4HUEA

Structure of 5-chlorouracil modified g:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hueA00
3TANA 3NGZA 4XIUA 2EX3A 1SV5A 3L3UA 4CHQA 5CZ2A 2PYJA 4J2AA 3T19A 3ZSQA 3SUQA 1VSJA 1B9DA 4N47A 3C95A 3I8DA 4FVMA 3RR8A 2LSNA 4M3ZA 1RT7A 2ITGA 5KGXA 3AVNA 4CJQA 4LSLA 4CJUA 3MAQA 4DTJA 4B9MA 4K8ZA 4OLBA 3ZSOA 5FROA 3AA2A 4M3RA 3S9HA 1JKHA 3AA3A 5D3GA 4DFKA 3TAGA 1KFDA 1RT3A 3AVFA 4M45A 1SKSA 4E3SA 3LWMA 1ZBIA 1KVBA 3OS2A 1NOZA 1RNHA 4E7IA 1IKXA 2VWKA 4O0IA 4CCHA 3O3FA 4N56A 1T03A 2JLEA 1RBUA 3HL8A 4DSKA 3AVAA 3OYAA 3ZT0A 3KK1A 4ELVA 4WE1A 3QIOA 3HT3A 5FDLA 4E7KA 2QKKA 1VRTA 1XHXA 4CJ3A 1I39A 3VQBA 3MEEA 3K58A 4C8KA 1T05A 5JS2A 4RW7A 2G8IA 4AH9A 1S6QA 1TKXA 3OYFA 3DLKA 5J2MA 1L3UA 2OPSA 1RBSA 3TR8A 1EX4A 1ZYQA 4C8NA 3AVKA 1HPZA 3KIOA 4CHZA 4B9NA 1BIZA 2G8FA 4ELTA 1XWLA 3AA4A 2GV9A 4ZTFA 4EZ9A 1EXQA 1S1WA 4JLHA 3VQ9A 4ZHRA 2P5OA 3SI6A 4ICLA 1HNVA 4DU1A 1RTIA 3BDPA 5HRSA 1QSYA 3M8PA 3M8QA 1NOYA 2WOMA 4Z0UA 1U47A 1C6VA 2OZSA 1IKYA 1Q9YA 3SUOA 4Z4EA 4KHQA 3CM6A 1JL2A 1BI4A 1WSHA 4DU3A 1DLOA 3EY1A 1IH7A 2XY5A 4W5RA 2OYQA 1BHLA 1LW2A 1NKBA 1QTMA 3QEPA 3IAYA 1RT2A 4E89A 1SKRA 3QEWA 3L2UA 4FK0A 1LAVA 4TSXA 4CEBA 1BCOA 4CHOA 2E4LA 4O4GA 3NH2A 4KV8A 2G8VA 1NKEA 2O4GA 2XO7A 4FJ7A 2XHBA 4OPJA 4F3OA 1YVUA 3OS1A 3RMCA 1LW0A 1JLEA 4Y1DA 2VWJA 2X6NA 2P5GA 4Y1CA 2HHTA 2RPIA 3DRRA 3VQ7A 3HO1A 1WSIA 2HHUA 2Z1HA 1HYZA 3QESA 3AO1A 3RWUA 2E6MA 3CM5A 1HQUA 2GBZA 3P83D 4FLWA 3S3OA 1J5OA 3UIQA 4DLGA 5KRSA 3OJSA 5J1EA 3OYGA 3VA3A 4KFBA 5HRNA 3NBPA 5HRRA 4CHNA 3TAPA 1FK9A 3VQCA 4M42A 4DS5A 5J2NA 4FLUA 1D9FA 3HVTA 3PO4A 3ASMA 4GVMA 4GMJB 5JS1A 2DFFA 1NK5A 4CEQA 4KKOA 4BWMA 3HPOA 1U49A 3FFIA 1TGOA 3NGYA 3U3YA 2HMIA 2FBYA 3D45A 4E7HA 3B6PA 1JL1A 3VQ6A 5FRNA 4DFMA 3SQ2A 3B6OA 3I0RA 1TK5A 2HNYA 2F8SA 4Q0BA 3TAMA 1C1AA 1VSMA 3LAMA 3ALYA 3RTVA 1KTQA 4HVJA 3OYKA 1WLJA 5CYQA 1TVRA 3V81A 3KJVA 3DLEA 3S3MA 1HJRA 5DK5A 1C1CA 1RT6A 1CXQA 5CZ1A 3QIPA 3AVIA 4CJVA 3RMAA 2G8UA 4I2QA 1BL3A 2JGUA 3AVJA 1LWFA 5C24A 1RBTA 2DY4A 3HXMA 4RW6A 1SUQA 3E01A 4AHSA 3L2WA 4DFJA 4O0JA 3QNNA 4F2RA 3HJFA 3O4QA 1B9FA 1RBRA 4E7LA 2NUBA 4DTRA 1TKTA 1S9EA 3ISNC 4CERA 3NH0A 2DTUA 4I7FA 1S1UA 1CZBA 3T3FA 4FLZA 2YHBA 3OVNA 3C94A 2VG5A 4CGDA 3V1OA 2X78A 3KLEA 1HRHA 1S1VA 1RCHA 4KTZA 3ULDA 3HM9A 4DU4A 4FJ5A 2HVHA 4AHVA 3SV4A 2HNDA 3AV9A 4CESA 5HP1A 4CEZA 2OPRA 4CFDA 3KTQA 3NF8A 3MEGA 2YNIA 4IDKA 3PX0A 1Z25A 1SKWA 4YNQA 4DTMA 3DLBA 1IO2A 1NJXA 4BE1A 4DF8A 4M3YA 4HCCA 1JLBA 1WSGA 3LANA 4Z4HA 4FJ8A 2RF2A 4FZZA 2E6LA 1BGXT 4KHSA 4CJRA 1NK7A 1LWEA 3AO4A 4R5PA 3DYAA 1KCFA 4DQPA 4GW6A 4J2BA 4FJNA 5KRTA 4FM1A 2D0AA 3SPZA 4OKEA 4CK2A 2IS3A 2PZSA 1XC9A 4J2EA 4DQIA 3DRSA 3ZT1A 4FJGA 1WSEA 4H4OA 4OVLA 3K59A 4HTUA 5K14A 3QO9A 4OLAA 3BGRA 4FLXA 4QCLA 4B9LA 1HQEA 2RKIA 4OGCA 4BE2A 4KI4A 4CJSA 3LAKA 1NK6A 3ZT2A 3ZSZA 5DMRA 4RW4A 3F73A 4E19A 4DQRA 5I3UA 1NJWA 4KAZA 3KK2A 1HNIA 4KHNA 3CYMA 5J2QA 1BCMA 2A1RA 3IS9A 3L2RA 1W9HA 3NAEA 3LZIA 3RMDA 3KD5E 4CJ5A 4FJLA 1U45A 2GUIA 4Z4IA 4OGEA 4KRFA 2ETJA 4E1MA 2KFZA 1VSDA 1TL3A 2D5RA 4IBNA 1TK8A 4FCYA 4DSJA 4BDZA 2PYLA 1JXEA 2B5JA 5E41A 1EKEA 1BISA 1Y97A 4OPKA 4I9QA 5FRMA 2BGGA 1WAJA 4B8AB 4AHTA 3HVRA 3S3NA 3QEIA 2EHGA 1Z26A 3VQ8A 1TV6A 5C25A 3V9XA 2YKMA 2KZMA 3AO2A 4CEOA 2IAJA 4M3WA 1RBVA 3ZSRA 2BANA 3JSMA 3OYIA 1QE1A 1RTDA 2FC0A 4C8MA 4NCBA 1VSLA 4CJTA 1N6QA 1TK0A 3HK2A 2F96A 3KLGA 3QNOA 1N5YA 4FLYA 2XY8A 1J54A 3SQ4A 4DLEA 4DF4A 4CJFA 3CFRA 3OYMA 4LH5A 3U6FA 1YTUA 1RDBA 4KREA 4EP5A 3G10A 4ID5A 3QERA 3ZSWA 3RRGA 4ZTJA 3LZJA 1KVCA 1BIUA 4NCGA 4CJLA 1Q9XA 4PWDA 3ZT4A 1Q8IA 4PUOA 4BWJA 2B6AA 1FKOA 2ZE2A 3MXJA 3DLGA 3I0SA 3NF9A 2FBVA 3F9KA 4QAGA 5KI6A 4N41A 2B4JA 1S5JA 1F21A 4CGFA 3VN5A 4CHPA 1A5WA 2QXFA 1DTQA 3NF7A 4AHUA 3K57A 5KTQA 4BACA 1QSLA 1T7PA 3L2VA 2KFNA 1FKPA 3AVLA 3OYNA 4CJWA 3CG7A 2O4IA 4HUGA 3QINA 1A5XA 3CFOA 4CF9A 1CLQA 3AVBA 3AA5X 1ZBUA 3OYDA 3SQ1A 4CF0A 1S6PA 4DTPA 4DWIA 3C6UA 4J2DA 5C42A 3OS0A 2RN2A 1SL2A 1JXBA 4CIEA 3KLHA 4HUEA 4CJPA 4IG3A 3T1AA 4E1NA 3SV3A 4W5QA 2KTQA 1NK4A 1B92A 4DTOA 3AVCA 3NCIA 3ZSVA 3K5NA 4N5SA 3SYZA 3RRHA 4AILC 4FZXC 4RW9A 1REVA 1RT1A 1EETA 3LPTA 4FM0A 3DOKA 2YV0X 1JLQA 1IG9A 3AO5A 3WNFA 1D9DA 4CFBA 4FJHA 1GOCA 4PY5A 3SUPA 1DTTA 4FLTA 4CF1A 3HP9A 4LH4A 3TAEA 1IKVA 4CIFA 3L3VA 1VRUA 4DQSA 3SPYA 4OJRA 3KK3A 1KLMA 2XY7A 4CFAA 4Q5VA 3C6TA 2Z1JA 3LALA 2FBTA 3DOLA 2D0CA 3LP0A 1NKCA 1ITGA 1RILA 3AVMA 5CYMA 3OYCA 4FJJA 1TL1A 2P1JA 1T8EA 1ZBFA 3PX6A 3RMBA 3M8RA 4B9VA 4PA1A 3ITHA 2HHSA 4Z4GA 1R0AA 4KB0A 1JLCA 2HNZA 3OJUA 3NGIA 1HYVA 2IDOA 5KGWA 4CK1A 2VG6A 4Z4FA 1S1TA 4B9TA 3AVHA 4W5TA 4NCAA 4JS5A 4CJKA 4ELUA 1BQNA 4K8XA 4G1QA 2R7YA 4KPYA 3TAFA 4I9LA 2HHVA 3HPGA 4FJMA 1QQCA 3NF6A 4KHYA 3WNGA 1J53A 4DFPA 1U4BA 4N76A 4W5OA 1XI1A 4FZYA 1RDCA 5HRPA 4O44A 1GOBA 2X6SA 1J9AA 1GOAA 3L2QA 4IG0A 4E7JA 1HMVA 1O1WA 3LP3A 2IGIA 2VG7A 3HPHA 4EP4A 5J2PA 1IKWA 3PO5A 4CK3A 1KFSA 3KKRA 2YHAA 1S1XA 4DTXA 1X9MA 3CQ8A 3P1GA 4DTNA 2HB5A 2G8KA 2YNFA 4O5BA 3V4IA 4KHUA 3DLRA 3V1RA 4DG1A 3PX4A 2WONA 4MFBA 3KLFA 3VQDA 1C0MA 1U48A 4DSLA 3KLIA 3VQQA 3OYLA 2PY5A 1QHTA 3L8BA 4HCBA 3NE6A 3TI0A 2OZMA 1TKDA 4OKJA 3WNHA 3G0ZA 1L3SA 4CJEA 3DLHA 3DMJA 4B8CA 3SNNA 4FJ9A 4M3TA 3OYBA 3QETA 1HYSA 4FLVA 3VQ5A 1RTHA 1LWCA 1U04A 2Y1IA 3TAQA 4DSEA 4JRQA 1SL0A 1D8YA 4B9UA 4AHCA 2Q3SA 4FJKA 1RT5A 1RDAA 1VSHA 1NK9A 2HHWA 4H4MA 2AJQA 3AO3A 3SUNA 3PY8A 2KQ2A 4LSNA 3VQ4A 4QOZB 4PQUA 1C1BA 3ZCMA 4F8RA 1ASWA 3A2FA 4KO0A 4CF8A 4L8RB 1NJYA 3V9SA 1EP4A 4BDPA 3MEDA 3D0PA 4FXDA 4JS4A 4C8LA 3K2PA 4M3UA 2A1SA 2YKNA 3LPUA 4CEDA 1L3TA 3MXIA 3DI6A 4I2PA 3NHGA 4HHTA 3ZSYA 2XY6A 5HLFA 4CGIA 3V9WA 4DTUA 4JRPA 4CHYA 4YFUA 1BQMA 3TWHA 2YNGA 4CECA 3HYFA 4CGJA 4DTSA 3SJJA 1YTAA 5EU7A 4AHRA 1CXUA 3LDSA 3TARA 1KVAA 3WNEA 5SWMA 1XHZA 1NK0A 3MXMA 2IOCA 4NYFA 1LAWA 1S9GA 3OYJA 3KD1E 4F2SA 4CE9A 2QKBA 3THVA 1BI4B 1K6YA 1UOCA 5HBMA 2KZZA 3KKSA 2X74A 4CF2A 4DSFA 4FK2A 4FYDA 3NFAA 1KRPA 4KHWA 1VSIA 3PUFA 3H08A 4RG8A 1TKZA 4CFCA 2DFEA 2Z1IA 1C0UA 1G15A 3OYHA 1VSEA 4CEEA 1C0TA 2Z1GA 4NYNA 4CEFA 3VA0A 4CJ4A 4DMNA 3OY9A 3SCXA 5HROA 2HHQA 4LD0A 4CGHA 2OA8A 3NDKA 1VSFA 3VQAA 1D5AA 4FJIA 2BDPA 4ID1A 4KB1A 2IC3A 4CGGA 3O4NA 5CY4A 4MQ3A 2YNHA 4B08A 2OPPA 3LP1A 4FM2A 2KW4A 4CIGA 1A5VA 1CZ9A 3RR7A 3U3GA 3O3GA 4M41A 1QS4A 1UWBA 4RW8A 3ZSXA 3OYEA 4DSIA 2G8HA 1NJZA 3JYTA 1ASVA 1X1PA 2W42A 4UQGA 3HSTB 4CEAA 4C8OA 4FW2A 1ZBHA 1FXXA 2FBXA 1YT3A 3IRXA 4KTWA 1UAXA 3EZ5A 1VSKA 4IKFA 4Z4CA 1SL1A 5I42A 4M3XA 3DM2A 3DRPA 2ATQA 1JLAA 1KSPA 4O55A 1TAQA 3NH1A 3LWLA 3ZT3A 4F3TA 3QLHA 1UA0A 4W5NA 1WSFA 2DFHA 1L5UA 1W0HA 4OKKA 3PV8A 2OPQA 4DS4A 4KTQA 5T7BA 1JLGA 2Y1JA 3AVGA 3LP2A 4IFVA 3K5LA 1RT4A 1L3VA 2QK9A 4F4KA 2ZQBA 2D0BA 3P5JA 2I5JA 2HW3A 1WNSA 3TABA 4EZ6A 3V1QA 3O3HA 1X9WA 3M8SA 5SZTA 1NK8A 3V9ZA 1WN7A 2XRIA 4IFYA 3SZ2A 1X9SA 2HHXA 1MU2A 4B3OA 1QSSA 1RTJA 3V6DA 2G8WA 1RDDA 2P51A 2HVIA 4LY7A 4B9SA 1LV5A 3HP6A 4FW1A 4DQQA 1WAFA 4FK4A 4BDYA 3K5OA 3VQEA 3SQ0A 2F8TA 3MECA 1TAUA 3K5MA 3VQPA 1VK0A 3EYZA 3V9UA 1UA1A 3CFPA 1WSJA 3QEXA 4KI6A 2BE2A 1I3AA 4H8KA 4BE0A 1KLNA 1ZBLA 2ZD1A 4FJXA 4HUFA 4E0DA 1JLFA 3IG1A 3QEVA 1ASUA
chains in the Genus database with same CATH superfamily
2EX3A 4CHQA 5BPNA 2Q0UA 3T19A 5AQQA 3SUQA 3U9DA 1B9DA 4CZEA 4FVMA 3RR8A 3FZLA 4IJAA 1HNZK 4DTJA 4OLBA 2P9PB 2ZWHA 4FWLA 1GLEG 3AA3A 3WXMB 1OVQA 1E4GT 4M45A 1SKSA 1ZBIA 3OS2A 3CIPA 3BY5A 1HLUA 4CCHA 4CZLA 1T03A 5AQMA 1NM1A 2HHHK 5AQWA 3VQBA 2DPNA 2ZGYA 3K58A 4C8KA 1T05A 5JS2A 2FSNA 1VHXA 4DV5K 4BG8A 4FSVA 2ZJRL 4CHZA 1BIZA 2A40A 4ZTFA 2QWMA 4MLHA 3FLCO 1QSYA 1NOYA 4IWVA 5BRFA 1IKYA 1Q9YA 4H5TA 5A2QO 5TKWA 5JLFA 2XY5A 1NGIA 1K9MO 4A2AA 1OH8A 3QEPA 1NMNA 1VQNN 5BR8K 5E26A 4FK0A 2G8VA 4GV9A 3LDQA 1YVUA 2RPIA 4K0KK 2NRVA 1WSIA 2Z1HA 5AQUA 3QESA 1HQUA 5FPNA 5J1EA 4KFBA 4M42A 1D9FA 4GVMA 2QWOA 3G25A 1QZ5A 4BWMA 3FFIA 1TGOA 4A5BA 1JL1A 3SQ2A 1TK5A 2UUBK 2F8SA 4Q0BA 1VSMA 3RTVA 3OYKA 1WLJA 3V81A 1HJRA 1CXQA 1RT6A 5CZ1A 5AJ3K 3THYA 3CD6N 4I2QA 5EOYA 1LWFA 1RBTA 4B1YB 3HXMA 1SUQA 3QB0A 1Q18A 1RBRA 2NUBA 3LDOA 1K8AO 4JI3K 3ISNC 4I7FA 4BVOA 4B3TK 3H46O 1XUPO 3KWGA 2VG5A 2HOEA 4KTZA 2HVHA 1RFQA 4CESA 3NMUA 5M1QA 1Z25A 4YNQA 3MK6A 4BE1A 4DF8A 1YUWA 1JLBA 4Z4HA 5AQJA 4FJ8A 1BGXT 5KPRA 3VETA 5KQDA 3DYAA 3U9ZA 1KCFA 4B3RK 5KRTA 3SPZA 4OKEA 2IS3A 3ZX3A 4OVLA 4HTUA 4OLAA 3D7EO 5GIPA 4CD3A 4MDBA 3ZT2A 2ZJPL 4RW4A 4KHNA 4E19A 1Q81O 1BCMA 4BGAA 1SAZA 4JK8A 3O9SA 3L2RA 3LZIA 3KD5E 3FGUA 1NGCA 2P9KB 2Q97A 4KRFA 2GUIA 3OBWA 3VOVA 4IJNA 4XH5A 2KFZA 4IBNA 1J5EK 1TK8A 1JXEA 2B5JA 1ZXOA 5E41A 1BISA 3MMVA 2QI2A 2QW9A 2NRRA 3S3NA 3V9XA 3VQ8A 1TV6A 3A5OC 1RBVA 3P38A 3ULEA 3ZSRA 5GAHP 2BANA 3JSMA 2FC0A 4C8MA 3E9PA 2F96A 4PHTX 4B1WB 4KH4A 4X65K 1NGBA 4K42A 3OYMA 3THXB 4KREA 4EP5A 3VGMA 5H1SQ 3CI5A 4NCGA 2B6AA 3F9KA 1QZ6A 1U2VB 2B4JA 5BPMA 4CGFA 4JKGB 2KLAA 4AHUA 1N34K 1FKPA 3O80A 4CJWA 5F0XA 1A5XA 4CF9A 3OYDA 2P9LA 3SQ1A 3TPQA 4CF0A 4DTPA 3UKUB 5C10A 3BF1A 3BZKA 3SJHA 3I8BA 2O8CA 3NCIA 3K5NA 4FZXC 3RRHA 1VQ8N 1EETA 2PFUA 2Q1NA 1JLQA 3WNFA 1N8RO 4WYBA 5C2DA 4PY5A 2NZTA 4JI8K 3HP9A 4LH4A 1VQLN 3SAGA 4BR0A 3SPYA 4OJRA 1X3NA 3LP0A 2FBTA 4H5NA 5CYMA 5CHIA 4U67L 1WOQA 4EFHA 1T8EA 1XNQK 2QXLA 3M8RA 5JMVA 4Z4GA 5IT9O 3AGKA 1HYVA 3BZCA 4CK1A 4ISEA 3AVHA 3ZYYX 4K8XA 4G1QA 1S3XA 3D2FA 2E8AA 3E66A 4PKGA 1QQCA 3NF6A 4KHYA 3SMSA 5FLXO 5HRPA 4JN4A 4FPBA 2X6SA 1O1WA 3R1XA 4BRPA 3PO5A 3H1VX 3O1BA 4DR7K 3E9OA 2HB5A 4JKHA 3AAQA 3DLRA 3PX4A 1GLBG 3OYLA 2PY5A 4WCEL 1VQ9N 4YDUA 1TKDA 4CJEA 3DMJA 4B8CA 4M3TA 4JI5K 3OYBA 1VQ6N 1HYSA 4FLVA 1T3VA 3T1YK 3CCRN 3VQ5A 3T69A 4JRQA 4BRNA 1NG9A 3SUNA 4QS9A 1KAZA 2QTDA 4PKIA 1C0FA 3VEZA 1NGEA 4BDPA 4M3UA 1L3TA 2ASPA 4FOEA 3ZSYA 4H0PA 2E1YA 1T6DA 3QFUA 4B1ZA 4DTUA 4JRPA 3HYFA 4CGJA 4DTSA 1KVAA 4BRGA 2IOCA 2QWLA 4F2SA 3VGKA 1YJ9N 5HBMA 4FK2A 4J8FA 2BH1A 1R59O 4KHWA 1VSIA 4RG8A 3H08A 1NGGA 3WXKA 2P9NB 1VQ7N 3H1QA 1VSEA 3OYHA 1YIJN 4NYNA 3K9KA 4CEFA 4CJ4A 3OY9A 3DJCA 3O1WA 1KXPA 3C6HA 1N36K 4KB1A 5AQYA 3F2KA 3O4NA 4FWRA 1OH6A 4MQ3A 3C7NB 3DXMB 2IVPA 3VEXA 3RR7A 3O3GA 3OHRA 4M41A 2GUPA 2UXCK 1NJZA 1RDWX 4EAHD 3O08A 4DR4K 2F9TA 1YF5L 2FBXA 1YT3A 4KTWA 4IKFA 4Z4CA 1SL1A 1BDGA 4M3XA 3DM2A 2PAVA 4IO8A 4U7BA 2ATQA 4F3TA 1TAQA 1UA0A 1WSFA 2DFHA 5ELZA 1W0HA 1BG3A 1MDUB 4DS4A 5T7BA 1JLGA 1RT4A 2UXDK 2GEMA 2ZQBA 2D0BA 5GINA 1WNSA 4M7XA 5IWAK 3THYB 1X9WA 4O5FA 1NK8A 1W7AA 1WN7A 2XRIA 3RSEA 3QBXA 3V6DA 4B9SA 3HP6A 3VQEA 4FOIA 4WF9L 3DLLL 2O8DA 1QVGM 3ZEUA 1HNWK 4KI6A 4Y0WA 3OTOK 3CC4N 2ZGZA 1KLNA 1ZBLA 1T44A 4E0DA 4JKCA 4KH5A 1JLFA 3IG1A 1ASUA 3TANA 3NGZA 4XIUA 5FPMA 3HZ6A 4B1XB 1VSJA 4N47A 2LSNA 4M3ZA 5ADXA 1VQPN 3EKUA 4CJQA 4LSLA 3ATUA 3MAQA 4Z94A 4B9MA 1NNEA 3S9HA 1JKHA 4DFKA 3WXLA 3AVFA 3LWMA 1KVBA 3SAFA 1NOZA 1ZBSA 2FSKA 4N56A 4DSKA 3KK1A 2F7TA 4WE1A 5FDLA 1BA0A 1VRTA 1XHXA 4QS7A 4O8UA 3WEEA 4RW7A 2D0PA 3CXCM 3OYFA 5J2MA 1W97L 1NMDA 1EX4A 4B9NA 2G8FA 1XWLA 5AZIB 4EZ9A 4DR6K 4ICLA 1M1KO 3BDPA 3CCQN 1C6VA 3JAMO 3PIOL 3WT0A 3CM6A 1WSHA 4DU3A 3EY1A 4CZIA 4W5RA 2CGKA 2OYQA 1LW2A 1NKBA 3IAYA 2NNWA 1IJJA 3QEWA 3L2UA 4AM6A 1NGHA 4CHOA 1N33K 3MN7A 2XO7A 4FJ7A 4F3OA 4A5AA 2VWJA 2HHTA 4Y1CA 2ITMA 3VQ7A 3L4QA 3HO1A 3AO1A 4YOXA 3CM5A 3P83D 2GBZA 3S3OA 1J5OA 2UYTA 3OJSA 3NBPA 5HRRA 4CHNA 1FK9A 2YX6A 5J2NA 1SZ2A 4GMJB 5JS1A 1NK5A 3VGLA 4KKOA 3KZBA 3HPOA 3F9MA 1U6ZA 3NGYA 2HMIA 3Q7BA 4H0XB 4XH4A 4DFMA 1YAGA 2O8CB 3TAMA 3DWLA 5AFUA 5LJWA 4HVJA 5CYQA 3TTFA 4BRKA 5F1XA 3VEVA 1EWQA 3RMAA 1HNXK 3EN9A 2W6LA 3IMXA 3J81O 3E01A 4AHSA 1NGJA 1G99A 3FR0A 4DKWA 2UU9K 2QWRA 4I6MA 1S1UA 1CZBA 3KK7A 5F2RA 5C15A 3T3FA 4FLZA 3OVNA 3V1OA 2X78A 3QEXA 1RCHA 4YOYA 3HM9A 4AHVA 3SV4A 5HP1A 4W5NA 3CERA 5TKYA 4YHHK 1IO2A 3D2EA 3LANA 2RF2A 2A41A 3W0LA 4CJRA 3WXIA 1LWEA 3AO4A 1LCUA 4R5PA 4B9QA 4H5RA 4GW6A 4FM1A 2WUSA 4J2EA 3IDHA 4H4OA 3K59A 5K14A 3BGRA 4QCLA 4B9LA 4KI4A 4CBXA 3LAKA 1NK6A 3ZSZA 4KAZA 1HNIA 3CYMA 5J2QA 1VAZA 3DAWA 5AQSA 2A1RA 4HTLA 4Z4IA 3EO3A 4FJLA 1U45A 4H0OA 3MWTA 3SBTA 1TL3A 2D5RA 1HX1A 2IIRA 5AQOA 4BDZA 4DSJA 4JKBA 1EKEA 2BGGA 1WAJA 4B8AB 3QEIA 1Z26A 5C25A 4JHDB 3AO2A 2IAJA 4M3WA 3HOSA 3L4IA 3OYIA 1RTDA 3FE1A 1VSLA 2HBKA 1ILYA 3KLGA 1TYQA 1J54A 4DLEA 4CJFA 1BA1A 1VQ4N 1OVYA 3RRGA 2GTDA 4ZTJA 3LZJA 4PUOA 4BWJA 2OANA 2QA4N 3LM9A 3NF9A 3LL3A 4QAGA 1F21A 2HMPA 3ZETA 5JLHA 2QXFA 4X62K 2VGMA 3K57A 3B8AX 4X66K 2I7PA 4HUGA 3THWA 3QINA 5BR9A 4JI2K 3QDKA 1K8KA 4IOXA 3OS0A 1Y64A 5LL6Z 2RN2A 2OTJN 4H0TB 4OX9K 3KLHA 4HUEA 4E1NA 1YI2N 3T1AA 2KTQA 3OW2M 1NK4A 4AILC 3ZSVA 3A5MC 3SYZA 4JD2B 2VQEK 1REVA 3LPTA 3DOKA 4WFBL 4WFNL 4JK7A 1IG9A 4DR1K 1D9DA 4FJHA 3MN6A 4A57A 4CF1A 3M5RA 3L3VA 2ZF5O 3O4WA 1KLMA 4Q5VA 1NKCA 2Z1JA 2D0CA 4H0YB 5AQLA 2HF3A 3EL2A 3RMBA 4B9VA 3DXKA 4KB0A 4JK9A 4JEPA 2A3ZA 2HNZA 3LM2A 2VG6A 4B9TA 1FJGK 4W5TA 2O8EA 4ELUA 1BQNA 2P9IB 3ID6A 4KPYA 4WQ4C 3VPZA 3CCUN 3TAFA 3HPGA 4FJMA 3HSCA 2YI1A 1QQMA 1J53A 4LC9B 1U4BA 4N76A 1XI1A 3UKRA 4JKDA 1GOBA 1GOAA 3HBTA 4IG0A 4RWTA 4E7JA 2O8DB 3LP3A 3HPHA 3ZEUB 1IKWA 3KKRA 2YHAA 3CQ8A 2P9SB 2G8KA 3V4IA 1DEJA 3OBYA 1U48A 4DSLA 3KLIA 4GV6A 1QHTA 3L8BA 3TI0A 4M63C 3WNHA 4B1VA 3L6QA 3TU5A 2ASMA 5AQIA 1LWCA 1U04A 3TAQA 5DM7L 4B9UA 1SL0A 3GG4A 3O5BA 3P4IA 1VSHA 1EWRA 1LOTB 1V4TA 4XEIA 4BGBA 3ZCMA 4KO0A 4CF8A 3N4PA 3L0QA 4DR2K 2GWJA 1HJOA 1NJYA 4FL9A 3D0PA 3TSPA 4JS4A 1JCEA 2A1SA 4AQYK 4DB3A 2QWQA 3J80O 3NHGA 3WEEB 4MDAA 4BROA 2XY6A 5HLFA 3GL1A 1BQMA 1M90O 1YTAA 4AHRA 4LFAK 4NYFA 3OYJA 1S9GA 4CE9A 2OTLN 1VQ5N 5AQFA 4IEEA 5B8HA 4EIAA 3FZHA 3HM8A 2UXBK 3PUFA 3TSQA 1G15A 3CCLN 1OKJA 2CGLA 4CGHA 2OA8A 4RTFD 1VSFA 2BDPA 4CGGA 5CY4A 2OPPA 1BOTO 2KW4A 5DM6L 1A5VA 4ISGA 2H3GX 1CZ9A 3ENBA 3P31A 1QS4A 1UWBA 4DSIA 4MO4A 2G8HA 3CJBA 1XMOK 3HSTB 4C8OA 1ZBHA 3J7AP 1FXXA 3IRXA 1UAXA 1VSKA 3G4SN 3ZT3A 3QLHA 1X9JA 2Y1JA 5KPZA 4F4KA 3P5JA 4YOTA 3TABA 4LFBK 2FXUA 4IDHA 5SZTA 2YJFA 3V9ZA 1X9SA 2P9UB 1RTJA 2P51A 2HVIA 2NLXA 1LV5A 4BDYA 3IFRA 2F8TA 3CCEN 1TAUA 2NRZA 3MX2A 3CFPA 1FW6A 4H8KA 4BE0A 3VENA 2ZD1A 4CZKA 4FJXA 4HUFA 3UB5A 1H1VA 3SMPA 3VESA 1Z6RA 2FF3B 3L3UA 2PYJA 4GVEA 4AM7A 4DV0K 3LDPA 3I8DA 3FFKB 2ITGA 5KGXA 3AVNA 2V7YA 2P9PA 4CJUA 3AARA 2IVNA 2IVOA 3ZSOA 3AA2A 5M1OA 4M3RA 5D3GA 3TAGA 2Q0RA 1RNHA 2E20A 4E7IA 1IKXA 2VWKA 2D1KA 4MLEA 2JLEA 1RBUA 3HL8A 3AVAA 4ELVA 3NVKA 1EQYA 3HT3A 4E7KA 2QKKA 4CJ3A 4JI6K 3MEEA 1JCFA 4AH9A 3O9RA 3K0SA 1L3UA 3AVKA 1HPZA 3KIOA 3CCMN 4ELTA 3WQTA 4MO5A 1HUXA 1S1WA 4ZHRA 3SI6A 1HNVA 2YCHA 1RTIA 4IZ9A 4Z0UA 3VTHA 3HTVA 3SUOA 4KHQA 5LY3A 2YHXA 4CZGA 1BI4A 1DLOA 2AA4A 2FSJA 1C0GA 1BHLA 5CR4A 1QTMA 1RT2A 1T6CA 5GAGP 1SKRA 4TSXA 3R8EA 3NH2A 1GLCG 2E4LA 4O4GA 5JVHL 4KV8A 4NXNK 5ADXH 1ESVA 2O4GA 4YOWA 2OCEA 3CQYA 3RMCA 1JLEA 2X6NA 2BTFA 1HKBA 3H45C 5EY4A 4FWQA 4BRIA 2HHUA 2E6MA 4FLWA 3H6EA 3VA3A 2E2NA 3O8MA 3VQCA 1JJ2M 3K9JA 4FLUA 4LF7K 3BUZB 1U49A 5KPTA 4CW7B 5FRNA 5GADP 3B6OA 3I0RA 3LAMA 3ALYA 1TVRA 3KJVA 3DLEA 5FPDA 5DK5A 1C1CA 3UE5A 3QIPA 3AVIA 2JGUA 2E2QA 3AVJA 5C24A 5JVGL 1IG8A 4RW6A 3QNNA 3VMFB 4F2RA 3EE8A 1B9FA 4E7LA 3IUCA 3ZX2A 4BC5A 3O6WA 3CCJN 1S9EA 3NH0A 4YORA 2DTUA 3CJ1A 4X64K 3C94A 2WTUA 3KLEA 4DU4A 3ULDA 2HNDA 3QBWA 3AV9A 4FWMA 4CFDA 2OPRA 5AZJA 4KHUA 3NF8A 3MEGA 3PX0A 4IDKA 3DLBA 1NJXA 2QWNA 4HCCA 4F9OA 1D4XA 4FZZA 4DV4K 3AY9A 4BR2A 5BN9A 4BVPA 1NK7A 3R6MA 3TTDA 5GIOA 2W40A 4IFEA 4DQPA 4J2BA 3H3OB 3UKRB 4DUYK 4CK2A 3MN5A 1NLVA 4NLCA 4DQIA 3DRSA 4R79A 1VQMN 3J8AA 1IBKK 1HQEA 4CI6A 2GX9A 1NU0A 5DMRA 3T1HK 3RVCA 5AFUH 3C6AA 4WQ4A 2P9KA 1W9HA 1JCGA 4CJ5A 4A61A 3FZMA 5M1NA 2HBMA 4E1MA 1VSDA 3GDQA 2O8BA 2PYLA 4G9ZA 5EX5A 1Y97A 5FRMA 4I9QA 4AHTA 2KZMA 2YHYA 1S72N 2YKMA 4FWSA 3N4QA 3ULEB 4C1NI 4NCBA 1N6QA 1TK0A 3HK2A 3G71N 3QNOA 1N5YA 4FLYA 3SQ4A 4DF4A 3CFRA 5CE3A 3THXA 4L3QA 4IOCL 3U6FA 1YTUA 1RDBA 3AGRA 3G10A 4ID5A 3HOTA 1KVCA 1BIUA 4CJLA 1Q9XA 1Q8IA 2ZE2A 1FKOA 3I0SA 4N41A 4JKGA 1WB9A 4CHPA 4BACA 3EKSA 3SAHA 2CH6A 3L2VA 3OYNA 3AVLA 4BR4A 3CG7A 2O4IA 3CFOA 3E9LA 4LF4K 1ZBUA 2A5XA 2P9LB 4DWIA 1NGAA 3C6UA 3UKUA 4W5QA 1B92A 3AVCA 4IXCA 4N5SA 1KD1O 3WQUA 1RT1A 4NXMK 2E1ZA 4CFBA 3NVMA 1GOCA 4A2BA 3PIPL 3SUPA 1KAXA 4ILJA 4V19S 3TAEA 1IKVA 1VRUA 3KK3A 2XY7A 3C6TA 3LALA 4FJJA 1RILA 3AVMA 4GNIA 2P1JA 4JI1K 4CJ7A 3PX6A 4PA1A 3ITHA 1KC8O 2HHSA 1R0AA 3T7ZA 1JLCA 4JNEA 4Z4FA 4K43A 4NCAA 4JS5A 4CJKA 4JI7K 2HHVA 3D2FB 3WNGA 1ATRA 2O8FA 3EZWA 4FZYA 3HRGA 1J9AA 3I55N 1HMVA 5LMNK 2IGIA 4EP4A 3CC2N 4JAXA 3HI0A 1ZC6A 3P1GA 4DUZK 2YNFA 5LMUK 2WONA 4BC2A 4MFBA 1SS6A 3VQQA 4HCBA 3NE6A 2OZMA 4OKJA 1L3SA 3G0ZA 3SNNA 3QETA 1RTHA 5HOOA 4BRMA 4EHUA 2Y1IA 4LF9K 5JICA 4AHCA 1W2BM 1RT5A 1NK9A 3VEOA 2HHWA 1MA9B 4QOZB 4BR7A 4F8RA 3A2FA 4L8RB 5AQXA 3V9SA 1WBBA 3J7YP 4C8LA 3K2PA 5I9EB 3LPUA 4BC3A 4H5VA 3OA9A 3DI6A 3A0IX 1IBMK 3GOIA 4HHTA 3ATVA 4IO9L 4CGIA 3WUHA 1Q86O 4DR3K 2YNGA 4BQZA 4CECA 3SJJA 5EU7A 3LDSA 3TARA 5SWMA 3MXMA 1LAWA 2QKBA 3THVA 1BI4B 3D6RA 1UOCA 3KKSA 2X74A 3CPEA 5BRDA 4CF2A 4DSFA 4CBWA 4FYDA 3QFPA 3M1FA 4ISFA 4CFCA 5AQZA 1TKZA 2P9NA 4CZHA 2DFEA 2QEXN 2Z1IA 1C0UA 1C0TA 3SCXA 2W41A 4WQ5C 5HROA 2HHQA 4LD0A 3NDKA 4DR5K 2VQFK 4FJIA 3FZFA 3C7NA 3DXMA 2PBDA 3ENHA 3LP1A 3R9PA 3ZSXA 4BC4A 3CCVN 1HR0K 2W42A 1ASVA 1X1PA 4UQGA 1YITN 3O9UA 3I33A 1XMQK 3MWPA 3BEXA 1S22A 3W3DA 1KSPA 4O55A 3NH1A 1YJWN 4OKKA 3PV8A 4K41A 2OPQA 3SBGA 3AVGA 4JKEA 3LP2A 4IFVA 3K5LA 4BRLA 4PL8A 2QK9A 2HW3A 4EZ6A 3V1QA 3LDLA 4XH1A 4DV3K 1IBLK 2HHXA 2NRTA 3SZ2A 1MU2A 3RSEB 2G8WA 5AQGA 1P90A 4C23A 1KAYA 4DQQA 1KQSM 1K73O 5E84A 4DCHA 3MECA 3VQPA 4KHPK 1VK0A 3CF5L 2I7NA 3EYZA 1UA1A 1WSJA 3A5NC 4BRAA 4JKAA 5AZJB 4NB4A 2D0OA 1HPMA 4KH6A 2J4RA 2QM1A 3QEVA 1NWKA 4OO1J 2YJEA 5C12A 1SV5A 1YXQA 4KBOA 5CZ2A 4J2AA 4WFAL 4FVUA 3ZSQA 2A42A 1SQKA 3C95A 1RT7A 4FPAA 4K8ZA 5FROA 3I56N 2UUCK 1KFDA 1RT3A 4E3SA 3M6GA 4BRDA 5HL7L 4O0IA 3O3FA 2NRHA 4JI0K 3OYAA 3ZT0A 4H5WA 5M1KA 3MX5A 3QIOA 5AQNA 5BPLA 1I39A 4GKKK 4OPAA 2G8IA 1S6QA 1TKXA 5EXWA 2O8BB 3DLKA 2OPSA 1X3MA 1RBSA 3TR8A 1ZYQA 4C8NA 5AZIA 3MCPA 3AA4A 2GV9A 1EXQA 4JLHA 3VQ9A 3KWIA 2P5OA 1DKGD 4UY8O 4DU1A 1BU6O 5HRSA 3M8PA 3M8QA 2WOMA 5BREA 1U47A 2OZSA 4Z4EA 1QHAA 1JL2A 1RDUA 1IH7A 3A5LC 3CJ9A 3S41A 2E2OA 2Q2RA 4E89A 2D4WA 1LAVA 4CEBA 5M1FA 1BCOA 1NKEA 2XHBA 3CPWM 4OPJA 3J7ZO 1VQKN 3OS1A 2P5GA 1LW0A 4Y1DA 3DRRA 4CZMA 4BG9A 2FLOA 1HYZA 3RWUA 3UIQA 1NBWA 4GY2B 5KRSA 4DLGA 1DGKN 3OYGA 5HRNA 3TAPA 1E3MA 4DS5A 3HVTA 3PO4A 3ASMA 2DFFA 4CEQA 1YHQN 1I94K 3C0BA 5BN8A 4LF5K 2VGNA 3U3YA 3A8YA 4BY9C 2FBYA 3D45A 3MDQA 4E7HA 3B6PA 2V7ZA 3VQ6A 2HNYA 1C1AA 2JWKA 1KTQA 3ID8A 3S3MA 3PLAA 3KVGA 2G8UA 5EVZA 4CJVA 1BL3A 4LFCK 4M7YA 2UUAK 2DY4A 4DFJA 3L2WA 1J6ZA 3HJFA 4O0JA 3O4QA 4DTRA 1TKTA 3O9TA 4CERA 1TUYA 4B3MK 3VF2A 4I6MB 2YHBA 4AF1A 4BRFA 1GLFO 4CGDA 1HRHA 1S1VA 2KHOA 2ZM6K 4FJ5A 3ENOA 3KTQA 4CEZA 2YNIA 3PY8A 2V52B 1SKWA 4DTMA 4M3YA 2F4VK 1WSGA 3D2EB 2AP1A 4CD1A 2E6LA 3F5TA 4KHSA 2CGJA 3ZLJA 1XC3A 3AAPA 4IOAL 2NRXA 2O8FB 4BQLA 4FJNA 2D0AA 3WXJA 3EE9A 2PZSA 1XC9A 5C0YA 3ZT1A 4FJGA 1WSEA 1XNRK 3CC7N 3QO9A 4A62A 4FLXA 1HKGA 4OGCA 1QQOA 2RKIA 4BE2A 4DQ8A 4CJSA 3F73A 3MCAB 4DQRA 5I3UA 1NJWA 3KK2A 4JV5K 4CZFA 3TSUA 3IS9A 1IV0A 3NAEA 3RMDA 4OGEA 2CH5A 3MN9A 2ETJA 2GWKA 4BR5A 3CMEN 4FCYA 5C2FA 3VEWA 4FWPA 4OPKA 1WBDA 2E88A 3HVRA 2EHGA 3CHWA 4JHDA 4DHYA 1DT9A 4CEOA 1OH5A 3SK3A 1QE1A 3TTCA 4CJTA 5GAEP 3H3NO 3PSIA 1E4FT 1P8ZA 2XY8A 1TYQB 4LH5A 2RE2A 3QERA 3ZSWA 1HKCA 4NLBA 1YVNA 4PWDA 3ZT4A 1QQNA 2E2PA 5BRHA 4BR9A 3MXJA 3DLGA 5KI6A 2FBVA 4LF6K 1S5JA 3VN5A 3U8XA 5LJVA 1Q82O 3ZETB 1A5WA 2VYPA 1DTQA 3NF7A 1T7PA 2KKZA 5KTQA 1QSLA 1GLLO 4A59A 4YY3K 2A6AA 3IKMA 3JXUA 3THWB 4EHTA 1CLQA 3AVBA 1MWMA 3AA5X 5KQ8A 4PKHA 4J2DA 1S6PA 4FWKA 3CJ7A 3JS6A 5C42A 1K8KB 4GKJK 1BO5O 3C65A 5MLCQ 1JXBA 1SL2A 4CIEA 4NO7A 3SV3A 4CJPA 4IG3A 4BRHA 1ATSA 4DTOA 4JD2A 5AQVA 4RW9A 3SLCA 4FM0A 1TUUA 2YV0X 3CMAN 3O9QA 3AO5A 2RHKA 1OH7A 1GLJO 2NRWA 1DTTA 2YHWA 3Q7CA 4YOUA 4FLTA 3P39A 1ATNA 3ZX0A 4CIFA 4GV3A 4LF8K 3U4LA 4DQSA 3QICA 4CFAA 3R3LA 3DOLA 2ASOA 1ITGA 3OYCA 1TL1A 4WQ5A 1BUPA 1ZBFA 2HF4A 2HBLA 3DXKB 3OJUA 3NGIA 2IDOA 5KGWA 4BREA 1S1TA 2BUPA 2P9IA 4BRCA 2O8EB 2R7YA 3VTIA 4I9LA 2W6KA 3VF4A 4DFPA 3GBTA 2VWBA 5AR0A 4B3SK 4W5OA 5AQHA 1Q7YO 4PL7A 1RDCA 4O44A 4RCHA 4H0VB 3L2QA 2VG7A 5J2PA 5AQKA 4CK3A 1KFSA 1S1XA 2QWPA 4DTXA 2P9SA 1X9MA 4DTNA 4O5BA 3V1RA 5FPEA 4DG1A 3LDNA 3KLFA 3VQDA 1C0MA 2VCPA 4CBUA 3GE1A 3G6EN 3DLHA 4FJ9A 1NJIO 2E5LK 3PSFA 4ILGB 1O13A 4DSEA 4FJKA 1D8YA 4K25A 2Q3SA 4DV1K 1RDAA 4H4MA 2AJQA 3AO3A 2KQ2A 4LSNA 3VQ4A 4PQUA 1C1BA 3BP8A 1ASWA 2F9WA 3QMLA 1EP4A 3MEDA 4QS8A 4FXDA 2YKNA 4HWIA 4CEDA 3MXIA 5AQPA 4I2PA 4JKFA 4DV2K 4DV6K 3CCSN 5AQTA 3V9WA 4FWOA 4YOVA 4CZJA 4CHYA 4YFUA 3TWHA 5M1PA 1CXUA 1RGIA 1U2VA 1XHZA 3WNEA 1NK0A 1N32K 3KD1E 4JI4K 1BWFO 3CETA 1CZAN 2HSTA 1K6YA 3VF6A 2KZZA 3CJCA 3NFAA 1EO1A 1KRPA 2FF6A 1XQSC 3BF3A 5AQRA 4CEEA 2Z1GA 3VA0A 4DMNA 1NGFA 4B1UB 3VQAA 1D5AA 4ID1A 2IC3A 2YNHA 4B08A 1GLDG 4FM2A 3CQXA 4CIGA 3U3GA 3KHYA 1NGDA 4RW8A 3OYEA 4E1JA 2Q31A 1V4SA 2V51B 3JYTA 3CJAA 4JYAK 2WC9A 4CEAA 4FW2A 2EWSA 3EZ5A 4H03B 2HBJA 5I42A 3DRPA 2KFNA 1JLAA 3LWLA 4IEIA 2WBNA 1L5UA 4FWNA 4KTQA 4DV7K 3FZKA 1L3VA 2I5JA 2WFBA 1YJNN 1QVFM 3O3HA 3EEQA 3M8SA 1Z05A 2P9UA 4IFYA 4FO0A 2JWLA 3E1YA 4YDUC 4B3OA 2ZJQL 1VQON 1QSSA 1RDDA 4C1NK 1WUAA 4ILHA 4LY7A 4BRQA 4FW1A 2Q36A 1MWKA 1WAFA 4FK4A 3K5OA 4OPHA 3SQ0A 3K5MA 4CVNE 3V9UA 3VERA 4O8KA 2GELA 2BE2A 1I3AA 3VEYA 1GLAG 3M3ZA
chains in the Genus database with same CATH topology
3TANA 3NGZA 4XIUA 2EX3A 1SV5A 3L3UA 4CHQA 5CZ2A 2PYJA 4J2AA 3T19A 3ZSQA 3SUQA 1VSJA 1B9DA 4N47A 3C95A 3I8DA 4FVMA 3RR8A 2LSNA 4M3ZA 1RT7A 2ITGA 5KGXA 3AVNA 4CJQA 4LSLA 4CJUA 3MAQA 4DTJA 4B9MA 4K8ZA 4OLBA 3ZSOA 5FROA 3AA2A 4M3RA 3S9HA 1JKHA 3AA3A 5D3GA 4DFKA 3TAGA 1KFDA 1RT3A 3AVFA 4M45A 1SKSA 4E3SA 3LWMA 1ZBIA 1KVBA 3OS2A 1NOZA 1RNHA 4E7IA 1IKXA 2VWKA 4O0IA 4CCHA 3O3FA 4N56A 1T03A 2JLEA 1RBUA 3HL8A 4DSKA 3AVAA 3OYAA 3ZT0A 3KK1A 4ELVA 4WE1A 3QIOA 3HT3A 5FDLA 4E7KA 2QKKA 1VRTA 1XHXA 4CJ3A 1I39A 3VQBA 3MEEA 3K58A 4C8KA 1T05A 5JS2A 4RW7A 2G8IA 4AH9A 1S6QA 1TKXA 3OYFA 3DLKA 5J2MA 1L3UA 2OPSA 1RBSA 3TR8A 1EX4A 1ZYQA 4C8NA 3AVKA 1HPZA 3KIOA 4CHZA 4B9NA 1BIZA 2G8FA 4ELTA 1XWLA 3AA4A 2GV9A 4ZTFA 4EZ9A 1EXQA 1S1WA 4JLHA 3VQ9A 4ZHRA 2P5OA 3SI6A 4ICLA 1HNVA 4DU1A 1RTIA 3BDPA 5HRSA 1QSYA 3M8PA 3M8QA 1NOYA 2WOMA 4Z0UA 1U47A 1C6VA 2OZSA 1IKYA 1Q9YA 3SUOA 4Z4EA 4KHQA 3CM6A 1JL2A 1BI4A 1WSHA 4DU3A 1DLOA 3EY1A 1IH7A 2XY5A 4W5RA 2OYQA 1BHLA 1LW2A 1NKBA 1QTMA 3QEPA 3IAYA 1RT2A 4E89A 1SKRA 3QEWA 3L2UA 4FK0A 1LAVA 4TSXA 4CEBA 1BCOA 4CHOA 2E4LA 4O4GA 3NH2A 4KV8A 2G8VA 1NKEA 2O4GA 2XO7A 4FJ7A 2XHBA 4OPJA 4F3OA 1YVUA 3OS1A 3RMCA 1LW0A 1JLEA 4Y1DA 2VWJA 2X6NA 2P5GA 4Y1CA 2HHTA 2RPIA 3DRRA 3VQ7A 3HO1A 1WSIA 2HHUA 2Z1HA 1HYZA 3QESA 3AO1A 3RWUA 2E6MA 3CM5A 1HQUA 2GBZA 3P83D 4FLWA 3S3OA 1J5OA 3UIQA 4DLGA 5KRSA 3OJSA 5J1EA 3OYGA 3VA3A 4KFBA 5HRNA 3NBPA 5HRRA 4CHNA 3TAPA 1FK9A 3VQCA 4M42A 4DS5A 5J2NA 4FLUA 1D9FA 3HVTA 3PO4A 3ASMA 4GVMA 4GMJB 5JS1A 2DFFA 1NK5A 4CEQA 4KKOA 4BWMA 3HPOA 1U49A 3FFIA 1TGOA 3NGYA 3U3YA 2HMIA 2FBYA 3D45A 4E7HA 3B6PA 1JL1A 3VQ6A 5FRNA 4DFMA 3SQ2A 3B6OA 3I0RA 1TK5A 2HNYA 2F8SA 4Q0BA 3TAMA 1C1AA 1VSMA 3LAMA 3ALYA 3RTVA 1KTQA 4HVJA 3OYKA 1WLJA 5CYQA 1TVRA 3V81A 3KJVA 3DLEA 3S3MA 1HJRA 5DK5A 1C1CA 1RT6A 1CXQA 5CZ1A 3QIPA 3AVIA 4CJVA 3RMAA 2G8UA 4I2QA 1BL3A 2JGUA 3AVJA 1LWFA 5C24A 1RBTA 2DY4A 3HXMA 4RW6A 1SUQA 3E01A 4AHSA 3L2WA 4DFJA 4O0JA 3QNNA 4F2RA 3HJFA 3O4QA 1B9FA 1RBRA 4E7LA 2NUBA 4DTRA 1TKTA 1S9EA 3ISNC 4CERA 3NH0A 2DTUA 4I7FA 1S1UA 1CZBA 3T3FA 4FLZA 2YHBA 3OVNA 3C94A 2VG5A 4CGDA 3V1OA 2X78A 3KLEA 1HRHA 1S1VA 1RCHA 4KTZA 3ULDA 3HM9A 4DU4A 4FJ5A 2HVHA 4AHVA 3SV4A 2HNDA 3AV9A 4CESA 5HP1A 4CEZA 2OPRA 4CFDA 3KTQA 3NF8A 3MEGA 2YNIA 4IDKA 3PX0A 1Z25A 1SKWA 4YNQA 4DTMA 3DLBA 1IO2A 1NJXA 4BE1A 4DF8A 4M3YA 4HCCA 1JLBA 1WSGA 3LANA 4Z4HA 4FJ8A 2RF2A 4FZZA 2E6LA 1BGXT 4KHSA 4CJRA 1NK7A 1LWEA 3AO4A 4R5PA 3DYAA 1KCFA 4DQPA 4GW6A 4J2BA 4FJNA 5KRTA 4FM1A 2D0AA 3SPZA 4OKEA 4CK2A 2IS3A 2PZSA 1XC9A 4J2EA 4DQIA 3DRSA 3ZT1A 4FJGA 1WSEA 4H4OA 4OVLA 3K59A 4HTUA 5K14A 3QO9A 4OLAA 3BGRA 4FLXA 4QCLA 4B9LA 1HQEA 2RKIA 4OGCA 4BE2A 4KI4A 4CJSA 3LAKA 1NK6A 3ZT2A 3ZSZA 5DMRA 4RW4A 3F73A 4E19A 4DQRA 5I3UA 1NJWA 4KAZA 3KK2A 1HNIA 4KHNA 3CYMA 5J2QA 1BCMA 2A1RA 3IS9A 3L2RA 1W9HA 3NAEA 3LZIA 3RMDA 3KD5E 4CJ5A 4FJLA 1U45A 2GUIA 4Z4IA 4OGEA 4KRFA 2ETJA 4E1MA 2KFZA 1VSDA 1TL3A 2D5RA 4IBNA 1TK8A 4FCYA 4DSJA 4BDZA 2PYLA 1JXEA 2B5JA 5E41A 1EKEA 1BISA 1Y97A 4OPKA 4I9QA 5FRMA 2BGGA 1WAJA 4B8AB 4AHTA 3HVRA 3S3NA 3QEIA 2EHGA 1Z26A 3VQ8A 1TV6A 5C25A 3V9XA 2YKMA 2KZMA 3AO2A 4CEOA 2IAJA 4M3WA 1RBVA 3ZSRA 2BANA 3JSMA 3OYIA 1QE1A 1RTDA 2FC0A 4C8MA 4NCBA 1VSLA 4CJTA 1N6QA 1TK0A 3HK2A 2F96A 3KLGA 3QNOA 1N5YA 4FLYA 2XY8A 1J54A 3SQ4A 4DLEA 4DF4A 4CJFA 3CFRA 3OYMA 4LH5A 3U6FA 1YTUA 1RDBA 4KREA 4EP5A 3G10A 4ID5A 3QERA 3ZSWA 3RRGA 4ZTJA 3LZJA 1KVCA 1BIUA 4NCGA 4CJLA 1Q9XA 4PWDA 3ZT4A 1Q8IA 4PUOA 4BWJA 2B6AA 1FKOA 2ZE2A 3MXJA 3DLGA 3I0SA 3NF9A 2FBVA 3F9KA 4QAGA 5KI6A 4N41A 2B4JA 1S5JA 1F21A 4CGFA 3VN5A 4CHPA 1A5WA 2QXFA 1DTQA 3NF7A 4AHUA 3K57A 5KTQA 4BACA 1QSLA 1T7PA 3L2VA 2KFNA 1FKPA 3AVLA 3OYNA 4CJWA 3CG7A 2O4IA 4HUGA 3QINA 1A5XA 3CFOA 4CF9A 1CLQA 3AVBA 3AA5X 1ZBUA 3OYDA 3SQ1A 4CF0A 1S6PA 4DTPA 4DWIA 3C6UA 4J2DA 5C42A 3OS0A 2RN2A 1SL2A 1JXBA 4CIEA 3KLHA 4HUEA 4CJPA 4IG3A 3T1AA 4E1NA 3SV3A 4W5QA 2KTQA 1NK4A 1B92A 4DTOA 3AVCA 3NCIA 3ZSVA 3K5NA 4N5SA 3SYZA 3RRHA 4AILC 4FZXC 4RW9A 1REVA 1RT1A 1EETA 3LPTA 4FM0A 3DOKA 2YV0X 1JLQA 1IG9A 3AO5A 3WNFA 1D9DA 4CFBA 4FJHA 1GOCA 4PY5A 3SUPA 1DTTA 4FLTA 4CF1A 3HP9A 4LH4A 3TAEA 1IKVA 4CIFA 3L3VA 1VRUA 4DQSA 3SPYA 4OJRA 3KK3A 1KLMA 2XY7A 4CFAA 4Q5VA 3C6TA 2Z1JA 3LALA 2FBTA 3DOLA 2D0CA 3LP0A 1NKCA 1ITGA 1RILA 3AVMA 5CYMA 3OYCA 4FJJA 1TL1A 2P1JA 1T8EA 1ZBFA 3PX6A 3RMBA 3M8RA 4B9VA 4PA1A 3ITHA 2HHSA 4Z4GA 1R0AA 4KB0A 1JLCA 2HNZA 3OJUA 3NGIA 1HYVA 2IDOA 5KGWA 4CK1A 2VG6A 4Z4FA 1S1TA 4B9TA 3AVHA 4W5TA 4NCAA 4JS5A 4CJKA 4ELUA 1BQNA 4K8XA 4G1QA 2R7YA 4KPYA 3TAFA 4I9LA 2HHVA 3HPGA 4FJMA 1QQCA 3NF6A 4KHYA 3WNGA 1J53A 4DFPA 1U4BA 4N76A 4W5OA 1XI1A 4FZYA 1RDCA 5HRPA 4O44A 1GOBA 2X6SA 1J9AA 1GOAA 3L2QA 4IG0A 4E7JA 1HMVA 1O1WA 3LP3A 2IGIA 2VG7A 3HPHA 4EP4A 5J2PA 1IKWA 3PO5A 4CK3A 1KFSA 3KKRA 2YHAA 1S1XA 4DTXA 1X9MA 3CQ8A 3P1GA 4DTNA 2HB5A 2G8KA 2YNFA 4O5BA 3V4IA 4KHUA 3DLRA 3V1RA 4DG1A 3PX4A 2WONA 4MFBA 3KLFA 3VQDA 1C0MA 1U48A 4DSLA 3KLIA 3VQQA 3OYLA 2PY5A 1QHTA 3L8BA 4HCBA 3NE6A 3TI0A 2OZMA 1TKDA 4OKJA 3WNHA 3G0ZA 1L3SA 4CJEA 3DLHA 3DMJA 4B8CA 3SNNA 4FJ9A 4M3TA 3OYBA 3QETA 1HYSA 4FLVA 3VQ5A 1RTHA 1LWCA 1U04A 2Y1IA 3TAQA 4DSEA 4JRQA 1SL0A 1D8YA 4B9UA 4AHCA 2Q3SA 4FJKA 1RT5A 1RDAA 1VSHA 1NK9A 2HHWA 4H4MA 2AJQA 3AO3A 3SUNA 3PY8A 2KQ2A 4LSNA 3VQ4A 4QOZB 4PQUA 1C1BA 3ZCMA 4F8RA 1ASWA 3A2FA 4KO0A 4CF8A 4L8RB 1NJYA 3V9SA 1EP4A 4BDPA 3MEDA 3D0PA 4FXDA 4JS4A 4C8LA 3K2PA 4M3UA 2A1SA 2YKNA 3LPUA 4CEDA 1L3TA 3MXIA 3DI6A 4I2PA 3NHGA 4HHTA 3ZSYA 2XY6A 5HLFA 4CGIA 3V9WA 4DTUA 4JRPA 4CHYA 4YFUA 1BQMA 3TWHA 2YNGA 4CECA 3HYFA 4CGJA 4DTSA 3SJJA 1YTAA 5EU7A 4AHRA 1CXUA 3LDSA 3TARA 1KVAA 3WNEA 5SWMA 1XHZA 1NK0A 3MXMA 2IOCA 4NYFA 1LAWA 1S9GA 3OYJA 3KD1E 4F2SA 4CE9A 2QKBA 3THVA 1BI4B 1K6YA 1UOCA 5HBMA 2KZZA 3KKSA 2X74A 4CF2A 4DSFA 4FK2A 4FYDA 3NFAA 1KRPA 4KHWA 1VSIA 3PUFA 3H08A 4RG8A 1TKZA 4CFCA 2DFEA 2Z1IA 1C0UA 1G15A 3OYHA 1VSEA 4CEEA 1C0TA 2Z1GA 4NYNA 4CEFA 3VA0A 4CJ4A 4DMNA 3OY9A 3SCXA 5HROA 2HHQA 4LD0A 4CGHA 2OA8A 3NDKA 1VSFA 3VQAA 1D5AA 4FJIA 2BDPA 4ID1A 4KB1A 2IC3A 4CGGA 3O4NA 5CY4A 4MQ3A 2YNHA 4B08A 2OPPA 3LP1A 4FM2A 2KW4A 4CIGA 1A5VA 1CZ9A 3RR7A 3U3GA 3O3GA 4M41A 1QS4A 1UWBA 4RW8A 3ZSXA 3OYEA 4DSIA 2G8HA 1NJZA 3JYTA 1ASVA 1X1PA 2W42A 4UQGA 3HSTB 4CEAA 4C8OA 4FW2A 1ZBHA 1FXXA 2FBXA 1YT3A 3IRXA 4KTWA 1UAXA 3EZ5A 1VSKA 4IKFA 4Z4CA 1SL1A 5I42A 4M3XA 3DM2A 3DRPA 2ATQA 1JLAA 1KSPA 4O55A 1TAQA 3NH1A 3LWLA 3ZT3A 4F3TA 3QLHA 1UA0A 4W5NA 1WSFA 2DFHA 1L5UA 1W0HA 4OKKA 3PV8A 2OPQA 4DS4A 4KTQA 5T7BA 1JLGA 2Y1JA 3AVGA 3LP2A 4IFVA 3K5LA 1RT4A 1L3VA 2QK9A 4F4KA 2ZQBA 2D0BA 3P5JA 2I5JA 2HW3A 1WNSA 3TABA 4EZ6A 3V1QA 3O3HA 1X9WA 3M8SA 5SZTA 1NK8A 3V9ZA 1WN7A 2XRIA 4IFYA 3SZ2A 1X9SA 2HHXA 1MU2A 4B3OA 1QSSA 1RTJA 3V6DA 2G8WA 1RDDA 2P51A 2HVIA 4LY7A 4B9SA 1LV5A 3HP6A 4FW1A 4DQQA 1WAFA 4FK4A 4BDYA 3K5OA 3VQEA 3SQ0A 2F8TA 3MECA 1TAUA 3K5MA 3VQPA 1VK0A 3EYZA 3V9UA 1UA1A 3CFPA 1WSJA 3QEXA 4KI6A 2BE2A 1I3AA 4H8KA 4BE0A 1KLNA 1ZBLA 2ZD1A 4FJXA 4HUFA 4E0DA 1JLFA 3IG1A 3QEVA 1ASUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAN A;  3NGZ A;  4XIU A;  2EX3 A;  1SV5 A;  3L3U A;  4CHQ A;  5CZ2 A;  2PYJ A;  4J2A A;  3T19 A;  3ZSQ A;  3SUQ A;  1VSJ A;  1B9D A;  4N47 A;  3C95 A;  3I8D A;  4FVM A;  3RR8 A;  2LSN A;  4M3Z A;  1RT7 A;  2ITG A;  5KGX A;  3AVN A;  4CJQ A;  4LSL A;  4CJU A;  3MAQ A;  4DTJ A;  4B9M A;  4K8Z A;  4OLB A;  3ZSO A;  5FRO A;  3AA2 A;  4M3R A;  3S9H A;  1JKH A;  3AA3 A;  5D3G A;  4DFK A;  3TAG A;  1KFD A;  1RT3 A;  3AVF A;  4M45 A;  1SKS A;  4E3S A;  3LWM A;  1ZBI A;  1KVB A;  3OS2 A;  1NOZ A;  1RNH A;  4E7I A;  1IKX A;  2VWK A;  4O0I A;  4CCH A;  3O3F A;  4N56 A;  1T03 A;  2JLE A;  1RBU A;  3HL8 A;  4DSK A;  3AVA A;  3OYA A;  3ZT0 A;  3KK1 A;  4ELV A;  4WE1 A;  3QIO A;  3HT3 A;  5FDL A;  4E7K A;  2QKK A;  1VRT A;  1XHX A;  4CJ3 A;  1I39 A;  3VQB A;  3MEE A;  3K58 A;  4C8K A;  1T05 A;  5JS2 A;  4RW7 A;  2G8I A;  4AH9 A;  1S6Q A;  1TKX A;  3OYF A;  3DLK A;  5J2M A;  1L3U A;  2OPS A;  1RBS A;  3TR8 A;  1EX4 A;  1ZYQ A;  4C8N A;  3AVK A;  1HPZ A;  3KIO A;  4CHZ A;  4B9N A;  1BIZ A;  2G8F A;  4ELT A;  1XWL A;  3AA4 A;  2GV9 A;  4ZTF A;  4EZ9 A;  1EXQ A;  1S1W A;  4JLH A;  3VQ9 A;  4ZHR A;  2P5O A;  3SI6 A;  4ICL A;  1HNV A;  4DU1 A;  1RTI A;  3BDP A;  5HRS A;  1QSY A;  3M8P A;  3M8Q A;  1NOY A;  2WOM A;  4Z0U A;  1U47 A;  1C6V A;  2OZS A;  1IKY A;  1Q9Y A;  3SUO A;  4Z4E A;  4KHQ A;  3CM6 A;  1JL2 A;  1BI4 A;  1WSH A;  4DU3 A;  1DLO A;  3EY1 A;  1IH7 A;  2XY5 A;  4W5R A;  2OYQ A;  1BHL A;  1LW2 A;  1NKB A;  1QTM A;  3QEP A;  3IAY A;  1RT2 A;  4E89 A;  1SKR A;  3QEW A;  3L2U A;  4FK0 A;  1LAV A;  4TSX A;  4CEB A;  1BCO A;  4CHO A;  2E4L A;  4O4G A;  3NH2 A;  4KV8 A;  2G8V A;  1NKE A;  2O4G A;  2XO7 A;  4FJ7 A;  2XHB A;  4OPJ A;  4F3O A;  1YVU A;  3OS1 A;  3RMC A;  1LW0 A;  1JLE A;  4Y1D A;  2VWJ A;  2X6N A;  2P5G A;  4Y1C A;  2HHT A;  2RPI A;  3DRR A;  3VQ7 A;  3HO1 A;  1WSI A;  2HHU A;  2Z1H A;  1HYZ A;  3QES A;  3AO1 A;  3RWU A;  2E6M A;  3CM5 A;  1HQU A;  2GBZ A;  3P83 D;  4FLW A;  3S3O A;  1J5O A;  3UIQ A;  4DLG A;  5KRS A;  3OJS A;  5J1E A;  3OYG A;  3VA3 A;  4KFB A;  5HRN A;  3NBP A;  5HRR A;  4CHN A;  3TAP A;  1FK9 A;  3VQC A;  4M42 A;  4DS5 A;  5J2N A;  4FLU A;  1D9F A;  3HVT A;  3PO4 A;  3ASM A;  4GVM A;  4GMJ B;  5JS1 A;  2DFF A;  1NK5 A;  4CEQ A;  4KKO A;  4BWM A;  3HPO A;  1U49 A;  3FFI A;  1TGO A;  3NGY A;  3U3Y A;  2HMI A;  2FBY A;  3D45 A;  4E7H A;  3B6P A;  1JL1 A;  3VQ6 A;  5FRN A;  4DFM A;  3SQ2 A;  3B6O A;  3I0R A;  1TK5 A;  2HNY A;  2F8S A;  4Q0B A;  3TAM A;  1C1A A;  1VSM A;  3LAM A;  3ALY A;  3RTV A;  1KTQ A;  4HVJ A;  3OYK A;  1WLJ A;  5CYQ A;  1TVR A;  3V81 A;  3KJV A;  3DLE A;  3S3M A;  1HJR A;  5DK5 A;  1C1C A;  1RT6 A;  1CXQ A;  5CZ1 A;  3QIP A;  3AVI A;  4CJV A;  3RMA A;  2G8U A;  4I2Q A;  1BL3 A;  2JGU A;  3AVJ A;  1LWF A;  5C24 A;  1RBT A;  2DY4 A;  3HXM A;  4RW6 A;  1SUQ A;  3E01 A;  4AHS A;  3L2W A;  4DFJ A;  4O0J A;  3QNN A;  4F2R A;  3HJF A;  3O4Q A;  1B9F A;  1RBR A;  4E7L A;  2NUB A;  4DTR A;  1TKT A;  1S9E A;  3ISN C;  4CER A;  3NH0 A;  2DTU A;  4I7F A;  1S1U A;  1CZB A;  3T3F A;  4FLZ A;  2YHB A;  3OVN A;  3C94 A;  2VG5 A;  4CGD A;  3V1O A;  2X78 A;  3KLE A;  1HRH A;  1S1V A;  1RCH A;  4KTZ A;  3ULD A;  3HM9 A;  4DU4 A;  4FJ5 A;  2HVH A;  4AHV A;  3SV4 A;  2HND A;  3AV9 A;  4CES A;  5HP1 A;  4CEZ A;  2OPR A;  4CFD A;  3KTQ A;  3NF8 A;  3MEG A;  2YNI A;  4IDK A;  3PX0 A;  1Z25 A;  1SKW A;  4YNQ A;  4DTM A;  3DLB A;  1IO2 A;  1NJX A;  4BE1 A;  4DF8 A;  4M3Y A;  4HCC A;  1JLB A;  1WSG A;  3LAN A;  4Z4H A;  4FJ8 A;  2RF2 A;  4FZZ A;  2E6L A;  1BGX T;  4KHS A;  4CJR A;  1NK7 A;  1LWE A;  3AO4 A;  4R5P A;  3DYA A;  1KCF A;  4DQP A;  4GW6 A;  4J2B A;  4FJN A;  5KRT A;  4FM1 A;  2D0A A;  3SPZ A;  4OKE A;  4CK2 A;  2IS3 A;  2PZS A;  1XC9 A;  4J2E A;  4DQI A;  3DRS A;  3ZT1 A;  4FJG A;  1WSE A;  4H4O A;  4OVL A;  3K59 A;  4HTU A;  5K14 A;  3QO9 A;  4OLA A;  3BGR A;  4FLX A;  4QCL A;  4B9L A;  1HQE A;  2RKI A;  4OGC A;  4BE2 A;  4KI4 A;  4CJS A;  3LAK A;  1NK6 A;  3ZT2 A;  3ZSZ A;  5DMR A;  4RW4 A;  3F73 A;  4E19 A;  4DQR A;  5I3U A;  1NJW A;  4KAZ A;  3KK2 A;  1HNI A;  4KHN A;  3CYM A;  5J2Q A;  1BCM A;  2A1R A;  3IS9 A;  3L2R A;  1W9H A;  3NAE A;  3LZI A;  3RMD A;  3KD5 E;  4CJ5 A;  4FJL A;  1U45 A;  2GUI A;  4Z4I A;  4OGE A;  4KRF A;  2ETJ A;  4E1M A;  2KFZ A;  1VSD A;  1TL3 A;  2D5R A;  4IBN A;  1TK8 A;  4FCY A;  4DSJ A;  4BDZ A;  2PYL A;  1JXE A;  2B5J A;  5E41 A;  1EKE A;  1BIS A;  1Y97 A;  4OPK A;  4I9Q A;  5FRM A;  2BGG A;  1WAJ A;  4B8A B;  4AHT A;  3HVR A;  3S3N A;  3QEI A;  2EHG A;  1Z26 A;  3VQ8 A;  1TV6 A;  5C25 A;  3V9X A;  2YKM A;  2KZM A;  3AO2 A;  4CEO A;  2IAJ A;  4M3W A;  1RBV A;  3ZSR A;  2BAN A;  3JSM A;  3OYI A;  1QE1 A;  1RTD A;  2FC0 A;  4C8M A;  4NCB A;  1VSL A;  4CJT A;  1N6Q A;  1TK0 A;  3HK2 A;  2F96 A;  3KLG A;  3QNO A;  1N5Y A;  4FLY A;  2XY8 A;  1J54 A;  3SQ4 A;  4DLE A;  4DF4 A;  4CJF A;  3CFR A;  3OYM A;  4LH5 A;  3U6F A;  1YTU A;  1RDB A;  4KRE A;  4EP5 A;  3G10 A;  4ID5 A;  3QER A;  3ZSW A;  3RRG A;  4ZTJ A;  3LZJ A;  1KVC A;  1BIU A;  4NCG A;  4CJL A;  1Q9X A;  4PWD A;  3ZT4 A;  1Q8I A;  4PUO A;  4BWJ A;  2B6A A;  1FKO A;  2ZE2 A;  3MXJ A;  3DLG A;  3I0S A;  3NF9 A;  2FBV A;  3F9K A;  4QAG A;  5KI6 A;  4N41 A;  2B4J A;  1S5J A;  1F21 A;  4CGF A;  3VN5 A;  4CHP A;  1A5W A;  2QXF A;  1DTQ A;  3NF7 A;  4AHU A;  3K57 A;  5KTQ A;  4BAC A;  1QSL A;  1T7P A;  3L2V A;  2KFN A;  1FKP A;  3AVL A;  3OYN A;  4CJW A;  3CG7 A;  2O4I A;  4HUG A;  3QIN A;  1A5X A;  3CFO A;  4CF9 A;  1CLQ A;  3AVB A;  3AA5 X;  1ZBU A;  3OYD A;  3SQ1 A;  4CF0 A;  1S6P A;  4DTP A;  4DWI A;  3C6U A;  4J2D A;  5C42 A;  3OS0 A;  2RN2 A;  1SL2 A;  1JXB A;  4CIE A;  3KLH A;  4HUE A;  4CJP A;  4IG3 A;  3T1A A;  4E1N A;  3SV3 A;  4W5Q A;  2KTQ A;  1NK4 A;  1B92 A;  4DTO A;  3AVC A;  3NCI A;  3ZSV A;  3K5N A;  4N5S A;  3SYZ A;  3RRH A;  4AIL C;  4FZX C;  4RW9 A;  1REV A;  1RT1 A;  1EET A;  3LPT A;  4FM0 A;  3DOK A;  2YV0 X;  1JLQ A;  1IG9 A;  3AO5 A;  3WNF A;  1D9D A;  4CFB A;  4FJH A;  1GOC A;  4PY5 A;  3SUP A;  1DTT A;  4FLT A;  4CF1 A;  3HP9 A;  4LH4 A;  3TAE A;  1IKV A;  4CIF A;  3L3V A;  1VRU A;  4DQS A;  3SPY A;  4OJR A;  3KK3 A;  1KLM A;  2XY7 A;  4CFA A;  4Q5V A;  3C6T A;  2Z1J A;  3LAL A;  2FBT A;  3DOL A;  2D0C A;  3LP0 A;  1NKC A;  1ITG A;  1RIL A;  3AVM A;  5CYM A;  3OYC A;  4FJJ A;  1TL1 A;  2P1J A;  1T8E A;  1ZBF A;  3PX6 A;  3RMB A;  3M8R A;  4B9V A;  4PA1 A;  3ITH A;  2HHS A;  4Z4G A;  1R0A A;  4KB0 A;  1JLC A;  2HNZ A;  3OJU A;  3NGI A;  1HYV A;  2IDO A;  5KGW A;  4CK1 A;  2VG6 A;  4Z4F A;  1S1T A;  4B9T A;  3AVH A;  4W5T A;  4NCA A;  4JS5 A;  4CJK A;  4ELU A;  1BQN A;  4K8X A;  4G1Q A;  2R7Y A;  4KPY A;  3TAF A;  4I9L A;  2HHV A;  3HPG A;  4FJM A;  1QQC A;  3NF6 A;  4KHY A;  3WNG A;  1J53 A;  4DFP A;  1U4B A;  4N76 A;  4W5O A;  1XI1 A;  4FZY A;  1RDC A;  5HRP A;  4O44 A;  1GOB A;  2X6S A;  1J9A A;  1GOA A;  3L2Q A;  4IG0 A;  4E7J A;  1HMV A;  1O1W A;  3LP3 A;  2IGI A;  2VG7 A;  3HPH A;  4EP4 A;  5J2P A;  1IKW A;  3PO5 A;  4CK3 A;  1KFS A;  3KKR A;  2YHA A;  1S1X A;  4DTX A;  1X9M A;  3CQ8 A;  3P1G A;  4DTN A;  2HB5 A;  2G8K A;  2YNF A;  4O5B A;  3V4I A;  4KHU A;  3DLR A;  3V1R A;  4DG1 A;  3PX4 A;  2WON A;  4MFB A;  3KLF A;  3VQD A;  1C0M A;  1U48 A;  4DSL A;  3KLI A;  3VQQ A;  3OYL A;  2PY5 A;  1QHT A;  3L8B A;  4HCB A;  3NE6 A;  3TI0 A;  2OZM A;  1TKD A;  4OKJ A;  3WNH A;  3G0Z A;  1L3S A;  4CJE A;  3DLH A;  3DMJ A;  4B8C A;  3SNN A;  4FJ9 A;  4M3T A;  3OYB A;  3QET A;  1HYS A;  4FLV A;  3VQ5 A;  1RTH A;  1LWC A;  1U04 A;  2Y1I A;  3TAQ A;  4DSE A;  4JRQ A;  1SL0 A;  1D8Y A;  4B9U A;  4AHC A;  2Q3S A;  4FJK A;  1RT5 A;  1RDA A;  1VSH A;  1NK9 A;  2HHW A;  4H4M A;  2AJQ A;  3AO3 A;  3SUN A;  3PY8 A;  2KQ2 A;  4LSN A;  3VQ4 A;  4QOZ B;  4PQU A;  1C1B A;  3ZCM A;  4F8R A;  1ASW A;  3A2F A;  4KO0 A;  4CF8 A;  4L8R B;  1NJY A;  3V9S A;  1EP4 A;  4BDP A;  3MED A;  3D0P A;  4FXD A;  4JS4 A;  4C8L A;  3K2P A;  4M3U A;  2A1S A;  2YKN A;  3LPU A;  4CED A;  1L3T A;  3MXI A;  3DI6 A;  4I2P A;  3NHG A;  4HHT A;  3ZSY A;  2XY6 A;  5HLF A;  4CGI A;  3V9W A;  4DTU A;  4JRP A;  4CHY A;  4YFU A;  1BQM A;  3TWH A;  2YNG A;  4CEC A;  3HYF A;  4CGJ A;  4DTS A;  3SJJ A;  1YTA A;  5EU7 A;  4AHR A;  1CXU A;  3LDS A;  3TAR A;  1KVA A;  3WNE A;  5SWM A;  1XHZ A;  1NK0 A;  3MXM A;  2IOC A;  4NYF A;  1LAW A;  1S9G A;  3OYJ A;  3KD1 E;  4F2S A;  4CE9 A;  2QKB A;  3THV A;  1BI4 B;  1K6Y A;  1UOC A;  5HBM A;  2KZZ A;  3KKS A;  2X74 A;  4CF2 A;  4DSF A;  4FK2 A;  4FYD A;  3NFA A;  1KRP A;  4KHW A;  1VSI A;  3PUF A;  3H08 A;  4RG8 A;  1TKZ A;  4CFC A;  2DFE A;  2Z1I A;  1C0U A;  1G15 A;  3OYH A;  1VSE A;  4CEE A;  1C0T A;  2Z1G A;  4NYN A;  4CEF A;  3VA0 A;  4CJ4 A;  4DMN A;  3OY9 A;  3SCX A;  5HRO A;  2HHQ A;  4LD0 A;  4CGH A;  2OA8 A;  3NDK A;  1VSF A;  3VQA A;  1D5A A;  4FJI A;  2BDP A;  4ID1 A;  4KB1 A;  2IC3 A;  4CGG A;  3O4N A;  5CY4 A;  4MQ3 A;  2YNH A;  4B08 A;  2OPP A;  3LP1 A;  4FM2 A;  2KW4 A;  4CIG A;  1A5V A;  1CZ9 A;  3RR7 A;  3U3G A;  3O3G A;  4M41 A;  1QS4 A;  1UWB A;  4RW8 A;  3ZSX A;  3OYE A;  4DSI A;  2G8H A;  1NJZ A;  3JYT A;  1ASV A;  1X1P A;  2W42 A;  4UQG A;  3HST B;  4CEA A;  4C8O A;  4FW2 A;  1ZBH A;  1FXX A;  2FBX A;  1YT3 A;  3IRX A;  4KTW A;  1UAX A;  3EZ5 A;  1VSK A;  4IKF A;  4Z4C A;  1SL1 A;  5I42 A;  4M3X A;  3DM2 A;  3DRP A;  2ATQ A;  1JLA A;  1KSP A;  4O55 A;  1TAQ A;  3NH1 A;  3LWL A;  3ZT3 A;  4F3T A;  3QLH A;  1UA0 A;  4W5N A;  1WSF A;  2DFH A;  1L5U A;  1W0H A;  4OKK A;  3PV8 A;  2OPQ A;  4DS4 A;  4KTQ A;  5T7B A;  1JLG A;  2Y1J A;  3AVG A;  3LP2 A;  4IFV A;  3K5L A;  1RT4 A;  1L3V A;  2QK9 A;  4F4K A;  2ZQB A;  2D0B A;  3P5J A;  2I5J A;  2HW3 A;  1WNS A;  3TAB A;  4EZ6 A;  3V1Q A;  3O3H A;  1X9W A;  3M8S A;  5SZT A;  1NK8 A;  3V9Z A;  1WN7 A;  2XRI A;  4IFY A;  3SZ2 A;  1X9S A;  2HHX A;  1MU2 A;  4B3O A;  1QSS A;  1RTJ A;  3V6D A;  2G8W A;  1RDD A;  2P51 A;  2HVI A;  4LY7 A;  4B9S A;  1LV5 A;  3HP6 A;  4FW1 A;  4DQQ A;  1WAF A;  4FK4 A;  4BDY A;  3K5O A;  3VQE A;  3SQ0 A;  2F8T A;  3MEC A;  1TAU A;  3K5M A;  3VQP A;  1VK0 A;  3EYZ A;  3V9U A;  1UA1 A;  3CFP A;  1WSJ A;  3QEX A;  4KI6 A;  2BE2 A;  1I3A A;  4H8K A;  4BE0 A;  1KLN A;  1ZBL A;  2ZD1 A;  4FJX A;  4HUF A;  4E0D A;  1JLF A;  3IG1 A;  3QEV A;  1ASU A; 
#chains in the Genus database with same CATH topology
 2EX3 A;  4CHQ A;  5BPN A;  2Q0U A;  3T19 A;  5AQQ A;  3SUQ A;  3U9D A;  1B9D A;  4CZE A;  4FVM A;  3RR8 A;  3FZL A;  4IJA A;  1HNZ K;  4DTJ A;  4OLB A;  2P9P B;  2ZWH A;  4FWL A;  1GLE G;  3AA3 A;  3WXM B;  1OVQ A;  1E4G T;  4M45 A;  1SKS A;  1ZBI A;  3OS2 A;  3CIP A;  3BY5 A;  1HLU A;  4CCH A;  4CZL A;  1T03 A;  5AQM A;  1NM1 A;  2HHH K;  5AQW A;  3VQB A;  2DPN A;  2ZGY A;  3K58 A;  4C8K A;  1T05 A;  5JS2 A;  2FSN A;  1VHX A;  4DV5 K;  4BG8 A;  4FSV A;  2ZJR L;  4CHZ A;  1BIZ A;  2A40 A;  4ZTF A;  2QWM A;  4MLH A;  3FLC O;  1QSY A;  1NOY A;  4IWV A;  5BRF A;  1IKY A;  1Q9Y A;  4H5T A;  5A2Q O;  5TKW A;  5JLF A;  2XY5 A;  1NGI A;  1K9M O;  4A2A A;  1OH8 A;  3QEP A;  1NMN A;  1VQN N;  5BR8 K;  5E26 A;  4FK0 A;  2G8V A;  4GV9 A;  3LDQ A;  1YVU A;  2RPI A;  4K0K K;  2NRV A;  1WSI A;  2Z1H A;  5AQU A;  3QES A;  1HQU A;  5FPN A;  5J1E A;  4KFB A;  4M42 A;  1D9F A;  4GVM A;  2QWO A;  3G25 A;  1QZ5 A;  4BWM A;  3FFI A;  1TGO A;  4A5B A;  1JL1 A;  3SQ2 A;  1TK5 A;  2UUB K;  2F8S A;  4Q0B A;  1VSM A;  3RTV A;  3OYK A;  1WLJ A;  3V81 A;  1HJR A;  1CXQ A;  1RT6 A;  5CZ1 A;  5AJ3 K;  3THY A;  3CD6 N;  4I2Q A;  5EOY A;  1LWF A;  1RBT A;  4B1Y B;  3HXM A;  1SUQ A;  3QB0 A;  1Q18 A;  1RBR A;  2NUB A;  3LDO A;  1K8A O;  4JI3 K;  3ISN C;  4I7F A;  4BVO A;  4B3T K;  3H46 O;  1XUP O;  3KWG A;  2VG5 A;  2HOE A;  4KTZ A;  2HVH A;  1RFQ A;  4CES A;  3NMU A;  5M1Q A;  1Z25 A;  4YNQ A;  3MK6 A;  4BE1 A;  4DF8 A;  1YUW A;  1JLB A;  4Z4H A;  5AQJ A;  4FJ8 A;  1BGX T;  5KPR A;  3VET A;  5KQD A;  3DYA A;  3U9Z A;  1KCF A;  4B3R K;  5KRT A;  3SPZ A;  4OKE A;  2IS3 A;  3ZX3 A;  4OVL A;  4HTU A;  4OLA A;  3D7E O;  5GIP A;  4CD3 A;  4MDB A;  3ZT2 A;  2ZJP L;  4RW4 A;  4KHN A;  4E19 A;  1Q81 O;  1BCM A;  4BGA A;  1SAZ A;  4JK8 A;  3O9S A;  3L2R A;  3LZI A;  3KD5 E;  3FGU A;  1NGC A;  2P9K B;  2Q97 A;  4KRF A;  2GUI A;  3OBW A;  3VOV A;  4IJN A;  4XH5 A;  2KFZ A;  4IBN A;  1J5E K;  1TK8 A;  1JXE A;  2B5J A;  1ZXO A;  5E41 A;  1BIS A;  3MMV A;  2QI2 A;  2QW9 A;  2NRR A;  3S3N A;  3V9X A;  3VQ8 A;  1TV6 A;  3A5O C;  1RBV A;  3P38 A;  3ULE A;  3ZSR A;  5GAH P;  2BAN A;  3JSM A;  2FC0 A;  4C8M A;  3E9P A;  2F96 A;  4PHT X;  4B1W B;  4KH4 A;  4X65 K;  1NGB A;  4K42 A;  3OYM A;  3THX B;  4KRE A;  4EP5 A;  3VGM A;  5H1S Q;  3CI5 A;  4NCG A;  2B6A A;  3F9K A;  1QZ6 A;  1U2V B;  2B4J A;  5BPM A;  4CGF A;  4JKG B;  2KLA A;  4AHU A;  1N34 K;  1FKP A;  3O80 A;  4CJW A;  5F0X A;  1A5X A;  4CF9 A;  3OYD A;  2P9L A;  3SQ1 A;  3TPQ A;  4CF0 A;  4DTP A;  3UKU B;  5C10 A;  3BF1 A;  3BZK A;  3SJH A;  3I8B A;  2O8C A;  3NCI A;  3K5N A;  4FZX C;  3RRH A;  1VQ8 N;  1EET A;  2PFU A;  2Q1N A;  1JLQ A;  3WNF A;  1N8R O;  4WYB A;  5C2D A;  4PY5 A;  2NZT A;  4JI8 K;  3HP9 A;  4LH4 A;  1VQL N;  3SAG A;  4BR0 A;  3SPY A;  4OJR A;  1X3N A;  3LP0 A;  2FBT A;  4H5N A;  5CYM A;  5CHI A;  4U67 L;  1WOQ A;  4EFH A;  1T8E A;  1XNQ K;  2QXL A;  3M8R A;  5JMV A;  4Z4G A;  5IT9 O;  3AGK A;  1HYV A;  3BZC A;  4CK1 A;  4ISE A;  3AVH A;  3ZYY X;  4K8X A;  4G1Q A;  1S3X A;  3D2F A;  2E8A A;  3E66 A;  4PKG A;  1QQC A;  3NF6 A;  4KHY A;  3SMS A;  5FLX O;  5HRP A;  4JN4 A;  4FPB A;  2X6S A;  1O1W A;  3R1X A;  4BRP A;  3PO5 A;  3H1V X;  3O1B A;  4DR7 K;  3E9O A;  2HB5 A;  4JKH A;  3AAQ A;  3DLR A;  3PX4 A;  1GLB G;  3OYL A;  2PY5 A;  4WCE L;  1VQ9 N;  4YDU A;  1TKD A;  4CJE A;  3DMJ A;  4B8C A;  4M3T A;  4JI5 K;  3OYB A;  1VQ6 N;  1HYS A;  4FLV A;  1T3V A;  3T1Y K;  3CCR N;  3VQ5 A;  3T69 A;  4JRQ A;  4BRN A;  1NG9 A;  3SUN A;  4QS9 A;  1KAZ A;  2QTD A;  4PKI A;  1C0F A;  3VEZ A;  1NGE A;  4BDP A;  4M3U A;  1L3T A;  2ASP A;  4FOE A;  3ZSY A;  4H0P A;  2E1Y A;  1T6D A;  3QFU A;  4B1Z A;  4DTU A;  4JRP A;  3HYF A;  4CGJ A;  4DTS A;  1KVA A;  4BRG A;  2IOC A;  2QWL A;  4F2S A;  3VGK A;  1YJ9 N;  5HBM A;  4FK2 A;  4J8F A;  2BH1 A;  1R59 O;  4KHW A;  1VSI A;  4RG8 A;  3H08 A;  1NGG A;  3WXK A;  2P9N B;  1VQ7 N;  3H1Q A;  1VSE A;  3OYH A;  1YIJ N;  4NYN A;  3K9K A;  4CEF A;  4CJ4 A;  3OY9 A;  3DJC A;  3O1W A;  1KXP A;  3C6H A;  1N36 K;  4KB1 A;  5AQY A;  3F2K A;  3O4N A;  4FWR A;  1OH6 A;  4MQ3 A;  3C7N B;  3DXM B;  2IVP A;  3VEX A;  3RR7 A;  3O3G A;  3OHR A;  4M41 A;  2GUP A;  2UXC K;  1NJZ A;  1RDW X;  4EAH D;  3O08 A;  4DR4 K;  2F9T A;  1YF5 L;  2FBX A;  1YT3 A;  4KTW A;  4IKF A;  4Z4C A;  1SL1 A;  1BDG A;  4M3X A;  3DM2 A;  2PAV A;  4IO8 A;  4U7B A;  2ATQ A;  4F3T A;  1TAQ A;  1UA0 A;  1WSF A;  2DFH A;  5ELZ A;  1W0H A;  1BG3 A;  1MDU B;  4DS4 A;  5T7B A;  1JLG A;  1RT4 A;  2UXD K;  2GEM A;  2ZQB A;  2D0B A;  5GIN A;  1WNS A;  4M7X A;  5IWA K;  3THY B;  1X9W A;  4O5F A;  1NK8 A;  1W7A A;  1WN7 A;  2XRI A;  3RSE A;  3QBX A;  3V6D A;  4B9S A;  3HP6 A;  3VQE A;  4FOI A;  4WF9 L;  3DLL L;  2O8D A;  1QVG M;  3ZEU A;  1HNW K;  4KI6 A;  4Y0W A;  3OTO K;  3CC4 N;  2ZGZ A;  1KLN A;  1ZBL A;  1T44 A;  4E0D A;  4JKC A;  4KH5 A;  1JLF A;  3IG1 A;  1ASU A;  3TAN A;  3NGZ A;  4XIU A;  5FPM A;  3HZ6 A;  4B1X B;  1VSJ A;  4N47 A;  2LSN A;  4M3Z A;  5ADX A;  1VQP N;  3EKU A;  4CJQ A;  4LSL A;  3ATU A;  3MAQ A;  4Z94 A;  4B9M A;  1NNE A;  3S9H A;  1JKH A;  4DFK A;  3WXL A;  3AVF A;  3LWM A;  1KVB A;  3SAF A;  1NOZ A;  1ZBS A;  2FSK A;  4N56 A;  4DSK A;  3KK1 A;  2F7T A;  4WE1 A;  5FDL A;  1BA0 A;  1VRT A;  1XHX A;  4QS7 A;  4O8U A;  3WEE A;  4RW7 A;  2D0P A;  3CXC M;  3OYF A;  5J2M A;  1W97 L;  1NMD A;  1EX4 A;  4B9N A;  2G8F A;  1XWL A;  5AZI B;  4EZ9 A;  4DR6 K;  4ICL A;  1M1K O;  3BDP A;  3CCQ N;  1C6V A;  3JAM O;  3PIO L;  3WT0 A;  3CM6 A;  1WSH A;  4DU3 A;  3EY1 A;  4CZI A;  4W5R A;  2CGK A;  2OYQ A;  1LW2 A;  1NKB A;  3IAY A;  2NNW A;  1IJJ A;  3QEW A;  3L2U A;  4AM6 A;  1NGH A;  4CHO A;  1N33 K;  3MN7 A;  2XO7 A;  4FJ7 A;  4F3O A;  4A5A A;  2VWJ A;  2HHT A;  4Y1C A;  2ITM A;  3VQ7 A;  3L4Q A;  3HO1 A;  3AO1 A;  4YOX A;  3CM5 A;  3P83 D;  2GBZ A;  3S3O A;  1J5O A;  2UYT A;  3OJS A;  3NBP A;  5HRR A;  4CHN A;  1FK9 A;  2YX6 A;  5J2N A;  1SZ2 A;  4GMJ B;  5JS1 A;  1NK5 A;  3VGL A;  4KKO A;  3KZB A;  3HPO A;  3F9M A;  1U6Z A;  3NGY A;  2HMI A;  3Q7B A;  4H0X B;  4XH4 A;  4DFM A;  1YAG A;  2O8C B;  3TAM A;  3DWL A;  5AFU A;  5LJW A;  4HVJ A;  5CYQ A;  3TTF A;  4BRK A;  5F1X A;  3VEV A;  1EWQ A;  3RMA A;  1HNX K;  3EN9 A;  2W6L A;  3IMX A;  3J81 O;  3E01 A;  4AHS A;  1NGJ A;  1G99 A;  3FR0 A;  4DKW A;  2UU9 K;  2QWR A;  4I6M A;  1S1U A;  1CZB A;  3KK7 A;  5F2R A;  5C15 A;  3T3F A;  4FLZ A;  3OVN A;  3V1O A;  2X78 A;  3QEX A;  1RCH A;  4YOY A;  3HM9 A;  4AHV A;  3SV4 A;  5HP1 A;  4W5N A;  3CER A;  5TKY A;  4YHH K;  1IO2 A;  3D2E A;  3LAN A;  2RF2 A;  2A41 A;  3W0L A;  4CJR A;  3WXI A;  1LWE A;  3AO4 A;  1LCU A;  4R5P A;  4B9Q A;  4H5R A;  4GW6 A;  4FM1 A;  2WUS A;  4J2E A;  3IDH A;  4H4O A;  3K59 A;  5K14 A;  3BGR A;  4QCL A;  4B9L A;  4KI4 A;  4CBX A;  3LAK A;  1NK6 A;  3ZSZ A;  4KAZ A;  1HNI A;  3CYM A;  5J2Q A;  1VAZ A;  3DAW A;  5AQS A;  2A1R A;  4HTL A;  4Z4I A;  3EO3 A;  4FJL A;  1U45 A;  4H0O A;  3MWT A;  3SBT A;  1TL3 A;  2D5R A;  1HX1 A;  2IIR A;  5AQO A;  4BDZ A;  4DSJ A;  4JKB A;  1EKE A;  2BGG A;  1WAJ A;  4B8A B;  3QEI A;  1Z26 A;  5C25 A;  4JHD B;  3AO2 A;  2IAJ A;  4M3W A;  3HOS A;  3L4I A;  3OYI A;  1RTD A;  3FE1 A;  1VSL A;  2HBK A;  1ILY A;  3KLG A;  1TYQ A;  1J54 A;  4DLE A;  4CJF A;  1BA1 A;  1VQ4 N;  1OVY A;  3RRG A;  2GTD A;  4ZTJ A;  3LZJ A;  4PUO A;  4BWJ A;  2OAN A;  2QA4 N;  3LM9 A;  3NF9 A;  3LL3 A;  4QAG A;  1F21 A;  2HMP A;  3ZET A;  5JLH A;  2QXF A;  4X62 K;  2VGM A;  3K57 A;  3B8A X;  4X66 K;  2I7P A;  4HUG A;  3THW A;  3QIN A;  5BR9 A;  4JI2 K;  3QDK A;  1K8K A;  4IOX A;  3OS0 A;  1Y64 A;  5LL6 Z;  2RN2 A;  2OTJ N;  4H0T B;  4OX9 K;  3KLH A;  4HUE A;  4E1N A;  1YI2 N;  3T1A A;  2KTQ A;  3OW2 M;  1NK4 A;  4AIL C;  3ZSV A;  3A5M C;  3SYZ A;  4JD2 B;  2VQE K;  1REV A;  3LPT A;  3DOK A;  4WFB L;  4WFN L;  4JK7 A;  1IG9 A;  4DR1 K;  1D9D A;  4FJH A;  3MN6 A;  4A57 A;  4CF1 A;  3M5R A;  3L3V A;  2ZF5 O;  3O4W A;  1KLM A;  4Q5V A;  1NKC A;  2Z1J A;  2D0C A;  4H0Y B;  5AQL A;  2HF3 A;  3EL2 A;  3RMB A;  4B9V A;  3DXK A;  4KB0 A;  4JK9 A;  4JEP A;  2A3Z A;  2HNZ A;  3LM2 A;  2VG6 A;  4B9T A;  1FJG K;  4W5T A;  2O8E A;  4ELU A;  1BQN A;  2P9I B;  3ID6 A;  4KPY A;  4WQ4 C;  3VPZ A;  3CCU N;  3TAF A;  3HPG A;  4FJM A;  3HSC A;  2YI1 A;  1QQM A;  1J53 A;  4LC9 B;  1U4B A;  4N76 A;  1XI1 A;  3UKR A;  4JKD A;  1GOB A;  1GOA A;  3HBT A;  4IG0 A;  4RWT A;  4E7J A;  2O8D B;  3LP3 A;  3HPH A;  3ZEU B;  1IKW A;  3KKR A;  2YHA A;  3CQ8 A;  2P9S B;  2G8K A;  3V4I A;  1DEJ A;  3OBY A;  1U48 A;  4DSL A;  3KLI A;  4GV6 A;  1QHT A;  3L8B A;  3TI0 A;  4M63 C;  3WNH A;  4B1V A;  3L6Q A;  3TU5 A;  2ASM A;  5AQI A;  1LWC A;  1U04 A;  3TAQ A;  5DM7 L;  4B9U A;  1SL0 A;  3GG4 A;  3O5B A;  3P4I A;  1VSH A;  1EWR A;  1LOT B;  1V4T A;  4XEI A;  4BGB A;  3ZCM A;  4KO0 A;  4CF8 A;  3N4P A;  3L0Q A;  4DR2 K;  2GWJ A;  1HJO A;  1NJY A;  4FL9 A;  3D0P A;  3TSP A;  4JS4 A;  1JCE A;  2A1S A;  4AQY K;  4DB3 A;  2QWQ A;  3J80 O;  3NHG A;  3WEE B;  4MDA A;  4BRO A;  2XY6 A;  5HLF A;  3GL1 A;  1BQM A;  1M90 O;  1YTA A;  4AHR A;  4LFA K;  4NYF A;  3OYJ A;  1S9G A;  4CE9 A;  2OTL N;  1VQ5 N;  5AQF A;  4IEE A;  5B8H A;  4EIA A;  3FZH A;  3HM8 A;  2UXB K;  3PUF A;  3TSQ A;  1G15 A;  3CCL N;  1OKJ A;  2CGL A;  4CGH A;  2OA8 A;  4RTF D;  1VSF A;  2BDP A;  4CGG A;  5CY4 A;  2OPP A;  1BOT O;  2KW4 A;  5DM6 L;  1A5V A;  4ISG A;  2H3G X;  1CZ9 A;  3ENB A;  3P31 A;  1QS4 A;  1UWB A;  4DSI A;  4MO4 A;  2G8H A;  3CJB A;  1XMO K;  3HST B;  4C8O A;  1ZBH A;  3J7A P;  1FXX A;  3IRX A;  1UAX A;  1VSK A;  3G4S N;  3ZT3 A;  3QLH A;  1X9J A;  2Y1J A;  5KPZ A;  4F4K A;  3P5J A;  4YOT A;  3TAB A;  4LFB K;  2FXU A;  4IDH A;  5SZT A;  2YJF A;  3V9Z A;  1X9S A;  2P9U B;  1RTJ A;  2P51 A;  2HVI A;  2NLX A;  1LV5 A;  4BDY A;  3IFR A;  2F8T A;  3CCE N;  1TAU A;  2NRZ A;  3MX2 A;  3CFP A;  1FW6 A;  4H8K A;  4BE0 A;  3VEN A;  2ZD1 A;  4CZK A;  4FJX A;  4HUF A;  3UB5 A;  1H1V A;  3SMP A;  3VES A;  1Z6R A;  2FF3 B;  3L3U A;  2PYJ A;  4GVE A;  4AM7 A;  4DV0 K;  3LDP A;  3I8D A;  3FFK B;  2ITG A;  5KGX A;  3AVN A;  2V7Y A;  2P9P A;  4CJU A;  3AAR A;  2IVN A;  2IVO A;  3ZSO A;  3AA2 A;  5M1O A;  4M3R A;  5D3G A;  3TAG A;  2Q0R A;  1RNH A;  2E20 A;  4E7I A;  1IKX A;  2VWK A;  2D1K A;  4MLE A;  2JLE A;  1RBU A;  3HL8 A;  3AVA A;  4ELV A;  3NVK A;  1EQY A;  3HT3 A;  4E7K A;  2QKK A;  4CJ3 A;  4JI6 K;  3MEE A;  1JCF A;  4AH9 A;  3O9R A;  3K0S A;  1L3U A;  3AVK A;  1HPZ A;  3KIO A;  3CCM N;  4ELT A;  3WQT A;  4MO5 A;  1HUX A;  1S1W A;  4ZHR A;  3SI6 A;  1HNV A;  2YCH A;  1RTI A;  4IZ9 A;  4Z0U A;  3VTH A;  3HTV A;  3SUO A;  4KHQ A;  5LY3 A;  2YHX A;  4CZG A;  1BI4 A;  1DLO A;  2AA4 A;  2FSJ A;  1C0G A;  1BHL A;  5CR4 A;  1QTM A;  1RT2 A;  1T6C A;  5GAG P;  1SKR A;  4TSX A;  3R8E A;  3NH2 A;  1GLC G;  2E4L A;  4O4G A;  5JVH L;  4KV8 A;  4NXN K;  5ADX H;  1ESV A;  2O4G A;  4YOW A;  2OCE A;  3CQY A;  3RMC A;  1JLE A;  2X6N A;  2BTF A;  1HKB A;  3H45 C;  5EY4 A;  4FWQ A;  4BRI A;  2HHU A;  2E6M A;  4FLW A;  3H6E A;  3VA3 A;  2E2N A;  3O8M A;  3VQC A;  1JJ2 M;  3K9J A;  4FLU A;  4LF7 K;  3BUZ B;  1U49 A;  5KPT A;  4CW7 B;  5FRN A;  5GAD P;  3B6O A;  3I0R A;  3LAM A;  3ALY A;  1TVR A;  3KJV A;  3DLE A;  5FPD A;  5DK5 A;  1C1C A;  3UE5 A;  3QIP A;  3AVI A;  2JGU A;  2E2Q A;  3AVJ A;  5C24 A;  5JVG L;  1IG8 A;  4RW6 A;  3QNN A;  3VMF B;  4F2R A;  3EE8 A;  1B9F A;  4E7L A;  3IUC A;  3ZX2 A;  4BC5 A;  3O6W A;  3CCJ N;  1S9E A;  3NH0 A;  4YOR A;  2DTU A;  3CJ1 A;  4X64 K;  3C94 A;  2WTU A;  3KLE A;  4DU4 A;  3ULD A;  2HND A;  3QBW A;  3AV9 A;  4FWM A;  4CFD A;  2OPR A;  5AZJ A;  4KHU A;  3NF8 A;  3MEG A;  3PX0 A;  4IDK A;  3DLB A;  1NJX A;  2QWN A;  4HCC A;  4F9O A;  1D4X A;  4FZZ A;  4DV4 K;  3AY9 A;  4BR2 A;  5BN9 A;  4BVP A;  1NK7 A;  3R6M A;  3TTD A;  5GIO A;  2W40 A;  4IFE A;  4DQP A;  4J2B A;  3H3O B;  3UKR B;  4DUY K;  4CK2 A;  3MN5 A;  1NLV A;  4NLC A;  4DQI A;  3DRS A;  4R79 A;  1VQM N;  3J8A A;  1IBK K;  1HQE A;  4CI6 A;  2GX9 A;  1NU0 A;  5DMR A;  3T1H K;  3RVC A;  5AFU H;  3C6A A;  4WQ4 A;  2P9K A;  1W9H A;  1JCG A;  4CJ5 A;  4A61 A;  3FZM A;  5M1N A;  2HBM A;  4E1M A;  1VSD A;  3GDQ A;  2O8B A;  2PYL A;  4G9Z A;  5EX5 A;  1Y97 A;  5FRM A;  4I9Q A;  4AHT A;  2KZM A;  2YHY A;  1S72 N;  2YKM A;  4FWS A;  3N4Q A;  3ULE B;  4C1N I;  4NCB A;  1N6Q A;  1TK0 A;  3HK2 A;  3G71 N;  3QNO A;  1N5Y A;  4FLY A;  3SQ4 A;  4DF4 A;  3CFR A;  5CE3 A;  3THX A;  4L3Q A;  4IOC L;  3U6F A;  1YTU A;  1RDB A;  3AGR A;  3G10 A;  4ID5 A;  3HOT A;  1KVC A;  1BIU A;  4CJL A;  1Q9X A;  1Q8I A;  2ZE2 A;  1FKO A;  3I0S A;  4N41 A;  4JKG A;  1WB9 A;  4CHP A;  4BAC A;  3EKS A;  3SAH A;  2CH6 A;  3L2V A;  3OYN A;  3AVL A;  4BR4 A;  3CG7 A;  2O4I A;  3CFO A;  3E9L A;  4LF4 K;  1ZBU A;  2A5X A;  2P9L B;  4DWI A;  1NGA A;  3C6U A;  3UKU A;  4W5Q A;  1B92 A;  3AVC A;  4IXC A;  4N5S A;  1KD1 O;  3WQU A;  1RT1 A;  4NXM K;  2E1Z A;  4CFB A;  3NVM A;  1GOC A;  4A2B A;  3PIP L;  3SUP A;  1KAX A;  4ILJ A;  4V19 S;  3TAE A;  1IKV A;  1VRU A;  3KK3 A;  2XY7 A;  3C6T A;  3LAL A;  4FJJ A;  1RIL A;  3AVM A;  4GNI A;  2P1J A;  4JI1 K;  4CJ7 A;  3PX6 A;  4PA1 A;  3ITH A;  1KC8 O;  2HHS A;  1R0A A;  3T7Z A;  1JLC A;  4JNE A;  4Z4F A;  4K43 A;  4NCA A;  4JS5 A;  4CJK A;  4JI7 K;  2HHV A;  3D2F B;  3WNG A;  1ATR A;  2O8F A;  3EZW A;  4FZY A;  3HRG A;  1J9A A;  3I55 N;  1HMV A;  5LMN K;  2IGI A;  4EP4 A;  3CC2 N;  4JAX A;  3HI0 A;  1ZC6 A;  3P1G A;  4DUZ K;  2YNF A;  5LMU K;  2WON A;  4BC2 A;  4MFB A;  1SS6 A;  3VQQ A;  4HCB A;  3NE6 A;  2OZM A;  4OKJ A;  1L3S A;  3G0Z A;  3SNN A;  3QET A;  1RTH A;  5HOO A;  4BRM A;  4EHU A;  2Y1I A;  4LF9 K;  5JIC A;  4AHC A;  1W2B M;  1RT5 A;  1NK9 A;  3VEO A;  2HHW A;  1MA9 B;  4QOZ B;  4BR7 A;  4F8R A;  3A2F A;  4L8R B;  5AQX A;  3V9S A;  1WBB A;  3J7Y P;  4C8L A;  3K2P A;  5I9E B;  3LPU A;  4BC3 A;  4H5V A;  3OA9 A;  3DI6 A;  3A0I X;  1IBM K;  3GOI A;  4HHT A;  3ATV A;  4IO9 L;  4CGI A;  3WUH A;  1Q86 O;  4DR3 K;  2YNG A;  4BQZ A;  4CEC A;  3SJJ A;  5EU7 A;  3LDS A;  3TAR A;  5SWM A;  3MXM A;  1LAW A;  2QKB A;  3THV A;  1BI4 B;  3D6R A;  1UOC A;  3KKS A;  2X74 A;  3CPE A;  5BRD A;  4CF2 A;  4DSF A;  4CBW A;  4FYD A;  3QFP A;  3M1F A;  4ISF A;  4CFC A;  5AQZ A;  1TKZ A;  2P9N A;  4CZH A;  2DFE A;  2QEX N;  2Z1I A;  1C0U A;  1C0T A;  3SCX A;  2W41 A;  4WQ5 C;  5HRO A;  2HHQ A;  4LD0 A;  3NDK A;  4DR5 K;  2VQF K;  4FJI A;  3FZF A;  3C7N A;  3DXM A;  2PBD A;  3ENH A;  3LP1 A;  3R9P A;  3ZSX A;  4BC4 A;  3CCV N;  1HR0 K;  2W42 A;  1ASV A;  1X1P A;  4UQG A;  1YIT N;  3O9U A;  3I33 A;  1XMQ K;  3MWP A;  3BEX A;  1S22 A;  3W3D A;  1KSP A;  4O55 A;  3NH1 A;  1YJW N;  4OKK A;  3PV8 A;  4K41 A;  2OPQ A;  3SBG A;  3AVG A;  4JKE A;  3LP2 A;  4IFV A;  3K5L A;  4BRL A;  4PL8 A;  2QK9 A;  2HW3 A;  4EZ6 A;  3V1Q A;  3LDL A;  4XH1 A;  4DV3 K;  1IBL K;  2HHX A;  2NRT A;  3SZ2 A;  1MU2 A;  3RSE B;  2G8W A;  5AQG A;  1P90 A;  4C23 A;  1KAY A;  4DQQ A;  1KQS M;  1K73 O;  5E84 A;  4DCH A;  3MEC A;  3VQP A;  4KHP K;  1VK0 A;  3CF5 L;  2I7N A;  3EYZ A;  1UA1 A;  1WSJ A;  3A5N C;  4BRA A;  4JKA A;  5AZJ B;  4NB4 A;  2D0O A;  1HPM A;  4KH6 A;  2J4R A;  2QM1 A;  3QEV A;  1NWK A;  4OO1 J;  2YJE A;  5C12 A;  1SV5 A;  1YXQ A;  4KBO A;  5CZ2 A;  4J2A A;  4WFA L;  4FVU A;  3ZSQ A;  2A42 A;  1SQK A;  3C95 A;  1RT7 A;  4FPA A;  4K8Z A;  5FRO A;  3I56 N;  2UUC K;  1KFD A;  1RT3 A;  4E3S A;  3M6G A;  4BRD A;  5HL7 L;  4O0I A;  3O3F A;  2NRH A;  4JI0 K;  3OYA A;  3ZT0 A;  4H5W A;  5M1K A;  3MX5 A;  3QIO A;  5AQN A;  5BPL A;  1I39 A;  4GKK K;  4OPA A;  2G8I A;  1S6Q A;  1TKX A;  5EXW A;  2O8B B;  3DLK A;  2OPS A;  1X3M A;  1RBS A;  3TR8 A;  1ZYQ A;  4C8N A;  5AZI A;  3MCP A;  3AA4 A;  2GV9 A;  1EXQ A;  4JLH A;  3VQ9 A;  3KWI A;  2P5O A;  1DKG D;  4UY8 O;  4DU1 A;  1BU6 O;  5HRS A;  3M8P A;  3M8Q A;  2WOM A;  5BRE A;  1U47 A;  2OZS A;  4Z4E A;  1QHA A;  1JL2 A;  1RDU A;  1IH7 A;  3A5L C;  3CJ9 A;  3S41 A;  2E2O A;  2Q2R A;  4E89 A;  2D4W A;  1LAV A;  4CEB A;  5M1F A;  1BCO A;  1NKE A;  2XHB A;  3CPW M;  4OPJ A;  3J7Z O;  1VQK N;  3OS1 A;  2P5G A;  1LW0 A;  4Y1D A;  3DRR A;  4CZM A;  4BG9 A;  2FLO A;  1HYZ A;  3RWU A;  3UIQ A;  1NBW A;  4GY2 B;  5KRS A;  4DLG A;  1DGK N;  3OYG A;  5HRN A;  3TAP A;  1E3M A;  4DS5 A;  3HVT A;  3PO4 A;  3ASM A;  2DFF A;  4CEQ A;  1YHQ N;  1I94 K;  3C0B A;  5BN8 A;  4LF5 K;  2VGN A;  3U3Y A;  3A8Y A;  4BY9 C;  2FBY A;  3D45 A;  3MDQ A;  4E7H A;  3B6P A;  2V7Z A;  3VQ6 A;  2HNY A;  1C1A A;  2JWK A;  1KTQ A;  3ID8 A;  3S3M A;  3PLA A;  3KVG A;  2G8U A;  5EVZ A;  4CJV A;  1BL3 A;  4LFC K;  4M7Y A;  2UUA K;  2DY4 A;  4DFJ A;  3L2W A;  1J6Z A;  3HJF A;  4O0J A;  3O4Q A;  4DTR A;  1TKT A;  3O9T A;  4CER A;  1TUY A;  4B3M K;  3VF2 A;  4I6M B;  2YHB A;  4AF1 A;  4BRF A;  1GLF O;  4CGD A;  1HRH A;  1S1V A;  2KHO A;  2ZM6 K;  4FJ5 A;  3ENO A;  3KTQ A;  4CEZ A;  2YNI A;  3PY8 A;  2V52 B;  1SKW A;  4DTM A;  4M3Y A;  2F4V K;  1WSG A;  3D2E B;  2AP1 A;  4CD1 A;  2E6L A;  3F5T A;  4KHS A;  2CGJ A;  3ZLJ A;  1XC3 A;  3AAP A;  4IOA L;  2NRX A;  2O8F B;  4BQL A;  4FJN A;  2D0A A;  3WXJ A;  3EE9 A;  2PZS A;  1XC9 A;  5C0Y A;  3ZT1 A;  4FJG A;  1WSE A;  1XNR K;  3CC7 N;  3QO9 A;  4A62 A;  4FLX A;  1HKG A;  4OGC A;  1QQO A;  2RKI A;  4BE2 A;  4DQ8 A;  4CJS A;  3F73 A;  3MCA B;  4DQR A;  5I3U A;  1NJW A;  3KK2 A;  4JV5 K;  4CZF A;  3TSU A;  3IS9 A;  1IV0 A;  3NAE A;  3RMD A;  4OGE A;  2CH5 A;  3MN9 A;  2ETJ A;  2GWK A;  4BR5 A;  3CME N;  4FCY A;  5C2F A;  3VEW A;  4FWP A;  4OPK A;  1WBD A;  2E88 A;  3HVR A;  2EHG A;  3CHW A;  4JHD A;  4DHY A;  1DT9 A;  4CEO A;  1OH5 A;  3SK3 A;  1QE1 A;  3TTC A;  4CJT A;  5GAE P;  3H3N O;  3PSI A;  1E4F T;  1P8Z A;  2XY8 A;  1TYQ B;  4LH5 A;  2RE2 A;  3QER A;  3ZSW A;  1HKC A;  4NLB A;  1YVN A;  4PWD A;  3ZT4 A;  1QQN A;  2E2P A;  5BRH A;  4BR9 A;  3MXJ A;  3DLG A;  5KI6 A;  2FBV A;  4LF6 K;  1S5J A;  3VN5 A;  3U8X A;  5LJV A;  1Q82 O;  3ZET B;  1A5W A;  2VYP A;  1DTQ A;  3NF7 A;  1T7P A;  2KKZ A;  5KTQ A;  1QSL A;  1GLL O;  4A59 A;  4YY3 K;  2A6A A;  3IKM A;  3JXU A;  3THW B;  4EHT A;  1CLQ A;  3AVB A;  1MWM A;  3AA5 X;  5KQ8 A;  4PKH A;  4J2D A;  1S6P A;  4FWK A;  3CJ7 A;  3JS6 A;  5C42 A;  1K8K B;  4GKJ K;  1BO5 O;  3C65 A;  5MLC Q;  1JXB A;  1SL2 A;  4CIE A;  4NO7 A;  3SV3 A;  4CJP A;  4IG3 A;  4BRH A;  1ATS A;  4DTO A;  4JD2 A;  5AQV A;  4RW9 A;  3SLC A;  4FM0 A;  1TUU A;  2YV0 X;  3CMA N;  3O9Q A;  3AO5 A;  2RHK A;  1OH7 A;  1GLJ O;  2NRW A;  1DTT A;  2YHW A;  3Q7C A;  4YOU A;  4FLT A;  3P39 A;  1ATN A;  3ZX0 A;  4CIF A;  4GV3 A;  4LF8 K;  3U4L A;  4DQS A;  3QIC A;  4CFA A;  3R3L A;  3DOL A;  2ASO A;  1ITG A;  3OYC A;  1TL1 A;  4WQ5 A;  1BUP A;  1ZBF A;  2HF4 A;  2HBL A;  3DXK B;  3OJU A;  3NGI A;  2IDO A;  5KGW A;  4BRE A;  1S1T A;  2BUP A;  2P9I A;  4BRC A;  2O8E B;  2R7Y A;  3VTI A;  4I9L A;  2W6K A;  3VF4 A;  4DFP A;  3GBT A;  2VWB A;  5AR0 A;  4B3S K;  4W5O A;  5AQH A;  1Q7Y O;  4PL7 A;  1RDC A;  4O44 A;  4RCH A;  4H0V B;  3L2Q A;  2VG7 A;  5J2P A;  5AQK A;  4CK3 A;  1KFS A;  1S1X A;  2QWP A;  4DTX A;  2P9S A;  1X9M A;  4DTN A;  4O5B A;  3V1R A;  5FPE A;  4DG1 A;  3LDN A;  3KLF A;  3VQD A;  1C0M A;  2VCP A;  4CBU A;  3GE1 A;  3G6E N;  3DLH A;  4FJ9 A;  1NJI O;  2E5L K;  3PSF A;  4ILG B;  1O13 A;  4DSE A;  4FJK A;  1D8Y A;  4K25 A;  2Q3S A;  4DV1 K;  1RDA A;  4H4M A;  2AJQ A;  3AO3 A;  2KQ2 A;  4LSN A;  3VQ4 A;  4PQU A;  1C1B A;  3BP8 A;  1ASW A;  2F9W A;  3QML A;  1EP4 A;  3MED A;  4QS8 A;  4FXD A;  2YKN A;  4HWI A;  4CED A;  3MXI A;  5AQP A;  4I2P A;  4JKF A;  4DV2 K;  4DV6 K;  3CCS N;  5AQT A;  3V9W A;  4FWO A;  4YOV A;  4CZJ A;  4CHY A;  4YFU A;  3TWH A;  5M1P A;  1CXU A;  1RGI A;  1U2V A;  1XHZ A;  3WNE A;  1NK0 A;  1N32 K;  3KD1 E;  4JI4 K;  1BWF O;  3CET A;  1CZA N;  2HST A;  1K6Y A;  3VF6 A;  2KZZ A;  3CJC A;  3NFA A;  1EO1 A;  1KRP A;  2FF6 A;  1XQS C;  3BF3 A;  5AQR A;  4CEE A;  2Z1G A;  3VA0 A;  4DMN A;  1NGF A;  4B1U B;  3VQA A;  1D5A A;  4ID1 A;  2IC3 A;  2YNH A;  4B08 A;  1GLD G;  4FM2 A;  3CQX A;  4CIG A;  3U3G A;  3KHY A;  1NGD A;  4RW8 A;  3OYE A;  4E1J A;  2Q31 A;  1V4S A;  2V51 B;  3JYT A;  3CJA A;  4JYA K;  2WC9 A;  4CEA A;  4FW2 A;  2EWS A;  3EZ5 A;  4H03 B;  2HBJ A;  5I42 A;  3DRP A;  2KFN A;  1JLA A;  3LWL A;  4IEI A;  2WBN A;  1L5U A;  4FWN A;  4KTQ A;  4DV7 K;  3FZK A;  1L3V A;  2I5J A;  2WFB A;  1YJN N;  1QVF M;  3O3H A;  3EEQ A;  3M8S A;  1Z05 A;  2P9U A;  4IFY A;  4FO0 A;  2JWL A;  3E1Y A;  4YDU C;  4B3O A;  2ZJQ L;  1VQO N;  1QSS A;  1RDD A;  4C1N K;  1WUA A;  4ILH A;  4LY7 A;  4BRQ A;  4FW1 A;  2Q36 A;  1MWK A;  1WAF A;  4FK4 A;  3K5O A;  4OPH A;  3SQ0 A;  3K5M A;  4CVN E;  3V9U A;  3VER A;  4O8K A;  2GEL A;  2BE2 A;  1I3A A;  3VEY A;  1GLA G;  3M3Z A; 
#chains in the Genus database with same CATH homology
 3TAN A;  3NGZ A;  4XIU A;  2EX3 A;  1SV5 A;  3L3U A;  4CHQ A;  5CZ2 A;  2PYJ A;  4J2A A;  3T19 A;  3ZSQ A;  3SUQ A;  1VSJ A;  1B9D A;  4N47 A;  3C95 A;  3I8D A;  4FVM A;  3RR8 A;  2LSN A;  4M3Z A;  1RT7 A;  2ITG A;  5KGX A;  3AVN A;  4CJQ A;  4LSL A;  4CJU A;  3MAQ A;  4DTJ A;  4B9M A;  4K8Z A;  4OLB A;  3ZSO A;  5FRO A;  3AA2 A;  4M3R A;  3S9H A;  1JKH A;  3AA3 A;  5D3G A;  4DFK A;  3TAG A;  1KFD A;  1RT3 A;  3AVF A;  4M45 A;  1SKS A;  4E3S A;  3LWM A;  1ZBI A;  1KVB A;  3OS2 A;  1NOZ A;  1RNH A;  4E7I A;  1IKX A;  2VWK A;  4O0I A;  4CCH A;  3O3F A;  4N56 A;  1T03 A;  2JLE A;  1RBU A;  3HL8 A;  4DSK A;  3AVA A;  3OYA A;  3ZT0 A;  3KK1 A;  4ELV A;  4WE1 A;  3QIO A;  3HT3 A;  5FDL A;  4E7K A;  2QKK A;  1VRT A;  1XHX A;  4CJ3 A;  1I39 A;  3VQB A;  3MEE A;  3K58 A;  4C8K A;  1T05 A;  5JS2 A;  4RW7 A;  2G8I A;  4AH9 A;  1S6Q A;  1TKX A;  3OYF A;  3DLK A;  5J2M A;  1L3U A;  2OPS A;  1RBS A;  3TR8 A;  1EX4 A;  1ZYQ A;  4C8N A;  3AVK A;  1HPZ A;  3KIO A;  4CHZ A;  4B9N A;  1BIZ A;  2G8F A;  4ELT A;  1XWL A;  3AA4 A;  2GV9 A;  4ZTF A;  4EZ9 A;  1EXQ A;  1S1W A;  4JLH A;  3VQ9 A;  4ZHR A;  2P5O A;  3SI6 A;  4ICL A;  1HNV A;  4DU1 A;  1RTI A;  3BDP A;  5HRS A;  1QSY A;  3M8P A;  3M8Q A;  1NOY A;  2WOM A;  4Z0U A;  1U47 A;  1C6V A;  2OZS A;  1IKY A;  1Q9Y A;  3SUO A;  4Z4E A;  4KHQ A;  3CM6 A;  1JL2 A;  1BI4 A;  1WSH A;  4DU3 A;  1DLO A;  3EY1 A;  1IH7 A;  2XY5 A;  4W5R A;  2OYQ A;  1BHL A;  1LW2 A;  1NKB A;  1QTM A;  3QEP A;  3IAY A;  1RT2 A;  4E89 A;  1SKR A;  3QEW A;  3L2U A;  4FK0 A;  1LAV A;  4TSX A;  4CEB A;  1BCO A;  4CHO A;  2E4L A;  4O4G A;  3NH2 A;  4KV8 A;  2G8V A;  1NKE A;  2O4G A;  2XO7 A;  4FJ7 A;  2XHB A;  4OPJ A;  4F3O A;  1YVU A;  3OS1 A;  3RMC A;  1LW0 A;  1JLE A;  4Y1D A;  2VWJ A;  2X6N A;  2P5G A;  4Y1C A;  2HHT A;  2RPI A;  3DRR A;  3VQ7 A;  3HO1 A;  1WSI A;  2HHU A;  2Z1H A;  1HYZ A;  3QES A;  3AO1 A;  3RWU A;  2E6M A;  3CM5 A;  1HQU A;  2GBZ A;  3P83 D;  4FLW A;  3S3O A;  1J5O A;  3UIQ A;  4DLG A;  5KRS A;  3OJS A;  5J1E A;  3OYG A;  3VA3 A;  4KFB A;  5HRN A;  3NBP A;  5HRR A;  4CHN A;  3TAP A;  1FK9 A;  3VQC A;  4M42 A;  4DS5 A;  5J2N A;  4FLU A;  1D9F A;  3HVT A;  3PO4 A;  3ASM A;  4GVM A;  4GMJ B;  5JS1 A;  2DFF A;  1NK5 A;  4CEQ A;  4KKO A;  4BWM A;  3HPO A;  1U49 A;  3FFI A;  1TGO A;  3NGY A;  3U3Y A;  2HMI A;  2FBY A;  3D45 A;  4E7H A;  3B6P A;  1JL1 A;  3VQ6 A;  5FRN A;  4DFM A;  3SQ2 A;  3B6O A;  3I0R A;  1TK5 A;  2HNY A;  2F8S A;  4Q0B A;  3TAM A;  1C1A A;  1VSM A;  3LAM A;  3ALY A;  3RTV A;  1KTQ A;  4HVJ A;  3OYK A;  1WLJ A;  5CYQ A;  1TVR A;  3V81 A;  3KJV A;  3DLE A;  3S3M A;  1HJR A;  5DK5 A;  1C1C A;  1RT6 A;  1CXQ A;  5CZ1 A;  3QIP A;  3AVI A;  4CJV A;  3RMA A;  2G8U A;  4I2Q A;  1BL3 A;  2JGU A;  3AVJ A;  1LWF A;  5C24 A;  1RBT A;  2DY4 A;  3HXM A;  4RW6 A;  1SUQ A;  3E01 A;  4AHS A;  3L2W A;  4DFJ A;  4O0J A;  3QNN A;  4F2R A;  3HJF A;  3O4Q A;  1B9F A;  1RBR A;  4E7L A;  2NUB A;  4DTR A;  1TKT A;  1S9E A;  3ISN C;  4CER A;  3NH0 A;  2DTU A;  4I7F A;  1S1U A;  1CZB A;  3T3F A;  4FLZ A;  2YHB A;  3OVN A;  3C94 A;  2VG5 A;  4CGD A;  3V1O A;  2X78 A;  3KLE A;  1HRH A;  1S1V A;  1RCH A;  4KTZ A;  3ULD A;  3HM9 A;  4DU4 A;  4FJ5 A;  2HVH A;  4AHV A;  3SV4 A;  2HND A;  3AV9 A;  4CES A;  5HP1 A;  4CEZ A;  2OPR A;  4CFD A;  3KTQ A;  3NF8 A;  3MEG A;  2YNI A;  4IDK A;  3PX0 A;  1Z25 A;  1SKW A;  4YNQ A;  4DTM A;  3DLB A;  1IO2 A;  1NJX A;  4BE1 A;  4DF8 A;  4M3Y A;  4HCC A;  1JLB A;  1WSG A;  3LAN A;  4Z4H A;  4FJ8 A;  2RF2 A;  4FZZ A;  2E6L A;  1BGX T;  4KHS A;  4CJR A;  1NK7 A;  1LWE A;  3AO4 A;  4R5P A;  3DYA A;  1KCF A;  4DQP A;  4GW6 A;  4J2B A;  4FJN A;  5KRT A;  4FM1 A;  2D0A A;  3SPZ A;  4OKE A;  4CK2 A;  2IS3 A;  2PZS A;  1XC9 A;  4J2E A;  4DQI A;  3DRS A;  3ZT1 A;  4FJG A;  1WSE A;  4H4O A;  4OVL A;  3K59 A;  4HTU A;  5K14 A;  3QO9 A;  4OLA A;  3BGR A;  4FLX A;  4QCL A;  4B9L A;  1HQE A;  2RKI A;  4OGC A;  4BE2 A;  4KI4 A;  4CJS A;  3LAK A;  1NK6 A;  3ZT2 A;  3ZSZ A;  5DMR A;  4RW4 A;  3F73 A;  4E19 A;  4DQR A;  5I3U A;  1NJW A;  4KAZ A;  3KK2 A;  1HNI A;  4KHN A;  3CYM A;  5J2Q A;  1BCM A;  2A1R A;  3IS9 A;  3L2R A;  1W9H A;  3NAE A;  3LZI A;  3RMD A;  3KD5 E;  4CJ5 A;  4FJL A;  1U45 A;  2GUI A;  4Z4I A;  4OGE A;  4KRF A;  2ETJ A;  4E1M A;  2KFZ A;  1VSD A;  1TL3 A;  2D5R A;  4IBN A;  1TK8 A;  4FCY A;  4DSJ A;  4BDZ A;  2PYL A;  1JXE A;  2B5J A;  5E41 A;  1EKE A;  1BIS A;  1Y97 A;  4OPK A;  4I9Q A;  5FRM A;  2BGG A;  1WAJ A;  4B8A B;  4AHT A;  3HVR A;  3S3N A;  3QEI A;  2EHG A;  1Z26 A;  3VQ8 A;  1TV6 A;  5C25 A;  3V9X A;  2YKM A;  2KZM A;  3AO2 A;  4CEO A;  2IAJ A;  4M3W A;  1RBV A;  3ZSR A;  2BAN A;  3JSM A;  3OYI A;  1QE1 A;  1RTD A;  2FC0 A;  4C8M A;  4NCB A;  1VSL A;  4CJT A;  1N6Q A;  1TK0 A;  3HK2 A;  2F96 A;  3KLG A;  3QNO A;  1N5Y A;  4FLY A;  2XY8 A;  1J54 A;  3SQ4 A;  4DLE A;  4DF4 A;  4CJF A;  3CFR A;  3OYM A;  4LH5 A;  3U6F A;  1YTU A;  1RDB A;  4KRE A;  4EP5 A;  3G10 A;  4ID5 A;  3QER A;  3ZSW A;  3RRG A;  4ZTJ A;  3LZJ A;  1KVC A;  1BIU A;  4NCG A;  4CJL A;  1Q9X A;  4PWD A;  3ZT4 A;  1Q8I A;  4PUO A;  4BWJ A;  2B6A A;  1FKO A;  2ZE2 A;  3MXJ A;  3DLG A;  3I0S A;  3NF9 A;  2FBV A;  3F9K A;  4QAG A;  5KI6 A;  4N41 A;  2B4J A;  1S5J A;  1F21 A;  4CGF A;  3VN5 A;  4CHP A;  1A5W A;  2QXF A;  1DTQ A;  3NF7 A;  4AHU A;  3K57 A;  5KTQ A;  4BAC A;  1QSL A;  1T7P A;  3L2V A;  2KFN A;  1FKP A;  3AVL A;  3OYN A;  4CJW A;  3CG7 A;  2O4I A;  4HUG A;  3QIN A;  1A5X A;  3CFO A;  4CF9 A;  1CLQ A;  3AVB A;  3AA5 X;  1ZBU A;  3OYD A;  3SQ1 A;  4CF0 A;  1S6P A;  4DTP A;  4DWI A;  3C6U A;  4J2D A;  5C42 A;  3OS0 A;  2RN2 A;  1SL2 A;  1JXB A;  4CIE A;  3KLH A;  4HUE A;  4CJP A;  4IG3 A;  3T1A A;  4E1N A;  3SV3 A;  4W5Q A;  2KTQ A;  1NK4 A;  1B92 A;  4DTO A;  3AVC A;  3NCI A;  3ZSV A;  3K5N A;  4N5S A;  3SYZ A;  3RRH A;  4AIL C;  4FZX C;  4RW9 A;  1REV A;  1RT1 A;  1EET A;  3LPT A;  4FM0 A;  3DOK A;  2YV0 X;  1JLQ A;  1IG9 A;  3AO5 A;  3WNF A;  1D9D A;  4CFB A;  4FJH A;  1GOC A;  4PY5 A;  3SUP A;  1DTT A;  4FLT A;  4CF1 A;  3HP9 A;  4LH4 A;  3TAE A;  1IKV A;  4CIF A;  3L3V A;  1VRU A;  4DQS A;  3SPY A;  4OJR A;  3KK3 A;  1KLM A;  2XY7 A;  4CFA A;  4Q5V A;  3C6T A;  2Z1J A;  3LAL A;  2FBT A;  3DOL A;  2D0C A;  3LP0 A;  1NKC A;  1ITG A;  1RIL A;  3AVM A;  5CYM A;  3OYC A;  4FJJ A;  1TL1 A;  2P1J A;  1T8E A;  1ZBF A;  3PX6 A;  3RMB A;  3M8R A;  4B9V A;  4PA1 A;  3ITH A;  2HHS A;  4Z4G A;  1R0A A;  4KB0 A;  1JLC A;  2HNZ A;  3OJU A;  3NGI A;  1HYV A;  2IDO A;  5KGW A;  4CK1 A;  2VG6 A;  4Z4F A;  1S1T A;  4B9T A;  3AVH A;  4W5T A;  4NCA A;  4JS5 A;  4CJK A;  4ELU A;  1BQN A;  4K8X A;  4G1Q A;  2R7Y A;  4KPY A;  3TAF A;  4I9L A;  2HHV A;  3HPG A;  4FJM A;  1QQC A;  3NF6 A;  4KHY A;  3WNG A;  1J53 A;  4DFP A;  1U4B A;  4N76 A;  4W5O A;  1XI1 A;  4FZY A;  1RDC A;  5HRP A;  4O44 A;  1GOB A;  2X6S A;  1J9A A;  1GOA A;  3L2Q A;  4IG0 A;  4E7J A;  1HMV A;  1O1W A;  3LP3 A;  2IGI A;  2VG7 A;  3HPH A;  4EP4 A;  5J2P A;  1IKW A;  3PO5 A;  4CK3 A;  1KFS A;  3KKR A;  2YHA A;  1S1X A;  4DTX A;  1X9M A;  3CQ8 A;  3P1G A;  4DTN A;  2HB5 A;  2G8K A;  2YNF A;  4O5B A;  3V4I A;  4KHU A;  3DLR A;  3V1R A;  4DG1 A;  3PX4 A;  2WON A;  4MFB A;  3KLF A;  3VQD A;  1C0M A;  1U48 A;  4DSL A;  3KLI A;  3VQQ A;  3OYL A;  2PY5 A;  1QHT A;  3L8B A;  4HCB A;  3NE6 A;  3TI0 A;  2OZM A;  1TKD A;  4OKJ A;  3WNH A;  3G0Z A;  1L3S A;  4CJE A;  3DLH A;  3DMJ A;  4B8C A;  3SNN A;  4FJ9 A;  4M3T A;  3OYB A;  3QET A;  1HYS A;  4FLV A;  3VQ5 A;  1RTH A;  1LWC A;  1U04 A;  2Y1I A;  3TAQ A;  4DSE A;  4JRQ A;  1SL0 A;  1D8Y A;  4B9U A;  4AHC A;  2Q3S A;  4FJK A;  1RT5 A;  1RDA A;  1VSH A;  1NK9 A;  2HHW A;  4H4M A;  2AJQ A;  3AO3 A;  3SUN A;  3PY8 A;  2KQ2 A;  4LSN A;  3VQ4 A;  4QOZ B;  4PQU A;  1C1B A;  3ZCM A;  4F8R A;  1ASW A;  3A2F A;  4KO0 A;  4CF8 A;  4L8R B;  1NJY A;  3V9S A;  1EP4 A;  4BDP A;  3MED A;  3D0P A;  4FXD A;  4JS4 A;  4C8L A;  3K2P A;  4M3U A;  2A1S A;  2YKN A;  3LPU A;  4CED A;  1L3T A;  3MXI A;  3DI6 A;  4I2P A;  3NHG A;  4HHT A;  3ZSY A;  2XY6 A;  5HLF A;  4CGI A;  3V9W A;  4DTU A;  4JRP A;  4CHY A;  4YFU A;  1BQM A;  3TWH A;  2YNG A;  4CEC A;  3HYF A;  4CGJ A;  4DTS A;  3SJJ A;  1YTA A;  5EU7 A;  4AHR A;  1CXU A;  3LDS A;  3TAR A;  1KVA A;  3WNE A;  5SWM A;  1XHZ A;  1NK0 A;  3MXM A;  2IOC A;  4NYF A;  1LAW A;  1S9G A;  3OYJ A;  3KD1 E;  4F2S A;  4CE9 A;  2QKB A;  3THV A;  1BI4 B;  1K6Y A;  1UOC A;  5HBM A;  2KZZ A;  3KKS A;  2X74 A;  4CF2 A;  4DSF A;  4FK2 A;  4FYD A;  3NFA A;  1KRP A;  4KHW A;  1VSI A;  3PUF A;  3H08 A;  4RG8 A;  1TKZ A;  4CFC A;  2DFE A;  2Z1I A;  1C0U A;  1G15 A;  3OYH A;  1VSE A;  4CEE A;  1C0T A;  2Z1G A;  4NYN A;  4CEF A;  3VA0 A;  4CJ4 A;  4DMN A;  3OY9 A;  3SCX A;  5HRO A;  2HHQ A;  4LD0 A;  4CGH A;  2OA8 A;  3NDK A;  1VSF A;  3VQA A;  1D5A A;  4FJI A;  2BDP A;  4ID1 A;  4KB1 A;  2IC3 A;  4CGG A;  3O4N A;  5CY4 A;  4MQ3 A;  2YNH A;  4B08 A;  2OPP A;  3LP1 A;  4FM2 A;  2KW4 A;  4CIG A;  1A5V A;  1CZ9 A;  3RR7 A;  3U3G A;  3O3G A;  4M41 A;  1QS4 A;  1UWB A;  4RW8 A;  3ZSX A;  3OYE A;  4DSI A;  2G8H A;  1NJZ A;  3JYT A;  1ASV A;  1X1P A;  2W42 A;  4UQG A;  3HST B;  4CEA A;  4C8O A;  4FW2 A;  1ZBH A;  1FXX A;  2FBX A;  1YT3 A;  3IRX A;  4KTW A;  1UAX A;  3EZ5 A;  1VSK A;  4IKF A;  4Z4C A;  1SL1 A;  5I42 A;  4M3X A;  3DM2 A;  3DRP A;  2ATQ A;  1JLA A;  1KSP A;  4O55 A;  1TAQ A;  3NH1 A;  3LWL A;  3ZT3 A;  4F3T A;  3QLH A;  1UA0 A;  4W5N A;  1WSF A;  2DFH A;  1L5U A;  1W0H A;  4OKK A;  3PV8 A;  2OPQ A;  4DS4 A;  4KTQ A;  5T7B A;  1JLG A;  2Y1J A;  3AVG A;  3LP2 A;  4IFV A;  3K5L A;  1RT4 A;  1L3V A;  2QK9 A;  4F4K A;  2ZQB A;  2D0B A;  3P5J A;  2I5J A;  2HW3 A;  1WNS A;  3TAB A;  4EZ6 A;  3V1Q A;  3O3H A;  1X9W A;  3M8S A;  5SZT A;  1NK8 A;  3V9Z A;  1WN7 A;  2XRI A;  4IFY A;  3SZ2 A;  1X9S A;  2HHX A;  1MU2 A;  4B3O A;  1QSS A;  1RTJ A;  3V6D A;  2G8W A;  1RDD A;  2P51 A;  2HVI A;  4LY7 A;  4B9S A;  1LV5 A;  3HP6 A;  4FW1 A;  4DQQ A;  1WAF A;  4FK4 A;  4BDY A;  3K5O A;  3VQE A;  3SQ0 A;  2F8T A;  3MEC A;  1TAU A;  3K5M A;  3VQP A;  1VK0 A;  3EYZ A;  3V9U A;  1UA1 A;  3CFP A;  1WSJ A;  3QEX A;  4KI6 A;  2BE2 A;  1I3A A;  4H8K A;  4BE0 A;  1KLN A;  1ZBL A;  2ZD1 A;  4FJX A;  4HUF A;  4E0D A;  1JLF A;  3IG1 A;  3QEV A;  1ASU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...