3AO1A

Fragment-based approach to the design of ligands targeting a novel site in hiv-1 integrase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
151
structure length
141
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
molecule tags Viral protein/transferase inhibitor
source organism Human immunodeficiency virus 1
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
total genus 52
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao1A00
4I9LA 3OYHA 1S6PA 4CE9A 3SQ2A 4FJNA 1TL3A 1VSJA 3AVKA 2XY8A 4RW8A 1S9EA 1U04A 3MXMA 4FM2A 1BHLA 3O4NA 1ASUA 1VK0A 5HBMA 3E01A 2YHAA 4RG8A 4KHWA 1BI4B 2ZE2A 3ULDA 4KHSA 5FRMA 1KTQA 4I7FA 5DK5A 3RMAA 4FJ9A 4W5OA 2IS3A 3P83D 2YNHA 2D0AA 3DYAA 4WE1A 1HMVA 5HROA 2VG7A 1KVCA 4W5TA 1RTJA 2NUBA 3OS1A 3OYJA 5J2NA 3VQEA 3V9UA 1QSSA 3PX6A 3OYNA 1QE1A 1RDCA 4F4KA 3HK2A 2GUIA 2FBYA 1S1WA 2Q3SA 2OPSA 2G8WA 2F8SA 3V1RA 4CJEA 1J9AA 3F9KA 1TAQA 4CF0A 4KFBA 4DFMA 2D0BA 3KK2A 3LPTA 3KTQA 2IDOA 1QS4A 3AA5X 3K59A 1EP4A 3OYEA 3OJSA 2DFHA 1TK5A 3V1QA 4C8MA 4J2DA 3HPGA 1BQNA 4PQUA 1VSLA 2YNIA 4CJUA 3OYMA 4FM1A 1ZBHA 1S9GA 4Y1CA 3IAYA 1IKYA 4AHSA 5SZTA 5HRPA 1BIZA 3TAFA 4CF2A 4DTMA 1RT1A 2X6SA 3D45A 4TSXA 3SCXA 4CJKA 4B9VA 4CCHA 3CM5A 5C24A 1BQMA 1FKPA 2OPRA 4CHOA 4N56A 4KAZA 3TARA 4IDKA 3M8SA 4H8KA 4JLHA 1FKOA 4CEDA 1N5YA 4K8ZA 4O55A 3SNNA 3S3OA 4M41A 3SQ0A 3KJVA 1CZBA 1A5XA 3V9XA 4I9QA 3AO3A 4BDPA 5CY4A 3MEEA 3JSMA 2B4JA 3SYZA 4DSKA 3RMDA 2EX3A 4KHNA 1WSEA 1KCFA 4CIGA 2YNGA 3ZSVA 2KZMA 1VSFA 3ZSQA 3JYTA 4HUFA 1S1VA 3HPOA 2JGUA 3KKRA 4FK4A 3ZT1A 3VQ4A 4FLYA 2OPPA 3U3GA 3ZSZA 1JXEA 4DG1A 1VSKA 4OLBA 4OJRA 3WNFA 4CEZA 3NF9A 1KFDA 4FJLA 3VA3A 3K2PA 3PX0A 4OGCA 3RMCA 3OY9A 2KW4A 4LSLA 1VSDA 3ZT3A 1GOCA 2KTQA 3K5LA 3LP1A 3SUPA 5HP1A 4CFDA 1TKDA 2AJQA 1FK9A 1NJZA 3VN5A 1LW0A 1Q8IA 2D5RA 5K14A 3AA3A 3VQ8A 2IC3A 3AA4A 1CZ9A 3HVTA 4FLXA 4W5QA 3ITHA 2R7YA 1RT2A 1QSLA 4M3WA 3DRSA 2G8UA 3LP0A 3NCIA 3ZCMA 3M8QA 4FJKA 3RRGA 4IFVA 1IKWA 4CFAA 3SUOA 5I3UA 4H4OA 3IRXA 4CECA 3KKSA 3ZSYA 1VSMA 1BL3A 3TABA 4EP5A 4G1QA 3B6PA 2PY5A 1BCOA 5E41A 1WAJA 1R0AA 4DF4A 4F8RA 1KVBA 4FZZA 5KI6A 3CM6A 4AH9A 3NDKA 1CXQA 1X1PA 4BDZA 1UA0A 3PO5A 3HM9A 1LWFA 3HP9A 1YVUA 3KLEA 1JLBA 1W0HA 3ISNC 2QKKA 3QNNA 3TAEA 3L2VA 1S6QA 1WSJA 3DMJA 4LH4A 4Z4IA 2BDPA 2W42A 1S5JA 3VQDA 4FJ5A 4FJ8A 4OLAA 3LP2A 3NAEA 2P5OA 3QEVA 4DU3A 1UOCA 4AHRA 4BDYA 4M3TA 3DLGA 1Z26A 1QTMA 2P5GA 4PUOA 2F8TA 4W5RA 1Q9XA 1XC9A 2IAJA 2Y1JA 2KFNA 4HUEA 4E19A 4DTJA 2HHXA 4DS5A 4M45A 4FZXC 4IG3A 3OVNA 1SUQA 4B8AB 4KB0A 1S1UA 1RNHA 3DRPA 2KFZA 1TVRA 3MECA 4DS4A 5D3GA 1C0UA 1WLJA 2RPIA 1WAFA 2YKMA 4AHCA 3LANA 3VQQA 4E1MA 4NYNA 3PV8A 3AVGA 3AV9A 5I42A 4FK2A 1HRHA 4CEFA 1JLAA 2Z1GA 1NK9A 2DTUA 4FJIA 3EY1A 1WSFA 3RTVA 3OYKA 1FXXA 2GBZA 2BGGA 4NCGA 5CZ1A 4CK2A 4CHQA 3O3FA 2HHUA 4E7LA 2A1SA 2RF2A 4CEAA 4YNQA 1NKEA 1J5OA 4DSJA 4Q0BA 1ASWA 4CJ4A 4I2QA 3SPZA 1RILA 4KV8A 4B3OA 4F2RA 5HLFA 2PZSA 2D0CA 1IO2A 1LW2A 1U48A 3NH0A 4DQRA 1UAXA 4FW2A 4KKOA 1KRPA 2JLEA 1ZBLA 4JRQA 3QIPA 4OKJA 3MXJA 1RT7A 3M8RA 3SV4A 3LP3A 4DMNA 4IKFA 4FYDA 4B8CA 4QCLA 4CJWA 4BE0A 1RT3A 3HL8A 1ITGA 2IOCA 3KLHA 3IS9A 1SL0A 3QINA 3V81A 4CF9A 4XIUA 1EETA 1YTAA 3TR8A 3L2WA 4DSFA 1NK4A 3ZSWA 4BE1A 2WONA 3AVFA 1JL2A 1LAVA 1RBRA 3O4QA 4O0IA 4N5SA 3CFPA 3AVNA 3KIOA 4CJ3A 3AVHA 3MAQA 3QNOA 4PA1A 3DOKA 1RDDA 2HVIA 1XWLA 1D8YA 3KLGA 3FFIA 4GVMA 4CK3A 2HHVA 3OYIA 1EXQA 3AVMA 1TKTA 3L3VA 1YTUA 4B9NA 3DRRA 3PX4A 4Q5VA 1QHTA 4FW1A 4ID5A 4AHUA 3ZSXA 1JLGA 1ZBUA 4CJLA 3RMBA 2OYQA 4KHYA 4AHTA 3T19A 3V1OA 1C0TA 3KLIA 4E0DA 4HTUA 5CZ2A 3TWHA 3G10A 3NF8A 4EZ9A 2OPQA 1WN7A 2DFFA 1ZBFA 4LH5A 3HYFA 5C25A 4PWDA 3LDSA 4W5NA 1T05A 1BCMA 3AO1A 3QIOA 4B08A 3F73A 2OZMA 2LSNA 4FJGA 1NK7A 3AVCA 1SKSA 1RTHA 1NJXA 4NCBA 3K5OA 4OVLA 4E7HA 1TGOA 4CJPA 4FLUA 1L5UA 1NJWA 4B9UA 1T8EA 1BISA 1BI4A 1RTIA 1HYVA 3ASMA 2HVHA 3C95A 1XHXA 2IGIA 4J2AA 3AVLA 1HYSA 2O4IA 4CFBA 1D9FA 5KGXA 1WSIA 3NHGA 4ELTA 4M3RA 4EP4A 1KLMA 2G8HA 5EU7A 1NKCA 4ELVA 3LAMA 1C1AA 3VQ5A 4JS5A 3OYLA 3DLHA 5SWMA 3SV3A 1WSHA 4DSIA 1SV5A 1TV6A 3I0SA 4CHZA 3TAPA 2HHWA 3B6OA 3O3GA 2XO7A 3DM2A 3V9SA 3QEIA 4CFCA 1HPZA 5DMRA 3CG7A 1NK0A 1CLQA 1QQCA 4F2SA 4CF1A 3QETA 3OS2A 2ATQA 4ELUA 3K5MA 4FCYA 3PUFA 3P1GA 1BIUA 1W9HA 3VQ6A 4BWMA 4CJSA 1NKBA 1D9DA 4DTNA 4KTZA 4MFBA 4F3OA 3NH2A 4CJVA 4FLZA 4F3TA 1Y97A 4DTPA 3AO4A 3QERA 4ZTFA 2DY4A 1NK5A 1REVA 4DQQA 4KTQA 4OPJA 2EHGA 1RT5A 2B5JA 4CGJA 3DLKA 3I0RA 1Z25A 1DLOA 2FBVA 4CEQA 4Z4EA 2Z1HA 3LZIA 5KGWA 4Z4GA 2B6AA 2HNZA 2FBTA 4CIFA 1NOZA 4KB1A 3LWLA 1RDBA 1JLQA 4O5BA 3ZT4A 2VWJA 2F96A 4NYFA 2WOMA 1SL1A 2YHBA 1KSPA 4KREA 1IKXA 4FLWA 3QLHA 3L2QA 4BE2A 3V4IA 4CF8A 1A5VA 1IG9A 3VQPA 4LY7A 3T1AA 3DI6A 2HMIA 2YNFA 1RDAA 3DLBA 4RW7A 4K8XA 3MEGA 1HQUA 3BGRA 4CIEA 3KK1A 2QXFA 3AVJA 3SJJA 1TK8A 1LWEA 2OZSA 3AO5A 3WNHA 4KI4A 4DLGA 1O1WA 1NJYA 5HRRA 4DQPA 5J2PA 3OYDA 1RT4A 3THVA 3L2RA 1KFSA 1VRTA 3LWMA 3WNGA 3VQBA 3NGIA 1RCHA 2E6MA 2PYLA 1RBTA 4DTOA 2VG5A 2QK9A 4IG0A 2HNDA 3T3FA 2DFEA 2VWKA 3EZ5A 3UIQA 4CJTA 3S9HA 3AVBA 2A1RA 4KPYA 1JXBA 3NF7A 1JLEA 1N6QA 3BDPA 4DWIA 1T03A 1B9DA 2Y1IA 5HRSA 4FJJA 3L2UA 4C8OA 3RR8A 4CHYA 3NH1A 4AILC 1K6YA 4LSNA 3OJUA 4B9SA 1J53A 4CJQA 3TAGA 3SUNA 3PY8A 3KD1E 3ZT0A 4E1NA 2FC0A 4ICLA 5JS2A 1LAWA 4DTSA 4DFKA 4EZ6A 3HO1A 2HHTA 3SPYA 1S1TA 1LWCA 4JRPA 4KO0A 3U6FA 4FZYA 1VSIA 1T7PA 2ETJA 3OYGA 4C8KA 4OPKA 1X9WA 3VQCA 4CERA 2Z1IA 2E6LA 4CGFA 1GOAA 4CGGA 1EX4A 3C6UA 3K57A 3MXIA 3KD5E 4FJ7A 4KTWA 2XRIA 1S1XA 3NGYA 2BANA 3VQ7A 4DU4A 1J54A 3HVRA 3OYFA 3OYBA 2YV0X 1KLNA 4OGEA 4H4MA 1RT6A 4R5PA 5J1EA 1ASVA 1I39A 3NGZA 2E4LA 2G8KA 3L8BA 3QEWA 3QEXA 1DTQA 2G8IA 2RN2A 3M8PA 2YKNA 1G15A 1JLCA 1VSEA 4HVJA 4FJHA 2HW3A 2G8FA 2X6NA 1WSGA 3SQ1A 4HCBA 4M3YA 1NK6A 4GW6A 4OKKA 5FRNA 1Q9YA 4FLTA 1WNSA 4GMJB 4N47A 3WNEA 1SKRA 2PYJA 1HNVA 3ZSOA 4FXDA 4CGIA 4CJ5A 3H08A 4E3SA 1KVAA 4ZTJA 4RW4A 4RW6A 4DFPA 2G8VA 4RW9A 1X9MA 1L3UA 4C8LA 1F21A 2HB5A 3K58A 1C6VA 3TAQA 4FK0A 4DTRA 4IFYA 3KLFA 1U47A 1HYZA 3CYMA 3VQ9A 3HXMA 2XHBA 2QKBA 4CK1A 1X9SA 2ZD1A 4CEEA 3S3NA 4KHQA 3P5JA 3V9ZA 1UA1A 2GV9A 5HRNA 3SUQA 4JS4A 2ITGA 3AO2A 1ZBIA 5CYQA 4FJMA 5J2MA 1C1BA 1C1CA 4ZHRA 3CFRA 3NF6A 4Z4HA 2HNYA 1RBSA 5KTQA 3LAKA 3TANA 1L3TA 4DQIA 4UQGA 3SI6A 5FDLA 4CEBA 3OYAA 4DFJA 4HCCA 1YT3A 2BE2A 4DQSA 4O4GA 3LZJA 3KK3A 2Z1JA 3HSTB 3DLRA 3AVIA 3EYZA 1JL1A 4FLVA 3ZSRA 1RBUA 4CJRA 3RRHA 3IG1A 4CHPA 3U3YA 4FM0A 4CESA 2O4GA 4J2EA 4AHVA 4HHTA 1SKWA 1U45A 3S3MA 5KRSA 3MEDA 1D5AA 4N76A 4QAGA 4LD0A 4E7JA 4M42A 1VSHA 2I5JA 2FBXA 5J2QA 1U4BA 4Z0UA 2OA8A 1B9FA 1GOBA 4E7KA 1L3VA 4MQ3A 4DF8A 4O0JA 4M3XA 1I3AA 1TAUA 4QOZB 3HT3A 2X74A 3ALYA 3PO4A 1C0MA 1TKZA 1EKEA 1B92A 1VRUA 4HUGA 1RTDA 4M3UA 1U49A 1SL2A 4Z4CA 1TL1A 4YFUA 3OS0A 4B9MA 5T7BA 1TKXA 3V9WA 3VA0A 2P51A 3SQ4A 3CFOA 4DU1A 1MU2A 4BACA 5KRTA 3RWUA 3NBPA 1IKVA 3NFAA 2HHQA 3AA2A 1QSYA 4CGDA 1CXUA 4DLEA 3SZ2A 3QESA 2KQ2A 4B9TA 3QEPA 2ZQBA 4N41A 4DTXA 3TI0A 4FJXA 1L3SA 4C8NA 3C6TA 3A2FA 3V6DA 4CJFA 4Y1DA 3TAMA 3DLEA 4B9LA 4CHNA 2XY6A 1XHZA 3ZT2A 3QO9A 4OKEA 4IBNA 1HJRA 3G0ZA 1JLFA 5C42A 1LV5A 3HJFA 4KRFA 1NOYA 3NE6A 1ZYQA 4O44A 1HNIA 2KZZA 4I2PA 5CYMA 3O3HA 3HPHA 2X78A 3OYCA 3RR7A 3I8DA 4KHUA 1UWBA 4DSLA 3HP6A 3DOLA 3VQAA 5FROA 4CGHA 3D0PA 1JKHA 3L3UA 4L8RB 3LALA 2P1JA 2XY7A 2VG6A 1NK8A 3CQ8A 4NCAA 1HQEA 4BWJA 4E7IA 4FVMA 2RKIA 2XY5A 1RBVA 3LPUA 3K5NA 1TK0A 4KI6A 1XI1A 1A5WA 5JS1A 1DTTA 3C94A 4J2BA 1BGXT 1IH7A 4ID1A 4Z4FA 3AVAA 4PY5A 4DTUA 4M3ZA 4E89A 4CEOA 4DSEA 2HHSA
chains in the Genus database with same CATH superfamily
4I9LA 1NG9A 1S6PA 4CE9A 2XY8A 3OTOK 2FLOA 4FM2A 1BHLA 1YHQN 4CVNE 2YHAA 3Q7BA 3TTDA 5FRMA 3SAHA 4FJ9A 2IS3A 1HNZK 2YNHA 3M3ZA 3VEVA 4WE1A 4DV5K 2A5XA 2O8CB 2VG7A 3UKUB 2O8EA 1RTJA 4IWVA 4NO7A 3OYNA 1QE1A 3HK2A 4A59A 5JVHL 1S1WA 2Q3SA 2OPSA 2G8WA 3CI5A 3MWPA 1YJ9N 2QM1A 2A40A 1QS4A 2IDOA 2IVNA 2JWKA 3MCPA 3OJSA 1BQNA 2NNWA 3KZBA 4FM1A 1OVYA 3LL3A 2ZWHA 1IKYA 4AHSA 1BIZA 1NLVA 4TSXA 3CCUN 4CCHA 1BQMA 2OPRA 4N56A 2Q36A 3TTCA 4IDKA 3M8SA 4H8KA 3S3OA 2UXBK 4MO5A 4I9QA 2P9SB 3HOSA 4C23A 2D1KA 3RMDA 4FWOA 4CIGA 5DM7L 3L4QA 3KKRA 3ZSZA 1JXEA 3T7ZA 2J4RA 3WNFA 4CEZA 3CQXA 1U2VB 4BC5A 4CI6A 4OGCA 3VA3A 3LDOA 3PSFA 3LP1A 5HP1A 2AJQA 4K43A 2KHOA 2IVPA 3AA3A 1CZ9A 4IOAL 4W5QA 2R7YA 3MDQA 4M3WA 5GAEP 3LP0A 3NCIA 3ZCMA 3ZETA 4DUZK 1IKWA 5AQRA 4H4OA 4O8UA 1VSMA 3VEWA 1N8RO 4G1QA 1BCOA 4B9QA 3I8BA 1YJWN 5KI6A 1NGDA 1N32K 4BDZA 1UA0A 3PO5A 3O8MA 3HP9A 3VEZA 1JLBA 2QKKA 3ISNC 4A5BA 4BRQA 3VENA 1S5JA 3SAGA 2P5OA 3QEVA 1IJJA 2F8TA 4H0XB 1LCUA 4HUEA 2VQEK 4UY8O 2HHXA 3VETA 4M45A 4IG3A 3OVNA 1SUQA 4B8AB 1S1UA 4GVEA 3DRPA 4DS4A 1WLJA 1IBLK 4X66K 2BH1A 3LANA 3VQQA 4H0YB 3WT0A 4E1MA 1HRHA 1WSFA 3E66A 4CHQA 3O3FA 2RF2A 1J5OA 1NKEA 4WQ5A 1Z05A 1ASWA 1WBDA 1VQ4N 3D2EB 5BREA 4ISEA 1UAXA 2P9UB 2JLEA 5AQSA 2YHXA 3CQYA 4BE0A 1RT3A 4JKDA 3KLHA 4JI5K 4CF9A 1NK4A 4BE1A 2WONA 1JL2A 1Y64A 3AVFA 3CFPA 1K8KB 4CJ3A 3CF5L 3QNOA 1RDDA 4JI6K 3ATVA 1VQON 3KLGA 4IO9L 2HHVA 1MA9B 5AQJA 4B9NA 4AHUA 3ZSXA 4CJLA 4Z94A 2OYQA 3U9ZA 5GIPA 4EZ9A 2Q2RA 1ZBFA 1QHAA 3WQTA 5C25A 4W5NA 4CBWA 2LSNA 4FJGA 3AVCA 3EE9A 1NJXA 3M1FA 4OVLA 1TGOA 3GG4A 4CJPA 4IJAA 1L5UA 1OKJA 1XMOK 5TKWA 1RTIA 3C95A 4U67L 3RSEA 4GY2B 3AVLA 3D2FA 3CC2N 1HYSA 2O4IA 1ATRA 1WSIA 3NHGA 4M3RA 4EP4A 4ELVA 4RTFD 2F4VK 4GKJK 1WSHA 4DSIA 1BG3A 4AM7A 1ZXOA 4CFCA 3FZKA 4CF1A 3QETA 3OS2A 4ELUA 3KK7A 4BR7A 3VQ6A 4DTNA 3FZMA 4FLZA 3QERA 1REVA 4DQQA 1ATNA 4KTQA 3I0RA 1Z25A 5LJWA 1NGJA 2A42A 4LC9B 4Z4EA 5KGWA 3SK3A 1OH8A 2FBTA 1NOZA 3CERA 3CCLN 4DB3A 4NYFA 1KSPA 4RWTA 3THXB 1DT9A 1XNRK 2QWPA 3VQPA 3T1AA 2HMIA 2YNFA 1RDAA 5AFUA 4RW7A 3BGRA 2QXFA 4KI4A 1NJYA 3VF4A 3EL2A 1WUAA 1LOTB 5JICA 2Q97A 2E6MA 3CJ9A 2D0PA 4I6MA 3A5NC 2VG5A 3DXKA 3T69A 1VQ9N 2QK9A 4IG0A 2HNDA 3UIQA 1YJNN 1JLEA 1WBBA 3C7NB 1MWKA 4DWIA 4QS8A 5HRSA 4FJJA 5AQGA 5H1SQ 4KHPK 1K8KA 1K6YA 4AILC 3TAGA 4FVUA 1X3MA 3ZT0A 4ICLA 4DTSA 3DXKB 3VEOA 1S1TA 1LWCA 1S3XA 4FZYA 2W40A 3H1QA 1X9WA 4CGFA 3A5LC 4CGGA 1EX4A 3C6UA 3KD5E 1S1XA 3OYFA 1YAGA 3OYBA 4H4MA 4LF5K 1I39A 3NGZA 4DR4K 3QEWA 1HJOA 1VQMN 4KBOA 2D0OA 4G9ZA 4HVJA 4BR9A 3SQ1A 3HBTA 2HOEA 4M3YA 1NK6A 2E1ZA 4GW6A 4OKKA 4M7YA 3SMSA 4GMJB 4QS9A 2HMPA 2W41A 3EE8A 4FWSA 3H08A 1HKBA 4DFPA 1BOTO 5C15A 3O9UA 4RW9A 4NLCA 3FZLA 2WTUA 4C8LA 1DEJA 2HB5A 2HBJA 4JNEA 3TAQA 1OH7A 1RDWX 3ENHA 4DTRA 3BZKA 3KLFA 4JD2A 3VQ9A 2XHBA 1HNXK 1UA1A 1Q81O 5F0XA 2YHYA 2P9KB 4FJMA 2NRVA 3TANA 1RBSA 3LAKA 4DQIA 3SI6A 5FDLA 2ZJRL 3ZYYX 3HSTB 3AVIA 3U3YA 3IG1A 4FM0A 4CESA 4J2EA 4AHVA 4YOXA 2NRTA 1U4BA 4EIAA 4YHHK 5C2FA 5AZIB 1L3VA 4KH6A 3N4QA 4BRKA 3ID6A 2W6LA 1EKEA 4M3UA 1R59O 1TL1A 2GELA 4FL9A 4DU1A 3RWUA 3NFAA 1CXUA 3QESA 3RVCA 4DTXA 4FJXA 1L3SA 3A2FA 3TAMA 4BC3A 1XHZA 3QO9A 1BWFO 4IBNA 4OX9K 1HJRA 4KRFA 3HJFA 1XQSC 1HR0K 3FGUA 3O3HA 2FF3B 1BDGA 2V7ZA 5LMNK 2E2OA 5AQKA 3I8DA 4FWPA 4KHUA 4CD1A 5FROA 4CGHA 3M5RA 2P1JA 4LFBK 3MN7A 1NK8A 4E7IA 4FVMA 3BY5A 1TK0A 4EHTA 1A5WA 1DTTA 3C94A 4J2BA 1BGXT 4ID1A 1NGBA 1XUPO 4PY5A 1XC3A 4DSEA 4KPYA 2GEMA 1XMQK 1XNQK 4PKIA 1TL3A 4CZMA 2O8CA 2NRHA 4RW8A 1S9EA 3WXJA 1U04A 2Q0UA 1BU6O 4JI1K 4RG8A 4KHWA 2AA4A 5BRFA 2UYTA 1OH6A 2ZE2A 3JXUA 3K9JA 3R9PA 3IFRA 1HMVA 5HROA 2NUBA 1CZAN 5F1XA 3PX6A 3ZEUB 5KPTA 4YOYA 2F8SA 4CJEA 1J9AA 3F9KA 4KH5A 1TAQA 4CF0A 3KK2A 3VTHA 3PSIA 4X64K 3K59A 1EP4A 1TK5A 1T3VA 4PQUA 1VSLA 5JLHA 4HTLA 2HHHK 3R6MA 1S9GA 3J7YP 3JAMO 3C7NA 5SZTA 5HRPA 4JKAA 4CF2A 4O5FA 5BR8K 3VESA 3SCXA 4CJKA 5C24A 4CHOA 4KAZA 4DV6K 2HBLA 4CEDA 4O55A 4I6MB 4WCEL 3SNNA 5BN9A 1CZBA 1SAZA 3O9RA 3AO3A 3K9KA 3MEEA 3SYZA 4DSKA 5DM6L 2EX3A 4H0TB 3ATUA 4O8KA 2YNGA 3ZSVA 1W2BM 4NXMK 3ZT1A 4FLYA 2OPPA 3U3GA 2FSJA 2HBKA 1VSKA 4OLBA 4OJRA 2Q1NA 4JKHA 3K2PA 3WUHA 3NMUA 1DKGD 2KW4A 1VSDA 4IEIA 4PKHA 2BUPA 3I33A 1LW0A 2KKZA 1GLDG 1BA0A 2HBMA 4LF9K 2IC3A 1Q86O 1I94K 1RT2A 1VQKN 3F2KA 1YUWA 4K25A 4L3QA 3RRGA 4X62K 3SUOA 5AQQA 4DR2K 1NBWA 4CECA 2OTJN 3TABA 4EP5A 3B6PA 1RFQA 1WAJA 1R0AA 4F8RA 4J8FA 3MCAB 1X1PA 2VCPA 5AQXA 1TUUA 3QNNA 3TSPA 3TAEA 4BRNA 2ASPA 5FLXO 5JVGL 4FJ5A 3EKUA 4FJ8A 1S72N 3VEYA 2ASMA 1UOCA 1FJGK 4M3TA 4WQ5C 4PUOA 4W5RA 1XC9A 2IAJA 5AR0A 5BN8A 5HL7L 3OBYA 1RNHA 4HWIA 2KFZA 5D3GA 2KLAA 2A41A 1WAFA 4JN4A 4LF6K 2QWOA 3CCVN 4NYNA 3PV8A 1BA1A 1JLAA 4IJNA 1X9JA 4JI8K 4FJIA 1FXXA 4JI2K 2BGGA 3KHYA 5CZ1A 2HHUA 4CEAA 1IG8A 3P39A 5AFUH 3EO3A 4I2QA 2P9IA 4FW2A 4KKOA 3SAFA 1ZBLA 4JRQA 4ILHA 4OKJA 3SV4A 4DMNA 1Q82O 3G71N 2O8BB 3SBTA 4B8CA 3AARA 3HL8A 1ITGA 4FWLA 1SL0A 4XIUA 3L2WA 4DSFA 1GLAG 1LAVA 3O4QA 4XH1A 4N5SA 3G6EN 3KIOA 4JEPA 3AVHA 4C1NK 3U8XA 4PA1A 3DOKA 5I9EB 2HVIA 5AQIA 4K41A 3PIOL 3CPWM 3FFIA 4GVMA 4CK3A 3CC7N 1NM1A 1TKTA 3L3VA 1YTUA 4PKGA 3PX4A 4FPBA 4JK9A 4FW1A 1ZBUA 4JK7A 3T19A 4C1NI 1C0TA 3KLIA 3O5BA 3NF8A 2ZJQL 1WN7A 2JWLA 4LH5A 3QIOA 3AO1A 2OZMA 3VERA 1GLBG 2CGKA 3K5OA 4E7HA 5AQOA 3FR0A 4B9UA 3D2EA 1BISA 4A2BA 2HVHA 1HYVA 1GLFO 4CFBA 4ELTA 5EU7A 3VQ5A 1W7AA 3E9PA 4WQ4C 5BRHA 1NU0A 1SV5A 1TV6A 4QS7A 2HHWA 2FSKA 3V9SA 1CLQA 4X65K 4F2SA 3ZLJA 3A5MC 4BR0A 4FCYA 1W9HA 5EY4A 2QWLA 4CJSA 4IOCL 3CC4N 4KTZA 4F3OA 3NH2A 4CJVA 4WF9L 4DHYA 3AO4A 5BPMA 4JKGA 1QVFM 1RT5A 2B5JA 2FBVA 4CEQA 3VF6A 2Z1HA 3CETA 3LZIA 5AQTA 3FZFA 1EO1A 2B6AA 4CIFA 3LWLA 4H5RA 1NMDA 4O5BA 2F96A 4K0KK 2YHBA 4KREA 4FLWA 3QLHA 3L2QA 3JS6A 4CF8A 1A5VA 4YOWA 2H3GX 1IG9A 4KH4A 1S22A 4K8XA 4JV5K 1KAXA 1O13A 1TK8A 3AO5A 3A0IX 5J2PA 2FF6A 1RT4A 3ZX0A 3T1HK 2P9SA 4B1VA 4OO1J 1RBTA 1T44A 4BRPA 4H5TA 4ISGA 5B8HA 5GAHP 3NF7A 3O4WA 3U4LA 3BDPA 4BC2A 1T03A 1B9DA 5AQZA 3RR8A 4CHYA 4LSNA 4B9SA 2HF4A 3H45C 3SUNA 4IEEA 3PY8A 4E1NA 1LAWA 3VEXA 4IOXA 3ULEB 4OPKA 2E6LA 3CIPA 4V19S 3K57A 2BANA 1J54A 4H0VB 1TYQB 4BREA 1RT6A 2CGLA 5KPZA 4NLBA 2E2PA 1VSEA 2HW3A 3CCMN 5BR9A 2QTDA 5FRNA 1WNSA 5IT9O 2PYJA 1RDUA 4CZLA 4E3SA 3UKUA 1KVAA 3VGKA 4ZTJA 3HSCA 3KVGA 3L4IA 2P9NB 4FK0A 5M1KA 1X3NA 1U47A 1DGKN 3HXMA 1ATSA 4CK1A 1X9SA 4KHQA 3V9ZA 4XEIA 5M1QA 4BGBA 1ZBIA 1C1BA 1SS6A 3ENOA 3CFRA 2HNYA 4FWMA 2NRZA 3THYB 4UQGA 3OYAA 4DFJA 3F9MA 3TSUA 3ZX3A 1YT3A 3OBWA 3HOTA 4DQSA 3KK3A 3DLRA 3VTIA 3L6QA 1JL1A 2OCEA 4CJRA 4CHPA 2WBNA 4B3TK 3S3MA 3I55N 4N76A 1D5AA 1VSHA 3LDQA 4DV0K 5AQNA 3LDNA 4IZ9A 3S41A 4M3XA 4ILJA 1TAUA 3OA9A 3HT3A 2X74A 4QOZB 3HTVA 1SL2A 4Z4CA 4YFUA 4B1YB 4B9MA 4MLHA 2UU9K 1TKXA 5C10A 3VA0A 3FFKB 3CFOA 2F9WA 4PHTX 3AA2A 4CGDA 4DLEA 2KQ2A 1M1KO 3BZCA 3A5OC 3TI0A 1E4GT 4C8NA 3V6DA 3G25A 1D4XA 3DLEA 3OHRA 2XY6A 3H3OB 3G0ZA 5C42A 1LV5A 1NOYA 5MLCQ 1ZYQA 5E26A 1HNIA 4I2PA 5CYMA 3HPHA 3O9SA 3HP6A 3VQAA 2P9PB 2P9LA 5AQVA 1JKHA 4NCAA 2IVOA 4IO8A 3LPUA 3K5NA 4IFEA 3AVAA 4DTUA 1VQ5N 4M3ZA 4CEOA 4FOIA 4M7XA 4FJNA 5CHIA 3SQ2A 3CJAA 1YVNA 1U6ZA 3MXMA 4JKCA 3O4NA 1VK0A 3EN9A 3ULDA 1KTQA 4I7FA 3RMAA 1HLUA 4W5OA 4AQYK 3DYAA 2ZJPL 4DKWA 3CCRN 1MDUB 3V9UA 4BVPA 3QMLA 4F4KA 2FBYA 4YDUC 3W0LA 3V1RA 2P9KA 3AGRA 1YITN 4DFMA 2D0BA 3NVMA 4ISFA 3KTQA 3OYEA 2DFHA 3EKSA 4C8MA 4BR2A 3HPGA 4BY9C 1GLEG 4H5NA 3OYMA 4CJUA 1ZBHA 2YJEA 5EOYA 3IAYA 4PL8A 4DTMA 3J7AP 3SJHA 1OVQA 1RT1A 3D45A 4B1ZA 4B9VA 3CM5A 5BPLA 3CJ7A 3GBTA 1N5YA 5M1NA 4BC4A 4M41A 3SQ0A 3KJVA 1A5XA 3V9XA 4GKKK 3JSMA 2B4JA 4BQLA 4FWQA 1KCFA 1VSFA 3RSEB 4HUFA 3HPOA 2DPNA 2JGUA 3VQ4A 4CZIA 4DG1A 4H0OA 2P9IB 4FJLA 1NWKA 4DV3K 3ZT3A 2RHKA 2KTQA 4CFDA 5FPEA 2YCHA 4BRCA 1TKDA 1NJZA 4IDHA 4CD3A 1K8AO 2UXDK 3VQ8A 3AA4A 3HVTA 1QSLA 3A8YA 4YOUA 4FJKA 4CBUA 1BL3A 2D4WA 2YHWA 5E41A 4U7BA 5KPRA 4DF4A 3B8AX 4FZZA 2ASOA 3CM6A 4H5VA 4AH9A 1CXQA 4AM6A 2UXCK 3HM9A 3CCQN 1YVUA 3KLEA 1W0HA 4JI4K 3GDQA 3L2VA 1QQMA 1S6QA 1WSJA 3DMJA 4OPHA 2BDPA 1E3MA 3VQDA 3C6AA 3D7EO 4NB4A 3LP2A 2QWMA 3NAEA 3E9LA 3DLGA 1Z26A 4FWNA 2P5GA 3WEEA 1Q9XA 2Y1JA 4DS5A 4FZXC 1QVGM 4KB0A 3THXA 1TVRA 3MECA 4BRHA 2RPIA 2YKMA 4AHCA 3AV9A 5I42A 4CEFA 5CR4A 1NK9A 2E20A 3RTVA 1NGIA 4GNIA 2ZGYA 4NCGA 4E7LA 5EX5A 4YNQA 1KC8O 1FW6A 4Q0BA 1RILA 2P9LB 2P9PA 5HLFA 2D0CA 4F2RA 1IO2A 1LW2A 2HSTA 3BP8A 1K73O 5AQMA 5AQUA 4CZFA 4IKFA 3MXJA 3M8RA 3LP3A 1YIJN 4FYDA 2VQFK 3IS9A 2A6AA 3M6GA 3V81A 4CBXA 5LL6Z 1YTAA 1RBRA 3AVNA 3D2FB 3MN5A 3MAQA 3PLAA 1QQOA 2I7NA 4A57A 4A61A 3AVMA 2CH5A 3DWLA 3ZETB 4Q5VA 1Q18A 1QHTA 4DQ8A 1JLGA 4E0DA 4HTUA 5CZ2A 3TWHA 3G10A 2O8FA 2OPQA 3HYFA 4BGAA 3WQUA 4PWDA 3LDSA 1T05A 4B08A 2E2NA 3TU5A 1NK7A 1RTHA 2E1YA 3BUZB 3P38A 1NJWA 1TUYA 4MDBA 5GIOA 5JLFA 4CZEA 2AP1A 2QI2A 1XHXA 2IGIA 4J2AA 5GAGP 1D9FA 5KGXA 3O9QA 4AF1A 2QEXN 1VAZA 3AGKA 4M63C 4MDAA 2G8HA 1NKCA 3O08A 4BRFA 4JS5A 3THYA 5SWMA 3SV3A 4MO4A 4CZHA 3J80O 3VGLA 3TAPA 3O3GA 1NK0A 3H6EA 2O8DA 2ATQA 3K5MA 2QA4N 3P1GA 1BIUA 4R79A 4BWMA 1NKBA 2VWBA 4MFBA 2V51B 4F3TA 1Y97A 4ZTFA 3CCJN 2DY4A 1NK5A 4H5WA 4CGJA 4JKEA 3DLKA 1KQSM 2CH6A 3CJCA 4A62A 3ZEUA 4E1JA 1NGFA 1RDBA 3ZT4A 2O8EB 1BUPA 1IKXA 4BE2A 3V4IA 4B1UB 3QFUA 1K9MO 4LY7A 3LDLA 3DLBA 5AQLA 3MEGA 3KK1A 3SJJA 4CIEA 2OZSA 3H3NO 4H03B 5HRRA 4DQPA 3OYDA 3G4SN 2ZM6K 4FSVA 1KFSA 1VRTA 2PBDA 3WNGA 3LWMA 3VQBA 3NGIA 2PYLA 4WFBL 2DFEA 2VWKA 4JHDA 3S9HA 4DR5K 3J8AA 1JXBA 4EAHD 4B1XB 2Y1IA 3L2UA 3NH1A 3LDPA 1HKCA 1J53A 4CJQA 5JMVA 3KD1E 3HO1A 3SPYA 3HZ6A 3WXKA 4KO0A 3DXMB 1T7PA 3O1BA 3OYGA 5AZIA 4CERA 2Z1IA 3MXIA 1GOAA 2HHTA 3ZX2A 3FLCO 2XRIA 3NGYA 1T6CA 4DU4A 1NGGA 2YV0X 5A2QO 1HNWK 4R5PA 5J1EA 5AQPA 2G8KA 1HUXA 3QEXA 2RN2A 2YKNA 1JLCA 4FJHA 2G8FA 2X6NA 1WSGA 2QW9A 3CMAN 1Q9YA 1GLJO 4FLTA 5FPMA 4N47A 1N34K 3WNEA 1SKRA 1HNVA 3ZSOA 1NNEA 4CJ5A 5LJVA 4RW6A 2G8VA 3WXLA 1X9MA 4JKBA 4BG9A 2OTLN 3K58A 2GWJA 1Z6RA 4IFYA 3I56N 5M1PA 1HYZA 2QKBA 2ZD1A 2P9NA 4CEEA 3CJ1A 5HRNA 3EEQA 3AO2A 5ADXA 1C1CA 1E4FT 4ZHRA 2ZGZA 3NF6A 4CEBA 5BPNA 2BE2A 4O4GA 3LZJA 2OANA 3EYZA 4FLVA 1ILYA 1MWMA 1TYQA 4JAXA 1YXQA 1C0FA 3PIPL 4DV4K 4HHTA 2HF3A 3MEDA 4M42A 4QAGA 4XH4A 3LM2A 3WXIA 2FBXA 3AAPA 1B9FA 1GOBA 3QDKA 4E7KA 3ENBA 4MQ3A 3ULEA 5EXWA 3O1WA 4O0JA 1JCFA 1P8ZA 1TKZA 1B92A 4FPAA 2V7YA 4ILGB 4HUGA 3C0BA 4JI3K 1U49A 3KWGA 4BVOA 5LMUK 3V9WA 2QWRA 4BACA 2NLXA 3NBPA 1IKVA 3C6HA 4FWRA 1QSYA 3MX5A 3QEPA 2ZQBA 4B9TA 4N41A 2I7PA 1GLCG 4LFAK 4BR4A 4K42A 4JK8A 4LF7K 3ZT2A 4OKEA 1IBKK 4O44A 2QWQA 3OYCA 1YF5L 1UWBA 3L3UA 2XY7A 4FO0A 3CQ8A 3O6WA 4BWJA 2RKIA 1RBVA 4KI6A 5JS1A 3CJBA 4Z4FA 4E89A 2HHSA 3OYHA 1VSJA 3AVKA 3CHWA 4MLEA 1ASUA 5HBMA 3E01A 5KQ8A 1BI4B 4PL7A 5CE3A 4KHSA 1NGCA 4XH5A 5DK5A 2FXUA 3P83D 3WEEB 2D0AA 1KVCA 4CZKA 4W5TA 5J2NA 3OS1A 3OYJA 3VQEA 3THWB 1QSSA 1RDCA 2WC9A 4Y0WA 2GUIA 3DLLL 2IIRA 4KFBA 3E9OA 3LPTA 3AA5X 1BO5O 3V1QA 4J2DA 3TPQA 2YNIA 1N36K 4Y1CA 5TKYA 3HM8A 1T6DA 3TAFA 1VQLN 5AZJB 3VPZA 2QWNA 2X6SA 3AY9A 4BRMA 1FKPA 3TARA 4JLHA 1FKOA 4BRGA 4K8ZA 3IUCA 3MWTA 4BDPA 5CY4A 4KHNA 1WSEA 1SQKA 1KAZA 2KZMA 3ZSQA 3JYTA 1S1VA 5FPNA 4DV2K 3P31A 3FZHA 4DCHA 4FK4A 3NF9A 1KFDA 4FWKA 3E1YA 3PX0A 2RE2A 3RMCA 3OY9A 4LSLA 1GOCA 4BR5A 2E8AA 3K5LA 3CCSN 3SUPA 1EWRA 1FK9A 3SBGA 3VN5A 4DR3K 1Q8IA 2D5RA 5K14A 2YI1A 3LM9A 4FLXA 1VHXA 3ITHA 3FE1A 2A3ZA 3CCEN 2F7TA 5AJ3K 2V52B 2GTDA 3DRSA 3KWIA 1WB9A 3M8QA 1NGHA 4IFVA 4CFAA 4JKFA 5I3UA 3IRXA 3KKSA 3ZSYA 5C2DA 2PY5A 2GX9A 3UKRB 4DR1K 1KVBA 3NDKA 1QZ5A 3MN6A 2YJFA 4GV6A 1LWFA 4JI7K 4LH4A 4DV1K 4Z4IA 2W42A 4OLAA 4JKGB 4DU3A 3VGMA 4AHRA 4BDYA 2E5LK 1QTMA 4JD2B 1EQYA 1W97L 3UKRA 5KQDA 3R8EA 2KFNA 4E19A 4DTJA 3OW2M 4H0PA 1NJIO 1WOQA 1EWQA 4B3SK 1C0UA 3J81O 3TSQA 3AVGA 1C0GA 4FK2A 2NRXA 2DTUA 2Z1GA 4YORA 2O8FB 3EY1A 2ITMA 3OYKA 2GBZA 3N4PA 4CK2A 5M1FA 2A1SA 2UUAK 4DSJA 3IDHA 4CJ4A 3SPZA 4KV8A 4B3OA 3DJCA 2PZSA 1KD1O 1U48A 2O8DB 2PFUA 3NH0A 4DQRA 5E84A 1KRPA 3CPEA 1IBMK 3QIPA 1RT7A 1SZ2A 1H1VA 1VQPN 4QCLA 4CJWA 4DR6K 1JJ2M 2IOCA 3QINA 3GOIA 3J7ZO 1EETA 3TR8A 4GV3A 3ZSWA 4O0IA 3BF3A 1VQ7N 3QBWA 2VGNA 1XWLA 1U2VA 1D8YA 2PAVA 2CGJA 1EXQA 3OYIA 4DR7K 3MMVA 3R1XA 1IV0A 4A5AA 3DRRA 4ID5A 3R3LA 3RMBA 4BRLA 4KHYA 4AHTA 3V1OA 3SLCA 1J5EK 2DFFA 4LF4K 5GINA 1BCMA 3F73A 2NZTA 1SKSA 4NCBA 1KXPA 3GL1A 4FLUA 3CMEN 1T8EA 3ASMA 1BI4A 1HX1A 4B1WB 5HOOA 3MK6A 2WUSA 1KLMA 1HPMA 1C1AA 3LAMA 2ZF5O 3OYLA 3VMFB 4GV9A 5LY3A 3DLHA 4EFHA 4CHZA 3I0SA 2Q31A 3B6OA 2XO7A 3DM2A 3TTFA 3QEIA 5AZJA 1HPZA 5DMRA 3CG7A 3H46O 1QQCA 2GUPA 3BF1A 2NRWA 2FSNA 3PUFA 1D9DA 4YOVA 4WFNL 3ID8A 4DTPA 1ESVA 4OPJA 2EHGA 2UUBK 2E88A 1DLOA 2E2QA 4F9OA 3SMPA 4Z4GA 2HNZA 4KB1A 1JLQA 2VWJA 3VF2A 2WOMA 1SL1A 1NGEA 4A2AA 4BROA 3DI6A 3H1VX 3GE1A 5F2RA 1V4TA 4YY3K 4CJ7A 1HQUA 3AVJA 3QBXA 5BRDA 1LWEA 3D6RA 3WNHA 4WQ4A 4DLGA 1O1WA 1NMNA 2VYPA 5C12A 1ZC6A 3THVA 3L2RA 3Q7CA 5AQHA 1RCHA 4DTOA 3MX2A 3U9DA 3HI0A 2QXLA 3T3FA 3EZ5A 4CW7B 5M1OA 4CJTA 3AVBA 2A1RA 1V4SA 1N6QA 4C8OA 1Q7YO 3OJUA 1KAYA 4DFKA 2FC0A 5JS2A 4EZ6A 3UB5A 4JRPA 3U6FA 1VSIA 2ETJA 1ZBSA 4C8KA 2O8BA 3VQCA 5GADP 3HRGA 3VOVA 2G8UA 4FJ7A 4KTWA 3T1YK 3VQ7A 2UUCK 3F5TA 2NRRA 4CZJA 3HVRA 4YOTA 2Q0RA 1KLNA 4OGEA 5AQFA 1ASVA 1YI2N 2E4LA 3L8BA 1JCGA 1DTQA 4JI0K 2G8IA 3M8PA 1G15A 5AQWA 3QB0A 4DUYK 3NVKA 3IKMA 4DV7K 4HCBA 1P90A 4WFAL 4FXDA 4CGIA 4RW4A 5IWAK 2BTFA 1L3UA 4NXNK 3MN9A 1F21A 1C6VA 5C0YA 3CYMA 3EZWA 4BQZA 3S3NA 3P4IA 3P5JA 2GV9A 4CZGA 3SUQA 4JS4A 2ITGA 1GLLO 4WYBA 5CYQA 5J2MA 1L3TA 4Z4HA 5KTQA 4BRDA 3THWA 4JYAK 2WFBA 4HCCA 1RGIA 3AAQA 5ADXH 2Z1JA 4LF8K 4YDUA 3ZSRA 1RBUA 3RRHA 3IMXA 2F9TA 2O4GA 1SKWA 1U45A 5KRSA 4OPAA 1VQNN 4LD0A 4E7JA 4JHDB 1G99A 2I5JA 2OA8A 5J2QA 4Z0UA 1QZ6A 4FOEA 4BG8A 4BRIA 4DF8A 1OH5A 1I3AA 3PO4A 3ALYA 3QFPA 1C0MA 1VRUA 4BRAA 1RTDA 2VGMA 3CD6N 3OS0A 5T7BA 3C65A 3O9TA 2P51A 3SQ4A 1MU2A 1N33K 5KRTA 2HHQA 4RCHA 3L0QA 3K0SA 4B3RK 3SZ2A 1VQ6N 3C6TA 2EWSA 1M90O 3DXMA 3DAWA 4CJFA 4Y1DA 4B9LA 4CHNA 2YX6A 3O80A 1VQ8N 4LFCK 3WXMB 1JLFA 1NGAA 3NE6A 4B3MK 2KZZA 5ELZA 2P9UA 4EHUA 2X78A 5FPDA 3RR7A 3BEXA 2GWKA 4DSLA 3W3DA 3DOLA 3D0PA 1JCEA 4L8RB 3LALA 3QICA 5AQYA 2VG6A 1HKGA 3UE5A 1HQEA 4IXCA 2XY5A 1J6ZA 5EVZA 2W6KA 1XI1A 1IH7A 3CXCM 1QQNA
chains in the Genus database with same CATH topology
4I9LA 3OYHA 1S6PA 4CE9A 3SQ2A 4FJNA 1TL3A 1VSJA 3AVKA 2XY8A 4RW8A 1S9EA 1U04A 3MXMA 4FM2A 1BHLA 3O4NA 1ASUA 1VK0A 5HBMA 3E01A 2YHAA 4RG8A 4KHWA 1BI4B 2ZE2A 3ULDA 4KHSA 5FRMA 1KTQA 4I7FA 5DK5A 3RMAA 4FJ9A 4W5OA 2IS3A 3P83D 2YNHA 2D0AA 3DYAA 4WE1A 1HMVA 5HROA 2VG7A 1KVCA 4W5TA 1RTJA 2NUBA 3OS1A 3OYJA 5J2NA 3VQEA 3V9UA 1QSSA 3PX6A 3OYNA 1QE1A 1RDCA 4F4KA 3HK2A 2GUIA 2FBYA 1S1WA 2Q3SA 2OPSA 2G8WA 2F8SA 3V1RA 4CJEA 1J9AA 3F9KA 1TAQA 4CF0A 4KFBA 4DFMA 2D0BA 3KK2A 3LPTA 3KTQA 2IDOA 1QS4A 3AA5X 3K59A 1EP4A 3OYEA 3OJSA 2DFHA 1TK5A 3V1QA 4C8MA 4J2DA 3HPGA 1BQNA 4PQUA 1VSLA 2YNIA 4CJUA 3OYMA 4FM1A 1ZBHA 1S9GA 4Y1CA 3IAYA 1IKYA 4AHSA 5SZTA 5HRPA 1BIZA 3TAFA 4CF2A 4DTMA 1RT1A 2X6SA 3D45A 4TSXA 3SCXA 4CJKA 4B9VA 4CCHA 3CM5A 5C24A 1BQMA 1FKPA 2OPRA 4CHOA 4N56A 4KAZA 3TARA 4IDKA 3M8SA 4H8KA 4JLHA 1FKOA 4CEDA 1N5YA 4K8ZA 4O55A 3SNNA 3S3OA 4M41A 3SQ0A 3KJVA 1CZBA 1A5XA 3V9XA 4I9QA 3AO3A 4BDPA 5CY4A 3MEEA 3JSMA 2B4JA 3SYZA 4DSKA 3RMDA 2EX3A 4KHNA 1WSEA 1KCFA 4CIGA 2YNGA 3ZSVA 2KZMA 1VSFA 3ZSQA 3JYTA 4HUFA 1S1VA 3HPOA 2JGUA 3KKRA 4FK4A 3ZT1A 3VQ4A 4FLYA 2OPPA 3U3GA 3ZSZA 1JXEA 4DG1A 1VSKA 4OLBA 4OJRA 3WNFA 4CEZA 3NF9A 1KFDA 4FJLA 3VA3A 3K2PA 3PX0A 4OGCA 3RMCA 3OY9A 2KW4A 4LSLA 1VSDA 3ZT3A 1GOCA 2KTQA 3K5LA 3LP1A 3SUPA 5HP1A 4CFDA 1TKDA 2AJQA 1FK9A 1NJZA 3VN5A 1LW0A 1Q8IA 2D5RA 5K14A 3AA3A 3VQ8A 2IC3A 3AA4A 1CZ9A 3HVTA 4FLXA 4W5QA 3ITHA 2R7YA 1RT2A 1QSLA 4M3WA 3DRSA 2G8UA 3LP0A 3NCIA 3ZCMA 3M8QA 4FJKA 3RRGA 4IFVA 1IKWA 4CFAA 3SUOA 5I3UA 4H4OA 3IRXA 4CECA 3KKSA 3ZSYA 1VSMA 1BL3A 3TABA 4EP5A 4G1QA 3B6PA 2PY5A 1BCOA 5E41A 1WAJA 1R0AA 4DF4A 4F8RA 1KVBA 4FZZA 5KI6A 3CM6A 4AH9A 3NDKA 1CXQA 1X1PA 4BDZA 1UA0A 3PO5A 3HM9A 1LWFA 3HP9A 1YVUA 3KLEA 1JLBA 1W0HA 3ISNC 2QKKA 3QNNA 3TAEA 3L2VA 1S6QA 1WSJA 3DMJA 4LH4A 4Z4IA 2BDPA 2W42A 1S5JA 3VQDA 4FJ5A 4FJ8A 4OLAA 3LP2A 3NAEA 2P5OA 3QEVA 4DU3A 1UOCA 4AHRA 4BDYA 4M3TA 3DLGA 1Z26A 1QTMA 2P5GA 4PUOA 2F8TA 4W5RA 1Q9XA 1XC9A 2IAJA 2Y1JA 2KFNA 4HUEA 4E19A 4DTJA 2HHXA 4DS5A 4M45A 4FZXC 4IG3A 3OVNA 1SUQA 4B8AB 4KB0A 1S1UA 1RNHA 3DRPA 2KFZA 1TVRA 3MECA 4DS4A 5D3GA 1C0UA 1WLJA 2RPIA 1WAFA 2YKMA 4AHCA 3LANA 3VQQA 4E1MA 4NYNA 3PV8A 3AVGA 3AV9A 5I42A 4FK2A 1HRHA 4CEFA 1JLAA 2Z1GA 1NK9A 2DTUA 4FJIA 3EY1A 1WSFA 3RTVA 3OYKA 1FXXA 2GBZA 2BGGA 4NCGA 5CZ1A 4CK2A 4CHQA 3O3FA 2HHUA 4E7LA 2A1SA 2RF2A 4CEAA 4YNQA 1NKEA 1J5OA 4DSJA 4Q0BA 1ASWA 4CJ4A 4I2QA 3SPZA 1RILA 4KV8A 4B3OA 4F2RA 5HLFA 2PZSA 2D0CA 1IO2A 1LW2A 1U48A 3NH0A 4DQRA 1UAXA 4FW2A 4KKOA 1KRPA 2JLEA 1ZBLA 4JRQA 3QIPA 4OKJA 3MXJA 1RT7A 3M8RA 3SV4A 3LP3A 4DMNA 4IKFA 4FYDA 4B8CA 4QCLA 4CJWA 4BE0A 1RT3A 3HL8A 1ITGA 2IOCA 3KLHA 3IS9A 1SL0A 3QINA 3V81A 4CF9A 4XIUA 1EETA 1YTAA 3TR8A 3L2WA 4DSFA 1NK4A 3ZSWA 4BE1A 2WONA 3AVFA 1JL2A 1LAVA 1RBRA 3O4QA 4O0IA 4N5SA 3CFPA 3AVNA 3KIOA 4CJ3A 3AVHA 3MAQA 3QNOA 4PA1A 3DOKA 1RDDA 2HVIA 1XWLA 1D8YA 3KLGA 3FFIA 4GVMA 4CK3A 2HHVA 3OYIA 1EXQA 3AVMA 1TKTA 3L3VA 1YTUA 4B9NA 3DRRA 3PX4A 4Q5VA 1QHTA 4FW1A 4ID5A 4AHUA 3ZSXA 1JLGA 1ZBUA 4CJLA 3RMBA 2OYQA 4KHYA 4AHTA 3T19A 3V1OA 1C0TA 3KLIA 4E0DA 4HTUA 5CZ2A 3TWHA 3G10A 3NF8A 4EZ9A 2OPQA 1WN7A 2DFFA 1ZBFA 4LH5A 3HYFA 5C25A 4PWDA 3LDSA 4W5NA 1T05A 1BCMA 3AO1A 3QIOA 4B08A 3F73A 2OZMA 2LSNA 4FJGA 1NK7A 3AVCA 1SKSA 1RTHA 1NJXA 4NCBA 3K5OA 4OVLA 4E7HA 1TGOA 4CJPA 4FLUA 1L5UA 1NJWA 4B9UA 1T8EA 1BISA 1BI4A 1RTIA 1HYVA 3ASMA 2HVHA 3C95A 1XHXA 2IGIA 4J2AA 3AVLA 1HYSA 2O4IA 4CFBA 1D9FA 5KGXA 1WSIA 3NHGA 4ELTA 4M3RA 4EP4A 1KLMA 2G8HA 5EU7A 1NKCA 4ELVA 3LAMA 1C1AA 3VQ5A 4JS5A 3OYLA 3DLHA 5SWMA 3SV3A 1WSHA 4DSIA 1SV5A 1TV6A 3I0SA 4CHZA 3TAPA 2HHWA 3B6OA 3O3GA 2XO7A 3DM2A 3V9SA 3QEIA 4CFCA 1HPZA 5DMRA 3CG7A 1NK0A 1CLQA 1QQCA 4F2SA 4CF1A 3QETA 3OS2A 2ATQA 4ELUA 3K5MA 4FCYA 3PUFA 3P1GA 1BIUA 1W9HA 3VQ6A 4BWMA 4CJSA 1NKBA 1D9DA 4DTNA 4KTZA 4MFBA 4F3OA 3NH2A 4CJVA 4FLZA 4F3TA 1Y97A 4DTPA 3AO4A 3QERA 4ZTFA 2DY4A 1NK5A 1REVA 4DQQA 4KTQA 4OPJA 2EHGA 1RT5A 2B5JA 4CGJA 3DLKA 3I0RA 1Z25A 1DLOA 2FBVA 4CEQA 4Z4EA 2Z1HA 3LZIA 5KGWA 4Z4GA 2B6AA 2HNZA 2FBTA 4CIFA 1NOZA 4KB1A 3LWLA 1RDBA 1JLQA 4O5BA 3ZT4A 2VWJA 2F96A 4NYFA 2WOMA 1SL1A 2YHBA 1KSPA 4KREA 1IKXA 4FLWA 3QLHA 3L2QA 4BE2A 3V4IA 4CF8A 1A5VA 1IG9A 3VQPA 4LY7A 3T1AA 3DI6A 2HMIA 2YNFA 1RDAA 3DLBA 4RW7A 4K8XA 3MEGA 1HQUA 3BGRA 4CIEA 3KK1A 2QXFA 3AVJA 3SJJA 1TK8A 1LWEA 2OZSA 3AO5A 3WNHA 4KI4A 4DLGA 1O1WA 1NJYA 5HRRA 4DQPA 5J2PA 3OYDA 1RT4A 3THVA 3L2RA 1KFSA 1VRTA 3LWMA 3WNGA 3VQBA 3NGIA 1RCHA 2E6MA 2PYLA 1RBTA 4DTOA 2VG5A 2QK9A 4IG0A 2HNDA 3T3FA 2DFEA 2VWKA 3EZ5A 3UIQA 4CJTA 3S9HA 3AVBA 2A1RA 4KPYA 1JXBA 3NF7A 1JLEA 1N6QA 3BDPA 4DWIA 1T03A 1B9DA 2Y1IA 5HRSA 4FJJA 3L2UA 4C8OA 3RR8A 4CHYA 3NH1A 4AILC 1K6YA 4LSNA 3OJUA 4B9SA 1J53A 4CJQA 3TAGA 3SUNA 3PY8A 3KD1E 3ZT0A 4E1NA 2FC0A 4ICLA 5JS2A 1LAWA 4DTSA 4DFKA 4EZ6A 3HO1A 2HHTA 3SPYA 1S1TA 1LWCA 4JRPA 4KO0A 3U6FA 4FZYA 1VSIA 1T7PA 2ETJA 3OYGA 4C8KA 4OPKA 1X9WA 3VQCA 4CERA 2Z1IA 2E6LA 4CGFA 1GOAA 4CGGA 1EX4A 3C6UA 3K57A 3MXIA 3KD5E 4FJ7A 4KTWA 2XRIA 1S1XA 3NGYA 2BANA 3VQ7A 4DU4A 1J54A 3HVRA 3OYFA 3OYBA 2YV0X 1KLNA 4OGEA 4H4MA 1RT6A 4R5PA 5J1EA 1ASVA 1I39A 3NGZA 2E4LA 2G8KA 3L8BA 3QEWA 3QEXA 1DTQA 2G8IA 2RN2A 3M8PA 2YKNA 1G15A 1JLCA 1VSEA 4HVJA 4FJHA 2HW3A 2G8FA 2X6NA 1WSGA 3SQ1A 4HCBA 4M3YA 1NK6A 4GW6A 4OKKA 5FRNA 1Q9YA 4FLTA 1WNSA 4GMJB 4N47A 3WNEA 1SKRA 2PYJA 1HNVA 3ZSOA 4FXDA 4CGIA 4CJ5A 3H08A 4E3SA 1KVAA 4ZTJA 4RW4A 4RW6A 4DFPA 2G8VA 4RW9A 1X9MA 1L3UA 4C8LA 1F21A 2HB5A 3K58A 1C6VA 3TAQA 4FK0A 4DTRA 4IFYA 3KLFA 1U47A 1HYZA 3CYMA 3VQ9A 3HXMA 2XHBA 2QKBA 4CK1A 1X9SA 2ZD1A 4CEEA 3S3NA 4KHQA 3P5JA 3V9ZA 1UA1A 2GV9A 5HRNA 3SUQA 4JS4A 2ITGA 3AO2A 1ZBIA 5CYQA 4FJMA 5J2MA 1C1BA 1C1CA 4ZHRA 3CFRA 3NF6A 4Z4HA 2HNYA 1RBSA 5KTQA 3LAKA 3TANA 1L3TA 4DQIA 4UQGA 3SI6A 5FDLA 4CEBA 3OYAA 4DFJA 4HCCA 1YT3A 2BE2A 4DQSA 4O4GA 3LZJA 3KK3A 2Z1JA 3HSTB 3DLRA 3AVIA 3EYZA 1JL1A 4FLVA 3ZSRA 1RBUA 4CJRA 3RRHA 3IG1A 4CHPA 3U3YA 4FM0A 4CESA 2O4GA 4J2EA 4AHVA 4HHTA 1SKWA 1U45A 3S3MA 5KRSA 3MEDA 1D5AA 4N76A 4QAGA 4LD0A 4E7JA 4M42A 1VSHA 2I5JA 2FBXA 5J2QA 1U4BA 4Z0UA 2OA8A 1B9FA 1GOBA 4E7KA 1L3VA 4MQ3A 4DF8A 4O0JA 4M3XA 1I3AA 1TAUA 4QOZB 3HT3A 2X74A 3ALYA 3PO4A 1C0MA 1TKZA 1EKEA 1B92A 1VRUA 4HUGA 1RTDA 4M3UA 1U49A 1SL2A 4Z4CA 1TL1A 4YFUA 3OS0A 4B9MA 5T7BA 1TKXA 3V9WA 3VA0A 2P51A 3SQ4A 3CFOA 4DU1A 1MU2A 4BACA 5KRTA 3RWUA 3NBPA 1IKVA 3NFAA 2HHQA 3AA2A 1QSYA 4CGDA 1CXUA 4DLEA 3SZ2A 3QESA 2KQ2A 4B9TA 3QEPA 2ZQBA 4N41A 4DTXA 3TI0A 4FJXA 1L3SA 4C8NA 3C6TA 3A2FA 3V6DA 4CJFA 4Y1DA 3TAMA 3DLEA 4B9LA 4CHNA 2XY6A 1XHZA 3ZT2A 3QO9A 4OKEA 4IBNA 1HJRA 3G0ZA 1JLFA 5C42A 1LV5A 3HJFA 4KRFA 1NOYA 3NE6A 1ZYQA 4O44A 1HNIA 2KZZA 4I2PA 5CYMA 3O3HA 3HPHA 2X78A 3OYCA 3RR7A 3I8DA 4KHUA 1UWBA 4DSLA 3HP6A 3DOLA 3VQAA 5FROA 4CGHA 3D0PA 1JKHA 3L3UA 4L8RB 3LALA 2P1JA 2XY7A 2VG6A 1NK8A 3CQ8A 4NCAA 1HQEA 4BWJA 4E7IA 4FVMA 2RKIA 2XY5A 1RBVA 3LPUA 3K5NA 1TK0A 4KI6A 1XI1A 1A5WA 5JS1A 1DTTA 3C94A 4J2BA 1BGXT 1IH7A 4ID1A 4Z4FA 3AVAA 4PY5A 4DTUA 4M3ZA 4E89A 4CEOA 4DSEA 2HHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I9L A;  3OYH A;  1S6P A;  4CE9 A;  3SQ2 A;  4FJN A;  1TL3 A;  1VSJ A;  3AVK A;  2XY8 A;  4RW8 A;  1S9E A;  1U04 A;  3MXM A;  4FM2 A;  1BHL A;  3O4N A;  1ASU A;  1VK0 A;  5HBM A;  3E01 A;  2YHA A;  4RG8 A;  4KHW A;  1BI4 B;  2ZE2 A;  3ULD A;  4KHS A;  5FRM A;  1KTQ A;  4I7F A;  5DK5 A;  3RMA A;  4FJ9 A;  4W5O A;  2IS3 A;  3P83 D;  2YNH A;  2D0A A;  3DYA A;  4WE1 A;  1HMV A;  5HRO A;  2VG7 A;  1KVC A;  4W5T A;  1RTJ A;  2NUB A;  3OS1 A;  3OYJ A;  5J2N A;  3VQE A;  3V9U A;  1QSS A;  3PX6 A;  3OYN A;  1QE1 A;  1RDC A;  4F4K A;  3HK2 A;  2GUI A;  2FBY A;  1S1W A;  2Q3S A;  2OPS A;  2G8W A;  2F8S A;  3V1R A;  4CJE A;  1J9A A;  3F9K A;  1TAQ A;  4CF0 A;  4KFB A;  4DFM A;  2D0B A;  3KK2 A;  3LPT A;  3KTQ A;  2IDO A;  1QS4 A;  3AA5 X;  3K59 A;  1EP4 A;  3OYE A;  3OJS A;  2DFH A;  1TK5 A;  3V1Q A;  4C8M A;  4J2D A;  3HPG A;  1BQN A;  4PQU A;  1VSL A;  2YNI A;  4CJU A;  3OYM A;  4FM1 A;  1ZBH A;  1S9G A;  4Y1C A;  3IAY A;  1IKY A;  4AHS A;  5SZT A;  5HRP A;  1BIZ A;  3TAF A;  4CF2 A;  4DTM A;  1RT1 A;  2X6S A;  3D45 A;  4TSX A;  3SCX A;  4CJK A;  4B9V A;  4CCH A;  3CM5 A;  5C24 A;  1BQM A;  1FKP A;  2OPR A;  4CHO A;  4N56 A;  4KAZ A;  3TAR A;  4IDK A;  3M8S A;  4H8K A;  4JLH A;  1FKO A;  4CED A;  1N5Y A;  4K8Z A;  4O55 A;  3SNN A;  3S3O A;  4M41 A;  3SQ0 A;  3KJV A;  1CZB A;  1A5X A;  3V9X A;  4I9Q A;  3AO3 A;  4BDP A;  5CY4 A;  3MEE A;  3JSM A;  2B4J A;  3SYZ A;  4DSK A;  3RMD A;  2EX3 A;  4KHN A;  1WSE A;  1KCF A;  4CIG A;  2YNG A;  3ZSV A;  2KZM A;  1VSF A;  3ZSQ A;  3JYT A;  4HUF A;  1S1V A;  3HPO A;  2JGU A;  3KKR A;  4FK4 A;  3ZT1 A;  3VQ4 A;  4FLY A;  2OPP A;  3U3G A;  3ZSZ A;  1JXE A;  4DG1 A;  1VSK A;  4OLB A;  4OJR A;  3WNF A;  4CEZ A;  3NF9 A;  1KFD A;  4FJL A;  3VA3 A;  3K2P A;  3PX0 A;  4OGC A;  3RMC A;  3OY9 A;  2KW4 A;  4LSL A;  1VSD A;  3ZT3 A;  1GOC A;  2KTQ A;  3K5L A;  3LP1 A;  3SUP A;  5HP1 A;  4CFD A;  1TKD A;  2AJQ A;  1FK9 A;  1NJZ A;  3VN5 A;  1LW0 A;  1Q8I A;  2D5R A;  5K14 A;  3AA3 A;  3VQ8 A;  2IC3 A;  3AA4 A;  1CZ9 A;  3HVT A;  4FLX A;  4W5Q A;  3ITH A;  2R7Y A;  1RT2 A;  1QSL A;  4M3W A;  3DRS A;  2G8U A;  3LP0 A;  3NCI A;  3ZCM A;  3M8Q A;  4FJK A;  3RRG A;  4IFV A;  1IKW A;  4CFA A;  3SUO A;  5I3U A;  4H4O A;  3IRX A;  4CEC A;  3KKS A;  3ZSY A;  1VSM A;  1BL3 A;  3TAB A;  4EP5 A;  4G1Q A;  3B6P A;  2PY5 A;  1BCO A;  5E41 A;  1WAJ A;  1R0A A;  4DF4 A;  4F8R A;  1KVB A;  4FZZ A;  5KI6 A;  3CM6 A;  4AH9 A;  3NDK A;  1CXQ A;  1X1P A;  4BDZ A;  1UA0 A;  3PO5 A;  3HM9 A;  1LWF A;  3HP9 A;  1YVU A;  3KLE A;  1JLB A;  1W0H A;  3ISN C;  2QKK A;  3QNN A;  3TAE A;  3L2V A;  1S6Q A;  1WSJ A;  3DMJ A;  4LH4 A;  4Z4I A;  2BDP A;  2W42 A;  1S5J A;  3VQD A;  4FJ5 A;  4FJ8 A;  4OLA A;  3LP2 A;  3NAE A;  2P5O A;  3QEV A;  4DU3 A;  1UOC A;  4AHR A;  4BDY A;  4M3T A;  3DLG A;  1Z26 A;  1QTM A;  2P5G A;  4PUO A;  2F8T A;  4W5R A;  1Q9X A;  1XC9 A;  2IAJ A;  2Y1J A;  2KFN A;  4HUE A;  4E19 A;  4DTJ A;  2HHX A;  4DS5 A;  4M45 A;  4FZX C;  4IG3 A;  3OVN A;  1SUQ A;  4B8A B;  4KB0 A;  1S1U A;  1RNH A;  3DRP A;  2KFZ A;  1TVR A;  3MEC A;  4DS4 A;  5D3G A;  1C0U A;  1WLJ A;  2RPI A;  1WAF A;  2YKM A;  4AHC A;  3LAN A;  3VQQ A;  4E1M A;  4NYN A;  3PV8 A;  3AVG A;  3AV9 A;  5I42 A;  4FK2 A;  1HRH A;  4CEF A;  1JLA A;  2Z1G A;  1NK9 A;  2DTU A;  4FJI A;  3EY1 A;  1WSF A;  3RTV A;  3OYK A;  1FXX A;  2GBZ A;  2BGG A;  4NCG A;  5CZ1 A;  4CK2 A;  4CHQ A;  3O3F A;  2HHU A;  4E7L A;  2A1S A;  2RF2 A;  4CEA A;  4YNQ A;  1NKE A;  1J5O A;  4DSJ A;  4Q0B A;  1ASW A;  4CJ4 A;  4I2Q A;  3SPZ A;  1RIL A;  4KV8 A;  4B3O A;  4F2R A;  5HLF A;  2PZS A;  2D0C A;  1IO2 A;  1LW2 A;  1U48 A;  3NH0 A;  4DQR A;  1UAX A;  4FW2 A;  4KKO A;  1KRP A;  2JLE A;  1ZBL A;  4JRQ A;  3QIP A;  4OKJ A;  3MXJ A;  1RT7 A;  3M8R A;  3SV4 A;  3LP3 A;  4DMN A;  4IKF A;  4FYD A;  4B8C A;  4QCL A;  4CJW A;  4BE0 A;  1RT3 A;  3HL8 A;  1ITG A;  2IOC A;  3KLH A;  3IS9 A;  1SL0 A;  3QIN A;  3V81 A;  4CF9 A;  4XIU A;  1EET A;  1YTA A;  3TR8 A;  3L2W A;  4DSF A;  1NK4 A;  3ZSW A;  4BE1 A;  2WON A;  3AVF A;  1JL2 A;  1LAV A;  1RBR A;  3O4Q A;  4O0I A;  4N5S A;  3CFP A;  3AVN A;  3KIO A;  4CJ3 A;  3AVH A;  3MAQ A;  3QNO A;  4PA1 A;  3DOK A;  1RDD A;  2HVI A;  1XWL A;  1D8Y A;  3KLG A;  3FFI A;  4GVM A;  4CK3 A;  2HHV A;  3OYI A;  1EXQ A;  3AVM A;  1TKT A;  3L3V A;  1YTU A;  4B9N A;  3DRR A;  3PX4 A;  4Q5V A;  1QHT A;  4FW1 A;  4ID5 A;  4AHU A;  3ZSX A;  1JLG A;  1ZBU A;  4CJL A;  3RMB A;  2OYQ A;  4KHY A;  4AHT A;  3T19 A;  3V1O A;  1C0T A;  3KLI A;  4E0D A;  4HTU A;  5CZ2 A;  3TWH A;  3G10 A;  3NF8 A;  4EZ9 A;  2OPQ A;  1WN7 A;  2DFF A;  1ZBF A;  4LH5 A;  3HYF A;  5C25 A;  4PWD A;  3LDS A;  4W5N A;  1T05 A;  1BCM A;  3AO1 A;  3QIO A;  4B08 A;  3F73 A;  2OZM A;  2LSN A;  4FJG A;  1NK7 A;  3AVC A;  1SKS A;  1RTH A;  1NJX A;  4NCB A;  3K5O A;  4OVL A;  4E7H A;  1TGO A;  4CJP A;  4FLU A;  1L5U A;  1NJW A;  4B9U A;  1T8E A;  1BIS A;  1BI4 A;  1RTI A;  1HYV A;  3ASM A;  2HVH A;  3C95 A;  1XHX A;  2IGI A;  4J2A A;  3AVL A;  1HYS A;  2O4I A;  4CFB A;  1D9F A;  5KGX A;  1WSI A;  3NHG A;  4ELT A;  4M3R A;  4EP4 A;  1KLM A;  2G8H A;  5EU7 A;  1NKC A;  4ELV A;  3LAM A;  1C1A A;  3VQ5 A;  4JS5 A;  3OYL A;  3DLH A;  5SWM A;  3SV3 A;  1WSH A;  4DSI A;  1SV5 A;  1TV6 A;  3I0S A;  4CHZ A;  3TAP A;  2HHW A;  3B6O A;  3O3G A;  2XO7 A;  3DM2 A;  3V9S A;  3QEI A;  4CFC A;  1HPZ A;  5DMR A;  3CG7 A;  1NK0 A;  1CLQ A;  1QQC A;  4F2S A;  4CF1 A;  3QET A;  3OS2 A;  2ATQ A;  4ELU A;  3K5M A;  4FCY A;  3PUF A;  3P1G A;  1BIU A;  1W9H A;  3VQ6 A;  4BWM A;  4CJS A;  1NKB A;  1D9D A;  4DTN A;  4KTZ A;  4MFB A;  4F3O A;  3NH2 A;  4CJV A;  4FLZ A;  4F3T A;  1Y97 A;  4DTP A;  3AO4 A;  3QER A;  4ZTF A;  2DY4 A;  1NK5 A;  1REV A;  4DQQ A;  4KTQ A;  4OPJ A;  2EHG A;  1RT5 A;  2B5J A;  4CGJ A;  3DLK A;  3I0R A;  1Z25 A;  1DLO A;  2FBV A;  4CEQ A;  4Z4E A;  2Z1H A;  3LZI A;  5KGW A;  4Z4G A;  2B6A A;  2HNZ A;  2FBT A;  4CIF A;  1NOZ A;  4KB1 A;  3LWL A;  1RDB A;  1JLQ A;  4O5B A;  3ZT4 A;  2VWJ A;  2F96 A;  4NYF A;  2WOM A;  1SL1 A;  2YHB A;  1KSP A;  4KRE A;  1IKX A;  4FLW A;  3QLH A;  3L2Q A;  4BE2 A;  3V4I A;  4CF8 A;  1A5V A;  1IG9 A;  3VQP A;  4LY7 A;  3T1A A;  3DI6 A;  2HMI A;  2YNF A;  1RDA A;  3DLB A;  4RW7 A;  4K8X A;  3MEG A;  1HQU A;  3BGR A;  4CIE A;  3KK1 A;  2QXF A;  3AVJ A;  3SJJ A;  1TK8 A;  1LWE A;  2OZS A;  3AO5 A;  3WNH A;  4KI4 A;  4DLG A;  1O1W A;  1NJY A;  5HRR A;  4DQP A;  5J2P A;  3OYD A;  1RT4 A;  3THV A;  3L2R A;  1KFS A;  1VRT A;  3LWM A;  3WNG A;  3VQB A;  3NGI A;  1RCH A;  2E6M A;  2PYL A;  1RBT A;  4DTO A;  2VG5 A;  2QK9 A;  4IG0 A;  2HND A;  3T3F A;  2DFE A;  2VWK A;  3EZ5 A;  3UIQ A;  4CJT A;  3S9H A;  3AVB A;  2A1R A;  4KPY A;  1JXB A;  3NF7 A;  1JLE A;  1N6Q A;  3BDP A;  4DWI A;  1T03 A;  1B9D A;  2Y1I A;  5HRS A;  4FJJ A;  3L2U A;  4C8O A;  3RR8 A;  4CHY A;  3NH1 A;  4AIL C;  1K6Y A;  4LSN A;  3OJU A;  4B9S A;  1J53 A;  4CJQ A;  3TAG A;  3SUN A;  3PY8 A;  3KD1 E;  3ZT0 A;  4E1N A;  2FC0 A;  4ICL A;  5JS2 A;  1LAW A;  4DTS A;  4DFK A;  4EZ6 A;  3HO1 A;  2HHT A;  3SPY A;  1S1T A;  1LWC A;  4JRP A;  4KO0 A;  3U6F A;  4FZY A;  1VSI A;  1T7P A;  2ETJ A;  3OYG A;  4C8K A;  4OPK A;  1X9W A;  3VQC A;  4CER A;  2Z1I A;  2E6L A;  4CGF A;  1GOA A;  4CGG A;  1EX4 A;  3C6U A;  3K57 A;  3MXI A;  3KD5 E;  4FJ7 A;  4KTW A;  2XRI A;  1S1X A;  3NGY A;  2BAN A;  3VQ7 A;  4DU4 A;  1J54 A;  3HVR A;  3OYF A;  3OYB A;  2YV0 X;  1KLN A;  4OGE A;  4H4M A;  1RT6 A;  4R5P A;  5J1E A;  1ASV A;  1I39 A;  3NGZ A;  2E4L A;  2G8K A;  3L8B A;  3QEW A;  3QEX A;  1DTQ A;  2G8I A;  2RN2 A;  3M8P A;  2YKN A;  1G15 A;  1JLC A;  1VSE A;  4HVJ A;  4FJH A;  2HW3 A;  2G8F A;  2X6N A;  1WSG A;  3SQ1 A;  4HCB A;  4M3Y A;  1NK6 A;  4GW6 A;  4OKK A;  5FRN A;  1Q9Y A;  4FLT A;  1WNS A;  4GMJ B;  4N47 A;  3WNE A;  1SKR A;  2PYJ A;  1HNV A;  3ZSO A;  4FXD A;  4CGI A;  4CJ5 A;  3H08 A;  4E3S A;  1KVA A;  4ZTJ A;  4RW4 A;  4RW6 A;  4DFP A;  2G8V A;  4RW9 A;  1X9M A;  1L3U A;  4C8L A;  1F21 A;  2HB5 A;  3K58 A;  1C6V A;  3TAQ A;  4FK0 A;  4DTR A;  4IFY A;  3KLF A;  1U47 A;  1HYZ A;  3CYM A;  3VQ9 A;  3HXM A;  2XHB A;  2QKB A;  4CK1 A;  1X9S A;  2ZD1 A;  4CEE A;  3S3N A;  4KHQ A;  3P5J A;  3V9Z A;  1UA1 A;  2GV9 A;  5HRN A;  3SUQ A;  4JS4 A;  2ITG A;  3AO2 A;  1ZBI A;  5CYQ A;  4FJM A;  5J2M A;  1C1B A;  1C1C A;  4ZHR A;  3CFR A;  3NF6 A;  4Z4H A;  2HNY A;  1RBS A;  5KTQ A;  3LAK A;  3TAN A;  1L3T A;  4DQI A;  4UQG A;  3SI6 A;  5FDL A;  4CEB A;  3OYA A;  4DFJ A;  4HCC A;  1YT3 A;  2BE2 A;  4DQS A;  4O4G A;  3LZJ A;  3KK3 A;  2Z1J A;  3HST B;  3DLR A;  3AVI A;  3EYZ A;  1JL1 A;  4FLV A;  3ZSR A;  1RBU A;  4CJR A;  3RRH A;  3IG1 A;  4CHP A;  3U3Y A;  4FM0 A;  4CES A;  2O4G A;  4J2E A;  4AHV A;  4HHT A;  1SKW A;  1U45 A;  3S3M A;  5KRS A;  3MED A;  1D5A A;  4N76 A;  4QAG A;  4LD0 A;  4E7J A;  4M42 A;  1VSH A;  2I5J A;  2FBX A;  5J2Q A;  1U4B A;  4Z0U A;  2OA8 A;  1B9F A;  1GOB A;  4E7K A;  1L3V A;  4MQ3 A;  4DF8 A;  4O0J A;  4M3X A;  1I3A A;  1TAU A;  4QOZ B;  3HT3 A;  2X74 A;  3ALY A;  3PO4 A;  1C0M A;  1TKZ A;  1EKE A;  1B92 A;  1VRU A;  4HUG A;  1RTD A;  4M3U A;  1U49 A;  1SL2 A;  4Z4C A;  1TL1 A;  4YFU A;  3OS0 A;  4B9M A;  5T7B A;  1TKX A;  3V9W A;  3VA0 A;  2P51 A;  3SQ4 A;  3CFO A;  4DU1 A;  1MU2 A;  4BAC A;  5KRT A;  3RWU A;  3NBP A;  1IKV A;  3NFA A;  2HHQ A;  3AA2 A;  1QSY A;  4CGD A;  1CXU A;  4DLE A;  3SZ2 A;  3QES A;  2KQ2 A;  4B9T A;  3QEP A;  2ZQB A;  4N41 A;  4DTX A;  3TI0 A;  4FJX A;  1L3S A;  4C8N A;  3C6T A;  3A2F A;  3V6D A;  4CJF A;  4Y1D A;  3TAM A;  3DLE A;  4B9L A;  4CHN A;  2XY6 A;  1XHZ A;  3ZT2 A;  3QO9 A;  4OKE A;  4IBN A;  1HJR A;  3G0Z A;  1JLF A;  5C42 A;  1LV5 A;  3HJF A;  4KRF A;  1NOY A;  3NE6 A;  1ZYQ A;  4O44 A;  1HNI A;  2KZZ A;  4I2P A;  5CYM A;  3O3H A;  3HPH A;  2X78 A;  3OYC A;  3RR7 A;  3I8D A;  4KHU A;  1UWB A;  4DSL A;  3HP6 A;  3DOL A;  3VQA A;  5FRO A;  4CGH A;  3D0P A;  1JKH A;  3L3U A;  4L8R B;  3LAL A;  2P1J A;  2XY7 A;  2VG6 A;  1NK8 A;  3CQ8 A;  4NCA A;  1HQE A;  4BWJ A;  4E7I A;  4FVM A;  2RKI A;  2XY5 A;  1RBV A;  3LPU A;  3K5N A;  1TK0 A;  4KI6 A;  1XI1 A;  1A5W A;  5JS1 A;  1DTT A;  3C94 A;  4J2B A;  1BGX T;  1IH7 A;  4ID1 A;  4Z4F A;  3AVA A;  4PY5 A;  4DTU A;  4M3Z A;  4E89 A;  4CEO A;  4DSE A;  2HHS A; 
#chains in the Genus database with same CATH topology
 4I9L A;  1NG9 A;  1S6P A;  4CE9 A;  2XY8 A;  3OTO K;  2FLO A;  4FM2 A;  1BHL A;  1YHQ N;  4CVN E;  2YHA A;  3Q7B A;  3TTD A;  5FRM A;  3SAH A;  4FJ9 A;  2IS3 A;  1HNZ K;  2YNH A;  3M3Z A;  3VEV A;  4WE1 A;  4DV5 K;  2A5X A;  2O8C B;  2VG7 A;  3UKU B;  2O8E A;  1RTJ A;  4IWV A;  4NO7 A;  3OYN A;  1QE1 A;  3HK2 A;  4A59 A;  5JVH L;  1S1W A;  2Q3S A;  2OPS A;  2G8W A;  3CI5 A;  3MWP A;  1YJ9 N;  2QM1 A;  2A40 A;  1QS4 A;  2IDO A;  2IVN A;  2JWK A;  3MCP A;  3OJS A;  1BQN A;  2NNW A;  3KZB A;  4FM1 A;  1OVY A;  3LL3 A;  2ZWH A;  1IKY A;  4AHS A;  1BIZ A;  1NLV A;  4TSX A;  3CCU N;  4CCH A;  1BQM A;  2OPR A;  4N56 A;  2Q36 A;  3TTC A;  4IDK A;  3M8S A;  4H8K A;  3S3O A;  2UXB K;  4MO5 A;  4I9Q A;  2P9S B;  3HOS A;  4C23 A;  2D1K A;  3RMD A;  4FWO A;  4CIG A;  5DM7 L;  3L4Q A;  3KKR A;  3ZSZ A;  1JXE A;  3T7Z A;  2J4R A;  3WNF A;  4CEZ A;  3CQX A;  1U2V B;  4BC5 A;  4CI6 A;  4OGC A;  3VA3 A;  3LDO A;  3PSF A;  3LP1 A;  5HP1 A;  2AJQ A;  4K43 A;  2KHO A;  2IVP A;  3AA3 A;  1CZ9 A;  4IOA L;  4W5Q A;  2R7Y A;  3MDQ A;  4M3W A;  5GAE P;  3LP0 A;  3NCI A;  3ZCM A;  3ZET A;  4DUZ K;  1IKW A;  5AQR A;  4H4O A;  4O8U A;  1VSM A;  3VEW A;  1N8R O;  4G1Q A;  1BCO A;  4B9Q A;  3I8B A;  1YJW N;  5KI6 A;  1NGD A;  1N32 K;  4BDZ A;  1UA0 A;  3PO5 A;  3O8M A;  3HP9 A;  3VEZ A;  1JLB A;  2QKK A;  3ISN C;  4A5B A;  4BRQ A;  3VEN A;  1S5J A;  3SAG A;  2P5O A;  3QEV A;  1IJJ A;  2F8T A;  4H0X B;  1LCU A;  4HUE A;  2VQE K;  4UY8 O;  2HHX A;  3VET A;  4M45 A;  4IG3 A;  3OVN A;  1SUQ A;  4B8A B;  1S1U A;  4GVE A;  3DRP A;  4DS4 A;  1WLJ A;  1IBL K;  4X66 K;  2BH1 A;  3LAN A;  3VQQ A;  4H0Y B;  3WT0 A;  4E1M A;  1HRH A;  1WSF A;  3E66 A;  4CHQ A;  3O3F A;  2RF2 A;  1J5O A;  1NKE A;  4WQ5 A;  1Z05 A;  1ASW A;  1WBD A;  1VQ4 N;  3D2E B;  5BRE A;  4ISE A;  1UAX A;  2P9U B;  2JLE A;  5AQS A;  2YHX A;  3CQY A;  4BE0 A;  1RT3 A;  4JKD A;  3KLH A;  4JI5 K;  4CF9 A;  1NK4 A;  4BE1 A;  2WON A;  1JL2 A;  1Y64 A;  3AVF A;  3CFP A;  1K8K B;  4CJ3 A;  3CF5 L;  3QNO A;  1RDD A;  4JI6 K;  3ATV A;  1VQO N;  3KLG A;  4IO9 L;  2HHV A;  1MA9 B;  5AQJ A;  4B9N A;  4AHU A;  3ZSX A;  4CJL A;  4Z94 A;  2OYQ A;  3U9Z A;  5GIP A;  4EZ9 A;  2Q2R A;  1ZBF A;  1QHA A;  3WQT A;  5C25 A;  4W5N A;  4CBW A;  2LSN A;  4FJG A;  3AVC A;  3EE9 A;  1NJX A;  3M1F A;  4OVL A;  1TGO A;  3GG4 A;  4CJP A;  4IJA A;  1L5U A;  1OKJ A;  1XMO K;  5TKW A;  1RTI A;  3C95 A;  4U67 L;  3RSE A;  4GY2 B;  3AVL A;  3D2F A;  3CC2 N;  1HYS A;  2O4I A;  1ATR A;  1WSI A;  3NHG A;  4M3R A;  4EP4 A;  4ELV A;  4RTF D;  2F4V K;  4GKJ K;  1WSH A;  4DSI A;  1BG3 A;  4AM7 A;  1ZXO A;  4CFC A;  3FZK A;  4CF1 A;  3QET A;  3OS2 A;  4ELU A;  3KK7 A;  4BR7 A;  3VQ6 A;  4DTN A;  3FZM A;  4FLZ A;  3QER A;  1REV A;  4DQQ A;  1ATN A;  4KTQ A;  3I0R A;  1Z25 A;  5LJW A;  1NGJ A;  2A42 A;  4LC9 B;  4Z4E A;  5KGW A;  3SK3 A;  1OH8 A;  2FBT A;  1NOZ A;  3CER A;  3CCL N;  4DB3 A;  4NYF A;  1KSP A;  4RWT A;  3THX B;  1DT9 A;  1XNR K;  2QWP A;  3VQP A;  3T1A A;  2HMI A;  2YNF A;  1RDA A;  5AFU A;  4RW7 A;  3BGR A;  2QXF A;  4KI4 A;  1NJY A;  3VF4 A;  3EL2 A;  1WUA A;  1LOT B;  5JIC A;  2Q97 A;  2E6M A;  3CJ9 A;  2D0P A;  4I6M A;  3A5N C;  2VG5 A;  3DXK A;  3T69 A;  1VQ9 N;  2QK9 A;  4IG0 A;  2HND A;  3UIQ A;  1YJN N;  1JLE A;  1WBB A;  3C7N B;  1MWK A;  4DWI A;  4QS8 A;  5HRS A;  4FJJ A;  5AQG A;  5H1S Q;  4KHP K;  1K8K A;  1K6Y A;  4AIL C;  3TAG A;  4FVU A;  1X3M A;  3ZT0 A;  4ICL A;  4DTS A;  3DXK B;  3VEO A;  1S1T A;  1LWC A;  1S3X A;  4FZY A;  2W40 A;  3H1Q A;  1X9W A;  4CGF A;  3A5L C;  4CGG A;  1EX4 A;  3C6U A;  3KD5 E;  1S1X A;  3OYF A;  1YAG A;  3OYB A;  4H4M A;  4LF5 K;  1I39 A;  3NGZ A;  4DR4 K;  3QEW A;  1HJO A;  1VQM N;  4KBO A;  2D0O A;  4G9Z A;  4HVJ A;  4BR9 A;  3SQ1 A;  3HBT A;  2HOE A;  4M3Y A;  1NK6 A;  2E1Z A;  4GW6 A;  4OKK A;  4M7Y A;  3SMS A;  4GMJ B;  4QS9 A;  2HMP A;  2W41 A;  3EE8 A;  4FWS A;  3H08 A;  1HKB A;  4DFP A;  1BOT O;  5C15 A;  3O9U A;  4RW9 A;  4NLC A;  3FZL A;  2WTU A;  4C8L A;  1DEJ A;  2HB5 A;  2HBJ A;  4JNE A;  3TAQ A;  1OH7 A;  1RDW X;  3ENH A;  4DTR A;  3BZK A;  3KLF A;  4JD2 A;  3VQ9 A;  2XHB A;  1HNX K;  1UA1 A;  1Q81 O;  5F0X A;  2YHY A;  2P9K B;  4FJM A;  2NRV A;  3TAN A;  1RBS A;  3LAK A;  4DQI A;  3SI6 A;  5FDL A;  2ZJR L;  3ZYY X;  3HST B;  3AVI A;  3U3Y A;  3IG1 A;  4FM0 A;  4CES A;  4J2E A;  4AHV A;  4YOX A;  2NRT A;  1U4B A;  4EIA A;  4YHH K;  5C2F A;  5AZI B;  1L3V A;  4KH6 A;  3N4Q A;  4BRK A;  3ID6 A;  2W6L A;  1EKE A;  4M3U A;  1R59 O;  1TL1 A;  2GEL A;  4FL9 A;  4DU1 A;  3RWU A;  3NFA A;  1CXU A;  3QES A;  3RVC A;  4DTX A;  4FJX A;  1L3S A;  3A2F A;  3TAM A;  4BC3 A;  1XHZ A;  3QO9 A;  1BWF O;  4IBN A;  4OX9 K;  1HJR A;  4KRF A;  3HJF A;  1XQS C;  1HR0 K;  3FGU A;  3O3H A;  2FF3 B;  1BDG A;  2V7Z A;  5LMN K;  2E2O A;  5AQK A;  3I8D A;  4FWP A;  4KHU A;  4CD1 A;  5FRO A;  4CGH A;  3M5R A;  2P1J A;  4LFB K;  3MN7 A;  1NK8 A;  4E7I A;  4FVM A;  3BY5 A;  1TK0 A;  4EHT A;  1A5W A;  1DTT A;  3C94 A;  4J2B A;  1BGX T;  4ID1 A;  1NGB A;  1XUP O;  4PY5 A;  1XC3 A;  4DSE A;  4KPY A;  2GEM A;  1XMQ K;  1XNQ K;  4PKI A;  1TL3 A;  4CZM A;  2O8C A;  2NRH A;  4RW8 A;  1S9E A;  3WXJ A;  1U04 A;  2Q0U A;  1BU6 O;  4JI1 K;  4RG8 A;  4KHW A;  2AA4 A;  5BRF A;  2UYT A;  1OH6 A;  2ZE2 A;  3JXU A;  3K9J A;  3R9P A;  3IFR A;  1HMV A;  5HRO A;  2NUB A;  1CZA N;  5F1X A;  3PX6 A;  3ZEU B;  5KPT A;  4YOY A;  2F8S A;  4CJE A;  1J9A A;  3F9K A;  4KH5 A;  1TAQ A;  4CF0 A;  3KK2 A;  3VTH A;  3PSI A;  4X64 K;  3K59 A;  1EP4 A;  1TK5 A;  1T3V A;  4PQU A;  1VSL A;  5JLH A;  4HTL A;  2HHH K;  3R6M A;  1S9G A;  3J7Y P;  3JAM O;  3C7N A;  5SZT A;  5HRP A;  4JKA A;  4CF2 A;  4O5F A;  5BR8 K;  3VES A;  3SCX A;  4CJK A;  5C24 A;  4CHO A;  4KAZ A;  4DV6 K;  2HBL A;  4CED A;  4O55 A;  4I6M B;  4WCE L;  3SNN A;  5BN9 A;  1CZB A;  1SAZ A;  3O9R A;  3AO3 A;  3K9K A;  3MEE A;  3SYZ A;  4DSK A;  5DM6 L;  2EX3 A;  4H0T B;  3ATU A;  4O8K A;  2YNG A;  3ZSV A;  1W2B M;  4NXM K;  3ZT1 A;  4FLY A;  2OPP A;  3U3G A;  2FSJ A;  2HBK A;  1VSK A;  4OLB A;  4OJR A;  2Q1N A;  4JKH A;  3K2P A;  3WUH A;  3NMU A;  1DKG D;  2KW4 A;  1VSD A;  4IEI A;  4PKH A;  2BUP A;  3I33 A;  1LW0 A;  2KKZ A;  1GLD G;  1BA0 A;  2HBM A;  4LF9 K;  2IC3 A;  1Q86 O;  1I94 K;  1RT2 A;  1VQK N;  3F2K A;  1YUW A;  4K25 A;  4L3Q A;  3RRG A;  4X62 K;  3SUO A;  5AQQ A;  4DR2 K;  1NBW A;  4CEC A;  2OTJ N;  3TAB A;  4EP5 A;  3B6P A;  1RFQ A;  1WAJ A;  1R0A A;  4F8R A;  4J8F A;  3MCA B;  1X1P A;  2VCP A;  5AQX A;  1TUU A;  3QNN A;  3TSP A;  3TAE A;  4BRN A;  2ASP A;  5FLX O;  5JVG L;  4FJ5 A;  3EKU A;  4FJ8 A;  1S72 N;  3VEY A;  2ASM A;  1UOC A;  1FJG K;  4M3T A;  4WQ5 C;  4PUO A;  4W5R A;  1XC9 A;  2IAJ A;  5AR0 A;  5BN8 A;  5HL7 L;  3OBY A;  1RNH A;  4HWI A;  2KFZ A;  5D3G A;  2KLA A;  2A41 A;  1WAF A;  4JN4 A;  4LF6 K;  2QWO A;  3CCV N;  4NYN A;  3PV8 A;  1BA1 A;  1JLA A;  4IJN A;  1X9J A;  4JI8 K;  4FJI A;  1FXX A;  4JI2 K;  2BGG A;  3KHY A;  5CZ1 A;  2HHU A;  4CEA A;  1IG8 A;  3P39 A;  5AFU H;  3EO3 A;  4I2Q A;  2P9I A;  4FW2 A;  4KKO A;  3SAF A;  1ZBL A;  4JRQ A;  4ILH A;  4OKJ A;  3SV4 A;  4DMN A;  1Q82 O;  3G71 N;  2O8B B;  3SBT A;  4B8C A;  3AAR A;  3HL8 A;  1ITG A;  4FWL A;  1SL0 A;  4XIU A;  3L2W A;  4DSF A;  1GLA G;  1LAV A;  3O4Q A;  4XH1 A;  4N5S A;  3G6E N;  3KIO A;  4JEP A;  3AVH A;  4C1N K;  3U8X A;  4PA1 A;  3DOK A;  5I9E B;  2HVI A;  5AQI A;  4K41 A;  3PIO L;  3CPW M;  3FFI A;  4GVM A;  4CK3 A;  3CC7 N;  1NM1 A;  1TKT A;  3L3V A;  1YTU A;  4PKG A;  3PX4 A;  4FPB A;  4JK9 A;  4FW1 A;  1ZBU A;  4JK7 A;  3T19 A;  4C1N I;  1C0T A;  3KLI A;  3O5B A;  3NF8 A;  2ZJQ L;  1WN7 A;  2JWL A;  4LH5 A;  3QIO A;  3AO1 A;  2OZM A;  3VER A;  1GLB G;  2CGK A;  3K5O A;  4E7H A;  5AQO A;  3FR0 A;  4B9U A;  3D2E A;  1BIS A;  4A2B A;  2HVH A;  1HYV A;  1GLF O;  4CFB A;  4ELT A;  5EU7 A;  3VQ5 A;  1W7A A;  3E9P A;  4WQ4 C;  5BRH A;  1NU0 A;  1SV5 A;  1TV6 A;  4QS7 A;  2HHW A;  2FSK A;  3V9S A;  1CLQ A;  4X65 K;  4F2S A;  3ZLJ A;  3A5M C;  4BR0 A;  4FCY A;  1W9H A;  5EY4 A;  2QWL A;  4CJS A;  4IOC L;  3CC4 N;  4KTZ A;  4F3O A;  3NH2 A;  4CJV A;  4WF9 L;  4DHY A;  3AO4 A;  5BPM A;  4JKG A;  1QVF M;  1RT5 A;  2B5J A;  2FBV A;  4CEQ A;  3VF6 A;  2Z1H A;  3CET A;  3LZI A;  5AQT A;  3FZF A;  1EO1 A;  2B6A A;  4CIF A;  3LWL A;  4H5R A;  1NMD A;  4O5B A;  2F96 A;  4K0K K;  2YHB A;  4KRE A;  4FLW A;  3QLH A;  3L2Q A;  3JS6 A;  4CF8 A;  1A5V A;  4YOW A;  2H3G X;  1IG9 A;  4KH4 A;  1S22 A;  4K8X A;  4JV5 K;  1KAX A;  1O13 A;  1TK8 A;  3AO5 A;  3A0I X;  5J2P A;  2FF6 A;  1RT4 A;  3ZX0 A;  3T1H K;  2P9S A;  4B1V A;  4OO1 J;  1RBT A;  1T44 A;  4BRP A;  4H5T A;  4ISG A;  5B8H A;  5GAH P;  3NF7 A;  3O4W A;  3U4L A;  3BDP A;  4BC2 A;  1T03 A;  1B9D A;  5AQZ A;  3RR8 A;  4CHY A;  4LSN A;  4B9S A;  2HF4 A;  3H45 C;  3SUN A;  4IEE A;  3PY8 A;  4E1N A;  1LAW A;  3VEX A;  4IOX A;  3ULE B;  4OPK A;  2E6L A;  3CIP A;  4V19 S;  3K57 A;  2BAN A;  1J54 A;  4H0V B;  1TYQ B;  4BRE A;  1RT6 A;  2CGL A;  5KPZ A;  4NLB A;  2E2P A;  1VSE A;  2HW3 A;  3CCM N;  5BR9 A;  2QTD A;  5FRN A;  1WNS A;  5IT9 O;  2PYJ A;  1RDU A;  4CZL A;  4E3S A;  3UKU A;  1KVA A;  3VGK A;  4ZTJ A;  3HSC A;  3KVG A;  3L4I A;  2P9N B;  4FK0 A;  5M1K A;  1X3N A;  1U47 A;  1DGK N;  3HXM A;  1ATS A;  4CK1 A;  1X9S A;  4KHQ A;  3V9Z A;  4XEI A;  5M1Q A;  4BGB A;  1ZBI A;  1C1B A;  1SS6 A;  3ENO A;  3CFR A;  2HNY A;  4FWM A;  2NRZ A;  3THY B;  4UQG A;  3OYA A;  4DFJ A;  3F9M A;  3TSU A;  3ZX3 A;  1YT3 A;  3OBW A;  3HOT A;  4DQS A;  3KK3 A;  3DLR A;  3VTI A;  3L6Q A;  1JL1 A;  2OCE A;  4CJR A;  4CHP A;  2WBN A;  4B3T K;  3S3M A;  3I55 N;  4N76 A;  1D5A A;  1VSH A;  3LDQ A;  4DV0 K;  5AQN A;  3LDN A;  4IZ9 A;  3S41 A;  4M3X A;  4ILJ A;  1TAU A;  3OA9 A;  3HT3 A;  2X74 A;  4QOZ B;  3HTV A;  1SL2 A;  4Z4C A;  4YFU A;  4B1Y B;  4B9M A;  4MLH A;  2UU9 K;  1TKX A;  5C10 A;  3VA0 A;  3FFK B;  3CFO A;  2F9W A;  4PHT X;  3AA2 A;  4CGD A;  4DLE A;  2KQ2 A;  1M1K O;  3BZC A;  3A5O C;  3TI0 A;  1E4G T;  4C8N A;  3V6D A;  3G25 A;  1D4X A;  3DLE A;  3OHR A;  2XY6 A;  3H3O B;  3G0Z A;  5C42 A;  1LV5 A;  1NOY A;  5MLC Q;  1ZYQ A;  5E26 A;  1HNI A;  4I2P A;  5CYM A;  3HPH A;  3O9S A;  3HP6 A;  3VQA A;  2P9P B;  2P9L A;  5AQV A;  1JKH A;  4NCA A;  2IVO A;  4IO8 A;  3LPU A;  3K5N A;  4IFE A;  3AVA A;  4DTU A;  1VQ5 N;  4M3Z A;  4CEO A;  4FOI A;  4M7X A;  4FJN A;  5CHI A;  3SQ2 A;  3CJA A;  1YVN A;  1U6Z A;  3MXM A;  4JKC A;  3O4N A;  1VK0 A;  3EN9 A;  3ULD A;  1KTQ A;  4I7F A;  3RMA A;  1HLU A;  4W5O A;  4AQY K;  3DYA A;  2ZJP L;  4DKW A;  3CCR N;  1MDU B;  3V9U A;  4BVP A;  3QML A;  4F4K A;  2FBY A;  4YDU C;  3W0L A;  3V1R A;  2P9K A;  3AGR A;  1YIT N;  4DFM A;  2D0B A;  3NVM A;  4ISF A;  3KTQ A;  3OYE A;  2DFH A;  3EKS A;  4C8M A;  4BR2 A;  3HPG A;  4BY9 C;  1GLE G;  4H5N A;  3OYM A;  4CJU A;  1ZBH A;  2YJE A;  5EOY A;  3IAY A;  4PL8 A;  4DTM A;  3J7A P;  3SJH A;  1OVQ A;  1RT1 A;  3D45 A;  4B1Z A;  4B9V A;  3CM5 A;  5BPL A;  3CJ7 A;  3GBT A;  1N5Y A;  5M1N A;  4BC4 A;  4M41 A;  3SQ0 A;  3KJV A;  1A5X A;  3V9X A;  4GKK K;  3JSM A;  2B4J A;  4BQL A;  4FWQ A;  1KCF A;  1VSF A;  3RSE B;  4HUF A;  3HPO A;  2DPN A;  2JGU A;  3VQ4 A;  4CZI A;  4DG1 A;  4H0O A;  2P9I B;  4FJL A;  1NWK A;  4DV3 K;  3ZT3 A;  2RHK A;  2KTQ A;  4CFD A;  5FPE A;  2YCH A;  4BRC A;  1TKD A;  1NJZ A;  4IDH A;  4CD3 A;  1K8A O;  2UXD K;  3VQ8 A;  3AA4 A;  3HVT A;  1QSL A;  3A8Y A;  4YOU A;  4FJK A;  4CBU A;  1BL3 A;  2D4W A;  2YHW A;  5E41 A;  4U7B A;  5KPR A;  4DF4 A;  3B8A X;  4FZZ A;  2ASO A;  3CM6 A;  4H5V A;  4AH9 A;  1CXQ A;  4AM6 A;  2UXC K;  3HM9 A;  3CCQ N;  1YVU A;  3KLE A;  1W0H A;  4JI4 K;  3GDQ A;  3L2V A;  1QQM A;  1S6Q A;  1WSJ A;  3DMJ A;  4OPH A;  2BDP A;  1E3M A;  3VQD A;  3C6A A;  3D7E O;  4NB4 A;  3LP2 A;  2QWM A;  3NAE A;  3E9L A;  3DLG A;  1Z26 A;  4FWN A;  2P5G A;  3WEE A;  1Q9X A;  2Y1J A;  4DS5 A;  4FZX C;  1QVG M;  4KB0 A;  3THX A;  1TVR A;  3MEC A;  4BRH A;  2RPI A;  2YKM A;  4AHC A;  3AV9 A;  5I42 A;  4CEF A;  5CR4 A;  1NK9 A;  2E20 A;  3RTV A;  1NGI A;  4GNI A;  2ZGY A;  4NCG A;  4E7L A;  5EX5 A;  4YNQ A;  1KC8 O;  1FW6 A;  4Q0B A;  1RIL A;  2P9L B;  2P9P A;  5HLF A;  2D0C A;  4F2R A;  1IO2 A;  1LW2 A;  2HST A;  3BP8 A;  1K73 O;  5AQM A;  5AQU A;  4CZF A;  4IKF A;  3MXJ A;  3M8R A;  3LP3 A;  1YIJ N;  4FYD A;  2VQF K;  3IS9 A;  2A6A A;  3M6G A;  3V81 A;  4CBX A;  5LL6 Z;  1YTA A;  1RBR A;  3AVN A;  3D2F B;  3MN5 A;  3MAQ A;  3PLA A;  1QQO A;  2I7N A;  4A57 A;  4A61 A;  3AVM A;  2CH5 A;  3DWL A;  3ZET B;  4Q5V A;  1Q18 A;  1QHT A;  4DQ8 A;  1JLG A;  4E0D A;  4HTU A;  5CZ2 A;  3TWH A;  3G10 A;  2O8F A;  2OPQ A;  3HYF A;  4BGA A;  3WQU A;  4PWD A;  3LDS A;  1T05 A;  4B08 A;  2E2N A;  3TU5 A;  1NK7 A;  1RTH A;  2E1Y A;  3BUZ B;  3P38 A;  1NJW A;  1TUY A;  4MDB A;  5GIO A;  5JLF A;  4CZE A;  2AP1 A;  2QI2 A;  1XHX A;  2IGI A;  4J2A A;  5GAG P;  1D9F A;  5KGX A;  3O9Q A;  4AF1 A;  2QEX N;  1VAZ A;  3AGK A;  4M63 C;  4MDA A;  2G8H A;  1NKC A;  3O08 A;  4BRF A;  4JS5 A;  3THY A;  5SWM A;  3SV3 A;  4MO4 A;  4CZH A;  3J80 O;  3VGL A;  3TAP A;  3O3G A;  1NK0 A;  3H6E A;  2O8D A;  2ATQ A;  3K5M A;  2QA4 N;  3P1G A;  1BIU A;  4R79 A;  4BWM A;  1NKB A;  2VWB A;  4MFB A;  2V51 B;  4F3T A;  1Y97 A;  4ZTF A;  3CCJ N;  2DY4 A;  1NK5 A;  4H5W A;  4CGJ A;  4JKE A;  3DLK A;  1KQS M;  2CH6 A;  3CJC A;  4A62 A;  3ZEU A;  4E1J A;  1NGF A;  1RDB A;  3ZT4 A;  2O8E B;  1BUP A;  1IKX A;  4BE2 A;  3V4I A;  4B1U B;  3QFU A;  1K9M O;  4LY7 A;  3LDL A;  3DLB A;  5AQL A;  3MEG A;  3KK1 A;  3SJJ A;  4CIE A;  2OZS A;  3H3N O;  4H03 B;  5HRR A;  4DQP A;  3OYD A;  3G4S N;  2ZM6 K;  4FSV A;  1KFS A;  1VRT A;  2PBD A;  3WNG A;  3LWM A;  3VQB A;  3NGI A;  2PYL A;  4WFB L;  2DFE A;  2VWK A;  4JHD A;  3S9H A;  4DR5 K;  3J8A A;  1JXB A;  4EAH D;  4B1X B;  2Y1I A;  3L2U A;  3NH1 A;  3LDP A;  1HKC A;  1J53 A;  4CJQ A;  5JMV A;  3KD1 E;  3HO1 A;  3SPY A;  3HZ6 A;  3WXK A;  4KO0 A;  3DXM B;  1T7P A;  3O1B A;  3OYG A;  5AZI A;  4CER A;  2Z1I A;  3MXI A;  1GOA A;  2HHT A;  3ZX2 A;  3FLC O;  2XRI A;  3NGY A;  1T6C A;  4DU4 A;  1NGG A;  2YV0 X;  5A2Q O;  1HNW K;  4R5P A;  5J1E A;  5AQP A;  2G8K A;  1HUX A;  3QEX A;  2RN2 A;  2YKN A;  1JLC A;  4FJH A;  2G8F A;  2X6N A;  1WSG A;  2QW9 A;  3CMA N;  1Q9Y A;  1GLJ O;  4FLT A;  5FPM A;  4N47 A;  1N34 K;  3WNE A;  1SKR A;  1HNV A;  3ZSO A;  1NNE A;  4CJ5 A;  5LJV A;  4RW6 A;  2G8V A;  3WXL A;  1X9M A;  4JKB A;  4BG9 A;  2OTL N;  3K58 A;  2GWJ A;  1Z6R A;  4IFY A;  3I56 N;  5M1P A;  1HYZ A;  2QKB A;  2ZD1 A;  2P9N A;  4CEE A;  3CJ1 A;  5HRN A;  3EEQ A;  3AO2 A;  5ADX A;  1C1C A;  1E4F T;  4ZHR A;  2ZGZ A;  3NF6 A;  4CEB A;  5BPN A;  2BE2 A;  4O4G A;  3LZJ A;  2OAN A;  3EYZ A;  4FLV A;  1ILY A;  1MWM A;  1TYQ A;  4JAX A;  1YXQ A;  1C0F A;  3PIP L;  4DV4 K;  4HHT A;  2HF3 A;  3MED A;  4M42 A;  4QAG A;  4XH4 A;  3LM2 A;  3WXI A;  2FBX A;  3AAP A;  1B9F A;  1GOB A;  3QDK A;  4E7K A;  3ENB A;  4MQ3 A;  3ULE A;  5EXW A;  3O1W A;  4O0J A;  1JCF A;  1P8Z A;  1TKZ A;  1B92 A;  4FPA A;  2V7Y A;  4ILG B;  4HUG A;  3C0B A;  4JI3 K;  1U49 A;  3KWG A;  4BVO A;  5LMU K;  3V9W A;  2QWR A;  4BAC A;  2NLX A;  3NBP A;  1IKV A;  3C6H A;  4FWR A;  1QSY A;  3MX5 A;  3QEP A;  2ZQB A;  4B9T A;  4N41 A;  2I7P A;  1GLC G;  4LFA K;  4BR4 A;  4K42 A;  4JK8 A;  4LF7 K;  3ZT2 A;  4OKE A;  1IBK K;  4O44 A;  2QWQ A;  3OYC A;  1YF5 L;  1UWB A;  3L3U A;  2XY7 A;  4FO0 A;  3CQ8 A;  3O6W A;  4BWJ A;  2RKI A;  1RBV A;  4KI6 A;  5JS1 A;  3CJB A;  4Z4F A;  4E89 A;  2HHS A;  3OYH A;  1VSJ A;  3AVK A;  3CHW A;  4MLE A;  1ASU A;  5HBM A;  3E01 A;  5KQ8 A;  1BI4 B;  4PL7 A;  5CE3 A;  4KHS A;  1NGC A;  4XH5 A;  5DK5 A;  2FXU A;  3P83 D;  3WEE B;  2D0A A;  1KVC A;  4CZK A;  4W5T A;  5J2N A;  3OS1 A;  3OYJ A;  3VQE A;  3THW B;  1QSS A;  1RDC A;  2WC9 A;  4Y0W A;  2GUI A;  3DLL L;  2IIR A;  4KFB A;  3E9O A;  3LPT A;  3AA5 X;  1BO5 O;  3V1Q A;  4J2D A;  3TPQ A;  2YNI A;  1N36 K;  4Y1C A;  5TKY A;  3HM8 A;  1T6D A;  3TAF A;  1VQL N;  5AZJ B;  3VPZ A;  2QWN A;  2X6S A;  3AY9 A;  4BRM A;  1FKP A;  3TAR A;  4JLH A;  1FKO A;  4BRG A;  4K8Z A;  3IUC A;  3MWT A;  4BDP A;  5CY4 A;  4KHN A;  1WSE A;  1SQK A;  1KAZ A;  2KZM A;  3ZSQ A;  3JYT A;  1S1V A;  5FPN A;  4DV2 K;  3P31 A;  3FZH A;  4DCH A;  4FK4 A;  3NF9 A;  1KFD A;  4FWK A;  3E1Y A;  3PX0 A;  2RE2 A;  3RMC A;  3OY9 A;  4LSL A;  1GOC A;  4BR5 A;  2E8A A;  3K5L A;  3CCS N;  3SUP A;  1EWR A;  1FK9 A;  3SBG A;  3VN5 A;  4DR3 K;  1Q8I A;  2D5R A;  5K14 A;  2YI1 A;  3LM9 A;  4FLX A;  1VHX A;  3ITH A;  3FE1 A;  2A3Z A;  3CCE N;  2F7T A;  5AJ3 K;  2V52 B;  2GTD A;  3DRS A;  3KWI A;  1WB9 A;  3M8Q A;  1NGH A;  4IFV A;  4CFA A;  4JKF A;  5I3U A;  3IRX A;  3KKS A;  3ZSY A;  5C2D A;  2PY5 A;  2GX9 A;  3UKR B;  4DR1 K;  1KVB A;  3NDK A;  1QZ5 A;  3MN6 A;  2YJF A;  4GV6 A;  1LWF A;  4JI7 K;  4LH4 A;  4DV1 K;  4Z4I A;  2W42 A;  4OLA A;  4JKG B;  4DU3 A;  3VGM A;  4AHR A;  4BDY A;  2E5L K;  1QTM A;  4JD2 B;  1EQY A;  1W97 L;  3UKR A;  5KQD A;  3R8E A;  2KFN A;  4E19 A;  4DTJ A;  3OW2 M;  4H0P A;  1NJI O;  1WOQ A;  1EWQ A;  4B3S K;  1C0U A;  3J81 O;  3TSQ A;  3AVG A;  1C0G A;  4FK2 A;  2NRX A;  2DTU A;  2Z1G A;  4YOR A;  2O8F B;  3EY1 A;  2ITM A;  3OYK A;  2GBZ A;  3N4P A;  4CK2 A;  5M1F A;  2A1S A;  2UUA K;  4DSJ A;  3IDH A;  4CJ4 A;  3SPZ A;  4KV8 A;  4B3O A;  3DJC A;  2PZS A;  1KD1 O;  1U48 A;  2O8D B;  2PFU A;  3NH0 A;  4DQR A;  5E84 A;  1KRP A;  3CPE A;  1IBM K;  3QIP A;  1RT7 A;  1SZ2 A;  1H1V A;  1VQP N;  4QCL A;  4CJW A;  4DR6 K;  1JJ2 M;  2IOC A;  3QIN A;  3GOI A;  3J7Z O;  1EET A;  3TR8 A;  4GV3 A;  3ZSW A;  4O0I A;  3BF3 A;  1VQ7 N;  3QBW A;  2VGN A;  1XWL A;  1U2V A;  1D8Y A;  2PAV A;  2CGJ A;  1EXQ A;  3OYI A;  4DR7 K;  3MMV A;  3R1X A;  1IV0 A;  4A5A A;  3DRR A;  4ID5 A;  3R3L A;  3RMB A;  4BRL A;  4KHY A;  4AHT A;  3V1O A;  3SLC A;  1J5E K;  2DFF A;  4LF4 K;  5GIN A;  1BCM A;  3F73 A;  2NZT A;  1SKS A;  4NCB A;  1KXP A;  3GL1 A;  4FLU A;  3CME N;  1T8E A;  3ASM A;  1BI4 A;  1HX1 A;  4B1W B;  5HOO A;  3MK6 A;  2WUS A;  1KLM A;  1HPM A;  1C1A A;  3LAM A;  2ZF5 O;  3OYL A;  3VMF B;  4GV9 A;  5LY3 A;  3DLH A;  4EFH A;  4CHZ A;  3I0S A;  2Q31 A;  3B6O A;  2XO7 A;  3DM2 A;  3TTF A;  3QEI A;  5AZJ A;  1HPZ A;  5DMR A;  3CG7 A;  3H46 O;  1QQC A;  2GUP A;  3BF1 A;  2NRW A;  2FSN A;  3PUF A;  1D9D A;  4YOV A;  4WFN L;  3ID8 A;  4DTP A;  1ESV A;  4OPJ A;  2EHG A;  2UUB K;  2E88 A;  1DLO A;  2E2Q A;  4F9O A;  3SMP A;  4Z4G A;  2HNZ A;  4KB1 A;  1JLQ A;  2VWJ A;  3VF2 A;  2WOM A;  1SL1 A;  1NGE A;  4A2A A;  4BRO A;  3DI6 A;  3H1V X;  3GE1 A;  5F2R A;  1V4T A;  4YY3 K;  4CJ7 A;  1HQU A;  3AVJ A;  3QBX A;  5BRD A;  1LWE A;  3D6R A;  3WNH A;  4WQ4 A;  4DLG A;  1O1W A;  1NMN A;  2VYP A;  5C12 A;  1ZC6 A;  3THV A;  3L2R A;  3Q7C A;  5AQH A;  1RCH A;  4DTO A;  3MX2 A;  3U9D A;  3HI0 A;  2QXL A;  3T3F A;  3EZ5 A;  4CW7 B;  5M1O A;  4CJT A;  3AVB A;  2A1R A;  1V4S A;  1N6Q A;  4C8O A;  1Q7Y O;  3OJU A;  1KAY A;  4DFK A;  2FC0 A;  5JS2 A;  4EZ6 A;  3UB5 A;  4JRP A;  3U6F A;  1VSI A;  2ETJ A;  1ZBS A;  4C8K A;  2O8B A;  3VQC A;  5GAD P;  3HRG A;  3VOV A;  2G8U A;  4FJ7 A;  4KTW A;  3T1Y K;  3VQ7 A;  2UUC K;  3F5T A;  2NRR A;  4CZJ A;  3HVR A;  4YOT A;  2Q0R A;  1KLN A;  4OGE A;  5AQF A;  1ASV A;  1YI2 N;  2E4L A;  3L8B A;  1JCG A;  1DTQ A;  4JI0 K;  2G8I A;  3M8P A;  1G15 A;  5AQW A;  3QB0 A;  4DUY K;  3NVK A;  3IKM A;  4DV7 K;  4HCB A;  1P90 A;  4WFA L;  4FXD A;  4CGI A;  4RW4 A;  5IWA K;  2BTF A;  1L3U A;  4NXN K;  3MN9 A;  1F21 A;  1C6V A;  5C0Y A;  3CYM A;  3EZW A;  4BQZ A;  3S3N A;  3P4I A;  3P5J A;  2GV9 A;  4CZG A;  3SUQ A;  4JS4 A;  2ITG A;  1GLL O;  4WYB A;  5CYQ A;  5J2M A;  1L3T A;  4Z4H A;  5KTQ A;  4BRD A;  3THW A;  4JYA K;  2WFB A;  4HCC A;  1RGI A;  3AAQ A;  5ADX H;  2Z1J A;  4LF8 K;  4YDU A;  3ZSR A;  1RBU A;  3RRH A;  3IMX A;  2F9T A;  2O4G A;  1SKW A;  1U45 A;  5KRS A;  4OPA A;  1VQN N;  4LD0 A;  4E7J A;  4JHD B;  1G99 A;  2I5J A;  2OA8 A;  5J2Q A;  4Z0U A;  1QZ6 A;  4FOE A;  4BG8 A;  4BRI A;  4DF8 A;  1OH5 A;  1I3A A;  3PO4 A;  3ALY A;  3QFP A;  1C0M A;  1VRU A;  4BRA A;  1RTD A;  2VGM A;  3CD6 N;  3OS0 A;  5T7B A;  3C65 A;  3O9T A;  2P51 A;  3SQ4 A;  1MU2 A;  1N33 K;  5KRT A;  2HHQ A;  4RCH A;  3L0Q A;  3K0S A;  4B3R K;  3SZ2 A;  1VQ6 N;  3C6T A;  2EWS A;  1M90 O;  3DXM A;  3DAW A;  4CJF A;  4Y1D A;  4B9L A;  4CHN A;  2YX6 A;  3O80 A;  1VQ8 N;  4LFC K;  3WXM B;  1JLF A;  1NGA A;  3NE6 A;  4B3M K;  2KZZ A;  5ELZ A;  2P9U A;  4EHU A;  2X78 A;  5FPD A;  3RR7 A;  3BEX A;  2GWK A;  4DSL A;  3W3D A;  3DOL A;  3D0P A;  1JCE A;  4L8R B;  3LAL A;  3QIC A;  5AQY A;  2VG6 A;  1HKG A;  3UE5 A;  1HQE A;  4IXC A;  2XY5 A;  1J6Z A;  5EVZ A;  2W6K A;  1XI1 A;  1IH7 A;  3CXC M;  1QQN A; 
#chains in the Genus database with same CATH homology
 4I9L A;  3OYH A;  1S6P A;  4CE9 A;  3SQ2 A;  4FJN A;  1TL3 A;  1VSJ A;  3AVK A;  2XY8 A;  4RW8 A;  1S9E A;  1U04 A;  3MXM A;  4FM2 A;  1BHL A;  3O4N A;  1ASU A;  1VK0 A;  5HBM A;  3E01 A;  2YHA A;  4RG8 A;  4KHW A;  1BI4 B;  2ZE2 A;  3ULD A;  4KHS A;  5FRM A;  1KTQ A;  4I7F A;  5DK5 A;  3RMA A;  4FJ9 A;  4W5O A;  2IS3 A;  3P83 D;  2YNH A;  2D0A A;  3DYA A;  4WE1 A;  1HMV A;  5HRO A;  2VG7 A;  1KVC A;  4W5T A;  1RTJ A;  2NUB A;  3OS1 A;  3OYJ A;  5J2N A;  3VQE A;  3V9U A;  1QSS A;  3PX6 A;  3OYN A;  1QE1 A;  1RDC A;  4F4K A;  3HK2 A;  2GUI A;  2FBY A;  1S1W A;  2Q3S A;  2OPS A;  2G8W A;  2F8S A;  3V1R A;  4CJE A;  1J9A A;  3F9K A;  1TAQ A;  4CF0 A;  4KFB A;  4DFM A;  2D0B A;  3KK2 A;  3LPT A;  3KTQ A;  2IDO A;  1QS4 A;  3AA5 X;  3K59 A;  1EP4 A;  3OYE A;  3OJS A;  2DFH A;  1TK5 A;  3V1Q A;  4C8M A;  4J2D A;  3HPG A;  1BQN A;  4PQU A;  1VSL A;  2YNI A;  4CJU A;  3OYM A;  4FM1 A;  1ZBH A;  1S9G A;  4Y1C A;  3IAY A;  1IKY A;  4AHS A;  5SZT A;  5HRP A;  1BIZ A;  3TAF A;  4CF2 A;  4DTM A;  1RT1 A;  2X6S A;  3D45 A;  4TSX A;  3SCX A;  4CJK A;  4B9V A;  4CCH A;  3CM5 A;  5C24 A;  1BQM A;  1FKP A;  2OPR A;  4CHO A;  4N56 A;  4KAZ A;  3TAR A;  4IDK A;  3M8S A;  4H8K A;  4JLH A;  1FKO A;  4CED A;  1N5Y A;  4K8Z A;  4O55 A;  3SNN A;  3S3O A;  4M41 A;  3SQ0 A;  3KJV A;  1CZB A;  1A5X A;  3V9X A;  4I9Q A;  3AO3 A;  4BDP A;  5CY4 A;  3MEE A;  3JSM A;  2B4J A;  3SYZ A;  4DSK A;  3RMD A;  2EX3 A;  4KHN A;  1WSE A;  1KCF A;  4CIG A;  2YNG A;  3ZSV A;  2KZM A;  1VSF A;  3ZSQ A;  3JYT A;  4HUF A;  1S1V A;  3HPO A;  2JGU A;  3KKR A;  4FK4 A;  3ZT1 A;  3VQ4 A;  4FLY A;  2OPP A;  3U3G A;  3ZSZ A;  1JXE A;  4DG1 A;  1VSK A;  4OLB A;  4OJR A;  3WNF A;  4CEZ A;  3NF9 A;  1KFD A;  4FJL A;  3VA3 A;  3K2P A;  3PX0 A;  4OGC A;  3RMC A;  3OY9 A;  2KW4 A;  4LSL A;  1VSD A;  3ZT3 A;  1GOC A;  2KTQ A;  3K5L A;  3LP1 A;  3SUP A;  5HP1 A;  4CFD A;  1TKD A;  2AJQ A;  1FK9 A;  1NJZ A;  3VN5 A;  1LW0 A;  1Q8I A;  2D5R A;  5K14 A;  3AA3 A;  3VQ8 A;  2IC3 A;  3AA4 A;  1CZ9 A;  3HVT A;  4FLX A;  4W5Q A;  3ITH A;  2R7Y A;  1RT2 A;  1QSL A;  4M3W A;  3DRS A;  2G8U A;  3LP0 A;  3NCI A;  3ZCM A;  3M8Q A;  4FJK A;  3RRG A;  4IFV A;  1IKW A;  4CFA A;  3SUO A;  5I3U A;  4H4O A;  3IRX A;  4CEC A;  3KKS A;  3ZSY A;  1VSM A;  1BL3 A;  3TAB A;  4EP5 A;  4G1Q A;  3B6P A;  2PY5 A;  1BCO A;  5E41 A;  1WAJ A;  1R0A A;  4DF4 A;  4F8R A;  1KVB A;  4FZZ A;  5KI6 A;  3CM6 A;  4AH9 A;  3NDK A;  1CXQ A;  1X1P A;  4BDZ A;  1UA0 A;  3PO5 A;  3HM9 A;  1LWF A;  3HP9 A;  1YVU A;  3KLE A;  1JLB A;  1W0H A;  3ISN C;  2QKK A;  3QNN A;  3TAE A;  3L2V A;  1S6Q A;  1WSJ A;  3DMJ A;  4LH4 A;  4Z4I A;  2BDP A;  2W42 A;  1S5J A;  3VQD A;  4FJ5 A;  4FJ8 A;  4OLA A;  3LP2 A;  3NAE A;  2P5O A;  3QEV A;  4DU3 A;  1UOC A;  4AHR A;  4BDY A;  4M3T A;  3DLG A;  1Z26 A;  1QTM A;  2P5G A;  4PUO A;  2F8T A;  4W5R A;  1Q9X A;  1XC9 A;  2IAJ A;  2Y1J A;  2KFN A;  4HUE A;  4E19 A;  4DTJ A;  2HHX A;  4DS5 A;  4M45 A;  4FZX C;  4IG3 A;  3OVN A;  1SUQ A;  4B8A B;  4KB0 A;  1S1U A;  1RNH A;  3DRP A;  2KFZ A;  1TVR A;  3MEC A;  4DS4 A;  5D3G A;  1C0U A;  1WLJ A;  2RPI A;  1WAF A;  2YKM A;  4AHC A;  3LAN A;  3VQQ A;  4E1M A;  4NYN A;  3PV8 A;  3AVG A;  3AV9 A;  5I42 A;  4FK2 A;  1HRH A;  4CEF A;  1JLA A;  2Z1G A;  1NK9 A;  2DTU A;  4FJI A;  3EY1 A;  1WSF A;  3RTV A;  3OYK A;  1FXX A;  2GBZ A;  2BGG A;  4NCG A;  5CZ1 A;  4CK2 A;  4CHQ A;  3O3F A;  2HHU A;  4E7L A;  2A1S A;  2RF2 A;  4CEA A;  4YNQ A;  1NKE A;  1J5O A;  4DSJ A;  4Q0B A;  1ASW A;  4CJ4 A;  4I2Q A;  3SPZ A;  1RIL A;  4KV8 A;  4B3O A;  4F2R A;  5HLF A;  2PZS A;  2D0C A;  1IO2 A;  1LW2 A;  1U48 A;  3NH0 A;  4DQR A;  1UAX A;  4FW2 A;  4KKO A;  1KRP A;  2JLE A;  1ZBL A;  4JRQ A;  3QIP A;  4OKJ A;  3MXJ A;  1RT7 A;  3M8R A;  3SV4 A;  3LP3 A;  4DMN A;  4IKF A;  4FYD A;  4B8C A;  4QCL A;  4CJW A;  4BE0 A;  1RT3 A;  3HL8 A;  1ITG A;  2IOC A;  3KLH A;  3IS9 A;  1SL0 A;  3QIN A;  3V81 A;  4CF9 A;  4XIU A;  1EET A;  1YTA A;  3TR8 A;  3L2W A;  4DSF A;  1NK4 A;  3ZSW A;  4BE1 A;  2WON A;  3AVF A;  1JL2 A;  1LAV A;  1RBR A;  3O4Q A;  4O0I A;  4N5S A;  3CFP A;  3AVN A;  3KIO A;  4CJ3 A;  3AVH A;  3MAQ A;  3QNO A;  4PA1 A;  3DOK A;  1RDD A;  2HVI A;  1XWL A;  1D8Y A;  3KLG A;  3FFI A;  4GVM A;  4CK3 A;  2HHV A;  3OYI A;  1EXQ A;  3AVM A;  1TKT A;  3L3V A;  1YTU A;  4B9N A;  3DRR A;  3PX4 A;  4Q5V A;  1QHT A;  4FW1 A;  4ID5 A;  4AHU A;  3ZSX A;  1JLG A;  1ZBU A;  4CJL A;  3RMB A;  2OYQ A;  4KHY A;  4AHT A;  3T19 A;  3V1O A;  1C0T A;  3KLI A;  4E0D A;  4HTU A;  5CZ2 A;  3TWH A;  3G10 A;  3NF8 A;  4EZ9 A;  2OPQ A;  1WN7 A;  2DFF A;  1ZBF A;  4LH5 A;  3HYF A;  5C25 A;  4PWD A;  3LDS A;  4W5N A;  1T05 A;  1BCM A;  3AO1 A;  3QIO A;  4B08 A;  3F73 A;  2OZM A;  2LSN A;  4FJG A;  1NK7 A;  3AVC A;  1SKS A;  1RTH A;  1NJX A;  4NCB A;  3K5O A;  4OVL A;  4E7H A;  1TGO A;  4CJP A;  4FLU A;  1L5U A;  1NJW A;  4B9U A;  1T8E A;  1BIS A;  1BI4 A;  1RTI A;  1HYV A;  3ASM A;  2HVH A;  3C95 A;  1XHX A;  2IGI A;  4J2A A;  3AVL A;  1HYS A;  2O4I A;  4CFB A;  1D9F A;  5KGX A;  1WSI A;  3NHG A;  4ELT A;  4M3R A;  4EP4 A;  1KLM A;  2G8H A;  5EU7 A;  1NKC A;  4ELV A;  3LAM A;  1C1A A;  3VQ5 A;  4JS5 A;  3OYL A;  3DLH A;  5SWM A;  3SV3 A;  1WSH A;  4DSI A;  1SV5 A;  1TV6 A;  3I0S A;  4CHZ A;  3TAP A;  2HHW A;  3B6O A;  3O3G A;  2XO7 A;  3DM2 A;  3V9S A;  3QEI A;  4CFC A;  1HPZ A;  5DMR A;  3CG7 A;  1NK0 A;  1CLQ A;  1QQC A;  4F2S A;  4CF1 A;  3QET A;  3OS2 A;  2ATQ A;  4ELU A;  3K5M A;  4FCY A;  3PUF A;  3P1G A;  1BIU A;  1W9H A;  3VQ6 A;  4BWM A;  4CJS A;  1NKB A;  1D9D A;  4DTN A;  4KTZ A;  4MFB A;  4F3O A;  3NH2 A;  4CJV A;  4FLZ A;  4F3T A;  1Y97 A;  4DTP A;  3AO4 A;  3QER A;  4ZTF A;  2DY4 A;  1NK5 A;  1REV A;  4DQQ A;  4KTQ A;  4OPJ A;  2EHG A;  1RT5 A;  2B5J A;  4CGJ A;  3DLK A;  3I0R A;  1Z25 A;  1DLO A;  2FBV A;  4CEQ A;  4Z4E A;  2Z1H A;  3LZI A;  5KGW A;  4Z4G A;  2B6A A;  2HNZ A;  2FBT A;  4CIF A;  1NOZ A;  4KB1 A;  3LWL A;  1RDB A;  1JLQ A;  4O5B A;  3ZT4 A;  2VWJ A;  2F96 A;  4NYF A;  2WOM A;  1SL1 A;  2YHB A;  1KSP A;  4KRE A;  1IKX A;  4FLW A;  3QLH A;  3L2Q A;  4BE2 A;  3V4I A;  4CF8 A;  1A5V A;  1IG9 A;  3VQP A;  4LY7 A;  3T1A A;  3DI6 A;  2HMI A;  2YNF A;  1RDA A;  3DLB A;  4RW7 A;  4K8X A;  3MEG A;  1HQU A;  3BGR A;  4CIE A;  3KK1 A;  2QXF A;  3AVJ A;  3SJJ A;  1TK8 A;  1LWE A;  2OZS A;  3AO5 A;  3WNH A;  4KI4 A;  4DLG A;  1O1W A;  1NJY A;  5HRR A;  4DQP A;  5J2P A;  3OYD A;  1RT4 A;  3THV A;  3L2R A;  1KFS A;  1VRT A;  3LWM A;  3WNG A;  3VQB A;  3NGI A;  1RCH A;  2E6M A;  2PYL A;  1RBT A;  4DTO A;  2VG5 A;  2QK9 A;  4IG0 A;  2HND A;  3T3F A;  2DFE A;  2VWK A;  3EZ5 A;  3UIQ A;  4CJT A;  3S9H A;  3AVB A;  2A1R A;  4KPY A;  1JXB A;  3NF7 A;  1JLE A;  1N6Q A;  3BDP A;  4DWI A;  1T03 A;  1B9D A;  2Y1I A;  5HRS A;  4FJJ A;  3L2U A;  4C8O A;  3RR8 A;  4CHY A;  3NH1 A;  4AIL C;  1K6Y A;  4LSN A;  3OJU A;  4B9S A;  1J53 A;  4CJQ A;  3TAG A;  3SUN A;  3PY8 A;  3KD1 E;  3ZT0 A;  4E1N A;  2FC0 A;  4ICL A;  5JS2 A;  1LAW A;  4DTS A;  4DFK A;  4EZ6 A;  3HO1 A;  2HHT A;  3SPY A;  1S1T A;  1LWC A;  4JRP A;  4KO0 A;  3U6F A;  4FZY A;  1VSI A;  1T7P A;  2ETJ A;  3OYG A;  4C8K A;  4OPK A;  1X9W A;  3VQC A;  4CER A;  2Z1I A;  2E6L A;  4CGF A;  1GOA A;  4CGG A;  1EX4 A;  3C6U A;  3K57 A;  3MXI A;  3KD5 E;  4FJ7 A;  4KTW A;  2XRI A;  1S1X A;  3NGY A;  2BAN A;  3VQ7 A;  4DU4 A;  1J54 A;  3HVR A;  3OYF A;  3OYB A;  2YV0 X;  1KLN A;  4OGE A;  4H4M A;  1RT6 A;  4R5P A;  5J1E A;  1ASV A;  1I39 A;  3NGZ A;  2E4L A;  2G8K A;  3L8B A;  3QEW A;  3QEX A;  1DTQ A;  2G8I A;  2RN2 A;  3M8P A;  2YKN A;  1G15 A;  1JLC A;  1VSE A;  4HVJ A;  4FJH A;  2HW3 A;  2G8F A;  2X6N A;  1WSG A;  3SQ1 A;  4HCB A;  4M3Y A;  1NK6 A;  4GW6 A;  4OKK A;  5FRN A;  1Q9Y A;  4FLT A;  1WNS A;  4GMJ B;  4N47 A;  3WNE A;  1SKR A;  2PYJ A;  1HNV A;  3ZSO A;  4FXD A;  4CGI A;  4CJ5 A;  3H08 A;  4E3S A;  1KVA A;  4ZTJ A;  4RW4 A;  4RW6 A;  4DFP A;  2G8V A;  4RW9 A;  1X9M A;  1L3U A;  4C8L A;  1F21 A;  2HB5 A;  3K58 A;  1C6V A;  3TAQ A;  4FK0 A;  4DTR A;  4IFY A;  3KLF A;  1U47 A;  1HYZ A;  3CYM A;  3VQ9 A;  3HXM A;  2XHB A;  2QKB A;  4CK1 A;  1X9S A;  2ZD1 A;  4CEE A;  3S3N A;  4KHQ A;  3P5J A;  3V9Z A;  1UA1 A;  2GV9 A;  5HRN A;  3SUQ A;  4JS4 A;  2ITG A;  3AO2 A;  1ZBI A;  5CYQ A;  4FJM A;  5J2M A;  1C1B A;  1C1C A;  4ZHR A;  3CFR A;  3NF6 A;  4Z4H A;  2HNY A;  1RBS A;  5KTQ A;  3LAK A;  3TAN A;  1L3T A;  4DQI A;  4UQG A;  3SI6 A;  5FDL A;  4CEB A;  3OYA A;  4DFJ A;  4HCC A;  1YT3 A;  2BE2 A;  4DQS A;  4O4G A;  3LZJ A;  3KK3 A;  2Z1J A;  3HST B;  3DLR A;  3AVI A;  3EYZ A;  1JL1 A;  4FLV A;  3ZSR A;  1RBU A;  4CJR A;  3RRH A;  3IG1 A;  4CHP A;  3U3Y A;  4FM0 A;  4CES A;  2O4G A;  4J2E A;  4AHV A;  4HHT A;  1SKW A;  1U45 A;  3S3M A;  5KRS A;  3MED A;  1D5A A;  4N76 A;  4QAG A;  4LD0 A;  4E7J A;  4M42 A;  1VSH A;  2I5J A;  2FBX A;  5J2Q A;  1U4B A;  4Z0U A;  2OA8 A;  1B9F A;  1GOB A;  4E7K A;  1L3V A;  4MQ3 A;  4DF8 A;  4O0J A;  4M3X A;  1I3A A;  1TAU A;  4QOZ B;  3HT3 A;  2X74 A;  3ALY A;  3PO4 A;  1C0M A;  1TKZ A;  1EKE A;  1B92 A;  1VRU A;  4HUG A;  1RTD A;  4M3U A;  1U49 A;  1SL2 A;  4Z4C A;  1TL1 A;  4YFU A;  3OS0 A;  4B9M A;  5T7B A;  1TKX A;  3V9W A;  3VA0 A;  2P51 A;  3SQ4 A;  3CFO A;  4DU1 A;  1MU2 A;  4BAC A;  5KRT A;  3RWU A;  3NBP A;  1IKV A;  3NFA A;  2HHQ A;  3AA2 A;  1QSY A;  4CGD A;  1CXU A;  4DLE A;  3SZ2 A;  3QES A;  2KQ2 A;  4B9T A;  3QEP A;  2ZQB A;  4N41 A;  4DTX A;  3TI0 A;  4FJX A;  1L3S A;  4C8N A;  3C6T A;  3A2F A;  3V6D A;  4CJF A;  4Y1D A;  3TAM A;  3DLE A;  4B9L A;  4CHN A;  2XY6 A;  1XHZ A;  3ZT2 A;  3QO9 A;  4OKE A;  4IBN A;  1HJR A;  3G0Z A;  1JLF A;  5C42 A;  1LV5 A;  3HJF A;  4KRF A;  1NOY A;  3NE6 A;  1ZYQ A;  4O44 A;  1HNI A;  2KZZ A;  4I2P A;  5CYM A;  3O3H A;  3HPH A;  2X78 A;  3OYC A;  3RR7 A;  3I8D A;  4KHU A;  1UWB A;  4DSL A;  3HP6 A;  3DOL A;  3VQA A;  5FRO A;  4CGH A;  3D0P A;  1JKH A;  3L3U A;  4L8R B;  3LAL A;  2P1J A;  2XY7 A;  2VG6 A;  1NK8 A;  3CQ8 A;  4NCA A;  1HQE A;  4BWJ A;  4E7I A;  4FVM A;  2RKI A;  2XY5 A;  1RBV A;  3LPU A;  3K5N A;  1TK0 A;  4KI6 A;  1XI1 A;  1A5W A;  5JS1 A;  1DTT A;  3C94 A;  4J2B A;  1BGX T;  1IH7 A;  4ID1 A;  4Z4F A;  3AVA A;  4PY5 A;  4DTU A;  4M3Z A;  4E89 A;  4CEO A;  4DSE A;  2HHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...