1TVRA

Hiv-1 rt/9-cl tibo
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Aspartyl protease
molecule keywords REVERSE TRANSCRIPTASE
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tvrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tvrA05
2C2EA 4JV2A 3T5JA 3KK1B 2ASDA 1HYSA 2YNFA 4K4WA 1LW2B 4IOBA 3H2LA 5KGWA 4IFYB 2XC9A 4K4SA 1NKEA 3FFIB 2YNGA 3AO5A 4Z4HA 3P1GA 5KG3A 3UR0A 2GIQA 5F8HA 2IOCA 1RCHA 5KFJA 5KFYA 4M45A 2G8FA 2E6MA 3IGVA 3SYZA 4DQSA 4RW4B 1JL2A 4DWIA 3QO9B 1LWCA 5I42A 1IKWA 4CFAA 4XPEA 4ZP7A 2XI3A 5CYQA 1NK5A 3M9OB 1K6YA 4MK7A 2E9TA 2D3UA 4CGHA 3SUNA 1NK9A 1S6QA 1T05A 1KLMB 4RNMA 2B43A 4ZHRA 3UPFA 4BDZA 1K1SA 5KFTA 4Y1DA 4B9NA 3KLFB 4DL6A 4CCHA 1UWBA 4IH5A 4O3QA 3NKYA 4JS5A 2G8IA 4CGIA 2R8GA 4QPXA 2Y1IA 4KB1A 3ITHA 4M94A 1BI4A 5L1KA 4M3ZA 1S5JA 1JXLA 4B3OB 1Z26A 3OSPA 3KJVA 3HJFA 4BE2A 3QESA 2BE2B 4QWEA 4M3UA 4FLVA 4I9QA 1FKPB 4N76A 3CG7A 4TY8B 2YKNB 3QGHA 4N56A 3M9NB 3NGYA 4O55A 4NLVA 2PZSA 2FVPA 3NH2A 4NLTA 4K4ZA 1S9FA 2RDIA 2HW3A 4MQ3A 1I3AA 1JLGA 3T19A 3E51A 4MK9A 4CIEA 4B08A 1D9DA 4CHPA 4J2BA 4AHCA 1U48A 1N6QA 1VSJA 2BGGA 4QOZB 3IG1B 3MECB 4Z4FA 5KT4A 5KFRA 4J9SA 2ILYA 1U04A 3SZ2A 4B8CA 5J1EB 3SJJA 3LANA 3OYIA 3LZJA 3HP6A 3DRPA 4RW7A 4FJ8A 4CFCA 4KREA 1SUQA 4FK0A 3OYJA 4FK4A 3C94A 4CESA 4GW6A 5KFZA 4LSLB 3H5UA 2I5JA 3L8BA 4AHUA 3MR5A 3TAEA 3M8QB 4RW8A 4FLYA 1N5YA 2KFNA 2OPSA 4IRCA 3GIKA 1ZTWA 4KTQA 4TY9A 3AA4A 1EETB 5KT5A 4FLUA 1TKDA 4ID1A 2GC8A 4FJ5A 4J9NA 2XRIA 4M3YA 3NAHA 2HNYA 4EO6A 4JRQA 5KTQA 3OS0A 2IS3A 1LWFA 1TGOA 3KHGA 5KFVA 1ZYQA 1VRTA 2UVVA 3KK1A 2HMIB 4M42A 5HLFB 3CJ3A 1KVCA 3QIDA 2O4GA 1LW2A 2KW4A 4F3OA 1VRUB 3CJ4A 4Z0UA 4MFBB 4W5RA 4E7HA 3FFIA 4J2EA 4O0IA 1NKBA 2JC0A 1EP4B 3L2QA 2AGQA 3HM9A 3OJSA 2HHQA 4PQUA 4B9LA 4E7KA 2W9AA 4ZTFA 4G3IA 3F73A 1T8EA 3AVGA 3HPHA 1RDRA 2LSNA 2AU0A 3OYEA 1A5WA 2X78A 3EZUA 3KLIB 4RW4A 2HWHA 1CSJA 3U3GA 4WYLA 2P5OA 3V6HA 1I39A 4OPKA 3LWLA 4ZP8A 1RT3A 2BR0A 3C6TA 3VQAA 1HARA 1HYVA 3ZSXA 4CJPA 1GOBA 1KLMA 1KHWA 2D3ZA 3N6MA 3PV8A 4TYAA 4Y2AA 4URGA 4MIBA 1BQNB 3LDSA 4KB7A 3KNAA 3HPGA 4U7CA 1N56A 3H59A 2EX3A 4DTXA 3S3MA 2HHXA 3QINA 2RPIA 4KV8B 2QKBA 2IJNA 4RUAA 4M41A 4ZVHA 5KFFA 3KHHA 4NCGA 2YV0X 3AVBA 4CGFA 4DSLA 1B9DA 3NCIA 4DTRA 2BE2A 1KHVA 1VSKA 3CVKA 3OLBA 1NHUA 1FKPA 4TY8A 3HT3A 4JRPA 1BHLA 3HO1A 1L5UA 4ZP9A 4IDKB 4RNHA 3N6LA 2C28A 4KRFA 4QWDA 2QKKA 3V9UA 4ECXA 3TR8A 3TVKA 3DOKB 3MEGB 3BGRB 4F2SA 4B9MA 3MFHA 2J6TA 1RA6A 4ECQA 3BR9A 3SFGA 3V9XA 4HKQA 1QQCA 2FVRA 1JLCB 3SUOA 5KT2A 3IG1A 3MECA 2YKMA 4ECSA 5E41A 3K59A 4OGCA 2HNZB 4E89A 5J1EA 4O5BA 3OL8A 2GIRA 2HNDB 1VSIA 3HK2A 3B6OA 4O4GB 5KFQA 3P5JA 1JX4A 4WZQA 1QE1A 5F9LA 1CZBA 2XCPA 4CJEA 3OYHA 4QCLA 1C1CB 3M8QA 4IR1A 3ZSVA 4O3OA 3JSMB 3VQ5A 1NK8A 5KFAA 3KK2A 2QK9A 4IR9A 4EEYA 1QUVA 2DTUA 2UVWA 2GV9A 1EETA 3BSAA 1KSPA 4CJQA 4C8KA 4FW1A 1QHTA 4FJLA 3L3UA 1TK0A 4AHTA 5JS1A 3KLGA 4ED1A 3FRZA 1YTAA 4KHQA 1QAIA 3Q8QB 1ZBIA 1DTTB 3KHRA 2C22A 1IKYB 4KAZA 3LP2B 4HUEA 4GC7A 3M8PA 1N4LA 4W5TA 1NOZA 4DSEA 3OYNA 4FZYA 3KKRA 4TQSA 1VRUA 1RT7B 4IG0B 4MFBA 3M8RA 4CGGA 4AILC 3PJXA 1EP4A 2WK4A 3DLGB 4CEDA 4EBEA 1DTQB 3PO4A 5KI6A 1QSYA 5I42B 1IG9A 3KLIA 1HYZA 1JLQB 1KFDA 5SZTA 4NLYA 3KK3B 2ASLA 3PY8A 4FLZA 1RT5A 4I2QB 1RYSA 5DG8A 3PX0A 1MMLA 2D7SA 2G8KA 4DQPA 1TV6A 1WSHA 5FRMA 1J54A 1S6PA 2KQ2A 5F8NA 1BQNA 4CK1A 4DF8A 1ZBHA 1JLAB 3BQ0A 4MIAA 3T5HA 3HVRA 2YNHA 3OYLA 1C0UB 3KD1E 4Z4EA 4KV8A 2R7YA 1NJYA 1TL1B 3H40A 1R0AB 4TSXA 3O4QA 4J2AA 2YHAA 4M95A 3PJWA 2ILZA 3HKWA 4WFXA 1L3SA 2IDOA 4EYIB 1C0MA 4ZVEA 4F4YA 3O4NA 4DMNA 3V1OA 4DU3A 2DPIA 3MXJA 5C42B 3NAEA 4DSJA 4EZ6A 4O4RA 3OL9A 4X2BA 2NUBA 1S48A 2X6NA 4M3TA 2V4QA 2HWIA 2DPJA 4CJLA 4EP4A 4HCCA 4WXOA 1X9WA 1TKXB 4XIUA 1HPZB 4NYZA 3DOKA 2KZZA 4F50A 3MEGA 4FCYA 3BGRA 2P1JA 4FM2A 4Y2CA 2HAIA 2JLEA 4ED6A 2DY4A 2A1SA 1KTQA 1HQUB 1JLCA 1UAXA 3DRPB 4Q44A 3AO3A 3DI6B 5DQIA 2RKIB 1T03B 1S4FA 1WNSA 4O4GA 3FQKA 4DTUA 5CY4A 4FS1A 3NDKA 2OZMA 3EPGA 1N5YB 4FJJA 3SQ0A 2OZSA 1RTDB 4NCBA 1C1CA 4KSEB 1IKVB 3OYGA 3TANA 3NF7A 3I8DA 1Q9XA 5J2QB 1D9FA 1IO2A 2G8HA 4NLPA 1U45A 4HUGA 4PY5A 2FBVA 3DMJB 3KMQA 2FJXA 4E7IA 3AO1A 4DS5A 1UOCA 4KHSA 5DLFA 1VK0A 1RT6A 3LWMA 1VRTB 4FW2A 4EZ9A 1DTTA 1B92A 1IKYA 3K2PA 3LP2A 5HP1B 3VQPA 2JEJA 3BDPA 5KFHA 2P51A 2IJFA 3E01B 3CFRA 2CJQA 4PQUB 1RT7A 4IG0A 1YTUA 4C8NA 3DLGA 1DTQA 3MEDB 5J2MB 4ZMMA 3AVMA 4KAIA 4F4ZA 4CIFA 1BGXT 3IGNA 5KFUA 2OPQB 3GV5B 5DMRA 1JL1A 2KTQA 2AQ4A 1RT1B 4CF8A 4DU1A 1RT3B 4FJNA 1JLQA 3C6TB 4B9UA 3KK3A 3V81B 2R2UA 4I2QA 4OKJA 4ED8A 1ITGA 4F4WA 2BQUA 3OSNA 1QAJA 3PHEA 1UA0A 1J5OB 4XO0A 3BJYA 1RTHB 5KT7A 4J9QA 2VWKA 2AGPA 1B9FA 1S49A 3BSNA 4FXDA 2GUIA 1CXQA 4ED2A 3DRSA 3I5CA 3MTKA 4DLEA 3ZT0A 1HQEB 1LAVA 1JLAA 4N5SA 3MXIA 4C8OA 4KFBB 4C8MA 4DL3A 5FRNA 4KO0B 4DTSA 3AA3A 4FLXA 1C0UA 1LW0B 4ZVGA 4NCGB 4O44B 5HRRA 4DFMA 1TL1A 1R0AA 2XY6A 3AVIA 3ZT1A 4RZRA 2XGPA 4CJSA 4Q45A 3L3VA 2XY5A 5EWFA 3NF8A 4CEOA 5C42A 3GIJA 4BE0A 3BQ2A 1XHXA 1ASUA 3ZSYA 3TWHA 2X74A 1TKXA 4IH6A 4ELVA 2HHSA 1HPZA 4E1NA 2QV6A 1JLBB 4OL8A 2DFEA 1XHZA 3PZPA 3QEIA 4NCAA 3UIQA 4ZP6A 3PR4A 4YP3A 1VSDA 2YKMB 3U6FA 1D5AA 4EP5A 1Y97A 1HQUA 4KHUA 3OHAA 2PY5A 4E7LA 3AVJA 2YHBA 3DI6A 1W0HA 2RKIA 1QE1B 1T03A 4NLXA 3LP3A 3M8SA 1NOYA 3QEPA 4IG3B 1X9SA 4U6PA 1WLJA 4F8RA 1KLNA 5HROB 3QLHB 5KFLA 2OA8A 2F8EX 4YNQA 3KK2B 1RNHA 1RTDA 4CGDA 1IKVA 4LH5A 2DFFA 4KKOB 3OS2A 1BIZA 1D1UA 5CYMB 2E9RX 5J2QA 4CHNA 2W8KA 2R8HA 3KLGB 1HMVB 4WFZA 2IC3B 1BL3A 2Q3SA 2RF2B 3DMJA 3SV4A 2BRLA 4I7FB 1VSHA 3SFUA 1CZ9A 2FLNA 3M8PB 3HPOA 3PX6A 2E9ZA 4E7JA 2E6LA 1S10A 3OHBA 3HYFA 4HUFA 5HP1A 2W7PA 1SV5B 4BDYA 4TLRA 3E01A 4H4OA 1TL3A 1GOCA 4ECUA 2WONA 3N6NA 3NE6A 2G8VA 2JEGA 4MH8A 4OVLA 1J9AA 2GBZA 3MEDA 4BE1A 5KFSA 1TK8A 5J2MA 4KB0A 2FVSA 1BIUA 2OPQA 2G8WA 1RT5B 3IN5A 3OYKA 1RT1A 3K58A 1D0EA 4ECTA 3SPYA 3EY1A 4WFYA 4H54A 5DGBA 3V81A 1QSLA 1T94A 3DOLA 2IM1A 3RMCA 4YFUA 1J5OA 3RR7A 1TV6B 2BRKA 2R2RA 1RTHA 1S6PB 4Z4CA 1WSJA 5KFPA 1RBTA 2A1RA 4PWDB 2YNHB 1HQEA 3DLEB 4ECYA 5T14A 2ZQBA 4KFBA 4KO0A 1LW0A 2RDJA 5KT3A 4O44A 4NLGA 3ZSQA 4CFBA 4EYHB 4H8KA 2EHGA 4M3WA 1WN7A 3FSIA 4FBTA 4FVMA 1YT3A 4LSNB 1EKEA 3PW7A 3AVHA 3PO5A 2VG5B 1QTMA 4IFVB 4FJIA 1S0MA 3BSOA 1HNIB 3NAIA 4AHRA 4ZPCA 2JGUA 5F8IA 1U09A 4R8UB 3AA2A 3OYBA 4CEAA 3ZSWA 4B9TA 1JLBA 3SQ4A 5KFDA 3D0PA 4DF4A 3RB4A 5KFKA 2YNIA 5KFIA 4Q5VA 3CIZA 3DRRB 4FS2A 4J9PA 4F3TA 1GOAA 3KLEB 1S1VA 4ID5B 4IRKA 3OYCA 2ETJA 3MR6A 4KBIA 3C6UA 1SKSA 4HTUA 5KGXA 3KOAA 1ASVA 4IG3A 1U49A 4ZPDA 3Q8RB 1FK9B 3VQDA 4QAGA 5HROA 3KLHB 4F4XA 3QLHA 3V4IA 5KG0A 4AH9A 2UVRA 1YVFA 1LAWA 4MKAA 5EWGA 4CE9A 4KKOA 5CYMA 3I0SA 1RDCA 1TKZB 2R8JA 4E19A 1KCFA 1ZBLA 1JLEA 1HMVA 3O3HA 1RT6B 2IC3A 2JEIA 2RF2A 2EC0A 2AX1A 4I7FA 2Z1JA 2J6UA 4FJGA 4O3NA 4FJ9A 2UVUA 3QGGA 1SKWA 4OLBA 2F8SA 3NH0A 5T7BA 3H4DA 2IBKA 4FZXC 3LAKA 4ZTJA 2VG6B 1RBSA 3OY9A 1SV5A 1BISA 1MU2B 4DG1B 2FJWA 3UQSA 3CWJA 1ZETA 4YR0A 2W8LA 4LQ3A 4FJ7A 2O5DA 4Q0BB 1SH3A 4NLQA 3L2WA 1L3TA 2OPRB 5C25B 4URSA 4ELTA 3VQ9A 4FYDA 3ISNC 3EZ5A 3C95A 4QW9A 3QNOA 1S9GB 4J2DA 3S3NA 3WNEA 1JIHA 3PUFA 3GYNA 1SL1A 3RMDA 1SH2A 4KTZA 2PYJA 2FC0A 2QE5A 4M3RA 3VN5A 4PUOB 1NK6A 4NLUA 1ZBFA 3ALYA 3DRSB 3ZT4A 3RRHA 4PWDA 4JS4A 3H5SA 1CLQA 2XHBA 4CK3A 4OJRA 3DLEA 4DEZA 3TAPA 4CECA 1S1WB 3SUQA 3L2VA 5KG4A 4ECZA 3VQBA 1G15A 3TARA 3RB0A 1TKTB 2AWZA 1SL2A 4RW9B 4NLDA 2BANB 3TI0A 2C2RA 1RBVA 2XCAA 3M9MB 4FM0A 4LSNA 3VQCA 2V4RA 1EXQA 3QNNA 3D45A 2PYLA 3KTQA 2G8UA 1S9EB 2VG5A 4IFVA 1NKCA 1HNIA 2OPPB 5SWMA 1X9MA 3RB3A 4AHSA 1L3UA 4NLSA 3ZSZA 2V9WA 4K8ZA 4RUCA 4R8UA 2IM0A 3V9SA 4IKFA 2VA3A 1XWLA 4IRDA 4Q43A 3LPTA 2WB4A 1S0NA 4TN2A 2DFHA 4Q8EA 2IM2A 3VQ4A 3DRRA 3VQ6A 1NK0A 3KLEA 1FKOB 4ID5A 4CJ5A 2AJQA 3DM2B 3GIMA 3WNGA 3RMBA 3VQ7A 2FJVA 4CF2A 3UDLA 1TQLA 4CF0A 3OYAA 2FBXA 4WXWA 1FK9A 1RILA 1BQMB 2HVIA 1S1TB 5JS2A 4DSFA 4FJXA 3I0RB 3KLHA 2W9BB 1ZTTA 4JUZA 5J2NB 3Q8SB 3O3GA 1IH7A 3ZSRA 3V6JA 5DQHA 3VA3A 3CFPA 1XR5A 1GX5A 5L1IA 3CM5A 4J9OA 1TAQA 3DLHA 1TKZA 4K8XA 5CZ1A 5EU7A 3ASMA 1L3VA 1RYRA 2WCXA 1RT4B 3IRXA 2D0CA 3F9KA 4ZPAA 1GX6A 2WOMB 4O3RA 2V0NA 3K5OA 1RTJB 2FBYA 3OYMA 3GV8B 4FJMA 4EO8A 2BDPA 2VG6A 4H4OB 4AHVA 2HVHA 1TL3B 3QERA 2WONB 4GMJB 4E0DA 4ECRA 1MU2A 4DG1A 3SI8A 2ATLA 2BQRA 3AVNA 4PA1A 1K1QA 4M3XA 4FM1A 4C8LA 5L1LA 1YVUA 4KI6A 4Q0BA 1RDAA 5FDLB 2OPRA 5C25A 4YR2A 4YMEA 4KHRA 5EWEA 5I3UA 4HVJA 1S9GA 1RT2A 3G6YA 3DOLB 4QW8A 5KG1A 1BCMA 3AVAA 2OYQA 3TAFA 1RTIB 2RN2A 3V9WA 3QIPB 4DL7A 5F8JA 4L8RB 4PUOA 4K4YA 1KVBA 3D5MA 4DL4A 4EBCA 1S1UB 3MAQA 3T3FA 3NHGA 3ZCMA 3AO2A 4JV0A 3NL0A 4UQGA 1VSMA 3G6VA 1VSLA 4CJWA 3FQLA 2Z1GA 4DFPA 2R8IA 3MEEB 2VG7B 1KFSA 1S0OA 2IA6A 3DYAB 5JXSA 3AVKA 3SUPA 1S1WA 3WNHA 2HHVA 1C1BB 3H4BA 1SKRA 1T7PA 5KFNA 3I5AA 1C6VA 4IQXA 1TKTA 3LPUA 1RBUA 4RW9A 2BANA 1I6JA 5KFEA 4RU9A 2WHOA 3V6DB 4CHOA 4NYFA 4CEZA 4DQRA 4NLWA 3PVXA 4TYBA 5L1JA 5J2PB 3DLBA 2ZD1B 4TQRA 4KI4A 1N48A 1S9EA 4QWAA 3RAQA 4DL5A 2D5RA 4CJUA 4GVMA 4CJ4A 2W9CB 3VQQA 3LP1B 3TAQA 3VQSA 2JEFA 2OPPA 4XPCA 1NNDA 4MK8A 3I5BA 4W5OA 4WZMA 3NF6A 2YNIB 2B4JA 4OPJA 1JLFB 3GV7B 1S1VB 1WAFA 3G10A 3V9ZA 3C6UB 4WE1A 3LP0B 4ED7A 3IS9B 1XR6A 3TABA 2B6AA 2FVCA 1HNVB 3O3FA 1FKOA 3DM2A 2B5JB 3KHLA 4LH4A 5DQGA 3RBEA 1NJXA 4F2RA 3HHKA 5DK5A 3ULDA 4FK2A 3V4IB 3PW2A 4K50A 1HJRA 4K4UA 4DSIA 4K4TA 1BQMA 5DG9A 4DFKA 1S1TA 4KTWA 3QGIA 3I0RA 4G1QB 3HSTB 2W9BA 1RAJA 2J6SA 3NGIA 5C24A 3I0SB 5J2NA 3AV9A 1TVRB 1WAJA 4K4XA 1IM4A 3NH1A 3OVNA 3OYDA 4O0JA 1JLEB 1C0TB 2OH2A 1WSEA 2XY7A 1HRHA 3T5LA 4ECWA 4NRTA 5DGAA 3CYMA 4ICLA 3PW4A 1OS5A 4KE5A 1NJZA 1RT4A 4HCBA 3RWUA 5DLGA 1JKHB 2ZE2B 4R0EA 2WOMA 4HYKA 1RDDA 5C5JA 1VSFA 3GIIA 1RTJA 4R5PB 5KG2A 5KFCA 4RW6B 3OL6A 5KFBA 2R8KA 4W5QA 4CIGA 1IKXB 1ASWA 4RNOA 2ITGA 2FLLA 1RDBA 1Z25A 3MR3A 4BDPA 3THVA 3VQEA 4IFYA 4RNNA 4E1MA 1LWEB 4BACA 2UUTA 5FDLA 3ICLA 3IAYA 2HB5A 3CJ5A 4CHZA 5HRSA 4OKEA 1QS4A 3HXMA 4CERA 1NK4A 2R2SA 4I2PB 1RTIA 4LY7A 3QIPA 3OLAA 3QO9A 2D0BA 3RB6A 4RG8A 1VSEA 1S1UA 4IH7A 3VQ8A 1BCOA 3VA0A 1Z4UA 4KHYA 1CXUA 3HP9A 3QETA 3NGDA 4CF9A 3H5XA 2BQ3A 3KLVA 2P5GA 4KPYA 1J53A 3H5YA 2W42A 5KG7A 4CHQA 4W5NA 4ZVFA 3MEEA 2VG7A 4NZ0A 3DYAA 2IAJB 4OLAA 3CO9A 1REVB 5KRSA 4IBNA 2JC1A 3L2RA 4I9LA 3KLFA 4NRUA 4CJ3A 1LV5A 1C1BA 4O3PA 5HRNA 2I1RA 3KKSA 3CM6A 2AGOA 3AVLA 1TK5A 1TP7A 4DQIA 3V6DA 2AX0A 1KRPA 4FJKA 3TQ1A 1WNEA 3SCXA 4B3OA 1W25A 2Z1HA 5J2PA 3BQ1A 2ZD1A 4B9VA 2XY8A 4EBDA 3TAMB 5KFWA 3MR2A 2VWJA 2W9CA 3OS1A 3H08A 3LP1A 2YKNA 3AVFA 4WYWA 3PW5A 4ELUA 4BWMA 1WSIA 1C2PA 2UUWA 5K14B 3V1QA 3SI6A 3NGZA 1JLFA 3G6XA 5F8LA 3QZ7A 4N41A 4DFJA 3QIOA 3MXMA 3LP0A 3IS9A 4CEEA 1S1XB 3AO4A 3CJ2A 5FROA 3HVTB 1HNVA 5KG6A 3T5KA 3DLKB 2R2TA 4LD0A 4RNFA 2B5JA 4OKKA 4FLWA 3SQ2A 3LAMA 2ASJA 4CJKA 3KMSA 4H4MB 4ZPBA 4DS4A 4Z4GA 4DLGA 3K5LA 4CJTA 4G1QA 3OYFA 4LSLA 3SNNA 5D3GB 1XR7A 3FDSA 4DTPA 1TVRA 1RBRA 1C0TA 5HBMB 3KIOA 4NLOA 3JYTB 4DTNA 3QEXA 3IRXB 4ECVA 5KFXA 3SPZA 1FXXA 2HHUA 1A5VA 3BREA 3PR5B 2VA2A 2F8TA 4CEBA 3NBPB 4FLTA 3P83D 4YQWA 3CJ0A 5JUMA 3LZIA 1JKHA 2ZE2A 3BSCA 1UA1A 2HHTA 4DTMA 1DLOB 4ED0A 4R5PA 3TAGA 3OL7A 1HYSB 4J9LA 4RW6A 3HL8A 1O1WA 2YNFB 1SH0A 4CF1A 3G0ZA 3LALA 2D0AA 1IKXA 3NMAA 2HMIA 3CDUA 3K5NA 2YNGB 5HLFA 3HVWA 1D8YA 2Z1IA 3AVCA 2IGIA 5I3UB 1LWEA 1RT2B 4Y3CA 4CGJA 1WSFA 3QZ8A 2WRMA 4J9RA 5KFOA 1F21A 3ISND 4KHNA 2IM3A 3MF5A 2XWYA 3ZT2A 2KZMA 1LWCB 1IKWB 5KFMA 4OGEA 4Y1CA 4I2PA 4JLHA 5CYQB 4Y34A 1NJWA 4BWJA 3H98A 1JXBA 2CKWA 5DG7A 2FLPA 4CJFA 4DTOA 3Q8PB 1JXEA 1S6QB 1T05B 4QWCA 3T1AA 2ZKUA 3QEVA 5EUHA 1EX4A 2ALZA 1C1AA 4ZHRB 3CFOA 5KFGA 5CZ2A 4K4VA 3PX4A 4TXSA 1XI1A 4ED3A 4JV1A 1UWBB 4N47A 3CDEA 4CEQA 1QSSA 5KG5A 2IAJA 1REVA 3RR8A 4URQU 3RTVA 1X1PA 4NLRA 3SV3A 2IMWP 1ZBUA 3ITHB 3GQCA 3V6KA 1BI4B 2HHWA 4GC6A 1NK7A 4Z4IA 4IKAA 1XC9A 2E4LA 3V1RA 4FBUA 3KJVB 1A5XA 5F9NA 4B8AB 1SL0A 2W7OA 4FZZA 3DLRA 4DU4A 1WSGA 3QEWA 3TAMA 3U3YA 5EDWA 1W9HA 5KRTA 2XGQA 1KVAA 3B6PA 4J9MA 1NHVA 5L9XA 4IDKA 3EYZA 3HVAA 3NF9A 4MKBA 1RA7A 4CEFA 3PW0A 3CDWA 1JLGB 5K14A 4WE1B 4CK2A 4LQ9A 2B6AB 3K5MA 3AA5X 4CHYA 1N6QB 3QYYA 2XI2A 1Q9YA 2X6SA 1S1XA 3RMAA 1U4BA 4KHWA 3HVTA 3RRGA 3KD5E 3D28A 4CJVA 3S9HA 1TAUA 3EPIA 4O3SA 3DLKA 3GILA 3NFAA 1T3NA 4DSKA 4RW7B 2WTFA 3CQ8A 1SUQB 1S97A 5F8GA 4FJHA 2HNZA 4CFDA 3ZT3A 1Q8IA 3WNFA 4KHMA 4HHTA 2HNDA 3RAXA 2Y1JA 4H4MA 3G86A 2I5JB 5C24B 4J9KA 4QWBA 3L2UA 4DTJA 4RW8B 2FVQA 4CJRA 1U47A 5D3GA 3S3OA 2F96A 2C2DA 2OPSB 5F8MA 2O4IA 5HBMA 4Q8FA 4ICLB 3JYTA 3A2FA 3DDKA 3ZSOA 3SQ1A 3JSMA 4F4KA 4YR3A 4DL2A 2XO7A 4B9SA 2ATQA 2KFZA 5KT6A 5HRPA 3K57A 2HNYB 3NBPA 4E3SA 2QXFA 4NYNA 3MFIA 3OJUA 3RBDA 2D41A 2FBTA 1LWFB 4DQQA 1DLOA
chains in the Genus database with same CATH superfamily
2C2EA 3CC4N 1A9NB 4DUYJ 1HYSA 2X1FA 4LF8K 4K4WA 4N77A 1SQGA 4FF3A 2XC9A 3FFIB 3AO5A 2R7QA 3KFWX 2IOCA 5HI7A 3IM8A 1RCHA 1YKWA 1MWQA 4JI7K 3SCIE 4DQSA 3PFOA 2GJIA 3H20A 5D78A 1B7YB 4XPEA 4ZP7A 1Y5NB 3AB2B 2XWXA 5CYQA 2XS7A 3H46O 2DR6A 3WQPA 1NGIA 2IVMA 4CGHA 3CJCA 2ROGA 1IBMJ 4BRQA 3UPFA 3E3XA 2VWBA 4BDZA 1K1SA 3M2UB 3D0GE 4DL6A 1UWBA 2YCHA 2F4VK 1SAZA 2E20A 3DDIA 1WI8A 3E8OA 2VZ9A 3EL2A 2MLYA 2FDNA 3CCSN 3CJKA 4F04B 4M94A 3W1YC 5L1KA 1UETA 2WAQD 2NXJA 1G6BA 1V9OA 5HO4A 4BE2A 3QESA 1N0UA 4QWEA 4M3UA 4FLVA 2L9WA 4KQZA 4CBXA 1OVYA 4NLVA 4DUYK 2Q3PA 2Z0GA 3LDOA 3JQMA 3CT9A 4MQ3A 4MK9A 3E51A 1F9EB 3C3LA 4ED4A 5CAAA 2UXCJ 5T7LB 4J2BA 3AD9C 1N6QA 1VSJA 1YDLA 1NGCA 3IG1B 1VC5A 5KT4A 5KFRA 4J9SA 4DX8H 4DXLA 4KH0B 4BROA 5J1EB 4L3QA 4C2MA 4MT1A 3KK7A 3LZJA 2CPHA 4FJ8A 3B4DA 3VZIA 4CESA 2W4DA 4FSVA 2O8EA 2AJ0A 2DRDA 5KFZA 2R4FA 1E6YB 2CNNB 1UVNA 1BU6O 1IBMK 3BR8A 1KVJA 3G4SS 3M8QB 4RW8A 4FLYA 1EQMA 2EKYA 6FDRA 3FEZA 2KFNA 4X62F 1ZTWA 2DR5A 4KTQA 1RKIA 2IIRA 4I6AA 4L73A 4LIWA 4C3LA 2X3GA 1S0VA 2GC8A 4FJ5A 4Y2MA 1FRLA 2E5HA 3GYGA 1FX2A 5IM0B 1BUXA 2HVDA 1M1KT 1U2RA 3W66A 5KFVA 3MM9A 1VRTA 5AQMA 1CJVB 2KVIA 4M42A 5HLFB 1W2BR 1N88A 2HBLA 1KVCA 2KW4A 4MFBB 3CD6S 2V2KA 3L7PA 1NKBA 3L2QA 1URNA 2VD3A 4ZTFA 3F73A 1NLVA 1T8EA 2LSNA 2AU0A 4CQ1A 2M4MA 2QC3A 1K9MO 4B3RF 3M6XA 3GSIA 2HWHA 1CSJA 1YZ7A 4WYLA 1I39A 4OPKA 3D3BJ 2DBBA 4ZP8A 4Q2LA 1LKZA 2Z57B 1SC3B 1KR4A 1SIZA 1HYVA 2VCPA 1HI0P 1GOBA 4Y6IA 3QT5A 4ZN3A 2ZH8A 2UUBK 1TL7A 3UCUP 1X4EA 3PV8A 4Y2AA 3HHLB 4QZVB 4LF9J 1HWJA 1BHNA 3H59A 2DHXA 2Q66A 2RPIA 2HBYB 2IJNA 2EBEA 2J9DE 3KUEA 1ELOA 1OSCA 1SZ2A 5F41A 2VJVA 3AVBA 3I56S 4CT9A 4OHYA 4A8FA 3G6ES 3CVKA 3S41A 1F5CA 4JYAF 4TY8A 3HT3A 1OY8A 4RU2A 1PJ6A 4KHPF 1L5UA 2VBXA 4RNHA 2FSNA 2C28A 3KYLA 3CDAA 4QWDA 3G8SA 3V9UA 1PCAA 3O5BA 3TVKA 2VYPA 3CJ8A 3R97A 4BC3A 2DGXA 1ROFA 1RGIA 4USWA 3MFHA 4ECQA 1EAYC 1X4CA 1SC6A 1IBLF 2QTDA 2MGZA 2IRYA 1BXNA 3MMAA 3K59A 4OGCA 4E89A 4A8KA 1LXJA 3CJRA 2GIRA 1GXTA 1VSIA 3PACA 3HK2A 1RWPB 3N79A 5KFQA 1FO1A 1HNXF 3CC4S 1GK8A 2LXFA 1ZBTA 1VC0A 4G9ZA 4BR4A 2MXYA 2DGOA 3GCXP 4IR1A 2K3IA 4O3OA 1NK8A 1R6YA 3SSSA 3VQ5A 3N4QA 3AT1B 4IR9A 2Q0RA 5FPNA 2UVWA 4DR1J 3R7BB 1EETA 1Q86T 1U2VB 2GV9A 4A8OA 4FJLA 4OZJA 4CZEA 1YTAA 1ZBIA 2C22A 2YWEA 2VIHA 2Y0BB 5ETVA 2CNKB 4W5TA 2HHHK 1U26A 1Y0HA 4ZCIA 1Q78A 3MTJA 2IJRA 4IG0B 4NA3A 2DXFA 1NGGA 3DOMA 2CQCA 1FDNA 1EP4A 1TFYA 3DLGB 4CEDA 1DTQB 2R7SA 1RCXB 2KLAA 4ZVQB 2RQKA 5AQHA 1IG9A 4JEPA 2HZVA 4JI2J 3C46A 1TFWA 3CCSS 2MDAA 3I96A 4K8RA 3B8AX 1RLCL 3TUJC 4DV5J 3PX0A 1MMLA 1K8AO 3OTCA 1J27A 1KQSR 5BRDA 5FRMA 1NDPA 1J54A 4RWTA 1YVNA 1ZBHA 1JLAB 4MIAA 3HVRA 1MWMA 4ZS6A 4KV8A 2R7TA 2KH9A 4CZIA 1IR0A 1NJYA 1TL1B 1GEHA 2VICA 1XERA 4DCOB 3LUYA 2QL7B 4DR1K 2BJDA 2IDOA 3P39A 2O8CB 1T6CA 1C0MA 2CRLA 3P5TL 4CBUA 4GKKJ 1FDAA 4DMNA 2FC8A 3MXJA 3NAEA 3BKUA 2BH1A 3T1YF 1Z05A 2NUBA 5HK4A 1T0TV 3ZX2A 5T41A 2ZGZA 3CCEN 3RRKA 4B1VA 3BGUA 1TKXB 3ULEB 4NXMF 3O9RA 1K73O 2LU1A 3MEGA 2KO1A 4FM2A 4WKYA 4OZNA 1B4SA 1U0SA 2JDJA 4M5MA 2NRWA 1FDBA 4ED6A 4WTYA 2OO4A 1JLCA 1X4GA 3AO3A 2PO4A 4JI2K 3HDSA 3WEEA 1ZM4A 1EJ7L 3UW1A 4B3MJ 3HF5A 3AOCA 2P9IA 4HTLA 2CQDA 3NOGA 4FJJA 1K0TA 4QR2A 2XLKA 1GTHA 3OYGA 3GMGA 3I8DA 3GIRA 1D9FA 1NDCA 2RS8A 5LJVA 4H5VA 1IO2A 3VEXA 3GCWP 1RHJB 1FRIA 4NLPA 1U45A 4MMOA 1FT8A 1AZSA 2FJXA 1TMMA 3K2YA 4KHSA 3LWMA 2XEXA 5IT9Y 2C2KB 3JSBA 2FSJA 2ATCB 3A3PB 1DTTA 2A6OA 4ZCLA 4QS7A 3K2PA 2EG2A 3EM1A 2LA4A 3OBYA 2JEJA 3OFHA 3TTFA 2P51A 4EMDA 4JI0K 1U2CA 4PQUB 3NS7B 1Z2ZA 3F2KA 1YTUA 1I5OB 4C8NA 2RB7A 1Q1KA 3TUPA 4CIOA 2C2MB 4F4ZA 4RUHA 2V9KA 3T1HF 2KTQA 4RO0A 2MQNA 3V81B 3MCMA 3OFFA 4I2QA 1CJUB 4F4WA 3OSNA 1QAJA 1UA0A 4YOEA 3KUGA 2XQCA 1Y3KA 1HNZF 1AFJA 5KT7A 3U8XA 4J9QA 3IAS9 2AGPA 2V5HG 3AOBA 4BVPA 3OUYA 1S49A 4B3MK 3BSNA 4FXDA 2GUIA 1HQEB 1NSAA 5AXNA 5A0YA 4C8OA 4KFBB 4C8MA 4DL3A 5MLCQ 5FRNA 4DTSA 4FLXA 1LW0B 1FTCA 4ZVGA 2LA6A 2M9KA 2R7VA 2OKQA 1WUUA 2ZZMA 2P9PB 4RZRA 2RRAA 1R89A 2XGPA 5AFUA 4Q45A 3L3VA 4F26A 3LM2A 4F0KA 2J9CA 4LVOP 4B02A 1SQEA 3GIJA 4BE0A 4C8YA 2CQBA 3CSKA 3EZWA 1X60A 3HFKA 1XHXA 3BV8A 5GAHP 2YY3A 3ZSYA 2Q6CA 1ULRA 1C0FA 3AJDA 5LSRA 4OL8A 2DCLA 3P96A 1MW7A 4EFAC 4LF2A 1D5AA 5H9EJ 4HDGA 1S79A 2FSKA 4J90A 2A2CA 3BBBA 4B1ZA 4E7LA 2VL1A 5F0XA 1I94J 2KT2A 1QE1B 1T03A 2LQ5A 2A40A 5AQYA 1NOYA 4IG3B 1G4CA 3UVJA 1X9SA 3FEXB 4JOUA 2CQ1A 4OLPA 2ZM6J 5HQMA 1URRA 4X4RA 5K8NA 3VALA 5HROB 1OH8A 3NGKA 4YNQA 1RTDA 3M5RA 5HMZA 2DFFA 3W9HA 3OS2A 4NL5A 1D1UA 2E9RX 2LKZA 3ZNUA 1HMVB 4QU6A 3DMJA 3D6TB 3SV4A 1F0XA 4O8KA 4OX9K 2IRXA 5GAGU 2WZ1A 1SJFA 1IV0A 3M8PB 1T3VA 2RHSB 2E9ZA 2BTFA 1Y5IB 2AV5A 2AEFA 4C0HA 4TLRA 1UCNA 2HQ3A 4DR5J 2HGMA 3THWB 5HL7Q 1IM6A 3W62A 2WONA 4ANCA 4CNYA 3RW7A 2FUG9 2AIRB 5EN1A 5KFSA 1Q82T 4Y00A 1YRTA 4M5NA 2FVSA 3VF4A 1RT5B 3HSZA 1RT1A 4IO1A 3W8PA 2DT9A 1MDUB 3PEJA 5ETPA 1T94A 3DOLA 2IM1A 4JI5F 2QIFA 4OZLA 1H38A 5IT4A 5FLXY 1RTHA 4Z4CA 2HF4A 1NBEB 4C8ZA 5M2PA 4LF8F 2YNHB 5KQDA 3CCES 1E3MA 2HVZA 4KH4A 2ZQBA 2JSXA 4JNEA 4KO0A 5IT0A 4Z2XA 5KT3A 4JKCA 4O44A 3PJ9A 4OI4A 2DGWA 5ETSA 2CQHA 4JI7F 2N3OA 3FSIA 1CJTB 4FVMA 4CLZA 1YT3A 3HZEA 2YH0A 1EKEA 3QPIA 3EDRB 4GVBA 5G4DA 1UVLA 4OZ5A 5A8RA 2GS8A 1S0MA 3T9NA 3BSOA 1YUWA 3BZCA 1QY7A 4ZPCA 4BRMA 2EWHA 4OQJA 3AA2A 3I9ZA 4OI2A 3WXIA 1VQ4N 3SQ4A 2CZ4A 1P27B 2F4VF 3D0PA 4DPXA 3O8MA 2BM1A 3R9LA 2FF6A 1MSWD 5HQLA 3PG9A 4F36A 3DRRB 4FS2A 1HIYA 1D3WA 5EXWA 4F3TA 3KLEB 4YDXA 4YN3B 1HKAA 2ETJA 2ZC3A 3MR6A 1SKSA 2NLWA 2V8PA 2WC9A 4P75A 1VLOA 2P6SA 1DFDA 2W40A 5A8KA 4X4NA 3Q8RB 1N54B 2YVSA 2DYAA 3VQDA 3DGPB 4ZLJA 3KLHB 2LXUA 3QLHA 2D1KA 3ILLA 3D54A 4DUYF 1YI2N 1YVFA 1LAWA 5C0YA 4UTGA 4CE9A 2HLTA 4KKOA 3E66A 1V5VA 2VQFK 1M5KC 1Q8KA 3G87A 4E19A 1KCFA 3NNAA 2IC3A 2JEIA 2RF2A 3OBWA 4I7FA 2Z1JA 2J6UA 4FJGA 4L75A 2PFDA 4ED5A 3ENBA 4Z7CA 4OLBA 2PA8D 3NH0A 3H4DA 4FZXC 2L48A 1JJ2M 3OY9A 3OFGA 3TA0A 4LFCK 3FCHA 3J81U 3ZTSA 1BISA 4H0YB 4JI1K 4DV3K 4O23A 4FWOA 3ZETA 1IBMF 4NWBA 1KTVA 2CVIA 2J9EA 4ELTA 2VPWB 5LSOA 4FXWA 3C95A 4QW9A 4TU9A 4M63C 2BW7A 3QBWA 4KGMA 3PUFA 4RJVA 2QA4S 2FC0A 2QE5A 4M3RA 3M1VB 1FWLA 4M5IA 2JJ4D 1RWXB 3ALYA 4OX8A 1RAIB 4YHHJ 1VHXA 3VPZA 2DNKA 4GMKA 4PWDA 3H5SA 2MKJA 2XHBA 4CK3A 1FFWB 2DHSA 2DNRA 4CECA 5U47A 3SUQA 4MDAA 4GKJK 3IBFB 1G15A 2U1AA 2CQ2A 4PRFA 4NLDA 7FD1A 2C2RA 2RUSA 1RBVA 3M9MB 2RUGA 1L3KA 2UXCF 1RUSA 1XEZA 3BO4A 1X31C 3S7RA 1FRMA 4USHA 3JQJA 4X66J 4CJ7A 1N0VC 3MXHP 4AHSA 1QVFM 4NLSA 3AB4B 4FF2A 4RUCA 4CO2A 1CZAN 3J80O 3G96A 1W7AA 1HLWA 4IRDA 4RBVA 3US5A 2WB4A 4TN2A 2DFHA 4Q8EA 3VQ4A 2XMJA 3IWXA 1X7VA 3AJ2A 5AZIB 4ID5A 2ZOMA 3GL1A 2AJQA 2Q6BA 4YOWA 3GIMA 3WNGA 4TU8A 5C15A 2F65A 2FY1A 2FJVA 1B0TA 2B4OA 3GOIA 3TSPA 1FW6A 2B8PA 1BA1A 4X65J 4CO3A 4DV7J 4A4JA 2BJ7A 2HVIA 5AXLA 1Y5LB 3GB0A 5AQOA 4DV4J 1KBRA 4YHHK 3O3GA 3V6JA 3VA3A 3OTEA 1AFIA 2UV8G 1IJEB 1HNWK 3H0PA 4JKGB 1Q95G 1GMUA 2F8HA 2ZBCA 2WCXA 4P2XA 3F9KA 2W2PP 1H7XA 2F1FA 2FBYA 5AQLA 1UFLA 5DM7L 1FDDA 3GV8B 2P8IA 2ZITA 2VG6A 4AE5A 5M1KA 2KT3A 2HVHA 1U1MA 4GMJB 4E0DA 3L7OA 4ECRA 2PD1A 5GVQA 2BQRA 2R7OA 3A3NB 1BMQB 1BWEA 1ZA2B 3I8BA 5C25A 3BZKA 4YMEA 4KHRA 2QGFB 5EWEA 3JAMU 4LF9F 5BR8J 4BRHA 4HVJA 1RT2A 3G6YA 4QW8A 5KG1A 3AVAA 4AF1A 3W61A 1WWHA 5AE1A 3WQTA 3GLJA 1NU0A 4DL4A 4EBCA 4A47A 3T3FA 3SBTA 4JV0A 1ITPA 4UQGA 1VSMA 2OAUA 4WFNL 2HHHF 3EGNA 5HMWA 1FI4A 1KWMA 4OPHA 3FBBA 4USUA 1O13A 4UOCA 2FJEB 3AVKA 2HHVA 1VQ4S 4DPUA 5KFNA 1SXLA 3IWLA 1YLXA 4C3MA 1RBUA 2OD4A 1I6JA 2E5LJ 3D2WA 2OLWA 4NLWA 3DXMB 4CVNE 2H1YA 4KPCA 1S9EA 4QWAA 2O8FA 4GVMA 2MYFA 4AT1B 2MQLA 4MK8A 2O67A 3MX5A 3N01A 4WK1A 3I4HX 1M5SA 1YI2S 4A2BA 2A6MA 3FBFA 5CD4A 2CA9A 4YOVA 1JLFB 1S1VB 3T6JA 4OMFG 2VC1A 4WE1A 5CA5A 3WZ0A 5BR8K 2B6AA 4QYZJ 2FVCA 2E1YA 2JRSA 4ES1A 1FKOA 2HIQA 4DR1F 1NJXA 1X4AA 3W9JA 1HJOA 3ULDA 3PW2A 2QLJB 2F5GA 4WF9Q 1J6ZA 1W26A 3CF5L 3CXCM 4ZJQA 1RBLA 2ZZTA 1JB0C 1VK3A 3I0SB 2GX8A 4H5NA 5J2NA 2HOEA 2CPZA 1TVRB 4K4XA 1IM4A 3NH1A 3THXA 4O0JA 1JLEB 5IXUA 2OH2A 1WSEA 3S8SA 2AA4A 1H2TZ 2NXCA 2PSZA 1D8ZA 2QYGA 4NRTA 5DGAA 3CYMA 2PFUA 2DEJA 2KHCA 4HCBA 4P2FA 1JKHB 4ZA1A 2P9NA 3BH7B 1VSFA 1FKAF 2MQMA 2KJVA 3GIIA 3KG4A 2E5LK 3VGLA 4JI2F 4BRAA 4RW6B 3D6FB 5KFBA 2R8KA 2NQPA 4JKDA 3M2VB 1JMTA 4DV5F 2ITGA 3KG0A 4B1XB 4HLBA 4IO9Q 3THVA 2MZTA 3AGKA 4RNNA 1LWEB 5FDLA 3ICLA 1SJRA 5SUHA 1QS4A 3IFEA 4CERA 2Q36A 1IR1A 1NK4A 4PPZA 3SLCA 4JI6J 1RTIA 2V8HA 4LY7A 3QIPA 3OLAA 4WFBL 3RB6A 3VV2B 2WSCC 3VA0A 3LW5C 1I51B 4KHYA 1CXUA 2LQBA 3FMBA 3HP9A 3NGDA 4GKKF 4CF9A 3H5XA 4CH0S 2CGJA 1RHKB 4Y28C 2DHHA 1IBCB 1TYQB 2ACYA 2VG7A 3M6VA 2IAJB 4KR0B 4EWTA 4IBNA 1LCUA 4CJ3A 1C1BA 2OGUA 5HRNA 5B09A 3KKSA 3MUVP 5CZVA 4DR4J 1K0VA 2GMLA 3V6DA 1CG2A 3BZQA 2AX0A 4NA1A 4CH7A 1KRPA 4RBTA 3SCXA 4C11A 1W25A 2AJ4A 2V2QA 4CO4A 4DPTA 3NCPA 2PIIA 5JMVA 3TYTA 2VWJA 4DHVA 4IOCQ 3SXLA 2W9CA 3H08A 3LP1A 1NU4A 2E44A 3PW5A 2DK2A 4IZ9A 4B3MF 1VQNN 1U1QA 3WXMB 1Q8BA 3NGZA 1XMOK 5F8LA 4DFJA 1ZZFA 2NZCA 1U0HB 4CO5A 5T7LA 5C2GA 3C15A 3DLKB 1WG1A 3NOCA 4ERDA 4OKKA 2K2PA 4DCPB 3R5AA 3LAMA 2ASJA 3MUMP 1UFKA 3A5MC 1HFEL 4ZPBA 1QZ5A 4DLGA 4G1QA 4NO7A 5D3GB 2DKOB 1XR7A 3FDSA 4DTPA 3BKFA 1C0TA 4NLOA 5GAGI 3BYPA 3CB4A 5B0GA 4CZJA 2PBDA 1Y9OA 2WBRA 3IRXB 5KFXA 2VA2A 3P83D 2HFNA 3HSCA 3GDQA 5JUMA 1S77D 1PC4A 1QM9A 2HHTA 4DR4K 3JTOA 1VQKS 5AXKA 5GIOA 1HYSB 2CVEA 5FPDA 3HL8A 3CJ9A 2GVDA 3G0ZA 5H9FK 3CMES 4ZLNA 1IKXA 3ZNJ1 3CDUA 3D3CJ 5HLFA 4N7TA 2Z1IA 4C23A 3BP8A 5B0EA 3Q2TC 5I3UB 2WFBA 3IWNC 4Y3CA 4CGJA 2WRMA 5KFOA 1F21A 3BB5A 4XDDA 4KHNA 1MLAA 2KZMA 3ZT2A 4OGEA 4M1KA 4NX9A 4JLHA 5CYQB 2RRBA 3O4WA 2FGOA 2QO3A 4CD3A 1HWIA 2NYIA 3HSDA 5EUHA 1EX4A 4CO0A 6FD1A 3CFOA 5KFGA 3PX4A 4K4VA 1XI1A 4ED3A 3MMBA 1R0BG 1CJKA 5LSLA 1UWBB 4Z94A 2BMBA 4BC9A 5BPMA 4CEQA 1QSSA 3RBXA 4OX7A 2QMXA 3RR8A 1OPIA 4J8FA 4FWSA 1KQGB 4PKIA 2AJ1A 3MPYA 2IVFB 2MZSA 3FBCA 3CJBA 3SV3A 2IMWP 1CQNA 3CJKB 2C2ZB 2ZGYA 3V6KA 2P6TA 2CYYA 2Q79A 1YJ9N 1R43A 1HBUA 2J8SA 4K25A 1N34J 3CPWR 1KD1T 3EXYA 2D3O1 3DLRA 1SB6A 1VI7A 3TAMA 1I94F 2DNHA 1U1LA 2D74B 2FB0A 1EHWA 1S99A 5L9XA 2BEFA 4CLPA 4R79A 2ZM6F 3WXJA 3CCRN 4CK2A 2DNQA 4IOXA 4CHYA 1N6QB 2HSTA 1E6VA 1Q9YA 3TX8A 4CH1A 2ZZNA 2X6SA 5MLCV 3L3CA 4KHWA 3HULA 3EPIA 1T3NA 1T9VA 2NUHA 2WTFA 2J7WA 3M6WA 3ZT3A 1Q8IA 4G1IA 2O8EB 1JK9B 2CJBA 3A8YA 5KAKA 4HHTA 5AQSA 3G86A 1I1GA 3OVAA 3ZZUA 3U9DA 3QFPA 2J76E 5IT9U 4RW8B 5HVHA 4LFAK 3S1TA 3S3OA 1HKCA 3A12A 4E2FB 3M7VA 2OJ3A 2ZWHA 4DR5F 3PYGA 3QFHA 5K20B 4YR3A 4DL2A 4B9SA 3WQUA 2ATQA 2AZ3A 1Q81O 1FF2A 1RWMB 5HRPA 3MFIA 1ZM2A 3OJUA 3PFEA 3SSRA 2UXDJ 4DQQA 1RTZA 1B0PA 3D0HE 1DLOA 3T5JA 2DR8A 3MM9B 2EW9A 2ASDA 4PHTX 4DUZK 3ENAA 2NNWA 3LPYA 4IOBA 4I4BA 5KGWA 2B7BB 1TL5A 1GLAG 4IOCL 3J7AN 3KVGA 3CC7N 2YNGA 4Z4HA 3P1GA 2WVFA 1OYEA 3CQYA 4M45A 3C7NA 4WFAL 2E1AA 1RABB 4DWIA 3DJCA 4N8OA 1IKWA 5JICA 2XI3A 2BE7D 2YHXA 1K6YA 2E9TA 3GFYA 2NCKL 4PKGA 1G7CB 1F9HA 1MWYA 4OHVA 1T05A 5BYSA 1TL7B 4BG9A 3VMFB 1RKJA 2H5EA 2VPXB 5KFTA 4OLOA 1GXLA 1O51A 4C1NK 2FJBB 3NKYA 4L74A 1KN6A 5DZ7A 1VQNS 2RU9A 3TJ9A 5AT1B 3MM8A 5BPNA 4CGIA 3HHEA 3ITHA 4UQTA 4OHWA 3GR0A 4M3ZA 4B3OB 1KKHA 2PGCA 3H2UB 1Z26A 3KJVA 5D0EA 1CPZA 2ZBPA 2B4VA 1V3SA 2CQPA 5DDQC 3N0VA 1WD6A 3SAGA 4N76A 4TY8B 2O8BA 3M9NB 1QVGR 4O55A 2FVPA 1X4DA 4K4ZA 2K1RA 1TELA 2XMUA 2VOOA 4DR7J 1M1KO 4CLSA 1X5SA 2WSEC 4P10A 1I3AA 1WELA 1JLGA 3T19A 2C2OB 3ULEA 4B08A 2VFSA 1DEJA 5CCMA 4CTAB 4XH4A 4CHPA 3QFWA 1U48A 1YZ6A 4AL7A 2BGGA 2MGZB 4QOZB 3MMAB 2ILYA 3SZ2A 4MIWA 3CIMA 4CLFA 4CFCA 4FK0A 2KB2A 4JI4K 3OYJA 1Y7PA 3JAMO 3TNVA 2ZH3A 4PG8A 3L8BA 4XK8C 2QWNA 3TAEA 4BBYA 2QFIA 1SJ3P 2H5JB 3W5XA 1Y4ZB 1EETB 5KT5A 2QA4G 1OMSA 1X4HA 4CZGA 2W6LA 4ID1A 4B17A 1VBXA 3WX4A 3NAHA 2XSFA 1RJJA 2W4CA 2I7PA 1WEXA 3C2PA 1APSA 3OS0A 3UN2A 5B08A 2P9CA 4DPWA 2Y8YA 3KK1A 2GMJA 3CJ3A 2MY7A 3VAHA 4ZVOB 2H65B 3UFCX 1WOSA 4F3OA 2KJWA 3DOMB 4E8UA 2ZJQQ 4A46A 4GVEA 2JC0A 1EP4B 2AGQA 2HHQA 4PQUA 3P5BP 4OV6A 4DR7K 4YB5A 4YHHF 4QU7A 1A5WA 5HN0A 4BRKA 3TR5A 4RW4A 1FNMA 4CD1A 1SI9A 2LFVA 4OFZA 2ZJPL 3NWRA 1U1NA 4DU7A 3CCTA 1A0OB 3OTOJ 4ILJA 4M7XA 5KPZA 1YJ9S 3VEVA 1K44A 2FD2A 4M5JA 3C6HA 1KHWA 3N6MA 2Y9HA 3LDSA 4KB7A 2CXEA 4U7CA 3GP9A 4DTXA 2XS2A 2HHXA 2WSFC 2BOAA 4X66F 4IUFA 4KV8B 2DNGA 4M41A 3CCRS 2PEBA 4A48A 3SJHA 2YV0X 2E1RA 2CH6A 4C48A 3EVOA 2OIHA 3NCIA 2UXBJ 5ETOA 2IVPA 3OLBA 5LJWA 4AFFA 1FKPA 2Y3YA 1Q86O 3A8EA 2I0XA 4BRPA 1UPMB 4KRFA 2CQGA 4A8WA 4X65F 1YHQN 4DI6A 2QKKA 4U8YA 4DV7F 1DZ5A 1WOPA 4YB1P 3POTA 4CZFA 2BZ2A 3MEGB 4BG8A 4NI2B 4DV4F 4B9MA 3KWIA 3UDEA 2HGLA 1BOTO 2KI2A 1JLCB 2BOPA 4X4VA 1WKKA 2W2QP 5E41A 4ECSA 4XAKA 2KM8C 2N3LA 3WEEB 2IVYA 2DO0A 1DGKN 3B6OA 2KG0A 3N28A 4CI0B 4P2SA 1AA1B 1QE1A 1GLDG 1CZBA 4ISGA 1Q7LB 4IYQA 2P9IB 1VS3A 4CJEA 3GE9A 2EVZA 4QCLA 1W2IA 2XYPB 3W2WA 3B78A 5IWAJ 3CC7S 3QWPA 2QK9A 2AEJA 2XM3A 4EEYA 2DTUA 5KOWA 2XB2D 4HDHA 4KH6A 3BSAA 1AZSB 2J0SD 3L3UA 1CEZA 4AHTA 5JS1A 3MCAB 1N8RO 3VEWA 2YBVA 3FRZA 1VC6A 2EFPA 2KVQE 3Q8QB 1B7FA 1DTTB 5BR8F 1VR6A 5E3PA 4C1NI 4GC7A 3M8PA 1N4LA 3I6PA 1NOZA 2UXBK 1PIEA 2YXLA 2E66A 2IDEA 3OYNA 3PNIA 5H1SV 3M8RA 3L95X 4CGGA 4PG4A 4AILC 1HX1A 3CNQP 4EBEA 2RAQA 4X4OA 4RLEA 4C6AA 3PO4A 5CQGA 2IPOB 2YHWA 3R5DA 5I42B 2ZDOA 1VQ6N 3D6RA 3KLIA 2VGMA 3OT9A 1CC7A 3ID8A 3PY8A 3VVUA 3J80Y 2OUGA 4FLZA 1RT5A 4I2QB 1RYSA 4NA2A 1VISA 3TA1A 2D7SA 5HANA 4JI8J 2UUAJ 4IOAQ 2E5LF 1D9AA 4DQPA 3OUYB 1XN9A 2KQ2A 3IUCA 4DF8A 5AZJA 2DNYA 4HTIA 2OEJA 5A0YB 3F9MA 3ZTPA 2YNHA 2VDIA 4CWBA 5IWAK 3NRBA 2R7YA 4LVNP 1WHWA 3O4QA 4J2AA 2YHAA 1HW8A 4JK8A 2B9YA 4OZ1A 1L3SA 5E7OB 4F4YA 2IFXA 4C7QA 2DPIA 4DSJA 5ETRA 3O2IA 2QWLA 2X6NA 2V4QA 4M8LA 4WXOA 4TLQA 3NXZA 3ENOA 2MQ8A 4FCYA 3BGRA 3D68A 4BGBA 2DY4A 4FPIA 3OXFA 1Q7YT 3DRPB 3GWCA 3CERA 3ENHA 1FNXH 3CTRA 4C3KA 4HACB 1FE4A 4UZCA 1T03B 1WNSA 3UVJB 4KGVB 1YAGA 1NJIT 3FQKA 1GMVA 4P9SA 5CY4A 3VTIA 1DRZA 4BRDA 4ZPTR 4JI8K 3JTPA 3EPGA 1RHRB 3L9ZA 4X4UA 1RTDB 1C1CA 4KSEB 2OTLN 4BC5A 1U24A 3TANA 3NF7A 5LMNJ 1RBOB 1T9UA 3QT7A 1ZPVA 2YX1A 4HUGA 2QWRA 4B3RK 3F44A 3DMJB 4H0VB 4PCQA 3AO1A 2IVNA 2QI2A 4FW2A 2PMHA 5AJ3J 1XMQJ 1B92A 1UEVA 2B9XA 3SMZA 3LP2A 1UZDA 3VQPA 4JI6F 1AB8A 3O6WA 3BDPA 5KFHA 1CLFA 3FCWA 4CI6A 3TZYA 1RT7A 3RBZA 2CH5A 2EPIA 3W5ZA 1WHYA 2SXLA 1YJ7A 4LBHA 3QSYB 4LF4J 1UAWA 8RUCA 4ILRA 1RQ0A 1WF1A 2DNZA 1S6OA 2XO6A 3IGNA 4JD2A 5DMRA 1JL1A 4UOGA 1RT1B 1RT3B 4FJNA 1RHQB 1QUPA 4KY3A 3J8AA 2VU5A 3U02A 3SDEA 1B0VA 2ACMA 3WDOA 1JNRB 4LR8A 3VWSA 1RTHB 2QW9A 3KG1A 4DR4F 1SCJB 4HHUA 1X3NA 1CXQA 4ED2A 3I5CA 1NGJA 3HZGA 3MX2A 3ZT0A 4UOFA 1OJ4A 1YHQS 2AD9A 4KO0B 3QMLA 1C0UA 3R5JB 4O44B 2BABA 1S72N 3AVIA 4A8XA 1XIQA 1YITN 5LMNK 4X64J 3VTHA 4CJSA 3CJTA 1PJ7A 2ERRA 5EWFA 4BRLA 3NF8A 1Q18A 4MO5A 4GVBB 5AJ3K 3DHWC 5A8RB 2Z58B 1KVIA 4AXIA 3TW0A 3HHDA 3TWHA 3Q0AA 3SMSA 1LQ9A 4IH6A 3HLUA 1NZAA 1HPZA 3R7NB 3FZKA 2HFOA 1Z6RA 2VASA 2NPIA 4I6WA 3U1LA 1KNZA 1VSDA 2YKMB 3MCPA 1Q0NA 3U6FA 1AYEA 2DNNA 3CULA 1Y97A 2ZOGA 4WCEQ 4KHUA 4FVUA 1YRXA 1BWFO 2MKCA 3AVJA 1CS4A 2KHDA 3RYLA 1LK5A 2RKIA 1Q82O 3THPA 3EE9A 4EFHA 4C0BA 4M63A 4F8RA 4DR3J 3PCOB 3ZZPA 1KLNA 1S6UA 3QLHB 1DJ0A 4V19S 4PG5A 1ESVA 3B6BA 3A5NC 3O5TB 3DXSX 1U25A 4KH1B 4KKOB 2LP4A 2EI5A 4CHNA 4AL5A 2V7ZA 2F9DA 4FWKA 1UJ4A 2IC3B 2MKHA 2RF2B 2O01C 4I7FB 3QNWB 1VQ6S 4YB6A 4MKYA 1VSHA 3E1YA 1OY6A 3BH6B 3HPOA 3C14A 3PX6A 1H72C 3EN9A 5HP1A 5THWA 2W7PA 3GG4A 2GCFA 3E01A 2V67A 1TTHB 4UY85 3ZETB 2M52A 4PYAA 4B9QA 2JEGA 3RVCA 4OVLA 1TK8A 1BA0A 2GBZA 3MMCA 3FCVA 1HWLA 4KB0A 1BIUA 2G8WA 1F6TA 2X51A 3OYKA 3SPYA 3DRYA 3AJ1A 4H54A 4KJIA 3LA0A 4YOYA 5DGBA 2ZH5A 3GE1A 3RMCA 4YFUA 1MG7A 3CCUS 2W2MP 4FF1A 1J5OA 3RR7A 2XZDB 3T1YK 1S6PB 1N34F 4PWDB 1UWAA 2ALYB 2DEIA 4NXMK 2HFZA 2FIUA 3JXUA 2ZVSA 4ECYA 1DKGD 5LL6d 3SBMA 2C3PA 4J37A 4USTA 3ZSQA 2XSJA 5E2QA 5DRKA 1NLKL 4LF7J 1WN7A 5EGYA 3I82A 4PABA 2XZWA 4U67Q 5KPRA 2OEMA 3AVHA 2L9DA 5B0DA 3T69A 3CD7A 3LO3A 4CM2A 3KJFB 3Q89A 4RX6A 1U09A 4KGXB 3KJNB 3ZSWA 2OTLS 3GFHA 3JTNA 2MKSA 5A2QO 3HCXA 3K7RA 3FGVA 5KFIA 5IQ6A 1R7IA 2BX6A 3CIZA 2MJNA 1VJWA 1YX2A 1S1VA 4ID5B 4IRKA 1XK8A 4NZ7A 5D77A 3AARA 4PG7A 4L3KA 3LGHA 3CJ7A 3CJSA 2JWNA 3ILIA 2JFKA 3L4BC 2KRBA 2D4WA 4OYXA 3DU6A 3AHPA 4WBFA 2ROEA 2UXDF 4QIGA 3MHYA 4CZMA 4WU3A 1FRXA 3I0SA 1RDCA 5CHCB 2V50A 3G82A 1IJJA 3T1HK 1JLEA 2DD8S 3KDOA 2EC0A 4U7UD 4M5HA 3BGOP 2HBKA 4O3NA 2H5IB 3X1LB 1HNZK 3BEGB 3VETA 2VG6B 1RHMB 1BDGA 3CO0P 3NG8A 4BCAA 1YJNN 2W8LA 5ETQA 3MN6A 2N4CA 3PYFA 3BO2A 4NLQA 2MZQA 2PAVA 1L3TA 5C25B 3VQ9A 2AYBA 3LM9A 3EZ5A 2N7CA 1VAZA 3QNOA 3VVTA 1BE4A 1JNZB 2CJYB 5B7WA 1H1VA 1S72S 2P9EA 3ZFVA 1SS6A 3WNEA 1YITS 1SH2A 4KTZA 3ZZOA 3JB9k 2HYIB 3VN5A 3MAAA 4H5WA 1FXDA 1U02A 2B4UA 4FPAA 1RP5A 2F9JA 3DRSB 1NGAA 2M5YA 2OELA 3ZT4A 3N5FA 2UV8A 5ADXH 1TR0A 3DLEA 4M5DA 4DEZA 2YJEA 1U6FA 2YPZA 3LDQA 1VCTA 4J7CA 4DR7F 4PKHA 2FYXA 1GH8A 4P73A 1NSPA 2CZVC 4DV2J 3TI0A 3GPAA 2KYZA 1WG4A 5AXMA 4LSNA 4ENOA 2GGPA 5TKWA 3QNNA 4CLUA 2G8UA 1S9EB 4IFVA 1NKCA 1X5TA 3DC2A 4A2AA 3EMTA 2V8GA 3FUYA 2WBMA 1HNIA 5SWMA 1X9MA 3J7A1 5B0CA 5GMKa 4K8ZA 4R8UA 2C3YA 2VA3A 3OA9A 4ID8A 1K47A 1QJHA 4B3SJ 2UU9J 3CD5A 1VQ7N 4U7BA 4R25A 1EO1A 1NK0A 3VQ6A 5M1FA 1JCEA 2JX2A 2MPUA 1FKOB 4ZIWA 2MZJA 1N36J 4IDHA 4P7TA 3VQ7A 4CF2A 3UDLA 2OSRA 1TQLA 1C4AA 1T9YA 2FBXA 1B3TA 3VF6A 1FK9A 3HJVA 5JS2A 3L4QA 3M05A 2QN6B 1NAQA 1ZTTA 3VEYA 1S59A 5J2NB 1IH7A 3RAMA 4O5FA 4OYOA 2NREA 3CFPA 1XR5A 1GX5A 2BJ8A 5L1IA 1TAQA 2WVBA 4K8XA 1TKZA 1R0CB 5AE3A 5CZ1A 1VK8A 1FHTA 3E9PA 3P45B 5HAOA 3IRXA 4V1Ak 3PKYA 2P9NB 1ZZNA 4ZPAA 4JV5J 1GX6A 1VYAA 2OFGX 2NXEA 4HI2A 4O3RA 3K5OA 2CNLB 2YWWA 3OYMA 2Q2RA 4EO8A 4H4OB 3UE5A 4AHVA 3OTOF 4DG1A 3VF0B 3AVNA 3W8GA 4C8LA 1IN0A 5L1LA 1LOTB 5FDLB 2FQQB 2CPDA 5BRHA 2VHGA 2NZ4A 3DDNA 5I3UA 1S9GA 5A6PA 4BQLA 3ET6A 3D9BA 4XEIA 3I33A 2CQ0A 2UU9K 1RTIB 2LQ9A 3FSXA 1RADB 3V9WA 3K89A 3QIPB 4ZITA 4EUVA 5F8JA 1IWAA 2HPUA 4K4YA 1VLYA 3D5MA 2GO9A 3NHGA 3AO2A 3NL0A 2KXFA 4BRFA 3MDFA 3OFEA 3BUZB 2UXBF 3DXKA 3JAMY 1Q81T 2VG7B 3O9QA 1R8HA 4A8QA 4OI3A 2JL9A 4EI2A 1C0GA 1S1WA 1QQNA 3WNHA 1UTAA 4K7QA 1C1BB 3PEHA 1C6VA 4IQXA 3CETA 3H2VE 2QMWA 4ILMA 3OQ2A 2WHOA 3V6DB 3SBGA 1PAUB 4CHOA 4NYFA 3R6GB 2DIVA 2HAFA 3PVXA 4C11B 5L1JA 4JV5K 3DLBA 3MZIA 4KI4A 2I6WA 1X4BA 5JVGQ 1ZOTA 1JJCB 4D3GA 1P6TA 2W9CB 3LP1B 3VQSA 4IFEA 2OPPA 1QTNB 1W7WA 1B64A 2MQOA 1VQLN 1FVQA 2B4JA 4OPJA 4B1UB 5AQJA 3HTVA 3C0BA 2F4FA 1WAFA 3V9ZA 4FZVA 4ED7A 5IWAF 3TABA 3ZX0A 2HHPA 3C15B 2ABYA 3DM2A 2DNMA 3IR7B 3KHLA 2A1BA 3CIPA 3U1MA 4LH4A 4PXDA 4BR2A 2GELA 2B9WA 3HHKA 3PRDA 4K50A 1HJRA 4K4UA 1RWWB 1FXRA 3P4UB 4WQ5C 4G1QB 2A0FB 1RAJA 2R7WA 3NGIA 3N9UC 5E3QA 1YJNS 3AV9A 2HBQB 1WAJA 3OVNA 1C0TB 3MPVA 1OPZA 5DJBA 1HRHA 2Z2MA 3J7Z5 1OS5A 3QJLA 1NJZA 5L39A 4PXBA 2U2FA 3RWUA 1C4CA 5D4NA 2E1MC 2WOMA 4R0EA 4HYKA 1RDDA 1T9XA 4Q2MA 4DV6J 1QQOA 2EK1A 2E5GA 5KG2A 2GVDB 4W5QA 2MB0B 3Q86A 2LCWA 1IKXB 2GQCA 3BGFA 4RNOA 1VQ5N 4K43A 1WORA 4BDPA 2QLFB 4JI8F 3VQEA 2HB5A 2KFYA 2EEYA 4A62A 3QJPA 1ZAVA 4G6VB 4CHZA 4FOEA 2J0XA 3QATA 4OKEA 3HXMA 2JVOA 4DU8A 2FLOA 4EIAA 2R7UA 2QEXN 1S3XA 3DLLL 4P72A 3HI9A 2UXCK 4RG8A 3WXLA 1VSEA 1RSCA 2HGNA 3CQXA 1S1UA 2V51B 3FZ2A 4WU2A 3MMBB 1J53A 2W42A 1CJKB 3KDNA 2XMMA 2RD5C 3MEEA 2QL5B 3DYAA 3CO9A 5KRSA 1UVKA 1ZA1B 1BUPA 1SQKA 2GO8A 4CM0A 2GX9A 3GR1A 8ATCB 2I1RA 1EKSA 3CM6A 1VQ7S 1TK5A 1TP7A 3TZWA 1HBUB 3FJ2A 2B0GA 2J4RA 1M1HA 4KH5A 4FJKA 3TQ1A 1M5PC 5K8OA 1FJGJ 4B3OA 5J2PA 1WBBA 2ZD1A 1UMJA 4DV6K 4EBDA 3TAMB 2AYEA 2G2YA 4DX6A 1J2VA 2MSTA 4BGAA 4MO4A 3OS1A 3AVFA 3Q8UA 4ELUA 1HHSA 1C2PA 2UUWA 3V1QA 1GFWB 4N41A 5I4MA 3MXMA 1E6VB 3IS9A 4NYOA 3AO4A 5FROA 4CTAA 1HNVA 5KG6A 5LMNF 4LD0A 4A8MP 2B5JA 5F2RA 4BREA 1WKJA 2E7VA 3SQ2A 3CHWA 5AQKA 3KMSA 1S76D 4NPOA 2E29A 5AQUA 5AJ3F 1XMQF 3A8IA 3MD1A 3R7SB 1QD1A 5ETNA 2DXEA 3JS6A 1HR0J 2HQFA 1XNQJ 2OTJN 5E5NA 2IA0A 3THYA 3THTA 3W9IA 5GADU 3KIOA 1YSJA 2AF6A 2WVEA 1FRJA 3CCZA 3QEXA 4LF9K 4ECVA 4LF4F 3IMQJ 1A5VA 2X7IA 3KXDA 3MPUB 4JI3J 2F9WA 4CEBA 4CZHA 2R9LA 3TQEA 1Q79A 4H0PA 4A5BA 1DT9A 3W63A 3ONQA 3LZIA 2FZGB 2ZE2A 5IC4B 1DLOB 3AAQA 4ED0A 1JJ2R 4R5PA 4J9LA 2HBRB 3TSUA 1O1WA 3KKFA 4CBWA 3J80U 9ATCB 1YJRA 5JVGL 2ZDPA 2YNGB 1D8YA 2XYHB 3AVCA 4DBQA 3G2XA 3TA2A 3W3SA 3CCJN 1KEKA 1VDHA 1KD1O 1WSFA 3O9TA 3C7NB 3VGKA 2I7NA 2IM3A 2XWYA 2W7AA 3A5LC 1IKWB 5KFMA 1LFWA 2RIJA 4Y1CA 2M3DA 2CIMA 1NJWA 2NLXA 3M32A 3H3NO 4BWJA 2CJKA 2ZJRL 2FLPA 4WQ4C 4DTOA 3Q8PB 4X64F 1T05B 3T1AA 2ZKUA 4ITSA 2ALZA 3MM7A 3P4IA 2DVIA 1RI7A 4TXSA 4KRWA 1ACMB 1ZM9A 1N8RT 3SCJE 2M70A 5KG5A 1HR0K 1REVA 3QMQA 4OPAA 1VQLS 5JLHA 3MM8B 2IMOA 3ZZTA 4NLRA 5AQRA 3ITHB 3VAIA 4GC6A 3H42A 1NK7A 3S6EA 4Z4IA 2DO4A 1LNQA 4ZK7M 4C0OC 2OP5A 3KJVB 3VEOA 1RWUA 5B8HA 3CPWM 5F9NA 1SL0A 4B8AB 2OEKA 5A8WA 4KGZB 2O8BB 4DU4A 2VFTA 4GV3A 3U3YA 2POKA 2VFUA 5BPLA 3IFRA 2XGQA 2K1RB 4J9MA 4DR3F 1JLGB 3W5YA 3PIOL 2VGNA 3WXKA 3MURP 3CI5A 4F0HA 3SSQA 4NI2A 2LMIA 2KKHA 1U4BA 2KT5A 1HLUA 4PL7A 1TAUA 4FPBA 4MYUA 3GILA 5CABA 1S97A 1T9TA 5F8GA 2LEAA 1NB7A 4HT5A 3WNFA 2Y1JA 4H4MA 1RWVB 4QWBA 3BM7A 2V6AA 4DV5K 4DTJA 4B1WB 3EVMA 1IXKA 3W0LA 1VQ5S 2F96A 2O4IA 2XG8A 5HBMA 1NB2A 3P3DA 3JYTA 3A2FA 1K8KA 1H98A 2EC2A 3ZSOA 4H4KC 3QB0A 3EEQA 2KFZA 1TUUA 5C2FA 3K57A 3NBPA 3JQKA 5TKYA 2IHR1 4JKBA 2DGSA 4NYNA 2DNPA 3RBDA 2CZ9A 3QBCA 5ADZA 2FBTA 2QEXS 1AW0A 4AQYJ 3KK1B 1EKRA 2H51B 3IRWP 8AT1B 3MWBA 4GKKK 3H2LA 3VF2A 2BM0A 1NKEA 2FXUA 3CC2N 2J7UA 4FNHA 5KG3A 3UR0A 1X5OA 3F5TA 5F8HA 1DAXA 5IOLA 1BO5O 1WC4A 5HJXA 4DV0J 3K17A 2G8FA 3SYZA 2E6MA 4RW4B 3GJSB 1WF0A 3QO9B 4I1TA 4BY9C 5I42A 2NUUG 4C97A 1NK5A 4BC7A 4MK7A 3SUNA 1S6QA 4RNMA 4LF7F 4ZHRA 4UT4A 3BPSP 4QYRA 4ZOSA 2OD6A 4B9NA 5EOYA 2G0CA 3O9UA 3L7UA 1V3RA 3FZMA 4NASA 4JS5A 2Z2ZA 2RHKA 2G8IA 2HLUA 4QPXA 4DR2J 2Y1IA 5CXTA 1NG9A 4QPTA 4KB1A 2CPJA 1IUJA 2WW4A 1S5JA 2VFVA 3TEHB 5HVFA 1HKGA 1CC8A 4G1PA 2QA4N 2R42A 3CCLN 3W3DA 3TPQA 4I9QA 3S01A 1FKPB 3CG7A 4LMZA 1QVGM 3QGHA 4N56A 3OR2B 2PZSA 3NH2A 3H1VX 3EGZA 2Y1LB 2RDIA 2HW3A 3HM8A 3POTB 5F3TA 2PN6A 2OTJS 5C2DA 1D9DA 1RAAB 1EB0A 4F9OA 3H25A 4DX5A 3MWTA 3OYIA 3HP6A 3DRPA 2M8HA 4RW7A 4KREA 1NBWA 1SUQA 3H3OB 4FK4A 3C94A 2QT7A 4GW6A 4HACA 3ZZYA 1BD6A 4F3QA 4LSLB 3H5UA 2DJWA 1R8AA 1HD1A 1UEUA 2Q0UA 3W2WB 5GMEA 4V19X 2OPSA 3GIKA 2EKNA 4RTFD 3AA4A 4LF6J 3CCJS 5BYQA 4FWMA 4NXNJ 2ZH4A 2GQQA 2HNYA 2H54B 1LXNA 3P49B 4EO6A 4OJGA 3KHGA 2UVVA 3ILJA 1KS2A 1KC8T 1LW2A 3OW2R 3CPEA 4Z0UA 3J7ZO 4W5RA 4E7HA 3SQOP 1HBNA 5E0OA 4J2EA 4O0IA 4TU7A 1HBOA 2P9KA 1RU1A 3LGNA 3HM9A 1D4XA 4BR9A 4B9LA 4E7KA 2W9AA 2QA2A 3AVGA 2LECA 2CJ9A 1WUAA 2X78A 3KLIB 1ZBSA 4QIWD 2WVDA 5GINA 3U3GA 5A2QY 3LWLA 3CJ1A 1RT3A 2BR0A 2A3ZA 3VQAA 1HARA 1WOQA 3ZSXA 1UEKA 5H9EK 4CJPA 4BRCA 4DV2F 1KLMA 2D3ZA 1F9FA 2Q97A 1I94K 1YIJN 2KL8A 4URGA 3D0IE 3K0SA 5AZJB 2W25A 4LRBA 1N56A 1F5AA 2EX3A 2GUPA 2ZM6K 3PXGa 3QINA 3UCZP 2JH3A 3MPDA 5ETMA 4ZVHA 2VONA 2QWMA 3DNCA 3A13A 2GVZA 4LF6K 1RAFB 4AM7A 2CUYA 4CGFA 3IDHA 4DSLA 4NEYA 3AXMA 3Q7BA 5AQZA 3FLCO 2BA9A 4B3SF 2UU9F 3AY0A 3MPWA 2DPNA 2BE2A 1VSKA 5DM7Q 1BHLA 3HO1A 2KXHA 4LREA 1EX8A 4ZP9A 1N36F 3ATUA 3E2EA 3ZZ0A 5ETTA 2MKKA 1DARA 4ECXA 3DCAA 3TX0A 2LQ8A 1PG5B 3HZ6A 4OJHA 3BGRB 4DR5K 4F2SA 2O8DA 2J6TA 1RA6A 4BRNA 3AAPA 3BR9A 3SFGA 3V9XA 4HKQA 3G71N 1QQCA 5KT2A 2XMTA 3MECA 3TTCA 2YKMA 2LYVA 2DH8A 3PDNA 1MWKA 2ZKTA 2HNDB 3AGRA 3P5JA 1MA9B 2CJAA 3R1XA 4WZQA 5F9LA 4JV5F 4OYPA 3TJ8A 3OYHA 4LRCA 1NDLA 1UPPA 4KYZA 1C1CB 4WFNQ 4Y65A 5D6GA 3CC2S 3OPKA 5KFAA 2B9EA 1WI6A 3PSIA 4HH1A 1KSPA 4FW1A 1QHTA 3VESA 1TK0A 1VGYA 2C42A 4ED1A 4KHQA 2GWKA 1KP6A 4JB8B 4KAZA 5LM7E 1A7GE 3LP2B 3FVYA 2R7XA 2XULA 4USKA 4USMA 4DSEA 3TO8A 1DQ8A 1GTEA 4FZYA 3QDKA 2K8GA 1V4SA 4USVA 3KKRA 2NSCA 4GY2B 1VRUA 1RT7B 1VQMN 4FKXA 4EAHD 5E3RA 2AMCB 3QWUA 3PSFA 2C3MA 4JD2B 1QSYA 4RWWA 2Q31A 1MMDA 2ASLA 2XMWA 3FZHA 5DG8A 3SDEB 4JKHA 3CCLS 2RH3A 4LFBJ 1OSDA 4ZDNA 1WSHA 1S6PA 1Q7YO 4NLCA 1RK8A 3CF5Q 1BQNA 4CK1A 2ZNZA 3C16A 2GMHA 3MOJB 3BQ0A 5RUBA 2E2QA 3T5HA 5LXRA 1WG5A 5C2CA 1C0UB 4Z4EA 1ZAWA 2HS0A 3MD3A 1NJIO 4TSXA 2A6AA 1UKUA 2QTWA 4HVZA 4YORA 2MLZA 4M95A 2DRBA 2ILZA 3HKWA 1CBKA 4ZVEA 2DCUB 4S0MA 5LL6Z 3NMUA 4LR7A 3FZFA 3RSEA 3N4PA 1GT8A 3V1OA 3PLAA 4ES3A 3VGMA 4EZ6A 4K42A 3OL9A 2ASYA 3D67A 4JK9A 2C2NA 1S48A 3ILOA 2H4WB 2DPJA 2V52B 4CJLA 4EP4A 4HCCA 1WC1A 2N7YA 3BBCA 1X9WA 4FPRA 1HPZB 1SBRA 2MZRA 1LOUA 3HOSA 2Z8QA 5B0FA 3DOKA 4QOTA 3WT0A 2G1DA 2JLEA 3TZZA 3WIUA 3Q83A 2ASOA 4YS2A 2OCEA 3FMWA 4YEAA 2XTJP 2AP1A 2RNEA 5AQNA 3NS5A 2F63A 3CUNA 1CS4B 5DQIA 2P9LA 2RKIB 1S4FA 4WFBQ 2JNJA 2VV5A 3EX7B 4O4GA 1SJ1A 2BJ1A 4DTUA 2N4DA 5H1SQ 5GADI 1O5JA 4FS1A 3NDKA 4DV6F 4AM6A 1N5YB 1XMBA 3FK4A 3SQ0A 5AQQA 2V8VA 2G4BA 4ISEA 1B70B 2FJAB 3VGUA 3NNHA 2G8HA 3KMQA 4E7IA 3D4JA 5IS2A 4DS5A 1UW9A 2MLXA 1DY3A 4X4QA 5DLFA 1VK0A 3NCRA 2GFFA 3C14B 1IKYA 3KUHA 4C4WA 1YJTA 1GLJO 5DZ6A 1KONA 2P5VA 5HP1B 3D2EA 2COLA 2IJFA 3E01B 3UKRA 3CFRA 3OTDA 3BEXA 2L3MA 1YIJS 4RUBA 2MTLA 2PEHA 3MMCB 4X66K 5EX0A 3AVMA 4ANEA 5KFUA 3GV5B 5CHIA 4CRJA 4DU1A 1JLQA 3C6TB 1GLCG 4B9UA 4LIRA 3KK3A 2QSWA 3IR5B 3MM6A 2R2UA 3TTDA 1ITGA 3VR1A 3UD3P 2BKPA 3AD8C 3PHEA 1J5OB 4XO0A 1VQKN 3BJYA 1M5VC 2BKNA 2FHJD 4OV1A 1B9FA 2JVRA 1X4FA 3CMEN 4AL6A 2DH7A 1FJGF 4MDBA 1N5VA 2WUSA 4X65K 3DRSA 3MTKA 1LAVA 4DV7K 2F8MA 3CE8A 4N5SA 3G8TA 1Q5VA 3AA3A 4QR1A 3DXBA 4NMXA 4DV4K 4NCGB 4DFMA 1R0AA 2XSJB 5BXIA 2ADBA 3J7YP 3G71S 1PYOB 2IY5B 4O8UA 3ZZZA 5C42A 1NH7A 3BQ2A 3UD4P 2QLWA 7AT1B 1OQ3A 2M8DB 2HHSA 1JJHA 2ZH9A 1MN9A 2HVEA 1XHZA 3MEKA 1FA0A 4ZP6A 4RPFA 1NWKA 4YP3A 1HR0F 1XNQF 4EP5A 1HQUA 3QAUA 2VQEJ 1NGDA 3EJMA 2VBYA 3OHAA 2CPFA 2UUBJ 3HHLC 3DI6A 3UN5A 4HEA9 1W0HA 3TOQA 4IXCA 1GMWD 1XQSC 5HJYA 3M8SA 5F0WA 4JI3F 2IYIA 4OZ2A 4U6PA 1WLJA 4ZVUB 2JFDA 5K8MA 1DQ9A 3A4TA 3V5RA 1RISA 4D3HA 2F8EX 3KK2B 3HRGA 3MK6A 3VEZA 2NRZA 1IKVA 1VQMS 2KG1A 1NSQA 1BIZA 5J2QA 2CPXA 3G82B 2W8KA 3KLGB 4IO8A 5EX5A 1BL3A 4J9VA 2XYGB 4HI1A 4QQBA 5GAEP 1UVIA 3SFUA 1ATRA 2M0GB 2YHYA 3WBZA 2QRRA 1KOOA 3OHBA 3HYFA 4H03B 4L3NA 3NVMA 4CLWA 2ZH2A 3H90A 3KZBA 2BV3A 4H4OA 2X1GA 2XBPA 1Q8LA 1GOCA 4ECUA 3N6NA 3O44A 2Y8WA 2P9SA 5M2RA 4CNZA 1J9AA 5KQ8A 3MEDA 4BE1A 1U6ZA 5J2MA 1SVDA 3OTBA 2OPQA 3IN5A 5LXYA 4H5TA 3EY1A 4WK3A 2K06A 2A42A 1RDUA 2NRHA 3FZBA 2VQEK 2ZOFA 2DHGA 3MAAB 3MAHA 3M4XA 3EO3A 1TV6B 2BRKA 2M2BA 3TZXA 4QYZK 1N5SA 1RBTA 2GV1A 3R5CA 2LDYA 3DLEB 1WC3A 3O80A 4M5DB 1R8PA 2W6KA 2FC9A 4C9DA 2H3EB 2RDJA 4DUTA 3U7JA 5JLFA 2PDAA 5DDOC 2HBMA 3ISZA 4EYHB 3FE1A 5D4OA 1VFJA 4H8KA 2GAGC 2OSQA 4M3WA 3I31A 2HHHJ 3GBTA 2EG1A 2GIFA 4BLGA 4LSNB 1SPBP 2GGPB 2J0WA 3C19A 3PW7A 4DZDA 3PO5A 4P52A 1WBDA 4IFVB 3FGUA 2E5JA 1UVMA 1HNIB 1PKUA 4E1JA 2J9DA 3O1LA 3NWGA 4ATNA 5F8IA 1VHFA 4R8UB 3OYBA 4CEAA 1JLBA 2Z2LA 3UDCA 2F7VA 4UY8T 2DR9A 4H5RA 2NS1B 1R3NA 4GRSA 1HD0A 1YBAA 1X8DA 4Q5VA 4J9PA 4X4TA 3WC2A 1GOAA 2NZTA 4WFAQ 4K0KJ 4YY3J 4W92B 3OYCA 2IYGA 1HA1A 2RQ4A 2YQ3A 1NRKA 4HTUA 1LEOA 3KOAA 4ZPDA 1FK9B 4JI6K 1V3ZA 2GAHC 4NB4A 1NUEA 4AQYF 4DQ8A 1HI1A 2CWXA 2V4JA 4QIVA 2JHEA 1XNRJ 4RR5A 3ZEUA 3N4WA 4AH9A 5BN8A 2UVRA 3D2FA 1HI8A 2RU3A 3GZ7A 2PFFB 5CYMA 1HQ2A 4KBOA 2CADA 1TKZB 2R8JA 1ZBLA 1RT6B 5FPMA 4ZJLA 1U1OA 2VF3A 1FJCA 1OQ6A 4DV0F 2UVUA 1SKWA 5ADXA 2F8SA 1SC1B 5T7BA 3LAKA 5HMYA 4ZTJA 5LMUJ 3DN9A 5D0HA 1SV5A 4DG1B 2FJWA 3CEDA 5I3QA 3CWJA 2DIUA 3HSGA 2X3DA 4LQ3A 4ZCKA 4FJ7A 2V8DA 2O5DA 1SH3A 4FYDA 3OBIA 2PMZD 2WBNA 3UO0A 2RVJA 4J2DA 1S9GB 5GMDA 3S3NA 1KDNA 3ET6B 1QLNA 1SL1A 3GYNA 2XHWA 4FWQA 4FDFA 5ETLA 1M5HA 3QGPA 3IMXA 4K0KK 1ZAXA 4DR2F 4YY3K 2HEKA 2GJ2A 4CDIA 3CDBA 3SQGA 3FBEA 1ZBFA 1T11A 4FYVB 2ZF5O 4RL1A 4BHQA 2YX7A 3EXCX 3DXKB 3MGJA 2ZH1A 2A10A 4JS4A 4OJRA 2HQCA 4G65A 3BPDA 2PMWA 4PXEA 1XNRK 1S1WB 3L2VA 1G99A 4WQ5A 5AQIA 5L46A 2Z4PA 1OKJA 3DAWA 1NGHA 2H9ZA 4YDUC 3J7AP 1SL2A 3VCDA 1WHVA 4JI0J 3EE8A 2XCAA 2ASPA 1JWWA 3M1FA 1EARA 2V4RA 1EXQA 3OXLA 2Z30B 4O0NA 3U9ZA 3KTQA 1M1GA 3RJMB 4WYBA 2VG5A 3O1BA 3QSIA 5LMUK 2OPPB