4HUEA

Structure of 5-chlorouracil modified g:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hueA00
1QHTA 4CJTA 5HROA 1JL2A 2X74A 3T1AA 4AILC 4KHSA 2QKKA 4FJIA 4N76A 4O4GA 2D0BA 5I3UA 3V9WA 1QE1A 3OYMA 3V4IA 4CEBA 4O44A 4KRFA 4K8ZA 4KO0A 1WNSA 3AVCA 3ZT0A 2YHAA 1DLOA 3M8QA 3VQ8A 3ZSVA 3SI6A 4ELUA 4Z4HA 1UA0A 3PV8A 2W42A 2DFFA 3NH2A 5FDLA 1Q9YA 3HPGA 4DTUA 4DTRA 4B9SA 4HCCA 3O3GA 3I0RA 4DTSA 2Z1HA 4M3YA 1BISA 4F3TA 3DOKA 2G8KA 4DQQA 4JS5A 1VRTA 1D9FA 3WNEA 1ZBLA 4KPYA 1D8YA 3AA4A 3V81A 1CLQA 4CIEA 2DFEA 2XO7A 3THVA 4DQIA 1X9MA 1RT1A 4KFBA 1K6YA 4FXDA 5KI6A 4CGHA 4CHQA 3PY8A 3AV9A 5HRRA 1KLNA 3K2PA 3NF6A 1LAWA 4DU3A 1KRPA 4DQPA 2B4JA 2ETJA 4KTWA 4N41A 4DTJA 1WSGA 4N47A 2YKMA 1RTIA 4CK3A 3LWLA 2XY5A 1YTUA 4CJKA 1KFSA 5C42A 4H4OA 3HP6A 1IH7A 4OVLA 4CJSA 1Y97A 4AHCA 4CEAA 1XWLA 3SPZA 3DMJA 3P5JA 2VWJA 1C0TA 3K59A 1BHLA 3QEXA 4LSLA 4BDZA 3AVIA 3VQ7A 3G10A 3PX0A 3SQ0A 1QSYA 1L3UA 2BGGA 4Y1CA 2A1RA 1HYZA 2FBTA 3LAKA 3JSMA 1RCHA 4DTNA 2PY5A 4MQ3A 3OYBA 3MEEA 4FVMA 1GOAA 4B9UA 1WSIA 5DK5A 3B6PA 4B08A 4ID5A 2ITGA 3L3VA 4PA1A 3F9KA 1NKCA 4E1MA 4ID1A 4E7KA 4FJ9A 1S1WA 4HTUA 4B9LA 3H08A 4FJMA 3MXIA 3KD5E 4M45A 4FM1A 1IKWA 1C0UA 4RW4A 3C6UA 1I39A 3DI6A 1ASVA 1RTJA 1BI4B 4HVJA 1NJWA 1VSIA 2EHGA 3TAMA 4ZTJA 3AVNA 1NK9A 1B9FA 4NCGA 1JLEA 3ZSOA 3HO1A 2YV0X 4BDPA 3O4QA 3OYEA 3KKSA 3AVKA 2IS3A 1RNHA 4B9VA 1T8EA 2LSNA 5JS2A 1RBTA 3LAMA 1LW0A 4B8CA 5HBMA 3CYMA 4MFBA 4DQRA 4DFPA 2P1JA 2YNFA 3TI0A 2OYQA 4I2QA 3RMBA 1S1TA 3QIPA 3SZ2A 3VQ6A 3OS1A 3EYZA 1S5JA 4CJRA 2OZSA 4HUFA 4CJFA 4DTOA 4CCHA 4PWDA 3AO1A 4FJNA 1TAUA 1NK0A 1VSFA 1RDDA 4FM0A 3F73A 3CFPA 4DLEA 1CXUA 4OGCA 1UAXA 1J54A 2VG5A 3C95A 4CJ3A 4CHYA 4AH9A 1C1CA 4E7JA 2FC0A 4KHNA 3D0PA 4CK1A 4FLZA 1RDBA 3O4NA 3ZT1A 3OYNA 4DTMA 2IOCA 2OPPA 3KLFA 3QEIA 2Z1JA 3SJJA 3ZCMA 2RN2A 3CM6A 3KK3A 2XRIA 2IC3A 3K57A 1LV5A 4I7FA 1TKXA 2O4GA 1Z25A 1IKVA 1FKPA 4CEQA 3AVGA 3NDKA 1NK5A 3RMCA 4NYNA 3OVNA 4FJ8A 3P83D 4J2AA 4B9MA 1WN7A 3OYJA 1U49A 4KTQA 5E41A 1EX4A 2HMIA 2KFZA 4FLVA 4YNQA 2P5GA 2AJQA 4FCYA 1JLFA 3OYCA 1FK9A 3KD1E 1B92A 3ZSWA 1WSFA 2HVIA 1VRUA 4CEEA 4W5QA 1BQMA 4F3OA 4CFCA 3MXMA 3DLEA 4BDYA 3AA3A 3QIOA 4I2PA 4FJJA 3M8PA 4C8KA 1C1AA 3U6FA 2E6LA 3RMDA 1ZYQA 2HW3A 3AVLA 4Z4EA 4IFYA 3NH0A 2F96A 5KGWA 3TR8A 1D5AA 1RBUA 4IG3A 4CIGA 4CEDA 4UQGA 3WNFA 3LWMA 3SYZA 3PX4A 3K5LA 1TK8A 1WAJA 4CEOA 1YVUA 4IDKA 1NOZA 1VSJA 3CM5A 4DLGA 4FK4A 1G15A 3QETA 4O0JA 5CY4A 1BIUA 4B8AB 4CJEA 3O3HA 3QEVA 3U3YA 3DLGA 1BGXT 1SKWA 4O55A 4I9QA 3ZSRA 2OPSA 3NHGA 2Y1IA 1A5XA 2FBVA 1IKXA 4IG0A 2ZE2A 4DSLA 2E6MA 1RBVA 3HP9A 3AO2A 1T7PA 3K5NA 3RRHA 3M8SA 3HK2A 1ASWA 1RILA 1ZBFA 4AHUA 4CJ4A 2Q3SA 2QK9A 3AVMA 3S3MA 4DFMA 1S9EA 4CJUA 3T3FA 4F2SA 4CJQA 3OYGA 3UIQA 3NH1A 1LWCA 4TSXA 5T7BA 2A1SA 1WSEA 3LPTA 4N56A 2G8WA 4FLXA 3AVFA 4CIFA 2BANA 4M3UA 1RDAA 1IO2A 1ZBUA 3DLRA 1UOCA 2OPRA 3MEGA 1JL1A 4FYDA 4DSFA 2X6SA 2HHTA 2X6NA 1VSEA 4RW7A 3D45A 4YFUA 1NK7A 3KLIA 4DG1A 4FZXC 4FJ5A 4JS4A 2Y1JA 2GUIA 4BWJA 4CERA 3OJSA 2GV9A 1JKHA 1TL1A 3BGRA 4DFJA 3KTQA 3TAQA 2F8TA 3NGIA 1CZ9A 4IBNA 3SQ4A 4CECA 4O5BA 3TANA 3TABA 1U45A 1QSLA 4J2BA 2XY6A 1KFDA 4FZZA 4IKFA 3K5OA 1QTMA 1S6PA 1NJYA 1DTQA 4CK2A 1W9HA 3RRGA 1QSSA 1FKOA 2ZQBA 4XIUA 1YTAA 1JLBA 4AHVA 1EXQA 2VWKA 3C94A 3G0ZA 4DTPA 1BQNA 1A5WA 4Q0BA 4OLAA 1ITGA 4ELTA 3V9SA 4H8KA 3HT3A 4DSEA 4I9LA 4M42A 4OLBA 1S6QA 5C25A 4Z4CA 1RBSA 1X9SA 4G1QA 1F21A 1NKEA 1U47A 3TAEA 3OYIA 4CEZA 3DRPA 3MXJA 4FJXA 3JYTA 4ZHRA 3SV3A 5SWMA 3WNHA 4DSIA 1BCOA 1XHXA 2B6AA 4EP4A 3OS2A 3QNNA 5HLFA 1U4BA 3LP1A 1CZBA 4CEFA 3P1GA 4DS4A 5JS1A 2FBXA 5D3GA 2HHXA 2FBYA 1TVRA 1TKTA 4FLUA 3OYFA 1KCFA 5CZ2A 1KVAA 4R5PA 4FZYA 4LSNA 4OKJA 1C6VA 3B6OA 3CQ8A 3RMAA 3AO5A 1EETA 4RG8A 1RT4A 3VQCA 5KGXA 1UWBA 3HPOA 1S1VA 1HRHA 1BL3A 3K5MA 2HHUA 3AVJA 3TAGA 3OYHA 1B9DA 1KLMA 4Z4IA 4B3OA 3T19A 4RW8A 4BACA 4M3RA 3SUNA 1JXBA 4DSJA 4PY5A 4KV8A 4KI4A 2ZD1A 3LP2A 3VQPA 1UA1A 1NKBA 1WAFA 2RF2A 3VQDA 3DRRA 1HYSA 3QINA 2KQ2A 4F8RA 1C1BA 4JRQA 3LDSA 4DFKA 3SQ1A 2ATQA 3ZT3A 4CE9A 3PUFA 4CJPA 1X9WA 1EP4A 1JLCA 4DQSA 2G8FA 3QEPA 2VG6A 1HPZA 3OS0A 3L2UA 2R7YA 4M3WA 2G8HA 3C6TA 1GOBA 2Z1IA 1IKYA 4EZ6A 1ASUA 1RT7A 3OYAA 5FRNA 1FXXA 2HNZA 3V1QA 3VQBA 1TK0A 5KRTA 1SUQA 4CGFA 2IGIA 4Y1DA 3MAQA 2OA8A 2DY4A 1LW2A 4CJWA 4JRPA 2YNHA 2DFHA 1IG9A 3HJFA 4CF8A 1KSPA 1D9DA 2G8UA 3L2RA 3PO4A 1EKEA 3AA5X 3ALYA 4C8NA 4K8XA 3NAEA 1TL3A 1SL1A 4Z4GA 3ZT2A 1TV6A 3KLEA 1L3TA 3O3FA 3HSTB 4CF1A 1KVCA 1NK8A 2E4LA 3LZIA 4OGEA 1JLAA 4KB0A 4KHYA 3L2QA 4KREA 4F4KA 2G8VA 2KFNA 3V6DA 3ZSQA 3V9ZA 4FM2A 3NE6A 1N6QA 4KHWA 2YNIA 3TWHA 2I5JA 3HVTA 3DM2A 5HP1A 2BE2A 4BE1A 3PO5A 4NYFA 4M41A 5CYQA 2HHSA 5SZTA 2EX3A 1VSHA 3KJVA 1SL2A 3ITHA 4E19A 1J9AA 3LZJA 5J2NA 5J2PA 1J5OA 3SUPA 3QO9A 1L3VA 2VG7A 4ZTFA 1Q8IA 4E0DA 4F2RA 4KHUA 3VQ4A 4OKKA 2HHWA 4FJHA 4GVMA 3OY9A 3WNGA 3VA0A 4W5OA 4E7IA 4OJRA 3VQ5A 5C24A 3DOLA 3HYFA 2NUBA 3NCIA 3DLKA 4CFBA 3KLGA 2XY7A 3RR7A 1TKZA 3S3OA 3S9HA 1A5VA 3VQ9A 1XC9A 4KKOA 3CG7A 3L2VA 3QNOA 4OPJA 3OYDA 3V1OA 2KTQA 3I8DA 3VA3A 3IS9A 4M3TA 1BI4A 2G8IA 4LD0A 4CHNA 3CFOA 2RKIA 3TAFA 1R0AA 5HRSA 3QEWA 1RT5A 2HNYA 1VK0A 3ZSXA 4DU1A 4LH5A 4CJLA 5EU7A 2DTUA 2B5JA 4HUEA 1HYVA 4DTXA 2PYJA 4EZ9A 1NJXA 3RR8A 2HHQA 1SL0A 1HJRA 1C0MA 3ISNC 3VQQA 4E7HA 3TAPA 2BDPA 3IAYA 1HNVA 2YNGA 5I42A 4AHTA 4CFAA 4KAZA 1CXQA 4Q5VA 2JLEA 3OJUA 4W5RA 3V9UA 4HUGA 2HB5A 2IDOA 5DMRA 1RTHA 4N5SA 2XHBA 3EY1A 2YKNA 2KZZA 3QESA 3TARA 1BIZA 4FJKA 1WSJA 4OPKA 2P5OA 3VN5A 5J2MA 2WONA 3K58A 4J2DA 3SV4A 2P51A 4GMJB 1S1XA 4CGJA 1GOCA 1X1PA 4EP5A 3NGZA 2O4IA 3VQAA 4E3SA 4LY7A 3DLBA 4CF9A 3AVHA 1RT6A 4QAGA 3RTVA 5J2QA 1U04A 1TK5A 2PYLA 1ZBHA 3IRXA 1T03A 3EZ5A 4FK0A 4BE2A 1HQUA 4L8RB 1ZBIA 1U48A 1I3AA 1TKDA 1SKSA 2HVHA 2HHVA 3AVBA 4GW6A 1TAQA 1RBRA 2OPQA 3LANA 5KRSA 3OYKA 4HHTA 1HQEA 3V9XA 4E7LA 1NK6A 2PZSA 3PX6A 4KI6A 5FRMA 1JLQA 2HNDA 3MEDA 1LWFA 4KTZA 5KTQA 3ASMA 1S9GA 3SNNA 2YHBA 4CJVA 3DLHA 1KTQA 5FROA 3AVAA 2XY8A 4CFDA 1QS4A 3KLHA 4M3XA 3BDPA 4CGIA 3V1RA 4BE0A 1YT3A 3IG1A 2D0AA 4DS5A 4Z4FA 3ZT4A 4FLWA 4BWMA 3ZSZA 3L2WA 4RW9A 4E89A 4WE1A 1O1WA 4Z0UA 1WLJA 1LWEA 1JXEA 1L5UA 3SUOA 4NCAA 3LPUA 1HMVA 3L8BA 2X78A 1VSKA 4FJGA 1VSLA 3AO3A 4C8LA 4FK2A 1LAVA 5HRPA 4KHQA 1J53A 4B9NA 2Z1GA 4JLHA 5CYMA 3DRSA 4CGDA 3CFRA 2GBZA 3NGYA 4DWIA 4B9TA 3KKRA 3L3UA 1SKRA 3LP0A 4CHOA 1SV5A 3KIOA 3KK2A 4PQUA 4DU4A 4DF4A 1HNIA 3NFAA 3AO4A 4E1NA 3A2FA 3KK1A 1L3SA 4CF2A 4C8MA 4CHPA 1BCMA 4AHRA 1REVA 4FW2A 4RW6A 1RT2A 3OYLA 4W5TA 3SUQA 1RTDA 4IFVA 3SPYA 3LALA 3HM9A 3HPHA 3S3NA 3RWUA 4QCLA 2JGUA 4DF8A 1TGOA 4FJLA 3VQEA 1T05A 4J2EA 1RDCA 1NJZA 4W5NA 2KZMA 3HL8A 3HXMA 4FLTA 2F8SA 3MECA 4CHZA 1S1UA 1DTTA 1Q9XA 3I0SA 2QXFA 5HRNA 1N5YA 1JLGA 3HVRA 3LP3A 3E01A 4AHSA 4CESA 2IAJA 1VSDA 1WSHA 3ZSYA 2QKBA 3QLHA 1NK4A 3U3GA 1NOYA 5K14A 4DSKA 4M3ZA 4OKEA 4QOZB 1RT3A 2WOMA 4FJ7A 2D5RA 2KW4A 4CF0A 3DYAA 1VSMA 1Z26A 2D0CA 1QQCA 3NF9A 4O0IA 3ULDA 3QERA 1XI1A 1XHZA 3NF7A 4PUOA 4ELVA 4NCBA 3FFIA 3NF8A 4FLYA 4HCBA 4H4MA 4LH4A 3M8RA 3SQ2A 2OZMA 3AA2A 4KB1A 5J1EA 1MU2A 4FW1A 3SCXA 1KVBA 2RPIA 1W0HA 5CZ1A 4CGGA 4DMNA 4C8OA 3NBPA 4ICLA 4CJ5A
chains in the Genus database with same CATH superfamily
1QHTA 4LFBK 2ASPA 3T1AA 4JKDA 3V9WA 4JKGA 1QE1A 3OYMA 3V4IA 1HJOA 4ELUA 3ZSVA 3PV8A 3HPGA 4A2BA 4DTRA 2VYPA 3I0RA 3BF1A 2Z1HA 4M3YA 2NRXA 3DOKA 4RCHA 3WNEA 1D8YA 1CLQA 3MK6A 4K0KK 3R9PA 4CHQA 4EHUA 3PY8A 3LL3A 2IVPA 4DU3A 3VGLA 3IUCA 1EWRA 2ETJA 3A5LC 4KTWA 5AQJA 4N47A 1RTIA 3UKRA 3U4LA 1KFSA 5C42A 4H4OA 1S72N 4AHCA 4H5WA 3QBXA 2W41A 3PSIA 3SPZA 1K8KA 3P5JA 4LSLA 3VQ7A 3G10A 3GG4A 1QSYA 4BGBA 1HX1A 5H1SQ 3VEXA 2O8BA 4DV1K 5EVZA 2P9LA 3LDPA 1RCHA 2PY5A 4MQ3A 5AFUA 1BDGA 3MEEA 4LF5K 5LMUK 2O8CA 4PA1A 5JMVA 3F9KA 1NKCA 4ID1A 4E7KA 3CD6N 3RSEB 2NNWA 3F2KA 2ZJRL 1R59O 4IWVA 4FJMA 4M45A 2GEMA 3C6UA 3DI6A 1ASVA 1VQMN 2EHGA 5E84A 3KK7A 1T6CA 4C23A 2FLOA 4ILJA 3OYEA 2IS3A 5JS2A 2WTUA 1RBTA 3LAMA 3VTHA 2UUBK 1N33K 4DQRA 3VF4A 4NLCA 4DFPA 4YDUA 1EO1A 4I2QA 3OS1A 1S5JA 2OZSA 4HUFA 4PWDA 4FJNA 4OGCA 4BRMA 2VG5A 3IDHA 4YORA 4CK1A 3EN9A 3O4NA 3ZT1A 2P9SA 1NG9A 3EE9A 3T7ZA 3QB0A 2IC3A 1Z25A 4BRAA 1NK5A 4X66K 3RMCA 4QS9A 2W40A 3P83D 4J2AA 1WN7A 2KFZA 4YNQA 4BRQA 2P5GA 4XH5A 2AJQA 4FCYA 3OYCA 3ZSWA 5KPZA 4CEEA 2E20A 4BDYA 3M8PA 1ZYQA 5BN8A 1XC3A 4A5BA 1RBUA 1TK8A 3SYZA 3T69A 3WNFA 3K5LA 4LFAK 4CEOA 4JI6K 1NOZA 1FJGK 3ZYYX 3J80O 2HBMA 1IBKK 4FK4A 3MDQA 4CW7B 5CY4A 1NKEA 4BY9C 3MX5A 4H0VB 3CF5L 1FW6A 3ZSRA 3VGMA 3F5TA 3IKMA 3WT0A 1CZAN 2YHYA 4DSLA 1RBVA 1H1VA 1T7PA 3K5NA 3BF3A 3M8SA 3RRHA 3HK2A 1ASWA 1RILA 4AHUA 2QK9A 2ZWHA 1S9EA 3JXUA 4F2SA 3OYGA 3VENA 3NH1A 2UUCK 4BR7A 2G8WA 2P9IA 3ZEUA 3AVFA 1RDAA 1IO2A 4DSFA 5AZJA 2X6NA 4RW7A 1NK7A 3KLIA 4CERA 3CJ1A 2F8TA 3ENHA 4IBNA 3CCJN 3SQ4A 2JWKA 3MN5A 4WFNL 1C0FA 1GLBG 4CK2A 4RTFD 5AQZA 3W3DA 1FKOA 1LCUA 1OH7A 1S22A 1NMNA 3C94A 4IEEA 5BRFA 4Q0BA 1BQNA 4OLAA 4ELTA 3V9SA 2UXDK 1I94K 4I9LA 1QHAA 1X9SA 4Z4CA 1M90O 2FF3B 1F21A 4WFAL 4IOCL 1G99A 3VTIA 3MXJA 3WNHA 4EP4A 2CGKA 3OS2A 1U4BA 4CI6A 1YHQN 4H5NA 4DR6K 3O1WA 2FBYA 4FLUA 2P9NB 4CZKA 1KCFA 3H1QA 3CQ8A 3CJCA 1EETA 3LM2A 4C1NK 1RT4A 3H1VX 3AVJA 4OX9K 1KLMA 4B3OA 4ILHA 3SUNA 4PY5A 4BACA 5LMNK 4A57A 4DSJA 3LP2A 1NKBA 1WAFA 1YI2N 2ZGZA 1NGGA 1C0GA 2UUAK 1Q82O 3MX2A 1RFQA 2G8FA 3L2UA 4DR3K 3O9TA 3SK3A 4PKGA 4KH6A 2G8HA 1BO5O 2UYTA 2Z1IA 4EZ6A 5LY3A 1ASUA 4CZEA 4Y0WA 1TK0A 4AF1A 2DY4A 4CGFA 4Y1DA 4IOAL 4CJWA 4JRPA 3HJFA 2DFHA 4CF8A 1KSPA 2G8UA 1NGJA 3D2FA 3L2RA 3EE8A 4A5AA 3H6EA 4K8XA 3NAEA 3DXMB 2V7ZA 4DR4K 3FZMA 4KB0A 3LDOA 3V9ZA 3SMPA 4FM2A 3NE6A 1N6QA 3C7NB 2HBJA 2YNIA 3TWHA 3DM2A 1Z05A 3M1FA 2HHSA 3H45C 5SZTA 1VSHA 4E19A 3LZJA 5J2PA 1QQMA 3SUPA 5KQDA 4PL7A 3TPQA 1L3VA 4ZTFA 4E0DA 1EWQA 3CQYA 1YVNA 4DV3K 4MDBA 3N4QA 3VA0A 4W5OA 1NBWA 2GX9A 1DT9A 3VQ5A 3CCQN 2E1ZA 3S3OA 4B9TA 3VQ9A 2F9WA 4J2DA 4YHHK 4DV0K 3L2VA 3LM9A 1ILYA 3CJ9A 2RKIA 4U7BA 3CETA 1VK0A 3DJCA 1HNXK 4B1VA 5EU7A 2DTUA 3ULEA 3HZ6A 2B5JA 4HUEA 1HYVA 4DTXA 2PYJA 4I6MB 4BR9A 3RR8A 2HHQA 4M7XA 1SL0A 1HJRA 3ISNC 3O8MA 4E7HA 2ZJPL 1HNVA 2YNGA 4LF9K 4KAZA 1CXQA 4Q5VA 4XH4A 3WQUA 4HUGA 2IDOA 4N5SA 2HHHK 1OH5A 3SJHA 3TARA 4K25A 1QVFM 4FJKA 4OPKA 4H0OA 2WONA 5BRHA 1LOTB 2O4IA 4E3SA 4LY7A 4CF9A 4QAGA 1HNZK 1TK5A 4JKEA 3IRXA 3R3LA 4BE2A 1HQUA 4L8RB 1ZBIA 3MCAB 5AQKA 1NGFA 3HI0A 3LANA 1RBRA 2OPQA 1NK6A 4E7LA 3M3ZA 3PLAA 3PX6A 1BWFO 1Q86O 4GV3A 5KTQA 4JI0K 4IJNA 2YHBA 4CJVA 5FROA 2E5LK 1QS4A 3O9SA 4BRGA 3KLHA 5I9EB 4JKBA 5AR0A 3AGKA 4H5VA 4DS5A 3MN9A 3ZT4A 4RW9A 4Z0UA 4WE1A 1LWEA 1JXEA 4NCAA 3LPUA 2HSTA 3CCRN 3VEZA 2H3GX 4FJGA 1VSLA 2RHKA 5LJVA 2P9PB 2NRWA 2P9KA 4B9NA 2A42A 4JLHA 3NGYA 3KKRA 3OTOK 2F4VK 3LP0A 5GINA 4DU4A 4DF4A 3NFAA 1YJWN 4EFHA 1L3SA 1IV0A 4CF2A 1MA9B 4FW2A 4W5TA 4IFVA 3SPYA 3ZX2A 2JGUA 1TGOA 1RDCA 3DXKB 4WQ4A 4IZ9A 2F8SA 3MECA 1Q9XA 4FWMA 1OVYA 5HRNA 4X64K 3E01A 4CESA 3ZSYA 5JLHA 1J6ZA 1NOYA 4NLBA 2WOMA 1BA1A 2D5RA 4O0IA 2O8EB 1VSMA 1Z26A 3ULDA 1QQCA 4BRDA 3THYB 4ELVA 3WEEA 2EWSA 4H0YB 3SCXA 3EKUA 1W0HA 5CZ1A 4DMNA 1SAZA 3NBPA 3DAWA 2PAVA 4BRFA 4CJ5A 1JL2A 2X74A 4KHSA 3MCPA 2QKKA 4FJIA 3C65A 4ISGA 2D0BA 5I3UA 4CEBA 4O44A 4KO0A 3ZT0A 2YHAA 4LC9B 1K9MO 1UA0A 2DFFA 5FDLA 1HPMA 4DTUA 4B9SA 2P9UB 3QFUA 4HCCA 4DTSA 4F3TA 4IJAA 2G8KA 4KPYA 1HR0K 5AQGA 3AA4A 3THVA 2DFEA 2J4RA 4BRHA 4FXDA 5LL6Z 5KI6A 5DM7L 3AV9A 5HRRA 4JI7K 1U2VB 2NRHA 5LJWA 3CCVN 2CH6A 3I8BA 4CJKA 3UKUB 4AQYK 1IH7A 4OVLA 2VWBA 2WUSA 1XWLA 2VWJA 4LFCK 3SQ0A 5GAEP 3GDQA 4RWTA 2BGGA 4NB4A 3LAKA 5BREA 4DTNA 5C0YA 3OYBA 2Q1NA 1ATNA 1GOAA 5JLFA 3HM8A 3L3VA 4FJ9A 4HTUA 2WFBA 2VQFK 5F1XA 3GOIA 4JKGB 3N4PA 1YF5L 5JVHL 3KD5E 3A5OC 4Z94A 1BI4B 5GADP 5M1KA 1VSIA 1NK9A 3TAMA 3CCUN 1X3MA 3HO1A 1JCGA 2I7NA 1XQSC 3O4QA 3AVKA 1RNHA 1T8EA 5FPMA 3C0BA 5CHIA 1LW0A 5HBMA 2OYQA 1GLJO 4DV7K 1VQNN 4B1UB 4EAHD 4DTOA 4CJFA 4JAXA 1TAUA 3CFPA 3UKRB 4DLEA 4BC3A 4CJ3A 3C95A 4CHYA 3TTFA 3NMUA 2FC0A 2IOCA 2OPPA 3O6WA 3KLFA 1NGIA 3U9DA 3MWPA 3CM6A 2OCEA 1MWMA 1LV5A 4ISEA 2O4GA 1IKVA 3LDNA 2PFUA 4FO0A 2O8BB 4NYNA 2P9LB 4O8UA 3A0IX 3OYJA 4KTQA 2A41A 5E41A 2RE2A 4XH1A 1NGAA 5DM6L 4FLVA 2HVIA 2DPNA 2QI2A 3MXMA 2FXUA 5BRDA 4JI4K 3AA3A 3QIOA 4AM6A 4BC2A 2QW9A 2NRTA 4YDUC 3RMDA 5HL7L 5AQHA 5KGWA 5HP1A 3FGUA 3LWMA 5AQMA 3BZCA 1YVUA 4BRPA 4DLGA 5A2QO 2BH1A 3QETA 4B8AB 4BVPA 1BIUA 1SKWA 4I9QA 2OPSA 2FBVA 4IG0A 3DLLL 3HP9A 3AO2A 3QICA 2D0PA 4DFMA 3S3MA 4GKJK 2KKZA 5FPDA 4KHUA 1LWCA 1DEJA 3LPTA 1KAYA 2BANA 3DLRA 1UOCA 2OPRA 2P9SB 3D45A 3Q7CA 3MWTA 5EXWA 4DG1A 4BWJA 4IEIA 4DFJA 1JJ2M 3TANA 4CECA 1U45A 1QTMA 1W9HA 2NRVA 4DTPA 3G0ZA 1ITGA 2O8FB 3TSQA 4H8KA 4DSEA 1HNWK 4OLBA 4FWKA 1RBSA 4G1QA 4ILGB 2V51B 1V4TA 4OPHA 3JYTA 4IFEA 3W0LA 1BCOA 1YJ9N 3FE1A 3QNNA 1CZBA 1K8AO 3P1GA 3ENOA 5D3GA 5AFUH 4DV5K 1TVRA 1RDWX 4FZYA 4R5PA 4WQ5A 1C6VA 3E9LA 3J7YP 1IG8A 3ATUA 5KGXA 2OANA 4H0XB 1BL3A 3K5MA 3G71N 5BPMA 1BOTO 3WXJA 2P9IB 4JI8K 3CCLN 3ENBA 5AZJB 1UA1A 3DRRA 5KPTA 4F8RA 3AAPA 4O8KA 3EKSA 4CVNE 3E9OA 4JRQA 4DFKA 3T1HK 3NVMA 1X9WA 2HBLA 2QTDA 1JLCA 1HPZA 3TTCA 2Q2RA 3C6TA 1GOBA 1IKYA 1RT7A 2E88A 3THXA 2HF3A 2HNZA 3VQBA 4LF8K 4DR7K 5KRTA 1SUQA 1XMQK 2IGIA 3MAQA 2OA8A 3CMEN 1D9DA 3HSCA 1MWKA 3PO4A 3ALYA 4C8NA 1VQ6N 1TL3A 2UXCK 3ZT2A 3NVKA 1L3TA 3I33A 3HSTB 1KVCA 1S3XA 3D2EA 4OGEA 3L2QA 2GTDA 2I5JA 5M1NA 3TSUA 4NYFA 3LDQA 4FSVA 1SL2A 1J9AA 2FF6A 3SBGA 2VG7A 3VQ4A 2A5XA 4FWOA 3OY9A 4CD1A 4OJRA 4K42A 4GKKK 5C24A 3RSEA 3I56N 1DKGD 3NCIA 4YOYA 1TKZA 3S9HA 1A5VA 3CG7A 1VQON 4OPJA 2KTQA 3V1OA 3VA3A 2D1KA 1BA0A 2CH5A 4CZGA 4LD0A 4KHPK 3CFOA 2QXLA 5HRSA 1QVGM 1RT5A 2HNYA 4DB3A 4LH5A 4A59A 3GE1A 4WF9L 1C0MA 3TAPA 3CCSN 4A62A 5JICA 3AAQA 3D2FB 3OJUA 3VERA 3V9UA 5DMRA 3VESA 2YI1A 2KZZA 3QESA 1O13A 1WSJA 2P5OA 3VN5A 4F9OA 5J2MA 3SV4A 3QDKA 1S1XA 3FZFA 4JHDB 1X1PA 1NWKA 3DLBA 1RT6A 3RTVA 1U04A 2PYLA 4CBXA 5FPNA 4B1XB 4PHTX 1TKDA 2HVHA 4GW6A 4KI6A 1JLQA 2HNDA 3MEDA 4YOVA 3ASMA 1KTQA 2XY8A 4CFDA 4JI5K 4FLWA 4PKIA 1VQ7N 4E89A 1O1WA 4B3MK 4JYAK 4DR5K 3ULEB 2E2PA 4C8LA 1T6DA 1HUXA 4KH4A 1HKGA 2YHWA 2Z1GA 4CGDA 1P8ZA 5AJ3K 3AARA 1SKRA 2VCPA 5KPRA 3AO4A 4E1NA 3KK1A 4CJ7A 5E26A 3CPEA 4C8MA 4CHPA 4AHRA 2VGNA 4BROA 4FOIA 1RT2A 1RTDA 3HM9A 3VEWA 4OPAA 2KZMA 2QWRA 3RVCA 4FLTA 5B8HA 1VQ9N 2GELA 3CXCM 1JLGA 2V52B 2YCHA 3HVRA 4AHSA 2QKBA 3QLHA 3P4IA 1NK4A 1XUPO 3QBWA 2Q31A 1RT3A 1ZBHA 4CF0A 1OH6A 2D0CA 5AQUA 1XI1A 1NGEA 3QERA 4JK8A 4LF4K 2A6AA 3M8RA 3SQ2A 3AA2A 3GL1A 5J1EA 1MU2A 4FW1A 4DV6K 3VGKA 5C12A 1TYQB 3PIPL 1YUWA 1BUPA 5HROA 1XNRK 3MN7A 4AILC 3MN6A 2HMPA 4KRFA 3SMSA 4K8ZA 1WNSA 4JI1K 5AZIA 3SI6A 4BR0A 4Z4HA 4JNEA 3NH2A 2P9NA 4WQ4C 1BISA 1VRTA 1ZBLA 3V81A 4DQIA 2D0OA 1X9MA 1RT1A 1K6YA 1QZ5A 4JV5K 4CGHA 1KLNA 3NF6A 1LAWA 3E1YA 4DQ8A 2GUPA 4DTJA 2YKMA 4BGAA 4CK3A 5M1QA 2E2OA 3OBYA 3DMJA 2KHOA 3K59A 3QEXA 4BDZA 3AVIA 4YOWA 4G9ZA 4Y1CA 3ZETB 3WXIA 1HYZA 4JK9A 2FBTA 3GBTA 3S41A 3WEEB 5AQPA 1SQKA 3G6EN 4B9UA 4DUZK 4B08A 4ID5A 2ITGA 1S1WA 4RW4A 1NJWA 4FWQA 1RTJA 3P31A 5AQSA 4C1NI 4HVJA 3AVNA 1B9FA 4NCGA 3KWIA 1VQPN 1JLEA 4NO7A 2AA4A 3ZSOA 2YV0X 3KKSA 4H0TB 4B9VA 2LSNA 5FPEA 3L6QA 3JS6A 3TI0A 3CYMA 4MFBA 4K43A 2YNFA 2JWLA 3QIPA 3SZ2A 3EYZA 4CJRA 4BREA 1HKBA 2E8AA 4KBOA 3CPWM 2ASOA 4CCHA 4FM0A 1CXUA 1D4XA 1UAXA 2W6KA 3THWA 3FZHA 1C1CA 4X65K 4KHNA 4FLZA 4DHYA 3OYNA 4DTMA 3I55N 3SJJA 5AQVA 3KK3A 2XRIA 2E2QA 4I7FA 1W2BM 5EX5A 4QS7A 5AQFA 2ASMA 2HMIA 5EOYA 1ZC6A 3K9JA 1B92A 1WSFA 1VRUA 3CIPA 4W5QA 4CFCA 4YOUA 4I2PA 4FJJA 1C1AA 3U6FA 4NXNK 2I7PA 2HW3A 4Z4EA 3NH0A 3EZ5A 4IG3A 4UQGA 4CBWA 1WAJA 3HRGA 3KHYA 3L4IA 4O0JA 4CJEA 3U3YA 1BGXT 4NXMK 4O55A 3NHGA 1IKXA 2E6MA 4EIAA 3L4QA 2Q3SA 1JCEA 1QQNA 1TUUA 2O8DB 4CJQA 4M7YA 2A1SA 4FLXA 4YY3K 4M3UA 1JL1A 4FYDA 2HHTA 2X6SA 2ZGYA 3FZLA 3QMLA 4FZXC 4FJ5A 4JS4A 3BGRA 3SLCA 2HBKA 1CZ9A 3C6AA 2HHUA 1QSLA 4J2BA 1KAXA 2XY6A 1N34K 4WCEL 4IKFA 5AQNA 1NJYA 1OVQA 3RRGA 1QSSA 1JLBA 3E9PA 4BRIA 3G25A 2VWKA 1A5WA 2UXBK 5AQRA 4X62K 3TAEA 1P90A 3OYIA 1YITN 3DRPA 4FJXA 2QM1A 3IMXA 1RGIA 4DSIA 1XHXA 1KAZA 5ADXH 3C6HA 5BPLA 4MO4A 3ZX0A 4DS4A 3VEOA 5JS1A 2FBXA 1N36K 2HHXA 4FWLA 1KD1O 3OYFA 2CGJA 5IWAK 4OKJA 1E4GT 3B6OA 3RMAA 3AO5A 4RG8A 3VQCA 3HPOA 1S1VA 3JAMO 1HRHA 4H5TA 3TAGA 5M1OA 3OYHA 1B9DA 4Z4IA 1TUYA 4RW8A 3T19A 4M3RA 3H3OB 3VQPA 2RF2A 1HYSA 1GLLO 3QINA 2KQ2A 1C1BA 1NM1A 4CE9A 3PUFA 4CJPA 1K8KB 2V7YA 1VHXA 1EP4A 1GLEG 4DQSA 3QEPA 2VG6A 3OS0A 4M3WA 2R7YA 4BRLA 3F9MA 5GIOA 2P9UA 5CE3A 3CJ7A 2AP1A 3L0QA 5FRNA 1FXXA 4IO9L 1LW2A 2YNHA 2O8CB 1GLAG 1SZ2A 1EKEA 4GY2B 4Z4GA 4WQ5C 1U2VA 3CI5A 1ATRA 1ESVA 4B9QA 3O3FA 4H03B 3LZIA 1VQ5N 3UKUA 1JLAA 4KHYA 1ZBSA 4KREA 2KFNA 2G8VA 3A8YA 3ZSQA 5IT9O 4KHWA 3HVTA 4BE1A 3PO5A 3CC4N 4M41A 2WC9A 5CYQA 1RDUA 3H3NO 5AQOA 3KJVA 1J5OA 3QO9A 1YJNN 3BY5A 4BRKA 4F2RA 4GVMA 3WNGA 3M5RA 3J81O 1Z6RA 3DOLA 2NUBA 4JD2A 3KLGA 1XC9A 5C2DA 2QWMA 3OYDA 3IFRA 3OBWA 4M3TA 1BI4A 4UY8O 3TAFA 1R0AA 3QEWA 4CJLA 4EZ9A 3CJBA 3THXB 1NJXA 3TTDA 4BG8A 5I42A 4CFAA 2Q0RA 5AQYA 2JLEA 3CC2N 2HB5A 4MLHA 1DGKN 1BIZA 2W6LA 3K58A 4B1ZA 4BVOA 1K73O 3D2EB 4CGJA 1GOCA 4EP5A 3NGZA 3VQAA 3AVHA 4JKFA 1T03A 5GAHP 3R1XA 1U48A 2HHVA 1TAQA 4LF6K 5KRSA 2PZSA 1HQEA 3V9XA 1BU6O 1LWFA 4KTZA 4MO5A 1S9GA 1SS6A 3TU5A 4B3TK 4M3XA 3BDPA 4CGIA 3V1RA 4BE0A 4JEPA 3CJAA 2D0AA 4Z4FA 3ZEUB 3TSPA 1NLVA 2A3ZA 5FLXO 1WLJA 1L5UA 4IXCA 1HMVA 1Y64A 3L8BA 1YIJN 2ZF5O 3AO3A 3R8EA 4DCHA 2FSKA 5HRPA 3CHWA 5HOOA 3HOSA 1XNQK 4YOTA 1J53A 3BEXA 5M1FA 3O4WA 2ZM6K 3DRSA 3CFRA 4DWIA 2GWKA 4GV9A 1SV5A 3VF2A 1WUAA 5C15A 3A2FA 4B3SK 3O1BA 1BCMA 1REVA 3LDLA 4L3QA 1D9FA 2BTFA 3LALA 3O9UA 4JI3K 4DF8A 4FJLA 1T05A 2OTJN 4W5NA 4PKHA 3HXMA 1XMOK 4MLEA 1DTTA 3I0SA 2QXFA 4O5FA 3OA9A 3LP3A 3OW2M 3WXKA 4JK7A 4CZFA 3K0SA 3VEYA 5BPNA 5K14A 1NMDA 2ITMA 4DSKA 4OKEA 5C2FA 3OHRA 3VETA 1NJIO 4QOZB 4FJ7A 4J8FA 2KW4A 2F7TA 3DYAA 2IVNA 3NF9A 1XHZA 4A2AA 4NCBA 3UE5A 3NF8A 4FLYA 4KB1A 4H4MA 4LH4A 2O8FA 2OZMA 1JCFA 1KVBA 2RPIA 4ICLA 4CJTA 4N76A 4ISFA 4O4GA 5EY4A 4GNIA 3EL2A 3HOTA 3AVCA 1DLOA 3M8QA 4FWNA 3VQ8A 2W42A 1IBLK 1Q9YA 3O3GA 3UB5A 4FOEA 4IO8A 4DQQA 4JS5A 1HLUA 4CIEA 2XO7A 4R79A 3SAFA 4KFBA 3K2PA 4DQPA 1KRPA 5BN9A 2B4JA 4N41A 4U67L 2D4WA 1WSGA 3SBTA 4JKCA 3LWLA 2XY5A 1YTUA 3P39A 1WBDA 3HP6A 5TKWA 4CJSA 1Y97A 4CEAA 2FSJA 1C0TA 1BHLA 3PX0A 3EEQA 2A1RA 3BZKA 5F2RA 3JSMA 4FVMA 3EO3A 1QZ6A 1HKCA 1WSIA 2YJFA 5DK5A 3B6PA 4OO1J 1KXPA 4E1MA 4B9LA 1U6ZA 3H08A 3MXIA 4FM1A 1IKWA 1C0UA 1M1KO 4YOXA 1I39A 5AZIB 1NU0A 3O5BA 4H0PA 4ZTJA 2VQEK 3CCEN 3ID8A 2VGMA 4E1JA 2CGLA 3KVGA 4BDPA 3J7ZO 4CBUA 2WBNA 1YXQA 4B8CA 2P1JA 3RMBA 1S1TA 5BR8K 1QQOA 3VQ6A 2E1YA 4XEIA 1NNEA 3AO1A 1NK0A 1VSFA 1RDDA 3F73A 1J54A 5TKYA 4AH9A 4E7JA 3D0PA 3J7AP 3ATVA 1N8RO 1RDBA 3EZWA 3QEIA 2Z1JA 4JKAA 5CR4A 2YHXA 3ZCMA 2RN2A 3QFPA 3K57A 1TKXA 4FWPA 1KQSM 4CEQA 1FKPA 3NDKA 3AVGA 3VPZA 3OVNA 4FJ8A 2Q36A 4B9MA 4JI2K 1U49A 2HF4A 1EX4A 5BR9A 4DV4K 2ZJQL 1JLFA 1FK9A 1VAZA 3VF6A 3KD1E 4F3OA 1BQMA 3DLEA 2PBDA 4C8KA 2E6LA 3AVLA 2NRZA 4IFYA 2Q0UA 4JHDA 2F96A 3TR8A 3SNNA 1D5AA 4CIGA 4CEDA 3PX4A 4FPBA 4IDKA 1VSJA 4GV6A 3CM5A 3FR0A 1G15A 2QWLA 3O3HA 3AGRA 1NGHA 3QEVA 3DLGA 2P9KB 3R6MA 4BR2A 2E2NA 2Y1IA 1A5XA 2NZTA 2ZE2A 4HTLA 3D6RA 3KZBA 2F9TA 1ZBFA 4CJ4A 3AVMA 4DKWA 1N32K 4CD3A 4CJUA 3T3FA 4PUOA 5AQIA 3UIQA 4TSXA 2A40A 5T7BA 1WSEA 4N56A 3THWB 5JVGL 4CIFA 3J8AA 1ZBUA 3VOVA 3MEGA 1NGCA 1WBBA 1VSEA 4YFUA 2Y1JA 2GUIA 3D7EO 3KTQA 3OJSA 2GV9A 1JKHA 1TL1A 3TAQA 1BG3A 3NGIA 4O5BA 1VQKN 3TABA 4FZZA 1KFDA 3K5OA 1S6PA 1DTQA 1J5EK 4FVUA 5AQQA 2ZQBA 4XIUA 1YTAA 3CCMN 4AHVA 1EXQA 3MMVA 1VQ8N 3HT3A 2YJEA 4M42A 2HOEA 1S6QA 5C25A 4EHTA 1U47A 4CEZA 4IOXA 3DXMA 4ZHRA 3SV3A 5SWMA 2B6AA 5HLFA 3LP1A 4CEFA 1GLCG 4DV2K 3C7NA 1TKTA 4B1YB 5CZ2A 1KVAA 4PL8A 4LSNA 3AY9A 3BP8A 1OKJA 1UWBA 3E66A 4BRCA 1JXBA 1TYQA 4KV8A 4KI4A 2ZD1A 4FWSA 3PIOL 3VQDA 3PSFA 4K41A 3M6GA 2QWPA 4BR5A 3LDSA 3SQ1A 2ATQA 3ZT3A 4DR2K 5AQWA 3A5MC 2FSNA 4IDHA 3P38A 3FFKB 4MDAA 3FLCO 3OYAA 4FPAA 4I6MA 3V1QA 2QEXN 1IG9A 2YX6A 1VQLN 2KLAA 1IJJA 4DUYK 4KH5A 3AA5X 3VMFB 1YAGA 1SL1A 2NLXA 3Q7BA 1TV6A 3O9RA 3KLEA 3CC7N 4CF1A 1T44A 1NK8A 2E4LA 4H5RA 5ELZA 1WB9A 4QS8A 2OTLN 3V6DA 4F4KA 4V19S 3H46O 1NGBA 2BE2A 4BR4A 1WOQA 3ZETA 1NGDA 2EX3A 3CMAN 3ITHA 5J2NA 3ID6A 1Q8IA 4BC5A 4OKKA 2HHWA 4FJHA 2IVOA 1X3NA 3U8XA 3O80A 4E7IA 3SAGA 4BG9A 3HYFA 3FZKA 3DLKA 4CFBA 2XY7A 3RR7A 1L3UA 4KKOA 3QNOA 3I8DA 2NRRA 4A61A 3IS9A 4WFBL 2QA4N 5C10A 1Q7YO 1W7AA 4CHNA 2G8IA 3WXLA 3U9ZA 3ZSXA 4AM7A 2QWOA 4DU1A 1MDUB 2P9PA 1GLFO 3IAYA 3K9KA 3T1YK 3VQQA 4HWIA 5M1PA 4AHTA 3VEVA 2GWJA 4B1WB 3B8AX 4W5RA 4BC4A 1RTHA 4CZMA 2XHBA 1GLDG 3EY1A 2YKNA 1EQYA 3WUHA 4FL9A 3ZX3A 2P51A 4GMJB 1IBMK 1E4FT 3DXKA 4BQZA 5J2QA 4FK0A 5ADXA 4JN4A 1OH8A 1E3MA 1I3AA 1SKSA 3AVBA 4CZHA 4B3RK 3OYKA 4HHTA 1V4SA 5FRMA 4M63C 1ATSA 2QWQA 4FWRA 1ZXOA 1W97L 2O8EA 3DLHA 3AVAA 4CZJA 5MLCQ 3THYA 3WQTA 4JD2B 1YT3A 4JKHA 3IG1A 4GVEA 4BWMA 3ZSZA 3L2WA 1X9JA 5AQTA 3SUOA 1Q81O 5GIPA 4BQLA 2X78A 1VSKA 5F0XA 2QWNA 3BUZB 2Q97A 2BUPA 1LAVA 4FK2A 3SAHA 4KHQA 4CZIA 5CYMA 1VQ4N 2GBZA 4CZLA 1Q18A 3CQXA 3L3UA 4CHOA 3KIOA 4BRNA 3KK2A 4PQUA 1HNIA 2O8DA 3OYLA 4RW6A 3SUQA 3KWGA 5AQLA 3HPHA 3S3NA 3RWUA 4QCLA 2IIRA 4J2EA 3VQEA 3CERA 1NJZA 5AQXA 1T3VA 3HL8A 4CHZA 1S1UA 3O9QA 3HTVA 3HBTA 2UU9K 1N5YA 2IAJA 5GAGP 1VSDA 1WSHA 4WYBA 3ZLJA 3U3GA 3O08A 4M3ZA 5KQ8A 2BDPA 3G4SN 3WXMB 3DWLA 3NF7A 3FFIA 4HCBA 3A5NC 1KC8O 4LF7K 4DR1K 4CGGA 4C8OA
chains in the Genus database with same CATH topology
1QHTA 4CJTA 5HROA 1JL2A 2X74A 3T1AA 4AILC 4KHSA 2QKKA 4FJIA 4N76A 4O4GA 2D0BA 5I3UA 3V9WA 1QE1A 3OYMA 3V4IA 4CEBA 4O44A 4KRFA 4K8ZA 4KO0A 1WNSA 3AVCA 3ZT0A 2YHAA 1DLOA 3M8QA 3VQ8A 3ZSVA 3SI6A 4ELUA 4Z4HA 1UA0A 3PV8A 2W42A 2DFFA 3NH2A 5FDLA 1Q9YA 3HPGA 4DTUA 4DTRA 4B9SA 4HCCA 3O3GA 3I0RA 4DTSA 2Z1HA 4M3YA 1BISA 4F3TA 3DOKA 2G8KA 4DQQA 4JS5A 1VRTA 1D9FA 3WNEA 1ZBLA 4KPYA 1D8YA 3AA4A 3V81A 1CLQA 4CIEA 2DFEA 2XO7A 3THVA 4DQIA 1X9MA 1RT1A 4KFBA 1K6YA 4FXDA 5KI6A 4CGHA 4CHQA 3PY8A 3AV9A 5HRRA 1KLNA 3K2PA 3NF6A 1LAWA 4DU3A 1KRPA 4DQPA 2B4JA 2ETJA 4KTWA 4N41A 4DTJA 1WSGA 4N47A 2YKMA 1RTIA 4CK3A 3LWLA 2XY5A 1YTUA 4CJKA 1KFSA 5C42A 4H4OA 3HP6A 1IH7A 4OVLA 4CJSA 1Y97A 4AHCA 4CEAA 1XWLA 3SPZA 3DMJA 3P5JA 2VWJA 1C0TA 3K59A 1BHLA 3QEXA 4LSLA 4BDZA 3AVIA 3VQ7A 3G10A 3PX0A 3SQ0A 1QSYA 1L3UA 2BGGA 4Y1CA 2A1RA 1HYZA 2FBTA 3LAKA 3JSMA 1RCHA 4DTNA 2PY5A 4MQ3A 3OYBA 3MEEA 4FVMA 1GOAA 4B9UA 1WSIA 5DK5A 3B6PA 4B08A 4ID5A 2ITGA 3L3VA 4PA1A 3F9KA 1NKCA 4E1MA 4ID1A 4E7KA 4FJ9A 1S1WA 4HTUA 4B9LA 3H08A 4FJMA 3MXIA 3KD5E 4M45A 4FM1A 1IKWA 1C0UA 4RW4A 3C6UA 1I39A 3DI6A 1ASVA 1RTJA 1BI4B 4HVJA 1NJWA 1VSIA 2EHGA 3TAMA 4ZTJA 3AVNA 1NK9A 1B9FA 4NCGA 1JLEA 3ZSOA 3HO1A 2YV0X 4BDPA 3O4QA 3OYEA 3KKSA 3AVKA 2IS3A 1RNHA 4B9VA 1T8EA 2LSNA 5JS2A 1RBTA 3LAMA 1LW0A 4B8CA 5HBMA 3CYMA 4MFBA 4DQRA 4DFPA 2P1JA 2YNFA 3TI0A 2OYQA 4I2QA 3RMBA 1S1TA 3QIPA 3SZ2A 3VQ6A 3OS1A 3EYZA 1S5JA 4CJRA 2OZSA 4HUFA 4CJFA 4DTOA 4CCHA 4PWDA 3AO1A 4FJNA 1TAUA 1NK0A 1VSFA 1RDDA 4FM0A 3F73A 3CFPA 4DLEA 1CXUA 4OGCA 1UAXA 1J54A 2VG5A 3C95A 4CJ3A 4CHYA 4AH9A 1C1CA 4E7JA 2FC0A 4KHNA 3D0PA 4CK1A 4FLZA 1RDBA 3O4NA 3ZT1A 3OYNA 4DTMA 2IOCA 2OPPA 3KLFA 3QEIA 2Z1JA 3SJJA 3ZCMA 2RN2A 3CM6A 3KK3A 2XRIA 2IC3A 3K57A 1LV5A 4I7FA 1TKXA 2O4GA 1Z25A 1IKVA 1FKPA 4CEQA 3AVGA 3NDKA 1NK5A 3RMCA 4NYNA 3OVNA 4FJ8A 3P83D 4J2AA 4B9MA 1WN7A 3OYJA 1U49A 4KTQA 5E41A 1EX4A 2HMIA 2KFZA 4FLVA 4YNQA 2P5GA 2AJQA 4FCYA 1JLFA 3OYCA 1FK9A 3KD1E 1B92A 3ZSWA 1WSFA 2HVIA 1VRUA 4CEEA 4W5QA 1BQMA 4F3OA 4CFCA 3MXMA 3DLEA 4BDYA 3AA3A 3QIOA 4I2PA 4FJJA 3M8PA 4C8KA 1C1AA 3U6FA 2E6LA 3RMDA 1ZYQA 2HW3A 3AVLA 4Z4EA 4IFYA 3NH0A 2F96A 5KGWA 3TR8A 1D5AA 1RBUA 4IG3A 4CIGA 4CEDA 4UQGA 3WNFA 3LWMA 3SYZA 3PX4A 3K5LA 1TK8A 1WAJA 4CEOA 1YVUA 4IDKA 1NOZA 1VSJA 3CM5A 4DLGA 4FK4A 1G15A 3QETA 4O0JA 5CY4A 1BIUA 4B8AB 4CJEA 3O3HA 3QEVA 3U3YA 3DLGA 1BGXT 1SKWA 4O55A 4I9QA 3ZSRA 2OPSA 3NHGA 2Y1IA 1A5XA 2FBVA 1IKXA 4IG0A 2ZE2A 4DSLA 2E6MA 1RBVA 3HP9A 3AO2A 1T7PA 3K5NA 3RRHA 3M8SA 3HK2A 1ASWA 1RILA 1ZBFA 4AHUA 4CJ4A 2Q3SA 2QK9A 3AVMA 3S3MA 4DFMA 1S9EA 4CJUA 3T3FA 4F2SA 4CJQA 3OYGA 3UIQA 3NH1A 1LWCA 4TSXA 5T7BA 2A1SA 1WSEA 3LPTA 4N56A 2G8WA 4FLXA 3AVFA 4CIFA 2BANA 4M3UA 1RDAA 1IO2A 1ZBUA 3DLRA 1UOCA 2OPRA 3MEGA 1JL1A 4FYDA 4DSFA 2X6SA 2HHTA 2X6NA 1VSEA 4RW7A 3D45A 4YFUA 1NK7A 3KLIA 4DG1A 4FZXC 4FJ5A 4JS4A 2Y1JA 2GUIA 4BWJA 4CERA 3OJSA 2GV9A 1JKHA 1TL1A 3BGRA 4DFJA 3KTQA 3TAQA 2F8TA 3NGIA 1CZ9A 4IBNA 3SQ4A 4CECA 4O5BA 3TANA 3TABA 1U45A 1QSLA 4J2BA 2XY6A 1KFDA 4FZZA 4IKFA 3K5OA 1QTMA 1S6PA 1NJYA 1DTQA 4CK2A 1W9HA 3RRGA 1QSSA 1FKOA 2ZQBA 4XIUA 1YTAA 1JLBA 4AHVA 1EXQA 2VWKA 3C94A 3G0ZA 4DTPA 1BQNA 1A5WA 4Q0BA 4OLAA 1ITGA 4ELTA 3V9SA 4H8KA 3HT3A 4DSEA 4I9LA 4M42A 4OLBA 1S6QA 5C25A 4Z4CA 1RBSA 1X9SA 4G1QA 1F21A 1NKEA 1U47A 3TAEA 3OYIA 4CEZA 3DRPA 3MXJA 4FJXA 3JYTA 4ZHRA 3SV3A 5SWMA 3WNHA 4DSIA 1BCOA 1XHXA 2B6AA 4EP4A 3OS2A 3QNNA 5HLFA 1U4BA 3LP1A 1CZBA 4CEFA 3P1GA 4DS4A 5JS1A 2FBXA 5D3GA 2HHXA 2FBYA 1TVRA 1TKTA 4FLUA 3OYFA 1KCFA 5CZ2A 1KVAA 4R5PA 4FZYA 4LSNA 4OKJA 1C6VA 3B6OA 3CQ8A 3RMAA 3AO5A 1EETA 4RG8A 1RT4A 3VQCA 5KGXA 1UWBA 3HPOA 1S1VA 1HRHA 1BL3A 3K5MA 2HHUA 3AVJA 3TAGA 3OYHA 1B9DA 1KLMA 4Z4IA 4B3OA 3T19A 4RW8A 4BACA 4M3RA 3SUNA 1JXBA 4DSJA 4PY5A 4KV8A 4KI4A 2ZD1A 3LP2A 3VQPA 1UA1A 1NKBA 1WAFA 2RF2A 3VQDA 3DRRA 1HYSA 3QINA 2KQ2A 4F8RA 1C1BA 4JRQA 3LDSA 4DFKA 3SQ1A 2ATQA 3ZT3A 4CE9A 3PUFA 4CJPA 1X9WA 1EP4A 1JLCA 4DQSA 2G8FA 3QEPA 2VG6A 1HPZA 3OS0A 3L2UA 2R7YA 4M3WA 2G8HA 3C6TA 1GOBA 2Z1IA 1IKYA 4EZ6A 1ASUA 1RT7A 3OYAA 5FRNA 1FXXA 2HNZA 3V1QA 3VQBA 1TK0A 5KRTA 1SUQA 4CGFA 2IGIA 4Y1DA 3MAQA 2OA8A 2DY4A 1LW2A 4CJWA 4JRPA 2YNHA 2DFHA 1IG9A 3HJFA 4CF8A 1KSPA 1D9DA 2G8UA 3L2RA 3PO4A 1EKEA 3AA5X 3ALYA 4C8NA 4K8XA 3NAEA 1TL3A 1SL1A 4Z4GA 3ZT2A 1TV6A 3KLEA 1L3TA 3O3FA 3HSTB 4CF1A 1KVCA 1NK8A 2E4LA 3LZIA 4OGEA 1JLAA 4KB0A 4KHYA 3L2QA 4KREA 4F4KA 2G8VA 2KFNA 3V6DA 3ZSQA 3V9ZA 4FM2A 3NE6A 1N6QA 4KHWA 2YNIA 3TWHA 2I5JA 3HVTA 3DM2A 5HP1A 2BE2A 4BE1A 3PO5A 4NYFA 4M41A 5CYQA 2HHSA 5SZTA 2EX3A 1VSHA 3KJVA 1SL2A 3ITHA 4E19A 1J9AA 3LZJA 5J2NA 5J2PA 1J5OA 3SUPA 3QO9A 1L3VA 2VG7A 4ZTFA 1Q8IA 4E0DA 4F2RA 4KHUA 3VQ4A 4OKKA 2HHWA 4FJHA 4GVMA 3OY9A 3WNGA 3VA0A 4W5OA 4E7IA 4OJRA 3VQ5A 5C24A 3DOLA 3HYFA 2NUBA 3NCIA 3DLKA 4CFBA 3KLGA 2XY7A 3RR7A 1TKZA 3S3OA 3S9HA 1A5VA 3VQ9A 1XC9A 4KKOA 3CG7A 3L2VA 3QNOA 4OPJA 3OYDA 3V1OA 2KTQA 3I8DA 3VA3A 3IS9A 4M3TA 1BI4A 2G8IA 4LD0A 4CHNA 3CFOA 2RKIA 3TAFA 1R0AA 5HRSA 3QEWA 1RT5A 2HNYA 1VK0A 3ZSXA 4DU1A 4LH5A 4CJLA 5EU7A 2DTUA 2B5JA 4HUEA 1HYVA 4DTXA 2PYJA 4EZ9A 1NJXA 3RR8A 2HHQA 1SL0A 1HJRA 1C0MA 3ISNC 3VQQA 4E7HA 3TAPA 2BDPA 3IAYA 1HNVA 2YNGA 5I42A 4AHTA 4CFAA 4KAZA 1CXQA 4Q5VA 2JLEA 3OJUA 4W5RA 3V9UA 4HUGA 2HB5A 2IDOA 5DMRA 1RTHA 4N5SA 2XHBA 3EY1A 2YKNA 2KZZA 3QESA 3TARA 1BIZA 4FJKA 1WSJA 4OPKA 2P5OA 3VN5A 5J2MA 2WONA 3K58A 4J2DA 3SV4A 2P51A 4GMJB 1S1XA 4CGJA 1GOCA 1X1PA 4EP5A 3NGZA 2O4IA 3VQAA 4E3SA 4LY7A 3DLBA 4CF9A 3AVHA 1RT6A 4QAGA 3RTVA 5J2QA 1U04A 1TK5A 2PYLA 1ZBHA 3IRXA 1T03A 3EZ5A 4FK0A 4BE2A 1HQUA 4L8RB 1ZBIA 1U48A 1I3AA 1TKDA 1SKSA 2HVHA 2HHVA 3AVBA 4GW6A 1TAQA 1RBRA 2OPQA 3LANA 5KRSA 3OYKA 4HHTA 1HQEA 3V9XA 4E7LA 1NK6A 2PZSA 3PX6A 4KI6A 5FRMA 1JLQA 2HNDA 3MEDA 1LWFA 4KTZA 5KTQA 3ASMA 1S9GA 3SNNA 2YHBA 4CJVA 3DLHA 1KTQA 5FROA 3AVAA 2XY8A 4CFDA 1QS4A 3KLHA 4M3XA 3BDPA 4CGIA 3V1RA 4BE0A 1YT3A 3IG1A 2D0AA 4DS5A 4Z4FA 3ZT4A 4FLWA 4BWMA 3ZSZA 3L2WA 4RW9A 4E89A 4WE1A 1O1WA 4Z0UA 1WLJA 1LWEA 1JXEA 1L5UA 3SUOA 4NCAA 3LPUA 1HMVA 3L8BA 2X78A 1VSKA 4FJGA 1VSLA 3AO3A 4C8LA 4FK2A 1LAVA 5HRPA 4KHQA 1J53A 4B9NA 2Z1GA 4JLHA 5CYMA 3DRSA 4CGDA 3CFRA 2GBZA 3NGYA 4DWIA 4B9TA 3KKRA 3L3UA 1SKRA 3LP0A 4CHOA 1SV5A 3KIOA 3KK2A 4PQUA 4DU4A 4DF4A 1HNIA 3NFAA 3AO4A 4E1NA 3A2FA 3KK1A 1L3SA 4CF2A 4C8MA 4CHPA 1BCMA 4AHRA 1REVA 4FW2A 4RW6A 1RT2A 3OYLA 4W5TA 3SUQA 1RTDA 4IFVA 3SPYA 3LALA 3HM9A 3HPHA 3S3NA 3RWUA 4QCLA 2JGUA 4DF8A 1TGOA 4FJLA 3VQEA 1T05A 4J2EA 1RDCA 1NJZA 4W5NA 2KZMA 3HL8A 3HXMA 4FLTA 2F8SA 3MECA 4CHZA 1S1UA 1DTTA 1Q9XA 3I0SA 2QXFA 5HRNA 1N5YA 1JLGA 3HVRA 3LP3A 3E01A 4AHSA 4CESA 2IAJA 1VSDA 1WSHA 3ZSYA 2QKBA 3QLHA 1NK4A 3U3GA 1NOYA 5K14A 4DSKA 4M3ZA 4OKEA 4QOZB 1RT3A 2WOMA 4FJ7A 2D5RA 2KW4A 4CF0A 3DYAA 1VSMA 1Z26A 2D0CA 1QQCA 3NF9A 4O0IA 3ULDA 3QERA 1XI1A 1XHZA 3NF7A 4PUOA 4ELVA 4NCBA 3FFIA 3NF8A 4FLYA 4HCBA 4H4MA 4LH4A 3M8RA 3SQ2A 2OZMA 3AA2A 4KB1A 5J1EA 1MU2A 4FW1A 3SCXA 1KVBA 2RPIA 1W0HA 5CZ1A 4CGGA 4DMNA 4C8OA 3NBPA 4ICLA 4CJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QHT A;  4CJT A;  5HRO A;  1JL2 A;  2X74 A;  3T1A A;  4AIL C;  4KHS A;  2QKK A;  4FJI A;  4N76 A;  4O4G A;  2D0B A;  5I3U A;  3V9W A;  1QE1 A;  3OYM A;  3V4I A;  4CEB A;  4O44 A;  4KRF A;  4K8Z A;  4KO0 A;  1WNS A;  3AVC A;  3ZT0 A;  2YHA A;  1DLO A;  3M8Q A;  3VQ8 A;  3ZSV A;  3SI6 A;  4ELU A;  4Z4H A;  1UA0 A;  3PV8 A;  2W42 A;  2DFF A;  3NH2 A;  5FDL A;  1Q9Y A;  3HPG A;  4DTU A;  4DTR A;  4B9S A;  4HCC A;  3O3G A;  3I0R A;  4DTS A;  2Z1H A;  4M3Y A;  1BIS A;  4F3T A;  3DOK A;  2G8K A;  4DQQ A;  4JS5 A;  1VRT A;  1D9F A;  3WNE A;  1ZBL A;  4KPY A;  1D8Y A;  3AA4 A;  3V81 A;  1CLQ A;  4CIE A;  2DFE A;  2XO7 A;  3THV A;  4DQI A;  1X9M A;  1RT1 A;  4KFB A;  1K6Y A;  4FXD A;  5KI6 A;  4CGH A;  4CHQ A;  3PY8 A;  3AV9 A;  5HRR A;  1KLN A;  3K2P A;  3NF6 A;  1LAW A;  4DU3 A;  1KRP A;  4DQP A;  2B4J A;  2ETJ A;  4KTW A;  4N41 A;  4DTJ A;  1WSG A;  4N47 A;  2YKM A;  1RTI A;  4CK3 A;  3LWL A;  2XY5 A;  1YTU A;  4CJK A;  1KFS A;  5C42 A;  4H4O A;  3HP6 A;  1IH7 A;  4OVL A;  4CJS A;  1Y97 A;  4AHC A;  4CEA A;  1XWL A;  3SPZ A;  3DMJ A;  3P5J A;  2VWJ A;  1C0T A;  3K59 A;  1BHL A;  3QEX A;  4LSL A;  4BDZ A;  3AVI A;  3VQ7 A;  3G10 A;  3PX0 A;  3SQ0 A;  1QSY A;  1L3U A;  2BGG A;  4Y1C A;  2A1R A;  1HYZ A;  2FBT A;  3LAK A;  3JSM A;  1RCH A;  4DTN A;  2PY5 A;  4MQ3 A;  3OYB A;  3MEE A;  4FVM A;  1GOA A;  4B9U A;  1WSI A;  5DK5 A;  3B6P A;  4B08 A;  4ID5 A;  2ITG A;  3L3V A;  4PA1 A;  3F9K A;  1NKC A;  4E1M A;  4ID1 A;  4E7K A;  4FJ9 A;  1S1W A;  4HTU A;  4B9L A;  3H08 A;  4FJM A;  3MXI A;  3KD5 E;  4M45 A;  4FM1 A;  1IKW A;  1C0U A;  4RW4 A;  3C6U A;  1I39 A;  3DI6 A;  1ASV A;  1RTJ A;  1BI4 B;  4HVJ A;  1NJW A;  1VSI A;  2EHG A;  3TAM A;  4ZTJ A;  3AVN A;  1NK9 A;  1B9F A;  4NCG A;  1JLE A;  3ZSO A;  3HO1 A;  2YV0 X;  4BDP A;  3O4Q A;  3OYE A;  3KKS A;  3AVK A;  2IS3 A;  1RNH A;  4B9V A;  1T8E A;  2LSN A;  5JS2 A;  1RBT A;  3LAM A;  1LW0 A;  4B8C A;  5HBM A;  3CYM A;  4MFB A;  4DQR A;  4DFP A;  2P1J A;  2YNF A;  3TI0 A;  2OYQ A;  4I2Q A;  3RMB A;  1S1T A;  3QIP A;  3SZ2 A;  3VQ6 A;  3OS1 A;  3EYZ A;  1S5J A;  4CJR A;  2OZS A;  4HUF A;  4CJF A;  4DTO A;  4CCH A;  4PWD A;  3AO1 A;  4FJN A;  1TAU A;  1NK0 A;  1VSF A;  1RDD A;  4FM0 A;  3F73 A;  3CFP A;  4DLE A;  1CXU A;  4OGC A;  1UAX A;  1J54 A;  2VG5 A;  3C95 A;  4CJ3 A;  4CHY A;  4AH9 A;  1C1C A;  4E7J A;  2FC0 A;  4KHN A;  3D0P A;  4CK1 A;  4FLZ A;  1RDB A;  3O4N A;  3ZT1 A;  3OYN A;  4DTM A;  2IOC A;  2OPP A;  3KLF A;  3QEI A;  2Z1J A;  3SJJ A;  3ZCM A;  2RN2 A;  3CM6 A;  3KK3 A;  2XRI A;  2IC3 A;  3K57 A;  1LV5 A;  4I7F A;  1TKX A;  2O4G A;  1Z25 A;  1IKV A;  1FKP A;  4CEQ A;  3AVG A;  3NDK A;  1NK5 A;  3RMC A;  4NYN A;  3OVN A;  4FJ8 A;  3P83 D;  4J2A A;  4B9M A;  1WN7 A;  3OYJ A;  1U49 A;  4KTQ A;  5E41 A;  1EX4 A;  2HMI A;  2KFZ A;  4FLV A;  4YNQ A;  2P5G A;  2AJQ A;  4FCY A;  1JLF A;  3OYC A;  1FK9 A;  3KD1 E;  1B92 A;  3ZSW A;  1WSF A;  2HVI A;  1VRU A;  4CEE A;  4W5Q A;  1BQM A;  4F3O A;  4CFC A;  3MXM A;  3DLE A;  4BDY A;  3AA3 A;  3QIO A;  4I2P A;  4FJJ A;  3M8P A;  4C8K A;  1C1A A;  3U6F A;  2E6L A;  3RMD A;  1ZYQ A;  2HW3 A;  3AVL A;  4Z4E A;  4IFY A;  3NH0 A;  2F96 A;  5KGW A;  3TR8 A;  1D5A A;  1RBU A;  4IG3 A;  4CIG A;  4CED A;  4UQG A;  3WNF A;  3LWM A;  3SYZ A;  3PX4 A;  3K5L A;  1TK8 A;  1WAJ A;  4CEO A;  1YVU A;  4IDK A;  1NOZ A;  1VSJ A;  3CM5 A;  4DLG A;  4FK4 A;  1G15 A;  3QET A;  4O0J A;  5CY4 A;  1BIU A;  4B8A B;  4CJE A;  3O3H A;  3QEV A;  3U3Y A;  3DLG A;  1BGX T;  1SKW A;  4O55 A;  4I9Q A;  3ZSR A;  2OPS A;  3NHG A;  2Y1I A;  1A5X A;  2FBV A;  1IKX A;  4IG0 A;  2ZE2 A;  4DSL A;  2E6M A;  1RBV A;  3HP9 A;  3AO2 A;  1T7P A;  3K5N A;  3RRH A;  3M8S A;  3HK2 A;  1ASW A;  1RIL A;  1ZBF A;  4AHU A;  4CJ4 A;  2Q3S A;  2QK9 A;  3AVM A;  3S3M A;  4DFM A;  1S9E A;  4CJU A;  3T3F A;  4F2S A;  4CJQ A;  3OYG A;  3UIQ A;  3NH1 A;  1LWC A;  4TSX A;  5T7B A;  2A1S A;  1WSE A;  3LPT A;  4N56 A;  2G8W A;  4FLX A;  3AVF A;  4CIF A;  2BAN A;  4M3U A;  1RDA A;  1IO2 A;  1ZBU A;  3DLR A;  1UOC A;  2OPR A;  3MEG A;  1JL1 A;  4FYD A;  4DSF A;  2X6S A;  2HHT A;  2X6N A;  1VSE A;  4RW7 A;  3D45 A;  4YFU A;  1NK7 A;  3KLI A;  4DG1 A;  4FZX C;  4FJ5 A;  4JS4 A;  2Y1J A;  2GUI A;  4BWJ A;  4CER A;  3OJS A;  2GV9 A;  1JKH A;  1TL1 A;  3BGR A;  4DFJ A;  3KTQ A;  3TAQ A;  2F8T A;  3NGI A;  1CZ9 A;  4IBN A;  3SQ4 A;  4CEC A;  4O5B A;  3TAN A;  3TAB A;  1U45 A;  1QSL A;  4J2B A;  2XY6 A;  1KFD A;  4FZZ A;  4IKF A;  3K5O A;  1QTM A;  1S6P A;  1NJY A;  1DTQ A;  4CK2 A;  1W9H A;  3RRG A;  1QSS A;  1FKO A;  2ZQB A;  4XIU A;  1YTA A;  1JLB A;  4AHV A;  1EXQ A;  2VWK A;  3C94 A;  3G0Z A;  4DTP A;  1BQN A;  1A5W A;  4Q0B A;  4OLA A;  1ITG A;  4ELT A;  3V9S A;  4H8K A;  3HT3 A;  4DSE A;  4I9L A;  4M42 A;  4OLB A;  1S6Q A;  5C25 A;  4Z4C A;  1RBS A;  1X9S A;  4G1Q A;  1F21 A;  1NKE A;  1U47 A;  3TAE A;  3OYI A;  4CEZ A;  3DRP A;  3MXJ A;  4FJX A;  3JYT A;  4ZHR A;  3SV3 A;  5SWM A;  3WNH A;  4DSI A;  1BCO A;  1XHX A;  2B6A A;  4EP4 A;  3OS2 A;  3QNN A;  5HLF A;  1U4B A;  3LP1 A;  1CZB A;  4CEF A;  3P1G A;  4DS4 A;  5JS1 A;  2FBX A;  5D3G A;  2HHX A;  2FBY A;  1TVR A;  1TKT A;  4FLU A;  3OYF A;  1KCF A;  5CZ2 A;  1KVA A;  4R5P A;  4FZY A;  4LSN A;  4OKJ A;  1C6V A;  3B6O A;  3CQ8 A;  3RMA A;  3AO5 A;  1EET A;  4RG8 A;  1RT4 A;  3VQC A;  5KGX A;  1UWB A;  3HPO A;  1S1V A;  1HRH A;  1BL3 A;  3K5M A;  2HHU A;  3AVJ A;  3TAG A;  3OYH A;  1B9D A;  1KLM A;  4Z4I A;  4B3O A;  3T19 A;  4RW8 A;  4BAC A;  4M3R A;  3SUN A;  1JXB A;  4DSJ A;  4PY5 A;  4KV8 A;  4KI4 A;  2ZD1 A;  3LP2 A;  3VQP A;  1UA1 A;  1NKB A;  1WAF A;  2RF2 A;  3VQD A;  3DRR A;  1HYS A;  3QIN A;  2KQ2 A;  4F8R A;  1C1B A;  4JRQ A;  3LDS A;  4DFK A;  3SQ1 A;  2ATQ A;  3ZT3 A;  4CE9 A;  3PUF A;  4CJP A;  1X9W A;  1EP4 A;  1JLC A;  4DQS A;  2G8F A;  3QEP A;  2VG6 A;  1HPZ A;  3OS0 A;  3L2U A;  2R7Y A;  4M3W A;  2G8H A;  3C6T A;  1GOB A;  2Z1I A;  1IKY A;  4EZ6 A;  1ASU A;  1RT7 A;  3OYA A;  5FRN A;  1FXX A;  2HNZ A;  3V1Q A;  3VQB A;  1TK0 A;  5KRT A;  1SUQ A;  4CGF A;  2IGI A;  4Y1D A;  3MAQ A;  2OA8 A;  2DY4 A;  1LW2 A;  4CJW A;  4JRP A;  2YNH A;  2DFH A;  1IG9 A;  3HJF A;  4CF8 A;  1KSP A;  1D9D A;  2G8U A;  3L2R A;  3PO4 A;  1EKE A;  3AA5 X;  3ALY A;  4C8N A;  4K8X A;  3NAE A;  1TL3 A;  1SL1 A;  4Z4G A;  3ZT2 A;  1TV6 A;  3KLE A;  1L3T A;  3O3F A;  3HST B;  4CF1 A;  1KVC A;  1NK8 A;  2E4L A;  3LZI A;  4OGE A;  1JLA A;  4KB0 A;  4KHY A;  3L2Q A;  4KRE A;  4F4K A;  2G8V A;  2KFN A;  3V6D A;  3ZSQ A;  3V9Z A;  4FM2 A;  3NE6 A;  1N6Q A;  4KHW A;  2YNI A;  3TWH A;  2I5J A;  3HVT A;  3DM2 A;  5HP1 A;  2BE2 A;  4BE1 A;  3PO5 A;  4NYF A;  4M41 A;  5CYQ A;  2HHS A;  5SZT A;  2EX3 A;  1VSH A;  3KJV A;  1SL2 A;  3ITH A;  4E19 A;  1J9A A;  3LZJ A;  5J2N A;  5J2P A;  1J5O A;  3SUP A;  3QO9 A;  1L3V A;  2VG7 A;  4ZTF A;  1Q8I A;  4E0D A;  4F2R A;  4KHU A;  3VQ4 A;  4OKK A;  2HHW A;  4FJH A;  4GVM A;  3OY9 A;  3WNG A;  3VA0 A;  4W5O A;  4E7I A;  4OJR A;  3VQ5 A;  5C24 A;  3DOL A;  3HYF A;  2NUB A;  3NCI A;  3DLK A;  4CFB A;  3KLG A;  2XY7 A;  3RR7 A;  1TKZ A;  3S3O A;  3S9H A;  1A5V A;  3VQ9 A;  1XC9 A;  4KKO A;  3CG7 A;  3L2V A;  3QNO A;  4OPJ A;  3OYD A;  3V1O A;  2KTQ A;  3I8D A;  3VA3 A;  3IS9 A;  4M3T A;  1BI4 A;  2G8I A;  4LD0 A;  4CHN A;  3CFO A;  2RKI A;  3TAF A;  1R0A A;  5HRS A;  3QEW A;  1RT5 A;  2HNY A;  1VK0 A;  3ZSX A;  4DU1 A;  4LH5 A;  4CJL A;  5EU7 A;  2DTU A;  2B5J A;  4HUE A;  1HYV A;  4DTX A;  2PYJ A;  4EZ9 A;  1NJX A;  3RR8 A;  2HHQ A;  1SL0 A;  1HJR A;  1C0M A;  3ISN C;  3VQQ A;  4E7H A;  3TAP A;  2BDP A;  3IAY A;  1HNV A;  2YNG A;  5I42 A;  4AHT A;  4CFA A;  4KAZ A;  1CXQ A;  4Q5V A;  2JLE A;  3OJU A;  4W5R A;  3V9U A;  4HUG A;  2HB5 A;  2IDO A;  5DMR A;  1RTH A;  4N5S A;  2XHB A;  3EY1 A;  2YKN A;  2KZZ A;  3QES A;  3TAR A;  1BIZ A;  4FJK A;  1WSJ A;  4OPK A;  2P5O A;  3VN5 A;  5J2M A;  2WON A;  3K58 A;  4J2D A;  3SV4 A;  2P51 A;  4GMJ B;  1S1X A;  4CGJ A;  1GOC A;  1X1P A;  4EP5 A;  3NGZ A;  2O4I A;  3VQA A;  4E3S A;  4LY7 A;  3DLB A;  4CF9 A;  3AVH A;  1RT6 A;  4QAG A;  3RTV A;  5J2Q A;  1U04 A;  1TK5 A;  2PYL A;  1ZBH A;  3IRX A;  1T03 A;  3EZ5 A;  4FK0 A;  4BE2 A;  1HQU A;  4L8R B;  1ZBI A;  1U48 A;  1I3A A;  1TKD A;  1SKS A;  2HVH A;  2HHV A;  3AVB A;  4GW6 A;  1TAQ A;  1RBR A;  2OPQ A;  3LAN A;  5KRS A;  3OYK A;  4HHT A;  1HQE A;  3V9X A;  4E7L A;  1NK6 A;  2PZS A;  3PX6 A;  4KI6 A;  5FRM A;  1JLQ A;  2HND A;  3MED A;  1LWF A;  4KTZ A;  5KTQ A;  3ASM A;  1S9G A;  3SNN A;  2YHB A;  4CJV A;  3DLH A;  1KTQ A;  5FRO A;  3AVA A;  2XY8 A;  4CFD A;  1QS4 A;  3KLH A;  4M3X A;  3BDP A;  4CGI A;  3V1R A;  4BE0 A;  1YT3 A;  3IG1 A;  2D0A A;  4DS5 A;  4Z4F A;  3ZT4 A;  4FLW A;  4BWM A;  3ZSZ A;  3L2W A;  4RW9 A;  4E89 A;  4WE1 A;  1O1W A;  4Z0U A;  1WLJ A;  1LWE A;  1JXE A;  1L5U A;  3SUO A;  4NCA A;  3LPU A;  1HMV A;  3L8B A;  2X78 A;  1VSK A;  4FJG A;  1VSL A;  3AO3 A;  4C8L A;  4FK2 A;  1LAV A;  5HRP A;  4KHQ A;  1J53 A;  4B9N A;  2Z1G A;  4JLH A;  5CYM A;  3DRS A;  4CGD A;  3CFR A;  2GBZ A;  3NGY A;  4DWI A;  4B9T A;  3KKR A;  3L3U A;  1SKR A;  3LP0 A;  4CHO A;  1SV5 A;  3KIO A;  3KK2 A;  4PQU A;  4DU4 A;  4DF4 A;  1HNI A;  3NFA A;  3AO4 A;  4E1N A;  3A2F A;  3KK1 A;  1L3S A;  4CF2 A;  4C8M A;  4CHP A;  1BCM A;  4AHR A;  1REV A;  4FW2 A;  4RW6 A;  1RT2 A;  3OYL A;  4W5T A;  3SUQ A;  1RTD A;  4IFV A;  3SPY A;  3LAL A;  3HM9 A;  3HPH A;  3S3N A;  3RWU A;  4QCL A;  2JGU A;  4DF8 A;  1TGO A;  4FJL A;  3VQE A;  1T05 A;  4J2E A;  1RDC A;  1NJZ A;  4W5N A;  2KZM A;  3HL8 A;  3HXM A;  4FLT A;  2F8S A;  3MEC A;  4CHZ A;  1S1U A;  1DTT A;  1Q9X A;  3I0S A;  2QXF A;  5HRN A;  1N5Y A;  1JLG A;  3HVR A;  3LP3 A;  3E01 A;  4AHS A;  4CES A;  2IAJ A;  1VSD A;  1WSH A;  3ZSY A;  2QKB A;  3QLH A;  1NK4 A;  3U3G A;  1NOY A;  5K14 A;  4DSK A;  4M3Z A;  4OKE A;  4QOZ B;  1RT3 A;  2WOM A;  4FJ7 A;  2D5R A;  2KW4 A;  4CF0 A;  3DYA A;  1VSM A;  1Z26 A;  2D0C A;  1QQC A;  3NF9 A;  4O0I A;  3ULD A;  3QER A;  1XI1 A;  1XHZ A;  3NF7 A;  4PUO A;  4ELV A;  4NCB A;  3FFI A;  3NF8 A;  4FLY A;  4HCB A;  4H4M A;  4LH4 A;  3M8R A;  3SQ2 A;  2OZM A;  3AA2 A;  4KB1 A;  5J1E A;  1MU2 A;  4FW1 A;  3SCX A;  1KVB A;  2RPI A;  1W0H A;  5CZ1 A;  4CGG A;  4DMN A;  4C8O A;  3NBP A;  4ICL A;  4CJ5 A; 
#chains in the Genus database with same CATH topology
 1QHT A;  4LFB K;  2ASP A;  3T1A A;  4JKD A;  3V9W A;  4JKG A;  1QE1 A;  3OYM A;  3V4I A;  1HJO A;  4ELU A;  3ZSV A;  3PV8 A;  3HPG A;  4A2B A;  4DTR A;  2VYP A;  3I0R A;  3BF1 A;  2Z1H A;  4M3Y A;  2NRX A;  3DOK A;  4RCH A;  3WNE A;  1D8Y A;  1CLQ A;  3MK6 A;  4K0K K;  3R9P A;  4CHQ A;  4EHU A;  3PY8 A;  3LL3 A;  2IVP A;  4DU3 A;  3VGL A;  3IUC A;  1EWR A;  2ETJ A;  3A5L C;  4KTW A;  5AQJ A;  4N47 A;  1RTI A;  3UKR A;  3U4L A;  1KFS A;  5C42 A;  4H4O A;  1S72 N;  4AHC A;  4H5W A;  3QBX A;  2W41 A;  3PSI A;  3SPZ A;  1K8K A;  3P5J A;  4LSL A;  3VQ7 A;  3G10 A;  3GG4 A;  1QSY A;  4BGB A;  1HX1 A;  5H1S Q;  3VEX A;  2O8B A;  4DV1 K;  5EVZ A;  2P9L A;  3LDP A;  1RCH A;  2PY5 A;  4MQ3 A;  5AFU A;  1BDG A;  3MEE A;  4LF5 K;  5LMU K;  2O8C A;  4PA1 A;  5JMV A;  3F9K A;  1NKC A;  4ID1 A;  4E7K A;  3CD6 N;  3RSE B;  2NNW A;  3F2K A;  2ZJR L;  1R59 O;  4IWV A;  4FJM A;  4M45 A;  2GEM A;  3C6U A;  3DI6 A;  1ASV A;  1VQM N;  2EHG A;  5E84 A;  3KK7 A;  1T6C A;  4C23 A;  2FLO A;  4ILJ A;  3OYE A;  2IS3 A;  5JS2 A;  2WTU A;  1RBT A;  3LAM A;  3VTH A;  2UUB K;  1N33 K;  4DQR A;  3VF4 A;  4NLC A;  4DFP A;  4YDU A;  1EO1 A;  4I2Q A;  3OS1 A;  1S5J A;  2OZS A;  4HUF A;  4PWD A;  4FJN A;  4OGC A;  4BRM A;  2VG5 A;  3IDH A;  4YOR A;  4CK1 A;  3EN9 A;  3O4N A;  3ZT1 A;  2P9S A;  1NG9 A;  3EE9 A;  3T7Z A;  3QB0 A;  2IC3 A;  1Z25 A;  4BRA A;  1NK5 A;  4X66 K;  3RMC A;  4QS9 A;  2W40 A;  3P83 D;  4J2A A;  1WN7 A;  2KFZ A;  4YNQ A;  4BRQ A;  2P5G A;  4XH5 A;  2AJQ A;  4FCY A;  3OYC A;  3ZSW A;  5KPZ A;  4CEE A;  2E20 A;  4BDY A;  3M8P A;  1ZYQ A;  5BN8 A;  1XC3 A;  4A5B A;  1RBU A;  1TK8 A;  3SYZ A;  3T69 A;  3WNF A;  3K5L A;  4LFA K;  4CEO A;  4JI6 K;  1NOZ A;  1FJG K;  3ZYY X;  3J80 O;  2HBM A;  1IBK K;  4FK4 A;  3MDQ A;  4CW7 B;  5CY4 A;  1NKE A;  4BY9 C;  3MX5 A;  4H0V B;  3CF5 L;  1FW6 A;  3ZSR A;  3VGM A;  3F5T A;  3IKM A;  3WT0 A;  1CZA N;  2YHY A;  4DSL A;  1RBV A;  1H1V A;  1T7P A;  3K5N A;  3BF3 A;  3M8S A;  3RRH A;  3HK2 A;  1ASW A;  1RIL A;  4AHU A;  2QK9 A;  2ZWH A;  1S9E A;  3JXU A;  4F2S A;  3OYG A;  3VEN A;  3NH1 A;  2UUC K;  4BR7 A;  2G8W A;  2P9I A;  3ZEU A;  3AVF A;  1RDA A;  1IO2 A;  4DSF A;  5AZJ A;  2X6N A;  4RW7 A;  1NK7 A;  3KLI A;  4CER A;  3CJ1 A;  2F8T A;  3ENH A;  4IBN A;  3CCJ N;  3SQ4 A;  2JWK A;  3MN5 A;  4WFN L;  1C0F A;  1GLB G;  4CK2 A;  4RTF D;  5AQZ A;  3W3D A;  1FKO A;  1LCU A;  1OH7 A;  1S22 A;  1NMN A;  3C94 A;  4IEE A;  5BRF A;  4Q0B A;  1BQN A;  4OLA A;  4ELT A;  3V9S A;  2UXD K;  1I94 K;  4I9L A;  1QHA A;  1X9S A;  4Z4C A;  1M90 O;  2FF3 B;  1F21 A;  4WFA L;  4IOC L;  1G99 A;  3VTI A;  3MXJ A;  3WNH A;  4EP4 A;  2CGK A;  3OS2 A;  1U4B A;  4CI6 A;  1YHQ N;  4H5N A;  4DR6 K;  3O1W A;  2FBY A;  4FLU A;  2P9N B;  4CZK A;  1KCF A;  3H1Q A;  3CQ8 A;  3CJC A;  1EET A;  3LM2 A;  4C1N K;  1RT4 A;  3H1V X;  3AVJ A;  4OX9 K;  1KLM A;  4B3O A;  4ILH A;  3SUN A;  4PY5 A;  4BAC A;  5LMN K;  4A57 A;  4DSJ A;  3LP2 A;  1NKB A;  1WAF A;  1YI2 N;  2ZGZ A;  1NGG A;  1C0G A;  2UUA K;  1Q82 O;  3MX2 A;  1RFQ A;  2G8F A;  3L2U A;  4DR3 K;  3O9T A;  3SK3 A;  4PKG A;  4KH6 A;  2G8H A;  1BO5 O;  2UYT A;  2Z1I A;  4EZ6 A;  5LY3 A;  1ASU A;  4CZE A;  4Y0W A;  1TK0 A;  4AF1 A;  2DY4 A;  4CGF A;  4Y1D A;  4IOA L;  4CJW A;  4JRP A;  3HJF A;  2DFH A;  4CF8 A;  1KSP A;  2G8U A;  1NGJ A;  3D2F A;  3L2R A;  3EE8 A;  4A5A A;  3H6E A;  4K8X A;  3NAE A;  3DXM B;  2V7Z A;  4DR4 K;  3FZM A;  4KB0 A;  3LDO A;  3V9Z A;  3SMP A;  4FM2 A;  3NE6 A;  1N6Q A;  3C7N B;  2HBJ A;  2YNI A;  3TWH A;  3DM2 A;  1Z05 A;  3M1F A;  2HHS A;  3H45 C;  5SZT A;  1VSH A;  4E19 A;  3LZJ A;  5J2P A;  1QQM A;  3SUP A;  5KQD A;  4PL7 A;  3TPQ A;  1L3V A;  4ZTF A;  4E0D A;  1EWQ A;  3CQY A;  1YVN A;  4DV3 K;  4MDB A;  3N4Q A;  3VA0 A;  4W5O A;  1NBW A;  2GX9 A;  1DT9 A;  3VQ5 A;  3CCQ N;  2E1Z A;  3S3O A;  4B9T A;  3VQ9 A;  2F9W A;  4J2D A;  4YHH K;  4DV0 K;  3L2V A;  3LM9 A;  1ILY A;  3CJ9 A;  2RKI A;  4U7B A;  3CET A;  1VK0 A;  3DJC A;  1HNX K;  4B1V A;  5EU7 A;  2DTU A;  3ULE A;  3HZ6 A;  2B5J A;  4HUE A;  1HYV A;  4DTX A;  2PYJ A;  4I6M B;  4BR9 A;  3RR8 A;  2HHQ A;  4M7X A;  1SL0 A;  1HJR A;  3ISN C;  3O8M A;  4E7H A;  2ZJP L;  1HNV A;  2YNG A;  4LF9 K;  4KAZ A;  1CXQ A;  4Q5V A;  4XH4 A;  3WQU A;  4HUG A;  2IDO A;  4N5S A;  2HHH K;  1OH5 A;  3SJH A;  3TAR A;  4K25 A;  1QVF M;  4FJK A;  4OPK A;  4H0O A;  2WON A;  5BRH A;  1LOT B;  2O4I A;  4E3S A;  4LY7 A;  4CF9 A;  4QAG A;  1HNZ K;  1TK5 A;  4JKE A;  3IRX A;  3R3L A;  4BE2 A;  1HQU A;  4L8R B;  1ZBI A;  3MCA B;  5AQK A;  1NGF A;  3HI0 A;  3LAN A;  1RBR A;  2OPQ A;  1NK6 A;  4E7L A;  3M3Z A;  3PLA A;  3PX6 A;  1BWF O;  1Q86 O;  4GV3 A;  5KTQ A;  4JI0 K;  4IJN A;  2YHB A;  4CJV A;  5FRO A;  2E5L K;  1QS4 A;  3O9S A;  4BRG A;  3KLH A;  5I9E B;  4JKB A;  5AR0 A;  3AGK A;  4H5V A;  4DS5 A;  3MN9 A;  3ZT4 A;  4RW9 A;  4Z0U A;  4WE1 A;  1LWE A;  1JXE A;  4NCA A;  3LPU A;  2HST A;  3CCR N;  3VEZ A;  2H3G X;  4FJG A;  1VSL A;  2RHK A;  5LJV A;  2P9P B;  2NRW A;  2P9K A;  4B9N A;  2A42 A;  4JLH A;  3NGY A;  3KKR A;  3OTO K;  2F4V K;  3LP0 A;  5GIN A;  4DU4 A;  4DF4 A;  3NFA A;  1YJW N;  4EFH A;  1L3S A;  1IV0 A;  4CF2 A;  1MA9 B;  4FW2 A;  4W5T A;  4IFV A;  3SPY A;  3ZX2 A;  2JGU A;  1TGO A;  1RDC A;  3DXK B;  4WQ4 A;  4IZ9 A;  2F8S A;  3MEC A;  1Q9X A;  4FWM A;  1OVY A;  5HRN A;  4X64 K;  3E01 A;  4CES A;  3ZSY A;  5JLH A;  1J6Z A;  1NOY A;  4NLB A;  2WOM A;  1BA1 A;  2D5R A;  4O0I A;  2O8E B;  1VSM A;  1Z26 A;  3ULD A;  1QQC A;  4BRD A;  3THY B;  4ELV A;  3WEE A;  2EWS A;  4H0Y B;  3SCX A;  3EKU A;  1W0H A;  5CZ1 A;  4DMN A;  1SAZ A;  3NBP A;  3DAW A;  2PAV A;  4BRF A;  4CJ5 A;  1JL2 A;  2X74 A;  4KHS A;  3MCP A;  2QKK A;  4FJI A;  3C65 A;  4ISG A;  2D0B A;  5I3U A;  4CEB A;  4O44 A;  4KO0 A;  3ZT0 A;  2YHA A;  4LC9 B;  1K9M O;  1UA0 A;  2DFF A;  5FDL A;  1HPM A;  4DTU A;  4B9S A;  2P9U B;  3QFU A;  4HCC A;  4DTS A;  4F3T A;  4IJA A;  2G8K A;  4KPY A;  1HR0 K;  5AQG A;  3AA4 A;  3THV A;  2DFE A;  2J4R A;  4BRH A;  4FXD A;  5LL6 Z;  5KI6 A;  5DM7 L;  3AV9 A;  5HRR A;  4JI7 K;  1U2V B;  2NRH A;  5LJW A;  3CCV N;  2CH6 A;  3I8B A;  4CJK A;  3UKU B;  4AQY K;  1IH7 A;  4OVL A;  2VWB A;  2WUS A;  1XWL A;  2VWJ A;  4LFC K;  3SQ0 A;  5GAE P;  3GDQ A;  4RWT A;  2BGG A;  4NB4 A;  3LAK A;  5BRE A;  4DTN A;  5C0Y A;  3OYB A;  2Q1N A;  1ATN A;  1GOA A;  5JLF A;  3HM8 A;  3L3V A;  4FJ9 A;  4HTU A;  2WFB A;  2VQF K;  5F1X A;  3GOI A;  4JKG B;  3N4P A;  1YF5 L;  5JVH L;  3KD5 E;  3A5O C;  4Z94 A;  1BI4 B;  5GAD P;  5M1K A;  1VSI A;  1NK9 A;  3TAM A;  3CCU N;  1X3M A;  3HO1 A;  1JCG A;  2I7N A;  1XQS C;  3O4Q A;  3AVK A;  1RNH A;  1T8E A;  5FPM A;  3C0B A;  5CHI A;  1LW0 A;  5HBM A;  2OYQ A;  1GLJ O;  4DV7 K;  1VQN N;  4B1U B;  4EAH D;  4DTO A;  4CJF A;  4JAX A;  1TAU A;  3CFP A;  3UKR B;  4DLE A;  4BC3 A;  4CJ3 A;  3C95 A;  4CHY A;  3TTF A;  3NMU A;  2FC0 A;  2IOC A;  2OPP A;  3O6W A;  3KLF A;  1NGI A;  3U9D A;  3MWP A;  3CM6 A;  2OCE A;  1MWM A;  1LV5 A;  4ISE A;  2O4G A;  1IKV A;  3LDN A;  2PFU A;  4FO0 A;  2O8B B;  4NYN A;  2P9L B;  4O8U A;  3A0I X;  3OYJ A;  4KTQ A;  2A41 A;  5E41 A;  2RE2 A;  4XH1 A;  1NGA A;  5DM6 L;  4FLV A;  2HVI A;  2DPN A;  2QI2 A;  3MXM A;  2FXU A;  5BRD A;  4JI4 K;  3AA3 A;  3QIO A;  4AM6 A;  4BC2 A;  2QW9 A;  2NRT A;  4YDU C;  3RMD A;  5HL7 L;  5AQH A;  5KGW A;  5HP1 A;  3FGU A;  3LWM A;  5AQM A;  3BZC A;  1YVU A;  4BRP A;  4DLG A;  5A2Q O;  2BH1 A;  3QET A;  4B8A B;  4BVP A;  1BIU A;  1SKW A;  4I9Q A;  2OPS A;  2FBV A;  4IG0 A;  3DLL L;  3HP9 A;  3AO2 A;  3QIC A;  2D0P A;  4DFM A;  3S3M A;  4GKJ K;  2KKZ A;  5FPD A;  4KHU A;  1LWC A;  1DEJ A;  3LPT A;  1KAY A;  2BAN A;  3DLR A;  1UOC A;  2OPR A;  2P9S B;  3D45 A;  3Q7C A;  3MWT A;  5EXW A;  4DG1 A;  4BWJ A;  4IEI A;  4DFJ A;  1JJ2 M;  3TAN A;  4CEC A;  1U45 A;  1QTM A;  1W9H A;  2NRV A;  4DTP A;  3G0Z A;  1ITG A;  2O8F B;  3TSQ A;  4H8K A;  4DSE A;  1HNW K;  4OLB A;  4FWK A;  1RBS A;  4G1Q A;  4ILG B;  2V51 B;  1V4T A;  4OPH A;  3JYT A;  4IFE A;  3W0L A;  1BCO A;  1YJ9 N;  3FE1 A;  3QNN A;  1CZB A;  1K8A O;  3P1G A;  3ENO A;  5D3G A;  5AFU H;  4DV5 K;  1TVR A;  1RDW X;  4FZY A;  4R5P A;  4WQ5 A;  1C6V A;  3E9L A;  3J7Y P;  1IG8 A;  3ATU A;  5KGX A;  2OAN A;  4H0X B;  1BL3 A;  3K5M A;  3G71 N;  5BPM A;  1BOT O;  3WXJ A;  2P9I B;  4JI8 K;  3CCL N;  3ENB A;  5AZJ B;  1UA1 A;  3DRR A;  5KPT A;  4F8R A;  3AAP A;  4O8K A;  3EKS A;  4CVN E;  3E9O A;  4JRQ A;  4DFK A;  3T1H K;  3NVM A;  1X9W A;  2HBL A;  2QTD A;  1JLC A;  1HPZ A;  3TTC A;  2Q2R A;  3C6T A;  1GOB A;  1IKY A;  1RT7 A;  2E88 A;  3THX A;  2HF3 A;  2HNZ A;  3VQB A;  4LF8 K;  4DR7 K;  5KRT A;  1SUQ A;  1XMQ K;  2IGI A;  3MAQ A;  2OA8 A;  3CME N;  1D9D A;  3HSC A;  1MWK A;  3PO4 A;  3ALY A;  4C8N A;  1VQ6 N;  1TL3 A;  2UXC K;  3ZT2 A;  3NVK A;  1L3T A;  3I33 A;  3HST B;  1KVC A;  1S3X A;  3D2E A;  4OGE A;  3L2Q A;  2GTD A;  2I5J A;  5M1N A;  3TSU A;  4NYF A;  3LDQ A;  4FSV A;  1SL2 A;  1J9A A;  2FF6 A;  3SBG A;  2VG7 A;  3VQ4 A;  2A5X A;  4FWO A;  3OY9 A;  4CD1 A;  4OJR A;  4K42 A;  4GKK K;  5C24 A;  3RSE A;  3I56 N;  1DKG D;  3NCI A;  4YOY A;  1TKZ A;  3S9H A;  1A5V A;  3CG7 A;  1VQO N;  4OPJ A;  2KTQ A;  3V1O A;  3VA3 A;  2D1K A;  1BA0 A;  2CH5 A;  4CZG A;  4LD0 A;  4KHP K;  3CFO A;  2QXL A;  5HRS A;  1QVG M;  1RT5 A;  2HNY A;  4DB3 A;  4LH5 A;  4A59 A;  3GE1 A;  4WF9 L;  1C0M A;  3TAP A;  3CCS N;  4A62 A;  5JIC A;  3AAQ A;  3D2F B;  3OJU A;  3VER A;  3V9U A;  5DMR A;  3VES A;  2YI1 A;  2KZZ A;  3QES A;  1O13 A;  1WSJ A;  2P5O A;  3VN5 A;  4F9O A;  5J2M A;  3SV4 A;  3QDK A;  1S1X A;  3FZF A;  4JHD B;  1X1P A;  1NWK A;  3DLB A;  1RT6 A;  3RTV A;  1U04 A;  2PYL A;  4CBX A;  5FPN A;  4B1X B;  4PHT X;  1TKD A;  2HVH A;  4GW6 A;  4KI6 A;  1JLQ A;  2HND A;  3MED A;  4YOV A;  3ASM A;  1KTQ A;  2XY8 A;  4CFD A;  4JI5 K;  4FLW A;  4PKI A;  1VQ7 N;  4E89 A;  1O1W A;  4B3M K;  4JYA K;  4DR5 K;  3ULE B;  2E2P A;  4C8L A;  1T6D A;  1HUX A;  4KH4 A;  1HKG A;  2YHW A;  2Z1G A;  4CGD A;  1P8Z A;  5AJ3 K;  3AAR A;  1SKR A;  2VCP A;  5KPR A;  3AO4 A;  4E1N A;  3KK1 A;  4CJ7 A;  5E26 A;  3CPE A;  4C8M A;  4CHP A;  4AHR A;  2VGN A;  4BRO A;  4FOI A;  1RT2 A;  1RTD A;  3HM9 A;  3VEW A;  4OPA A;  2KZM A;  2QWR A;  3RVC A;  4FLT A;  5B8H A;  1VQ9 N;  2GEL A;  3CXC M;  1JLG A;  2V52 B;  2YCH A;  3HVR A;  4AHS A;  2QKB A;  3QLH A;  3P4I A;  1NK4 A;  1XUP O;  3QBW A;  2Q31 A;  1RT3 A;  1ZBH A;  4CF0 A;  1OH6 A;  2D0C A;  5AQU A;  1XI1 A;  1NGE A;  3QER A;  4JK8 A;  4LF4 K;  2A6A A;  3M8R A;  3SQ2 A;  3AA2 A;  3GL1 A;  5J1E A;  1MU2 A;  4FW1 A;  4DV6 K;  3VGK A;  5C12 A;  1TYQ B;  3PIP L;  1YUW A;  1BUP A;  5HRO A;  1XNR K;  3MN7 A;  4AIL C;  3MN6 A;  2HMP A;  4KRF A;  3SMS A;  4K8Z A;  1WNS A;  4JI1 K;  5AZI A;  3SI6 A;  4BR0 A;  4Z4H A;  4JNE A;  3NH2 A;  2P9N A;  4WQ4 C;  1BIS A;  1VRT A;  1ZBL A;  3V81 A;  4DQI A;  2D0O A;  1X9M A;  1RT1 A;  1K6Y A;  1QZ5 A;  4JV5 K;  4CGH A;  1KLN A;  3NF6 A;  1LAW A;  3E1Y A;  4DQ8 A;  2GUP A;  4DTJ A;  2YKM A;  4BGA A;  4CK3 A;  5M1Q A;  2E2O A;  3OBY A;  3DMJ A;  2KHO A;  3K59 A;  3QEX A;  4BDZ A;  3AVI A;  4YOW A;  4G9Z A;  4Y1C A;  3ZET B;  3WXI A;  1HYZ A;  4JK9 A;  2FBT A;  3GBT A;  3S41 A;  3WEE B;  5AQP A;  1SQK A;  3G6E N;  4B9U A;  4DUZ K;  4B08 A;  4ID5 A;  2ITG A;  1S1W A;  4RW4 A;  1NJW A;  4FWQ A;  1RTJ A;  3P31 A;  5AQS A;  4C1N I;  4HVJ A;  3AVN A;  1B9F A;  4NCG A;  3KWI A;  1VQP N;  1JLE A;  4NO7 A;  2AA4 A;  3ZSO A;  2YV0 X;  3KKS A;  4H0T B;  4B9V A;  2LSN A;  5FPE A;  3L6Q A;  3JS6 A;  3TI0 A;  3CYM A;  4MFB A;  4K43 A;  2YNF A;  2JWL A;  3QIP A;  3SZ2 A;  3EYZ A;  4CJR A;  4BRE A;  1HKB A;  2E8A A;  4KBO A;  3CPW M;  2ASO A;  4CCH A;  4FM0 A;  1CXU A;  1D4X A;  1UAX A;  2W6K A;  3THW A;  3FZH A;  1C1C A;  4X65 K;  4KHN A;  4FLZ A;  4DHY A;  3OYN A;  4DTM A;  3I55 N;  3SJJ A;  5AQV A;  3KK3 A;  2XRI A;  2E2Q A;  4I7F A;  1W2B M;  5EX5 A;  4QS7 A;  5AQF A;  2ASM A;  2HMI A;  5EOY A;  1ZC6 A;  3K9J A;  1B92 A;  1WSF A;  1VRU A;  3CIP A;  4W5Q A;  4CFC A;  4YOU A;  4I2P A;  4FJJ A;  1C1A A;  3U6F A;  4NXN K;  2I7P A;  2HW3 A;  4Z4E A;  3NH0 A;  3EZ5 A;  4IG3 A;  4UQG A;  4CBW A;  1WAJ A;  3HRG A;  3KHY A;  3L4I A;  4O0J A;  4CJE A;  3U3Y A;  1BGX T;  4NXM K;  4O55 A;  3NHG A;  1IKX A;  2E6M A;  4EIA A;  3L4Q A;  2Q3S A;  1JCE A;  1QQN A;  1TUU A;  2O8D B;  4CJQ A;  4M7Y A;  2A1S A;  4FLX A;  4YY3 K;  4M3U A;  1JL1 A;  4FYD A;  2HHT A;  2X6S A;  2ZGY A;  3FZL A;  3QML A;  4FZX C;  4FJ5 A;  4JS4 A;  3BGR A;  3SLC A;  2HBK A;  1CZ9 A;  3C6A A;  2HHU A;  1QSL A;  4J2B A;  1KAX A;  2XY6 A;  1N34 K;  4WCE L;  4IKF A;  5AQN A;  1NJY A;  1OVQ A;  3RRG A;  1QSS A;  1JLB A;  3E9P A;  4BRI A;  3G25 A;  2VWK A;  1A5W A;  2UXB K;  5AQR A;  4X62 K;  3TAE A;  1P90 A;  3OYI A;  1YIT N;  3DRP A;  4FJX A;  2QM1 A;  3IMX A;  1RGI A;  4DSI A;  1XHX A;  1KAZ A;  5ADX H;  3C6H A;  5BPL A;  4MO4 A;  3ZX0 A;  4DS4 A;  3VEO A;  5JS1 A;  2FBX A;  1N36 K;  2HHX A;  4FWL A;  1KD1 O;  3OYF A;  2CGJ A;  5IWA K;  4OKJ A;  1E4G T;  3B6O A;  3RMA A;  3AO5 A;  4RG8 A;  3VQC A;  3HPO A;  1S1V A;  3JAM O;  1HRH A;  4H5T A;  3TAG A;  5M1O A;  3OYH A;  1B9D A;  4Z4I A;  1TUY A;  4RW8 A;  3T19 A;  4M3R A;  3H3O B;  3VQP A;  2RF2 A;  1HYS A;  1GLL O;  3QIN A;  2KQ2 A;  1C1B A;  1NM1 A;  4CE9 A;  3PUF A;  4CJP A;  1K8K B;  2V7Y A;  1VHX A;  1EP4 A;  1GLE G;  4DQS A;  3QEP A;  2VG6 A;  3OS0 A;  4M3W A;  2R7Y A;  4BRL A;  3F9M A;  5GIO A;  2P9U A;  5CE3 A;  3CJ7 A;  2AP1 A;  3L0Q A;  5FRN A;  1FXX A;  4IO9 L;  1LW2 A;  2YNH A;  2O8C B;  1GLA G;  1SZ2 A;  1EKE A;  4GY2 B;  4Z4G A;  4WQ5 C;  1U2V A;  3CI5 A;  1ATR A;  1ESV A;  4B9Q A;  3O3F A;  4H03 B;  3LZI A;  1VQ5 N;  3UKU A;  1JLA A;  4KHY A;  1ZBS A;  4KRE A;  2KFN A;  2G8V A;  3A8Y A;  3ZSQ A;  5IT9 O;  4KHW A;  3HVT A;  4BE1 A;  3PO5 A;  3CC4 N;  4M41 A;  2WC9 A;  5CYQ A;  1RDU A;  3H3N O;  5AQO A;  3KJV A;  1J5O A;  3QO9 A;  1YJN N;  3BY5 A;  4BRK A;  4F2R A;  4GVM A;  3WNG A;  3M5R A;  3J81 O;  1Z6R A;  3DOL A;  2NUB A;  4JD2 A;  3KLG A;  1XC9 A;  5C2D A;  2QWM A;  3OYD A;  3IFR A;  3OBW A;  4M3T A;  1BI4 A;  4UY8 O;  3TAF A;  1R0A A;  3QEW A;  4CJL A;  4EZ9 A;  3CJB A;  3THX B;  1NJX A;  3TTD A;  4BG8 A;  5I42 A;  4CFA A;  2Q0R A;  5AQY A;  2JLE A;  3CC2 N;  2HB5 A;  4MLH A;  1DGK N;  1BIZ A;  2W6L A;  3K58 A;  4B1Z A;  4BVO A;  1K73 O;  3D2E B;  4CGJ A;  1GOC A;  4EP5 A;  3NGZ A;  3VQA A;  3AVH A;  4JKF A;  1T03 A;  5GAH P;  3R1X A;  1U48 A;  2HHV A;  1TAQ A;  4LF6 K;  5KRS A;  2PZS A;  1HQE A;  3V9X A;  1BU6 O;  1LWF A;  4KTZ A;  4MO5 A;  1S9G A;  1SS6 A;  3TU5 A;  4B3T K;  4M3X A;  3BDP A;  4CGI A;  3V1R A;  4BE0 A;  4JEP A;  3CJA A;  2D0A A;  4Z4F A;  3ZEU B;  3TSP A;  1NLV A;  2A3Z A;  5FLX O;  1WLJ A;  1L5U A;  4IXC A;  1HMV A;  1Y64 A;  3L8B A;  1YIJ N;  2ZF5 O;  3AO3 A;  3R8E A;  4DCH A;  2FSK A;  5HRP A;  3CHW A;  5HOO A;  3HOS A;  1XNQ K;  4YOT A;  1J53 A;  3BEX A;  5M1F A;  3O4W A;  2ZM6 K;  3DRS A;  3CFR A;  4DWI A;  2GWK A;  4GV9 A;  1SV5 A;  3VF2 A;  1WUA A;  5C15 A;  3A2F A;  4B3S K;  3O1B A;  1BCM A;  1REV A;  3LDL A;  4L3Q A;  1D9F A;  2BTF A;  3LAL A;  3O9U A;  4JI3 K;  4DF8 A;  4FJL A;  1T05 A;  2OTJ N;  4W5N A;  4PKH A;  3HXM A;  1XMO K;  4MLE A;  1DTT A;  3I0S A;  2QXF A;  4O5F A;  3OA9 A;  3LP3 A;  3OW2 M;  3WXK A;  4JK7 A;  4CZF A;  3K0S A;  3VEY A;  5BPN A;  5K14 A;  1NMD A;  2ITM A;  4DSK A;  4OKE A;  5C2F A;  3OHR A;  3VET A;  1NJI O;  4QOZ B;  4FJ7 A;  4J8F A;  2KW4 A;  2F7T A;  3DYA A;  2IVN A;  3NF9 A;  1XHZ A;  4A2A A;  4NCB A;  3UE5 A;  3NF8 A;  4FLY A;  4KB1 A;  4H4M A;  4LH4 A;  2O8F A;  2OZM A;  1JCF A;  1KVB A;  2RPI A;  4ICL A;  4CJT A;  4N76 A;  4ISF A;  4O4G A;  5EY4 A;  4GNI A;  3EL2 A;  3HOT A;  3AVC A;  1DLO A;  3M8Q A;  4FWN A;  3VQ8 A;  2W42 A;  1IBL K;  1Q9Y A;  3O3G A;  3UB5 A;  4FOE A;  4IO8 A;  4DQQ A;  4JS5 A;  1HLU A;  4CIE A;  2XO7 A;  4R79 A;  3SAF A;  4KFB A;  3K2P A;  4DQP A;  1KRP A;  5BN9 A;  2B4J A;  4N41 A;  4U67 L;  2D4W A;  1WSG A;  3SBT A;  4JKC A;  3LWL A;  2XY5 A;  1YTU A;  3P39 A;  1WBD A;  3HP6 A;  5TKW A;  4CJS A;  1Y97 A;  4CEA A;  2FSJ A;  1C0T A;  1BHL A;  3PX0 A;  3EEQ A;  2A1R A;  3BZK A;  5F2R A;  3JSM A;  4FVM A;  3EO3 A;  1QZ6 A;  1HKC A;  1WSI A;  2YJF A;  5DK5 A;  3B6P A;  4OO1 J;  1KXP A;  4E1M A;  4B9L A;  1U6Z A;  3H08 A;  3MXI A;  4FM1 A;  1IKW A;  1C0U A;  1M1K O;  4YOX A;  1I39 A;  5AZI B;  1NU0 A;  3O5B A;  4H0P A;  4ZTJ A;  2VQE K;  3CCE N;  3ID8 A;  2VGM A;  4E1J A;  2CGL A;  3KVG A;  4BDP A;  3J7Z O;  4CBU A;  2WBN A;  1YXQ A;  4B8C A;  2P1J A;  3RMB A;  1S1T A;  5BR8 K;  1QQO A;  3VQ6 A;  2E1Y A;  4XEI A;  1NNE A;  3AO1 A;  1NK0 A;  1VSF A;  1RDD A;  3F73 A;  1J54 A;  5TKY A;  4AH9 A;  4E7J A;  3D0P A;  3J7A P;  3ATV A;  1N8R O;  1RDB A;  3EZW A;  3QEI A;  2Z1J A;  4JKA A;  5CR4 A;  2YHX A;  3ZCM A;  2RN2 A;  3QFP A;  3K57 A;  1TKX A;  4FWP A;  1KQS M;  4CEQ A;  1FKP A;  3NDK A;  3AVG A;  3VPZ A;  3OVN A;  4FJ8 A;  2Q36 A;  4B9M A;  4JI2 K;  1U49 A;  2HF4 A;  1EX4 A;  5BR9 A;  4DV4 K;  2ZJQ L;  1JLF A;  1FK9 A;  1VAZ A;  3VF6 A;  3KD1 E;  4F3O A;  1BQM A;  3DLE A;  2PBD A;  4C8K A;  2E6L A;  3AVL A;  2NRZ A;  4IFY A;  2Q0U A;  4JHD A;  2F96 A;  3TR8 A;  3SNN A;  1D5A A;  4CIG A;  4CED A;  3PX4 A;  4FPB A;  4IDK A;  1VSJ A;  4GV6 A;  3CM5 A;  3FR0 A;  1G15 A;  2QWL A;  3O3H A;  3AGR A;  1NGH A;  3QEV A;  3DLG A;  2P9K B;  3R6M A;  4BR2 A;  2E2N A;  2Y1I A;  1A5X A;  2NZT A;  2ZE2 A;  4HTL A;  3D6R A;  3KZB A;  2F9T A;  1ZBF A;  4CJ4 A;  3AVM A;  4DKW A;  1N32 K;  4CD3 A;  4CJU A;  3T3F A;  4PUO A;  5AQI A;  3UIQ A;  4TSX A;  2A40 A;  5T7B A;  1WSE A;  4N56 A;  3THW B;  5JVG L;  4CIF A;  3J8A A;  1ZBU A;  3VOV A;  3MEG A;  1NGC A;  1WBB A;  1VSE A;  4YFU A;  2Y1J A;  2GUI A;  3D7E O;  3KTQ A;  3OJS A;  2GV9 A;  1JKH A;  1TL1 A;  3TAQ A;  1BG3 A;  3NGI A;  4O5B A;  1VQK N;  3TAB A;  4FZZ A;  1KFD A;  3K5O A;  1S6P A;  1DTQ A;  1J5E K;  4FVU A;  5AQQ A;  2ZQB A;  4XIU A;  1YTA A;  3CCM N;  4AHV A;  1EXQ A;  3MMV A;  1VQ8 N;  3HT3 A;  2YJE A;  4M42 A;  2HOE A;  1S6Q A;  5C25 A;  4EHT A;  1U47 A;  4CEZ A;  4IOX A;  3DXM A;  4ZHR A;  3SV3 A;  5SWM A;  2B6A A;  5HLF A;  3LP1 A;  4CEF A;  1GLC G;  4DV2 K;  3C7N A;  1TKT A;  4B1Y B;  5CZ2 A;  1KVA A;  4PL8 A;  4LSN A;  3AY9 A;  3BP8 A;  1OKJ A;  1UWB A;  3E66 A;  4BRC A;  1JXB A;  1TYQ A;  4KV8 A;  4KI4 A;  2ZD1 A;  4FWS A;  3PIO L;  3VQD A;  3PSF A;  4K41 A;  3M6G A;  2QWP A;  4BR5 A;  3LDS A;  3SQ1 A;  2ATQ A;  3ZT3 A;  4DR2 K;  5AQW A;  3A5M C;  2FSN A;  4IDH A;  3P38 A;  3FFK B;  4MDA A;  3FLC O;  3OYA A;  4FPA A;  4I6M A;  3V1Q A;  2QEX N;  1IG9 A;  2YX6 A;  1VQL N;  2KLA A;  1IJJ A;  4DUY K;  4KH5 A;  3AA5 X;  3VMF B;  1YAG A;  1SL1 A;  2NLX A;  3Q7B A;  1TV6 A;  3O9R A;  3KLE A;  3CC7 N;  4CF1 A;  1T44 A;  1NK8 A;  2E4L A;  4H5R A;  5ELZ A;  1WB9 A;  4QS8 A;  2OTL N;  3V6D A;  4F4K A;  4V19 S;  3H46 O;  1NGB A;  2BE2 A;  4BR4 A;  1WOQ A;  3ZET A;  1NGD A;  2EX3 A;  3CMA N;  3ITH A;  5J2N A;  3ID6 A;  1Q8I A;  4BC5 A;  4OKK A;  2HHW A;  4FJH A;  2IVO A;  1X3N A;  3U8X A;  3O80 A;  4E7I A;  3SAG A;  4BG9 A;  3HYF A;  3FZK A;  3DLK A;  4CFB A;  2XY7 A;  3RR7 A;  1L3U A;  4KKO A;  3QNO A;  3I8D A;  2NRR A;  4A61 A;  3IS9 A;  4WFB L;  2QA4 N;  5C10 A;  1Q7Y O;  1W7A A;  4CHN A;  2G8I A;  3WXL A;  3U9Z A;  3ZSX A;  4AM7 A;  2QWO A;  4DU1 A;  1MDU B;  2P9P A;  1GLF O;  3IAY A;  3K9K A;  3T1Y K;  3VQQ A;  4HWI A;  5M1P A;  4AHT A;  3VEV A;  2GWJ A;  4B1W B;  3B8A X;  4W5R A;  4BC4 A;  1RTH A;  4CZM A;  2XHB A;  1GLD G;  3EY1 A;  2YKN A;  1EQY A;  3WUH A;  4FL9 A;  3ZX3 A;  2P51 A;  4GMJ B;  1IBM K;  1E4F T;  3DXK A;  4BQZ A;  5J2Q A;  4FK0 A;  5ADX A;  4JN4 A;  1OH8 A;  1E3M A;  1I3A A;  1SKS A;  3AVB A;  4CZH A;  4B3R K;  3OYK A;  4HHT A;  1V4S A;  5FRM A;  4M63 C;  1ATS A;  2QWQ A;  4FWR A;  1ZXO A;  1W97 L;  2O8E A;  3DLH A;  3AVA A;  4CZJ A;  5MLC Q;  3THY A;  3WQT A;  4JD2 B;  1YT3 A;  4JKH A;  3IG1 A;  4GVE A;  4BWM A;  3ZSZ A;  3L2W A;  1X9J A;  5AQT A;  3SUO A;  1Q81 O;  5GIP A;  4BQL A;  2X78 A;  1VSK A;  5F0X A;  2QWN A;  3BUZ B;  2Q97 A;  2BUP A;  1LAV A;  4FK2 A;  3SAH A;  4KHQ A;  4CZI A;  5CYM A;  1VQ4 N;  2GBZ A;  4CZL A;  1Q18 A;  3CQX A;  3L3U A;  4CHO A;  3KIO A;  4BRN A;  3KK2 A;  4PQU A;  1HNI A;  2O8D A;  3OYL A;  4RW6 A;  3SUQ A;  3KWG A;  5AQL A;  3HPH A;  3S3N A;  3RWU A;  4QCL A;  2IIR A;  4J2E A;  3VQE A;  3CER A;  1NJZ A;  5AQX A;  1T3V A;  3HL8 A;  4CHZ A;  1S1U A;  3O9Q A;  3HTV A;  3HBT A;  2UU9 K;  1N5Y A;  2IAJ A;  5GAG P;  1VSD A;  1WSH A;  4WYB A;  3ZLJ A;  3U3G A;  3O08 A;  4M3Z A;  5KQ8 A;  2BDP A;  3G4S N;  3WXM B;  3DWL A;  3NF7 A;  3FFI A;  4HCB A;  3A5N C;  1KC8 O;  4LF7 K;  4DR1 K;  4CGG A;  4C8O A; 
#chains in the Genus database with same CATH homology
 1QHT A;  4CJT A;  5HRO A;  1JL2 A;  2X74 A;  3T1A A;  4AIL C;  4KHS A;  2QKK A;  4FJI A;  4N76 A;  4O4G A;  2D0B A;  5I3U A;  3V9W A;  1QE1 A;  3OYM A;  3V4I A;  4CEB A;  4O44 A;  4KRF A;  4K8Z A;  4KO0 A;  1WNS A;  3AVC A;  3ZT0 A;  2YHA A;  1DLO A;  3M8Q A;  3VQ8 A;  3ZSV A;  3SI6 A;  4ELU A;  4Z4H A;  1UA0 A;  3PV8 A;  2W42 A;  2DFF A;  3NH2 A;  5FDL A;  1Q9Y A;  3HPG A;  4DTU A;  4DTR A;  4B9S A;  4HCC A;  3O3G A;  3I0R A;  4DTS A;  2Z1H A;  4M3Y A;  1BIS A;  4F3T A;  3DOK A;  2G8K A;  4DQQ A;  4JS5 A;  1VRT A;  1D9F A;  3WNE A;  1ZBL A;  4KPY A;  1D8Y A;  3AA4 A;  3V81 A;  1CLQ A;  4CIE A;  2DFE A;  2XO7 A;  3THV A;  4DQI A;  1X9M A;  1RT1 A;  4KFB A;  1K6Y A;  4FXD A;  5KI6 A;  4CGH A;  4CHQ A;  3PY8 A;  3AV9 A;  5HRR A;  1KLN A;  3K2P A;  3NF6 A;  1LAW A;  4DU3 A;  1KRP A;  4DQP A;  2B4J A;  2ETJ A;  4KTW A;  4N41 A;  4DTJ A;  1WSG A;  4N47 A;  2YKM A;  1RTI A;  4CK3 A;  3LWL A;  2XY5 A;  1YTU A;  4CJK A;  1KFS A;  5C42 A;  4H4O A;  3HP6 A;  1IH7 A;  4OVL A;  4CJS A;  1Y97 A;  4AHC A;  4CEA A;  1XWL A;  3SPZ A;  3DMJ A;  3P5J A;  2VWJ A;  1C0T A;  3K59 A;  1BHL A;  3QEX A;  4LSL A;  4BDZ A;  3AVI A;  3VQ7 A;  3G10 A;  3PX0 A;  3SQ0 A;  1QSY A;  1L3U A;  2BGG A;  4Y1C A;  2A1R A;  1HYZ A;  2FBT A;  3LAK A;  3JSM A;  1RCH A;  4DTN A;  2PY5 A;  4MQ3 A;  3OYB A;  3MEE A;  4FVM A;  1GOA A;  4B9U A;  1WSI A;  5DK5 A;  3B6P A;  4B08 A;  4ID5 A;  2ITG A;  3L3V A;  4PA1 A;  3F9K A;  1NKC A;  4E1M A;  4ID1 A;  4E7K A;  4FJ9 A;  1S1W A;  4HTU A;  4B9L A;  3H08 A;  4FJM A;  3MXI A;  3KD5 E;  4M45 A;  4FM1 A;  1IKW A;  1C0U A;  4RW4 A;  3C6U A;  1I39 A;  3DI6 A;  1ASV A;  1RTJ A;  1BI4 B;  4HVJ A;  1NJW A;  1VSI A;  2EHG A;  3TAM A;  4ZTJ A;  3AVN A;  1NK9 A;  1B9F A;  4NCG A;  1JLE A;  3ZSO A;  3HO1 A;  2YV0 X;  4BDP A;  3O4Q A;  3OYE A;  3KKS A;  3AVK A;  2IS3 A;  1RNH A;  4B9V A;  1T8E A;  2LSN A;  5JS2 A;  1RBT A;  3LAM A;  1LW0 A;  4B8C A;  5HBM A;  3CYM A;  4MFB A;  4DQR A;  4DFP A;  2P1J A;  2YNF A;  3TI0 A;  2OYQ A;  4I2Q A;  3RMB A;  1S1T A;  3QIP A;  3SZ2 A;  3VQ6 A;  3OS1 A;  3EYZ A;  1S5J A;  4CJR A;  2OZS A;  4HUF A;  4CJF A;  4DTO A;  4CCH A;  4PWD A;  3AO1 A;  4FJN A;  1TAU A;  1NK0 A;  1VSF A;  1RDD A;  4FM0 A;  3F73 A;  3CFP A;  4DLE A;  1CXU A;  4OGC A;  1UAX A;  1J54 A;  2VG5 A;  3C95 A;  4CJ3 A;  4CHY A;  4AH9 A;  1C1C A;  4E7J A;  2FC0 A;  4KHN A;  3D0P A;  4CK1 A;  4FLZ A;  1RDB A;  3O4N A;  3ZT1 A;  3OYN A;  4DTM A;  2IOC A;  2OPP A;  3KLF A;  3QEI A;  2Z1J A;  3SJJ A;  3ZCM A;  2RN2 A;  3CM6 A;  3KK3 A;  2XRI A;  2IC3 A;  3K57 A;  1LV5 A;  4I7F A;  1TKX A;  2O4G A;  1Z25 A;  1IKV A;  1FKP A;  4CEQ A;  3AVG A;  3NDK A;  1NK5 A;  3RMC A;  4NYN A;  3OVN A;  4FJ8 A;  3P83 D;  4J2A A;  4B9M A;  1WN7 A;  3OYJ A;  1U49 A;  4KTQ A;  5E41 A;  1EX4 A;  2HMI A;  2KFZ A;  4FLV A;  4YNQ A;  2P5G A;  2AJQ A;  4FCY A;  1JLF A;  3OYC A;  1FK9 A;  3KD1 E;  1B92 A;  3ZSW A;  1WSF A;  2HVI A;  1VRU A;  4CEE A;  4W5Q A;  1BQM A;  4F3O A;  4CFC A;  3MXM A;  3DLE A;  4BDY A;  3AA3 A;  3QIO A;  4I2P A;  4FJJ A;  3M8P A;  4C8K A;  1C1A A;  3U6F A;  2E6L A;  3RMD A;  1ZYQ A;  2HW3 A;  3AVL A;  4Z4E A;  4IFY A;  3NH0 A;  2F96 A;  5KGW A;  3TR8 A;  1D5A A;  1RBU A;  4IG3 A;  4CIG A;  4CED A;  4UQG A;  3WNF A;  3LWM A;  3SYZ A;  3PX4 A;  3K5L A;  1TK8 A;  1WAJ A;  4CEO A;  1YVU A;  4IDK A;  1NOZ A;  1VSJ A;  3CM5 A;  4DLG A;  4FK4 A;  1G15 A;  3QET A;  4O0J A;  5CY4 A;  1BIU A;  4B8A B;  4CJE A;  3O3H A;  3QEV A;  3U3Y A;  3DLG A;  1BGX T;  1SKW A;  4O55 A;  4I9Q A;  3ZSR A;  2OPS A;  3NHG A;  2Y1I A;  1A5X A;  2FBV A;  1IKX A;  4IG0 A;  2ZE2 A;  4DSL A;  2E6M A;  1RBV A;  3HP9 A;  3AO2 A;  1T7P A;  3K5N A;  3RRH A;  3M8S A;  3HK2 A;  1ASW A;  1RIL A;  1ZBF A;  4AHU A;  4CJ4 A;  2Q3S A;  2QK9 A;  3AVM A;  3S3M A;  4DFM A;  1S9E A;  4CJU A;  3T3F A;  4F2S A;  4CJQ A;  3OYG A;  3UIQ A;  3NH1 A;  1LWC A;  4TSX A;  5T7B A;  2A1S A;  1WSE A;  3LPT A;  4N56 A;  2G8W A;  4FLX A;  3AVF A;  4CIF A;  2BAN A;  4M3U A;  1RDA A;  1IO2 A;  1ZBU A;  3DLR A;  1UOC A;  2OPR A;  3MEG A;  1JL1 A;  4FYD A;  4DSF A;  2X6S A;  2HHT A;  2X6N A;  1VSE A;  4RW7 A;  3D45 A;  4YFU A;  1NK7 A;  3KLI A;  4DG1 A;  4FZX C;  4FJ5 A;  4JS4 A;  2Y1J A;  2GUI A;  4BWJ A;  4CER A;  3OJS A;  2GV9 A;  1JKH A;  1TL1 A;  3BGR A;  4DFJ A;  3KTQ A;  3TAQ A;  2F8T A;  3NGI A;  1CZ9 A;  4IBN A;  3SQ4 A;  4CEC A;  4O5B A;  3TAN A;  3TAB A;  1U45 A;  1QSL A;  4J2B A;  2XY6 A;  1KFD A;  4FZZ A;  4IKF A;  3K5O A;  1QTM A;  1S6P A;  1NJY A;  1DTQ A;  4CK2 A;  1W9H A;  3RRG A;  1QSS A;  1FKO A;  2ZQB A;  4XIU A;  1YTA A;  1JLB A;  4AHV A;  1EXQ A;  2VWK A;  3C94 A;  3G0Z A;  4DTP A;  1BQN A;  1A5W A;  4Q0B A;  4OLA A;  1ITG A;  4ELT A;  3V9S A;  4H8K A;  3HT3 A;  4DSE A;  4I9L A;  4M42 A;  4OLB A;  1S6Q A;  5C25 A;  4Z4C A;  1RBS A;  1X9S A;  4G1Q A;  1F21 A;  1NKE A;  1U47 A;  3TAE A;  3OYI A;  4CEZ A;  3DRP A;  3MXJ A;  4FJX A;  3JYT A;  4ZHR A;  3SV3 A;  5SWM A;  3WNH A;  4DSI A;  1BCO A;  1XHX A;  2B6A A;  4EP4 A;  3OS2 A;  3QNN A;  5HLF A;  1U4B A;  3LP1 A;  1CZB A;  4CEF A;  3P1G A;  4DS4 A;  5JS1 A;  2FBX A;  5D3G A;  2HHX A;  2FBY A;  1TVR A;  1TKT A;  4FLU A;  3OYF A;  1KCF A;  5CZ2 A;  1KVA A;  4R5P A;  4FZY A;  4LSN A;  4OKJ A;  1C6V A;  3B6O A;  3CQ8 A;  3RMA A;  3AO5 A;  1EET A;  4RG8 A;  1RT4 A;  3VQC A;  5KGX A;  1UWB A;  3HPO A;  1S1V A;  1HRH A;  1BL3 A;  3K5M A;  2HHU A;  3AVJ A;  3TAG A;  3OYH A;  1B9D A;  1KLM A;  4Z4I A;  4B3O A;  3T19 A;  4RW8 A;  4BAC A;  4M3R A;  3SUN A;  1JXB A;  4DSJ A;  4PY5 A;  4KV8 A;  4KI4 A;  2ZD1 A;  3LP2 A;  3VQP A;  1UA1 A;  1NKB A;  1WAF A;  2RF2 A;  3VQD A;  3DRR A;  1HYS A;  3QIN A;  2KQ2 A;  4F8R A;  1C1B A;  4JRQ A;  3LDS A;  4DFK A;  3SQ1 A;  2ATQ A;  3ZT3 A;  4CE9 A;  3PUF A;  4CJP A;  1X9W A;  1EP4 A;  1JLC A;  4DQS A;  2G8F A;  3QEP A;  2VG6 A;  1HPZ A;  3OS0 A;  3L2U A;  2R7Y A;  4M3W A;  2G8H A;  3C6T A;  1GOB A;  2Z1I A;  1IKY A;  4EZ6 A;  1ASU A;  1RT7 A;  3OYA A;  5FRN A;  1FXX A;  2HNZ A;  3V1Q A;  3VQB A;  1TK0 A;  5KRT A;  1SUQ A;  4CGF A;  2IGI A;  4Y1D A;  3MAQ A;  2OA8 A;  2DY4 A;  1LW2 A;  4CJW A;  4JRP A;  2YNH A;  2DFH A;  1IG9 A;  3HJF A;  4CF8 A;  1KSP A;  1D9D A;  2G8U A;  3L2R A;  3PO4 A;  1EKE A;  3AA5 X;  3ALY A;  4C8N A;  4K8X A;  3NAE A;  1TL3 A;  1SL1 A;  4Z4G A;  3ZT2 A;  1TV6 A;  3KLE A;  1L3T A;  3O3F A;  3HST B;  4CF1 A;  1KVC A;  1NK8 A;  2E4L A;  3LZI A;  4OGE A;  1JLA A;  4KB0 A;  4KHY A;  3L2Q A;  4KRE A;  4F4K A;  2G8V A;  2KFN A;  3V6D A;  3ZSQ A;  3V9Z A;  4FM2 A;  3NE6 A;  1N6Q A;  4KHW A;  2YNI A;  3TWH A;  2I5J A;  3HVT A;  3DM2 A;  5HP1 A;  2BE2 A;  4BE1 A;  3PO5 A;  4NYF A;  4M41 A;  5CYQ A;  2HHS A;  5SZT A;  2EX3 A;  1VSH A;  3KJV A;  1SL2 A;  3ITH A;  4E19 A;  1J9A A;  3LZJ A;  5J2N A;  5J2P A;  1J5O A;  3SUP A;  3QO9 A;  1L3V A;  2VG7 A;  4ZTF A;  1Q8I A;  4E0D A;  4F2R A;  4KHU A;  3VQ4 A;  4OKK A;  2HHW A;  4FJH A;  4GVM A;  3OY9 A;  3WNG A;  3VA0 A;  4W5O A;  4E7I A;  4OJR A;  3VQ5 A;  5C24 A;  3DOL A;  3HYF A;  2NUB A;  3NCI A;  3DLK A;  4CFB A;  3KLG A;  2XY7 A;  3RR7 A;  1TKZ A;  3S3O A;  3S9H A;  1A5V A;  3VQ9 A;  1XC9 A;  4KKO A;  3CG7 A;  3L2V A;  3QNO A;  4OPJ A;  3OYD A;  3V1O A;  2KTQ A;  3I8D A;  3VA3 A;  3IS9 A;  4M3T A;  1BI4 A;  2G8I A;  4LD0 A;  4CHN A;  3CFO A;  2RKI A;  3TAF A;  1R0A A;  5HRS A;  3QEW A;  1RT5 A;  2HNY A;  1VK0 A;  3ZSX A;  4DU1 A;  4LH5 A;  4CJL A;  5EU7 A;  2DTU A;  2B5J A;  4HUE A;  1HYV A;  4DTX A;  2PYJ A;  4EZ9 A;  1NJX A;  3RR8 A;  2HHQ A;  1SL0 A;  1HJR A;  1C0M A;  3ISN C;  3VQQ A;  4E7H A;  3TAP A;  2BDP A;  3IAY A;  1HNV A;  2YNG A;  5I42 A;  4AHT A;  4CFA A;  4KAZ A;  1CXQ A;  4Q5V A;  2JLE A;  3OJU A;  4W5R A;  3V9U A;  4HUG A;  2HB5 A;  2IDO A;  5DMR A;  1RTH A;  4N5S A;  2XHB A;  3EY1 A;  2YKN A;  2KZZ A;  3QES A;  3TAR A;  1BIZ A;  4FJK A;  1WSJ A;  4OPK A;  2P5O A;  3VN5 A;  5J2M A;  2WON A;  3K58 A;  4J2D A;  3SV4 A;  2P51 A;  4GMJ B;  1S1X A;  4CGJ A;  1GOC A;  1X1P A;  4EP5 A;  3NGZ A;  2O4I A;  3VQA A;  4E3S A;  4LY7 A;  3DLB A;  4CF9 A;  3AVH A;  1RT6 A;  4QAG A;  3RTV A;  5J2Q A;  1U04 A;  1TK5 A;  2PYL A;  1ZBH A;  3IRX A;  1T03 A;  3EZ5 A;  4FK0 A;  4BE2 A;  1HQU A;  4L8R B;  1ZBI A;  1U48 A;  1I3A A;  1TKD A;  1SKS A;  2HVH A;  2HHV A;  3AVB A;  4GW6 A;  1TAQ A;  1RBR A;  2OPQ A;  3LAN A;  5KRS A;  3OYK A;  4HHT A;  1HQE A;  3V9X A;  4E7L A;  1NK6 A;  2PZS A;  3PX6 A;  4KI6 A;  5FRM A;  1JLQ A;  2HND A;  3MED A;  1LWF A;  4KTZ A;  5KTQ A;  3ASM A;  1S9G A;  3SNN A;  2YHB A;  4CJV A;  3DLH A;  1KTQ A;  5FRO A;  3AVA A;  2XY8 A;  4CFD A;  1QS4 A;  3KLH A;  4M3X A;  3BDP A;  4CGI A;  3V1R A;  4BE0 A;  1YT3 A;  3IG1 A;  2D0A A;  4DS5 A;  4Z4F A;  3ZT4 A;  4FLW A;  4BWM A;  3ZSZ A;  3L2W A;  4RW9 A;  4E89 A;  4WE1 A;  1O1W A;  4Z0U A;  1WLJ A;  1LWE A;  1JXE A;  1L5U A;  3SUO A;  4NCA A;  3LPU A;  1HMV A;  3L8B A;  2X78 A;  1VSK A;  4FJG A;  1VSL A;  3AO3 A;  4C8L A;  4FK2 A;  1LAV A;  5HRP A;  4KHQ A;  1J53 A;  4B9N A;  2Z1G A;  4JLH A;  5CYM A;  3DRS A;  4CGD A;  3CFR A;  2GBZ A;  3NGY A;  4DWI A;  4B9T A;  3KKR A;  3L3U A;  1SKR A;  3LP0 A;  4CHO A;  1SV5 A;  3KIO A;  3KK2 A;  4PQU A;  4DU4 A;  4DF4 A;  1HNI A;  3NFA A;  3AO4 A;  4E1N A;  3A2F A;  3KK1 A;  1L3S A;  4CF2 A;  4C8M A;  4CHP A;  1BCM A;  4AHR A;  1REV A;  4FW2 A;  4RW6 A;  1RT2 A;  3OYL A;  4W5T A;  3SUQ A;  1RTD A;  4IFV A;  3SPY A;  3LAL A;  3HM9 A;  3HPH A;  3S3N A;  3RWU A;  4QCL A;  2JGU A;  4DF8 A;  1TGO A;  4FJL A;  3VQE A;  1T05 A;  4J2E A;  1RDC A;  1NJZ A;  4W5N A;  2KZM A;  3HL8 A;  3HXM A;  4FLT A;  2F8S A;  3MEC A;  4CHZ A;  1S1U A;  1DTT A;  1Q9X A;  3I0S A;  2QXF A;  5HRN A;  1N5Y A;  1JLG A;  3HVR A;  3LP3 A;  3E01 A;  4AHS A;  4CES A;  2IAJ A;  1VSD A;  1WSH A;  3ZSY A;  2QKB A;  3QLH A;  1NK4 A;  3U3G A;  1NOY A;  5K14 A;  4DSK A;  4M3Z A;  4OKE A;  4QOZ B;  1RT3 A;  2WOM A;  4FJ7 A;  2D5R A;  2KW4 A;  4CF0 A;  3DYA A;  1VSM A;  1Z26 A;  2D0C A;  1QQC A;  3NF9 A;  4O0I A;  3ULD A;  3QER A;  1XI1 A;  1XHZ A;  3NF7 A;  4PUO A;  4ELV A;  4NCB A;  3FFI A;  3NF8 A;  4FLY A;  4HCB A;  4H4M A;  4LH4 A;  3M8R A;  3SQ2 A;  2OZM A;  3AA2 A;  4KB1 A;  5J1E A;  1MU2 A;  4FW1 A;  3SCX A;  1KVB A;  2RPI A;  1W0H A;  5CZ1 A;  4CGG A;  4DMN A;  4C8O A;  3NBP A;  4ICL A;  4CJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...