1REVA

Hiv-1 reverse transcriptase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title The structure of HIV-1 reverse transcriptase complexed with 9-chloro-TIBO: lessons for inhibitor design.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 145
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1revA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1revA05
3PW7A 2ASLA 3U3YA 2D0CA 4Q0BA 4CERA 2OPRB 3TAMA 5KRTA 4FLTA 3OSPA 3DYAB 3MEEA 2C2RA 1JLCB 4OL8A 4ECWA 1GX6A 1EP4A 1RBRA 4DMNA 1CXQA 3O3FA 4DS5A 3VQ7A 2W8KA 2V4RA 2YNHA 3HJFA 5J2MA 2HVIA 1S9EB 4JV2A 4E89A 3PJWA 1XHXA 2IDOA 2R8GA 4KHNA 1D1UA 3DLKA 3TR8A 5EDWA 4F3OA 3UQSA 3VA0A 1NK4A 4NLWA 2QV6A 4ED3A 2W9BB 1NHVA 3AA4A 4LSNA 1VRTA 4K8ZA 2V4QA 4QPXA 3LDSA 3CJ3A 5K14B 1J9AA 3VQBA 3OYJA 5SZTA 1QQCA 2Z1GA 3PO5A 3HVTB 5HLFA 1S1TB 4JUZA 4RU9A 3CG7A 1RTHA 1YTAA 3KJVB 1D5AA 3ALYA 1JXEA 4EBDA 4C8NA 3BQ0A 3DLGA 2FBVA 4K4VA 4OKJA 1J5OA 4EBCA 1T7PA 1NOZA 3SQ1A 4NZ0A 4C8KA 2RKIA 1RCHA 3H5XA 4DSJA 2ASDA 4HUGA 3AO4A 5F8MA 4EP5A 4WYWA 1A5XA 4QW8A 3SI6A 2GIRA 4CIFA 3PY8A 3MFHA 2XWYA 4RW6A 2W9CA 4CJLA 3I0SA 4JV1A 1NHUA 4FW2A 4E3SA 2ITGA 1TL3A 4R8UA 3M8RA 4OLBA 4KFBA 3P1GA 3RB3A 1S6PB 1NK7A 2IJNA 4KO0B 1TK0A 3NL0A 1RDAA 2KFNA 3RR7A 4E7IA 5EU7A 5KFUA 3H98A 1EETA 4IKFA 4N76A 2Y1JA 3PX4A 4TYAA 1Q9XA 2QKBA 2EHGA 2X74A 4NLQA 3AVFA 4F4ZA 4I7FB 4ECYA 2IA6A 2BE2A 1TAUA 3KK3A 4E1NA 3E01A 3K5OA 5C42A 1U48A 1JKHA 1X9WA 1Z25A 2R8JA 1T03A 5D3GB 4K4YA 2X6NA 3ZSRA 2BDPA 2PYJA 2YNGA 2Y1IA 3RB0A 3BDPA 4B9MA 2GBZA 4XO0A 4Y2CA 3AVBA 1C0UA 3H4BA 3RMAA 5KT4A 3PUFA 4FW1A 3DMJA 2GIQA 1RNHA 1U47A 3BSNA 1CLQA 3V1QA 3NMAA 4JS5A 3ZSVA 4KREA 2KZZA 4CEBA 4RNOA 1LWCB 1Q8IA 3PR4A 4IKAA 4B8CA 3NE6A 4ECQA 5JS1A 4CGIA 3KMSA 2PYLA 4CGHA 1TK8A 3OY9A 2I5JA 4CJQA 3MR2A 4KTZA 1T05B 2BANA 1HYSB 3IGNA 3ULDA 3K5NA 3TAMB 5KFDA 3GIKA 4J2BA 1KHVA 3H5YA 3OYEA 4CIEA 3M9MB 3IS9A 4CK2A 4G1QA 2YNHB 4ECTA 3RTVA 1DTQB 4CGJA 3LP0A 4I2PB 3KLIA 2ZKUA 1NJXA 4WZQA 3IN5A 3PW4A 3DLKB 5KFGA 3PX0A 1WSGA 4IBNA 3OYKA 4M3WA 4QW9A 3HVAA 2KW4A 1K1QA 4DSEA 4F2SA 3MECB 4O44A 3OL8A 4NYFA 4KI6A 2CJQA 2ALZA 4DQSA 4RNHA 3N6LA 2E9ZA 4PQUA 1HPZB 3KHHA 4KV8A 1GX5A 4W5RA 4FLXA 3ISNC 3MXIA 3VQ8A 1JLFA 2XY5A 4ZPBA 1HQUA 5J2QB 4CJVA 1VRUA 3DLBA 3LP1A 3RMDA 2FJXA 1XWLA 3L2RA 3SCXA 3F9KA 1X9MA 4CEFA 1TVRB 1S6QA 4ECSA 3QGGA 1VSIA 4WXOA 2RKIB 4OGCA 2FVRA 3KLHA 4NLVA 3AVIA 2XGQA 4IFVA 1HNIA 4IDKA 3S9HA 3PW2A 3ZT1A 3I0SB 2AU0A 1FK9A 4J9PA 2IM3A 3S3MA 2HMIA 4Y34A 2IMWP 3VQ4A 1NK8A 3BSOA 1IKXA 4JV0A 2R8IA 4FJJA 5CYMA 4KKOB 1REVA 4ECZA 5I3UB 2FLPA 4KFBB 3SV3A 4DL7A 5KFSA 2HHXA 2Z1HA 3K57A 1S9GA 2DPIA 2ATLA 3KNAA 1IKVA 1HMVA 4Y3CA 1EETB 2FVPA 4ED1A 3KD5E 3BJYA 1RT7A 2HVHA 4J9SA 1YVFA 3KTQA 4IR9A 4Q45A 1C0TB 3QYYA 3G6YA 4ELVA 3QLHA 2BE2B 4NLPA 3KK3B 2WONA 3SUQA 5C42B 2YHBA 1JKHB 4IQXA 4ZMMA 4RW8A 1ZBFA 3CWJA 5KFYA 1LW2A 4IG0A 4FJKA 2YNGB 3MEDA 3V6JA 2KZMA 2DFFA 4WFYA 3MXJA 2G8HA 3GV8B 2XY8A 1BHLA 4M3ZA 3OYLA 3H5UA 3V9UA 4CJUA 4KRFA 2IM2A 2OPRA 5JS2A 5DGAA 3OYGA 3DYAA 1BISA 4ZP9A 1JLCA 4IFYB 3DRSA 4Z4GA 1N56A 3E51A 1VSHA 2LSNA 3CQ8A 3K5LA 4CHOA 4DL3A 3BSAA 2BANB 4HCCA 3VQEA 4LH4A 1IM4A 4ZVFA 1L3TA 1RA6A 1U4BA 3TQ1A 2R2SA 4PA1A 1Z26A 2WK4A 1N48A 2P5OA 1S4FA 1NKEA 2HNDB 2R2UA 3CDEA 4LQ3A 2WCXA 2B6AA 3HVTA 1KLMA 1S1TA 5KFZA 3I5CA 1ZTWA 4DFMA 3KJVA 3LP0B 2FLNA 5F8GA 3LWLA 3Q8SB 2ILZA 4TY8A 3OYCA 2Z1IA 4RNNA 3NAHA 4WFXA 3TAFA 3OL9A 3QIPA 2JC1A 3NCIA 2E6MA 4FCYA 4QCLA 4M3UA 4IH5A 4E0DA 4ZVHA 4DTJA 3QEWA 4NCGB 4J9LA 5J2PB 4KV8B 4ZVEA 3DOLB 4Q44A 4FZYA 1BIZA 2YNFB 1HQUB 5KFPA 1T8EA 1RBSA 2W9AA 4F3TA 2XO7A 1S6QB 4CF9A 3GV7B 1S6PA 4CGGA 5KFOA 1QUVA 3PR5B 5DLGA 4ED6A 4DLEA 4CFBA 2J6SA 4K4SA 2VWJA 3K58A 3KLHB 2D5RA 4BDPA 4BE2A 1YT3A 3KLGA 4IFVB 4Z4EA 1HNIB 4NRUA 4ECUA 4IDKB 2YKMB 2OPPB 3EZ5A 3HXMA 3DDKA 4LQ9A 3G86A 4TY9A 1C0MA 4DTSA 4FLZA 5L1IA 3AVLA 3LANA 3SV4A 1ZBIA 3DRPB 4M3TA 4FJ5A 4B8AB 3TVKA 2HHQA 2IAJB 1TGOA 4RW7B 4M94A 1IKVB 3OS2A 1CXUA 4HUFA 4F4WA 2BRLA 4CESA 3NHGA 3CVKA 1FKPA 4HHTA 4CEZA 4O3QA 4NLDA 1RT7B 2D0AA 4OPKA 3DOKA 2C22A 1HRHA 3OS0A 1LWCA 3NGIA 3G6VA 4IRKA 3C6TA 2WONB 3EPGA 4EO6A 3OL7A 2G8KA 3V9SA 3SNNA 2HHVA 2ATQA 1NK6A 2OPQA 4IG0B 5KFHA 4B9UA 3HVRA 3HT3A 4MK9A 2E9TA 1T05A 3LALA 4H54A 3SQ4A 4DQRA 5SWMA 4E7HA 1HYSA 3M9NB 2ZQBA 5FROA 4H4OA 5HRRA 3FRZA 3DM2B 3OYFA 3P83D 3KD1E 3HYFA 5KG2A 3V6KA 2WB4A 3F73A 3HHKA 2R8HA 1WSIA 2D0BA 5I42B 3DRSB 4ID5A 4LSLB 5C24A 3OL6A 1K6YA 1NJZA 1HYVA 2B43A 2QKKA 1DTQA 3I8DA 4I2PA 2AGOA 1KRPA 3ZSQA 4RUAA 3CJ5A 2RF2B 1VSFA 1S48A 4KB0A 4O3SA 3O4NA 5FRNA 4R0EA 3ZSWA 4PUOA 3OSNA 1BI4B 4UQGA 4DTOA 3NGYA 4CHZA 4YQWA 1HARA 4KHWA 3MECA 1LAWA 4E1MA 2XCPA 3CIZA 4WZMA 2FBYA 4DFJA 1JLEB 4QWCA 2B6AB 4B9VA 2B5JA 2DTUA 1KLMB 1HPZA 3QNOA 1I3AA 2BR0A 3OYHA 4E7JA 4FZZA 4DTRA 3JYTA 4CEOA 5J2QA 4TY8B 4O3PA 4YMEA 2J6TA 3OLBA 4B3OB 4FLUA 3D28A 1TVRA 2EX3A 1CZBA 1IKYB 2IOCA 3KKRA 3OJSA 4B9NA 3QIPB 3RWUA 2FJVA 5F9NA 2FBTA 1SH2A 3AV9A 2BRKA 1CSJA 2XHBA 1SL1A 1UA1A 1J53A 5CYQA 4YR3A 4CJEA 4FLVA 4ICLB 3VQ9A 4DQPA 4KKOA 2YHAA 4RW4A 4TN2A 5I3UA 3T5KA 3SZ2A 5KFIA 5EWGA 1BIUA 4JS4A 2FJWA 1ZBUA 3P5JA 4F2RA 4FBTA 3RAXA 1SH0A 4DL4A 4KB7A 4I2QA 3KLGB 3V6HA 4BWMA 4KI4A 4FM2A 5KGXA 3K5MA 1C0TA 5KG0A 1RYRA 4AHUA 3C94A 3HVWA 4TXSA 4O3OA 3AA2A 4DG1B 4CF1A 4ED0A 4CJKA 4RG8A 1WSJA 1RTJB 4CIGA 4NYZA 4DL6A 3QGHA 1UOCA 2GV9A 3TANA 1KVAA 5KFCA 4KSEB 3LP2B 1X1PA 1Z4UA 3OHBA 1SKRA 1FKPB 4IH6A 5KFBA 3BQ2A 3L8BA 3L2VA 2RDJA 3DOKB 4MH8A 3G6XA 5FDLB 3H4DA 4WE1B 4ZP7A 3G0ZA 3C6TB 1TV6A 3L2WA 4IFYA 1RT1A 2DY4A 1JXLA 3KHRA 3RMCA 2OPQB 3KHGA 2B4JA 1RYSA 4URGA 2GC8A 4RUCA 4ZPDA 5EWFA 1IG9A 4DU1A 4CK1A 5KFWA 2W8LA 4YFUA 1TQLA 1VSEA 2P51A 4TQSA 4QWAA 1TP7A 4H4OB 4URQU 2A1SA 4H8KA 1WSEA 4EP4A 2OH2A 4MKBA 4AHRA 2HNDA 4KHQA 4CE9A 4GW6A 3BR9A 4E19A 2O4GA 2C2EA 4NLSA 4ID5B 5C24B 4Z4FA 4O4RA 4OLAA 4U6PA 5L1JA 2BQUA 4F4YA 2VG7B 3SFGA 3OLAA 3WNGA 4CF8A 4F50A 4GC6A 1WLJA 3SUPA 4PUOB 1SUQB 2HHUA 3GQCA 4RW9A 4N5SA 1HQEA 2Z1JA 2QK9A 5KFLA 4DLGA 4JRQA 4BDYA 4PWDB 4J9MA 1C1CB 1UWBB 3RB4A 1ZBLA 3V6DB 3DLHA 3QETA 4HCBA 4NCGA 2B5JB 3N6NA 2JEIA 5J2PA 3NH1A 3QIOA 1L3SA 3DOLA 1TL1B 2C2DA 2YNFA 3JYTB 2HAIA 4O3RA 4O4GB 3O3GA 3LZIA 3T19A 5KG6A 1BCOA 1VSJA 3GILA 4Z4CA 5KG7A 4HYKA 2IM1A 3DLEB 5KTQA 3GIIA 4JLHA 4CEQA 4B9TA 4DF4A 3IG1B 4L8RB 5L1LA 3VA3A 1JL2A 5DK5A 2YKMA 2WRMA 2OPPA 3NGDA 3SQ2A 1IO2A 3V9XA 3M8QB 5CYQB 1TKZB 4DTPA 2DFEA 1W25A 2XI2A 4RW4B 2ZD1A 3H5SA 3DRPA 4CF0A 4CEAA 4FVMA 1WN7A 3AO3A 1LWFA 3QEIA 3PV8A 2ETJA 1KLNA 2IAJA 3T1AA 3T5JA 4RW7A 4BE1A 3U6FA 3MTKA 3NF7A 2GUIA 4I2QB 3FDSA 2YV0X 2JC0A 4FJHA 4ED8A 1KCFA 4EYHB 4XPEA 5KFRA 2DFHA 3CYMA 3V9WA 1BCMA 2AWZA 3D5MA 3QINA 2HHWA 2XY7A 3MR5A 2UUWA 4W5QA 4M41A 1NKCA 3WNEA 1JX4A 1IH7A 2IC3A 3DM2A 3TAPA 4Q8EA 4FM1A 3H08A 2D7SA 5I42A 1JLQA 1TV6B 4Q8FA 5HBMA 1RT1B 4NCBA 4LSLA 1DLOB 2HW3A 4J9QA 3HP6A 2IBKA 1NOYA 4NCAA 1RT5A 2O4IA 4NLRA 3QZ8A 4CF2A 3MEGA 1L3UA 4DS4A 2RF2A 3PW5A 3ZT3A 4FS2A 4N47A 1EXQA 1BI4A 4DSLA 4TQRA 2AJQA 1ZETA 1S0OA 3CDUA 3LPTA 1ZBHA 4ELUA 2DPJA 4HKQA 4KAIA 4CJWA 4KHRA 5DGBA 1JLEA 4MK7A 3QEVA 1LW0A 2VG5B 1NJWA 4I9QA 5KI6A 2RDIA 1QE1B 3ITHB 1SH3A 2G8WA 4M95A 1R0AB 4XPCA 4CJFA 3A2FA 3L2QA 4FJ9A 1QTMA 4MKAA 3HPHA 3DLRA 4O5BA 5KT2A 1WSFA 1XR5A 4M3XA 2F8SA 3QIDA 5CY4A 3IRXB 3KHLA 4B3OA 1ASVA 4J9RA 2AGQA 2D41A 1FKOB 1D8YA 4AILC 1IKYA 1HNVB 4ECXA 1TKXB 4RW9B 3KOAA 1HQEB 4IG3B 3CJ2A 3HKWA 1S9FA 3KLEA 5KFQA 3CFPA 3SUNA 4CHPA 4FK2A 3FQKA 3V4IB 4PY5A 1VSMA 1U09A 1FXXA 4ZTFA 3UPFA 4G3IA 1ZTTA 1S10A 1RDDA 2VWKA 4ID1A 2J6UA 2A1RA 4C8OA 4EO8A 1VSKA 3MFIA 4KB1A 2ZE2A 4NLOA 4ICLA 1WSHA 4F4XA 3AVJA 1C2PA 3SQ0A 4OVLA 1L5UA 3VQPA 4YP3A 2YKNA 3HPOA 3AVCA 4FLWA 4MFBA 3PHEA 2FVCA 3SYZA 1L3VA 2OPSA 1OS5A 5T14A 3ZSXA 2UUTA 4NLYA 4FJMA 4W5OA 4KE5A 3NKYA 2YNIB 5DQIA 4DG1A 3PJXA 4EZ6A 3PVXA 1B9FA 1RTJA 1BGXT 3CM5A 2HB5A 4ZPCA 2ZD1B 4YNQA 1EKEA 2XY6A 3ISND 3QNNA 4EEYA 1BQNA 1LWFB 3K2PA 4IH7A 1SV5B 3FFIB 3VQCA 4Q5VA 1IKWA 3TI0A 3LP2A 4DL2A 4FJIA 1QSYA 5KT3A 1RT3B 3HSTB 3SJJA 1EX4A 3WNHA 5FDLA 2XGPA 4J2DA 4WE1A 4MIBA 5KFXA 4DEZA 5DMRA 2WHOA 4CHQA 3OYNA 4RNMA 3C6UA 3VQSA 2UVWA 4FK0A 4CCHA 5HROA 1BQMB 4AHCA 2P1JA 3Q8QB 1U49A 2HNYA 4NYNA 2JEFA 4OPJA 1D9FA 5KFKA 2VA2A 5DQHA 3MAQA 4J2EA 1RA7A 1ASWA 3BGRB 5C25A 4FJLA 2IC3B 5KG3A 5L9XA 4KBIA 4KHMA 1I39A 3AVAA 4FM0A 2WOMB 3GIJA 1JLQB 2G8IA 1JLGB 5HBMB 3UDLA 2IJFA 4RZRA 4IOBA 4FJNA 3VQQA 2JEJA 2XC9A 1XR7A 3NBPA 2AQ4A 5L1KA 1RT5B 5F8LA 4CJTA 2VG7A 4J9KA 4DSKA 3MEGB 3SPYA 2VG6B 2WTFA 3M9OB 1CZ9A 1BL3A 2KQ2A 3T5LA 1SUQA 4OGEA 5KFFA 1RTIA 4QWBA 3ZT0A 4FJ7A 1C6VA 3ZCMA 4FYDA 4Y1CA 1WAJA 2BGGA 2E6LA 3EZUA 3DI6A 1RT6A 3TARA 4PWDA 1C1CA 1UWBA 3V6DA 5J1EB 1HYZA 4R5PB 1RBTA 2W7PA 4E7KA 3M8SA 2OZSA 1LW0B 3KK1A 4ECRA 5KFMA 5KRSA 3RB6A 2HWIA 3CFOA 1TL1A 4KHYA 3AVNA 3OYMA 4O4GA 3OYAA 2KTQA 3BSCA 1C1BB 2HNZB 3VQDA 3RRHA 4J9OA 4B08A 3N6MA 4J2AA 3NGZA 3DLEA 2FBXA 4F4KA 5F9LA 1S1UB 3KIOA 3IG1A 3D45A 3AO5A 3KLEB 2V9WA 3D0PA 2Q3SA 3KLFB 5DLFA 4DTNA 3AVMA 1RTDB 1VSDA 4DSIA 3QEXA 2C28A 3M8QA 4DF8A 4BE0A 1TKZA 4OJRA 5T7BA 4E7LA 4I9LA 4TYBA 2ZE2B 4FK4A 3NH2A 4DL5A 5HP1B 1LAVA 3ZSZA 2KFZA 1C1AA 4ZHRB 4CECA 3LWMA 4FLYA 2YKNB 3QZ7A 3NF8A 5J2NA 3T5HA 1W9HA 4CEEA 3OYIA 1KFDA 4MFBB 1KHWA 4CJRA 5EWEA 3Q8RB 4K4XA 4CFDA 4CJ4A 2OPSB 3DRRA 3Q8PB 1QAJA 3FSIA 5DG7A 3B6PA 3JSMB 4K8XA 1UA0A 2E9RX 3K59A 2P5GA 2XRIA 3U3GA 1TAQA 2JEGA 1A5VA 4H4MB 3VQ5A 3RR8A 3V81A 4KHUA 1KTQA 4ZP6A 1RDRA 2UVRA 1GOAA 3PO4A 4O55A 4IRCA 3AA5X 3KK2A 3NF9A 3QO9B 1S1WA 4ED2A 1S1VB 4KHSA 3HO1A 1B92A 1BQNB 1S49A 2OZMA 3MF5A 4CK3A 1IKWB 1HJRA 1SKWA 1S97A 5F8JA 1JLBA 5C5JA 5KT6A 4O3NA 3ZT2A 1A5WA 1JXBA 3H2LA 3AVHA 2QE5A 3QGIA 1DLOA 3C6UB 4RNFA 4FS1A 5HROB 4MQ3A 2NUBA 2HNYB 2F96A 3EPIA 3TABA 2AX1A 1ZYQA 1SL0A 3H40A 4ECVA 3OS1A 5HRPA 1RT4B 5C25B 1QSLA 3UR0A 1RT2A 2VA3A 3LZJA 5KFEA 2UVVA 4F8RA 4AHVA 2BQRA 4DTUA 4IR1A 4FJXA 2VG5A 4FJ8A 2E4LA 1QE1A 3FQLA 3ITHA 4HUEA 1R0AA 4ZPAA 2HHSA 4Q0BB 3RBEA 3NBPB 4FZXC 3CJ0A 4AH9A 3IRXA 5F8HA 3MEEB 1ASUA 3HL8A 1FKOA 1EP4B 1HNVA 1RTIB 4NLUA 4QOZB 1TKXA 1DTTA 4KTQA 2FLLA 3OYBA 3SPZA 3TAEA 3T3FA 5J2MB 4BACA 2JGUA 4IG3A 1XI1A 1W0HA 3IAYA 2IS3A 5KG1A 3DI6B 1RT6B 4CHYA 3M8PA 5KFJA 3V4IA 1KVBA 3NAIA 3LAKA 2X6SA 3KK1B 3AVKA 1ITGA 1QAIA 1N4LA 3ASMA 2AX0A 1B9DA 4AHSA 4LSNB 1VRTB 3MXMA 4M45A 4W5TA 3KLVA 4DTMA 3PX6A 5HLFB 3LPUA 1RTHB 3SFUA 3TAGA 1GOCA 1TKTA 1RDCA 3VN5A 1N5YA 3VQ6A 4QWEA 1LWEA 3OYDA 4YR0A 2ILYA 3DLGB 3WNFA 1J5OB 4OKEA 1Q9YA 4CEDA 3THVA 1X9SA 3OHAA 2YNIA 4CFCA 4M3YA 3O4QA 4YR2A 2R2TA 2HWHA 4K50A 1NNDA 2F8EX 4RW6B 2W9CB 3OVNA 1N6QA 1SV5A 3FFIA 5J2NB 2FVSA 4B9LA 3H59A 3S3OA 3B6OA 3I0RA 2D3ZA 4Q43A 3DRRB 1TL3B 1RT3A 1JL1A 4WFZA 5KG5A 4R8UB 1J54A 4DU4A 1S1XA 5DG9A 5DG8A 4K4TA 3I5BA 3OJUA 2RN2A 4FBUA 1JLAA 2G8VA 3V81B 3RMBA 1S0MA 3KMQA 4JRPA 3RRGA 2PY5A 1BQMA 1MMLA 5HRSA 3KK2B 3L2UA 1S1WB 2D3UA 4O0IA 1SL2A 3PZPA 4Z4IA 2UVUA 4DSFA 4NLXA 1RDBA 4WXWA 3GIMA 1QSSA 4Y2AA 4NLGA 4MIAA 3AO1A 3BGRA 3E01B 2IGIA 4HTUA 4GVMA 1JLBB 4CJPA 2R8KA 3AO2A 3KKSA 1T03B 4GC7A 4DTXA 3ZSYA 4WYLA 4Y1DA 1NK5A 2G8FA 2WOMA 1U45A 1JLGA 3RAQA 1MU2A 3RBDA 4K4ZA 5KT7A 5HRNA 3LAMA 4U7CA 1C0UB 2HHTA 1KVCA 4Z4HA 4GMJB 4C8MA 3DMJB 3ICLA 1RBVA 3CFRA 3GYNA 1KSPA 2VG6A 3NF6A 1NK9A 3HM9A 4ZTJA 1UAXA 1VK0A 1RBUA 4CFAA 4FJGA 3IGVA 1RT2B 4N41A 1NK0A 4CJ3A 1S9EA 2XI3A 3CDWA 3QESA 4QWDA 1D0EA 5KFNA 2I5JB 4OKKA 5J1EA 5KFTA 4R5PA 4ELTA 2RPIA 4K4UA 2W7OA 1U04A 4TSXA 2W9BA 2AGPA 4BDZA 3HPGA 4C8LA 3TWHA 3S3NA 2FVQA 1F21A 1T94A 2I1RA 5K14A 3QERA 1C1BA 2HNZA 4TLRA 3CJ4A 5JXSA 4Z0UA 1XHZA 1DTTB 4DQQA 3QEPA 3BQ1A 3IS9B 4G1QB 4KAZA 1SKSA 4DWIA 1T3NA 2FC0A 1S1UA 4URSA 3KLIB 3ZT4A 4KPYA 3M8PB 4IRDA 3NDKA 3KLFA 2ASJA 5JUMA 1RTDA 3LP3A 1QS4A 4ZP8A 4M3RA 1VSLA 1LV5A 2R7YA 1NKBA 4DFPA 1KFSA 4EBEA 4O44B 5HP1A 3NAEA 2F8TA 4ZHRA 2OYQA 3V1OA 4PQUB 3AVGA 3TAQA 3I5AA 4ED7A 2V0NA 3L3UA 1Y97A 1RAJA 1TKTB 1WNSA 3V9ZA 5FRMA 4CJ5A 1WAFA 4KTWA 1N5YB 4LY7A 1JLFB 1I6JA 4FXDA 3SI8A 1VRUB 3LP1B 1LWEB 1S0NA 2W42A 4BWJA 3JSMA 4X2BA 2JLEA 1YVUA 2X78A 4CHNA 3EYZA 3AA3A 1WNEA 4H4MA 4QAGA 1NJYA 4KO0A 1S5JA 2QXFA 3HP9A 1G15A 2CKWA 4CGDA 3PW0A 2EC0A 4CGFA 4ZVGA 4N56A 3QO9A 5DQGA 1S1VA 5CZ2A 3NH0A 5E41A 1N6QB 3MR6A 4NLTA 1FK9B 4I7FA 4J9NA 4EZ9A 3NFAA 4NRTA 2HMIB 4AHTA 1RILA 3EY1A 3I0RB 1GOBA 2XCAA 4LH5A 4CJSA 1IKXB 1O1WA 5CYMB 5D3GA 5F8IA 3L3VA 1S1XB 1REVB 3HK2A 1XR6A 3BREA 3ZSOA 1QHTA 2BQ3A 1JLAB 2O5DA 4O0JA 3VQAA 4W5NA 1S9GB 4MK8A 4B9SA 1HMVB 5EUHA 3G10A 5KFAA 4DFKA 4M42A 5KFVA 2G8UA 5KT5A 4LD0A 4DU3A 1YTUA 3CO9A 3V1RA 3C95A 5CZ1A 5KGWA 5KG4A 4EYIB 3QLHB 2OA8A 3UIQA 1RT4A 4XIUA 4RW8B 3CM6A 4DQIA 3SUOA 1LW2B 1TKDA 4HVJA 2IM0A 2R2RA 3MEDB 1TK5A 1XC9A 1JIHA 4K4WA 1D9DA 5F8NA 1K1SA 1MU2B 3O3HA 2PZSA 3GV5B 3MR3A
chains in the Genus database with same CATH superfamily
3U3YA 2YY3A 3W2VA 4NYPA 2OPRB 3OSPA 1T9YA 2RS2A 4YY3J 3HI0A 1HBMB 1JLCB 4OI2A 2IIRA 4ECWA 1RBRA 5C2DA 3FZBA 3VQ7A 3IAS9 2KRRA 2V4RA 4OI6A 2MY8A 4JI3K 4X66F 2EKNA 3OUYB 5AFUH 2ZUGA 4JV2A 4E89A 1XHXA 3FZMA 2W4CA 1G2EA 5AR0A 2V52B 1D1UA 3DLKA 2PMWA 3VENA 2OD4A 1RAGB 2HHPA 1SC6A 4ED3A 3ONQA 1VRTA 2MQLA 3WXJA 4CZLA 1JWWA 3MK6A 1RDUA 5MLCQ 4N77A 1O0PA 5T7LA 2NSCA 1QQCA 1WOSA 4YOUA 4NL5A 3VOVA 4JUZA 4P73A 2LQ9A 1SC4B 3KJVB 4BRNA 3ALYA 2BOAA 5GAEU 4EBDA 2O8CB 3MN6A 2FBVA 3IWXA 4Y28C 4EBCA 2QWMA 5LMUJ 4HT7A 3SQ1A 1RCHA 4DSJA 4I64A 2ASDA 1CJVA 1XMQF 3W63A 5F8MA 4EP5A 4MYTA 1GXLA 4OV1A 4CIFA 1XMBA 5CE3A 4RW6A 1S3XA 4I6AA 1OH8A 4XH1A 2FF3B 4FW2A 4H0OA 3U27A 4FXWA 4OZ2A 3EVOA 2ITGA 4FWOA 4FPBA 5L9NA 3HZGA 3B54A 2OTLS 2RAQA 1WC0A 4BR5A 3H20A 4KO0B 3NL0A 4M5DA 3C14A 5EU7A 3ULHA 1EETA 1MROA 4EAHD 4JNEA 3G9CA 2UXDK 1HWKA 2EHGA 1CG2A 3T6BA 1VQ8N 4ECYA 3H0PA 3CJTA 2BE2A 3KK3A 4E1NA 3E01A 3K5OA 1GK8A 1U48A 1X9WA 1IBLJ 2G2YA 4CZEA 5D3GB 5LMUK 2Q97A 2PYJA 1PC5A 3BH6B 1TFYA 4OZ1A 4Z94A 1HWLA 3JXUA 3RB0A 1EWRA 1KEKA 2GX9A 1XEZA 4PYDA 3H4BA 5KT4A 1DZ5A 3S6EA 5IT9U 4P2SA 4CZFA 1U47A 1IUJA 3ZSVA 4KREA 1S4EA 1Q8IA 2K1RA 4I6MB 1OH5A 2MHNA 3HJVA 3CJKB 3J7ZT 3NE6A 4ECQA 2HBYB 4NA2A 3Q8YA 3RU0A 2KVIA 2NXUA 1EKSA 4KTZA 1T05B 2AJ4A 2DNNA 4ZN1A 4X4NA 1AW0A 3EGVA 3IGNA 3ULDA 4FO0A 3M8YA 2FHJD 1KKHA 5IM0A 4CH0S 3UN2A 2HG4A 2HIQA 3G6ES 2MHEA 4J2BA 1KXPA 2UV8G 2VUGA 2HF4A 1KHVA 3N5FA 3H5YA 4HTLA 3OFHA 1GEHA 2WUSA 4AT1B 1RWPB 4G1QA 2J9CA 2YNHB 4U8YA 3O1LA 5LSLA 2ZKUA 3PW4A 3R8YA 4WCEQ 4C2MA 2ZDPA 4IBNA 3OYKA 1VCTA 2HZVA 3CO0P 4DSEA 3JQMA 1N32F 3HM8A 3A5LC 2VBZA 3GJTB 4NYFA 2VGMA 4DQSA 3NNHA 4FVUA 3SMZA 3T1HF 4LF2A 2AYMA 4Y65A 2H5EA 4AL5A 3L4IA 5J2QB 2FJXA 4OX6A 4WK1A 2MZSA 1B3TA 4WKYA 3F9KA 4ECSA 3QGGA 4WXOA 2HQ3A 2F9DA 3KLHA 1IXKA 4CWBA 2ZHBA 4IFVA 2IVYA 2V50A 2XHWA 1HNIA 3S9HA 3PW2A 3G8TA 1FK9A 4J9PA 2IM3A 3VQ4A 3DU6A 5I4MA 1PBUA 1MW7A 3PYDA 1ATSA 2V8HA 5CYMA 2EBEA 4GKKF 3QPIA 5I3UB 4WF9L 1VQLS 1BHNA 3SV3A 1RWKB 3K57A 1Z2LA 4DU7A 3G71N 1IKVA 1HMVA 3MCSA 2M88A 1EQ0A 2CG8A 3QYYA 3G6YA 1W7WA 2Y8WA 3QLHA 4DR1F 4NLPA 4OHYA 5C42B 2YHBA 4RW8A 2Z58B 2D1CA 1GLFO 3TTFA 5KFYA 1X4HA 5AZIB 2HFSA 2Q0UA 3ZNUA 1U8SA 4WFYA 2VBYA 3A4TA 4DV3J 4M3ZA 2E5HA 3H5UA 3HZEA 3L7PA 3QFHA 3FLCO 4CJUA 4KRFA 2D69A 2GMHA 2CVIA 1BISA 2GVZB 2EW9A 2WVBA 1XERA 5A8WA 1P9YA 1IWAA 1N56A 4OX7A 2V67A 3BR8A 1VHFA 2LSNA 3SBMA 4CHOA 4J9VA 4M5KA 2FC8A 3VQEA 1IM4A 2DCUB 3LW5C 1RA6A 2CQPA 2R2SA 3IBFB 1Z26A 1HQ2A 1TUWA 2GQCA 2P5OA 3VEOA 1NKEA 2R2UA 3QATA 3NGKA 3OBIA 3MPUB 4KYZA 3CCSN 3HVTA 3W5XA 3ILLA 3I5CA 4DFMA 1FWLA 3I96A 3LP0B 2G1HA 2DNYA 1Y5NB 3RYLA 3MM6B 3NAHA 4WFXA 1PAUB 5ETNA 4NI2A 3CCUS 3VAIA 1JCEA 2D1KA 4QU6A 1T6DA 1GXTA 2HBZB 4E0DA 1ACMB 2I7PA 1D9AA 4MDAA 4DTJA 3QEWA 4NCGB 1VQ7S 4J9LA 3IXQA 5J2PB 2NS1B 3QICA 4KV8B 3P5BP 4P6QA 1WKLA 2B9EA 3AT1B 4DL0C 1N0VC 1T8EA 3KG4A 4OYBA 2XO7A 4CI6A 1S6QB 4JKEA 5D0RA 3GV7B 1S6PA 2IMOA 2JLFA 4ILJA 3PR5B 3W0LA 3N0VA 3O6WA 5IT4A 4DR4J 1NDKA 2LDYA 4BE2A 1YT3A 1XNRK 1TYQA 4LF8K 3TUZC 4IDKB 3GJQB 2OPPB 3EZ5A 2F7TA 3M2UB 1X7VA 3BM7A 3G86A 9ATCB 1C0MA 4R25A 3C66A 3J81Y 2H5JB 3AVLA 1WSRA 3LANA 4IJAA 3DRPB 1E6YB 2EBGA 1JJCB 5C7PA 4ZVTB 2ZWHA 2HHQA 4RW7B 2OAUA 4M94A 2EVZA 3FCHA 3NHGA 5IV4A 1FKPA 3AD7C 4HTJA 1FFSB 1RT7B 1Z1ZA 2D0AA 3F2KA 3JSYA 4ISEA 3DOKA 4OPKA 3OS0A 4A8SA 4XH4A 3NGIA 4DUZF 2WONB 4EO6A 2XB2D 1WDTA 4YB5A 3V9SA 4ETXA 3T7ZA 2KXNB 4AFFA 2QSFA 4MK9A 2E9TA 1X3MA 3SQ4A 3ID6A 4DQRA 3LUYA 2ZQBA 3K9JA 1VQYA 2QWRA 5B0DA 3MN5A 4L76A 1HNZK 4J8FA 1G3OA 3J7YP 2DYAA 3BS9A 1WB9A 5E2QA 1DTQA 3C46A 3I8DA 2V4JA 2F3JA 1VSFA 1S48A 3MHYA 4NO7A 4O3SA 4PUOA 1BI4B 2DT9A 4CHZA 4YQWA 4E1MA 2XCPA 4P71A 1JLEB 2JLGA 3CQXA 2OFGX 5FLXU 4QWCA 2EEYA 2B5JA 4CO1A 2F7VA 1WWHA 1NU0A 1WBDA 4E7JA 2IDEA 4JYAF 3KJFB 3AJDA 2LEBA 3BO4A 5HATA 1K73T 1MMDA 2AEMA 4KH6A 2QLFB 5AQKA 3D28A 4RBVA 2CIMA 4B9NA 3BBBA 3FUYA 4X62F 2FGCA 3QIPB 2IBOA 4AE5A 1K73O 4PRFA 2AIRB 3AV9A 2F1FA 3BBCA 1CSJA 1Z6RA 4RLEA 3MCPA 1SL1A 1ICEB 2LU1A 1VQPS 2CDQA 2LVWA 2YVSA 4K2JA 4IOXA 1LOTB 4USHA 4ICLB 4DQPA 1X9JA 4LRCA 4PG7A 4TN2A 5KFIA 3RW6A 5FJ4A 2RS8A 1F2GA 2LQJA 1I1GA 3OPKA 4DL4A 1N33F 4FKXA 3ZYYX 3KLGB 4DX6A 5HANA 3MPYA 2I7NA 5KGXA 3K5MA 1U25A 1C0TA 2UXBK 2EFNA 4WFBQ 4WBFA 1EQYA 2R7XA 3VZHA 2YPZA 1R8HA 3BKFA 2O67A 4DBQA 4E1JA 2P6SA 5KFCA 4DR7F 3PRVA 1OPZA 2A1BA 3LP2B 4H4KC 4IH6A 2M3DA 3L2VA 2RDJA 3X3UA 4ZP7A 3L2WA 1EX8A 2DNZA 1JXLA 1W97L 4CLYA 3RMCA 1S77D 2E5LJ 4DV5J 2OPQB 1Y9OA 2GV1A 2B4JA 1RYSA 1BMQB 4XDCA 5D4NA 1IG9A 5DDRC 3KFWX 1HBOB 4CK1A 5KFWA 3NLCA 3HD2A 2UUAJ 2HVDA 4KGXB 4QWAA 4H4OB 4UZBA 1KQKA 5AQXA 1WSEA 2NRXA 2ROEA 4KHQA 5CA5A 2ROPA 4BBYA 2EK1A 4B3TF 4ID5B 1OWXA 4U6PA 1LCUA 1R6YA 3MX5A 3IFRA 1OKJA 1YITN 3SFGA 3OLAA 1KC8T 3SUPA 1WC4A 1KN6A 4CZIA 1SUQB 3H8YA 4OYOA 3GQCA 1HQEA 3P31A 3MM8B 4DLGA 2Y3YA 2RHQB 2NRZA 4BDYA 3W65A 4J9MA 1ZBLA 2J9EA 3V6DB 3DLHA 3ETMA 2E5LK 4DV5K 3N6NA 2JEIA 1Y64A 5JVHL 2VPWB 1I3OB 2V63A 1T9TA 4NB4A 1TL1B 4X64J 2C2DA 2YNFA 4OZ3A 2HAIA 2UUAK 2KDOA 1GAOA 3W60A 5ETPA 5KG6A 1IQTA 2VZ9A 3LDOA 1N36K 2RU9A 4NOHA 4DV2K 4F3QA 2RB7A 3GIIA 3QAEA 1RTZA 2Q2RA 4AXIA 5L1LA 1JL2A 2DIUA 3SQ2A 3V9XA 2V8VA 4AF1A 1GMUA 5CYQB 1XJWB 1TKZB 3MPWA 4DTPA 3ZEUA 1W25A 2MJNA 3U9DA 2P9LA 1BC6A 4IYQA 1WN7A 3DXMB 3AO3A 2IAJA 4WFAL 3M8ZA 3U6FA 3MTKA 2HVZA 4LFCJ 3FDSA 3EICA 4JK7A 2JC0A 1YBUA 1WBBA 2FHKA 5TKYA 3J7AN 3EEQA 4ED8A 4DUTA 2ZBPA 1S7HA 1XMOF 3IRWP 1HNXF 5A2QO 5KFRA 3PIPQ 5B0GA 3NRBA 1J5EJ 1MWYA 2AWZA 5A0YB 1RDWX 4X4SA 3QJJA 4L3NA 3MR5A 4QS7A 2OSRA 4N8OA 3ZZOA 2UUWA 3L0QA 3W8GA 2DH8A 3M8WA 5AQUA 1IH7A 3AXMA 4RL1A 3PRDA 4C97A 1S57A 2UP1A 2V7ZA 2W7AA 5KQDA 3A8IA 4Q8FA 1RT1B 2H54B 3NS7B 4LSLA 3MTJA 3BF4A 2HW3A 4QS8A 4B3SJ 3HP6A 4X65J 3Q2SC 1NDLA 1RCOB 4Z37A 1FEEA 3T41A 1L3UA 2X1GA 3PW5A 1Q16B 3VHQA 4JI2K 5ADXA 4TQRA 4I6WA 1S0OA 3CDUA 3LPTA 3A8EA 3G71S 2MTLA 4ELUA 4RBUA 3QSIA 5B0CA 4OLOA 5LL6Z 2RE2A 3ZFVA 1DJ0A 1LW0A 1UEVA 2RDIA 1QE1B 1SH3A 5DETA 2ZJPQ 3H2VE 3A2FA 3WXKA 4CLSA 4O5BA 1HHTP 5CYJA 2NPIA 2LEAA 5EHHA 2VQFF 2QTDA 1FKOB 1D8YA 3A5NC 1IKYA 1HNVB 2GO9A 1TKXB 2F40A 3VETA 1LQ9A 2C2KB 3IR6B 4OV6A 3R2DJ 1FDBA 3OFFA 3ZTSA 3MD1A 4B3SK 1NM1A 3V4IB 4Y2IA 2J0XA 4PY5A 4PL7A 3ILIA 1VSMA 1U09A 3KYLA 4CBWA 3UPFA 4UQTA 4KH5A 4K2XA 1WTFA 1H7XA 3GMGA 4ID1A 2N7YA 5T41A 5GAGP 4EO8A 4KB1A 2ZE2A 3OXFA 4K43A 1BO5O 2V2KA 3OA9A 3CCWA 4HH0A 1WF0A 4CH7A 2CNKB 5LSOA 3PHEA 1SJFA 4LF5F 3L95X 1OS5A 5T14A 2LA6A 3DGPA 3ZSXA 1WUUA 4NLYA 3QFPA 1FERA 1YHQN 2BKOA 4OO1J 4FJMA 3OR1A 2CH6A 3MMCB 3ET6A 3CCSS 2VFTA 1WD6A 2Z2ZA 4UUXA 5DQIA 1RI7A 1B9FA 3O80A 1EKEA 4OYPA 4EEYA 1SV5B 4Q5VA 3NS5A 1S79A 3I9ZA 2ZGZA 1BUXA 3CDBA 2ACMA 3UCGA 1QSYA 1H6KX 4JD2B 4GKJJ 1IJFB 4J2DA 5HJXA 1Q95G 1CVJA 2WHOA 4OYAA 4RNMA 2UVWA 1NGHA 1BQMB 2DRAA 4AQYJ 4DR3F 2KVQE 4F25A 1SIZA 3SK3A 3SAHA 1ASWA 2JDJA 1WKJA 3CC2N 3QRQA 4DUYJ 2IC3B 5KG3A 2BJ9A 1VBXA 2L41A 4KBIA 3LL3A 4FM0A 3UVJA 2F5GA 2YX4A 3UDLA 1RSCA 2IJFA 2AT1B 4P52A 4QU7A 4IOBA 4C0HA 2KXFA 1VMBA 5CZVA 2AQ4A 1FNMA 1RT5B 3M32B 3IMXA 3SPYA 2VG6B 2WTFA 3M9OB 2KQ2A 3T5LA 4L3QA 4H0TB 2ZZMA 3O6QA 2NRTA 3ZCMA 1T9UA 5AQJA 5B08A 3EZUA 1P27B 4USWA 3TARA 4OJHA 2YQ1A 5J1EB 5B0AA 1SQEA 2OZSA 3N01A 5KFMA 1UZHA 2W24A 3QSYB 3CFOA 4CVNE 4KHYA 2KB2A 2XMWA 1IBMF 3OYMA 3OYAA 4M5LA 4CO0A 4M5HA 1WHVA 1C1BB 3JS6A 1ZOTA 1HNWF 4QS9A 1GLBG 3DLEA 4F4KA 3CJSA 2UXCF 1MG7A 3M3ZA 1CS4B 1FDAA 2V9WA 2BM1A 3PSIA 3AH6A 4DTNA 1V4SA 1H98A 4DSIA 2C28A 3DXSX 4OJRA 3L7OA 3EUNA 3N4PA 4ZCKA 1LAVA 3ENBA 4F9OA 3ZSZA 2KFZA 5A76A 3T1YJ 1C1AA 2HGMA 4ZHRB 4FLYA 4LFAJ 3NF8A 4CEEA 2VFVA 5IWAJ 2H3EB 4CJRA 4K4XA 4HHHA 2OPSB 3Q8PB 3FSIA 3I8BA 4C11B 4D3HA 2E9RX 1X4CA 1WOOA 2DY1A 4DJBA 3KWMA 5JICA 3U3GA 2JEGA 3JAMO 4B3RF 1XUPO 3A3NB 1KTQA 4ZP6A 3GFZA 1HR0F 1VJWA 4FVCA 4DR2K 5LMNF 3KK2A 4OIXA 3HO1A 1BQNB 4BRQA 1UCNA 2BZ2A 2R4FA 3V5RA 1S97A 4JI1K 5F8JA 3A12A 3A8JA 3R7BB 1Q82T 3H2LA 3MGJA 5IT9Y 2DCLA 1BOTO 3CCVN 4RNFA 4FS1A 3H6EA 4LFAK 3SCIE 3PKMA 2ASPA 5IWAK 5AXKA 2DY9A 4PKGA 2Z56B 1U1QA 4JI8J 1BA1A 2B4OA 2ZKTA 5C25B 1QSLA 2HS3A 2VA3A 3LZJA 5KFEA 2UVVA 2POKA 4DTUA 5HK4A 5IZHA 1BUPA 1WC3A 2XSFA 4FJ8A 1NBEB 2DXEA 2PI5A 4HUEA 4GVLA 1R0AA 4ZPAA 3W2VB 4JKBA 3RBEA 4C1NI 4PG8A 4WFBL 3AAQA 2C1EB 2V51B 2O8BB 2ZJQQ 2MGZA 5E84A 1AROP 1DTTA 4JI3F 1QZ5A 4MAKA 3T3FA 1YRUA 3C19A 2IJRA 4JV5J 1U6ZA 3ENAA 2CDRB 4H4KA 4JI7K 5B0BA 2LU2A 2MLYA 3FNNA 3AY9A 3LAKA 3O8MA 3CMEN 4I6YA 1ITGA 4NXNK 1MSWD 1QAIA 2AX0A 1B9DA 2KRBA 1VRTB 1LFPA 4M8LA 3GFYA 5THWA 2N3LA 2CZVC 4DTMA 4B02A 4NX9A 3PX6A 2OIHA 2W2OP 1QAXA 2P9EA 3LPUA 2ZHAA 3TAGA 4HL9A 1RDCA 2VBWA 4A8YA 1N5YA 4QWEA 4WQ4A 2R7WA 1NBWA 3W1YC 1NB2A 5HVGA 2ILYA 2OP5A 3WNFA 3RBZA 3H1VX 4OKEA 1Q9YA 3FZFA 4CEDA 2MLXA 4YOTA 2GGPA 5AQOA 1E4GT 2YNIA 3O4QA 2R7UA 1CJVB 2E1MC 4ZKAA 1C4AA 2QL7B 3LDQA 3PNIA 2HWHA 4K50A 3ID8A 2FYXA 3IA0A 4BROA 3UDCA 4RW6B 4FKYA 1X4DA 3OVNA 2HEKA 3C8YA 4DV7F 3CCQN 2C2OB 4FWKA 3A3PB 5AQMA 1KD1O 4FYYB 1JL1A 2DGSA 4WFZA 1S1XA 2RQ4A 3VAKA 4YOEA 4DB3A 4CRJA 1IV0A 1TTHB 4OYWA 4ZN3A 4CLPA 3SEOA 4M5DB 3C14B 1GLEG 3RUBL 2PY5A 5F41A 2UXDF 3HZ6A 3L2UA 1NGAA 1VQKN 4O0IA 4W92B 2UVUA 3HT0A 3E01B 1HJOA 3D0IE 1JLBB 3O8WA 2R8KA 2QLBB 1TMMA 3ZETA 1ILYA 4EGLA 4NZ7A 3D3CJ 2YX1A 4WYLA 2XULA 1JMTA 1VQ9N 2O8EB 1YJNN 3WQPA 2RE1A 1KVCA 4Z4HA 4FXVA 3THYB 1GQEA 4DV1J 3X1LB 1VDHA 1RBVA 3WX4A 2H4YB 1Q0NA 1KSPA 2BMBA 2BJ8A 3L6QA 2K1RB 3CJ8A 5GIOA 3HM9A 1FWPA 4ZTJA 1K0TA 1RBUA 2YX6A 5F0XA 1F3VA 2K8GA 3AB2B 3IGVA 4N41A 1TUUA 3FVYA 4CLLA 3OUYA 4CJ3A 5E3CA 1OSCA 1D0EA 2VASA 4OKKA 1EQMA 2VCPA 2RVJA 4PAAA 2CJXB 4K4UA 4B1UB 1NGEA 1UMJA 5IM0B 2J0QD 3PIPL 2XYHB 3S3NA 1T94A 2BW7A 2V68A 1NH8A 3VGVA 4Z0UA 3D1HA 5LY3A 4EMDA 4G1QB 4KAZA 1P1LA 1KWMA 1T3NA 2RRNA 1S1UA 4URSA 5CAAA 3AY0A 2O8CA 1SQGA 3LP3A 1QS4A 4ZP8A 5A8KA 2OCEA 1NKBA 2WVDA 4ZPVR 1GMWA 4ENOA 2DNMA 5HP1A 3PEHA 3NAEA 3N9UC 3W2WB 3V1OA 4DV0K 4K0KK 2XMMA 3AVGA 3TAQA 1LK7A 5AQTA 1RAJA 1Y97A 1TKTB 5AQVA 2VOPA 2HRUA 2OMLA 4FXDA 2PD1A 1X0PA 4PQAA 2W40A 3JSMA 3D2FB 2LCWA 1TZ0A 3EYZA 2DISA 3AA3A 1CZAN 3DOMB 4KO0A 3NCPA 5GAHU 1G15A 3PW0A 3W61A 1RBOB 2IVMA 3GE1A 1KBRA 1FK9B 1I5OB 4J9NA 4EZ9A 3PSFA 3NFAA 1YRTA 3I0RB 4LH5A 2BOPA 2DVIA 4BRPA 5CYMB 5D3GA 2XNRA 3L3VA 4R79A 2ADBA 4N8NA 3BREA 4OZ5A 1QHTA 4O0JA 3VQAA 5HQ8A 2MDAA 4LMZA 1HMVB 5EUHA 4M42A 1XQIA 1TFWA 3TVYA 4YHHK 3QLHB 2OA8A 3R2CJ 1AFIA 3CJKA 4XIUA 2J0SD 4RW8B 3SUOA 3IKMA 4OJ1A 1TKDA 2C2MB 1JXVA 5F2RA 3VEVA 3PLAA 3FSYA 2F4VK 2FC9A 1JIHA 2OEKA 1MU2B 3O3HA 1YHQS 2N4DA 3PW7A 2GJ2A 4JI5K 1H2TZ 1RHKB 4BC4A 4FLTA 3LH2S 3TSPA 5KRTA 3TEGA 4EHTA 1U1KA 3MEEA 2C2RA 2M5YA 4OL8A 2XZTB 2J9DE 3M6UA 1EP4A 1DBDA 2DRBA 4DZ6A 4DS5A 2JJ4D 2YNHA 5J2MA 4FZVA 2CQ1A 4FDFA 2FJEB 1HUXA 3DFEA 3DLJA 3HX9A 1NGIA 4K59A 5EDWA 1QVFR 5LL6d 4LR8A 1BE4A 1OQ6A 2QV6A 4ATNA 1UFLA 2HKEA 4LSNA 4K8ZA 1X5SA 4QPXA 3LDSA 3CJ3A 2XMUA 5JVGQ 5K14B 3IUCA 3VQBA 5SZTA 1M0SA 3AAPA 3HVTB 4JN4A 2E5JA 2XMKA 1HA1A 1B99A 3FBCA 4M7XA 2C3UA 1Y0HA 3P45B 1FDDA 1N8RT 3HOSA 1JXEA 5GAEI 3AOAA 1NNEA 4K4VA 1NPRA 5HSPA 2L3MA 3WDOA 3A0IX 5BRDA 4K7QA 3O1BA 1FTRA 2ZNYA 1HD0A 3AO4A 2RHSB 1Z2ZA 2M7SA 2CAJA 3D4JA 4QW8A 2VQEJ 1FA0A 1NMNA 2QWQA 4K25A 3PY8A 3MWBA 1YI2S 5KAKA 2RDDA 2EFVA 2GJFA 4IDHA 4R8UA 2DH9A 4ISGA 3P1GA 4JI6J 3RB3A 1K8KA 1S6PB 2FSNA 1NK7A 1TK0A 2NZ4A 3POTA 1ELOA 1VK3A 2W25A 1VQSA 4E7IA 1XNRF 4LF8F 2BKPA 2QLJB 1TYQB 3PX4A 1Q9XA 2QKBA 2X74A 3R9LA 3IBWA 4A5AA 1WHWA 1JJ4A 5C42A 3HHLC 2A10A 2X6NA 2IRXA 4OHXA 3ZX2A 1CULB 1T3OA 5AZIA 1BD6A 5M1FA 3NMRA 3NVMA 3BDPA 4XO0A 5AJ3F 3PUFA 4RO0A 1IBKJ 4AXJA 1RNHA 2QLXA 3FZ2A 4JS5A 2GVZA 4RNOA 2LQBA 1WTBA 4LF9J 3JSBA 1XIQA 3WC0A 4F36A 4B8CA 4ED4A 3T9NA 3KMSA 4JI6K 3C6AA 2AJ1A 3G4SS 1TK8A 2WBNA 5AQNA 4PCQA 1RAHB 3MR2A 3NGRA 4JI4J 1OH6A 4CT8A 3GIKA 4LRDA 1HNZF 3EE9A 3OYEA 3M9MB 3CT9A 1DTQB 1YWXA 2V4JB 4CGJA 3LP0A 4Y6IA 3J80Y 3F5TA 4NMXA 3IN5A 4KPCA 3SMPA 2NXEA 1FNXH 3PX0A 1WSGA 3HFZB 5HI7A 3CXCR 2ZBQA 4M3WA 1RAOA 3CCVS 2QA4N 2LECA 2IVNA 1F5AA 5AQZA 1U8WA 2MQPA 2KL8A 2XLKA 2ALZA 5DZ6A 2MQNA 2NSBA 2E9ZA 3PEJA 3KHHA 4KV8A 1GX5A 4F7VA 4W5RA 4FLXA 1Y5IB 5G4DA 4ZPBA 2ZC4A 2C3OA 3AAWB 3L2RA 2P9NB 4JI4K 1S6QA 5CD4A 1VSIA 3MUVP 4OGCA 2FVRA 4JBCA 3A3OB 1NZAA 2XMAA 3UCUP 4IDKA 3NS6A 3VESA 4LF4K 3I0SB 2AU0A 5BYSA 4NEYA 2CNOB 4JK8A 3MMAB 2HMIA 2ZJQL 5E5NA 2ZOMA 2LXUA 2Q1NA 2R8IA 1UZDA 4ECZA 3ILOA 4ZIWA 2FLPA 4FWSA 4KFBB 1QVFM 3KWGA 4DL7A 4LF6K 5KFSA 2DO4A 2DPIA 4MT1A 3DAWA 4DX5A 5SUHA 3K0SA 2UXBF 1RT7A 5JMNA 1YVFA 4Q45A 1C0TB 1SB6A 3SUQA 2WONA 3AOCA 3VF6A 1JKHB 3W3DA 4FNIA 2YNGB 2PDAA 3ZZ0A 2DFFA 4ZCIA 5H9FK 2EG1A 4A8FA 1YK9A 3T6JA 3VVTA 1BHLA 3V9UA 3QWUA 5MAOA 1S72N 2PEHA 4CO2A 1NGDA 2CUYA 2H9ZA 5DGAA 3OYGA 4ZP9A 3UWTA 5A8RB 1JNRB 1N5TA 3HBTA 3E51A 5M1PA 1F5BA 3W9IA 1VSHA 3AOBA 2ZWPA 2DHSA 4OZJA 1VQ5S 3GIRA 2CRLA 1F2HA 1NCLA 2DD8S 3K5LA 3BSAA 2BANB 4AL7A 4HCCA 4LH4A 4BR7A 5K8PA 2B4PA 3R5BA 3OXGA 5KQ8A 3I9V9 3TQ1A 4GNIA 2J8AA 2WK4A 1HPMA 2A2CA 3OTEA 1X31C 5B8HA 2XNQA 4IO9L 3MX2A 1XK8A 1VQKS 1FJGJ 4LQ3A 2WCXA 2M9KA 3BN4A 5BRHA 3EZOA 1YBAA 3U4LA 5KFZA 3FK4A 5D4PA 1MWKA 2YHYA 1ZTWA 3KWIA 4B1WB 2FLNA 4NE9C 5F8GA 3Q8SB 2W01A 4N7TA 4V19X 4KRWA 4RNNA 3R5DA 3TAFA 3MD3A 3VGTA 3QIPA 3NCIA 1SC3B 1JJ2M 1VQ9S 4FCYA 4JK9A 1YJNS 5K5MA 4XK8C 1XNQK 1ITPA 3Q0AA 4ZVHA 1NMEB 1U26A 1X5TA 2B8QA 3WX8A 2PC6A 4A8WA 4ZVEA 4FZYA 2UUAF 2LDIA 2YNFB 2XTJP 1HQUB 3LOUA 3HLUA 5C2FA 4HH1A 3VPZA 4USUA 2W9AA 3HDSA 4CF9A 1N36F 5IT9O 1OYEA 4DV2F 4CGGA 5KFOA 1QUVA 1WDDA 2QI2A 2ASOA 4CFBA 3D6MB 3KLGA 3ZZPA 4NRUA 2E7VA 3DHWC 3UW1A 3WQTA 5D4OA 4M7YA 3HXMA 2VWBA 1N5QA 4FLZA 2BW2A 4OJ3A 3E9OA 3EXYA 1EARA 4U95A 2NNWA 4ERDA 2QLWA 3J81U 1Q5VA 1PC4A 2QX0A 2EFOA 3TVKA 2UUCK 2IAJB 2UU9J 2AV5A 2JWNA 3OS2A 1VISA 2BRLA 3CVKA 1NSAA 4HHTA 3D0HE 4PL8A 1YRXA 1VQOS 1OVYA 1LWCA 3EPGA 1MDUB 5AXNA 2MZRA 3CCES 3OL7A 2G8KA 3OFGA 1JCGA 4LBPA 2OPQA 2QA4G 1PIEA 3TR5A 4PXBA 3HVRA 4WWSA 4LRAA 1IBCB 1T02A 2E1AA 1HBOA 1HYSA 3M9NB 2AJFE 2VPZB 4H4OA 2GA7A 1TUVA 3B78A 4YS2A 2Y1LB 3GJSB 2CPHA 2A2DA 4NEZA 3V6KA 1UKUA 3TOQA 2VD3A 1WSIA 2Q43A 1FI4A 1Q18A 4ID5A 4LSLB 3THTA 3OL6A 1NJZA 3NXZA 2KJVA 3JTPA 3CD7A 2QKKA 4UY8T 2UU9K 3UR3C 4K42A 3CJ5A 2P9UA 4JI2F 2JOQA 3O4NA 5FRNA 4UQGA 3FFKB 3NGYA 4B1YB 4USMA 4UY8O 2H4WB 4J37A 4ZJOA 3CIZA 2RRAA 4IOAQ 2FBYA 2XS2A 2B6AB 2FQQB 4MJKA 2DTUA 1KLMB 1HPZA 3QNOA 1I3AA 2BR0A 4DR6K 4LJMA 4IEEA 5M2UA 4DTRA 3CCZA 1HWUA 2P5VA 1UVJA 1WC6A 2E8AA 2M70A 4YMEA 2J6TA 2E2PA 4FLUA 3C7NA 1TVRA 1PYSB 4NYOA 1CZBA 1IKYB 2G13A 2IOCA 2CXEA 3P96A 3RWUA 5F9NA 2FBTA 3MCMA 4NA3A 2Q66A 2K2PA 3KK7A 4K41A 3GG0A 4JB8B 3G8QA 4ISFA 2AZ1A 3JXOA 4H0VB 1J53A 1WI8A 5CYQA 3WIUA 3KG0A 4CJEA 3CJRA 4OX9J 1SKUB 4KKOA 3T5KA 3MPVA 3OTDA 4LIRA 3DXMA 3EWGA 4F2RA 2ZH3A 1V4TA 1SH0A 3KNGA 4R0JA 4BWMA 1ZH5A 3DGPB 3GSDA 4FM2A 2ZDOA 2IYGA 1NMDA 2O01C 3G8SA 1KR4A 3TSUA 3OR1B 5GMDA 1RYRA 4AHUA 3C94A 2PMHA 4O3OA 4CF1A 4ED0A 1FE4A 4FYVB 3SQOP 2BV3A 2E7XA 3P39A 3QGHA 3AD9C 3M1VA 1QQOA 4CNZA 1GNKA 3G87A 5KFBA 3L8BA 2AJ2A 2ZOFA 2X7IA 2XYPB 4BG8A 3ZLJA 3G0ZA 3C6TB 1SCJB 1NB7A 1RT1A 3J8AA 1ZA2B 2DY4A 3ADAC 2GO8A 1ZXOA 3KHRA 4BRLA 3Q23A 5M1QA 3R6GB 4UOFA 4CIOA 3SQGA 1VBYA 1TMJA 1VSEA 2P51A 4LC9B 4BRAA 4H8KA 3D1QA 3TQEA 4GVBA 4CD3A 4EP4A 3TU5A 3PTWA 4MKBA 4AHRA 2HNDA 2QL5B 1BXNA 2H65B 3CPWM 3UVJB 1GH8A 4E19A 4Y0FA 4ED5A 4NLSA 4Z4FA 3VEWA 4BLGA 4OLAA 5L1JA 2I8EA 3R6MA 1VK8A 2AHOB 3HHLA 2Q1LA 3FGUA 1E6VA 5LJVA 5F0WA 2OANA 4CF8A 2MSSA 4F50A 4GC6A 2X1BA 5K9FA 3KUGA 2E1ZA 5AQRA 1YAGA 5KFLA 2MKJA 1RLCL 2ZITA 3QFUA 1MN9A 4LF7J 3QETA 3UKRB 1GXUA 1K8AT 4JKGB 2HYIB 3A8YA 3DOLA 4MKVA 3LGMA 4KHPK 2CPJA 3JYTB 3BGOP 3W3SA 1R31A 2ZM6J 4CM0A 1K8AO 4BCAA 1UW4A 5JMVA 4Z4CA 2P8IA 2IM1A 3DLEB 1F9FA 1R3NA 4B9TA 4NXMJ 5AQIA 4L8RB 2XG8A 5DK5A 2YKMA 1ZPVA 3NGDA 3K89A 4OPHA 1RFQA 5C15A 4B1ZA 1UVLA 3ZX3A 1NGJA 1NDPA 2OTJN 2B0GA 1NH7A 2Q3PA 4DCHA 3H5SA 4RW4B 3QT6A 3M1FA 4ES3A 4ZVSB 4FVMA 4OZLA 5IC6B 3PV8A 2ETJA 3T5JA 1Q53A 4X66J 2DHAA 3NF7A 3CCJN 2PE8A 4JP8A 1DRZA 1SI9A 3CCMS 4CTAA 1IN0A 1PKUA 2QA4S 1CEZA 2WVCA 4AD6A 1FVSA 4JD2A 1KCFA 3L09A 1GFWB 3LGNA 1P8ZA 4FWPA 4XPEA 3ENQA 2ZM6K 2JSXA 3V9WA 4DR2F 4B3MK 4QYRA 4YDDB 5B7WA 3EE3A 2WTUA 2QG9B 3HKZD 2JWKA 4JI1F 2RJZA 1JX4A 5FLXO 4PKHA 2IC3A 3DM2A 3OTOK 2E2QA 3PYFA 4FM1A 4KIAA 2PIIA 1PILA 3QRRA 5I42A 1TV6B 1YSJA 5DRKA 3ZNJ1 1XMQJ 5IV3A 3A8KA 5IFMA 2OJ3A 2QMWA 5IWAF 1SVDA 4X66K 1RT5A 2H51B 3AQOA 1TUYA 1OY9A 4FS2A 2YHXA 1EXQA 2GVDA 2E5GA 1E4FT 4PXDA 5HO4A 3BP8A 1UEUA 1CPZA 1C4CA 2WFBA 2FZKB 4Q2LA 4M95A 1R0AB 1QTMA 4L6V3 3DLRA 1KVKA 1WSFA 3QIDA 2A5XA 4B3OA 2MGZB 2D41A 3NCRA 2QXLA 4AILC 2B9XA 4DV4F 5IOLA 2XHCA 1M90O 4RW9B 2VOOA 2XZDB 4CNYA 2VKRA 4JI7F 3HKWA 4ZVOB 1S9FA 1S72S 1F5CA 2A6AA 3SUNA 4CHPA 1Q5YA 1YJ7A 3EM1A 2HHHK 4NXNF 2CPYA 4CYUA 4OYZA 1ZTTA 1D3WA 1S10A 2VWKA 5DM6Q 4C8OA 2A1RA 1VSKA 1R59O 1SXLA 3NOGA 1C2PA 4OVLA 3VQPA 4HDGA 4YP3A 1I94K 2PGCA 3VF2A 4ZA1A 2OPSA 4UZCA 4A8OA 2UUTA 1NGCA 4MO4A 3P4UB 2EFQA 2A6MA 2PT0A 2GGPB 2MPUA 3CQYA 2YNIB 2CGJA 4DG1A 2QYGA 2MB0B 1RTJA 3ENWA 2HB5A 2WBMA 3J7YU 3QNNA 3GZ7A 1BQNA 1LWFB 1H74A 2Z2MA 3VQCA 1T9XA 3TI0A 2XZWA 1AFJA 2W4DA 2ATCB 2VONA 3TSQA 2C3YA 3HSTB 3VV2B 2VICA 1EX4A 2XGPA 5EN1A 3FBEA 3AD8C 3DU5A 4PHTX 2DNLA 3OYNA 3MM5A 1N32J 5IQ6A 5AQLA 3CCRN 2HBRB 2RQCA 3FGVA 3GONA 3T1HJ 5KFKA 1TL7B 3DDNA 4QR0A 4CZGA 4IQMA 5D4LA 1RA7A 2MQQA 4LFBK 3WXLA 2ZJRQ 1NM2A 3EDRB 3W8PA 2AYGA 5C25A 1NRKA 1JB0C 3ZETB 1GLCG 1K47A 2BJ7A 4TU9A 1H0HB 1I39A 1R43A 2NUUG 4YDUC 4I1TA 1JLQB 1RB0A 4DPOA 4RZRA 1VQMN 3K5PA 4FJNA 2JEJA 1XR7A 4J9UE 5L1KA 1VLOA 1BY9A 5F8LA 4PABA 2VG7A 3GSIA 4CJTA 2ABYA 3TNVA 3MEGB 1BL3A 2O8BA 4C3LA 3VAGA 3NNCA 4M63A 4OGEA 3P38A 5KFFA 4O8UA 3IR7B 2DEIA 1C6VA 4FYDA 1CJTB 4GKKJ 1XQSC 2E6LA 1FXDA 2MKSA 1E3MA 4PWDA 3HHDA 1C1CA 1UWBA 4WK3A 1HYZA 1ZM9A 4DQ8A 3M8SA 4ECRA 5KRSA 4FL9A 1WELA 2BUNA 3UNGC 1X3NA 2CPEA 5BR8K 3SSSA 2QWPA 4O4GA 2KTQA 4DR1J 2QT7A 2RD5C 1S59A 4DV6K 2F9TA 2WVEA 2GHWA 5CD4H 2J7WA 1O51A 2DIVA 3GR0A 3TRGA 4J2AA 5F9LA 1S1UB 1WUAA 1N5SA 3D45A 1R89A 2AW0A 2Q3SA 3NCQA 3AVMA 2VPXB 3NMUA 3MZIA 3TJAA 4YY3K 3QEXA 5A8KB 2C2ZB 3M8QA 4BGAA 4E7LA 2M2BA 5DM7Q 4TYBA 3TA1A 4CD1A 3A1YG 1Q8LA 2MLZA 4JKDA 5HP1B 1PJ6A 3O9TA 3CD5A 4GKKK 3I4HX 4DV0F 4K0KF 3THWB 2DGTA 2QZ8A 3W5YA 3LWMA 3QZ7A 3T5HA 1VI7A 3OYIA 2NXJA 4CFDA 4GV3A 4CJ4A 5DG7A 3JSMB 3NGTA 2P5GA 2KYZA 1TAQA 3N5BA 2U2FA 3VQ5A 4DR1K 4X4PA 4KHUA 2HK3A 4A8QA 1RDRA 2UVRA 1GOAA 2JH3A 2A3ZA 4WIQA 2R42A 3UKUA 4ED2A 4IO8A 1RBLA 4KHSA 1B92A 1ZBTA 4WU2A 3CETA 3FBBA 2MJUA 4CK3A 2CJYB 1HJRA 4WQ5C 3PYGA 1IJJA 3CIMA 2G9OA 1JLBA 5C2CA 1VGYA 4U8VA 5K20B 3ZT2A 5M1OA 3AVHA 1GLLO 4XTTA 1DHMA 5DJBA 2O8EA 2F8HA 3THYA 3BPSP 4J7CA 3L4BC 1WF1A 3R1XA 4U67Q 2HNYB 2YWFA 4YHHF 1VBKA 3F9MA 5C0YA 3TABA 1KAYA 2GW8A 3R1HA 3CJBA 2BM0A 4ECVA 1RK8A 1Q86T 1BG3A 2D3O1 2F4VF 2YH1A 4JHDB 3FMBA 4FJXA 2F8MA 3TUJC 4PR6A 5BYQA 1DURA 2E4LA 2OEJA 4JI5F 1Q86O 3I6PA 3CJ0A 1QZ6A 3VF0B 4EK2A 3MEEB 1IBLK 1EP4B 2L9NA 5D0HA 3HHEA 3THPA 2FLLA 3TAEA 1OMSA 5J2MB 4BACA 1XI1A 2N4CA 2ADCA 1RT6B 2CGKA 5H1SQ 2JL9A 3G96A 2X6SA 3KK1B 3AVKA 3MN7A 1DGKN 1U1MA 2D9OA 2VL1A 3E3XA 4AHSA 4LSNB 4DCJB 3MXMA 4M45A 5B09A 1UAWA 3I33A 2YWEA 1SJ4P 1DT9A 1NJIO 3W9HA 3W2WA 1X5OA 2B56A 3WUHA 3BY5A 1GOCA 1TKTA 3BGFA 4DHYA 2DPNA 2OGUA 5DDOC 3UD3P 3D2FA 5CXTA 4HEA9 4MLHA 3DOMA 1X9SA 3OHAA 4BR0A 3C3LA 4FF2A 4HVZA 1UVMA 3NGSA 4BR4A 2HS0A 2DNHA 2CJBA 4HI2A 2R2TA 3OBYA 2KKHA 2P6TA 4EFHA 1F9HA 3GB0A 3CIPA 2UUBF 5J2NB 3H59A 3I0RA 3US5A 3CC4N 3S1TA 2PA3A 4R8UB 2HBMA 2ZH2A 5DG9A 5DG8A 4K4TA 3OJUA 1T9VA 1K8KB 4FBUA 2BEFA 1M5OC 4OX8A 3V81B 3DRXA 3POTB 4OFZA 4JRPA 2OEMA 4FWLA 2BYCA 1MMLA 1S1WB 3TPQA 5ADZA 3S41A 3R5GA 1GLDG 1RDBA 4WXWA 5GADU 3GIMA 1QSSA 4JYAJ 4MIAA 3BGRA 2IGIA 5CABA 4CJPA 4EFAC 1UWAA 3AO2A 3ZTPA 4DTXA 1KNZA 3ZSYA 6FD1A 4L74A 1QD1A 2FSJA 4Y1DA 2WOMA 4X62J 4CZJA 1U45A 3RAQA 1MU2A 3RBDA 2IRYA 5HRNA 3LAMA 4U7UK 3IWNC 5L39A 4GMJB 2W1BA 1SAZA 2MKIA 1YDLA 3CW2C 4NLBA 1FF2A 2QTWA 2OTJS 3GYNA 3RW7A 3OTBA 3CMQA 2YKOA 1UAXA 5K8MA 4CFAA 4HT5A 3CCJS 3HOTA 2ZGYA 3D0GE 4P9SA 3K0JA 2GELA 3QESA 3ZTOA 1Q78A 2RPIA 3FEYB 2DKOB 1N33J 1RLDA 2W7OA 1U04A 4TSXA 4JYAK 4BDZA 1F60B 3HPGA 4C8LA 3TWHA 3EVMA 1F21A 5K14A 3CC7N 2HNZA 4TLRA 5JXSA 2Y0SD 3CJ4A 1WOQA 1XHZA 1VQNN 4ZCLA 3QEPA 3BQ1A 3M05A 4X62K 1SKSA 3BF1A 5ETTA 3LDPA 4WP8A 1RWNB 3ZT4A 1ZM2A 3M8PB 4IRDA 4DV3K 4DR7J 1OY8A 1PGZA 5JUMA 5D0GA 4M3RA 1VSLA 2HAFA 1KFSA 1AXQA 1N5VA 1YJ9N 4PKIA 2NXNA 1QVGR 2CPDA 4X84A 2F8TA 5ITHA 4H5RA 2D74B 1DQ9A 2NZCA 3D1OA 3I5AA 3ISZA 3L3UA 5FRMA 2M52A 4CJ5A 4LY7A 4A2BA 5F1XA 3VVUA 1KVIA 1DQAA 5F3TA 1LWEB 4RPFA 4EI2A 2DITA 4CHNA 2XMVA 1WNEA 4QAGA 5GAHI 3HP9A 2CKWA 3BN7A 1V3SA 4N56A 3QO9A 4B3TJ 1S1VA 4LF4F 3NH0A 2WZ1A 4Z7CA 1N6QB 3MR6A 2BA9A 5E7OB 1OIAA 4CLZA 5J1PA 5BPMA 2LMIA 2HMIB 2O8DB 2VJUA 1GOBA 2GZOA 2XMTA 4BC3A 3HK2A 5ETQA 1CULA 4LF6F 2O8FA 4A2AA 4W5NA 1EO1A 4QIGA 4B9SA 4YUDA 1RWWB 2F65A 3TW0A 2G8UA 5AE2A 5KT5A 4DU3A 4USJC 1RU2A 3BKTA 3V1RA 2WSCC 4G9ZA 5CZ1A 3EKSA 5DM6L 4A57A 4EYIB 4NA1A 5HMYA 3Q2TC 3H2UB 1DY3A 3UIQA 1RT4A 1VYAA 4K8RA 3MDQA 4WP9A 2DR5A 2R2RA 2D4WA 5GAHP 2KJWA 2NRRA 4K4WA 1D9DA 4DR4K 4WPAA 4OI3A 2CQ2A 3GV5B 4J5OA 2ZNZA 7FD1A 2ASLA 1TU0B 3GTYX 3W7BA 4Q0BA 3VAFA 1VAZA 1T95A 2H3GX 5K8NA 1PO6A 1GX6A 3TZXA 4DMNA 3CMAN 4HHUA 1CXQA 3O3FA 4DMZA 3M6GA 2CQCA 2OTLN 3RVCA 2JX2A 2R8GA 4KHNA 3UQSA 2RSQA 3VA0A 4NLWA 2BH1A 2W9BB 1NHVA 1Q1KA 3AA4A 2V4QA 2LKZA 1Y10A 3CCRS 2CPFA 1XMOJ 1O13A 1HNXJ 2VC1A 2XSJA 1GMWD 2KG1A 1FDNA 2RHKA 5AQHA 3PO5A 4RU9A 4BRMA 1RTHA 2VBXA 3VTIA 5HJYA 1D5AA 2HFOA 1RZMA 2R7VA 4C8NA 4DN9A 4YOWA 3DLGA 3E9LA 2P9NA 1J5OA 4YDUA 3D9BA 2VYPA 2KT3A 1NOZA 4UOHA 4C8KA 1VQMS 1UW9A 1XNQF 4WU3A 3SI6A 2GIRA 3MI7X 2R7OA 1RBAA 3MCOA 2B51A 2V7YA 2W9CA 4CJLA 3I0SA 3CNQP 3QBXA 1NHUA 2Z2LA 3MMAA 4ZK7M 4E3SA 4WTOB 3M8RA 3SDEB 4KFBA 3EXCX 2MKCA 3RSEA 4YORA 3QBWA 2Q79A 3FZHA 1SJ3P 1KQSR 3G6EN 2RIJA 3UD5A 3H98A 2WB1D 3GLJA 2Y1JA 5CHIA 1WF2A 2FTRA 2QFJA 2CWXA 3AVFA 3GR1A 2IA6A 1HKBA 1T6CA 1S5ZA 1JKHA 1ZZFA 2WBRA 1UJ6A 2VQFJ 1T03A 4K5SA 3ZSRA 3HSGA 4EU0A 4S0MA 4C23A 2YNGA 3D2WA 3FMWA 2UUCF 2Y1IA 5D15A 4Y2CA 3AVBA 1C0UA 1C0GA 4FW1A 1WG5A 2GIQA 2DB1A 3BSNA 1CLQA 3NMAA 4I0WA 4CEBA 1LWCB 4FWQA 1JK9B 4IKAA 5A8RA 1VIOA 5JS1A 1FD8A 1SJRA 1FW6A 2EXUA 3N79A 2Z8QA 4CGHA 2VF3A 1D09B 1KAXA 3LF0A 3OY9A 2I5JA 4CJQA 2BANA 3O08A 1HYSB 4UY85 4LF5J 2J5AA 1NGBA 3U7JA 3K5NA 3TAMB 3M6WA 5KFDA 3UD4P 3CSKA 4D3GA 4CIEA 5EOYA 4EIAA 2B7CB 3IS9A 4CK2A 1VQ8S 4WQ5A 1URNA 5EX0A 1OVQA 2N3OA 1VQLN 4WZQA 2C3MA 3MOJB 5E3AA 3L9ZA 2P9UB 2ZBIA 3H25A 4CBXA 4JKAA 3J80U 1SJQA 3HVAA 1K1QA 2AKWB 4OMFG 4ZVRB 3M7VA 2ZUAA 3OL8A 3CD6N 4A5BA 4DR6F 1HPZB 3A5MC 2R7SA 3ISNC 1M1GA 4DR3J 3BKUA 3DLBA 1HQUA 4LF5K 4OQJA 3SCXA 1O8BA 2EWSA 3B4MA 4NWBA 3C7NB 1TVRB 1LFWA 5E0OA 1F0XA 2OELA 2FY8A 5DO2A 2RKIB 1HX1A 2B7BB 2CZ4A 3VERA 4NLVA 2M8DB 4XDDA 3AVIA 3W66A 3RBXA 1ZS6A 4A48A 2NYIA 1UVNA 3ZT1A 1JQGA 4ZLPA 5LJ3Y 3S3MA 5KPZA 4Y34A 1YZ6A 3BSOA 1NK8A 1IKXA 1Q79A 3R3LA 4KKOB 1QJHA 1WI6A 1VFJA 4HLBA 3RG6A 2ZHOA 5HAOA 3TZYA 1S9GA 2QWNA 1RKIA 3KNAA 4WCEL 3P49B 4RWXA 2A40A 4Y3CA 1W26A 2FVPA 2Z57B 3DXBA 4ED1A 3WQUA 1KQGB 4TNOA 3KD5E 4XEIA 2DTJA 2HVHA 2HK2A 4J9SA 3KTQA 4X64K 4GMKA 4ELVA 5I9EB 1IBMJ 3ZTQA 4IQXA 1J27A 3NEKA 3O3LA 3CWJA 4DPXA 3PG9A 3V6JA 3ZZTA 4JOUA 1HNWJ 2KKZA 4C3MA 3M1VB 1VC5A 3CCUN 2G8HA 5M2RA 4NMLA 3SCKE 3OYLA 1PBAA 4Z7YA 2FY1A 3DYAA 4DR5F 1KDNA 1VQ7N 2K3KA 5D6GA 2FSKA 2XM3A 4FF4A 3AB4B 2CYYA 4ALZA 3FKBA 3CC4S 2VHGA 4UW2A 4LFCK 4DL3A 1F3FA 3SCJE 4FNHA 3SQGB 1KQSM 1HLUA 3MURP 1UJ4A 1U4BA 4P75A 2R7TA 4PA1A 3BF3A 4GVBB 4I69A 3UDVA 1IBMK 2HNDB 2QEXN 4FN5A 4B3RJ 1J5EK 2B6AA 3ENOA 1KLMA 4O0NA 1S1TA 5GMEA 4OI1A 1HR0J 5LMNJ 4USTA 1HNWK 3HHLB 1E6VB 1HFEL 4WIIA 3OYCA 5HQLA 3DXKB 4U9RA 2HRTA 1QQNA 2JC1A 2BE7D 2ROGA 3HFVA 1H2VZ 5C12A 4QYZJ 4QCLA 3R8EA 3TEHB 4M3UA 1QQMA 3QJPA 4X65K 2OHDA 5I3PA 4KH0B 4ZVPB 3DOLB 4Q44A 4KHPF 2OI2A 4TLQA 5KFPA 1MWMA 3D66A 1CJKA 4F3TA 5LT5A 5DLGA 1UTAA 5ETVA 2HBQB 4K4SA 3K58A 2D5RA 2M0GB 3CF5Q 4ECUA 2YKMB 1LNQA 3FJ2A 3CC7S 2I0XA 4RTFD 4DTSA 4L72B 4A8MP 1P9QC 4M3TA 4DX8H 1KAZA 4FJ5A 1QDUB 2QMUB 4B8AB 1WC1A 2V94A 3VWSA 1FFGB 4JKCA 4HUFA 3M4XA 4F4WA 3CERA 4CTAB 3FCVA 4CEZA 4O3QA 3PJ9A 4RWTA 1FT8A 4NASA 4NLDA 4NPOA 1YJ9S 2C22A 1OO0B 4IRKA 3C6TA 2QSWA 2GCFA 4EUVA 4B3MF 2BUPA 2E44A 4DU8A 1KS2A 2ZZTA 2ATQA 1NK6A 2P9PA 4IG0B 3PDNA 5AQQA 4PEOA 5SWMA 9RUBA 4E7HA 2LXFA 5FROA 2HZCA 3OTOF 3DM2B 1FTCA 3OYFA 3P83D 3KD1E 5KG2A 4E8UA 3F73A 2X3GA 3HHKA 3BH7B 2KM8C 2A42A 2R8HA 3B6BA 2D0BA 5ETLA 1ATNA 5I42B 4MMOA 3IM9A 5A2QY 1VQPN 2N82B 3DRSB 4ZCMA 1HL6A 3UI3A 3E66A 5EX3A 3ENVA 1B0VA 2B4VA 1XC3A 4I2PA 4FWNA 4WJBA 2AGOA 3HULA 4DV7J 3ZSQA 4RUAA 2E88A 4R0EA 3OSNA 2GVDB 4GKJK 2YKAA 3GOIA 2CJ9A 2FXUA 1HARA 2PFFB 4KHWA 5D8HB 5CCLA 3GBTA 1OJ4A 2CA9A 4KGZB 3MECA 4WZMA 1SBRA 4DFJA 4ID8A 1N34J 4CZMA 4B9VA 3UKRA 4AQYK 3MUMP 2UXDJ 2VFSA 4JKGA 2KG0A 3OYHA 4CJ7A 4FZZA 3JYTA 2MZJA 1G1XA 4TY8B 2CQDA 2NUHA 2BACA 3AGKA 3OLBA 4C4WA 4B3OB 2Y8YA 5AXLA 4DUYK 2EX3A 3KKRA 1R8CA 5LXYA 1CC7A 3IC1A 2FJVA 1OY6A 4KR0B 2V2VA 2HHHF 2BRKA 2B9YA 1NGGA 1NHKL 3KUEA 4X4QA 4CYUB 2YJFA 4DV7K 2MMYA 3CMAS 4RU2A 1VHIA 3FBFA 4YR3A 4OHWA 3EGNA 1WEZA 4RW4A 2YHAA 3SZ2A 1D8ZA 2EG2A 2RUGA 2LFVA 2X1AA 1I94F 4JS4A 1NGFA 1U1LA 1ZBUA 3P5JA 3MXHP 4FBTA 1N34K 3RAXA 2YJEA 1RGIA 3V6HA 4ZLNA 2HBLA 4KI4A 3MUTP 5KG0A 3F41A 2CPZA 1OPIA 4TXSA 2PFDA 3K8WA 2COLA 3LO3A 3AA2A 3MAAA 2DJWA 4DG1B 3MN9A 4DCPB 3SBTA 1NLVA 2CNLB 1WSJA 1URRA 2YBVA 1RTJB 5G0RB 4CIGA 3JS9A 4DL6A 2Q6BA 3UCZP 1UOCA 3TANA 1ZBSA 2GV9A 2CVEA 4A62A 1KVAA 4KSEB 1U2RA 1X1PA 3V2UC 5JVHQ 4I4BA 2JVOA 1YQHA 2MZ1A 3H4DA 4Z2XA 4FWRA 3K2YA 1TV6A 4IFYA 2G0CA 3MM5B 3T1YK 4YEAA 4DHVA 3KHGA 4ZPTR 1HKCA 4P10A 2PAVA 4ZPDA 2UV8A 5EWFA 3ZX0A 2E2NA 4DU1A 4LFBF 3J7ZO 1G4CA 4YFUA 4TU7A 3LDLA 1TQLA 4TQSA 4URQU 2ZWOA 4QR1A 3CJ7A 4X4OA 4O5FA 4WFNQ 3C2PA 4GW6A 3BGUA 4M5IA 5C24B 2YX7A 2BQUA 3FRYA 3O9SA 4WFAQ 2VG7B 3WNGA 1MWZA 2GNKA 4ZDNA 2Q0RA 4JI0J 1QUPA 2MKKA 4RW9A 1T11A 3G2XA 4N5SA 5BPLA 4UUWA 2I9SA 4JRQA 3QT7A 4PWDB 3U9ZA 1C1CB 1UWBB 2CADA 3AFGA 2KI2A 3ZZRA 2DNQA 3AODA 5CHCB 4YB1P 3QIOA 1Y11A 5BR8F 4J91A 3J81O 3OTCA 4O3RA 4JI8K 4O4GB 2HOEA 3O3GA 1KOOA 4BRKA 4DV6F 1H38A 3R5CA 1VSJA 1DKGD 3GILA 5KG7A 1ZA1B 4JLHA 4DF4A 2AZ3A 1FRMA 4W4MA 4H0YB 4HHJA 1VQ6N 2C42A 1YTYA 4USVA 4YY3F 4ES2A 1IO2A 4RR5A 4DZDA 5J1NA 3M8QB 3J7AP 4FPRA 5KOWA 4F3MA 2DFEA 4JI0K 1KD1T 4ZLLA 1Y00A 2KHOA 1YITS 4UOGA 4KQZA 4W90B 1LWFA 4BC5A 3QEIA 4ZVQB 4JV5K 3F56A 2W6KA 3T1AA 4BE1A 3Q7CA 2PO4A 3MEKA 4I2QB 2YV0X 4X4UA 1AT1B 3O1WA 4FYWB 2DXFA 3QNWB 4FJHA 2JVRA 4Q7AA 4EYHB 2P9SA 2VDIA 3CD6S 3DHXA 2P2CB 4C98A 5AZJB 1BCMA 2CQHA 2RQMA 2YKPA 3KDOA 2KT5A 3D5MA 3UKUB 2Z2YB 3QINA 4MLEA 2AEJA 3IMQJ 2XY7A 2CJKA 3EKUA 1TL7A 2EFPA 4W5QA 3JSRA 1SQKA 2RNEA 3MM7A 3J7A1 3ZXWA 4KGKA 4W98A 1NKCA 5LMUF 3O4WA 5AQWA 3Q86A 3EL2A 2HQCA 1YJTA 1B70B 3LM2A 5HN0A 1NDCA 3H08A 3SSQA 2E1PA 2HZAA 1JLQA 3M30B 1S7IA 3JAMY 2QYCA 4NCBA 1ZM4A 1DAXA 4NCAA 2HFNA 2O4IA 3HHLD 2PMZD 3QZ8A 4CF2A 3MEGA 4DS4A 3UO0A 2RF2A 3ZZUA 4U7UD 4ZLJA 7FDRA 5CCMA 3ZZYA 4DSLA 4A61A 2RU3A 5IQQA 1CJTA 1UFKA 5EY4A 1ZBHA 4A4JA 3KVGA 4HKQA 2P9KA 3L4QA 2LQ8A 2CWKA 1ATRA 1T44A 4E98A 2QL9B 4MK7A 3E2EA 3TTCA 4I9QA 1X4AA 1UEKA 2F4FA 1XNRJ 4LF8J 2G8WA 3L2QA 4CJFA 2HSEB 1YGYA 3HPHA 2QA1A 5TKWA 2K06A 1SPBP 5KT2A 1R8AA 4M3XA 5CY4A 1Y4ZB 1IBLF 2Q6CA 1ASVA 4FPAA 4J9RA 2AGQA 2GUPA 2G0IA 4ECXA 3W9JA 1F1BB 2Z0GA 3CJ2A 5K8OA 1HKAA 3CFPA 4BR2A 4DV1K 3FQKA 1EB0A 3R3TA 5AJ3J 3PRBA 4JAXA 3U02A 1CLFA 4G3IA 1RDDA 3E8OA 7AT1B 2J6UA 1UVKA 2J8SA 4H5VA 4NLOA 4U96A 1WSHA 1YKWA 2RUSA 4L3KA 4F4XA 2D0PA 3THWA 1DARA 2KXHA 2YPYA 3HPOA 3GDQA 2PN6A 1H73A 4FLWA 1HBNB 3SYZA 4L73A 5ELZA 1M5VC 5RUBA 1RXOB 4IZ9A 2O3DA 3EDQB 3I31A 2QEXS 1M1KT 1YX2A 3M2RB 4KGMA 4CP5A 2YHWA 1HNZJ