4HUEA

Structure of 5-chlorouracil modified g:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
b'EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hueA00
1HJRA 2OPRA 1IH7A 3C95A 3G10A 3SV4A 4DFJA 1QSYA 4JRQA 4KRFA 3SUOA 4F3TA 1YT3A 4NYFA 3F73A 1TL3A 2PY5A 1I39A 5I3UA 3V9WA 1RBSA 1ZBLA 1RTHA 1W0HA 4CF9A 2B4JA 4M42A 4M3RA 4B9SA 1U47A 3TAFA 1C0TA 4RW9A 4RG8A 1JLFA 5J2MA 1S1UA 1RBTA 3ZSZA 4KTQA 3HP9A 3VQPA 1LAVA 5KGXA 1JXBA 1ASVA 4CCHA 3RRGA 3AA4A 4OGEA 4FLTA 3RRHA 3AVMA 3JYTA 1JLCA 3AO5A 3RMDA 1HPZA 1VSFA 3O3FA 4CHPA 4DU4A 1YTUA 4O55A 4N56A 4MQ3A 1QSSA 3C6UA 4HTUA 1RT3A 1HMVA 2DFFA 3CYMA 4DMNA 1CXQA 3AVBA 3M8SA 3THVA 2RKIA 3L2WA 3AA3A 4PUOA 3P1GA 4OLBA 3RR7A 1MU2A 3KJVA 3DRRA 3QLHA 3V4IA 4FJMA 1KTQA 4C8MA 5HRPA 3HP6A 3DLKA 4B9LA 1B9DA 2HNZA 3LALA 3V1OA 3RMCA 4FJXA 4F8RA 2HMIA 4E3SA 5J2PA 4F2SA 1K6YA 1SV5A 3ULDA 4B08A 3DLBA 2HHUA 4HUEA 1J9AA 1WLJA 2O4IA 4GW6A 4KI6A 3OJUA 1LWFA 3AA2A 3WNFA 3NH2A 3RMAA 1T03A 1TK8A 1O1WA 1VSKA 1UOCA 2B6AA 2E6LA 3SI6A 2VWJA 1S9EA 4KTZA 2ZE2A 1JKHA 1L5UA 5JS2A 2FBYA 1U45A 4F2RA 3HSTB 3SQ1A 4H4MA 3E01A 4W5QA 1HYVA 4E7HA 1LW2A 3ZSOA 3VQAA 3KLIA 1UA0A 2Z1IA 4DTXA 1X9SA 1J53A 2LSNA 4B9UA 1JLGA 3F9KA 3SUPA 4GMJB 4CE9A 1JLQA 3OYAA 1QS4A 2G8VA 2HHQA 3WNHA 5FRMA 4E19A 5JS1A 3OY9A 2FBVA 5J2NA 1Q8IA 4O4GA 4OKJA 5FDLA 1NJXA 3RR8A 3A2FA 3ASMA 3HYFA 2ITGA 2E6MA 1TKXA 3OVNA 4FLXA 4CJRA 4DFMA 3K57A 3S9HA 4OPJA 4KHQA 5I42A 2YV0X 3NH1A 1N6QA 2Y1JA 3OYCA 1RT7A 1L3SA 4QCLA 2QXFA 1IKWA 4CJ5A 1T7PA 4FM1A 3S3MA 1RT2A 3MEDA 3MEEA 4DTPA 2FC0A 1S1TA 4AHCA 1ZBUA 2PYJA 4J2DA 4E7JA 1NJZA 3EZ5A 2BGGA 1Z26A 1A5VA 4CESA 4KTWA 2BE2A 1C1BA 3D45A 1QSLA 3NF9A 4PA1A 1XHXA 4N47A 3L2UA 1JLBA 2HNYA 4NYNA 2HHTA 3NFAA 4ZHRA 4CEDA 2P51A 3LWMA 4DWIA 2VWKA 3VQDA 1SKSA 4DSFA 4CGGA 3DLHA 1EKEA 3CM6A 5K14A 4DS4A 2E4LA 3LWLA 1T05A 2YHBA 4M3WA 4OKKA 1RT4A 4QOZB 2YHAA 2KFZA 1S9GA 4CGHA 5J2QA 3SPYA 1CZBA 3LP0A 3SZ2A 1RTIA 5SWMA 2X6SA 1XWLA 4AHUA 3K5MA 3LAKA 2O4GA 1S6QA 3L2RA 5HRNA 3S3NA 1UA1A 2HW3A 3MEGA 4CEQA 1SL2A 3VQEA 2XY5A 4DU3A 3PX6A 3O3HA 3VQ8A 1VSHA 3LAMA 4FZYA 4E1NA 3AVGA 3NF8A 5T7BA 2P5OA 1YTAA 3CFOA 4DF8A 1KRPA 3O4QA 2JLEA 4OVLA 4EP4A 4DF4A 3QEVA 1L3UA 2ZD1A 1C1CA 4ID1A 1SKWA 2OZMA 3D0PA 4CF2A 1ZBHA 1G15A 3ALYA 3IG1A 4CJKA 1TAQA 1RT5A 4BDZA 4DTMA 3OYEA 2BDPA 2FBXA 4CHYA 3U6FA 4RW4A 4M3ZA 3K59A 3OYMA 3TWHA 5C25A 4PQUA 2G8IA 3OYGA 1BQMA 1NK4A 1WSGA 1BI4B 1EETA 4DTOA 1C0UA 1TK5A 3AVAA 4DTRA 1WSFA 3TI0A 2Z1GA 4CEZA 4N41A 2KZMA 4OJRA 4ELTA 4BE1A 2ATQA 1RTJA 5DMRA 4CJQA 3MXJA 4MFBA 1LWCA 4O0JA 1X9MA 3RWUA 3QIOA 2XHBA 1WAJA 4TSXA 2XO7A 2P5GA 3LDSA 4FCYA 2P1JA 4AILC 3IAYA 4KKOA 4JS5A 1S1VA 3L2VA 3TAPA 4DSJA 2GBZA 4O0IA 1JLEA 2D0CA 3KKSA 4CGDA 3NHGA 4I9LA 2OPPA 1F21A 4IBNA 4CIGA 5C24A 1NK6A 2QKBA 2X74A 1NK7A 3OYHA 3TAEA 3MXMA 3CQ8A 3G0ZA 1RNHA 2XY8A 4KB0A 4KV8A 3NBPA 4CGJA 1RT1A 4DS5A 4CFBA 4LSNA 5CYMA 4CEOA 4I2QA 1S1WA 3B6PA 3CM5A 4FJHA 1BIZA 2ZQBA 3CG7A 3V9UA 1C0MA 1DTQA 3WNEA 4FJ8A 1ZBIA 3DLGA 1FXXA 4H4OA 2VG6A 3VQQA 4FLWA 3SQ0A 4WE1A 3HJFA 2D5RA 1NKEA 4AH9A 3MAQA 1R0AA 4I9QA 2KQ2A 1ASWA 4IFVA 3AVKA 4CF0A 3HPOA 4ICLA 3S3OA 4FK0A 3DMJA 4IG0A 3L8BA 3LANA 3T3FA 1U48A 2YNHA 1VSEA 4DSIA 4FK4A 4W5NA 4RW7A 3UIQA 3IRXA 4M45A 1QTMA 3I0RA 3L3UA 1TV6A 4BWMA 3CFPA 1VSLA 1XI1A 4Z4IA 4C8LA 3ITHA 1CLQA 3ZCMA 4CK1A 4CFDA 1IO2A 4DQRA 4I2PA 2NUBA 1HRHA 4CEEA 2EX3A 2IOCA 1REVA 3QNNA 3TAMA 1U4BA 4CEAA 4CFAA 1TAUA 4DFKA 1FKOA 2IS3A 3QEPA 3M8QA 4KHSA 2G8WA 3AO2A 4B9TA 4Z4EA 4CIFA 4O44A 3V9ZA 4K8ZA 2X6NA 3V81A 3L3VA 3ZT2A 3U3YA 2YNIA 4JLHA 3BGRA 1L3TA 3VQ6A 2YKNA 4DTUA 4RW8A 3DLEA 3SJJA 4ZTFA 4HCCA 2HHXA 4FJGA 4B8AB 3ZSVA 3ZSRA 3OYJA 3M8RA 4CJUA 3K5NA 4DLEA 4RW6A 3OYBA 2Z1HA 4FJ5A 5KI6A 3OJSA 1HYSA 4N5SA 4FLVA 4FJJA 4B9NA 3LZIA 3AV9A 3HVRA 1TK0A 1KCFA 3SCXA 1QE1A 1UAXA 1W9HA 4KHYA 4W5RA 3OS2A 3T19A 3CFRA 4CJ3A 3PV8A 3AA5X 4C8NA 1NK9A 2OZSA 4F4KA 1YVUA 4C8OA 4Q5VA 3QEWA 2B5JA 4KPYA 2JGUA 3ISNC 3NGZA 1IKVA 4E0DA 3P5JA 5E41A 3QNOA 4Q0BA 4FJ7A 1WSEA 3V6DA 4N76A 4FK2A 4KAZA 3V9XA 4ELVA 1NKBA 4FW1A 4ID5A 4BACA 3K5OA 4KB1A 4CEBA 4CHZA 1NKCA 1VRUA 3AVNA 1HYZA 3PUFA 3VN5A 3KLGA 3QEIA 1D9DA 4DTNA 2A1SA 3M8PA 2GV9A 2OA8A 3DRSA 3OS0A 4FJNA 1BHLA 3KKRA 3KK1A 1C1AA 4W5OA 2IC3A 3MXIA 3VQ5A 3AVLA 2OYQA 3C94A 4FJLA 1RDAA 5J1EA 3KK2A 1BIUA 4L8RB 4CJEA 3LZJA 4YFUA 4E7LA 1NK0A 3HT3A 4CEFA 2HNDA 3K5LA 4M3TA 1KFDA 1VSJA 2HHVA 2IDOA 1T8EA 5HBMA 2PYLA 1KVCA 4CJVA 3VQ7A 3DLRA 5KTQA 4CERA 2G8FA 2KFNA 1HNIA 4LH5A 2GUIA 4CFCA 4CGIA 4BE2A 4K8XA 1BGXT 3IS9A 2HHWA 3TR8A 4J2AA 2KW4A 3V1QA 4G1QA 2FBTA 4IFYA 1RBVA 3SUQA 4ZTJA 3V1RA 2OPQA 4FLZA 5DK5A 1Q9XA 4J2EA 2RN2A 1A5WA 1EX4A 4Z4FA 3PO5A 4QAGA 2I5JA 3EY1A 1B9FA 1BQNA 2D0BA 1L3VA 1TKZA 3KTQA 4EZ6A 4F3OA 2WONA 1S1XA 3HO1A 1EP4A 3QIPA 4NCBA 4KHWA 4AHVA 4IG3A 4CF8A 3PX4A 2OPSA 3TANA 3VQCA 1CZ9A 3MECA 4NCAA 3KD1E 4KREA 3LP3A 3DOKA 2WOMA 2R7YA 1RDBA 4CJPA 2AJQA 3NF7A 4B9VA 2HHSA 2YNGA 4CJ4A 3TAGA 3DYAA 3KLFA 1VSIA 1QQCA 4DTJA 3WNGA 3OYKA 3HXMA 2D0AA 3DM2A 3VQ4A 5HROA 1D8YA 2QK9A 1VSMA 4DFPA 3EYZA 3OYDA 3SQ2A 1Y97A 3KD5E 1KSPA 5FRNA 4DQSA 3ZSQA 1SKRA 1NOYA 1DTTA 2EHGA 3AO1A 4CJTA 4JS4A 4DLGA 3VA0A 1KLNA 1U49A 1RT6A 1UWBA 1Q9YA 1ITGA 1WSJA 1BCMA 4E89A 1I3AA 3ZT4A 1RDCA 1GOBA 3HVTA 4BWJA 4AHRA 4KHUA 3TABA 3TARA 4UQGA 1ZYQA 3AVJA 2G8UA 1XC9A 1DLOA 3U3GA 4CHNA 1WSIA 2RPIA 5CZ1A 3PY8A 1ZBFA 4DTSA 3QERA 5SZTA 5HP1A 2IGIA 4ELUA 4FZZA 3ZT1A 1JXEA 1TL1A 2IAJA 3HPHA 1D5AA 1U04A 4GVMA 4FM0A 5KGWA 4CF1A 4HCBA 3HK2A 3KIOA 1RBRA 2YNFA 1IKXA 1S6PA 2XRIA 3AO4A 5EU7A 4YNQA 3FFIA 3AVFA 3AVHA 3K2PA 3NH0A 3RTVA 4E7KA 4PWDA 1WNSA 3T1AA 4FJKA 2DFEA 2VG7A 3ZSXA 4B9MA 1LWEA 4EP5A 2G8KA 4FXDA 4Y1CA 4DU1A 1NJYA 4Z4CA 4DQPA 4CHQA 4CHOA 1IKYA 3P83D 3O3GA 1BI4A 3AO3A 3AVIA 2VG5A 3SYZA 4KHNA 1A5XA 3LP1A 3NGYA 4CIEA 1NK5A 3ZT0A 3LP2A 3VQ9A 2XY7A 3SUNA 1LW0A 1RTDA 4FW2A 3I8DA 3DRPA 1X1PA 4AHTA 4M3UA 5C42A 2HVIA 3B6OA 1Z25A 3OYFA 4FVMA 1BISA 1RBUA 3H08A 3QINA 3VQBA 4R5PA 4LY7A 4FM2A 2KZZA 3HL8A 4KFBA 3V9SA 3RMBA 4B3OA 4FYDA 1BCOA 1RCHA 1TGOA 4M3XA 1HNVA 4IDKA 5CZ2A 4KO0A 4H8KA 3NF6A 4BDPA 4PY5A 3NDKA 1KLMA 4LH4A 4CJLA 3QETA 4FLUA 2F8TA 2DFHA 1FK9A 4E1MA 1VK0A 4HUGA 1LAWA 1J54A 4J2BA 1WSHA 3L2QA 2Q3SA 3I0SA 1RDDA 4LSLA 4B8CA 4CK3A 1JL2A 1J5OA 1ASUA 3QESA 3AVCA 4KI4A 1GOCA 4FZXC 4DG1A 1TKTA 4JRPA 1NK8A 3BDPA 5D3GA 5KRSA 2DY4A 1N5YA 4I7FA 3QO9A 5HLFA 1TKDA 3JSMA 3SPZA 1HQUA 4DQQA 4OLAA 1SUQA 2KTQA 4CGFA 4HUFA 3SV3A 2G8HA 5KRTA 3NAEA 4DSEA 3HM9A 1JLAA 3ZSYA 2W42A 3SNNA 1GOAA 3HPGA 4FJ9A 4AHSA 1SL1A 4M41A 3K58A 4C8KA 2Z1JA 3LPUA 2A1RA 1JL1A 2PZSA 4FJIA 1TVRA 3OYLA 4OPKA 3KLEA 1IG9A 4CJSA 3PX0A 4Y1DA 4CJWA 1SL0A 3NE6A 3OS1A 5CY4A 3QEXA 4M3YA 3ZSWA 1HQEA 1QHTA 3ZT3A 1D9FA 1KFSA 4EZ9A 4Z0UA 3SQ4A 1VSDA 4E7IA 1KVAA 3DI6A 3OYNA 4O5BA 3VA3A 1BL3A 1XHZA 1X9WA 4DSLA 2XY6A 1NJWA 1NOZA 3DOLA 4HHTA 1FKPA 5FROA 4IKFA 1B92A 2F96A 3KK3A 2HVHA 4XIUA 5CYQA 3LPTA 3NCIA 2F8SA 3OYIA 2BANA 4LD0A 4Z4HA 2QKKA 4Z4GA 4HVJA 2Y1IA 3TAQA 3C6TA 4OKEA 1EXQA 5HRSA 5HRRA 4CK2A 2X78A 1VRTA 2YKMA 1C6VA 3O4NA 1RILA 1S5JA 4CECA 3KLHA 4BDYA 4FLYA 1WAFA 2HB5A 4DQIA 2RF2A 4OGCA 4BE0A 1CXUA 4CJFA 1LV5A 3PO4A 4DSKA 3NGIA 1WN7A 2ETJA 4W5TA 4NCGA 2DTUA 1KVBA
chains in the Genus database with same CATH superfamily
1HJRA 3C95A 3G10A 3QFPA 2FXUA 3SUOA 3J80O 1ZC6A 2PY5A 2A6AA 1I39A 4M3RA 1U47A 4KTQA 3HP9A 1LAVA 3T1HK 3S41A 4CW7B 3OTOK 3QDKA 1FW6A 4FLTA 1RFQA 3JYTA 1JLCA 3RMDA 3CMEN 3G71N 3C6UA 3J8AA 1HMVA 3THVA 3NMUA 2DPNA 1S72N 2RKIA 3L2WA 5KPTA 4PUOA 3P1GA 4OLBA 3RR7A 1MU2A 3DRRA 3V4IA 3RMCA 4F2SA 1X3NA 1K6YA 3WXIA 5AZIB 4IOCL 3ULDA 1J9AA 4ILGB 1NBWA 3OJUA 4DQ8A 1VQ7N 1TK8A 1QQOA 3NVKA 4YOVA 1UOCA 3VEWA 4NLCA 2A3ZA 2ZE2A 1JKHA 3C0BA 3I55N 2OCEA 3SQ1A 4W5QA 5JICA 4H0TB 4LC9B 1UA0A 5E26A 2Q0UA 2E88A 3FZFA 4GMJB 4CE9A 3GG4A 3WNHA 4DV0K 2ZWHA 3KWGA 4O4GA 3ASMA 1XC3A 3MCAB 3S9HA 2CGLA 3K57A 4JKDA 2YV0X 1N6QA 3OYCA 1RT7A 1L3SA 3EEQA 4CJ5A 3HOSA 1T7PA 3GOIA 3MEEA 5M1NA 4DTPA 2FC0A 2PYJA 1ZBUA 3C7NA 4A61A 1Z26A 3DXKA 4CESA 3D45A 1EO1A 4JKGB 3BF1A 1JLBA 4MO5A 3LWMA 2YCHA 2O8BB 4NB4A 4DSFA 3DLHA 2UU9K 2FLOA 1T05A 2P9UA 1Z6RA 2YHAA 3OW2M 3SPYA 1CZBA 5SWMA 1XWLA 5HRNA 2HW3A 4H0VB 3VQEA 5EVZA 1HKBA 2W40A 3PX6A 1NLVA 3R9PA 4DR5K 4H0XB 3AVGA 3NF8A 4BRLA 1KRPA 2JLEA 3QEVA 1L3UA 2ZD1A 1C1CA 2GWKA 1ZBHA 1G15A 1GLCG 5BRFA 4DTMA 1RT5A 3WXMB 4FWMA 4XH4A 3OYEA 3QB0A 3U6FA 4JNEA 2Q36A 4DV2K 1U2VA 3OYMA 4GKKK 2D4WA 1VHXA 4DTOA 1EETA 3GBTA 3F2KA 2Z1GA 5DM6L 3GE1A 4JK9A 2ATQA 3A5NC 1X9MA 3RWUA 1WAJA 4TSXA 1E4GT 2QM1A 2O8FB 4JS5A 1S1VA 4DSJA 2E2QA 4MLHA 3EE9A 4IBNA 2NZTA 3IMXA 2X74A 1NK7A 1XNRK 2XY8A 4BR5A 1QHAA 2ZGZA 5EOYA 4HWIA 3SAGA 3NBPA 1RT1A 5CYMA 2KHOA 5A2QO 4FJ8A 1FXXA 2HMPA 2VG6A 4M7YA 4PL7A 4X65K 1NKEA 4AH9A 4A2AA 1ASWA 4IFVA 4BY9C 1QZ6A 4ICLA 3S3OA 5JMVA 3O8MA 4RW7A 4DV1K 3JXUA 1XI1A 4JAXA 1CLQA 3RSEB 4K0KK 1IO2A 4DQRA 2NUBA 4C1NI 3TAMA 4CFAA 2VGMA 4HTLA 2CGKA 2NRRA 3CPWM 4MO4A 3IFRA 5TKYA 4CIFA 3N4PA 4O44A 1TUYA 2X6NA 1L3TA 4CZIA 3BGRA 3SJJA 4ZTFA 3DLEA 1VQMN 2E2PA 3M8RA 4FJ5A 4CJUA 3SAFA 3A5LC 5KI6A 4FOIA 3MMVA 2VQFK 1HYSA 4CZFA 2UUAK 2ZJQL 3LM9A 1UAXA 1W9HA 4KHYA 4W5RA 3K9JA 3PV8A 3AA5X 3QICA 2ITMA 1M90O 2NRXA 5GAEP 4Q5VA 1VQLN 4KPYA 4KH6A 5E41A 4BRIA 4FK2A 4KAZA 4ELVA 1NKCA 1HYZA 2A1SA 5BREA 3O9RA 4FJNA 3KKRA 1GLDG 3PIPL 1RDAA 4JKFA 3KK2A 4L8RB 5IWAK 3HT3A 4H5WA 3T7ZA 3K5LA 3CIPA 4FWRA 2A40A 4K8XA 2E2OA 3IS9A 3CJ9A 3MN7A 1N36K 2ASPA 4FLZA 1A5WA 5AJ3K 1OKJA 1I94K 2D0BA 2WONA 4YY3K 5GADP 4AHVA 4CF8A 3PX4A 4NCAA 3VQCA 1CZ9A 3KD1E 1T44A 2D0OA 5BPLA 5LJWA 2P9KA 4MLEA 2HHSA 3UKRA 3DXKB 2GX9A 4CJ4A 3PSIA 3C6AA 3WNGA 1D8YA 3DM2A 3WT0A 2QK9A 5B8HA 1OH7A 4YOXA 1SKRA 2Q1NA 3ZSQA 2EHGA 5M1PA 1RT6A 2F4VK 1UWBA 2YJFA 4GY2B 5M1KA 2P9UB 3H45C 4E89A 3ZT4A 1RDCA 5AQRA 3CC7N 3I56N 4UQGA 2YHXA 2G8UA 3U3GA 2RPIA 3CC2N 4H5RA 1VQ8N 3QERA 4ELUA 4EIAA 5C0YA 2NNWA 2IAJA 5ADXA 4HCBA 5KGWA 1RGIA 3H46O 3RTVA 3CJCA 4B9MA 3A0IX 4FXDA 5C2FA 3H1QA 4Z4CA 4DQPA 2BUPA 3D2FA 1O13A 5AQPA 1S3XA 3J81O 1A5XA 4G9ZA 4IJNA 1LW0A 4AHTA 3JS6A 1Z25A 4C23A 3OYFA 3MCPA 4FM2A 3RVCA 1GLFO 3V9SA 4FYDA 1BCOA 1RCHA 2QW9A 4BR0A 4CZLA 5CZ2A 4H8KA 1T6CA 3NF6A 4PKIA 2DFHA 1FK9A 4E1MA 3D2EA 1WSHA 2Q3SA 3I0SA 4B8CA 3BZKA 1GLAG 3E9LA 3AAQA 1VQPN 4FWOA 4KI4A 3AVCA 1WUAA 2GEMA 3VETA 4DG1A 3Q7BA 1JJ2M 3BDPA 5KRSA 3THXB 4I7FA 3JSMA 4DQQA 2KTQA 4IZ9A 3VEYA 1QVGM 2W42A 1QZ5A 4B3TK 3AGKA 3QFUA 2E20A 3HRGA 4OPKA 3U4LA 4CJSA 4WQ4C 4JEPA 3IDHA 1NGJA 4E7IA 1XHZA 4O5BA 2XY6A 4BROA 4HHTA 4IKFA 1B92A 2HVHA 1VQ6N 5CYQA 3LPTA 5GAHP 2BANA 4LD0A 4Z4HA 5AQHA 2O8DA 4HVJA 2Y1IA 3C6TA 3CJBA 5HRSA 1N8RO 4BDYA 3KLHA 2HB5A 3O4WA 4BR7A 4BE0A 1CXUA 2QEXN 4CJFA 3PO4A 3CCLN 3SMSA 4W5TA 1KVBA 1BG3A 1FJGK 3VGLA 1YT3A 3V9WA 1RTHA 1J6ZA 4B9SA 3TAFA 3O9TA 4BRCA 4RW9A 4RG8A 5J2MA 1S1UA 5FPEA 4DR3K 3ZSZA 2P9IA 3VERA 3VQPA 4DV5K 4LF9K 3QBXA 1ASVA 3DWLA 3AA4A 4OGEA 1Q18A 2O8EA 1BA1A 3AVMA 5AQIA 1HPZA 4CHPA 4DU4A 4O55A 4MQ3A 1QSSA 4HTUA 1RT3A 4DMNA 3G4SN 1JCFA 3AA3A 4CZMA 3LDQA 4FWLA 4FJMA 1KTQA 5HRPA 5E84A 3HP6A 5JVHL 1NGHA 2HMIA 5J2PA 2P9LB 1SV5A 2HHUA 4HUEA 4DR7K 1Z05A 1WLJA 1LWFA 1T03A 1M1KO 3NH2A 3RMAA 1EQYA 4RCHA 2B6AA 2VWJA 1L5UA 4F2RA 5JS2A 4H4MA 5AQSA 1LW2A 3KK7A 2IVPA 3AAPA 4H0OA 4LFAK 4IEEA 2CGJA 3ID6A 2P9NA 2G8VA 3F9MA 5FRMA 4E19A 3C65A 3O9UA 5J2NA 1Q8IA 4DB3A 5FDLA 2VCPA 1NJXA 3K9KA 3HYFA 3OVNA 2E6MA 1TKXA 4FLXA 3U8XA 3TSPA 5I42A 3CCRN 4QCLA 2QXFA 1T3VA 3MEDA 1SQKA 1E3MA 2YHWA 5F0XA 4PA1A 3L2UA 2QWPA 3NFAA 2HHTA 4DWIA 5C2DA 2VWKA 3VEVA 1SKSA 4IEIA 3AGRA 3H3NO 3CJ7A 5AQUA 4O8UA 5AQVA 4BRGA 2UXDK 2YHBA 1RT4A 4BRFA 2KFZA 5AQNA 4KH4A 1S9GA 4GV9A 3LP0A 2X6SA 4AHUA 5M1OA 2J4RA 2O4GA 4JI4K 3S3NA 2CH6A 5H1SQ 1N32K 3MEGA 4CEQA 3W0LA 4FZYA 3LAMA 5AFUH 3SMPA 2P5OA 1W2BM 3VF4A 4EP4A 2PYLA 2OZMA 1SKWA 1IBLK 5FPMA 3CD6N 2P9PA 3ALYA 4CJKA 3FGUA 4BDZA 3HZ6A 2QA4N 2FBXA 3SBTA 3K59A 4U67L 5C25A 4LF8K 4PQUA 3EKSA 1WSGA 1KAYA 4N41A 4DTRA 3TI0A 4CEZA 4ELTA 4BE1A 2QWOA 3R6MA 4A59A 3MXJA 4O0JA 3QIOA 2P5GA 2QWLA 2FF3B 3LDSA 2HBLA 3IAYA 2QWMA 3ZYYX 4KKOA 4NXMK 3FZKA 3KKSA 3NHGA 2VGNA 1KQSM 1F21A 2OPPA 5AR0A 3CCUN 3O9QA 4JK7A 3D2EB 3MXMA 3PSFA 1RNHA 1NGEA 3I33A 1YUWA 4DS5A 2HF4A 1GLEG 4I2QA 5BPMA 3V9UA 2NRWA 4BRQA 3WNEA 3VQQA 3SQ0A 3HJFA 4WE1A 4BR4A 1GLJO 4BRDA 4PHTX 4U7BA 4FK0A 2E5LK 4IG0A 3L8BA 3LANA 1U48A 4W5NA 4FK4A 3ZETA 1ATRA 3BF3A 5F1XA 3FZLA 3IRXA 4M45A 3UIQA 1Q86O 1NGFA 4JD2A 4Z4IA 3CHWA 4CK1A 4WF9L 4DR4K 4IO9L 3THWA 4I2PA 2O8DB 2IOCA 1HUXA 3W3DA 3CQXA 4X62K 3WXLA 3THYA 4H5VA 4JI2K 1LCUA 2IS3A 3QEPA 4K8ZA 4WFNL 2EWSA 3MN9A 4JLHA 1VAZA 4FJGA 4B8AB 3K5NA 3ZSRA 3OYJA 4DLEA 4RW6A 3HOTA 3PLAA 4CZHA 5BN9A 4FWPA 4N5SA 4FLVA 2PBDA 4FJJA 2QI2A 3SCXA 5AZJA 2P9IB 3OS2A 4CJ3A 5LMNK 3ZEUB 4BRMA 4F4KA 3D7EO 3O1BA 3VEZA 3QNOA 5AQKA 4Q0BA 1HPMA 1WSEA 3ZX3A 4CBWA 3CXCM 3G25A 1HKCA 3V9XA 3VOVA 1NGIA 4CHZA 1VRUA 3AVNA 4I6MA 3VGKA 4DTNA 3M8PA 3CETA 2GV9A 3DRSA 3OS0A 2QXLA 1BHLA 1C1AA 2IC3A 1YJ9N 4FJLA 4YDUA 1K8AO 1BIUA 1Q81O 4CJEA 4AM6A 4YFUA 4E7LA 3J7ZO 4M3TA 2IVOA 3JAMO 4EHTA 2HHVA 3MN6A 2I7PA 4CJVA 3VQ7A 4AM7A 3DLRA 5KTQA 4BGBA 4CERA 1GLLO 2KFNA 4DUYK 4BE2A 4CFCA 3M6GA 3V1QA 1RBVA 2P9NB 3SUQA 2OPQA 1Q7YO 3P31A 2I5JA 5EX5A 1BQNA 5LL6Z 1L3VA 4DCHA 1TKZA 4EZ6A 5KQDA 5KQ8A 3WXJA 1S1XA 1EP4A 4KHWA 2E8AA 4IG3A 3MECA 1N33K 4BR2A 4EHUA 3DOKA 4IJAA 4B9VA 4IDHA 2YNGA 3DYAA 1VSIA 1QQCA 2WBNA 4B9QA 3HXMA 4CZEA 3TU5A 3H6EA 5HROA 5AQLA 4DFPA 3EYZA 3SQ2A 1VQ4N 1KSPA 4DQSA 1DTTA 3AO1A 1WSJA 1GOBA 2HF3A 5FPDA 4JKCA 4WFBL 3TABA 5BR9A 1WSIA 2ZGYA 2PFUA 4K41A 4K25A 2IGIA 5BN8A 1JXEA 4FL9A 4CF1A 3KIOA 1RBRA 1IKXA 1HR0K 3AVHA 1SS6A 2W6LA 3CCSN 4EP5A 3O9SA 4O8KA 3CCVN 2G8KA 4DU1A 1NJYA 2P9PB 4CHQA 4CHOA 1NMNA 1QQNA 3NGYA 1HKGA 3CI5A 4BRAA 1NK5A 3VQ9A 2XY7A 3SUNA 1X1PA 3R1XA 4M3UA 4ISFA 3ATUA 3QINA 2KZZA 4KFBA 4A57A 4B3OA 4JN4A 1TGOA 4IDKA 4WCEL 4KO0A 4BDPA 4BRPA 4PY5A 4IWVA 1KLMA 4LH4A 1HJOA 4O5FA 1BOTO 4FLUA 2F8TA 4J2BA 2V51B 4JKEA 2GWJA 3EO3A 3QESA 4KH5A 1GOCA 3LDPA 4JRPA 2DY4A 3T1YK 3QO9A 5HLFA 5BRDA 1TKDA 3SPZA 1HQUA 4BG9A 2YI1A 1YHQN 2G8HA 1BUPA 4DSEA 4FJ9A 1SL1A 3MWTA 4M41A 3K58A 2A1RA 3LPUA 4FJIA 4L3QA 1TVRA 4J8FA 1IG9A 1CZAN 3PX0A 3OS1A 1QHTA 1KFSA 4KHPK 3SQ4A 1KVAA 3VA3A 1BL3A 1X9WA 1NJWA 3DOLA 3N4QA 2CH5A 4BC5A 2F96A 3ZETB 3KK3A 4XIUA 1SAZA 1YXQA 3NCIA 3OYIA 4LF7K 1LOTB 3HI0A 4FPBA 4Z4GA 3CJ1A 4KBOA 1EXQA 5HRRA 1SZ2A 4JD2B 1VRTA 2X78A 2YKMA 4B1XB 1RILA 1S5JA 4CECA 1WAFA 4DQIA 1IG8A 4MDAA 3NGIA 3NAEA 3HPGA 1WN7A 3E1YA 3CCMN 4E7KA 3THYB 2QWNA 4FJKA 2OPRA 4DFJA 1QSYA 4JRQA 3AY9A 3ZX2A 4F3TA 4NYFA 3F73A 1TL3A 5I3UA 1ZBLA 2WTUA 3C7NB 4CF9A 1X3MA 4BRKA 5CHIA 1C0TA 2FSKA 1XNQK 1ATNA 1RBTA 3M5RA 3VESA 5KGXA 3RRGA 3CJAA 3ZLJA 3RRHA 5AZJB 3AO5A 4N56A 3E9PA 1OH6A 3H1VX 1CXQA 4PL8A 3U9DA 3M8SA 3UKUA 3P38A 4BREA 1ILYA 2JWKA 3VF6A 5JVGL 1B9DA 2HNZA 3LALA 3DLLL 4FJXA 4WYBA 4I6MB 2NLXA 3DLBA 4B08A 1NJIO 3D6RA 3P39A 4OPHA 4AQYK 2O4IA 3WNFA 1VSKA 3O5BA 5C12A 3EN9A 1U45A 2FBYA 1S22A 3E01A 2NRTA 1HYVA 3DJCA 1D4XA 3KLIA 1U2VB 1X9SA 3LM2A 1J53A 4B9UA 1JLGA 4JYAK 3CCJN 1JLQA 1QS4A 2OANA 2IVNA 2FBVA 4OKJA 1TYQA 3RR8A 3A2FA 3K0SA 1C0GA 4CJRA 4DFMA 4OPJA 3M3ZA 3VENA 3NH1A 2Y1JA 3MN5A 1YJNN 1IKWA 3EKUA 4CZGA 4FM1A 3S3MA 5M1FA 1RT2A 1S1TA 4AHCA 4J2DA 4E7JA 1NJZA 3EZ5A 2OTLN 3ENOA 5FPNA 2BE2A 1QSLA 4ISGA 1XHXA 3UE5A 2HNYA 4NYNA 4ZHRA 1ATSA 4CEDA 4R79A 4CGGA 1EKEA 4DS4A 5K14A 2E4LA 4FWSA 4JV5K 4QOZB 1BA0A 5FLXO 4CZJA 4WFAL 4V19S 3FLCO 1UA1A 2XY5A 4DU3A 3O3HA 5AQXA 1VSHA 1QVFM 4IFEA 2UUBK 2V7YA 1YTAA 3CFOA 4DF8A 3O4QA 4DF4A 4ID1A 1JCEA 3D0PA 4QS7A 3IG1A 1TAQA 1MWKA 2VQEK 4RW4A 3VGMA 5ELZA 1U6ZA 2D0PA 4FOEA 1C0UA 2ASOA 1TK5A 3AVAA 1NGBA 1OVYA 4OJRA 5DMRA 4M7XA 3R3LA 4CJQA 4MFBA 1Q82O 1NGGA 1WBBA 2HOEA 4FCYA 2P1JA 4AILC 4KHSA 4XH5A 2A5XA 1K8KA 4O0IA 1JLEA 4I9LA 5CE3A 5MLCQ 3L4QA 4CIGA 5C24A 1VQON 2QKBA 4JKGA 3TAEA 3CQ8A 3G0ZA 4M63C 1DEJA 1TUUA 3IKMA 3B6PA 3CG7A 1C0MA 1ZBIA 3DLGA 4DHYA 5AQZA 4FLWA 3A5OC 2NRZA 2KQ2A 4K42A 5AQOA 3A8YA 3AVKA 4CF0A 3T3FA 4DSIA 2YNHA 1VSEA 4FPAA 1QTMA 3SK3A 1TV6A 4BWMA 3CFPA 3TTFA 1KAZA 3ITHA 4BC3A 4EFHA 2EX3A 4DR6K 2YX6A 1REVA 4C1NK 3VEXA 3EE8A 1TAUA 4DFKA 1FKOA 4B9TA 3V9ZA 4YORA 3V81A 3L3VA 3VQ6A 2YKNA 1NNEA 1ESVA 2HHXA 4H0YB 4HCCA 3ZSVA 4CI6A 3OYBA 2Z1HA 4IOXA 3OJSA 1K73O 2ZF5O 2RHKA 2P9KB 3BZCA 2UYTA 4B9NA 3UKRB 1NGAA 2ZJRL 1KCFA 1QE1A 3CFRA 1N34K 4C8NA 1NK9A 2OZSA 4CD3A 1YVUA 4C8OA 3QEWA 4FVUA 2B5JA 4QS8A 5C15A 1ZBSA 3ISNC 3NGZA 1IKVA 1R59O 4E0DA 1OH5A 4FJ7A 1YJWN 3V6DA 4N76A 2QWQA 3QMLA 1DKGD 2HBMA 3UKUB 1HNZK 4ID5A 3VN5A 1Y64A 3CCQN 1WOQA 3KK1A 4W5OA 3VQ5A 3AVLA 2H3GX 4UY8O 3SBGA 3VEOA 4AF1A 3LZJA 5DM7L 4XH1A 3TSQA 4CEFA 3E9OA 5KPRA 3P4IA 2IDOA 1KVCA 3D2FB 1HNIA 4LH5A 2KKZA 1BGXT 2HHWA 3TR8A 4J2AA 2KW4A 4G1QA 2YJEA 1NG9A 4A2BA 1Q9XA 2JWLA 2RN2A 5AQFA 4Z4FA 4ILJA 1TYQB 4JI6K 3EY1A 4DKWA 3KHYA 2OTJN 3KTQA 4LF4K 3QIPA 3VPZA 4KREA 2OPSA 3LP3A 2QTDA 3WUHA 3EL2A 4YOYA 3TAGA 3KLFA 3ZX0A 4DTJA 2Q97A 3BEXA 2AP1A 1W7AA 3VQ4A 5AQWA 4GNIA 3SJHA 1Y97A 2ZM6K 3KD5E 2PAVA 5F2RA 1IBKK 4CJTA 1IJJA 4BR9A 4DLGA 3VA0A 5C10A 4CJ7A 3CPEA 2BH1A 2FSNA 3G6EN 2ASMA 4BWJA 4AHRA 2NRHA 3TARA 1XC9A 1DLOA 3PY8A 3ULEA 4DTSA 4FZZA 5SZTA 1HNWK 3TSUA 3VMFB 1TL1A 1D5AA 4GVMA 4FM0A 1KXPA 1S6PA 5EU7A 3NH0A 4JI1K 3HBTA 1YIJN 4BG8A 4A5BA 2DFEA 2VG7A 2HHHK 1HNXK 1LWEA 4PKHA 1W97L 3MWPA 1BI4A 3AO3A 3AVIA 3SYZA 4LF6K 3LP1A 3TTDA 4OPAA 3ZT0A 2O8CA 3LP2A 4JI5K 4A5AA 4B3RK 4FW2A 3I8DA 4GVEA 2UUCK 5C42A 2I7NA 2HVIA 2F7TA 3EZWA 4FVMA 3H08A 3VQBA 3WQUA 1HNVA 3TPQA 5AQYA 5EY4A 4JI0K 3NDKA 1MDUB 5JLFA 4HUGA 1LAWA 1J54A 1K8KB 4CBUA 3L2QA 2O8EB 4LSLA 1RDDA 1J5OA 4JI8K 1JL2A 3J7AP 4JKBA 3FZMA 2W41A 4DV7K 4JKHA 4FZXC 3A5MC 3KVGA 1TKTA 1NK8A 5D3GA 2WC9A 5AQTA 3C6HA 1YAGA 2A41A 5KRTA 1NMDA 3BUZB 3HM9A 3ZSYA 2P9SA 2Z1JA 2PZSA 3SAHA 4CJWA 5AFUA 4M3YA 5CY4A 1D9FA 4EZ9A 4H5TA 4Z0UA 3DI6A 3OYNA 4FWNA 4X64K 3BP8A 1FKPA 3WEEA 2VWBA 4NO7A 2F8SA 1RDUA 1P90A 3L6QA 1U4BA 4CK2A 1DGKN 3O4NA 4FLYA 4IOAL 3PIOL 4B1YB 3MX2A 2E1ZA 4BRNA 4DV6K 4DSKA 3MX5A 2ETJA 5LMUK 1JCGA 2DTUA 3OHRA 1IH7A 3SV4A 4KRFA 4OX9K 4GKJK 4WQ5A 1RBSA 1W0HA 4M42A 2B4JA 2UXBK 1JLFA 4JI7K 4Z94A 1JXBA 4CCHA 3ENBA 1VSFA 3O3FA 4QS9A 1YTUA 5LJVA 1WBDA 2DFFA 3CYMA 3THXA 3AVBA 5GAGP 3LDLA 3KJVA 3OBYA 3QLHA 2HBJA 4C8MA 3DLKA 4H0PA 4B9LA 3V1OA 4F8RA 4B1ZA 4E3SA 1NGCA 2HSTA 4DUZK 4OO1J 4IO8A 1GLBG 4LF5K 4GW6A 4KI6A 3AA2A 3ID8A 1O1WA 2FF6A 2E6LA 3SI6A 1S9EA 4XEIA 4KTZA 4H03B 1X9JA 5ADXH 3HSTB 2VYPA 4YOUA 4BQLA 4E7HA 3ZSOA 3VQAA 2Z1IA 4DTXA 3FR0A 2LSNA 3F9KA 3SUPA 2HHQA 3OYAA 1YITN 4A62A 5JS1A 3OY9A 4CVNE 4NCBA 2ITGA 4YDUC 4KHQA 3DAWA 4BRHA 4JK8A 2BGGA 5IT9O 3R8EA 1A5VA 4KTWA 1C1BA 2AA4A 3NF9A 4N47A 3VTHA 2P51A 3VQDA 1EWRA 5JLHA 1XMQK 3CM6A 3LWLA 3AARA 1BWFO 2FSJA 4M3WA 4OKKA 1MA9B 1QQMA 1KAXA 4LFCK 4YOWA 4CGHA 5J2QA 3UB5A 3SZ2A 4WQ5C 1RTIA 2V52B 3K5MA 3LAKA 3T69A 1S6QA 3L2RA 3KWIA 2GUPA 1SL2A 3ULEB 4EAHD 2P9LA 3L4IA 3CCEN 3VQ8A 4E1NA 5BR8K 5T7BA 4OVLA 1BO5O 2F9WA 4CF2A 3THWB 4B1WB 3MDQA 1C0FA 3DXMA 5AQQA 2BDPA 4CHYA 4M3ZA 3TWHA 2G8IA 3OYGA 1BQMA 1NK4A 1BI4B 1WSFA 2KZMA 2O8CB 1G99A 1RTJA 1T6DA 4BGAA 3QBWA 1LWCA 4X66K 2XHBA 2KLAA 4PKGA 2XO7A 3HSCA 3CMAN 4B3MK 4NXNK 2IIRA 3VF2A 3L2VA 3TAPA 2GBZA 2D0CA 2ZJPL 4CGDA 1HLUA 1V4SA 3LDOA 4FWQA 5HOOA 2NRVA 1NK6A 3VTIA 4JHDA 1XMOK 4WQ4A 3OYHA 3TTCA 4YOTA 4KV8A 4CGJA 4CFBA 4LSNA 1YI2N 4CEOA 1S1WA 2QWRA 3CM5A 4FJHA 1BIZA 4BC2A 2ZQBA 1DTQA 4H4OA 4CBXA 3L0QA 2D5RA 1XUPO 4JKAA 2P9SB 2Q31A 3H3OB 3MAQA 1R0AA 4JI3K 4I9QA 3FE1A 1NGDA 3HPOA 3O08A 1YVNA 3HTVA 3DMJA 1HX1A 1BDGA 3CQYA 3I0RA 1H1VA 3L3UA 1VSLA 3WEEB 4C8LA 3F5TA 3ZCMA 4CFDA 3GL1A 3J7YP 1HRHA 4CEEA 3QNNA 4CEAA 3O6WA 1XQSC 3M8QA 3O1WA 3AO2A 2G8WA 4Z4EA 4BVOA 3U3YA 3ZT2A 2YNIA 2V7ZA 4DTUA 5AQJA 4RW8A 1K9MO 2Q2RA 3CC4N 3OBWA 5GIOA 4RTFD 4DR2K 3LZIA 1ZXOA 3AV9A 3HVRA 1TK0A 1OVQA 3Q7CA 3T19A 1EWQA 1YF5L 2JGUA 3P5JA 1IV0A 1E4FT 2HBKA 1NKBA 4FW1A 4BACA 3K5OA 4KB1A 4CEBA 3PUFA 3QEIA 1D9DA 3KLGA 1NM1A 5GINA 1WB9A 4K43A 4NLBA 5AZIA 2OA8A 4ILHA 4E1JA 4Y0WA 2Q0RA 1P8ZA 4B1UB 3MXIA 2UXCK 2OYQA 3C94A 5J1EA 3E66A 1NK0A 4RWTA 2HNDA 1KFDA 1VSJA 3WXKA 1T8EA 5HBMA 1VQ5N 1VQNN 2G8FA 5BPNA 5LY3A 4CGIA 2GUIA 1KD1O 2RE2A 4YHHK 2FBTA 4IFYA 5I9EB 4FSVA 4ZTJA 3V1RA 5DK5A 4J2EA 1EX4A 3PO5A 3CERA 4QAGA 1B9FA 4F3OA 3KZBA 3HO1A 4MDBA 3WQTA 4FO0A 5HL7L 3TANA 4GV6A 3ENHA 3B8AX 1RDWX 3MK6A 2R7YA 2WOMA 3CF5L 1RDBA 4CJPA 2AJQA 1DT9A 3NF7A 5AQGA 2BTFA 2O8BA 2F9TA 3OYKA 2D0AA 1VSMA 2WFBA 3ZEUA 3OYDA 4BC4A 5FRNA 1NOYA 1NWKA 2YHYA 4JS4A 1KLNA 4ISEA 1U49A 4B1VA 2WUSA 1Q9YA 1ITGA 2E2NA 1BCMA 4BVPA 1I3AA 5CR4A 3HVTA 5KPZA 4KHUA 4DV4K 1ZYQA 3AVJA 4DR1K 3LDNA 4CHNA 3M1FA 5CZ1A 3HM8A 4F9OA 1ZBFA 5HP1A 4CD1A 3ZT1A 3HPHA 1U04A 3HK2A 5M1QA 5GIPA 2YNFA 2XRIA 1VQKN 3AO4A 4YNQA 3FFIA 3AVFA 3K2PA 4PWDA 1KC8O 1WNSA 3T1AA 3ZSXA 5AQMA 4Y1CA 3FZHA 1IKYA 3P83D 4CZKA 3O3GA 3DXMB 2VG5A 4KHNA 4CIEA 3GDQA 3OA9A 1RTDA 3DRPA 3B6OA 1J5EK 1VQ9N 1BISA 1RBUA 4R5PA 4LY7A 3FFKB 3HL8A 3LL3A 3I8BA 3RMBA 2O8FA 3ATVA 4M3XA 4B3SK 5EXWA 3IUCA 2A42A 4CJLA 3QETA 1NU0A 1VK0A 3NVMA 4CK3A 4GV3A 1ASUA 4JHDB 1IBMK 1N5YA 1BU6O 3O80A 3BY5A 4OLAA 1SUQA 4CGFA 4HUFA 1OH8A 4LFBK 3SV3A 2GTDA 4DV3K 1JLAA 3SNNA 1GOAA 4AHSA 4C8KA 1JL1A 3OYLA 4H5NA 3KLEA 4Y1DA 2D1KA 1SL0A 4BQZA 3NE6A 2E1YA 3QEXA 3ZSWA 1HQEA 3ZT3A 1VSDA 4IXCA 4DSLA 1NOZA 4FWKA 5FROA 3U9ZA 3RSEA 1V4TA 2QKKA 3SLCA 5TKWA 3TAQA 4OKEA 4KB0A 1C6VA 2GELA 1MWMA 2RF2A 4OGCA 2W6KA 1LV5A 4NCGA 5BRHA
chains in the Genus database with same CATH topology
1HJRA 2OPRA 1IH7A 3C95A 3G10A 3SV4A 4DFJA 1QSYA 4JRQA 4KRFA 3SUOA 4F3TA 1YT3A 4NYFA 3F73A 1TL3A 2PY5A 1I39A 5I3UA 3V9WA 1RBSA 1ZBLA 1RTHA 1W0HA 4CF9A 2B4JA 4M42A 4M3RA 4B9SA 1U47A 3TAFA 1C0TA 4RW9A 4RG8A 1JLFA 5J2MA 1S1UA 1RBTA 3ZSZA 4KTQA 3HP9A 3VQPA 1LAVA 5KGXA 1JXBA 1ASVA 4CCHA 3RRGA 3AA4A 4OGEA 4FLTA 3RRHA 3AVMA 3JYTA 1JLCA 3AO5A 3RMDA 1HPZA 1VSFA 3O3FA 4CHPA 4DU4A 1YTUA 4O55A 4N56A 4MQ3A 1QSSA 3C6UA 4HTUA 1RT3A 1HMVA 2DFFA 3CYMA 4DMNA 1CXQA 3AVBA 3M8SA 3THVA 2RKIA 3L2WA 3AA3A 4PUOA 3P1GA 4OLBA 3RR7A 1MU2A 3KJVA 3DRRA 3QLHA 3V4IA 4FJMA 1KTQA 4C8MA 5HRPA 3HP6A 3DLKA 4B9LA 1B9DA 2HNZA 3LALA 3V1OA 3RMCA 4FJXA 4F8RA 2HMIA 4E3SA 5J2PA 4F2SA 1K6YA 1SV5A 3ULDA 4B08A 3DLBA 2HHUA 4HUEA 1J9AA 1WLJA 2O4IA 4GW6A 4KI6A 3OJUA 1LWFA 3AA2A 3WNFA 3NH2A 3RMAA 1T03A 1TK8A 1O1WA 1VSKA 1UOCA 2B6AA 2E6LA 3SI6A 2VWJA 1S9EA 4KTZA 2ZE2A 1JKHA 1L5UA 5JS2A 2FBYA 1U45A 4F2RA 3HSTB 3SQ1A 4H4MA 3E01A 4W5QA 1HYVA 4E7HA 1LW2A 3ZSOA 3VQAA 3KLIA 1UA0A 2Z1IA 4DTXA 1X9SA 1J53A 2LSNA 4B9UA 1JLGA 3F9KA 3SUPA 4GMJB 4CE9A 1JLQA 3OYAA 1QS4A 2G8VA 2HHQA 3WNHA 5FRMA 4E19A 5JS1A 3OY9A 2FBVA 5J2NA 1Q8IA 4O4GA 4OKJA 5FDLA 1NJXA 3RR8A 3A2FA 3ASMA 3HYFA 2ITGA 2E6MA 1TKXA 3OVNA 4FLXA 4CJRA 4DFMA 3K57A 3S9HA 4OPJA 4KHQA 5I42A 2YV0X 3NH1A 1N6QA 2Y1JA 3OYCA 1RT7A 1L3SA 4QCLA 2QXFA 1IKWA 4CJ5A 1T7PA 4FM1A 3S3MA 1RT2A 3MEDA 3MEEA 4DTPA 2FC0A 1S1TA 4AHCA 1ZBUA 2PYJA 4J2DA 4E7JA 1NJZA 3EZ5A 2BGGA 1Z26A 1A5VA 4CESA 4KTWA 2BE2A 1C1BA 3D45A 1QSLA 3NF9A 4PA1A 1XHXA 4N47A 3L2UA 1JLBA 2HNYA 4NYNA 2HHTA 3NFAA 4ZHRA 4CEDA 2P51A 3LWMA 4DWIA 2VWKA 3VQDA 1SKSA 4DSFA 4CGGA 3DLHA 1EKEA 3CM6A 5K14A 4DS4A 2E4LA 3LWLA 1T05A 2YHBA 4M3WA 4OKKA 1RT4A 4QOZB 2YHAA 2KFZA 1S9GA 4CGHA 5J2QA 3SPYA 1CZBA 3LP0A 3SZ2A 1RTIA 5SWMA 2X6SA 1XWLA 4AHUA 3K5MA 3LAKA 2O4GA 1S6QA 3L2RA 5HRNA 3S3NA 1UA1A 2HW3A 3MEGA 4CEQA 1SL2A 3VQEA 2XY5A 4DU3A 3PX6A 3O3HA 3VQ8A 1VSHA 3LAMA 4FZYA 4E1NA 3AVGA 3NF8A 5T7BA 2P5OA 1YTAA 3CFOA 4DF8A 1KRPA 3O4QA 2JLEA 4OVLA 4EP4A 4DF4A 3QEVA 1L3UA 2ZD1A 1C1CA 4ID1A 1SKWA 2OZMA 3D0PA 4CF2A 1ZBHA 1G15A 3ALYA 3IG1A 4CJKA 1TAQA 1RT5A 4BDZA 4DTMA 3OYEA 2BDPA 2FBXA 4CHYA 3U6FA 4RW4A 4M3ZA 3K59A 3OYMA 3TWHA 5C25A 4PQUA 2G8IA 3OYGA 1BQMA 1NK4A 1WSGA 1BI4B 1EETA 4DTOA 1C0UA 1TK5A 3AVAA 4DTRA 1WSFA 3TI0A 2Z1GA 4CEZA 4N41A 2KZMA 4OJRA 4ELTA 4BE1A 2ATQA 1RTJA 5DMRA 4CJQA 3MXJA 4MFBA 1LWCA 4O0JA 1X9MA 3RWUA 3QIOA 2XHBA 1WAJA 4TSXA 2XO7A 2P5GA 3LDSA 4FCYA 2P1JA 4AILC 3IAYA 4KKOA 4JS5A 1S1VA 3L2VA 3TAPA 4DSJA 2GBZA 4O0IA 1JLEA 2D0CA 3KKSA 4CGDA 3NHGA 4I9LA 2OPPA 1F21A 4IBNA 4CIGA 5C24A 1NK6A 2QKBA 2X74A 1NK7A 3OYHA 3TAEA 3MXMA 3CQ8A 3G0ZA 1RNHA 2XY8A 4KB0A 4KV8A 3NBPA 4CGJA 1RT1A 4DS5A 4CFBA 4LSNA 5CYMA 4CEOA 4I2QA 1S1WA 3B6PA 3CM5A 4FJHA 1BIZA 2ZQBA 3CG7A 3V9UA 1C0MA 1DTQA 3WNEA 4FJ8A 1ZBIA 3DLGA 1FXXA 4H4OA 2VG6A 3VQQA 4FLWA 3SQ0A 4WE1A 3HJFA 2D5RA 1NKEA 4AH9A 3MAQA 1R0AA 4I9QA 2KQ2A 1ASWA 4IFVA 3AVKA 4CF0A 3HPOA 4ICLA 3S3OA 4FK0A 3DMJA 4IG0A 3L8BA 3LANA 3T3FA 1U48A 2YNHA 1VSEA 4DSIA 4FK4A 4W5NA 4RW7A 3UIQA 3IRXA 4M45A 1QTMA 3I0RA 3L3UA 1TV6A 4BWMA 3CFPA 1VSLA 1XI1A 4Z4IA 4C8LA 3ITHA 1CLQA 3ZCMA 4CK1A 4CFDA 1IO2A 4DQRA 4I2PA 2NUBA 1HRHA 4CEEA 2EX3A 2IOCA 1REVA 3QNNA 3TAMA 1U4BA 4CEAA 4CFAA 1TAUA 4DFKA 1FKOA 2IS3A 3QEPA 3M8QA 4KHSA 2G8WA 3AO2A 4B9TA 4Z4EA 4CIFA 4O44A 3V9ZA 4K8ZA 2X6NA 3V81A 3L3VA 3ZT2A 3U3YA 2YNIA 4JLHA 3BGRA 1L3TA 3VQ6A 2YKNA 4DTUA 4RW8A 3DLEA 3SJJA 4ZTFA 4HCCA 2HHXA 4FJGA 4B8AB 3ZSVA 3ZSRA 3OYJA 3M8RA 4CJUA 3K5NA 4DLEA 4RW6A 3OYBA 2Z1HA 4FJ5A 5KI6A 3OJSA 1HYSA 4N5SA 4FLVA 4FJJA 4B9NA 3LZIA 3AV9A 3HVRA 1TK0A 1KCFA 3SCXA 1QE1A 1UAXA 1W9HA 4KHYA 4W5RA 3OS2A 3T19A 3CFRA 4CJ3A 3PV8A 3AA5X 4C8NA 1NK9A 2OZSA 4F4KA 1YVUA 4C8OA 4Q5VA 3QEWA 2B5JA 4KPYA 2JGUA 3ISNC 3NGZA 1IKVA 4E0DA 3P5JA 5E41A 3QNOA 4Q0BA 4FJ7A 1WSEA 3V6DA 4N76A 4FK2A 4KAZA 3V9XA 4ELVA 1NKBA 4FW1A 4ID5A 4BACA 3K5OA 4KB1A 4CEBA 4CHZA 1NKCA 1VRUA 3AVNA 1HYZA 3PUFA 3VN5A 3KLGA 3QEIA 1D9DA 4DTNA 2A1SA 3M8PA 2GV9A 2OA8A 3DRSA 3OS0A 4FJNA 1BHLA 3KKRA 3KK1A 1C1AA 4W5OA 2IC3A 3MXIA 3VQ5A 3AVLA 2OYQA 3C94A 4FJLA 1RDAA 5J1EA 3KK2A 1BIUA 4L8RB 4CJEA 3LZJA 4YFUA 4E7LA 1NK0A 3HT3A 4CEFA 2HNDA 3K5LA 4M3TA 1KFDA 1VSJA 2HHVA 2IDOA 1T8EA 5HBMA 2PYLA 1KVCA 4CJVA 3VQ7A 3DLRA 5KTQA 4CERA 2G8FA 2KFNA 1HNIA 4LH5A 2GUIA 4CFCA 4CGIA 4BE2A 4K8XA 1BGXT 3IS9A 2HHWA 3TR8A 4J2AA 2KW4A 3V1QA 4G1QA 2FBTA 4IFYA 1RBVA 3SUQA 4ZTJA 3V1RA 2OPQA 4FLZA 5DK5A 1Q9XA 4J2EA 2RN2A 1A5WA 1EX4A 4Z4FA 3PO5A 4QAGA 2I5JA 3EY1A 1B9FA 1BQNA 2D0BA 1L3VA 1TKZA 3KTQA 4EZ6A 4F3OA 2WONA 1S1XA 3HO1A 1EP4A 3QIPA 4NCBA 4KHWA 4AHVA 4IG3A 4CF8A 3PX4A 2OPSA 3TANA 3VQCA 1CZ9A 3MECA 4NCAA 3KD1E 4KREA 3LP3A 3DOKA 2WOMA 2R7YA 1RDBA 4CJPA 2AJQA 3NF7A 4B9VA 2HHSA 2YNGA 4CJ4A 3TAGA 3DYAA 3KLFA 1VSIA 1QQCA 4DTJA 3WNGA 3OYKA 3HXMA 2D0AA 3DM2A 3VQ4A 5HROA 1D8YA 2QK9A 1VSMA 4DFPA 3EYZA 3OYDA 3SQ2A 1Y97A 3KD5E 1KSPA 5FRNA 4DQSA 3ZSQA 1SKRA 1NOYA 1DTTA 2EHGA 3AO1A 4CJTA 4JS4A 4DLGA 3VA0A 1KLNA 1U49A 1RT6A 1UWBA 1Q9YA 1ITGA 1WSJA 1BCMA 4E89A 1I3AA 3ZT4A 1RDCA 1GOBA 3HVTA 4BWJA 4AHRA 4KHUA 3TABA 3TARA 4UQGA 1ZYQA 3AVJA 2G8UA 1XC9A 1DLOA 3U3GA 4CHNA 1WSIA 2RPIA 5CZ1A 3PY8A 1ZBFA 4DTSA 3QERA 5SZTA 5HP1A 2IGIA 4ELUA 4FZZA 3ZT1A 1JXEA 1TL1A 2IAJA 3HPHA 1D5AA 1U04A 4GVMA 4FM0A 5KGWA 4CF1A 4HCBA 3HK2A 3KIOA 1RBRA 2YNFA 1IKXA 1S6PA 2XRIA 3AO4A 5EU7A 4YNQA 3FFIA 3AVFA 3AVHA 3K2PA 3NH0A 3RTVA 4E7KA 4PWDA 1WNSA 3T1AA 4FJKA 2DFEA 2VG7A 3ZSXA 4B9MA 1LWEA 4EP5A 2G8KA 4FXDA 4Y1CA 4DU1A 1NJYA 4Z4CA 4DQPA 4CHQA 4CHOA 1IKYA 3P83D 3O3GA 1BI4A 3AO3A 3AVIA 2VG5A 3SYZA 4KHNA 1A5XA 3LP1A 3NGYA 4CIEA 1NK5A 3ZT0A 3LP2A 3VQ9A 2XY7A 3SUNA 1LW0A 1RTDA 4FW2A 3I8DA 3DRPA 1X1PA 4AHTA 4M3UA 5C42A 2HVIA 3B6OA 1Z25A 3OYFA 4FVMA 1BISA 1RBUA 3H08A 3QINA 3VQBA 4R5PA 4LY7A 4FM2A 2KZZA 3HL8A 4KFBA 3V9SA 3RMBA 4B3OA 4FYDA 1BCOA 1RCHA 1TGOA 4M3XA 1HNVA 4IDKA 5CZ2A 4KO0A 4H8KA 3NF6A 4BDPA 4PY5A 3NDKA 1KLMA 4LH4A 4CJLA 3QETA 4FLUA 2F8TA 2DFHA 1FK9A 4E1MA 1VK0A 4HUGA 1LAWA 1J54A 4J2BA 1WSHA 3L2QA 2Q3SA 3I0SA 1RDDA 4LSLA 4B8CA 4CK3A 1JL2A 1J5OA 1ASUA 3QESA 3AVCA 4KI4A 1GOCA 4FZXC 4DG1A 1TKTA 4JRPA 1NK8A 3BDPA 5D3GA 5KRSA 2DY4A 1N5YA 4I7FA 3QO9A 5HLFA 1TKDA 3JSMA 3SPZA 1HQUA 4DQQA 4OLAA 1SUQA 2KTQA 4CGFA 4HUFA 3SV3A 2G8HA 5KRTA 3NAEA 4DSEA 3HM9A 1JLAA 3ZSYA 2W42A 3SNNA 1GOAA 3HPGA 4FJ9A 4AHSA 1SL1A 4M41A 3K58A 4C8KA 2Z1JA 3LPUA 2A1RA 1JL1A 2PZSA 4FJIA 1TVRA 3OYLA 4OPKA 3KLEA 1IG9A 4CJSA 3PX0A 4Y1DA 4CJWA 1SL0A 3NE6A 3OS1A 5CY4A 3QEXA 4M3YA 3ZSWA 1HQEA 1QHTA 3ZT3A 1D9FA 1KFSA 4EZ9A 4Z0UA 3SQ4A 1VSDA 4E7IA 1KVAA 3DI6A 3OYNA 4O5BA 3VA3A 1BL3A 1XHZA 1X9WA 4DSLA 2XY6A 1NJWA 1NOZA 3DOLA 4HHTA 1FKPA 5FROA 4IKFA 1B92A 2F96A 3KK3A 2HVHA 4XIUA 5CYQA 3LPTA 3NCIA 2F8SA 3OYIA 2BANA 4LD0A 4Z4HA 2QKKA 4Z4GA 4HVJA 2Y1IA 3TAQA 3C6TA 4OKEA 1EXQA 5HRSA 5HRRA 4CK2A 2X78A 1VRTA 2YKMA 1C6VA 3O4NA 1RILA 1S5JA 4CECA 3KLHA 4BDYA 4FLYA 1WAFA 2HB5A 4DQIA 2RF2A 4OGCA 4BE0A 1CXUA 4CJFA 1LV5A 3PO4A 4DSKA 3NGIA 1WN7A 2ETJA 4W5TA 4NCGA 2DTUA 1KVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJR A;  2OPR A;  1IH7 A;  3C95 A;  3G10 A;  3SV4 A;  4DFJ A;  1QSY A;  4JRQ A;  4KRF A;  3SUO A;  4F3T A;  1YT3 A;  4NYF A;  3F73 A;  1TL3 A;  2PY5 A;  1I39 A;  5I3U A;  3V9W A;  1RBS A;  1ZBL A;  1RTH A;  1W0H A;  4CF9 A;  2B4J A;  4M42 A;  4M3R A;  4B9S A;  1U47 A;  3TAF A;  1C0T A;  4RW9 A;  4RG8 A;  1JLF A;  5J2M A;  1S1U A;  1RBT A;  3ZSZ A;  4KTQ A;  3HP9 A;  3VQP A;  1LAV A;  5KGX A;  1JXB A;  1ASV A;  4CCH A;  3RRG A;  3AA4 A;  4OGE A;  4FLT A;  3RRH A;  3AVM A;  3JYT A;  1JLC A;  3AO5 A;  3RMD A;  1HPZ A;  1VSF A;  3O3F A;  4CHP A;  4DU4 A;  1YTU A;  4O55 A;  4N56 A;  4MQ3 A;  1QSS A;  3C6U A;  4HTU A;  1RT3 A;  1HMV A;  2DFF A;  3CYM A;  4DMN A;  1CXQ A;  3AVB A;  3M8S A;  3THV A;  2RKI A;  3L2W A;  3AA3 A;  4PUO A;  3P1G A;  4OLB A;  3RR7 A;  1MU2 A;  3KJV A;  3DRR A;  3QLH A;  3V4I A;  4FJM A;  1KTQ A;  4C8M A;  5HRP A;  3HP6 A;  3DLK A;  4B9L A;  1B9D A;  2HNZ A;  3LAL A;  3V1O A;  3RMC A;  4FJX A;  4F8R A;  2HMI A;  4E3S A;  5J2P A;  4F2S A;  1K6Y A;  1SV5 A;  3ULD A;  4B08 A;  3DLB A;  2HHU A;  4HUE A;  1J9A A;  1WLJ A;  2O4I A;  4GW6 A;  4KI6 A;  3OJU A;  1LWF A;  3AA2 A;  3WNF A;  3NH2 A;  3RMA A;  1T03 A;  1TK8 A;  1O1W A;  1VSK A;  1UOC A;  2B6A A;  2E6L A;  3SI6 A;  2VWJ A;  1S9E A;  4KTZ A;  2ZE2 A;  1JKH A;  1L5U A;  5JS2 A;  2FBY A;  1U45 A;  4F2R A;  3HST B;  3SQ1 A;  4H4M A;  3E01 A;  4W5Q A;  1HYV A;  4E7H A;  1LW2 A;  3ZSO A;  3VQA A;  3KLI A;  1UA0 A;  2Z1I A;  4DTX A;  1X9S A;  1J53 A;  2LSN A;  4B9U A;  1JLG A;  3F9K A;  3SUP A;  4GMJ B;  4CE9 A;  1JLQ A;  3OYA A;  1QS4 A;  2G8V A;  2HHQ A;  3WNH A;  5FRM A;  4E19 A;  5JS1 A;  3OY9 A;  2FBV A;  5J2N A;  1Q8I A;  4O4G A;  4OKJ A;  5FDL A;  1NJX A;  3RR8 A;  3A2F A;  3ASM A;  3HYF A;  2ITG A;  2E6M A;  1TKX A;  3OVN A;  4FLX A;  4CJR A;  4DFM A;  3K57 A;  3S9H A;  4OPJ A;  4KHQ A;  5I42 A;  2YV0 X;  3NH1 A;  1N6Q A;  2Y1J A;  3OYC A;  1RT7 A;  1L3S A;  4QCL A;  2QXF A;  1IKW A;  4CJ5 A;  1T7P A;  4FM1 A;  3S3M A;  1RT2 A;  3MED A;  3MEE A;  4DTP A;  2FC0 A;  1S1T A;  4AHC A;  1ZBU A;  2PYJ A;  4J2D A;  4E7J A;  1NJZ A;  3EZ5 A;  2BGG A;  1Z26 A;  1A5V A;  4CES A;  4KTW A;  2BE2 A;  1C1B A;  3D45 A;  1QSL A;  3NF9 A;  4PA1 A;  1XHX A;  4N47 A;  3L2U A;  1JLB A;  2HNY A;  4NYN A;  2HHT A;  3NFA A;  4ZHR A;  4CED A;  2P51 A;  3LWM A;  4DWI A;  2VWK A;  3VQD A;  1SKS A;  4DSF A;  4CGG A;  3DLH A;  1EKE A;  3CM6 A;  5K14 A;  4DS4 A;  2E4L A;  3LWL A;  1T05 A;  2YHB A;  4M3W A;  4OKK A;  1RT4 A;  4QOZ B;  2YHA A;  2KFZ A;  1S9G A;  4CGH A;  5J2Q A;  3SPY A;  1CZB A;  3LP0 A;  3SZ2 A;  1RTI A;  5SWM A;  2X6S A;  1XWL A;  4AHU A;  3K5M A;  3LAK A;  2O4G A;  1S6Q A;  3L2R A;  5HRN A;  3S3N A;  1UA1 A;  2HW3 A;  3MEG A;  4CEQ A;  1SL2 A;  3VQE A;  2XY5 A;  4DU3 A;  3PX6 A;  3O3H A;  3VQ8 A;  1VSH A;  3LAM A;  4FZY A;  4E1N A;  3AVG A;  3NF8 A;  5T7B A;  2P5O A;  1YTA A;  3CFO A;  4DF8 A;  1KRP A;  3O4Q A;  2JLE A;  4OVL A;  4EP4 A;  4DF4 A;  3QEV A;  1L3U A;  2ZD1 A;  1C1C A;  4ID1 A;  1SKW A;  2OZM A;  3D0P A;  4CF2 A;  1ZBH A;  1G15 A;  3ALY A;  3IG1 A;  4CJK A;  1TAQ A;  1RT5 A;  4BDZ A;  4DTM A;  3OYE A;  2BDP A;  2FBX A;  4CHY A;  3U6F A;  4RW4 A;  4M3Z A;  3K59 A;  3OYM A;  3TWH A;  5C25 A;  4PQU A;  2G8I A;  3OYG A;  1BQM A;  1NK4 A;  1WSG A;  1BI4 B;  1EET A;  4DTO A;  1C0U A;  1TK5 A;  3AVA A;  4DTR A;  1WSF A;  3TI0 A;  2Z1G A;  4CEZ A;  4N41 A;  2KZM A;  4OJR A;  4ELT A;  4BE1 A;  2ATQ A;  1RTJ A;  5DMR A;  4CJQ A;  3MXJ A;  4MFB A;  1LWC A;  4O0J A;  1X9M A;  3RWU A;  3QIO A;  2XHB A;  1WAJ A;  4TSX A;  2XO7 A;  2P5G A;  3LDS A;  4FCY A;  2P1J A;  4AIL C;  3IAY A;  4KKO A;  4JS5 A;  1S1V A;  3L2V A;  3TAP A;  4DSJ A;  2GBZ A;  4O0I A;  1JLE A;  2D0C A;  3KKS A;  4CGD A;  3NHG A;  4I9L A;  2OPP A;  1F21 A;  4IBN A;  4CIG A;  5C24 A;  1NK6 A;  2QKB A;  2X74 A;  1NK7 A;  3OYH A;  3TAE A;  3MXM A;  3CQ8 A;  3G0Z A;  1RNH A;  2XY8 A;  4KB0 A;  4KV8 A;  3NBP A;  4CGJ A;  1RT1 A;  4DS5 A;  4CFB A;  4LSN A;  5CYM A;  4CEO A;  4I2Q A;  1S1W A;  3B6P A;  3CM5 A;  4FJH A;  1BIZ A;  2ZQB A;  3CG7 A;  3V9U A;  1C0M A;  1DTQ A;  3WNE A;  4FJ8 A;  1ZBI A;  3DLG A;  1FXX A;  4H4O A;  2VG6 A;  3VQQ A;  4FLW A;  3SQ0 A;  4WE1 A;  3HJF A;  2D5R A;  1NKE A;  4AH9 A;  3MAQ A;  1R0A A;  4I9Q A;  2KQ2 A;  1ASW A;  4IFV A;  3AVK A;  4CF0 A;  3HPO A;  4ICL A;  3S3O A;  4FK0 A;  3DMJ A;  4IG0 A;  3L8B A;  3LAN A;  3T3F A;  1U48 A;  2YNH A;  1VSE A;  4DSI A;  4FK4 A;  4W5N A;  4RW7 A;  3UIQ A;  3IRX A;  4M45 A;  1QTM A;  3I0R A;  3L3U A;  1TV6 A;  4BWM A;  3CFP A;  1VSL A;  1XI1 A;  4Z4I A;  4C8L A;  3ITH A;  1CLQ A;  3ZCM A;  4CK1 A;  4CFD A;  1IO2 A;  4DQR A;  4I2P A;  2NUB A;  1HRH A;  4CEE A;  2EX3 A;  2IOC A;  1REV A;  3QNN A;  3TAM A;  1U4B A;  4CEA A;  4CFA A;  1TAU A;  4DFK A;  1FKO A;  2IS3 A;  3QEP A;  3M8Q A;  4KHS A;  2G8W A;  3AO2 A;  4B9T A;  4Z4E A;  4CIF A;  4O44 A;  3V9Z A;  4K8Z A;  2X6N A;  3V81 A;  3L3V A;  3ZT2 A;  3U3Y A;  2YNI A;  4JLH A;  3BGR A;  1L3T A;  3VQ6 A;  2YKN A;  4DTU A;  4RW8 A;  3DLE A;  3SJJ A;  4ZTF A;  4HCC A;  2HHX A;  4FJG A;  4B8A B;  3ZSV A;  3ZSR A;  3OYJ A;  3M8R A;  4CJU A;  3K5N A;  4DLE A;  4RW6 A;  3OYB A;  2Z1H A;  4FJ5 A;  5KI6 A;  3OJS A;  1HYS A;  4N5S A;  4FLV A;  4FJJ A;  4B9N A;  3LZI A;  3AV9 A;  3HVR A;  1TK0 A;  1KCF A;  3SCX A;  1QE1 A;  1UAX A;  1W9H A;  4KHY A;  4W5R A;  3OS2 A;  3T19 A;  3CFR A;  4CJ3 A;  3PV8 A;  3AA5 X;  4C8N A;  1NK9 A;  2OZS A;  4F4K A;  1YVU A;  4C8O A;  4Q5V A;  3QEW A;  2B5J A;  4KPY A;  2JGU A;  3ISN C;  3NGZ A;  1IKV A;  4E0D A;  3P5J A;  5E41 A;  3QNO A;  4Q0B A;  4FJ7 A;  1WSE A;  3V6D A;  4N76 A;  4FK2 A;  4KAZ A;  3V9X A;  4ELV A;  1NKB A;  4FW1 A;  4ID5 A;  4BAC A;  3K5O A;  4KB1 A;  4CEB A;  4CHZ A;  1NKC A;  1VRU A;  3AVN A;  1HYZ A;  3PUF A;  3VN5 A;  3KLG A;  3QEI A;  1D9D A;  4DTN A;  2A1S A;  3M8P A;  2GV9 A;  2OA8 A;  3DRS A;  3OS0 A;  4FJN A;  1BHL A;  3KKR A;  3KK1 A;  1C1A A;  4W5O A;  2IC3 A;  3MXI A;  3VQ5 A;  3AVL A;  2OYQ A;  3C94 A;  4FJL A;  1RDA A;  5J1E A;  3KK2 A;  1BIU A;  4L8R B;  4CJE A;  3LZJ A;  4YFU A;  4E7L A;  1NK0 A;  3HT3 A;  4CEF A;  2HND A;  3K5L A;  4M3T A;  1KFD A;  1VSJ A;  2HHV A;  2IDO A;  1T8E A;  5HBM A;  2PYL A;  1KVC A;  4CJV A;  3VQ7 A;  3DLR A;  5KTQ A;  4CER A;  2G8F A;  2KFN A;  1HNI A;  4LH5 A;  2GUI A;  4CFC A;  4CGI A;  4BE2 A;  4K8X A;  1BGX T;  3IS9 A;  2HHW A;  3TR8 A;  4J2A A;  2KW4 A;  3V1Q A;  4G1Q A;  2FBT A;  4IFY A;  1RBV A;  3SUQ A;  4ZTJ A;  3V1R A;  2OPQ A;  4FLZ A;  5DK5 A;  1Q9X A;  4J2E A;  2RN2 A;  1A5W A;  1EX4 A;  4Z4F A;  3PO5 A;  4QAG A;  2I5J A;  3EY1 A;  1B9F A;  1BQN A;  2D0B A;  1L3V A;  1TKZ A;  3KTQ A;  4EZ6 A;  4F3O A;  2WON A;  1S1X A;  3HO1 A;  1EP4 A;  3QIP A;  4NCB A;  4KHW A;  4AHV A;  4IG3 A;  4CF8 A;  3PX4 A;  2OPS A;  3TAN A;  3VQC A;  1CZ9 A;  3MEC A;  4NCA A;  3KD1 E;  4KRE A;  3LP3 A;  3DOK A;  2WOM A;  2R7Y A;  1RDB A;  4CJP A;  2AJQ A;  3NF7 A;  4B9V A;  2HHS A;  2YNG A;  4CJ4 A;  3TAG A;  3DYA A;  3KLF A;  1VSI A;  1QQC A;  4DTJ A;  3WNG A;  3OYK A;  3HXM A;  2D0A A;  3DM2 A;  3VQ4 A;  5HRO A;  1D8Y A;  2QK9 A;  1VSM A;  4DFP A;  3EYZ A;  3OYD A;  3SQ2 A;  1Y97 A;  3KD5 E;  1KSP A;  5FRN A;  4DQS A;  3ZSQ A;  1SKR A;  1NOY A;  1DTT A;  2EHG A;  3AO1 A;  4CJT A;  4JS4 A;  4DLG A;  3VA0 A;  1KLN A;  1U49 A;  1RT6 A;  1UWB A;  1Q9Y A;  1ITG A;  1WSJ A;  1BCM A;  4E89 A;  1I3A A;  3ZT4 A;  1RDC A;  1GOB A;  3HVT A;  4BWJ A;  4AHR A;  4KHU A;  3TAB A;  3TAR A;  4UQG A;  1ZYQ A;  3AVJ A;  2G8U A;  1XC9 A;  1DLO A;  3U3G A;  4CHN A;  1WSI A;  2RPI A;  5CZ1 A;  3PY8 A;  1ZBF A;  4DTS A;  3QER A;  5SZT A;  5HP1 A;  2IGI A;  4ELU A;  4FZZ A;  3ZT1 A;  1JXE A;  1TL1 A;  2IAJ A;  3HPH A;  1D5A A;  1U04 A;  4GVM A;  4FM0 A;  5KGW A;  4CF1 A;  4HCB A;  3HK2 A;  3KIO A;  1RBR A;  2YNF A;  1IKX A;  1S6P A;  2XRI A;  3AO4 A;  5EU7 A;  4YNQ A;  3FFI A;  3AVF A;  3AVH A;  3K2P A;  3NH0 A;  3RTV A;  4E7K A;  4PWD A;  1WNS A;  3T1A A;  4FJK A;  2DFE A;  2VG7 A;  3ZSX A;  4B9M A;  1LWE A;  4EP5 A;  2G8K A;  4FXD A;  4Y1C A;  4DU1 A;  1NJY A;  4Z4C A;  4DQP A;  4CHQ A;  4CHO A;  1IKY A;  3P83 D;  3O3G A;  1BI4 A;  3AO3 A;  3AVI A;  2VG5 A;  3SYZ A;  4KHN A;  1A5X A;  3LP1 A;  3NGY A;  4CIE A;  1NK5 A;  3ZT0 A;  3LP2 A;  3VQ9 A;  2XY7 A;  3SUN A;  1LW0 A;  1RTD A;  4FW2 A;  3I8D A;  3DRP A;  1X1P A;  4AHT A;  4M3U A;  5C42 A;  2HVI A;  3B6O A;  1Z25 A;  3OYF A;  4FVM A;  1BIS A;  1RBU A;  3H08 A;  3QIN A;  3VQB A;  4R5P A;  4LY7 A;  4FM2 A;  2KZZ A;  3HL8 A;  4KFB A;  3V9S A;  3RMB A;  4B3O A;  4FYD A;  1BCO A;  1RCH A;  1TGO A;  4M3X A;  1HNV A;  4IDK A;  5CZ2 A;  4KO0 A;  4H8K A;  3NF6 A;  4BDP A;  4PY5 A;  3NDK A;  1KLM A;  4LH4 A;  4CJL A;  3QET A;  4FLU A;  2F8T A;  2DFH A;  1FK9 A;  4E1M A;  1VK0 A;  4HUG A;  1LAW A;  1J54 A;  4J2B A;  1WSH A;  3L2Q A;  2Q3S A;  3I0S A;  1RDD A;  4LSL A;  4B8C A;  4CK3 A;  1JL2 A;  1J5O A;  1ASU A;  3QES A;  3AVC A;  4KI4 A;  1GOC A;  4FZX C;  4DG1 A;  1TKT A;  4JRP A;  1NK8 A;  3BDP A;  5D3G A;  5KRS A;  2DY4 A;  1N5Y A;  4I7F A;  3QO9 A;  5HLF A;  1TKD A;  3JSM A;  3SPZ A;  1HQU A;  4DQQ A;  4OLA A;  1SUQ A;  2KTQ A;  4CGF A;  4HUF A;  3SV3 A;  2G8H A;  5KRT A;  3NAE A;  4DSE A;  3HM9 A;  1JLA A;  3ZSY A;  2W42 A;  3SNN A;  1GOA A;  3HPG A;  4FJ9 A;  4AHS A;  1SL1 A;  4M41 A;  3K58 A;  4C8K A;  2Z1J A;  3LPU A;  2A1R A;  1JL1 A;  2PZS A;  4FJI A;  1TVR A;  3OYL A;  4OPK A;  3KLE A;  1IG9 A;  4CJS A;  3PX0 A;  4Y1D A;  4CJW A;  1SL0 A;  3NE6 A;  3OS1 A;  5CY4 A;  3QEX A;  4M3Y A;  3ZSW A;  1HQE A;  1QHT A;  3ZT3 A;  1D9F A;  1KFS A;  4EZ9 A;  4Z0U A;  3SQ4 A;  1VSD A;  4E7I A;  1KVA A;  3DI6 A;  3OYN A;  4O5B A;  3VA3 A;  1BL3 A;  1XHZ A;  1X9W A;  4DSL A;  2XY6 A;  1NJW A;  1NOZ A;  3DOL A;  4HHT A;  1FKP A;  5FRO A;  4IKF A;  1B92 A;  2F96 A;  3KK3 A;  2HVH A;  4XIU A;  5CYQ A;  3LPT A;  3NCI A;  2F8S A;  3OYI A;  2BAN A;  4LD0 A;  4Z4H A;  2QKK A;  4Z4G A;  4HVJ A;  2Y1I A;  3TAQ A;  3C6T A;  4OKE A;  1EXQ A;  5HRS A;  5HRR A;  4CK2 A;  2X78 A;  1VRT A;  2YKM A;  1C6V A;  3O4N A;  1RIL A;  1S5J A;  4CEC A;  3KLH A;  4BDY A;  4FLY A;  1WAF A;  2HB5 A;  4DQI A;  2RF2 A;  4OGC A;  4BE0 A;  1CXU A;  4CJF A;  1LV5 A;  3PO4 A;  4DSK A;  3NGI A;  1WN7 A;  2ETJ A;  4W5T A;  4NCG A;  2DTU A;  1KVB A; 
#chains in the Genus database with same CATH topology
 1HJR A;  3C95 A;  3G10 A;  3QFP A;  2FXU A;  3SUO A;  3J80 O;  1ZC6 A;  2PY5 A;  2A6A A;  1I39 A;  4M3R A;  1U47 A;  4KTQ A;  3HP9 A;  1LAV A;  3T1H K;  3S41 A;  4CW7 B;  3OTO K;  3QDK A;  1FW6 A;  4FLT A;  1RFQ A;  3JYT A;  1JLC A;  3RMD A;  3CME N;  3G71 N;  3C6U A;  3J8A A;  1HMV A;  3THV A;  3NMU A;  2DPN A;  1S72 N;  2RKI A;  3L2W A;  5KPT A;  4PUO A;  3P1G A;  4OLB A;  3RR7 A;  1MU2 A;  3DRR A;  3V4I A;  3RMC A;  4F2S A;  1X3N A;  1K6Y A;  3WXI A;  5AZI B;  4IOC L;  3ULD A;  1J9A A;  4ILG B;  1NBW A;  3OJU A;  4DQ8 A;  1VQ7 N;  1TK8 A;  1QQO A;  3NVK A;  4YOV A;  1UOC A;  3VEW A;  4NLC A;  2A3Z A;  2ZE2 A;  1JKH A;  3C0B A;  3I55 N;  2OCE A;  3SQ1 A;  4W5Q A;  5JIC A;  4H0T B;  4LC9 B;  1UA0 A;  5E26 A;  2Q0U A;  2E88 A;  3FZF A;  4GMJ B;  4CE9 A;  3GG4 A;  3WNH A;  4DV0 K;  2ZWH A;  3KWG A;  4O4G A;  3ASM A;  1XC3 A;  3MCA B;  3S9H A;  2CGL A;  3K57 A;  4JKD A;  2YV0 X;  1N6Q A;  3OYC A;  1RT7 A;  1L3S A;  3EEQ A;  4CJ5 A;  3HOS A;  1T7P A;  3GOI A;  3MEE A;  5M1N A;  4DTP A;  2FC0 A;  2PYJ A;  1ZBU A;  3C7N A;  4A61 A;  1Z26 A;  3DXK A;  4CES A;  3D45 A;  1EO1 A;  4JKG B;  3BF1 A;  1JLB A;  4MO5 A;  3LWM A;  2YCH A;  2O8B B;  4NB4 A;  4DSF A;  3DLH A;  2UU9 K;  2FLO A;  1T05 A;  2P9U A;  1Z6R A;  2YHA A;  3OW2 M;  3SPY A;  1CZB A;  5SWM A;  1XWL A;  5HRN A;  2HW3 A;  4H0V B;  3VQE A;  5EVZ A;  1HKB A;  2W40 A;  3PX6 A;  1NLV A;  3R9P A;  4DR5 K;  4H0X B;  3AVG A;  3NF8 A;  4BRL A;  1KRP A;  2JLE A;  3QEV A;  1L3U A;  2ZD1 A;  1C1C A;  2GWK A;  1ZBH A;  1G15 A;  1GLC G;  5BRF A;  4DTM A;  1RT5 A;  3WXM B;  4FWM A;  4XH4 A;  3OYE A;  3QB0 A;  3U6F A;  4JNE A;  2Q36 A;  4DV2 K;  1U2V A;  3OYM A;  4GKK K;  2D4W A;  1VHX A;  4DTO A;  1EET A;  3GBT A;  3F2K A;  2Z1G A;  5DM6 L;  3GE1 A;  4JK9 A;  2ATQ A;  3A5N C;  1X9M A;  3RWU A;  1WAJ A;  4TSX A;  1E4G T;  2QM1 A;  2O8F B;  4JS5 A;  1S1V A;  4DSJ A;  2E2Q A;  4MLH A;  3EE9 A;  4IBN A;  2NZT A;  3IMX A;  2X74 A;  1NK7 A;  1XNR K;  2XY8 A;  4BR5 A;  1QHA A;  2ZGZ A;  5EOY A;  4HWI A;  3SAG A;  3NBP A;  1RT1 A;  5CYM A;  2KHO A;  5A2Q O;  4FJ8 A;  1FXX A;  2HMP A;  2VG6 A;  4M7Y A;  4PL7 A;  4X65 K;  1NKE A;  4AH9 A;  4A2A A;  1ASW A;  4IFV A;  4BY9 C;  1QZ6 A;  4ICL A;  3S3O A;  5JMV A;  3O8M A;  4RW7 A;  4DV1 K;  3JXU A;  1XI1 A;  4JAX A;  1CLQ A;  3RSE B;  4K0K K;  1IO2 A;  4DQR A;  2NUB A;  4C1N I;  3TAM A;  4CFA A;  2VGM A;  4HTL A;  2CGK A;  2NRR A;  3CPW M;  4MO4 A;  3IFR A;  5TKY A;  4CIF A;  3N4P A;  4O44 A;  1TUY A;  2X6N A;  1L3T A;  4CZI A;  3BGR A;  3SJJ A;  4ZTF A;  3DLE A;  1VQM N;  2E2P A;  3M8R A;  4FJ5 A;  4CJU A;  3SAF A;  3A5L C;  5KI6 A;  4FOI A;  3MMV A;  2VQF K;  1HYS A;  4CZF A;  2UUA K;  2ZJQ L;  3LM9 A;  1UAX A;  1W9H A;  4KHY A;  4W5R A;  3K9J A;  3PV8 A;  3AA5 X;  3QIC A;  2ITM A;  1M90 O;  2NRX A;  5GAE P;  4Q5V A;  1VQL N;  4KPY A;  4KH6 A;  5E41 A;  4BRI A;  4FK2 A;  4KAZ A;  4ELV A;  1NKC A;  1HYZ A;  2A1S A;  5BRE A;  3O9R A;  4FJN A;  3KKR A;  1GLD G;  3PIP L;  1RDA A;  4JKF A;  3KK2 A;  4L8R B;  5IWA K;  3HT3 A;  4H5W A;  3T7Z A;  3K5L A;  3CIP A;  4FWR A;  2A40 A;  4K8X A;  2E2O A;  3IS9 A;  3CJ9 A;  3MN7 A;  1N36 K;  2ASP A;  4FLZ A;  1A5W A;  5AJ3 K;  1OKJ A;  1I94 K;  2D0B A;  2WON A;  4YY3 K;  5GAD P;  4AHV A;  4CF8 A;  3PX4 A;  4NCA A;  3VQC A;  1CZ9 A;  3KD1 E;  1T44 A;  2D0O A;  5BPL A;  5LJW A;  2P9K A;  4MLE A;  2HHS A;  3UKR A;  3DXK B;  2GX9 A;  4CJ4 A;  3PSI A;  3C6A A;  3WNG A;  1D8Y A;  3DM2 A;  3WT0 A;  2QK9 A;  5B8H A;  1OH7 A;  4YOX A;  1SKR A;  2Q1N A;  3ZSQ A;  2EHG A;  5M1P A;  1RT6 A;  2F4V K;  1UWB A;  2YJF A;  4GY2 B;  5M1K A;  2P9U B;  3H45 C;  4E89 A;  3ZT4 A;  1RDC A;  5AQR A;  3CC7 N;  3I56 N;  4UQG A;  2YHX A;  2G8U A;  3U3G A;  2RPI A;  3CC2 N;  4H5R A;  1VQ8 N;  3QER A;  4ELU A;  4EIA A;  5C0Y A;  2NNW A;  2IAJ A;  5ADX A;  4HCB A;  5KGW A;  1RGI A;  3H46 O;  3RTV A;  3CJC A;  4B9M A;  3A0I X;  4FXD A;  5C2F A;  3H1Q A;  4Z4C A;  4DQP A;  2BUP A;  3D2F A;  1O13 A;  5AQP A;  1S3X A;  3J81 O;  1A5X A;  4G9Z A;  4IJN A;  1LW0 A;  4AHT A;  3JS6 A;  1Z25 A;  4C23 A;  3OYF A;  3MCP A;  4FM2 A;  3RVC A;  1GLF O;  3V9S A;  4FYD A;  1BCO A;  1RCH A;  2QW9 A;  4BR0 A;  4CZL A;  5CZ2 A;  4H8K A;  1T6C A;  3NF6 A;  4PKI A;  2DFH A;  1FK9 A;  4E1M A;  3D2E A;  1WSH A;  2Q3S A;  3I0S A;  4B8C A;  3BZK A;  1GLA G;  3E9L A;  3AAQ A;  1VQP N;  4FWO A;  4KI4 A;  3AVC A;  1WUA A;  2GEM A;  3VET A;  4DG1 A;  3Q7B A;  1JJ2 M;  3BDP A;  5KRS A;  3THX B;  4I7F A;  3JSM A;  4DQQ A;  2KTQ A;  4IZ9 A;  3VEY A;  1QVG M;  2W42 A;  1QZ5 A;  4B3T K;  3AGK A;  3QFU A;  2E20 A;  3HRG A;  4OPK A;  3U4L A;  4CJS A;  4WQ4 C;  4JEP A;  3IDH A;  1NGJ A;  4E7I A;  1XHZ A;  4O5B A;  2XY6 A;  4BRO A;  4HHT A;  4IKF A;  1B92 A;  2HVH A;  1VQ6 N;  5CYQ A;  3LPT A;  5GAH P;  2BAN A;  4LD0 A;  4Z4H A;  5AQH A;  2O8D A;  4HVJ A;  2Y1I A;  3C6T A;  3CJB A;  5HRS A;  1N8R O;  4BDY A;  3KLH A;  2HB5 A;  3O4W A;  4BR7 A;  4BE0 A;  1CXU A;  2QEX N;  4CJF A;  3PO4 A;  3CCL N;  3SMS A;  4W5T A;  1KVB A;  1BG3 A;  1FJG K;  3VGL A;  1YT3 A;  3V9W A;  1RTH A;  1J6Z A;  4B9S A;  3TAF A;  3O9T A;  4BRC A;  4RW9 A;  4RG8 A;  5J2M A;  1S1U A;  5FPE A;  4DR3 K;  3ZSZ A;  2P9I A;  3VER A;  3VQP A;  4DV5 K;  4LF9 K;  3QBX A;  1ASV A;  3DWL A;  3AA4 A;  4OGE A;  1Q18 A;  2O8E A;  1BA1 A;  3AVM A;  5AQI A;  1HPZ A;  4CHP A;  4DU4 A;  4O55 A;  4MQ3 A;  1QSS A;  4HTU A;  1RT3 A;  4DMN A;  3G4S N;  1JCF A;  3AA3 A;  4CZM A;  3LDQ A;  4FWL A;  4FJM A;  1KTQ A;  5HRP A;  5E84 A;  3HP6 A;  5JVH L;  1NGH A;  2HMI A;  5J2P A;  2P9L B;  1SV5 A;  2HHU A;  4HUE A;  4DR7 K;  1Z05 A;  1WLJ A;  1LWF A;  1T03 A;  1M1K O;  3NH2 A;  3RMA A;  1EQY A;  4RCH A;  2B6A A;  2VWJ A;  1L5U A;  4F2R A;  5JS2 A;  4H4M A;  5AQS A;  1LW2 A;  3KK7 A;  2IVP A;  3AAP A;  4H0O A;  4LFA K;  4IEE A;  2CGJ A;  3ID6 A;  2P9N A;  2G8V A;  3F9M A;  5FRM A;  4E19 A;  3C65 A;  3O9U A;  5J2N A;  1Q8I A;  4DB3 A;  5FDL A;  2VCP A;  1NJX A;  3K9K A;  3HYF A;  3OVN A;  2E6M A;  1TKX A;  4FLX A;  3U8X A;  3TSP A;  5I42 A;  3CCR N;  4QCL A;  2QXF A;  1T3V A;  3MED A;  1SQK A;  1E3M A;  2YHW A;  5F0X A;  4PA1 A;  3L2U A;  2QWP A;  3NFA A;  2HHT A;  4DWI A;  5C2D A;  2VWK A;  3VEV A;  1SKS A;  4IEI A;  3AGR A;  3H3N O;  3CJ7 A;  5AQU A;  4O8U A;  5AQV A;  4BRG A;  2UXD K;  2YHB A;  1RT4 A;  4BRF A;  2KFZ A;  5AQN A;  4KH4 A;  1S9G A;  4GV9 A;  3LP0 A;  2X6S A;  4AHU A;  5M1O A;  2J4R A;  2O4G A;  4JI4 K;  3S3N A;  2CH6 A;  5H1S Q;  1N32 K;  3MEG A;  4CEQ A;  3W0L A;  4FZY A;  3LAM A;  5AFU H;  3SMP A;  2P5O A;  1W2B M;  3VF4 A;  4EP4 A;  2PYL A;  2OZM A;  1SKW A;  1IBL K;  5FPM A;  3CD6 N;  2P9P A;  3ALY A;  4CJK A;  3FGU A;  4BDZ A;  3HZ6 A;  2QA4 N;  2FBX A;  3SBT A;  3K59 A;  4U67 L;  5C25 A;  4LF8 K;  4PQU A;  3EKS A;  1WSG A;  1KAY A;  4N41 A;  4DTR A;  3TI0 A;  4CEZ A;  4ELT A;  4BE1 A;  2QWO A;  3R6M A;  4A59 A;  3MXJ A;  4O0J A;  3QIO A;  2P5G A;  2QWL A;  2FF3 B;  3LDS A;  2HBL A;  3IAY A;  2QWM A;  3ZYY X;  4KKO A;  4NXM K;  3FZK A;  3KKS A;  3NHG A;  2VGN A;  1KQS M;  1F21 A;  2OPP A;  5AR0 A;  3CCU N;  3O9Q A;  4JK7 A;  3D2E B;  3MXM A;  3PSF A;  1RNH A;  1NGE A;  3I33 A;  1YUW A;  4DS5 A;  2HF4 A;  1GLE G;  4I2Q A;  5BPM A;  3V9U A;  2NRW A;  4BRQ A;  3WNE A;  3VQQ A;  3SQ0 A;  3HJF A;  4WE1 A;  4BR4 A;  1GLJ O;  4BRD A;  4PHT X;  4U7B A;  4FK0 A;  2E5L K;  4IG0 A;  3L8B A;  3LAN A;  1U48 A;  4W5N A;  4FK4 A;  3ZET A;  1ATR A;  3BF3 A;  5F1X A;  3FZL A;  3IRX A;  4M45 A;  3UIQ A;  1Q86 O;  1NGF A;  4JD2 A;  4Z4I A;  3CHW A;  4CK1 A;  4WF9 L;  4DR4 K;  4IO9 L;  3THW A;  4I2P A;  2O8D B;  2IOC A;  1HUX A;  3W3D A;  3CQX A;  4X62 K;  3WXL A;  3THY A;  4H5V A;  4JI2 K;  1LCU A;  2IS3 A;  3QEP A;  4K8Z A;  4WFN L;  2EWS A;  3MN9 A;  4JLH A;  1VAZ A;  4FJG A;  4B8A B;  3K5N A;  3ZSR A;  3OYJ A;  4DLE A;  4RW6 A;  3HOT A;  3PLA A;  4CZH A;  5BN9 A;  4FWP A;  4N5S A;  4FLV A;  2PBD A;  4FJJ A;  2QI2 A;  3SCX A;  5AZJ A;  2P9I B;  3OS2 A;  4CJ3 A;  5LMN K;  3ZEU B;  4BRM A;  4F4K A;  3D7E O;  3O1B A;  3VEZ A;  3QNO A;  5AQK A;  4Q0B A;  1HPM A;  1WSE A;  3ZX3 A;  4CBW A;  3CXC M;  3G25 A;  1HKC A;  3V9X A;  3VOV A;  1NGI A;  4CHZ A;  1VRU A;  3AVN A;  4I6M A;  3VGK A;  4DTN A;  3M8P A;  3CET A;  2GV9 A;  3DRS A;  3OS0 A;  2QXL A;  1BHL A;  1C1A A;  2IC3 A;  1YJ9 N;  4FJL A;  4YDU A;  1K8A O;  1BIU A;  1Q81 O;  4CJE A;  4AM6 A;  4YFU A;  4E7L A;  3J7Z O;  4M3T A;  2IVO A;  3JAM O;  4EHT A;  2HHV A;  3MN6 A;  2I7P A;  4CJV A;  3VQ7 A;  4AM7 A;  3DLR A;  5KTQ A;  4BGB A;  4CER A;  1GLL O;  2KFN A;  4DUY K;  4BE2 A;  4CFC A;  3M6G A;  3V1Q A;  1RBV A;  2P9N B;  3SUQ A;  2OPQ A;  1Q7Y O;  3P31 A;  2I5J A;  5EX5 A;  1BQN A;  5LL6 Z;  1L3V A;  4DCH A;  1TKZ A;  4EZ6 A;  5KQD A;  5KQ8 A;  3WXJ A;  1S1X A;  1EP4 A;  4KHW A;  2E8A A;  4IG3 A;  3MEC A;  1N33 K;  4BR2 A;  4EHU A;  3DOK A;  4IJA A;  4B9V A;  4IDH A;  2YNG A;  3DYA A;  1VSI A;  1QQC A;  2WBN A;  4B9Q A;  3HXM A;  4CZE A;  3TU5 A;  3H6E A;  5HRO A;  5AQL A;  4DFP A;  3EYZ A;  3SQ2 A;  1VQ4 N;  1KSP A;  4DQS A;  1DTT A;  3AO1 A;  1WSJ A;  1GOB A;  2HF3 A;  5FPD A;  4JKC A;  4WFB L;  3TAB A;  5BR9 A;  1WSI A;  2ZGY A;  2PFU A;  4K41 A;  4K25 A;  2IGI A;  5BN8 A;  1JXE A;  4FL9 A;  4CF1 A;  3KIO A;  1RBR A;  1IKX A;  1HR0 K;  3AVH A;  1SS6 A;  2W6L A;  3CCS N;  4EP5 A;  3O9S A;  4O8K A;  3CCV N;  2G8K A;  4DU1 A;  1NJY A;  2P9P B;  4CHQ A;  4CHO A;  1NMN A;  1QQN A;  3NGY A;  1HKG A;  3CI5 A;  4BRA A;  1NK5 A;  3VQ9 A;  2XY7 A;  3SUN A;  1X1P A;  3R1X A;  4M3U A;  4ISF A;  3ATU A;  3QIN A;  2KZZ A;  4KFB A;  4A57 A;  4B3O A;  4JN4 A;  1TGO A;  4IDK A;  4WCE L;  4KO0 A;  4BDP A;  4BRP A;  4PY5 A;  4IWV A;  1KLM A;  4LH4 A;  1HJO A;  4O5F A;  1BOT O;  4FLU A;  2F8T A;  4J2B A;  2V51 B;  4JKE A;  2GWJ A;  3EO3 A;  3QES A;  4KH5 A;  1GOC A;  3LDP A;  4JRP A;  2DY4 A;  3T1Y K;  3QO9 A;  5HLF A;  5BRD A;  1TKD A;  3SPZ A;  1HQU A;  4BG9 A;  2YI1 A;  1YHQ N;  2G8H A;  1BUP A;  4DSE A;  4FJ9 A;  1SL1 A;  3MWT A;  4M41 A;  3K58 A;  2A1R A;  3LPU A;  4FJI A;  4L3Q A;  1TVR A;  4J8F A;  1IG9 A;  1CZA N;  3PX0 A;  3OS1 A;  1QHT A;  1KFS A;  4KHP K;  3SQ4 A;  1KVA A;  3VA3 A;  1BL3 A;  1X9W A;  1NJW A;  3DOL A;  3N4Q A;  2CH5 A;  4BC5 A;  2F96 A;  3ZET B;  3KK3 A;  4XIU A;  1SAZ A;  1YXQ A;  3NCI A;  3OYI A;  4LF7 K;  1LOT B;  3HI0 A;  4FPB A;  4Z4G A;  3CJ1 A;  4KBO A;  1EXQ A;  5HRR A;  1SZ2 A;  4JD2 B;  1VRT A;  2X78 A;  2YKM A;  4B1X B;  1RIL A;  1S5J A;  4CEC A;  1WAF A;  4DQI A;  1IG8 A;  4MDA A;  3NGI A;  3NAE A;  3HPG A;  1WN7 A;  3E1Y A;  3CCM N;  4E7K A;  3THY B;  2QWN A;  4FJK A;  2OPR A;  4DFJ A;  1QSY A;  4JRQ A;  3AY9 A;  3ZX2 A;  4F3T A;  4NYF A;  3F73 A;  1TL3 A;  5I3U A;  1ZBL A;  2WTU A;  3C7N B;  4CF9 A;  1X3M A;  4BRK A;  5CHI A;  1C0T A;  2FSK A;  1XNQ K;  1ATN A;  1RBT A;  3M5R A;  3VES A;  5KGX A;  3RRG A;  3CJA A;  3ZLJ A;  3RRH A;  5AZJ B;  3AO5 A;  4N56 A;  3E9P A;  1OH6 A;  3H1V X;  1CXQ A;  4PL8 A;  3U9D A;  3M8S A;  3UKU A;  3P38 A;  4BRE A;  1ILY A;  2JWK A;  3VF6 A;  5JVG L;  1B9D A;  2HNZ A;  3LAL A;  3DLL L;  4FJX A;  4WYB A;  4I6M B;  2NLX A;  3DLB A;  4B08 A;  1NJI O;  3D6R A;  3P39 A;  4OPH A;  4AQY K;  2O4I A;  3WNF A;  1VSK A;  3O5B A;  5C12 A;  3EN9 A;  1U45 A;  2FBY A;  1S22 A;  3E01 A;  2NRT A;  1HYV A;  3DJC A;  1D4X A;  3KLI A;  1U2V B;  1X9S A;  3LM2 A;  1J53 A;  4B9U A;  1JLG A;  4JYA K;  3CCJ N;  1JLQ A;  1QS4 A;  2OAN A;  2IVN A;  2FBV A;  4OKJ A;  1TYQ A;  3RR8 A;  3A2F A;  3K0S A;  1C0G A;  4CJR A;  4DFM A;  4OPJ A;  3M3Z A;  3VEN A;  3NH1 A;  2Y1J A;  3MN5 A;  1YJN N;  1IKW A;  3EKU A;  4CZG A;  4FM1 A;  3S3M A;  5M1F A;  1RT2 A;  1S1T A;  4AHC A;  4J2D A;  4E7J A;  1NJZ A;  3EZ5 A;  2OTL N;  3ENO A;  5FPN A;  2BE2 A;  1QSL A;  4ISG A;  1XHX A;  3UE5 A;  2HNY A;  4NYN A;  4ZHR A;  1ATS A;  4CED A;  4R79 A;  4CGG A;  1EKE A;  4DS4 A;  5K14 A;  2E4L A;  4FWS A;  4JV5 K;  4QOZ B;  1BA0 A;  5FLX O;  4CZJ A;  4WFA L;  4V19 S;  3FLC O;  1UA1 A;  2XY5 A;  4DU3 A;  3O3H A;  5AQX A;  1VSH A;  1QVF M;  4IFE A;  2UUB K;  2V7Y A;  1YTA A;  3CFO A;  4DF8 A;  3O4Q A;  4DF4 A;  4ID1 A;  1JCE A;  3D0P A;  4QS7 A;  3IG1 A;  1TAQ A;  1MWK A;  2VQE K;  4RW4 A;  3VGM A;  5ELZ A;  1U6Z A;  2D0P A;  4FOE A;  1C0U A;  2ASO A;  1TK5 A;  3AVA A;  1NGB A;  1OVY A;  4OJR A;  5DMR A;  4M7X A;  3R3L A;  4CJQ A;  4MFB A;  1Q82 O;  1NGG A;  1WBB A;  2HOE A;  4FCY A;  2P1J A;  4AIL C;  4KHS A;  4XH5 A;  2A5X A;  1K8K A;  4O0I A;  1JLE A;  4I9L A;  5CE3 A;  5MLC Q;  3L4Q A;  4CIG A;  5C24 A;  1VQO N;  2QKB A;  4JKG A;  3TAE A;  3CQ8 A;  3G0Z A;  4M63 C;  1DEJ A;  1TUU A;  3IKM A;  3B6P A;  3CG7 A;  1C0M A;  1ZBI A;  3DLG A;  4DHY A;  5AQZ A;  4FLW A;  3A5O C;  2NRZ A;  2KQ2 A;  4K42 A;  5AQO A;  3A8Y A;  3AVK A;  4CF0 A;  3T3F A;  4DSI A;  2YNH A;  1VSE A;  4FPA A;  1QTM A;  3SK3 A;  1TV6 A;  4BWM A;  3CFP A;  3TTF A;  1KAZ A;  3ITH A;  4BC3 A;  4EFH A;  2EX3 A;  4DR6 K;  2YX6 A;  1REV A;  4C1N K;  3VEX A;  3EE8 A;  1TAU A;  4DFK A;  1FKO A;  4B9T A;  3V9Z A;  4YOR A;  3V81 A;  3L3V A;  3VQ6 A;  2YKN A;  1NNE A;  1ESV A;  2HHX A;  4H0Y B;  4HCC A;  3ZSV A;  4CI6 A;  3OYB A;  2Z1H A;  4IOX A;  3OJS A;  1K73 O;  2ZF5 O;  2RHK A;  2P9K B;  3BZC A;  2UYT A;  4B9N A;  3UKR B;  1NGA A;  2ZJR L;  1KCF A;  1QE1 A;  3CFR A;  1N34 K;  4C8N A;  1NK9 A;  2OZS A;  4CD3 A;  1YVU A;  4C8O A;  3QEW A;  4FVU A;  2B5J A;  4QS8 A;  5C15 A;  1ZBS A;  3ISN C;  3NGZ A;  1IKV A;  1R59 O;  4E0D A;  1OH5 A;  4FJ7 A;  1YJW N;  3V6D A;  4N76 A;  2QWQ A;  3QML A;  1DKG D;  2HBM A;  3UKU B;  1HNZ K;  4ID5 A;  3VN5 A;  1Y64 A;  3CCQ N;  1WOQ A;  3KK1 A;  4W5O A;  3VQ5 A;  3AVL A;  2H3G X;  4UY8 O;  3SBG A;  3VEO A;  4AF1 A;  3LZJ A;  5DM7 L;  4XH1 A;  3TSQ A;  4CEF A;  3E9O A;  5KPR A;  3P4I A;  2IDO A;  1KVC A;  3D2F B;  1HNI A;  4LH5 A;  2KKZ A;  1BGX T;  2HHW A;  3TR8 A;  4J2A A;  2KW4 A;  4G1Q A;  2YJE A;  1NG9 A;  4A2B A;  1Q9X A;  2JWL A;  2RN2 A;  5AQF A;  4Z4F A;  4ILJ A;  1TYQ B;  4JI6 K;  3EY1 A;  4DKW A;  3KHY A;  2OTJ N;  3KTQ A;  4LF4 K;  3QIP A;  3VPZ A;  4KRE A;  2OPS A;  3LP3 A;  2QTD A;  3WUH A;  3EL2 A;  4YOY A;  3TAG A;  3KLF A;  3ZX0 A;  4DTJ A;  2Q97 A;  3BEX A;  2AP1 A;  1W7A A;  3VQ4 A;  5AQW A;  4GNI A;  3SJH A;  1Y97 A;  2ZM6 K;  3KD5 E;  2PAV A;  5F2R A;  1IBK K;  4CJT A;  1IJJ A;  4BR9 A;  4DLG A;  3VA0 A;  5C10 A;  4CJ7 A;  3CPE A;  2BH1 A;  2FSN A;  3G6E N;  2ASM A;  4BWJ A;  4AHR A;  2NRH A;  3TAR A;  1XC9 A;  1DLO A;  3PY8 A;  3ULE A;  4DTS A;  4FZZ A;  5SZT A;  1HNW K;  3TSU A;  3VMF B;  1TL1 A;  1D5A A;  4GVM A;  4FM0 A;  1KXP A;  1S6P A;  5EU7 A;  3NH0 A;  4JI1 K;  3HBT A;  1YIJ N;  4BG8 A;  4A5B A;  2DFE A;  2VG7 A;  2HHH K;  1HNX K;  1LWE A;  4PKH A;  1W97 L;  3MWP A;  1BI4 A;  3AO3 A;  3AVI A;  3SYZ A;  4LF6 K;  3LP1 A;  3TTD A;  4OPA A;  3ZT0 A;  2O8C A;  3LP2 A;  4JI5 K;  4A5A A;  4B3R K;  4FW2 A;  3I8D A;  4GVE A;  2UUC K;  5C42 A;  2I7N A;  2HVI A;  2F7T A;  3EZW A;  4FVM A;  3H08 A;  3VQB A;  3WQU A;  1HNV A;  3TPQ A;  5AQY A;  5EY4 A;  4JI0 K;  3NDK A;  1MDU B;  5JLF A;  4HUG A;  1LAW A;  1J54 A;  1K8K B;  4CBU A;  3L2Q A;  2O8E B;  4LSL A;  1RDD A;  1J5O A;  4JI8 K;  1JL2 A;  3J7A P;  4JKB A;  3FZM A;  2W41 A;  4DV7 K;  4JKH A;  4FZX C;  3A5M C;  3KVG A;  1TKT A;  1NK8 A;  5D3G A;  2WC9 A;  5AQT A;  3C6H A;  1YAG A;  2A41 A;  5KRT A;  1NMD A;  3BUZ B;  3HM9 A;  3ZSY A;  2P9S A;  2Z1J A;  2PZS A;  3SAH A;  4CJW A;  5AFU A;  4M3Y A;  5CY4 A;  1D9F A;  4EZ9 A;  4H5T A;  4Z0U A;  3DI6 A;  3OYN A;  4FWN A;  4X64 K;  3BP8 A;  1FKP A;  3WEE A;  2VWB A;  4NO7 A;  2F8S A;  1RDU A;  1P90 A;  3L6Q A;  1U4B A;  4CK2 A;  1DGK N;  3O4N A;  4FLY A;  4IOA L;  3PIO L;  4B1Y B;  3MX2 A;  2E1Z A;  4BRN A;  4DV6 K;  4DSK A;  3MX5 A;  2ETJ A;  5LMU K;  1JCG A;  2DTU A;  3OHR A;  1IH7 A;  3SV4 A;  4KRF A;  4OX9 K;  4GKJ K;  4WQ5 A;  1RBS A;  1W0H A;  4M42 A;  2B4J A;  2UXB K;  1JLF A;  4JI7 K;  4Z94 A;  1JXB A;  4CCH A;  3ENB A;  1VSF A;  3O3F A;  4QS9 A;  1YTU A;  5LJV A;  1WBD A;  2DFF A;  3CYM A;  3THX A;  3AVB A;  5GAG P;  3LDL A;  3KJV A;  3OBY A;  3QLH A;  2HBJ A;  4C8M A;  3DLK A;  4H0P A;  4B9L A;  3V1O A;  4F8R A;  4B1Z A;  4E3S A;  1NGC A;  2HST A;  4DUZ K;  4OO1 J;  4IO8 A;  1GLB G;  4LF5 K;  4GW6 A;  4KI6 A;  3AA2 A;  3ID8 A;  1O1W A;  2FF6 A;  2E6L A;  3SI6 A;  1S9E A;  4XEI A;  4KTZ A;  4H03 B;  1X9J A;  5ADX H;  3HST B;  2VYP A;  4YOU A;  4BQL A;  4E7H A;  3ZSO A;  3VQA A;  2Z1I A;  4DTX A;  3FR0 A;  2LSN A;  3F9K A;  3SUP A;  2HHQ A;  3OYA A;  1YIT N;  4A62 A;  5JS1 A;  3OY9 A;  4CVN E;  4NCB A;  2ITG A;  4YDU C;  4KHQ A;  3DAW A;  4BRH A;  4JK8 A;  2BGG A;  5IT9 O;  3R8E A;  1A5V A;  4KTW A;  1C1B A;  2AA4 A;  3NF9 A;  4N47 A;  3VTH A;  2P51 A;  3VQD A;  1EWR A;  5JLH A;  1XMQ K;  3CM6 A;  3LWL A;  3AAR A;  1BWF O;  2FSJ A;  4M3W A;  4OKK A;  1MA9 B;  1QQM A;  1KAX A;  4LFC K;  4YOW A;  4CGH A;  5J2Q A;  3UB5 A;  3SZ2 A;  4WQ5 C;  1RTI A;  2V52 B;  3K5M A;  3LAK A;  3T69 A;  1S6Q A;  3L2R A;  3KWI A;  2GUP A;  1SL2 A;  3ULE B;  4EAH D;  2P9L A;  3L4I A;  3CCE N;  3VQ8 A;  4E1N A;  5BR8 K;  5T7B A;  4OVL A;  1BO5 O;  2F9W A;  4CF2 A;  3THW B;  4B1W B;  3MDQ A;  1C0F A;  3DXM A;  5AQQ A;  2BDP A;  4CHY A;  4M3Z A;  3TWH A;  2G8I A;  3OYG A;  1BQM A;  1NK4 A;  1BI4 B;  1WSF A;  2KZM A;  2O8C B;  1G99 A;  1RTJ A;  1T6D A;  4BGA A;  3QBW A;  1LWC A;  4X66 K;  2XHB A;  2KLA A;  4PKG A;  2XO7 A;  3HSC A;  3CMA N;  4B3M K;  4NXN K;  2IIR A;  3VF2 A;  3L2V A;  3TAP A;  2GBZ A;  2D0C A;  2ZJP L;  4CGD A;  1HLU A;  1V4S A;  3LDO A;  4FWQ A;  5HOO A;  2NRV A;  1NK6 A;  3VTI A;  4JHD A;  1XMO K;  4WQ4 A;  3OYH A;  3TTC A;  4YOT A;  4KV8 A;  4CGJ A;  4CFB A;  4LSN A;  1YI2 N;  4CEO A;  1S1W A;  2QWR A;  3CM5 A;  4FJH A;  1BIZ A;  4BC2 A;  2ZQB A;  1DTQ A;  4H4O A;  4CBX A;  3L0Q A;  2D5R A;  1XUP O;  4JKA A;  2P9S B;  2Q31 A;  3H3O B;  3MAQ A;  1R0A A;  4JI3 K;  4I9Q A;  3FE1 A;  1NGD A;  3HPO A;  3O08 A;  1YVN A;  3HTV A;  3DMJ A;  1HX1 A;  1BDG A;  3CQY A;  3I0R A;  1H1V A;  3L3U A;  1VSL A;  3WEE B;  4C8L A;  3F5T A;  3ZCM A;  4CFD A;  3GL1 A;  3J7Y P;  1HRH A;  4CEE A;  3QNN A;  4CEA A;  3O6W A;  1XQS C;  3M8Q A;  3O1W A;  3AO2 A;  2G8W A;  4Z4E A;  4BVO A;  3U3Y A;  3ZT2 A;  2YNI A;  2V7Z A;  4DTU A;  5AQJ A;  4RW8 A;  1K9M O;  2Q2R A;  3CC4 N;  3OBW A;  5GIO A;  4RTF D;  4DR2 K;  3LZI A;  1ZXO A;  3AV9 A;  3HVR A;  1TK0 A;  1OVQ A;  3Q7C A;  3T19 A;  1EWQ A;  1YF5 L;  2JGU A;  3P5J A;  1IV0 A;  1E4F T;  2HBK A;  1NKB A;  4FW1 A;  4BAC A;  3K5O A;  4KB1 A;  4CEB A;  3PUF A;  3QEI A;  1D9D A;  3KLG A;  1NM1 A;  5GIN A;  1WB9 A;  4K43 A;  4NLB A;  5AZI A;  2OA8 A;  4ILH A;  4E1J A;  4Y0W A;  2Q0R A;  1P8Z A;  4B1U B;  3MXI A;  2UXC K;  2OYQ A;  3C94 A;  5J1E A;  3E66 A;  1NK0 A;  4RWT A;  2HND A;  1KFD A;  1VSJ A;  3WXK A;  1T8E A;  5HBM A;  1VQ5 N;  1VQN N;  2G8F A;  5BPN A;  5LY3 A;  4CGI A;  2GUI A;  1KD1 O;  2RE2 A;  4YHH K;  2FBT A;  4IFY A;  5I9E B;  4FSV A;  4ZTJ A;  3V1R A;  5DK5 A;  4J2E A;  1EX4 A;  3PO5 A;  3CER A;  4QAG A;  1B9F A;  4F3O A;  3KZB A;  3HO1 A;  4MDB A;  3WQT A;  4FO0 A;  5HL7 L;  3TAN A;  4GV6 A;  3ENH A;  3B8A X;  1RDW X;  3MK6 A;  2R7Y A;  2WOM A;  3CF5 L;  1RDB A;  4CJP A;  2AJQ A;  1DT9 A;  3NF7 A;  5AQG A;  2BTF A;  2O8B A;  2F9T A;  3OYK A;  2D0A A;  1VSM A;  2WFB A;  3ZEU A;  3OYD A;  4BC4 A;  5FRN A;  1NOY A;  1NWK A;  2YHY A;  4JS4 A;  1KLN A;  4ISE A;  1U49 A;  4B1V A;  2WUS A;  1Q9Y A;  1ITG A;  2E2N A;  1BCM A;  4BVP A;  1I3A A;  5CR4 A;  3HVT A;  5KPZ A;  4KHU A;  4DV4 K;  1ZYQ A;  3AVJ A;  4DR1 K;  3LDN A;  4CHN A;  3M1F A;  5CZ1 A;  3HM8 A;  4F9O A;  1ZBF A;  5HP1 A;  4CD1 A;  3ZT1 A;  3HPH A;  1U04 A;  3HK2 A;  5M1Q A;  5GIP A;  2YNF A;  2XRI A;  1VQK N;  3AO4 A;  4YNQ A;  3FFI A;  3AVF A;  3K2P A;  4PWD A;  1KC8 O;  1WNS A;  3T1A A;  3ZSX A;  5AQM A;  4Y1C A;  3FZH A;  1IKY A;  3P83 D;  4CZK A;  3O3G A;  3DXM B;  2VG5 A;  4KHN A;  4CIE A;  3GDQ A;  3OA9 A;  1RTD A;  3DRP A;  3B6O A;  1J5E K;  1VQ9 N;  1BIS A;  1RBU A;  4R5P A;  4LY7 A;  3FFK B;  3HL8 A;  3LL3 A;  3I8B A;  3RMB A;  2O8F A;  3ATV A;  4M3X A;  4B3S K;  5EXW A;  3IUC A;  2A42 A;  4CJL A;  3QET A;  1NU0 A;  1VK0 A;  3NVM A;  4CK3 A;  4GV3 A;  1ASU A;  4JHD B;  1IBM K;  1N5Y A;  1BU6 O;  3O80 A;  3BY5 A;  4OLA A;  1SUQ A;  4CGF A;  4HUF A;  1OH8 A;  4LFB K;  3SV3 A;  2GTD A;  4DV3 K;  1JLA A;  3SNN A;  1GOA A;  4AHS A;  4C8K A;  1JL1 A;  3OYL A;  4H5N A;  3KLE A;  4Y1D A;  2D1K A;  1SL0 A;  4BQZ A;  3NE6 A;  2E1Y A;  3QEX A;  3ZSW A;  1HQE A;  3ZT3 A;  1VSD A;  4IXC A;  4DSL A;  1NOZ A;  4FWK A;  5FRO A;  3U9Z A;  3RSE A;  1V4T A;  2QKK A;  3SLC A;  5TKW A;  3TAQ A;  4OKE A;  4KB0 A;  1C6V A;  2GEL A;  1MWM A;  2RF2 A;  4OGC A;  2W6K A;  1LV5 A;  4NCG A;  5BRH A; 
#chains in the Genus database with same CATH homology
 1HJR A;  2OPR A;  1IH7 A;  3C95 A;  3G10 A;  3SV4 A;  4DFJ A;  1QSY A;  4JRQ A;  4KRF A;  3SUO A;  4F3T A;  1YT3 A;  4NYF A;  3F73 A;  1TL3 A;  2PY5 A;  1I39 A;  5I3U A;  3V9W A;  1RBS A;  1ZBL A;  1RTH A;  1W0H A;  4CF9 A;  2B4J A;  4M42 A;  4M3R A;  4B9S A;  1U47 A;  3TAF A;  1C0T A;  4RW9 A;  4RG8 A;  1JLF A;  5J2M A;  1S1U A;  1RBT A;  3ZSZ A;  4KTQ A;  3HP9 A;  3VQP A;  1LAV A;  5KGX A;  1JXB A;  1ASV A;  4CCH A;  3RRG A;  3AA4 A;  4OGE A;  4FLT A;  3RRH A;  3AVM A;  3JYT A;  1JLC A;  3AO5 A;  3RMD A;  1HPZ A;  1VSF A;  3O3F A;  4CHP A;  4DU4 A;  1YTU A;  4O55 A;  4N56 A;  4MQ3 A;  1QSS A;  3C6U A;  4HTU A;  1RT3 A;  1HMV A;  2DFF A;  3CYM A;  4DMN A;  1CXQ A;  3AVB A;  3M8S A;  3THV A;  2RKI A;  3L2W A;  3AA3 A;  4PUO A;  3P1G A;  4OLB A;  3RR7 A;  1MU2 A;  3KJV A;  3DRR A;  3QLH A;  3V4I A;  4FJM A;  1KTQ A;  4C8M A;  5HRP A;  3HP6 A;  3DLK A;  4B9L A;  1B9D A;  2HNZ A;  3LAL A;  3V1O A;  3RMC A;  4FJX A;  4F8R A;  2HMI A;  4E3S A;  5J2P A;  4F2S A;  1K6Y A;  1SV5 A;  3ULD A;  4B08 A;  3DLB A;  2HHU A;  4HUE A;  1J9A A;  1WLJ A;  2O4I A;  4GW6 A;  4KI6 A;  3OJU A;  1LWF A;  3AA2 A;  3WNF A;  3NH2 A;  3RMA A;  1T03 A;  1TK8 A;  1O1W A;  1VSK A;  1UOC A;  2B6A A;  2E6L A;  3SI6 A;  2VWJ A;  1S9E A;  4KTZ A;  2ZE2 A;  1JKH A;  1L5U A;  5JS2 A;  2FBY A;  1U45 A;  4F2R A;  3HST B;  3SQ1 A;  4H4M A;  3E01 A;  4W5Q A;  1HYV A;  4E7H A;  1LW2 A;  3ZSO A;  3VQA A;  3KLI A;  1UA0 A;  2Z1I A;  4DTX A;  1X9S A;  1J53 A;  2LSN A;  4B9U A;  1JLG A;  3F9K A;  3SUP A;  4GMJ B;  4CE9 A;  1JLQ A;  3OYA A;  1QS4 A;  2G8V A;  2HHQ A;  3WNH A;  5FRM A;  4E19 A;  5JS1 A;  3OY9 A;  2FBV A;  5J2N A;  1Q8I A;  4O4G A;  4OKJ A;  5FDL A;  1NJX A;  3RR8 A;  3A2F A;  3ASM A;  3HYF A;  2ITG A;  2E6M A;  1TKX A;  3OVN A;  4FLX A;  4CJR A;  4DFM A;  3K57 A;  3S9H A;  4OPJ A;  4KHQ A;  5I42 A;  2YV0 X;  3NH1 A;  1N6Q A;  2Y1J A;  3OYC A;  1RT7 A;  1L3S A;  4QCL A;  2QXF A;  1IKW A;  4CJ5 A;  1T7P A;  4FM1 A;  3S3M A;  1RT2 A;  3MED A;  3MEE A;  4DTP A;  2FC0 A;  1S1T A;  4AHC A;  1ZBU A;  2PYJ A;  4J2D A;  4E7J A;  1NJZ A;  3EZ5 A;  2BGG A;  1Z26 A;  1A5V A;  4CES A;  4KTW A;  2BE2 A;  1C1B A;  3D45 A;  1QSL A;  3NF9 A;  4PA1 A;  1XHX A;  4N47 A;  3L2U A;  1JLB A;  2HNY A;  4NYN A;  2HHT A;  3NFA A;  4ZHR A;  4CED A;  2P51 A;  3LWM A;  4DWI A;  2VWK A;  3VQD A;  1SKS A;  4DSF A;  4CGG A;  3DLH A;  1EKE A;  3CM6 A;  5K14 A;  4DS4 A;  2E4L A;  3LWL A;  1T05 A;  2YHB A;  4M3W A;  4OKK A;  1RT4 A;  4QOZ B;  2YHA A;  2KFZ A;  1S9G A;  4CGH A;  5J2Q A;  3SPY A;  1CZB A;  3LP0 A;  3SZ2 A;  1RTI A;  5SWM A;  2X6S A;  1XWL A;  4AHU A;  3K5M A;  3LAK A;  2O4G A;  1S6Q A;  3L2R A;  5HRN A;  3S3N A;  1UA1 A;  2HW3 A;  3MEG A;  4CEQ A;  1SL2 A;  3VQE A;  2XY5 A;  4DU3 A;  3PX6 A;  3O3H A;  3VQ8 A;  1VSH A;  3LAM A;  4FZY A;  4E1N A;  3AVG A;  3NF8 A;  5T7B A;  2P5O A;  1YTA A;  3CFO A;  4DF8 A;  1KRP A;  3O4Q A;  2JLE A;  4OVL A;  4EP4 A;  4DF4 A;  3QEV A;  1L3U A;  2ZD1 A;  1C1C A;  4ID1 A;  1SKW A;  2OZM A;  3D0P A;  4CF2 A;  1ZBH A;  1G15 A;  3ALY A;  3IG1 A;  4CJK A;  1TAQ A;  1RT5 A;  4BDZ A;  4DTM A;  3OYE A;  2BDP A;  2FBX A;  4CHY A;  3U6F A;  4RW4 A;  4M3Z A;  3K59 A;  3OYM A;  3TWH A;  5C25 A;  4PQU A;  2G8I A;  3OYG A;  1BQM A;  1NK4 A;  1WSG A;  1BI4 B;  1EET A;  4DTO A;  1C0U A;  1TK5 A;  3AVA A;  4DTR A;  1WSF A;  3TI0 A;  2Z1G A;  4CEZ A;  4N41 A;  2KZM A;  4OJR A;  4ELT A;  4BE1 A;  2ATQ A;  1RTJ A;  5DMR A;  4CJQ A;  3MXJ A;  4MFB A;  1LWC A;  4O0J A;  1X9M A;  3RWU A;  3QIO A;  2XHB A;  1WAJ A;  4TSX A;  2XO7 A;  2P5G A;  3LDS A;  4FCY A;  2P1J A;  4AIL C;  3IAY A;  4KKO A;  4JS5 A;  1S1V A;  3L2V A;  3TAP A;  4DSJ A;  2GBZ A;  4O0I A;  1JLE A;  2D0C A;  3KKS A;  4CGD A;  3NHG A;  4I9L A;  2OPP A;  1F21 A;  4IBN A;  4CIG A;  5C24 A;  1NK6 A;  2QKB A;  2X74 A;  1NK7 A;  3OYH A;  3TAE A;  3MXM A;  3CQ8 A;  3G0Z A;  1RNH A;  2XY8 A;  4KB0 A;  4KV8 A;  3NBP A;  4CGJ A;  1RT1 A;  4DS5 A;  4CFB A;  4LSN A;  5CYM A;  4CEO A;  4I2Q A;  1S1W A;  3B6P A;  3CM5 A;  4FJH A;  1BIZ A;  2ZQB A;  3CG7 A;  3V9U A;  1C0M A;  1DTQ A;  3WNE A;  4FJ8 A;  1ZBI A;  3DLG A;  1FXX A;  4H4O A;  2VG6 A;  3VQQ A;  4FLW A;  3SQ0 A;  4WE1 A;  3HJF A;  2D5R A;  1NKE A;  4AH9 A;  3MAQ A;  1R0A A;  4I9Q A;  2KQ2 A;  1ASW A;  4IFV A;  3AVK A;  4CF0 A;  3HPO A;  4ICL A;  3S3O A;  4FK0 A;  3DMJ A;  4IG0 A;  3L8B A;  3LAN A;  3T3F A;  1U48 A;  2YNH A;  1VSE A;  4DSI A;  4FK4 A;  4W5N A;  4RW7 A;  3UIQ A;  3IRX A;  4M45 A;  1QTM A;  3I0R A;  3L3U A;  1TV6 A;  4BWM A;  3CFP A;  1VSL A;  1XI1 A;  4Z4I A;  4C8L A;  3ITH A;  1CLQ A;  3ZCM A;  4CK1 A;  4CFD A;  1IO2 A;  4DQR A;  4I2P A;  2NUB A;  1HRH A;  4CEE A;  2EX3 A;  2IOC A;  1REV A;  3QNN A;  3TAM A;  1U4B A;  4CEA A;  4CFA A;  1TAU A;  4DFK A;  1FKO A;  2IS3 A;  3QEP A;  3M8Q A;  4KHS A;  2G8W A;  3AO2 A;  4B9T A;  4Z4E A;  4CIF A;  4O44 A;  3V9Z A;  4K8Z A;  2X6N A;  3V81 A;  3L3V A;  3ZT2 A;  3U3Y A;  2YNI A;  4JLH A;  3BGR A;  1L3T A;  3VQ6 A;  2YKN A;  4DTU A;  4RW8 A;  3DLE A;  3SJJ A;  4ZTF A;  4HCC A;  2HHX A;  4FJG A;  4B8A B;  3ZSV A;  3ZSR A;  3OYJ A;  3M8R A;  4CJU A;  3K5N A;  4DLE A;  4RW6 A;  3OYB A;  2Z1H A;  4FJ5 A;  5KI6 A;  3OJS A;  1HYS A;  4N5S A;  4FLV A;  4FJJ A;  4B9N A;  3LZI A;  3AV9 A;  3HVR A;  1TK0 A;  1KCF A;  3SCX A;  1QE1 A;  1UAX A;  1W9H A;  4KHY A;  4W5R A;  3OS2 A;  3T19 A;  3CFR A;  4CJ3 A;  3PV8 A;  3AA5 X;  4C8N A;  1NK9 A;  2OZS A;  4F4K A;  1YVU A;  4C8O A;  4Q5V A;  3QEW A;  2B5J A;  4KPY A;  2JGU A;  3ISN C;  3NGZ A;  1IKV A;  4E0D A;  3P5J A;  5E41 A;  3QNO A;  4Q0B A;  4FJ7 A;  1WSE A;  3V6D A;  4N76 A;  4FK2 A;  4KAZ A;  3V9X A;  4ELV A;  1NKB A;  4FW1 A;  4ID5 A;  4BAC A;  3K5O A;  4KB1 A;  4CEB A;  4CHZ A;  1NKC A;  1VRU A;  3AVN A;  1HYZ A;  3PUF A;  3VN5 A;  3KLG A;  3QEI A;  1D9D A;  4DTN A;  2A1S A;  3M8P A;  2GV9 A;  2OA8 A;  3DRS A;  3OS0 A;  4FJN A;  1BHL A;  3KKR A;  3KK1 A;  1C1A A;  4W5O A;  2IC3 A;  3MXI A;  3VQ5 A;  3AVL A;  2OYQ A;  3C94 A;  4FJL A;  1RDA A;  5J1E A;  3KK2 A;  1BIU A;  4L8R B;  4CJE A;  3LZJ A;  4YFU A;  4E7L A;  1NK0 A;  3HT3 A;  4CEF A;  2HND A;  3K5L A;  4M3T A;  1KFD A;  1VSJ A;  2HHV A;  2IDO A;  1T8E A;  5HBM A;  2PYL A;  1KVC A;  4CJV A;  3VQ7 A;  3DLR A;  5KTQ A;  4CER A;  2G8F A;  2KFN A;  1HNI A;  4LH5 A;  2GUI A;  4CFC A;  4CGI A;  4BE2 A;  4K8X A;  1BGX T;  3IS9 A;  2HHW A;  3TR8 A;  4J2A A;  2KW4 A;  3V1Q A;  4G1Q A;  2FBT A;  4IFY A;  1RBV A;  3SUQ A;  4ZTJ A;  3V1R A;  2OPQ A;  4FLZ A;  5DK5 A;  1Q9X A;  4J2E A;  2RN2 A;  1A5W A;  1EX4 A;  4Z4F A;  3PO5 A;  4QAG A;  2I5J A;  3EY1 A;  1B9F A;  1BQN A;  2D0B A;  1L3V A;  1TKZ A;  3KTQ A;  4EZ6 A;  4F3O A;  2WON A;  1S1X A;  3HO1 A;  1EP4 A;  3QIP A;  4NCB A;  4KHW A;  4AHV A;  4IG3 A;  4CF8 A;  3PX4 A;  2OPS A;  3TAN A;  3VQC A;  1CZ9 A;  3MEC A;  4NCA A;  3KD1 E;  4KRE A;  3LP3 A;  3DOK A;  2WOM A;  2R7Y A;  1RDB A;  4CJP A;  2AJQ A;  3NF7 A;  4B9V A;  2HHS A;  2YNG A;  4CJ4 A;  3TAG A;  3DYA A;  3KLF A;  1VSI A;  1QQC A;  4DTJ A;  3WNG A;  3OYK A;  3HXM A;  2D0A A;  3DM2 A;  3VQ4 A;  5HRO A;  1D8Y A;  2QK9 A;  1VSM A;  4DFP A;  3EYZ A;  3OYD A;  3SQ2 A;  1Y97 A;  3KD5 E;  1KSP A;  5FRN A;  4DQS A;  3ZSQ A;  1SKR A;  1NOY A;  1DTT A;  2EHG A;  3AO1 A;  4CJT A;  4JS4 A;  4DLG A;  3VA0 A;  1KLN A;  1U49 A;  1RT6 A;  1UWB A;  1Q9Y A;  1ITG A;  1WSJ A;  1BCM A;  4E89 A;  1I3A A;  3ZT4 A;  1RDC A;  1GOB A;  3HVT A;  4BWJ A;  4AHR A;  4KHU A;  3TAB A;  3TAR A;  4UQG A;  1ZYQ A;  3AVJ A;  2G8U A;  1XC9 A;  1DLO A;  3U3G A;  4CHN A;  1WSI A;  2RPI A;  5CZ1 A;  3PY8 A;  1ZBF A;  4DTS A;  3QER A;  5SZT A;  5HP1 A;  2IGI A;  4ELU A;  4FZZ A;  3ZT1 A;  1JXE A;  1TL1 A;  2IAJ A;  3HPH A;  1D5A A;  1U04 A;  4GVM A;  4FM0 A;  5KGW A;  4CF1 A;  4HCB A;  3HK2 A;  3KIO A;  1RBR A;  2YNF A;  1IKX A;  1S6P A;  2XRI A;  3AO4 A;  5EU7 A;  4YNQ A;  3FFI A;  3AVF A;  3AVH A;  3K2P A;  3NH0 A;  3RTV A;  4E7K A;  4PWD A;  1WNS A;  3T1A A;  4FJK A;  2DFE A;  2VG7 A;  3ZSX A;  4B9M A;  1LWE A;  4EP5 A;  2G8K A;  4FXD A;  4Y1C A;  4DU1 A;  1NJY A;  4Z4C A;  4DQP A;  4CHQ A;  4CHO A;  1IKY A;  3P83 D;  3O3G A;  1BI4 A;  3AO3 A;  3AVI A;  2VG5 A;  3SYZ A;  4KHN A;  1A5X A;  3LP1 A;  3NGY A;  4CIE A;  1NK5 A;  3ZT0 A;  3LP2 A;  3VQ9 A;  2XY7 A;  3SUN A;  1LW0 A;  1RTD A;  4FW2 A;  3I8D A;  3DRP A;  1X1P A;  4AHT A;  4M3U A;  5C42 A;  2HVI A;  3B6O A;  1Z25 A;  3OYF A;  4FVM A;  1BIS A;  1RBU A;  3H08 A;  3QIN A;  3VQB A;  4R5P A;  4LY7 A;  4FM2 A;  2KZZ A;  3HL8 A;  4KFB A;  3V9S A;  3RMB A;  4B3O A;  4FYD A;  1BCO A;  1RCH A;  1TGO A;  4M3X A;  1HNV A;  4IDK A;  5CZ2 A;  4KO0 A;  4H8K A;  3NF6 A;  4BDP A;  4PY5 A;  3NDK A;  1KLM A;  4LH4 A;  4CJL A;  3QET A;  4FLU A;  2F8T A;  2DFH A;  1FK9 A;  4E1M A;  1VK0 A;  4HUG A;  1LAW A;  1J54 A;  4J2B A;  1WSH A;  3L2Q A;  2Q3S A;  3I0S A;  1RDD A;  4LSL A;  4B8C A;  4CK3 A;  1JL2 A;  1J5O A;  1ASU A;  3QES A;  3AVC A;  4KI4 A;  1GOC A;  4FZX C;  4DG1 A;  1TKT A;  4JRP A;  1NK8 A;  3BDP A;  5D3G A;  5KRS A;  2DY4 A;  1N5Y A;  4I7F A;  3QO9 A;  5HLF A;  1TKD A;  3JSM A;  3SPZ A;  1HQU A;  4DQQ A;  4OLA A;  1SUQ A;  2KTQ A;  4CGF A;  4HUF A;  3SV3 A;  2G8H A;  5KRT A;  3NAE A;  4DSE A;  3HM9 A;  1JLA A;  3ZSY A;  2W42 A;  3SNN A;  1GOA A;  3HPG A;  4FJ9 A;  4AHS A;  1SL1 A;  4M41 A;  3K58 A;  4C8K A;  2Z1J A;  3LPU A;  2A1R A;  1JL1 A;  2PZS A;  4FJI A;  1TVR A;  3OYL A;  4OPK A;  3KLE A;  1IG9 A;  4CJS A;  3PX0 A;  4Y1D A;  4CJW A;  1SL0 A;  3NE6 A;  3OS1 A;  5CY4 A;  3QEX A;  4M3Y A;  3ZSW A;  1HQE A;  1QHT A;  3ZT3 A;  1D9F A;  1KFS A;  4EZ9 A;  4Z0U A;  3SQ4 A;  1VSD A;  4E7I A;  1KVA A;  3DI6 A;  3OYN A;  4O5B A;  3VA3 A;  1BL3 A;  1XHZ A;  1X9W A;  4DSL A;  2XY6 A;  1NJW A;  1NOZ A;  3DOL A;  4HHT A;  1FKP A;  5FRO A;  4IKF A;  1B92 A;  2F96 A;  3KK3 A;  2HVH A;  4XIU A;  5CYQ A;  3LPT A;  3NCI A;  2F8S A;  3OYI A;  2BAN A;  4LD0 A;  4Z4H A;  2QKK A;  4Z4G A;  4HVJ A;  2Y1I A;  3TAQ A;  3C6T A;  4OKE A;  1EXQ A;  5HRS A;  5HRR A;  4CK2 A;  2X78 A;  1VRT A;  2YKM A;  1C6V A;  3O4N A;  1RIL A;  1S5J A;  4CEC A;  3KLH A;  4BDY A;  4FLY A;  1WAF A;  2HB5 A;  4DQI A;  2RF2 A;  4OGC A;  4BE0 A;  1CXU A;  4CJF A;  1LV5 A;  3PO4 A;  4DSK A;  3NGI A;  1WN7 A;  2ETJ A;  4W5T A;  4NCG A;  2DTU A;  1KVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...