1TVRA

Hiv-1 rt/9-cl tibo
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Aspartyl protease
molecule keywords REVERSE TRANSCRIPTASE
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tvrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tvrA05
4U7CA 4FJXA 3MXIA 1SH2A 3CJ3A 4RW6B 2KW4A 4AHVA 4O3NA 2XY8A 3OYDA 4ICLB 3L2UA 1QSYA 5KG4A 3L8BA 1JLAA 4O3OA 4QW9A 1RBRA 3MEDB 4O4RA 3MFIA 4CGJA 4DTOA 4Z4GA 1BQNB 2EHGA 1SH3A 3Q8PB 4BWJA 3VQ8A 1TKZB 3G10A 5FRMA 4B8CA 2VWKA 4FM0A 4N41A 4CEZA 4E89A 5J2QA 1WSIA 2BGGA 3I5AA 1NKCA 4WE1B 4FJ7A 4CJ5A 2BR0A 3HKWA 5KT6A 4CJUA 1NKEA 2VG5A 4DTXA 2WONA 4IDKB 3SYZA 1S9EB 3AVIA 3SUOA 4KHWA 3NBPA 4K4XA 3MECA 5KFDA 4ELUA 3KHGA 4CFDA 1SUQA 1SKSA 3V9WA 3HVRA 5J2NA 4O4GB 4IR1A 1EETA 1UWBA 4OL8A 2E9ZA 1IM4A 4HYKA 2RF2B 3CM6A 2D3ZA 5I3UA 1QS4A 4I9QA 4J9QA 3PHEA 4W5TA 1D9DA 4MIAA 3JYTA 4FLXA 1I6JA 4DQRA 5HP1B 4ICLA 4K4YA 4IBNA 4IFVB 1RCHA 2D0AA 3NF7A 5J2PA 4PY5A 1S5JA 3DYAA 3NF6A 3HVTA 3OYHA 2G8VA 5F8JA 4FM1A 1IH7A 3HPHA 1U09A 3F9KA 2JLEA 1Z4UA 4K8ZA 4LH5A 2OPQA 1IKYA 1ZYQA 5I42B 3KLIA 4E7KA 3QGIA 1RT5A 4WYLA 4NLPA 4HUFA 2E4LA 1RDDA 3AA2A 3CWJA 4DSJA 1FKPB 3RMBA 3PO5A 2ITGA 2DTUA 2D41A 4DU3A 3CJ0A 2DY4A 4NLUA 4J9OA 1EX4A 2E6MA 4O55A 4CGHA 1XR7A 1U49A 1NK7A 3I0RA 3RB0A 4FJMA 2E9TA 2VWJA 3NDKA 2CKWA 4IRCA 4O0JA 3OY9A 3SI6A 3UIQA 5KGXA 4Q8EA 3MAQA 1S1WB 3SQ0A 3LP2B 4ZP6A 3IG1A 2IJNA 2IC3A 1XHZA 1SL0A 4JV1A 4FBTA 2PZSA 5CYQA 3BSCA 1XHXA 3V9SA 3K57A 2DPIA 3DOKA 3PR4A 4URSA 4IRDA 2RDIA 3AVMA 1JKHB 4EEYA 4CJQA 1RDBA 1F21A 4FJKA 1DTTA 1SV5A 4IG3B 3E01A 3QEPA 1VK0A 4MFBB 4RW7B 3QIDA 3SJJA 3KLGB 5KFKA 3HO1A 4CEQA 4YQWA 4CIEA 3BGRB 2GC8A 4ELVA 2DPJA 2V4RA 4TQRA 3NGZA 2HHSA 3ZT0A 1QSLA 1IKWB 3AVHA 4ZVGA 3MEDA 1JLEA 1T8EA 1S48A 3QNNA 2Z1HA 4CJ4A 2QK9A 4DFMA 1BCMA 2KFZA 1TVRA 1S0MA 4O3QA 3D28A 4RZRA 3DM2A 4CEOA 3TANA 4HUGA 1ZTTA 5HLFA 2JC0A 4WXOA 4RNNA 4DTRA 3OYMA 1KHWA 4BDPA 1NHVA 4K4UA 3AO5A 1U48A 1JXLA 3T1AA 5KFSA 3SZ2A 4KTWA 4CF8A 3SUNA 2HNYA 4ZTJA 4Z4HA 1B9DA 4AHRA 1HPZB 3H5YA 1RT7B 3AV9A 1IKVB 5C5JA 3TARA 3L2VA 2F8TA 3LP0A 4B9SA 4W5NA 4UQGA 3K5LA 5DGAA 1UOCA 3OL6A 5KFFA 2OPRB 3G6XA 4JV0A 1KRPA 2UVRA 3AVFA 4IFVA 3IG1B 4C8NA 4CJ3A 2W9BB 1GX5A 3LALA 4MK8A 5J1EB 4ED2A 3KOAA 3VQBA 4FJGA 3VQDA 4CJPA 3OYGA 5KFWA 1NJXA 3NFAA 3NGYA 3TI0A 2XWYA 3OYKA 4O4GA 3T5KA 1XWLA 3KTQA 1RTIB 4DMNA 2HNZA 1WSJA 3KIOA 4ZPBA 3N6LA 1FKPA 4FJ8A 2HHXA 1RT2B 3NH2A 3MR3A 4Y34A 3NBPB 1LW2A 5F8LA 2ASDA 4KHSA 4IFYB 5F8HA 4AH9A 4H4OB 3I0RB 2BQUA 2HW3A 1RT3B 5J2MA 2QKKA 4NCGB 4M3TA 5C25A 3AVGA 3OYAA 4DQSA 4QWAA 3PX6A 4B9VA 2HHVA 4M41A 2AX1A 3QESA 3KK1A 4J2DA 4DTUA 1BGXT 2Z1GA 3CQ8A 3IS9A 3KK3A 1TL3A 1BIUA 5KT4A 3DOLA 2OPSA 4OPJA 4KI6A 4CE9A 4RNOA 2GBZA 3O4QA 1VSFA 3M8RA 5KFOA 1SV5B 2FVCA 1D8YA 4Q43A 3KD1E 4ECUA 4KHNA 4OLAA 1DLOB 3OYIA 1C0TB 4TYAA 3LP2A 1ITGA 2YKMA 3H4DA 4FLTA 3TVKA 3H5XA 4F4ZA 4DF8A 3NAHA 4MKAA 2W8KA 1FKOA 4FJ5A 4M3RA 2YV0X 1HQUB 3D45A 1QUVA 3MF5A 2UVVA 3SPYA 4EZ9A 2DFFA 3PW0A 2W9CA 3RMCA 2C2RA 4TYBA 2GIQA 2VG6B 1Z26A 3ISNC 4R5PA 4Q45A 1GOBA 4WXWA 1JLQA 4KB1A 3QERA 2XGQA 5L1IA 1D9FA 3I8DA 3AVLA 4DQQA 4FCYA 3HL8A 4K50A 1TL1A 1HMVA 1Q8IA 2RN2A 2PY5A 2FBVA 3V6DA 3THVA 1L5UA 2IAJA 3RRHA 1BQMB 2YNFB 4O44B 2HWIA 1BL3A 3AVNA 2AGPA 3KLHA 4FJLA 3P83D 1C1BA 4FS2A 1KHVA 2VG7B 2QKBA 1DLOA 2XCPA 1KLMB 4Z4FA 4FLZA 4PWDA 1S1TA 1K1QA 2YNHA 4JRPA 1RNHA 3MXMA 4NRTA 2WCXA 3AO2A 1HNVB 2G8WA 1A5VA 4ECQA 1N4LA 4CK2A 3HXMA 4J2BA 3T19A 5FRNA 4J2EA 1CXQA 1S9GA 1SKWA 1TAQA 4J2AA 3GV5B 4CHNA 4ED0A 5T14A 3VQ9A 1RBSA 4FW2A 1HARA 2B5JA 4TN2A 3V6KA 2UVUA 1MU2A 4MQ3A 3K5MA 1RTDA 2J6SA 3DYAB 3CJ5A 3VQEA 4K4VA 4DLEA 2ZD1A 2AGOA 3KKRA 1KFSA 4DQIA 5FDLB 3QO9A 1JLFB 1VRUB 4RUCA 2ILZA 1ASWA 1FK9A 2ZE2A 3PW4A 3TAMB 1KSPA 3VN5A 4FK4A 4C8KA 4MIBA 1SL2A 4KO0A 3TWHA 3KLFA 1NK9A 4KHUA 1T03B 1X9WA 1RA7A 4QW8A 5DQGA 3DOLB 3QEIA 3ZT1A 1G15A 5DMRA 3QETA 1KFDA 4CCHA 3QZ7A 5C24A 4CECA 4E7HA 4CF1A 2BRLA 2IBKA 1IG9A 1TKTA 4CEFA 3OL9A 3OVNA 4F50A 1RT6B 1KVCA 1BCOA 3SQ1A 4G1QA 4DL5A 1NK5A 3H59A 3Q8SB 2G8KA 3O4NA 3OHAA 3C95A 2WHOA 2FC0A 3PW2A 2W42A 3LP1B 4RUAA 4FLWA 5DLFA 2G8HA 4LSLB 4EO8A 1RDAA 2YNIA 3L3UA 4ZVHA 2BANB 3UQSA 1VSKA 4DL2A 2F96A 4ECXA 4RW6A 3ISND 1JLEB 3DRSB 3ZSRA 1UAXA 3BQ0A 1VRTA 1SUQB 3T5JA 1N48A 3HJFA 2E6LA 4DSKA 1HYZA 1ZETA 3KK2B 2F8SA 1RTHA 4DTJA 1WAJA 3O3FA 4H8KA 1TKDA 4B9UA 3MTKA 4TQSA 1BIZA 2D5RA 4CJEA 4CIGA 3G86A 3VQ4A 1S1XB 4OLBA 1WSFA 4NCAA 1S6PB 1JL1A 2A1SA 2HNYB 4BE0A 5K14B 2FVSA 3FFIA 1JLCA 1S1UA 2O4GA 3IGNA 4I2PA 1QAJA 3V1OA 3HT3A 3M9NB 3QLHB 2V4QA 3PW5A 1YTUA 5KFHA 3LP0B 4ED6A 3N6MA 3SCXA 2OYQA 5L1KA 2W7OA 2Z1JA 1C1AA 3V9ZA 1X1PA 1LAVA 4DFPA 5KG7A 3V6JA 3EPGA 2FBXA 2R2RA 3CFPA 3V81B 5KRSA 5KFPA 4NLQA 4HKQA 4KFBB 3QO9B 2D0CA 4M3WA 4RU9A 3I5CA 4O3RA 3OLBA 3WNFA 3PJWA 4FZZA 3KNAA 2P51A 4C8MA 1XR6A 3RWUA 4RW4A 3DRPB 1I39A 4PUOA 1IKYB 2IM1A 2BQ3A 3PZPA 2G8FA 1ZTWA 2X78A 3N6NA 4QWCA 5F8NA 4PA1A 4Z0UA 5F9LA 4CERA 1LAWA 4RW9B 1HYVA 5EWFA 4YR2A 1KTQA 2D3UA 3JSMA 5HRSA 5FDLA 1HQEB 1J54A 3MEGB 2I5JA 2B6AB 1Q9YA 4NLWA 4KKOA 4AHCA 2UVWA 1MU2B 3LAMA 1FKOB 4C8OA 2AU0A 5KFBA 1HYSA 5J2PB 2R2SA 2AX0A 3V81A 4BE2A 5KFAA 4ZVEA 3WNEA 1N5YA 3FSIA 3MECB 1HNVA 2VA3A 1GOAA 2IM2A 5KG2A 2HHTA 4EYIB 1EETB 1UWBB 1LWEA 3TAMA 4EBEA 1Y97A 4ID5B 1RILA 3VA0A 2C2DA 3DLEB 3QEVA 4NLVA 4IG3A 2YKNB 2GV9A 2B5JB 4ECZA 1RT1A 4QWEA 4IG0B 4TLRA 4IRKA 4OVLA 3RAXA 4E3SA 1LW0A 1BQMA 5C24B 3O3GA 3RBDA 1B92A 2P1JA 3KK2A 3H5UA 3DI6A 4LD0A 4B3OB 4KV8A 1W25A 4M3YA 1VSIA 3MFHA 5CZ1A 3H98A 1S1VA 1XR5A 2FVRA 2KFNA 1S6PA 3QYYA 3DRPA 1CXUA 5KFJA 2ASLA 4DWIA 3QIPA 4AHSA 4IDKA 1J5OA 3AVBA 1RBVA 4TSXA 1QTMA 4CESA 4DTNA 4XPCA 3K5NA 3VQ7A 2HWHA 3BDPA 4NYZA 3ZSOA 4I7FB 4CHQA 2XRIA 1JLGA 3H5SA 4CK3A 1LWEB 2D0BA 2V9WA 4RNMA 3K5OA 3BQ1A 4DS4A 2HHUA 3PR5B 3CFOA 3JYTB 3MR2A 1A5XA 2IMWP 3ZT2A 2JEJA 4ZHRA 2WK4A 1J53A 1NK6A 1NK8A 3HHKA 2FBTA 4J9LA 4J9PA 3RR8A 3CDEA 2HVHA 5F8MA 1K1SA 3LPTA 4ED7A 4NYFA 4LSLA 3SUPA 4DFJA 1X9MA 3LAKA 1RBTA 5KFIA 1S9FA 5CZ2A 4NLRA 3HPGA 3SUQA 4QPXA 5KT5A 2FJWA 3MXJA 1YT3A 5E41A 2YKNA 3IN5A 5JS2A 4JRQA 2KQ2A 4F4KA 4CFBA 2XCAA 3L3VA 2O4IA 4DTSA 3OYJA 2EX3A 1XC9A 1TKTB 4IR9A 3ASMA 2W9AA 2IA6A 3GYNA 4NLGA 3E01B 3DM2B 4E1NA 4J9RA 3HK2A 2WRMA 3KLFB 3AA3A 4K4SA 2IM0A 4Y2CA 4WFYA 1N5YB 3KLEB 1CLQA 1HQUA 2OH2A 4K4ZA 3VA3A 4XIUA 1EKEA 4I2PB 3RMAA 4C8LA 4WZMA 1S0NA 4KAIA 4RW9A 4LY7A 4KRFA 3BSOA 2OPPA 4EO6A 1L3VA 4FJHA 3P5JA 2HVIA 3RB3A 3GQCA 1WSEA 4GVMA 4G1QB 4MK7A 4F4XA 3SI8A 1RT1B 5L9XA 4CJRA 3T5HA 3C6UA 4CJFA 4YR3A 1VRTB 4N47A 3ZSQA 3T3FA 3AA5X 1RT4B 4JS5A 2ZQBA 1Q9XA 1RT7A 3OSNA 4KE5A 1U45A 4DG1B 3OYLA 1IKXB 2C22A 3EY1A 2FJXA 1SH0A 3NH0A 4CJTA 2OPQB 4FJIA 3PVXA 3DDKA 2VG7A 3TQ1A 1S1XA 4J9KA 4QAGA 3OYEA 2W9BA 5CYQB 3ITHA 2VA2A 3HVAA 4Y1DA 1A5WA 3AA4A 5K14A 3B6OA 2C2EA 1W0HA 3OS1A 3BJYA 3QEWA 4OGCA 4F4WA 2A1RA 4CJSA 4DTMA 3QLHA 2ASJA 1REVB 3ZSXA 3D5MA 1ZBLA 2Y1IA 3CYMA 4E7IA 4WYWA 4JV2A 3NKYA 2IAJB 1T05B 4BACA 2RPIA 3I5BA 3TABA 2XY6A 4O3SA 4NLOA 2AQ4A 3E51A 1RT2A 4KKOB 1N6QB 2YHAA 4NLDA 4OGEA 4FLVA 2X6NA 1U47A 3IAYA 2FLLA 3AO3A 3VQSA 5KFQA 5KFUA 1TK0A 5KFRA 2WOMA 4J9NA 4OJRA 4CJLA 4DG1A 2W9CB 4CHYA 4HCCA 1L3TA 3ZSZA 2XGPA 1KLNA 1JLGB 1NNDA 2IGIA 1BHLA 3GV8B 4ZMMA 2R8JA 2P5GA 4NCBA 4M95A 3EPIA 3NGDA 1LW2B 4QWDA 4N56A 3HSTB 4W5QA 1LWCB 5KTQA 1L3UA 1RDCA 3JSMB 1LW0B 5DQHA 5EU7A 1RDRA 3I0SA 5HROB 3PW7A 2LSNA 1RT3A 3SQ2A 4ED8A 3LDSA 2P5OA 4BDZA 4RW8B 5KFYA 3QEXA 4DQPA 4CEEA 1WN7A 3G0ZA 1JLFA 3PJXA 4FM2A 3A2FA 3RRGA 1FK9B 4WFXA 1NKBA 3KKSA 3MR6A 4FJJA 2R2TA 4HTUA 4KO0B 2D7SA 1U4BA 4F3OA 4X2BA 3MEEA 3FRZA 4Z4EA 2HHQA 4CEBA 4FYDA 1BI4B 4FJNA 1Z25A 4M45A 2KTQA 2HNZB 3QINA 2XHBA 4EP4A 4R8UA 4TY8B 3H4BA 5L1JA 4CHPA 3KLHB 1C1BB 4NLYA 1BISA 4W5OA 2BDPA 1VSDA 3K2PA 3DLRA 2YKMB 5KG3A 4F3TA 1C0UB 1C1CB 3QIOA 3SQ4A 4E1MA 4CJKA 5J1EA 4IH6A 4CGFA 5C25B 3M8QB 5C42A 2PYLA 2HAIA 1RTHB 3TAFA 3HVTB 1VRUA 2WOMB 4F2RA 1KVBA 3ALYA 1ZBUA 4ID5A 4OKEA 2FVPA 3L2WA 3T5LA 3QIPB 2VG5B 2E9RX 2YNHB 4IKAA 3DLGB 1K6YA 5KFNA 2YNGA 3NF9A 1TL1B 4QOZB 2B4JA 1RT4A 2R8KA 5J2NB 1JXBA 4NRUA 2Z1IA 5HRPA 3OL8A 1VSMA 4NCGA 3F73A 2FBYA 2DFEA 2ATLA 2YNFA 1DTTB 4O44A 5KT3A 5KFVA 3MR5A 3VQQA 4ZHRB 1L3SA 3BGRA 3ZSWA 3WNGA 4WE1A 3GIKA 3FQLA 3NE6A 4CGIA 1IKWA 4DTPA 1S0OA 1C6VA 2R8IA 2FJVA 5SZTA 4M42A 2FLPA 3KLEA 1YVFA 4E7JA 4M3ZA 4RG8A 1TKZA 4ZVFA 4YR0A 2KZMA 3V1RA 3DOKB 1VSJA 4KB0A 5HRNA 3NMAA 1LV5A 4FLUA 5I42A 4DU1A 5EDWA 4IOBA 3U6FA 4AHUA 3KJVB 4DU4A 3SFUA 4DL4A 1T03A 3S3OA 4CHOA 5DQIA 4CF0A 2JEIA 4CGDA 3OHBA 1JLAB 3CDWA 1QAIA 4CIFA 1JL2A 4IH5A 1QHTA 5DG7A 4N5SA 5HBMB 3BREA 4KFBA 2B43A 4L8RB 4H54A 4OKJA 2OZMA 4NYNA 4CK1A 3ZT4A 1J9AA 4KAZA 4F2SA 2HHWA 3ITHB 4FBUA 3EZ5A 1R0AB 2J6UA 1JLCB 3SV3A 1D1UA 3PX0A 3DLGA 3FDSA 1NK0A 3VQCA 4O0IA 2JGUA 2Y1JA 1NJYA 5JUMA 1RT5B 1D0EA 4PQUA 4BDYA 1FXXA 2XY7A 2FVQA 4FZYA 2WTFA 1RT6A 1S1WA 1N6QA 4DL6A 1RYRA 4PWDB 3KMQA 1TQLA 3PV8A 4ECTA 3ZSVA 3U3GA 3G6VA 1QSSA 1B9FA 1VSEA 4KBIA 1RTJB 3U3YA 4ZP9A 3ZT3A 4ZPDA 4ED1A 4FZXC 4LQ9A 4BWMA 1N56A 2R8GA 2C28A 3D0PA 2GUIA 1RBUA 1DTQA 5EWGA 4U6PA 3OLAA 4B9LA 2YNIB 3V9UA 1RYSA 4JLHA 3AVKA 3ZCMA 2EC0A 4CJVA 2CJQA 4YFUA 2FLNA 1IO2A 3M8PA 3KJVA 3KK3B 4G3IA 3KHLA 1VSHA 3OJSA 3LZIA 4KTQA 1C0UA 1C1CA 4I2QB 4ECVA 1CZ9A 4GMJB 4URGA 3DRSA 4IG0A 1WAFA 5DK5A 1NJZA 3I0SB 5HROA 1QE1A 1RAJA 4K4WA 3TAEA 4MFBA 4OKKA 4RW7A 5J2MB 5T7BA 4RW8A 1CZBA 5J2QB 2F8EX 2BE2A 5KFCA 3AVCA 3UPFA 4ID1A 5HRRA 2OA8A 5F8GA 5F9NA 4HCBA 2UUTA 4DSLA 4E7LA 4XPEA 3EYZA 1UA0A 4QCLA 1S49A 3S3NA 1R0AA 4F4YA 3GIJA 4DFKA 3QGGA 3OYCA 3CIZA 1TV6A 4E19A 3V9XA 3M9MB 4URQU 3K58A 1IKVA 1T05A 1WNSA 2ETJA 5D3GA 3NCIA 1C0MA 4NLTA 3C94A 3VQ6A 3M8PB 4DLGA 4DL7A 4KHYA 3DLBA 2IJFA 3RB4A 1HPZA 3PO4A 1HYSB 4QWBA 3VQPA 4H4OA 5F8IA 4Q8FA 3DRRA 4TY9A 2XO7A 3V6DB 2BQRA 4Y3CA 3LP1A 5EUHA 1U04A 3MEGA 5DG8A 1ASVA 4FK2A 2B6AA 4MK9A 4WFZA 4CJWA 1YTAA 3L2QA 1UA1A 4EZ6A 4DSFA 1TAUA 3BSAA 3OYFA 4Y2AA 4HUEA 5EWEA 5KGWA 1RTIA 2VG6A 5CYMB 3SPZA 3DLKA 4AHTA 1S1TB 1S1UB 4ELTA 4CF9A 1S97A 1TK8A 2OPSB 1LWFB 1BI4A 2YNGB 3PX4A 4I2QA 3HVWA 5KT2A 2JEFA 4M3UA 1WLJA 4M3XA 3Q8QB 3KD5E 4LSNA 2RKIA 2ATQA 2I5JB 2QE5A 3ICLA 4J9MA 3G6YA 3KHHA 3KLVA 4B9MA 4FS1A 1S1VB 2R2UA 1EXQA 3C6UB 3ULDA 2ZKUA 3LPUA 3BR9A 3HM9A 4O5BA 4HVJA 1D5AA 3CDUA 3FFIB 3DI6B 4B3OA 1WSHA 5HBMA 4KB7A 5KFXA 5L1LA 4BE1A 3OS2A 4K8XA 3DLHA 4PUOB 1RA6A 3OYBA 3M8SA 4Q44A 5KG5A 1S6QA 4ECRA 1HNIA 4B08A 4B8AB 3RR7A 3HP6A 1HMVB 3KHRA 3BSNA 4IFYA 3K59A 5KFLA 5DG9A 1REVA 3IRXA 5KFMA 1JLBA 2ALZA 4IKFA 1ASUA 4IH7A 2ZD1B 4ZP7A 2GIRA 4Y1CA 4JUZA 3LWMA 5KFTA 2OPRA 1O1WA 5I3UB 1TP7A 1C0TA 5KFGA 1WNEA 1I3AA 2AGQA 3RAQA 4KSEB 4NLXA 4DEZA 4ECSA 4IQXA 3CM5A 4FXDA 3OS0A 1JLQB 3QZ8A 3V4IB 3PY8A 3C6TB 3NL0A 4ECWA 4CFCA 1SKRA 1TV6B 4Q5VA 4EP5A 2OPPB 3AVAA 4FK0A 3OL7A 2R7YA 2QXFA 4PQUB 2HNDA 2QV6A 2RF2A 2R8HA 4MH8A 1S6QB 3TAPA 3DMJB 3PUFA 3P1GA 4O3PA 4J9SA 2OZSA 1KLMA 3TR8A 3ZSYA 4KHRA 4Z4CA 5HP1A 1RTDB 4KHQA 4CFAA 1WSGA 4KREA 2AWZA 4ED3A 4LH4A 3AO4A 2UUWA 1QE1B 1RTJA 5JS1A 1SL1A 3LANA 2O5DA 4K4TA 3CFRA 4TXSA 1TK5A 1S9GB 1ZBHA 1HJRA 5CYMA 3AO1A 4EBCA 2IC3B 4GC6A 3KLIB 1TL3B 5JXSA 4WZQA 1J5OB 1TGOA 3HP9A 4OPKA 2WONB 3HYFA 2ILYA 2AJQA 4NLSA 3V4IA 3IGVA 2HMIA 3B6PA 1T7PA 4I7FA 1W9HA 2IM3A 3DRRB 2Q3SA 2NUBA 3OYNA 3GV7B 3CO9A 4FVMA 3RBEA 4KV8B 1QQCA 2X74A 4KI4A 2RKIB 4LSNB 4H4MA 4NZ0A 4LQ3A 4EBDA 1NK4A 4CEAA 3KLGA 4ZP8A 1NOYA 2DFHA 3WNHA 3SNNA 1IKXA 3VQ5A 1YVUA 3MEEB 4W5RA 3UDLA 2BRKA 4FW1A 5HLFB 4R0EA 5KG1A 1EP4A 4CGGA 3UR0A 5KFZA 3RMDA 3O3HA 4ZPAA 1X9SA 3GIIA 1NOZA 5DGBA 5D3GB 5CY4A 3TAGA 3NGIA 1ZBIA 5KT7A 2XY5A 1LWFA 5KI6A 3DMJA 3S9HA 2IDOA 3H40A 2W7PA 3NH1A 1S10A 3LZJA 4YMEA 3L2RA 3V6HA 3RB6A 5DLGA 5KG0A 1TVRB 1HQEA 3CG7A 4KPYA 1MMLA 4YP3A 4M94A 4CHZA 4Z4IA 2XI3A 4R5PB 3EZUA 3QNOA 1T94A 4I9LA 4XO0A 3OJUA 2PYJA 1KCFA 3NF8A 1C2PA 4FJ9A 3V1QA 1OS5A 1HNIB 2X6SA 2XC9A 4YNQA 3NAIA 1NJWA 1TKXA 4Q0BA 3CJ4A 4GC7A 3GIMA 3LP3A 2JEGA 4CF2A 3NAEA 4HHTA 4TY8A 4CEDA 2BANA 3CJ2A 2XI2A 2BE2B 3OSPA 4B9NA 2HB5A 2WB4A 2G8UA 2I1RA 1ZBFA 4RNFA 4DL3A 4DS5A 4MKBA 3TAQA 3HPOA 1BQNA 3M9OB 1S4FA 2V0NA 4ZTFA 4B9TA 3BQ2A 4AILC 4RNHA 1VSLA 1JKHA 5SWMA 4FLYA 4DSEA 3FQKA 3CVKA 3LWLA 4KHMA 4DF4A 3DLKB 4DSIA 1CSJA 2W8LA 3DLEA 1NHUA 3IS9B 2HMIB 4JS4A 1HRHA 3AVJA 4EYHB 3H08A 1LWCA 3GILA 4Q0BB 2YHBA 3KMSA 1KVAA 3IRXB 2RDJA 1JLBB 1GOCA 1JIHA 1JX4A 1T3NA 4R8UB 3NHGA 2G8IA 1GX6A 4H4MB 2HNDB 2J6TA 5FROA 2KZZA 2ZE2B 5KRTA 3VQAA 4RW4B 3H2LA 3KK1B 5KG6A 4F8RA 4KTZA 1XI1A 1S9EA 2IS3A 4GW6A 3M8QA 5C42B 2IOCA 3SV4A 5KFEA 4ZPCA 3C6TA 1JXEA 2JC1A 3S3MA 3SFGA 3QGHA 1EP4B 1TKXB 3Q8RB 1DTQB 4ECYA 4E0DA 4N76A 3RTVA
chains in the Genus database with same CATH superfamily
2ZZTA 1RWNB 1SH2A 4RW6B 2KW4A 1HNZF 3OYDA 2GVDA 4DPYA 1QSYA 2CPEA 4P6QA 1RU1A 5KG4A 3PM9A 4O3OA 3UDEA 2PDAA 2V8GA 4L3QA 4PAAA 4CGJA 4Z4GA 1SH3A 5AE1A 3Q8PB 3MM6B 4BWJA 4DX8H 2Q97A 2LFVA 1ZAWA 5FRMA 4FM0A 2HBZB 4E89A 3ID6A 2BGGA 3HDSA 3D6MB 3GIRA 1XJWB 4FJ7A 1BWFO 4DUYK 5JJBA 2NXJA 2WONA 5EN1A 1X4HA 2JNJA 4KHWA 5KFDA 3LTOA 3R1LA 4YY3F 1SUQA 2Q3PA 3R5AA 4G9ZA 3HVRA 2HBLA 4DR5F 4IR1A 4OL8A 4HYKA 4C0BA 1VR6A 2D3ZA 3MUVP 4J9QA 1D9DA 1Q95G 5IZHA 4P71A 3HFKA 5A2QO 4HVZA 3QMLA 1RWMB 1KQSR 2WZ1A 4JKEA 2O1PA 2D0AA 1S5ZA 4FOEA 1RP5A 1HQ2A 2WUSA 3NF6A 2ABYA 3HVTA 4ZVSB 2G8VA 2V8DA 5F8JA 3HPHA 1U09A 1SC1B 1PYOB 2XMWA 4K8ZA 3D7SB 1ZA2B 3WT0A 4OJGA 3KLIA 2ZUAA 3VPZA 1LEOA 1RHRB 5ADXH 4CQ1A 1LOTB 2P9CA 1RDDA 1B0PA 1NDLA 3RMBA 3PO5A 2ITGA 3HHLD 3A8YA 3Q2SC 1M0SA 4B3MK 3MUMP 4DUZJ 5DJBA 3G82A 1FVQA 4NEYA 1A6LA 3I0RA 4QR2A 2VWJA 2QT7A 3W5XA 4PR6A 4IRCA 4O0JA 2HFZA 3SI6A 5KGXA 4Q8EA 4JHDA 3IG1A 3HOTA 2I38A 2J7UA 4MIWA 3NNHA 2BKPA 4JOUA 1Z2LA 5IC6B 5CYQA 3OTEA 2L08A 2A10A 2DPIA 2QM1A 2HBYB 1TMJA 3AA9A 4FJKA 3JS9A 4R25A 1SV5A 4RW7B 3SJJA 3HO1A 2M8DB 4X64K 4CIEA 1FNOA 1P9YA 4LJMA 1RDUA 4X4SA 2V4RA 1S7HA 3BPDA 3NGZA 5FIIA 3ZZTA 3CQXA 3R9PA 4CJ4A 2C3OA 4DPTA 4BC9A 1FI4A 4A48A 2DNKA 3MK6A 2M7SA 4JNEA 5AQQA 3NG8A 3DM2A 3TANA 4HUGA 1O6XA 2CJYB 3I56S 3TA2A 2JC0A 1KHWA 3BV8A 1YJNS 2WW8A 3RBXA 1YDLA 1JXLA 1FWLA 5E3PA 3H5YA 3GTYX 3AV9A 1G2EA 2DYAA 5C5JA 2DNZA 3TJ9A 3EVMA 4WKYA 3TJ8A 4AL5A 5DGAA 2XSJB 1UOCA 3QICA 2CJ9A 2KVIA 2PA3A 3AVFA 5LM7E 3IG1B 4N8OA 4NXNK 4RBVA 3VQBA 3AB2B 4GV9A 1HR0J 2G0IA 1FRJA 4DV4J 2Y1LB 1UZHA 3VQDA 3OYGA 1NJXA 5KFWA 5AE3A 2CGLA 3NGYA 3T5KA 3KTQA 1RTIB 4AM6A 4ENOA 4MO4A 1O5JA 3NH2A 3NBPB 1LW2A 3G8TA 5F41A 2ASDA 3CCUS 1BWVA 4KHSA 4IFYB 4ZVQB 1R6YA 2BJ9A 2XMTA 2UUCK 1LXJA 4H4OB 2BQUA 5J2MA 3U7JA 4B9VA 2DO4A 3GP9A 4ZIVA 4M41A 2GVZA 1HNXJ 1RWWB 3KK1A 4LBIA 3UCGA 3DXMA 2LMIA 2F65A 3HHDA 4BC3A 2MGZA 1BE4A 4C3KA 3EUNA 2E1PA 1N0VC 1VSFA 5BXIA 5BYRA 7AT1B 2V9KA 4OLAA 1YRTA 2B4PA 3QQCD 3VHQA 4DF8A 4MKAA 1KQSM 3P49B 3JQKA 3CJ9A 5IT0A 4JI4F 3D45A 3CJKB 4D3GA 4DV7F 2KT2A 3D2EA 4EZ9A 4I68A 2ZH5A 3PW0A 2W9CA 1FF2A 2HLUA 3FSYA 1ITPA 3MMBA 1TR0A 2UU9J 4R5PA 4Q45A 5CCLA 1ZC6A 4H0VB 2MJUA 1EKSA 3PSFA 1OQ6A 4QU7A 3QERA 5B0BA 4H5TA 3I8DA 1W2IA 4DQQA 3ULEA 4DKWA 1Q8IA 4H4KC 1NJIT 2HHHJ 2IAJA 3RRHA 5AQZA 5F3TA 2AGPA 2W6LA 3P83D 1GLJO 1C1BA 1M90O 4F0KA 2XCPA 1KLMB 2IIHA 3FC9A 4FLZA 3TTFA 1S1TA 2OEMA 1T9UA 1WD6A 3MXMA 1EB0A 1TUVA 1A5VA 4ECQA 3W3SA 3CCVN 4J2EA 2ZNYA 2HS0A 1TAQA 2EKYA 4WTOB 3T69A 1SS6A 4JI7F 1Q8BA 2DY9A 4FW2A 1HARA 2B5JA 2XS7A 5D0EA 2L9DA 2UVUA 1XERA 4WFNQ 2LP4A 3R97A 2LA4A 1VQ4S 4YHHJ 2A42A 4K4VA 1HWIA 1KFSA 5FDLB 3QO9A 2YWGA 2HRYA 1FK9A 2RUGA 4LF5J 4FF3A 3NCPA 2JWLA 2DIUA 4HH0A 4C8KA 2MSTA 4KO0A 3VF4A 1N32K 1LKZA 3QWUA 3HFVA 1T03B 1RA7A 4QW8A 3BO2A 4JI7J 5DQGA 1SI9A 2RE1A 4K5SA 1Y5LB 3TVYA 3QEIA 2CADA 3MXHP 1G15A 4CCHA 5C24A 4OJ1A 1U0HB 2BRLA 1JCGA 1T9WA 3QJPA 1F1BB 3AHPA 4B3RK 3O2IA 4CLZA 1PKUA 1TKTA 1OYDA 1WC4A 4KH0B 1U25A 5A8WB 4G1QA 2DGSA 2E5LF 1NK5A 3F44A 3H59A 3U1LA 1SJ4P 2G8KA 2ZM6K 3VR1A 4DDFA 1IJJA 2DNNA 3PW2A 1Q78A 5GAHI 2RS2A 4RUAA 2X3DA 4LSLB 1LFWA 2DNGA 4X62K 3E9LA 3MCOA 2YNIA 5D0GA 1J6ZA 5KOXA 2M88A 4BGBA 2BANB 1VSKA 2J7WA 3OV7A 3CI5A 1RAOA 4DL2A 2QSFA 1RAAB 5KQDA 2ERRA 2QA4S 3LUYA 4PG8A 4WF9Q 4CZKA 3X1LB 1FTCA 2ZWHA 1W2BR 3HJFA 2XYPB 4H0TB 3KK2B 4HR2A 2JDJA 3GCXP 2Z2ZA 1RWPB 5L9NA 3SMZA 1NXIA 1AYEA 1BIZA 2GCFA 3HULA 4C1NK 1RISA 2JOQA 3UKRA 1AA1B 2FSJA 2HFUA 1JL1A 2ZVIA 5G4DA 2LCWA 3MD1A 3JSRA 3H42A 4DV1K 3V1OA 3KYLA 1VQLS 2QTDA 3ZEUB 2V4QA 1VCTA 2VJUA 1YTUA 3LP0B 4JI3K 3DKDA 3BZKA 1VBYA 1C1AA 1CQMA 4RBTA 3V6JA 3EPGA 2FBXA 3ZX3A 2R2RA 3CFPA 3CPWM 2Z0GA 3V81B 1J5EJ 1LWXA 3D6TB 3M6UA 5GAEP 4NLQA 3RSEB 3TO8A 4KFBB 1CS4A 5D78A 1UVJA 3DXKA 1WHVA 4C8MA 2HG4A 5AZJA 1HBOA 2H5JB 4ILJA 1U6BA 2RT3A 3QT8A 3N4WA 6FDRA 2X78A 5LJ5Y 2DISA 1KP6A 4CERA 5TKWA 4FPBA 2HGNA 5EWFA 3JSMA 4QQBA 1HQEB 5BYSA 3MEGB 2VB6A 3M8WA 4EUVA 4BBYA 3CCSS 2X1GA 2AU0A 5KFBA 1HYSA 5CABA 3V81A 3WNEA 1HNXK 5LL6Z 1C0FA 2VF3A 2P6SA 2BX6A 2ZM6J 2ZOFA 3THXB 5A6PA 1RILA 3O9RA 3TPQA 3T7ZA 2IY5B 3Q8YA 3KG1A 4X4TA 3OXLA 2YKNB 2V69A 1AW0A 2B5JB 4ECZA 3AARA 4WPAA 4OVLA 1Y00A 2HVDA 4M5MA 3O3GA 5KPRA 2VBWA 2K1RA 5CZVA 3MOJB 2VBYA 4LD0A 4B3OB 3TR5A 4CO4A 1KC8T 3PFOA 4DV5K 4B02A 3H98A 2CWKA 2E7WA 1S1VA 3CD7A 4ZVUB 4A61A 4OJ3A 2CNLB 3LA0A 5F1XA 3B8HA 5KFJA 3DLLL 2QA2A 1HBUB 2R4FA 3H90A 1J5OA 4MJKA 2ZM6F 5CZXA 3CT9A 1F0XA 4GNIA 1Y5NB 3B4MA 5HMXA 4CHQA 4LSZB 1LWEB 2CXEA 1T3OA 5HN0A 3CDBA 3ZNJ1 4X62F 2EW9A 1F2HA 1IQTA 4FF1A 2Z8QA 1A5XA 3L95X 2EFNA 3VEXA 4G6VB 5BYQA 2QWMA 3HHKA 4BRGA 1VQPS 3SLCA 1R0BG 4NYOA 1VQ4N 1UEUA 5E33A 3RR8A 3HHLC 3LAKA 4QIFA 2L48A 1VQMS 5KQ8A 5CZ2A 3UKRB 4NLRA 1DY3A 2VL1A 3A8IA 3B4DA 5D77A 3HPGA 4EFAC 1NZ8A 3MPWA 2O8CA 2F9TA 5KT5A 3MXJA 5DDOC 2MHEA 1BA1A 4USIA 1VQ6S 4X4QA 1ZBTA 4CFBA 2XCAA 2O4IA 3AQOA 4NXMJ 4AT1B 3GYNA 4NLGA 2QO3A 2PD1A 3AY9A 3OTCA 2AEMA 3MPVA 2OIHA 4BG8A 4LF4K 2PMWA 1QQNA 4XEIA 2R42A 3M5RA 3KLFB 3VEOA 2FYXA 1S76D 1HQUA 2QWRA 1EKEA 3RMAA 5DDQC 1NSAA 4KRFA 4RU2A 3FGVA 2OPPA 1YJ9S 5GVQA 2QG9B 1L3VA 2G9OA 4ZIWA 4QOTA 3P5JA 2ZBCA 1NBWA 5JVHQ 1UVLA 4H0OA 4G1QB 4F4XA 5M1QA 3KUHA 1P1TA 3T3FA 3ZSQA 4FO0A 2EC2A 4USUA 4JS5A 4JKBA 1Q9XA 6AT1B 1YHQS 3UWTA 1CC8A 1KQKA 1N36F 4W4MA 4DG1B 4IO1A 3TU5A 4HLBA 4YOEA 2AA4A 4FJIA 3SMPA 3MN9A 4UY85 3H2UB 3MM8B 2VQEF 4Y1DA 3AA4A 2FJEB 3B6OA 2LYVA 2C2EA 1W0HA 4BRQA 2VBZA 3K9JA 1URNA 4K2XA 3OS1A 4F4WA 4I56A 1KTVA 1HHQA 2DNRA 3ZZ0A 4KH1B 1ZBLA 2Y1IA 4P2FA 1RAFB 2LDYA 5B0DA 2HZVA 1IV0A 2RPIA 3I5BA 4M7YA 1RT2A 3W8GA 4PHTX 1EO1A 4KKOB 4NLDA 2X6NA 2FLLA 3VQSA 1M1HA 2OSRA 4ZLNA 3MTJA 3TX8A 5KFRA 2OHDA 4PXBA 1U02A 1WACA 3UKUB 3VGMA 3L7OA 3B8AX 3OTOF 2Q36A 1FJ7A 1NNDA 2Y8WA 4ZMMA 2V68A 3EMTA 4OV1A 4N56A 3CD0A 4FVUA 3SAFA 1SJFA 1LW0B 4A59A 1HNXF 5HROB 3GU0A 2G2ZA 4ED8A 4BDZA 4A8OA 2NRWA 1WN7A 1S72N 2RRAA 4OZ5A 3PJXA 4FM2A 3RRGA 1YX2A 4XH5A 1NKBA 1I5OB 3KKSA 4DR4J 4UF4A 1VMBA 4OYXA 3ZXWA 4KO0B 1U4BA 2MLZA 1AFJA 2W6KA 3FRZA 1BI4B 2XZTB 1U1RA 4M45A 4QJVA 2XHBA 1ZM2A 2KJVA 2A18A 4CHPA 2AMCB 4DCPB 1RK8A 1BISA 4W5OA 1RGIA 1VSDA 3CW2C 3D1HA 1IBLJ 2YKMB 3BGOP 4DV2F 1KVJA 1GLAG 4LF9F 2BXJA 4CGFA 5C25B 3D7EO 5C42A 2A2CA 4M7XA 5BJRA 3J7YU 4DR6K 2VPXB 4WYBA 2WOMB 4F2RA 4ES1A 1EHWA 4WKRA 2EK1A 4ID5A 4OKEA 3EKSA 2E9RX 5HL7Q 1S3XA 1MSWD 1VQYA 4YEAA 2HBMA 1SQFA 4DUZK 4KGZB 3PIPL 2F4FA 4NRUA 4OHXA 3F73A 3KNGA 2ATLA 4GMKA 3LDNA 5BN9A 2DKOB 5BPMA 1HD1A 3GIKA 3KDNA 3ILOA 4B3TJ 5A8RB 5ETTA 4DTPA 4EIAA 2MQLA 5SZTA 1WC1A 1FA0A 3DFEA 2GV1A 2FLPA 1IN0A 4E7JA 3CE8A 1Y10A 4RG8A 1WF2A 5D15A 5DZ7A 4ZVFA 2KZMA 1MW7A 4KB0A 1FW6A 1U2CA 1H1VA 5JVGQ 4DU4A 3SFUA 3S3OA 2QLJB 5EOYA 4X66J 3P38A 4J9VA 4CGDA 2VQEK 4B9QA 3VOVA 1K44A 2NSCA 3UO0A 2JSXA 3O9TA 5KAKA 1QHTA 3C7NA 5T41A 2KH9A 4N5SA 1S79A 3BREA 2NZTA 4L8RB 5D4OA 2KKHA 4H54A 4Z7YA 1D09B 4CK1A 2BUNA 2KXHA 3ETMA 2YQ1A 3ITHB 4LVNP 3WBZA 1R8HA 2AEJA 2J6UA 3G8SA 1MWMA 2CQCA 1JLCB 2FQQB 4OI4A 1D1UA 3PX0A 1WSRA 3DLGA 4J9UE 3FDSA 1E4GT 3AOBA 4OMFG 3VQCA 5C15A 2UXCF 3CJAA 4PQUA 3CJRA 1WC6A 4JKFA 2MJNA 4JP8A 4C48A 2GS8A 4FZYA 1N6QA 2HQCA 4PWDB 2MZJA 3GJTB 4JI0F 2KDOA 2B8PA 4OFZA 3PNIA 1B9FA 4OPAA 1QD1A 1RTJB 4HI1A 4CYUA 2OCEA 3ZT3A 3ENQA 4FZXC 4BWMA 1XQSC 8ATCB 1N56A 2EBEA 2NR0A 4ER8A 1DTQA 4U6PA 1BY9A 3NLCA 4B9LA 3V9UA 3OUYA 1RYSA 4X65F 2P9PB 4NE9C 3G71N 2CJQA 3JAMO 1IO2A 1ZM9A 3M8PA 1X0PA 3IBCB 3KJVA 3QT5A 1VSHA 4Y0FA 4I2QB 2CQGA 1U1MA 3Q83A 1K73O 3S8SA 4ES3A 4M5JA 5ELZA 2ZGZA 1NJZA 3I0SB 1AB8A 1RAJA 3DU5A 3MDFA 1BQXA 2QLFB 1WHWA 1CZBA 1NO8A 5HANA 3CC2N 4JB8B 3O1LA 4OZLA 1IR2A 2YBVA 1FESA 1R0AA 5B0FA 2D0PA 1UJ5A 3OYCA 5AQJA 1X8DA 4E19A 1MWYA 2ZVSA 4URQU 3THYB 3K58A 4F25A 1IKVA 2YKOA 1E6YB 3C94A 1JJCB 3M8PB 3NS6A 2P9SA 4DR2F 1Z1ZA 2M3DA 5IT9O 3BF1A 2K3IA 4Q8FA 3SSRA 4S0MA 2H9ZA 2GUPA 1WKJA 3QBWA 1TTHB 2MZRA 2VCPA 3MEGA 1ASVA 4GO5X 4DV1F 1R89A 4CJWA 5D4LA 4O5FA 4I67A 3L2QA 2FC8A 3L09A 2O01C 4DSFA 3KUGA 3OYFA 2VKRA 4CZEA 3OVBA 4DHVA 4HUEA 5EWEA 1DRZA 2XHCA 2GW8A 2QMUB 3DLKA 3CPWR 2FY1A 3M6VA 4X4OA 4ZK7M 5C2FA 3SSSA 1TK8A 1LWFB 1APSA 5IV3A 3C16B 1BI4A 3OD2A 1Y9OA 4IQMA 1ZM4A 3H1QA 1UEKA 4JI8F 3Q8QB 1HWJA 2D69A 3KD5E 4LSNA 2RKIA 3CD6S 4FNIA 1VQ5S 5L39A 3T1YJ 3FBCA 3KLVA 4B9MA 1JCFA 2YY3A 3G4SN 3P3DA 3CTRA 3LPUA 2YX7A 1FEEA 2E1AA 1D5AA 3IDHA 3DI6B 1F5CA 3QFWA 5L1LA 3OS2A 4K8XA 1U6ZA 2J76E 3NP5A 2P9LA 2HVEA 3OYBA 3M32B 4X66F 3EE9A 4W90B 3GSIA 3M30A 4CIOA 2KT3A 1QDUB 3X3UA 4ECRA 2HQIA 1XQIA 3RR7A 3K9KA 5AQFA 3KHRA 1N8RO 2BACA 5DG9A 1REVA 4IKFA 2Z2MA 4IH7A 3HSGA 2AD9A 2GIRA 2QEXS 3LWMA 4QIVA 2QSWA 4X84A 1WNEA 3M1VA 4J90A 3SXLA 5HMWA 1I3AA 2W2QP 3ZZZA 3RAQA 2MZSA 4KSEB 4FXDA 1AZSB 4USTA 1N52B 1N5VA 2XO6A 1T6DA 4OPHA 3QZ8A 3QATA 4L75A 2PSZA 4ECWA 4LRBA 1SKRA 3QRRA 1FWPA 2E2OA 3QBCA 2YJFA 2E1MC 4YB1P 5AT1B 3OL7A 5CR4A 4IEIA 1FDDA 2BH1A 2JVOA 2QV6A 1RAHB 2R8HA 3EGVA 3CJQA 4LF5F 1Y3KA 3D1QA 3CNQP 4O3PA 2MLYA 3MOZA 5F3ZA 2DIVA 4W92B 4KREA 2XSFA 4ED3A 5CHIA 1QE1B 3RW6A 1H74A 1KXPA 2GZOA 2PIIA 3A3NB 2HOEA 2V2ZA 1HJRA 5CYMA 3AO1A 4P2SA 1TGOA 2CIMA 4DR2K 2I7PA 3KXDA 2ILYA 1RCOB 4DB3A 1RAGB 4RUBA 4EHUA 1H0HB 5HQMA 2DGUA 1U1PA 3B6PA 3FR0A 2YCHA 1T7PA 1VHXA 3IR5B 1PSDA 3FBBA 1CJVA 3CMQA 2UXBF 2ZGYA 4K5RA 1NMEB 3CERA 1U1QA 4EBDA 2Q66A 2DR6A 4F26A 1T95A 3I9ZA 3BH7B 2ZDOA 1TUWA 3UN2A 2KB2A 3D6HB 2Z30B 1YVUA 1XMOJ 2Z56B 4WTYA 4IO9Q 4L76A 4R0EA 5KG1A 3RMDA 5KFZA 2RHSB 2W4DA 3JSBA 4ZPAA 3P96A 1NOZA 3CF5L 2HGLA 4PG4A 1RI7A 4JI6K 1QZ6A 5DGBA 3I9V9 5CY4A 2AJFE 1ZBIA 4F3MA 4ISEA 5EVZA 2IDOA 1NM1A 1MN9A 4Y28C 2MZTA 3TSQA 2HFNA 2JX2A 3CC2S 3GG0A 5KG0A 4KPYA 2FHOB 2HSEB 4JBCA 2NNWA 4Y65A 2WBNA 4M94A 4CHZA 4Z4IA 5LT5A 2KN4A 2ROPA 1F60B 3V5RA 1RGVA 2VOOA 3OJUA 4LFCF 1HPMA 4AXIA 1HNIB 4YNQA 3IR6B 1TKXA 1ZH5A 3F5TA 2JEGA 3NAEA 1BDGA 4HTJA 1QHAA 4HHTA 4TY8A 4B3SF 2DRAA 4H5WA 1WB9A 3CJ2A 2XI2A 2WB4A 2JWKA 2G8UA 2WC9A 4FYXB 4DL3A 4DS5A 1WBDA 1MN7A 4BREA 2C3YA 4DXLA 5BPNA 5K8NA 1F9EB 3BQ2A 2PA8D 2NUUG 1VSLA 1JKHA 1YJTA 1JJHA 2AHOB 4DF4A 1HFEL 1IBMJ 4PXDA 4DR3K 1NHUA 1NPPA 3CO0P 3AVJA 4ISGA 4A47A 3OQ2A 1DQ9A 1GOCA 1YKWA 3LM2A 2J6TA 5FROA 4FWRA 4YB6A 2GNKA 3OTOK 2WVFA 2BA9A 3H2LA 3MWTA 1ZOTA 4YB7A 1H38A 2IS3A 3C6TA 4M5GA 3SFGA 2Z2LA 4A8SA 1ZA1B 4DV5F 3NRBA 3NNAA 3NMUA 1FX4A 4N76A 3RTVA 2J7KA 2K8GA 1VK8A 4ANCA 4U7CA 3P39A 3MXIA 3CJ3A 2CDRB 2ASOA 4ICLB 2AKWB 1SXLA 2VD3A 1JLAA 4QW9A 1RBRA 2AW0A 1Q1KA 4O4RA 3RSEA 3NGUA 3SBTA 3J7YI 4ZS6A 2IPOB 3SQGB 3VQ8A 1TKZB 4YOUA 4JI5F 2GELA 5J2QA 2AJ0A 2KVQE 5H9EJ 5C2CA 1NKCA 2IVPA 3GE1A 1W7AA 3G2XA 4CJUA 4ZA1A 3L7UA 1NKEA 4IDKB 3SYZA 1S9EB 3Q8VA 2JLFA 4CFDA 4DV3K 3DHXA 1C4AA 3THTA 1SZ2A 1IM4A 4ITSA 2MTLA 3CM6A 2I7NA 1FE0A 1N88A 3DGVA 2DO0A 3TYTA 3A12A 4JI5J 1I6JA 3JTNA 5HP1B 3HZ6A 4ICLA 4GKKF 4E8UA 3KK7A 5J2PA 3EGWB 2RU3A 4XK8C 2QEXN 2HQGA 4CD3A 3OYHA 2ZZNA 3DXBA 3CJ1A 3GLJA 5AQSA 2N3LA 3R3LA 1IH7A 4B3SK 2JLEA 1Z4UA 3IP0A 2UXBK 3MN7A 2QA4G 2MEWA 1OH5A 3QGIA 4HUFA 3AA2A 4DSJA 1JNZB 2XS5A 3ULEB 4ILHA 4LFCK 1IBKF 2ASPA 3VAMA 2BOPA 2XM3A 2QL7B 4DV0F 1S59A 4AF1A 2E6MA 1U49A 2LQBA 2C3MA 1XNRK 4FJMA 2E9TA 4HTIA 4PYDA 1WUUA 3OY9A 3MAQA 1Q7YO 1OJ4A 4DR3F 2KYZA 3M2RB 5B7WA 2BUPA 2PZSA 3I56N 3WXJA 4A8WA 1MMDA 3K57A 3PR4A 2DHGA 4IRDA 3MMAA 1VBKA 2RDIA 1JKHB 1R31A 1RDBA 3A1YG 1NJIO 1RAIB 3UNYA 1VK0A 4MFBB 4C3MA 1GXUA 3H8YA 4CEQA 2MQMA 4PKIA 2GC8A 2DPJA 2NUHA 4TQRA 2HHSA 3AVHA 4ZVGA 3MEDA 1S48A 2Z1HA 2QK9A 3CCLS 1BCMA 1XK8A 1TVRA 1S0MA 3OVAA 2RQ4A 3D28A 3J7Z5 1J5EF 1PBAA 1M90T 1KOHA 3VVUA 3TEHB 2GMHA 4CH0S 4JI7K 4DTRA 5CXTA 3SBMA 2X51A 1NHVA 4CH7A 2QZ8A 1AXQA 5HVFA 2UXDF 5KFSA 5IT9U 4FWKA 4KTWA 4ZVPB 2VONA 4ZTJA 4Z4HA 1HPZB 1HI1A 2AP6A 4ZVRB 3ZEUA 4OX9K 4GKJJ 3IUCA 4B9SA 4QS7A 4UQGA 3Q0AA 4JKCA 2GQQA 1EQYA 2JL9A 3TUZC 1WSVA 2UVRA 5U47A 4IFVA 5C0YA 4CJ3A 4MK8A 4ED2A 2FJAB 3PTWA 4FJGA 4DV5J 4CJPA 1I1GA 3P8BB 2HLTA 3HD2A 1OY8A 4NZ6A 1FKAF 3NFAA 3TI0A 1V3RA 5H9EK 1DFDA 3EZOA 4O4GA 1XWLA 2H5EA 5AQTA 3J7ZT 2R7XA 2HVZA 2QL5B 4AL6A 3AAPA 2PO4A 3N6LA 1FKPA 2OANA 1RT2B 5CYJA 3MR3A 5JLHA 1NRKA 5F8LA 5D8HB 2QW9A 3J80U 3VGTA 5F8HA 1YBUA 2AJ4A 1RHUB 2HW3A 1RT3B 2DHXA 3AJ2A 4LRCA 4HACA 3AVGA 4DQSA 2HHVA 4QWAA 3OYAA 4LF1A 4MT1A 2G1HA 4FVCA 2MY8A 3HSZA 2AX1A 2LDIA 4FPRA 1Z6RA 3QESA 4J2DA 5LSOA 5ETNA 4DTUA 1SQGA 1FD8A 4N8NA 1BC6A 4OYIA 2B9YA 4KH6A 1BIUA 4KI6A 2ZH3A 5HQ8A 1A0OB 6FD1A 1HBNA 3BH6B 3IMQJ 1TYQA 2ZH2A 4DR7F 3G25A 1SV5B 4DPOA 4Q43A 1OQ3A 1X3NA 4ECUA 4X4VA 4ZLPA 3OYIA 1C0TB 2FSNA 2C3UA 1VC5A 4TYAA 4H0PA 2FDNA 3E3XA 2J5AA 4L3NA 1TU0B 4F4ZA 3VAJA 1AUDA 1DEJA 4FJ5A 5C10A 3RUBL 4J91A 5HSPA 1N5QA 4DHYA 1R6VA 3Q7BA 3MF5A 1RXOB 2DY1A 3SPYA 2VJVA 4WCEQ 1IG8A 4HTLA 5CA5A 5ADZA 3GOIA 2GIQA 5JICA 3ISNC 2RUSA 4CZMA 1WELA 1GOBA 4WXWA 3MR7A 1JLQA 5LMUJ 4KB1A 2AZ3A 4OO1J 2DXDA 5L1IA 3WEEA 4FCYA 4K50A 3MM9B 3HL8A 1DARA 2PY5A 3U1NA 3J8AA 3AOCA 3I33A 2V4JA 3THVA 1L5UA 2JVRA 1GLCG 2E66A 3NOGA 5A2QU 3KKFA 3M6WA 2VV5A 3OR1A 4O44B 4FJLA 1NUEA 4FS2A 2CYYA 3C7NB 2QKBA 1DLOA 3MCMA 4Z4FA 4JI1K 1BHNA 1WBBA 2ZWPA 2AJ2A 1K0TA 2CQ2A 4PKDB 4C11B 2VYPA 2G8WA 4CK2A 1V5IB 3SBGA 1MG7A 8RUCA 1KWMA 1SKWA 3GV5B 1NSQA 3RRKA 2FHJA 1MROB 4ED0A 2V5HG 4PXEA 5AR0A 4MQ3A 2C2NA 2F5GA 3RZAA 1RTDA 3DYAB 3PYGA 2WSFC 1WTBA 3VQEA 2ZD1A 4AUKA 2UXCK 2RAQA 3C65A 4RUCA 2ILZA 1X4BA 4NXMF 2WTUA 2BM0A 1N32J 1RWXB 4M5LA 2KG0A 4ZCMA 3THXA 5AZJB 3CXCM 3VN5A 4USKA 3MX5A 3KLFA 2NZ4A 4KHUA 4PG7A 3CC4N 1X4AA 2UUBF 5A0YA 2NLWA 1FRKA 3QZ7A 4CECA 4CF1A 4RL1A 2IBKA 2J8AA 3ELHA 1M5PC 3CJ7A 2P9NA 2NS1B 2DR7A 1H98A 3J7AP 4L73A 2G2YA 1C4CA 2P9GA 4BC7A 3O4NA 3ZETB 5AQXA 1DBDA 2DH9A 4KGXB 4KT0C 2ZHOA 1D4XA 1NHKL 1VK3A 5DLFA 4MLHA 2CRLA 4PPZA 4OYOA 2QL9B 1PIEA 3UE5A 1T9TA 3TWZA 3L3UA 3KJNB 4Q2LA 5ETVA 4ZVOB 1YWXA 4ECXA 4H03B 3ISND 1JLEB 3DRSB 1HBMA 3UVJA 2KXFA 1UAXA 3BQ0A 1SUQB 3T5JA 1FDBA 2E6LA 1M5VC 1OWXA 2O67A 4DSKA 1ZETA 2F8SA 4DTJA 2XWXA 4DBQA 1ATRA 2HFVA 4H8KA 3PYFA 1TKDA 4B9UA 4NMLA 2R7UA 4TQSA 2D5RA 3VAFA 4HL9A 4CIGA 3K8VA 3G86A 2QLWA 4OLBA 2U1AA 5EHHA 1O8BA 4NWBA 2YVSA 2A1SA 2FVSA 3FFIA 2O4GA 2XLJA 3VERA 1FXDA 1T9XA 3BGFA 2NXNA 4TKTA 2UUCF 3M9NB 4TVAB 3J7A1 3QLHB 1XC3A 2IVFB 4D3HA 3QSIA 4ED6A 2GIFA 3SCXA 3BBCA 3MEKA 5L1KA 1NB2A 2W7OA 2P9IB 5FPEA 5M1PA 2DCLA 3VAKA 2QA1A 2LLZA 3JAMU 5GAEU 4DFPA 2DHSA 1HBMB 1HNWK 3IMXA 5KRSA 1DKGD 5AQOA 3OR1B 3VAHA 4HKQA 4WQ5A 2E1ZA 2XYGB 4CNYA 4RU9A 4UT4A 2J9DA 3WNFA 4DR7K 1GXLA 2P2CB 3RWUA 4RW4A 3DRPB 1I39A 2BV3A 1ZM3A 1IKYB 3SMSA 1XNQJ 1N8RT 2G8FA 2GAHC 1BA0A 1ZTWA 5AXNA 3MMJA 4PA1A 4Z0UA 3BY5A 4M5NA 2W4CA 3EXYA 4PWWA 2R7QA 1U0HA 4RW9B 1HYVA 2DR5A 3BF4A 3WC2A 3OXGA 1U24A 2FSKA 1ICEB 2I5JA 2LXIA 4KKOA 3D54A 4GRSA 2DK2A 1S7IA 2DRBA 3R5BA 4OQJA 4PL7A 3IFEA 2AX0A 3OFFA 4BR2A 4ZVEA 3FSIA 3MECB 2YWEA 2IM2A 4CZIA 3W9JA 1Y97A 2MMYA 3V2UC 3VA0A 2YKQA 1NB7A 4NLVA 2NRXA 1RT1A 3R9LA 1DAXA 4TLRA 2F9WA 2YHWA 3JQJA 5C24B 5K8PA 2P1JA 2D9OA 3UB5A 1CJVB 3H5UA 1X5SA 2KHOA 2XMKA 2BJ8A 2EBGA 2MZ1A 1QY7A 3RJMB 4KV8A 3ZTOA 3W9IA 2ZHBA 3HTVA 1W25A 3MFHA 5GMDA 4LF5K 1XR5A 1SQKA 1REGX 2KFNA 1YITS 1P9QC 1R7IA 2HK2A 1RZMA 1EWRA 4DU8A 4C11A 2N82B 4LFAK 4YHHK 1QTMA 4CESA 2CQPA 4USVA 3BDPA 2O8EB 3BKTA 3MPUB 4J7CA 2VPZB 3HFZB 1JLGA 3ISZA 3VGUA 3POTB 2D0BA 2V9WA 3BQ1A 1V4TA 4DS4A 4DR1K 4Z2XA 4IOAQ 4NXMK 3E8OA 3JYTB 3P45B 3U9DA 3ZT2A 4ZHRA 3ZZUA 1W26A 1UCNA 2FBTA 5D0HA 4J9PA 2UUBK 1N54B 3CDEA 4X4RA 2ROGA 2HVHA 3BYRA 3ILJA 4NYFA 3ZYYX 3HHLB 5BR8F 1S9FA 3OFEA 4J37A 3IAS9 2R7SA 2MSSA 3BN7A 4CZGA 4Y2KA 2A0FB 2RQKA 4NXNF 2W7AA 1Y11A 1HNWF 5EX3A 1YT3A 5DDRC 5GMEA 5E41A 3MCNA 1FJCA 4JAXA 1YLXA 3BDEA 2YWHA 2KQ2A 3MMAB 4CP5A 4DZ6A 3OYJA 1XC9A 5DM6L 4LFBJ 2W9AA 2ZH6A 3E01B 3K17A 4OHVA 3R3TA 4IDHA 4E1NA 1BOTO 2P9KA 3O1WA 2ZOGA 1LXNA 1NGCA 2M8HA 2H65B 3G6EN 5E2QA 4Y2CA 4WFYA 1N5YB 4Q7AA 2COLA 4Z7CA 4K4ZA 4YDDB 2DR9A 3RBZA 3VA3A 3Q23A 4ED5A 4WZMA 1S0NA 4F67A 1UETA 1L3KA 4RW9A 2V2KA 3DNCA 4NEZA 2HVIA 3KHYA 2JRSA 3GQCA 3PLAA 4GVMA 2P9IA 4MK7A 3SI8A 1RT1B 2PGCA 3G8QA 4EGLA 3T5HA 4CJFA 1P6TA 1VRTB 2RHQB 2UZAA 3AA5X 1RT4B 3OSNA 2K1RB 1BG3A 1HR0F 2ZZMA 3OYLA 1IKXB 3EY1A 2FJXA 1GEHA 2DNQA 4M5DB 2IVOA 2IRUA 1JNRB 4JKGB 4RKUC 2OPQB 2LKZA 4PZVA 4ANEA 1NDPA 5JVGL 4F0MA 4H4KA 3BM7A 1GMWA 4C8ZA 3BJYA 5IQQA 2CPIA 2A1RA 5CD4A 5AFUH 3F2KA 4DTMA 3QLHA 9ATCB 2ASJA 1WG1A 4ANDA 3RYLA 2R7RA 1KVIA 3D5MA 3CYMA 3C8YA 3NKYA 2IAJB 2L3MA 3CULA 2XY6A 2CFXA 3E51A 2DGTA 1N6QB 1LOUA 2B56A 2FHMA 4OGEA 7FDRA 3D1OA 3S6EA 3IAYA 3FEZA 2QWLA 4WCEL 1K73T 5A8RA 2J0QD 3VAIA 3TQEA 2BVZA 5KFQA 4QR0A 5KFUA 4JI2K 3W0LA 5IV4A 4OJRA 4CJLA 4PPDA 2B9WA 4R79A 1UW9A 2W9CB 5HL7L 1L3TA 3LO3A 5AQLA 4Q2MA 4AQYJ 4OLOA 2O8BA 2H51B 4IZ9A 1DQ8A 3NGDA 1LW2B 2RS8A 2DNPA 4W5QA 5IM0A 3JSMB 2RJZA 3I0SA 3PW7A 3SQ2A 3LDSA 1P90A 2P5OA 2OTLS 4BRPA 1QAYA 3ZTQA 4LFCJ 4GY2B 2DHAA 1TL7B 1JLFA 1Q86T 3R2DJ 3AD7C 1W97L 1ZPVA 4BR7A 1TUGB 2VUGA 3MR6A 2QLXA 3EL2A 2R2TA 1U2VA 2CVIA 2F7TA 1DGKN 1I94F 4F3OA 5GIPA 3MEEA 4B3SJ 2ROEA 3DCAA 5GIOA 4Z4EA 2HHQA 1I94J 1UFLA 4CEBA 3TA0A 3D67A 3HHNB 3NVKA 5F2RA 1UTAA 4FJNA 2GX9A 2KTQA 2H1YA 3QB0A 3QINA 1Q79A 4A8FA 1U0SA 3FZFA 2XNQA 4R8UA 3H4BA 3KLHB 4Y2IA 3KJFB 4U8YA 4OX8A 3K2PA 5LSLA 5J1EA 2B9XA 4IH6A 4Z37A 2B9EA 3J7YP 1R43A 4K7QA 3QMQA 2KHCA 4DV3F 5IFMA 4FF4A 5DM6Q 2HAIA 3HVTB 2VGMA 3HJVA 3ZC4A 1KVBA 2V2QA 3A8KA 1ZBUA 2FY8A 3S01A 1SAZA 4ED4A 2FVPA 3L2WA 4DR1F 1KKHA 1HBUA 3QIPB 3M8YA 2YNHB 1QQMA 3EDRB 2HHHF 4AQYF 4DJBA 5LJ3Y 2HBKA 1ROFA 1K6YA 3NF9A 1TL1B 1VIOA 2Z1IA 3OL8A 1VSMA 4NCGA 2FBYA 1NPKA 2DFEA 1DTTB 5KT3A 3BEGB 5KFVA 1FCAA 1LCUA 2UXBJ 1Q81O 1R0CB 5BR8K 2GQ2A 1BLUA 2YHXA 4RWWA 4NASA 3BGRA 4IOAL 3WNGA 3LDQA 3DLJA 5JMVA 2FUG9 3NE6A 2E2QA 5GAHP 1IKWA 2FJVA 3KLEA 4M3ZA 1CG2A 2GMLA 1HR0K 3DOKB 1VSJA 5HRNA 3NMAA 1LV5A 2H4WB 5I42A 1GMVA 2CQHA 1R8AA 2WSEC 2XEXA 3G4SS 1WKLA 2UXCJ 1SJQA 2BKNA 4AHUA 5FLXU 4DL4A 4CHOA 2NRZA 2IIRA 4F02A 1PYSB 3OHBA 1JLAB 4OX9J 3CDWA 3HMJG 3UCUP 4C3LA 4JI3F 2DD8S 1WHXA 5HBMB 3FUYA 2DGQA 4KFBA 4GVBB 1CC7A 3U27A 1FRIA 2XZDB 2V6AA 3VENA 4KAZA 2YQ0A 3Q89A 1D9AA 4B3TK 2KRBA 2HHWA 2RIJA 2Q2RA 4CI6A 2M70A 1VIXA 3MAAA 2B7BB 2YPZA 3RVCA 1LNQA 5I4MA 1K0VA 2DNOA 3KFWX 2Y1JA 2JGUA 4X65J 5JUMA 4BDYA 1NGDA 4QR1A 3ETOA 1RUSA 4HT7A 2OUGA 1S1WA 4DL6A 4ILRA 4DR2J 3PV8A 3CJSA 3R8YA 4ECTA 2VHGA 4ZLJA 3G6VA 2RMLA 2OO4A 1QSSA 1Q4RA 2ZKTA 1VSEA 4KBIA 5LMUK 4CRJA 4ZPDA 4RCHA 2AIRB 2F40A 1RBUA 5ETOA 3G6ES 2DCUB 3SCLE 4DCHA 1NLKL 3K89A 3GMGA 4UOFA 4HH1A 2HHPA 2YX6A 4CJVA 4YFUA 1IQZA 3IRWP 3G71S 4G3IA 3KHLA 2IA0A 1C1CA 2CPFA 4ECVA 4IG0A 3AAWB 1WAFA 3ILIA 1YBAA 5GADI 2RNEA 3W1YC 5DK5A 2NRVA 5HROA 1QE1A 4QIEA 2VC0A 3TAEA 4OKKA 3FCVA 4P2XA 5LL6d 2BE2A 5KFCA 1S22A 3AVCA 3UPFA 3KZBA 5AQMA 3C2PA 2N7CA 2Q79A 2OA8A 5F8GA 1BO5O 2C2ZB 2QWPA 2UUTA 4K0KK 2ZITA 1UZDA 3F0NA 4NPOA 4JD2B 3I6PA 2EXUA 4USWA 4NA3A 1VQ7S 2RSQA 4CO0A 3S3NA 2YXLA 4F4YA 1RDWX 3CIZA 3V9XA 5CH7B 4F7VA 4GKJF 1WNSA 2D9PA 3MZIA 1N0UA 4U67L 3SSQA 5D3GA 2XQCA 1P1LA 4OV6A 5B08A 3C3LA 2AJ1A 5HVGA 4DL7A 4BRFA 3O8WA 3DLBA 4YOYA 4DV3J 1E6VA 3PO4A 2D0OA 4PEOA 3VQPA 4H4OA 3TJAA 5F8IA 3DRRA 4C23A 4Y3CA 3LP1A 1WUAA 3OXFA 1U04A 5DG8A 2V7YA 2OI2A 2W40A 2B6AA 4ILGB 1TAUA 4EZ6A 3KJQB 2NRRA 3VAGA 1R27B 5KGWA 1RTIA 2APOA 3O9QA 2A6MA 3SPZA 2G13A 4ZVTB 4BHQA 2G0CA 1S1TB 1WKKA 4AHTA 1S1UB 4CF9A 2DITA 1VRQC 3CB4A 1YGYA 4RBUA 2PAVA 2QTWA 1QM9A 5M2PA 4LF9K 5H9FJ 4ZDNA 3TZWA 3W64A 4I2QA 5KT2A 3AA8A 3CSKA 4PKGA 1GQEA 1F9FA 2VZ9A 2Q43A 3KWGA 1NMNA 1GLBG 1GNKA 4B1WB 4N7TA 4B3TF 3I55S 3KHHA 3ZTSA 1GFWB 5K8OA 2HBJA 2X1AA 4O5BA 4DV4K 3CDUA 3J7AN 1FJGK 2H48B 3T41A 4KB7A 4K0KJ 3DLHA 3R2CJ 4PUOB 5E5NA 3ULHA 4Q44A 1FFSB 1VBZA 5DDPC 1KQFB 5MLCV 4CT8A 3PCOB 2PT0A 2NYHA 2R9LA 5D6GA 2KRRA 3NWGA 3R5GA 3K59A 3IRXA 5KFMA 1OSCA 1JLBA 1ASUA 4JUZA 5AXKA 3R5CA 1C0TA 2XS2A 4IEEA 2AGQA 2DRDA 4DEZA 4ECSA 4IQXA 1RB0A 4LF7K 4G1PA 1N36K 4UQTA 3C6TB 5AJ3F 3T6JA 3WXMB 2UUAJ 1K8AT 4EP5A 2OPPB 1SIWB 2O8FB 3AT1B 4L72B 2UU9F 4I4BA 2QXFA 2E1YA 1YSJA 2HNDA 3TSPA 1XNRJ 2RF2A 3R5JB 4MH8A 4MDAA 1S6QB 3TAPA 4K59A 2XMMA 3P1GA 3A5LC 3CCZA 2FGCA 3MD3A 4NO7A 5HP1A 4NA1A 2UUAK 1S0VA 4CFAA 2AWZA 3G82B 4YDXA 2QWQA 3AO4A 2UUWA 5JS1A 1RTJA 3SQGA 4KH5A 3W63A 3O1BA 1EKRA 3LANA 1X4DA 2O5DA 4K4TA 4UY8T 1RWUA 1IBMF 1TK5A 1S9GB 2XLKA 4EBCA 1WOOA 4GC6A 3KLIB 4WZQA 1J5OB 1K9MO 2ZJRL 3AAQA 4NLSA 2V34A 3V4IA 4K0KF 3BB5A 4U7UD 4I7FA 4JI5K 5RUBA 4J8FA 1N33F 3CO9A 1RCXB 5A6WA 1QQCA 4KI4A 3BBBA 2RKIB 4LSNB 2JFKA 4H4MA 4CI0B 2DFHA 1OH7A 2CQDA 1EAYC 2RVJA 3VZIA 5IC4B 1EQMA 2OTLN 1OH8A 2YKPA 3NVMA 2DH7A 4DPUA 1Q82O 1F6TA 3CCVS 3SNNA 4JEPA 4P7TA 4BS2A 2JHEA 4OYMA 3FZKA 3WZ0A 3EVOA 4ATNA 3MEEB 3VEVA 1WF0A 3LW5C 3IFRA 2BRKA 4FW1A 3UR0A 4ZPTR 2BEFA 3GIIA 3NXZA 4BROA 4GKKK 4H5RA 4GVEA 1D8ZA 2FLOA 4OI2A 3CJCA 3NGIA 3TAGA 2ZJPQ 3CGIA 3S9HA 1FFWB 4L6V3 3LZJA 4YMEA 3FBFA 3L2RA 3V6HA 1TUUA 3RB6A 1KONA 4X64J 1HQEA 3US5A 4YP3A 2ZC4A 4ILMA 5A8WA 4MAKA 1FVSA 4CLWA 4I9LA 3MM7B 3ZETA 3NF8A 1HNZK 1IBLF 3IWLA 3B82A 2XC9A 3NAIA 4U95A 3IKMA 4CD1A 2AF6A 4WFAQ 3PIOQ 4E1JA 2EFOA 4CF2A 5IQ6A 1FJEB 3TVZA 4BRNA 2BANA 1OH6A 3OSPA 4FWMA 2M9KA 2W4PA 4RTFD 2I1RA 4RNFA 3HI0A 4MKBA 3QJLA 4DR4F 3HPOA 2MQPA 2E5LJ 2V0NA 1IBKK 4RR5A 3M2VB 5ETPA 4B9TA 4AILC 3DXKB 4A8KA 3ILLA 3LWLA 2UV8G 2E20A 2VQFK 2J8SA 3Q8UA 2NREA 2DTJA 2E5LK 3IS9B 2XMVA 4JS4A 4EYHB 2JH3A 4JI2F 4EWTA 4CBWA 3MN5A 2MDAA 3GJRB 3CCWA 1JLBB 2RDJA 1JIHA 1JX4A 4R8UB 1IBMK 2HNDB 2RD5C 5E0OA 4V19S 5KRTA 3EGZA 4U7UK 3ID8A 1VISA 2D3O1 1M1GA 1VLOA 5KG6A 4KTZA 3W8PA 3NNCA 4ZKAA 5KFEA 2YWKA 5A0YB 1JXEA 2OGUA 1UVIA 1VQPN 4BRAA 4PWUA 1EP4B 2CA9A 1TKXB 1OPIA 2NSBA 2ZEJA 1XNRF 4HEA9 1WTFA 1CEZA 2A41A 5I9EB 4AHVA 4O3NA 2XY8A 3LGHA 4MKVA 5IM0B 3L2UA 2ZHAA 3W7BA 3L8BA 1QJHA 4A62A 3MFIA 1BQNB 2WVCA 2EHGA 2LEAA 1Q7LB 2POKA 4CLLA 1WEYA 3G10A 2VWKA 4OX9F 4CEZA 1WSIA 2HQ3A 3I5AA 1W2BM 2HQFA 3UI3A 4CJ5A 1PC4A 2DGWA 3HKWA 5KT6A 2CWXA 3A5OC 3NBPA 3ZTPA 2PC6A 4USJC 3EX7B 1EIYB 2VPWB 1DURA 3V9WA 1TYQB 4O4GB 3TP2A 4I6AA 4YDUA 2E9ZA 2XTJP 2VICA 2RF2B 1NGGA 4I9QA 3PHEA 5ITHA 4MIAA 2VFUA 2V2VA 1M5SA 4FLXA 3NY0A 1VQNS 4K4YA 4IBNA 1BD6A 4IFVB 3FZLA 4CBUA 1RCHA 1B7YB 4UZCA 4ZLLA 1QUPA 5AQPA 4PY5A 1KD1T 1S5JA 3DYAA 3ZO7A 1S4EA 1JK9B 4FM1A 2EPIA 2OKQA 3F9KA 1YUWA 4B1YB 4LH5A 2OPQA 4O8KA 4ZN1A 1ZYQA 4Y6IA 1RT5A 3CCSN 2BBEA 2ZH8A 2KO1A 2P9UA 1F9HA 2D41A 2W01A 3GJSB 2CPJA 3MMCB 1D3WA 3CJ0A 4IOCL 3CXCR 4CDIA 5FJ4A 2DY4A 2LQJA 4J9OA 1ZS6A 1EX4A 4BCAA 4O55A 2DJWA 1XR7A 1R59O 1FD2A 2PFUA 2PEBA 5FPNA 1UJ4A 5THWA 4CLSA 4BRDA 3SQ0A 2ZUGA 3WQUA 2IJNA 2FTRA 2IC3A 3TEGA 1XHZA 4JI6F 2QXLA 3QWPA 2Y3YA 1VFJA 2X1FA 3A0IX 4EMDA 2Q1LA 3V9SA 1N5SA 3DOKA 2ATCB 3AVMA 2NCKL 3HCXA 4KGKA 2FGOA 1GLFO 1VQNN 3AY0A 3E01A 3S7RA 3POTA 4CO3A 1ZAVA 3QIDA 5ETSA 1HWKA 4OI6A 1X3MA 1N5TA 3NS7B 2VQFF 3BGRB 3WHIA 3DOMA 3K0SA 4ELVA 1X5TA 1CJTA 3MDQA 1QSLA 3QNNA 1EJ7L 4PYAA 2KFZA 4DR5K 4FF2A 2OMLA 1YQHA 4JI4J 5HLFA 3LDOA 4ZJOA 4WXOA 4RNNA 4C4WA 4FWSA 4UOHA 1PC5A 1TUYA 2IVMA 4U7BA 1X4FA 3T1AA 5LXYA 3JB9k 2O8CB 4M63A 2HNYA 1B9DA 2A6OA 4AHRA 2K2PA 2OD6A 2JLGA 1RT7B 3UW1A 1IKVB 2NXCA 2CG8A 4DOZA 3TARA 2B4VA 3L2VA 4LF2A 2QA4N 3LP0A 3DHWC 2F8TA 4W5NA 1VS3A 2G1DA 5BREA 2YWFA 5KFFA 5A8KA 2Y0BB 4JV0A 1U1LA 1KRPA 2W9BB 1GX5A 1NDKA 3LALA 3M2RA 2DNHA 4B3MF 1VJWA 3KOAA 1VGYA 2CAJA 1FRMA 2R3VA 3OBIA 1EARA 3HKZD 3QAUA 3C14A 2E1CA 4CZFA 3UNGC 1QVFM 3ET6A 2MXYA 3AD9C 1XEZA 2HNZA 1WSJA 3KIOA 2HHXA 4LF4F 1E6YA 2RHKA 4Y34A 3HD1A 4JKDA 3IWNC 3LQVA 5AQGA 3N4QA 3MM5B 4AH9A 3I0RB 2GFFA 1FT8A 2QKKA 4NCGB 1WWHA 2J9DE 4CH1A 1XNQK 3DN9A 2CNNB 5C7PA 1HI8A 1BGXT 3CQ8A 3ENVA 1FRHA 3MURP 3KK3A 1TL3A 1N36J 1YRXA 5KT4A 4DCJB 3DOLA 2XLIA 2YI1A 4CE9A 2GBZA 4DU7A 3O4QA 5KFOA 4HWIA 5M1NA 2FVCA 2XMJA 3KD1E 4A46A 5E84A 1NGBA 1ITGA 3H4DA 3H5XA 4A8XA 3NAHA 4M63C 1M1KT 3A8EA 2A1BA 2GQCA 2OSQA 4LFBF 3FZHA 4KGVB 1HQUB 2A2DA 3BUZB 1QUVA 2FJDB 5GAGP 4H5NA 2C3PA 2UVVA 4WU3A 2C2RA 2DVIA 3M6XA 4BLGA 1Z26A 2IRXA 3T1HK 1PYTA 3WX8A 2PFDA 3L0QA 1RHMB 1TL1A 1HMVA 3C66A 2RN2A 5K5MA 3FK4A 5FD1A 2FBVA 3V6DA 4K2JA 4M5HA 3LM9A 3CMAN 3HSCA 1BQMB 3AB4B 1FJGF 2YNFB 1BL3A 3AVNA 3KLHA 1WC3A 1CS4B 5AQNA 1KHVA 3WXKA 2VG7B 3TUPA 1KEKA 2GVZB 1RSCA 2VFSA 4PWDA 3CCRN 1K1QA 2GJFA 4JRPA 2MPUA 2WCXA 3AO2A 1HNVB 4BGAA 3H20A 1DJ0A 3HXMA 4J2BA 4WQ4C 4QU6A 1S9GA 2RDDA 2RE2A 4CHNA 2UUCJ 1U2RA 5T14A 3WQPA 1CJKA 3VQ9A 4A57A 1S6OA 3K5MA 3VGSA 3CJ5A 4DLEA 3W3DA 4DUZF 3KKRA 4DQIA 4BVPA 2KHDA 3GYGA 1JLFB 2H4YB 3PW4A 1Y7PA 5GAHU 2DXFA 3TAMB 1KSPA 4MIBA 4I69A 1NK9A 3MCPA 3O5TB 3GE9A 3NWRA 3DOLB 2MQ8A 4ZCKA 3UVJB 3ZT1A 1VQLN 1EWQA 1KFDA 4E7HA 4MYTA 1NGEA 1AT1B 1H6KX 3CCUN 1IG9A 3A4TA 2IBOA 3OL9A 3SJHA 4LVOP 5AQWA 3Q7CA 4FSVA 2YH1A 1RT6B 1KVCA 2QYGA 1P8GA 3SQ1A 1JQGA 3ZZOA 3RAMA 4YN3B 3OHAA 3C95A 1RBLA 3OR2A 5IS2A 2FC0A 3DXMB 4I6MB 1UFWA 3VEZA 2UYTA 1YJUA 2HS4A 3TRGA 3LP1B 1V4SA 5M1KA 4FLWA 3D3BJ 2G8HA 2J0SD 1FX2A 2V8HA 1V9OA 1G6BA 3B6BA 1XNQF 2W1BA 3CETA 3UQSA 2N4CA 1KAYA 2VU5A 4BR4A 2VWBA 2EEYA 4RW6A 3MM9A 3F9MA 4KRWA 4JYAK 3ZSRA 1VRTA 8AT1B 1FHTA 4OYBA 1HYZA 1M5OC 1WAJA 2GMJA 4DV6K 5A8KB 1FRLA 4CZHA 4PKHA 3BZCA 3BBFA 2BTFA 4YOWA 2WBRA 4P72A 1BU6O 2J4RA 3VQ4A 1Q0NA 3CIMA 4NCAA 2QIFA 1KOOA 4LRDA 4A4JA 3ZTRA 2HNYB 4BE0A 5HOOA 1JLCA 1S1UA 4I2PA 2EFGA 1QAJA 1B64A 2CDQA 5M1FA 3FVYA 1ATNA 3HT3A 4U9RA 2NYIA 3UKUA 2LQ5A 1ULRA 2ZJPL 3N6MA 2I6WA 3M3ZA 3O9SA 4OZJA 3L9ZA 2Z1JA 3GJQB 3V9ZA 1WHYA 3DWLA 1HHTP 4AFFA 2L41A 3JSYA 3M7VA 5KFPA 2PEHA 2C42A 4YHHF 1YK9A 3QO9B 4M3WA 5IWAF 4O3RA 4FZZA 4OHZA 2P51A 1XR6A 2PMHA 4P74A 4CO5A 4PUOA 4UOCA 3J81Y 1M5KC 4NLBA 2BQ3A 3PZPA 3A5NC 4JI2J 1B70B 3N6NA 2X3GA 4QWCA 5F8NA 1KAXA 2YTCA 2VC1A 4I64A 5BR9A 5LMNK 5F9LA 1AUSL 3WEEB 4FPIA 5F0WA 1LAWA 3CJTA 3LDPA 4YR2A 1KTQA 2B4UA 3GWCA 2D3UA 2P8IA 3IC1A 1T9YA 5FDLA 1VBXA 1MWQA 5C12A 3EXCX 1PJ6A 2B6AB 1Q9YA 5SUHA 3CCRS 5EGYA 2D74B 3LPYA 4X62J 4DUYF 3R6LB 3FMBA 3TZZA 3GPAA 4C8OA 2R2SA 1CBKA 2E2NA 4BE2A 5KFAA 1KD1O 1N5YA 3SCIE 2J9CA 1GOAA 1UKUA 1NLVA 3AFGA 4NXNJ 3FNNA 1G3OA 2CG4A 4QZVB 4EYIB 4E2FB 1S6UA 3J81O 1EETB 1UWBB 1YZ6A 2VFRA 4ID5B 1VJQA 2CJAA 3DLEB 1IR0A 4KH4A 3CC4S 4K43A 3PYDA 2GV9A 2OELA 2V52B 1N34K 4IG0B 4QYZJ 4IRKA 2G2OA 3RAXA 3OR2B 1LW0A 1BQMA 3RBDA 1B92A 5LMNJ 4YY3K 5LJWA 3GFZA 1PILA 2HIQA 4OIXA 1VSIA 1SC6A 4B1XB 5CZ1A 1ILYA 2OAUA 4DV1J 3PHTA 1S6PA 1H72C 2ASLA 4DWIA 3QIPA 2H54B 1RBVA 1WC0A 3EEQA 2JJ4D 1PAUB 4WF9L 4MKYA 4NYZA 1H7XA 3ATUA 4I7FB 3EICA 4FYVB 4KPCA 4CK3A 4RNMA 3OHRA 2QN6B 4Z94A 2HHUA 1T0TV 3PR5B 1C0GA 1DQAA 4QS8A 2IMWP 2G0JA 2JEJA 1J53A 4LR7A 1OO0B 2BKOA 5GAEI 1RABB 3EE8A 1NK6A 3VF0B 2GWJA 2CH6A 1SKUB 5ETQA 3VEYA 2QX0A 1K1SA 2K7JA 3LPTA 3OA9A 4A2AA 3SUPA 2WBMA 1UP1A 1RHKB 2N3OA 1HBOB 5KFIA 4DV6F 3FZMA 1HKAA 3OPKA 5AQKA 4FWQA 2W24A 4H0XB 3DJCA 3SUQA 1OY6A 1O13A 2RQMA 2FJWA 3C16A 4X4UA 2YKNA 1IUJA 1Y64A 3IN5A 1SJ1A 5JS2A 3EZWA 3B78A 4F4KA 1XMQJ 3HRGA 3DRXA 2O8FA 5AJ3K 1WOSA 4IR9A 3ASMA 2IA6A 1FDAA 3DRYA 4TU9A 3CQYA 3DM2B 4YOTA 4OJHA 1R8PA 3MAHA 4J9RA 3HK2A 2NZCA 2WRMA 4OZ2A 4K4SA 3PACA 2Z2YB 3QSYB 3KLEB 4ZJQA 2OH2A 4XIUA 4I2PB 4WFNL 4KAIA 3BF3A 3D0HE 3BS9A 4EO6A 1RWKB 4FJHA 4LUBA 4IUFA 2XMUA 5L9XA 4CJRA 5GADP 3C6UA 4YR3A 3E9OA 2ZQBA 2DNYA 1NBEB 3IAM9 4L74A 2CZ9A 5IXUA 2C22A 2B4OA 4IOCQ 1SH0A 3VESA 4CYUB 3NCQA 3BYPA 2O8DA 3PVXA 2VG7A 4J9KA 3UR3C 4QAGA 4OYPA 2W9BA 4WJBA 5CYQB 3ITHA 2VA2A 5K14A 3W2WB 4LF6F 2W2OP 3CPEA 3QEWA 4DUTA 4JI4K 4OGCA 9RUBA 5E26A 4XDCA 4CJSA 4HHUA 4O8UA 3P4IA 1XMQF 2QI2A 3O08A 1A9NB 4E7IA 1CJUB 4WYWA 4NLCA 1T05B 4OX7A 1RBOB 4O3SA 4LT6A 4LC9B 3R27A 5G0RB 3AH6A 2XHWA 4IXCA 2V51B 4V19X 1U47A 3G87A 2WW4A 2BJ3A 1Z2ZA 3AO3A 1S77D 3L6QA 3TNVA 1FXLA 3D3CJ 1MWZA 3G9CA 1TK0A 1IWAA 2WOMA 4IJNA 5HVHA 3GR0A 1NGAA 4C8YA 4HCCA 4JI1J 3D0IE 4DR7J 2XGPA 2QJ3A 1Q86O 5F0XA 1BHLA 3GV8B 2R8JA 3D0GE 4NCBA 1RACB 3GSDA 3FBEA 3EPIA 4DN9A 4QWDA 3HSTB 1LWCB 1L3UA 1RDCA 1H2TZ 5DQHA 1BMQB 1RDRA 1VQ9S