4HUEA

Structure of 5-chlorouracil modified g:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease H
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hueA00
3C94A 1TKZA 4B8CA 2B5JA 4Y1DA 3NGYA 4DS4A 3RMDA 1RBRA 3G0ZA 1IKYA 3EYZA 3RMCA 3LWMA 4FM1A 3VQ8A 1C6VA 2YHBA 1SKWA 1BCOA 3BDPA 3AVNA 1LAVA 1TV6A 4FLUA 4LD0A 4AH9A 4DQQA 4B9TA 3K5LA 3QO9A 2E4LA 2OYQA 1VSJA 4DTOA 4C8LA 1BQMA 3DLRA 1QS4A 2JLEA 2GBZA 4LY7A 3AA2A 4CE9A 1L3VA 2HMIA 2Y1JA 3DRRA 4DTRA 3RR8A 3OS1A 4CK1A 4FJLA 4CEDA 1I3AA 4E7LA 3KLEA 1S9GA 3HSTB 4IBNA 5KTQA 3HXMA 3SQ4A 3CYMA 1RILA 4CJPA 3RMBA 3KD1E 3LAMA 3DRPA 5SWMA 4FJ9A 3CFRA 2G8KA 2F8SA 1VRUA 1VSMA 3PX4A 3SUQA 4CEAA 3NHGA 3H08A 3K5NA 1JLCA 5E41A 2FBVA 1C1AA 4CJVA 3K58A 2PY5A 4O5BA 2OPSA 1BI4B 3TR8A 2DFHA 3VQEA 2BE2A 4KTWA 3L8BA 3MXIA 2BDPA 3JSMA 3CG7A 4NYFA 1ASUA 4HTUA 4FVMA 4DQSA 1L3TA 1KVAA 1WLJA 2G8VA 3RR7A 1JLBA 4CEEA 4CJQA 1U49A 1BIUA 1C0TA 1VSFA 2ITGA 3C6UA 3AO1A 3QINA 4JLHA 1IH7A 4MQ3A 4FM2A 4CCHA 3OJSA 3QESA 4AHSA 4CEZA 1Q9YA 4FJXA 1NK8A 3O3FA 1SL2A 3KD5E 3DI6A 3LP1A 4FXDA 1HNIA 1LAWA 4K8XA 4Q0BA 4PA1A 4CECA 5K14A 3NF8A 1RDAA 4I9LA 1X9WA 1T03A 4ELUA 4Y1CA 1Q8IA 4DTJA 3LDSA 3PX6A 4CJKA 4DSLA 3AA3A 4CF8A 3LP2A 4DSIA 1C0UA 5D3GA 4CF2A 4AHCA 3TAPA 2WOMA 3C6TA 4E1MA 1ITGA 3AVLA 3KKSA 3NH2A 3ZT2A 3ZSYA 2KW4A 4FJNA 4B08A 1ZYQA 2KZMA 4FLVA 3SQ0A 1S9EA 5CY4A 1RT2A 4H4MA 5DK5A 2ATQA 3ZT3A 4R5PA 3U3YA 1N5YA 1L3UA 4B9LA 2Z1GA 3PO4A 4B3OA 1B92A 3V4IA 2IC3A 3TAEA 1S1WA 1EX4A 4NCAA 2HHWA 4QOZB 4DQPA 3ISNC 4DF4A 4DMNA 3P1GA 4OKEA 2ETJA 4KFBA 4Z4FA 4FJIA 3TWHA 3HVRA 2LSNA 4E0DA 3NH0A 3SUPA 1RBVA 3AVFA 5FDLA 4BWJA 4JS4A 3T3FA 3HYFA 3VQ4A 2X6SA 3RRHA 2ZQBA 4JS5A 4GVMA 3SZ2A 4DWIA 1RBSA 4FJGA 4KHSA 1U47A 1YVUA 3O4QA 3OY9A 4C8MA 4BDZA 3OS0A 3SV3A 3L2UA 1ASWA 4OKKA 4ZTFA 4CGHA 1TL1A 4LSNA 1D9FA 3VQ5A 3AVCA 5CZ1A 4OJRA 3WNEA 3HJFA 3LALA 1HMVA 2G8WA 1KVBA 4CFDA 3THVA 4B9UA 1QSSA 4KHUA 2FBTA 5JS1A 4DTSA 1U4BA 2EX3A 1BISA 3NF7A 5J2QA 1A5XA 4CF0A 3AVJA 3ZSZA 4CK2A 1TL3A 4DQRA 3SNNA 3M8QA 2R7YA 1B9DA 3L2QA 4PUOA 1I39A 4OGCA 2DFEA 4E19A 1WAFA 4CJ5A 3LWLA 1LWFA 4M45A 1B9FA 2B6AA 3HO1A 3L3VA 1JKHA 4EZ6A 4TSXA 4CFAA 4OGEA 1FXXA 3VQQA 5EU7A 4CGFA 3QNNA 3S3OA 1U48A 2HW3A 2E6LA 4KREA 2HHQA 1UA0A 3UIQA 1HYVA 1S1XA 1U04A 3AO4A 1XHZA 1XHXA 3K59A 2X78A 3SJJA 2P1JA 1CZ9A 1BGXT 4KB1A 2ZE2A 1O1WA 1Z25A 3TARA 3VQ9A 3JYTA 4IG0A 4DTXA 1CXUA 3DMJA 4GW6A 1WN7A 3AVKA 4M3WA 5HRPA 4Z4EA 4OPJA 4LSLA 3CFOA 4K8ZA 2VWJA 1WSIA 3L2WA 3V9XA 1HPZA 3ASMA 4BWMA 3TAMA 1QHTA 3OYIA 4DFJA 1JLFA 1TAQA 3DLKA 1S5JA 4J2AA 3RWUA 4FM0A 2YNIA 4DSEA 3SUOA 3ZT1A 2HNZA 2YNFA 2GUIA 2OZMA 4M3UA 3DLEA 4G1QA 1LW0A 2JGUA 3OYKA 4Z4CA 2XY8A 3SUNA 3KLHA 4FW2A 1XI1A 4NCBA 3ZCMA 1QTMA 4CHYA 4HUGA 3AVMA 1X9MA 1Q9XA 4DFMA 3I8DA 4DF8A 1NK0A 4M3TA 4H8KA 4Q5VA 2KZZA 1D9DA 3O4NA 1T8EA 4DSKA 4NYNA 2OPPA 3V9ZA 2OA8A 2DTUA 1NJXA 4KAZA 2VG6A 3T1AA 4Z4GA 4IDKA 1RDDA 1SUQA 3QERA 1FK9A 4CHPA 1RDBA 2HB5A 1NJYA 3OYLA 5FRNA 1X9SA 5C42A 3OYGA 3OYJA 1RTIA 4W5QA 4N41A 4M3XA 1JLQA 3V1OA 2G8UA 1G15A 1VSEA 3AVHA 4BDYA 4ELTA 2Y1IA 3M8SA 1HQEA 1KLNA 4B9VA 1J5OA 4JRQA 4DTUA 4OPKA 3MAQA 1DTQA 1JLGA 4E7JA 3IRXA 3OYMA 3SPZA 3RRGA 4KI6A 4N47A 4FCYA 2F96A 4PY5A 1BIZA 4FK4A 3M8PA 3OYCA 3V9WA 1W9HA 2NUBA 1Z26A 4AHVA 1QSLA 3EZ5A 3QEXA 1IKVA 4M3ZA 4CF1A 1KFDA 3K57A 3QLHA 3DOLA 2EHGA 4ID5A 2O4IA 2RKIA 3NBPA 3WNHA 3PO5A 1RTHA 5JS2A 3VA3A 3PY8A 1VK0A 1BHLA 4KB0A 3CFPA 3SCXA 3S3NA 2Z1JA 3MEDA 3ZSRA 4B9SA 4YNQA 5HLFA 4KRFA 1TKTA 1TK5A 1TK0A 1WSEA 3PUFA 3ALYA 1XWLA 3SQ1A 4PWDA 2IOCA 4M42A 3B6OA 1VSLA 1WAJA 3AVBA 4PQUA 3ITHA 2AJQA 4CJ3A 1IO2A 1JL1A 1DTTA 3P5JA 1Y97A 1RBTA 3T19A 3VQDA 4CGJA 4AILC 1UA1A 3K5MA 4GMJB 1YTUA 2HHSA 4HVJA 1FKOA 1NK9A 2ZD1A 1JXBA 4E7HA 3LP3A 1TAUA 3HPGA 4J2BA 1HYSA 1JLAA 3HVTA 3P83D 3NDKA 3V9SA 1UOCA 2KTQA 5C25A 5FROA 2PYLA 1J53A 1W0HA 2XO7A 1T7PA 2W42A 1HJRA 2X74A 3HT3A 3NF9A 5KGXA 4C8KA 4I9QA 4QCLA 1CLQA 3KKRA 1C0MA 2OZSA 2HHUA 2P51A 4DU4A 4FZYA 3AV9A 1D5AA 1T05A 4N5SA 4RW8A 4CK3A 5HRSA 3LZIA 3AO2A 3QEIA 3IAYA 3S3MA 1BCMA 4EP5A 3HPHA 1HRHA 4IG3A 3OYFA 1KFSA 4FLYA 2Q3SA 1RNHA 4CHQA 1KCFA 4CGDA 2IDOA 2D0CA 3FFIA 2XHBA 3ZT4A 3V1RA 1SL0A 3HK2A 4I7FA 5I42A 1J54A 2OPQA 2HHTA 1S1UA 3LPTA 2HHXA 1RT5A 1RCHA 2YKMA 2KFNA 3MEEA 1SV5A 3AVIA 1UAXA 3K5OA 5KRSA 4OLAA 1RT3A 4ZHRA 3HP9A 2WONA 3NH1A 3SPYA 2QXFA 1VSKA 1KTQA 4FLZA 3VA0A 4DSFA 4KHWA 3B6PA 4CFBA 4UQGA 3KK3A 4BACA 3PX0A 2IS3A 5KGWA 4AHUA 4DTNA 3ULDA 1NK7A 1WNSA 4I2QA 3MECA 3ZT0A 4ID1A 4KO0A 4W5TA 3OYNA 4CEOA 3OJUA 1F21A 1ZBHA 3HL8A 2HHVA 3F9KA 2P5GA 3OVNA 4W5NA 5CYMA 3O3HA 2PZSA 3MEGA 1ZBUA 2RF2A 1NKCA 3V6DA 1NKBA 4FJJA 4FJMA 3L3UA 1VSHA 3ZSOA 4YFUA 1HNVA 3QNOA 4M3RA 3E01A 1NJZA 3DYAA 4CJUA 1EP4A 2RPIA 4ICLA 3U3GA 2O4GA 3OS2A 3VQ7A 1R0AA 2A1RA 2XY6A 2G8IA 3AVAA 3SYZA 3NE6A 4M3YA 1A5WA 2P5OA 3K2PA 1C1BA 3WNFA 4FJKA 4AHTA 3ZSQA 5FRMA 4CGGA 2XY7A 5DMRA 3O3GA 3OYBA 2HNDA 4BE0A 2XY5A 3QEWA 3WNGA 2YKNA 5J2PA 2IAJA 3KTQA 2GV9A 3NFAA 1IKWA 4CEFA 3OYAA 1RT6A 4F2SA 3EY1A 4C8OA 3VQ6A 1U45A 5KRTA 5KI6A 4FLXA 1LV5A 4RW6A 1EXQA 1LW2A 4I2PA 4CIEA 4F3OA 1TK8A 4KV8A 2I5JA 2PYJA 3I0RA 3SV4A 4FJHA 4DS5A 3LAKA 4BE2A 3S9HA 3U6FA 4E89A 4KTQA 2X6NA 1KSPA 1WSGA 2BGGA 2VG5A 4BDPA 1S6PA 3CQ8A 4HUFA 5HP1A 4DLGA 1NOYA 3CM5A 4JRPA 3MXMA 4HCBA 4CJTA 2Z1HA 5HBMA 4CJLA 2QKKA 1HYZA 4O4GA 3VQAA 3QIOA 1NJWA 4B8AB 4CHNA 4W5OA 1RT4A 4KHQA 2E6MA 1QQCA 4LH5A 3HP6A 5HROA 4CJRA 4F2RA 4E3SA 4DTPA 1VSIA 1WSFA 4B9NA 3ZSXA 1MU2A 2YHAA 4CIFA 4FZZA 5SZTA 4CF9A 4DFKA 3RMAA 4H4OA 4DFPA 2Z1IA 3M8RA 3DLHA 2B4JA 3AVGA 3VQPA 4RW7A 4CHOA 1TGOA 1YT3A 3LZJA 4FK0A 3RTVA 3DM2A 1XC9A 4FW1A 3QEVA 4NCGA 4J2DA 3NAEA 2KFZA 2F8TA 4MFBA 3HPOA 5CZ2A 4O55A 1QSYA 2HVIA 1ZBLA 4CJFA 4BE1A 1CXQA 4FLTA 3IG1A 1IKXA 3VQCA 1S6QA 2YNGA 4DSJA 1A5VA 1K6YA 1S1TA 4F8RA 1ZBIA 1TVRA 3NGIA 1SKRA 1KRPA 4ZTJA 2XRIA 4OVLA 3IS9A 4CHZA 4RW4A 1WSJA 2D0AA 1LWEA 4CJWA 1VSDA 4F3TA 3KK1A 3CM6A 4QAGA 4Z4HA 3QIPA 5J1EA 4CEQA 1RBUA 2YV0X 1DLOA 2KQ2A 4FLWA 4KHNA 3D45A 2YNHA 1RT1A 3AO3A 3LP0A 3OYEA 1J9AA 5CYQA 3KLFA 3KJVA 1CZBA 1VRTA 1SKSA 1X1PA 4FK2A 1L3SA 3KLGA 4M41A 4CJEA 4O44A 2HNYA 3TABA 3L2VA 4KI4A 2DFFA 4FZXC 4RG8A 4C8NA 4W5RA 4DU1A 1UWBA 4XIUA 1NKEA 2QK9A 1YTAA 4E1NA 4DTMA 1JL2A 2G8FA 5T7BA 5J2MA 2FBXA 4CEBA 3PV8A 1LWCA 1C1CA 3LANA 5HRRA 4CERA 1EKEA 4HCCA 1FKPA 2FC0A 3D0PA 3V9UA 3L2RA 4O0JA 4KPYA 1QE1A 1S1VA 3DLGA 2D5RA 4Z4IA 1ZBFA 1GOCA 3TAFA 1TKDA 3V1QA 3DOKA 4DG1A 4Z0UA 1D8YA 3VN5A 3DRSA 3ZSWA 1L5UA 4ELVA 4FJ7A 3I0SA 4EZ9A 4L8RB 3NF6A 3MXJA 3LPUA 4KKOA 4FJ5A 1ASVA 4CGIA 4HUEA 3BGRA 4LH4A 3TANA 4J2EA 3TAGA 3ZSVA 4N76A 3KIOA 3OYDA 4DLEA 4DU3A 3QEPA 1RTJA 4IFVA 3AA4A 4E7IA 2VWKA 3KK2A 2HVHA 1RDCA 3A2FA 4IFYA 3V81A 4IKFA 4OLBA 1JXEA 3G10A 1TKXA 4CFCA 1EETA 3F73A 1NK4A 2QKBA 4CESA 3AO5A 3VQBA 1NOZA 1NK5A 3AA5X 3SI6A 1GOBA 2G8HA 4KHYA 3NGZA 2BANA 3C95A 1RT7A 2IGIA 3DLBA 4O0IA 1KVCA 5I3UA 4FYDA 4CIGA 4N56A 5J2NA 4FJ8A 2A1SA 2OPRA 1GOAA 1HQUA 4HHTA 1BQNA 4CJ4A 4KTZA 5C24A 1N6QA 1JLEA 1IG9A 4AHRA 1SL1A 1RTDA 4B9MA 4RW9A 1BI4A 2RN2A 4WE1A 5HRNA 2DY4A 3SQ2A 4E7KA 3QETA 1REVA 4DQIA 1NK6A 3KLIA 1WSHA 3OYHA 3TAQA 3NCIA 1BL3A 4OKJA 3HM9A 3TI0A 4F4KA 2FBYA 4EP4A 2D0BA 4CJSA 1KLMA 2VG7A
chains in the Genus database with same CATH superfamily
4FVUA 3C94A 4B8CA 2B5JA 2Q0RA 1V4TA 1DT9A 4BVOA 1RBRA 4JYAK 4HWIA 4FM1A 3VQ8A 1BCOA 3C6AA 3CC2N 1LAVA 4LD0A 4DQQA 3QO9A 4J8FA 2E4LA 3SLCA 3P4IA 1VSJA 4DTOA 4C8LA 3U9ZA 4B1WB 2GBZA 3MN6A 4JI7K 5AJ3K 4FSVA 2HHHK 4CEDA 3MK6A 1I94K 4U67L 5KTQA 3HXMA 3RMBA 3CYMA 2W40A 2F8SA 3LAMA 3DRPA 2G8KA 2YHWA 4CEAA 2RE2A 1JLCA 5M1OA 4B1XB 3UKUB 4EAHD 3RSEB 3MXIA 2E88A 4YOXA 5GAGP 1WLJA 2KLAA 4CJQA 5JVHL 1C0TA 3C6UA 3OJSA 1Q9YA 4AHSA 4CEZA 3O3FA 2Q97A 3HTVA 4RWTA 4FXDA 4K8XA 4CECA 5KPZA 4Y1CA 2O8BB 4DTJA 4GNIA 4WFNL 3TAPA 1KQSM 3NH2A 1E4GT 5F0XA 2KW4A 1X3MA 5AQRA 2KZMA 3D2FB 5CY4A 1RT2A 4H4MA 5DK5A 3U3YA 3VETA 2YHYA 1B92A 3BP8A 2IC3A 2QWMA 4NCAA 3SAHA 2E5LK 3VESA 2ETJA 5TKYA 4JD2B 3TWHA 3DJCA 4KH6A 3HVRA 4H5NA 3NH0A 3SUPA 3EO3A 3T3FA 4B3TK 4JS5A 4WQ4C 1U47A 3MCAB 3U4LA 3THWB 3VF4A 3A8YA 3VQ5A 3L0QA 1KAXA 3HJFA 3LALA 3CCRN 2G8WA 1KVBA 5LJWA 3THVA 5KPRA 2FBTA 4BRFA 3VENA 3UB5A 1BISA 5J2QA 3SNNA 2F4VK 3F5TA 3ZSZA 3M8QA 3ENBA 4MLEA 4OGCA 1LWFA 2B6AA 3VTHA 3FFKB 1FXXA 3VQQA 5EU7A 5EVZA 1UA0A 2O8DA 1HYVA 2BH1A 1XHXA 2X78A 3WUHA 3SJJA 1LCUA 4KB1A 2ZE2A 3H1QA 3TARA 2E2PA 3DMJA 4GW6A 5HRPA 1JCEA 1HUXA 4DV5K 5M1QA 4J2AA 1TAQA 3DLKA 3RWUA 5FPDA 1YIJN 2P9UB 3KWGA 1KAYA 4G1QA 3P31A 4Z4CA 2XY8A 4ISGA 3KLHA 2NZTA 4FW2A 1XI1A 4JI0K 1QTMA 4CHYA 3W0LA 1NGDA 1DGKN 3AVMA 1Q9XA 4LFCK 4DFMA 1NK0A 2KZZA 1D9DA 2VGMA 5HOOA 4IO9L 4IDKA 2A40A 3O9UA 5JVGL 3CCSN 5C42A 5FRNA 3GL1A 4Z94A 2BTFA 4M3XA 5EY4A 1G15A 1VSEA 3AVHA 4ELTA 3M8SA 4BRLA 3A5OC 2NRVA 2OCEA 5IWAK 3HI0A 3MAQA 4XEIA 1YF5L 3QICA 3PIOL 3DWLA 2NUBA 3EZ5A 1IKVA 5JICA 4M3ZA 4K0KK 1KFDA 4EHUA 3DOLA 1QVGM 1HPMA 2O4IA 3PO5A 5JS2A 4BQZA 1BHLA 4DV1K 2YJEA 4KRFA 5AZIA 1TK5A 1TK0A 4BROA 3SQ1A 3ALYA 1JJ2M 1WAJA 4A2AA 3CJAA 2AJQA 2UUCK 1JL1A 4QOZB 1DTTA 3T19A 1Y97A 1RBTA 4CGJA 1UA1A 1NK9A 4E7HA 4B3MK 1XUPO 1JLAA 2KTQA 3BEXA 1SS6A 3FZFA 4ISEA 5AQGA 2X74A 5DM7L 3AV9A 4YDUC 3CI5A 4DR4K 3LZIA 3DXKA 1BCMA 4YOVA 4CHQA 1RNHA 3CQXA 2D0CA 3FFIA 3ZT4A 3O1WA 4JHDA 3V1RA 4I7FA 1Q82O 1S1UA 4PL7A 1RCHA 3MEEA 1SV5A 2D1KA 3AVIA 4LF7K 3K5OA 4OLAA 1RT3A 4JKAA 3K9KA 3HP9A 1IG8A 1VSKA 5AQSA 4FLZA 4UQGA 3KK3A 4BACA 4R79A 5C2FA 4EIAA 4A5AA 3ZT0A 3OJUA 1OH6A 4DB3A 3HL8A 2D0OA 3EKUA 4W5NA 5CYMA 3O3HA 3LDPA 5AQKA 5M1FA 3I33A 1NKCA 3V6DA 1HNXK 1ZXOA 3KK7A 3QNOA 4M3RA 2O4GA 3EE9A 3NE6A 1C1BA 5FRMA 4CGGA 5DMRA 2ASPA 1WB9A 2HNDA 4LC9B 3QEWA 2YKNA 5LL6Z 4WFAL 3I8BA 3KTQA 2HBJA 3OYAA 4DR1K 5C0YA 1LV5A 4GKKK 4RW6A 5AQUA 1EXQA 1LW2A 2ZWHA 3H6EA 4F3OA 2I5JA 4FWQA 2PYJA 4FWPA 4DKWA 3SV4A 2E2NA 4FJHA 3LAKA 3L4IA 4E89A 4IOAL 4BDPA 3MN5A 4HUFA 5AZJA 4JRPA 5AFUH 3D2EA 1NJWA 4M7XA 3U8XA 2JWKA 1IV0A 4FWKA 4LH5A 2QW9A 1KXPA 4C23A 3IMXA 4F2RA 4B9NA 1W7AA 3M5RA 4H4OA 4DFPA 2Z1IA 3DLHA 2OTLN 3AVGA 4RW7A 4CHOA 1YT3A 3RTVA 1XC9A 2F8TA 3HPOA 1V4SA 4BE1A 4FLTA 4PKHA 2YNGA 1K6YA 1S1TA 2CGLA 4F8RA 3FZLA 3WXIA 3ZETB 2P9IB 4OVLA 2HF4A 4RW4A 1WSJA 2D0AA 1LWEA 1IBMK 3CM6A 4QAGA 1T6DA 1RBUA 3D45A 3SMSA 2HOEA 3OYEA 2O8FA 1SKSA 1VRTA 1X1PA 4BC3A 1L3SA 4M41A 4YORA 3L2VA 1XNQK 3VMFB 1QVFM 1NKEA 3ULEB 1NMDA 5J2MA 3OW2M 3TTCA 5HRRA 4CERA 4CD3A 2D5RA 4DG1A 4OO1J 5JLFA 3VN5A 3ZSWA 1CZAN 3MN9A 1VQ8N 3ZX2A 4EZ9A 4L8RB 4FJ5A 4A61A 4GV9A 3CQYA 2W6KA 4JEPA 4A5BA 4UY8O 4N76A 3OYDA 1RTJA 4FOEA 4E7IA 3C65A 2VWKA 3V81A 4DUYK 1JXEA 1TKXA 3F73A 4DV0K 4CESA 3QBXA 3VQBA 1GOBA 1DKGD 3J81O 2G8HA 2GTDA 3DLBA 1KVCA 2ZGYA 4N56A 4FJ8A 4HHTA 1NBWA 4KTZA 1N6QA 3GE1A 2H3GX 3THXB 1IG9A 4RW9A 2RN2A 2DY4A 4E7KA 4DQIA 4NXNK 3KLIA 1BWFO 1BUPA 2HBKA 3CIPA 3NCIA 1BL3A 2VQFK 4WQ4A 1N34K 2UUAK 4EP4A 2D0BA 4IXCA 1IBLK 1KLMA 2Q2RA 1TKZA 3RMDA 1OH5A 5AQYA 1JCFA 3NMUA 3UKRA 1C6VA 2E1YA 2P9KB 5M1PA 5AFUA 3P39A 4X65K 1N33K 4BG8A 1GLCG 3DLRA 4CBWA 2JLEA 4CE9A 3AA2A 2ZM6K 2VYPA 4V19S 2P9PB 4JI4K 5LMNK 4E7LA 3FLCO 2I7PA 3SQ4A 3KD1E 1RILA 4FJ9A 2HW3A 5SWMA 3CFRA 4H5WA 3OBYA 1VSMA 3O8MA 3SUQA 3NHGA 2D4WA 3K5NA 5FPEA 3K58A 1C1AA 2PY5A 4O5BA 2OPSA 4FWRA 4DCHA 1QZ6A 3HBTA 3HM8A 1L3TA 1KVAA 1OVYA 1EWRA 3VEWA 3RR7A 1T44A 3QINA 1VSFA 1VHXA 4MQ3A 3AO1A 5BR9A 4FM2A 4CCHA 1YJNN 3QESA 4FJXA 1SL2A 3SAGA 1S22A 1HNIA 5AQQA 1U2VB 3NF8A 1X9WA 3PX6A 4DSIA 1C0UA 4CF2A 3VEYA 4E1MA 1ITGA 3ZSYA 4NLCA 4FJNA 2F9WA 1ZYQA 4H0TB 5F2RA 4BR5A 5AR0A 4F9OA 4R5PA 1NGEA 4BRMA 4B9LA 4CZKA 2Z1GA 3PO4A 3V4IA 5CR4A 3TAEA 4DF4A 4Z4FA 4FJIA 3VGLA 3M1FA 2LSNA 4E0DA 3ATUA 1RBVA 2P9SA 1QQNA 4JS4A 2X6SA 2ZQBA 3E9LA 1RBSA 4KHSA 3G4SN 3BZCA 4H0YB 2VGNA 4BDZA 5M1NA 4OKKA 3U9DA 2E8AA 2A3ZA 1D9FA 4OJRA 3WNEA 2VWBA 4CFDA 5JS1A 1QSSA 4DTSA 1U4BA 3G25A 4L3QA 3AVJA 2GWJA 1B9DA 3L2QA 4E19A 1HKCA 4ILHA 4BRQA 3L3VA 3THYB 5EOYA 1U48A 4KREA 3AO4A 4A59A 1BG3A 1BGXT 3R6MA 3C0BA 1RDUA 3UKUA 3RSEA 4IG0A 4DTXA 3ENHA 2P9SB 3FGUA 3T1YK 4K41A 3L2WA 3TAMA 3SCXA 3OYIA 1QHTA 4WQ5A 1VQ4N 4BREA 3ZT1A 2HNZA 2YNFA 2PAVA 3WXMB 1LW0A 2JGUA 3OYKA 4BRCA 3HOTA 3ZCMA 2O8BA 4BR2A 1X9MA 2V7ZA 1MWMA 1U6ZA 2OA8A 2J4RA 3D2FA 2VG6A 1MA9B 4CJ7A 1QQOA 1NU0A 1RDDA 3UE5A 1FK9A 1RDBA 1VQ7N 3CCUN 4W5QA 4N41A 3V1OA 2G8UA 1HLUA 4JD2A 1SAZA 1JLGA 2V51B 3RRGA 4KI6A 4B3SK 2F96A 3N4PA 4M7YA 4PY5A 3QFUA 4FK4A 2A6AA 2OANA 3M8PA 3OYCA 3H1VX 4AHVA 1Z26A 4DV6K 1QSLA 2UUBK 4BY9C 2HSTA 2A41A 3JS6A 3THWA 5CE3A 3NBPA 1RTHA 3VA3A 3PY8A 4KB0A 3CFPA 4FWLA 2Z1JA 3AAQA 3ZSRA 3S3NA 5JMVA 1BDGA 3VF6A 1Y64A 4IO8A 3PUFA 2QM1A 4PWDA 3BZKA 2IOCA 4M42A 3B6OA 3WQTA 3AVBA 4PQUA 3ITHA 2O8EB 3P5JA 2O8CA 1JXBA 2FF3B 3LP3A 3HPGA 1HYSA 1UOCA 5C25A 3M3ZA 1W0HA 4CW7B 1HJRA 2FSNA 4QCLA 3VF2A 1CLQA 1C0MA 3VGMA 2P51A 4DU4A 1Q7YO 1HR0K 2KKZA 1D5AA 3K9JA 1T05A 5AQTA 4N5SA 4RW8A 5HRSA 3QEIA 3IAYA 3AO2A 5MLCQ 2P9UA 4YOYA 3OYFA 2XHBA 1J54A 2KFNA 5KRSA 4ZHRA 1N36K 4WFBL 3CCEN 3NH1A 3I55N 3CCJN 3SPYA 1NG9A 3J7YP 1KTQA 4CFBA 2O8CB 4RCHA 2IS3A 4DTNA 4AHUA 3CCMN 4I2QA 3MECA 5KPTA 4ID1A 4AM7A 3T7ZA 3F9KA 3CMAN 2P5GA 3MEGA 1RGIA 4BRNA 1NKBA 1HNVA 4I6MB 4B1UB 4FPAA 4KH5A 1NLVA 3CPWM 4ICLA 3U3GA 3VGKA 4MLHA 1TUUA 3VQ7A 1R0AA 1NJIO 2Q1NA 2G8IA 1HNWK 1A5WA 3WNFA 4A62A 4AHTA 3ZSQA 3OYBA 3TTDA 2XY5A 3WNGA 4B1VA 2IAJA 1IKWA 3AARA 1RT6A 1U45A 4JKGB 5AQNA 3MWTA 4FLXA 1P8ZA 3I0RA 1XQSC 4DS5A 1C0FA 2GELA 3S9HA 4KTQA 1KSPA 3KVGA 5HP1A 1NOYA 4CJTA 5BR8K 1HYZA 3R9PA 4BRDA 1LOTB 4JNEA 4W5OA 4KHQA 3VEZA 3O5BA 4CJRA 4DV2K 3TSUA 3ZSXA 4XH5A 3CHWA 5BRHA 2YHAA 4CIFA 3A5LC 1NGHA 3Q7BA 5BREA 3DXMB 4MO4A 3DM2A 3QEVA 1SQKA 4J2DA 5BRFA 2KFZA 4MFBA 3IG1A 1IKXA 4JKDA 1EO1A 1VQ6N 2P9LA 1JCGA 2A42A 3NGIA 3CC4N 2XRIA 5AQOA 2GX9A 1HX1A 3QIPA 3FZKA 5HL7L 4JK9A 5BN8A 3AO3A 1J9AA 1IJJA 4JKCA 5CYQA 3KJVA 4JK7A 3CPEA 3KLGA 4KBOA 4O44A 1GLBG 2HNYA 4CJEA 5JLHA 4WQ5C 2DFFA 4C8NA 4W5RA 2QK9A 1UWBA 1YTAA 4XH4A 2UYTA 4DTMA 4PHTX 2G8FA 2FBXA 3D7EO 4K43A 4CEBA 3PV8A 5BPNA 1FKPA 3V9UA 4O0JA 1S1VA 3DLGA 4QS8A 1GOCA 1HJOA 3V1QA 1D8YA 4FJ7A 4WYBA 2QWLA 2P9LB 3LPUA 3WXJA 1J5EK 1N32K 1ASVA 1QQMA 3ZSVA 4DU3A 3MCPA 4IFVA 2D0PA 5E84A 3ENOA 4IOCL 4IFYA 2WC9A 4OLBA 1EETA 3DAWA 1D4XA 3SK3A 4H5VA 1GLDG 4KHYA 3C95A 1RT7A 2IGIA 4FYDA 3F9MA 1X9JA 1NGCA 4O8UA 3T69A 1YHQN 1JLEA 2ZF5O 5GADP 1SL1A 4B9MA 3QETA 2PFUA 1WSHA 3FZMA 3TAQA 4DR7K 1M1KO 4OKJA 4BC5A 2FBYA 4CJSA 5GIPA 4DQPA 2VQEK 3IDHA 3NGYA 4DS4A 3G0ZA 3RMCA 4DR3K 3LWMA 3J7ZO 1SKWA 3ZETA 2P9IA 3TU5A 4AH9A 3K5LA 3VEVA 1BQMA 1QS4A 4FOIA 4LY7A 4DTRA 3OS1A 2CGJA 1I3AA 3CCVN 4YY3K 3KLEA 3HSTB 4IBNA 4CJPA 4WF9L 4KH4A 5E41A 3SJHA 2FSKA 3ULEA 1Z05A 4IEIA 3TR8A 1BA0A 2DFHA 2BE2A 4NYFA 1ASUA 4FVMA 2G8VA 1JLBA 3CF5L 1G99A 2ITGA 1NK8A 1VQMN 2ASOA 3DI6A 2QWPA 1LAWA 4GV3A 2CGKA 4Q0BA 4PA1A 1FJGK 5BPLA 5K14A 3AGKA 5AQVA 2WBNA 1VQKN 1T03A 1Q8IA 3AA3A 3ZX0A 3LP2A 5D3GA 4AHCA 3C6TA 1XNRK 3AVLA 3ATVA 3G6EN 4FLVA 3SQ0A 4CZIA 4BRPA 1N5YA 2ATQA 1WBBA 1L3UA 4JI1K 2HHWA 1S1WA 1ATNA 1XC3A 4RTFD 5AQHA 4OKEA 3THXA 2HBLA 1GLEG 2WTUA 3ID8A 1IBKK 3AVFA 3VQ4A 4DQ8A 3NVMA 5F1XA 3SZ2A 4FJGA 3O4QA 3OY9A 4C8MA 3SV3A 3L2UA 2NLXA 2V7YA 4ZTFA 4PL8A 4LSNA 3J8AA 5CZ1A 2P9KA 4XH1A 3NF7A 4CZHA 4CF0A 4CK2A 1GLJO 5C2DA 3H45C 1I39A 1HKGA 2ZJQL 1WAFA 3LWLA 1N8RO 5AQMA 2IVNA 1B9FA 2P9PA 4OPHA 1MWKA 1TYQA 3HO1A 1JKHA 4TSXA 4CFAA 5B8HA 3H3NO 2E6LA 3QMLA 2QTDA 3UIQA 1S1XA 1U04A 3BF1A 2P1JA 1CZ9A 3PSIA 1Z25A 3I56N 4CZLA 1CXUA 1WN7A 4M3WA 2VWJA 1WSIA 1HPZA 3ASMA 4DFJA 5C12A 1JLFA 1S5JA 4DSEA 3SUOA 2GEMA 2OZMA 4M3UA 3DLEA 2PBDA 2NRHA 3OHRA 1U2VA 4B3RK 4BGBA 2RHKA 3I8DA 4H8KA 4Q5VA 3O4NA 1TYQB 1T8EA 3CERA 2QXLA 3OTOK 4DSKA 4NYNA 2OPPA 3V9ZA 3T1AA 1WOQA 4Z4GA 3QERA 1SUQA 1NJYA 2YHXA 3OYLA 1X9SA 3OYGA 3OYJA 1RTIA 2YX6A 3O9QA 1VQ5N 3O6WA 1JLQA 3ZEUB 4BDYA 4B9VA 4JRQA 4DTUA 4OPKA 1NGGA 4B9QA 4E7JA 1ESVA 4N47A 5FLXO 4FCYA 3O1BA 5AQFA 2P9NB 3CJ1A 3V9WA 1W9HA 1Q81O 1NWKA 4CF1A 3K57A 4BC2A 3QLHA 2EHGA 2RKIA 4LF4K 1VK0A 2IVPA 3MEDA 4B9SA 4YNQA 1TKTA 1K8KB 3E66A 1WSEA 4IJNA 1NGFA 1XWLA 1EWQA 3CJCA 1VSLA 4LF5K 1M90O 4CJ3A 3THYA 1IO2A 4AILC 1YI2N 3K5MA 3L4QA 4GMJB 4JKEA 4HVJA 1FKOA 1YITN 1VQ9N 3VEXA 2UXDK 1TAUA 4GV6A 4J2BA 2V52B 3P83D 3NDKA 3V9SA 3HSCA 5FROA 1WBDA 4DV3K 2XO7A 3HT3A 4C8KA 4I9QA 4IJAA 3KKRA 2Q36A 4CK3A 2QWOA 3VTIA 3HPHA 1HRHA 4FLYA 2IDOA 3MX2A 1XMQK 4IDHA 1SL0A 3LL3A 5I42A 3C6HA 2OPQA 2GUPA 3OA9A 3CCQN 2YKMA 3B8AX 1UAXA 2E1ZA 5AQWA 1VQLN 4CBXA 3VA0A 2JWLA 2E20A 2UXCK 5BN9A 3ULDA 1Q86O 2FSJA 4ILJA 4W5TA 3OYNA 3FE1A 2HHVA 4BVPA 2NRXA 2PZSA 1ZBUA 4WCEL 4FJJA 3L3UA 1VQNN 3JAMO 3ZSOA 3E01A 3DYAA 4H5TA 3C7NB 4C1NI 1EP4A 2RPIA 3EE8A 2NRTA 2E2OA 3SAFA 5EX5A 3SYZA 3KWIA 3HOSA 2XY7A 3H46O 4BE0A 5J2PA 3NFAA 4CEFA 4F2SA 3EY1A 4C8OA 3VQ6A 5KI6A 1E4FT 4CIEA 4I2PA 4KV8A 3OBWA 5C10A 5LMUK 3O9SA 3WXLA 1YJ9N 3LM2A 3U6FA 4DHYA 2O8EA 2VG5A 3R8EA 3WEEB 3M6GA 5AQIA 3CM5A 1T3VA 3MXMA 4JV5K 2Z1HA 5HBMA 4CJLA 3N4QA 4O4GA 3VQAA 3RVCA 3TTFA 1RT4A 4BRAA 2E6MA 5KQDA 3HP6A 5AQXA 5ADXH 1NNEA 1X3NA 4E3SA 1S72N 1WSFA 5TKWA 4FZZA 5SZTA 4CZEA 4DFKA 3M8RA 2B4JA 4FO0A 2I7NA 3LDLA 3VQPA 3LZJA 1TGOA 4FK0A 5GIOA 4BR9A 4NCGA 2F9TA 1QSYA 5CZ2A 4O55A 4EFHA 1ZBLA 4CJFA 3CETA 1CXQA 3VQCA 4X62K 1ZBIA 1A5VA 1TVRA 3DLLL 1HKBA 4BR7A 1SKRA 4ZTJA 1W2BM 2F7TA 3IS9A 4CHZA 3BY5A 1FW6A 1OVQA 4F3TA 3F2KA 4CEQA 2YV0X 4KHNA 1DLOA 4AQYK 4FWNA 1RT1A 3KLFA 4FK2A 2QWQA 1MDUB 4I6MA 4KI4A 2NRZA 4RG8A 3ZLJA 4E1JA 1NGJA 3VERA 4U7BA 1LWCA 1C1CA 3LANA 5A2QO 4HCCA 3J80O 2FC0A 5LY3A 4KPYA 1QE1A 1ZBFA 4A57A 4JKHA 3DRSA 3I0SA 4JKGA 3L6QA 4FPBA 3MXJA 4KKOA 3CJBA 2GWKA 4FL9A 4CGIA 1OH7A 4IOXA 3BGRA 3TANA 1KC8O 4J2EA 4NO7A 3TAGA 3KIOA 2OTJN 3P38A 3AA4A 2W6LA 2HVHA 3A2FA 3MMVA 3E9PA 4CFCA 1NK4A 2QKBA 1H1VA 3AO5A 3SBTA 3SI6A 3O4WA 2BANA 5GAHP 1YAGA 5GINA 4CIGA 5J2NA 1BQNA 3O80A 5E26A 5C24A 4BC4A 1RTDA 3JXUA 1BI4A 4WE1A 4GY2B 5HRNA 4JN4A 3NVKA 1ZC6A 3OYHA 3DXMA 4NB4A 3E9OA 3CCLN 1EQYA 3CG7A 2VG7A 2AP1A 4Y1DA 1IKYA 3EYZA 2YHBA 3BDPA 3AVNA 1TV6A 4FLUA 1NGAA 4EHTA 3CJ9A 2OYQA 4BRHA 3AAPA 4NLBA 1L3VA 2HMIA 3MX5A 3DRRA 2Y1JA 3RR8A 4FJLA 4CK1A 1S9GA 3D6RA 5ADXA 3PSFA 5BPMA 5H1SQ 3CXCM 4BRGA 1VRUA 3PX4A 2O8DB 3H08A 4B9TA 2FBVA 4CJVA 3CC7N 1BI4B 1T6CA 4GVEA 3VQEA 4KTWA 3L8BA 2BDPA 3JSMA 4HTUA 4DQSA 4CD1A 2CH6A 4CEEA 1U49A 1BIUA 4JLHA 4CBUA 1IH7A 1W97L 3QBWA 4M63C 3KD5E 3LP1A 1K73O 2YCHA 3PLAA 1VAZA 2HBMA 2AA4A 3EL2A 3G71N 2Q31A 1RDAA 4I9LA 4ELUA 2BUPA 5LJVA 1NMNA 1RFQA 3LDSA 4CJKA 4DSLA 3KZBA 4CF8A 2WOMA 2IVOA 3KKSA 3ZT2A 4DR2K 4B08A 4JKFA 1S9EA 3MDQA 2NNWA 1K9MO 3ZT3A 4CI6A 4JI2K 4B3OA 1EX4A 1C0GA 3ISNC 4DMNA 3P1GA 4KFBA 1ATSA 1NGIA 1J6ZA 3A5NC 3TSQA 5FDLA 4BWJA 3QDKA 3AGRA 3HYFA 2FF6A 4X64K 3HZ6A 3RRHA 4GVMA 3EEQA 4DWIA 4YOTA 3BUZB 1YVUA 4DV4K 2YJFA 3OS0A 1ASWA 2ASMA 4CGHA 1TL1A 4GKJK 3AVCA 1O13A 1HMVA 4KHUA 4B9UA 1DEJA 1ATRA 1KD1O 2EX3A 5AZIB 1A5XA 3CJ7A 4CZJA 4DQRA 1TL3A 1VQON 3H3OB 2R7YA 4IWVA 4PUOA 4MO5A 3WT0A 2DFEA 4CJ5A 4M45A 2FLOA 4EZ6A 4OGEA 4CGFA 3S3OA 3QNNA 2HHQA 4C1NK 1XHZA 3K59A 1O1WA 3VQ9A 3JYTA 3Q7CA 4IFEA 1WUAA 3A0IX 3AVKA 4LF6K 4FWSA 4Z4EA 4OPJA 4YHHK 4LSLA 3CFOA 4K8ZA 5AQJA 3V9XA 4BWMA 1NGBA 3IFRA 4FM0A 2YNIA 3DXKB 2GUIA 2VCPA 4FWOA 4JHDB 3SUNA 4NCBA 4HUGA 3LDNA 4ISFA 1Q18A 4DF8A 4M3TA 4BRIA 5EXWA 5FPNA 2DTUA 1NJXA 4KAZA 2WFBA 3BF3A 4CHPA 2HB5A 1BOTO 3HRGA 3EZWA 2W41A 5KQ8A 2Y1IA 1HQEA 1KLNA 4BGAA 1J5OA 2KHOA 4JI6K 1DTQA 3LDQA 3IRXA 3OYMA 3SPZA 1BIZA 4PKIA 3KHYA 5ELZA 3QEXA 4ID5A 3CD6N 4CZFA 3WNHA 4YOWA 1OKJA 1NM1A 3WXKA 3K0SA 5HLFA 2QEXN 3MN7A 2A5XA 1S3XA 5GAEP 5I9EB 3GG4A 2ZJPL 1BU6O 3LDOA 3VQDA 5AZJB 1YTUA 2HHSA 2ZD1A 2HMPA 3D2EB 3HVTA 2PYLA 1J53A 1ILYA 1T7PA 2W42A 4K25A 4B1ZA 3NF9A 5KGXA 1Z6RA 4QS7A 2OZSA 3PIPL 2HHUA 4FZYA 3QB0A 4NXMK 3QFPA 4CVNE 4JI5K 3S3MA 4H0PA 4EP5A 4IG3A 1KFSA 4BR0A 2Q3SA 1KCFA 4CGDA 3E1YA 3HK2A 3ZX3A 2HHTA 3LPTA 2HHXA 1RT5A 3MWPA 4H0OA 3GBTA 2Q0UA 2WONA 3ID6A 3R3LA 4KHPK 2QXFA 4DSFA 4KHWA 3B6PA 1K8AO 4B1YB 3PX0A 4JKBA 5KGWA 3AY9A 1NK7A 1WNSA 1R59O 4KO0A 4AM6A 2UXBK 4CEOA 1ZBHA 1F21A 3OVNA 4DUZK 2O8FB 3ZEUA 1OH8A 2RF2A 4FJMA 1VSHA 4YFUA 3IKMA 1NJZA 4CJUA 5M1KA 2ZJRL 3OS2A 2P9NA 4X66K 2A1RA 2XY6A 1RDWX 2ITMA 3AVAA 4M3YA 4CZMA 4OX9K 2P5OA 3K2PA 4FJKA 3O3GA 2IIRA 3WQUA 2FXUA 3CMEN 4A2BA 2GV9A 4QS9A 2UU9K 4H0VB 1XMOK 3A5MC 2YI1A 5KRTA 4DV7K 5AQPA 1K8KA 4JK8A 1GLLO 1TK8A 4CZGA 3IUCA 3EKSA 4BE2A 2BGGA 2X6NA 1WSGA 1S6PA 3CQ8A 4DLGA 4HCBA 4H0XB 2QKKA 4DR5K 3QIOA 4BRKA 4B8AB 4CHNA 2E2QA 1QQCA 2WUSA 5HROA 1E3MA 4DTPA 2QA4N 5DM6L 1VSIA 3LM9A 3O9RA 4K42A 1MU2A 2EWSA 4CF9A 3RMAA 1ZBSA 1BO5O 4IEEA 4BG9A 1GLAG 5CHIA 3VOVA 4FW1A 4IZ9A 3S41A 3T1HK 2CH5A 3NAEA 3TSPA 1BA1A 3VEOA 4G9ZA 2HVIA 4ILGB 1YJWN 3W3DA 4DSJA 1S6QA 3UKRB 4O5FA 2QWNA 1KRPA 4HTLA 3FZHA 4FWMA 1P90A 4CJWA 1VSDA 3KK1A 4Z4HA 5J1EA 3FR0A 4FLWA 2KQ2A 3EN9A 2YNHA 3LP0A 1CZBA 2DPNA 3TPQA 4Y0WA 5AQLA 4O8KA 3TABA 3ZYYX 2NRWA 5BRDA 3C7NA 4FZXC 4DU1A 4XIUA 4E1NA 1JL2A 5T7BA 1TUYA 3SBGA 5AQZA 5FPMA 4AF1A 2QI2A 1EKEA 2ZGZA 3D0PA 3L2RA 1KAZA 4Z4IA 3TAFA 1TKDA 3DOKA 1YUWA 4H03B 4Z0UA 4MDBA 1L5UA 4ELVA 4OPAA 3GOIA 3SMPA 4LFBK 4JI8K 4LF9K 3NF6A 4LFAK 3J7AP 2HF3A 4HUEA 4LH4A 4DLEA 4YOUA 3QEPA 3WEEA 4BQLA 3KK2A 1RDCA 1VQPN 4IKFA 3O9TA 3G10A 4H5RA 3VPZA 3GDQA 1NOZA 4PKGA 1NK5A 3AA5X 1QZ5A 2QWRA 3NGZA 1YVNA 1YXQA 4O0IA 5I3UA 1QHAA 5IT9O 2A1SA 2OPRA 1GOAA 1HQUA 4CJ4A 2NRRA 4AHRA 4BR4A 5C15A 3O08A 3SQ2A 1REVA 1NK6A 4MDAA 4JAXA 4DR6K 1SZ2A 3HM9A 1HNZK 3TI0A 4JI3K 4F4KA 4LF8K 1GLFO 3R1XA 4YDUA
chains in the Genus database with same CATH topology
3C94A 1TKZA 4B8CA 2B5JA 4Y1DA 3NGYA 4DS4A 3RMDA 1RBRA 3G0ZA 1IKYA 3EYZA 3RMCA 3LWMA 4FM1A 3VQ8A 1C6VA 2YHBA 1SKWA 1BCOA 3BDPA 3AVNA 1LAVA 1TV6A 4FLUA 4LD0A 4AH9A 4DQQA 4B9TA 3K5LA 3QO9A 2E4LA 2OYQA 1VSJA 4DTOA 4C8LA 1BQMA 3DLRA 1QS4A 2JLEA 2GBZA 4LY7A 3AA2A 4CE9A 1L3VA 2HMIA 2Y1JA 3DRRA 4DTRA 3RR8A 3OS1A 4CK1A 4FJLA 4CEDA 1I3AA 4E7LA 3KLEA 1S9GA 3HSTB 4IBNA 5KTQA 3HXMA 3SQ4A 3CYMA 1RILA 4CJPA 3RMBA 3KD1E 3LAMA 3DRPA 5SWMA 4FJ9A 3CFRA 2G8KA 2F8SA 1VRUA 1VSMA 3PX4A 3SUQA 4CEAA 3NHGA 3H08A 3K5NA 1JLCA 5E41A 2FBVA 1C1AA 4CJVA 3K58A 2PY5A 4O5BA 2OPSA 1BI4B 3TR8A 2DFHA 3VQEA 2BE2A 4KTWA 3L8BA 3MXIA 2BDPA 3JSMA 3CG7A 4NYFA 1ASUA 4HTUA 4FVMA 4DQSA 1L3TA 1KVAA 1WLJA 2G8VA 3RR7A 1JLBA 4CEEA 4CJQA 1U49A 1BIUA 1C0TA 1VSFA 2ITGA 3C6UA 3AO1A 3QINA 4JLHA 1IH7A 4MQ3A 4FM2A 4CCHA 3OJSA 3QESA 4AHSA 4CEZA 1Q9YA 4FJXA 1NK8A 3O3FA 1SL2A 3KD5E 3DI6A 3LP1A 4FXDA 1HNIA 1LAWA 4K8XA 4Q0BA 4PA1A 4CECA 5K14A 3NF8A 1RDAA 4I9LA 1X9WA 1T03A 4ELUA 4Y1CA 1Q8IA 4DTJA 3LDSA 3PX6A 4CJKA 4DSLA 3AA3A 4CF8A 3LP2A 4DSIA 1C0UA 5D3GA 4CF2A 4AHCA 3TAPA 2WOMA 3C6TA 4E1MA 1ITGA 3AVLA 3KKSA 3NH2A 3ZT2A 3ZSYA 2KW4A 4FJNA 4B08A 1ZYQA 2KZMA 4FLVA 3SQ0A 1S9EA 5CY4A 1RT2A 4H4MA 5DK5A 2ATQA 3ZT3A 4R5PA 3U3YA 1N5YA 1L3UA 4B9LA 2Z1GA 3PO4A 4B3OA 1B92A 3V4IA 2IC3A 3TAEA 1S1WA 1EX4A 4NCAA 2HHWA 4QOZB 4DQPA 3ISNC 4DF4A 4DMNA 3P1GA 4OKEA 2ETJA 4KFBA 4Z4FA 4FJIA 3TWHA 3HVRA 2LSNA 4E0DA 3NH0A 3SUPA 1RBVA 3AVFA 5FDLA 4BWJA 4JS4A 3T3FA 3HYFA 3VQ4A 2X6SA 3RRHA 2ZQBA 4JS5A 4GVMA 3SZ2A 4DWIA 1RBSA 4FJGA 4KHSA 1U47A 1YVUA 3O4QA 3OY9A 4C8MA 4BDZA 3OS0A 3SV3A 3L2UA 1ASWA 4OKKA 4ZTFA 4CGHA 1TL1A 4LSNA 1D9FA 3VQ5A 3AVCA 5CZ1A 4OJRA 3WNEA 3HJFA 3LALA 1HMVA 2G8WA 1KVBA 4CFDA 3THVA 4B9UA 1QSSA 4KHUA 2FBTA 5JS1A 4DTSA 1U4BA 2EX3A 1BISA 3NF7A 5J2QA 1A5XA 4CF0A 3AVJA 3ZSZA 4CK2A 1TL3A 4DQRA 3SNNA 3M8QA 2R7YA 1B9DA 3L2QA 4PUOA 1I39A 4OGCA 2DFEA 4E19A 1WAFA 4CJ5A 3LWLA 1LWFA 4M45A 1B9FA 2B6AA 3HO1A 3L3VA 1JKHA 4EZ6A 4TSXA 4CFAA 4OGEA 1FXXA 3VQQA 5EU7A 4CGFA 3QNNA 3S3OA 1U48A 2HW3A 2E6LA 4KREA 2HHQA 1UA0A 3UIQA 1HYVA 1S1XA 1U04A 3AO4A 1XHZA 1XHXA 3K59A 2X78A 3SJJA 2P1JA 1CZ9A 1BGXT 4KB1A 2ZE2A 1O1WA 1Z25A 3TARA 3VQ9A 3JYTA 4IG0A 4DTXA 1CXUA 3DMJA 4GW6A 1WN7A 3AVKA 4M3WA 5HRPA 4Z4EA 4OPJA 4LSLA 3CFOA 4K8ZA 2VWJA 1WSIA 3L2WA 3V9XA 1HPZA 3ASMA 4BWMA 3TAMA 1QHTA 3OYIA 4DFJA 1JLFA 1TAQA 3DLKA 1S5JA 4J2AA 3RWUA 4FM0A 2YNIA 4DSEA 3SUOA 3ZT1A 2HNZA 2YNFA 2GUIA 2OZMA 4M3UA 3DLEA 4G1QA 1LW0A 2JGUA 3OYKA 4Z4CA 2XY8A 3SUNA 3KLHA 4FW2A 1XI1A 4NCBA 3ZCMA 1QTMA 4CHYA 4HUGA 3AVMA 1X9MA 1Q9XA 4DFMA 3I8DA 4DF8A 1NK0A 4M3TA 4H8KA 4Q5VA 2KZZA 1D9DA 3O4NA 1T8EA 4DSKA 4NYNA 2OPPA 3V9ZA 2OA8A 2DTUA 1NJXA 4KAZA 2VG6A 3T1AA 4Z4GA 4IDKA 1RDDA 1SUQA 3QERA 1FK9A 4CHPA 1RDBA 2HB5A 1NJYA 3OYLA 5FRNA 1X9SA 5C42A 3OYGA 3OYJA 1RTIA 4W5QA 4N41A 4M3XA 1JLQA 3V1OA 2G8UA 1G15A 1VSEA 3AVHA 4BDYA 4ELTA 2Y1IA 3M8SA 1HQEA 1KLNA 4B9VA 1J5OA 4JRQA 4DTUA 4OPKA 3MAQA 1DTQA 1JLGA 4E7JA 3IRXA 3OYMA 3SPZA 3RRGA 4KI6A 4N47A 4FCYA 2F96A 4PY5A 1BIZA 4FK4A 3M8PA 3OYCA 3V9WA 1W9HA 2NUBA 1Z26A 4AHVA 1QSLA 3EZ5A 3QEXA 1IKVA 4M3ZA 4CF1A 1KFDA 3K57A 3QLHA 3DOLA 2EHGA 4ID5A 2O4IA 2RKIA 3NBPA 3WNHA 3PO5A 1RTHA 5JS2A 3VA3A 3PY8A 1VK0A 1BHLA 4KB0A 3CFPA 3SCXA 3S3NA 2Z1JA 3MEDA 3ZSRA 4B9SA 4YNQA 5HLFA 4KRFA 1TKTA 1TK5A 1TK0A 1WSEA 3PUFA 3ALYA 1XWLA 3SQ1A 4PWDA 2IOCA 4M42A 3B6OA 1VSLA 1WAJA 3AVBA 4PQUA 3ITHA 2AJQA 4CJ3A 1IO2A 1JL1A 1DTTA 3P5JA 1Y97A 1RBTA 3T19A 3VQDA 4CGJA 4AILC 1UA1A 3K5MA 4GMJB 1YTUA 2HHSA 4HVJA 1FKOA 1NK9A 2ZD1A 1JXBA 4E7HA 3LP3A 1TAUA 3HPGA 4J2BA 1HYSA 1JLAA 3HVTA 3P83D 3NDKA 3V9SA 1UOCA 2KTQA 5C25A 5FROA 2PYLA 1J53A 1W0HA 2XO7A 1T7PA 2W42A 1HJRA 2X74A 3HT3A 3NF9A 5KGXA 4C8KA 4I9QA 4QCLA 1CLQA 3KKRA 1C0MA 2OZSA 2HHUA 2P51A 4DU4A 4FZYA 3AV9A 1D5AA 1T05A 4N5SA 4RW8A 4CK3A 5HRSA 3LZIA 3AO2A 3QEIA 3IAYA 3S3MA 1BCMA 4EP5A 3HPHA 1HRHA 4IG3A 3OYFA 1KFSA 4FLYA 2Q3SA 1RNHA 4CHQA 1KCFA 4CGDA 2IDOA 2D0CA 3FFIA 2XHBA 3ZT4A 3V1RA 1SL0A 3HK2A 4I7FA 5I42A 1J54A 2OPQA 2HHTA 1S1UA 3LPTA 2HHXA 1RT5A 1RCHA 2YKMA 2KFNA 3MEEA 1SV5A 3AVIA 1UAXA 3K5OA 5KRSA 4OLAA 1RT3A 4ZHRA 3HP9A 2WONA 3NH1A 3SPYA 2QXFA 1VSKA 1KTQA 4FLZA 3VA0A 4DSFA 4KHWA 3B6PA 4CFBA 4UQGA 3KK3A 4BACA 3PX0A 2IS3A 5KGWA 4AHUA 4DTNA 3ULDA 1NK7A 1WNSA 4I2QA 3MECA 3ZT0A 4ID1A 4KO0A 4W5TA 3OYNA 4CEOA 3OJUA 1F21A 1ZBHA 3HL8A 2HHVA 3F9KA 2P5GA 3OVNA 4W5NA 5CYMA 3O3HA 2PZSA 3MEGA 1ZBUA 2RF2A 1NKCA 3V6DA 1NKBA 4FJJA 4FJMA 3L3UA 1VSHA 3ZSOA 4YFUA 1HNVA 3QNOA 4M3RA 3E01A 1NJZA 3DYAA 4CJUA 1EP4A 2RPIA 4ICLA 3U3GA 2O4GA 3OS2A 3VQ7A 1R0AA 2A1RA 2XY6A 2G8IA 3AVAA 3SYZA 3NE6A 4M3YA 1A5WA 2P5OA 3K2PA 1C1BA 3WNFA 4FJKA 4AHTA 3ZSQA 5FRMA 4CGGA 2XY7A 5DMRA 3O3GA 3OYBA 2HNDA 4BE0A 2XY5A 3QEWA 3WNGA 2YKNA 5J2PA 2IAJA 3KTQA 2GV9A 3NFAA 1IKWA 4CEFA 3OYAA 1RT6A 4F2SA 3EY1A 4C8OA 3VQ6A 1U45A 5KRTA 5KI6A 4FLXA 1LV5A 4RW6A 1EXQA 1LW2A 4I2PA 4CIEA 4F3OA 1TK8A 4KV8A 2I5JA 2PYJA 3I0RA 3SV4A 4FJHA 4DS5A 3LAKA 4BE2A 3S9HA 3U6FA 4E89A 4KTQA 2X6NA 1KSPA 1WSGA 2BGGA 2VG5A 4BDPA 1S6PA 3CQ8A 4HUFA 5HP1A 4DLGA 1NOYA 3CM5A 4JRPA 3MXMA 4HCBA 4CJTA 2Z1HA 5HBMA 4CJLA 2QKKA 1HYZA 4O4GA 3VQAA 3QIOA 1NJWA 4B8AB 4CHNA 4W5OA 1RT4A 4KHQA 2E6MA 1QQCA 4LH5A 3HP6A 5HROA 4CJRA 4F2RA 4E3SA 4DTPA 1VSIA 1WSFA 4B9NA 3ZSXA 1MU2A 2YHAA 4CIFA 4FZZA 5SZTA 4CF9A 4DFKA 3RMAA 4H4OA 4DFPA 2Z1IA 3M8RA 3DLHA 2B4JA 3AVGA 3VQPA 4RW7A 4CHOA 1TGOA 1YT3A 3LZJA 4FK0A 3RTVA 3DM2A 1XC9A 4FW1A 3QEVA 4NCGA 4J2DA 3NAEA 2KFZA 2F8TA 4MFBA 3HPOA 5CZ2A 4O55A 1QSYA 2HVIA 1ZBLA 4CJFA 4BE1A 1CXQA 4FLTA 3IG1A 1IKXA 3VQCA 1S6QA 2YNGA 4DSJA 1A5VA 1K6YA 1S1TA 4F8RA 1ZBIA 1TVRA 3NGIA 1SKRA 1KRPA 4ZTJA 2XRIA 4OVLA 3IS9A 4CHZA 4RW4A 1WSJA 2D0AA 1LWEA 4CJWA 1VSDA 4F3TA 3KK1A 3CM6A 4QAGA 4Z4HA 3QIPA 5J1EA 4CEQA 1RBUA 2YV0X 1DLOA 2KQ2A 4FLWA 4KHNA 3D45A 2YNHA 1RT1A 3AO3A 3LP0A 3OYEA 1J9AA 5CYQA 3KLFA 3KJVA 1CZBA 1VRTA 1SKSA 1X1PA 4FK2A 1L3SA 3KLGA 4M41A 4CJEA 4O44A 2HNYA 3TABA 3L2VA 4KI4A 2DFFA 4FZXC 4RG8A 4C8NA 4W5RA 4DU1A 1UWBA 4XIUA 1NKEA 2QK9A 1YTAA 4E1NA 4DTMA 1JL2A 2G8FA 5T7BA 5J2MA 2FBXA 4CEBA 3PV8A 1LWCA 1C1CA 3LANA 5HRRA 4CERA 1EKEA 4HCCA 1FKPA 2FC0A 3D0PA 3V9UA 3L2RA 4O0JA 4KPYA 1QE1A 1S1VA 3DLGA 2D5RA 4Z4IA 1ZBFA 1GOCA 3TAFA 1TKDA 3V1QA 3DOKA 4DG1A 4Z0UA 1D8YA 3VN5A 3DRSA 3ZSWA 1L5UA 4ELVA 4FJ7A 3I0SA 4EZ9A 4L8RB 3NF6A 3MXJA 3LPUA 4KKOA 4FJ5A 1ASVA 4CGIA 4HUEA 3BGRA 4LH4A 3TANA 4J2EA 3TAGA 3ZSVA 4N76A 3KIOA 3OYDA 4DLEA 4DU3A 3QEPA 1RTJA 4IFVA 3AA4A 4E7IA 2VWKA 3KK2A 2HVHA 1RDCA 3A2FA 4IFYA 3V81A 4IKFA 4OLBA 1JXEA 3G10A 1TKXA 4CFCA 1EETA 3F73A 1NK4A 2QKBA 4CESA 3AO5A 3VQBA 1NOZA 1NK5A 3AA5X 3SI6A 1GOBA 2G8HA 4KHYA 3NGZA 2BANA 3C95A 1RT7A 2IGIA 3DLBA 4O0IA 1KVCA 5I3UA 4FYDA 4CIGA 4N56A 5J2NA 4FJ8A 2A1SA 2OPRA 1GOAA 1HQUA 4HHTA 1BQNA 4CJ4A 4KTZA 5C24A 1N6QA 1JLEA 1IG9A 4AHRA 1SL1A 1RTDA 4B9MA 4RW9A 1BI4A 2RN2A 4WE1A 5HRNA 2DY4A 3SQ2A 4E7KA 3QETA 1REVA 4DQIA 1NK6A 3KLIA 1WSHA 3OYHA 3TAQA 3NCIA 1BL3A 4OKJA 3HM9A 3TI0A 4F4KA 2FBYA 4EP4A 2D0BA 4CJSA 1KLMA 2VG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C94 A;  1TKZ A;  4B8C A;  2B5J A;  4Y1D A;  3NGY A;  4DS4 A;  3RMD A;  1RBR A;  3G0Z A;  1IKY A;  3EYZ A;  3RMC A;  3LWM A;  4FM1 A;  3VQ8 A;  1C6V A;  2YHB A;  1SKW A;  1BCO A;  3BDP A;  3AVN A;  1LAV A;  1TV6 A;  4FLU A;  4LD0 A;  4AH9 A;  4DQQ A;  4B9T A;  3K5L A;  3QO9 A;  2E4L A;  2OYQ A;  1VSJ A;  4DTO A;  4C8L A;  1BQM A;  3DLR A;  1QS4 A;  2JLE A;  2GBZ A;  4LY7 A;  3AA2 A;  4CE9 A;  1L3V A;  2HMI A;  2Y1J A;  3DRR A;  4DTR A;  3RR8 A;  3OS1 A;  4CK1 A;  4FJL A;  4CED A;  1I3A A;  4E7L A;  3KLE A;  1S9G A;  3HST B;  4IBN A;  5KTQ A;  3HXM A;  3SQ4 A;  3CYM A;  1RIL A;  4CJP A;  3RMB A;  3KD1 E;  3LAM A;  3DRP A;  5SWM A;  4FJ9 A;  3CFR A;  2G8K A;  2F8S A;  1VRU A;  1VSM A;  3PX4 A;  3SUQ A;  4CEA A;  3NHG A;  3H08 A;  3K5N A;  1JLC A;  5E41 A;  2FBV A;  1C1A A;  4CJV A;  3K58 A;  2PY5 A;  4O5B A;  2OPS A;  1BI4 B;  3TR8 A;  2DFH A;  3VQE A;  2BE2 A;  4KTW A;  3L8B A;  3MXI A;  2BDP A;  3JSM A;  3CG7 A;  4NYF A;  1ASU A;  4HTU A;  4FVM A;  4DQS A;  1L3T A;  1KVA A;  1WLJ A;  2G8V A;  3RR7 A;  1JLB A;  4CEE A;  4CJQ A;  1U49 A;  1BIU A;  1C0T A;  1VSF A;  2ITG A;  3C6U A;  3AO1 A;  3QIN A;  4JLH A;  1IH7 A;  4MQ3 A;  4FM2 A;  4CCH A;  3OJS A;  3QES A;  4AHS A;  4CEZ A;  1Q9Y A;  4FJX A;  1NK8 A;  3O3F A;  1SL2 A;  3KD5 E;  3DI6 A;  3LP1 A;  4FXD A;  1HNI A;  1LAW A;  4K8X A;  4Q0B A;  4PA1 A;  4CEC A;  5K14 A;  3NF8 A;  1RDA A;  4I9L A;  1X9W A;  1T03 A;  4ELU A;  4Y1C A;  1Q8I A;  4DTJ A;  3LDS A;  3PX6 A;  4CJK A;  4DSL A;  3AA3 A;  4CF8 A;  3LP2 A;  4DSI A;  1C0U A;  5D3G A;  4CF2 A;  4AHC A;  3TAP A;  2WOM A;  3C6T A;  4E1M A;  1ITG A;  3AVL A;  3KKS A;  3NH2 A;  3ZT2 A;  3ZSY A;  2KW4 A;  4FJN A;  4B08 A;  1ZYQ A;  2KZM A;  4FLV A;  3SQ0 A;  1S9E A;  5CY4 A;  1RT2 A;  4H4M A;  5DK5 A;  2ATQ A;  3ZT3 A;  4R5P A;  3U3Y A;  1N5Y A;  1L3U A;  4B9L A;  2Z1G A;  3PO4 A;  4B3O A;  1B92 A;  3V4I A;  2IC3 A;  3TAE A;  1S1W A;  1EX4 A;  4NCA A;  2HHW A;  4QOZ B;  4DQP A;  3ISN C;  4DF4 A;  4DMN A;  3P1G A;  4OKE A;  2ETJ A;  4KFB A;  4Z4F A;  4FJI A;  3TWH A;  3HVR A;  2LSN A;  4E0D A;  3NH0 A;  3SUP A;  1RBV A;  3AVF A;  5FDL A;  4BWJ A;  4JS4 A;  3T3F A;  3HYF A;  3VQ4 A;  2X6S A;  3RRH A;  2ZQB A;  4JS5 A;  4GVM A;  3SZ2 A;  4DWI A;  1RBS A;  4FJG A;  4KHS A;  1U47 A;  1YVU A;  3O4Q A;  3OY9 A;  4C8M A;  4BDZ A;  3OS0 A;  3SV3 A;  3L2U A;  1ASW A;  4OKK A;  4ZTF A;  4CGH A;  1TL1 A;  4LSN A;  1D9F A;  3VQ5 A;  3AVC A;  5CZ1 A;  4OJR A;  3WNE A;  3HJF A;  3LAL A;  1HMV A;  2G8W A;  1KVB A;  4CFD A;  3THV A;  4B9U A;  1QSS A;  4KHU A;  2FBT A;  5JS1 A;  4DTS A;  1U4B A;  2EX3 A;  1BIS A;  3NF7 A;  5J2Q A;  1A5X A;  4CF0 A;  3AVJ A;  3ZSZ A;  4CK2 A;  1TL3 A;  4DQR A;  3SNN A;  3M8Q A;  2R7Y A;  1B9D A;  3L2Q A;  4PUO A;  1I39 A;  4OGC A;  2DFE A;  4E19 A;  1WAF A;  4CJ5 A;  3LWL A;  1LWF A;  4M45 A;  1B9F A;  2B6A A;  3HO1 A;  3L3V A;  1JKH A;  4EZ6 A;  4TSX A;  4CFA A;  4OGE A;  1FXX A;  3VQQ A;  5EU7 A;  4CGF A;  3QNN A;  3S3O A;  1U48 A;  2HW3 A;  2E6L A;  4KRE A;  2HHQ A;  1UA0 A;  3UIQ A;  1HYV A;  1S1X A;  1U04 A;  3AO4 A;  1XHZ A;  1XHX A;  3K59 A;  2X78 A;  3SJJ A;  2P1J A;  1CZ9 A;  1BGX T;  4KB1 A;  2ZE2 A;  1O1W A;  1Z25 A;  3TAR A;  3VQ9 A;  3JYT A;  4IG0 A;  4DTX A;  1CXU A;  3DMJ A;  4GW6 A;  1WN7 A;  3AVK A;  4M3W A;  5HRP A;  4Z4E A;  4OPJ A;  4LSL A;  3CFO A;  4K8Z A;  2VWJ A;  1WSI A;  3L2W A;  3V9X A;  1HPZ A;  3ASM A;  4BWM A;  3TAM A;  1QHT A;  3OYI A;  4DFJ A;  1JLF A;  1TAQ A;  3DLK A;  1S5J A;  4J2A A;  3RWU A;  4FM0 A;  2YNI A;  4DSE A;  3SUO A;  3ZT1 A;  2HNZ A;  2YNF A;  2GUI A;  2OZM A;  4M3U A;  3DLE A;  4G1Q A;  1LW0 A;  2JGU A;  3OYK A;  4Z4C A;  2XY8 A;  3SUN A;  3KLH A;  4FW2 A;  1XI1 A;  4NCB A;  3ZCM A;  1QTM A;  4CHY A;  4HUG A;  3AVM A;  1X9M A;  1Q9X A;  4DFM A;  3I8D A;  4DF8 A;  1NK0 A;  4M3T A;  4H8K A;  4Q5V A;  2KZZ A;  1D9D A;  3O4N A;  1T8E A;  4DSK A;  4NYN A;  2OPP A;  3V9Z A;  2OA8 A;  2DTU A;  1NJX A;  4KAZ A;  2VG6 A;  3T1A A;  4Z4G A;  4IDK A;  1RDD A;  1SUQ A;  3QER A;  1FK9 A;  4CHP A;  1RDB A;  2HB5 A;  1NJY A;  3OYL A;  5FRN A;  1X9S A;  5C42 A;  3OYG A;  3OYJ A;  1RTI A;  4W5Q A;  4N41 A;  4M3X A;  1JLQ A;  3V1O A;  2G8U A;  1G15 A;  1VSE A;  3AVH A;  4BDY A;  4ELT A;  2Y1I A;  3M8S A;  1HQE A;  1KLN A;  4B9V A;  1J5O A;  4JRQ A;  4DTU A;  4OPK A;  3MAQ A;  1DTQ A;  1JLG A;  4E7J A;  3IRX A;  3OYM A;  3SPZ A;  3RRG A;  4KI6 A;  4N47 A;  4FCY A;  2F96 A;  4PY5 A;  1BIZ A;  4FK4 A;  3M8P A;  3OYC A;  3V9W A;  1W9H A;  2NUB A;  1Z26 A;  4AHV A;  1QSL A;  3EZ5 A;  3QEX A;  1IKV A;  4M3Z A;  4CF1 A;  1KFD A;  3K57 A;  3QLH A;  3DOL A;  2EHG A;  4ID5 A;  2O4I A;  2RKI A;  3NBP A;  3WNH A;  3PO5 A;  1RTH A;  5JS2 A;  3VA3 A;  3PY8 A;  1VK0 A;  1BHL A;  4KB0 A;  3CFP A;  3SCX A;  3S3N A;  2Z1J A;  3MED A;  3ZSR A;  4B9S A;  4YNQ A;  5HLF A;  4KRF A;  1TKT A;  1TK5 A;  1TK0 A;  1WSE A;  3PUF A;  3ALY A;  1XWL A;  3SQ1 A;  4PWD A;  2IOC A;  4M42 A;  3B6O A;  1VSL A;  1WAJ A;  3AVB A;  4PQU A;  3ITH A;  2AJQ A;  4CJ3 A;  1IO2 A;  1JL1 A;  1DTT A;  3P5J A;  1Y97 A;  1RBT A;  3T19 A;  3VQD A;  4CGJ A;  4AIL C;  1UA1 A;  3K5M A;  4GMJ B;  1YTU A;  2HHS A;  4HVJ A;  1FKO A;  1NK9 A;  2ZD1 A;  1JXB A;  4E7H A;  3LP3 A;  1TAU A;  3HPG A;  4J2B A;  1HYS A;  1JLA A;  3HVT A;  3P83 D;  3NDK A;  3V9S A;  1UOC A;  2KTQ A;  5C25 A;  5FRO A;  2PYL A;  1J53 A;  1W0H A;  2XO7 A;  1T7P A;  2W42 A;  1HJR A;  2X74 A;  3HT3 A;  3NF9 A;  5KGX A;  4C8K A;  4I9Q A;  4QCL A;  1CLQ A;  3KKR A;  1C0M A;  2OZS A;  2HHU A;  2P51 A;  4DU4 A;  4FZY A;  3AV9 A;  1D5A A;  1T05 A;  4N5S A;  4RW8 A;  4CK3 A;  5HRS A;  3LZI A;  3AO2 A;  3QEI A;  3IAY A;  3S3M A;  1BCM A;  4EP5 A;  3HPH A;  1HRH A;  4IG3 A;  3OYF A;  1KFS A;  4FLY A;  2Q3S A;  1RNH A;  4CHQ A;  1KCF A;  4CGD A;  2IDO A;  2D0C A;  3FFI A;  2XHB A;  3ZT4 A;  3V1R A;  1SL0 A;  3HK2 A;  4I7F A;  5I42 A;  1J54 A;  2OPQ A;  2HHT A;  1S1U A;  3LPT A;  2HHX A;  1RT5 A;  1RCH A;  2YKM A;  2KFN A;  3MEE A;  1SV5 A;  3AVI A;  1UAX A;  3K5O A;  5KRS A;  4OLA A;  1RT3 A;  4ZHR A;  3HP9 A;  2WON A;  3NH1 A;  3SPY A;  2QXF A;  1VSK A;  1KTQ A;  4FLZ A;  3VA0 A;  4DSF A;  4KHW A;  3B6P A;  4CFB A;  4UQG A;  3KK3 A;  4BAC A;  3PX0 A;  2IS3 A;  5KGW A;  4AHU A;  4DTN A;  3ULD A;  1NK7 A;  1WNS A;  4I2Q A;  3MEC A;  3ZT0 A;  4ID1 A;  4KO0 A;  4W5T A;  3OYN A;  4CEO A;  3OJU A;  1F21 A;  1ZBH A;  3HL8 A;  2HHV A;  3F9K A;  2P5G A;  3OVN A;  4W5N A;  5CYM A;  3O3H A;  2PZS A;  3MEG A;  1ZBU A;  2RF2 A;  1NKC A;  3V6D A;  1NKB A;  4FJJ A;  4FJM A;  3L3U A;  1VSH A;  3ZSO A;  4YFU A;  1HNV A;  3QNO A;  4M3R A;  3E01 A;  1NJZ A;  3DYA A;  4CJU A;  1EP4 A;  2RPI A;  4ICL A;  3U3G A;  2O4G A;  3OS2 A;  3VQ7 A;  1R0A A;  2A1R A;  2XY6 A;  2G8I A;  3AVA A;  3SYZ A;  3NE6 A;  4M3Y A;  1A5W A;  2P5O A;  3K2P A;  1C1B A;  3WNF A;  4FJK A;  4AHT A;  3ZSQ A;  5FRM A;  4CGG A;  2XY7 A;  5DMR A;  3O3G A;  3OYB A;  2HND A;  4BE0 A;  2XY5 A;  3QEW A;  3WNG A;  2YKN A;  5J2P A;  2IAJ A;  3KTQ A;  2GV9 A;  3NFA A;  1IKW A;  4CEF A;  3OYA A;  1RT6 A;  4F2S A;  3EY1 A;  4C8O A;  3VQ6 A;  1U45 A;  5KRT A;  5KI6 A;  4FLX A;  1LV5 A;  4RW6 A;  1EXQ A;  1LW2 A;  4I2P A;  4CIE A;  4F3O A;  1TK8 A;  4KV8 A;  2I5J A;  2PYJ A;  3I0R A;  3SV4 A;  4FJH A;  4DS5 A;  3LAK A;  4BE2 A;  3S9H A;  3U6F A;  4E89 A;  4KTQ A;  2X6N A;  1KSP A;  1WSG A;  2BGG A;  2VG5 A;  4BDP A;  1S6P A;  3CQ8 A;  4HUF A;  5HP1 A;  4DLG A;  1NOY A;  3CM5 A;  4JRP A;  3MXM A;  4HCB A;  4CJT A;  2Z1H A;  5HBM A;  4CJL A;  2QKK A;  1HYZ A;  4O4G A;  3VQA A;  3QIO A;  1NJW A;  4B8A B;  4CHN A;  4W5O A;  1RT4 A;  4KHQ A;  2E6M A;  1QQC A;  4LH5 A;  3HP6 A;  5HRO A;  4CJR A;  4F2R A;  4E3S A;  4DTP A;  1VSI A;  1WSF A;  4B9N A;  3ZSX A;  1MU2 A;  2YHA A;  4CIF A;  4FZZ A;  5SZT A;  4CF9 A;  4DFK A;  3RMA A;  4H4O A;  4DFP A;  2Z1I A;  3M8R A;  3DLH A;  2B4J A;  3AVG A;  3VQP A;  4RW7 A;  4CHO A;  1TGO A;  1YT3 A;  3LZJ A;  4FK0 A;  3RTV A;  3DM2 A;  1XC9 A;  4FW1 A;  3QEV A;  4NCG A;  4J2D A;  3NAE A;  2KFZ A;  2F8T A;  4MFB A;  3HPO A;  5CZ2 A;  4O55 A;  1QSY A;  2HVI A;  1ZBL A;  4CJF A;  4BE1 A;  1CXQ A;  4FLT A;  3IG1 A;  1IKX A;  3VQC A;  1S6Q A;  2YNG A;  4DSJ A;  1A5V A;  1K6Y A;  1S1T A;  4F8R A;  1ZBI A;  1TVR A;  3NGI A;  1SKR A;  1KRP A;  4ZTJ A;  2XRI A;  4OVL A;  3IS9 A;  4CHZ A;  4RW4 A;  1WSJ A;  2D0A A;  1LWE A;  4CJW A;  1VSD A;  4F3T A;  3KK1 A;  3CM6 A;  4QAG A;  4Z4H A;  3QIP A;  5J1E A;  4CEQ A;  1RBU A;  2YV0 X;  1DLO A;  2KQ2 A;  4FLW A;  4KHN A;  3D45 A;  2YNH A;  1RT1 A;  3AO3 A;  3LP0 A;  3OYE A;  1J9A A;  5CYQ A;  3KLF A;  3KJV A;  1CZB A;  1VRT A;  1SKS A;  1X1P A;  4FK2 A;  1L3S A;  3KLG A;  4M41 A;  4CJE A;  4O44 A;  2HNY A;  3TAB A;  3L2V A;  4KI4 A;  2DFF A;  4FZX C;  4RG8 A;  4C8N A;  4W5R A;  4DU1 A;  1UWB A;  4XIU A;  1NKE A;  2QK9 A;  1YTA A;  4E1N A;  4DTM A;  1JL2 A;  2G8F A;  5T7B A;  5J2M A;  2FBX A;  4CEB A;  3PV8 A;  1LWC A;  1C1C A;  3LAN A;  5HRR A;  4CER A;  1EKE A;  4HCC A;  1FKP A;  2FC0 A;  3D0P A;  3V9U A;  3L2R A;  4O0J A;  4KPY A;  1QE1 A;  1S1V A;  3DLG A;  2D5R A;  4Z4I A;  1ZBF A;  1GOC A;  3TAF A;  1TKD A;  3V1Q A;  3DOK A;  4DG1 A;  4Z0U A;  1D8Y A;  3VN5 A;  3DRS A;  3ZSW A;  1L5U A;  4ELV A;  4FJ7 A;  3I0S A;  4EZ9 A;  4L8R B;  3NF6 A;  3MXJ A;  3LPU A;  4KKO A;  4FJ5 A;  1ASV A;  4CGI A;  4HUE A;  3BGR A;  4LH4 A;  3TAN A;  4J2E A;  3TAG A;  3ZSV A;  4N76 A;  3KIO A;  3OYD A;  4DLE A;  4DU3 A;  3QEP A;  1RTJ A;  4IFV A;  3AA4 A;  4E7I A;  2VWK A;  3KK2 A;  2HVH A;  1RDC A;  3A2F A;  4IFY A;  3V81 A;  4IKF A;  4OLB A;  1JXE A;  3G10 A;  1TKX A;  4CFC A;  1EET A;  3F73 A;  1NK4 A;  2QKB A;  4CES A;  3AO5 A;  3VQB A;  1NOZ A;  1NK5 A;  3AA5 X;  3SI6 A;  1GOB A;  2G8H A;  4KHY A;  3NGZ A;  2BAN A;  3C95 A;  1RT7 A;  2IGI A;  3DLB A;  4O0I A;  1KVC A;  5I3U A;  4FYD A;  4CIG A;  4N56 A;  5J2N A;  4FJ8 A;  2A1S A;  2OPR A;  1GOA A;  1HQU A;  4HHT A;  1BQN A;  4CJ4 A;  4KTZ A;  5C24 A;  1N6Q A;  1JLE A;  1IG9 A;  4AHR A;  1SL1 A;  1RTD A;  4B9M A;  4RW9 A;  1BI4 A;  2RN2 A;  4WE1 A;  5HRN A;  2DY4 A;  3SQ2 A;  4E7K A;  3QET A;  1REV A;  4DQI A;  1NK6 A;  3KLI A;  1WSH A;  3OYH A;  3TAQ A;  3NCI A;  1BL3 A;  4OKJ A;  3HM9 A;  3TI0 A;  4F4K A;  2FBY A;  4EP4 A;  2D0B A;  4CJS A;  1KLM A;  2VG7 A; 
#chains in the Genus database with same CATH topology
 4FVU A;  3C94 A;  4B8C A;  2B5J A;  2Q0R A;  1V4T A;  1DT9 A;  4BVO A;  1RBR A;  4JYA K;  4HWI A;  4FM1 A;  3VQ8 A;  1BCO A;  3C6A A;  3CC2 N;  1LAV A;  4LD0 A;  4DQQ A;  3QO9 A;  4J8F A;  2E4L A;  3SLC A;  3P4I A;  1VSJ A;  4DTO A;  4C8L A;  3U9Z A;  4B1W B;  2GBZ A;  3MN6 A;  4JI7 K;  5AJ3 K;  4FSV A;  2HHH K;  4CED A;  3MK6 A;  1I94 K;  4U67 L;  5KTQ A;  3HXM A;  3RMB A;  3CYM A;  2W40 A;  2F8S A;  3LAM A;  3DRP A;  2G8K A;  2YHW A;  4CEA A;  2RE2 A;  1JLC A;  5M1O A;  4B1X B;  3UKU B;  4EAH D;  3RSE B;  3MXI A;  2E88 A;  4YOX A;  5GAG P;  1WLJ A;  2KLA A;  4CJQ A;  5JVH L;  1C0T A;  3C6U A;  3OJS A;  1Q9Y A;  4AHS A;  4CEZ A;  3O3F A;  2Q97 A;  3HTV A;  4RWT A;  4FXD A;  4K8X A;  4CEC A;  5KPZ A;  4Y1C A;  2O8B B;  4DTJ A;  4GNI A;  4WFN L;  3TAP A;  1KQS M;  3NH2 A;  1E4G T;  5F0X A;  2KW4 A;  1X3M A;  5AQR A;  2KZM A;  3D2F B;  5CY4 A;  1RT2 A;  4H4M A;  5DK5 A;  3U3Y A;  3VET A;  2YHY A;  1B92 A;  3BP8 A;  2IC3 A;  2QWM A;  4NCA A;  3SAH A;  2E5L K;  3VES A;  2ETJ A;  5TKY A;  4JD2 B;  3TWH A;  3DJC A;  4KH6 A;  3HVR A;  4H5N A;  3NH0 A;  3SUP A;  3EO3 A;  3T3F A;  4B3T K;  4JS5 A;  4WQ4 C;  1U47 A;  3MCA B;  3U4L A;  3THW B;  3VF4 A;  3A8Y A;  3VQ5 A;  3L0Q A;  1KAX A;  3HJF A;  3LAL A;  3CCR N;  2G8W A;  1KVB A;  5LJW A;  3THV A;  5KPR A;  2FBT A;  4BRF A;  3VEN A;  3UB5 A;  1BIS A;  5J2Q A;  3SNN A;  2F4V K;  3F5T A;  3ZSZ A;  3M8Q A;  3ENB A;  4MLE A;  4OGC A;  1LWF A;  2B6A A;  3VTH A;  3FFK B;  1FXX A;  3VQQ A;  5EU7 A;  5EVZ A;  1UA0 A;  2O8D A;  1HYV A;  2BH1 A;  1XHX A;  2X78 A;  3WUH A;  3SJJ A;  1LCU A;  4KB1 A;  2ZE2 A;  3H1Q A;  3TAR A;  2E2P A;  3DMJ A;  4GW6 A;  5HRP A;  1JCE A;  1HUX A;  4DV5 K;  5M1Q A;  4J2A A;  1TAQ A;  3DLK A;  3RWU A;  5FPD A;  1YIJ N;  2P9U B;  3KWG A;  1KAY A;  4G1Q A;  3P31 A;  4Z4C A;  2XY8 A;  4ISG A;  3KLH A;  2NZT A;  4FW2 A;  1XI1 A;  4JI0 K;  1QTM A;  4CHY A;  3W0L A;  1NGD A;  1DGK N;  3AVM A;  1Q9X A;  4LFC K;  4DFM A;  1NK0 A;  2KZZ A;  1D9D A;  2VGM A;  5HOO A;  4IO9 L;  4IDK A;  2A40 A;  3O9U A;  5JVG L;  3CCS N;  5C42 A;  5FRN A;  3GL1 A;  4Z94 A;  2BTF A;  4M3X A;  5EY4 A;  1G15 A;  1VSE A;  3AVH A;  4ELT A;  3M8S A;  4BRL A;  3A5O C;  2NRV A;  2OCE A;  5IWA K;  3HI0 A;  3MAQ A;  4XEI A;  1YF5 L;  3QIC A;  3PIO L;  3DWL A;  2NUB A;  3EZ5 A;  1IKV A;  5JIC A;  4M3Z A;  4K0K K;  1KFD A;  4EHU A;  3DOL A;  1QVG M;  1HPM A;  2O4I A;  3PO5 A;  5JS2 A;  4BQZ A;  1BHL A;  4DV1 K;  2YJE A;  4KRF A;  5AZI A;  1TK5 A;  1TK0 A;  4BRO A;  3SQ1 A;  3ALY A;  1JJ2 M;  1WAJ A;  4A2A A;  3CJA A;  2AJQ A;  2UUC K;  1JL1 A;  4QOZ B;  1DTT A;  3T19 A;  1Y97 A;  1RBT A;  4CGJ A;  1UA1 A;  1NK9 A;  4E7H A;  4B3M K;  1XUP O;  1JLA A;  2KTQ A;  3BEX A;  1SS6 A;  3FZF A;  4ISE A;  5AQG A;  2X74 A;  5DM7 L;  3AV9 A;  4YDU C;  3CI5 A;  4DR4 K;  3LZI A;  3DXK A;  1BCM A;  4YOV A;  4CHQ A;  1RNH A;  3CQX A;  2D0C A;  3FFI A;  3ZT4 A;  3O1W A;  4JHD A;  3V1R A;  4I7F A;  1Q82 O;  1S1U A;  4PL7 A;  1RCH A;  3MEE A;  1SV5 A;  2D1K A;  3AVI A;  4LF7 K;  3K5O A;  4OLA A;  1RT3 A;  4JKA A;  3K9K A;  3HP9 A;  1IG8 A;  1VSK A;  5AQS A;  4FLZ A;  4UQG A;  3KK3 A;  4BAC A;  4R79 A;  5C2F A;  4EIA A;  4A5A A;  3ZT0 A;  3OJU A;  1OH6 A;  4DB3 A;  3HL8 A;  2D0O A;  3EKU A;  4W5N A;  5CYM A;  3O3H A;  3LDP A;  5AQK A;  5M1F A;  3I33 A;  1NKC A;  3V6D A;  1HNX K;  1ZXO A;  3KK7 A;  3QNO A;  4M3R A;  2O4G A;  3EE9 A;  3NE6 A;  1C1B A;  5FRM A;  4CGG A;  5DMR A;  2ASP A;  1WB9 A;  2HND A;  4LC9 B;  3QEW A;  2YKN A;  5LL6 Z;  4WFA L;  3I8B A;  3KTQ A;  2HBJ A;  3OYA A;  4DR1 K;  5C0Y A;  1LV5 A;  4GKK K;  4RW6 A;  5AQU A;  1EXQ A;  1LW2 A;  2ZWH A;  3H6E A;  4F3O A;  2I5J A;  4FWQ A;  2PYJ A;  4FWP A;  4DKW A;  3SV4 A;  2E2N A;  4FJH A;  3LAK A;  3L4I A;  4E89 A;  4IOA L;  4BDP A;  3MN5 A;  4HUF A;  5AZJ A;  4JRP A;  5AFU H;  3D2E A;  1NJW A;  4M7X A;  3U8X A;  2JWK A;  1IV0 A;  4FWK A;  4LH5 A;  2QW9 A;  1KXP A;  4C23 A;  3IMX A;  4F2R A;  4B9N A;  1W7A A;  3M5R A;  4H4O A;  4DFP A;  2Z1I A;  3DLH A;  2OTL N;  3AVG A;  4RW7 A;  4CHO A;  1YT3 A;  3RTV A;  1XC9 A;  2F8T A;  3HPO A;  1V4S A;  4BE1 A;  4FLT A;  4PKH A;  2YNG A;  1K6Y A;  1S1T A;  2CGL A;  4F8R A;  3FZL A;  3WXI A;  3ZET B;  2P9I B;  4OVL A;  2HF4 A;  4RW4 A;  1WSJ A;  2D0A A;  1LWE A;  1IBM K;  3CM6 A;  4QAG A;  1T6D A;  1RBU A;  3D45 A;  3SMS A;  2HOE A;  3OYE A;  2O8F A;  1SKS A;  1VRT A;  1X1P A;  4BC3 A;  1L3S A;  4M41 A;  4YOR A;  3L2V A;  1XNQ K;  3VMF B;  1QVF M;  1NKE A;  3ULE B;  1NMD A;  5J2M A;  3OW2 M;  3TTC A;  5HRR A;  4CER A;  4CD3 A;  2D5R A;  4DG1 A;  4OO1 J;  5JLF A;  3VN5 A;  3ZSW A;  1CZA N;  3MN9 A;  1VQ8 N;  3ZX2 A;  4EZ9 A;  4L8R B;  4FJ5 A;  4A61 A;  4GV9 A;  3CQY A;  2W6K A;  4JEP A;  4A5B A;  4UY8 O;  4N76 A;  3OYD A;  1RTJ A;  4FOE A;  4E7I A;  3C65 A;  2VWK A;  3V81 A;  4DUY K;  1JXE A;  1TKX A;  3F73 A;  4DV0 K;  4CES A;  3QBX A;  3VQB A;  1GOB A;  1DKG D;  3J81 O;  2G8H A;  2GTD A;  3DLB A;  1KVC A;  2ZGY A;  4N56 A;  4FJ8 A;  4HHT A;  1NBW A;  4KTZ A;  1N6Q A;  3GE1 A;  2H3G X;  3THX B;  1IG9 A;  4RW9 A;  2RN2 A;  2DY4 A;  4E7K A;  4DQI A;  4NXN K;  3KLI A;  1BWF O;  1BUP A;  2HBK A;  3CIP A;  3NCI A;  1BL3 A;  2VQF K;  4WQ4 A;  1N34 K;  2UUA K;  4EP4 A;  2D0B A;  4IXC A;  1IBL K;  1KLM A;  2Q2R A;  1TKZ A;  3RMD A;  1OH5 A;  5AQY A;  1JCF A;  3NMU A;  3UKR A;  1C6V A;  2E1Y A;  2P9K B;  5M1P A;  5AFU A;  3P39 A;  4X65 K;  1N33 K;  4BG8 A;  1GLC G;  3DLR A;  4CBW A;  2JLE A;  4CE9 A;  3AA2 A;  2ZM6 K;  2VYP A;  4V19 S;  2P9P B;  4JI4 K;  5LMN K;  4E7L A;  3FLC O;  2I7P A;  3SQ4 A;  3KD1 E;  1RIL A;  4FJ9 A;  2HW3 A;  5SWM A;  3CFR A;  4H5W A;  3OBY A;  1VSM A;  3O8M A;  3SUQ A;  3NHG A;  2D4W A;  3K5N A;  5FPE A;  3K58 A;  1C1A A;  2PY5 A;  4O5B A;  2OPS A;  4FWR A;  4DCH A;  1QZ6 A;  3HBT A;  3HM8 A;  1L3T A;  1KVA A;  1OVY A;  1EWR A;  3VEW A;  3RR7 A;  1T44 A;  3QIN A;  1VSF A;  1VHX A;  4MQ3 A;  3AO1 A;  5BR9 A;  4FM2 A;  4CCH A;  1YJN N;  3QES A;  4FJX A;  1SL2 A;  3SAG A;  1S22 A;  1HNI A;  5AQQ A;  1U2V B;  3NF8 A;  1X9W A;  3PX6 A;  4DSI A;  1C0U A;  4CF2 A;  3VEY A;  4E1M A;  1ITG A;  3ZSY A;  4NLC A;  4FJN A;  2F9W A;  1ZYQ A;  4H0T B;  5F2R A;  4BR5 A;  5AR0 A;  4F9O A;  4R5P A;  1NGE A;  4BRM A;  4B9L A;  4CZK A;  2Z1G A;  3PO4 A;  3V4I A;  5CR4 A;  3TAE A;  4DF4 A;  4Z4F A;  4FJI A;  3VGL A;  3M1F A;  2LSN A;  4E0D A;  3ATU A;  1RBV A;  2P9S A;  1QQN A;  4JS4 A;  2X6S A;  2ZQB A;  3E9L A;  1RBS A;  4KHS A;  3G4S N;  3BZC A;  4H0Y B;  2VGN A;  4BDZ A;  5M1N A;  4OKK A;  3U9D A;  2E8A A;  2A3Z A;  1D9F A;  4OJR A;  3WNE A;  2VWB A;  4CFD A;  5JS1 A;  1QSS A;  4DTS A;  1U4B A;  3G25 A;  4L3Q A;  3AVJ A;  2GWJ A;  1B9D A;  3L2Q A;  4E19 A;  1HKC A;  4ILH A;  4BRQ A;  3L3V A;  3THY B;  5EOY A;  1U48 A;  4KRE A;  3AO4 A;  4A59 A;  1BG3 A;  1BGX T;  3R6M A;  3C0B A;  1RDU A;  3UKU A;  3RSE A;  4IG0 A;  4DTX A;  3ENH A;  2P9S B;  3FGU A;  3T1Y K;  4K41 A;  3L2W A;  3TAM A;  3SCX A;  3OYI A;  1QHT A;  4WQ5 A;  1VQ4 N;  4BRE A;  3ZT1 A;  2HNZ A;  2YNF A;  2PAV A;  3WXM B;  1LW0 A;  2JGU A;  3OYK A;  4BRC A;  3HOT A;  3ZCM A;  2O8B A;  4BR2 A;  1X9M A;  2V7Z A;  1MWM A;  1U6Z A;  2OA8 A;  2J4R A;  3D2F A;  2VG6 A;  1MA9 B;  4CJ7 A;  1QQO A;  1NU0 A;  1RDD A;  3UE5 A;  1FK9 A;  1RDB A;  1VQ7 N;  3CCU N;  4W5Q A;  4N41 A;  3V1O A;  2G8U A;  1HLU A;  4JD2 A;  1SAZ A;  1JLG A;  2V51 B;  3RRG A;  4KI6 A;  4B3S K;  2F96 A;  3N4P A;  4M7Y A;  4PY5 A;  3QFU A;  4FK4 A;  2A6A A;  2OAN A;  3M8P A;  3OYC A;  3H1V X;  4AHV A;  1Z26 A;  4DV6 K;  1QSL A;  2UUB K;  4BY9 C;  2HST A;  2A41 A;  3JS6 A;  3THW A;  5CE3 A;  3NBP A;  1RTH A;  3VA3 A;  3PY8 A;  4KB0 A;  3CFP A;  4FWL A;  2Z1J A;  3AAQ A;  3ZSR A;  3S3N A;  5JMV A;  1BDG A;  3VF6 A;  1Y64 A;  4IO8 A;  3PUF A;  2QM1 A;  4PWD A;  3BZK A;  2IOC A;  4M42 A;  3B6O A;  3WQT A;  3AVB A;  4PQU A;  3ITH A;  2O8E B;  3P5J A;  2O8C A;  1JXB A;  2FF3 B;  3LP3 A;  3HPG A;  1HYS A;  1UOC A;  5C25 A;  3M3Z A;  1W0H A;  4CW7 B;  1HJR A;  2FSN A;  4QCL A;  3VF2 A;  1CLQ A;  1C0M A;  3VGM A;  2P51 A;  4DU4 A;  1Q7Y O;  1HR0 K;  2KKZ A;  1D5A A;  3K9J A;  1T05 A;  5AQT A;  4N5S A;  4RW8 A;  5HRS A;  3QEI A;  3IAY A;  3AO2 A;  5MLC Q;  2P9U A;  4YOY A;  3OYF A;  2XHB A;  1J54 A;  2KFN A;  5KRS A;  4ZHR A;  1N36 K;  4WFB L;  3CCE N;  3NH1 A;  3I55 N;  3CCJ N;  3SPY A;  1NG9 A;  3J7Y P;  1KTQ A;  4CFB A;  2O8C B;  4RCH A;  2IS3 A;  4DTN A;  4AHU A;  3CCM N;  4I2Q A;  3MEC A;  5KPT A;  4ID1 A;  4AM7 A;  3T7Z A;  3F9K A;  3CMA N;  2P5G A;  3MEG A;  1RGI A;  4BRN A;  1NKB A;  1HNV A;  4I6M B;  4B1U B;  4FPA A;  4KH5 A;  1NLV A;  3CPW M;  4ICL A;  3U3G A;  3VGK A;  4MLH A;  1TUU A;  3VQ7 A;  1R0A A;  1NJI O;  2Q1N A;  2G8I A;  1HNW K;  1A5W A;  3WNF A;  4A62 A;  4AHT A;  3ZSQ A;  3OYB A;  3TTD A;  2XY5 A;  3WNG A;  4B1V A;  2IAJ A;  1IKW A;  3AAR A;  1RT6 A;  1U45 A;  4JKG B;  5AQN A;  3MWT A;  4FLX A;  1P8Z A;  3I0R A;  1XQS C;  4DS5 A;  1C0F A;  2GEL A;  3S9H A;  4KTQ A;  1KSP A;  3KVG A;  5HP1 A;  1NOY A;  4CJT A;  5BR8 K;  1HYZ A;  3R9P A;  4BRD A;  1LOT B;  4JNE A;  4W5O A;  4KHQ A;  3VEZ A;  3O5B A;  4CJR A;  4DV2 K;  3TSU A;  3ZSX A;  4XH5 A;  3CHW A;  5BRH A;  2YHA A;  4CIF A;  3A5L C;  1NGH A;  3Q7B A;  5BRE A;  3DXM B;  4MO4 A;  3DM2 A;  3QEV A;  1SQK A;  4J2D A;  5BRF A;  2KFZ A;  4MFB A;  3IG1 A;  1IKX A;  4JKD A;  1EO1 A;  1VQ6 N;  2P9L A;  1JCG A;  2A42 A;  3NGI A;  3CC4 N;  2XRI A;  5AQO A;  2GX9 A;  1HX1 A;  3QIP A;  3FZK A;  5HL7 L;  4JK9 A;  5BN8 A;  3AO3 A;  1J9A A;  1IJJ A;  4JKC A;  5CYQ A;  3KJV A;  4JK7 A;  3CPE A;  3KLG A;  4KBO A;  4O44 A;  1GLB G;  2HNY A;  4CJE A;  5JLH A;  4WQ5 C;  2DFF A;  4C8N A;  4W5R A;  2QK9 A;  1UWB A;  1YTA A;  4XH4 A;  2UYT A;  4DTM A;  4PHT X;  2G8F A;  2FBX A;  3D7E O;  4K43 A;  4CEB A;  3PV8 A;  5BPN A;  1FKP A;  3V9U A;  4O0J A;  1S1V A;  3DLG A;  4QS8 A;  1GOC A;  1HJO A;  3V1Q A;  1D8Y A;  4FJ7 A;  4WYB A;  2QWL A;  2P9L B;  3LPU A;  3WXJ A;  1J5E K;  1N32 K;  1ASV A;  1QQM A;  3ZSV A;  4DU3 A;  3MCP A;  4IFV A;  2D0P A;  5E84 A;  3ENO A;  4IOC L;  4IFY A;  2WC9 A;  4OLB A;  1EET A;  3DAW A;  1D4X A;  3SK3 A;  4H5V A;  1GLD G;  4KHY A;  3C95 A;  1RT7 A;  2IGI A;  4FYD A;  3F9M A;  1X9J A;  1NGC A;  4O8U A;  3T69 A;  1YHQ N;  1JLE A;  2ZF5 O;  5GAD P;  1SL1 A;  4B9M A;  3QET A;  2PFU A;  1WSH A;  3FZM A;  3TAQ A;  4DR7 K;  1M1K O;  4OKJ A;  4BC5 A;  2FBY A;  4CJS A;  5GIP A;  4DQP A;  2VQE K;  3IDH A;  3NGY A;  4DS4 A;  3G0Z A;  3RMC A;  4DR3 K;  3LWM A;  3J7Z O;  1SKW A;  3ZET A;  2P9I A;  3TU5 A;  4AH9 A;  3K5L A;  3VEV A;  1BQM A;  1QS4 A;  4FOI A;  4LY7 A;  4DTR A;  3OS1 A;  2CGJ A;  1I3A A;  3CCV N;  4YY3 K;  3KLE A;  3HST B;  4IBN A;  4CJP A;  4WF9 L;  4KH4 A;  5E41 A;  3SJH A;  2FSK A;  3ULE A;  1Z05 A;  4IEI A;  3TR8 A;  1BA0 A;  2DFH A;  2BE2 A;  4NYF A;  1ASU A;  4FVM A;  2G8V A;  1JLB A;  3CF5 L;  1G99 A;  2ITG A;  1NK8 A;  1VQM N;  2ASO A;  3DI6 A;  2QWP A;  1LAW A;  4GV3 A;  2CGK A;  4Q0B A;  4PA1 A;  1FJG K;  5BPL A;  5K14 A;  3AGK A;  5AQV A;  2WBN A;  1VQK N;  1T03 A;  1Q8I A;  3AA3 A;  3ZX0 A;  3LP2 A;  5D3G A;  4AHC A;  3C6T A;  1XNR K;  3AVL A;  3ATV A;  3G6E N;  4FLV A;  3SQ0 A;  4CZI A;  4BRP A;  1N5Y A;  2ATQ A;  1WBB A;  1L3U A;  4JI1 K;  2HHW A;  1S1W A;  1ATN A;  1XC3 A;  4RTF D;  5AQH A;  4OKE A;  3THX A;  2HBL A;  1GLE G;  2WTU A;  3ID8 A;  1IBK K;  3AVF A;  3VQ4 A;  4DQ8 A;  3NVM A;  5F1X A;  3SZ2 A;  4FJG A;  3O4Q A;  3OY9 A;  4C8M A;  3SV3 A;  3L2U A;  2NLX A;  2V7Y A;  4ZTF A;  4PL8 A;  4LSN A;  3J8A A;  5CZ1 A;  2P9K A;  4XH1 A;  3NF7 A;  4CZH A;  4CF0 A;  4CK2 A;  1GLJ O;  5C2D A;  3H45 C;  1I39 A;  1HKG A;  2ZJQ L;  1WAF A;  3LWL A;  1N8R O;  5AQM A;  2IVN A;  1B9F A;  2P9P A;  4OPH A;  1MWK A;  1TYQ A;  3HO1 A;  1JKH A;  4TSX A;  4CFA A;  5B8H A;  3H3N O;  2E6L A;  3QML A;  2QTD A;  3UIQ A;  1S1X A;  1U04 A;  3BF1 A;  2P1J A;  1CZ9 A;  3PSI A;  1Z25 A;  3I56 N;  4CZL A;  1CXU A;  1WN7 A;  4M3W A;  2VWJ A;  1WSI A;  1HPZ A;  3ASM A;  4DFJ A;  5C12 A;  1JLF A;  1S5J A;  4DSE A;  3SUO A;  2GEM A;  2OZM A;  4M3U A;  3DLE A;  2PBD A;  2NRH A;  3OHR A;  1U2V A;  4B3R K;  4BGB A;  2RHK A;  3I8D A;  4H8K A;  4Q5V A;  3O4N A;  1TYQ B;  1T8E A;  3CER A;  2QXL A;  3OTO K;  4DSK A;  4NYN A;  2OPP A;  3V9Z A;  3T1A A;  1WOQ A;  4Z4G A;  3QER A;  1SUQ A;  1NJY A;  2YHX A;  3OYL A;  1X9S A;  3OYG A;  3OYJ A;  1RTI A;  2YX6 A;  3O9Q A;  1VQ5 N;  3O6W A;  1JLQ A;  3ZEU B;  4BDY A;  4B9V A;  4JRQ A;  4DTU A;  4OPK A;  1NGG A;  4B9Q A;  4E7J A;  1ESV A;  4N47 A;  5FLX O;  4FCY A;  3O1B A;  5AQF A;  2P9N B;  3CJ1 A;  3V9W A;  1W9H A;  1Q81 O;  1NWK A;  4CF1 A;  3K57 A;  4BC2 A;  3QLH A;  2EHG A;  2RKI A;  4LF4 K;  1VK0 A;  2IVP A;  3MED A;  4B9S A;  4YNQ A;  1TKT A;  1K8K B;  3E66 A;  1WSE A;  4IJN A;  1NGF A;  1XWL A;  1EWQ A;  3CJC A;  1VSL A;  4LF5 K;  1M90 O;  4CJ3 A;  3THY A;  1IO2 A;  4AIL C;  1YI2 N;  3K5M A;  3L4Q A;  4GMJ B;  4JKE A;  4HVJ A;  1FKO A;  1YIT N;  1VQ9 N;  3VEX A;  2UXD K;  1TAU A;  4GV6 A;  4J2B A;  2V52 B;  3P83 D;  3NDK A;  3V9S A;  3HSC A;  5FRO A;  1WBD A;  4DV3 K;  2XO7 A;  3HT3 A;  4C8K A;  4I9Q A;  4IJA A;  3KKR A;  2Q36 A;  4CK3 A;  2QWO A;  3VTI A;  3HPH A;  1HRH A;  4FLY A;  2IDO A;  3MX2 A;  1XMQ K;  4IDH A;  1SL0 A;  3LL3 A;  5I42 A;  3C6H A;  2OPQ A;  2GUP A;  3OA9 A;  3CCQ N;  2YKM A;  3B8A X;  1UAX A;  2E1Z A;  5AQW A;  1VQL N;  4CBX A;  3VA0 A;  2JWL A;  2E20 A;  2UXC K;  5BN9 A;  3ULD A;  1Q86 O;  2FSJ A;  4ILJ A;  4W5T A;  3OYN A;  3FE1 A;  2HHV A;  4BVP A;  2NRX A;  2PZS A;  1ZBU A;  4WCE L;  4FJJ A;  3L3U A;  1VQN N;  3JAM O;  3ZSO A;  3E01 A;  3DYA A;  4H5T A;  3C7N B;  4C1N I;  1EP4 A;  2RPI A;  3EE8 A;  2NRT A;  2E2O A;  3SAF A;  5EX5 A;  3SYZ A;  3KWI A;  3HOS A;  2XY7 A;  3H46 O;  4BE0 A;  5J2P A;  3NFA A;  4CEF A;  4F2S A;  3EY1 A;  4C8O A;  3VQ6 A;  5KI6 A;  1E4F T;  4CIE A;  4I2P A;  4KV8 A;  3OBW A;  5C10 A;  5LMU K;  3O9S A;  3WXL A;  1YJ9 N;  3LM2 A;  3U6F A;  4DHY A;  2O8E A;  2VG5 A;  3R8E A;  3WEE B;  3M6G A;  5AQI A;  3CM5 A;  1T3V A;  3MXM A;  4JV5 K;  2Z1H A;  5HBM A;  4CJL A;  3N4Q A;  4O4G A;  3VQA A;  3RVC A;  3TTF A;  1RT4 A;  4BRA A;  2E6M A;  5KQD A;  3HP6 A;  5AQX A;  5ADX H;  1NNE A;  1X3N A;  4E3S A;  1S72 N;  1WSF A;  5TKW A;  4FZZ A;  5SZT A;  4CZE A;  4DFK A;  3M8R A;  2B4J A;  4FO0 A;  2I7N A;  3LDL A;  3VQP A;  3LZJ A;  1TGO A;  4FK0 A;  5GIO A;  4BR9 A;  4NCG A;  2F9T A;  1QSY A;  5CZ2 A;  4O55 A;  4EFH A;  1ZBL A;  4CJF A;  3CET A;  1CXQ A;  3VQC A;  4X62 K;  1ZBI A;  1A5V A;  1TVR A;  3DLL L;  1HKB A;  4BR7 A;  1SKR A;  4ZTJ A;  1W2B M;  2F7T A;  3IS9 A;  4CHZ A;  3BY5 A;  1FW6 A;  1OVQ A;  4F3T A;  3F2K A;  4CEQ A;  2YV0 X;  4KHN A;  1DLO A;  4AQY K;  4FWN A;  1RT1 A;  3KLF A;  4FK2 A;  2QWQ A;  1MDU B;  4I6M A;  4KI4 A;  2NRZ A;  4RG8 A;  3ZLJ A;  4E1J A;  1NGJ A;  3VER A;  4U7B A;  1LWC A;  1C1C A;  3LAN A;  5A2Q O;  4HCC A;  3J80 O;  2FC0 A;  5LY3 A;  4KPY A;  1QE1 A;  1ZBF A;  4A57 A;  4JKH A;  3DRS A;  3I0S A;  4JKG A;  3L6Q A;  4FPB A;  3MXJ A;  4KKO A;  3CJB A;  2GWK A;  4FL9 A;  4CGI A;  1OH7 A;  4IOX A;  3BGR A;  3TAN A;  1KC8 O;  4J2E A;  4NO7 A;  3TAG A;  3KIO A;  2OTJ N;  3P38 A;  3AA4 A;  2W6L A;  2HVH A;  3A2F A;  3MMV A;  3E9P A;  4CFC A;  1NK4 A;  2QKB A;  1H1V A;  3AO5 A;  3SBT A;  3SI6 A;  3O4W A;  2BAN A;  5GAH P;  1YAG A;  5GIN A;  4CIG A;  5J2N A;  1BQN A;  3O80 A;  5E26 A;  5C24 A;  4BC4 A;  1RTD A;  3JXU A;  1BI4 A;  4WE1 A;  4GY2 B;  5HRN A;  4JN4 A;  3NVK A;  1ZC6 A;  3OYH A;  3DXM A;  4NB4 A;  3E9O A;  3CCL N;  1EQY A;  3CG7 A;  2VG7 A;  2AP1 A;  4Y1D A;  1IKY A;  3EYZ A;  2YHB A;  3BDP A;  3AVN A;  1TV6 A;  4FLU A;  1NGA A;  4EHT A;  3CJ9 A;  2OYQ A;  4BRH A;  3AAP A;  4NLB A;  1L3V A;  2HMI A;  3MX5 A;  3DRR A;  2Y1J A;  3RR8 A;  4FJL A;  4CK1 A;  1S9G A;  3D6R A;  5ADX A;  3PSF A;  5BPM A;  5H1S Q;  3CXC M;  4BRG A;  1VRU A;  3PX4 A;  2O8D B;  3H08 A;  4B9T A;  2FBV A;  4CJV A;  3CC7 N;  1BI4 B;  1T6C A;  4GVE A;  3VQE A;  4KTW A;  3L8B A;  2BDP A;  3JSM A;  4HTU A;  4DQS A;  4CD1 A;  2CH6 A;  4CEE A;  1U49 A;  1BIU A;  4JLH A;  4CBU A;  1IH7 A;  1W97 L;  3QBW A;  4M63 C;  3KD5 E;  3LP1 A;  1K73 O;  2YCH A;  3PLA A;  1VAZ A;  2HBM A;  2AA4 A;  3EL2 A;  3G71 N;  2Q31 A;  1RDA A;  4I9L A;  4ELU A;  2BUP A;  5LJV A;  1NMN A;  1RFQ A;  3LDS A;  4CJK A;  4DSL A;  3KZB A;  4CF8 A;  2WOM A;  2IVO A;  3KKS A;  3ZT2 A;  4DR2 K;  4B08 A;  4JKF A;  1S9E A;  3MDQ A;  2NNW A;  1K9M O;  3ZT3 A;  4CI6 A;  4JI2 K;  4B3O A;  1EX4 A;  1C0G A;  3ISN C;  4DMN A;  3P1G A;  4KFB A;  1ATS A;  1NGI A;  1J6Z A;  3A5N C;  3TSQ A;  5FDL A;  4BWJ A;  3QDK A;  3AGR A;  3HYF A;  2FF6 A;  4X64 K;  3HZ6 A;  3RRH A;  4GVM A;  3EEQ A;  4DWI A;  4YOT A;  3BUZ B;  1YVU A;  4DV4 K;  2YJF A;  3OS0 A;  1ASW A;  2ASM A;  4CGH A;  1TL1 A;  4GKJ K;  3AVC A;  1O13 A;  1HMV A;  4KHU A;  4B9U A;  1DEJ A;  1ATR A;  1KD1 O;  2EX3 A;  5AZI B;  1A5X A;  3CJ7 A;  4CZJ A;  4DQR A;  1TL3 A;  1VQO N;  3H3O B;  2R7Y A;  4IWV A;  4PUO A;  4MO5 A;  3WT0 A;  2DFE A;  4CJ5 A;  4M45 A;  2FLO A;  4EZ6 A;  4OGE A;  4CGF A;  3S3O A;  3QNN A;  2HHQ A;  4C1N K;  1XHZ A;  3K59 A;  1O1W A;  3VQ9 A;  3JYT A;  3Q7C A;  4IFE A;  1WUA A;  3A0I X;  3AVK A;  4LF6 K;  4FWS A;  4Z4E A;  4OPJ A;  4YHH K;  4LSL A;  3CFO A;  4K8Z A;  5AQJ A;  3V9X A;  4BWM A;  1NGB A;  3IFR A;  4FM0 A;  2YNI A;  3DXK B;  2GUI A;  2VCP A;  4FWO A;  4JHD B;  3SUN A;  4NCB A;  4HUG A;  3LDN A;  4ISF A;  1Q18 A;  4DF8 A;  4M3T A;  4BRI A;  5EXW A;  5FPN A;  2DTU A;  1NJX A;  4KAZ A;  2WFB A;  3BF3 A;  4CHP A;  2HB5 A;  1BOT O;  3HRG A;  3EZW A;  2W41 A;  5KQ8 A;  2Y1I A;  1HQE A;  1KLN A;  4BGA A;  1J5O A;  2KHO A;  4JI6 K;  1DTQ A;  3LDQ A;  3IRX A;  3OYM A;  3SPZ A;  1BIZ A;  4PKI A;  3KHY A;  5ELZ A;  3QEX A;  4ID5 A;  3CD6 N;  4CZF A;  3WNH A;  4YOW A;  1OKJ A;  1NM1 A;  3WXK A;  3K0S A;  5HLF A;  2QEX N;  3MN7 A;  2A5X A;  1S3X A;  5GAE P;  5I9E B;  3GG4 A;  2ZJP L;  1BU6 O;  3LDO A;  3VQD A;  5AZJ B;  1YTU A;  2HHS A;  2ZD1 A;  2HMP A;  3D2E B;  3HVT A;  2PYL A;  1J53 A;  1ILY A;  1T7P A;  2W42 A;  4K25 A;  4B1Z A;  3NF9 A;  5KGX A;  1Z6R A;  4QS7 A;  2OZS A;  3PIP L;  2HHU A;  4FZY A;  3QB0 A;  4NXM K;  3QFP A;  4CVN E;  4JI5 K;  3S3M A;  4H0P A;  4EP5 A;  4IG3 A;  1KFS A;  4BR0 A;  2Q3S A;  1KCF A;  4CGD A;  3E1Y A;  3HK2 A;  3ZX3 A;  2HHT A;  3LPT A;  2HHX A;  1RT5 A;  3MWP A;  4H0O A;  3GBT A;  2Q0U A;  2WON A;  3ID6 A;  3R3L A;  4KHP K;  2QXF A;  4DSF A;  4KHW A;  3B6P A;  1K8A O;  4B1Y B;  3PX0 A;  4JKB A;  5KGW A;  3AY9 A;  1NK7 A;  1WNS A;  1R59 O;  4KO0 A;  4AM6 A;  2UXB K;  4CEO A;  1ZBH A;  1F21 A;  3OVN A;  4DUZ K;  2O8F B;  3ZEU A;  1OH8 A;  2RF2 A;  4FJM A;  1VSH A;  4YFU A;  3IKM A;  1NJZ A;  4CJU A;  5M1K A;  2ZJR L;  3OS2 A;  2P9N A;  4X66 K;  2A1R A;  2XY6 A;  1RDW X;  2ITM A;  3AVA A;  4M3Y A;  4CZM A;  4OX9 K;  2P5O A;  3K2P A;  4FJK A;  3O3G A;  2IIR A;  3WQU A;  2FXU A;  3CME N;  4A2B A;  2GV9 A;  4QS9 A;  2UU9 K;  4H0V B;  1XMO K;  3A5M C;  2YI1 A;  5KRT A;  4DV7 K;  5AQP A;  1K8K A;  4JK8 A;  1GLL O;  1TK8 A;  4CZG A;  3IUC A;  3EKS A;  4BE2 A;  2BGG A;  2X6N A;  1WSG A;  1S6P A;  3CQ8 A;  4DLG A;  4HCB A;  4H0X B;  2QKK A;  4DR5 K;  3QIO A;  4BRK A;  4B8A B;  4CHN A;  2E2Q A;  1QQC A;  2WUS A;  5HRO A;  1E3M A;  4DTP A;  2QA4 N;  5DM6 L;  1VSI A;  3LM9 A;  3O9R A;  4K42 A;  1MU2 A;  2EWS A;  4CF9 A;  3RMA A;  1ZBS A;  1BO5 O;  4IEE A;  4BG9 A;  1GLA G;  5CHI A;  3VOV A;  4FW1 A;  4IZ9 A;  3S41 A;  3T1H K;  2CH5 A;  3NAE A;  3TSP A;  1BA1 A;  3VEO A;  4G9Z A;  2HVI A;  4ILG B;  1YJW N;  3W3D A;  4DSJ A;  1S6Q A;  3UKR B;  4O5F A;  2QWN A;  1KRP A;  4HTL A;  3FZH A;  4FWM A;  1P90 A;  4CJW A;  1VSD A;  3KK1 A;  4Z4H A;  5J1E A;  3FR0 A;  4FLW A;  2KQ2 A;  3EN9 A;  2YNH A;  3LP0 A;  1CZB A;  2DPN A;  3TPQ A;  4Y0W A;  5AQL A;  4O8K A;  3TAB A;  3ZYY X;  2NRW A;  5BRD A;  3C7N A;  4FZX C;  4DU1 A;  4XIU A;  4E1N A;  1JL2 A;  5T7B A;  1TUY A;  3SBG A;  5AQZ A;  5FPM A;  4AF1 A;  2QI2 A;  1EKE A;  2ZGZ A;  3D0P A;  3L2R A;  1KAZ A;  4Z4I A;  3TAF A;  1TKD A;  3DOK A;  1YUW A;  4H03 B;  4Z0U A;  4MDB A;  1L5U A;  4ELV A;  4OPA A;  3GOI A;  3SMP A;  4LFB K;  4JI8 K;  4LF9 K;  3NF6 A;  4LFA K;  3J7A P;  2HF3 A;  4HUE A;  4LH4 A;  4DLE A;  4YOU A;  3QEP A;  3WEE A;  4BQL A;  3KK2 A;  1RDC A;  1VQP N;  4IKF A;  3O9T A;  3G10 A;  4H5R A;  3VPZ A;  3GDQ A;  1NOZ A;  4PKG A;  1NK5 A;  3AA5 X;  1QZ5 A;  2QWR A;  3NGZ A;  1YVN A;  1YXQ A;  4O0I A;  5I3U A;  1QHA A;  5IT9 O;  2A1S A;  2OPR A;  1GOA A;  1HQU A;  4CJ4 A;  2NRR A;  4AHR A;  4BR4 A;  5C15 A;  3O08 A;  3SQ2 A;  1REV A;  1NK6 A;  4MDA A;  4JAX A;  4DR6 K;  1SZ2 A;  3HM9 A;  1HNZ K;  3TI0 A;  4JI3 K;  4F4K A;  4LF8 K;  1GLF O;  3R1X A;  4YDU A; 
#chains in the Genus database with same CATH homology
 3C94 A;  1TKZ A;  4B8C A;  2B5J A;  4Y1D A;  3NGY A;  4DS4 A;  3RMD A;  1RBR A;  3G0Z A;  1IKY A;  3EYZ A;  3RMC A;  3LWM A;  4FM1 A;  3VQ8 A;  1C6V A;  2YHB A;  1SKW A;  1BCO A;  3BDP A;  3AVN A;  1LAV A;  1TV6 A;  4FLU A;  4LD0 A;  4AH9 A;  4DQQ A;  4B9T A;  3K5L A;  3QO9 A;  2E4L A;  2OYQ A;  1VSJ A;  4DTO A;  4C8L A;  1BQM A;  3DLR A;  1QS4 A;  2JLE A;  2GBZ A;  4LY7 A;  3AA2 A;  4CE9 A;  1L3V A;  2HMI A;  2Y1J A;  3DRR A;  4DTR A;  3RR8 A;  3OS1 A;  4CK1 A;  4FJL A;  4CED A;  1I3A A;  4E7L A;  3KLE A;  1S9G A;  3HST B;  4IBN A;  5KTQ A;  3HXM A;  3SQ4 A;  3CYM A;  1RIL A;  4CJP A;  3RMB A;  3KD1 E;  3LAM A;  3DRP A;  5SWM A;  4FJ9 A;  3CFR A;  2G8K A;  2F8S A;  1VRU A;  1VSM A;  3PX4 A;  3SUQ A;  4CEA A;  3NHG A;  3H08 A;  3K5N A;  1JLC A;  5E41 A;  2FBV A;  1C1A A;  4CJV A;  3K58 A;  2PY5 A;  4O5B A;  2OPS A;  1BI4 B;  3TR8 A;  2DFH A;  3VQE A;  2BE2 A;  4KTW A;  3L8B A;  3MXI A;  2BDP A;  3JSM A;  3CG7 A;  4NYF A;  1ASU A;  4HTU A;  4FVM A;  4DQS A;  1L3T A;  1KVA A;  1WLJ A;  2G8V A;  3RR7 A;  1JLB A;  4CEE A;  4CJQ A;  1U49 A;  1BIU A;  1C0T A;  1VSF A;  2ITG A;  3C6U A;  3AO1 A;  3QIN A;  4JLH A;  1IH7 A;  4MQ3 A;  4FM2 A;  4CCH A;  3OJS A;  3QES A;  4AHS A;  4CEZ A;  1Q9Y A;  4FJX A;  1NK8 A;  3O3F A;  1SL2 A;  3KD5 E;  3DI6 A;  3LP1 A;  4FXD A;  1HNI A;  1LAW A;  4K8X A;  4Q0B A;  4PA1 A;  4CEC A;  5K14 A;  3NF8 A;  1RDA A;  4I9L A;  1X9W A;  1T03 A;  4ELU A;  4Y1C A;  1Q8I A;  4DTJ A;  3LDS A;  3PX6 A;  4CJK A;  4DSL A;  3AA3 A;  4CF8 A;  3LP2 A;  4DSI A;  1C0U A;  5D3G A;  4CF2 A;  4AHC A;  3TAP A;  2WOM A;  3C6T A;  4E1M A;  1ITG A;  3AVL A;  3KKS A;  3NH2 A;  3ZT2 A;  3ZSY A;  2KW4 A;  4FJN A;  4B08 A;  1ZYQ A;  2KZM A;  4FLV A;  3SQ0 A;  1S9E A;  5CY4 A;  1RT2 A;  4H4M A;  5DK5 A;  2ATQ A;  3ZT3 A;  4R5P A;  3U3Y A;  1N5Y A;  1L3U A;  4B9L A;  2Z1G A;  3PO4 A;  4B3O A;  1B92 A;  3V4I A;  2IC3 A;  3TAE A;  1S1W A;  1EX4 A;  4NCA A;  2HHW A;  4QOZ B;  4DQP A;  3ISN C;  4DF4 A;  4DMN A;  3P1G A;  4OKE A;  2ETJ A;  4KFB A;  4Z4F A;  4FJI A;  3TWH A;  3HVR A;  2LSN A;  4E0D A;  3NH0 A;  3SUP A;  1RBV A;  3AVF A;  5FDL A;  4BWJ A;  4JS4 A;  3T3F A;  3HYF A;  3VQ4 A;  2X6S A;  3RRH A;  2ZQB A;  4JS5 A;  4GVM A;  3SZ2 A;  4DWI A;  1RBS A;  4FJG A;  4KHS A;  1U47 A;  1YVU A;  3O4Q A;  3OY9 A;  4C8M A;  4BDZ A;  3OS0 A;  3SV3 A;  3L2U A;  1ASW A;  4OKK A;  4ZTF A;  4CGH A;  1TL1 A;  4LSN A;  1D9F A;  3VQ5 A;  3AVC A;  5CZ1 A;  4OJR A;  3WNE A;  3HJF A;  3LAL A;  1HMV A;  2G8W A;  1KVB A;  4CFD A;  3THV A;  4B9U A;  1QSS A;  4KHU A;  2FBT A;  5JS1 A;  4DTS A;  1U4B A;  2EX3 A;  1BIS A;  3NF7 A;  5J2Q A;  1A5X A;  4CF0 A;  3AVJ A;  3ZSZ A;  4CK2 A;  1TL3 A;  4DQR A;  3SNN A;  3M8Q A;  2R7Y A;  1B9D A;  3L2Q A;  4PUO A;  1I39 A;  4OGC A;  2DFE A;  4E19 A;  1WAF A;  4CJ5 A;  3LWL A;  1LWF A;  4M45 A;  1B9F A;  2B6A A;  3HO1 A;  3L3V A;  1JKH A;  4EZ6 A;  4TSX A;  4CFA A;  4OGE A;  1FXX A;  3VQQ A;  5EU7 A;  4CGF A;  3QNN A;  3S3O A;  1U48 A;  2HW3 A;  2E6L A;  4KRE A;  2HHQ A;  1UA0 A;  3UIQ A;  1HYV A;  1S1X A;  1U04 A;  3AO4 A;  1XHZ A;  1XHX A;  3K59 A;  2X78 A;  3SJJ A;  2P1J A;  1CZ9 A;  1BGX T;  4KB1 A;  2ZE2 A;  1O1W A;  1Z25 A;  3TAR A;  3VQ9 A;  3JYT A;  4IG0 A;  4DTX A;  1CXU A;  3DMJ A;  4GW6 A;  1WN7 A;  3AVK A;  4M3W A;  5HRP A;  4Z4E A;  4OPJ A;  4LSL A;  3CFO A;  4K8Z A;  2VWJ A;  1WSI A;  3L2W A;  3V9X A;  1HPZ A;  3ASM A;  4BWM A;  3TAM A;  1QHT A;  3OYI A;  4DFJ A;  1JLF A;  1TAQ A;  3DLK A;  1S5J A;  4J2A A;  3RWU A;  4FM0 A;  2YNI A;  4DSE A;  3SUO A;  3ZT1 A;  2HNZ A;  2YNF A;  2GUI A;  2OZM A;  4M3U A;  3DLE A;  4G1Q A;  1LW0 A;  2JGU A;  3OYK A;  4Z4C A;  2XY8 A;  3SUN A;  3KLH A;  4FW2 A;  1XI1 A;  4NCB A;  3ZCM A;  1QTM A;  4CHY A;  4HUG A;  3AVM A;  1X9M A;  1Q9X A;  4DFM A;  3I8D A;  4DF8 A;  1NK0 A;  4M3T A;  4H8K A;  4Q5V A;  2KZZ A;  1D9D A;  3O4N A;  1T8E A;  4DSK A;  4NYN A;  2OPP A;  3V9Z A;  2OA8 A;  2DTU A;  1NJX A;  4KAZ A;  2VG6 A;  3T1A A;  4Z4G A;  4IDK A;  1RDD A;  1SUQ A;  3QER A;  1FK9 A;  4CHP A;  1RDB A;  2HB5 A;  1NJY A;  3OYL A;  5FRN A;  1X9S A;  5C42 A;  3OYG A;  3OYJ A;  1RTI A;  4W5Q A;  4N41 A;  4M3X A;  1JLQ A;  3V1O A;  2G8U A;  1G15 A;  1VSE A;  3AVH A;  4BDY A;  4ELT A;  2Y1I A;  3M8S A;  1HQE A;  1KLN A;  4B9V A;  1J5O A;  4JRQ A;  4DTU A;  4OPK A;  3MAQ A;  1DTQ A;  1JLG A;  4E7J A;  3IRX A;  3OYM A;  3SPZ A;  3RRG A;  4KI6 A;  4N47 A;  4FCY A;  2F96 A;  4PY5 A;  1BIZ A;  4FK4 A;  3M8P A;  3OYC A;  3V9W A;  1W9H A;  2NUB A;  1Z26 A;  4AHV A;  1QSL A;  3EZ5 A;  3QEX A;  1IKV A;  4M3Z A;  4CF1 A;  1KFD A;  3K57 A;  3QLH A;  3DOL A;  2EHG A;  4ID5 A;  2O4I A;  2RKI A;  3NBP A;  3WNH A;  3PO5 A;  1RTH A;  5JS2 A;  3VA3 A;  3PY8 A;  1VK0 A;  1BHL A;  4KB0 A;  3CFP A;  3SCX A;  3S3N A;  2Z1J A;  3MED A;  3ZSR A;  4B9S A;  4YNQ A;  5HLF A;  4KRF A;  1TKT A;  1TK5 A;  1TK0 A;  1WSE A;  3PUF A;  3ALY A;  1XWL A;  3SQ1 A;  4PWD A;  2IOC A;  4M42 A;  3B6O A;  1VSL A;  1WAJ A;  3AVB A;  4PQU A;  3ITH A;  2AJQ A;  4CJ3 A;  1IO2 A;  1JL1 A;  1DTT A;  3P5J A;  1Y97 A;  1RBT A;  3T19 A;  3VQD A;  4CGJ A;  4AIL C;  1UA1 A;  3K5M A;  4GMJ B;  1YTU A;  2HHS A;  4HVJ A;  1FKO A;  1NK9 A;  2ZD1 A;  1JXB A;  4E7H A;  3LP3 A;  1TAU A;  3HPG A;  4J2B A;  1HYS A;  1JLA A;  3HVT A;  3P83 D;  3NDK A;  3V9S A;  1UOC A;  2KTQ A;  5C25 A;  5FRO A;  2PYL A;  1J53 A;  1W0H A;  2XO7 A;  1T7P A;  2W42 A;  1HJR A;  2X74 A;  3HT3 A;  3NF9 A;  5KGX A;  4C8K A;  4I9Q A;  4QCL A;  1CLQ A;  3KKR A;  1C0M A;  2OZS A;  2HHU A;  2P51 A;  4DU4 A;  4FZY A;  3AV9 A;  1D5A A;  1T05 A;  4N5S A;  4RW8 A;  4CK3 A;  5HRS A;  3LZI A;  3AO2 A;  3QEI A;  3IAY A;  3S3M A;  1BCM A;  4EP5 A;  3HPH A;  1HRH A;  4IG3 A;  3OYF A;  1KFS A;  4FLY A;  2Q3S A;  1RNH A;  4CHQ A;  1KCF A;  4CGD A;  2IDO A;  2D0C A;  3FFI A;  2XHB A;  3ZT4 A;  3V1R A;  1SL0 A;  3HK2 A;  4I7F A;  5I42 A;  1J54 A;  2OPQ A;  2HHT A;  1S1U A;  3LPT A;  2HHX A;  1RT5 A;  1RCH A;  2YKM A;  2KFN A;  3MEE A;  1SV5 A;  3AVI A;  1UAX A;  3K5O A;  5KRS A;  4OLA A;  1RT3 A;  4ZHR A;  3HP9 A;  2WON A;  3NH1 A;  3SPY A;  2QXF A;  1VSK A;  1KTQ A;  4FLZ A;  3VA0 A;  4DSF A;  4KHW A;  3B6P A;  4CFB A;  4UQG A;  3KK3 A;  4BAC A;  3PX0 A;  2IS3 A;  5KGW A;  4AHU A;  4DTN A;  3ULD A;  1NK7 A;  1WNS A;  4I2Q A;  3MEC A;  3ZT0 A;  4ID1 A;  4KO0 A;  4W5T A;  3OYN A;  4CEO A;  3OJU A;  1F21 A;  1ZBH A;  3HL8 A;  2HHV A;  3F9K A;  2P5G A;  3OVN A;  4W5N A;  5CYM A;  3O3H A;  2PZS A;  3MEG A;  1ZBU A;  2RF2 A;  1NKC A;  3V6D A;  1NKB A;  4FJJ A;  4FJM A;  3L3U A;  1VSH A;  3ZSO A;  4YFU A;  1HNV A;  3QNO A;  4M3R A;  3E01 A;  1NJZ A;  3DYA A;  4CJU A;  1EP4 A;  2RPI A;  4ICL A;  3U3G A;  2O4G A;  3OS2 A;  3VQ7 A;  1R0A A;  2A1R A;  2XY6 A;  2G8I A;  3AVA A;  3SYZ A;  3NE6 A;  4M3Y A;  1A5W A;  2P5O A;  3K2P A;  1C1B A;  3WNF A;  4FJK A;  4AHT A;  3ZSQ A;  5FRM A;  4CGG A;  2XY7 A;  5DMR A;  3O3G A;  3OYB A;  2HND A;  4BE0 A;  2XY5 A;  3QEW A;  3WNG A;  2YKN A;  5J2P A;  2IAJ A;  3KTQ A;  2GV9 A;  3NFA A;  1IKW A;  4CEF A;  3OYA A;  1RT6 A;  4F2S A;  3EY1 A;  4C8O A;  3VQ6 A;  1U45 A;  5KRT A;  5KI6 A;  4FLX A;  1LV5 A;  4RW6 A;  1EXQ A;  1LW2 A;  4I2P A;  4CIE A;  4F3O A;  1TK8 A;  4KV8 A;  2I5J A;  2PYJ A;  3I0R A;  3SV4 A;  4FJH A;  4DS5 A;  3LAK A;  4BE2 A;  3S9H A;  3U6F A;  4E89 A;  4KTQ A;  2X6N A;  1KSP A;  1WSG A;  2BGG A;  2VG5 A;  4BDP A;  1S6P A;  3CQ8 A;  4HUF A;  5HP1 A;  4DLG A;  1NOY A;  3CM5 A;  4JRP A;  3MXM A;  4HCB A;  4CJT A;  2Z1H A;  5HBM A;  4CJL A;  2QKK A;  1HYZ A;  4O4G A;  3VQA A;  3QIO A;  1NJW A;  4B8A B;  4CHN A;  4W5O A;  1RT4 A;  4KHQ A;  2E6M A;  1QQC A;  4LH5 A;  3HP6 A;  5HRO A;  4CJR A;  4F2R A;  4E3S A;  4DTP A;  1VSI A;  1WSF A;  4B9N A;  3ZSX A;  1MU2 A;  2YHA A;  4CIF A;  4FZZ A;  5SZT A;  4CF9 A;  4DFK A;  3RMA A;  4H4O A;  4DFP A;  2Z1I A;  3M8R A;  3DLH A;  2B4J A;  3AVG A;  3VQP A;  4RW7 A;  4CHO A;  1TGO A;  1YT3 A;  3LZJ A;  4FK0 A;  3RTV A;  3DM2 A;  1XC9 A;  4FW1 A;  3QEV A;  4NCG A;  4J2D A;  3NAE A;  2KFZ A;  2F8T A;  4MFB A;  3HPO A;  5CZ2 A;  4O55 A;  1QSY A;  2HVI A;  1ZBL A;  4CJF A;  4BE1 A;  1CXQ A;  4FLT A;  3IG1 A;  1IKX A;  3VQC A;  1S6Q A;  2YNG A;  4DSJ A;  1A5V A;  1K6Y A;  1S1T A;  4F8R A;  1ZBI A;  1TVR A;  3NGI A;  1SKR A;  1KRP A;  4ZTJ A;  2XRI A;  4OVL A;  3IS9 A;  4CHZ A;  4RW4 A;  1WSJ A;  2D0A A;  1LWE A;  4CJW A;  1VSD A;  4F3T A;  3KK1 A;  3CM6 A;  4QAG A;  4Z4H A;  3QIP A;  5J1E A;  4CEQ A;  1RBU A;  2YV0 X;  1DLO A;  2KQ2 A;  4FLW A;  4KHN A;  3D45 A;  2YNH A;  1RT1 A;  3AO3 A;  3LP0 A;  3OYE A;  1J9A A;  5CYQ A;  3KLF A;  3KJV A;  1CZB A;  1VRT A;  1SKS A;  1X1P A;  4FK2 A;  1L3S A;  3KLG A;  4M41 A;  4CJE A;  4O44 A;  2HNY A;  3TAB A;  3L2V A;  4KI4 A;  2DFF A;  4FZX C;  4RG8 A;  4C8N A;  4W5R A;  4DU1 A;  1UWB A;  4XIU A;  1NKE A;  2QK9 A;  1YTA A;  4E1N A;  4DTM A;  1JL2 A;  2G8F A;  5T7B A;  5J2M A;  2FBX A;  4CEB A;  3PV8 A;  1LWC A;  1C1C A;  3LAN A;  5HRR A;  4CER A;  1EKE A;  4HCC A;  1FKP A;  2FC0 A;  3D0P A;  3V9U A;  3L2R A;  4O0J A;  4KPY A;  1QE1 A;  1S1V A;  3DLG A;  2D5R A;  4Z4I A;  1ZBF A;  1GOC A;  3TAF A;  1TKD A;  3V1Q A;  3DOK A;  4DG1 A;  4Z0U A;  1D8Y A;  3VN5 A;  3DRS A;  3ZSW A;  1L5U A;  4ELV A;  4FJ7 A;  3I0S A;  4EZ9 A;  4L8R B;  3NF6 A;  3MXJ A;  3LPU A;  4KKO A;  4FJ5 A;  1ASV A;  4CGI A;  4HUE A;  3BGR A;  4LH4 A;  3TAN A;  4J2E A;  3TAG A;  3ZSV A;  4N76 A;  3KIO A;  3OYD A;  4DLE A;  4DU3 A;  3QEP A;  1RTJ A;  4IFV A;  3AA4 A;  4E7I A;  2VWK A;  3KK2 A;  2HVH A;  1RDC A;  3A2F A;  4IFY A;  3V81 A;  4IKF A;  4OLB A;  1JXE A;  3G10 A;  1TKX A;  4CFC A;  1EET A;  3F73 A;  1NK4 A;  2QKB A;  4CES A;  3AO5 A;  3VQB A;  1NOZ A;  1NK5 A;  3AA5 X;  3SI6 A;  1GOB A;  2G8H A;  4KHY A;  3NGZ A;  2BAN A;  3C95 A;  1RT7 A;  2IGI A;  3DLB A;  4O0I A;  1KVC A;  5I3U A;  4FYD A;  4CIG A;  4N56 A;  5J2N A;  4FJ8 A;  2A1S A;  2OPR A;  1GOA A;  1HQU A;  4HHT A;  1BQN A;  4CJ4 A;  4KTZ A;  5C24 A;  1N6Q A;  1JLE A;  1IG9 A;  4AHR A;  1SL1 A;  1RTD A;  4B9M A;  4RW9 A;  1BI4 A;  2RN2 A;  4WE1 A;  5HRN A;  2DY4 A;  3SQ2 A;  4E7K A;  3QET A;  1REV A;  4DQI A;  1NK6 A;  3KLI A;  1WSH A;  3OYH A;  3TAQ A;  3NCI A;  1BL3 A;  4OKJ A;  3HM9 A;  3TI0 A;  4F4K A;  2FBY A;  4EP4 A;  2D0B A;  4CJS A;  1KLM A;  2VG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...