4ID1A

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
154
structure length
140
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Gag-Pol polyprotein
publication title Allosteric integrase inhibitor potency is determined through the inhibition of HIV-1 particle maturation.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 49
structure length 140
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4id1A00
3KK2A 3ZSXA 4JS5A 4OPJA 3V9SA 4FJNA 3AA2A 4HUFA 5JS2A 1SKSA 1SV5A 1WSIA 3L3UA 3HPGA 4WE1A 1NK9A 2QKKA 4C8LA 4W5TA 3AO1A 4KV8A 3B6PA 4PY5A 1CLQA 3UIQA 1IH7A 1Q8IA 1IO2A 2OPQA 3WNEA 1B9DA 3VQCA 1NKBA 2OYQA 2A1SA 3SPZA 1BQNA 3K59A 4PQUA 1KSPA 4B3OA 1RBUA 4KTWA 3DMJA 2I5JA 3AO2A 3ASMA 3K5NA 1BCMA 3PUFA 4Q0BA 2G8UA 4HTUA 4KO0A 4CIGA 2YKMA 4HHTA 4ZTJA 2HHQA 3K5OA 4DG1A 4FJ5A 1D9DA 4FJMA 1KLMA 1WLJA 1KLNA 4OKEA 4Z4FA 2PYJA 2HHWA 2P5OA 3AO5A 1TK0A 3OYBA 3AVBA 3NE6A 3IS9A 4DFKA 1JLEA 2G8FA 1SL0A 1LAVA 5FRMA 2ZQBA 4DLGA 1U4BA 3SQ4A 4ZHRA 4FJHA 4B9SA 3AVHA 4E3SA 3K2PA 3SJJA 1NKEA 3QEIA 2PY5A 3VQQA 4C8OA 3IG1A 1LWCA 4CHYA 1WSJA 4FK0A 2HHTA 5FRNA 3KKRA 2HHUA 1HRHA 4E7KA 5K14A 4DQRA 4DS5A 3TAFA 2HHXA 3LAKA 1Q9XA 1KTQA 1S1WA 1X9SA 3DRSA 1IKYA 3ZSWA 3NDKA 4N76A 1RTHA 4H8KA 3ZT2A 3RR7A 3ULDA 1VRUA 3V9WA 1N6QA 1LWEA 4CEDA 3PO4A 4DSIA 2OPSA 2X78A 1RTIA 4FLWA 2KTQA 2D5RA 3D45A 5EU7A 3TAMA 1NJWA 4GMJB 3NBPA 1TV6A 3DLKA 4CEZA 4E7HA 4DTUA 3VN5A 4IKFA 4M3XA 4KHWA 3THVA 1KVAA 2E6MA 1TGOA 4B9LA 1RDBA 3D0PA 1RBTA 1QS4A 3VA0A 4KTQA 1Z25A 2DFEA 2E6LA 3ALYA 3LP2A 3VQ4A 1UA1A 3HSTB 1TVRA 3O3FA 1QSLA 4CEEA 1KCFA 1UAXA 4FW2A 1RILA 5KI6A 3G0ZA 1O1WA 3NFAA 4DSLA 4K8ZA 1TKDA 2QKBA 4CJRA 3MAQA 3I0SA 3BGRA 3AVLA 1VSJA 3LAMA 4OGCA 4CK1A 4OLBA 3O4QA 3VQ7A 1JKHA 4E0DA 1JL2A 2HB5A 2WOMA 3NGYA 3V4IA 4FK2A 2IAJA 2W42A 4CERA 3F73A 4Z4CA 1X9WA 3OYAA 3KLHA 1GOBA 4BDZA 1FKOA 1KFDA 2D0BA 1A5VA 1S9GA 1TKXA 1U47A 4F3TA 1TAUA 1BI4A 2FC0A 3KK3A 5C42A 2Z1JA 3QNNA 4CJUA 3TAPA 2ZE2A 1BQMA 3B6OA 1RNHA 3DRPA 4CJLA 4E89A 1EP4A 2B4JA 2OZSA 3TAEA 3OJUA 2FBTA 4CEFA 3LP0A 3A2FA 4FLUA 3NHGA 2HVIA 4CF2A 1BIZA 3VQDA 3SUNA 4I9LA 3LPTA 3K57A 1RT2A 1RDAA 2HNDA 4N56A 1VSEA 4B9TA 3QIOA 4OPKA 3SQ2A 2RPIA 1XHZA 3LALA 4K8XA 2EX3A 1ASVA 1TKZA 2LSNA 3TABA 4DU4A 3AA4A 1QSYA 1VSDA 4DTPA 1J54A 3SI6A 4FZXC 4CJ4A 4Z4EA 4B08A 3M8RA 4DU3A 3QETA 3AVGA 4LD0A 4DTRA 4KFBA 4AHRA 4CF1A 1YT3A 3NAEA 1RT6A 3JSMA 4DTSA 4FJGA 4Z4HA 1ZBIA 3OYFA 3NGZA 3CFRA 1UA0A 4ELVA 4OKKA 5DK5A 1BCOA 5CY4A 1C0UA 1HQUA 2VWKA 3V1OA 1XWLA 3OS2A 1CZ9A 3M8PA 1RTDA 1S1XA 2YKNA 1NOYA 3V1RA 4Z0UA 3ZT1A 3ZT4A 4CJKA 4FJJA 4KHUA 4C8NA 3HJFA 2HVHA 3DLHA 1IKWA 1BGXT 1D5AA 1U04A 4NYNA 4CFDA 2R7YA 1T7PA 4NCAA 4LSNA 4I2PA 2Z1HA 3L2QA 3CM6A 1EKEA 5KRTA 1A5WA 4C8KA 1HQEA 3F9KA 3RRGA 2P1JA 1RBSA 3DI6A 1LW0A 3MXMA 3KIOA 1JXBA 1SL1A 3NF8A 3P5JA 4CEOA 4M3WA 4Z4GA 1W9HA 3G10A 4XIUA 3K58A 3TWHA 1ZBFA 1X9MA 4DQPA 3DRRA 1QE1A 3AVCA 4CJVA 5HRPA 4DLEA 4F2SA 2AJQA 2ZD1A 4FVMA 4Y1DA 4YFUA 4BE2A 1JLGA 4DSFA 4IG0A 3SPYA 3L8BA 3NH2A 4KRFA 4HCCA 4KI6A 2X6NA 3AVFA 1ZBHA 4CHNA 4Q5VA 4DTXA 3SUPA 4FJKA 4FJXA 3ZSYA 4IFVA 3T3FA 4KB1A 2FBVA 4B8AB 2IS3A 1Q9YA 4RG8A 4M3TA 3MEDA 1NK7A 5JS1A 3O4NA 3SYZA 3NCIA 1DTQA 1KVBA 1RDCA 1FK9A 2Q3SA 1IKVA 3ZSOA 3HXMA 4W5RA 2HMIA 4J2DA 4W5QA 3LP1A 3LANA 1RTJA 3NF6A 3VQAA 3O3HA 2IC3A 3DM2A 1BHLA 4O0JA 1C6VA 1SKRA 1S6PA 4F3OA 1L3VA 3VQBA 2ITGA 4CJ5A 4ID1A 2KZMA 4DSKA 3MEGA 1T05A 3KK1A 4FM2A 4EZ9A 4BE0A 1N5YA 3JYTA 1WN7A 2F96A 3V1QA 2O4IA 1WAJA 4H4MA 3HPOA 1VSFA 4CEQA 4DS4A 1L3UA 1RCHA 3AVIA 3OYMA 1TK8A 2BDPA 4KPYA 3TARA 3VQEA 4FCYA 3SV4A 4NYFA 3ZT3A 4J2BA 1S9EA 1TAQA 5CYQA 3SV3A 4CJ3A 1WSEA 1TL1A 3OJSA 4LH5A 5KGWA 4H4OA 1VSKA 4CJSA 3SUOA 4KTZA 4FJ8A 4E1MA 3PX6A 3ISNC 4Y1CA 3KD5E 5CZ1A 4M45A 4CGDA 4HVJA 1FXXA 3QIPA 5J2QA 4HCBA 4CE9A 1JL1A 4FLYA 3QEXA 1NJYA 4FW1A 1B9FA 3TR8A 1SL2A 3MECA 4C8MA 2WONA 1L3SA 3S3OA 4GVMA 3OYCA 4I7FA 3K5MA 1JXEA 1YTAA 3K5LA 3V81A 4FJ9A 5HBMA 1JLFA 1U49A 1ZBUA 2IGIA 2XO7A 4L8RB 2DY4A 4CGJA 4M3ZA 3ITHA 1RT7A 1RT5A 3VQ5A 1YVUA 4N5SA 3SZ2A 1XI1A 1S5JA 4DMNA 3PO5A 4FXDA 4B9NA 1MU2A 4CGIA 3RMAA 4GW6A 4W5NA 2KFZA 1WSGA 4E7JA 4E7LA 4RW6A 4OGEA 2RF2A 3MXIA 3AA3A 1ZBLA 3TANA 4PUOA 3RTVA 2HNYA 1ITGA 3DLEA 4AILC 4M41A 3DLBA 1ASWA 1BL3A 4EP4A 4KKOA 3QEWA 1SUQA 4CHOA 3HVRA 3HT3A 4BACA 3VA3A 3HO1A 3OY9A 3LWLA 1X1PA 5HRRA 4HUEA 4ELTA 4FJ7A 4NCBA 1C1AA 4M42A 1NJZA 1NOZA 3V9UA 5J2PA 3QERA 1JLAA 2YNHA 4JRQA 4W5OA 4DQSA 5E41A 4DFMA 2BANA 1D9FA 4RW8A 4B9UA 4DQIA 1EXQA 4O44A 4AHVA 4DTNA 4QAGA 3CQ8A 4IG3A 4FLTA 3OYLA 2IOCA 1NK8A 3KLGA 3QO9A 3ZT0A 3LWMA 3EZ5A 1HMVA 2HW3A 1SKWA 3OYHA 4AHCA 3DLGA 4CJPA 1I39A 3AA5X 3C95A 4M3RA 2VG5A 3ZSQA 4CHQA 1WSHA 3KJVA 3L2WA 3LZIA 4LH4A 3U6FA 2XY7A 4E1NA 2G8HA 1VSHA 2HHSA 2XHBA 4NCGA 1JLQA 3OYNA 4BWMA 4OKJA 3VQ6A 3M8SA 3WNFA 4CF8A 3OVNA 3PX0A 2GUIA 4RW9A 1YTUA 2ETJA 4UQGA 2JGUA 3SQ0A 1HPZA 2GBZA 3CFPA 3E01A 1NK4A 4M3UA 3LDSA 2BGGA 3U3YA 2F8SA 4CESA 3VQPA 2QXFA 1I3AA 1WAFA 3S3NA 4FM1A 4KB0A 2GV9A 3NF7A 1HYSA 3OYGA 1NJXA 4N47A 4CJQA 3WNGA 3SUQA 1JLBA 4CFBA 4CIFA 4DSEA 2NUBA 3OYIA 4FLXA 4KHNA 1L3TA 4M3YA 4KAZA 3DOLA 4DWIA 4KHQA 3P83D 4CF0A 5CYMA 3C94A 3AVKA 4CGGA 4DSJA 2XY5A 2XY6A 4DTOA 1CXQA 1R0AA 1EX4A 3T1AA 5KRSA 4FJLA 3NF9A 3QNOA 1KVCA 3H08A 4DU1A 1LWFA 1WNSA 1DTTA 2DFHA 2DFFA 3QINA 3TAGA 1NK5A 2KZZA 3TI0A 4I9QA 1C1CA 3DLRA 1HNIA 3M8QA 4CJFA 4FK4A 1JLCA 2PZSA 4DTMA 1U48A 4ID5A 3RRHA 4F4KA 1C0MA 3OS1A 4LY7A 2Y1IA 4DFJA 5D3GA 2Z1IA 1RBVA 3SNNA 5HRNA 3HVTA 2G8IA 3V9XA 2P5GA 3OYJA 3HM9A 4Z4IA 4O0IA 2FBXA 2FBYA 1J53A 4FJIA 2QK9A 4G1QA 3DOKA 3S3MA 4DTJA 2Y1JA 3SCXA 1KFSA 4KI4A 4LSLA 2B5JA 4ICLA 4DF8A 3CYMA 3KKSA 4OJRA 1CZBA 4CF9A 4FM0A 4CIEA 3IAYA 4F2RA 1RT1A 1VSMA 1HYVA 3RMBA 2YV0X 4F8RA 1NKCA 4PA1A 3LP3A 3OYKA 4BDPA 1WSFA 1LW2A 4YNQA 1KRPA 4KHSA 1TL3A 2X6SA 5J2NA 2PYLA 3PV8A 3O3GA 4CHZA 1XC9A 1GOCA 5I42A 1RDDA 2E4LA 4CJTA 3CFOA 4IDKA 4TSXA 3DYAA 4AH9A 3S9HA 3EYZA 2D0CA 4RW4A 5FROA 2XY8A 3V9ZA 4ELUA 2G8VA 4QCLA 1BIUA 3KLEA 3SQ1A 3MXJA 2HNZA 2VG6A 4IBNA 1IG9A 4QOZB 2YHBA 2OPPA 1F21A 4J2EA 4FZYA 1UOCA 2G8KA 4CECA 1BI4B 4CJWA 3EY1A 5C24A 1VSIA 4BDYA 2KQ2A 1EETA 5CZ2A 4AHUA 3LPUA 2YHAA 3KTQA 3WNHA 3HYFA 3HPHA 2X74A 1IKXA 3TAQA 4EP5A 2XRIA 3IRXA 4B8CA 1S1TA 3HL8A 4E19A 2ATQA 1BISA 1XHXA 4CFCA 1J9AA 4R5PA 3NH0A 2Z1GA 1VK0A 2OA8A 3P1GA 1ASUA 2VWJA 3CG7A 3T19A 4CJEA 3QEVA 3OS0A 2YNGA 2F8TA 3NGIA 3LZJA 3AO3A 1K6YA 1HYZA 3CM5A 1L5UA 3ZCMA 1J5OA 2IDOA 4CGHA 3HK2A 1RBRA 3NH1A 4DQQA 2RN2A 4BE1A 4CEAA 4E7IA 3MEEA 1CXUA 3HP9A 3L3VA 4O5BA 2OZMA 5SZTA 4JS4A 2G8WA 2B6AA 5J2MA 3AVAA 1LV5A 1Y97A 4IFYA 4MFBA 4JLHA 5C25A 4EZ6A 1LAWA 1ZYQA 1T8EA 4FLVA 3AVNA 4MQ3A 5FDLA 1S6QA 1C1BA 1HJRA 1S1UA 3AO4A 1VRTA 3AVJA 3AVMA 1RT4A 4I2QA 2A1RA 1VSLA 1GOAA 5I3UA 4ZTFA 1RT3A 3KD1E 1QHTA 2O4GA 4RW7A 3KLFA 1TKTA 4B9MA 3L2RA 3OYEA 2BE2A 2HHVA 4AHTA 4CK3A 3HP6A 3L2VA 3BDPA 4OLAA 4FZZA 3FFIA 3C6TA 4OVLA 5HP1A 3ZSRA 2YNFA 3QLHA 4DFPA 1QTMA 5T7BA 1QSSA 1UWBA 2P51A 1HNVA 2OPRA 5DMRA 5KGXA 3I8DA 1B92A 2EHGA 1Z26A 3AV9A 3C6UA 2D0AA 2KW4A 4CGFA 4CK2A 3L2UA 1TK5A 4BWJA 4KHYA 3KLIA 4N41A 3RMCA 3RR8A 4B9VA 5SWMA 1G15A 2VG7A 5J1EA 4JRPA 1C0TA 3QEPA 4CFAA 3PX4A 5HROA 4KREA 4CEBA 1NK0A 2KFNA 1T03A 1D8YA 4CCHA 3PY8A 3RWUA 2JLEA 4FLZA 5HRSA 3VQ9A 4DF4A 4PWDA 1S1VA 4HUGA 1QQCA 2YNIA 1U45A 1DLOA 3ZSZA 4AHSA 3RMDA 3ZSVA 5HLFA 2DTUA 3I0RA 1FKPA 3V6DA 4J2AA 4CHPA 4O4GA 3VQ8A 1W0HA 3OYDA 5KTQA 1A5XA 3QESA 1NK6A 2RKIA 4FYDA 3U3GA 4O55A 1REVA
chains in the Genus database with same CATH superfamily
3V9SA 4OPJA 2YHWA 3AA2A 4ILGB 2HOEA 5JS2A 4BR9A 3HPGA 2P9IB 1EO1A 1Z05A 5ADXH 3L0QA 2ZM6K 4PY5A 3HM8A 5AQZA 3UIQA 1IH7A 1Q8IA 4FWLA 3HBTA 3K59A 1E3MA 1KSPA 1OH6A 1RBUA 2F9TA 3ASMA 4QS9A 4BG9A 1BCMA 3K5NA 1NJIO 3U8XA 4FJ5A 3CJ9A 4RTFD 1ZC6A 4J8FA 2QXLA 3AVBA 3FLCO 2G8FA 5BRDA 1IBKK 2YJFA 2GWJA 4MDAA 4B9SA 4GKKK 3F9MA 1NKEA 2I7NA 1WSJA 4DUZK 2GUPA 4E7KA 5K14A 3F5TA 3LAKA 1S72N 3ZSWA 1S22A 3NDKA 4DQ8A 3ULDA 1XQSC 1LWEA 4CEDA 1RTIA 2KTQA 2ASPA 2D5RA 3RSEB 1NNEA 4DB3A 5GINA 4M3XA 3A5OC 2JWLA 1RDBA 1RBTA 4OX9K 4KTQA 1Z25A 2E6LA 3O3FA 4A5AA 4JI3K 4GNIA 3NFAA 1IBLK 3I0SA 3IDHA 4CK1A 4OLBA 3O4QA 2F9WA 3M6GA 1C0GA 1OVYA 3V4IA 4BR5A 2IAJA 4H0OA 3N4QA 1QVGM 3CJBA 1TKXA 2HBLA 2RHKA 3QNNA 4H0VB 4CJUA 3TAPA 1BO5O 3J81O 4ISGA 3SAGA 4E89A 3WQUA 1U6ZA 3ZX2A 2FBTA 4CEFA 3LP0A 3A2FA 4FLUA 3SUNA 1XHZA 3LALA 3FE1A 1ASVA 2LSNA 5FPEA 3TABA 1VSDA 4CJ4A 5LMUK 3QETA 3BY5A 4AHRA 4YHHK 4DTSA 4O5FA 3NGZA 3E66A 3OBYA 1H1VA 2Q36A 1CZ9A 3M8PA 3QB0A 2YKNA 1NOYA 5BR8K 2HVHA 4CFDA 1D5AA 3L6QA 2VYPA 3VOVA 3CD6N 3P38A 4C8KA 1HQEA 1RBSA 1SL1A 3BP8A 2HSTA 3KIOA 4M7YA 3PSIA 4Z4GA 1W9HA 1ZBFA 3DRRA 1QE1A 3OHRA 5HRPA 2AJQA 4OO1J 3CJ1A 4BRCA 3CMAN 4DSFA 3SPYA 3NH2A 4BR4A 2IVPA 4M63C 3HSCA 4KI6A 1JCGA 4CHNA 4Q5VA 1XUPO 2NRRA 1Q9YA 2J4RA 3SYZA 3NCIA 3WXLA 1IJJA 1VQ7N 2E2PA 1HX1A 3LDLA 4J2DA 1RTJA 4IOXA 2FLOA 3VQAA 1BHLA 1OH5A 5BPMA 1SKRA 3P39A 1S6PA 4F3OA 3VQBA 1YI2N 4LF6K 4BRIA 4BE0A 2F96A 2QWRA 1WAJA 4H4MA 3HPOA 4U7BA 4DS4A 1RCHA 3OYMA 4LF8K 4GV6A 2A5XA 3VQEA 3ZT3A 4J2BA 3THYA 3SV3A 3RVCA 4LF7K 1LOTB 4CJSA 2P9LA 4KTZA 4H0TB 3ZYYX 4HVJA 1FXXA 3QIPA 2UXDK 1NJYA 1TYQA 5AQRA 3TR8A 2E88A 4CBXA 2WONA 3UKRB 4ISEA 4MO4A 1VQKN 4I7FA 1JXEA 2UUBK 3K5LA 4FJ9A 5HBMA 4CBWA 1U49A 4L8RB 2DY4A 2IGIA 4H5NA 2XO7A 3CC7N 1RT5A 3SZ2A 5GAGP 1S5JA 3BEXA 3J7ZO 4B9NA 4CGIA 2KFZA 1G99A 4FVUA 1WSGA 5GADP 3AA3A 1ZBLA 1VQ4N 4OPHA 3IUCA 3TANA 4PUOA 3RTVA 1D4XA 2HNYA 3ZETA 4AILC 2AP1A 4M41A 1BL3A 5F2RA 5HRRA 3A5MC 4ELTA 4NCBA 5C2FA 1NM1A 3QERA 1TUYA 2O8DB 5AQQA 5EY4A 1FJGK 1D9FA 1EXQA 1NK8A 3CCLN 3QO9A 3LWMA 1HMVA 4AHCA 4CJPA 4E7LA 1I39A 4M3RA 2VG5A 2HHSA 4E1NA 1VSHA 1JLQA 3M8SA 3OVNA 3H45C 4UQGA 2JGUA 3OTOK 1N32K 4XEIA 1HPZA 3VGMA 3E01A 4M3UA 4BRMA 3LDSA 4JK7A 2ZJPL 3O9SA 3THWA 3HI0A 4JNEA 4FM1A 1QHAA 3WEEB 1HYSA 3OYGA 4LFCK 5AQTA 4YOVA 1NJXA 4CJQA 2P9KB 3WNGA 3FR0A 2NUBA 4DKWA 4M3YA 4KAZA 4CF0A 5CYMA 5GIPA 4DTOA 1CXQA 1R0AA 1EX4A 4DR6K 4A59A 3NF9A 3QNOA 1LWFA 1HUXA 3CC4N 1C1CA 1HNIA 2PZSA 4ID5A 2E20A 4F4KA 1C0MA 4JHDB 1T6DA 4Z4IA 3OYJA 2HHHK 1K8KA 2P9LB 2QW9A 4FJIA 4G1QA 3DOKA 3S3MA 4DTJA 2PFUA 4B3MK 4PKGA 3KKSA 1RDWX 4CF9A 4FM0A 1TYQB 1HYVA 5C2DA 1NKCA 2VWBA 1KC8O 4KHSA 4K42A 2NRXA 3EE9A 4CHZA 1XC9A 2BUPA 5I42A 3CFOA 4WFBL 4X62K 2XY8A 3MXJA 1Q86O 2VG6A 3VEXA 4QOZB 3THXB 1E4FT 4CECA 4HTLA 2OTLN 4CJWA 2D0OA 2KQ2A 4AHUA 1HJOA 1HLUA 3WNHA 3HYFA 3HPHA 1EWQA 3D2FB 2XRIA 1QQNA 4R5PA 3ZLJA 2NRWA 3NH0A 1VK0A 2OA8A 3CJCA 5BR9A 3OS0A 3HK2A 1XMOK 3NVMA 1OVQA 4PL7A 3HP9A 2CGLA 2OZMA 2B6AA 3HOSA 3AVAA 3WUHA 3AVNA 1YJ9N 2Q1NA 1NMNA 2P9SB 1NGFA 3THWB 1VRTA 4FWQA 2VQFK 2A1RA 2BH1A 3O9TA 3W3DA 1RT3A 3EE8A 2WUSA 4X65K 3L2RA 2BE2A 4AHTA 4B1YB 3HP6A 4YORA 4FZZA 4OVLA 2QI2A 4MLHA 4G9ZA 4DR4K 4YOTA 1ILYA 4BRPA 2P51A 5DMRA 4BRNA 4JI7K 2D0AA 5C12A 5BRHA 3MCPA 4KHYA 1MDUB 2WTUA 1ZBSA 1G15A 2VG7A 1C0TA 2RE2A 5H1SQ 4FLZA 1QQCA 4CW7B 3LDPA 1DLOA 1K8KB 1QQOA 1FKPA 1JJ2M 1NK6A 4BGBA 4FYDA 3O08A 3VGKA 3KK2A 3ZSXA 4JS5A 2VGNA 4H5WA 4C1NI 5KPRA 2QA4N 3L3UA 5AQJA 2QKKA 3AO1A 4JKFA 1CLQA 2OYQA 3SPZA 3U4LA 1BQNA 1K9MO 1VQNN 3MN7A 3CJ7A 3CCRN 4B3OA 2GTDA 2G8UA 4HTUA 4ZTJA 1D9DA 1KLMA 1QQMA 4OKEA 2HHWA 3AO5A 3TU5A 3OYBA 3NE6A 3T1YK 3UKUB 1S3XA 2WC9A 4DR5K 1LAVA 2ZQBA 3K2PA 5AFUA 2W6LA 3QEIA 2PY5A 3VQQA 4C8OA 1NMDA 3IG1A 1LWCA 3O1BA 1KAXA 1K73O 2HHXA 1KTQA 3CF5L 4JKGA 1IG8A 3M1FA 4FWMA 3DRSA 3M3ZA 1RTHA 4YDUC 3B8AX 1N6QA 2FSJA 2X78A 2NZTA 2BTFA 1TV6A 3DLKA 4KHWA 3FZKA 1TGOA 2NNWA 2QWLA 3D0PA 1SS6A 3VA0A 3ALYA 3LP2A 4OPAA 3MX5A 3HSTB 1SQKA 4FWNA 1KCFA 4B1WB 4DSLA 2QKBA 4CJRA 3AAQA 3KHYA 5IWAK 4BRGA 3GL1A 1VQMN 4A2BA 2HB5A 2KHOA 2WOMA 3NGYA 5LL6Z 3F73A 4BR0A 4Z4CA 2PAVA 2WFBA 3OYAA 2D0BA 1S9GA 1U47A 4F3TA 1DKGD 2Z1JA 1BQMA 3DRPA 3S41A 1EP4A 3I56N 3TAEA 3OJUA 2HVIA 3LPTA 3K57A 2HNDA 4FO0A 4B9TA 5HOOA 4OPKA 2RPIA 3CQYA 4B9QA 4BQZA 4DU4A 3SJHA 4DTPA 3AARA 3AVGA 4DR7K 4DTRA 4H0XB 1X9JA 1YT3A 1ZBIA 4FOIA 4WQ5C 5KPTA 3V1OA 1BUPA 1S1XA 1RTDA 4Y0WA 4H5RA 1KAZA 4K43A 3KZBA 3V1RA 3ZT1A 3ZT4A 4FJJA 4KHUA 5AQGA 1BGXT 3I55N 4NCAA 5MLCQ 4I2PA 5BPLA 3L2QA 3CM6A 2DPNA 1A5WA 3F9KA 1WOQA 3DI6A 3PIPL 4M3WA 4AF1A 4AM6A 4GV9A 3G10A 4DQPA 1X9MA 4F2SA 2ZD1A 2Q2RA 2O8BB 3SAHA 4BRKA 4HCCA 2X6NA 4LF9K 4DTXA 1YJNN 4B8AB 4M3TA 2PBDA 5JS1A 1NGEA 5FPDA 3O4NA 5F1XA 4B1VA 3H1QA 3HXMA 3ENHA 2IC3A 4O0JA 4YDUA 1C6VA 1T44A 4IO8A 1NGIA 2YI1A 5KQDA 2KZMA 5AQIA 3KK1A 1N5YA 3V1QA 3CCJN 1L3UA 4CEQA 2NRHA 3G6EN 2BDPA 3SV4A 5CYQA 3CC2N 4CJ3A 4LH5A 5C10A 3SUOA 1NGBA 5J2QA 1JL1A 4FLYA 2E1YA 1SL2A 1WBBA 1L3SA 3S3OA 4JD2B 4B3RK 2Q31A 3V81A 1JLFA 1RDUA 4NO7A 3ITHA 3PO5A 4FXDA 4DMNA 3SBGA 5AQMA 4H03B 3DWLA 2KLAA 4E7JA 3MXIA 2P9PA 1ITGA 4GV3A 1ASWA 3QEWA 1X1PA 4HUEA 3DXKA 1C1AA 4BY9C 2F7TA 1NOZA 3V9UA 4DQSA 4JRQA 2WBNA 1BOTO 5DM7L 3CI5A 4B9UA 4DQIA 4QAGA 4DV2K 3D6RA 4WQ5A 3WXJA 4H5VA 3EZ5A 1M90O 2HW3A 1SKWA 3DLGA 3ZSQA 2G8HA 3LZIA 3WQTA 5IT9O 1JCEA 3CCEN 4BWMA 3VQ6A 4IOCL 4RW9A 2ETJA 1GLJO 4CZFA 2GBZA 3M5RA 3R3LA 3VQPA 1I3AA 4X66K 5EX5A 2QWPA 4KB0A 2GV9A 1MWKA 4YOUA 3TPQA 3SUQA 4CFBA 4WCEL 1SZ2A 5AQKA 4DV6K 4KHQA 3AVKA 4CGGA 3LM2A 2XY5A 2QWMA 4JKDA 5KQ8A 4CZMA 5KRSA 4FJLA 5BPNA 4AM7A 3MN9A 1BA1A 3O5BA 4DU1A 1WNSA 2DFFA 3TAGA 1NK5A 4CVNE 4JI1K 4EAHD 4DR1K 5LJWA 2IVOA 5D3GA 4L3QA 4BC4A 2Z1IA 5HRNA 1DT9A 3HM9A 2FBXA 4CBUA 3C65A 4JI8K 2FBYA 1J53A 3O1WA 1EQYA 1I94K 4LFBK 3SCXA 1KFSA 3P31A 2V7YA 3CYMA 4ICLA 3VF6A 1CZBA 2ZGZA 4F2RA 4CIEA 4ISFA 4BRAA 1VSMA 1FW6A 3DJCA 3K9KA 3OYKA 1WSFA 1LW2A 2PYLA 1RDDA 4CJTA 4BRQA 5FROA 2YCHA 1YXQA 1BG3A 3T7ZA 3KWIA 5HL7L 1IG9A 3O9QA 2YHBA 1F21A 4J2EA 2P9PB 2P9UA 4FZYA 1UOCA 1VQON 1DGKN 4PL8A 4BQLA 3EY1A 5C24A 3D7EO 3LPUA 1WUAA 2YHAA 3QDKA 3MWTA 3KTQA 2HBKA 1U2VA 2X74A 2Q0RA 4EP5A 3IRXA 2ATQA 4PKIA 3MN6A 3CG7A 3T19A 3NGIA 3AO3A 3LDNA 1K6YA 3CM5A 1L5UA 1EWRA 5TKWA 4WQ4C 4CEAA 1CXUA 4A57A 3L3VA 2Q0UA 3EN9A 4JS4A 3OW2M 5J2MA 4JI2K 1LV5A 5AR0A 3CCMN 1YAGA 4EZ6A 1LAWA 1T8EA 4MQ3A 1S6QA 2FSKA 2QTDA 1S1UA 3G71N 3AVMA 3U9DA 2ASOA 1RT4A 1VSLA 1HNZK 4ZTFA 3E1YA 2E2OA 1P8ZA 1KXPA 3L2VA 3C6TA 4RCHA 2YNFA 5AJ3K 1QTMA 1QSSA 3ATUA 5JLFA 2OPRA 1B92A 1YHQN 2EHGA 3AV9A 3BF3A 1TK5A 2KW4A 3L4IA 3C6AA 3KLIA 4JKEA 5SWMA 1OKJA 3LM9A 4FWRA 4JRPA 3QEPA 3VENA 4CFAA 1J5EK 1VQ9N 5C15A 2KFNA 1NK0A 3ATVA 1T03A 3TTCA 3PY8A 3VQ9A 4HUGA 1U45A 4IEEA 3ZSZA 3RMDA 1NBWA 2DTUA 1YVNA 3O9UA 3I0RA 4EFHA 2W40A 4CHPA 2A6AA 3OYDA 4CZKA 1A5XA 3U3GA 3TTFA 4FJNA 4HUFA 1SV5A 1WSIA 4BC2A 1XNRK 1NK9A 4W5TA 1NGCA 4KV8A 3WNEA 1IO2A 2OPQA 2ZJRL 4I6MA 1B9DA 3VQCA 4X64K 1NKBA 5ELZA 3THYB 4PQUA 4KTWA 2QWNA 2I5JA 3PUFA 1V4TA 4CIGA 3CXCM 3K5OA 4FJMA 1NGAA 3FZLA 2ASMA 1WLJA 1KLNA 1HPMA 1V4SA 2P5OA 1C0FA 1TK0A 4DFKA 1U2VB 1JLEA 4ILJA 5FRMA 4ZHRA 5JVGL 4B1XB 3SJJA 3CIPA 4FSVA 4E1JA 3DXMA 1N33K 4F9OA 4CHYA 3IKMA 3JXUA 4FK0A 2D0PA 5FRNA 3KKRA 2HHTA 3CCVN 4GKJK 2HHUA 4DS5A 1Q9XA 1S1WA 3ZETB 3LDOA 4N76A 4H8KA 2AA4A 3ZT2A 3A5LC 3RR7A 1VRUA 3V9WA 3UB5A 5ADXA 3PO4A 1GLFO 4FLWA 5M1QA 3EZWA 1NJWA 5EU7A 5CHIA 4CEZA 4E7HA 3VN5A 4IKFA 3THVA 1KVAA 2E6MA 4B9LA 2O8CA 3E9OA 5AQLA 4WFAL 4WQ4A 3MCAB 2O8FA 1QS4A 3SMPA 2DFEA 1HNWK 1TVRA 4CEEA 1OH8A 1UAXA 4FW2A 1RILA 4V19S 3G0ZA 1O1WA 4K8ZA 4DV3K 4FPAA 4FWKA 3AVLA 3BGRA 1VSJA 5EOYA 5AQWA 4E0DA 4BG8A 4JI0K 1ATSA 3H3OB 4FK2A 2W42A 2QM1A 1X9WA 1VQ8N 3KLHA 3ZEUA 4WF9L 4MDBA 3ZX3A 1A5VA 1TAUA 1BI4A 1GLEG 3KK3A 5C42A 1Q82O 4CJLA 1RNHA 4KH6A 3GDQA 3IFRA 2IIRA 3VETA 5BN9A 3NHGA 3MK6A 4CF2A 1BIZA 2UXCK 4I9LA 2UU9K 2ZGYA 4N56A 3VERA 3SQ2A 1XNQK 3FZFA 2EX3A 3G25A 5EXWA 3AA4A 1QSYA 2VCPA 3SI6A 4NXMK 3M8RA 5FPNA 3NAEA 3JSMA 4Z4HA 3OYFA 3CFRA 3Q7CA 1Q7YO 1BCOA 1C0UA 1HQUA 1XWLA 2HMPA 3OA9A 4Z0UA 1BWFO 1KAYA 4BROA 3HJFA 4UY8O 1IKWA 1U04A 2YHYA 2R7YA 5A2QO 4LSNA 4ILHA 3QMLA 2P9NA 5KRTA 2P1JA 2V7ZA 1JXBA 3NF8A 3C6HA 3K58A 4CJVA 4DLEA 3SMSA 5M1NA 2CGJA 4FVMA 4Y1DA 4YFUA 3I33A 4BE2A 1JLGA 1WBDA 3L8BA 1N34K 3CPEA 4JK8A 2Q97A 3SUPA 4FJKA 4FJXA 2GX9A 4IFVA 4KB1A 2FBVA 2IS3A 3QFPA 4RG8A 1DTQA 2NRVA 1KVBA 4XH1A 2O8CB 3VEOA 1IKVA 5GAEP 3J7YP 2O8FB 3ZSOA 4W5RA 4XH4A 2HMIA 4W5QA 3LANA 3NF6A 3DM2A 4B1ZA 3SAFA 2O8EA 2HF3A 3HTVA 2ITGA 4ID1A 3HRGA 4DSKA 4FM2A 4O8UA 4EZ9A 4BVOA 2P9IA 2O4IA 1MA9B 2A42A 3FGUA 1VSFA 3AVIA 4NXNK 3WXMB 5LMNK 2CH6A 4CI6A 1TL1A 5KGWA 3O80A 4H4OA 3MN5A 3ZEUB 4PKHA 4FJ8A 4IFEA 5TKYA 3KD5E 5CZ1A 3VGLA 3QEXA 3MECA 4GVMA 3OYCA 4AQYK 3CPWM 3DAWA 3OBWA 1ZBUA 3O6WA 4M3ZA 5AQXA 1MU2A 3U9ZA 3VTIA 3RMAA 4FWOA 4KHPK 4RW6A 3MWPA 3DLBA 5AQUA 4EP4A 1SUQA 3HVRA 4JKCA 3HT3A 3VA3A 4JI4K 4M42A 4B3SK 5J2PA 4KH5A 1RFQA 4W5OA 1QVFM 3FZMA 5E41A 3R6MA 1LCUA 4B1UB 2BANA 2HF4A 3T69A 4RW8A 5AQYA 4EHUA 4AHVA 1NGHA 4BRFA 3CQ8A 4IG3A 4FLTA 1NLVA 3KLGA 5B8HA 4BR7A 2P9NB 4BREA 4O8KA 3OYHA 3AA5X 1TUUA 4FL9A 1WSHA 4LH4A 3U6FA 1ATNA 2XHBA 3OYNA 3WNFA 3PX0A 2GUIA 1IV0A 1KD1O 4IO9L 3C0BA 2QXFA 4HWIA 2A3ZA 3S3NA 3NF7A 1JLBA 2GELA 4DSEA 4FLXA 4KHNA 4YOYA 5GIOA 1NG9A 3P83D 4DV0K 2XY6A 3CCUN 4JV5K 3T1AA 2O8EB 5AQPA 1KVCA 3H08A 4CZEA 2DFHA 4JKGB 2KZZA 3TI0A 3QICA 4CJFA 1JLCA 4CD3A 1ATRA 4DTMA 3J80O 1U48A 4NB4A 4LY7A 4DFJA 3K0SA 5BN8A 1RBVA 5I9EB 2G8IA 3BUZB 4O0IA 3CHWA 2QK9A 2YX6A 4LSLA 2B5JA 2UYTA 3NVKA 5JVHL 1RT1A 2YV0X 2NRZA 5AQOA 4F8RA 5AQHA 3EKSA 2A40A 4BDPA 4YNQA 1TL3A 5J2NA 5AQSA 1GOCA 3KWGA 4IDKA 3DYAA 4AH9A 3S9HA 3E9LA 3WT0A 4CZGA 1BIUA 1T6CA 2HNZA 4IBNA 2G8KA 3Q7BA 1VSIA 4YOXA 1EETA 5CZ2A 4BVPA 5CE3A 5KPZA 4IJAA 3HOTA 4R79A 4WYBA 1BISA 1XHXA 1J9AA 2HBMA 1HKCA 2Z1GA 4IOAL 3QEVA 2YNGA 3LZJA 1OH7A 1HYZA 1RGIA 3VEZA 1J5OA 1HR0K 5BREA 1CZAN 2RN2A 4BE1A 3MEEA 2ZJQL 3A8YA 4QS7A 1Y64A 5C25A 3O8MA 3IMXA 1ZYQA 1W7AA 1IBMK 4MLEA 1C1BA 1HJRA 3AO4A 2OANA 3TSQA 2E2QA 1JCFA 1QHTA 4RW7A 3OYEA 4Z94A 2HHVA 2VQEK 4CK3A 1QZ5A 1K8AO 3BDPA 4EIAA 4KBOA 5HP1A 3I8BA 2FF6A 3UKRA 3QFUA 1HNVA 5KGXA 3I8DA 3D2EA 1Z26A 3JS6A 4CGFA 3L2UA 3W0LA 3P4IA 3O9RA 3RMCA 3RR8A 3UE5A 3KVGA 4GY2B 4K41A 5J1EA 3PX4A 3SLCA 5HROA 4KREA 4CEBA 5AFUH 3ENOA 5HRSA 4DF4A 4PWDA 1NWKA 1S1VA 2YNIA 4CZIA 2FF3B 3TSUA 3ZSVA 1P90A 1GLCG 3QESA 1W0HA 1Q81O 3NMUA 2O8DA 3A0IX 3TSPA 1SKSA 2ZWHA 4H0PA 4WE1A 4YOWA 4C8LA 4LFAK 3CJAA 3B6PA 4NLBA 4GVEA 1N36K 5CR4A 3VF2A 2A1SA 1GLBG 5AQVA 3DMJA 3AO2A 4Q0BA 3T1HK 3ENBA 4KO0A 2YKMA 4HHTA 2HHQA 3VMFB 4DG1A 3EKUA 4Z4FA 2PYJA 1WB9A 4K25A 3IS9A 1T3VA 3WEEA 3MX2A 1SL0A 5C0YA 1U4BA 4DLGA 3SQ4A 4FJHA 2P9KA 3AVHA 4E3SA 3CCSN 3O4WA 4LF4K 3KK7A 3LL3A 4DV5K 1GLAG 2YJEA 1HRHA 4IEIA 2D1KA 4DQRA 3TAFA 3BZKA 4C1NK 3LDQA 3PIOL 5E84A 1X9SA 1IKYA 5AZJA 3VESA 1XC3A 3DXKB 2OPSA 3BZCA 1DEJA 3CMEN 3D45A 3TAMA 4GMJB 2QWOA 3NBPA 4JHDA 5LY3A 4DTUA 1NGGA 1Q18A 3QBWA 5DM6L 3VQ4A 1UA1A 1VQ5N 4A62A 1QSLA 1GLLO 5KI6A 1X3NA 1TKDA 1R59O 3MAQA 3CETA 3LAMA 4OGCA 3D2EB 2KKZA 3VQ7A 1JKHA 4LC9B 1YITN 1JL2A 4DR3K 1O13A 1VQPN 4CERA 1GOBA 5AZIA 4BDZA 1FKOA 3THXA 1HKGA 1KFDA 2GEMA 3R9PA 2FC0A 2H3GX 1BDGA 2ZE2A 3B6OA 3D2FA 2B4JA 2OZSA 5BRFA 1NGJA 1YJWN 3VQDA 4IXCA 1RT2A 1RDAA 2HBJA 1VSEA 3QIOA 4BC5A 4K8XA 1TKZA 5GAHP 4DR2K 3MDQA 2D4WA 3CQXA 3C7NA 1J54A 4FZXC 4Z4EA 4B08A 4DU3A 4LD0A 4KFBA 4CF1A 4FJGA 1RT6A 3JAMO 2E8AA 1UA0A 4ELVA 4OKKA 5DK5A 4WFNL 5CY4A 3R1XA 2VWKA 2CGKA 3VEYA 3OS2A 1QZ6A 4CJKA 2P9SA 4C8NA 4LF5K 1N8RO 4IZ9A 3DLHA 1NU0A 4NYNA 3FFKB 4BRHA 1T7PA 2GWKA 2Z1HA 4JN4A 1EKEA 3GOIA 3VEVA 3RRGA 3CERA 3MXMA 4FPBA 1LW0A 3P5JA 3EO3A 4CEOA 4CZLA 3BF1A 4K0KK 4BGAA 4XIUA 3TWHA 3AVCA 2UUCK 4MO5A 4PHTX 4A61A 2P9UB 4JKBA 4IG0A 4BR2A 4KRFA 5AZJB 3AVFA 1ZBHA 3ZSYA 3T3FA 4DHYA 3MEDA 1NK7A 4A5BA 1RDCA 1FK9A 2Q3SA 2F4VK 2NRTA 3LP1A 3O3HA 3VPZA 2QWQA 5AQNA 1L3VA 4CJ5A 3MEGA 1T05A 4JYAK 3JYTA 1WN7A 4KPYA 1TK8A 3TARA 2FXUA 4FCYA 4FOEA 4NYFA 1S9EA 1TAQA 1E4GT 1WSEA 3OJSA 4CD1A 1VSKA 1J6ZA 5AZIB 1YUWA 3SK3A 4E1MA 3PX6A 3ISNC 4Y1CA 2E1ZA 4M45A 4CGDA 4HCBA 4CE9A 4CJ7A 4FW1A 1B9FA 3CCQN 4C8MA 3UKUA 3K5MA 1YTAA 4IJNA 3WXIA 4CGJA 1RT7A 4N5SA 1BU6O 1YVUA 3VQ5A 3TTDA 1XI1A 4GW6A 4W5NA 3C7NB 3H1VX 2RF2A 4OGEA 2ZF5O 4FWPA 1X3MA 1MWMA 3DLEA 3DLLL 4KKOA 4CHOA 4BACA 3HO1A 1VAZA 5JMVA 3OY9A 3LWLA 4FJ7A 1NJZA 4DV7K 4U67L 2OCEA 1JLAA 2YNHA 3AAPA 4DFMA 2QEXN 2CH5A 4O44A 4DTNA 4C23A 3OYLA 2IOCA 3ZT0A 4I6MB 3VEWA 3KJVA 5EVZA 3C95A 4CHQA 3L2WA 4DSIA 2XY7A 4NCGA 4OKJA 4CF8A 1YTUA 4JKAA 3PSFA 3SQ0A 4QS8A 5M1KA 3CFPA 4B3TK 1NK4A 2BGGA 3EEQA 2F8SA 3U3YA 4CESA 4IDHA 1WAFA 5FLXO 1GLDG 1W2BM 1KQSM 1VQLN 2A41A 4BRLA 4N47A 4CIFA 2UXBK 3H46O 3OYIA 3QBXA 1L3TA 4DV4K 3DOLA 3GBTA 4DWIA 2E5LK 3DXMB 3FZHA 3C94A 3ID8A 4DSJA 4A2AA 1DTTA 3QINA 4H5TA 4JI6K 3G4SN 4JAXA 4I9QA 2JWKA 3DLRA 4FK4A 3M8QA 3GE1A 3AGRA 5FPMA 3RRHA 3OS1A 2Y1IA 1SAZA 1W97L 1NGDA 1YIJN 3SNNA 3HVTA 5JLHA 1ZXOA 3V9XA 2P5GA 2I7PA 1HNXK 3H6EA 2W41A 4KI4A 3K9JA 3ULEA 4EHTA 2Y1JA 4BC3A 3H3NO 4DF8A 4OJRA 3IAYA 3A5NC 3ZX0A 3RMBA 4PA1A 5M1FA 3LP3A 1KRPA 2X6SA 4RWTA 3PV8A 3O3GA 3N4PA 2W6KA 2E4LA 3AGKA 4TSXA 4M7XA 3L4QA 5JICA 4FWSA 4JI5K 3EYZA 2D0CA 2EWSA 4RW4A 4BRDA 4ELUA 3V9ZA 4QCLA 3GG4A 2G8VA 3WXKA 3KLEA 3SQ1A 1HKBA 3R8EA 3J8AA 2OPPA 1BI4B 2O8BA 4BDYA 2ITMA 1YF5L 1IKXA 2YHXA 3TAQA 4B8CA 3ID6A 1S1TA 3HL8A 4E19A 1M1KO 4CFCA 3F2KA 4KH4A 3EL2A 5M1PA 3P1GA 1ASUA 2VWJA 4DUYK 4CJEA 4JK9A 2F8TA 5M1OA 2UUAK 3ZCMA 4CZHA 2IDOA 4H0YB 4IWVA 1RBRA 4CGHA 3NH1A 4DQQA 4DV1K 4E7IA 3AY9A 3PLAA 4O55A 5AQFA 5SZTA 2G8WA 1Y97A 4IFYA 4MFBA 4JLHA 3RSEA 4FLVA 5FDLA 2OTJN 4YY3K 3AVJA 4I2QA 1GOAA 5I3UA 3KD1E 1ESVA 2O4GA 5E26A 3KLFA 1TKTA 2E2NA 4B9MA 1BA0A 1Z6RA 3E9PA 4JEPA 3MMVA 2V52B 2VGMA 3SBTA 4OLAA 4JKHA 3FFIA 3VTHA 3ZSRA 4NLCA 3QLHA 4JD2A 4DFPA 5T7BA 3VF4A 1UWBA 1VQ6N 3HZ6A 3C6UA 3J7AP 4CK2A 5F0XA 4BWJA 2FSNA 4N41A 4B9VA 2IVNA 1D8YA 4XH5A 4CCHA 5LJVA 3RWUA 2JLEA 2NLXA 2V51B 4DCHA 4AHSA 5HLFA 3V6DA 4J2AA 4O4GA 3VQ8A 1VHXA 5KTQA 4CZJA 1XMQK 2RKIA 3ULEB 4O5BA 1REVA
chains in the Genus database with same CATH topology
3KK2A 3ZSXA 4JS5A 4OPJA 3V9SA 4FJNA 3AA2A 4HUFA 5JS2A 1SKSA 1SV5A 1WSIA 3L3UA 3HPGA 4WE1A 1NK9A 2QKKA 4C8LA 4W5TA 3AO1A 4KV8A 3B6PA 4PY5A 1CLQA 3UIQA 1IH7A 1Q8IA 1IO2A 2OPQA 3WNEA 1B9DA 3VQCA 1NKBA 2OYQA 2A1SA 3SPZA 1BQNA 3K59A 4PQUA 1KSPA 4B3OA 1RBUA 4KTWA 3DMJA 2I5JA 3AO2A 3ASMA 3K5NA 1BCMA 3PUFA 4Q0BA 2G8UA 4HTUA 4KO0A 4CIGA 2YKMA 4HHTA 4ZTJA 2HHQA 3K5OA 4DG1A 4FJ5A 1D9DA 4FJMA 1KLMA 1WLJA 1KLNA 4OKEA 4Z4FA 2PYJA 2HHWA 2P5OA 3AO5A 1TK0A 3OYBA 3AVBA 3NE6A 3IS9A 4DFKA 1JLEA 2G8FA 1SL0A 1LAVA 5FRMA 2ZQBA 4DLGA 1U4BA 3SQ4A 4ZHRA 4FJHA 4B9SA 3AVHA 4E3SA 3K2PA 3SJJA 1NKEA 3QEIA 2PY5A 3VQQA 4C8OA 3IG1A 1LWCA 4CHYA 1WSJA 4FK0A 2HHTA 5FRNA 3KKRA 2HHUA 1HRHA 4E7KA 5K14A 4DQRA 4DS5A 3TAFA 2HHXA 3LAKA 1Q9XA 1KTQA 1S1WA 1X9SA 3DRSA 1IKYA 3ZSWA 3NDKA 4N76A 1RTHA 4H8KA 3ZT2A 3RR7A 3ULDA 1VRUA 3V9WA 1N6QA 1LWEA 4CEDA 3PO4A 4DSIA 2OPSA 2X78A 1RTIA 4FLWA 2KTQA 2D5RA 3D45A 5EU7A 3TAMA 1NJWA 4GMJB 3NBPA 1TV6A 3DLKA 4CEZA 4E7HA 4DTUA 3VN5A 4IKFA 4M3XA 4KHWA 3THVA 1KVAA 2E6MA 1TGOA 4B9LA 1RDBA 3D0PA 1RBTA 1QS4A 3VA0A 4KTQA 1Z25A 2DFEA 2E6LA 3ALYA 3LP2A 3VQ4A 1UA1A 3HSTB 1TVRA 3O3FA 1QSLA 4CEEA 1KCFA 1UAXA 4FW2A 1RILA 5KI6A 3G0ZA 1O1WA 3NFAA 4DSLA 4K8ZA 1TKDA 2QKBA 4CJRA 3MAQA 3I0SA 3BGRA 3AVLA 1VSJA 3LAMA 4OGCA 4CK1A 4OLBA 3O4QA 3VQ7A 1JKHA 4E0DA 1JL2A 2HB5A 2WOMA 3NGYA 3V4IA 4FK2A 2IAJA 2W42A 4CERA 3F73A 4Z4CA 1X9WA 3OYAA 3KLHA 1GOBA 4BDZA 1FKOA 1KFDA 2D0BA 1A5VA 1S9GA 1TKXA 1U47A 4F3TA 1TAUA 1BI4A 2FC0A 3KK3A 5C42A 2Z1JA 3QNNA 4CJUA 3TAPA 2ZE2A 1BQMA 3B6OA 1RNHA 3DRPA 4CJLA 4E89A 1EP4A 2B4JA 2OZSA 3TAEA 3OJUA 2FBTA 4CEFA 3LP0A 3A2FA 4FLUA 3NHGA 2HVIA 4CF2A 1BIZA 3VQDA 3SUNA 4I9LA 3LPTA 3K57A 1RT2A 1RDAA 2HNDA 4N56A 1VSEA 4B9TA 3QIOA 4OPKA 3SQ2A 2RPIA 1XHZA 3LALA 4K8XA 2EX3A 1ASVA 1TKZA 2LSNA 3TABA 4DU4A 3AA4A 1QSYA 1VSDA 4DTPA 1J54A 3SI6A 4FZXC 4CJ4A 4Z4EA 4B08A 3M8RA 4DU3A 3QETA 3AVGA 4LD0A 4DTRA 4KFBA 4AHRA 4CF1A 1YT3A 3NAEA 1RT6A 3JSMA 4DTSA 4FJGA 4Z4HA 1ZBIA 3OYFA 3NGZA 3CFRA 1UA0A 4ELVA 4OKKA 5DK5A 1BCOA 5CY4A 1C0UA 1HQUA 2VWKA 3V1OA 1XWLA 3OS2A 1CZ9A 3M8PA 1RTDA 1S1XA 2YKNA 1NOYA 3V1RA 4Z0UA 3ZT1A 3ZT4A 4CJKA 4FJJA 4KHUA 4C8NA 3HJFA 2HVHA 3DLHA 1IKWA 1BGXT 1D5AA 1U04A 4NYNA 4CFDA 2R7YA 1T7PA 4NCAA 4LSNA 4I2PA 2Z1HA 3L2QA 3CM6A 1EKEA 5KRTA 1A5WA 4C8KA 1HQEA 3F9KA 3RRGA 2P1JA 1RBSA 3DI6A 1LW0A 3MXMA 3KIOA 1JXBA 1SL1A 3NF8A 3P5JA 4CEOA 4M3WA 4Z4GA 1W9HA 3G10A 4XIUA 3K58A 3TWHA 1ZBFA 1X9MA 4DQPA 3DRRA 1QE1A 3AVCA 4CJVA 5HRPA 4DLEA 4F2SA 2AJQA 2ZD1A 4FVMA 4Y1DA 4YFUA 4BE2A 1JLGA 4DSFA 4IG0A 3SPYA 3L8BA 3NH2A 4KRFA 4HCCA 4KI6A 2X6NA 3AVFA 1ZBHA 4CHNA 4Q5VA 4DTXA 3SUPA 4FJKA 4FJXA 3ZSYA 4IFVA 3T3FA 4KB1A 2FBVA 4B8AB 2IS3A 1Q9YA 4RG8A 4M3TA 3MEDA 1NK7A 5JS1A 3O4NA 3SYZA 3NCIA 1DTQA 1KVBA 1RDCA 1FK9A 2Q3SA 1IKVA 3ZSOA 3HXMA 4W5RA 2HMIA 4J2DA 4W5QA 3LP1A 3LANA 1RTJA 3NF6A 3VQAA 3O3HA 2IC3A 3DM2A 1BHLA 4O0JA 1C6VA 1SKRA 1S6PA 4F3OA 1L3VA 3VQBA 2ITGA 4CJ5A 4ID1A 2KZMA 4DSKA 3MEGA 1T05A 3KK1A 4FM2A 4EZ9A 4BE0A 1N5YA 3JYTA 1WN7A 2F96A 3V1QA 2O4IA 1WAJA 4H4MA 3HPOA 1VSFA 4CEQA 4DS4A 1L3UA 1RCHA 3AVIA 3OYMA 1TK8A 2BDPA 4KPYA 3TARA 3VQEA 4FCYA 3SV4A 4NYFA 3ZT3A 4J2BA 1S9EA 1TAQA 5CYQA 3SV3A 4CJ3A 1WSEA 1TL1A 3OJSA 4LH5A 5KGWA 4H4OA 1VSKA 4CJSA 3SUOA 4KTZA 4FJ8A 4E1MA 3PX6A 3ISNC 4Y1CA 3KD5E 5CZ1A 4M45A 4CGDA 4HVJA 1FXXA 3QIPA 5J2QA 4HCBA 4CE9A 1JL1A 4FLYA 3QEXA 1NJYA 4FW1A 1B9FA 3TR8A 1SL2A 3MECA 4C8MA 2WONA 1L3SA 3S3OA 4GVMA 3OYCA 4I7FA 3K5MA 1JXEA 1YTAA 3K5LA 3V81A 4FJ9A 5HBMA 1JLFA 1U49A 1ZBUA 2IGIA 2XO7A 4L8RB 2DY4A 4CGJA 4M3ZA 3ITHA 1RT7A 1RT5A 3VQ5A 1YVUA 4N5SA 3SZ2A 1XI1A 1S5JA 4DMNA 3PO5A 4FXDA 4B9NA 1MU2A 4CGIA 3RMAA 4GW6A 4W5NA 2KFZA 1WSGA 4E7JA 4E7LA 4RW6A 4OGEA 2RF2A 3MXIA 3AA3A 1ZBLA 3TANA 4PUOA 3RTVA 2HNYA 1ITGA 3DLEA 4AILC 4M41A 3DLBA 1ASWA 1BL3A 4EP4A 4KKOA 3QEWA 1SUQA 4CHOA 3HVRA 3HT3A 4BACA 3VA3A 3HO1A 3OY9A 3LWLA 1X1PA 5HRRA 4HUEA 4ELTA 4FJ7A 4NCBA 1C1AA 4M42A 1NJZA 1NOZA 3V9UA 5J2PA 3QERA 1JLAA 2YNHA 4JRQA 4W5OA 4DQSA 5E41A 4DFMA 2BANA 1D9FA 4RW8A 4B9UA 4DQIA 1EXQA 4O44A 4AHVA 4DTNA 4QAGA 3CQ8A 4IG3A 4FLTA 3OYLA 2IOCA 1NK8A 3KLGA 3QO9A 3ZT0A 3LWMA 3EZ5A 1HMVA 2HW3A 1SKWA 3OYHA 4AHCA 3DLGA 4CJPA 1I39A 3AA5X 3C95A 4M3RA 2VG5A 3ZSQA 4CHQA 1WSHA 3KJVA 3L2WA 3LZIA 4LH4A 3U6FA 2XY7A 4E1NA 2G8HA 1VSHA 2HHSA 2XHBA 4NCGA 1JLQA 3OYNA 4BWMA 4OKJA 3VQ6A 3M8SA 3WNFA 4CF8A 3OVNA 3PX0A 2GUIA 4RW9A 1YTUA 2ETJA 4UQGA 2JGUA 3SQ0A 1HPZA 2GBZA 3CFPA 3E01A 1NK4A 4M3UA 3LDSA 2BGGA 3U3YA 2F8SA 4CESA 3VQPA 2QXFA 1I3AA 1WAFA 3S3NA 4FM1A 4KB0A 2GV9A 3NF7A 1HYSA 3OYGA 1NJXA 4N47A 4CJQA 3WNGA 3SUQA 1JLBA 4CFBA 4CIFA 4DSEA 2NUBA 3OYIA 4FLXA 4KHNA 1L3TA 4M3YA 4KAZA 3DOLA 4DWIA 4KHQA 3P83D 4CF0A 5CYMA 3C94A 3AVKA 4CGGA 4DSJA 2XY5A 2XY6A 4DTOA 1CXQA 1R0AA 1EX4A 3T1AA 5KRSA 4FJLA 3NF9A 3QNOA 1KVCA 3H08A 4DU1A 1LWFA 1WNSA 1DTTA 2DFHA 2DFFA 3QINA 3TAGA 1NK5A 2KZZA 3TI0A 4I9QA 1C1CA 3DLRA 1HNIA 3M8QA 4CJFA 4FK4A 1JLCA 2PZSA 4DTMA 1U48A 4ID5A 3RRHA 4F4KA 1C0MA 3OS1A 4LY7A 2Y1IA 4DFJA 5D3GA 2Z1IA 1RBVA 3SNNA 5HRNA 3HVTA 2G8IA 3V9XA 2P5GA 3OYJA 3HM9A 4Z4IA 4O0IA 2FBXA 2FBYA 1J53A 4FJIA 2QK9A 4G1QA 3DOKA 3S3MA 4DTJA 2Y1JA 3SCXA 1KFSA 4KI4A 4LSLA 2B5JA 4ICLA 4DF8A 3CYMA 3KKSA 4OJRA 1CZBA 4CF9A 4FM0A 4CIEA 3IAYA 4F2RA 1RT1A 1VSMA 1HYVA 3RMBA 2YV0X 4F8RA 1NKCA 4PA1A 3LP3A 3OYKA 4BDPA 1WSFA 1LW2A 4YNQA 1KRPA 4KHSA 1TL3A 2X6SA 5J2NA 2PYLA 3PV8A 3O3GA 4CHZA 1XC9A 1GOCA 5I42A 1RDDA 2E4LA 4CJTA 3CFOA 4IDKA 4TSXA 3DYAA 4AH9A 3S9HA 3EYZA 2D0CA 4RW4A 5FROA 2XY8A 3V9ZA 4ELUA 2G8VA 4QCLA 1BIUA 3KLEA 3SQ1A 3MXJA 2HNZA 2VG6A 4IBNA 1IG9A 4QOZB 2YHBA 2OPPA 1F21A 4J2EA 4FZYA 1UOCA 2G8KA 4CECA 1BI4B 4CJWA 3EY1A 5C24A 1VSIA 4BDYA 2KQ2A 1EETA 5CZ2A 4AHUA 3LPUA 2YHAA 3KTQA 3WNHA 3HYFA 3HPHA 2X74A 1IKXA 3TAQA 4EP5A 2XRIA 3IRXA 4B8CA 1S1TA 3HL8A 4E19A 2ATQA 1BISA 1XHXA 4CFCA 1J9AA 4R5PA 3NH0A 2Z1GA 1VK0A 2OA8A 3P1GA 1ASUA 2VWJA 3CG7A 3T19A 4CJEA 3QEVA 3OS0A 2YNGA 2F8TA 3NGIA 3LZJA 3AO3A 1K6YA 1HYZA 3CM5A 1L5UA 3ZCMA 1J5OA 2IDOA 4CGHA 3HK2A 1RBRA 3NH1A 4DQQA 2RN2A 4BE1A 4CEAA 4E7IA 3MEEA 1CXUA 3HP9A 3L3VA 4O5BA 2OZMA 5SZTA 4JS4A 2G8WA 2B6AA 5J2MA 3AVAA 1LV5A 1Y97A 4IFYA 4MFBA 4JLHA 5C25A 4EZ6A 1LAWA 1ZYQA 1T8EA 4FLVA 3AVNA 4MQ3A 5FDLA 1S6QA 1C1BA 1HJRA 1S1UA 3AO4A 1VRTA 3AVJA 3AVMA 1RT4A 4I2QA 2A1RA 1VSLA 1GOAA 5I3UA 4ZTFA 1RT3A 3KD1E 1QHTA 2O4GA 4RW7A 3KLFA 1TKTA 4B9MA 3L2RA 3OYEA 2BE2A 2HHVA 4AHTA 4CK3A 3HP6A 3L2VA 3BDPA 4OLAA 4FZZA 3FFIA 3C6TA 4OVLA 5HP1A 3ZSRA 2YNFA 3QLHA 4DFPA 1QTMA 5T7BA 1QSSA 1UWBA 2P51A 1HNVA 2OPRA 5DMRA 5KGXA 3I8DA 1B92A 2EHGA 1Z26A 3AV9A 3C6UA 2D0AA 2KW4A 4CGFA 4CK2A 3L2UA 1TK5A 4BWJA 4KHYA 3KLIA 4N41A 3RMCA 3RR8A 4B9VA 5SWMA 1G15A 2VG7A 5J1EA 4JRPA 1C0TA 3QEPA 4CFAA 3PX4A 5HROA 4KREA 4CEBA 1NK0A 2KFNA 1T03A 1D8YA 4CCHA 3PY8A 3RWUA 2JLEA 4FLZA 5HRSA 3VQ9A 4DF4A 4PWDA 1S1VA 4HUGA 1QQCA 2YNIA 1U45A 1DLOA 3ZSZA 4AHSA 3RMDA 3ZSVA 5HLFA 2DTUA 3I0RA 1FKPA 3V6DA 4J2AA 4CHPA 4O4GA 3VQ8A 1W0HA 3OYDA 5KTQA 1A5XA 3QESA 1NK6A 2RKIA 4FYDA 3U3GA 4O55A 1REVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KK2 A;  3ZSX A;  4JS5 A;  4OPJ A;  3V9S A;  4FJN A;  3AA2 A;  4HUF A;  5JS2 A;  1SKS A;  1SV5 A;  1WSI A;  3L3U A;  3HPG A;  4WE1 A;  1NK9 A;  2QKK A;  4C8L A;  4W5T A;  3AO1 A;  4KV8 A;  3B6P A;  4PY5 A;  1CLQ A;  3UIQ A;  1IH7 A;  1Q8I A;  1IO2 A;  2OPQ A;  3WNE A;  1B9D A;  3VQC A;  1NKB A;  2OYQ A;  2A1S A;  3SPZ A;  1BQN A;  3K59 A;  4PQU A;  1KSP A;  4B3O A;  1RBU A;  4KTW A;  3DMJ A;  2I5J A;  3AO2 A;  3ASM A;  3K5N A;  1BCM A;  3PUF A;  4Q0B A;  2G8U A;  4HTU A;  4KO0 A;  4CIG A;  2YKM A;  4HHT A;  4ZTJ A;  2HHQ A;  3K5O A;  4DG1 A;  4FJ5 A;  1D9D A;  4FJM A;  1KLM A;  1WLJ A;  1KLN A;  4OKE A;  4Z4F A;  2PYJ A;  2HHW A;  2P5O A;  3AO5 A;  1TK0 A;  3OYB A;  3AVB A;  3NE6 A;  3IS9 A;  4DFK A;  1JLE A;  2G8F A;  1SL0 A;  1LAV A;  5FRM A;  2ZQB A;  4DLG A;  1U4B A;  3SQ4 A;  4ZHR A;  4FJH A;  4B9S A;  3AVH A;  4E3S A;  3K2P A;  3SJJ A;  1NKE A;  3QEI A;  2PY5 A;  3VQQ A;  4C8O A;  3IG1 A;  1LWC A;  4CHY A;  1WSJ A;  4FK0 A;  2HHT A;  5FRN A;  3KKR A;  2HHU A;  1HRH A;  4E7K A;  5K14 A;  4DQR A;  4DS5 A;  3TAF A;  2HHX A;  3LAK A;  1Q9X A;  1KTQ A;  1S1W A;  1X9S A;  3DRS A;  1IKY A;  3ZSW A;  3NDK A;  4N76 A;  1RTH A;  4H8K A;  3ZT2 A;  3RR7 A;  3ULD A;  1VRU A;  3V9W A;  1N6Q A;  1LWE A;  4CED A;  3PO4 A;  4DSI A;  2OPS A;  2X78 A;  1RTI A;  4FLW A;  2KTQ A;  2D5R A;  3D45 A;  5EU7 A;  3TAM A;  1NJW A;  4GMJ B;  3NBP A;  1TV6 A;  3DLK A;  4CEZ A;  4E7H A;  4DTU A;  3VN5 A;  4IKF A;  4M3X A;  4KHW A;  3THV A;  1KVA A;  2E6M A;  1TGO A;  4B9L A;  1RDB A;  3D0P A;  1RBT A;  1QS4 A;  3VA0 A;  4KTQ A;  1Z25 A;  2DFE A;  2E6L A;  3ALY A;  3LP2 A;  3VQ4 A;  1UA1 A;  3HST B;  1TVR A;  3O3F A;  1QSL A;  4CEE A;  1KCF A;  1UAX A;  4FW2 A;  1RIL A;  5KI6 A;  3G0Z A;  1O1W A;  3NFA A;  4DSL A;  4K8Z A;  1TKD A;  2QKB A;  4CJR A;  3MAQ A;  3I0S A;  3BGR A;  3AVL A;  1VSJ A;  3LAM A;  4OGC A;  4CK1 A;  4OLB A;  3O4Q A;  3VQ7 A;  1JKH A;  4E0D A;  1JL2 A;  2HB5 A;  2WOM A;  3NGY A;  3V4I A;  4FK2 A;  2IAJ A;  2W42 A;  4CER A;  3F73 A;  4Z4C A;  1X9W A;  3OYA A;  3KLH A;  1GOB A;  4BDZ A;  1FKO A;  1KFD A;  2D0B A;  1A5V A;  1S9G A;  1TKX A;  1U47 A;  4F3T A;  1TAU A;  1BI4 A;  2FC0 A;  3KK3 A;  5C42 A;  2Z1J A;  3QNN A;  4CJU A;  3TAP A;  2ZE2 A;  1BQM A;  3B6O A;  1RNH A;  3DRP A;  4CJL A;  4E89 A;  1EP4 A;  2B4J A;  2OZS A;  3TAE A;  3OJU A;  2FBT A;  4CEF A;  3LP0 A;  3A2F A;  4FLU A;  3NHG A;  2HVI A;  4CF2 A;  1BIZ A;  3VQD A;  3SUN A;  4I9L A;  3LPT A;  3K57 A;  1RT2 A;  1RDA A;  2HND A;  4N56 A;  1VSE A;  4B9T A;  3QIO A;  4OPK A;  3SQ2 A;  2RPI A;  1XHZ A;  3LAL A;  4K8X A;  2EX3 A;  1ASV A;  1TKZ A;  2LSN A;  3TAB A;  4DU4 A;  3AA4 A;  1QSY A;  1VSD A;  4DTP A;  1J54 A;  3SI6 A;  4FZX C;  4CJ4 A;  4Z4E A;  4B08 A;  3M8R A;  4DU3 A;  3QET A;  3AVG A;  4LD0 A;  4DTR A;  4KFB A;  4AHR A;  4CF1 A;  1YT3 A;  3NAE A;  1RT6 A;  3JSM A;  4DTS A;  4FJG A;  4Z4H A;  1ZBI A;  3OYF A;  3NGZ A;  3CFR A;  1UA0 A;  4ELV A;  4OKK A;  5DK5 A;  1BCO A;  5CY4 A;  1C0U A;  1HQU A;  2VWK A;  3V1O A;  1XWL A;  3OS2 A;  1CZ9 A;  3M8P A;  1RTD A;  1S1X A;  2YKN A;  1NOY A;  3V1R A;  4Z0U A;  3ZT1 A;  3ZT4 A;  4CJK A;  4FJJ A;  4KHU A;  4C8N A;  3HJF A;  2HVH A;  3DLH A;  1IKW A;  1BGX T;  1D5A A;  1U04 A;  4NYN A;  4CFD A;  2R7Y A;  1T7P A;  4NCA A;  4LSN A;  4I2P A;  2Z1H A;  3L2Q A;  3CM6 A;  1EKE A;  5KRT A;  1A5W A;  4C8K A;  1HQE A;  3F9K A;  3RRG A;  2P1J A;  1RBS A;  3DI6 A;  1LW0 A;  3MXM A;  3KIO A;  1JXB A;  1SL1 A;  3NF8 A;  3P5J A;  4CEO A;  4M3W A;  4Z4G A;  1W9H A;  3G10 A;  4XIU A;  3K58 A;  3TWH A;  1ZBF A;  1X9M A;  4DQP A;  3DRR A;  1QE1 A;  3AVC A;  4CJV A;  5HRP A;  4DLE A;  4F2S A;  2AJQ A;  2ZD1 A;  4FVM A;  4Y1D A;  4YFU A;  4BE2 A;  1JLG A;  4DSF A;  4IG0 A;  3SPY A;  3L8B A;  3NH2 A;  4KRF A;  4HCC A;  4KI6 A;  2X6N A;  3AVF A;  1ZBH A;  4CHN A;  4Q5V A;  4DTX A;  3SUP A;  4FJK A;  4FJX A;  3ZSY A;  4IFV A;  3T3F A;  4KB1 A;  2FBV A;  4B8A B;  2IS3 A;  1Q9Y A;  4RG8 A;  4M3T A;  3MED A;  1NK7 A;  5JS1 A;  3O4N A;  3SYZ A;  3NCI A;  1DTQ A;  1KVB A;  1RDC A;  1FK9 A;  2Q3S A;  1IKV A;  3ZSO A;  3HXM A;  4W5R A;  2HMI A;  4J2D A;  4W5Q A;  3LP1 A;  3LAN A;  1RTJ A;  3NF6 A;  3VQA A;  3O3H A;  2IC3 A;  3DM2 A;  1BHL A;  4O0J A;  1C6V A;  1SKR A;  1S6P A;  4F3O A;  1L3V A;  3VQB A;  2ITG A;  4CJ5 A;  4ID1 A;  2KZM A;  4DSK A;  3MEG A;  1T05 A;  3KK1 A;  4FM2 A;  4EZ9 A;  4BE0 A;  1N5Y A;  3JYT A;  1WN7 A;  2F96 A;  3V1Q A;  2O4I A;  1WAJ A;  4H4M A;  3HPO A;  1VSF A;  4CEQ A;  4DS4 A;  1L3U A;  1RCH A;  3AVI A;  3OYM A;  1TK8 A;  2BDP A;  4KPY A;  3TAR A;  3VQE A;  4FCY A;  3SV4 A;  4NYF A;  3ZT3 A;  4J2B A;  1S9E A;  1TAQ A;  5CYQ A;  3SV3 A;  4CJ3 A;  1WSE A;  1TL1 A;  3OJS A;  4LH5 A;  5KGW A;  4H4O A;  1VSK A;  4CJS A;  3SUO A;  4KTZ A;  4FJ8 A;  4E1M A;  3PX6 A;  3ISN C;  4Y1C A;  3KD5 E;  5CZ1 A;  4M45 A;  4CGD A;  4HVJ A;  1FXX A;  3QIP A;  5J2Q A;  4HCB A;  4CE9 A;  1JL1 A;  4FLY A;  3QEX A;  1NJY A;  4FW1 A;  1B9F A;  3TR8 A;  1SL2 A;  3MEC A;  4C8M A;  2WON A;  1L3S A;  3S3O A;  4GVM A;  3OYC A;  4I7F A;  3K5M A;  1JXE A;  1YTA A;  3K5L A;  3V81 A;  4FJ9 A;  5HBM A;  1JLF A;  1U49 A;  1ZBU A;  2IGI A;  2XO7 A;  4L8R B;  2DY4 A;  4CGJ A;  4M3Z A;  3ITH A;  1RT7 A;  1RT5 A;  3VQ5 A;  1YVU A;  4N5S A;  3SZ2 A;  1XI1 A;  1S5J A;  4DMN A;  3PO5 A;  4FXD A;  4B9N A;  1MU2 A;  4CGI A;  3RMA A;  4GW6 A;  4W5N A;  2KFZ A;  1WSG A;  4E7J A;  4E7L A;  4RW6 A;  4OGE A;  2RF2 A;  3MXI A;  3AA3 A;  1ZBL A;  3TAN A;  4PUO A;  3RTV A;  2HNY A;  1ITG A;  3DLE A;  4AIL C;  4M41 A;  3DLB A;  1ASW A;  1BL3 A;  4EP4 A;  4KKO A;  3QEW A;  1SUQ A;  4CHO A;  3HVR A;  3HT3 A;  4BAC A;  3VA3 A;  3HO1 A;  3OY9 A;  3LWL A;  1X1P A;  5HRR A;  4HUE A;  4ELT A;  4FJ7 A;  4NCB A;  1C1A A;  4M42 A;  1NJZ A;  1NOZ A;  3V9U A;  5J2P A;  3QER A;  1JLA A;  2YNH A;  4JRQ A;  4W5O A;  4DQS A;  5E41 A;  4DFM A;  2BAN A;  1D9F A;  4RW8 A;  4B9U A;  4DQI A;  1EXQ A;  4O44 A;  4AHV A;  4DTN A;  4QAG A;  3CQ8 A;  4IG3 A;  4FLT A;  3OYL A;  2IOC A;  1NK8 A;  3KLG A;  3QO9 A;  3ZT0 A;  3LWM A;  3EZ5 A;  1HMV A;  2HW3 A;  1SKW A;  3OYH A;  4AHC A;  3DLG A;  4CJP A;  1I39 A;  3AA5 X;  3C95 A;  4M3R A;  2VG5 A;  3ZSQ A;  4CHQ A;  1WSH A;  3KJV A;  3L2W A;  3LZI A;  4LH4 A;  3U6F A;  2XY7 A;  4E1N A;  2G8H A;  1VSH A;  2HHS A;  2XHB A;  4NCG A;  1JLQ A;  3OYN A;  4BWM A;  4OKJ A;  3VQ6 A;  3M8S A;  3WNF A;  4CF8 A;  3OVN A;  3PX0 A;  2GUI A;  4RW9 A;  1YTU A;  2ETJ A;  4UQG A;  2JGU A;  3SQ0 A;  1HPZ A;  2GBZ A;  3CFP A;  3E01 A;  1NK4 A;  4M3U A;  3LDS A;  2BGG A;  3U3Y A;  2F8S A;  4CES A;  3VQP A;  2QXF A;  1I3A A;  1WAF A;  3S3N A;  4FM1 A;  4KB0 A;  2GV9 A;  3NF7 A;  1HYS A;  3OYG A;  1NJX A;  4N47 A;  4CJQ A;  3WNG A;  3SUQ A;  1JLB A;  4CFB A;  4CIF A;  4DSE A;  2NUB A;  3OYI A;  4FLX A;  4KHN A;  1L3T A;  4M3Y A;  4KAZ A;  3DOL A;  4DWI A;  4KHQ A;  3P83 D;  4CF0 A;  5CYM A;  3C94 A;  3AVK A;  4CGG A;  4DSJ A;  2XY5 A;  2XY6 A;  4DTO A;  1CXQ A;  1R0A A;  1EX4 A;  3T1A A;  5KRS A;  4FJL A;  3NF9 A;  3QNO A;  1KVC A;  3H08 A;  4DU1 A;  1LWF A;  1WNS A;  1DTT A;  2DFH A;  2DFF A;  3QIN A;  3TAG A;  1NK5 A;  2KZZ A;  3TI0 A;  4I9Q A;  1C1C A;  3DLR A;  1HNI A;  3M8Q A;  4CJF A;  4FK4 A;  1JLC A;  2PZS A;  4DTM A;  1U48 A;  4ID5 A;  3RRH A;  4F4K A;  1C0M A;  3OS1 A;  4LY7 A;  2Y1I A;  4DFJ A;  5D3G A;  2Z1I A;  1RBV A;  3SNN A;  5HRN A;  3HVT A;  2G8I A;  3V9X A;  2P5G A;  3OYJ A;  3HM9 A;  4Z4I A;  4O0I A;  2FBX A;  2FBY A;  1J53 A;  4FJI A;  2QK9 A;  4G1Q A;  3DOK A;  3S3M A;  4DTJ A;  2Y1J A;  3SCX A;  1KFS A;  4KI4 A;  4LSL A;  2B5J A;  4ICL A;  4DF8 A;  3CYM A;  3KKS A;  4OJR A;  1CZB A;  4CF9 A;  4FM0 A;  4CIE A;  3IAY A;  4F2R A;  1RT1 A;  1VSM A;  1HYV A;  3RMB A;  2YV0 X;  4F8R A;  1NKC A;  4PA1 A;  3LP3 A;  3OYK A;  4BDP A;  1WSF A;  1LW2 A;  4YNQ A;  1KRP A;  4KHS A;  1TL3 A;  2X6S A;  5J2N A;  2PYL A;  3PV8 A;  3O3G A;  4CHZ A;  1XC9 A;  1GOC A;  5I42 A;  1RDD A;  2E4L A;  4CJT A;  3CFO A;  4IDK A;  4TSX A;  3DYA A;  4AH9 A;  3S9H A;  3EYZ A;  2D0C A;  4RW4 A;  5FRO A;  2XY8 A;  3V9Z A;  4ELU A;  2G8V A;  4QCL A;  1BIU A;  3KLE A;  3SQ1 A;  3MXJ A;  2HNZ A;  2VG6 A;  4IBN A;  1IG9 A;  4QOZ B;  2YHB A;  2OPP A;  1F21 A;  4J2E A;  4FZY A;  1UOC A;  2G8K A;  4CEC A;  1BI4 B;  4CJW A;  3EY1 A;  5C24 A;  1VSI A;  4BDY A;  2KQ2 A;  1EET A;  5CZ2 A;  4AHU A;  3LPU A;  2YHA A;  3KTQ A;  3WNH A;  3HYF A;  3HPH A;  2X74 A;  1IKX A;  3TAQ A;  4EP5 A;  2XRI A;  3IRX A;  4B8C A;  1S1T A;  3HL8 A;  4E19 A;  2ATQ A;  1BIS A;  1XHX A;  4CFC A;  1J9A A;  4R5P A;  3NH0 A;  2Z1G A;  1VK0 A;  2OA8 A;  3P1G A;  1ASU A;  2VWJ A;  3CG7 A;  3T19 A;  4CJE A;  3QEV A;  3OS0 A;  2YNG A;  2F8T A;  3NGI A;  3LZJ A;  3AO3 A;  1K6Y A;  1HYZ A;  3CM5 A;  1L5U A;  3ZCM A;  1J5O A;  2IDO A;  4CGH A;  3HK2 A;  1RBR A;  3NH1 A;  4DQQ A;  2RN2 A;  4BE1 A;  4CEA A;  4E7I A;  3MEE A;  1CXU A;  3HP9 A;  3L3V A;  4O5B A;  2OZM A;  5SZT A;  4JS4 A;  2G8W A;  2B6A A;  5J2M A;  3AVA A;  1LV5 A;  1Y97 A;  4IFY A;  4MFB A;  4JLH A;  5C25 A;  4EZ6 A;  1LAW A;  1ZYQ A;  1T8E A;  4FLV A;  3AVN A;  4MQ3 A;  5FDL A;  1S6Q A;  1C1B A;  1HJR A;  1S1U A;  3AO4 A;  1VRT A;  3AVJ A;  3AVM A;  1RT4 A;  4I2Q A;  2A1R A;  1VSL A;  1GOA A;  5I3U A;  4ZTF A;  1RT3 A;  3KD1 E;  1QHT A;  2O4G A;  4RW7 A;  3KLF A;  1TKT A;  4B9M A;  3L2R A;  3OYE A;  2BE2 A;  2HHV A;  4AHT A;  4CK3 A;  3HP6 A;  3L2V A;  3BDP A;  4OLA A;  4FZZ A;  3FFI A;  3C6T A;  4OVL A;  5HP1 A;  3ZSR A;  2YNF A;  3QLH A;  4DFP A;  1QTM A;  5T7B A;  1QSS A;  1UWB A;  2P51 A;  1HNV A;  2OPR A;  5DMR A;  5KGX A;  3I8D A;  1B92 A;  2EHG A;  1Z26 A;  3AV9 A;  3C6U A;  2D0A A;  2KW4 A;  4CGF A;  4CK2 A;  3L2U A;  1TK5 A;  4BWJ A;  4KHY A;  3KLI A;  4N41 A;  3RMC A;  3RR8 A;  4B9V A;  5SWM A;  1G15 A;  2VG7 A;  5J1E A;  4JRP A;  1C0T A;  3QEP A;  4CFA A;  3PX4 A;  5HRO A;  4KRE A;  4CEB A;  1NK0 A;  2KFN A;  1T03 A;  1D8Y A;  4CCH A;  3PY8 A;  3RWU A;  2JLE A;  4FLZ A;  5HRS A;  3VQ9 A;  4DF4 A;  4PWD A;  1S1V A;  4HUG A;  1QQC A;  2YNI A;  1U45 A;  1DLO A;  3ZSZ A;  4AHS A;  3RMD A;  3ZSV A;  5HLF A;  2DTU A;  3I0R A;  1FKP A;  3V6D A;  4J2A A;  4CHP A;  4O4G A;  3VQ8 A;  1W0H A;  3OYD A;  5KTQ A;  1A5X A;  3QES A;  1NK6 A;  2RKI A;  4FYD A;  3U3G A;  4O55 A;  1REV A; 
#chains in the Genus database with same CATH topology
 3V9S A;  4OPJ A;  2YHW A;  3AA2 A;  4ILG B;  2HOE A;  5JS2 A;  4BR9 A;  3HPG A;  2P9I B;  1EO1 A;  1Z05 A;  5ADX H;  3L0Q A;  2ZM6 K;  4PY5 A;  3HM8 A;  5AQZ A;  3UIQ A;  1IH7 A;  1Q8I A;  4FWL A;  3HBT A;  3K59 A;  1E3M A;  1KSP A;  1OH6 A;  1RBU A;  2F9T A;  3ASM A;  4QS9 A;  4BG9 A;  1BCM A;  3K5N A;  1NJI O;  3U8X A;  4FJ5 A;  3CJ9 A;  4RTF D;  1ZC6 A;  4J8F A;  2QXL A;  3AVB A;  3FLC O;  2G8F A;  5BRD A;  1IBK K;  2YJF A;  2GWJ A;  4MDA A;  4B9S A;  4GKK K;  3F9M A;  1NKE A;  2I7N A;  1WSJ A;  4DUZ K;  2GUP A;  4E7K A;  5K14 A;  3F5T A;  3LAK A;  1S72 N;  3ZSW A;  1S22 A;  3NDK A;  4DQ8 A;  3ULD A;  1XQS C;  1LWE A;  4CED A;  1RTI A;  2KTQ A;  2ASP A;  2D5R A;  3RSE B;  1NNE A;  4DB3 A;  5GIN A;  4M3X A;  3A5O C;  2JWL A;  1RDB A;  1RBT A;  4OX9 K;  4KTQ A;  1Z25 A;  2E6L A;  3O3F A;  4A5A A;  4JI3 K;  4GNI A;  3NFA A;  1IBL K;  3I0S A;  3IDH A;  4CK1 A;  4OLB A;  3O4Q A;  2F9W A;  3M6G A;  1C0G A;  1OVY A;  3V4I A;  4BR5 A;  2IAJ A;  4H0O A;  3N4Q A;  1QVG M;  3CJB A;  1TKX A;  2HBL A;  2RHK A;  3QNN A;  4H0V B;  4CJU A;  3TAP A;  1BO5 O;  3J81 O;  4ISG A;  3SAG A;  4E89 A;  3WQU A;  1U6Z A;  3ZX2 A;  2FBT A;  4CEF A;  3LP0 A;  3A2F A;  4FLU A;  3SUN A;  1XHZ A;  3LAL A;  3FE1 A;  1ASV A;  2LSN A;  5FPE A;  3TAB A;  1VSD A;  4CJ4 A;  5LMU K;  3QET A;  3BY5 A;  4AHR A;  4YHH K;  4DTS A;  4O5F A;  3NGZ A;  3E66 A;  3OBY A;  1H1V A;  2Q36 A;  1CZ9 A;  3M8P A;  3QB0 A;  2YKN A;  1NOY A;  5BR8 K;  2HVH A;  4CFD A;  1D5A A;  3L6Q A;  2VYP A;  3VOV A;  3CD6 N;  3P38 A;  4C8K A;  1HQE A;  1RBS A;  1SL1 A;  3BP8 A;  2HST A;  3KIO A;  4M7Y A;  3PSI A;  4Z4G A;  1W9H A;  1ZBF A;  3DRR A;  1QE1 A;  3OHR A;  5HRP A;  2AJQ A;  4OO1 J;  3CJ1 A;  4BRC A;  3CMA N;  4DSF A;  3SPY A;  3NH2 A;  4BR4 A;  2IVP A;  4M63 C;  3HSC A;  4KI6 A;  1JCG A;  4CHN A;  4Q5V A;  1XUP O;  2NRR A;  1Q9Y A;  2J4R A;  3SYZ A;  3NCI A;  3WXL A;  1IJJ A;  1VQ7 N;  2E2P A;  1HX1 A;  3LDL A;  4J2D A;  1RTJ A;  4IOX A;  2FLO A;  3VQA A;  1BHL A;  1OH5 A;  5BPM A;  1SKR A;  3P39 A;  1S6P A;  4F3O A;  3VQB A;  1YI2 N;  4LF6 K;  4BRI A;  4BE0 A;  2F96 A;  2QWR A;  1WAJ A;  4H4M A;  3HPO A;  4U7B A;  4DS4 A;  1RCH A;  3OYM A;  4LF8 K;  4GV6 A;  2A5X A;  3VQE A;  3ZT3 A;  4J2B A;  3THY A;  3SV3 A;  3RVC A;  4LF7 K;  1LOT B;  4CJS A;  2P9L A;  4KTZ A;  4H0T B;  3ZYY X;  4HVJ A;  1FXX A;  3QIP A;  2UXD K;  1NJY A;  1TYQ A;  5AQR A;  3TR8 A;  2E88 A;  4CBX A;  2WON A;  3UKR B;  4ISE A;  4MO4 A;  1VQK N;  4I7F A;  1JXE A;  2UUB K;  3K5L A;  4FJ9 A;  5HBM A;  4CBW A;  1U49 A;  4L8R B;  2DY4 A;  2IGI A;  4H5N A;  2XO7 A;  3CC7 N;  1RT5 A;  3SZ2 A;  5GAG P;  1S5J A;  3BEX A;  3J7Z O;  4B9N A;  4CGI A;  2KFZ A;  1G99 A;  4FVU A;  1WSG A;  5GAD P;  3AA3 A;  1ZBL A;  1VQ4 N;  4OPH A;  3IUC A;  3TAN A;  4PUO A;  3RTV A;  1D4X A;  2HNY A;  3ZET A;  4AIL C;  2AP1 A;  4M41 A;  1BL3 A;  5F2R A;  5HRR A;  3A5M C;  4ELT A;  4NCB A;  5C2F A;  1NM1 A;  3QER A;  1TUY A;  2O8D B;  5AQQ A;  5EY4 A;  1FJG K;  1D9F A;  1EXQ A;  1NK8 A;  3CCL N;  3QO9 A;  3LWM A;  1HMV A;  4AHC A;  4CJP A;  4E7L A;  1I39 A;  4M3R A;  2VG5 A;  2HHS A;  4E1N A;  1VSH A;  1JLQ A;  3M8S A;  3OVN A;  3H45 C;  4UQG A;  2JGU A;  3OTO K;  1N32 K;  4XEI A;  1HPZ A;  3VGM A;  3E01 A;  4M3U A;  4BRM A;  3LDS A;  4JK7 A;  2ZJP L;  3O9S A;  3THW A;  3HI0 A;  4JNE A;  4FM1 A;  1QHA A;  3WEE B;  1HYS A;  3OYG A;  4LFC K;  5AQT A;  4YOV A;  1NJX A;  4CJQ A;  2P9K B;  3WNG A;  3FR0 A;  2NUB A;  4DKW A;  4M3Y A;  4KAZ A;  4CF0 A;  5CYM A;  5GIP A;  4DTO A;  1CXQ A;  1R0A A;  1EX4 A;  4DR6 K;  4A59 A;  3NF9 A;  3QNO A;  1LWF A;  1HUX A;  3CC4 N;  1C1C A;  1HNI A;  2PZS A;  4ID5 A;  2E20 A;  4F4K A;  1C0M A;  4JHD B;  1T6D A;  4Z4I A;  3OYJ A;  2HHH K;  1K8K A;  2P9L B;  2QW9 A;  4FJI A;  4G1Q A;  3DOK A;  3S3M A;  4DTJ A;  2PFU A;  4B3M K;  4PKG A;  3KKS A;  1RDW X;  4CF9 A;  4FM0 A;  1TYQ B;  1HYV A;  5C2D A;  1NKC A;  2VWB A;  1KC8 O;  4KHS A;  4K42 A;  2NRX A;  3EE9 A;  4CHZ A;  1XC9 A;  2BUP A;  5I42 A;  3CFO A;  4WFB L;  4X62 K;  2XY8 A;  3MXJ A;  1Q86 O;  2VG6 A;  3VEX A;  4QOZ B;  3THX B;  1E4F T;  4CEC A;  4HTL A;  2OTL N;  4CJW A;  2D0O A;  2KQ2 A;  4AHU A;  1HJO A;  1HLU A;  3WNH A;  3HYF A;  3HPH A;  1EWQ A;  3D2F B;  2XRI A;  1QQN A;  4R5P A;  3ZLJ A;  2NRW A;  3NH0 A;  1VK0 A;  2OA8 A;  3CJC A;  5BR9 A;  3OS0 A;  3HK2 A;  1XMO K;  3NVM A;  1OVQ A;  4PL7 A;  3HP9 A;  2CGL A;  2OZM A;  2B6A A;  3HOS A;  3AVA A;  3WUH A;  3AVN A;  1YJ9 N;  2Q1N A;  1NMN A;  2P9S B;  1NGF A;  3THW B;  1VRT A;  4FWQ A;  2VQF K;  2A1R A;  2BH1 A;  3O9T A;  3W3D A;  1RT3 A;  3EE8 A;  2WUS A;  4X65 K;  3L2R A;  2BE2 A;  4AHT A;  4B1Y B;  3HP6 A;  4YOR A;  4FZZ A;  4OVL A;  2QI2 A;  4MLH A;  4G9Z A;  4DR4 K;  4YOT A;  1ILY A;  4BRP A;  2P51 A;  5DMR A;  4BRN A;  4JI7 K;  2D0A A;  5C12 A;  5BRH A;  3MCP A;  4KHY A;  1MDU B;  2WTU A;  1ZBS A;  1G15 A;  2VG7 A;  1C0T A;  2RE2 A;  5H1S Q;  4FLZ A;  1QQC A;  4CW7 B;  3LDP A;  1DLO A;  1K8K B;  1QQO A;  1FKP A;  1JJ2 M;  1NK6 A;  4BGB A;  4FYD A;  3O08 A;  3VGK A;  3KK2 A;  3ZSX A;  4JS5 A;  2VGN A;  4H5W A;  4C1N I;  5KPR A;  2QA4 N;  3L3U A;  5AQJ A;  2QKK A;  3AO1 A;  4JKF A;  1CLQ A;  2OYQ A;  3SPZ A;  3U4L A;  1BQN A;  1K9M O;  1VQN N;  3MN7 A;  3CJ7 A;  3CCR N;  4B3O A;  2GTD A;  2G8U A;  4HTU A;  4ZTJ A;  1D9D A;  1KLM A;  1QQM A;  4OKE A;  2HHW A;  3AO5 A;  3TU5 A;  3OYB A;  3NE6 A;  3T1Y K;  3UKU B;  1S3X A;  2WC9 A;  4DR5 K;  1LAV A;  2ZQB A;  3K2P A;  5AFU A;  2W6L A;  3QEI A;  2PY5 A;  3VQQ A;  4C8O A;  1NMD A;  3IG1 A;  1LWC A;  3O1B A;  1KAX A;  1K73 O;  2HHX A;  1KTQ A;  3CF5 L;  4JKG A;  1IG8 A;  3M1F A;  4FWM A;  3DRS A;  3M3Z A;  1RTH A;  4YDU C;  3B8A X;  1N6Q A;  2FSJ A;  2X78 A;  2NZT A;  2BTF A;  1TV6 A;  3DLK A;  4KHW A;  3FZK A;  1TGO A;  2NNW A;  2QWL A;  3D0P A;  1SS6 A;  3VA0 A;  3ALY A;  3LP2 A;  4OPA A;  3MX5 A;  3HST B;  1SQK A;  4FWN A;  1KCF A;  4B1W B;  4DSL A;  2QKB A;  4CJR A;  3AAQ A;  3KHY A;  5IWA K;  4BRG A;  3GL1 A;  1VQM N;  4A2B A;  2HB5 A;  2KHO A;  2WOM A;  3NGY A;  5LL6 Z;  3F73 A;  4BR0 A;  4Z4C A;  2PAV A;  2WFB A;  3OYA A;  2D0B A;  1S9G A;  1U47 A;  4F3T A;  1DKG D;  2Z1J A;  1BQM A;  3DRP A;  3S41 A;  1EP4 A;  3I56 N;  3TAE A;  3OJU A;  2HVI A;  3LPT A;  3K57 A;  2HND A;  4FO0 A;  4B9T A;  5HOO A;  4OPK A;  2RPI A;  3CQY A;  4B9Q A;  4BQZ A;  4DU4 A;  3SJH A;  4DTP A;  3AAR A;  3AVG A;  4DR7 K;  4DTR A;  4H0X B;  1X9J A;  1YT3 A;  1ZBI A;  4FOI A;  4WQ5 C;  5KPT A;  3V1O A;  1BUP A;  1S1X A;  1RTD A;  4Y0W A;  4H5R A;  1KAZ A;  4K43 A;  3KZB A;  3V1R A;  3ZT1 A;  3ZT4 A;  4FJJ A;  4KHU A;  5AQG A;  1BGX T;  3I55 N;  4NCA A;  5MLC Q;  4I2P A;  5BPL A;  3L2Q A;  3CM6 A;  2DPN A;  1A5W A;  3F9K A;  1WOQ A;  3DI6 A;  3PIP L;  4M3W A;  4AF1 A;  4AM6 A;  4GV9 A;  3G10 A;  4DQP A;  1X9M A;  4F2S A;  2ZD1 A;  2Q2R A;  2O8B B;  3SAH A;  4BRK A;  4HCC A;  2X6N A;  4LF9 K;  4DTX A;  1YJN N;  4B8A B;  4M3T A;  2PBD A;  5JS1 A;  1NGE A;  5FPD A;  3O4N A;  5F1X A;  4B1V A;  3H1Q A;  3HXM A;  3ENH A;  2IC3 A;  4O0J A;  4YDU A;  1C6V A;  1T44 A;  4IO8 A;  1NGI A;  2YI1 A;  5KQD A;  2KZM A;  5AQI A;  3KK1 A;  1N5Y A;  3V1Q A;  3CCJ N;  1L3U A;  4CEQ A;  2NRH A;  3G6E N;  2BDP A;  3SV4 A;  5CYQ A;  3CC2 N;  4CJ3 A;  4LH5 A;  5C10 A;  3SUO A;  1NGB A;  5J2Q A;  1JL1 A;  4FLY A;  2E1Y A;  1SL2 A;  1WBB A;  1L3S A;  3S3O A;  4JD2 B;  4B3R K;  2Q31 A;  3V81 A;  1JLF A;  1RDU A;  4NO7 A;  3ITH A;  3PO5 A;  4FXD A;  4DMN A;  3SBG A;  5AQM A;  4H03 B;  3DWL A;  2KLA A;  4E7J A;  3MXI A;  2P9P A;  1ITG A;  4GV3 A;  1ASW A;  3QEW A;  1X1P A;  4HUE A;  3DXK A;  1C1A A;  4BY9 C;  2F7T A;  1NOZ A;  3V9U A;  4DQS A;  4JRQ A;  2WBN A;  1BOT O;  5DM7 L;  3CI5 A;  4B9U A;  4DQI A;  4QAG A;  4DV2 K;  3D6R A;  4WQ5 A;  3WXJ A;  4H5V A;  3EZ5 A;  1M90 O;  2HW3 A;  1SKW A;  3DLG A;  3ZSQ A;  2G8H A;  3LZI A;  3WQT A;  5IT9 O;  1JCE A;  3CCE N;  4BWM A;  3VQ6 A;  4IOC L;  4RW9 A;  2ETJ A;  1GLJ O;  4CZF A;  2GBZ A;  3M5R A;  3R3L A;  3VQP A;  1I3A A;  4X66 K;  5EX5 A;  2QWP A;  4KB0 A;  2GV9 A;  1MWK A;  4YOU A;  3TPQ A;  3SUQ A;  4CFB A;  4WCE L;  1SZ2 A;  5AQK A;  4DV6 K;  4KHQ A;  3AVK A;  4CGG A;  3LM2 A;  2XY5 A;  2QWM A;  4JKD A;  5KQ8 A;  4CZM A;  5KRS A;  4FJL A;  5BPN A;  4AM7 A;  3MN9 A;  1BA1 A;  3O5B A;  4DU1 A;  1WNS A;  2DFF A;  3TAG A;  1NK5 A;  4CVN E;  4JI1 K;  4EAH D;  4DR1 K;  5LJW A;  2IVO A;  5D3G A;  4L3Q A;  4BC4 A;  2Z1I A;  5HRN A;  1DT9 A;  3HM9 A;  2FBX A;  4CBU A;  3C65 A;  4JI8 K;  2FBY A;  1J53 A;  3O1W A;  1EQY A;  1I94 K;  4LFB K;  3SCX A;  1KFS A;  3P31 A;  2V7Y A;  3CYM A;  4ICL A;  3VF6 A;  1CZB A;  2ZGZ A;  4F2R A;  4CIE A;  4ISF A;  4BRA A;  1VSM A;  1FW6 A;  3DJC A;  3K9K A;  3OYK A;  1WSF A;  1LW2 A;  2PYL A;  1RDD A;  4CJT A;  4BRQ A;  5FRO A;  2YCH A;  1YXQ A;  1BG3 A;  3T7Z A;  3KWI A;  5HL7 L;  1IG9 A;  3O9Q A;  2YHB A;  1F21 A;  4J2E A;  2P9P B;  2P9U A;  4FZY A;  1UOC A;  1VQO N;  1DGK N;  4PL8 A;  4BQL A;  3EY1 A;  5C24 A;  3D7E O;  3LPU A;  1WUA A;  2YHA A;  3QDK A;  3MWT A;  3KTQ A;  2HBK A;  1U2V A;  2X74 A;  2Q0R A;  4EP5 A;  3IRX A;  2ATQ A;  4PKI A;  3MN6 A;  3CG7 A;  3T19 A;  3NGI A;  3AO3 A;  3LDN A;  1K6Y A;  3CM5 A;  1L5U A;  1EWR A;  5TKW A;  4WQ4 C;  4CEA A;  1CXU A;  4A57 A;  3L3V A;  2Q0U A;  3EN9 A;  4JS4 A;  3OW2 M;  5J2M A;  4JI2 K;  1LV5 A;  5AR0 A;  3CCM N;  1YAG A;  4EZ6 A;  1LAW A;  1T8E A;  4MQ3 A;  1S6Q A;  2FSK A;  2QTD A;  1S1U A;  3G71 N;  3AVM A;  3U9D A;  2ASO A;  1RT4 A;  1VSL A;  1HNZ K;  4ZTF A;  3E1Y A;  2E2O A;  1P8Z A;  1KXP A;  3L2V A;  3C6T A;  4RCH A;  2YNF A;  5AJ3 K;  1QTM A;  1QSS A;  3ATU A;  5JLF A;  2OPR A;  1B92 A;  1YHQ N;  2EHG A;  3AV9 A;  3BF3 A;  1TK5 A;  2KW4 A;  3L4I A;  3C6A A;  3KLI A;  4JKE A;  5SWM A;  1OKJ A;  3LM9 A;  4FWR A;  4JRP A;  3QEP A;  3VEN A;  4CFA A;  1J5E K;  1VQ9 N;  5C15 A;  2KFN A;  1NK0 A;  3ATV A;  1T03 A;  3TTC A;  3PY8 A;  3VQ9 A;  4HUG A;  1U45 A;  4IEE A;  3ZSZ A;  3RMD A;  1NBW A;  2DTU A;  1YVN A;  3O9U A;  3I0R A;  4EFH A;  2W40 A;  4CHP A;  2A6A A;  3OYD A;  4CZK A;  1A5X A;  3U3G A;  3TTF A;  4FJN A;  4HUF A;  1SV5 A;  1WSI A;  4BC2 A;  1XNR K;  1NK9 A;  4W5T A;  1NGC A;  4KV8 A;  3WNE A;  1IO2 A;  2OPQ A;  2ZJR L;  4I6M A;  1B9D A;  3VQC A;  4X64 K;  1NKB A;  5ELZ A;  3THY B;  4PQU A;  4KTW A;  2QWN A;  2I5J A;  3PUF A;  1V4T A;  4CIG A;  3CXC M;  3K5O A;  4FJM A;  1NGA A;  3FZL A;  2ASM A;  1WLJ A;  1KLN A;  1HPM A;  1V4S A;  2P5O A;  1C0F A;  1TK0 A;  4DFK A;  1U2V B;  1JLE A;  4ILJ A;  5FRM A;  4ZHR A;  5JVG L;  4B1X B;  3SJJ A;  3CIP A;  4FSV A;  4E1J A;  3DXM A;  1N33 K;  4F9O A;  4CHY A;  3IKM A;  3JXU A;  4FK0 A;  2D0P A;  5FRN A;  3KKR A;  2HHT A;  3CCV N;  4GKJ K;  2HHU A;  4DS5 A;  1Q9X A;  1S1W A;  3ZET B;  3LDO A;  4N76 A;  4H8K A;  2AA4 A;  3ZT2 A;  3A5L C;  3RR7 A;  1VRU A;  3V9W A;  3UB5 A;  5ADX A;  3PO4 A;  1GLF O;  4FLW A;  5M1Q A;  3EZW A;  1NJW A;  5EU7 A;  5CHI A;  4CEZ A;  4E7H A;  3VN5 A;  4IKF A;  3THV A;  1KVA A;  2E6M A;  4B9L A;  2O8C A;  3E9O A;  5AQL A;  4WFA L;  4WQ4 A;  3MCA B;  2O8F A;  1QS4 A;  3SMP A;  2DFE A;  1HNW K;  1TVR A;  4CEE A;  1OH8 A;  1UAX A;  4FW2 A;  1RIL A;  4V19 S;  3G0Z A;  1O1W A;  4K8Z A;  4DV3 K;  4FPA A;  4FWK A;  3AVL A;  3BGR A;  1VSJ A;  5EOY A;  5AQW A;  4E0D A;  4BG8 A;  4JI0 K;  1ATS A;  3H3O B;  4FK2 A;  2W42 A;  2QM1 A;  1X9W A;  1VQ8 N;  3KLH A;  3ZEU A;  4WF9 L;  4MDB A;  3ZX3 A;  1A5V A;  1TAU A;  1BI4 A;  1GLE G;  3KK3 A;  5C42 A;  1Q82 O;  4CJL A;  1RNH A;  4KH6 A;  3GDQ A;  3IFR A;  2IIR A;  3VET A;  5BN9 A;  3NHG A;  3MK6 A;  4CF2 A;  1BIZ A;  2UXC K;  4I9L A;  2UU9 K;  2ZGY A;  4N56 A;  3VER A;  3SQ2 A;  1XNQ K;  3FZF A;  2EX3 A;  3G25 A;  5EXW A;  3AA4 A;  1QSY A;  2VCP A;  3SI6 A;  4NXM K;  3M8R A;  5FPN A;  3NAE A;  3JSM A;  4Z4H A;  3OYF A;  3CFR A;  3Q7C A;  1Q7Y O;  1BCO A;  1C0U A;  1HQU A;  1XWL A;  2HMP A;  3OA9 A;  4Z0U A;  1BWF O;  1KAY A;  4BRO A;  3HJF A;  4UY8 O;  1IKW A;  1U04 A;  2YHY A;  2R7Y A;  5A2Q O;  4LSN A;  4ILH A;  3QML A;  2P9N A;  5KRT A;  2P1J A;  2V7Z A;  1JXB A;  3NF8 A;  3C6H A;  3K58 A;  4CJV A;  4DLE A;  3SMS A;  5M1N A;  2CGJ A;  4FVM A;  4Y1D A;  4YFU A;  3I33 A;  4BE2 A;  1JLG A;  1WBD A;  3L8B A;  1N34 K;  3CPE A;  4JK8 A;  2Q97 A;  3SUP A;  4FJK A;  4FJX A;  2GX9 A;  4IFV A;  4KB1 A;  2FBV A;  2IS3 A;  3QFP A;  4RG8 A;  1DTQ A;  2NRV A;  1KVB A;  4XH1 A;  2O8C B;  3VEO A;  1IKV A;  5GAE P;  3J7Y P;  2O8F B;  3ZSO A;  4W5R A;  4XH4 A;  2HMI A;  4W5Q A;  3LAN A;  3NF6 A;  3DM2 A;  4B1Z A;  3SAF A;  2O8E A;  2HF3 A;  3HTV A;  2ITG A;  4ID1 A;  3HRG A;  4DSK A;  4FM2 A;  4O8U A;  4EZ9 A;  4BVO A;  2P9I A;  2O4I A;  1MA9 B;  2A42 A;  3FGU A;  1VSF A;  3AVI A;  4NXN K;  3WXM B;  5LMN K;  2CH6 A;  4CI6 A;  1TL1 A;  5KGW A;  3O80 A;  4H4O A;  3MN5 A;  3ZEU B;  4PKH A;  4FJ8 A;  4IFE A;  5TKY A;  3KD5 E;  5CZ1 A;  3VGL A;  3QEX A;  3MEC A;  4GVM A;  3OYC A;  4AQY K;  3CPW M;  3DAW A;  3OBW A;  1ZBU A;  3O6W A;  4M3Z A;  5AQX A;  1MU2 A;  3U9Z A;  3VTI A;  3RMA A;  4FWO A;  4KHP K;  4RW6 A;  3MWP A;  3DLB A;  5AQU A;  4EP4 A;  1SUQ A;  3HVR A;  4JKC A;  3HT3 A;  3VA3 A;  4JI4 K;  4M42 A;  4B3S K;  5J2P A;  4KH5 A;  1RFQ A;  4W5O A;  1QVF M;  3FZM A;  5E41 A;  3R6M A;  1LCU A;  4B1U B;  2BAN A;  2HF4 A;  3T69 A;  4RW8 A;  5AQY A;  4EHU A;  4AHV A;  1NGH A;  4BRF A;  3CQ8 A;  4IG3 A;  4FLT A;  1NLV A;  3KLG A;  5B8H A;  4BR7 A;  2P9N B;  4BRE A;  4O8K A;  3OYH A;  3AA5 X;  1TUU A;  4FL9 A;  1WSH A;  4LH4 A;  3U6F A;  1ATN A;  2XHB A;  3OYN A;  3WNF A;  3PX0 A;  2GUI A;  1IV0 A;  1KD1 O;  4IO9 L;  3C0B A;  2QXF A;  4HWI A;  2A3Z A;  3S3N A;  3NF7 A;  1JLB A;  2GEL A;  4DSE A;  4FLX A;  4KHN A;  4YOY A;  5GIO A;  1NG9 A;  3P83 D;  4DV0 K;  2XY6 A;  3CCU N;  4JV5 K;  3T1A A;  2O8E B;  5AQP A;  1KVC A;  3H08 A;  4CZE A;  2DFH A;  4JKG B;  2KZZ A;  3TI0 A;  3QIC A;  4CJF A;  1JLC A;  4CD3 A;  1ATR A;  4DTM A;  3J80 O;  1U48 A;  4NB4 A;  4LY7 A;  4DFJ A;  3K0S A;  5BN8 A;  1RBV A;  5I9E B;  2G8I A;  3BUZ B;  4O0I A;  3CHW A;  2QK9 A;  2YX6 A;  4LSL A;  2B5J A;  2UYT A;  3NVK A;  5JVH L;  1RT1 A;  2YV0 X;  2NRZ A;  5AQO A;  4F8R A;  5AQH A;  3EKS A;  2A40 A;  4BDP A;  4YNQ A;  1TL3 A;  5J2N A;  5AQS A;  1GOC A;  3KWG A;  4IDK A;  3DYA A;  4AH9 A;  3S9H A;  3E9L A;  3WT0 A;  4CZG A;  1BIU A;  1T6C A;  2HNZ A;  4IBN A;  2G8K A;  3Q7B A;  1VSI A;  4YOX A;  1EET A;  5CZ2 A;  4BVP A;  5CE3 A;  5KPZ A;  4IJA A;  3HOT A;  4R79 A;  4WYB A;  1BIS A;  1XHX A;  1J9A A;  2HBM A;  1HKC A;  2Z1G A;  4IOA L;  3QEV A;  2YNG A;  3LZJ A;  1OH7 A;  1HYZ A;  1RGI A;  3VEZ A;  1J5O A;  1HR0 K;  5BRE A;  1CZA N;  2RN2 A;  4BE1 A;  3MEE A;  2ZJQ L;  3A8Y A;  4QS7 A;  1Y64 A;  5C25 A;  3O8M A;  3IMX A;  1ZYQ A;  1W7A A;  1IBM K;  4MLE A;  1C1B A;  1HJR A;  3AO4 A;  2OAN A;  3TSQ A;  2E2Q A;  1JCF A;  1QHT A;  4RW7 A;  3OYE A;  4Z94 A;  2HHV A;  2VQE K;  4CK3 A;  1QZ5 A;  1K8A O;  3BDP A;  4EIA A;  4KBO A;  5HP1 A;  3I8B A;  2FF6 A;  3UKR A;  3QFU A;  1HNV A;  5KGX A;  3I8D A;  3D2E A;  1Z26 A;  3JS6 A;  4CGF A;  3L2U A;  3W0L A;  3P4I A;  3O9R A;  3RMC A;  3RR8 A;  3UE5 A;  3KVG A;  4GY2 B;  4K41 A;  5J1E A;  3PX4 A;  3SLC A;  5HRO A;  4KRE A;  4CEB A;  5AFU H;  3ENO A;  5HRS A;  4DF4 A;  4PWD A;  1NWK A;  1S1V A;  2YNI A;  4CZI A;  2FF3 B;  3TSU A;  3ZSV A;  1P90 A;  1GLC G;  3QES A;  1W0H A;  1Q81 O;  3NMU A;  2O8D A;  3A0I X;  3TSP A;  1SKS A;  2ZWH A;  4H0P A;  4WE1 A;  4YOW A;  4C8L A;  4LFA K;  3CJA A;  3B6P A;  4NLB A;  4GVE A;  1N36 K;  5CR4 A;  3VF2 A;  2A1S A;  1GLB G;  5AQV A;  3DMJ A;  3AO2 A;  4Q0B A;  3T1H K;  3ENB A;  4KO0 A;  2YKM A;  4HHT A;  2HHQ A;  3VMF B;  4DG1 A;  3EKU A;  4Z4F A;  2PYJ A;  1WB9 A;  4K25 A;  3IS9 A;  1T3V A;  3WEE A;  3MX2 A;  1SL0 A;  5C0Y A;  1U4B A;  4DLG A;  3SQ4 A;  4FJH A;  2P9K A;  3AVH A;  4E3S A;  3CCS N;  3O4W A;  4LF4 K;  3KK7 A;  3LL3 A;  4DV5 K;  1GLA G;  2YJE A;  1HRH A;  4IEI A;  2D1K A;  4DQR A;  3TAF A;  3BZK A;  4C1N K;  3LDQ A;  3PIO L;  5E84 A;  1X9S A;  1IKY A;  5AZJ A;  3VES A;  1XC3 A;  3DXK B;  2OPS A;  3BZC A;  1DEJ A;  3CME N;  3D45 A;  3TAM A;  4GMJ B;  2QWO A;  3NBP A;  4JHD A;  5LY3 A;  4DTU A;  1NGG A;  1Q18 A;  3QBW A;  5DM6 L;  3VQ4 A;  1UA1 A;  1VQ5 N;  4A62 A;  1QSL A;  1GLL O;  5KI6 A;  1X3N A;  1TKD A;  1R59 O;  3MAQ A;  3CET A;  3LAM A;  4OGC A;  3D2E B;  2KKZ A;  3VQ7 A;  1JKH A;  4LC9 B;  1YIT N;  1JL2 A;  4DR3 K;  1O13 A;  1VQP N;  4CER A;  1GOB A;  5AZI A;  4BDZ A;  1FKO A;  3THX A;  1HKG A;  1KFD A;  2GEM A;  3R9P A;  2FC0 A;  2H3G X;  1BDG A;  2ZE2 A;  3B6O A;  3D2F A;  2B4J A;  2OZS A;  5BRF A;  1NGJ A;  1YJW N;  3VQD A;  4IXC A;  1RT2 A;  1RDA A;  2HBJ A;  1VSE A;  3QIO A;  4BC5 A;  4K8X A;  1TKZ A;  5GAH P;  4DR2 K;  3MDQ A;  2D4W A;  3CQX A;  3C7N A;  1J54 A;  4FZX C;  4Z4E A;  4B08 A;  4DU3 A;  4LD0 A;  4KFB A;  4CF1 A;  4FJG A;  1RT6 A;  3JAM O;  2E8A A;  1UA0 A;  4ELV A;  4OKK A;  5DK5 A;  4WFN L;  5CY4 A;  3R1X A;  2VWK A;  2CGK A;  3VEY A;  3OS2 A;  1QZ6 A;  4CJK A;  2P9S A;  4C8N A;  4LF5 K;  1N8R O;  4IZ9 A;  3DLH A;  1NU0 A;  4NYN A;  3FFK B;  4BRH A;  1T7P A;  2GWK A;  2Z1H A;  4JN4 A;  1EKE A;  3GOI A;  3VEV A;  3RRG A;  3CER A;  3MXM A;  4FPB A;  1LW0 A;  3P5J A;  3EO3 A;  4CEO A;  4CZL A;  3BF1 A;  4K0K K;  4BGA A;  4XIU A;  3TWH A;  3AVC A;  2UUC K;  4MO5 A;  4PHT X;  4A61 A;  2P9U B;  4JKB A;  4IG0 A;  4BR2 A;  4KRF A;  5AZJ B;  3AVF A;  1ZBH A;  3ZSY A;  3T3F A;  4DHY A;  3MED A;  1NK7 A;  4A5B A;  1RDC A;  1FK9 A;  2Q3S A;  2F4V K;  2NRT A;  3LP1 A;  3O3H A;  3VPZ A;  2QWQ A;  5AQN A;  1L3V A;  4CJ5 A;  3MEG A;  1T05 A;  4JYA K;  3JYT A;  1WN7 A;  4KPY A;  1TK8 A;  3TAR A;  2FXU A;  4FCY A;  4FOE A;  4NYF A;  1S9E A;  1TAQ A;  1E4G T;  1WSE A;  3OJS A;  4CD1 A;  1VSK A;  1J6Z A;  5AZI B;  1YUW A;  3SK3 A;  4E1M A;  3PX6 A;  3ISN C;  4Y1C A;  2E1Z A;  4M45 A;  4CGD A;  4HCB A;  4CE9 A;  4CJ7 A;  4FW1 A;  1B9F A;  3CCQ N;  4C8M A;  3UKU A;  3K5M A;  1YTA A;  4IJN A;  3WXI A;  4CGJ A;  1RT7 A;  4N5S A;  1BU6 O;  1YVU A;  3VQ5 A;  3TTD A;  1XI1 A;  4GW6 A;  4W5N A;  3C7N B;  3H1V X;  2RF2 A;  4OGE A;  2ZF5 O;  4FWP A;  1X3M A;  1MWM A;  3DLE A;  3DLL L;  4KKO A;  4CHO A;  4BAC A;  3HO1 A;  1VAZ A;  5JMV A;  3OY9 A;  3LWL A;  4FJ7 A;  1NJZ A;  4DV7 K;  4U67 L;  2OCE A;  1JLA A;  2YNH A;  3AAP A;  4DFM A;  2QEX N;  2CH5 A;  4O44 A;  4DTN A;  4C23 A;  3OYL A;  2IOC A;  3ZT0 A;  4I6M B;  3VEW A;  3KJV A;  5EVZ A;  3C95 A;  4CHQ A;  3L2W A;  4DSI A;  2XY7 A;  4NCG A;  4OKJ A;  4CF8 A;  1YTU A;  4JKA A;  3PSF A;  3SQ0 A;  4QS8 A;  5M1K A;  3CFP A;  4B3T K;  1NK4 A;  2BGG A;  3EEQ A;  2F8S A;  3U3Y A;  4CES A;  4IDH A;  1WAF A;  5FLX O;  1GLD G;  1W2B M;  1KQS M;  1VQL N;  2A41 A;  4BRL A;  4N47 A;  4CIF A;  2UXB K;  3H46 O;  3OYI A;  3QBX A;  1L3T A;  4DV4 K;  3DOL A;  3GBT A;  4DWI A;  2E5L K;  3DXM B;  3FZH A;  3C94 A;  3ID8 A;  4DSJ A;  4A2A A;  1DTT A;  3QIN A;  4H5T A;  4JI6 K;  3G4S N;  4JAX A;  4I9Q A;  2JWK A;  3DLR A;  4FK4 A;  3M8Q A;  3GE1 A;  3AGR A;  5FPM A;  3RRH A;  3OS1 A;  2Y1I A;  1SAZ A;  1W97 L;  1NGD A;  1YIJ N;  3SNN A;  3HVT A;  5JLH A;  1ZXO A;  3V9X A;  2P5G A;  2I7P A;  1HNX K;  3H6E A;  2W41 A;  4KI4 A;  3K9J A;  3ULE A;  4EHT A;  2Y1J A;  4BC3 A;  3H3N O;  4DF8 A;  4OJR A;  3IAY A;  3A5N C;  3ZX0 A;  3RMB A;  4PA1 A;  5M1F A;  3LP3 A;  1KRP A;  2X6S A;  4RWT A;  3PV8 A;  3O3G A;  3N4P A;  2W6K A;  2E4L A;  3AGK A;  4TSX A;  4M7X A;  3L4Q A;  5JIC A;  4FWS A;  4JI5 K;  3EYZ A;  2D0C A;  2EWS A;  4RW4 A;  4BRD A;  4ELU A;  3V9Z A;  4QCL A;  3GG4 A;  2G8V A;  3WXK A;  3KLE A;  3SQ1 A;  1HKB A;  3R8E A;  3J8A A;  2OPP A;  1BI4 B;  2O8B A;  4BDY A;  2ITM A;  1YF5 L;  1IKX A;  2YHX A;  3TAQ A;  4B8C A;  3ID6 A;  1S1T A;  3HL8 A;  4E19 A;  1M1K O;  4CFC A;  3F2K A;  4KH4 A;  3EL2 A;  5M1P A;  3P1G A;  1ASU A;  2VWJ A;  4DUY K;  4CJE A;  4JK9 A;  2F8T A;  5M1O A;  2UUA K;  3ZCM A;  4CZH A;  2IDO A;  4H0Y B;  4IWV A;  1RBR A;  4CGH A;  3NH1 A;  4DQQ A;  4DV1 K;  4E7I A;  3AY9 A;  3PLA A;  4O55 A;  5AQF A;  5SZT A;  2G8W A;  1Y97 A;  4IFY A;  4MFB A;  4JLH A;  3RSE A;  4FLV A;  5FDL A;  2OTJ N;  4YY3 K;  3AVJ A;  4I2Q A;  1GOA A;  5I3U A;  3KD1 E;  1ESV A;  2O4G A;  5E26 A;  3KLF A;  1TKT A;  2E2N A;  4B9M A;  1BA0 A;  1Z6R A;  3E9P A;  4JEP A;  3MMV A;  2V52 B;  2VGM A;  3SBT A;  4OLA A;  4JKH A;  3FFI A;  3VTH A;  3ZSR A;  4NLC A;  3QLH A;  4JD2 A;  4DFP A;  5T7B A;  3VF4 A;  1UWB A;  1VQ6 N;  3HZ6 A;  3C6U A;  3J7A P;  4CK2 A;  5F0X A;  4BWJ A;  2FSN A;  4N41 A;  4B9V A;  2IVN A;  1D8Y A;  4XH5 A;  4CCH A;  5LJV A;  3RWU A;  2JLE A;  2NLX A;  2V51 B;  4DCH A;  4AHS A;  5HLF A;  3V6D A;  4J2A A;  4O4G A;  3VQ8 A;  1VHX A;  5KTQ A;  4CZJ A;  1XMQ K;  2RKI A;  3ULE B;  4O5B A;  1REV A; 
#chains in the Genus database with same CATH homology
 3KK2 A;  3ZSX A;  4JS5 A;  4OPJ A;  3V9S A;  4FJN A;  3AA2 A;  4HUF A;  5JS2 A;  1SKS A;  1SV5 A;  1WSI A;  3L3U A;  3HPG A;  4WE1 A;  1NK9 A;  2QKK A;  4C8L A;  4W5T A;  3AO1 A;  4KV8 A;  3B6P A;  4PY5 A;  1CLQ A;  3UIQ A;  1IH7 A;  1Q8I A;  1IO2 A;  2OPQ A;  3WNE A;  1B9D A;  3VQC A;  1NKB A;  2OYQ A;  2A1S A;  3SPZ A;  1BQN A;  3K59 A;  4PQU A;  1KSP A;  4B3O A;  1RBU A;  4KTW A;  3DMJ A;  2I5J A;  3AO2 A;  3ASM A;  3K5N A;  1BCM A;  3PUF A;  4Q0B A;  2G8U A;  4HTU A;  4KO0 A;  4CIG A;  2YKM A;  4HHT A;  4ZTJ A;  2HHQ A;  3K5O A;  4DG1 A;  4FJ5 A;  1D9D A;  4FJM A;  1KLM A;  1WLJ A;  1KLN A;  4OKE A;  4Z4F A;  2PYJ A;  2HHW A;  2P5O A;  3AO5 A;  1TK0 A;  3OYB A;  3AVB A;  3NE6 A;  3IS9 A;  4DFK A;  1JLE A;  2G8F A;  1SL0 A;  1LAV A;  5FRM A;  2ZQB A;  4DLG A;  1U4B A;  3SQ4 A;  4ZHR A;  4FJH A;  4B9S A;  3AVH A;  4E3S A;  3K2P A;  3SJJ A;  1NKE A;  3QEI A;  2PY5 A;  3VQQ A;  4C8O A;  3IG1 A;  1LWC A;  4CHY A;  1WSJ A;  4FK0 A;  2HHT A;  5FRN A;  3KKR A;  2HHU A;  1HRH A;  4E7K A;  5K14 A;  4DQR A;  4DS5 A;  3TAF A;  2HHX A;  3LAK A;  1Q9X A;  1KTQ A;  1S1W A;  1X9S A;  3DRS A;  1IKY A;  3ZSW A;  3NDK A;  4N76 A;  1RTH A;  4H8K A;  3ZT2 A;  3RR7 A;  3ULD A;  1VRU A;  3V9W A;  1N6Q A;  1LWE A;  4CED A;  3PO4 A;  4DSI A;  2OPS A;  2X78 A;  1RTI A;  4FLW A;  2KTQ A;  2D5R A;  3D45 A;  5EU7 A;  3TAM A;  1NJW A;  4GMJ B;  3NBP A;  1TV6 A;  3DLK A;  4CEZ A;  4E7H A;  4DTU A;  3VN5 A;  4IKF A;  4M3X A;  4KHW A;  3THV A;  1KVA A;  2E6M A;  1TGO A;  4B9L A;  1RDB A;  3D0P A;  1RBT A;  1QS4 A;  3VA0 A;  4KTQ A;  1Z25 A;  2DFE A;  2E6L A;  3ALY A;  3LP2 A;  3VQ4 A;  1UA1 A;  3HST B;  1TVR A;  3O3F A;  1QSL A;  4CEE A;  1KCF A;  1UAX A;  4FW2 A;  1RIL A;  5KI6 A;  3G0Z A;  1O1W A;  3NFA A;  4DSL A;  4K8Z A;  1TKD A;  2QKB A;  4CJR A;  3MAQ A;  3I0S A;  3BGR A;  3AVL A;  1VSJ A;  3LAM A;  4OGC A;  4CK1 A;  4OLB A;  3O4Q A;  3VQ7 A;  1JKH A;  4E0D A;  1JL2 A;  2HB5 A;  2WOM A;  3NGY A;  3V4I A;  4FK2 A;  2IAJ A;  2W42 A;  4CER A;  3F73 A;  4Z4C A;  1X9W A;  3OYA A;  3KLH A;  1GOB A;  4BDZ A;  1FKO A;  1KFD A;  2D0B A;  1A5V A;  1S9G A;  1TKX A;  1U47 A;  4F3T A;  1TAU A;  1BI4 A;  2FC0 A;  3KK3 A;  5C42 A;  2Z1J A;  3QNN A;  4CJU A;  3TAP A;  2ZE2 A;  1BQM A;  3B6O A;  1RNH A;  3DRP A;  4CJL A;  4E89 A;  1EP4 A;  2B4J A;  2OZS A;  3TAE A;  3OJU A;  2FBT A;  4CEF A;  3LP0 A;  3A2F A;  4FLU A;  3NHG A;  2HVI A;  4CF2 A;  1BIZ A;  3VQD A;  3SUN A;  4I9L A;  3LPT A;  3K57 A;  1RT2 A;  1RDA A;  2HND A;  4N56 A;  1VSE A;  4B9T A;  3QIO A;  4OPK A;  3SQ2 A;  2RPI A;  1XHZ A;  3LAL A;  4K8X A;  2EX3 A;  1ASV A;  1TKZ A;  2LSN A;  3TAB A;  4DU4 A;  3AA4 A;  1QSY A;  1VSD A;  4DTP A;  1J54 A;  3SI6 A;  4FZX C;  4CJ4 A;  4Z4E A;  4B08 A;  3M8R A;  4DU3 A;  3QET A;  3AVG A;  4LD0 A;  4DTR A;  4KFB A;  4AHR A;  4CF1 A;  1YT3 A;  3NAE A;  1RT6 A;  3JSM A;  4DTS A;  4FJG A;  4Z4H A;  1ZBI A;  3OYF A;  3NGZ A;  3CFR A;  1UA0 A;  4ELV A;  4OKK A;  5DK5 A;  1BCO A;  5CY4 A;  1C0U A;  1HQU A;  2VWK A;  3V1O A;  1XWL A;  3OS2 A;  1CZ9 A;  3M8P A;  1RTD A;  1S1X A;  2YKN A;  1NOY A;  3V1R A;  4Z0U A;  3ZT1 A;  3ZT4 A;  4CJK A;  4FJJ A;  4KHU A;  4C8N A;  3HJF A;  2HVH A;  3DLH A;  1IKW A;  1BGX T;  1D5A A;  1U04 A;  4NYN A;  4CFD A;  2R7Y A;  1T7P A;  4NCA A;  4LSN A;  4I2P A;  2Z1H A;  3L2Q A;  3CM6 A;  1EKE A;  5KRT A;  1A5W A;  4C8K A;  1HQE A;  3F9K A;  3RRG A;  2P1J A;  1RBS A;  3DI6 A;  1LW0 A;  3MXM A;  3KIO A;  1JXB A;  1SL1 A;  3NF8 A;  3P5J A;  4CEO A;  4M3W A;  4Z4G A;  1W9H A;  3G10 A;  4XIU A;  3K58 A;  3TWH A;  1ZBF A;  1X9M A;  4DQP A;  3DRR A;  1QE1 A;  3AVC A;  4CJV A;  5HRP A;  4DLE A;  4F2S A;  2AJQ A;  2ZD1 A;  4FVM A;  4Y1D A;  4YFU A;  4BE2 A;  1JLG A;  4DSF A;  4IG0 A;  3SPY A;  3L8B A;  3NH2 A;  4KRF A;  4HCC A;  4KI6 A;  2X6N A;  3AVF A;  1ZBH A;  4CHN A;  4Q5V A;  4DTX A;  3SUP A;  4FJK A;  4FJX A;  3ZSY A;  4IFV A;  3T3F A;  4KB1 A;  2FBV A;  4B8A B;  2IS3 A;  1Q9Y A;  4RG8 A;  4M3T A;  3MED A;  1NK7 A;  5JS1 A;  3O4N A;  3SYZ A;  3NCI A;  1DTQ A;  1KVB A;  1RDC A;  1FK9 A;  2Q3S A;  1IKV A;  3ZSO A;  3HXM A;  4W5R A;  2HMI A;  4J2D A;  4W5Q A;  3LP1 A;  3LAN A;  1RTJ A;  3NF6 A;  3VQA A;  3O3H A;  2IC3 A;  3DM2 A;  1BHL A;  4O0J A;  1C6V A;  1SKR A;  1S6P A;  4F3O A;  1L3V A;  3VQB A;  2ITG A;  4CJ5 A;  4ID1 A;  2KZM A;  4DSK A;  3MEG A;  1T05 A;  3KK1 A;  4FM2 A;  4EZ9 A;  4BE0 A;  1N5Y A;  3JYT A;  1WN7 A;  2F96 A;  3V1Q A;  2O4I A;  1WAJ A;  4H4M A;  3HPO A;  1VSF A;  4CEQ A;  4DS4 A;  1L3U A;  1RCH A;  3AVI A;  3OYM A;  1TK8 A;  2BDP A;  4KPY A;  3TAR A;  3VQE A;  4FCY A;  3SV4 A;  4NYF A;  3ZT3 A;  4J2B A;  1S9E A;  1TAQ A;  5CYQ A;  3SV3 A;  4CJ3 A;  1WSE A;  1TL1 A;  3OJS A;  4LH5 A;  5KGW A;  4H4O A;  1VSK A;  4CJS A;  3SUO A;  4KTZ A;  4FJ8 A;  4E1M A;  3PX6 A;  3ISN C;  4Y1C A;  3KD5 E;  5CZ1 A;  4M45 A;  4CGD A;  4HVJ A;  1FXX A;  3QIP A;  5J2Q A;  4HCB A;  4CE9 A;  1JL1 A;  4FLY A;  3QEX A;  1NJY A;  4FW1 A;  1B9F A;  3TR8 A;  1SL2 A;  3MEC A;  4C8M A;  2WON A;  1L3S A;  3S3O A;  4GVM A;  3OYC A;  4I7F A;  3K5M A;  1JXE A;  1YTA A;  3K5L A;  3V81 A;  4FJ9 A;  5HBM A;  1JLF A;  1U49 A;  1ZBU A;  2IGI A;  2XO7 A;  4L8R B;  2DY4 A;  4CGJ A;  4M3Z A;  3ITH A;  1RT7 A;  1RT5 A;  3VQ5 A;  1YVU A;  4N5S A;  3SZ2 A;  1XI1 A;  1S5J A;  4DMN A;  3PO5 A;  4FXD A;  4B9N A;  1MU2 A;  4CGI A;  3RMA A;  4GW6 A;  4W5N A;  2KFZ A;  1WSG A;  4E7J A;  4E7L A;  4RW6 A;  4OGE A;  2RF2 A;  3MXI A;  3AA3 A;  1ZBL A;  3TAN A;  4PUO A;  3RTV A;  2HNY A;  1ITG A;  3DLE A;  4AIL C;  4M41 A;  3DLB A;  1ASW A;  1BL3 A;  4EP4 A;  4KKO A;  3QEW A;  1SUQ A;  4CHO A;  3HVR A;  3HT3 A;  4BAC A;  3VA3 A;  3HO1 A;  3OY9 A;  3LWL A;  1X1P A;  5HRR A;  4HUE A;  4ELT A;  4FJ7 A;  4NCB A;  1C1A A;  4M42 A;  1NJZ A;  1NOZ A;  3V9U A;  5J2P A;  3QER A;  1JLA A;  2YNH A;  4JRQ A;  4W5O A;  4DQS A;  5E41 A;  4DFM A;  2BAN A;  1D9F A;  4RW8 A;  4B9U A;  4DQI A;  1EXQ A;  4O44 A;  4AHV A;  4DTN A;  4QAG A;  3CQ8 A;  4IG3 A;  4FLT A;  3OYL A;  2IOC A;  1NK8 A;  3KLG A;  3QO9 A;  3ZT0 A;  3LWM A;  3EZ5 A;  1HMV A;  2HW3 A;  1SKW A;  3OYH A;  4AHC A;  3DLG A;  4CJP A;  1I39 A;  3AA5 X;  3C95 A;  4M3R A;  2VG5 A;  3ZSQ A;  4CHQ A;  1WSH A;  3KJV A;  3L2W A;  3LZI A;  4LH4 A;  3U6F A;  2XY7 A;  4E1N A;  2G8H A;  1VSH A;  2HHS A;  2XHB A;  4NCG A;  1JLQ A;  3OYN A;  4BWM A;  4OKJ A;  3VQ6 A;  3M8S A;  3WNF A;  4CF8 A;  3OVN A;  3PX0 A;  2GUI A;  4RW9 A;  1YTU A;  2ETJ A;  4UQG A;  2JGU A;  3SQ0 A;  1HPZ A;  2GBZ A;  3CFP A;  3E01 A;  1NK4 A;  4M3U A;  3LDS A;  2BGG A;  3U3Y A;  2F8S A;  4CES A;  3VQP A;  2QXF A;  1I3A A;  1WAF A;  3S3N A;  4FM1 A;  4KB0 A;  2GV9 A;  3NF7 A;  1HYS A;  3OYG A;  1NJX A;  4N47 A;  4CJQ A;  3WNG A;  3SUQ A;  1JLB A;  4CFB A;  4CIF A;  4DSE A;  2NUB A;  3OYI A;  4FLX A;  4KHN A;  1L3T A;  4M3Y A;  4KAZ A;  3DOL A;  4DWI A;  4KHQ A;  3P83 D;  4CF0 A;  5CYM A;  3C94 A;  3AVK A;  4CGG A;  4DSJ A;  2XY5 A;  2XY6 A;  4DTO A;  1CXQ A;  1R0A A;  1EX4 A;  3T1A A;  5KRS A;  4FJL A;  3NF9 A;  3QNO A;  1KVC A;  3H08 A;  4DU1 A;  1LWF A;  1WNS A;  1DTT A;  2DFH A;  2DFF A;  3QIN A;  3TAG A;  1NK5 A;  2KZZ A;  3TI0 A;  4I9Q A;  1C1C A;  3DLR A;  1HNI A;  3M8Q A;  4CJF A;  4FK4 A;  1JLC A;  2PZS A;  4DTM A;  1U48 A;  4ID5 A;  3RRH A;  4F4K A;  1C0M A;  3OS1 A;  4LY7 A;  2Y1I A;  4DFJ A;  5D3G A;  2Z1I A;  1RBV A;  3SNN A;  5HRN A;  3HVT A;  2G8I A;  3V9X A;  2P5G A;  3OYJ A;  3HM9 A;  4Z4I A;  4O0I A;  2FBX A;  2FBY A;  1J53 A;  4FJI A;  2QK9 A;  4G1Q A;  3DOK A;  3S3M A;  4DTJ A;  2Y1J A;  3SCX A;  1KFS A;  4KI4 A;  4LSL A;  2B5J A;  4ICL A;  4DF8 A;  3CYM A;  3KKS A;  4OJR A;  1CZB A;  4CF9 A;  4FM0 A;  4CIE A;  3IAY A;  4F2R A;  1RT1 A;  1VSM A;  1HYV A;  3RMB A;  2YV0 X;  4F8R A;  1NKC A;  4PA1 A;  3LP3 A;  3OYK A;  4BDP A;  1WSF A;  1LW2 A;  4YNQ A;  1KRP A;  4KHS A;  1TL3 A;  2X6S A;  5J2N A;  2PYL A;  3PV8 A;  3O3G A;  4CHZ A;  1XC9 A;  1GOC A;  5I42 A;  1RDD A;  2E4L A;  4CJT A;  3CFO A;  4IDK A;  4TSX A;  3DYA A;  4AH9 A;  3S9H A;  3EYZ A;  2D0C A;  4RW4 A;  5FRO A;  2XY8 A;  3V9Z A;  4ELU A;  2G8V A;  4QCL A;  1BIU A;  3KLE A;  3SQ1 A;  3MXJ A;  2HNZ A;  2VG6 A;  4IBN A;  1IG9 A;  4QOZ B;  2YHB A;  2OPP A;  1F21 A;  4J2E A;  4FZY A;  1UOC A;  2G8K A;  4CEC A;  1BI4 B;  4CJW A;  3EY1 A;  5C24 A;  1VSI A;  4BDY A;  2KQ2 A;  1EET A;  5CZ2 A;  4AHU A;  3LPU A;  2YHA A;  3KTQ A;  3WNH A;  3HYF A;  3HPH A;  2X74 A;  1IKX A;  3TAQ A;  4EP5 A;  2XRI A;  3IRX A;  4B8C A;  1S1T A;  3HL8 A;  4E19 A;  2ATQ A;  1BIS A;  1XHX A;  4CFC A;  1J9A A;  4R5P A;  3NH0 A;  2Z1G A;  1VK0 A;  2OA8 A;  3P1G A;  1ASU A;  2VWJ A;  3CG7 A;  3T19 A;  4CJE A;  3QEV A;  3OS0 A;  2YNG A;  2F8T A;  3NGI A;  3LZJ A;  3AO3 A;  1K6Y A;  1HYZ A;  3CM5 A;  1L5U A;  3ZCM A;  1J5O A;  2IDO A;  4CGH A;  3HK2 A;  1RBR A;  3NH1 A;  4DQQ A;  2RN2 A;  4BE1 A;  4CEA A;  4E7I A;  3MEE A;  1CXU A;  3HP9 A;  3L3V A;  4O5B A;  2OZM A;  5SZT A;  4JS4 A;  2G8W A;  2B6A A;  5J2M A;  3AVA A;  1LV5 A;  1Y97 A;  4IFY A;  4MFB A;  4JLH A;  5C25 A;  4EZ6 A;  1LAW A;  1ZYQ A;  1T8E A;  4FLV A;  3AVN A;  4MQ3 A;  5FDL A;  1S6Q A;  1C1B A;  1HJR A;  1S1U A;  3AO4 A;  1VRT A;  3AVJ A;  3AVM A;  1RT4 A;  4I2Q A;  2A1R A;  1VSL A;  1GOA A;  5I3U A;  4ZTF A;  1RT3 A;  3KD1 E;  1QHT A;  2O4G A;  4RW7 A;  3KLF A;  1TKT A;  4B9M A;  3L2R A;  3OYE A;  2BE2 A;  2HHV A;  4AHT A;  4CK3 A;  3HP6 A;  3L2V A;  3BDP A;  4OLA A;  4FZZ A;  3FFI A;  3C6T A;  4OVL A;  5HP1 A;  3ZSR A;  2YNF A;  3QLH A;  4DFP A;  1QTM A;  5T7B A;  1QSS A;  1UWB A;  2P51 A;  1HNV A;  2OPR A;  5DMR A;  5KGX A;  3I8D A;  1B92 A;  2EHG A;  1Z26 A;  3AV9 A;  3C6U A;  2D0A A;  2KW4 A;  4CGF A;  4CK2 A;  3L2U A;  1TK5 A;  4BWJ A;  4KHY A;  3KLI A;  4N41 A;  3RMC A;  3RR8 A;  4B9V A;  5SWM A;  1G15 A;  2VG7 A;  5J1E A;  4JRP A;  1C0T A;  3QEP A;  4CFA A;  3PX4 A;  5HRO A;  4KRE A;  4CEB A;  1NK0 A;  2KFN A;  1T03 A;  1D8Y A;  4CCH A;  3PY8 A;  3RWU A;  2JLE A;  4FLZ A;  5HRS A;  3VQ9 A;  4DF4 A;  4PWD A;  1S1V A;  4HUG A;  1QQC A;  2YNI A;  1U45 A;  1DLO A;  3ZSZ A;  4AHS A;  3RMD A;  3ZSV A;  5HLF A;  2DTU A;  3I0R A;  1FKP A;  3V6D A;  4J2A A;  4CHP A;  4O4G A;  3VQ8 A;  1W0H A;  3OYD A;  5KTQ A;  1A5X A;  3QES A;  1NK6 A;  2RKI A;  4FYD A;  3U3G A;  4O55 A;  1REV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...