3AO1A

Fragment-based approach to the design of ligands targeting a novel site in hiv-1 integrase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
151
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
molecule keywords POL polyprotein
total genus 52
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao1A00
5D3GA 4CJVA 1FXXA 2OZSA 4Z4IA 1KLMA 2IC3A 5DMRA 4F3OA 3QEPA 1TK5A 2YNFA 4C8NA 1LWFA 4FJJA 3KLIA 4I2PA 3AA5X 3LWMA 3DOLA 3RMCA 4IG0A 1ZBFA 1MU2A 1RILA 3NF8A 4JLHA 1NK6A 1WAJA 4OVLA 4R5PA 3QNNA 3QEWA 2FC0A 5KGWA 4XIUA 3K58A 3TAEA 3NHGA 3QO9A 3H08A 4C8MA 4BDZA 1YTUA 1HYSA 3CFOA 4FJ9A 3AVCA 2X6SA 3OYBA 3NAEA 3SZ2A 3DLRA 4N47A 2BE2A 2B6AA 3IAYA 4CJ3A 4NCAA 1SKRA 2DTUA 4DU1A 3AVIA 4DSKA 3NF7A 4KO0A 3OYCA 3K5LA 2R7YA 4FVMA 3SQ2A 3PO5A 2Z1HA 4FJ7A 2FBTA 3LZJA 1WSHA 3TAGA 1Q9YA 2HVHA 3M8QA 1CZ9A 4OPJA 4N5SA 1S1VA 4DQQA 2YV0X 2ZE2A 4CHQA 4L8RB 4ZHRA 3AVMA 3NH0A 4JRQA 4DSIA 1ZBUA 4FM2A 1KCFA 1JLCA 3LALA 5CY4A 3ZSZA 4AILC 2PYLA 3V9UA 2BDPA 1IO2A 1WLJA 1TAQA 3OYLA 1HRHA 2HHTA 4DFMA 4W5QA 4ELVA 3HPGA 4CEDA 4AHCA 1L3UA 3AVLA 1RCHA 1S5JA 3TAPA 1KVAA 4OJRA 3NH1A 1VRTA 3NGYA 3NH2A 3TR8A 3AVKA 3V9SA 5K14A 4Z4CA 3TARA 4CEQA 2VG7A 4FW2A 3RR7A 4B8AB 1X9WA 3OJUA 4O0IA 2PZSA 1X1PA 4WE1A 2X78A 3U3YA 5HROA 4CIFA 3TAQA 4CJFA 4B08A 3KLEA 3NBPA 3VN5A 3ISNC 3MXIA 2QKKA 4HCBA 4N76A 1NK7A 1L3VA 3K57A 2HMIA 3SPZA 3L8BA 4AHSA 1TKXA 1RBTA 4CGIA 4J2BA 3KLFA 2E4LA 3SYZA 3T19A 5J2NA 4MQ3A 4MFBA 4CFBA 3CM6A 3VQQA 4FM0A 3LZIA 4CF8A 4OPKA 3KTQA 4ICLA 2RN2A 1BIUA 5CZ1A 4M45A 1JL1A 4E89A 3HYFA 3NGZA 3E01A 4O44A 3K5MA 4EZ9A 4HCCA 2AJQA 3MXMA 5HRPA 3CFRA 4QAGA 1HNIA 4DLGA 1X9SA 1QTMA 3QIOA 2PY5A 2HNDA 4DTSA 1F21A 2FBXA 1HPZA 2Y1JA 3IG1A 4CJEA 2OYQA 4LSNA 3P83D 3VQPA 1IKWA 3KKSA 3NFAA 5T7BA 4KHUA 4FJMA 5HLFA 2PYJA 3HVRA 1K6YA 4B8CA 3V4IA 1R0AA 4CHZA 1D8YA 1YT3A 4DWIA 1VSFA 3LAKA 1XI1A 1VSHA 2DFHA 4CGHA 4CJLA 1IG9A 1BCOA 2P1JA 3U6FA 2A1RA 1VSKA 1VSMA 3B6OA 4KHWA 3OYIA 1KSPA 3QETA 4FZYA 3ITHA 3D45A 4M3RA 1S1XA 4AHVA 1D9DA 1SV5A 1HMVA 4DSEA 4PY5A 4CJUA 3L2RA 2B5JA 1VK0A 3OYJA 3MEEA 3EYZA 1HYZA 4HUGA 2YNHA 1NK4A 2HW3A 4H8KA 1UA1A 1O1WA 1BGXT 3U3GA 3MEDA 4FK0A 2HHUA 1EP4A 3VA3A 3SCXA 4JS4A 1C1BA 1Z25A 1ASWA 3AO5A 1KVBA 4CHPA 4DS5A 5J2MA 3ASMA 2P51A 4IBNA 4K8XA 3V81A 1RBSA 2HNZA 4CEZA 4E7JA 4DS4A 4BDPA 4B9VA 4DFJA 1C6VA 1C1CA 1QS4A 2Z1GA 2YHBA 2D0AA 5FROA 4CK1A 4CHNA 3ZSXA 4ZTJA 1UA0A 1NJWA 3QINA 1JLBA 4B9MA 4CEAA 3SV4A 1Z26A 2XY7A 1IKYA 4NYNA 4I7FA 4Z4FA 4DG1A 3AVGA 1WSFA 4FLZA 3O3HA 3RMDA 1QQCA 3A2FA 4KI6A 4DSFA 2RPIA 1RT4A 4DFKA 4FJXA 4PWDA 2HHSA 3WNHA 4Q0BA 3DOKA 2I5JA 5CYMA 4CERA 1J5OA 3L2VA 4CHOA 3OYDA 4DF8A 1KRPA 4FJNA 3SI6A 5I42A 3BDPA 1JXBA 2P5GA 4LD0A 1DTTA 4IG3A 4DTNA 1S6PA 3AA4A 1YVUA 1LW0A 2DFFA 1ASUA 4CIEA 3LWLA 4FLXA 4F2SA 3ZSOA 3VQ5A 3F9KA 2IAJA 1JLEA 4GMJB 4Y1DA 3O3FA 3QERA 1SKSA 1VSEA 1LW2A 2OPSA 4G1QA 4BACA 4DQPA 3LP3A 2KZMA 3NCIA 4FXDA 3WNFA 3LDSA 2OPPA 3IRXA 3OYHA 3TI0A 1QSYA 2KW4A 2E6LA 3AV9A 4GW6A 1IKVA 1UOCA 3T3FA 4LH4A 3NGIA 4DTOA 1RTDA 4UQGA 4FLYA 3SQ0A 3DLGA 5KGXA 1VSJA 4CHYA 2BANA 2DFEA 3OYFA 1S9EA 4CJKA 4KHYA 4FM1A 3C6TA 3OYEA 3OJSA 1ZBIA 3WNEA 1HNVA 2EX3A 5DK5A 1BI4B 1NKCA 2Z1JA 1A5WA 1TVRA 2ZQBA 3AO3A 1FKOA 1DLOA 4FJGA 3EY1A 2YNGA 4CEFA 3AO1A 3V6DA 1NKBA 4CFDA 4BWMA 4B9LA 5JS2A 3OYGA 4CF1A 3KLGA 1S1WA 3DM2A 3KJVA 3SQ4A 3LPUA 3MEGA 3UIQA 1JL2A 1REVA 2VG5A 3V1RA 1C0TA 3VQEA 1FK9A 2D0BA 4QCLA 4M41A 3I0RA 3RMAA 4KKOA 1QHTA 3L3VA 3O3GA 1X9MA 4DQIA 4FJLA 2ATQA 3QIPA 2GUIA 4KTWA 4Y1CA 4ELUA 4CIGA 5SZTA 2A1SA 1J9AA 4OKEA 1YTAA 4PQUA 1JXEA 4RW8A 1W0HA 5CZ2A 1LAVA 3HSTB 4J2DA 2XY5A 2JGUA 3L3UA 1U49A 4CCHA 3TWHA 2IS3A 4CJTA 1RNHA 1L3SA 2Z1IA 3HXMA 4KREA 3QEIA 2XRIA 4FJIA 4FYDA 1KFDA 2YNIA 3JSMA 4E7IA 3DLBA 3SJJA 1RBUA 1TK8A 3QESA 1S1UA 4KAZA 3NF6A 4C8LA 4KRFA 1KVCA 3AVAA 3C95A 1DTQA 1NJYA 4CJ4A 3EZ5A 1KLNA 3TAMA 4AHUA 4FCYA 3NDKA 1RT1A 4Z4EA 3PUFA 2ZD1A 4HHTA 1NJXA 1EXQA 3V9XA 3ZCMA 1XHZA 2HNYA 2E6MA 1QSLA 3CYMA 1TKTA 3VQ4A 4FLUA 4BE2A 3AVBA 4B9UA 2YHAA 4DTRA 1SL1A 4YNQA 3K5OA 3ULDA 1BQMA 3SPYA 1JLAA 2QKBA 3RTVA 3S9HA 5J1EA 3MXJA 3P5JA 4I2QA 4BE1A 3C94A 3K5NA 4CEBA 2O4GA 3RRHA 1U45A 4BDYA 5I3UA 1EKEA 5HP1A 2G8KA 4DQSA 4KTQA 3JYTA 3QNOA 1KFSA 2G8IA 1HJRA 1S6QA 1CZBA 1WAFA 3OY9A 1HQEA 4B9SA 4Z0UA 1XC9A 2G8WA 4B9NA 2ITGA 4F8RA 3TANA 2XO7A 1J53A 4OGEA 3L2QA 1HQUA 2LSNA 3KIOA 3CQ8A 1N5YA 2HHQA 4FJHA 4FZZA 4DTPA 2BGGA 4H4MA 3ALYA 3PO4A 1L3TA 4CK3A 4DLEA 3NE6A 2OA8A 4O4GA 4W5NA 2FBYA 2X6NA 1CLQA 1U48A 3VQCA 2P5OA 5KRSA 4FJ5A 4FK2A 4CGGA 4BWJA 3DLKA 1RT3A 4RW4A 3ZT4A 1VSDA 4M3XA 4M3UA 3LAMA 4RW6A 3MECA 3QEXA 4KHQA 4NCGA 3KK3A 2OPQA 4ID1A 4HUEA 3ZT3A 4K8ZA 1J54A 3O4QA 3VQ6A 5HRNA 3VQAA 3IS9A 4F4KA 4J2EA 4Z4GA 2Q3SA 3ZSQA 4PA1A 3PV8A 3HPOA 5JS1A 3LANA 1JLGA 4N41A 1JLFA 1W9HA 2D0CA 3O4NA 4N56A 4DMNA 5HRSA 1B92A 3HT3A 3THVA 4AHTA 2Y1IA 3BGRA 3HJFA 2IDOA 3LP2A 4LY7A 4DU3A 1UWBA 3MAQA 3SV3A 1L5UA 4LSLA 4E19A 4OKJA 4CEEA 3K59A 1QSSA 3AO2A 4FLWA 3L2WA 2XY6A 1U04A 1NK0A 2ETJA 4B3OA 4PUOA 2W42A 1RTHA 1ZYQA 5HBMA 1Y97A 1S9GA 3P1GA 4KI4A 2WOMA 4CJ5A 4E1NA 4KV8A 4CESA 4FLVA 4CGFA 1CXQA 1RT5A 3VQ9A 3WNGA 2RF2A 1GOAA 4DTUA 2HHVA 3RWUA 4FW1A 3V9ZA 5HRRA 4JS5A 1NJZA 1ZBLA 1RBVA 4CJRA 3OYAA 4IDKA 1RT6A 4CFAA 3S3MA 4W5OA 2WONA 4M3WA 2IOCA 1QE1A 4F3TA 1B9DA 4CJPA 4NYFA 1RTJA 4IFVA 3V1QA 3I0SA 2XY8A 5FDLA 3L2UA 3PX4A 4LH5A 3NF9A 1D9FA 1BHLA 3AVHA 5C42A 1KTQA 3DLHA 1FKPA 1RT2A 2OZMA 4RG8A 4OLAA 5KRTA 3V1OA 5SWMA 3OVNA 4AHRA 4ELTA 4FK4A 2F8TA 4ID5A 4IFYA 4CK2A 5C25A 1SL0A 3OS2A 4HTUA 4DSJA 3DYAA 1T03A 1N6QA 1RDDA 3OYNA 1LV5A 1D5AA 5C24A 3VQ8A 3SUPA 4FJ8A 1BL3A 1HYVA 4YFUA 3VQ7A 1Q9XA 4DTJA 2HHXA 3AA3A 4DQRA 4FLTA 3TABA 3QLHA 1G15A 4IKFA 1XWLA 5EU7A 2HVIA 4KPYA 4CGDA 1TGOA 4GVMA 4EP4A 3V9WA 4TSXA 1U47A 4EP5A 1NOYA 1S1TA 1BCMA 1TV6A 1C0MA 3SUNA 4C8KA 2KFZA 3AVFA 1LWCA 3CM5A 4W5RA 2KZZA 1JKHA 4E7LA 4B9TA 4CF9A 1TL1A 1WN7A 4HVJA 3OS1A 1GOCA 3HM9A 5FRNA 3KKRA 1TAUA 4M3YA 1BI4A 3PX0A 4CEOA 2F96A 3HVTA 4CJSA 4DTMA 3LPTA 3D0PA 3M8PA 1ZBHA 4C8OA 1WSJA 4KB0A 4E7KA 4O5BA 4HUFA 1VSLA 1WSIA 2O4IA 3HK2A 1WSGA 3ZT1A 1I39A 1XHXA 4CGJA 3DRPA 1BQNA 1WNSA 1TKDA 3HL8A 3G10A 1UAXA 4OKKA 1NK8A 2G8FA 3AVNA 3SUOA 2OPRA 5J2QA 4OLBA 4KTZA 3ZSVA 4DTXA 3DMJA 2F8SA 1SL2A 3FFIA 5KTQA 2GBZA 4FJKA 1B9FA 4QOZB 3PX6A 1NKEA 1GOBA 3CG7A 3VQBA 2QK9A 1ASVA 3ZSRA 3CFPA 3LP1A 4J2AA 1BIZA 3C6UA 2VG6A 4CECA 3HP6A 3DI6A 4DF4A 1VRUA 4CJQA 2EHGA 2XHBA 4EZ6A 1TKZA 3PY8A 1TK0A 3DLEA 4Q5VA 4ZTFA 3ZT0A 1JLQA 3QEVA 1EETA 4F2RA 4KB1A 3VA0A 4DFPA 3ZSWA 4E1MA 3AO4A 3M8SA 2GV9A 2YKNA 1IH7A 4CJWA 5KI6A 3KK2A 1ITGA 2IGIA 1NK9A 4M42A 4AH9A 4KHSA 3KK1A 3DRSA 1A5VA 5FRMA 1LWEA 4I9QA 3KLHA 4Z4HA 4W5TA 4E3SA 1NK5A 3KD5E 3DRRA 2FBVA 1T7PA 1C1AA 3M8RA 1IKXA 2DY4A 3HO1A 1Q8IA 2X74A 1NOZA 3S3NA 1T8EA 3ZT2A 4M3ZA 3S3OA 3RR8A 2KFNA 2G8VA 2NUBA 1RDCA 4O55A 5J2PA 3SQ1A 2G8UA 4KFBA 2YKMA 4RW7A 4KHNA 4RW9A 2VWKA 3TAFA 4O0JA 4CFCA 4FZXC 4NCBA 1SKWA 1RDBA 3HPHA 3B6PA 1T05A 3T1AA 3G0ZA 5E41A 3VQDA 2HB5A 2HHWA 3SUQA 3OYMA 3ZSYA 1RBRA 1EX4A 4M3TA 3HP9A 2KQ2A 1LAWA 1SUQA 1RTIA 4H4OA 3OS0A 4CF2A 1WSEA 2KTQA 1I3AA 2RKIA 3LP0A 3F73A 4E7HA 2D5RA 4OGCA 3AA2A 1RT7A 2VWJA 2QXFA 5CYQA 3RRGA 2JLEA 2G8HA 1RDAA 4I9LA 4DSLA 1U4BA 1VSIA 3KD1E 3SNNA 4CF0A 2B4JA 1BISA 4DU4A 1A5XA 1TL3A 1CXUA 3I8DA 4BE0A 4E0DA 3AVJA 3OYKA 4CE9A 4JRPA 3RMBA 3K2PA 1C0UA
chains in the Genus database with same CATH superfamily
2E1YA 4V19S 4Z4IA 1KLMA 3N4PA 4JI7K 3AA5X 2E20A 4ISFA 2W6KA 1ZBFA 4CZKA 1WAJA 4CZMA 4R5PA 1HKCA 1YTUA 3NHGA 3QO9A 1NGIA 3H08A 3M3ZA 3H3OB 4EHUA 4JI0K 3VGKA 4FJ9A 3OYBA 2BE2A 2P9PB 2B6AA 4CJ3A 4NLBA 3IMXA 2QM1A 4DSKA 1ATNA 2D1KA 1R59O 1DGKN 3D2EB 2KLAA 3K5LA 2F8SA 3PO5A 1NLVA 3H1QA 1DKGD 1CZ9A 4OPJA 4DQQA 2YV0X 2ZE2A 4L8RB 1EO1A 3V9UA 3I55N 3CF5L 4ELVA 4CEDA 3AVLA 3UKUA 3NH1A 1VRTA 3TR8A 3MCPA 3OBYA 4Z4CA 4FW2A 2WBNA 4B8AB 1X9WA 1WOQA 4O0IA 1Q81O 3BZKA 4B08A 3CJ1A 1TUUA 3K57A 1TKXA 5J2NA 3T19A 4YY3K 1HNZK 3MWPA 4FM0A 3E66A 1BIUA 4HCCA 3E01A 4IFEA 4R79A 4QAGA 4DLGA 2HNDA 1GLAG 1HPZA 1X3NA 4CJEA 3P83D 1Q18A 3VF4A 1NM1A 4A62A 3CCLN 5HLFA 1K6YA 1R0AA 3ID8A 4BGBA 1Z05A 1BCOA 2P1JA 4KHWA 3K9JA 1KSPA 3NVKA 5F2RA 3ITHA 3D45A 3T1YK 2CGLA 1NU0A 3CC7N 4M3RA 2P9NA 3OYJA 5LJWA 5AQIA 2HW3A 5M1NA 1UA1A 3U3GA 3EN9A 1EP4A 3VA3A 5LJVA 1ZBSA 5JMVA 1Z25A 4DS5A 1KVBA 3QMLA 4Z94A 3T69A 4PL8A 4JKDA 2QWMA 4B9VA 2NRHA 1C6VA 1C1CA 4KHQA 2D0AA 1GLLO 1TYQA 1NJWA 1N36K 4CEAA 4Z4FA 4I7FA 5CE3A 3RMDA 3CCMN 5C2DA 2RPIA 1RT4A 4H5WA 2ZM6K 1YAGA 5AQTA 3DOKA 5FLXO 5GIPA 4KHPK 3OYDA 4DF8A 1KRPA 4FJNA 5I42A 5F0XA 4LD0A 3KWIA 1DTTA 5JLHA 4DTNA 1GLJO 3AA4A 2F7TA 1LW0A 4FOIA 1NGBA 3TSPA 2IAJA 1JLEA 4GMJB 1SKSA 1VSEA 1LW2A 2OPSA 4G1QA 5AR0A 4ILJA 3L4IA 3AV9A 1UOCA 3T3FA 4UQGA 3SQ0A 3CIPA 5KGXA 2E2OA 3OYFA 1S9EA 4CJKA 3OJSA 1ZBIA 5DK5A 1BI4B 1NKCA 1C0GA 1E4GT 3CCRN 5GAHP 3ENBA 2YNGA 5EOYA 3V6DA 1X9JA 4CF1A 3KLGA 3SQ4A 2Q31A 3MN7A 4M41A 3WT0A 4H5NA 4DQIA 4HWIA 4FJLA 2ATQA 3A8YA 1Q86O 3WXIA 4Y1CA 3O08A 3P38A 4LF8K 1JXEA 1W0HA 2E2NA 3M5RA 1LAVA 2ZWHA 3CJ9A 5EXWA 4JKGB 2CH5A 2IS3A 5AQJA 1OH5A 2XRIA 4FJIA 4GKJK 1N32K 3DLBA 3SJJA 1RBUA 4K25A 4DCHA 1KVCA 3C95A 1DTQA 1NJYA 3TAMA 1NJXA 2E2QA 5H1SQ 4DTRA 3FZKA 1BA0A 3K5OA 1BQMA 3TTDA 3CCVN 3MXJA 1VQ6N 3P5JA 4CI6A 3K5NA 4CEBA 3RRHA 5MLCQ 2G8KA 4KTQA 1X3MA 4PKHA 3OY9A 1CZBA 1XC9A 3GBTA 4BR0A 2G8WA 4B9NA 3L2QA 1HQUA 3KIOA 3WXKA 2BGGA 4JNEA 3ALYA 3PO4A 1L3TA 3OA9A 4CK3A 1NG9A 3VOVA 4B3RK 3U9ZA 2FBYA 2QXLA 3SAHA 4FJ5A 3O4WA 1RT3A 4RW4A 3E9PA 3OBWA 2HOEA 4B1VA 3OW2M 3KK3A 4OX9K 3KZBA 3QB0A 4U67L 1HUXA 4J2EA 5AQZA 4FWQA 3D7EO 3HPOA 3LANA 1JLGA 3R8EA 2D0CA 3CPEA 2V52B 3J81O 3Q7BA 4JI6K 3BGRA 3EZWA 4LY7A 4IOXA 3SAGA 4LSLA 3K59A 1QSSA 4FLWA 1U04A 4B3OA 2ETJA 2W42A 1RTHA 1ZYQA 3CQXA 5HBMA 1Y97A 2I7PA 3BP8A 1NNEA 1HNWK 3UKUB 4FLVA 1CXQA 4DTUA 4FW1A 1YVNA 1NJZA 1ZBLA 1RBVA 3F5TA 4CJRA 3OYAA 1K73O 1K8AO 3C0BA 1RT6A 3KK7A 4W5OA 2WONA 4NYFA 1QVGM 3I0SA 2XY8A 5FDLA 5C42A 1KTQA 3DLHA 3BF1A 3CMEN 4RG8A 4YOUA 3F9MA 5SWMA 2O8CB 5LMUK 4ELTA 4FK4A 4IZ9A 4CK2A 3TSUA 5IWAK 1OH7A 4DSJA 3VEWA 1N6QA 4FL9A 1OVYA 5C24A 3VQ8A 4C1NK 4CZIA 4YFUA 3VQ7A 2FSKA 4JKCA 3VEOA 4M7XA 1G15A 4CZJA 1NGAA 5EU7A 2HVIA 4J8FA 3J7ZO 1CZAN 3V9WA 3AY9A 5M1OA 5E84A 4W5RA 4E7LA 4B9TA 4CF9A 3J7YP 4CEOA 3MN6A 4CJSA 4DTMA 5BRDA 2NRZA 3H46O 4C8OA 2GELA 4KB0A 2YJFA 1WSIA 3ZT1A 1VQ8N 4CGJA 5C10A 4YOXA 1TKDA 3G10A 2G8FA 1NK8A 2V7ZA 3SUOA 5J2QA 1MA9B 1RDUA 4KTZA 2ASOA 4XH5A 4B9QA 1DEJA 3ATVA 4CZFA 5JVGL 3LM2A 4JKAA 4A2BA 4CECA 3E1YA 4BQZA 3DI6A 2EHGA 1M1KO 3PY8A 1I94K 3FR0A 4JHDA 3J8AA 3M1FA 4BC4A 4DFPA 2ASPA 4E1MA 4BR7A 4DV6K 1KC8O 4DR1K 1IBLK 4CD1A 4B1YB 1A5VA 1LWEA 2UUAK 3KLHA 3ZX3A 1NK5A 1TYQB 1C1AA 3E9LA 3M8RA 4I6MA 4KBOA 1NOZA 4M3ZA 5KPZA 1WUAA 1EQYA 2KFNA 3SQ1A 4RW7A 2VWKA 3SMPA 4CFCA 1RDBA 2D0PA 4LF6K 3B6PA 4CW7B 4BRLA 2P9KB 5BPNA 4X65K 1EX4A 1Z6RA 3AAQA 5AQGA 2KTQA 4H0YB 5GADP 4DV4K 3LP0A 1K8KB 1J6ZA 4OGCA 1T6DA 3AA2A 2VWJA 2QXFA 5CYQA 3RRGA 2G8HA 4I9LA 4CBXA 1U4BA 3QFPA 1JJ2M 3DXMA 4CF0A 4DU4A 2O8CA 1CXUA 2P9UB 4E0DA 3IKMA 4J2BA 3K2PA 3C7NA 4IWVA 5D3GA 4CJVA 5AZIA 1FXXA 1IV0A 5DMRA 4F3OA 3QEPA 2AA4A 5KPTA 3VESA 4FJJA 4JLHA 1NK6A 4KH4A 3QNNA 3QEWA 3I56N 3CCJN 5AQHA 2IVPA 3CFOA 4JAXA 3NAEA 4LF9K 3DLRA 4BRNA 4N47A 3IAYA 2DTUA 1SKRA 4IDHA 4KO0A 2OTLN 2Z1HA 3LZJA 1WSHA 3M8QA 1NWKA 3KWGA 1VQLN 4N5SA 3ULEA 1YJ9N 2W41A 3AVMA 3NH0A 2NRVA 4FM2A 3ZSZA 3LALA 3MX2A 4YDUC 4AILC 3CETA 4CZLA 2HHTA 4AHCA 3QBWA 1S5JA 4H03B 3V9SA 3AVKA 3TARA 4YOVA 2PZSA 2P9PA 4WE1A 5HROA 3TAQA 4BY9C 4CJFA 2D0OA 3KLEA 3NBPA 2UUBK 1NK7A 2J4RA 4QS7A 5GIOA 3FGUA 4B1ZA 3T7ZA 3R1XA 4E1JA 3WXLA 3KLFA 3EKUA 4MQ3A 4MFBA 4BRHA 3VQQA 4CFBA 2GWKA 4OPKA 4BVPA 3K5MA 4JKFA 3MXMA 3O5BA 1HNIA 1X9SA 2PY5A 2O8FB 4DTSA 1F21A 2QEXN 2OYQA 5T7BA 3NFAA 5M1FA 4JI1K 4JEPA 4B8CA 4IEEA 1VSFA 3D6RA 4A59A 2A42A 1VSKA 1VSMA 3B6OA 3QETA 1HMVA 2B5JA 3EYZA 2YNHA 1BGXT 3MEDA 1KAXA 1MWMA 3SCXA 5LMNK 4CBUA 3A5MC 1ASWA 4LF4K 1ILYA 3ASMA 3AGKA 3MK6A 4EAHD 3U9DA 1RBSA 4JKHA 5FROA 3CJBA 4ZTJA 1OH8A 3CHWA 1UA0A 2YI1A 4B9MA 2QWNA 3SV4A 4DG1A 3AVGA 1NGCA 4FLZA 2P9SA 4WCEL 3A2FA 4KI6A 2ASMA 3G25A 3WNHA 5CYMA 1RFQA 3L2VA 4FWOA 1XMOK 1J5OA 3THXB 5AZIB 4O8UA 1S6PA 4CIEA 1ASUA 4F2SA 4FLXA 1RDWX 3ZSOA 2YCHA 4DQPA 3LP3A 3HBTA 3DXMB 3HOTA 4H0OA 2AP1A 2OPPA 3OYHA 2KW4A 2E6LA 4GW6A 3SJHA 4WQ5A 4U7BA 4LH4A 3SBGA 3NGIA 1RTDA 2E5LK 5GINA 5AQVA 1K8KA 3DLGA 4GV3A 2NRRA 2A5XA 2GTDA 3L0QA 3AO3A 3OHRA 1DLOA 2O8DB 5HOOA 2ZJPL 4IO9L 2Q0RA 2P9LA 3AO1A 3VTHA 4CFDA 4B9LA 3OYGA 3H3NO 1S72N 2RE2A 3DM2A 3LPUA 3MEGA 1JL2A 2VG5A 2A40A 1C0TA 3V1RA 4BC2A 5JICA 1FK9A 2OTJN 4QCLA 3VERA 1X9MA 4KKOA 1QHTA 1QQNA 4KTWA 4ELUA 4BRDA 5SZTA 2A1SA 3MX5A 5E26A 1YTAA 3K9KA 1KAZA 1C0FA 4AQYK 5CZ2A 4C1NI 4J2DA 2XY5A 2JGUA 2OANA 3L3UA 3UE5A 4IEIA 4CCHA 5AZJA 3RVCA 5AQNA 1YUWA 4CJTA 1L3SA 2Z1IA 3QDKA 4MLHA 2VGNA 2VGMA 4E7IA 2F4VK 3MDQA 1S1UA 4KAZA 3NF6A 4C8LA 4KRFA 5ELZA 3EZ5A 4FCYA 4CZHA 4Z4EA 2ZD1A 4HHTA 5ADXA 3ZCMA 3CYMA 5C2FA 2QW9A 3EE8A 4H5RA 4FLUA 4B9UA 4B3TK 2VYPA 2IVNA 4YNQA 3SPYA 1GLBG 2RHKA 4I2QA 1ESVA 2O4GA 3O9UA 5HP1A 4DQSA 3JYTA 2VWBA 2G8IA 3BEXA 1WAFA 3MCAB 3LM9A 4JYAK 4F8RA 2HBJA 2NRTA 2Q97A 2LSNA 4YORA 4FJHA 4DTPA 3WUHA 1J5EK 1RGIA 4O4GA 4W5NA 2X6NA 1CLQA 5KRSA 1NMDA 4CGGA 4BWJA 3ZT4A 1V4TA 1VSDA 4M3XA 1VQ9N 4ID1A 4HUEA 3O4QA 3VQAA 3EL2A 4QS8A 3ZSQA 4Z4GA 3IUCA 4RTFD 4ILHA 1JLFA 4N56A 4DMNA 1B92A 2Y1IA 5LL6Z 4RWTA 3HM8A 3LDPA 1L5UA 4JD2A 4E19A 4AM6A 5TKWA 3D2EA 3L2WA 2XY6A 5C15A 2W40A 5DM6L 4CJ5A 4CGFA 3VQ9A 3WNGA 2RF2A 1GOAA 1DT9A 4JS5A 1SAZA 4IJNA 4IDKA 2D4WA 4JK7A 4CFAA 4M3WA 3V1QA 1KD1O 2ZGYA 2ZGZA 4LH5A 3GOIA 5M1QA 3AVHA 2HMPA 4XH4A 1FKPA 1RT2A 3D2FB 2OZMA 2P9SB 1LOTB 4OLAA 3V1OA 2KKZA 4AHRA 4A5AA 2F8TA 4IFYA 3ZETB 2P9IB 3OS2A 4HTUA 2BH1A 4JKBA 1RDDA 1D5AA 4BVOA 1U6ZA 4MDAA 1O13A 2E8AA 4JI2K 5BN8A 4FLTA 1TUYA 5DM7L 2DPNA 3THYA 4CGDA 1TGOA 4GVMA 3WEEB 4EP5A 4AM7A 1S1TA 4C8KA 2KFZA 3AVFA 1JKHA 3FZLA 1TL1A 1WN7A 4HVJA 1N34K 1TAUA 4M3YA 3PX0A 2UXBK 1U2VB 1ZBHA 3GDQA 1WSJA 4A57A 2GUPA 3FFKB 4O5BA 4E7KA 4KH6A 2O4IA 2IIRA 1I39A 1XHXA 5AJ3K 1FJGK 2O8EA 3MMVA 4BG8A 1SQKA 3VEZA 4GY2B 2HBMA 4QOZB 1NKEA 3DAWA 3CG7A 3ATUA 3CFPA 1KXPA 4HTLA 4CJQA 2XHBA 4EZ6A 3U8XA 3WEEA 2O8BB 4BREA 1QZ5A 2YHYA 5EY4A 2FLOA 1QQMA 2YKNA 3THWA 1IH7A 3KK2A 2PFUA 5IT9O 3DRSA 5FRMA 4E3SA 2FBVA 2V51B 1T7PA 2DY4A 5AQOA 5KQDA 1Q8IA 2X74A 3EO3A 1T8EA 3RR8A 5J2PA 4YOWA 1JCEA 4FZXC 3TAFA 2NRWA 1SKWA 1HKGA 3T1AA 2BUPA 2GEMA 3ZSYA 4H5TA 3OTOK 2KQ2A 1RTIA 3OS0A 1WSEA 5AQLA 1I3AA 3W0LA 2D5RA 5CHIA 4O8KA 5BRHA 1RDAA 4DSLA 5FPEA 4MO5A 5HL7L 1JCGA 4CD3A 1BISA 1VQPN 3AVJA 3OYKA 1W97L 2OZSA 2IC3A 2YNFA 1LWFA 3K0SA 4I2PA 3TPQA 3LWMA 1MU2A 3NF8A 4H0TB 1GLFO 3G71N 2P9UA 2FC0A 4XIUA 1LCUA 5AQRA 4BDZA 3AAPA 3AVCA 2X6SA 1BO5O 3AVIA 3WQTA 3NF7A 3OYCA 4FVMA 3PIOL 3SQ2A 4FJ7A 2FBTA 1Q9YA 4K43A 1VAZA 4L3QA 1S1VA 4XEIA 4CHQA 1KAYA 4IJAA 4JRQA 4DSIA 1ZBUA 1KCFA 1JLCA 2PYLA 3L6QA 2BDPA 1IO2A 1TAQA 3OYLA 4BROA 4W5QA 4C23A 1RCHA 1KVAA 1QZ6A 3R3LA 3NGYA 3NH2A 1MDUB 4CEQA 3OJUA 1X1PA 3U3YA 2X78A 3BY5A 4CIFA 3MXIA 3RWUA 3VN5A 3ISNC 3JXUA 4NXMK 4BR9A 3P39A 5BPLA 1RBTA 2E4LA 4IXCA 4Y0WA 4CF8A 5CZ1A 4M45A 3NGZA 3HYFA 4EZ9A 3CFRA 4FWLA 1QTMA 1VHXA 3IG1A 4FWKA 3VQPA 2QWOA 2UU9K 4XH1A 4FJMA 3LDLA 5ADXH 1FW6A 1D8YA 2HBKA 4DWIA 3LAKA 3CC2N 4CGHA 5AFUH 4CJLA 2E88A 3U6FA 2A1RA 2WUSA 3OYIA 1GLDG 4FZYA 1W2BM 4AHVA 2Q2RA 4PY5A 4CJUA 3L2RA 4O5FA 2JWKA 5JVHL 1NK4A 2A3ZA 3N4QA 4BRGA 1O1WA 3CCEN 5FPDA 4B1UB 3ZYYX 3AO5A 3CERA 2P51A 3BUZB 4IBNA 2BTFA 4K8XA 3CPWM 3TSQA 3VETA 4CEZA 4F9OA 4DS4A 5F1XA 2AJQA 1QS4A 4CK1A 4CHNA 3ZSXA 4GNIA 4BC5A 4NYNA 1WSFA 3O3HA 3M6GA 1EWQA 2QWLA 2HHHK 3UKRB 2O8BA 3FE1A 4A2AA 3THXA 4CERA 2PBDA 4CHOA 4MO4A 2FF6A 3EEQA 4LC9B 3AGRA 2P5GA 1YVUA 3LWLA 1NGGA 3VQ5A 3F9KA 1NGDA 4Y1DA 3O3FA 3QERA 2KZMA 4BACA 2YX6A 3NCIA 4FXDA 3LDSA 3IRXA 3I8BA 1IKVA 4WYBA 3DLLL 4CBWA 1VSJA 4DQ8A 4KHYA 4FM1A 3C6TA 3WNEA 3KHYA 1JCFA 4BR4A 2Z1JA 1A5WA 1TVRA 4FJGA 4MLEA 5B8HA 4BWMA 3KJVA 3E9OA 4YOTA 3DXKA 2CGKA 3VEYA 3VENA 1HPMA 4CZEA 3I0RA 2OCEA 3RMAA 4QS9A 5LY3A 3QIPA 4KH5A 2GUIA 3ZETA 4H0PA 4DV3K 4JV5K 4IOAL 2IVOA 4OKEA 4PQUA 4RW8A 3C6HA 5M1KA 1HX1A 3HSTB 4DUZK 3F2KA 4IOCL 3EE9A 4DV5K 3TWHA 1RNHA 3HXMA 4KREA 1KFDA 2YNIA 4DV1K 3JSMA 3QESA 1KLNA 4CJ4A 4AHUA 3ZLJA 3AARA 1XHZA 3J80O 3VQ4A 4BE2A 2YHAA 4FVUA 1SL1A 2QKBA 3S9HA 5J1EA 2E1ZA 1U45A 3O8MA 4BDYA 4X62K 1SS6A 1KFSA 2FXUA 1VQNN 4Z0UA 4B1XB 3A5LC 5AQXA 1ZC6A 4JKGA 4JK8A 4H0XB 1J53A 3ZX2A 2HHQA 3CQ8A 2ZJRL 2FF3B 4BRFA 4DLEA 4M7YA 3VQCA 2P5OA 3DLKA 3O9RA 4M3UA 3MECA 5A2QO 4EHTA 1V4SA 3ZT3A 5HRNA 3IS9A 2Q3SA 4FOEA 4PA1A 4X64K 4N41A 3HT3A 5HRSA 3O9QA 4DR7K 1YITN 4A61A 1NBWA 4DR6K 1XNQK 3LP2A 4DU3A 4A5BA 1UWBA 3MAQA 1T44A 4OKJA 5EX5A 3VGLA 5AQUA 5AQMA 4ISGA 3VF6A 4B1WB 3SMSA 3SBTA 1GLEG 3P1GA 1NGJA 4NB4A 4KI4A 4FWPA 1HNXK 3PSFA 3O9SA 2HHVA 4JI4K 3V9ZA 4DKWA 3THWB 5FPMA 2Q1NA 4DR2K 1WBBA 4BRMA 1QHAA 4CJPA 1RTJA 3VF2A 3L2UA 2NLXA 4OPHA 2ZF5O 3ZX0A 4BRCA 1BHLA 3VMFB 1D9FA 3B8AX 2Q36A 3NVMA 2VQEK 3OVNA 1SL0A 2WTUA 3OYNA 1LV5A 3SUPA 1HYVA 2GWJA 3WXMB 1YJWN 2HHXA 3AA3A 4DQRA 3TABA 3DXKB 1XWLA 4CZGA 4KPYA 1NOYA 4TSXA 3O1BA 1BA1A 1BCMA 1TV6A 1C0MA 4MDBA 4LFCK 1GOCA 3KKRA 4K42A 4UY8O 4PKIA 3HVTA 2P9NB 5I9EB 3ENOA 4G9ZA 1D4XA 3BZCA 1ATSA 1N33K 1VSLA 3PLAA 4BR5A 1WSGA 1YXQA 4WFAL 3G6EN 1BQNA 1WNSA 3FZFA 3HL8A 4GKKK 1UAXA 4OKKA 4CJ7A 3AVNA 3ZSVA 3DMJA 1SL2A 3FFIA 4FJKA 1B9FA 1OVQA 3VQBA 4AF1A 2V7YA 2QK9A 1ASVA 1VQMN 3PSIA 3LP1A 1BIZA 1XMQK 3C6UA 4X66K 4H5VA 2VG6A 2UXCK 3HP6A 5BRFA 4DF4A 1VRUA 3DLEA 4Q5VA 4ZTFA 3ZT0A 1JLQA 3RSEB 3UKRA 3ZSWA 3AO4A 3M8SA 1T6CA 3G4SN 5KI6A 2IGIA 4KHSA 4BRAA 4Z4HA 4W5TA 1XNRK 4YDUA 3KD5E 3DRRA 4CVNE 3CMAN 2YHXA 3ZT2A 3CXCM 3S3OA 1IJJA 2G8VA 2NUBA 1RDCA 4O55A 4KFBA 2YKMA 4O0JA 4BC3A 1YIJN 3H45C 2NRXA 4WFNL 3VQDA 1NGFA 3SUQA 1RBRA 4EFHA 3HP9A 4BG9A 1LAWA 4H4OA 3FZMA 2HBLA 2RKIA 2E2PA 4E7HA 3FZHA 2GX9A 4WF9L 1YHQN 3SNNA 4ISEA 4BRQA 1A5XA 3I8DA 4BE0A 4CE9A 4WFBL 3GG4A 4B3SK 4FPAA 2WC9A 3C6AA 5C12A 1TK5A 4C8NA 3KLIA 3THYB 3RMCA 3DOLA 5BREA 3HTVA 4IG0A 4YOYA 1RILA 4OVLA 5KGWA 1HR0K 3K58A 3TAEA 4C8MA 3KVGA 1HYSA 3U4LA 3FLCO 2P9IA 1VQ4N 4LF5K 3SZ2A 4K0KK 5GAGP 4NCAA 4DU1A 3QFUA 3D2FA 2R7YA 2HVHA 3TAGA 2UUCK 4LF7K 1YI2N 4ZHRA 3MN9A 3O80A 5CY4A 3TTCA 1WLJA 1XC3A 1HRHA 3ID6A 4DFMA 3HPGA 1L3UA 1BG3A 3ZEUA 3TAPA 5AZJB 4OJRA 4BR2A 4OPAA 5KPRA 4N76A 5K14A 2VG7A 3CJCA 3RR7A 1IG8A 2F9TA 4HCBA 2QKKA 1L3VA 2HMIA 3SPZA 3L8BA 4AHSA 3HRGA 2FSJA 4JD2B 4BRKA 4CGIA 3ENHA 3SYZA 4JKEA 1E3MA 4YHHK 3CM6A 4NLCA 3LZIA 5AQYA 3KTQA 4ICLA 2RN2A 4E89A 2A6AA 1JL1A 4O44A 1S22A 3L4QA 5EVZA 5HRPA 3QIOA 2O8DA 3LDNA 5BN9A 2FBXA 2Y1JA 4LSNA 1IKWA 1IBKK 3KKSA 4OO1J 4KHUA 3T1HK 3A5NC 2PYJA 3HVRA 3V4IA 4CHZA 1YT3A 3A5OC 1XI1A 1VSHA 2DFHA 1IG9A 1P90A 4FO0A 4PL7A 4FWNA 3NMUA 1D9DA 1S1XA 1SV5A 1HKBA 4DSEA 1VK0A 4HUGA 3C65A 3MEEA 1HYZA 2P9KA 4H8KA 3Q7CA 4WQ5C 3WXJA 1VQON 2A41A 4FK0A 4JS4A 1C1BA 4RCHA 4CHPA 3HOSA 5J2MA 3CCSN 4JI5K 3BF3A 2I7NA 5BPMA 4I6MB 4JI3K 3V81A 2HNZA 4E7JA 4EIAA 4BDPA 4DFJA 2Z1GA 5AQPA 2YHBA 3MN5A 3QINA 1JLBA 3HZ6A 4JI8K 3HI0A 1Z26A 2XY7A 3GL1A 1MWKA 1IKYA 1S3XA 3P31A 1QQCA 4FWSA 1G99A 3IDHA 3LDOA 3CJAA 4JHDB 4DSFA 4DFKA 4FJXA 4PWDA 2HHSA 4Q0BA 2I5JA 4PHTX 1HJOA 3H1VX 3O1WA 4H0VB 3SI6A 3BDPA 1JXBA 4IG3A 2DFFA 5AQKA 3VGMA 3J7AP 4DR4K 3WNFA 1QSYA 3TI0A 1P8ZA 4WQ4A 4DTOA 1Q82O 3CCQN 4FLYA 1BWFO 4GV6A 4CHYA 2BANA 2DFEA 2QTDA 3IFRA 1IBMK 3OYEA 1NGEA 1HNVA 2EX3A 1U2VA 2VCPA 2ZQBA 4BGAA 1FKOA 1KQSM 3S41A 1XQSC 3EKSA 3EY1A 4LFAK 4CEFA 1NKBA 5JS2A 2CH6A 1S1WA 3UIQA 1REVA 3VQEA 2D0BA 3GE1A 3L3VA 3O3GA 3TU5A 2ZJQL 5C0YA 2Q0UA 4CIGA 1J9AA 1U49A 1H1VA 1E4FT 3RSEA 2CGJA 1VQKN 3QEIA 4FYDA 4NXNK 3DWLA 1TK8A 4B3MK 3A0IX 3AVAA 5M1PA 1XUPO 3LL3A 3NDKA 1RT1A 3PUFA 1EXQA 3V9XA 2HNYA 2E6MA 3H6EA 4DHYA 1QSLA 1TKTA 5AQWA 3AVBA 3ULDA 1JLAA 3RTVA 1VQ7N 3CC4N 4BE1A 3C94A 5AQFA 4NO7A 5I3UA 2NZTA 4PKGA 1EKEA 3QNOA 4WQ4C 1HJRA 1S6QA 1HQEA 4B9SA 3QBXA 1YF5L 5CR4A 2ITGA 3TANA 5JLFA 2XO7A 4OGEA 1N5YA 4FZZA 1M90O 4H4MA 3DJCA 3NE6A 5AQSA 2OA8A 1U48A 4FK2A 1N8RO 2F9WA 2UXDK 4DR3K 3LAMA 4RW6A 3QEXA 4NCGA 2YJEA 2KHOA 2OPQA 4DUYK 2EWSA 2PAVA 4K8ZA 3R6MA 1J54A 3VQ6A 4F4KA 2O8FA 3O9TA 3PV8A 5JS1A 3JS6A 1W9HA 3O4NA 2NNWA 3THVA 4JN4A 1NJIO 4AHTA 3HJFA 1QVFM 5AQQA 2IDOA 3JAMO 5BR8K 3SV3A 4CEEA 3AO2A 4GVEA 1NK0A 4PUOA 1YJNN 1NGHA 1S9GA 3UB5A 2VQFK 1T3VA 2WOMA 4FPBA 4E1NA 4KV8A 4CESA 1RT5A 1ZXOA 4FWRA 4BRPA 5HRRA 3PIPL 2YHWA 3O6WA 5TKYA 2QA4N 2QWQA 4DV2K 1HLUA 3W3DA 2JWLA 2UYTA 3ULEB 3S3MA 4F3TA 2HHUA 2IOCA 1QE1A 1B9DA 3CI5A 4IFVA 1BOTO 3CJ7A 4FWMA 3CCUN 3PX4A 3NF9A 5FPNA 3MWTA 5KRTA 1VQ5N 3CD6N 4ID5A 5C25A 3DYAA 3VTIA 1T03A 1NMNA 4FSVA 4FJ8A 1BL3A 1Q9XA 4DTJA 2W6LA 2FSNA 2QWRA 3VEVA 4IKFA 3QLHA 2HSTA 4EP4A 1U47A 3SUNA 2KZZA 2HF3A 2P9LB 1LWCA 2WFBA 3CM5A 1QQOA 1GLCG 4BQLA 4JK9A 4M63C 3C7NB 3OS1A 3HM9A 5FRNA 1BI4A 2F96A 2ITMA 3LPTA 3D0PA 3M8PA 4DV7K 4HUFA 3HK2A 1Q7YO 4GV9A 3DRPA 4IO8A 2OPRA 4OLBA 1BU6O 4DTXA 5GAEP 5KTQA 2GBZA 3PX6A 1GOBA 1Y64A 3ZSRA 1SZ2A 4J2AA 5KQ8A 1OH6A 3SLCA 3R9PA 1BUPA 4LFBK 3TTFA 1TKZA 3P4IA 1TK0A 3QEVA 1EETA 4F2RA 4KB1A 3VA0A 4BRIA 2GV9A 4CJWA 1ITGA 1NK9A 3LDQA 4M42A 4AH9A 2QWPA 3I33A 3KK1A 4I9QA 4DV0K 2O8EB 1IKXA 3HO1A 3HSCA 3CQYA 3ZEUB 4DB3A 3S3NA 1W7AA 1K9MO 2H3GX 2G8UA 4KHNA 4RW9A 4NCBA 4K41A 3HPHA 1T05A 3G0ZA 5E41A 1ATRA 3SK3A 3SAFA 1EWRA 2HB5A 2HHWA 3OYMA 4M3TA 1SUQA 4CF2A 1WBDA 3F73A 3VPZA 1RT7A 2HF4A 2JLEA 3VEXA 4ILGB 1OKJA 2QI2A 1VSIA 3KD1E 5BR9A 5AFUA 2B4JA 1TL3A 1WB9A 1BDGA 4JRPA 3WQUA 4DR5K 3RMBA 3QICA 1C0UA
chains in the Genus database with same CATH topology
5D3GA 4CJVA 1FXXA 2OZSA 4Z4IA 1KLMA 2IC3A 5DMRA 4F3OA 3QEPA 1TK5A 2YNFA 4C8NA 1LWFA 4FJJA 3KLIA 4I2PA 3AA5X 3LWMA 3DOLA 3RMCA 4IG0A 1ZBFA 1MU2A 1RILA 3NF8A 4JLHA 1NK6A 1WAJA 4OVLA 4R5PA 3QNNA 3QEWA 2FC0A 5KGWA 4XIUA 3K58A 3TAEA 3NHGA 3QO9A 3H08A 4C8MA 4BDZA 1YTUA 1HYSA 3CFOA 4FJ9A 3AVCA 2X6SA 3OYBA 3NAEA 3SZ2A 3DLRA 4N47A 2BE2A 2B6AA 3IAYA 4CJ3A 4NCAA 1SKRA 2DTUA 4DU1A 3AVIA 4DSKA 3NF7A 4KO0A 3OYCA 3K5LA 2R7YA 4FVMA 3SQ2A 3PO5A 2Z1HA 4FJ7A 2FBTA 3LZJA 1WSHA 3TAGA 1Q9YA 2HVHA 3M8QA 1CZ9A 4OPJA 4N5SA 1S1VA 4DQQA 2YV0X 2ZE2A 4CHQA 4L8RB 4ZHRA 3AVMA 3NH0A 4JRQA 4DSIA 1ZBUA 4FM2A 1KCFA 1JLCA 3LALA 5CY4A 3ZSZA 4AILC 2PYLA 3V9UA 2BDPA 1IO2A 1WLJA 1TAQA 3OYLA 1HRHA 2HHTA 4DFMA 4W5QA 4ELVA 3HPGA 4CEDA 4AHCA 1L3UA 3AVLA 1RCHA 1S5JA 3TAPA 1KVAA 4OJRA 3NH1A 1VRTA 3NGYA 3NH2A 3TR8A 3AVKA 3V9SA 5K14A 4Z4CA 3TARA 4CEQA 2VG7A 4FW2A 3RR7A 4B8AB 1X9WA 3OJUA 4O0IA 2PZSA 1X1PA 4WE1A 2X78A 3U3YA 5HROA 4CIFA 3TAQA 4CJFA 4B08A 3KLEA 3NBPA 3VN5A 3ISNC 3MXIA 2QKKA 4HCBA 4N76A 1NK7A 1L3VA 3K57A 2HMIA 3SPZA 3L8BA 4AHSA 1TKXA 1RBTA 4CGIA 4J2BA 3KLFA 2E4LA 3SYZA 3T19A 5J2NA 4MQ3A 4MFBA 4CFBA 3CM6A 3VQQA 4FM0A 3LZIA 4CF8A 4OPKA 3KTQA 4ICLA 2RN2A 1BIUA 5CZ1A 4M45A 1JL1A 4E89A 3HYFA 3NGZA 3E01A 4O44A 3K5MA 4EZ9A 4HCCA 2AJQA 3MXMA 5HRPA 3CFRA 4QAGA 1HNIA 4DLGA 1X9SA 1QTMA 3QIOA 2PY5A 2HNDA 4DTSA 1F21A 2FBXA 1HPZA 2Y1JA 3IG1A 4CJEA 2OYQA 4LSNA 3P83D 3VQPA 1IKWA 3KKSA 3NFAA 5T7BA 4KHUA 4FJMA 5HLFA 2PYJA 3HVRA 1K6YA 4B8CA 3V4IA 1R0AA 4CHZA 1D8YA 1YT3A 4DWIA 1VSFA 3LAKA 1XI1A 1VSHA 2DFHA 4CGHA 4CJLA 1IG9A 1BCOA 2P1JA 3U6FA 2A1RA 1VSKA 1VSMA 3B6OA 4KHWA 3OYIA 1KSPA 3QETA 4FZYA 3ITHA 3D45A 4M3RA 1S1XA 4AHVA 1D9DA 1SV5A 1HMVA 4DSEA 4PY5A 4CJUA 3L2RA 2B5JA 1VK0A 3OYJA 3MEEA 3EYZA 1HYZA 4HUGA 2YNHA 1NK4A 2HW3A 4H8KA 1UA1A 1O1WA 1BGXT 3U3GA 3MEDA 4FK0A 2HHUA 1EP4A 3VA3A 3SCXA 4JS4A 1C1BA 1Z25A 1ASWA 3AO5A 1KVBA 4CHPA 4DS5A 5J2MA 3ASMA 2P51A 4IBNA 4K8XA 3V81A 1RBSA 2HNZA 4CEZA 4E7JA 4DS4A 4BDPA 4B9VA 4DFJA 1C6VA 1C1CA 1QS4A 2Z1GA 2YHBA 2D0AA 5FROA 4CK1A 4CHNA 3ZSXA 4ZTJA 1UA0A 1NJWA 3QINA 1JLBA 4B9MA 4CEAA 3SV4A 1Z26A 2XY7A 1IKYA 4NYNA 4I7FA 4Z4FA 4DG1A 3AVGA 1WSFA 4FLZA 3O3HA 3RMDA 1QQCA 3A2FA 4KI6A 4DSFA 2RPIA 1RT4A 4DFKA 4FJXA 4PWDA 2HHSA 3WNHA 4Q0BA 3DOKA 2I5JA 5CYMA 4CERA 1J5OA 3L2VA 4CHOA 3OYDA 4DF8A 1KRPA 4FJNA 3SI6A 5I42A 3BDPA 1JXBA 2P5GA 4LD0A 1DTTA 4IG3A 4DTNA 1S6PA 3AA4A 1YVUA 1LW0A 2DFFA 1ASUA 4CIEA 3LWLA 4FLXA 4F2SA 3ZSOA 3VQ5A 3F9KA 2IAJA 1JLEA 4GMJB 4Y1DA 3O3FA 3QERA 1SKSA 1VSEA 1LW2A 2OPSA 4G1QA 4BACA 4DQPA 3LP3A 2KZMA 3NCIA 4FXDA 3WNFA 3LDSA 2OPPA 3IRXA 3OYHA 3TI0A 1QSYA 2KW4A 2E6LA 3AV9A 4GW6A 1IKVA 1UOCA 3T3FA 4LH4A 3NGIA 4DTOA 1RTDA 4UQGA 4FLYA 3SQ0A 3DLGA 5KGXA 1VSJA 4CHYA 2BANA 2DFEA 3OYFA 1S9EA 4CJKA 4KHYA 4FM1A 3C6TA 3OYEA 3OJSA 1ZBIA 3WNEA 1HNVA 2EX3A 5DK5A 1BI4B 1NKCA 2Z1JA 1A5WA 1TVRA 2ZQBA 3AO3A 1FKOA 1DLOA 4FJGA 3EY1A 2YNGA 4CEFA 3AO1A 3V6DA 1NKBA 4CFDA 4BWMA 4B9LA 5JS2A 3OYGA 4CF1A 3KLGA 1S1WA 3DM2A 3KJVA 3SQ4A 3LPUA 3MEGA 3UIQA 1JL2A 1REVA 2VG5A 3V1RA 1C0TA 3VQEA 1FK9A 2D0BA 4QCLA 4M41A 3I0RA 3RMAA 4KKOA 1QHTA 3L3VA 3O3GA 1X9MA 4DQIA 4FJLA 2ATQA 3QIPA 2GUIA 4KTWA 4Y1CA 4ELUA 4CIGA 5SZTA 2A1SA 1J9AA 4OKEA 1YTAA 4PQUA 1JXEA 4RW8A 1W0HA 5CZ2A 1LAVA 3HSTB 4J2DA 2XY5A 2JGUA 3L3UA 1U49A 4CCHA 3TWHA 2IS3A 4CJTA 1RNHA 1L3SA 2Z1IA 3HXMA 4KREA 3QEIA 2XRIA 4FJIA 4FYDA 1KFDA 2YNIA 3JSMA 4E7IA 3DLBA 3SJJA 1RBUA 1TK8A 3QESA 1S1UA 4KAZA 3NF6A 4C8LA 4KRFA 1KVCA 3AVAA 3C95A 1DTQA 1NJYA 4CJ4A 3EZ5A 1KLNA 3TAMA 4AHUA 4FCYA 3NDKA 1RT1A 4Z4EA 3PUFA 2ZD1A 4HHTA 1NJXA 1EXQA 3V9XA 3ZCMA 1XHZA 2HNYA 2E6MA 1QSLA 3CYMA 1TKTA 3VQ4A 4FLUA 4BE2A 3AVBA 4B9UA 2YHAA 4DTRA 1SL1A 4YNQA 3K5OA 3ULDA 1BQMA 3SPYA 1JLAA 2QKBA 3RTVA 3S9HA 5J1EA 3MXJA 3P5JA 4I2QA 4BE1A 3C94A 3K5NA 4CEBA 2O4GA 3RRHA 1U45A 4BDYA 5I3UA 1EKEA 5HP1A 2G8KA 4DQSA 4KTQA 3JYTA 3QNOA 1KFSA 2G8IA 1HJRA 1S6QA 1CZBA 1WAFA 3OY9A 1HQEA 4B9SA 4Z0UA 1XC9A 2G8WA 4B9NA 2ITGA 4F8RA 3TANA 2XO7A 1J53A 4OGEA 3L2QA 1HQUA 2LSNA 3KIOA 3CQ8A 1N5YA 2HHQA 4FJHA 4FZZA 4DTPA 2BGGA 4H4MA 3ALYA 3PO4A 1L3TA 4CK3A 4DLEA 3NE6A 2OA8A 4O4GA 4W5NA 2FBYA 2X6NA 1CLQA 1U48A 3VQCA 2P5OA 5KRSA 4FJ5A 4FK2A 4CGGA 4BWJA 3DLKA 1RT3A 4RW4A 3ZT4A 1VSDA 4M3XA 4M3UA 3LAMA 4RW6A 3MECA 3QEXA 4KHQA 4NCGA 3KK3A 2OPQA 4ID1A 4HUEA 3ZT3A 4K8ZA 1J54A 3O4QA 3VQ6A 5HRNA 3VQAA 3IS9A 4F4KA 4J2EA 4Z4GA 2Q3SA 3ZSQA 4PA1A 3PV8A 3HPOA 5JS1A 3LANA 1JLGA 4N41A 1JLFA 1W9HA 2D0CA 3O4NA 4N56A 4DMNA 5HRSA 1B92A 3HT3A 3THVA 4AHTA 2Y1IA 3BGRA 3HJFA 2IDOA 3LP2A 4LY7A 4DU3A 1UWBA 3MAQA 3SV3A 1L5UA 4LSLA 4E19A 4OKJA 4CEEA 3K59A 1QSSA 3AO2A 4FLWA 3L2WA 2XY6A 1U04A 1NK0A 2ETJA 4B3OA 4PUOA 2W42A 1RTHA 1ZYQA 5HBMA 1Y97A 1S9GA 3P1GA 4KI4A 2WOMA 4CJ5A 4E1NA 4KV8A 4CESA 4FLVA 4CGFA 1CXQA 1RT5A 3VQ9A 3WNGA 2RF2A 1GOAA 4DTUA 2HHVA 3RWUA 4FW1A 3V9ZA 5HRRA 4JS5A 1NJZA 1ZBLA 1RBVA 4CJRA 3OYAA 4IDKA 1RT6A 4CFAA 3S3MA 4W5OA 2WONA 4M3WA 2IOCA 1QE1A 4F3TA 1B9DA 4CJPA 4NYFA 1RTJA 4IFVA 3V1QA 3I0SA 2XY8A 5FDLA 3L2UA 3PX4A 4LH5A 3NF9A 1D9FA 1BHLA 3AVHA 5C42A 1KTQA 3DLHA 1FKPA 1RT2A 2OZMA 4RG8A 4OLAA 5KRTA 3V1OA 5SWMA 3OVNA 4AHRA 4ELTA 4FK4A 2F8TA 4ID5A 4IFYA 4CK2A 5C25A 1SL0A 3OS2A 4HTUA 4DSJA 3DYAA 1T03A 1N6QA 1RDDA 3OYNA 1LV5A 1D5AA 5C24A 3VQ8A 3SUPA 4FJ8A 1BL3A 1HYVA 4YFUA 3VQ7A 1Q9XA 4DTJA 2HHXA 3AA3A 4DQRA 4FLTA 3TABA 3QLHA 1G15A 4IKFA 1XWLA 5EU7A 2HVIA 4KPYA 4CGDA 1TGOA 4GVMA 4EP4A 3V9WA 4TSXA 1U47A 4EP5A 1NOYA 1S1TA 1BCMA 1TV6A 1C0MA 3SUNA 4C8KA 2KFZA 3AVFA 1LWCA 3CM5A 4W5RA 2KZZA 1JKHA 4E7LA 4B9TA 4CF9A 1TL1A 1WN7A 4HVJA 3OS1A 1GOCA 3HM9A 5FRNA 3KKRA 1TAUA 4M3YA 1BI4A 3PX0A 4CEOA 2F96A 3HVTA 4CJSA 4DTMA 3LPTA 3D0PA 3M8PA 1ZBHA 4C8OA 1WSJA 4KB0A 4E7KA 4O5BA 4HUFA 1VSLA 1WSIA 2O4IA 3HK2A 1WSGA 3ZT1A 1I39A 1XHXA 4CGJA 3DRPA 1BQNA 1WNSA 1TKDA 3HL8A 3G10A 1UAXA 4OKKA 1NK8A 2G8FA 3AVNA 3SUOA 2OPRA 5J2QA 4OLBA 4KTZA 3ZSVA 4DTXA 3DMJA 2F8SA 1SL2A 3FFIA 5KTQA 2GBZA 4FJKA 1B9FA 4QOZB 3PX6A 1NKEA 1GOBA 3CG7A 3VQBA 2QK9A 1ASVA 3ZSRA 3CFPA 3LP1A 4J2AA 1BIZA 3C6UA 2VG6A 4CECA 3HP6A 3DI6A 4DF4A 1VRUA 4CJQA 2EHGA 2XHBA 4EZ6A 1TKZA 3PY8A 1TK0A 3DLEA 4Q5VA 4ZTFA 3ZT0A 1JLQA 3QEVA 1EETA 4F2RA 4KB1A 3VA0A 4DFPA 3ZSWA 4E1MA 3AO4A 3M8SA 2GV9A 2YKNA 1IH7A 4CJWA 5KI6A 3KK2A 1ITGA 2IGIA 1NK9A 4M42A 4AH9A 4KHSA 3KK1A 3DRSA 1A5VA 5FRMA 1LWEA 4I9QA 3KLHA 4Z4HA 4W5TA 4E3SA 1NK5A 3KD5E 3DRRA 2FBVA 1T7PA 1C1AA 3M8RA 1IKXA 2DY4A 3HO1A 1Q8IA 2X74A 1NOZA 3S3NA 1T8EA 3ZT2A 4M3ZA 3S3OA 3RR8A 2KFNA 2G8VA 2NUBA 1RDCA 4O55A 5J2PA 3SQ1A 2G8UA 4KFBA 2YKMA 4RW7A 4KHNA 4RW9A 2VWKA 3TAFA 4O0JA 4CFCA 4FZXC 4NCBA 1SKWA 1RDBA 3HPHA 3B6PA 1T05A 3T1AA 3G0ZA 5E41A 3VQDA 2HB5A 2HHWA 3SUQA 3OYMA 3ZSYA 1RBRA 1EX4A 4M3TA 3HP9A 2KQ2A 1LAWA 1SUQA 1RTIA 4H4OA 3OS0A 4CF2A 1WSEA 2KTQA 1I3AA 2RKIA 3LP0A 3F73A 4E7HA 2D5RA 4OGCA 3AA2A 1RT7A 2VWJA 2QXFA 5CYQA 3RRGA 2JLEA 2G8HA 1RDAA 4I9LA 4DSLA 1U4BA 1VSIA 3KD1E 3SNNA 4CF0A 2B4JA 1BISA 4DU4A 1A5XA 1TL3A 1CXUA 3I8DA 4BE0A 4E0DA 3AVJA 3OYKA 4CE9A 4JRPA 3RMBA 3K2PA 1C0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3G A;  4CJV A;  1FXX A;  2OZS A;  4Z4I A;  1KLM A;  2IC3 A;  5DMR A;  4F3O A;  3QEP A;  1TK5 A;  2YNF A;  4C8N A;  1LWF A;  4FJJ A;  3KLI A;  4I2P A;  3AA5 X;  3LWM A;  3DOL A;  3RMC A;  4IG0 A;  1ZBF A;  1MU2 A;  1RIL A;  3NF8 A;  4JLH A;  1NK6 A;  1WAJ A;  4OVL A;  4R5P A;  3QNN A;  3QEW A;  2FC0 A;  5KGW A;  4XIU A;  3K58 A;  3TAE A;  3NHG A;  3QO9 A;  3H08 A;  4C8M A;  4BDZ A;  1YTU A;  1HYS A;  3CFO A;  4FJ9 A;  3AVC A;  2X6S A;  3OYB A;  3NAE A;  3SZ2 A;  3DLR A;  4N47 A;  2BE2 A;  2B6A A;  3IAY A;  4CJ3 A;  4NCA A;  1SKR A;  2DTU A;  4DU1 A;  3AVI A;  4DSK A;  3NF7 A;  4KO0 A;  3OYC A;  3K5L A;  2R7Y A;  4FVM A;  3SQ2 A;  3PO5 A;  2Z1H A;  4FJ7 A;  2FBT A;  3LZJ A;  1WSH A;  3TAG A;  1Q9Y A;  2HVH A;  3M8Q A;  1CZ9 A;  4OPJ A;  4N5S A;  1S1V A;  4DQQ A;  2YV0 X;  2ZE2 A;  4CHQ A;  4L8R B;  4ZHR A;  3AVM A;  3NH0 A;  4JRQ A;  4DSI A;  1ZBU A;  4FM2 A;  1KCF A;  1JLC A;  3LAL A;  5CY4 A;  3ZSZ A;  4AIL C;  2PYL A;  3V9U A;  2BDP A;  1IO2 A;  1WLJ A;  1TAQ A;  3OYL A;  1HRH A;  2HHT A;  4DFM A;  4W5Q A;  4ELV A;  3HPG A;  4CED A;  4AHC A;  1L3U A;  3AVL A;  1RCH A;  1S5J A;  3TAP A;  1KVA A;  4OJR A;  3NH1 A;  1VRT A;  3NGY A;  3NH2 A;  3TR8 A;  3AVK A;  3V9S A;  5K14 A;  4Z4C A;  3TAR A;  4CEQ A;  2VG7 A;  4FW2 A;  3RR7 A;  4B8A B;  1X9W A;  3OJU A;  4O0I A;  2PZS A;  1X1P A;  4WE1 A;  2X78 A;  3U3Y A;  5HRO A;  4CIF A;  3TAQ A;  4CJF A;  4B08 A;  3KLE A;  3NBP A;  3VN5 A;  3ISN C;  3MXI A;  2QKK A;  4HCB A;  4N76 A;  1NK7 A;  1L3V A;  3K57 A;  2HMI A;  3SPZ A;  3L8B A;  4AHS A;  1TKX A;  1RBT A;  4CGI A;  4J2B A;  3KLF A;  2E4L A;  3SYZ A;  3T19 A;  5J2N A;  4MQ3 A;  4MFB A;  4CFB A;  3CM6 A;  3VQQ A;  4FM0 A;  3LZI A;  4CF8 A;  4OPK A;  3KTQ A;  4ICL A;  2RN2 A;  1BIU A;  5CZ1 A;  4M45 A;  1JL1 A;  4E89 A;  3HYF A;  3NGZ A;  3E01 A;  4O44 A;  3K5M A;  4EZ9 A;  4HCC A;  2AJQ A;  3MXM A;  5HRP A;  3CFR A;  4QAG A;  1HNI A;  4DLG A;  1X9S A;  1QTM A;  3QIO A;  2PY5 A;  2HND A;  4DTS A;  1F21 A;  2FBX A;  1HPZ A;  2Y1J A;  3IG1 A;  4CJE A;  2OYQ A;  4LSN A;  3P83 D;  3VQP A;  1IKW A;  3KKS A;  3NFA A;  5T7B A;  4KHU A;  4FJM A;  5HLF A;  2PYJ A;  3HVR A;  1K6Y A;  4B8C A;  3V4I A;  1R0A A;  4CHZ A;  1D8Y A;  1YT3 A;  4DWI A;  1VSF A;  3LAK A;  1XI1 A;  1VSH A;  2DFH A;  4CGH A;  4CJL A;  1IG9 A;  1BCO A;  2P1J A;  3U6F A;  2A1R A;  1VSK A;  1VSM A;  3B6O A;  4KHW A;  3OYI A;  1KSP A;  3QET A;  4FZY A;  3ITH A;  3D45 A;  4M3R A;  1S1X A;  4AHV A;  1D9D A;  1SV5 A;  1HMV A;  4DSE A;  4PY5 A;  4CJU A;  3L2R A;  2B5J A;  1VK0 A;  3OYJ A;  3MEE A;  3EYZ A;  1HYZ A;  4HUG A;  2YNH A;  1NK4 A;  2HW3 A;  4H8K A;  1UA1 A;  1O1W A;  1BGX T;  3U3G A;  3MED A;  4FK0 A;  2HHU A;  1EP4 A;  3VA3 A;  3SCX A;  4JS4 A;  1C1B A;  1Z25 A;  1ASW A;  3AO5 A;  1KVB A;  4CHP A;  4DS5 A;  5J2M A;  3ASM A;  2P51 A;  4IBN A;  4K8X A;  3V81 A;  1RBS A;  2HNZ A;  4CEZ A;  4E7J A;  4DS4 A;  4BDP A;  4B9V A;  4DFJ A;  1C6V A;  1C1C A;  1QS4 A;  2Z1G A;  2YHB A;  2D0A A;  5FRO A;  4CK1 A;  4CHN A;  3ZSX A;  4ZTJ A;  1UA0 A;  1NJW A;  3QIN A;  1JLB A;  4B9M A;  4CEA A;  3SV4 A;  1Z26 A;  2XY7 A;  1IKY A;  4NYN A;  4I7F A;  4Z4F A;  4DG1 A;  3AVG A;  1WSF A;  4FLZ A;  3O3H A;  3RMD A;  1QQC A;  3A2F A;  4KI6 A;  4DSF A;  2RPI A;  1RT4 A;  4DFK A;  4FJX A;  4PWD A;  2HHS A;  3WNH A;  4Q0B A;  3DOK A;  2I5J A;  5CYM A;  4CER A;  1J5O A;  3L2V A;  4CHO A;  3OYD A;  4DF8 A;  1KRP A;  4FJN A;  3SI6 A;  5I42 A;  3BDP A;  1JXB A;  2P5G A;  4LD0 A;  1DTT A;  4IG3 A;  4DTN A;  1S6P A;  3AA4 A;  1YVU A;  1LW0 A;  2DFF A;  1ASU A;  4CIE A;  3LWL A;  4FLX A;  4F2S A;  3ZSO A;  3VQ5 A;  3F9K A;  2IAJ A;  1JLE A;  4GMJ B;  4Y1D A;  3O3F A;  3QER A;  1SKS A;  1VSE A;  1LW2 A;  2OPS A;  4G1Q A;  4BAC A;  4DQP A;  3LP3 A;  2KZM A;  3NCI A;  4FXD A;  3WNF A;  3LDS A;  2OPP A;  3IRX A;  3OYH A;  3TI0 A;  1QSY A;  2KW4 A;  2E6L A;  3AV9 A;  4GW6 A;  1IKV A;  1UOC A;  3T3F A;  4LH4 A;  3NGI A;  4DTO A;  1RTD A;  4UQG A;  4FLY A;  3SQ0 A;  3DLG A;  5KGX A;  1VSJ A;  4CHY A;  2BAN A;  2DFE A;  3OYF A;  1S9E A;  4CJK A;  4KHY A;  4FM1 A;  3C6T A;  3OYE A;  3OJS A;  1ZBI A;  3WNE A;  1HNV A;  2EX3 A;  5DK5 A;  1BI4 B;  1NKC A;  2Z1J A;  1A5W A;  1TVR A;  2ZQB A;  3AO3 A;  1FKO A;  1DLO A;  4FJG A;  3EY1 A;  2YNG A;  4CEF A;  3AO1 A;  3V6D A;  1NKB A;  4CFD A;  4BWM A;  4B9L A;  5JS2 A;  3OYG A;  4CF1 A;  3KLG A;  1S1W A;  3DM2 A;  3KJV A;  3SQ4 A;  3LPU A;  3MEG A;  3UIQ A;  1JL2 A;  1REV A;  2VG5 A;  3V1R A;  1C0T A;  3VQE A;  1FK9 A;  2D0B A;  4QCL A;  4M41 A;  3I0R A;  3RMA A;  4KKO A;  1QHT A;  3L3V A;  3O3G A;  1X9M A;  4DQI A;  4FJL A;  2ATQ A;  3QIP A;  2GUI A;  4KTW A;  4Y1C A;  4ELU A;  4CIG A;  5SZT A;  2A1S A;  1J9A A;  4OKE A;  1YTA A;  4PQU A;  1JXE A;  4RW8 A;  1W0H A;  5CZ2 A;  1LAV A;  3HST B;  4J2D A;  2XY5 A;  2JGU A;  3L3U A;  1U49 A;  4CCH A;  3TWH A;  2IS3 A;  4CJT A;  1RNH A;  1L3S A;  2Z1I A;  3HXM A;  4KRE A;  3QEI A;  2XRI A;  4FJI A;  4FYD A;  1KFD A;  2YNI A;  3JSM A;  4E7I A;  3DLB A;  3SJJ A;  1RBU A;  1TK8 A;  3QES A;  1S1U A;  4KAZ A;  3NF6 A;  4C8L A;  4KRF A;  1KVC A;  3AVA A;  3C95 A;  1DTQ A;  1NJY A;  4CJ4 A;  3EZ5 A;  1KLN A;  3TAM A;  4AHU A;  4FCY A;  3NDK A;  1RT1 A;  4Z4E A;  3PUF A;  2ZD1 A;  4HHT A;  1NJX A;  1EXQ A;  3V9X A;  3ZCM A;  1XHZ A;  2HNY A;  2E6M A;  1QSL A;  3CYM A;  1TKT A;  3VQ4 A;  4FLU A;  4BE2 A;  3AVB A;  4B9U A;  2YHA A;  4DTR A;  1SL1 A;  4YNQ A;  3K5O A;  3ULD A;  1BQM A;  3SPY A;  1JLA A;  2QKB A;  3RTV A;  3S9H A;  5J1E A;  3MXJ A;  3P5J A;  4I2Q A;  4BE1 A;  3C94 A;  3K5N A;  4CEB A;  2O4G A;  3RRH A;  1U45 A;  4BDY A;  5I3U A;  1EKE A;  5HP1 A;  2G8K A;  4DQS A;  4KTQ A;  3JYT A;  3QNO A;  1KFS A;  2G8I A;  1HJR A;  1S6Q A;  1CZB A;  1WAF A;  3OY9 A;  1HQE A;  4B9S A;  4Z0U A;  1XC9 A;  2G8W A;  4B9N A;  2ITG A;  4F8R A;  3TAN A;  2XO7 A;  1J53 A;  4OGE A;  3L2Q A;  1HQU A;  2LSN A;  3KIO A;  3CQ8 A;  1N5Y A;  2HHQ A;  4FJH A;  4FZZ A;  4DTP A;  2BGG A;  4H4M A;  3ALY A;  3PO4 A;  1L3T A;  4CK3 A;  4DLE A;  3NE6 A;  2OA8 A;  4O4G A;  4W5N A;  2FBY A;  2X6N A;  1CLQ A;  1U48 A;  3VQC A;  2P5O A;  5KRS A;  4FJ5 A;  4FK2 A;  4CGG A;  4BWJ A;  3DLK A;  1RT3 A;  4RW4 A;  3ZT4 A;  1VSD A;  4M3X A;  4M3U A;  3LAM A;  4RW6 A;  3MEC A;  3QEX A;  4KHQ A;  4NCG A;  3KK3 A;  2OPQ A;  4ID1 A;  4HUE A;  3ZT3 A;  4K8Z A;  1J54 A;  3O4Q A;  3VQ6 A;  5HRN A;  3VQA A;  3IS9 A;  4F4K A;  4J2E A;  4Z4G A;  2Q3S A;  3ZSQ A;  4PA1 A;  3PV8 A;  3HPO A;  5JS1 A;  3LAN A;  1JLG A;  4N41 A;  1JLF A;  1W9H A;  2D0C A;  3O4N A;  4N56 A;  4DMN A;  5HRS A;  1B92 A;  3HT3 A;  3THV A;  4AHT A;  2Y1I A;  3BGR A;  3HJF A;  2IDO A;  3LP2 A;  4LY7 A;  4DU3 A;  1UWB A;  3MAQ A;  3SV3 A;  1L5U A;  4LSL A;  4E19 A;  4OKJ A;  4CEE A;  3K59 A;  1QSS A;  3AO2 A;  4FLW A;  3L2W A;  2XY6 A;  1U04 A;  1NK0 A;  2ETJ A;  4B3O A;  4PUO A;  2W42 A;  1RTH A;  1ZYQ A;  5HBM A;  1Y97 A;  1S9G A;  3P1G A;  4KI4 A;  2WOM A;  4CJ5 A;  4E1N A;  4KV8 A;  4CES A;  4FLV A;  4CGF A;  1CXQ A;  1RT5 A;  3VQ9 A;  3WNG A;  2RF2 A;  1GOA A;  4DTU A;  2HHV A;  3RWU A;  4FW1 A;  3V9Z A;  5HRR A;  4JS5 A;  1NJZ A;  1ZBL A;  1RBV A;  4CJR A;  3OYA A;  4IDK A;  1RT6 A;  4CFA A;  3S3M A;  4W5O A;  2WON A;  4M3W A;  2IOC A;  1QE1 A;  4F3T A;  1B9D A;  4CJP A;  4NYF A;  1RTJ A;  4IFV A;  3V1Q A;  3I0S A;  2XY8 A;  5FDL A;  3L2U A;  3PX4 A;  4LH5 A;  3NF9 A;  1D9F A;  1BHL A;  3AVH A;  5C42 A;  1KTQ A;  3DLH A;  1FKP A;  1RT2 A;  2OZM A;  4RG8 A;  4OLA A;  5KRT A;  3V1O A;  5SWM A;  3OVN A;  4AHR A;  4ELT A;  4FK4 A;  2F8T A;  4ID5 A;  4IFY A;  4CK2 A;  5C25 A;  1SL0 A;  3OS2 A;  4HTU A;  4DSJ A;  3DYA A;  1T03 A;  1N6Q A;  1RDD A;  3OYN A;  1LV5 A;  1D5A A;  5C24 A;  3VQ8 A;  3SUP A;  4FJ8 A;  1BL3 A;  1HYV A;  4YFU A;  3VQ7 A;  1Q9X A;  4DTJ A;  2HHX A;  3AA3 A;  4DQR A;  4FLT A;  3TAB A;  3QLH A;  1G15 A;  4IKF A;  1XWL A;  5EU7 A;  2HVI A;  4KPY A;  4CGD A;  1TGO A;  4GVM A;  4EP4 A;  3V9W A;  4TSX A;  1U47 A;  4EP5 A;  1NOY A;  1S1T A;  1BCM A;  1TV6 A;  1C0M A;  3SUN A;  4C8K A;  2KFZ A;  3AVF A;  1LWC A;  3CM5 A;  4W5R A;  2KZZ A;  1JKH A;  4E7L A;  4B9T A;  4CF9 A;  1TL1 A;  1WN7 A;  4HVJ A;  3OS1 A;  1GOC A;  3HM9 A;  5FRN A;  3KKR A;  1TAU A;  4M3Y A;  1BI4 A;  3PX0 A;  4CEO A;  2F96 A;  3HVT A;  4CJS A;  4DTM A;  3LPT A;  3D0P A;  3M8P A;  1ZBH A;  4C8O A;  1WSJ A;  4KB0 A;  4E7K A;  4O5B A;  4HUF A;  1VSL A;  1WSI A;  2O4I A;  3HK2 A;  1WSG A;  3ZT1 A;  1I39 A;  1XHX A;  4CGJ A;  3DRP A;  1BQN A;  1WNS A;  1TKD A;  3HL8 A;  3G10 A;  1UAX A;  4OKK A;  1NK8 A;  2G8F A;  3AVN A;  3SUO A;  2OPR A;  5J2Q A;  4OLB A;  4KTZ A;  3ZSV A;  4DTX A;  3DMJ A;  2F8S A;  1SL2 A;  3FFI A;  5KTQ A;  2GBZ A;  4FJK A;  1B9F A;  4QOZ B;  3PX6 A;  1NKE A;  1GOB A;  3CG7 A;  3VQB A;  2QK9 A;  1ASV A;  3ZSR A;  3CFP A;  3LP1 A;  4J2A A;  1BIZ A;  3C6U A;  2VG6 A;  4CEC A;  3HP6 A;  3DI6 A;  4DF4 A;  1VRU A;  4CJQ A;  2EHG A;  2XHB A;  4EZ6 A;  1TKZ A;  3PY8 A;  1TK0 A;  3DLE A;  4Q5V A;  4ZTF A;  3ZT0 A;  1JLQ A;  3QEV A;  1EET A;  4F2R A;  4KB1 A;  3VA0 A;  4DFP A;  3ZSW A;  4E1M A;  3AO4 A;  3M8S A;  2GV9 A;  2YKN A;  1IH7 A;  4CJW A;  5KI6 A;  3KK2 A;  1ITG A;  2IGI A;  1NK9 A;  4M42 A;  4AH9 A;  4KHS A;  3KK1 A;  3DRS A;  1A5V A;  5FRM A;  1LWE A;  4I9Q A;  3KLH A;  4Z4H A;  4W5T A;  4E3S A;  1NK5 A;  3KD5 E;  3DRR A;  2FBV A;  1T7P A;  1C1A A;  3M8R A;  1IKX A;  2DY4 A;  3HO1 A;  1Q8I A;  2X74 A;  1NOZ A;  3S3N A;  1T8E A;  3ZT2 A;  4M3Z A;  3S3O A;  3RR8 A;  2KFN A;  2G8V A;  2NUB A;  1RDC A;  4O55 A;  5J2P A;  3SQ1 A;  2G8U A;  4KFB A;  2YKM A;  4RW7 A;  4KHN A;  4RW9 A;  2VWK A;  3TAF A;  4O0J A;  4CFC A;  4FZX C;  4NCB A;  1SKW A;  1RDB A;  3HPH A;  3B6P A;  1T05 A;  3T1A A;  3G0Z A;  5E41 A;  3VQD A;  2HB5 A;  2HHW A;  3SUQ A;  3OYM A;  3ZSY A;  1RBR A;  1EX4 A;  4M3T A;  3HP9 A;  2KQ2 A;  1LAW A;  1SUQ A;  1RTI A;  4H4O A;  3OS0 A;  4CF2 A;  1WSE A;  2KTQ A;  1I3A A;  2RKI A;  3LP0 A;  3F73 A;  4E7H A;  2D5R A;  4OGC A;  3AA2 A;  1RT7 A;  2VWJ A;  2QXF A;  5CYQ A;  3RRG A;  2JLE A;  2G8H A;  1RDA A;  4I9L A;  4DSL A;  1U4B A;  1VSI A;  3KD1 E;  3SNN A;  4CF0 A;  2B4J A;  1BIS A;  4DU4 A;  1A5X A;  1TL3 A;  1CXU A;  3I8D A;  4BE0 A;  4E0D A;  3AVJ A;  3OYK A;  4CE9 A;  4JRP A;  3RMB A;  3K2P A;  1C0U A; 
#chains in the Genus database with same CATH topology
 2E1Y A;  4V19 S;  4Z4I A;  1KLM A;  3N4P A;  4JI7 K;  3AA5 X;  2E20 A;  4ISF A;  2W6K A;  1ZBF A;  4CZK A;  1WAJ A;  4CZM A;  4R5P A;  1HKC A;  1YTU A;  3NHG A;  3QO9 A;  1NGI A;  3H08 A;  3M3Z A;  3H3O B;  4EHU A;  4JI0 K;  3VGK A;  4FJ9 A;  3OYB A;  2BE2 A;  2P9P B;  2B6A A;  4CJ3 A;  4NLB A;  3IMX A;  2QM1 A;  4DSK A;  1ATN A;  2D1K A;  1R59 O;  1DGK N;  3D2E B;  2KLA A;  3K5L A;  2F8S A;  3PO5 A;  1NLV A;  3H1Q A;  1DKG D;  1CZ9 A;  4OPJ A;  4DQQ A;  2YV0 X;  2ZE2 A;  4L8R B;  1EO1 A;  3V9U A;  3I55 N;  3CF5 L;  4ELV A;  4CED A;  3AVL A;  3UKU A;  3NH1 A;  1VRT A;  3TR8 A;  3MCP A;  3OBY A;  4Z4C A;  4FW2 A;  2WBN A;  4B8A B;  1X9W A;  1WOQ A;  4O0I A;  1Q81 O;  3BZK A;  4B08 A;  3CJ1 A;  1TUU A;  3K57 A;  1TKX A;  5J2N A;  3T19 A;  4YY3 K;  1HNZ K;  3MWP A;  4FM0 A;  3E66 A;  1BIU A;  4HCC A;  3E01 A;  4IFE A;  4R79 A;  4QAG A;  4DLG A;  2HND A;  1GLA G;  1HPZ A;  1X3N A;  4CJE A;  3P83 D;  1Q18 A;  3VF4 A;  1NM1 A;  4A62 A;  3CCL N;  5HLF A;  1K6Y A;  1R0A A;  3ID8 A;  4BGB A;  1Z05 A;  1BCO A;  2P1J A;  4KHW A;  3K9J A;  1KSP A;  3NVK A;  5F2R A;  3ITH A;  3D45 A;  3T1Y K;  2CGL A;  1NU0 A;  3CC7 N;  4M3R A;  2P9N A;  3OYJ A;  5LJW A;  5AQI A;  2HW3 A;  5M1N A;  1UA1 A;  3U3G A;  3EN9 A;  1EP4 A;  3VA3 A;  5LJV A;  1ZBS A;  5JMV A;  1Z25 A;  4DS5 A;  1KVB A;  3QML A;  4Z94 A;  3T69 A;  4PL8 A;  4JKD A;  2QWM A;  4B9V A;  2NRH A;  1C6V A;  1C1C A;  4KHQ A;  2D0A A;  1GLL O;  1TYQ A;  1NJW A;  1N36 K;  4CEA A;  4Z4F A;  4I7F A;  5CE3 A;  3RMD A;  3CCM N;  5C2D A;  2RPI A;  1RT4 A;  4H5W A;  2ZM6 K;  1YAG A;  5AQT A;  3DOK A;  5FLX O;  5GIP A;  4KHP K;  3OYD A;  4DF8 A;  1KRP A;  4FJN A;  5I42 A;  5F0X A;  4LD0 A;  3KWI A;  1DTT A;  5JLH A;  4DTN A;  1GLJ O;  3AA4 A;  2F7T A;  1LW0 A;  4FOI A;  1NGB A;  3TSP A;  2IAJ A;  1JLE A;  4GMJ B;  1SKS A;  1VSE A;  1LW2 A;  2OPS A;  4G1Q A;  5AR0 A;  4ILJ A;  3L4I A;  3AV9 A;  1UOC A;  3T3F A;  4UQG A;  3SQ0 A;  3CIP A;  5KGX A;  2E2O A;  3OYF A;  1S9E A;  4CJK A;  3OJS A;  1ZBI A;  5DK5 A;  1BI4 B;  1NKC A;  1C0G A;  1E4G T;  3CCR N;  5GAH P;  3ENB A;  2YNG A;  5EOY A;  3V6D A;  1X9J A;  4CF1 A;  3KLG A;  3SQ4 A;  2Q31 A;  3MN7 A;  4M41 A;  3WT0 A;  4H5N A;  4DQI A;  4HWI A;  4FJL A;  2ATQ A;  3A8Y A;  1Q86 O;  3WXI A;  4Y1C A;  3O08 A;  3P38 A;  4LF8 K;  1JXE A;  1W0H A;  2E2N A;  3M5R A;  1LAV A;  2ZWH A;  3CJ9 A;  5EXW A;  4JKG B;  2CH5 A;  2IS3 A;  5AQJ A;  1OH5 A;  2XRI A;  4FJI A;  4GKJ K;  1N32 K;  3DLB A;  3SJJ A;  1RBU A;  4K25 A;  4DCH A;  1KVC A;  3C95 A;  1DTQ A;  1NJY A;  3TAM A;  1NJX A;  2E2Q A;  5H1S Q;  4DTR A;  3FZK A;  1BA0 A;  3K5O A;  1BQM A;  3TTD A;  3CCV N;  3MXJ A;  1VQ6 N;  3P5J A;  4CI6 A;  3K5N A;  4CEB A;  3RRH A;  5MLC Q;  2G8K A;  4KTQ A;  1X3M A;  4PKH A;  3OY9 A;  1CZB A;  1XC9 A;  3GBT A;  4BR0 A;  2G8W A;  4B9N A;  3L2Q A;  1HQU A;  3KIO A;  3WXK A;  2BGG A;  4JNE A;  3ALY A;  3PO4 A;  1L3T A;  3OA9 A;  4CK3 A;  1NG9 A;  3VOV A;  4B3R K;  3U9Z A;  2FBY A;  2QXL A;  3SAH A;  4FJ5 A;  3O4W A;  1RT3 A;  4RW4 A;  3E9P A;  3OBW A;  2HOE A;  4B1V A;  3OW2 M;  3KK3 A;  4OX9 K;  3KZB A;  3QB0 A;  4U67 L;  1HUX A;  4J2E A;  5AQZ A;  4FWQ A;  3D7E O;  3HPO A;  3LAN A;  1JLG A;  3R8E A;  2D0C A;  3CPE A;  2V52 B;  3J81 O;  3Q7B A;  4JI6 K;  3BGR A;  3EZW A;  4LY7 A;  4IOX A;  3SAG A;  4LSL A;  3K59 A;  1QSS A;  4FLW A;  1U04 A;  4B3O A;  2ETJ A;  2W42 A;  1RTH A;  1ZYQ A;  3CQX A;  5HBM A;  1Y97 A;  2I7P A;  3BP8 A;  1NNE A;  1HNW K;  3UKU B;  4FLV A;  1CXQ A;  4DTU A;  4FW1 A;  1YVN A;  1NJZ A;  1ZBL A;  1RBV A;  3F5T A;  4CJR A;  3OYA A;  1K73 O;  1K8A O;  3C0B A;  1RT6 A;  3KK7 A;  4W5O A;  2WON A;  4NYF A;  1QVG M;  3I0S A;  2XY8 A;  5FDL A;  5C42 A;  1KTQ A;  3DLH A;  3BF1 A;  3CME N;  4RG8 A;  4YOU A;  3F9M A;  5SWM A;  2O8C B;  5LMU K;  4ELT A;  4FK4 A;  4IZ9 A;  4CK2 A;  3TSU A;  5IWA K;  1OH7 A;  4DSJ A;  3VEW A;  1N6Q A;  4FL9 A;  1OVY A;  5C24 A;  3VQ8 A;  4C1N K;  4CZI A;  4YFU A;  3VQ7 A;  2FSK A;  4JKC A;  3VEO A;  4M7X A;  1G15 A;  4CZJ A;  1NGA A;  5EU7 A;  2HVI A;  4J8F A;  3J7Z O;  1CZA N;  3V9W A;  3AY9 A;  5M1O A;  5E84 A;  4W5R A;  4E7L A;  4B9T A;  4CF9 A;  3J7Y P;  4CEO A;  3MN6 A;  4CJS A;  4DTM A;  5BRD A;  2NRZ A;  3H46 O;  4C8O A;  2GEL A;  4KB0 A;  2YJF A;  1WSI A;  3ZT1 A;  1VQ8 N;  4CGJ A;  5C10 A;  4YOX A;  1TKD A;  3G10 A;  2G8F A;  1NK8 A;  2V7Z A;  3SUO A;  5J2Q A;  1MA9 B;  1RDU A;  4KTZ A;  2ASO A;  4XH5 A;  4B9Q A;  1DEJ A;  3ATV A;  4CZF A;  5JVG L;  3LM2 A;  4JKA A;  4A2B A;  4CEC A;  3E1Y A;  4BQZ A;  3DI6 A;  2EHG A;  1M1K O;  3PY8 A;  1I94 K;  3FR0 A;  4JHD A;  3J8A A;  3M1F A;  4BC4 A;  4DFP A;  2ASP A;  4E1M A;  4BR7 A;  4DV6 K;  1KC8 O;  4DR1 K;  1IBL K;  4CD1 A;  4B1Y B;  1A5V A;  1LWE A;  2UUA K;  3KLH A;  3ZX3 A;  1NK5 A;  1TYQ B;  1C1A A;  3E9L A;  3M8R A;  4I6M A;  4KBO A;  1NOZ A;  4M3Z A;  5KPZ A;  1WUA A;  1EQY A;  2KFN A;  3SQ1 A;  4RW7 A;  2VWK A;  3SMP A;  4CFC A;  1RDB A;  2D0P A;  4LF6 K;  3B6P A;  4CW7 B;  4BRL A;  2P9K B;  5BPN A;  4X65 K;  1EX4 A;  1Z6R A;  3AAQ A;  5AQG A;  2KTQ A;  4H0Y B;  5GAD P;  4DV4 K;  3LP0 A;  1K8K B;  1J6Z A;  4OGC A;  1T6D A;  3AA2 A;  2VWJ A;  2QXF A;  5CYQ A;  3RRG A;  2G8H A;  4I9L A;  4CBX A;  1U4B A;  3QFP A;  1JJ2 M;  3DXM A;  4CF0 A;  4DU4 A;  2O8C A;  1CXU A;  2P9U B;  4E0D A;  3IKM A;  4J2B A;  3K2P A;  3C7N A;  4IWV A;  5D3G A;  4CJV A;  5AZI A;  1FXX A;  1IV0 A;  5DMR A;  4F3O A;  3QEP A;  2AA4 A;  5KPT A;  3VES A;  4FJJ A;  4JLH A;  1NK6 A;  4KH4 A;  3QNN A;  3QEW A;  3I56 N;  3CCJ N;  5AQH A;  2IVP A;  3CFO A;  4JAX A;  3NAE A;  4LF9 K;  3DLR A;  4BRN A;  4N47 A;  3IAY A;  2DTU A;  1SKR A;  4IDH A;  4KO0 A;  2OTL N;  2Z1H A;  3LZJ A;  1WSH A;  3M8Q A;  1NWK A;  3KWG A;  1VQL N;  4N5S A;  3ULE A;  1YJ9 N;  2W41 A;  3AVM A;  3NH0 A;  2NRV A;  4FM2 A;  3ZSZ A;  3LAL A;  3MX2 A;  4YDU C;  4AIL C;  3CET A;  4CZL A;  2HHT A;  4AHC A;  3QBW A;  1S5J A;  4H03 B;  3V9S A;  3AVK A;  3TAR A;  4YOV A;  2PZS A;  2P9P A;  4WE1 A;  5HRO A;  3TAQ A;  4BY9 C;  4CJF A;  2D0O A;  3KLE A;  3NBP A;  2UUB K;  1NK7 A;  2J4R A;  4QS7 A;  5GIO A;  3FGU A;  4B1Z A;  3T7Z A;  3R1X A;  4E1J A;  3WXL A;  3KLF A;  3EKU A;  4MQ3 A;  4MFB A;  4BRH A;  3VQQ A;  4CFB A;  2GWK A;  4OPK A;  4BVP A;  3K5M A;  4JKF A;  3MXM A;  3O5B A;  1HNI A;  1X9S A;  2PY5 A;  2O8F B;  4DTS A;  1F21 A;  2QEX N;  2OYQ A;  5T7B A;  3NFA A;  5M1F A;  4JI1 K;  4JEP A;  4B8C A;  4IEE A;  1VSF A;  3D6R A;  4A59 A;  2A42 A;  1VSK A;  1VSM A;  3B6O A;  3QET A;  1HMV A;  2B5J A;  3EYZ A;  2YNH A;  1BGX T;  3MED A;  1KAX A;  1MWM A;  3SCX A;  5LMN K;  4CBU A;  3A5M C;  1ASW A;  4LF4 K;  1ILY A;  3ASM A;  3AGK A;  3MK6 A;  4EAH D;  3U9D A;  1RBS A;  4JKH A;  5FRO A;  3CJB A;  4ZTJ A;  1OH8 A;  3CHW A;  1UA0 A;  2YI1 A;  4B9M A;  2QWN A;  3SV4 A;  4DG1 A;  3AVG A;  1NGC A;  4FLZ A;  2P9S A;  4WCE L;  3A2F A;  4KI6 A;  2ASM A;  3G25 A;  3WNH A;  5CYM A;  1RFQ A;  3L2V A;  4FWO A;  1XMO K;  1J5O A;  3THX B;  5AZI B;  4O8U A;  1S6P A;  4CIE A;  1ASU A;  4F2S A;  4FLX A;  1RDW X;  3ZSO A;  2YCH A;  4DQP A;  3LP3 A;  3HBT A;  3DXM B;  3HOT A;  4H0O A;  2AP1 A;  2OPP A;  3OYH A;  2KW4 A;  2E6L A;  4GW6 A;  3SJH A;  4WQ5 A;  4U7B A;  4LH4 A;  3SBG A;  3NGI A;  1RTD A;  2E5L K;  5GIN A;  5AQV A;  1K8K A;  3DLG A;  4GV3 A;  2NRR A;  2A5X A;  2GTD A;  3L0Q A;  3AO3 A;  3OHR A;  1DLO A;  2O8D B;  5HOO A;  2ZJP L;  4IO9 L;  2Q0R A;  2P9L A;  3AO1 A;  3VTH A;  4CFD A;  4B9L A;  3OYG A;  3H3N O;  1S72 N;  2RE2 A;  3DM2 A;  3LPU A;  3MEG A;  1JL2 A;  2VG5 A;  2A40 A;  1C0T A;  3V1R A;  4BC2 A;  5JIC A;  1FK9 A;  2OTJ N;  4QCL A;  3VER A;  1X9M A;  4KKO A;  1QHT A;  1QQN A;  4KTW A;  4ELU A;  4BRD A;  5SZT A;  2A1S A;  3MX5 A;  5E26 A;  1YTA A;  3K9K A;  1KAZ A;  1C0F A;  4AQY K;  5CZ2 A;  4C1N I;  4J2D A;  2XY5 A;  2JGU A;  2OAN A;  3L3U A;  3UE5 A;  4IEI A;  4CCH A;  5AZJ A;  3RVC A;  5AQN A;  1YUW A;  4CJT A;  1L3S A;  2Z1I A;  3QDK A;  4MLH A;  2VGN A;  2VGM A;  4E7I A;  2F4V K;  3MDQ A;  1S1U A;  4KAZ A;  3NF6 A;  4C8L A;  4KRF A;  5ELZ A;  3EZ5 A;  4FCY A;  4CZH A;  4Z4E A;  2ZD1 A;  4HHT A;  5ADX A;  3ZCM A;  3CYM A;  5C2F A;  2QW9 A;  3EE8 A;  4H5R A;  4FLU A;  4B9U A;  4B3T K;  2VYP A;  2IVN A;  4YNQ A;  3SPY A;  1GLB G;  2RHK A;  4I2Q A;  1ESV A;  2O4G A;  3O9U A;  5HP1 A;  4DQS A;  3JYT A;  2VWB A;  2G8I A;  3BEX A;  1WAF A;  3MCA B;  3LM9 A;  4JYA K;  4F8R A;  2HBJ A;  2NRT A;  2Q97 A;  2LSN A;  4YOR A;  4FJH A;  4DTP A;  3WUH A;  1J5E K;  1RGI A;  4O4G A;  4W5N A;  2X6N A;  1CLQ A;  5KRS A;  1NMD A;  4CGG A;  4BWJ A;  3ZT4 A;  1V4T A;  1VSD A;  4M3X A;  1VQ9 N;  4ID1 A;  4HUE A;  3O4Q A;  3VQA A;  3EL2 A;  4QS8 A;  3ZSQ A;  4Z4G A;  3IUC A;  4RTF D;  4ILH A;  1JLF A;  4N56 A;  4DMN A;  1B92 A;  2Y1I A;  5LL6 Z;  4RWT A;  3HM8 A;  3LDP A;  1L5U A;  4JD2 A;  4E19 A;  4AM6 A;  5TKW A;  3D2E A;  3L2W A;  2XY6 A;  5C15 A;  2W40 A;  5DM6 L;  4CJ5 A;  4CGF A;  3VQ9 A;  3WNG A;  2RF2 A;  1GOA A;  1DT9 A;  4JS5 A;  1SAZ A;  4IJN A;  4IDK A;  2D4W A;  4JK7 A;  4CFA A;  4M3W A;  3V1Q A;  1KD1 O;  2ZGY A;  2ZGZ A;  4LH5 A;  3GOI A;  5M1Q A;  3AVH A;  2HMP A;  4XH4 A;  1FKP A;  1RT2 A;  3D2F B;  2OZM A;  2P9S B;  1LOT B;  4OLA A;  3V1O A;  2KKZ A;  4AHR A;  4A5A A;  2F8T A;  4IFY A;  3ZET B;  2P9I B;  3OS2 A;  4HTU A;  2BH1 A;  4JKB A;  1RDD A;  1D5A A;  4BVO A;  1U6Z A;  4MDA A;  1O13 A;  2E8A A;  4JI2 K;  5BN8 A;  4FLT A;  1TUY A;  5DM7 L;  2DPN A;  3THY A;  4CGD A;  1TGO A;  4GVM A;  3WEE B;  4EP5 A;  4AM7 A;  1S1T A;  4C8K A;  2KFZ A;  3AVF A;  1JKH A;  3FZL A;  1TL1 A;  1WN7 A;  4HVJ A;  1N34 K;  1TAU A;  4M3Y A;  3PX0 A;  2UXB K;  1U2V B;  1ZBH A;  3GDQ A;  1WSJ A;  4A57 A;  2GUP A;  3FFK B;  4O5B A;  4E7K A;  4KH6 A;  2O4I A;  2IIR A;  1I39 A;  1XHX A;  5AJ3 K;  1FJG K;  2O8E A;  3MMV A;  4BG8 A;  1SQK A;  3VEZ A;  4GY2 B;  2HBM A;  4QOZ B;  1NKE A;  3DAW A;  3CG7 A;  3ATU A;  3CFP A;  1KXP A;  4HTL A;  4CJQ A;  2XHB A;  4EZ6 A;  3U8X A;  3WEE A;  2O8B B;  4BRE A;  1QZ5 A;  2YHY A;  5EY4 A;  2FLO A;  1QQM A;  2YKN A;  3THW A;  1IH7 A;  3KK2 A;  2PFU A;  5IT9 O;  3DRS A;  5FRM A;  4E3S A;  2FBV A;  2V51 B;  1T7P A;  2DY4 A;  5AQO A;  5KQD A;  1Q8I A;  2X74 A;  3EO3 A;  1T8E A;  3RR8 A;  5J2P A;  4YOW A;  1JCE A;  4FZX C;  3TAF A;  2NRW A;  1SKW A;  1HKG A;  3T1A A;  2BUP A;  2GEM A;  3ZSY A;  4H5T A;  3OTO K;  2KQ2 A;  1RTI A;  3OS0 A;  1WSE A;  5AQL A;  1I3A A;  3W0L A;  2D5R A;  5CHI A;  4O8K A;  5BRH A;  1RDA A;  4DSL A;  5FPE A;  4MO5 A;  5HL7 L;  1JCG A;  4CD3 A;  1BIS A;  1VQP N;  3AVJ A;  3OYK A;  1W97 L;  2OZS A;  2IC3 A;  2YNF A;  1LWF A;  3K0S A;  4I2P A;  3TPQ A;  3LWM A;  1MU2 A;  3NF8 A;  4H0T B;  1GLF O;  3G71 N;  2P9U A;  2FC0 A;  4XIU A;  1LCU A;  5AQR A;  4BDZ A;  3AAP A;  3AVC A;  2X6S A;  1BO5 O;  3AVI A;  3WQT A;  3NF7 A;  3OYC A;  4FVM A;  3PIO L;  3SQ2 A;  4FJ7 A;  2FBT A;  1Q9Y A;  4K43 A;  1VAZ A;  4L3Q A;  1S1V A;  4XEI A;  4CHQ A;  1KAY A;  4IJA A;  4JRQ A;  4DSI A;  1ZBU A;  1KCF A;  1JLC A;  2PYL A;  3L6Q A;  2BDP A;  1IO2 A;  1TAQ A;  3OYL A;  4BRO A;  4W5Q A;  4C23 A;  1RCH A;  1KVA A;  1QZ6 A;  3R3L A;  3NGY A;  3NH2 A;  1MDU B;  4CEQ A;  3OJU A;  1X1P A;  3U3Y A;  2X78 A;  3BY5 A;  4CIF A;  3MXI A;  3RWU A;  3VN5 A;  3ISN C;  3JXU A;  4NXM K;  4BR9 A;  3P39 A;  5BPL A;  1RBT A;  2E4L A;  4IXC A;  4Y0W A;  4CF8 A;  5CZ1 A;  4M45 A;  3NGZ A;  3HYF A;  4EZ9 A;  3CFR A;  4FWL A;  1QTM A;  1VHX A;  3IG1 A;  4FWK A;  3VQP A;  2QWO A;  2UU9 K;  4XH1 A;  4FJM A;  3LDL A;  5ADX H;  1FW6 A;  1D8Y A;  2HBK A;  4DWI A;  3LAK A;  3CC2 N;  4CGH A;  5AFU H;  4CJL A;  2E88 A;  3U6F A;  2A1R A;  2WUS A;  3OYI A;  1GLD G;  4FZY A;  1W2B M;  4AHV A;  2Q2R A;  4PY5 A;  4CJU A;  3L2R A;  4O5F A;  2JWK A;  5JVH L;  1NK4 A;  2A3Z A;  3N4Q A;  4BRG A;  1O1W A;  3CCE N;  5FPD A;  4B1U B;  3ZYY X;  3AO5 A;  3CER A;  2P51 A;  3BUZ B;  4IBN A;  2BTF A;  4K8X A;  3CPW M;  3TSQ A;  3VET A;  4CEZ A;  4F9O A;  4DS4 A;  5F1X A;  2AJQ A;  1QS4 A;  4CK1 A;  4CHN A;  3ZSX A;  4GNI A;  4BC5 A;  4NYN A;  1WSF A;  3O3H A;  3M6G A;  1EWQ A;  2QWL A;  2HHH K;  3UKR B;  2O8B A;  3FE1 A;  4A2A A;  3THX A;  4CER A;  2PBD A;  4CHO A;  4MO4 A;  2FF6 A;  3EEQ A;  4LC9 B;  3AGR A;  2P5G A;  1YVU A;  3LWL A;  1NGG A;  3VQ5 A;  3F9K A;  1NGD A;  4Y1D A;  3O3F A;  3QER A;  2KZM A;  4BAC A;  2YX6 A;  3NCI A;  4FXD A;  3LDS A;  3IRX A;  3I8B A;  1IKV A;  4WYB A;  3DLL L;  4CBW A;  1VSJ A;  4DQ8 A;  4KHY A;  4FM1 A;  3C6T A;  3WNE A;  3KHY A;  1JCF A;  4BR4 A;  2Z1J A;  1A5W A;  1TVR A;  4FJG A;  4MLE A;  5B8H A;  4BWM A;  3KJV A;  3E9O A;  4YOT A;  3DXK A;  2CGK A;  3VEY A;  3VEN A;  1HPM A;  4CZE A;  3I0R A;  2OCE A;  3RMA A;  4QS9 A;  5LY3 A;  3QIP A;  4KH5 A;  2GUI A;  3ZET A;  4H0P A;  4DV3 K;  4JV5 K;  4IOA L;  2IVO A;  4OKE A;  4PQU A;  4RW8 A;  3C6H A;  5M1K A;  1HX1 A;  3HST B;  4DUZ K;  3F2K A;  4IOC L;  3EE9 A;  4DV5 K;  3TWH A;  1RNH A;  3HXM A;  4KRE A;  1KFD A;  2YNI A;  4DV1 K;  3JSM A;  3QES A;  1KLN A;  4CJ4 A;  4AHU A;  3ZLJ A;  3AAR A;  1XHZ A;  3J80 O;  3VQ4 A;  4BE2 A;  2YHA A;  4FVU A;  1SL1 A;  2QKB A;  3S9H A;  5J1E A;  2E1Z A;  1U45 A;  3O8M A;  4BDY A;  4X62 K;  1SS6 A;  1KFS A;  2FXU A;  1VQN N;  4Z0U A;  4B1X B;  3A5L C;  5AQX A;  1ZC6 A;  4JKG A;  4JK8 A;  4H0X B;  1J53 A;  3ZX2 A;  2HHQ A;  3CQ8 A;  2ZJR L;  2FF3 B;  4BRF A;  4DLE A;  4M7Y A;  3VQC A;  2P5O A;  3DLK A;  3O9R A;  4M3U A;  3MEC A;  5A2Q O;  4EHT A;  1V4S A;  3ZT3 A;  5HRN A;  3IS9 A;  2Q3S A;  4FOE A;  4PA1 A;  4X64 K;  4N41 A;  3HT3 A;  5HRS A;  3O9Q A;  4DR7 K;  1YIT N;  4A61 A;  1NBW A;  4DR6 K;  1XNQ K;  3LP2 A;  4DU3 A;  4A5B A;  1UWB A;  3MAQ A;  1T44 A;  4OKJ A;  5EX5 A;  3VGL A;  5AQU A;  5AQM A;  4ISG A;  3VF6 A;  4B1W B;  3SMS A;  3SBT A;  1GLE G;  3P1G A;  1NGJ A;  4NB4 A;  4KI4 A;  4FWP A;  1HNX K;  3PSF A;  3O9S A;  2HHV A;  4JI4 K;  3V9Z A;  4DKW A;  3THW B;  5FPM A;  2Q1N A;  4DR2 K;  1WBB A;  4BRM A;  1QHA A;  4CJP A;  1RTJ A;  3VF2 A;  3L2U A;  2NLX A;  4OPH A;  2ZF5 O;  3ZX0 A;  4BRC A;  1BHL A;  3VMF B;  1D9F A;  3B8A X;  2Q36 A;  3NVM A;  2VQE K;  3OVN A;  1SL0 A;  2WTU A;  3OYN A;  1LV5 A;  3SUP A;  1HYV A;  2GWJ A;  3WXM B;  1YJW N;  2HHX A;  3AA3 A;  4DQR A;  3TAB A;  3DXK B;  1XWL A;  4CZG A;  4KPY A;  1NOY A;  4TSX A;  3O1B A;  1BA1 A;  1BCM A;  1TV6 A;  1C0M A;  4MDB A;  4LFC K;  1GOC A;  3KKR A;  4K42 A;  4UY8 O;  4PKI A;  3HVT A;  2P9N B;  5I9E B;  3ENO A;  4G9Z A;  1D4X A;  3BZC A;  1ATS A;  1N33 K;  1VSL A;  3PLA A;  4BR5 A;  1WSG A;  1YXQ A;  4WFA L;  3G6E N;  1BQN A;  1WNS A;  3FZF A;  3HL8 A;  4GKK K;  1UAX A;  4OKK A;  4CJ7 A;  3AVN A;  3ZSV A;  3DMJ A;  1SL2 A;  3FFI A;  4FJK A;  1B9F A;  1OVQ A;  3VQB A;  4AF1 A;  2V7Y A;  2QK9 A;  1ASV A;  1VQM N;  3PSI A;  3LP1 A;  1BIZ A;  1XMQ K;  3C6U A;  4X66 K;  4H5V A;  2VG6 A;  2UXC K;  3HP6 A;  5BRF A;  4DF4 A;  1VRU A;  3DLE A;  4Q5V A;  4ZTF A;  3ZT0 A;  1JLQ A;  3RSE B;  3UKR A;  3ZSW A;  3AO4 A;  3M8S A;  1T6C A;  3G4S N;  5KI6 A;  2IGI A;  4KHS A;  4BRA A;  4Z4H A;  4W5T A;  1XNR K;  4YDU A;  3KD5 E;  3DRR A;  4CVN E;  3CMA N;  2YHX A;  3ZT2 A;  3CXC M;  3S3O A;  1IJJ A;  2G8V A;  2NUB A;  1RDC A;  4O55 A;  4KFB A;  2YKM A;  4O0J A;  4BC3 A;  1YIJ N;  3H45 C;  2NRX A;  4WFN L;  3VQD A;  1NGF A;  3SUQ A;  1RBR A;  4EFH A;  3HP9 A;  4BG9 A;  1LAW A;  4H4O A;  3FZM A;  2HBL A;  2RKI A;  2E2P A;  4E7H A;  3FZH A;  2GX9 A;  4WF9 L;  1YHQ N;  3SNN A;  4ISE A;  4BRQ A;  1A5X A;  3I8D A;  4BE0 A;  4CE9 A;  4WFB L;  3GG4 A;  4B3S K;  4FPA A;  2WC9 A;  3C6A A;  5C12 A;  1TK5 A;  4C8N A;  3KLI A;  3THY B;  3RMC A;  3DOL A;  5BRE A;  3HTV A;  4IG0 A;  4YOY A;  1RIL A;  4OVL A;  5KGW A;  1HR0 K;  3K58 A;  3TAE A;  4C8M A;  3KVG A;  1HYS A;  3U4L A;  3FLC O;  2P9I A;  1VQ4 N;  4LF5 K;  3SZ2 A;  4K0K K;  5GAG P;  4NCA A;  4DU1 A;  3QFU A;  3D2F A;  2R7Y A;  2HVH A;  3TAG A;  2UUC K;  4LF7 K;  1YI2 N;  4ZHR A;  3MN9 A;  3O80 A;  5CY4 A;  3TTC A;  1WLJ A;  1XC3 A;  1HRH A;  3ID6 A;  4DFM A;  3HPG A;  1L3U A;  1BG3 A;  3ZEU A;  3TAP A;  5AZJ B;  4OJR A;  4BR2 A;  4OPA A;  5KPR A;  4N76 A;  5K14 A;  2VG7 A;  3CJC A;  3RR7 A;  1IG8 A;  2F9T A;  4HCB A;  2QKK A;  1L3V A;  2HMI A;  3SPZ A;  3L8B A;  4AHS A;  3HRG A;  2FSJ A;  4JD2 B;  4BRK A;  4CGI A;  3ENH A;  3SYZ A;  4JKE A;  1E3M A;  4YHH K;  3CM6 A;  4NLC A;  3LZI A;  5AQY A;  3KTQ A;  4ICL A;  2RN2 A;  4E89 A;  2A6A A;  1JL1 A;  4O44 A;  1S22 A;  3L4Q A;  5EVZ A;  5HRP A;  3QIO A;  2O8D A;  3LDN A;  5BN9 A;  2FBX A;  2Y1J A;  4LSN A;  1IKW A;  1IBK K;  3KKS A;  4OO1 J;  4KHU A;  3T1H K;  3A5N C;  2PYJ A;  3HVR A;  3V4I A;  4CHZ A;  1YT3 A;  3A5O C;  1XI1 A;  1VSH A;  2DFH A;  1IG9 A;  1P90 A;  4FO0 A;  4PL7 A;  4FWN A;  3NMU A;  1D9D A;  1S1X A;  1SV5 A;  1HKB A;  4DSE A;  1VK0 A;  4HUG A;  3C65 A;  3MEE A;  1HYZ A;  2P9K A;  4H8K A;  3Q7C A;  4WQ5 C;  3WXJ A;  1VQO N;  2A41 A;  4FK0 A;  4JS4 A;  1C1B A;  4RCH A;  4CHP A;  3HOS A;  5J2M A;  3CCS N;  4JI5 K;  3BF3 A;  2I7N A;  5BPM A;  4I6M B;  4JI3 K;  3V81 A;  2HNZ A;  4E7J A;  4EIA A;  4BDP A;  4DFJ A;  2Z1G A;  5AQP A;  2YHB A;  3MN5 A;  3QIN A;  1JLB A;  3HZ6 A;  4JI8 K;  3HI0 A;  1Z26 A;  2XY7 A;  3GL1 A;  1MWK A;  1IKY A;  1S3X A;  3P31 A;  1QQC A;  4FWS A;  1G99 A;  3IDH A;  3LDO A;  3CJA A;  4JHD B;  4DSF A;  4DFK A;  4FJX A;  4PWD A;  2HHS A;  4Q0B A;  2I5J A;  4PHT X;  1HJO A;  3H1V X;  3O1W A;  4H0V B;  3SI6 A;  3BDP A;  1JXB A;  4IG3 A;  2DFF A;  5AQK A;  3VGM A;  3J7A P;  4DR4 K;  3WNF A;  1QSY A;  3TI0 A;  1P8Z A;  4WQ4 A;  4DTO A;  1Q82 O;  3CCQ N;  4FLY A;  1BWF O;  4GV6 A;  4CHY A;  2BAN A;  2DFE A;  2QTD A;  3IFR A;  1IBM K;  3OYE A;  1NGE A;  1HNV A;  2EX3 A;  1U2V A;  2VCP A;  2ZQB A;  4BGA A;  1FKO A;  1KQS M;  3S41 A;  1XQS C;  3EKS A;  3EY1 A;  4LFA K;  4CEF A;  1NKB A;  5JS2 A;  2CH6 A;  1S1W A;  3UIQ A;  1REV A;  3VQE A;  2D0B A;  3GE1 A;  3L3V A;  3O3G A;  3TU5 A;  2ZJQ L;  5C0Y A;  2Q0U A;  4CIG A;  1J9A A;  1U49 A;  1H1V A;  1E4F T;  3RSE A;  2CGJ A;  1VQK N;  3QEI A;  4FYD A;  4NXN K;  3DWL A;  1TK8 A;  4B3M K;  3A0I X;  3AVA A;  5M1P A;  1XUP O;  3LL3 A;  3NDK A;  1RT1 A;  3PUF A;  1EXQ A;  3V9X A;  2HNY A;  2E6M A;  3H6E A;  4DHY A;  1QSL A;  1TKT A;  5AQW A;  3AVB A;  3ULD A;  1JLA A;  3RTV A;  1VQ7 N;  3CC4 N;  4BE1 A;  3C94 A;  5AQF A;  4NO7 A;  5I3U A;  2NZT A;  4PKG A;  1EKE A;  3QNO A;  4WQ4 C;  1HJR A;  1S6Q A;  1HQE A;  4B9S A;  3QBX A;  1YF5 L;  5CR4 A;  2ITG A;  3TAN A;  5JLF A;  2XO7 A;  4OGE A;  1N5Y A;  4FZZ A;  1M90 O;  4H4M A;  3DJC A;  3NE6 A;  5AQS A;  2OA8 A;  1U48 A;  4FK2 A;  1N8R O;  2F9W A;  2UXD K;  4DR3 K;  3LAM A;  4RW6 A;  3QEX A;  4NCG A;  2YJE A;  2KHO A;  2OPQ A;  4DUY K;  2EWS A;  2PAV A;  4K8Z A;  3R6M A;  1J54 A;  3VQ6 A;  4F4K A;  2O8F A;  3O9T A;  3PV8 A;  5JS1 A;  3JS6 A;  1W9H A;  3O4N A;  2NNW A;  3THV A;  4JN4 A;  1NJI O;  4AHT A;  3HJF A;  1QVF M;  5AQQ A;  2IDO A;  3JAM O;  5BR8 K;  3SV3 A;  4CEE A;  3AO2 A;  4GVE A;  1NK0 A;  4PUO A;  1YJN N;  1NGH A;  1S9G A;  3UB5 A;  2VQF K;  1T3V A;  2WOM A;  4FPB A;  4E1N A;  4KV8 A;  4CES A;  1RT5 A;  1ZXO A;  4FWR A;  4BRP A;  5HRR A;  3PIP L;  2YHW A;  3O6W A;  5TKY A;  2QA4 N;  2QWQ A;  4DV2 K;  1HLU A;  3W3D A;  2JWL A;  2UYT A;  3ULE B;  3S3M A;  4F3T A;  2HHU A;  2IOC A;  1QE1 A;  1B9D A;  3CI5 A;  4IFV A;  1BOT O;  3CJ7 A;  4FWM A;  3CCU N;  3PX4 A;  3NF9 A;  5FPN A;  3MWT A;  5KRT A;  1VQ5 N;  3CD6 N;  4ID5 A;  5C25 A;  3DYA A;  3VTI A;  1T03 A;  1NMN A;  4FSV A;  4FJ8 A;  1BL3 A;  1Q9X A;  4DTJ A;  2W6L A;  2FSN A;  2QWR A;  3VEV A;  4IKF A;  3QLH A;  2HST A;  4EP4 A;  1U47 A;  3SUN A;  2KZZ A;  2HF3 A;  2P9L B;  1LWC A;  2WFB A;  3CM5 A;  1QQO A;  1GLC G;  4BQL A;  4JK9 A;  4M63 C;  3C7N B;  3OS1 A;  3HM9 A;  5FRN A;  1BI4 A;  2F96 A;  2ITM A;  3LPT A;  3D0P A;  3M8P A;  4DV7 K;  4HUF A;  3HK2 A;  1Q7Y O;  4GV9 A;  3DRP A;  4IO8 A;  2OPR A;  4OLB A;  1BU6 O;  4DTX A;  5GAE P;  5KTQ A;  2GBZ A;  3PX6 A;  1GOB A;  1Y64 A;  3ZSR A;  1SZ2 A;  4J2A A;  5KQ8 A;  1OH6 A;  3SLC A;  3R9P A;  1BUP A;  4LFB K;  3TTF A;  1TKZ A;  3P4I A;  1TK0 A;  3QEV A;  1EET A;  4F2R A;  4KB1 A;  3VA0 A;  4BRI A;  2GV9 A;  4CJW A;  1ITG A;  1NK9 A;  3LDQ A;  4M42 A;  4AH9 A;  2QWP A;  3I33 A;  3KK1 A;  4I9Q A;  4DV0 K;  2O8E B;  1IKX A;  3HO1 A;  3HSC A;  3CQY A;  3ZEU B;  4DB3 A;  3S3N A;  1W7A A;  1K9M O;  2H3G X;  2G8U A;  4KHN A;  4RW9 A;  4NCB A;  4K41 A;  3HPH A;  1T05 A;  3G0Z A;  5E41 A;  1ATR A;  3SK3 A;  3SAF A;  1EWR A;  2HB5 A;  2HHW A;  3OYM A;  4M3T A;  1SUQ A;  4CF2 A;  1WBD A;  3F73 A;  3VPZ A;  1RT7 A;  2HF4 A;  2JLE A;  3VEX A;  4ILG B;  1OKJ A;  2QI2 A;  1VSI A;  3KD1 E;  5BR9 A;  5AFU A;  2B4J A;  1TL3 A;  1WB9 A;  1BDG A;  4JRP A;  3WQU A;  4DR5 K;  3RMB A;  3QIC A;  1C0U A; 
#chains in the Genus database with same CATH homology
 5D3G A;  4CJV A;  1FXX A;  2OZS A;  4Z4I A;  1KLM A;  2IC3 A;  5DMR A;  4F3O A;  3QEP A;  1TK5 A;  2YNF A;  4C8N A;  1LWF A;  4FJJ A;  3KLI A;  4I2P A;  3AA5 X;  3LWM A;  3DOL A;  3RMC A;  4IG0 A;  1ZBF A;  1MU2 A;  1RIL A;  3NF8 A;  4JLH A;  1NK6 A;  1WAJ A;  4OVL A;  4R5P A;  3QNN A;  3QEW A;  2FC0 A;  5KGW A;  4XIU A;  3K58 A;  3TAE A;  3NHG A;  3QO9 A;  3H08 A;  4C8M A;  4BDZ A;  1YTU A;  1HYS A;  3CFO A;  4FJ9 A;  3AVC A;  2X6S A;  3OYB A;  3NAE A;  3SZ2 A;  3DLR A;  4N47 A;  2BE2 A;  2B6A A;  3IAY A;  4CJ3 A;  4NCA A;  1SKR A;  2DTU A;  4DU1 A;  3AVI A;  4DSK A;  3NF7 A;  4KO0 A;  3OYC A;  3K5L A;  2R7Y A;  4FVM A;  3SQ2 A;  3PO5 A;  2Z1H A;  4FJ7 A;  2FBT A;  3LZJ A;  1WSH A;  3TAG A;  1Q9Y A;  2HVH A;  3M8Q A;  1CZ9 A;  4OPJ A;  4N5S A;  1S1V A;  4DQQ A;  2YV0 X;  2ZE2 A;  4CHQ A;  4L8R B;  4ZHR A;  3AVM A;  3NH0 A;  4JRQ A;  4DSI A;  1ZBU A;  4FM2 A;  1KCF A;  1JLC A;  3LAL A;  5CY4 A;  3ZSZ A;  4AIL C;  2PYL A;  3V9U A;  2BDP A;  1IO2 A;  1WLJ A;  1TAQ A;  3OYL A;  1HRH A;  2HHT A;  4DFM A;  4W5Q A;  4ELV A;  3HPG A;  4CED A;  4AHC A;  1L3U A;  3AVL A;  1RCH A;  1S5J A;  3TAP A;  1KVA A;  4OJR A;  3NH1 A;  1VRT A;  3NGY A;  3NH2 A;  3TR8 A;  3AVK A;  3V9S A;  5K14 A;  4Z4C A;  3TAR A;  4CEQ A;  2VG7 A;  4FW2 A;  3RR7 A;  4B8A B;  1X9W A;  3OJU A;  4O0I A;  2PZS A;  1X1P A;  4WE1 A;  2X78 A;  3U3Y A;  5HRO A;  4CIF A;  3TAQ A;  4CJF A;  4B08 A;  3KLE A;  3NBP A;  3VN5 A;  3ISN C;  3MXI A;  2QKK A;  4HCB A;  4N76 A;  1NK7 A;  1L3V A;  3K57 A;  2HMI A;  3SPZ A;  3L8B A;  4AHS A;  1TKX A;  1RBT A;  4CGI A;  4J2B A;  3KLF A;  2E4L A;  3SYZ A;  3T19 A;  5J2N A;  4MQ3 A;  4MFB A;  4CFB A;  3CM6 A;  3VQQ A;  4FM0 A;  3LZI A;  4CF8 A;  4OPK A;  3KTQ A;  4ICL A;  2RN2 A;  1BIU A;  5CZ1 A;  4M45 A;  1JL1 A;  4E89 A;  3HYF A;  3NGZ A;  3E01 A;  4O44 A;  3K5M A;  4EZ9 A;  4HCC A;  2AJQ A;  3MXM A;  5HRP A;  3CFR A;  4QAG A;  1HNI A;  4DLG A;  1X9S A;  1QTM A;  3QIO A;  2PY5 A;  2HND A;  4DTS A;  1F21 A;  2FBX A;  1HPZ A;  2Y1J A;  3IG1 A;  4CJE A;  2OYQ A;  4LSN A;  3P83 D;  3VQP A;  1IKW A;  3KKS A;  3NFA A;  5T7B A;  4KHU A;  4FJM A;  5HLF A;  2PYJ A;  3HVR A;  1K6Y A;  4B8C A;  3V4I A;  1R0A A;  4CHZ A;  1D8Y A;  1YT3 A;  4DWI A;  1VSF A;  3LAK A;  1XI1 A;  1VSH A;  2DFH A;  4CGH A;  4CJL A;  1IG9 A;  1BCO A;  2P1J A;  3U6F A;  2A1R A;  1VSK A;  1VSM A;  3B6O A;  4KHW A;  3OYI A;  1KSP A;  3QET A;  4FZY A;  3ITH A;  3D45 A;  4M3R A;  1S1X A;  4AHV A;  1D9D A;  1SV5 A;  1HMV A;  4DSE A;  4PY5 A;  4CJU A;  3L2R A;  2B5J A;  1VK0 A;  3OYJ A;  3MEE A;  3EYZ A;  1HYZ A;  4HUG A;  2YNH A;  1NK4 A;  2HW3 A;  4H8K A;  1UA1 A;  1O1W A;  1BGX T;  3U3G A;  3MED A;  4FK0 A;  2HHU A;  1EP4 A;  3VA3 A;  3SCX A;  4JS4 A;  1C1B A;  1Z25 A;  1ASW A;  3AO5 A;  1KVB A;  4CHP A;  4DS5 A;  5J2M A;  3ASM A;  2P51 A;  4IBN A;  4K8X A;  3V81 A;  1RBS A;  2HNZ A;  4CEZ A;  4E7J A;  4DS4 A;  4BDP A;  4B9V A;  4DFJ A;  1C6V A;  1C1C A;  1QS4 A;  2Z1G A;  2YHB A;  2D0A A;  5FRO A;  4CK1 A;  4CHN A;  3ZSX A;  4ZTJ A;  1UA0 A;  1NJW A;  3QIN A;  1JLB A;  4B9M A;  4CEA A;  3SV4 A;  1Z26 A;  2XY7 A;  1IKY A;  4NYN A;  4I7F A;  4Z4F A;  4DG1 A;  3AVG A;  1WSF A;  4FLZ A;  3O3H A;  3RMD A;  1QQC A;  3A2F A;  4KI6 A;  4DSF A;  2RPI A;  1RT4 A;  4DFK A;  4FJX A;  4PWD A;  2HHS A;  3WNH A;  4Q0B A;  3DOK A;  2I5J A;  5CYM A;  4CER A;  1J5O A;  3L2V A;  4CHO A;  3OYD A;  4DF8 A;  1KRP A;  4FJN A;  3SI6 A;  5I42 A;  3BDP A;  1JXB A;  2P5G A;  4LD0 A;  1DTT A;  4IG3 A;  4DTN A;  1S6P A;  3AA4 A;  1YVU A;  1LW0 A;  2DFF A;  1ASU A;  4CIE A;  3LWL A;  4FLX A;  4F2S A;  3ZSO A;  3VQ5 A;  3F9K A;  2IAJ A;  1JLE A;  4GMJ B;  4Y1D A;  3O3F A;  3QER A;  1SKS A;  1VSE A;  1LW2 A;  2OPS A;  4G1Q A;  4BAC A;  4DQP A;  3LP3 A;  2KZM A;  3NCI A;  4FXD A;  3WNF A;  3LDS A;  2OPP A;  3IRX A;  3OYH A;  3TI0 A;  1QSY A;  2KW4 A;  2E6L A;  3AV9 A;  4GW6 A;  1IKV A;  1UOC A;  3T3F A;  4LH4 A;  3NGI A;  4DTO A;  1RTD A;  4UQG A;  4FLY A;  3SQ0 A;  3DLG A;  5KGX A;  1VSJ A;  4CHY A;  2BAN A;  2DFE A;  3OYF A;  1S9E A;  4CJK A;  4KHY A;  4FM1 A;  3C6T A;  3OYE A;  3OJS A;  1ZBI A;  3WNE A;  1HNV A;  2EX3 A;  5DK5 A;  1BI4 B;  1NKC A;  2Z1J A;  1A5W A;  1TVR A;  2ZQB A;  3AO3 A;  1FKO A;  1DLO A;  4FJG A;  3EY1 A;  2YNG A;  4CEF A;  3AO1 A;  3V6D A;  1NKB A;  4CFD A;  4BWM A;  4B9L A;  5JS2 A;  3OYG A;  4CF1 A;  3KLG A;  1S1W A;  3DM2 A;  3KJV A;  3SQ4 A;  3LPU A;  3MEG A;  3UIQ A;  1JL2 A;  1REV A;  2VG5 A;  3V1R A;  1C0T A;  3VQE A;  1FK9 A;  2D0B A;  4QCL A;  4M41 A;  3I0R A;  3RMA A;  4KKO A;  1QHT A;  3L3V A;  3O3G A;  1X9M A;  4DQI A;  4FJL A;  2ATQ A;  3QIP A;  2GUI A;  4KTW A;  4Y1C A;  4ELU A;  4CIG A;  5SZT A;  2A1S A;  1J9A A;  4OKE A;  1YTA A;  4PQU A;  1JXE A;  4RW8 A;  1W0H A;  5CZ2 A;  1LAV A;  3HST B;  4J2D A;  2XY5 A;  2JGU A;  3L3U A;  1U49 A;  4CCH A;  3TWH A;  2IS3 A;  4CJT A;  1RNH A;  1L3S A;  2Z1I A;  3HXM A;  4KRE A;  3QEI A;  2XRI A;  4FJI A;  4FYD A;  1KFD A;  2YNI A;  3JSM A;  4E7I A;  3DLB A;  3SJJ A;  1RBU A;  1TK8 A;  3QES A;  1S1U A;  4KAZ A;  3NF6 A;  4C8L A;  4KRF A;  1KVC A;  3AVA A;  3C95 A;  1DTQ A;  1NJY A;  4CJ4 A;  3EZ5 A;  1KLN A;  3TAM A;  4AHU A;  4FCY A;  3NDK A;  1RT1 A;  4Z4E A;  3PUF A;  2ZD1 A;  4HHT A;  1NJX A;  1EXQ A;  3V9X A;  3ZCM A;  1XHZ A;  2HNY A;  2E6M A;  1QSL A;  3CYM A;  1TKT A;  3VQ4 A;  4FLU A;  4BE2 A;  3AVB A;  4B9U A;  2YHA A;  4DTR A;  1SL1 A;  4YNQ A;  3K5O A;  3ULD A;  1BQM A;  3SPY A;  1JLA A;  2QKB A;  3RTV A;  3S9H A;  5J1E A;  3MXJ A;  3P5J A;  4I2Q A;  4BE1 A;  3C94 A;  3K5N A;  4CEB A;  2O4G A;  3RRH A;  1U45 A;  4BDY A;  5I3U A;  1EKE A;  5HP1 A;  2G8K A;  4DQS A;  4KTQ A;  3JYT A;  3QNO A;  1KFS A;  2G8I A;  1HJR A;  1S6Q A;  1CZB A;  1WAF A;  3OY9 A;  1HQE A;  4B9S A;  4Z0U A;  1XC9 A;  2G8W A;  4B9N A;  2ITG A;  4F8R A;  3TAN A;  2XO7 A;  1J53 A;  4OGE A;  3L2Q A;  1HQU A;  2LSN A;  3KIO A;  3CQ8 A;  1N5Y A;  2HHQ A;  4FJH A;  4FZZ A;  4DTP A;  2BGG A;  4H4M A;  3ALY A;  3PO4 A;  1L3T A;  4CK3 A;  4DLE A;  3NE6 A;  2OA8 A;  4O4G A;  4W5N A;  2FBY A;  2X6N A;  1CLQ A;  1U48 A;  3VQC A;  2P5O A;  5KRS A;  4FJ5 A;  4FK2 A;  4CGG A;  4BWJ A;  3DLK A;  1RT3 A;  4RW4 A;  3ZT4 A;  1VSD A;  4M3X A;  4M3U A;  3LAM A;  4RW6 A;  3MEC A;  3QEX A;  4KHQ A;  4NCG A;  3KK3 A;  2OPQ A;  4ID1 A;  4HUE A;  3ZT3 A;  4K8Z A;  1J54 A;  3O4Q A;  3VQ6 A;  5HRN A;  3VQA A;  3IS9 A;  4F4K A;  4J2E A;  4Z4G A;  2Q3S A;  3ZSQ A;  4PA1 A;  3PV8 A;  3HPO A;  5JS1 A;  3LAN A;  1JLG A;  4N41 A;  1JLF A;  1W9H A;  2D0C A;  3O4N A;  4N56 A;  4DMN A;  5HRS A;  1B92 A;  3HT3 A;  3THV A;  4AHT A;  2Y1I A;  3BGR A;  3HJF A;  2IDO A;  3LP2 A;  4LY7 A;  4DU3 A;  1UWB A;  3MAQ A;  3SV3 A;  1L5U A;  4LSL A;  4E19 A;  4OKJ A;  4CEE A;  3K59 A;  1QSS A;  3AO2 A;  4FLW A;  3L2W A;  2XY6 A;  1U04 A;  1NK0 A;  2ETJ A;  4B3O A;  4PUO A;  2W42 A;  1RTH A;  1ZYQ A;  5HBM A;  1Y97 A;  1S9G A;  3P1G A;  4KI4 A;  2WOM A;  4CJ5 A;  4E1N A;  4KV8 A;  4CES A;  4FLV A;  4CGF A;  1CXQ A;  1RT5 A;  3VQ9 A;  3WNG A;  2RF2 A;  1GOA A;  4DTU A;  2HHV A;  3RWU A;  4FW1 A;  3V9Z A;  5HRR A;  4JS5 A;  1NJZ A;  1ZBL A;  1RBV A;  4CJR A;  3OYA A;  4IDK A;  1RT6 A;  4CFA A;  3S3M A;  4W5O A;  2WON A;  4M3W A;  2IOC A;  1QE1 A;  4F3T A;  1B9D A;  4CJP A;  4NYF A;  1RTJ A;  4IFV A;  3V1Q A;  3I0S A;  2XY8 A;  5FDL A;  3L2U A;  3PX4 A;  4LH5 A;  3NF9 A;  1D9F A;  1BHL A;  3AVH A;  5C42 A;  1KTQ A;  3DLH A;  1FKP A;  1RT2 A;  2OZM A;  4RG8 A;  4OLA A;  5KRT A;  3V1O A;  5SWM A;  3OVN A;  4AHR A;  4ELT A;  4FK4 A;  2F8T A;  4ID5 A;  4IFY A;  4CK2 A;  5C25 A;  1SL0 A;  3OS2 A;  4HTU A;  4DSJ A;  3DYA A;  1T03 A;  1N6Q A;  1RDD A;  3OYN A;  1LV5 A;  1D5A A;  5C24 A;  3VQ8 A;  3SUP A;  4FJ8 A;  1BL3 A;  1HYV A;  4YFU A;  3VQ7 A;  1Q9X A;  4DTJ A;  2HHX A;  3AA3 A;  4DQR A;  4FLT A;  3TAB A;  3QLH A;  1G15 A;  4IKF A;  1XWL A;  5EU7 A;  2HVI A;  4KPY A;  4CGD A;  1TGO A;  4GVM A;  4EP4 A;  3V9W A;  4TSX A;  1U47 A;  4EP5 A;  1NOY A;  1S1T A;  1BCM A;  1TV6 A;  1C0M A;  3SUN A;  4C8K A;  2KFZ A;  3AVF A;  1LWC A;  3CM5 A;  4W5R A;  2KZZ A;  1JKH A;  4E7L A;  4B9T A;  4CF9 A;  1TL1 A;  1WN7 A;  4HVJ A;  3OS1 A;  1GOC A;  3HM9 A;  5FRN A;  3KKR A;  1TAU A;  4M3Y A;  1BI4 A;  3PX0 A;  4CEO A;  2F96 A;  3HVT A;  4CJS A;  4DTM A;  3LPT A;  3D0P A;  3M8P A;  1ZBH A;  4C8O A;  1WSJ A;  4KB0 A;  4E7K A;  4O5B A;  4HUF A;  1VSL A;  1WSI A;  2O4I A;  3HK2 A;  1WSG A;  3ZT1 A;  1I39 A;  1XHX A;  4CGJ A;  3DRP A;  1BQN A;  1WNS A;  1TKD A;  3HL8 A;  3G10 A;  1UAX A;  4OKK A;  1NK8 A;  2G8F A;  3AVN A;  3SUO A;  2OPR A;  5J2Q A;  4OLB A;  4KTZ A;  3ZSV A;  4DTX A;  3DMJ A;  2F8S A;  1SL2 A;  3FFI A;  5KTQ A;  2GBZ A;  4FJK A;  1B9F A;  4QOZ B;  3PX6 A;  1NKE A;  1GOB A;  3CG7 A;  3VQB A;  2QK9 A;  1ASV A;  3ZSR A;  3CFP A;  3LP1 A;  4J2A A;  1BIZ A;  3C6U A;  2VG6 A;  4CEC A;  3HP6 A;  3DI6 A;  4DF4 A;  1VRU A;  4CJQ A;  2EHG A;  2XHB A;  4EZ6 A;  1TKZ A;  3PY8 A;  1TK0 A;  3DLE A;  4Q5V A;  4ZTF A;  3ZT0 A;  1JLQ A;  3QEV A;  1EET A;  4F2R A;  4KB1 A;  3VA0 A;  4DFP A;  3ZSW A;  4E1M A;  3AO4 A;  3M8S A;  2GV9 A;  2YKN A;  1IH7 A;  4CJW A;  5KI6 A;  3KK2 A;  1ITG A;  2IGI A;  1NK9 A;  4M42 A;  4AH9 A;  4KHS A;  3KK1 A;  3DRS A;  1A5V A;  5FRM A;  1LWE A;  4I9Q A;  3KLH A;  4Z4H A;  4W5T A;  4E3S A;  1NK5 A;  3KD5 E;  3DRR A;  2FBV A;  1T7P A;  1C1A A;  3M8R A;  1IKX A;  2DY4 A;  3HO1 A;  1Q8I A;  2X74 A;  1NOZ A;  3S3N A;  1T8E A;  3ZT2 A;  4M3Z A;  3S3O A;  3RR8 A;  2KFN A;  2G8V A;  2NUB A;  1RDC A;  4O55 A;  5J2P A;  3SQ1 A;  2G8U A;  4KFB A;  2YKM A;  4RW7 A;  4KHN A;  4RW9 A;  2VWK A;  3TAF A;  4O0J A;  4CFC A;  4FZX C;  4NCB A;  1SKW A;  1RDB A;  3HPH A;  3B6P A;  1T05 A;  3T1A A;  3G0Z A;  5E41 A;  3VQD A;  2HB5 A;  2HHW A;  3SUQ A;  3OYM A;  3ZSY A;  1RBR A;  1EX4 A;  4M3T A;  3HP9 A;  2KQ2 A;  1LAW A;  1SUQ A;  1RTI A;  4H4O A;  3OS0 A;  4CF2 A;  1WSE A;  2KTQ A;  1I3A A;  2RKI A;  3LP0 A;  3F73 A;  4E7H A;  2D5R A;  4OGC A;  3AA2 A;  1RT7 A;  2VWJ A;  2QXF A;  5CYQ A;  3RRG A;  2JLE A;  2G8H A;  1RDA A;  4I9L A;  4DSL A;  1U4B A;  1VSI A;  3KD1 E;  3SNN A;  4CF0 A;  2B4J A;  1BIS A;  4DU4 A;  1A5X A;  1TL3 A;  1CXU A;  3I8D A;  4BE0 A;  4E0D A;  3AVJ A;  3OYK A;  4CE9 A;  4JRP A;  3RMB A;  3K2P A;  1C0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...