4HUEA

Structure of 5-chlorouracil modified g:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
molecule keywords Ribonuclease H
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hueA00
3DI6A 4OKJA 2PY5A 3KKSA 3RR7A 4CIEA 4W5NA 2GBZA 3ZCMA 4H8KA 3AVLA 2XY6A 3V6DA 1WSIA 4CEQA 4F3OA 1T8EA 4B08A 2R7YA 2D0CA 3ZT3A 5C24A 4O44A 1BI4B 5I3UA 3AA2A 3KK3A 4J2AA 2P51A 1W0HA 3MECA 3V81A 2HHUA 1SKRA 4BE1A 4LD0A 2EHGA 4FM2A 4N56A 3OYIA 1RTHA 2VG6A 4NCGA 3VQCA 4HUGA 4AILC 4FJLA 3OYNA 3OYAA 3AVIA 3CFRA 5HLFA 3NGIA 1NK4A 4C8KA 3V1QA 3G10A 1CZBA 4B8CA 2G8IA 2D0BA 3RTVA 3I8DA 4NCBA 2DFHA 1KCFA 3DLEA 4Q0BA 2FBTA 5J2MA 2RPIA 2FBVA 3ZSWA 3AO3A 4CEBA 5J1EA 4FW2A 3SJJA 4M3UA 4DLEA 2W42A 4CEDA 1VSEA 4ZHRA 1U45A 1D8YA 2GV9A 4FCYA 4CEEA 4TSXA 1LV5A 3QIOA 1JLFA 4FLWA 4CIFA 2QKBA 2WOMA 2PYJA 3DLKA 3U3YA 4DMNA 5I42A 2DFFA 4KHWA 3QESA 4FLYA 3RWUA 1VSIA 3DRRA 4R5PA 1JXBA 3B6PA 3MEDA 3OJSA 3TAEA 3PX4A 4ZTJA 4O55A 3KTQA 2G8HA 2YHAA 1DTQA 2O4GA 4DTNA 4FJMA 3VQQA 1TVRA 4J2DA 4FK0A 3SYZA 3VA0A 3K2PA 1VRTA 3HJFA 2KZMA 1RCHA 4Z4FA 1IH7A 1U48A 1C0MA 3TAFA 1HPZA 3SQ1A 4FJJA 4E1NA 1BIZA 1VRUA 2HNDA 1T05A 1RDCA 4DWIA 3HPGA 4DQRA 1QSSA 1RDAA 4CFBA 5FDLA 3QEIA 1TKZA 4NYFA 1L3UA 4PWDA 1NJWA 3AV9A 3HM9A 4WE1A 5CY4A 1EETA 1RILA 3C6TA 4FJXA 1NK8A 3LALA 3NFAA 3LP2A 5KRSA 4CJQA 1LAVA 1ZBHA 2KFNA 2JLEA 1I3AA 2XO7A 3HVRA 1MU2A 2G8VA 1I39A 4KFBA 4DG1A 3TAMA 1RBRA 4CEFA 3CM6A 3VQ6A 4DTPA 1ZYQA 3PY8A 3L3VA 4IBNA 1XI1A 3HO1A 2IGIA 3DYAA 2G8KA 4FJ7A 4H4OA 4FLVA 4FM1A 3VA3A 4N41A 3B6OA 3L2WA 4E7IA 1RTJA 2Q3SA 2PYLA 2A1SA 2IC3A 4CF0A 4JS5A 1ASVA 2RN2A 5SZTA 4C8LA 2FBXA 3SCXA 4FJ8A 3SQ4A 4ID1A 1W9HA 5C42A 1JL1A 1VSJA 1J54A 1IKYA 3AO5A 4E7JA 4M3YA 1NJZA 1QS4A 1NK7A 1X9MA 2OZSA 3P83D 1B92A 2HB5A 3AA3A 4YFUA 4FJGA 4KHQA 3CFPA 4ELVA 4DSIA 4M3ZA 2E4LA 1J53A 1HNIA 3KK1A 1TK8A 1WSHA 2YNIA 1QHTA 4C8NA 3OYBA 4E0DA 3V9SA 4FK4A 1IKXA 4JS4A 1J9AA 3DRPA 4E89A 3QEVA 3QEXA 3BGRA 3RMDA 3V9XA 3HPHA 3NF6A 3TANA 4HCCA 4KTWA 3L2VA 4OLAA 4MQ3A 3VQ8A 1VSKA 3DMJA 1X1PA 4FZZA 1TAQA 1U47A 4BDPA 1GOBA 4G1QA 4CJTA 1JLCA 2Z1HA 3NCIA 2OYQA 4E7LA 1Z26A 1Y97A 2FC0A 5CYMA 1D9FA 1JLEA 4LH5A 4RW4A 3WNHA 3HP9A 3LANA 3P1GA 4BWJA 2F8TA 5HRPA 2P1JA 2X74A 1L5UA 1X9SA 4KRFA 2XY7A 3TAGA 4F2SA 1L3VA 4DTUA 3SUNA 4C8MA 3ZSQA 2ATQA 4KKOA 1RT4A 4AHRA 2YHBA 5CYQA 3KLEA 3G0ZA 2VG7A 3RRGA 2I5JA 1RT5A 4QAGA 4DTXA 3KIOA 2F8SA 4NYNA 1UWBA 1WNSA 1CLQA 5HRSA 4IDKA 4E7HA 4EP4A 2ZD1A 1HJRA 4OVLA 1U49A 2QKKA 2DTUA 3CFOA 3A2FA 1KVBA 5KRTA 3TWHA 3ZSRA 1ITGA 1BL3A 5KGWA 3VQBA 4CHNA 1IKVA 3S3OA 4FJNA 1L3SA 4Y1DA 2Y1IA 3ZT4A 3LDSA 4DU3A 1S1XA 2G8FA 3RMCA 1JLGA 1FK9A 4CHZA 4CJVA 3MAQA 2F96A 3O4QA 2HNZA 5CZ2A 2B5JA 3VQDA 1S9EA 3LWLA 3OYGA 1NK5A 1NK9A 3CG7A 4KO0A 4YNQA 3TI0A 3NH1A 4B9SA 3WNEA 4CIGA 1U4BA 1KVCA 2KQ2A 2FBYA 2OA8A 4CJWA 1WSFA 2Z1IA 3ITHA 1KLNA 4O0IA 1JXEA 3ULDA 4M41A 4GMJB 3ZT1A 3LP1A 3DLRA 4LSLA 3AVGA 3LP0A 3PUFA 5HRRA 4O5BA 4FJ9A 3HP6A 2VG5A 3OS0A 3HT3A 1ASWA 3KLFA 4DFJA 4CK3A 5K14A 1NKBA 1LWCA 1TL1A 2YNFA 4JRQA 4KTQA 1UAXA 4PY5A 4AHUA 4RW8A 4KI4A 1Q8IA 5FRNA 4BDYA 3SQ0A 2QK9A 5KGXA 1C1AA 5SWMA 1YT3A 4DTJA 3ISNC 3QINA 3HXMA 1S6PA 2NUBA 3T1AA 4CJEA 5J2NA 1NOYA 4JRPA 4OGCA 3V9UA 2HVHA 3LPTA 3T3FA 1WAFA 4ELUA 1S1VA 5KTQA 1X9WA 3LAMA 4BE2A 2VWJA 1S1WA 4Z4HA 3NF8A 1RTDA 1KSPA 1BCMA 2KFZA 3VQ7A 3O4NA 5J2PA 3TABA 4F2RA 1TKXA 4CEZA 4OKKA 3VQEA 4CF1A 2PZSA 1VSMA 3CQ8A 3NBPA 4O0JA 3M8SA 4J2BA 1ZBFA 2X6NA 3TAQA 2HNYA 3F73A 1FKOA 4B9TA 2OZMA 4ICLA 1K6YA 2QXFA 4PA1A 4CJ4A 1QSYA 4W5QA 4CK2A 3D45A 3MXJA 3SUQA 3ZSVA 4LY7A 1TK0A 3VQPA 4Z4GA 4CE9A 2HHVA 4CERA 3V9ZA 1NKCA 1ZBUA 4EP5A 4W5TA 2XY8A 5D3GA 4H4MA 4Y1CA 5HP1A 4B9LA 1XC9A 3OYLA 4B9VA 1SKSA 3V4IA 2Z1GA 4CESA 4DS5A 1RBSA 1RDBA 4Z4IA 3IAYA 4J2EA 1FXXA 1QE1A 3AA4A 3VQ4A 4HHTA 1NKEA 4KHUA 3S3NA 3DLBA 4W5RA 5HBMA 2D5RA 3CM5A 3CYMA 3PO4A 3I0RA 4M3XA 2DFEA 1RBVA 4HCBA 2HHTA 1S1UA 2XRIA 4FLTA 2OPQA 2WONA 2LSNA 4DFMA 3TARA 1NJXA 4C8OA 3LZJA 3K5NA 4DQSA 1N6QA 4DLGA 1LWFA 4FLXA 4OKEA 4Q5VA 3HL8A 1B9DA 3LPUA 3QIPA 3WNFA 3EY1A 3RMBA 1N5YA 2RKIA 3E01A 4CHOA 3ZSZA 4BWMA 4DF4A 2KTQA 3MEEA 1HYSA 2D0AA 4IG3A 3SV4A 3OYFA 1KLMA 1ASUA 1VSHA 4Z4EA 3EZ5A 3K5OA 3HPOA 4DFKA 1C1CA 1UOCA 5CZ1A 4FZYA 4KREA 3WNGA 3MEGA 2A1RA 3NF9A 4HTUA 4RW9A 3L2QA 3SZ2A 1LW2A 5E41A 3RRHA 2ZQBA 3S3MA 2HVIA 3QETA 3LP3A 4DF8A 3MXMA 2IOCA 4CJSA 4F3TA 4CEAA 4M3TA 2ITGA 1SL0A 3SPYA 4KB1A 1SV5A 1Q9YA 4DQIA 4AHSA 4CF9A 3RR8A 1C0UA 4FJIA 1BI4A 1KVAA 3ZT2A 2XY5A 1QTMA 1A5XA 1EXQA 1LAWA 2JGUA 4CJLA 4DTSA 4FYDA 1HQEA 3NGYA 5J2QA 4K8ZA 2P5GA 3OYCA 1CXUA 1RBTA 5JS2A 4CF8A 3AVJA 3OJUA 1DTTA 2HMIA 2BGGA 3PX0A 4CHYA 1SL1A 3HK2A 1KFDA 2BDPA 4CGIA 1RBUA 3O3HA 3SUOA 4KPYA 4UQGA 1C6VA 1VSDA 3LAKA 3ZSYA 4EZ9A 4ZTFA 3AVNA 3F9KA 4BDZA 4M3RA 3OYKA 4CJPA 4B8AB 4OPKA 3V1OA 5HRNA 1NK6A 3KLGA 1F21A 1T03A 3TR8A 4AHTA 3HYFA 4M45A 1J5OA 3NF7A 3SI6A 1G15A 4CGDA 1Q9XA 3OYEA 1EX4A 3VQ5A 1JL2A 3VN5A 1TK5A 1BGXT 1C0TA 4RW7A 3NDKA 4B9NA 4DQPA 4M42A 4AH9A 3AO4A 4CGHA 2YV0X 4KTZA 1BISA 4CF2A 4K8XA 4DQQA 2P5OA 3BDPA 3SQ2A 4FLUA 2AJQA 4GVMA 3ASMA 5FROA 1YTUA 2HHXA 2EX3A 4B3OA 1RT2A 2YKMA 4LSNA 3KJVA 3NHGA 4KV8A 4QCLA 1A5VA 1QSLA 3L8BA 2X6SA 1WSGA 3AO2A 2B4JA 4B9UA 3OYMA 3K59A 4DTOA 5DK5A 4IG0A 4KHNA 3H08A 3PV8A 3AA5X 4O4GA 4JLHA 3L2UA 3AVFA 3M8PA 5C25A 3OY9A 5HROA 3EYZA 1HYVA 2XHBA 4DFPA 4DU4A 1TV6A 1BQMA 1VSFA 4AHCA 1Z25A 1WSEA 1XWLA 1RT7A 4DSEA 3JSMA 3QEPA 1IG9A 1L3TA 1KRPA 4EZ6A 3SNNA 4CJFA 2E6MA 3IG1A 1C1BA 1HYZA 4MFBA 4N76A 3U3GA 1CZ9A 1RTIA 1JLBA 1RT1A 3VQ9A 3ZSXA 4FLZA 1XHZA 1NK0A 4KI6A 2DY4A 1SUQA 2BANA 4PUOA 1NOZA 1JLAA 3L3UA 3KD5E 1BIUA 4IFVA 4DTRA 3C94A 1WSJA 4CGGA 4I9LA 5FRMA 1R0AA 2X78A 4FXDA 4CJKA 3NH0A 1XHXA 2ZE2A 4KHSA 3DM2A 5DMRA 3SUPA 1KTQA 3C6UA 4B9MA 2Z1JA 4OLBA 3KLHA 1LW0A 3K57A 4DU1A 3QERA 3P5JA 3PO5A 1TAUA 1HRHA 3DOKA 3I0SA 4CFDA 3NE6A 1LWEA 4Z0UA 3V1RA 1EP4A 3O3GA 4E3SA 2YKNA 1QQCA 3KK2A 4CJRA 4KB0A 3L2RA 1UA0A 4FJHA 3NGZA 2ETJA 3AVBA 4I2QA 1BCOA 3QLHA 2G8UA 1TGOA 4I9QA 4RW6A 1BQNA 2IAJA 2Y1JA 3O3FA 1S1TA 3D0PA 3OS2A 4PQUA 1YVUA 3OVNA 2IS3A 3FFIA 3AVKA 4CGFA 3OYDA 4KHYA 4FVMA 2HHWA 2VWKA 4GW6A 4RG8A 3VQAA 1B9FA 4CK1A 3LZIA 2KW4A 4CHQA 4DSJA 4DS4A 4F8RA 3T19A 3V9WA 5JS1A 2GUIA 1NJYA 1A5WA 4OGEA 4FJ5A 2HHQA 4HUFA 4L8RB 3DLGA 2B6AA 4CCHA 1YTAA 1JKHA 3DLHA 4FK2A 1WLJA 4LH4A 2YNHA 4CGJA 3PX6A 1HQUA 2G8WA 3AVMA 4XIUA 3K58A 4ELTA 1D9DA 1S9GA 3LWMA 1FKPA 5T7BA 3K5MA 4DTMA 3RMAA 3UIQA 3THVA 2OPSA 3C95A 4I7FA 1HNVA 4OJRA 1S5JA 4W5OA 1WAJA 2OPPA 4DSFA 4HVJA 4HUEA 3QNOA 2HHSA 4Z4CA 3JYTA 4FW1A 2RF2A 2IDOA 4E19A 4CFAA 4CJ5A 1S6QA 1TKTA 3AO1A 3ZSOA 1JLQA 4CJUA 1DLOA 3IRXA 4IFYA 3MXIA 4DSKA 3HSTB 1IO2A 1GOAA 4N47A 4CECA 3AVHA 4OPJA 1RT6A 4M3WA 1VK0A 1ZBLA 1RNHA 5KI6A 3AVAA 4FJKA 1RDDA 3ALYA 3QO9A 3K5LA 1REVA 4NCAA 3NAEA 4BACA 3SPZA 2HW3A 4ID5A 1EKEA 1SL2A 3M8RA 1WN7A 1O1WA 3U6FA 3TAPA 2O4IA 3SV3A 1RT3A 3S9HA 1BHLA 4IKFA 4AHVA 3KLIA 1GOCA 1T7PA 4QOZB 4E7KA 1TKDA 3KKRA 1ZBIA 1HMVA 3OYJA 4E1MA 3HVTA 3QEWA 5EU7A 1UA1A 2BE2A 1SKWA 1CXQA 1U04A 3KD1E 4KAZA 3OS1A 3QNNA 2OPRA 4CHPA 2YNGA 4CEOA 1KFSA 4F4KA 4BE0A 4FZXC 4CFCA 4DSLA 3M8QA 3NH2A 4N5SA 3DRSA 1D5AA 2KZZA 4FM0A 2E6LA 3IS9A 3DOLA 3AVCA 1TL3A 1IKWA 4I2PA 3OYHA 3ZT0A 1VSLA 4CJ3A
chains in the Genus database with same CATH superfamily
3KKSA 3RR7A 4CIEA 4WYBA 1YXQA 4DR4K 5C24A 5I3UA 3AA2A 5AZJA 1W0HA 2HHUA 1SKRA 3OYIA 1RTHA 2VG6A 3VQCA 3HM8A 4AILC 3CCEN 3OYNA 4MO4A 3G10A 3BY5A 5KQ8A 3RTVA 3I8DA 3U8XA 2DFHA 4Q0BA 4FPAA 3UKRA 5JMVA 4CEBA 4XH1A 1HKGA 2CH6A 4ZHRA 1D8YA 4FCYA 4CEEA 3CCQN 3QIOA 1JLFA 4CIFA 2O8DA 3U3YA 4DMNA 3I55N 5I42A 1VSIA 1JXBA 3B6PA 4H0PA 3TSPA 2O4GA 4H5VA 4FJMA 4GV6A 4AM7A 3PIPL 1VRTA 1RCHA 1U48A 1C0MA 1HPZA 1T05A 3HPGA 4DCHA 3CCMN 3AV9A 3HM9A 4WE1A 5JVGL 3T1HK 5BPMA 3LALA 3NFAA 5AQLA 1ZBHA 5AR0A 1ILYA 2G8VA 3VF4A 2XO7A 1ZYQA 3OA9A 3DYAA 4FLVA 1OH7A 4N41A 4BC5A 3O4WA 1JJ2M 2I7NA 1NBWA 4JAXA 5AQNA 2RN2A 5SZTA 2ZWHA 4ID1A 4CD1A 1W9HA 1IKYA 4E7JA 3ENBA 1NK7A 1X9MA 3FZLA 4YFUA 3ATVA 4KHQA 4DSIA 2ZJPL 3KK1A 1TK8A 4BR9A 3ZLJA 4CBXA 1QHAA 2YNIA 4H0XB 3OHRA 1IKXA 4JS4A 2P9UA 3LDQA 2RHKA 1NGFA 4BG8A 2YJFA 3TANA 4OLAA 3VQ8A 3VF2A 1NU0A 2P9IA 2HBKA 1TAQA 3DXMB 4DR1K 3QICA 1E4FT 4CJTA 1JLCA 4FWNA 2FC0A 4A5BA 1D9FA 4EFHA 4RW4A 4C1NI 3HP9A 2HBLA 4JI5K 2Q2RA 1MDUB 4F2SA 1L3VA 1OKJA 3GG4A 1WBBA 3ZSQA 2OANA 4AHRA 5IWAK 2VG7A 3WXKA 2V52B 3TSQA 4IO9L 1RT5A 3KIOA 3U9DA 5C10A 4NYNA 2F8SA 2ZD1A 1HJRA 1WUAA 3CJBA 2DTUA 3CFOA 1NJIO 3ZSRA 2PBDA 1BL3A 3S3OA 4Y1DA 3ZT4A 3RMCA 2GEMA 4CHZA 5FPDA 3A0IX 2F96A 5CZ2A 2B5JA 3L0QA 3VQDA 5M1OA 1NK5A 1NK9A 3BEXA 4YNQA 4B9SA 3WNEA 5B8HA 2KQ2A 1XNQK 2ASPA 3ITHA 1KLNA 3O9QA 4O0IA 2KLAA 3AVGA 5HRRA 4O5BA 2VG5A 4IOAL 4DFJA 4CK3A 2VYPA 3FFKB 1LWCA 5AQJA 4KTQA 1UAXA 4PY5A 1N34K 5FRNA 3L6QA 1VQ5N 4OX9K 1C1AA 5JICA 3KHYA 3WEEB 2QM1A 2F7TA 3ISNC 3HXMA 2NUBA 1EO1A 3GOIA 5J2NA 4OGCA 3V9UA 4B1ZA 3LPTA 1WAFA 3VESA 1QQNA 1S1WA 1BCMA 3RSEA 1GLJO 4CF1A 5JLFA 5AQHA 3BF1A 3LM9A 1U2VB 3TAQA 4PKGA 4CI6A 3CERA 3O5BA 3D45A 4JK8A 3SUQA 4CJ7A 4EP5A 2XY8A 4H4MA 3CQXA 5HP1A 4B1WB 1NNEA 1HNZK 5AQRA 4PKIA 5AQOA 4K42A 4FWQA 3J81O 3MN9A 3O1WA 4Z4IA 3VQ4A 1ZXOA 3CXCM 3DLBA 4GNIA 3FR0A 4M3XA 1RBVA 1N33K 2OPQA 4DFMA 1NJXA 3QBWA 3LZJA 1N6QA 4OKEA 2D0OA 3QIPA 2RKIA 3E01A 3ZSZA 1XC3A 3GE1A 3K5OA 4JI4K 4DFKA 2I7PA 4KREA 3WNGA 5AQGA 1DEJA 3F9MA 3NF9A 2E20A 2QWMA 4RW9A 4AF1A 3RRHA 4ILJA 2NRHA 3LP3A 3ENHA 3SLCA 2QWQA 1RDWX 3LDOA 4DQ8A 4IZ9A 4KB1A 4JEPA 1SV5A 2QWNA 4DQIA 4AHSA 4CF9A 3A5OC 3ZT2A 3VENA 2XY5A 1HPMA 4BRAA 1EXQA 3THXB 5MLCQ 2JGUA 4DTSA 1Q82O 4FYDA 5J2QA 5GADP 4CF8A 2HMIA 5HL7L 4R79A 1RBUA 2JWKA 3ZSYA 2NRZA 4CJPA 2P9KB 3WXLA 1G15A 4CGDA 1EX4A 3R1XA 3VN5A 2HHHK 4DQPA 3NVKA 3TTFA 4MO5A 3DXKB 4K8XA 4DQQA 2AA4A 3MN5A 5AZJB 3RSEB 5I9EB 1DGKN 4B3OA 4LSNA 2NZTA 1A5VA 2GX9A 4H0TB 3C6AA 1M1KO 2X6SA 4YOXA 3WT0A 4B9UA 1ZBSA 5DK5A 4BC2A 1VHXA 3PV8A 3AA5X 3L2UA 5HROA 3OY9A 3M8PA 1HYVA 2PAVA 3HBTA 3C0BA 3I8BA 2CGLA 5C12A 3QEPA 1IG9A 4EZ6A 1NMDA 3SNNA 1C1BA 4X64K 3U3GA 1CZ9A 1RTIA 4KHSA 1NGBA 5AQQA 4CZKA 4FLZA 1NK0A 2DY4A 3OBYA 1JLAA 2YI1A 1WSJA 1X3NA 1YAGA 4I9LA 5FRMA 1QVGM 2X78A 2ZE2A 3E1YA 2KKZA 2QW9A 3KLHA 3K57A 1DKGD 2FLOA 3DOKA 3I0SA 4A61A 1IV0A 5EX5A 3BP8A 1QQCA 1ATSA 3VERA 4FJHA 3NGZA 3AVBA 4JKGB 1N8RO 3QLHA 4AM6A 1TGOA 3ID6A 2E1ZA 4I9QA 2A3ZA 1YVNA 3D0PA 4DR7K 3E9LA 4PHTX 2BUPA 1YVUA 1C0GA 3FFIA 4U67L 2J4RA 3AVKA 4BR5A 4RG8A 4MDBA 4CHQA 4F8RA 3CPWM 3UKUA 5JS1A 2GUIA 1A5WA 4WF9L 4HUFA 4YDUC 3D2EB 1JKHA 5GIOA 3O9UA 4NB4A 1WLJA 4LH4A 4CGJA 2OYQA 2G8WA 4XIUA 1S9GA 3LWMA 4DTMA 1KAZA 3M5RA 3THVA 4OO1J 1HNVA 4W5OA 2OPPA 1NMNA 1TUYA 3OW2M 2HHSA 2IDOA 4CJ5A 4HWIA 2YHYA 5ELZA 1JLQA 1DLOA 3HI0A 3IRXA 2RE2A 3VEWA 4M3WA 3VTIA 1RNHA 4FJKA 1RDDA 3QO9A 2V7ZA 1KAYA 3G6EN 1SL2A 3U6FA 2O4IA 1T7PA 1YUWA 4FWKA 1ZBIA 3OYJA 4E1MA 5LJWA 1VQ4N 4BR0A 3KD1E 4B9QA 1KFSA 4JD2A 4BE0A 4FZXC 5FPMA 4CFCA 3NH2A 3H6EA 4DR5K 2KZZA 1BU6O 4FOEA 3SMSA 2E6LA 1IKWA 4JRQA 1YI2N 4CJ3A 2QWLA 2PY5A 4CZGA 3N4PA 3ZCMA 4BREA 4H8KA 3V6DA 3HRGA 2R7YA 3EO3A 3ZT3A 1U2VA 3OTOK 5BPNA 4IXCA 2P51A 3MECA 3H3NO 4CZHA 4N56A 4FJLA 4HUGA 3OYAA 5HLFA 1NK4A 1I94K 1CZBA 4B8CA 5BR8K 3DAWA 2RPIA 3ZSWA 5J1EA 4PL7A 3AGRA 4DLEA 3LM2A 1XNRK 4WCEL 1LV5A 4TSXA 4JYAK 4BC4A 1VQ6N 1EQYA 4MDAA 2PYJA 2P9PB 5F1XA 3PSIA 3VEOA 3RWUA 4DR2K 1DTQA 4KH6A 4FWRA 4FK0A 3HJFA 3FZHA 2E2OA 2NRRA 3FGUA 2HNDA 4DWIA 1BA0A 4I6MB 3CMAN 1RDUA 1QSSA 4B3SK 5FDLA 3QEIA 1TKZA 3HSCA 2UXBK 1RILA 3C6TA 4FJXA 2UUCK 1XQSC 2UU9K 5KRSA 4CJQA 1LAVA 2KFNA 2JLEA 3PY8A 4KFBA 3CM6A 2BTFA 5M1QA 2IGIA 2O8CB 1T3VA 5AQXA 1P90A 3L2WA 2Q3SA 3MWPA 2A1SA 3T1YK 4JS5A 1ASVA 2FBXA 4MLEA 2KHOA 3SAGA 2F4VK 4EIAA 3P83D 3ULEA 2HB5A 3CETA 4FJGA 4AQYK 1HKBA 1BUPA 3J8AA 4JHDA 3RVCA 2E4LA 1HNIA 2F9TA 2O8BB 5BRFA 4E0DA 3V9SA 4H5RA 4H5TA 2Q31A 1J9AA 4E89A 5A2QO 3BGRA 2GTDA 4JI2K 3RMDA 3NF6A 3SBGA 3IDHA 4KTWA 4RTFD 1LOTB 1X1PA 3P31A 1NGCA 2QWOA 3O9SA 4G1QA 2Z1HA 2P9SA 3VTHA 4E7LA 1Z26A 1CZAN 1JLEA 3WNHA 3KWGA 2F8TA 2X74A 4FVUA 4HTLA 4KRFA 2XY7A 3TAGA 3SUNA 1TYQB 4KKOA 3ZYYX 3KLEA 2I5JA 2VGMA 4LF5K 4QAGA 4DTXA 4K43A 4X66K 4IDKA 4EP4A 3E9PA 4JD2B 1U49A 1KVBA 3TWHA 5KGWA 3VQBA 1NLVA 1S1XA 5LY3A 1JLGA 4CJVA 3MAQA 4KO0A 1U4BA 1KVCA 2FBYA 3P4IA 2EWSA 4GMJB 3ZX2A 3DLRA 3HP6A 3OS0A 5K14A 1TL1A 2YNFA 3SQ0A 4DTJA 3QINA 3EKUA 3I33A 1YIJN 4CJEA 4YOTA 3VEXA 4WFAL 4CZEA 2HVHA 1X9JA 5KTQA 1X9WA 1HLUA 4BE2A 1NGJA 4Z4HA 3SAHA 3VQ7A 3O4NA 5J2PA 4LF6K 4F2RA 3O08A 4E1JA 1VSMA 3FZKA 4O0JA 5AZIA 3M8SA 4JV5K 1E4GT 2HNYA 3F73A 4B9TA 4ICLA 1QSYA 4MLHA 4JI3K 4W5QA 3MXJA 3ZSVA 4LY7A 3V9ZA 1RGIA 1XC9A 3VGLA 5JLHA 1SKSA 2Z1GA 1RBSA 1RDBA 4FWMA 2WBNA 3W0LA 5HBMA 2D5RA 3CYMA 3PO4A 4ILHA 3EN9A 4QS9A 2WONA 3TARA 4C8OA 1W7AA 4DV3K 4FLXA 1B9DA 1IBLK 4CHOA 4DF4A 1K8KA 3ZEUB 1HYSA 4IG3A 3OYFA 3CJAA 4LFAK 3CCLN 1TYQA 4BG9A 1C1CA 1UOCA 4WQ5C 4FZYA 3R3LA 3MEGA 3SZ2A 3S3MA 5E41A 3TPQA 1HR0K 4CEAA 4OPAA 2ITGA 3THYB 1Q9YA 2A6AA 3QMLA 1T6DA 3RR8A 3HZ6A 1C0UA 4EHTA 4K25A 4FJIA 5H1SQ 1BI4A 1KVAA 1QTMA 1A5XA 3WUHA 4CJLA 2OTJN 3F2KA 2UXDK 3CCUN 1HQEA 2P9PA 1VQLN 1CXUA 1DTTA 5ADXH 1YJWN 5M1KA 3HK2A 1XUPO 1KFDA 1P8ZA 3SUOA 4CZLA 3O3HA 4UQGA 4ZTFA 3E9OA 3IFRA 3OYKA 2NRXA 3G71N 4B8AB 4OPKA 1NK6A 3KLGA 1F21A 3KVGA 4M45A 1J5OA 5AJ3K 3NF7A 3VETA 1Q9XA 3OYEA 3VQ5A 4B3RK 1JL2A 2NRVA 1TK5A 3NDKA 3M6GA 2P9UB 3AO4A 3BUZB 3AY9A 4AH9A 4FLUA 4O8KA 4ILGB 4F9OA 1IBMK 3ASMA 5FROA 5AQYA 3ZETB 2HHXA 2YKMA 3AGKA 3KJVA 3U9ZA 4C1NK 1GLFO 2Q97A 1TUUA 1SQKA 1ESVA 2D4WA 4KHNA 3H08A 4O4GA 4JLHA 1ZC6A 3AVFA 3O8MA 2XHBA 4DFPA 4DU4A 1Z25A 4DSEA 3D2FB 1L3TA 4BRQA 4CJFA 4CZIA 2FF6A 1DT9A 4N76A 3VQ9A 1XHZA 3I56N 2BANA 4JKFA 1R0AA 4FWLA 2A41A 3TU5A 1OVYA 3DM2A 5DMRA 2ITMA 1IJJA 4A62A 4B9MA 4OLBA 1LW0A 5JVHL 4JI7K 1HRHA 3EE8A 3EZWA 3SBTA 4Z0UA 3V1RA 4E3SA 2VQFK 2GUPA 1ATNA 3JXUA 2ETJA 1BCOA 2G8UA 3SJHA 4YOUA 4RW6A 4WQ4C 3CJCA 3N4QA 1NGHA 2V51B 1VQNN 4H5NA 2UUBK 2HHWA 4CK1A 4GW6A 1B9FA 1SS6A 4DSJA 3VF6A 5BRHA 4JI6K 1NJYA 4FJ5A 2HHQA 3QDKA 4L8RB 2B6AA 5EY4A 4CCHA 1RFQA 2Q0RA 2YNHA 1HQUA 3ID8A 5T7BA 4DV6K 2D1KA 1S5JA 5BN9A 4DSFA 3THWB 2RF2A 4M7YA 4BRHA 4E19A 1S6QA 1TKTA 5AQTA 3U4LA 3ZSOA 4CW7B 4BVPA 4IFYA 4L3QA 3MXIA 3HSTB 1IO2A 4BC3A 5TKWA 1RT6A 1ZBLA 3AVAA 3MN7A 3ALYA 1REVA 4NCAA 3NAEA 4BACA 4ID5A 5GAHP 1WN7A 1O1WA 3SV3A 3KLIA 4QOZB 3PIOL 5CR4A 2W6KA 2WUSA 4E7KA 3KKRA 1HMVA 3M1FA 2H3GX 3HVTA 2FF3B 5EU7A 2BE2A 1U04A 4KAZA 4CD3A 3EKSA 3J80O 2YNGA 3C6HA 4N5SA 3DRSA 3LDLA 3F5TA 1TL3A 4I2PA 3OYHA 3T3FA 1VSLA 1YHQN 1EWRA 3DI6A 4DHYA 4OKJA 4W5NA 3CF5L 3AVLA 1WSIA 4B1VA 3HOTA 3BZCA 3QB0A 4B08A 1VQ7N 1V4SA 4BE1A 4H0OA 5AQWA 4DV7K 3CFRA 1Q81O 3NGIA 3WXIA 1W97L 4NCBA 2O8EB 4BVOA 3DLEA 2FBVA 3AO3A 3SJJA 1S72N 4U7BA 4M3UA 2W42A 4CEDA 1MWMA 4JKGA 1NGDA 1U45A 1OVQA 4FLWA 1Q86O 3D2FA 2WOMA 3SAFA 3DLKA 1KQSM 4IJAA 1QQOA 5AQMA 3PX4A 3KTQA 3MEDA 4ZTJA 2DPNA 2YHAA 3UE5A 4DTNA 4BQLA 3AAQA 1BDGA 1K8KB 1TVRA 3ZEUA 3SYZA 3VA0A 4J2DA 3K2PA 2KZMA 4Z4FA 1IH7A 3TAFA 5LMUK 4E1NA 1BIZA 1VRUA 4A59A 4DQRA 4PWDA 4NYFA 1L3UA 1NJWA 4FOIA 5CY4A 1EETA 5HOOA 1K9MO 4JI0K 1KC8O 3OBWA 4LFBK 1I3AA 3HVRA 4NO7A 1MU2A 3L3VA 5KQDA 3J7ZO 4FJ7A 4H4OA 1VQKN 4FM1A 4M7XA 1YJNN 5C0YA 4DB3A 4E7IA 4DV1K 4NLCA 3K9KA 3B8AX 4C8LA 3SCXA 4FJ8A 4OPHA 2QXLA 3AO5A 1NJZA 3FZFA 1QS4A 4LF9K 4JKDA 1B92A 2NRTA 4XH5A 5C15A 5GIPA 1K8AO 4M3ZA 1J53A 3H46O 1WSHA 1QHTA 2YX6A 5ADXA 3OYBA 4FK4A 2E88A 2YJEA 4DKWA 3L2VA 3CPEA 2NNWA 3AAPA 3MN6A 4MQ3A 4H5WA 5GINA 2ZGZA 3DWLA 4IEIA 3T69A 1U47A 4BDPA 1WBDA 1GOBA 2QWPA 1WB9A 5CYMA 4DR6K 3LANA 4PKHA 4BROA 3P1GA 4BWJA 5HRPA 4EAHD 1GLLO 1JCEA 1VQPN 4DTUA 1FW6A 2O8EA 3D2EA 5CYQA 3G0ZA 3RRGA 3C7NB 4WFNL 1UWBA 1WNSA 5HRSA 4E7HA 2QKKA 3A2FA 3M3ZA 4CHNA 1L3SA 2Y1IA 3LDSA 1FK9A 1LCUA 3O4QA 3C65A 2HNZA 3OYGA 3TI0A 3NH1A 2IIRA 1BWFO 4CIGA 2OA8A 1WSFA 2Z1IA 1JXEA 4M41A 3ZT1A 3LP1A 4LSLA 3LP0A 3O9TA 3PUFA 3HT3A 1C0FA 1NKBA 3GDQA 3JAMO 2D0PA 4AHUA 1GLDG 3CJ1A 1Q8IA 2VQEK 4BDYA 2QK9A 5KGXA 4GV3A 2P9KA 2O8CA 1S6PA 4JKCA 3T1AA 2PFUA 2UYTA 4M63C 1NOYA 4LC9B 2O8DB 3A8YA 1Q7YO 3VGKA 2WFBA 2VWJA 4BR2A 2KFZA 1ATRA 5M1PA 4OKKA 3VQEA 2PZSA 2W41A 3CQ8A 3NBPA 5F0XA 2X6NA 4FWSA 1FKOA 3HOSA 4CJ4A 1NGGA 4BRGA 4CK2A 1TK0A 3VQPA 1IBKK 4CE9A 4CERA 1XMOK 4W5TA 5D3GA 4B9LA 4GVEA 4B9VA 4UY8O 4XEIA 4CESA 1FXXA 4HHTA 4KHUA 4W5RA 3CM5A 5AQPA 4HCBA 2HHTA 4FL9A 1S1UA 4J8FA 2LSNA 4H0YB 3K5NA 1HJOA 1NGIA 3HL8A 3LPUA 3WNFA 3J7AP 3O80A 4BWMA 4DV4K 2KTQA 3SV4A 1KLMA 1ASUA 1VSHA 4BRPA 4Z4EA 3HPOA 2E2QA 5CZ1A 2IVPA 2A1RA 3O6WA 2HBJA 3L2QA 1LW2A 2HVIA 1FJGK 1OH5A 2IOCA 3Q7BA 4DV2K 4M3TA 1T6CA 3SPYA 3UB5A 4RCHA 4ISFA 3CCSN 3P38A 3MX2A 1J5EK 4LF8K 1LAWA 3NGYA 2P5GA 3OYCA 5AQVA 5JS2A 3OJUA 3CIPA 2BGGA 2O8FB 3GL1A 4CHYA 2A40A 1C6VA 5CE3A 3LAKA 4EZ9A 2VWBA 3AVNA 4BDZA 2QI2A 2ZGYA 4M3RA 4FPBA 3HYFA 4WFBL 2E1YA 3J7YP 4PL8A 4DV0K 1WOQA 3G25A 2YV0X 3CC7N 4CF2A 3MWTA 3TSUA 3SQ2A 5DM7L 3H45C 1YTUA 4KHPK 2EX3A 4V19S 1RT2A 3NHGA 1WSGA 2QWRA 2B4JA 3OYMA 4DTOA 2OCEA 5C25A 4AHCA 1Q18A 1WSEA 1D4XA 1RT7A 1XWLA 3KZBA 1VQMN 1KRPA 3JS6A 4IWVA 2E6MA 3IG1A 3H1QA 1HYZA 4MFBA 2P9NB 1RT1A 2P9LA 4FSVA 5E26A 2O8BA 3VEZA 1SUQA 4PUOA 2NRWA 3CCVN 3CHWA 3L3UA 1BOTO 3KD5E 4DTRA 3C94A 4CGGA 4CJKA 1XHXA 3VOVA 2P9IB 2W40A 3SUPA 4K0KK 2Z1JA 4CBWA 1TAUA 4DU1A 3QERA 4JI8K 1M90O 4CFDA 5AQUA 1VAZA 3AARA 2YKNA 1BO5O 4CJRA 4KB0A 3L2RA 4I2QA 4WQ5A 3THYA 3DXMA 3TTCA 4BRLA 1BQNA 3O3FA 1S1TA 1XMQK 5AQZA 4DR3K 2ZM6K 4CGFA 3VQAA 2VWKA 3LZIA 2KW4A 4A5AA 3V9WA 3KWIA 2ASOA 2A42A 2UXCK 1YTAA 3DLHA 3KK7A 3PX6A 4I6MA 3AVMA 3K58A 4ELTA 1D9DA 3WQUA 1FKPA 3K5MA 3RMAA 3WEEA 3UIQA 2HBMA 2OPSA 3CI5A 1U6ZA 2HF3A 4OJRA 1WAJA 3FLCO 4A2BA 4BRMA 3QNOA 3JYTA 4FW1A 3ATUA 3GBTA 4B1YB 4CJUA 5EOYA 1OH6A 3CJ7A 3R8EA 4DSKA 3MDQA 4N47A 3DXKA 1EWQA 4OPJA 1VK0A 1QQMA 5KI6A 2QA4N 4RWTA 3K5LA 4IFEA 3NMUA 4B1XB 4ISEA 3SPZA 2HW3A 5CHIA 3M8RA 3TAPA 3PLAA 1RT3A 1BHLA 1O13A 4AHVA 4IKFA 2GWJA 1TKDA 3ZX3A 3QEWA 1MWKA 4JKHA 1CXQA 2OPRA 4CEOA 4F4KA 4YDUA 3M8QA 5GAGP 4GKKK 1H1VA 4FM0A 3IS9A 4YOVA 3DOLA 3DJCA 2P9NA 4X65K 3CC2N 4BRIA 1Z05A 3Q7CA 4IOCL 2GBZA 4BRFA 3EL2A 2XY6A 4CEQA 4F3OA 1T8EA 2D0CA 3VPZA 4DV5K 1N32K 4O44A 1BI4B 2CGKA 3KK3A 4J2AA 3V81A 4LD0A 2EHGA 2F9WA 3VMFB 4BRCA 4FM2A 4NCGA 3CMEN 5F2RA 3AVIA 4C8KA 3V1QA 4IJNA 2G8IA 2D0BA 2O8FA 5AFUH 1KCFA 4YY3K 2FBTA 5J2MA 5M1NA 4FW2A 1NGEA 2Q1NA 1VSEA 1KAXA 2GV9A 2QKBA 2DFFA 4KHWA 3QESA 4FLYA 4R5PA 3DRRA 3TAEA 3OJSA 1HX1A 4O55A 2G8HA 2CH5A 3VQQA 4B1UB 4XH4A 1HNWK 5AZIB 3SQ1A 4FJJA 3CD6N 4B3MK 3CCRN 1RDCA 3WQTA 1RDAA 3MMVA 4CFBA 2E2PA 2QTDA 4H0VB 1NK8A 1KD1O 1X3MA 3LP2A 3LL3A 3SMPA 1G99A 3ZX0A 4DUYK 1I39A 1IG8A 4DG1A 3TAMA 1RBRA 4CEFA 4GY2B 3VQ6A 4DTPA 1XI1A 4IBNA 3HO1A 2G8KA 4LF7K 5DM6L 4H03B 3VA3A 3B6OA 2PYLA 1RTJA 2IC3A 4CF0A 5LMNK 1VQON 3R9PA 4A57A 3SQ4A 3LDPA 5C42A 1JL1A 1VSJA 1J54A 4QS7A 5KPZA 4M3YA 2OZSA 3AA3A 2QEXN 3MX5A 3CFPA 4ELVA 5AQIA 1HKCA 4C8NA 3DRPA 3QEVA 2JWLA 3QEXA 3V9XA 3HPHA 4HCCA 1QZ5A 1VSKA 3DMJA 4BGBA 4FZZA 4BGAA 4LF4K 4QS8A 3ZETA 3NCIA 2ZJQL 1KXPA 1Y97A 4LH5A 2ZF5O 1S22A 3EE9A 2P1JA 1L5UA 1HUXA 1X9SA 2HF4A 4FWPA 4C8MA 2ATQA 5LL6Z 1RT4A 4JKEA 2YHBA 2E5LK 1CLQA 4OVLA 1MA9B 5E84A 5C2DA 5KRTA 3CQYA 1ITGA 5AQSA 1IKVA 4FJNA 4DU3A 2G8FA 2GELA 5EVZA 4NXMK 4IEEA 3LWLA 3THXA 1S9EA 3CG7A 4CJWA 4BR7A 3ULDA 4FO0A 4BRKA 5KPTA 4FJ9A 1ASWA 3KLFA 1W2BM 2HMPA 4FWOA 1VQ9N 4KI4A 4RW8A 1NG9A 3L4IA 4IDHA 5SWMA 1YT3A 1NWKA 2P9LB 4C23A 4JRPA 1JCFA 3LDNA 4IO8A 3QBXA 4ELUA 1S1VA 1GLCG 3LAMA 1RTDA 1KSPA 3NF8A 2GWKA 3VEYA 3BF3A 3TABA 2Q36A 1TKXA 4CEZA 5FLXO 4CZMA 4J2BA 1ZBFA 1GLAG 2OZMA 1K6YA 2QXFA 4PA1A 4JI1K 3THWA 1OH8A 1HNXK 2FXUA 3TTDA 4Z4GA 2HHVA 1NKCA 1ZBUA 3NVMA 4YHHK 4Y1CA 1NGAA 2IVOA 3OYLA 3V4IA 2CGJA 4DS5A 3IAYA 4J2EA 1QE1A 2V7YA 3AA4A 5AQKA 3T7ZA 1R59O 1GLBG 1NKEA 3S3NA 1BA1A 3I0RA 2DFEA 1QVFM 1K73O 2XRIA 4FLTA 4GV9A 4JKBA 4DQSA 3UKUB 1LWFA 3MK6A 2E8AA 4DLGA 5BN8A 4Q5VA 3K0SA 3EY1A 3RMBA 1N5YA 3P39A 3G4SN 2BH1A 3MEEA 2D0AA 2W6LA 3VEVA 3CCJN 3EZ5A 3FZMA 4BR4A 2VGNA 1GLEG 1YJ9N 4KH5A 5FPEA 4YOWA 4HTUA 4JHDB 2ZQBA 3QETA 4DF8A 3O1BA 3MXMA 4BRNA 4CJSA 4F3TA 1SL0A 2IVNA 3UKRB 2Q0UA 3E66A 5TKYA 2E2NA 4K8ZA 4BY9C 1RBTA 3AVJA 3SK3A 3PX0A 1SL1A 4JN4A 2HOEA 2BDPA 4CGIA 4KPYA 1VSDA 3W3DA 3IUCA 1N36K 1Z6RA 3F9KA 3L4QA 1VQ8N 3V1OA 5HRNA 2FSKA 4NLBA 4CVNE 1T03A 4JKAA 3TR8A 4AHTA 1YITN 5BREA 3SI6A 4B3TK 1BGXT 1C0TA 1YF5L 1SZ2A 4RW7A 5GAEP 4CZJA 4B9NA 4M42A 4CGHA 2ZJRL 4KTZA 1BISA 1JCGA 5LJVA 4ISGA 3BDPA 5BPLA 2P5OA 2AJQA 4GVMA 1QZ6A 3D7EO 1J6ZA 4BQZA 3IMXA 4KV8A 4G9ZA 4QCLA 1QSLA 3IKMA 3L8BA 3AO2A 4KH4A 4LFCK 3K59A 4JK9A 4IG0A 4K41A 3ENOA 5EXWA 2OTLN 3EYZA 2WTUA 2YHWA 1TV6A 1BQMA 1VSFA 3JSMA 1E3MA 3HTVA 1JLBA 4KI6A 4O5FA 3ZSXA 3K9JA 3CJ9A 3WXMB 1NOZA 3D6RA 1BIUA 5IT9O 4IFVA 4EHUA 4GKJK 3ULEB 4FXDA 3NH0A 5AQFA 3C7NA 3A5NC 1KTQA 3C6UA 5C2FA 3QFUA 4YOYA 3PO5A 3P5JA 1NM1A 5AFUA 3DLLL 3NE6A 1LWEA 1EP4A 3O3GA 3PSFA 3KK2A 1UA0A 3H3OB 4A2AA 2IAJA 2Y1JA 2P9SB 3S41A 4Z94A 3OS2A 4PQUA 5M1FA 3OVNA 2IS3A 3OYDA 3MCAB 4FVMA 4KHYA 3BZKA 3H1VX 4KBOA 2AP1A 4DS4A 2YHXA 3T19A 2UUAK 1S3XA 4OGEA 3A5MC 2A5XA 3DLGA 2WC9A 2ASMA 5FPNA 4CZFA 4FK2A 4YORA 3C95A 4I7FA 4HVJA 4HUEA 2FSNA 4Z4CA 1Y64A 4CFAA 3AO1A 5BR9A 3O9RA 5BRDA 4BRDA 4NXNK 3QFPA 4O8UA 1GOAA 4CECA 1T44A 3AVHA 3WXJA 4JNEA 5KPRA 2FSJA 3CC4N 4WQ4A 1EKEA 2YCHA 3S9HA 3VGMA 1GOCA 3R6MA 4Y0WA 3FE1A 1UA1A 1SKWA 2HSTA 3OS1A 3QNNA 4CHPA 2VCPA 3MCPA 4CBUA 4IOXA 1BG3A 3A5LC 4DSLA 3EEQA 4JK7A 1SAZA 1D5AA 4X62K 1V4TA 3AVCA 2NLXA 4DUZK 3ZT0A
chains in the Genus database with same CATH topology
3DI6A 4OKJA 2PY5A 3KKSA 3RR7A 4CIEA 4W5NA 2GBZA 3ZCMA 4H8KA 3AVLA 2XY6A 3V6DA 1WSIA 4CEQA 4F3OA 1T8EA 4B08A 2R7YA 2D0CA 3ZT3A 5C24A 4O44A 1BI4B 5I3UA 3AA2A 3KK3A 4J2AA 2P51A 1W0HA 3MECA 3V81A 2HHUA 1SKRA 4BE1A 4LD0A 2EHGA 4FM2A 4N56A 3OYIA 1RTHA 2VG6A 4NCGA 3VQCA 4HUGA 4AILC 4FJLA 3OYNA 3OYAA 3AVIA 3CFRA 5HLFA 3NGIA 1NK4A 4C8KA 3V1QA 3G10A 1CZBA 4B8CA 2G8IA 2D0BA 3RTVA 3I8DA 4NCBA 2DFHA 1KCFA 3DLEA 4Q0BA 2FBTA 5J2MA 2RPIA 2FBVA 3ZSWA 3AO3A 4CEBA 5J1EA 4FW2A 3SJJA 4M3UA 4DLEA 2W42A 4CEDA 1VSEA 4ZHRA 1U45A 1D8YA 2GV9A 4FCYA 4CEEA 4TSXA 1LV5A 3QIOA 1JLFA 4FLWA 4CIFA 2QKBA 2WOMA 2PYJA 3DLKA 3U3YA 4DMNA 5I42A 2DFFA 4KHWA 3QESA 4FLYA 3RWUA 1VSIA 3DRRA 4R5PA 1JXBA 3B6PA 3MEDA 3OJSA 3TAEA 3PX4A 4ZTJA 4O55A 3KTQA 2G8HA 2YHAA 1DTQA 2O4GA 4DTNA 4FJMA 3VQQA 1TVRA 4J2DA 4FK0A 3SYZA 3VA0A 3K2PA 1VRTA 3HJFA 2KZMA 1RCHA 4Z4FA 1IH7A 1U48A 1C0MA 3TAFA 1HPZA 3SQ1A 4FJJA 4E1NA 1BIZA 1VRUA 2HNDA 1T05A 1RDCA 4DWIA 3HPGA 4DQRA 1QSSA 1RDAA 4CFBA 5FDLA 3QEIA 1TKZA 4NYFA 1L3UA 4PWDA 1NJWA 3AV9A 3HM9A 4WE1A 5CY4A 1EETA 1RILA 3C6TA 4FJXA 1NK8A 3LALA 3NFAA 3LP2A 5KRSA 4CJQA 1LAVA 1ZBHA 2KFNA 2JLEA 1I3AA 2XO7A 3HVRA 1MU2A 2G8VA 1I39A 4KFBA 4DG1A 3TAMA 1RBRA 4CEFA 3CM6A 3VQ6A 4DTPA 1ZYQA 3PY8A 3L3VA 4IBNA 1XI1A 3HO1A 2IGIA 3DYAA 2G8KA 4FJ7A 4H4OA 4FLVA 4FM1A 3VA3A 4N41A 3B6OA 3L2WA 4E7IA 1RTJA 2Q3SA 2PYLA 2A1SA 2IC3A 4CF0A 4JS5A 1ASVA 2RN2A 5SZTA 4C8LA 2FBXA 3SCXA 4FJ8A 3SQ4A 4ID1A 1W9HA 5C42A 1JL1A 1VSJA 1J54A 1IKYA 3AO5A 4E7JA 4M3YA 1NJZA 1QS4A 1NK7A 1X9MA 2OZSA 3P83D 1B92A 2HB5A 3AA3A 4YFUA 4FJGA 4KHQA 3CFPA 4ELVA 4DSIA 4M3ZA 2E4LA 1J53A 1HNIA 3KK1A 1TK8A 1WSHA 2YNIA 1QHTA 4C8NA 3OYBA 4E0DA 3V9SA 4FK4A 1IKXA 4JS4A 1J9AA 3DRPA 4E89A 3QEVA 3QEXA 3BGRA 3RMDA 3V9XA 3HPHA 3NF6A 3TANA 4HCCA 4KTWA 3L2VA 4OLAA 4MQ3A 3VQ8A 1VSKA 3DMJA 1X1PA 4FZZA 1TAQA 1U47A 4BDPA 1GOBA 4G1QA 4CJTA 1JLCA 2Z1HA 3NCIA 2OYQA 4E7LA 1Z26A 1Y97A 2FC0A 5CYMA 1D9FA 1JLEA 4LH5A 4RW4A 3WNHA 3HP9A 3LANA 3P1GA 4BWJA 2F8TA 5HRPA 2P1JA 2X74A 1L5UA 1X9SA 4KRFA 2XY7A 3TAGA 4F2SA 1L3VA 4DTUA 3SUNA 4C8MA 3ZSQA 2ATQA 4KKOA 1RT4A 4AHRA 2YHBA 5CYQA 3KLEA 3G0ZA 2VG7A 3RRGA 2I5JA 1RT5A 4QAGA 4DTXA 3KIOA 2F8SA 4NYNA 1UWBA 1WNSA 1CLQA 5HRSA 4IDKA 4E7HA 4EP4A 2ZD1A 1HJRA 4OVLA 1U49A 2QKKA 2DTUA 3CFOA 3A2FA 1KVBA 5KRTA 3TWHA 3ZSRA 1ITGA 1BL3A 5KGWA 3VQBA 4CHNA 1IKVA 3S3OA 4FJNA 1L3SA 4Y1DA 2Y1IA 3ZT4A 3LDSA 4DU3A 1S1XA 2G8FA 3RMCA 1JLGA 1FK9A 4CHZA 4CJVA 3MAQA 2F96A 3O4QA 2HNZA 5CZ2A 2B5JA 3VQDA 1S9EA 3LWLA 3OYGA 1NK5A 1NK9A 3CG7A 4KO0A 4YNQA 3TI0A 3NH1A 4B9SA 3WNEA 4CIGA 1U4BA 1KVCA 2KQ2A 2FBYA 2OA8A 4CJWA 1WSFA 2Z1IA 3ITHA 1KLNA 4O0IA 1JXEA 3ULDA 4M41A 4GMJB 3ZT1A 3LP1A 3DLRA 4LSLA 3AVGA 3LP0A 3PUFA 5HRRA 4O5BA 4FJ9A 3HP6A 2VG5A 3OS0A 3HT3A 1ASWA 3KLFA 4DFJA 4CK3A 5K14A 1NKBA 1LWCA 1TL1A 2YNFA 4JRQA 4KTQA 1UAXA 4PY5A 4AHUA 4RW8A 4KI4A 1Q8IA 5FRNA 4BDYA 3SQ0A 2QK9A 5KGXA 1C1AA 5SWMA 1YT3A 4DTJA 3ISNC 3QINA 3HXMA 1S6PA 2NUBA 3T1AA 4CJEA 5J2NA 1NOYA 4JRPA 4OGCA 3V9UA 2HVHA 3LPTA 3T3FA 1WAFA 4ELUA 1S1VA 5KTQA 1X9WA 3LAMA 4BE2A 2VWJA 1S1WA 4Z4HA 3NF8A 1RTDA 1KSPA 1BCMA 2KFZA 3VQ7A 3O4NA 5J2PA 3TABA 4F2RA 1TKXA 4CEZA 4OKKA 3VQEA 4CF1A 2PZSA 1VSMA 3CQ8A 3NBPA 4O0JA 3M8SA 4J2BA 1ZBFA 2X6NA 3TAQA 2HNYA 3F73A 1FKOA 4B9TA 2OZMA 4ICLA 1K6YA 2QXFA 4PA1A 4CJ4A 1QSYA 4W5QA 4CK2A 3D45A 3MXJA 3SUQA 3ZSVA 4LY7A 1TK0A 3VQPA 4Z4GA 4CE9A 2HHVA 4CERA 3V9ZA 1NKCA 1ZBUA 4EP5A 4W5TA 2XY8A 5D3GA 4H4MA 4Y1CA 5HP1A 4B9LA 1XC9A 3OYLA 4B9VA 1SKSA 3V4IA 2Z1GA 4CESA 4DS5A 1RBSA 1RDBA 4Z4IA 3IAYA 4J2EA 1FXXA 1QE1A 3AA4A 3VQ4A 4HHTA 1NKEA 4KHUA 3S3NA 3DLBA 4W5RA 5HBMA 2D5RA 3CM5A 3CYMA 3PO4A 3I0RA 4M3XA 2DFEA 1RBVA 4HCBA 2HHTA 1S1UA 2XRIA 4FLTA 2OPQA 2WONA 2LSNA 4DFMA 3TARA 1NJXA 4C8OA 3LZJA 3K5NA 4DQSA 1N6QA 4DLGA 1LWFA 4FLXA 4OKEA 4Q5VA 3HL8A 1B9DA 3LPUA 3QIPA 3WNFA 3EY1A 3RMBA 1N5YA 2RKIA 3E01A 4CHOA 3ZSZA 4BWMA 4DF4A 2KTQA 3MEEA 1HYSA 2D0AA 4IG3A 3SV4A 3OYFA 1KLMA 1ASUA 1VSHA 4Z4EA 3EZ5A 3K5OA 3HPOA 4DFKA 1C1CA 1UOCA 5CZ1A 4FZYA 4KREA 3WNGA 3MEGA 2A1RA 3NF9A 4HTUA 4RW9A 3L2QA 3SZ2A 1LW2A 5E41A 3RRHA 2ZQBA 3S3MA 2HVIA 3QETA 3LP3A 4DF8A 3MXMA 2IOCA 4CJSA 4F3TA 4CEAA 4M3TA 2ITGA 1SL0A 3SPYA 4KB1A 1SV5A 1Q9YA 4DQIA 4AHSA 4CF9A 3RR8A 1C0UA 4FJIA 1BI4A 1KVAA 3ZT2A 2XY5A 1QTMA 1A5XA 1EXQA 1LAWA 2JGUA 4CJLA 4DTSA 4FYDA 1HQEA 3NGYA 5J2QA 4K8ZA 2P5GA 3OYCA 1CXUA 1RBTA 5JS2A 4CF8A 3AVJA 3OJUA 1DTTA 2HMIA 2BGGA 3PX0A 4CHYA 1SL1A 3HK2A 1KFDA 2BDPA 4CGIA 1RBUA 3O3HA 3SUOA 4KPYA 4UQGA 1C6VA 1VSDA 3LAKA 3ZSYA 4EZ9A 4ZTFA 3AVNA 3F9KA 4BDZA 4M3RA 3OYKA 4CJPA 4B8AB 4OPKA 3V1OA 5HRNA 1NK6A 3KLGA 1F21A 1T03A 3TR8A 4AHTA 3HYFA 4M45A 1J5OA 3NF7A 3SI6A 1G15A 4CGDA 1Q9XA 3OYEA 1EX4A 3VQ5A 1JL2A 3VN5A 1TK5A 1BGXT 1C0TA 4RW7A 3NDKA 4B9NA 4DQPA 4M42A 4AH9A 3AO4A 4CGHA 2YV0X 4KTZA 1BISA 4CF2A 4K8XA 4DQQA 2P5OA 3BDPA 3SQ2A 4FLUA 2AJQA 4GVMA 3ASMA 5FROA 1YTUA 2HHXA 2EX3A 4B3OA 1RT2A 2YKMA 4LSNA 3KJVA 3NHGA 4KV8A 4QCLA 1A5VA 1QSLA 3L8BA 2X6SA 1WSGA 3AO2A 2B4JA 4B9UA 3OYMA 3K59A 4DTOA 5DK5A 4IG0A 4KHNA 3H08A 3PV8A 3AA5X 4O4GA 4JLHA 3L2UA 3AVFA 3M8PA 5C25A 3OY9A 5HROA 3EYZA 1HYVA 2XHBA 4DFPA 4DU4A 1TV6A 1BQMA 1VSFA 4AHCA 1Z25A 1WSEA 1XWLA 1RT7A 4DSEA 3JSMA 3QEPA 1IG9A 1L3TA 1KRPA 4EZ6A 3SNNA 4CJFA 2E6MA 3IG1A 1C1BA 1HYZA 4MFBA 4N76A 3U3GA 1CZ9A 1RTIA 1JLBA 1RT1A 3VQ9A 3ZSXA 4FLZA 1XHZA 1NK0A 4KI6A 2DY4A 1SUQA 2BANA 4PUOA 1NOZA 1JLAA 3L3UA 3KD5E 1BIUA 4IFVA 4DTRA 3C94A 1WSJA 4CGGA 4I9LA 5FRMA 1R0AA 2X78A 4FXDA 4CJKA 3NH0A 1XHXA 2ZE2A 4KHSA 3DM2A 5DMRA 3SUPA 1KTQA 3C6UA 4B9MA 2Z1JA 4OLBA 3KLHA 1LW0A 3K57A 4DU1A 3QERA 3P5JA 3PO5A 1TAUA 1HRHA 3DOKA 3I0SA 4CFDA 3NE6A 1LWEA 4Z0UA 3V1RA 1EP4A 3O3GA 4E3SA 2YKNA 1QQCA 3KK2A 4CJRA 4KB0A 3L2RA 1UA0A 4FJHA 3NGZA 2ETJA 3AVBA 4I2QA 1BCOA 3QLHA 2G8UA 1TGOA 4I9QA 4RW6A 1BQNA 2IAJA 2Y1JA 3O3FA 1S1TA 3D0PA 3OS2A 4PQUA 1YVUA 3OVNA 2IS3A 3FFIA 3AVKA 4CGFA 3OYDA 4KHYA 4FVMA 2HHWA 2VWKA 4GW6A 4RG8A 3VQAA 1B9FA 4CK1A 3LZIA 2KW4A 4CHQA 4DSJA 4DS4A 4F8RA 3T19A 3V9WA 5JS1A 2GUIA 1NJYA 1A5WA 4OGEA 4FJ5A 2HHQA 4HUFA 4L8RB 3DLGA 2B6AA 4CCHA 1YTAA 1JKHA 3DLHA 4FK2A 1WLJA 4LH4A 2YNHA 4CGJA 3PX6A 1HQUA 2G8WA 3AVMA 4XIUA 3K58A 4ELTA 1D9DA 1S9GA 3LWMA 1FKPA 5T7BA 3K5MA 4DTMA 3RMAA 3UIQA 3THVA 2OPSA 3C95A 4I7FA 1HNVA 4OJRA 1S5JA 4W5OA 1WAJA 2OPPA 4DSFA 4HVJA 4HUEA 3QNOA 2HHSA 4Z4CA 3JYTA 4FW1A 2RF2A 2IDOA 4E19A 4CFAA 4CJ5A 1S6QA 1TKTA 3AO1A 3ZSOA 1JLQA 4CJUA 1DLOA 3IRXA 4IFYA 3MXIA 4DSKA 3HSTB 1IO2A 1GOAA 4N47A 4CECA 3AVHA 4OPJA 1RT6A 4M3WA 1VK0A 1ZBLA 1RNHA 5KI6A 3AVAA 4FJKA 1RDDA 3ALYA 3QO9A 3K5LA 1REVA 4NCAA 3NAEA 4BACA 3SPZA 2HW3A 4ID5A 1EKEA 1SL2A 3M8RA 1WN7A 1O1WA 3U6FA 3TAPA 2O4IA 3SV3A 1RT3A 3S9HA 1BHLA 4IKFA 4AHVA 3KLIA 1GOCA 1T7PA 4QOZB 4E7KA 1TKDA 3KKRA 1ZBIA 1HMVA 3OYJA 4E1MA 3HVTA 3QEWA 5EU7A 1UA1A 2BE2A 1SKWA 1CXQA 1U04A 3KD1E 4KAZA 3OS1A 3QNNA 2OPRA 4CHPA 2YNGA 4CEOA 1KFSA 4F4KA 4BE0A 4FZXC 4CFCA 4DSLA 3M8QA 3NH2A 4N5SA 3DRSA 1D5AA 2KZZA 4FM0A 2E6LA 3IS9A 3DOLA 3AVCA 1TL3A 1IKWA 4I2PA 3OYHA 3ZT0A 1VSLA 4CJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DI6 A;  4OKJ A;  2PY5 A;  3KKS A;  3RR7 A;  4CIE A;  4W5N A;  2GBZ A;  3ZCM A;  4H8K A;  3AVL A;  2XY6 A;  3V6D A;  1WSI A;  4CEQ A;  4F3O A;  1T8E A;  4B08 A;  2R7Y A;  2D0C A;  3ZT3 A;  5C24 A;  4O44 A;  1BI4 B;  5I3U A;  3AA2 A;  3KK3 A;  4J2A A;  2P51 A;  1W0H A;  3MEC A;  3V81 A;  2HHU A;  1SKR A;  4BE1 A;  4LD0 A;  2EHG A;  4FM2 A;  4N56 A;  3OYI A;  1RTH A;  2VG6 A;  4NCG A;  3VQC A;  4HUG A;  4AIL C;  4FJL A;  3OYN A;  3OYA A;  3AVI A;  3CFR A;  5HLF A;  3NGI A;  1NK4 A;  4C8K A;  3V1Q A;  3G10 A;  1CZB A;  4B8C A;  2G8I A;  2D0B A;  3RTV A;  3I8D A;  4NCB A;  2DFH A;  1KCF A;  3DLE A;  4Q0B A;  2FBT A;  5J2M A;  2RPI A;  2FBV A;  3ZSW A;  3AO3 A;  4CEB A;  5J1E A;  4FW2 A;  3SJJ A;  4M3U A;  4DLE A;  2W42 A;  4CED A;  1VSE A;  4ZHR A;  1U45 A;  1D8Y A;  2GV9 A;  4FCY A;  4CEE A;  4TSX A;  1LV5 A;  3QIO A;  1JLF A;  4FLW A;  4CIF A;  2QKB A;  2WOM A;  2PYJ A;  3DLK A;  3U3Y A;  4DMN A;  5I42 A;  2DFF A;  4KHW A;  3QES A;  4FLY A;  3RWU A;  1VSI A;  3DRR A;  4R5P A;  1JXB A;  3B6P A;  3MED A;  3OJS A;  3TAE A;  3PX4 A;  4ZTJ A;  4O55 A;  3KTQ A;  2G8H A;  2YHA A;  1DTQ A;  2O4G A;  4DTN A;  4FJM A;  3VQQ A;  1TVR A;  4J2D A;  4FK0 A;  3SYZ A;  3VA0 A;  3K2P A;  1VRT A;  3HJF A;  2KZM A;  1RCH A;  4Z4F A;  1IH7 A;  1U48 A;  1C0M A;  3TAF A;  1HPZ A;  3SQ1 A;  4FJJ A;  4E1N A;  1BIZ A;  1VRU A;  2HND A;  1T05 A;  1RDC A;  4DWI A;  3HPG A;  4DQR A;  1QSS A;  1RDA A;  4CFB A;  5FDL A;  3QEI A;  1TKZ A;  4NYF A;  1L3U A;  4PWD A;  1NJW A;  3AV9 A;  3HM9 A;  4WE1 A;  5CY4 A;  1EET A;  1RIL A;  3C6T A;  4FJX A;  1NK8 A;  3LAL A;  3NFA A;  3LP2 A;  5KRS A;  4CJQ A;  1LAV A;  1ZBH A;  2KFN A;  2JLE A;  1I3A A;  2XO7 A;  3HVR A;  1MU2 A;  2G8V A;  1I39 A;  4KFB A;  4DG1 A;  3TAM A;  1RBR A;  4CEF A;  3CM6 A;  3VQ6 A;  4DTP A;  1ZYQ A;  3PY8 A;  3L3V A;  4IBN A;  1XI1 A;  3HO1 A;  2IGI A;  3DYA A;  2G8K A;  4FJ7 A;  4H4O A;  4FLV A;  4FM1 A;  3VA3 A;  4N41 A;  3B6O A;  3L2W A;  4E7I A;  1RTJ A;  2Q3S A;  2PYL A;  2A1S A;  2IC3 A;  4CF0 A;  4JS5 A;  1ASV A;  2RN2 A;  5SZT A;  4C8L A;  2FBX A;  3SCX A;  4FJ8 A;  3SQ4 A;  4ID1 A;  1W9H A;  5C42 A;  1JL1 A;  1VSJ A;  1J54 A;  1IKY A;  3AO5 A;  4E7J A;  4M3Y A;  1NJZ A;  1QS4 A;  1NK7 A;  1X9M A;  2OZS A;  3P83 D;  1B92 A;  2HB5 A;  3AA3 A;  4YFU A;  4FJG A;  4KHQ A;  3CFP A;  4ELV A;  4DSI A;  4M3Z A;  2E4L A;  1J53 A;  1HNI A;  3KK1 A;  1TK8 A;  1WSH A;  2YNI A;  1QHT A;  4C8N A;  3OYB A;  4E0D A;  3V9S A;  4FK4 A;  1IKX A;  4JS4 A;  1J9A A;  3DRP A;  4E89 A;  3QEV A;  3QEX A;  3BGR A;  3RMD A;  3V9X A;  3HPH A;  3NF6 A;  3TAN A;  4HCC A;  4KTW A;  3L2V A;  4OLA A;  4MQ3 A;  3VQ8 A;  1VSK A;  3DMJ A;  1X1P A;  4FZZ A;  1TAQ A;  1U47 A;  4BDP A;  1GOB A;  4G1Q A;  4CJT A;  1JLC A;  2Z1H A;  3NCI A;  2OYQ A;  4E7L A;  1Z26 A;  1Y97 A;  2FC0 A;  5CYM A;  1D9F A;  1JLE A;  4LH5 A;  4RW4 A;  3WNH A;  3HP9 A;  3LAN A;  3P1G A;  4BWJ A;  2F8T A;  5HRP A;  2P1J A;  2X74 A;  1L5U A;  1X9S A;  4KRF A;  2XY7 A;  3TAG A;  4F2S A;  1L3V A;  4DTU A;  3SUN A;  4C8M A;  3ZSQ A;  2ATQ A;  4KKO A;  1RT4 A;  4AHR A;  2YHB A;  5CYQ A;  3KLE A;  3G0Z A;  2VG7 A;  3RRG A;  2I5J A;  1RT5 A;  4QAG A;  4DTX A;  3KIO A;  2F8S A;  4NYN A;  1UWB A;  1WNS A;  1CLQ A;  5HRS A;  4IDK A;  4E7H A;  4EP4 A;  2ZD1 A;  1HJR A;  4OVL A;  1U49 A;  2QKK A;  2DTU A;  3CFO A;  3A2F A;  1KVB A;  5KRT A;  3TWH A;  3ZSR A;  1ITG A;  1BL3 A;  5KGW A;  3VQB A;  4CHN A;  1IKV A;  3S3O A;  4FJN A;  1L3S A;  4Y1D A;  2Y1I A;  3ZT4 A;  3LDS A;  4DU3 A;  1S1X A;  2G8F A;  3RMC A;  1JLG A;  1FK9 A;  4CHZ A;  4CJV A;  3MAQ A;  2F96 A;  3O4Q A;  2HNZ A;  5CZ2 A;  2B5J A;  3VQD A;  1S9E A;  3LWL A;  3OYG A;  1NK5 A;  1NK9 A;  3CG7 A;  4KO0 A;  4YNQ A;  3TI0 A;  3NH1 A;  4B9S A;  3WNE A;  4CIG A;  1U4B A;  1KVC A;  2KQ2 A;  2FBY A;  2OA8 A;  4CJW A;  1WSF A;  2Z1I A;  3ITH A;  1KLN A;  4O0I A;  1JXE A;  3ULD A;  4M41 A;  4GMJ B;  3ZT1 A;  3LP1 A;  3DLR A;  4LSL A;  3AVG A;  3LP0 A;  3PUF A;  5HRR A;  4O5B A;  4FJ9 A;  3HP6 A;  2VG5 A;  3OS0 A;  3HT3 A;  1ASW A;  3KLF A;  4DFJ A;  4CK3 A;  5K14 A;  1NKB A;  1LWC A;  1TL1 A;  2YNF A;  4JRQ A;  4KTQ A;  1UAX A;  4PY5 A;  4AHU A;  4RW8 A;  4KI4 A;  1Q8I A;  5FRN A;  4BDY A;  3SQ0 A;  2QK9 A;  5KGX A;  1C1A A;  5SWM A;  1YT3 A;  4DTJ A;  3ISN C;  3QIN A;  3HXM A;  1S6P A;  2NUB A;  3T1A A;  4CJE A;  5J2N A;  1NOY A;  4JRP A;  4OGC A;  3V9U A;  2HVH A;  3LPT A;  3T3F A;  1WAF A;  4ELU A;  1S1V A;  5KTQ A;  1X9W A;  3LAM A;  4BE2 A;  2VWJ A;  1S1W A;  4Z4H A;  3NF8 A;  1RTD A;  1KSP A;  1BCM A;  2KFZ A;  3VQ7 A;  3O4N A;  5J2P A;  3TAB A;  4F2R A;  1TKX A;  4CEZ A;  4OKK A;  3VQE A;  4CF1 A;  2PZS A;  1VSM A;  3CQ8 A;  3NBP A;  4O0J A;  3M8S A;  4J2B A;  1ZBF A;  2X6N A;  3TAQ A;  2HNY A;  3F73 A;  1FKO A;  4B9T A;  2OZM A;  4ICL A;  1K6Y A;  2QXF A;  4PA1 A;  4CJ4 A;  1QSY A;  4W5Q A;  4CK2 A;  3D45 A;  3MXJ A;  3SUQ A;  3ZSV A;  4LY7 A;  1TK0 A;  3VQP A;  4Z4G A;  4CE9 A;  2HHV A;  4CER A;  3V9Z A;  1NKC A;  1ZBU A;  4EP5 A;  4W5T A;  2XY8 A;  5D3G A;  4H4M A;  4Y1C A;  5HP1 A;  4B9L A;  1XC9 A;  3OYL A;  4B9V A;  1SKS A;  3V4I A;  2Z1G A;  4CES A;  4DS5 A;  1RBS A;  1RDB A;  4Z4I A;  3IAY A;  4J2E A;  1FXX A;  1QE1 A;  3AA4 A;  3VQ4 A;  4HHT A;  1NKE A;  4KHU A;  3S3N A;  3DLB A;  4W5R A;  5HBM A;  2D5R A;  3CM5 A;  3CYM A;  3PO4 A;  3I0R A;  4M3X A;  2DFE A;  1RBV A;  4HCB A;  2HHT A;  1S1U A;  2XRI A;  4FLT A;  2OPQ A;  2WON A;  2LSN A;  4DFM A;  3TAR A;  1NJX A;  4C8O A;  3LZJ A;  3K5N A;  4DQS A;  1N6Q A;  4DLG A;  1LWF A;  4FLX A;  4OKE A;  4Q5V A;  3HL8 A;  1B9D A;  3LPU A;  3QIP A;  3WNF A;  3EY1 A;  3RMB A;  1N5Y A;  2RKI A;  3E01 A;  4CHO A;  3ZSZ A;  4BWM A;  4DF4 A;  2KTQ A;  3MEE A;  1HYS A;  2D0A A;  4IG3 A;  3SV4 A;  3OYF A;  1KLM A;  1ASU A;  1VSH A;  4Z4E A;  3EZ5 A;  3K5O A;  3HPO A;  4DFK A;  1C1C A;  1UOC A;  5CZ1 A;  4FZY A;  4KRE A;  3WNG A;  3MEG A;  2A1R A;  3NF9 A;  4HTU A;  4RW9 A;  3L2Q A;  3SZ2 A;  1LW2 A;  5E41 A;  3RRH A;  2ZQB A;  3S3M A;  2HVI A;  3QET A;  3LP3 A;  4DF8 A;  3MXM A;  2IOC A;  4CJS A;  4F3T A;  4CEA A;  4M3T A;  2ITG A;  1SL0 A;  3SPY A;  4KB1 A;  1SV5 A;  1Q9Y A;  4DQI A;  4AHS A;  4CF9 A;  3RR8 A;  1C0U A;  4FJI A;  1BI4 A;  1KVA A;  3ZT2 A;  2XY5 A;  1QTM A;  1A5X A;  1EXQ A;  1LAW A;  2JGU A;  4CJL A;  4DTS A;  4FYD A;  1HQE A;  3NGY A;  5J2Q A;  4K8Z A;  2P5G A;  3OYC A;  1CXU A;  1RBT A;  5JS2 A;  4CF8 A;  3AVJ A;  3OJU A;  1DTT A;  2HMI A;  2BGG A;  3PX0 A;  4CHY A;  1SL1 A;  3HK2 A;  1KFD A;  2BDP A;  4CGI A;  1RBU A;  3O3H A;  3SUO A;  4KPY A;  4UQG A;  1C6V A;  1VSD A;  3LAK A;  3ZSY A;  4EZ9 A;  4ZTF A;  3AVN A;  3F9K A;  4BDZ A;  4M3R A;  3OYK A;  4CJP A;  4B8A B;  4OPK A;  3V1O A;  5HRN A;  1NK6 A;  3KLG A;  1F21 A;  1T03 A;  3TR8 A;  4AHT A;  3HYF A;  4M45 A;  1J5O A;  3NF7 A;  3SI6 A;  1G15 A;  4CGD A;  1Q9X A;  3OYE A;  1EX4 A;  3VQ5 A;  1JL2 A;  3VN5 A;  1TK5 A;  1BGX T;  1C0T A;  4RW7 A;  3NDK A;  4B9N A;  4DQP A;  4M42 A;  4AH9 A;  3AO4 A;  4CGH A;  2YV0 X;  4KTZ A;  1BIS A;  4CF2 A;  4K8X A;  4DQQ A;  2P5O A;  3BDP A;  3SQ2 A;  4FLU A;  2AJQ A;  4GVM A;  3ASM A;  5FRO A;  1YTU A;  2HHX A;  2EX3 A;  4B3O A;  1RT2 A;  2YKM A;  4LSN A;  3KJV A;  3NHG A;  4KV8 A;  4QCL A;  1A5V A;  1QSL A;  3L8B A;  2X6S A;  1WSG A;  3AO2 A;  2B4J A;  4B9U A;  3OYM A;  3K59 A;  4DTO A;  5DK5 A;  4IG0 A;  4KHN A;  3H08 A;  3PV8 A;  3AA5 X;  4O4G A;  4JLH A;  3L2U A;  3AVF A;  3M8P A;  5C25 A;  3OY9 A;  5HRO A;  3EYZ A;  1HYV A;  2XHB A;  4DFP A;  4DU4 A;  1TV6 A;  1BQM A;  1VSF A;  4AHC A;  1Z25 A;  1WSE A;  1XWL A;  1RT7 A;  4DSE A;  3JSM A;  3QEP A;  1IG9 A;  1L3T A;  1KRP A;  4EZ6 A;  3SNN A;  4CJF A;  2E6M A;  3IG1 A;  1C1B A;  1HYZ A;  4MFB A;  4N76 A;  3U3G A;  1CZ9 A;  1RTI A;  1JLB A;  1RT1 A;  3VQ9 A;  3ZSX A;  4FLZ A;  1XHZ A;  1NK0 A;  4KI6 A;  2DY4 A;  1SUQ A;  2BAN A;  4PUO A;  1NOZ A;  1JLA A;  3L3U A;  3KD5 E;  1BIU A;  4IFV A;  4DTR A;  3C94 A;  1WSJ A;  4CGG A;  4I9L A;  5FRM A;  1R0A A;  2X78 A;  4FXD A;  4CJK A;  3NH0 A;  1XHX A;  2ZE2 A;  4KHS A;  3DM2 A;  5DMR A;  3SUP A;  1KTQ A;  3C6U A;  4B9M A;  2Z1J A;  4OLB A;  3KLH A;  1LW0 A;  3K57 A;  4DU1 A;  3QER A;  3P5J A;  3PO5 A;  1TAU A;  1HRH A;  3DOK A;  3I0S A;  4CFD A;  3NE6 A;  1LWE A;  4Z0U A;  3V1R A;  1EP4 A;  3O3G A;  4E3S A;  2YKN A;  1QQC A;  3KK2 A;  4CJR A;  4KB0 A;  3L2R A;  1UA0 A;  4FJH A;  3NGZ A;  2ETJ A;  3AVB A;  4I2Q A;  1BCO A;  3QLH A;  2G8U A;  1TGO A;  4I9Q A;  4RW6 A;  1BQN A;  2IAJ A;  2Y1J A;  3O3F A;  1S1T A;  3D0P A;  3OS2 A;  4PQU A;  1YVU A;  3OVN A;  2IS3 A;  3FFI A;  3AVK A;  4CGF A;  3OYD A;  4KHY A;  4FVM A;  2HHW A;  2VWK A;  4GW6 A;  4RG8 A;  3VQA A;  1B9F A;  4CK1 A;  3LZI A;  2KW4 A;  4CHQ A;  4DSJ A;  4DS4 A;  4F8R A;  3T19 A;  3V9W A;  5JS1 A;  2GUI A;  1NJY A;  1A5W A;  4OGE A;  4FJ5 A;  2HHQ A;  4HUF A;  4L8R B;  3DLG A;  2B6A A;  4CCH A;  1YTA A;  1JKH A;  3DLH A;  4FK2 A;  1WLJ A;  4LH4 A;  2YNH A;  4CGJ A;  3PX6 A;  1HQU A;  2G8W A;  3AVM A;  4XIU A;  3K58 A;  4ELT A;  1D9D A;  1S9G A;  3LWM A;  1FKP A;  5T7B A;  3K5M A;  4DTM A;  3RMA A;  3UIQ A;  3THV A;  2OPS A;  3C95 A;  4I7F A;  1HNV A;  4OJR A;  1S5J A;  4W5O A;  1WAJ A;  2OPP A;  4DSF A;  4HVJ A;  4HUE A;  3QNO A;  2HHS A;  4Z4C A;  3JYT A;  4FW1 A;  2RF2 A;  2IDO A;  4E19 A;  4CFA A;  4CJ5 A;  1S6Q A;  1TKT A;  3AO1 A;  3ZSO A;  1JLQ A;  4CJU A;  1DLO A;  3IRX A;  4IFY A;  3MXI A;  4DSK A;  3HST B;  1IO2 A;  1GOA A;  4N47 A;  4CEC A;  3AVH A;  4OPJ A;  1RT6 A;  4M3W A;  1VK0 A;  1ZBL A;  1RNH A;  5KI6 A;  3AVA A;  4FJK A;  1RDD A;  3ALY A;  3QO9 A;  3K5L A;  1REV A;  4NCA A;  3NAE A;  4BAC A;  3SPZ A;  2HW3 A;  4ID5 A;  1EKE A;  1SL2 A;  3M8R A;  1WN7 A;  1O1W A;  3U6F A;  3TAP A;  2O4I A;  3SV3 A;  1RT3 A;  3S9H A;  1BHL A;  4IKF A;  4AHV A;  3KLI A;  1GOC A;  1T7P A;  4QOZ B;  4E7K A;  1TKD A;  3KKR A;  1ZBI A;  1HMV A;  3OYJ A;  4E1M A;  3HVT A;  3QEW A;  5EU7 A;  1UA1 A;  2BE2 A;  1SKW A;  1CXQ A;  1U04 A;  3KD1 E;  4KAZ A;  3OS1 A;  3QNN A;  2OPR A;  4CHP A;  2YNG A;  4CEO A;  1KFS A;  4F4K A;  4BE0 A;  4FZX C;  4CFC A;  4DSL A;  3M8Q A;  3NH2 A;  4N5S A;  3DRS A;  1D5A A;  2KZZ A;  4FM0 A;  2E6L A;  3IS9 A;  3DOL A;  3AVC A;  1TL3 A;  1IKW A;  4I2P A;  3OYH A;  3ZT0 A;  1VSL A;  4CJ3 A; 
#chains in the Genus database with same CATH topology
 3KKS A;  3RR7 A;  4CIE A;  4WYB A;  1YXQ A;  4DR4 K;  5C24 A;  5I3U A;  3AA2 A;  5AZJ A;  1W0H A;  2HHU A;  1SKR A;  3OYI A;  1RTH A;  2VG6 A;  3VQC A;  3HM8 A;  4AIL C;  3CCE N;  3OYN A;  4MO4 A;  3G10 A;  3BY5 A;  5KQ8 A;  3RTV A;  3I8D A;  3U8X A;  2DFH A;  4Q0B A;  4FPA A;  3UKR A;  5JMV A;  4CEB A;  4XH1 A;  1HKG A;  2CH6 A;  4ZHR A;  1D8Y A;  4FCY A;  4CEE A;  3CCQ N;  3QIO A;  1JLF A;  4CIF A;  2O8D A;  3U3Y A;  4DMN A;  3I55 N;  5I42 A;  1VSI A;  1JXB A;  3B6P A;  4H0P A;  3TSP A;  2O4G A;  4H5V A;  4FJM A;  4GV6 A;  4AM7 A;  3PIP L;  1VRT A;  1RCH A;  1U48 A;  1C0M A;  1HPZ A;  1T05 A;  3HPG A;  4DCH A;  3CCM N;  3AV9 A;  3HM9 A;  4WE1 A;  5JVG L;  3T1H K;  5BPM A;  3LAL A;  3NFA A;  5AQL A;  1ZBH A;  5AR0 A;  1ILY A;  2G8V A;  3VF4 A;  2XO7 A;  1ZYQ A;  3OA9 A;  3DYA A;  4FLV A;  1OH7 A;  4N41 A;  4BC5 A;  3O4W A;  1JJ2 M;  2I7N A;  1NBW A;  4JAX A;  5AQN A;  2RN2 A;  5SZT A;  2ZWH A;  4ID1 A;  4CD1 A;  1W9H A;  1IKY A;  4E7J A;  3ENB A;  1NK7 A;  1X9M A;  3FZL A;  4YFU A;  3ATV A;  4KHQ A;  4DSI A;  2ZJP L;  3KK1 A;  1TK8 A;  4BR9 A;  3ZLJ A;  4CBX A;  1QHA A;  2YNI A;  4H0X B;  3OHR A;  1IKX A;  4JS4 A;  2P9U A;  3LDQ A;  2RHK A;  1NGF A;  4BG8 A;  2YJF A;  3TAN A;  4OLA A;  3VQ8 A;  3VF2 A;  1NU0 A;  2P9I A;  2HBK A;  1TAQ A;  3DXM B;  4DR1 K;  3QIC A;  1E4F T;  4CJT A;  1JLC A;  4FWN A;  2FC0 A;  4A5B A;  1D9F A;  4EFH A;  4RW4 A;  4C1N I;  3HP9 A;  2HBL A;  4JI5 K;  2Q2R A;  1MDU B;  4F2S A;  1L3V A;  1OKJ A;  3GG4 A;  1WBB A;  3ZSQ A;  2OAN A;  4AHR A;  5IWA K;  2VG7 A;  3WXK A;  2V52 B;  3TSQ A;  4IO9 L;  1RT5 A;  3KIO A;  3U9D A;  5C10 A;  4NYN A;  2F8S A;  2ZD1 A;  1HJR A;  1WUA A;  3CJB A;  2DTU A;  3CFO A;  1NJI O;  3ZSR A;  2PBD A;  1BL3 A;  3S3O A;  4Y1D A;  3ZT4 A;  3RMC A;  2GEM A;  4CHZ A;  5FPD A;  3A0I X;  2F96 A;  5CZ2 A;  2B5J A;  3L0Q A;  3VQD A;  5M1O A;  1NK5 A;  1NK9 A;  3BEX A;  4YNQ A;  4B9S A;  3WNE A;  5B8H A;  2KQ2 A;  1XNQ K;  2ASP A;  3ITH A;  1KLN A;  3O9Q A;  4O0I A;  2KLA A;  3AVG A;  5HRR A;  4O5B A;  2VG5 A;  4IOA L;  4DFJ A;  4CK3 A;  2VYP A;  3FFK B;  1LWC A;  5AQJ A;  4KTQ A;  1UAX A;  4PY5 A;  1N34 K;  5FRN A;  3L6Q A;  1VQ5 N;  4OX9 K;  1C1A A;  5JIC A;  3KHY A;  3WEE B;  2QM1 A;  2F7T A;  3ISN C;  3HXM A;  2NUB A;  1EO1 A;  3GOI A;  5J2N A;  4OGC A;  3V9U A;  4B1Z A;  3LPT A;  1WAF A;  3VES A;  1QQN A;  1S1W A;  1BCM A;  3RSE A;  1GLJ O;  4CF1 A;  5JLF A;  5AQH A;  3BF1 A;  3LM9 A;  1U2V B;  3TAQ A;  4PKG A;  4CI6 A;  3CER A;  3O5B A;  3D45 A;  4JK8 A;  3SUQ A;  4CJ7 A;  4EP5 A;  2XY8 A;  4H4M A;  3CQX A;  5HP1 A;  4B1W B;  1NNE A;  1HNZ K;  5AQR A;  4PKI A;  5AQO A;  4K42 A;  4FWQ A;  3J81 O;  3MN9 A;  3O1W A;  4Z4I A;  3VQ4 A;  1ZXO A;  3CXC M;  3DLB A;  4GNI A;  3FR0 A;  4M3X A;  1RBV A;  1N33 K;  2OPQ A;  4DFM A;  1NJX A;  3QBW A;  3LZJ A;  1N6Q A;  4OKE A;  2D0O A;  3QIP A;  2RKI A;  3E01 A;  3ZSZ A;  1XC3 A;  3GE1 A;  3K5O A;  4JI4 K;  4DFK A;  2I7P A;  4KRE A;  3WNG A;  5AQG A;  1DEJ A;  3F9M A;  3NF9 A;  2E20 A;  2QWM A;  4RW9 A;  4AF1 A;  3RRH A;  4ILJ A;  2NRH A;  3LP3 A;  3ENH A;  3SLC A;  2QWQ A;  1RDW X;  3LDO A;  4DQ8 A;  4IZ9 A;  4KB1 A;  4JEP A;  1SV5 A;  2QWN A;  4DQI A;  4AHS A;  4CF9 A;  3A5O C;  3ZT2 A;  3VEN A;  2XY5 A;  1HPM A;  4BRA A;  1EXQ A;  3THX B;  5MLC Q;  2JGU A;  4DTS A;  1Q82 O;  4FYD A;  5J2Q A;  5GAD P;  4CF8 A;  2HMI A;  5HL7 L;  4R79 A;  1RBU A;  2JWK A;  3ZSY A;  2NRZ A;  4CJP A;  2P9K B;  3WXL A;  1G15 A;  4CGD A;  1EX4 A;  3R1X A;  3VN5 A;  2HHH K;  4DQP A;  3NVK A;  3TTF A;  4MO5 A;  3DXK B;  4K8X A;  4DQQ A;  2AA4 A;  3MN5 A;  5AZJ B;  3RSE B;  5I9E B;  1DGK N;  4B3O A;  4LSN A;  2NZT A;  1A5V A;  2GX9 A;  4H0T B;  3C6A A;  1M1K O;  2X6S A;  4YOX A;  3WT0 A;  4B9U A;  1ZBS A;  5DK5 A;  4BC2 A;  1VHX A;  3PV8 A;  3AA5 X;  3L2U A;  5HRO A;  3OY9 A;  3M8P A;  1HYV A;  2PAV A;  3HBT A;  3C0B A;  3I8B A;  2CGL A;  5C12 A;  3QEP A;  1IG9 A;  4EZ6 A;  1NMD A;  3SNN A;  1C1B A;  4X64 K;  3U3G A;  1CZ9 A;  1RTI A;  4KHS A;  1NGB A;  5AQQ A;  4CZK A;  4FLZ A;  1NK0 A;  2DY4 A;  3OBY A;  1JLA A;  2YI1 A;  1WSJ A;  1X3N A;  1YAG A;  4I9L A;  5FRM A;  1QVG M;  2X78 A;  2ZE2 A;  3E1Y A;  2KKZ A;  2QW9 A;  3KLH A;  3K57 A;  1DKG D;  2FLO A;  3DOK A;  3I0S A;  4A61 A;  1IV0 A;  5EX5 A;  3BP8 A;  1QQC A;  1ATS A;  3VER A;  4FJH A;  3NGZ A;  3AVB A;  4JKG B;  1N8R O;  3QLH A;  4AM6 A;  1TGO A;  3ID6 A;  2E1Z A;  4I9Q A;  2A3Z A;  1YVN A;  3D0P A;  4DR7 K;  3E9L A;  4PHT X;  2BUP A;  1YVU A;  1C0G A;  3FFI A;  4U67 L;  2J4R A;  3AVK A;  4BR5 A;  4RG8 A;  4MDB A;  4CHQ A;  4F8R A;  3CPW M;  3UKU A;  5JS1 A;  2GUI A;  1A5W A;  4WF9 L;  4HUF A;  4YDU C;  3D2E B;  1JKH A;  5GIO A;  3O9U A;  4NB4 A;  1WLJ A;  4LH4 A;  4CGJ A;  2OYQ A;  2G8W A;  4XIU A;  1S9G A;  3LWM A;  4DTM A;  1KAZ A;  3M5R A;  3THV A;  4OO1 J;  1HNV A;  4W5O A;  2OPP A;  1NMN A;  1TUY A;  3OW2 M;  2HHS A;  2IDO A;  4CJ5 A;  4HWI A;  2YHY A;  5ELZ A;  1JLQ A;  1DLO A;  3HI0 A;  3IRX A;  2RE2 A;  3VEW A;  4M3W A;  3VTI A;  1RNH A;  4FJK A;  1RDD A;  3QO9 A;  2V7Z A;  1KAY A;  3G6E N;  1SL2 A;  3U6F A;  2O4I A;  1T7P A;  1YUW A;  4FWK A;  1ZBI A;  3OYJ A;  4E1M A;  5LJW A;  1VQ4 N;  4BR0 A;  3KD1 E;  4B9Q A;  1KFS A;  4JD2 A;  4BE0 A;  4FZX C;  5FPM A;  4CFC A;  3NH2 A;  3H6E A;  4DR5 K;  2KZZ A;  1BU6 O;  4FOE A;  3SMS A;  2E6L A;  1IKW A;  4JRQ A;  1YI2 N;  4CJ3 A;  2QWL A;  2PY5 A;  4CZG A;  3N4P A;  3ZCM A;  4BRE A;  4H8K A;  3V6D A;  3HRG A;  2R7Y A;  3EO3 A;  3ZT3 A;  1U2V A;  3OTO K;  5BPN A;  4IXC A;  2P51 A;  3MEC A;  3H3N O;  4CZH A;  4N56 A;  4FJL A;  4HUG A;  3OYA A;  5HLF A;  1NK4 A;  1I94 K;  1CZB A;  4B8C A;  5BR8 K;  3DAW A;  2RPI A;  3ZSW A;  5J1E A;  4PL7 A;  3AGR A;  4DLE A;  3LM2 A;  1XNR K;  4WCE L;  1LV5 A;  4TSX A;  4JYA K;  4BC4 A;  1VQ6 N;  1EQY A;  4MDA A;  2PYJ A;  2P9P B;  5F1X A;  3PSI A;  3VEO A;  3RWU A;  4DR2 K;  1DTQ A;  4KH6 A;  4FWR A;  4FK0 A;  3HJF A;  3FZH A;  2E2O A;  2NRR A;  3FGU A;  2HND A;  4DWI A;  1BA0 A;  4I6M B;  3CMA N;  1RDU A;  1QSS A;  4B3S K;  5FDL A;  3QEI A;  1TKZ A;  3HSC A;  2UXB K;  1RIL A;  3C6T A;  4FJX A;  2UUC K;  1XQS C;  2UU9 K;  5KRS A;  4CJQ A;  1LAV A;  2KFN A;  2JLE A;  3PY8 A;  4KFB A;  3CM6 A;  2BTF A;  5M1Q A;  2IGI A;  2O8C B;  1T3V A;  5AQX A;  1P90 A;  3L2W A;  2Q3S A;  3MWP A;  2A1S A;  3T1Y K;  4JS5 A;  1ASV A;  2FBX A;  4MLE A;  2KHO A;  3SAG A;  2F4V K;  4EIA A;  3P83 D;  3ULE A;  2HB5 A;  3CET A;  4FJG A;  4AQY K;  1HKB A;  1BUP A;  3J8A A;  4JHD A;  3RVC A;  2E4L A;  1HNI A;  2F9T A;  2O8B B;  5BRF A;  4E0D A;  3V9S A;  4H5R A;  4H5T A;  2Q31 A;  1J9A A;  4E89 A;  5A2Q O;  3BGR A;  2GTD A;  4JI2 K;  3RMD A;  3NF6 A;  3SBG A;  3IDH A;  4KTW A;  4RTF D;  1LOT B;  1X1P A;  3P31 A;  1NGC A;  2QWO A;  3O9S A;  4G1Q A;  2Z1H A;  2P9S A;  3VTH A;  4E7L A;  1Z26 A;  1CZA N;  1JLE A;  3WNH A;  3KWG A;  2F8T A;  2X74 A;  4FVU A;  4HTL A;  4KRF A;  2XY7 A;  3TAG A;  3SUN A;  1TYQ B;  4KKO A;  3ZYY X;  3KLE A;  2I5J A;  2VGM A;  4LF5 K;  4QAG A;  4DTX A;  4K43 A;  4X66 K;  4IDK A;  4EP4 A;  3E9P A;  4JD2 B;  1U49 A;  1KVB A;  3TWH A;  5KGW A;  3VQB A;  1NLV A;  1S1X A;  5LY3 A;  1JLG A;  4CJV A;  3MAQ A;  4KO0 A;  1U4B A;  1KVC A;  2FBY A;  3P4I A;  2EWS A;  4GMJ B;  3ZX2 A;  3DLR A;  3HP6 A;  3OS0 A;  5K14 A;  1TL1 A;  2YNF A;  3SQ0 A;  4DTJ A;  3QIN A;  3EKU A;  3I33 A;  1YIJ N;  4CJE A;  4YOT A;  3VEX A;  4WFA L;  4CZE A;  2HVH A;  1X9J A;  5KTQ A;  1X9W A;  1HLU A;  4BE2 A;  1NGJ A;  4Z4H A;  3SAH A;  3VQ7 A;  3O4N A;  5J2P A;  4LF6 K;  4F2R A;  3O08 A;  4E1J A;  1VSM A;  3FZK A;  4O0J A;  5AZI A;  3M8S A;  4JV5 K;  1E4G T;  2HNY A;  3F73 A;  4B9T A;  4ICL A;  1QSY A;  4MLH A;  4JI3 K;  4W5Q A;  3MXJ A;  3ZSV A;  4LY7 A;  3V9Z A;  1RGI A;  1XC9 A;  3VGL A;  5JLH A;  1SKS A;  2Z1G A;  1RBS A;  1RDB A;  4FWM A;  2WBN A;  3W0L A;  5HBM A;  2D5R A;  3CYM A;  3PO4 A;  4ILH A;  3EN9 A;  4QS9 A;  2WON A;  3TAR A;  4C8O A;  1W7A A;  4DV3 K;  4FLX A;  1B9D A;  1IBL K;  4CHO A;  4DF4 A;  1K8K A;  3ZEU B;  1HYS A;  4IG3 A;  3OYF A;  3CJA A;  4LFA K;  3CCL N;  1TYQ A;  4BG9 A;  1C1C A;  1UOC A;  4WQ5 C;  4FZY A;  3R3L A;  3MEG A;  3SZ2 A;  3S3M A;  5E41 A;  3TPQ A;  1HR0 K;  4CEA A;  4OPA A;  2ITG A;  3THY B;  1Q9Y A;  2A6A A;  3QML A;  1T6D A;  3RR8 A;  3HZ6 A;  1C0U A;  4EHT A;  4K25 A;  4FJI A;  5H1S Q;  1BI4 A;  1KVA A;  1QTM A;  1A5X A;  3WUH A;  4CJL A;  2OTJ N;  3F2K A;  2UXD K;  3CCU N;  1HQE A;  2P9P A;  1VQL N;  1CXU A;  1DTT A;  5ADX H;  1YJW N;  5M1K A;  3HK2 A;  1XUP O;  1KFD A;  1P8Z A;  3SUO A;  4CZL A;  3O3H A;  4UQG A;  4ZTF A;  3E9O A;  3IFR A;  3OYK A;  2NRX A;  3G71 N;  4B8A B;  4OPK A;  1NK6 A;  3KLG A;  1F21 A;  3KVG A;  4M45 A;  1J5O A;  5AJ3 K;  3NF7 A;  3VET A;  1Q9X A;  3OYE A;  3VQ5 A;  4B3R K;  1JL2 A;  2NRV A;  1TK5 A;  3NDK A;  3M6G A;  2P9U B;  3AO4 A;  3BUZ B;  3AY9 A;  4AH9 A;  4FLU A;  4O8K A;  4ILG B;  4F9O A;  1IBM K;  3ASM A;  5FRO A;  5AQY A;  3ZET B;  2HHX A;  2YKM A;  3AGK A;  3KJV A;  3U9Z A;  4C1N K;  1GLF O;  2Q97 A;  1TUU A;  1SQK A;  1ESV A;  2D4W A;  4KHN A;  3H08 A;  4O4G A;  4JLH A;  1ZC6 A;  3AVF A;  3O8M A;  2XHB A;  4DFP A;  4DU4 A;  1Z25 A;  4DSE A;  3D2F B;  1L3T A;  4BRQ A;  4CJF A;  4CZI A;  2FF6 A;  1DT9 A;  4N76 A;  3VQ9 A;  1XHZ A;  3I56 N;  2BAN A;  4JKF A;  1R0A A;  4FWL A;  2A41 A;  3TU5 A;  1OVY A;  3DM2 A;  5DMR A;  2ITM A;  1IJJ A;  4A62 A;  4B9M A;  4OLB A;  1LW0 A;  5JVH L;  4JI7 K;  1HRH A;  3EE8 A;  3EZW A;  3SBT A;  4Z0U A;  3V1R A;  4E3S A;  2VQF K;  2GUP A;  1ATN A;  3JXU A;  2ETJ A;  1BCO A;  2G8U A;  3SJH A;  4YOU A;  4RW6 A;  4WQ4 C;  3CJC A;  3N4Q A;  1NGH A;  2V51 B;  1VQN N;  4H5N A;  2UUB K;  2HHW A;  4CK1 A;  4GW6 A;  1B9F A;  1SS6 A;  4DSJ A;  3VF6 A;  5BRH A;  4JI6 K;  1NJY A;  4FJ5 A;  2HHQ A;  3QDK A;  4L8R B;  2B6A A;  5EY4 A;  4CCH A;  1RFQ A;  2Q0R A;  2YNH A;  1HQU A;  3ID8 A;  5T7B A;  4DV6 K;  2D1K A;  1S5J A;  5BN9 A;  4DSF A;  3THW B;  2RF2 A;  4M7Y A;  4BRH A;  4E19 A;  1S6Q A;  1TKT A;  5AQT A;  3U4L A;  3ZSO A;  4CW7 B;  4BVP A;  4IFY A;  4L3Q A;  3MXI A;  3HST B;  1IO2 A;  4BC3 A;  5TKW A;  1RT6 A;  1ZBL A;  3AVA A;  3MN7 A;  3ALY A;  1REV A;  4NCA A;  3NAE A;  4BAC A;  4ID5 A;  5GAH P;  1WN7 A;  1O1W A;  3SV3 A;  3KLI A;  4QOZ B;  3PIO L;  5CR4 A;  2W6K A;  2WUS A;  4E7K A;  3KKR A;  1HMV A;  3M1F A;  2H3G X;  3HVT A;  2FF3 B;  5EU7 A;  2BE2 A;  1U04 A;  4KAZ A;  4CD3 A;  3EKS A;  3J80 O;  2YNG A;  3C6H A;  4N5S A;  3DRS A;  3LDL A;  3F5T A;  1TL3 A;  4I2P A;  3OYH A;  3T3F A;  1VSL A;  1YHQ N;  1EWR A;  3DI6 A;  4DHY A;  4OKJ A;  4W5N A;  3CF5 L;  3AVL A;  1WSI A;  4B1V A;  3HOT A;  3BZC A;  3QB0 A;  4B08 A;  1VQ7 N;  1V4S A;  4BE1 A;  4H0O A;  5AQW A;  4DV7 K;  3CFR A;  1Q81 O;  3NGI A;  3WXI A;  1W97 L;  4NCB A;  2O8E B;  4BVO A;  3DLE A;  2FBV A;  3AO3 A;  3SJJ A;  1S72 N;  4U7B A;  4M3U A;  2W42 A;  4CED A;  1MWM A;  4JKG A;  1NGD A;  1U45 A;  1OVQ A;  4FLW A;  1Q86 O;  3D2F A;  2WOM A;  3SAF A;  3DLK A;  1KQS M;  4IJA A;  1QQO A;  5AQM A;  3PX4 A;  3KTQ A;  3MED A;  4ZTJ A;  2DPN A;  2YHA A;  3UE5 A;  4DTN A;  4BQL A;  3AAQ A;  1BDG A;  1K8K B;  1TVR A;  3ZEU A;  3SYZ A;  3VA0 A;  4J2D A;  3K2P A;  2KZM A;  4Z4F A;  1IH7 A;  3TAF A;  5LMU K;  4E1N A;  1BIZ A;  1VRU A;  4A59 A;  4DQR A;  4PWD A;  4NYF A;  1L3U A;  1NJW A;  4FOI A;  5CY4 A;  1EET A;  5HOO A;  1K9M O;  4JI0 K;  1KC8 O;  3OBW A;  4LFB K;  1I3A A;  3HVR A;  4NO7 A;  1MU2 A;  3L3V A;  5KQD A;  3J7Z O;  4FJ7 A;  4H4O A;  1VQK N;  4FM1 A;  4M7X A;  1YJN N;  5C0Y A;  4DB3 A;  4E7I A;  4DV1 K;  4NLC A;  3K9K A;  3B8A X;  4C8L A;  3SCX A;  4FJ8 A;  4OPH A;  2QXL A;  3AO5 A;  1NJZ A;  3FZF A;  1QS4 A;  4LF9 K;  4JKD A;  1B92 A;  2NRT A;  4XH5 A;  5C15 A;  5GIP A;  1K8A O;  4M3Z A;  1J53 A;  3H46 O;  1WSH A;  1QHT A;  2YX6 A;  5ADX A;  3OYB A;  4FK4 A;  2E88 A;  2YJE A;  4DKW A;  3L2V A;  3CPE A;  2NNW A;  3AAP A;  3MN6 A;  4MQ3 A;  4H5W A;  5GIN A;  2ZGZ A;  3DWL A;  4IEI A;  3T69 A;  1U47 A;  4BDP A;  1WBD A;  1GOB A;  2QWP A;  1WB9 A;  5CYM A;  4DR6 K;  3LAN A;  4PKH A;  4BRO A;  3P1G A;  4BWJ A;  5HRP A;  4EAH D;  1GLL O;  1JCE A;  1VQP N;  4DTU A;  1FW6 A;  2O8E A;  3D2E A;  5CYQ A;  3G0Z A;  3RRG A;  3C7N B;  4WFN L;  1UWB A;  1WNS A;  5HRS A;  4E7H A;  2QKK A;  3A2F A;  3M3Z A;  4CHN A;  1L3S A;  2Y1I A;  3LDS A;  1FK9 A;  1LCU A;  3O4Q A;  3C65 A;  2HNZ A;  3OYG A;  3TI0 A;  3NH1 A;  2IIR A;  1BWF O;  4CIG A;  2OA8 A;  1WSF A;  2Z1I A;  1JXE A;  4M41 A;  3ZT1 A;  3LP1 A;  4LSL A;  3LP0 A;  3O9T A;  3PUF A;  3HT3 A;  1C0F A;  1NKB A;  3GDQ A;  3JAM O;  2D0P A;  4AHU A;  1GLD G;  3CJ1 A;  1Q8I A;  2VQE K;  4BDY A;  2QK9 A;  5KGX A;  4GV3 A;  2P9K A;  2O8C A;  1S6P A;  4JKC A;  3T1A A;  2PFU A;  2UYT A;  4M63 C;  1NOY A;  4LC9 B;  2O8D B;  3A8Y A;  1Q7Y O;  3VGK A;  2WFB A;  2VWJ A;  4BR2 A;  2KFZ A;  1ATR A;  5M1P A;  4OKK A;  3VQE A;  2PZS A;  2W41 A;  3CQ8 A;  3NBP A;  5F0X A;  2X6N A;  4FWS A;  1FKO A;  3HOS A;  4CJ4 A;  1NGG A;  4BRG A;  4CK2 A;  1TK0 A;  3VQP A;  1IBK K;  4CE9 A;  4CER A;  1XMO K;  4W5T A;  5D3G A;  4B9L A;  4GVE A;  4B9V A;  4UY8 O;  4XEI A;  4CES A;  1FXX A;  4HHT A;  4KHU A;  4W5R A;  3CM5 A;  5AQP A;  4HCB A;  2HHT A;  4FL9 A;  1S1U A;  4J8F A;  2LSN A;  4H0Y B;  3K5N A;  1HJO A;  1NGI A;  3HL8 A;  3LPU A;  3WNF A;  3J7A P;  3O80 A;  4BWM A;  4DV4 K;  2KTQ A;  3SV4 A;  1KLM A;  1ASU A;  1VSH A;  4BRP A;  4Z4E A;  3HPO A;  2E2Q A;  5CZ1 A;  2IVP A;  2A1R A;  3O6W A;  2HBJ A;  3L2Q A;  1LW2 A;  2HVI A;  1FJG K;  1OH5 A;  2IOC A;  3Q7B A;  4DV2 K;  4M3T A;  1T6C A;  3SPY A;  3UB5 A;  4RCH A;  4ISF A;  3CCS N;  3P38 A;  3MX2 A;  1J5E K;  4LF8 K;  1LAW A;  3NGY A;  2P5G A;  3OYC A;  5AQV A;  5JS2 A;  3OJU A;  3CIP A;  2BGG A;  2O8F B;  3GL1 A;  4CHY A;  2A40 A;  1C6V A;  5CE3 A;  3LAK A;  4EZ9 A;  2VWB A;  3AVN A;  4BDZ A;  2QI2 A;  2ZGY A;  4M3R A;  4FPB A;  3HYF A;  4WFB L;  2E1Y A;  3J7Y P;  4PL8 A;  4DV0 K;  1WOQ A;  3G25 A;  2YV0 X;  3CC7 N;  4CF2 A;  3MWT A;  3TSU A;  3SQ2 A;  5DM7 L;  3H45 C;  1YTU A;  4KHP K;  2EX3 A;  4V19 S;  1RT2 A;  3NHG A;  1WSG A;  2QWR A;  2B4J A;  3OYM A;  4DTO A;  2OCE A;  5C25 A;  4AHC A;  1Q18 A;  1WSE A;  1D4X A;  1RT7 A;  1XWL A;  3KZB A;  1VQM N;  1KRP A;  3JS6 A;  4IWV A;  2E6M A;  3IG1 A;  3H1Q A;  1HYZ A;  4MFB A;  2P9N B;  1RT1 A;  2P9L A;  4FSV A;  5E26 A;  2O8B A;  3VEZ A;  1SUQ A;  4PUO A;  2NRW A;  3CCV N;  3CHW A;  3L3U A;  1BOT O;  3KD5 E;  4DTR A;  3C94 A;  4CGG A;  4CJK A;  1XHX A;  3VOV A;  2P9I B;  2W40 A;  3SUP A;  4K0K K;  2Z1J A;  4CBW A;  1TAU A;  4DU1 A;  3QER A;  4JI8 K;  1M90 O;  4CFD A;  5AQU A;  1VAZ A;  3AAR A;  2YKN A;  1BO5 O;  4CJR A;  4KB0 A;  3L2R A;  4I2Q A;  4WQ5 A;  3THY A;  3DXM A;  3TTC A;  4BRL A;  1BQN A;  3O3F A;  1S1T A;  1XMQ K;  5AQZ A;  4DR3 K;  2ZM6 K;  4CGF A;  3VQA A;  2VWK A;  3LZI A;  2KW4 A;  4A5A A;  3V9W A;  3KWI A;  2ASO A;  2A42 A;  2UXC K;  1YTA A;  3DLH A;  3KK7 A;  3PX6 A;  4I6M A;  3AVM A;  3K58 A;  4ELT A;  1D9D A;  3WQU A;  1FKP A;  3K5M A;  3RMA A;  3WEE A;  3UIQ A;  2HBM A;  2OPS A;  3CI5 A;  1U6Z A;  2HF3 A;  4OJR A;  1WAJ A;  3FLC O;  4A2B A;  4BRM A;  3QNO A;  3JYT A;  4FW1 A;  3ATU A;  3GBT A;  4B1Y B;  4CJU A;  5EOY A;  1OH6 A;  3CJ7 A;  3R8E A;  4DSK A;  3MDQ A;  4N47 A;  3DXK A;  1EWQ A;  4OPJ A;  1VK0 A;  1QQM A;  5KI6 A;  2QA4 N;  4RWT A;  3K5L A;  4IFE A;  3NMU A;  4B1X B;  4ISE A;  3SPZ A;  2HW3 A;  5CHI A;  3M8R A;  3TAP A;  3PLA A;  1RT3 A;  1BHL A;  1O13 A;  4AHV A;  4IKF A;  2GWJ A;  1TKD A;  3ZX3 A;  3QEW A;  1MWK A;  4JKH A;  1CXQ A;  2OPR A;  4CEO A;  4F4K A;  4YDU A;  3M8Q A;  5GAG P;  4GKK K;  1H1V A;  4FM0 A;  3IS9 A;  4YOV A;  3DOL A;  3DJC A;  2P9N A;  4X65 K;  3CC2 N;  4BRI A;  1Z05 A;  3Q7C A;  4IOC L;  2GBZ A;  4BRF A;  3EL2 A;  2XY6 A;  4CEQ A;  4F3O A;  1T8E A;  2D0C A;  3VPZ A;  4DV5 K;  1N32 K;  4O44 A;  1BI4 B;  2CGK A;  3KK3 A;  4J2A A;  3V81 A;  4LD0 A;  2EHG A;  2F9W A;  3VMF B;  4BRC A;  4FM2 A;  4NCG A;  3CME N;  5F2R A;  3AVI A;  4C8K A;  3V1Q A;  4IJN A;  2G8I A;  2D0B A;  2O8F A;  5AFU H;  1KCF A;  4YY3 K;  2FBT A;  5J2M A;  5M1N A;  4FW2 A;  1NGE A;  2Q1N A;  1VSE A;  1KAX A;  2GV9 A;  2QKB A;  2DFF A;  4KHW A;  3QES A;  4FLY A;  4R5P A;  3DRR A;  3TAE A;  3OJS A;  1HX1 A;  4O55 A;  2G8H A;  2CH5 A;  3VQQ A;  4B1U B;  4XH4 A;  1HNW K;  5AZI B;  3SQ1 A;  4FJJ A;  3CD6 N;  4B3M K;  3CCR N;  1RDC A;  3WQT A;  1RDA A;  3MMV A;  4CFB A;  2E2P A;  2QTD A;  4H0V B;  1NK8 A;  1KD1 O;  1X3M A;  3LP2 A;  3LL3 A;  3SMP A;  1G99 A;  3ZX0 A;  4DUY K;  1I39 A;  1IG8 A;  4DG1 A;  3TAM A;  1RBR A;  4CEF A;  4GY2 B;  3VQ6 A;  4DTP A;  1XI1 A;  4IBN A;  3HO1 A;  2G8K A;  4LF7 K;  5DM6 L;  4H03 B;  3VA3 A;  3B6O A;  2PYL A;  1RTJ A;  2IC3 A;  4CF0 A;  5LMN K;  1VQO N;  3R9P A;  4A57 A;  3SQ4 A;  3LDP A;  5C42 A;  1JL1 A;  1VSJ A;  1J54 A;  4QS7 A;  5KPZ A;  4M3Y A;  2OZS A;  3AA3 A;  2QEX N;  3MX5 A;  3CFP A;  4ELV A;  5AQI A;  1HKC A;  4C8N A;  3DRP A;  3QEV A;  2JWL A;  3QEX A;  3V9X A;  3HPH A;  4HCC A;  1QZ5 A;  1VSK A;  3DMJ A;  4BGB A;  4FZZ A;  4BGA A;  4LF4 K;  4QS8 A;  3ZET A;  3NCI A;  2ZJQ L;  1KXP A;  1Y97 A;  4LH5 A;  2ZF5 O;  1S22 A;  3EE9 A;  2P1J A;  1L5U A;  1HUX A;  1X9S A;  2HF4 A;  4FWP A;  4C8M A;  2ATQ A;  5LL6 Z;  1RT4 A;  4JKE A;  2YHB A;  2E5L K;  1CLQ A;  4OVL A;  1MA9 B;  5E84 A;  5C2D A;  5KRT A;  3CQY A;  1ITG A;  5AQS A;  1IKV A;  4FJN A;  4DU3 A;  2G8F A;  2GEL A;  5EVZ A;  4NXM K;  4IEE A;  3LWL A;  3THX A;  1S9E A;  3CG7 A;  4CJW A;  4BR7 A;  3ULD A;  4FO0 A;  4BRK A;  5KPT A;  4FJ9 A;  1ASW A;  3KLF A;  1W2B M;  2HMP A;  4FWO A;  1VQ9 N;  4KI4 A;  4RW8 A;  1NG9 A;  3L4I A;  4IDH A;  5SWM A;  1YT3 A;  1NWK A;  2P9L B;  4C23 A;  4JRP A;  1JCF A;  3LDN A;  4IO8 A;  3QBX A;  4ELU A;  1S1V A;  1GLC G;  3LAM A;  1RTD A;  1KSP A;  3NF8 A;  2GWK A;  3VEY A;  3BF3 A;  3TAB A;  2Q36 A;  1TKX A;  4CEZ A;  5FLX O;  4CZM A;  4J2B A;  1ZBF A;  1GLA G;  2OZM A;  1K6Y A;  2QXF A;  4PA1 A;  4JI1 K;  3THW A;  1OH8 A;  1HNX K;  2FXU A;  3TTD A;  4Z4G A;  2HHV A;  1NKC A;  1ZBU A;  3NVM A;  4YHH K;  4Y1C A;  1NGA A;  2IVO A;  3OYL A;  3V4I A;  2CGJ A;  4DS5 A;  3IAY A;  4J2E A;  1QE1 A;  2V7Y A;  3AA4 A;  5AQK A;  3T7Z A;  1R59 O;  1GLB G;  1NKE A;  3S3N A;  1BA1 A;  3I0R A;  2DFE A;  1QVF M;  1K73 O;  2XRI A;  4FLT A;  4GV9 A;  4JKB A;  4DQS A;  3UKU B;  1LWF A;  3MK6 A;  2E8A A;  4DLG A;  5BN8 A;  4Q5V A;  3K0S A;  3EY1 A;  3RMB A;  1N5Y A;  3P39 A;  3G4S N;  2BH1 A;  3MEE A;  2D0A A;  2W6L A;  3VEV A;  3CCJ N;  3EZ5 A;  3FZM A;  4BR4 A;  2VGN A;  1GLE G;  1YJ9 N;  4KH5 A;  5FPE A;  4YOW A;  4HTU A;  4JHD B;  2ZQB A;  3QET A;  4DF8 A;  3O1B A;  3MXM A;  4BRN A;  4CJS A;  4F3T A;  1SL0 A;  2IVN A;  3UKR B;  2Q0U A;  3E66 A;  5TKY A;  2E2N A;  4K8Z A;  4BY9 C;  1RBT A;  3AVJ A;  3SK3 A;  3PX0 A;  1SL1 A;  4JN4 A;  2HOE A;  2BDP A;  4CGI A;  4KPY A;  1VSD A;  3W3D A;  3IUC A;  1N36 K;  1Z6R A;  3F9K A;  3L4Q A;  1VQ8 N;  3V1O A;  5HRN A;  2FSK A;  4NLB A;  4CVN E;  1T03 A;  4JKA A;  3TR8 A;  4AHT A;  1YIT N;  5BRE A;  3SI6 A;  4B3T K;  1BGX T;  1C0T A;  1YF5 L;  1SZ2 A;  4RW7 A;  5GAE P;  4CZJ A;  4B9N A;  4M42 A;  4CGH A;  2ZJR L;  4KTZ A;  1BIS A;  1JCG A;  5LJV A;  4ISG A;  3BDP A;  5BPL A;  2P5O A;  2AJQ A;  4GVM A;  1QZ6 A;  3D7E O;  1J6Z A;  4BQZ A;  3IMX A;  4KV8 A;  4G9Z A;  4QCL A;  1QSL A;  3IKM A;  3L8B A;  3AO2 A;  4KH4 A;  4LFC K;  3K59 A;  4JK9 A;  4IG0 A;  4K41 A;  3ENO A;  5EXW A;  2OTL N;  3EYZ A;  2WTU A;  2YHW A;  1TV6 A;  1BQM A;  1VSF A;  3JSM A;  1E3M A;  3HTV A;  1JLB A;  4KI6 A;  4O5F A;  3ZSX A;  3K9J A;  3CJ9 A;  3WXM B;  1NOZ A;  3D6R A;  1BIU A;  5IT9 O;  4IFV A;  4EHU A;  4GKJ K;  3ULE B;  4FXD A;  3NH0 A;  5AQF A;  3C7N A;  3A5N C;  1KTQ A;  3C6U A;  5C2F A;  3QFU A;  4YOY A;  3PO5 A;  3P5J A;  1NM1 A;  5AFU A;  3DLL L;  3NE6 A;  1LWE A;  1EP4 A;  3O3G A;  3PSF A;  3KK2 A;  1UA0 A;  3H3O B;  4A2A A;  2IAJ A;  2Y1J A;  2P9S B;  3S41 A;  4Z94 A;  3OS2 A;  4PQU A;  5M1F A;  3OVN A;  2IS3 A;  3OYD A;  3MCA B;  4FVM A;  4KHY A;  3BZK A;  3H1V X;  4KBO A;  2AP1 A;  4DS4 A;  2YHX A;  3T19 A;  2UUA K;  1S3X A;  4OGE A;  3A5M C;  2A5X A;  3DLG A;  2WC9 A;  2ASM A;  5FPN A;  4CZF A;  4FK2 A;  4YOR A;  3C95 A;  4I7F A;  4HVJ A;  4HUE A;  2FSN A;  4Z4C A;  1Y64 A;  4CFA A;  3AO1 A;  5BR9 A;  3O9R A;  5BRD A;  4BRD A;  4NXN K;  3QFP A;  4O8U A;  1GOA A;  4CEC A;  1T44 A;  3AVH A;  3WXJ A;  4JNE A;  5KPR A;  2FSJ A;  3CC4 N;  4WQ4 A;  1EKE A;  2YCH A;  3S9H A;  3VGM A;  1GOC A;  3R6M A;  4Y0W A;  3FE1 A;  1UA1 A;  1SKW A;  2HST A;  3OS1 A;  3QNN A;  4CHP A;  2VCP A;  3MCP A;  4CBU A;  4IOX A;  1BG3 A;  3A5L C;  4DSL A;  3EEQ A;  4JK7 A;  1SAZ A;  1D5A A;  4X62 K;  1V4T A;  3AVC A;  2NLX A;  4DUZ K;  3ZT0 A; 
#chains in the Genus database with same CATH homology
 3DI6 A;  4OKJ A;  2PY5 A;  3KKS A;  3RR7 A;  4CIE A;  4W5N A;  2GBZ A;  3ZCM A;  4H8K A;  3AVL A;  2XY6 A;  3V6D A;  1WSI A;  4CEQ A;  4F3O A;  1T8E A;  4B08 A;  2R7Y A;  2D0C A;  3ZT3 A;  5C24 A;  4O44 A;  1BI4 B;  5I3U A;  3AA2 A;  3KK3 A;  4J2A A;  2P51 A;  1W0H A;  3MEC A;  3V81 A;  2HHU A;  1SKR A;  4BE1 A;  4LD0 A;  2EHG A;  4FM2 A;  4N56 A;  3OYI A;  1RTH A;  2VG6 A;  4NCG A;  3VQC A;  4HUG A;  4AIL C;  4FJL A;  3OYN A;  3OYA A;  3AVI A;  3CFR A;  5HLF A;  3NGI A;  1NK4 A;  4C8K A;  3V1Q A;  3G10 A;  1CZB A;  4B8C A;  2G8I A;  2D0B A;  3RTV A;  3I8D A;  4NCB A;  2DFH A;  1KCF A;  3DLE A;  4Q0B A;  2FBT A;  5J2M A;  2RPI A;  2FBV A;  3ZSW A;  3AO3 A;  4CEB A;  5J1E A;  4FW2 A;  3SJJ A;  4M3U A;  4DLE A;  2W42 A;  4CED A;  1VSE A;  4ZHR A;  1U45 A;  1D8Y A;  2GV9 A;  4FCY A;  4CEE A;  4TSX A;  1LV5 A;  3QIO A;  1JLF A;  4FLW A;  4CIF A;  2QKB A;  2WOM A;  2PYJ A;  3DLK A;  3U3Y A;  4DMN A;  5I42 A;  2DFF A;  4KHW A;  3QES A;  4FLY A;  3RWU A;  1VSI A;  3DRR A;  4R5P A;  1JXB A;  3B6P A;  3MED A;  3OJS A;  3TAE A;  3PX4 A;  4ZTJ A;  4O55 A;  3KTQ A;  2G8H A;  2YHA A;  1DTQ A;  2O4G A;  4DTN A;  4FJM A;  3VQQ A;  1TVR A;  4J2D A;  4FK0 A;  3SYZ A;  3VA0 A;  3K2P A;  1VRT A;  3HJF A;  2KZM A;  1RCH A;  4Z4F A;  1IH7 A;  1U48 A;  1C0M A;  3TAF A;  1HPZ A;  3SQ1 A;  4FJJ A;  4E1N A;  1BIZ A;  1VRU A;  2HND A;  1T05 A;  1RDC A;  4DWI A;  3HPG A;  4DQR A;  1QSS A;  1RDA A;  4CFB A;  5FDL A;  3QEI A;  1TKZ A;  4NYF A;  1L3U A;  4PWD A;  1NJW A;  3AV9 A;  3HM9 A;  4WE1 A;  5CY4 A;  1EET A;  1RIL A;  3C6T A;  4FJX A;  1NK8 A;  3LAL A;  3NFA A;  3LP2 A;  5KRS A;  4CJQ A;  1LAV A;  1ZBH A;  2KFN A;  2JLE A;  1I3A A;  2XO7 A;  3HVR A;  1MU2 A;  2G8V A;  1I39 A;  4KFB A;  4DG1 A;  3TAM A;  1RBR A;  4CEF A;  3CM6 A;  3VQ6 A;  4DTP A;  1ZYQ A;  3PY8 A;  3L3V A;  4IBN A;  1XI1 A;  3HO1 A;  2IGI A;  3DYA A;  2G8K A;  4FJ7 A;  4H4O A;  4FLV A;  4FM1 A;  3VA3 A;  4N41 A;  3B6O A;  3L2W A;  4E7I A;  1RTJ A;  2Q3S A;  2PYL A;  2A1S A;  2IC3 A;  4CF0 A;  4JS5 A;  1ASV A;  2RN2 A;  5SZT A;  4C8L A;  2FBX A;  3SCX A;  4FJ8 A;  3SQ4 A;  4ID1 A;  1W9H A;  5C42 A;  1JL1 A;  1VSJ A;  1J54 A;  1IKY A;  3AO5 A;  4E7J A;  4M3Y A;  1NJZ A;  1QS4 A;  1NK7 A;  1X9M A;  2OZS A;  3P83 D;  1B92 A;  2HB5 A;  3AA3 A;  4YFU A;  4FJG A;  4KHQ A;  3CFP A;  4ELV A;  4DSI A;  4M3Z A;  2E4L A;  1J53 A;  1HNI A;  3KK1 A;  1TK8 A;  1WSH A;  2YNI A;  1QHT A;  4C8N A;  3OYB A;  4E0D A;  3V9S A;  4FK4 A;  1IKX A;  4JS4 A;  1J9A A;  3DRP A;  4E89 A;  3QEV A;  3QEX A;  3BGR A;  3RMD A;  3V9X A;  3HPH A;  3NF6 A;  3TAN A;  4HCC A;  4KTW A;  3L2V A;  4OLA A;  4MQ3 A;  3VQ8 A;  1VSK A;  3DMJ A;  1X1P A;  4FZZ A;  1TAQ A;  1U47 A;  4BDP A;  1GOB A;  4G1Q A;  4CJT A;  1JLC A;  2Z1H A;  3NCI A;  2OYQ A;  4E7L A;  1Z26 A;  1Y97 A;  2FC0 A;  5CYM A;  1D9F A;  1JLE A;  4LH5 A;  4RW4 A;  3WNH A;  3HP9 A;  3LAN A;  3P1G A;  4BWJ A;  2F8T A;  5HRP A;  2P1J A;  2X74 A;  1L5U A;  1X9S A;  4KRF A;  2XY7 A;  3TAG A;  4F2S A;  1L3V A;  4DTU A;  3SUN A;  4C8M A;  3ZSQ A;  2ATQ A;  4KKO A;  1RT4 A;  4AHR A;  2YHB A;  5CYQ A;  3KLE A;  3G0Z A;  2VG7 A;  3RRG A;  2I5J A;  1RT5 A;  4QAG A;  4DTX A;  3KIO A;  2F8S A;  4NYN A;  1UWB A;  1WNS A;  1CLQ A;  5HRS A;  4IDK A;  4E7H A;  4EP4 A;  2ZD1 A;  1HJR A;  4OVL A;  1U49 A;  2QKK A;  2DTU A;  3CFO A;  3A2F A;  1KVB A;  5KRT A;  3TWH A;  3ZSR A;  1ITG A;  1BL3 A;  5KGW A;  3VQB A;  4CHN A;  1IKV A;  3S3O A;  4FJN A;  1L3S A;  4Y1D A;  2Y1I A;  3ZT4 A;  3LDS A;  4DU3 A;  1S1X A;  2G8F A;  3RMC A;  1JLG A;  1FK9 A;  4CHZ A;  4CJV A;  3MAQ A;  2F96 A;  3O4Q A;  2HNZ A;  5CZ2 A;  2B5J A;  3VQD A;  1S9E A;  3LWL A;  3OYG A;  1NK5 A;  1NK9 A;  3CG7 A;  4KO0 A;  4YNQ A;  3TI0 A;  3NH1 A;  4B9S A;  3WNE A;  4CIG A;  1U4B A;  1KVC A;  2KQ2 A;  2FBY A;  2OA8 A;  4CJW A;  1WSF A;  2Z1I A;  3ITH A;  1KLN A;  4O0I A;  1JXE A;  3ULD A;  4M41 A;  4GMJ B;  3ZT1 A;  3LP1 A;  3DLR A;  4LSL A;  3AVG A;  3LP0 A;  3PUF A;  5HRR A;  4O5B A;  4FJ9 A;  3HP6 A;  2VG5 A;  3OS0 A;  3HT3 A;  1ASW A;  3KLF A;  4DFJ A;  4CK3 A;  5K14 A;  1NKB A;  1LWC A;  1TL1 A;  2YNF A;  4JRQ A;  4KTQ A;  1UAX A;  4PY5 A;  4AHU A;  4RW8 A;  4KI4 A;  1Q8I A;  5FRN A;  4BDY A;  3SQ0 A;  2QK9 A;  5KGX A;  1C1A A;  5SWM A;  1YT3 A;  4DTJ A;  3ISN C;  3QIN A;  3HXM A;  1S6P A;  2NUB A;  3T1A A;  4CJE A;  5J2N A;  1NOY A;  4JRP A;  4OGC A;  3V9U A;  2HVH A;  3LPT A;  3T3F A;  1WAF A;  4ELU A;  1S1V A;  5KTQ A;  1X9W A;  3LAM A;  4BE2 A;  2VWJ A;  1S1W A;  4Z4H A;  3NF8 A;  1RTD A;  1KSP A;  1BCM A;  2KFZ A;  3VQ7 A;  3O4N A;  5J2P A;  3TAB A;  4F2R A;  1TKX A;  4CEZ A;  4OKK A;  3VQE A;  4CF1 A;  2PZS A;  1VSM A;  3CQ8 A;  3NBP A;  4O0J A;  3M8S A;  4J2B A;  1ZBF A;  2X6N A;  3TAQ A;  2HNY A;  3F73 A;  1FKO A;  4B9T A;  2OZM A;  4ICL A;  1K6Y A;  2QXF A;  4PA1 A;  4CJ4 A;  1QSY A;  4W5Q A;  4CK2 A;  3D45 A;  3MXJ A;  3SUQ A;  3ZSV A;  4LY7 A;  1TK0 A;  3VQP A;  4Z4G A;  4CE9 A;  2HHV A;  4CER A;  3V9Z A;  1NKC A;  1ZBU A;  4EP5 A;  4W5T A;  2XY8 A;  5D3G A;  4H4M A;  4Y1C A;  5HP1 A;  4B9L A;  1XC9 A;  3OYL A;  4B9V A;  1SKS A;  3V4I A;  2Z1G A;  4CES A;  4DS5 A;  1RBS A;  1RDB A;  4Z4I A;  3IAY A;  4J2E A;  1FXX A;  1QE1 A;  3AA4 A;  3VQ4 A;  4HHT A;  1NKE A;  4KHU A;  3S3N A;  3DLB A;  4W5R A;  5HBM A;  2D5R A;  3CM5 A;  3CYM A;  3PO4 A;  3I0R A;  4M3X A;  2DFE A;  1RBV A;  4HCB A;  2HHT A;  1S1U A;  2XRI A;  4FLT A;  2OPQ A;  2WON A;  2LSN A;  4DFM A;  3TAR A;  1NJX A;  4C8O A;  3LZJ A;  3K5N A;  4DQS A;  1N6Q A;  4DLG A;  1LWF A;  4FLX A;  4OKE A;  4Q5V A;  3HL8 A;  1B9D A;  3LPU A;  3QIP A;  3WNF A;  3EY1 A;  3RMB A;  1N5Y A;  2RKI A;  3E01 A;  4CHO A;  3ZSZ A;  4BWM A;  4DF4 A;  2KTQ A;  3MEE A;  1HYS A;  2D0A A;  4IG3 A;  3SV4 A;  3OYF A;  1KLM A;  1ASU A;  1VSH A;  4Z4E A;  3EZ5 A;  3K5O A;  3HPO A;  4DFK A;  1C1C A;  1UOC A;  5CZ1 A;  4FZY A;  4KRE A;  3WNG A;  3MEG A;  2A1R A;  3NF9 A;  4HTU A;  4RW9 A;  3L2Q A;  3SZ2 A;  1LW2 A;  5E41 A;  3RRH A;  2ZQB A;  3S3M A;  2HVI A;  3QET A;  3LP3 A;  4DF8 A;  3MXM A;  2IOC A;  4CJS A;  4F3T A;  4CEA A;  4M3T A;  2ITG A;  1SL0 A;  3SPY A;  4KB1 A;  1SV5 A;  1Q9Y A;  4DQI A;  4AHS A;  4CF9 A;  3RR8 A;  1C0U A;  4FJI A;  1BI4 A;  1KVA A;  3ZT2 A;  2XY5 A;  1QTM A;  1A5X A;  1EXQ A;  1LAW A;  2JGU A;  4CJL A;  4DTS A;  4FYD A;  1HQE A;  3NGY A;  5J2Q A;  4K8Z A;  2P5G A;  3OYC A;  1CXU A;  1RBT A;  5JS2 A;  4CF8 A;  3AVJ A;  3OJU A;  1DTT A;  2HMI A;  2BGG A;  3PX0 A;  4CHY A;  1SL1 A;  3HK2 A;  1KFD A;  2BDP A;  4CGI A;  1RBU A;  3O3H A;  3SUO A;  4KPY A;  4UQG A;  1C6V A;  1VSD A;  3LAK A;  3ZSY A;  4EZ9 A;  4ZTF A;  3AVN A;  3F9K A;  4BDZ A;  4M3R A;  3OYK A;  4CJP A;  4B8A B;  4OPK A;  3V1O A;  5HRN A;  1NK6 A;  3KLG A;  1F21 A;  1T03 A;  3TR8 A;  4AHT A;  3HYF A;  4M45 A;  1J5O A;  3NF7 A;  3SI6 A;  1G15 A;  4CGD A;  1Q9X A;  3OYE A;  1EX4 A;  3VQ5 A;  1JL2 A;  3VN5 A;  1TK5 A;  1BGX T;  1C0T A;  4RW7 A;  3NDK A;  4B9N A;  4DQP A;  4M42 A;  4AH9 A;  3AO4 A;  4CGH A;  2YV0 X;  4KTZ A;  1BIS A;  4CF2 A;  4K8X A;  4DQQ A;  2P5O A;  3BDP A;  3SQ2 A;  4FLU A;  2AJQ A;  4GVM A;  3ASM A;  5FRO A;  1YTU A;  2HHX A;  2EX3 A;  4B3O A;  1RT2 A;  2YKM A;  4LSN A;  3KJV A;  3NHG A;  4KV8 A;  4QCL A;  1A5V A;  1QSL A;  3L8B A;  2X6S A;  1WSG A;  3AO2 A;  2B4J A;  4B9U A;  3OYM A;  3K59 A;  4DTO A;  5DK5 A;  4IG0 A;  4KHN A;  3H08 A;  3PV8 A;  3AA5 X;  4O4G A;  4JLH A;  3L2U A;  3AVF A;  3M8P A;  5C25 A;  3OY9 A;  5HRO A;  3EYZ A;  1HYV A;  2XHB A;  4DFP A;  4DU4 A;  1TV6 A;  1BQM A;  1VSF A;  4AHC A;  1Z25 A;  1WSE A;  1XWL A;  1RT7 A;  4DSE A;  3JSM A;  3QEP A;  1IG9 A;  1L3T A;  1KRP A;  4EZ6 A;  3SNN A;  4CJF A;  2E6M A;  3IG1 A;  1C1B A;  1HYZ A;  4MFB A;  4N76 A;  3U3G A;  1CZ9 A;  1RTI A;  1JLB A;  1RT1 A;  3VQ9 A;  3ZSX A;  4FLZ A;  1XHZ A;  1NK0 A;  4KI6 A;  2DY4 A;  1SUQ A;  2BAN A;  4PUO A;  1NOZ A;  1JLA A;  3L3U A;  3KD5 E;  1BIU A;  4IFV A;  4DTR A;  3C94 A;  1WSJ A;  4CGG A;  4I9L A;  5FRM A;  1R0A A;  2X78 A;  4FXD A;  4CJK A;  3NH0 A;  1XHX A;  2ZE2 A;  4KHS A;  3DM2 A;  5DMR A;  3SUP A;  1KTQ A;  3C6U A;  4B9M A;  2Z1J A;  4OLB A;  3KLH A;  1LW0 A;  3K57 A;  4DU1 A;  3QER A;  3P5J A;  3PO5 A;  1TAU A;  1HRH A;  3DOK A;  3I0S A;  4CFD A;  3NE6 A;  1LWE A;  4Z0U A;  3V1R A;  1EP4 A;  3O3G A;  4E3S A;  2YKN A;  1QQC A;  3KK2 A;  4CJR A;  4KB0 A;  3L2R A;  1UA0 A;  4FJH A;  3NGZ A;  2ETJ A;  3AVB A;  4I2Q A;  1BCO A;  3QLH A;  2G8U A;  1TGO A;  4I9Q A;  4RW6 A;  1BQN A;  2IAJ A;  2Y1J A;  3O3F A;  1S1T A;  3D0P A;  3OS2 A;  4PQU A;  1YVU A;  3OVN A;  2IS3 A;  3FFI A;  3AVK A;  4CGF A;  3OYD A;  4KHY A;  4FVM A;  2HHW A;  2VWK A;  4GW6 A;  4RG8 A;  3VQA A;  1B9F A;  4CK1 A;  3LZI A;  2KW4 A;  4CHQ A;  4DSJ A;  4DS4 A;  4F8R A;  3T19 A;  3V9W A;  5JS1 A;  2GUI A;  1NJY A;  1A5W A;  4OGE A;  4FJ5 A;  2HHQ A;  4HUF A;  4L8R B;  3DLG A;  2B6A A;  4CCH A;  1YTA A;  1JKH A;  3DLH A;  4FK2 A;  1WLJ A;  4LH4 A;  2YNH A;  4CGJ A;  3PX6 A;  1HQU A;  2G8W A;  3AVM A;  4XIU A;  3K58 A;  4ELT A;  1D9D A;  1S9G A;  3LWM A;  1FKP A;  5T7B A;  3K5M A;  4DTM A;  3RMA A;  3UIQ A;  3THV A;  2OPS A;  3C95 A;  4I7F A;  1HNV A;  4OJR A;  1S5J A;  4W5O A;  1WAJ A;  2OPP A;  4DSF A;  4HVJ A;  4HUE A;  3QNO A;  2HHS A;  4Z4C A;  3JYT A;  4FW1 A;  2RF2 A;  2IDO A;  4E19 A;  4CFA A;  4CJ5 A;  1S6Q A;  1TKT A;  3AO1 A;  3ZSO A;  1JLQ A;  4CJU A;  1DLO A;  3IRX A;  4IFY A;  3MXI A;  4DSK A;  3HST B;  1IO2 A;  1GOA A;  4N47 A;  4CEC A;  3AVH A;  4OPJ A;  1RT6 A;  4M3W A;  1VK0 A;  1ZBL A;  1RNH A;  5KI6 A;  3AVA A;  4FJK A;  1RDD A;  3ALY A;  3QO9 A;  3K5L A;  1REV A;  4NCA A;  3NAE A;  4BAC A;  3SPZ A;  2HW3 A;  4ID5 A;  1EKE A;  1SL2 A;  3M8R A;  1WN7 A;  1O1W A;  3U6F A;  3TAP A;  2O4I A;  3SV3 A;  1RT3 A;  3S9H A;  1BHL A;  4IKF A;  4AHV A;  3KLI A;  1GOC A;  1T7P A;  4QOZ B;  4E7K A;  1TKD A;  3KKR A;  1ZBI A;  1HMV A;  3OYJ A;  4E1M A;  3HVT A;  3QEW A;  5EU7 A;  1UA1 A;  2BE2 A;  1SKW A;  1CXQ A;  1U04 A;  3KD1 E;  4KAZ A;  3OS1 A;  3QNN A;  2OPR A;  4CHP A;  2YNG A;  4CEO A;  1KFS A;  4F4K A;  4BE0 A;  4FZX C;  4CFC A;  4DSL A;  3M8Q A;  3NH2 A;  4N5S A;  3DRS A;  1D5A A;  2KZZ A;  4FM0 A;  2E6L A;  3IS9 A;  3DOL A;  3AVC A;  1TL3 A;  1IKW A;  4I2P A;  3OYH A;  3ZT0 A;  1VSL A;  4CJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...