4ID1A

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
154
structure length
140
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Allosteric integrase inhibitor potency is determined through the inhibition of HIV-1 particle maturation.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 140
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4id1A00
3SQ1A 4W5OA 3LWMA 4CEFA 1SUQA 4N56A 3P1GA 1QSLA 3U6FA 3LZIA 2HHWA 1J5OA 2HHSA 2ZE2A 3RMBA 4DSEA 3VQDA 3LPUA 1SL2A 1HMVA 2Y1JA 1IH7A 3D45A 3V1OA 4CJ3A 2OZSA 2X6SA 3DLGA 2PYLA 1C0TA 4FJHA 1WNSA 3RRHA 5KTQA 4CF1A 4DU4A 1ZYQA 3IS9A 3VQAA 3OYIA 4DLGA 1RT4A 4DU3A 3DI6A 4WE1A 3M8SA 3NGIA 3KKSA 3SQ0A 2OZMA 4MQ3A 3HP6A 5SZTA 1VSIA 3SCXA 5HRNA 1F21A 2X74A 4MFBA 3M8RA 4FLVA 1CZBA 3AVGA 1WN7A 3LDSA 1KVBA 1WSGA 2HHUA 3NH1A 3PUFA 4KPYA 5KGWA 3HO1A 4FK2A 4CJ5A 4NYNA 1RT3A 1RTJA 1WAJA 1VSDA 1WLJA 4M42A 4FVMA 4IFYA 1IKVA 1U04A 1FXXA 3AVIA 2ATQA 3VQ8A 4Z4FA 1ZBIA 4KRFA 4Z4IA 3OYCA 3JYTA 4B8CA 3SJJA 1U47A 1NK5A 2R7YA 1Q9YA 2OA8A 4DSKA 2DFHA 2XY7A 3IG1A 5J2PA 3NBPA 2KFNA 3TI0A 3TR8A 4IFVA 4JS4A 1RBUA 4AHVA 5J2MA 3O3GA 4YNQA 4CGJA 2D5RA 5HROA 1VSMA 5FRMA 3V1RA 1IKWA 3ZSWA 1T8EA 3VQ6A 1BI4B 5FDLA 1XHZA 2G8KA 1NKEA 4F3TA 3LALA 4GMJB 4ID1A 4O0IA 3MAQA 1X9MA 4IBNA 3V6DA 1VK0A 4O55A 1UA0A 3T19A 1EX4A 4E1NA 1NK7A 3QO9A 4CEOA 2VG7A 4H4MA 3VQQA 4FJLA 4XIUA 4ELVA 3DM2A 1RT5A 1NOYA 1S1XA 4HVJA 4OVLA 2KTQA 1RDDA 1NK8A 1X9WA 3SV4A 1NJYA 2GV9A 1J9AA 3MEGA 4FJIA 4PY5A 3NCIA 4FLWA 2QK9A 4I7FA 5HRRA 1SV5A 2YNFA 3L3VA 2LSNA 3IRXA 3VQ4A 1LAVA 2HHQA 4IG0A 1WSJA 4IDKA 2PYJA 2OPQA 4DTSA 1ASWA 3C6UA 4W5TA 2F8TA 1JLEA 1NOZA 4CGGA 2JLEA 4O5BA 2XHBA 2PY5A 4FJJA 4DFKA 3PX0A 4FK4A 2A1RA 1KRPA 3OS0A 2G8WA 4E7HA 4CJWA 1O1WA 2ZD1A 4OPKA 1BHLA 1DLOA 1S6PA 3L2UA 3QETA 3V81A 4HCBA 3MXIA 4CCHA 2HVIA 1HYZA 1SL0A 2RPIA 3K59A 1G15A 1NK4A 2VG6A 3OS2A 2DY4A 3K2PA 1RCHA 1XHXA 4EP5A 3L8BA 1B92A 1TKXA 4CJRA 3OYBA 3AVNA 4ZTJA 3F9KA 1LWFA 4DTNA 2E4LA 4ZHRA 4CK1A 5KI6A 2G8FA 4F3OA 1XWLA 3U3YA 4B3OA 1MU2A 1RT1A 3LP2A 5FRNA 4KFBA 2F8SA 5CZ2A 4BE0A 3ZSRA 4CF9A 1KLMA 2BANA 3ITHA 4FZYA 4Y1DA 3AVKA 4Z4HA 3KTQA 4KHUA 3TAQA 1X9SA 2FBYA 2KW4A 3L2RA 1IO2A 4FM2A 4OKKA 3TAFA 2Y1IA 4Z4GA 4CEQA 4KTQA 3RRGA 1TV6A 3KKRA 1KFDA 1TK8A 1KVAA 1JKHA 3M8PA 2D0CA 5C42A 3V9UA 4ICLA 4C8LA 4I2PA 2Z1JA 2FC0A 2YNIA 1TKDA 4G1QA 3AA2A 4RW8A 3LWLA 3NFAA 3KD1E 4FJGA 4CJFA 2WOMA 1ASUA 3RR8A 3OYEA 4BE1A 4AHRA 4FW1A 3WNEA 1JLFA 3ZT0A 2YHBA 2G8VA 3C95A 3S9HA 1T03A 4FYDA 2HHTA 1RBVA 3K5LA 1HJRA 1VSEA 4FJNA 5K14A 1W9HA 2HVHA 4DTPA 3QEIA 2HW3A 2HHXA 1K6YA 4RW7A 1I3AA 4DF8A 4CHNA 4CECA 3I8DA 3PV8A 1NK6A 4H8KA 4AHCA 4I9LA 3SYZA 4AILC 1QHTA 2D0AA 3SQ2A 2B4JA 3ISNC 1KVCA 4CJVA 3G10A 3AVLA 3TAGA 1YTUA 4M41A 4DSIA 5JS1A 3CM5A 3VA3A 4DTMA 4CFDA 3D0PA 3OYMA 3ALYA 5CYQA 3KLFA 4DQRA 4QOZB 1ZBLA 3HL8A 4O4GA 1HNIA 1ZBHA 3QINA 2P5GA 4DTOA 5CZ1A 4JRPA 4DSJA 2KQ2A 3T1AA 1VRUA 3ZT4A 3NF7A 3MEEA 2Z1GA 4E7KA 1C6VA 1FKPA 4CEDA 4CJKA 4B9NA 1KLNA 3KIOA 1W0HA 1TGOA 4FXDA 2P5OA 1VSFA 5HRSA 1N5YA 3DLEA 2FBTA 1D9DA 1JXBA 3O4QA 3QLHA 4CJEA 4FM0A 4CGIA 3AA4A 1A5VA 4CJLA 1WSFA 2BGGA 4FZZA 3HPHA 4AHSA 1BCOA 3TARA 4F2RA 4FLYA 1HQEA 4GVMA 3QIOA 4CHZA 4YFUA 4NCAA 5KRSA 3OY9A 4BDZA 3SPYA 2Q3SA 1NJWA 2HNYA 3K57A 4J2BA 1EETA 1WSIA 3SUPA 2Z1HA 1BQMA 5HBMA 4CIEA 3OJSA 1X1PA 4FJ5A 1J53A 1RTHA 1RT6A 3AVCA 3QEPA 1VSHA 2DFEA 4EZ9A 4Z4EA 4DQPA 4PQUA 3AA3A 2OYQA 3PY8A 4BWJA 2F96A 3UIQA 3KLGA 2G8UA 1NK9A 1EXQA 3AO3A 4E7JA 2I5JA 3RMAA 3KK2A 3AVHA 1JLCA 1TL1A 2XRIA 4CFAA 4OPJA 4DTJA 3OYHA 3K5NA 4E3SA 1D9FA 4BWMA 1VSKA 3NAEA 4DQSA 3DLHA 1S1WA 4C8NA 3DLKA 5KRTA 3SV3A 1SKRA 3OVNA 4FJXA 3HVTA 2ZQBA 1WSHA 4AH9A 3SPZA 4Q0BA 3KLHA 1JXEA 1TKTA 1LWCA 1BIUA 4PUOA 3HT3A 3K58A 4F4KA 4OGCA 3PX4A 1NKBA 4CGHA 3SI6A 3V1QA 3DRPA 1TK0A 3ZT1A 1NJZA 1HRHA 2P51A 5FROA 3THVA 2P1JA 3O4NA 1NK0A 1S1UA 3BGRA 3AVAA 1RILA 3LP3A 3VQ5A 2B5JA 3RTVA 3NF6A 3QESA 3QNNA 4B9SA 4EZ6A 1RTDA 4HCCA 3DYAA 4KB0A 4KHNA 4RW6A 1REVA 4DU1A 1JL2A 3ULDA 4F2SA 3HM9A 3NF9A 4L8RB 1S1VA 3OS1A 3QEWA 3TAEA 1C1AA 2HB5A 1GOBA 3LANA 4OLBA 2ETJA 3CFOA 4OLAA 2E6LA 2OPPA 4CF0A 3HYFA 2NUBA 3DRRA 3ZSZA 4FLUA 4J2AA 2O4IA 4DQIA 2ITGA 2YHAA 3ZSQA 3NDKA 4B9UA 3I0RA 4M45A 4F8RA 2RKIA 3AA5X 3P5JA 4JLHA 5EU7A 5T7BA 3O3HA 1JLGA 4KHQA 3HP9A 5HP1A 3V9SA 4Z4CA 1YT3A 3EZ5A 3QERA 5DMRA 4FW2A 1HPZA 2OPRA 3DOKA 4CJQA 3LAMA 3L2QA 3VQBA 3KD5E 4N41A 4NCGA 1A5WA 3K5OA 1L3VA 3LAKA 2VWJA 4OKJA 3L2VA 1KCFA 3CFRA 4N47A 1U48A 1HYVA 1BCMA 2PZSA 4DWIA 1CXUA 4CF2A 4FLZA 1CLQA 1ZBUA 4CEZA 3S3MA 3AO4A 1A5XA 3MEDA 1IKYA 4CHYA 1BL3A 1QSSA 4OKEA 4E89A 2IDOA 5JS2A 3AVFA 3F73A 4CEAA 5CYMA 1TAQA 4UQGA 1R0AA 4B9TA 1BGXT 3E01A 4FJ9A 3ASMA 2IGIA 3G0ZA 3VQPA 3OYFA 1L5UA 4FJMA 3MECA 1GOAA 4FJ7A 3FFIA 1RDCA 1IG9A 2QKKA 3HVRA 4KHWA 4M3WA 4KAZA 3OYKA 1HNVA 4CJUA 3SZ2A 4LD0A 4HUEA 1TK5A 4O44A 3V4IA 2IC3A 2DTUA 3HK2A 4CESA 5KGXA 1SKSA 3DLRA 2KFZA 2XY6A 3H08A 1QSYA 5DK5A 4QCLA 3JSMA 3V9WA 3HPGA 4O0JA 1FK9A 1CXQA 3HJFA 4LY7A 1JLBA 1T7PA 1D8YA 3HXMA 3TANA 3WNFA 3RMCA 4DFJA 1EP4A 3OYDA 3KLEA 3SNNA 1UA1A 3OYAA 2KZMA 2A1SA 3NF8A 2G8HA 2OPSA 2D0BA 4LSNA 3OYNA 1C0UA 3MXJA 3LZJA 2Z1IA 5C25A 4HUFA 4LH4A 4KI4A 2WONA 4CIFA 1DTQA 2YNHA 1RDBA 4QAGA 1Y97A 4DG1A 1LWEA 3L2WA 3ZSYA 4CGDA 4K8ZA 3C6TA 1S1TA 2KZZA 4I2QA 2O4GA 3DMJA 2EX3A 1GOCA 1WAFA 2X78A 2HNZA 1RT2A 1IKXA 1VSLA 4W5QA 1L3SA 3RWUA 3S3OA 4E19A 4JS5A 1YVUA 1FKOA 4KB1A 3AO1A 4CHOA 4HUGA 2W42A 4FLTA 3AO5A 3TAPA 4J2DA 2IOCA 2BDPA 2QXFA 3CQ8A 4CFBA 3RR7A 1S9GA 1C1BA 1DTTA 4JRQA 3S3NA 1B9DA 1Z26A 3KLIA 4CFCA 3KK3A 2GUIA 2BE2A 1CZ9A 4TSXA 5J2NA 5J1EA 4FZXC 4B8AB 4ELUA 1TAUA 3B6OA 4DQQA 1BISA 4BACA 2VG5A 4BDPA 3TABA 3V9XA 2VWKA 4RG8A 3HPOA 5J2QA 4KHYA 2JGUA 4DFMA 4LSLA 1S9EA 3SUQA 1RBTA 4GW6A 1KTQA 3SUNA 3RMDA 5HLFA 1Q9XA 4IKFA 1C1CA 4FCYA 3M8QA 4BE2A 3T3FA 4E1MA 3OYLA 3NH2A 3NHGA 4C8MA 4NCBA 1RTIA 3NE6A 1RNHA 4Y1CA 4PWDA 4AHUA 4M3TA 1UAXA 4CEBA 2YNGA 4KV8A 1XC9A 4K8XA 2IAJA 1QS4A 1BIZA 2HMIA 5D3GA 4Z0UA 4DF4A 2YV0X 1U45A 3OJUA 1S5JA 4CHQA 4RW9A 4DTXA 3VQ9A 3QIPA 4LH5A 4KTWA 5C24A 2E6MA 3WNGA 4DMNA 4B9VA 1T05A 4DSLA 3AO2A 3NGYA 4FJ8A 3CG7A 1U4BA 3ZSXA 1C0MA 3KJVA 2YKNA 3PO4A 1JLQA 4CJ4A 3V9ZA 1QQCA 3SQ4A 4CE9A 3AVBA 3MXMA 2YKMA 4J2EA 4HTUA 4B9MA 4CHPA 3KK1A 1RBRA 4HHTA 4M3XA 3ZT3A 4M3RA 5I3UA 4W5RA 1BQNA 5SWMA 2AJQA 4CJSA 1TVRA 2GBZA 2DFFA 1TKZA 3ZSVA 4E0DA 1HQUA 2HHVA 4KHSA 4KKOA 4E7IA 4H4OA 1NKCA 1NJXA 1L3UA 3CM6A 4NYFA 5I42A 3BDPA 4C8OA 1LW2A 4M3YA 3L3UA 4E7LA 1RT7A 4RW4A 1LW0A 1Z25A 4CEEA 1TL3A 4ZTFA 1J54A 1KSPA 1LV5A 4CERA 1WSEA 1RBSA 1JL1A 1L3TA 3QEXA 3C94A 1QTMA 4FLXA 3QEVA 3TWHA 1JLAA 1UOCA 4M3ZA 1VRTA 4PA1A 4DTRA 4IG3A 2FBXA 3LP0A 4B9LA 4KO0A 5E41A 1N6QA 4I9QA 4KREA 1UWBA 3EY1A 1XI1A 1KFSA 4CGFA 3WNHA 4EP4A 5HRPA 2IS3A 3ZSOA 1RDAA 1I39A 3AV9A 3ZCMA 3B6PA 4DS5A 3VA0A 3K5MA 3VN5A 4DSFA 3U3GA 4CJTA 3P83D 3CYMA 1EKEA 4ID5A 1B9FA 3SUOA 4W5NA 3AVMA 5CY4A 1YTAA 4OJRA 1U49A 3ZT2A 4N76A 4BDYA 3A2FA 3EYZA 3AVJA 4FM1A 3PX6A 4R5PA 3LP1A 4Q5VA 3O3FA 3CFPA 2RF2A 2G8IA 3OYGA 2RN2A 3OYJA 4FJKA 4FK0A 1HYSA 3DRSA 1ZBFA 3DLBA 4N5SA 3DOLA 3IAYA 4ELTA 3VQ7A 4CIGA 3NH0A 4B08A 1ITGA 2EHGA 4CK3A 3VQCA 1SL1A 2FBVA 2QKBA 1VSJA 3PO5A 1Q8IA 4CF8A 4KI6A 4CJPA 4DFPA 4DLEA 1BI4A 4CK2A 3VQEA 2XY8A 3I0SA 4AHTA 1S6QA 4OGEA 4KTZA 4DS4A 3LPTA 4DTUA 3QNOA 4C8KA 3HSTB 3TAMA 1ASVA 2XY5A 1LAWA 2XO7A 3NGZA 2X6NA 2HNDA 1QE1A 1SKWA 2B6AA 4M3UA 1D5AA
chains in the Genus database with same CATH superfamily
3CJBA 2WBNA 5B8HA 3MX5A 1SUQA 2NRXA 1NGIA 3EKUA 1J5OA 2ZE2A 3VGLA 3V1OA 1OH8A 4GV9A 2HF4A 4CF1A 1ZYQA 3QICA 4U7BA 5AQXA 2UUBK 3KKSA 2OZMA 4BROA 5HRNA 1NGEA 2PFUA 4MFBA 4FLVA 3WXIA 3CXCM 3R1XA 1KVBA 1HNXK 4CZLA 3NH1A 3PUFA 5KGWA 1WOQA 4NYNA 4M42A 4H0XB 3AVIA 3VQ8A 4PL7A 4Z4IA 3OYCA 3JYTA 1MDUB 3T7ZA 3LM2A 2E1YA 4YNQA 1ATRA 3MWPA 3V1RA 5HOOA 3ZSWA 3KK7A 3THYB 4B3SK 3SBTA 2G8KA 3LALA 4ID1A 4CZMA 4O0IA 2F4VK 1QQMA 5GIOA 1VK0A 4IFEA 4FWKA 1TYQA 1N33K 4H4MA 4FWRA 1RT5A 1NOYA 4JI6K 3SV4A 5C2FA 4JK8A 3MEGA 4JKDA 4FJIA 3DLLL 1NGCA 4I7FA 3W0LA 1SV5A 2YNFA 3L3VA 2HHQA 1WSJA 4DTSA 4WQ5A 2JLEA 2D4WA 4X62K 3PX0A 2A1RA 4KH5A 2G8WA 4BRKA 1NM1A 1TUYA 3V81A 3BZKA 3EZWA 4CCHA 1G99A 2VG6A 1RCHA 4EP5A 3L6QA 3AVNA 2V7YA 4ZHRA 3SAHA 4X64K 4B3OA 1RT1A 3LP2A 1XQSC 4BRIA 1S22A 2V7ZA 3ZSRA 4YOTA 4V19S 3AVKA 4Z4HA 4KHUA 2FBYA 3SAGA 3L2RA 4FM2A 4FWQA 4CEQA 4KTQA 3M1FA 3M8PA 3V9UA 4ICLA 2YNIA 1EQYA 3N4QA 4RW8A 3LWLA 1KAYA 3J7ZO 3VEVA 3WNEA 2G8VA 1T03A 4FYDA 3VEWA 3CCSN 3K5LA 1HUXA 1HJRA 2HVHA 1W9HA 4BQZA 3T69A 2NRHA 3UKRA 2HBMA 3PV8A 4C1NI 3SYZA 1QHTA 1S3XA 3O5BA 3AVLA 5E84A 3TAGA 4JKFA 4DSIA 4BRNA 3J7YP 1VQON 2QWNA 4DTMA 4CFDA 3OYMA 5CYQA 3CCJN 3CPEA 2P5GA 4OO1J 4JRPA 3ZT4A 2H3GX 3MEEA 1FKPA 2QTDA 2UUAK 2ZWHA 4FOIA 4BRGA 2FBTA 3O4QA 4CJEA 4CGIA 4PHTX 3HPHA 1BCOA 3TARA 3CIPA 4FLYA 4NB4A 4CHZA 1NG9A 5KRSA 3OY9A 3LDLA 4FWPA 1DKGD 1NJWA 2UXBK 3K57A 1NWKA 1BOTO 3OJSA 2NZTA 1X1PA 4EZ9A 3MN7A 3SJHA 3O08A 2OYQA 3HBTA 1Q82O 3O1BA 3KLGA 4E7JA 3AO3A 3AVHA 4OPJA 2XRIA 3UKRB 3K5NA 4BWMA 3AGRA 4DQSA 3DLHA 3U8XA 4DR4K 2WFBA 2HOEA 2VGMA 4HWIA 3WQTA 1DT9A 4BG9A 1BIUA 3K58A 3SI6A 3FLCO 1HRHA 2P1JA 1NK0A 1S1UA 3LP3A 3AVAA 2B5JA 4EZ6A 5GAHP 4HCCA 3ENOA 1BO5O 4RW6A 4MO5A 3HM9A 3NF9A 1S1VA 3QEWA 3O8MA 4KHPK 4PKGA 3CFOA 2E6LA 2OPPA 2NUBA 3ZSQA 2YHAA 3WUHA 1NGAA 3C0BA 3QERA 1NJIO 5DMRA 4FW2A 3DOKA 4B1ZA 3LAMA 4JKEA 4LFCK 4Y0WA 3KD5E 4NCGA 3K5OA 2IVOA 3KVGA 3L2VA 2HHHK 4N47A 3ZX0A 1U48A 1HYVA 2FLOA 4GV3A 4FLZA 3CMEN 4CEZA 4BRMA 3AO4A 1A5XA 4K43A 4YORA 2IDOA 3F73A 1TAQA 4EAHD 5KPRA 4B9TA 1BGXT 3G0ZA 3VQPA 3OYFA 1YHQN 1RDCA 2QKKA 3IFRA 4JKGA 4KAZA 3OYKA 3CCEN 4HUEA 3V4IA 2AP1A 5KGXA 3CCQN 4WCEL 2KFZA 2XY6A 1QSYA 3H6EA 3JSMA 4A59A 4XEIA 3HXMA 1VQ9N 3SNNA 1EP4A 1BWFO 2A1SA 5AQFA 1W97L 2G8HA 1Z05A 3LZJA 1C0UA 3WEEB 5C25A 3J8AA 4LH4A 4KI4A 4CIFA 2P9KA 3CQYA 4QAGA 3CI5A 3L2WA 3C6TA 2KZZA 4DR2K 4EFHA 2O4GA 4FL9A 2O8BB 2HNZA 2NRVA 1VSLA 4BGBA 4CBUA 3BP8A 3FZMA 1YVUA 3AO5A 2NLXA 2IOCA 2BDPA 2QXFA 3RR7A 1YITN 4CVNE 1DTTA 1B9DA 3VEOA 3NMUA 4WFBL 4CFCA 1ATSA 1CZ9A 4TSXA 3KHYA 4JI5K 2QM1A 4DQQA 4JI2K 5JVGL 2E2NA 4DV6K 3V9XA 4RG8A 4LSLA 5M1OA 1KTQA 1ZXOA 3SUNA 3LL3A 4FCYA 3M8QA 4BE2A 3T3FA 4E1MA 4BR0A 1BDGA 4JKGB 4PWDA 1HNZK 1RGIA 1SAZA 2YNGA 4KV8A 4CEBA 1XC9A 1QS4A 4DR1K 3CJAA 4Z0UA 2YV0X 1U45A 4JKBA 4CI6A 3QBXA 4DTXA 2YCHA 2E2OA 2E6MA 1S72N 1BG3A 5GAEP 2HF3A 1U4BA 1C0MA 3R9PA 3KJVA 4CJ4A 3V9ZA 2FSKA 1QQCA 2CH6A 1EWRA 3VF2A 2P9KB 2P9SB 4BC4A 3EEQA 4JD2B 4JHDA 3BEXA 5I3UA 1BQNA 2AJQA 1D4XA 2GBZA 4H5RA 2DFFA 3A5MC 3P38A 4GY2B 4BR5A 4KHSA 4U67L 4H4OA 4H0VB 3CM6A 4NYFA 2Q1NA 4YOXA 4C8OA 4RW4A 1Z25A 4ZTFA 1J54A 4FWSA 1NMNA 1RBSA 1QQNA 3QEXA 1JLAA 1UOCA 4M3ZA 4PA1A 4IG3A 1QQOA 5M1FA 3CHWA 4B9LA 4KO0A 1IG8A 4KREA 1UWBA 1XI1A 4CGFA 2YI1A 3WNHA 4M7YA 1WUAA 1RDAA 4R79A 3VN5A 4DSFA 4K0KK 3ZT2A 3AVJA 5KPZA 2A41A 4Q5VA 3O3FA 2RF2A 1Q7YO 5GAGP 5EX5A 3OYGA 3OYJA 3FGUA 4M7XA 3DLBA 4H5TA 3IAYA 4DV1K 4CIGA 1ITGA 2WC9A 2FBVA 1VSJA 5I9EB 1Q8IA 1MA9B 1ZC6A 4JHDB 4CJPA 3G6EN 1BI4A 4CK2A 4DLEA 4AHTA 3I0SA 1S6QA 4KTZA 3HSTB 1ASVA 5AQJA 1M90O 2XO7A 3RSEB 2X6NA 2HNDA 4H0YB 2B6AA 1D5AA 4X66K 3SQ1A 4W5OA 4CEFA 4N56A 3BZCA 3LZIA 4FWMA 1U2VA 3O6WA 4DSEA 3VQDA 1K9MO 1RDWX 3D7EO 3DLGA 4FJHA 1WNSA 4IOXA 5AQSA 5KTQA 4DU4A 2QWPA 3VQAA 4C23A 3OYIA 4DLGA 3T1YK 1VQLN 4FPAA 3DI6A 3NGIA 3DXKB 4MQ3A 3HP6A 4FO0A 3SCXA 4BVOA 3M8RA 4MDBA 3AVGA 1WN7A 2E8AA 3VF4A 5JLHA 1JCGA 4BGAA 2HHUA 1VAZA 1FW6A 4FK2A 4CJ5A 2KKZA 1RT3A 1P8ZA 1IKVA 1FXXA 2Q97A 5TKYA 1ZBSA 4KRFA 1E4FT 5C10A 3SJJA 1NK5A 1U47A 1Q9YA 5HL7L 3NBPA 3TI0A 4IFVA 4AF1A 4JS4A 4AHVA 5J2MA 2RE2A 4CGJA 2D5RA 1IKWA 1BI4B 3M6GA 1XHZA 1X9MA 1GLBG 4O55A 1JCFA 3QO9A 2E5LK 3VQQA 4XIUA 4WQ4C 4HVJA 4OVLA 2KTQA 1NK8A 4PY5A 1X9JA 3O9RA 4FLWA 5HRRA 1HPMA 4YOYA 3IDHA 1YI2N 4IG0A 2PYJA 3MDQA 3C6UA 3Q7BA 4W5TA 2XHBA 1NOZA 4CGGA 4FJJA 4QS9A 4LF9K 4FK4A 5JICA 1VQNN 4K25A 4E7HA 5FPEA 4CJWA 1O1WA 2ZD1A 4OPKA 4NXMK 1SL0A 3MN6A 1NK4A 3CCMN 4A2AA 1XHXA 5CE3A 3L8BA 1B92A 2P9UB 3F9KA 1JCEA 4F3OA 5FRNA 4BRLA 2F8SA 4BE0A 1KLMA 3H46O 3ITHA 4FZYA 3KTQA 3HOTA 1TV6A 3KKRA 2CGKA 3H45C 1KVAA 1JKHA 4DB3A 3SK3A 4I2PA 1OH6A 2FC0A 3AA2A 3KD1E 4AQYK 4A61A 2WOMA 3SBGA 3THYA 3CC2N 4BE1A 4AHRA 3RR8A 4F9OA 3ZT0A 2GELA 2HHTA 3C95A 4DUZK 4IEIA 2QW9A 5LMUK 5FLXO 2HSTA 1VSEA 1JJ2M 3CC4N 4DTPA 2HHXA 1K6YA 4DF8A 4H8KA 2UYTA 4AHCA 2P9LB 5M1KA 3SQ2A 3ISNC 2F7TA 4DV4K 2HBLA 3ZLJA 3QB0A 3VA3A 4IWVA 2JWLA 4QOZB 4ILJA 4DSJA 2KQ2A 5AQQA 3T1AA 2PBDA 2Z1GA 1C6VA 4RTFD 4CJKA 4DHYA 1W0HA 5IWAK 5AFUA 5HRSA 2P9IB 4KH6A 1D9DA 4BR4A 3ID6A 3D2EA 1A5VA 4CJLA 1WSFA 3F5TA 4AHSA 4FZZA 3CC7N 2V52B 4F2RA 1HQEA 2QWLA 4QS8A 5IT9O 2GTDA 2YHWA 5AQTA 3SUPA 2Z1HA 5KQ8A 1RTHA 1RT6A 3J81O 3TTFA 4Z4EA 1VQ6N 5BR9A 2P9PA 4MO4A 2QI2A 3AA3A 3PY8A 2F96A 3UIQA 3WXKA 1NK9A 3RMAA 1TL1A 4FK0A 1D9FA 4CZKA 3OYHA 3NAEA 1VSKA 1S1WA 1NGFA 1SKRA 3VGMA 4Z94A 4FJXA 5F2RA 4DCHA 1YF5L 1JXEA 1TKTA 1LWCA 3PX4A 3VEXA 3ZT1A 2P51A 5EOYA 4FOEA 3ZYYX 1RILA 1GLJO 3NF6A 3H1VX 3CERA 3DYAA 3JS6A 4GVEA 4F2SA 4L8RB 1MWKA 1C1AA 4OLBA 1GOBA 3LANA 4MLHA 2ETJA 1XMOK 3HYFA 3DRRA 4CZGA 3ZSZA 4DQIA 3NDKA 3ZX3A 4B9UA 4CZHA 2OTJN 3I0RA 4M45A 3AA5X 3D2EB 4JLHA 4JKCA 3HP9A 3IUCA 2YHYA 1HPZA 1WB9A 4CJQA 2FF6A 3VQBA 4N41A 1EWQA 2PZSA 5AQYA 3A8YA 2BH1A 4O8UA 2P9PB 3MEDA 1QSSA 1SS6A 4E89A 1NGDA 3AVFA 4CEAA 4UQGA 3E01A 4FJ9A 3ASMA 1L5UA 1NGHA 3CJCA 1IG9A 4KHWA 1IBMK 1HNVA 3H1QA 4XH1A 4CJUA 5LJVA 1CZAN 1GLLO 4O44A 4JK7A 3HK2A 4CESA 3H08A 1T6CA 4H03B 3EN9A 3HJFA 4LY7A 1YJWN 1JLBA 1T7PA 4ISGA 3TANA 2KZMA 5BPLA 3OYAA 2GX9A 2OPSA 4KI6A 4LSNA 3OYNA 3MXJA 4HUFA 2UUCK 4PL8A 1GLCG 2UU9K 1RDBA 4DG1A 1LWEA 3ZSYA 4CGDA 3CJ9A 2EX3A 1WAFA 2E2QA 1IKXA 1L3SA 3RWUA 4JS5A 2QWQA 1FKOA 2A40A 4BRCA 4CHOA 4HUGA 3TAPA 4J2DA 2O8FB 4CFBA 1S9GA 4K42A 3S3NA 2ASMA 3GBTA 3KLIA 3KK3A 3SLCA 2BE2A 3E66A 3TABA 3HPOA 5J2QA 4KHYA 4NO7A 3VMFB 3VOVA 5HLFA 3OBYA 4G9ZA 1C1CA 1VQ8N 2O8DA 3NHGA 3QMLA 4AM7A 5AZJB 1UAXA 5D3GA 2HMIA 5ELZA 4DF4A 4BRFA 1KQSM 3VQ9A 4LH5A 5ADXA 4DMNA 2YX6A 2ZJQL 1T05A 3ZSXA 1JLQA 3SQ4A 1OVQA 3MXMA 4J2EA 2AA4A 4HTUA 1MWMA 2GUPA 1YIJN 1K8KB 1RBRA 3KK1A 4HHTA 4M3XA 1Q81O 3WEEA 4CJSA 4E0DA 4GKKK 1TKZA 1N32K 2VCPA 2W6LA 2HHVA 1L3UA 1GLEG 5I42A 5AQWA 5BN9A 3L3UA 1IBLK 1TL3A 4XH4A 2J4RA 2O8BA 3ZX2A 5BN8A 5AQMA 3DWLA 4DR5K 1L3TA 4CW7B 1QTMA 4FLXA 3QEVA 3MN5A 3O1WA 2OANA 4IOCL 4DTRA 4BRDA 2FSNA 3L0QA 1GLDG 3EY1A 5LY3A 3I56N 2I7PA 3C6HA 2BUPA 5HRPA 2IS3A 3CJ7A 5LJWA 3BUZB 1I39A 3ZCMA 2IVPA 3B6PA 2O8DB 3K5MA 5M1PA 3U3GA 3ENBA 4CJTA 2OCEA 2A5XA 4E1JA 5CY4A 4DUYK 1U49A 2QWRA 3MN9A 3A2FA 3N4PA 4BC5A 4LFAK 4R5PA 3LP1A 2G8IA 3AARA 3FR0A 3DRSA 1ZBFA 4ELTA 4BR2A 5KPTA 4ISFA 4CK3A 4CD3A 1GLAG 1SL1A 2W40A 4H5VA 3PO5A 4WQ4A 4IO8A 3JAMO 3S41A 4DTUA 3QNOA 4OGEA 3LPTA 3VPZA 1QVFM 4C8KA 3TAMA 2P9SA 3OHRA 4I6MA 2GWJA 2RHKA 4JD2A 3VETA 3O9TA 3CPWM 2ZM6K 4JN4A 2Q0RA 1QSLA 4LF6K 3AGKA 2HHWA 1W2BM 3LPUA 1SL2A 1HMVA 2Y1JA 1IH7A 3D45A 4CJ3A 1IBKK 2OZSA 2X6SA 2PYLA 1C0TA 4JNEA 1U6ZA 3RRHA 2CH5A 1RT4A 4DU3A 3THXB 3PIPL 3SMPA 4H0TB 3W3DA 2X74A 3T1HK 4DV3K 3HO1A 3O4WA 1RTJA 4AM6A 1WLJA 4Z4FA 4IFYA 5AQIA 1U04A 4DSKA 2R7YA 2DFHA 3IG1A 5J2PA 3TR8A 1YAGA 3PSFA 3I55N 5FRMA 1T8EA 1KAXA 5FDLA 4GMJB 3MAQA 4RCHA 3T19A 1EX4A 4I6MB 4E1NA 5MLCQ 4B1YB 4FJLA 3A5LC 1I94K 3CCLN 4ELVA 1S1XA 2IIRA 2A42A 1N8RO 4BR7A 3RSEA 1J9AA 4PKIA 2QK9A 4GNIA 2QA4N 3VQ4A 3WXMB 3OBWA 4BC3A 4IDKA 1BA1A 2D0OA 2Q2RA 2F8TA 1JLEA 3O9SA 4O5FA 4JI0K 4GV6A 4DFKA 3CCVN 4DV2K 1BHLA 3L2UA 4HCBA 2HVIA 1HYZA 3K59A 2DY4A 4BC2A 3K2PA 3DXKA 1TKXA 3OYBA 3K9JA 4ZTJA 1LWFA 2E4LA 2Q31A 1XWLA 3U3YA 4KH4A 1MU2A 4KFBA 2VQFK 1XC3A 3TU5A 1T44A 2E20A 4Y1DA 3K9KA 1C0GA 3TAQA 1DEJA 5AQOA 1X9SA 2KW4A 4OKKA 2Y1IA 1TK8A 2D0CA 3HM8A 4C8LA 5AJ3K 1TKDA 3VESA 4G1QA 3AAPA 3KWGA 3NFAA 1ASUA 3OYEA 1JLFA 2YHBA 3S9HA 3EO3A 1RBVA 4XH5A 3CCRN 3QEIA 2HW3A 4RW7A 1I3AA 5FPMA 2NRZA 3I8DA 3UB5A 1NK6A 4I9LA 4AILC 3D6RA 2D0AA 3HTVA 4B1XB 5AQGA 2B4JA 3G10A 3HI0A 2FXUA 4M41A 1YTUA 1T3VA 2HBKA 3CM5A 3U9DA 3U4LA 2GWKA 3ALYA 3KLFA 1ZBLA 3HL8A 3GL1A 1HNIA 1ZBHA 1XMQK 5CZ1A 2IVNA 4IJNA 5AQPA 1VRUA 1HNWK 1V4SA 3LM9A 4E7KA 1HLUA 1ILYA 4CEDA 2HMPA 1KLNA 1TGOA 4FXDA 1YJNN 2YJFA 1N5YA 3DLEA 1JXBA 2P9UA 3THWB 1LCUA 5GIPA 3EKSA 4CBXA 3O80A 5C0YA 3QIOA 4YFUA 4NCAA 3PSIA 5BPMA 3CF5L 1V4TA 4J2BA 1R59O 5HBMA 1J53A 4ISEA 3AVCA 1VSHA 2NRRA 4DQPA 2ASOA 1EXQA 2I5JA 5AQVA 3KK2A 4FWLA 4DTJA 3ZEUB 5H1SQ 3WT0A 4C8NA 3DLKA 3SV3A 3OVNA 4AH9A 3SPZA 4QS7A 4Q0BA 3HT3A 2P9LA 3JXUA 4F4KA 4CGHA 3V1QA 3QFPA 4IDHA 1NJZA 3THVA 1NGGA 4IJAA 3UE5A 3VQ5A 3QNNA 2ASPA 4B9SA 1H1VA 4KHNA 1REVA 4DU1A 1KC8O 5GADP 3TAEA 4M63C 3OW2M 4J2AA 4CF0A 2O4IA 4DV0K 1Z6RA 1YUWA 4F8RA 3FZHA 1HKGA 4EHUA 1JLGA 4KHQA 3OTOK 5HP1A 4Z4CA 3EZ5A 2P9IA 4B1VA 2F9TA 3D2FB 4JKAA 3L2QA 5BRFA 2VWJA 4OKJA 2O8CB 1N36K 5BR8K 5CHIA 1CXUA 5FPDA 1LOTB 5AZIA 1CLQA 1IKYA 4CHYA 1BL3A 3EE8A 5JS2A 5CYMA 1R0AA 2VYPA 4L3QA 4FJMA 4MDAA 3MECA 3BY5A 4FJ7A 3FFIA 4YOWA 1BU6O 4M3WA 1J5EK 1O13A 4JAXA 4LD0A 3SZ2A 2IC3A 4A5BA 4JI1K 1SKSA 3DLRA 4CJ7A 4LF8K 5DK5A 4QCLA 4DR3K 3V9WA 3HPGA 4O0JA 1FK9A 3HSCA 2WUSA 3SAFA 1D8YA 1E4GT 2BTFA 3WNFA 3RMCA 2D1KA 2D0BA 2WONA 4FSVA 4O8KA 2YNHA 1Y97A 1S1TA 5AQZA 2WTUA 4BRAA 3ATUA 2VQEK 3EE9A 1RT2A 4IZ9A 4NLCA 4W5QA 3MCPA 4E19A 3WXLA 3E9PA 4KB1A 3AO1A 2W42A 4K41A 3CQ8A 3C7NB 5JLFA 1K8AO 5AQNA 5JVHL 5DM7L 5AZIB 4FPBA 5J2NA 5J1EA 4FZXC 4ELUA 1TAUA 3B6OA 1BISA 4BACA 3WXJA 2VWKA 1NBWA 2JGUA 1RBTA 4GW6A 1SZ2A 4IKFA 3DJCA 3OYLA 1C0FA 3NH2A 1RTIA 1RNHA 4AHUA 5EXWA 4M3TA 1NNEA 2IAJA 1BIZA 1OKJA 2ZJPL 2O8EA 3C65A 3OJUA 1S5JA 4RW9A 3QIPA 4H5NA 4B9VA 3AO2A 3UKUB 4BR9A 3PO4A 5BRHA 2YKMA 3ZETB 4B9MA 2YJEA 4CHPA 4OPHA 2F9WA 4M3RA 4W5RA 3IMXA 3L4QA 1HQUA 4C1NK 4KKOA 1NJXA 3CQXA 3I33A 3E9OA 4E7LA 4YDUC 4CEEA 1KSPA 3IKMA 1LV5A 4CERA 1TUUA 1IV0A 1WSEA 5AQKA 3C94A 4BRHA 1RDUA 2GEMA 4EIAA 1WBDA 3G71N 2FBXA 3LP0A 2O8FA 4I9QA 1KFSA 1HJOA 3L4IA 3ZSOA 1KXPA 4CBWA 3AV9A 4DS5A 2P9NA 3VA0A 4JI3K 3HOSA 4JKHA 3O9UA 3ENHA 4ID5A 1EKEA 4W5NA 4CD1A 3AVMA 1YTAA 4JYAK 2O8EB 4WYBA 4BDYA 1Q86O 1XNQK 2QWMA 3M5RA 5A2QO 3NVKA 4PKHA 3CFPA 5AZJA 3A0IX 2RN2A 1NGJA 1NMDA 4FJKA 3TTDA 3VQ7A 3NH0A 3GOIA 2EHGA 3VQCA 2ZJRL 2QKBA 1TYQB 3ULEA 5C2DA 3CCUN 3M3ZA 4H0PA 3VQEA 1HX1A 3Q7CA 3AY9A 1K8KA 1QE1A 1SKWA 4LC9B 4M3UA 2OTLN 3LWMA 4LF7K 3P1GA 3U6FA 3G25A 2HHSA 4IOAL 3RMBA 3P4IA 4BVPA 2NRTA 4YOUA 4CZIA 2KHOA 3IS9A 3LDQA 4WE1A 3M8SA 3SQ0A 5SZTA 1VSIA 1F21A 1CZBA 1SQKA 2P9NB 3LDSA 1WSGA 3E1YA 3O9QA 4KPYA 3U9ZA 3PIOL 3VEZA 4B1UB 1WAJA 1VSDA 4FVMA 1ZBIA 2ATQA 4B8CA 2OA8A 4JI8K 2XY7A 3AAQA 4MLEA 2KFNA 1RBUA 3F2KA 3O3GA 5HROA 4HTLA 1VSMA 3ULEB 3J7AP 3VQ6A 4A2BA 4BRPA 3QDKA 1M1KO 1NKEA 4F3TA 3ID8A 1VQ5N 3H3NO 5BRDA 4IBNA 3V6DA 1UA0A 1NK7A 3TTCA 4CEOA 2VG7A 3DM2A 5E26A 1RDDA 4ILHA 1X9WA 4GKJK 1NJYA 2GV9A 2KLAA 3NCIA 3HRGA 4ILGB 3TSUA 2LSNA 3IRXA 1LAVA 4FWNA 2OPQA 1ASWA 1E3MA 4O5BA 5C15A 2PY5A 4DR6K 1OVYA 3C6AA 1KRPA 3OS0A 1OH5A 4JI4K 3VTIA 5F1XA 1DLOA 5AQUA 1S6PA 3QETA 3VENA 4JI7K 4B3MK 3MXIA 3VERA 4WF9L 2RPIA 1G15A 3THXA 3OS2A 4NXNK 5F0XA 4CJRA 3MMVA 5CR4A 4DTNA 4WFAL 4CK1A 5KI6A 5GINA 3TSQA 2W41A 1FJGK 1NU0A 4LF5K 1IJJA 1EO1A 5CZ2A 5EVZA 3BF1A 4CF9A 2BANA 5JMVA 3MK6A 1IO2A 3TAFA 4Z4GA 1QZ6A 3RRGA 1KFDA 5FPNA 3CD6N 4B3TK 2HBJA 5C42A 2Z1JA 4FJGA 4CJFA 4FW1A 1XUPO 1DGKN 2D0PA 4YOVA 3R3LA 2QEXN 4FJNA 5K14A 5BPNA 5AFUH 3SMSA 4CHNA 4CECA 2UXDK 1Y64A 2FSJA 1ESVA 4WFNL 1KVCA 4CJVA 5JS1A 1QZ5A 3D0PA 3LDPA 4DQRA 3WQUA 4O4GA 4BQLA 4WQ5C 1VQMN 3QINA 5AR0A 4DTOA 3NF7A 3DXMA 4B9NA 2I7NA 3KIOA 4IO9L 1BA0A 2P5OA 1VSFA 3CMAN 3VGKA 3QLHA 2CGJA 3EL2A 5KQDA 4FVUA 2QWOA 4FM0A 3AA4A 2BGGA 4DQ8A 2PAVA 5M1QA 4JEPA 3FE1A 4GVMA 2Q0UA 3K0SA 4BDZA 3SPYA 2Q3SA 2HNYA 1EETA 1WSIA 4H0OA 3TPQA 1BQMA 3NVMA 4CIEA 4FJ5A 3QEPA 2DFEA 4IXCA 4PQUA 3A5OC 3R8EA 4BWJA 2NRWA 2G8UA 1JLCA 4CFAA 4E3SA 2CGLA 3CETA 4A62A 3ATVA 5KRTA 1KD1O 3HVTA 2ZQBA 1WSHA 4OX9K 3KLHA 1XNRK 1VHXA 4PUOA 4OGCA 1NKBA 1TK0A 3DRPA 5FROA 1QVGM 3MWTA 3O4NA 4BRQA 1HR0K 3BGRA 3QESA 3RTVA 5AQRA 1RTDA 4KB0A 1JL2A 3DXMB 3ULDA 1VQ7N 3OS1A 2HB5A 4OLAA 4FLUA 2FF3B 2ITGA 2RKIA 3P5JA 5EU7A 1J6ZA 5T7BA 3O3HA 3J80O 3V9SA 1YT3A 2OPRA 4OPAA 1X3MA 4FWOA 3THWA 2V51B 1A5WA 1L3VA 3LAKA 1VQ4N 3VF6A 3CFRA 1KCFA 4DWIA 1BCMA 4H5WA 5AQLA 4CF2A 3KZBA 1YJ9N 1VQKN 1ZBUA 3S3MA 4B3RK 3H3OB 4OKEA 3PLAA 2YHXA 4JK9A 4IEEA 3LDOA 2IGIA 3FFKB 1ATNA 1GOAA 3GDQA 4A5AA 3HVRA 4J8FA 1TK5A 1HKCA 2DTUA 3ZEUA 1W7AA 1QHAA 1K73O 4LF4K 3CJ1A 1CXQA 5M1NA 2ZF5O 4DFJA 3OYDA 3KLEA 1UA1A 3NF8A 4JV5K 2Z1IA 1DTQA 4YDUA 3BF3A 3DAWA 4K8ZA 1NLVA 4I2QA 3DMJA 3TSPA 5DM6L 1GOCA 2X78A 2ITMA 3GG4A 3P39A 4B9QA 3I8BA 1YVNA 3S3OA 1P90A 4FLTA 1C1BA 4JRQA 1N34K 2DPNA 4B1WB 4BREA 5ADXH 3VTHA 1Z26A 3E9LA 1NGBA 2GUIA 3D2FA 2E1ZA 4B8AB 4BDPA 2VG5A 2VWBA 2O8CA 1OH7A 2ZGZA 2E2PA 2A3ZA 4DFMA 1S9EA 3MX2A 3SUQA 3RMDA 1Q9XA 2UXCK 5AQHA 3FZKA 2ZGYA 4C8MA 4NCBA 3NE6A 4Y1CA 4DV7K 4K8XA 3LDNA 3FZFA 3FZLA 5BREA 5EY4A 4CHQA 2E88A 3VEYA 4KTWA 5C24A 3WNGA 4DSLA 3NGYA 3B8AX 4FJ8A 4LFBK 3CG7A 4DKWA 4DV5K 4EHTA 4KBOA 2YKNA 4CE9A 3A5NC 3AVBA 4NLBA 3ZT3A 2NNWA 5SWMA 1TVRA 2QXLA 3ZSVA 4RWTA 4E7IA 3R6MA 1U2VB 1NKCA 3BDPA 1LW2A 4M3YA 4YY3K 1WBBA 1RT7A 1KAZA 1LW0A 1RFQA 2JWKA 1JL1A 3TWHA 3HZ6A 4DR7K 1VRTA 4CZEA 5TKWA 1Q18A 3C7NA 3KWIA 3QFUA 3P31A 3OA9A 5E41A 4CZJA 1N6QA 4EP4A 4A57A 2EWSA 3QBWA 4BY9C 3P83D 3CYMA 3SUOA 1B9FA 4OJRA 4N76A 3EYZA 4YHHK 5LMNK 5LL6Z 4BG8A 3GE1A 4FM1A 3PX6A 2Q36A 3G4SN 4X65K 1BUPA 1HYSA 1HKBA 4N5SA 3DOLA 4B08A 3UKUA 1GLFO 3RVCA 4CF8A 4UY8O 4DFPA 2W6KA 3MCAB 2XY8A 2A6AA 1VQPN 4DS4A 5C12A 4CZFA 1YXQA 2XY5A 1T6DA 3ZETA 1LAWA 3NGZA 2VGNA 2G8FA 1X3NA 3F9MA
chains in the Genus database with same CATH topology
3SQ1A 4W5OA 3LWMA 4CEFA 1SUQA 4N56A 3P1GA 1QSLA 3U6FA 3LZIA 2HHWA 1J5OA 2HHSA 2ZE2A 3RMBA 4DSEA 3VQDA 3LPUA 1SL2A 1HMVA 2Y1JA 1IH7A 3D45A 3V1OA 4CJ3A 2OZSA 2X6SA 3DLGA 2PYLA 1C0TA 4FJHA 1WNSA 3RRHA 5KTQA 4CF1A 4DU4A 1ZYQA 3IS9A 3VQAA 3OYIA 4DLGA 1RT4A 4DU3A 3DI6A 4WE1A 3M8SA 3NGIA 3KKSA 3SQ0A 2OZMA 4MQ3A 3HP6A 5SZTA 1VSIA 3SCXA 5HRNA 1F21A 2X74A 4MFBA 3M8RA 4FLVA 1CZBA 3AVGA 1WN7A 3LDSA 1KVBA 1WSGA 2HHUA 3NH1A 3PUFA 4KPYA 5KGWA 3HO1A 4FK2A 4CJ5A 4NYNA 1RT3A 1RTJA 1WAJA 1VSDA 1WLJA 4M42A 4FVMA 4IFYA 1IKVA 1U04A 1FXXA 3AVIA 2ATQA 3VQ8A 4Z4FA 1ZBIA 4KRFA 4Z4IA 3OYCA 3JYTA 4B8CA 3SJJA 1U47A 1NK5A 2R7YA 1Q9YA 2OA8A 4DSKA 2DFHA 2XY7A 3IG1A 5J2PA 3NBPA 2KFNA 3TI0A 3TR8A 4IFVA 4JS4A 1RBUA 4AHVA 5J2MA 3O3GA 4YNQA 4CGJA 2D5RA 5HROA 1VSMA 5FRMA 3V1RA 1IKWA 3ZSWA 1T8EA 3VQ6A 1BI4B 5FDLA 1XHZA 2G8KA 1NKEA 4F3TA 3LALA 4GMJB 4ID1A 4O0IA 3MAQA 1X9MA 4IBNA 3V6DA 1VK0A 4O55A 1UA0A 3T19A 1EX4A 4E1NA 1NK7A 3QO9A 4CEOA 2VG7A 4H4MA 3VQQA 4FJLA 4XIUA 4ELVA 3DM2A 1RT5A 1NOYA 1S1XA 4HVJA 4OVLA 2KTQA 1RDDA 1NK8A 1X9WA 3SV4A 1NJYA 2GV9A 1J9AA 3MEGA 4FJIA 4PY5A 3NCIA 4FLWA 2QK9A 4I7FA 5HRRA 1SV5A 2YNFA 3L3VA 2LSNA 3IRXA 3VQ4A 1LAVA 2HHQA 4IG0A 1WSJA 4IDKA 2PYJA 2OPQA 4DTSA 1ASWA 3C6UA 4W5TA 2F8TA 1JLEA 1NOZA 4CGGA 2JLEA 4O5BA 2XHBA 2PY5A 4FJJA 4DFKA 3PX0A 4FK4A 2A1RA 1KRPA 3OS0A 2G8WA 4E7HA 4CJWA 1O1WA 2ZD1A 4OPKA 1BHLA 1DLOA 1S6PA 3L2UA 3QETA 3V81A 4HCBA 3MXIA 4CCHA 2HVIA 1HYZA 1SL0A 2RPIA 3K59A 1G15A 1NK4A 2VG6A 3OS2A 2DY4A 3K2PA 1RCHA 1XHXA 4EP5A 3L8BA 1B92A 1TKXA 4CJRA 3OYBA 3AVNA 4ZTJA 3F9KA 1LWFA 4DTNA 2E4LA 4ZHRA 4CK1A 5KI6A 2G8FA 4F3OA 1XWLA 3U3YA 4B3OA 1MU2A 1RT1A 3LP2A 5FRNA 4KFBA 2F8SA 5CZ2A 4BE0A 3ZSRA 4CF9A 1KLMA 2BANA 3ITHA 4FZYA 4Y1DA 3AVKA 4Z4HA 3KTQA 4KHUA 3TAQA 1X9SA 2FBYA 2KW4A 3L2RA 1IO2A 4FM2A 4OKKA 3TAFA 2Y1IA 4Z4GA 4CEQA 4KTQA 3RRGA 1TV6A 3KKRA 1KFDA 1TK8A 1KVAA 1JKHA 3M8PA 2D0CA 5C42A 3V9UA 4ICLA 4C8LA 4I2PA 2Z1JA 2FC0A 2YNIA 1TKDA 4G1QA 3AA2A 4RW8A 3LWLA 3NFAA 3KD1E 4FJGA 4CJFA 2WOMA 1ASUA 3RR8A 3OYEA 4BE1A 4AHRA 4FW1A 3WNEA 1JLFA 3ZT0A 2YHBA 2G8VA 3C95A 3S9HA 1T03A 4FYDA 2HHTA 1RBVA 3K5LA 1HJRA 1VSEA 4FJNA 5K14A 1W9HA 2HVHA 4DTPA 3QEIA 2HW3A 2HHXA 1K6YA 4RW7A 1I3AA 4DF8A 4CHNA 4CECA 3I8DA 3PV8A 1NK6A 4H8KA 4AHCA 4I9LA 3SYZA 4AILC 1QHTA 2D0AA 3SQ2A 2B4JA 3ISNC 1KVCA 4CJVA 3G10A 3AVLA 3TAGA 1YTUA 4M41A 4DSIA 5JS1A 3CM5A 3VA3A 4DTMA 4CFDA 3D0PA 3OYMA 3ALYA 5CYQA 3KLFA 4DQRA 4QOZB 1ZBLA 3HL8A 4O4GA 1HNIA 1ZBHA 3QINA 2P5GA 4DTOA 5CZ1A 4JRPA 4DSJA 2KQ2A 3T1AA 1VRUA 3ZT4A 3NF7A 3MEEA 2Z1GA 4E7KA 1C6VA 1FKPA 4CEDA 4CJKA 4B9NA 1KLNA 3KIOA 1W0HA 1TGOA 4FXDA 2P5OA 1VSFA 5HRSA 1N5YA 3DLEA 2FBTA 1D9DA 1JXBA 3O4QA 3QLHA 4CJEA 4FM0A 4CGIA 3AA4A 1A5VA 4CJLA 1WSFA 2BGGA 4FZZA 3HPHA 4AHSA 1BCOA 3TARA 4F2RA 4FLYA 1HQEA 4GVMA 3QIOA 4CHZA 4YFUA 4NCAA 5KRSA 3OY9A 4BDZA 3SPYA 2Q3SA 1NJWA 2HNYA 3K57A 4J2BA 1EETA 1WSIA 3SUPA 2Z1HA 1BQMA 5HBMA 4CIEA 3OJSA 1X1PA 4FJ5A 1J53A 1RTHA 1RT6A 3AVCA 3QEPA 1VSHA 2DFEA 4EZ9A 4Z4EA 4DQPA 4PQUA 3AA3A 2OYQA 3PY8A 4BWJA 2F96A 3UIQA 3KLGA 2G8UA 1NK9A 1EXQA 3AO3A 4E7JA 2I5JA 3RMAA 3KK2A 3AVHA 1JLCA 1TL1A 2XRIA 4CFAA 4OPJA 4DTJA 3OYHA 3K5NA 4E3SA 1D9FA 4BWMA 1VSKA 3NAEA 4DQSA 3DLHA 1S1WA 4C8NA 3DLKA 5KRTA 3SV3A 1SKRA 3OVNA 4FJXA 3HVTA 2ZQBA 1WSHA 4AH9A 3SPZA 4Q0BA 3KLHA 1JXEA 1TKTA 1LWCA 1BIUA 4PUOA 3HT3A 3K58A 4F4KA 4OGCA 3PX4A 1NKBA 4CGHA 3SI6A 3V1QA 3DRPA 1TK0A 3ZT1A 1NJZA 1HRHA 2P51A 5FROA 3THVA 2P1JA 3O4NA 1NK0A 1S1UA 3BGRA 3AVAA 1RILA 3LP3A 3VQ5A 2B5JA 3RTVA 3NF6A 3QESA 3QNNA 4B9SA 4EZ6A 1RTDA 4HCCA 3DYAA 4KB0A 4KHNA 4RW6A 1REVA 4DU1A 1JL2A 3ULDA 4F2SA 3HM9A 3NF9A 4L8RB 1S1VA 3OS1A 3QEWA 3TAEA 1C1AA 2HB5A 1GOBA 3LANA 4OLBA 2ETJA 3CFOA 4OLAA 2E6LA 2OPPA 4CF0A 3HYFA 2NUBA 3DRRA 3ZSZA 4FLUA 4J2AA 2O4IA 4DQIA 2ITGA 2YHAA 3ZSQA 3NDKA 4B9UA 3I0RA 4M45A 4F8RA 2RKIA 3AA5X 3P5JA 4JLHA 5EU7A 5T7BA 3O3HA 1JLGA 4KHQA 3HP9A 5HP1A 3V9SA 4Z4CA 1YT3A 3EZ5A 3QERA 5DMRA 4FW2A 1HPZA 2OPRA 3DOKA 4CJQA 3LAMA 3L2QA 3VQBA 3KD5E 4N41A 4NCGA 1A5WA 3K5OA 1L3VA 3LAKA 2VWJA 4OKJA 3L2VA 1KCFA 3CFRA 4N47A 1U48A 1HYVA 1BCMA 2PZSA 4DWIA 1CXUA 4CF2A 4FLZA 1CLQA 1ZBUA 4CEZA 3S3MA 3AO4A 1A5XA 3MEDA 1IKYA 4CHYA 1BL3A 1QSSA 4OKEA 4E89A 2IDOA 5JS2A 3AVFA 3F73A 4CEAA 5CYMA 1TAQA 4UQGA 1R0AA 4B9TA 1BGXT 3E01A 4FJ9A 3ASMA 2IGIA 3G0ZA 3VQPA 3OYFA 1L5UA 4FJMA 3MECA 1GOAA 4FJ7A 3FFIA 1RDCA 1IG9A 2QKKA 3HVRA 4KHWA 4M3WA 4KAZA 3OYKA 1HNVA 4CJUA 3SZ2A 4LD0A 4HUEA 1TK5A 4O44A 3V4IA 2IC3A 2DTUA 3HK2A 4CESA 5KGXA 1SKSA 3DLRA 2KFZA 2XY6A 3H08A 1QSYA 5DK5A 4QCLA 3JSMA 3V9WA 3HPGA 4O0JA 1FK9A 1CXQA 3HJFA 4LY7A 1JLBA 1T7PA 1D8YA 3HXMA 3TANA 3WNFA 3RMCA 4DFJA 1EP4A 3OYDA 3KLEA 3SNNA 1UA1A 3OYAA 2KZMA 2A1SA 3NF8A 2G8HA 2OPSA 2D0BA 4LSNA 3OYNA 1C0UA 3MXJA 3LZJA 2Z1IA 5C25A 4HUFA 4LH4A 4KI4A 2WONA 4CIFA 1DTQA 2YNHA 1RDBA 4QAGA 1Y97A 4DG1A 1LWEA 3L2WA 3ZSYA 4CGDA 4K8ZA 3C6TA 1S1TA 2KZZA 4I2QA 2O4GA 3DMJA 2EX3A 1GOCA 1WAFA 2X78A 2HNZA 1RT2A 1IKXA 1VSLA 4W5QA 1L3SA 3RWUA 3S3OA 4E19A 4JS5A 1YVUA 1FKOA 4KB1A 3AO1A 4CHOA 4HUGA 2W42A 4FLTA 3AO5A 3TAPA 4J2DA 2IOCA 2BDPA 2QXFA 3CQ8A 4CFBA 3RR7A 1S9GA 1C1BA 1DTTA 4JRQA 3S3NA 1B9DA 1Z26A 3KLIA 4CFCA 3KK3A 2GUIA 2BE2A 1CZ9A 4TSXA 5J2NA 5J1EA 4FZXC 4B8AB 4ELUA 1TAUA 3B6OA 4DQQA 1BISA 4BACA 2VG5A 4BDPA 3TABA 3V9XA 2VWKA 4RG8A 3HPOA 5J2QA 4KHYA 2JGUA 4DFMA 4LSLA 1S9EA 3SUQA 1RBTA 4GW6A 1KTQA 3SUNA 3RMDA 5HLFA 1Q9XA 4IKFA 1C1CA 4FCYA 3M8QA 4BE2A 3T3FA 4E1MA 3OYLA 3NH2A 3NHGA 4C8MA 4NCBA 1RTIA 3NE6A 1RNHA 4Y1CA 4PWDA 4AHUA 4M3TA 1UAXA 4CEBA 2YNGA 4KV8A 1XC9A 4K8XA 2IAJA 1QS4A 1BIZA 2HMIA 5D3GA 4Z0UA 4DF4A 2YV0X 1U45A 3OJUA 1S5JA 4CHQA 4RW9A 4DTXA 3VQ9A 3QIPA 4LH5A 4KTWA 5C24A 2E6MA 3WNGA 4DMNA 4B9VA 1T05A 4DSLA 3AO2A 3NGYA 4FJ8A 3CG7A 1U4BA 3ZSXA 1C0MA 3KJVA 2YKNA 3PO4A 1JLQA 4CJ4A 3V9ZA 1QQCA 3SQ4A 4CE9A 3AVBA 3MXMA 2YKMA 4J2EA 4HTUA 4B9MA 4CHPA 3KK1A 1RBRA 4HHTA 4M3XA 3ZT3A 4M3RA 5I3UA 4W5RA 1BQNA 5SWMA 2AJQA 4CJSA 1TVRA 2GBZA 2DFFA 1TKZA 3ZSVA 4E0DA 1HQUA 2HHVA 4KHSA 4KKOA 4E7IA 4H4OA 1NKCA 1NJXA 1L3UA 3CM6A 4NYFA 5I42A 3BDPA 4C8OA 1LW2A 4M3YA 3L3UA 4E7LA 1RT7A 4RW4A 1LW0A 1Z25A 4CEEA 1TL3A 4ZTFA 1J54A 1KSPA 1LV5A 4CERA 1WSEA 1RBSA 1JL1A 1L3TA 3QEXA 3C94A 1QTMA 4FLXA 3QEVA 3TWHA 1JLAA 1UOCA 4M3ZA 1VRTA 4PA1A 4DTRA 4IG3A 2FBXA 3LP0A 4B9LA 4KO0A 5E41A 1N6QA 4I9QA 4KREA 1UWBA 3EY1A 1XI1A 1KFSA 4CGFA 3WNHA 4EP4A 5HRPA 2IS3A 3ZSOA 1RDAA 1I39A 3AV9A 3ZCMA 3B6PA 4DS5A 3VA0A 3K5MA 3VN5A 4DSFA 3U3GA 4CJTA 3P83D 3CYMA 1EKEA 4ID5A 1B9FA 3SUOA 4W5NA 3AVMA 5CY4A 1YTAA 4OJRA 1U49A 3ZT2A 4N76A 4BDYA 3A2FA 3EYZA 3AVJA 4FM1A 3PX6A 4R5PA 3LP1A 4Q5VA 3O3FA 3CFPA 2RF2A 2G8IA 3OYGA 2RN2A 3OYJA 4FJKA 4FK0A 1HYSA 3DRSA 1ZBFA 3DLBA 4N5SA 3DOLA 3IAYA 4ELTA 3VQ7A 4CIGA 3NH0A 4B08A 1ITGA 2EHGA 4CK3A 3VQCA 1SL1A 2FBVA 2QKBA 1VSJA 3PO5A 1Q8IA 4CF8A 4KI6A 4CJPA 4DFPA 4DLEA 1BI4A 4CK2A 3VQEA 2XY8A 3I0SA 4AHTA 1S6QA 4OGEA 4KTZA 4DS4A 3LPTA 4DTUA 3QNOA 4C8KA 3HSTB 3TAMA 1ASVA 2XY5A 1LAWA 2XO7A 3NGZA 2X6NA 2HNDA 1QE1A 1SKWA 2B6AA 4M3UA 1D5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQ1 A;  4W5O A;  3LWM A;  4CEF A;  1SUQ A;  4N56 A;  3P1G A;  1QSL A;  3U6F A;  3LZI A;  2HHW A;  1J5O A;  2HHS A;  2ZE2 A;  3RMB A;  4DSE A;  3VQD A;  3LPU A;  1SL2 A;  1HMV A;  2Y1J A;  1IH7 A;  3D45 A;  3V1O A;  4CJ3 A;  2OZS A;  2X6S A;  3DLG A;  2PYL A;  1C0T A;  4FJH A;  1WNS A;  3RRH A;  5KTQ A;  4CF1 A;  4DU4 A;  1ZYQ A;  3IS9 A;  3VQA A;  3OYI A;  4DLG A;  1RT4 A;  4DU3 A;  3DI6 A;  4WE1 A;  3M8S A;  3NGI A;  3KKS A;  3SQ0 A;  2OZM A;  4MQ3 A;  3HP6 A;  5SZT A;  1VSI A;  3SCX A;  5HRN A;  1F21 A;  2X74 A;  4MFB A;  3M8R A;  4FLV A;  1CZB A;  3AVG A;  1WN7 A;  3LDS A;  1KVB A;  1WSG A;  2HHU A;  3NH1 A;  3PUF A;  4KPY A;  5KGW A;  3HO1 A;  4FK2 A;  4CJ5 A;  4NYN A;  1RT3 A;  1RTJ A;  1WAJ A;  1VSD A;  1WLJ A;  4M42 A;  4FVM A;  4IFY A;  1IKV A;  1U04 A;  1FXX A;  3AVI A;  2ATQ A;  3VQ8 A;  4Z4F A;  1ZBI A;  4KRF A;  4Z4I A;  3OYC A;  3JYT A;  4B8C A;  3SJJ A;  1U47 A;  1NK5 A;  2R7Y A;  1Q9Y A;  2OA8 A;  4DSK A;  2DFH A;  2XY7 A;  3IG1 A;  5J2P A;  3NBP A;  2KFN A;  3TI0 A;  3TR8 A;  4IFV A;  4JS4 A;  1RBU A;  4AHV A;  5J2M A;  3O3G A;  4YNQ A;  4CGJ A;  2D5R A;  5HRO A;  1VSM A;  5FRM A;  3V1R A;  1IKW A;  3ZSW A;  1T8E A;  3VQ6 A;  1BI4 B;  5FDL A;  1XHZ A;  2G8K A;  1NKE A;  4F3T A;  3LAL A;  4GMJ B;  4ID1 A;  4O0I A;  3MAQ A;  1X9M A;  4IBN A;  3V6D A;  1VK0 A;  4O55 A;  1UA0 A;  3T19 A;  1EX4 A;  4E1N A;  1NK7 A;  3QO9 A;  4CEO A;  2VG7 A;  4H4M A;  3VQQ A;  4FJL A;  4XIU A;  4ELV A;  3DM2 A;  1RT5 A;  1NOY A;  1S1X A;  4HVJ A;  4OVL A;  2KTQ A;  1RDD A;  1NK8 A;  1X9W A;  3SV4 A;  1NJY A;  2GV9 A;  1J9A A;  3MEG A;  4FJI A;  4PY5 A;  3NCI A;  4FLW A;  2QK9 A;  4I7F A;  5HRR A;  1SV5 A;  2YNF A;  3L3V A;  2LSN A;  3IRX A;  3VQ4 A;  1LAV A;  2HHQ A;  4IG0 A;  1WSJ A;  4IDK A;  2PYJ A;  2OPQ A;  4DTS A;  1ASW A;  3C6U A;  4W5T A;  2F8T A;  1JLE A;  1NOZ A;  4CGG A;  2JLE A;  4O5B A;  2XHB A;  2PY5 A;  4FJJ A;  4DFK A;  3PX0 A;  4FK4 A;  2A1R A;  1KRP A;  3OS0 A;  2G8W A;  4E7H A;  4CJW A;  1O1W A;  2ZD1 A;  4OPK A;  1BHL A;  1DLO A;  1S6P A;  3L2U A;  3QET A;  3V81 A;  4HCB A;  3MXI A;  4CCH A;  2HVI A;  1HYZ A;  1SL0 A;  2RPI A;  3K59 A;  1G15 A;  1NK4 A;  2VG6 A;  3OS2 A;  2DY4 A;  3K2P A;  1RCH A;  1XHX A;  4EP5 A;  3L8B A;  1B92 A;  1TKX A;  4CJR A;  3OYB A;  3AVN A;  4ZTJ A;  3F9K A;  1LWF A;  4DTN A;  2E4L A;  4ZHR A;  4CK1 A;  5KI6 A;  2G8F A;  4F3O A;  1XWL A;  3U3Y A;  4B3O A;  1MU2 A;  1RT1 A;  3LP2 A;  5FRN A;  4KFB A;  2F8S A;  5CZ2 A;  4BE0 A;  3ZSR A;  4CF9 A;  1KLM A;  2BAN A;  3ITH A;  4FZY A;  4Y1D A;  3AVK A;  4Z4H A;  3KTQ A;  4KHU A;  3TAQ A;  1X9S A;  2FBY A;  2KW4 A;  3L2R A;  1IO2 A;  4FM2 A;  4OKK A;  3TAF A;  2Y1I A;  4Z4G A;  4CEQ A;  4KTQ A;  3RRG A;  1TV6 A;  3KKR A;  1KFD A;  1TK8 A;  1KVA A;  1JKH A;  3M8P A;  2D0C A;  5C42 A;  3V9U A;  4ICL A;  4C8L A;  4I2P A;  2Z1J A;  2FC0 A;  2YNI A;  1TKD A;  4G1Q A;  3AA2 A;  4RW8 A;  3LWL A;  3NFA A;  3KD1 E;  4FJG A;  4CJF A;  2WOM A;  1ASU A;  3RR8 A;  3OYE A;  4BE1 A;  4AHR A;  4FW1 A;  3WNE A;  1JLF A;  3ZT0 A;  2YHB A;  2G8V A;  3C95 A;  3S9H A;  1T03 A;  4FYD A;  2HHT A;  1RBV A;  3K5L A;  1HJR A;  1VSE A;  4FJN A;  5K14 A;  1W9H A;  2HVH A;  4DTP A;  3QEI A;  2HW3 A;  2HHX A;  1K6Y A;  4RW7 A;  1I3A A;  4DF8 A;  4CHN A;  4CEC A;  3I8D A;  3PV8 A;  1NK6 A;  4H8K A;  4AHC A;  4I9L A;  3SYZ A;  4AIL C;  1QHT A;  2D0A A;  3SQ2 A;  2B4J A;  3ISN C;  1KVC A;  4CJV A;  3G10 A;  3AVL A;  3TAG A;  1YTU A;  4M41 A;  4DSI A;  5JS1 A;  3CM5 A;  3VA3 A;  4DTM A;  4CFD A;  3D0P A;  3OYM A;  3ALY A;  5CYQ A;  3KLF A;  4DQR A;  4QOZ B;  1ZBL A;  3HL8 A;  4O4G A;  1HNI A;  1ZBH A;  3QIN A;  2P5G A;  4DTO A;  5CZ1 A;  4JRP A;  4DSJ A;  2KQ2 A;  3T1A A;  1VRU A;  3ZT4 A;  3NF7 A;  3MEE A;  2Z1G A;  4E7K A;  1C6V A;  1FKP A;  4CED A;  4CJK A;  4B9N A;  1KLN A;  3KIO A;  1W0H A;  1TGO A;  4FXD A;  2P5O A;  1VSF A;  5HRS A;  1N5Y A;  3DLE A;  2FBT A;  1D9D A;  1JXB A;  3O4Q A;  3QLH A;  4CJE A;  4FM0 A;  4CGI A;  3AA4 A;  1A5V A;  4CJL A;  1WSF A;  2BGG A;  4FZZ A;  3HPH A;  4AHS A;  1BCO A;  3TAR A;  4F2R A;  4FLY A;  1HQE A;  4GVM A;  3QIO A;  4CHZ A;  4YFU A;  4NCA A;  5KRS A;  3OY9 A;  4BDZ A;  3SPY A;  2Q3S A;  1NJW A;  2HNY A;  3K57 A;  4J2B A;  1EET A;  1WSI A;  3SUP A;  2Z1H A;  1BQM A;  5HBM A;  4CIE A;  3OJS A;  1X1P A;  4FJ5 A;  1J53 A;  1RTH A;  1RT6 A;  3AVC A;  3QEP A;  1VSH A;  2DFE A;  4EZ9 A;  4Z4E A;  4DQP A;  4PQU A;  3AA3 A;  2OYQ A;  3PY8 A;  4BWJ A;  2F96 A;  3UIQ A;  3KLG A;  2G8U A;  1NK9 A;  1EXQ A;  3AO3 A;  4E7J A;  2I5J A;  3RMA A;  3KK2 A;  3AVH A;  1JLC A;  1TL1 A;  2XRI A;  4CFA A;  4OPJ A;  4DTJ A;  3OYH A;  3K5N A;  4E3S A;  1D9F A;  4BWM A;  1VSK A;  3NAE A;  4DQS A;  3DLH A;  1S1W A;  4C8N A;  3DLK A;  5KRT A;  3SV3 A;  1SKR A;  3OVN A;  4FJX A;  3HVT A;  2ZQB A;  1WSH A;  4AH9 A;  3SPZ A;  4Q0B A;  3KLH A;  1JXE A;  1TKT A;  1LWC A;  1BIU A;  4PUO A;  3HT3 A;  3K58 A;  4F4K A;  4OGC A;  3PX4 A;  1NKB A;  4CGH A;  3SI6 A;  3V1Q A;  3DRP A;  1TK0 A;  3ZT1 A;  1NJZ A;  1HRH A;  2P51 A;  5FRO A;  3THV A;  2P1J A;  3O4N A;  1NK0 A;  1S1U A;  3BGR A;  3AVA A;  1RIL A;  3LP3 A;  3VQ5 A;  2B5J A;  3RTV A;  3NF6 A;  3QES A;  3QNN A;  4B9S A;  4EZ6 A;  1RTD A;  4HCC A;  3DYA A;  4KB0 A;  4KHN A;  4RW6 A;  1REV A;  4DU1 A;  1JL2 A;  3ULD A;  4F2S A;  3HM9 A;  3NF9 A;  4L8R B;  1S1V A;  3OS1 A;  3QEW A;  3TAE A;  1C1A A;  2HB5 A;  1GOB A;  3LAN A;  4OLB A;  2ETJ A;  3CFO A;  4OLA A;  2E6L A;  2OPP A;  4CF0 A;  3HYF A;  2NUB A;  3DRR A;  3ZSZ A;  4FLU A;  4J2A A;  2O4I A;  4DQI A;  2ITG A;  2YHA A;  3ZSQ A;  3NDK A;  4B9U A;  3I0R A;  4M45 A;  4F8R A;  2RKI A;  3AA5 X;  3P5J A;  4JLH A;  5EU7 A;  5T7B A;  3O3H A;  1JLG A;  4KHQ A;  3HP9 A;  5HP1 A;  3V9S A;  4Z4C A;  1YT3 A;  3EZ5 A;  3QER A;  5DMR A;  4FW2 A;  1HPZ A;  2OPR A;  3DOK A;  4CJQ A;  3LAM A;  3L2Q A;  3VQB A;  3KD5 E;  4N41 A;  4NCG A;  1A5W A;  3K5O A;  1L3V A;  3LAK A;  2VWJ A;  4OKJ A;  3L2V A;  1KCF A;  3CFR A;  4N47 A;  1U48 A;  1HYV A;  1BCM A;  2PZS A;  4DWI A;  1CXU A;  4CF2 A;  4FLZ A;  1CLQ A;  1ZBU A;  4CEZ A;  3S3M A;  3AO4 A;  1A5X A;  3MED A;  1IKY A;  4CHY A;  1BL3 A;  1QSS A;  4OKE A;  4E89 A;  2IDO A;  5JS2 A;  3AVF A;  3F73 A;  4CEA A;  5CYM A;  1TAQ A;  4UQG A;  1R0A A;  4B9T A;  1BGX T;  3E01 A;  4FJ9 A;  3ASM A;  2IGI A;  3G0Z A;  3VQP A;  3OYF A;  1L5U A;  4FJM A;  3MEC A;  1GOA A;  4FJ7 A;  3FFI A;  1RDC A;  1IG9 A;  2QKK A;  3HVR A;  4KHW A;  4M3W A;  4KAZ A;  3OYK A;  1HNV A;  4CJU A;  3SZ2 A;  4LD0 A;  4HUE A;  1TK5 A;  4O44 A;  3V4I A;  2IC3 A;  2DTU A;  3HK2 A;  4CES A;  5KGX A;  1SKS A;  3DLR A;  2KFZ A;  2XY6 A;  3H08 A;  1QSY A;  5DK5 A;  4QCL A;  3JSM A;  3V9W A;  3HPG A;  4O0J A;  1FK9 A;  1CXQ A;  3HJF A;  4LY7 A;  1JLB A;  1T7P A;  1D8Y A;  3HXM A;  3TAN A;  3WNF A;  3RMC A;  4DFJ A;  1EP4 A;  3OYD A;  3KLE A;  3SNN A;  1UA1 A;  3OYA A;  2KZM A;  2A1S A;  3NF8 A;  2G8H A;  2OPS A;  2D0B A;  4LSN A;  3OYN A;  1C0U A;  3MXJ A;  3LZJ A;  2Z1I A;  5C25 A;  4HUF A;  4LH4 A;  4KI4 A;  2WON A;  4CIF A;  1DTQ A;  2YNH A;  1RDB A;  4QAG A;  1Y97 A;  4DG1 A;  1LWE A;  3L2W A;  3ZSY A;  4CGD A;  4K8Z A;  3C6T A;  1S1T A;  2KZZ A;  4I2Q A;  2O4G A;  3DMJ A;  2EX3 A;  1GOC A;  1WAF A;  2X78 A;  2HNZ A;  1RT2 A;  1IKX A;  1VSL A;  4W5Q A;  1L3S A;  3RWU A;  3S3O A;  4E19 A;  4JS5 A;  1YVU A;  1FKO A;  4KB1 A;  3AO1 A;  4CHO A;  4HUG A;  2W42 A;  4FLT A;  3AO5 A;  3TAP A;  4J2D A;  2IOC A;  2BDP A;  2QXF A;  3CQ8 A;  4CFB A;  3RR7 A;  1S9G A;  1C1B A;  1DTT A;  4JRQ A;  3S3N A;  1B9D A;  1Z26 A;  3KLI A;  4CFC A;  3KK3 A;  2GUI A;  2BE2 A;  1CZ9 A;  4TSX A;  5J2N A;  5J1E A;  4FZX C;  4B8A B;  4ELU A;  1TAU A;  3B6O A;  4DQQ A;  1BIS A;  4BAC A;  2VG5 A;  4BDP A;  3TAB A;  3V9X A;  2VWK A;  4RG8 A;  3HPO A;  5J2Q A;  4KHY A;  2JGU A;  4DFM A;  4LSL A;  1S9E A;  3SUQ A;  1RBT A;  4GW6 A;  1KTQ A;  3SUN A;  3RMD A;  5HLF A;  1Q9X A;  4IKF A;  1C1C A;  4FCY A;  3M8Q A;  4BE2 A;  3T3F A;  4E1M A;  3OYL A;  3NH2 A;  3NHG A;  4C8M A;  4NCB A;  1RTI A;  3NE6 A;  1RNH A;  4Y1C A;  4PWD A;  4AHU A;  4M3T A;  1UAX A;  4CEB A;  2YNG A;  4KV8 A;  1XC9 A;  4K8X A;  2IAJ A;  1QS4 A;  1BIZ A;  2HMI A;  5D3G A;  4Z0U A;  4DF4 A;  2YV0 X;  1U45 A;  3OJU A;  1S5J A;  4CHQ A;  4RW9 A;  4DTX A;  3VQ9 A;  3QIP A;  4LH5 A;  4KTW A;  5C24 A;  2E6M A;  3WNG A;  4DMN A;  4B9V A;  1T05 A;  4DSL A;  3AO2 A;  3NGY A;  4FJ8 A;  3CG7 A;  1U4B A;  3ZSX A;  1C0M A;  3KJV A;  2YKN A;  3PO4 A;  1JLQ A;  4CJ4 A;  3V9Z A;  1QQC A;  3SQ4 A;  4CE9 A;  3AVB A;  3MXM A;  2YKM A;  4J2E A;  4HTU A;  4B9M A;  4CHP A;  3KK1 A;  1RBR A;  4HHT A;  4M3X A;  3ZT3 A;  4M3R A;  5I3U A;  4W5R A;  1BQN A;  5SWM A;  2AJQ A;  4CJS A;  1TVR A;  2GBZ A;  2DFF A;  1TKZ A;  3ZSV A;  4E0D A;  1HQU A;  2HHV A;  4KHS A;  4KKO A;  4E7I A;  4H4O A;  1NKC A;  1NJX A;  1L3U A;  3CM6 A;  4NYF A;  5I42 A;  3BDP A;  4C8O A;  1LW2 A;  4M3Y A;  3L3U A;  4E7L A;  1RT7 A;  4RW4 A;  1LW0 A;  1Z25 A;  4CEE A;  1TL3 A;  4ZTF A;  1J54 A;  1KSP A;  1LV5 A;  4CER A;  1WSE A;  1RBS A;  1JL1 A;  1L3T A;  3QEX A;  3C94 A;  1QTM A;  4FLX A;  3QEV A;  3TWH A;  1JLA A;  1UOC A;  4M3Z A;  1VRT A;  4PA1 A;  4DTR A;  4IG3 A;  2FBX A;  3LP0 A;  4B9L A;  4KO0 A;  5E41 A;  1N6Q A;  4I9Q A;  4KRE A;  1UWB A;  3EY1 A;  1XI1 A;  1KFS A;  4CGF A;  3WNH A;  4EP4 A;  5HRP A;  2IS3 A;  3ZSO A;  1RDA A;  1I39 A;  3AV9 A;  3ZCM A;  3B6P A;  4DS5 A;  3VA0 A;  3K5M A;  3VN5 A;  4DSF A;  3U3G A;  4CJT A;  3P83 D;  3CYM A;  1EKE A;  4ID5 A;  1B9F A;  3SUO A;  4W5N A;  3AVM A;  5CY4 A;  1YTA A;  4OJR A;  1U49 A;  3ZT2 A;  4N76 A;  4BDY A;  3A2F A;  3EYZ A;  3AVJ A;  4FM1 A;  3PX6 A;  4R5P A;  3LP1 A;  4Q5V A;  3O3F A;  3CFP A;  2RF2 A;  2G8I A;  3OYG A;  2RN2 A;  3OYJ A;  4FJK A;  4FK0 A;  1HYS A;  3DRS A;  1ZBF A;  3DLB A;  4N5S A;  3DOL A;  3IAY A;  4ELT A;  3VQ7 A;  4CIG A;  3NH0 A;  4B08 A;  1ITG A;  2EHG A;  4CK3 A;  3VQC A;  1SL1 A;  2FBV A;  2QKB A;  1VSJ A;  3PO5 A;  1Q8I A;  4CF8 A;  4KI6 A;  4CJP A;  4DFP A;  4DLE A;  1BI4 A;  4CK2 A;  3VQE A;  2XY8 A;  3I0S A;  4AHT A;  1S6Q A;  4OGE A;  4KTZ A;  4DS4 A;  3LPT A;  4DTU A;  3QNO A;  4C8K A;  3HST B;  3TAM A;  1ASV A;  2XY5 A;  1LAW A;  2XO7 A;  3NGZ A;  2X6N A;  2HND A;  1QE1 A;  1SKW A;  2B6A A;  4M3U A;  1D5A A; 
#chains in the Genus database with same CATH topology
 3CJB A;  2WBN A;  5B8H A;  3MX5 A;  1SUQ A;  2NRX A;  1NGI A;  3EKU A;  1J5O A;  2ZE2 A;  3VGL A;  3V1O A;  1OH8 A;  4GV9 A;  2HF4 A;  4CF1 A;  1ZYQ A;  3QIC A;  4U7B A;  5AQX A;  2UUB K;  3KKS A;  2OZM A;  4BRO A;  5HRN A;  1NGE A;  2PFU A;  4MFB A;  4FLV A;  3WXI A;  3CXC M;  3R1X A;  1KVB A;  1HNX K;  4CZL A;  3NH1 A;  3PUF A;  5KGW A;  1WOQ A;  4NYN A;  4M42 A;  4H0X B;  3AVI A;  3VQ8 A;  4PL7 A;  4Z4I A;  3OYC A;  3JYT A;  1MDU B;  3T7Z A;  3LM2 A;  2E1Y A;  4YNQ A;  1ATR A;  3MWP A;  3V1R A;  5HOO A;  3ZSW A;  3KK7 A;  3THY B;  4B3S K;  3SBT A;  2G8K A;  3LAL A;  4ID1 A;  4CZM A;  4O0I A;  2F4V K;  1QQM A;  5GIO A;  1VK0 A;  4IFE A;  4FWK A;  1TYQ A;  1N33 K;  4H4M A;  4FWR A;  1RT5 A;  1NOY A;  4JI6 K;  3SV4 A;  5C2F A;  4JK8 A;  3MEG A;  4JKD A;  4FJI A;  3DLL L;  1NGC A;  4I7F A;  3W0L A;  1SV5 A;  2YNF A;  3L3V A;  2HHQ A;  1WSJ A;  4DTS A;  4WQ5 A;  2JLE A;  2D4W A;  4X62 K;  3PX0 A;  2A1R A;  4KH5 A;  2G8W A;  4BRK A;  1NM1 A;  1TUY A;  3V81 A;  3BZK A;  3EZW A;  4CCH A;  1G99 A;  2VG6 A;  1RCH A;  4EP5 A;  3L6Q A;  3AVN A;  2V7Y A;  4ZHR A;  3SAH A;  4X64 K;  4B3O A;  1RT1 A;  3LP2 A;  1XQS C;  4BRI A;  1S22 A;  2V7Z A;  3ZSR A;  4YOT A;  4V19 S;  3AVK A;  4Z4H A;  4KHU A;  2FBY A;  3SAG A;  3L2R A;  4FM2 A;  4FWQ A;  4CEQ A;  4KTQ A;  3M1F A;  3M8P A;  3V9U A;  4ICL A;  2YNI A;  1EQY A;  3N4Q A;  4RW8 A;  3LWL A;  1KAY A;  3J7Z O;  3VEV A;  3WNE A;  2G8V A;  1T03 A;  4FYD A;  3VEW A;  3CCS N;  3K5L A;  1HUX A;  1HJR A;  2HVH A;  1W9H A;  4BQZ A;  3T69 A;  2NRH A;  3UKR A;  2HBM A;  3PV8 A;  4C1N I;  3SYZ A;  1QHT A;  1S3X A;  3O5B A;  3AVL A;  5E84 A;  3TAG A;  4JKF A;  4DSI A;  4BRN A;  3J7Y P;  1VQO N;  2QWN A;  4DTM A;  4CFD A;  3OYM A;  5CYQ A;  3CCJ N;  3CPE A;  2P5G A;  4OO1 J;  4JRP A;  3ZT4 A;  2H3G X;  3MEE A;  1FKP A;  2QTD A;  2UUA K;  2ZWH A;  4FOI A;  4BRG A;  2FBT A;  3O4Q A;  4CJE A;  4CGI A;  4PHT X;  3HPH A;  1BCO A;  3TAR A;  3CIP A;  4FLY A;  4NB4 A;  4CHZ A;  1NG9 A;  5KRS A;  3OY9 A;  3LDL A;  4FWP A;  1DKG D;  1NJW A;  2UXB K;  3K57 A;  1NWK A;  1BOT O;  3OJS A;  2NZT A;  1X1P A;  4EZ9 A;  3MN7 A;  3SJH A;  3O08 A;  2OYQ A;  3HBT A;  1Q82 O;  3O1B A;  3KLG A;  4E7J A;  3AO3 A;  3AVH A;  4OPJ A;  2XRI A;  3UKR B;  3K5N A;  4BWM A;  3AGR A;  4DQS A;  3DLH A;  3U8X A;  4DR4 K;  2WFB A;  2HOE A;  2VGM A;  4HWI A;  3WQT A;  1DT9 A;  4BG9 A;  1BIU A;  3K58 A;  3SI6 A;  3FLC O;  1HRH A;  2P1J A;  1NK0 A;  1S1U A;  3LP3 A;  3AVA A;  2B5J A;  4EZ6 A;  5GAH P;  4HCC A;  3ENO A;  1BO5 O;  4RW6 A;  4MO5 A;  3HM9 A;  3NF9 A;  1S1V A;  3QEW A;  3O8M A;  4KHP K;  4PKG A;  3CFO A;  2E6L A;  2OPP A;  2NUB A;  3ZSQ A;  2YHA A;  3WUH A;  1NGA A;  3C0B A;  3QER A;  1NJI O;  5DMR A;  4FW2 A;  3DOK A;  4B1Z A;  3LAM A;  4JKE A;  4LFC K;  4Y0W A;  3KD5 E;  4NCG A;  3K5O A;  2IVO A;  3KVG A;  3L2V A;  2HHH K;  4N47 A;  3ZX0 A;  1U48 A;  1HYV A;  2FLO A;  4GV3 A;  4FLZ A;  3CME N;  4CEZ A;  4BRM A;  3AO4 A;  1A5X A;  4K43 A;  4YOR A;  2IDO A;  3F73 A;  1TAQ A;  4EAH D;  5KPR A;  4B9T A;  1BGX T;  3G0Z A;  3VQP A;  3OYF A;  1YHQ N;  1RDC A;  2QKK A;  3IFR A;  4JKG A;  4KAZ A;  3OYK A;  3CCE N;  4HUE A;  3V4I A;  2AP1 A;  5KGX A;  3CCQ N;  4WCE L;  2KFZ A;  2XY6 A;  1QSY A;  3H6E A;  3JSM A;  4A59 A;  4XEI A;  3HXM A;  1VQ9 N;  3SNN A;  1EP4 A;  1BWF O;  2A1S A;  5AQF A;  1W97 L;  2G8H A;  1Z05 A;  3LZJ A;  1C0U A;  3WEE B;  5C25 A;  3J8A A;  4LH4 A;  4KI4 A;  4CIF A;  2P9K A;  3CQY A;  4QAG A;  3CI5 A;  3L2W A;  3C6T A;  2KZZ A;  4DR2 K;  4EFH A;  2O4G A;  4FL9 A;  2O8B B;  2HNZ A;  2NRV A;  1VSL A;  4BGB A;  4CBU A;  3BP8 A;  3FZM A;  1YVU A;  3AO5 A;  2NLX A;  2IOC A;  2BDP A;  2QXF A;  3RR7 A;  1YIT N;  4CVN E;  1DTT A;  1B9D A;  3VEO A;  3NMU A;  4WFB L;  4CFC A;  1ATS A;  1CZ9 A;  4TSX A;  3KHY A;  4JI5 K;  2QM1 A;  4DQQ A;  4JI2 K;  5JVG L;  2E2N A;  4DV6 K;  3V9X A;  4RG8 A;  4LSL A;  5M1O A;  1KTQ A;  1ZXO A;  3SUN A;  3LL3 A;  4FCY A;  3M8Q A;  4BE2 A;  3T3F A;  4E1M A;  4BR0 A;  1BDG A;  4JKG B;  4PWD A;  1HNZ K;  1RGI A;  1SAZ A;  2YNG A;  4KV8 A;  4CEB A;  1XC9 A;  1QS4 A;  4DR1 K;  3CJA A;  4Z0U A;  2YV0 X;  1U45 A;  4JKB A;  4CI6 A;  3QBX A;  4DTX A;  2YCH A;  2E2O A;  2E6M A;  1S72 N;  1BG3 A;  5GAE P;  2HF3 A;  1U4B A;  1C0M A;  3R9P A;  3KJV A;  4CJ4 A;  3V9Z A;  2FSK A;  1QQC A;  2CH6 A;  1EWR A;  3VF2 A;  2P9K B;  2P9S B;  4BC4 A;  3EEQ A;  4JD2 B;  4JHD A;  3BEX A;  5I3U A;  1BQN A;  2AJQ A;  1D4X A;  2GBZ A;  4H5R A;  2DFF A;  3A5M C;  3P38 A;  4GY2 B;  4BR5 A;  4KHS A;  4U67 L;  4H4O A;  4H0V B;  3CM6 A;  4NYF A;  2Q1N A;  4YOX A;  4C8O A;  4RW4 A;  1Z25 A;  4ZTF A;  1J54 A;  4FWS A;  1NMN A;  1RBS A;  1QQN A;  3QEX A;  1JLA A;  1UOC A;  4M3Z A;  4PA1 A;  4IG3 A;  1QQO A;  5M1F A;  3CHW A;  4B9L A;  4KO0 A;  1IG8 A;  4KRE A;  1UWB A;  1XI1 A;  4CGF A;  2YI1 A;  3WNH A;  4M7Y A;  1WUA A;  1RDA A;  4R79 A;  3VN5 A;  4DSF A;  4K0K K;  3ZT2 A;  3AVJ A;  5KPZ A;  2A41 A;  4Q5V A;  3O3F A;  2RF2 A;  1Q7Y O;  5GAG P;  5EX5 A;  3OYG A;  3OYJ A;  3FGU A;  4M7X A;  3DLB A;  4H5T A;  3IAY A;  4DV1 K;  4CIG A;  1ITG A;  2WC9 A;  2FBV A;  1VSJ A;  5I9E B;  1Q8I A;  1MA9 B;  1ZC6 A;  4JHD B;  4CJP A;  3G6E N;  1BI4 A;  4CK2 A;  4DLE A;  4AHT A;  3I0S A;  1S6Q A;  4KTZ A;  3HST B;  1ASV A;  5AQJ A;  1M90 O;  2XO7 A;  3RSE B;  2X6N A;  2HND A;  4H0Y B;  2B6A A;  1D5A A;  4X66 K;  3SQ1 A;  4W5O A;  4CEF A;  4N56 A;  3BZC A;  3LZI A;  4FWM A;  1U2V A;  3O6W A;  4DSE A;  3VQD A;  1K9M O;  1RDW X;  3D7E O;  3DLG A;  4FJH A;  1WNS A;  4IOX A;  5AQS A;  5KTQ A;  4DU4 A;  2QWP A;  3VQA A;  4C23 A;  3OYI A;  4DLG A;  3T1Y K;  1VQL N;  4FPA A;  3DI6 A;  3NGI A;  3DXK B;  4MQ3 A;  3HP6 A;  4FO0 A;  3SCX A;  4BVO A;  3M8R A;  4MDB A;  3AVG A;  1WN7 A;  2E8A A;  3VF4 A;  5JLH A;  1JCG A;  4BGA A;  2HHU A;  1VAZ A;  1FW6 A;  4FK2 A;  4CJ5 A;  2KKZ A;  1RT3 A;  1P8Z A;  1IKV A;  1FXX A;  2Q97 A;  5TKY A;  1ZBS A;  4KRF A;  1E4F T;  5C10 A;  3SJJ A;  1NK5 A;  1U47 A;  1Q9Y A;  5HL7 L;  3NBP A;  3TI0 A;  4IFV A;  4AF1 A;  4JS4 A;  4AHV A;  5J2M A;  2RE2 A;  4CGJ A;  2D5R A;  1IKW A;  1BI4 B;  3M6G A;  1XHZ A;  1X9M A;  1GLB G;  4O55 A;  1JCF A;  3QO9 A;  2E5L K;  3VQQ A;  4XIU A;  4WQ4 C;  4HVJ A;  4OVL A;  2KTQ A;  1NK8 A;  4PY5 A;  1X9J A;  3O9R A;  4FLW A;  5HRR A;  1HPM A;  4YOY A;  3IDH A;  1YI2 N;  4IG0 A;  2PYJ A;  3MDQ A;  3C6U A;  3Q7B A;  4W5T A;  2XHB A;  1NOZ A;  4CGG A;  4FJJ A;  4QS9 A;  4LF9 K;  4FK4 A;  5JIC A;  1VQN N;  4K25 A;  4E7H A;  5FPE A;  4CJW A;  1O1W A;  2ZD1 A;  4OPK A;  4NXM K;  1SL0 A;  3MN6 A;  1NK4 A;  3CCM N;  4A2A A;  1XHX A;  5CE3 A;  3L8B A;  1B92 A;  2P9U B;  3F9K A;  1JCE A;  4F3O A;  5FRN A;  4BRL A;  2F8S A;  4BE0 A;  1KLM A;  3H46 O;  3ITH A;  4FZY A;  3KTQ A;  3HOT A;  1TV6 A;  3KKR A;  2CGK A;  3H45 C;  1KVA A;  1JKH A;  4DB3 A;  3SK3 A;  4I2P A;  1OH6 A;  2FC0 A;  3AA2 A;  3KD1 E;  4AQY K;  4A61 A;  2WOM A;  3SBG A;  3THY A;  3CC2 N;  4BE1 A;  4AHR A;  3RR8 A;  4F9O A;  3ZT0 A;  2GEL A;  2HHT A;  3C95 A;  4DUZ K;  4IEI A;  2QW9 A;  5LMU K;  5FLX O;  2HST A;  1VSE A;  1JJ2 M;  3CC4 N;  4DTP A;  2HHX A;  1K6Y A;  4DF8 A;  4H8K A;  2UYT A;  4AHC A;  2P9L B;  5M1K A;  3SQ2 A;  3ISN C;  2F7T A;  4DV4 K;  2HBL A;  3ZLJ A;  3QB0 A;  3VA3 A;  4IWV A;  2JWL A;  4QOZ B;  4ILJ A;  4DSJ A;  2KQ2 A;  5AQQ A;  3T1A A;  2PBD A;  2Z1G A;  1C6V A;  4RTF D;  4CJK A;  4DHY A;  1W0H A;  5IWA K;  5AFU A;  5HRS A;  2P9I B;  4KH6 A;  1D9D A;  4BR4 A;  3ID6 A;  3D2E A;  1A5V A;  4CJL A;  1WSF A;  3F5T A;  4AHS A;  4FZZ A;  3CC7 N;  2V52 B;  4F2R A;  1HQE A;  2QWL A;  4QS8 A;  5IT9 O;  2GTD A;  2YHW A;  5AQT A;  3SUP A;  2Z1H A;  5KQ8 A;  1RTH A;  1RT6 A;  3J81 O;  3TTF A;  4Z4E A;  1VQ6 N;  5BR9 A;  2P9P A;  4MO4 A;  2QI2 A;  3AA3 A;  3PY8 A;  2F96 A;  3UIQ A;  3WXK A;  1NK9 A;  3RMA A;  1TL1 A;  4FK0 A;  1D9F A;  4CZK A;  3OYH A;  3NAE A;  1VSK A;  1S1W A;  1NGF A;  1SKR A;  3VGM A;  4Z94 A;  4FJX A;  5F2R A;  4DCH A;  1YF5 L;  1JXE A;  1TKT A;  1LWC A;  3PX4 A;  3VEX A;  3ZT1 A;  2P51 A;  5EOY A;  4FOE A;  3ZYY X;  1RIL A;  1GLJ O;  3NF6 A;  3H1V X;  3CER A;  3DYA A;  3JS6 A;  4GVE A;  4F2S A;  4L8R B;  1MWK A;  1C1A A;  4OLB A;  1GOB A;  3LAN A;  4MLH A;  2ETJ A;  1XMO K;  3HYF A;  3DRR A;  4CZG A;  3ZSZ A;  4DQI A;  3NDK A;  3ZX3 A;  4B9U A;  4CZH A;  2OTJ N;  3I0R A;  4M45 A;  3AA5 X;  3D2E B;  4JLH A;  4JKC A;  3HP9 A;  3IUC A;  2YHY A;  1HPZ A;  1WB9 A;  4CJQ A;  2FF6 A;  3VQB A;  4N41 A;  1EWQ A;  2PZS A;  5AQY A;  3A8Y A;  2BH1 A;  4O8U A;  2P9P B;  3MED A;  1QSS A;  1SS6 A;  4E89 A;  1NGD A;  3AVF A;  4CEA A;  4UQG A;  3E01 A;  4FJ9 A;  3ASM A;  1L5U A;  1NGH A;  3CJC A;  1IG9 A;  4KHW A;  1IBM K;  1HNV A;  3H1Q A;  4XH1 A;  4CJU A;  5LJV A;  1CZA N;  1GLL O;  4O44 A;  4JK7 A;  3HK2 A;  4CES A;  3H08 A;  1T6C A;  4H03 B;  3EN9 A;  3HJF A;  4LY7 A;  1YJW N;  1JLB A;  1T7P A;  4ISG A;  3TAN A;  2KZM A;  5BPL A;  3OYA A;  2GX9 A;  2OPS A;  4KI6 A;  4LSN A;  3OYN A;  3MXJ A;  4HUF A;  2UUC K;  4PL8 A;  1GLC G;  2UU9 K;  1RDB A;  4DG1 A;  1LWE A;  3ZSY A;  4CGD A;  3CJ9 A;  2EX3 A;  1WAF A;  2E2Q A;  1IKX A;  1L3S A;  3RWU A;  4JS5 A;  2QWQ A;  1FKO A;  2A40 A;  4BRC A;  4CHO A;  4HUG A;  3TAP A;  4J2D A;  2O8F B;  4CFB A;  1S9G A;  4K42 A;  3S3N A;  2ASM A;  3GBT A;  3KLI A;  3KK3 A;  3SLC A;  2BE2 A;  3E66 A;  3TAB A;  3HPO A;  5J2Q A;  4KHY A;  4NO7 A;  3VMF B;  3VOV A;  5HLF A;  3OBY A;  4G9Z A;  1C1C A;  1VQ8 N;  2O8D A;  3NHG A;  3QML A;  4AM7 A;  5AZJ B;  1UAX A;  5D3G A;  2HMI A;  5ELZ A;  4DF4 A;  4BRF A;  1KQS M;  3VQ9 A;  4LH5 A;  5ADX A;  4DMN A;  2YX6 A;  2ZJQ L;  1T05 A;  3ZSX A;  1JLQ A;  3SQ4 A;  1OVQ A;  3MXM A;  4J2E A;  2AA4 A;  4HTU A;  1MWM A;  2GUP A;  1YIJ N;  1K8K B;  1RBR A;  3KK1 A;  4HHT A;  4M3X A;  1Q81 O;  3WEE A;  4CJS A;  4E0D A;  4GKK K;  1TKZ A;  1N32 K;  2VCP A;  2W6L A;  2HHV A;  1L3U A;  1GLE G;  5I42 A;  5AQW A;  5BN9 A;  3L3U A;  1IBL K;  1TL3 A;  4XH4 A;  2J4R A;  2O8B A;  3ZX2 A;  5BN8 A;  5AQM A;  3DWL A;  4DR5 K;  1L3T A;  4CW7 B;  1QTM A;  4FLX A;  3QEV A;  3MN5 A;  3O1W A;  2OAN A;  4IOC L;  4DTR A;  4BRD A;  2FSN A;  3L0Q A;  1GLD G;  3EY1 A;  5LY3 A;  3I56 N;  2I7P A;  3C6H A;  2BUP A;  5HRP A;  2IS3 A;  3CJ7 A;  5LJW A;  3BUZ B;  1I39 A;  3ZCM A;  2IVP A;  3B6P A;  2O8D B;  3K5M A;  5M1P A;  3U3G A;  3ENB A;  4CJT A;  2OCE A;  2A5X A;  4E1J A;  5CY4 A;  4DUY K;  1U49 A;  2QWR A;  3MN9 A;  3A2F A;  3N4P A;  4BC5 A;  4LFA K;  4R5P A;  3LP1 A;  2G8I A;  3AAR A;  3FR0 A;  3DRS A;  1ZBF A;  4ELT A;  4BR2 A;  5KPT A;  4ISF A;  4CK3 A;  4CD3 A;  1GLA G;  1SL1 A;  2W40 A;  4H5V A;  3PO5 A;  4WQ4 A;  4IO8 A;  3JAM O;  3S41 A;  4DTU A;  3QNO A;  4OGE A;  3LPT A;  3VPZ A;  1QVF M;  4C8K A;  3TAM A;  2P9S A;  3OHR A;  4I6M A;  2GWJ A;  2RHK A;  4JD2 A;  3VET A;  3O9T A;  3CPW M;  2ZM6 K;  4JN4 A;  2Q0R A;  1QSL A;  4LF6 K;  3AGK A;  2HHW A;  1W2B M;  3LPU A;  1SL2 A;  1HMV A;  2Y1J A;  1IH7 A;  3D45 A;  4CJ3 A;  1IBK K;  2OZS A;  2X6S A;  2PYL A;  1C0T A;  4JNE A;  1U6Z A;  3RRH A;  2CH5 A;  1RT4 A;  4DU3 A;  3THX B;  3PIP L;  3SMP A;  4H0T B;  3W3D A;  2X74 A;  3T1H K;  4DV3 K;  3HO1 A;  3O4W A;  1RTJ A;  4AM6 A;  1WLJ A;  4Z4F A;  4IFY A;  5AQI A;  1U04 A;  4DSK A;  2R7Y A;  2DFH A;  3IG1 A;  5J2P A;  3TR8 A;  1YAG A;  3PSF A;  3I55 N;  5FRM A;  1T8E A;  1KAX A;  5FDL A;  4GMJ B;  3MAQ A;  4RCH A;  3T19 A;  1EX4 A;  4I6M B;  4E1N A;  5MLC Q;  4B1Y B;  4FJL A;  3A5L C;  1I94 K;  3CCL N;  4ELV A;  1S1X A;  2IIR A;  2A42 A;  1N8R O;  4BR7 A;  3RSE A;  1J9A A;  4PKI A;  2QK9 A;  4GNI A;  2QA4 N;  3VQ4 A;  3WXM B;  3OBW A;  4BC3 A;  4IDK A;  1BA1 A;  2D0O A;  2Q2R A;  2F8T A;  1JLE A;  3O9S A;  4O5F A;  4JI0 K;  4GV6 A;  4DFK A;  3CCV N;  4DV2 K;  1BHL A;  3L2U A;  4HCB A;  2HVI A;  1HYZ A;  3K59 A;  2DY4 A;  4BC2 A;  3K2P A;  3DXK A;  1TKX A;  3OYB A;  3K9J A;  4ZTJ A;  1LWF A;  2E4L A;  2Q31 A;  1XWL A;  3U3Y A;  4KH4 A;  1MU2 A;  4KFB A;  2VQF K;  1XC3 A;  3TU5 A;  1T44 A;  2E20 A;  4Y1D A;  3K9K A;  1C0G A;  3TAQ A;  1DEJ A;  5AQO A;  1X9S A;  2KW4 A;  4OKK A;  2Y1I A;  1TK8 A;  2D0C A;  3HM8 A;  4C8L A;  5AJ3 K;  1TKD A;  3VES A;  4G1Q A;  3AAP A;  3KWG A;  3NFA A;  1ASU A;  3OYE A;  1JLF A;  2YHB A;  3S9H A;  3EO3 A;  1RBV A;  4XH5 A;  3CCR N;  3QEI A;  2HW3 A;  4RW7 A;  1I3A A;  5FPM A;  2NRZ A;  3I8D A;  3UB5 A;  1NK6 A;  4I9L A;  4AIL C;  3D6R A;  2D0A A;  3HTV A;  4B1X B;  5AQG A;  2B4J A;  3G10 A;  3HI0 A;  2FXU A;  4M41 A;  1YTU A;  1T3V A;  2HBK A;  3CM5 A;  3U9D A;  3U4L A;  2GWK A;  3ALY A;  3KLF A;  1ZBL A;  3HL8 A;  3GL1 A;  1HNI A;  1ZBH A;  1XMQ K;  5CZ1 A;  2IVN A;  4IJN A;  5AQP A;  1VRU A;  1HNW K;  1V4S A;  3LM9 A;  4E7K A;  1HLU A;  1ILY A;  4CED A;  2HMP A;  1KLN A;  1TGO A;  4FXD A;  1YJN N;  2YJF A;  1N5Y A;  3DLE A;  1JXB A;  2P9U A;  3THW B;  1LCU A;  5GIP A;  3EKS A;  4CBX A;  3O80 A;  5C0Y A;  3QIO A;  4YFU A;  4NCA A;  3PSI A;  5BPM A;  3CF5 L;  1V4T A;  4J2B A;  1R59 O;  5HBM A;  1J53 A;  4ISE A;  3AVC A;  1VSH A;  2NRR A;  4DQP A;  2ASO A;  1EXQ A;  2I5J A;  5AQV A;  3KK2 A;  4FWL A;  4DTJ A;  3ZEU B;  5H1S Q;  3WT0 A;  4C8N A;  3DLK A;  3SV3 A;  3OVN A;  4AH9 A;  3SPZ A;  4QS7 A;  4Q0B A;  3HT3 A;  2P9L A;  3JXU A;  4F4K A;  4CGH A;  3V1Q A;  3QFP A;  4IDH A;  1NJZ A;  3THV A;  1NGG A;  4IJA A;  3UE5 A;  3VQ5 A;  3QNN A;  2ASP A;  4B9S A;  1H1V A;  4KHN A;  1REV A;  4DU1 A;  1KC8 O;  5GAD P;  3TAE A;  4M63 C;  3OW2 M;  4J2A A;  4CF0 A;  2O4I A;  4DV0 K;  1Z6R A;  1YUW A;  4F8R A;  3FZH A;  1HKG A;  4EHU A;  1JLG A;  4KHQ A;  3OTO K;  5HP1 A;  4Z4C A;  3EZ5 A;  2P9I A;  4B1V A;  2F9T A;  3D2F B;  4JKA A;  3L2Q A;  5BRF A;  2VWJ A;  4OKJ A;  2O8C B;  1N36 K;  5BR8 K;  5CHI A;  1CXU A;  5FPD A;  1LOT B;  5AZI A;  1CLQ A;  1IKY A;  4CHY A;  1BL3 A;  3EE8 A;  5JS2 A;  5CYM A;  1R0A A;  2VYP A;  4L3Q A;  4FJM A;  4MDA A;  3MEC A;  3BY5 A;  4FJ7 A;  3FFI A;  4YOW A;  1BU6 O;  4M3W A;  1J5E K;  1O13 A;  4JAX A;  4LD0 A;  3SZ2 A;  2IC3 A;  4A5B A;  4JI1 K;  1SKS A;  3DLR A;  4CJ7 A;  4LF8 K;  5DK5 A;  4QCL A;  4DR3 K;  3V9W A;  3HPG A;  4O0J A;  1FK9 A;  3HSC A;  2WUS A;  3SAF A;  1D8Y A;  1E4G T;  2BTF A;  3WNF A;  3RMC A;  2D1K A;  2D0B A;  2WON A;  4FSV A;  4O8K A;  2YNH A;  1Y97 A;  1S1T A;  5AQZ A;  2WTU A;  4BRA A;  3ATU A;  2VQE K;  3EE9 A;  1RT2 A;  4IZ9 A;  4NLC A;  4W5Q A;  3MCP A;  4E19 A;  3WXL A;  3E9P A;  4KB1 A;  3AO1 A;  2W42 A;  4K41 A;  3CQ8 A;  3C7N B;  5JLF A;  1K8A O;  5AQN A;  5JVH L;  5DM7 L;  5AZI B;  4FPB A;  5J2N A;  5J1E A;  4FZX C;  4ELU A;  1TAU A;  3B6O A;  1BIS A;  4BAC A;  3WXJ A;  2VWK A;  1NBW A;  2JGU A;  1RBT A;  4GW6 A;  1SZ2 A;  4IKF A;  3DJC A;  3OYL A;  1C0F A;  3NH2 A;  1RTI A;  1RNH A;  4AHU A;  5EXW A;  4M3T A;  1NNE A;  2IAJ A;  1BIZ A;  1OKJ A;  2ZJP L;  2O8E A;  3C65 A;  3OJU A;  1S5J A;  4RW9 A;  3QIP A;  4H5N A;  4B9V A;  3AO2 A;  3UKU B;  4BR9 A;  3PO4 A;  5BRH A;  2YKM A;  3ZET B;  4B9M A;  2YJE A;  4CHP A;  4OPH A;  2F9W A;  4M3R A;  4W5R A;  3IMX A;  3L4Q A;  1HQU A;  4C1N K;  4KKO A;  1NJX A;  3CQX A;  3I33 A;  3E9O A;  4E7L A;  4YDU C;  4CEE A;  1KSP A;  3IKM A;  1LV5 A;  4CER A;  1TUU A;  1IV0 A;  1WSE A;  5AQK A;  3C94 A;  4BRH A;  1RDU A;  2GEM A;  4EIA A;  1WBD A;  3G71 N;  2FBX A;  3LP0 A;  2O8F A;  4I9Q A;  1KFS A;  1HJO A;  3L4I A;  3ZSO A;  1KXP A;  4CBW A;  3AV9 A;  4DS5 A;  2P9N A;  3VA0 A;  4JI3 K;  3HOS A;  4JKH A;  3O9U A;  3ENH A;  4ID5 A;  1EKE A;  4W5N A;  4CD1 A;  3AVM A;  1YTA A;  4JYA K;  2O8E B;  4WYB A;  4BDY A;  1Q86 O;  1XNQ K;  2QWM A;  3M5R A;  5A2Q O;  3NVK A;  4PKH A;  3CFP A;  5AZJ A;  3A0I X;  2RN2 A;  1NGJ A;  1NMD A;  4FJK A;  3TTD A;  3VQ7 A;  3NH0 A;  3GOI A;  2EHG A;  3VQC A;  2ZJR L;  2QKB A;  1TYQ B;  3ULE A;  5C2D A;  3CCU N;  3M3Z A;  4H0P A;  3VQE A;  1HX1 A;  3Q7C A;  3AY9 A;  1K8K A;  1QE1 A;  1SKW A;  4LC9 B;  4M3U A;  2OTL N;  3LWM A;  4LF7 K;  3P1G A;  3U6F A;  3G25 A;  2HHS A;  4IOA L;  3RMB A;  3P4I A;  4BVP A;  2NRT A;  4YOU A;  4CZI A;  2KHO A;  3IS9 A;  3LDQ A;  4WE1 A;  3M8S A;  3SQ0 A;  5SZT A;  1VSI A;  1F21 A;  1CZB A;  1SQK A;  2P9N B;  3LDS A;  1WSG A;  3E1Y A;  3O9Q A;  4KPY A;  3U9Z A;  3PIO L;  3VEZ A;  4B1U B;  1WAJ A;  1VSD A;  4FVM A;  1ZBI A;  2ATQ A;  4B8C A;  2OA8 A;  4JI8 K;  2XY7 A;  3AAQ A;  4MLE A;  2KFN A;  1RBU A;  3F2K A;  3O3G A;  5HRO A;  4HTL A;  1VSM A;  3ULE B;  3J7A P;  3VQ6 A;  4A2B A;  4BRP A;  3QDK A;  1M1K O;  1NKE A;  4F3T A;  3ID8 A;  1VQ5 N;  3H3N O;  5BRD A;  4IBN A;  3V6D A;  1UA0 A;  1NK7 A;  3TTC A;  4CEO A;  2VG7 A;  3DM2 A;  5E26 A;  1RDD A;  4ILH A;  1X9W A;  4GKJ K;  1NJY A;  2GV9 A;  2KLA A;  3NCI A;  3HRG A;  4ILG B;  3TSU A;  2LSN A;  3IRX A;  1LAV A;  4FWN A;  2OPQ A;  1ASW A;  1E3M A;  4O5B A;  5C15 A;  2PY5 A;  4DR6 K;  1OVY A;  3C6A A;  1KRP A;  3OS0 A;  1OH5 A;  4JI4 K;  3VTI A;  5F1X A;  1DLO A;  5AQU A;  1S6P A;  3QET A;  3VEN A;  4JI7 K;  4B3M K;  3MXI A;  3VER A;  4WF9 L;  2RPI A;  1G15 A;  3THX A;  3OS2 A;  4NXN K;  5F0X A;  4CJR A;  3MMV A;  5CR4 A;  4DTN A;  4WFA L;  4CK1 A;  5KI6 A;  5GIN A;  3TSQ A;  2W41 A;  1FJG K;  1NU0 A;  4LF5 K;  1IJJ A;  1EO1 A;  5CZ2 A;  5EVZ A;  3BF1 A;  4CF9 A;  2BAN A;  5JMV A;  3MK6 A;  1IO2 A;  3TAF A;  4Z4G A;  1QZ6 A;  3RRG A;  1KFD A;  5FPN A;  3CD6 N;  4B3T K;  2HBJ A;  5C42 A;  2Z1J A;  4FJG A;  4CJF A;  4FW1 A;  1XUP O;  1DGK N;  2D0P A;  4YOV A;  3R3L A;  2QEX N;  4FJN A;  5K14 A;  5BPN A;  5AFU H;  3SMS A;  4CHN A;  4CEC A;  2UXD K;  1Y64 A;  2FSJ A;  1ESV A;  4WFN L;  1KVC A;  4CJV A;  5JS1 A;  1QZ5 A;  3D0P A;  3LDP A;  4DQR A;  3WQU A;  4O4G A;  4BQL A;  4WQ5 C;  1VQM N;  3QIN A;  5AR0 A;  4DTO A;  3NF7 A;  3DXM A;  4B9N A;  2I7N A;  3KIO A;  4IO9 L;  1BA0 A;  2P5O A;  1VSF A;  3CMA N;  3VGK A;  3QLH A;  2CGJ A;  3EL2 A;  5KQD A;  4FVU A;  2QWO A;  4FM0 A;  3AA4 A;  2BGG A;  4DQ8 A;  2PAV A;  5M1Q A;  4JEP A;  3FE1 A;  4GVM A;  2Q0U A;  3K0S A;  4BDZ A;  3SPY A;  2Q3S A;  2HNY A;  1EET A;  1WSI A;  4H0O A;  3TPQ A;  1BQM A;  3NVM A;  4CIE A;  4FJ5 A;  3QEP A;  2DFE A;  4IXC A;  4PQU A;  3A5O C;  3R8E A;  4BWJ A;  2NRW A;  2G8U A;  1JLC A;  4CFA A;  4E3S A;  2CGL A;  3CET A;  4A62 A;  3ATV A;  5KRT A;  1KD1 O;  3HVT A;  2ZQB A;  1WSH A;  4OX9 K;  3KLH A;  1XNR K;  1VHX A;  4PUO A;  4OGC A;  1NKB A;  1TK0 A;  3DRP A;  5FRO A;  1QVG M;  3MWT A;  3O4N A;  4BRQ A;  1HR0 K;  3BGR A;  3QES A;  3RTV A;  5AQR A;  1RTD A;  4KB0 A;  1JL2 A;  3DXM B;  3ULD A;  1VQ7 N;  3OS1 A;  2HB5 A;  4OLA A;  4FLU A;  2FF3 B;  2ITG A;  2RKI A;  3P5J A;  5EU7 A;  1J6Z A;  5T7B A;  3O3H A;  3J80 O;  3V9S A;  1YT3 A;  2OPR A;  4OPA A;  1X3M A;  4FWO A;  3THW A;  2V51 B;  1A5W A;  1L3V A;  3LAK A;  1VQ4 N;  3VF6 A;  3CFR A;  1KCF A;  4DWI A;  1BCM A;  4H5W A;  5AQL A;  4CF2 A;  3KZB A;  1YJ9 N;  1VQK N;  1ZBU A;  3S3M A;  4B3R K;  3H3O B;  4OKE A;  3PLA A;  2YHX A;  4JK9 A;  4IEE A;  3LDO A;  2IGI A;  3FFK B;  1ATN A;  1GOA A;  3GDQ A;  4A5A A;  3HVR A;  4J8F A;  1TK5 A;  1HKC A;  2DTU A;  3ZEU A;  1W7A A;  1QHA A;  1K73 O;  4LF4 K;  3CJ1 A;  1CXQ A;  5M1N A;  2ZF5 O;  4DFJ A;  3OYD A;  3KLE A;  1UA1 A;  3NF8 A;  4JV5 K;  2Z1I A;  1DTQ A;  4YDU A;  3BF3 A;  3DAW A;  4K8Z A;  1NLV A;  4I2Q A;  3DMJ A;  3TSP A;  5DM6 L;  1GOC A;  2X78 A;  2ITM A;  3GG4 A;  3P39 A;  4B9Q A;  3I8B A;  1YVN A;  3S3O A;  1P90 A;  4FLT A;  1C1B A;  4JRQ A;  1N34 K;  2DPN A;  4B1W B;  4BRE A;  5ADX H;  3VTH A;  1Z26 A;  3E9L A;  1NGB A;  2GUI A;  3D2F A;  2E1Z A;  4B8A B;  4BDP A;  2VG5 A;  2VWB A;  2O8C A;  1OH7 A;  2ZGZ A;  2E2P A;  2A3Z A;  4DFM A;  1S9E A;  3MX2 A;  3SUQ A;  3RMD A;  1Q9X A;  2UXC K;  5AQH A;  3FZK A;  2ZGY A;  4C8M A;  4NCB A;  3NE6 A;  4Y1C A;  4DV7 K;  4K8X A;  3LDN A;  3FZF A;  3FZL A;  5BRE A;  5EY4 A;  4CHQ A;  2E88 A;  3VEY A;  4KTW A;  5C24 A;  3WNG A;  4DSL A;  3NGY A;  3B8A X;  4FJ8 A;  4LFB K;  3CG7 A;  4DKW A;  4DV5 K;  4EHT A;  4KBO A;  2YKN A;  4CE9 A;  3A5N C;  3AVB A;  4NLB A;  3ZT3 A;  2NNW A;  5SWM A;  1TVR A;  2QXL A;  3ZSV A;  4RWT A;  4E7I A;  3R6M A;  1U2V B;  1NKC A;  3BDP A;  1LW2 A;  4M3Y A;  4YY3 K;  1WBB A;  1RT7 A;  1KAZ A;  1LW0 A;  1RFQ A;  2JWK A;  1JL1 A;  3TWH A;  3HZ6 A;  4DR7 K;  1VRT A;  4CZE A;  5TKW A;  1Q18 A;  3C7N A;  3KWI A;  3QFU A;  3P31 A;  3OA9 A;  5E41 A;  4CZJ A;  1N6Q A;  4EP4 A;  4A57 A;  2EWS A;  3QBW A;  4BY9 C;  3P83 D;  3CYM A;  3SUO A;  1B9F A;  4OJR A;  4N76 A;  3EYZ A;  4YHH K;  5LMN K;  5LL6 Z;  4BG8 A;  3GE1 A;  4FM1 A;  3PX6 A;  2Q36 A;  3G4S N;  4X65 K;  1BUP A;  1HYS A;  1HKB A;  4N5S A;  3DOL A;  4B08 A;  3UKU A;  1GLF O;  3RVC A;  4CF8 A;  4UY8 O;  4DFP A;  2W6K A;  3MCA B;  2XY8 A;  2A6A A;  1VQP N;  4DS4 A;  5C12 A;  4CZF A;  1YXQ A;  2XY5 A;  1T6D A;  3ZET A;  1LAW A;  3NGZ A;  2VGN A;  2G8F A;  1X3N A;  3F9M A; 
#chains in the Genus database with same CATH homology
 3SQ1 A;  4W5O A;  3LWM A;  4CEF A;  1SUQ A;  4N56 A;  3P1G A;  1QSL A;  3U6F A;  3LZI A;  2HHW A;  1J5O A;  2HHS A;  2ZE2 A;  3RMB A;  4DSE A;  3VQD A;  3LPU A;  1SL2 A;  1HMV A;  2Y1J A;  1IH7 A;  3D45 A;  3V1O A;  4CJ3 A;  2OZS A;  2X6S A;  3DLG A;  2PYL A;  1C0T A;  4FJH A;  1WNS A;  3RRH A;  5KTQ A;  4CF1 A;  4DU4 A;  1ZYQ A;  3IS9 A;  3VQA A;  3OYI A;  4DLG A;  1RT4 A;  4DU3 A;  3DI6 A;  4WE1 A;  3M8S A;  3NGI A;  3KKS A;  3SQ0 A;  2OZM A;  4MQ3 A;  3HP6 A;  5SZT A;  1VSI A;  3SCX A;  5HRN A;  1F21 A;  2X74 A;  4MFB A;  3M8R A;  4FLV A;  1CZB A;  3AVG A;  1WN7 A;  3LDS A;  1KVB A;  1WSG A;  2HHU A;  3NH1 A;  3PUF A;  4KPY A;  5KGW A;  3HO1 A;  4FK2 A;  4CJ5 A;  4NYN A;  1RT3 A;  1RTJ A;  1WAJ A;  1VSD A;  1WLJ A;  4M42 A;  4FVM A;  4IFY A;  1IKV A;  1U04 A;  1FXX A;  3AVI A;  2ATQ A;  3VQ8 A;  4Z4F A;  1ZBI A;  4KRF A;  4Z4I A;  3OYC A;  3JYT A;  4B8C A;  3SJJ A;  1U47 A;  1NK5 A;  2R7Y A;  1Q9Y A;  2OA8 A;  4DSK A;  2DFH A;  2XY7 A;  3IG1 A;  5J2P A;  3NBP A;  2KFN A;  3TI0 A;  3TR8 A;  4IFV A;  4JS4 A;  1RBU A;  4AHV A;  5J2M A;  3O3G A;  4YNQ A;  4CGJ A;  2D5R A;  5HRO A;  1VSM A;  5FRM A;  3V1R A;  1IKW A;  3ZSW A;  1T8E A;  3VQ6 A;  1BI4 B;  5FDL A;  1XHZ A;  2G8K A;  1NKE A;  4F3T A;  3LAL A;  4GMJ B;  4ID1 A;  4O0I A;  3MAQ A;  1X9M A;  4IBN A;  3V6D A;  1VK0 A;  4O55 A;  1UA0 A;  3T19 A;  1EX4 A;  4E1N A;  1NK7 A;  3QO9 A;  4CEO A;  2VG7 A;  4H4M A;  3VQQ A;  4FJL A;  4XIU A;  4ELV A;  3DM2 A;  1RT5 A;  1NOY A;  1S1X A;  4HVJ A;  4OVL A;  2KTQ A;  1RDD A;  1NK8 A;  1X9W A;  3SV4 A;  1NJY A;  2GV9 A;  1J9A A;  3MEG A;  4FJI A;  4PY5 A;  3NCI A;  4FLW A;  2QK9 A;  4I7F A;  5HRR A;  1SV5 A;  2YNF A;  3L3V A;  2LSN A;  3IRX A;  3VQ4 A;  1LAV A;  2HHQ A;  4IG0 A;  1WSJ A;  4IDK A;  2PYJ A;  2OPQ A;  4DTS A;  1ASW A;  3C6U A;  4W5T A;  2F8T A;  1JLE A;  1NOZ A;  4CGG A;  2JLE A;  4O5B A;  2XHB A;  2PY5 A;  4FJJ A;  4DFK A;  3PX0 A;  4FK4 A;  2A1R A;  1KRP A;  3OS0 A;  2G8W A;  4E7H A;  4CJW A;  1O1W A;  2ZD1 A;  4OPK A;  1BHL A;  1DLO A;  1S6P A;  3L2U A;  3QET A;  3V81 A;  4HCB A;  3MXI A;  4CCH A;  2HVI A;  1HYZ A;  1SL0 A;  2RPI A;  3K59 A;  1G15 A;  1NK4 A;  2VG6 A;  3OS2 A;  2DY4 A;  3K2P A;  1RCH A;  1XHX A;  4EP5 A;  3L8B A;  1B92 A;  1TKX A;  4CJR A;  3OYB A;  3AVN A;  4ZTJ A;  3F9K A;  1LWF A;  4DTN A;  2E4L A;  4ZHR A;  4CK1 A;  5KI6 A;  2G8F A;  4F3O A;  1XWL A;  3U3Y A;  4B3O A;  1MU2 A;  1RT1 A;  3LP2 A;  5FRN A;  4KFB A;  2F8S A;  5CZ2 A;  4BE0 A;  3ZSR A;  4CF9 A;  1KLM A;  2BAN A;  3ITH A;  4FZY A;  4Y1D A;  3AVK A;  4Z4H A;  3KTQ A;  4KHU A;  3TAQ A;  1X9S A;  2FBY A;  2KW4 A;  3L2R A;  1IO2 A;  4FM2 A;  4OKK A;  3TAF A;  2Y1I A;  4Z4G A;  4CEQ A;  4KTQ A;  3RRG A;  1TV6 A;  3KKR A;  1KFD A;  1TK8 A;  1KVA A;  1JKH A;  3M8P A;  2D0C A;  5C42 A;  3V9U A;  4ICL A;  4C8L A;  4I2P A;  2Z1J A;  2FC0 A;  2YNI A;  1TKD A;  4G1Q A;  3AA2 A;  4RW8 A;  3LWL A;  3NFA A;  3KD1 E;  4FJG A;  4CJF A;  2WOM A;  1ASU A;  3RR8 A;  3OYE A;  4BE1 A;  4AHR A;  4FW1 A;  3WNE A;  1JLF A;  3ZT0 A;  2YHB A;  2G8V A;  3C95 A;  3S9H A;  1T03 A;  4FYD A;  2HHT A;  1RBV A;  3K5L A;  1HJR A;  1VSE A;  4FJN A;  5K14 A;  1W9H A;  2HVH A;  4DTP A;  3QEI A;  2HW3 A;  2HHX A;  1K6Y A;  4RW7 A;  1I3A A;  4DF8 A;  4CHN A;  4CEC A;  3I8D A;  3PV8 A;  1NK6 A;  4H8K A;  4AHC A;  4I9L A;  3SYZ A;  4AIL C;  1QHT A;  2D0A A;  3SQ2 A;  2B4J A;  3ISN C;  1KVC A;  4CJV A;  3G10 A;  3AVL A;  3TAG A;  1YTU A;  4M41 A;  4DSI A;  5JS1 A;  3CM5 A;  3VA3 A;  4DTM A;  4CFD A;  3D0P A;  3OYM A;  3ALY A;  5CYQ A;  3KLF A;  4DQR A;  4QOZ B;  1ZBL A;  3HL8 A;  4O4G A;  1HNI A;  1ZBH A;  3QIN A;  2P5G A;  4DTO A;  5CZ1 A;  4JRP A;  4DSJ A;  2KQ2 A;  3T1A A;  1VRU A;  3ZT4 A;  3NF7 A;  3MEE A;  2Z1G A;  4E7K A;  1C6V A;  1FKP A;  4CED A;  4CJK A;  4B9N A;  1KLN A;  3KIO A;  1W0H A;  1TGO A;  4FXD A;  2P5O A;  1VSF A;  5HRS A;  1N5Y A;  3DLE A;  2FBT A;  1D9D A;  1JXB A;  3O4Q A;  3QLH A;  4CJE A;  4FM0 A;  4CGI A;  3AA4 A;  1A5V A;  4CJL A;  1WSF A;  2BGG A;  4FZZ A;  3HPH A;  4AHS A;  1BCO A;  3TAR A;  4F2R A;  4FLY A;  1HQE A;  4GVM A;  3QIO A;  4CHZ A;  4YFU A;  4NCA A;  5KRS A;  3OY9 A;  4BDZ A;  3SPY A;  2Q3S A;  1NJW A;  2HNY A;  3K57 A;  4J2B A;  1EET A;  1WSI A;  3SUP A;  2Z1H A;  1BQM A;  5HBM A;  4CIE A;  3OJS A;  1X1P A;  4FJ5 A;  1J53 A;  1RTH A;  1RT6 A;  3AVC A;  3QEP A;  1VSH A;  2DFE A;  4EZ9 A;  4Z4E A;  4DQP A;  4PQU A;  3AA3 A;  2OYQ A;  3PY8 A;  4BWJ A;  2F96 A;  3UIQ A;  3KLG A;  2G8U A;  1NK9 A;  1EXQ A;  3AO3 A;  4E7J A;  2I5J A;  3RMA A;  3KK2 A;  3AVH A;  1JLC A;  1TL1 A;  2XRI A;  4CFA A;  4OPJ A;  4DTJ A;  3OYH A;  3K5N A;  4E3S A;  1D9F A;  4BWM A;  1VSK A;  3NAE A;  4DQS A;  3DLH A;  1S1W A;  4C8N A;  3DLK A;  5KRT A;  3SV3 A;  1SKR A;  3OVN A;  4FJX A;  3HVT A;  2ZQB A;  1WSH A;  4AH9 A;  3SPZ A;  4Q0B A;  3KLH A;  1JXE A;  1TKT A;  1LWC A;  1BIU A;  4PUO A;  3HT3 A;  3K58 A;  4F4K A;  4OGC A;  3PX4 A;  1NKB A;  4CGH A;  3SI6 A;  3V1Q A;  3DRP A;  1TK0 A;  3ZT1 A;  1NJZ A;  1HRH A;  2P51 A;  5FRO A;  3THV A;  2P1J A;  3O4N A;  1NK0 A;  1S1U A;  3BGR A;  3AVA A;  1RIL A;  3LP3 A;  3VQ5 A;  2B5J A;  3RTV A;  3NF6 A;  3QES A;  3QNN A;  4B9S A;  4EZ6 A;  1RTD A;  4HCC A;  3DYA A;  4KB0 A;  4KHN A;  4RW6 A;  1REV A;  4DU1 A;  1JL2 A;  3ULD A;  4F2S A;  3HM9 A;  3NF9 A;  4L8R B;  1S1V A;  3OS1 A;  3QEW A;  3TAE A;  1C1A A;  2HB5 A;  1GOB A;  3LAN A;  4OLB A;  2ETJ A;  3CFO A;  4OLA A;  2E6L A;  2OPP A;  4CF0 A;  3HYF A;  2NUB A;  3DRR A;  3ZSZ A;  4FLU A;  4J2A A;  2O4I A;  4DQI A;  2ITG A;  2YHA A;  3ZSQ A;  3NDK A;  4B9U A;  3I0R A;  4M45 A;  4F8R A;  2RKI A;  3AA5 X;  3P5J A;  4JLH A;  5EU7 A;  5T7B A;  3O3H A;  1JLG A;  4KHQ A;  3HP9 A;  5HP1 A;  3V9S A;  4Z4C A;  1YT3 A;  3EZ5 A;  3QER A;  5DMR A;  4FW2 A;  1HPZ A;  2OPR A;  3DOK A;  4CJQ A;  3LAM A;  3L2Q A;  3VQB A;  3KD5 E;  4N41 A;  4NCG A;  1A5W A;  3K5O A;  1L3V A;  3LAK A;  2VWJ A;  4OKJ A;  3L2V A;  1KCF A;  3CFR A;  4N47 A;  1U48 A;  1HYV A;  1BCM A;  2PZS A;  4DWI A;  1CXU A;  4CF2 A;  4FLZ A;  1CLQ A;  1ZBU A;  4CEZ A;  3S3M A;  3AO4 A;  1A5X A;  3MED A;  1IKY A;  4CHY A;  1BL3 A;  1QSS A;  4OKE A;  4E89 A;  2IDO A;  5JS2 A;  3AVF A;  3F73 A;  4CEA A;  5CYM A;  1TAQ A;  4UQG A;  1R0A A;  4B9T A;  1BGX T;  3E01 A;  4FJ9 A;  3ASM A;  2IGI A;  3G0Z A;  3VQP A;  3OYF A;  1L5U A;  4FJM A;  3MEC A;  1GOA A;  4FJ7 A;  3FFI A;  1RDC A;  1IG9 A;  2QKK A;  3HVR A;  4KHW A;  4M3W A;  4KAZ A;  3OYK A;  1HNV A;  4CJU A;  3SZ2 A;  4LD0 A;  4HUE A;  1TK5 A;  4O44 A;  3V4I A;  2IC3 A;  2DTU A;  3HK2 A;  4CES A;  5KGX A;  1SKS A;  3DLR A;  2KFZ A;  2XY6 A;  3H08 A;  1QSY A;  5DK5 A;  4QCL A;  3JSM A;  3V9W A;  3HPG A;  4O0J A;  1FK9 A;  1CXQ A;  3HJF A;  4LY7 A;  1JLB A;  1T7P A;  1D8Y A;  3HXM A;  3TAN A;  3WNF A;  3RMC A;  4DFJ A;  1EP4 A;  3OYD A;  3KLE A;  3SNN A;  1UA1 A;  3OYA A;  2KZM A;  2A1S A;  3NF8 A;  2G8H A;  2OPS A;  2D0B A;  4LSN A;  3OYN A;  1C0U A;  3MXJ A;  3LZJ A;  2Z1I A;  5C25 A;  4HUF A;  4LH4 A;  4KI4 A;  2WON A;  4CIF A;  1DTQ A;  2YNH A;  1RDB A;  4QAG A;  1Y97 A;  4DG1 A;  1LWE A;  3L2W A;  3ZSY A;  4CGD A;  4K8Z A;  3C6T A;  1S1T A;  2KZZ A;  4I2Q A;  2O4G A;  3DMJ A;  2EX3 A;  1GOC A;  1WAF A;  2X78 A;  2HNZ A;  1RT2 A;  1IKX A;  1VSL A;  4W5Q A;  1L3S A;  3RWU A;  3S3O A;  4E19 A;  4JS5 A;  1YVU A;  1FKO A;  4KB1 A;  3AO1 A;  4CHO A;  4HUG A;  2W42 A;  4FLT A;  3AO5 A;  3TAP A;  4J2D A;  2IOC A;  2BDP A;  2QXF A;  3CQ8 A;  4CFB A;  3RR7 A;  1S9G A;  1C1B A;  1DTT A;  4JRQ A;  3S3N A;  1B9D A;  1Z26 A;  3KLI A;  4CFC A;  3KK3 A;  2GUI A;  2BE2 A;  1CZ9 A;  4TSX A;  5J2N A;  5J1E A;  4FZX C;  4B8A B;  4ELU A;  1TAU A;  3B6O A;  4DQQ A;  1BIS A;  4BAC A;  2VG5 A;  4BDP A;  3TAB A;  3V9X A;  2VWK A;  4RG8 A;  3HPO A;  5J2Q A;  4KHY A;  2JGU A;  4DFM A;  4LSL A;  1S9E A;  3SUQ A;  1RBT A;  4GW6 A;  1KTQ A;  3SUN A;  3RMD A;  5HLF A;  1Q9X A;  4IKF A;  1C1C A;  4FCY A;  3M8Q A;  4BE2 A;  3T3F A;  4E1M A;  3OYL A;  3NH2 A;  3NHG A;  4C8M A;  4NCB A;  1RTI A;  3NE6 A;  1RNH A;  4Y1C A;  4PWD A;  4AHU A;  4M3T A;  1UAX A;  4CEB A;  2YNG A;  4KV8 A;  1XC9 A;  4K8X A;  2IAJ A;  1QS4 A;  1BIZ A;  2HMI A;  5D3G A;  4Z0U A;  4DF4 A;  2YV0 X;  1U45 A;  3OJU A;  1S5J A;  4CHQ A;  4RW9 A;  4DTX A;  3VQ9 A;  3QIP A;  4LH5 A;  4KTW A;  5C24 A;  2E6M A;  3WNG A;  4DMN A;  4B9V A;  1T05 A;  4DSL A;  3AO2 A;  3NGY A;  4FJ8 A;  3CG7 A;  1U4B A;  3ZSX A;  1C0M A;  3KJV A;  2YKN A;  3PO4 A;  1JLQ A;  4CJ4 A;  3V9Z A;  1QQC A;  3SQ4 A;  4CE9 A;  3AVB A;  3MXM A;  2YKM A;  4J2E A;  4HTU A;  4B9M A;  4CHP A;  3KK1 A;  1RBR A;  4HHT A;  4M3X A;  3ZT3 A;  4M3R A;  5I3U A;  4W5R A;  1BQN A;  5SWM A;  2AJQ A;  4CJS A;  1TVR A;  2GBZ A;  2DFF A;  1TKZ A;  3ZSV A;  4E0D A;  1HQU A;  2HHV A;  4KHS A;  4KKO A;  4E7I A;  4H4O A;  1NKC A;  1NJX A;  1L3U A;  3CM6 A;  4NYF A;  5I42 A;  3BDP A;  4C8O A;  1LW2 A;  4M3Y A;  3L3U A;  4E7L A;  1RT7 A;  4RW4 A;  1LW0 A;  1Z25 A;  4CEE A;  1TL3 A;  4ZTF A;  1J54 A;  1KSP A;  1LV5 A;  4CER A;  1WSE A;  1RBS A;  1JL1 A;  1L3T A;  3QEX A;  3C94 A;  1QTM A;  4FLX A;  3QEV A;  3TWH A;  1JLA A;  1UOC A;  4M3Z A;  1VRT A;  4PA1 A;  4DTR A;  4IG3 A;  2FBX A;  3LP0 A;  4B9L A;  4KO0 A;  5E41 A;  1N6Q A;  4I9Q A;  4KRE A;  1UWB A;  3EY1 A;  1XI1 A;  1KFS A;  4CGF A;  3WNH A;  4EP4 A;  5HRP A;  2IS3 A;  3ZSO A;  1RDA A;  1I39 A;  3AV9 A;  3ZCM A;  3B6P A;  4DS5 A;  3VA0 A;  3K5M A;  3VN5 A;  4DSF A;  3U3G A;  4CJT A;  3P83 D;  3CYM A;  1EKE A;  4ID5 A;  1B9F A;  3SUO A;  4W5N A;  3AVM A;  5CY4 A;  1YTA A;  4OJR A;  1U49 A;  3ZT2 A;  4N76 A;  4BDY A;  3A2F A;  3EYZ A;  3AVJ A;  4FM1 A;  3PX6 A;  4R5P A;  3LP1 A;  4Q5V A;  3O3F A;  3CFP A;  2RF2 A;  2G8I A;  3OYG A;  2RN2 A;  3OYJ A;  4FJK A;  4FK0 A;  1HYS A;  3DRS A;  1ZBF A;  3DLB A;  4N5S A;  3DOL A;  3IAY A;  4ELT A;  3VQ7 A;  4CIG A;  3NH0 A;  4B08 A;  1ITG A;  2EHG A;  4CK3 A;  3VQC A;  1SL1 A;  2FBV A;  2QKB A;  1VSJ A;  3PO5 A;  1Q8I A;  4CF8 A;  4KI6 A;  4CJP A;  4DFP A;  4DLE A;  1BI4 A;  4CK2 A;  3VQE A;  2XY8 A;  3I0S A;  4AHT A;  1S6Q A;  4OGE A;  4KTZ A;  4DS4 A;  3LPT A;  4DTU A;  3QNO A;  4C8K A;  3HST B;  3TAM A;  1ASV A;  2XY5 A;  1LAW A;  2XO7 A;  3NGZ A;  2X6N A;  2HND A;  1QE1 A;  1SKW A;  2B6A A;  4M3U A;  1D5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...