1TVRA

Hiv-1 rt/9-cl tibo
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Aspartyl protease
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tvrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tvrA05
2I1RA 1NK7A 2D0BA 3MF5A 1NKCA 4PQUB 4KB1A 1HMVA 4J2BA 1DTQB 5E41A 1UWBA 3RMDA 4O3NA 5J1EB 4DL4A 1S1XA 3NH0A 1VK0A 4W5NA 2FJWA 4DTMA 4NLQA 4DWIA 4ZPAA 1BISA 1VSEA 4IH6A 1RTHA 2RN2A 3NAIA 4U7CA 1JLAB 3K59A 3S3OA 3SFGA 5KFRA 4FK0A 3DMJB 3BSCA 1B92A 3N6NA 4KHNA 3THVA 2Y1JA 1BCMA 4NLUA 3SFUA 5J2QA 2JEFA 4QAGA 1MU2B 2ASJA 1T3NA 4EEYA 2XI3A 4MK9A 5HBMB 2OPRA 4FXDA 2W8LA 4JUZA 2R2UA 3BGRB 3V1RA 3OYBA 1RTDB 2OYQA 1RDBA 5FRNA 3C6TA 3PZPA 3ISNC 3F73A 3LANA 2IJNA 4O4GB 4FM2A 4DL7A 2I5JA 2XCPA 2OZSA 2W8KA 4FW2A 4FJMA 2ZD1A 5HROB 3GV5B 3RRHA 1RBUA 5DLFA 3QZ8A 2OPQA 4AH9A 4Z4CA 3NGYA 3QNNA 4YQWA 1RTIA 1YT3A 4ECYA 3L8BA 3LAKA 4CFAA 1LWFB 1RT4A 2KFZA 4IFVA 2HHWA 2QKBA 3M8QA 4LSNA 2XY5A 4WFXA 3PX4A 5KFBA 5F8NA 5KFUA 4DEZA 4H8KA 1RT2B 3TVKA 4CEOA 5J2NB 3S3MA 1HQUA 3E01B 2VG5B 3ALYA 3ZSVA 1C1CA 2IM3A 4GW6A 4AHSA 3QEVA 2R2SA 1RT3B 3ZSRA 3OJUA 2G8KA 5F9LA 3FRZA 2YKMB 5HP1A 5KG4A 2BE2B 5KFSA 4EO6A 2HNDB 3TAPA 4E1NA 1TKZB 3IG1B 5KI6A 2EC0A 3K5LA 4URQU 2W7PA 2YNGB 4B9MA 3NE6A 1JXEA 3KK3B 3KLGA 3K5NA 1C2PA 1YVFA 3H59A 1NK9A 4RNOA 2Z1IA 2IDOA 3M8SA 4KE5A 1S9FA 2FJXA 3KLHB 4GMJB 2EHGA 5C25A 3UDLA 1KLMA 5KFOA 3TAMA 1NKEA 1S5JA 2IA6A 2V0NA 2RF2A 2GUIA 4ZTJA 4FJLA 4CF0A 4BACA 3NF9A 2YNIB 4RW9B 3OYJA 4MKBA 5DGBA 4BWJA 3TAFA 1WSEA 4B9SA 4CHOA 1S4FA 4B3OB 3MR6A 1S6PB 4AHRA 4CFCA 5DQHA 3NBPB 2O5DA 1YTAA 1IKVB 4LSLA 4QW9A 5KT3A 2C2EA 3TQ1A 1IKWB 3SQ4A 1N6QB 5C24B 3T5KA 4ZP7A 3OLBA 4Q43A 3IN5A 2UVRA 4ED3A 1T03B 1JKHB 4Z4GA 2C2DA 2BANB 3ISND 4PY5A 4N47A 5C42B 1SKWA 2J6TA 3KD5E 4HUEA 4B9LA 4TY8B 3OL8A 4DTRA 2XY6A 5CYQA 3HL8A 3V9UA 1HMVB 3DDKA 4CJEA 4IG0A 1S9GB 4FZYA 5DGAA 1NK0A 1RT1A 1BGXT 1C0UA 3NH2A 2QE5A 4DG1A 1J5OA 4LQ9A 2R8KA 4ZVHA 3L2UA 4FLWA 4FJKA 3KJVA 2OPSA 4RU9A 5DMRA 4FJGA 2J6UA 4IG3B 1KRPA 3Q8QB 3SPYA 3P83D 2HHUA 2ITGA 3KHGA 3OYDA 4Q45A 2KZMA 5KFDA 3SUOA 2CKWA 3T5JA 1S1VA 1N56A 4CK3A 3HVTA 3OS2A 3OLAA 4DS5A 3UR0A 2R8HA 4Z4IA 2FLNA 4NYZA 2HWIA 3V6JA 3LP2A 1LW0B 5F8IA 4KB0A 3IRXB 3VQ8A 2GV9A 4J9LA 3SV3A 4MKAA 5F8GA 1HNIA 4QPXA 1S97A 4M3XA 2R8JA 4CK1A 1TP7A 4DFJA 2O4IA 3SZ2A 4TXSA 4CJVA 4FCYA 1TK8A 3VN5A 2W9BB 4CGHA 3C94A 3LP3A 3L3VA 1ZETA 4XPCA 3BDPA 4I2QB 4KO0A 4OKKA 1JLQA 5F9NA 3HVAA 2R8GA 1RT5B 4ECZA 1A5XA 1TKTA 5KFKA 3QEPA 3MTKA 2KTQA 2FJVA 4M3ZA 2F8TA 3IGVA 1D0EA 1BI4A 4EZ6A 1RBSA 3JYTB 3T3FA 2ZQBA 2OA8A 1RT4B 2D0CA 5T14A 4O3PA 1NJZA 1GOBA 4PQUA 2HB5A 4JS4A 4KREA 1HPZB 1DTQA 3M8QB 3V9XA 2HVHA 1A5VA 1L5UA 5KT5A 3EZ5A 3KTQA 4JV0A 4E7IA 3TI0A 4J9SA 1BIUA 3O4NA 3I0RB 1HARA 5J1EA 3CFOA 5KFHA 4TQRA 3G6VA 1S6QB 1RA6A 4JRPA 3G6YA 4ECSA 1I3AA 4DQRA 1C1CB 2BQRA 4IR9A 3M8RA 4DU1A 4DTSA 2JLEA 5JXSA 2W9CB 4DF4A 3H40A 4EBDA 3DMJA 4NZ0A 3LDSA 1WSIA 2E6LA 3AV9A 3WNFA 3HVRA 5KFAA 1VSDA 3GV7B 3QERA 1MU2A 4XPEA 2ASLA 3CM6A 1QSYA 4FVMA 2B4JA 4EYHB 4YP3A 4HTUA 3MXJA 5CY4A 5HBMA 4CJTA 2RKIB 1QSSA 1QHTA 4MK7A 3LALA 1X9WA 4NLGA 2E9RX 4KV8B 1RTDA 2FVRA 2G8WA 5C25B 2HMIB 1D5AA 2V4RA 1KLMB 3KLEB 4DTUA 5J2MA 3LAMA 5KG7A 2JC0A 4FBUA 3AVHA 2DFEA 3RBDA 3P5JA 2FVCA 2RF2B 2FLLA 3OY9A 4O4GA 4ZPCA 3AO5A 4OPJA 1HYSB 4FLTA 3QEIA 3MFHA 4DL3A 1KVCA 5HRSA 2R2TA 4YMEA 4ZP8A 4C8MA 4NLOA 4M3RA 3OYFA 1S48A 4J2DA 3ZT0A 4G1QB 4O5BA 3SQ2A 3GIMA 4LSLB 4IOBA 5HLFB 3OHAA 2HVIA 4NLWA 4RG8A 4CIGA 4ECVA 4RW6A 4NLVA 4I2PB 2BQUA 3TAQA 2YV0X 4M45A 4CEAA 4HCBA 3GYNA 2P5GA 5CYMA 2AU0A 1WN7A 2G8UA 3AVGA 3NAHA 5J2NA 1SL2A 2VG5A 5CYQB 4FYDA 2D3UA 3FQLA 3V81B 4E1MA 5L1LA 5KFPA 4EP5A 4AHTA 2Z1JA 1RT1B 3VQBA 1RT3A 4O0IA 1RDDA 3AVLA 3OYCA 4N76A 2E6MA 1GX5A 2YKMA 3AO1A 1D9DA 3OVNA 4GVMA 3KJVB 2OPSB 4BE2A 1JLFB 1EX4A 2IGIA 3BJYA 3D5MA 3Q8RB 4W5TA 3KK2B 3V6HA 4QWCA 1T94A 3RAQA 4OL8A 4PUOB 3IG1A 2UUTA 5EU7A 3H5UA 2BGGA 2YNGA 4CEQA 4CESA 3RTVA 4FLXA 2HWHA 4NLTA 4CJLA 2IMWP 3EPIA 3LWMA 2F8SA 4QWBA 2VG6A 1RT7B 1KVBA 3HVTB 5SZTA 4B8AB 1NK5A 3KLHA 3PW2A 2QKKA 3CDEA 5KFIA 4E3SA 2D3ZA 3IS9A 2GC8A 4Z4FA 4NLYA 2Q3SA 3MXMA 4CGIA 4RW4B 2YNIA 4RW9A 2O4GA 3AA3A 2WHOA 4LD0A 2UVWA 1WSGA 4IH5A 3H2LA 3AVJA 1NOYA 4Y3CA 4B3OA 4WYLA 4TN2A 1S6PA 3I8DA 1F21A 2IOCA 2IAJA 3NBPA 3D0PA 1IKVA 3OYIA 4J9RA 1IKWA 1N6QA 1FK9B 1S49A 1S1WB 1XWLA 3N6MA 5C24A 3AVNA 5KFEA 1TKTB 1T03A 1JKHA 4LY7A 4DTNA 4M3YA 5C42A 4OJRA 2QXFA 4FM1A 3ZT1A 2D0AA 3OYGA 5KRSA 1KHWA 3V1OA 4J9KA 4TY8A 1QUVA 5KFNA 4ED8A 1S9GA 3LWLA 1Y97A 5KFLA 3QO9B 4QWDA 4NCBA 1EETB 2ZE2B 2ATLA 3VQEA 3G86A 3VQ4A 4Z4HA 3O3GA 2FBXA 4WFZA 1L3VA 1RDAA 4BWMA 4IG3A 3SUPA 3HKWA 4RUAA 4E7HA 3KLFB 3LPUA 3KNAA 4M95A 3NHGA 4ZPBA 3NGDA 4DFMA 4CJ5A 1VRTB 3LPTA 3GV8B 4MH8A 5EWGA 3I0SA 4F2SA 2B6AA 5KGXA 4M41A 1G15A 4CJ3A 1S0OA 3VQ6A 1LW0A 3IRXA 2AGPA 3MECB 3AA4A 4CERA 4DMNA 3O4QA 5KG3A 3DI6B 1RYSA 2IC3A 1CXQA 3MEGB 2BQ3A 1NJXA 3PW5A 3ZCMA 4FJHA 2ILYA 3L2VA 5J2MB 4F3TA 1XR5A 2XY7A 2W9BA 5EDWA 4J9NA 1U04A 2GBZA 3RR7A 4I2QA 4IRDA 4ZPDA 1TVRA 4CF1A 1SL1A 5T7BA 5KFFA 4CEEA 2KFNA 1L3SA 4ID5A 3BREA 3BR9A 3HPOA 4YR3A 4ED2A 1RT5A 1SV5B 3DRPB 4M3WA 4ED1A 1BQNB 1VSHA 2WB4A 3HHKA 3JYTA 3RWUA 2HW3A 3RMBA 4JS5A 4RW6B 3SPZA 4NLRA 3GIKA 3I5CA 4KTQA 1HPZA 1IKYB 1UAXA 1SKRA 4XIUA 3RB4A 5CYMB 4N56A 3DLHA 3QIDA 3I0RA 1S6QA 3NF6A 4X2BA 3G10A 3MXIA 5F8HA 1WNSA 4EO8A 4KHSA 4DU3A 2W9CA 3RMCA 1QQCA 1RBVA 1W25A 4Y2CA 3FFIB 4CJPA 2R7YA 5KT2A 1IH7A 2PYJA 3PV8A 3BSAA 4BDZA 5KFGA 3DLEB 1C1AA 1JLEB 4FLVA 3RB3A 4F4XA 4IRKA 1HYVA 4Q8EA 2VG6B 2DFHA 2RKIA 4FK4A 3GIJA 4DSJA 4KV8A 1HNVB 4DU4A 5KFWA 2HMIA 2XY8A 4J9OA 1NK4A 4TQSA 3KLEA 3IS9B 3O3FA 3UQSA 1TL3B 4IKAA 4EBCA 4FJ5A 4RUCA 3V6KA 2X78A 3CFPA 1HYSA 3QEWA 2XGPA 2HNYB 3BSOA 3OL6A 1OS5A 2OPPB 3NAEA 5FROA 3HJFA 2HHQA 1SL0A 3QGIA 2FC0A 3NKYA 2G8IA 1DLOB 3WNEA 2Z1GA 3HP9A 4G1QA 2IAJB 5DK5A 2C2RA 2LSNA 4MIBA 4ZVFA 3PR5B 4ED7A 5HLFA 2R8IA 4IRCA 3NGIA 2D5RA 1XR7A 5DG9A 5CZ1A 2ALZA 4I2PA 2VA2A 5KT6A 3OSNA 1SKSA 1RTJB 2AWZA 5SWMA 2G8HA 4O3SA 4NRTA 2QK9A 3CDUA 4O3RA 1KVAA 4B9UA 4YR2A 4CF2A 4FJ7A 3CJ2A 3V81A 1YVUA 2E4LA 3HSTB 4J2AA 3ZT3A 1FXXA 1QSLA 1U49A 5KFCA 2YKNB 3QIPA 2WCXA 4CF9A 3TWHA 4OVLA 1D9FA 3DRSA 1JLFA 1BHLA 3MEEB 3KK2A 2VG7B 4IFYB 4KTWA 1T05B 2IM0A 3H5SA 4PUOA 4MFBB 3AA2A 4HUFA 3M8PB 1Q9XA 1RT7A 1D8YA 4G3IA 4DLEA 3I0SB 4KRFA 2B6AB 1RBRA 1LV5A 1ZTWA 3DLKB 3D45A 4M3TA 5D3GB 1X9MA 4RNNA 3PO4A 2OH2A 5KT7A 5L1JA 4K8XA 2IC3B 2IM2A 5KTQA 3B6PA 4RW4A 1TK5A 4Z4EA 3O3HA 4E89A 4KFBB 4O55A 1S9EB 4CJFA 4WZMA 4BE1A 4FLYA 3Q8PB 4DSKA 5KRTA 2JEIA 1VRUB 2XI2A 1C0TB 2YNHA 4OLAA 2AGOA 4ZP9A 4CFBA 4OGEA 3ZSWA 4ZVGA 3EYZA 4KHMA 3UIQA 1TVRB 3KD1E 2DPIA 3AVMA 1FK9A 5JS1A 1S1WA 4ID5B 4GC6A 4UQGA 4CJKA 1BQMB 5HRRA 4W5QA 5I3UA 4Q8FA 1NK8A 2E9TA 1C6VA 3V9ZA 3E51A 1RCHA 4IDKB 4ECTA 4CJSA 3S3NA 1VSIA 3U3YA 1ZBFA 4RNMA 1JX4A 2IM1A 4CHZA 3L2WA 4ICLA 3MR3A 2EX3A 3VQCA 3MFIA 4NYFA 4R5PB 1WNEA 3QO9A 1B9DA 1RT6B 1EETA 2ZE2A 1NHVA 4FJIA 4NRUA 4C8KA 4YFUA 3QGGA 4PA1A 4DQQA 2QV6A 1X9SA 1CXUA 1FKPB 4AHCA 4FZZA 4B9NA 1GOCA 3VQ5A 3AO2A 2YNFB 3KLFA 4K4XA 4BE0A 4W5RA 2XC9A 4OLBA 3CJ4A 4F50A 4OGCA 2P5OA 1N4LA 5DLGA 1SH2A 1UA0A 1VRTA 2AX0A 4O44B 1JLCA 4NLPA 1WSHA 1HQEB 2WK4A 4KKOB 2WONB 5KG1A 2IS3A 4TSXA 2R2RA 1REVB 4R8UA 4CGGA 1D1UA 5KFTA 2DY4A 3MECA 4H4OB 4DLGA 2A1RA 2Y1IA 2OZMA 1KFSA 3DI6A 3MEGA 3ITHB 4CHNA 3VQSA 1KSPA 2IJFA 2AQ4A 4RZRA 5C5JA 3P1GA 4TYAA 4ED0A 5I42B 3AVAA 2XGQA 3LP1B 4ELVA 3QYYA 3CJ5A 1ASWA 3HT3A 1WSJA 4ELUA 4NCGB 2JEGA 3WNHA 1QTMA 4WE1B 4AHVA 1SV5A 3DRPA 4YR0A 1ZBHA 4QWAA 3ZT2A 4F2RA 4FS1A 1BQNA 2FVSA 4L8RB 3KIOA 1LAWA 4CGFA 2W7OA 2GIQA 3MEDA 3PX6A 1U4BA 2P1JA 3S9HA 2VWKA 3VQPA 1EP4B 1UOCA 1IKYA 4WXWA 4K4SA 4FJ8A 3V9SA 4HHTA 4RW8B 3SYZA 4QW8A 3DRRB 4KHWA 2D7SA 4LH5A 3OHBA 4ELTA 1W9HA 1VSJA 4CGJA 4N41A 4F8RA 4HKQA 5KFXA 3U3GA 2DFFA 1L3UA 4DL5A 2ASDA 3CM5A 4DL6A 3QIPB 4KTZA 3K5MA 3QINA 1SH0A 2HNZA 1N5YA 4IQXA 1S0NA 4J9MA 3DRSB 1S1UB 3FFIA 4KHRA 4DTOA 4KI4A 3I5AA 4CF8A 5FDLB 4CIFA 3TABA 3DLEA 1JLEA 4PWDB 3PW7A 1NOZA 3PX0A 3OYAA 3NCIA 5KG6A 1HNVA 1U09A 3IGNA 1JXBA 3SQ0A 1JXLA 4F4WA 4HVJA 3PJXA 2G8VA 1TL3A 2WTFA 1NNDA 3L2QA 4QWEA 2HNYA 2A1SA 2OPPA 3DLRA 4RNFA 4B08A 4O4RA 1JL2A 4Y1DA 3KMQA 1DLOA 1S10A 4CE9A 2YNHB 4CHYA 3K2PA 3U6FA 2JC1A 2RDJA 3PW0A 3OYLA 3V4IA 3KLVA 3PVXA 3V6DA 4E0DA 3H4BA 4KHUA 3AO4A 4HUGA 3QLHA 1NKBA 1Z26A 1R0AB 4B9TA 5I3UB 1ZBUA 4JV1A 4CK2A 1RTJA 5KGWA 1SH3A 3H08A 1TKXB 3VA0A 2BDPA 3DYAB 4FJXA 1TQLA 3JSMB 5KG5A 1S1TB 3CDWA 4ICLB 3G0ZA 1RDRA 3SI6A 2VWJA 2FBVA 2YKNA 4TY9A 1IKXB 5J2PB 3V1QA 3G6XA 4TLRA 4ED6A 1LWEB 3CG7A 4DSLA 3PHEA 3SJJA 4ECWA 3MEEA 1ITGA 2WOMA 2VG7A 4IFYA 1GX6A 4Q0BB 1T05A 5DG8A 4DTPA 4F4ZA 4MFBA 1TV6A 1BIZA 3UPFA 4CJQA 2BRKA 3KKSA 3M8PA 4KHYA 3A2FA 4ZP6A 5KFVA 3CFRA 4KPYA 4I7FB 3K5OA 1JLCB 1TL1A 4K4VA 5KFJA 2IBKA 4RW7B 3DM2A 3DLKA 3GILA 1C0MA 4GC7A 4R8UB 5D3GA 1J54A 4YNQA 1LW2B 3ZSZA 3KK1B 1UA1A 1QAJA 3M9MB 3NF7A 4KFBA 3IAYA 1S9EA 5K14B 1CSJA 4JV2A 4K4UA 2E9ZA 2B43A 1LWCB 3ZSXA 4MK8A 1I39A 1VRUA 4FJ9A 4Q5VA 1C0TA 4E19A 4MIAA 1Z25A 4F4YA 4KAZA 3QGHA 1BL3A 1W0HA 3VA3A 3PJWA 2F96A 4QOZB 3AVKA 1DTTB 3NL0A 4Z0UA 3H5XA 1BCOA 1BQMA 4DL2A 1GOAA 2D41A 2AX1A 1TAUA 4FZXC 4IDKA 4KHQA 4ECRA 3MEDB 1IO2A 3DLGA 1T8EA 3BSNA 5DQIA 1X1PA 3Q8SB 4R5PA 2ILZA 4F4KA 1RT6A 3NH1A 3NDKA 4DQIA 4F3OA 1VSKA 1KHVA 4EP4A 4URSA 3RBEA 5F8MA 3OSPA 2B5JB 4HYKA 3T5LA 3ZSYA 1FKPA 4H4MA 2YNFA 3FDSA 2XO7A 4CEBA 2JGUA 2HNZB 1XHZA 3VQDA 1N5YB 3EY1A 1IM4A 3QNOA 4KI6A 2WRMA 1JIHA 4HCCA 3PR4A 4O44A 3MR5A 1Q9YA 1HQEA 3I5BA 4KKOA 2WONA 4E7JA 3NGZA 1IG9A 3OJSA 1REVA 3RMAA 4H4OA 3AVIA 4ZHRB 3H5YA 4OKEA 3ITHA 1HJRA 4AILC 3SQ1A 5L1IA 1CLQA 4C8LA 3QESA 3TAGA 1RA7A 5I42A 2W9AA 4CEFA 5JS2A 3LP1A 3L2RA 3WNGA 1HYZA 3EZUA 3SUNA 4KAIA 2PY5A 1NK6A 3OYMA 2FVPA 2CJQA 3ULDA 4NCGA 5CZ2A 4WFYA 3KOAA 4WE1A 2J6SA 2P51A 4DQSA 2V4QA 1QS4A 1WLJA 3DOKB 4J2EA 3V4IB 5KFQA 5KFZA 1XC9A 2HHVA 1C1BA 3V6DB 1NJYA 1TAQA 2C22A 5HRPA 1MMLA 3QLHB 3HP6A 4IKFA 1EP4A 2GIRA 4TYBA 2UUWA 1ASUA 3TR8A 3GIIA 4CGDA 3RB0A 1O1WA 4RW8A 3AA5X 5HRNA 4E7LA 3DRRA 3BQ2A 3LP0B 1JLBB 1LAVA 3QEXA 3QZ7A 3KLIA 1QE1B 4E7KA 3VQ9A 3HYFA 1CZBA 4M42A 3T5HA 1SUQB 2V9WA 4DFPA 3M9NB 1JLGB 3CVKA 3QETA 5F8JA 3F9KA 3OL9A 4RNHA 1S1UA 1B9FA 4K4TA 3MR2A 4MQ3A 2HAIA 2WOMB 3RB6A 1TK0A 4EZ9A 1UWBB 5FDLA 3AO3A 3NFAA 1TV6B 2JEJA 4K50A 2BRLA 1S1XB 3FQKA 3OL7A 3HPGA 3ZSQA 4PWDA 3PUFA 1TL1B 3SCXA 2G8FA 3OS1A 2YHBA 4K4YA 1RTHB 1K1QA 3DM2B 2UVVA 2PZSA 4FJJA 1J9AA 2DTUA 4CJWA 3TANA 5J2QB 4CJ4A 4CJRA 2VA3A 4AHUA 1KCFA 3HM9A 4FM0A 1CZ9A 3OYKA 4ZTFA 2ATQA 3NF8A 1WAFA 4IR1A 3LZJA 2OPRB 3K57A 1XR6A 3CJ3A 2AGQA 3ZSOA 3DOLA 3C6UA 1U48A 3BQ1A 4WYWA 1RILA 3C6TB 1TGOA 1YTUA 1VSMA 4ID1A 4B9VA 3CWJA 3T1AA 1XI1A 1K1SA 1R0AA 5KT4A 4DSEA 3SUQA 1FKOA 1T7PA 4Y2AA 2I5JB 1TKXA 4K4WA 1HRHA 4EYIB 3DYAA 2C28A 2ZD1B 3HO1A 3JSMA 1KTQA 3QIOA 3DLGB 5F8LA 3V9WA 3C95A 2FLPA 1S1TA 3MAQA 2OPQB 1J53A 3PO5A 3CIZA 3K58A 1IKXA 1RTIB 5J2PA 3CQ8A 1LWEA 3RAXA 2F8EX 2NUBA 1RYRA 2DPJA 4IFVB 3HK2A 4DF8A 3ICLA 4LSNB 4H4MB 4Q0BA 4DQPA 2HHSA 4CFDA 3VQ7A 4I9QA 3D28A 2XHBA 4WXOA 2ZKUA 4DFKA 4OPKA 1HQUB 3TAEA 4I7FA 4JRQA 4J9PA 1L3TA 3SV4A 4NYNA 3DLBA 3CYMA 4W5OA 2ETJA 4RW7A 2FVQA 2HHXA 1JLAA 4Q44A 3VQQA 1XHXA 4N5SA 3HXMA 2Z1HA 1LW2A 3B6OA 2X74A 5HP1B 4K4ZA 3KK1A 5EUHA 3PW4A 1U47A 5EWFA 3AVBA 4KBIA 5K14A 3N6LA 4K8ZA 1Z4UA 1NJWA 1LWCA 1JL1A 4QCLA 4DS4A 4CHQA 4M94A 4JLHA 1ZBIA 4ECXA 3KLGB 1RBTA 3H4DA 1WSFA 3BGRA 2XRIA 3AVFA 4CCHA 4LH4A 1DTTA 3T19A 4XO0A 3HPHA 2RDIA 3RR8A 2AJQA 2W42A 3L3UA 3TAMB 2UVUA 5KFMA 1C1BB 3KKRA 4CHPA 4C8OA 4ZVEA 3RRGA 5HROA 3LZIA 2RPIA 4KSEB 2X6NA 5DG7A 1I6JA 1TKDA 4OKJA 3FSIA 4ECUA 1EXQA 4IBNA 1LWFA 1VSFA 4NCAA 2B5JA 3KHRA 3KHHA 2FBTA 3KLIB 1ASVA 4DSFA 4DTJA 4FLZA 4FBTA 1S0MA 1RDCA 3KHLA 4H54A 4CJUA 1RT2A 5FRMA 3CO9A 3E01A 5L1KA 4O3QA 1ZBLA 4Y1CA 4IG0B 4CEDA 4IH7A 3AVCA 3SI8A 2PYLA 3OYNA 1C0UB 1N48A 2XWYA 4FK2A 4DG1B 1J5OB 4ZHRA 5KG2A 3M9OB 4ZMMA 2BE2A 1VSLA 5L9XA 4O3OA 2HNDA 2XCAA 1TKZA 3OS0A 4BDPA 2HHTA 1K6YA 3GQCA 2BR0A 3CJ0A 3EPGA 3H98A 2KQ2A 4KB7A 3KK3A 4R0EA 4U6PA 4FS2A 4FJNA 3OYHA 1S1VB 5EWEA 4WZQA 3NMAA 3LP2B 3OYEA 2X6SA 1Q8IA 4DSIA 1NHUA 3HVWA 4CIEA 1RNHA 1QAIA 4ECQA 2KZZA 3DOKA 1RAJA 4DTXA 1HNIB 4C8NA 5JUMA 3DOLB 3C6UB 1KLNA 1KFDA 4O0JA 1A5WA 5DQGA 1WAJA 4J9QA 4EBEA 1EKEA 2FBYA 4Y34A 5KG0A 4URGA 1FKOB 4NLXA 4I9LA 4FLUA 4M3UA 3ZT4A 4KO0B 3LP0A 2KW4A 1ZTTA 1JLQB 1JLBA 5KFYA 3ASMA 2YHAA 1U45A 4NLDA 4B8CA 1QE1A 4CECA 3TARA 4NLSA 3KMSA 2BANA 3VQAA 1SUQA 1BI4B 4CEZA 3BQ0A 1JLGA 1ZYQA 3SNNA 4BDYA 4FW1A 3PY8A 4LQ3A
chains in the Genus database with same CATH superfamily
3MF5A 3R8EA 3JS9A 2V2ZA 5BYRA 4DUYF 1N8RO 5E41A 2UU9K 2NYIA 8AT1B 2EFNA 5GAGP 1JK9B 4DL4A 4O8UA 5HQMA 1XMQF 1VK0A 1LK5A 2JVOA 4W5NA 4EWTA 4B9QA 2CPZA 2QC3A 5B8HA 2JSXA 5AQXA 1FVQA 2RN2A 4JI4J 3SFGA 5KFRA 2M4MA 3VEZA 1B92A 1WHYA 1NDCA 5E3PA 3THVA 4Q2MA 3VGLA 4DV5J 1DEJA 5CA5A 1KXPA 2JEFA 4ZVQB 1AB8A 4P2SA 3KK7A 3DRYA 1T3NA 1XTZA 2P9NA 2XI3A 2CQPA 4CZIA 1C0FA 3Q83A 3ISZA 1N5QA 3BGRB 1Y7PA 2QA4N 5D0EA 4K41A 2KRRA 5JVGL 3C6TA 3PZPA 2F8MA 2BX6A 3GJRB 3MM8B 2IJNA 1I1GA 2XMUA 3KUGA 4FW2A 2ZD1A 5HROB 2W2NP 1RBUA 5A6WA 4ES3A 4ILLA 2OPQA 4Z4CA 3NGYA 4YQWA 2RSQA 5AXNA 3FZKA 5KOWA 5LJ5Y 4ECYA 3LAKA 4CFAA 5A8WA 4DPWA 2XY5A 1YKWA 1DQAA 3TR5A 3PSIA 1NDLA 4JI8J 3HHLC 2KM8B 3AAQA 2RHQB 2YBVA 4ED4A 3A5NC 5MAOA 3G9CA 2JFDA 4OZ3A 3CF5Q 1S99A 2V50A 5ADZA 3N4PA 3HFKA 3Q23A 2G8KA 3FRZA 1U26A 2E2PA 1ZXOA 3Q7BA 2OSRA 2N3LA 3TAPA 2P8IA 4E1NA 2CQ1A 4F3QA 3CCWA 3P4IA 4UZCA 2ZJRQ 1JXEA 3NE6A 4I6YA 2R7RA 1UCNA 3TUJC 3K5NA 1YVFA 2QWLA 1NK9A 2IDOA 2XLJA 3M8SA 5GIOA 1S9FA 2W2OP 1T9XA 3KLHB 3O8MA 2FDNA 2JL9A 2Y0SD 2EHGA 3O44A 5AQZA 4PG8A 1KLMA 4ED5A 3EVWA 5KFOA 3TAMA 1NKEA 1LXNA 4DR3F 1RHRB 1MWQA 2YNIB 3VTIA 2J5AA 2KKHA 4XTTA 4MKBA 5DGBA 3MZIA 3CCVN 4CHOA 3MR6A 3C66A 5IXUA 4QW9A 2HOEA 4CDIA 2C2EA 5CCMA 3MCSA 3T5KA 4ZP7A 3OLBA 1R8HA 2VF3A 2UVRA 4JV5J 4W92B 2AF6A 2HHHK 4JI7J 3WQUA 5AXLA 2UUAJ 2XYPB 4B3MK 2D69A 3GMGA 1CS4B 1NEEA 1I5OB 2CPEA 3DDKA 2B8QA 4CJEA 4JHDB 4FZYA 1LFWA 2OCEA 4ZK7M 1NK0A 1BGXT 3NH2A 4BVPA 3BPSP 4OPAA 2MY7A 2XMJA 4V1Ak 1Z6RA 4FJKA 3KJVA 1VYAA 2P9LA 3F56A 1VAZA 5M1KA 2D74B 2J6UA 4IG3B 2ERRA 3AJDA 3VGMA 2RD5C 2MQMA 4X66F 4JK9A 4LF8F 1VMBA 2C3UA 2PGCA 2GQQA 2V63A 1N56A 4NZ6A 2E2OA 1NMNA 4UW2A 1FRLA 4DS5A 2HIYA 2FLNA 3W2WB 3V6JA 1LW0B 4QIGA 5AJ3F 4L74A 1TTHB 1UTAA 3SV3A 4G9ZA 2AJ4A 1HKAA 4OI1A 4YN3B 1KQSR 3G96A 3GG4A 5I4MA 3SZ2A 1VQ5N 1YITN 5F41A 4H0VB 3EVOA 3VGKA 2W41A 1ZETA 4IJAA 4KO0A 1YX2A 1XMBA 3HVAA 2R8GA 2CWKA 4ECZA 1A5XA 2FJVA 4OHXA 4NLBA 1WKJA 3X1LB 3LTOA 5A8WB 1EB0A 2RNEA 3H20A 1NJZA 3NOGA 4KRWA 3NGKA 3P39A 3PLAA 1GOBA 2WVBA 1MW7A 1DTQA 3V9XA 3FZHA 2HRUA 5E7OB 1WTFA 1A5VA 3M1FA 3FLCO 3TI0A 1EARA 2HLTA 1BIUA 3I0RB 5J1EA 2GUPA 4LRCA 4TQRA 4ZIVA 4B3TF 1NHKL 2BQRA 1I51B 4DQ8A 2JLEA 2E1CA 1B3TA 4DR5K 4ETZA 3DMJA 3LDSA 4X4OA 2V9KA 3OR1A 4LBPA 2MKHA 4DOZA 2XSJA 3KWMA 1QSYA 2DKOB 4FVMA 2G0IA 2AT1B 4YP3A 1M5PC 2KDOA 3IR7B 5CY4A 2KG0A 2WB1D 5HBMA 1KAYA 1QSSA 1QHTA 1ZPWX 1PJ7A 1X9WA 3R2DJ 1NPPA 2FVRA 2G8WA 1KLMB 3KLEB 5KG7A 4FBUA 3AVHA 3I96A 3P5JA 3EM1A 2FLLA 1HNWK 4OPJA 4L76A 3QEIA 1HKGA 2KRBA 1N34J 1P9QC 4B1ZA 2R2TA 4NLOA 4FF2A 3H2VE 4G1QB 1Q81O 2Q3PA 2A40A 4O5BA 1RWVB 3SQ2A 3IA0A 3FBCA 5FPMA 4CIGA 2I6WA 4ECVA 4I2PB 5B0AA 2BQUA 3TAQA 1VQNN 2PFDA 3BN7A 2IBOA 3K0JA 4DV1J 4OI6A 3GYNA 1FE0A 2AU0A 5M2PA 2OAUA 4FSVA 1Q86O 2D3UA 3K89A 3FQLA 4OI2A 4PQAA 3G6ES 3RZAA 5L1LA 2ZOGA 3TP2A 1AROP 2P9KB 2QEXS 4AHTA 2WBMA 1RT3A 3AVLA 1DJ0A 4N76A 1D9DA 3AO1A 3OVNA 1F3VA 3KJVB 1JLFB 3B8AX 3PEJA 3CJAA 2ROGA 3D5MA 3KK2B 3NGRA 4QWCA 5F1XA 8RUCA 4PUOB 1CULB 4A8WA 2QWMA 2IMWP 2DXDA 3LWMA 2VG6A 2OLWA 3K17A 2AW0A 2O8BA 4E3SA 2GC8A 4Z4FA 3CQYA 1NCLA 4EHTA 2H9ZA 4CGIA 5LOQA 2WHOA 2BZ2A 1RBAA 2UVWA 4KH1B 3CCMS 4IH5A 3H2LA 4Y3CA 4B3OA 4TN2A 1HNZK 3I8DA 3ILIA 5HANA 3VEYA 2IOCA 2IAJA 3C14A 1NGAA 4CWBA 1IKVA 4JKGA 3QBXA 2O8FA 4LF8K 1N6QA 2ZM6J 1S1WB 3FZLA 3N6MA 1F5CA 3UDCA 3CQXA 2OJ3A 2DY9A 4JKCA 4QR1A 4M3YA 4JKEA 3ZT1A 3OYGA 3PFOA 1ZPVA 2PBDA 3MMBB 4TY8A 3A5MC 2J4RA 4U7BA 4ED8A 4WBFA 1NDPA 2HSTA 2HRYA 2MKYA 2M3DA 4JKHA 3QO9B 2ATLA 2DRAA 3FCWA 4DCJB 4Z4HA 3M7VA 2FBXA 3QFUA 1RDAA 3DWLA 3I4HX 2NSBA 4C7QA 1GMWD 1YGYA 3ENVA 1RDUA 4BY9C 2DR9A 3NHGA 1GMWA 3NGDA 4DFMA 1GLEG 1VRTB 4LREA 1GFWB 2B6AA 4BG9A 4BRDA 4WYBA 5THWA 1FVSA 3O4QA 2LQ5A 4GKJJ 1CXQA 2AMCB 2RUSA 1UW4A 5JVHL 1IJEB 5A8RA 1OH5A 5AE2A 1WEZA 2NSCA 4J9NA 1S76D 2QI2A 1U04A 1O0PA 3RR7A 3G25A 2GQCA 2KFNA 4CEEA 5T7BA 1VQMS 2UXBJ 1L3SA 1H7XA 3BREA 4YR3A 2MTLA 5GMKa 4ED2A 2K8GA 2LQ9A 4DUZJ 4ED1A 4HDHA 3IWXA 3KYLA 3JYTA 1B4SA 3CJSA 4NE9C 4AQYK 3R6GB 1HPZA 1IKYB 1FDBA 2GAGC 2PMHA 4XIUA 1X4FA 3D3BJ 4NPOA 3RB4A 1UEUA 1B99A 4ZDNA 5B0DA 2GFFA 4JI2F 1B64A 1FERA 1OPIA 4KHSA 4Z7YA 2B9EA 2Y8YA 4B1XB 3JQKA 4B3SF 4DR4K 4Y2CA 3FFIB 3FZ2A 2M70A 3HOTA 3CJKA 3BSAA 4PG5A 3RB3A 4IRKA 1FD8A 2VG6B 2DFHA 1Y10A 2OFHX 3GIJA 3OA9A 3ENQA 4H0XB 1KBRA 5KFWA 2HMIA 2O8BB 2XY8A 2QFJA 1NK4A 3O3FA 1C0GA 4FJ5A 4P72A 2DNLA 4EBCA 2DH7A 1U6ZA 1NGFA 3CFPA 2I0XA 3G82A 3KG0A 2QXLA 2HNYB 4OX9J 1OS5A 2V8PA 4H0PA 3FSYA 3OFEA 2FHMA 2HHQA 3BUZB 4A48A 2G8IA 3UVJA 3MN9A 1L3KA 2Z1GA 2RAQA 1HJOA 3WNEA 2IAJB 5DK5A 3AOBA 4ZVFA 7FDRA 3PR5B 2FYXA 4AUKA 5HLFA 1WOPA 1XR7A 4BVOA 1SQGA 2ZBPA 1H6KX 1N8RT 4JD2B 3ZTSA 1RU1A 3U7JA 4BC5A 4YOUA 4LF9K 2AWZA 5SWMA 2HVZA 4NRTA 3T6JA 2MKKA 3CDUA 1KVAA 2ABYA 2QT7A 1UFLA 4YR2A 4PYDA 2FY1A 2BOPA 3KDNA 4OYAA 3CJ2A 4U9RA 3WT0A 1JNRB 4PRFA 2ZNZA 3ZT3A 1U49A 5KFCA 4ZJLA 3QRRA 3IBWA 3MDQA 1GK8A 2O8EA 1Q18A 2AV5A 1RAFB 2BUNA 1D9FA 4C1NI 1R8BA 3AQPA 2KKZA 3DRSA 4DPYA 2KHCA 6FD1A 1NSPA 4RLEA 1BHLA 3MEEB 2CDRB 4OIXA 4QU7A 2VG7B 1KQSM 4KTWA 5GADP 3DKDA 4HUFA 4NEYA 4NMLA 1OMSA 2MYFA 2VH7A 1NXIA 3TX0A 1Q9XA 4LF4K 4OYOA 1QQOA 4DLEA 2B6AB 2VQFF 2F40A 3AB4B 3DLKB 1OSCA 3EGZA 4DN9A 3W2VA 1QVGR 3DU6A 3CJ8A 2OH2A 3PO4A 2HS4A 5KT7A 3B6PA 5GAGU 4RW4A 2B4UA 4Z4EA 1JJ2R 3FR0A 3O3HA 4KFBB 1B7YB 4O55A 1VQ9S 4O5FA 3D54A 4CJFA 1CLFA 1HD1A 1M0SA 3HI0A 2LA6A 4DSKA 1T44A 3MM5B 1Q8BA 3AOCA 2V7YA 4DMZA 4FKYA 4KHMA 5JS1A 3AJ2A 2QO3A 4EK2A 3T1YK 1DQ9A 2P9EA 4UQGA 1I94K 2APOA 2NXUA 1BQMB 5HRRA 4W5QA 2RS8A 2PA3A 1NK8A 1C6VA 3OTDA 3V9ZA 2Z8QA 1RCHA 4NXNJ 1VSIA 1ZBFA 3L2WA 2FHOB 1S77D 2E44A 4X4VA 5HSPA 1WNEA 4JYAF 2ZH8A 4KT0C 4ILJA 5E3CA 4ZVOB 2MJUA 2GWJA 4C8KA 3FBFA 2ZBIA 4DQQA 2QV6A 2YHWA 1KQFB 3W5YA 3VQ5A 2MGZB 2D3O1 1RGVA 4W5RA 4OLBA 3PYFA 4F50A 4MKVA 2F4VK 4QJVA 2A3JA 1SH2A 1UA0A 1YRXA 2DHGA 2A2CA 2MZTA 1HQEB 3Q24A 4KKOB 2WONB 3HOSA 4DPOA 2AA4A 2IS3A 3MAAB 4WQ4A 1KR4A 1UEVA 3CDBA 2FC9A 4UTGA 1VBZA 2E8AA 5AQQA 1YVNA 4TYAA 5I42B 3AVAA 2XGQA 3I33A 4ELVA 3JSYA 4USJC 1X7VA 3CCUN 3SCJE 1G99A 1WSJA 2J7UA 4YR0A 3AY0A 3GJQB 4F2RA 1IR2A 1BQNA 3TEGA 4DV3J 2QN6B 1WHWA 1LAWA 2W7OA 1UVNA 1W7WA 3LL3A 2P1JA 1V3RA 3VWSA 2CQ0A 2V2KA 2K3IA 1BA0A 3MMAB 2Y8WA 4HHTA 3DGPB 2UUCJ 4JEPA 2D1KA 3DRRB 3I55S 2OTJN 4JAXA 3AY9A 4N41A 4F8RA 2H4WB 3ZNJ1 1L3UA 4DL5A 2DFFA 4DR1J 3M30A 3D2EA 3TVZA 2FC8A 4FZVA 4DL6A 4OHZA 4DBQA 2FQQB 4CM0A 2H4YB 3PG9A 1YRUA 2V8VA 3DRSB 2VBZA 4LFCK 4CLWA 3FEYB 3NNCA 3MPWA 4X64F 3NWGA 2AEJA 4CIFA 4CQ1A 3L95X 4QZVB 3DLEA 4WP3A 2O8DB 2DGQA 2HQIA 3U1LA 2ZH7A 1VQ6S 1N36F 2PAVA 2RIJA 2VICA 3HULA 5KG6A 5AQLA 1JXLA 3W65A 2UXDJ 2OFGX 4A61A 2X1FA 2OPPA 4B08A 3NVKA 1KVJA 4LFAK 1JL2A 1EHWA 4ES2A 4GKKK 4RBTA 3R9PA 4CHYA 3CD6S 4EMDA 2NPFA 1NGHA 3U6FA 3V4IA 2YVSA 3V6DA 1TU0B 5D77A 3HZEA 4KHUA 2EC2A 3OR2A 3CD7A 1UFKA 2EW9A 1Z26A 1R0AB 4LF1A 2QGFB 1XNQF 1Q4RA 3UCUP 2DK2A 3H08A 4PKDB 1YXQA 2BDPA 3PSFA 4FJXA 2E5LK 2YQ1A 3QFWA 3JSMB 5KG5A 3CDWA 1RK8A 3CCEN 2FBVA 2YKNA 4TY9A 1NUEA 4X65F 3G6XA 1KVIA 2E2QA 3TTDA 3CG7A 1PJ6A 3SJJA 2ZH5A 2WOMA 1GX6A 3UKUA 2DXFA 4QYRA 3OW2R 5LJVA 1PG5B 4CJQA 3KKSA 4KHYA 2Q43A 4KPYA 3A8YA 4I7FB 1CEZA 1TL1A 3IRWP 2DNGA 2F7VA 4RW7B 2HGNA 1PGZA 5IQ6A 4GC7A 3DXMA 4DUYJ 4FF4A 5IOLA 2WSFC 2VCPA 1D9AA 3ZSZA 1MDUB 1QAYA 2BACA 2DVIA 3KK1B 4USWA 1XMQJ 3S01A 4CLFA 1S9EA 1YBUA 3D2FA 2B43A 3ZSXA 4MK8A 2EI5A 4FJ9A 1RWNB 2G2ZA 2H54B 4QS9A 1W0HA 1Y3KA 3VA3A 1R0CB 2F96A 2M7SA 1HR0K 3QT8A 2CJBA 1Q78A 3NL0A 1ZA2B 3ZZZA 4BRKA 4ZS6A 2AX1A 1FD2A 2W1BA 5CHIA 3ULEB 3VF4A 4BRAA 1Q86T 1P1LA 4RL1A 1IO2A 3WXMB 3EKUA 3DLGA 3D3CJ 3H7HB 4RJVA 5AQWA 4WK1A 1NBWA 5A6PA 5D0RA 3Q8SB 4R5PA 1O13A 2VOPA 2CQBA 1Z2LA 1VQ5S 1D3WA 1YITS 2K1RB 3PRDA 1VSKA 1KHVA 1WEYA 5LXYA 4LFBK 3O4WA 5F8MA 2KFYA 3TOQA 3D2EB 1FRIA 4FWMA 4JKAA 2DNPA 1H38A 1U1QA 5BR8K 1T9WA 3VQDA 3EY1A 2V8DA 4RBVA 4KI6A 4B17A 4L3QA 4YS2A 3MR5A 1GXUA 3MMVA 4I6AA 1IBMK 2HQ3A 1SKUB 2BTFA 3IBCB 1IG9A 1CZAN 1FJ7A 3AD7C 1NPRA 3J7AN 1P9YA 1UVLA 4DXLA 1CVJA 3QDKA 2BA9A 5L1IA 3W7BA 4C8LA 3TAGA 4EGLA 2RQMA 2XTJP 4PEOA 4CEFA 3LP1A 4C0HA 1WUAA 3DXKB 5CD4H 4CZMA 1VIOA 1EAYC 4BR0A 3VMFB 3ZX3A 1UMJA 5E2QA 1YZ7A 4DZDA 3EE8A 2YKOA 2GCFA 2CJQA 5FPNA 5CZ2A 4X64K 1K8KA 4WE1A 1WOOA 2J6SA 3MWPA 2V4QA 1MG7A 2EBEA 1X4HA 5TKWA 4AF1A 4IOCL 3B4DA 3V4IB 2E1AA 4IO9L 3V6DB 3BR8A 3WEEB 4WF9L 1WC1A 1YJWN 3OR2B 3UI3A 3HP6A 4IKFA 4OV1A 4DR6K 1PAUB 3O1LA 3M05A 4JI1K 1N33K 3R5DA 3RB0A 4RW8A 1MROB 2V67A 1WJ9A 3POTB 4DR3J 1H98A 2R9LA 3QEXA 4J5OA 3QZ7A 1TFYA 1KS2A 1PC5A 2HSEB 3KLIA 2ZC4A 3VQ9A 4A8XA 2ACYA 3HYFA 4J9UE 3D66A 3H6EA 5M1PA 1SUQB 2V9WA 1VQ4N 3GR1A 2J76E 5KPRA 4N77A 4RNHA 1B9FA 4K4TA 2D3OR 1K8AT 2GAHC 3W0LA 2WOMB 2G0JA 3THYB 3AO3A 2GWKA 2JEJA 4K50A 3FQKA 3HPGA 4KBOA 1TL1B 2ADBA 3SCXA 2G8FA 2GX8A 2HBYB 4K4YA 1K1QA 1TL7B 5DM6L 3DXMB 4XK8C 1BQXA 3DFEA 2MZQA 2DTUA 1J9AA 4B3RF 2P9IA 1HBNA 5J2QB 3WBZA 4CJRA 2VA3A 3K8WA 4P74A 4AHUA 3D2FB 1QVFR 4FM0A 1CZ9A 3OYKA 5T41A 3NF8A 3EZOA 3IR5B 3BB5A 2OPRB 4X66J 1XR6A 4V19X 3ZSOA 3DOLA 5T7LB 5CD4A 4LF8J 3BO3A 1YTUA 4PXCA 2E20A 1UWAA 3QMLA 4ID1A 3T1AA 2KXNB 4OZ0A 4LVNP 5KT4A 4DSEA 1S6UA 4BRPA 5AJ3J 2I5JB 1H2TZ 2A41A 3GLJA 4EYIB 2C28A 1KTQA 3QIOA 3DLGB 1T3VA 1ZM3A 3V9WA 1RWMB 4HACB 1UZHA 3DC2A 1SJFA 5F0WA 1W7AA 4ZJQA 2QIFA 1IKXA 1RTIB 2RU9A 4X4SA 1AZSB 3CQ8A 3KZBA 2F8EX 1RE1B 2XMAA 2E5GA 2LP4A 2DBBA 1FXDA 4LSNB 2ZBQA 4Q0BA 3O9QA 4WFAL 3VQ7A 3EGVA 3Q7CA 2XLIA 1Q8KA 2XHBA 3O1WA 1XJWB 2K3KA 4WXOA 4DV0F 4DU7A 3SXLA 3TJAA 2E1ZA 1L3TA 3SV4A 3DLBA 4W5OA 2V2VA 4AT1B 2GTDA 3N4QA 4ES1A 2QWQA 2HHXA 1JLAA 2DD8S 3VQQA 1MMDA 4BQZA 2UXCF 2MKCA 3L4QA 1OY6A 1HBUB 1VCTA 3U1MA 2ZJPQ 4BRQA 1U47A 4H4KA 1F0XA 5K14A 4B3TJ 3HFZB 1Z4UA 1F9HA 1NJWA 1WWHA 2Z30B 3E2EA 4CBUA 5IM0A 4JLHA 4I0WA 3MPVA 5EVZA 1VQSA 1RBTA 2DEJA 4KY3A 4HHHA 4FWPA 1FDDA 5GAEP 4CCHA 3CMEN 4LH4A 2JRSA 2VHGA 1K8KB 3ENAA 1RAIB 4QQBA 3RR8A 2OGUA 1ZH5A 2EWSA 2AJ1A 1RCOB 3O9SA 5H1SV 3DXBA 4NXMK 1Q0NA 2IFXA 3FMWA 2VDHA 4J37A 3C7NB 2D9PA 3RRGA 3BH6B 4USIA 4LBHA 1H7WA 3D0HE 2IVOA 2HBKA 1U2RA 4OI3A 1Z1ZA 5B08A 2MB0B 3IKMA 3FSIA 4DUTA 4ECUA 4FL9A 4IBNA 2FBTA 3KLIB 1W26A 1F9FA 2E7VA 3S1TA 1M5OC 1U0HA 5I9EB 4IFEA 5KAKA 5CE3A 2CAJA 3E01A 2NZ4A 1G7CB 4IG0B 4CLLA 2WVDA 3MDFA 3SI8A 3OHRA 3FC9A 2WFBA 1N48A 3IDHA 4FK2A 1J5OB 1MMNA 2YKAA 3M9OB 4ZMMA 2R7UA 3BGFA 9ATCB 4AL5A 3EO3A 2XCAA 3NS7B 1VISA 3NMRA 2HEKA 1B0PA 4W90B 2KI2A 2BR0A 3EPGA 2B56A 2P9IB 4KB7A 5ADXH 1HBNB 3RAMA 4U6PA 4K0KF 1S1VB 1ZM9A 4WZQA 1BWFO 1FHTA 3NMAA 2IVPA 3HBTA 3C15A 1GXLA 3LP2B 3OYEA 1Q8IA 5GADU 4CIEA 1UW9A 4CIOA 4ECQA 3DOKA 2VGMA 2B4OA 3DOLB 1KLNA 2QRRA 3RBXA 3UE5A 4RUBA 1KAXA 5GAGI 2KH9A 4KH4A 4I9LA 4PHTX 3ZT4A 4HWIA 3LP0A 1N32K 1VLYA 4HTIA 1QE1A 3AXKA 3TARA 5AE1A 1RABB 3KMSA 1CQMA 3VQAA 2BJDA 1BI4B 1ZA1B 3NP5A 3C65A 1D4XA 3PY8A 3A3OB 3O9UA 2I1RA 1NK7A 2CG8A 1KD1O 4JI4F 4KB1A 2CNNB 1HMVA 4J2BA 3P38A 1WBBA 3RMDA 1ESVA 2GELA 4FWQA 2CWXA 3N9UC 1H1VA 3CDAA 5AE3A 2KN4A 3ZETB 3GCXP 1VSEA 7AT1B 1KWMA 3NAIA 3HD2A 4U7CA 5DDPC 1Q79A 3CHWA 1JLAB 4EHUA 3S3OA 4P6QA 1XEZA 4FK0A 3BYPA 4UUXA 3BSCA 3OFHA 3N6NA 2BM0A 3HHNB 3DXSX 2OKQA 2B7BB 4BRHA 2W2QP 3SFUA 3GL1A 4QYZK 4DI6A 1MU2B 2VC1A 2GQ2A 3MMCA 3T1HK 1NB7A 1OSDA 2ASJA 5JLHA 4EEYA 2FHKA 5U47A 1RHUB 2EG1A 3E9PA 3CC7S 1UJ4A 3KUHA 4JUZA 1VI7A 3V1RA 1V9OA 3HZGA 4FYYB 1IBKK 5FRNA 2C1EB 5ADXA 3ISNC 1WELA 2GW8A 4O4GB 2IRUA 3CF5L 3IWNC 4FM2A 5BR9A 5D0HA 2W8KA 1DKGD 4FJMA 2EWHA 4JOUA 3RRHA 5HMZA 4R0JA 3QZ8A 2F8HA 1DRZA 1Q53A 1SJ3P 5BYQA 2NUUG 5CZXA 4FPAA 4ZN1A 2HZCA 2ZJRL 4YHHK 2GGPB 3HTVA 4IFVA 4LF6F 2HHWA 1WHXA 2EEYA 4JI5F 2KHOA 3R7NB 3M8QA 2ZUAA 4E1JA 5KFBA 2IYIA 4H8KA 4UQTA 3QB0A 5J2NB 3S3MA 3E01B 3ALYA 1BWVA 4AHSA 3JQJA 2E88A 4CT8A 2PD1A 3ZSRA 3OJUA 2ZNYA 1JQGA 3HX9A 4WFNQ 4DJBA 3AQOA 2E1YA 4JI2J 1OVYA 3EUNA 2EC0A 3K5LA 3TO8A 2YNGB 3SMSA 2WAQD 3KLGA 2VB6A 2RRAA 4B3SJ 2VFSA 2NRWA 3U9ZA 2BEFA 4CTAA 1SAZA 4C6AA 3KWGA 3WZ0A 2RDDA 2MHEA 3GU0A 3WXKA 3A5LC 2RF2A 4ZTJA 4QR2A 4L72B 5A0YB 1U2VA 4RKUC 1SC6A 3OYJA 4BWJA 4H5WA 2L48A 1HFEL 1S6PB 4Q7AA 4CFCA 2X3GA 5DQHA 4USMA 1YTAA 4X62F 5KT3A 1WG4A 3M6XA 3TZZA 3TQ1A 4JK7A 3RW6A 2SXLA 3SQ4A 4K0KK 4A2AA 2PA8D 1T03B 1JKHB 5E5NA 4CVNE 3ZZTA 2X1AA 3FCHA 5DZ7A 2V52B 2R42A 4B9LA 3OL8A 2XY6A 1XMOK 3M8ZA 5AQKA 3HL8A 5ETSA 3HZ6A 1HMVB 4K5SA 1S9GB 4YY3F 3ZEUB 4H0TB 4M5DA 4ZVRB 3KVGA 2NREA 1C0UA 2IRYA 4DG1A 4NYPA 4FYWB 2OELA 5FIIA 4P75A 4FLWA 3N5FA 3VERA 4H03B 1F2GA 5DMRA 4OYZA 4DN0A 3SPYA 3M2RA 4ERDA 4XAKA 3KHGA 3HHLD 4CO0A 4Q45A 1M5HA 2KZMA 3TRGA 2BJ1A 4RWTA 2QLXA 3HHLA 3T5JA 4CK3A 3P45B 3OS2A 3OLAA 3UCZP 4OHVA 4TVAB 4NYZA 2HWIA 3RG6A 1BUXA 1VQKS 2CGKA 3IRXB 5A8KB 3VQ8A 2GV9A 4MTPA 3PM9A 2HQGA 2HFUA 4M3XA 5F3ZA 4CLYA 1FTCA 2ZZMA 4TXSA 4FCYA 2VQFJ 3DRXA 2QWPA 1QQNA 4CGHA 3NY0A 3I56S 2GX9A 1JLQA 5F9NA 2DGOA 3JSBA 2BVZA 2CIMA 1TKTA 1HHQA 3QEPA 3QSYB 2F8TA 1D0EA 1VHXA 2WSEC 3T3FA 2HZAA 2ZQBA 2OA8A 3L6QA 4WCEQ 5T14A 2D0CA 2YJEA 1J5EK 1BA1A 2N4DA 4HTLA 3VENA 2V34A 2RVJA 1YTYA 4F7VA 4PQUA 4K5RA 4NLCA 2HB5A 2JNJA 4JS4A 4KREA 5HK4A 3M8QB 1S22A 4GVBB 3EZ5A 3LPEA 4E7IA 4J9SA 5FLXU 1VDHA 3CFOA 3G6VA 1HBOA 3TJ8A 1I3AA 4A4JA 1FJCA 3EDQB 2W9CB 4OQJA 3OBIA 4DF4A 4EBDA 4Q2LA 3TQEA 3ZZYA 3WNFA 1CBKA 3HVRA 4JYAJ 1NSQA 1ELOA 1WBDA 3QERA 4F02A 4XPEA 3CM6A 1IUJA 3GDQA 2P9GA 4JI5K 1X4GA 2B4VA 4HTUA 1AUDA 2MQOA 1R7IA 5M1NA 3D6FB 4Z37A 2E1PA 5LMUK 4CJTA 1YLXA 4MK7A 3VEXA 2QA4G 3LALA 2ZVSA 2E9RX 4KV8B 4H0OA 1RTDA 3PKYA 2KXHA 3CCRS 3OXGA 2HURA 1Q1KA 4DTUA 4CT9A 2JC0A 4PWWA 3BP8A 4A2BA 4QU6A 5FLXY 2RF2B 3OY9A 1JB0C 4ZPCA 3AO5A 1HYSB 3T9ZA 4I6MA 4B1VA 5D4NA 2ASYA 1J2VA 3LQVA 4IJNA 3PFEA 5HRSA 4YMEA 2YPZA 4Y65A 2FY8A 4ZP8A 4M3RA 2F4FA 2F5GA 1PAEX 3H3NO 2DR8A 1X0FA 1MWMA 3QAEA 4JNEA 4WPAA 2F1FA 4CLPA 1VQOS 2EPIA 3VETA 5B0BA 4E8UA 4NLVA 2YV0X 3NGTA 2NYHA 2OHDA 4M45A 4CEAA 3GFZA 5CYMA 4WIQA 3HSJA 3AGRA 4LR7A 2E2NA 3AVGA 3NAHA 1RAEB 5BYSA 4FN5A 2Q0RA 2VG5A 4UF4A 4FYDA 2HBLA 3V81B 4YOVA 2ZH3A 1YIJS 4DPUA 4EP5A 3PIOQ 2FF3B 1GX5A 2YKMA 4CYUB 1HWIA 3O5BA 4YDXA 4CRJA 2HF3A 5M1QA 5AT1B 3RAQA 3IG1A 5AQGA 3J7AP 1FJEB 2F8SA 4QWBA 1A9NB 1RT7B 2CXEA 4IQMA 1XQSC 1WOQA 5KFIA 1NLVA 4X64J 4BCAA 2AZ3A 1FJGF 4RW9A 4C23A 1N36J 4LD0A 2CJKA 1R6YA 3PEHA 3CC2N 2QSFA 4WYLA 4DV6K 1QQMA 1F21A 2VBWA 2C3PA 4USUA 3NBPA 3D0PA 3GSIA 3OYIA 4J9RA 1IKWA 1FK9B 3THXB 1VLOA 5C24A 1FRJA 1WOSA 3AVNA 1TKTB 2BJ3A 2QTDA 3CE8A 2JLFA 3FFKB 3JS6A 5C42A 2QXFA 2D0AA 2C3MA 5KRSA 4ZOSA 3SLCA 2LXIA 1BHNA 1U1PA 5LJWA 3MEKA 2HFVA 4KH0B 3LWLA 4OZ1A 5KFLA 3G71S 5DZ6A 4NCBA 1EETB 4IEIA 1CQNA 3B8HA 5DDRC 3VQ4A 2W4DA 3O3GA 4WFZA 3I6PA 4I69A 3CPWR 2VWBA 3C19A 4WTYA 3KLFB 3LPUA 2AKWB 4LF7K 3MGJA 4X65J 4GVLA 1VQ8S 1VGYA 4CJ5A 4MIWA 3GE1A 4F2SA 2VQEF 1NNEA 4M41A 1G15A 1S0OA 1NGIA 3MECB 2WC9A 2P6TA 5K8MA 1CJUA 2VFTA 4OZJA 5E3QA 1ZAWA 2IJRA 3ZCMA 4FJHA 3SQGA 2ILYA 1SVDA 3L4BC 4F3TA 2XY7A 2W9BA 3NNHA 1NGBA 4E2FB 4I2QA 4IRDA 2Z57B 1TVRA 4CF1A 1SL1A 3RRKA 4ID5A 3EL2A 3GG0A 2VV5A 2CQ3A 1RT5A 3DRPB 4M3WA 1XQIA 1VSHA 1T9TA 5AQYA 1HW8A 3MUVP 5HI7A 4U7UD 3RMBA 5AQOA 1LWXA 4JS5A 4WKRA 3SPZA 4JBCA 3J81j 3GIKA 3CCLS 2H1YA 2IIHA 2Q66A 1U02A 2CZ4A 1UAXA 5GAEU 2VYPA 3VVUA 2GVZA 2VJVA 5CYMB 1BXNA 3OVAA 3QIDA 2AP1A 4HR2A 3FZMA 1S6QA 2XQCA 2W4PA 3G10A 1CJVA 5F8HA 4WWSA 1SS6A 4DV4K 1WACA 1QQCA 4M63C 1RBVA 2QMUB 2Q1NA 3THWB 4CJPA 2XMVA 3ZFVA 2PYJA 1FT8A 2OIHA 3AARA 2L9NA 2KJVA 4OJHA 5KFGA 4FLVA 1JLEB 1IWAA 2YQ3A 2YTCA 5K20B 1HWLA 2RKIA 3Q86A 4DSJA 3ONQA 4FWOA 1HNVB 2RQCA 2CRLA 2F7TA 3ZZPA 1S0VA 2I9SA 1FF2A 1NDKA 1TL3B 4J90A 3D1QA 1HKBA 5F2RA 3A5OC 3CJ1A 3MCNA 5FROA 1KQGB 3FCVA 1BLUA 4M7XA 1SL0A 5IFMA 3T6BA 1NWKA 4PG4A 1BG3A 4BREA 4ED7A 5IC6B 5B0GA 2BJ7A 2NRXA 2CADA 1YBTA 2D5RA 4MT1A 5ETRA 1KD1T 5CZ1A 5GADI 4C3MA 3GZ7A 5KT6A 1NGJA 2KG1A 1YDLA 3ZNUA 1BE4A 4QIEA 2YWEA 3R8YA 2EKNA 5BREA 4CF2A 3MCMA 2LECA 1FXXA 4C8ZA 1FNXH 3QIPA 3M2UA 4CF9A 4OVLA 3VAMA 4M5NA 1OWXA 3WQPA 2V7ZA 2NRZA 5GIPA 1HIYA 2IM0A 1C4CA 1IBLK 2X1GA 5DM7Q 1D8YA 3W3SA 2BBEA 4G3IA 3SDEA 1LV5A 3U02A 4M3TA 2QA1A 1CJUB 4JK8A 5KTQA 1YI2S 1S3XA 1YK9A 4JI0K 4OZLA 2NR0A 2YWGA 4MKYA 3FJ2A 2RS2A 1AFJA 4FLYA 3SCIE 3Q8PB 2CZ9A 5KRTA 2JEIA 1QZ6A 2OEMA 1S6OA 2BYCA 4OLAA 4ZP9A 4CFBA 4OGEA 3EYZA 4B3RJ 1Z05A 1TVRB 3KD1E 4OV6A 2DPIA 4ID5B 4ZLLA 2VQEK 3GYXB 3MUTP 4CJKA 2UU9F 2DGVA 3SAGA 5AQIA 4LUBA 1CC7A 5D8HB 1W2BR 4IDKB 4ECTA 4CJSA 3S3NA 3U3YA 1KC8O 1F6TA 1N5SA 4RNMA 3H90A 3DDNA 4CHZA 5J1NA 2E29A 4ICLA 3MR3A 2GVZB 3LOUA 4HEA9 2E7XA 3VQCA 1SIZA 3MFIA 4A8FA 3PTWA 1EWQA 2ZE2A 1NHVA 4DPXA 4C11B 1RWWB 4M5IA 3QGGA 5K8NA 1CJVB 5LT5A 1FKPB 2P6SA 4FZZA 3MR7A 4LF5K 1GOCA 4K4XA 1TYQB 4N7TA 1RWXB 2HK2A 3IM8A 1J6ZA 4IYQA 4NLPA 1NU4A 3IMXA 4QYZJ 2YWKA 1HW9A 2MDAA 2LDIA 1N54B 3L9ZA 5KFTA 4CGGA 3G8QA 4H4OB 5L8RC 2CPXA 3DI6A 3MEGA 3ITHB 1MNEA 1NH7A 3VQSA 4DV0J 4RZRA 5C5JA 1ICEB 4ED0A 4IWVA 3M3ZA 1IBKJ 2YHXA 3TZWA 2B9YA 5D78A 1U7LA 1ASWA 2UXCJ 3HT3A 1IVZA 4NCGB 2WSCC 3WNHA 5L38A 3W66A 1SV5A 3SCKE 3J7Z5 4QWAA 2NXNA 3TA0A 3VF0B 4FS1A 1RADB 5EN1A 2GIQA 3VGSA 3J81O 3R5AA 5I3QA 3RU0A 2ZBCA 3DOMB 3SBMA 2M8DB 3EN9A 1HQ2A 2GHWA 2VWKA 4UZBA 1UOCA 4WXWA 3E1YA 4K4SA 1VBXA 2WVFA 3V9SA 3MI7X 3L7OA 3SYZA 4QW8A 4KHWA 1NG9A 3C16A 3VEVA 1FDNA 1V5IB 2C3YA 4A46A 4CGJA 5GAHP 3BGUA 1M5KC 2YWWA 3CM5A 1XNRK 3QIPB 4KTZA 3M2UB 2QMWA 4P2MA 1RZMA 3HMJG 4OLOA 2P9SA 1FRXA 4NWBA 1S0NA 2JLGA 2G2YA 4DTOA 3EMTA 5H9EJ 4FYXB 5AZJB 1MSWD 4X4NA 3I5AA 1E6VA 1YJNN 4ANCA 3TABA 1ITPA 3W3DA 3R9LA 1B0VA 3NLCA 3SDEB 3GWCA 3OYAA 3FZFA 3NCIA 2BKPA 3IGNA 3T41A 1ACMB 4DCHA 2G8VA 2WTFA 3ZTPA 2DO0A 2ALYB 3L2QA 3DLRA 1YG0A 5B0CA 1DLOA 2B4PA 1S10A 4CE9A 3E9OA 3K2PA 5HVFA 5F0XA 4I64A 3FGUA 5FD1A 3CTRA 2RDJA 3MM7A 3KLVA 2HHHF 3ET6B 3PVXA 3H4BA 2ZBRA 4B3MF 4K0KJ 2JWNA 1VC0A 3AO4A 3UO0A 1NKBA 2XYGB 3J7A1 3MX5A 4LJMA 1QTNB 3CIMA 1RTJA 2QJ3A 2BW2A 3IWLA 1V5VA 2RHSB 3VA0A 3A3NB 2D1CA 3DYAB 1X5SA 1N0VC 1LNQA 1TQLA 2CPJA 2RU3A 2CZVC 1XMOJ 2Q97A 1AW0A 4ICLB 1DQ8A 3G0ZA 1RDRA 2CQHA 4ED6A 1LWEB 2AYBA 1YJ9S 4F04B 5H1SQ 1X60A 1DARA 1HBMB 4IFYA 3RW7A 1T05A 3W61A 5DG8A 4O0NA 3CETA 4F4ZA 4MFBA 1NBEB 1VHIA 3A12A 2CPIA 3M8PA 4ZP6A 5KFVA 3FUYA 2VKZG 3CFRA 4L75A 4ITSA 2IBKA 3ZO7A 3NS5A 1C0MA 3K0SA 2G13A 5D3GA 1YJUA 5HJYA 1NRKA 1IWGA 3TNVA 3TSPA 1LW2B 1UA1A 1QAJA 3NF7A 1QDUB 1RHJB 3IAYA 4WP8A 2E9ZA 2ZHOA 1LWCB 2C2KB 2Z2MA 1VRUA 1UETA 4Q5VA 1C0TA 5AZIA 2J0XA 1K0VA 4E19A 2CJ9A 4CI0B 3QGHA 2NNWA 3DDIA 1QAXA 2DYAA 1NMEB 2N7CA 3AVKA 4KGZB 1WC0A 4Z0UA 2G9OA 4DL2A 1GOAA 3QRPA 3W64A 5CQGA 1BY9A 4ECRA 1VJWA 3EE3A 2G2OA 3KHYA 4YUDA 4P73A 4DR5F 3N79A 1RT6A 2LQ8A 3EZWA 4PKIA 3C16B 2ZH6A 4F3OA 4URSA 3RBEA 4YB6A 4IOXA 3OSPA 2I2YA 2J8SA 3T5LA 1QJHA 1HKCA 2YNFA 4RPFA 3U4LA 2MZSA 4I4BA 1N0UA 1U2CA 1IM4A 1EQMA 1WF1A 4OX6A 1URNA 4O44A 4KIAA 3GJSB 1MLAA 1Q9YA 1E6VB 4LF6J 5MLCV 4JI5J 1FTRA 1REVA 3H0PA 3BV8A 1HNWF 4C98A 4OKEA 2DY1A 3SQ1A 3K5PA 4FWRA 4JI3K 2V8GA 3O80A 2ZH2A 5JS2A 2ACMA 1VC5A 1EX8A 2Z58B 3SUNA 3H42A 5ETQA 2ROEA 1EQ0A 3H25A 2BOAA 2CJYB 3UCGA 4WFYA 3QBWA 3KOAA 3CUNA 1SI9A 4ZCLA 4CD1A 4JI6F 4J2EA 3US5A 2MLXA 2HHVA 2NRTA 1C1BA 1ZBTA 1M90T 3O08A 2GVDB 1NJYA 1GLDG 2Y1LB 2C22A 5E26A 2JDJA 1EP4A 3SBGA 4TYBA 3HT0A 4MMOA 3GIIA 4DU8A 1AXQA 4KC5A 1SQKA 4NYOA 4M8LA 3MMJA 4ZKAA 3NEKA 4DV2K 2JJ4D 1CZBA 3QAUA 1WF2A 3T5HA 2VPWB 4D3HA 1KVKA 4DV7K 1JLGB 3CVKA 1XUPO 5F8JA 3QETA 4OZ2A 2CYYA 3F9KA 4X62J 2OI2A 1S1UA 3J7YP 1RCXB 3GE9A 2HAIA 4P10A 1TK0A 4EZ9A 3BEXA 3UFCX 5FDLA 1QY7A 1NGEA 1CJKA 4BR4A 2M9KA 1N52B 1FX2A 4A5BA 3A8EA 1NGCA 4PWDA 3O3LA 1NMDA 2YHBA 1HNZF 1QHAA 3NMUA 4YY3J 2AIRB 2V4JA 4CJWA 4DV5K 5AQFA 2M0GB 3TANA 4BROA 3O1BA 2QA2A 4CJ4A 3PKMA 2W7AA 1KCFA 2NXEA 4OLPA 2UV8A 2LA4A 1FRHA 1Y3JA 2P9NB 1O51A 1WAFA 4NX9A 4ZLNA 3EVMA 5IZHA 3CJ3A 2AGQA 3C6UA 1U48A 3BQ1A 4WYWA 2DISA 4DX8H 1RILA 3C6TB 1TGOA 2AJ2A 1VSMA 3CWJA 1K1SA 3BBBA 2F63A 2XB2D 1T7PA 1N5TA 4Y2AA 1H0HB 1KDNA 1SC4B 3R5GA 4K59A 1TKXA 2ASMA 4K4WA 3M6VA 3QWPA 1ZS6A 1HRHA 3P31A 1U1NA 2ZD1B 1U6FA 2Y9HA 2CFXA 1T3OA 1H73A 3KG1A 1S1TA 2ZHAA 4PYAA 2OPQB 5E33A 1J53A 1YJ7A 3CC2S 5J2PA 2HS3A 2PC6A 3PDNA 3AOAA 2NUBA 1S7HA 3OUYA 1UL3A 1YWXA 4WU2A 1BOTO 2HHSA 4JI8K 4CO5A 1PYOB 4I9QA 2PEBA 4V19J 4DL0C 2YX1A 2CNOB 3CIPA 1LXJA 5JMVA 4DHYA 3J80U 5GAEI 4DFKA 4JRQA 4UOFA 5E3RA 3CYMA 3G4SS 2D9OA 4Q44A 3M32A 4B02A 1DBDA 4XDDA 3MN7A 3HXMA 2Z1HA 4ATNA 3QPIA 3GPAA 5LL6Z 4EFHA 2A6OA 4KBIA 1GQEA 1M5VC 4IZ9A 4CHQA 3O6QA 3T69A 4H5NA 1ZBIA 4ILRA 2B7CB 1U24A 3KJNB 3D1OA 1K44A 4AQYF 5IQQA 1HLWA 2DB1A 6FDRA 1JWWA 1DTTA 3EXYA 3T19A 1RFQA 3BKTA 4OPHA 3L3UA 3TAMB 2W40A 2UVUA 1NJIO 3ZXWA 1C1BB 1HA1A 3KKRA 4CHPA 5A2QO 2O8CA 4ZVEA 2IHR1 2NRHA 3F0NA 1SJ1A 4M5LA 2W25A 2IPOB 1VQ7N 4KGVB 1IN0A 3HF5A 4KSEB 2X6NA 3J81U 3GOIA 1YZ6A 2YQ0A 4QS8A 3FMBA 3FK4A 4OKJA 1EXQA 4DR4F 4YDUC 3JAMO 4NCAA 2B5JA 3KHRA 3W8PA 4JV5K 3R1LA 2YX4A 3MWBA 4BR2A 1M1HA 1S0MA 1RDCA 2DNYA 3QFPA 4JI6K 3DN9A 2UUAK 2GJ2A 2B51A 5L1KA 2BH1A 5D6GA 1YHQS 1ZBLA 1QUPA 5FJ4A 4Y1CA 2BJEA 4CEDA 4WFBQ 1HLUA 1JJHA 1Y5IB 2RQ4A 3TWZA 3OYNA 2AEFA 1U1MA 1EJ7L 2XWYA 4ILGB 4EIAA 4ZHRA 5D4OA 2C2MB 2P9LB 2BE2A 5L9XA 2QLBB 1HX1A 2HNDA 1ZC6A 1VIXA 1TKZA 3RGIA 1UVJA 3OS0A 3J81Y 3MOZA 1JNZB 2DJWA 3IC1A 2KQ2A 4FPIA 3NCPA 2YWFA 1GEHA 2R7VA 1IR0A 2B0GA 3S6EA 2X6SA 5H9FJ 4DSIA 4LF9F 3E66A 1Q16B 1RAJA 3C6UB 1KC8T 4QS7A 1KFDA 1FESA 4I56A 2RB7A 4NOHA 2ZWPA 4DX5A 1WAJA 2RRNA 4W98A 4Y34A 1GXTA 5KG0A 4CLZA 3ATVA 4Y0WA 4M3UA 5ELZA 2LLZA 2YH1A 4KO0B 1NGDA 1ZTTA 1FJGJ 1E6YA 1JLBA 5KFYA 4TU9A 3WHIA 2YHAA 1VHFA 4NLDA 4CECA 1WKKA 5LL6d 5C0YA 4FPRA 1Q7YO 3F41A 4D3GA 2NRVA 4LF4F 4B1WB 5HATA 2M88A 3TU5A 2HBQB 3I87A 2PEHA 4ZVPB 1DTQB 1UWBA 1XIQA 5AR0A 5J1EB 1S1XA 4FP9A 4F26A 2FJWA 4NLQA 4DWIA 1Y64A 3AAPA 1BISA 4TU8A 4IH6A 1RTHA 3K2YA 2JVRA 5KOXA 3DMJB 2QL5B 2HFOA 4KHNA 3OD2A 3OR1B 3KKFA 2Y1JA 1BCMA 1GH8A 2XSJB 1SC3B 2Z0GA 5ETKA 1Q5VA 5AQHA 3T1YF 2Q6BA 2QLWA 4PL7A 1K8AO 4NZ7A 1I94F 2RH3A 2KJWA 1YBAA 2V6AA 4DCPB 5HBMB 4DDFA 4FXDA 2DNRA 2HFNA 4PG6A 2OYQA 3H2UB 4KR0B 3WXIA 1ZM2A 2VQEJ 2OEJA 4MDBA 3WX8A 5AQSA 3LANA 4U8YA 4C1NK 4AYBD 3MCOA 3G6EN 4DL7A 4U95A 2AYEA 3ETMA 2XCPA 3HRGA 1N34K 2QEXN 3R1XA 3GV5B 4DCOB 5DLFA 2IA0A 3P5BP 2Q1LA 2E1RA 2F4VF 4IXCA 2BE7D 3HLUA 2ZWOA 3EEQA 4DV1K 3VGTA 4WFXA 3PX4A 5F8NA 1U2FA 2P9UA 2NXCA 3Q2SC 4HLBA 3HSGA 3ZZRA 2Q0UA 4CEOA 3UR3C 1HQUA 2U2FA 3VAJA 4I67A 4CNZA 2ZH1A 3ZSVA 1C1CA 4BS2A 3SMPA 2R2SA 2WBRA 2NLXA 3BKFA 1RT3B 1YF5L 5HP1A 5KG4A 2BE2B 2IVMA 1Y11A 2UV8G 1RDWX 5KFSA 2HNDB 1A6LA 5GAHU 3ILOA 1TKZB 1YSJA 1TL5A 3MPDA 4URQU 2W7PA 3ENHA 4B9MA 1AT1B 3CJTA 1O8BA 1P8GA 4S0MA 1C2PA 3NNAA 5EOYA 2FJXA 3LDOA 5C25A 3UDLA 1EIYB 1S5JA 2DRBA 3OTOK 4BRGA 4BBYA 5AQUA 4CF0A 4BACA 3NF9A 1WKLA 4DHVA 3D7EO 1FE4A 2EFVA 2AJFE 3TAFA 1WSEA 2R7OA 3MK6A 1S4FA 4Z94A 4B3OB 3PACA 3C14B 2QSWA 3GBTA 2O5DA 1IKVB 4JKGB 2ZM6K 2O8FB 4PZVA 3CERA 1N6QB 4QIVA 4LFCF 4G6VB 4R79A 4OYXA 4Q43A 4YDDB 3ISND 2IDLA 3EJMA 1H72C 4NEZA 1SKWA 2J6TA 3CCQS 5K5MA 2RMLA 2YX6A 3KD5E 4HUEA 4TY8B 3WUHA 4F4AA 2EFOA 5DETA 2XMWA 5G4DA 3G2XA 3R6LB 1VQYA 4GO7X 1RT1A 4IO9Q 1W2IA 2WBNA 2QE5A 4LQ9A 3M5RA 5IT4A 2EVZA 2OPSA 4RU9A 2DTJA 3G8TA 1RWUA 4LFAF 4C2MA 4FJGA 1OIAA 1KRPA 4GKKF 3P83D 2ZOMA 3HHEA 1KNZA 2HHUA 1VQMN 3C2PA 2ITGA 2W4CA 3PRBA 4OI4A 5KFDA 2CKWA 4H5RA 3CMAN 4A62A 1IJFB 3ENWA 3HVTA 1KN6A 3UR0A 2W01A 4ZLJA 3WIVA 4BGBA 5F8IA 4KB0A 1S12A 2MKIA 1RSCA 4GKJK 3M2VA 3VV2B 4J9LA 2BV3A 4MKAA 5F8GA 1HNIA 5HVGA 4LC9B 3ZLJA 2R8JA 2E5LF 1VBYA 2FSJA 5A8RB 3LPYA 4USKA 2RT3A 3F2KA 1TP7A 4DFJA 4CJVA 4PPDA 1TK8A 3VN5A 1BDGA 2ZJQL 2V8HA 4CH1A 3C94A 3LP3A 3L3VA 4XPCA 3BDPA 4FNIA 2UXBK 1IQZA 3TTCA 4UY8O 4CZJA 3B78A 2P2CB 4TKTA 3BZCA 3RSEA 4DUZK 3LUYA 5GINA 3MTKA 2KTQA 3LW5C 5B0FA 4EZ6A 3JYTB 3J7ZO 4O3PA 3UD4P 1T6CA 3B6BA 3K8VA 5SUHA 1HPZB 4ANDA 4JB8B 1L5UA 1P27B 3KTQA 2UU9J 1Y5LB 2MLYA 5I3PA 3O4NA 3ZTQA 2ZITA 5KFHA 3E9LA 4JRPA 1C1CB 3GJTB 4BC9A 1P6TA 3ADAC 1NPKA 3JB9k 3O2IA 4NZ0A 1WSIA 2E6LA 1VSDA 1WUUA 3GV7B 2ASLA 1HR0F 1FFWB 3LGHA 1APSA 4AL7A 2B4JA 4EYHB 3IFRA 4GRSA 3CJKB 1RISA 5IWAF 1HWUA 2J7KA 4A8KA 2B8PA 1LK7A 5BPNA 3S7RA 4C4WA 2VUGA 5C25B 2HMIB 2PT0A 5J2MA 3LAMA 4CI6A 1TUUA 3PIOL 4ID8A 4OX9K 3G82B 5D4LA 3R3TA 5K8PA 3MFHA 4LFBF 3VGVA 4BLGA 1KVCA 5TKYA 3UVJB 4C8MA 1ZBSA 1S48A 4J2DA 3ZT0A 4RUHA 5A2QU 3X3UA 2JFKA 5BR8F 3GIMA 2Z56B 4IOBA 5HLFB 2ATCB 1AYEA 4RU2A 2DITA 1HI8A 4KGKA 4RW6A 4IO1A 4F36A 1LEOA 4OYPA 1IBMF 2QA4S 1TUVA 4LRFA 3JAMU 2ASOA 3F5TA 2R7SA 3MN6A 1SL2A 1VS3A 5LM7E 3GFXA 3M8YA 1BWEA 1EQYA 5ETPA 1FFSB 3ZX2A 6AT1B 3TA2A 2ZH4A 3BF1A 2Z1JA 4M1KA 1RT1B 1VQ9N 2O8EB 3OYCA 2E6MA 4OX8A 2FGOA 1VR6A 1LKZA 4GVMA 3IP0A 3PXGa 2OPSB 2YPYA 1EX4A 4ILMA 4KH6A 3Q8RB 3OPKA 1S7IA 5CXTA 4OL8A 4IOAL 5A2QY 2UUTA 5EU7A 4HI2A 3DGVA 4FLXA 3QMQA 3EPIA 2CH6A 2Z4PA 1KVBA 2VJUA 2HRTA 3HVTB 4QBUA 1UP1A 1NK5A 3KLHA 3J7YU 3CDEA 4DR6F 4ETXA 2QG9B 3IFEA 5E84A 5M1FA 3W2VB 3JAMY 3IS9A 1V3SA 2NZTA 4JI1F 1N33F 2L08A 3M2VB 4NLYA 1PBAA 2VD3A 1YJTA 4RW4B 2YNIA 2O4GA 3AA3A 3QWUA 3HFVA 1WC3A 1WSGA 3QT7A 3AVJA 4AM7A 2NCKL 3W63A 3L7UA 4HL9A 5B0EA 1S72N 3R5JB 2CA9A 3TZXA 2KYZA 5KFEA 2RE1A 4DTNA 1R27B 2AZ1A 2EFQA 4FPBA 4QIFA 4NB4A 4NXNK 1KHWA 2FJDB 3SSSA 2HHHJ 1CS4A 3RBZA 4BRCA 4B3MJ 1H2UX 4JHDA 1WG5A 3HDSA 4OZ5A 1NU0A 3D2WA 4QWDA 5HL7Q 3CCVS 3M8WA 5EY4A 3WXJA 1RWKB 5LMNF 2JX2A 1P90A 4BWMA 5DRKA 4IG3A 3SUPA 4RUAA 1SBRA 2B3TB 1FNMA 3KNAA 3RJMB 4RR5A 4M95A 1URRA 1GMUA 3SCLE 3WQTA 1GTHA 3LPTA 1R31A 1GLCG 2HAFA 5EWGA 3I0SA 1WI8A 4G1IA 2E5HA 4CJ3A 1RLCL 3W2WA 4LRDA 3VQ6A 1LW0A 2AGPA 1FCAA 1NJIT 2FZGB 3AA4A 2FZCB 4CNYA 4CERA 4DMNA 1RYSA 2IC3A 2VL1A 3BGOP 2HF4A 5L9NA 3PW5A 5M2RA 3UE2A 3I55N 5J2MB 1OYEA 1CC8A 1XR5A 5EDWA 4JKFA 2MLZA 2UYTA 2RRBA 4PAAA 4USVA 3LGMA 4PG7A 3R2CJ 4ZPDA 2DNKA 4NA2A 2FIUA 3Q8VA 5AXMA 3MCAB 2VFUA 4DB3A 4DV3K 1DGKN 3SAHA 1BQNB 5ITHA 5IWAK 3VAIA 3HHKA 3P96A 2HW3A 3RWUA 2MEWA 2V2QA 1P1TA 2LYVA 4RW6B 4NLRA 2N4CA 1QZ5A 3I5CA 1FDAA 4KTQA 4Y2KA 2FSNA 1VQ6N 3A8IA 1ULRA 2XMKA 2UUCK 3SSQA 3FEXB 4N56A 2A6MA 3I0RA 1X5PA 3HI9A 5ETLA 3HSCA 3THPA 3MXIA 1WNSA 4EO8A 4DR1K 3AT1B 3GP9A 3M30B 2OMLA 3Q22A 3RMCA 1TUYA 3KJFB 1RJJA 4DR5J 1X4BA 1X3MA 2AP6A 1W25A 3VVTA 1IR1A 3CD6N 3CCJN 2DGSA 3PV8A 4BDZA 4ZVSB 3LGNA 1RAHB 2I7NA 3DLEB 3MURP 2BUPA 4CD3A 4QR0A 2VFRA 4EU0A 4NXMF 2V94A 2PN6A 2UXDK 2A6AA 1VQLN 4FVCA 4J9OA 3R5BA 4MYUA 4TQSA 3KLEA 3IS9B 3UQSA 2X78A 1HNWJ 3OL6A 1RTZA 1RWPB 2OPPB 3NAEA 3PIPQ 2FC0A 3NKYA 5AQPA 1FI4A 2DH9A 3VGUA 3MTJA 4G1QA 2X3DA 4WQ5C 1Q7YT 2C2RA 4MIBA 3U8XA 3P5TL 2R8IA 4IRCA 1VFJA 4F0HA 3NGIA 1ROFA 2PFUA 1WORA 2DNQA 2K2PA 4I2PA 2LEAA 5DM7L 2DGXA 4CLSA 3OSNA 1FWLA 1MN9A 3I9V9 3NCQA 2G8HA 2QK9A 4DKWA 3DLJA 2F9JA 2O67A 2AYGA 3HSDA 4JI6J 2ZOFA 4KHPF 4B9UA 4JKDA 4HH1A 3U9DA 4ISFA 4DR7F 1GTEA 4H5VA 5D4PA 2E4LA 1BMQB 1UJ6A 2P9KA 5C2CA 4CP5A 2YKNB 1WG1A 3TWHA 3W5XA 2DGTA 1VQ7S 1QVGM 3PYDA 2HVEA 3FKBA 1JLFA 3OXFA 1IM6A 3UB5A 1JJ2M 3KK2A 2CQGA 5AQNA 3UKUB 3H5SA 3ENBA 4PUOA 3GTYX 1CULA 2HQCA 1VQNS 1GMVA 1V6HA 5LSOA 2VOOA 5AFUH 3I0SB 4DUYK 3D45A 1X9MA 2UUBF 5L1JA 4CZHA 4K8XA 2IC3B 1N32F 1XMQK 2HS0A 4E89A 1DY3A 4K2XA 1S9EB 4M63A 5LMNK 4BE1A 3FNNA 1F5AA 2VKRA 4NASA 2MSSA 1GLFO 2YNHA 2AGOA 4G1PA 1HNZJ 5DJBA 5D0GA 3ZSWA 3WXLA 5MLCQ 1VJQA 3AVMA 1S1WA 4CZEA 1FW6A 1X4DA 3QNWB 3C6AA 2H65B 1AA1B 5I3UA 4Q8FA 2KL8A 3L3CA 1IJJA 3MMBA 4A59A 2L3MA 1JX4A 2IM1A 4GVEA 5L39A 4R5PB 3QO9A 4GY2B 2B9XA 2FD2A 1PO6A 4YFUA 3OTBA 4PA1A 2JOQA 3T1HF 2R7XA 2IVNA 5FLXO 1QLNA 1X9SA 2KXFA 4OJ1A 1CXUA 3AA8A 3JXUA 3L0QA 4GV3A 1R3NA 2XC9A 2F9TA 3CJ4A 4OGCA 2GMJA 1N4LA 5C7PA 1U25A 1VRTA 1WF0A 2AX0A 3OT9A 1JLCA 1IBKF 5KG1A 2R2RA 2DNMA 4R8UA 1D1UA 4LVOP 1GLAG 2A1RA 2OZMA 5CR4A 3OXLA 2UP1A 2DNOA 3NGSA 4CHNA 2VIHA 1KSPA 4J7CA 1A0OB 1NSAA 2W2MP 3P1GA 3SK3A 4A8MP 2GHVC 3LP1B 5AFUA 5C2GA 4K2JA 5GAHI 3CJ5A 4YHHF 4U67L 2W6LA 1HPMA 1O6XA 3E8OA 4CZCA 1QTMA 4WE1B 2PMZD 1ZBHA 3ZT2A 2GHPA 2FVSA 1BU6O </