1REVA

Hiv-1 reverse transcriptase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of HIV-1 reverse transcriptase complexed with 9-chloro-TIBO: lessons for inhibitor design.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 145
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1revA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1revA05
4HCCA 2I5JA 4RW4B 1HQEA 4ZTJA 3OYLA 1RYRA 3KD5E 4O55A 4HYKA 1VSJA 3K5NA 4FK4A 4FJLA 3HKWA 1A5XA 3TAPA 2W9BA 5J2NB 3QEPA 2YNIA 2AGOA 2W8LA 4J9KA 5DLGA 5JS1A 2XGPA 3THVA 1HNIA 4IG0A 2RF2A 3WNFA 1GOCA 4Z4EA 1RNHA 3NH2A 4OPKA 3M8PB 4I2QB 3NAHA 3P1GA 4B9NA 4WE1A 4M45A 3AVBA 1S1UA 3SJJA 1ZBFA 2IAJB 4KHMA 4ZVFA 4KBIA 1JXEA 4B9VA 1TGOA 4W5OA 2HNZB 2QKKA 3IG1B 1SL2A 2WONA 1IKVB 3ZCMA 2BE2B 2DFFA 2FBVA 5KFFA 5KFNA 3V6JA 4KSEB 4DS5A 4J9OA 1KLMA 2GBZA 4DSEA 3N6NA 4FZZA 5KGWA 3KLHA 4R0EA 1U45A 3DLKA 1WNEA 3OLAA 4K4SA 1S1UB 4B9LA 4ZPAA 3PJWA 4DS4A 3ZT0A 2R7YA 4Y2AA 1TKDA 4NLGA 2OA8A 4J9LA 1C6VA 4K4WA 4CESA 4DG1B 1U04A 4J9NA 3HJFA 4NLTA 2ZE2A 4FJ5A 3S3OA 3HVRA 5F8IA 4EO8A 4ED8A 1HJRA 3HL8A 4TN2A 3EPGA 4YR0A 1LW0B 1LWCA 5J1EB 2BGGA 4H4OB 3V6DA 3VQ4A 1LW2A 4EBCA 3LWLA 1LWEB 3C6TB 3KJVA 3E51A 3RMCA 4FJ8A 3KLIA 1QSYA 2DPIA 4FS1A 2UVRA 4CFBA 5KG7A 4FJIA 5EWEA 4RW7B 1NJYA 2FC0A 1J54A 3TARA 3OYJA 4JUZA 1RDRA 1RTJB 4R8UA 3O4NA 5KG6A 4H4OA 3NH0A 1BHLA 3KKRA 4CGFA 3PO4A 1S1WA 4WXOA 3QESA 4E7KA 1ZBLA 4URSA 3OYIA 4O44A 3KLIB 4Q5VA 2FJVA 3KHRA 3V9XA 1CZBA 2W7OA 3BGRB 3AVMA 1T05A 1RT1A 4GMJB 3KK3B 3RBEA 3I0SB 4XIUA 1RAJA 3S3NA 5KFKA 5KFOA 3JYTB 4Z0UA 4IG3B 2HMIB 3PX4A 4R8UB 5EWGA 5KFYA 3QEIA 3C6UA 4FS2A 3RAQA 1SH3A 1MMLA 3G6YA 4CF1A 3LP1A 2ATQA 4XPEA 1VSFA 4CHOA 3NE6A 3DLRA 1EETA 1KLNA 2OPSA 4RW6A 5DQHA 3K2PA 1X9MA 4CECA 5J2QB 4Q44A 4C8LA 1L3TA 3SI8A 5KFQA 3MECB 1I6JA 4W5NA 5C5JA 4ID1A 5J2MA 1C2PA 1A5VA 5KFEA 3OHAA 1HYSA 4YP3A 4KO0A 5L1JA 4KHSA 4E7LA 4YMEA 5KFMA 4CFCA 4E7HA 2FLNA 2P51A 4F4YA 1MU2A 4B9MA 2DY4A 5KRSA 1RT5B 4EZ9A 4J9SA 1TQLA 4NLSA 2UVWA 1K1QA 3CM5A 1VSKA 5KFZA 3GILA 4H4MB 2A1RA 3T5LA 4ZP9A 5DLFA 4LQ3A 2HHTA 2QK9A 3RR8A 4BDPA 2F8TA 1O1WA 3HHKA 4IRCA 4F2RA 5HRPA 4J9QA 1HYVA 2WOMB 4ED7A 4BDYA 4CJTA 1JXLA 5EWFA 4CHPA 3KOAA 1TK8A 2PYLA 3SQ0A 4FM0A 1K1SA 3ASMA 4QPXA 1VSMA 1RILA 1S0NA 1S1WB 4N47A 4E3SA 5HLFA 3M8SA 4ZPDA 2OPPA 4K4ZA 3AVKA 3N6LA 1WSEA 3QGIA 2F8EX 4DTOA 3VQQA 3K5LA 4F3OA 3FSIA 4KHUA 3D0PA 4DTPA 1NKEA 3SUOA 3DMJA 3T5KA 1T7PA 2BANB 1XWLA 2E9TA 4RW8A 3S9HA 3NGIA 3BQ1A 1J9AA 3GV7B 1VRTB 5C25A 4ZP8A 3DRRA 4TYBA 5DMRA 3RB6A 2PZSA 2YNGA 1HPZA 1SH2A 3GV5B 3LP1B 3IS9B 2RF2B 2FVRA 4KHNA 5HRRA 2D0BA 4OPJA 1NOZA 3BR9A 1RTIA 3MECA 4KI4A 4CF8A 4JS4A 1C0TB 4IQXA 1XR5A 3L2UA 3KK1A 2LSNA 4O3RA 3ZSXA 1D8YA 4CF2A 5KFDA 1VRTA 3UQSA 3HVWA 4J9MA 3H2LA 3PX0A 3EZ5A 4KB0A 2XI2A 1U48A 1UWBA 1JLCA 3QETA 3RWUA 2VG5A 1HMVB 3KLFB 5CYQA 4JS5A 4Q45A 4ECYA 3IRXA 2OZSA 4NLPA 2YV0X 4CJFA 4FJGA 1ASVA 4O3NA 3IN5A 3PO5A 3EZUA 2OYQA 2GV9A 2HHQA 4ECQA 1RT7B 2ILYA 4IH7A 3K58A 2XGQA 1LAWA 4DL4A 4CJWA 4Q43A 1ASWA 3NAEA 3FQKA 3CJ3A 1TK5A 2QXFA 5I3UB 4KREA 4TQRA 3M9MB 3BSAA 2XY8A 3MXIA 4NYFA 1WSGA 3SUNA 1L3SA 1IKWA 3GIIA 4F3TA 4K4VA 3DLEA 4KFBB 5DGAA 4O3PA 4HUEA 3TANA 1FKOB 3CQ8A 3ZT4A 3VQDA 1SL1A 1IKXB 3KLEA 4CEFA 4PA1A 4DFJA 2HWHA 3DLGA 2WHOA 5KGXA 1BCOA 2B5JA 3DOLA 3V6DB 3RMDA 3SV4A 4DFMA 1HQUB 1C1BB 3OJUA 2R8IA 1JKHB 3MEDB 3ZT1A 5KT2A 4MIAA 2C2EA 3P83D 5KFBA 4MK8A 5KFHA 2OH2A 2XY7A 1SKRA 3NGZA 1TL3A 1TKZB 1FKPB 3NGDA 3OL6A 1IG9A 4CIGA 3NCIA 3D28A 4GC7A 4M3YA 4ZP6A 4R5PB 3ICLA 4AHSA 2YNGB 2IC3B 3OL9A 3HPGA 5T14A 5HP1A 1VSLA 2KFNA 4B8AB 2G8UA 3H59A 4NYZA 3HXMA 2PYJA 4ZMMA 1NK5A 5KFIA 4QWBA 4ECWA 2Y1IA 3DM2A 1RTIB 1HQEB 1XHXA 2DFEA 4KAIA 4FZXC 2FVQA 2R8HA 3V81A 4I7FB 4QWAA 1VK0A 2F96A 4QCLA 1B92A 4CCHA 5J2NA 3UPFA 2D0AA 2AJQA 3NBPB 1CSJA 4E0DA 3T1AA 3C95A 3VN5A 1TVRA 2R2UA 5DK5A 3HPHA 3RTVA 3LP2B 3EY1A 3NDKA 1S97A 5K14B 2IM3A 4M3UA 4DF4A 2G8VA 3OLBA 2GIRA 4J9PA 3RRHA 1RDDA 1KSPA 1FKOA 3G10A 5KFSA 1KLMB 2IM0A 3BJYA 4Z4GA 1LWFA 3DLGB 2B5JB 4PWDB 3QGGA 2EC0A 1S1XA 1S1TB 4IOBA 4ECTA 3NKYA 2WTFA 3DI6A 3V9UA 4M3WA 4ZHRA 5DQIA 2WK4A 1ZYQA 4FJJA 4KB7A 1NHVA 1WSFA 1FXXA 3AA4A 3GIMA 2UVUA 2HWIA 2HNZA 1NJZA 3AVIA 3K59A 2IOCA 3SNNA 4KHRA 1CLQA 4IRDA 4L8RB 1BCMA 5KRTA 4ELTA 2HAIA 1JLAB 3I5CA 3AA3A 3CJ2A 1HRHA 4RW9B 1LWEA 5SZTA 4YR3A 5HP1B 4ECZA 4KTZA 3ULDA 1JLEB 1RBRA 4ZHRB 1IKYB 1N4LA 3VQAA 3SYZA 1RTDB 2E9RX 4AILC 3MFHA 4HTUA 5KT3A 2G8WA 4ECUA 4ZPBA 1BI4B 4FM1A 3V9WA 4LH5A 3QGHA 1TV6A 4ECRA 2ZE2B 1G15A 2JGUA 3BSNA 4ECXA 1VSIA 1RT2A 4ELVA 1WAJA 5JXSA 3MR3A 1RTHA 3T5JA 2YNHA 5KFPA 3ZSZA 3PZPA 3RAXA 4NLUA 1QSSA 4ED6A 4TY8A 3QEWA 2YHBA 4MKBA 4FM2A 4C8NA 4FJHA 2HVIA 4X2BA 3BQ2A 1CZ9A 4RW7A 1YVFA 5HBMB 4JRPA 5KTQA 1UAXA 1NJXA 4RNOA 3OJSA 1BQMB 3MEEA 4BWJA 1RTJA 3LAMA 3SFGA 3M8QA 2OPQA 1CXQA 4ZP7A 4NCGB 1JX4A 4NZ0A 1JXBA 3PV8A 2QE5A 3OS0A 3IRXB 5KFGA 3HM9A 4CGHA 1XHZA 3AVNA 4PWDA 2JEFA 1RT4A 4M95A 1RT1B 3AO1A 3KLGA 5L1IA 3KK3A 4URQU 3M9NB 1NK7A 4FLTA 4IRKA 2FBXA 2D7SA 4Q0BB 1RDCA 4IG3A 2HMIA 4J2EA 4ED3A 1JL1A 4FJMA 2G8KA 3VQ9A 1U47A 4DLGA 2OPRB 1L3UA 1NNDA 3ZT2A 4CFAA 5C42A 4CERA 1HNIB 4IG0B 2E6LA 4LSLA 3AVAA 4O4GA 4WE1B 4MH8A 3OYNA 3DYAA 1HYSB 2J6SA 3H4DA 2Z1JA 3K57A 1TKZA 1C1CA 4OJRA 5FRNA 3IG1A 3KK2A 4E7JA 2OPRA 2P5OA 4RNFA 3RB3A 1IKVA 4CGDA 1R0AB 2B6AB 2BE2A 3E01B 2FBYA 4LQ9A 4E89A 4I9QA 4HUGA 5DGBA 4OGCA 4I2PB 4C8MA 4NLYA 2FVSA 1S0MA 3SQ2A 4EZ6A 4FLXA 1T3NA 2JC1A 4WFXA 2Z1IA 4DSKA 4CJ3A 4FJNA 5F8HA 3ITHB 2DFHA 2W9AA 2VWJA 4TY9A 4DLEA 4PY5A 5KFXA 4QAGA 4DMNA 4JV2A 4F8RA 1D0EA 3AO3A 3DM2B 4CEBA 4MKAA 4KRFA 4JRQA 4M3RA 3LP0A 1R0AA 3QIDA 4ED1A 4G3IA 4NCAA 2B4JA 4FYDA 4TLRA 1RYSA 4WFZA 4NLQA 5T7BA 3SFUA 4EYIB 4B8CA 4CEDA 3HVTB 5DG9A 3NBPA 4FLUA 1X1PA 5EDWA 1I39A 2YNIB 3KD1E 4NLOA 1TK0A 5KG2A 2NUBA 1N6QB 1XR7A 4K4TA 3V1RA 3KLGB 4K4YA 4G1QB 2XO7A 3QIPB 5D3GB 3L2RA 3HSTB 2ETJA 3U6FA 5F9LA 4AHCA 4DFKA 3G86A 1TL1A 4CJRA 2W42A 4KPYA 2BR0A 4W5RA 1S6PB 4MK7A 4N56A 4M3XA 3Q8PB 4M94A 3CJ0A 3PHEA 3OHBA 1L3VA 1N5YA 1BIUA 3DLHA 4FZYA 4N76A 1U09A 1RT7A 4CHYA 3CWJA 4MIBA 3G0ZA 3NFAA 2JC0A 4ED0A 3U3GA 3ZSVA 1BQNA 3MFIA 1VSDA 1XC9A 4E1MA 3OYEA 4B9UA 4ZVEA 1EKEA 4DQSA 3ZSQA 3DLEB 4HKQA 1RA6A 2V4RA 2ATLA 2A1SA 3OYMA 3KK2B 4FLVA 1IKXA 3KLEB 1QS4A 4FK2A 3AVGA 1QE1A 1TKXA 4JV0A 4GVMA 1HNVA 1W9HA 3AA2A 5DG8A 1HMVA 2YNFB 3L2VA 3LP3A 1FK9A 4RW9A 5F8GA 3BDPA 2JEIA 3M8PA 4I2QA 4WYLA 3TAFA 3AVJA 3DRSA 3KHHA 4DSJA 3QLHB 3Q8QB 3H40A 4OLAA 3CM6A 1JLBB 2R2TA 5KFVA 2ASDA 4CF0A 4FLWA 3PW7A 3I0RA 1BI4A 3OY9A 2W9CA 2RN2A 1JLFA 5I42A 3VQ7A 4ELUA 2HHUA 2HNYA 3KLVA 1S9GA 4BE1A 3CVKA 4KV8A 2RDJA 4CEQA 5DG7A 3MF5A 2CJQA 4KTQA 5KFUA 3LANA 5KFAA 4NRUA 4Y1DA 1DTQA 1JLGB 4F4XA 1WLJA 2F8SA 2IJNA 4TY8B 1RT6A 2VG7B 4OGEA 3WNGA 4J2BA 3PVXA 4IH6A 2AGPA 4IKFA 2R2RA 1Q8IA 3UIQA 4FBTA 3AVCA 1JLFB 2C22A 2P5GA 3V6KA 1S9GB 2PY5A 3LWMA 1RT3A 1D9FA 3MEEB 3AO4A 4KV8B 3PW4A 3TAQA 3SQ4A 3LAKA 4NLRA 3VQ8A 3QYYA 3BREA 1LWCB 2XRIA 2G8FA 5CZ2A 1NHUA 4PQUB 2JEGA 4CE9A 4EP5A 1T94A 1DTTB 1D9DA 3H5SA 1SV5B 1GOBA 4W5TA 5FDLB 4U6PA 2OPSB 3SUPA 1X9SA 4CF9A 3SQ1A 4NLWA 3VA0A 1KCFA 1NOYA 4RNHA 4EEYA 4Q0BA 3AA5X 1ZTWA 4PUOB 2AU0A 4IR1A 4IFVA 1BIZA 3TAMB 4EBEA 2IJFA 3T5HA 3RMAA 1HYZA 1C0UA 1Q9YA 2R8JA 3U3YA 1RCHA 1QE1B 4DL5A 3CFPA 5JUMA 4HCBA 3K5MA 4IDKB 3PW2A 3QZ7A 1S6QB 1DTTA 4B08A 3HK2A 1FK9B 4EP4A 3PW0A 4QW8A 4DTNA 4LSNB 3ZT3A 4K8XA 2RKIB 4DTMA 5F9NA 1LAVA 3O4QA 2AX0A 4CEZA 2P1JA 2EX3A 4CEEA 3KK1B 3DYAB 1EXQA 2HVHA 1CXUA 3HPOA 3I0RB 4CHQA 1KVAA 3C6UB 4O0IA 4CJUA 1Y97A 2B6AA 2G8IA 4ED2A 4KHWA 2KW4A 3AVLA 4F50A 1JLAA 4DL2A 4E7IA 3VQEA 4N41A 1UA1A 1KHVA 5KFJA 2HHSA 3KMQA 1S1TA 1DTQB 1JLGA 1IM4A 1JLEA 5HRSA 4HVJA 5HLFB 2O5DA 4KE5A 3NH1A 1JIHA 3K5OA 2HNDB 4DEZA 1NK0A 3SZ2A 2VA2A 3VQBA 3LP0B 3IAYA 4OKKA 1MU2B 4W5QA 4DU1A 1L5UA 4O3SA 4FK0A 3KLHB 4AHRA 1RTHB 3WNHA 3OL8A 1WSIA 3CO9A 4H4MA 5C25B 4CK2A 4DTJA 3DLKB 1DLOA 2VG6B 2YKMB 1C1BA 1HPZB 3GV8B 2HHVA 3OYGA 4OVLA 3PW5A 1NK9A 3RB0A 5CYMB 3H5UA 1T05B 4CEAA 3MEGA 1OS5A 3PR5B 3RR7A 4DG1A 4AHVA 2UUWA 3UR0A 2ALZA 2C2RA 2WOMA 1C0MA 1FKPA 2FJWA 3SPYA 4DQRA 1C0TA 1TV6B 4IFVB 2HW3A 1KHWA 2FBTA 1S6PA 2QV6A 4KI6A 1IO2A 3M9OB 3MXMA 4XO0A 3RRGA 1S1VB 3SPZA 3QINA 5HROB 4IDKA 4KKOA 3IGVA 4WFYA 1XR6A 2X6NA 3H5YA 4CJVA 4OLBA 4KHQA 2BQ3A 2OZMA 4YNQA 1KRPA 4RG8A 2DPJA 3CDWA 5KFTA 2JEJA 4ECSA 3LPTA 3EYZA 2RKIA 3V9SA 4EBDA 4RW8B 3QIOA 5KG4A 4ID5B 1RBSA 4M3ZA 2HB5A 2XWYA 1NKBA 2IGIA 3GYNA 2WONB 1YTUA 3CIZA 5KT7A 3TR8A 4E19A 1S4FA 1RBTA 1GX6A 4QW9A 2XY5A 3IS9A 3B6OA 4QWDA 3I0SA 3TI0A 1W25A 2BQUA 4J9RA 2UVVA 4B9TA 1RT4B 5KFWA 3CYMA 1HQUA 3DOKB 4KB1A 3T3FA 3AVHA 4O5BA 5KG3A 2AQ4A 3HO1A 2QKBA 3MEDA 2R8GA 2Q3SA 3EPIA 1JLBA 4ID5A 4Q8FA 2GIQA 2AWZA 1RBVA 5I42B 1GX5A 3NF6A 1HARA 1J5OB 4URGA 4NLXA 1TL3B 1REVB 4CFDA 3GQCA 4OL8A 2KZZA 5E41A 3TAEA 4FLZA 5CYQB 3ISND 4CIEA 4RW6B 5CZ1A 1LWFB 1ZETA 5J2QA 3ZSWA 2IBKA 2BDPA 5F8MA 2R8KA 2J6TA 3QNOA 3B6PA 3JSMB 2HHWA 3FRZA 1B9FA 3QO9A 4DF8A 3VQ5A 3M8RA 1D5AA 1SL0A 1WSHA 4YR2A 2D41A 3NF8A 4DTXA 4NLVA 3H5XA 4DU4A 2AX1A 2IM2A 4WZMA 3Q8RB 3V81B 2BANA 1YT3A 3TQ1A 5JS2A 4CK3A 1NJWA 1NKCA 4IBNA 3KTQA 3H98A 4M41A 4IKAA 1A5WA 4N5SA 4CJQA 3RBDA 4IFYA 4KKOB 3PR4A 3HP9A 2GUIA 2X6SA 1U49A 2R2SA 4CJ5A 4FJXA 2YHAA 1TVRB 1RTDA 3QIPA 5D3GA 4NLDA 2FLPA 2WB4A 4O0JA 4IH5A 4PUOA 2B43A 5SWMA 4BE0A 4HUFA 4M42A 4DTRA 1C0UB 4YQWA 4H8KA 2IC3A 2GC8A 2Z1GA 1JLQB 2ZD1B 4B3OA 4WZQA 3QZ8A 3SCXA 5KT4A 4ICLA 1S0OA 1QAIA 2AGQA 1EETB 2D3UA 3IGNA 4BE2A 1S49A 3OYHA 3L3VA 3MR2A 2IM1A 4CJEA 3A2FA 3ZSYA 3SUQA 3CJ4A 4QWEA 1S5JA 3GIJA 4BWMA 3V4IA 2W7PA 4Z4HA 2JLEA 1QTMA 4H54A 3FDSA 3NL0A 1QSLA 3VQCA 4LD0A 2EHGA 3CDEA 1BGXT 4KAZA 1SKWA 4CGJA 4ZTFA 4MQ3A 2E4LA 3LDSA 3LZJA 3FFIB 2Z1HA 1Z25A 2IMWP 1WNSA 4O4RA 3AO2A 1BISA 3QLHA 4CGIA 4FVMA 4FJ7A 3GIKA 3AO5A 3T19A 1D1UA 3CFRA 2WCXA 4TSXA 1IKYA 3OSNA 2W9CB 2FJXA 2IAJA 3BSCA 3OYAA 1GOAA 4GC6A 4BACA 2BRLA 3OSPA 3MR5A 1EP4A 1I3AA 1KFSA 3HVAA 3BQ0A 5C42B 2IDOA 1RT2B 2XCPA 3VQ6A 1S1XB 2W8KA 4EO6A 2ITGA 4J2DA 4LSLB 3OVNA 2VG7A 3LPUA 1EX4A 4DSFA 2ZQBA 4TQSA 1BL3A 2D3ZA 4RU9A 3DRPA 5J2PB 1J53A 3MEGB 4Y3CA 3ALYA 3KHGA 3NGYA 1IKWB 4K8ZA 1RT3B 3HT3A 3AV9A 3KKSA 4UQGA 3TVKA 3DDKA 1TP7A 3QERA 2V9WA 1TAUA 4I2PA 2OPQB 1K6YA 1S1VA 5KFCA 4JLHA 5EU7A 1S10A 4CJKA 4ZPCA 1S9FA 3PX6A 1LW2B 1LV5A 3PY8A 1RBUA 4FJKA 3JYTA 2YKNA 5K14A 1S48A 3HP6A 4DTSA 3V4IB 1T03A 3TAMA 3RB4A 2C28A 4Q8EA 5C24A 4DSLA 4K4XA 1ITGA 4Y1CA 1S9EA 4F4ZA 4Z4IA 3BSOA 3DLBA 3KLFA 2V4QA 1QQCA 2FVCA 4Y2CA 4DSIA 3BGRA 2XC9A 2E6MA 3DOKA 3D45A 4G1QA 4MFBB 3V6HA 4DWIA 5J2MB 3V9ZA 4ZVHA 2HHXA 5I3UA 4KO0B 2Y1JA 3ZSOA 4DQPA 3ZSRA 2KTQA 5F8JA 5KI6A 3L8BA 1REVA 4TYAA 1C1CB 5KT6A 3VQPA 4FXDA 2W9BB 1EP4B 5HRNA 3E01A 2V0NA 1NK8A 3MAQA 2IS3A 1S6QA 1N5YB 2D5RA 3LP2A 3NHGA 4C8KA 1ZTTA 4NRTA 4CHNA 3JSMA 1JKHA 1KTQA 3ITHA 3G6VA 3QO9B 2HNDA 3DRPB 5J2PA 5F8LA 1QHTA 3VQSA 4RUCA 3FQLA 3QEVA 3N6MA 5KFRA 4FW1A 3MTKA 3H4BA 4I9LA 1KVCA 4JV1A 4EYHB 4WXWA 3OYKA 4FBUA 4TXSA 3TABA 3V1OA 1UA0A 1HNVB 4LY7A 4AH9A 3SV3A 4F2SA 2FVPA 1DLOB 4CJ4A 5KG1A 1U4BA 1SUQB 2YNHB 1F21A 3OL7A 4IFYB 4DQIA 2WRMA 3PJXA 4M3TA 3L2WA 5KFLA 3NF7A 1N6QA 3L3UA 3CG7A 1QUVA 4Z4FA 2YKNB 3QNNA 4ECVA 5HBMA 4K4UA 1WN7A 1XI1A 4DL7A 3C94A 5KG5A 4CJLA 4I7FA 3ISNC 5C24B 3AVFA 5KG0A 2KQ2A 4NCBA 3M8QB 4WYWA 4CJPA 3KIOA 2DTUA 1SUQA 4KTWA 1T8EA 1WAFA 5HROA 2G8HA 4DL3A 1TAQA 2RPIA 2VG6A 2YKMA 1QAJA 1ZBUA 4ICLB 3H08A 3LZIA 4F4WA 1VSHA 5CYMA 2BRKA 1VSEA 3PUFA 3V1QA 4B9SA 5EUHA 1RA7A 2XCAA 1BQNB 4GW6A 4KHYA 2J6UA 1WSJA 3TAGA 3DMJB 2UUTA 4MK9A 2X74A 2ZKUA 1ZBIA 4Y34A 4Z4CA 3HYFA 3HVTA 2ASJA 3MXJA 4CEOA 3DRRB 3RMBA 2CKWA 4LH4A 4DU3A 2XI3A 1ASUA 4FCYA 5FROA 1TKXB 3WNEA 4O44B 1SKSA 3OYBA 3FFIA 1RDBA 5FDLA 3DI6B 1TKTA 1NK6A 3Q8SB 4J2AA 4RUAA 4FLYA 4XPCA 2I5JB 4RW4A 4CJSA 4CGGA 2VA3A 3NMAA 3OYCA 3G6XA 3OS1A 3OS2A 3KMSA 4KFBA 3CJ5A 4NCGA 4QWCA 3NF9A 1N56A 4OKJA 2HNYB 4RNMA 2XY6A 1UWBB 4DQQA 1JLCB 4OKEA 3VA3A 1Z4UA 2VG5B 1SH0A 4RNNA 3DOLB 5L9XA 1YVUA 4YFUA 2E9ZA 3F9KA 3S3MA 1TKTB 3OYFA 2ASLA 3D5MA 1UOCA 4LSNA 4K50A 4BDZA 4CK1A 1RT6B 3OYDA 2IA6A 2C2DA 4F4KA 3CDUA 3SI6A 2FLLA 3I5BA 2XHBA 1KVBA 4AHUA 1J5OA 2I1RA 1VRUA 4U7CA 1RT5A 4ZVGA 2YNFA 2VWKA 3UDLA 4R5PA 4O3OA 4NYNA 3KNAA 1Q9XA 4O4GB 4HHTA 4PQUA 5F8NA 4C8OA 3O3FA 3TWHA 4DFPA 3DRSB 5L1LA 5CY4A 1IH7A 1NK4A 1RDAA 4CHZA 1SV5A 2RDIA 4QOZB 4O3QA 5DQGA 1YTAA 5KT5A 1X9WA 2ILZA 1T03B 1BQMA 2KZMA 1VRUB 1N48A 3P5JA 4FW2A 4CIFA 3KHLA 4FJ9A 3MR6A 1TL1B 4RZRA 4DTUA 3L2QA 1LW0A 3O3GA 3F73A 5J1EA 1S9EB 4AHTA 2D0CA 2O4GA 1JLQA 4IR9A 1KFDA 2ZD1A 4B3OB 1Z26A 3I8DA 1B9DA 5FRMA 3NAIA 3QEXA 3C6TA 3KJVB 4E1NA 1ZBHA 2O4IA 2BQRA 2OPPB 1JL2A 3CFOA 3LALA 4DL6A 1C1AA 5L1KA 1W0HA 3I5AA 2X78A 2KFZA 3O3HA 4MFBA
chains in the Genus database with same CATH superfamily
1XMOJ 2I5JA 4RW4B 4MLHA 5TKWA 4DV7J 4ZTJA 2OMLA 3GL1A 4WWSA 4F0HA 1C0FA 5DRKA 4O55A 3QPIA 4OJ3A 4DCHA 3IXQA 3TAPA 4IZ9A 2DGOA 4YDDB 2QFJA 2YNIA 2FSNA 2W8LA 4ZITA 2RT3A 1M5SA 2Y0BB 4KC5A 5JS1A 4IG0A 1FTRA 4IUFA 4Z4EA 2A5XA 3GFXA 4OPKA 4I2QB 3NAHA 2F7VA 4M45A 1JB0C 4OX7A 3AVBA 3PXGa 3VERA 1ZBFA 4KQZA 2R7VA 2IAJB 4KHMA 4LUBA 4R79A 4KBIA 1GAOA 4DV0J 4W5OA 1SL2A 3VALA 3TZXA 2FBVA 3CSKA 4JHDA 5RUBA 4P2XA 1IM6A 4FWKA 4MKVA 2FGCA 4P7TA 2NR0A 3SSRA 3H3OB 1U45A 3DLKA 3ZZOA 4ETXA 4JI7K 4FPBA 4P2FA 3PFEA 3SQGA 4B9LA 4ZPAA 3KDNA 2VQFK 2KG0A 4NLGA 1NGFA 2OA8A 4DR3J 4K4WA 2PGCA 4DG1B 1FX4A 5F0WA 8AT1B 4I6WA 2V7YA 3PRBA 4YR0A 3OUYA 1I94F 1YHQN 1WC4A 1KOOA 1QAYA 1QM9A 4AM7A 1BLUA 4IOAL 2O8DB 1EX8A 4A8OA 4FS1A 4AL6A 2UVRA 2HK2A 3H42A 3O4WA 1EQYA 3CJSA 1HBNA 3DRXA 1J54A 5A2QO 1OYEA 1RTJB 2HS3A 4QIFA 3O4NA 3GONA 4JD2A 3OTCA 1U02A 5A8RB 4H4OA 3CW2C 1ZAWA 3NH0A 2HLUA 1X60A 3PO4A 4WXOA 1KWMA 1GQEA 4E7KA 4DPWA 3OYIA 1RHRB 1ZM9A 3CUNA 2FJVA 4GMJB 3KK3B 4CLTA 3OHRA 1YRUA 4Y2KA 1RABB 5KFOA 2X51A 4Z0UA 2A6MA 1HJOA 3IC1A 4IG3B 2PC6A 4A46A 4R8UB 2FGOA 3NOCA 5KFYA 2BJDA 1O8BA 1Q53A 4B9QA 3JS6A 5LMUK 3JQMA 3A5OC 1YJ9S 3KK7A 1YG0A 4CF1A 4ZIVA 4JI5F 3NG8A 1UP1A 1IG8A 4CHOA 3NE6A 1UETA 2OPSA 5DQHA 3K2PA 4CECA 2KXFA 2XNQA 3FZHA 1SJQA 4Q44A 4I64A 1ATRA 2N3LA 3SI8A 3CT9A 3MGJA 1Q82O 3KG1A 5C5JA 4ID1A 3G87A 3GFZA 1A5VA 1VQKS 3OHAA 1HYSA 4KHSA 1E6VB 2FLNA 2L08A 2MZTA 1MU2A 3O9SA 5GAHI 4WCEQ 4I56A 2G1DA 4NLSA 4OV6A 2ADCA 2ZJRQ 4OJHA 4HR2A 2A1RA 2WVBA 3ZTSA 3T5LA 3H1QA 3MZIA 3WEEB 3PHTA 4RBUA 2XSJB 1RGVA 2WOMB 3B6BA 4ED7A 2DHGA 1WB9A 1AB8A 1XEZA 2H51B 4CHPA 1TK8A 1N33J 3SQ0A 4FM0A 1DY3A 4FNIA 1TFYA 3O44A 4QPXA 4YDUC 5JJBA 1VSMA 4GVBB 2AYBA 3ZZPA 2DIVA 1S79A 2F7TA 4H0PA 4BC7A 1BC6A 2E2OA 3PACA 4JI4F 5HLFA 2NRVA 4X4VA 1IR1A 4YY3K 1MW7A 4RUBA 4C23A 1JJHA 2VBXA 4F3OA 4KHUA 3HFVA 3O2IA 4DTPA 1NKEA 1VQOS 3DMJA 2NRZA 1T7PA 3QT6A 1C4AA 2E9TA 4RW8A 2BJ9A 3CPWR 4Y0WA 1J9AA 4F36A 3GV7B 1VRTB 4ZLLA 1TUWA 4ZP8A 3DRRA 4IDHA 2YNGA 1HPZA 1AFIA 3AXMA 1C0GA 3GV5B 4CLYA 2ITMA 3QFWA 5IQ6A 1FRIA 4FWRA 5CAAA 4H0VB 2FDNA 3OTOJ 4I67A 2CPYA 2RF2B 2BZ2A 1VBYA 2MGZA 2D0BA 1AUDA 5I4MA 3FEXB 2Z57B 3BR9A 1RTIA 4KI4A 1AXQA 4CF8A 3GSDA 5GIPA 4NZ7A 3L2UA 3A3NB 1D8YA 3ZSXA 3H2VE 5GMDA 3H2LA 5M1OA 3G6EN 2OTJS 3EZ5A 4KB0A 2XI2A 4F3MA 1UWBA 2FHMA 4ER8A 4JKDA 5FLXU 3IRXA 2OZSA 4NLPA 4NL5A 2XLIA 4ID8A 4ES1A 3GP9A 3K58A 2XGQA 2J9DE 4Q43A 1VQMN 5I3UB 4TQRA 1LK5A 3MXIA 2YX4A 4NYFA 4NPOA 3SUNA 1L3SA 4K4VA 3DLEA 3OPKA 3TANA 1FKOB 1SL1A 5AQNA 2YWHA 4KH4A 4CEFA 2HWHA 3ZX2A 4BR5A 1GEHA 4HHUA 5B7WA 3RMDA 4LF7J 2GHVC 3WXMB 2G2OA 1EO1A 2VCPA 2Q97A 5GINA 5KT2A 3HOTA 2C2EA 2WSFC 3BH6B 4UF4A 3CB4A 4TKTA 5IWAJ 3NGDA 4JYAJ 3ULEB 3TA2A 4GC7A 4JKFA 3UKUB 1X31C 3ET6A 4OX9J 3BN7A 3OL9A 3HPGA 1UPPA 3F44A 3FE1A 2LCWA 1NH8A 2HRYA 1HI8A 2AT1B 4JKGB 1DHMA 1NK5A 4QWBA 3NMUA 5BR8F 1SB6A 2FUG9 2P8IA 3FCWA 1RWNB 2DFEA 4KAIA 3SAHA 4FZXC 4M63C 4DR7F 2UUCJ 1S7IA 1MWYA 3NWRA 1VK0A 1T95A 3SCKE 1GLJO 3PKYA 2UUBF 1KQSR 4LF5F 3O1LA 1QD1A 4E0DA 2V8HA 4IJNA 3CD6S 1T6CA 2PSZA 5ETRA 5M1PA 3IAM9 3VN5A 2R2UA 5K8MA 3SCJE 3LP2B 1FDBA 3GWCA 3D68A 3NDKA 4NA3A 4BRQA 3BF4A 2UXDJ 2XYGB 4M3UA 4NASA 3FNNA 1VGYA 1ACMB 1XJWB 4ILGB 3I56N 2V69A 2F8HA 2CG8A 3UFCX 5AFUH 2FJDB 2W2MP 2DGWA 4Y00A 4CVNE 2VFSA 3L09A 1RDDA 2Y0SD 2X3DA 3CJAA 1CULB 4MMOA 2EC0A 1S1XA 2YXLA 2JZ5A 1S1TB 2GNKA 1S5ZA 3NKYA 3V9UA 2XO6A 1UMJA 1FRLA 2FSKA 1S0VA 3HZGA 4ZHRA 1WSFA 3W5ZA 5LJWA 5LJ5Y 3CCEN 1NJZA 5IWAF 1RWMB 5A6WA 3UWTA 1CLQA 4LFBJ 4L8RB 3I5CA 2SXLA 3CDBA 3D2FA 2OGUA 2HBQB 1HRHA 2H3EB 5SZTA 3BF1A 2YVSA 4ZLPA 4HTIA 3J7YU 5ETNA 3NMRA 2CJYB 1LK7A 2HURA 3SYZA 2E9RX 4LF6F 2G8WA 2UP1A 3W62A 4DN9A 2ZE2B 2IRYA 3MR7A 5FPMA 1RT2A 3L9ZA 3RUBL 1IBLF 5JXSA 4JI2J 1B7FA 1RTHA 5A6PA 4O8UA 5L38A 1VQ6S 2ZGZA 3QEWA 2JLGA 2V51B 4FJHA 3LM9A 2VQEF 2HVIA 2E1PA 1S99A 3M30A 3BQ2A 1YVFA 5HBMB 1UAXA 2G13A 2F40A 2N82B 4Z37A 3MEEA 2OEKA 1M1KO 2E66A 4MYUA 3SFGA 1NGAA 3GBTA 4ZP7A 2RU3A 2CQ2A 1JX4A 3PV8A 3W3SA 3B78A 3WIVA 1NGDA 3H0PA 3LO3A 3OS0A 5KFGA 4LF8K 1XHZA 1BD6A 4PWDA 2AJFE 1RAHB 3CD0A 1RT1B 3AO1A 4K41A 5L1IA 2MZSA 3M9NB 1GTEA 4IRKA 2O67A 4J2EA 1HW8A 8RUCA 4FJMA 3VQ9A 4XAKA 1SBRA 1I51B 3AD8C 2PDAA 3TEHB 3CD5A 3EGZA 1O5JA 2QT7A 4IG0B 5AQFA 3MCMA 5G0RA 3AVAA 4OHZA 4J5OA 5THWA 3FSXA 4NA2A 2V34A 1OH5A 3R5GA 3VF0B 2ZM6F 3HCXA 5JMVA 1WEXA 2J6SA 1TZ0A 2DR8A 1C1CA 5FRNA 2DGUA 2J9DA 4E7JA 2P5OA 2JJ4D 4RTFD 4CGDA 5F41A 1R0AB 3MN9A 5FLXY 4AQYF 2ZH3A 3C16B 3M2RA 2HG4A 2KL8A 4I2PB 4NLYA 1S0MA 4X4UA 1DBDA 2JC1A 2Z1IA 3B8HA 4USJC 4LFCF 1HKGA 3LGNA 3NGUA 4TY9A 4FYVB 4QAGA 4F8RA 4JV2A 3M6GA 3IMXA 2DGVA 3KKFA 3MN6A 1WF1A 4M3RA 3LDPA 4ED1A 4NCAA 4NLQA 4OQJA 3MUVP 5IM0B 1YKWA 3NBPA 3IWNC 2G0CA 4X62K 1A6LA 5EDWA 1I39A 4NLOA 3RU0A 4LIRA 2NUBA 2DNKA 3BUZB 2GAGC 3P4IA 3WX8A 4CM2A 3PEHA 1MROA 2E1AA 3B4MA 3OQ2A 2ZDOA 2P9IB 4CJRA 5IT9O 3C19A 2RSQA 1BG3A 5A8RA 4IOAQ 1Z2ZA 2LLZA 2NS1B 4M5DB 3VGMA 3KUEA 4DR4K 4EGLA 3B8AX 4X64J 3DLHA 4K5RA 2DNQA 4ZIWA 4FWLA 2JC0A 3C15A 4C11A 5ETKA 3MFIA 4KGXB 4E1MA 5GMKa 4DQSA 3MN5A 2O8BA 3DLEB 1H6KX 1YBAA 2V4RA 3H2UB 3OYMA 4FLVA 1A0OB 1QS4A 3CCSN 3X1LB 3D1HA 2OTLS 1IJFB 4HWIA 1V5VA 1HMVA 3LP3A 4JV5K 1BMQB 2OLWA 4RW9A 2GGPB 4YHHJ 3A8EA 4I0WA 2F9TA 5DETA 3M8PA 4OI1A 4DSJA 4P72A 3Q8QB 1R27B 1CJUA 2LQ9A 4C3KA 2R2TA 3MCNA 3CCZA 4CF0A 2HBRB 3PW7A 3I0RA 2ZITA 3SBGA 3MAAA 4ELUA 2HNYA 1VDHA 2RDJA 2CJQA 1PYTA 4C8YA 5ETSA 3NGTA 3ET6B 4U8YA 4DX8H 1JLGB 4F4XA 1WLJA 2F8SA 4LVNP 4MT1A 2HMPA 2QWOA 1NEEA 2G9OA 5MLCV 2EFVA 4E98A 4JKGA 3L95X 5DS7A 1IBKK 3BKFA 1VOMA 4IH6A 3UD4P 4FBTA 2XSJA 3AVCA 4WQ4A 2P5GA 4F3QA 3V6KA 2PY5A 1Y3KA 1HWUA 1RWPB 3SQ4A 4EIAA 1WTBA 1FDAA 3HHLA 1LWCB 2QLFB 2G8FA 1ATNA 1QVFR 4PQUB 4JI4J 4NXMK 1E6YB 4HTLA 1DTTB 3TTCA 1SV5B 1GOBA 2EFPA 4CF9A 3HSGA 3ZZTA 2HOEA 2A18A 4U67Q 1ZTWA 2AU0A 1HNXJ 1IXKA 1N8RO 1RK8A 2P5VA 1X4BA 3SSSA 2CPJA 2N4DA 2GV1A 3M32B 1RCHA 5JUMA 2DXEA 3R7NB 3EGNA 1WHYA 3QAEA 1WC1A 5H9FK 1CJVA 1FK9B 2BH1A 4EWTA 1QVGR 1IUJA 2M52A 3LTOA 5D4LA 1N88A 3MEKA 2CGKA 3CCMS 5F9NA 3O4QA 1HWIA 3KJNB 2EX3A 2ZJPL 4WBFA 3MMBA 4OX6A 4O0IA 2Z56B 2NUHA 5L46A 1Y97A 3QB0A 2QA4N 2G8IA 4ED2A 1T6DA 4WQ5A 1ZA1B 1ITPA 2AJ0A 3OUYB 3VQEA 4N41A 2DH7A 2E8AA 2QEXS 1DTQB 3PYGA 3MD1A 3C65A 4JI5J 4HVJA 2O8DA 1N34F 1VI7A 1X4AA 3MM9B 2O5DA 4NEYA 2ZBPA 1JIHA 5AQKA 2VA2A 3VQBA 3VGLA 1X4CA 4A8QA 3FGUA 4USTA 5LMNJ 2M70A 4FK0A 4A62A 1RTHB 3WNHA 4QS8A 3D6FB 1YXQA 2W24A 4LVOP 4O23A 1P8GA 2QGFB 2Q3PA 2W4DA 2ZZNA 3TSUA 2EBGA 1NZ8A 2L9NA 1X9JA 5ITHA 4OVLA 2P9KA 3VEXA 2RD5C 1ILYA 3V5RA 3SMZA 4CLKA 4QOTA 4F67A 4AHVA 3UR0A 1LXJA 3QBWA 2KT3A 5AXLA 5M1NA 1QY7A 4DQRA 1CVJA 1TV6B 1A9NB 4IFVB 4QIVA 4L75A 1LWXA 3RRGA 2YKOA 3SPZA 3ULHA 3IGVA 3M7VA 4WFYA 1KQFB 1XR6A 2X6NA 3IBWA 2E2QA 3CDAA 4E1JA 5AQRA 2QLBB 1KRPA 1FDNA 5BR9A 3AB2B 3AXKA 9RUBA 5TKYA 2RKIA 4ZLNA 4FWSA 2E1CA 2QW9A 2KXNB 5KG4A 1O13A 5LSOA 2XB2D 3QMLA 3Q8UA 4CO5A 4B3RF 3S6EA 4YB5A 3NNAA 3B6OA 4A8MP 3TI0A 2VB6A 1GXUA 1RT4B 2XTJP 1YZ7A 5KG3A 3MM5A 3MEDA 4OI0A 3GG1A 1PG5B 4ID5A 4ZJLA 2JNJA 3TVYA 2AWZA 1RBVA 1GH8A 1GX5A 1HARA 1YSJA 1TL3B 4CFDA 3GQCA 4OL8A 4CH1A 3AJ2A 4RUHA 4OYZA 5CZ1A 1WKJA 1CG2A 3BB5A 3K5PA 3AOAA 5BREA 4YOVA 2Z0GA 1G1XA 1KVIA 2R8KA 3UDEA 3MMVA 1OMSA 3QNOA 3B6PA 2GCFA 1X5OA 4ZCKA 5LY3A 2HF3A 4F9OA 4AFFA 1BWFO 3VQ5A 3GCXP 1VIOA 3NY0A 3M8RA 1D5AA 4I6YA 4YR2A 4NLVA 3H5XA 3N5BA 3UDVA 3MPDA 2DR5A 3ZX3A 4C0HA 3TQ1A 4CK3A 4ES2A 4IBNA 3H98A 5KOWA 4JI7F 2QO3A 1MN7A 2CZVC 1YJNS 4CZJA 2ASYA 2F1FA 5C10A 1HHTP 3FZBA 4IFYA 2GUIA 2X6SA 2CAJA 2WVEA 1H7XA 1HI1A 4OV1A 1DT9A 2GS8A 4DR4J 4IH5A 2CFXA 4Z7CA 2GVZA 1N33F 2BE7D 4WU3A 1X5SA 2ASOA 4LFCK 1C0UB 3BR8A 3GR0A 4PG8A 2IC3A 3E1YA 1RHUB 1FXLA 3CQYA 2Z1GA 5ETQA 2ZD1B 4CLZA 4N8OA 1VK3A 1GLEG 1RI7A 2AGQA 1QAIA 1BQXA 2BVZA 3MR2A 1VQPN 2IM1A 4CBUA 3E3XA 3ZSYA 2CPDA 4QWEA 1UEUA 3THXA 2RH3A 3U02A 4X62J 3V4IA 2MYFA 3A4TA 3AH6A 2ZH5A 5E2QA 2VGNA 1N33K 3FDSA 3NL0A 3VQCA 4LD0A 2WBRA 3CDEA 1BGXT 4BRLA 1M1GA 4MQ3A 1KP6A 3J81U 4JI4K 2DR9A 3GOIA 3LDSA 3GJTB 2V6AA 4B3MJ 5B0EA 3WXLA 4M1KA 3V2UC 3OVAA 3CFRA 1IKYA 3BS9A 3MM8B 4KIAA 2FJXA 3R8YA 3UD3P 2B51A 1GT8A 5A8WB 5B0DA 4GC6A 3F41A 1VQ4S 3OSPA 3UE2A 1EKRA 3HVAA 3MMCA 3M1VA 1UVMA 4J2DA 4PZVA 1IBMK 2BUNA 2D3ZA 4A48A 3MHYA 3MEGB 1VQ9N 4V1Ak 4HHJA 3TQEA 2CZ4A 4TVAB 3NGYA 4X4TA 1RLCL 5LMUJ 3I4PA 2BM1A 2KJWA 3HT3A 1MWQA 1ZPVA 3TVKA 5E84A 3I9V9 4JV5F 4AL5A 2J7UA 1TAUA 3LPEA 4I2PA 1S1VA 3Q7CA 1S10A 4CJKA 1RKJA 1W97L 1E6YA 3T1YF 1LW2B 5ETLA 1LV5A 4ZKAA 1RBUA 2ZM6K 1UL3A 2CPHA 1VJWA 4CI0B 4GKKF 2MEWA 3L0QA 5DM6Q 2R7OA 1T03A 3DLLQ 1NHKL 2AJ2A 4WTYA 2P9CA 2YTCA 4FF2A 4NI2B 1U2CA 5IM0A 2MDAA 1J6ZA 3H1VX 2P6TA 3DLBA 1F1BB 1PAEX 2OEJA 2NXNA 2V4QA 1HPMA 4BC2A 3EL2A 5IC6B 1BXNA 5HANA 4DU7A 2V2ZA 1I94J 3VEYA 3CMQA 3AAWB 1WSRA 3DOKA 4PQAA 2K3IA 4P71A 4DWIA 2X1BA 1JJ4A 1ESVA 4ZVHA 3G71N 4ISFA 2AJ1A 4JAXA 3EMTA 4DQPA 3ZSRA 4YY3J 1YITS 3I82A 5EOYA 1N5QA 2VQEJ 2W9BB 1EP4B 2F4VF 2V0NA 3D67A 2KHDA 2GFFA 2IS3A 2P9LA 1MN9A 3L6QA 2BUPA 4B17A 2MSSA 3T1HF 3JSMA 3QNWB 1TUUA 1RAEB 3G6VA 3THWB 2BKPA 3FMWA 5F8LA 1T9TA 1ZA2B 3FQLA 2UU9K 2V9KA 2A42A 5KFRA 1EQMA 2XLJA 3FEZA 2IY5B 4OZ3A 2GEMA 4DR2F 4AQYJ 1GXTA 3H4BA 1GLLO 5H9EK 1KVCA 4WXWA 3NRBA 3ZFVA 4M5JA 1UA0A 1TELA 4FYYB 5DM6L 2LQ5A 3HRGA 1FJGK 5KG1A 4C3LA 1SVDA 4FL9A 2FTRA 2JL9A 4DX6A 1HR0K 2M88A 5KFLA 3IRWP 2RS2A 3QRQA 1HWLA 3CCES 4Z4FA 2YKNB 3QNNA 2CNLB 2KHCA 5HBMA 3AQPA 4DL7A 4A8XA 4CJLA 3AGRA 4I7FA 1PC5A 5BYQA 2LECA 3ISNC 4JI0J 3AD7C 4NCBA 2KQ2A 4P10A 4CBXA 3BBBA 4PYAA 2DTUA 2KLAA 5LSLA 3RW6A 2RB7A 2W2QP 4DL3A 2VG6A 2YKMA 4ICLB 2LEAA 3LZIA 4CQ1A 3EXYA 1QDUB 2IIHA 1VSHA 5JVGL 1GTHA 2BRKA 3LA0A 1R3NA 4FPRA 4MKYA 5EUHA 5GAGU 2FJEB 2E5LF 1Q4RA 2J6UA 1WSJA 2JHEA 2JWNA 4Z4CA 3MM7A 4O8KA 2CQ3A 1UFKA 4FCYA 3BPDA 2NLWA 4P74A 5HO4A 2OCEA 4O44B 3E8OA 3O9UA 3FFIA 1RDBA 1R8PA 1RP5A 4DV5F 5FIIA 4CH0S 3P4UB 3DI6B 1TKTA 3MPUB 4J2AA 1WSVA 1YWXA 4RUAA 5FJ4A 2D69A 3PYDA 5K9FA 2ZWHA 3OS1A 3M2UA 2FF6A 3ISZA 3EX7B 2B7BB 4RL1A 4FYWB 4YY3F 2EVZA 1KQSM 4U7BA 4B3MK 1NZAA 2HVEA 4DQQA 2OANA 2RUSA 1VBXA 1Z4UA 4RNNA 3DOLB 3QFPA 1YVUA 4X66F 2E9ZA 3F9KA 1VISA 3S3MA 2C3UA 3OYFA 1Q81T 5A2QU 5FPNA 1NPPA 4ISEA 2B4PA 1QUPA 2V50A 1N32K 4XH1A 3K2YA 2IA6A 2BBEA 2ZJPQ 2A0FB 3CDUA 1P27B 4NWBA 2VC1A 3TJ9A 3I5BA 5D78A 3MMBB 4H4KA 4P75A 4AHUA 2I1RA 4WK1A 1RT5A 4ZVGA 2YNFA 1L3KA 3MDFA 2VWKA 4R5PA 1WUAA 1NH7A 1I94K 2IVFB 3DRSB 4ANCA 2YKQA 2M3DA 1NK4A 5CY4A 4YHHF 4V19X 3C46A 4QPTA 1CJKA 3IR7B 2RDIA 5AZIB 1AUSL 4QOZB 3VGSA 1YTAA 1X9WA 2ILZA 3W63A 4RWXA 1VRUB 5GADI 3P5JA 4ZDNA 3MR6A 2QX0A 3L2QA 4FVUA 3F73A 5J1EA 4OLPA 1S9EB 2LFVA 2XMMA 4AHTA 2HBYB 2D0CA 5FLXO 1KFDA 2ZD1A 3NAIA 2O1PA 3D66A 3C2PA 1RWXB 1ZBHA 2O4IA 2BQRA 2CIMA 3W1YC 5L1KA 1R31A 5CQGA 3I5AA 2KFZA 3O3HA 2C3YA 2V2KA 1HQEA 4CD1A 1RYRA 3KD5E 4HYKA 4WU2A 5M2UA 2R7UA 1HLUA 2AHOB 1F60B 1A5XA 2QA4S 3MDQA 1AW0A 3FUYA 1NGIA 1WHVA 2YBVA 2AGOA 2BV3A 4AE5A 4KT0C 2YWFA 4LF7K 2CH6A 1NDKA 1NDLA 2QEXN 2HPUA 3M8PB 3P1GA 4WE1A 3VF6A 1DKGD 3DXKA 4M7XA 2NZ4A 5A8WA 4H03B 4DOZA 2DITA 3IG1B 4EHUA 2BMBA 3ZCMA 2DFFA 4OZNA 3DLLL 2WW8A 5AQZA 3OTDA 4KSEB 4CRJA 4DS5A 6FD1A 1KLMA 2GBZA 3D3BJ 3N6NA 4CJ7A 3CJRA 4A8YA 3KLHA 4DUYJ 2K7KA 3J7AP 8ATCB 4I6AA 1B0TA 2Y8YA 2HFUA 2C3PA 5IT9U 1WNEA 4QR1A 3OLAA 2NXJA 3I8BA 3HULA 5AQQA 3ZT0A 1TKDA 2ACMA 4J9LA 4A8KA 2UUAK 4J9NA 1U04A 5IV4A 2HBJA 3R9PA 2OTLN 2J9EA 4J8FA 4JHDB 2VGMA 4EO8A 4ED8A 1HJRA 1NB2A 1UVNA 4FWQA 1Y11A 1LW0B 3IP0A 3EKUA 1LWCA 2HFZA 2DHXA 3M4XA 4JI2K 4F0MA 3KVGA 2VYPA 4HT5A 3DN9A 3JAMY 2JX2A 1LW2A 3QSIA 3C6TB 3KJVA 4FSVA 3KLIA 1QSYA 3UNGC 1W7AA 1FCAA 4PWWA 2DPIA 2RQCA 5KG7A 3PNIA 4FJIA 4D3HA 3H3NO 5GAEP 1Y10A 2FC0A 2EK1A 2F9DA 3PG9A 4KGMA 1T11A 2YQ1A 4JUZA 3PIOQ 4PL8A 4KJIA 2X1FA 3CEDA 1NGEA 3KKRA 3SAGA 3QESA 3TO8A 1U7LA 2BJ8A 2RQKA 3W2VA 2P9NA 2W7OA 3AVMA 4F0KA 1EZZB 1R8CA 3JYTB 3CC2S 4WFBQ 2GZOA 2GVZB 3CCUN 5EWGA 1FEEA 1Q5VA 3D2WA 4LR7A 3QEIA 4HL9A 2NSCA 2V94A 2UUAJ 3SIPB 1U1NA 3BPSP 4BC5A 4FS2A 2KJVA 3BBCA 2VQFF 4BROA 5GAHU 1J5EK 4NB4A 1PYOB 1HIYA 4XPEA 4IEIA 1K47A 1X9MA 3T9ZA 5J2QB 3W66A 1L3TA 2GVDB 1OVQA 1NPRA 1UVIA 4M5HA 2F9WA 1WKLA 2O66A 3RSEB 5L1JA 2OHDA 1Q8KA 4E7LA 3CCTA 5KFMA 4E7HA 2VPYB 4PR6A 2DY4A 2IMOA 5KRSA 4EZ9A 4J9SA 1U6ZA 4DV6K 3E9LA 2UVWA 4DV7F 2UUBK 3GILA 3ENQA 5M2PA 1LNQA 5E3QA 2GMJA 2V8GA 5I9EB 2UXCK 2HHTA 2QK9A 2F8TA 3SCLE 3E9OA 4J9QA 4LFBF 1SZ2A 1ZZFA 3U1NA 1FD8A 4QJVA 3D7EO 3CJKA 1LFWA 2XULA 4HDGA 2J8SA 4RX6A 3IMQJ 3ZZ0A 4PL7A 3A8IA 2PMZD 2UYTA 4EK2A 3VMFB 1PKUA 1S1WB 3ENAA 3GB0A 3DOMA 4K4ZA 2OPPA 3MM6A 1SPBP 3N6LA 2E1ZA 4WP9A 4OZ2A 3R8EA 3HTVA 4JKAA 4CDIA 1JMTA 1XWLA 3S9HA 3A1YG 3PYFA 3NGIA 3BQ1A 4X64K 4GVBA 2XHWA 3UI3A 2A6OA 4TYBA 5DMRA 4DV2J 4DKWA 3DLJA 4DR6J 3LP1B 4ILLA 5JVHL 5HRRA 4RJVA 3MECA 1RE1B 2QMXA 4P52A 3E9PA 1C0TB 3ENVA 5BPMA 2LSNA 4O3RA 1VRTA 4J9MA 3MCSA 3CCJN 3PX0A 1VAZA 4CZMA 2HAFA 3DHWC 1VQ4N 4JS5A 4Q45A 4ECYA 4NMXA 3N79A 4CZKA 2A3JA 1FEHA 2KH9A 3IN5A 3EZUA 2OYQA 1RT7B 1K0VA 3GYGA 1LAWA 2DH8A 2DTJA 3ADAC 3NAEA 3FQKA 4KREA 3BSAA 1VQ9S 2XY8A 2ACYA 3OBIA 1RDUA 2ZOFA 4KFBB 2QTWA 5DGAA 4O3PA 3CQ8A 2EI5A 1IKXB 1IBMF 2GQCA 3OFEA 2QWRA 4ZVSB 1DAXA 1XN9A 3RBXA 3RZAA 3SV4A 1H38A 3M8ZA 2NXUA 1V9OA 3OJUA 2R8IA 1O0PA 2CQ4A 5KFBA 1F5AA 3Q83A 2VASA 2OH2A 2BJ3A 2MB0B 1YHQS 2YKPA 3IDHA 3OL6A 1IG9A 1X5PA 2CVIA 3NCIA 1XMOK 1TMMA 1WD6A 3ICLA 3SBTA 2ZH2A 3EDRB 4DU8A 2IVNA 2IC3B 1ZOTA 5F3TA 1HHSA 3GG4A 2FJBB 5HP1A 5HQMA 5EXWA 1GK8A 1K8KA 3GDQA 4B8AB 2G8UA 3KJQB 4U7UK 3ENBA 1IBCB 5GADP 4ZMMA 5KFIA 1VQSA 3DM2A 3R2DJ 2R42A 1HQEB 1RBAA 2AIRB 2C2ZB 3V81A 4WFAQ 4I7FB 1WI6A 2O8FA 3TX0A 4OI4A 3NOGA 5C2CA 4CCHA 2D0AA 1FWPA 4BREA 2NRHA 4M5KA 4PABA 4BRCA 3CCUS 3HPHA 3RTVA 2KXHA 5AQTA 5K14B 3DXMB 1SIWB 4DPYA 1NNEA 2Q1NA 4DF4A 1KEKA 3CC7N 1AYEA 2HGMA 2D4WA 1VBKA 4X66K 1RAGB 2AKWB 2Z2MA 1KLMB 5BR8J 3VAHA 4CLPA 2H5IB 2V67A 1NGCA 4Z4GA 2XMUA 1LWFA 3DLGB 2B5JB 3QGGA 1X4DA 4RR5A 2WTFA 3DI6A 2HHPA 2LP4A 1OPIA 3S1TA 1FRHA 5DQIA 1ZYQA 2WK4A 5DDOC 1VRQC 1BA0A 4KB7A 5AJ3F 1FXXA 3M2UB 3GIMA 2VPWB 4OYXA 2CGJA 1IV0A 4W90B 1O6XA 2VICA 2KU7A 3E2EA 2IOCA 3SNNA 3LUYA 4OHVA 4IRDA 1FFGB 1FESA 1TMJA 4A59A 5F2RA 2WBNA 3ELHA 2HIYA 3TZZA 3TEGA 3AA3A 2CPIA 3HT0A 3D6MB 1YJTA 4YR3A 4AXJA 2EPIA 1RBRA 4ZHRB 1TTHB 4XH5A 4C0BA 3VQAA 3MFHA 3JAMU 4DBQA 2J76E 3KDOA 4ZPBA 1BI4B 1KXPA 3V9WA 3QGHA 4ECRA 1G15A 4LBHA 1ULRA 2JFDA 1HFEL 1K73T 3P8BB 1G7CB 3W2WA 1H72C 4UQTA 2A40A 4ZVRB 3T5JA 5EN1A 2YNHA 4BRAA 4V19S 1CC7A 5KFPA 2WC9A 3ZSZA 5K5MA 3PZPA 4RWWA 4CT9A 3VGKA 4TY8A 1XUPO 3V4MA 2CXEA 1WOPA 4PG5A 4X2BA 1M0SA 2DEIA 4OZ5A 1Y9OA 2YX6A 5AQUA 3VESA 1VQ5S 2B3TB 4RNOA 3MCPA 2B9EA 1FTCA 1RTJA 3GFYA 4JD2B 4OZJA 4NZ0A 4CD3A 2QE5A 1G6BA 3NGKA 3IRXB 4ENOA 5CZVA 3HSCA 4M7YA 1APSA 2V4JA 3TR5A 4H0YB 3QJPA 2JEFA 2GVDA 3KLGA 3KK3A 4URQU 3G6ES 1NK7A 3DAWA 4I6MB 3TOQA 2UXBJ 2MZJA 2D7SA 4A5AA 4IG3A 2LEBA 3D6HB 1UZHA 4OIXA 1U47A 4U9RA 4DLGA 2HBZB 1L3UA 3ZT2A 4BC3A 5C42A 1JNZB 4CERA 1J2VA 3PRDA 1GNKA 4L3NA 4LSLA 2M8DB 3CJ8A 1GLDG 2HKEA 2BOPA 4B3TF 2WSEC 2HFSA 4WE1B 3G71S 4DUYK 4OFZA 4MH8A 1DQAA 1I5OB 1VFJA 1HYSB 2GELA 4FNHA 3P45B 3IG1A 3C3LA 4RNFA 4USKA 2MQ8A 4UOCA 1RUSA 2B6AB 3E01B 1EQ0A 2J0SD 2CJBA 1N54B 4OGCA 4DV6J 4C8MA 2FVSA 3T9NA 1JCGA 3K7RA 1U0HB 1IWGA 3J81j 4FLXA 2YY3A 1HNZK 3FEYB 2OSRA 2FZKB 2HS4A 1HBUB 1U1MA 5DDRC 2CQ0A 1Q82T 4IXCA 4PY5A 3UR3C 4LR9A 4DMNA 1D0EA 4H5WA 4BR9A 4OMFG 1E4FT 4MKAA 4KRFA 4EHTA 5M2RA 3WIUA 4LFCJ 1R0AA 2ZWPA 4LF4K 3Q24A 2Y8WA 1SI9A 1NGJA 3SFUA 2MQMA 4CEDA 1C4CA 5DG9A 3G25A 3H90A 4FLUA 1X1PA 4DV3K 4USIA 2YNIB 3U1LA 1TK0A 3VAMA 5KG2A 1U1PA 1N6QB 3R5AA 3V1RA 1H2VZ 2GMLA 1Q7YT 4MTPA 4G1QB 4LRAA 1X3NA 3IUCA 3U6FA 1OSCA 3LOUA 1U1QA 3D2EA 2I9SA 2W42A 1F9FA 3ZO7A 1S6PB 1DARA 4N56A 4M3XA 1UW4A 3UW1A 3PHEA 1YIJS 1N5YA 3W2VB 2P9NB 1V5IB 4ES3A 3I56S 3RVCA 4N76A 1RT7A 3W9IA 3CWJA 3CC7S 4MIBA 3G0ZA 4CHYA 2J7KA 1R6YA 2B8PA 4CO1A 3ZSVA 1EHWA 1VSDA 1XC9A 2L48A 3TTDA 1TL7A 3OYEA 1EKEA 3MXHP 2BXJA 3ZSQA 4HKQA 2A1SA 3VEVA 3KK2B 1IKXA 4FK2A 4BRNA 1TKXA 4X65F 3MPYA 1FNOA 4UOFA 2YNFB 2G4BA 3L2VA 1KONA 1UW9A 3W8GA 2PFDA 1YK9A 3DRSA 3KHHA 4OLAA 2C2KB 4DCPB 2I7NA 1JLBB 4X66J 4K8RA 3OY9A 2RN2A 2W9CA 3KJFB 1AT1B 1S72S 1JLFA 2HHUA 2GO9A 1S9GA 3RBZA 4BE1A 3CVKA 5HL7Q 4JKHA 4CBWA 2AA4A 2D74B 2GW8A 3POTA 2B9XA 1RXOB 2WW4A 4Y1DA 3N4WA 1FI4A 3OT9A 3CF5L 1RT6A 3HF5A 1GLCG 3G8SA 4LF4J 4OGEA 3EUNA 1NJIT 2BW2A 4WK3A 2I7PA 4J2BA 4RPFA 4LF4F 4CNYA 1Q8IA 1FJCA 3CPEA 2ZZMA 1K73O 2O8FB 1RT3A 1D9FA 1WHXA 3MEEB 3AO4A 3CCWA 3TAQA 3LAKA 4NLRA 2BYCA 2CPXA 2PEHA 4BBYA 1B3TA 2IDLA 2NQPA 2F4VK 2GA7A 3EM1A 2OMOA 4Z2XA 1KD1T 1URNA 4EP5A 1T94A 2X1AA 4CTAA 2OKQA 1EWQA 3EDQB 4H5TA 4U6PA 2OPSB 4F02A 2DGTA 1KCFA 2I0XA 1G2EA 5LMNK 2XS5A 3TAMB 1FVSA 3T5HA 4LF6J 1HYZA 4O5FA 4LBPA 1BDGA 2FHJD 4BRMA 4G9ZA 1QE1B 4DL5A 3K5MA 3MK6A 4IDKB 5L39A 3PW2A 1F9HA 3QZ7A 1S6QB 1DTTA 4JEPA 1YQHA 5ADXA 4QW8A 4DTNA 2QFIA 1EJ7L 5BXIA 3KNGA 1LAVA 4U8VA 3HPOA 2QWMA 1XNQF 3EXCX 1XQSC 1IQZA 4DX5A 4YS2A 3M1FA 4A61A 3ZYYX 3CCVN 3PIPQ 2KW4A 1PSDA 2KRRA 2DKOB 2P9PA 4E7IA 3OFFA 2J4RA 4YORA 3GE9A 3KMQA 1S1TA 2DIUA 3EKSA 5HRSA 4B02A 2N3OA 5HLFB 2QC3A 2HQ3A 2X3GA 4MYTA 3NH1A 4R25A 4JV5J 3BZQA 2KHOA 5HMZA 3SZ2A 3HHEA 4QYRA 4S0MA 1JWWA 4L3KA 1F5BA 1YVNA 4F4AA 2M0GB 3EGWB 4KH6A 4R0JA 1L5UA 1NLVA 2MKIA 4AHRA 4ZPVR 1WSIA 4B1UB 4DTJA 2R7TA 1OH7A 1R6VA 1HPZB 2DR7A 3GV8B 2P9UB 2HHVA 3OYGA 1WHWA 3GJQB 3HSDA 3PW5A 5CYMB 1PBAA 3VEOA 1ICEB 4OX9F 3BY5A 4CEAA 3RR7A 2MGZB 2UUWA 7FDRA 1C0MA 1OH8A 2MLXA 4DV1J 1OWXA 1CEZA 1XMQF 2FJWA 3AY0A 1BA1A 2NUUG 4KR0B 3U1MA 2FBTA 2NSBA 4M5DA 5BJRA 1IO2A 2MZQA 3M9OB 2CA9A 4XO0A 2PI5A 1U1LA 2K1RB 4GMKA 3TRGA 3QINA 4KH1B 4DR1F 3CETA 4NLBA 4KKOA 3JTOA 5IT4A 2ZM6J 1X3MA 2BQ3A 4YNQA 1MMNA 4X4OA 3CDWA 3WXIA 4ECSA 4BRIA 3V9SA 4EBDA 4A8WA 3QIOA 2L41A 1RBSA 2GIFA 2HB5A 4JI7J 3CNQP 2WONB 1YTUA 1M90O 3CIZA 2H65B 3GMGA 3TR8A 1S4FA 2GTDA 1H2UX 5K8OA 2F9JA 2CADA 4QW9A 2H5EA 1YBUA 5KQ8A 3BGOP 3I0SA 3MMJA 2BQUA 1YBTA 1DFDA 1D09B 3EO3A 1TL5A 1DEJA 1WF2A 5B0AA 3U27A 1R0BG 3HO1A 1RLDA 4XDDA 1ZS6A 4ZCLA 1MMDA 5ETOA 1OKJA 4FVCA 1NGBA 3DNCA 1J5OB 3BKTA 3THYA 3IM8A 1CS4A 4GKKJ 1RBOB 4LF8F 3U4LA 5CYQB 4HI2A 3ISND 3TW0A 4RW6B 1LWFB 2E5LK 4DPOA 2GWKA 2IBKA 2BDPA 5F8MA 2J6TA 5H9EJ 2LKZA 2QI2A 1GFWB 4DL0C 2HHWA 1T9YA 3FRZA 2GJ2A 3B82A 4DF8A 3HMJG 1NB7A 3QJLA 1WSHA 2D41A 3WBZA 4DTXA 4OI6A 2AX1A 2PO4A 4FWOA 3CPWM 2IM2A 5F3ZA 1WI8A 4WZMA 2HHHJ 3HHLB 1YT3A 2UU9F 2LXFA 1ZM2A 5JS2A 1NKCA 4WTOB 3KTQA 2VU5A 4QR2A 4M41A 4L74A 2VQEK 3CGIA 4KYZA 1VQLN 4IKAA 3CJBA 4CJQA 3RBDA 4OYOA 2CQBA 5D8HB 3PR4A 3HP9A 5C2GA 3VENA 2FY1A 1U49A 2R2SA 1U24A 1KAYA 4B3MF 5EGYA 1ZC6A 4DN0A 4NLDA 3M8YA 3AD9C 3EICA 2FLPA 4A4JA 4O0JA 4A57A 4WF9L 2B43A 7FD1A 4H8KA 2KKZA 4ZCMA 4UUWA 3HDSA 4P9SA 2CQ1A 3TYTA 1OSDA 3SCXA 1S0OA 1EETB 5LSRA 3GG0A 4BE2A 1LOUA 3L3VA 2ZJQQ 4B1YB 2IVOA 3CI5A 4O0NA 1MROB 4DUZK 3BF3A 3N4PA 4Z4HA 1P1TA 5CE3A 3T6JA 2JLEA 2MZ1A 4C3MA 1B0VA 1QSLA 3K9KA 1HBMA 1TUGB 1RZMA 3MOJB 2V5HG 2FHJA 4K2JA 1SKWA 3OTBA 4ZTFA 3L4IA 3LZJA 3GIRA 2Z1HA 2DCUB 3SQOP 2XQCA 1Z25A 1D8ZA 2IMWP 1WNSA 4O4RA 3Q7BA 3TP2A 1BISA 3GIKA 4TSXA 4DV5K 2W9CB 5AQHA 4WPAA 3PEJA 4MO4A 1YRTA 4JI3F 5BYRA 3UN3A 3OYAA 2NCKL 1XNRF 4Y65A 5LXYA 4YOEA 1ZH5A 5CH7B 2Z58B 2DGXA 3MR5A 1I3AA 5C42B 6FDRA 2IDOA 3POTB 1RT2B 2PT0A 5M1FA 4HEA9 2IRXA 4EO6A 3K9JA 4LSLB 3OVNA 3LPUA 5B08A 3C0BA 4TQSA 4PKIA 2QSFA 4XH4A 4UY85 3DRPA 3JQKA 5A8KA 1J53A 3KHGA 4IOXA 2QG9B 4YN3B 1IKWB 1AZSB 1RT3B 1RHJB 1KVKA 5E5NA 1R8BA 1CQNA 3MAAB 4B1WB 1OVYA 1SCJB 2I8EA 3QERA 2W2NP 1QHAA 2DYAA 5KFCA 5EU7A 4AF1A 5IWAK 1S9FA 3CERA 4CM0A 4BRKA 3PY8A 4FJKA 1WEZA 2WSCC 5K14A 3J7A1 3WXKA 4DPTA 3TAMA 5IOLA 4Q8EA 1SQFA 4X4RA 4K4XA 5JVHQ 4KGZB 4LBIA 2I38A 3BDEA 4F4ZA 4Z4IA 3TUIC 4BRGA 1QQCA 1Y7PA 3LDQA 1B0PA 3VR1A 1TUVA 2Q79A 1BU6O 3GTYX 3BGRA 2P9SB 5GAHP 2E6MA 1NU0A 2CQDA 3O9RA 4G1QA 1KAXA 4MFBB 5J2MB 4KO0B 3OVBA 3PSIA 3CJ1A 4HH0A 2HF4A 2KTQA 3AARA 4CH7A 4DR6F 3L8BA 4TYAA 1C1CB 1E4GT 4FXDA 2E1YA 5HRNA 1FO1A 2BJ7A 5AQWA 4PCQA 1N5YB 2D5RA 4BRHA 2AYMA 5CZXA 4GO5X 4QIGA 3DGVA 4NRTA 2R3VA 3QBCA 1JKHA 1KTQA 1UTAA 4DR7K 5J2PA 3VQSA 2HVZA 3N6MA 3EVWA 3MTKA 3Q0AA 1RADB 4FKXA 2DISA 4I9LA 4JV1A 3TABA 3V1OA 4OYIA 4C97A 2NYHA 3K17A 2DNRA 4AH9A 4F2SA 1P1LA 3Q8VA 3TZWA 4DV5J 4CP5A 2YNHB 5HMWA 2D1KA 4A47A 3OL7A 4IFYB 1HNXF 4XEIA 3UE5A 4H0TB 5H9FJ 1XNQK 3QGPA 3RRKA 1QUVA 3PKMA 1HI0P 2PD1A 2IJRA 1VQLS 4C98A 5F1XA 2RRNA 5C24B 4OJGA 5CCMA 5C2DA 3OBYA 1Y5NB 2C1EB 2NRWA 1T8EA 2YKAA 1WAFA 2G8HA 3R6MA 1TAQA 2XBPA 4YOTA 2L9DA 3FCHA 1YIJN 4WF9Q 1HR0F 1VSEA 5LOQA 3THXB 4D3GA 2ZNZA 2VF3A 3VGUA 4B9SA 1RU1A 1BHNA 4U95A 5IV3A 2BOAA 2MY7A 2HS0A 3A12A 1YJUA 3HYFA 3HVTA 4HHHA 3MXJA 1LQ9A 5AZJB 3RMBA 1WG1A 4W4MA 1XERA 1SKSA 4JKBA 4M5MA 3P6YC 3BKUA 4B1XB 2RU9A 4DUYF 3F5TA 1VQ5N 5HVFA 2I5JB 4RW4A 3VOVA 3HD1A 3VVUA 3NMAA 3O3LA 3OYCA 1BUPA 2PMWA 1CBKA 1RWVB 4KHPF 4NCGA 3OR2A 1S4EA 1XBWA 1E3MA 1N56A 2HNYB 4DV4K 2W4CA 5HAOA 4RNMA 2EW9A 4FKYA 2CH5A 1JLCB 3MMCB 5L9XA 4YFUA 3OVSA 4B3SJ 1TKTB 3AJ1A 3D5MA 3VETA 1U2RA 3AA9A 3OYDA 1M5VC 4DXLA 3UD5A 2C2DA 1UPMB 3MM5B 1FJ7A 3SI6A 2FLLA 2XHBA 3QBXA 3QFUA 2FD2A 4LF8J 4J7CA 3DHXA 4U7CA 5AXMA 2RHQB 3K89A 4X4SA 3P38A 5LL6d 3J8AA 5AXKA 1FJGJ 1Q9XA 2VJVA 3L7OA 3R6GB 4O4GB 1MWMA 4PQUA 4DFPA 3MX2A 1IH7A 3W3DA 1N5SA 1RDAA 2KRBA 4PXDA 1SV5A 2APOA 2VKRA 4FYXB 3HFKA 4PG4A 3HHLD 1T03B 1BQMA 2DRDA 1N48A 2KZMA 4FJ9A 3D2EB 4NI2A 2DNZA 2FC8A 4OLOA 5IS2A 2O4GA 4IR9A 3J7ZT 3BV8A 4LRDA 1Z26A 1B9DA 5FRMA 1H1VA 3P39A 3QEXA 1EARA 3GLJA 4CI6A 4PKDB 3LALA 4OX8A 4KBOA 2DJWA 4DL6A 3DWLA 1UJ4A 4ZOSA 4JI8K 3ILLA 2HHHF 1H3DA 4JI1F 3OYLA 3D6RA 1VSJA 3K5NA 4DR5F 3OFHA 3J80Y 4FJLA 2E29A 3HKWA 4X65K 4IWVA 2W9BA 5J2NB 2HRUA 4DV1K 1RKIA 3VF2A 3VWSA 3CIMA 5DLGA 1WC0A 2XGPA 2LYVA 1HNIA 3THVA 1GOCA 3SJHA 3NH2A 2G2ZA 1YITN 1S1UA 1SKUB 3R6LB 2OELA 4JI3J 2FPHX 1G4CA 1TGOA 1B99A 4KRWA 2HNZB 3TWZA 2JOQA 2QKKA 2OO4A 2WONA 3FR0A 5KFFA 2UV8A 3LH2S 3V6JA 2ZGYA 1T9XA 4J9OA 1M5KC 4I4BA 5FPDA 3C14B 5KGWA 4R0EA 2QMUB 3DXKB 1JJ2M 5A8KB 4ETZA 1FXRA 3JS9A 3O8WA 4KHPJ 4CESA 1J27A 2Z4PA 2E20A 4FJ5A 3S3OA 3EJMA 4GVLA 4X62F 3HVRA 5F8IA 1VMBA 3HL8A 3EPGA 3D54A 5HVGA 2BGGA 2KT5A 2A10A 3V6DA 3ZTRA 5DZ6A 4EBCA 3M6XA 3A3OB 3RMCA 4FJ8A 1N0VC 4CO2A 1X4HA 2CZ9A 2BKNA 2ATCB 3HFZB 2K8GA 3ENWA 2ZVSA 2AYGA 4RW7B 1UVLA 1CPZA 2WVCA 5GAEU 3PLAA 2MMYA 1RDRA 2NZCA 4JK7A 2J9CA 5KG6A 3R3LA 4G65A 4CGFA 2MQNA 4JI2F 2YWGA 2VFRA 1RFQA 2LMIA 4URSA 4NXNF 4O44A 3KLIB 4Q5VA 3KUGA 3KHRA 3THPA 2RQMA 2HZAA 2O01C 3BGRB 3IO1A 1T05A 2DO4A 3RBEA 1FA0A 4B3RK 1XMBA 3FBEA 3D0IE 3EE9A 4XIUA 4EAHD 1RAJA 4BC9A 1VC5A 1HKCA 1RCXB 3MD3A 2HMIB 1HKBA 5HN0A 1HHQA 2EC2A 3UVJA 4CLWA 4C2MA 3MPWA 3RAQA 1HW9A 2QLXA 2HZCA 1ATSA 3G6YA 2Q1LA 4WCEL 2XG8A 2ATQA 2BACA 1UVJA 1VSFA 1JK9B 1EETA 2DNGA 3MN7A 3ZZZA 5KFQA 4DCOB 2EKYA 1FRJA 2YX1A 1I6JA 1DJ0A 1SAZA 4H5RA 4PWUA 5FPEA 4OHXA 1FVQA 2RJZA 1YJRA 3J7YI 4YMEA 2P51A 4F4YA 2EEYA 4B9MA 1RT5B 1Q95G 3LGMA 3O6WA 1TQLA 1K1QA 3KHYA 3CM5A 2XMJA 2JLFA 1VBZA 1AROP 2E5IA 4ZP9A 1IBLJ 5BRHA 1YZ6A 3RR8A 4BDPA 1O1WA 2GMHA 1FNMA 5HRPA 4E2FB 3JSYA 1HBNB 4BDYA 4IO9L 4CJTA 4EI2A 1JXLA 5CR4A 3KOAA 2PYLA 5E33A 3ASMA 3R7SB 1RILA 1S0NA 2QLWA 2IBOA 2WUSA 4AM6A 3I4HX 4N47A 4LF5J 3PYEA 1S12A 4E3SA 5H1SQ 2NPFA 3M8SA 3AVKA 1OPZA 1HA1A 1WSEA 4Z94A 2F8EX 1YGYA 4QYZK 4DV2K 2PA8D 3VQQA 2CPFA 4HLBA 1N36F 3K5LA 1J5EF 5H1SV 3ZZYA 3TPQA 3AOCA 3SUOA 4G1IA 3T5KA 2BANB 2KVQE 2ZH7A 1RTZA 3KXDA 3CMAN 5C25A 5AZJA 3DU5A 2PZSA 2LQBA 1SH2A 4LFAF 2E5JA 3UCGA 3AOBA 1PILA 2FVRA 1QAXA 4KHNA 2VOOA 2V8DA 2VDHA 2DGQA 4OPJA 1NOZA 3WZ0A 2E1MC 3JSBA 3N5FA 5ETTA 3VV2B 4JS4A 1XR5A 3KK1A 1KS2A 2MJUA 5D4OA 4UOGA 4NYPA 3I55N 1JJCB 1U48A 1FT8A 3EWGA 2J0XA 1JLCA 3QETA 3RWUA 3W9HA 3NNHA 2Q2RA 3VHQA 5CYQA 4K42A 1FNXH 2YV0X 5I3QA 4FJGA 3O6QA 2J5AA 3PO5A 2CQGA 2GV9A 2R9LA 4ECQA 4IH7A 4DL4A 1UJ6A 1HNZJ 2CQIA 3W5XA 1TK5A 1XNQJ 3QFHA 2HSEB 2U2FA 1WSGA 2F63A 2WTUA 2O8EB 2UV8G 3A5MC 2Q6CA 3GU0A 4F3TA 1N34J 4HUEA 3FZKA 3VQDA 3KLEA 1KN6A 1RHKB 2KM8C 2Z2ZA 2YPYA 1FE4A 2R7XA 5KGXA 1BCOA 3DOLA 2XHCA 4PEOA 3TUZC 3O1WA 1HQUB 1R8HA 1C1BB 2G1HA 1S7HA 1JKHB 3ZT1A 2NZTA 2Q31A 3KWMA 5KFHA 5C15A 2H4YB 2XY7A 1SKRA 1Q86T 1TKZB 5AQMA 2KB2A 3ZEUA 5IFMA 1IBLK 4CIGA 1X7VA 3D28A 2R7QA 3IAS9 1Y3JA 4M3YA 1ZAVA 4R5PB 2HFVA 4BGBA 3D0HE 1RBLA 1YJVA 4AHSA 4RKUC 4PRFA 2YNGB 2AEFA 3RG6A 2BM0A 2A2CA 2MLZA 3PDNA 1VSLA 3BGFA 2W40A 4MDAA 1N36K 2FC9A 3FZFA 3H59A 2PYJA 4ECWA 7AT1B 1RTIB 2Y3YA 1XHXA 3GCWP 2FVQA 3F2KA 1UFLA 1SJ4P 1U1OA 1V3ZA 1NGHA 4QCLA 1B92A 1S76D 1Y0HA 5J2NA 3UPFA 4OZ0A 5B09A 1P9QC 1M1HA 4NX9A 3T1AA 2DNPA 2IFXA 2DR6A 3C95A 3HD2A 1RDWX 2K2PA 3ENOA 1TVRA 5DK5A 2HFNA 3EY1A 2UUCK 2H9ZA 4CT8A 2OAUA 3M30B 2IM3A 2YWEA 4FP9A 2G8VA 3OLBA 2GIRA 3T1HK 2C42A 1QZ6A 3QDKA 4J9PA 3ONQA 3RRHA 1FKOA 5K8PA 3G10A 2GHWA 2VUGA 1Q18A 2OUGA 2QWNA 4PWDB 4IOBA 1UAWA 2FY8A 3ILOA 5AQGA 2HRTA 2B9YA 3NS6A 2ZHBA 2ZFHA 4M3WA 1V3RA 1NUEA 4ILHA 4FJJA 3MAHA 1HX1A 1NHVA 1WC6A 2V52B 3AA4A 4OO1J 2BTFA 2MPUA 2HWIA 2KFYA 2QJ3A 2AD9A 3AVIA 2DHSA 1WDDA 1PJ7A 2H5JB 2YPZA 5I3PA 4UUXA 2FZCB 1N34K 5E7OB 4KHRA 4CZEA 4QBUA 1BCMA 5T41A 5KRTA 1WBBA 1XMQJ 2W41A 3CJ2A 5LMNF 4LF1A 2IA0A 4ECZA 3FBBA 1U1RA 3CXCM 1NJIO 1OY9A 3FLCO 2RDDA 5BPNA 4DV7K 1NPKA 1FJEB 4NOHA 5AQVA 1N4LA 1NO8A 1TFWA 4AILC 4HTUA 1OYDA 3FK4A 2OSQA 1R0CB 2MHEA 2VDIA 3NEKA 2JGUA 3BSNA 4ISGA 4ECXA 1VSIA 1WTFA 4ELVA 3A5NC 1WAJA 5CCLA 3L4QA 4JOUA 1FJGF 4PG6A 3VAGA 2DNMA 3BH7B 4ED6A 2E5GA 2KO1A 4LF9K 5T7LB 2YHBA 4MKBA 4FM2A 4C8NA 3I9ZA 3G4SN 3NWGA 1Q86O 2E2PA 3CMAS 4JI3K 2ZH1A 4JRPA 2HWTA 1H7WA 1NJXA 3ZETA 1BQMB 1H73A 3UVJB 3LAMA 1IR2A 3FRYA 2OPQA 3NCPA 4P2MA 1CXQA 3BGUA 2DNLA 4DR1K 3TA0A 4BQZA 3TJAA 1MNEA 3HM9A 4CGHA 3AVNA 1NMEB 1OQ6A 4X4QA 3VAJA 3NS5A 2YX7A 4ZK7M 3CCJS 4ZLJA 4FLTA 4RBTA 4Q0BB 2P9IA 4ED3A 3DGPA 1JL1A 2KYZA 2JDJA 2NXEA 2G8KA 5C12A 2XWXA 2OPRB 1GXLA 2MKSA 1DGKN 2QWQA 5DM7Q 2BA9A 1HNIB 3MX5A 4ED5A 3U9DA 4YOWA 1SQKA 2KG1A 5JLFA 2C3OA 2P6SA 3OYNA 3DYAA 3IKMA 2LXIA 3H4DA 2Z1JA 3K57A 2F5GA 2FBYA 3SDEA 3G8QA 2HEKA 3T1YK 4HUGA 3FZMA 2DEJA 3C14A 3CXCR 1X0FA 4EZ6A 4TU9A 4WFXA 2F8MA 4H4KC 4FJNA 5F8HA 3ITHB 3AAPA 5BN8A 2A3ZA 3S7RA 2VWJA 4DLEA 5KFXA 4AXIA 4KH5A 4UY8O 4FO0A 3DM2B 4CEBA 4JRQA 3LP0A 2Z2LA 3QIDA 5KAKA 5B0CA 4G3IA 3CJKB 3VGVA 4FYDA 2B4JA 1HD1A 4ZN3A 4PAAA 2OJ3A 4B8CA 4RWTA 3HVTB 1UKUA 3VAFA 3ILIA 3N4QA 2KVIA 4I1TA 5BRDA 3IR5B 4F26A 1HNWK 3CULA 4K4YA 3NVKA 3TVZA 1NAQA 1NSKL 3FBFA 2XO7A 3QIPB 3O1BA 2QRRA 3HSTB 2ETJA 4OZ1A 4DFKA 4FWNA 3I6PA 2MXYA 3QSYB 4UTGA 2BR0A 4WKYA 3KYLA 2A2DA 2XEXA 2YJFA 4CYUB 4AUKA 1URRA 3Q8PB 4M94A 3OHBA 1HR0J 2RE2A 4FZYA 3ZTQA 2PN6A 2DHAA 1U09A 4I69A 5G0RB 2F4FA 4AD6A 3NFAA 4GKJF 4YDUA 1BQNA 3KFWX 1QVGM 2H3GX 1KNZA 4KGKA 4QS7A 3EEQA 4LT6A 1RA6A 2G0IA 3M32A 3KLEB 4IYQA 3FC9A 3AVGA 4JV0A 2W25A 1VQ8N 3TSQA 1HNVA 3C16A 3HKZD 1CJVB 4DR2J 1FK9A 2GWJA 5F8GA 2XZTB 3BDPA 4OYMA 4WP3A 4WYLA 2EWHA 3T41A 1QQMA 4Y2MA 3WQUA 3IR6B 2KN4A 2ROEA 3QLHB 3BP8A 4CZGA 3CHWA 1BI4A 5I42A 5ADZA 3KLVA 4FZVA 3A3PB 4KV8A 5DG7A 1NM1A 3MF5A 5HQ8A 2IYGA 4KTQA 2MY8A 5KFUA 3LANA 2OI2A 5C2FA 5KFAA 4NRUA 1DTQA 4TY8B 2AMCB 1TYQA 1VLOA 2RILA 1H74A 2R2RA 1H98A 3O9TA 1JLFB 4DR7J 1S9GB 1RAOA 3LWMA 2AYEA 4DHVA 4GNIA 3VQ8A 3QYYA 1N0UA 2XRIA 2FHOB 5CZ2A 2FJAB 1AA1B 3PIPL 3HI9A 3FBCA 4PYDA 3OXGA 2JEGA 5E3RA 1WF0A 4G6VB 3RYLA 1FHTA 3H5SA 5FDLB 3SUPA 1X9SA 2IVMA 1Y5IB 4I6MA 1VHXA 4NLCA 2VPXB 1NOYA 4RNHA 1S6OA 4EEYA 2YQ0A 2VZ9A 4CLFA 4PUOB 1HNWJ 4IR1A 1SJRA 5SUHA 4IFVA 4LR8A 2EBEA 5BPLA 4EBEA 4Q2MA 5B0FA 3RMAA 2QYCA 1Q9YA 2DNYA 3I31A 2GO8A 3U3YA 3CFPA 4Q2LA 3ZXWA 3BEXA 2F4VJ 4B08A 4UW2A 4F7VA 2MTLA 4C0OC 2QA4G 4PXEA 1IBMJ 1IR0A 2HGLA 5AT1B 1Q5YA 5K8NA 4DHYA 1NRKA 1Q8BA 3ZT3A 2YHXA 4YOUA 3DXMA 4K8XA 2RKIB 5E3CA 4DTMA 2Q0UA 2AX0A 4CEZA 4CEEA 3KK1B 1EXQA 2HVHA