1BIZA

Hiv-1 integrase core domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
147
Chain Sequence
VDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Three new structures of the core domain of HIV-1 integrase: an active site that binds magnesium.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 46
structure length 147
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bizA00
4IDKA 3OYMA 4J2DA 4IG3A 4E19A 2KTQA 4FLWA 5J2MA 4GVMA 4RW6A 3DOKA 4OJRA 3L2QA 3WNEA 3OYLA 4LY7A 4DSFA 1REVA 5KRSA 4Z4EA 5HRPA 1NK0A 3KTQA 4FW2A 3OYBA 3TABA 1B9DA 1BCOA 3DLEA 2BGGA 4FJLA 1GOAA 3O4QA 1WSEA 4FXDA 4B3OA 3RRGA 1L3UA 1GOCA 2ATQA 3VQCA 1KLMA 1S1TA 1RTJA 3B6PA 4Z0UA 3CFRA 4KHSA 1BQMA 4O4GA 4E1NA 2HB5A 3OYCA 4DSJA 4E3SA 1LWEA 3S3MA 1QSLA 5KRTA 4O44A 3K5MA 1HQEA 1NOYA 3OYGA 1KFSA 4C8LA 1LW0A 2G8HA 3RTVA 4ID5A 3VQPA 1G15A 2YHAA 4M45A 5E41A 4I7FA 4J2AA 3K57A 3SZ2A 4CF9A 3PO5A 3JYTA 3SUQA 4NCGA 3C95A 3HPOA 4N56A 1O1WA 3THVA 4EZ9A 5HP1A 5HRSA 4NCBA 1QSSA 2HHTA 4F3TA 4RW4A 3NF9A 1BISA 3HVTA 3TAQA 1UOCA 3CFOA 4OPJA 3QLHA 3AV9A 1JKHA 3VQEA 3KLIA 3MXMA 3OVNA 4CEBA 2PYLA 3NBPA 4DLEA 1QQCA 1S1WA 1VRTA 5HBMA 3VN5A 4AHSA 4CJ4A 4E7KA 2G8WA 2HMIA 1YTUA 1CZBA 3T19A 1S6QA 3U3GA 2BDPA 2OA8A 4FJIA 3QINA 4F2RA 3SUNA 4CGGA 2GV9A 3NF7A 3M8QA 4CHZA 3LP1A 4CERA 3V9ZA 3OJSA 4DF4A 1WN7A 4B8AB 4FJ9A 4FW1A 4OGEA 4AHTA 3KJVA 2A1RA 4DFPA 2QK9A 4F8RA 1ZBIA 2KFNA 1NJZA 3ZSYA 4HTUA 2KW4A 4BDZA 3KD1E 2E4LA 2XY7A 4CEFA 2Z1JA 3S3OA 4E1MA 1L3SA 3PX0A 1YVUA 3VQQA 1WAJA 3CFPA 1L5UA 3HPHA 2HVIA 2R7YA 1JLEA 1U48A 4AH9A 3NF8A 4W5RA 3I8DA 1QHTA 4FLVA 3TAEA 2Y1JA 3IS9A 2HHVA 1ASVA 1JL2A 4H4MA 2YKNA 1C0TA 1EX4A 2XO7A 1KVAA 1WSHA 4DFJA 3AO3A 3DYAA 3SJJA 4HHTA 3DLBA 2VG7A 3KKSA 3HP6A 4HUGA 1TKZA 3TR8A 3O3GA 4Y1DA 3CQ8A 4J2EA 4CEDA 1BI4A 2A1SA 3PX6A 3QEVA 5KI6A 4CESA 3V9XA 4C8MA 1Q9XA 4F4KA 5CY4A 2DFHA 4AILC 2X6NA 4NYNA 3K2PA 3VQBA 1JXEA 3U6FA 2PZSA 3VQ8A 4CE9A 5C25A 5EU7A 3TAPA 4KKOA 4B9NA 3ALYA 4CGFA 4FLUA 1N6QA 2P5GA 1T03A 3KLFA 1ASWA 4DTUA 1X9SA 1S1UA 1TV6A 2QXFA 4QAGA 3OYEA 3ZT4A 3TWHA 3OYJA 2Z1HA 4FCYA 3PV8A 4CCHA 4DQIA 3AA3A 4DU1A 1NKBA 3V9SA 4KTZA 3VQ4A 3PX4A 3HSTB 1IH7A 3NGYA 4IKFA 1DLOA 2E6MA 4CGHA 1I39A 1TK0A 4FK2A 2ITGA 1B9FA 4ZTFA 1C0UA 4DQQA 3QERA 3VQ7A 3I0SA 4FK0A 1VSFA 1HYSA 3DLGA 1VSEA 3VQ6A 5CYMA 1S5JA 3DM2A 3K5OA 1FK9A 4AHRA 1KVBA 1TK5A 3CG7A 1UA1A 4FK4A 1L3VA 4JRPA 3C6TA 3L2VA 2KZZA 1TAQA 3AVJA 2G8IA 3SQ0A 1QSYA 3AVFA 1QTMA 3LWLA 5J2QA 1KLNA 1TKXA 3CM6A 4ICLA 5SWMA 4CJ5A 4FLXA 1SKWA 2PY5A 1RTDA 1RCHA 3O4NA 1BQNA 1U04A 4DMNA 3KLGA 1NK5A 3FFIA 5DMRA 4W5NA 1D5AA 4O0JA 3ZSVA 3ISNC 4N47A 4RG8A 1S6PA 3C94A 4RW9A 1HQUA 1SL2A 4KFBA 4DG1A 4DSKA 3F73A 1S1VA 2IAJA 1HRHA 1D8YA 1EXQA 1WSFA 4KHQA 1NOZA 1TVRA 4DTXA 1NK9A 5I3UA 3WNGA 3TAMA 3RMCA 1D9DA 4BDPA 2GUIA 3LPTA 4IBNA 4ZHRA 1N5YA 4OVLA 5K14A 1W0HA 4W5OA 2FC0A 4HUEA 1FXXA 4EZ6A 1VSHA 3L3UA 2IC3A 1A5VA 3SPZA 3NH1A 3SQ4A 3RWUA 4FJXA 3RRHA 4B9VA 4C8NA 3V81A 4CIGA 4XIUA 5J1EA 1JLGA 1U47A 4CJPA 3DRSA 4M3YA 4DSEA 1EKEA 2YNIA 3L2WA 3L3VA 3AVHA 3LP2A 4Y1CA 5FROA 2D5RA 3ZSZA 1UAXA 3KD5E 2FBXA 3IRXA 4CK1A 1X9WA 2P1JA 3BGRA 4PY5A 3SPYA 3AVKA 3LANA 3K59A 2I5JA 4IFYA 3V9WA 4FJ8A 2HHSA 2ZQBA 3QEWA 3HYFA 1J9AA 5I42A 1RTIA 3K5LA 4FM0A 4E7JA 3OY9A 2PYJA 2OYQA 1NKCA 4KPYA 4CJRA 2HVHA 3TARA 4CK2A 2O4IA 4FYDA 1S1XA 3G10A 3HXMA 1IO2A 1RBSA 4HCCA 4KREA 2XY5A 4QCLA 1RDDA 3LZJA 3RMDA 4RW8A 4KB0A 3ZT3A 1SKRA 1TGOA 2X78A 3P1GA 4AHVA 4CJWA 4Z4CA 3ZSQA 2RKIA 4MFBA 3SQ1A 4R5PA 2G8VA 4WE1A 4JS4A 1NJXA 3ASMA 1BGXT 3VQDA 1W9HA 4CHOA 3V9UA 4M3UA 1LWFA 5HRNA 2ZD1A 1XHXA 3KK2A 1NKEA 3KIOA 5JS2A 2HNYA 1BL3A 4FJMA 4KV8A 3LALA 4FJKA 2IOCA 1YTAA 3AVNA 1J53A 4EP5A 4FVMA 2YNGA 4B9LA 4M41A 2IGIA 4CJFA 3LDSA 1ZBFA 2DFEA 4B9SA 1WSJA 4FZXC 4O55A 1RBUA 3ZSWA 4G1QA 2AJQA 4CEAA 4LH4A 4CEZA 1KCFA 4E0DA 1LAVA 4CJQA 2OZSA 2HNZA 4OKEA 3SV4A 1IKWA 4LSNA 2OPPA 3LPUA 3LWMA 2OZMA 5SZTA 3HK2A 1QE1A 3AO5A 3L8BA 3ULDA 4DWIA 1SUQA 3OJUA 1BCMA 3AVMA 3C6UA 3KKRA 3PUFA 1RT6A 1BI4B 4CJEA 3KLEA 1S9EA 2XY8A 4DLGA 5J2PA 5CYQA 4ELUA 3OS0A 1KSPA 3PO4A 1LWCA 1Q9YA 1XWLA 4KRFA 2NUBA 3QNOA 4E89A 4H8KA 3VA3A 2YKMA 2F96A 1HJRA 3AVCA 3HPGA 3WNHA 5KGWA 4CHQA 4BDYA 1EP4A 3MEDA 4BWMA 4DQSA 4DU3A 1A5XA 4NCAA 1ZBHA 3LAKA 3AVLA 2O4GA 1RDCA 4FLTA 4CFCA 2X6SA 4TSXA 1WNSA 3K5NA 4JS5A 4Z4IA 2WONA 2VWJA 1WSIA 4ELVA 4FJ7A 3AVGA 4CFDA 1TKDA 3SUOA 1RT3A 1SV5A 4OKJA 3ZSOA 1LV5A 4DTRA 2YHBA 3QEIA 5FDLA 2LSNA 3RR8A 4DTMA 1RT5A 4PA1A 1YT3A 1SL0A 1ZYQA 3RMBA 3QEPA 4B8CA 3MXIA 3HO1A 4JLHA 3IAYA 3QETA 3A2FA 2D0AA 1RT7A 3DOLA 1UA0A 2B5JA 3T1AA 1D9FA 2G8KA 4CFAA 1WSGA 1A5WA 2BE2A 1VK0A 4CJUA 3QNNA 1NJWA 1RBRA 4DSLA 2XHBA 1HNIA 4CGJA 2KZMA 4I2PA 2YNHA 3NGIA 3QESA 4M3WA 4NYFA 3VQ5A 4HVJA 4Z4HA 3AO1A 3NE6A 4M42A 4LSLA 4CJKA 3KK3A 1KRPA 3EYZA 1Y97A 5KGXA 1HNVA 3SNNA 4CEEA 4GMJB 1U4BA 2YNFA 1HMVA 4HUFA 4FJHA 4F2SA 3T3FA 3M8PA 3VQ9A 4F3OA 4FJNA 3AA4A 3LAMA 1JLFA 3V4IA 1TKTA 5HRRA 4CF0A 1BHLA 1TAUA 1DTTA 4YFUA 2G8FA 1VRUA 4K8XA 4KHWA 2F8TA 2HHWA 2DFFA 1RBTA 2VG6A 2WOMA 3NH0A 4QOZB 2HHXA 4CEOA 3OYHA 5T7BA 5FRMA 3OYAA 2ETJA 1RNHA 4MQ3A 4M3RA 3ZT0A 4CJSA 1X9MA 4FLZA 4I9LA 4DS4A 2RN2A 4ZTJA 3RR7A 5CZ2A 4ELTA 3VA0A 4CECA 5DK5A 4YNQA 4KTWA 1C0MA 3AO4A 4LD0A 4FLYA 4CFBA 1CLQA 3V1QA 5J2NA 2IS3A 4UQGA 3HM9A 4BE0A 4DF8A 2Y1IA 4BACA 1NK8A 4C8OA 4OLBA 2ZE2A 3P5JA 2EX3A 4EP4A 3S3NA 4KB1A 2B6AA 2HHQA 5KTQA 4C8KA 1KTQA 3NHGA 1ZBUA 4CF2A 3V1RA 1JLBA 3CM5A 1TK8A 4FJ5A 3OYFA 4DSIA 1CXQA 3TI0A 1RDAA 3HT3A 1CXUA 3DLRA 2BANA 4CHNA 3D0PA 1NJYA 4BWJA 3M8RA 1GOBA 1LAWA 1C6VA 3MEEA 4Z4GA 4CIFA 1F21A 3TAFA 3E01A 1RT2A 1T8EA 1JLCA 1VSIA 1WAFA 3HVRA 4DS5A 2EHGA 2B4JA 3DI6A 2XRIA 3ZSXA 5HROA 1JLAA 4KI4A 1LW2A 1K6YA 1FKOA 1NK4A 4FJJA 4OGCA 4CJVA 2G8UA 4W5TA 4IG0A 2Z1IA 1QS4A 4Z4FA 4IFVA 2DTUA 2D0BA 3V1OA 1L3TA 1TL1A 3AA5X 4O0IA 3QEXA 4OLAA 3ITHA 1MU2A 4CF1A 4E7HA 2KQ2A 3H08A 1B92A 1Z25A 1JLQA 4KTQA 4DTNA 4FZZA 1ITGA 2OPRA 3V6DA 4AHUA 1ASUA 4BE1A 1RT4A 1FKPA 3BDPA 1CZ9A 2RF2A 3UIQA 1NK6A 3IG1A 1VSKA 4CIEA 3KK1A 3K58A 3SYZA 4E7LA 1S9GA 4KI6A 1BIZA 3AO2A 4CJLA 4JRQA 2HNDA 3SI6A 1C1BA 3I0RA 2YV0X 4GW6A 3WNFA 4CK3A 4I9QA 4PQUA 4CEQA 2QKBA 2Z1GA 3QO9A 4AHCA 4DU4A 1EETA 1VSDA 3ZCMA 1C1CA 4DFKA 2QKKA 3SCXA 2RPIA 4PUOA 4CF8A 3TANA 3MEGA 1Q8IA 4B9TA 3AA2A 3OS2A 3QIOA 3QIPA 4DTOA 2FBTA 4FZYA 1RDBA 3AVIA 3MECA 4M3XA 3DLKA 1ZBLA 3HP9A 3P83D 4KO0A 4B08A 4OPKA 3NGZA 3NCIA 4DTJA 1IKVA 1XHZA 4B9MA 3MXJA 1HPZA 4CGIA 1XC9A 5HLFA 2Q3SA 4KHUA 5D3GA 1HYZA 3PY8A 3RMAA 1JXBA 4LH5A 3ZT1A 3HJFA 1VSLA 1Z26A 3KLHA 2W42A 1KFDA 3ZT2A 5C42A 1TL3A 1X1PA 2HHUA 4Q0BA 1VSJA 4Q5VA 2HW3A 3B6OA 3SUPA 4DQPA 3O3FA 4RW7A 5C24A 2VG5A 4BE2A 1C1AA 4DTSA 4L8RB 2JLEA 1NK7A 4J2BA 4N76A 3NAEA 2VWKA 4W5QA 1VSMA 3DRRA 2FBVA 3ZSRA 3NF6A 4N5SA 1XI1A 5FRNA 5JS1A 1HYVA 1RTHA 2OPQA 4CGDA 1R0AA 4DTPA 3OYIA 4PWDA 3U3YA 3LZIA 3JSMA 4E7IA 3TAGA 4B9UA 3OYKA 4KHNA 3SV3A 4K8ZA 4CHYA 3G0ZA 4CJTA 2KFZA 1IG9A 3L2RA 3SQ2A 4M3TA 2F8SA 3L2UA 3EZ5A 4M3ZA 1RT1A 4FM2A 2E6LA 2X74A 1T05A 3M8SA 2GBZA 4H4OA 4O5BA 2IDOA 3HL8A 1IKXA 1I3AA 2FBYA 3NDKA 4DFMA 3DLHA 2P5OA 4CJ3A 4FM1A 2P51A 2XY6A 1KVCA 1SL1A 3AVBA 5CZ1A 3LP3A 3CYMA 3NFAA 2D0CA 1UWBA 1U49A 1T7PA 3OYDA 4DQRA 3AVAA 3DRPA 4KHYA 2JGUA 3DMJA 3EY1A 3VQAA 4FJGA 3LP0A 4I2QA 1RILA 4CHPA 1IKYA 1SKSA 1DTQA 2DY4A 3OYNA 1RBVA 4ID1A 3S9HA 1JL1A 1U45A 3D45A 4OKKA 2OPSA 3O3HA 4KAZA 1J54A 3MAQA 1J5OA 3NH2A 4N41A 1BIUA 3F9KA 3OS1A 4HCBA 1WLJA
chains in the Genus database with same CATH superfamily
4IG3A 4M63C 4FLWA 4B1WB 4OJRA 5M1KA 3L2QA 4DSFA 1W97L 5E84A 3VEZA 3KTQA 4FW2A 3OYBA 3TABA 2BGGA 4FJLA 5EX5A 4JKGA 5BREA 4LFCK 1HUXA 1HX1A 1GOCA 2ATQA 2VWBA 3A5NC 3VQCA 1S1TA 4Z0UA 1RTJA 3OTOK 4KHNA 2O8BB 4DSJA 4JI3K 3QICA 4C8LA 3K5MA 3OYGA 2P9LB 3RTVA 1OKJA 3VQPA 2YHAA 3K57A 2F4VK 5LJWA 1KXPA 3AARA 1XMOK 4DR4K 1QSSA 2HHTA 3S41A 4F3TA 3NF9A 4JD2A 3EKUA 1UOCA 3CJCA 3CFOA 3QLHA 1YI2N 1JKHA 3KLIA 2PYLA 4BGBA 4DLEA 1U6ZA 2BUPA 3PIPL 3CCLN 4AHSA 2G8WA 3WT0A 2HMIA 4GKJK 3T19A 4FJIA 4F2RA 1QQNA 4CGGA 3NF7A 4DF4A 2A1RA 3AGRA 1GLFO 4E1MA 4WCEL 3WUHA 3OW2M 1L5UA 3HPHA 2UUBK 4FSVA 1ZBSA 5KQ8A 1U48A 3CJ9A 3TAEA 1DT9A 1CZAN 3IS9A 1T3VA 2HHVA 1JL2A 4H4MA 2YKNA 3CCVN 1KVAA 1WSHA 4DFJA 4YY3K 3SJJA 2WC9A 3KKSA 3DXKA 3D2FB 2F7TA 3FFKB 5EVZA 3QEVA 3V9XA 2DFHA 4AILC 3U6FA 1JXEA 3EL2A 1S72N 4B9NA 4XH4A 3JAMO 3KLFA 1Z05A 1X9SA 3TWHA 5FPNA 4JI7K 4FCYA 4DQIA 1NGCA 3AA3A 4KTZA 4IXCA 4IKFA 1DLOA 3OHRA 4FK2A 4FK0A 1ATSA 3MN5A 5CYMA 1S5JA 2A3ZA 3DM2A 4LC9B 3K5OA 4FWMA 3UKRB 3VGLA 1FK9A 1TK5A 5GAEP 1L3VA 3C6TA 2KZZA 1QSYA 4WFAL 3E9OA 4MLHA 3O4NA 3CQYA 4BRPA 1NK5A 4ISFA 1D5AA 4RG8A 1S6PA 5GIPA 5AQYA 3F73A 1S1VA 2IAJA 1HRHA 1D8YA 1EXQA 4YDUC 1NOZA 1TVRA 3R1XA 4CI6A 3WNGA 2PFUA 4BDPA 2GUIA 3LPTA 5K14A 2FC0A 4EZ6A 1VSHA 1XNQK 1A5VA 3G6EN 4KHPK 3RRHA 3VESA 1P90A 4CJPA 4DSEA 2YNIA 5FROA 2FSJA 2CH5A 4Y1CA 3KD5E 4CK1A 1X9WA 2P1JA 4PY5A 2RHKA 2YCHA 3SPYA 3BZCA 3LANA 3EKSA 3HYFA 3LDLA 4YORA 2OYQA 1OVYA 4FL9A 2ZF5O 4CK2A 3J7ZO 1EWRA 4KREA 4BRLA 1RDDA 1HLUA 5LJVA 4AHVA 4YDUA 3I33A 3ZSQA 4BRFA 4MFBA 4WE1A 1J5EK 3E1YA 3ASMA 1BGXT 1SQKA 3VQDA 3V9UA 4M3UA 1LWFA 3HBTA 3KIOA 4NXNK 5ADXH 1BL3A 4LFBK 3IFRA 4A59A 3SAGA 1J53A 4FVMA 2YNGA 4KBOA 4M41A 4B9LA 3LDSA 4FPBA 1RBUA 4B3SK 1KCFA 4LF9K 3SV4A 4LSNA 4WFNL 3HK2A 4MLEA 3AO5A 1T6CA 2HBKA 3OJUA 1BCMA 3AVMA 3TU5A 4LF7K 1BI4B 2XY8A 3O9QA 3PO4A 2NRXA 3VA3A 4BR5A 2F96A 3HPGA 4CHQA 4BDYA 4ILJA 2AP1A 1TUYA 1A5XA 3AVLA 1NBWA 4FLTA 2X6SA 1WNSA 4CZLA 1RGIA 3M6GA 4ELVA 2O8EA 1SV5A 4H0OA 3ZSOA 2OTJN 4JI8K 3A8YA 4DTMA 1RT5A 1SL0A 3CCMN 4YOTA 5CE3A 3QEPA 3HM8A 1UA0A 3LM9A 4CFAA 2GTDA 3QNNA 3QMLA 3T1HK 4I2PA 2YNHA 3QESA 1QHAA 2P9SB 3EYZA 3SNNA 4KH5A 4HUFA 5C12A 3M8PA 4BC2A 1KC8O 3AA4A 2E2PA 2ZWHA 3LAMA 4FO0A 3V4IA 3DJCA 3U9DA 4K8XA 2F8TA 5BRHA 1VRUA 3IMXA 3C7NB 3MMVA 2VG6A 4QOZB 3BF1A 4B3TK 3GG4A 2V52B 4CJSA 1X9MA 4M3RA 5AQPA 2RN2A 3FLCO 5DK5A 3ID6A 1K8KB 2QWMA 1C0MA 4LD0A 2P9PB 1CLQA 3CERA 2IS3A 1NK8A 4CBWA 4K43A 3SBGA 4BACA 4C8OA 4OLBA 2ZE2A 3P5JA 4EP4A 1ATNA 3MDQA 5KTQA 3NHGA 1YJ9N 1CXQA 1RDAA 4HWIA 2BANA 1Q18A 1LAWA 1C6VA 3JS6A 1F21A 1RT2A 3MWPA 3HVRA 1WAFA 2EHGA 3DI6A 2O8BA 1K6YA 1NK4A 4ILHA 4IG0A 4PL7A 2P9LA 1GLCG 5DM7L 3SAFA 1L3TA 3U8XA 2A42A 4BY9C 2Q0RA 3ITHA 1MU2A 4OLAA 5JLHA 2KQ2A 3P39A 1VQNN 4DV0K 3BZKA 1ITGA 2OPRA 3V6DA 4DV6K 3CPEA 1GLAG 3UIQA 4BC3A 4JKFA 3K58A 4DR1K 4U7BA 4CJLA 2HNDA 5IWAK 4PQUA 3WNFA 4I9QA 2QKKA 3D6RA 3G4SN 4DFKA 1JCFA 3TANA 4B9TA 1Q8IA 3MN7A 3QIOA 4QS9A 1J6ZA 4FZYA 2A41A 3AVIA 2IIRA 3NGZA 4B9MA 3MXJA 1HPZA 3CC7N 5HLFA 3R3LA 2Q3SA 4LF4K 2ZGYA 3PY8A 1C0GA 2WTUA 2GWKA 1KFDA 3K0SA 1TL3A 4Q0BA 3H1VX 1VSJA 2KLAA 1NNEA 3D2FA 5C24A 4BR7A 1C1AA 3ZX2A 4DTSA 5FPEA 4DUYK 1Z6RA 1VSMA 3DRRA 4MO5A 1WBDA 3BF3A 3U3YA 3TAGA 1U2VB 2HMPA 4CZHA 4K8ZA 1TUUA 4BREA 4M3TA 3L2UA 4G9ZA 4O5BA 4BRKA 4DFMA 2P5OA 4CJ3A 2HSTA 4CZJA 3UKRA 1LCUA 2JGUA 3LP0A 4CHPA 1DTQA 2DY4A 3O6WA 3D45A 4OKKA 4CD1A 1J54A 3VETA 4N41A 4Z4EA 3H3OB 4HCBA 2QM1A 4IDKA 3WXKA 3ZYYX 5JVHL 3L4QA 5J2MA 4H0YB 4RW6A 5HRPA 1HNWK 3FZLA 4WQ4C 1BCOA 3DLEA 1GOAA 4JKCA 3PLAA 2Q31A 1WSEA 4FXDA 2BTFA 3I8BA 3SK3A 1YF5L 3CFRA 4KHSA 4BR4A 1LWEA 3S3MA 1NGIA 4O44A 1HQEA 4JKEA 4Y0WA 1NGHA 4ID5A 1IG8A 4DV3K 2CGKA 4M45A 3SZ2A 3WQTA 3M3ZA 3JYTA 1HKCA 3C95A 4H5RA 4NCBA 2P9NB 3CJ1A 1BISA 3HVTA 3TAQA 3BP8A 3OVNA 1V4SA 3NBPA 2ZM6K 5HBMA 3VN5A 3CI5A 3EE9A 2E20A 1VAZA 1CZBA 5C0YA 1S6QA 4I6MA 3O1WA 2HF3A 3THXB 3M8QA 3O1BA 4OGEA 2KFNA 4F8RA 3F9MA 1ZBIA 1NJZA 4CZKA 4BDZA 3KD1E 2XY7A 2GEMA 1VQKN 3PX0A 3OBYA 2QWLA 5TKWA 3O9UA 5LL6Z 1JLEA 4AH9A 3NF8A 4W5RA 3I8DA 1QHTA 4FLVA 3J7YP 3EE8A 2Y1JA 3A0IX 4B3MK 1LOTB 2XO7A 5FPDA 1YVNA 3DLBA 5HL7L 1NGBA 4HUGA 1NG9A 3CQ8A 4J2EA 1BI4A 4F4KA 4PKIA 4C8MA 3CHWA 4NYNA 1VQ4N 5AQWA 2PZSA 3VQ8A 5C25A 1BA0A 3U4LA 5M1QA 4BROA 4RTFD 1MWMA 2CH6A 4DTUA 1IBMK 1T6DA 3OYJA 1GLBG 2Z1HA 3PV8A 4IOCL 4CCHA 2ASMA 3VQ4A 3AGKA 3PX4A 3O9TA 1IH7A 2E6MA 1ATRA 1I39A 1B9FA 4ZTFA 4DQQA 3QERA 1W7AA 4BG9A 3I0SA 1VSFA 2O8CB 1VSEA 3VQ6A 5M1FA 4FOEA 3ATVA 1UA1A 4FK4A 2KKZA 3L2VA 3H45C 3C6HA 1KLNA 3W0LA 2P9SA 4B1VA 5GADP 4H0TB 4EHUA 4FLXA 1WB9A 4E1JA 1BQNA 1U04A 3J80O 4W5NA 4O0JA 3CXCM 3C94A 1T44A 2E2NA 4DSKA 3CC2N 2E2OA 3C7NA 4FWPA 1WSFA 4KHQA 4DTXA 3CCEN 3TAMA 1D9DA 3BY5A 4HUEA 2ASOA 3L3UA 5AQUA 1K8KA 2P9PA 3G71N 3RWUA 3D2EB 4B9VA 4C8NA 4MDAA 4CIGA 3GBTA 3FE1A 3DRSA 3H6EA 3CJ7A 1OVQA 4HTLA 5AQIA 3ZEUB 3O80A 2VQEK 1GLDG 4FJ8A 2ZQBA 3QEWA 3EN9A 1NGFA 2A6AA 4A2AA 3AAPA 3N4PA 3K5LA 4RWTA 4FM0A 3H3NO 3QFUA 1NGAA 4KPYA 4CJRA 2HVHA 1K73O 4FYDA 3CPWM 1IO2A 2XY5A 1W2BM 4L3QA 3PSFA 1HKBA 4KB0A 1HKGA 2X78A 3UKUB 3SQ1A 1HNZK 4JS4A 2QTDA 4JI5K 2ZD1A 1NKEA 3VMFB 1YTAA 4YOVA 1NMDA 5AQQA 4CJFA 4B9SA 4FZXC 4O55A 1VQON 4CEAA 3FZFA 4E0DA 4A2BA 4CJQA 3CC4N 3ZETB 4CD3A 1IKWA 5AQHA 2E8AA 3RSEB 3LPUA 3LWMA 2OZMA 1QE1A 3L8BA 4BRQA 5FLXO 1HNXK 3C6UA 2P9UA 1S9EA 5J2PA 4ELUA 3P4IA 2D0OA 1XWLA 4KRFA 2NUBA 5HOOA 4XH1A 4BVPA 4JNEA 1VQ8N 5KGWA 4BWMA 4NCAA 1ZBHA 1RDCA 1Q7YO 4TSXA 3J8AA 4FJ7A 3AVGA 3VGKA 3SUOA 4CZGA 1YAGA 4AM6A 3RR8A 2LSNA 4PA1A 3RMBA 3MXIA 4JLHA 3IAYA 3KWGA 3QETA 3KZBA 1RT7A 1D9FA 2H3GX 1A5WA 1U2VA 4CJUA 4DB3A 1HNIA 1OH6A 3WQUA 4IO8A 5BRFA 1IV0A 1BUPA 1V4TA 3VQ5A 4HVJA 3AO1A 3G25A 2Q1NA 1KRPA 1QZ6A 4CEEA 3D7EO 4GMJB 1SS6A 2YNFA 3T3FA 4F3OA 4FJNA 1EQYA 1Y64A 3EZWA 1HPMA 5HRRA 5F1XA 4H03B 2WOMA 3NH0A 4Z94A 5T7BA 3WXLA 3ID8A 3RR7A 4I9LA 2QI2A 4H0VB 4ELTA 3VA0A 5AQTA 4YNQA 4KTWA 3WEEB 3AO4A 3CF5L 5J2NA 3HM9A 4DF8A 3H46O 2BH1A 2B6AA 4JK8A 1TK8A 4FJ5A 4DSIA 3TI0A 3N4QA 1CXUA 3DLRA 2I7PA 4CHNA 5CHIA 3E01A 1T8EA 4IOAL 4DS5A 4BR0A 3VF6A 2XRIA 3ZSXA 1JLAA 1LW2A 4CBXA 1VQ9N 4WFBL 4FJJA 3UE5A 4CJVA 2G8UA 4CBUA 4Z4FA 2DTUA 3QEXA 1HJOA 3P31A 4E7HA 4CJ7A 1JLQA 4FWSA 4KTQA 3THYA 2YHXA 5GAHP 3WXJA 5E26A 1NK6A 4FWRA 4KI6A 4JRQA 3VTIA 1BU6O 2QKBA 3THXA 4AHCA 4DU4A 1EETA 1VSDA 1DGKN 3LDPA 4YOWA 2RPIA 1KD1O 4CF8A 4X65K 3AA2A 1H1VA 3HTVA 4IO9L 1YITN 1YJWN 3M1FA 3MN6A 4DTJA 4OPKA 3NCIA 1RDUA 2WFBA 2UXBK 1HYZA 4LH5A 5AZJB 3KLHA 5C42A 3SMSA 3O3FA 4RW7A 2VG5A 4BE2A 4L8RB 3OA9A 4O8UA 2HBMA 4J2BA 4N76A 4OPAA 4W5QA 2FBVA 3NF6A 4N5SA 1QQOA 2QWRA 5AQGA 4H0XB 5KPZA 4CGDA 1R0AA 4DTPA 3Q7CA 4PWDA 4JKAA 3JSMA 4E7IA 3MX2A 4DR5K 4FWLA 5ELZA 3IKMA 2NNWA 2F8SA 1RT1A 2E6LA 3GDQA 3M8SA 2IDOA 3CCSN 4FM1A 3A5LC 3AVBA 1DKGD 3LP3A 4K42A 3GE1A 1U49A 1T7PA 3DRPA 3OBWA 3VQAA 2O8FB 2UXDK 1RILA 1SKSA 4GV9A 4RCHA 1QQMA 3FZMA 3S9HA 1U45A 1JL1A 3VEWA 3TPQA 3MAQA 1BIUA 5EY4A 3F9KA 3UB5A 1S1XA 4XEIA 1BDGA 4E19A 2KTQA 3WNEA 5KRSA 4JAXA 5AQSA 2YX6A 4BVOA 3ULEB 1NMNA 3ENHA 4YHHK 3KWIA 1OH7A 4FWNA 4CVNE 1L3UA 1KLMA 3B6PA 4JKBA 2YI1A 3D2EA 2HB5A 4KAZA 4E3SA 1KFSA 1QSLA 5KRTA 3K9KA 2G8HA 2YJFA 4EFHA 1XUPO 1E4FT 1JCEA 4J2AA 4I7FA 2QA4N 4NCGA 3HPOA 3THVA 3ZEUA 1ZC6A 4EZ9A 5HRSA 4ISEA 4QS8A 3VQEA 3MXMA 3HZ6A 5AQOA 4OX9K 1VRTA 3MN9A 4CJ4A 5BPMA 4BRHA 1YTUA 3QINA 1K8AO 2GV9A 2NRRA 3NMUA 3UKUA 3C0BA 4CHZA 3LP1A 4EAHD 5BN8A 3OJSA 1WN7A 4UY8O 3KJVA 4AHTA 3ZSYA 4K41A 2Z1JA 2OANA 1BA1A 3A5OC 2V7YA 1Q86O 2HVIA 5AQKA 2R7YA 1OH8A 3WXIA 1RFQA 4CZMA 1E3MA 4BRAA 3ZETA 1ASVA 1C0TA 1EX4A 3RSEA 3EO3A 3AO3A 2VG7A 3CCRN 4LF6K 3LM2A 4DR3K 3O3GA 4Y1DA 5M1NA 2A1SA 3H1QA 1I94K 3VQBA 5EU7A 1WUAA 4KKOA 1YHQN 1T03A 5GINA 1ASWA 1S1UA 1TV6A 2QXFA 3FGUA 1VHXA 4QAGA 2QWQA 5AQMA 4IOXA 3V9SA 1Q81O 2HBLA 4CGHA 1YUWA 1C0UA 3U9ZA 3VQ7A 3NVKA 3DLGA 3L6QA 1GLEG 5KPTA 3KVGA 3AVJA 3SQ0A 3AVFA 5AFUA 4A5AA 1QTMA 4ICLA 2QXLA 5SWMA 4CJ5A 3HRGA 1X3MA 3SAHA 4DMNA 1YXQA 3ISNC 4N47A 3LL3A 4RW9A 1SL2A 5KQDA 4NO7A 5F0XA 4ILGB 1JJ2M 1NK9A 5I3UA 4IBNA 4ZHRA 2JWLA 3AY9A 5BRDA 3CMAN 1FXXA 2FF3B 1K9MO 3SQ4A 3VTHA 2P9IB 3T1YK 4ISGA 3SMPA 3V81A 4XIUA 5J1EA 1JLGA 4PL8A 3VF2A 1EKEA 4GV3A 2D5RA 3ZSZA 1UAXA 3IRXA 2UXCK 4NLBA 3J7AP 4IFYA 3ENBA 1N36K 1J9AA 1ESVA 4E7JA 2QEXN 3E66A 3G10A 3HXMA 4HCCA 4QCLA 3F5TA 4O8KA 3M5RA 4BRNA 1TYQB 3ZT3A 1SKRA 1TGOA 3P1GA 4CJWA 4Z4CA 2RKIA 3MK6A 5BPLA 4R5PA 3A5MC 3ZLJA 1W9HA 5HRNA 5JS2A 4FJMA 5BR9A 3LALA 4FJKA 3PSIA 4PKHA 3I55N 3RVCA 3AVNA 4DV7K 1ZBFA 2DFEA 4GY2B 1WSJA 1MA9B 1JCGA 2AJQA 4H5NA 4LH4A 3K9JA 1N8RO 2QWNA 2OZSA 2HNZA 4OKEA 2OPPA 2AA4A 2GX9A 4H5TA 3ULDA 4K0KK 2P9KB 3FZKA 4DWIA 4B1YB 1BG3A 1EO1A 3F2KA 4BR9A 3PUFA 3KKRA 3KLEA 1XNRK 2NLXA 3OS0A 1KSPA 1LWCA 1Q9YA 1HR0K 4E89A 5A2QO 5AZJA 3AVCA 5C2DA 2ZJQL 4H0PA 4DU3A 3QDKA 4FPAA 3LAKA 4MO4A 1WBBA 3K5NA 1WSIA 3CQXA 4IJAA 2RE2A 1TKDA 1RT3A 4OKJA 1LV5A 2O8EB 4DTRA 5FDLA 1VQ7N 1NGJA 5BR8K 1YT3A 4OO1J 3HO1A 4DHYA 2D0AA 3DOLA 2G8KA 2B5JA 2IVOA 1VK0A 1NJWA 1RBRA 2QWPA 2EWSA 4DSLA 2XHBA 3CETA 4CGJA 3L4IA 3CCQN 4NYFA 3NE6A 4CJKA 3KK3A 4NB4A 1Y97A 3PIOL 1HNVA 1U4BA 1HMVA 5EOYA 3VQ9A 4CW7B 4R79A 4CF0A 1BHLA 4DKWA 2O8FA 4KHWA 2VGNA 2DFFA 3IDHA 1SAZA 3BEXA 4CEOA 2IVNA 3OYHA 3KK7A 2HOEA 3OYAA 4FLZA 4ZTJA 2PBDA 5CZ2A 4CECA 2OCEA 4FLYA 4UQGA 4BE0A 2Y1IA 4V19S 3DLLL 2O8DB 4KB1A 4JI4K 2UU9K 2HHQA 3C6AA 3WXMB 1ZBUA 4CF2A 3ULEA 1JLBA 3D0PA 3HT3A 4DQ8A 3M8RA 3MEEA 4M7YA 4CIFA 4DR7K 5AQXA 4FWQA 5JMVA 1IBKK 5GAGP 2IVPA 2B4JA 4KI4A 5HROA 1FKOA 4OGCA 5AQZA 1VQLN 1P8ZA 2Z1IA 1OH5A 2D0BA 3AA5X 4O0IA 4BQZA 3EEQA 4BR2A 4CF1A 3Q7BA 5C2FA 1B92A 4GKKK 4FZZA 5JVGL 4BRIA 4BE1A 3BDPA 1CZ9A 3CCUN 1VSKA 4CIEA 3KK1A 1G99A 4E7LA 1Q82O 1S9GA 2ZJRL 1BIZA 3SI6A 2D4WA 1C1BA 3I0RA 2YV0X 4GW6A 4JI0K 4PKGA 4CEQA 5AFUH 1C1CA 3O5BA 5I9EB 3CJBA 3MEGA 3OS2A 3QIPA 1KAZA 3J81O 4DTOA 2I7NA 4QS7A 1KAYA 4AM7A 4M3XA 3DLKA 1ZBLA 4KO0A 2V7ZA 3ENOA 4CGIA 1XC9A 4YOUA 1MWKA 3O8MA 2NRVA 3VGMA 3ZT1A 3HJFA 2CGJA 1Z26A 5H1SQ 2D0PA 2VCPA 3ZT2A 2Q0UA 3E9PA 3CD6N 2YHWA 4BRCA 2HHUA 3JXUA 4Q5VA 2HW3A 4A5BA 4DQPA 1FJGK 2E1ZA 4JV5K 2JLEA 3VEOA 2WUSA 5AZIB 1NK7A 1S22A 2ZJPL 3NAEA 2VWKA 4YOYA 3GL1A 2F9TA 5FRNA 5M1PA 1HYVA 5JS1A 1RTHA 2YJEA 4NLCA 1FW6A 3LDOA 2E2QA 4B9UA 3G0ZA 4CJTA 2KFZA 3R6MA 4DV1K 2CGLA 3SLCA 3EZ5A 1BO5O 4K25A 2X74A 1T05A 1GLLO 2GBZA 2HF4A 2KHOA 5C15A 1XQSC 3CYMA 2D0CA 1UWBA 1YIJN 3OYDA 3THWB 3AVAA 3VF4A 4BRDA 1X3NA 1KQSM 4I2QA 2ASPA 3CJAA 4FOIA 3TSQA 3O3HA 4NXMK 1VQ5N 3TSPA 5LY3A 3OYMA 1NWKA 4J2DA 4GVMA 2D1KA 3DOKA 2A5XA 3MWTA 3OYLA 4LY7A 1N33K 1REVA 1BWFO 1NK0A 5JLFA 2ITMA 3TSUA 5JICA 2QW9A 1B9DA 3TTFA 3O4QA 4B9QA 4B3OA 3ZX0A 3KHYA 1IJJA 3RRGA 4LF5K 3LDNA 2P9IA 1BQMA 4O4GA 2W41A 4E1NA 3OYCA 3VENA 1NOYA 1LW0A 1XMQK 3ATUA 1WOQA 1G15A 5E41A 4DCHA 4CF9A 3PO5A 3SUQA 4N56A 1O1WA 3C65A 5HP1A 2P9NA 4RW4A 3QBWA 4OPJA 4CZFA 2ZGZA 1QZ5A 3AV9A 5AR0A 4CEBA 1XC3A 2GUPA 1QQCA 1S1WA 3VEVA 3FZHA 3VPZA 4E7KA 3U3GA 2BDPA 2OA8A 4I6MB 3SUNA 1TYQA 4JHDB 5LMUK 3VEXA 4CERA 3V9ZA 4X66K 4FJ9A 4B8AB 4FW1A 2QK9A 4DFPA 3VOVA 4HTUA 2KW4A 1MDUB 3QFPA 2E4LA 1VQMN 2V51B 4CEFA 3HOTA 3S3OA 2VQFK 3NVMA 1L3SA 1YVUA 1NJIO 4B1XB 3VERA 3VQQA 1WAJA 4CZEA 3CFPA 4DUZK 2NZTA 4JI1K 1R59O 4IDHA 4YOXA 5BPNA 1D4XA 4FWKA 3SBTA 3DYAA 4BQLA 4HHTA 3HP6A 2P9KA 4H5WA 1TKZA 3TR8A 4JI6K 3CIPA 5AQJA 3IUCA 4CEDA 1SZ2A 3TTDA 3PX6A 5KI6A 4CESA 1Q9XA 2FSNA 5CY4A 2X6NA 2GWJA 3K2PA 2HHHK 3DXMB 4BG8A 4CE9A 3TAPA 4O5FA 3ALYA 4CGFA 5FPMA 4FLUA 2P5GA 1RDWX 4M7XA 3OYEA 3ZT4A 4C1NI 4DU1A 1NKBA 1NM1A 4BRMA 4DV2K 3HSTB 4WYBA 3NGYA 1ZXOA 3W3DA 1C0FA 1TK0A 2ITGA 2YHYA 2O8CA 1HYSA 4JN4A 3MCPA 2Q2RA 5CR4A 1KVBA 4AHRA 1VQPN 3CG7A 4JRPA 1TAQA 2G8IA 2E1YA 3LWLA 2A40A 5J2QA 3L0QA 2UUCK 1TKXA 3CM6A 4A61A 4LFAK 5AQLA 1SKWA 2PY5A 1RTDA 1RCHA 3KLGA 3FFIA 5DMRA 3ZSVA 3O9RA 4JKDA 1HQUA 4KFBA 4DG1A 4MDBA 1EWQA 3T69A 3R8EA 3RMCA 1N5YA 4JKGB 1IBLK 4OVLA 1W0HA 3ZX3A 3BUZB 2IC3A 3SPZA 3DWLA 3FR0A 3QB0A 1NGEA 4KH6A 3NH1A 4FJXA 4H5VA 2O8DA 5MLCQ 1U47A 4IEEA 4M3YA 2DPNA 3L2WA 3L3VA 3AVHA 3LP2A 2Q97A 2FBXA 3BGRA 4IZ9A 3AVKA 1KAXA 3K59A 2I5JA 3V9WA 2HHSA 1GLJO 4JD2B 5I42A 1RTIA 3OY9A 2PYJA 3VEYA 1NGGA 1NKCA 3CMEN 5F2RA 3TARA 2O4IA 5DM6L 3AAQA 3TTCA 1RBSA 3LZJA 3RMDA 4RW8A 2UUAK 2J4RA 3LDQA 2G8VA 1NJXA 4CHOA 3I56N 3T7ZA 3KK2A 1XHXA 2HNYA 4OPHA 4KV8A 5B8HA 2OTLN 2IOCA 2W40A 4F9OA 4IFEA 4EP5A 4B1ZA 2IGIA 4DR2K 2PAVA 4JYAK 3ZSWA 4G1QA 3DAWA 5M1OA 3O4WA 3P38A 4CEZA 1LAVA 4EIAA 4JKHA 2QWOA 1BOTO 5SZTA 3DXKB 4JI2K 1NLVA 1SUQA 2FSKA 1NGDA 3O08A 1N6QA 4CJEA 1RT6A 4M3WA 2P9UB 2NRTA 4DLGA 5CYQA 2NRZA 3QNOA 4JEPA 4H8KA 2YKMA 1QVFM 1HJRA 3WNHA 4DQSA 5AQVA 1EP4A 3MEDA 2O4GA 2W6KA 4CFCA 4AF1A 4JS5A 4Z4IA 2WONA 2VWJA 2FXUA 2E88A 4CFDA 4DV5K 5AZIA 2YHBA 3QEIA 4DR6K 5TKYA 4BGAA 1ZYQA 4GVEA 4B8CA 2Q36A 4JK9A 3A2FA 3T1AA 1O13A 1N34K 1WSGA 2BE2A 4CZIA 2KZMA 1NU0A 3NGIA 4J8FA 4Z4HA 4M42A 4LSLA 4A57A 5KGXA 4FJHA 2GELA 4F2SA 3MX5A 4B3RK 3O9SA 1JLFA 1TKTA 3THWA 1TAUA 1DTTA 4YFUA 5KPRA 2G8FA 2W6LA 2HHWA 1RBTA 2HHXA 2WBNA 1ILYA 4IJNA 4GNIA 5FRMA 2ETJA 1RNHA 4MQ3A 3ZT0A 4JK7A 4DS4A 3WEEA 4DV4K 4CFBA 3V1QA 3S3NA 2EX3A 4C8KA 1KTQA 4KH4A 3V1RA 3CM5A 2FF6A 4BRGA 5AJ3K 3OYFA 3E9LA 1DEJA 1YJNN 5LMNK 1NJYA 4BWJA 1GOBA 4PHTX 4Z4GA 4WQ5C 3TAFA 1M90O 1JLCA 1VSIA 2F9WA 4W5TA 1QS4A 4IFVA 5C10A 2NRWA 3V1OA 1TL1A 5AQFA 3H08A 3HI0A 1Z25A 4DTNA 4AHUA 1ASUA 3THYB 1RT4A 1FKPA 2RF2A 4IWVA 3IG1A 4IEIA 5EXWA 3SYZA 3AO2A 4EHTA 3QBXA 4C1NK 4CK3A 1M1KO 2Z1GA 3QO9A 3ZCMA 4JHDA 3SCXA 4PUOA 4WQ4A 4WF9L 4X64K 3HSCA 2FBTA 2UYTA 1RDBA 3MECA 5BN9A 4LF8K 4A62A 3HP9A 2NRHA 3P83D 4WQ5A 4B08A 1XHZA 1IKVA 5AQNA 1E4GT 4KHUA 1S3XA 5D3GA 3R9PA 3RMAA 1JXBA 2JWKA 1VSLA 4XH5A 2W42A 1X1PA 2E5LK 3MCAB 3B6OA 3SUPA 3B8AX 3GOIA 3HOSA 2VYPA 3DXMA 4C23A 2FLOA 3ZSRA 1XI1A 1QVGM 4U67L 1VQ6N 2OPQA 3OYIA 4B1UB 3LZIA 5GIOA 3OYKA 3SV3A 4BC4A 4FWOA 4CHYA 3CCJN 1IG9A 3L2RA 3SQ2A 4M3ZA 4FM2A 1X9JA 3SJHA 4H4OA 5AQRA 1N32K 3HL8A 1IKXA 1I3AA 2FBYA 3NDKA 3DLHA 2P51A 5ADXA 1KVCA 2XY6A 1SL1A 5CZ1A 3NFAA 4BC5A 2VGMA 4DQRA 4KHYA 3DMJA 3EY1A 4FJGA 2HBJA 4GV6A 1IKYA 3OYNA 1RBVA 4ID1A 2OPSA 4AQYK 4X62K 1J5OA 3NH2A 4W5OA 5IT9O 3OS1A 1WLJA 4FVUA
chains in the Genus database with same CATH topology
4IDKA 3OYMA 4J2DA 4IG3A 4E19A 2KTQA 4FLWA 5J2MA 4GVMA 4RW6A 3DOKA 4OJRA 3L2QA 3WNEA 3OYLA 4LY7A 4DSFA 1REVA 5KRSA 4Z4EA 5HRPA 1NK0A 3KTQA 4FW2A 3OYBA 3TABA 1B9DA 1BCOA 3DLEA 2BGGA 4FJLA 1GOAA 3O4QA 1WSEA 4FXDA 4B3OA 3RRGA 1L3UA 1GOCA 2ATQA 3VQCA 1KLMA 1S1TA 1RTJA 3B6PA 4Z0UA 3CFRA 4KHSA 1BQMA 4O4GA 4E1NA 2HB5A 3OYCA 4DSJA 4E3SA 1LWEA 3S3MA 1QSLA 5KRTA 4O44A 3K5MA 1HQEA 1NOYA 3OYGA 1KFSA 4C8LA 1LW0A 2G8HA 3RTVA 4ID5A 3VQPA 1G15A 2YHAA 4M45A 5E41A 4I7FA 4J2AA 3K57A 3SZ2A 4CF9A 3PO5A 3JYTA 3SUQA 4NCGA 3C95A 3HPOA 4N56A 1O1WA 3THVA 4EZ9A 5HP1A 5HRSA 4NCBA 1QSSA 2HHTA 4F3TA 4RW4A 3NF9A 1BISA 3HVTA 3TAQA 1UOCA 3CFOA 4OPJA 3QLHA 3AV9A 1JKHA 3VQEA 3KLIA 3MXMA 3OVNA 4CEBA 2PYLA 3NBPA 4DLEA 1QQCA 1S1WA 1VRTA 5HBMA 3VN5A 4AHSA 4CJ4A 4E7KA 2G8WA 2HMIA 1YTUA 1CZBA 3T19A 1S6QA 3U3GA 2BDPA 2OA8A 4FJIA 3QINA 4F2RA 3SUNA 4CGGA 2GV9A 3NF7A 3M8QA 4CHZA 3LP1A 4CERA 3V9ZA 3OJSA 4DF4A 1WN7A 4B8AB 4FJ9A 4FW1A 4OGEA 4AHTA 3KJVA 2A1RA 4DFPA 2QK9A 4F8RA 1ZBIA 2KFNA 1NJZA 3ZSYA 4HTUA 2KW4A 4BDZA 3KD1E 2E4LA 2XY7A 4CEFA 2Z1JA 3S3OA 4E1MA 1L3SA 3PX0A 1YVUA 3VQQA 1WAJA 3CFPA 1L5UA 3HPHA 2HVIA 2R7YA 1JLEA 1U48A 4AH9A 3NF8A 4W5RA 3I8DA 1QHTA 4FLVA 3TAEA 2Y1JA 3IS9A 2HHVA 1ASVA 1JL2A 4H4MA 2YKNA 1C0TA 1EX4A 2XO7A 1KVAA 1WSHA 4DFJA 3AO3A 3DYAA 3SJJA 4HHTA 3DLBA 2VG7A 3KKSA 3HP6A 4HUGA 1TKZA 3TR8A 3O3GA 4Y1DA 3CQ8A 4J2EA 4CEDA 1BI4A 2A1SA 3PX6A 3QEVA 5KI6A 4CESA 3V9XA 4C8MA 1Q9XA 4F4KA 5CY4A 2DFHA 4AILC 2X6NA 4NYNA 3K2PA 3VQBA 1JXEA 3U6FA 2PZSA 3VQ8A 4CE9A 5C25A 5EU7A 3TAPA 4KKOA 4B9NA 3ALYA 4CGFA 4FLUA 1N6QA 2P5GA 1T03A 3KLFA 1ASWA 4DTUA 1X9SA 1S1UA 1TV6A 2QXFA 4QAGA 3OYEA 3ZT4A 3TWHA 3OYJA 2Z1HA 4FCYA 3PV8A 4CCHA 4DQIA 3AA3A 4DU1A 1NKBA 3V9SA 4KTZA 3VQ4A 3PX4A 3HSTB 1IH7A 3NGYA 4IKFA 1DLOA 2E6MA 4CGHA 1I39A 1TK0A 4FK2A 2ITGA 1B9FA 4ZTFA 1C0UA 4DQQA 3QERA 3VQ7A 3I0SA 4FK0A 1VSFA 1HYSA 3DLGA 1VSEA 3VQ6A 5CYMA 1S5JA 3DM2A 3K5OA 1FK9A 4AHRA 1KVBA 1TK5A 3CG7A 1UA1A 4FK4A 1L3VA 4JRPA 3C6TA 3L2VA 2KZZA 1TAQA 3AVJA 2G8IA 3SQ0A 1QSYA 3AVFA 1QTMA 3LWLA 5J2QA 1KLNA 1TKXA 3CM6A 4ICLA 5SWMA 4CJ5A 4FLXA 1SKWA 2PY5A 1RTDA 1RCHA 3O4NA 1BQNA 1U04A 4DMNA 3KLGA 1NK5A 3FFIA 5DMRA 4W5NA 1D5AA 4O0JA 3ZSVA 3ISNC 4N47A 4RG8A 1S6PA 3C94A 4RW9A 1HQUA 1SL2A 4KFBA 4DG1A 4DSKA 3F73A 1S1VA 2IAJA 1HRHA 1D8YA 1EXQA 1WSFA 4KHQA 1NOZA 1TVRA 4DTXA 1NK9A 5I3UA 3WNGA 3TAMA 3RMCA 1D9DA 4BDPA 2GUIA 3LPTA 4IBNA 4ZHRA 1N5YA 4OVLA 5K14A 1W0HA 4W5OA 2FC0A 4HUEA 1FXXA 4EZ6A 1VSHA 3L3UA 2IC3A 1A5VA 3SPZA 3NH1A 3SQ4A 3RWUA 4FJXA 3RRHA 4B9VA 4C8NA 3V81A 4CIGA 4XIUA 5J1EA 1JLGA 1U47A 4CJPA 3DRSA 4M3YA 4DSEA 1EKEA 2YNIA 3L2WA 3L3VA 3AVHA 3LP2A 4Y1CA 5FROA 2D5RA 3ZSZA 1UAXA 3KD5E 2FBXA 3IRXA 4CK1A 1X9WA 2P1JA 3BGRA 4PY5A 3SPYA 3AVKA 3LANA 3K59A 2I5JA 4IFYA 3V9WA 4FJ8A 2HHSA 2ZQBA 3QEWA 3HYFA 1J9AA 5I42A 1RTIA 3K5LA 4FM0A 4E7JA 3OY9A 2PYJA 2OYQA 1NKCA 4KPYA 4CJRA 2HVHA 3TARA 4CK2A 2O4IA 4FYDA 1S1XA 3G10A 3HXMA 1IO2A 1RBSA 4HCCA 4KREA 2XY5A 4QCLA 1RDDA 3LZJA 3RMDA 4RW8A 4KB0A 3ZT3A 1SKRA 1TGOA 2X78A 3P1GA 4AHVA 4CJWA 4Z4CA 3ZSQA 2RKIA 4MFBA 3SQ1A 4R5PA 2G8VA 4WE1A 4JS4A 1NJXA 3ASMA 1BGXT 3VQDA 1W9HA 4CHOA 3V9UA 4M3UA 1LWFA 5HRNA 2ZD1A 1XHXA 3KK2A 1NKEA 3KIOA 5JS2A 2HNYA 1BL3A 4FJMA 4KV8A 3LALA 4FJKA 2IOCA 1YTAA 3AVNA 1J53A 4EP5A 4FVMA 2YNGA 4B9LA 4M41A 2IGIA 4CJFA 3LDSA 1ZBFA 2DFEA 4B9SA 1WSJA 4FZXC 4O55A 1RBUA 3ZSWA 4G1QA 2AJQA 4CEAA 4LH4A 4CEZA 1KCFA 4E0DA 1LAVA 4CJQA 2OZSA 2HNZA 4OKEA 3SV4A 1IKWA 4LSNA 2OPPA 3LPUA 3LWMA 2OZMA 5SZTA 3HK2A 1QE1A 3AO5A 3L8BA 3ULDA 4DWIA 1SUQA 3OJUA 1BCMA 3AVMA 3C6UA 3KKRA 3PUFA 1RT6A 1BI4B 4CJEA 3KLEA 1S9EA 2XY8A 4DLGA 5J2PA 5CYQA 4ELUA 3OS0A 1KSPA 3PO4A 1LWCA 1Q9YA 1XWLA 4KRFA 2NUBA 3QNOA 4E89A 4H8KA 3VA3A 2YKMA 2F96A 1HJRA 3AVCA 3HPGA 3WNHA 5KGWA 4CHQA 4BDYA 1EP4A 3MEDA 4BWMA 4DQSA 4DU3A 1A5XA 4NCAA 1ZBHA 3LAKA 3AVLA 2O4GA 1RDCA 4FLTA 4CFCA 2X6SA 4TSXA 1WNSA 3K5NA 4JS5A 4Z4IA 2WONA 2VWJA 1WSIA 4ELVA 4FJ7A 3AVGA 4CFDA 1TKDA 3SUOA 1RT3A 1SV5A 4OKJA 3ZSOA 1LV5A 4DTRA 2YHBA 3QEIA 5FDLA 2LSNA 3RR8A 4DTMA 1RT5A 4PA1A 1YT3A 1SL0A 1ZYQA 3RMBA 3QEPA 4B8CA 3MXIA 3HO1A 4JLHA 3IAYA 3QETA 3A2FA 2D0AA 1RT7A 3DOLA 1UA0A 2B5JA 3T1AA 1D9FA 2G8KA 4CFAA 1WSGA 1A5WA 2BE2A 1VK0A 4CJUA 3QNNA 1NJWA 1RBRA 4DSLA 2XHBA 1HNIA 4CGJA 2KZMA 4I2PA 2YNHA 3NGIA 3QESA 4M3WA 4NYFA 3VQ5A 4HVJA 4Z4HA 3AO1A 3NE6A 4M42A 4LSLA 4CJKA 3KK3A 1KRPA 3EYZA 1Y97A 5KGXA 1HNVA 3SNNA 4CEEA 4GMJB 1U4BA 2YNFA 1HMVA 4HUFA 4FJHA 4F2SA 3T3FA 3M8PA 3VQ9A 4F3OA 4FJNA 3AA4A 3LAMA 1JLFA 3V4IA 1TKTA 5HRRA 4CF0A 1BHLA 1TAUA 1DTTA 4YFUA 2G8FA 1VRUA 4K8XA 4KHWA 2F8TA 2HHWA 2DFFA 1RBTA 2VG6A 2WOMA 3NH0A 4QOZB 2HHXA 4CEOA 3OYHA 5T7BA 5FRMA 3OYAA 2ETJA 1RNHA 4MQ3A 4M3RA 3ZT0A 4CJSA 1X9MA 4FLZA 4I9LA 4DS4A 2RN2A 4ZTJA 3RR7A 5CZ2A 4ELTA 3VA0A 4CECA 5DK5A 4YNQA 4KTWA 1C0MA 3AO4A 4LD0A 4FLYA 4CFBA 1CLQA 3V1QA 5J2NA 2IS3A 4UQGA 3HM9A 4BE0A 4DF8A 2Y1IA 4BACA 1NK8A 4C8OA 4OLBA 2ZE2A 3P5JA 2EX3A 4EP4A 3S3NA 4KB1A 2B6AA 2HHQA 5KTQA 4C8KA 1KTQA 3NHGA 1ZBUA 4CF2A 3V1RA 1JLBA 3CM5A 1TK8A 4FJ5A 3OYFA 4DSIA 1CXQA 3TI0A 1RDAA 3HT3A 1CXUA 3DLRA 2BANA 4CHNA 3D0PA 1NJYA 4BWJA 3M8RA 1GOBA 1LAWA 1C6VA 3MEEA 4Z4GA 4CIFA 1F21A 3TAFA 3E01A 1RT2A 1T8EA 1JLCA 1VSIA 1WAFA 3HVRA 4DS5A 2EHGA 2B4JA 3DI6A 2XRIA 3ZSXA 5HROA 1JLAA 4KI4A 1LW2A 1K6YA 1FKOA 1NK4A 4FJJA 4OGCA 4CJVA 2G8UA 4W5TA 4IG0A 2Z1IA 1QS4A 4Z4FA 4IFVA 2DTUA 2D0BA 3V1OA 1L3TA 1TL1A 3AA5X 4O0IA 3QEXA 4OLAA 3ITHA 1MU2A 4CF1A 4E7HA 2KQ2A 3H08A 1B92A 1Z25A 1JLQA 4KTQA 4DTNA 4FZZA 1ITGA 2OPRA 3V6DA 4AHUA 1ASUA 4BE1A 1RT4A 1FKPA 3BDPA 1CZ9A 2RF2A 3UIQA 1NK6A 3IG1A 1VSKA 4CIEA 3KK1A 3K58A 3SYZA 4E7LA 1S9GA 4KI6A 1BIZA 3AO2A 4CJLA 4JRQA 2HNDA 3SI6A 1C1BA 3I0RA 2YV0X 4GW6A 3WNFA 4CK3A 4I9QA 4PQUA 4CEQA 2QKBA 2Z1GA 3QO9A 4AHCA 4DU4A 1EETA 1VSDA 3ZCMA 1C1CA 4DFKA 2QKKA 3SCXA 2RPIA 4PUOA 4CF8A 3TANA 3MEGA 1Q8IA 4B9TA 3AA2A 3OS2A 3QIOA 3QIPA 4DTOA 2FBTA 4FZYA 1RDBA 3AVIA 3MECA 4M3XA 3DLKA 1ZBLA 3HP9A 3P83D 4KO0A 4B08A 4OPKA 3NGZA 3NCIA 4DTJA 1IKVA 1XHZA 4B9MA 3MXJA 1HPZA 4CGIA 1XC9A 5HLFA 2Q3SA 4KHUA 5D3GA 1HYZA 3PY8A 3RMAA 1JXBA 4LH5A 3ZT1A 3HJFA 1VSLA 1Z26A 3KLHA 2W42A 1KFDA 3ZT2A 5C42A 1TL3A 1X1PA 2HHUA 4Q0BA 1VSJA 4Q5VA 2HW3A 3B6OA 3SUPA 4DQPA 3O3FA 4RW7A 5C24A 2VG5A 4BE2A 1C1AA 4DTSA 4L8RB 2JLEA 1NK7A 4J2BA 4N76A 3NAEA 2VWKA 4W5QA 1VSMA 3DRRA 2FBVA 3ZSRA 3NF6A 4N5SA 1XI1A 5FRNA 5JS1A 1HYVA 1RTHA 2OPQA 4CGDA 1R0AA 4DTPA 3OYIA 4PWDA 3U3YA 3LZIA 3JSMA 4E7IA 3TAGA 4B9UA 3OYKA 4KHNA 3SV3A 4K8ZA 4CHYA 3G0ZA 4CJTA 2KFZA 1IG9A 3L2RA 3SQ2A 4M3TA 2F8SA 3L2UA 3EZ5A 4M3ZA 1RT1A 4FM2A 2E6LA 2X74A 1T05A 3M8SA 2GBZA 4H4OA 4O5BA 2IDOA 3HL8A 1IKXA 1I3AA 2FBYA 3NDKA 4DFMA 3DLHA 2P5OA 4CJ3A 4FM1A 2P51A 2XY6A 1KVCA 1SL1A 3AVBA 5CZ1A 3LP3A 3CYMA 3NFAA 2D0CA 1UWBA 1U49A 1T7PA 3OYDA 4DQRA 3AVAA 3DRPA 4KHYA 2JGUA 3DMJA 3EY1A 3VQAA 4FJGA 3LP0A 4I2QA 1RILA 4CHPA 1IKYA 1SKSA 1DTQA 2DY4A 3OYNA 1RBVA 4ID1A 3S9HA 1JL1A 1U45A 3D45A 4OKKA 2OPSA 3O3HA 4KAZA 1J54A 3MAQA 1J5OA 3NH2A 4N41A 1BIUA 3F9KA 3OS1A 4HCBA 1WLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDK A;  3OYM A;  4J2D A;  4IG3 A;  4E19 A;  2KTQ A;  4FLW A;  5J2M A;  4GVM A;  4RW6 A;  3DOK A;  4OJR A;  3L2Q A;  3WNE A;  3OYL A;  4LY7 A;  4DSF A;  1REV A;  5KRS A;  4Z4E A;  5HRP A;  1NK0 A;  3KTQ A;  4FW2 A;  3OYB A;  3TAB A;  1B9D A;  1BCO A;  3DLE A;  2BGG A;  4FJL A;  1GOA A;  3O4Q A;  1WSE A;  4FXD A;  4B3O A;  3RRG A;  1L3U A;  1GOC A;  2ATQ A;  3VQC A;  1KLM A;  1S1T A;  1RTJ A;  3B6P A;  4Z0U A;  3CFR A;  4KHS A;  1BQM A;  4O4G A;  4E1N A;  2HB5 A;  3OYC A;  4DSJ A;  4E3S A;  1LWE A;  3S3M A;  1QSL A;  5KRT A;  4O44 A;  3K5M A;  1HQE A;  1NOY A;  3OYG A;  1KFS A;  4C8L A;  1LW0 A;  2G8H A;  3RTV A;  4ID5 A;  3VQP A;  1G15 A;  2YHA A;  4M45 A;  5E41 A;  4I7F A;  4J2A A;  3K57 A;  3SZ2 A;  4CF9 A;  3PO5 A;  3JYT A;  3SUQ A;  4NCG A;  3C95 A;  3HPO A;  4N56 A;  1O1W A;  3THV A;  4EZ9 A;  5HP1 A;  5HRS A;  4NCB A;  1QSS A;  2HHT A;  4F3T A;  4RW4 A;  3NF9 A;  1BIS A;  3HVT A;  3TAQ A;  1UOC A;  3CFO A;  4OPJ A;  3QLH A;  3AV9 A;  1JKH A;  3VQE A;  3KLI A;  3MXM A;  3OVN A;  4CEB A;  2PYL A;  3NBP A;  4DLE A;  1QQC A;  1S1W A;  1VRT A;  5HBM A;  3VN5 A;  4AHS A;  4CJ4 A;  4E7K A;  2G8W A;  2HMI A;  1YTU A;  1CZB A;  3T19 A;  1S6Q A;  3U3G A;  2BDP A;  2OA8 A;  4FJI A;  3QIN A;  4F2R A;  3SUN A;  4CGG A;  2GV9 A;  3NF7 A;  3M8Q A;  4CHZ A;  3LP1 A;  4CER A;  3V9Z A;  3OJS A;  4DF4 A;  1WN7 A;  4B8A B;  4FJ9 A;  4FW1 A;  4OGE A;  4AHT A;  3KJV A;  2A1R A;  4DFP A;  2QK9 A;  4F8R A;  1ZBI A;  2KFN A;  1NJZ A;  3ZSY A;  4HTU A;  2KW4 A;  4BDZ A;  3KD1 E;  2E4L A;  2XY7 A;  4CEF A;  2Z1J A;  3S3O A;  4E1M A;  1L3S A;  3PX0 A;  1YVU A;  3VQQ A;  1WAJ A;  3CFP A;  1L5U A;  3HPH A;  2HVI A;  2R7Y A;  1JLE A;  1U48 A;  4AH9 A;  3NF8 A;  4W5R A;  3I8D A;  1QHT A;  4FLV A;  3TAE A;  2Y1J A;  3IS9 A;  2HHV A;  1ASV A;  1JL2 A;  4H4M A;  2YKN A;  1C0T A;  1EX4 A;  2XO7 A;  1KVA A;  1WSH A;  4DFJ A;  3AO3 A;  3DYA A;  3SJJ A;  4HHT A;  3DLB A;  2VG7 A;  3KKS A;  3HP6 A;  4HUG A;  1TKZ A;  3TR8 A;  3O3G A;  4Y1D A;  3CQ8 A;  4J2E A;  4CED A;  1BI4 A;  2A1S A;  3PX6 A;  3QEV A;  5KI6 A;  4CES A;  3V9X A;  4C8M A;  1Q9X A;  4F4K A;  5CY4 A;  2DFH A;  4AIL C;  2X6N A;  4NYN A;  3K2P A;  3VQB A;  1JXE A;  3U6F A;  2PZS A;  3VQ8 A;  4CE9 A;  5C25 A;  5EU7 A;  3TAP A;  4KKO A;  4B9N A;  3ALY A;  4CGF A;  4FLU A;  1N6Q A;  2P5G A;  1T03 A;  3KLF A;  1ASW A;  4DTU A;  1X9S A;  1S1U A;  1TV6 A;  2QXF A;  4QAG A;  3OYE A;  3ZT4 A;  3TWH A;  3OYJ A;  2Z1H A;  4FCY A;  3PV8 A;  4CCH A;  4DQI A;  3AA3 A;  4DU1 A;  1NKB A;  3V9S A;  4KTZ A;  3VQ4 A;  3PX4 A;  3HST B;  1IH7 A;  3NGY A;  4IKF A;  1DLO A;  2E6M A;  4CGH A;  1I39 A;  1TK0 A;  4FK2 A;  2ITG A;  1B9F A;  4ZTF A;  1C0U A;  4DQQ A;  3QER A;  3VQ7 A;  3I0S A;  4FK0 A;  1VSF A;  1HYS A;  3DLG A;  1VSE A;  3VQ6 A;  5CYM A;  1S5J A;  3DM2 A;  3K5O A;  1FK9 A;  4AHR A;  1KVB A;  1TK5 A;  3CG7 A;  1UA1 A;  4FK4 A;  1L3V A;  4JRP A;  3C6T A;  3L2V A;  2KZZ A;  1TAQ A;  3AVJ A;  2G8I A;  3SQ0 A;  1QSY A;  3AVF A;  1QTM A;  3LWL A;  5J2Q A;  1KLN A;  1TKX A;  3CM6 A;  4ICL A;  5SWM A;  4CJ5 A;  4FLX A;  1SKW A;  2PY5 A;  1RTD A;  1RCH A;  3O4N A;  1BQN A;  1U04 A;  4DMN A;  3KLG A;  1NK5 A;  3FFI A;  5DMR A;  4W5N A;  1D5A A;  4O0J A;  3ZSV A;  3ISN C;  4N47 A;  4RG8 A;  1S6P A;  3C94 A;  4RW9 A;  1HQU A;  1SL2 A;  4KFB A;  4DG1 A;  4DSK A;  3F73 A;  1S1V A;  2IAJ A;  1HRH A;  1D8Y A;  1EXQ A;  1WSF A;  4KHQ A;  1NOZ A;  1TVR A;  4DTX A;  1NK9 A;  5I3U A;  3WNG A;  3TAM A;  3RMC A;  1D9D A;  4BDP A;  2GUI A;  3LPT A;  4IBN A;  4ZHR A;  1N5Y A;  4OVL A;  5K14 A;  1W0H A;  4W5O A;  2FC0 A;  4HUE A;  1FXX A;  4EZ6 A;  1VSH A;  3L3U A;  2IC3 A;  1A5V A;  3SPZ A;  3NH1 A;  3SQ4 A;  3RWU A;  4FJX A;  3RRH A;  4B9V A;  4C8N A;  3V81 A;  4CIG A;  4XIU A;  5J1E A;  1JLG A;  1U47 A;  4CJP A;  3DRS A;  4M3Y A;  4DSE A;  1EKE A;  2YNI A;  3L2W A;  3L3V A;  3AVH A;  3LP2 A;  4Y1C A;  5FRO A;  2D5R A;  3ZSZ A;  1UAX A;  3KD5 E;  2FBX A;  3IRX A;  4CK1 A;  1X9W A;  2P1J A;  3BGR A;  4PY5 A;  3SPY A;  3AVK A;  3LAN A;  3K59 A;  2I5J A;  4IFY A;  3V9W A;  4FJ8 A;  2HHS A;  2ZQB A;  3QEW A;  3HYF A;  1J9A A;  5I42 A;  1RTI A;  3K5L A;  4FM0 A;  4E7J A;  3OY9 A;  2PYJ A;  2OYQ A;  1NKC A;  4KPY A;  4CJR A;  2HVH A;  3TAR A;  4CK2 A;  2O4I A;  4FYD A;  1S1X A;  3G10 A;  3HXM A;  1IO2 A;  1RBS A;  4HCC A;  4KRE A;  2XY5 A;  4QCL A;  1RDD A;  3LZJ A;  3RMD A;  4RW8 A;  4KB0 A;  3ZT3 A;  1SKR A;  1TGO A;  2X78 A;  3P1G A;  4AHV A;  4CJW A;  4Z4C A;  3ZSQ A;  2RKI A;  4MFB A;  3SQ1 A;  4R5P A;  2G8V A;  4WE1 A;  4JS4 A;  1NJX A;  3ASM A;  1BGX T;  3VQD A;  1W9H A;  4CHO A;  3V9U A;  4M3U A;  1LWF A;  5HRN A;  2ZD1 A;  1XHX A;  3KK2 A;  1NKE A;  3KIO A;  5JS2 A;  2HNY A;  1BL3 A;  4FJM A;  4KV8 A;  3LAL A;  4FJK A;  2IOC A;  1YTA A;  3AVN A;  1J53 A;  4EP5 A;  4FVM A;  2YNG A;  4B9L A;  4M41 A;  2IGI A;  4CJF A;  3LDS A;  1ZBF A;  2DFE A;  4B9S A;  1WSJ A;  4FZX C;  4O55 A;  1RBU A;  3ZSW A;  4G1Q A;  2AJQ A;  4CEA A;  4LH4 A;  4CEZ A;  1KCF A;  4E0D A;  1LAV A;  4CJQ A;  2OZS A;  2HNZ A;  4OKE A;  3SV4 A;  1IKW A;  4LSN A;  2OPP A;  3LPU A;  3LWM A;  2OZM A;  5SZT A;  3HK2 A;  1QE1 A;  3AO5 A;  3L8B A;  3ULD A;  4DWI A;  1SUQ A;  3OJU A;  1BCM A;  3AVM A;  3C6U A;  3KKR A;  3PUF A;  1RT6 A;  1BI4 B;  4CJE A;  3KLE A;  1S9E A;  2XY8 A;  4DLG A;  5J2P A;  5CYQ A;  4ELU A;  3OS0 A;  1KSP A;  3PO4 A;  1LWC A;  1Q9Y A;  1XWL A;  4KRF A;  2NUB A;  3QNO A;  4E89 A;  4H8K A;  3VA3 A;  2YKM A;  2F96 A;  1HJR A;  3AVC A;  3HPG A;  3WNH A;  5KGW A;  4CHQ A;  4BDY A;  1EP4 A;  3MED A;  4BWM A;  4DQS A;  4DU3 A;  1A5X A;  4NCA A;  1ZBH A;  3LAK A;  3AVL A;  2O4G A;  1RDC A;  4FLT A;  4CFC A;  2X6S A;  4TSX A;  1WNS A;  3K5N A;  4JS5 A;  4Z4I A;  2WON A;  2VWJ A;  1WSI A;  4ELV A;  4FJ7 A;  3AVG A;  4CFD A;  1TKD A;  3SUO A;  1RT3 A;  1SV5 A;  4OKJ A;  3ZSO A;  1LV5 A;  4DTR A;  2YHB A;  3QEI A;  5FDL A;  2LSN A;  3RR8 A;  4DTM A;  1RT5 A;  4PA1 A;  1YT3 A;  1SL0 A;  1ZYQ A;  3RMB A;  3QEP A;  4B8C A;  3MXI A;  3HO1 A;  4JLH A;  3IAY A;  3QET A;  3A2F A;  2D0A A;  1RT7 A;  3DOL A;  1UA0 A;  2B5J A;  3T1A A;  1D9F A;  2G8K A;  4CFA A;  1WSG A;  1A5W A;  2BE2 A;  1VK0 A;  4CJU A;  3QNN A;  1NJW A;  1RBR A;  4DSL A;  2XHB A;  1HNI A;  4CGJ A;  2KZM A;  4I2P A;  2YNH A;  3NGI A;  3QES A;  4M3W A;  4NYF A;  3VQ5 A;  4HVJ A;  4Z4H A;  3AO1 A;  3NE6 A;  4M42 A;  4LSL A;  4CJK A;  3KK3 A;  1KRP A;  3EYZ A;  1Y97 A;  5KGX A;  1HNV A;  3SNN A;  4CEE A;  4GMJ B;  1U4B A;  2YNF A;  1HMV A;  4HUF A;  4FJH A;  4F2S A;  3T3F A;  3M8P A;  3VQ9 A;  4F3O A;  4FJN A;  3AA4 A;  3LAM A;  1JLF A;  3V4I A;  1TKT A;  5HRR A;  4CF0 A;  1BHL A;  1TAU A;  1DTT A;  4YFU A;  2G8F A;  1VRU A;  4K8X A;  4KHW A;  2F8T A;  2HHW A;  2DFF A;  1RBT A;  2VG6 A;  2WOM A;  3NH0 A;  4QOZ B;  2HHX A;  4CEO A;  3OYH A;  5T7B A;  5FRM A;  3OYA A;  2ETJ A;  1RNH A;  4MQ3 A;  4M3R A;  3ZT0 A;  4CJS A;  1X9M A;  4FLZ A;  4I9L A;  4DS4 A;  2RN2 A;  4ZTJ A;  3RR7 A;  5CZ2 A;  4ELT A;  3VA0 A;  4CEC A;  5DK5 A;  4YNQ A;  4KTW A;  1C0M A;  3AO4 A;  4LD0 A;  4FLY A;  4CFB A;  1CLQ A;  3V1Q A;  5J2N A;  2IS3 A;  4UQG A;  3HM9 A;  4BE0 A;  4DF8 A;  2Y1I A;  4BAC A;  1NK8 A;  4C8O A;  4OLB A;  2ZE2 A;  3P5J A;  2EX3 A;  4EP4 A;  3S3N A;  4KB1 A;  2B6A A;  2HHQ A;  5KTQ A;  4C8K A;  1KTQ A;  3NHG A;  1ZBU A;  4CF2 A;  3V1R A;  1JLB A;  3CM5 A;  1TK8 A;  4FJ5 A;  3OYF A;  4DSI A;  1CXQ A;  3TI0 A;  1RDA A;  3HT3 A;  1CXU A;  3DLR A;  2BAN A;  4CHN A;  3D0P A;  1NJY A;  4BWJ A;  3M8R A;  1GOB A;  1LAW A;  1C6V A;  3MEE A;  4Z4G A;  4CIF A;  1F21 A;  3TAF A;  3E01 A;  1RT2 A;  1T8E A;  1JLC A;  1VSI A;  1WAF A;  3HVR A;  4DS5 A;  2EHG A;  2B4J A;  3DI6 A;  2XRI A;  3ZSX A;  5HRO A;  1JLA A;  4KI4 A;  1LW2 A;  1K6Y A;  1FKO A;  1NK4 A;  4FJJ A;  4OGC A;  4CJV A;  2G8U A;  4W5T A;  4IG0 A;  2Z1I A;  1QS4 A;  4Z4F A;  4IFV A;  2DTU A;  2D0B A;  3V1O A;  1L3T A;  1TL1 A;  3AA5 X;  4O0I A;  3QEX A;  4OLA A;  3ITH A;  1MU2 A;  4CF1 A;  4E7H A;  2KQ2 A;  3H08 A;  1B92 A;  1Z25 A;  1JLQ A;  4KTQ A;  4DTN A;  4FZZ A;  1ITG A;  2OPR A;  3V6D A;  4AHU A;  1ASU A;  4BE1 A;  1RT4 A;  1FKP A;  3BDP A;  1CZ9 A;  2RF2 A;  3UIQ A;  1NK6 A;  3IG1 A;  1VSK A;  4CIE A;  3KK1 A;  3K58 A;  3SYZ A;  4E7L A;  1S9G A;  4KI6 A;  1BIZ A;  3AO2 A;  4CJL A;  4JRQ A;  2HND A;  3SI6 A;  1C1B A;  3I0R A;  2YV0 X;  4GW6 A;  3WNF A;  4CK3 A;  4I9Q A;  4PQU A;  4CEQ A;  2QKB A;  2Z1G A;  3QO9 A;  4AHC A;  4DU4 A;  1EET A;  1VSD A;  3ZCM A;  1C1C A;  4DFK A;  2QKK A;  3SCX A;  2RPI A;  4PUO A;  4CF8 A;  3TAN A;  3MEG A;  1Q8I A;  4B9T A;  3AA2 A;  3OS2 A;  3QIO A;  3QIP A;  4DTO A;  2FBT A;  4FZY A;  1RDB A;  3AVI A;  3MEC A;  4M3X A;  3DLK A;  1ZBL A;  3HP9 A;  3P83 D;  4KO0 A;  4B08 A;  4OPK A;  3NGZ A;  3NCI A;  4DTJ A;  1IKV A;  1XHZ A;  4B9M A;  3MXJ A;  1HPZ A;  4CGI A;  1XC9 A;  5HLF A;  2Q3S A;  4KHU A;  5D3G A;  1HYZ A;  3PY8 A;  3RMA A;  1JXB A;  4LH5 A;  3ZT1 A;  3HJF A;  1VSL A;  1Z26 A;  3KLH A;  2W42 A;  1KFD A;  3ZT2 A;  5C42 A;  1TL3 A;  1X1P A;  2HHU A;  4Q0B A;  1VSJ A;  4Q5V A;  2HW3 A;  3B6O A;  3SUP A;  4DQP A;  3O3F A;  4RW7 A;  5C24 A;  2VG5 A;  4BE2 A;  1C1A A;  4DTS A;  4L8R B;  2JLE A;  1NK7 A;  4J2B A;  4N76 A;  3NAE A;  2VWK A;  4W5Q A;  1VSM A;  3DRR A;  2FBV A;  3ZSR A;  3NF6 A;  4N5S A;  1XI1 A;  5FRN A;  5JS1 A;  1HYV A;  1RTH A;  2OPQ A;  4CGD A;  1R0A A;  4DTP A;  3OYI A;  4PWD A;  3U3Y A;  3LZI A;  3JSM A;  4E7I A;  3TAG A;  4B9U A;  3OYK A;  4KHN A;  3SV3 A;  4K8Z A;  4CHY A;  3G0Z A;  4CJT A;  2KFZ A;  1IG9 A;  3L2R A;  3SQ2 A;  4M3T A;  2F8S A;  3L2U A;  3EZ5 A;  4M3Z A;  1RT1 A;  4FM2 A;  2E6L A;  2X74 A;  1T05 A;  3M8S A;  2GBZ A;  4H4O A;  4O5B A;  2IDO A;  3HL8 A;  1IKX A;  1I3A A;  2FBY A;  3NDK A;  4DFM A;  3DLH A;  2P5O A;  4CJ3 A;  4FM1 A;  2P51 A;  2XY6 A;  1KVC A;  1SL1 A;  3AVB A;  5CZ1 A;  3LP3 A;  3CYM A;  3NFA A;  2D0C A;  1UWB A;  1U49 A;  1T7P A;  3OYD A;  4DQR A;  3AVA A;  3DRP A;  4KHY A;  2JGU A;  3DMJ A;  3EY1 A;  3VQA A;  4FJG A;  3LP0 A;  4I2Q A;  1RIL A;  4CHP A;  1IKY A;  1SKS A;  1DTQ A;  2DY4 A;  3OYN A;  1RBV A;  4ID1 A;  3S9H A;  1JL1 A;  1U45 A;  3D45 A;  4OKK A;  2OPS A;  3O3H A;  4KAZ A;  1J54 A;  3MAQ A;  1J5O A;  3NH2 A;  4N41 A;  1BIU A;  3F9K A;  3OS1 A;  4HCB A;  1WLJ A; 
#chains in the Genus database with same CATH topology
 4IG3 A;  4M63 C;  4FLW A;  4B1W B;  4OJR A;  5M1K A;  3L2Q A;  4DSF A;  1W97 L;  5E84 A;  3VEZ A;  3KTQ A;  4FW2 A;  3OYB A;  3TAB A;  2BGG A;  4FJL A;  5EX5 A;  4JKG A;  5BRE A;  4LFC K;  1HUX A;  1HX1 A;  1GOC A;  2ATQ A;  2VWB A;  3A5N C;  3VQC A;  1S1T A;  4Z0U A;  1RTJ A;  3OTO K;  4KHN A;  2O8B B;  4DSJ A;  4JI3 K;  3QIC A;  4C8L A;  3K5M A;  3OYG A;  2P9L B;  3RTV A;  1OKJ A;  3VQP A;  2YHA A;  3K57 A;  2F4V K;  5LJW A;  1KXP A;  3AAR A;  1XMO K;  4DR4 K;  1QSS A;  2HHT A;  3S41 A;  4F3T A;  3NF9 A;  4JD2 A;  3EKU A;  1UOC A;  3CJC A;  3CFO A;  3QLH A;  1YI2 N;  1JKH A;  3KLI A;  2PYL A;  4BGB A;  4DLE A;  1U6Z A;  2BUP A;  3PIP L;  3CCL N;  4AHS A;  2G8W A;  3WT0 A;  2HMI A;  4GKJ K;  3T19 A;  4FJI A;  4F2R A;  1QQN A;  4CGG A;  3NF7 A;  4DF4 A;  2A1R A;  3AGR A;  1GLF O;  4E1M A;  4WCE L;  3WUH A;  3OW2 M;  1L5U A;  3HPH A;  2UUB K;  4FSV A;  1ZBS A;  5KQ8 A;  1U48 A;  3CJ9 A;  3TAE A;  1DT9 A;  1CZA N;  3IS9 A;  1T3V A;  2HHV A;  1JL2 A;  4H4M A;  2YKN A;  3CCV N;  1KVA A;  1WSH A;  4DFJ A;  4YY3 K;  3SJJ A;  2WC9 A;  3KKS A;  3DXK A;  3D2F B;  2F7T A;  3FFK B;  5EVZ A;  3QEV A;  3V9X A;  2DFH A;  4AIL C;  3U6F A;  1JXE A;  3EL2 A;  1S72 N;  4B9N A;  4XH4 A;  3JAM O;  3KLF A;  1Z05 A;  1X9S A;  3TWH A;  5FPN A;  4JI7 K;  4FCY A;  4DQI A;  1NGC A;  3AA3 A;  4KTZ A;  4IXC A;  4IKF A;  1DLO A;  3OHR A;  4FK2 A;  4FK0 A;  1ATS A;  3MN5 A;  5CYM A;  1S5J A;  2A3Z A;  3DM2 A;  4LC9 B;  3K5O A;  4FWM A;  3UKR B;  3VGL A;  1FK9 A;  1TK5 A;  5GAE P;  1L3V A;  3C6T A;  2KZZ A;  1QSY A;  4WFA L;  3E9O A;  4MLH A;  3O4N A;  3CQY A;  4BRP A;  1NK5 A;  4ISF A;  1D5A A;  4RG8 A;  1S6P A;  5GIP A;  5AQY A;  3F73 A;  1S1V A;  2IAJ A;  1HRH A;  1D8Y A;  1EXQ A;  4YDU C;  1NOZ A;  1TVR A;  3R1X A;  4CI6 A;  3WNG A;  2PFU A;  4BDP A;  2GUI A;  3LPT A;  5K14 A;  2FC0 A;  4EZ6 A;  1VSH A;  1XNQ K;  1A5V A;  3G6E N;  4KHP K;  3RRH A;  3VES A;  1P90 A;  4CJP A;  4DSE A;  2YNI A;  5FRO A;  2FSJ A;  2CH5 A;  4Y1C A;  3KD5 E;  4CK1 A;  1X9W A;  2P1J A;  4PY5 A;  2RHK A;  2YCH A;  3SPY A;  3BZC A;  3LAN A;  3EKS A;  3HYF A;  3LDL A;  4YOR A;  2OYQ A;  1OVY A;  4FL9 A;  2ZF5 O;  4CK2 A;  3J7Z O;  1EWR A;  4KRE A;  4BRL A;  1RDD A;  1HLU A;  5LJV A;  4AHV A;  4YDU A;  3I33 A;  3ZSQ A;  4BRF A;  4MFB A;  4WE1 A;  1J5E K;  3E1Y A;  3ASM A;  1BGX T;  1SQK A;  3VQD A;  3V9U A;  4M3U A;  1LWF A;  3HBT A;  3KIO A;  4NXN K;  5ADX H;  1BL3 A;  4LFB K;  3IFR A;  4A59 A;  3SAG A;  1J53 A;  4FVM A;  2YNG A;  4KBO A;  4M41 A;  4B9L A;  3LDS A;  4FPB A;  1RBU A;  4B3S K;  1KCF A;  4LF9 K;  3SV4 A;  4LSN A;  4WFN L;  3HK2 A;  4MLE A;  3AO5 A;  1T6C A;  2HBK A;  3OJU A;  1BCM A;  3AVM A;  3TU5 A;  4LF7 K;  1BI4 B;  2XY8 A;  3O9Q A;  3PO4 A;  2NRX A;  3VA3 A;  4BR5 A;  2F96 A;  3HPG A;  4CHQ A;  4BDY A;  4ILJ A;  2AP1 A;  1TUY A;  1A5X A;  3AVL A;  1NBW A;  4FLT A;  2X6S A;  1WNS A;  4CZL A;  1RGI A;  3M6G A;  4ELV A;  2O8E A;  1SV5 A;  4H0O A;  3ZSO A;  2OTJ N;  4JI8 K;  3A8Y A;  4DTM A;  1RT5 A;  1SL0 A;  3CCM N;  4YOT A;  5CE3 A;  3QEP A;  3HM8 A;  1UA0 A;  3LM9 A;  4CFA A;  2GTD A;  3QNN A;  3QML A;  3T1H K;  4I2P A;  2YNH A;  3QES A;  1QHA A;  2P9S B;  3EYZ A;  3SNN A;  4KH5 A;  4HUF A;  5C12 A;  3M8P A;  4BC2 A;  1KC8 O;  3AA4 A;  2E2P A;  2ZWH A;  3LAM A;  4FO0 A;  3V4I A;  3DJC A;  3U9D A;  4K8X A;  2F8T A;  5BRH A;  1VRU A;  3IMX A;  3C7N B;  3MMV A;  2VG6 A;  4QOZ B;  3BF1 A;  4B3T K;  3GG4 A;  2V52 B;  4CJS A;  1X9M A;  4M3R A;  5AQP A;  2RN2 A;  3FLC O;  5DK5 A;  3ID6 A;  1K8K B;  2QWM A;  1C0M A;  4LD0 A;  2P9P B;  1CLQ A;  3CER A;  2IS3 A;  1NK8 A;  4CBW A;  4K43 A;  3SBG A;  4BAC A;  4C8O A;  4OLB A;  2ZE2 A;  3P5J A;  4EP4 A;  1ATN A;  3MDQ A;  5KTQ A;  3NHG A;  1YJ9 N;  1CXQ A;  1RDA A;  4HWI A;  2BAN A;  1Q18 A;  1LAW A;  1C6V A;  3JS6 A;  1F21 A;  1RT2 A;  3MWP A;  3HVR A;  1WAF A;  2EHG A;  3DI6 A;  2O8B A;  1K6Y A;  1NK4 A;  4ILH A;  4IG0 A;  4PL7 A;  2P9L A;  1GLC G;  5DM7 L;  3SAF A;  1L3T A;  3U8X A;  2A42 A;  4BY9 C;  2Q0R A;  3ITH A;  1MU2 A;  4OLA A;  5JLH A;  2KQ2 A;  3P39 A;  1VQN N;  4DV0 K;  3BZK A;  1ITG A;  2OPR A;  3V6D A;  4DV6 K;  3CPE A;  1GLA G;  3UIQ A;  4BC3 A;  4JKF A;  3K58 A;  4DR1 K;  4U7B A;  4CJL A;  2HND A;  5IWA K;  4PQU A;  3WNF A;  4I9Q A;  2QKK A;  3D6R A;  3G4S N;  4DFK A;  1JCF A;  3TAN A;  4B9T A;  1Q8I A;  3MN7 A;  3QIO A;  4QS9 A;  1J6Z A;  4FZY A;  2A41 A;  3AVI A;  2IIR A;  3NGZ A;  4B9M A;  3MXJ A;  1HPZ A;  3CC7 N;  5HLF A;  3R3L A;  2Q3S A;  4LF4 K;  2ZGY A;  3PY8 A;  1C0G A;  2WTU A;  2GWK A;  1KFD A;  3K0S A;  1TL3 A;  4Q0B A;  3H1V X;  1VSJ A;  2KLA A;  1NNE A;  3D2F A;  5C24 A;  4BR7 A;  1C1A A;  3ZX2 A;  4DTS A;  5FPE A;  4DUY K;  1Z6R A;  1VSM A;  3DRR A;  4MO5 A;  1WBD A;  3BF3 A;  3U3Y A;  3TAG A;  1U2V B;  2HMP A;  4CZH A;  4K8Z A;  1TUU A;  4BRE A;  4M3T A;  3L2U A;  4G9Z A;  4O5B A;  4BRK A;  4DFM A;  2P5O A;  4CJ3 A;  2HST A;  4CZJ A;  3UKR A;  1LCU A;  2JGU A;  3LP0 A;  4CHP A;  1DTQ A;  2DY4 A;  3O6W A;  3D45 A;  4OKK A;  4CD1 A;  1J54 A;  3VET A;  4N41 A;  4Z4E A;  3H3O B;  4HCB A;  2QM1 A;  4IDK A;  3WXK A;  3ZYY X;  5JVH L;  3L4Q A;  5J2M A;  4H0Y B;  4RW6 A;  5HRP A;  1HNW K;  3FZL A;  4WQ4 C;  1BCO A;  3DLE A;  1GOA A;  4JKC A;  3PLA A;  2Q31 A;  1WSE A;  4FXD A;  2BTF A;  3I8B A;  3SK3 A;  1YF5 L;  3CFR A;  4KHS A;  4BR4 A;  1LWE A;  3S3M A;  1NGI A;  4O44 A;  1HQE A;  4JKE A;  4Y0W A;  1NGH A;  4ID5 A;  1IG8 A;  4DV3 K;  2CGK A;  4M45 A;  3SZ2 A;  3WQT A;  3M3Z A;  3JYT A;  1HKC A;  3C95 A;  4H5R A;  4NCB A;  2P9N B;  3CJ1 A;  1BIS A;  3HVT A;  3TAQ A;  3BP8 A;  3OVN A;  1V4S A;  3NBP A;  2ZM6 K;  5HBM A;  3VN5 A;  3CI5 A;  3EE9 A;  2E20 A;  1VAZ A;  1CZB A;  5C0Y A;  1S6Q A;  4I6M A;  3O1W A;  2HF3 A;  3THX B;  3M8Q A;  3O1B A;  4OGE A;  2KFN A;  4F8R A;  3F9M A;  1ZBI A;  1NJZ A;  4CZK A;  4BDZ A;  3KD1 E;  2XY7 A;  2GEM A;  1VQK N;  3PX0 A;  3OBY A;  2QWL A;  5TKW A;  3O9U A;  5LL6 Z;  1JLE A;  4AH9 A;  3NF8 A;  4W5R A;  3I8D A;  1QHT A;  4FLV A;  3J7Y P;  3EE8 A;  2Y1J A;  3A0I X;  4B3M K;  1LOT B;  2XO7 A;  5FPD A;  1YVN A;  3DLB A;  5HL7 L;  1NGB A;  4HUG A;  1NG9 A;  3CQ8 A;  4J2E A;  1BI4 A;  4F4K A;  4PKI A;  4C8M A;  3CHW A;  4NYN A;  1VQ4 N;  5AQW A;  2PZS A;  3VQ8 A;  5C25 A;  1BA0 A;  3U4L A;  5M1Q A;  4BRO A;  4RTF D;  1MWM A;  2CH6 A;  4DTU A;  1IBM K;  1T6D A;  3OYJ A;  1GLB G;  2Z1H A;  3PV8 A;  4IOC L;  4CCH A;  2ASM A;  3VQ4 A;  3AGK A;  3PX4 A;  3O9T A;  1IH7 A;  2E6M A;  1ATR A;  1I39 A;  1B9F A;  4ZTF A;  4DQQ A;  3QER A;  1W7A A;  4BG9 A;  3I0S A;  1VSF A;  2O8C B;  1VSE A;  3VQ6 A;  5M1F A;  4FOE A;  3ATV A;  1UA1 A;  4FK4 A;  2KKZ A;  3L2V A;  3H45 C;  3C6H A;  1KLN A;  3W0L A;  2P9S A;  4B1V A;  5GAD P;  4H0T B;  4EHU A;  4FLX A;  1WB9 A;  4E1J A;  1BQN A;  1U04 A;  3J80 O;  4W5N A;  4O0J A;  3CXC M;  3C94 A;  1T44 A;  2E2N A;  4DSK A;  3CC2 N;  2E2O A;  3C7N A;  4FWP A;  1WSF A;  4KHQ A;  4DTX A;  3CCE N;  3TAM A;  1D9D A;  3BY5 A;  4HUE A;  2ASO A;  3L3U A;  5AQU A;  1K8K A;  2P9P A;  3G71 N;  3RWU A;  3D2E B;  4B9V A;  4C8N A;  4MDA A;  4CIG A;  3GBT A;  3FE1 A;  3DRS A;  3H6E A;  3CJ7 A;  1OVQ A;  4HTL A;  5AQI A;  3ZEU B;  3O80 A;  2VQE K;  1GLD G;  4FJ8 A;  2ZQB A;  3QEW A;  3EN9 A;  1NGF A;  2A6A A;  4A2A A;  3AAP A;  3N4P A;  3K5L A;  4RWT A;  4FM0 A;  3H3N O;  3QFU A;  1NGA A;  4KPY A;  4CJR A;  2HVH A;  1K73 O;  4FYD A;  3CPW M;  1IO2 A;  2XY5 A;  1W2B M;  4L3Q A;  3PSF A;  1HKB A;  4KB0 A;  1HKG A;  2X78 A;  3UKU B;  3SQ1 A;  1HNZ K;  4JS4 A;  2QTD A;  4JI5 K;  2ZD1 A;  1NKE A;  3VMF B;  1YTA A;  4YOV A;  1NMD A;  5AQQ A;  4CJF A;  4B9S A;  4FZX C;  4O55 A;  1VQO N;  4CEA A;  3FZF A;  4E0D A;  4A2B A;  4CJQ A;  3CC4 N;  3ZET B;  4CD3 A;  1IKW A;  5AQH A;  2E8A A;  3RSE B;  3LPU A;  3LWM A;  2OZM A;  1QE1 A;  3L8B A;  4BRQ A;  5FLX O;  1HNX K;  3C6U A;  2P9U A;  1S9E A;  5J2P A;  4ELU A;  3P4I A;  2D0O A;  1XWL A;  4KRF A;  2NUB A;  5HOO A;  4XH1 A;  4BVP A;  4JNE A;  1VQ8 N;  5KGW A;  4BWM A;  4NCA A;  1ZBH A;  1RDC A;  1Q7Y O;  4TSX A;  3J8A A;  4FJ7 A;  3AVG A;  3VGK A;  3SUO A;  4CZG A;  1YAG A;  4AM6 A;  3RR8 A;  2LSN A;  4PA1 A;  3RMB A;  3MXI A;  4JLH A;  3IAY A;  3KWG A;  3QET A;  3KZB A;  1RT7 A;  1D9F A;  2H3G X;  1A5W A;  1U2V A;  4CJU A;  4DB3 A;  1HNI A;  1OH6 A;  3WQU A;  4IO8 A;  5BRF A;  1IV0 A;  1BUP A;  1V4T A;  3VQ5 A;  4HVJ A;  3AO1 A;  3G25 A;  2Q1N A;  1KRP A;  1QZ6 A;  4CEE A;  3D7E O;  4GMJ B;  1SS6 A;  2YNF A;  3T3F A;  4F3O A;  4FJN A;  1EQY A;  1Y64 A;  3EZW A;  1HPM A;  5HRR A;  5F1X A;  4H03 B;  2WOM A;  3NH0 A;  4Z94 A;  5T7B A;  3WXL A;  3ID8 A;  3RR7 A;  4I9L A;  2QI2 A;  4H0V B;  4ELT A;  3VA0 A;  5AQT A;  4YNQ A;  4KTW A;  3WEE B;  3AO4 A;  3CF5 L;  5J2N A;  3HM9 A;  4DF8 A;  3H46 O;  2BH1 A;  2B6A A;  4JK8 A;  1TK8 A;  4FJ5 A;  4DSI A;  3TI0 A;  3N4Q A;  1CXU A;  3DLR A;  2I7P A;  4CHN A;  5CHI A;  3E01 A;  1T8E A;  4IOA L;  4DS5 A;  4BR0 A;  3VF6 A;  2XRI A;  3ZSX A;  1JLA A;  1LW2 A;  4CBX A;  1VQ9 N;  4WFB L;  4FJJ A;  3UE5 A;  4CJV A;  2G8U A;  4CBU A;  4Z4F A;  2DTU A;  3QEX A;  1HJO A;  3P31 A;  4E7H A;  4CJ7 A;  1JLQ A;  4FWS A;  4KTQ A;  3THY A;  2YHX A;  5GAH P;  3WXJ A;  5E26 A;  1NK6 A;  4FWR A;  4KI6 A;  4JRQ A;  3VTI A;  1BU6 O;  2QKB A;  3THX A;  4AHC A;  4DU4 A;  1EET A;  1VSD A;  1DGK N;  3LDP A;  4YOW A;  2RPI A;  1KD1 O;  4CF8 A;  4X65 K;  3AA2 A;  1H1V A;  3HTV A;  4IO9 L;  1YIT N;  1YJW N;  3M1F A;  3MN6 A;  4DTJ A;  4OPK A;  3NCI A;  1RDU A;  2WFB A;  2UXB K;  1HYZ A;  4LH5 A;  5AZJ B;  3KLH A;  5C42 A;  3SMS A;  3O3F A;  4RW7 A;  2VG5 A;  4BE2 A;  4L8R B;  3OA9 A;  4O8U A;  2HBM A;  4J2B A;  4N76 A;  4OPA A;  4W5Q A;  2FBV A;  3NF6 A;  4N5S A;  1QQO A;  2QWR A;  5AQG A;  4H0X B;  5KPZ A;  4CGD A;  1R0A A;  4DTP A;  3Q7C A;  4PWD A;  4JKA A;  3JSM A;  4E7I A;  3MX2 A;  4DR5 K;  4FWL A;  5ELZ A;  3IKM A;  2NNW A;  2F8S A;  1RT1 A;  2E6L A;  3GDQ A;  3M8S A;  2IDO A;  3CCS N;  4FM1 A;  3A5L C;  3AVB A;  1DKG D;  3LP3 A;  4K42 A;  3GE1 A;  1U49 A;  1T7P A;  3DRP A;  3OBW A;  3VQA A;  2O8F B;  2UXD K;  1RIL A;  1SKS A;  4GV9 A;  4RCH A;  1QQM A;  3FZM A;  3S9H A;  1U45 A;  1JL1 A;  3VEW A;  3TPQ A;  3MAQ A;  1BIU A;  5EY4 A;  3F9K A;  3UB5 A;  1S1X A;  4XEI A;  1BDG A;  4E19 A;  2KTQ A;  3WNE A;  5KRS A;  4JAX A;  5AQS A;  2YX6 A;  4BVO A;  3ULE B;  1NMN A;  3ENH A;  4YHH K;  3KWI A;  1OH7 A;  4FWN A;  4CVN E;  1L3U A;  1KLM A;  3B6P A;  4JKB A;  2YI1 A;  3D2E A;  2HB5 A;  4KAZ A;  4E3S A;  1KFS A;  1QSL A;  5KRT A;  3K9K A;  2G8H A;  2YJF A;  4EFH A;  1XUP O;  1E4F T;  1JCE A;  4J2A A;  4I7F A;  2QA4 N;  4NCG A;  3HPO A;  3THV A;  3ZEU A;  1ZC6 A;  4EZ9 A;  5HRS A;  4ISE A;  4QS8 A;  3VQE A;  3MXM A;  3HZ6 A;  5AQO A;  4OX9 K;  1VRT A;  3MN9 A;  4CJ4 A;  5BPM A;  4BRH A;  1YTU A;  3QIN A;  1K8A O;  2GV9 A;  2NRR A;  3NMU A;  3UKU A;  3C0B A;  4CHZ A;  3LP1 A;  4EAH D;  5BN8 A;  3OJS A;  1WN7 A;  4UY8 O;  3KJV A;  4AHT A;  3ZSY A;  4K41 A;  2Z1J A;  2OAN A;  1BA1 A;  3A5O C;  2V7Y A;  1Q86 O;  2HVI A;  5AQK A;  2R7Y A;  1OH8 A;  3WXI A;  1RFQ A;  4CZM A;  1E3M A;  4BRA A;  3ZET A;  1ASV A;  1C0T A;  1EX4 A;  3RSE A;  3EO3 A;  3AO3 A;  2VG7 A;  3CCR N;  4LF6 K;  3LM2 A;  4DR3 K;  3O3G A;  4Y1D A;  5M1N A;  2A1S A;  3H1Q A;  1I94 K;  3VQB A;  5EU7 A;  1WUA A;  4KKO A;  1YHQ N;  1T03 A;  5GIN A;  1ASW A;  1S1U A;  1TV6 A;  2QXF A;  3FGU A;  1VHX A;  4QAG A;  2QWQ A;  5AQM A;  4IOX A;  3V9S A;  1Q81 O;  2HBL A;  4CGH A;  1YUW A;  1C0U A;  3U9Z A;  3VQ7 A;  3NVK A;  3DLG A;  3L6Q A;  1GLE G;  5KPT A;  3KVG A;  3AVJ A;  3SQ0 A;  3AVF A;  5AFU A;  4A5A A;  1QTM A;  4ICL A;  2QXL A;  5SWM A;  4CJ5 A;  3HRG A;  1X3M A;  3SAH A;  4DMN A;  1YXQ A;  3ISN C;  4N47 A;  3LL3 A;  4RW9 A;  1SL2 A;  5KQD A;  4NO7 A;  5F0X A;  4ILG B;  1JJ2 M;  1NK9 A;  5I3U A;  4IBN A;  4ZHR A;  2JWL A;  3AY9 A;  5BRD A;  3CMA N;  1FXX A;  2FF3 B;  1K9M O;  3SQ4 A;  3VTH A;  2P9I B;  3T1Y K;  4ISG A;  3SMP A;  3V81 A;  4XIU A;  5J1E A;  1JLG A;  4PL8 A;  3VF2 A;  1EKE A;  4GV3 A;  2D5R A;  3ZSZ A;  1UAX A;  3IRX A;  2UXC K;  4NLB A;  3J7A P;  4IFY A;  3ENB A;  1N36 K;  1J9A A;  1ESV A;  4E7J A;  2QEX N;  3E66 A;  3G10 A;  3HXM A;  4HCC A;  4QCL A;  3F5T A;  4O8K A;  3M5R A;  4BRN A;  1TYQ B;  3ZT3 A;  1SKR A;  1TGO A;  3P1G A;  4CJW A;  4Z4C A;  2RKI A;  3MK6 A;  5BPL A;  4R5P A;  3A5M C;  3ZLJ A;  1W9H A;  5HRN A;  5JS2 A;  4FJM A;  5BR9 A;  3LAL A;  4FJK A;  3PSI A;  4PKH A;  3I55 N;  3RVC A;  3AVN A;  4DV7 K;  1ZBF A;  2DFE A;  4GY2 B;  1WSJ A;  1MA9 B;  1JCG A;  2AJQ A;  4H5N A;  4LH4 A;  3K9J A;  1N8R O;  2QWN A;  2OZS A;  2HNZ A;  4OKE A;  2OPP A;  2AA4 A;  2GX9 A;  4H5T A;  3ULD A;  4K0K K;  2P9K B;  3FZK A;  4DWI A;  4B1Y B;  1BG3 A;  1EO1 A;  3F2K A;  4BR9 A;  3PUF A;  3KKR A;  3KLE A;  1XNR K;  2NLX A;  3OS0 A;  1KSP A;  1LWC A;  1Q9Y A;  1HR0 K;  4E89 A;  5A2Q O;  5AZJ A;  3AVC A;  5C2D A;  2ZJQ L;  4H0P A;  4DU3 A;  3QDK A;  4FPA A;  3LAK A;  4MO4 A;  1WBB A;  3K5N A;  1WSI A;  3CQX A;  4IJA A;  2RE2 A;  1TKD A;  1RT3 A;  4OKJ A;  1LV5 A;  2O8E B;  4DTR A;  5FDL A;  1VQ7 N;  1NGJ A;  5BR8 K;  1YT3 A;  4OO1 J;  3HO1 A;  4DHY A;  2D0A A;  3DOL A;  2G8K A;  2B5J A;  2IVO A;  1VK0 A;  1NJW A;  1RBR A;  2QWP A;  2EWS A;  4DSL A;  2XHB A;  3CET A;  4CGJ A;  3L4I A;  3CCQ N;  4NYF A;  3NE6 A;  4CJK A;  3KK3 A;  4NB4 A;  1Y97 A;  3PIO L;  1HNV A;  1U4B A;  1HMV A;  5EOY A;  3VQ9 A;  4CW7 B;  4R79 A;  4CF0 A;  1BHL A;  4DKW A;  2O8F A;  4KHW A;  2VGN A;  2DFF A;  3IDH A;  1SAZ A;  3BEX A;  4CEO A;  2IVN A;  3OYH A;  3KK7 A;  2HOE A;  3OYA A;  4FLZ A;  4ZTJ A;  2PBD A;  5CZ2 A;  4CEC A;  2OCE A;  4FLY A;  4UQG A;  4BE0 A;  2Y1I A;  4V19 S;  3DLL L;  2O8D B;  4KB1 A;  4JI4 K;  2UU9 K;  2HHQ A;  3C6A A;  3WXM B;  1ZBU A;  4CF2 A;  3ULE A;  1JLB A;  3D0P A;  3HT3 A;  4DQ8 A;  3M8R A;  3MEE A;  4M7Y A;  4CIF A;  4DR7 K;  5AQX A;  4FWQ A;  5JMV A;  1IBK K;  5GAG P;  2IVP A;  2B4J A;  4KI4 A;  5HRO A;  1FKO A;  4OGC A;  5AQZ A;  1VQL N;  1P8Z A;  2Z1I A;  1OH5 A;  2D0B A;  3AA5 X;  4O0I A;  4BQZ A;  3EEQ A;  4BR2 A;  4CF1 A;  3Q7B A;  5C2F A;  1B92 A;  4GKK K;  4FZZ A;  5JVG L;  4BRI A;  4BE1 A;  3BDP A;  1CZ9 A;  3CCU N;  1VSK A;  4CIE A;  3KK1 A;  1G99 A;  4E7L A;  1Q82 O;  1S9G A;  2ZJR L;  1BIZ A;  3SI6 A;  2D4W A;  1C1B A;  3I0R A;  2YV0 X;  4GW6 A;  4JI0 K;  4PKG A;  4CEQ A;  5AFU H;  1C1C A;  3O5B A;  5I9E B;  3CJB A;  3MEG A;  3OS2 A;  3QIP A;  1KAZ A;  3J81 O;  4DTO A;  2I7N A;  4QS7 A;  1KAY A;  4AM7 A;  4M3X A;  3DLK A;  1ZBL A;  4KO0 A;  2V7Z A;  3ENO A;  4CGI A;  1XC9 A;  4YOU A;  1MWK A;  3O8M A;  2NRV A;  3VGM A;  3ZT1 A;  3HJF A;  2CGJ A;  1Z26 A;  5H1S Q;  2D0P A;  2VCP A;  3ZT2 A;  2Q0U A;  3E9P A;  3CD6 N;  2YHW A;  4BRC A;  2HHU A;  3JXU A;  4Q5V A;  2HW3 A;  4A5B A;  4DQP A;  1FJG K;  2E1Z A;  4JV5 K;  2JLE A;  3VEO A;  2WUS A;  5AZI B;  1NK7 A;  1S22 A;  2ZJP L;  3NAE A;  2VWK A;  4YOY A;  3GL1 A;  2F9T A;  5FRN A;  5M1P A;  1HYV A;  5JS1 A;  1RTH A;  2YJE A;  4NLC A;  1FW6 A;  3LDO A;  2E2Q A;  4B9U A;  3G0Z A;  4CJT A;  2KFZ A;  3R6M A;  4DV1 K;  2CGL A;  3SLC A;  3EZ5 A;  1BO5 O;  4K25 A;  2X74 A;  1T05 A;  1GLL O;  2GBZ A;  2HF4 A;  2KHO A;  5C15 A;  1XQS C;  3CYM A;  2D0C A;  1UWB A;  1YIJ N;  3OYD A;  3THW B;  3AVA A;  3VF4 A;  4BRD A;  1X3N A;  1KQS M;  4I2Q A;  2ASP A;  3CJA A;  4FOI A;  3TSQ A;  3O3H A;  4NXM K;  1VQ5 N;  3TSP A;  5LY3 A;  3OYM A;  1NWK A;  4J2D A;  4GVM A;  2D1K A;  3DOK A;  2A5X A;  3MWT A;  3OYL A;  4LY7 A;  1N33 K;  1REV A;  1BWF O;  1NK0 A;  5JLF A;  2ITM A;  3TSU A;  5JIC A;  2QW9 A;  1B9D A;  3TTF A;  3O4Q A;  4B9Q A;  4B3O A;  3ZX0 A;  3KHY A;  1IJJ A;  3RRG A;  4LF5 K;  3LDN A;  2P9I A;  1BQM A;  4O4G A;  2W41 A;  4E1N A;  3OYC A;  3VEN A;  1NOY A;  1LW0 A;  1XMQ K;  3ATU A;  1WOQ A;  1G15 A;  5E41 A;  4DCH A;  4CF9 A;  3PO5 A;  3SUQ A;  4N56 A;  1O1W A;  3C65 A;  5HP1 A;  2P9N A;  4RW4 A;  3QBW A;  4OPJ A;  4CZF A;  2ZGZ A;  1QZ5 A;  3AV9 A;  5AR0 A;  4CEB A;  1XC3 A;  2GUP A;  1QQC A;  1S1W A;  3VEV A;  3FZH A;  3VPZ A;  4E7K A;  3U3G A;  2BDP A;  2OA8 A;  4I6M B;  3SUN A;  1TYQ A;  4JHD B;  5LMU K;  3VEX A;  4CER A;  3V9Z A;  4X66 K;  4FJ9 A;  4B8A B;  4FW1 A;  2QK9 A;  4DFP A;  3VOV A;  4HTU A;  2KW4 A;  1MDU B;  3QFP A;  2E4L A;  1VQM N;  2V51 B;  4CEF A;  3HOT A;  3S3O A;  2VQF K;  3NVM A;  1L3S A;  1YVU A;  1NJI O;  4B1X B;  3VER A;  3VQQ A;  1WAJ A;  4CZE A;  3CFP A;  4DUZ K;  2NZT A;  4JI1 K;  1R59 O;  4IDH A;  4YOX A;  5BPN A;  1D4X A;  4FWK A;  3SBT A;  3DYA A;  4BQL A;  4HHT A;  3HP6 A;  2P9K A;  4H5W A;  1TKZ A;  3TR8 A;  4JI6 K;  3CIP A;  5AQJ A;  3IUC A;  4CED A;  1SZ2 A;  3TTD A;  3PX6 A;  5KI6 A;  4CES A;  1Q9X A;  2FSN A;  5CY4 A;  2X6N A;  2GWJ A;  3K2P A;  2HHH K;  3DXM B;  4BG8 A;  4CE9 A;  3TAP A;  4O5F A;  3ALY A;  4CGF A;  5FPM A;  4FLU A;  2P5G A;  1RDW X;  4M7X A;  3OYE A;  3ZT4 A;  4C1N I;  4DU1 A;  1NKB A;  1NM1 A;  4BRM A;  4DV2 K;  3HST B;  4WYB A;  3NGY A;  1ZXO A;  3W3D A;  1C0F A;  1TK0 A;  2ITG A;  2YHY A;  2O8C A;  1HYS A;  4JN4 A;  3MCP A;  2Q2R A;  5CR4 A;  1KVB A;  4AHR A;  1VQP N;  3CG7 A;  4JRP A;  1TAQ A;  2G8I A;  2E1Y A;  3LWL A;  2A40 A;  5J2Q A;  3L0Q A;  2UUC K;  1TKX A;  3CM6 A;  4A61 A;  4LFA K;  5AQL A;  1SKW A;  2PY5 A;  1RTD A;  1RCH A;  3KLG A;  3FFI A;  5DMR A;  3ZSV A;  3O9R A;  4JKD A;  1HQU A;  4KFB A;  4DG1 A;  4MDB A;  1EWQ A;  3T69 A;  3R8E A;  3RMC A;  1N5Y A;  4JKG B;  1IBL K;  4OVL A;  1W0H A;  3ZX3 A;  3BUZ B;  2IC3 A;  3SPZ A;  3DWL A;  3FR0 A;  3QB0 A;  1NGE A;  4KH6 A;  3NH1 A;  4FJX A;  4H5V A;  2O8D A;  5MLC Q;  1U47 A;  4IEE A;  4M3Y A;  2DPN A;  3L2W A;  3L3V A;  3AVH A;  3LP2 A;  2Q97 A;  2FBX A;  3BGR A;  4IZ9 A;  3AVK A;  1KAX A;  3K59 A;  2I5J A;  3V9W A;  2HHS A;  1GLJ O;  4JD2 B;  5I42 A;  1RTI A;  3OY9 A;  2PYJ A;  3VEY A;  1NGG A;  1NKC A;  3CME N;  5F2R A;  3TAR A;  2O4I A;  5DM6 L;  3AAQ A;  3TTC A;  1RBS A;  3LZJ A;  3RMD A;  4RW8 A;  2UUA K;  2J4R A;  3LDQ A;  2G8V A;  1NJX A;  4CHO A;  3I56 N;  3T7Z A;  3KK2 A;  1XHX A;  2HNY A;  4OPH A;  4KV8 A;  5B8H A;  2OTL N;  2IOC A;  2W40 A;  4F9O A;  4IFE A;  4EP5 A;  4B1Z A;  2IGI A;  4DR2 K;  2PAV A;  4JYA K;  3ZSW A;  4G1Q A;  3DAW A;  5M1O A;  3O4W A;  3P38 A;  4CEZ A;  1LAV A;  4EIA A;  4JKH A;  2QWO A;  1BOT O;  5SZT A;  3DXK B;  4JI2 K;  1NLV A;  1SUQ A;  2FSK A;  1NGD A;  3O08 A;  1N6Q A;  4CJE A;  1RT6 A;  4M3W A;  2P9U B;  2NRT A;  4DLG A;  5CYQ A;  2NRZ A;  3QNO A;  4JEP A;  4H8K A;  2YKM A;  1QVF M;  1HJR A;  3WNH A;  4DQS A;  5AQV A;  1EP4 A;  3MED A;  2O4G A;  2W6K A;  4CFC A;  4AF1 A;  4JS5 A;  4Z4I A;  2WON A;  2VWJ A;  2FXU A;  2E88 A;  4CFD A;  4DV5 K;  5AZI A;  2YHB A;  3QEI A;  4DR6 K;  5TKY A;  4BGA A;  1ZYQ A;  4GVE A;  4B8C A;  2Q36 A;  4JK9 A;  3A2F A;  3T1A A;  1O13 A;  1N34 K;  1WSG A;  2BE2 A;  4CZI A;  2KZM A;  1NU0 A;  3NGI A;  4J8F A;  4Z4H A;  4M42 A;  4LSL A;  4A57 A;  5KGX A;  4FJH A;  2GEL A;  4F2S A;  3MX5 A;  4B3R K;  3O9S A;  1JLF A;  1TKT A;  3THW A;  1TAU A;  1DTT A;  4YFU A;  5KPR A;  2G8F A;  2W6L A;  2HHW A;  1RBT A;  2HHX A;  2WBN A;  1ILY A;  4IJN A;  4GNI A;  5FRM A;  2ETJ A;  1RNH A;  4MQ3 A;  3ZT0 A;  4JK7 A;  4DS4 A;  3WEE A;  4DV4 K;  4CFB A;  3V1Q A;  3S3N A;  2EX3 A;  4C8K A;  1KTQ A;  4KH4 A;  3V1R A;  3CM5 A;  2FF6 A;  4BRG A;  5AJ3 K;  3OYF A;  3E9L A;  1DEJ A;  1YJN N;  5LMN K;  1NJY A;  4BWJ A;  1GOB A;  4PHT X;  4Z4G A;  4WQ5 C;  3TAF A;  1M90 O;  1JLC A;  1VSI A;  2F9W A;  4W5T A;  1QS4 A;  4IFV A;  5C10 A;  2NRW A;  3V1O A;  1TL1 A;  5AQF A;  3H08 A;  3HI0 A;  1Z25 A;  4DTN A;  4AHU A;  1ASU A;  3THY B;  1RT4 A;  1FKP A;  2RF2 A;  4IWV A;  3IG1 A;  4IEI A;  5EXW A;  3SYZ A;  3AO2 A;  4EHT A;  3QBX A;  4C1N K;  4CK3 A;  1M1K O;  2Z1G A;  3QO9 A;  3ZCM A;  4JHD A;  3SCX A;  4PUO A;  4WQ4 A;  4WF9 L;  4X64 K;  3HSC A;  2FBT A;  2UYT A;  1RDB A;  3MEC A;  5BN9 A;  4LF8 K;  4A62 A;  3HP9 A;  2NRH A;  3P83 D;  4WQ5 A;  4B08 A;  1XHZ A;  1IKV A;  5AQN A;  1E4G T;  4KHU A;  1S3X A;  5D3G A;  3R9P A;  3RMA A;  1JXB A;  2JWK A;  1VSL A;  4XH5 A;  2W42 A;  1X1P A;  2E5L K;  3MCA B;  3B6O A;  3SUP A;  3B8A X;  3GOI A;  3HOS A;  2VYP A;  3DXM A;  4C23 A;  2FLO A;  3ZSR A;  1XI1 A;  1QVG M;  4U67 L;  1VQ6 N;  2OPQ A;  3OYI A;  4B1U B;  3LZI A;  5GIO A;  3OYK A;  3SV3 A;  4BC4 A;  4FWO A;  4CHY A;  3CCJ N;  1IG9 A;  3L2R A;  3SQ2 A;  4M3Z A;  4FM2 A;  1X9J A;  3SJH A;  4H4O A;  5AQR A;  1N32 K;  3HL8 A;  1IKX A;  1I3A A;  2FBY A;  3NDK A;  3DLH A;  2P51 A;  5ADX A;  1KVC A;  2XY6 A;  1SL1 A;  5CZ1 A;  3NFA A;  4BC5 A;  2VGM A;  4DQR A;  4KHY A;  3DMJ A;  3EY1 A;  4FJG A;  2HBJ A;  4GV6 A;  1IKY A;  3OYN A;  1RBV A;  4ID1 A;  2OPS A;  4AQY K;  4X62 K;  1J5O A;  3NH2 A;  4W5O A;  5IT9 O;  3OS1 A;  1WLJ A;  4FVU A; 
#chains in the Genus database with same CATH homology
 4IDK A;  3OYM A;  4J2D A;  4IG3 A;  4E19 A;  2KTQ A;  4FLW A;  5J2M A;  4GVM A;  4RW6 A;  3DOK A;  4OJR A;  3L2Q A;  3WNE A;  3OYL A;  4LY7 A;  4DSF A;  1REV A;  5KRS A;  4Z4E A;  5HRP A;  1NK0 A;  3KTQ A;  4FW2 A;  3OYB A;  3TAB A;  1B9D A;  1BCO A;  3DLE A;  2BGG A;  4FJL A;  1GOA A;  3O4Q A;  1WSE A;  4FXD A;  4B3O A;  3RRG A;  1L3U A;  1GOC A;  2ATQ A;  3VQC A;  1KLM A;  1S1T A;  1RTJ A;  3B6P A;  4Z0U A;  3CFR A;  4KHS A;  1BQM A;  4O4G A;  4E1N A;  2HB5 A;  3OYC A;  4DSJ A;  4E3S A;  1LWE A;  3S3M A;  1QSL A;  5KRT A;  4O44 A;  3K5M A;  1HQE A;  1NOY A;  3OYG A;  1KFS A;  4C8L A;  1LW0 A;  2G8H A;  3RTV A;  4ID5 A;  3VQP A;  1G15 A;  2YHA A;  4M45 A;  5E41 A;  4I7F A;  4J2A A;  3K57 A;  3SZ2 A;  4CF9 A;  3PO5 A;  3JYT A;  3SUQ A;  4NCG A;  3C95 A;  3HPO A;  4N56 A;  1O1W A;  3THV A;  4EZ9 A;  5HP1 A;  5HRS A;  4NCB A;  1QSS A;  2HHT A;  4F3T A;  4RW4 A;  3NF9 A;  1BIS A;  3HVT A;  3TAQ A;  1UOC A;  3CFO A;  4OPJ A;  3QLH A;  3AV9 A;  1JKH A;  3VQE A;  3KLI A;  3MXM A;  3OVN A;  4CEB A;  2PYL A;  3NBP A;  4DLE A;  1QQC A;  1S1W A;  1VRT A;  5HBM A;  3VN5 A;  4AHS A;  4CJ4 A;  4E7K A;  2G8W A;  2HMI A;  1YTU A;  1CZB A;  3T19 A;  1S6Q A;  3U3G A;  2BDP A;  2OA8 A;  4FJI A;  3QIN A;  4F2R A;  3SUN A;  4CGG A;  2GV9 A;  3NF7 A;  3M8Q A;  4CHZ A;  3LP1 A;  4CER A;  3V9Z A;  3OJS A;  4DF4 A;  1WN7 A;  4B8A B;  4FJ9 A;  4FW1 A;  4OGE A;  4AHT A;  3KJV A;  2A1R A;  4DFP A;  2QK9 A;  4F8R A;  1ZBI A;  2KFN A;  1NJZ A;  3ZSY A;  4HTU A;  2KW4 A;  4BDZ A;  3KD1 E;  2E4L A;  2XY7 A;  4CEF A;  2Z1J A;  3S3O A;  4E1M A;  1L3S A;  3PX0 A;  1YVU A;  3VQQ A;  1WAJ A;  3CFP A;  1L5U A;  3HPH A;  2HVI A;  2R7Y A;  1JLE A;  1U48 A;  4AH9 A;  3NF8 A;  4W5R A;  3I8D A;  1QHT A;  4FLV A;  3TAE A;  2Y1J A;  3IS9 A;  2HHV A;  1ASV A;  1JL2 A;  4H4M A;  2YKN A;  1C0T A;  1EX4 A;  2XO7 A;  1KVA A;  1WSH A;  4DFJ A;  3AO3 A;  3DYA A;  3SJJ A;  4HHT A;  3DLB A;  2VG7 A;  3KKS A;  3HP6 A;  4HUG A;  1TKZ A;  3TR8 A;  3O3G A;  4Y1D A;  3CQ8 A;  4J2E A;  4CED A;  1BI4 A;  2A1S A;  3PX6 A;  3QEV A;  5KI6 A;  4CES A;  3V9X A;  4C8M A;  1Q9X A;  4F4K A;  5CY4 A;  2DFH A;  4AIL C;  2X6N A;  4NYN A;  3K2P A;  3VQB A;  1JXE A;  3U6F A;  2PZS A;  3VQ8 A;  4CE9 A;  5C25 A;  5EU7 A;  3TAP A;  4KKO A;  4B9N A;  3ALY A;  4CGF A;  4FLU A;  1N6Q A;  2P5G A;  1T03 A;  3KLF A;  1ASW A;  4DTU A;  1X9S A;  1S1U A;  1TV6 A;  2QXF A;  4QAG A;  3OYE A;  3ZT4 A;  3TWH A;  3OYJ A;  2Z1H A;  4FCY A;  3PV8 A;  4CCH A;  4DQI A;  3AA3 A;  4DU1 A;  1NKB A;  3V9S A;  4KTZ A;  3VQ4 A;  3PX4 A;  3HST B;  1IH7 A;  3NGY A;  4IKF A;  1DLO A;  2E6M A;  4CGH A;  1I39 A;  1TK0 A;  4FK2 A;  2ITG A;  1B9F A;  4ZTF A;  1C0U A;  4DQQ A;  3QER A;  3VQ7 A;  3I0S A;  4FK0 A;  1VSF A;  1HYS A;  3DLG A;  1VSE A;  3VQ6 A;  5CYM A;  1S5J A;  3DM2 A;  3K5O A;  1FK9 A;  4AHR A;  1KVB A;  1TK5 A;  3CG7 A;  1UA1 A;  4FK4 A;  1L3V A;  4JRP A;  3C6T A;  3L2V A;  2KZZ A;  1TAQ A;  3AVJ A;  2G8I A;  3SQ0 A;  1QSY A;  3AVF A;  1QTM A;  3LWL A;  5J2Q A;  1KLN A;  1TKX A;  3CM6 A;  4ICL A;  5SWM A;  4CJ5 A;  4FLX A;  1SKW A;  2PY5 A;  1RTD A;  1RCH A;  3O4N A;  1BQN A;  1U04 A;  4DMN A;  3KLG A;  1NK5 A;  3FFI A;  5DMR A;  4W5N A;  1D5A A;  4O0J A;  3ZSV A;  3ISN C;  4N47 A;  4RG8 A;  1S6P A;  3C94 A;  4RW9 A;  1HQU A;  1SL2 A;  4KFB A;  4DG1 A;  4DSK A;  3F73 A;  1S1V A;  2IAJ A;  1HRH A;  1D8Y A;  1EXQ A;  1WSF A;  4KHQ A;  1NOZ A;  1TVR A;  4DTX A;  1NK9 A;  5I3U A;  3WNG A;  3TAM A;  3RMC A;  1D9D A;  4BDP A;  2GUI A;  3LPT A;  4IBN A;  4ZHR A;  1N5Y A;  4OVL A;  5K14 A;  1W0H A;  4W5O A;  2FC0 A;  4HUE A;  1FXX A;  4EZ6 A;  1VSH A;  3L3U A;  2IC3 A;  1A5V A;  3SPZ A;  3NH1 A;  3SQ4 A;  3RWU A;  4FJX A;  3RRH A;  4B9V A;  4C8N A;  3V81 A;  4CIG A;  4XIU A;  5J1E A;  1JLG A;  1U47 A;  4CJP A;  3DRS A;  4M3Y A;  4DSE A;  1EKE A;  2YNI A;  3L2W A;  3L3V A;  3AVH A;  3LP2 A;  4Y1C A;  5FRO A;  2D5R A;  3ZSZ A;  1UAX A;  3KD5 E;  2FBX A;  3IRX A;  4CK1 A;  1X9W A;  2P1J A;  3BGR A;  4PY5 A;  3SPY A;  3AVK A;  3LAN A;  3K59 A;  2I5J A;  4IFY A;  3V9W A;  4FJ8 A;  2HHS A;  2ZQB A;  3QEW A;  3HYF A;  1J9A A;  5I42 A;  1RTI A;  3K5L A;  4FM0 A;  4E7J A;  3OY9 A;  2PYJ A;  2OYQ A;  1NKC A;  4KPY A;  4CJR A;  2HVH A;  3TAR A;  4CK2 A;  2O4I A;  4FYD A;  1S1X A;  3G10 A;  3HXM A;  1IO2 A;  1RBS A;  4HCC A;  4KRE A;  2XY5 A;  4QCL A;  1RDD A;  3LZJ A;  3RMD A;  4RW8 A;  4KB0 A;  3ZT3 A;  1SKR A;  1TGO A;  2X78 A;  3P1G A;  4AHV A;  4CJW A;  4Z4C A;  3ZSQ A;  2RKI A;  4MFB A;  3SQ1 A;  4R5P A;  2G8V A;  4WE1 A;  4JS4 A;  1NJX A;  3ASM A;  1BGX T;  3VQD A;  1W9H A;  4CHO A;  3V9U A;  4M3U A;  1LWF A;  5HRN A;  2ZD1 A;  1XHX A;  3KK2 A;  1NKE A;  3KIO A;  5JS2 A;  2HNY A;  1BL3 A;  4FJM A;  4KV8 A;  3LAL A;  4FJK A;  2IOC A;  1YTA A;  3AVN A;  1J53 A;  4EP5 A;  4FVM A;  2YNG A;  4B9L A;  4M41 A;  2IGI A;  4CJF A;  3LDS A;  1ZBF A;  2DFE A;  4B9S A;  1WSJ A;  4FZX C;  4O55 A;  1RBU A;  3ZSW A;  4G1Q A;  2AJQ A;  4CEA A;  4LH4 A;  4CEZ A;  1KCF A;  4E0D A;  1LAV A;  4CJQ A;  2OZS A;  2HNZ A;  4OKE A;  3SV4 A;  1IKW A;  4LSN A;  2OPP A;  3LPU A;  3LWM A;  2OZM A;  5SZT A;  3HK2 A;  1QE1 A;  3AO5 A;  3L8B A;  3ULD A;  4DWI A;  1SUQ A;  3OJU A;  1BCM A;  3AVM A;  3C6U A;  3KKR A;  3PUF A;  1RT6 A;  1BI4 B;  4CJE A;  3KLE A;  1S9E A;  2XY8 A;  4DLG A;  5J2P A;  5CYQ A;  4ELU A;  3OS0 A;  1KSP A;  3PO4 A;  1LWC A;  1Q9Y A;  1XWL A;  4KRF A;  2NUB A;  3QNO A;  4E89 A;  4H8K A;  3VA3 A;  2YKM A;  2F96 A;  1HJR A;  3AVC A;  3HPG A;  3WNH A;  5KGW A;  4CHQ A;  4BDY A;  1EP4 A;  3MED A;  4BWM A;  4DQS A;  4DU3 A;  1A5X A;  4NCA A;  1ZBH A;  3LAK A;  3AVL A;  2O4G A;  1RDC A;  4FLT A;  4CFC A;  2X6S A;  4TSX A;  1WNS A;  3K5N A;  4JS5 A;  4Z4I A;  2WON A;  2VWJ A;  1WSI A;  4ELV A;  4FJ7 A;  3AVG A;  4CFD A;  1TKD A;  3SUO A;  1RT3 A;  1SV5 A;  4OKJ A;  3ZSO A;  1LV5 A;  4DTR A;  2YHB A;  3QEI A;  5FDL A;  2LSN A;  3RR8 A;  4DTM A;  1RT5 A;  4PA1 A;  1YT3 A;  1SL0 A;  1ZYQ A;  3RMB A;  3QEP A;  4B8C A;  3MXI A;  3HO1 A;  4JLH A;  3IAY A;  3QET A;  3A2F A;  2D0A A;  1RT7 A;  3DOL A;  1UA0 A;  2B5J A;  3T1A A;  1D9F A;  2G8K A;  4CFA A;  1WSG A;  1A5W A;  2BE2 A;  1VK0 A;  4CJU A;  3QNN A;  1NJW A;  1RBR A;  4DSL A;  2XHB A;  1HNI A;  4CGJ A;  2KZM A;  4I2P A;  2YNH A;  3NGI A;  3QES A;  4M3W A;  4NYF A;  3VQ5 A;  4HVJ A;  4Z4H A;  3AO1 A;  3NE6 A;  4M42 A;  4LSL A;  4CJK A;  3KK3 A;  1KRP A;  3EYZ A;  1Y97 A;  5KGX A;  1HNV A;  3SNN A;  4CEE A;  4GMJ B;  1U4B A;  2YNF A;  1HMV A;  4HUF A;  4FJH A;  4F2S A;  3T3F A;  3M8P A;  3VQ9 A;  4F3O A;  4FJN A;  3AA4 A;  3LAM A;  1JLF A;  3V4I A;  1TKT A;  5HRR A;  4CF0 A;  1BHL A;  1TAU A;  1DTT A;  4YFU A;  2G8F A;  1VRU A;  4K8X A;  4KHW A;  2F8T A;  2HHW A;  2DFF A;  1RBT A;  2VG6 A;  2WOM A;  3NH0 A;  4QOZ B;  2HHX A;  4CEO A;  3OYH A;  5T7B A;  5FRM A;  3OYA A;  2ETJ A;  1RNH A;  4MQ3 A;  4M3R A;  3ZT0 A;  4CJS A;  1X9M A;  4FLZ A;  4I9L A;  4DS4 A;  2RN2 A;  4ZTJ A;  3RR7 A;  5CZ2 A;  4ELT A;  3VA0 A;  4CEC A;  5DK5 A;  4YNQ A;  4KTW A;  1C0M A;  3AO4 A;  4LD0 A;  4FLY A;  4CFB A;  1CLQ A;  3V1Q A;  5J2N A;  2IS3 A;  4UQG A;  3HM9 A;  4BE0 A;  4DF8 A;  2Y1I A;  4BAC A;  1NK8 A;  4C8O A;  4OLB A;  2ZE2 A;  3P5J A;  2EX3 A;  4EP4 A;  3S3N A;  4KB1 A;  2B6A A;  2HHQ A;  5KTQ A;  4C8K A;  1KTQ A;  3NHG A;  1ZBU A;  4CF2 A;  3V1R A;  1JLB A;  3CM5 A;  1TK8 A;  4FJ5 A;  3OYF A;  4DSI A;  1CXQ A;  3TI0 A;  1RDA A;  3HT3 A;  1CXU A;  3DLR A;  2BAN A;  4CHN A;  3D0P A;  1NJY A;  4BWJ A;  3M8R A;  1GOB A;  1LAW A;  1C6V A;  3MEE A;  4Z4G A;  4CIF A;  1F21 A;  3TAF A;  3E01 A;  1RT2 A;  1T8E A;  1JLC A;  1VSI A;  1WAF A;  3HVR A;  4DS5 A;  2EHG A;  2B4J A;  3DI6 A;  2XRI A;  3ZSX A;  5HRO A;  1JLA A;  4KI4 A;  1LW2 A;  1K6Y A;  1FKO A;  1NK4 A;  4FJJ A;  4OGC A;  4CJV A;  2G8U A;  4W5T A;  4IG0 A;  2Z1I A;  1QS4 A;  4Z4F A;  4IFV A;  2DTU A;  2D0B A;  3V1O A;  1L3T A;  1TL1 A;  3AA5 X;  4O0I A;  3QEX A;  4OLA A;  3ITH A;  1MU2 A;  4CF1 A;  4E7H A;  2KQ2 A;  3H08 A;  1B92 A;  1Z25 A;  1JLQ A;  4KTQ A;  4DTN A;  4FZZ A;  1ITG A;  2OPR A;  3V6D A;  4AHU A;  1ASU A;  4BE1 A;  1RT4 A;  1FKP A;  3BDP A;  1CZ9 A;  2RF2 A;  3UIQ A;  1NK6 A;  3IG1 A;  1VSK A;  4CIE A;  3KK1 A;  3K58 A;  3SYZ A;  4E7L A;  1S9G A;  4KI6 A;  1BIZ A;  3AO2 A;  4CJL A;  4JRQ A;  2HND A;  3SI6 A;  1C1B A;  3I0R A;  2YV0 X;  4GW6 A;  3WNF A;  4CK3 A;  4I9Q A;  4PQU A;  4CEQ A;  2QKB A;  2Z1G A;  3QO9 A;  4AHC A;  4DU4 A;  1EET A;  1VSD A;  3ZCM A;  1C1C A;  4DFK A;  2QKK A;  3SCX A;  2RPI A;  4PUO A;  4CF8 A;  3TAN A;  3MEG A;  1Q8I A;  4B9T A;  3AA2 A;  3OS2 A;  3QIO A;  3QIP A;  4DTO A;  2FBT A;  4FZY A;  1RDB A;  3AVI A;  3MEC A;  4M3X A;  3DLK A;  1ZBL A;  3HP9 A;  3P83 D;  4KO0 A;  4B08 A;  4OPK A;  3NGZ A;  3NCI A;  4DTJ A;  1IKV A;  1XHZ A;  4B9M A;  3MXJ A;  1HPZ A;  4CGI A;  1XC9 A;  5HLF A;  2Q3S A;  4KHU A;  5D3G A;  1HYZ A;  3PY8 A;  3RMA A;  1JXB A;  4LH5 A;  3ZT1 A;  3HJF A;  1VSL A;  1Z26 A;  3KLH A;  2W42 A;  1KFD A;  3ZT2 A;  5C42 A;  1TL3 A;  1X1P A;  2HHU A;  4Q0B A;  1VSJ A;  4Q5V A;  2HW3 A;  3B6O A;  3SUP A;  4DQP A;  3O3F A;  4RW7 A;  5C24 A;  2VG5 A;  4BE2 A;  1C1A A;  4DTS A;  4L8R B;  2JLE A;  1NK7 A;  4J2B A;  4N76 A;  3NAE A;  2VWK A;  4W5Q A;  1VSM A;  3DRR A;  2FBV A;  3ZSR A;  3NF6 A;  4N5S A;  1XI1 A;  5FRN A;  5JS1 A;  1HYV A;  1RTH A;  2OPQ A;  4CGD A;  1R0A A;  4DTP A;  3OYI A;  4PWD A;  3U3Y A;  3LZI A;  3JSM A;  4E7I A;  3TAG A;  4B9U A;  3OYK A;  4KHN A;  3SV3 A;  4K8Z A;  4CHY A;  3G0Z A;  4CJT A;  2KFZ A;  1IG9 A;  3L2R A;  3SQ2 A;  4M3T A;  2F8S A;  3L2U A;  3EZ5 A;  4M3Z A;  1RT1 A;  4FM2 A;  2E6L A;  2X74 A;  1T05 A;  3M8S A;  2GBZ A;  4H4O A;  4O5B A;  2IDO A;  3HL8 A;  1IKX A;  1I3A A;  2FBY A;  3NDK A;  4DFM A;  3DLH A;  2P5O A;  4CJ3 A;  4FM1 A;  2P51 A;  2XY6 A;  1KVC A;  1SL1 A;  3AVB A;  5CZ1 A;  3LP3 A;  3CYM A;  3NFA A;  2D0C A;  1UWB A;  1U49 A;  1T7P A;  3OYD A;  4DQR A;  3AVA A;  3DRP A;  4KHY A;  2JGU A;  3DMJ A;  3EY1 A;  3VQA A;  4FJG A;  3LP0 A;  4I2Q A;  1RIL A;  4CHP A;  1IKY A;  1SKS A;  1DTQ A;  2DY4 A;  3OYN A;  1RBV A;  4ID1 A;  3S9H A;  1JL1 A;  1U45 A;  3D45 A;  4OKK A;  2OPS A;  3O3H A;  4KAZ A;  1J54 A;  3MAQ A;  1J5O A;  3NH2 A;  4N41 A;  1BIU A;  3F9K A;  3OS1 A;  4HCB A;  1WLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...