1REVA

Hiv-1 reverse transcriptase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title The structure of HIV-1 reverse transcriptase complexed with 9-chloro-TIBO: lessons for inhibitor design.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 145
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1revA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1revA05
3TVKA 4YFUA 4KE5A 2HNYB 4ED3A 5SWMA 4U7CA 1YVUA 4B3OB 4OLAA 1UA1A 3AVFA 2XGQA 2AGPA 1UWBA 4M45A 4O3RA 1BQNA 4AHUA 1XI1A 3K59A 4OJRA 1VSIA 3NE6A 3DLEA 4ELTA 4YR3A 3G86A 4CJEA 1VRUA 3QO9B 5KFAA 4H8KA 4CFBA 4CJFA 1ZTWA 1RAJA 2R8IA 4J2AA 4ED1A 5I42B 2HB5A 1U09A 4E19A 4JV0A 3KD5E 3QZ7A 1BISA 1IKWB 4J9NA 3DDKA 3VA0A 3OSNA 2RF2A 4NLOA 4RZRA 1LWFB 1VSKA 4DTUA 4ZMMA 4LD0A 2FLLA 4JV1A 2G8WA 1CLQA 4B08A 3UQSA 3DYAA 1RTDB 4FW1A 2R8GA 2ZQBA 3LP0B 1JLFB 3OVNA 5KFUA 4W5NA 5C42B 1D8YA 3M9OB 4ZP8A 4WE1A 3CO9A 3HJFA 4G1QA 1JLCB 1WN7A 1S0OA 4KHSA 1VSDA 1C0TA 2F8SA 3V9XA 2OYQA 1S49A 4W5QA 2AJQA 3E01B 4M42A 1U49A 4BDYA 4U6PA 3AVCA 3GV7B 2F8TA 3PW0A 3OYKA 5F8GA 4JS4A 4RW6A 3KK1B 3OL7A 2F8EX 3S9HA 2OZSA 2IJFA 5KFIA 1L3UA 2KQ2A 3V6JA 5J1EA 1VSEA 3QERA 4NCGA 5DG8A 3Q8QB 1ITGA 1KCFA 3VQ9A 3H4BA 3ALYA 4CEQA 4IQXA 1KLMB 4RUCA 3EY1A 5KFCA 1KSPA 3TWHA 3PX4A 1BHLA 3OL6A 2HHVA 1D1UA 4FJ9A 4NLWA 4BE0A 1SH0A 4RNFA 2Y1JA 3VQEA 2OPSA 1RDCA 3BR9A 1U04A 1NJXA 3OYNA 1RDBA 1S9EB 2WONB 4WFZA 3V4IB 3H4DA 2C2RA 3DLKA 4FZYA 1CXUA 2G8UA 4IRDA 3LDSA 4LSLB 4C8NA 1BGXT 4Q0BB 3BSOA 1Z25A 3V81A 1JXBA 1HQUA 1I3AA 4BWJA 4MK8A 1WSJA 4RW8A 3MEEB 1REVB 5C5JA 1DTTA 3SQ1A 1IKVB 4DU1A 5EDWA 1S0MA 2BE2A 4OLBA 3RWUA 1S1UB 3G6YA 4IRCA 3D28A 1WSEA 1S9GA 3SI8A 4CIEA 4K50A 1LW2B 4CJ3A 5KFRA 3PHEA 2C28A 4O55A 3CIZA 1LWEA 4FLUA 2KTQA 3PJXA 2AX0A 2D5RA 1MU2B 4AH9A 2B5JB 4E7HA 5HROB 1U48A 4QWDA 3P5JA 4B9MA 2BQRA 1RBVA 3I5CA 3ISNC 3AVJA 2EX3A 2R8HA 3SQ4A 3I0RB 1RT5A 3OL9A 1HPZB 2PYJA 3PR5B 3AA4A 3ZT3A 4Z4EA 2G8KA 2QXFA 5EU7A 4E7JA 1KFSA 3BGRA 5K14B 3AVGA 2HNDB 1T7PA 4IBNA 1LAVA 4J9QA 2RN2A 4Z4HA 3CVKA 4ZVEA 3QETA 4DL4A 3K5MA 3IG1B 3KJVA 1QAJA 2BANA 5DQHA 3QIOA 1N5YB 3CG7A 4OKEA 3MEGA 3KLFA 2C2DA 3VN5A 3PO4A 1RTIA 4I2QB 5FDLB 4Q8EA 1NKEA 3TANA 5KRSA 3VQPA 4LSNA 4IH7A 4M41A 4FJHA 4CE9A 4XPEA 4FJ8A 3V1RA 3RBDA 4KKOB 1QUVA 3K5OA 1GOBA 4CJTA 3CWJA 1LW0A 2X78A 4C8MA 1S9FA 1QQCA 1DTQA 4M3TA 3EZUA 3SUNA 1RT1B 3HSTB 4IKFA 2RDJA 3F9KA 4FLVA 2VG6A 1RT2A 4AHTA 1YTUA 3PY8A 3U3GA 3KHGA 1TL3B 4CJQA 4NYFA 4KAIA 3LPTA 3AVIA 1C6VA 3CYMA 4CJKA 4KHUA 3SUOA 4FBUA 3VQCA 1NK8A 4W5RA 2FVRA 2IGIA 3HP9A 2R8JA 4IFVA 2IS3A 4FLWA 1ZBIA 2VG5B 3D5MA 3CFOA 4Y3CA 4E7LA 3MR3A 3HL8A 3QEWA 5L9XA 1S1TB 2C2EA 3QNNA 2IM2A 1WSGA 2D3UA 4RW7B 4O3SA 5KI6A 4QWCA 3L2UA 3PW7A 3V6KA 3OSPA 4IR9A 1TKDA 4ZTJA 3OS1A 4RNMA 2WK4A 3SPZA 1S5JA 3KTQA 3KLGA 1HNVB 4FBTA 5C25B 4IKAA 4M3RA 2GBZA 4F50A 1N6QB 5JUMA 2VA2A 1JX4A 2HVHA 3ZSZA 2JEFA 1LWCA 1SV5A 1JLBB 1T94A 3S3NA 1JLQB 3QYYA 4NLSA 1MMLA 3KLVA 4KHYA 1RDRA 5HRSA 4E7IA 3RBEA 3JYTB 4OKKA 3SCXA 4ECZA 4Y1CA 3ASMA 2VG7A 1ZBUA 3OY9A 1WSFA 4QWEA 3O3HA 3ITHA 4CJWA 3LP2A 4DTXA 1HYSA 2OPRA 3IS9B 4QOZB 4ZPBA 4Z4IA 3ZCMA 4ECTA 3DI6B 2YNGB 1S6PA 2AU0A 4DTNA 4H4MA 3SV4A 4ED7A 3CDUA 2W8LA 5J2PB 1S1XB 4WZMA 2I1RA 3UR0A 3HVTA 3PUFA 5F8MA 4LQ3A 3IRXB 1C1CB 1BI4B 1KTQA 3H2LA 3OS2A 4FM1A 2O4GA 4R5PA 2FVPA 2QV6A 4TYAA 2FLNA 4EP4A 4B8AB 5HBMA 1WNEA 1S1VA 1XR7A 3OYDA 1S6QA 4PQUA 4RNNA 4XIUA 4MK7A 1CZBA 3FQLA 3TAEA 1RT3A 1TKTB 5L1IA 4ID5B 1SUQA 3V6DB 1TV6B 2FBYA 4ELVA 2FVSA 4NYZA 4LH4A 4DTPA 4FJIA 2YNIB 2O4IA 5DGAA 3NHGA 1JL1A 4WYLA 3T5LA 1WNSA 2IJNA 4O4GA 1TL1A 3M8PB 2DFEA 3RR8A 1C1BA 3M8QB 1NKBA 3IN5A 3HO1A 4NRUA 3DM2A 4O0IA 3AO3A 4DG1B 3RR7A 3AV9A 2FBXA 2DPJA 2G8VA 3ZSOA 5J2NB 3QIPA 3E51A 4ED2A 3NGDA 3T1AA 2B6AA 1CZ9A 3SI6A 4KV8B 5KG0A 1QE1A 5FROA 5KT3A 4KO0A 3Q8RB 1N48A 4DSJA 2YNHB 3KLIA 2P51A 3BREA 4KTQA 5T7BA 5KFBA 3SFGA 1NJWA 2IC3A 4CF2A 2XRIA 1HMVB 2YKNA 4J9MA 2QK9A 2RDIA 1RTJB 4NLQA 4B3OA 4CJVA 3GIJA 2IAJB 4RW9A 4CK3A 4CECA 1UAXA 3V1QA 2XY5A 4IG3B 4PWDB 1NKCA 4K4TA 1U47A 4CEFA 3HPHA 3OYLA 3TAMB 1BIUA 5EWEA 3L2VA 5T14A 4RW4A 3QO9A 3AVBA 4LQ9A 3KLHB 4YMEA 2W9AA 4C8OA 3K5LA 4DQPA 4IH5A 2HMIA 2XWYA 5I3UB 3QGGA 3RMAA 2UUTA 1RYSA 4DLEA 3CJ4A 3FSIA 5I42A 3T3FA 4TLRA 2YV0X 4OL8A 2XC9A 5JS1A 4K4UA 4B9SA 4ZHRB 3PX0A 1S0NA 1NOYA 4MKBA 1YVFA 4CJUA 3PX6A 1T05B 1LWFA 3K2PA 5KFVA 1RNHA 4K4YA 2HNZB 4H4OB 2WTFA 1RDDA 3L2RA 3K57A 5KFLA 4TYBA 4DMNA 1Q9XA 4FXDA 4WXOA 3PZPA 4NLPA 4ZP6A 1VSLA 5F9NA 1SL0A 1JLFA 2RKIB 2ASDA 4KHWA 5KFPA 3BSAA 1BQNB 4Q43A 3NFAA 4DS4A 5DK5A 2D41A 2BRLA 5HLFA 3DLEB 2B4JA 4URSA 4ED6A 1WSHA 2D0BA 1JL2A 4R8UB 3U3YA 1RT6A 3E01A 5DLFA 2PZSA 5KFYA 1VRUB 2G8FA 3GV5B 1G15A 1TQLA 3H5YA 3S3MA 2I5JA 2OH2A 4RNOA 3BQ2A 5EWGA 1TVRB 4EYIB 4O4RA 1KHWA 2P5GA 3KK1A 2EC0A 3HP6A 4H54A 4J2DA 1RA7A 2W9BB 2QKBA 4WFXA 4ZVHA 4CGJA 4C8KA 5KT5A 2RF2B 1BQMB 3RB4A 5DGBA 2YNFA 1XHZA 2IM3A 2HHTA 3HPGA 3JSMA 1ZBHA 5KG1A 2CJQA 3IGNA 2HHQA 4DSFA 5KT7A 3DYAB 1I6JA 3OYMA 4KB1A 4FJMA 4K4SA 3KK2B 4E1NA 1XR5A 5DMRA 4HHTA 4WE1B 1WAJA 4F4WA 4AHRA 1TKZB 4G1QB 5KFFA 2OZMA 1S9EA 3EPIA 1A5VA 2J6SA 4DF4A 3V4IA 1VRTA 4O3QA 4EZ6A 2KW4A 4LSLA 3KKSA 4J2BA 2ILYA 2IDOA 4DFJA 3NDKA 1DLOA 4DL3A 4YP3A 1D9FA 1VSMA 1HYVA 3AO1A 5KFSA 1RBSA 1HNIB 4RW6B 3QEIA 3AO2A 1REVA 5JXSA 3H98A 4O3NA 1VSJA 1A5WA 1JLGB 1IKVA 1FKOA 2IBKA 5D3GA 2XCPA 3DOKA 2QE5A 3OLAA 1L3VA 4ECYA 3NGYA 1T8EA 4M3WA 2CKWA 3PO5A 2D0AA 4ECUA 1ZBLA 4KSEB 2ALZA 4Z4GA 1MU2A 3LPUA 3P83D 2B5JA 4FCYA 4ED8A 5DQGA 4Q8FA 4JRQA 4TQRA 4WYWA 3SFUA 4CGGA 1D5AA 2A1RA 3RAQA 4FJ7A 4JRPA 4NLVA 5KG6A 3RRGA 1HPZA 3N6NA 2Z1GA 2WB4A 4E0DA 3MAQA 5KG2A 2R2SA 2P5OA 4B9LA 3KMSA 1KRPA 3OJSA 3SV3A 3DLKB 2BR0A 3LAKA 5HP1A 1RT4B 4NLYA 3N6LA 2ITGA 3RB0A 4TQSA 4CERA 3UPFA 4HYKA 3QEVA 2HNDA 3CDEA 1RT7B 1HQUB 2R2TA 3O4NA 4RW8B 2WOMB 5KFHA 3IG1A 1SKSA 3QGHA 1DTTB 5C24B 1JKHB 3NKYA 3HPOA 4QWAA 3KNAA 2XGPA 3BJYA 3DRRB 5KT4A 4N5SA 5F8HA 2E9TA 1ASUA 1BL3A 1RYRA 3VA3A 3WNFA 2BRKA 1J54A 3AA3A 3NH1A 4DSIA 3NAIA 1FK9A 2OPPB 4AHCA 4C8LA 2V0NA 3GQCA 4ECVA 4IFYA 1N56A 4OGCA 4DTMA 3MEDB 1ZBFA 5E41A 3M9MB 2B43A 4DTJA 3UIQA 3AVAA 3I8DA 4Q45A 1IKXB 2UVUA 1RT1A 3TR8A 4KHQA 4K8ZA 1KFDA 3FDSA 2IMWP 2W9CA 4KB0A 1RT5B 5F8JA 3DRSB 4B9NA 5J2MA 2XCAA 4NLGA 3T5HA 3T5JA 4W5TA 3O3FA 4HUFA 3KD1E 4RNHA 5CYMB 5CYQB 4KREA 3BGRB 2IM1A 4JS5A 4QPXA 4ZPDA 4XO0A 2OPQA 3L2WA 5KG5A 4K4VA 4GC7A 1VSHA 2D7SA 4ICLA 2JC1A 2XY7A 2VG5A 3KJVB 3I5AA 4B8CA 4KRFA 2BANB 1RDAA 3QEXA 2HW3A 2HWHA 3MEGB 4DFPA 1RTIB 4CEOA 4UQGA 4MFBA 3DLRA 1S48A 4RW7A 1R0AA 4N76A 3MR6A 4HCBA 2EHGA 2J6UA 4LSNB 1K1SA 4BACA 1X1PA 1ZYQA 3AVHA 3LP1B 4CHQA 3ZSWA 1NK4A 4WXWA 4KHRA 1RILA 1LW0B 4BDPA 4J9OA 3DRPB 1DTQB 3HHKA 1S10A 4Z4FA 5C25A 4ZTFA 3RB6A 3AA5X 4DQIA 1C0UB 4Y2AA 3BSCA 5KRTA 4DTOA 3TARA 2VG6B 3ZSXA 4XPCA 1RT2B 1HQEB 2JGUA 4ZPAA 2D0CA 1JLBA 4B9TA 4MIBA 4I2PB 3I0SA 4FYDA 3L3VA 1ASVA 3OYBA 4IG0A 4J9KA 2JLEA 3AVKA 2RPIA 2G8HA 3L2QA 2GUIA 4IFVB 3V1OA 4KFBB 4O0JA 4N41A 4PUOA 5DLGA 3AO5A 3AA2A 3NH0A 3BQ1A 4K4XA 3DI6A 2YNGA 3C6UA 4CGIA 3KK3A 3G6VA 3DOLA 2BQUA 3OHAA 1WAFA 2W7OA 4QCLA 5J2QB 1SKWA 1Z26A 3RTVA 4CHOA 5J2PA 1S97A 1LV5A 1T03A 2AQ4A 4CGHA 4CFDA 3IRXA 1SKRA 2YKMB 3NH2A 3QEPA 5KFEA 1RCHA 3SYZA 3OYCA 2ZD1A 3HVAA 4FJXA 4MIAA 4IH6A 3WNGA 3BQ0A 1C0MA 1FKPB 1TKXB 1X9SA 1EP4A 3F73A 4CJPA 5KGWA 2R7YA 3PJWA 4DQRA 3RB3A 1KVCA 4DWIA 4BWMA 4DTSA 4DF8A 2FJXA 2IM0A 1RBRA 3TABA 2KFZA 2V9WA 4ID5A 4TXSA 4CFCA 1TV6A 2Z1JA 3DLBA 1IG9A 1CSJA 1RBTA 1EX4A 3LP2B 1GX6A 2YNIA 4NCBA 4M95A 4EEYA 2WCXA 4B9UA 2ZE2B 4DFKA 1EETA 3KHLA 2X6SA 3K58A 1S6PB 4Q44A 3M8QA 4H4MB 2VA3A 3DMJB 3DLHA 4RUAA 3B6OA 1XR6A 4DG1A 3GV8B 2G8IA 3ICLA 3ZT1A 1Q8IA 3HVTB 3TI0A 2FLPA 3FFIB 1JLEA 1K1QA 4URGA 5KFJA 3ULDA 4CIFA 4ECRA 2YHAA 4KHNA 4IDKB 5DQIA 3CJ0A 2GC8A 1HJRA 3KLEA 5KT2A 4KV8A 4DLGA 3DLGB 3QESA 3HYFA 3OYIA 3H5UA 4QW9A 1J5OB 4I7FB 4TY8B 4ZP7A 4J2EA 4JLHA 2F96A 1L3SA 2HHSA 1JLAA 2XO7A 3QGIA 1S1WB 3QLHB 4FK4A 1S6QB 3HVRA 3CFPA 1HMVA 2IA6A 3C6TA 3CQ8A 1ZETA 1T3NA 1RTHB 3TAFA 3NCIA 1J9AA 4CJSA 5HRNA 1Q9YA 2XI3A 5KGXA 2IAJA 1U4BA 3TAQA 4FK2A 4OGEA 4PWDA 2QKKA 1SUQB 4ECWA 2YHBA 4DL2A 4EZ9A 1WLJA 2Z1IA 4OPJA 3PW5A 4CK2A 4DFMA 2WRMA 4O44B 2HNYA 2AWZA 4O4GB 1TL1B 4YQWA 5KT6A 2DFHA 2HWIA 3OLBA 1C1BB 4KTZA 3KLHA 2FJWA 1QSLA 3AO4A 4CF8A 3SNNA 4FK0A 1TAUA 2GV9A 4Y34A 4K4WA 2JEIA 4HVJA 2IOCA 1C2PA 3NBPB 3QIPB 3MECB 5KFTA 1GOCA 2B6AB 4Z4CA 2P1JA 1QE1B 4KO0B 4DS5A 3ZSVA 4F8RA 1TAQA 1IKYB 3MFHA 1X9MA 4RG8A 1B9FA 1VK0A 1XWLA 4CEDA 2YKNB 5KFXA 1IKWA 4Z0UA 3PVXA 3QNOA 2X74A 4F4KA 2BDPA 2FC0A 3VQ4A 4RW9B 3CM6A 2VWJA 2RKIA 3RMDA 4F2RA 2E9RX 5KFQA 4R0EA 3NGZA 4N47A 4J9RA 4DU3A 4TN2A 2ASLA 4KPYA 5SZTA 3MXJA 2FBVA 2KZZA 3SQ2A 3EPGA 4CF0A 4R8UA 4CEEA 4RW4B 4RU9A 1RTDA 5KTQA 4IRKA 3LP0A 1UWBB 2HMIB 4CEAA 1TVRA 5C42A 1X9WA 4HUEA 3U6FA 2D3ZA 1QS4A 1JLCA 4FLZA 4CEBA 1QSYA 1KVBA 2VWKA 2XHBA 5JS2A 3HXMA 4F4XA 4EO8A 2W9BA 4DTRA 3ZSRA 1NJYA 4J9LA 3KHRA 1BQMA 3V6HA 3HKWA 4M3XA 1OS5A 3T5KA 5F8NA 4DSEA 3M8SA 3I5BA 2UUWA 3EYZA 1EXQA 3Q8PB 4M3UA 3H08A 2W7PA 4O3PA 4FJNA 3S3OA 5CY4A 3MXIA 4FLTA 3KK2A 3G6XA 4JV2A 1RA6A 4HCCA 1JXLA 5DG9A 3CDWA 3CM5A 4EO6A 1KLMA 1TKZA 3CJ5A 4GW6A 1ZTTA 2C22A 5HLFB 4CHYA 4FLYA 1QAIA 3V9WA 1RT6B 3T19A 2LSNA 1RBUA 2W42A 3WNEA 4BDZA 2I5JB 4NLTA 4ZVGA 4DL7A 4ECSA 5F8LA 1D9DA 1NHVA 5KG7A 4I9LA 3NF9A 3VQDA 3CJ2A 2WONA 1UA0A 1HNIA 3LZIA 1C0TB 4PA1A 3WNHA 4CIGA 1JLGA 4DSKA 3NF8A 4O3OA 3IAYA 4CJRA 3SUPA 4NLUA 3GIMA 3H40A 1NOZA 3NF6A 4O5BA 4Q0BA 4CHZA 1BCOA 5KFNA 4AHSA 2YNFB 3SUQA 1O1WA 3L3UA 3JSMB 1FXXA 1A5XA 3LP3A 3MEEA 3V9UA 2R2UA 4KHMA 5KFWA 3NGIA 3CFRA 3VQ8A 1L3TA 5J1EB 5KFGA 3HK2A 5L1JA 4NCGB 1S1UA 4CJ4A 4CJLA 4F3OA 1LW2A 3C95A 3RRHA 4DEZA 2W8KA 4ZPCA 3KOAA 1EKEA 4KTWA 5KFZA 1VRTB 1RT4A 1TGOA 1B92A 3MF5A 4K8XA 3ZT4A 3PW4A 4CJ5A 1GOAA 5HROA 4DQQA 5KG4A 1B9DA 2OPSB 1RT7A 3PV8A 4IR1A 1DLOB 3TAGA 1BCMA 2WHOA 4QAGA 4NLXA 3I0RA 3BSNA 4FZXC 2WOMA 1YTAA 3OHBA 4ZVFA 4OKJA 4MKAA 5C24A 3QIDA 1FKOB 1JKHA 2X6NA 3KKRA 5D3GB 4CHNA 3DOKB 1NHUA 4BE1A 5FRMA 3DRRA 5K14A 4YR2A 3LWMA 4E89A 3V81B 5HRPA 1BIZA 4K4ZA 2HHUA 4ED0A 3SPYA 2FJVA 2FVQA 2OPPA 2HVIA 2JEJA 3SQ0A 4CEZA 3TQ1A 1NJZA 3MEDA 3P1GA 3OYGA 4KB7A 3V9ZA 4X2BA 3VQSA 1N5YA 4AHVA 3D0PA 2KZMA 4I2QA 2AX1A 5FDLA 1IKXA 4GC6A 3OJUA 2ZKUA 2BE2B 3OYHA 3NAHA 4I9QA 3AVNA 4ID1A 4ZP9A 1S9GB 3OYAA 1NK7A 1C1AA 5KG3A 1N4LA 1LWEB 4KKOA 4NRTA 5HRRA 3LZJA 4EYHB 3DRSA 3MR2A 4N56A 5HP1B 4NZ0A 2ATLA 1JXEA 3QINA 2OA8A 3HM9A 2HAIA 3HT3A 3MR5A 5L1LA 5CYMA 5CYQA 2UVVA 2NUBA 3V9SA 2ETJA 1SH2A 4NCAA 3OL8A 2UVWA 4QW8A 4PY5A 3GYNA 3NAEA 2ASJA 3RMCA 5KFDA 4CHPA 3VQ6A 3ZSYA 3H5SA 3QZ8A 1TL3A 4FJKA 1IH7A 3M8RA 1U45A 4EBDA 3FRZA 4FJGA 4OVLA 3KMQA 1UOCA 1NK6A 2BQ3A 1FK9B 2XY6A 3NL0A 4FS1A 2BGGA 3LALA 3LP1A 4IFYB 4TY9A 5CZ2A 1Z4UA 1W0HA 4W5OA 3DRPA 3KLFB 1S1TA 4HUGA 3L8BA 1C0UA 4FVMA 2ATQA 3RAXA 3UDLA 2W9CB 2XY8A 1HQEA 4E3SA 4DQSA 5J2MB 1HNVA 4I2PA 4LH5A 3MXMA 4MQ3A 1WSIA 3GILA 4KI6A 4CCHA 2E6LA 2OPQB 4M3YA 3MFIA 1N6QA 3THVA 4M94A 4YR0A 4QWBA 4ICLB 2O5DA 4KFBA 1JIHA 2GIQA 2AGOA 4FZZA 3TAPA 1JLQA 4F4ZA 3NF7A 1TP7A 5KFKA 4MFBB 5DG7A 1HARA 3JYTA 5J2QA 1R0AB 4G3IA 4DU4A 4FW2A 2DTUA 4GVMA 4CGDA 3LWLA 3PR4A 3B6PA 3VQBA 1NK0A 1QSSA 4B9VA 4DSLA 1KLNA 3O4QA 2YKMA 3IS9A 3OYFA 4JUZA 1I39A 2PYLA 3O3GA 4HKQA 1L5UA 4J9SA 4HTUA 4KAZA 4F3TA 3GIKA 3OS0A 4L8RB 2E6MA 5FRNA 1S1XA 4URQU 1FKPA 4KI4A 2PY5A 1TKXA 4MK9A 2JEGA 3LANA 3Q8SB 1C1CA 1BI4A 3KLGB 4NLRA 4Q5VA 3I0SB 3N6MA 4CESA 4CGFA 1SL1A 4IG0B 1XHXA 4FM0A 2R2RA 1NK9A 4EP5A 4BE2A 1HYZA 4F2SA 4AILC 4CFAA 1LWCB 1J53A 4PUOB 1SV5B 2ZE2A 4KBIA 3VQQA 3VQ7A 3C6UB 3KK3B 3SZ2A 1YT3A 3DOLB 3ZSQA 1TKTA 4FJ5A 3DMJA 2VG7B 4CK1A 4DL6A 5KFOA 3V6DA 1T03B 5KFMA 3ITHB 3SJJA 3G0ZA 4IOBA 4EBCA 1CXQA 3FFIA 1HYSB 2OPRB 1D0EA 1Y97A 3PW2A 1QTMA 1S4FA 4GMJB 4IDKA 2GIRA 3M8PA 2HHXA 3OYJA 3DLGA 4E7KA 2ZD1B 3M9NB 1J5OA 4I7FA 1ASWA 4TY8A 2DY4A 1IO2A 2A1SA 5F9LA 4FLXA 1S1WA 1TK0A 3QLHA 2DFFA 1EP4B 1F21A 3KIOA 2JC0A 5J2NA 2Y1IA 4J9PA 3HVWA 1RTHA 4R5PB 3GIIA 2J6TA 3D45A 3NMAA 4M3ZA 3LAMA 2YNHA 1KHVA 4WFYA 2FBTA 1NK5A 5HBMB 2Z1HA 1S1VB 1NNDA 4PQUB 4F4YA 4ECQA 2E9ZA 4O44A 4ECXA 1EETB 1RTJA 3KHHA 4FS2A 4MH8A 5EUHA 1HRHA 1SL2A 3ZT0A 4YNQA 2AGQA 1RT3B 3A2FA 2FVCA 2HHWA 4TSXA 1TK8A 5L1KA 3H59A 3VQAA 4NYNA 4IG3A 1GX5A 2Q3SA 3K5NA 3H5XA 1TK5A 2XI2A 3CJ3A 1JLEB 3MTKA 3TAMA 3FQKA 3NBPA 4WZQA 3IGVA 3MECA 1KVAA 1LAWA 3ZT2A 4DL5A 4ELUA 3KLEB 3RMBA 3AVMA 2E4LA 3AVLA 3BDPA 5I3UA 2UVRA 1K6YA 1IKYA 3DM2B 5F8IA 4E1MA 4CF1A 1JLAB 1QHTA 3VQ5A 4FJLA 3EZ5A 1XC9A 2KFNA 4Y1DA 4FJJA 3C6TB 2ILZA 1W25A 4Y2CA 4FM2A 4NLDA 4ZHRA 3C94A 1IM4A 5EWFA 4CF9A 4OPKA 2V4RA 1SH3A 3OYEA 3KLIB 1T05A 5CZ1A 2IC3B 3ISND 2DPIA 3G10A 4LY7A 2V4QA 2HNZA 4H4OA 1W9HA 1VSFA 2R8KA 4EBEA
chains in the Genus database with same CATH superfamily
3MMCB 2RS2A 3M8WA 2V94A 1Q5YA 3T6BA 4K41A 3SAFA 3AVFA 2GMHA 4CBXA 4H5WA 2NNWA 4D3GA 4JI6K 3MM7B 4FXWA 4OQJA 4OJRA 4B3SK 3NE6A 5D6GA 4K0KF 3O9SA 3HCXA 1GLJO 3QO9B 5KFAA 1NCLA 2QLWA 2ZH1A 2GGPA 4I68A 1ZTWA 2R8IA 4J2AA 1FNMA 3K8VA 2P9LA 3TUJC 1VQPN 1BISA 1FEEA 4CT8A 4JI8F 1IKWB 2EFQA 4X64J 3S1TA 3OW2M 1VDHA 3OSNA 4GV9A 2L3MA 4DTUA 2HOEA 5HMWA 2YWKA 5LJWA 2NREA 1R89A 2VKZG 5LOQA 3BN4A 4UW2A 2P9KA 3OFHA 3UQSA 3DLJA 1K44A 3NOCA 1BWVA 2BOAA 2R8GA 4TU7A 1D8YA 2DRDA 4WE1A 3K7RA 1RWVB 1R31A 4G1QA 1NNEA 1Q7LB 1B3TA 2OYQA 1FKAF 1R0CB 1TMJA 4AT1B 2RB7A 1WTBA 1HNWK 5AQPA 4FKYA 1U2FA 3OYKA 1W26A 2MKSA 4M1KA 2FUG9 5AQKA 2KFYA 5KFIA 1L3UA 3HM8A 1O8BA 3MURP 4KJIA 5DG8A 5IWAF 3VQ9A 3H4BA 4CEQA 4Z7CA 1KLMB 2OGUA 1SQEA 1C4CA 1H73A 2BJDA 3MDFA 3CJBA 5KFCA 3TWHA 1BHLA 4DV3K 2HHVA 2A5XA 1ZAXA 3L7PA 3KUGA 3IM8A 4RNFA 2OPSA 1RDCA 1NJXA 3OYNA 2GVZB 2WONB 1W7AA 4JKAA 3THXA 2VQFJ 3DLKA 2XMKA 3AY0A 4WF9Q 4WIQA 4RJVA 4PCQA 4W98A 4E8UA 4NXMF 4Q0BB 3M6UA 3V81A 4AF1A 2FHJA 4FWRA 2Z56B 1VQ5S 5D4NA 2QWMA 3EO3A 2KJVA 1P90A 4I6YA 3ZZOA 5C5JA 3I9V9 5A8WA 1H2UX 1PIEA 2PT0A 5IS2A 4IRCA 1WSEA 2R7SA 4CIEA 3ZEUA 1LW2B 2WSEC 1KOOA 1GQEA 4CJ3A 3PHEA 3W9IA 3OW2R 1RWXB 1LWEA 2KVQE 3UB5A 3PJXA 4IEIA 4L3KA 3TTDA 4OPAA 4DUTA 3ZXWA 4KH0B 5HROB 2E5LJ 3ISNC 3AVJA 2J8SA 2HFVA 3J81Y 3R3LA 2R8HA 4H5TA 1NDCA 2ERRA 3C6HA 4DPWA 1X4HA 4MO5A 2KLAA 2G8KA 4B9QA 1Z05A 2E1AA 3IBWA 5K14B 3AVGA 4F9OA 5BR8J 1T7PA 1YJWN 3TJAA 3MX5A 4J9QA 2GMJA 4J9UE 3CVKA 4DR1J 4DL4A 2ZBCA 4RWWA 2GJFA 4PPZA 1UMJA 3O2IA 3KJVA 3LA0A 3SQGA 3Q8UA 3QIOA 4OKEA 3MEGA 2C2DA 3J80Y 2XB2D 2C3PA 1YITS 1T6DA 3VQPA 2EFGA 3TX8A 3QRPA 2YKOA 1QY7A 3RBDA 4KKOB 2E7WA 3OVAA 4CYUB 1GOBA 4UF4A 4CJTA 2CNNB 3DRYA 4H5RA 5LM7E 2MHNA 1WB9A 1N5QA 4IKFA 2RDJA 1KN6A 2VG6A 1RT2A 4AHTA 3D2WA 4GKJK 1FX4A 1U1OA 1X9JA 2CPEA 2CZ9A 3T6JA 1T9UA 2HVZA 1C0FA 1NBEB 3LPTA 3CYMA 4MYUA 2HQGA 3VQCA 2BEFA 1NK8A 3O9TA 1JQGA 3MD1A 3M2VA 3GWCA 3EL2A 2QA4G 4LIWA 2R8JA 3QJPA 1BWEA 1NDLA 1JJ4A 2RILA 1RHUB 2H5JB 1GLEG 1YG0A 3MR3A 1VQSA 1S22A 5EX3A 3DAWA 1S1TB 3D6TB 4RW7B 1QDUB 4QWCA 1HBNA 3H42A 4CZGA 2NS1B 2LEBA 1TKDA 1U25A 3OS1A 4RNMA 2QIFA 5DZ7A 3SPZA 2Z0GA 3T1HK 3QMLA 1S12A 4OX8A 3F44A 1QVFM 5C25B 4M3RA 1OYDA 2GBZA 4WJBA 1UFWA 5JUMA 4P2XA 4F4AA 2VA2A 1LWCA 3HOSA 2P6SA 1T94A 2CNOB 4NLSA 4PZVA 3KLVA 4KHYA 2B3TB 3JYTB 4BLGA 4Y1CA 4JV5K 4F04B 3Q0AA 3D1OA 5AJ3J 4CJWA 3LP2A 1HYSA 4C98A 2QTDA 3I56S 1M1GA 2D3O1 2AZ3A 1VBYA 2ZH9A 3CEDA 3SV4A 4DR2J 1S1XB 4ZLLA 2XNQA 2I1RA 3UR0A 4ERDA 3DU6A 1KTQA 3QBWA 3NWRA 3TZYA 1HX1A 2O4GA 3AJ2A 1HBOB 4G65A 5A8KB 3O80A 4K8RA 2FLNA 5HMYA 2NRXA 2BOPA 3FEXB 3EE8A 4HTJA 3T9ZA 3BGFA 2KM8B 1WNEA 4GO5X 1V5IB 4L6V3 2AJFE 3OYDA 3EXCX 4RNNA 4PQUA 4QOTA 4XIUA 1S77D 4H0XB 4A57A 5D4LA 3TAEA 1QUPA 1TKTB 4ID5B 1SC4B 3IAM9 4LUBA 3OUYA 4KHPK 2KYXA 3PRDA 2N4DA 2W24A 1NSQA 4WYLA 2Y3YA 4U7BA 1KVKA 1G7CB 3A5LC 2DFEA 3RR8A 3HO1A 4YOTA 4NRUA 4MJKA 2BJ3A 1Z2ZA 2FBXA 3ZSOA 2CJBA 1VLYA 3E9PA 2VPZB 5AE3A 2JWNA 5KG0A 2G2OA 1OYEA 2OTLS 1N48A 4G1IA 1KOHA 3BREA 4EWTA 3QRQA 3SFGA 1NJWA 2GCFA 2PC6A 3TJ9A 4CD1A 1HMVB 1HD1A 3IR5B 3MPUB 4RUBA 2AEFA 4NLQA 4DV0F 1NGHA 2IAJB 4CK3A 2YWGA 4CECA 1U6BA 2X51A 5FPDA 2EC2A 4GY2B 4AD6A 1HKAA 1BHNA 1URNA 1GTEA 2JFDA 3MM7A 3FZFA 5IV4A 5M1FA 2FDNA 5AQIA 1JXVA 5T14A 4USVA 3QO9A 5DM7Q 4JI6J 2ZH7A 2PFDA 4DQPA 1T6CA 2XWYA 1SJ3P 5I3UB 3VZIA 3MN5A 2UUCK 3IA0A 3FSIA 1NEEA 3C15A 4TLRA 3A12A 2RQMA 2YBVA 4OL8A 4KPCA 1E4GT 1CLFA 4K4UA 3SMSA 4B9SA 3FGUA 4LRAA 4BRMA 4GKKF 2ZWPA 4LREA 1NLVA 2DH8A 1RNHA 2G1DA 4K4YA 2HNZB 2WTFA 3K57A 3O8MA 4JK9A 4ZS6A 4FXDA 4WXOA 3PZPA 5A2QY 5F9NA 1SL0A 2IA0A 1BQNB 4ER8A 2HVDA 4USHA 5DK5A 3IDHA 5HLFA 1TUUA 2RQCA 1RQ0A 2B4JA 4ED6A 2DRAA 3Q7CA 3U3YA 1RT6A 2PZSA 2E29A 2K1RB 3ZETB 3BF1A 3GYGA 4HHJA 3S3MA 2OH2A 5M1QA 1SJRA 1E6VA 1MSWD 1V4TA 3EGVA 2O8BA 3I55S 6FD1A 1HNWJ 3KUEA 3VCDA 4EFHA 4H54A 1RA7A 2W9BB 3JAMY 1WC4A 4JI0K 2AEJA 4HT5A 5KT5A 2QC3A 3L4IA 1MA9B 3RB4A 5AXKA 4JI4J 5G0RB 4WFNQ 1XHZA 2IM3A 3K17A 2UUBK 2QI2A 4LT6A 5AFUA 2CQIA 4I1TA 5KT7A 2NCKL 4HH0A 1HNXF 3ZNJ1 1Y7PA 5IXUA 1XR5A 5DMRA 3W66A 5DO2A 4EMDA 1R3NA 4DV3J 1WAJA 3GJTB 3LF0A 5KFFA 1BE4A 1A5VA 3LH2S 1GMUA 2P9IB 4O3QA 4XK8C 4PL8A 2J9EA 3KKSA 2IDOA 4OHXA 4DFJA 3MMBB 3NG8A 2WSFC 2ZHBA 1JJCB 2B9YA 1WORA 1WELA 1HNIB 4FNIA 3QEIA 1NH8A 1ZH5A 5K5MA 1X4DA 2GS8A 3CCUS 4BBYA 1R6VA 5JXSA 2D4WA 2X3GA 2KG1A 2F8HA 2XCPA 1VQ9N 1N34J 1PILA 3P5TL 4ECYA 3NGYA 2CKWA 5L39A 3PO5A 2DCUB 2D0AA 4QYRA 4CZKA 1ZBLA 1SQGA 5CHIA 5DQGA 2CQCA 4Q8FA 2CZ4A 1SPBP 3SFUA 1GLDG 2VZ9A 3GG1A 1ZS6A 2AP1A 2A1RA 4NLVA 5KG6A 3RRGA 3B4DA 3RBZA 5KG2A 1KD1T 1IV0A 4B9LA 3CC4S 3OJSA 3SV3A 4JI3F 5H1SQ 3N6LA 2AKWB 4TQSA 2FPHX 5EVZA 5D0RA 4DX7A 2NQPA 4CZMA 5D8HB 1HQUB 3TU5A 3C0BA 5HANA 3O4NA 3D9BA 1YJ7A 3OFFA 3J81O 4RW8B 2WOMB 3TR5A 3MOZA 3P38A 4FVUA 4QIVA 1SKSA 2W4CA 3CF5Q 3W3DA 2M4MA 1GLCG 4LR7A 2K3IA 2XGPA 5KT4A 2KB2A 1BL3A 4I64A 4AL6A 3WNFA 3BPSP 3C19A 1IBMF 4AHCA 2AA4A 3BZQA 2V0NA 3W7BA 4ECVA 5BPMA 4CYUA 1ZBFA 2MZQA 4RU2A 4JI2F 4GV6A 4BGAA 2MY7A 3FKBA 1GXLA 2AV5A 3J80O 1KFDA 4OHWA 5B0FA 3OV7A 1M1KT 1RT5B 2Y8YA 1IJEB 5F8JA 3UE2A 5CAAA 3N4WA 2VODA 2ZGYA 5J2MA 1FTCA 1X7VA 5D0EA 2VF3A 1HJOA 3T5HA 3T5JA 1AROP 1TELA 2UYTA 4GKJJ 4DV1K 3HFKA 3BGRB 2FSJA 3T69A 4ZPDA 4XO0A 2OPQA 2VOPA 3OTOF 3L2WA 1SKUB 3CT9A 2F4VF 2VPYB 4B8CA 3RVCA 2HW3A 2HWHA 2HGNA 2L9WA 2V9KA 3RU0A 3DLRA 4RW7A 2QEXN 1HI8A 1OQ3A 5GAHU 1NSAA 5D0HA 1ZYQA 3DXKB 2AJ4A 3ZSWA 4ZJOA 4OYPA 1NK4A 4ANEA 3CDAA 1NGIA 5B0BA 4KHRA 3TA0A 1LW0B 4ES3A 1S72S 4BDPA 1S10A 5C25A 3RB6A 4ALZA 2M8DB 4F67A 3WQPA 3T1HJ 4IZ9A 3ZSXA 4ETXA 3LPEA 9RUBA 1BOTO 3DDIA 1YJ9N 3UKRB 2OI2A 1DRZA 4B9TA 3QT7A 3B54A 2O8CA 5C0YA 3UDVA 2ZITA 3BV8A 1YRTA 2B7CB 3J81j 2CNKB 4PUOA 3PACA 4LF4K 1YRUA 2H51B 4JV5J 2CQDA 3C6UA 4CGIA 2VH7A 3DDNA 1D09B 1MN7A 1GFWB 2GJIA 5J2QB 1ZZFA 3VGKA 3RTVA 3TO8A 4GVLA 4L76A 2XLKA 2AQ4A 2RHQB 2BZ2A 3BZCA 3CSKA 3QJLA 3FFKB 1XMOF 3A8YA 4BRFA 5KFEA 2HFOA 4DMZA 1S57A 2DGWA 3IXQA 1J6ZA 4IH6A 3SCJE 3J7YP 1H0HB 1TKXB 1UVKA 3MCNA 3CJKA 3CCVN 2R7YA 3SSSA 3RB3A 1KVCA 1Y5IB 4MKVA 3TVYA 1LWXA 2IM0A 4BS2A 1RBRA 1N33K 2RUSA 2ZWHA 4ID5A 2C2MB 3S41A 4TXSA 2Z1JA 1IG9A 2NUHA 1CSJA 3FEYB 5I9EB 4M95A 3CGIA 3PLAA 4DV7K 3P31A 4B9UA 1V3SA 2ZE2B 3PYEA 1ELOA 3K58A 5CD4A 2HQIA 1S6PB 2ZHOA 3CJSA 5KPRA 4KHPJ 5E84A 1ICEB 3B6OA 3QT8A 1REGX 2PMHA 3OA9A 1XR6A 1QQNA 1K1QA 1JLEA 2HFZA 3D0GE 3O8WA 4ECRA 3MX2A 4IDKB 2GC8A 1T9YA 3NGSA 4X66F 2E2QA 3H5UA 4RTFD 2Z30B 3D2EA 1HQ2A 2F96A 4WQ4C 1JLAA 2CPDA 3QGIA 4CNYA 4X4NA 1HWKA 2MKYA 2LXIA 3GMGA 3NMRA 3BZKA 3HVRA 3CFPA 1HMVA 2K06A 2IA6A 2JFKA 2H5EA 3AH6A 2YH1A 3X3UA 3NP5A 1Y3KA 2NPIA 4K5SA 2V8GA 3HKZD 3VAMA 1NLKL 5HRNA 2A18A 3C16B 2XI3A 2IAJA 3HT0A 4FK2A 2B7BB 3SSQA 2IRYA 2AYMA 4ECWA 1MMDA 1IQTA 3GU0A 1YQHA 1NJIT 4CK2A 5BJRA 2ZH2A 2NRWA 1BO5O 4O4GB 2LKZA 5M2RA 4A8YA 1LXJA 4DCPB 4H0PA 1LOTB 2ZWOA 4FK0A 1RGIA 1TAUA 5E3PA 4YOUA 4Y34A 2DY1A 3CCES 3B8HA 5M1NA 3QIPB 1WG4A 4LFCF 2DKOB 2UUCJ 2B6AB 1PYTA 1IKYB 2JHEA 1VK0A 1X60A 4K5RA 2VICA 4QR1A 3QNOA 4JB8B 2HVEA 2FC0A 3VQ4A 2VWJA 1FI4A 1DHMA 1EWRA 3RMDA 4I6MB 5KFQA 3E9LA 4R0EA 4N47A 5KQDA 2PGCA 5SZTA 1LQ9A 1P8ZA 2VASA 2YCHA 3U1LA 2GV1A 2AZ1A 2ZZTA 1RTDA 3W9JA 1H7WA 1U8SA 2QL5B 3C65A 1UWBB 2HMIB 5A2QO 4UTGA 5C42A 3A3NB 4HUEA 1S3XA 3Q89A 1QS4A 1YIJS 1JLCA 1VK3A 3E2EA 3P3DA 4CBUA 2FGOA 1FDNA 2XHBA 4PEOA 3LGHA 1H72C 2W9BA 4YN3B 1NJYA 2EXUA 2ACYA 3WXMB 3EDRB 4NLCA 2V69A 1VQKN 1OS5A 3M8SA 3I5BA 3EYZA 2UUWA 2VHGA 4OV6A 2W7PA 5H9EK 4JI0J 4ISFA 3S3OA 4JNEA 3L95X 4O23A 1HR0K 2ASYA 4QZVB 1IXKA 3G6XA 2UUBJ 2CIMA 3P4UB 3CM5A 3BUZB 1BC6A 4DR7F 4NMLA 1ZTTA 1WOOA 1R8CA 3IM9A 4HACA 4Y0WA 1WBDA 4KH1B 2HSEB 1RBUA 3MCAB 5J1PA 4DL7A 1MNEA 3BYPA 2XEXA 5KG7A 1WI8A 2FHKA 2L9NA 2VWBA 4U67L 1UA0A 1HNIA 3LZIA 3VENA 2P9EA 2Z2YB 5MLCQ 3NF8A 2EG2A 1OY6A 4NA2A 4WKRA 3C14B 1N54B 1LK5A 4J5OA 3R5AA 2XS7A 1VQ6N 1IWGA 1WI6A 2XZTB 1O1WA 5AZIB 1N5VA 3KFWX 3L3UA 3WEEB 1A5XA 1U6ZA 3JSYA 3MEEA 4JD2A 2R2UA 5KFWA 3CFRA 4V19X 3W5ZA 1L3TA 1Q7YT 5KFGA 4BRNA 3HK2A 1CZAN 1S1UA 1PSDA 4FDFA 1T9TA 3C95A 4R0JA 4X65K 3GBTA 3VF4A 1YK9A 5B09A 2R7TA 2AP6A 5KFZA 1TGOA 2L48A 2CPHA 4CO0A 1DQ9A 1M5VC 3MF5A 4K8XA 3ILOA 1R27B 1FDAA 4IR1A 1DLOB 1FNXH 1BCMA 4ZCKA 1QD1A 3BSNA 4JI1K 4BR7A 2WOMA 4ZVFA 4C8YA 1G99A 1Y3JA 2QA4S 4MKAA 2WAQD 1FKOB 3AHPA 1NGFA 5D3GB 5CABA 4BE1A 2HS4A 3JQMA 2V8DA 3LWMA 4OX9F 4A2AA 2MLYA 4ED0A 2Q6BA 2KI2A 2FSKA 4LF8J 2DNKA 3L4BC 4N8NA 4X2BA 4AHVA 4LF6K 1G2EA 3HHNB 4I2QA 5FDLA 4GC6A 5JVHQ 3D6FB 2ZKUA 2BE2B 5C10A 1FX2A 2NXUA 2JVRA 1HFEL 3OYAA 1VQMS 1NK7A 5GVQA 4BROA 1C1AA 2ZKTA 1N4LA 3NCRA 3O3LA 1VQON 5HP1B 2ATLA 3VOVA 3WT0A 3HT3A 2ZDPA 2IHR1 2VJVA 3AOAA 3SK3A 3H6EA 3FMBA 1UFKA 3RMCA 3QQCD 4DV1J 3MM6B 1MMNA 1TL3A 2GWJA 2A0FB 1IH7A 1PYSB 2Q79A 3JXUA 4OJGA 2F4FA 1Q82T 1U45A 2HQDA 4EBDA 4FJGA 4OVLA 4E1JA 4M7YA 4HT7A 2BQ3A 1RHRB 3E66A 2E1ZA 2LVWA 2XY6A 3ZX0A 3O6QA 1AFJA 3AB2B 2Q3PA 2KXNB 2AYGA 1BMQB 3BBCA 3T7ZA 3UDLA 2W9CB 3K89A 2XY8A 2J9CA 1U7LA 1F2HA 4CJ7A 1YF5L 3WXKA 2DITA 4PXDA 3GILA 2Y0SD 5ETLA 1MLAA 3VTHA 4DU8A 2E6LA 5K9FA 4HTIA 2O5DA 3UDEA 2AGOA 4H4KA 3TAPA 4DBQA 2MQOA 5KFKA 2ADBA 1EO1A 3SXLA 1X3NA 5J2QA 4JBCA 4DV6F 4G3IA 2XSFA 3UN5A 5ETQA 4FW2A 4LF4J 3LDQA 4CGDA 3WHIA 2V8PA 4FF2A 1EKSA 3ZZTA 1YUWA 1MROB 2OMOA 4HKQA 2OSRA 1L5UA 2XSJB 3H3NO 2CQ4A 4J9SA 4C23A 1ZBTA 4L8RB 2E6MA 3UD4P 2PY5A 1TKXA 4MK9A 3LANA 3EGZA 3KLGB 5LSOA 4X62F 3VF0B 3KJNB 1XHXA 2IFXA 1EAYC 1SC6A 2FB0A 4EP5A 5LMUF 3MM5A 4BE2A 1HYZA 2VKRA 4AILC 3CCQS 3B78A 1SV5B 1T11A 1N33J 2ZE2A 1A0OB 4HHUA 5ETVA 3JTOA 1YT3A 2DRBA 3ZSQA 4YORA 4DR4F 4DL6A 4DV7J 1H74A 1T03B 5DM6L 3NOGA 3R97A 3SJJA 4ES2A 2HWTA 1CXQA 4O8UA 4AL5A 4ZVQB 4IDKA 4J37A 1DGKN 2HHXA 3OYJA 3RUBL 1OSDA 1ACMB 2DY4A 1IO2A 3EKUA 4IO1A 1NB2A 3W61A 3IWLA 2DFFA 4C2MA 3ZZUA 1EP4B 4NYPA 1FVSA 1KXPA 2LQJA 5J2NA 2ZOGA 1A9NB 2Z8QA 2DH7A 2DNZA 1OMSA 4M3ZA 2HAFA 3ZC4A 3VAGA 2RD5C 1KHVA 3I32A 1GLLO 4UZBA 1NNDA 4X4UA 2E9ZA 1FDBA 5IM0A 2ZBPA 3DOMB 2BE7D 3QJJA 4B3MK 4XEIA 1SL2A 5A6PA 1RWWB 2AGQA 1RT3B 2V52B 4XH1A 1TK8A 2WZ1A 3H59A 1WEYA 3K5NA 3H5XA 5E33A 1LXNA 1NXIA 3CJ3A 1HWIA 1SS6A 3TAMA 2OHDA 4CH0S 4DI6A 5ETNA 3ZT2A 4DL5A 1I94K 3KLEB 5AQUA 1HL6A 2DEJA 3JQJA 3AVMA 1XMQF 2A42A 3BDPA 3TZXA 1XNRK 4LFAF 1IKYA 3DM2B 5LL6Z 4FJLA 5BPLA 3G71S 4LF7K 5FJ4A 2ZEJA 2ILZA 4Y2CA 3IAS9 3Q8VA 2OKQA 2VQEF 2KRRA 2W2QP 5GADI 5EWFA 1EQ0A 4YOEA 2Q31A 3KLIB 1T05A 4I6MA 5CZ1A 1T9WA 2YHXA 1T02A 2IC3B 2QYCA 2MJUA 2R8KA 5IT9U 4KE5A 1M1KO 2F3JA 4U7CA 1YVUA 3C3LA 1UA1A 1WUAA 4FF1A 1NPPA 2B4VA 3CCTA 1Z2LA 3J7AP 3O1BA 1UWBA 5AFUH 4O3RA 4PRFA 3MMAB 2BJ8A 4HHHA 4AHUA 4FYXB 3K59A 1YJVA 3SCKE 1WJ9A 3PIOL 3CCRN 2XLJA 1HIYA 1KVJA 4H8KA 4K0KK 2ROEA 2EFOA 2YPZA 1GMVA 1IBLF 4CFBA 4DR6K 4UOHA 4ED1A 2HB5A 4WYBA 4Y2KA 2WW4A 3QZ7A 2YX4A 1HWLA 2N7YA 4X64F 1HLWA 5AQXA 4AXIA 5GMKa 1RISA 4JI8K 2O3DA 4NLOA 5GAGI 5H9EJ 1LWFB 3ZFVA 3RGIA 1HR0J 3PSFA 4ZMMA 3BO3A 3GJSB 4B08A 3DYAA 2OTJS 3M3ZA 3EN9A 2UP1A 2ALYB 4P73A 4PHTX 3LP0B 4ZN1A 3CMES 3ENBA 3VEZA 3MPWA 4ZP8A 2HKEA 3HJFA 3UO0A 1WN7A 1S0OA 2MHEA 1O6XA 2AJQA 1NSKL 1VQLS 4FPAA 1U49A 1HBMB 4DN9A 1H3DA 4BDYA 3AVCA 1D3WA 3V4MA 5CZXA 2PMWA 4KBOA 1WEXA 2DR5A 2G0CA 1FRMA 4C4WA 3WEEA 3KK1B 2G2YA 2F8EX 2OZSA 3M2RA 2PA8D 2VFUA 4YEAA 2HRTA 2O8DA 3IMXA 4JI5F 2V8HA 1VSEA 4OZ1A 3QERA 1U2RA 2Z58B 1ITGA 4OI2A 4M5LA 4IQXA 1K8KB 4A5AA 3M30B 3G96A 3OBWA 3BF3A 2KN4A 5IWAK 1O5JA 4RUCA 3EY1A 1WG1A 3R1XA 1KSPA 3J7AN 2MQNA 4BHQA 2WFBA 1JCFA 3H1VX 4EIAA 3M5RA 5LXYA 4X65J 3BR9A 4QYZK 1U04A 4DV2K 1RDBA 1X5OA 1NHKL 2WTUA 4BRPA 4WFZA 3C2PA 2V63A 1FE4A 5HL7Q 3M1FA 1CXUA 5I3PA 4LSLB 1X5PA 4JI1J 1FJGJ 4BRQA 2UXDF 1XQIA 1Z25A 4BWJA 4P74A 5IT9Y 2QL7B 1CC8A 1R43A 4NXMK 2KXFA 1WF1A 4WFAQ 2HBRB 3EGNA 2IIHA 2BW7A 2N3OA 1QVGR 3SQ1A 1IKVB 1RU1A 4KC5A 4P10A 1S0MA 2BE2A 3RWUA 4MKYA 1TYQB 4IOCL 4K50A 5KFRA 3HHLB 2C28A 4O55A 5J1NA 4YB6A 4FLUA 3NVKA 2KTQA 2YX6A 1WC3A 3WXLA 4AH9A 2ZH6A 2C2NA 1RWPB 4B3RJ 1U48A 3P5JA 3WX8A 3D0HE 3I5CA 2XHCA 3FZMA 2EX3A 3I0RB 1HPZB 2PYJA 1Q79A 1S99A 3MM6A 4PXBA 1LFPA 3ZT3A 4LF1A 2OAUA 3ZO7A 5F3TA 1RK8A 4EUVA 4J91A 2LMIA 1VOMA 3LOUA 3MGJA 4IBNA 5AE1A 2RN2A 4E98A 4DZ6A 5IOLA 3DXMB 3K5MA 3RZAA 4KR0B 1YVNA 3SAHA 2OELA 4NASA 1M5SA 3VN5A 3PO4A 1RTIA 2RRNA 2DR9A 1UPPA 4ZITA 2NLWA 1I3OB 1CEZA 8RUCA 4LSNA 4M41A 4FJHA 4CE9A 2R3VA 4XPEA 2PN6A 2E7XA 4FJ8A 1FFWB 2VC0A 4CO5A 1Q81T 4BY9C 3U02A 4EHUA 1VQ7S 2DNHA 3W65A 1WTFA 3F9KA 2L08A 4WBFA 4FLVA 4L74A 3HHDA 1YTUA 4ZCMA 3AT1B 4LRBA 4CJQA 3CJ1A 3H46O 1C6VA 2J0WA 3PIPQ 2ZJRQ 1VRQC 3G82B 2FVRA 3H2VE 2IGIA 1LOUA 3CC2N 1DURA 4IFVA 3D5MA 1IJJA 4Y3CA 4CW7B 3D68A 2XSJA 3QNNA 2PDAA 1WSGA 4OJHA 4C0HA 5KI6A 4CO2A 3L2UA 3TRGA 3PYFA 3PW7A 1NPRA 3BR8A 4CWBA 1PBUA 3AQPA 2E5IA 1FRLA 4ES1A 1S5JA 3N4QA 2QWNA 4MAKA 3KLGA 4S0MA 2CYYA 2NRHA 4C7QA 1V4SA 5DDOC 1B64A 4V19J 4F50A 1N6QB 2ASPA 1W7WA 4JOUA 2DHGA 2HVHA 4OZLA 3G25A 1SV5A 1ATNA 5HQMA 4R79A 1JLBB 2W25A 1JLQB 3QYYA 5HRSA 4DUZF 3RBEA 3SCXA 3ASMA 2QZ8A 3J7Z5 1ZBUA 1WSFA 3O3HA 3CETA 3F5TA 5AJ3F 3H45C 4FWKA 1WHVA 4A4JA 2ZH8A 2XO6A 4ECTA 4FPRA 2YNGB 3MCOA 4WP3A 2AU0A 4H4MA 1WHWA 3M32B 4ED7A 2CA9A 3HVTA 4OYAA 4DB3A 2EPIA 1BI4B 1ULRA 4FM1A 2UZAA 4OYXA 2YKPA 1VJWA 3SCLE 2CJXB 4KGVB 1Q7YO 4B8AB 2BUPA 1XR7A 3VGSA 2EKYA 4FOIA 3FQLA 1RT3A 2X3DA 2XYPB 5F0XA 5L1IA 3K0JA 3VR1A 1FRXA 4ELVA 3RRKA 2FVSA 2GO9A 4NYZA 4IO9L 4B3MJ 3SMZA 1VQ8S 2XLIA 3T5LA 3HSDA 1TL1A 2GHWA 1C1BA 1RZMA 3QAUA 3IN5A 4PXCA 3DM2A 1FWLA 1Q16B 3AO3A 1I5OB 3RR7A 1KONA 3HMJG 3AV9A 1I94J 4F0KA 1VAZA 4TNOA 2FJEB 4QR2A 1XNRJ 3NGDA 3AD8C 5JLFA 2DEIA 1CZ9A 3MWTA 2GNKA 4KV8B 3LDPA 2WVFA 4LF7J 1QE1A 2FD2A 5KT3A 5FD1A 4KO0A 4K42A 1V9OA 4A2BA 4DSJA 2YNHB 3KLIA 2P51A 4YHHK 4C3MA 5KFBA 2IC3A 3DLLL 4CF2A 2EK1A 2YKNA 2MY8A 1RHKB 2Q97A 4XH4A 2QK9A 1RTJB 3ZZRA 5IC6B 3GIJA 1ATSA 4RW9A 1MWZA 2BYCA 1UAXA 3V1QA 3MMAA 4IG3B 3W8PA 2F9WA 3FGVA 1NKCA 4ZLNA 3HPHA 4CEFA 3OYLA 1NMNA 2RMLA 1B0VA 4LFBK 1BIUA 2ZJQL 1GMWD 4JEPA 3MWBA 4YMEA 2W9AA 3IO1A 4JKFA 1SC1B 4B3SF 3A8KA 3RMAA 4ETZA 1RYSA 2V7YA 1VQ5N 1NGJA 4Y2IA 2WC9A 1Y00A 3HSJA 3MPVA 4NE9C 5L9NA 1X5SA 5B08A 1Q82O 2AD9A 2YV0X 2RUGA 2XC9A 4K0KJ 3AJDA 4BG9A 5JS1A 4DR6J 4ZHRB 3PX0A 4BREA 4F0HA 1PJ7A 1NOYA 3TZWA 4DV4K 1YVFA 2XWXA 4CJUA 4JKCA 1LWFA 3OBYA 2CUYA 3GR1A 5KFVA 4AXJA 2MZ1A 1NAQA 3D1HA 1OKJA 2RIJA 4JI8J 5BN9A 1PJ5A 1U1QA 3NNAA 2R4FA 3IP0A 2MZRA 1GXTA 4NLPA 4ZP6A 1VSLA 1NU4A 1P9YA 5KFPA 3ZTPA 4P2SA 3NFAA 4DS4A 2HZAA 2IVOA 4CTAB 3OR2B 3HFVA 4URSA 2LA4A 3CD0A 4QR0A 5DLFA 1XEZA 4XH5A 4A47A 3OXGA 1G15A 1HBMA 1RHQB 1O13A 2I5JA 3FBBA 1NZ8A 5JMVA 3SCIE 5CCLA 4O4RA 2HQCA 2CJYB 4M7XA 3KK1A 3HP6A 3KZBA 2E1PA 4M5MA 2PI4A 2E44A 4YUDA 1U1LA 4USTA 5H1SV 4WFXA 4ZVHA 3MM9A 4NXNK 5GINA 4CGJA 4C8KA 1YITN 2YQ1A 2ZUAA 3KWMA 4BR4A 3IFRA 2V51B 2ZM6F 1WDTA 1TMMA 4QS8A 3KG0A 4QQBA 3JSMA 3L4QA 1ZBHA 5KG1A 4BC4A 2A1BA 4DSFA 4HWIA 1I6JA 3OYMA 4B17A 4KB1A 4FJMA 3VVUA 4E1NA 3ZZZA 5IWAJ 4OZ2A 3DXSX 4ZVRB 4WE1B 2ZNYA 1C0GA 4G1QB 2OZMA 4H0YB 4N7TA 3EPIA 3QT6A 3M1VA 2W6KA 2YJFA 2P6TA 1EX8A 4DV2J 4QYZJ 4EZ6A 3DGPA 4PWUA 3UNGC 5EXWA 4LSLA 5A8RB 3PDNA 4RWTA 1EARA 3BH6B 2OD6A 1FRIA 1R8AA 5CHCB 5E7OB 4YP3A 1D9FA 3AO1A 1P1TA 1FW6A 5KAKA 5HJXA 1FRJA 1VGYA 1CG2A 3H98A 4UOGA 1VSJA 1JLGB 1IKVA 4JKHA 4LF9K 3DOKA 2DGUA 3OLAA 1W2IA 4A59A 4NXMJ 2P9UB 2RAQA 3MPDA 1AB8A 4FPBA 1KKHA 2ALZA 4Z4GA 3QWUA 3LPUA 3P83D 4FCYA 1Y9OA 4ED8A 1XNQF 4TQRA 1VK8A 4KY3A 3NMUA 3I31A 2B0GA 3CCLS 1WHYA 2G13A 3RAQA 3BO4A 4JRPA 1HPZA 3N6NA 2Z1GA 2MDAA 2WB4A 3UN3A 4QIEA 5HSPA 3THXB 3DLKB 8ATCB 3RB0A 2GTDA 3LO3A 4Z7YA 2CQHA 3QEVA 5U47A 3G9CA 3CDEA 2R2TA 1CVJA 4AE5A 1EZZB 4FP9A 3ATUA 2XNRA 3I56N 3QGHA 5C24B 4UQTA 1T3OA 1S6UA 1CS4A 3HPOA 4BRKA 4DR5K 3DRRB 1YHQS 2B4OA 1RDUA 2FSNA 1ASUA 1BY9A 2BRKA 3ZEUB 2Q2RA 3MCMA 4IFYA 4OGCA 4DTMA 2E5LK 1Y11A 3OBIA 2ZDOA 3UWTA 2B43A 2MZSA 4ZIWA 3AVAA 1IBMK 3I8DA 1SZ2A 1RB0A 4NLBA 3TR8A 2YJEA 4JI2K 3FDSA 3MR7A 3UCGA 1HWUA 2JH3A 7FD1A 4ZVTB 3WXIA 5BR8K 4OHVA 2YTCA 3DRSB 4B9NA 3GSDA 3H7HB 1W2BM 4DR1K 4NLGA 1JNZB 4ISEA 4P7VA 4HUFA 4RNHA 2C3MA 2IM1A 4DDFA 4JS5A 4QPXA 3CD7A 3NNCA 1VQYA 2PMZD 3G82A 2E5HA 1UTAA 4ZIVA 4K4VA 1YI2S 1VSHA 3QFUA 1YWXA 3OTOK 3KJVB 3SQGB 2XMVA 2OCEA 3VAIA 5JVGQ 2DNOA 3MEGB 1JNRB 5AQZA 3KG1A 1V3RA 2BJ7A 2XHWA 4RKUC 1R0AA 4HCBA 2CPJA 3R6MA 1AUSL 2XYHB 4Z94A 1X1PA 5F2RA 3Q2TC 1ZM3A 3TVZA 3AAPA 3THPA 2DR7A 2P9SB 3HHKA 2XYGB 4DQIA 4OYZA 2OTLN 1VR6A 4X4OA 2DR8A 4ATNA 2DNNA 2R7RA 1QQMA 2VG6B 3T1HF 1RT2B 3VEXA 2O67A 4CH7A 3R6LB 4IOXA 2JDJA 1B7YB 1NM1A 3NS6A 1JLBA 3UDCA 4X4RA 3I0SA 1WC1A 1N36F 2K7JA 3OYBA 4IG0A 4J9KA 3AVKA 2CPYA 3M2VB 1YJTA 4KT0C 4O0JA 5GIOA 2LQ8A 2VFTA 2FXUA 3BQ1A 3FE1A 5DZ6A 2YNGA 3N0VA 3G6VA 1LCUA 1Q8LA 4FOEA 3DOLA 1S7HA 2VBZA 3FRYA 2GX9A 2W7OA 2A40A 1T0TV 3GB0A 3M32A 4L3NA 2ZC3A 1RU2A 2CRLA 4QU7A 2VOOA 4KQZA 4CGHA 4B1YB 5LT5A 4C8ZA 2YKMB 1M5PC 2DYAA 1OJ4A 2QLBB 4IXCA 3NH2A 2HEKA 4JI7K 1ZPVA 3QEPA 4P71A 4RX6A 3OYCA 2RVJA 5B0CA 3HVAA 4FJXA 1CJTB 3WNGA 2G2ZA 1C0MA 2FLOA 2DBBA 1IM6A 1Q86T 3VGVA 5L38A 3PJWA 4DWIA 4Q2LA 4CBWA 3VERA 2FJXA 3LTOA 2V9WA 3RSEB 2DGQA 4CZJA 1EHWA 3AD9C 3M6VA 5IFMA 4OYIA 3IRWP 4W90B 3LP2B 3CUNA 3D66A 3IFEA 1T9XA 5AXLA 4DFKA 1JK9B 1S7IA 3KHLA 2ABYA 4LF2A 4PG7A 2UUAF 2M2BA 3DMJB 4KHPF 3MN6A 5FLXO 1SC3B 2SXLA 2C42A 3AFGA 3TI0A 3I55N 1NGGA 2Z4PA 4URGA 5KFJA 3ULDA 4CIFA 3NVMA 2Y8WA 5DQIA 1P6TA 1FJ7A 4KV8A 2YPYA 1SQFA 2B8QA 4DLGA 3DLGB 5IT0A 3HYFA 4QW9A 2ITMA 2DGXA 4TY8B 4J2EA 3VF6A 4NPOA 2WVCA 2OP5A 4CZEA 4U9RA 3ET6A 4X66K 1FTRA 3KJFB 3DC2A 2NRRA 1ZETA 1T3NA 1RTHB 3TAFA 3TTFA 4YHHJ 2UV8G 5KGXA 1U4BA 3TAQA 4OGEA 4DL2A 3G6EN 1U26A 2JZ5A 4EZ9A 5GADU 4LC9B 3OUYB 2WRMA 2HNYA 3IR6B 2DIVA 5AZJB 1E6YB 4DV0J 2XZWA 2FJWA 3ENOA 4CF8A 2FZCB 2DK2A 2MKCA 1RWMB 3F0NA 1WKJA 4J9VA 2M52A 4HVJA 3CCUN 1C2PA 3E3XA 3NBPB 4FVCA 3FJ2A 4OZ0A 5KFTA 3I4HX 3ZTOA 3VAFA 5K20B 3R7BB 3LGMA 1U0HA 3NCPA 3PVXA 1DBDA 4DV4J 5MLCV 2P2CB 3GDQA 2JRSA 2BDPA 1SQKA 1UP1A 4A8WA 1Q81O 4GKKJ 1OH8A 3WC0A 1RACB 5ETKA 4CTAA 4L73A 4BRCA 3OR2A 5GAGU 4KPYA 2KZZA 2FBVA 3MXJA 3CC4N 2HF3A 3SQ2A 5K8PA 1GTHA 4X4SA 1Q4RA 3ULEB 3OR1B 3M05A 1CJUB 5BYQA 4CEAA 1FE0A 2H48B 7FDRA 3ELHA 4I6WA 2IVYA 2CGJA 2DHSA 1G6BA 4FLZA 1RTZA 3BO2A 4WQ4A 4CEBA 3C15B 3ILJA 4WTOB 1S6OA 5JS2A 3HXMA 2ZOMA 1QHAA 4F4XA 4EO8A 2MEWA 1DY3A 2VBWA 4J9LA 3HSCA 4HI1A 4O5FA 3HKWA 2BKPA 1TZ0A 3ILIA 3VWSA 1UCNA 4DSEA 3GP9A 1QAXA 2V50A 3Q8PB 1IJFB 4NXNJ 4O3PA 2V5HG 4JI0F 5FPEA 4OYBA 1BG3A 4JV2A 3VZHA 5HOOA 2RE1A 5DG9A 4FF4A 1WC5A 1QAYA 2AHOB 3D0IE 5HLFB 2DR6A 4H5NA 1GNKA 3ETMA 1B0TA 5AQOA 3UKUB 5BRDA 3R7NB 3QATA 5F3ZA 1QAIA 4ZJLA 1RT6B 2X1FA 3V9WA 1TUYA 1HNXJ 3T19A 5A8RA 1E6VB 1D9DA 1YBUA 2CQ2A 2D9PA 3NF9A 4DJBA 2YX7A 4JI4K 2O8BB 1C0TB 1HW8A 3BBFA 4PA1A 4CIGA 1JLGA 1Q95G 4DSKA 4P75A 5KOXA 4NLUA 4OMFG 2P9UA 1NOZA 1AZSB 1EJ7L 3M8YA 2FTRA 1N8RT 4AHSA 2EFPA 4A8MP 4RCHA 3QRRA 4LF9J 2XS5A 3LP3A 1IBCB 1S72N 3CQXA 3ENWA 4Y28C 1P9QC 4NL5A 2J0XA 2ZZMA 4CJ4A 2DNGA 4DPYA 2HHHF 3MMVA 4CJLA 3CCJS 3RRHA 2QFIA 2W8KA 2A6AA 4ZPCA 3DWLA 3KOAA 1FEHA 1GLFO 4KTWA 1DKGD 2V68A 5RUBA 4CQ1A 2W2NP 3ZT4A 3HOTA 1U1RA 1R6YA 1EKRA 5B7WA 4Y0FA 3UFCX 2W6LA 1I1GA 1N34K 1NGBA 4FZXC 1YTAA 1B0PA 1R8HA 2WUSA 2IVMA 1FWKA 4LF5F 4JI3J 1FHTA 1P8GA 5C24A 2A6OA 1ZA2B 3I6PA 2X6NA 3AJ1A 3QNWB 3KKRA 4RBTA 3DRRA 3QT5A 2LA6A 3QFPA 3PYGA 1BIZA 4K4ZA 3SPYA 2FVQA 3IMQJ 1U1KA 2JEJA 3W63A 4DR5J 1BA0A 4ITSA 4RUHA 3OYGA 4BVPA 4C0BA 1RKJA 1FESA 3TSQA 3LW5C 1NDPA 3EJMA 3VQSA 1N5YA 1U8WA 2KZMA 4M5HA 2R42A 3OJUA 4YY3K 1TU0B 3AVNA 4ID1A 1S9GB 2HLUA 4NEZA 1IBMJ 2VFSA 2DNPA 5HMXA 4NRTA 5HRRA 3LZJA 3DRSA 4AFFA 4U8YA 2IBOA 1JXEA 4JI2J 3MM8B 3N9UC 3MR5A 5L1LA 4TKTA 5C2CA 1R8PA 1IVZA 2A2CA 4DX8H 2F9DA 4QW8A 5D4PA 4PY5A 5KFDA 4CHPA 2J5AA 1IG8A 3KHYA 1X3MA 5HI7A 3ZSYA 2LCWA 3QZ8A 3JTNA 1NGDA 5L8RC 3FRZA 1DAXA 1B4SA 2CAJA 2HFSA 3OTOJ 3KMQA 3ADAC 4Q2MA 4AM6A 3NL0A 4FS1A 1RABB 2WW8A 1S4EA 1A7GE 5CZ2A 1Z4UA 2HRUA 4GVBB 2P9SA 4PPDA 4YS2A 3KLFB 3GYXB 3T41A 3CTRA 1YJNS 4B02A 5BYSA 4PAAA 2BUNA 3W60A 4CRJA 2CJ9A 5J2MB 4HI2A 1HNVA 1JJHA 1VQ4S 1F2GA 4LH5A 4MQ3A 2HF4A 4CCHA 1JWWA 2P8IA 2OPQB 5CXTA 4P2FA 3RBXA 4DCHA 5E3AA 3F9MA 1YBTA 4I56A 1GMWA 3A0IX 2HYIB 3NF7A 1O0PA 4CIOA 2VGMA 2DTUA 4GVMA 3MN7A 5HN0A 4LF4F 4PG6A 3CCEN 2PFUA 1CBKA 4B9VA 4HL9A 2YKMA 3IS9A 2H4YB 4OI0A 4JUZA 3WUHA 3OYFA 4PKIA 3CD5A 2KVIA 4JKEA 3O3GA 3N79A 4F3TA 3VGUA 3OS0A 4QS9A 1CJTA 1FXRA 3EICA 4JI7J 1C1CA 4GRSA 1XMOJ 4NLRA 4Q5VA 1X0PA 1URRA 4QS7A 9ATCB 4HR2A 3GG0A 3SBMA 2QRRA 2GZOA 3RSEA 1IR2A 2O8CB 2D3OR 2LLZA 4X62K 4JHDB 3ENAA 4CFAA 3CDBA 2R9LA 2ADCA 4PUOB 2NZCA 5C15A 2V2KA 5LMUK 3C6UB 3SZ2A 2DNMA 2EW9A 2F40A 3VEVA 1CC7A 1NGCA 3DMJA 2VBYA 2VG7B 3M6WA 3V6DA 5EOYA 1RJJA 3FSXA 1ZXOA 3GL1A 4DR4K 2OPRB 3PW2A 3NEKA 3M8PA 3GOIA 3DLGA 3QPIA 1ASWA 4TY8A 2LECA 2QJ3A 2XTJP 4FLXA 2GIFA 4A8XA 4ZCIA 1TK0A 5AQLA 4KH4A 3CJKB 1HI0P 2EKNA 2QWPA 2Y1IA 4WK1A 3D67A 3D7EO 1RTHA 4OHYA 4M5GA 4R5PB 3GIIA 1UJ5A 2PA3A 3D45A 3NMAA 4X66J 3GLJA 3DGVA 1T9VA 5HBMB 3A3OB 2QA2A 3G8SA 3CJAA 4ECQA 4F4YA 1F5BA 3IWNC 2LQ5A 2NUUG 1EQMA 4ED4A 2YVSA 5AZJA 4M5NA 1E6YA 2I6WA 3ZT0A 4YNQA 3VF2A 2FVCA 2YQ0A 4C48A 2MXYA 2OEJA 1HHQA 5L1KA 4NYNA 2CQ3A 3CE8A 2Q3SA 1J5EK 2CVIA 5DRKA 2W40A 1JLEB 2CQGA 4DQ8A 3MTKA 3NBPA 1LAWA 1ZM2A 2M7SA 2FHMA 2I7PA 5F8IA 3D2EB 4E1MA 1JLAB 3G4SS 1ROFA 3VQ5A 1XMQK 3SDEA 4DV5F 2KFNA 4A8OA 3ATVA 4LSZB 1XUPO 1Y64A 1W25A 4LFCJ 4LRCA 3O5BA 1WG5A 1VFJA 2V4RA 1SH3A 2N4CA 3EDQB 2I8EA 2VQEK 1OQ6A 2DPIA 4H4OA 1W9HA 2QTWA 1K47A 3TVKA 4EFAC 1RWOB 3ULEA 4B3OB 3OR1A 3R27A 1CJUA 4CM2A 2XGQA 2AGPA 2V2QA 4X4VA 2VONA 1H98A 2EVZA 2E5JA 1F6TA 2CGLA 5E3QA 2QA4N 1M5HA 1VSIA 3DLEA 4ELTA 4YR3A 2H3GX 3G86A 4DX5A 1VRUA 3HSZA 4IJAA 1UW4A 2BACA 3SBTA 1NZAA 1RAJA 1K73T 1NMEB 4CD3A 5I42B 2AIRB 1IBLK 1JB0C 5AQNA 2WVBA 4BR0A 1RWUA 3U4LA 3NS7B 2RF2A 1VQMN 2HMPA 2BJ9A 2E1CA 3WX4A 4RZRA 3RW6A 2XM3A 4JAXA 3KK7A 3PSIA 3UKUA 4LD0A 1CLQA 2YKAA 4YOWA 1RTDB 3FLCO 1OVYA 1JLFB 3OVNA 2MQLA 5KFUA 5C42B 4RR5A 3CO9A 1G1XA 1JLCB 2OFHX 4KHSA 4U95A 2EBGA 2E2NA 1VSDA 1C0TA 3V9XA 1S49A 3DFEA 4W5QA 3DHXA 2O8EB 4F3MA 1UEKA 3ISZA 3E01B 3TNVA 1XTZA 2ZBIA 4CLTA 1FD8A 3QSYB 4FWSA 3QGPA 1AZSA 4U6PA 1YAGA 1K0VA 2F8TA 5B0EA 5F8GA 4JS4A 4IWVA 4NX9A 4RW6A 3OL7A 4CZFA 2OFGX 3HDSA 3TW0A 2IJFA 6AT1B 2KQ2A 3V6JA 1PAUB 5C2GA 4CP5A 1VLOA 3QMQA 2ZBQA 3Q8QB 2ZGZA 1JCGA 3D3CJ 2CQBA 1KCFA 4JI5K 4HLBA 2V67A 2VD3A 1HHSA 3PX4A 3U7JA 4HACB 4FJ9A 4NLWA 4BE0A 1Q86O 1SH0A 2Y1JA 3PFEA 5TKYA 2V34A 2BKOA 1X4FA 3UCZP 1S9EB 4CO4A 3KYLA 3V4IB 3BKUA 2A2DA 4WQ5C 4FZYA 2H54B 4IRDA 3LDSA 4C8NA 5BR9A 1CJKB 1BGXT 3OT9A 4BC7A 2YI1A 3F41A 5KPZA 4B1ZA 2O1PA 4RBUA 4U96A 2UXDK 3US5A 3MEEB 1BLUA 4JD2B 3I33A 1DTTA 1V6HA 2HGMA 5EGYA 1UJ6A 2IIRA 3R1LA 5DS7A 4OLBA 1M5OC 4MIWA 1S1UB 3G6YA 3AXKA 1VBKA 1S9GA 2P9PA 3AAQA 2R7VA 4OX9J 1H1VA 5ELZA 3PRBA 4H5VA 3D2FA 4LF6F 2H4WB 3L9ZA 4YY3J 4DL0C 3MM8A 1F3VA 4E7HA 3LM9A 4BC3A 4B9MA 2BQRA 1RBVA 4BRAA 1D4XA 5AQFA 3PR5B 4YDUC 4PKGA 5H9FK 3CJCA 4CO1A 4CI0B 3MWPA 4Z4EA 3GE9A 2QXFA 1U1NA 1AUDA 2OLWA 5EU7A 4LF8K 1KFSA 3CJQA 1K8AT 3KWIA 3VHQA 3GZ7A 3WC2A 3BGOP 3UCUP 2UXBF 2GW8A 2HG4A 3IG1B 4CLFA 2CFXA 1QAJA 2BANA 1KP6A 4GVBA 2I9SA 4CLZA 3KLFA 4USIA 4I2QB 4DHYA 5FDLB 1NKEA 3TANA 1D9AA 5KRSA 3UI3A 1PKUA 1LFWA 4IH7A 4BC9A 5GAEU 5BRHA 3NGTA 5LXRA 4EI2A 3K5OA 1CQMA 5D4OA 3BS9A 3CWJA 2BM0A 3EE3A 1DTQA 3EZUA 5AQHA 4A8QA 1HLUA 4YOXA 1BUXA 1TUVA 4P9SA 3H8YA 4JK8A 3LDNA 3PY8A 1LK7A 3U3GA 1LEOA 3QBCA 2CQ0A 1RI7A 2ASOA 1TL3B 4NYFA 1NRKA 4KHUA 3SUOA 4WCEL 5HK4A 5D77A 4WFBL 3H25A 1VS3A 4CLUA 3FBCA 3HP9A 1CQNA 4A8FA 2IS3A 2NSCA 4F0MA 3ONQA 2W41A 3CFOA 1V3ZA 4DUYK 1F9EB 4I67A 3R8EA 3HL8A 5L9XA 2C2EA 5GAHI 3E1YA 1UEVA 2IYGA 3V6KA 3S6EA 1KS2A 2AF6A 3G71N 2NRVA 3DN9A 1ZAVA 3OFGA 1DQAA 1FO1A 3BKTA 2GHPA 3CMQA 4JHDA 2FF6A 4ZPVR 3ZZ0A 2V8VA 1CULB 1R59O 4IFEA 3S3NA 4X62J 1MMLA 4E7IA 3NGUA 4ECZA 2VG7A 1ZM4A 5LMUJ 2QWLA 5E26A 4QWEA 4DUZK 1QLNA 3ZTSA 3I96A 2OPRA 4XDCA 1AT1B 1T95A 2DHXA 3A1YG 3DI6B 3MTJA 4PG4A 4DTNA 4DR4J 4IQMA 2W8LA 5J2PB 2DIUA 4BRGA 2F5GA 1VBZA 3PUFA 4LIRA 5F8MA 4LQ3A 3IRXB 3H2LA 3WDOA 5TKWA 1N8RO 3Q24A 4R5PA 2UXCK 2N82B 4IOAL 2VB6A 2UU9F 2QV6A 4TYAA 4IEEA 5M2UA 3CCZA 3MM5B 4BQZA 5HBMA 4M5DB 3TSPA 1S6QA 4CDIA 2JNJA 3D6RA 5GADP 2OTJN 2GHVC 2G9OA 4MDBA 1F5AA 3H1QA 4H03B 2FGCA 1SUQA 1TV6B 2U1AA 4LH4A 4DTPA 3O9RA 4M63C 4JN4A 1ZBSA 3SEOA 2O4IA 1PO6A 5DGAA 5C2FA 1LKZA 3MOJB 1JL1A 3NHGA 1X4EA 1QM9A 2IJNA 1U1PA 1VQLN 1GEHA 1J5EJ 3SBGA 1NKBA 2DXEA 2RRAA 1X4GA 4OLPA 3FK4A 4O0IA 2MSTA 1YZ6A 4FWNA 4NI2B 4P6QA 3D1QA 3CC2S 2G8VA 4LJMA 2OEMA 5J2NB 3HHEA 1U02A 4N77A 3T1YF 4CZLA 1MW7A 1VC6A 1YSJA 3T1AA 1XNRF 1Q5VA 1XMQJ 3SI6A 2PEBA 2QLXA 1NPKA 3BEXA 3W1YC 3O1WA 3GG4A 5T7BA 3N28A 2XRIA 2CG8A 2JX2A 4J9MA 2Q0UA 5IM0B 2F7TA 2QMXA 3TZZA 4B3OA 4OHZA 2H1YA 5GAGP 3HZ6A 2VQEJ 1ILYA 2XY5A 5DETA 2X1GA 5HVGA 4JKBA 3S01A 2WSCC 1SJ4P 1J2VA 1IQZA 3TAMB 2Y0BB 3E8OA 4L3QA 2HS3A 3C46A 1WC0A 3L2VA 4Y2MA 2KHOA 4RW4A 5IQ6A 3HULA 4LQ9A 3KLHB 3K5LA 2K3KA 4IH5A 2CZVC 4ILMA 4DLEA 2FQQB 2QWOA 5I42A 2AMCB 2ZJPL 1VC0A 4OZJA 1RE1B 4ZVOB 3CI5A 3PXGa 4DR6F 4C6AA 1S0NA 3MK6A 2ZUGA 4PYDA 3S7RA 1IBLJ 3PX6A 1T05B 3V5RA 4USMA 3S8SA 3F56A 4C0OC 1RDDA 3OTCA 1WF0A 3J81U 2ACMA 4DCOB 5KFLA 4TYBA 2DNRA 3G8QA 3J7ZT 4F25A 1NH7A 1RWNB 4NZ7A 3IC1A 4BR9A 1JLFA 2QLJB 2RKIB 2RQKA 5DJBA 3D6MB 4LMZA 3M2UB 3BSAA 2XBPA 4Q43A 4MYTA 3QFHA 1GH8A 1JJ2R 1WSHA 2D0BA 3KWGA 2O8EA 1JL2A 4R8UB 2KL8A 3E01A 1RAFB 1MDUB 5KFYA 4B1UB 3GV5B 3LM2A 4DR3F 1TQLA 1RAOA 3NCQA 3H5YA 3BQ2A 1T3VA 4ILJA 3J80U 3CO0P 1KHWA 2EC0A 2VBXA 3CJ9A 2DD8S 2VC1A 2BVZA 4C3KA 3PNIA 4J2DA 2QKBA 3JAMO 3HD1A 1BQMB 1RSCA 5DGBA 2YNFA 1KR4A 4U67Q 3HPGA 5K8OA 3P49B 1R0BG 3P6YC 3IGNA 2HHQA 2ZM6K 1NGEA 1VQ7N 4JI5J 3DYAB 2OANA 3C8YA 2E2PA 4F4WA 4W92B 4AHRA 1S9EA 1N5TA 2NXEA 3UE5A 2QG9B 2YWWA 3V4IA 3FZBA 1VRTA 4DV2F 1VIOA 1AW0A 2KW4A 3CJTA 4J2BA 2ILYA 1CJKA 1KBRA 3B8AX 3NDKA 4DL3A 3O6WA 4BRDA 5A76A 1VSMA 5F1XA 3E9OA 2KYZA 2PD1A 3M2RB 5HQ8A 2O8DB 1A5WA 4WP8A 2QE5A 1L3VA 2UXDJ 4CZHA 3DCAA 1T8EA 3GR0A 4KSEB 4PQAA 2DVIA 4WF9L 2AW0A 3LDLA 4WYWA 4CGGA 1XNQK 3KKFA 1ZZNA 5AE2A 2MLXA 1FJGK 4WKYA 4M5KA 5KQ8A 4E0DA 3MAQA 2P5OA 3HBTA 3L0QA 3LAKA 2DT9A 1RT4B 4NLYA 4C1NI 4CERA 2QL9B 3GIRA 2F9JA 1MG7A 2PIIA 3OVSA 2J0QD 5H9FJ 1RT7B 4NA1A 1S59A 4EHTA 5KFHA 3IG1A 1E3MA 3M7VA 2HSTA 1SIWB 3IUCA 3QB0A 3FCVA 3TUPA 4KGMA 5LY3A 3NRBA 1VQNN 4N5SA 5F8HA 2E9TA 3I87A 1RYRA 3VA3A 2E5GA 1J54A 4B3RK 4DSIA 3NAIA 1FK9A 4C8LA 5G4DA 1N56A 4F36A 5C12A 3M9MB 4A62A 4DTJA 2WBRA 3UIQA 1SXLA 3GFYA 4AUKA 5LMNF 3BP8A 4K8ZA 2IMWP 3J7A1 3CCSN 3VMFB 3AODA 5CR4A 4JYAK 5AQGA 3MUVP 1WDDA 4OLOA 1YJUA 1U6FA 1YLXA 4W5TA 1U2VB 3MAAB 3KD1E 3FUYA 3H0PA 2CWKA 4YB5A 5KG5A 1GLBG 3R1HA 2RS8A 2F9TA 2JC1A 4ICLA 1VQ8N 1OH7A 4JKDA 1SB6A 1BU6O 5AQWA 4KRFA 1RDAA 2OJ3A 2FZKB 3EMTA 3QEXA 1IBKK 1WACA 2GWKA 5F41A 4DFPA 3CCMS 1RTIB 2IPOB 2Z57B 4UQGA 3CC7S 4CEOA 4MFBA 1S48A 3M6GA 1QTNB 2P5VA 4N76A 3BKFA 4LSNB 1K1SA 4DUYJ 4C9DA 3A8JA 3TSUA 3LP1B 5HMZA 4WXWA 1K73O 1SJFA 4CLPA 1WUUA 5EN1A 3HRGA 2B8PA 4ZTFA 4Z4FA 4ZVSB 3AA5X 1S0VA 1DQ8A 1C0UB 4Y2AA 3BSCA 3TARA 1HQEB 3QWPA 4NZ6A 2JGUA 4ZPAA 2D0CA 5IZHA 3G2XA 4B1XB 1CULA 5KPTA 4I2PB 4FYDA 3L3VA 4FWOA 4K43A 1HNZK 2D0OA 3BF4A 2RU9A 2O8FA 1GK8A 1RGVA 4OYMA 1N36K 1PG5B 2GUIA 1QJHA 4IFVB 1TL4A 3V1OA 2ASMA 4KFBB 4NO7A 3AA2A 3NH0A 1OH6A 3DI6A 2KDOA 3KK3A 1HI1A 2PSZA 4DUZJ 2M3DA 4QU6A 4PABA 3MHYA 1Z26A 4CHOA 5J2PA 4K59A 1S97A 1LV5A 2ZBRA 3LDOA 3ZTQA 5ETSA 1YJRA 3IRXA 1SKRA 2EBEA 1TR0A 4WU2A 2FJAB 1RBAA 1IWAA 2G0IA 3P39A 2ZD1A 1WOQA 4TVAB 4BVOA 4QIFA 5A2QU 4M5DA 4ED5A 5DM6Q 1X9SA 2UXCJ 2XMUA 3F73A 2I2YA 4CJPA 2OUGA 1PC5A 4DQRA 4ZK7M 4BWMA 3EXYA 1VISA 4DF8A 1ZC6A 3TABA 2KFZA 1TV6A 3DLBA 2QO3A 3P45B 2GUPA 3C7NA 4DN0A 5JLHA 2WCXA 4RBVA 2C2OB 1Z1ZA 2FJBB 2J76E 4C3LA 2DGVA 1EETA 1Q53A 4PKHA 2YXLA 4YDDB