1TVRA

Hiv-1 rt/9-cl tibo
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Aspartyl protease
molecule keywords REVERSE TRANSCRIPTASE
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tvrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tvrA05
4HUGA 1XR7A 2RPIA 1T7PA 3C6TB 4ZVEA 4IR1A 3ZT4A 1UAXA 4M42A 4M3ZA 1QSLA 2HWHA 5KFZA 3MR5A 3OJSA 2OPPB 2B4JA 3LZJA 4KFBA 1NK5A 3TAMB 1VSMA 3TAQA 1S9FA 4HCBA 1TV6B 5KFUA 4O3SA 4BWMA 2WB4A 5FDLB 4Q43A 3HVAA 2R8JA 2E9RX 2R2RA 4B9VA 4Z4HA 3QESA 2HB5A 4O5BA 4AHTA 4H4MB 1JLEA 4ZPDA 2YHAA 1HYVA 1SH3A 3HHKA 3KLVA 2PZSA 1TVRB 1WNEA 4F4XA 4F3TA 2VA2A 1W0HA 4E19A 4DLGA 4KTQA 3AO5A 4G1QB 2XWYA 3N6MA 4FJKA 4CF8A 4ZVHA 1QTMA 4ICLA 3CFRA 3S3OA 5KG4A 1RA6A 1YT3A 2PYLA 1HQUA 3VN5A 3T19A 4FYDA 5J2NB 5DG7A 2IBKA 3C6UB 3ULDA 3LPUA 2BE2A 4FS2A 4DL3A 3EPIA 3OL9A 2VWKA 1QE1A 3ICLA 3KHLA 4WFYA 1O1WA 4TY8A 4WZQA 3NH2A 2BQRA 4IKFA 2YKNB 4EO6A 3LZIA 4CJRA 4QWDA 3Q8RB 4DTUA 5L1LA 4B9UA 1IKXA 3K5OA 1D9FA 3SI6A 4CEQA 5CYQB 1KLMA 4CJ3A 4PUOA 3LAKA 2ETJA 4YFUA 1C0MA 3HP9A 3K5NA 4KHSA 2ZQBA 4KV8B 2R2UA 2YNGB 4F50A 4CIFA 2XI2A 3E51A 2W7OA 3VQ9A 3DDKA 1YTUA 4MIAA 4EP4A 1NKEA 1QUVA 3OHAA 3KOAA 3NH1A 4CF2A 4Z4GA 3MECB 3UIQA 3KLFB 4KREA 2R2SA 4FJIA 3FDSA 3ZSRA 5F8LA 3GQCA 3RB0A 1RBRA 4DFJA 3H4BA 5C42A 2DFEA 3QO9A 4C8NA 4CGJA 3NGIA 3PY8A 4MH8A 4LH5A 1R0AB 1SUQA 2YNHA 4NLRA 3ZSVA 1U04A 4GMJB 3TAMA 2XHBA 4ELUA 5KFKA 1X9WA 4JV0A 3ISNC 1BCMA 3UDLA 3SQ4A 4KB7A 5KG1A 4R8UB 3D45A 2D5RA 1ZBUA 1RDDA 3MR2A 5KFJA 3V9SA 2C2RA 3CFPA 4R5PA 4FJ8A 1JIHA 1LV5A 3I5BA 1RT1B 2ZD1A 3OVNA 4FLYA 1TL3A 4NCGA 4R0EA 4IRCA 2W8KA 1HJRA 1TAUA 1LAVA 2XO7A 1U4BA 1C0UA 1NHUA 3AVKA 4J2DA 4M95A 1N6QA 1ASUA 4Q5VA 3MEEA 4XPCA 5CZ1A 1Q9XA 2AGOA 1JLFB 4KB0A 4I9LA 4DTRA 4FJ5A 1RTJA 3LALA 3ZT0A 3ZSWA 3H4DA 4RG8A 3DMJB 1L5UA 4CEDA 5C24A 1RT7B 3K59A 1KLNA 1WSFA 3ALYA 1JLQB 4OL8A 4ZTFA 1JLFA 3TABA 4FVMA 4K4YA 3LWLA 1GOAA 4N56A 4NYFA 3KD5E 3Q8SB 4WFXA 4CJ5A 3K5MA 4K4ZA 3SFGA 4I2PA 4DTMA 1TL1B 3S9HA 1BQMB 4TQRA 4AHUA 2F8EX 3T5HA 5T14A 1MU2A 1ZBIA 3V1QA 4CERA 4O3QA 4UQGA 1S1UA 3PX6A 3KK1B 4ED1A 3KJVA 1TP7A 3ZSQA 4ZMMA 3DM2A 2BE2B 4FLTA 4IQXA 3ASMA 1SKSA 1VSJA 3OYFA 2W9AA 3DLEB 4E3SA 3EPGA 1S49A 3BSAA 4QAGA 3BGRB 4CGFA 2VG6A 4ICLB 4URSA 4CGIA 3KLIB 1JLAA 1RT4B 3GIJA 3AV9A 3H40A 2FJWA 3AVGA 1FK9B 4IG0A 4RUAA 5KFEA 1N48A 3CWJA 3QZ8A 2IA6A 4O3NA 4BWJA 3CM5A 3BQ1A 3LP2A 3MECA 4KKOA 3T5KA 3AO4A 2JEGA 4FW2A 3IGVA 1JLAB 1KVAA 4QWEA 2R8KA 4NYNA 1SKWA 4LQ3A 4NLXA 3SUNA 3BGRA 4KFBB 4TY9A 4DTSA 3F9KA 3OYHA 4CJEA 4X2BA 3OS1A 4OLAA 1LWFB 3IRXB 1C2PA 1S1WB 3RAXA 2IM3A 4RNHA 3ZT2A 2DY4A 2ASLA 3U3YA 2D0BA 4E7HA 5KG0A 4ECWA 4CHZA 5F9NA 3O3FA 2OPRA 3H5SA 5HP1B 4O3OA 4DSEA 3THVA 4N41A 4TY8B 2OZMA 2A1SA 2J6SA 5L1IA 4U7CA 1TL1A 3G6VA 3D28A 3I5AA 4NRUA 1CZ9A 3G0ZA 2HNDB 3H98A 3L8BA 2YNIB 2BRLA 3M9MB 3O3GA 2RDJA 4FJMA 1LW2A 4DL4A 2Q3SA 4YNQA 2HVHA 4IKAA 2JC1A 3VQSA 3BQ0A 2R8IA 3QGHA 4LSNA 4DMNA 3V4IB 4L8RB 5C24B 4NLQA 3RR7A 4KHQA 3CJ3A 4RW6A 1D1UA 4DG1B 1RTJB 4HHTA 4C8KA 3KTQA 4J9NA 4CJSA 4LSNB 1RT3B 1DTQB 3NDKA 1D8YA 4NCBA 2AWZA 3AA4A 4NLPA 4EZ6A 5KGXA 3DLBA 3ZSYA 3NAHA 2KTQA 5KT6A 4CIGA 4OVLA 5KFSA 5KG2A 4I2QB 4XO0A 2Z1IA 1VSKA 1S10A 2FBXA 1D0EA 3CYMA 3KHRA 4JS4A 4E7IA 4DU1A 1UA0A 4DEZA 4FJHA 5K14A 5KFIA 4FLVA 1IKYB 1S9EA 3ITHB 4IG3A 4JUZA 3DLGB 4ED7A 1XHZA 3I8DA 3NHGA 3OYKA 4YP3A 3SI8A 3C6TA 3NL0A 3FQKA 2FVPA 4R8UA 4EO8A 4CHPA 1VSLA 5JXSA 3RBEA 3DLHA 3E01A 2Z1JA 4B3OB 3OLBA 2EC0A 4IFVA 3GV8B 4DSJA 4YMEA 5KT5A 4BDZA 5EUHA 4F8RA 3V81A 1REVB 3KD1E 3L2UA 4CFAA 1LWCB 3CVKA 2AGQA 1RILA 4KTWA 2IM1A 3DLKA 1UA1A 3RB6A 4N76A 4M3UA 4FBUA 3OYLA 1TKZA 4MFBB 3QNNA 1T03B 1TK5A 2UVRA 2E6MA 3L3UA 1BQNB 1TK8A 4KHRA 1I39A 2G8UA 3KMQA 3SV4A 3VQ5A 2YKMB 2VG6B 4ECZA 4Q0BB 2D3ZA 2WONB 4AHSA 4ID1A 1CSJA 1RT5A 3DRPA 3G86A 1T3NA 4DWIA 4ED2A 2W9CB 3C95A 2C22A 3VQEA 4CK1A 1RDRA 3AA5X 2ITGA 5T7BA 4DS4A 4TSXA 1NNDA 4CHOA 2HHXA 2V4QA 1NK6A 4CJLA 4B9LA 1KSPA 4TQSA 4J2AA 4FZYA 4KPYA 3AVCA 3ZT3A 4WXOA 1JXLA 3AVIA 3EZUA 5KRSA 2CKWA 1NK8A 3QLHA 4PQUA 4RW4A 1GX6A 4DL7A 1NHVA 2XCPA 2ZE2B 2ZE2A 4OKKA 3SUQA 4DTPA 4Y34A 2HHVA 4E1MA 4QCLA 1UWBA 2XI3A 1RYRA 3H5XA 5KFYA 4JLHA 3V9ZA 1VK0A 5DG8A 1T94A 4RNOA 1S1UB 4CJQA 4FLXA 3P5JA 3HK2A 2FVQA 2OZSA 1RDCA 5I42B 2G8WA 1IKVA 3L3VA 3L2WA 2YNFB 4AH9A 3DRSB 2VA3A 5KT3A 4ED8A 3HPHA 1LW0B 2YNFA 1NJZA 1C0TB 5HBMB 4J9QA 2VG7B 1EKEA 5I42A 2FBYA 3FFIB 1RA7A 3DYAA 4EBDA 4CK3A 4WE1B 3PVXA 5HROB 3OYGA 4ZPAA 4BE2A 4CHYA 3QIPA 4GW6A 4M3TA 1S6QA 4YR0A 2R8HA 5KFRA 3PHEA 2OPQB 3MFHA 3Q8PB 4DQIA 3P1GA 3GV5B 3WNEA 5F8IA 5J2PA 1A5XA 1C1AA 1JKHA 1R0AA 4RW4B 4OJRA 1TKTA 5J2MA 4CJUA 4E0DA 2PY5A 4LQ9A 3TVKA 3RTVA 1CXQA 4GC6A 4FLUA 2WOMB 3I0SA 2D0CA 3LP0B 4JS5A 3FSIA 3E01B 4KHMA 2P1JA 3LP3A 1NJXA 4DU3A 2QXFA 2LSNA 2JLEA 3M8QA 1N5YA 2GBZA 4IG3B 3MR6A 4JV2A 1CLQA 5F8GA 4RZRA 3OSNA 4W5OA 3T5JA 3HXMA 4EBCA 4ZPBA 2OPSB 2IGIA 1T8EA 3NFAA 1LW0A 3QYYA 1WN7A 4YR2A 3MEGB 3MXJA 3SFUA 3TR8A 3I0RA 1RTHB 5I3UA 1T03A 2FLNA 1IKXB 2ILZA 2IDOA 1K1SA 4J9LA 1JLGB 3BSCA 3A2FA 1WLJA 3TQ1A 3KLEB 3NAEA 2YHBA 4RW7B 4I7FA 1QAIA 1RT4A 3KLIA 4CHQA 1TKTB 5J2MB 1TQLA 3V9UA 2P5OA 1UWBB 2RKIA 1REVA 4TN2A 3SCXA 4M94A 5KFMA 1WSHA 1S1VA 2QKBA 4IFVB 1L3SA 3M8SA 1B9FA 3NH0A 2QK9A 4IH7A 5KFOA 3QIPB 1IKWA 3QEXA 2P5GA 4G1QA 3PR5B 4MK7A 2IC3B 2GUIA 2ALZA 3SPZA 3M8PA 2Z1GA 4FZXC 4MKAA 3CJ0A 3AVAA 1FKPB 1XC9A 1OS5A 2FC0A 2VG7A 1BQMA 4CJPA 3WNFA 4ZP6A 5HBMA 4FJGA 3IAYA 1RTHA 5I3UB 1S1WA 4F4ZA 3V6KA 4RUCA 1BI4A 3IRXA 4Q8EA 4CIEA 4Z0UA 4FZZA 3QZ7A 4FS1A 3WNHA 2HHSA 3KK2B 2OPPA 4Q0BA 1X1PA 4DQPA 1RBVA 3MEDB 1N5YB 5EWFA 3B6PA 4HUFA 4B8AB 5JUMA 4B9NA 2OYQA 3SZ2A 2KFZA 2X78A 1KTQA 3AVJA 4JRQA 4TYBA 2W8LA 3TARA 1KRPA 5HLFA 3NGYA 3GYNA 3QEPA 1NKBA 1SL0A 1HNVB 2O5DA 2GV9A 1S48A 1CZBA 5J2QA 1EX4A 4M41A 4IRDA 3EYZA 3QLHB 5JS1A 1TL3B 4FK2A 4QW8A 2Y1IA 5DGAA 1J53A 2HNZB 1A5VA 2B43A 4MK8A 1I3AA 3CJ2A 1S6QB 3OL6A 3HYFA 3HL8A 3KKSA 3UR0A 3DI6A 3EZ5A 3IGNA 4FJJA 4JV1A 3PJXA 3KMSA 2KZZA 1RDBA 3CJ5A 3FFIA 1QS4A 3KK3A 5EWGA 4DLEA 2XGQA 5F8NA 4O4GA 3KLGA 4RW8B 5DQIA 1N56A 3O3HA 3CQ8A 4K4TA 4XPEA 2D41A 2J6UA 4BE1A 5KTQA 1X9MA 1ASVA 1WSJA 3PX4A 4QWAA 1VSIA 2VWJA 4F4YA 3T1AA 2X6SA 3N6NA 4ZVGA 2CJQA 3I5CA 2WHOA 4PA1A 4KHWA 2AJQA 3PW2A 3NKYA 4K4WA 3MAQA 1YTAA 4BDYA 5KFNA 4CESA 4K4SA 1KLMB 2XY5A 4GVMA 4HCCA 3VQ7A 4ECRA 2WTFA 3V9WA 4NLUA 1SL1A 4E7LA 3D5MA 3OL8A 3KJVB 4I7FB 3DLRA 4KHUA 3ITHA 1FKPA 4AILC 3K2PA 5K14B 1JLGA 1HYSA 2RF2A 1S6PA 4M3XA 4DU4A 2OA8A 4YQWA 1JL2A 1LWFA 3HP6A 4ED6A 1EXQA 1HQUB 1L3VA 3LWMA 3VA0A 4FJ7A 1JLQA 1DTQA 4DSLA 2RKIB 1BCOA 5DG9A 3RB4A 4ELVA 1IM4A 1YVUA 2G8VA 3B6OA 5L9XA 4DTNA 1KFDA 1S0OA 3ZSZA 1EETA 3HM9A 1XI1A 4DTXA 2UVWA 3VQPA 2HNYA 4KHYA 3VQ8A 4CHNA 3PX0A 2D3UA 2W42A 4KBIA 1S5JA 3TI0A 3MXMA 4ID5B 2W9BB 4J9KA 5DMRA 4CE9A 4Q8FA 1XR6A 1ASWA 3AO2A 4J2EA 4OPKA 5D3GB 3MEGA 3TAFA 4CEFA 3OYMA 5KFAA 4NZ0A 5EU7A 2DFHA 2J6TA 4KSEB 3KHHA 3KK3B 3DLEA 2B6AB 2IS3A 4E7JA 1NK7A 4ECYA 3P83D 4PUOB 3RRHA 1TKXA 1B9DA 2D7SA 4Z4CA 2ASJA 4J9RA 1RT6A 4CJKA 5FRMA 4ELTA 4M3YA 5HROA 4M45A 2XY7A 1JXEA 4IRKA 3PO4A 3QINA 1LAWA 1TAQA 3DLGA 1HYZA 4LD0A 2EX3A 2FLLA 5CYMB 3CM6A 1MU2B 3N6LA 2WOMA 3IS9A 5L1JA 4URGA 2HW3A 2W7PA 3M8RA 5DQHA 4H54A 5C5JA 2C28A 1RTIB 3O4QA 5DK5A 4MIBA 4B9TA 1JLBA 3C6UA 5J2NA 3PJWA 5C42B 4ZPCA 4QPXA 3AA2A 1RBSA 4IG0B 2EHGA 2V9WA 1HMVA 3DMJA 2AX0A 4OGEA 3OYDA 1HMVB 2C2DA 2HAIA 3TAPA 3OY9A 1Z4UA 4K8ZA 1S1XA 1ZBHA 3H5UA 1Q9YA 4NLDA 1RNHA 1UOCA 4J2BA 1SV5A 5C25B 1LW2B 3OYIA 1HPZB 1ZBFA 3OYJA 4OGCA 4KHNA 2NUBA 3NF9A 2HNDA 4IDKA 2X74A 3RB3A 3V6DA 1HYSB 4MQ3A 3O4NA 3IS9B 3M8PB 2IMWP 5HP1A 4LH4A 4O55A 2OPRB 1BHLA 2HMIA 3KNAA 3SUPA 4I2PB 1IO2A 4BDPA 1D9DA 4CJVA 2ATLA 3IN5A 4NLSA 1VSDA 2BQUA 3CG7A 1SV5B 4NLOA 2IAJA 4CFDA 4CCHA 3DOKA 2BDPA 2FVSA 3L2VA 1CXUA 2AU0A 3MTKA 4F3OA 4LSLA 2I5JA 3PW7A 4C8MA 1JLCA 3BSOA 2BANA 4CFCA 4J9PA 4ID5A 4ZP7A 2W9BA 3V1OA 2AQ4A 3AVLA 1JLEB 4QOZB 3DLKB 3MEEB 4N47A 3KLFA 2XCAA 4IH6A 4TXSA 1N6QB 2FJXA 4Z4IA 2BANB 3FQLA 3JYTA 2XC9A 4LSLB 2Z1HA 4RW8A 1TV6A 1LWCA 3TAGA 3PW5A 1Q8IA 1RT2B 4O0IA 2IAJB 2IM2A 3AVMA 3RR8A 4R5PB 1B92A 1RTDB 5CYMA 4CEZA 4B9MA 3M8QB 3DM2B 4ECUA 1HQEA 3D0PA 3EY1A 4FW1A 3DI6B 1S6PB 5EWEA 4M3WA 3KK1A 1FXXA 1TKXB 4QW9A 2YKNA 3ZSXA 1TK0A 2ZKUA 3BQ2A 4ECSA 4DL2A 4OKJA 3OYNA 1HRHA 1QE1B 3ISND 5J1EB 4ZP8A 4I2QA 3RMAA 4Y2AA 1F21A 3H08A 4M3RA 3VQAA 4K4UA 4Z4EA 5FROA 2RDIA 3NF7A 2ILYA 4CGHA 3SQ2A 2G8HA 3CJ4A 2HNYB 4F4KA 4Z4FA 5KT4A 3QIOA 1NJYA 4RW6B 1SH2A 2KZMA 4Q44A 3OYCA 2HVIA 1SH0A 3MEDA 2OH2A 1K1QA 3VA3A 2YNGA 1T05B 1HNIB 4DSFA 4HYKA 3QNOA 4NLTA 1QSYA 3RRGA 1JLBB 3HVRA 2DPJA 4CEAA 5FDLA 3RWUA 2JGUA 3MFIA 5CYQA 4O4GB 3KLGB 1RTIA 5KFTA 4CJTA 2DTUA 2O4GA 1RDAA 4NCGB 1U47A 4EEYA 4WYLA 4Y1DA 4E89A 2HHQA 4HVJA 5KG5A 3GIKA 4FK4A 2IM0A 4FJLA 3C94A 1TKDA 4IFYA 5KGWA 1WNSA 4ZTJA 2IC3A 1NOYA 4DS5A 1EP4A 3CIZA 2ASDA 1C1CB 3KLHA 3UPFA 1SL2A 3BDPA 4PY5A 1FKOB 4QWCA 3ZCMA 1RTDA 5KFWA 2D0AA 3GILA 2B6AA 1VSFA 5KFXA 3OL7A 4DL6A 5HRRA 4KTZA 1RT2A 1U49A 4H8KA 1SUQB 4FK0A 4WXWA 3L2RA 2X6NA 4FM1A 5D3GA 1GX5A 1VRTA 4FLZA 4CF0A 3S3MA 1TVRA 4ECXA 4FM2A 3SQ0A 1BISA 1NOZA 3NCIA 4FJNA 3SYZA 3HVTB 2R8GA 1ZTWA 2F96A 3NGDA 3NMAA 2KW4A 3PUFA 3OJUA 3RMDA 4EYHB 4CECA 4EBEA 4FJXA 4KE5A 3DOKB 2BQ3A 5JS2A 4KV8A 3V6JA 1S1TB 5F8HA 4MK9A 3UQSA 1I6JA 3OS0A 4O3PA 3KLHB 1Z26A 4F2SA 4K4XA 1SKRA 3K5LA 3PV8A 2YV0X 5KG3A 4MFBA 2JC0A 2JEJA 1YVFA 4K8XA 3I0SB 1FK9A 3HJFA 3G6YA 2QV6A 2C2EA 2HNZA 4Y1CA 4I9QA 1VRTB 4TLRA 3NE6A 1IKWB 4LY7A 5HLFB 1ZBLA 4HUEA 3HT3A 1HNIA 4RW9A 1U09A 3V6HA 4CEEA 4CF1A 5KT2A 1FKOA 3KHGA 1Z25A 4NCAA 4WE1A 3MR3A 3QERA 2XY6A 1X9SA 3LP1B 4WFZA 3G6XA 5KFVA 3CDWA 2P51A 4ZHRB 1KVCA 4W5QA 1ZYQA 4PWDB 1JXBA 2HHUA 1GOCA 1BI4B 3HO1A 1U45A 5J1EA 1G15A 4H4OB 1U48A 2IJNA 1IKVB 1N4LA 4FBTA 4B08A 4PWDA 2BGGA 4KI4A 4ZHRA 3RMBA 3TWHA 3JSMB 2FBTA 5KT7A 1A5WA 4DTOA 1RT7A 4U6PA 3WNGA 3LP1A 2KFNA 3KIOA 4ED3A 4URQU 3DOLB 2JEIA 2E9TA 4W5RA 1RT6B 3T3FA 2O4IA 1DTTB 4GC7A 1QQCA 2F8SA 4E7KA 2DFFA 3MF5A 2B5JA 1KCFA 3QETA 3SUOA 3LP0A 2UUTA 5KFLA 1S1VB 1S9GA 1JL1A 4W5NA 3BREA 4KAZA 5DLGA 3VQCA 1C0UB 2YNHB 2HHTA 4F4WA 1IH7A 1RCHA 2YNIA 4FM0A 1HNVA 5FRNA 2R2TA 2XRIA 3F73A 1S4FA 4WYWA 2OPQA 4DSKA 5HRSA 1LWEB 4G3IA 4KRFA 3T5LA 1BL3A 1EETB 3DRRB 3DOLA 2HWIA 1JLCB 2I5JB 4C8OA 3VQ6A 3SNNA 3BSNA 4CK2A 1S1TA 4Y2CA 3KK2A 2WONA 2WRMA 1VSHA 3OYAA 4BE0A 1C0TA 2AX1A 2G8FA 5KI6A 3GIIA 4CJWA 4K4VA 3AVFA 1HARA 1NK4A 1KVBA 3NBPA 3QO9B 5DLFA 3LP2B 3G10A 4DFPA 4N5SA 4DF4A 4CGDA 4C8LA 1JX4A 4RU9A 3AVHA 5F9LA 2QKKA 2G8KA 4EP5A 5CY4A 5HRNA 4ECVA 3V6DB 3QGGA 2BR0A 2FLPA 3AVNA 3HPGA 3LAMA 1ITGA 4IDKB 1W9HA 4ECTA 2FJVA 4O4RA 1JKHB 3L2QA 1NKCA 5J2PB 4RNNA 5F8JA 4B8CA 4W5TA 3M9OB 1KHVA 4FCYA 3MXIA 5L1KA 5KFHA 1S9GB 3AVBA 1WSGA 4CJFA 1XHXA 3CO9A 2VG5B 4YR3A 1RBUA 4K50A 1EP4B 2HMIB 3KLEA 4OPJA 4Y3CA 3JSMA 2E6LA 1Y97A 4EZ9A 3ZT1A 3PZPA 1J9AA 4KI6A 4DSIA 4NLVA 4NLGA 3PR4A 5KFBA 3IG1B 4KB1A 3QEWA 1HPZA 1NK9A 2OPSA 4ZVFA 1RT5B 3DRPB 1L3UA 5E41A 3K58A 3PO5A 3V1RA 1S1XB 4FLWA 2R7YA 3CDUA 1BQNA 4DG1A 3HKWA 4O0JA 1BIZA 5SWMA 2FBVA 3GIMA 1DLOA 4CF9A 3VQDA 5EDWA 1WSEA 3PW0A 1TKZB 2V0NA 3GV7B 2VG5A 1D5AA 2JEFA 4DQQA 2UVVA 2E9ZA 1VRUB 4IBNA 2XY8A 1GOBA 3SV3A 3OYBA 4PQUB 3ZSOA 4IOBA 3KKRA 3V9XA 5F8MA 1VRUA 2E4LA 2UVUA 1RT1A 1QSSA 3OS2A 2UUWA 3OHBA 3TAEA 4NLWA 1C1BA 5DGBA 2B5JB 3Q8QB 4DQSA 3BJYA 3NBPB 1DLOB 1ZETA 5KFFA 1NK0A 1ZTTA 4NYZA 3U6FA 1S97A 2F8TA 3OYEA 1K6YA 1QHTA 3LDSA 1IKYA 1S9EB 1RAJA 4IFYB 2BRKA 3DYAB 2WK4A 1XWLA 4ZP9A 4IR9A 4DFMA 4H4OA 4CEBA 4AHVA 4RNMA 3IG1A 3DRSA 2FVCA 3LPTA 3JYTB 1S0NA 2KQ2A 3DRRA 1W25A 4KKOB 2HHWA 2XGPA 2RF2B 1T05A 3U3GA 4O44A 4BACA 5KFCA 4DF8A 5KG6A 1RT3A 3HSTB 4NLYA 3RMCA 1IG9A 2A1RA 1BGXT 2G8IA 1J5OA 5KFDA 1WSIA 2I1RA 4KO0A 3OSPA 5DQGA 2WCXA 3V4IA 4J9OA 3PW4A 1KFSA 4OLBA 3AO3A 3NAIA 4HKQA 4RW9B 3AO1A 5KG7A 2GIRA 2GIQA 3H5YA 4TYAA 3SQ1A 1J54A 5KFPA 1NJWA 1TGOA 4B3OA 2GC8A 3QIDA 3NF6A 4AHCA 3LANA 4KO0B 2RN2A 1C1CA 2IOCA 4RW7A 2ATQA 4JRPA 3OLAA 3CDEA 1WAFA 2FVRA 2IJFA 4J9MA 1QAJA 4O3RA 1S0MA 1KHWA 3S3NA 4Q45A 4O44B 4ECQA 1C6VA 4FJ9A 4AHRA 3HVWA 4WZMA 3SJJA 3I0RB 1HQEB 4CEOA 5HRPA 4E1NA 1WAJA 3RAQA 4XIUA 2W9CA 4DFKA 5C25A 3M9NB 2Y1JA 4DQRA 4CJ4A 4CFBA 4DL5A 1VSEA 4QWBA 2YKMA 4MKBA 3VQBA 5CZ2A 3NGZA 1J5OB 1BIUA 4OKEA 2PYJA 3CFOA 4J9SA 3VQ4A 5KFGA 4KAIA 4IH5A 3HVTA 3RBDA 1RBTA 1LWEA 1C1BB 1MMLA 4H4MA 3H59A 4DTJA 3QEIA 3VQQA 4CGGA 1XR5A 4NRTA 3QEVA 3BR9A 5KRTA 2V4RA 3FRZA 5J2QB 3TANA 4HTUA 4RNFA 5KFQA 1RYSA 4B9SA 4F2RA 3V81B 3AA3A 3NF8A 2ZD1B 3HPOA 3H2LA 2DPIA 4ED0A 4FXDA 5SZTA 3K57A 4EYIB 2QE5A 1L3TA 3QGIA 1DTTA 3SPYA 2AGPA
chains in the Genus database with same CATH superfamily
4HUGA 1XR7A 2W2QP 2V34A 2HWHA 5KFZA 5CH7B 3OJSA 2ACMA 3AH6A 3JAMO 1NMNA 4DUZK 4CNYA 5BJRA 3TAMB 1BE4A 4C48A 4HCBA 5GIOA 1TV6B 3A0IX 1LQ9A 5FDLB 4EHTA 2YX1A 2E9RX 2V4JB 4H4MB 2NR0A 1JLEA 4ZPDA 2YHAA 1B4SA 1SH3A 4ITSA 2PZSA 2IVOA 2C2OB 4F4XA 4KTQA 4DLGA 4E19A 2ABYA 4FJKA 3D1HA 3ILIA 4ZVHA 2B4OA 2PFUA 2R7RA 2GELA 4AXIA 1ZXOA 3GSDA 4O5FA 4TU7A 2PYLA 4PKDB 3C6UB 2YPYA 4TNOA 4DL3A 3EPIA 3OL9A 2VWKA 4JYAF 1RJJA 3ICLA 2PA3A 3FFKB 2UXDK 1HNWJ 4TY8A 2A0FB 3NH2A 2BQRA 2VASA 2YWGA 1KAXA 1KWMA 4JN4A 1IJEB 1IKXA 2M52A 3RRKA 1U6BA 4LC9B 2EFQA 3UVJB 3QBCA 5CYQB 3T1HF 4DR3F 4CJ3A 3QAUA 3LAKA 1QZ6A 3R2CJ 3HP9A 3K5NA 1F5AA 3ENOA 5DS7A 2ZQBA 2R2UA 4CIFA 2XI2A 3E51A 3VQ9A 3G71N 4IO8A 1ESVA 1NKEA 2QSWA 2U2FA 3A3OB 3EVWA 1RWKB 4CF2A 4K42A 3UIQA 3QWPA 4KREA 4FJIA 5G4DA 5LM7E 1RBRA 1HWIA 5C42A 4BHQA 3MM7A 5HK4A 2VWBA 4I6WA 3PEHA 2WB1D 4L3NA 3DKDA 4MH8A 3IMQJ 4BRFA 4U8YA 4QIEA 2AT1B 2FGOA 4GKKK 2GMLA 1RAHB 1RACB 5KG1A 2E7XA 4DHVA 2DNQA 4UZBA 1LV5A 2AP1A 2ZD1A 4FLYA 3UE2A 3R1XA 4IRCA 5A6WA 3QFPA 4DR7K 2E2NA 4KJIA 3N4QA 2AGOA 2BABA 4YDDB 4WQ5C 3THYA 4FJ5A 3ZSWA 3R8YA 3H4DA 2C3OA 4CLZA 1RT7B 3EDRB 1DZ5A 5CR4A 1KLNA 4J91A 3C15B 5J1NA 1GH8A 2P9EA 5IFMA 2HGLA 5B09A 3SAGA 3L09A 4JI3F 3EZWA 3MCPA 3PRVA 3UO0A 2NYHA 4WFXA 4CT9A 2FHJD 3LPEA 1YK9A 2C2NA 5IC6B 3LDOA 4DTMA 3S9HA 2BW2A 2COLA 4L76A 5T14A 2BUPA 2EPIA 4CERA 3KK1B 4DV4J 4CBWA 2V67A 2H5EA 4Y6IA 3FZFA 3JS6A 1NDPA 4NA3A 2QRRA 2VC0A 1V5VA 1SKSA 3OYFA 5CA5A 2W9AA 1AT1B 2CGLA 3BSAA 4QAGA 3MD1A 3BGRB 4JNEA 3W0LA 3GJQB 2ATCB 2NXCA 4JI4J 1JLAA 4PYAA 3QRPA 3GG4A 3D6HB 5A0YB 3H40A 2Z30B 3E2EA 4IG0A 2VBZA 3QZ8A 3GG1A 3BGLA 2IA6A 4F25A 3BQ1A 1E6VB 3MECA 2RU9A 3TTCA 2GMJA 4ANEA 3ENAA 1JLAB 1MWZA 4QWEA 4ZIVA 1P90A 1I1GA 4DUYF 3KG4A 3BGRA 3SUNA 4KFBB 2PFFB 1W7WA 3BP8A 3PLAA 4B1WB 3F9KA 3NGUA 1Y10A 4X2BA 4ZCMA 1LWFB 2FY1A 2K7JA 2IM3A 4W98A 3CT9A 2Z57B 2DY4A 2FZKB 3H2UB 2D0BA 5KG0A 4OHZA 4CHZA 5HMWA 5F9NA 2P9UA 2CNNB 4DSEA 1XMQJ 3D6RA 1QQNA 1T6CA 2OZMA 1H73A 4B17A 3L4BC 2HNDB 3H98A 1OIAA 1PSDA 3M9MB 3O3GA 2CQHA 3ZYYX 1GXUA 4OYOA 2C3UA 4FYVB 5AQXA 3WDOA 1LW2A 4DL4A 1NNEA 2Q3SA 4J90A 3BGFA 4IKAA 2JC1A 2CJ9A 1WSVA 4LSNA 2KG0A 4JKGA 3VHQA 4L8RB 4H5RA 4DCHA 2CNLB 2E2OA 2P9NB 4XH1A 3CJ3A 4RW6A 4P74A 4EAHD 1RTJB 2MKYA 4HHTA 5AQSA 2FZCB 3KTQA 3IP0A 4LSNB 1HBOA 4JKGB 2LU1A 1D8YA 3K17A 3OTOK 1YI2S 4EZ6A 3ZSYA 4KPCA 3NAHA 4LRCA 4CIGA 2V8GA 4GV6A 4X4UA 4U96A 4XO0A 3QICA 1SC3B 3EE3A 1D0EA 4LR8A 3KHRA 4JS4A 4E7IA 4CYUB 2J0SD 4FLVA 5IM0B 1S9EA 3DLGB 2GWJA 2CJYB 4P10A 3OYKA 5ETNA 3AD9C 1WOQA 2XYPB 1W7AA 4EO8A 1CQMA 3RBEA 3PNIA 4LIWA 3TX8A 3OLBA 3QGPA 4IFVA 3NGRA 3ZETB 2F3JA 1YHQS 3DJCA 4BDZA 5EUHA 2YH1A 3K8WA 3Q86A 2YX6A 2RUGA 1LWCB 1YBAA 4PWUA 2AGQA 4KTWA 4M5HA 2RRNA 1UA1A 2F9DA 3CCJN 3P3DA 2NXNA 4FBUA 5FPMA 2DRBA 3VGKA 3CULA 1TKZA 3GCWP 4MO5A 3GFZA 5A0YA 1N33J 1T03B 1V4SA 5C15A 4USIA 1PAEX 2PI4A 4ILJA 4ECZA 3JSRA 4Q0BB 4AHSA 1RT5A 3C95A 2C22A 3FC9A 4YB7A 4DV5J 3M1FA 3FKBA 4CO5A 1RDRA 2UZAA 1EIYB 3AA5X 4DCPB 1E6VA 4OYPA 2HHXA 3IO1A 2X1BA 3HMJG 2HG4A 1AUSL 4Z94A 3H46O 2BM0A 3AVIA 3LDNA 3EZUA 1NK8A 4PQUA 3MM8A 3VAMA 2DGQA 3IBCB 3OTEA 1S7HA 1GX6A 1EHWA 2GFFA 1FERA 2BKNA 2ZE2B 2YWEA 4CJ7A 2V7YA 2OD6A 1ATRA 3F0NA 4B1XB 4Y34A 1JCEA 4BRDA 3Q8VA 1BG3A 3A3PB 2HHVA 1X5TA 1C0GA 4TLQA 3V9ZA 1Q86T 1MMNA 5DG8A 3VAGA 2HIQA 1S57A 2NZTA 1SXLA 1GLDG 3ZEUB 5M1QA 4K25A 4LJMA 5I42B 4ZITA 1UW9A 1YJVA 1V4TA 1KVJA 3HTVA 1Y64A 2YNFB 4LF7K 3SQGB 2GA7A 3HPHA 2P9LA 2W01A 1S6UA 1U1OA 1U26A 1C0TB 5G0RB 5HBMB 4K43A 1JB0C 1EKEA 2FJBB 1VQKS 2FBYA 1RA7A 4A61A 1RAOA 1SC4B 4EBDA 2ZWHA 2V2ZA 2VBYA 2CQ1A 2FC8A 2J8AA 4HTIA 2LDIA 4WE1B 4ZPAA 2BKPA 3PM9A 4CHYA 1W26A 4C8YA 3THWB 1Y7PA 2EI5A 3Q8PB 2FJAB 3P1GA 4B3TK 3WNEA 1JKHA 1R0AA 4Z7YA 4RW4B 4E1JA 1GMWA 4E0DA 3CD6S 3CCSS 2XMAA 2NXUA 2OTLN 1YJ7A 3TVKA 2ZJRQ 1VQYA 3I0SA 2BA9A 1XMOJ 4K5RA 3TSUA 1ZM3A 1VK8A 1FT8A 1B99A 2H4YB 2P1JA 3TUPA 2LMIA 1WEZA 2V63A 2NRXA 3SDEA 2E8AA 4DU3A 4ZPVR 1T95A 3CUNA 2JLEA 1Q81O 2HVZA 3W63A 1UEUA 4JV2A 3D2FA 4DV2F 4PKGA 1PAUB 3MN7A 4B3SJ 2GW8A 3NFAA 4YB1P 3CO0P 2CVEA 1VQ6N 2LEAA 4YR2A 3MEGB 3TZWA 1RTHB 2DHAA 4UOHA 1NU0A 3J7ZT 1IKXB 3PG9A 4F3QA 4J9LA 3W1YC 3J80O 4JI8F 1ZS6A 3NAEA 2IYGA 4I7FA 1QAIA 3BKFA 4J9UE 1TKTB 1RLDA 4FYXB 3V9UA 2NXJA 1REVA 2B7BB 1UFWA 2KHCA 1WSHA 3FSXA 1BUPA 2QKBA 4YOYA 4JI5J 5DETA 3QIPB 4L3KA 5F3TA 1TL4A 1RZMA 4G1QA 3G6ES 1C0FA 4YOUA 2VODA 2ZUGA 3QB0A 4OX8A 3EVMA 3G25A 1R6YA 5BYRA 3AVAA 3MWPA 4ES3A 3CJ8A 3CHWA 4DCJB 4CJPA 3WNFA 5I3UB 1BI4A 4DI6A 1TUGB 5HVGA 4Q8EA 1SJ1A 2Z2ZA 2AYEA 1HD1A 1YI2N 4FS1A 3J7Z5 4F3MA 4Q0BA 3I56S 3MEDB 3CQYA 1IBMF 2DB1A 3BKUA 4HUFA 2EG2A 5JUMA 2MDAA 2DTJA 1U1NA 1O13A 1CJVB 2X78A 1UEKA 3NGYA 3QEPA 3VEYA 1EARA 1NMEB 2YX4A 4AF1A 2CPZA 5J2QA 4M41A 4JI3K 4JKBA 4LF6J 5CABA 4FK2A 2ASOA 3MUMP 2Y1IA 1FJ7A 3BO2A 4MK8A 1WI6A 4NXMF 1O6XA 2V8DA 1KDNA 3HYFA 3MCSA 2Z8QA 1JJ4A 4YS2A 3UR0A 3GMGA 4JV1A 2QZ8A 3O08A 3CCQN 1H6KX 1OJ4A 4DV0F 4O0NA 2XLKA 2NLXA 1NB7A 3G82A 1BHNA 1MROA 1ZOTA 3ENVA 1WORA 4O4GA 1T9XA 4RW8B 1NGHA 4LF4K 4K4TA 3E66A 1ASVA 1K47A 4B9QA 4M5LA 3PX4A 1EAYC 1RTZA 2MY8A 2FLOA 8RUCA 4F4YA 3H1QA 4CZKA 1J2VA 3THYB 2D1CA 2AJQA 1RWOB 1CC7A 3PW2A 3FSYA 1NGEA 1RLCL 1OH5A 2ZH3A 4K4WA 4QIGA 3QSIA 5B0EA 1R8AA 2XY5A 4GVMA 2ZVSA 4HCCA 2PE8A 3VQ7A 3V9WA 4HR2A 4E7LA 5CE3A 3D5MA 3DLRA 2MKKA 4JHDB 3K2PA 5K14B 1N5TA 2GAHC 1MA9B 1JLGA 2QI2A 4ENOA 5A76A 1T9YA 1K0VA 3FUYA 1ROFA 4M3XA 1P8GA 2EWHA 3PIPQ 1FF2A 3MUVP 2OUGA 3T1HJ 3VENA 4KBOA 1WC3A 3X3UA 4IEIA 1K8AO 3JSBA 8AT1B 1DTQA 2PC6A 1TU0B 5DG9A 3GBTA 1IM4A 3U27A 2E5LK 5L9XA 5AQJA 4KT0C 4DTNA 2HS4A 1H74A 3A8JA 5AE1A 1KEKA 2HSTA 2D3UA 1S5JA 1NDKA 4J9KA 2VGNA 3BH7B 4J2EA 1SIWB 5DM6L 4X62J 5MLCQ 3PIPL 3KK3B 1VK3A 2ZOGA 5LMNJ 2B6AB 3N5BA 1NK7A 4ECYA 5JVGQ 3RRHA 4FPIA 1B9DA 1UEVA 2G0CA 2QC3A 4Z4CA 4J9RA 2OEMA 5FRMA 2XY7A 1ZAWA 4FVCA 3CJCA 1HYZA 4LD0A 3M5RA 4M5DA 2WOMA 5BYSA 3OBYA 4RJVA 4JKAA 3N5FA 1R0BG 2HW3A 1S72S 3CCQS 2DNKA 4H54A 2C28A 1RTIB 4LFAK 3SSRA 3TA1A 4BVPA 2WSFC 5SUHA 3PJWA 2F9JA 3CJRA 3AA2A 4RL1A 3B8HA 2DRAA 1Q8LA 2D0PA 3GONA 4OGEA 2RJZA 3OYDA 2C2DA 1I5OB 1P9QC 1Z4UA 5CAAA 3HZGA 1ZBHA 2PN6A 1NGJA 1U1RA 1IQTA 1RNHA 1UOCA 1SV5A 4DV0J 3BYPA 2UXCF 2CUYA 2FJEB 4FO0A 2DXFA 4OHXA 2X51A 1ZBFA 2DHGA 2NUBA 3NF9A 4JK8A 4F0MA 3S6EA 4PG6A 1G2EA 4LFCF 2CH5A 1NZAA 4NXNJ 3IS9B 4CO0A 3SUPA 4FWLA 4LF6F 4WYBA 4CJVA 1Y4ZB 2FF3B 4OZ0A 1RWMB 3KXDA 5L39A 1HBUB 1QJHA 4LVNP 2GMHA 1QY7A 2BQUA 3H45C 1XQSC 1SV5B 3BV8A 2IAJA 4CCHA 4ALZA 3DOKA 1UVNA 2JOQA 4C1NI 2DGWA 5IT9O 4ZDNA 2AU0A 4HTLA 2GWKA 4YORA 4F3OA 2I5JA 1N34K 4CFCA 2GVDB 1CULB 2W9BA 2J7KA 4OX6A 3W2WA 4NXNF 2GEMA 1N6QB 4BRNA 4V19J 3VERA 1HNZK 3I87A 4NZ7A 4MMOA 2XC9A 3DLLL 3UWTA 4GKJF 1U1PA 3TAGA 2MQ8A 4IOAL 3TR5A 3OR2A 3D7EO 4OJGA 2UXCJ 4USVA 4BR2A 4S0MA 5H9FK 3AVMA 1IBKF 3CJKB 2ZZNA 1MWKA 1WG1A 1B92A 3VEVA 2CPXA 2FY8A 1KC8O 1FXXA 4QW9A 2F7TA 2C2KB 3MPVA 1TK0A 2M5YA 3OYNA 2EWSA 1RAAB 1QE1B 5J1EB 2RQMA 4OZ2A 4Y2AA 2XTJP 1ICEB 3H08A 3VPZA 2YPZA 4BY9C 4LF9J 3U7JA 2KL8A 1GLLO 2A10A 4MTPA 3JAMY 2XM3A 1WELA 3L7UA 3IR6B 2EBGA 4ILRA 4LRDA 2ZHAA 2KZMA 3OYCA 2JLGA 1I94J 2HVIA 3MEDA 4ZN1A 2YNGA 1KVIA 5DZ7A 1KQKA 2QMWA 2X1FA 3HVRA 2DPJA 3BDEA 3MFIA 3CCRS 4HDHA 4ER8A 1Y3KA 4Y1DA 4E89A 4BQZA 5KG5A 2ASYA 5GIPA 1TKDA 5M1OA 4L6V3 4IFYA 2CWKA 1C4CA 1FWPA 1NOYA 1IWAA 1FFGB 4DS5A 2EW9A 2ASDA 2WVEA 1SL2A 3UPFA 4PKIA 4E98A 1FXLA 3EL2A 2G4BA 5KFWA 3GILA 2B6AA 5KFXA 5T7LA 1SI9A 4P72A 3W64A 1SUQB 1RP5A 2GHWA 2N82B 4FK0A 4WXWA 1SS6A 2V51B 1QZ5A 1R59O 1GX5A 4FLZA 3F2KA 4CF0A 3S3MA 1XN9A 3JS9A 4OJ3A 3VAFA 3SQ0A 2Y1LB 1NOZA 4KGVB 3M32B 4FJNA 3MMAA 1E3MA 4LT6A 3EGVA 5LL6d 2GGPA 3NS7B 2AZ1A 5M2UA 2IPOB 3RMDA 4CECA 4ZJLA 2BQ3A 1AZSB 4KV8A 3M2VA 3V6JA 1S1TB 5F8HA 4LFBK 4MK9A 3H8YA 3OS0A 3BBFA 5AE3A 1X4HA 1Z26A 5BREA 4K4XA 1TMMA 3MDQA 2XLJA 2FF6A 3MWTA 1U1KA 1ATNA 5HOOA 4BRAA 4LFAJ 1FK9A 5ADXA 3DGPA 1CPZA 2EC2A 1PBUA 1VC5A 5HMYA 5IC4B 1IKWB 3P8BB 3H90A 4IUFA 5IWAK 5HQLA 1ZBLA 4HUEA 3IC1A 3VVTA 3HT3A 1HNIA 4KH5A 3LGHA 1U0HB 4CEEA 1BWVA 3O1LA 1VCTA 3KHGA 1QVGR 3AGKA 4WE1A 1XC3A 2GTDA 5HVHA 2WUSA 4WFAQ 3G6XA 3AJ1A 2GJFA 2VU5A 3T41A 4QR0A 4UOFA 3JXOA 4DZ6A 3CC7N 2KH9A 1BI4B 1RAGB 1YVNA 3UKRB 3HFVA 4C23A 3BB5A 4B08A 1BU6O 2VBXA 1KD1T 4JK7A 1A5WA 4LF7J 4CIOA 3LP1A 5AQNA 3R2DJ 4AE5A 2JEIA 4W5RA 1NRKA 4M63A 2DFFA 5GINA 3MF5A 3FK4A 1KCFA 3QETA 1HW8A 2CQ4A 3UDCA 2UUTA 4W5NA 1R43A 4DR7F 2VKZG 4WIIA 2JL9A 4DR2K 2YNIA 2FZGB 5L8RC 3UDVA 1GXTA 3POTA 4FM0A 1HNVA 2C3YA 2PGCA 2Z2LA 2XWXA 4DSKA 3IR5B 1LWEB 1GLAG 1VQ9N 3BUZB 4OI1A 3O4WA 1K8AT 2V8VA 3SMSA 2J7WA 3HLUA 2XS7A 1J6ZA 3OTDA 3CERA 2RT3A 3SNNA 3VGLA 2IYIA 4W92B 2WRMA 2DR9A 1XNQF 2AX1A 2O1PA 1QLNA 4DV5K 2DCUB 5A8WB 1F3VA 3MI7X 5AXLA 3ZTOA 1KVBA 5B0GA 1YSJA 1PIEA 4DFPA 3NXZA 5AQUA 1WHYA 3V5RA 4DF4A 2K2PA 1JX4A 2CFXA 3I4HX 3AVHA 2UP1A 2G8KA 3V6DB 3NEKA 2AP6A 3KJFB 2OD4A 1W9HA 3CIMA 4H5TA 2RB7A 2HBLA 1N34J 5F8JA 4B8CA 4PXDA 2UV8G 1GXLA 5FLXY 1S9GB 1OPIA 3AVBA 2YCHA 2RVJA 4CJFA 3BH6B 5IOLA 2UUBF 2D4WA 5B0FA 3CO9A 4K5SA 3J7YU 2YJFA 3WIUA 2BJ3A 3NNCA 3ZZRA 4OHYA 3KG1A 1M5PC 2LA6A 5IM0A 2FD2A 4WFAL 4X4QA 2J0QD 2E6LA 4CLWA 4EZ9A 1T3VA 4ZIWA 4NLGA 3PR4A 2R7WA 4CLYA 1HPZA 1NK9A 3QRRA 1HWKA 1L3UA 2P9KA 4JI2F 3PO5A 3V1RA 4RR5A 5ETVA 2NRRA 3ID6A 4CO2A 4DG1A 1U8SA 5SWMA 1MSWD 2HBYB 1FW6A 4H0XB 3RAMA 4TVAB 1D5AA 2BYCA 2LECA 2UVVA 2E9ZA 2MY7A 1VRUB 3FE1A 4IBNA 1WKKA 4KH1B 1M90T 3CCVS 1M0SA 1U24A 5B0CA 3ZSOA 1U2FA 2HBZB 3V9XA 2EFPA 1HKGA 1K9MT 3T1YK 4FF3A 2Z4PA 4NLWA 3AA8A 2P9UB 4UQTA 1UTAA 1ZETA 4LF5J 4NYZA 1MN7A 2BXJA 3EGZA 2F8TA 3BM7A 4DN9A 1FDDA 1K6YA 1QHTA 4IFYB 2BRKA 4NYOA 1GEHA 2P9CA 4RWWA 2QWRA 2WK4A 1XWLA 3TEHB 5JLFA 3W61A 4DFMA 1D8ZA 4AHVA 4RNMA 5KAKA 3S01A 2WW4A 4FWKA 4LRAA 1WG5A 4FOIA 2H51B 2XNQA 4X4RA 2VDHA 4U8VA 2B4UA 2FSKA 2O8DB 4BACA 4DF8A 4H0YB 2AD9A 1HA1A 3JAMU 4P6QA 1BGXT 3WIVA 2ZH2A 2E88A 2G8IA 5KFDA 1JCGA 1AROP 1ZA1B 3OSPA 5DQGA 2CQ0A 2WCXA 3THPA 4J9OA 2CQCA 4DPYA 3Q23A 1YRTA 2GIQA 3IBWA 2E1MC 3D2EA 1J54A 2GC8A 3QIDA 3PXGa 3WXIA 3NF6A 2PEBA 1KN6A 1RFQA 2XMTA 1C1CA 1IBKK 2DNPA 1BA0A 4IEEA 2ROEA 3O5TB 1IXKA 3CDEA 2MGZA 4GKKJ 1QAJA 1KHWA 2MZJA 3SCIE 1NDCA 1RHKB 4OZ1A 5FLXU 3J7AP 3JTPA 4LF1A 3SJJA 5KPZA 1BD6A 3JQKA 4DBQA 4BRIA 1G4CA 3E8OA 1WC5A 5C25A 2Y1JA 1YJWS 1U2VA 4BR0A 3HSGA 2QXLA 2RHQB 3K8VA 3M8YA 4CH7A 5H9FJ 3VQBA 5FPEA 3NGSA 2JVOA 3AAPA 3VQ4A 5KFGA 4IH5A 4ED4A 4JKFA 4RPFA 4DTJA 2Q6CA 2GVDA 4CGGA 4NRTA 3TZYA 1PC5A 3VQTA 1VQ4S 1N36K 2EFVA 3FRZA 5H1SV 2ROPA 4F2RA 4DR3K 4R0JA 2DPIA 1AUDA 3P38A 5SZTA 3K57A 5D4LA 2QE5A 1DAXA 3I9ZA 1KAYA 1SQKA 4DMZA 4U7UK 1DTTA 3HCXA 1B70B 1YAGA 1PJ7A 4FWPA 3CD6N 2A3ZA 2UV8A 3C6TB 2ZH4A 1J5EF 2HHPA 2D3O1 1VR6A 4M42A 3IUCA 5H1SQ 2IVMA 2CPDA 5LJ3Y 3HSZA 2DIUA 1SJFA 5FPDA 2OPPB 4LF7F 2B4JA 3A5LC 4KFBA 1W2BR 3EN9A 1VSMA 1S9FA 3VGSA 5D0EA 4WPAA 2IRXA 2WB4A 4Q43A 3NY0A 2R8JA 4GVLA 4B9VA 4JD2B 4F0HA 2HB5A 2DNOA 4O5BA 2W1BA 3KLVA 2XMMA 3BN7A 4Y2KA 4DKWA 3TW0A 2XWYA 2VYPA 1NM1A 5CZXA 2VOOA 2MPUA 1PYOB 3Q8YA 5KG4A 2K06A 3U9ZA 1HQUA 3VN5A 4QS7A 1XMQK 5J2NB 5HMZA 1HR0J 2IBKA 3TOQA 3EX7B 4PQAA 4FS2A 1DEJA 1NU4A 1X4GA 1A7GE 4EGLA 1WF2A 3THXA 3P39A 4C6AA 4HACB 4IKFA 4ILLA 2CZVC 4DV1J 1MWMA 5L1LA 3H25A 4B9UA 1D9FA 4GY2B 2PD1A 3BGOP 4XDCA 2QWLA 5TKWA 1FJGJ 3R8EA 3PYEA 3LO3A 2XSFA 2QFJA 2YNGB 3WEEB 2EFNA 2KB2A 2W7OA 2DO0A 2BVZA 3TA0A 3DC2A 1GLBG 1ZBSA 2DBBA 3OHAA 2BACA 3S7RA 4OYAA 4A8KA 3OFFA 1N54B 4USUA 2KXNB 3KLFB 1R8PA 3ZSRA 4BC4A 2LXUA 4DFJA 1X3MA 2CXEA 3H4BA 2CQ3A 3TO8A 2HAFA 4C8NA 4CGJA 3I55S 1GQEA 3W8PA 1S99A 1JNRB 1FRIA 5ETSA 3P49B 5BN8A 4BG9A 4NWBA 4CM0A 2YNHA 4NLRA 1U04A 3TAMA 4ELUA 5KFKA 1AFJA 2E5GA 1Q95G 2DVIA 2AA4A 2A3JA 1HUXA 1DARA 2D5RA 1ZBUA 2PDAA 2EXUA 2X3GA 4MIWA 3AD8C 4ZLJA 3AA9A 5ETKA 5AT1B 1NHKL 2V8HA 3AY0A 4YHHF 4EHUA 4FJ8A 4UY85 4ZPWR 3I5BA 3OVNA 4JI5K 4CT8A 4NCGA 4R0EA 1MG7A 3V2UC 3UFCX 5IT0A 2NRTA 3ULHA 1U4BA 2E7WA 4Q5VA 1ASUA 1G6BA 4OZNA 1Q9XA 2JVRA 1KQSM 1VQMN 4KB0A 4USKA 4DTRA 4U67Q 1RTJA 2L9NA 2PT0A 4C3LA 2QA1A 4OHWA 2CJXB 4CEDA 2I0XA 3A5OC 2OIHA 1FEHA 2PI5A 3ALYA 1JLQB 4ZTFA 2V6AA 1IN0A 4IO9L 2HBQB 4IOCQ 4LF5K 3KD5E 3Q8SB 4CLFA 5BPLA 4LF9F 5A8RB 4CJ5A 3AAWB 2NNWA 3MOZA 5FPNA 2XS5A 1RBAA 2DITA 4AHUA 2XYHB 4JI1J 3TJ8A 1VDHA 3T5HA 1ZBIA 4BRPA 5LXYA 4NASA 4ED1A 2Y8WA 3RBXA 4LFBJ 1WG4A 1TP7A 3ZSQA 2FTRA 4JBCA 4FWOA 3DM2A 1N5VA 4IQXA 4A4JA 3ASMA 1WHWA 4MDBA 5HO4A 2AZ3A 2OEJA 4CGFA 4ICLB 1VQLS 3KLIB 1RT4B 4YHHK 3GIJA 2OTJN 4JI8J 2FJWA 1ULRA 3ZZ0A 2LQBA 4RUAA 2WTUA 3ENQA 4BWJA 1H7XA 4BRMA 3T5KA 3GU0A 3DOMB 5GAHI 4ISFA 4CZIA 2DPNA 3VESA 4ZOSA 3U1LA 4NYNA 1WTFA 3ZX2A 3L9ZA 5ETOA 1S77D 3GLJA 2LLZA 4NLXA 2QWOA 4BC3A 3NLCA 2CGKA 3QDKA 3OYHA 2MQMA 4NA1A 1X5PA 4CJEA 3BPDA 4OLAA 1Y00A 4GVBB 2GJ2A 4Z7CA 2XSJB 1F1BB 3RAXA 3GSIA 3ZT2A 4ECWA 1PO6A 3O3FA 1UPPA 2W4PA 5HP1B 2UUCF 1YBTA 4N41A 2J6SA 2HZCA 4ZJQA 4U7CA 4ZN3A 2O8EB 3I5AA 1VQLN 4DR1J 3SLCA 3L8BA 4K59A 3CI5A 5CXTA 1NGFA 3U1MA 1BA1A 2X7IA 2HVHA 1GK8A 3BQ0A 3FCHA 4I6YA 4JKHA 3ZTPA 3QGHA 3FBBA 3NCQA 3T1YF 1KVKA 4NLQA 3RR7A 3M30A 2AW0A 4N7TA 4DG1B 1F2GA 2MHEA 4FL9A 3SMZA 1RT3B 3G9CA 3OHRA 3MPWA 3NDKA 5FIIA 4EMDA 2AWZA 4Q2MA 2GX8A 2W7AA 5KGXA 3DLBA 1VC6A 1Z2ZA 4OVLA 4DB3A 4I2QB 1KOOA 1Y5IB 2DGSA 2IA0A 1AW0A 1JXVA 2Q3PA 1P6TA 1X8DA 3AJ2A 2DD8S 2J4RA 4USMA 2FPHX 4DEZA 5KFIA 3ITHB 2UUAF 1N33K 1JQGA 1SJ3P 3AJDA 3NHGA 4YP3A 3SI8A 1UCNA 3C6TA 4QPTA 3C7NB 3SEOA 1YIJS 1KP6A 3VGTA 1SJ4P 3TPQA 2FVPA 4A8SA 4R8UA 4CHPA 2CQIA 5E7OB 1AB8A 5JXSA 4B3OB 2EC0A 2DKOB 1VHFA 3V81A 2G1HA 4BROA 3KD1E 2CPIA 4CFAA 6AT1B 2EKNA 2RHKA 4K0KJ 1RILA 4X62F 2QLBB 2ZZMA 2IM1A 3C0BA 2IRUA 3W2WB 3RB6A 3EM1A 2KVIA 4M3UA 3THWA 4MFBB 1RI7A 2E6MA 4P7TA 2L9DA 4RUHA 3O6QA 3NMUA 3J80Y 3VQ5A 1V3RA 2A40A 2VG6B 3N4WA 3VR1A 2WONB 2P9KB 2E66A 4ID1A 1CSJA 5D0GA 4ED2A 1UZHA 3VQEA 2R7UA 1KAZA 2GJIA 4LFCK 3J81O 5T7BA 4TSXA 1IJFB 1NK6A 4CJLA 4J2AA 3ULEB 3WHIA 3AVCA 1I3OB 1JXLA 2CKWA 2CDRB 2HBRB 5LMNK 4QU7A 1LFPA 5F0WA 3MZIA 4UY8O 2GS8A 2HS3A 4DL7A 2XCPA 3B4MA 2J0XA 2ZE2A 2GX9A 3SUQA 3TTDA 4DTPA 3Q83A 4QCLA 1UWBA 2CNKB 2XI3A 3H5XA 3MMVA 5AQYA 1S4EA 1Y5LB 4ANCA 4PEOA 1S1UB 1VAZA 3N0VA 3P5TL 2IVPA 2ZBIA 1RDCA 2B8QA 4KH4A 5E0OA 3CCJS 4M7YA 4M5MA 1U8WA 2AHOB 1UW4A 3NG8A 2HK3A 4YY3J 4M5JA 3DXBA 4TU9A 1Q8KA 1OSCA 1RAFB 3DYAA 4CZHA 4YDUA 2AV5A 2HS0A 2HFOA 5DRKA 1YX2A 2NCKL 4CRJA 3PVXA 3OYGA 3HHLB 3OW2M 4M3TA 1S6QA 3PHEA 4NEZA 5EOYA 4FP9A 4LBHA 2GHPA 3MFHA 1WUUA 2E1ZA 4L3QA 5F8IA 2VFVA 1C1AA 2P9SB 4OJRA 1TKTA 2VFTA 4CJUA 4LQ9A 4GC6A 4FLUA 4IDHA 1WOPA 3BN4A 2CQGA 4JYAK 5K8OA 2GV1A 3FSIA 3LF0A 1WEXA 1PGZA 4YOTA 5B08A 4GO7X 4MT1A 2OFHX 3KJQB 3PIOQ 4WQ4A 1NJXA 3LP3A 1FNOA 1R6VA 4BVOA 2B4PA 2QXFA 4JI1K 2LSNA 2A42A 4RZRA 4W5OA 4DUYJ 1K0TA 4M63C 2HFUA 3D2FB 2F9WA 4DJBA 3QYYA 2KG1A 5K9FA 3OVBA 3SFUA 3TR8A 1BQXA 2KT2A 1RHQB 1H38A 3KUHA 2B7CB 4XK8C 2ILZA 2IDOA 1K1SA 1JLGB 3VF0B 2ADCA 3BSCA 3BO4A 3A2FA 1WLJA 5LSOA 4C7QA 2DHHA 3U02A 3AODA 3IMXA 5E26A 5F3ZA 2NZCA 2MEWA 4FF2A 2YHBA 2BE7D 3WXLA 3MPDA 1PYTA 2PMHA 4CHQA 1RISA 2XYGB 2P5OA 2RKIA 1BO5O 3OV7A 4TN2A 1BUXA 1EKRA 2IRYA 4FNHA 1L3SA 3C14B 2IJRA 3M8SA 2OLWA 5ETQA 5KFOA 2P5GA 3X1LB 3FBFA 1X3NA 3PR5B 4B1ZA 4ES1A 2MYFA 3HSDA 1OQ3A 8ATCB 3CEDA 1P9YA 3ZC4A 1QAYA 1FKPB 1XC9A 1X5OA 2FC0A 2E7VA 3T6BA 1BQMA 4FXVA 3BPSP 5HBMA 1Q81T 4FJGA 4NLCA 3DLJA 2CQDA 1YITS 9ATCB 4Z0UA 3M6WA 3VAIA 3WNHA 1Q7LB 4UOGA 4ILMA 1HLWA 4DQPA 1LK5A 1N5YB 4FF4A 1RE1B 2CAJA 2O01C 2R7VA 4WIQA 3SZ2A 4P75A 2KFZA 2BX6A 2LP4A 2JSXA 3AVJA 5ELZA 2W8LA 3NGKA 1FFWB 3PKYA 3GYNA 1NKBA 1HNVB 1RWVB 1Z05A 1U0SA 4IRDA 4CZMA 5JS1A 1FE0A 1URNA 4WCEL 3JB9k 1A5VA 4F36A 2B43A 2ZJQQ 1I3AA 1AFIA 3CJ2A 2UU9F 1S6QB 3TVZA 3HL8A 3DI6A 4B3MK 2O8BA 2E5LF 2QFIA 3K2YA 4I6MB 3CJ5A 4WU3A 4HHUA 4HI2A 2ASMA 3UKRA 2XGQA 5F8NA 2VH7A 3O3HA 2FB0A 3R5JB 5AQWA 1IR1A 4XPEA 2D41A 4I6AA 2QLFB 3L3CA 1X9MA 3I56N 5BYQA 4QWAA 2R7XA 2W24A 2B51A 3VVUA 2VICA 3R5BA 2VWJA 1UVIA 5AE2A 2X6SA 4NLBA 2CJQA 4PA1A 2B3TB 4KHWA 3OTBA 4JP8A 4ZVQB 4MKVA 3MAQA 4BDYA 4JI6K 1SQFA 2HLTA 1DKGD 3NCPA 1KLMB 4ECRA 1VJWA 3W60A 3KJVB 4OLPA 3Q2SC 5DJBA 3ITHA 1AXQA 1KD1O 2B4VA 4DV6J 3GYGA 4PPDA 5KPTA 2Q66A 1O51A 1S6PA 2WAQD 4DU4A 4YQWA 3BEXA 1RWXB 1EXQA 1NJIO 2UXBJ 1L3VA 3LWMA 4DV5F 4FJ7A 2GIFA 3M2VB 5IZHA 5LJWA 1YUWA 1JLQA 4DSLA 4AT1B 3D6FB 1ZAXA 2C1EB 2WSEC 1K73O 2W2OP 1X31C 3H3NO 1KFDA 1S0OA 3HSCA 4HH0A 1XI1A 3LOUA 2NXEA 4DTXA 2QX0A 2HNYA 3VQ8A 3IKMA 4OHVA 3ZZOA 2W42A 4KBIA 2IDLA 2W9BB 1RQ0A 4CE9A 4Q8FA 1XR6A 3AO2A 6FDRA 4CEFA 2YWKA 2J6TA 4KSEB 4I67A 3KHHA 3DLEA 2GHVC 4E7JA 2BJDA 1U1MA 1KQSR 2OCEA 4GNIA 2Z56B 3NOCA 2ASJA 2APOA 4HVZA 2KM8B 2EX3A 5CYMB 1MU2B 3T9ZA 2HGMA 3IS9A 3AY9A 4ETXA 5L1JA 3KK7A 4C4WA 2G2ZA 2V8PA 2YKAA 3KWMA 3GR0A 3C6UA 2KKZA 1YBUA 3CCUS 1SC1B 4QPXA 3GPAA 2NPFA 2C42A 4IOXA 1XMOK 2EHGA 2BMBA 2HF3A 3DMJA 5M1PA 2MLYA 4XAKA 2GO8A 1IBLK 3OY9A 4K8ZA 3H5UA 1VQNS 1VQMS 3CCZA 2ZDPA 4ZVSB 4B3TJ 2ZGZA 3OYIA 2YY3A 1NM2A 4Q2LA 4KHNA 1XNRK 4OZ5A 4HHJA 1XJWB 2X74A 2G13A 4MQ3A 4LH4A 3CSKA 2GUPA 4LSZB 4CLTA 3RSEB 2HMIA 3OVAA 3KNAA 3AHPA 5AQPA 1U1QA 1GMVA 2ATLA 4HEA9 1QVFR 3W2VA 2HHHF 1SZ2A 1VHXA 1ILYA 4NLOA 4CFDA 1UVKA 1UL3A 2FVSA 4RBVA 3GB0A 1CXUA 3P31A 3LUYA 2VPYB 4P7VA 4LSLA 1QTNB 3PW7A 4BRKA 4C8MA 4FPAA 1JLCA 3BSOA 3MUTP 2O67A 3D68A 3RYLA 3KWIA 4EU0A 4H03B 4ZP7A 3NVKA 3SJHA 3O9QA 2LQ5A 1KXPA 2FJXA 4KHPJ 2WBMA 2Z1HA 1NSQA 4RW8A 1LWCA 2DHXA 1RT2B 4OI4A 2LKZA 4LREA 2IAJB 2IM2A 4NI2B 4C11A 1EQ0A 1CZAN 3O1WA 1HKCA 3CCSN 2KO1A 3R5DA 1HQEA 1F9EB 1VQ8N 3D1QA 1S6PB 3KFWX 1P1TA 3L4IA 1UVLA 2YKNA 2F8HA 3NWGA 1R0CB 2ZKUA 3PDNA 3BQ2A 1XNRF 3IM8A 3KHYA 2LQJA 2HVEA 3VV2B 1HRHA 1TL7A 4I2QA 3RMAA 1RHUB 4M3RA 4Z4EA 1HHQA 1CVJA 3QFWA 4DV7J 1FO1A 2OGUA 3TJAA 2RDIA 3FZBA 2G8HA 1RBLA 4LF6K 2VQEJ 3Q7CA 5HVFA 2AKWB 3EXCX 3QIOA 4ZJOA 4Q44A 4NXMJ 4FNIA 3VA3A 1T05B 4KIAA 3UW1A 3QNOA 3RRGA 4CEAA 3DXSX 3RWUA 3K5PA 4CJTA 1RTIA 1WC1A 1RDAA 4Y00A 3Q0AA 4EEYA 1N32F 2X1AA 3GIKA 1CJKB 3C3LA 2EBEA 5IWAF 2H5JB 5HSPA 1J5EK 1WNSA 4ZTJA 4K8RA 3SQOP 2Q36A 2HFSA 2ZOFA 1C1CB 2CVIA 2R4FA 4DUZF 1KKHA 1IBMJ 1HWUA 1FKOB 2YKPA 2PEHA 1RTDA 1HQ2A 3DDNA 1S79A 2F65A 4X4SA 3D7SB 1FJEB 1VSFA 3CMAS 3IBFB 3GE1A 4KTZA 4MDAA 5K8PA 4H8KA 1HW9A 1VRTA 2AJ4A 3HD1A 4ECXA 1IR2A 2ZBPA 3QNWB 1Y0HA 1BISA 3NCIA 3AGRA 2MQQA 4FKXA 4WF9Q 4FYYB 2LXFA 2R8GA 1WACA 4AL7A 2XHWA 3GCXP 4N8OA 4AXJA 3O8MA 2K1RA 3OJUA 2QMXA 4FJXA 4KE5A 4PXCA 3CJ9A 2LEPA 1BWEA 1B0PA 3UQSA 2HYIB 2DGOA 1TFYA 2QL5B 3SDEB 3KLHB 1SKRA 2HK2A 5KG3A 2O8FA 4MFBA 1RU2A 3I0SB 1G3OA 2E29A 3G6YA 2C2EA 3RG6A 4IFEA 3DGVA 3DFEA 1NAQA 4I9QA 3ID8A 1RKJA 3UCGA 2LU2A 1LXNA 3R5CA 2JZ5A 1S72N 2G9OA 5EGYA 2E5IA 5HLFB 2OMLA 4RW9A 2LQ9A 1KTVA 3ZTSA 2VV5A 4CF1A 5KT2A 2BUNA 2N3LA 3UDEA 3MPUB 4NCAA 3ET6A 2MTLA 1M1HA 2CZ4A 4JI7K 3BGUA 3MXHP 2CPFA 5U47A 5FJ4A 4RLEA 4JI7J 3EO3A 3BBCA 4B3MF 2P51A 2PBDA 4ZHRB 1KVCA 4PWDB 2N7CA 1WC0A 3BZCA 1JXBA 2HHUA 3VTHA 2Q1LA 4OJHA 2BJ9A 3LPYA 4Y2MA 2ZUAA 1G15A 1U6FA 1LEOA 1QM9A 1IKVB 1N4LA 1HIYA 1QD1A 1IJJA 4ZHRA 3W9IA 2E5LJ 3FVYA 1ZH5A 4W90B 5KT7A 3R6MA 4DTOA 3W65A 1YDLA 3U4LA 2DNMA 4XDDA 4CLPA 7AT1B 4URQU 1BY9A 3VZIA 1QQCA 1VQ8S 4E7KA 5ETPA 1TFWA 1FA0A 5IS2A 1YXQA 1S1VB 4NI2A 4C11B 1S9GA 2YBVA 1JL1A 1JJCB 2OSRA 4KAZA 5F2RA 2HKEA 3W7BA 4PKHA 1C0UB 4YOVA 2YNHB 3DXKA 4F67A 4QU6A 2L48A 2DR8A 2R2TA 4QBUA 2WBNA 1WC6A 2OAUA 1S4FA 1YKWA 2KRBA 5F0XA 3TQEA 1FTRA 4OIXA 3A8EA 2JDJA 1EETB 3DOLA 2HWIA 1REGX 3MAAA 2G0JA 3VQ6A 3KDOA 2AJ2A 3AXMA 3AAQA 1RDUA 4B3RK 3D0IE 1C0TA 1R27B 2K1RB 5KI6A 3QFUA 2L08A 3GR1A 1HARA 2MQNA 2RQKA 5GADI 4X64J 5M1NA 5DLFA 3QO9B 1FX4A 4OLOA 4ZKAA 4NX9A 5GAHP 1HR0F 2EEYA 5F9LA 4EP5A 4E2FB 3SAFA 3R7SB 2EG1A 3QGGA 2FLPA 1BWFO 4DCOB 5GMKa 4I69A 2QTDA 1VMBA 2FHOB 2RE1A 1FHTA 2E1YA 2CIMA 5J2PB 1YGYA 2KM8C 4FCYA 2R42A 5L1KA 3IFRA 3ILJA 1WSGA 4EIAA 1GTEA 1T44A 3CCUN 3O2IA 3O9RA 1RBUA 4K50A 1EP4B 3HZ6A 1X4EA 3T9NA 2ZFHA 4OPJA 2DY1A 1CJKA 2HGNA 3UKUA 2HRUA 3C6AA 4R79A 2MKCA 3VGVA 1HI8A 3F44A 5E3RA 1CQNA 4DSIA 1FNMA 3IG1B 4KB1A 3TTFA 2KJVA 4YDUC 2HLUA 1XNRJ 2B0GA 3K58A 5D6GA 4B1UB 1S1XB 4CQ1A 2R7YA 2EK6A 2J7UA 1RHJB 1FRLA 2FBVA 3ETMA 3GIMA 3D9BA 3PYDA 1RB0A 5EDWA 1K44A 3PW0A 2V0NA 1M5KC 3OVSA 2ZM6F 2H9ZA 1SVDA 3L7PA 1VQPS 3MCNA 4B1YB 2XY8A 2MSSA 2VQFK 2UXCK 4PXBA 3OYBA 2AYMA 4CLUA 3CE8A 4JOUA 2UU9J 1QSSA 4NYPA 5H9EJ 3TAEA 3D0HE 1U2RA 3ZZPA 1HKAA 2ZBRA 4LF2A 1IUJA 3BJYA 3U6FA 1S97A 3O8WA 1FD2A 4DHYA 2P5VA 1S9EB 1RAJA 3CCES 3VEOA 2DO4A 2YJEA 1MNEA 4ZP9A 5DDOC 5M2RA 3HHEA 4IR9A 1U6ZA 5GAEI 2IIHA 1RAIB 1APSA 3IG1A 2P9LB 2FVCA 1FNXH 1T9TA 2KQ2A 3DRRA 1VC0A 1N36F 5JMNA 5LOQA 5KFCA 1N34F 4DV2J 1RT3A 3OXGA 1JJHA 4KC5A 2C3PA 3CMES 2I1RA 2YX7A 2FHMA 5JVHL 3DNCA 7FDRA 1VQ5N 4WFNQ 2QLXA 2HZVA 1SB6A 3D2EB 3NAIA 4RW9B 5KG7A 3AO1A 2W2PP 1N5QA 2BJ8A 2H4WB 3SQ1A 3PTWA 5KFPA 4DX5A 2OELA 4ZVOB 4AHCA 3MK6A 1OH6A 2IOCA 2ATQA 4RTFD 1T9VA 1WAFA 2IJFA 4ZVUB 3MM9A 1S0MA 4DR1K 3ZX0A 2GO9A 3C19A 4ECQA 3L4QA 1X5SA 4FJ9A 4AHRA 2AEMA 5HQ8A 1VQOS 4X66K 4CEOA 2NREA 1P8ZA 5HRPA 4E1NA 3ILOA 3M9NB 4MLEA 4BR9A 4QJVA 4CFBA 4DL5A 3LDQA 3MN5A 1XQIA 3NGZA 1BIUA 1SC6A 4OKEA 2PYJA 4J9SA 2ZJRL 4KAIA 1V3ZA 2DNRA 3GFXA 4PCQA 3RBDA 1IR0A 2O8DA 1LWEA 1MMLA 2IBOA 2VPZB 3H59A 4JK9A 3VQQA 1NH8A 3QEVA 1B0VA 4X64F 2MB0B 2V4RA 3D1OA 4DR5F 3TANA 3T6JA 5CHIA 3HBTA 1K73T 3CCMS 3WQTA 2QN6B 3T1HK 1O0PA 2ZD1B 3DLLQ 3HPOA 3H2LA 4RU2A 4WFBL 2VPXB 4ZLNA 4ED0A 1NDLA 4JI2J 3QPIA 3BZKA 1NCLA 2AGPA 2HVDA 4IR1A 3ZT4A 1WBBA 4LRBA 2MJNA 2NSCA 4M3ZA 5FLXO 3UNGC 3MR5A 4YEAA 1S7IA 1J27A 2FHKA 3G4SS 3LZJA 3A5MC 2MZRA 4F02A 2VIHA 3B8AX 2GZOA 5KFUA 4BWMA 4CLKA 3DU5A 3FNNA 5ETTA 3CJBA 4Z4HA 1NXIA 4D3GA 4A48A 1IWGA 4F3TA 1W0HA 3T1YJ 3AO5A 5AQVA 1D9AA 1QTMA 3CFRA 1YT3A 1WC4A 1VHIA 4BG8A 3T19A 2B8PA 1W97L 1EO1A 4ETZA 3ULDA 4OX9F 2FSNA 2DGUA 1FD8A 5BRDA 1YTYA 4WFYA 1O1WA 1FDBA 4WZQA 4B3MJ 2YKNB 1FRMA 2A5XA 4CJRA 4QWDA 2MGZB 1PJ6A 4DTUA 3K5OA 4OZJA 2SXLA 3I8BA 3SI6A 1RWNB 3E3XA 4U7UD 5AQGA 1KLMA 4UTGA 2E20A 4YFUA 5IQQA 4LF4J 2J9DE 4F50A 3SXLA 4M5NA 1JNZB 3TJ9A 2E1PA 4BS2A 1YTUA 4MIAA 1FESA 4UF4A 3QMLA 1S22A 4OFZA 3KOAA 2E44A 3MECB 5CHCB 2G2OA 1VGYA 4F4AA 4L73A 2L9WA 1V6HA 4ILHA 1SJRA 5F8LA 3GQCA 3RB0A 4DR7J 4IJAA 1NGIA 3G87A 3SBMA 1HNWF 2M2BA 3QO9A 4U67L 3NGIA 4WKYA 1DURA 1XUPO 2P9SA 1SUQA 3ZSVA 4GMJB 3ISNC 3UDLA 3SQ4A 3EZOA 3CPEA 2NLWA 3D45A 3ISZA 2PMZD 1WWHA 3V9SA 2C2RA 1YJWN 2CPHA 1XMQF 4R5PA 2HF4A 3TSQA 1I94F 4QYZK 1HPMA 2CYYA 4J5OA 4QYRA 1TL3A 5IV4A 2UXDJ 1HJRA 1LAVA 1C0UA 1NLVA 3AVKA 4J2DA 1N6QA 4TU8A 1IBMK 3Q7BA 5CZ1A 2P6TA 4JEPA 3QRQA 4ATNA 1HX1A 4BR7A 4RG8A 3BF1A 5C24A 1WSFA 1UVMA 4OL8A 5E3AA 5IWAJ 1JLFA 3TABA 4A2BA 3LWLA 2V4JA 1FDAA 3LW5C 4C1NK 2UUCK 1Q18A 2FUG9 4B3RF 1T02A 3K5MA 4K4ZA 3MPYA 2DEIA 1TL1B 4NXMK 1GNKA 1BQMB 3FZLA 2PFDA 2F8EX 2KXHA 4R25A 2HSEB 1MU2A 3V1QA 4AM7A 4O3QA 3PX6A 3FCWA 4DR6F 1Q5YA 5CZVA 3KJVA 1HR0K 4DV0K 4YOXA 3W62A 1PILA 2BE2B 4FLTA 1VSJA 2BOAA 5ETLA 3DLEB 5L9NA 3EPGA 1S49A 1K9MO 3WC0A 3PKMA 2QA2A 3CJ1A 3IWNC 1HFEL 4URSA 4NL5A 3NVMA 4CGIA 4Y0WA 5ETRA 3FEYB 2J9CA 3SIPB 2HMPA 3AVGA 1NBEB 3CWJA 4KKOA 1IQZA 2WSCC 3DHXA 4FW2A 5C10A 3IGVA 1VQPN 3TUIC 1SKWA 5E84A 2B9YA 4YDXA 4BR5A 3J7AN 1DJ0A 4PZVA 3RVCA 3I55N 1U2VB 2L3MA 2VGMA 2A2CA 4DTSA 2OI2A 2P6SA 1HI0P 3BZQA 4PWWA 3OS1A 4K2XA 4ED5A 1C2PA 3UVJA 2VKRA 2F5GA 1S1WB 1CJTA 4RNHA 1RADB 2ASLA 4F26A 1HBMA 3H5SA 2ZC4A 4HDGA 4O3OA 3MM5B 4TY8B 2A1SA 3D6MB 3CCEN 4NRUA 3G0ZA 2YNIB 2BRLA 2FJDB 2RDJA 1LOUA 2DT9A 2QEXS 4M7XA 2PAVA 1BMQB 3EXYA 2XO6A 3M8WA 2VC1A 4DR6K 3OUYA 2R8IA 3CDAA 4CDIA 2V94A 4KHQA 1UJ5A 2KT5A 4FVUA 4P2XA 1D1UA 2BJ1A 1S3XA 5AZJB 4YB5A 5IXUA 1NEEA 2ZNZA 2MKIA 4J9NA 3MR7A 3GP9A 3A5NC 1DTQB 2MZSA 4OQJA 5MAOA 5K8MA 1HL6A 1BOTO 3GE9A 1PBAA 3WZ0A 2QYGA 1UWAA 5DDPC 4DV6K 5KG2A 2Z1IA 1VSKA 4FXWA 3UN2A 1KC8T 3MDFA 5LMNF 2HQIA 2Q0UA 2EVZA 1UA0A 4DU1A 4FJHA 5K14A 1J5EJ 1IKYB 2MZTA 4JUZA 4ED7A 3I8DA 2G2YA 2R7QA 5AZJA 4IZ9A 2H65B 1GAOA 3NL0A 3FQKA 2C3MA 2IMOA 3P96A 3DLHA 3E01A 4I68A 1YIJN 3CJKA 3GV8B 2JX2A 1VYAA 4YHHJ 3FGUA 4F8RA 3N4PA 3L2UA 4CO1A 1R31A 3NS6A 4LRFA 4UZCA 3TYTA 1LOTB 1VISA 5D77A 3GFHA 4XH4A 3OYLA 3UN3A 1IBLF 2L41A 4ILGB 4KGXB 3DXMA 1LFWA 3P4UB 3NWRA 3QNNA 1VBYA 2PSZA 1CJTB 2UVRA 1BQNB 4KHRA 4D3HA 2G8UA 1V9OA 3SV4A 3MMCB 2YKMB 2QL7B 4BC9A 4ZCIA 1R89A 1MMDA 1RK8A 2V52B 4DWIA 5AJ3K 1FWKA 2W9CB 3KJNB 2E5HA 3MMCA 1HBUA 4O8UA 1VQ7S 5ETMA 4X84A 4CK1A 1WEYA 2ITGA 2K7KA 5JMVA 1NNDA 4PR6A 1EQMA 1FVQA 4B9LA 1KSPA 4TQSA 4BQLA 3M32A 1GMUA 4KPYA 1H1VA 3ZT3A 4WXOA 4NE9C 1JCFA 3B54A 5KRSA 2HHHK 3NOGA 2LVWA 3LTOA 2QYCA 5AFUH 5HANA 3QJLA 5HI7A 1IBLJ 1KNZA 3G8TA 3PYFA 5AQTA 3I4PA 5BR8F 4E1MA 3HT0A 1RYRA 5KFYA 3ONQA 3J80U 4JLHA 3BEGB 1VK0A 1XK8A 1T94A 2A6OA 4WTYA 4B02A 3MTJA 3P5JA 2FVQA 2Y8YA 2OZSA 3FZ2A 3GDQA 3M4XA 1YQHA 1GLFO 3MCOA 1UFLA 1FTCA 4AH9A 3PYGA 3O5BA 3DRSB 5KT3A 3NMRA 1LW0B 2VG7B 3R5GA 2WBRA 2P9IA 5GAGP 2F8MA 5EX5A 4AM6A 2BOPA 1IG8A 2O8BB 5HROB 3M30B 1W2IA 3QIPA 2MLXA 3H42A 2OPQB 2CZ9A 4DQIA 3FEXB 1OY9A 3DWLA 1A5XA 3QJJA 5J2MA 1VI7A 3R6LB 2EK1A 1HWLA 4OYXA 2OTJS 4NEYA 2UXDF 1Q0NA 4KHMA 4HL9A 2MQLA 3OW2R 5JVGL 3CNQP 1F0XA 4LR9A 1N5YA 4IG3B 2XMVA 3MR6A 3G2XA 2JFKA 5F8GA 3OSNA 4X4NA 3HXMA 4CO3A 2OPSB 4NZ6A 1A6LA 4U9RA 1LW0A 2F4VJ 3UB5A 3SCJE 3MXJA 1LCUA 4X4TA 3I0RA 5F41A 2AYBA 5I3UA 1T03A 2FLNA 1HBNB 1TL5A 3BY5A 4EFHA 1NPRA 4PABA 3GJSB 2NRZA 3TQ1A 1OO0B 3KLEB 4RW7B 4C98A 1NZ8A 3KLIA 5E3PA 4X65J 5JICA 1MLAA 1UWBB 1SBRA 3CC7S 3SCXA 2DGVA 5KFMA 1S1VA 4IFVB 4GKKF 3NH0A 4A8FA 4IH7A 2QK9A 1IKWA 1UP1A 2ZJQL 1ZM2A 3QEXA 3C7NA 4MK7A 4OV1A 4KGMA 3MM5A 4DPTA 3VEWA 4B3TF 3QFHA 3MHYA 3SPZA 2Z1GA 1G99A 2VHGA 3CJ0A 4CZFA 3R1HA 4M5KA 1RTHA 4XTTA 1S1WA 3V6KA 4RUCA 3IRXA 4CIEA 4CLSA 4FZZA 2G0IA 2HHSA 3KK2B 2DJWA 2OPPA 2GQQA 3J7A1 4J7CA 1RBVA 4WF9L 5EWFA 2Y9HA 1YRUA 3B6PA 3JQMA 4B9NA 1CEZA 2M3DA 3Q24A 2OYQA 4K41A 4DR2J 4CBUA 4WK3A 1KTQA 2QWPA 4JRQA 2VQEF 3TARA 1S76D 3OBWA 3SMPA 1KRPA 1V3SA 2DK2A 5HLFA 5A6PA 1I51B 4NMLA 3H0PA 3VF2A 2O5DA 1CZBA 2LQ8A 2FHJA 1TL3B 5FD1A 4QW8A 2R7SA 1DHMA 4OI6A 5DGAA 1J53A 2HNZB 4RO0A 2HIYA 5B0BA 4U7BA 1D3WA 1TUVA 2I6WA 3TZXA 5C2DA 1BXNA 3OL6A 1F5BA 3EZ5A 3IGNA 4FJJA 1KQFB 1UJ6A 1H98A 2AJ0A 2ZKTA 2DH7A 3Q8UA 3KK3A 4DLEA 4WKRA 5JJBA 1N56A 3LGMA 4Q7AA 1ZBTA 5RUBA 4H4KA 3CQ8A 2ZBCA 2QL9B 3KYLA 3MURP 4C97A 4FYWB 4DPXA 5AXMA 2I9SA 3MM6A 2H54B 2J6UA 4LF8F 4BGAA 4CTAB 4JKEA 4P2SA 1X0PA 2KHOA 1OH8A 2DNGA 1LNQA 3L0QA 1M90O 3T1AA 3GTYX 2WHOA 3CCRN 4G65A 2QGFB 3NKYA 1YTAA 1GMWD 1DBDA 4YY3F 4V1Ak 4DDFA 3DRYA 2HFVA 1SL1A 5JLHA 4I7FB 4LFAF 2YQ1A 1FKPA 2I7PA 4AILC 2W4DA 4I56A 4OV6A 1OWXA 4BRLA 5BPNA 4OZLA 3QT5A 4KR0B 2NSBA 5A8RA 3HP6A 2VF3A 2WVCA 4ED6A 1GT8A 3PSFA 3VA0A 3GWCA 4HH1A 2RKIB 1BCOA 1F9HA 3J81U 3RB4A 2LEBA 1VBZA 1YVUA 2G8VA 2BKOA 3B6OA 4ZS6A 3ZSZA 3HM9A 1EETA 2DH8A 3C66A 2V2QA 1WHXA 3VQPA 4KHYA 2J5AA 1WOOA 3UD5A 1Q5VA 2CG8A 1YF5L 1H3DA 3TI0A 4A57A 3MXMA 1X4FA 4PRFA 3AOAA 1ASWA 4BLGA 5BN9A 2Y0BB 4OPKA 5D3GB 3MEGA 4PPZA 1TL7B 3LGNA 3OYMA 5KFAA 3H7HB 3FGVA 4NZ0A 4XH5A 5B0AA 3FZKA 3G82B 4P2FA 2HZAA 4PUOB 1TKXA 3W5YA 2D7SA 1SQEA 1ZM4A 2FIUA 1RT6A 4LIRA 4ELTA 4M3YA 1JXEA 3MX5A 2GCFA 4IRKA 1C4AA 3QINA 4OMFG 4L75A 1WI8A 3L95X 3N6LA 4YB6A 4URGA 2W7PA 3M8RA 1MWQA 3ENHA 5DQHA 4K0KF 5BRFA 3O4QA 3R6GB 5E2QA 2JH3A 3KNGA 3BS9A 4RX6A 4ZPCA 2MQOA 2ZF5O 2DIVA 1RBSA 4IG0B 3M6GA 2DRDA 4X62K 1LWXA 2D3OR 5D8HB 1HMVA 2AX0A 2AJFE 2HAIA 1FVSA 3BR8A 3SCKE 1QQMA 1S1XA 3D0GE 3L6QA 1Q9YA 4NLDA 2AJ1A 2VQFF 1WDDA 5C25B 2GVZA 4JI0F 5LMUJ 3OYJA 4A59A 2NPIA 3NCRA 4OGCA 2JLFA 2HNDA 2Y0SD 3M6XA 3V6DA 1A0OB 1HYSB 3O4NA 4QIWD 3BKTA 5HP1A 5ITHA 4O55A 1ITPA 4P73A 5I9EB 2DGXA 3UI3A 1BHLA 2O8FB 5D4NA 1NO8A 1X7VA 4U95A 2IY5B 2XQCA 2DH9A 5LJ5Y 5D15A 4CWBA 4NLSA 2MKHA 3CG7A 1CC8A 2O3DA 3WXKA 4Y0FA 1H7WA 2HQFA 1PJ5A 3MAAB 5A2QU 4I4BA 4IQMA 2BANA 5CCLA 4J9PA 2QWMA 3MN6A 3PFOA 4Z37A 4ID5A 3CW2C 1HWJA