1TVRA

Hiv-1 rt/9-cl tibo
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Aspartyl protease
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tvrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tvrA05
1IKWA 4DSKA 4IRDA 2XRIA 2W9CB 3P5JA 2QKKA 3SNNA 4YR3A 4DS5A 1CXUA 1LW0A 3RWUA 4CF0A 4J9RA 3CWJA 4JUZA 1BGXT 1S10A 1HPZB 3ALYA 1HJRA 3OSNA 2BGGA 4K4YA 1JX4A 3H08A 3QLHA 5J1EB 3PW4A 1XI1A 3HVRA 4DTOA 1L5UA 4ED0A 1DTTA 1Q8IA 4FLTA 2P5OA 2Q3SA 2IJFA 2JEFA 1S9GA 3RAQA 1KTQA 1TKTA 1C0MA 2Y1IA 3KLIA 5FDLA 3CDWA 3V81A 2KQ2A 4W5RA 4FJHA 4DU3A 3O3GA 1Z25A 4HHTA 4TQRA 4EZ6A 4KI6A 3QLHB 5J2PB 4FJ7A 1T3NA 5F8HA 5E41A 3EPIA 2ZE2A 1JXLA 3KK2A 4GC6A 5KGXA 1HYZA 1RNHA 3GV8B 2P1JA 1RDCA 1HYSB 2R2RA 2FJXA 3V81B 3THVA 4ZP9A 2IAJB 1VSHA 1RBRA 3BSNA 1WSGA 3H4BA 4NCAA 4KTZA 3VQ5A 4CJKA 4MFBB 4YP3A 2WOMB 4FBUA 5EWEA 3PW0A 1KLMA 1NOYA 2ZE2B 4QWDA 3KLVA 2GBZA 5DK5A 4F2SA 4LQ3A 2O4IA 4IG3B 3MEEA 4FJGA 2KZZA 2AJQA 3H5YA 4EO8A 4IKFA 2EX3A 3KHLA 4DLEA 4EZ9A 4J2DA 4NCGA 4CJVA 4Z4FA 1NJZA 4ZHRB 1WSHA 4DG1B 4EP4A 4M3ZA 1QE1B 5J2QA 3ISND 3OLBA 1S1XA 4ECVA 3B6PA 3D5MA 3MXJA 4QPXA 1S6PB 1N5YB 3AA2A 4DSLA 3IS9A 3Q8RB 4CF9A 5KG6A 3TAQA 2G8VA 1I6JA 3TARA 4ZPBA 1WNSA 2IS3A 4Z4GA 1RTIB 1HNVB 4NLOA 3RBDA 3MXMA 5FRMA 3OYJA 5I42B 5J2NB 1J5OB 4PUOA 3LANA 4C8NA 1HARA 2ILZA 1JXBA 4F4KA 2JEIA 3FQLA 4CECA 4OL8A 3OHAA 4I7FA 1TK5A 3ZT1A 2I1RA 4CGHA 3ICLA 3JSMB 3QGHA 2OZSA 5KTQA 1FKPB 4FZZA 3CJ0A 4O3SA 3OHBA 1D5AA 4QWBA 3M8QA 5D3GB 5CY4A 2RKIB 1YT3A 4BWMA 4PUOB 2UUWA 1T7PA 3IGVA 4ID1A 2XCPA 4ECQA 2OPPA 4IKAA 2C2DA 5F8IA 1ZBFA 2VG7A 3VQPA 3DRSB 1TKZB 1TL3B 1S4FA 1TKXA 1XHXA 5C42A 5KGWA 1VSLA 1TV6A 3C6UA 4Q45A 3V9SA 1IKYB 2IC3B 3HK2A 5F8GA 3T5LA 1S9EB 5EU7A 2BE2A 3OYNA 3TQ1A 2X6SA 2C28A 4DTXA 2CKWA 2BQUA 3KOAA 3NL0A 3CQ8A 3JYTA 5CYMA 2VG7B 1TKXB 2ZD1A 3PJWA 1ZTTA 4FLUA 1TVRB 2FLLA 5EDWA 4DFMA 1U45A 5CYQA 4B08A 5CZ2A 1D9DA 4IFYB 4ED3A 3PJXA 1VRTB 3BDPA 2BE2B 4K4WA 3VQQA 4ZPCA 1SV5B 4CGFA 3ZCMA 4N76A 2D5RA 3HHKA 2AGQA 3LP1B 3A2FA 3MR3A 1BQMA 1JXEA 4DTNA 1C1CB 2DFHA 2ZD1B 3HXMA 4FJ9A 4LSLA 5KFRA 4DL6A 1UA1A 4N5SA 3CYMA 1RT3A 1RYRA 1BI4A 3EYZA 1YVFA 4CHQA 4KHSA 3H2LA 1MMLA 1HQEB 3AVKA 2IOCA 1MU2A 3PZPA 1T05B 2C2EA 4FLZA 4WYWA 4X2BA 3LP3A 1JLAA 3OYEA 3OL6A 2AGPA 4QOZB 4O3PA 3V1RA 2BQ3A 2HNYA 2D3ZA 2B5JA 3M9NB 4CHZA 1ZETA 4KI4A 1BI4B 3SUPA 2ZQBA 5KG3A 4U7CA 3DRPA 5I3UA 3S3OA 4XO0A 1KVBA 3DLEA 3OSPA 3UPFA 1SKWA 4ZP8A 1UWBA 5KFZA 5KFPA 4GW6A 2YNIB 2FLNA 4BE1A 2FBVA 2Z1HA 1S1TA 4KB1A 4WE1A 3KIOA 2BDPA 4CJTA 4JV0A 3V9WA 1REVA 4CGDA 3ITHA 2B5JB 1WAJA 4MKAA 2VWJA 3V6JA 3IAYA 3HP6A 5KFQA 2UVUA 3KNAA 3AVHA 4GC7A 4F3TA 1B9FA 4RW8B 4DL5A 2R8IA 4PY5A 3N6NA 2ATQA 2HAIA 2ASJA 3NE6A 3QEIA 1TL1A 2FBXA 3OL7A 4CGJA 1XWLA 1L3VA 3PUFA 1ZBUA 2W42A 4FS1A 3V6DB 3OYHA 3HPGA 3MEGA 1RT6A 3OJUA 4IFVA 3L2QA 1J54A 1IKVB 3HL8A 3H4DA 2R8JA 2W8LA 4Z0UA 1TGOA 4JV1A 3GIKA 4FBTA 3U3GA 1RTHB 4KREA 2IMWP 4CJRA 1CXQA 4DLGA 4ECZA 2R7YA 4Q0BA 3SV3A 1S1VA 3PY8A 1T03A 3SUOA 4KHMA 1QAIA 4F4WA 3IG1B 1U49A 4QCLA 4J9NA 1RT6B 4ECWA 2ATLA 1O1WA 5K14B 4RNMA 4ED8A 3OYIA 4KAZA 3C6TA 1F21A 2HNZB 2YNHA 1NKBA 4FK0A 1WLJA 4L8RB 4PWDB 3KLEA 5KT7A 3IN5A 2R2TA 3E51A 5KFAA 2G8WA 2VA2A 3NGYA 3BGRA 5HRNA 4ZVGA 1BL3A 1GOAA 4DSFA 2YKNA 1B92A 5F8MA 3NF8A 5KG1A 4OVLA 4ELUA 3CJ3A 4KO0B 2HMIA 1L3TA 4RNOA 2E4LA 2AGOA 5HROA 2G8FA 2GC8A 4H4OB 2IM3A 1LWEA 3AVMA 2BANA 1D1UA 4OKEA 4KHYA 1RTJA 2CJQA 4BE0A 4HCBA 4KB7A 1XR6A 1N6QA 4CEAA 3HVTA 2RDIA 1C0UA 3MR6A 1CZ9A 4B9MA 5KFIA 3Q8PB 1R0AA 3QIPB 5KFUA 1B9DA 3RMDA 2WONA 3I8DA 2XO7A 4DFJA 3D45A 3RB4A 3NHGA 4KHNA 3DLKA 2OPRA 2ASLA 1T8EA 3ZT0A 1S6QA 1W0HA 4QWEA 3U3YA 4C8OA 4CESA 2XI2A 3NDKA 4WXWA 3DOKB 1N6QB 2QK9A 1XR7A 3HVTB 1C0UB 3BREA 5C25B 3PVXA 4RW9A 1JLBA 3TAMA 2WONB 3ZSXA 4DFKA 1SL0A 3FFIA 1I39A 3F9KA 2OPRB 4DQPA 1KHVA 3LPUA 3UR0A 2C22A 3G6XA 3CDUA 2YKMB 5DGBA 4IH7A 4O4RA 1K1SA 4NYFA 1RCHA 2VG6B 3K5LA 1EP4A 3KMSA 2XY7A 3KK3A 2GV9A 4ZMMA 3K57A 4HCCA 4R5PB 4E7LA 1RT1B 3IRXB 4PQUA 3LP2B 2FVPA 3QZ8A 1VSDA 3K5NA 1KLNA 5HP1B 2V0NA 4RZRA 1QUVA 2WRMA 2BRKA 1D9FA 1VSJA 2FBTA 3VQBA 3K5MA 4TY8A 3WNFA 4ID5A 3OYAA 4G1QA 5KFKA 4J9KA 2W9CA 5L1JA 2GIQA 3RRHA 4CK3A 4DSJA 1CZBA 1HPZA 1XR5A 3AO1A 4FJ5A 1TQLA 3FDSA 1C0TB 2Z1JA 1BIUA 4TY8B 1U09A 2F8SA 4CFAA 4ED2A 1A5WA 2PYJA 1RA6A 3RMBA 1NK4A 3G6VA 3SZ2A 5DQGA 1VSFA 4C8LA 2PZSA 5DQHA 4QWCA 3EPGA 4DL4A 1LWCB 1RT5B 1BCOA 4Y1DA 5J2PA 4J2AA 4ICLB 1RDRA 5L9XA 4URSA 4XIUA 4FK2A 2R8KA 5KFJA 3LZIA 3MFHA 4CJUA 3L3VA 1HYSA 1ASVA 3RR8A 2I5JB 1RT4A 1RDDA 1KHWA 2W9BB 1NJWA 4FS2A 3G6YA 5KFHA 2IAJA 4XPCA 4B9TA 1GX6A 3CFOA 4MFBA 1DTQB 4K4UA 2AU0A 2WOMA 2HWHA 4E3SA 4QW8A 1I3AA 2W7OA 3MXIA 3BJYA 2ETJA 3UQSA 1BHLA 4IG3A 1TKDA 3PO4A 4W5NA 5C24B 4MH8A 1RT4B 1VRUB 2J6SA 3AVLA 2J6UA 3QZ7A 1JLFB 3KKRA 1HMVA 3MECB 4DTUA 1BIZA 2XGQA 3QEVA 1S0MA 4E7KA 4ZHRA 3CFPA 4DG1A 1T94A 3OS0A 3BQ1A 5FRNA 3SJJA 3GIMA 4URGA 3WNEA 1QE1A 4JV2A 2OPSB 4CIFA 2UVVA 2V4QA 5KFLA 1S6PA 1N5YA 1BISA 1ZBHA 3NGZA 1NKEA 1HMVB 2HNDB 3CM5A 2ITGA 1NK5A 3H59A 3LZJA 1U47A 4AHUA 2OPQB 4RNFA 4ZP6A 4HVJA 4MIAA 1KSPA 4ZPAA 1RTIA 1RAJA 1HNVA 5C5JA 3NAEA 3GV7B 4M95A 1S0OA 1ITGA 1SH0A 1QAJA 5I42A 5J2NA 1J5OA 1LAWA 5F9NA 3O4NA 4DTMA 3H5XA 3TWHA 2HHXA 4O44B 5KT6A 4M3WA 3AO3A 4DWIA 5L1IA 3JSMA 4IH6A 4NLUA 3QINA 1FKPA 3KK1B 4CEOA 4WYLA 1NKCA 4OLBA 4KBIA 5D3GA 2RKIA 2KFZA 3BSCA 3QETA 1QSYA 3CJ5A 4NLXA 3QYYA 5KI6A 3DRSA 3PX0A 1TKZA 1TL3A 5KFYA 4FJLA 1A5XA 3L2RA 2WB4A 2ASDA 4CEZA 3AVCA 2BQRA 4CJEA 2OH2A 4W5TA 1KRPA 4E19A 1IKYA 2IC3A 1S9EA 3LP0B 3F73A 3DI6A 2W7PA 4TXSA 5KFOA 4YMEA 4FLWA 2V4RA 3OYFA 3NGIA 1WSJA 5KG7A 4CFDA 3MAQA 2G8HA 4Q5VA 2F96A 1JLGB 4IG0B 2A1RA 4O0JA 3AO5A 3DLGB 3K5OA 4FJJA 3HO1A 4E7HA 3DLHA 1TVRA 4ECRA 4NLQA 3WNGA 5HBMA 2AQ4A 3DI6B 4IFYA 3QNNA 1VRTA 5KG2A 3PHEA 1UOCA 3VQ8A 3OYKA 2IM0A 1IH7A 3UIQA 3AVGA 1SV5A 4DQRA 3LP1A 3KLFA 3OL9A 3SPZA 2IBKA 4BACA 1C1CA 3I0RB 2AX1A 2XI3A 3CDEA 1WSFA 1Q9XA 1U48A 3FSIA 3OYGA 5KFMA 5HBMB 3O3HA 3ZSQA 1HQEA 2Z1GA 3SUNA 1UA0A 4EEYA 4ZTJA 1JKHB 4AHVA 2DPIA 1T05A 4LQ9A 4NRTA 1FKOB 4QWAA 2GUIA 3M8SA 3KLFB 1JIHA 3RR7A 2FLPA 1RTDB 5KT2A 3DLBA 1NJYA 1GOCA 3PW2A 3MR2A 3AVAA 3AO2A 4DQSA 4CEDA 1VSEA 2YNIA 1JL1A 4ZPDA 3VQ4A 3M8RA 3RTVA 1RYSA 1NK0A 3HVAA 2DFEA 5KFBA 2YNGA 1S48A 3OYCA 2IJNA 4C8KA 4F8RA 3QGIA 4OPJA 3V1QA 4LD0A 4TYAA 4M3RA 4RW8A 1RT7B 4HKQA 2FVCA 4B8AB 2IA6A 2WTFA 1K6YA 1EX4A 3KLHB 4HTUA 2YNGB 4URQU 1JL2A 4U6PA 5DMRA 2KZMA 4KKOB 4G3IA 4E1NA 3V6DA 3QIOA 4BDPA 4IQXA 4TY9A 3KHRA 4ED6A 3FRZA 2OZMA 2HHTA 3BQ0A 2BR0A 1U04A 4CE9A 1IKVA 4DU4A 4J9SA 4ECYA 2W9AA 3TR8A 1RTHA 4KHQA 5DG7A 4FM1A 4RW7B 4O3OA 1RBUA 3V9XA 4B9SA 3IGNA 4R8UB 4DEZA 1IKXB 1ZTWA 4B3OA 2XY6A 3M9OB 4MKBA 4CFBA 1HNIB 4F4ZA 3IG1A 1SUQB 4CF2A 3KD1E 1KCFA 3SV4A 1TK0A 2AWZA 3TANA 5K14A 1S97A 3VQCA 4DL3A 4F2RA 4J9LA 2HNZA 4FLXA 2O5DA 4NRUA 2YHBA 4ZVHA 4HYKA 4PWDA 4DTSA 4Y2CA 3HJFA 3DMJB 4B3OB 4RUCA 2D3UA 4CHNA 4LY7A 3PW7A 4OGCA 1LV5A 3KLGB 4CK1A 4JRQA 3AVBA 4CJQA 1BQNB 4NZ0A 3DOLB 4AHTA 3KHGA 1HRHA 4CIEA 3LWMA 5HRSA 3L2VA 4KO0A 1BCMA 4DTPA 2IGIA 1DLOB 3PR4A 3NF9A 3LWLA 3HPOA 2XGPA 4RW6B 3EZUA 4H4OA 1W9HA 3QNOA 1ZYQA 1NK8A 3HP9A 3NH2A 4J2BA 4DU1A 4KFBB 3H5UA 1WNEA 3PX6A 3ULDA 4KHUA 3C95A 4PA1A 4J9OA 4IBNA 2QE5A 3V6HA 3L3UA 3DRRA 4MQ3A 3HVWA 4DF8A 2F8TA 3QIPA 1RT2B 3AVFA 3D28A 4E1MA 2RDJA 5JXSA 3TAGA 2KTQA 4Q44A 4CFCA 2D41A 3DYAB 2F8EX 4OKKA 3T1AA 4RW4B 5JS1A 4CJFA 1U4BA 4IRKA 5JUMA 5HLFB 3S3MA 3RRGA 3SQ4A 3I5AA 4FW1A 2HHUA 3DOKA 4JRPA 4ECTA 4NLGA 3DRRB 3T5KA 5C25A 3NBPB 1SH3A 4ECXA 3WNHA 2HVIA 4IR1A 2XY5A 4M3UA 1D8YA 2G8UA 5DQIA 1S9FA 1D0EA 1Y97A 3CIZA 3D0PA 4K8ZA 2YKMA 1KVCA 1FK9B 1X9SA 1X9MA 2VG6A 4W5OA 3RAXA 4M3YA 2FBYA 3MF5A 5KT4A 3AV9A 2JC0A 1RILA 3NF7A 3PO5A 3P1GA 3CFRA 4R5PA 1RT1A 3IRXA 3VA3A 3LP2A 3QEXA 1KFDA 1SH2A 5HP1A 1C1AA 4O4GB 1NOZA 1QSSA 2R2SA 1JLCB 2YHAA 2LSNA 1IG9A 4WZMA 3G86A 4LSNB 2FVRA 3RB0A 1KFSA 4OJRA 4J2EA 4NLTA 4Z4CA 4W5QA 4Y2AA 2R2UA 3SI6A 4B9UA 3RB6A 1UAXA 5J2MB 2EC0A 1X1PA 3SUQA 3PW5A 2E9RX 2VWKA 3NMAA 3NH0A 3SCXA 1XHZA 1TAUA 4NCBA 5SZTA 1C0TA 4J9PA 4RNHA 3MTKA 3H5SA 3ZSVA 1SL2A 4EBCA 3T3FA 3T5HA 4RNNA 3ZT3A 3OLAA 5F8NA 1QSLA 1KVAA 3ZT4A 4CK2A 2AX0A 3O4QA 1IO2A 2YV0X 4DL2A 5HRPA 2DPJA 1JLEB 1EETB 1VK0A 1LWCA 4BE2A 1RT5A 1S1WB 2E9ZA 1HQUB 3ZSWA 4EP5A 2B6AB 4ICLA 4M45A 3SQ1A 3LALA 2HVHA 4IR9A 4FLYA 4KV8B 2I5JA 2XHBA 2JLEA 2W9BA 3ZT2A 1Q9YA 4BDZA 4I2QA 4KPYA 4CJ3A 3AVIA 1S5JA 4YR0A 3PV8A 1SKSA 2D0CA 1C6VA 1DTQA 4E7JA 4B9NA 4AHRA 4MK9A 2YNFA 4DTRA 4CERA 4WXOA 1J9AA 1Z26A 3E01A 4KB0A 3VQEA 5C24A 4FVMA 4FZXC 4I9QA 5KFGA 1LWFB 1VRUA 3V4IB 4Z4IA 2OA8A 2J6TA 4CJWA 4FCYA 1LW2B 3AO4A 1JLFA 1CSJA 3MECA 3MEDB 4DSIA 3MFIA 4IDKB 1S1UB 4I2QB 4FLVA 5KFWA 5KRSA 2G8KA 1IKWB 4NLSA 1X9WA 3HSTB 1RBTA 4ZP7A 1RDBA 2YNFB 2OPSA 4TLRA 2HHVA 1LW0B 4EBDA 3HT3A 3V6KA 1EKEA 3E01B 3HKWA 3NGDA 4C8MA 1C1BA 1OS5A 4BDYA 2HNDA 3GIJA 5KFFA 3TABA 1N56A 3OS1A 3SYZA 1S0NA 1DTTB 2OPQA 1WN7A 1TAQA 2P51A 4CEFA 1VSKA 1K1QA 1S9GB 4CJ4A 4B8CA 3I5BA 1TKTB 4FJMA 4CGGA 4FM2A 2OYQA 3KLIB 5FDLB 1W25A 4O0IA 2ILYA 4DMNA 4WZQA 4CJLA 1C1BB 2FC0A 3OL8A 3LAKA 3H98A 5KG5A 1WAFA 4O44A 1N4LA 3CVKA 3KK2B 4EBEA 3QEPA 3CG7A 4F3OA 3VQDA 5KFSA 3KK1A 2HHQA 2VG5A 3EZ5A 4FJIA 3OJSA 4M3TA 4YQWA 4QW9A 4EYIB 1L3UA 3VQ7A 2V9WA 4OLAA 4DTJA 1LAVA 4OGEA 4FM0A 4AH9A 4MK8A 3K58A 4DS4A 4CJ5A 5KFCA 1KLMB 2O4GA 3OYLA 4IH5A 1NHVA 2KW4A 3CJ2A 3MEEB 4IOBA 5EWGA 4EYHB 3NAHA 1Z4UA 2VG5B 4FYDA 5F8JA 3LP0A 4Q8EA 4NCGB 2X6NA 3ZSYA 4NLYA 3GILA 1JLGA 4IG0A 4AHCA 3G0ZA 3DLGA 4TYBA 5J2QB 1NK7A 2X78A 1S1XB 3TAPA 1NK6A 5L1LA 4CF8A 3KTQA 4H8KA 4M41A 3IS9B 4K50A 4TSXA 4KSEB 3KJVA 3T19A 1ASUA 4M42A 1IM4A 4RUAA 2Z1IA 2IM2A 4Y34A 3AA4A 2QKBA 3S9HA 4CHYA 3I0RA 4ED1A 3AA5X 5KFTA 3VQAA 3DM2A 2UUTA 4E89A 5KFNA 4OPKA 3DDKA 4E7IA 4H4MA 2DTUA 4AILC 3AA3A 4CEEA 3KJVB 4J9MA 4K4XA 1NHUA 2RPIA 1JKHA 4I7FB 4KHRA 3SFGA 1FKOA 2QV6A 1RDAA 1SL1A 4EO6A 1XC9A 1ZBLA 1RTDA 4XPEA 4K4VA 3M8QB 5EWFA 3DM2B 3VA0A 2HHSA 3V1OA 3LDSA 3QGGA 2JC1A 3LAMA 4H4MB 5KFXA 3MR5A 3ZSRA 2OPPB 4N41A 4CEBA 4I2PA 1VSIA 3V9ZA 5DLGA 1ASWA 5C42B 1YVUA 3M8PA 1TV6B 5FROA 3C6UB 4YFUA 3ZSOA 3I5CA 3SQ0A 3S3NA 3VN5A 3K2PA 4I9LA 4K4TA 4O3NA 1G15A 5KRTA 5L1KA 2HHWA 3QO9A 2DY4A 4DL7A 2FVQA 1TK8A 3OYMA 2UVRA 3JYTB 5CYMB 4KE5A 1RT7A 4JS5A 4I2PB 4KRFA 2UVWA 2JGUA 2JEGA 3B6OA 4NYNA 3KLHA 3L2UA 3M8PB 4KKOA 3OY9A 2IDOA 5CYQB 4F4XA 4CGIA 5KG0A 1JLQA 3TVKA 1QTMA 3L2WA 3RBEA 4K8XA 3QO9B 4Y3CA 4HUFA 1RA7A 1HYVA 4FJKA 2GIRA 4O3QA 2A1SA 4LH5A 4RW7A 1BQMB 1GX5A 4R8UA 3T5JA 1IKXA 4LH4A 3Q8SB 3BSOA 4GVMA 4LSLB 2JEJA 1HNIA 1SUQA 4KTWA 1RT3B 4CIGA 2D7SA 4JS4A 3G10A 1WSIA 1JLQB 5KG4A 1YTAA 2WK4A 4Q8FA 3O3FA 1MU2B 4NLRA 3QERA 5T7BA 3SQ2A 3LPTA 3FQKA 3Q8QB 1JLAB 4F4YA 3L8BA 3N6LA 4DSEA 2WHOA 5DG9A 3DMJA 4ZVFA 2HW3A 2HNYB 3TAFA 5KT5A 1FXXA 2B43A 2G8IA 2EHGA 3KLGA 3DRPB 2XWYA 5I3UB 3SI8A 1WSEA 1BQNA 4O5BA 2PYLA 3DLEB 3K59A 1RBSA 1UWBB 3DOLA 3ZSZA 3KD5E 4O3RA 4M94A 4YNQA 4YR2A 1S1TB 5DLFA 1DLOA 4WE1B 4ECSA 4B9LA 4MK7A 3ISNC 4RW6A 2RF2A 3KMQA 4O55A 1REVB 4Z4HA 3ITHB 4DFPA 3SFUA 2R8GA 4KFBA 2XY8A 4ZVEA 3AVNA 3GV5B 3HM9A 4F50A 3GYNA 3NH1A 4FXDA 3AVJA 3H40A 3NKYA 4ELVA 1TL1B 1RT2A 2E6LA 4TN2A 4H54A 2W8KA 3HPHA 4ZTFA 2ZKUA 2RF2B 2Y1JA 3DYAA 4K4SA 4Z4EA 3MEGB 2VA3A 5CZ1A 3RMCA 4IFVB 4RW4A 4ECUA 4FK4A 5HLFA 5F9LA 4FJXA 3QIDA 5DG8A 1NNDA 4OKJA 5JS2A 4DQIA 1QQCA 2B4JA 3CO9A 2P5GA 4B9VA 3NBPA 4Q43A 2FJWA 4Q0BB 1C2PA 3N6MA 1S1VB 4NLDA 4FZYA 1T03B 4RG8A 2ALZA 2XCAA 4KHWA 3C94A 4UQGA 4M3XA 1ZBIA 1EXQA 5EUHA 4ED7A 2IM1A 1FK9A 3BSAA 3C6TB 4DQQA 1NK9A 2YNHB 1S49A 4N56A 3I0SA 2BRLA 3EY1A 4FJNA 2XC9A 2E6MA 4JLHA 2KFNA 3QESA 3KLEB 5SWMA 4WFXA 1QS4A 3BGRB 3KKSA 5KFEA 4TQSA 2YKNB 4KTQA 2FVSA 1GOBA 1N48A 3CJ4A 4O4GA 4MIBA 4FW2A 2X74A 4CCHA 3VQ9A 4GMJB 4AHSA 1JLCA 4K4ZA 4KAIA 3U6FA 4LSNA 4HUEA 3I0SB 5DGAA 1CLQA 2C2RA 2HMIB 1L3SA 2FJVA 5HROB 5J2MA 1LWEB 2BANB 5F8LA 3OYBA 1RTJB 1A5VA 1TP7A 4RU9A 3NCIA 4NYZA 3BQ2A 4E0DA 5HRRA 3V9UA 4FJ8A 3OYDA 1YTUA 4WFYA 1R0AB 2D0AA 3P83D 4DF4A 3BR9A 4NLVA 4CHPA 4CF1A 3DLKB 2QXFA 1S6QB 4CJPA 2NUBA 1SKRA 4CJSA 1QHTA 2RN2A 1JLEA 1EETA 1S1WA 3VQSA 3KHHA 1HQUA 4RW9B 4WFZA 4Y1CA 4BWJA 2B6AA 1JLBB 3TAMB 1NJXA 4CHOA 5T14A 3PX4A 3FFIB 3CM6A 1J53A 2E9TA 2HWIA 3OVNA 3QEWA 5KFVA 4CEQA 3GIIA 3OS2A 4N47A 4KV8A 4HUGA 3SPYA 4R0EA 3ASMA 3M9MB 3NF6A 2D0BA 1RBVA 2HB5A 1EP4B 4ELTA 3RMAA 3KK3B 5KT3A 4IRCA 2R8HA 2DFFA 3UDLA 5KFDA 3NFAA 4NLPA 3DLRA 4J9QA 4PQUB 3NAIA 2PY5A 3TAEA 1LWFA 3V4IA 3RB3A 1LW2A 2WCXA 3PR5B 3HYFA 4NLWA 4ID5B 3MEDA 4QAGA 3TI0A 4IDKA 5J1EA 1S1UA 3VQ6A 4G1QB 3GQCA 1VSMA
chains in the Genus database with same CATH superfamily
2BM0A 1OYEA 1EIYB 4DS5A 3R27A 2DPNA 2RUGA 1LW0A 3I9V9 4J9RA 4JUZA 2DR9A 4BR4A 2WBMA 3ALYA 1HJRA 3O1BA 3M6GA 2D74B 2HMPA 4K4YA 3CDAA 1XI1A 2P9LB 3CJSA 4DTOA 1DBDA 3HBTA 5AQOA 2RS8A 1WC4A 2Y1IA 2DEIA 4WQ4C 5FDLA 3V81A 4Y00A 2GQQA 4DV6F 4FDFA 1N32F 3AAWB 1YJVA 4EZ6A 3K5PA 3D6TB 3HD1A 3QLHB 2ASPA 2GTDA 1BO5O 5GAEU 4FWLA 4DR6F 1RNHA 2P1JA 1P9YA 3CGIA 2EI5A 2R7QA 1AZSA 1B7FA 5ETOA 2IAJB 1KKHA 1S22A 1YBUA 4DV2F 2QSFA 5IT9Y 4A4JA 3H4BA 4PXCA 3DKDA 4CJKA 4YP3A 1SVDA 3CCTA 3OTOF 3KLVA 5DK5A 2O4IA 4I64A 2EFOA 2QYGA 4FJGA 1HWJA 4IKFA 4NCGA 3T1YK 3W9HA 1NJZA 4OZ3A 3SAGA 3D3BJ 4B3SK 4H5NA 1GLBG 5BR8K 3M6UA 2V67A 1YITN 1IBLK 4ZK7M 4I1TA 2DYAA 2BABA 2F9DA 2D1CA 1N5YB 1PAEX 2PDAA 3IS9A 4CF9A 5KG6A 2DRDA 2KO1A 2XMWA 3LTOA 5ETMA 5IFMA 1PSDA 4LF4F 3RSEA 3MM6B 1RTIB 1WKJA 4QIVA 4ILMA 2CJBA 1VCTA 3HFZB 3HTVA 5BRHA 4H0XB 3ZETA 1Q0NA 4ALZA 2CPHA 4LF9J 1GMWD 5BJRA 3ULEB 4DR7J 4F4KA 5AZJA 3TPQA 5B0FA 2YJFA 2VQEJ 2VC0A 1QY7A 3QGHA 4U67Q 1FJGK 2HBYB 3OHBA 4QWBA 5D3GB 1R6YA 2CG8A 2WZ1A 4PUOB 3NLCA 4ID1A 4I4BA 3TX0A 4ECQA 5D4PA 2ZVIA 4IKAA 2NRXA 2FHKA 2ROEA 1TKZB 1TL3B 1CPZA 3D4JA 3ZTPA 2IVMA 1NU4A 5KGWA 1VSLA 3BS9A 2R4FA 2IC3B 2HIQA 4RUHA 1CZAN 1PJ6A 3TQ1A 1DARA 2ZBQA 2CKWA 3IAM9 4QIFA 3KOAA 3N0VA 4Q2MA 5CYMA 4LSZB 4LF6F 2ZD1A 3PJWA 1ZTTA 3ZXWA 1TVRB 1S12A 4JB8B 2B51A 4XH5A 4A5AA 2ZBIA 4B08A 2CH5A 1D9DA 2BE2B 5E3QA 4K4WA 3H2VE 3VQQA 1NGIA 3DXKA 1M5PC 4JKEA 1L3KA 4CBUA 4U8YA 2DHAA 4ATNA 3HHKA 3MR3A 5D4NA 3OR1A 1C1CB 3PHTA 4Z7CA 2IVYA 2DCUB 4CHQA 4KHSA 3H2LA 3IBFB 1SJRA 2BE9B 5A8RB 2X1AA 2C2EA 4FLZA 4WYWA 3GMGA 4K59A 2AGPA 1HI1A 4QOZB 3CC7S 3R3LA 2BQ3A 3W1YC 1XNQK 4A8WA 3M9NB 4M5DB 1ZETA 4LF8J 2XWXA 1BI4B 2QMWA 5KG3A 1S57A 3S3OA 1UW4A 3OSPA 1SKWA 4CNZA 4ZP8A 1UWBA 2P9GA 4FYVB 4GW6A 1WACA 4BE1A 2Z1HA 3V4MA 1UVJA 3KIOA 3UFCX 2QWQA 3V9WA 4CGDA 5BYQA 1WAJA 2UYTA 3EKSA 4FWQA 4OI6A 3IAYA 1VISA 2MZQA 3B4MA 2LQ5A 3AVHA 1PBUA 1ZAWA 4A2BA 4F3TA 5A0YA 4RW8B 5C10A 4PY5A 2OKQA 2ASJA 1FRLA 3C0BA 5GAGP 3J81O 3OL7A 4ZJOA 1R8BA 2GAGC 3V6DB 3OYHA 3KG0A 4I0WA 1RT6A 3OJUA 4IFVA 2EK6A 3L2QA 2CQ4A 3MMAB 1TGOA 4PRFA 4JV1A 1HNWK 3E8OA 3CCVS 2IMWP 1Z1ZA 1WOOA 2HGNA 5GAGU 4DLGA 2R7YA 1KVJA 1M1KT 4NXMK 3SUOA 1M0SA 3FMBA 4F4WA 5D78A 2XYPB 4DUZJ 2EC2A 4QCLA 4K5SA 1WC3A 1F0XA 5HMYA 1KNZA 3NGTA 2HWTA 2CNKB 2ATLA 3VETA 8ATCB 5F2RA 2L3MA 3OYIA 2O8DB 4YOEA 2N3OA 3VGSA 1HKCA 2PC6A 3HDSA 2POKA 3IN5A 1PGZA 2ZHAA 2YQ1A 2IHR1 2G8WA 1UMJA 1J5EJ 2OD4A 1GLJO 4ENOA 1YRUA 4QS9A 4CTAA 1MW7A 1B92A 4YOTA 3Q2SC 4JI7K 1SXLA 3MAAB 3OXFA 3NF8A 4ZOSA 2M2BA 3LF0A 3OXGA 4JP8A 3CJ3A 5AFUH 2YHYA 1OQ6A 4JOUA 4RNOA 2AGOA 5HROA 4H4OB 2IM3A 3GR1A 1WOSA 2LVWA 4OKEA 1SJFA 4U67L 1B64A 4BE0A 1WD6A 1ZA2B 4CEAA 3HVTA 3JXOA 2RU9A 3DU5A 4B9MA 5KFIA 1CZ9A 5HL7Q 1DKGD 5KFUA 3RMDA 3EZWA 2ZH5A 2Z2YB 4XH4A 3HI0A 3U3YA 4USMA 4C8OA 3C6AA 4PR6A 2XI2A 1VQ7N 3ELHA 2ZZMA 3DOKB 4DR7F 1N6QB 2E7VA 4MYUA 1XR7A 2NLXA 2LFVA 2XZTB 3TYTA 4ERDA 2PFDA 3BREA 2VQEF 3G4SN 3PVXA 4WQ5A 4M5NA 1SPBP 1EX8A 3TAMA 3J7AN 2WONB 3ZSXA 4LBIA 1JMTA 4BC3A 2AIRB 4LF7K 3QWUA 3UKUA 2C22A 3ILLA 2YXLA 3M6XA 2CUYA 3HSZA 1K1SA 4NYFA 2VG6B 1QHAA 2RRBA 3KMSA 2XY7A 2GV9A 4HCCA 1EQMA 5BPMA 3G2XA 1HKAA 1WG5A 4LR7A 4BREA 1MMDA 1OMSA 1UEVA 3TA0A 3LP2B 2FVPA 3SIPB 5HP1B 2Q79A 2ROPA 3DOMA 3OQ2A 1D9FA 3QBWA 2O1PA 1RKIA 2HQDA 3GG1A 3OYAA 5BYRA 4G1QA 3VGVA 2W24A 1XK8A 5L1JA 2GIQA 3RRHA 1RHMB 1SQKA 2V69A 1CZBA 2VH7A 4LR9A 4O8KA 5SUHA 1QJHA 3DXSX 3W63A 1BIUA 4EGLA 4A57A 4BC7A 2Q3PA 1AW0A 4RUBA 2HF3A 3R97A 3NVMA 3VF4A 2NNWA 5H9EJ 4DJBA 1BWVA 4UOFA 3UB5A 3R6GB 3PFEA 4X62J 1VSFA 2VHGA 1ICEB 4G1IA 3BF1A 4CWBA 1LWCB 4DL4A 2F65A 5L9XA 5RUBA 4URSA 5JVHQ 3ETOA 3MM9B 2I5JB 4LF8F 1NJWA 1LNQA 2IAJA 4HVZA 2QJ3A 3S01A 4B9TA 3CFOA 1C4AA 4K4UA 2XS2A 1ITPA 5ETVA 1K0VA 3MCOA 3BJYA 4NXNJ 1TKDA 3PO4A 4MH8A 4P2MA 3UKRB 4OQJA 3QZ7A 2P9CA 3W65A 4CO4A 3KKRA 3KHYA 4GRSA 1BIZA 1NJIT 2XGQA 3QEVA 4DPUA 3T7ZA 2HZVA 4BRDA 4KGMA 3BQ1A 3GIMA 3LDLA 4BR5A 3HSJA 4HT5A 2LLZA 2V4QA 1HD1A 4JKCA 1RFQA 1N5YA 5CCLA 1QVGM 1HMVB 3BBFA 3CM5A 1FDNA 3IO1A 3NXZA 2ZWOA 3H59A 3LZJA 2VKRA 1U47A 1VBKA 2V5HG 4MIAA 3DXBA 3MM6A 4KYZA 1RTIA 1RAJA 1U25A 3NAEA 4JYAJ 4DUZF 4M95A 1S0OA 1ITGA 2D9PA 3KFWX 3MM8B 4KBOA 2VD3A 2V51B 4DTMA 3AJDA 3DWLA 5KT6A 1HA1A 3WXMB 2YWFA 4RCHA 5HL7L 2C3PA 4IH6A 1J5EF 3ONQA 1NKCA 1PC4A 4X4TA 4DV1J 4LF5K 4JV5K 5D3GA 4YHHK 2NRWA 1FERA 1VYAA 4AXJA 1K73O 4NLXA 3G25A 4JK9A 4GV6A 2E5LJ 5KI6A 4W98A 1TKZA 1TL3A 5KFYA 1RAGB 2K7KA 2CNLB 4C1NI 2WB4A 5K8OA 1E4GT 1VQ8S 3AVCA 3B8AX 4W5TA 2XNRA 2IC3A 3A8KA 5JLHA 3HJVA 3LP0B 1BOTO 2DB1A 2C2KB 5KFOA 3T1HJ 4YMEA 1VI7A 3H1VX 1VIOA 2V4RA 4WFBQ 3OYFA 3UE2A 1KEKA 1WSJA 5KG7A 3GJQB 1SC1B 3NWGA 1JLGB 4I6YA 4LJMA 4O0JA 1TVRA 3LDOA 3WNGA 1NUEA 4NOHA 3DI6B 3TVZA 3WX8A 3VAFA 3UVJA 5EHHA 1PJ5A 4DQRA 2UUAK 2MY8A 3O4WA 1C1CA 2XI3A 1BWFO 3ENBA 4YB7A 1Q9XA 2VPXB 2V52B 3FSIA 4C23A 2D0PA 2E2NA 2XS5A 3GFYA 2HLTA 3SUNA 1WF1A 5A8RA 4LQ9A 3RBZA 2FLPA 4PKIA 3G71S 3DLBA 5AQUA 2Z2LA 2Z4PA 2OP5A 3VMFB 3AVAA 1YJTA 3AO2A 1AA1B 2UXBJ 4YY3K 1IBKK 4DQSA 1LKZA 4CEDA 1VSEA 3RZAA 2J0XA 3C7NB 1I51B 2QA1A 3RTVA 1FXDA 4F4AA 1RYSA 2VUGA 3MMBB 4DUTA 1QM9A 5KFBA 3R2DJ 2IJNA 4V19S 1NZ8A 5LMUK 3MX5A 2JWNA 2MEWA 4GV3A 5JVHL 3A12A 1YI2S 2JL9A 2BZ2A 1FWPA 4I67A 2FHJD 4TYAA 3CXCM 2HFUA 4M3RA 3ET6B 4RW8A 2V8HA 1QQMA 1HWUA 4B8AB 1UWAA 4HEA9 4LIRA 1EX4A 3KLHB 2MSSA 3IR6B 4OHYA 5CAAA 3V6DA 2J4RA 4YS2A 1ZZNA 4BDPA 3EDRB 3KHRA 3D6FB 3O9QA 2UUBK 4ECYA 3MMAA 4KHQA 3GOIA 1ZM3A 3HKZD 3QFHA 4D3GA 3V9XA 4DR1K 1HX1A 2HYIB 2XY6A 3EXCX 4JI3K 5JMNA 2RSQA 5L46A 1TK0A 2AWZA 1S97A 1VQNN 4DL3A 2O8DA 4EHTA 2O5DA 3DJCA 3CCLS 3MPWA 4JD2B 4BRQA 1YVNA 1WWHA 1J2VA 4B3OB 2A40A 4NXNF 1Z2ZA 2DNZA 2H3GX 3QRRA 1JWWA 1S3XA 4LY7A 1A9NB 4JRQA 5DZ6A 2IDLA 1BQNB 3ZO7A 1Q81T 2G1HA 3KHGA 1HRHA 4DDFA 4IYQA 4FKXA 4R0JA 4EMDA 5FLXO 1BLUA 2IBOA 3PR4A 2QZ8A 3HPOA 2VF3A 3FVYA 4H4OA 3Q24A 3QNOA 1ZYQA 1NK8A 3VGMA 2UUCK 2CG4A 4KFBB 1RK8A 3H5UA 2DR6A 2CGJA 3I96A 4IBNA 2QE5A 3V6HA 1R8HA 3OTBA 3L3UA 3R8YA 4KHPK 3DRRA 4DF8A 3UDVA 4QR0A 4E1MA 1NWKA 3RRKA 2R7WA 4ZCMA 4RTFD 2MMYA 5K8MA 3JTOA 2D41A 3D7EO 2F8EX 5CR4A 4BRMA 4NMXA 3S3MA 3OW2R 3DOKA 1B0VA 1JK9B 2GQ2A 4WP8A 4ECXA 3WNHA 4WFBL 2ACYA 4M3UA 2AJ1A 1D8YA 3G82B 1D0EA 3BN7A 3K2YA 1EAYC 4DV1F 4WU2A 1XEZA 1X0PA 1N34J 2V2QA 1VRQC 1NBWA 3TWZA 1FK9B 2VG6A 2A6MA 2P5VA 3MF5A 2E5LF 1YG0A 3PDNA 3NF7A 3P1GA 1Q86O 1FD2A 4CZHA 2VFVA 2EG1A 3LP2A 3LA0A 4DZDA 5HP1A 3Q86A 2DGWA 1C1AA 3LW5C 2HVZA 1NOZA 3T1HF 1JLCB 2VFSA 1IG9A 3MURP 3G86A 4LSNB 2FVRA 3RB0A 4P52A 4PAAA 4J2EA 4LRBA 1LK7A 2R2UA 3RB6A 2FJEB 2L9WA 1X1PA 5T7LB 4Z37A 1FE0A 4OZ1A 4PEOA 2D9OA 3NH0A 1XHZA 1CS4B 2NYIA 4OPHA 3THTA 5J1PA 3LGNA 1KQGB 2CQCA 4DR4K 1QQOA 4RNNA 3EKUA 4U7BA 3WXKA 5F8NA 1VQYA 3HCXA 2W01A 1P8GA 4QIEA 3ZT4A 4E1JA 2UXDF 3OUYB 2A10A 1N33J 2O66A 1URNA 4BRAA 2GQCA 2GMHA 1NMDA 1JLEB 1EETB 3MOJB 1PG5B 2AHOB 1LWCA 1S1WB 1NGCA 5GIPA 3ZC4A 1KOOA 5E84A 4MIWA 3HZGA 1S6UA 3R9LA 2OD6A 3BF3A 3MM9A 5M2PA 2HVHA 1X9JA 4IR9A 2I5JA 4ETZA 3QB0A 2H65B 1Q9YA 1FRXA 2CNNB 4GKKJ 2BJ8A 1S5JA 4YR0A 1RAEB 2DNKA 4PWUA 3GP9A 2YNFA 2VZ9A 3E2EA 1Z26A 1P6TA 1PYSB 3WZ0A 4FZXC 4Z4IA 5B0CA 2AKWB 3UKRA 4DUYJ 3HMJG 3CTRA 1CSJA 3GE9A 3ZZZA 3I32A 3MFIA 2Z58B 4I2QB 4WJBA 2J0WA 3PKYA 2VC1A 1IKWB 4NLSA 1X9WA 3HSTB 1E4FT 4Z94A 2W4DA 4YUDA 1YJWS 3M8ZA 4TLRA 2HHVA 3HT3A 3BO2A 2DNPA 3E01B 2KYZA 2DNRA 1CJTB 1M5HA 1QD1A 3H7HB 1GK8A 1N32K 1VQ8N 2NXUA 1S79A 1N56A 2AP6A 3PYDA 5AQWA 1HLUA 4WIQA 1DTTB 1WN7A 1U24A 2ZFHA 1TAQA 4DR6K 4CEFA 4B8CA 3I5BA 5G4DA 3H46O 3G6ES 4BR9A 3MM8A 2ILYA 1C1BB 4EWTA 1KQSR 2FC0A 4DV2K 3LAKA 1WAFA 1N4LA 2OI2A 2GX9A 3CVKA 3OTOK 1Q95G 3QEPA 4ZN1A 5LJ3Y 2H9ZA 3EZ5A 5AQJA 5M1QA 1Y11A 2G1DA 2ZDOA 1L3UA 2V9WA 3EM1A 2W2OP 2AP1A 3J80U 1X4AA 3SDEB 4MK8A 3K58A 1YK9A 5HVGA 4CJ5A 5KFCA 4L3KA 1HWKA 1XN9A 2RU3A 3OYLA 1W2BM 1RUSA 1NHVA 2ZNZA 3MEEB 4EYHB 5KPZA 2C2ZB 4A47A 2P9NB 4FYDA 2WTUA 1KN6A 4E98A 3LP0A 2ZH4A 2BE7D 2QA4S 5CZXA 3G71N 4NLYA 2ZOGA 4JN4A 3CNQP 1JLGA 2CQ1A 1SC3B 4AFFA 4LF4K 4TYBA 2X1BA 4OJ1A 2ZHBA 2X78A 1SC6A 4DX5A 1FI4A 4ETXA 4CF8A 2IRUA 4CYUB 4H8KA 4BC2A 4M41A 1UAWA 3LUYA 2DGUA 2DO0A 1OY9A 3IBWA 5IC4B 4KSEB 1BMQB 4DV3J 3FGVA 1N54B 5EX0A 2IM2A 1EWRA 5E3RA 1XTZA 1YI2N 3AA4A 3SQGB 4LREA 1HI8A 3S9HA 1T6DA 3AA5X 1Q82O 4OV1A 4OV6A 3WBZA 2DHGA 4E7IA 3GYGA 4H03B 1DQ8A 3CCQN 3G9CA 2ZDPA 1J6ZA 2ZM6J 3AA3A 4J9MA 1VK8A 4I7FB 4BY9C 1SL1A 1XMBA 1RDAA 4EO6A 2A3ZA 4ZLJA 5IT9O 5E33A 2NRRA 1EKSA 2EPIA 2ZEJA 3LDSA 2JC1A 3LAMA 2RHSB 3QT8A 2Q2RA 4OLOA 3MR5A 3ZSRA 2OPPB 4N41A 4JKGB 3C7NA 4HHJA 5DLGA 1ASWA 2H4WB 2L9NA 2V8DA 5C42B 5EOYA 4OFZA 3MMBA 4MKYA 1TV6B 4LF6K 1IM6A 3S3NA 1WEXA 3ZNUA 3K2PA 4K4TA 3CCLN 2QLFB 5CD4H 1S76D 2DY4A 3GYXB 3OYMA 5IWAJ 4A59A 2VOPA 2UVWA 4J9VA 1U1QA 3GSDA 2EW9A 2JEGA 3KLHA 3L2UA 1U6FA 2EWHA 3EGNA 3OY9A 5CYQB 1WTBA 4CGIA 2FJDB 2VDHA 5KG0A 4BC9A 4X4RA 5GADP 2GFFA 3TVKA 3JB9k 1QTMA 2RQCA 3OD2A 1Q78A 3R3TA 4CO5A 3RBEA 3J7A1 5D6GA 3EICA 4FJKA 2GIRA 4O3QA 3OV7A 2YI1A 3T69A 3F0NA 4B02A 2CPDA 4K0KJ 1BQMB 3T5JA 4X66J 3Q8SB 4GVMA 3OTCA 1V9OA 3R6MA 4M5HA 1HR0F 1JLQB 1YTAA 2WK4A 4EIAA 4EI2A 1K44A 9RUBA 3UNYA 3L9ZA 5HANA 3QERA 2PFUA 1SQGA 4JD2A 3FQKA 2DNGA 3THPA 4DSEA 3JSBA 3CCES 2HNYB 1Q16B 4JHDB 5C2FA 4FN5A 1P1LA 1XIQA 1BQNA 2LMIA 3GG0A 1RBSA 3DRXA 2NPIA 2F8MA 3ZSZA 3IBCB 5GAHP 4O3RA 2BV3A 4YNQA 4ISGA 1S1TB 4R79A 3O6WA 4WE1B 1H38A 2V2ZA 4ECSA 1KAYA 4IEIA 4L73A 3ISNC 4USWA 2DRAA 3KMQA 4Z4HA 3OFEA 3VOVA 2I7PA 2R8GA 4KFBA 4JNEA 2MQQA 4IOAQ 3DFEA 3HM9A 2ZJPQ 3M2VA 1JJ2R 4FXDA 3A8YA 1NDKA 4HDGA 3H40A 1VQSA 2J9DE 4ZITA 3NKYA 3EDQB 1TL1B 1H2VZ 5BR8J 1U1MA 1IBLJ 4P75A 2L9DA 4H54A 2RF2B 2IY5B 3CSKA 2VA3A 5CZ1A 3Q8UA 3RMCA 1FCAA 3FZMA 4ECUA 4FK4A 2DNLA 1UFKA 2PA8D 1NNDA 3MM7B 3LDQA 4HT7A 3I4PA 2R9LA 4OHWA 3AB2B 3G82A 2QYCA 4BRHA 1LXJA 4IEEA 1M90O 4LF2A 4KHWA 1B0TA 2OFHX 1FK9A 4QIGA 2JZ5A 3J7YP 3FE1A 1WEZA 3BY5A 1FVSA 1X60A 4FJNA 3KLEB 2R42A 3CCRS 4NE9C 1TYQB 1FJGJ 5JICA 4E8UA 4Q7AA 4KC5A 5M1NA 5KFEA 1NHKL 1MWKA 1VQ6S 2QLWA 2YKNB 2FVSA 3BGLA 2AYBA 3CJ4A 4MIBA 2DEJA 1JLCA 1D3WA 2I9SA 3NS7B 4KAIA 3V2UC 4LSNA 5LY3A 2HMIB 1AXQA 2F9TA 3R7SB 5HVHA 4FYXB 3QJJA 1F60B 5T7LA 2J7KA 4AQYJ 1CS4A 2AD9A 3JAMO 4P7VA 2I2YA 4DR7K 2AJ2A 1UJ6A 4WFYA 2VQEK 2N3LA 4DV3F 4RKUC 1EJ7L 2MLYA 1VJWA 1U2CA 4UUWA 5EGYA 4CF1A 3DLKB 2QXFA 1X7VA 3EUNA 3EVWA 2FIUA 2QRRA 2XS7A 2MJUA 4WQ4A 2LQ8A 3OUYA 2DGXA 4F02A 2YKOA 5AQMA 1JLEA 1EETA 3GWCA 2IYIA 1YJWN 3H2UB 1S1WA 2FDNA 2KRRA 4LRDA 2KI2A 4WFZA 1AFIA 1ATNA 3PX4A 2Q0UA 2E9TA 2HWIA 3OVNA 3SXLA 2CQHA 4FWSA 3SPYA 2D0BA 1NMEB 3JXUA 5KOXA 2X3DA 3RMAA 1ILYA 3KK3B 5KT3A 4OLPA 4IRCA 3G6EN 1OQ3A 2ZBPA 2V8GA 5KFDA 4NLPA 1R3NA 2ZUGA 1JCEA 2CPEA 3OFHA 4QJVA 1FRHA 5E3CA 4J9QA 5DJBA 1XNQJ 1ELOA 2RVJA 2CJXB 3RB3A 2WCXA 3PR5B 3HYFA 1UVLA 4OYXA 4ID5B 3LM9A 3L4QA 2CZVC 5IWAF 3GQCA 1LEOA 1VSMA 4OX9J 1IKWA 2F9WA 2JRSA 2XRIA 5C15A 3BYPA 2W9CB 3UD3P 3SNNA 2VB6A 4QR2A 2NUHA 1ROFA 1LQ9A 4CF0A 3CWJA 1KVKA 7AT1B 3C19A 1BGXT 1S10A 1CJTA 3OFFA 2K3IA 3OSNA 2BGGA 3D1HA 2CNOB 4LBPA 3H08A 2QWNA 3BEGB 2Q6BA 5J1EB 3PW4A 3HVRA 1VR6A 1DTTA 4K0KF 4BRCA 2IJFA 4X66F 5HO4A 1RU2A 2JEFA 4BC5A 4PG4A 1KTQA 2QA4N 4PYDA 2KQ2A 4LF8K 3W8GA 1WG1A 5AQPA 1KXPA 1ZM9A 1Z25A 2QN6B 5HI7A 4HHTA 1HNWJ 3LGHA 4IOAL 5J2PB 2ZJPL 4NXMJ 5E41A 2ZE2A 1YQHA 1RDCA 4BRFA 1HYSB 1ZA1B 2R2RA 4J91A 3THVA 4ZP9A 3BSNA 1QZ6A 1WSGA 2XZDB 3SDEA 4ZKAA 2XMKA 4KTZA 2DGOA 5EWEA 4CLSA 2HQGA 1BXNA 2GBZA 4QWDA 1U02A 4F2SA 3MPYA 1OVYA 2MKCA 4NEYA 1F1BB 3MEEA 1PBAA 2Y9HA 3H5YA 1LXNA 2P9NA 4EO8A 4F0KA 3KHLA 1RABB 4DLEA 4OJ3A 3L3CA 4EZ9A 1T95A 3BZKA 2J9EA 1WSHA 1WBBA 4M3ZA 1RSCA 4B3RF 4Y2KA 4K43A 3CCZA 1QE1B 3OLBA 4C7QA 4DUZK 3EWGA 3B6PA 4CZLA 2N4CA 5AFUA 1ATRA 3J8AA 3Q8RB 2HHHJ 4ZVRB 3O6QA 4CH0S 1UFLA 2G8VA 3WC2A 4ZPBA 3FGUA 2DHSA 2H1YA 5HMXA 1IQTA 2CPZA 4C0BA 1N5VA 2F7VA 2KHCA 3SQGA 5CCMA 3RBDA 2IVNA 1JJCB 1J5EK 2AEMA 3MXMA 5IT4A 5FRMA 4NZ6A 1WBDA 5J2NB 2LXIA 2DHXA 2ILZA 2KT2A 1JXBA 3R6LB 2JEIA 2D4WA 2W2MP 1NU0A 4OL8A 5ADZA 1ZXOA 2QTWA 4I7FA 2MQLA 1YX2A 3FBFA 3ICLA 3V5RA 4JI6F 5KTQA 3KUEA 3CJ8A 4FZZA 2M0GB 2PT0A 4U7UD 1YT3A 3D2EB 1Q1KA 5AQFA 1GLDG 4HI2A 2GWJA 1VFJA 1RWUA 4ILHA 2XCPA 3MDQA 2F4VF 2OPPA 2B7CB 2C2DA 1ZBFA 4JKGA 3EZOA 1S4FA 5C42A 1TV6A 1VBYA 2CWXA 2RHKA 5CXTA 3UW1A 1IKYB 1T9WA 3HK2A 2AMCB 5AQQA 4AQYF 2AZ3A 3T5LA 2P9KB 2O8FB 3NOCA 4CLUA 1FFWB 2CDRB 2C28A 1M1HA 4DTXA 3CPWR 3CCEN 3FKBA 3NL0A 1IJFB 2VG7B 3ZX0A 2YH1A 1TKXB 1N8RO 3SK3A 3IMXA 1R0CB 3Q0AA 5EDWA 5CYQA 3M30B 4FOIA 5AJ3F 2IVOA 2QI2A 3AHPA 3O9SA 4ED3A 2ZC3A 4B1WB 1T9YA 1PCAA 4BBYA 4BG9A 4CGFA 3LM2A 1BQMA 1JXEA 1O8BA 1VBZA 2A5XA 2YCHA 5KPRA 3CYMA 5G0RB 1YVFA 1MLAA 1IV0A 2ZH3A 3CCSS 3FZKA 4DMZA 1T05B 2HGMA 1U2RA 3OYEA 3OL6A 4L76A 1U1NA 3E3XA 2HNYA 2D3ZA 4JHDA 2B5JA 2A41A 4CHZA 1KTVA 4C6AA 2MB0B 1KVBA 3POTA 4LIWA 5KFPA 3J81j 2X1FA 2YNIB 2XLJA 2FBVA 1S1TA 4OX9F 4LUBA 2G9OA 4WE1A 3PFOA 5L38A 4CJTA 1VQKS 1ACMB 4JV0A 2QC3A 4G1PA 5D0EA 5HVFA 1H1VA 2MQNA 5AXLA 3MOZA 2VWJA 4X64F 1WEYA 3HP6A 3D2WA 5KFQA 2UVUA 3WHIA 2P6SA 3NG8A 1B9FA 4DL5A 3N6NA 2ATQA 2HAIA 4F7VA 2XB2D 3NE6A 1TL1A 1VQ6N 2QIFA 4OYAA 4AUKA 1K0TA 4G9ZA 2VKZG 3HL8A 1VHXA 3H4DA 2IRXA 1Q7YO 2OO4A 4FBTA 1T9VA 3MM7A 4KREA 4CJRA 3HX9A 3CD5A 1GLCG 3PY8A 4LF1A 4NXNK 3R1HA 1CLFA 4C0OC 5K14B 5CE3A 2AJ4A 4RNMA 2D3O1 4ED8A 4KAZA 2XSJB 1FEHA 4L8RB 3D68A 3KLEA 4USTA 3E51A 1TYQA 2VA2A 3NGYA 5HRNA 4LF5J 2LA6A 4YHHJ 2RNEA 4CD3A 2YKNA 1D9AA 2VONA 5DO2A 1KP6A 4NMLA 1N0VC 5D4OA 5KG1A 1EQ0A 1Y0HA 2GO8A 2F9JA 4OVLA 4ELUA 3PEJA 4CLPA 3WUHA 2HMIA 3O3LA 3WIVA 2G8FA 4PYAA 4KHYA 2NREA 2CJQA 4KB7A 1XR6A 1U1OA 4CDIA 2HHHF 1X4FA 2RE2A 1C0UA 3H8YA 3Q8PB 3CIMA 3SEOA 4HTJA 1W7WA 1BWEA 4DFJA 3NHGA 3PLAA 3DLKA 2ZNYA 3ZT0A 3FZHA 2DO4A 1W0HA 4DV1K 3JTPA 4NLBA 2LCWA 1Q7LB 1GMUA 2CA9A 3PSIA 3WXIA 3VGLA 4A8SA 1VQOS 2E5LK 2UUAJ 3PTWA 2E66A 1NGGA 3FBEA 1KAXA 4M7YA 4BQZA 4DFKA 2MGZA 1I39A 2OPRB 4DQPA 3LPUA 4UOGA 1FJEB 3UR0A 4DCPB 3G6XA 2A1BA 5DGBA 4O4RA 3T1HK 1SJ3P 3K5LA 2HS0A 3KK3A 3GONA 3QAEA 4E7LA 1RT1B 2EEYA 5ETSA 4FWPA 1VSDA 3HSDA 2A6AA 2MHEA 3K5NA 4BRPA 1HI0P 4RZRA 3UN2A 3VAMA 2DR5A 4YY3J 3WNFA 4ID5A 3D6HB 3KWMA 1NGFA 2FZKB 5KFKA 3DLLQ 5DDPC 1RWNB 4DR5F 1FDDA 4L75A 2AEJA 3GB0A 2P2CB 5LXRA 2W9CA 4MDAA 3MCAB 3C16B 2UXDK 1XR5A 4WK3A 4TY8B 1U09A 2JWKA 4ED2A 2B4UA 2OEJA 5HQ8A 3I87A 2CGLA 3UD5A 2PYJA 1UEUA 2OAUA 1NK4A 3N4QA 3SZ2A 3TNVA 3CI5A 2EFGA 2QLXA 4DI6A 3EVOA 5DQHA 2E2QA 5H9FJ 3VENA 1JCFA 1BCOA 3HULA 5J2PA 4DR1J 3K8VA 1S6OA 4XIUA 1VDHA 2O3DA 1HPMA 3QBCA 4YDXA 4CJUA 1HYSA 1YGYA 4GKJF 3B78A 1U26A 1TUUA 2CQGA 1BA1A 4XK8C 4DV5F 3I9ZA 3C2PA 5EX5A 3LDNA 2HWHA 4HHHA 3ZZUA 4E3SA 3O08A 5AQRA 2YQ0A 1I3AA 2ETJA 1MWQA 2KM8C 4Y2MA 1RT4B 4GO7X 4WTOB 3TTCA 1JLFB 1NGJA 1PO6A 2YWKA 4H0PA 5BREA 5CABA 1XQIA 1QE1A 1ZBTA 4ZS6A 2UUCJ 1X4GA 5KFLA 3QDKA 1CJKB 3BEXA 4F36A 1HUXA 3NGZA 1NKEA 4KHPJ 1RGIA 2HNDB 4OHZA 2ITGA 1NK5A 4AHUA 2OPQB 1YIJS 1VHFA 4RNFA 4LRCA 1KSPA 3D67A 1HHSA 4ZPAA 2ASOA 5ETLA 2XEXA 5J2NA 2DH7A 3SCIE 1LAWA 1O5JA 5F9NA 1NH7A 5LSOA 3KZBA 2GELA 3O4NA 4CI0B 4FVUA 5JMVA 2DNHA 1W97L 1B70B 5L1IA 2NXCA 1NLKL 1U1KA 3CJBA 4KBIA 2YX6A 1QDUB 2W7AA 4IDHA 1W2IA 2QW9A 3BSCA 3N28A 2MLZA 3QFWA 3LDPA 3CJ5A 4P73A 3BBCA 5AE2A 4FJLA 2IIRA 3JS9A 4JI0J 2A3JA 2CQ3A 1CVJA 1TL5A 2BQRA 3P49B 1IBMJ 2JJ4D 4AD6A 3CCSN 1K8AO 1IKYA 2JVRA 3F73A 2BTFA 3AY0A 2EG2A 2FQQB 3K7RA 1EZZB 1GLFO 3NGIA 4J7CA 2OTJS 4BRGA 3MAQA 2L41A 1WC6A 2F96A 4IG0B 2P6TA 4NI2B 2Z57B 3NNCA 4BVPA 1HW8A 4E7HA 3DLHA 5IT0A 4ECRA 3M30A 1IG8A 3D9BA 5HBMA 4IO9Q 2AQ4A 3QNNA 3HHLC 4PXDA 3PHEA 3VQ8A 1PILA 1N52B 1VQKN 3R5CA 3MWTA 1WI6A 3AVGA 1ZAXA 3KKFA 3KLFA 3G8QA 3Q8VA 3HM8A 2RB7A 3DLLL 3D1OA 2AX1A 3ATUA 4LRAA 1U48A 2HBQB 1OPIA 3W62A 5ELZA 3O3HA 1YITS 2WBRA 3ZSQA 3JSRA 1RWXB 3NRBA 3NVKA 4CZJA 2DPIA 1T05A 1ULRA 1FKOB 2GUIA 3I55S 3RR7A 1HNXJ 2F7TA 1UTAA 1RTDB 3TJ9A 1LK5A 2HFZA 4YORA 5LM7E 3IR7B 1GOCA 5LJVA 3AD9C 4KQZA 2MQ8A 2RT3A 3QPIA 2YNIA 5ETTA 1JL1A 3VQ4A 2GX8A 4B1UB 2YNGA 1FTCA 3O44A 4F8RA 3QGIA 4LC9B 2GZOA 3N5FA 3QFUA 5A6PA 1FX4A 1N5TA 4ER8A 1VGYA 4Y2IA 3TW0A 2YWWA 1K6YA 1PKUA 4HTUA 1QQNA 5H1SQ 5DMRA 2MZ1A 2KZMA 4G3IA 2Y8WA 4DOZA 2M3DA 1FFGB 3P3DA 1HR0K 2OZMA 2HHTA 1U04A 4DV6J 4CE9A 1N32J 2W9AA 1XNRJ 3TR8A 1OSCA 5GVQA 4YDUC 2VODA 1OKJA 3HT0A 2VQFJ 4DR6J 3M32B 4R8UB 4DEZA 4CO0A 1IKXB 1ZTWA 4DHVA 1C0GA 4MKBA 2VGMA 1EO1A 2VPWB 2NQPA 1KCFA 3SV4A 2BJDA 2ZZTA 3NGSA 2H54B 3TANA 5U47A 5K14A 3SCJE 3ENHA 4MTPA 3VQCA 2AEFA 2WSEC 2YX1A 2XSJA 2B3TB 4NRUA 2YHBA 4ZPTR 3WQPA 3X1LB 3HJFA 2DR8A 3DMJB 2O8CA 4CHNA 3IFRA 2HIYA 3PW7A 4OGCA 1VQON 4GO5X 3KLGB 1FVQA 3VAJA 1P9QC 4UY8O 1Q18A 4AHTA 1OYDA 3ULHA 4DB3A 3QNWB 5IC6B 4C48A 1DLOB 3ENWA 1QUPA 3EZUA 5B0GA 2KT3A 1SIZA 1YKWA 3L4IA 4A5BA 4J2BA 2DNOA 1BHNA 3MTJA 4JEPA 3HZEA 3BYRA 4J9OA 1CBKA 3QRPA 3IWXA 4MQ3A 1GXTA 1IBCB 2F8TA 1RT2B 3D28A 3MCMA 4USKA 4LF4J 4HLBA 5E5NA 4FF3A 4Q44A 2KTQA 4RW4B 2O8BB 5AXMA 3RRGA 5HLFB 1RGVA 3SQ4A 4OX6A 2HHUA 2HFNA 3FJ2A 4NLGA 5THWA 3Q7CA 2WFBA 4HDHA 2GV1A 1SH3A 2XY5A 4IR1A 1QVGR 2G8UA 1R8CA 1TELA 3ATVA 4OJHA 4IO9L 1RAFB 5KT4A 2M8DB 4ID8A 2DH9A 4C4WA 1RT1A 1IBMF 4AE5A 3QEXA 1T02A 1I5OB 3DC2A 4C97A 1QSSA 1MA9B 3O5TB 1YDLA 2R2SA 1ZH5A 2LSNA 4WZMA 4DV3K 1KFSA 4NLTA 4CLKA 4Z4CA 2B7BB 2VCPA 4W5QA 4Y2AA 4R25A 1UAXA 3F9MA 3TP2A 2EC0A 2HZCA 2XM3A 1DEJA 1NGAA 3GCWP 3ADAC 5BN8A 3C16A 1TAUA 5LMNF 5SZTA 3C6HA 1VOMA 4LFAF 4RNHA 4KY3A 2GAHC 3T3FA 1S5ZA 1Q4RA 1SS6A 1QSLA 4KRWA 4CBXA 5B09A 3AQOA 4CK2A 3AY9A 3A4TA 1HWIA 3O4QA 4NA2A 4FWKA 3ZTOA 2MDAA 3G96A 4DL2A 3W8PA 3FMWA 3ZSWA 1ZS6A 3P6YC 4EP5A 4NYPA 2GJFA 1HNXF 3W60A 1O13A 3A0IX 5FPDA 5E26A 2DGQA 4FLYA 2ZOMA 1APSA 4OZNA 2QTDA 2XHBA 2JLEA 3ZT2A 2P9UB 1TUWA 1OJ4A 3BO4A 1SC4B 1U1LA 1VQ7S 4RPFA 1M1GA 5IWAK 1C6VA 4CLYA 2CQ2A 4AHRA 4EHUA 3WXLA 4CJ7A 1S99A 4MK9A 3G4SS 3BKUA 4WXOA 1MWMA 1NGDA 1FFSB 4KB0A 3VQEA 5KFGA 2OA8A 3QATA 1Y3JA 2J6TA 1LW2B 1T3VA 1JLFA 4ISFA 3LPYA 3MEDB 1LCUA 3UNGC 5JLFA 4RBUA 3NNAA 5KRSA 3IWNC 4N8OA 2MTLA 4FXWA 4K0KK 4RU2A 1T9TA 3ILOA 3FZ2A 4CT8A 4X66K 2NZ4A 4ZP7A 1FHTA 1M5OC 4EBDA 1CULB 1HBOB 3HKWA 4ILRA 2V2VA 1CJKA 4AF1A 5I3QA 1OS5A 2HNDA 1XNRF 2FHOB 2E2OA 5E7OB 2G13A 2Q1LA 5DZ7A 2PMZD 3Q7BA 2VQFF 2OPQA 2VBZA 1H6KX 2C2OB 1OSDA 2P51A 3OW2M 1S9GB 1KQFB 4CJ4A 3QFPA 2MLXA 2Q1NA 1PAUB 1TKTB 4FJMA 4FM2A 4FWRA 4JK8A 2OTJN 3LOUA 1S7IA 3U27A 5AZIB 1QAYA 2LQ9A 4WZQA 3J7Z5 3HF5A 1NXIA 1URRA 4B3SF 1DY3A 1R0BG 2VJVA 3KK2B 5AQZA 4F3OA 2KT5A 3TSUA 2HHQA 2VG5A 1QLNA 4FJIA 4YQWA 5ADXH 3J7ZT 4RR5A 4OI1A 2NRVA 1BA0A 1FT8A 3BKFA 1NB2A 1HW9A 4FM0A 3PEHA 1G1XA 2DD8S 1OH5A 3L7UA 2O4GA 2BJ7A 1IJJA 3DNCA 4IH5A 3QT7A 4B3RK 1Y64A 1RLDA 4P74A 5EWGA 2MZRA 1Z4UA 4USVA 1X5OA 3VVUA 3HHDA 1C0FA 1F5BA 3OHRA 2X6NA 3I55N 3O9RA 2B4PA 4X4UA 4PG6A 4OZLA 4KH5A 4IG0A 4NI2A 2VPZB 5J2QB 4C8YA 1NK6A 3KTQA 3RGIA 2FC9A 3AA9A 3T9NA 2FZCB 4K50A 3KJVA 1R89A 1SBRA 4RUAA 1X5SA 1RACB 4H0YB 2QKBA 4JI6K 4OYMA 1VAZA 4ED1A 3VQAA 3DM2A 2UUTA 4E89A 3OVSA 5KFNA 3AD7C 1UFWA 1CJVB 1I1GA 2KVIA 1Q8LA 2E5JA 2EKYA 1YLXA 2W6LA 2P9SA 2F4VK 2X7IA 4K4XA 1FRKA 2BACA 3SFGA 1FKOA 2QV6A 2IRYA 1RTDA 2JLGA 4KJIA 1RAAB 1QVFM 2PEBA 4I68A 1B3TA 1RADB 5EWFA 4AXIA 4AQYK 3V1OA 5AQVA 2Z30B 4DU8A 1RLCL 4RWWA 3SQOP 5T41A 4H4MB 4NO7A 3GIRA 2VOOA 4CEBA 1VSIA 4CZIA 4EFHA 3JQKA 3H6EA 2K1RB 1NSKL 3RU0A 3I5CA 3SQ0A 2CDQA 4J8FA 1RWPB 4FYYB 5AJ3K 4O3NA 5KRTA 5LT5A 1OO0B 3TUPA 2HHWA 1B0PA 4CI6A 2KU7A 4DL7A 2FVQA 2UVRA 3QSIA 1TFWA 4I2PB 3EN9A 2JGUA 2QG9B 3UN5A 3SMSA 3M8PB 3NY0A 2HQIA 2ASMA 3MPUB 2GJIA 3JTNA 2Q31A 2IDOA 3AD8C 4F4XA 1UCNA 4H5VA 2DY9A 5K8PA 1FESA 1WC0A 5HJYA 2VIHA 2RQMA 4K8XA 3QO9B 4HUFA 2G0CA 2A1SA 3NCQA 4LH5A 4KH6A 3M32A 4C11B 3VAIA 4R8UA 3PG9A 1S72N 2PEHA 1KQSM 1IKXA 3BSOA 4LSLB 2GNKA 1F5AA 4PPZA 3G10A 1WSIA 4AL5A 4FWNA 3QSYB 1FEEA 3S8SA 2YPZA 4QU7A 3O3FA 1MU2B 5AE1A 1M1KO 3Q83A 3R7BB 5T7BA 3GSIA 3SQ2A 3NWRA 3M8YA 4OX9K 4F4YA 1JJ4A 2V7YA 2HW3A 3DMJA 4ZVFA 2V4JB 3TAFA 5KT5A 3UDCA 2B43A 2EHGA 3KLGA 5F3TA 4X64K 3DRPB 5I3UB 3SI8A 1WSEA 2PYLA 3DLEB 3K0SA 2EBGA 1GXLA 4YR2A 1T11A 4WYBA 1DLOA 4B9LA 1REVB 3SBTA 4DFPA 3CCJN 3SFUA 2ZGZA 5CZVA 3MPVA 2XY8A 4H0OA 4ZVEA 1HBUB 3B8HA 2E1RA 3NH1A 4A8KA 3IC1A 2ZJQQ 4ELVA 1RT2A 2E6LA 3GLJA 3ZZTA 1U8WA 5B0DA 3I31A 4TN2A 2ASYA 3HPHA 2HS4A 2ZKUA 2Y1JA 4K4SA 4FWMA 3ZTSA 4RW4A 2P9PB 5HLFA 4JI7F 3QIDA 4KT0C 1M5VC 3KDNA 4DQIA 4GY2B 1Y5LB 4YB6A 3CO9A 3C65A 4B9VA 3PM9A 4Q43A 4C9DA 1S1VB 4NLDA 5D77A 1AYEA 2XMVA 1T03B 4RG8A 2LP4A 4ZA1A 2C3YA 2XCAA 3C94A 4M3XA 3NP5A 5K8NA 4AT1B 1V5VA 1YTYA 2GO9A 1EXQA 3OA9A 2FHJA 2YJEA 3NMUA 4N56A 3I0SA 4MT1A 2E7XA 2FSKA 4PXBA 4NL5A 4Y0WA 1UVIA 3U9DA 1EB0A 3C15B 1GXUA 2V8PA 3CJTA 4USIA 1NPRA 5F0WA 4JI1F 2C3OA 3EVMA 2HHHK 3THXB 3VQ9A 4AHSA 3NMRA 1GFWB 2Y3YA 2MZTA 3NGUA 1RHUB 4ZVUB 1VQNS 1RHQB 2Y1RI 1CLQA 4DV4F 1LWEB 3BH6B 5F8LA 1X0FA 3OYBA 5TKYA 4WTYA 1TP7A 1FNMA 1MMNA 4F26A 4CZFA 2V6AA 4CH1A 4ANCA 1R0AB 1T3OA 2D0AA 4I6MA 4DF4A 1VC0A 3MGJA 4WU3A 3ZX3A 3BPSP 1H7XA 3DXMB 1WC5A 4CJSA 1QHTA 3SSRA 2RN2A 5HOOA 5GADI 3VQSA 4RW9B 1NJXA 4QS7A 3D0IE 5T14A 3CM6A 1WG4A 2K06A 2HBLA 4HUGA 2B4VA 3VEWA 2IA0A 1N5QA 2SXLA 4K8RA 2P9UA 3VQTA 4ELTA 2OCEA 2VPYB 3UDLA 3NFAA 2WB1D 4DR5K 5FPNA 2PY5A 3TAEA 2KM8B 3EE3A 3N01A 1H74A 1CJUB 1FRIA 3CJCA 1LW2A 3S1TA 2BKPA 1RJJA 4NLWA 3MEDA 1NDLA 4JKHA 3W9JA 2GEMA 2P9LA 1KOHA 3NEKA 2ZBRA 2ZKTA 1Q5VA 3P5JA 5GMDA 4YR3A 1JJ2M 5GAHI 4CNYA 1CXUA 1T9XA 2OIHA 3MXHP 1CULA 1HBOA 1NJIO 2YY3A 1RU1A 4BC4A 1XMQJ 2HQFA 3MZIA 1FD8A 4QIWD 1R6VA 3QLHA 4XEIA 1NNEA 9ATCB 2XMJA 4ED0A 1LWXA 2XG8A 3VESA 2P5OA 4B3MJ 3EGWB 3DGPB 5DM7Q 2ACMA 1SB6A 2UV8G 1S9GA 3W7BA 3RAQA 5AT1B 1X4EA 2QL5B 1TKTA 1C0MA 2EXUA 3M4XA 4F25A 3CDWA 4EU0A 4W5RA 4FJHA 4DU3A 3O3GA 2FPHX 3TRGA 2FD2A 4GKJK 4JI5F 3VTIA 2OSQA 3BM7A 4TQRA 1SIWB 1OH7A 4KI6A 3EMTA 4DV5K 1Q8BA 3OT9A 1XQSC 4AM6A 1P8ZA 3KK2A 4GC6A 2ZJQL 2I0XA 2M5YA 3I82A 2NR0A 3V81B 1U6ZA 5BRDA 3CD7A 1VSHA 4BROA 4XH1A 3T41A 3ILIA 1NOYA 3NCPA 2E2PA 3J7YI 1A6LA 4RBVA 5BPNA 4IG3B 1Z05A 1P1TA 5LSRA 2EX3A 1ZM4A 1RBOB 4Z4FA 1BC6A 2GGPB 3G8SA 3CO0P 1FJ7A 5J2QA 1TFYA 3ISND 1RAIB 3D5MA 2ZVSA 1HKBA 4QPXA 1S6PB 3ULEA 1AFJA 1HLWA 3AA2A 3HSCA 1NDPA 3HHLB 3VWSA 3TAQA 2GUPA 3DU6A 1AROP 3KXDA 2WBNA 1F3VA 4I6WA 1I6JA 4X65J 3TARA 2IS3A 4Z4GA 4WP9A 1VHIA 2ZH9A 2COLA 2FSJA 3GDQA 4NLOA 3OYJA 1J5OB 4OZ5A 1X3NA 1WC1A 4PUOA 4C8NA 3AARA 1HARA 2JHEA 1CJVA 4C3MA 3IMQJ 3FQLA 4CECA 3BKTA 3CUNA 2F4FA 1TK5A 3ZT1A 2I1RA 2R7SA 1IQZA 1MG7A 2RILA 4O3SA 3N4PA 3GL1A 5CY4A 4BWMA 5A76A 3MMCB 2BKOA 5AZJB 2WVDA 2LEBA 5F8IA 3VQPA 4H5RA 2YHXA 1I94J 2LEPA 5M1PA 2V34A 2K1RA 4PQAA 4DV7J 2J9CA 3HFVA 4Q45A 3B54A 1FE4A 3V9SA 1HWLA 1U6BA 5LL6d 1S9EB 5EU7A 2BE2A 3GPAA 1X4BA 4USUA 2X6SA 2HGLA 2BQUA 4B1VA 3WEEB 4NB4A 4O0NA 3CQ8A 2XMUA 2GMLA 5I4MA 1NDCA 2WW8A 2E1MC 4O23A 4A8XA 2CJYB 2FLLA 4DFMA 1U45A 2UXDJ 2B9YA 4PXEA 4DV0F 2E5GA 3F41A 1VRTB 3BDPA 3ID8A 2LECA 3OPKA 4ZPCA 1X31C 3H3NO 1SV5B 2D5RA 3O1LA 3LP1B 3A2FA 2U2FA 4C11A 2C3UA 2DFHA 2ZD1B 2FB0A 4LR8A 4FJ9A 4LSLA 1CG2A 4BQLA 5AQGA 4M5DA 1V3SA 1BI4A 3M8WA 3EYZA 1YZ7A 4IUFA 1MMLA 1HQEB 4GVBB 2CRLA 1NZAA 1MU2A 2DBBA 4CBWA 3ZLJA 2V94A 2BH1A 1MWYA 4X2BA 3U4LA 3LP3A 2B0GA 4O3PA 2RRAA 4C2MA 2V4JA 2P8IA 2QX0A 2HVDA 5DM7L 1RKJA 2H3EB 2GVZB 4KI4A 1PYTA 2ZQBA 3DRPA 2I7NA 5I3UA 1YSJA 3UR3C 3DLEA 2C3MA 3UPFA 2MQMA 1JXVA 3Q23A 3H45C 2FLNA 2LEAA 3MPDA 4KB1A 3BF4A 3CCQS 2A6OA 1KD1T 1WELA 2KXFA 3OFGA 4WWSA 2EFPA 2L48A 2BDPA 1REVA 4CH7A 1Q81O 1A7GE 4DR3F 4MKAA 1XMQF 1M5SA 2OGUA 3VPZA 4X4QA 1HBUA 5CHIA 5H9FK 2M9KA 5MLCQ 2CJAA 3QEIA 4OHVA 2FBXA 4B3MF 4CGJA 1ZBUA 2W42A 2VBYA 1NBEB 4ZN3A 4P2FA 4DPWA 4FS1A 3HPGA 2RJZA 1OY6A 2QWLA 3CC2S 1FX2A 1TMJA 2R8JA 2P9PA 2W8LA 1WHVA 3M6VA 2ALYB 3GIKA 1HBMB 1CXQA 4ECZA 2DT9A 4FKYA 4K2JA 2XMTA 1S1VA 1T03A 3IFEA 3IG1B 3WQUA 1U49A 4J9NA 1RT6B 1FNOA 4ECWA 1O1WA 1P90A 1H2UX 3MAAA 4H0VB 4C3LA 1Q5YA 2DXEA 1F21A 2HNZB 1WSVA 2MPUA 8RUCA 4UT4A 4U8VA 2M70A 4UY85 2R2TA 5KFAA 3C15A 4X4NA 5EXWA 2J9DA 2JWLA 4ZVGA 3MX2A 1GOAA 3NNHA 3AB4B 1GT8A 2KLAA 2GCFA 2QT7A 5F8MA 4ZIVA 2KHDA 3THXA 4KGZB 2ZH2A 3MHYA 3G87A 3CD6N 5HN0A 2QWMA 1NCLA 4KO0B 5CHCB 1GMVA 2FJAB 2M4MA 1L3TA 4OZJA 2E4LA 2Q0RA 1LWEA 1D1UA 2KRBA 4S0MA 1N6QA 2X51A 3MR6A 3PSFA 1U1PA 4U7UK 4X65F 1R0AA 1RDUA 3QIPB 1B9DA 4W4MA 1MDUB 1GQEA 2WONA 2XO7A 3D45A 4KHNA 4M5JA 1K9MT 5F0UA 3MMJA 1T8EA 1ZPWX 4QWEA 3DXMA 4CESA 1MWZA 2G4BA 4DN9A 3NDKA 1YRTA 2WAQD 3H90A 4WXWA 1G99A 2X1GA 2QFIA 2GWKA 2R7VA 2QK9A 3HVTB 3P4IA 5C25B 3DHWC 5FPEA 4RW9A 4JI0K 1V3RA 4UQTA 1WKKA 1IWGA 3QWPA 4YB1P 1IBMK 4QS8A 4BCAA 3DRYA 1JNRB 3KWGA 5IQQA 4ZMMA 3K57A 4C8ZA 5A2QU 1I94F 2UXCJ 2QM1A 1HFEL 3IM8A 4DV7F 1TMMA 3IRXB 1Y9OA 3DGVA 2Y1LB 1WSRA 3OXLA 4LMZA 3ENOA 2V0NA 4UOCA 2J7UA 3UKUB 1WUUA 2BMBA 3NS6A 2WRMA 5LMNK 1CJUA 2BRKA 4KGVB 3PIOQ 1VSJA 4JI8F 3K5MA 3VQBA 4LFAK 3HFKA 4LFCF 1RZMA 4B1XB 2ZWPA 2VBXA 3H3OB 2VFUA 4CK3A 1XBWA 3OVBA 3RJMB 3VEVA 1SQFA 2NPFA 1J27A 1VQMN 3CE8A 2J7WA 4PPDA 3AO1A 4FJ5A 1TQLA 3A8EA 1C0TB 3FDSA 2Z1JA 5M1KA 2W2QP 2ADBA 2WUSA 2F8SA 3C46A 3IWLA 4CFAA 1X5TA 3E9OA 4USJC 2V50A 1U1RA 4K41A 1UPMB 4RLEA 3DGPA 1HNXK 2E29A 4W90B 4HHUA 8AT1B 1RA6A 2DVIA 5AXNA 3G6VA 1HR0J 2XNQA 4FWOA 5DQGA 2B9XA 4DXLA 1NM2A 4N7TA 2PZSA 4QWCA 3VV2B 2AF6A 1V6HA 3FSXA 4YOWA 4J2AA 4ICLB 1RDRA 4RWXA 3GCXP 2GHWA 4FK2A 2R8KA 5KFJA 5GAEP 3MFHA 1RI7A 3L3VA 4UF4A 5BPLA 2FTRA 1ASVA 3BV8A 3G8TA 4P2SA 2W9BB 1XUPO 4FS2A 2BEFA 3CIPA 5KFHA 3FZBA 1OY8A 5HMWA 4E2FB 5L8RC 2XMAA 4ZPVR 1IR0A 1E6YB 5C2CA 4YDDB 5KQ8A 4WFAQ 1V5IB 3MUMP 2CJ9A 3MXIA 2K8GA 4IG3A 4W5NA 2H48B 3CMQA 5C24B 1YWXA 2G2YA 2W2NP 1VMBA 2J6SA 1NH8A 2PE8A 4DV6K 2CZ9A 4JKFA 1HMVA 5E2QA 2PBDA 1S0MA 1XNRK 4E7KA 4MMOA 1DJ0A 5GMKa 2E8AA 2XZWA 2GGPA 2VQFK 3D6MB 1YXQA 5FRNA 4BR2A 3SJJA 2KYXA 2DGVA 2OPSB 4CIFA 2L08A 2OHDA 2ZHOA 4UOHA 3FEYB 3ZX2A 4MO5A 1S6PA 1JB0C 5MLCV 3CQYA 2IVFB 3MN9A 3HHLA 5I9EB 2GS8A 3FR0A 4HH1A 1HNZJ 4DCOB 2FYXA 3VR1A 3ZEUB 5CQGA 2BM1A 4HVJA 3SJHA 3JSYA 3VEZA 4PZVA 3A3OB 5C5JA 2QWOA 1SH0A 2BW2A 1J5OA 2CIMA 2HEKA 4MKVA 4CO2A 3CCUS 2LXUA 3TWHA 2QSWA 2V63A 3L09A 5AQHA 3W2WB 2WVEA 3N9UC 4I56A 2IPOB 5KAKA 4M3WA 3AO3A 4ZJLA 3UD4P 3QINA 3KK1B 4OLBA 2H51B 3J80O 1OH6A 2KFZA 3CETA 3MMCA 4F9OA 1QSYA 3QETA 1ZM2A 3N4WA 3QYYA 1OPZA 2P9IB 1NG9A 4K2XA 1A5XA 3L2RA 2ASDA 4CEZA 3AFGA 3KJFB 2OH2A 2KH9A 1S9EA 3FEZA 3DI6A 2W7PA 4TXSA 4B17A 1K47A 2YKAA 1FDAA 3WEEA 5E3AA 3FK4A 4L3NA 2G8HA 4Q5VA 2A1RA 3OTDA 2CH6A 4YOUA 2IIHA 4F67A 3P38A 4NX9A 3O1WA 5KOWA 1S77D 2HOEA 3TA1A 1VRTA 1UVKA 1UOCA 2LXFA 4A2AA 2B9EA 1IH7A 2VWBA 3PIOL 3UIQA 2YTCA 4YDUA 1SV5A 3LP1A 3SPZA 2IBKA 3TZZA 4DR2J 4GVLA 1NEEA 3CDEA 2DTJA 1WSFA 1REGX 3MM5B 4OHXA 3W3DA 5ETQA 5BN9A 1HQEA 3CDBA 4GVBA 2Z1GA 2AYGA 1UA0A 1R7IA 3TEHB 3UVJB 4EEYA 3ETMA 2ADCA 4ZTJA 4L6V3 3WIUA 3THWB 4AHVA 2BA9A 2DITA 2UXCF 4NA3A 4QWAA 3M8SA 3CC2N 2M8HA 4FF2A 2YX4A 1NJYA 3O9TA 1YUWA 3PW2A 1F9EB 2GVZA 3MR2A 3CMEN 4B9QA 2PN6A 4DU7A 3ET6A 3UCZP 1VQ5S 2ZOFA 4ZPDA 3A3PB 1NK0A 3X3UA 3W5XA 3THYB 4BLGA 3OYCA 3BR8A 1QTNB 2NXEA 2YPYA 2IFXA 1N36J 1T0TV 4WF9Q 3V1QA 4LD0A 4JI2F 1RAHB 3ZZOA 2HS3A 1LOUA 1RE1B 4U95A 4HKQA 4B3TJ 4NA1A 2G0IA 1SJ1A 2DXFA 4ED4A 1F2HA 3UWTA 5GINA 4KKOB 4WFAL 3J81U 5GADU 4JAXA 1O6XA 5BRFA 1XC3A 1KS2A 2GJ2A 3W5YA 3FRZA 2BR0A 4DU4A 4FPAA 2K2PA 4RO0A 5DG7A 2JH3A 1HBMA 4NWBA 4FM1A 7FDRA 3M1FA 1RBUA 4O3OA 3JAMY 4XTTA 4B9SA 4ZVQB 4B3OA 4IWVA 5KPTA 5D4LA 5GIOA 1HNIB 3IG1A 1SUQB 4OYBA 4CF2A 2XQCA 1P27B 4B1ZA 2H5IB 1RWWB 1ZPVA 4CZKA 2HNZA 4C0HA 4HYKA 4DTSA 4FOEA 4AM7A 2FXUA 4RUCA 2D3UA 5I3PA 4I6AA 1BUPA 3AVBA 4FO0A 6FDRA 5GAHU 4CIEA 3MCSA 3LWMA 3FLCO 1V4SA 4KO0A 4B3RJ 5ADXA 2V68A 1BCMA 4DTPA 3NF9A 1OIAA 3LWLA 4A8MP 1W9HA 3VHQA 2R7UA 3BGFA 1H7WA 3HHNB 3HP9A 4GVEA 4DU1A 1DQAA 3PX6A 3PKMA 4KHUA 4FF1A 3TSQA 3CULA 3C95A 2BJ1A 4NASA 2F1FA 1V4TA 1HNZF 3GFHA 3VALA 3AGRA 3QICA 1FRMA 1TUVA 3QIPA 5C2DA 3AVFA 2FZGB 2RDJA