1REVA

Hiv-1 reverse transcriptase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of HIV-1 reverse transcriptase complexed with 9-chloro-TIBO: lessons for inhibitor design.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 145
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1revA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1revA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1revA05
4LSNB 4EYIB 4FVMA 3I0SB 4J9NA 3GIMA 4ED6A 1XC9A 1QTMA 4IFVB 2GUIA 2RKIA 4WFYA 3AA2A 4O4GB 4CJUA 1HYZA 3ZSYA 4DMNA 3OVNA 2QV6A 4IRCA 4G1QA 1QAJA 3IG1B 4BWMA 1T8EA 4CJ3A 2I5JA 2C2EA 4C8KA 4FW2A 1RBVA 2FVCA 2F8SA 1KVCA 4RW7A 3RB4A 1WN7A 4F4WA 5E41A 5EDWA 1F21A 4CF0A 3OYMA 3QO9B 3OYBA 3V4IA 4ZVFA 3TAGA 5KG2A 3EY1A 3TVKA 3I5AA 4RW6B 3PX6A 2J6UA 4DSJA 3HVRA 3CWJA 4GW6A 4MIBA 3DLKB 1SKSA 5KFNA 4FM0A 5KFSA 1HMVB 4EP5A 4FLYA 4CHOA 1JLQA 1YVUA 5J2QB 1QUVA 1L3TA 1B92A 1R0AB 3T5HA 1NJXA 4Q5VA 3SJJA 1TKTB 2RPIA 3QYYA 5I3UA 2QKKA 3AV9A 4W5NA 4XPCA 3Q8SB 3CJ5A 2X6NA 3GQCA 4F4ZA 1UWBA 4CGJA 3CJ2A 4O4GA 3PR4A 2G8VA 3OYCA 2C22A 4WE1B 3K5OA 4R0EA 4FJ7A 1Z25A 2YNIB 4KFBB 2V4RA 2RN2A 5DG9A 3NMAA 4DU3A 4OL8A 3QIOA 4KB7A 1WSFA 2AQ4A 3ZSWA 1TP7A 3ZT3A 4N47A 3DLRA 2D3UA 2FC0A 4RNHA 4CF9A 3ULDA 2HHTA 2OPQA 3KLHB 2R8HA 4JS4A 4R8UB 4PY5A 3K5NA 3L2QA 3DRPB 4ZP9A 3BQ0A 3OL9A 4Y1DA 1RBRA 5KI6A 1SKRA 1EP4A 2YKNA 1HPZA 4AHTA 5HRNA 4FBTA 2P1JA 4CF8A 3D0PA 1VSHA 4WE1A 4PA1A 4Q43A 4H54A 2FLLA 1X9SA 4YR2A 1S1XA 1TKXA 4FK0A 1S6QA 4ICLA 2R8GA 5CYMA 3I5CA 4YP3A 4FJNA 1C1BA 3SCXA 3HVTB 4RUCA 4IG3A 1U09A 1KCFA 4KAZA 4HCBA 4AH9A 3RAXA 4O44A 4DL2A 3SV4A 2E6LA 1FXXA 1Q9XA 1J5OA 2OH2A 3G6XA 2R2UA 4K4YA 3CJ4A 1A5XA 2Z1IA 4J2DA 4CHQA 4NLUA 1XR5A 4Z4IA 1S1TA 5HRPA 3CM5A 4IRKA 1X1PA 2G8IA 4KTWA 4CJVA 2P51A 3T3FA 1FK9B 4HVJA 3NGZA 3JSMB 1S1VB 4RZRA 3T5LA 3OYJA 1RBUA 3HYFA 3ZCMA 4DTOA 4PUOA 4M94A 3VQ6A 1JLAB 1U47A 3RBEA 4N76A 1JKHA 3DOKA 4M3YA 3K59A 3SQ4A 1BI4A 1NJYA 3VQ7A 4TXSA 3NGDA 4CHPA 3I5BA 3PW4A 5HRSA 3ZSRA 4CHNA 2VG7B 3AO4A 3LP2B 3N6NA 4DSFA 4M45A 4J9PA 4XPEA 4ECSA 3IN5A 2YKNB 3CDEA 4M42A 4NLOA 4KSEB 5EU7A 5FDLA 3ITHA 1TL1B 3MXJA 3LP1A 3MECB 4NLGA 2D41A 4CEQA 4GC6A 1IH7A 3V81B 3SUPA 4DU1A 1S49A 3S3NA 1S1VA 1N5YB 3HVTA 4JRQA 1RT3A 3HKWA 5F9NA 2JC0A 1SL2A 5EWEA 1NKEA 1LW0B 3LP0A 3HK2A 5CYQB 4LY7A 4J2AA 3IRXB 3GIKA 3FQLA 4NRTA 1TK8A 2WOMA 1J5OB 2YKMA 3DYAA 3CJ0A 2XCAA 4ECZA 4OLBA 2PY5A 3FQKA 2E9TA 4FYDA 4R5PB 4BE1A 3QNOA 3DOLA 4Z4HA 3AA3A 1TQLA 4FJXA 5DGBA 1EKEA 2RF2B 3DM2A 4TY8A 1BHLA 2FLPA 2IMWP 1RT7B 1JLFB 1JLGB 1GX5A 4QWBA 4DFKA 2JEGA 5KRSA 2XY8A 3QEPA 1IG9A 3H40A 5KFOA 1BGXT 2P5OA 3QNNA 3PJXA 3DOKB 3HP6A 4IDKA 4DL4A 5JXSA 4IFVA 5KG3A 4FZXC 2KW4A 4M3WA 4DG1A 3TAMA 4ZVHA 2WOMB 1KVAA 2X6SA 1S9GA 1W0HA 1L3SA 4OKKA 4Y2CA 3PVXA 4AHVA 1HARA 4KB0A 1OS5A 3Q8RB 4W5TA 4CFCA 5DLFA 1UOCA 1NK9A 1LWFA 1TKDA 2QK9A 4LD0A 4Q45A 4AHCA 2KZZA 2RDIA 2OZSA 3NH0A 2ASDA 3TR8A 4CGHA 3KK2A 4B9LA 1LW0A 3LWLA 4K4ZA 2R7YA 5KGXA 2ATLA 1S48A 5I42A 2O4GA 4Z0UA 1S9GB 3LZIA 3RBDA 5T14A 4E1MA 1S6PA 1JLCA 2ETJA 1JLGA 2B4JA 4KTQA 1ZTWA 2B43A 4OPKA 4CJTA 4FJIA 2XY7A 3V4IB 4TSXA 4DWIA 2GC8A 4KI6A 1HNVB 4CF2A 1LWEA 3KLFB 4J9SA 3HXMA 2XWYA 3UR0A 3M8PB 4CFAA 1JLBB 4CHYA 5KG0A 3PW5A 3OLBA 3IGVA 3KLGA 5J2NA 2I1RA 4CEOA 2Y1IA 3TAMB 3OJUA 1K1SA 4PWDB 2W8LA 5KFFA 4NLVA 4CEAA 3SV3A 1K1QA 3V1OA 1U49A 1S1UB 1B9FA 4B3OA 3V1QA 5HBMB 3KKRA 3FSIA 4CGIA 3V6DA 4FLTA 1R0AA 4NCGB 1UA1A 1TVRB 3GIJA 3DI6B 4QWDA 1BISA 4XIUA 1KFSA 1ZBHA 3KHLA 4B9SA 1C0UA 4AILC 4IKAA 3PJWA 1D9DA 3KIOA 3TANA 4ELTA 4N41A 2Y1JA 4M3XA 2ILZA 3IAYA 1S1WB 4CJRA 4KE5A 4E3SA 3V6KA 2YHBA 4FCYA 1NHVA 3AO3A 1WSEA 3E51A 3NH2A 3ZSOA 4ECRA 2XHBA 2R8KA 3VA3A 4BWJA 2E9ZA 1S6QB 4CHZA 4EZ6A 3OYNA 4RW4A 3HJFA 3RB6A 1DLOA 2ZKUA 3OS0A 3RMBA 3RWUA 1HNIB 2YNFA 3S3MA 2HNDB 5C42B 2C2RA 1NJZA 3OJSA 3BGRA 3PW0A 3DRPA 1A5WA 1HRHA 5J1EA 3TAFA 2B6AA 4DTMA 4EZ9A 1CZ9A 1RDRA 3HL8A 3LDSA 2B5JB 3H4BA 1GOAA 2FVSA 4M3TA 4Y2AA 1NOZA 4NLXA 4CJEA 4M3UA 2JEFA 3IG1A 4YMEA 3OYHA 4ZTFA 1RT2B 4B3OB 2J6SA 2Z1HA 3KD1E 4MK9A 4O3QA 3HVWA 3PX0A 4I2QB 4ZTJA 3VQ5A 3DRRB 3H98A 4C8LA 1C0UB 4Q44A 4E7JA 4TLRA 4ID5B 3P5JA 4OVLA 3KK1B 1QQCA 4E7LA 4ZHRB 4EO6A 4AHSA 4DTXA 2IAJB 3S3OA 3AVLA 3T1AA 4NLDA 5F8HA 4ED2A 2HVHA 5DQIA 5F8GA 4EYHB 1ZYQA 3CDUA 4IBNA 3N6LA 2BE2B 1C0TB 1RT5A 1RT2A 1K6YA 3JSMA 1XR7A 3C95A 2UVWA 4WZMA 1HQEA 3CIZA 4RW4B 1WNSA 4CJPA 5EWFA 3OS1A 2VG6A 3PR5B 3OYLA 1BI4B 2IM2A 2HNZA 1IKVB 1SL1A 1ZBLA 3ICLA 4ZP8A 4KB1A 3AO1A 3KNAA 1T05A 3KLIA 4URGA 1RTIB 1DTQA 3CM6A 2W9CA 4I9QA 2V0NA 1L5UA 4M3ZA 1I3AA 1S97A 4B08A 3PO4A 2YNGA 2HMIA 1KHWA 4GMJB 4N56A 3PV8A 1NK4A 1T94A 4H4OA 1HYSB 5KT2A 4YNQA 3WNEA 5KG6A 1RT3B 1TK0A 1HQEB 4O3SA 3EYZA 2HVIA 4HUFA 2WTFA 5KFTA 3VQ9A 4LQ3A 5F8JA 2P5GA 4F2RA 5DGAA 4URSA 4F4XA 3VQQA 1IKVA 3KHHA 4DSIA 3K2PA 1S0NA 4J2BA 5JS2A 4KREA 1J53A 2RF2A 3ZT4A 1IKXA 2HHWA 4IR9A 2FVRA 4HCCA 1J9AA 5L1KA 3L2WA 2IA6A 4ECYA 3BSNA 1RT5B 3WNFA 4CJ5A 2W9BB 2YNGB 5C25A 2WONA 3O3HA 4QW8A 4ED3A 2ITGA 4I7FB 3UDLA 3MXIA 3QETA 3VQ8A 3EZUA 4IG3B 1D5AA 5HROB 4IDKB 1RYSA 3DMJB 2QKBA 2WHOA 4CJKA 3MTKA 2VWJA 2HNZB 1C2PA 5L1LA 1S0OA 3HP9A 3GYNA 4K8ZA 1KLMA 5FRNA 3MAQA 3M8QA 5D3GA 3DRSA 4EBDA 4F4KA 5KFHA 5KGWA 4DLGA 3OL7A 4CFBA 1EXQA 4MFBB 2W9AA 3FFIB 1JLCB 1TKTA 4ECVA 4KHMA 4Z4CA 4DQIA 2W9BA 4Q0BB 3SI8A 1C1CA 4J9KA 2C2DA 1CZBA 4W5OA 4JRPA 4CGGA 1C1AA 2AGQA 1ITGA 3V9SA 4LSNA 4W5RA 3NE6A 1XWLA 4IOBA 4KI4A 4NLRA 3HHKA 3BSOA 3V9ZA 4DLEA 4LSLB 2RKIB 4E19A 3SYZA 4GC7A 5KFXA 4PWDA 5KFJA 2HB5A 4WYLA 4C8OA 2IDOA 2OPPA 2EX3A 1I39A 1S6PB 4MKBA 4KHQA 3K58A 5FDLB 1VSEA 3DLGA 3S9HA 4E7IA 3C6UA 3BR9A 4O4RA 1C0MA 4ED8A 1HQUA 1RA6A 1NKCA 1RT6A 4RNMA 3SI6A 4J9MA 1N5YA 2FJXA 1BL3A 3AO5A 1IO2A 1EP4B 4IFYA 2YKMB 3H5SA 4MK7A 4TQRA 3L3VA 3V9XA 4O3OA 4B9VA 1KHVA 1RT1B 4YFUA 3NGIA 4K4VA 2FVPA 4OJRA 3GV7B 1TKXB 2YV0X 1JLQB 2AGOA 4E7HA 4NCGA 4DQRA 1TVRA 3SPZA 3DI6A 3LAMA 1EX4A 4TQSA 1BIZA 2OPSA 1ZBFA 1KFDA 5KFZA 1C1CB 5L1JA 4KO0B 2WRMA 4CK2A 1GX6A 3G6VA 2AU0A 3NCIA 1FKPA 2AJQA 1X9MA 4OPJA 3G0ZA 4I2PA 1RTDA 3PHEA 4N5SA 5KT6A 3L8BA 4JUZA 4NLYA 2B6AB 4FJGA 2IM0A 4DTSA 4CJLA 4WFZA 5KT5A 3VQSA 4EEYA 1WSJA 1QSSA 3TAQA 3RR7A 2OPPB 2UVRA 5KFEA 3M8SA 5KT3A 3ZSZA 4KAIA 4NLPA 4BDYA 3PZPA 2YNIA 4O55A 3FDSA 2VA3A 1REVA 4I2QA 1DLOB 5HRRA 1FKOA 2D0BA 3SUQA 4MH8A 1D9FA 4FZZA 3SPYA 3DLHA 1DTTB 4W5QA 2V9WA 3SZ2A 3LP2A 4LQ9A 5CZ1A 3KMQA 1Q8IA 4I2PB 4ECQA 2BGGA 4CK1A 3QERA 1RDCA 2JC1A 5J2PA 1TK5A 4YQWA 1RDDA 3ITHB 1TV6A 2BR0A 1HPZB 3THVA 3VQ4A 1NK8A 4FZYA 4KRFA 1SH0A 3B6OA 4ZPBA 3K5LA 3GV8B 2XC9A 5K14A 4IR1A 1KVBA 3OY9A 3CO9A 5J2MB 4CIGA 5CYMB 5F8MA 4BDZA 2ZE2A 1WSHA 3O3GA 2IJNA 3A2FA 5JS1A 5EWGA 1D0EA 3L2UA 3AVFA 1HNVA 4CECA 1FKPB 2F8EX 4B9MA 1RBTA 2XRIA 5KFWA 4X2BA 3PY8A 3G6YA 3KLGB 3CG7A 2OZMA 2X74A 3V6JA 3AVBA 1LW2B 5C24B 2KQ2A 2XY6A 2DY4A 4F8RA 1RT4B 3D5MA 4DEZA 5KFLA 3V6DB 4QOZB 2D0CA 1HYVA 3SQ2A 2ASLA 1JLEA 1XR6A 1JXEA 1FKOB 4DQSA 3L2VA 1VSMA 4DQPA 1C6VA 3CFPA 4ID1A 3P83D 4E7KA 4O44B 5L1IA 4IH5A 4FS2A 3NFAA 5KT7A 1DTTA 1VK0A 2CJQA 4DQQA 4CIFA 4CF1A 5KFUA 4E89A 5KFIA 2EC0A 4DFMA 3MR6A 2HWIA 3V9WA 3G10A 2KFNA 1NK7A 1B9DA 3ZT1A 4TYAA 1IKXB 5F8LA 5DLGA 1YTAA 4J9LA 2RDJA 1Z4UA 4QCLA 4DF8A 1ASVA 3KK3B 3V81A 4IG0B 2CKWA 3ZSQA 3E01A 1ZETA 4DL3A 4FJMA 4WYWA 3MXMA 1EETA 3TARA 2R2TA 3KLEB 3MR3A 1QE1B 1T3NA 3AVJA 3QINA 3DDKA 1ZBUA 5J1EB 2OPRB 4DFJA 4BE2A 2IOCA 5F8NA 3HM9A 3OYKA 4KV8B 3NH1A 2HHUA 5KFQA 3BSCA 1VSIA 4CEDA 4G3IA 1RCHA 4NLTA 3DLBA 2VA2A 5CY4A 4KHWA 4CEBA 3NBPB 1N4LA 3M9MB 4CEZA 1RTJA 1BQNA 1RNHA 4FLXA 3DRRA 4HTUA 3DMJA 3OL8A 1IKYA 4RW9B 2DFHA 2KZMA 3DYAB 4DL6A 1ZBIA 1X9WA 3QZ8A 2XGQA 4CIEA 5KFCA 4ZP6A 3H4DA 4KV8A 2W7PA 4ECWA 1BIUA 3O4QA 2KFZA 2G8UA 1D1UA 4U6PA 3AA4A 1KLNA 1WSIA 3ZSVA 4Q0BA 1VSLA 3C6UB 3NBPA 4HHTA 3KOAA 3E01B 3OYGA 1N6QA 2W42A 4FJ5A 4IKFA 1MMLA 3C6TA 2R2RA 5L9XA 4O3NA 3OS2A 3BQ1A 4RW8A 1QE1A 4ED7A 1XHXA 4RW9A 4LSLA 4DSEA 1J54A 4FK4A 2OPRA 4HKQA 3QZ7A 1ASWA 1RTHA 2BQRA 3QEWA 4B9UA 2XGPA 3LANA 4Y3CA 2HHQA 2E6MA 5DMRA 1TAQA 2W9CB 4L8RB 1VRUB 4FM1A 4EO8A 2E9RX 4OGCA 2D0AA 2YNHB 5KFVA 1O1WA 3LP3A 3LPUA 3B6PA 5I3UB 3F9KA 5F8IA 3N6MA 4J9OA 1YTUA 2GIRA 4B8CA 5KFBA 3NAEA 3WNHA 4KO0A 1LV5A 2JGUA 2LSNA 1N6QB 5HP1B 3JYTB 3HT3A 2VWKA 3SQ0A 4B9NA 1IKYB 1RTDB 3OLAA 2IGIA 4PQUA 1HMVA 1RBSA 3OYFA 3T5KA 1SH2A 2ALZA 4DL7A 4DTPA 2BANA 5KFMA 3G86A 3CYMA 5FROA 4FJHA 1MU2B 1NNDA 1NK0A 4NCAA 3CQ8A 3LAKA 4FJ9A 3MEGA 5DG8A 4O0IA 2IS3A 5KG7A 3OYIA 2FJWA 2G8FA 2J6TA 1JL1A 5KFRA 1T7PA 3K5MA 4FM2A 3BREA 4Y34A 3KLFA 1WSGA 4NCBA 3IS9B 1UA0A 4ZHRA 3RMCA 1UWBB 1CXQA 4KHUA 5HROA 2UUWA 3RR8A 2IAJA 4K8XA 3ASMA 4RW8B 4DTRA 2W8KA 1Y97A 3MEDA 4FJ8A 3HPHA 4ZPDA 4WXOA 3I8DA 3M9NB 2G8HA 4NYZA 3CFOA 2XI3A 5CZ2A 4FXDA 3D45A 5KG4A 5KG5A 3RMAA 2I5JB 4IRDA 3KMSA 4ECTA 3MFHA 3CDWA 1BCOA 3MEEB 1JXLA 3VN5A 3QGHA 2WCXA 2XY5A 1SUQB 5C42A 4BE0A 3SFGA 1IKWB 4ELUA 4DU4A 4CGFA 1NK6A 3D28A 3KLIB 4CJSA 3V1RA 3BGRB 4IH7A 1S1WA 4H4MB 1XI1A 4O5BA 1BQMA 4O3PA 3O4NA 3NAIA 3OYEA 1RYRA 1YVFA 1KRPA 1FK9A 3P1GA 1Z26A 4KKOB 1QAIA 3MEGB 3VQBA 2ZD1A 2OYQA 4OLAA 3OL6A 3RRGA 1HNIA 2YNFB 2KTQA 4OKEA 2BRLA 2AX0A 1LWCB 3MEEA 4Z4EA 3IS9A 4ECXA 3TWHA 4DSLA 1NHUA 3KK1A 4URQU 4IH6A 1S1TB 3KHRA 3T19A 4B9TA 3ISND 4F3OA 1GOBA 1QSYA 1BQMB 3GILA 3PO5A 3LP1B 4C8MA 5C25B 4ECUA 2UVVA 2BE2A 1S0MA 3QEVA 3VQCA 2IJFA 4NLQA 5DK5A 4KTZA 3QIPB 4KBIA 5KFAA 3QLHA 2ZD1B 3I0SA 2D5RA 4K50A 3Q8QB 1RDAA 4MIAA 2IBKA 1SL0A 1EETB 2ILYA 2R8JA 3AVCA 1KLMB 3NF9A 4OGEA 3TI0A 3KLEA 5KFKA 4EBCA 2UVUA 4CJFA 1VRTB 5KTQA 2V4QA 3RB3A 1GOCA 4G1QB 3DOLB 3PW7A 1TL1A 3V6HA 3PX4A 1DTQB 1LAWA 3GIIA 4FLWA 4EP4A 4E0DA 2BRKA 4I9LA 4DFPA 2XO7A 4KKOA 3NF7A 1T03A 2PYLA 1S1XB 2NUBA 3QO9A 1SH3A 3RMDA 4ICLB 1U04A 1S9EB 3QGGA 2PYJA 3NHGA 3H59A 2HHSA 2VG6B 2A1SA 3ZSXA 1KSPA 3F73A 1LWCA 2PZSA 1W25A 3AVMA 3HPOA 3U3GA 4QW9A 1VSJA 4DTNA 3ZT0A 1VSFA 1SKWA 1T05B 2FBTA 3EZ5A 1VRTA 3QESA 3K57A 3KLVA 2HWHA 3MFIA 3KJVA 2VG5A 1LAVA 2FJVA 2WB4A 4FLUA 2HMIB 1HQUB 3RRHA 2G8KA 2EHGA 1T03B 4ZPCA 5K14B 4C8NA 2HHVA 3QLHB 4K4UA 2IC3A 4K4TA 2DTUA 4XO0A 4CERA 3C6TB 1RAJA 2OA8A 1U45A 2IM1A 2IM3A 3AO2A 3PUFA 4F50A 5D3GB 1RTHB 1S10A 5SZTA 4RNNA 3UQSA 3MR2A 4RNOA 1L3VA 3H2LA 3QGIA 3KJVB 1LW2A 3AVIA 2OPSB 4JS5A 1JL2A 1TAUA 1WLJA 3U3YA 2Z1GA 1NJWA 5C5JA 4Y1CA 1JLEB 3GV5B 1TKZA 1TL3A 1U48A 4UQGA 1Q9YA 5KFYA 4DF4A 4QAGA 3V9UA 4MKAA 3LP0B 4YR3A 4E1NA 3SNNA 3LZJA 3FRZA 2D3ZA 5EUHA 2WK4A 3QEXA 4FBUA 1NK5A 4ED1A 3KHGA 4CE9A 1S1UA 4LH4A 4CJWA 1L3UA 4MFBA 3NAHA 3T5JA 3SUNA 1MU2A 3NL0A 2YNHA 4FJLA 2QE5A 3LPTA 4H8KA 4FW1A 1C1BB 4KHRA 3CVKA 4ED0A 5JUMA 1LWEB 5DG7A 3OSPA 4CFDA 4IQXA 3DLEB 4NYFA 3M8PA 1N48A 3JYTA 1JLBA 2AWZA 4JV1A 3RTVA 2XI2A 5FRMA 2F96A 4HYKA 4WXWA 2DPIA 2R8IA 4M95A 2R2SA 1D8YA 4RU9A 2ZQBA 4Z4FA 2HNYA 4IFYB 3MEDB 1CSJA 1YT3A 4J9RA 3H5YA 3CFRA 2C28A 4BDPA 5J2QA 1WNEA 4CEEA 4KHYA 3DLGB 4B8AB 3NF8A 3TAEA 1QS4A 4ZMMA 4MK8A 1TGOA 2YHAA 4RNFA 4TY9A 3AVGA 1TKZB 4RW6A 1TL3B 3Q8PB 4DL5A 4K4XA 1I6JA 2HAIA 4RUAA 4YR0A 4J9QA 2FVQA 1SUQA 4ELVA 1BCMA 3KK2B 3OYDA 1IKWA 1UAXA 1IM4A 4K4WA 3ISNC 1XHZA 4RG8A 5DQHA 3LWMA 2UUTA 2G8WA 3SFUA 3TQ1A 4O3RA 3BJYA 3H5UA 3UIQA 4ZP7A 5I42B 3HO1A 4HUGA 1RT1A 3AVNA 5KFPA 4FLZA 4TYBA 4QWEA 4KHNA 4F4YA 2JEJA 2HNDA 1REVB 2JLEA 3NKYA 2ATQA 1S4FA 5T7BA 3DLEA 2O5DA 3H08A 3BSAA 4R8UA 4NLSA 4K4SA 1NOYA 4DSKA 3NF6A 3U6FA 4CJ4A 3RAQA 2B5JA 3HPGA 2Z1JA 4H4MA 5J2NB 1HJRA 2DFFA 3AVAA 3EPGA 4AHRA 2HNYB 4JV0A 3DM2B 4TY8B 4ZPAA 1RT7A 3VQDA 1JLFA 3OHAA 3O3FA 4KFBA 1TV6B 4CEFA 1VSDA 4M3RA 3KD5E 4KHSA 5HBMA 3SQ1A 2F8TA 1VRUA 3KK3A 2DFEA 2QXFA 3OHBA 4WZQA 3SUOA 3TABA 2OPQB 5J2MA 3KLHA 4ID5A 1QSLA 3NGYA 3L3UA 2BQUA 4M41A 3MR5A 3MF5A 4DG1B 4KPYA 5HP1A 5HLFA 1A5VA 3VQPA 1QHTA 3AVHA 3I0RB 3OYAA 2XCPA 4LH5A 2AGPA 1RTIA 4NLWA 1JXBA 3L2RA 5F9LA 4QPXA 5J2PB 3BDPA 4HUEA 3VA0A 1S9FA 3M8RA 3PW2A 2BANB 4Q8FA 1LWFB 1G15A 5C24A 1CLQA 4JLHA 3QIPA 2W7OA 1CXUA 1S9EA 2ZE2B 3M9OB 4CJQA 1JLAA 1JKHB 4MQ3A 5KG1A 2GIQA 3UPFA 4GVMA 4CCHA 3IGNA 3H5XA 2AX1A 4CGDA 4DTJA 3VQAA 4NYNA 2FLNA 2O4IA 4FLVA 4O0JA 1S5JA 3ZT2A 2A1RA 1WAJA 2D7SA 2VG5B 3QEIA 1ZTTA 3ALYA 1RT4A 2FBYA 3AA5X 3BQ2A 4FS1A 3TAPA 4PUOB 4I7FA 3WNGA 5KT4A 4AHUA 4IG0A 3OSNA 3CJ3A 4WFXA 4J2EA 3AVKA 5CYQA 4FJKA 4ZVEA 4Z4GA 2FBVA 5HLFB 4F3TA 3I0RA 3DRSB 1JX4A 2VG7A 4Q8EA 3NDKA 2DPJA 2HW3A 3EPIA 5KFGA 3VQEA 1RILA 1RDBA 1SV5A 5KRTA 3FFIA 2E4LA 1WAFA 3MECA 1RA7A 3KKSA 3LALA 4U7CA 1C0TA 2WONB 4ZVGA 2BQ3A 4QWAA 3RB0A 2Q3SA 1JIHA 1U4BA 1KTQA 2IC3B 3HSTB 4JV2A 2ASJA 1BQNB 2FBXA 3IRXA 2GBZA 4OKJA 3M8QB 4PQUB 1N56A 4NRUA 5SWMA 3DLKA 3QIDA 2HHXA 4R5PA 4CESA 4QWCA 1VSKA 4DS4A 3KTQA 2JEIA 1NKBA 4TN2A 4DTUA 1W9HA 4DS5A 3C94A 4FJJA 3HVAA 1SV5B 4BACA 4EBEA 5DQGA 4NZ0A 2BDPA 4RW7B 4FK2A 4F2SA 4CK3A 1RT6B 4H4OB 1HYSA 1ASUA 5KFDA 1RTJB 2GV9A 2X78A
chains in the Genus database with same CATH superfamily
4JI4J 3DOMA 1QVGM 2UXBK 2UUAJ 1S99A 4K5RA 4QIVA 4RU2A 4CJUA 3SQGB 3ZSYA 3OVNA 5F0WA 4LF1A 5M1NA 1NPRA 5GAGU 1EO1A 2I5JA 2FHJA 1KEKA 4JKGB 4DV3F 2LYVA 1T44A 4CTAA 1KVCA 2QO3A 5GIPA 3O80A 3I56N 2O1PA 2K8GA 4N8NA 4PR6A 2Q0RA 2H1YA 3G71S 2XMKA 4MO4A 1GMWD 2UU9K 2J6UA 3TTFA 2YH0A 5KFNA 2KT2A 5A6WA 5B0CA 4CHOA 2CVEA 2O3DA 1R0AB 3T5HA 2MHNA 1RBOB 3AV9A 3X3UA 2XMMA 4XPCA 4C7QA 4OPHA 2BJEA 2CQ0A 4C0BA 2AF6A 2ZH5A 3ID6A 4F4ZA 4DV4F 2GO8A 3CJ2A 3VGKA 2OTLN 4RWXA 3C14B 3IMXA 4I6WA 2XS7A 2QLBB 4KFBB 4CT9A 1VHFA 1HNWF 4GKJK 3W61A 5B0EA 2BE7D 4CO5A 4DV7F 1TP7A 3ZSWA 4KPCA 3DLRA 2UU9F 2OPQA 2QG9B 4UUXA 3EICA 1W7WA 1QDUB 1G3OA 4R8UB 4PY5A 5L39A 2QA4G 4AYBD 1N54B 4ZP9A 3OL9A 3MMCB 3M30A 1VBKA 5EXWA 5IT9Y 3J7AN 4UUWA 1PAUB 2CFXA 2ZHOA 4IOCL 4PA1A 5BPLA 1OY8A 1X9SA 3CC7N 1F6TA 4CLYA 4YOYA 1I94K 4USUA 2R8GA 5CYMA 1A7GE 2EFOA 4IG3A 1U09A 3SSQA 1KCFA 4AH9A 3RGIA 4DL2A 2OUGA 4FXWA 1C0GA 2ZBIA 2RE2A 1JMTA 2Z8QA 1J5OA 1GLAG 1YZ7A 3DGPA 4F0KA 4C2MA 2Z1IA 2ZNYA 1LFPA 4Y28C 2G8IA 3U4LA 1WF1A 3VGSA 4KTWA 4CJVA 1H1VA 2RRBA 4OMFG 1RU2A 1VBXA 1WORA 3JSMB 1WF2A 2RU9A 1RBUA 3HYFA 2I38A 1KVIA 4M94A 1GLDG 2NCKL 3RBEA 2KN4A 3EKUA 3DOKA 2IVPA 3AHPA 5JMNA 4OFZA 4P71A 4Y6IA 3VQ7A 3NGDA 4CHPA 4K5SA 4ANCA 3C7NB 5HRSA 3KG0A 1DBDA 1KTVA 3OVAA 3LP2B 3N6NA 4A2BA 1YBUA 2YKNB 1RWKB 4NLOA 4RBUA 1SPBP 5A8KB 4M5DB 1Q0NA 4JI7J 1Y10A 4HTLA 4GC6A 1IH7A 4ZN1A 1VI7A 3SUPA 1X3NA 1N5YB 3EEQA 1U6FA 1S72S 1IBMJ 3GLJA 3HKWA 4X4QA 2MDAA 3HHDA 1DFDA 3DXMA 5CYQB 1ZM3A 2C3UA 2ZVIA 1X0FA 2EC2A 4ILGB 1TK8A 3A5NC 2FJAB 1ATNA 3FQKA 1HWJA 5B0AA 4FYDA 1PYTA 2UUCK 2WBNA 1TQLA 4FJXA 2LXUA 4ZA1A 1JLFB 1JLGB 3BN4A 2BH1A 2CPEA 2V8PA 4QWBA 1N8RT 4LF6F 4CO0A 1S12A 2O8EA 5AQRA 3R9LA 4U67Q 2XY8A 4J9VA 3H40A 4PXBA 5KFOA 2RD5C 1HBUB 2WVBA 1BGXT 1BOTO 3PJXA 4FF4A 3VVUA 3CXCM 4JI7K 1SKUB 1HQ2A 5KG3A 4DB3A 4OJ1A 4LF7K 4A8YA 1KVAA 4CZJA 5AXNA 1S9GA 3Q89A 4BREA 1FI4A 3E66A 4OKKA 4Y2CA 2GJFA 4OX6A 1WC1A 1RHJB 3T41A 5DLFA 1UOCA 1NK9A 4G9ZA 1XMQJ 3N4PA 3MTJA 1K8KB 1A6LA 2BW2A 2WSEC 4FVCA 4PYDA 4P2FA 4CGHA 3KK2A 3LWLA 4LRDA 4C3KA 2R7YA 4AD6A 3M1FA 2ATLA 4YUDA 2I8EA 4WQ5A 4ZIVA 3VGUA 1Q82T 3U1LA 2KXNB 1VQMS 1J5EK 1S6PA 1WD6A 1U1LA 2E1CA 4FYWB 4B3MK 4M5NA 3T1HK 1NBWA 2RQMA 4FOIA 2GA7A 4CJTA 2E5HA 3DLLL 3UKUB 4QIWD 3AQPA 2IMOA 4LF5J 1LWEA 3KLFB 4J9SA 3WQUA 3UR0A 2AYMA 3PW5A 3OLBA 4I6AA 3LDNA 3MCSA 2W8LA 1DEJA 5KFFA 2A6OA 3SV3A 2ZJPQ 1U49A 3KKRA 1HR0F 4FLTA 2QEXS 3KWGA 2DNMA 2LFVA 2EXUA 4U8YA 1NWKA 4LFBK 2UUBK 1TYQA 1FJ7A 3C6AA 1Z2ZA 2HK2A 4XIUA 2R7TA 3KHLA 1Y5LB 4DKWA 4LF8F 2E1PA 1D9DA 2WVCA 1BU6O 4WYBA 2BXJA 2Y1JA 4L3KA 2V8VA 2ILZA 1S1WB 2BJ1A 4X62K 4CJRA 4KE5A 1U2CA 1VQ9S 5A76A 3ZEUA 5M1OA 3R6MA 4F02A 4X64J 2XHBA 1FJEB 2YWFA 4M1KA 1RGVA 4RW4A 2RSQA 1OH6A 3FUYA 1IG8A 4CLSA 1MLAA 2YNFA 1YLXA 2YHXA 3NG8A 4JP8A 3HLUA 2Z58B 1SXLA 4BVPA 3M2RB 3BGRA 1R8CA 2WW8A 1SIZA 3PW0A 2F4FA 4Y00A 4C23A 2B5JB 1PYSB 3TO8A 3H4BA 1GOAA 4GKJJ 3BYPA 4JI5K 4M3TA 4NX9A 4CJEA 3HZ6A 2DRDA 3AOCA 1YAGA 1T9VA 4U7BA 2GHPA 3HVWA 4V19X 1HBMA 3Q23A 4ZTJA 2M5YA 1YWXA 3FK4A 3VQ5A 5ETQA 2XO6A 4C8LA 4B1YB 2J8AA 4E7JA 3GL1A 3C3LA 1RISA 3P5JA 4OVLA 1WBDA 1WC6A 2J76E 5LT5A 4AHSA 2IAJB 4OV1A 3T1AA 1IBMF 3EZWA 9ATCB 4YHHF 4ED2A 2HVHA 2YY3A 1VR6A 2ZWHA 2E5LF 1C0TB 1S59A 1H2UX 1TMJA 5E3RA 1RT2A 4LRBA 1JWWA 3GE9A 4HHHA 4JI1K 2LU1A 3CIZA 2VDHA 4CJPA 1GK8A 4BS2A 3Q7BA 3FVYA 3WDOA 3OYLA 4BRDA 1WC5A 4M63C 5D4OA 2OI2A 3KNAA 1DRZA 2R3VA 1B0TA 4URGA 4UF4A 2OSQA 1DTQA 5ADZA 3CM6A 3ENWA 2V0NA 2P9LA 3C14A 1Q4RA 4JNEA 2YNGA 4DV5J 1K9MO 1KHWA 4OLPA 1R7IA 3ILLA 2J0QD 3TR5A 2HS4A 3D7SB 1NK4A 2O8EB 1HYSB 3AA9A 3CO0P 2G1HA 3WNEA 1FWLA 1EQMA 1TK0A 3TUJC 3EYZA 3US5A 2ADCA 5KFTA 3C66A 1MDUB 5A2QO 3Q8YA 1O5JA 4G1IA 3FZFA 1KD1O 2CAJA 1X4BA 3MM8A 2UUBJ 2HHWA 2FHKA 2B9WA 3IKMA 3L2WA 2IA6A 4ECYA 3HOTA 1MMNA 4GVEA 3ZZPA 1WHXA 2ALYB 3W2WB 1M5VC 3O3HA 1GH8A 2LXFA 4DV4K 3QETA 1N33J 1I1GA 5I3QA 3HI9A 5IWAJ 4IG3B 2FZCB 1RDUA 1RYSA 4DV1K 2QKBA 4P2SA 4U7UD 2RIJA 2HNZB 4K8ZA 5DZ6A 2QL7B 5HQLA 3MAQA 2J7WA 5D3GA 4L72B 2DHSA 4C11A 2YHWA 3KJQB 4DR7K 3LQVA 1AZSA 3AA8A 3SDEB 2IJRA 3DHWC 1EXQA 5BPMA 3FFIB 2PSZA 3UE2A 1HHQA 4MYUA 1PBAA 1TKTA 3NCQA 4R25A 4Z4CA 1UEUA 4LBIA 3SI8A 3B8HA 1NDKA 1NJIO 4CGGA 3VWSA 1KDNA 2JRSA 4G6VB 4W5RA 3MWTA 4KI4A 2P9SA 4QIGA 2MSTA 3SQOP 3BSOA 5RUBA 5GADU 3CT9A 4DR5K 1P9QC 3MWPA 3D1OA 3IBCB 2MB0B 4JI6J 2OPPA 1I39A 4WK1A 3I32A 1YVNA 3EE3A 4JI6F 3C6UA 4E7IA 3GSDA 5IV3A 4DR1J 1HNZJ 2X7IA 3SI6A 1N5YA 3THTA 4NA2A 1BL3A 3PKYA 2QL9B 3AO5A 1Q8KA 2DT9A 3G8QA 1IQTA 3SLCA 3V9XA 3O08A 5D0RA 4DPWA 3GV7B 1JLQB 3ENHA 4E7HA 3NMRA 1TVRA 1OIAA 4ZLNA 1FVSA 1BIZA 2OPSA 1ZBFA 3IM8A 2CQDA 1C1CB 3QSYB 1E4GT 3D2EA 4E2FB 3ULEB 4NZ7A 3G6VA 4I1TA 1RWMB 2FSJA 2QMXA 1X9MA 2CWXA 4UOCA 4Z94A 3PHEA 1F9EB 4N5SA 1KR4A 3BZKA 4GO7X 1VQPN 2KM8B 5KT5A 1TFYA 1U26A 1H2TZ 4YB1P 3MN7A 3HBTA 3Q0AA 4MJKA 2RUGA 1O0PA 3L3CA 4I2QA 2M9KA 2D0BA 5HRRA 3C0BA 3QRRA 4MH8A 2CGJA 5A0YB 5BRFA 4BRLA 1X9JA 1RSCA 3DLHA 4WQ4A 1DTTB 4DPYA 3JAMY 3OFEA 1FDBA 4U9RA 1IV0A 3KMQA 2DNOA 4I2PB 3SCIE 2HGMA 3CDBA 1TK5A 1RDDA 4A8FA 2BR0A 8AT1B 4CZKA 2ASMA 5CXTA 1RJJA 2CQ2A 4B17A 2ZH3A 2ZJQL 4LC9B 3GV8B 3J80U 2BABA 5J2MB 2D3O1 2O67A 1WSHA 4TU8A 2IJNA 3A2FA 5EWGA 3CD7A 1FKPB 2F8EX 5T41A 1DJ0A 3CUNA 4X2BA 3ZZOA 3PY8A 3LDQA 3VTIA 2V68A 3HHEA 2OZMA 1X4CA 4FN5A 3NEKA 4EMDA 4CBWA 3UDVA 1Q8LA 4XH4A 3J80Y 3AVBA 2KXHA 5ETLA 3VEZA 3O9UA 2D0CA 1HYVA 4M7XA 1VQLN 2XBPA 1FKOB 1YJWS 2ZUGA 2DGOA 3P83D 4QYZJ 4QR0A 4RWTA 2Q1NA 4DQQA 4TKTA 2CJQA 1NGJA 5KQDA 3CCUN 4CD3A 4QR1A 3PNIA 1YJVA 4DFMA 3V9WA 3EVMA 3L9ZA 3G10A 1NK7A 2E1MC 3MCMA 4DBQA 3CF5Q 3MM8B 3HF5A 4ES1A 3WIVA 2RDJA 3WZ0A 3FBCA 3ZSQA 3CJ8A 2KRBA 2HZCA 3I31A 1EETA 4P75A 4OJGA 2HLUA 2HEKA 2XEXA 4X4NA 3QINA 2MLZA 3DDKA 4BE2A 4I64A 5A8RA 2N7YA 3VZIA 3OYKA 2GQCA 2JH3A 3WEEB 4FO0A 2KHDA 2PA8D 2WFBA 2GVZA 1O13A 5CY4A 2W4CA 2QYCA 2QMWA 4CEBA 4L3QA 1YRTA 3M9MB 1KQGB 3TEHB 4CEZA 2DNNA 1BQNA 5B0FA 3T1HJ 5JICA 3EZOA 1FNMA 5EY4A 5D8HB 4CZFA 2DFHA 2CH6A 3K8WA 2F5GA 2A40A 2KZMA 3DYAB 1VOMA 3SQGA 3QZ8A 4ED4A 2WAQD 4F3QA 4I67A 4HACA 3HFKA 3CB4A 1VIOA 4CIEA 5KFCA 2NPIA 3H4DA 3VF6A 2VQEK 4OI3A 4B3RK 1BIUA 3VOVA 3MM7B 3GFZA 3GCXP 5JLHA 2G8UA 2IBOA 3JSYA 1WSIA 1R0CB 3K5PA 4NLCA 5ADXH 3SSSA 3AB4B 3CC2N 3D3BJ 3HFZB 2VPZB 3OPKA 3N4QA 3GCWP 3M2VB 5HANA 2W42A 4C0OC 4LFAF 1UJ4A 1H74A 3BUZB 2W4DA 3BQ1A 4RW8A 1QE1A 4BRKA 3NLCA 1WHVA 4QYZK 2QWPA 2A10A 1P8ZA 4GY2B 2BQRA 3H45C 1FJGJ 2XGPA 2ROEA 4Y3CA 3AT1B 2A18A 1VYAA 4BC2A 4X4TA 3SCKE 2YWKA 2YNHB 4PZVA 1WF0A 1YTUA 4JI8K 3WNHA 2MZSA 5E26A 2ASYA 1RU1A 1XK8A 2VWKA 4B9NA 4DPTA 1IKYB 4UY8T 3OLAA 2AYEA 2Q6CA 1NGCA 3TZXA 2IGIA 3T5KA 2ALZA 4KGKA 3DFEA 4RUBA 2BANA 3N01A 2GIFA 1U1RA 4C1NK 3OT9A 1SC3B 4FJHA 1VQ9N 1NK0A 1JJCB 3IWLA 3CQ8A 1RGIA 5AZJA 4FJ9A 3VVTA 3BGUA 1JJHA 2J6TA 4P7TA 5LJ5Y 5KFRA 1PJ5A 3OVBA 2FSNA 4NCBA 3W9HA 3BV8A 4ZHRA 1EZZB 1CXQA 5HROA 2UUWA 2XLIA 4CM0A 2JVOA 1H7XA 4DTRA 2F40A 2CYYA 1Y97A 5I4MA 5HMWA 3PG9A 4ZPDA 3R3LA 3CFOA 1M5HA 4YDUA 1HA1A 2B4VA 2OELA 5KG5A 2YCHA 4FWMA 2I5JB 4ZLPA 4FWRA 2WSFC 4JKGA 5FLXO 2O8BA 3KMSA 3J8AA 5C2GA 3OUYA 4CLWA 3MEEB 2Q0UA 3RYLA 4DV3K 4MO5A 2WCXA 3FSXA 5C42A 2QLWA 1F5AA 1NK6A 4CJSA 3TYTA 2QRRA 2AEMA 1HNXJ 3N0VA 1XI1A 1BQMA 4OJ3A 4JOUA 3OYEA 3U1MA 1Z26A 2VQFJ 2CJAA 4KKOB 3DDNA 1QAIA 5FJ4A 4P9SA 2BZ2A 2ZD1A 4X4SA 3BO2A 3I4PA 2OYQA 1O51A 4OLAA 5H9EK 2QM1A 4A8KA 4OKEA 4OX7A 1TL5A 4YS2A 2HRTA 1U6ZA 3G87A 3PIOQ 4Z4EA 5CA5A 3QJLA 3KK1A 4K59A 4PWWA 5DJBA 3E9PA 4IH6A 2VASA 2K2PA 3PYFA 2D1KA 1B99A 1RAGB 4DZ6A 2ASOA 1AYEA 4IXCA 4ZVPB 3ISND 3IP0A 2B56A 2RJZA 4HI1A 5THWA 3LP1B 5C25B 2BE2A 1S0MA 3UI3A 4NXMK 2Y0BB 1T9UA 1BC6A 2IJFA 3QIPB 4KBIA 5KFAA 1RWPB 1Y64A 4QBUA 1VBYA 4USHA 3PKMA 3OVSA 1KLMB 2XTJP 4KC5A 4EI2A 3C7NA 3NF9A 3KLEA 3F44A 5E33A 2UXCJ 1VRTB 1R8BA 5HN0A 1A0OB 3RB3A 1B7YB 2D3OR 5AQHA 2O8FA 1WEZA 2BV3A 2HLTA 3V6HA 1LAWA 2G0CA 3BPDA 5KPZA 3CCVN 2VV5A 4A2AA 4FLWA 2H4WB 3VERA 1Q86T 2PYLA 2NUBA 3ET6A 1U04A 3QGGA 5ETKA 5HVHA 4JV5F 4D3GA 2NLWA 2PI5A 3ZX2A 4IO8A 4OX8A 1LWCA 3ONQA 2F63A 3JSRA 1Y9OA 1G99A 2C2KB 3ZT0A 3TWZA 1T05B 1QQMA 4MLEA 3K57A 1U1OA 3RVCA 3H20A 3R5DA 2HWHA 3G82B 2CJXB 3KJVA 5DZ7A 3E9LA 1HNWJ 4ITSA 2FJVA 4ETXA 1XMOF 1HQUB 2GZOA 2CWKA 3RRHA 1WUUA 3CCQS 2A6MA 4RKUC 3TVZA 3TZWA 3MR7A 4C98A 3CJKA 2DTUA 4O23A 3C6TB 2OA8A 4DPUA 3OR1A 1GXLA 3D6RA 1BDGA 2GWKA 2B0GA 1OSCA 1NGGA 4E8UA 5K8MA 3QWUA 1WELA 4Z7YA 1HBOB 2MKSA 3TW0A 5IT4A 4RNOA 3H2LA 3QNWB 1KAYA 4OV6A 2O8CA 1LW2A 3KYLA 2FF6A 1N34J 1J2VA 3DXSX 3WX8A 1TUUA 1JL2A 1TAUA 1WLJA 3L95X 1T9XA 2BYCA 1KQKA 3W1YC 5C5JA 2P9KA 3PSIA 3IXQA 3BZCA 1VQKN 1CS4B 1UL3A 2J8SA 3DNCA 4E1NA 3FRZA 4MDAA 5EUHA 3HKZD 4CW7B 3R5BA 4WQ5C 4DHYA 4CJWA 3L7OA 1FF2A 3LPTA 4H8KA 1C1BB 3HSJA 3JB9k 1FRMA 4KHRA 3CVKA 2ZH4A 1OH5A 4LJMA 2VB6A 5JUMA 3NS5A 2JSXA 1LWEB 3PXGa 4JI3K 1R43A 1HW8A 3DLEB 4A62A 1JLBA 2R7VA 3RG6A 4LBHA 2XNRA 4M95A 2FDNA 4OIXA 2R2SA 2ZQBA 5D0GA 3VF0B 2HNYA 4QS8A 1CSJA 1S5ZA 2V50A 3MN9A 2DIUA 4PL8A 4H0OA 3ZTQA 3L4BC 4CO4A 4IDHA 1XMQK 4KHYA 3BGFA 4B8AB 3NF8A 3MMBA 3TAEA 1VQ4N 1N0VC 4MK8A 4FPBA 3R1HA 2MQ8A 2IVFB 3Q86A 3KXDA 2Y1RI 3VGTA 1ZM2A 1IKWA 2ZEJA 5CABA 2FYXA 1Q81T 4K4WA 4NMLA 2CH5A 3S01A 4O3RA 3MCOA 5I42B 4ZP7A 3H46O 1PC4A 3VGVA 5FPNA 4KHPF 2AYBA 5CE3A 5KFPA 2F7VA 3UD5A 3EKSA 2W2NP 5B8HA 3MPDA 3FZ2A 2JEJA 1REVB 1W97L 1VLOA 1UEKA 3NKYA 1S4FA 2HIYA 5AT1B 1UEVA 4GKKJ 3BSAA 2ZF5O 4Y2KA 4K4SA 1NOYA 4DSKA 3U6FA 4NZ6A 3LM9A 3RAQA 2B5JA 3HPGA 1VISA 4YN3B 2RU3A 4JV0A 4PPZA 1SS6A 3CSKA 1R8HA 4WJBA 3VQDA 1TV6B 4JKBA 2JX2A 1VRUA 2QXFA 3OHBA 2QZ8A 4WZQA 5M1PA 3FEXB 2E7WA 3TABA 4NE9C 2V94A 3AXMA 1HKCA 2KJVA 5LL6Z 3DU5A 3R7SB 3L3UA 2BQUA 4M41A 2A6AA 1YJWN 1QHTA 3IR5B 2A41A 4DV6J 2A3ZA 1FXDA 3FMBA 4ZJQA 4JI3F 4BRPA 5J2PB 3KUHA 4F7VA 3GG4A 1CC7A 2DNHA 1LWFB 3FR0A 2PIIA 1AT1B 2NYHA 5JJBA 3D0HE 2DO0A 1CLQA 4BVOA 2Q31A 3D67A 3ET6B 1RADB 1S9EA 4F36A 3QPIA 1HKGA 2ZE2B 3R8EA 4CQ1A 3C46A 1FD8A 2DGWA 3R1LA 2C2MB 4UT4A 1XC3A 3OR2A 4KIAA 2ZH1A 1DT9A 2FLNA 1Q7LB 5FPMA 2O4IA 1MWQA 2E5GA 3NXZA 3HM8A 2E2QA 2G0IA 2ROGA 3CXCR 2FC8A 1NSPA 5CCMA 1NU4A 1I94J 1RT4A 2FBYA 4DR6K 3EUNA 1NMEB 3WNGA 4DU8A 4DV4J 5ETTA 3OUYB 1LEOA 4WFXA 3IBWA 4A4JA 1OSDA 4Z2XA 2I7NA 4NXMJ 2NXEA 1MG7A 2VG7A 4YDXA 3ZZYA 1VQ4S 4CLUA 2VWBA 2DPJA 2HW3A 4K2XA 4IO1A 1VQ6S 3F9MA 5KFGA 1WDDA 4WFAQ 1HNZK 1WAFA 4WTYA 1N34K 4I0WA 4QWAA 1RUSA 4JKHA 3ZETA 4B1WB 2ASPA 1U4BA 1KTQA 3VAFA 5H9FK 3JXOA 5BR8K 2ASJA 2UUAK 3N4WA 3R5AA 3IRXA 2AIRB 3M8QB 4PQUB 2FD2A 4F4AA 3DLKA 1FFWB 3QIDA 2E2PA 4R5PA 4FXVA 1NEEA 3OV7A 1M1GA 2FHMA 2ZOFA 4ILMA 3PYDA 1GLFO 1M1KT 2O8CB 5DQGA 4KH1B 1N36K 3TUPA 4F2SA 3VHQA 1UVKA 4PCQA 3VEYA 4GV6A 1HYSA 4S0MA 2IFXA 2UUAF 3RZAA 4IOAQ 5DM7Q 4ED6A 1QTMA 4IFVB 2M8HA 2A2DA 4CLFA 1F2GA 2E44A 4J7CA 3MMAB 4WFYA 3GG1A 1SJ4P 4OI6A 3UWTA 4C48A 2NRWA 1X7VA 1BA1A 3IG1B 2IDEA 1RWUA 2V69A 2C2EA 4C8KA 3DDIA 2KU7A 2RH3A 3JSBA 4G65A 3RB4A 3LM2A 4NA3A 3UCZP 4ZVFA 4YB7A 5KG2A 2V7ZA 3TVKA 3EXCX 4DSJA 4USTA 3HVRA 4GW6A 1WWHA 2P9EA 3CW2C 3CJBA 1SKSA 4LF4K 1QY7A 1FRHA 2DK2A 2GAGC 4EP5A 3WQTA 1E6YA 4C11B 2ZJRQ 4FLYA 1IR0A 3M1VB 4JI1F 2CDRB 3G82A 2YBVA 4Q5VA 3CMEN 2R4FA 2V5HG 3SJJA 1M5OC 5E0OA 2VOPA 5I3UA 1Q78A 4C3MA 2C3YA 3N5FA 4W5NA 3CJCA 1NJIT 2PGCA 2XZTB 3Q8SB 3AD9C 3GQCA 1UWBA 3EN9A 4RBVA 4O4GA 3AXKA 3PR4A 4PPDA 4WE1B 3W64A 3FNNA 2G2OA 3EE9A 1SQFA 4R0EA 4LF8K 4L76A 1B4SA 1Z25A 2YNIB 2RN2A 4OL8A 2WTUA 4ZVUB 3A8EA 1VRQC 4N47A 2BJ7A 2FC0A 4RNHA 3ULDA 4LF5K 2P9KB 2EFQA 3JTNA 4QJVA 1HIYA 4IO9L 4FYYB 5B0DA 3K5NA 5DS7A 3P4IA 1DGKN 1QTNB 1RBRA 2DISA 3K8VA 1RABB 3CPEA 4AHTA 5HRNA 4FBTA 4CF8A 3QSIA 4M5DA 2PN6A 1WKKA 4Q43A 4H54A 2VOOA 1AB8A 4WP8A 1UPPA 4FK0A 2IIRA 5HO4A 1C1BA 1I3OB 1N5TA 2IA0A 4RUCA 3I8BA 4F3MA 1LK5A 2Q3PA 4JI5J 3OTOF 4YB5A 3AH6A 3ULEA 2Z2MA 3SV4A 1SIWB 2Q1LA 3OFFA 2MQLA 1Q9XA 2AHOB 1YIJN 2ZM6K 2R2UA 3TZZA 1E4FT 2L3MA 1WOQA 5HRPA 1APSA 2VIHA 4EIAA 3H2VE 5MLCV 2YWWA 2P51A 2CG4A 4RO0A 1KVJA 3NGZA 4ZDNA 1S1VB 4RZRA 3OYJA 1AFIA 3TA0A 4DTOA 1HW9A 4PUOA 3FGVA 4N76A 1JKHA 1YJNS 2MTLA 3K59A 3W3DA 1BI4A 4FP9A 2R7SA 3VV2B 3QFUA 3PW4A 4CHNA 2XSFA 4IOXA 2QWNA 1S79A 2VC0A 1V3RA 5H1SQ 4BRGA 5FDLA 1JB0C 2MMYA 3HSGA 5FPEA 2KH9A 1S49A 2PA3A 3HVTA 4JRQA 1U2VA 3OTDA 3U9DA 2JC0A 2LA4A 2KHCA 2CQ1A 3WXJA 3I55N 2KT5A 2FY1A 3L4IA 2WOMA 4ECZA 2XCAA 2QI2A 2GX8A 3HHLD 2K7JA 3OHRA 3FRYA 5HAOA 1HUXA 4CLTA 2RF2B 4FPRA 3DM2A 1FRXA 2ZGYA 1S76D 3UO0A 3P96A 5HJYA 2YJEA 1EWRA 5KRSA 3MAAA 1MW7A 3QEPA 4J9UE 5HL7Q 1U2FA 1M90O 2P5OA 3QNNA 3DOKB 5GAHP 4IDKA 5AQFA 5CAAA 3D7EO 2VPXB 4DG1A 3E2EA 4A61A 4P2MA 1G1XA 4ISGA 2X6SA 1L3SA 1W0HA 3PVXA 5HQ8A 4AHVA 2W4PA 3BKFA 3TJ8A 1YRXA 6FD1A 3Q8RB 2QSFA 3MMJA 4DN9A 2CJYB 1TYQB 4LD0A 3M32B 1SC4B 4AHCA 4OQJA 1RBAA 4DR5J 5LMNF 3BYRA 4EFHA 3CE8A 1Z05A 3TR8A 1XQSC 1LW0A 1WUAA 2E1AA 3NS6A 4K4ZA 4WFBQ 3P4UB 3OFHA 1UFLA 3PACA 1S48A 2F9DA 3D0IE 3CULA 2UXDJ 2XB2D 2O4GA 1P27B 3LZIA 5AQXA 1OQ6A 1M0SA 7FDRA 3OFGA 1JLCA 1JLGA 3S41A 2B4JA 4KTQA 2YWHA 4OPKA 4OZ5A 5D0EA 1UW4A 1K8KA 2XY7A 3V4IB 3RAMA 2F4VF 3THWB 4NMXA 4BY9C 2B51A 5GADP 1HNVB 4CF2A 5D15A 3HXMA 3IDHA 4B1ZA 2V7YA 3IGVA 3KLGA 2Y1IA 1HWUA 4PWDB 1UCNA 4B3MJ 3FSYA 3FZLA 1S1UB 4EU0A 1B9FA 2F7TA 5HBMB 3FSIA 4DV5F 3V6DA 3UFCX 4NCGB 2NRRA 3NWRA 1BISA 3ZZ0A 3G8SA 6FDRA 1ZBHA 4B9SA 1UWAA 1MA9B 4AILC 4IKAA 3PJWA 3G6ES 1RAEB 3NP5A 2ZJRL 3KIOA 5IT9U 1CG2A 3TSUA 4N41A 1IBLK 3TPQA 3QT6A 1MWKA 4ZCIA 5ETSA 4JKCA 1WOSA 4XEIA 2BKPA 1EIYB 3VA3A 4BWJA 4YOUA 5J1PA 3P5BP 1CULA 3OYNA 4JK9A 3RMBA 4CJ7A 4ZKAA 3H7HB 1NJZA 5LSOA 3S8SA 3OJSA 1VBZA 4WF9Q 3HSDA 3PHTA 3L0QA 3T9ZA 1P1TA 2HQDA 1HRHA 5J1EA 5AQUA 4LR7A 2PEHA 1GAOA 3TAFA 2B6AA 2ZJQQ 4EZ9A 1VDHA 2QWMA 3M6GA 4Y2AA 3Q2TC 3O1LA 3AAQA 2MQMA 3IG1A 4YMEA 3OYHA 1FESA 4B3OB 2Z1HA 4NA1A 3FFKB 2IDLA 2UXBJ 5GAGP 1Y00A 2NLXA 1JJ4A 5ETOA 1L3KA 1RAOA 1XEZA 3KK1B 4E7LA 5HSPA 3S3OA 4QOTA 5AQNA 2XSJA 3GWCA 4DV1F 4OHWA 5F8HA 1IJJA 2VPWB 4EYHB 2F8MA 1KQSM 3OXLA 1K73O 2BE2B 2CPZA 4BRCA 4JBCA 4YOEA 1EKSA 2J0WA 2QGFB 1HQEA 4RW4B 3OS1A 2SXLA 3P38A 4ZLJA 4DI6A 3PR5B 2B9XA 3OBWA 1RHUB 1BI4B 2IM2A 2HNZA 1IKVB 2X51A 1SL1A 2DYAA 3FKBA 3ICLA 3K7RA 2CPIA 3AO1A 1UMJA 1ZC6A 4FWNA 1SJFA 1RTIB 2UYTA 4CT8A 2W9CA 4JI2J 1L5UA 4M3ZA 1QHAA 4KH5A 1IBMK 1PC5A 3PO4A 1YZ6A 2LEPA 1NDPA 3PV8A 3K0SA 4H4OA 3MAAB 4YNQA 2OTLS 1FCAA 2DR7A 5M1FA 5LM7E 2P9NB 2WTFA 4PXDA 2OLWA 2P5GA 2IVNA 3AODA 4URSA 3K17A 5CYJA 1F9HA 4F4XA 3AY9A 4UZBA 1S0NA 1Q81O 2DR6A 3SDEA 1T0TV 2L48A 3LGMA 3FZKA 2COLA 4DR4F 2RF2A 1JQGA 2FVRA 3VEOA 5L1KA 1Q1KA 2VKRA 4CJ5A 2W9BB 2YNGB 2EKYA 3CCMS 4RWWA 4QW8A 4ED3A 3HOSA 2ITGA 4I7FB 2P9IB 3MXIA 3EZUA 1B64A 3DMJB 5HMYA 4FNIA 2NRTA 4CJKA 1FX2A 1S0OA 4CH1A 1IN0A 5FRNA 3ZZZA 2HQIA 4B3MF 4HR2A 4RBTA 3Q83A 4CH7A 4IEEA 2VKZG 2G1DA 1RQ0A 4DLGA 3OL7A 4CFBA 2P9LB 1CQMA 3CCEN 4OHVA 1P1LA 1JLCB 2C3OA 5E3QA 2Z56B 3TUZC 4Q0BB 3LDPA 2V2VA 1C1CA 2DNZA 1CZBA 4JRPA 1V4SA 4B3SK 4Q2MA 2CZVC 5JMVA 4LSNA 5GINA 1Q18A 3NE6A 4DZDA 4NLRA 3K2YA 4PKHA 3NOGA 3SMPA 3HHKA 3V9ZA 5B0GA 2RKIB 1FT8A 3VTHA 2HB5A 4WYLA 2Y3YA 4QPTA 1FRIA 3Q22A 2W2OP 2VJUA 3IO1A 4NWBA 3D1HA 2E5LK 1C0MA 4ED8A 4B3RJ 1YF5L 4FWKA 3A5OC 4RNMA 2D0OA 2Q36A 3TU5A 2PI4A 3HSCA 4AQYF 1N5SA 1EP4B 4IFYA 4LFBJ 3CMQA 1TL7A 1NXIA 3NVKA 4M63A 1KHVA 4YFUA 3NGIA 1FA0A 1TKXB 2YV0X 1HI0P 3KWMA 3FCWA 3DI6A 1EX4A 2R7UA 3I9ZA 5L1JA 1WJ9A 1FKPA 3NGRA 2CGKA 1RTDA 3MUTP 3MD1A 1FFSB 2GO9A 4U7UK 1N32F 1YHQN 4JUZA 3CF5L 4NLYA 4CZGA 2B6AB 1ITPA 1HKBA 4FJGA 2IM0A 2KL8A 4TU7A 3G25A 4DTSA 1XNQF 2V51B 3VQSA 2KM8C 3TA2A 1QSSA 4MKVA 2E1YA 2OPPB 1K0VA 5KFEA 3M8SA 1U0HB 2MJNA 1FEEA 2JJ4D 4NLPA 4BDYA 1D4XA 4YEAA 2IRUA 1VHIA 5K5MA 2VA3A 1F5BA 1DLOB 3M32A 4N7TA 3SUQA 3LH2S 4Y2IA 4ES2A 3M5RA 2MEWA 3CQXA 2X1GA 2FIUA 4X4VA 1NGBA 4EAHD 1YJ9N 4W5QA 2V9WA 1QVFR 3TNVA 3LP2A 2BUPA 4LQ9A 1Q8IA 4ECQA 2BGGA 3C16A 1F0XA 5D78A 1YQHA 3QERA 5J2PA 4DUYF 2E2OA 1TV6A 2E2NA 4X66J 2VPYB 1NK8A 3VAHA 5JVGQ 4NI2B 2WSCC 2FXUA 2ZE2A 2FUG9 4AQYK 3O5BA 1UVNA 2RUSA 1HD1A 4CBXA 4O0NA 2CXEA 4NEYA 4CDIA 2VZ9A 5MAOA 3AVFA 3VGLA 2N4CA 2XRIA 3DJCA 5KFWA 4ANEA 1GFWB 3G6YA 3MMCA 3KLGB 1VQKS 3M6VA 4W4MA 3CG7A 1ZH5A 5CD4H 4OZNA 4XH1A 5AJ3J 5DETA 3RUBL 3W63A 2DVIA 4DR4J 2F4VJ 4F8RA 3D5MA 5TKYA 4V19S 4QOZB 1WTFA 4ZS6A 1LWXA 3R9PA 3MD3A 1JLEA 1A9NB 3M8ZA 5ETNA 1HL6A 1GT8A 5DM7L 3L2VA 4DQPA 3CFPA 3G2XA 4X66K 4IH5A 4FS2A 3CD5A 4FF2A 4X64K 5KT7A 1DTTA 1RHRB 4CIFA 5KFUA 4OYAA 4DN0A 3GJRB 2MKHA 3V4MA 5ETVA 4HTJA 3MR6A 2UP1A 1B9DA 2GX9A 4TYAA 5BXIA 2QTWA 5DLGA 3R27A 3DLJA 4DX5A 4LR9A 4DF8A 4X4UA 4ZCKA 3V81A 3D6HB 1ACMB 1VC0A 2CKWA 4BR9A 4K0KJ 1RAIB 2P9NA 4FJMA 4WYWA 3R2DJ 2R2TA 3ENBA 3I55S 2YI1A 3MR3A 4LF9J 4YDUC 1QE1B 4O8UA 1V5IB 3AVJA 1ZBUA 3T1YK 2OPRB 2EFVA 4DFJA 1CEZA 2IOCA 1VQ5S 3EGZA 4KV8B 2GV1A 1PJ6A 2XYGB 4F0MA 3BSCA 4NLTA 1EWQA 1SJRA 2IVMA 2VA2A 2FHOB 3QAEA 1N4LA 1I51B 2V4JB 5MLCQ 4EGLA 1OVQA 2RILA 2MY8A 2XLKA 4WFAL 3DMJA 4ZK7M 4A5BA 2CQIA 2OTJN 2A42A 1ZBIA 1RXOB 2MPUA 2B8PA 2ZWOA 1NB2A 1RWNB 1YJTA 3BY5A 4LT6A 4U96A 1D1UA 1DAXA 4CIOA 3AA4A 4Q0BA 2RRNA 3ZZUA 1VSLA 3K0JA 3TSPA 3KOAA 2QA2A 3OYGA 1NSQA 1N6QA 3GR0A 3EDQB 3DRXA 3BR8A 1MMLA 2R2RA 2L9DA 4JI6K 5L9XA 4ZVSB 1FE0A 3MMAA 3OS2A 4NASA 4DJBA 1XHXA 4LF4F 4DSEA 1J54A 3CPWM 1W26A 1CZAN 1ASWA 4B9UA 3LANA 2HHQA 3FC9A 2E6MA 5HK4A 1TAQA 5U47A 3R7NB 3O9SA 4EO8A 3LP3A 3DKDA 3B6PA 3ILOA 3ETMA 5I3UB 3F9KA 5F8IA 3CPWR 2GIRA 4B8CA 5KFBA 3O9RA 3SBTA 2JGUA 5D4LA 3HT3A 2DJWA 1X5TA 3G6EN 3C15A 1RAHB 4LVNP 1K8AT 4PQUA 1HMVA 1RBLA 3HJVA 1TL7B 1XNRF 4DL7A 1S7HA 1B0VA 5KFMA 1N33K 3CYMA 4PWUA 2BE9B 4HEA9 1VQ8S 3LAKA 5DDPC 5DG8A 4O0IA 2IS3A 3OYIA 2FJWA 3A3OB 2G8FA 1XNRK 1RKJA 2ZH2A 4A8XA 4UOFA 1T7PA 2P9PA 3K5MA 3KLFA 4OHYA 5JVHL 3RR8A 2IAJA 3A12A 3LPEA 2N7CA 4KT0C 3ASMA 5D4NA 3AFGA 3GFXA 2HG4A 1S22A 2PMWA 4CWBA 3I8DA 4X65F 2MYFA 2XI3A 4JHDB 2XHWA 4FXDA 1U2RA 5L38A 3D45A 1IWGA 4FWLA 3QJJA 2AEFA 2GW8A 3GP9A 3CDWA 2G13A 2MZ1A 1NRKA 2MQOA 3VPZA 3VN5A 3J81U 3U9ZA 3QGHA 1SUQB 1H72C 1LXJA 3ZC4A 3MM9B 2DGTA 3D28A 1NM2A 3BGRB 2QFJA 1S1WA 3D68A 1RP5A 2ZZNA 4O5BA 1RWVB 3HCXA 4OJHA 2J9CA 2VBWA 1ZBSA 1YVFA 1KRPA 2XS5A 4BR5A 4HI2A 2P2CB 2YX1A 3MEGB 1KOHA 1CJTA 5IOLA 1HNIA 3A8YA 3H8YA 1LWCB 3MEEA 1YI2N 1NHUA 2EW9A 1BE4A 2IRXA 3Q8UA 3Q8VA 3KHRA 2ACMA 1GOBA 5I3PA 1DKGD 2IRYA 3UDEA 3CC2S 1U0SA 3AOBA 4FKXA 2QW9A 1FJGF 3UN2A 2Q43A 2PAVA 1XERA 3HSZA 1RFQA 2U1AA 2QWOA 5DK5A 3M6WA 2K1RB 4K25A 1QLNA 2D5RA 1ESVA 3CCUS 3AAPA 2ZGZA 1RDAA 2DNPA 3WIUA 2R8JA 1FHTA 4I56A 4JI8J 3C2PA 4QZVB 4DV6K 2WVFA 1C4AA 3GPAA 5C0YA 4LFBF 4M5GA 4I4BA 4U67L 3A13A 1TL1A 1CJUB 1DTQB 2W01A 3CCVS 1MROB 4H0YB 2BRKA 4I9LA 4DFPA 5F41A 4YDDB 3QO9A 3RMDA 2PYJA 4JI4F 2FLOA 3MDQA 1O8BA 2DNKA 3JTPA 3DC2A 2LCWA 2V9KA 3F0NA 3H25A 4QW9A 1VSJA 4DTNA 1ZPVA 1VSFA 3QB0A 2BJDA 2FBTA 4DR3F 4H4KC 1VRTA 3RW6A 4JKAA 3MM5A 3AY0A 1S4EA 2HS3A 3KLVA 3WXLA 1R31A 4PXEA 4DV2J 4KGVB 1JJ2R 3OXFA 4C1NI 2G8KA 2LEBA 1JCEA 4ANDA 2EHGA 4ILRA 4KGZB 2OHDA 4EFAC 1VC5A 4LBPA 4K4UA 4YY3F 4NPOA 4K4TA 1URNA 3CC4S 2IM3A 2VFSA 2ITMA 3AO2A 2LU2A 3PUFA 1QZ6A 4F50A 3JQJA 5D3GB 3EVWA 2LEAA 1S10A 4RNNA 1DHMA 2MZRA 3MR2A 2D74B 2HFNA 1KAXA 1SQKA 1NCLA 2OPSB 4JS5A 5B0BA 4AL7A 2FSKA 4HWIA 4FF1A 4BRIA 4W98A 1YBTA 2D0PA 1JLEB 2VHGA 3GV5B 5JVHQ 1U48A 3HTVA 2Z0GA 3LDLA 2V2QA 5KFYA 4DF4A 4ZIWA 3V9UA 2HSTA 2OD6A 3HULA 2C2OB 3SNNA 1X4GA 4K0KF 1M1HA 3CCJN 3C15B 5C10A 1Q5VA 3NNAA 3R6LB 2WK4A 2KJWA 1S6UA 2P5VA 4LH4A 4EUVA 1MU2A 5GMDA 3NL0A 4FJLA 3VMFB 2F65A 2R7WA 4FW1A 4C9DA 3ATVA 1BUPA 4ED0A 2ZNZA 3OSPA 4NYFA 3M8PA 3RTVA 4JV1A 4BR4A 3OTOK 5FRMA 2ZDOA 2ZHAA 2F96A 3OR1B 4ZVRB 5IT9O 5AQYA 4XH5A 3GONA 3CNQP 4DDFA 4OI1A 3QFHA 3CJ9A 2XMVA 3KFWX 1ZM9A 3ZTPA 4JYAJ 1VQ7N 4J9RA 3H5YA 4JK7A 1WNEA 4P52A 1IBKF 4CTAB 2PMHA 1C0FA 3E1YA 1CULB 1GTHA 1Q7YO 4ZMMA 1TGOA 2V67A 4LF4J 1Q79A 2YHAA 4LF9F 1RDWX 4TY9A 4DX8H 3AVGA 1TKZB 3NNHA 3HD1A 3CJQA 3Q8PB 2GWJA 1I6JA 4LVOP 3L7PA 4YR0A 2FVQA 1V4TA 1XHZA 4RG8A 5DQHA 3LWMA 3HHLC 2UUTA 2G8WA 5DDRC 3IM9A 3H5UA 3UIQA 3FEZA 3HT0A 2PD1A 1FJCA 1GLJO 5EGYA 2W41A 3A0IX 3NRBA 4FLZA 3G4SN 4TYBA 4OZ2A 4QWEA 2QA4N 4V1Ak 4DR4K 4F4YA 5E2QA 3C6HA 1LKZA 5T7BA 3DLEA 3J7YI 3M4XA 4R8UA 3J7AP 1QUPA 1N88A 5TKWA 2Z1JA 1PAEX 1HJRA 4CO3A 3BO4A 5F0XA 1CBKA 4TVAB 3R3TA 2YXLA 4TY8B 2VICA 5DM6L 1UAWA 2L9WA 2I7PA 3OHAA 4KFBA 1WG5A 1VSDA 4JYAF 5D6GA 3KK3A 1FKAF 2DFEA 1E6VA 3MMBB 1F2HA 2P8IA 1Y5NB 2AT1B 2CVIA 3KLHA 4ID5A 1EQYA 2VL1A 3FE1A 3NGYA 4IOAL 1F9FA 4LSZB 5HP1A 1A5VA 4PAAA 3ZTRA 2XCPA 3OA9A 1NGHA 1RWXB 2AGPA 1HNWK 1RTIA 3L2RA 4QPXA 3BDPA 2K3KA 3VA0A 1HD0A 3FCHA 2F9TA 2B9EA 5IS2A 1IQZA 3I6PA 2Q6BA 1DQ9A 1OY9A 1XTZA 3AJ1A 2ZKTA 4JLHA 2K1RA 1CXUA 2RQKA 3D1QA 3H1VX 2UXDK 2RQCA 1JLAA 2N82B 5IT0A 3PCOB 3UPFA 3DGPB 3IGNA 3VQAA 4CLKA 2XZDB 2BOPA 3J7ZO 3KVGA 2GMHA 1IBLF 3ZT2A 4BC3A 2A1RA 5C2FA 3MN5A 3W9JA 4DMZA 3BF4A 4M5LA 1WAJA 1FRJA 2D7SA 1ZTTA 3ALYA 4JHDA 5LMUJ 4UZCA 3UKUA 2J7UA 1GNKA 4KH0B 3BQ2A 1K73T 3WX4A 3TAPA 2CRLA 4I7FA 4H0PA 4CM2A 4X4PA 3CIMA 3FGUA 4P6QA 3OSNA 1SVDA 3CJ3A 1WHYA 2CJKA 4ZVEA 4Z4GA 2MHEA 3D4JA 5HLFB 3NDKA 4WK3A 3VQEA 4B3TF 2BJ8A 2E4LA 3MECA 3KKSA 3LALA 4U7CA 1R6YA 1YBAA 3RB0A 2Q3SA 5AQKA 1OJ4A 1JIHA 1NLKL 2GCFA 2UXCF 3UVJB 2AZ3A 2W25A 1PILA 4JV2A 1F5CA 2FBXA 2W6LA 4OKJA 2NNWA 1S6OA 2A0FB 2E29A 3SK3A 4NRUA 5SWMA 3V5RA 5IC6B 2VQFK 2HHXA 1UFWA 4CESA 4QWCA 2JEIA 3M1VA 1W9HA 4DS5A 4DV0J 2VONA 3HVAA 1SV5B 3CJ1A 3KJFB 4NZ0A 2BDPA 4RW7B 4H03B 5AE1A 3R5CA 3WHIA 3U02A 4KHPK 2DH9A 2Z30B 1RT6B 1ASUA 1SC1B 1KBRA 1RLDA 4LSNB 2HGNA 4EYIB 4FVMA 1IBKJ 2KKHA 3LO3A 3GIMA 1XC9A 4B3TJ 3QFWA 2GUIA 4YORA 2RKIA 1UW9A 2R42A 4O4GB 1HYZA 3GIRA 4IWVA 2QV6A 3WT0A 4G1QA 1QAJA 4PYAA 4BWMA 3DRYA 3BN7A 2DRBA 2KT3A 4FW2A 1HFEL 2F8SA 2YQ3A 4I69A 3OYMA 4CF0A 3QO9B 3OYBA 2HFUA 2P9IA 3I5AA 3PX6A 5KPTA 1NZAA 3CWJA 4MIBA 2MXYA 3DLKB 2B8QA 4USKA 1U25A 1EAYC 4AUKA 1YVUA 5J2QB 5EOYA 1QUVA 1L3TA 1B92A 3QMQA 1NJXA 3UNYA 4Y65A 3QYYA 2QKKA 1FJGK 1YITN 1MN7A 3PFOA 4M5MA 2KB2A 4JI2K 1J5EF 4ISFA 2YTCA 3CJ5A 3CCSN 2X6NA 1H6KX 4FVUA 3I4HX 3AOAA 2F4VK 4U95A 2G8VA 1LCUA 3K5OA 3SMZA 3CCLN 2VBZA 3CCMN 4FJ7A 2AYGA 4GRSA 1EX8A 3NMAA 1DZ5A 3TJAA 4KB7A 2L08A 1DQAA 2H48B 1WSFA 3ZT3A 1NH8A 5AQLA 2D3UA 2KDOA 2CGLA 3KLHB 2R8HA 2NUHA 1WOOA 5CR4A 3L2QA 3DRPB 4BC4A 3HHLB 4Y1DA 2J9EA 3CCWA 1SKRA 2QA4S 1EP4A 1Q8BA 4BG9A 2P1JA 3D0PA 2AW0A 5EVZA 4WE1A 3GYGA 3PIOL 4H5VA 1QAXA 4EHUA 4ZJLA 4YR2A 1TKXA 4CLLA 4ICLA 2NZCA 3I5CA 4YP3A 3BH7B 3CCTA 2CNKB 3G96A 3SCXA 3HVTB 4ER8A 4HCBA 3RAXA 5C15A 3M05A 2N4DA 1UPMB 2OAUA 2OH2A 1UJ5A 2W2QP 4GV3A 4E98A 1SBRA 1A5XA 4C8ZA 4J2DA 1AZSB 4CHQA 4RLEA 3VEVA 4Z4IA 2VUGA 3CM5A 3MAHA 4AF1A 2GJ2A 3WUHA 2KVIA 2KYZA 1VQMN 2POKA 3T3FA 1FK9B 2L9NA 4ALZA 2JLFA 4ES3A 4M5KA 4L73A 1JLAB 2ERRA 1U47A 5BJRA 4XAKA 3H3OB 3SQ4A 3FBBA 1N33F 1NJYA 1N5VA 2CNOB 2ZOMA 4TXSA 4RUHA 3I5BA 3IFEA 1AW0A 3ZSRA 3AO4A 1T11A 4J9PA 4XPEA 4ECSA 3T1YJ 4CNZA 3IN5A 2RHKA 2DR5A 3EDRB 2O8FB 3ITHA 1GLCG 3MXJA 3VR1A 2U2FA 2MKCA 3LP1A 3MECB 4H0TB 2BEFA 2D41A 2C42A 2FQQB 3ZZRA 4CEQA 5E3CA 3V81B 3O1WA 4DU1A 3S3NA 1S1VA 1Q53A 1WG4A 1SL2A 1NKEA 1LW0B 3LP0A 3HK2A 2GHWA 4J2AA 3FQLA 3GIKA 1ZOTA 3MOJB 4OYMA 3EX7B 4NRTA 1U1NA 4OYZA 4OLBA 1N52B 1HHSA 2E9TA 3T9NA 1FW6A 3QNOA 4OZJA 4Z4HA 4UOGA 4EHTA 5DGBA 1VJQA 3C19A 4TY8A 2EFPA 1BHLA 3CD0A 2FLPA 2IMWP 3QMLA 1GX5A 2JEGA 4BQLA 2HBYB 2XWXA 4AL5A 4BRFA 1IG9A 3THWA 2WB1D 4B1VA 3HP6A 2ZVSA 2HS0A 1JXVA 3L6QA 5JXSA 3MPYA 1QZ5A 4M3WA 1FRKA 3TAMA 4ZVHA 5D4PA 2WOMB 3CC7S 1FVQA 2W24A 1HARA 4KB0A 1PYOB 2ATCB 1ZBTA 3M8YA 3MM6B 4W5TA 4DCOB 1TKDA 5SUHA 4OYIA 4JN4A 2NUUG 3LTOA 4Q45A 2DNQA 2KZZA 1REGX 4X62J 8RUCA 2OZSA 3NH0A 1LQ9A 2XYPB 4B9LA 4KGXB 1DARA 4LF9K 5KGXA 1OQ3A 4NXMF 5I42A 2PEBA 2XMUA 4Z0UA 2AP1A 3B4MA 3RBDA 5HMXA 4ZVOB 4H0VB 5T14A 4E1MA 3VALA 4ZN3A 1ZTWA 1K9MT 3O4WA 2ZH7A 1YG0A 4FJIA 2RQ4A 2GC8A 1JNZB 4CFAA 1JLBB 4CHYA 5KG0A 1CJKA 4A46A 2ZZMA 2I1RA 3NY0A 5E84A 3BEGB 3BZQA 3O2IA 3OJUA 4BRNA 3UKRA 3Q24A 2M52A 4NLVA 3CMES 3VAGA 4CEAA 1E3MA 1K1QA 3GZ7A 2NZTA 4ZPTR 4B3OA 3LPYA 3V1QA 5ADXA 2R7OA 3ZTOA 4USVA 1R0AA 3VAKA 1UA1A 1QVFM 1TVRB 2HHHJ 2X1BA 4XDCA 1KFSA 4BRQA 3G9CA 1C0UA 1KWMA 2MKJA 5M2RA 1K47A 5EX5A 3VESA 3TANA 2CNLB 4ELTA 2PT0A 1G4CA 2I0XA 3UD4P 5AZIB 1WEYA 2DR8A 3ZNJ1 4ILJA 3HHLA 3V6KA 2WBRA 2APOA 2Y9HA 4FCYA 2EG2A 1WG1A 3JTOA 3AO3A 2DHGA 3A8KA 1X3MA 2DBBA 3WQPA 1WSEA 2KRRA 1EQ0A 1T9TA 1HNXK 2A1BA 1V3SA 4DUZJ 2R8KA 2E9ZA 3BBCA 4PKGA 4Z37A 4B3RF 4EZ6A 2DHXA 3HJFA 2H54B 3RB6A 3OS0A 2ZKUA 3RWUA 1Q16B 1HNIB 4F9OA 3IRWP 3ILIA 3S3MA 1W2BM 1RACB 2HNDB 5ELZA 1R27B 2Q97A 5HI7A 1SJ1A 3MMVA 3DRPA 3DOMB 4OZ1A 4A5AA 2XSJB 1NLVA 1CZ9A 3THYB 4JKDA 2FVSA 1WOPA 1NOZA 4NLXA 4A48A 3QRQA 2JEFA 1HI1A 4ZTFA 4AXJA 1VQYA 3O1BA 1J5EJ 3P49B 3KD1E 3HX9A 3B78A 1CJTB 3R1XA 4I2QB 3ZZTA 3NS7B 1SJQA 1EHWA 3ZLJA 1YIJS 3H98A 5FPDA 4RTFD 1F60B 4Q44A 1R8AA 4LFCF 1WHWA 5G0RB 1QQCA 3U1NA 1XNQK 2G4BA 3AB2B 5BR8F 4DTXA 4F0HA 3AVLA 4DHVA 4NLDA 4I6YA 4QR2A 4CZMA 5DQIA 1ZYQA 3UNGC 3CDUA 4IBNA 3N6LA 1U8SA 3IMQJ 2OEKA 1KQFB 2EWHA 1HNZF 4LMZA 3RSEB 1K6YA 2CPXA 3JSMA 1CLFA 3KG1A 1JNRB 3C95A 2UVWA 4DV6F 2E1ZA 4FOEA 5EWFA 1WI8A 5K8OA 3MCNA 1BWFO 4LFAK 1OO0B 4CD1A 3O9TA 2NPFA 1M5PC 3UCGA 1ROFA 1NPPA 1ZBLA 2MLXA 2YHYA 4K0KK 1TUYA 2VFUA 4TNOA 4ZPWR 1EJ7L 4UTGA 3WC0A 1MWZA 4I9QA 1I3AA 1IR1A 2H5JB 4B08A 3J7Z5 2HMIA 1VAZA 4N56A 2EBGA 4LIRA 3J7A1 2QWRA 1HQEB 3K9JA 2HVEA 4HUFA 3D54A 4J90A 1K0TA 4LQ3A 3VQ9A 4JI5F 4C3LA 3J7YU 1IKVA 4DSIA 4J2BA 1YSJA 4KREA 4AXIA 3M8WA 3SEOA 1XBWA 2Z4PA 2EFGA 2ZH6A 3H90A 4HCCA 1J9AA 1XUPO 2OGUA 1OH7A 1LXNA 1RT5B 5HMZA 3WNFA 2YQ1A 1VQ6N 1BHNA 5LL6d 2WONA 4WWSA 1S7IA 4PG4A 2H5IB 2CA9A 1D5AA 5HROB 2IVOA 2E8AA 4ISEA 3MTKA 2HBRB 3HP9A 3GYNA 3PDNA 4ED5A 3M8QA 1IUJA 1HBNA 4MYTA 4F4KA 2NR0A 3TTCA 4W92B 5KGWA 2NXUA 4H5RA 4MFBB 5DM6Q 2GVZB 2WUSA 2RMLA 2CJ9A 4F67A 4ECVA 4KHMA 2W9BA 2J0XA 1YKWA 1WI6A 4W5OA 3TX0A 4LRAA 2AGQA 1ITGA 4EK2A 3M6XA 2GNKA 3V9SA 3HMJG 1XWLA 1X4AA 4IOBA 2CPJA 5K8PA 3MCPA 3I56S 4X84A 1DY3A 3SYZA 2FGCA 5KFXA 1YRUA 3G71N 5H9FJ 5BR8J 2AD9A 1VQ7S 4DUZF 2HBKA 4M5JA 4LFCJ 1S6PB 2KFYA 4A47A 5IWAF 4MKBA 3K58A 3I87A 2VYPA 3R5JB 4NLBA 3S9HA 2QYGA 2YKAA 3BR9A 4O4RA 2FTRA 2G2YA 1RA6A 2I6WA 2YX4A 1NKCA 4QYRA 4J9MA 5M2PA 4DCPB 3W9IA 2E5LJ 1QQOA 3T69A 1NZ8A 1SQEA 1IO2A 3QATA 1NM1A 1YXQA 4TQRA 3H5SA 4O3OA 5HJXA 3QJPA 4B9VA 2HHHF 1RT1B 2H9ZA 4OJRA 3TP2A 2B7BB 2AGOA 4DQRA 3SPZA 1OVYA 2MLYA 5M1KA 3GB0A 2BOAA 4DR7J 3SMSA 3CJ7A 1KFDA 5L8RC 3O8MA 2DO4A 4KO0B 2XMTA 1GX6A 2MGZA 3W5ZA 5DDQC 3CEDA 4OPJA 1LK7A 3KJNB 5D77A 2L41A 4H5TA 3SAGA 1HKAA 4KBOA 2K06A 3P8BB 4RCHA 4CJLA 4WFZA 1XMOJ 5J1NA 4IO9Q 3U7JA 5KT3A 4PQAA 4WF9L 2YNIA 1NGDA 2F8HA 3CCLS 2HMPA 2M0GB 2VCPA 3O44A 3MHYA 1X4EA 3W66A 3SZ2A 1UFKA 5LY3A 4OHXA 3QRPA 1QAYA 2MZQA 4CK1A 3MURP 1RDCA 2JC1A 3FEYB 2F9WA 4YQWA 1HPZB 5LOQA 1BY9A 1FDAA 4I6MB 4FZYA 4KRFA 2XYHB 1U0HA 3K5LA 4ZPBA 2XC9A 3CCRS 5K14A 1KVBA 1U2VB 3OY9A 3PEJA 2FHJD 4CIGA 4WBFA 1FXLA 2CQ4A 3ID8A 1VQNS 4DPOA 5JS1A 1D0EA 3ETOA 7AT1B 5BRDA 2BMBA 1AUSL 5EX3A 3F41A 3UCUP 4IOCQ 1RBTA 2QMUB 3SCLE 3I33A 1C4CA 2X74A 1XN9A 2J9DE 3MX5A 1WC0A 3PSFA 4HT7A 4JYAK 1LW2B 5C24B 2XY6A 5K20B 3HFVA 5KFLA 1QD1A 3SQ2A 1XR6A 4NI2A 3DXKA 4DQSA 1RWOB 1N32J 4H0XB 1VSMA 1C6VA 3ADAC 4X64F 2VC1A 4E7KA 4O44B 1GLLO 2DEIA 3QBXA 3NFAA 2W6KA 1IXKA 3DGVA 3SAHA 4PG7A 1VK0A 4CF1A 5KFIA 2BX6A 1ATSA 4QS9A 1S72N 2HWIA 2JFDA 3ZT1A 1NGFA 4HLBA 1YTAA 4OX9K 4GVLA 2FB0A 3IAM9 2P6SA 3W2WA 1Q86O 3KK3B 2NRHA 1ZETA 1I94F 2UXBF 3FBEA 1M5KC 2M7SA 2QC3A 1KQSR 3DWLA 3KLEB 3SCJE 5GMKa 3FCVA 1T3NA 5DRKA 2HWTA 2MJUA 1NNEA 3CCQN 3ELHA 2C1EB 1FTRA 3GSIA 3IR6B 5F8NA 3HM9A 1GMWA 5KFQA 2IIHA 1HHTP 3H0PA 4CP5A 3H6EA 1RCHA 2UV8G 4KHWA 5IM0B 4QIEA 4DR1F 5EN1A 3CHWA 3CIPA 3ILJA 4HTUA 4A8WA 4N77A 5EX0A 2BJ9A 3SXLA 4ZCLA 2UU9J 4P72A 3T1YF 4DL6A 2XGQA 2AJ2A 2AMCB 3QDKA 1VLYA 3N5BA 3ZXWA 3I9V9 2H4YB 2P9GA 1HBOA 4KV8A 3O4QA