 A;  4ZTF A;  4CE9 A;  3M8R A;  3L8B A;  2FBX A;  4MQ3 A;  5I42 A;  1NJY A;  1SL1 A;  4L8R B;  4KTW A;  1VSD A;  2IGI A;  1TV6 A;  4M3W A;  4EP4 A;  1S5J A;  3PO5 A;  1YT3 A;  1JL1 A;  1BIU A;  3IG1 A;  1LW0 A;  4H4M A;  5HRR A;  4B9T A;  1ZBF A;  1KVC A;  2ATQ A;  3MEG A;  4Q5V A;  3NH0 A;  4DLE A;  4N5S A;  2YNF A;  4DQI A;  2ZD1 A;  1RIL A;  3ZT1 A;  2VG6 A;  3NGY A;  3VQC A;  3RRH A;  3AO1 A;  5FRM A;  3AVJ A;  2WON A;  2YNI A;  3LAM A;  4CGI A;  4Z0U A;  3QEW A;  4I9L A;  4FK4 A;  1JLE A;  1W0H A;  1VSM A;  4AHU A;  5KGW A;  4ZHR A;  3S3M A;  2HHU A;  1GOC A;  2JLE A;  4KFB A;  1TVR A;  3ALY A;  4K8X A;  3DLH A;  3VQP A;  4FK2 A;  1BI4 B;  3G0Z A;  2RN2 A;  1SUQ A;  1UAX A;  1G15 A;  4F3O A;  3OYH A;  1HNV A;  3QNO A;  4DTN A;  4M3Y A;  4UQG A;  4FJL A;  1DLO A;  2KFZ A;  4RW8 A;  3JYT A;  4CFD A;  4DTM A;  1YTU A;  2YKM A;  4DTO A;  4EZ9 A;  1NKE A;  1WSJ A;  4FJ9 A;  4QAG A;  1J5O A;  1BI4 A;  2DFF A;  1CZB A;  2EX3 A;  1FXX A;  4FJJ A;  2D0C A;  3AVK A;  4RG8 A;  4CGH A;  4DS5 A;  2YV0 X;  4FJN A;  3LP2 A;  1RT5 A;  2KW4 A;  4FCY A;  4KB0 A;  4JLH A;  1TK8 A;  1D5A A;  4KHQ A;  4KHU A;  2QXF A;  1I39 A;  3LAL A;  4CEZ A;  1VRU A;  4OLB A;  1T8E A;  2OPQ A;  3QEV A;  2Q3S A;  2E4L A;  3QET A;  3OYM A;  1FK9 A;  2E6M A;  4FJ8 A;  4F3T A;  4G1Q A;  1JKH A;  3ZSO A;  4O5B A;  4O55 A;  3FFI A;  4CEB A;  1ZYQ A;  2OPR A;  4DU1 A;  1RBV A;  4CK1 A;  3NCI A;  3LP1 A;  4JRP A;  1RT7 A;  1QSS A;  1KVA A;  4W5N A;  5KTQ A;  4DSL A;  1ZBI A;  3HJF A;  3THV A;  1EXQ A;  2VWK A;  2OYQ A;  4CJV A;  3L2Q A;  4C8M A;  1EKE A;  3HP9 A;  3P5J A;  4AHC A;  3S9H A;  5FRN A;  5J2N A;  2BGG A;  3WNH A;  4O0I A;  4H4O A;  4M3R A;  4CHZ A;  2OZS A;  4OJR A;  2O4G A;  1HYZ A;  4Z4I A;  3KD5 E;  2G8U A;  1ZBL A;  3DOL A;  4KHS A;  3B6O A;  4K8Z A;  4CFC A;  1QHT A;  3MXM A;  1WSE A;  4CCH A;  4E7J A;  4LSN A;  1JXE A;  1RBR A;  2PYL A;  4CGD A;  4FW2 A;  3OYE A;  3IAY A;  3AO3 A;  4DMN A;  1S1V A;  2XY7 A;  3U6F A;  5CZ1 A;  5J2Q A;  3C6U A; 
#chains in the Genus database with same CATH topology
 3LPT A;  1KAY A;  3AVF A;  1Q18 A;  3LDL A;  5AQS A;  2QM1 A;  4H03 B;  3LP3 A;  3ZSX A;  4JKG B;  1NJZ A;  3DLK A;  3ZT4 A;  2UXB K;  3O3G A;  4CJP A;  4H5W A;  4B3O A;  1S1X A;  3PX6 A;  2P5G A;  3NVK A;  1R59 O;  5K14 A;  3LP0 A;  4AHS A;  3L2W A;  3HVT A;  1N32 K;  4KHP K;  4JI6 K;  4XH4 A;  1WLJ A;  4YFU A;  3CCR N;  3ULE A;  4DFK A;  4ILH A;  4FLX A;  2WUS A;  4FZX C;  4CD3 A;  4CER A;  5LJW A;  4CFB A;  2FLO A;  1HPM A;  3ULE B;  4J2B A;  5C15 A;  2X6N A;  3NH1 A;  2IS3 A;  4B3R K;  1S1U A;  3HK2 A;  3LWM A;  3KLE A;  1BQN A;  3D2E B;  1MA9 B;  3TTC A;  1TAQ A;  1UA0 A;  5J2M A;  3EY1 A;  4BR0 A;  4JD2 B;  4C8N A;  4WFN L;  1BA1 A;  4OKJ A;  2DY4 A;  2UYT A;  4PA1 A;  1RTD A;  3CMA N;  2DTU A;  2CH5 A;  4NYN A;  2QWP A;  4CZI A;  5LJV A;  3O9S A;  1UA1 A;  1LOT B;  5B8H A;  3AVL A;  4YOX A;  2A6A A;  1OH6 A;  2HW3 A;  5AQH A;  4JAX A;  1J54 A;  5CY4 A;  4CZG A;  2P9S B;  1GLA G;  4I7F A;  3RTV A;  2B4J A;  4B1U B;  4CBW A;  1YAG A;  4M42 A;  3AO4 A;  3UKR A;  3DRS A;  4DV4 K;  1VSI A;  5GAG P;  2CGJ A;  1LV5 A;  2BDP A;  3AA5 X;  4JK8 A;  1B9F A;  4LY7 A;  3CCM N;  3THX B;  4M3T A;  3MEE A;  2OTJ N;  1K8K A;  4O8U A;  2W42 A;  4AQY K;  2D0B A;  2KKZ A;  3TR8 A;  4BG8 A;  4CBU A;  3TAF A;  5HOO A;  3V9Z A;  2B6A A;  4CF8 A;  5LMU K;  1JLG A;  1XHX A;  4EAH D;  4DU3 A;  4E3S A;  3TAQ A;  3SQ4 A;  1ZXO A;  3J8A A;  5KQD A;  2VQE K;  4HWI A;  1U48 A;  2YHA A;  2ZE2 A;  1Q8I A;  3DXM A;  1LAW A;  3C0B A;  2VGM A;  3LWL A;  2XRI A;  4DFJ A;  1J5E K;  4FM2 A;  1I94 K;  1RDD A;  3O5B A;  1NK5 A;  3VQQ A;  4GKJ K;  4PQU A;  4LC9 B;  5FPD A;  3A2F A;  3VQ6 A;  3NFA A;  4DV5 K;  3HPO A;  4BE1 A;  2Y1J A;  1JJ2 M;  1VQ5 N;  4IO8 A;  1NGD A;  4Z4F A;  3WXK A;  3RSE B;  3ZET A;  4GW6 A;  2H3G X;  2IVO A;  2Z1J A;  4FWP A;  3PY8 A;  3KKS A;  3EEQ A;  4DU4 A;  5JS1 A;  4E89 A;  4JI3 K;  4CIE A;  4BRD A;  1UWB A;  2HNZ A;  5GIN A;  4DTJ A;  3SBG A;  5HRS A;  1DTT A;  3VQE A;  4W5Q A;  1IJJ A;  2HHQ A;  4NCG A;  2D4W A;  2QTD A;  4ICL A;  2UUB K;  3L2U A;  3CJ1 A;  2O8B B;  5C2D A;  4CHO A;  2E2N A;  5BPL A;  2FF3 B;  2VWJ A;  1J9A A;  4KH5 A;  4CHP A;  5C10 A;  4DTR A;  4KHY A;  5ADX H;  3OJU A;  3LDP A;  3VET A;  4CEC A;  4R5P A;  4OLA A;  3G4S N;  3WNG A;  5AQI A;  3WXI A;  4QS9 A;  5AQR A;  1GLC G;  4OO1 J;  2QW9 A;  3I8B A;  4CF9 A;  3GDQ A;  4MLE A;  1Q82 O;  4LF5 K;  2W6L A;  3BGR A;  4X65 K;  3VQ4 A;  1ESV A;  1VSH A;  4CW7 B;  1ZBH A;  4WE1 A;  4MO4 A;  4YOW A;  2HVI A;  4YDU C;  3OYB A;  1JLA A;  5DK5 A;  3HT3 A;  4UY8 O;  3RMC A;  1ASW A;  4JEP A;  5FPM A;  3K59 A;  3LDQ A;  1KVB A;  1Q81 O;  3WUH A;  1CXQ A;  1U2V B;  4BR9 A;  1RNH A;  3CFP A;  1L5U A;  2X74 A;  3QB0 A;  4DV6 K;  3U4L A;  3QDK A;  4E7L A;  4M3U A;  4YY3 K;  1EET A;  4HUF A;  1EWR A;  1VHX A;  3DMJ A;  3QEP A;  4OGE A;  4AH9 A;  4FSV A;  3C94 A;  1HNI A;  4Z4H A;  3D0P A;  2JWL A;  2NRT A;  4B8C A;  4J2E A;  3O8M A;  3FZH A;  1QQN A;  4CIG A;  3M8Q A;  2P9N A;  3ZX0 A;  1YJN N;  2RKI A;  3M8S A;  3HPG A;  4CJE A;  5JMV A;  1NGJ A;  4H0Y B;  4YDU A;  2E8A A;  3BZK A;  4FM0 A;  4OX9 K;  1BIZ A;  1RDA A;  3VQD A;  2HHX A;  2X6S A;  3P4I A;  4F8R A;  3SQ0 A;  5AQG A;  4WQ4 C;  3K9J A;  1IKV A;  2VG7 A;  3P83 D;  1A5W A;  5C42 A;  3D7E O;  3VTI A;  1TL1 A;  3CC4 N;  4B9S A;  3RMB A;  4U7B A;  5C25 A;  2XY6 A;  5AQX A;  4NXM K;  4CEQ A;  3V9X A;  3SQ1 A;  3VMF B;  5BN9 A;  4DLG A;  2IAJ A;  4EHU A;  1C1C A;  3WXJ A;  3UE5 A;  1QVF M;  1RBS A;  4FM1 A;  4JKG A;  3DXM B;  4H5R A;  2XO7 A;  3E1Y A;  1NGE A;  1LWF A;  2ASM A;  2A5X A;  4H5N A;  3O08 A;  2E2O A;  2GUI A;  4OGC A;  3MMV A;  3OYJ A;  2RHK A;  3DWL A;  2YKN A;  1N34 K;  5TKY A;  1BCO A;  3OS0 A;  4JV5 K;  3KLF A;  3SNN A;  5HL7 L;  3ZET B;  1K73 O;  1KFS A;  3C7N B;  1HNX K;  4JN4 A;  3ZX3 A;  2ZJQ L;  1DEJ A;  2G8V A;  4IJA A;  5F2R A;  3NHG A;  3OA9 A;  4B1V A;  2HMP A;  4XIU A;  5HLF A;  3O80 A;  1E4G T;  2HOE A;  3HBT A;  3RMA A;  2YI1 A;  4IFY A;  4YOV A;  1D9F A;  3OY9 A;  3D45 A;  4DB3 A;  3AAR A;  5AQL A;  3ATV A;  3KIO A;  5BR9 A;  3JAM O;  3P1G A;  3CIP A;  4YOY A;  2I7N A;  4CF1 A;  1NK0 A;  2QWR A;  3AVN A;  4DFM A;  5TKW A;  1WSF A;  1JLB A;  4DQS A;  5AJ3 K;  4GV6 A;  3V1O A;  5KI6 A;  4PKG A;  2P9K B;  2HNY A;  3ZSR A;  3AVB A;  1JLQ A;  1HQU A;  2NRZ A;  3BUZ B;  3BZC A;  3OYC A;  5GIO A;  2AA4 A;  3U9Z A;  3OTO K;  3ZSY A;  2ITM A;  3NE6 A;  3SUN A;  1LAV A;  5AZI B;  3O9T A;  1HKC A;  4B9Q A;  3W0L A;  3JS6 A;  3CCV N;  3O6W A;  2FSK A;  3HP6 A;  4E7H A;  1RDC A;  4BRK A;  5DM7 L;  4ZTF A;  3L8B A;  4FWS A;  2FBX A;  5I9E B;  5AQU A;  5C2F A;  1JL1 A;  1BIU A;  4C8L A;  1ZBF A;  2ATQ A;  3NH0 A;  2ZF5 O;  3ZT1 A;  3CCL N;  3AVJ A;  3I56 N;  3VTH A;  4NLB A;  3SMP A;  4CGI A;  3QEW A;  3ENB A;  4AHU A;  1GOC A;  3VQP A;  1M90 O;  1UAX A;  3OYH A;  4JK7 A;  4UQG A;  4FJL A;  1DLO A;  1QZ5 A;  4JI7 K;  1YUW A;  5LMN K;  1YTU A;  1NKE A;  1X3M A;  4QAG A;  3CPE A;  2DFF A;  4O5F A;  3C6A A;  4RG8 A;  2D0C A;  3AVK A;  4KH4 A;  3BF1 A;  4FJN A;  2O8C A;  4H5V A;  4JLH A;  4KHQ A;  2ZJR L;  3C65 A;  5BRF A;  3LAL A;  4A5A A;  4AF1 A;  4OLB A;  2OCE A;  2OPQ A;  5C12 A;  3SJH A;  3OYM A;  1JKH A;  4C1N I;  4O55 A;  2AP1 A;  4W5N A;  4MDA A;  4DSL A;  3THV A;  1EXQ A;  3L2Q A;  3P5J A;  1OKJ A;  3R8E A;  3ZYY X;  3DOL A;  1VQO N;  3GL1 A;  4K8Z A;  1QHT A;  3MXM A;  4LSN A;  2PYL A;  3CI5 A;  2P9I B;  4B3S K;  3CJ7 A;  4DMN A;  4DV2 K;  3VES A;  3VEN A;  1YF5 L;  4DSJ A;  3MX2 A;  3VEO A;  3CM6 A;  5JVH L;  1HNZ K;  4LSL A;  2UUA K;  1A5V A;  4FWQ A;  2HBK A;  4FLU A;  4EZ6 A;  3O9R A;  4CGF A;  1VSL A;  1HKB A;  3TTF A;  3AVA A;  3D2E A;  3B6P A;  1GLE G;  2ZGY A;  3FZF A;  1QQM A;  1LWC A;  1CZ9 A;  4GKK K;  3I0S A;  3FR0 A;  3S3O A;  4J2D A;  3ZX2 A;  5M1Q A;  3ZSZ A;  1X9M A;  1U4B A;  2GV9 A;  3TTD A;  3WNE A;  1NG9 A;  2HHS A;  1NOZ A;  2FBV A;  3OYL A;  3RR7 A;  4PUO A;  5CE3 A;  3CCU N;  4JK9 A;  3DOK A;  4KI4 A;  4BR5 A;  4M41 A;  1VQ4 N;  3QBW A;  3QO9 A;  4FYD A;  3DYA A;  3P38 A;  4C8K A;  3OYK A;  4CEO A;  3C95 A;  5BPM A;  4NCA A;  3LDS A;  4DR2 K;  3VQ7 A;  4IO9 L;  3AVI A;  3QLH A;  3CJC A;  1RT1 A;  2Q2R A;  3TAN A;  1SKS A;  1KCF A;  3LDO A;  2P9U A;  3PO4 A;  3D2F A;  4CI6 A;  3F9M A;  4CHQ A;  3NF7 A;  4I9Q A;  3O1B A;  3RVC A;  3CG7 A;  2OPS A;  2UXD K;  4CES A;  4B9U A;  4CEE A;  2FBT A;  2CGK A;  3WXL A;  2ASO A;  2YJE A;  4OPA A;  5IWA K;  2YHX A;  3EO3 A;  3ZT0 A;  3VA3 A;  4FOE A;  3V1R A;  1VQ6 N;  3UKU A;  4JHD B;  5AQY A;  4BE0 A;  4ELV A;  1HPZ A;  5KPZ A;  3FZL A;  4EP5 A;  4DQP A;  3BY5 A;  5FPN A;  3QNN A;  3OHR A;  4CED A;  1N36 K;  1UOC A;  5GAE P;  3F9K A;  3J7A P;  4KRE A;  1VSE A;  3RRG A;  3PV8 A;  1K6Y A;  4FO0 A;  3LM2 A;  1O1W A;  3VQ9 A;  2E1Z A;  3PUF A;  3SYZ A;  4NB4 A;  4DV7 K;  4HTL A;  1OH8 A;  1BU6 O;  3OYN A;  3SQ2 A;  1KQS M;  1FKP A;  2X78 A;  5AQO A;  4B3M K;  5HP1 A;  2AJQ A;  4BC3 A;  3K9K A;  3AO2 A;  3MX5 A;  1B9D A;  4MLH A;  3SK3 A;  4CJQ A;  3EKU A;  3BDP A;  1W9H A;  5H1S Q;  5I3U A;  3T3F A;  1NK7 A;  4GVE A;  4JKB A;  3I55 N;  1OH5 A;  2D0P A;  4K25 A;  4O0J A;  3MN6 A;  2RF2 A;  3TSP A;  4CK2 A;  2G8H A;  3R6M A;  3LZJ A;  4G9Z A;  3T1Y K;  1WUA A;  4BQZ A;  3TAR A;  2YHW A;  5JLH A;  2NRH A;  3ZCM A;  3E9L A;  1XUP O;  1MWM A;  2O8F A;  3V1Q A;  1XNQ K;  3H1V X;  1S9G A;  3E01 A;  4A2B A;  3KWI A;  3OYI A;  4KAZ A;  3NBP A;  4RW9 A;  4CJ3 A;  1VK0 A;  1RFQ A;  3A5L C;  5AZI A;  4AIL C;  3H1Q A;  3NAE A;  3CCE N;  3M5R A;  1D9D A;  3L3V A;  1C1B A;  2KHO A;  3R9P A;  2O8C B;  3SCX A;  2GEL A;  3G10 A;  1J53 A;  1TUU A;  3LM9 A;  3O4Q A;  5BR8 K;  3V81 A;  4CJK A;  3KLG A;  3TWH A;  4ILJ A;  4H0V B;  1IKW A;  1BUP A;  2HBM A;  4CJ7 A;  4A59 A;  3AVM A;  4TSX A;  1MWK A;  5J2P A;  3V4I A;  1WAJ A;  2P9P B;  1KRP A;  4M7X A;  1Q9Y A;  3GOI A;  4AHT A;  2G8F A;  4BR7 A;  4QCL A;  4B1W B;  3HM8 A;  4EIA A;  2YHY A;  1C0U A;  1RTJ A;  2QWO A;  2XY5 A;  4DR3 K;  2VG5 A;  3WQT A;  3MN9 A;  1B92 A;  2D0A A;  5BN8 A;  3QIN A;  4OPJ A;  4JI1 K;  4PL8 A;  3TSU A;  3L2V A;  1WAF A;  1T6C A;  3O1W A;  2FC0 A;  3MK6 A;  2I5J A;  4N76 A;  4FLY A;  4B9M A;  3ULD A;  3ZEU B;  3CF5 L;  3DLL L;  4ID1 A;  4BR4 A;  4X66 K;  4GMJ B;  4JI4 K;  4DWI A;  5EX5 A;  1NJW A;  2OA8 A;  4BWJ A;  2QK9 A;  1SAZ A;  3H3N O;  4JI0 K;  4CJR A;  2P1J A;  5KPT A;  4N56 A;  5JVG L;  3J7Z O;  1W7A A;  3L2R A;  3NF6 A;  2QI2 A;  4CHY A;  3KWG A;  2HHW A;  1SS6 A;  1U47 A;  2F7T A;  3VA0 A;  1HRH A;  2V51 B;  3CFR A;  3TAG A;  3QEI A;  4FOI A;  4QOZ B;  1RT3 A;  3WQU A;  2CGL A;  3V9S A;  3A0I X;  5SZT A;  3MXI A;  3AA2 A;  3K2P A;  5FRO A;  4DQR A;  5AQF A;  4E7I A;  4GV9 A;  3ZSW A;  4BRQ A;  4DR7 K;  1KAX A;  3VF6 A;  1KLM A;  1C0G A;  3LPU A;  1N5Y A;  4BVO A;  1L3V A;  4HUE A;  5T7B A;  3L4Q A;  1CLQ A;  2BAN A;  4FJH A;  3HYF A;  1R0A A;  2BE2 A;  3THY A;  1LWE A;  3E66 A;  3SAH A;  4CJF A;  1NK4 A;  3IRX A;  2NRW A;  1KFD A;  2P9U B;  1L3U A;  4LFC K;  1ASU A;  3HST B;  3KLI A;  4E19 A;  1HR0 K;  3KZB A;  3PSF A;  1ASV A;  1I3A A;  1XWL A;  1J6Z A;  1Z26 A;  5CYM A;  4FZZ A;  1XMO K;  1VQK N;  1X1P A;  3KK7 A;  2HB5 A;  3OJS A;  4YOU A;  3CJA A;  1S6P A;  5AFU A;  3DRR A;  3F5T A;  1TUY A;  5AQJ A;  3DLG A;  3HM9 A;  4BDZ A;  4W5T A;  4CJL A;  4DTX A;  2I7P A;  1YI2 N;  1LW2 A;  4O4G A;  1TKX A;  2HND A;  1JL2 A;  1BCM A;  4EFH A;  4CIF A;  4HCC A;  4IEE A;  3UKR B;  3OYA A;  2QEX N;  3V6D A;  3U8X A;  3KK1 A;  1X3N A;  1CXU A;  1QS4 A;  4IDK A;  3IKM A;  5BRD A;  3WXM B;  4BRA A;  3O4W A;  3ZSV A;  1LCU A;  3NGI A;  2PFU A;  3FFK B;  1D4X A;  4CZE A;  2E88 A;  1YVN A;  1KD1 O;  3ZEU A;  5KPR A;  4K0K K;  3SV4 A;  1CZA N;  3I8D A;  2O8E A;  1GLJ O;  4W5R A;  2V52 B;  3CJ9 A;  4JI5 K;  3M8R A;  3B8A X;  5I42 A;  3J7Y P;  1NJY A;  1NJI O;  1SL1 A;  3E9O A;  2HF4 A;  3EZW A;  2IVN A;  4H4M A;  2A40 A;  5HRR A;  2QKB A;  3VOV A;  2ZD1 A;  4DQ8 A;  3RRH A;  2VG6 A;  2P9L A;  2YNI A;  4IEI A;  4Z0U A;  3P39 A;  4CZH A;  1NM1 A;  4ZHR A;  3S3M A;  1TVR A;  3ALY A;  5M1K A;  2P9P A;  1S72 N;  4FK2 A;  1BI4 B;  5M1F A;  4BRM A;  1SUQ A;  3HSC A;  1G15 A;  3QNO A;  4DTN A;  2F4V K;  1GLF O;  2E2P A;  2QA4 N;  4LF7 K;  2YKM A;  1WSJ A;  4FJ9 A;  1BI4 A;  2EX3 A;  4MDB A;  4FJJ A;  3OBY A;  4CGH A;  3FZM A;  4M63 C;  5M1N A;  1TK8 A;  1D5A A;  4GV3 A;  4KHU A;  4JKE A;  2E4L A;  4LF6 K;  4FJ8 A;  2E6M A;  4IDH A;  4F3T A;  2VGN A;  3FFI A;  4IOX A;  1T3V A;  4BRO A;  4GY2 B;  3NCI A;  3LP1 A;  1RT7 A;  2NLX A;  5AQK A;  1ZBI A;  4CJV A;  5BRH A;  1E3M A;  1NLV A;  4BC5 A;  1HYZ A;  3E9P A;  3LDN A;  4CZJ A;  1ZBL A;  3B6O A;  4IXC A;  3I33 A;  1WSE A;  4CCH A;  4FW2 A;  3OYE A;  3AO3 A;  1NGF A;  4PHT X;  3EE8 A;  3VF4 A;  2P9N B;  3G25 A;  3P31 A;  1NGI A;  4CBX A;  4DR5 K;  3ID8 A;  1KSP A;  3ZT2 A;  3CXC M;  3DJC A;  2KFN A;  4AHR A;  4FLT A;  1QSY A;  3TSQ A;  1WBD A;  3QER A;  4FW1 A;  5BRE A;  4BRI A;  3T1A A;  4DV0 K;  1IBM K;  1DKG D;  5D3G A;  3J80 O;  2UUC K;  2WOM A;  1Z05 A;  4FVM A;  4KTZ A;  4M3Z A;  4FJ7 A;  4E0D A;  1U04 A;  1YIJ N;  2FSN A;  4OVL A;  3DLB A;  4WF9 L;  1RT2 A;  3M6G A;  4I2P A;  3IMX A;  5KRS A;  4BRL A;  1REV A;  1U49 A;  4A5B A;  1IG9 A;  1RBU A;  1NKB A;  4A62 A;  1BHL A;  3ZT3 A;  2V7Z A;  3VGK A;  3VF2 A;  2GBZ A;  2RPI A;  3VEX A;  5M1O A;  4NXN K;  3VQA A;  4B1X B;  4ELU A;  5HBM A;  2HHT A;  5J1E A;  3OVN A;  4I6M A;  2YNG A;  3EKS A;  3SZ2 A;  4IFV A;  4CJS A;  3U3Y A;  1GLL O;  5KQ8 A;  3SUQ A;  4C8O A;  4DR4 K;  4PKH A;  4FJI A;  3HXM A;  3N4P A;  3K5N A;  1K9M O;  4BDY A;  2CH6 A;  3D2F B;  1QE1 A;  2A1S A;  4HTU A;  3VEW A;  4KHN A;  4GVM A;  1VQM N;  4Y1C A;  3OS2 A;  3TAE A;  1NOY A;  4B08 A;  3IS9 A;  3DI6 A;  4Z94 A;  3KJV A;  2A1R A;  1KC8 O;  4JKD A;  4RWT A;  3CCJ N;  2QWL A;  5EXW A;  3UKU B;  4F9O A;  3OYF A;  1NU0 A;  3ENH A;  3IUC A;  4H5T A;  3NVM A;  5CHI A;  4KKO A;  1XQS C;  1V4T A;  5AQW A;  3SV3 A;  2O8D B;  4I6M B;  1VQL N;  1WNS A;  4IZ9 A;  4ISE A;  5A2Q O;  3ZLJ A;  5AQN A;  4ISF A;  3IFR A;  1KTQ A;  4YNQ A;  4Y0W A;  3H6E A;  2Z1I A;  2ZJP L;  2P9L B;  4AHV A;  3AAP A;  3HI0 A;  2W6K A;  3DLR A;  1T7P A;  1DT9 A;  3MCA B;  1WSI A;  4CJW A;  2D0O A;  4F2R A;  2F8S A;  4ILG B;  3GE1 A;  1RDB A;  3U9D A;  4WQ5 A;  4HVJ A;  3MEC A;  4F2S A;  2A3Z A;  4LFA K;  3HO1 A;  3C7N A;  3CPW M;  4BAC A;  3AAQ A;  2KZM A;  1YTA A;  1S22 A;  4BG9 A;  1RTH A;  4B9V A;  4K43 A;  4WFA L;  4DV1 K;  1TYQ B;  1HQE A;  3K5M A;  4DCH A;  3VN5 A;  1HJR A;  3NMU A;  3CQX A;  2OZM A;  3MWT A;  1OVQ A;  1TL3 A;  2EWS A;  4FWL A;  5FLX O;  4DR1 K;  2YHB A;  4M3X A;  5JIC A;  4Z4E A;  4BRH A;  4LD0 A;  4PL7 A;  1ZBS A;  3AA4 A;  2E2Q A;  5GIP A;  1BQM A;  3T69 A;  1QTM A;  1TAU A;  4K42 A;  4ZTJ A;  4CJ5 A;  4FLZ A;  1TKT A;  2G8K A;  5AR0 A;  1QSL A;  3MAQ A;  3EL2 A;  3IDH A;  1Z25 A;  3QFP A;  2ZWH A;  1JXB A;  4H0O A;  1RT6 A;  4N47 A;  4GNI A;  2HBL A;  1KLN A;  3TAP A;  4IWV A;  1C6V A;  1O13 A;  4FLW A;  3UIQ A;  3KHY A;  2YNH A;  3MXJ A;  1MU2 A;  4BWM A;  2XY8 A;  3R3L A;  3O3H A;  3EN9 A;  4QS7 A;  5E26 A;  3I0R A;  3CME N;  4FK0 A;  4DF8 A;  1BGX T;  4DV3 K;  4DS4 A;  1DTQ A;  5AQP A;  4CFA A;  4W5O A;  3ITH A;  4DSF A;  1NMN A;  2GTD A;  3QEX A;  3NDK A;  3NGZ A;  1IKX A;  4Z4C A;  1QQO A;  1FW6 A;  1FJG K;  3O3F A;  1EX4 A;  5HRO A;  1IH7 A;  4Y1D A;  3Q7C A;  4E7K A;  5HRP A;  4JS5 A;  2PAV A;  3QIC A;  2Y1I A;  2Q0U A;  4BRN A;  4JD2 A;  3QES A;  2O8F B;  3CFO A;  4CZK A;  3KKR A;  2NUB A;  3F2K A;  4BRC A;  1YVU A;  3BEX A;  3SAG A;  2Q1N A;  4FPA A;  3LZI A;  1YHQ N;  2BTF A;  4XEI A;  1NNE A;  4CK3 A;  1VSK A;  3QIO A;  1NMD A;  1ITG A;  2O8B A;  3SMS A;  1WN7 A;  3SPZ A;  1BWF O;  2E20 A;  1YJW N;  3HL8 A;  2HF3 A;  1S9E A;  3GG4 A;  4DTU A;  2EHG A;  1WOQ A;  4CJT A;  2Q36 A;  4E1J A;  2FSJ A;  3JXU A;  3SUP A;  1JCE A;  2IC3 A;  3TAB A;  3FGU A;  3O4N A;  2VYP A;  3MED A;  1BDG A;  5CYQ A;  3NH2 A;  3VGM A;  3SBT A;  3S3N A;  1HMV A;  1SQK A;  1WSG A;  4DUZ K;  4DKW A;  4IBN A;  4CZF A;  4FWN A;  4E1N A;  1FKO A;  3RMD A;  2PYJ A;  3CC2 N;  4PY5 A;  3A8Y A;  3AVH A;  4WFB L;  3J81 O;  1W2B M;  4KPY A;  5FDL A;  4R79 A;  1HKG A;  3SPY A;  3SJJ A;  3M8P A;  1RDU A;  3VQB A;  1ATS A;  1NK8 A;  3R1X A;  4JS4 A;  1ATN A;  4IOA L;  1SL2 A;  2DFE A;  4XH5 A;  3OS1 A;  1XNR K;  2Q31 A;  2F8T A;  1TKZ A;  1X9W A;  1MDU B;  2P9I A;  3ISN C;  3HPH A;  4NCB A;  3JSM A;  1HYS A;  4JKA A;  5KRT A;  4MFB A;  4KO0 A;  3VPZ A;  2ZQB A;  5GAD P;  1D8Y A;  4Z4G A;  3VQ5 A;  2OAN A;  1JLC A;  1GOA A;  1ZBU A;  3OBW A;  2E6L A;  4JNE A;  1ZC6 A;  4AM6 A;  4DFP A;  2Z1G A;  2LSN A;  2D5R A;  3QBX A;  3HOS A;  4MQ3 A;  1VQ7 N;  1H1V A;  4L8R B;  4KTW A;  3THX A;  3DAW A;  1S5J A;  1TYQ A;  1YT3 A;  1LW0 A;  3O9U A;  4Q5V A;  4DLE A;  4DQI A;  5FRM A;  1RIL A;  3NGY A;  4FWO A;  3LAM A;  1ILY A;  2OTL N;  2NNW A;  4I9L A;  4FK4 A;  1JLE A;  5AQV A;  3K0S A;  1VSM A;  1KAZ A;  2HHU A;  2JLE A;  3HZ6 A;  4KFB A;  3S41 A;  3DLH A;  4WQ5 C;  2RN2 A;  4MO5 A;  5EVZ A;  2BH1 A;  2VWB A;  2KFZ A;  4RW8 A;  3JYT A;  4CFD A;  3N4Q A;  4EZ9 A;  1NBW A;  3O9Q A;  1CZB A;  4KH6 A;  4BVP A;  1FXX A;  4BRF A;  1G99 A;  2YV0 X;  3LP2 A;  2KW4 A;  4FCY A;  4QS8 A;  4ISG A;  2GEM A;  3VEV A;  2QXF A;  4CEZ A;  4H0P A;  4FWR A;  3QEV A;  2Q3S A;  3PLA A;  3QET A;  1HX1 A;  1W97 L;  1FK9 A;  5DM6 L;  4G1Q A;  3ZSO A;  4O5B A;  3VEZ A;  4DU1 A;  1RBV A;  2WTU A;  2ZM6 K;  4JRP A;  1KVA A;  4YOR A;  4CZM A;  3AGR A;  2VWK A;  2OYQ A;  4C8M A;  1EKE A;  3HP9 A;  3ID6 A;  2BGG A;  2IVP A;  3HOT A;  5J2N A;  2FF6 A;  4H4O A;  4M3R A;  1IV0 A;  5MLC Q;  2O4G A;  4Z4I A;  4KHS A;  1EWQ A;  1VQ8 N;  1P8Z A;  1JXE A;  5ELZ A;  2XY7 A;  1S1V A;  3U6F A;  3TPQ A;  5J2Q A;  3C6U A;  1BA0 A;  1IG8 A;  3PIO L;  4FVU A;  3G71 N;  3TAM A;  4CHN A;  2P9K A;  1XMQ K;  2DPN A;  4BY9 C;  1XI1 A;  1RT4 A;  1NK9 A;  4JKH A;  1U45 A;  2XHB A;  1JCG A;  2ZGZ A;  1HYV A;  3FE1 A;  3CM5 A;  1QHA A;  3VER A;  4JI2 K;  4BE2 A;  1NGC A;  2NRX A;  2F96 A;  2O4I A;  1N33 K;  4OKK A;  5EOY A;  4BQL A;  4F4K A;  5SWM A;  1C0F A;  2WC9 A;  3U3G A;  4DSK A;  2KTQ A;  3AV9 A;  1NGB A;  3L0Q A;  1BO5 O;  4KV8 A;  4J8F A;  3THW A;  5AQZ A;  2KZZ A;  2O8E B;  2VCP A;  4BC4 A;  1L3S A;  3ZSQ A;  2QKK A;  1SL0 A;  4CD1 A;  4IOC L;  5GAH P;  3CQ8 A;  1RGI A;  5JS2 A;  3VEY A;  1YIT N;  4JRQ A;  1TK0 A;  4FJM A;  4LH4 A;  4V19 S;  3LL3 A;  4JI8 K;  1RDW X;  5C24 A;  1YXQ A;  4CF2 A;  3MN5 A;  3CHW A;  1QQC A;  2F9T A;  2JGU A;  1KXP A;  4OKE A;  4RW4 A;  3K58 A;  4DHY A;  4IG3 A;  3K5L A;  1IKY A;  3V9U A;  2DFH A;  3KLH A;  1NK6 A;  1M1K O;  3SLC A;  5E41 A;  4O8K A;  5KGX A;  3OYG A;  3L3U A;  5EY4 A;  1EO1 A;  4HUG A;  3KVG A;  3H46 O;  1XC9 A;  1VSJ A;  3CJB A;  3AVG A;  5HRN A;  2O8D A;  3L4I A;  1RTI A;  2A42 A;  2UXC K;  4B8A B;  4M7Y A;  5CR4 A;  1A5X A;  4NYF A;  3RWU A;  3PX4 A;  1NJX A;  1L3T A;  2W40 A;  1T03 A;  2QWN A;  4M45 A;  1SKR A;  2KQ2 A;  3AGK A;  4N41 A;  4C1N K;  1DGK N;  4PWD A;  1C1A A;  3V9W A;  1QZ6 A;  4DSE A;  3THW B;  1OVY A;  3MDQ A;  3T7Z A;  3Q7B A;  4FPB A;  4Q0B A;  2YX6 A;  3KD1 E;  3KK2 A;  2ITG A;  1N8R O;  4WCE L;  2V7Y A;  4PKI A;  5M1P A;  4KB1 A;  3H45 C;  4CGG A;  3OYD A;  3TU5 A;  4ELT A;  2Q0R A;  3M1F A;  2IOC A;  1VQN N;  4DTP A;  1SZ2 A;  3A5N C;  4CEA A;  1IO2 A;  4HCB A;  5F0X A;  2ETJ A;  4BRG A;  4JYA K;  1IBL K;  2E5L K;  3WNF A;  4DG1 A;  4LF4 K;  1S6Q A;  5E84 A;  1S1T A;  1Q86 O;  1JCF A;  1TGO A;  1EP4 A;  2HHH K;  1TKD A;  4CVN E;  3CYM A;  4CF0 A;  4JHD A;  4H8K A;  2E1Y A;  3H3O B;  3BP8 A;  2VQF K;  4A61 A;  3DXK B;  3NF8 A;  4BC2 A;  3DLE A;  3C6H A;  4IG0 A;  3W3D A;  3A5M C;  3LAN A;  4B9N A;  2WBN A;  1Q9X A;  4RW6 A;  1Y64 A;  1VRT A;  2D1K A;  3UB5 A;  3AA3 A;  5AZJ B;  1C0M A;  4RTF D;  2QWQ A;  5AQT A;  1U2V A;  5ADX A;  3F73 A;  2IIR A;  5LY3 A;  2Q97 A;  3MN7 A;  4BGA A;  4NLC A;  3CC7 N;  4B1Y B;  1N6Q A;  2HMI A;  3AO5 A;  2HVH A;  1XHZ A;  1RBT A;  3EZ5 A;  5FPE A;  3SI6 A;  3A5O C;  4CJ4 A;  1WSH A;  1HLU A;  2HHV A;  2YCH A;  4OPH A;  3EYZ A;  4ID5 A;  4DF4 A;  3C6T A;  3D6R A;  5CZ2 A;  4L3Q A;  2NRV A;  4RW7 A;  2GX9 A;  4KHW A;  1VQ9 N;  4B9L A;  4KTQ A;  3CER A;  4KI6 A;  1S1W A;  4CJU A;  1C0T A;  1IBK K;  4EHT A;  1VQP N;  4FJX A;  3VQ8 A;  5AQQ A;  3FZK A;  4FXD A;  3KTQ A;  2Z1H A;  1NKC A;  3TI0 A;  1X9J A;  1X9S A;  2J4R A;  3QFU A;  3K57 A;  4YOT A;  3SAF A;  1BG3 A;  4CGJ A;  3VGL A;  3RR8 A;  2KLA A;  3L6Q A;  2R7Y A;  1HUX A;  3QIP A;  4O44 A;  3SUO A;  2UU9 K;  3DM2 A;  1T05 A;  4BRE A;  3MCP A;  3AVC A;  4J2A A;  4NO7 A;  2GWK A;  2NZT A;  4JKC A;  4KRF A;  3LAK A;  1JLF A;  2PBD A;  5AQM A;  4DTS A;  4RCH A;  3HTV A;  3RSE A;  1P90 A;  2NRR A;  2G8W A;  1OH7 A;  1K8A O;  4C23 A;  4X62 K;  2PZS A;  1VAZ A;  3HVR A;  1TK5 A;  3ASM A;  4OPK A;  4DSI A;  1HJO A;  2P5O A;  4B3T K;  3CQY A;  4FJG A;  2JWK A;  3T19 A;  1WB9 A;  4BDP A;  5C0Y A;  4A57 A;  3DXK A;  4FJK A;  1BIS A;  4B1Z A;  1HNW K;  4LH5 A;  4LF8 K;  1T6D A;  1GOB A;  3MWP A;  3NF9 A;  4K41 A;  3ATU A;  3QML A;  4A2A A;  2HST A;  3EE9 A;  3T1H K;  5JLF A;  4KBO A;  4JKF A;  5F1X A;  4BRP A;  4IJN A;  2F9W A;  4X64 K;  5BPN A;  1YJ9 N;  4WYB A;  2HBJ A;  4FJ5 A;  4U67 L;  1SKW A;  2P51 A;  1VSF A;  3DRP A;  1BL3 A;  1Y97 A;  3H08 A;  1V4S A;  2PY5 A;  5DMR A;  4FZY A;  4BR2 A;  2P9S A;  3HRG A;  1F21 A;  2IDO A;  3KK3 A;  4HHT A;  4I2Q A;  4FLV A;  3K5O A;  3OW2 M;  2WFB A;  3PSI A;  2G8I A;  1SV5 A;  1NGG A;  2B5J A;  2GWJ A;  2FXU A;  2YJF A;  2BUP A;  5AFU H;  4IKF A;  4E1M A;  3FLC O;  2OPP A;  1RCH A;  3GBT A;  4BGB A;  3PX0 A;  4XH1 A;  2FBY A;  1NGH A;  1XC3 A;  2QWM A;  4FL9 A;  1Q7Y O;  3BF3 A;  1WBB A;  4CEF A;  5IT9 O;  4DQQ A;  5EU7 A;  4CE9 A;  3ENO A;  1VSD A;  2IGI A;  1TV6 A;  2ASP A;  4EP4 A;  4M3W A;  3PO5 A;  3IG1 A;  4B9T A;  3WT0 A;  2W41 A;  3MEG A;  1KVC A;  5FRN A;  4N5S A;  2YNF A;  3VQC A;  3AO1 A;  2WON A;  1EQY A;  3CD6 N;  4WQ4 A;  1ATR A;  1W0H A;  1BOT O;  5KGW A;  2A41 A;  4FWK A;  4K8X A;  3CCS N;  3WEE A;  3G0Z A;  4F3O A;  1Z6R A;  1HNV A;  4CZL A;  4M3Y A;  3AY9 A;  4LF9 K;  4DTM A;  4DTO A;  1QVG M;  4IFE A;  1J5O A;  3PIP L;  3WEE B;  4DUY K;  4DS5 A;  1RT5 A;  4KB0 A;  3CET A;  4LFB K;  1I39 A;  1E4F T;  4H0T B;  3CCQ N;  1VRU A;  1T8E A;  3THY B;  4YHH K;  2QXL A;  1T44 A;  4H0X B;  3G6E N;  4CEB A;  1ZYQ A;  2OPR A;  1S3X A;  4FWM A;  4CK1 A;  1QSS A;  5KTQ A;  1U6Z A;  1GLD G;  3HJF A;  2RE2 A;  1NGA A;  4AHC A;  3S9H A;  3WNH A;  4O0I A;  4CHZ A;  2OZS A;  2GUP A;  5AZJ A;  4OJR A;  3KD5 E;  2G8U A;  1NWK A;  1K8K B;  5LL6 Z;  4CFC A;  4E7J A;  3M3Z A;  1GLB G;  4AM7 A;  4DR6 K;  1RBR A;  4CGD A;  3IAY A;  5CZ1 A; 
#chains in the Genus database with same CATH homology
 3LPT A;  3AVF A;  3TAM A;  4DSJ A;  4CHN A;  3CM6 A;  4LSL A;  1A5V A;  1XI1 A;  1RT4 A;  1NK9 A;  3LP3 A;  1U45 A;  3ZSX A;  1NJZ A;  3DLK A;  2XHB A;  4FLU A;  3ZT4 A;  1KSP A;  3ZT2 A;  3O3G A;  4CGF A;  4CJP A;  4AHR A;  4FLT A;  4EZ6 A;  1VSL A;  2KFN A;  1QSY A;  1HYV A;  3CM5 A;  4B3O A;  3AVA A;  3B6P A;  1S1X A;  3QER A;  4FW1 A;  3PX6 A;  2P5G A;  5K14 A;  4BE2 A;  2F96 A;  1LWC A;  1CZ9 A;  3T1A A;  3LP0 A;  2O4I A;  3I0S A;  4OKK A;  4AHS A;  3L2W A;  3HVT A;  4F4K A;  5SWM A;  3S3O A;  4J2D A;  1X9M A;  3ZSZ A;  5D3G A;  3U3G A;  4DSK A;  1U4B A;  1WLJ A;  2WOM A;  4YFU A;  4FVM A;  2GV9 A;  4KTZ A;  3AV9 A;  3WNE A;  2KTQ A;  4DFK A;  4FJ7 A;  4E0D A;  4FZX C;  1U04 A;  4FLX A;  4M3Z A;  2HHS A;  4KV8 A;  1NOZ A;  2FBV A;  3OYL A;  3RR7 A;  4PUO A;  4CER A;  3DOK A;  4OVL A;  4KI4 A;  4M41 A;  3DLB A;  2KZZ A;  1RT2 A;  4CFB A;  4I2P A;  3QO9 A;  1L3S A;  4J2B A;  4FYD A;  3DYA A;  3ZSQ A;  5KRS A;  2QKK A;  4C8K A;  2X6N A;  3OYK A;  4CEO A;  3NH1 A;  1SL0 A;  2IS3 A;  3CQ8 A;  3C95 A;  4NCA A;  1S1U A;  3HK2 A;  3LDS A;  1REV A;  5JS2 A;  3VQ7 A;  3LWM A;  1U49 A;  4JRQ A;  3KLE A;  1TK0 A;  3AVI A;  1BQN A;  3QLH A;  4FJM A;  1TAQ A;  1RT1 A;  4LH4 A;  5J2M A;  1UA0 A;  1IG9 A;  3EY1 A;  1RBU A;  4C8N A;  1NKB A;  5C24 A;  3TAN A;  1SKS A;  1KCF A;  4CF2 A;  4OKJ A;  3PO4 A;  2DY4 A;  1BHL A;  4PA1 A;  1QQC A;  1RTD A;  4CHQ A;  3ZT3 A;  3NF7 A;  2JGU A;  4I9Q A;  4OKE A;  4RW4 A;  2DTU A;  3CG7 A;  2OPS A;  3K58 A;  2GBZ A;  2RPI A;  4CES A;  4B9U A;  4IG3 A;  4CEE A;  3K5L A;  1IKY A;  2FBT A;  4NYN A;  3VQA A;  3V9U A;  2DFH A;  3KLH A;  1NK6 A;  3ZT0 A;  4ELU A;  5E41 A;  5HBM A;  3VA3 A;  2HHT A;  5KGX A;  3V1R A;  1UA1 A;  3OYG A;  3L3U A;  5J1E A;  3OVN A;  2HW3 A;  3AVL A;  2YNG A;  4BE0 A;  3SZ2 A;  4IFV A;  1HPZ A;  4HUG A;  1J54 A;  4ELV A;  1XC9 A;  5CY4 A;  1VSJ A;  4CJS A;  4EP5 A;  3AVG A;  5HRN A;  3U3Y A;  3SUQ A;  4DQP A;  4C8O A;  4I7F A;  3RTV A;  3QNN A;  4FJI A;  2B4J A;  4CED A;  3HXM A;  1UOC A;  1RTI A;  4B8A B;  3K5N A;  4M42 A;  3AO4 A;  1A5X A;  4BDY A;  3DRS A;  4NYF A;  1QE1 A;  3RWU A;  2A1S A;  3PX4 A;  1VSI A;  4HTU A;  3F9K A;  4KHN A;  1NJX A;  4GVM A;  1L3T A;  4KRE A;  1VSE A;  4Y1C A;  3OS2 A;  3PV8 A;  1K6Y A;  4M45 A;  1T03 A;  1SKR A;  1LV5 A;  3RRG A;  1O1W A;  2KQ2 A;  3TAE A;  2BDP A;  3VQ9 A;  1NOY A;  3AA5 X;  1B9F A;  4LY7 A;  4N41 A;  3PUF A;  4B08 A;  3IS9 A;  3DI6 A;  3KJV A;  3SYZ A;  2A1R A;  4M3T A;  3MEE A;  4PWD A;  3OYN A;  3SQ2 A;  1C1A A;  3V9W A;  2W42 A;  1FKP A;  2D0B A;  2X78 A;  4DSE A;  3OYF A;  3TR8 A;  5HP1 A;  3TAF A;  4KKO A;  2AJQ A;  3V9Z A;  3SV3 A;  2B6A A;  3AO2 A;  4CF8 A;  4Q0B A;  1JLG A;  1WNS A;  1XHX A;  4DU3 A;  3KD1 E;  4E3S A;  3KK2 A;  3TAQ A;  3SQ4 A;  2ITG A;  1B9D A;  4CJQ A;  3BDP A;  1KTQ A;  4YNQ A;  1W9H A;  5I3U A;  4KB1 A;  3T3F A;  4CGG A;  1NK7 A;  1U48 A;  2YHA A;  3OYD A;  2Z1I A;  4ELT A;  2ZE2 A;  1Q8I A;  4AHV A;  1LAW A;  2IOC A;  4O0J A;  3LWL A;  2XRI A;  4DFJ A;  2RF2 A;  3DLR A;  1T7P A;  4FM2 A;  4CK2 A;  4DTP A;  1RDD A;  2G8H A;  1NK5 A;  3VQQ A;  3LZJ A;  1WSI A;  4CJW A;  4CEA A;  4F2R A;  2F8S A;  1IO2 A;  4HCB A;  4PQU A;  3A2F A;  3VQ6 A;  3NFA A;  4BE1 A;  3HPO A;  2Y1J A;  3TAR A;  1RDB A;  2ETJ A;  4HVJ A;  3ZCM A;  3MEC A;  4Z4F A;  4F2S A;  3V1Q A;  4GW6 A;  2Z1J A;  3WNF A;  1S9G A;  3E01 A;  3HO1 A;  3PY8 A;  4DG1 A;  1S6Q A;  4BAC A;  3KKS A;  2KZM A;  3OYI A;  4KAZ A;  3NBP A;  1S1T A;  4RW9 A;  1YTA A;  4C8L A;  1TGO A;  4DU4 A;  4CJ3 A;  1VK0 A;  4E89 A;  5JS1 A;  1EP4 A;  4CIE A;  1RTH A;  4B9V A;  4AIL C;  1UWB A;  1TKD A;  2HNZ A;  3CYM A;  4DTJ A;  4CF0 A;  1HQE A;  3K5M A;  4H8K A;  3VN5 A;  3NAE A;  1HJR A;  5HRS A;  1D9D A;  3L3V A;  1C1B A;  1DTT A;  3VQE A;  4W5Q A;  2HHQ A;  3NF8 A;  3DLE A;  2OZM A;  4NCG A;  4IG0 A;  3LAN A;  1TL3 A;  3SCX A;  4B9N A;  4ICL A;  3L2U A;  1Q9X A;  3G10 A;  2YHB A;  4M3X A;  4RW6 A;  1J53 A;  4CHO A;  3O4Q A;  3V81 A;  4Z4E A;  1VRT A;  4CJK A;  2VWJ A;  3AA3 A;  1J9A A;  4CHP A;  3KLG A;  4LD0 A;  1C0M A;  4DTR A;  4KHY A;  3TWH A;  3OJU A;  3AA4 A;  1IKW A;  4CEC A;  4R5P A;  3F73 A;  4OLA A;  3WNG A;  1BQM A;  3AVM A;  4TSX A;  5J2P A;  1QTM A;  3V4I A;  1TAU A;  1WAJ A;  4ZTJ A;  4CJ5 A;  4CF9 A;  1KRP A;  4FLZ A;  1N6Q A;  2HMI A;  1Q9Y A;  1TKT A;  3BGR A;  4AHT A;  2G8F A;  3AO5 A;  2G8K A;  2HVH A;  3VQ4 A;  1XHZ A;  1RBT A;  1QSL A;  3MAQ A;  1VSH A;  3EZ5 A;  4QCL A;  3SI6 A;  1Z25 A;  4CJ4 A;  1ZBH A;  4WE1 A;  1C0U A;  1RTJ A;  1JXB A;  1WSH A;  1RT6 A;  4N47 A;  2XY5 A;  2VG5 A;  2HHV A;  1B92 A;  3EYZ A;  2HVI A;  2D0A A;  4ID5 A;  3C6T A;  3QIN A;  5CZ2 A;  4DF4 A;  1KLN A;  3OYB A;  4RW7 A;  3TAP A;  1JLA A;  4OPJ A;  5DK5 A;  3HT3 A;  3RMC A;  4KHW A;  1ASW A;  4B9L A;  1C6V A;  4KTQ A;  4FLW A;  3L2V A;  3UIQ A;  1S1W A;  4KI6 A;  1WAF A;  2YNH A;  4CJU A;  3MXJ A;  1MU2 A;  4BWM A;  1C0T A;  3K59 A;  1KVB A;  2XY8 A;  2FC0 A;  1CXQ A;  2I5J A;  3CFP A;  1RNH A;  3O3H A;  4FJX A;  4FLY A;  1L5U A;  4N76 A;  2X74 A;  3VQ8 A;  4B9M A;  4FXD A;  3I0R A;  3ULD A;  3KTQ A;  2Z1H A;  4FK0 A;  4E7L A;  1NKC A;  4M3U A;  4DF8 A;  3TI0 A;  1EET A;  1BGX T;  4ID1 A;  4HUF A;  1DTQ A;  4DS4 A;  1X9S A;  3DMJ A;  3K57 A;  3QEP A;  4GMJ B;  4CFA A;  4W5O A;  3ITH A;  4OGE A;  4AH9 A;  4DSF A;  4DWI A;  3QEX A;  1NJW A;  3C94 A;  4BWJ A;  2OA8 A;  3NDK A;  1HNI A;  4Z4H A;  3D0P A;  3NGZ A;  2QK9 A;  1IKX A;  4CGJ A;  4Z4C A;  4B8C A;  4J2E A;  3RR8 A;  4CJR A;  2P1J A;  4N56 A;  3O3F A;  2R7Y A;  1EX4 A;  5HRO A;  1IH7 A;  4CIG A;  3L2R A;  3QIP A;  4O44 A;  3M8Q A;  4Y1D A;  3SUO A;  3DM2 A;  1T05 A;  4E7K A;  3NF6 A;  5HRP A;  2RKI A;  3M8S A;  4JS5 A;  3AVC A;  4J2A A;  3HPG A;  4CJE A;  4CHY A;  2HHW A;  1U47 A;  3VA0 A;  1HRH A;  4KRF A;  3LAK A;  3CFR A;  1JLF A;  2Y1I A;  4FM0 A;  3TAG A;  1BIZ A;  1RDA A;  3QEI A;  3VQD A;  4DTS A;  2HHX A;  2X6S A;  4QOZ B;  3QES A;  1RT3 A;  4F8R A;  3SQ0 A;  3V9S A;  3CFO A;  5SZT A;  3KKR A;  3MXI A;  3AA2 A;  1IKV A;  2VG7 A;  3K2P A;  3P83 D;  2G8W A;  1A5W A;  2NUB A;  5FRO A;  5C42 A;  4DQR A;  1TL1 A;  4B9S A;  1YVU A;  3RMB A;  4E7I A;  5C25 A;  2PZS A;  2XY6 A;  3ZSW A;  4CEQ A;  3V9X A;  3SQ1 A;  3HVR A;  1TK5 A;  3LZI A;  4DLG A;  2IAJ A;  1KLM A;  3LPU A;  1N5Y A;  1C1C A;  1L3V A;  3ASM A;  4OPK A;  5T7B A;  4HUE A;  1CLQ A;  4CK3 A;  2BAN A;  4FJH A;  1VSK A;  2QKB A;  3HYF A;  1RBS A;  2BE2 A;  3QIO A;  4FM1 A;  1ITG A;  1R0A A;  4DSI A;  1LWE A;  1WN7 A;  2P5O A;  3SPZ A;  2XO7 A;  4CJF A;  4FJG A;  1LWF A;  3T19 A;  3HL8 A;  1NK4 A;  4BDP A;  1S9E A;  3IRX A;  2GUI A;  4OGC A;  4DTU A;  2EHG A;  4CJT A;  4FJK A;  3OYJ A;  1BIS A;  1KFD A;  2YKN A;  4LH5 A;  3SUP A;  1GOB A;  1L3U A;  1ASU A;  3HST B;  3KLI A;  3NF9 A;  4E19 A;  1BCO A;  3OS0 A;  3KLF A;  2IC3 A;  3TAB A;  3O4N A;  3SNN A;  1ASV A;  1I3A A;  1XWL A;  3MED A;  1Z26 A;  5CYM A;  4FZZ A;  5CYQ A;  3NH2 A;  1KFS A;  2G8V A;  1X1P A;  3S3N A;  2HB5 A;  3OJS A;  3NHG A;  1HMV A;  1WSG A;  1S6P A;  4XIU A;  5HLF A;  1SKW A;  2P51 A;  1VSF A;  3DRR A;  4IBN A;  4FJ5 A;  3RMA A;  1D9F A;  4IFY A;  3DRP A;  1BL3 A;  1Y97 A;  3H08 A;  3OY9 A;  4E1N A;  3D45 A;  3DLG A;  2PY5 A;  1FKO A;  3HM9 A;  5DMR A;  3KIO A;  3RMD A;  2PYJ A;  4BDZ A;  4FZY A;  4W5T A;  3AVH A;  4PY5 A;  3P1G A;  4CJL A;  4CF1 A;  4DTX A;  1NK0 A;  1F21 A;  2IDO A;  3KK3 A;  4KPY A;  5FDL A;  4HHT A;  3SJJ A;  3SPY A;  1LW2 A;  3M8P A;  3AVN A;  4I2Q A;  1TKX A;  2HND A;  1JL2 A;  3K5O A;  4O4G A;  4FLV A;  4DFM A;  1BCM A;  3VQB A;  1WSF A;  1JLB A;  4CIF A;  4DQS A;  4HCC A;  1NK8 A;  3V1O A;  3OYA A;  2G8I A;  5KI6 A;  4JS4 A;  1SV5 A;  1SL2 A;  2DFE A;  3OS1 A;  3V6D A;  2B5J A;  2HNY A;  3KK1 A;  3ZSR A;  1CXU A;  1QS4 A;  3AVB A;  1JLQ A;  4IDK A;  4IKF A;  4E1M A;  2F8T A;  1HQU A;  1TKZ A;  1X9W A;  2OPP A;  3ZSV A;  3ISN C;  3OYC A;  3HPH A;  4NCB A;  1RCH A;  3JSM A;  5KRT A;  1HYS A;  3NGI A;  4MFB A;  4KO0 A;  3ZSY A;  3PX0 A;  2ZQB A;  2FBY A;  4Z4G A;  1D8Y A;  3NE6 A;  3VQ5 A;  3SUN A;  1JLC A;  1LAV A;  1GOA A;  1ZBU A;  3SV4 A;  3I8D A;  2E6L A;  4DFP A;  2Z1G A;  2LSN A;  4CEF A;  4DQQ A;  2D5R A;  3HP6 A;  4E7H A;  1RDC A;  4W5R A;  5EU7 A;  4ZTF A;  4CE9 A;  3M8R A;  3L8B A;  2FBX A;  4MQ3 A;  5I42 A;  1NJY A;  1SL1 A;  4L8R B;  4KTW A;  1VSD A;  2IGI A;  1TV6 A;  4M3W A;  4EP4 A;  1S5J A;  3PO5 A;  1YT3 A;  1JL1 A;  1BIU A;  3IG1 A;  1LW0 A;  4H4M A;  5HRR A;  4B9T A;  1ZBF A;  1KVC A;  2ATQ A;  3MEG A;  4Q5V A;  3NH0 A;  4DLE A;  4N5S A;  2YNF A;  4DQI A;  2ZD1 A;  1RIL A;  3ZT1 A;  2VG6 A;  3NGY A;  3VQC A;  3RRH A;  3AO1 A;  5FRM A;  3AVJ A;  2WON A;  2YNI A;  3LAM A;  4CGI A;  4Z0U A;  3QEW A;  4I9L A;  4FK4 A;  1JLE A;  1W0H A;  1VSM A;  4AHU A;  5KGW A;  4ZHR A;  3S3M A;  2HHU A;  1GOC A;  2JLE A;  4KFB A;  1TVR A;  3ALY A;  4K8X A;  3DLH A;  3VQP A;  4FK2 A;  1BI4 B;  3G0Z A;  2RN2 A;  1SUQ A;  1UAX A;  1G15 A;  4F3O A;  3OYH A;  1HNV A;  3QNO A;  4DTN A;  4M3Y A;  4UQG A;  4FJL A;  1DLO A;  2KFZ A;  4RW8 A;  3JYT A;  4CFD A;  4DTM A;  1YTU A;  2YKM A;  4DTO A;  4EZ9 A;  1NKE A;  1WSJ A;  4FJ9 A;  4QAG A;  1J5O A;  1BI4 A;  2DFF A;  1CZB A;  2EX3 A;  1FXX A;  4FJJ A;  2D0C A;  3AVK A;  4RG8 A;  4CGH A;  4DS5 A;  2YV0 X;  4FJN A;  3LP2 A;  1RT5 A;  2KW4 A;  4FCY A;  4KB0 A;  4JLH A;  1TK8 A;  1D5A A;  4KHQ A;  4KHU A;  2QXF A;  1I39 A;  3LAL A;  4CEZ A;  1VRU A;  4OLB A;  1T8E A;  2OPQ A;  3QEV A;  2Q3S A;  2E4L A;  3QET A;  3OYM A;  1FK9 A;  2E6M A;  4FJ8 A;  4F3T A;  4G1Q A;  1JKH A;  3ZSO A;  4O5B A;  4O55 A;  3FFI A;  4CEB A;  1ZYQ A;  2OPR A;  4DU1 A;  1RBV A;  4CK1 A;  3NCI A;  3LP1 A;  4JRP A;  1RT7 A;  1QSS A;  1KVA A;  4W5N A;  5KTQ A;  4DSL A;  1ZBI A;  3HJF A;  3THV A;  1EXQ A;  2VWK A;  2OYQ A;  4CJV A;  3L2Q A;  4C8M A;  1EKE A;  3HP9 A;  3P5J A;  4AHC A;  3S9H A;  5FRN A;  5J2N A;  2BGG A;  3WNH A;  4O0I A;  4H4O A;  4M3R A;  4CHZ A;  2OZS A;  4OJR A;  2O4G A;  1HYZ A;  4Z4I A;  3KD5 E;  2G8U A;  1ZBL A;  3DOL A;  4KHS A;  3B6O A;  4K8Z A;  4CFC A;  1QHT A;  3MXM A;  1WSE A;  4CCH A;  4E7J A;  4LSN A;  1JXE A;  1RBR A;  2PYL A;  4CGD A;  4FW2 A;  3OYE A;  3IAY A;  3AO3 A;  4DMN A;  1S1V A;  2XY7 A;  3U6F A;  5CZ1 A;  5J2Q A;  3C6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...