4HUEA

Structure of 5-chlorouracil modified g:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
molecule keywords Ribonuclease H
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hueA00
1RDAA 5T7BA 4O0JA 5FROA 3CG7A 4DTRA 3QERA 3VQ7A 4J2DA 1JXBA 1J9AA 2RN2A 1BIZA 4EZ9A 2HMIA 1JL2A 4Z4IA 1ASUA 4DLGA 4AHVA 3AVMA 3M8RA 4FK2A 1R0AA 1KVAA 3LPTA 2A1SA 3OYEA 3WNGA 3NGIA 3RMBA 4DTOA 1HPZA 4QAGA 4M45A 1B92A 5KGXA 3RMDA 4G1QA 2XY5A 3CFOA 4FJJA 2KZMA 3KK1A 1TL3A 4EP5A 3L8BA 4Z4GA 3OYKA 2G8UA 1G15A 4CERA 4KHWA 3OYLA 1BCMA 4FJNA 3AO5A 3HXMA 4ELUA 4B8AB 2RPIA 2HNZA 3ZSRA 4KKOA 4N56A 4BDYA 4OPKA 3NF9A 2X74A 2YKMA 4NYNA 3TAPA 3LWMA 4KB0A 4LH4A 1W0HA 5HROA 2HHTA 5HRPA 4FJGA 1JL1A 2G8FA 1KFSA 3L2WA 4E7KA 4CJEA 3VQQA 1SKSA 5SZTA 1NJWA 4CHOA 2HHWA 2HVIA 1RT1A 3SPYA 3C95A 3LAKA 2JGUA 4CFAA 4CJSA 1VRTA 1RTDA 4PA1A 3SZ2A 3QEIA 4CEZA 5J2QA 2KZZA 3K5OA 5HRRA 4DTSA 3LALA 3QNNA 4DQIA 2B5JA 4GMJB 3NGYA 3M8QA 2E6MA 3OYAA 3QEWA 2OZSA 4FZZA 2BGGA 1LAWA 3T19A 4CK2A 1Q8IA 3OYNA 4DMNA 1J53A 3C94A 1TKTA 4B9LA 1J5OA 1BISA 5CZ2A 2B6AA 1L3VA 4DU4A 3TAQA 1VSHA 1J54A 1KRPA 1C0MA 1S6PA 4RW6A 4AH9A 4B8CA 3OYJA 4KI4A 2IDOA 4I2PA 5E41A 3KD1E 1HMVA 1SL0A 1U04A 3DOKA 4M3RA 4DU1A 1NKEA 1LAVA 1GOCA 4OGCA 4CGIA 4O55A 4CEFA 2WOMA 1WSEA 1WSFA 4AHTA 3SQ2A 2YNGA 3SQ0A 1TK5A 1TK8A 4B9SA 3DMJA 3K58A 1UAXA 1C1AA 4ZTJA 4BE2A 3NCIA 3DRSA 4JLHA 4DSJA 1XHZA 3OJUA 4PQUA 2OPRA 2G8VA 2I5JA 3MEGA 4E0DA 3QIOA 3AA2A 3AVHA 3PX6A 4KB1A 1RNHA 1EETA 2PYJA 4KTQA 3CM6A 1L3UA 4KV8A 4RW4A 4F4KA 2HHSA 2KFNA 4KHSA 5SWMA 1S1UA 3ZSZA 4E7JA 4CEQA 4FM1A 3MAQA 1B9DA 3NH1A 2HNDA 1IO2A 1RT4A 1HQEA 5CYMA 1XWLA 2GUIA 4BDZA 4FJLA 3SV4A 3SQ1A 3NE6A 1HNVA 4EP4A 1L3SA 1IKYA 1Q9YA 4DF4A 4QOZB 4WE1A 3HP6A 3P83D 1RTIA 1HYSA 1NOYA 5HP1A 2ATQA 3ZT0A 3SJJA 3HJFA 1RT5A 4CJVA 3DOLA 1U49A 1C1CA 4DLEA 2IOCA 4PUOA 4KHUA 4CGHA 3AVBA 3AVGA 4B9UA 4FZXC 4FK4A 2IC3A 3SI6A 2OZMA 3KIOA 3VQ5A 3LP3A 3KK3A 4F2SA 3LANA 1QSLA 4C8MA 4Y1CA 2X6NA 2GBZA 4AHSA 1IKXA 4CESA 3KLFA 3NDKA 4DFJA 1S1WA 3VQ9A 4CFBA 3CM5A 3TWHA 3ALYA 4AHUA 3LWLA 5J2MA 4FYDA 4BE0A 2G8KA 4Z4FA 1TAUA 4KTWA 4UQGA 4XIUA 2D0AA 1RTHA 4CJUA 4FLYA 3JSMA 4O4GA 5EU7A 4CF8A 5I3UA 1K6YA 3NBPA 3SUPA 4OKKA 4E7IA 3SUOA 4Q0BA 5KRTA 4E89A 3PV8A 4PWDA 2HHXA 4JRPA 1I39A 4CGJA 4FCYA 3SCXA 4Z4EA 4CHYA 4H4MA 3NH2A 1NKBA 2PY5A 4M3WA 3MEDA 3PO5A 2QKKA 3U3GA 2YNFA 2Y1IA 4DQPA 3AVLA 2O4IA 1Q9XA 3TABA 1X9SA 1JLAA 1HQUA 1HRHA 3CQ8A 3AVNA 1SKRA 4CEOA 4DU3A 5HRNA 3V1QA 4DFKA 3BDPA 4KPYA 2ZE2A 3DRRA 4E7HA 4DG1A 5KRSA 3QNOA 1JLGA 5FRMA 1FKOA 4J2BA 3OS2A 4CJLA 4FLUA 4FJHA 1VSIA 1I3AA 1C0UA 3AVFA 3LP1A 4JRQA 3V1OA 4C8NA 1L5UA 1VSMA 1IG9A 5HRSA 4BACA 3S3MA 3C6TA 5C25A 3O3GA 1ASVA 4CJ4A 1T03A 2O4GA 4RW9A 4CEEA 1EXQA 3SPZA 2KQ2A 3AO3A 1NJYA 1VSKA 3ZCMA 4CEDA 1RBSA 1NK8A 1T8EA 4KI6A 1VSJA 1MU2A 2FBTA 2Z1HA 3MEEA 4IBNA 1BGXT 4KHYA 4N5SA 3AVJA 3OYCA 3K57A 4F3OA 1LWCA 1JLFA 4CEAA 3VQPA 5KI6A 1KSPA 1S1TA 4CJTA 3LZJA 3IS9A 4HUFA 1NK5A 2AJQA 1TK0A 3HSTB 1WNSA 4IFYA 4OKJA 3VA0A 1YT3A 3D0PA 2HB5A 3OVNA 4J2EA 1UWBA 1WSIA 3PY8A 2E6LA 1CXQA 2G8WA 5CZ1A 3AA4A 4DFPA 3OYMA 1QQCA 3IRXA 4CJKA 4OLAA 4E1NA 3KLHA 4W5QA 3DRPA 1S9EA 3VN5A 4LSLA 2A1RA 3EZ5A 4LSNA 2HVHA 1ZYQA 2X78A 1RT2A 1O1WA 2P51A 3IAYA 4DTJA 4DSFA 1RCHA 1TKXA 2VWJA 4I2QA 3P5JA 3CFPA 3DLHA 3MXJA 3AVCA 4FLXA 1BCOA 1WN7A 2PYLA 3CYMA 5C24A 3C6UA 3S3NA 3KD5E 3O3FA 1QTMA 3TI0A 4F8RA 2GV9A 2FBYA 2QXFA 4CF2A 1WSHA 1EX4A 2Z1JA 4AHCA 3E01A 3AO2A 1D8YA 4L8RB 2YHBA 1KVCA 4GVMA 3VQ8A 2ETJA 4O44A 3L2RA 4Z0UA 3JYTA 1WAFA 1HJRA 4LY7A 2LSNA 2DFFA 1A5WA 1TGOA 2IGIA 4CJQA 3K5MA 2OA8A 4NCBA 4C8KA 1N6QA 1BIUA 4FJMA 1RBUA 3RR8A 1RDCA 4OKEA 1ZBFA 1YTUA 1NK7A 3L2QA 1XI1A 4KHQA 1REVA 1JLEA 1KVBA 1DTTA 1RBTA 4RW8A 4CF0A 2P5OA 5CYQA 4FW2A 4Q5VA 4M3UA 4KO0A 1S5JA 4M41A 5J1EA 1VSLA 1Y97A 3AO4A 3KLEA 1RT3A 2Z1GA 3AVKA 3ZT1A 1A5XA 3V9SA 4E3SA 4DTMA 5D3GA 2F8TA 3AA5X 1KLMA 3AA3A 1F21A 1T05A 2EHGA 4N41A 4FK0A 1S6QA 4IG3A 4HHTA 3L3UA 2R7YA 4B9MA 3RR7A 2OYQA 5J2NA 2HW3A 5K14A 4DTNA 1ITGA 1T7PA 3K5NA 4DQSA 4DS5A 4CGDA 3KJVA 2BE2A 4CHPA 4M42A 4M3ZA 4F3TA 3TAEA 2DTUA 3AV9A 4NYFA 1XC9A 2ZD1A 4DS4A 3G0ZA 1X1PA 2OPSA 2Z1IA 3BGRA 3EYZA 4FJ7A 3EY1A 3VA3A 4DFMA 1FK9A 3VQAA 3ZT2A 3OYBA 4DSEA 4FXDA 3A2FA 1IKVA 1Z26A 4NCGA 3LZIA 4HUGA 4DSLA 4MQ3A 1C6VA 3F73A 4KAZA 2B4JA 4ID5A 1RILA 4CCHA 4GW6A 4HVJA 3SQ4A 3HPHA 3OYDA 4DQRA 4YFUA 3O4NA 3V1RA 3H08A 3DLBA 3L2VA 3TR8A 3HVRA 3V81A 1SKWA 2G8IA 3DYAA 1RBRA 2VG7A 4Z4HA 3I0RA 3QEVA 2P5GA 2IAJA 3HT3A 3AVIA 3HVTA 1VK0A 3WNFA 3RTVA 2DY4A 2YKNA 2XY6A 4CJ5A 1QSSA 1U47A 4CFCA 3ITHA 5I42A 3NH0A 4FLTA 1U45A 1NK6A 4NCAA 2ITGA 1NOZA 3OY9A 1S9GA 3OS0A 1BI4B 4CGFA 4OJRA 1YTAA 4FLZA 3MXIA 1N5YA 4RW7A 1C0TA 2RKIA 1TKZA 1Z25A 4LH5A 4FLWA 4F2RA 4HCCA 1TKDA 1FXXA 3OYHA 3NHGA 3ZT4A 1KLNA 2XY7A 3VQ4A 3S3OA 3NF7A 2BDPA 3HK2A 1NK0A 3DLRA 4FJKA 4KHNA 3B6OA 3RMCA 3ZSYA 4DWIA 1W9HA 2KFZA 3SNNA 4YNQA 4FJ8A 4LD0A 3LAMA 2YHAA 3D45A 4K8XA 3K59A 3PUFA 4BWJA 3AVAA 2P1JA 1NJXA 2DFEA 3WNEA 3AO1A 3L2UA 3G10A 1NJZA 3TANA 3VQDA 1KFDA 3P1GA 3OS1A 1FKPA 4BWMA 4CHZA 3SYZA 4B9NA 4FVMA 4ZHRA 1VSFA 3TAGA 5DK5A 2JLEA 4B9VA 5KGWA 3SUQA 3PX4A 3THVA 1X9WA 1LWFA 3ZSXA 3SV3A 2HHQA 4W5NA 3QLHA 1CZ9A 4CEBA 3FFIA 3RMAA 4ELVA 4C8OA 4PY5A 2Q3SA 3V6DA 1RT6A 3KKSA 2EX3A 3HPOA 2VG6A 1UA0A 4N76A 4OLBA 2X6SA 1UA1A 5CY4A 1QHTA 3LPUA 4CIFA 4R5PA 3OYGA 4DTXA 4CGGA 4JS5A 3V9WA 3HP9A 1TAQA 3DM2A 4TSXA 4Y1DA 2FBXA 3K5LA 2WONA 4FM2A 4DTPA 1LW2A 4M3TA 3QEPA 2W42A 1RBVA 2E4LA 1JKHA 1RDDA 3QEXA 1HYVA 2KTQA 4I7FA 1HNIA 4CJRA 4IKFA 3QESA 4OGEA 4OPJA 2FC0A 5FDLA 4JS4A 1GOAA 1S1VA 3LDSA 1B9FA 4CJPA 3MXMA 1EP4A 4FJIA 1SL1A 1JLBA 1RTJA 4B08A 3NGZA 1U4BA 3RRHA 4O5BA 4W5TA 4ID1A 3U6FA 3VQCA 3O3HA 4B9TA 4FJXA 1VRUA 3ULDA 3U3YA 3KTQA 4AHRA 1WSGA 2D0CA 3PO4A 2OPQA 4CF9A 3ZT3A 2XHBA 1LW0A 2XO7A 3ZSVA 1JXEA 4RG8A 4Z4CA 1IKWA 1LV5A 1YVUA 3QO9A 3DLKA 1RDBA 1BHLA 4KFBA 5JS2A 2QK9A 1NKCA 3M8PA 2ZQBA 3F9KA 3V9XA 4H8KA 4CFDA 2YNHA 3HL8A 5HLFA 3OYIA 4CIGA 4CJ3A 1ASWA 5C42A 4FLVA 4C8LA 4FJ9A 2F8SA 4KRFA 4I9LA 4CJFA 2YV0X 1NK9A 1EKEA 1KTQA 4B3OA 3RWUA 3V9UA 1RT7A 1JLQA 2XY8A 2OPPA 2VWKA 3MECA 4IG0A 1TV6A 3TAFA 4DTUA 4E1MA 3L3VA 4O0IA 3PX0A 5KTQA 4CECA 2FBVA 3CFRA 3LP2A 3TAMA 1D5AA 3OYFA 2HNYA 3NAEA 4DSKA 3DLGA 3TARA 1BI4A 3K2PA 1A5VA 1QS4A 4CF1A 3V9ZA 3S9HA 1U48A 1XHXA 4IDKA 1QE1A 3T1AA 1X9MA 4J2AA 4QCLA 1JLCA 1UOCA 4BDPA 1LWEA 2RF2A 4DSIA 1WSJA 4CK3A 2YNIA 4IFVA 3ZSWA 1ZBIA 2Y1JA 2VG5A 3LP0A 3QINA 3ISNC 2NUBA 3HM9A 2D0BA 4CE9A 5FRNA 1DLOA 1TVRA 1HYZA 1BL3A 1S1XA 3QIPA 1WLJA 4N47A 4CHQA 1CXUA 1TL1A 2BANA 3M8SA 1L3TA 2XRIA 3OJSA 4K8ZA 4CJWA 3O4QA 1SUQA 1ZBUA 4FZYA 2KW4A 3B6PA 4E7LA 1GOBA 3V4IA 4CK1A 3ZSQA 1VSDA 4W5OA 1C1BA 3HO1A 3DLEA 4BE1A 3KLIA 3NF8A 4ELTA 3VQEA 1QSYA 3ZSOA 1SV5A 1DTQA 3NF6A 3KKRA 1IH7A 4FW1A 4MFBA 4OVLA 4FM0A 3ASMA 4E19A 2D5RA 4HCBA 1VSEA 3NFAA 4AILC 4ZTFA 3T3FA 3RRGA 3UIQA 4KTZA 2G8HA 1D9FA 4HTUA 1SL2A 4DF8A 1NK4A 3KK2A 1BQMA 1ZBHA 1ZBLA 4KREA 5J2PA 1CZBA 2F96A 4H4OA 3KLGA 3VQBA 3QETA 4I9QA 4M3XA 2HHVA 3VQ6A 1CLQA 4CIEA 1KCFA 4EZ6A 3HYFA 4ICLA 5HBMA 2QKBA 4M3YA 5DMRA 1BQNA 3HPGA 1WAJA 4HUEA 1D9DA 2DFHA 3WNHA 3I8DA 2PZSA 3IG1A 2HHUA 4FJ5A 5JS1A 3I0SA 4W5RA 2IS3A 3DI6A 4CHNA 4DQQA 3SUNA
chains in the Genus database with same CATH superfamily
5MLCQ 4AM7A 3R8EA 4K43A 4PKHA 4QS7A 1BIZA 2HMIA 2GELA 2GWJA 3WUHA 1R0AA 2F7TA 3OYEA 3IUCA 2W41A 3O9SA 3WNGA 3NGIA 3RMBA 4DTOA 1HPZA 1B92A 4G1QA 4FWPA 3U8XA 3AO5A 3ZETB 4B8AB 3M1FA 1VQNN 3ZSRA 1XMQK 4DR4K 3VF2A 2X74A 2YKMA 4NYNA 2HHTA 2G8FA 2BH1A 4CJEA 3BZKA 3VERA 1NJWA 4CHOA 3SPYA 2J4RA 2PAVA 4JK9A 4PA1A 3QEIA 5J2QA 3QNNA 4GMJB 3M8QA 1VQ9N 1N32K 4BRQA 1J53A 2E20A 3ENHA 4B9LA 3CD6N 5CZ2A 2NRRA 4DB3A 1VQ6N 4BRNA 1HNWK 1C0MA 1HMVA 1SL0A 3DOKA 4M3RA 4BG8A 1NKEA 2ZJRL 1GOCA 4CEFA 2WOMA 1OH6A 2CGKA 1WSEA 2JWKA 3VGMA 4B9SA 5AR0A 3DMJA 3K58A 1QHAA 4BY9C 3O9QA 5AQVA 4BE2A 4BRIA 5AQZA 3R6MA 4E0DA 3MEGA 5AQIA 3QIOA 3AA2A 3PX6A 3C0BA 3THYA 2AP1A 1EWQA 1Z05A 3F9MA 2HMPA 3ZSZA 4CI6A 4FM1A 2RHKA 4BDZA 4JHDB 3GE1A 3EN9A 1HNVA 1MWMA 4DF4A 2QWOA 1RT5A 3DOLA 4PUOA 1TYQA 3AVBA 3AVGA 4B9UA 4PL7A 3P31A 3VQ5A 5GAHP 2NZTA 3KLFA 2X6NA 3NDKA 1IKXA 4DFJA 3AGKA 2D4WA 3TSPA 1M1KO 3CM5A 4OPAA 4JKDA 4CZFA 5J2MA 3AY9A 4CJUA 3AAQA 3JSMA 1LCUA 4JI1K 1VQPN 3BUZB 2AA4A 5KRTA 3U9ZA 4NLCA 4CHYA 3H45C 2NNWA 3RSEA 3U3GA 2Y1IA 1VQKN 2QKKA 3RVCA 3TABA 1X9SA 3CETA 3CQ8A 4DU3A 3BDPA 4KPYA 4DG1A 3QNOA 4YHHK 5FPMA 4JKEA 3TSUA 2WTUA 3C6TA 3O3GA 2NRVA 2O4GA 3R1XA 4CEEA 1EXQA 5I9EB 1P90A 1VSJA 1MU2A 2FBTA 2P9KB 2KLAA 3VTIA 3AVJA 3K57A 3VQPA 4NO7A 4WQ4A 3THXA 1YJWN 3BF3A 3FZKA 4OX9K 1WNSA 1VQ8N 4IFYA 3DWLA 2NRTA 3VA0A 3QMLA 2E6LA 3H1VX 3AA4A 4L3QA 4DFPA 2GX9A 1QQCA 2ZM6K 1S9EA 3EZ5A 3SJHA 1IV0A 3D2EB 3C7NB 1RT2A 3L4IA 3IAYA 3C65A 4DSFA 3DLHA 1Q82O 4BGAA 1WN7A 3SMSA 4OO1J 3A5NC 3O3FA 1QTMA 3CCEN 3TI0A 2FBYA 4LF8K 4FWLA 2P9LB 3CJCA 3AO2A 4GV3A 1KVCA 3FZMA 2ETJA 3THXB 2IGIA 2YHXA 3G71N 4FJMA 3RR8A 2VQFK 4KHQA 1JLEA 4CZIA 3J7AP 5JLFA 1N33K 4Q5VA 4M3UA 4M41A 3QICA 4DTMA 1RT3A 1NGAA 2Z1GA 4E3SA 1A5XA 1ZBSA 1EWRA 4DQ8A 4PKGA 4DV6K 4B9MA 5IT9O 3RR7A 4IEEA 2P9LA 3KJVA 4Y0WA 3DLLL 2NRXA 2DTUA 4NYFA 2ZD1A 1P8ZA 3VOVA 3L0QA 4BR4A 2QA4N 3CF5L 2O8CB 3A2FA 4DSLA 3F73A 3DXMA 4ID5A 3N4QA 4CCHA 4WQ5A 2OTLN 1ZXOA 3OYDA 4B3SK 3H08A 3DLBA 2WBNA 5C10A 1HPMA 3HVRA 3CCMN 3HI0A 1SKWA 3DYAA 5GIPA 3I0RA 3HT3A 3VPZA 3AVIA 3HVTA 1VK0A 4IOCL 3LDNA 5KPRA 2F9TA 1U47A 2O8DB 4B1UB 5I42A 3NH0A 1YITN 2W40A 3ID8A 1BI4B 4CGFA 3MXIA 3PIOL 4DKWA 1C0TA 1Z25A 3OTOK 1TKDA 3OYHA 5H1SQ 3ZT4A 1KLNA 2XY7A 3HK2A 3DLRA 3B6OA 5M1NA 1W9HA 3LAMA 4K8XA 3OBYA 1T3VA 1NM1A 2P1JA 1NJXA 2DFEA 3WNEA 4CBUA 3L2UA 5BREA 1KFDA 3P1GA 3HRGA 3SYZA 4FVMA 2HHQA 4A2AA 1CZ9A 3FFIA 3V6DA 2VG6A 2W6KA 4XEIA 4N76A 4OLBA 2X6SA 3O8MA 5C15A 5CY4A 2IVOA 4DTXA 3HP9A 4CZLA 3OBWA 3DM2A 3K5LA 3C6AA 1RBVA 3GDQA 3QESA 4OGEA 1KAXA 3SLCA 1O13A 4JS4A 2E5LK 4JKCA 4FJIA 3DXKB 1JLBA 4WQ4C 3UKUA 3U6FA 1WUAA 3VQCA 3O3HA 3CC4N 3U3YA 3KTQA 2D0CA 4CF9A 1Q7YO 3CIPA 1LW0A 4Z4CA 1JXEA 4RG8A 1IKWA 2Q36A 3F9KA 1U2VA 4B9QA 4FWRA 3VESA 3ENBA 5HLFA 4CIGA 4KRFA 4C8LA 4FJ9A 3E9PA 3MMVA 4DV1K 1RT7A 3WXMB 4IG0A 1SS6A 1TV6A 3PX0A 4HWIA 5KTQA 3LP2A 2NRZA 3EE9A 1GLCG 1D5AA 3NAEA 3WQTA 3DLGA 1A5VA 1QS4A 2A41A 3L6QA 3VEYA 4IDKA 1QE1A 4QCLA 1JLCA 1UOCA 3I8BA 4H5TA 2YNIA 3LDOA 2Y1JA 2VG5A 3ISNC 2NUBA 3F2KA 2D0BA 2GWKA 3BP8A 4FK4A 2DY4A 4N47A 1S1XA 3M8SA 2XRIA 5AQOA 5AQYA 4E7LA 5BN8A 1FJGK 3ZEUB 4F9OA 1C1BA 1QZ5A 3DLEA 3KLIA 3JXUA 5AQUA 3ZSOA 2F9WA 2IVPA 3NF6A 3KKRA 2UXDK 4FM0A 4H5RA 4HCBA 3UIQA 4EAHD 1QVFM 4KH4A 4LF9K 3M3ZA 2HHHK 5J2PA 5GAGP 3QETA 4KH5A 1CLQA 2P9SA 4EZ6A 1RFQA 5HBMA 1WBBA 4H03B 4M3YA 1BQNA 1W2BM 5KQDA 2PZSA 4DV4K 2IS3A 3DI6A 4CHNA 4DQQA 3I33A 3FZLA 3E9LA 1RDAA 5FROA 3O1WA 4DTRA 3VQ7A 4HTLA 5TKWA 4JYAK 1WOQA 4I6MA 4M63C 3M8RA 2A1SA 2D1KA 4K41A 4M45A 5KGXA 1NGDA 3CFOA 3H3OB 4EP5A 3L8BA 4Z4GA 3OYKA 1MDUB 5TKYA 3OYLA 3ZX2A 2HNZA 4N56A 4H5VA 3K9KA 4KB0A 4X66K 4DV3K 2O8EA 4XH1A 1K8KB 1NJIO 4E7KA 2CGJA 2YHWA 2E2NA 2BTFA 4K25A 1OH8A 2HHWA 2HVIA 3R9PA 1YJNN 3C95A 3T69A 2JGUA 4CFAA 4CJSA 1VRTA 1SQKA 1RTDA 3CQXA 3SZ2A 3THWA 4A62A 5HRRA 3OHRA 1YXQA 3VETA 3QEWA 3OYAA 4B1YB 1LAWA 3OYNA 1NGFA 1TKTA 2GUPA 1J5OA 2B6AA 4DR2K 3ZETA 1L3VA 1KRPA 1S6PA 2ASPA 4RW6A 4KI4A 2OTJN 4I2PA 5E41A 3K0SA 3VGLA 2P9UA 4OGCA 3FZHA 4O55A 5LMUK 3IFRA 3A5MC 5BPNA 1TK5A 1UAXA 2HOEA 3NCIA 3DRSA 4JLHA 1XHZA 3OJUA 3THWB 4PQUA 3O9RA 1RNHA 3LDLA 1EETA 4LF6K 1GLJO 5FPNA 2ZF5O 3J80O 2HSTA 4E7JA 4JKGA 4CEQA 3MAQA 2HNDA 1IO2A 1RT4A 1HQEA 5CYMA 1XWLA 2GUIA 1BU6O 3SV4A 3SQ1A 4QS8A 4EP4A 2EWSA 5E26A 1J5EK 5BRDA 4JI7K 1RTIA 1HYSA 1NOYA 2ATQA 1NU0A 3AGRA 4IOAL 3P38A 3EKSA 1U49A 4EHTA 1SZ2A 4FZXC 1TUUA 1IG8A 3SI6A 2OZMA 3MN6A 1QSLA 2O8FA 1BA0A 2NLXA 4AHSA 1OKJA 3VQ9A 4CFBA 3TWHA 4FYDA 4Z4FA 4KTWA 4B3MK 3CCSN 4FLYA 1RTHA 4O4GA 3G25A 3CCLN 4AQYK 5I3UA 1K6YA 3SUPA 4BVOA 4E89A 3PV8A 5LMNK 2HHXA 4GV6A 1I39A 4CGJA 4Z4EA 3NH2A 1NKBA 4M3WA 4DV2K 3BEXA 1S72N 2O4IA 1TYQB 2UU9K 1HRHA 1SKRA 4CEOA 5JICA 5LL6Z 5HRNA 2O8FB 3DRRA 1FKOA 1M90O 4FJHA 3AVFA 1C0UA 3V1OA 1IG9A 5HRSA 4BACA 2Q0RA 1T03A 1NLVA 1OH5A 1T8EA 4CEDA 1HNZK 3GOIA 2QWMA 1BGXT 4KHYA 4N5SA 1LWCA 1JLFA 3A5OC 4BC4A 5KI6A 1KSPA 1S1TA 5ADXA 4CJTA 3LZJA 3IS9A 4ISGA 1TK0A 1YT3A 2HB5A 4J2EA 1UWBA 3PY8A 3MN9A 1CXQA 1DT9A 3OYMA 4C23A 3IRXA 3T1HK 3KLHA 4JKAA 3VN5A 4LSLA 5AJ3K 2HVHA 2YJEA 2P51A 3LM2A 1GLEG 2YI1A 2VWJA 4BRFA 3CYMA 3DAWA 4F8RA 3QBXA 3O08A 5M1OA 4YOUA 4AHCA 4GVMA 4QS9A 3JYTA 4Z0UA 1WAFA 1HJRA 2DFFA 1TGOA 4NCBA 4YOXA 3KWIA 3SAGA 2E88A 3TPQA 1VHXA 5EOYA 1K9MO 3L2QA 4RW8A 1DTTA 1RBTA 5JVHL 4NXNK 2ZJPL 5J1EA 4JI4K 3ZT1A 2F8TA 1F21A 2EHGA 4DV7K 1S6QA 2OYQA 3MK6A 1E3MA 5J2NA 4DTNA 1ITGA 2D0OA 4DQSA 4DS5A 5DM6L 3RSEB 2BE2A 1XQSC 4M42A 4F3TA 5C2FA 2V51B 1XC9A 2YHYA 4G9ZA 3G0ZA 1X1PA 2OPSA 4FWQA 4CZKA 2I7PA 3VA3A 4FWNA 1IKVA 4H0TB 1Z26A 3A5LC 1EO1A 1C6VA 3SQ4A 4DQRA 4BQLA 1NGHA 5M1PA 4BC3A 1JCFA 4BGBA 2CH5A 3FLCO 3QEVA 2IAJA 3CPWM 3WNFA 3RTVA 2YKNA 3VMFB 1S22A 3ITHA 1NOZA 1XUPO 3TSQA 1S9GA 3OS0A 4FWOA 1N5YA 2E8AA 2V7ZA 4F2RA 1T6CA 4HCCA 1FXXA 4BRMA 1SAZA 3S3OA 4BR7A 2HF3A 1NK0A 4FJKA 3ZSYA 1HUXA 3PUFA 2QWRA 3J7ZO 4A61A 3ULEA 3TANA 3OS1A 3UE5A 4B9NA 5AFUA 1VSFA 2WFBA 4J8FA 4DV0K 2A6AA 2ZGZA 1OVQA 5KGWA 3SUQA 3THVA 1R59O 4A5AA 3RMAA 5AZIB 4PY5A 3VEZA 1RT6A 3KKSA 1GLDG 1YI2N 4YOYA 1UA1A 5F2RA 2FSJA 4CIFA 4R5PA 4CGGA 4JS5A 2FBXA 5F0XA 3H6EA 4DTPA 2E4LA 2Q1NA 4WQ5C 4LFAK 1BDGA 4IKFA 3ULEB 4OPJA 1S1VA 3O9UA 3WEEB 3LDSA 5FPDA 3MXMA 4JKFA 5AQFA 4U7BA 4ID1A 4W5TA 1GLAG 1VRUA 4AHRA 3O9TA 3PO4A 3O1BA 3H3NO 5HL7L 3G6EN 2XHBA 3ZSVA 3ENOA 3HZ6A 5AQHA 3CJ1A 4KFBA 2QWQA 1NKCA 3M8PA 4ILJA 4AM6A 3CJ7A 3CPEA 1I94K 3J81O 5LJVA 1KQSM 1EKEA 3CJBA 3V9UA 1ATNA 3VTHA 4O0IA 4CECA 3IMXA 4JI0K 2V52B 3OYFA 2D0PA 3TARA 5E84A 5AQPA 1U48A 1NWKA 5ELZA 5AQWA 3W0LA 2PFUA 3K9JA 4DSIA 4IFVA 3ZSWA 4B1VA 4E1JA 3LP0A 1TVRA 2HBMA 4CHQA 1L3TA 1TL1A 4CZJA 2P9SB 4BROA 1S3XA 1HJOA 4GNIA 1GOBA 3WT0A 4CK1A 1VSDA 4ELTA 3OA9A 4BREA 1DTQA 1WB9A 1IH7A 4MFBA 4OVLA 1HR0K 2P9IA 4E19A 2D5RA 3HM8A 4ZTFA 3NFAA 5M1FA 3T3FA 1FW6A 2QI2A 4KTZA 2G8HA 3FFKB 1D9FA 2A3ZA 4DF8A 4BRDA 1BQMA 1ZBHA 1ZBLA 2P9PA 4DCHA 3KLGA 5BRHA 2HHVA 3HYFA 4ICLA 1T44A 4IDHA 4X64K 5DMRA 3HPGA 1D9DA 3GG4A 3WNHA 3MCAB 3IG1A 2HHUA 1EQYA 4WFNL 1X3MA 5T7BA 4O0JA 3AAPA 4GV9A 2CH6A 1JXBA 4EZ9A 2QWNA 1HX1A 2QW9A 1JL2A 1ASUA 3GL1A 4AHVA 4DV5K 3TTDA 5GADP 4QAGA 4FJJA 2KZMA 2XY5A 3KK1A 4KH6A 4M7XA 4CERA 4YOTA 4YOVA 3CMAN 4KHWA 4FJNA 4ELUA 2UUBK 2RPIA 5F1XA 4CZHA 3NF9A 1YF5L 3TAPA 2FSNA 3PIPL 3LWMA 4LH4A 3ATVA 5HROA 5HRPA 3L2WA 3CMEN 5AQTA 1RGIA 3TTFA 5SZTA 4IXCA 4LF7K 3LAKA 3CI5A 4I6MB 4BRGA 1ATSA 4DQIA 3LALA 1DGKN 2B5JA 2OZSA 3T19A 1KXPA 4DMNA 1BOTO 1JJ2M 3C94A 4BRAA 1BISA 3TAQA 1J54A 1W97L 4AH9A 4IEIA 3LDQA 1U04A 4DU1A 1HLUA 1NGBA 2VQEK 3CCUN 4IO9L 1TK8A 2HBKA 4CZEA 1HKGA 2OPRA 4KB1A 4JD2B 3AVHA 2PYJA 4KTQA 4KV8A 1S1UA 1N8RO 1B9DA 2QWPA 4CW7B 4K42A 3NE6A 3HSCA 1L3SA 2CGLA 1Q81O 3EEQA 4WE1A 4QOZB 3P83D 3EKUA 1YVNA 5HP1A 1K73O 3ZT0A 4CD3A 3HJFA 4CJVA 4U67L 1Y64A 4DLEA 2IOCA 4KHUA 3LDPA 3O6WA 5C0YA 4WYBA 1KC8O 2IC3A 3CCRN 4H0VB 3KIOA 3LP3A 3KK3A 4Y1CA 4CESA 3JAMO 3ALYA 4BRLA 2G8KA 4JKBA 4UQGA 4XIUA 5EU7A 4DHYA 3NBPA 4OKKA 1K8KA 2NRWA 4Q0BA 4FPBA 4DR3K 2A40A 3BZCA 4H4MA 3PO5A 4DQPA 2YNFA 5AQSA 3VEOA 2WC9A 1JLAA 3KVGA 1IBKK 1H1VA 3AVNA 1C0GA 4DFKA 3WXKA 2ZE2A 4E7HA 5KRSA 4BG9A 1JLGA 3FGUA 4J2BA 3EZWA 3OS2A 4CJLA 4FLUA 1VSIA 1I3AA 1IBMK 4JRQA 4C8NA 3S3MA 3C7NA 4JK7A 5C25A 2YJFA 1VQON 2KQ2A 1NJYA 1VSKA 4YDUC 1RBSA 4IJNA 2P9UB 3MEEA 4IBNA 3OYCA 5CHIA 4F3OA 2H3GX 3ZX0A 5AQNA 4HUFA 3THYB 3OVNA 1WSIA 5M1QA 5CZ1A 4CJKA 3A0IX 4OLAA 2I7NA 4JK8A 3O4WA 3DRPA 3UKRB 2X78A 3MN7A 1O1WA 3OW2M 3W3DA 1RCHA 3CFPA 3P5JA 3MXJA 4FLXA 2PYLA 5C24A 4H0OA 3S3NA 2E2OA 5C12A 2QXFA 4CF2A 1WSHA 1EX4A 1K8AO 2VYPA 2KHOA 4L8RB 2YHBA 3VQ8A 3L2RA 4O44A 2WUSA 4LY7A 2LSNA 1A5WA 4CJQA 3K5MA 3CCQN 1YAGA 1RBUA 1ZBFA 1YTUA 2IVNA 4MDBA 1NK7A 3FE1A 3WXIA 2PBDA 4CF0A 1ESVA 5LJWA 5CYQA 4FW2A 4X65K 4H0YB 2FF6A 4KO0A 1VSLA 3A8YA 3KLEA 3V9SA 1E4FT 1V4TA 3AA5X 1KLMA 3AA3A 4GKJK 5EVZA 1T05A 4IG3A 2HW3A 3L3UA 5K14A 1NG9A 3K5NA 4CGDA 1XC3A 2O8DA 4CHPA 2RE2A 4JV5K 3AV9A 5C2DA 3EY1A 4DFMA 3OYBA 3D2FA 3T1YK 3HOSA 3NVMA 3LZIA 4NXMK 4HUGA 4MQ3A 1N34K 2B4JA 1HKCA 4PL8A 4GW6A 4HVJA 3HPHA 1TUYA 2QM1A 3O4NA 3V1RA 4MO4A 1YIJN 1X3NA 2GTDA 2G8IA 1HNXK 2P9KA 3VEVA 4LFBK 2XY6A 4CJ5A 1NMDA 3H1QA 4CFCA 2F4VK 4H0XB 4IO8A 1U45A 3G4SN 4NCAA 2ITGA 3OY9A 4FSVA 4FLZA 4JI5K 4RW7A 3SBGA 4FLWA 1TKZA 3NHGA 3MWTA 3VQ4A 1VAZA 3NF7A 2VGNA 4KHNA 3UKRA 3KK7A 4DWIA 2DPNA 4FJ8A 3D45A 4CJ7A 1XMOK 4BWJA 3KZBA 3CERA 3CJAA 3AO1A 4LF5K 4BR9A 1FKPA 4BWMA 5BPMA 5KQ8A 4CHZA 3J8AA 4ZHRA 5IWAK 3TAGA 4ILHA 5DK5A 2JLEA 4ILGB 4B9VA 1X9WA 3ZSXA 3SV3A 4W5NA 4ELVA 4CEBA 1VQ4N 3EE8A 1QHTA 3LPUA 3OYGA 3V9WA 1TAQA 4Y1DA 4TSXA 4FM2A 1LW2A 4M3TA 3QEPA 3VEXA 1JKHA 1RDDA 5CR4A 1YHQN 1HYVA 1MA9B 3QB0A 4I7FA 2KTQA 1HNIA 4CJRA 3TTCA 4BC2A 1GOAA 1EP4A 4UY8O 4IJAA 1RTJA 2QWLA 3RRHA 4O5BA 3ZYYX 4NB4A 4RWTA 4B9TA 2FSKA 3ULDA 1WSGA 1NGIA 1KD1O 3ZT3A 1N36K 1LV5A 1D4XA 2FLOA 3DLKA 3QFPA 2QK9A 3NMUA 4YDUA 3IKMA 3BF1A 2Q31A 3V9XA 2IIRA 2YNHA 1J6ZA 3OYIA 4H0PA 1ASWA 2ASOA 5C42A 4FLVA 4JI3K 4CJFA 3D7EO 1KTQA 3RWUA 2XY8A 3CC7N 2VWKA 3MECA 3QBWA 4E1MA 3L3VA 5GAEP 3TAMA 3CC2N 3EL2A 3I56N 2HNYA 2A5XA 3K2PA 3S9HA 3V9ZA 1X9MA 1XHXA 3T1AA 4J2AA 2P9NB 4XH4A 2RF2A 4CK3A 3S41A 4CE9A 1BL3A 1HYZA 3QIPA 1WLJA 4K8ZA 3O4QA 1SUQA 1ZBUA 3B6PA 3MCPA 2KKZA 3V4IA 3ATUA 3U9DA 3ZSQA 1QZ6A 5FPEA 4BE1A 3NF8A 3VQEA 1QSYA 1T6DA 1SV5A 3M6GA 5CE3A 1YJ9N 2UUCK 4FW1A 4JEPA 4A59A 1XNQK 3JS6A 1VSEA 3U4LA 4AILC 4WFBL 3RRGA 4JAXA 4M7YA 1KAZA 3ZX3A 4WFAL 4GKKK 4JKGB 1ATRA 4KREA 1NNEA 2F96A 4H4OA 4M3XA 3VQ6A 4CIEA 1KCFA 2QKBA 1BWFO 2O8EB 4HUEA 1WAJA 3KHYA 3PSIA 4FOEA 2DFHA 3I8DA 3H46O 4FWMA 2UXBK 3C6HA 4MLEA 4FJ5A 5JS1A 3SUNA 3CG7A 4J2DA 3QERA 1J9AA 2RN2A 4BRCA 4Z4IA 4DLGA 3AVMA 4FK2A 1KVAA 3LPTA 2UUAK 4BR0A 3RMDA 4DUZK 1TL3A 2G8UA 1G15A 1BCMA 2P9PB 3HXMA 5DM7L 3SBTA 2BUPA 4KKOA 4BDYA 4OPKA 1BO5O 3TU5A 4BQZA 1GLBG 1W0HA 4FJGA 1JL1A 3E66A 1KFSA 1VQLN 5AQXA 4JKHA 3VQQA 2E2PA 1SKSA 1RT1A 4KBOA 4CEZA 5GINA 4OPHA 2KZZA 3K5OA 3NGYA 3SAHA 2E6MA 4IWVA 4FZZA 4YORA 2BGGA 2UYTA 3WXLA 4CK2A 1Q8IA 1VQMN 1E4GT 4BRKA 3VGKA 4K0KK 4DU4A 2A42A 2FXUA 1VSHA 4B8CA 3OYJA 4ISFA 2IDOA 3KD1E 5B8HA 2Q0UA 4JI8K 1LAVA 1ILYA 4CGIA 1WSFA 4AHTA 3SQ2A 2YNGA 3SQ0A 2QXLA 2Q2RA 1C1AA 4ZTJA 4DSJA 2ASMA 5BRFA 5AQKA 2G8VA 2I5JA 5JLHA 4BC5A 5LY3A 3CM6A 4YY3K 1L3UA 4RW4A 4F4KA 2HHSA 2KFNA 1BA1A 1QQMA 4KHSA 5SWMA 3B8AX 5M1KA 3NH1A 4CVNE 1IKYA 3VF4A 2V7YA 3HP6A 2VWBA 5AZJB 3SJJA 3CQYA 1C1CA 4CGHA 4JN4A 3CHWA 4BR2A 4F2SA 3LANA 4C8MA 2GBZA 2ZJQL 4V19S 1S1WA 3R3LA 4RCHA 4AHUA 5BR8K 3SAFA 3LWLA 3MX2A 4BE0A 1TAUA 3VENA 2D0AA 3ZLJA 4C1NI 2YX6A 4CF8A 3CXCM 4E7IA 3SUOA 4BR5A 3LL3A 4PWDA 4JRPA 4FCYA 3SCXA 2PY5A 2E1YA 3MEDA 3I55N 3NVKA 1BG3A 3AVLA 4CD1A 1Q9XA 1HQUA 3VEWA 4ISEA 4LF4K 3SK3A 1QQNA 3V1QA 5FRMA 1YUWA 3D2FB 1DKGD 4KAZA 4FJLA 3LP1A 4MLHA 1L5UA 1VSMA 1ASVA 4CJ4A 3O5BA 4RW9A 3SPZA 3AO3A 3MN5A 3ZCMA 3CCVN 1NK8A 4KI6A 2Z1HA 2HF4A 4CEAA 5GIOA 4B3RK 1QVGM 1IBLK 4CBWA 2AJQA 1NK5A 4DR6K 3HSTB 2FF3B 5AQRA 4OKJA 3D0PA 2G8WA 3MDQA 4A2BA 4E1NA 3DJCA 4W5QA 5BR9A 2A1RA 2W6LA 4LSNA 1ZYQA 1JCGA 4DTJA 5KPTA 1TKXA 4I2QA 1WBDA 3IDHA 3AVCA 1BCOA 3C6UA 3KD5E 4A5BA 2GV9A 4EFHA 5AZJA 1W7AA 2Z1JA 4FO0A 3E01A 4CBXA 4CZMA 3FZFA 1D8YA 3FR0A 4FVUA 1RDUA 2OA8A 4C8KA 1N6QA 1BIUA 3J7YP 1RDCA 4OKEA 5AQJA 1XI1A 1REVA 1KVBA 3N4PA 4XH5A 2P5OA 4R79A 2YCHA 3D2EA 4BVPA 4H5WA 1S5JA 2NRHA 1Y97A 3AO4A 4EHUA 3AVKA 5D3GA 4N41A 4FK0A 3L4QA 4HHTA 5EXWA 2R7YA 5BN9A 1T7PA 3UB5A 3T7ZA 4M3ZA 3PLAA 1GLFO 3TAEA 2O8BA 1DEJA 3WXJA 4DS4A 3BGRA 2Z1IA 3EYZA 4FJ7A 1FK9A 3VQAA 3ZT2A 4AF1A 4DSEA 1NMNA 5JVGL 4FXDA 4RTFD 2UXCK 4NCGA 4DUYK 1RILA 1U2VB 3QFUA 4IFEA 2VGMA 2Q97A 4YFUA 4O8KA 1QQOA 3L2VA 3M5RA 3TR8A 4MDAA 2ITMA 3V81A 1OVYA 1RBRA 2VG7A 1Q86O 4Z4HA 2P5GA 2QEXN 5AQGA 1QSSA 4H5NA 2O8BB 4IOXA 4FLTA 1NK6A 4WF9L 4O5FA 4OJRA 1YTAA 4CZGA 4LH5A 2RKIA 3CCJN 4BRHA 4A57A 1XNRK 3Q7CA 3MWPA 4Z94A 2BDPA 1OH7A 3RMCA 2KFZA 1V4SA 2E1ZA 1ZC6A 4YNQA 3SNNA 4LD0A 1NGJA 4MO5A 1JCEA 2YHAA 3K59A 1BUPA 2E2QA 3AVAA 3G10A 1NJZA 5JMVA 3VQDA 5HOOA 4PKIA 4FWSA 5EY4A 1GLLO 4FOIA 3PX4A 3E1YA 1LWFA 4FPAA 3QLHA 2P9IB 4BRPA 4JNEA 3SMPA 4C8OA 1NGGA 2Q3SA 3GBTA 1IJJA 2EX3A 3HPOA 1UA0A 4DR5K 3BY5A 4GVEA 4X62K 2OANA 2WONA 1CZAN 2W42A 1HKBA 3QEXA 5BPLA 1G99A 4NLBA 2FC0A 4WCEL 5FDLA 1B9FA 4CJPA 4JI2K 1SL1A 4B08A 3WQUA 3NGZA 1U4BA 3MX5A 3CJ9A 1RDWX 1VQ7N 1X9JA 2HBLA 4FJXA 2OPQA 3D6RA 2XO7A 3E9OA 2O8CA 4B3TK 5AQMA 1YVUA 1NGCA 3QO9A 1RDBA 1BHLA 5JS2A 3DXMB 2JWLA 2ZQBA 5AFUH 2OCEA 1NGEA 4H8KA 4CFDA 3HL8A 3PSFA 4CJ3A 2F8SA 4EIAA 4I9LA 2YV0X 1NK9A 1Q18A 2ZWHA 3P39A 5A2QO 1C0FA 4B3OA 3WEEA 1JLQA 4FWKA 2OPPA 5AQQA 5EX5A 3ZEUA 3TAFA 4DTUA 3CFRA 2FBVA 3EO3A 3UKUB 4O8UA 1MWKA 4DSKA 5KPZA 1BI4A 4CF1A 4C1NK 4B1XB 4YOWA 4BDPA 1LWEA 1WSJA 3HTVA 3F5TA 2VCPA 4B1WB 1ZBIA 3ID6A 5ADXH 3QINA 3HM9A 5FRNA 1DLOA 3HBTA 1Q9YA 4DTSA 1CXUA 2BANA 4FL9A 3OJSA 4DR7K 4CJWA 4FZYA 2KW4A 2GEMA 4B1ZA 3AARA 4DR1K 3Q7BA 3P4IA 1Z6RA 2QTDA 1NBWA 4GY2B 4W5OA 3HO1A 5AQLA 3O80A 1LOTB 5AZIA 3ASMA 4JD2A 2P9NA 4IZ9A 4HTUA 1SL2A 3QDKA 3VF6A 1NK4A 1VQ5N 3KK2A 1KAYA 4LFCK 1CZBA 2HBJA 3VQBA 4JHDA 3LM9A 4JI6K 4I9QA 5FLXO 3KWGA 1U6ZA 4LC9B 4KHPK 2ZGYA 3I0SA 4W5RA 3DXKA 3HOTA 4PHTX
chains in the Genus database with same CATH topology
1RDAA 5T7BA 4O0JA 5FROA 3CG7A 4DTRA 3QERA 3VQ7A 4J2DA 1JXBA 1J9AA 2RN2A 1BIZA 4EZ9A 2HMIA 1JL2A 4Z4IA 1ASUA 4DLGA 4AHVA 3AVMA 3M8RA 4FK2A 1R0AA 1KVAA 3LPTA 2A1SA 3OYEA 3WNGA 3NGIA 3RMBA 4DTOA 1HPZA 4QAGA 4M45A 1B92A 5KGXA 3RMDA 4G1QA 2XY5A 3CFOA 4FJJA 2KZMA 3KK1A 1TL3A 4EP5A 3L8BA 4Z4GA 3OYKA 2G8UA 1G15A 4CERA 4KHWA 3OYLA 1BCMA 4FJNA 3AO5A 3HXMA 4ELUA 4B8AB 2RPIA 2HNZA 3ZSRA 4KKOA 4N56A 4BDYA 4OPKA 3NF9A 2X74A 2YKMA 4NYNA 3TAPA 3LWMA 4KB0A 4LH4A 1W0HA 5HROA 2HHTA 5HRPA 4FJGA 1JL1A 2G8FA 1KFSA 3L2WA 4E7KA 4CJEA 3VQQA 1SKSA 5SZTA 1NJWA 4CHOA 2HHWA 2HVIA 1RT1A 3SPYA 3C95A 3LAKA 2JGUA 4CFAA 4CJSA 1VRTA 1RTDA 4PA1A 3SZ2A 3QEIA 4CEZA 5J2QA 2KZZA 3K5OA 5HRRA 4DTSA 3LALA 3QNNA 4DQIA 2B5JA 4GMJB 3NGYA 3M8QA 2E6MA 3OYAA 3QEWA 2OZSA 4FZZA 2BGGA 1LAWA 3T19A 4CK2A 1Q8IA 3OYNA 4DMNA 1J53A 3C94A 1TKTA 4B9LA 1J5OA 1BISA 5CZ2A 2B6AA 1L3VA 4DU4A 3TAQA 1VSHA 1J54A 1KRPA 1C0MA 1S6PA 4RW6A 4AH9A 4B8CA 3OYJA 4KI4A 2IDOA 4I2PA 5E41A 3KD1E 1HMVA 1SL0A 1U04A 3DOKA 4M3RA 4DU1A 1NKEA 1LAVA 1GOCA 4OGCA 4CGIA 4O55A 4CEFA 2WOMA 1WSEA 1WSFA 4AHTA 3SQ2A 2YNGA 3SQ0A 1TK5A 1TK8A 4B9SA 3DMJA 3K58A 1UAXA 1C1AA 4ZTJA 4BE2A 3NCIA 3DRSA 4JLHA 4DSJA 1XHZA 3OJUA 4PQUA 2OPRA 2G8VA 2I5JA 3MEGA 4E0DA 3QIOA 3AA2A 3AVHA 3PX6A 4KB1A 1RNHA 1EETA 2PYJA 4KTQA 3CM6A 1L3UA 4KV8A 4RW4A 4F4KA 2HHSA 2KFNA 4KHSA 5SWMA 1S1UA 3ZSZA 4E7JA 4CEQA 4FM1A 3MAQA 1B9DA 3NH1A 2HNDA 1IO2A 1RT4A 1HQEA 5CYMA 1XWLA 2GUIA 4BDZA 4FJLA 3SV4A 3SQ1A 3NE6A 1HNVA 4EP4A 1L3SA 1IKYA 1Q9YA 4DF4A 4QOZB 4WE1A 3HP6A 3P83D 1RTIA 1HYSA 1NOYA 5HP1A 2ATQA 3ZT0A 3SJJA 3HJFA 1RT5A 4CJVA 3DOLA 1U49A 1C1CA 4DLEA 2IOCA 4PUOA 4KHUA 4CGHA 3AVBA 3AVGA 4B9UA 4FZXC 4FK4A 2IC3A 3SI6A 2OZMA 3KIOA 3VQ5A 3LP3A 3KK3A 4F2SA 3LANA 1QSLA 4C8MA 4Y1CA 2X6NA 2GBZA 4AHSA 1IKXA 4CESA 3KLFA 3NDKA 4DFJA 1S1WA 3VQ9A 4CFBA 3CM5A 3TWHA 3ALYA 4AHUA 3LWLA 5J2MA 4FYDA 4BE0A 2G8KA 4Z4FA 1TAUA 4KTWA 4UQGA 4XIUA 2D0AA 1RTHA 4CJUA 4FLYA 3JSMA 4O4GA 5EU7A 4CF8A 5I3UA 1K6YA 3NBPA 3SUPA 4OKKA 4E7IA 3SUOA 4Q0BA 5KRTA 4E89A 3PV8A 4PWDA 2HHXA 4JRPA 1I39A 4CGJA 4FCYA 3SCXA 4Z4EA 4CHYA 4H4MA 3NH2A 1NKBA 2PY5A 4M3WA 3MEDA 3PO5A 2QKKA 3U3GA 2YNFA 2Y1IA 4DQPA 3AVLA 2O4IA 1Q9XA 3TABA 1X9SA 1JLAA 1HQUA 1HRHA 3CQ8A 3AVNA 1SKRA 4CEOA 4DU3A 5HRNA 3V1QA 4DFKA 3BDPA 4KPYA 2ZE2A 3DRRA 4E7HA 4DG1A 5KRSA 3QNOA 1JLGA 5FRMA 1FKOA 4J2BA 3OS2A 4CJLA 4FLUA 4FJHA 1VSIA 1I3AA 1C0UA 3AVFA 3LP1A 4JRQA 3V1OA 4C8NA 1L5UA 1VSMA 1IG9A 5HRSA 4BACA 3S3MA 3C6TA 5C25A 3O3GA 1ASVA 4CJ4A 1T03A 2O4GA 4RW9A 4CEEA 1EXQA 3SPZA 2KQ2A 3AO3A 1NJYA 1VSKA 3ZCMA 4CEDA 1RBSA 1NK8A 1T8EA 4KI6A 1VSJA 1MU2A 2FBTA 2Z1HA 3MEEA 4IBNA 1BGXT 4KHYA 4N5SA 3AVJA 3OYCA 3K57A 4F3OA 1LWCA 1JLFA 4CEAA 3VQPA 5KI6A 1KSPA 1S1TA 4CJTA 3LZJA 3IS9A 4HUFA 1NK5A 2AJQA 1TK0A 3HSTB 1WNSA 4IFYA 4OKJA 3VA0A 1YT3A 3D0PA 2HB5A 3OVNA 4J2EA 1UWBA 1WSIA 3PY8A 2E6LA 1CXQA 2G8WA 5CZ1A 3AA4A 4DFPA 3OYMA 1QQCA 3IRXA 4CJKA 4OLAA 4E1NA 3KLHA 4W5QA 3DRPA 1S9EA 3VN5A 4LSLA 2A1RA 3EZ5A 4LSNA 2HVHA 1ZYQA 2X78A 1RT2A 1O1WA 2P51A 3IAYA 4DTJA 4DSFA 1RCHA 1TKXA 2VWJA 4I2QA 3P5JA 3CFPA 3DLHA 3MXJA 3AVCA 4FLXA 1BCOA 1WN7A 2PYLA 3CYMA 5C24A 3C6UA 3S3NA 3KD5E 3O3FA 1QTMA 3TI0A 4F8RA 2GV9A 2FBYA 2QXFA 4CF2A 1WSHA 1EX4A 2Z1JA 4AHCA 3E01A 3AO2A 1D8YA 4L8RB 2YHBA 1KVCA 4GVMA 3VQ8A 2ETJA 4O44A 3L2RA 4Z0UA 3JYTA 1WAFA 1HJRA 4LY7A 2LSNA 2DFFA 1A5WA 1TGOA 2IGIA 4CJQA 3K5MA 2OA8A 4NCBA 4C8KA 1N6QA 1BIUA 4FJMA 1RBUA 3RR8A 1RDCA 4OKEA 1ZBFA 1YTUA 1NK7A 3L2QA 1XI1A 4KHQA 1REVA 1JLEA 1KVBA 1DTTA 1RBTA 4RW8A 4CF0A 2P5OA 5CYQA 4FW2A 4Q5VA 4M3UA 4KO0A 1S5JA 4M41A 5J1EA 1VSLA 1Y97A 3AO4A 3KLEA 1RT3A 2Z1GA 3AVKA 3ZT1A 1A5XA 3V9SA 4E3SA 4DTMA 5D3GA 2F8TA 3AA5X 1KLMA 3AA3A 1F21A 1T05A 2EHGA 4N41A 4FK0A 1S6QA 4IG3A 4HHTA 3L3UA 2R7YA 4B9MA 3RR7A 2OYQA 5J2NA 2HW3A 5K14A 4DTNA 1ITGA 1T7PA 3K5NA 4DQSA 4DS5A 4CGDA 3KJVA 2BE2A 4CHPA 4M42A 4M3ZA 4F3TA 3TAEA 2DTUA 3AV9A 4NYFA 1XC9A 2ZD1A 4DS4A 3G0ZA 1X1PA 2OPSA 2Z1IA 3BGRA 3EYZA 4FJ7A 3EY1A 3VA3A 4DFMA 1FK9A 3VQAA 3ZT2A 3OYBA 4DSEA 4FXDA 3A2FA 1IKVA 1Z26A 4NCGA 3LZIA 4HUGA 4DSLA 4MQ3A 1C6VA 3F73A 4KAZA 2B4JA 4ID5A 1RILA 4CCHA 4GW6A 4HVJA 3SQ4A 3HPHA 3OYDA 4DQRA 4YFUA 3O4NA 3V1RA 3H08A 3DLBA 3L2VA 3TR8A 3HVRA 3V81A 1SKWA 2G8IA 3DYAA 1RBRA 2VG7A 4Z4HA 3I0RA 3QEVA 2P5GA 2IAJA 3HT3A 3AVIA 3HVTA 1VK0A 3WNFA 3RTVA 2DY4A 2YKNA 2XY6A 4CJ5A 1QSSA 1U47A 4CFCA 3ITHA 5I42A 3NH0A 4FLTA 1U45A 1NK6A 4NCAA 2ITGA 1NOZA 3OY9A 1S9GA 3OS0A 1BI4B 4CGFA 4OJRA 1YTAA 4FLZA 3MXIA 1N5YA 4RW7A 1C0TA 2RKIA 1TKZA 1Z25A 4LH5A 4FLWA 4F2RA 4HCCA 1TKDA 1FXXA 3OYHA 3NHGA 3ZT4A 1KLNA 2XY7A 3VQ4A 3S3OA 3NF7A 2BDPA 3HK2A 1NK0A 3DLRA 4FJKA 4KHNA 3B6OA 3RMCA 3ZSYA 4DWIA 1W9HA 2KFZA 3SNNA 4YNQA 4FJ8A 4LD0A 3LAMA 2YHAA 3D45A 4K8XA 3K59A 3PUFA 4BWJA 3AVAA 2P1JA 1NJXA 2DFEA 3WNEA 3AO1A 3L2UA 3G10A 1NJZA 3TANA 3VQDA 1KFDA 3P1GA 3OS1A 1FKPA 4BWMA 4CHZA 3SYZA 4B9NA 4FVMA 4ZHRA 1VSFA 3TAGA 5DK5A 2JLEA 4B9VA 5KGWA 3SUQA 3PX4A 3THVA 1X9WA 1LWFA 3ZSXA 3SV3A 2HHQA 4W5NA 3QLHA 1CZ9A 4CEBA 3FFIA 3RMAA 4ELVA 4C8OA 4PY5A 2Q3SA 3V6DA 1RT6A 3KKSA 2EX3A 3HPOA 2VG6A 1UA0A 4N76A 4OLBA 2X6SA 1UA1A 5CY4A 1QHTA 3LPUA 4CIFA 4R5PA 3OYGA 4DTXA 4CGGA 4JS5A 3V9WA 3HP9A 1TAQA 3DM2A 4TSXA 4Y1DA 2FBXA 3K5LA 2WONA 4FM2A 4DTPA 1LW2A 4M3TA 3QEPA 2W42A 1RBVA 2E4LA 1JKHA 1RDDA 3QEXA 1HYVA 2KTQA 4I7FA 1HNIA 4CJRA 4IKFA 3QESA 4OGEA 4OPJA 2FC0A 5FDLA 4JS4A 1GOAA 1S1VA 3LDSA 1B9FA 4CJPA 3MXMA 1EP4A 4FJIA 1SL1A 1JLBA 1RTJA 4B08A 3NGZA 1U4BA 3RRHA 4O5BA 4W5TA 4ID1A 3U6FA 3VQCA 3O3HA 4B9TA 4FJXA 1VRUA 3ULDA 3U3YA 3KTQA 4AHRA 1WSGA 2D0CA 3PO4A 2OPQA 4CF9A 3ZT3A 2XHBA 1LW0A 2XO7A 3ZSVA 1JXEA 4RG8A 4Z4CA 1IKWA 1LV5A 1YVUA 3QO9A 3DLKA 1RDBA 1BHLA 4KFBA 5JS2A 2QK9A 1NKCA 3M8PA 2ZQBA 3F9KA 3V9XA 4H8KA 4CFDA 2YNHA 3HL8A 5HLFA 3OYIA 4CIGA 4CJ3A 1ASWA 5C42A 4FLVA 4C8LA 4FJ9A 2F8SA 4KRFA 4I9LA 4CJFA 2YV0X 1NK9A 1EKEA 1KTQA 4B3OA 3RWUA 3V9UA 1RT7A 1JLQA 2XY8A 2OPPA 2VWKA 3MECA 4IG0A 1TV6A 3TAFA 4DTUA 4E1MA 3L3VA 4O0IA 3PX0A 5KTQA 4CECA 2FBVA 3CFRA 3LP2A 3TAMA 1D5AA 3OYFA 2HNYA 3NAEA 4DSKA 3DLGA 3TARA 1BI4A 3K2PA 1A5VA 1QS4A 4CF1A 3V9ZA 3S9HA 1U48A 1XHXA 4IDKA 1QE1A 3T1AA 1X9MA 4J2AA 4QCLA 1JLCA 1UOCA 4BDPA 1LWEA 2RF2A 4DSIA 1WSJA 4CK3A 2YNIA 4IFVA 3ZSWA 1ZBIA 2Y1JA 2VG5A 3LP0A 3QINA 3ISNC 2NUBA 3HM9A 2D0BA 4CE9A 5FRNA 1DLOA 1TVRA 1HYZA 1BL3A 1S1XA 3QIPA 1WLJA 4N47A 4CHQA 1CXUA 1TL1A 2BANA 3M8SA 1L3TA 2XRIA 3OJSA 4K8ZA 4CJWA 3O4QA 1SUQA 1ZBUA 4FZYA 2KW4A 3B6PA 4E7LA 1GOBA 3V4IA 4CK1A 3ZSQA 1VSDA 4W5OA 1C1BA 3HO1A 3DLEA 4BE1A 3KLIA 3NF8A 4ELTA 3VQEA 1QSYA 3ZSOA 1SV5A 1DTQA 3NF6A 3KKRA 1IH7A 4FW1A 4MFBA 4OVLA 4FM0A 3ASMA 4E19A 2D5RA 4HCBA 1VSEA 3NFAA 4AILC 4ZTFA 3T3FA 3RRGA 3UIQA 4KTZA 2G8HA 1D9FA 4HTUA 1SL2A 4DF8A 1NK4A 3KK2A 1BQMA 1ZBHA 1ZBLA 4KREA 5J2PA 1CZBA 2F96A 4H4OA 3KLGA 3VQBA 3QETA 4I9QA 4M3XA 2HHVA 3VQ6A 1CLQA 4CIEA 1KCFA 4EZ6A 3HYFA 4ICLA 5HBMA 2QKBA 4M3YA 5DMRA 1BQNA 3HPGA 1WAJA 4HUEA 1D9DA 2DFHA 3WNHA 3I8DA 2PZSA 3IG1A 2HHUA 4FJ5A 5JS1A 3I0SA 4W5RA 2IS3A 3DI6A 4CHNA 4DQQA 3SUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDA A;  5T7B A;  4O0J A;  5FRO A;  3CG7 A;  4DTR A;  3QER A;  3VQ7 A;  4J2D A;  1JXB A;  1J9A A;  2RN2 A;  1BIZ A;  4EZ9 A;  2HMI A;  1JL2 A;  4Z4I A;  1ASU A;  4DLG A;  4AHV A;  3AVM A;  3M8R A;  4FK2 A;  1R0A A;  1KVA A;  3LPT A;  2A1S A;  3OYE A;  3WNG A;  3NGI A;  3RMB A;  4DTO A;  1HPZ A;  4QAG A;  4M45 A;  1B92 A;  5KGX A;  3RMD A;  4G1Q A;  2XY5 A;  3CFO A;  4FJJ A;  2KZM A;  3KK1 A;  1TL3 A;  4EP5 A;  3L8B A;  4Z4G A;  3OYK A;  2G8U A;  1G15 A;  4CER A;  4KHW A;  3OYL A;  1BCM A;  4FJN A;  3AO5 A;  3HXM A;  4ELU A;  4B8A B;  2RPI A;  2HNZ A;  3ZSR A;  4KKO A;  4N56 A;  4BDY A;  4OPK A;  3NF9 A;  2X74 A;  2YKM A;  4NYN A;  3TAP A;  3LWM A;  4KB0 A;  4LH4 A;  1W0H A;  5HRO A;  2HHT A;  5HRP A;  4FJG A;  1JL1 A;  2G8F A;  1KFS A;  3L2W A;  4E7K A;  4CJE A;  3VQQ A;  1SKS A;  5SZT A;  1NJW A;  4CHO A;  2HHW A;  2HVI A;  1RT1 A;  3SPY A;  3C95 A;  3LAK A;  2JGU A;  4CFA A;  4CJS A;  1VRT A;  1RTD A;  4PA1 A;  3SZ2 A;  3QEI A;  4CEZ A;  5J2Q A;  2KZZ A;  3K5O A;  5HRR A;  4DTS A;  3LAL A;  3QNN A;  4DQI A;  2B5J A;  4GMJ B;  3NGY A;  3M8Q A;  2E6M A;  3OYA A;  3QEW A;  2OZS A;  4FZZ A;  2BGG A;  1LAW A;  3T19 A;  4CK2 A;  1Q8I A;  3OYN A;  4DMN A;  1J53 A;  3C94 A;  1TKT A;  4B9L A;  1J5O A;  1BIS A;  5CZ2 A;  2B6A A;  1L3V A;  4DU4 A;  3TAQ A;  1VSH A;  1J54 A;  1KRP A;  1C0M A;  1S6P A;  4RW6 A;  4AH9 A;  4B8C A;  3OYJ A;  4KI4 A;  2IDO A;  4I2P A;  5E41 A;  3KD1 E;  1HMV A;  1SL0 A;  1U04 A;  3DOK A;  4M3R A;  4DU1 A;  1NKE A;  1LAV A;  1GOC A;  4OGC A;  4CGI A;  4O55 A;  4CEF A;  2WOM A;  1WSE A;  1WSF A;  4AHT A;  3SQ2 A;  2YNG A;  3SQ0 A;  1TK5 A;  1TK8 A;  4B9S A;  3DMJ A;  3K58 A;  1UAX A;  1C1A A;  4ZTJ A;  4BE2 A;  3NCI A;  3DRS A;  4JLH A;  4DSJ A;  1XHZ A;  3OJU A;  4PQU A;  2OPR A;  2G8V A;  2I5J A;  3MEG A;  4E0D A;  3QIO A;  3AA2 A;  3AVH A;  3PX6 A;  4KB1 A;  1RNH A;  1EET A;  2PYJ A;  4KTQ A;  3CM6 A;  1L3U A;  4KV8 A;  4RW4 A;  4F4K A;  2HHS A;  2KFN A;  4KHS A;  5SWM A;  1S1U A;  3ZSZ A;  4E7J A;  4CEQ A;  4FM1 A;  3MAQ A;  1B9D A;  3NH1 A;  2HND A;  1IO2 A;  1RT4 A;  1HQE A;  5CYM A;  1XWL A;  2GUI A;  4BDZ A;  4FJL A;  3SV4 A;  3SQ1 A;  3NE6 A;  1HNV A;  4EP4 A;  1L3S A;  1IKY A;  1Q9Y A;  4DF4 A;  4QOZ B;  4WE1 A;  3HP6 A;  3P83 D;  1RTI A;  1HYS A;  1NOY A;  5HP1 A;  2ATQ A;  3ZT0 A;  3SJJ A;  3HJF A;  1RT5 A;  4CJV A;  3DOL A;  1U49 A;  1C1C A;  4DLE A;  2IOC A;  4PUO A;  4KHU A;  4CGH A;  3AVB A;  3AVG A;  4B9U A;  4FZX C;  4FK4 A;  2IC3 A;  3SI6 A;  2OZM A;  3KIO A;  3VQ5 A;  3LP3 A;  3KK3 A;  4F2S A;  3LAN A;  1QSL A;  4C8M A;  4Y1C A;  2X6N A;  2GBZ A;  4AHS A;  1IKX A;  4CES A;  3KLF A;  3NDK A;  4DFJ A;  1S1W A;  3VQ9 A;  4CFB A;  3CM5 A;  3TWH A;  3ALY A;  4AHU A;  3LWL A;  5J2M A;  4FYD A;  4BE0 A;  2G8K A;  4Z4F A;  1TAU A;  4KTW A;  4UQG A;  4XIU A;  2D0A A;  1RTH A;  4CJU A;  4FLY A;  3JSM A;  4O4G A;  5EU7 A;  4CF8 A;  5I3U A;  1K6Y A;  3NBP A;  3SUP A;  4OKK A;  4E7I A;  3SUO A;  4Q0B A;  5KRT A;  4E89 A;  3PV8 A;  4PWD A;  2HHX A;  4JRP A;  1I39 A;  4CGJ A;  4FCY A;  3SCX A;  4Z4E A;  4CHY A;  4H4M A;  3NH2 A;  1NKB A;  2PY5 A;  4M3W A;  3MED A;  3PO5 A;  2QKK A;  3U3G A;  2YNF A;  2Y1I A;  4DQP A;  3AVL A;  2O4I A;  1Q9X A;  3TAB A;  1X9S A;  1JLA A;  1HQU A;  1HRH A;  3CQ8 A;  3AVN A;  1SKR A;  4CEO A;  4DU3 A;  5HRN A;  3V1Q A;  4DFK A;  3BDP A;  4KPY A;  2ZE2 A;  3DRR A;  4E7H A;  4DG1 A;  5KRS A;  3QNO A;  1JLG A;  5FRM A;  1FKO A;  4J2B A;  3OS2 A;  4CJL A;  4FLU A;  4FJH A;  1VSI A;  1I3A A;  1C0U A;  3AVF A;  3LP1 A;  4JRQ A;  3V1O A;  4C8N A;  1L5U A;  1VSM A;  1IG9 A;  5HRS A;  4BAC A;  3S3M A;  3C6T A;  5C25 A;  3O3G A;  1ASV A;  4CJ4 A;  1T03 A;  2O4G A;  4RW9 A;  4CEE A;  1EXQ A;  3SPZ A;  2KQ2 A;  3AO3 A;  1NJY A;  1VSK A;  3ZCM A;  4CED A;  1RBS A;  1NK8 A;  1T8E A;  4KI6 A;  1VSJ A;  1MU2 A;  2FBT A;  2Z1H A;  3MEE A;  4IBN A;  1BGX T;  4KHY A;  4N5S A;  3AVJ A;  3OYC A;  3K57 A;  4F3O A;  1LWC A;  1JLF A;  4CEA A;  3VQP A;  5KI6 A;  1KSP A;  1S1T A;  4CJT A;  3LZJ A;  3IS9 A;  4HUF A;  1NK5 A;  2AJQ A;  1TK0 A;  3HST B;  1WNS A;  4IFY A;  4OKJ A;  3VA0 A;  1YT3 A;  3D0P A;  2HB5 A;  3OVN A;  4J2E A;  1UWB A;  1WSI A;  3PY8 A;  2E6L A;  1CXQ A;  2G8W A;  5CZ1 A;  3AA4 A;  4DFP A;  3OYM A;  1QQC A;  3IRX A;  4CJK A;  4OLA A;  4E1N A;  3KLH A;  4W5Q A;  3DRP A;  1S9E A;  3VN5 A;  4LSL A;  2A1R A;  3EZ5 A;  4LSN A;  2HVH A;  1ZYQ A;  2X78 A;  1RT2 A;  1O1W A;  2P51 A;  3IAY A;  4DTJ A;  4DSF A;  1RCH A;  1TKX A;  2VWJ A;  4I2Q A;  3P5J A;  3CFP A;  3DLH A;  3MXJ A;  3AVC A;  4FLX A;  1BCO A;  1WN7 A;  2PYL A;  3CYM A;  5C24 A;  3C6U A;  3S3N A;  3KD5 E;  3O3F A;  1QTM A;  3TI0 A;  4F8R A;  2GV9 A;  2FBY A;  2QXF A;  4CF2 A;  1WSH A;  1EX4 A;  2Z1J A;  4AHC A;  3E01 A;  3AO2 A;  1D8Y A;  4L8R B;  2YHB A;  1KVC A;  4GVM A;  3VQ8 A;  2ETJ A;  4O44 A;  3L2R A;  4Z0U A;  3JYT A;  1WAF A;  1HJR A;  4LY7 A;  2LSN A;  2DFF A;  1A5W A;  1TGO A;  2IGI A;  4CJQ A;  3K5M A;  2OA8 A;  4NCB A;  4C8K A;  1N6Q A;  1BIU A;  4FJM A;  1RBU A;  3RR8 A;  1RDC A;  4OKE A;  1ZBF A;  1YTU A;  1NK7 A;  3L2Q A;  1XI1 A;  4KHQ A;  1REV A;  1JLE A;  1KVB A;  1DTT A;  1RBT A;  4RW8 A;  4CF0 A;  2P5O A;  5CYQ A;  4FW2 A;  4Q5V A;  4M3U A;  4KO0 A;  1S5J A;  4M41 A;  5J1E A;  1VSL A;  1Y97 A;  3AO4 A;  3KLE A;  1RT3 A;  2Z1G A;  3AVK A;  3ZT1 A;  1A5X A;  3V9S A;  4E3S A;  4DTM A;  5D3G A;  2F8T A;  3AA5 X;  1KLM A;  3AA3 A;  1F21 A;  1T05 A;  2EHG A;  4N41 A;  4FK0 A;  1S6Q A;  4IG3 A;  4HHT A;  3L3U A;  2R7Y A;  4B9M A;  3RR7 A;  2OYQ A;  5J2N A;  2HW3 A;  5K14 A;  4DTN A;  1ITG A;  1T7P A;  3K5N A;  4DQS A;  4DS5 A;  4CGD A;  3KJV A;  2BE2 A;  4CHP A;  4M42 A;  4M3Z A;  4F3T A;  3TAE A;  2DTU A;  3AV9 A;  4NYF A;  1XC9 A;  2ZD1 A;  4DS4 A;  3G0Z A;  1X1P A;  2OPS A;  2Z1I A;  3BGR A;  3EYZ A;  4FJ7 A;  3EY1 A;  3VA3 A;  4DFM A;  1FK9 A;  3VQA A;  3ZT2 A;  3OYB A;  4DSE A;  4FXD A;  3A2F A;  1IKV A;  1Z26 A;  4NCG A;  3LZI A;  4HUG A;  4DSL A;  4MQ3 A;  1C6V A;  3F73 A;  4KAZ A;  2B4J A;  4ID5 A;  1RIL A;  4CCH A;  4GW6 A;  4HVJ A;  3SQ4 A;  3HPH A;  3OYD A;  4DQR A;  4YFU A;  3O4N A;  3V1R A;  3H08 A;  3DLB A;  3L2V A;  3TR8 A;  3HVR A;  3V81 A;  1SKW A;  2G8I A;  3DYA A;  1RBR A;  2VG7 A;  4Z4H A;  3I0R A;  3QEV A;  2P5G A;  2IAJ A;  3HT3 A;  3AVI A;  3HVT A;  1VK0 A;  3WNF A;  3RTV A;  2DY4 A;  2YKN A;  2XY6 A;  4CJ5 A;  1QSS A;  1U47 A;  4CFC A;  3ITH A;  5I42 A;  3NH0 A;  4FLT A;  1U45 A;  1NK6 A;  4NCA A;  2ITG A;  1NOZ A;  3OY9 A;  1S9G A;  3OS0 A;  1BI4 B;  4CGF A;  4OJR A;  1YTA A;  4FLZ A;  3MXI A;  1N5Y A;  4RW7 A;  1C0T A;  2RKI A;  1TKZ A;  1Z25 A;  4LH5 A;  4FLW A;  4F2R A;  4HCC A;  1TKD A;  1FXX A;  3OYH A;  3NHG A;  3ZT4 A;  1KLN A;  2XY7 A;  3VQ4 A;  3S3O A;  3NF7 A;  2BDP A;  3HK2 A;  1NK0 A;  3DLR A;  4FJK A;  4KHN A;  3B6O A;  3RMC A;  3ZSY A;  4DWI A;  1W9H A;  2KFZ A;  3SNN A;  4YNQ A;  4FJ8 A;  4LD0 A;  3LAM A;  2YHA A;  3D45 A;  4K8X A;  3K59 A;  3PUF A;  4BWJ A;  3AVA A;  2P1J A;  1NJX A;  2DFE A;  3WNE A;  3AO1 A;  3L2U A;  3G10 A;  1NJZ A;  3TAN A;  3VQD A;  1KFD A;  3P1G A;  3OS1 A;  1FKP A;  4BWM A;  4CHZ A;  3SYZ A;  4B9N A;  4FVM A;  4ZHR A;  1VSF A;  3TAG A;  5DK5 A;  2JLE A;  4B9V A;  5KGW A;  3SUQ A;  3PX4 A;  3THV A;  1X9W A;  1LWF A;  3ZSX A;  3SV3 A;  2HHQ A;  4W5N A;  3QLH A;  1CZ9 A;  4CEB A;  3FFI A;  3RMA A;  4ELV A;  4C8O A;  4PY5 A;  2Q3S A;  3V6D A;  1RT6 A;  3KKS A;  2EX3 A;  3HPO A;  2VG6 A;  1UA0 A;  4N76 A;  4OLB A;  2X6S A;  1UA1 A;  5CY4 A;  1QHT A;  3LPU A;  4CIF A;  4R5P A;  3OYG A;  4DTX A;  4CGG A;  4JS5 A;  3V9W A;  3HP9 A;  1TAQ A;  3DM2 A;  4TSX A;  4Y1D A;  2FBX A;  3K5L A;  2WON A;  4FM2 A;  4DTP A;  1LW2 A;  4M3T A;  3QEP A;  2W42 A;  1RBV A;  2E4L A;  1JKH A;  1RDD A;  3QEX A;  1HYV A;  2KTQ A;  4I7F A;  1HNI A;  4CJR A;  4IKF A;  3QES A;  4OGE A;  4OPJ A;  2FC0 A;  5FDL A;  4JS4 A;  1GOA A;  1S1V A;  3LDS A;  1B9F A;  4CJP A;  3MXM A;  1EP4 A;  4FJI A;  1SL1 A;  1JLB A;  1RTJ A;  4B08 A;  3NGZ A;  1U4B A;  3RRH A;  4O5B A;  4W5T A;  4ID1 A;  3U6F A;  3VQC A;  3O3H A;  4B9T A;  4FJX A;  1VRU A;  3ULD A;  3U3Y A;  3KTQ A;  4AHR A;  1WSG A;  2D0C A;  3PO4 A;  2OPQ A;  4CF9 A;  3ZT3 A;  2XHB A;  1LW0 A;  2XO7 A;  3ZSV A;  1JXE A;  4RG8 A;  4Z4C A;  1IKW A;  1LV5 A;  1YVU A;  3QO9 A;  3DLK A;  1RDB A;  1BHL A;  4KFB A;  5JS2 A;  2QK9 A;  1NKC A;  3M8P A;  2ZQB A;  3F9K A;  3V9X A;  4H8K A;  4CFD A;  2YNH A;  3HL8 A;  5HLF A;  3OYI A;  4CIG A;  4CJ3 A;  1ASW A;  5C42 A;  4FLV A;  4C8L A;  4FJ9 A;  2F8S A;  4KRF A;  4I9L A;  4CJF A;  2YV0 X;  1NK9 A;  1EKE A;  1KTQ A;  4B3O A;  3RWU A;  3V9U A;  1RT7 A;  1JLQ A;  2XY8 A;  2OPP A;  2VWK A;  3MEC A;  4IG0 A;  1TV6 A;  3TAF A;  4DTU A;  4E1M A;  3L3V A;  4O0I A;  3PX0 A;  5KTQ A;  4CEC A;  2FBV A;  3CFR A;  3LP2 A;  3TAM A;  1D5A A;  3OYF A;  2HNY A;  3NAE A;  4DSK A;  3DLG A;  3TAR A;  1BI4 A;  3K2P A;  1A5V A;  1QS4 A;  4CF1 A;  3V9Z A;  3S9H A;  1U48 A;  1XHX A;  4IDK A;  1QE1 A;  3T1A A;  1X9M A;  4J2A A;  4QCL A;  1JLC A;  1UOC A;  4BDP A;  1LWE A;  2RF2 A;  4DSI A;  1WSJ A;  4CK3 A;  2YNI A;  4IFV A;  3ZSW A;  1ZBI A;  2Y1J A;  2VG5 A;  3LP0 A;  3QIN A;  3ISN C;  2NUB A;  3HM9 A;  2D0B A;  4CE9 A;  5FRN A;  1DLO A;  1TVR A;  1HYZ A;  1BL3 A;  1S1X A;  3QIP A;  1WLJ A;  4N47 A;  4CHQ A;  1CXU A;  1TL1 A;  2BAN A;  3M8S A;  1L3T A;  2XRI A;  3OJS A;  4K8Z A;  4CJW A;  3O4Q A;  1SUQ A;  1ZBU A;  4FZY A;  2KW4 A;  3B6P A;  4E7L A;  1GOB A;  3V4I A;  4CK1 A;  3ZSQ A;  1VSD A;  4W5O A;  1C1B A;  3HO1 A;  3DLE A;  4BE1 A;  3KLI A;  3NF8 A;  4ELT A;  3VQE A;  1QSY A;  3ZSO A;  1SV5 A;  1DTQ A;  3NF6 A;  3KKR A;  1IH7 A;  4FW1 A;  4MFB A;  4OVL A;  4FM0 A;  3ASM A;  4E19 A;  2D5R A;  4HCB A;  1VSE A;  3NFA A;  4AIL C;  4ZTF A;  3T3F A;  3RRG A;  3UIQ A;  4KTZ A;  2G8H A;  1D9F A;  4HTU A;  1SL2 A;  4DF8 A;  1NK4 A;  3KK2 A;  1BQM A;  1ZBH A;  1ZBL A;  4KRE A;  5J2P A;  1CZB A;  2F96 A;  4H4O A;  3KLG A;  3VQB A;  3QET A;  4I9Q A;  4M3X A;  2HHV A;  3VQ6 A;  1CLQ A;  4CIE A;  1KCF A;  4EZ6 A;  3HYF A;  4ICL A;  5HBM A;  2QKB A;  4M3Y A;  5DMR A;  1BQN A;  3HPG A;  1WAJ A;  4HUE A;  1D9D A;  2DFH A;  3WNH A;  3I8D A;  2PZS A;  3IG1 A;  2HHU A;  4FJ5 A;  5JS1 A;  3I0S A;  4W5R A;  2IS3 A;  3DI6 A;  4CHN A;  4DQQ A;  3SUN A; 
#chains in the Genus database with same CATH topology
 5MLC Q;  4AM7 A;  3R8E A;  4K43 A;  4PKH A;  4QS7 A;  1BIZ A;  2HMI A;  2GEL A;  2GWJ A;  3WUH A;  1R0A A;  2F7T A;  3OYE A;  3IUC A;  2W41 A;  3O9S A;  3WNG A;  3NGI A;  3RMB A;  4DTO A;  1HPZ A;  1B92 A;  4G1Q A;  4FWP A;  3U8X A;  3AO5 A;  3ZET B;  4B8A B;  3M1F A;  1VQN N;  3ZSR A;  1XMQ K;  4DR4 K;  3VF2 A;  2X74 A;  2YKM A;  4NYN A;  2HHT A;  2G8F A;  2BH1 A;  4CJE A;  3BZK A;  3VER A;  1NJW A;  4CHO A;  3SPY A;  2J4R A;  2PAV A;  4JK9 A;  4PA1 A;  3QEI A;  5J2Q A;  3QNN A;  4GMJ B;  3M8Q A;  1VQ9 N;  1N32 K;  4BRQ A;  1J53 A;  2E20 A;  3ENH A;  4B9L A;  3CD6 N;  5CZ2 A;  2NRR A;  4DB3 A;  1VQ6 N;  4BRN A;  1HNW K;  1C0M A;  1HMV A;  1SL0 A;  3DOK A;  4M3R A;  4BG8 A;  1NKE A;  2ZJR L;  1GOC A;  4CEF A;  2WOM A;  1OH6 A;  2CGK A;  1WSE A;  2JWK A;  3VGM A;  4B9S A;  5AR0 A;  3DMJ A;  3K58 A;  1QHA A;  4BY9 C;  3O9Q A;  5AQV A;  4BE2 A;  4BRI A;  5AQZ A;  3R6M A;  4E0D A;  3MEG A;  5AQI A;  3QIO A;  3AA2 A;  3PX6 A;  3C0B A;  3THY A;  2AP1 A;  1EWQ A;  1Z05 A;  3F9M A;  2HMP A;  3ZSZ A;  4CI6 A;  4FM1 A;  2RHK A;  4BDZ A;  4JHD B;  3GE1 A;  3EN9 A;  1HNV A;  1MWM A;  4DF4 A;  2QWO A;  1RT5 A;  3DOL A;  4PUO A;  1TYQ A;  3AVB A;  3AVG A;  4B9U A;  4PL7 A;  3P31 A;  3VQ5 A;  5GAH P;  2NZT A;  3KLF A;  2X6N A;  3NDK A;  1IKX A;  4DFJ A;  3AGK A;  2D4W A;  3TSP A;  1M1K O;  3CM5 A;  4OPA A;  4JKD A;  4CZF A;  5J2M A;  3AY9 A;  4CJU A;  3AAQ A;  3JSM A;  1LCU A;  4JI1 K;  1VQP N;  3BUZ B;  2AA4 A;  5KRT A;  3U9Z A;  4NLC A;  4CHY A;  3H45 C;  2NNW A;  3RSE A;  3U3G A;  2Y1I A;  1VQK N;  2QKK A;  3RVC A;  3TAB A;  1X9S A;  3CET A;  3CQ8 A;  4DU3 A;  3BDP A;  4KPY A;  4DG1 A;  3QNO A;  4YHH K;  5FPM A;  4JKE A;  3TSU A;  2WTU A;  3C6T A;  3O3G A;  2NRV A;  2O4G A;  3R1X A;  4CEE A;  1EXQ A;  5I9E B;  1P90 A;  1VSJ A;  1MU2 A;  2FBT A;  2P9K B;  2KLA A;  3VTI A;  3AVJ A;  3K57 A;  3VQP A;  4NO7 A;  4WQ4 A;  3THX A;  1YJW N;  3BF3 A;  3FZK A;  4OX9 K;  1WNS A;  1VQ8 N;  4IFY A;  3DWL A;  2NRT A;  3VA0 A;  3QML A;  2E6L A;  3H1V X;  3AA4 A;  4L3Q A;  4DFP A;  2GX9 A;  1QQC A;  2ZM6 K;  1S9E A;  3EZ5 A;  3SJH A;  1IV0 A;  3D2E B;  3C7N B;  1RT2 A;  3L4I A;  3IAY A;  3C65 A;  4DSF A;  3DLH A;  1Q82 O;  4BGA A;  1WN7 A;  3SMS A;  4OO1 J;  3A5N C;  3O3F A;  1QTM A;  3CCE N;  3TI0 A;  2FBY A;  4LF8 K;  4FWL A;  2P9L B;  3CJC A;  3AO2 A;  4GV3 A;  1KVC A;  3FZM A;  2ETJ A;  3THX B;  2IGI A;  2YHX A;  3G71 N;  4FJM A;  3RR8 A;  2VQF K;  4KHQ A;  1JLE A;  4CZI A;  3J7A P;  5JLF A;  1N33 K;  4Q5V A;  4M3U A;  4M41 A;  3QIC A;  4DTM A;  1RT3 A;  1NGA A;  2Z1G A;  4E3S A;  1A5X A;  1ZBS A;  1EWR A;  4DQ8 A;  4PKG A;  4DV6 K;  4B9M A;  5IT9 O;  3RR7 A;  4IEE A;  2P9L A;  3KJV A;  4Y0W A;  3DLL L;  2NRX A;  2DTU A;  4NYF A;  2ZD1 A;  1P8Z A;  3VOV A;  3L0Q A;  4BR4 A;  2QA4 N;  3CF5 L;  2O8C B;  3A2F A;  4DSL A;  3F73 A;  3DXM A;  4ID5 A;  3N4Q A;  4CCH A;  4WQ5 A;  2OTL N;  1ZXO A;  3OYD A;  4B3S K;  3H08 A;  3DLB A;  2WBN A;  5C10 A;  1HPM A;  3HVR A;  3CCM N;  3HI0 A;  1SKW A;  3DYA A;  5GIP A;  3I0R A;  3HT3 A;  3VPZ A;  3AVI A;  3HVT A;  1VK0 A;  4IOC L;  3LDN A;  5KPR A;  2F9T A;  1U47 A;  2O8D B;  4B1U B;  5I42 A;  3NH0 A;  1YIT N;  2W40 A;  3ID8 A;  1BI4 B;  4CGF A;  3MXI A;  3PIO L;  4DKW A;  1C0T A;  1Z25 A;  3OTO K;  1TKD A;  3OYH A;  5H1S Q;  3ZT4 A;  1KLN A;  2XY7 A;  3HK2 A;  3DLR A;  3B6O A;  5M1N A;  1W9H A;  3LAM A;  4K8X A;  3OBY A;  1T3V A;  1NM1 A;  2P1J A;  1NJX A;  2DFE A;  3WNE A;  4CBU A;  3L2U A;  5BRE A;  1KFD A;  3P1G A;  3HRG A;  3SYZ A;  4FVM A;  2HHQ A;  4A2A A;  1CZ9 A;  3FFI A;  3V6D A;  2VG6 A;  2W6K A;  4XEI A;  4N76 A;  4OLB A;  2X6S A;  3O8M A;  5C15 A;  5CY4 A;  2IVO A;  4DTX A;  3HP9 A;  4CZL A;  3OBW A;  3DM2 A;  3K5L A;  3C6A A;  1RBV A;  3GDQ A;  3QES A;  4OGE A;  1KAX A;  3SLC A;  1O13 A;  4JS4 A;  2E5L K;  4JKC A;  4FJI A;  3DXK B;  1JLB A;  4WQ4 C;  3UKU A;  3U6F A;  1WUA A;  3VQC A;  3O3H A;  3CC4 N;  3U3Y A;  3KTQ A;  2D0C A;  4CF9 A;  1Q7Y O;  3CIP A;  1LW0 A;  4Z4C A;  1JXE A;  4RG8 A;  1IKW A;  2Q36 A;  3F9K A;  1U2V A;  4B9Q A;  4FWR A;  3VES A;  3ENB A;  5HLF A;  4CIG A;  4KRF A;  4C8L A;  4FJ9 A;  3E9P A;  3MMV A;  4DV1 K;  1RT7 A;  3WXM B;  4IG0 A;  1SS6 A;  1TV6 A;  3PX0 A;  4HWI A;  5KTQ A;  3LP2 A;  2NRZ A;  3EE9 A;  1GLC G;  1D5A A;  3NAE A;  3WQT A;  3DLG A;  1A5V A;  1QS4 A;  2A41 A;  3L6Q A;  3VEY A;  4IDK A;  1QE1 A;  4QCL A;  1JLC A;  1UOC A;  3I8B A;  4H5T A;  2YNI A;  3LDO A;  2Y1J A;  2VG5 A;  3ISN C;  2NUB A;  3F2K A;  2D0B A;  2GWK A;  3BP8 A;  4FK4 A;  2DY4 A;  4N47 A;  1S1X A;  3M8S A;  2XRI A;  5AQO A;  5AQY A;  4E7L A;  5BN8 A;  1FJG K;  3ZEU B;  4F9O A;  1C1B A;  1QZ5 A;  3DLE A;  3KLI A;  3JXU A;  5AQU A;  3ZSO A;  2F9W A;  2IVP A;  3NF6 A;  3KKR A;  2UXD K;  4FM0 A;  4H5R A;  4HCB A;  3UIQ A;  4EAH D;  1QVF M;  4KH4 A;  4LF9 K;  3M3Z A;  2HHH K;  5J2P A;  5GAG P;  3QET A;  4KH5 A;  1CLQ A;  2P9S A;  4EZ6 A;  1RFQ A;  5HBM A;  1WBB A;  4H03 B;  4M3Y A;  1BQN A;  1W2B M;  5KQD A;  2PZS A;  4DV4 K;  2IS3 A;  3DI6 A;  4CHN A;  4DQQ A;  3I33 A;  3FZL A;  3E9L A;  1RDA A;  5FRO A;  3O1W A;  4DTR A;  3VQ7 A;  4HTL A;  5TKW A;  4JYA K;  1WOQ A;  4I6M A;  4M63 C;  3M8R A;  2A1S A;  2D1K A;  4K41 A;  4M45 A;  5KGX A;  1NGD A;  3CFO A;  3H3O B;  4EP5 A;  3L8B A;  4Z4G A;  3OYK A;  1MDU B;  5TKY A;  3OYL A;  3ZX2 A;  2HNZ A;  4N56 A;  4H5V A;  3K9K A;  4KB0 A;  4X66 K;  4DV3 K;  2O8E A;  4XH1 A;  1K8K B;  1NJI O;  4E7K A;  2CGJ A;  2YHW A;  2E2N A;  2BTF A;  4K25 A;  1OH8 A;  2HHW A;  2HVI A;  3R9P A;  1YJN N;  3C95 A;  3T69 A;  2JGU A;  4CFA A;  4CJS A;  1VRT A;  1SQK A;  1RTD A;  3CQX A;  3SZ2 A;  3THW A;  4A62 A;  5HRR A;  3OHR A;  1YXQ A;  3VET A;  3QEW A;  3OYA A;  4B1Y B;  1LAW A;  3OYN A;  1NGF A;  1TKT A;  2GUP A;  1J5O A;  2B6A A;  4DR2 K;  3ZET A;  1L3V A;  1KRP A;  1S6P A;  2ASP A;  4RW6 A;  4KI4 A;  2OTJ N;  4I2P A;  5E41 A;  3K0S A;  3VGL A;  2P9U A;  4OGC A;  3FZH A;  4O55 A;  5LMU K;  3IFR A;  3A5M C;  5BPN A;  1TK5 A;  1UAX A;  2HOE A;  3NCI A;  3DRS A;  4JLH A;  1XHZ A;  3OJU A;  3THW B;  4PQU A;  3O9R A;  1RNH A;  3LDL A;  1EET A;  4LF6 K;  1GLJ O;  5FPN A;  2ZF5 O;  3J80 O;  2HST A;  4E7J A;  4JKG A;  4CEQ A;  3MAQ A;  2HND A;  1IO2 A;  1RT4 A;  1HQE A;  5CYM A;  1XWL A;  2GUI A;  1BU6 O;  3SV4 A;  3SQ1 A;  4QS8 A;  4EP4 A;  2EWS A;  5E26 A;  1J5E K;  5BRD A;  4JI7 K;  1RTI A;  1HYS A;  1NOY A;  2ATQ A;  1NU0 A;  3AGR A;  4IOA L;  3P38 A;  3EKS A;  1U49 A;  4EHT A;  1SZ2 A;  4FZX C;  1TUU A;  1IG8 A;  3SI6 A;  2OZM A;  3MN6 A;  1QSL A;  2O8F A;  1BA0 A;  2NLX A;  4AHS A;  1OKJ A;  3VQ9 A;  4CFB A;  3TWH A;  4FYD A;  4Z4F A;  4KTW A;  4B3M K;  3CCS N;  4FLY A;  1RTH A;  4O4G A;  3G25 A;  3CCL N;  4AQY K;  5I3U A;  1K6Y A;  3SUP A;  4BVO A;  4E89 A;  3PV8 A;  5LMN K;  2HHX A;  4GV6 A;  1I39 A;  4CGJ A;  4Z4E A;  3NH2 A;  1NKB A;  4M3W A;  4DV2 K;  3BEX A;  1S72 N;  2O4I A;  1TYQ B;  2UU9 K;  1HRH A;  1SKR A;  4CEO A;  5JIC A;  5LL6 Z;  5HRN A;  2O8F B;  3DRR A;  1FKO A;  1M90 O;  4FJH A;  3AVF A;  1C0U A;  3V1O A;  1IG9 A;  5HRS A;  4BAC A;  2Q0R A;  1T03 A;  1NLV A;  1OH5 A;  1T8E A;  4CED A;  1HNZ K;  3GOI A;  2QWM A;  1BGX T;  4KHY A;  4N5S A;  1LWC A;  1JLF A;  3A5O C;  4BC4 A;  5KI6 A;  1KSP A;  1S1T A;  5ADX A;  4CJT A;  3LZJ A;  3IS9 A;  4ISG A;  1TK0 A;  1YT3 A;  2HB5 A;  4J2E A;  1UWB A;  3PY8 A;  3MN9 A;  1CXQ A;  1DT9 A;  3OYM A;  4C23 A;  3IRX A;  3T1H K;  3KLH A;  4JKA A;  3VN5 A;  4LSL A;  5AJ3 K;  2HVH A;  2YJE A;  2P51 A;  3LM2 A;  1GLE G;  2YI1 A;  2VWJ A;  4BRF A;  3CYM A;  3DAW A;  4F8R A;  3QBX A;  3O08 A;  5M1O A;  4YOU A;  4AHC A;  4GVM A;  4QS9 A;  3JYT A;  4Z0U A;  1WAF A;  1HJR A;  2DFF A;  1TGO A;  4NCB A;  4YOX A;  3KWI A;  3SAG A;  2E88 A;  3TPQ A;  1VHX A;  5EOY A;  1K9M O;  3L2Q A;  4RW8 A;  1DTT A;  1RBT A;  5JVH L;  4NXN K;  2ZJP L;  5J1E A;  4JI4 K;  3ZT1 A;  2F8T A;  1F21 A;  2EHG A;  4DV7 K;  1S6Q A;  2OYQ A;  3MK6 A;  1E3M A;  5J2N A;  4DTN A;  1ITG A;  2D0O A;  4DQS A;  4DS5 A;  5DM6 L;  3RSE B;  2BE2 A;  1XQS C;  4M42 A;  4F3T A;  5C2F A;  2V51 B;  1XC9 A;  2YHY A;  4G9Z A;  3G0Z A;  1X1P A;  2OPS A;  4FWQ A;  4CZK A;  2I7P A;  3VA3 A;  4FWN A;  1IKV A;  4H0T B;  1Z26 A;  3A5L C;  1EO1 A;  1C6V A;  3SQ4 A;  4DQR A;  4BQL A;  1NGH A;  5M1P A;  4BC3 A;  1JCF A;  4BGB A;  2CH5 A;  3FLC O;  3QEV A;  2IAJ A;  3CPW M;  3WNF A;  3RTV A;  2YKN A;  3VMF B;  1S22 A;  3ITH A;  1NOZ A;  1XUP O;  3TSQ A;  1S9G A;  3OS0 A;  4FWO A;  1N5Y A;  2E8A A;  2V7Z A;  4F2R A;  1T6C A;  4HCC A;  1FXX A;  4BRM A;  1SAZ A;  3S3O A;  4BR7 A;  2HF3 A;  1NK0 A;  4FJK A;  3ZSY A;  1HUX A;  3PUF A;  2QWR A;  3J7Z O;  4A61 A;  3ULE A;  3TAN A;  3OS1 A;  3UE5 A;  4B9N A;  5AFU A;  1VSF A;  2WFB A;  4J8F A;  4DV0 K;  2A6A A;  2ZGZ A;  1OVQ A;  5KGW A;  3SUQ A;  3THV A;  1R59 O;  4A5A A;  3RMA A;  5AZI B;  4PY5 A;  3VEZ A;  1RT6 A;  3KKS A;  1GLD G;  1YI2 N;  4YOY A;  1UA1 A;  5F2R A;  2FSJ A;  4CIF A;  4R5P A;  4CGG A;  4JS5 A;  2FBX A;  5F0X A;  3H6E A;  4DTP A;  2E4L A;  2Q1N A;  4WQ5 C;  4LFA K;  1BDG A;  4IKF A;  3ULE B;  4OPJ A;  1S1V A;  3O9U A;  3WEE B;  3LDS A;  5FPD A;  3MXM A;  4JKF A;  5AQF A;  4U7B A;  4ID1 A;  4W5T A;  1GLA G;  1VRU A;  4AHR A;  3O9T A;  3PO4 A;  3O1B A;  3H3N O;  5HL7 L;  3G6E N;  2XHB A;  3ZSV A;  3ENO A;  3HZ6 A;  5AQH A;  3CJ1 A;  4KFB A;  2QWQ A;  1NKC A;  3M8P A;  4ILJ A;  4AM6 A;  3CJ7 A;  3CPE A;  1I94 K;  3J81 O;  5LJV A;  1KQS M;  1EKE A;  3CJB A;  3V9U A;  1ATN A;  3VTH A;  4O0I A;  4CEC A;  3IMX A;  4JI0 K;  2V52 B;  3OYF A;  2D0P A;  3TAR A;  5E84 A;  5AQP A;  1U48 A;  1NWK A;  5ELZ A;  5AQW A;  3W0L A;  2PFU A;  3K9J A;  4DSI A;  4IFV A;  3ZSW A;  4B1V A;  4E1J A;  3LP0 A;  1TVR A;  2HBM A;  4CHQ A;  1L3T A;  1TL1 A;  4CZJ A;  2P9S B;  4BRO A;  1S3X A;  1HJO A;  4GNI A;  1GOB A;  3WT0 A;  4CK1 A;  1VSD A;  4ELT A;  3OA9 A;  4BRE A;  1DTQ A;  1WB9 A;  1IH7 A;  4MFB A;  4OVL A;  1HR0 K;  2P9I A;  4E19 A;  2D5R A;  3HM8 A;  4ZTF A;  3NFA A;  5M1F A;  3T3F A;  1FW6 A;  2QI2 A;  4KTZ A;  2G8H A;  3FFK B;  1D9F A;  2A3Z A;  4DF8 A;  4BRD A;  1BQM A;  1ZBH A;  1ZBL A;  2P9P A;  4DCH A;  3KLG A;  5BRH A;  2HHV A;  3HYF A;  4ICL A;  1T44 A;  4IDH A;  4X64 K;  5DMR A;  3HPG A;  1D9D A;  3GG4 A;  3WNH A;  3MCA B;  3IG1 A;  2HHU A;  1EQY A;  4WFN L;  1X3M A;  5T7B A;  4O0J A;  3AAP A;  4GV9 A;  2CH6 A;  1JXB A;  4EZ9 A;  2QWN A;  1HX1 A;  2QW9 A;  1JL2 A;  1ASU A;  3GL1 A;  4AHV A;  4DV5 K;  3TTD A;  5GAD P;  4QAG A;  4FJJ A;  2KZM A;  2XY5 A;  3KK1 A;  4KH6 A;  4M7X A;  4CER A;  4YOT A;  4YOV A;  3CMA N;  4KHW A;  4FJN A;  4ELU A;  2UUB K;  2RPI A;  5F1X A;  4CZH A;  3NF9 A;  1YF5 L;  3TAP A;  2FSN A;  3PIP L;  3LWM A;  4LH4 A;  3ATV A;  5HRO A;  5HRP A;  3L2W A;  3CME N;  5AQT A;  1RGI A;  3TTF A;  5SZT A;  4IXC A;  4LF7 K;  3LAK A;  3CI5 A;  4I6M B;  4BRG A;  1ATS A;  4DQI A;  3LAL A;  1DGK N;  2B5J A;  2OZS A;  3T19 A;  1KXP A;  4DMN A;  1BOT O;  1JJ2 M;  3C94 A;  4BRA A;  1BIS A;  3TAQ A;  1J54 A;  1W97 L;  4AH9 A;  4IEI A;  3LDQ A;  1U04 A;  4DU1 A;  1HLU A;  1NGB A;  2VQE K;  3CCU N;  4IO9 L;  1TK8 A;  2HBK A;  4CZE A;  1HKG A;  2OPR A;  4KB1 A;  4JD2 B;  3AVH A;  2PYJ A;  4KTQ A;  4KV8 A;  1S1U A;  1N8R O;  1B9D A;  2QWP A;  4CW7 B;  4K42 A;  3NE6 A;  3HSC A;  1L3S A;  2CGL A;  1Q81 O;  3EEQ A;  4WE1 A;  4QOZ B;  3P83 D;  3EKU A;  1YVN A;  5HP1 A;  1K73 O;  3ZT0 A;  4CD3 A;  3HJF A;  4CJV A;  4U67 L;  1Y64 A;  4DLE A;  2IOC A;  4KHU A;  3LDP A;  3O6W A;  5C0Y A;  4WYB A;  1KC8 O;  2IC3 A;  3CCR N;  4H0V B;  3KIO A;  3LP3 A;  3KK3 A;  4Y1C A;  4CES A;  3JAM O;  3ALY A;  4BRL A;  2G8K A;  4JKB A;  4UQG A;  4XIU A;  5EU7 A;  4DHY A;  3NBP A;  4OKK A;  1K8K A;  2NRW A;  4Q0B A;  4FPB A;  4DR3 K;  2A40 A;  3BZC A;  4H4M A;  3PO5 A;  4DQP A;  2YNF A;  5AQS A;  3VEO A;  2WC9 A;  1JLA A;  3KVG A;  1IBK K;  1H1V A;  3AVN A;  1C0G A;  4DFK A;  3WXK A;  2ZE2 A;  4E7H A;  5KRS A;  4BG9 A;  1JLG A;  3FGU A;  4J2B A;  3EZW A;  3OS2 A;  4CJL A;  4FLU A;  1VSI A;  1I3A A;  1IBM K;  4JRQ A;  4C8N A;  3S3M A;  3C7N A;  4JK7 A;  5C25 A;  2YJF A;  1VQO N;  2KQ2 A;  1NJY A;  1VSK A;  4YDU C;  1RBS A;  4IJN A;  2P9U B;  3MEE A;  4IBN A;  3OYC A;  5CHI A;  4F3O A;  2H3G X;  3ZX0 A;  5AQN A;  4HUF A;  3THY B;  3OVN A;  1WSI A;  5M1Q A;  5CZ1 A;  4CJK A;  3A0I X;  4OLA A;  2I7N A;  4JK8 A;  3O4W A;  3DRP A;  3UKR B;  2X78 A;  3MN7 A;  1O1W A;  3OW2 M;  3W3D A;  1RCH A;  3CFP A;  3P5J A;  3MXJ A;  4FLX A;  2PYL A;  5C24 A;  4H0O A;  3S3N A;  2E2O A;  5C12 A;  2QXF A;  4CF2 A;  1WSH A;  1EX4 A;  1K8A O;  2VYP A;  2KHO A;  4L8R B;  2YHB A;  3VQ8 A;  3L2R A;  4O44 A;  2WUS A;  4LY7 A;  2LSN A;  1A5W A;  4CJQ A;  3K5M A;  3CCQ N;  1YAG A;  1RBU A;  1ZBF A;  1YTU A;  2IVN A;  4MDB A;  1NK7 A;  3FE1 A;  3WXI A;  2PBD A;  4CF0 A;  1ESV A;  5LJW A;  5CYQ A;  4FW2 A;  4X65 K;  4H0Y B;  2FF6 A;  4KO0 A;  1VSL A;  3A8Y A;  3KLE A;  3V9S A;  1E4F T;  1V4T A;  3AA5 X;  1KLM A;  3AA3 A;  4GKJ K;  5EVZ A;  1T05 A;  4IG3 A;  2HW3 A;  3L3U A;  5K14 A;  1NG9 A;  3K5N A;  4CGD A;  1XC3 A;  2O8D A;  4CHP A;  2RE2 A;  4JV5 K;  3AV9 A;  5C2D A;  3EY1 A;  4DFM A;  3OYB A;  3D2F A;  3T1Y K;  3HOS A;  3NVM A;  3LZI A;  4NXM K;  4HUG A;  4MQ3 A;  1N34 K;  2B4J A;  1HKC A;  4PL8 A;  4GW6 A;  4HVJ A;  3HPH A;  1TUY A;  2QM1 A;  3O4N A;  3V1R A;  4MO4 A;  1YIJ N;  1X3N A;  2GTD A;  2G8I A;  1HNX K;  2P9K A;  3VEV A;  4LFB K;  2XY6 A;  4CJ5 A;  1NMD A;  3H1Q A;  4CFC A;  2F4V K;  4H0X B;  4IO8 A;  1U45 A;  3G4S N;  4NCA A;  2ITG A;  3OY9 A;  4FSV A;  4FLZ A;  4JI5 K;  4RW7 A;  3SBG A;  4FLW A;  1TKZ A;  3NHG A;  3MWT A;  3VQ4 A;  1VAZ A;  3NF7 A;  2VGN A;  4KHN A;  3UKR A;  3KK7 A;  4DWI A;  2DPN A;  4FJ8 A;  3D45 A;  4CJ7 A;  1XMO K;  4BWJ A;  3KZB A;  3CER A;  3CJA A;  3AO1 A;  4LF5 K;  4BR9 A;  1FKP A;  4BWM A;  5BPM A;  5KQ8 A;  4CHZ A;  3J8A A;  4ZHR A;  5IWA K;  3TAG A;  4ILH A;  5DK5 A;  2JLE A;  4ILG B;  4B9V A;  1X9W A;  3ZSX A;  3SV3 A;  4W5N A;  4ELV A;  4CEB A;  1VQ4 N;  3EE8 A;  1QHT A;  3LPU A;  3OYG A;  3V9W A;  1TAQ A;  4Y1D A;  4TSX A;  4FM2 A;  1LW2 A;  4M3T A;  3QEP A;  3VEX A;  1JKH A;  1RDD A;  5CR4 A;  1YHQ N;  1HYV A;  1MA9 B;  3QB0 A;  4I7F A;  2KTQ A;  1HNI A;  4CJR A;  3TTC A;  4BC2 A;  1GOA A;  1EP4 A;  4UY8 O;  4IJA A;  1RTJ A;  2QWL A;  3RRH A;  4O5B A;  3ZYY X;  4NB4 A;  4RWT A;  4B9T A;  2FSK A;  3ULD A;  1WSG A;  1NGI A;  1KD1 O;  3ZT3 A;  1N36 K;  1LV5 A;  1D4X A;  2FLO A;  3DLK A;  3QFP A;  2QK9 A;  3NMU A;  4YDU A;  3IKM A;  3BF1 A;  2Q31 A;  3V9X A;  2IIR A;  2YNH A;  1J6Z A;  3OYI A;  4H0P A;  1ASW A;  2ASO A;  5C42 A;  4FLV A;  4JI3 K;  4CJF A;  3D7E O;  1KTQ A;  3RWU A;  2XY8 A;  3CC7 N;  2VWK A;  3MEC A;  3QBW A;  4E1M A;  3L3V A;  5GAE P;  3TAM A;  3CC2 N;  3EL2 A;  3I56 N;  2HNY A;  2A5X A;  3K2P A;  3S9H A;  3V9Z A;  1X9M A;  1XHX A;  3T1A A;  4J2A A;  2P9N B;  4XH4 A;  2RF2 A;  4CK3 A;  3S41 A;  4CE9 A;  1BL3 A;  1HYZ A;  3QIP A;  1WLJ A;  4K8Z A;  3O4Q A;  1SUQ A;  1ZBU A;  3B6P A;  3MCP A;  2KKZ A;  3V4I A;  3ATU A;  3U9D A;  3ZSQ A;  1QZ6 A;  5FPE A;  4BE1 A;  3NF8 A;  3VQE A;  1QSY A;  1T6D A;  1SV5 A;  3M6G A;  5CE3 A;  1YJ9 N;  2UUC K;  4FW1 A;  4JEP A;  4A59 A;  1XNQ K;  3JS6 A;  1VSE A;  3U4L A;  4AIL C;  4WFB L;  3RRG A;  4JAX A;  4M7Y A;  1KAZ A;  3ZX3 A;  4WFA L;  4GKK K;  4JKG B;  1ATR A;  4KRE A;  1NNE A;  2F96 A;  4H4O A;  4M3X A;  3VQ6 A;  4CIE A;  1KCF A;  2QKB A;  1BWF O;  2O8E B;  4HUE A;  1WAJ A;  3KHY A;  3PSI A;  4FOE A;  2DFH A;  3I8D A;  3H46 O;  4FWM A;  2UXB K;  3C6H A;  4MLE A;  4FJ5 A;  5JS1 A;  3SUN A;  3CG7 A;  4J2D A;  3QER A;  1J9A A;  2RN2 A;  4BRC A;  4Z4I A;  4DLG A;  3AVM A;  4FK2 A;  1KVA A;  3LPT A;  2UUA K;  4BR0 A;  3RMD A;  4DUZ K;  1TL3 A;  2G8U A;  1G15 A;  1BCM A;  2P9P B;  3HXM A;  5DM7 L;  3SBT A;  2BUP A;  4KKO A;  4BDY A;  4OPK A;  1BO5 O;  3TU5 A;  4BQZ A;  1GLB G;  1W0H A;  4FJG A;  1JL1 A;  3E66 A;  1KFS A;  1VQL N;  5AQX A;  4JKH A;  3VQQ A;  2E2P A;  1SKS A;  1RT1 A;  4KBO A;  4CEZ A;  5GIN A;  4OPH A;  2KZZ A;  3K5O A;  3NGY A;  3SAH A;  2E6M A;  4IWV A;  4FZZ A;  4YOR A;  2BGG A;  2UYT A;  3WXL A;  4CK2 A;  1Q8I A;  1VQM N;  1E4G T;  4BRK A;  3VGK A;  4K0K K;  4DU4 A;  2A42 A;  2FXU A;  1VSH A;  4B8C A;  3OYJ A;  4ISF A;  2IDO A;  3KD1 E;  5B8H A;  2Q0U A;  4JI8 K;  1LAV A;  1ILY A;  4CGI A;  1WSF A;  4AHT A;  3SQ2 A;  2YNG A;  3SQ0 A;  2QXL A;  2Q2R A;  1C1A A;  4ZTJ A;  4DSJ A;  2ASM A;  5BRF A;  5AQK A;  2G8V A;  2I5J A;  5JLH A;  4BC5 A;  5LY3 A;  3CM6 A;  4YY3 K;  1L3U A;  4RW4 A;  4F4K A;  2HHS A;  2KFN A;  1BA1 A;  1QQM A;  4KHS A;  5SWM A;  3B8A X;  5M1K A;  3NH1 A;  4CVN E;  1IKY A;  3VF4 A;  2V7Y A;  3HP6 A;  2VWB A;  5AZJ B;  3SJJ A;  3CQY A;  1C1C A;  4CGH A;  4JN4 A;  3CHW A;  4BR2 A;  4F2S A;  3LAN A;  4C8M A;  2GBZ A;  2ZJQ L;  4V19 S;  1S1W A;  3R3L A;  4RCH A;  4AHU A;  5BR8 K;  3SAF A;  3LWL A;  3MX2 A;  4BE0 A;  1TAU A;  3VEN A;  2D0A A;  3ZLJ A;  4C1N I;  2YX6 A;  4CF8 A;  3CXC M;  4E7I A;  3SUO A;  4BR5 A;  3LL3 A;  4PWD A;  4JRP A;  4FCY A;  3SCX A;  2PY5 A;  2E1Y A;  3MED A;  3I55 N;  3NVK A;  1BG3 A;  3AVL A;  4CD1 A;  1Q9X A;  1HQU A;  3VEW A;  4ISE A;  4LF4 K;  3SK3 A;  1QQN A;  3V1Q A;  5FRM A;  1YUW A;  3D2F B;  1DKG D;  4KAZ A;  4FJL A;  3LP1 A;  4MLH A;  1L5U A;  1VSM A;  1ASV A;  4CJ4 A;  3O5B A;  4RW9 A;  3SPZ A;  3AO3 A;  3MN5 A;  3ZCM A;  3CCV N;  1NK8 A;  4KI6 A;  2Z1H A;  2HF4 A;  4CEA A;  5GIO A;  4B3R K;  1QVG M;  1IBL K;  4CBW A;  2AJQ A;  1NK5 A;  4DR6 K;  3HST B;  2FF3 B;  5AQR A;  4OKJ A;  3D0P A;  2G8W A;  3MDQ A;  4A2B A;  4E1N A;  3DJC A;  4W5Q A;  5BR9 A;  2A1R A;  2W6L A;  4LSN A;  1ZYQ A;  1JCG A;  4DTJ A;  5KPT A;  1TKX A;  4I2Q A;  1WBD A;  3IDH A;  3AVC A;  1BCO A;  3C6U A;  3KD5 E;  4A5B A;  2GV9 A;  4EFH A;  5AZJ A;  1W7A A;  2Z1J A;  4FO0 A;  3E01 A;  4CBX A;  4CZM A;  3FZF A;  1D8Y A;  3FR0 A;  4FVU A;  1RDU A;  2OA8 A;  4C8K A;  1N6Q A;  1BIU A;  3J7Y P;  1RDC A;  4OKE A;  5AQJ A;  1XI1 A;  1REV A;  1KVB A;  3N4P A;  4XH5 A;  2P5O A;  4R79 A;  2YCH A;  3D2E A;  4BVP A;  4H5W A;  1S5J A;  2NRH A;  1Y97 A;  3AO4 A;  4EHU A;  3AVK A;  5D3G A;  4N41 A;  4FK0 A;  3L4Q A;  4HHT A;  5EXW A;  2R7Y A;  5BN9 A;  1T7P A;  3UB5 A;  3T7Z A;  4M3Z A;  3PLA A;  1GLF O;  3TAE A;  2O8B A;  1DEJ A;  3WXJ A;  4DS4 A;  3BGR A;  2Z1I A;  3EYZ A;  4FJ7 A;  1FK9 A;  3VQA A;  3ZT2 A;  4AF1 A;  4DSE A;  1NMN A;  5JVG L;  4FXD A;  4RTF D;  2UXC K;  4NCG A;  4DUY K;  1RIL A;  1U2V B;  3QFU A;  4IFE A;  2VGM A;  2Q97 A;  4YFU A;  4O8K A;  1QQO A;  3L2V A;  3M5R A;  3TR8 A;  4MDA A;  2ITM A;  3V81 A;  1OVY A;  1RBR A;  2VG7 A;  1Q86 O;  4Z4H A;  2P5G A;  2QEX N;  5AQG A;  1QSS A;  4H5N A;  2O8B B;  4IOX A;  4FLT A;  1NK6 A;  4WF9 L;  4O5F A;  4OJR A;  1YTA A;  4CZG A;  4LH5 A;  2RKI A;  3CCJ N;  4BRH A;  4A57 A;  1XNR K;  3Q7C A;  3MWP A;  4Z94 A;  2BDP A;  1OH7 A;  3RMC A;  2KFZ A;  1V4S A;  2E1Z A;  1ZC6 A;  4YNQ A;  3SNN A;  4LD0 A;  1NGJ A;  4MO5 A;  1JCE A;  2YHA A;  3K59 A;  1BUP A;  2E2Q A;  3AVA A;  3G10 A;  1NJZ A;  5JMV A;  3VQD A;  5HOO A;  4PKI A;  4FWS A;  5EY4 A;  1GLL O;  4FOI A;  3PX4 A;  3E1Y A;  1LWF A;  4FPA A;  3QLH A;  2P9I B;  4BRP A;  4JNE A;  3SMP A;  4C8O A;  1NGG A;  2Q3S A;  3GBT A;  1IJJ A;  2EX3 A;  3HPO A;  1UA0 A;  4DR5 K;  3BY5 A;  4GVE A;  4X62 K;  2OAN A;  2WON A;  1CZA N;  2W42 A;  1HKB A;  3QEX A;  5BPL A;  1G99 A;  4NLB A;  2FC0 A;  4WCE L;  5FDL A;  1B9F A;  4CJP A;  4JI2 K;  1SL1 A;  4B08 A;  3WQU A;  3NGZ A;  1U4B A;  3MX5 A;  3CJ9 A;  1RDW X;  1VQ7 N;  1X9J A;  2HBL A;  4FJX A;  2OPQ A;  3D6R A;  2XO7 A;  3E9O A;  2O8C A;  4B3T K;  5AQM A;  1YVU A;  1NGC A;  3QO9 A;  1RDB A;  1BHL A;  5JS2 A;  3DXM B;  2JWL A;  2ZQB A;  5AFU H;  2OCE A;  1NGE A;  4H8K A;  4CFD A;  3HL8 A;  3PSF A;  4CJ3 A;  2F8S A;  4EIA A;  4I9L A;  2YV0 X;  1NK9 A;  1Q18 A;  2ZWH A;  3P39 A;  5A2Q O;  1C0F A;  4B3O A;  3WEE A;  1JLQ A;  4FWK A;  2OPP A;  5AQQ A;  5EX5 A;  3ZEU A;  3TAF A;  4DTU A;  3CFR A;  2FBV A;  3EO3 A;  3UKU B;  4O8U A;  1MWK A;  4DSK A;  5KPZ A;  1BI4 A;  4CF1 A;  4C1N K;  4B1X B;  4YOW A;  4BDP A;  1LWE A;  1WSJ A;  3HTV A;  3F5T A;  2VCP A;  4B1W B;  1ZBI A;  3ID6 A;  5ADX H;  3QIN A;  3HM9 A;  5FRN A;  1DLO A;  3HBT A;  1Q9Y A;  4DTS A;  1CXU A;  2BAN A;  4FL9 A;  3OJS A;  4DR7 K;  4CJW A;  4FZY A;  2KW4 A;  2GEM A;  4B1Z A;  3AAR A;  4DR1 K;  3Q7B A;  3P4I A;  1Z6R A;  2QTD A;  1NBW A;  4GY2 B;  4W5O A;  3HO1 A;  5AQL A;  3O80 A;  1LOT B;  5AZI A;  3ASM A;  4JD2 A;  2P9N A;  4IZ9 A;  4HTU A;  1SL2 A;  3QDK A;  3VF6 A;  1NK4 A;  1VQ5 N;  3KK2 A;  1KAY A;  4LFC K;  1CZB A;  2HBJ A;  3VQB A;  4JHD A;  3LM9 A;  4JI6 K;  4I9Q A;  5FLX O;  3KWG A;  1U6Z A;  4LC9 B;  4KHP K;  2ZGY A;  3I0S A;  4W5R A;  3DXK A;  3HOT A;  4PHT X; 
#chains in the Genus database with same CATH homology
 1RDA A;  5T7B A;  4O0J A;  5FRO A;  3CG7 A;  4DTR A;  3QER A;  3VQ7 A;  4J2D A;  1JXB A;  1J9A A;  2RN2 A;  1BIZ A;  4EZ9 A;  2HMI A;  1JL2 A;  4Z4I A;  1ASU A;  4DLG A;  4AHV A;  3AVM A;  3M8R A;  4FK2 A;  1R0A A;  1KVA A;  3LPT A;  2A1S A;  3OYE A;  3WNG A;  3NGI A;  3RMB A;  4DTO A;  1HPZ A;  4QAG A;  4M45 A;  1B92 A;  5KGX A;  3RMD A;  4G1Q A;  2XY5 A;  3CFO A;  4FJJ A;  2KZM A;  3KK1 A;  1TL3 A;  4EP5 A;  3L8B A;  4Z4G A;  3OYK A;  2G8U A;  1G15 A;  4CER A;  4KHW A;  3OYL A;  1BCM A;  4FJN A;  3AO5 A;  3HXM A;  4ELU A;  4B8A B;  2RPI A;  2HNZ A;  3ZSR A;  4KKO A;  4N56 A;  4BDY A;  4OPK A;  3NF9 A;  2X74 A;  2YKM A;  4NYN A;  3TAP A;  3LWM A;  4KB0 A;  4LH4 A;  1W0H A;  5HRO A;  2HHT A;  5HRP A;  4FJG A;  1JL1 A;  2G8F A;  1KFS A;  3L2W A;  4E7K A;  4CJE A;  3VQQ A;  1SKS A;  5SZT A;  1NJW A;  4CHO A;  2HHW A;  2HVI A;  1RT1 A;  3SPY A;  3C95 A;  3LAK A;  2JGU A;  4CFA A;  4CJS A;  1VRT A;  1RTD A;  4PA1 A;  3SZ2 A;  3QEI A;  4CEZ A;  5J2Q A;  2KZZ A;  3K5O A;  5HRR A;  4DTS A;  3LAL A;  3QNN A;  4DQI A;  2B5J A;  4GMJ B;  3NGY A;  3M8Q A;  2E6M A;  3OYA A;  3QEW A;  2OZS A;  4FZZ A;  2BGG A;  1LAW A;  3T19 A;  4CK2 A;  1Q8I A;  3OYN A;  4DMN A;  1J53 A;  3C94 A;  1TKT A;  4B9L A;  1J5O A;  1BIS A;  5CZ2 A;  2B6A A;  1L3V A;  4DU4 A;  3TAQ A;  1VSH A;  1J54 A;  1KRP A;  1C0M A;  1S6P A;  4RW6 A;  4AH9 A;  4B8C A;  3OYJ A;  4KI4 A;  2IDO A;  4I2P A;  5E41 A;  3KD1 E;  1HMV A;  1SL0 A;  1U04 A;  3DOK A;  4M3R A;  4DU1 A;  1NKE A;  1LAV A;  1GOC A;  4OGC A;  4CGI A;  4O55 A;  4CEF A;  2WOM A;  1WSE A;  1WSF A;  4AHT A;  3SQ2 A;  2YNG A;  3SQ0 A;  1TK5 A;  1TK8 A;  4B9S A;  3DMJ A;  3K58 A;  1UAX A;  1C1A A;  4ZTJ A;  4BE2 A;  3NCI A;  3DRS A;  4JLH A;  4DSJ A;  1XHZ A;  3OJU A;  4PQU A;  2OPR A;  2G8V A;  2I5J A;  3MEG A;  4E0D A;  3QIO A;  3AA2 A;  3AVH A;  3PX6 A;  4KB1 A;  1RNH A;  1EET A;  2PYJ A;  4KTQ A;  3CM6 A;  1L3U A;  4KV8 A;  4RW4 A;  4F4K A;  2HHS A;  2KFN A;  4KHS A;  5SWM A;  1S1U A;  3ZSZ A;  4E7J A;  4CEQ A;  4FM1 A;  3MAQ A;  1B9D A;  3NH1 A;  2HND A;  1IO2 A;  1RT4 A;  1HQE A;  5CYM A;  1XWL A;  2GUI A;  4BDZ A;  4FJL A;  3SV4 A;  3SQ1 A;  3NE6 A;  1HNV A;  4EP4 A;  1L3S A;  1IKY A;  1Q9Y A;  4DF4 A;  4QOZ B;  4WE1 A;  3HP6 A;  3P83 D;  1RTI A;  1HYS A;  1NOY A;  5HP1 A;  2ATQ A;  3ZT0 A;  3SJJ A;  3HJF A;  1RT5 A;  4CJV A;  3DOL A;  1U49 A;  1C1C A;  4DLE A;  2IOC A;  4PUO A;  4KHU A;  4CGH A;  3AVB A;  3AVG A;  4B9U A;  4FZX C;  4FK4 A;  2IC3 A;  3SI6 A;  2OZM A;  3KIO A;  3VQ5 A;  3LP3 A;  3KK3 A;  4F2S A;  3LAN A;  1QSL A;  4C8M A;  4Y1C A;  2X6N A;  2GBZ A;  4AHS A;  1IKX A;  4CES A;  3KLF A;  3NDK A;  4DFJ A;  1S1W A;  3VQ9 A;  4CFB A;  3CM5 A;  3TWH A;  3ALY A;  4AHU A;  3LWL A;  5J2M A;  4FYD A;  4BE0 A;  2G8K A;  4Z4F A;  1TAU A;  4KTW A;  4UQG A;  4XIU A;  2D0A A;  1RTH A;  4CJU A;  4FLY A;  3JSM A;  4O4G A;  5EU7 A;  4CF8 A;  5I3U A;  1K6Y A;  3NBP A;  3SUP A;  4OKK A;  4E7I A;  3SUO A;  4Q0B A;  5KRT A;  4E89 A;  3PV8 A;  4PWD A;  2HHX A;  4JRP A;  1I39 A;  4CGJ A;  4FCY A;  3SCX A;  4Z4E A;  4CHY A;  4H4M A;  3NH2 A;  1NKB A;  2PY5 A;  4M3W A;  3MED A;  3PO5 A;  2QKK A;  3U3G A;  2YNF A;  2Y1I A;  4DQP A;  3AVL A;  2O4I A;  1Q9X A;  3TAB A;  1X9S A;  1JLA A;  1HQU A;  1HRH A;  3CQ8 A;  3AVN A;  1SKR A;  4CEO A;  4DU3 A;  5HRN A;  3V1Q A;  4DFK A;  3BDP A;  4KPY A;  2ZE2 A;  3DRR A;  4E7H A;  4DG1 A;  5KRS A;  3QNO A;  1JLG A;  5FRM A;  1FKO A;  4J2B A;  3OS2 A;  4CJL A;  4FLU A;  4FJH A;  1VSI A;  1I3A A;  1C0U A;  3AVF A;  3LP1 A;  4JRQ A;  3V1O A;  4C8N A;  1L5U A;  1VSM A;  1IG9 A;  5HRS A;  4BAC A;  3S3M A;  3C6T A;  5C25 A;  3O3G A;  1ASV A;  4CJ4 A;  1T03 A;  2O4G A;  4RW9 A;  4CEE A;  1EXQ A;  3SPZ A;  2KQ2 A;  3AO3 A;  1NJY A;  1VSK A;  3ZCM A;  4CED A;  1RBS A;  1NK8 A;  1T8E A;  4KI6 A;  1VSJ A;  1MU2 A;  2FBT A;  2Z1H A;  3MEE A;  4IBN A;  1BGX T;  4KHY A;  4N5S A;  3AVJ A;  3OYC A;  3K57 A;  4F3O A;  1LWC A;  1JLF A;  4CEA A;  3VQP A;  5KI6 A;  1KSP A;  1S1T A;  4CJT A;  3LZJ A;  3IS9 A;  4HUF A;  1NK5 A;  2AJQ A;  1TK0 A;  3HST B;  1WNS A;  4IFY A;  4OKJ A;  3VA0 A;  1YT3 A;  3D0P A;  2HB5 A;  3OVN A;  4J2E A;  1UWB A;  1WSI A;  3PY8 A;  2E6L A;  1CXQ A;  2G8W A;  5CZ1 A;  3AA4 A;  4DFP A;  3OYM A;  1QQC A;  3IRX A;  4CJK A;  4OLA A;  4E1N A;  3KLH A;  4W5Q A;  3DRP A;  1S9E A;  3VN5 A;  4LSL A;  2A1R A;  3EZ5 A;  4LSN A;  2HVH A;  1ZYQ A;  2X78 A;  1RT2 A;  1O1W A;  2P51 A;  3IAY A;  4DTJ A;  4DSF A;  1RCH A;  1TKX A;  2VWJ A;  4I2Q A;  3P5J A;  3CFP A;  3DLH A;  3MXJ A;  3AVC A;  4FLX A;  1BCO A;  1WN7 A;  2PYL A;  3CYM A;  5C24 A;  3C6U A;  3S3N A;  3KD5 E;  3O3F A;  1QTM A;  3TI0 A;  4F8R A;  2GV9 A;  2FBY A;  2QXF A;  4CF2 A;  1WSH A;  1EX4 A;  2Z1J A;  4AHC A;  3E01 A;  3AO2 A;  1D8Y A;  4L8R B;  2YHB A;  1KVC A;  4GVM A;  3VQ8 A;  2ETJ A;  4O44 A;  3L2R A;  4Z0U A;  3JYT A;  1WAF A;  1HJR A;  4LY7 A;  2LSN A;  2DFF A;  1A5W A;  1TGO A;  2IGI A;  4CJQ A;  3K5M A;  2OA8 A;  4NCB A;  4C8K A;  1N6Q A;  1BIU A;  4FJM A;  1RBU A;  3RR8 A;  1RDC A;  4OKE A;  1ZBF A;  1YTU A;  1NK7 A;  3L2Q A;  1XI1 A;  4KHQ A;  1REV A;  1JLE A;  1KVB A;  1DTT A;  1RBT A;  4RW8 A;  4CF0 A;  2P5O A;  5CYQ A;  4FW2 A;  4Q5V A;  4M3U A;  4KO0 A;  1S5J A;  4M41 A;  5J1E A;  1VSL A;  1Y97 A;  3AO4 A;  3KLE A;  1RT3 A;  2Z1G A;  3AVK A;  3ZT1 A;  1A5X A;  3V9S A;  4E3S A;  4DTM A;  5D3G A;  2F8T A;  3AA5 X;  1KLM A;  3AA3 A;  1F21 A;  1T05 A;  2EHG A;  4N41 A;  4FK0 A;  1S6Q A;  4IG3 A;  4HHT A;  3L3U A;  2R7Y A;  4B9M A;  3RR7 A;  2OYQ A;  5J2N A;  2HW3 A;  5K14 A;  4DTN A;  1ITG A;  1T7P A;  3K5N A;  4DQS A;  4DS5 A;  4CGD A;  3KJV A;  2BE2 A;  4CHP A;  4M42 A;  4M3Z A;  4F3T A;  3TAE A;  2DTU A;  3AV9 A;  4NYF A;  1XC9 A;  2ZD1 A;  4DS4 A;  3G0Z A;  1X1P A;  2OPS A;  2Z1I A;  3BGR A;  3EYZ A;  4FJ7 A;  3EY1 A;  3VA3 A;  4DFM A;  1FK9 A;  3VQA A;  3ZT2 A;  3OYB A;  4DSE A;  4FXD A;  3A2F A;  1IKV A;  1Z26 A;  4NCG A;  3LZI A;  4HUG A;  4DSL A;  4MQ3 A;  1C6V A;  3F73 A;  4KAZ A;  2B4J A;  4ID5 A;  1RIL A;  4CCH A;  4GW6 A;  4HVJ A;  3SQ4 A;  3HPH A;  3OYD A;  4DQR A;  4YFU A;  3O4N A;  3V1R A;  3H08 A;  3DLB A;  3L2V A;  3TR8 A;  3HVR A;  3V81 A;  1SKW A;  2G8I A;  3DYA A;  1RBR A;  2VG7 A;  4Z4H A;  3I0R A;  3QEV A;  2P5G A;  2IAJ A;  3HT3 A;  3AVI A;  3HVT A;  1VK0 A;  3WNF A;  3RTV A;  2DY4 A;  2YKN A;  2XY6 A;  4CJ5 A;  1QSS A;  1U47 A;  4CFC A;  3ITH A;  5I42 A;  3NH0 A;  4FLT A;  1U45 A;  1NK6 A;  4NCA A;  2ITG A;  1NOZ A;  3OY9 A;  1S9G A;  3OS0 A;  1BI4 B;  4CGF A;  4OJR A;  1YTA A;  4FLZ A;  3MXI A;  1N5Y A;  4RW7 A;  1C0T A;  2RKI A;  1TKZ A;  1Z25 A;  4LH5 A;  4FLW A;  4F2R A;  4HCC A;  1TKD A;  1FXX A;  3OYH A;  3NHG A;  3ZT4 A;  1KLN A;  2XY7 A;  3VQ4 A;  3S3O A;  3NF7 A;  2BDP A;  3HK2 A;  1NK0 A;  3DLR A;  4FJK A;  4KHN A;  3B6O A;  3RMC A;  3ZSY A;  4DWI A;  1W9H A;  2KFZ A;  3SNN A;  4YNQ A;  4FJ8 A;  4LD0 A;  3LAM A;  2YHA A;  3D45 A;  4K8X A;  3K59 A;  3PUF A;  4BWJ A;  3AVA A;  2P1J A;  1NJX A;  2DFE A;  3WNE A;  3AO1 A;  3L2U A;  3G10 A;  1NJZ A;  3TAN A;  3VQD A;  1KFD A;  3P1G A;  3OS1 A;  1FKP A;  4BWM A;  4CHZ A;  3SYZ A;  4B9N A;  4FVM A;  4ZHR A;  1VSF A;  3TAG A;  5DK5 A;  2JLE A;  4B9V A;  5KGW A;  3SUQ A;  3PX4 A;  3THV A;  1X9W A;  1LWF A;  3ZSX A;  3SV3 A;  2HHQ A;  4W5N A;  3QLH A;  1CZ9 A;  4CEB A;  3FFI A;  3RMA A;  4ELV A;  4C8O A;  4PY5 A;  2Q3S A;  3V6D A;  1RT6 A;  3KKS A;  2EX3 A;  3HPO A;  2VG6 A;  1UA0 A;  4N76 A;  4OLB A;  2X6S A;  1UA1 A;  5CY4 A;  1QHT A;  3LPU A;  4CIF A;  4R5P A;  3OYG A;  4DTX A;  4CGG A;  4JS5 A;  3V9W A;  3HP9 A;  1TAQ A;  3DM2 A;  4TSX A;  4Y1D A;  2FBX A;  3K5L A;  2WON A;  4FM2 A;  4DTP A;  1LW2 A;  4M3T A;  3QEP A;  2W42 A;  1RBV A;  2E4L A;  1JKH A;  1RDD A;  3QEX A;  1HYV A;  2KTQ A;  4I7F A;  1HNI A;  4CJR A;  4IKF A;  3QES A;  4OGE A;  4OPJ A;  2FC0 A;  5FDL A;  4JS4 A;  1GOA A;  1S1V A;  3LDS A;  1B9F A;  4CJP A;  3MXM A;  1EP4 A;  4FJI A;  1SL1 A;  1JLB A;  1RTJ A;  4B08 A;  3NGZ A;  1U4B A;  3RRH A;  4O5B A;  4W5T A;  4ID1 A;  3U6F A;  3VQC A;  3O3H A;  4B9T A;  4FJX A;  1VRU A;  3ULD A;  3U3Y A;  3KTQ A;  4AHR A;  1WSG A;  2D0C A;  3PO4 A;  2OPQ A;  4CF9 A;  3ZT3 A;  2XHB A;  1LW0 A;  2XO7 A;  3ZSV A;  1JXE A;  4RG8 A;  4Z4C A;  1IKW A;  1LV5 A;  1YVU A;  3QO9 A;  3DLK A;  1RDB A;  1BHL A;  4KFB A;  5JS2 A;  2QK9 A;  1NKC A;  3M8P A;  2ZQB A;  3F9K A;  3V9X A;  4H8K A;  4CFD A;  2YNH A;  3HL8 A;  5HLF A;  3OYI A;  4CIG A;  4CJ3 A;  1ASW A;  5C42 A;  4FLV A;  4C8L A;  4FJ9 A;  2F8S A;  4KRF A;  4I9L A;  4CJF A;  2YV0 X;  1NK9 A;  1EKE A;  1KTQ A;  4B3O A;  3RWU A;  3V9U A;  1RT7 A;  1JLQ A;  2XY8 A;  2OPP A;  2VWK A;  3MEC A;  4IG0 A;  1TV6 A;  3TAF A;  4DTU A;  4E1M A;  3L3V A;  4O0I A;  3PX0 A;  5KTQ A;  4CEC A;  2FBV A;  3CFR A;  3LP2 A;  3TAM A;  1D5A A;  3OYF A;  2HNY A;  3NAE A;  4DSK A;  3DLG A;  3TAR A;  1BI4 A;  3K2P A;  1A5V A;  1QS4 A;  4CF1 A;  3V9Z A;  3S9H A;  1U48 A;  1XHX A;  4IDK A;  1QE1 A;  3T1A A;  1X9M A;  4J2A A;  4QCL A;  1JLC A;  1UOC A;  4BDP A;  1LWE A;  2RF2 A;  4DSI A;  1WSJ A;  4CK3 A;  2YNI A;  4IFV A;  3ZSW A;  1ZBI A;  2Y1J A;  2VG5 A;  3LP0 A;  3QIN A;  3ISN C;  2NUB A;  3HM9 A;  2D0B A;  4CE9 A;  5FRN A;  1DLO A;  1TVR A;  1HYZ A;  1BL3 A;  1S1X A;  3QIP A;  1WLJ A;  4N47 A;  4CHQ A;  1CXU A;  1TL1 A;  2BAN A;  3M8S A;  1L3T A;  2XRI A;  3OJS A;  4K8Z A;  4CJW A;  3O4Q A;  1SUQ A;  1ZBU A;  4FZY A;  2KW4 A;  3B6P A;  4E7L A;  1GOB A;  3V4I A;  4CK1 A;  3ZSQ A;  1VSD A;  4W5O A;  1C1B A;  3HO1 A;  3DLE A;  4BE1 A;  3KLI A;  3NF8 A;  4ELT A;  3VQE A;  1QSY A;  3ZSO A;  1SV5 A;  1DTQ A;  3NF6 A;  3KKR A;  1IH7 A;  4FW1 A;  4MFB A;  4OVL A;  4FM0 A;  3ASM A;  4E19 A;  2D5R A;  4HCB A;  1VSE A;  3NFA A;  4AIL C;  4ZTF A;  3T3F A;  3RRG A;  3UIQ A;  4KTZ A;  2G8H A;  1D9F A;  4HTU A;  1SL2 A;  4DF8 A;  1NK4 A;  3KK2 A;  1BQM A;  1ZBH A;  1ZBL A;  4KRE A;  5J2P A;  1CZB A;  2F96 A;  4H4O A;  3KLG A;  3VQB A;  3QET A;  4I9Q A;  4M3X A;  2HHV A;  3VQ6 A;  1CLQ A;  4CIE A;  1KCF A;  4EZ6 A;  3HYF A;  4ICL A;  5HBM A;  2QKB A;  4M3Y A;  5DMR A;  1BQN A;  3HPG A;  1WAJ A;  4HUE A;  1D9D A;  2DFH A;  3WNH A;  3I8D A;  2PZS A;  3IG1 A;  2HHU A;  4FJ5 A;  5JS1 A;  3I0S A;  4W5R A;  2IS3 A;  3DI6 A;  4CHN A;  4DQQ A;  3SUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...