1TVRA

Hiv-1 rt/9-cl tibo
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Aspartyl protease
molecule keywords REVERSE TRANSCRIPTASE
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tvrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tvrA05
4KI6A 3KK3B 3LAMA 4GVMA 3S3OA 3HVRA 1B9FA 5J1EA 4FJKA 4Z0UA 2UVWA 5F8JA 5HLFA 2W42A 2DTUA 1ZTWA 5KFVA 5FDLA 4DTJA 4ELTA 3HVTB 4E7LA 2WOMB 3L8BA 2HW3A 4B9MA 3SUOA 3QEPA 4KV8B 1NJXA 4I9QA 4RUAA 1RA6A 3RB0A 1S6QB 1CSJA 4O3SA 1JLBB 4EP4A 4KHWA 1RT7B 3ZT1A 4FBTA 1W0HA 1VRTB 1QE1A 4B9UA 2G8IA 4ED7A 3JYTA 3DYAA 3P83D 1NK8A 1RBTA 3FQLA 3MXMA 2HHQA 3PO4A 1ZBLA 4FLYA 4RG8A 3OS2A 4LSLA 1RTIB 4PUOA 2ZQBA 1VSIA 4E1MA 3JSMB 4ZHRB 3D5MA 2D5RA 1TKTA 4FLVA 2OH2A 3OS1A 2NUBA 4MK7A 1Z26A 4RNOA 4GW6A 4CEZA 2W8KA 1TL1B 4NCGA 3TAMB 4YQWA 5F8HA 4KHQA 5KFQA 4IFVA 4RW8B 3DRPB 4F3TA 2J6SA 1RTDA 4CF8A 4PY5A 5KFRA 5F8NA 4O44A 3DLGA 1SKSA 2G8KA 4J9QA 1WSFA 2YNGB 4KV8A 3OL6A 2XY7A 3TAEA 3N6NA 1T94A 2HNZB 1S6QA 1JXBA 2WHOA 3TR8A 4M3TA 3CG7A 2FLNA 3M9MB 2HWHA 4H4OB 5CYQA 3VQ7A 3HO1A 5KFXA 1TQLA 1BQNA 2C22A 1TV6B 2X6NA 2AX0A 2WTFA 4IBNA 3MECA 1C1AA 5KGXA 4IOBA 1S1UA 3IAYA 4IG3B 1HMVA 2P1JA 4RW4B 1KHWA 4RW7B 1T03B 4J9RA 4PQUB 3FQKA 1LAVA 3OYLA 2OPPB 4ZP9A 2F8SA 3HPHA 4TQRA 4DSEA 2OPRA 1UOCA 3MR2A 4HTUA 3TVKA 2W9BA 3ISND 2BE2A 1NOZA 3EYZA 5CYMB 2I1RA 3HXMA 2JC0A 1B9DA 3LP1A 2QKKA 4ECWA 3OLAA 4NLGA 4MQ3A 3IRXA 3CDUA 4JRPA 1QAIA 4KB7A 4CEFA 1HYSA 5DG7A 2YHBA 3G6XA 1BL3A 1IKXB 3WNGA 4AH9A 3OHBA 3NGZA 3SUPA 4TLRA 4BWJA 1U49A 3ZT0A 3IS9B 3VN5A 2IJFA 3MXJA 3CWJA 4F4ZA 3S3NA 4RZRA 1EXQA 1BHLA 1RT6B 4O4GB 3B6PA 3ZSRA 1KCFA 4TYAA 4ECRA 4IG0A 2EC0A 3C6UA 3QEVA 4ZTFA 3NGDA 1ASUA 3V9XA 4CECA 3PVXA 2PZSA 3MEGB 1VSLA 3EPIA 3IGNA 1KFSA 3QETA 3DOLB 3LP3A 4DQQA 1JXLA 3HPGA 5J2NB 1UWBB 4NLDA 4DSFA 3PX6A 2G8HA 3ICLA 3NBPB 4QAGA 4ZP8A 1IH7A 1NK9A 4AHUA 4R8UA 3OL9A 4IR9A 1BQMA 1SV5A 1NHVA 3DM2A 4ED0A 1U04A 1QSYA 3CJ3A 3T5LA 3PX4A 3QIDA 1R0AA 2IAJB 4Y3CA 3PW0A 1C2PA 4EBEA 1VK0A 2PYJA 4KKOB 4J9KA 1GOAA 3I0SB 1JLGB 3LP2B 2R7YA 2P5OA 4PUOB 1L5UA 4KE5A 3KLFA 4ZHRA 3SFUA 2RF2B 3V6DB 1C0TB 4B9NA 5HBMB 2BANB 5CY4A 3QIPA 1EP4A 1Q9XA 2VG7B 3HJFA 5KFHA 3KLEB 1WSHA 2IM1A 3L3VA 3BDPA 1C1CB 4NLTA 3GV5B 2HMIB 1RTDB 3PJXA 1RBUA 3K5LA 4DL3A 5KG2A 1BCMA 3DLGB 2FBVA 4H54A 3QEXA 3L2RA 5HRPA 1LWCA 1VRTA 2XI3A 4DMNA 2OA8A 4HVJA 4DTSA 1BQMB 2HHUA 2XO7A 3D0PA 3LZIA 3N6LA 1SL0A 4KHMA 3OL7A 2R8IA 1RYRA 1CZ9A 3RMAA 4BDPA 1RILA 2KFZA 4KHRA 2C2RA 4TY8B 4OGCA 3HP6A 1K1QA 4DL2A 5HP1B 1C0UB 3OSPA 1RTJA 3LANA 4RNHA 5JUMA 4J9LA 2R2UA 2Z1HA 4DG1B 5E41A 5KT2A 3VQCA 3V6DA 3T5KA 2D0CA 3FFIB 5FRMA 1JXEA 1NKEA 4NYNA 4FJJA 2AX1A 1SL1A 4WXOA 3OS0A 3KTQA 2IDOA 2VWKA 4DL7A 2FVQA 3SUQA 3GQCA 4O3PA 5J2PB 3UPFA 1O1WA 3MR6A 4AHRA 2C2EA 1RT1A 3KHHA 3KHGA 5CZ2A 4KTQA 2D41A 4UQGA 1TAQA 2GIRA 4HCBA 2ATQA 3C6TB 1DTQB 3AVMA 3VQQA 4JV0A 4K4UA 3EZ5A 3L2WA 1RTHB 3OYNA 1HQEB 2VG5B 4H4OA 5CYQB 4J9PA 1BIZA 2C28A 3AVFA 3GIJA 4FJHA 3ZSYA 3KMQA 2HVHA 1IKYB 3RB6A 4RW4A 3SQ4A 3CFRA 4U7CA 4B08A 1NK7A 3BSOA 3FSIA 4LSNB 4TY8A 5L9XA 3K59A 4W5TA 4KTWA 4M3XA 1C0MA 4BE2A 3QEIA 2JC1A 3MFIA 2OPRB 3M9OB 3BSAA 1JLCA 4WZMA 4NYFA 3V4IB 4FLWA 4BACA 1U45A 1RT2B 3CDWA 2HNDB 1YTAA 5KG5A 3M9NB 3CO9A 1K6YA 2YKMB 1IKVB 3D28A 2IBKA 4KAZA 4ZMMA 3CQ8A 3IRXB 2XCPA 1WSIA 4NYZA 3M8PB 3NBPA 4IH6A 5KT3A 1DLOB 2BR0A 2DPIA 4NLPA 3Q8QB 2R8JA 2D3UA 2VA2A 4W5QA 3DM2B 4E0DA 1NNDA 1FKPB 4JUZA 1TGOA 4Z4FA 2B43A 1R0AB 2ATLA 4K50A 5F9NA 3I0SA 3BQ0A 4FJIA 2E6LA 1TKTB 5HRSA 3CIZA 5C25B 1TP7A 3NAIA 4E19A 4O3RA 3PW7A 1K1SA 2RKIB 4FJGA 2IC3A 3T3FA 1C0TA 1TL1A 3SQ0A 2BANA 4O5BA 4DWIA 3ITHB 3DOLA 3KD1E 3I5AA 3MEDB 2G8UA 1NK4A 4HCCA 1EP4B 2HNDA 4BE0A 3H5UA 4MH8A 3DLEB 4O0IA 4G1QA 3NKYA 3EY1A 3CM6A 3KD5E 3QLHA 5I3UB 2IJNA 2VG6A 2B6AB 1ZBHA 4CEQA 1EKEA 4R8UB 1L3UA 4KFBB 3TAPA 1RBSA 4E7KA 2V4RA 3VQBA 2ETJA 1YVFA 2OPSB 4FK0A 3MEEA 4TSXA 4NLSA 2HHSA 1S9EB 4NLOA 5KFGA 4ECSA 2AGQA 5KTQA 4DS5A 4WFXA 4CHOA 4DSLA 4ED6A 2VA3A 2Q3SA 1JLGA 3LP0B 4IQXA 2GBZA 1S9GB 3CJ0A 3N6MA 4R5PA 4HHTA 4YP3A 4K8XA 4OVLA 4CJVA 3NDKA 4ID5B 4Q43A 3AVHA 2IMWP 3ZSVA 4DL5A 1C0UA 3AVIA 4CHQA 4C8KA 3L2UA 4DTXA 4M3RA 3SQ2A 2IC3B 4EEYA 2HVIA 3WNEA 5CYMA 4ZPDA 1G15A 1WSJA 3VQSA 3DRPA 2CJQA 1B92A 4RUCA 3H59A 2Z1GA 4JS5A 2B5JA 4ECYA 4ED3A 3RAXA 5C5JA 4IDKB 3AO3A 1Z25A 5DK5A 2AWZA 3SJJA 2KZZA 3G0ZA 5C42A 4CERA 3QNNA 1C1BA 2IM2A 4O3QA 2FC0A 4ZP6A 1WLJA 3OL8A 2E9RX 3I5CA 4OL8A 4JV1A 1BQNB 3KLIA 2WK4A 4ICLA 4IRDA 5KFSA 5KRTA 4IG3A 1S9EA 2GV9A 4CFAA 3ZSQA 2O4GA 2HAIA 3NHGA 3MFHA 1KFDA 4WYLA 4WFZA 4NZ0A 3OYDA 2DPJA 4XPCA 3LP0A 2WB4A 4O4RA 1X9MA 2BQ3A 3QGIA 3KMSA 3RMBA 5J2QA 3QGHA 2AGPA 1ZBFA 3OYMA 3RAQA 1QSSA 2Y1IA 3LP1B 3AA2A 2YKNA 3QINA 1UWBA 3ULDA 4FJ9A 1WNEA 3MR3A 2B5JB 3OLBA 4K4YA 3NAHA 2DFFA 1RT1B 3T19A 3HYFA 4K4TA 5DGAA 3C6TA 4M3WA 3HSTB 3OYHA 4F8RA 3DYAB 4DLEA 1S0OA 4CF9A 4ZVHA 5KG1A 3PO5A 3AVCA 4MIAA 4J2DA 1JLQB 1S1TB 4CIFA 4G3IA 3PHEA 3VA3A 1S5JA 1JX4A 3HM9A 1RA7A 1ZTTA 1FXXA 1KVAA 3T5JA 1JL1A 5DLGA 2RDJA 2FLPA 4CF2A 2Y1JA 3G6VA 5FROA 3SQ1A 4CHNA 2RF2A 4I2QB 4B9VA 4QCLA 3MEGA 4DLGA 2O5DA 1BCOA 1OS5A 3KLGA 1D9FA 3KLHB 1RDBA 3CFOA 1LWFB 1RT2A 3HVAA 3Q8PB 1SUQB 1KVBA 1TKDA 2JLEA 4YR3A 3T1AA 3BQ2A 4EBCA 4Y1DA 1MU2A 3VQ5A 5EWEA 3S9HA 2JGUA 3RRGA 1DLOA 3QLHB 1LWCB 1S1WB 4IH7A 3TQ1A 4FZXC 2GC8A 1T05A 4MIBA 2OPQA 4MFBA 1CXQA 2IS3A 1L3SA 1UA0A 3H5XA 4URSA 3K58A 1VRUA 1NHUA 1VSKA 5KT5A 3QO9A 2FVRA 1J5OA 3MR5A 4FYDA 4M41A 3DLKA 4HUEA 1SH2A 5C25A 4JRQA 2D0BA 4CHPA 1RTJB 5SZTA 3O3FA 3QIPB 4FJLA 5JS2A 1I6JA 4IFYB 4B3OA 4FS1A 4QW8A 1N5YB 2HHTA 1KHVA 3KLGB 1XHXA 4O44B 1KLNA 4CJ4A 1GOBA 3DOKB 2YNGA 1NJYA 4K4ZA 3KK2B 4LQ3A 3M8QB 3F9KA 1IKXA 2VG6B 3K5NA 1WSEA 5KRSA 5KI6A 1A5XA 1C1BB 5JXSA 3OJSA 1HQUB 3HT3A 2YHAA 1RTHA 3LZJA 2VG5A 4CGFA 3QESA 2J6UA 2V9WA 1TL3A 5D3GA 4O4GA 1T3NA 5F9LA 3QZ8A 3DDKA 5KFMA 1JL2A 4FXDA 1T03A 2FBXA 1ZETA 2XY5A 4Y2CA 1VRUB 4PWDA 5J1EB 4YR0A 2PYLA 1XC9A 3H08A 3TI0A 5HLFB 4YFUA 1TAUA 4TQSA 3C95A 3DLKB 3PR5B 5C24A 5J2QB 3SV4A 1XR6A 4K4SA 2FJWA 1ASVA 2X74A 1IKVA 2YNIB 2G8WA 5K14A 4ID1A 3CYMA 1HNVB 2E6MA 2IA6A 3AA5X 1SKWA 4LQ9A 1KVCA 2R8GA 3ISNC 3OHAA 4CGDA 1GX5A 3PJWA 2UVRA 1SH0A 1J9AA 3OYEA 3LALA 3MAQA 2KZMA 4CF0A 3KLIB 3V1RA 5F8MA 4M45A 5L1JA 2JEFA 3MF5A 2P5GA 4KBIA 3LP2A 1TL3B 1EETB 4OLBA 4R0EA 3ASMA 4ZVFA 2WONB 4ECTA 3DLHA 2UUTA 1JKHB 4CJ5A 3ZT3A 2XI2A 4QPXA 3KHLA 2CKWA 4FW1A 4JLHA 4RNMA 4DSIA 3PUFA 5KT7A 4EBDA 3PY8A 3VQ4A 1JLCB 3PW5A 5DMRA 4WFYA 1I39A 4F50A 4Z4GA 1TK0A 2VG7A 3QGGA 4M94A 4CJ3A 1S6PB 3QYYA 5KT4A 4DQIA 1SL2A 1TVRB 4CJLA 2YNIA 3PV8A 2XGPA 2B4JA 4DTPA 1HNVA 4CK3A 5EU7A 4O55A 3DRSA 3TANA 3RBEA 1S4FA 3UDLA 4KAIA 3RTVA 1HMVB 3PW2A 3I0RB 3S3MA 4C8NA 2ZD1B 3TWHA 4F3OA 4CCHA 4GMJB 1U4BA 2WCXA 4XO0A 2BRLA 2BRKA 4NLYA 3V81A 3AA3A 1X1PA 4O3OA 3RBDA 3AA4A 3AVBA 4F4WA 4FJ8A 3Q8RB 4J9SA 2Z1JA 4CHYA 4B9TA 4C8OA 4RNFA 4FLZA 1RT3A 3E01A 4CFBA 3NFAA 1D5AA 3AVJA 4DU1A 1C1CA 4QWDA 4FZYA 4DU4A 1J54A 1RT5B 5J2PA 1S97A 3RRHA 2Z1IA 1RDCA 2XY8A 2D0AA 1HRHA 4LY7A 5I3UA 3WNFA 1DTQA 5J2MB 5KFJA 4KHNA 1MU2B 1W25A 3IG1B 3IS9A 4LH4A 1S1VA 3L2QA 1S1WA 2WRMA 4N41A 3K57A 5KFTA 3V9SA 1T05B 3OY9A 4MKBA 1S10A 2OPQB 4MFBB 1UAXA 3VA0A 3VQ9A 3DI6A 2RDIA 5D3GB 2JEGA 3AO4A 4WE1B 5T14A 3KJVA 1RDDA 4HUGA 1RTIA 3KOAA 4ID5A 2GUIA 4EP5A 1VSDA 3GV8B 5DQIA 1TK5A 3U6FA 4PWDB 1LV5A 1T8EA 3BJYA 2W7PA 4MK8A 1XR5A 4CK1A 3V4IA 2ASLA 5J2NA 2V0NA 4IKFA 3E01B 3OYBA 3HHKA 4AILC 2JEJA 2YKNB 4NRTA 1RT4A 4B8AB 3KK2A 4CFCA 5I42B 3CDEA 2D3ZA 3EPGA 5KG0A 4W5RA 4TYBA 1BI4A 4QWCA 3IGVA 4K4VA 1NJZA 2F8TA 4O3NA 5JS1A 2I5JA 1FKPA 1FKOA 4IR1A 4N5SA 3NCIA 1FK9A 1BIUA 4FJ5A 3F73A 2R2RA 4F4XA 1TV6A 1IM4A 5KFOA 4URQU 1S1UB 4L8RB 2FJXA 3NGIA 4DTOA 2A1SA 4CESA 3KK3A 4MK9A 4DQSA 3U3YA 5F8GA 3BR9A 4E7IA 4RW9B 4DTRA 5DQGA 4DFJA 4CJSA 2PY5A 1KSPA 1Q9YA 3ITHA 5C24B 2IGIA 5KG3A 3KLHA 3VQDA 1S1XB 3MEDA 1HYZA 2DFHA 5KG4A 5DG9A 3RB3A 4FVMA 4H4MB 2F8EX 4KB0A 5KFLA 3DLEA 3BGRA 5SWMA 4E1NA 3SUNA 4KHSA 3U3GA 3M8PA 4OKJA 5KFAA 1RT4B 5K14B 3AO5A 3B6OA 4CJQA 2B6AA 4KO0A 4OKKA 3E51A 5KT6A 3CJ4A 3KKSA 1U47A 3H5SA 1N6QA 3H4DA 3JYTB 1D1UA 4GC7A 3V9WA 3SYZA 1JIHA 2AJQA 3DRSB 1TKXA 4DL4A 2XGQA 3OYCA 4CIGA 1IKWA 3OYJA 1CZBA 4BDZA 3HL8A 3QZ7A 1W9HA 1F21A 2W8LA 1LAWA 4FJMA 4FK4A 2W9AA 4CJRA 3V81B 3ZT2A 3SI8A 1EX4A 4ECUA 2R2SA 4CEAA 3HK2A 1X9SA 4KHUA 5F8IA 4K4XA 4B3OB 3SV3A 3LPTA 4BE1A 1SH3A 1CLQA 5KFNA 2ZE2B 3CM5A 5HROB 2KQ2A 1S1XA 3OSNA 4CJUA 1S6PA 4Z4CA 2UVUA 3H2LA 4Q5VA 4H4MA 3RR7A 3M8QA 3BGRB 3CJ2A 3TAGA 4DQPA 4GC6A 4NLVA 1RCHA 4ECVA 3MEEB 3G6YA 4BWMA 3MXIA 4QWBA 4DFKA 1HYVA 2XRIA 1S0MA 4M95A 4ELVA 3P5JA 4J9MA 1KLMB 2HNYA 1HPZA 2YNFB 2BGGA 4CGIA 4R5PB 4DF4A 4LSNA 1LW0A 3K5MA 4YNQA 3SZ2A 3H98A 3HKWA 4AHSA 2R8KA 4EZ6A 4W5OA 1REVB 3KNAA 1I3AA 1NOYA 1LWEA 1JLFB 4X2BA 4NCGB 3TAMA 3NE6A 1YVUA 2G8FA 4LH5A 3NF6A 3GIKA 1ITGA 1RT5A 2O4IA 5KG7A 4E3SA 3RMDA 5C42B 1NKCA 3NF9A 4MKAA 1D8YA 4FLTA 4WYWA 3M8SA 3AO2A 5KFIA 4BDYA 4B8CA 3C94A 4FM0A 1ASWA 1DTTB 3PZPA 3KHRA 4Z4IA 2XWYA 1WAFA 4ZP7A 2J6TA 3LAKA 1JLQA 1S1TA 4C8LA 3NGYA 2F96A 4ED1A 3LDSA 2FVPA 2G8VA 3L2VA 4EZ9A 1RBVA 1BGXT 3RMCA 3TAQA 4J9OA 2FLLA 3UR0A 4ELUA 1ZYQA 1HPZB 2YNFA 2FVSA 4WE1A 4CGGA 4CK2A 1JKHA 1RT6A 3H4BA 3QEWA 4PQUA 1LW0B 4ZTJA 5KGWA 4HKQA 2R2TA 4IG0B 3V9ZA 4I2QA 3GYNA 5HP1A 4CJFA 1Z4UA 2RN2A 4PA1A 1NJWA 2YNHA 4O0JA 4NRUA 4WZQA 3AVNA 1RDAA 5KFKA 4DEZA 2BE2B 4CJKA 1U48A 4FM2A 2AU0A 4DSKA 1ZBIA 5HRRA 4IRCA 2X6SA 3WNHA 1LW2B 3V6KA 3SNNA 3UQSA 1MMLA 3D45A 1TVRA 3ZT4A 1C6VA 1HYSB 2UVVA 3VQAA 3NMAA 4FJNA 4F4KA 3SFGA 3BSCA 1RYSA 4FJXA 1QE1B 1UA1A 1DTTA 4DFPA 3P1GA 4AHCA 3ZSXA 4NCBA 5KFFA 3DRRA 4RW6A 2AQ4A 2D7SA 3ZSOA 3DMJB 4LSLB 3KKRA 2QV6A 1TKZB 3MTKA 1XI1A 4KSEB 3ALYA 4KB1A 1QS4A 1J5OB 3HVWA 2FBTA 3FDSA 4Q0BA 4Y1CA 4DF8A 1NK5A 2LSNA 4FLXA 2C2DA 3IN5A 2IOCA 4KREA 1D0EA 4CHZA 4IFYA 4OJRA 1GOCA 3L3UA 4JV2A 2WOMA 3BQ1A 1Q8IA 3AVKA 1WN7A 1SUQA 3SI6A 3KLEA 4ECQA 4FK2A 5DLFA 3GV7B 3OYIA 1RT7A 4QWEA 3ZSZA 4B9SA 3KK1A 4OKEA 4I7FB 2JEIA 1VSHA 2DFEA 4ICLB 1YTUA 4IKAA 1SV5B 4YMEA 1S49A 3VQPA 4E89A 1N6QB 4NCAA 5KFEA 4NLXA 4Y34A 4IRKA 3PW4A 4Y2AA 2IM3A 4JS4A 2OZSA 1KLMA 2HNYB 3QO9B 1S9FA 4I9LA 3DI6B 4J9NA 4K4WA 3KJVB 1VSMA 4TXSA 3DLBA 4RW7A 2IM0A 4QOZB 2OPPA 3AVAA 4CEDA 3KLFB 5EWGA 2VWJA 5F8LA 3PR4A 4FJ7A 4KHYA 1RT3B 1S48A 4F4YA 2ILZA 4Q45A 1REVA 1IG9A 4CJWA 4B9LA 4J2EA 3I8DA 3SCXA 4C8MA 2HHVA 1X9WA 3RWUA 1S0NA 3FFIA 2XC9A 3TARA 2ILYA 5HROA 4CGJA 1WNSA 4N56A 2ALZA 5KFBA 2E9TA 4NLRA 5J2MA 4G1QB 4E7JA 2EHGA 2W9CB 3KIOA 1RDRA 1HQUA 1XR7A 5KFYA 1KRPA 5KFUA 5FRNA 1HJRA 2EX3A 4FCYA 4CE9A 4DTUA 4DFMA 3NL0A 4KFBA 3CJ5A 2GIQA 4EO6A 4CJPA 5DG8A 2RPIA 3CVKA 3QNOA 3AO1A 4TN2A 3NH1A 1WAJA 3GIIA 3O4QA 3RB4A 4XIUA 4ECXA 5L1IA 1N48A 5KFCA 4AHVA 2X78A 5KFPA 4FBUA 1WSGA 3LWMA 4URGA 4M3YA 1QQCA 4I2PA 1QUVA 1HNIB 4CF1A 2OYQA 4CEBA 3T5HA 4CJEA 4FM1A 4DG1A 3V1QA 4W5NA 1LWFA 1KTQA 3HVTA 4M3ZA 5EWFA 4DQRA 1NK0A 4CIEA 4EYIB 5EUHA 2YKMA 4CJTA 3AVGA 2BQUA 3HP9A 2HWIA 1L3VA 4IDKA 3O3GA 5DGBA 1T7PA 4KO0B 3SPYA 3TABA 3H5YA 3V1OA 4ED8A 3H40A 4RU9A 4FS2A 3LPUA 4Z4EA 3QIOA 1JLAA 3HPOA 1FKOB 1NKBA 3I0RA 1FK9B 2XY6A 3A2FA 5KG6A 3ZCMA 3TAFA 1EETA 4Q8EA 4AHTA 4NLUA 4H8KA 4ED2A 2ASDA 4J2BA 4KKOA 4N76A 3OYFA 3JSMA 3DMJA 5L1LA 3AV9A 3QERA 3NF7A 4QWAA 4CEOA 4ZVGA 3K2PA 2QK9A 3BREA 3CFPA 4LD0A 4ZPAA 4XPEA 2QXFA 4NLQA 3OYAA 2E4LA 2QE5A 1XHZA 1RBRA 4Q0BB 1J53A 4RW9A 3GIMA 4DSJA 4WXWA 4Z4HA 1HNIA 4HUFA 2YNHB 4Q8FA 3O3HA 5FDLB 3NF8A 3NAEA 2QKBA 4FZZA 2RKIA 4OGEA 4F2RA 4IFVB 4RW8A 5EDWA 1Y97A 1ZBUA 1TK8A 3LWLA 4KI4A 1RNHA 3OYKA 1VSEA 4OPJA 2ZE2A 1XWLA 4ECZA 2V4QA 1CXUA 2KTQA 1LW2A 1JLBA 4IH5A 1A5WA 3V9UA 2HNZA 4ZVEA 1QAJA 3V6JA 1QHTA 3KK1B 3AVLA 3GILA 1HARA 3K5OA 2OZMA 4DS4A 3G86A 3KLVA 3MECB 2IAJA 3DRRB 4KTZA 1SKRA 4HYKA 3OYGA 3M8RA 2FBYA 1QTMA 4K8ZA 4NLWA 3VQ8A 1TKZA 5HRNA 4CFDA 1N56A 2E9ZA 1L3TA 2ZKUA 1GX6A 3DLRA 5HBMA 3THVA 1VSJA 4EYHB 4M3UA 4TY9A 4Q44A 1JLEB 2HMIA 2FJVA 4M42A 4DL6A 2BDPA 4E7HA 4ZPCA 3SPZA 5KFDA 5KFWA 3IG1A 3PX0A 2AGOA 4KPYA 1BI4B 3OVNA 1S1VB 2ASJA 4RNNA 4I7FA 2XHBA 2W9CA 2R8HA 2YV0X 2FVCA 2BQRA 3G10A 4OLAA 2OPSA 1U09A 4FW2A 2W7OA 3NH2A 4YR2A 2WONA 4CGHA 1D9DA 2HB5A 1IKYA 4DU3A 3BSNA 2HHXA 2DY4A 4EO8A 3C6UB 4QW9A 1S9GA 2KW4A 2UUWA 3Q8SB 2ITGA 3NH0A 3ZSWA 5L1KA 4N47A 4I2PB 2W9BB 1NK6A 3FRZA 1JLFA 1LWEB 2P51A 3O4NA 3V6HA 3VQEA 2A1RA 2KFNA 1YT3A 3EZUA 1A5VA 4ZPBA 4KRFA 4J2AA 4DTMA 1N5YA 5I42A 1N4LA 5T7BA 1JLEA 1VSFA 3UIQA 3DOKA 3VQ6A 1QSLA 4CEEA 5CZ1A 2HHWA 1BISA 1RAJA 1HQEA 2I5JB 4FLUA 3RR8A 3I5BA 1TKXB 5DQHA 4U6PA 2ZD1A 3OJUA 1JLAB 1IKWB 5KFZA 4OPKA 4F2SA 4RW6B 1IO2A 4DTNA 2XCAA
chains in the Genus database with same CATH superfamily
4CO1A 4I67A 3KK3B 1QJHA 3Q24A 4V19X 1YX2A 2DO4A 3HVRA 2D3O1 4FJKA 1OIAA 1GLCG 2W42A 3S1TA 2ADBA 1UEUA 4ZVRB 1ZTWA 4DTJA 3V5RA 4HEA9 2WOMB 2QW9A 3BGLA 3MX5A 4Z94A 3MOJB 1KS2A 4FNHA 1T0TV 1NJXA 1N0UA 4K7QA 3G6ES 3OTCA 4O3SA 4YORA 4EP4A 4XEIA 4B3TK 1M5HA 3GJQB 2DNZA 4F3MA 1QE1A 4ED7A 2F3JA 1VIXA 4FVCA 2XB2D 3PO4A 4RG8A 3IR6B 1OH6A 2F8HA 2ZOMA 1NZ8A 4PUOA 2KB2A 3O9TA 1IV0A 1WUUA 2ZQBA 5JMNA 3D66A 3O2IA 2ASOA 3JSMB 4PQAA 1TKTA 1I5OB 2DR8A 2ZVIA 3BO4A 4FWOA 3OS1A 1F9HA 1UVIA 3G8TA 3ZTRA 2V7ZA 4CRJA 3GYGA 2P9LA 5AJ3K 5D0RA 5KFQA 5LY3A 3CMAN 3KUEA 1RAAB 1U8SA 4WYBA 2CG8A 4O44A 4BQLA 2D9OA 1WSFA 1NSPA 4ZVTB 3OL6A 3N6NA 1T94A 2EBGA 1JXBA 2WHOA 3TR8A 1OPIA 2FZCB 3M9MB 2QN6B 3CCSN 2RQKA 3HO1A 3VF6A 2C22A 1TV6B 2BH1A 3IBWA 2X6NA 1R8AA 1TU0B 4ZJLA 5AQRA 4IG3B 1HMVA 2WTUA 2V52B 4RUBA 4DR2K 1KHWA 3GJRB 4RW7B 4PQUB 2OPPB 2BE7D 2NXJA 4FOEA 1YJ7A 4ZP9A 4FPRA 2HFZA 2XS5A 4DBQA 3SQGA 3T69A 1MDUB 4B9QA 3TVKA 5IT9O 4JKCA 3KK7A 2NXUA 5EX5A 2P9LB 1O8BA 4B1XB 2JC0A 1V9OA 3LP1A 1B9DA 4LF5F 1G4CA 4ECWA 3OLAA 2PEBA 3IRXA 3WT0A 1Y5NB 2YVSA 4CEFA 1EB0A 4HH1A 3CCMS 4FPAA 2YHBA 1BL3A 2QL7B 2IIRA 4AH9A 4UOFA 3MCSA 4WP3A 3L3CA 3D2EA 4OYXA 5M2RA 3MXJA 3R6MA 3ZZTA 4G1IA 4LF7K 1BHLA 2MQLA 5KOWA 4LRCA 3M8YA 1PJ6A 1KCFA 1V5IB 3R8YA 1MG7A 3VEVA 1Q7YO 3FLCO 1Y3JA 4BRHA 3MPDA 2Q43A 3UB5A 2VOOA 1JNRB 4D3GA 2R7QA 3MEGB 1VSLA 1PBUA 4OHYA 2BUNA 3DOLB 4PKGA 1JXLA 1MWMA 5J2NB 4BR9A 3D0HE 3KWGA 3LF0A 2GQCA 4ILGB 2CQ3A 1WI6A 4BC5A 5IV4A 5H1SV 4A8WA 3NBPB 4ZP8A 2P9UB 1CG2A 2YKQA 2E29A 2BJ7A 3CJTA 1BQMA 2KLAA 4NXMF 1NHVA 2ACYA 2OFHX 3CCLS 2AYBA 1U24A 3VZHA 2Q66A 3T5LA 3PX4A 3QIDA 5EN1A 3JSRA 4NI2B 2IAJB 1C2PA 2YY3A 3MTJA 4RCHA 2YWEA 3F2KA 2P5OA 3U27A 4MDAA 2QMWA 3S41A 4DV7J 3KLFA 1KOHA 3ZZUA 5BRFA 3LPYA 3W3DA 1UVJA 5BN9A 5HBMB 1U6FA 1PCAA 1IN0A 1Q9XA 2ZJPQ 5GMKa 3BDPA 1C1CB 3C15A 3W5YA 4BC3A 2MSSA 1RTDB 2YTCA 4TVAB 1RBUA 3K5LA 4BR4A 1Y64A 1BCMA 4YN3B 2HKEA 2FBVA 3QEXA 1LWCA 1VRTA 3ONQA 2XI3A 1SC4B 2DHGA 4A8KA 1BQMB 4RUHA 2N4DA 1S76D 2RHKA 3N6LA 3MMAA 4OJHA 1CZ9A 1RILA 4TY8B 2HVZA 2CPHA 1P1TA 4K43A 2H3GX 3H2VE 4OI2A 2M8DB 5K5MA 3OSPA 5L8RC 1RTJA 4RNHA 5JUMA 2W2MP 2KHOA 4J9LA 4K41A 5E41A 2X1BA 3VQCA 2IY5B 3FFIB 5D77A 2UXDF 1WG1A 1RWNB 2ZM6K 2DR5A 4DR4K 4WXOA 5CAAA 3OS0A 3SUQA 5J2PB 1M90T 5BJRA 1RT1A 1FRJA 4KTQA 4PCQA 4ETXA 4UQGA 2ZH7A 3LDOA 4HCBA 2PMHA 1DTQB 1N33F 2K1RB 4J9PA 4H4OA 4FO0A 1ULRA 1YRTA 4D3HA 5KPZA 3R8EA 3AVFA 4FJHA 4OZ1A 2O1PA 3MAAB 1M5PC 1IKYB 5D15A 1RQ0A 1OY6A 2GWJA 2V6AA 3WQTA 3FSIA 3CC4N 3QSIA 4TY8A 3K59A 4BR0A 1J5EJ 3L09A 1VQYA 4M3XA 1C0MA 2GX8A 1D3WA 2BJDA 2OPRB 3DGVA 4UQTA 1DZ5A 3BSAA 4WZMA 3V4IB 4BACA 2Z56B 2HBQB 5KG5A 5DZ7A 3P5BP 2E5GA 3ILJA 4ZMMA 3UCGA 1FKAF 3CQ8A 5KT3A 4OIXA 3GU0A 1KQFB 2MQOA 1VQMN 1WOSA 3RBZA 1YJRA 4C6AA 1IR1A 2D3UA 3SDEA 4LR8A 4E0DA 1S72N 3KVGA 2B43A 1KP6A 4IJNA 2WAQD 5HVHA 4JKAA 1QVFM 4DUZK 3PDNA 5D8HB 2HHHF 2DNQA 4K50A 3I0SA 3OFFA 4FJIA 2WBMA 3ZNJ1 4J5OA 1BDGA 3NAIA 3BH7B 3PW7A 2RKIB 4FJGA 4DHYA 1N52B 2VKZG 3T3FA 2G2OA 2BANA 4O5BA 1D8ZA 3ITHB 3GIRA 4YOWA 2G8UA 2FHJA 2QYCA 5GMDA 3EXCX 2KL8A 3DLEB 2XWXA 1OH8A 2CYYA 3CM6A 1RAEB 1X4EA 5I3UB 2V68A 3C14B 3I96A 1EKEA 3KZBA 1SJ1A 1SC3B 4RJVA 3I56S 1RBSA 4E7KA 3VQBA 1WB9A 3Q8YA 2OPSB 1AW0A 4KJIA 1PKUA 1NM2A 2NNWA 3GPAA 4GV3A 3GP9A 1RP5A 5M2PA 2ZH8A 1JLGA 3LP0B 2GBZA 4HHTA 3UDCA 4PYDA 4CJVA 1T6CA 4DR4J 4Q43A 4DV4J 1C0UA 3AVIA 5BPNA 3L2UA 2DISA 2IC3B 4ZVOB 1K8KA 2ZH2A 2LVWA 1G15A 4LFCK 4BGAA 3H59A 3F0NA 4H0OA 4IDKB 3IFEA 4NWBA 5EGYA 1YITS 2VGNA 1TFWA 1LFWA 3SJJA 1BA0A 3NEKA 2IM2A 2VODA 4BG8A 2Q3PA 3O1BA 1WF0A 4JI0F 3AFGA 3KLIA 1XK8A 4AM6A 5FLXU 5BN8A 4IRDA 2GGPB 5KFSA 1B7YB 2EK1A 1N0VC 4IG3A 1S9EA 2VFVA 5K8OA 4CFAA 5FPEA 1GXTA 2CH6A 1IBLJ 1GLLO 4O4RA 3J7ZT 2O8EB 2DT9A 3QFWA 2W41A 5AQTA 4N8OA 4KH1B 4B3SK 1DKGD 5J2QA 3PFEA 1SQFA 5SUHA 3RAQA 2AYEA 4JKGA 2QX0A 3FBCA 4BRFA 1QSSA 3LP1B 3AA2A 4HACB 2JSXA 2JWKA 1S77D 3OLBA 2DFFA 3NAHA 2BV3A 3O3LA 2CNKB 1WOPA 3HZEA 1KOOA 2RJZA 5DGAA 3C6TA 5B0GA 3OYHA 4W98A 5GAHU 4USTA 5KG1A 3PO5A 2RNEA 2DNYA 3MMVA 1MROA 2OTLN 2YQ3A 4J2DA 3ENHA 4FOIA 4YOVA 4FWPA 1JX4A 3WZ0A 4LF4F 1FXXA 2FLPA 4CF2A 3BDEA 2Y1JA 1Y3KA 1R0BG 4Y2IA 1F5AA 1ZA2B 3NWRA 4I2QB 2FJDB 3AH6A 3M30B 3BV8A 3MEGA 2O5DA 1BCOA 4JKHA 1T3VA 3KLHB 6FD1A 4P7TA 1RDBA 3D2FA 2E2OA 4LSZB 3CFOA 1LWFB 1CEZA 3HSJA 1KBRA 1Q82T 2EEYA 1KNZA 2R7XA 2HFNA 3I6PA 1SUQB 3R7SB 1TKDA 2QTDA 4Y1DA 5M1QA 2J5AA 2LEBA 3I31A 1T9XA 3AOCA 3VQ5A 2KKHA 5EWEA 2CA9A 2JGUA 2DBBA 3TZZA 1LWCB 2QXLA 3QJLA 4FZXC 3QBWA 2GC8A 1T05A 1HFEL 1L3SA 2C3MA 2LXFA 1UA0A 3PHTA 3H5XA 3J7YU 2XYHB 4K0KK 3K58A 1VRUA 1JJ4A 1Q82O 4AM7A 1CS4A 1VSKA 4FYDA 3FZ2A 4M41A 2ASPA 1IXKA 3W8GA 5C25A 3K9JA 1RHKB 4CHPA 1IQTA 2YQ0A 3O3FA 1UEVA 4IO9L 2KN4A 3QFUA 2HHTA 4DCHA 5L39A 1XHXA 4YDXA 3D2FB 2HHPA 4DV0J 5JJBA 1RWMB 2V94A 4LQ3A 2E5LF 2XLJA 4RWXA 2VG6B 3K5NA 1WSEA 5KI6A 3HZ6A 5HATA 3B8HA 1C1BB 2VPYB 4DUYF 1HNWF 3N9UC 3BKFA 3HT3A 4EK2A 2YHAA 4EWTA 2VG5A 4UZCA 2ZBPA 1KDNA 1M5OC 1TL3A 5D3GA 1JL2A 4L75A 3C6AA 2HAFA 4HDHA 3DKDA 1VRUB 3UD3P 3NGUA 2PYLA 1YBTA 5HLFB 4YFUA 4H5NA 1TAUA 5I4MA 3C95A 2V2QA 4CM0A 4M1KA 1S99A 1N36J 4PXEA 3SV4A 3J7ZO 1T02A 2X1FA 2P9NB 4DV2F 4MYTA 4K4SA 1XNRJ 2DH8A 3G71N 2X74A 1IKVA 2YNIB 2MB0B 3BO3A 4X4PA 2WVCA 4ID1A 2OJ3A 1BWFO 3CYMA 5H9EK 1SKWA 3IKMA 4O0NA 3SMZA 3EN9A 2KZMA 3C3LA 1Q1KA 5F8MA 4MTPA 4M45A 3WIUA 3MGJA 1Q4RA 1EETB 4QS8A 4ECTA 2GTDA 4CJ5A 1BMQB 2JRSA 4LFCJ 4ANDA 2AT1B 2CKWA 4FW1A 4JLHA 5IWAJ 1GTHA 3PUFA 5KT7A 3JTNA 2VC1A 3VQ4A 3VALA 2PBDA 1E3MA 2DR7A 3QSYB 1I39A 1TK0A 4NA1A 1S0VA 2E20A 3J81j 5BPMA 4DQIA 1A6LA 3HHLC 2B4PA 4BS2A 1XMOK 3DDNA 2DNOA 3WXLA 3JSYA 4KAIA 3RTVA 4NA3A 4UTGA 4A2BA 3GSDA 2RRBA 2W40A 4A8YA 3VENA 1U4BA 5U47A 2WCXA 3V2UC 3PCOB 3CJKB 2MZTA 5B08A 3KG4A 1FX2A 2X3DA 4NZ7A 3UVJB 1ZM9A 4DN0A 3NFAA 5K20B 1T9YA 1C1CA 4QWDA 1IBKJ 4OI1A 2HBMA 1HNWJ 1S97A 2Z1IA 4A4JA 5H9FK 1B4SA 3GFHA 2LQJA 3JSBA 4LY7A 4DPWA 1DTQA 4KHNA 3C14A 5ETOA 2K1RA 2JHEA 1JCEA 4GKKJ 4PKDB 1W7WA 3NXZA 1PBAA 1G3OA 3B78A 2WRMA 2NZ4A 4Q7AA 4MKBA 1WD6A 1S10A 2OPQB 4CZEA 3VA0A 1YVNA 3HHLA 2V4JA 5LJ5Y 3FZHA 2RDIA 4WE1B 1RDDA 3KJVA 1RTIA 1VQLN 3MM8B 4TNOA 2XM3A 4EP5A 5D0HA 4JN4A 1NMEB 1VYAA 4LF4J 3HSGA 2QM1A 2P9IA 1FNOA 1U7LA 2KH9A 5D4OA 4W4MA 5FPDA 2HOEA 2V0NA 2CPYA 4IKFA 3OYBA 4OZ0A 4CH0S 5B0BA 3TA2A 2JEJA 2YKNB 2VHGA 4NRTA 2KT3A 1UVNA 1UVLA 3TUZC 2POKA 1PILA 3S6EA 4CFCA 2GQQA 2D3ZA 3EPGA 1OJ4A 3FFKB 3CJ1A 1RU2A 2XHWA 3SMPA 3MPVA 4CWBA 1E6VA 1N36F 1VQ4N 2FY8A 3SDEB 3PYDA 5EY4A 2GGPA 2I5JA 4IR1A 4N5SA 3NCIA 1BIUA 2FUG9 3FNNA 5KFOA 2Y1LB 4V1Ak 2EFNA 4L8RB 3OTOJ 2YCHA 3MM9A 5AQLA 4MJKA 2C2MB 4FWNA 4MK9A 5F8GA 4DX6A 4E7IA 4DTRA 1J6ZA 5C24B 2IGIA 3KLHA 1S1XB 2RH3A 3QWUA 1HYZA 2ROEA 3DRYA 2DNPA 5DG9A 4WQ4A 4HWIA 4FVMA 2OHDA 3EL2A 5KFLA 4E1NA 3SIPB 3W7BA 4W90B 5KFAA 3NGRA 3AO5A 2YKPA 3QBCA 1KN6A 1NZAA 2HGNA 3CJ4A 4ISFA 2HVDA 1U47A 2LDIA 3H5SA 1N6QA 2FGCA 1NBWA 4GC7A 2PE8A 2V63A 1RGVA 3DRSB 1I51B 1NWKA 3CC7N 1CZBA 3T41A 4JKBA 2ZUAA 3D3BJ 1W9HA 1F21A 2W8LA 1LAWA 2XZDB 2W9AA 1RAHB 4BRIA 1WACA 4CIOA 4BR2A 2AP1A 4ECUA 3HK2A 4CEAA 4OHXA 1X9SA 2EXUA 4FWQA 2AV5A 3VR1A 3J81Y 4K25A 2XS2A 4RX6A 1CLQA 4GRSA 5AQKA 5M2UA 1S1XA 2E5LJ 1XMQJ 3W66A 3RR7A 4LRAA 4XDDA 3A5OC 1RFQA 1VQPS 5T41A 3UKUA 4PG6A 2GV1A 3H8YA 2OTLS 4ECVA 3MEEB 1YXQA 4A62A 8AT1B 5AQMA 3CE8A 3U1NA 1S0MA 2MGZA 4S0MA 1MNEA 4J9MA 1KLMB 1NEEA 3GCWP 2EBEA 4DF4A 4LSNA 1SBRA 3PXGa 1VGYA 5GAHI 4OI0A 1KONA 3K5MA 2HS3A 4YNQA 4JV5F 5B7WA 1REVB 3KNAA 1I3AA 1RCOB 1NOYA 1LWEA 3M3ZA 4XK8C 2J76E 1IBKK 3K8VA 5IFMA 2G8FA 4B1WB 2VIHA 5LMNF 2HQCA 2MLZA 5KG7A 3CGIA 3NF9A 1HI0P 2V2KA 4CZCA 3VCDA 1KXPA 3AO2A 1X4FA 4ZJOA 2UUCJ 1N32J 1DTTB 3PZPA 3KHRA 3Q8UA 5HVFA 5G4DA 2E88A 4ZP7A 1S1TA 4C8LA 1MMDA 2F96A 4OV1A 2G8VA 4WBFA 3L2VA 1WF1A 1YJUA 4MYUA 1NPKA 5JLHA 1RT6A 3H4BA 1BUXA 4LF4K 2O8EA 1P6TA 2R2TA 2MKHA 2A10A 3VZIA 3V9ZA 1TUVA 3MN9A 3D0IE 3OXFA 4O0JA 4WZQA 3BZQA 1WC0A 4YB1P 5M1FA 1NLVA 4LT6A 2J9EA 3TVYA 4I56A 4QIVA 4DSKA 5E7OB 2WVDA 2LQ5A 3WNHA 2XMTA 3V6KA 3MMJA 1MN9A 3VAFA 3TW0A 4ZCLA 1C6VA 3AB4B 3VAIA 1SJQA 2FHJD 5K8NA 3BSCA 3W1YC 4NXNK 2MLYA 1DTTA 3HF5A 4AHCA 5F2RA 2JJ4D 1TELA 1T9VA 2MZSA 3ZSOA 2EK6A 2BYCA 1FF2A 3MTKA 3P31A 3AT1B 5ETQA 1UEKA 4DV3F 3HVWA 2D1CA 4OYMA 4NLBA 2ZWPA 3THWB 2HF4A 3RRKA 2N4CA 4OJRA 4LR9A 3Q8VA 3N79A 4QQBA 4BRKA 2GVDA 4JV2A 4ZKAA 3GG4A 3H3NO 2Y8YA 4L3QA 2IMOA 3SI6A 4FK2A 5DLFA 3ET6B 3O9SA 1RT7A 3ID6A 3OA9A 1AZSB 4NA2A 3SXLA 4ES2A 2JEIA 2IVNA 5C2DA 1VSHA 4ICLB 4GKKK 1SV5B 1PIEA 4L76A 2V69A 3H1QA 1YJNN 2G0CA 4LIWA 2UXCF 1RBLA 2K8GA 4Y34A 4IRKA 1LOUA 2IM3A 1VIOA 4JS4A 2HNYB 2RHSB 4K4WA 4TXSA 4C23A 1QZ6A 2DO0A 1PAEX 2GHPA 2Y8WA 2Y3YA 5AJ3J 2ZJRQ 2VWJA 5LSLA 5F8LA 1RT3B 3CCVS 2ILZA 2PN6A 3AD7C 1IG9A 4B9LA 1GLFO 5AQOA 4C0BA 2MTLA 1S0NA 3FFIA 2VD3A 3TARA 3SSRA 3K0SA 3AGKA 2NSCA 3T1HF 1WNSA 2ALZA 4V19J 5KFBA 3T1YF 4NL5A 3HSDA 3M2VA 4NLRA 1B7FA 3GSIA 1FRHA 4G1QB 2MY7A 3CD6S 2Z4PA 2DRBA 4LF8J 2EHGA 2W9CB 1XR7A 1HQUA 2F63A 3TVZA 3AODA 2EKNA 4FCYA 4CE9A 3P45B 4EO6A 2GIQA 1SJ3P 5DG8A 3QNOA 2IRUA 1VQMS 2CJ9A 3CCJS 3DDIA 1X4GA 4ECXA 4GKJF 5L1IA 1NSQA 3MN6A 3K0JA 1FESA 2RRNA 4NLCA 2ZBIA 4F0HA 4URGA 1QUVA 3FZMA 3T5HA 3C65A 1YDLA 1RWKB 3V1QA 3KJNB 4C2MA 3THYA 3R9LA 2VFSA 4M3ZA 3OTBA 4KH6A 4CIEA 5TKWA 3PIOQ 2HFUA 4X4TA 2YH0A 3OR1A 2P9SB 3O3GA 5DGBA 1X60A 3SPYA 4PXBA 3GFXA 2E7VA 1Q78A 4RU9A 4FS2A 4Z4EA 1UPMB 1JLAA 3HPOA 4DV1K 3U9ZA 3CDAA 3A2FA 2DNKA 1EETA 1JWWA 2ZNYA 4Q8EA 4N76A 2FB0A 5L1LA 4L3NA 4JI1K 3NF7A 4QWAA 4CEOA 5C2FA 3K2PA 2C42A 3BREA 3A13A 2E4LA 2QE5A 4H5RA 1HR0K 2QMXA 1XNQF 3HSCA 2VWBA 5I3QA 4HUFA 3FVYA 2H1YA 4FZZA 2RKIA 5EDWA 3CIPA 1RNHA 3OYKA 1VSEA 1CXUA 1LW2A 2E5JA 1RJJA 2ZDPA 1U1KA 2UV8G 1VISA 4IH5A 2YKAA 3V9UA 2HNZA 1QAJA 4X65K 1QHTA 4PG7A 1WEYA 3AVLA 3K5OA 2HQ3A 4ALZA 3PNIA 2E66A 2AF6A 5IQQA 3JB9k 5IM0B 2YXLA 3DRRB 1SKRA 4NLWA 2LECA 3A8EA 3Q0AA 3ENOA 4CFDA 2M0GB 2E9ZA 3A5MC 3HOSA 4JI6J 2QWPA 3G8QA 2V2VA 2IRYA 1AT1B 2Y0SD 2GWKA 3THVA 4EYHB 5AR0A 2RU9A 4JYAK 4YEAA 3QICA 2L48A 4X4RA 4TY9A 1VQON 3VEOA 1OKJA 4WJBA 4C11A 4M42A 2Z2MA 4ZPCA 3D6RA 5KFDA 2VZ9A 1SIWB 1QDUB 3PX0A 2AGOA 1V5VA 3O9UA 3HBTA 4RNNA 3VAMA 4AUKA 4BVOA 2XHBA 2YV0X 2XHCA 3PYEA 4Z7CA 1HNWK 4ZIWA 3CCEN 2OPSA 1U09A 2V4JB 3NH2A 1OH7A 1YKWA 3SCJE 3DXKB 4BLGA 2CFXA 2APOA 1D9DA 2HB5A 2P6TA 1K47A 2HHXA 1UCNA 3Q8SB 2ITGA 4P2MA 3A3PB 3CIMA 5L1KA 2IFXA 2P51A 3BBFA 4W92B 2F4VF 1FDNA 4KGMA 4J2AA 2FSJA 1FEEA 5T7BA 4ZCMA 3UIQA 1QSLA 5CZ1A 3AJ2A 4L3KA 1U0HB 1UMJA 1RAJA 3A8IA 4XTTA 3QRPA 2JX2A 2I5JB 4H0PA 3ISZA 3NNAA 1DQ9A 3OJUA 2NYHA 4F2SA 3KFWX 4KGKA 3DXKA 2XCAA 2NPFA 2LYVA 3CXCM 1HD0A 3VQTA 2KHDA 2I6WA 2NXCA 1I94J 1XJWB 3LAMA 2B4VA 2H65B 1Q18A 4BY9C 1FI4A 4Z0UA 5F8JA 4LF7F 4RWWA 1J5EF 4ATNA 3MM7B 3HVTB 4H4KA 2HGLA 3N4WA 2YJFA 3FRYA 4I0WA 5HQMA 3H1VX 1CULA 2HW3A 3JS6A 2J9DE 1LOTB 3L7UA 1S3XA 4KV8B 3RB0A 4GMKA 1CSJA 1YZ7A 3HD1A 4KHWA 1RT7B 1W0HA 1UZHA 1VRTB 3Q86A 5HQ8A 3VOVA 2G8IA 2IVOA 4K42A 3M2RA 3GLJA 1Z1ZA 1WHVA 2A0FB 3FQLA 3MXMA 2HHQA 5A76A 3DNCA 4FLYA 2VKRA 1CLFA 2IVFB 4LSLA 4DCPB 1TUWA 2MKCA 4E1JA 4ZHRB 1HW8A 1KAYA 3D5MA 2D5RA 2DIVA 3UR3C 4FLVA 2VASA 3MCNA 1WDDA 2OH2A 2QWLA 2NUBA 2FHOB 3DXBA 2DHAA 4M8LA 3VEWA 3BUZB 3ZZPA 5AT1B 2W8KA 3PFOA 3MK6A 4RW8B 1NDCA 2ZM6J 3QAUA 4OLPA 5ELZA 3DRPB 4CF8A 2EWHA 2H3EB 5KFRA 5F8NA 3DN9A 2G8KA 4KV8A 4HTJA 2XY7A 4H5VA 3P96A 4M3TA 2DCLA 3CG7A 3ELHA 5KFXA 1TQLA 3VEXA 2AX0A 2W24A 1S1UA 3IAYA 3MUTP 4J8FA 4RW4B 4F25A 4X64F 5JLFA 1PAUB 2QZ8A 1VHXA 1VQNS 2RSQA 2PT0A 3C19A 1B3TA 2EFOA 4DSEA 1UOCA 4HTUA 2FDNA 3CD0A 5AQJA 4JI6F 4H03B 5HK4A 3CCTA 2DYAA 1UL3A 2E5LK 3JAMU 3J7AN 3G6EN 2FLOA 1QAIA 3I56N 4JI5J 4CZMA 1V4SA 4HDGA 4ZCIA 4FDFA 3M6GA 2VYPA 4BWJA 1LFPA 3W9JA 4E2FB 3VN5A 4F4ZA 3S3NA 2MKSA 1RHQB 5A6WA 2DCUB 1RT6B 2DY1A 2QLWA 1CJTA 3SJHA 3ZSRA 1C4CA 2J0XA 1GH8A 2EC0A 3C6UA 4CYUA 1F60B 3NGDA 1SC1B 1ASUA 4X4OA 2MKYA 1L3KA 4JKDA 1IBLK 3VTIA 4NB4A 1VBZA 4Y6IA 1U6BA 3H6EA 2NR0A 1MN7A 5EVZA 4P71A 4L73A 3LP3A 4IOCL 4MKYA 1K8AO 1UWBB 1NM1A 2J7WA 4QIEA 2HLUA 2J7UA 3WC2A 2G8HA 4R8UA 2CPJA 4IR9A 2LXIA 1SV5A 4HR2A 2F9TA 1N32K 1NMNA 1U04A 4LF1A 1QSYA 1OQ3A 4CLUA 4DXLA 1NRKA 2BBEA 4EBEA 1MWYA 1VK0A 4KKOB 5JVGQ 3JQKA 4H0XB 3I0SB 1JLGB 3OBYA 2VC0A 3IBCB 3I9V9 3CCQS 1APSA 2HFSA 2GVZB 5CXTA 2R7WA 3T6JA 3QIPA 1WKJA 5GAEP 1K8KB 1EP4A 1XNQK 3HJFA 3VF2A 1WSHA 2DNMA 1H73A 3BEXA 3GV5B 2ZJRL 3FCHA 3BM7A 3M2VB 3BKTA 2KVQE 3PJXA 3GL1A 4ID8A 4CD1A 3GR1A 4DMNA 2OA8A 4U67Q 2EC2A 1DEJA 2X51A 3CW2C 4BQZA 4V19S 5EHHA 3FBEA 4KHMA 4F67A 3OL7A 2ZH4A 3TYTA 1RYRA 1BHNA 2QC3A 3HP6A 3BYRA 1K1QA 1WHYA 4WFBQ 5HP1B 1C0UB 4WCEL 4KGZB 3NWGA 2OI2A 1M5SA 3BH6B 2R2UA 2MHNA 1OSDA 2P9IB 2QYGA 3V6DA 1Z6RA 3VAKA 1JMTA 1FVSA 1JXEA 3I87A 4FJJA 1ZM4A 2AX1A 3N28A 3KTQA 2VWKA 4DL7A 2QL5B 3U9DA 3VAGA 3HHNB 4WFAQ 4Y0FA 2QJ3A 3C6TB 3AVMA 3OW2R 4K4UA 4JI3K 2HG4A 3OYNA 2K3KA 5CYQB 2ZJQQ 1YJNS 3GIJA 2CNLB 3KMQA 2J9DA 3CT9A 1X4CA 3CJ9A 3E9PA 1RAFB 3VAJA 3CFRA 4B08A 1NK7A 5IOLA 1Q86O 5L9XA 2HMPA 4KTWA 1HBNB 2Q6BA 3MFIA 4AL7A 2V8HA 2E1CA 4NYFA 3VVUA 1XNRK 4X84A 1PYOB 3TR5A 1U45A 1ZS6A 1GLDG 3CO9A 1K6YA 1VQOS 2DH9A 3MPWA 4A8FA 2M7SA 3CMAS 3AJ1A 3POTB 2IBKA 4KAZA 5D4LA 2ZBCA 2AJ4A 2XCPA 4U7BA 3T9ZA 4YUDA 2BR0A 3VGSA 1ZXOA 1S7IA 2R8JA 2N82B 4JD2A 4W5QA 4X62J 3DM2B 1NNDA 4JUZA 3CC7S 4BG9A 1R0AB 4NXNJ 2JVOA 2CZVC 3CCUS 2AIRB 4HH0A 2NRWA 4WQ5C 3W2WA 5LM7E 1TKTB 1LK5A 1KAXA 5HRSA 5C25B 5GADU 2XNRA 1WC4A 4MT1A 2IC3A 2ZBQA 5M1NA 4QYRA 2H4YB 3QPIA 1C0TA 2YX6A 4DWIA 1TUYA 1HJOA 3I5AA 1FA0A 4BE0A 4LF9F 3H5UA 2VBYA 3HULA 4OHVA 1CJUB 4WU3A 5ADZA 1HW9A 2IJNA 4C8YA 1M1HA 4Q2LA 4HTLA 4A59A 4KFBB 2ZOGA 2ETJA 3MEEA 4LIRA 2HHSA 1EKSA 1S9EB 4OX8A 4PR6A 5KFGA 1NB2A 4ECSA 5M1PA 1Y7PA 4YS2A 3BN7A 2CQBA 1RACB 4DS5A 3SAGA 4PG4A 4CHOA 1NDPA 1SB6A 4ED6A 2VA3A 2Q3SA 4F26A 1RWWB 1S9GB 2MZ1A 4OYZA 4YP3A 4OVLA 3NDKA 2KRBA 1R31A 3SLCA 5FJ4A 5IC4B 3ZSVA 2YBVA 1P90A 3ATUA 4C8KA 4HI1A 4JKGB 4OZ3A 4I68A 4M3RA 3SQ2A 4GVBA 4EEYA 4HACA 2E1PA 1OPZA 2HEKA 3MUVP 1WF2A 2CJQA 4RUCA 3RAXA 5C5JA 3KJQB 2O8BA 3MPUB 1E4GT 5DK5A 4YDUA 2PMZD 4X62F 3CF5Q 5LJ3Y 2F9JA 5H9EJ 3L7OA 3G0ZA 4O3QA 2FC0A 1WLJA 1S6UA 3AQOA 1F0XA 1J27A 1PC4A 3P39A 2AJ1A 2RUSA 4NMXA 1HNXJ 4HL9A 5KRTA 2I8EA 2PC6A 3PJ9A 3EGWB 3FGVA 2HAIA 3IFRA 3MFHA 2E1RA 4IOXA 2BZ2A 1S4EA 3PRBA 2VJUA 4DCOB 2Q31A 1DAXA 3KMSA 1B0TA 3JTOA 3R6GB 3PEHA 1IBKF 2IYIA 5C0YA 2Z30B 2RIJA 5KOXA 2P8IA 2ZH6A 3TRGA 4WTYA 4OLOA 2XG8A 4GVBB 1UWBA 4BROA 5DRKA 1WNEA 4K4YA 2BKPA 1FHTA 4O8UA 4QIGA 4F8RA 3DYAB 4DLEA 3M2RB 5C15A 4ZVHA 4N8NA 1HLWA 3AVCA 5IQ6A 1V3SA 3CUNA 1RBAA 1S1TB 3ENWA 1U1QA 4DMZA 4G3IA 1N34K 1S5JA 3HM9A 2BABA 2FYXA 2JWNA 1RA7A 2M4MA 2M2BA 1JL1A 2CJYB 5DS7A 3DLLQ 4JAXA 4FPBA 4CHNA 2RU3A 5F1XA 1XMQK 3TTDA 4DPYA 2WC9A 1OS5A 3ZO7A 1KAZA 1SQKA 4NMLA 4A5BA 1VQ5S 1D9FA 2YWHA 4DR6J 3Q8PB 1GXUA 3MD3A 1RCXB 5GMEA 1U25A 4ZK7M 1UFWA 3NCRA 4FXVA 3HHDA 1XIQA 1Y5LB 1FDBA 3BQ2A 1X4AA 3IM8A 1MU2A 2IDEA 3ET6A 2AA4A 3FGUA 1MWQA 3UE2A 3RRGA 4DJBA 5CQGA 3QLHB 2I9SA 3PIOL 3TQ1A 4U8VA 1PJ7A 4MIBA 2OEMA 2MLXA 2UUAK 1XQSC 5HI7A 3HHEA 2CVIA 3HHLB 4I64A 4M5IA 4P2XA 3SK3A 4DV3K 4P75A 3CJKA 5F41A 5KT5A 2OTJS 1BD6A 5ETKA 1SH2A 3SCKE 1RTJB 2OD4A 2JNJA 2PIIA 1C4AA 1GXLA 4FJLA 5JS2A 1I6JA 2P9NA 1TMJA 4B3OA 1T95A 1W2BM 1DHMA 1HBMA 1VMBA 4JI8K 1PJ5A 4YHHK 2CQHA 3DOKB 2YNGA 4WQ4C 1JNZB 5HJYA 3KNGA 4M5DB 3VGKA 1DFDA 5ETVA 3F9KA 4P2SA 3SBTA 3M6UA 5KRSA 5DO2A 5K9FA 4UUXA 2KT2A 1FTRA 4J91A 3OJSA 1HQUB 4JP8A 4DV1F 3W5ZA 1DY3A 3EKUA 5HMZA 4QPTA 2E7XA 5GAEI 2GNKA 1T3NA 3RBXA 4FXDA 3GMGA 4FF2A 4JHDA 1LCUA 1GMWD 5GAGU 1HNZJ 2XY5A 2VQFJ 4Y2CA 1R59O 4PWDA 5J1EB 3TJAA 4RPFA 3M8ZA 4PZVA 3Q83A 4ILLA 3PR5B 4NEZA 4DCJB 2X7IA 5C24A 3HFVA 2OMLA 1XR6A 1MWZA 1VQKS 4F0KA 2YWWA 3IXQA 2G8WA 4QR2A 2GJIA 4RTFD 1RWUA 3UN3A 3CCSS 2E6MA 3HCXA 2YHYA 1KC8T 3OHAA 5LXYA 1YI2N 2DGOA 2UVRA 4RU2A 4UW2A 1J9AA 5A8WA 3OYEA 3CCMN 4LFBJ 4X4SA 1YJTA 4A46A 1N32F 4DR5F 4YOTA 4USHA 4KBIA 3WEEB 4R0EA 2VJVA 2CQ1A 4ZVFA 3ASMA 2M88A 3B8AX 1WBDA 1NMDA 3DOMA 2D0PA 4QPXA 3KHLA 2R7OA 5AQQA 5D0GA 3NVKA 1FW6A 3MWTA 1U1LA 2MZJA 1FEHA 1HD1A 4WFYA 4Z4GA 2IJRA 3QGGA 4CZHA 4M94A 4JI5F 5CZXA 3EJMA 4CJ3A 2OO4A 1RU1A 4M63A 4YDUC 2QSWA 2HBZB 2GAGC 4JOUA 1YITN 3TJ8A 2MZRA 4GNIA 1RSCA 1HNVA 4CK3A 1D4XA 2ZJPL 2UXCK 3CJ8A 4IXCA 2GQ2A 2CGLA 5DDRC 1HMVB 4X66F 1NUEA 3S3MA 3TWHA 5IM0A 3FJ2A 1RWOB 4QS7A 1FX4A 4XO0A 4U7UK 4CD3A 4HT7A 1X1PA 3D3CJ 3RBDA 4FJ8A 3UKRB 4B9TA 3GG0A 4RNFA 4FLZA 2CZ4A 3A8JA 2MQNA 3VESA 2JL9A 4DU1A 4BRQA 2QGFB 2XY8A 4ZN1A 1BOTO 4R79A 5I3UA 5J2MB 1ELOA 4B3RF 3IG1B 4HHUA 1WKKA 3TTCA 3IS9A 5CZVA 2AMCB 3QWPA 1HNZF 2Y1RI 4N41A 2ZWOA 3I8BA 2OLWA 1NU0A 1SXLA 2ZDOA 2BOAA 4MFBB 5AQFA 3VQ9A 2JEGA 5AFUH 2AP6A 3R2CJ 4WWSA 1H2TZ 5DQIA 1GLJO 3U6FA 4OZNA 2QWQA 1XUPO 1T8EA 2VQEK 2ZWHA 5CA5A 1YJWN 4CK1A 4LRBA 3E01B 5KAKA 2KFYA 3F5TA 1VQKN 3UCZP 1M1KO 1IWGA 2NS1B 2VPZB 4JK8A 3KK2A 4CLYA 4F0MA 2DR6A 4TYBA 1SAZA 1J2VA 1WDTA 4CBXA 3O5BA 4UOGA 1VS3A 1EWRA 2MQMA 5T7LB 1FKPA 2FXUA 1FK9A 3I4HX 3F73A 4CLFA 3W60A 4AXIA 1Z2LA 2ZHBA 2R2RA 3A4TA 4F4XA 4YHHJ 2FJXA 3TSUA 3R5JB 5HJXA 4DTOA 1Y9OA 3M4XA 2A1SA 1BE4A 2HSEB 4DQSA 3U3YA 3BR9A 3S7RA 4DR6F 3A5LC 1H7WA 1KSPA 5KG3A 3MEDA 4LF6J 1B0VA 3P49B 3FBBA 3BGRA 3R3LA 3SCIE 4KHSA 3SQOP 4K2JA 4OKJA 4QR0A 5K14B 1QHAA 4ANCA 1K9MO 5B0CA 4KO0A 2A5XA 2B9WA 5BREA 3IWLA 1D1UA 3NY0A 1FNXH 2WSEC 3RGIA 3D2EB 2DGXA 1R8PA 3NS7B 4CIGA 3OYJA 4KHPK 3HL8A 3AY9A 2Z2LA 3P38A 4R0JA 1VK8A 5FD1A 3OTOF 4FK4A 2HF3A 4DR5J 4CJRA 2P9CA 3EICA 5LMNK 4PKIA 2NRHA 3BPDA 3P5TL 4KHUA 5F8IA 4QR1A 2L41A 4MDBA 3JXOA 3LPTA 4FXWA 4BE1A 1SH3A 3KG1A 3MM7A 5KFNA 2ZE2B 3J7Z5 1A7GE 2XLIA 1R8CA 2GS8A 3PRDA 4Q5VA 3ZZOA 3BGRB 4DX5A 1OQ6A 2QIFA 2UXBJ 1IUJA 2P9UA 4DQPA 4NLVA 5G0RA 3G6YA 4QWBA 2ADCA 2YX7A 4HVZA 3W61A 4M95A 3P5JA 2HNYA 1T6DA 2YNFB 3OVAA 2BGGA 3DGPA 4CGIA 1I1GA 4JI7J 1REGX 2HPUA 1XNQJ 4USWA 2OELA 3H98A 2KG1A 2R8KA 3ZZYA 1RUSA 1WKLA 1RHJB 3M32B 2GIFA 2EFQA 4KH4A 3NE6A 2J0WA 2Q79A 3AD9C 3GIKA 2Z8QA 4LRDA 4DB3A 2BEFA 1QTNB 3RMDA 5AQNA 4YOXA 2HBLA 1WSVA 4B1YB 5HN0A 4B8CA 3C94A 3TA0A 4MO4A 1WAFA 3LAKA 1JLQA 1LK7A 3M6XA 4KGVB 4ED1A 4MLHA 2FVPA 3VF4A 4L72B 3RMCA 3TAQA 4ELUA 3UR0A 2YNFA 3IBFB 5DDOC 3DGPB 5BRHA 3QEWA 3DOMB 4A8QA 4HKQA 3TEGA 2E1ZA 4IG0B 2XSJA 4YOEA 2D74B 1Z4UA 2RN2A 2H48B 4I6AA 1ACMB 1NJWA 2E1YA 3N5BA 5BXIA 3AVNA 1VRQC 1OO0B 2HBRB 4FM2A 2AU0A 2ROGA 2UXBF 1ZBIA 4DR3F 1PGZA 2X6SA 1LW2B 5A6PA 1WTFA 2OGUA 3UQSA 3D45A 2EVZA 3ZT4A 4JI4J 1P1LA 1HYSB 4OHZA 2AJ2A 3VQAA 2C2NA 1RWXB 2DPNA 3M2UB 4B1UB 1X5TA 1UA1A 4OI3A 7FD1A 2XZWA 1RAGB 5GAEU 3P1GA 3Q7CA 3HFZB 3DRRA 3PRVA 4EFAC 4RW6A 2DEIA 4DX7A 3KKRA 1P8ZA 1XI1A 4B02A 2ZH3A 3R1XA 5B0EA 1BWEA 2DGTA 4K5SA 1M0SA 3FDSA 4Y1CA 4DF8A 1NK5A 2HFOA 4FLXA 3IN5A 3UKRA 4KREA 1D0EA 4CHZA 4OZ5A 2MQQA 1GOCA 1IBMK 3VPZA 3LW5C 1Q8IA 1IR0A 2J0SD 2RB7A 1KC8O 4B9SA 3KK1A 2LP4A 4RBUA 5JVGL 4I7FB 1JJ2R 3AAQA 2LEAA 4IKAA 4DV2J 4YMEA 1BC6A 4NE9C 1FERA 4LF5J 3NG8A 4CT8A 2HRTA 2OZSA 2ABYA 5HQLA 3FZFA 3PTWA 1T3OA 3KJVB 3A1YG 3GR0A 4ER8A 1NHKL 3ADAC 5EWGA 1NU4A 3PR4A 1OYEA 2GAHC 2LQ8A 4MAKA 3SCXA 3H3OB 4MKVA 2XC9A 2FPHX 4H0TB 2ILYA 4GO5X 2J7KA 4EIAA 5ETMA 4N56A 3CJCA 5J2MA 4E7JA 1RDRA 3CCWA 1U2CA 5KFUA 1HJRA 1JCGA 2EX3A 1PC5A 2V5HG 1OYDA 4IOAQ 4CJPA 4ISEA 2JFDA 2VDHA 3NH1A 3GIIA 3O4QA 4XIUA 1HNZK 4ZPWR 4K0KJ 3ZTOA 4FBUA 1WOQA 3O9QA 4PAAA 4CLTA 3OTDA 2FJAB 2UUAJ 5HVGA 4IFEA 2YPYA 2NRXA 4DPTA 4CEBA 4CO2A 1ITPA 3TA1A 3TUPA 4CJEA 4FM1A 3KG0A 4W5NA 1LWFA 1KTQA 4ERDA 3K5PA 1Q7YT 1FDDA 2JH3A 3DAWA 2DB1A 2RS8A 4CJTA 3AVGA 4FKXA 3POTA 1F9EB 2K2PA 3HP9A 1BLUA 2A41A 4FSVA 4LF8F 5GADP 2UUBJ 1Z05A 3E3XA 4KO0B 2AKWB 2F4VK 3QFPA 1E6VB 2PDAA 3H5YA 3V1OA 2VDIA 3EX7B 2C3UA 3VEYA 4QU6A 3CXCR 1FK9B 4NO7A 4GVLA 5KG6A 3J80Y 3LDQA 4DQ8A 4C1NK 4ED2A 2UV8A 3JSMA 7AT1B 3DMJA 3AV9A 4OO1J 2QK9A 4LD0A 4ZPAA 1MMNA 1RBRA 2EPIA 4Q0BB 2XMKA 5CHIA 1Y00A 1XNRF 1VQ5N 2YNHB 5KQDA 3O3HA 2G1HA 2M3DA 3NAEA 2XMAA 3OFHA 4F2RA 4FWRA 4RW8A 3J8AA 1Y97A 3DXMB 1TK8A 3TWZA 2ZE2A 4DV3J 1VCTA 2IDLA 4PL7A 3LM9A 3CTRA 2AD9A 3QJJA 4ZVEA 3PSIA 2BA9A 4DV7K 4JK7A 3F44A 3TJ9A 4ZA1A 4PG5A 5E33A 2H54B 2KJWA 3C66A 2OZMA 4DS4A 4WFAL 1SC6A 3KLVA 3L7PA 1WTBA 4BRLA 4HYKA 1GFWB 3M8RA 4LBPA 3VQ8A 1MA9B 3H20A 1TKZA 2FJEB 1XMBA 3ZZRA 1L3TA 4AQYJ 1R3NA 2FY1A 1GX6A 3KWIA 1Q5YA 1Q5VA 1VSJA 3NVMA 3AQPA 3M30A 1F6TA 2B9YA 2R7SA 1JLEB 2HMIA 1Q8BA 2O3DA 4OYIA 5E3QA 3GFZA 4E7HA 3GYXB 1CJUA 3QAEA 3IG1A 3FEZA 1BI4B 1X4BA 3AOBA 1R89A 1UVMA 2KXNB 4HI2A 2P9KB 2FVCA 2WW8A 3O8MA 4UY8O 4OLAA 2WSCC 3CCLN 4FW2A 3ENAA 2FD2A 4ILHA 4OV6A 4F02A 2WONA 4UY85 1OY8A 3OQ2A 3MMBA 1S9GA 2KW4A 1FWKA 1FJGF 3ZSWA 4N47A 4I2PB 2BKNA 1LWEB 4ZIVA 2VQFF 1BXNA 1YT3A 1A5VA 2E1AA 1SPBP 4DTMA 3OFGA 1XBWA 1JLEA 1HWIA 3VQ6A 4CEEA 3AHPA 1TL4A 3CCRN 1GQEA 3B82A 1BISA 5AQPA 3R2DJ 2LU2A 1HQEA 4KR0B 3OVSA 1YUWA 3RR8A 1U26A 1TKXB 4HLBA 4DDFA 2ZD1A 1NGAA 2D69A 2AZ1A 5KFZA 4OPKA 3G2XA 4NEYA 1QAYA 4H4KC 5ADXA 2ZITA 5DJBA 2UUBF 2G0JA 2W4DA 5AQZA 5ETLA 4DR1F 4GVMA 2I7PA 3L4BC 5AQUA 3LA0A 1B9FA 2UVWA 3I32A 5DZ6A 1QY7A 4OZJA 5HLFA 1FRLA 5HOOA 2GCFA 1DURA 3CJ7A 4U8YA 1HWUA 3MEKA 3MCAB 2MJNA 4B9MA 5K8PA 1FFSB 3SUOA 3QEPA 1HKGA 4CDIA 1S6QB 4Z7YA 4G1PA 3KHYA 5AFUA 4FBTA 3CMQA 1F1BB 4DOZA 3B4DA 4C1NI 5G0RB 1WORA 1YF5L 3JAMY 1VQSA 4X64K 3DYAA 3RG6A 1NK8A 1XQIA 1RBTA 4NI2A 1DQAA 3BB5A 1XMOF 1V4TA 1VFJA 1ZBLA 3MAHA 3OS2A 2XEXA 3PKMA 1KQKA 3FKBA 1RTIB 2KT5A 1VSIA 1YZ6A 2MEWA 2OTJN 1NJIO 4C48A 1URNA 4K5RA 4XH1A 2QMUB 3C8YA 1Z26A 1UP1A 4RNOA 4GW6A 4CEZA 1X8DA 4FVUA 1TL1B 4YQWA 2OP5A 5F8HA 1HPMA 3O80A 3ZX3A 2AHOB 2J6SA 1RTDA 2BACA 4PY5A 3THXB 4DUZJ 1HHSA 1RKIA 1SKSA 4J9QA 2YNGB 3DHWC 3TAEA 2DITA 2N3LA 1BU6O 1S6QA 2IRXA 3P8BB 3MPYA 4OJ3A 4FF3A 5CR4A 4P10A 2HWHA 4UOHA 4H4OB 5ITHA 3VQ7A 2YH1A 3MMAB 1KR4A 4IBNA 4B3TF 5KGXA 3SBMA 2V51B 5EOYA 3LPEA 1T11A 1ZM2A 4J9RA 2BJ9A 4HT5A 3QB0A 2AEFA 2R7UA 4DPXA 4DR4F 3M32A 2CPEA 4TQRA 1D09B 2OPRA 3MR2A 3HJVA 3K17A 2W9BA 3ISND 2GZOA 1NOZA 3EYZA 2HIQA 2QRRA 5CYMB 3HXMA 3O4WA 3CF5L 3W65A 3AAPA 1XC3A 2B8QA 2E2PA 1P8GA 1RWVB 3M6VA 2QT7A 3R27A 3CDUA 1SKUB 4JRPA 4KB7A 1HYSA 5DG7A 5AQHA 3H42A 1H38A 1IKXB 3JQJA 3NGZA 3SUPA 3ZT0A 2IJFA 2DJWA 4KC5A 3CWJA 5JMVA 2C1EB 2XMUA 1FTCA 3M1VA 3J81O 1RDUA 4O4GB 3B6PA 2QSFA 2DIUA 4NZ6A 4TYAA 4IG0A 2XSJB 2RAQA 3NNCA 1FFGB 1WSRA 4ZTFA 3DFEA 4F7VA 2CG4A 2HVEA 1AA1B 3MM8A 1RZMA 2ASMA 3PVXA 3WXIA 3EPIA 1ICEB 3VTHA 3QETA 4DR6K 4EU0A 4CNZA 2LQ9A 1XEZA 2IIHA 1OMSA 3HPGA 4NPOA 5MLCQ 4H0VB 4WFNL 3G8SA 2W2PP 2G2YA 2Y0BB 2HIYA 2NRZA 1W26A 1RKJA 4DSFA 3DC2A 3UW1A 1M1GA 5CD4H 4QAGA 1IH7A 5HL7L 3OR1B 2P9SA 2WVFA 3OL9A 2DNGA 1HI1A 2KXFA 1JJ2M 1JJHA 2K06A 4ED0A 2DGVA 4DUTA 1K8AT 5E3CA 1UWAA 4Y3CA 2PYJA 3FCWA 3LP2B 3VF0B 4A8MP 1L5UA 1NO8A 2BXJA 1DARA 2RF2B 4OI6A 3V6DB 1C0TB 1VQNN 2BANB 3A12A 5BR8F 3QMLA 2XYGB 2VG7B 2U1AA 4OX9J 3EE9A 1FNMA 5KFHA 3KLEB 3J7YP 2IM1A 2DGSA 3L3VA 4NLTA 1HKAA 3EVMA 2XQCA 5THWA 3QNWB 4CNYA 4DL3A 3M05A 5KG2A 3U02A 3DLGB 1UETA 3L2RA 5HRPA 2CWKA 2ITMA 4HVJA 3LZIA 3W9IA 3KYLA 2FSNA 1SS6A 4OJGA 4KIAA 3MI7X 3RMAA 4LVOP 2C2RA 2IVMA 4OGCA 1VHFA 3EXYA 4DL2A 1G2EA 4PKHA 2XMWA 1P9QC 3I82A 1X4DA 1NGBA 4P74A 1RLCL 2CQGA 4EHTA 4DG1B 5KT2A 2D0CA 3WDOA 2E8AA 1TUUA 2CPIA 2WBRA 1RHMB 1NKEA 2KVIA 3TX8A 5LSOA 2FVQA 3SAFA 3LTOA 4O3PA 3GQCA 3UPFA 3ENBA 3MR6A 4AHRA 4O23A 2C2EA 5IWAF 3EWGA 3KHGA 3KHHA 1O13A 2D41A 4LR7A 1TAQA 2GIRA 3TO8A 2L9DA 4OHWA 1H2UX 3D68A 4DUZF 3G9CA 3L2WA 1H1VA 4XH5A 1HQEB 4CT9A 3VEZA 2IHR1 3D0GE 3EVOA 1HR0J 2C28A 1RISA 2ZGYA 1VQ8N 3NCQA 3ZSYA 3TZWA 4JI1J 1RTZA 3HD2A 5LL6d 4KT0C 3HZGA 4U7CA 2PFUA 3EZWA 3BSOA 4LSNB 4WK1A 1WOOA 5EX0A 4W5TA 4XDCA 3QEIA 2JC1A 5CD4A 5DETA 1JLCA 4FLWA 2HNDB 1YTAA 3M9NB 1AFIA 2ZUGA 2EW9A 4NXMK 3OPKA 3UN2A 2CPXA 1EARA 3AY0A 2ROPA 5F0WA 3MCOA 4ZS6A 2GO9A 2KYXA 3WX8A 2EFPA 3QRQA 3D54A 1WSIA 4NYZA 2DNRA 4DPOA 4X66K 4NLPA 2O8FB 3IWXA 4PABA 2CJXB 2VA2A 2V67A 3E66A 1FKPB 2W1BA 2C3OA 1TGOA 2GUPA 5C10A 1LNQA 4Z4FA 4ITSA 3VGVA 2ATLA 5LSRA 4C97A 2QWRA 2FIUA 2GELA 1K73T 4LFCF 2QWNA 1TP7A 4MLEA 4F36A 4E19A 1FD8A 3VHQA 1YRUA 1TL1A 4NOHA 5LJWA 1J5EK 2VPWB 3KD1E 1CULB 3MEDB 2LU1A 3E9OA 1X0PA 4HCCA 3P6YC 2DNNA 2HNDA 4JI0K 3TTFA 1XMQF 4O0IA 3NKYA 3EY1A 2YX4A 3TUIC 1FXDA 3QLHA 3EDRB 3M8WA 4DHVA 1QVGM 2VG6A 1ZBHA 4CEQA 4H5TA 3VAHA 3D1OA 1CBKA 5L9NA 1M90O 1L3UA 4IO1A 3TAPA 3RW7A 3TOQA 2V4RA 4FK0A 2XSFA 2XBPA 4TSXA 3MR7A 1E6YB 4PYAA 2KI2A 2AGQA 3D9BA 5KTQA 4WFXA 4DSLA 1HBUB 3FSXA 3N0VA 3M7VA 3O1LA 4IQXA 2AEMA 3CJ0A 4K8XA 1WC5A 1SIZA 2DXEA 3CC2S 2E5HA 4ID5B 3AVHA 1VBYA 4P73A 2ZNZA 4DL5A 2HWTA 1EWQA 2K3IA 3NMRA 4YY3F 3BP8A 2HRUA 5D4PA 4JI8J 3D2WA 3DRPA 1SCJB 2Z1GA 2B5JA 4ED3A 2IVYA 3I55N 3AO3A 1Z25A 1WC1A 1YBUA 3W3SA 3R3TA 2AWZA 2KZZA 2CQ0A 1CQMA 4CTAA 5C42A 4CERA 1C1BA 1GLAG 3OL8A 3IR7B 2R7TA 3I5CA 3BPSP 3OUYB 5E3AA 3E2EA 4JV1A 4WP9A 3CCES 4ICLA 5E2QA 3BBCA 3ZC4A 2VPXB 3ZTQA 2GEMA 2N3OA 2QEXN 4JHDB 5AQVA 1SI9A 3ZX0A 1U2VB 4PL8A 3MAAA 2HBYB 2O4GA 3FBFA 2C2OB 3NHGA 2RHQB 1KFDA 4C8ZA 4WFZA 4NZ0A 3OYDA 1RADB 1IR2A 4XPCA 2F8MA 2UUBK 1X9MA 2BQ3A 3QBXA 4AF1A 3L4QA 3RMBA 3DLJA 3P4UB 3VV2B 1FD2A 4F04B 1EZZB 1H7XA 1SJRA 3G87A 1AROP 4ZN3A 2D0OA 4B3RJ 4IQMA 2B5JB 1RT1B 3T19A 2YKOA 4DZ6A 5AZJB 3HYFA 4M3WA 3HSTB 2JOQA 3BGFA 1AYEA 1S0OA 3CSKA 2DNHA 5A0YA 4OYOA 1HNXF 1VC0A 1JLQB 1YI2S 4CIFA 2B4OA 5H1SQ 1KVIA 3CCUN 5D78A 3PHEA 2QG9B 1CJTB 3RSEA 1ZTTA 1KVAA 3T5JA 3KUHA 5DLGA 1YG0A 2RDJA 3CCZA 2AJ0A 4M5LA 4JI1F 3G6VA 5FROA 2BX6A 2RF2A 4TU9A 2HHHK 3CMEN 1HQ2A 3BYPA 3TU5A 4OFZA 2GVZA 4WF9L 2UXBK 3RW6A 2WBNA 4ZPTR 1T9TA 1RT2A 1IBCB 3KUGA 1NLKL 4M5DA 2IYGA 3W2VA 2JLEA 2OD6A 1ESVA 3CO0P 5L38A 1FXRA 3S9HA 1DLOA 2FJBB 2BM1A 4IH7A 1QQMA 3G4SS 3OFEA 2F40A 2OPQA 1K9MT 1CXQA 4JI7K 4O5FA 4KHPJ 1NHUA 5IT0A 2FVRA 4QIFA 3ATVA 3MR5A 2UUCF 4HUEA 3MCPA 1B0PA 4BC2A 2ZH1A 2Q1NA 3QIPB 1CJKB 4IFYB 1FWLA 4RBVA 2CQ4A 3AA9A 3MM5B 1N5YB 2O66A 3THXA 4PPDA 3KLGB 5CCLA 3UWTA 1GOBA 3HDSA 1NJYA 1WC6A 3I55S 3KK2B 4CO4A 3MWBA 3M8QB 3KXDA 3ILLA 4OJ1A 4PWUA 1HLUA 1FWPA 3OD2A 1IKXA 3MDQA 2PFDA 1NGDA 2MDAA 1A5XA 1YHQS 3GE9A 3DWLA 4AFFA 5T7LA 4DU7A 3LZJA 2B9EA 4BRMA 3DJCA 1T9WA 3QESA 4DR3J 2V9WA 1BY9A 4M63C 2YHXA 4O4GA 2QLFB 5F9LA 4DR7J 3QZ8A 5KFMA 1T03A 1TR0A 1Q79A 2AZ3A 4JI4F 2FBXA 1ZETA 2LA6A 4YR0A 3H08A 4MMOA 2VFRA 2RMLA 4TQSA 3QT8A 2YX1A 3FMWA 3LDPA 2O8CB 5J2QB 2Q0UA 3CETA 3WX4A 4B3SF 4ZOSA 1ASVA 3UFCX 1HUXA 2UU9K 2FQQB 5K14A 1S59A 1HNVB 3Q22A 3AA5X 2XMVA 2NUUG 4QIWD 2R8GA 3K7RA 4ES3A 4CVNE 4CGDA 1GX5A 3PJWA 2R9LA 2BW2A 3LALA 2IA0A 4JI3F 4JD2B 5A8RB 3V1RA 1ZZFA 3BO2A 2JEFA 3MF5A 2P5GA 3LP2A 1ZAWA 3MM9B 2UUTA 2G9OA 1JKHB 1RDWX 2QA4G 3CC2N 2XI2A 4FYYB 3KWMA 3ZYYX 3W63A 5I3PA 5MAOA 1BUPA 1K73O 3D6HB 3PY8A 2DNLA 2M5YA 3LM2A 3PW5A 3NOGA 2VG7A 1RE1B 5CYJA 2BTFA 5ETTA 4LFAF 1VQ6N 3BF1A 3EO3A 1HHQA 4E98A 3G96A 1Q8LA 4MIWA 1SL2A 2VBXA 4JKFA 1TVRB 2OEKA 4KBOA 4DV2K 4K0KF 4KHPF 1H3DA 5EU7A 3TSPA 4ILJA 3DRSA 2EWSA 3RBEA 1S4FA 3MD1A 4FWMA 3UDLA 3GONA 3I0RB 3D7EO 2RT3A 2D3OR 2QO3A 3EZOA 2BKOA 4F3OA 4CCHA 1FJEB 2Z2YB 2BRLA 8RUCA 4LUBA 3AA3A 4O3OA 2GMLA 3AA4A 2ERRA 2Y9HA 1FO1A 4N7TA 4A61A 2W6KA 2Z1JA 2A42A 3NCPA 2IPOB 3E01A 1R8HA 2E2NA 3MCMA 1K0TA 4FZYA 1J54A 4WU2A 3A0IX 1N36K 4F3QA 2HZAA 3IO1A 5EX3A 4XAKA 4CZKA 2BMBA 4JI2J 5B0DA 2V50A 1DQ8A 4OYBA 1YJ9S 4DV5F 3OXGA 3AARA 3JAMO 3AD8C 2ASYA 1Y0HA 1S1VA 3CCRS 2MGZB 1S1WA 3W5XA 3GBTA 3K57A 2NPIA 3V9SA 1T05B 2WVEA 2R42A 5AXNA 1UAXA 1X3MA 5LMUK 1HBUA 3E8OA 3VWSA 3AO4A 3H90A 4CH1A 4HUGA 2CADA 3IA0A 2GUIA 3EGNA 1VSDA 3CPWM 3A3OB 3GV8B 1CJVA 2PO4A 3HKZD 4WFNQ 2W7PA 1DRZA 2DGWA 5J2NA 3OTEA 1NJIT 4BR5A 2DD8S 5HL7Q 4AILC 3ZLJA 2PI4A 3WXMB 2CUYA 5A2QO 1RT4A 1RB0A 3DHXA 4B8AB 4KRWA 1N5TA 2FC9A 2U2FA 2LA4A 2WZ1A 5AZJA 2XLKA 4W5RA 1BI4A 2O8FA 4M5GA 3TEHB 1JJCB 3IGVA 3IM9A 4K4VA 4QZVB 1NJZA 3CJBA 5JS1A 1FKOA 1V6HA 5AE2A 1RHUB 1S7HA 1TV6A