3AO1A

Fragment-based approach to the design of ligands targeting a novel site in hiv-1 integrase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
151
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
total genus 52
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao1A00
1U45A 4CGHA 3VA3A 4CK1A 1GOBA 1HYZA 2OPQA 3ZSWA 4CF2A 2A1RA 1FK9A 2Z1HA 3ZSZA 4B08A 2QXFA 5HRPA 3NE6A 4DWIA 1LW0A 1QE1A 3P83D 2HVIA 3LZIA 3ULDA 5J2MA 2RN2A 4F2SA 4FJMA 3K5LA 1YTAA 1XWLA 4E19A 3B6OA 3H08A 3HL8A 1U48A 1NOYA 4Z0UA 3ASMA 3DI6A 1ZBLA 4FJ7A 4CE9A 1X1PA 4JRPA 3VQEA 4CIFA 1GOCA 3RRGA 3LALA 2XY7A 3WNHA 3HM9A 4DTNA 4B9TA 2OPRA 1VSJA 2X6NA 3HPGA 3KLHA 3I0RA 4IFVA 4DFPA 4KO0A 1VRUA 4E7LA 2G8HA 1LV5A 4CGFA 2HHTA 1TL3A 3LZJA 1KLMA 2XY5A 1SL2A 4XIUA 1UA0A 1KVCA 1JL1A 3LWMA 3ISNC 3LP1A 4CJVA 4BE2A 4AHCA 3PX0A 1XC9A 1NK7A 1SL1A 4M3XA 1W0HA 2HHSA 1BCOA 1Z26A 3AVIA 1JLFA 4J2EA 2DY4A 1TVRA 1ZBUA 4FLTA 3VQ5A 4DSFA 3CFOA 1WSFA 4LH5A 1KLNA 3ZT2A 1K6YA 5T7BA 3JSMA 3QNNA 2OYQA 3P5JA 2DFHA 4RW4A 2WOMA 3DOKA 4BDZA 4KAZA 4CJPA 1SKRA 3MEEA 3AVFA 3MEDA 4O4GA 1L3SA 2HW3A 1WSEA 1J5OA 4CF8A 2B4JA 4KREA 2KZMA 1D8YA 5C42A 1S1VA 1X9WA 1YTUA 1WNSA 1X9MA 4W5TA 4CEEA 2PYLA 3SJJA 1G15A 3RMCA 3PO5A 2JGUA 3AVMA 3TAMA 3I8DA 5J2QA 1KVBA 3C6TA 1BQNA 2G8KA 2YNHA 3KKSA 3LAKA 4FK0A 3S9HA 4B9SA 3CYMA 2Z1GA 1S1TA 4FVMA 4O55A 3QLHA 3OS2A 1KFSA 4C8LA 4DU1A 2ZE2A 1JKHA 1JLEA 2XHBA 4DTPA 1VSEA 3K5OA 3HP9A 2BGGA 1S9EA 2BE2A 4Z4CA 3KLGA 3O3HA 4E1MA 1ZBFA 3NH2A 1UA1A 2ATQA 4DQSA 1C6VA 1Y97A 4I9LA 1TK0A 5CZ2A 3M8RA 3KD1E 3OYGA 1TKXA 1RTJA 1VSKA 4CHOA 4C8MA 4DF8A 1XHXA 3DYAA 2YNGA 1JLBA 4HVJA 2FBVA 3OYJA 4DU4A 1RDDA 2G8WA 3ALYA 2X6SA 3OYEA 3QIOA 3LPUA 3QETA 4L8RB 5E41A 3ZSOA 4JS4A 2IDOA 1SUQA 3O4NA 4CCHA 4DFJA 4ID5A 4N56A 3SQ2A 2Y1JA 1VSMA 4CJLA 3V9WA 3RR8A 1IO2A 3NGZA 2EHGA 3KLIA 1SV5A 3OY9A 4DLGA 1U4BA 3AVJA 4B9UA 2FBXA 1DLOA 2HB5A 1NJZA 5CYQA 4CJWA 4FLWA 3NHGA 3NF9A 4OVLA 4CHQA 3C6UA 4CJKA 1XI1A 3QEXA 4CGGA 2YV0X 1TKZA 3AVCA 4OPJA 3VA0A 3L2WA 3SUOA 4E0DA 4FXDA 5HRRA 2IAJA 3SI6A 3U3YA 4CJ4A 4I9QA 3KK3A 3O4QA 3LAMA 4C8OA 3IAYA 1A5XA 3OYBA 3DRPA 4FLVA 3IG1A 2GUIA 3PX4A 2HHUA 2ZD1A 4LSNA 4E1NA 4Z4HA 4C8KA 4EP5A 3AO5A 4AHSA 4CJEA 3TI0A 1ZBIA 2A1SA 4FLZA 1MU2A 4H8KA 2W42A 1HJRA 4CIGA 3F9KA 3OYAA 5C24A 3TWHA 4FJ9A 2HHXA 1DTTA 4NYNA 3MAQA 4FJNA 4MQ3A 4E7HA 1F21A 2OZSA 2Z1IA 2XRIA 4CF0A 3AVAA 2VG5A 3NBPA 4Z4GA 4CJ3A 4DMNA 3V9XA 2OPSA 3RR7A 3T1AA 1IKYA 2P1JA 4TSXA 1RDCA 1JLAA 2I5JA 3AVNA 2GBZA 4M45A 3NAEA 4CK2A 4FM2A 3BDPA 4FJKA 1RBTA 2RF2A 1Z25A 4OPKA 3L2VA 2BANA 2G8UA 1KRPA 1NK4A 3DLEA 3WNEA 4YNQA 3VQ4A 1NKEA 3C94A 1CXUA 2WONA 3AVGA 3PUFA 1SKSA 4RW7A 4F8RA 2F96A 2RKIA 4CESA 3OS1A 1HPZA 3HYFA 1BI4A 2YKMA 2P5GA 1YVUA 3EYZA 3QEVA 4DQQA 3SUQA 1QSLA 1GOAA 4IBNA 4DQIA 3LP2A 1L3UA 3AO1A 4AHTA 4DQRA 3OYMA 4LD0A 3HVTA 4CERA 4PY5A 4FYDA 4E7KA 3V9UA 3MECA 1J53A 3T3FA 1FKPA 3DOLA 1LAWA 4KTWA 1HNIA 4BDYA 1QTMA 2VG7A 1QHTA 1TKTA 3AVHA 3RMBA 3KJVA 3SYZA 2QKBA 1KVAA 3OJSA 3OYDA 1BIUA 3O3FA 3S3OA 1NJXA 4M3ZA 2D5RA 1N6QA 3KIOA 1S1UA 3QEIA 3M8QA 4OJRA 1WSGA 3RMAA 3SPZA 1T8EA 1IKWA 2OA8A 4CK3A 3VQ6A 3OYNA 4FW1A 4UQGA 1RT6A 3V1RA 1VSIA 1S6PA 4GW6A 4CFCA 4CJTA 3DLHA 4Z4EA 1UAXA 2HHWA 1J54A 4CJUA 1JLCA 1J9AA 3ZSQA 2QKKA 1JLQA 3T19A 1KSPA 1L3TA 3FFIA 3DLGA 3EY1A 3RMDA 1BCMA 2Z1JA 1LWEA 5KRTA 3CM6A 3ZSVA 3HXMA 3EZ5A 2X74A 3VQ9A 3QINA 1RTHA 4BDPA 1S9GA 2IOCA 3ITHA 2PY5A 1B9FA 4C8NA 3IRXA 5HP1A 3QERA 4Z4FA 4ICLA 4CGIA 1RBUA 3D45A 4KRFA 4FJHA 4DSKA 2KZZA 4B9NA 3HSTB 4PUOA 2DTUA 4H4MA 1S6QA 4E7JA 4JS5A 2B6AA 4DQPA 1S1XA 4K8ZA 4KKOA 3M8PA 3TAGA 1TV6A 3QNOA 3D0PA 1RTDA 3AVKA 1KCFA 1TGOA 2YKNA 3HK2A 3NH1A 4BE1A 1SKWA 1RT4A 3OYFA 3U6FA 2O4IA 1JXBA 4E7IA 4DG1A 1CLQA 2D0CA 3AA2A 4DU3A 4Y1CA 1R0AA 3AA4A 3AA3A 1TK5A 1A5WA 4DTRA 5FRMA 3LP0A 3CG7A 3P1GA 3TAPA 2KFNA 1LW2A 4HUEA 2HNZA 2XY8A 1QSYA 3VQAA 4FZXC 3V9SA 1IH7A 4HUFA 4FJXA 3ZSYA 2E6MA 4QAGA 4KHNA 5C25A 4M3RA 5KGWA 4ZHRA 3K59A 3ZT1A 2NUBA 1EKEA 4B8AB 4KHQA 3TAQA 4PWDA 3KK1A 3PX6A 4CECA 3SCXA 3K2PA 3LANA 4FZYA 5HBMA 3KKRA 4CEZA 1HYVA 3MXIA 4DSJA 1IKXA 4KHWA 2F8SA 4DTSA 2OZMA 4QOZB 3HT3A 3LDSA 3JYTA 1ZBHA 4G1QA 3RTVA 1C0UA 2KTQA 2KW4A 3HJFA 4LSLA 4KHUA 4DTXA 3AVLA 5J1EA 3L3UA 4IG3A 4CHYA 4GVMA 2E6LA 1C0TA 3AO2A 3DLKA 4PA1A 2AJQA 1NJYA 3VN5A 4MFBA 1BHLA 1KTQA 5HROA 2ETJA 1U47A 1S1WA 3DMJA 4J2BA 4ELUA 2EX3A 4ID1A 5SWMA 4KB1A 4M42A 5J2PA 4HCCA 5CY4A 4FZZA 5FRNA 4OKEA 1CXQA 1BI4B 1T03A 4DTOA 4AHVA 3BGRA 2FC0A 3G0ZA 3NDKA 4FLYA 4DTUA 4M3TA 4O5BA 4EZ9A 3QO9A 4CEOA 1JLGA 4H4OA 2E4LA 2OPPA 2FBYA 5HLFA 1UOCA 4CJ5A 1BIZA 4IDKA 1RT3A 4JRQA 2G8FA 2D0BA 1LAVA 3NF6A 4RW9A 4HTUA 4BE0A 4PQUA 4KV8A 4CHNA 4F2RA 3WNGA 3QIPA 4KI4A 4IKFA 1WAJA 3DLBA 3UIQA 2ITGA 4FK4A 3V1QA 3ZSRA 1RT7A 2Y1IA 1WN7A 1RNHA 1CZBA 2XO7A 1O1WA 4NYFA 4FCYA 3SUNA 1TAQA 3SQ1A 2JLEA 4O0IA 1ITGA 3HVRA 2PZSA 4KTZA 4Z4IA 5CYMA 4B9LA 4DFMA 5I42A 3NFAA 2DFFA 1NKBA 2HNDA 1D9DA 4Q5VA 4F3TA 4N76A 4W5NA 1JXEA 1FKOA 3OYCA 3TARA 4I2PA 1LWCA 3VQPA 3K5MA 2D0AA 3VQBA 3DLRA 4YFUA 2KFZA 1U04A 4KB0A 5KI6A 3RRHA 1NK6A 1C1BA 2G8IA 2HHVA 5I3UA 1B9DA 4OKKA 1HRHA 5FDLA 1ZYQA 1B92A 3KLFA 1VSLA 3MXMA 4CIEA 1NK0A 5KGXA 4AH9A 3VQCA 3L2UA 4CF9A 4CEQA 1RT2A 5FROA 3OYKA 4DLEA 3TAFA 4F3OA 3A2FA 4FJJA 3DRSA 4FJ5A 3OJUA 4OGEA 1RBSA 5D3GA 1VK0A 3OYHA 1WSHA 2FBTA 4HUGA 4Y1DA 5JS2A 4EZ6A 4OKJA 3HO1A 4I7FA 5SZTA 4CEDA 4CEBA 4CEFA 3C95A 1XHZA 3I0SA 3G10A 5HRSA 3KK2A 3NCIA 2B5JA 4ELTA 1EETA 1WSIA 1C1AA 4B9VA 4CFAA 3TAEA 4KTQA 3SV3A 5DMRA 2F8TA 1L5UA 3OYIA 2YHAA 1I3AA 3U3GA 3QEWA 4CGJA 2KQ2A 4BWMA 2YHBA 4CF1A 3ZT3A 4E3SA 3PY8A 1CZ9A 1BQMA 2DFEA 3HPOA 3NH0A 2VG6A 4FJGA 4DS4A 5EU7A 4CFBA 2IS3A 4JLHA 3HPHA 4BWJA 1NK8A 2IC3A 3TANA 1RDBA 5KRSA 1I39A 4OGCA 3S3MA 1HYSA 2VWKA 4KFBA 1YT3A 2O4GA 3CM5A 1D5AA 3NGYA 1RT1A 1WLJA 4FLXA 3MXJA 3SNNA 3AA5X 3DM2A 3K57A 3F73A 4B9MA 4DTMA 1JL2A 3ZSXA 3ZCMA 4AHRA 4N5SA 4W5OA 4I2QA 4M41A 4KHSA 4M3WA 3M8SA 4O44A 3AO4A 2RPIA 1C0MA 1TL1A 3LPTA 3LWLA 1T05A 4HCBA 3CQ8A 4J2DA 1NOZA 5DK5A 4IFYA 5K14A 4M3YA 4DSIA 4E89A 1KFDA 2HHQA 4CEAA 1FXXA 3SV4A 2IGIA 4B3OA 4F4KA 1BL3A 1EP4A 3SQ0A 4FM1A 4N41A 3V1OA 3V6DA 1NK5A 4LY7A 3MEGA 4W5RA 3CFPA 5J2NA 4NCAA 1QS4A 5CZ1A 3SQ4A 4QCLA 1WAFA 3SPYA 4KHYA 4DFKA 3SZ2A 1T7PA 3V81A 1RILA 4NCBA 4WE1A 4HHTA 3S3NA 1WSJA 4ZTJA 3ZT4A 1X9SA 4DSEA 3SUPA 3NF8A 1N5YA 3THVA 5JS1A 3PO4A 4NCGA 4CFDA 3V4IA 3E01A 1U49A 3RWUA 1RCHA 4KI6A 1VSFA 4AHUA 1EXQA 3LP3A 3TR8A 2P51A 4DF4A 3KD5E 4OLAA 2LSNA 1RT5A 4CJSA 2R7YA 4O0JA 2VWJA 1QQCA 5HRNA 4ZTFA 1HMVA 1RDAA 4FW2A 4DS5A 1TKDA 1Q9YA 3ZT0A 4N47A 1RBVA 2X78A 5KTQA 4K8XA 4FK2A 1Q8IA 3IS9A 3KLEA 2ZQBA 3OVNA 1RTIA 4EP4A 3TABA 1UWBA 3AO3A 4J2AA 2HVHA 2XY6A 4FM0A 2Q3SA 1HQUA 4CJQA 4OLBA 4CJFA 4CGDA 3PV8A 3QEPA 3O3GA 3AV9A 4CHZA 1IG9A 1HNVA 1LWFA 1NKCA 4M3UA 3VQ7A 1S5JA 1QSSA 2G8VA 1ASUA 4LH4A 4FJLA 3QESA 1TK8A 1VRTA 4RW6A 4AILC 4FLUA 2GV9A 4BACA 2BDPA 3L8BA 2HNYA 3WNFA 3VQDA 1VSHA 4RG8A 4W5QA 3DRRA 4GMJB 3OYLA 3L2QA 1DTQA 1C1CA 1REVA 1RBRA 4KPYA 3NGIA 4FJ8A 1NJWA 1BGXT 1EX4A 3AVBA 4CHPA 3B6PA 2PYJA 1IKVA 3L2RA 2HMIA 4ELVA 3VQQA 4CJRA 3KTQA 1TAUA 4R5PA 1SL0A 1Q9XA 4Q0BA 4B8CA 1A5VA 3HP6A 3VQ8A 4FJIA 1VSDA 1HQEA 1L3VA 2YNFA 1ASWA 3L3VA 1NK9A 2YNIA 3NF7A 2P5OA 3K5NA 3K58A 1D9FA 1BISA 3CFRA 4IG0A 4DSLA 4DTJA 2QK9A 1ASVA 4RW8A 3OS0A 3V9ZA 1W9HA
chains in the Genus database with same CATH superfamily
1U45A 2E2QA 4CK1A 2Z1HA 4B08A 3ZSZA 4B1WB 1S22A 2QXFA 1QE1A 3P83D 4FJMA 3K5LA 2QWOA 2A5XA 2D0OA 3HL8A 1NOYA 1SAZA 4CE9A 1NU0A 1X1PA 4FWPA 4JRPA 2WTUA 3HPGA 4DFPA 3UKUB 4E7LA 2G8HA 5LJVA 4CGFA 3TPQA 1SL2A 4XIUA 1JL1A 3LWMA 4FO0A 4M3XA 1XC9A 1VQLN 4BRHA 1JLFA 3C65A 2DY4A 4FLTA 3VQ5A 1KLNA 3LDPA 5KPZA 2VWBA 4H5NA 4H5RA 5IWAK 3P5JA 2DFHA 4JKCA 2E2PA 1G99A 3MEEA 3AVFA 5AQUA 1K9MO 2HW3A 3EE8A 1WOQA 2KZMA 4KREA 1MWKA 1S1VA 3UKUA 2V7ZA 3IDHA 1T44A 3H1VX 3PO5A 3W0LA 3SAFA 3LAKA 4ILGB 3S9HA 4B9SA 1YF5L 2UXCK 3MN7A 1KFSA 4O55A 2FSNA 2ZE2A 2UUAK 2XHBA 3T69A 4Z4CA 3CJBA 3S41A 4FWQA 4PL8A 4FWMA 1UA1A 4DQSA 1Y97A 3DLLL 5CZ2A 2P9PB 3EN9A 1NNEA 1VSKA 3KWGA 4DF8A 4GV3A 3OYJA 2Q2RA 2G8WA 1RDDA 3K9JA 1W7AA 4WFAL 3OYEA 2JWLA 3QIOA 5AQLA 4L8RB 5AQPA 4JV5K 1GLAG 1CZAN 4N56A 1VSMA 1YXQA 2VYPA 4CJLA 3KLIA 5E84A 1U4BA 3AVJA 3C7NB 1C0FA 1YUWA 1DLOA 2FBXA 2HB5A 5AQXA 4CHQA 3C6UA 4JKEA 4CJKA 1VAZA 3QEXA 4OPJA 4FXDA 5BPMA 4DV6K 2IAJA 5M1PA 5AQQA 5AQRA 3KK3A 2P9PA 4I9QA 4PKHA 3H45C 3IG1A 4LSNA 4E1NA 1ZBIA 4CW7B 1OH5A 4FWOA 3WEEB 3MK6A 3OYAA 3F9KA 3FZKA 3BZKA 5CHIA 4FJNA 1YAGA 4CBXA 4MQ3A 2OZSA 3AVAA 3VF2A 3RR7A 4TSXA 1RDCA 3C7NA 1JLAA 2E8AA 3MX5A 4FWLA 4M45A 2BUPA 5AQSA 3NAEA 2AP1A 1NBWA 4CK2A 2ZJRL 3BDPA 3CJCA 3DLEA 4YNQA 3C94A 4JHDA 5F1XA 3AVGA 2F96A 3OS1A 3THYB 3O9SA 2P5GA 3WEEA 4IBNA 1NGCA 4FYDA 3AO1A 4DQRA 1JJ2M 4CERA 4OX9K 1J53A 3T3FA 2W41A 1QTMA 4QS8A 4WQ5C 1TKTA 5BPLA 3J81O 4M7YA 4ISFA 3J7YP 1XNRK 3SYZA 1KVAA 3A5LC 4IOCL 3QEIA 3PY8A 4UQGA 3OHRA 4CJTA 2O8FA 1JCFA 2NRVA 3ZLJA 1BCMA 5KRTA 1LWEA 1YJWN 3ITHA 2PY5A 3IRXA 1N36K 2CGLA 3P4IA 1OVQA 2KZZA 2KKZA 2NRWA 5E26A 2IVNA 2DTUA 4E7JA 4GKKK 4BC3A 3EO3A 4K8ZA 4X65K 1S3XA 1TV6A 4O8KA 3D0PA 2HBKA 3ZX2A 3HK2A 2JWKA 2O4IA 3C0BA 4DU3A 4Y1CA 3AA4A 1A5WA 3CI5A 3LP0A 3CG7A 3W3DA 1QSYA 3U9DA 2XY8A 1IH7A 5BREA 4WQ5A 3ZSYA 5C25A 3E1YA 4M3RA 3BF3A 3RVCA 4B8AB 1BA0A 4DUZK 1K73O 4DV4K 3K2PA 3LANA 4FZYA 3RSEA 1GLEG 5AZJA 1NLVA 5AQIA 3JYTA 2D1KA 4G1QA 1C0UA 2KTQA 4KH6A 2A41A 3DLKA 4QS7A 4PA1A 4B1VA 5HROA 1KTQA 1S1WA 3H3NO 4J2BA 2GTDA 3LM2A 5J2PA 3CHWA 1M1KO 4FZZA 4AQYK 4AHVA 5JLHA 3TSPA 3G0ZA 4CEOA 2E4LA 1ZXOA 1BIZA 1ATNA 3PLAA 2D0BA 4IXCA 4WYBA 4RW9A 1HUXA 2HF4A 1KAYA 3WNGA 1OH8A 4XH1A 1O13A 2NRRA 2P9IA 1VQ7N 3UIQA 3V1QA 1WN7A 3WQUA 3I8BA 1HJOA 3SQ1A 3HVRA 1HLUA 4DFMA 1NKBA 3SMPA 4BREA 3UB5A 1WB9A 4KB0A 3RRHA 1NK6A 5FDLA 3KLFA 5TKYA 3MXMA 4CIEA 4IJAA 4K41A 4CVNE 5KGXA 1NK0A 1VQMN 3L2UA 1C0GA 1RT2A 5BR9A 1BO5O 4FJJA 4BY9C 3OJUA 4OGEA 3CC7N 1NGFA 3HO1A 1VQ6N 4K25A 3WXMB 3C95A 5HRSA 3KK2A 3NCIA 5C10A 4DR4K 1EETA 4I6MB 4KTQA 5DMRA 2I7NA 3U3GA 1V4TA 3QEWA 4CF1A 4E3SA 5EU7A 3U4LA 1NK8A 1HYSA 1Q81O 3NGYA 4DR2K 3AA5X 3DM2A 3K57A 3H3OB 2YI1A 2RPIA 1C0MA 4BG8A 4J2DA 1Q7YO 3FGUA 4NXMK 1HKGA 1NGGA 3VEYA 4JYAK 2HHQA 2H3GX 2ZF5O 4CEAA 1FXXA 4B3OA 4I6MA 4F4KA 1OKJA 3V1OA 3V6DA 3CFPA 1QS4A 5CZ1A 3AARA 1U2VB 4DFKA 3V81A 4HHTA 4ZTJA 2ASOA 1X9SA 4ILHA 1N5YA 4AF1A 3THVA 3V4IA 3O6WA 3RWUA 1VSFA 4H0XB 3FE1A 3JS6A 1RT5A 2R7YA 2VWJA 1RDAA 4FW2A 1TKDA 1P8ZA 4CZGA 5KTQA 4FWSA 4H5WA 3IS9A 5AZIB 3OVNA 3HI0A 4OLBA 3F2KA 3HZ6A 1NKCA 1S5JA 4JI1K 4LH4A 4DR1K 5ELZA 1VRTA 4RW6A 2BDPA 4DKWA 4LF8K 1QQMA 1VSHA 1YITN 4W5QA 4B3TK 1REVA 1C1CA 4KPYA 4FJ8A 1BGXT 4CHPA 1NWKA 2DPNA 3HTVA 1IKVA 3VGKA 4E1JA 1A5VA 2A42A 5DM6L 3WXIA 3CPWM 2YNFA 1L3VA 3L3VA 1BISA 3LDQA 4FOEA 1ASVA 4RW8A 3V9ZA 4ILJA 4CGHA 1RDUA 2ZJPL 2OPQA 3ZSWA 4CF2A 2A1RA 1FK9A 4KHUA 4B3RK 3NE6A 5HRPA 1LW0A 2HVIA 2GEMA 3LZIA 4F2SA 3A8YA 4BG9A 4B3MK 1XWLA 4E19A 3H08A 3CMAN 3FZLA 5MLCQ 3R6MA 5I9EB 3K9KA 4CIFA 5JVGL 2XY7A 3WNHA 3HM9A 3HRGA 4DTNA 3ZEUB 1VSJA 2X6NA 2EWSA 4EAHD 4PL7A 1Q82O 1FJGK 2HF3A 3LZJA 2XY5A 1YHQN 1UA0A 3ISNC 4CJVA 1HPMA 2PAVA 1ILYA 1W0HA 3MWTA 4J2EA 4DSFA 3I56N 4LH5A 3E66A 5A2QO 3ZT2A 5T7BA 3JSMA 5JVHL 2YJEA 4RW4A 3VEWA 1SKRA 3GOIA 4LFCK 1L3SA 3ZEUA 4O4GA 3ZX3A 2Q36A 4YOWA 1NGIA 4RCHA 2FF6A 1RDWX 5C42A 1D8YA 2FXUA 4B9QA 4X62K 4W5TA 2NNWA 3SJJA 3ATVA 4DV0K 5AQJA 4CI6A 1KVBA 2YNHA 2WBNA 4FK0A 4BVPA 3D6RA 1S1TA 5GIPA 4FVMA 4C8LA 2O8BB 1W97L 3J80O 1VSEA 2BE2A 3H1QA 3NVMA 4HTLA 1H1VA 1ATSA 4JKBA 3O3HA 4IO9L 4E1MA 3NH2A 4NLBA 2ATQA 3IFRA 1TK0A 1XHXA 4CZKA 4HVJA 2QWQA 4A2BA 4CZFA 2ASPA 3QETA 3M1FA 1DT9A 4IOXA 2UU9K 1NMNA 5HOOA 4CCHA 2Y1JA 3RR8A 4JKGB 1MWMA 2EHGA 3VEOA 2O8BA 4B9UA 1QVFM 1NJZA 2ZGZA 5C15A 5KQ8A 3NHGA 3NF9A 1X9JA 2YV0X 1TKZA 3SUOA 3L2WA 3EEQA 2E1ZA 3U3YA 2A6AA 4CJ4A 3LAMA 2GUIA 4Z4HA 4BQLA 3AO5A 4EP5A 4CJEA 2A1SA 1MU2A 4NLCA 1SZ2A 3TWHA 2HHXA 1DTTA 2O8CB 1F21A 2Z1IA 1GLCG 3CQYA 2VQEK 1Y64A 4JKGA 3AGRA 3AVNA 4CBUA 3QBXA 5JLFA 4JNEA 1QVGM 1NGDA 3CXCM 3L2VA 4V19S 1NK4A 2O8DA 4A5AA 3VQ4A 3MMVA 1NKEA 2AA4A 2Q0RA 2WC9A 3DJCA 4CESA 3O4WA 3J7ZO 1BI4A 4BC5A 1YVUA 3EYZA 1GOAA 2O8CA 4CZMA 3EZWA 4DR5K 4JI5K 3MECA 4ISGA 3DOLA 4KTWA 5BRHA 4DQ8A 3SAHA 3KJVA 4GVEA 1YVNA 1GLLO 2OTJN 3AAQA 3AAPA 3DWLA 4M3ZA 2D5RA 1N6QA 1S1UA 2UXBK 3M8QA 4OJRA 5C12A 3UE5A 1IKWA 4CK3A 4FW1A 4Z4EA 1UAXA 2HHWA 3VEVA 4X66K 2WFBA 5BN9A 4EHUA 2QKKA 1KSPA 1VQ9N 2OTLN 3ZSVA 5KQDA 2VQFK 3PSFA 1RTHA 4BDPA 4YOUA 3THXA 3OA9A 4Z4FA 3VF6A 4KRFA 3D45A 4B9NA 2D4WA 3HSTB 2P9KB 4H4MA 1S6QA 2IIRA 5M1KA 4DQPA 4GNIA 4H5TA 3TAGA 1W2BM 2YKNA 1SKWA 4E7IA 1R59O 2YHXA 3GE1A 3EKSA 5FPNA 3ZYYX 2RHKA 3P1GA 1RFQA 4HUEA 4OPHA 2HNZA 3SK3A 4FZXC 4FWNA 3V9SA 2Q1NA 4DR6K 2E6MA 2ZGYA 5KGWA 4ZHRA 4A59A 3K59A 4YDUC 1EKEA 4KHQA 3KK1A 3QFPA 5AFUH 3KKRA 4DTSA 1Z6RA 4JK8A 3P31A 3O8MA 1ZBHA 5CE3A 4EFHA 3AVLA 5M1FA 4IG3A 4GVMA 2OCEA 2AJQA 3VN5A 3O5BA 2CGJA 4BR0A 4JHDB 4KB1A 4C23A 4HCCA 4AM6A 3VOVA 2UYTA 4F9OA 3NDKA 4FLYA 2FSJA 1OVYA 3BF1A 1JLGA 1SQKA 4A2AA 4DB3A 1UOCA 1RT3A 2P9LA 5BPNA 4CZHA 2ZJQL 3BP8A 3KZBA 4KV8A 3M6GA 1HKBA 4KHPK 3CERA 3NVKA 3DLBA 3M5RA 2ITGA 4FK4A 3GG4A 2XO7A 2E88A 3CJ1A 1FW6A 4NYFA 2O8FB 2JLEA 4O0IA 2WUSA 2PZSA 4IEEA 4Z4IA 4B9LA 4IOAL 3CJAA 3NFAA 4U7BA 2HNDA 1NJIO 1YJ9N 3OYCA 2HMPA 3VQBA 3DLRA 2KFZA 1IJJA 3TU5A 3MX2A 1ZYQA 3TSQA 3ZX0A 3VERA 4B1XB 2PFUA 3VQCA 4CF9A 5FROA 4XH4A 4JI0K 1NGAA 4F3OA 3CCMN 3QMLA 2F4VK 1N8RO 3CCEN 3OYHA 3OBYA 5JS2A 1T6DA 4WQ4C 4OKJA 5SZTA 4CEBA 4H0OA 4CEFA 5FPDA 1XHZA 1BOTO 4ELTA 1C1AA 4BQZA 3TAEA 5BR8K 3QDKA 4DV2K 3OYIA 2YHAA 3IKMA 4PKGA 4BWMA 3ZT3A 1BQMA 2DFEA 3OBWA 2IC3A 1RDBA 2O8EB 2VWKA 1YT3A 1Z05A 3CM5A 5EY4A 1GLBG 4IO8A 3R9PA 4B9MA 3RSEB 4DTMA 4AHRA 4N5SA 4W5OA 4M41A 5AZJB 1TL1A 3LPTA 3LWLA 1T05A 4CD1A 3CQ8A 2PBDA 5DK5A 4E89A 1KFDA 5AR0A 3SBGA 3SV4A 2P9NB 1VQON 2IGIA 1BL3A 1MA9B 1NK5A 3O08A 3MN9A 3SQ4A 4JKDA 1XMOK 1WAFA 4KHYA 3N4PA 3CC2N 3SZ2A 2O8EA 4WE1A 3S3NA 1RGIA 4DSEA 3NF8A 4M63C 3PO4A 3E01A 3P39A 1RCHA 3J8AA 5KPRA 1EXQA 3LP3A 3O1WA 2I7PA 3SAGA 2LSNA 4FWRA 3CETA 2P9IB 1QQCA 5HRNA 2P9NA 3ULEB 3ZT0A 4N47A 2X78A 4K8XA 2NRTA 3ZETA 1S72N 4EP4A 5AQKA 4B1YB 1XUPO 1HQUA 4CJFA 3PV8A 3QEPA 3O3GA 4IJNA 3VEXA 3VQ7A 1QSSA 1ASUA 3D2EA 4AILC 3R3LA 4RG8A 4XH5A 3DRRA 4GMJB 4BRMA 1X3NA 2FF3B 1RBRA 1NJWA 4FL9A 3OTOK 3B6PA 3WXJA 3KTQA 5FPMA 1SL0A 4Q0BA 4B8CA 4C1NI 5EOYA 1ASWA 3ULEA 2YNIA 1BA1A 1EWQA 3VA3A 4BGBA 1GOBA 3FLCO 3CMEN 1D4XA 2BTFA 4BRLA 4JI3K 4BROA 3ULDA 2RN2A 5AQMA 1YTAA 3ASMA 3DI6A 4GV6A 3FFKB 1GLJO 1I94K 3RRGA 4B9TA 3KHYA 3KLHA 3WT0A 2P9UA 3I0RA 4IFVA 4KO0A 1LV5A 3AY9A 4LF5K 4H0VB 1KVCA 1YI2N 4BE2A 1NK7A 1Z26A 1ZBUA 3CFOA 1WSFA 3EE9A 3EL2A 1T3VA 2QM1A 5AQTA 5BRFA 2WOMA 3DOKA 4JK9A 1EQYA 5AQZA 4BRCA 3MEDA 1WSEA 2HSTA 3BEXA 2B4JA 1J5OA 4JN4A 5BRDA 1WNSA 1EWRA 2E2OA 4CEEA 2PYLA 1QZ5A 3I8DA 1NMDA 3C6AA 5AQNA 3QLHA 4K0KK 4IFEA 2P9SB 4DTPA 2BGGA 1S9EA 2GUPA 2YX6A 3D2FB 3AGKA 5B8HA 1K8AO 4CBWA 1C6VA 4I9LA 3KD1E 3LDLA 4C8MA 1JLBA 3F9MA 4DU4A 5M1NA 2VGNA 3LPUA 2ZWHA 4FOIA 1KAXA 3VF4A 2FSKA 4B3SK 4JS4A 4DUYK 3C6HA 4H0YB 1SUQA 3VETA 1QHAA 2HOEA 3DXMB 1IO2A 3NGZA 3OY9A 4MO4A 2ZM6K 2KHOA 2W6LA 2P9SA 3PIPL 5CYQA 4CJWA 4OVLA 1XI1A 4CGGA 3D2FA 4JI6K 5AJ3K 3SI6A 1N33K 3PSIA 2QI2A 4O8UA 3VESA 1P90A 2ZD1A 4C8KA 4AHSA 4FLZA 4MDBA 2W42A 1HJRA 5C24A 3UKRA 4FJ9A 2YJFA 4O5FA 4NYNA 3Q7CA 3PIOL 2XRIA 3MCAB 4MDAA 4CF0A 2VG5A 3NBPA 4Z4GA 5GADP 3DXMA 3V9XA 1TUUA 1EO1A 2I5JA 4CD3A 4L3QA 1NG9A 3THWA 2F9WA 5JMVA 1V4SA 4FJKA 1RBTA 2RF2A 1Z25A 5LY3A 5TKWA 3ENOA 3VGMA 1K8KA 4YOVA 2WONA 3PUFA 3FR0A 3HYFA 4DV3K 2YKMA 4BR2A 1QSLA 3J7AP 3VTIA 3LP2A 4PY5A 4AHTA 3OYMA 4LD0A 4E7KA 3V9UA 1U6ZA 4DV1K 1FKPA 3B8AX 3I33A 1QZ6A 1QHTA 3AVHA 3RMBA 2V52B 2QKBA 3OW2M 3CJ7A 1NM1A 5C0YA 3OYDA 5LMUK 3O3FA 1E3MA 2GELA 3KIOA 3SPZA 1T8EA 1WSGA 1S6PA 4CFCA 3HBTA 3DLHA 1J54A 1JLCA 1J9AA 3ZSQA 1L3TA 3EY1A 3RMDA 4DR3K 1TUYA 3HXMA 1NGEA 2X74A 3QINA 3VQ9A 2IOCA 1IBKK 1B9FA 3KWIA 4C8NA 1XC3A 3EKUA 3QERA 1MDUB 4ICLA 4CGIA 1RBUA 3WXLA 2B6AA 3DXKA 3M8PA 3QNOA 1HNZK 3AVKA 4ISEA 1LOTB 2HHHK 1JXBA 4BRQA 4DG1A 2D0CA 1R0AA 3AA3A 1OH7A 2KFNA 4BRDA 3VQAA 4BRIA 4HUFA 2VGMA 1Q18A 2NUBA 3PX6A 3SCXA 5GAEP 3A5NC 3CCSN 1E4FT 4DSJA 1IKXA 4BRPA 4YOYA 2F8SA 4QOZB 4Y0WA 3SMSA 4K42A 3LDSA 4M7XA 3RTVA 3HJFA 2ASMA 4DTXA 5J1EA 1DEJA 4CHYA 2E6LA 3AO2A 2O8DB 3KK7A 4G9ZA 3DMJA 5AFUA 4ELUA 2EX3A 4ID1A 4LC9B 5CY4A 3HOSA 4A57A 3VGLA 1BI4B 3VENA 1T03A 4DTOA 1VQPN 4DTUA 4M3TA 1BDGA 4CZJA 4EZ9A 3QO9A 4H4OA 2OPPA 5HLFA 4OO1J 4BR7A 2KLAA 5EXWA 3NF6A 3FZFA 4HTUA 4CHNA 3G25A 1VHXA 3L4IA 3QIPA 1QQNA 4H03B 1RT7A 2Y1IA 1CZBA 3SUNA 4DV5K 4JD2A 1YIJN 5CYMA 2DFFA 1D9DA 4F3TA 4N76A 1JXEA 4KBOA 1FKOA 3TARA 3K5MA 3VQPA 3F5TA 3CCRN 1U04A 2QA4N 5KI6A 3LDNA 1C1BA 2HHVA 5I3UA 1B9DA 1KQSM 3THXB 1B92A 4J8FA 4BC2A 4AH9A 3OYKA 4CEQA 3TAFA 4GY2B 4NB4A 1ZBSA 3G6EN 3JAMO 1RBSA 3A5OC 5D3GA 1VK0A 4EZ6A 2QWLA 4I7FA 4CEDA 1IBLK 2NZTA 1ZC6A 3G10A 2P9KA 4CFAA 4NO7A 3BUZB 2F8TA 1L5UA 3VMFB 1I3AA 4CGJA 2KQ2A 2YHBA 4BC4A 1CZ9A 4XEIA 2IS3A 4BWJA 5KRSA 4OGCA 5AQFA 4JKAA 1JCGA 2O4GA 1D5AA 3SNNA 2F9TA 3MXJA 3F73A 4GKJK 5AQYA 1JL2A 4FPBA 1GLDG 3A5MC 3ZCMA 5ADXH 4I2QA 5AQVA 2QWMA 1NOZA 4IFYA 4M3YA 3R1XA 3QB0A 4JI8K 4CZIA 4LFBK 4PHTX 2UUBK 1EP4A 3SQ0A 2GWKA 1HR0K 4R79A 4FM1A 4N41A 3NMUA 4K43A 2NRZA 5J2NA 2NLXA 4QCLA 3SPYA 3IMXA 1NGBA 1T7PA 1WSJA 3QICA 3ZT4A 4BRAA 3H6EA 5CR4A 4LFAK 3CQXA 3SUPA 3MN6A 3CCQN 2P9LB 5JS1A 4YORA 3HM8A 5GAHP 4NCGA 4CFDA 1U49A 1E4GT 4AHUA 4JI2K 2P51A 4OLAA 3CPEA 4X64K 4O0JA 4H0TB 4DS5A 1Q9YA 3TTFA 1KXPA 1Q8IA 3KLEA 2ZQBA 4EIAA 1VQKN 1RTIA 2CH5A 2HVHA 2XY6A 4CJQA 3AV9A 4CHZA 1IG9A 1LWFA 4BRNA 4IDHA 4YY3K 5KPTA 2G8VA 4JKHA 1TK8A 4FLUA 1KAZA 4BACA 3L8BA 4MLHA 3WNFA 1J6ZA 2A3ZA 3LDOA 3L2QA 3MDQA 2Q97A 3NGIA 5DM7L 1EX4A 2PYJA 1M90O 3L2RA 2HMIA 2E5LK 4R5PA 3L6QA 3HP6A 3VQ8A 4JI7K 1VSDA 1HQEA 3CC4N 4OPAA 4YDUA 4IG0A 5H1SQ 3CJ9A 1HYZA 4DWIA 3LL3A 5J2MA 3SLCA 1U48A 3B6OA 3WQTA 4IWVA 4Z0UA 1WUAA 3CCVN 3P38A 1ZBLA 3E9OA 4QS9A 4FJ7A 5EVZA 4JAXA 3VQEA 4LF7K 1GOCA 2HBJA 3CF5L 1BU6O 3LALA 1VQ8N 4CZEA 2OPRA 3WXKA 3VEZA 1VRUA 4CZLA 1HNWK 2HHTA 1TL3A 1KLMA 3LP1A 1SL1A 4AHCA 3PX0A 2HHSA 1BCOA 4DV7K 3AVIA 1TVRA 5HL7L 1DKGD 3O9RA 2OANA 1K6YA 3QNNA 2F7TA 2OYQA 5JICA 4BDZA 1IG8A 3IUCA 4KAZA 4CJPA 3G71N 3THYA 4CF8A 2V51B 1X9WA 1YTUA 3CD6N 5C2FA 1X9MA 4DR7K 1G15A 3RMCA 1TYQB 2JGUA 3AVMA 3TAMA 2G8KA 5J2QA 1N34K 3C6TA 1BQNA 3KKSA 3ZETB 3CYMA 4A5BA 4FSVA 1N32K 2Z1GA 5GAGP 3T7ZA 3WUHA 3OS2A 3Q7BA 4DU1A 3ENHA 4UY8O 1JKHA 1JLEA 2CH6A 3K5OA 3HP9A 4WQ4A 3KLGA 3D2EB 3O1BA 4FWKA 1ZBFA 1LCUA 3O9TA 3M8RA 3OYGA 3LM9A 1TKXA 1RTJA 4HWIA 4CHOA 4YOXA 4DHYA 4U67L 3DYAA 2YNGA 2FBVA 3ALYA 2X6SA 2D0PA 4AM7A 1TYQA 5E41A 5GIOA 1XQSC 3ZSOA 5F2RA 3VPZA 2IDOA 3O4NA 1Q86O 4DFJA 4ID5A 3SQ2A 3V9WA 1KC8O 1XMQK 3ID6A 5EX5A 1SV5A 4DLGA 4BVOA 4FLWA 4E0DA 3AVCA 3VA0A 3T1HK 3VTHA 2E20A 5HRRA 2GX9A 2QWPA 3O4QA 4C8OA 4BRKA 3IAYA 1A5XA 3OYBA 3DRPA 4FLVA 3PX4A 2HHUA 5C2DA 3TI0A 2YCHA 1QQOA 2P9UB 4H8KA 1NGHA 4CIGA 1YJNN 3MAQA 3GDQA 4E7HA 4CJ3A 4DMNA 1IBMK 2OPSA 3T1AA 1IKYA 2P1JA 3GBTA 2GBZA 2J4RA 4FM2A 3MWPA 1NGJA 4OPKA 2BANA 2G8UA 1KRPA 3U9ZA 3WNEA 4PKIA 1CXUA 1SKSA 4F8RA 4RW7A 2RKIA 3TTDA 1VQ4N 1HPZA 3E9PA 5LJWA 2Q31A 3QEVA 4DQQA 3SUQA 2HBLA 4DQIA 1L3UA 3HVTA 2E1YA 1LAWA 4C1NK 1HNIA 4BDYA 2VG7A 4FPAA 5F0XA 3CCUN 5AQGA 4A62A 1T6CA 3OJSA 3GL1A 1BIUA 3S3OA 1NJXA 3RMAA 2QWNA 2OA8A 3VQ6A 3OYNA 1RT6A 3V1RA 1VSIA 2GWJA 4GW6A 5LMNK 4CJUA 1JLQA 3T19A 3FFIA 3DLGA 3L4QA 1HX1A 2Z1JA 4WFNL 3CM6A 2BH1A 3EZ5A 4JKFA 1S9GA 2QW9A 4JI4K 2QTDA 5HP1A 1HKCA 5M1QA 5AQHA 4FJHA 4PUOA 4JS5A 1HNXK 1S1XA 4KKOA 1RTDA 1KCFA 3O80A 4KH5A 1XNQK 1TGOA 3HSCA 3NH1A 4BE1A 1RT4A 3OYFA 3U6FA 4Z94A 2W6KA 4IEIA 1CLQA 3AA2A 1BWFO 1TK5A 5FRMA 4DTRA 3T1YK 3TAPA 1LW2A 4JEPA 4FJXA 4QAGA 4KHNA 2RE2A 3ZT1A 3UKRB 3O9QA 4PWDA 3TAQA 4CECA 4LF9K 4WCEL 4MLEA 5HBMA 4CJ7A 4DCHA 5GINA 3MXIA 4B1UB 1HYVA 2IVPA 2V7YA 4CEZA 4KHWA 3E9LA 4BR4A 2OZMA 2E2NA 2Q0UA 3HT3A 2QWRA 3TTCA 1VQNN 3THWB 4JK7A 2KW4A 3SJHA 4LSLA 4BRGA 3L3UA 1C0TA 2ITMA 1NJYA 4MFBA 1BHLA 1U47A 2ETJA 2CGKA 1K8KB 5SWMA 4M42A 3N4QA 5FPEA 5FRNA 4OKEA 2A40A 4H5VA 1CXQA 5AQWA 3BGRA 2FC0A 1U2VA 4O5BA 1SS6A 5BN8A 3K0SA 2FBYA 4RTFD 5FLXO 4CJ5A 4IDKA 4JRQA 2G8FA 4FVUA 1LAVA 4BE0A 4EHTA 4PQUA 4F2RA 1VQ5N 4KI4A 4IKFA 1WAJA 5IT9O 3ZSRA 1RNHA 1O1WA 3A0IX 4FCYA 1TAQA 5AZIA 1ITGA 4KTZA 3FZMA 1WBBA 5I42A 4Q5VA 4W5NA 1DGKN 4I2PA 1LWCA 3M3ZA 2YHWA 2D0AA 4YFUA 4WF9L 2G8IA 3HOTA 4OKKA 1HRHA 1VSLA 2NRHA 4DLEA 1X3MA 4YHHK 5LL6Z 3A2FA 4MO5A 3JXUA 3DRSA 1WBDA 4FJ5A 3U8XA 1ESVA 4B1ZA 3DXKB 1WSHA 2FBTA 4H0PA 4Y1DA 3D7EO 3I55N 4HUGA 4BR9A 3BY5A 1J5EK 3I0SA 1OH6A 3CCJN 2B5JA 4B9VA 1WSIA 3SV3A 1GLFO 3HPOA 3NH0A 2VG6A 3KVGA 4DS4A 4CFBA 2UUCK 4JLHA 4FJGA 3HPHA 3TANA 2NRXA 1I39A 3S3MA 4KFBA 5AQOA 1RT1A 1WLJA 3ID8A 4FLXA 3ZSXA 1BG3A 4KH4A 4KHSA 4M3WA 3M8SA 4O44A 3AO4A 4HCBA 5K14A 4DSIA 4LF4K 4GV9A 3BZCA 5ADXA 3MN5A 1JCEA 4BRFA 3MCPA 3CCLN 4BGAA 4LY7A 3MEGA 4W5RA 4NCAA 2FLOA 4NCBA 1RILA 2IVOA 1IV0A 4KI6A 2HBMA 3TR8A 3KD5E 4DF4A 3L0QA 3ENBA 4CJSA 1BUPA 4ZTFA 3O9UA 1HMVA 4A61A 1RBVA 4FK2A 3TABA 4JD2B 1UWBA 3AO3A 4J2AA 4WFBL 3ATUA 4FM0A 2Q3SA 2W40A 4CGDA 4RWTA 1HNVA 4M3UA 2QXLA 1ATRA 4FJLA 3H46O 1KD1O 3QESA 2VCPA 2YHYA 2GV9A 3DAWA 4BR5A 2HNYA 3QBWA 3VQDA 3QFUA 3OYLA 1DTQA 3AVBA 4YOTA 2UXDK 3G4SN 3SBTA 4ELVA 1TAUA 3VQQA 4CJRA 1Q9XA 4FJIA 4IZ9A 3R8EA 2QEXN 1NK9A 3NF7A 2P5OA 3K5NA 3K58A 1D9FA 3CIPA 3CFRA 4DSLA 4LF6K 4DTJA 4NXNK 2QK9A 3TSUA 3OS0A 4DSKA 3FZHA 5M1OA 1W9HA
chains in the Genus database with same CATH topology
1U45A 4CGHA 3VA3A 4CK1A 1GOBA 1HYZA 2OPQA 3ZSWA 4CF2A 2A1RA 1FK9A 2Z1HA 3ZSZA 4B08A 2QXFA 5HRPA 3NE6A 4DWIA 1LW0A 1QE1A 3P83D 2HVIA 3LZIA 3ULDA 5J2MA 2RN2A 4F2SA 4FJMA 3K5LA 1YTAA 1XWLA 4E19A 3B6OA 3H08A 3HL8A 1U48A 1NOYA 4Z0UA 3ASMA 3DI6A 1ZBLA 4FJ7A 4CE9A 1X1PA 4JRPA 3VQEA 4CIFA 1GOCA 3RRGA 3LALA 2XY7A 3WNHA 3HM9A 4DTNA 4B9TA 2OPRA 1VSJA 2X6NA 3HPGA 3KLHA 3I0RA 4IFVA 4DFPA 4KO0A 1VRUA 4E7LA 2G8HA 1LV5A 4CGFA 2HHTA 1TL3A 3LZJA 1KLMA 2XY5A 1SL2A 4XIUA 1UA0A 1KVCA 1JL1A 3LWMA 3ISNC 3LP1A 4CJVA 4BE2A 4AHCA 3PX0A 1XC9A 1NK7A 1SL1A 4M3XA 1W0HA 2HHSA 1BCOA 1Z26A 3AVIA 1JLFA 4J2EA 2DY4A 1TVRA 1ZBUA 4FLTA 3VQ5A 4DSFA 3CFOA 1WSFA 4LH5A 1KLNA 3ZT2A 1K6YA 5T7BA 3JSMA 3QNNA 2OYQA 3P5JA 2DFHA 4RW4A 2WOMA 3DOKA 4BDZA 4KAZA 4CJPA 1SKRA 3MEEA 3AVFA 3MEDA 4O4GA 1L3SA 2HW3A 1WSEA 1J5OA 4CF8A 2B4JA 4KREA 2KZMA 1D8YA 5C42A 1S1VA 1X9WA 1YTUA 1WNSA 1X9MA 4W5TA 4CEEA 2PYLA 3SJJA 1G15A 3RMCA 3PO5A 2JGUA 3AVMA 3TAMA 3I8DA 5J2QA 1KVBA 3C6TA 1BQNA 2G8KA 2YNHA 3KKSA 3LAKA 4FK0A 3S9HA 4B9SA 3CYMA 2Z1GA 1S1TA 4FVMA 4O55A 3QLHA 3OS2A 1KFSA 4C8LA 4DU1A 2ZE2A 1JKHA 1JLEA 2XHBA 4DTPA 1VSEA 3K5OA 3HP9A 2BGGA 1S9EA 2BE2A 4Z4CA 3KLGA 3O3HA 4E1MA 1ZBFA 3NH2A 1UA1A 2ATQA 4DQSA 1C6VA 1Y97A 4I9LA 1TK0A 5CZ2A 3M8RA 3KD1E 3OYGA 1TKXA 1RTJA 1VSKA 4CHOA 4C8MA 4DF8A 1XHXA 3DYAA 2YNGA 1JLBA 4HVJA 2FBVA 3OYJA 4DU4A 1RDDA 2G8WA 3ALYA 2X6SA 3OYEA 3QIOA 3LPUA 3QETA 4L8RB 5E41A 3ZSOA 4JS4A 2IDOA 1SUQA 3O4NA 4CCHA 4DFJA 4ID5A 4N56A 3SQ2A 2Y1JA 1VSMA 4CJLA 3V9WA 3RR8A 1IO2A 3NGZA 2EHGA 3KLIA 1SV5A 3OY9A 4DLGA 1U4BA 3AVJA 4B9UA 2FBXA 1DLOA 2HB5A 1NJZA 5CYQA 4CJWA 4FLWA 3NHGA 3NF9A 4OVLA 4CHQA 3C6UA 4CJKA 1XI1A 3QEXA 4CGGA 2YV0X 1TKZA 3AVCA 4OPJA 3VA0A 3L2WA 3SUOA 4E0DA 4FXDA 5HRRA 2IAJA 3SI6A 3U3YA 4CJ4A 4I9QA 3KK3A 3O4QA 3LAMA 4C8OA 3IAYA 1A5XA 3OYBA 3DRPA 4FLVA 3IG1A 2GUIA 3PX4A 2HHUA 2ZD1A 4LSNA 4E1NA 4Z4HA 4C8KA 4EP5A 3AO5A 4AHSA 4CJEA 3TI0A 1ZBIA 2A1SA 4FLZA 1MU2A 4H8KA 2W42A 1HJRA 4CIGA 3F9KA 3OYAA 5C24A 3TWHA 4FJ9A 2HHXA 1DTTA 4NYNA 3MAQA 4FJNA 4MQ3A 4E7HA 1F21A 2OZSA 2Z1IA 2XRIA 4CF0A 3AVAA 2VG5A 3NBPA 4Z4GA 4CJ3A 4DMNA 3V9XA 2OPSA 3RR7A 3T1AA 1IKYA 2P1JA 4TSXA 1RDCA 1JLAA 2I5JA 3AVNA 2GBZA 4M45A 3NAEA 4CK2A 4FM2A 3BDPA 4FJKA 1RBTA 2RF2A 1Z25A 4OPKA 3L2VA 2BANA 2G8UA 1KRPA 1NK4A 3DLEA 3WNEA 4YNQA 3VQ4A 1NKEA 3C94A 1CXUA 2WONA 3AVGA 3PUFA 1SKSA 4RW7A 4F8RA 2F96A 2RKIA 4CESA 3OS1A 1HPZA 3HYFA 1BI4A 2YKMA 2P5GA 1YVUA 3EYZA 3QEVA 4DQQA 3SUQA 1QSLA 1GOAA 4IBNA 4DQIA 3LP2A 1L3UA 3AO1A 4AHTA 4DQRA 3OYMA 4LD0A 3HVTA 4CERA 4PY5A 4FYDA 4E7KA 3V9UA 3MECA 1J53A 3T3FA 1FKPA 3DOLA 1LAWA 4KTWA 1HNIA 4BDYA 1QTMA 2VG7A 1QHTA 1TKTA 3AVHA 3RMBA 3KJVA 3SYZA 2QKBA 1KVAA 3OJSA 3OYDA 1BIUA 3O3FA 3S3OA 1NJXA 4M3ZA 2D5RA 1N6QA 3KIOA 1S1UA 3QEIA 3M8QA 4OJRA 1WSGA 3RMAA 3SPZA 1T8EA 1IKWA 2OA8A 4CK3A 3VQ6A 3OYNA 4FW1A 4UQGA 1RT6A 3V1RA 1VSIA 1S6PA 4GW6A 4CFCA 4CJTA 3DLHA 4Z4EA 1UAXA 2HHWA 1J54A 4CJUA 1JLCA 1J9AA 3ZSQA 2QKKA 1JLQA 3T19A 1KSPA 1L3TA 3FFIA 3DLGA 3EY1A 3RMDA 1BCMA 2Z1JA 1LWEA 5KRTA 3CM6A 3ZSVA 3HXMA 3EZ5A 2X74A 3VQ9A 3QINA 1RTHA 4BDPA 1S9GA 2IOCA 3ITHA 2PY5A 1B9FA 4C8NA 3IRXA 5HP1A 3QERA 4Z4FA 4ICLA 4CGIA 1RBUA 3D45A 4KRFA 4FJHA 4DSKA 2KZZA 4B9NA 3HSTB 4PUOA 2DTUA 4H4MA 1S6QA 4E7JA 4JS5A 2B6AA 4DQPA 1S1XA 4K8ZA 4KKOA 3M8PA 3TAGA 1TV6A 3QNOA 3D0PA 1RTDA 3AVKA 1KCFA 1TGOA 2YKNA 3HK2A 3NH1A 4BE1A 1SKWA 1RT4A 3OYFA 3U6FA 2O4IA 1JXBA 4E7IA 4DG1A 1CLQA 2D0CA 3AA2A 4DU3A 4Y1CA 1R0AA 3AA4A 3AA3A 1TK5A 1A5WA 4DTRA 5FRMA 3LP0A 3CG7A 3P1GA 3TAPA 2KFNA 1LW2A 4HUEA 2HNZA 2XY8A 1QSYA 3VQAA 4FZXC 3V9SA 1IH7A 4HUFA 4FJXA 3ZSYA 2E6MA 4QAGA 4KHNA 5C25A 4M3RA 5KGWA 4ZHRA 3K59A 3ZT1A 2NUBA 1EKEA 4B8AB 4KHQA 3TAQA 4PWDA 3KK1A 3PX6A 4CECA 3SCXA 3K2PA 3LANA 4FZYA 5HBMA 3KKRA 4CEZA 1HYVA 3MXIA 4DSJA 1IKXA 4KHWA 2F8SA 4DTSA 2OZMA 4QOZB 3HT3A 3LDSA 3JYTA 1ZBHA 4G1QA 3RTVA 1C0UA 2KTQA 2KW4A 3HJFA 4LSLA 4KHUA 4DTXA 3AVLA 5J1EA 3L3UA 4IG3A 4CHYA 4GVMA 2E6LA 1C0TA 3AO2A 3DLKA 4PA1A 2AJQA 1NJYA 3VN5A 4MFBA 1BHLA 1KTQA 5HROA 2ETJA 1U47A 1S1WA 3DMJA 4J2BA 4ELUA 2EX3A 4ID1A 5SWMA 4KB1A 4M42A 5J2PA 4HCCA 5CY4A 4FZZA 5FRNA 4OKEA 1CXQA 1BI4B 1T03A 4DTOA 4AHVA 3BGRA 2FC0A 3G0ZA 3NDKA 4FLYA 4DTUA 4M3TA 4O5BA 4EZ9A 3QO9A 4CEOA 1JLGA 4H4OA 2E4LA 2OPPA 2FBYA 5HLFA 1UOCA 4CJ5A 1BIZA 4IDKA 1RT3A 4JRQA 2G8FA 2D0BA 1LAVA 3NF6A 4RW9A 4HTUA 4BE0A 4PQUA 4KV8A 4CHNA 4F2RA 3WNGA 3QIPA 4KI4A 4IKFA 1WAJA 3DLBA 3UIQA 2ITGA 4FK4A 3V1QA 3ZSRA 1RT7A 2Y1IA 1WN7A 1RNHA 1CZBA 2XO7A 1O1WA 4NYFA 4FCYA 3SUNA 1TAQA 3SQ1A 2JLEA 4O0IA 1ITGA 3HVRA 2PZSA 4KTZA 4Z4IA 5CYMA 4B9LA 4DFMA 5I42A 3NFAA 2DFFA 1NKBA 2HNDA 1D9DA 4Q5VA 4F3TA 4N76A 4W5NA 1JXEA 1FKOA 3OYCA 3TARA 4I2PA 1LWCA 3VQPA 3K5MA 2D0AA 3VQBA 3DLRA 4YFUA 2KFZA 1U04A 4KB0A 5KI6A 3RRHA 1NK6A 1C1BA 2G8IA 2HHVA 5I3UA 1B9DA 4OKKA 1HRHA 5FDLA 1ZYQA 1B92A 3KLFA 1VSLA 3MXMA 4CIEA 1NK0A 5KGXA 4AH9A 3VQCA 3L2UA 4CF9A 4CEQA 1RT2A 5FROA 3OYKA 4DLEA 3TAFA 4F3OA 3A2FA 4FJJA 3DRSA 4FJ5A 3OJUA 4OGEA 1RBSA 5D3GA 1VK0A 3OYHA 1WSHA 2FBTA 4HUGA 4Y1DA 5JS2A 4EZ6A 4OKJA 3HO1A 4I7FA 5SZTA 4CEDA 4CEBA 4CEFA 3C95A 1XHZA 3I0SA 3G10A 5HRSA 3KK2A 3NCIA 2B5JA 4ELTA 1EETA 1WSIA 1C1AA 4B9VA 4CFAA 3TAEA 4KTQA 3SV3A 5DMRA 2F8TA 1L5UA 3OYIA 2YHAA 1I3AA 3U3GA 3QEWA 4CGJA 2KQ2A 4BWMA 2YHBA 4CF1A 3ZT3A 4E3SA 3PY8A 1CZ9A 1BQMA 2DFEA 3HPOA 3NH0A 2VG6A 4FJGA 4DS4A 5EU7A 4CFBA 2IS3A 4JLHA 3HPHA 4BWJA 1NK8A 2IC3A 3TANA 1RDBA 5KRSA 1I39A 4OGCA 3S3MA 1HYSA 2VWKA 4KFBA 1YT3A 2O4GA 3CM5A 1D5AA 3NGYA 1RT1A 1WLJA 4FLXA 3MXJA 3SNNA 3AA5X 3DM2A 3K57A 3F73A 4B9MA 4DTMA 1JL2A 3ZSXA 3ZCMA 4AHRA 4N5SA 4W5OA 4I2QA 4M41A 4KHSA 4M3WA 3M8SA 4O44A 3AO4A 2RPIA 1C0MA 1TL1A 3LPTA 3LWLA 1T05A 4HCBA 3CQ8A 4J2DA 1NOZA 5DK5A 4IFYA 5K14A 4M3YA 4DSIA 4E89A 1KFDA 2HHQA 4CEAA 1FXXA 3SV4A 2IGIA 4B3OA 4F4KA 1BL3A 1EP4A 3SQ0A 4FM1A 4N41A 3V1OA 3V6DA 1NK5A 4LY7A 3MEGA 4W5RA 3CFPA 5J2NA 4NCAA 1QS4A 5CZ1A 3SQ4A 4QCLA 1WAFA 3SPYA 4KHYA 4DFKA 3SZ2A 1T7PA 3V81A 1RILA 4NCBA 4WE1A 4HHTA 3S3NA 1WSJA 4ZTJA 3ZT4A 1X9SA 4DSEA 3SUPA 3NF8A 1N5YA 3THVA 5JS1A 3PO4A 4NCGA 4CFDA 3V4IA 3E01A 1U49A 3RWUA 1RCHA 4KI6A 1VSFA 4AHUA 1EXQA 3LP3A 3TR8A 2P51A 4DF4A 3KD5E 4OLAA 2LSNA 1RT5A 4CJSA 2R7YA 4O0JA 2VWJA 1QQCA 5HRNA 4ZTFA 1HMVA 1RDAA 4FW2A 4DS5A 1TKDA 1Q9YA 3ZT0A 4N47A 1RBVA 2X78A 5KTQA 4K8XA 4FK2A 1Q8IA 3IS9A 3KLEA 2ZQBA 3OVNA 1RTIA 4EP4A 3TABA 1UWBA 3AO3A 4J2AA 2HVHA 2XY6A 4FM0A 2Q3SA 1HQUA 4CJQA 4OLBA 4CJFA 4CGDA 3PV8A 3QEPA 3O3GA 3AV9A 4CHZA 1IG9A 1HNVA 1LWFA 1NKCA 4M3UA 3VQ7A 1S5JA 1QSSA 2G8VA 1ASUA 4LH4A 4FJLA 3QESA 1TK8A 1VRTA 4RW6A 4AILC 4FLUA 2GV9A 4BACA 2BDPA 3L8BA 2HNYA 3WNFA 3VQDA 1VSHA 4RG8A 4W5QA 3DRRA 4GMJB 3OYLA 3L2QA 1DTQA 1C1CA 1REVA 1RBRA 4KPYA 3NGIA 4FJ8A 1NJWA 1BGXT 1EX4A 3AVBA 4CHPA 3B6PA 2PYJA 1IKVA 3L2RA 2HMIA 4ELVA 3VQQA 4CJRA 3KTQA 1TAUA 4R5PA 1SL0A 1Q9XA 4Q0BA 4B8CA 1A5VA 3HP6A 3VQ8A 4FJIA 1VSDA 1HQEA 1L3VA 2YNFA 1ASWA 3L3VA 1NK9A 2YNIA 3NF7A 2P5OA 3K5NA 3K58A 1D9FA 1BISA 3CFRA 4IG0A 4DSLA 4DTJA 2QK9A 1ASVA 4RW8A 3OS0A 3V9ZA 1W9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U45 A;  4CGH A;  3VA3 A;  4CK1 A;  1GOB A;  1HYZ A;  2OPQ A;  3ZSW A;  4CF2 A;  2A1R A;  1FK9 A;  2Z1H A;  3ZSZ A;  4B08 A;  2QXF A;  5HRP A;  3NE6 A;  4DWI A;  1LW0 A;  1QE1 A;  3P83 D;  2HVI A;  3LZI A;  3ULD A;  5J2M A;  2RN2 A;  4F2S A;  4FJM A;  3K5L A;  1YTA A;  1XWL A;  4E19 A;  3B6O A;  3H08 A;  3HL8 A;  1U48 A;  1NOY A;  4Z0U A;  3ASM A;  3DI6 A;  1ZBL A;  4FJ7 A;  4CE9 A;  1X1P A;  4JRP A;  3VQE A;  4CIF A;  1GOC A;  3RRG A;  3LAL A;  2XY7 A;  3WNH A;  3HM9 A;  4DTN A;  4B9T A;  2OPR A;  1VSJ A;  2X6N A;  3HPG A;  3KLH A;  3I0R A;  4IFV A;  4DFP A;  4KO0 A;  1VRU A;  4E7L A;  2G8H A;  1LV5 A;  4CGF A;  2HHT A;  1TL3 A;  3LZJ A;  1KLM A;  2XY5 A;  1SL2 A;  4XIU A;  1UA0 A;  1KVC A;  1JL1 A;  3LWM A;  3ISN C;  3LP1 A;  4CJV A;  4BE2 A;  4AHC A;  3PX0 A;  1XC9 A;  1NK7 A;  1SL1 A;  4M3X A;  1W0H A;  2HHS A;  1BCO A;  1Z26 A;  3AVI A;  1JLF A;  4J2E A;  2DY4 A;  1TVR A;  1ZBU A;  4FLT A;  3VQ5 A;  4DSF A;  3CFO A;  1WSF A;  4LH5 A;  1KLN A;  3ZT2 A;  1K6Y A;  5T7B A;  3JSM A;  3QNN A;  2OYQ A;  3P5J A;  2DFH A;  4RW4 A;  2WOM A;  3DOK A;  4BDZ A;  4KAZ A;  4CJP A;  1SKR A;  3MEE A;  3AVF A;  3MED A;  4O4G A;  1L3S A;  2HW3 A;  1WSE A;  1J5O A;  4CF8 A;  2B4J A;  4KRE A;  2KZM A;  1D8Y A;  5C42 A;  1S1V A;  1X9W A;  1YTU A;  1WNS A;  1X9M A;  4W5T A;  4CEE A;  2PYL A;  3SJJ A;  1G15 A;  3RMC A;  3PO5 A;  2JGU A;  3AVM A;  3TAM A;  3I8D A;  5J2Q A;  1KVB A;  3C6T A;  1BQN A;  2G8K A;  2YNH A;  3KKS A;  3LAK A;  4FK0 A;  3S9H A;  4B9S A;  3CYM A;  2Z1G A;  1S1T A;  4FVM A;  4O55 A;  3QLH A;  3OS2 A;  1KFS A;  4C8L A;  4DU1 A;  2ZE2 A;  1JKH A;  1JLE A;  2XHB A;  4DTP A;  1VSE A;  3K5O A;  3HP9 A;  2BGG A;  1S9E A;  2BE2 A;  4Z4C A;  3KLG A;  3O3H A;  4E1M A;  1ZBF A;  3NH2 A;  1UA1 A;  2ATQ A;  4DQS A;  1C6V A;  1Y97 A;  4I9L A;  1TK0 A;  5CZ2 A;  3M8R A;  3KD1 E;  3OYG A;  1TKX A;  1RTJ A;  1VSK A;  4CHO A;  4C8M A;  4DF8 A;  1XHX A;  3DYA A;  2YNG A;  1JLB A;  4HVJ A;  2FBV A;  3OYJ A;  4DU4 A;  1RDD A;  2G8W A;  3ALY A;  2X6S A;  3OYE A;  3QIO A;  3LPU A;  3QET A;  4L8R B;  5E41 A;  3ZSO A;  4JS4 A;  2IDO A;  1SUQ A;  3O4N A;  4CCH A;  4DFJ A;  4ID5 A;  4N56 A;  3SQ2 A;  2Y1J A;  1VSM A;  4CJL A;  3V9W A;  3RR8 A;  1IO2 A;  3NGZ A;  2EHG A;  3KLI A;  1SV5 A;  3OY9 A;  4DLG A;  1U4B A;  3AVJ A;  4B9U A;  2FBX A;  1DLO A;  2HB5 A;  1NJZ A;  5CYQ A;  4CJW A;  4FLW A;  3NHG A;  3NF9 A;  4OVL A;  4CHQ A;  3C6U A;  4CJK A;  1XI1 A;  3QEX A;  4CGG A;  2YV0 X;  1TKZ A;  3AVC A;  4OPJ A;  3VA0 A;  3L2W A;  3SUO A;  4E0D A;  4FXD A;  5HRR A;  2IAJ A;  3SI6 A;  3U3Y A;  4CJ4 A;  4I9Q A;  3KK3 A;  3O4Q A;  3LAM A;  4C8O A;  3IAY A;  1A5X A;  3OYB A;  3DRP A;  4FLV A;  3IG1 A;  2GUI A;  3PX4 A;  2HHU A;  2ZD1 A;  4LSN A;  4E1N A;  4Z4H A;  4C8K A;  4EP5 A;  3AO5 A;  4AHS A;  4CJE A;  3TI0 A;  1ZBI A;  2A1S A;  4FLZ A;  1MU2 A;  4H8K A;  2W42 A;  1HJR A;  4CIG A;  3F9K A;  3OYA A;  5C24 A;  3TWH A;  4FJ9 A;  2HHX A;  1DTT A;  4NYN A;  3MAQ A;  4FJN A;  4MQ3 A;  4E7H A;  1F21 A;  2OZS A;  2Z1I A;  2XRI A;  4CF0 A;  3AVA A;  2VG5 A;  3NBP A;  4Z4G A;  4CJ3 A;  4DMN A;  3V9X A;  2OPS A;  3RR7 A;  3T1A A;  1IKY A;  2P1J A;  4TSX A;  1RDC A;  1JLA A;  2I5J A;  3AVN A;  2GBZ A;  4M45 A;  3NAE A;  4CK2 A;  4FM2 A;  3BDP A;  4FJK A;  1RBT A;  2RF2 A;  1Z25 A;  4OPK A;  3L2V A;  2BAN A;  2G8U A;  1KRP A;  1NK4 A;  3DLE A;  3WNE A;  4YNQ A;  3VQ4 A;  1NKE A;  3C94 A;  1CXU A;  2WON A;  3AVG A;  3PUF A;  1SKS A;  4RW7 A;  4F8R A;  2F96 A;  2RKI A;  4CES A;  3OS1 A;  1HPZ A;  3HYF A;  1BI4 A;  2YKM A;  2P5G A;  1YVU A;  3EYZ A;  3QEV A;  4DQQ A;  3SUQ A;  1QSL A;  1GOA A;  4IBN A;  4DQI A;  3LP2 A;  1L3U A;  3AO1 A;  4AHT A;  4DQR A;  3OYM A;  4LD0 A;  3HVT A;  4CER A;  4PY5 A;  4FYD A;  4E7K A;  3V9U A;  3MEC A;  1J53 A;  3T3F A;  1FKP A;  3DOL A;  1LAW A;  4KTW A;  1HNI A;  4BDY A;  1QTM A;  2VG7 A;  1QHT A;  1TKT A;  3AVH A;  3RMB A;  3KJV A;  3SYZ A;  2QKB A;  1KVA A;  3OJS A;  3OYD A;  1BIU A;  3O3F A;  3S3O A;  1NJX A;  4M3Z A;  2D5R A;  1N6Q A;  3KIO A;  1S1U A;  3QEI A;  3M8Q A;  4OJR A;  1WSG A;  3RMA A;  3SPZ A;  1T8E A;  1IKW A;  2OA8 A;  4CK3 A;  3VQ6 A;  3OYN A;  4FW1 A;  4UQG A;  1RT6 A;  3V1R A;  1VSI A;  1S6P A;  4GW6 A;  4CFC A;  4CJT A;  3DLH A;  4Z4E A;  1UAX A;  2HHW A;  1J54 A;  4CJU A;  1JLC A;  1J9A A;  3ZSQ A;  2QKK A;  1JLQ A;  3T19 A;  1KSP A;  1L3T A;  3FFI A;  3DLG A;  3EY1 A;  3RMD A;  1BCM A;  2Z1J A;  1LWE A;  5KRT A;  3CM6 A;  3ZSV A;  3HXM A;  3EZ5 A;  2X74 A;  3VQ9 A;  3QIN A;  1RTH A;  4BDP A;  1S9G A;  2IOC A;  3ITH A;  2PY5 A;  1B9F A;  4C8N A;  3IRX A;  5HP1 A;  3QER A;  4Z4F A;  4ICL A;  4CGI A;  1RBU A;  3D45 A;  4KRF A;  4FJH A;  4DSK A;  2KZZ A;  4B9N A;  3HST B;  4PUO A;  2DTU A;  4H4M A;  1S6Q A;  4E7J A;  4JS5 A;  2B6A A;  4DQP A;  1S1X A;  4K8Z A;  4KKO A;  3M8P A;  3TAG A;  1TV6 A;  3QNO A;  3D0P A;  1RTD A;  3AVK A;  1KCF A;  1TGO A;  2YKN A;  3HK2 A;  3NH1 A;  4BE1 A;  1SKW A;  1RT4 A;  3OYF A;  3U6F A;  2O4I A;  1JXB A;  4E7I A;  4DG1 A;  1CLQ A;  2D0C A;  3AA2 A;  4DU3 A;  4Y1C A;  1R0A A;  3AA4 A;  3AA3 A;  1TK5 A;  1A5W A;  4DTR A;  5FRM A;  3LP0 A;  3CG7 A;  3P1G A;  3TAP A;  2KFN A;  1LW2 A;  4HUE A;  2HNZ A;  2XY8 A;  1QSY A;  3VQA A;  4FZX C;  3V9S A;  1IH7 A;  4HUF A;  4FJX A;  3ZSY A;  2E6M A;  4QAG A;  4KHN A;  5C25 A;  4M3R A;  5KGW A;  4ZHR A;  3K59 A;  3ZT1 A;  2NUB A;  1EKE A;  4B8A B;  4KHQ A;  3TAQ A;  4PWD A;  3KK1 A;  3PX6 A;  4CEC A;  3SCX A;  3K2P A;  3LAN A;  4FZY A;  5HBM A;  3KKR A;  4CEZ A;  1HYV A;  3MXI A;  4DSJ A;  1IKX A;  4KHW A;  2F8S A;  4DTS A;  2OZM A;  4QOZ B;  3HT3 A;  3LDS A;  3JYT A;  1ZBH A;  4G1Q A;  3RTV A;  1C0U A;  2KTQ A;  2KW4 A;  3HJF A;  4LSL A;  4KHU A;  4DTX A;  3AVL A;  5J1E A;  3L3U A;  4IG3 A;  4CHY A;  4GVM A;  2E6L A;  1C0T A;  3AO2 A;  3DLK A;  4PA1 A;  2AJQ A;  1NJY A;  3VN5 A;  4MFB A;  1BHL A;  1KTQ A;  5HRO A;  2ETJ A;  1U47 A;  1S1W A;  3DMJ A;  4J2B A;  4ELU A;  2EX3 A;  4ID1 A;  5SWM A;  4KB1 A;  4M42 A;  5J2P A;  4HCC A;  5CY4 A;  4FZZ A;  5FRN A;  4OKE A;  1CXQ A;  1BI4 B;  1T03 A;  4DTO A;  4AHV A;  3BGR A;  2FC0 A;  3G0Z A;  3NDK A;  4FLY A;  4DTU A;  4M3T A;  4O5B A;  4EZ9 A;  3QO9 A;  4CEO A;  1JLG A;  4H4O A;  2E4L A;  2OPP A;  2FBY A;  5HLF A;  1UOC A;  4CJ5 A;  1BIZ A;  4IDK A;  1RT3 A;  4JRQ A;  2G8F A;  2D0B A;  1LAV A;  3NF6 A;  4RW9 A;  4HTU A;  4BE0 A;  4PQU A;  4KV8 A;  4CHN A;  4F2R A;  3WNG A;  3QIP A;  4KI4 A;  4IKF A;  1WAJ A;  3DLB A;  3UIQ A;  2ITG A;  4FK4 A;  3V1Q A;  3ZSR A;  1RT7 A;  2Y1I A;  1WN7 A;  1RNH A;  1CZB A;  2XO7 A;  1O1W A;  4NYF A;  4FCY A;  3SUN A;  1TAQ A;  3SQ1 A;  2JLE A;  4O0I A;  1ITG A;  3HVR A;  2PZS A;  4KTZ A;  4Z4I A;  5CYM A;  4B9L A;  4DFM A;  5I42 A;  3NFA A;  2DFF A;  1NKB A;  2HND A;  1D9D A;  4Q5V A;  4F3T A;  4N76 A;  4W5N A;  1JXE A;  1FKO A;  3OYC A;  3TAR A;  4I2P A;  1LWC A;  3VQP A;  3K5M A;  2D0A A;  3VQB A;  3DLR A;  4YFU A;  2KFZ A;  1U04 A;  4KB0 A;  5KI6 A;  3RRH A;  1NK6 A;  1C1B A;  2G8I A;  2HHV A;  5I3U A;  1B9D A;  4OKK A;  1HRH A;  5FDL A;  1ZYQ A;  1B92 A;  3KLF A;  1VSL A;  3MXM A;  4CIE A;  1NK0 A;  5KGX A;  4AH9 A;  3VQC A;  3L2U A;  4CF9 A;  4CEQ A;  1RT2 A;  5FRO A;  3OYK A;  4DLE A;  3TAF A;  4F3O A;  3A2F A;  4FJJ A;  3DRS A;  4FJ5 A;  3OJU A;  4OGE A;  1RBS A;  5D3G A;  1VK0 A;  3OYH A;  1WSH A;  2FBT A;  4HUG A;  4Y1D A;  5JS2 A;  4EZ6 A;  4OKJ A;  3HO1 A;  4I7F A;  5SZT A;  4CED A;  4CEB A;  4CEF A;  3C95 A;  1XHZ A;  3I0S A;  3G10 A;  5HRS A;  3KK2 A;  3NCI A;  2B5J A;  4ELT A;  1EET A;  1WSI A;  1C1A A;  4B9V A;  4CFA A;  3TAE A;  4KTQ A;  3SV3 A;  5DMR A;  2F8T A;  1L5U A;  3OYI A;  2YHA A;  1I3A A;  3U3G A;  3QEW A;  4CGJ A;  2KQ2 A;  4BWM A;  2YHB A;  4CF1 A;  3ZT3 A;  4E3S A;  3PY8 A;  1CZ9 A;  1BQM A;  2DFE A;  3HPO A;  3NH0 A;  2VG6 A;  4FJG A;  4DS4 A;  5EU7 A;  4CFB A;  2IS3 A;  4JLH A;  3HPH A;  4BWJ A;  1NK8 A;  2IC3 A;  3TAN A;  1RDB A;  5KRS A;  1I39 A;  4OGC A;  3S3M A;  1HYS A;  2VWK A;  4KFB A;  1YT3 A;  2O4G A;  3CM5 A;  1D5A A;  3NGY A;  1RT1 A;  1WLJ A;  4FLX A;  3MXJ A;  3SNN A;  3AA5 X;  3DM2 A;  3K57 A;  3F73 A;  4B9M A;  4DTM A;  1JL2 A;  3ZSX A;  3ZCM A;  4AHR A;  4N5S A;  4W5O A;  4I2Q A;  4M41 A;  4KHS A;  4M3W A;  3M8S A;  4O44 A;  3AO4 A;  2RPI A;  1C0M A;  1TL1 A;  3LPT A;  3LWL A;  1T05 A;  4HCB A;  3CQ8 A;  4J2D A;  1NOZ A;  5DK5 A;  4IFY A;  5K14 A;  4M3Y A;  4DSI A;  4E89 A;  1KFD A;  2HHQ A;  4CEA A;  1FXX A;  3SV4 A;  2IGI A;  4B3O A;  4F4K A;  1BL3 A;  1EP4 A;  3SQ0 A;  4FM1 A;  4N41 A;  3V1O A;  3V6D A;  1NK5 A;  4LY7 A;  3MEG A;  4W5R A;  3CFP A;  5J2N A;  4NCA A;  1QS4 A;  5CZ1 A;  3SQ4 A;  4QCL A;  1WAF A;  3SPY A;  4KHY A;  4DFK A;  3SZ2 A;  1T7P A;  3V81 A;  1RIL A;  4NCB A;  4WE1 A;  4HHT A;  3S3N A;  1WSJ A;  4ZTJ A;  3ZT4 A;  1X9S A;  4DSE A;  3SUP A;  3NF8 A;  1N5Y A;  3THV A;  5JS1 A;  3PO4 A;  4NCG A;  4CFD A;  3V4I A;  3E01 A;  1U49 A;  3RWU A;  1RCH A;  4KI6 A;  1VSF A;  4AHU A;  1EXQ A;  3LP3 A;  3TR8 A;  2P51 A;  4DF4 A;  3KD5 E;  4OLA A;  2LSN A;  1RT5 A;  4CJS A;  2R7Y A;  4O0J A;  2VWJ A;  1QQC A;  5HRN A;  4ZTF A;  1HMV A;  1RDA A;  4FW2 A;  4DS5 A;  1TKD A;  1Q9Y A;  3ZT0 A;  4N47 A;  1RBV A;  2X78 A;  5KTQ A;  4K8X A;  4FK2 A;  1Q8I A;  3IS9 A;  3KLE A;  2ZQB A;  3OVN A;  1RTI A;  4EP4 A;  3TAB A;  1UWB A;  3AO3 A;  4J2A A;  2HVH A;  2XY6 A;  4FM0 A;  2Q3S A;  1HQU A;  4CJQ A;  4OLB A;  4CJF A;  4CGD A;  3PV8 A;  3QEP A;  3O3G A;  3AV9 A;  4CHZ A;  1IG9 A;  1HNV A;  1LWF A;  1NKC A;  4M3U A;  3VQ7 A;  1S5J A;  1QSS A;  2G8V A;  1ASU A;  4LH4 A;  4FJL A;  3QES A;  1TK8 A;  1VRT A;  4RW6 A;  4AIL C;  4FLU A;  2GV9 A;  4BAC A;  2BDP A;  3L8B A;  2HNY A;  3WNF A;  3VQD A;  1VSH A;  4RG8 A;  4W5Q A;  3DRR A;  4GMJ B;  3OYL A;  3L2Q A;  1DTQ A;  1C1C A;  1REV A;  1RBR A;  4KPY A;  3NGI A;  4FJ8 A;  1NJW A;  1BGX T;  1EX4 A;  3AVB A;  4CHP A;  3B6P A;  2PYJ A;  1IKV A;  3L2R A;  2HMI A;  4ELV A;  3VQQ A;  4CJR A;  3KTQ A;  1TAU A;  4R5P A;  1SL0 A;  1Q9X A;  4Q0B A;  4B8C A;  1A5V A;  3HP6 A;  3VQ8 A;  4FJI A;  1VSD A;  1HQE A;  1L3V A;  2YNF A;  1ASW A;  3L3V A;  1NK9 A;  2YNI A;  3NF7 A;  2P5O A;  3K5N A;  3K58 A;  1D9F A;  1BIS A;  3CFR A;  4IG0 A;  4DSL A;  4DTJ A;  2QK9 A;  1ASV A;  4RW8 A;  3OS0 A;  3V9Z A;  1W9H A; 
#chains in the Genus database with same CATH topology
 1U45 A;  2E2Q A;  4CK1 A;  2Z1H A;  4B08 A;  3ZSZ A;  4B1W B;  1S22 A;  2QXF A;  1QE1 A;  3P83 D;  4FJM A;  3K5L A;  2QWO A;  2A5X A;  2D0O A;  3HL8 A;  1NOY A;  1SAZ A;  4CE9 A;  1NU0 A;  1X1P A;  4FWP A;  4JRP A;  2WTU A;  3HPG A;  4DFP A;  3UKU B;  4E7L A;  2G8H A;  5LJV A;  4CGF A;  3TPQ A;  1SL2 A;  4XIU A;  1JL1 A;  3LWM A;  4FO0 A;  4M3X A;  1XC9 A;  1VQL N;  4BRH A;  1JLF A;  3C65 A;  2DY4 A;  4FLT A;  3VQ5 A;  1KLN A;  3LDP A;  5KPZ A;  2VWB A;  4H5N A;  4H5R A;  5IWA K;  3P5J A;  2DFH A;  4JKC A;  2E2P A;  1G99 A;  3MEE A;  3AVF A;  5AQU A;  1K9M O;  2HW3 A;  3EE8 A;  1WOQ A;  2KZM A;  4KRE A;  1MWK A;  1S1V A;  3UKU A;  2V7Z A;  3IDH A;  1T44 A;  3H1V X;  3PO5 A;  3W0L A;  3SAF A;  3LAK A;  4ILG B;  3S9H A;  4B9S A;  1YF5 L;  2UXC K;  3MN7 A;  1KFS A;  4O55 A;  2FSN A;  2ZE2 A;  2UUA K;  2XHB A;  3T69 A;  4Z4C A;  3CJB A;  3S41 A;  4FWQ A;  4PL8 A;  4FWM A;  1UA1 A;  4DQS A;  1Y97 A;  3DLL L;  5CZ2 A;  2P9P B;  3EN9 A;  1NNE A;  1VSK A;  3KWG A;  4DF8 A;  4GV3 A;  3OYJ A;  2Q2R A;  2G8W A;  1RDD A;  3K9J A;  1W7A A;  4WFA L;  3OYE A;  2JWL A;  3QIO A;  5AQL A;  4L8R B;  5AQP A;  4JV5 K;  1GLA G;  1CZA N;  4N56 A;  1VSM A;  1YXQ A;  2VYP A;  4CJL A;  3KLI A;  5E84 A;  1U4B A;  3AVJ A;  3C7N B;  1C0F A;  1YUW A;  1DLO A;  2FBX A;  2HB5 A;  5AQX A;  4CHQ A;  3C6U A;  4JKE A;  4CJK A;  1VAZ A;  3QEX A;  4OPJ A;  4FXD A;  5BPM A;  4DV6 K;  2IAJ A;  5M1P A;  5AQQ A;  5AQR A;  3KK3 A;  2P9P A;  4I9Q A;  4PKH A;  3H45 C;  3IG1 A;  4LSN A;  4E1N A;  1ZBI A;  4CW7 B;  1OH5 A;  4FWO A;  3WEE B;  3MK6 A;  3OYA A;  3F9K A;  3FZK A;  3BZK A;  5CHI A;  4FJN A;  1YAG A;  4CBX A;  4MQ3 A;  2OZS A;  3AVA A;  3VF2 A;  3RR7 A;  4TSX A;  1RDC A;  3C7N A;  1JLA A;  2E8A A;  3MX5 A;  4FWL A;  4M45 A;  2BUP A;  5AQS A;  3NAE A;  2AP1 A;  1NBW A;  4CK2 A;  2ZJR L;  3BDP A;  3CJC A;  3DLE A;  4YNQ A;  3C94 A;  4JHD A;  5F1X A;  3AVG A;  2F96 A;  3OS1 A;  3THY B;  3O9S A;  2P5G A;  3WEE A;  4IBN A;  1NGC A;  4FYD A;  3AO1 A;  4DQR A;  1JJ2 M;  4CER A;  4OX9 K;  1J53 A;  3T3F A;  2W41 A;  1QTM A;  4QS8 A;  4WQ5 C;  1TKT A;  5BPL A;  3J81 O;  4M7Y A;  4ISF A;  3J7Y P;  1XNR K;  3SYZ A;  1KVA A;  3A5L C;  4IOC L;  3QEI A;  3PY8 A;  4UQG A;  3OHR A;  4CJT A;  2O8F A;  1JCF A;  2NRV A;  3ZLJ A;  1BCM A;  5KRT A;  1LWE A;  1YJW N;  3ITH A;  2PY5 A;  3IRX A;  1N36 K;  2CGL A;  3P4I A;  1OVQ A;  2KZZ A;  2KKZ A;  2NRW A;  5E26 A;  2IVN A;  2DTU A;  4E7J A;  4GKK K;  4BC3 A;  3EO3 A;  4K8Z A;  4X65 K;  1S3X A;  1TV6 A;  4O8K A;  3D0P A;  2HBK A;  3ZX2 A;  3HK2 A;  2JWK A;  2O4I A;  3C0B A;  4DU3 A;  4Y1C A;  3AA4 A;  1A5W A;  3CI5 A;  3LP0 A;  3CG7 A;  3W3D A;  1QSY A;  3U9D A;  2XY8 A;  1IH7 A;  5BRE A;  4WQ5 A;  3ZSY A;  5C25 A;  3E1Y A;  4M3R A;  3BF3 A;  3RVC A;  4B8A B;  1BA0 A;  4DUZ K;  1K73 O;  4DV4 K;  3K2P A;  3LAN A;  4FZY A;  3RSE A;  1GLE G;  5AZJ A;  1NLV A;  5AQI A;  3JYT A;  2D1K A;  4G1Q A;  1C0U A;  2KTQ A;  4KH6 A;  2A41 A;  3DLK A;  4QS7 A;  4PA1 A;  4B1V A;  5HRO A;  1KTQ A;  1S1W A;  3H3N O;  4J2B A;  2GTD A;  3LM2 A;  5J2P A;  3CHW A;  1M1K O;  4FZZ A;  4AQY K;  4AHV A;  5JLH A;  3TSP A;  3G0Z A;  4CEO A;  2E4L A;  1ZXO A;  1BIZ A;  1ATN A;  3PLA A;  2D0B A;  4IXC A;  4WYB A;  4RW9 A;  1HUX A;  2HF4 A;  1KAY A;  3WNG A;  1OH8 A;  4XH1 A;  1O13 A;  2NRR A;  2P9I A;  1VQ7 N;  3UIQ A;  3V1Q A;  1WN7 A;  3WQU A;  3I8B A;  1HJO A;  3SQ1 A;  3HVR A;  1HLU A;  4DFM A;  1NKB A;  3SMP A;  4BRE A;  3UB5 A;  1WB9 A;  4KB0 A;  3RRH A;  1NK6 A;  5FDL A;  3KLF A;  5TKY A;  3MXM A;  4CIE A;  4IJA A;  4K41 A;  4CVN E;  5KGX A;  1NK0 A;  1VQM N;  3L2U A;  1C0G A;  1RT2 A;  5BR9 A;  1BO5 O;  4FJJ A;  4BY9 C;  3OJU A;  4OGE A;  3CC7 N;  1NGF A;  3HO1 A;  1VQ6 N;  4K25 A;  3WXM B;  3C95 A;  5HRS A;  3KK2 A;  3NCI A;  5C10 A;  4DR4 K;  1EET A;  4I6M B;  4KTQ A;  5DMR A;  2I7N A;  3U3G A;  1V4T A;  3QEW A;  4CF1 A;  4E3S A;  5EU7 A;  3U4L A;  1NK8 A;  1HYS A;  1Q81 O;  3NGY A;  4DR2 K;  3AA5 X;  3DM2 A;  3K57 A;  3H3O B;  2YI1 A;  2RPI A;  1C0M A;  4BG8 A;  4J2D A;  1Q7Y O;  3FGU A;  4NXM K;  1HKG A;  1NGG A;  3VEY A;  4JYA K;  2HHQ A;  2H3G X;  2ZF5 O;  4CEA A;  1FXX A;  4B3O A;  4I6M A;  4F4K A;  1OKJ A;  3V1O A;  3V6D A;  3CFP A;  1QS4 A;  5CZ1 A;  3AAR A;  1U2V B;  4DFK A;  3V81 A;  4HHT A;  4ZTJ A;  2ASO A;  1X9S A;  4ILH A;  1N5Y A;  4AF1 A;  3THV A;  3V4I A;  3O6W A;  3RWU A;  1VSF A;  4H0X B;  3FE1 A;  3JS6 A;  1RT5 A;  2R7Y A;  2VWJ A;  1RDA A;  4FW2 A;  1TKD A;  1P8Z A;  4CZG A;  5KTQ A;  4FWS A;  4H5W A;  3IS9 A;  5AZI B;  3OVN A;  3HI0 A;  4OLB A;  3F2K A;  3HZ6 A;  1NKC A;  1S5J A;  4JI1 K;  4LH4 A;  4DR1 K;  5ELZ A;  1VRT A;  4RW6 A;  2BDP A;  4DKW A;  4LF8 K;  1QQM A;  1VSH A;  1YIT N;  4W5Q A;  4B3T K;  1REV A;  1C1C A;  4KPY A;  4FJ8 A;  1BGX T;  4CHP A;  1NWK A;  2DPN A;  3HTV A;  1IKV A;  3VGK A;  4E1J A;  1A5V A;  2A42 A;  5DM6 L;  3WXI A;  3CPW M;  2YNF A;  1L3V A;  3L3V A;  1BIS A;  3LDQ A;  4FOE A;  1ASV A;  4RW8 A;  3V9Z A;  4ILJ A;  4CGH A;  1RDU A;  2ZJP L;  2OPQ A;  3ZSW A;  4CF2 A;  2A1R A;  1FK9 A;  4KHU A;  4B3R K;  3NE6 A;  5HRP A;  1LW0 A;  2HVI A;  2GEM A;  3LZI A;  4F2S A;  3A8Y A;  4BG9 A;  4B3M K;  1XWL A;  4E19 A;  3H08 A;  3CMA N;  3FZL A;  5MLC Q;  3R6M A;  5I9E B;  3K9K A;  4CIF A;  5JVG L;  2XY7 A;  3WNH A;  3HM9 A;  3HRG A;  4DTN A;  3ZEU B;  1VSJ A;  2X6N A;  2EWS A;  4EAH D;  4PL7 A;  1Q82 O;  1FJG K;  2HF3 A;  3LZJ A;  2XY5 A;  1YHQ N;  1UA0 A;  3ISN C;  4CJV A;  1HPM A;  2PAV A;  1ILY A;  1W0H A;  3MWT A;  4J2E A;  4DSF A;  3I56 N;  4LH5 A;  3E66 A;  5A2Q O;  3ZT2 A;  5T7B A;  3JSM A;  5JVH L;  2YJE A;  4RW4 A;  3VEW A;  1SKR A;  3GOI A;  4LFC K;  1L3S A;  3ZEU A;  4O4G A;  3ZX3 A;  2Q36 A;  4YOW A;  1NGI A;  4RCH A;  2FF6 A;  1RDW X;  5C42 A;  1D8Y A;  2FXU A;  4B9Q A;  4X62 K;  4W5T A;  2NNW A;  3SJJ A;  3ATV A;  4DV0 K;  5AQJ A;  4CI6 A;  1KVB A;  2YNH A;  2WBN A;  4FK0 A;  4BVP A;  3D6R A;  1S1T A;  5GIP A;  4FVM A;  4C8L A;  2O8B B;  1W97 L;  3J80 O;  1VSE A;  2BE2 A;  3H1Q A;  3NVM A;  4HTL A;  1H1V A;  1ATS A;  4JKB A;  3O3H A;  4IO9 L;  4E1M A;  3NH2 A;  4NLB A;  2ATQ A;  3IFR A;  1TK0 A;  1XHX A;  4CZK A;  4HVJ A;  2QWQ A;  4A2B A;  4CZF A;  2ASP A;  3QET A;  3M1F A;  1DT9 A;  4IOX A;  2UU9 K;  1NMN A;  5HOO A;  4CCH A;  2Y1J A;  3RR8 A;  4JKG B;  1MWM A;  2EHG A;  3VEO A;  2O8B A;  4B9U A;  1QVF M;  1NJZ A;  2ZGZ A;  5C15 A;  5KQ8 A;  3NHG A;  3NF9 A;  1X9J A;  2YV0 X;  1TKZ A;  3SUO A;  3L2W A;  3EEQ A;  2E1Z A;  3U3Y A;  2A6A A;  4CJ4 A;  3LAM A;  2GUI A;  4Z4H A;  4BQL A;  3AO5 A;  4EP5 A;  4CJE A;  2A1S A;  1MU2 A;  4NLC A;  1SZ2 A;  3TWH A;  2HHX A;  1DTT A;  2O8C B;  1F21 A;  2Z1I A;  1GLC G;  3CQY A;  2VQE K;  1Y64 A;  4JKG A;  3AGR A;  3AVN A;  4CBU A;  3QBX A;  5JLF A;  4JNE A;  1QVG M;  1NGD A;  3CXC M;  3L2V A;  4V19 S;  1NK4 A;  2O8D A;  4A5A A;  3VQ4 A;  3MMV A;  1NKE A;  2AA4 A;  2Q0R A;  2WC9 A;  3DJC A;  4CES A;  3O4W A;  3J7Z O;  1BI4 A;  4BC5 A;  1YVU A;  3EYZ A;  1GOA A;  2O8C A;  4CZM A;  3EZW A;  4DR5 K;  4JI5 K;  3MEC A;  4ISG A;  3DOL A;  4KTW A;  5BRH A;  4DQ8 A;  3SAH A;  3KJV A;  4GVE A;  1YVN A;  1GLL O;  2OTJ N;  3AAQ A;  3AAP A;  3DWL A;  4M3Z A;  2D5R A;  1N6Q A;  1S1U A;  2UXB K;  3M8Q A;  4OJR A;  5C12 A;  3UE5 A;  1IKW A;  4CK3 A;  4FW1 A;  4Z4E A;  1UAX A;  2HHW A;  3VEV A;  4X66 K;  2WFB A;  5BN9 A;  4EHU A;  2QKK A;  1KSP A;  1VQ9 N;  2OTL N;  3ZSV A;  5KQD A;  2VQF K;  3PSF A;  1RTH A;  4BDP A;  4YOU A;  3THX A;  3OA9 A;  4Z4F A;  3VF6 A;  4KRF A;  3D45 A;  4B9N A;  2D4W A;  3HST B;  2P9K B;  4H4M A;  1S6Q A;  2IIR A;  5M1K A;  4DQP A;  4GNI A;  4H5T A;  3TAG A;  1W2B M;  2YKN A;  1SKW A;  4E7I A;  1R59 O;  2YHX A;  3GE1 A;  3EKS A;  5FPN A;  3ZYY X;  2RHK A;  3P1G A;  1RFQ A;  4HUE A;  4OPH A;  2HNZ A;  3SK3 A;  4FZX C;  4FWN A;  3V9S A;  2Q1N A;  4DR6 K;  2E6M A;  2ZGY A;  5KGW A;  4ZHR A;  4A59 A;  3K59 A;  4YDU C;  1EKE A;  4KHQ A;  3KK1 A;  3QFP A;  5AFU H;  3KKR A;  4DTS A;  1Z6R A;  4JK8 A;  3P31 A;  3O8M A;  1ZBH A;  5CE3 A;  4EFH A;  3AVL A;  5M1F A;  4IG3 A;  4GVM A;  2OCE A;  2AJQ A;  3VN5 A;  3O5B A;  2CGJ A;  4BR0 A;  4JHD B;  4KB1 A;  4C23 A;  4HCC A;  4AM6 A;  3VOV A;  2UYT A;  4F9O A;  3NDK A;  4FLY A;  2FSJ A;  1OVY A;  3BF1 A;  1JLG A;  1SQK A;  4A2A A;  4DB3 A;  1UOC A;  1RT3 A;  2P9L A;  5BPN A;  4CZH A;  2ZJQ L;  3BP8 A;  3KZB A;  4KV8 A;  3M6G A;  1HKB A;  4KHP K;  3CER A;  3NVK A;  3DLB A;  3M5R A;  2ITG A;  4FK4 A;  3GG4 A;  2XO7 A;  2E88 A;  3CJ1 A;  1FW6 A;  4NYF A;  2O8F B;  2JLE A;  4O0I A;  2WUS A;  2PZS A;  4IEE A;  4Z4I A;  4B9L A;  4IOA L;  3CJA A;  3NFA A;  4U7B A;  2HND A;  1NJI O;  1YJ9 N;  3OYC A;  2HMP A;  3VQB A;  3DLR A;  2KFZ A;  1IJJ A;  3TU5 A;  3MX2 A;  1ZYQ A;  3TSQ A;  3ZX0 A;  3VER A;  4B1X B;  2PFU A;  3VQC A;  4CF9 A;  5FRO A;  4XH4 A;  4JI0 K;  1NGA A;  4F3O A;  3CCM N;  3QML A;  2F4V K;  1N8R O;  3CCE N;  3OYH A;  3OBY A;  5JS2 A;  1T6D A;  4WQ4 C;  4OKJ A;  5SZT A;  4CEB A;  4H0O A;  4CEF A;  5FPD A;  1XHZ A;  1BOT O;  4ELT A;  1C1A A;  4BQZ A;  3TAE A;  5BR8 K;  3QDK A;  4DV2 K;  3OYI A;  2YHA A;  3IKM A;  4PKG A;  4BWM A;  3ZT3 A;  1BQM A;  2DFE A;  3OBW A;  2IC3 A;  1RDB A;  2O8E B;  2VWK A;  1YT3 A;  1Z05 A;  3CM5 A;  5EY4 A;  1GLB G;  4IO8 A;  3R9P A;  4B9M A;  3RSE B;  4DTM A;  4AHR A;  4N5S A;  4W5O A;  4M41 A;  5AZJ B;  1TL1 A;  3LPT A;  3LWL A;  1T05 A;  4CD1 A;  3CQ8 A;  2PBD A;  5DK5 A;  4E89 A;  1KFD A;  5AR0 A;  3SBG A;  3SV4 A;  2P9N B;  1VQO N;  2IGI A;  1BL3 A;  1MA9 B;  1NK5 A;  3O08 A;  3MN9 A;  3SQ4 A;  4JKD A;  1XMO K;  1WAF A;  4KHY A;  3N4P A;  3CC2 N;  3SZ2 A;  2O8E A;  4WE1 A;  3S3N A;  1RGI A;  4DSE A;  3NF8 A;  4M63 C;  3PO4 A;  3E01 A;  3P39 A;  1RCH A;  3J8A A;  5KPR A;  1EXQ A;  3LP3 A;  3O1W A;  2I7P A;  3SAG A;  2LSN A;  4FWR A;  3CET A;  2P9I B;  1QQC A;  5HRN A;  2P9N A;  3ULE B;  3ZT0 A;  4N47 A;  2X78 A;  4K8X A;  2NRT A;  3ZET A;  1S72 N;  4EP4 A;  5AQK A;  4B1Y B;  1XUP O;  1HQU A;  4CJF A;  3PV8 A;  3QEP A;  3O3G A;  4IJN A;  3VEX A;  3VQ7 A;  1QSS A;  1ASU A;  3D2E A;  4AIL C;  3R3L A;  4RG8 A;  4XH5 A;  3DRR A;  4GMJ B;  4BRM A;  1X3N A;  2FF3 B;  1RBR A;  1NJW A;  4FL9 A;  3OTO K;  3B6P A;  3WXJ A;  3KTQ A;  5FPM A;  1SL0 A;  4Q0B A;  4B8C A;  4C1N I;  5EOY A;  1ASW A;  3ULE A;  2YNI A;  1BA1 A;  1EWQ A;  3VA3 A;  4BGB A;  1GOB A;  3FLC O;  3CME N;  1D4X A;  2BTF A;  4BRL A;  4JI3 K;  4BRO A;  3ULD A;  2RN2 A;  5AQM A;  1YTA A;  3ASM A;  3DI6 A;  4GV6 A;  3FFK B;  1GLJ O;  1I94 K;  3RRG A;  4B9T A;  3KHY A;  3KLH A;  3WT0 A;  2P9U A;  3I0R A;  4IFV A;  4KO0 A;  1LV5 A;  3AY9 A;  4LF5 K;  4H0V B;  1KVC A;  1YI2 N;  4BE2 A;  1NK7 A;  1Z26 A;  1ZBU A;  3CFO A;  1WSF A;  3EE9 A;  3EL2 A;  1T3V A;  2QM1 A;  5AQT A;  5BRF A;  2WOM A;  3DOK A;  4JK9 A;  1EQY A;  5AQZ A;  4BRC A;  3MED A;  1WSE A;  2HST A;  3BEX A;  2B4J A;  1J5O A;  4JN4 A;  5BRD A;  1WNS A;  1EWR A;  2E2O A;  4CEE A;  2PYL A;  1QZ5 A;  3I8D A;  1NMD A;  3C6A A;  5AQN A;  3QLH A;  4K0K K;  4IFE A;  2P9S B;  4DTP A;  2BGG A;  1S9E A;  2GUP A;  2YX6 A;  3D2F B;  3AGK A;  5B8H A;  1K8A O;  4CBW A;  1C6V A;  4I9L A;  3KD1 E;  3LDL A;  4C8M A;  1JLB A;  3F9M A;  4DU4 A;  5M1N A;  2VGN A;  3LPU A;  2ZWH A;  4FOI A;  1KAX A;  3VF4 A;  2FSK A;  4B3S K;  4JS4 A;  4DUY K;  3C6H A;  4H0Y B;  1SUQ A;  3VET A;  1QHA A;  2HOE A;  3DXM B;  1IO2 A;  3NGZ A;  3OY9 A;  4MO4 A;  2ZM6 K;  2KHO A;  2W6L A;  2P9S A;  3PIP L;  5CYQ A;  4CJW A;  4OVL A;  1XI1 A;  4CGG A;  3D2F A;  4JI6 K;  5AJ3 K;  3SI6 A;  1N33 K;  3PSI A;  2QI2 A;  4O8U A;  3VES A;  1P90 A;  2ZD1 A;  4C8K A;  4AHS A;  4FLZ A;  4MDB A;  2W42 A;  1HJR A;  5C24 A;  3UKR A;  4FJ9 A;  2YJF A;  4O5F A;  4NYN A;  3Q7C A;  3PIO L;  2XRI A;  3MCA B;  4MDA A;  4CF0 A;  2VG5 A;  3NBP A;  4Z4G A;  5GAD P;  3DXM A;  3V9X A;  1TUU A;  1EO1 A;  2I5J A;  4CD3 A;  4L3Q A;  1NG9 A;  3THW A;  2F9W A;  5JMV A;  1V4S A;  4FJK A;  1RBT A;  2RF2 A;  1Z25 A;  5LY3 A;  5TKW A;  3ENO A;  3VGM A;  1K8K A;  4YOV A;  2WON A;  3PUF A;  3FR0 A;  3HYF A;  4DV3 K;  2YKM A;  4BR2 A;  1QSL A;  3J7A P;  3VTI A;  3LP2 A;  4PY5 A;  4AHT A;  3OYM A;  4LD0 A;  4E7K A;  3V9U A;  1U6Z A;  4DV1 K;  1FKP A;  3B8A X;  3I33 A;  1QZ6 A;  1QHT A;  3AVH A;  3RMB A;  2V52 B;  2QKB A;  3OW2 M;  3CJ7 A;  1NM1 A;  5C0Y A;  3OYD A;  5LMU K;  3O3F A;  1E3M A;  2GEL A;  3KIO A;  3SPZ A;  1T8E A;  1WSG A;  1S6P A;  4CFC A;  3HBT A;  3DLH A;  1J54 A;  1JLC A;  1J9A A;  3ZSQ A;  1L3T A;  3EY1 A;  3RMD A;  4DR3 K;  1TUY A;  3HXM A;  1NGE A;  2X74 A;  3QIN A;  3VQ9 A;  2IOC A;  1IBK K;  1B9F A;  3KWI A;  4C8N A;  1XC3 A;  3EKU A;  3QER A;  1MDU B;  4ICL A;  4CGI A;  1RBU A;  3WXL A;  2B6A A;  3DXK A;  3M8P A;  3QNO A;  1HNZ K;  3AVK A;  4ISE A;  1LOT B;  2HHH K;  1JXB A;  4BRQ A;  4DG1 A;  2D0C A;  1R0A A;  3AA3 A;  1OH7 A;  2KFN A;  4BRD A;  3VQA A;  4BRI A;  4HUF A;  2VGM A;  1Q18 A;  2NUB A;  3PX6 A;  3SCX A;  5GAE P;  3A5N C;  3CCS N;  1E4F T;  4DSJ A;  1IKX A;  4BRP A;  4YOY A;  2F8S A;  4QOZ B;  4Y0W A;  3SMS A;  4K42 A;  3LDS A;  4M7X A;  3RTV A;  3HJF A;  2ASM A;  4DTX A;  5J1E A;  1DEJ A;  4CHY A;  2E6L A;  3AO2 A;  2O8D B;  3KK7 A;  4G9Z A;  3DMJ A;  5AFU A;  4ELU A;  2EX3 A;  4ID1 A;  4LC9 B;  5CY4 A;  3HOS A;  4A57 A;  3VGL A;  1BI4 B;  3VEN A;  1T03 A;  4DTO A;  1VQP N;  4DTU A;  4M3T A;  1BDG A;  4CZJ A;  4EZ9 A;  3QO9 A;  4H4O A;  2OPP A;  5HLF A;  4OO1 J;  4BR7 A;  2KLA A;  5EXW A;  3NF6 A;  3FZF A;  4HTU A;  4CHN A;  3G25 A;  1VHX A;  3L4I A;  3QIP A;  1QQN A;  4H03 B;  1RT7 A;  2Y1I A;  1CZB A;  3SUN A;  4DV5 K;  4JD2 A;  1YIJ N;  5CYM A;  2DFF A;  1D9D A;  4F3T A;  4N76 A;  1JXE A;  4KBO A;  1FKO A;  3TAR A;  3K5M A;  3VQP A;  3F5T A;  3CCR N;  1U04 A;  2QA4 N;  5KI6 A;  3LDN A;  1C1B A;  2HHV A;  5I3U A;  1B9D A;  1KQS M;  3THX B;  1B92 A;  4J8F A;  4BC2 A;  4AH9 A;  3OYK A;  4CEQ A;  3TAF A;  4GY2 B;  4NB4 A;  1ZBS A;  3G6E N;  3JAM O;  1RBS A;  3A5O C;  5D3G A;  1VK0 A;  4EZ6 A;  2QWL A;  4I7F A;  4CED A;  1IBL K;  2NZT A;  1ZC6 A;  3G10 A;  2P9K A;  4CFA A;  4NO7 A;  3BUZ B;  2F8T A;  1L5U A;  3VMF B;  1I3A A;  4CGJ A;  2KQ2 A;  2YHB A;  4BC4 A;  1CZ9 A;  4XEI A;  2IS3 A;  4BWJ A;  5KRS A;  4OGC A;  5AQF A;  4JKA A;  1JCG A;  2O4G A;  1D5A A;  3SNN A;  2F9T A;  3MXJ A;  3F73 A;  4GKJ K;  5AQY A;  1JL2 A;  4FPB A;  1GLD G;  3A5M C;  3ZCM A;  5ADX H;  4I2Q A;  5AQV A;  2QWM A;  1NOZ A;  4IFY A;  4M3Y A;  3R1X A;  3QB0 A;  4JI8 K;  4CZI A;  4LFB K;  4PHT X;  2UUB K;  1EP4 A;  3SQ0 A;  2GWK A;  1HR0 K;  4R79 A;  4FM1 A;  4N41 A;  3NMU A;  4K43 A;  2NRZ A;  5J2N A;  2NLX A;  4QCL A;  3SPY A;  3IMX A;  1NGB A;  1T7P A;  1WSJ A;  3QIC A;  3ZT4 A;  4BRA A;  3H6E A;  5CR4 A;  4LFA K;  3CQX A;  3SUP A;  3MN6 A;  3CCQ N;  2P9L B;  5JS1 A;  4YOR A;  3HM8 A;  5GAH P;  4NCG A;  4CFD A;  1U49 A;  1E4G T;  4AHU A;  4JI2 K;  2P51 A;  4OLA A;  3CPE A;  4X64 K;  4O0J A;  4H0T B;  4DS5 A;  1Q9Y A;  3TTF A;  1KXP A;  1Q8I A;  3KLE A;  2ZQB A;  4EIA A;  1VQK N;  1RTI A;  2CH5 A;  2HVH A;  2XY6 A;  4CJQ A;  3AV9 A;  4CHZ A;  1IG9 A;  1LWF A;  4BRN A;  4IDH A;  4YY3 K;  5KPT A;  2G8V A;  4JKH A;  1TK8 A;  4FLU A;  1KAZ A;  4BAC A;  3L8B A;  4MLH A;  3WNF A;  1J6Z A;  2A3Z A;  3LDO A;  3L2Q A;  3MDQ A;  2Q97 A;  3NGI A;  5DM7 L;  1EX4 A;  2PYJ A;  1M90 O;  3L2R A;  2HMI A;  2E5L K;  4R5P A;  3L6Q A;  3HP6 A;  3VQ8 A;  4JI7 K;  1VSD A;  1HQE A;  3CC4 N;  4OPA A;  4YDU A;  4IG0 A;  5H1S Q;  3CJ9 A;  1HYZ A;  4DWI A;  3LL3 A;  5J2M A;  3SLC A;  1U48 A;  3B6O A;  3WQT A;  4IWV A;  4Z0U A;  1WUA A;  3CCV N;  3P38 A;  1ZBL A;  3E9O A;  4QS9 A;  4FJ7 A;  5EVZ A;  4JAX A;  3VQE A;  4LF7 K;  1GOC A;  2HBJ A;  3CF5 L;  1BU6 O;  3LAL A;  1VQ8 N;  4CZE A;  2OPR A;  3WXK A;  3VEZ A;  1VRU A;  4CZL A;  1HNW K;  2HHT A;  1TL3 A;  1KLM A;  3LP1 A;  1SL1 A;  4AHC A;  3PX0 A;  2HHS A;  1BCO A;  4DV7 K;  3AVI A;  1TVR A;  5HL7 L;  1DKG D;  3O9R A;  2OAN A;  1K6Y A;  3QNN A;  2F7T A;  2OYQ A;  5JIC A;  4BDZ A;  1IG8 A;  3IUC A;  4KAZ A;  4CJP A;  3G71 N;  3THY A;  4CF8 A;  2V51 B;  1X9W A;  1YTU A;  3CD6 N;  5C2F A;  1X9M A;  4DR7 K;  1G15 A;  3RMC A;  1TYQ B;  2JGU A;  3AVM A;  3TAM A;  2G8K A;  5J2Q A;  1N34 K;  3C6T A;  1BQN A;  3KKS A;  3ZET B;  3CYM A;  4A5B A;  4FSV A;  1N32 K;  2Z1G A;  5GAG P;  3T7Z A;  3WUH A;  3OS2 A;  3Q7B A;  4DU1 A;  3ENH A;  4UY8 O;  1JKH A;  1JLE A;  2CH6 A;  3K5O A;  3HP9 A;  4WQ4 A;  3KLG A;  3D2E B;  3O1B A;  4FWK A;  1ZBF A;  1LCU A;  3O9T A;  3M8R A;  3OYG A;  3LM9 A;  1TKX A;  1RTJ A;  4HWI A;  4CHO A;  4YOX A;  4DHY A;  4U67 L;  3DYA A;  2YNG A;  2FBV A;  3ALY A;  2X6S A;  2D0P A;  4AM7 A;  1TYQ A;  5E41 A;  5GIO A;  1XQS C;  3ZSO A;  5F2R A;  3VPZ A;  2IDO A;  3O4N A;  1Q86 O;  4DFJ A;  4ID5 A;  3SQ2 A;  3V9W A;  1KC8 O;  1XMQ K;  3ID6 A;  5EX5 A;  1SV5 A;  4DLG A;  4BVO A;  4FLW A;  4E0D A;  3AVC A;  3VA0 A;  3T1H K;  3VTH A;  2E20 A;  5HRR A;  2GX9 A;  2QWP A;  3O4Q A;  4C8O A;  4BRK A;  3IAY A;  1A5X A;  3OYB A;  3DRP A;  4FLV A;  3PX4 A;  2HHU A;  5C2D A;  3TI0 A;  2YCH A;  1QQO A;  2P9U B;  4H8K A;  1NGH A;  4CIG A;  1YJN N;  3MAQ A;  3GDQ A;  4E7H A;  4CJ3 A;  4DMN A;  1IBM K;  2OPS A;  3T1A A;  1IKY A;  2P1J A;  3GBT A;  2GBZ A;  2J4R A;  4FM2 A;  3MWP A;  1NGJ A;  4OPK A;  2BAN A;  2G8U A;  1KRP A;  3U9Z A;  3WNE A;  4PKI A;  1CXU A;  1SKS A;  4F8R A;  4RW7 A;  2RKI A;  3TTD A;  1VQ4 N;  1HPZ A;  3E9P A;  5LJW A;  2Q31 A;  3QEV A;  4DQQ A;  3SUQ A;  2HBL A;  4DQI A;  1L3U A;  3HVT A;  2E1Y A;  1LAW A;  4C1N K;  1HNI A;  4BDY A;  2VG7 A;  4FPA A;  5F0X A;  3CCU N;  5AQG A;  4A62 A;  1T6C A;  3OJS A;  3GL1 A;  1BIU A;  3S3O A;  1NJX A;  3RMA A;  2QWN A;  2OA8 A;  3VQ6 A;  3OYN A;  1RT6 A;  3V1R A;  1VSI A;  2GWJ A;  4GW6 A;  5LMN K;  4CJU A;  1JLQ A;  3T19 A;  3FFI A;  3DLG A;  3L4Q A;  1HX1 A;  2Z1J A;  4WFN L;  3CM6 A;  2BH1 A;  3EZ5 A;  4JKF A;  1S9G A;  2QW9 A;  4JI4 K;  2QTD A;  5HP1 A;  1HKC A;  5M1Q A;  5AQH A;  4FJH A;  4PUO A;  4JS5 A;  1HNX K;  1S1X A;  4KKO A;  1RTD A;  1KCF A;  3O80 A;  4KH5 A;  1XNQ K;  1TGO A;  3HSC A;  3NH1 A;  4BE1 A;  1RT4 A;  3OYF A;  3U6F A;  4Z94 A;  2W6K A;  4IEI A;  1CLQ A;  3AA2 A;  1BWF O;  1TK5 A;  5FRM A;  4DTR A;  3T1Y K;  3TAP A;  1LW2 A;  4JEP A;  4FJX A;  4QAG A;  4KHN A;  2RE2 A;  3ZT1 A;  3UKR B;  3O9Q A;  4PWD A;  3TAQ A;  4CEC A;  4LF9 K;  4WCE L;  4MLE A;  5HBM A;  4CJ7 A;  4DCH A;  5GIN A;  3MXI A;  4B1U B;  1HYV A;  2IVP A;  2V7Y A;  4CEZ A;  4KHW A;  3E9L A;  4BR4 A;  2OZM A;  2E2N A;  2Q0U A;  3HT3 A;  2QWR A;  3TTC A;  1VQN N;  3THW B;  4JK7 A;  2KW4 A;  3SJH A;  4LSL A;  4BRG A;  3L3U A;  1C0T A;  2ITM A;  1NJY A;  4MFB A;  1BHL A;  1U47 A;  2ETJ A;  2CGK A;  1K8K B;  5SWM A;  4M42 A;  3N4Q A;  5FPE A;  5FRN A;  4OKE A;  2A40 A;  4H5V A;  1CXQ A;  5AQW A;  3BGR A;  2FC0 A;  1U2V A;  4O5B A;  1SS6 A;  5BN8 A;  3K0S A;  2FBY A;  4RTF D;  5FLX O;  4CJ5 A;  4IDK A;  4JRQ A;  2G8F A;  4FVU A;  1LAV A;  4BE0 A;  4EHT A;  4PQU A;  4F2R A;  1VQ5 N;  4KI4 A;  4IKF A;  1WAJ A;  5IT9 O;  3ZSR A;  1RNH A;  1O1W A;  3A0I X;  4FCY A;  1TAQ A;  5AZI A;  1ITG A;  4KTZ A;  3FZM A;  1WBB A;  5I42 A;  4Q5V A;  4W5N A;  1DGK N;  4I2P A;  1LWC A;  3M3Z A;  2YHW A;  2D0A A;  4YFU A;  4WF9 L;  2G8I A;  3HOT A;  4OKK A;  1HRH A;  1VSL A;  2NRH A;  4DLE A;  1X3M A;  4YHH K;  5LL6 Z;  3A2F A;  4MO5 A;  3JXU A;  3DRS A;  1WBD A;  4FJ5 A;  3U8X A;  1ESV A;  4B1Z A;  3DXK B;  1WSH A;  2FBT A;  4H0P A;  4Y1D A;  3D7E O;  3I55 N;  4HUG A;  4BR9 A;  3BY5 A;  1J5E K;  3I0S A;  1OH6 A;  3CCJ N;  2B5J A;  4B9V A;  1WSI A;  3SV3 A;  1GLF O;  3HPO A;  3NH0 A;  2VG6 A;  3KVG A;  4DS4 A;  4CFB A;  2UUC K;  4JLH A;  4FJG A;  3HPH A;  3TAN A;  2NRX A;  1I39 A;  3S3M A;  4KFB A;  5AQO A;  1RT1 A;  1WLJ A;  3ID8 A;  4FLX A;  3ZSX A;  1BG3 A;  4KH4 A;  4KHS A;  4M3W A;  3M8S A;  4O44 A;  3AO4 A;  4HCB A;  5K14 A;  4DSI A;  4LF4 K;  4GV9 A;  3BZC A;  5ADX A;  3MN5 A;  1JCE A;  4BRF A;  3MCP A;  3CCL N;  4BGA A;  4LY7 A;  3MEG A;  4W5R A;  4NCA A;  2FLO A;  4NCB A;  1RIL A;  2IVO A;  1IV0 A;  4KI6 A;  2HBM A;  3TR8 A;  3KD5 E;  4DF4 A;  3L0Q A;  3ENB A;  4CJS A;  1BUP A;  4ZTF A;  3O9U A;  1HMV A;  4A61 A;  1RBV A;  4FK2 A;  3TAB A;  4JD2 B;  1UWB A;  3AO3 A;  4J2A A;  4WFB L;  3ATU A;  4FM0 A;  2Q3S A;  2W40 A;  4CGD A;  4RWT A;  1HNV A;  4M3U A;  2QXL A;  1ATR A;  4FJL A;  3H46 O;  1KD1 O;  3QES A;  2VCP A;  2YHY A;  2GV9 A;  3DAW A;  4BR5 A;  2HNY A;  3QBW A;  3VQD A;  3QFU A;  3OYL A;  1DTQ A;  3AVB A;  4YOT A;  2UXD K;  3G4S N;  3SBT A;  4ELV A;  1TAU A;  3VQQ A;  4CJR A;  1Q9X A;  4FJI A;  4IZ9 A;  3R8E A;  2QEX N;  1NK9 A;  3NF7 A;  2P5O A;  3K5N A;  3K58 A;  1D9F A;  3CIP A;  3CFR A;  4DSL A;  4LF6 K;  4DTJ A;  4NXN K;  2QK9 A;  3TSU A;  3OS0 A;  4DSK A;  3FZH A;  5M1O A;  1W9H A; 
#chains in the Genus database with same CATH homology
 1U45 A;  4CGH A;  3VA3 A;  4CK1 A;  1GOB A;  1HYZ A;  2OPQ A;  3ZSW A;  4CF2 A;  2A1R A;  1FK9 A;  2Z1H A;  3ZSZ A;  4B08 A;  2QXF A;  5HRP A;  3NE6 A;  4DWI A;  1LW0 A;  1QE1 A;  3P83 D;  2HVI A;  3LZI A;  3ULD A;  5J2M A;  2RN2 A;  4F2S A;  4FJM A;  3K5L A;  1YTA A;  1XWL A;  4E19 A;  3B6O A;  3H08 A;  3HL8 A;  1U48 A;  1NOY A;  4Z0U A;  3ASM A;  3DI6 A;  1ZBL A;  4FJ7 A;  4CE9 A;  1X1P A;  4JRP A;  3VQE A;  4CIF A;  1GOC A;  3RRG A;  3LAL A;  2XY7 A;  3WNH A;  3HM9 A;  4DTN A;  4B9T A;  2OPR A;  1VSJ A;  2X6N A;  3HPG A;  3KLH A;  3I0R A;  4IFV A;  4DFP A;  4KO0 A;  1VRU A;  4E7L A;  2G8H A;  1LV5 A;  4CGF A;  2HHT A;  1TL3 A;  3LZJ A;  1KLM A;  2XY5 A;  1SL2 A;  4XIU A;  1UA0 A;  1KVC A;  1JL1 A;  3LWM A;  3ISN C;  3LP1 A;  4CJV A;  4BE2 A;  4AHC A;  3PX0 A;  1XC9 A;  1NK7 A;  1SL1 A;  4M3X A;  1W0H A;  2HHS A;  1BCO A;  1Z26 A;  3AVI A;  1JLF A;  4J2E A;  2DY4 A;  1TVR A;  1ZBU A;  4FLT A;  3VQ5 A;  4DSF A;  3CFO A;  1WSF A;  4LH5 A;  1KLN A;  3ZT2 A;  1K6Y A;  5T7B A;  3JSM A;  3QNN A;  2OYQ A;  3P5J A;  2DFH A;  4RW4 A;  2WOM A;  3DOK A;  4BDZ A;  4KAZ A;  4CJP A;  1SKR A;  3MEE A;  3AVF A;  3MED A;  4O4G A;  1L3S A;  2HW3 A;  1WSE A;  1J5O A;  4CF8 A;  2B4J A;  4KRE A;  2KZM A;  1D8Y A;  5C42 A;  1S1V A;  1X9W A;  1YTU A;  1WNS A;  1X9M A;  4W5T A;  4CEE A;  2PYL A;  3SJJ A;  1G15 A;  3RMC A;  3PO5 A;  2JGU A;  3AVM A;  3TAM A;  3I8D A;  5J2Q A;  1KVB A;  3C6T A;  1BQN A;  2G8K A;  2YNH A;  3KKS A;  3LAK A;  4FK0 A;  3S9H A;  4B9S A;  3CYM A;  2Z1G A;  1S1T A;  4FVM A;  4O55 A;  3QLH A;  3OS2 A;  1KFS A;  4C8L A;  4DU1 A;  2ZE2 A;  1JKH A;  1JLE A;  2XHB A;  4DTP A;  1VSE A;  3K5O A;  3HP9 A;  2BGG A;  1S9E A;  2BE2 A;  4Z4C A;  3KLG A;  3O3H A;  4E1M A;  1ZBF A;  3NH2 A;  1UA1 A;  2ATQ A;  4DQS A;  1C6V A;  1Y97 A;  4I9L A;  1TK0 A;  5CZ2 A;  3M8R A;  3KD1 E;  3OYG A;  1TKX A;  1RTJ A;  1VSK A;  4CHO A;  4C8M A;  4DF8 A;  1XHX A;  3DYA A;  2YNG A;  1JLB A;  4HVJ A;  2FBV A;  3OYJ A;  4DU4 A;  1RDD A;  2G8W A;  3ALY A;  2X6S A;  3OYE A;  3QIO A;  3LPU A;  3QET A;  4L8R B;  5E41 A;  3ZSO A;  4JS4 A;  2IDO A;  1SUQ A;  3O4N A;  4CCH A;  4DFJ A;  4ID5 A;  4N56 A;  3SQ2 A;  2Y1J A;  1VSM A;  4CJL A;  3V9W A;  3RR8 A;  1IO2 A;  3NGZ A;  2EHG A;  3KLI A;  1SV5 A;  3OY9 A;  4DLG A;  1U4B A;  3AVJ A;  4B9U A;  2FBX A;  1DLO A;  2HB5 A;  1NJZ A;  5CYQ A;  4CJW A;  4FLW A;  3NHG A;  3NF9 A;  4OVL A;  4CHQ A;  3C6U A;  4CJK A;  1XI1 A;  3QEX A;  4CGG A;  2YV0 X;  1TKZ A;  3AVC A;  4OPJ A;  3VA0 A;  3L2W A;  3SUO A;  4E0D A;  4FXD A;  5HRR A;  2IAJ A;  3SI6 A;  3U3Y A;  4CJ4 A;  4I9Q A;  3KK3 A;  3O4Q A;  3LAM A;  4C8O A;  3IAY A;  1A5X A;  3OYB A;  3DRP A;  4FLV A;  3IG1 A;  2GUI A;  3PX4 A;  2HHU A;  2ZD1 A;  4LSN A;  4E1N A;  4Z4H A;  4C8K A;  4EP5 A;  3AO5 A;  4AHS A;  4CJE A;  3TI0 A;  1ZBI A;  2A1S A;  4FLZ A;  1MU2 A;  4H8K A;  2W42 A;  1HJR A;  4CIG A;  3F9K A;  3OYA A;  5C24 A;  3TWH A;  4FJ9 A;  2HHX A;  1DTT A;  4NYN A;  3MAQ A;  4FJN A;  4MQ3 A;  4E7H A;  1F21 A;  2OZS A;  2Z1I A;  2XRI A;  4CF0 A;  3AVA A;  2VG5 A;  3NBP A;  4Z4G A;  4CJ3 A;  4DMN A;  3V9X A;  2OPS A;  3RR7 A;  3T1A A;  1IKY A;  2P1J A;  4TSX A;  1RDC A;  1JLA A;  2I5J A;  3AVN A;  2GBZ A;  4M45 A;  3NAE A;  4CK2 A;  4FM2 A;  3BDP A;  4FJK A;  1RBT A;  2RF2 A;  1Z25 A;  4OPK A;  3L2V A;  2BAN A;  2G8U A;  1KRP A;  1NK4 A;  3DLE A;  3WNE A;  4YNQ A;  3VQ4 A;  1NKE A;  3C94 A;  1CXU A;  2WON A;  3AVG A;  3PUF A;  1SKS A;  4RW7 A;  4F8R A;  2F96 A;  2RKI A;  4CES A;  3OS1 A;  1HPZ A;  3HYF A;  1BI4 A;  2YKM A;  2P5G A;  1YVU A;  3EYZ A;  3QEV A;  4DQQ A;  3SUQ A;  1QSL A;  1GOA A;  4IBN A;  4DQI A;  3LP2 A;  1L3U A;  3AO1 A;  4AHT A;  4DQR A;  3OYM A;  4LD0 A;  3HVT A;  4CER A;  4PY5 A;  4FYD A;  4E7K A;  3V9U A;  3MEC A;  1J53 A;  3T3F A;  1FKP A;  3DOL A;  1LAW A;  4KTW A;  1HNI A;  4BDY A;  1QTM A;  2VG7 A;  1QHT A;  1TKT A;  3AVH A;  3RMB A;  3KJV A;  3SYZ A;  2QKB A;  1KVA A;  3OJS A;  3OYD A;  1BIU A;  3O3F A;  3S3O A;  1NJX A;  4M3Z A;  2D5R A;  1N6Q A;  3KIO A;  1S1U A;  3QEI A;  3M8Q A;  4OJR A;  1WSG A;  3RMA A;  3SPZ A;  1T8E A;  1IKW A;  2OA8 A;  4CK3 A;  3VQ6 A;  3OYN A;  4FW1 A;  4UQG A;  1RT6 A;  3V1R A;  1VSI A;  1S6P A;  4GW6 A;  4CFC A;  4CJT A;  3DLH A;  4Z4E A;  1UAX A;  2HHW A;  1J54 A;  4CJU A;  1JLC A;  1J9A A;  3ZSQ A;  2QKK A;  1JLQ A;  3T19 A;  1KSP A;  1L3T A;  3FFI A;  3DLG A;  3EY1 A;  3RMD A;  1BCM A;  2Z1J A;  1LWE A;  5KRT A;  3CM6 A;  3ZSV A;  3HXM A;  3EZ5 A;  2X74 A;  3VQ9 A;  3QIN A;  1RTH A;  4BDP A;  1S9G A;  2IOC A;  3ITH A;  2PY5 A;  1B9F A;  4C8N A;  3IRX A;  5HP1 A;  3QER A;  4Z4F A;  4ICL A;  4CGI A;  1RBU A;  3D45 A;  4KRF A;  4FJH A;  4DSK A;  2KZZ A;  4B9N A;  3HST B;  4PUO A;  2DTU A;  4H4M A;  1S6Q A;  4E7J A;  4JS5 A;  2B6A A;  4DQP A;  1S1X A;  4K8Z A;  4KKO A;  3M8P A;  3TAG A;  1TV6 A;  3QNO A;  3D0P A;  1RTD A;  3AVK A;  1KCF A;  1TGO A;  2YKN A;  3HK2 A;  3NH1 A;  4BE1 A;  1SKW A;  1RT4 A;  3OYF A;  3U6F A;  2O4I A;  1JXB A;  4E7I A;  4DG1 A;  1CLQ A;  2D0C A;  3AA2 A;  4DU3 A;  4Y1C A;  1R0A A;  3AA4 A;  3AA3 A;  1TK5 A;  1A5W A;  4DTR A;  5FRM A;  3LP0 A;  3CG7 A;  3P1G A;  3TAP A;  2KFN A;  1LW2 A;  4HUE A;  2HNZ A;  2XY8 A;  1QSY A;  3VQA A;  4FZX C;  3V9S A;  1IH7 A;  4HUF A;  4FJX A;  3ZSY A;  2E6M A;  4QAG A;  4KHN A;  5C25 A;  4M3R A;  5KGW A;  4ZHR A;  3K59 A;  3ZT1 A;  2NUB A;  1EKE A;  4B8A B;  4KHQ A;  3TAQ A;  4PWD A;  3KK1 A;  3PX6 A;  4CEC A;  3SCX A;  3K2P A;  3LAN A;  4FZY A;  5HBM A;  3KKR A;  4CEZ A;  1HYV A;  3MXI A;  4DSJ A;  1IKX A;  4KHW A;  2F8S A;  4DTS A;  2OZM A;  4QOZ B;  3HT3 A;  3LDS A;  3JYT A;  1ZBH A;  4G1Q A;  3RTV A;  1C0U A;  2KTQ A;  2KW4 A;  3HJF A;  4LSL A;  4KHU A;  4DTX A;  3AVL A;  5J1E A;  3L3U A;  4IG3 A;  4CHY A;  4GVM A;  2E6L A;  1C0T A;  3AO2 A;  3DLK A;  4PA1 A;  2AJQ A;  1NJY A;  3VN5 A;  4MFB A;  1BHL A;  1KTQ A;  5HRO A;  2ETJ A;  1U47 A;  1S1W A;  3DMJ A;  4J2B A;  4ELU A;  2EX3 A;  4ID1 A;  5SWM A;  4KB1 A;  4M42 A;  5J2P A;  4HCC A;  5CY4 A;  4FZZ A;  5FRN A;  4OKE A;  1CXQ A;  1BI4 B;  1T03 A;  4DTO A;  4AHV A;  3BGR A;  2FC0 A;  3G0Z A;  3NDK A;  4FLY A;  4DTU A;  4M3T A;  4O5B A;  4EZ9 A;  3QO9 A;  4CEO A;  1JLG A;  4H4O A;  2E4L A;  2OPP A;  2FBY A;  5HLF A;  1UOC A;  4CJ5 A;  1BIZ A;  4IDK A;  1RT3 A;  4JRQ A;  2G8F A;  2D0B A;  1LAV A;  3NF6 A;  4RW9 A;  4HTU A;  4BE0 A;  4PQU A;  4KV8 A;  4CHN A;  4F2R A;  3WNG A;  3QIP A;  4KI4 A;  4IKF A;  1WAJ A;  3DLB A;  3UIQ A;  2ITG A;  4FK4 A;  3V1Q A;  3ZSR A;  1RT7 A;  2Y1I A;  1WN7 A;  1RNH A;  1CZB A;  2XO7 A;  1O1W A;  4NYF A;  4FCY A;  3SUN A;  1TAQ A;  3SQ1 A;  2JLE A;  4O0I A;  1ITG A;  3HVR A;  2PZS A;  4KTZ A;  4Z4I A;  5CYM A;  4B9L A;  4DFM A;  5I42 A;  3NFA A;  2DFF A;  1NKB A;  2HND A;  1D9D A;  4Q5V A;  4F3T A;  4N76 A;  4W5N A;  1JXE A;  1FKO A;  3OYC A;  3TAR A;  4I2P A;  1LWC A;  3VQP A;  3K5M A;  2D0A A;  3VQB A;  3DLR A;  4YFU A;  2KFZ A;  1U04 A;  4KB0 A;  5KI6 A;  3RRH A;  1NK6 A;  1C1B A;  2G8I A;  2HHV A;  5I3U A;  1B9D A;  4OKK A;  1HRH A;  5FDL A;  1ZYQ A;  1B92 A;  3KLF A;  1VSL A;  3MXM A;  4CIE A;  1NK0 A;  5KGX A;  4AH9 A;  3VQC A;  3L2U A;  4CF9 A;  4CEQ A;  1RT2 A;  5FRO A;  3OYK A;  4DLE A;  3TAF A;  4F3O A;  3A2F A;  4FJJ A;  3DRS A;  4FJ5 A;  3OJU A;  4OGE A;  1RBS A;  5D3G A;  1VK0 A;  3OYH A;  1WSH A;  2FBT A;  4HUG A;  4Y1D A;  5JS2 A;  4EZ6 A;  4OKJ A;  3HO1 A;  4I7F A;  5SZT A;  4CED A;  4CEB A;  4CEF A;  3C95 A;  1XHZ A;  3I0S A;  3G10 A;  5HRS A;  3KK2 A;  3NCI A;  2B5J A;  4ELT A;  1EET A;  1WSI A;  1C1A A;  4B9V A;  4CFA A;  3TAE A;  4KTQ A;  3SV3 A;  5DMR A;  2F8T A;  1L5U A;  3OYI A;  2YHA A;  1I3A A;  3U3G A;  3QEW A;  4CGJ A;  2KQ2 A;  4BWM A;  2YHB A;  4CF1 A;  3ZT3 A;  4E3S A;  3PY8 A;  1CZ9 A;  1BQM A;  2DFE A;  3HPO A;  3NH0 A;  2VG6 A;  4FJG A;  4DS4 A;  5EU7 A;  4CFB A;  2IS3 A;  4JLH A;  3HPH A;  4BWJ A;  1NK8 A;  2IC3 A;  3TAN A;  1RDB A;  5KRS A;  1I39 A;  4OGC A;  3S3M A;  1HYS A;  2VWK A;  4KFB A;  1YT3 A;  2O4G A;  3CM5 A;  1D5A A;  3NGY A;  1RT1 A;  1WLJ A;  4FLX A;  3MXJ A;  3SNN A;  3AA5 X;  3DM2 A;  3K57 A;  3F73 A;  4B9M A;  4DTM A;  1JL2 A;  3ZSX A;  3ZCM A;  4AHR A;  4N5S A;  4W5O A;  4I2Q A;  4M41 A;  4KHS A;  4M3W A;  3M8S A;  4O44 A;  3AO4 A;  2RPI A;  1C0M A;  1TL1 A;  3LPT A;  3LWL A;  1T05 A;  4HCB A;  3CQ8 A;  4J2D A;  1NOZ A;  5DK5 A;  4IFY A;  5K14 A;  4M3Y A;  4DSI A;  4E89 A;  1KFD A;  2HHQ A;  4CEA A;  1FXX A;  3SV4 A;  2IGI A;  4B3O A;  4F4K A;  1BL3 A;  1EP4 A;  3SQ0 A;  4FM1 A;  4N41 A;  3V1O A;  3V6D A;  1NK5 A;  4LY7 A;  3MEG A;  4W5R A;  3CFP A;  5J2N A;  4NCA A;  1QS4 A;  5CZ1 A;  3SQ4 A;  4QCL A;  1WAF A;  3SPY A;  4KHY A;  4DFK A;  3SZ2 A;  1T7P A;  3V81 A;  1RIL A;  4NCB A;  4WE1 A;  4HHT A;  3S3N A;  1WSJ A;  4ZTJ A;  3ZT4 A;  1X9S A;  4DSE A;  3SUP A;  3NF8 A;  1N5Y A;  3THV A;  5JS1 A;  3PO4 A;  4NCG A;  4CFD A;  3V4I A;  3E01 A;  1U49 A;  3RWU A;  1RCH A;  4KI6 A;  1VSF A;  4AHU A;  1EXQ A;  3LP3 A;  3TR8 A;  2P51 A;  4DF4 A;  3KD5 E;  4OLA A;  2LSN A;  1RT5 A;  4CJS A;  2R7Y A;  4O0J A;  2VWJ A;  1QQC A;  5HRN A;  4ZTF A;  1HMV A;  1RDA A;  4FW2 A;  4DS5 A;  1TKD A;  1Q9Y A;  3ZT0 A;  4N47 A;  1RBV A;  2X78 A;  5KTQ A;  4K8X A;  4FK2 A;  1Q8I A;  3IS9 A;  3KLE A;  2ZQB A;  3OVN A;  1RTI A;  4EP4 A;  3TAB A;  1UWB A;  3AO3 A;  4J2A A;  2HVH A;  2XY6 A;  4FM0 A;  2Q3S A;  1HQU A;  4CJQ A;  4OLB A;  4CJF A;  4CGD A;  3PV8 A;  3QEP A;  3O3G A;  3AV9 A;  4CHZ A;  1IG9 A;  1HNV A;  1LWF A;  1NKC A;  4M3U A;  3VQ7 A;  1S5J A;  1QSS A;  2G8V A;  1ASU A;  4LH4 A;  4FJL A;  3QES A;  1TK8 A;  1VRT A;  4RW6 A;  4AIL C;  4FLU A;  2GV9 A;  4BAC A;  2BDP A;  3L8B A;  2HNY A;  3WNF A;  3VQD A;  1VSH A;  4RG8 A;  4W5Q A;  3DRR A;  4GMJ B;  3OYL A;  3L2Q A;  1DTQ A;  1C1C A;  1REV A;  1RBR A;  4KPY A;  3NGI A;  4FJ8 A;  1NJW A;  1BGX T;  1EX4 A;  3AVB A;  4CHP A;  3B6P A;  2PYJ A;  1IKV A;  3L2R A;  2HMI A;  4ELV A;  3VQQ A;  4CJR A;  3KTQ A;  1TAU A;  4R5P A;  1SL0 A;  1Q9X A;  4Q0B A;  4B8C A;  1A5V A;  3HP6 A;  3VQ8 A;  4FJI A;  1VSD A;  1HQE A;  1L3V A;  2YNF A;  1ASW A;  3L3V A;  1NK9 A;  2YNI A;  3NF7 A;  2P5O A;  3K5N A;  3K58 A;  1D9F A;  1BIS A;  3CFR A;  4IG0 A;  4DSL A;  4DTJ A;  2QK9 A;  1ASV A;  4RW8 A;  3OS0 A;  3V9Z A;  1W9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...