3V9ZA

Crystal structure of rnase t in complex with a product ssdna (acc) with one mg in the active site
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
209
Chain Sequence
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 63
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9zA00
4KV8A 3VQBA 4FJ7A 4DG1A 1RTDA 4DTMA 4CESA 4KRFA 1VSIA 3KKSA 3DLEA 5SWMA 3ZSZA 1X9WA 2HW3A 1UOCA 1NK6A 3LAMA 4FM1A 4B08A 4BDPA 5C25A 4FLUA 1QS4A 3NHGA 1NKBA 1LAVA 2D0AA 1FKPA 4NCBA 4DSJA 1TKTA 2D5RA 1NK7A 4CJPA 1N6QA 2IS3A 1IO2A 3MEDA 4HUFA 3OY9A 3NCIA 3QEWA 4RW9A 3HXMA 3JYTA 3KLFA 3QNNA 1TGOA 1SL0A 1SL2A 1TL3A 1J5OA 4CCHA 3AVMA 3K5OA 3V9XA 1LW2A 2XY7A 3K58A 3ZSRA 3EZ5A 1C6VA 4H4OA 1FXXA 3TI0A 2HNYA 1RBVA 2HNZA 3WNEA 3K57A 4B3OA 3NGIA 2DFEA 4CK3A 1Q8IA 3SQ1A 3RR8A 4DTSA 3RRGA 3V1OA 1B92A 4N5SA 3ZSQA 1KRPA 1RILA 3VQEA 1HMVA 1QQCA 3K5LA 4ELUA 1WNSA 4OJRA 3F9KA 2IOCA 1JLGA 1BQMA 4F3OA 3NE6A 3L2VA 4B9UA 2QKBA 1HRHA 2FBTA 5J2NA 3OYEA 1KVCA 4CJTA 1VSHA 3DOKA 3AA2A 4DSFA 2GV9A 4M45A 2G8VA 2HHTA 1XC9A 1B9FA 3LWMA 2P51A 3OYGA 3LP1A 4JRQA 1N5YA 4CHPA 3OYNA 2VWKA 1T05A 2VG5A 5KRTA 4QCLA 4B9NA 4GW6A 4YFUA 3BDPA 3RWUA 1S1UA 3ALYA 2F8SA 1HJRA 2RPIA 3V81A 4DQQA 4KTZA 4CJ5A 4E3SA 1CXUA 1HNIA 1NK9A 3PO4A 2HHVA 1TK8A 1C0UA 3P83D 4O44A 5HBMA 4CJWA 4UQGA 3O3HA 4OLBA 3SI6A 2HHWA 3OJUA 3VA3A 1C0TA 3ZT0A 3F73A 3NF7A 3OYDA 5J2PA 4B9VA 3KLEA 1BCOA 1EP4A 1EX4A 4ID1A 1L5UA 2O4IA 2IAJA 4FLYA 4DLEA 3HSTB 4RW8A 2PY5A 3AO3A 1IKYA 3U3YA 1WSJA 1HYZA 4O0IA 4DQIA 1RTIA 5JS1A 4N41A 1JXBA 3C6TA 1B9DA 3AVBA 3LPUA 5KI6A 3TWHA 4CJEA 1TL1A 2KZZA 3AO4A 3L3UA 3WNHA 1WSEA 1LAWA 4KTWA 1W9HA 1VSDA 2PYLA 1HYVA 4M3WA 2F96A 1BIUA 2IC3A 2AJQA 3T1AA 3DLKA 4KO0A 1JL1A 1VRTA 3DYAA 4CJ3A 3SV3A 4AH9A 5HROA 3VN5A 5D3GA 4O5BA 3OS1A 3ITHA 4I9QA 1S6QA 5HLFA 2O4GA 4CIGA 4M3ZA 4FJ5A 3ASMA 1ZBIA 4FW1A 3IS9A 1SV5A 2KFNA 2X6SA 1S9EA 1KLMA 1VSFA 3AVFA 4RW4A 3OJSA 3IG1A 3OYMA 4HTUA 3CQ8A 3ZSXA 2Y1JA 2YHBA 4CJLA 3DRPA 4DTRA 3L2WA 3P5JA 1RTHA 4DTNA 1L3UA 1JLAA 2A1SA 1S1WA 4DQPA 4C8OA 4AILC 3U3GA 2HB5A 2OZSA 3RMDA 4CGHA 2RF2A 4FM0A 1ZBUA 1YT3A 4IFYA 3EYZA 1X9SA 3FFIA 1S1TA 1G15A 4CF0A 1NK5A 5JS2A 3HPOA 4KHWA 3NF9A 4BACA 4I7FA 5CZ2A 3VQQA 4CJVA 4CFDA 2VWJA 4PUOA 4ZTFA 3AVJA 3NDKA 3VA0A 2EHGA 2I5JA 4CFAA 3HYFA 1BCMA 4CEDA 1CZ9A 1DLOA 4C8KA 4E0DA 5FROA 2OPPA 4FJ9A 2HHSA 3TR8A 4B8AB 3BGRA 3MXJA 4F4KA 3G10A 3RRHA 4CF1A 3SZ2A 4CEQA 1U47A 1U49A 1T8EA 3VQCA 4FK0A 2XO7A 5K14A 2YKMA 2Z1HA 4DTOA 4M3UA 3UIQA 3LPTA 1I39A 3M8QA 3SUPA 3AVNA 4HCCA 4LH4A 4L8RB 3AVLA 3L3VA 4IBNA 4OPJA 2XY8A 2FC0A 3M8RA 1C1AA 3M8SA 3SCXA 4FJ8A 4TSXA 3PO5A 2KTQA 1SL1A 4IDKA 1NJWA 4M42A 3KK2A 4Z4GA 2ZD1A 3AA4A 3U6FA 1C1CA 1CZBA 3L2QA 3V4IA 3PX6A 3G0ZA 3MEEA 1RDBA 1RDAA 1RT7A 4IFVA 2E4LA 4G1QA 5E41A 4DTUA 1GOCA 4NYNA 5FRMA 3DM2A 3QNOA 3HO1A 2A1RA 4DSKA 2BGGA 1TVRA 3NF8A 4AHCA 3ZT1A 4ICLA 1QSSA 1S5JA 3V1RA 4JLHA 3VQ8A 4AHUA 2YNIA 4O55A 3DOLA 1ITGA 4EP4A 2KFZA 3SQ0A 3QO9A 4QAGA 1L3VA 2EX3A 1VSKA 4BE2A 4W5TA 4N56A 3V9ZA 2DY4A 3V9UA 1JLCA 3A2FA 3LDSA 3DLRA 3NH1A 3SV4A 4NYFA 1JLFA 4DQSA 1L3SA 4Z4IA 2NUBA 3B6OA 4OKKA 3AV9A 1Q9XA 4W5OA 1T03A 3IRXA 4H4MA 3S3MA 3ZSOA 4KI4A 4E19A 3AVGA 3C94A 3LZIA 1GOBA 3HVRA 1FK9A 4CJSA 1NOYA 4XIUA 2X6NA 3V9SA 4BWMA 4CGFA 2BDPA 3H08A 3MAQA 4CERA 2B6AA 3K5NA 4KTQA 4FYDA 4O4GA 1TKZA 4H8KA 2E6LA 4CJUA 3THVA 3O4NA 1J54A 4RG8A 3OS2A 4NCAA 4FJHA 4E89A 4DQRA 4Z4EA 5J1EA 3NGZA 4LY7A 3SPYA 1LWEA 4ZTJA 1NK0A 3HVTA 1FKOA 4DFKA 5HP1A 2YV0X 4FZYA 3OYFA 3LZJA 1VSMA 1BISA 4OGEA 2D0CA 4OLAA 1RNHA 4GVMA 4O0JA 3S9HA 4M3TA 5HRNA 4KFBA 2LSNA 3JSMA 2P5GA 3QEXA 3VQ9A 1RDDA 4FJMA 1EETA 2HHXA 1S6PA 2B5JA 3VQ5A 4CJ4A 3L8BA 3ZCMA 2VG7A 2P1JA 3I0RA 4K8XA 4M3XA 3PX4A 3TAMA 3DLGA 4PY5A 4CFBA 1LV5A 3QLHA 3MXIA 1QHTA 1KVBA 3NGYA 1HPZA 3TAEA 1BQNA 2B4JA 3S3OA 1RBUA 3P1GA 1IKXA 4F8RA 4CGIA 4KAZA 1D9FA 4EZ9A 1MU2A 4OVLA 3V6DA 2QKKA 3ZT3A 4CGGA 3CM6A 4I2PA 3SJJA 4BDZA 4K8ZA 4HVJA 4QOZB 3HPHA 1D5AA 3HP6A 2RN2A 4CE9A 3V9WA 3TAGA 3SQ2A 2KW4A 2KQ2A 3AA3A 3HL8A 4Y1DA 3PY8A 4GMJB 3OYBA 4JS4A 3SQ4A 4DMNA 1R0AA 4ELTA 4F2RA 2BE2A 4IG0A 1TKDA 4KHSA 1JLQA 4DU1A 4FJXA 3KTQA 1UAXA 1RDCA 1RBRA 3WNGA 3KJVA 3QEIA 4E7LA 1WN7A 4Y1CA 3LP2A 2ZQBA 4KPYA 1T7PA 2G8UA 2QK9A 1UA1A 2WOMA 4FZXC 4OKEA 3C6UA 1TV6A 3HP9A 2XRIA 3NH2A 4E7HA 3M8PA 3TAQA 5HRPA 4EP5A 3QEPA 2G8HA 4CJRA 3OYAA 1BI4B 2Z1JA 4C8NA 4DF4A 3OYKA 2OA8A 2PZSA 4EZ6A 1RT6A 4FJLA 3B6PA 4CF8A 3ZT2A 1L3TA 1HNVA 2FBXA 2Y1IA 3S3NA 3OYJA 2FBYA 3ZSWA 1S1XA 3E01A 3TABA 4BDYA 5I3UA 2OZMA 3OVNA 5DMRA 4CEAA 2OPSA 4KHQA 4MQ3A 2QXFA 4AHTA 3T19A 5HRSA 4DF8A 4J2DA 4W5NA 2Z1IA 2X78A 1JL2A 1WSIA 4KHNA 4FK4A 1XWLA 3ZT4A 3VQ4A 1C1BA 5I42A 2JLEA 4CEFA 1BL3A 4CGJA 1BIZA 2Q3SA 1A5VA 2W42A 1TK0A 1IKWA 3TAFA 3VQAA 3KKRA 4N76A 3DLBA 3LWLA 3HK2A 4FLTA 2G8WA 1DTTA 4Q5VA 5C24A 2E6MA 4FJGA 3IAYA 4FLZA 4KHYA 5FDLA 1Q9YA 3L2UA 4CF9A 3AVAA 3SYZA 1RBSA 4DSEA 4AHRA 2FBVA 3OS0A 1VRUA 4KREA 4LD0A 1XHZA 5HRRA 1ASWA 3AO1A 4FXDA 1Z25A 1K6YA 4I9LA 4RW6A 2IGIA 4FJKA 3K2PA 1WAJA 2IDOA 4KB1A 4ZHRA 2G8IA 1KFSA 4IG3A 3O3FA 2YNGA 1IG9A 4M3YA 2YHAA 3ULDA 4M3RA 3RMBA 4FLVA 1ASVA 1YTAA 3K5MA 3QESA 3SPZA 4CHZA 2GUIA 4Z0UA 1RT3A 2Z1GA 4DS5A 5J2MA 4Q0BA 3ZSVA 2G8FA 2R7YA 1RT1A 3NFAA 3QERA 4E1NA 1X1PA 4M41A 3DI6A 3NBPA 3AVHA 3KK1A 1ZBFA 4CIFA 1CXQA 2DFHA 3KLHA 2XHBA 4ELVA 1I3AA 1QSYA 1SKWA 3CFOA 3OYHA 4DLGA 4E7JA 2HNDA 3EY1A 4AHSA 2P5OA 3CM5A 4N47A 1HQEA 4CHQA 1BGXT 1HQUA 2OPRA 3AVIA 4KHUA 5CYQA 4NCGA 4CEOA 4CK1A 3SUQA 3OYIA 4FJIA 1HYSA 4HHTA 1S1VA 1WSFA 4CEEA 3HT3A 3SUNA 4F2SA 3C95A 4YNQA 4PWDA 5SZTA 4FVMA 5C42A 4DTPA 1KTQA 3V1QA 3KD5E 1QSLA 4WE1A 3I8DA 4DFMA 1RTJA 3KIOA 1UWBA 2HHQA 3HM9A 4B9TA 2HMIA 4FJNA 2XY5A 1IH7A 1LW0A 4FZZA 4CECA 3ISNC 3VQDA 5KGXA 4CEZA 4J2BA 4FW2A 4HUGA 1U45A 3HPGA 4KI6A 1YVUA 3AO2A 3I0SA 4B8CA 5KTQA 1KLNA 2HVIA 1CLQA 1KSPA 4DTJA 3SUOA 3VQPA 1VSEA 4PQUA 4R5PA 1SKSA 4J2EA 3QETA 4DFJA 1A5XA 4B9MA 1A5WA 3RMAA 4FM2A 4CHYA 1JLBA 3MXMA 4BWJA 4C8LA 3D45A 1F21A 2RKIA 5CYMA 1GOAA 2WONA 4B9LA 1WAFA 4KKOA 4BE1A 1RT5A 1NKCA 4CHNA 4Z4HA 4J2AA 4MFBA 5DK5A 4HUEA 2PYJA 1ASUA 3MECA 4Z4FA 2OPQA 3QIOA 2HVHA 1NOZA 5J2QA 1VSJA 4PA1A 3AVCA 4LSLA 1SUQA 4FLXA 3DMJA 3PV8A 3DRSA 1RT2A 1TK5A 1XHXA 1O1WA 4CEBA 1TAQA 4OPKA 3DRRA 4DU4A 1BI4A 3T3FA 1QE1A 2X74A 5CY4A 3RR7A 1JXEA 3L2RA 3SNNA 4LSNA 3DLHA 1EXQA 1WSGA 3LANA 1WLJA 4C8MA 3VQ7A 1QTMA 1ZBHA 1NK4A 3CG7A 5FRNA 3KLGA 5KGWA 1ZBLA 2YNFA 4B9SA 4W5QA 4FLWA 1WSHA 3RTVA 1BHLA 1J53A 3CFPA 1D8YA 4KB0A 4CK2A 3O3GA 1TAUA 2GBZA 3MEGA 1JKHA 1KCFA 1KFDA 1UA0A 3NAEA 3LAKA 2D0BA 1XI1A 1EKEA 4JRPA 1REVA 2DFFA 2BANA 1U04A 1J9AA 4CF2A 1ZYQA 3OYCA 3OYLA 5EU7A 3TAPA 4F3TA 4E7KA 3VQ6A 1LWCA 1S9GA 4CJKA 1JLEA 3CYMA 3RMCA 1IKVA 3HJFA 4DU3A 4BE0A 2JGUA 4AHVA 2OYQA 4CHOA 1KVAA 3TARA 3KD1E 2YNHA 3AVKA 3AO5A 1TKXA 4E1MA 4I2QA 4ID5A 4RW7A 2ITGA 2VG6A 4E7IA 3AA5X 1SKRA 4DSLA 3O4QA 1NJYA 1D9DA 1NKEA 5T7BA 2YKNA 4CIEA 2XY6A 1NJZA 4DWIA 4DS4A 2F8TA 1Z26A 4Z4CA 3PUFA 4HCBA 2HHUA 4LH5A 2G8KA 1DTQA 3LP0A 5CZ1A 4CJFA 4DFPA 3CFRA 3PX0A 3QIPA 3KK3A 3TANA 4CFCA 1X9MA 1VSLA 2DTUA 4IKFA 4CGDA 3QEVA 1LWFA 1RCHA 2ATQA 1C0MA 4DSIA 1Y97A 4DTXA 5KRSA 2KZMA 1NJXA 1RBTA 1NK8A 3LALA 3KLIA 4JS5A 4FJJA 1W0HA 3QINA 3K59A 3LP3A 3NH0A 1U48A 2ZE2A 3D0PA 4FCYA 4OGCA 4OKJA 3ZSYA 4CJQA 4W5RA 1RT4A 1YTUA 2ETJA 1VK0A 3WNFA 3NF6A 1U4BA 4FK2A
chains in the Genus database with same CATH superfamily
3VQBA 1K8KA 3R3LA 4FJ7A 1RTDA 3OBYA 1VSIA 3ZSZA 1UOCA 4BRHA 1NK6A 3D2FB 1QS4A 2Q2RA 4DSJA 4DR4K 3BEXA 4H03B 5H1SQ 1N6QA 3P39A 1TUYA 4M7XA 3AGRA 2ZJQL 5A2QO 3KLFA 1TGOA 4FWMA 2Q97A 1RBVA 3K57A 1NGCA 4X62K 1NGHA 3D2EA 3V1OA 1B92A 3PSIA 4OX9K 1RILA 1QQCA 4JKBA 1NGGA 5GADP 4F3OA 4B9UA 2FBTA 5J2NA 1VSHA 2UYTA 2GV9A 4M45A 2O8FB 1VQLN 2P51A 5IWAK 3MMVA 3OTOK 2QWQA 3OYNA 3O1BA 3WQUA 1ATNA 2VG5A 4B9NA 4GW6A 3BDPA 3RWUA 1S1UA 4FPAA 2F8SA 1HJRA 1ZXOA 4BC2A 4DQQA 4KTZA 4JI5K 4PKHA 1JJ2M 3CXCM 1HNIA 1NK9A 2HHVA 3P83D 4O44A 4RTFD 4UQGA 3SI6A 3HTVA 3TTFA 3VTIA 3VA3A 3F73A 3ZETA 3R8EA 3ZX3A 4B9VA 1BCOA 1EP4A 3MCPA 4FO0A 3U3YA 2ZF5O 1B9DA 3LPUA 4YOYA 1TL1A 3L3UA 4KTWA 2WBNA 2PYLA 4M3WA 4KO0A 2Q31A 2HMPA 2NRVA 3SV3A 3KZBA 4AH9A 3R1XA 5BN9A 3J8AA 4YHHK 1BWFO 3EKUA 4CIGA 1E4FT 4WF9L 4X64K 3AVFA 1S9EA 4BRNA 1MWMA 4HTUA 3IG1A 3OYMA 3CQ8A 4BGAA 4BC5A 5F1XA 3EL2A 2P9LA 3L2WA 3P5JA 1S1WA 1NWKA 1MA9B 2KHOA 3W3DA 4AILC 1XC3A 1GLAG 4IJNA 5GAGP 3FZKA 4CGHA 4IFYA 1G99A 1KD1O 4IOAL 4IEIA 4BRCA 3HPOA 3NF9A 4PUOA 4CFDA 5CZ2A 2VWJA 4BRFA 4ZTFA 3AVJA 4AM6A 3MX2A 1BCMA 5BR8K 1CZ9A 1DLOA 3CJ1A 2QXLA 3TTDA 4BREA 2HF3A 5KPZA 4H5WA 3TR8A 4B8AB 4LF7K 4JI6K 2WUSA 3D7EO 4CF1A 4DR7K 4CEQA 4FK0A 3WXJA 4KH6A 4DTOA 3U8XA 4CI6A 1P90A 3AVNA 2HOEA 3KWIA 3CCLN 3SCXA 4FL9A 5AZJA 3U4LA 4FWSA 1CZBA 5BREA 3V4IA 2FLOA 3MEEA 4IFVA 3LM9A 2E4LA 4DTUA 3DM2A 4DSKA 1C0FA 1YXQA 3NF8A 4JLHA 2YNIA 3CJCA 1ITGA 1U2VA 1KC8O 3SQ0A 2E1ZA 2EX3A 2WTUA 5IT9O 3DLRA 3CQYA 3NH1A 3SV4A 4NYFA 2NUBA 1VQNN 4OKKA 3AV9A 2I7PA 3IRXA 4H4MA 3S3MA 4KI4A 2NLXA 3SLCA 3MDQA 4E19A 3C94A 1NOYA 1BO5O 1FK9A 4ISEA 2X6NA 3V9SA 2ZJRL 2BDPA 4CGFA 1TKZA 2QTDA 3O4NA 1IBLK 4FJHA 4LF8K 4DQRA 4Z4EA 5AFUH 3KK7A 2PBDA 5GIPA 4BRQA 4DFKA 1FKOA 4BRLA 3T69A 3VERA 2YV0X 1N8RO 3C6HA 3OYFA 4FZYA 2D0CA 1RNHA 4O0JA 3K9KA 3JSMA 1IBKK 4I6MA 1RDDA 3L8BA 2NRRA 3ZCMA 3CC7N 4M3XA 3PX4A 1LV5A 3TAEA 4JI7K 2E1YA 1IKXA 1WUAA 1OKJA 2QKKA 1NGBA 1KXPA 3CCUN 3SJJA 4I2PA 4K41A 4K8ZA 4HVJA 1D5AA 4IWVA 3HM8A 4CE9A 3SQ2A 3DXKB 2KQ2A 4FJLA 3PY8A 4JS4A 1R0AA 4ELTA 4KHSA 4DU1A 4FJXA 3EKSA 1W2BM 4OKEA 3C6UA 4YY3K 1TV6A 3HP9A 3NH2A 2G8HA 1YI2N 4CJRA 4EIAA 1BOTO 2Z1JA 4C8NA 3WXIA 3O9RA 1HNVA 3WXLA 1K8AO 2QA4N 1YJNN 3OVNA 4BC3A 3T19A 4CW7B 4CZLA 3F9MA 1JCGA 4X66K 4CEFA 1A5VA 1GLBG 1IKWA 3TAFA 1K73O 3HK2A 1QHAA 3VOVA 4FLTA 1IJJA 2I7NA 1OH5A 2G8WA 1VQ8N 1YVNA 1HNZK 2EWSA 3O08A 1Q9YA 4FOEA 4CD1A 3OS0A 1VRUA 1N36K 1ASWA 5LY3A 1K6YA 5C12A 2F9WA 4M3YA 4DR6K 1XMQK 3H1VX 4M3RA 3RMBA 4FLVA 1ASVA 5AQIA 3FFKB 1YTAA 3K5MA 5BN8A 4Z0UA 1RT3A 2Z1GA 2R7YA 4E1NA 2DFHA 2XHBA 1J6ZA 2P5OA 3EY1A 3CM5A 4N47A 1HQEA 3AVIA 3FE1A 4YOVA 4FJIA 4NCGA 1HYSA 2DPNA 1S1VA 3SUNA 2VWBA 4FVMA 3O1WA 2VQEK 4DTPA 3OHRA 1QSLA 3I8DA 4JI2K 1X3NA 4B9TA 2HHQA 4FJNA 2XY5A 2YCHA 4CECA 3MX5A 4BY9C 5KGXA 4JI8K 4FW2A 4KI6A 4FWLA 3AO2A 1OH6A 1M1KO 3LDNA 3SUOA 3VQPA 3LM2A 4PQUA 4LF6K 4J2EA 2O8CA 3RSEB 1A5WA 1ESVA 2P9SB 2QWOA 3D45A 2O8BB 5CYMA 2WONA 4IFEA 3E1YA 4BE1A 1E3MA 1TUUA 4Z4HA 1KAXA 2PYJA 2HVHA 4Z4FA 2OPQA 1NOZA 2NRZA 4JKAA 5J2QA 3AVCA 4LSLA 2E88A 4FVUA 1N32K 3DRRA 1BI4A 2E5LK 3T3FA 2UU9K 3DLHA 1ZBHA 1EXQA 1WSGA 1ZC6A 5KGWA 1VHXA 4B9SA 4PHTX 3RTVA 1D8YA 4KB0A 1Q18A 3O3GA 2GBZA 2RHKA 1UA0A 3NAEA 3LAKA 2D0BA 3VETA 2YJFA 2BANA 1U04A 1J9AA 4CF2A 1HLUA 3OYCA 2ASMA 1S9GA 1JLEA 3TSQA 5AQFA 1IKVA 4DU3A 4BE0A 4CHOA 4JI4K 3KD1E 2YNHA 3AVKA 3AO5A 4BG8A 2D0OA 1S3XA 2ITGA 2VG6A 4E1JA 4DSLA 1NKEA 2YKNA 5AQKA 1NJZA 3O4WA 2F8TA 1Z26A 5AQYA 1X9MA 3D2FA 4CFCA 1X9JA 3VF6A 4IKFA 1P8ZA 3CMEN 2ATQA 3GG4A 3UE5A 2YJEA 4QS7A 4GY2B 4DTXA 4BRMA 4BRIA 4JS5A 3QB0A 5FPEA 3K59A 3NH0A 1XMOK 4OGCA 4CJQA 2UUCK 3WNFA 2ZJPL 3BF1A 2HHWA 3GOIA 4DG1A 3M3ZA 4KRFA 3MN7A 3KKSA 3DLEA 3ZYYX 4PL7A 3QDKA 4QS9A 1YUWA 4BDPA 4GKKK 5B8HA 4BR7A 1Q81O 3VEVA 2O8FA 1EWRA 3TSPA 1U6ZA 2O8EB 2P9KB 3AVMA 2V7YA 3K58A 4DHYA 3I56N 1FXXA 4B3OA 3THYB 1Q8IA 3PSFA 2VCPA 5BRDA 3ZSQA 1KRPA 3NVKA 1HMVA 3DXMB 3L4IA 3K5LA 2ASOA 4ELUA 3F9KA 3T7ZA 3L2VA 3OYEA 1KVCA 1VQKN 4JNEA 4DSFA 3BP8A 3DAWA 1Z05A 4FWPA 1T05A 4NXNK 2QEXN 3ALYA 4AF1A 1C0UA 5HBMA 3O3HA 2FSKA 1C0TA 4X65K 3Q7BA 1EX4A 5GAHP 4ID1A 3UB5A 4JK8A 3BF3A 4H5RA 4FLYA 4DLEA 3HSTB 2ZGYA 3FR0A 1HYZA 4O0IA 4DQIA 1RTIA 3I33A 3CI5A 4N41A 3CCJN 3J7AP 4MLHA 5KI6A 1Q7YO 3WNHA 4GV6A 2F96A 1BIUA 4DV4K 3VEXA 1QVFM 3DYAA 5HROA 5D3GA 3ITHA 2VQFK 1S6QA 3K0SA 2IVPA 4M3ZA 4FJ5A 3ASMA 3MWPA 5AR0A 4RW4A 4IXCA 4DTRA 1RTHA 1L3UA 2UXBK 2P9PB 1VQON 4C8OA 2HB5A 3EYZA 1BG3A 3CERA 1XQSC 2QM1A 1VQ5N 3N4QA 3C7NB 1S72N 4KHWA 3VQQA 1HJOA 3NDKA 3HYFA 4CEDA 4WFBL 1CZAN 1GLCG 3MXJA 1T8EA 5AQPA 4WQ5A 5M1FA 1I39A 3SAGA 3IUCA 5TKYA 5LL6Z 3VF2A 3F2KA 3AVLA 3L3VA 4H0VB 4IBNA 2XY8A 3M8RA 4FJ8A 4H5VA 4Z4GA 3ZX2A 3U6FA 4CBUA 2FF6A 1NGAA 4BGBA 1FJGK 2NNWA 2OANA 2Q0UA 3O6WA 4NYNA 3QNOA 4BQZA 1TVRA 4ICLA 1IV0A 3V1RA 2Q1NA 3DOLA 2UUBK 3ZLJA 5MLCQ 4KBOA 2GUPA 4CBXA 3V9UA 1JLCA 1QQOA 3QICA 4YDUA 5AQSA 1NU0A 1Q9XA 5FPMA 1FW6A 2GTDA 3AVGA 3LZIA 1GOBA 3HVRA 3CQXA 4YORA 2B6AA 3K5NA 2P9IB 2E6LA 3CPWM 2KKZA 4B9QA 3P31A 4FSVA 3DWLA 4B1UB 3OS2A 4NCAA 3EO3A 4WYBA 1M90O 5ELZA 1NGJA 3SPYA 4LY7A 4ZTJA 5EX5A 3DXKA 3LZJA 4R79A 2OTJN 4OGEA 4GVMA 3S9HA 4M3TA 5HRNA 2LSNA 5CR4A 3MN6A 3H6EA 3J7YP 3QBXA 4L3QA 2QI2A 3VQ5A 3J81O 3Q7CA 3TAMA 3NGYA 1HPZA 4DV3K 4M63C 4JKEA 4C1NI 3OW2M 3P1GA 4F8RA 4CGIA 4KAZA 2H3GX 2HBJA 4H5NA 1MU2A 3V6DA 4LFAK 5KPTA 1OH7A 2FSJA 1ATRA 3HPHA 3J80O 3SMSA 5HL7L 3ID8A 2KW4A 4Y1DA 4C1NK 3OYBA 2UXCK 4F2RA 4CZFA 4B1WB 1TKDA 1OH8A 4MO4A 1RDWX 3QEIA 4GVEA 1WN7A 5LJVA 1YF5L 3AY9A 2ZQBA 1VQMN 4DV6K 2QK9A 1UA1A 4BR2A 3T1HK 3EE9A 3TAQA 2P9UA 3SAHA 4F9OA 2PZSA 2OA8A 1RT6A 3B6PA 4A62A 4GV3A 3OYJA 5E26A 3ZSWA 3ULEB 3E01A 5ADXA 4EFHA 3J7ZO 4BDYA 5I3UA 4KHQA 2QXFA 5HRSA 4W5NA 5GAEP 3CJ9A 2X78A 1WSIA 3FLCO 4FK4A 2YHYA 3TU5A 1XWLA 3VQ4A 5KPRA 2JLEA 3UKUB 1BL3A 2A6AA 1DGKN 3KKRA 2E2NA 1DTTA 4BR0A 5C24A 2E6MA 4FJGA 3CCEN 3L2UA 1RBSA 4DSEA 1HNXK 4KREA 4LD0A 1XHZA 5HRRA 4FXDA 3ENOA 3SBTA 4RWTA 4JHDB 4I9LA 4A61A 4RW6A 2IGIA 5M1QA 3K2PA 2IDOA 5AQVA 4KB1A 2G8IA 3O3FA 2YNGA 1IG9A 3WXMB 3H1QA 5EOYA 1NGEA 4Q0BA 5J2MA 4M41A 3DI6A 4NB4A 3AVHA 3KK1A 1ZBFA 1SKWA 3RSEA 4DLGA 2HNDA 4OPHA 4AHSA 2P9SA 3WUHA 2O8BA 1T3VA 4CK1A 3O9TA 1YJWN 2IVNA 1WSFA 1N34K 5EY4A 5C42A 1E4GT 2UXDK 3QFUA 1UWBA 3HM9A 3C0BA 1IH7A 1LW0A 2D4WA 2E20A 3VQDA 4HUGA 3GBTA 1WBDA 3I0SA 5KTQA 4JAXA 1KLNA 1KSPA 1OVQA 4R5PA 1SKSA 3QETA 1A5XA 1TYQB 4FM2A 3HOTA 4C8LA 2A42A 2RKIA 4Y0WA 1WBBA 1RT5A 5DK5A 5AQTA 4PA1A 3UKRB 3PIPL 4FWKA 3DMJA 2YHXA 3DRSA 3FZFA 3FGUA 3SJHA 1BDGA 1O1WA 1XHXA 3TPQA 5C10A 5AQRA 3RR7A 1JXEA 3L2RA 1NMNA 3LANA 4C8MA 2GEMA 3C6AA 5FRNA 3KLGA 1BU6O 2YNFA 2FXUA 4FLWA 1V4SA 5AQZA 3BZKA 3MEGA 4DCHA 3U9ZA 1N33K 2HBLA 2DFFA 3H3OB 3P4IA 1ZYQA 4CVNE 3PIOL 4CJKA 3HJFA 4KH4A 3LDPA 4AHVA 3JXUA 2OYQA 3TSUA 3TARA 2AP1A 3BUZB 4RW7A 4ILJA 4E7IA 3CCMN 3O4QA 4QS8A 1GLJO 5T7BA 1EQYA 3AAQA 4DS4A 3THWB 1SAZA 3PUFA 4HCBA 1J5OA 3CFRA 4BC4A 1DEJA 4JKGB 4CGDA 3WQTA 4WQ4C 1V4TA 4MDBA 2O8EA 1C0MA 2P9KA 2GWKA 2KZMA 5KRSA 5AQQA 4FJJA 1U48A 2ZE2A 3D0PA 4FCYA 4OKJA 1GLLO 3THYA 1YTUA 3QFPA 1U4BA 3JAMO 4EHTA 1J5EK 5BR9A 4CBWA 3DXMA 3C65A 5BRFA 5SWMA 4JKCA 1X9WA 2HW3A 1MDUB 3LAMA 4FM1A 4B08A 4OO1J 5C25A 3G25A 4FLUA 1NKBA 2F9TA 1LAVA 1FKPA 4IJAA 4CJPA 4DB3A 4HUFA 3QEWA 3OY9A 3NCIA 3QNNA 4RW9A 1SL2A 1SL0A 3ENBA 1TL3A 4CCHA 1LW2A 2XY7A 4H0TB 1C6VA 3TI0A 3MN5A 4O8KA 2HNYA 2HNZA 3WNEA 2DFEA 3RR8A 4DTSA 2QWLA 3D6RA 3RRGA 4N5SA 2O8DB 5AQHA 1DT9A 3CHWA 4OJRA 1BQMA 2QKBA 3KWGA 4CJTA 5AQXA 4IOCL 3DOKA 2V51B 3AA2A 4JKDA 5AQUA 5DM6L 2G8VA 4FWQA 4HWIA 3CJAA 4JRQA 3LP1A 4CHPA 5KRTA 4QCLA 4YFUA 4XH5A 4YOXA 1KAZA 4CJ5A 4WFAL 1CXUA 4JI0K 3PO4A 4OLBA 4FWOA 3NF7A 3OYDA 3KLEA 3LDLA 2IAJA 1SQKA 3DJCA 5M1KA 4YDUC 4JD2B 3VEYA 4DV1K 2P9PA 1HR0K 5JS1A 1JXBA 3C6TA 3AVBA 1JCFA 4CJEA 3CC4N 2NRXA 3AO4A 3O5BA 3SAFA 1LAWA 5JMVA 3HOSA 3NMUA 1HYVA 2IC3A 3C7NA 1JL1A 4CJ3A 4IOXA 3VN5A 5HOOA 2O4GA 1ZBIA 3IS9A 1NLVA 2KFNA 2X6SA 3MK6A 1KLMA 5JLHA 3OJSA 4B3MK 3ZSXA 3CETA 4DTNA 2A1SA 3U3GA 2OZSA 3RMDA 2RF2A 1YT3A 2HSTA 3FFIA 1S1TA 1G15A 4CF0A 1NK5A 1X3MA 4IZ9A 3VA0A 2QWMA 4CFAA 3FZHA 1NMDA 4E0DA 2E2OA 2E2QA 2OPPA 2HHSA 1VQ6N 3BGRA 4B1XB 3F5TA 3G10A 4H5TA 1ZBSA 3RRHA 3CF5L 3AAPA 3SZ2A 1U49A 4MO5A 3VQCA 4CZMA 2XO7A 4LF5K 4RCHA 5GINA 5K14A 2YKMA 2Z1HA 4M3UA 3UIQA 3AGKA 3CD6N 2GX9A 2F4VK 4H0XB 4HCCA 4DV7K 4L8RB 4OPJA 2KTQA 2FC0A 1C1AA 5E84A 1NJWA 3AA4A 4DV2K 3A5NC 3OA9A 4YOUA 3VMFB 1NM1A 5F0XA 2QWRA 4LF9K 2OTLN 4BVPA 5E41A 4G1QA 5FRMA 4B1ZA 3HO1A 4UY8O 2P9IA 2A1RA 2BGGA 3ZT1A 1S5JA 3VQ8A 1WB9A 4EP4A 3QO9A 1NBWA 3QBWA 1VQ4N 5GIOA 1VSKA 1RGIA 3HZ6A 4BE2A 4W5TA 3V9ZA 1BA0A 2DY4A 3A2FA 3LDSA 4DQSA 4Z4IA 1T03A 1NGFA 2NRHA 3ZSOA 2CGKA 2A3ZA 4CJSA 4JYAK 3MAQA 4KTQA 4FYDA 4O4GA 4H8KA 4CZEA 2HBMA 4CJUA 1NGDA 3THVA 1D4XA 1J54A 1YHQN 4DR5K 4E89A 4XEIA 1W97L 1NK0A 1BUPA 5KQDA 5HP1A 4CZJA 1VSMA 3MCAB 3G6EN 2P5GA 3QEXA 3E66A 3VQ9A 2J4RA 1EETA 4DUYK 2HHXA 1S6PA 3KVGA 3O9UA 1VQ9N 2E2PA 3LDQA 4K8XA 2VG7A 1QQMA 3QLHA 3MXIA 1QHTA 3THXB 2B4JA 3E9LA 5FPNA 1LCUA 1D9FA 4JK9A 3IFRA 3ULEA 4CGGA 3CM6A 4BDZA 3DLLL 4HTLA 3HP6A 1DKGD 2RN2A 3V9WA 1XUPO 3TAGA 3AA3A 5JLFA 3HL8A 4GMJB 3SQ4A 2NZTA 2YHWA 4DMNA 1IBMK 2ASPA 1JLQA 3UKUA 1UAXA 1RDCA 3WNGA 3IKMA 4E7LA 4Y1CA 2CGLA 4KPYA 1T7PA 2WOMA 4M7YA 2XRIA 3VEOA 4E7HA 3P38A 4EP5A 5HRPA 3QEPA 4A2BA 1BI4B 4EZ6A 3OYKA 3A5LC 4NLCA 1K9MO 4JHDA 1GLEG 4CF8A 4JI3K 4U67L 1L3TA 2FBYA 3SMPA 1S1XA 2OZMA 5DMRA 2OPSA 3ZEUB 4J2DA 1JL2A 4K25A 4AQYK 3ZT4A 1C1BA 5I42A 2WFBA 2A40A 4CGJA 2PFUA 2Q3SA 4N76A 3LWLA 4A2AA 4Q5VA 3IAYA 2HF4A 1KQSM 3A5OC 4KHYA 5FDLA 3I55N 4CF9A 3AVAA 3SYZA 4AHRA 3AARA 4MLEA 4ZHRA 1KFSA 3E9OA 4XH1A 3QESA 1QQNA 3SPZA 1RDUA 4CHZA 4WFNL 2A41A 4DS5A 1ILYA 3ZSVA 3QERA 1S22A 4K42A 1VAZA 1X1PA 3NBPA 4LF4K 4DV5K 4CIFA 1CXQA 4ELVA 1SS6A 1I3AA 4E7JA 1TYQA 4O5FA 1HQUA 2AA4A 2OPRA 4B1VA 1NNEA 4CEOA 3OYIA 3EN9A 5F2RA 3C95A 4YNQA 1IG8A 3VGKA 3V1QA 3KD5E 4DFMA 3VEWA 1RTJA 3KIOA 3UKRA 2HMIA 3ISNC 3W0LA 4CEZA 4J2BA 3TTCA 5AQLA 4ILGB 3CMAN 4B8CA 4O8UA 2VGNA 4NO7A 4DFJA 4B9MA 4CHYA 5AJ3K 4BWJA 1F21A 1GOAA 2F7TA 5AZIB 5BPMA 1XNRK 4MFBA 3BZCA 1WOQA 3A5MC 3QIOA 1VSJA 4GNIA 4JKHA 3PV8A 4V19S 5BPNA 4CEBA 1TAQA 4DU4A 1Z6RA 4JK7A 3VTHA 1QE1A 5CY4A 5EVZA 3HRGA 1NGIA 4JEPA 3SNNA 4LSNA 3VQ7A 1QTMA 2NRTA 1Q82O 4Z94A 1EO1A 4W5QA 1WSHA 3CFPA 4CK2A 1TAUA 2RE2A 5AQJA 3THWA 1QZ5A 3H46O 3OYLA 4JKGA 3HI0A 4F3TA 4PL8A 3VQ6A 1LWCA 5ADXH 4C23A 2CGJA 3CYMA 2WC9A 3RMCA 5BPLA 5BRHA 3GL1A 3VEZA 2JGUA 4ISFA 4A5AA 1KVAA 2GELA 3B8AX 3GDQA 3ATUA 4JI1K 4E1MA 4I2QA 1T6DA 4WCEL 1MWKA 1NJYA 5JICA 4BQLA 1D9DA 1GLFO 4BR5A 4DWIA 5JVGL 4DV0K 4LH5A 2KZZA 4DFPA 5CZ1A 1TK5A 3QIPA 3KK3A 1VSLA 3WEEB 2VYPA 5AQGA 4DSIA 1VQPN 3MWTA 1W0HA 3LP3A 2BH1A 3ZSYA 1RT4A 3HBTA 4FK2A 2P9NB 4KV8A 2O8DA 4CZGA 4DTMA 4CESA 1HNWK 1HUXA 3FZMA 3R9PA 3I8BA 3NHGA 2D0AA 4NCBA 1TKTA 2QWPA 2D5RA 1NK7A 2HBKA 2IS3A 1IO2A 3MEDA 4H0PA 4CZHA 4QOZB 3HXMA 3JYTA 2VGMA 3K5OA 4B3RK 3V9XA 1VQ7N 3ZSRA 3EZ5A 4H4OA 4XH4A 4DUZK 3NGIA 4CK3A 1W7AA 3SQ1A 5JVHL 1K8KB 3VGMA 5CHIA 3VQEA 1LOTB 1YAGA 1WNSA 2IOCA 1JLGA 3U9DA 1SZ2A 2D1KA 3NE6A 1HRHA 5C2FA 4BRGA 4JD2A 2HHTA 1XC9A 1B9FA 3LWMA 3OYGA 1N5YA 2VWKA 3ENHA 3H3NO 4BRKA 1C0GA 4G9ZA 2RPIA 3V81A 1I94K 4E3SA 3D2EB 4MDAA 1OVYA 2ZWHA 1TK8A 4CJWA 3OJUA 4IEEA 3ZT0A 5J2PA 4LFBK 1L5UA 2O4IA 4OPAA 4RW8A 2PY5A 3AO3A 5AFUA 1RFQA 1IKYA 1WSJA 1QZ6A 3PLAA 3TWHA 3A8YA 1WSEA 4LFCK 1W9HA 3E9PA 1VSDA 2AJQA 3T1AA 3DLKA 1VRTA 3FZLA 3KHYA 4O5BA 2JWLA 3OS1A 4I9QA 4A5BA 5HLFA 3L4QA 3LL3A 3ZETB 3CPEA 4FW1A 1SV5A 1VSFA 2Y1JA 2YHBA 4ILHA 4CJLA 3DRPA 4DR3K 1JLAA 5DM7L 4DQPA 3MN9A 4BR4A 3RVCA 5LMUK 2OCEA 2ZGZA 4FM0A 1ZBUA 1X9SA 1Y64A 4EHUA 3VGLA 3EE8A 5JS2A 5M1OA 4BACA 4I7FA 4CJVA 1XNQK 1QVGM 4H0OA 2EHGA 2I5JA 4C8KA 4GKJK 5FROA 3CCRN 4B3TK 4FJ9A 3M5RA 4F4KA 5LMNK 3GE1A 4CZIA 3CCVN 4BRPA 1U47A 2ITMA 4K43A 2P9LB 3LPTA 3M8QA 2ZM6K 3N4PA 3SUPA 4LH4A 3M8SA 2P9UB 5AQMA 3K9JA 4TSXA 3PO5A 1SL1A 4IDKA 4CJ7A 4M42A 3KK2A 2ZD1A 1C1CA 4JKFA 3L2QA 3PX6A 2W6LA 3G0ZA 1NJIO 1RDBA 1RDAA 1RT7A 4JV5K 3SK3A 1GOCA 1BA1A 4AHCA 1QSSA 4AHUA 2KFZA 4O55A 2UUAK 2V7ZA 2BUPA 4QAGA 1JCEA 5M1NA 1L3VA 4FOIA 5CE3A 5M1PA 4WQ5C 4N56A 1KAYA 3R6MA 2FF3B 1JLFA 1L3SA 5AZJB 3B6OA 2PAVA 4W5OA 4GV9A 4IO9L 2D0PA 3CJ7A 4XIUA 3THXA 4BWMA 3H08A 4CERA 3L0QA 3JS6A 4PKGA 4RG8A 1U2VB 4IO8A 1HPMA 4BR9A 5J1EA 3L6QA 3NGZA 3CC2N 1LWEA 4U7BA 3HVTA 4A57A 1BISA 4OLAA 4FPBA 4KFBA 3O9QA 3G4SN 2Q36A 4FJMA 2FSNA 1H1VA 2B5JA 4CJ4A 3IDHA 3I0RA 2P1JA 2KLAA 3WT0A 4A59A 3T1YK 3DLGA 4PY5A 4CFBA 1KVBA 1BQNA 3S3OA 1RBUA 4IDHA 4EZ9A 2IIRA 4OVLA 3ZT3A 4PKIA 3O8MA 3ZEUA 2W41A 2W6KA 2BE2A 4IG0A 4KHPK 5AQOA 3KTQA 2QW9A 4I6MB 1RBRA 3KJVA 2GWJA 3LP2A 2G8UA 4FZXC 4LC9B 3IMXA 3M8PA 3OYAA 3ATVA 5FPDA 4DF4A 3CJBA 5EXWA 3ID6A 3CCSN 4BRAA 4BROA 3ZT2A 2FBXA 4FWNA 2Y1IA 3S3NA 3QMLA 3TABA 2IVOA 4CEAA 4BG9A 4MQ3A 4AHTA 4J8FA 3BY5A 4DF8A 2Z1IA 1Q86O 4KHNA 1T6CA 1TK0A 1BIZA 5I9EB 2W42A 4DKWA 3VQAA 3DLBA 4H0YB 4FLZA 3CIPA 3SBGA 2FBVA 2NRWA 3AO1A 1Z25A 3O9SA 4B3SK 4FJKA 1WAJA 4IG3A 5KQ8A 4FWRA 2YHAA 3ULDA 4CZKA 5C0YA 5TKWA 2GUIA 4NXMK 5LJWA 1NG9A 1HKGA 2G8FA 1RT1A 2QWNA 3NFAA 4JN4A 3KLHA 1QSYA 3CFOA 3OYHA 4CHQA 1BGXT 5C15A 4BRDA 4KHUA 4EAHD 5CYQA 3SUQA 1ATSA 5AZIA 4HHTA 4CEEA 3HT3A 4F2SA 4PWDA 3A0IX 3HSCA 5SZTA 1KTQA 4WE1A 3LDOA 3M1FA 3WXKA 3ZX0A 4FZZA 2Q0RA 1U45A 3HPGA 1YVUA 5AQWA 5AQNA 2CH5A 2YI1A 2HVIA 1CLQA 4DTJA 2V52B 1VSEA 3NVMA 3S41A 4DR2K 1EWQA 1GLDG 2CH6A 3VESA 3RMAA 1JLBA 1R59O 3MXMA 1HX1A 3VENA 4B9LA 3VF4A 1WAFA 4KKOA 4DR1K 1NKCA 4CHNA 3M6GA 4J2AA 4HUEA 1ASUA 3MECA 1SUQA 4FLXA 1YJ9N 3OBWA 1RT2A 4OPKA 2BTFA 2X74A 1WLJA 1YIJN 1NK4A 3CG7A 1ZBLA 2O8CB 1YITN 1BHLA 1J53A 4B1YB 1JKHA 1KCFA 1KFDA 3CCQN 1XI1A 1EKEA 4JRPA 1REVA 5C2DA 4WQ4A 2HHHK 5EU7A 3TAPA 4KH5A 4E7KA 4YOTA 1O13A 3WEEA 1HKBA 2A5XA 2JWKA 4CD3A 1TKXA 4ID5A 3AA5X 2E8AA 1SKRA 2P9NA 3EEQA 4BVOA 4K0KK 4CIEA 2XY6A 4Z4CA 3VPZA 2YX6A 4NLBA 2G8KA 5FLXO 1DTQA 3LP0A 4CJFA 3PX0A 3TANA 2HHUA 2DTUA 1HKCA 4ISGA 3QEVA 3EZWA 1LWFA 1RCHA 1Y97A 4AM7A 1NJXA 1RBTA 1NK8A 3LALA 3KLIA 3QINA 2W40A 3H45C 4W5RA 1T44A 3G71N 4DQ8A 4YOWA 2ETJA 1VK0A 3O80A 3NF6A
chains in the Genus database with same CATH topology
4KV8A 3VQBA 4FJ7A 4DG1A 1RTDA 4DTMA 4CESA 4KRFA 1VSIA 3KKSA 3DLEA 5SWMA 3ZSZA 1X9WA 2HW3A 1UOCA 1NK6A 3LAMA 4FM1A 4B08A 4BDPA 5C25A 4FLUA 1QS4A 3NHGA 1NKBA 1LAVA 2D0AA 1FKPA 4NCBA 4DSJA 1TKTA 2D5RA 1NK7A 4CJPA 1N6QA 2IS3A 1IO2A 3MEDA 4HUFA 3OY9A 3NCIA 3QEWA 4RW9A 3HXMA 3JYTA 3KLFA 3QNNA 1TGOA 1SL0A 1SL2A 1TL3A 1J5OA 4CCHA 3AVMA 3K5OA 3V9XA 1LW2A 2XY7A 3K58A 3ZSRA 3EZ5A 1C6VA 4H4OA 1FXXA 3TI0A 2HNYA 1RBVA 2HNZA 3WNEA 3K57A 4B3OA 3NGIA 2DFEA 4CK3A 1Q8IA 3SQ1A 3RR8A 4DTSA 3RRGA 3V1OA 1B92A 4N5SA 3ZSQA 1KRPA 1RILA 3VQEA 1HMVA 1QQCA 3K5LA 4ELUA 1WNSA 4OJRA 3F9KA 2IOCA 1JLGA 1BQMA 4F3OA 3NE6A 3L2VA 4B9UA 2QKBA 1HRHA 2FBTA 5J2NA 3OYEA 1KVCA 4CJTA 1VSHA 3DOKA 3AA2A 4DSFA 2GV9A 4M45A 2G8VA 2HHTA 1XC9A 1B9FA 3LWMA 2P51A 3OYGA 3LP1A 4JRQA 1N5YA 4CHPA 3OYNA 2VWKA 1T05A 2VG5A 5KRTA 4QCLA 4B9NA 4GW6A 4YFUA 3BDPA 3RWUA 1S1UA 3ALYA 2F8SA 1HJRA 2RPIA 3V81A 4DQQA 4KTZA 4CJ5A 4E3SA 1CXUA 1HNIA 1NK9A 3PO4A 2HHVA 1TK8A 1C0UA 3P83D 4O44A 5HBMA 4CJWA 4UQGA 3O3HA 4OLBA 3SI6A 2HHWA 3OJUA 3VA3A 1C0TA 3ZT0A 3F73A 3NF7A 3OYDA 5J2PA 4B9VA 3KLEA 1BCOA 1EP4A 1EX4A 4ID1A 1L5UA 2O4IA 2IAJA 4FLYA 4DLEA 3HSTB 4RW8A 2PY5A 3AO3A 1IKYA 3U3YA 1WSJA 1HYZA 4O0IA 4DQIA 1RTIA 5JS1A 4N41A 1JXBA 3C6TA 1B9DA 3AVBA 3LPUA 5KI6A 3TWHA 4CJEA 1TL1A 2KZZA 3AO4A 3L3UA 3WNHA 1WSEA 1LAWA 4KTWA 1W9HA 1VSDA 2PYLA 1HYVA 4M3WA 2F96A 1BIUA 2IC3A 2AJQA 3T1AA 3DLKA 4KO0A 1JL1A 1VRTA 3DYAA 4CJ3A 3SV3A 4AH9A 5HROA 3VN5A 5D3GA 4O5BA 3OS1A 3ITHA 4I9QA 1S6QA 5HLFA 2O4GA 4CIGA 4M3ZA 4FJ5A 3ASMA 1ZBIA 4FW1A 3IS9A 1SV5A 2KFNA 2X6SA 1S9EA 1KLMA 1VSFA 3AVFA 4RW4A 3OJSA 3IG1A 3OYMA 4HTUA 3CQ8A 3ZSXA 2Y1JA 2YHBA 4CJLA 3DRPA 4DTRA 3L2WA 3P5JA 1RTHA 4DTNA 1L3UA 1JLAA 2A1SA 1S1WA 4DQPA 4C8OA 4AILC 3U3GA 2HB5A 2OZSA 3RMDA 4CGHA 2RF2A 4FM0A 1ZBUA 1YT3A 4IFYA 3EYZA 1X9SA 3FFIA 1S1TA 1G15A 4CF0A 1NK5A 5JS2A 3HPOA 4KHWA 3NF9A 4BACA 4I7FA 5CZ2A 3VQQA 4CJVA 4CFDA 2VWJA 4PUOA 4ZTFA 3AVJA 3NDKA 3VA0A 2EHGA 2I5JA 4CFAA 3HYFA 1BCMA 4CEDA 1CZ9A 1DLOA 4C8KA 4E0DA 5FROA 2OPPA 4FJ9A 2HHSA 3TR8A 4B8AB 3BGRA 3MXJA 4F4KA 3G10A 3RRHA 4CF1A 3SZ2A 4CEQA 1U47A 1U49A 1T8EA 3VQCA 4FK0A 2XO7A 5K14A 2YKMA 2Z1HA 4DTOA 4M3UA 3UIQA 3LPTA 1I39A 3M8QA 3SUPA 3AVNA 4HCCA 4LH4A 4L8RB 3AVLA 3L3VA 4IBNA 4OPJA 2XY8A 2FC0A 3M8RA 1C1AA 3M8SA 3SCXA 4FJ8A 4TSXA 3PO5A 2KTQA 1SL1A 4IDKA 1NJWA 4M42A 3KK2A 4Z4GA 2ZD1A 3AA4A 3U6FA 1C1CA 1CZBA 3L2QA 3V4IA 3PX6A 3G0ZA 3MEEA 1RDBA 1RDAA 1RT7A 4IFVA 2E4LA 4G1QA 5E41A 4DTUA 1GOCA 4NYNA 5FRMA 3DM2A 3QNOA 3HO1A 2A1RA 4DSKA 2BGGA 1TVRA 3NF8A 4AHCA 3ZT1A 4ICLA 1QSSA 1S5JA 3V1RA 4JLHA 3VQ8A 4AHUA 2YNIA 4O55A 3DOLA 1ITGA 4EP4A 2KFZA 3SQ0A 3QO9A 4QAGA 1L3VA 2EX3A 1VSKA 4BE2A 4W5TA 4N56A 3V9ZA 2DY4A 3V9UA 1JLCA 3A2FA 3LDSA 3DLRA 3NH1A 3SV4A 4NYFA 1JLFA 4DQSA 1L3SA 4Z4IA 2NUBA 3B6OA 4OKKA 3AV9A 1Q9XA 4W5OA 1T03A 3IRXA 4H4MA 3S3MA 3ZSOA 4KI4A 4E19A 3AVGA 3C94A 3LZIA 1GOBA 3HVRA 1FK9A 4CJSA 1NOYA 4XIUA 2X6NA 3V9SA 4BWMA 4CGFA 2BDPA 3H08A 3MAQA 4CERA 2B6AA 3K5NA 4KTQA 4FYDA 4O4GA 1TKZA 4H8KA 2E6LA 4CJUA 3THVA 3O4NA 1J54A 4RG8A 3OS2A 4NCAA 4FJHA 4E89A 4DQRA 4Z4EA 5J1EA 3NGZA 4LY7A 3SPYA 1LWEA 4ZTJA 1NK0A 3HVTA 1FKOA 4DFKA 5HP1A 2YV0X 4FZYA 3OYFA 3LZJA 1VSMA 1BISA 4OGEA 2D0CA 4OLAA 1RNHA 4GVMA 4O0JA 3S9HA 4M3TA 5HRNA 4KFBA 2LSNA 3JSMA 2P5GA 3QEXA 3VQ9A 1RDDA 4FJMA 1EETA 2HHXA 1S6PA 2B5JA 3VQ5A 4CJ4A 3L8BA 3ZCMA 2VG7A 2P1JA 3I0RA 4K8XA 4M3XA 3PX4A 3TAMA 3DLGA 4PY5A 4CFBA 1LV5A 3QLHA 3MXIA 1QHTA 1KVBA 3NGYA 1HPZA 3TAEA 1BQNA 2B4JA 3S3OA 1RBUA 3P1GA 1IKXA 4F8RA 4CGIA 4KAZA 1D9FA 4EZ9A 1MU2A 4OVLA 3V6DA 2QKKA 3ZT3A 4CGGA 3CM6A 4I2PA 3SJJA 4BDZA 4K8ZA 4HVJA 4QOZB 3HPHA 1D5AA 3HP6A 2RN2A 4CE9A 3V9WA 3TAGA 3SQ2A 2KW4A 2KQ2A 3AA3A 3HL8A 4Y1DA 3PY8A 4GMJB 3OYBA 4JS4A 3SQ4A 4DMNA 1R0AA 4ELTA 4F2RA 2BE2A 4IG0A 1TKDA 4KHSA 1JLQA 4DU1A 4FJXA 3KTQA 1UAXA 1RDCA 1RBRA 3WNGA 3KJVA 3QEIA 4E7LA 1WN7A 4Y1CA 3LP2A 2ZQBA 4KPYA 1T7PA 2G8UA 2QK9A 1UA1A 2WOMA 4FZXC 4OKEA 3C6UA 1TV6A 3HP9A 2XRIA 3NH2A 4E7HA 3M8PA 3TAQA 5HRPA 4EP5A 3QEPA 2G8HA 4CJRA 3OYAA 1BI4B 2Z1JA 4C8NA 4DF4A 3OYKA 2OA8A 2PZSA 4EZ6A 1RT6A 4FJLA 3B6PA 4CF8A 3ZT2A 1L3TA 1HNVA 2FBXA 2Y1IA 3S3NA 3OYJA 2FBYA 3ZSWA 1S1XA 3E01A 3TABA 4BDYA 5I3UA 2OZMA 3OVNA 5DMRA 4CEAA 2OPSA 4KHQA 4MQ3A 2QXFA 4AHTA 3T19A 5HRSA 4DF8A 4J2DA 4W5NA 2Z1IA 2X78A 1JL2A 1WSIA 4KHNA 4FK4A 1XWLA 3ZT4A 3VQ4A 1C1BA 5I42A 2JLEA 4CEFA 1BL3A 4CGJA 1BIZA 2Q3SA 1A5VA 2W42A 1TK0A 1IKWA 3TAFA 3VQAA 3KKRA 4N76A 3DLBA 3LWLA 3HK2A 4FLTA 2G8WA 1DTTA 4Q5VA 5C24A 2E6MA 4FJGA 3IAYA 4FLZA 4KHYA 5FDLA 1Q9YA 3L2UA 4CF9A 3AVAA 3SYZA 1RBSA 4DSEA 4AHRA 2FBVA 3OS0A 1VRUA 4KREA 4LD0A 1XHZA 5HRRA 1ASWA 3AO1A 4FXDA 1Z25A 1K6YA 4I9LA 4RW6A 2IGIA 4FJKA 3K2PA 1WAJA 2IDOA 4KB1A 4ZHRA 2G8IA 1KFSA 4IG3A 3O3FA 2YNGA 1IG9A 4M3YA 2YHAA 3ULDA 4M3RA 3RMBA 4FLVA 1ASVA 1YTAA 3K5MA 3QESA 3SPZA 4CHZA 2GUIA 4Z0UA 1RT3A 2Z1GA 4DS5A 5J2MA 4Q0BA 3ZSVA 2G8FA 2R7YA 1RT1A 3NFAA 3QERA 4E1NA 1X1PA 4M41A 3DI6A 3NBPA 3AVHA 3KK1A 1ZBFA 4CIFA 1CXQA 2DFHA 3KLHA 2XHBA 4ELVA 1I3AA 1QSYA 1SKWA 3CFOA 3OYHA 4DLGA 4E7JA 2HNDA 3EY1A 4AHSA 2P5OA 3CM5A 4N47A 1HQEA 4CHQA 1BGXT 1HQUA 2OPRA 3AVIA 4KHUA 5CYQA 4NCGA 4CEOA 4CK1A 3SUQA 3OYIA 4FJIA 1HYSA 4HHTA 1S1VA 1WSFA 4CEEA 3HT3A 3SUNA 4F2SA 3C95A 4YNQA 4PWDA 5SZTA 4FVMA 5C42A 4DTPA 1KTQA 3V1QA 3KD5E 1QSLA 4WE1A 3I8DA 4DFMA 1RTJA 3KIOA 1UWBA 2HHQA 3HM9A 4B9TA 2HMIA 4FJNA 2XY5A 1IH7A 1LW0A 4FZZA 4CECA 3ISNC 3VQDA 5KGXA 4CEZA 4J2BA 4FW2A 4HUGA 1U45A 3HPGA 4KI6A 1YVUA 3AO2A 3I0SA 4B8CA 5KTQA 1KLNA 2HVIA 1CLQA 1KSPA 4DTJA 3SUOA 3VQPA 1VSEA 4PQUA 4R5PA 1SKSA 4J2EA 3QETA 4DFJA 1A5XA 4B9MA 1A5WA 3RMAA 4FM2A 4CHYA 1JLBA 3MXMA 4BWJA 4C8LA 3D45A 1F21A 2RKIA 5CYMA 1GOAA 2WONA 4B9LA 1WAFA 4KKOA 4BE1A 1RT5A 1NKCA 4CHNA 4Z4HA 4J2AA 4MFBA 5DK5A 4HUEA 2PYJA 1ASUA 3MECA 4Z4FA 2OPQA 3QIOA 2HVHA 1NOZA 5J2QA 1VSJA 4PA1A 3AVCA 4LSLA 1SUQA 4FLXA 3DMJA 3PV8A 3DRSA 1RT2A 1TK5A 1XHXA 1O1WA 4CEBA 1TAQA 4OPKA 3DRRA 4DU4A 1BI4A 3T3FA 1QE1A 2X74A 5CY4A 3RR7A 1JXEA 3L2RA 3SNNA 4LSNA 3DLHA 1EXQA 1WSGA 3LANA 1WLJA 4C8MA 3VQ7A 1QTMA 1ZBHA 1NK4A 3CG7A 5FRNA 3KLGA 5KGWA 1ZBLA 2YNFA 4B9SA 4W5QA 4FLWA 1WSHA 3RTVA 1BHLA 1J53A 3CFPA 1D8YA 4KB0A 4CK2A 3O3GA 1TAUA 2GBZA 3MEGA 1JKHA 1KCFA 1KFDA 1UA0A 3NAEA 3LAKA 2D0BA 1XI1A 1EKEA 4JRPA 1REVA 2DFFA 2BANA 1U04A 1J9AA 4CF2A 1ZYQA 3OYCA 3OYLA 5EU7A 3TAPA 4F3TA 4E7KA 3VQ6A 1LWCA 1S9GA 4CJKA 1JLEA 3CYMA 3RMCA 1IKVA 3HJFA 4DU3A 4BE0A 2JGUA 4AHVA 2OYQA 4CHOA 1KVAA 3TARA 3KD1E 2YNHA 3AVKA 3AO5A 1TKXA 4E1MA 4I2QA 4ID5A 4RW7A 2ITGA 2VG6A 4E7IA 3AA5X 1SKRA 4DSLA 3O4QA 1NJYA 1D9DA 1NKEA 5T7BA 2YKNA 4CIEA 2XY6A 1NJZA 4DWIA 4DS4A 2F8TA 1Z26A 4Z4CA 3PUFA 4HCBA 2HHUA 4LH5A 2G8KA 1DTQA 3LP0A 5CZ1A 4CJFA 4DFPA 3CFRA 3PX0A 3QIPA 3KK3A 3TANA 4CFCA 1X9MA 1VSLA 2DTUA 4IKFA 4CGDA 3QEVA 1LWFA 1RCHA 2ATQA 1C0MA 4DSIA 1Y97A 4DTXA 5KRSA 2KZMA 1NJXA 1RBTA 1NK8A 3LALA 3KLIA 4JS5A 4FJJA 1W0HA 3QINA 3K59A 3LP3A 3NH0A 1U48A 2ZE2A 3D0PA 4FCYA 4OGCA 4OKJA 3ZSYA 4CJQA 4W5RA 1RT4A 1YTUA 2ETJA 1VK0A 3WNFA 3NF6A 1U4BA 4FK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KV8 A;  3VQB A;  4FJ7 A;  4DG1 A;  1RTD A;  4DTM A;  4CES A;  4KRF A;  1VSI A;  3KKS A;  3DLE A;  5SWM A;  3ZSZ A;  1X9W A;  2HW3 A;  1UOC A;  1NK6 A;  3LAM A;  4FM1 A;  4B08 A;  4BDP A;  5C25 A;  4FLU A;  1QS4 A;  3NHG A;  1NKB A;  1LAV A;  2D0A A;  1FKP A;  4NCB A;  4DSJ A;  1TKT A;  2D5R A;  1NK7 A;  4CJP A;  1N6Q A;  2IS3 A;  1IO2 A;  3MED A;  4HUF A;  3OY9 A;  3NCI A;  3QEW A;  4RW9 A;  3HXM A;  3JYT A;  3KLF A;  3QNN A;  1TGO A;  1SL0 A;  1SL2 A;  1TL3 A;  1J5O A;  4CCH A;  3AVM A;  3K5O A;  3V9X A;  1LW2 A;  2XY7 A;  3K58 A;  3ZSR A;  3EZ5 A;  1C6V A;  4H4O A;  1FXX A;  3TI0 A;  2HNY A;  1RBV A;  2HNZ A;  3WNE A;  3K57 A;  4B3O A;  3NGI A;  2DFE A;  4CK3 A;  1Q8I A;  3SQ1 A;  3RR8 A;  4DTS A;  3RRG A;  3V1O A;  1B92 A;  4N5S A;  3ZSQ A;  1KRP A;  1RIL A;  3VQE A;  1HMV A;  1QQC A;  3K5L A;  4ELU A;  1WNS A;  4OJR A;  3F9K A;  2IOC A;  1JLG A;  1BQM A;  4F3O A;  3NE6 A;  3L2V A;  4B9U A;  2QKB A;  1HRH A;  2FBT A;  5J2N A;  3OYE A;  1KVC A;  4CJT A;  1VSH A;  3DOK A;  3AA2 A;  4DSF A;  2GV9 A;  4M45 A;  2G8V A;  2HHT A;  1XC9 A;  1B9F A;  3LWM A;  2P51 A;  3OYG A;  3LP1 A;  4JRQ A;  1N5Y A;  4CHP A;  3OYN A;  2VWK A;  1T05 A;  2VG5 A;  5KRT A;  4QCL A;  4B9N A;  4GW6 A;  4YFU A;  3BDP A;  3RWU A;  1S1U A;  3ALY A;  2F8S A;  1HJR A;  2RPI A;  3V81 A;  4DQQ A;  4KTZ A;  4CJ5 A;  4E3S A;  1CXU A;  1HNI A;  1NK9 A;  3PO4 A;  2HHV A;  1TK8 A;  1C0U A;  3P83 D;  4O44 A;  5HBM A;  4CJW A;  4UQG A;  3O3H A;  4OLB A;  3SI6 A;  2HHW A;  3OJU A;  3VA3 A;  1C0T A;  3ZT0 A;  3F73 A;  3NF7 A;  3OYD A;  5J2P A;  4B9V A;  3KLE A;  1BCO A;  1EP4 A;  1EX4 A;  4ID1 A;  1L5U A;  2O4I A;  2IAJ A;  4FLY A;  4DLE A;  3HST B;  4RW8 A;  2PY5 A;  3AO3 A;  1IKY A;  3U3Y A;  1WSJ A;  1HYZ A;  4O0I A;  4DQI A;  1RTI A;  5JS1 A;  4N41 A;  1JXB A;  3C6T A;  1B9D A;  3AVB A;  3LPU A;  5KI6 A;  3TWH A;  4CJE A;  1TL1 A;  2KZZ A;  3AO4 A;  3L3U A;  3WNH A;  1WSE A;  1LAW A;  4KTW A;  1W9H A;  1VSD A;  2PYL A;  1HYV A;  4M3W A;  2F96 A;  1BIU A;  2IC3 A;  2AJQ A;  3T1A A;  3DLK A;  4KO0 A;  1JL1 A;  1VRT A;  3DYA A;  4CJ3 A;  3SV3 A;  4AH9 A;  5HRO A;  3VN5 A;  5D3G A;  4O5B A;  3OS1 A;  3ITH A;  4I9Q A;  1S6Q A;  5HLF A;  2O4G A;  4CIG A;  4M3Z A;  4FJ5 A;  3ASM A;  1ZBI A;  4FW1 A;  3IS9 A;  1SV5 A;  2KFN A;  2X6S A;  1S9E A;  1KLM A;  1VSF A;  3AVF A;  4RW4 A;  3OJS A;  3IG1 A;  3OYM A;  4HTU A;  3CQ8 A;  3ZSX A;  2Y1J A;  2YHB A;  4CJL A;  3DRP A;  4DTR A;  3L2W A;  3P5J A;  1RTH A;  4DTN A;  1L3U A;  1JLA A;  2A1S A;  1S1W A;  4DQP A;  4C8O A;  4AIL C;  3U3G A;  2HB5 A;  2OZS A;  3RMD A;  4CGH A;  2RF2 A;  4FM0 A;  1ZBU A;  1YT3 A;  4IFY A;  3EYZ A;  1X9S A;  3FFI A;  1S1T A;  1G15 A;  4CF0 A;  1NK5 A;  5JS2 A;  3HPO A;  4KHW A;  3NF9 A;  4BAC A;  4I7F A;  5CZ2 A;  3VQQ A;  4CJV A;  4CFD A;  2VWJ A;  4PUO A;  4ZTF A;  3AVJ A;  3NDK A;  3VA0 A;  2EHG A;  2I5J A;  4CFA A;  3HYF A;  1BCM A;  4CED A;  1CZ9 A;  1DLO A;  4C8K A;  4E0D A;  5FRO A;  2OPP A;  4FJ9 A;  2HHS A;  3TR8 A;  4B8A B;  3BGR A;  3MXJ A;  4F4K A;  3G10 A;  3RRH A;  4CF1 A;  3SZ2 A;  4CEQ A;  1U47 A;  1U49 A;  1T8E A;  3VQC A;  4FK0 A;  2XO7 A;  5K14 A;  2YKM A;  2Z1H A;  4DTO A;  4M3U A;  3UIQ A;  3LPT A;  1I39 A;  3M8Q A;  3SUP A;  3AVN A;  4HCC A;  4LH4 A;  4L8R B;  3AVL A;  3L3V A;  4IBN A;  4OPJ A;  2XY8 A;  2FC0 A;  3M8R A;  1C1A A;  3M8S A;  3SCX A;  4FJ8 A;  4TSX A;  3PO5 A;  2KTQ A;  1SL1 A;  4IDK A;  1NJW A;  4M42 A;  3KK2 A;  4Z4G A;  2ZD1 A;  3AA4 A;  3U6F A;  1C1C A;  1CZB A;  3L2Q A;  3V4I A;  3PX6 A;  3G0Z A;  3MEE A;  1RDB A;  1RDA A;  1RT7 A;  4IFV A;  2E4L A;  4G1Q A;  5E41 A;  4DTU A;  1GOC A;  4NYN A;  5FRM A;  3DM2 A;  3QNO A;  3HO1 A;  2A1R A;  4DSK A;  2BGG A;  1TVR A;  3NF8 A;  4AHC A;  3ZT1 A;  4ICL A;  1QSS A;  1S5J A;  3V1R A;  4JLH A;  3VQ8 A;  4AHU A;  2YNI A;  4O55 A;  3DOL A;  1ITG A;  4EP4 A;  2KFZ A;  3SQ0 A;  3QO9 A;  4QAG A;  1L3V A;  2EX3 A;  1VSK A;  4BE2 A;  4W5T A;  4N56 A;  3V9Z A;  2DY4 A;  3V9U A;  1JLC A;  3A2F A;  3LDS A;  3DLR A;  3NH1 A;  3SV4 A;  4NYF A;  1JLF A;  4DQS A;  1L3S A;  4Z4I A;  2NUB A;  3B6O A;  4OKK A;  3AV9 A;  1Q9X A;  4W5O A;  1T03 A;  3IRX A;  4H4M A;  3S3M A;  3ZSO A;  4KI4 A;  4E19 A;  3AVG A;  3C94 A;  3LZI A;  1GOB A;  3HVR A;  1FK9 A;  4CJS A;  1NOY A;  4XIU A;  2X6N A;  3V9S A;  4BWM A;  4CGF A;  2BDP A;  3H08 A;  3MAQ A;  4CER A;  2B6A A;  3K5N A;  4KTQ A;  4FYD A;  4O4G A;  1TKZ A;  4H8K A;  2E6L A;  4CJU A;  3THV A;  3O4N A;  1J54 A;  4RG8 A;  3OS2 A;  4NCA A;  4FJH A;  4E89 A;  4DQR A;  4Z4E A;  5J1E A;  3NGZ A;  4LY7 A;  3SPY A;  1LWE A;  4ZTJ A;  1NK0 A;  3HVT A;  1FKO A;  4DFK A;  5HP1 A;  2YV0 X;  4FZY A;  3OYF A;  3LZJ A;  1VSM A;  1BIS A;  4OGE A;  2D0C A;  4OLA A;  1RNH A;  4GVM A;  4O0J A;  3S9H A;  4M3T A;  5HRN A;  4KFB A;  2LSN A;  3JSM A;  2P5G A;  3QEX A;  3VQ9 A;  1RDD A;  4FJM A;  1EET A;  2HHX A;  1S6P A;  2B5J A;  3VQ5 A;  4CJ4 A;  3L8B A;  3ZCM A;  2VG7 A;  2P1J A;  3I0R A;  4K8X A;  4M3X A;  3PX4 A;  3TAM A;  3DLG A;  4PY5 A;  4CFB A;  1LV5 A;  3QLH A;  3MXI A;  1QHT A;  1KVB A;  3NGY A;  1HPZ A;  3TAE A;  1BQN A;  2B4J A;  3S3O A;  1RBU A;  3P1G A;  1IKX A;  4F8R A;  4CGI A;  4KAZ A;  1D9F A;  4EZ9 A;  1MU2 A;  4OVL A;  3V6D A;  2QKK A;  3ZT3 A;  4CGG A;  3CM6 A;  4I2P A;  3SJJ A;  4BDZ A;  4K8Z A;  4HVJ A;  4QOZ B;  3HPH A;  1D5A A;  3HP6 A;  2RN2 A;  4CE9 A;  3V9W A;  3TAG A;  3SQ2 A;  2KW4 A;  2KQ2 A;  3AA3 A;  3HL8 A;  4Y1D A;  3PY8 A;  4GMJ B;  3OYB A;  4JS4 A;  3SQ4 A;  4DMN A;  1R0A A;  4ELT A;  4F2R A;  2BE2 A;  4IG0 A;  1TKD A;  4KHS A;  1JLQ A;  4DU1 A;  4FJX A;  3KTQ A;  1UAX A;  1RDC A;  1RBR A;  3WNG A;  3KJV A;  3QEI A;  4E7L A;  1WN7 A;  4Y1C A;  3LP2 A;  2ZQB A;  4KPY A;  1T7P A;  2G8U A;  2QK9 A;  1UA1 A;  2WOM A;  4FZX C;  4OKE A;  3C6U A;  1TV6 A;  3HP9 A;  2XRI A;  3NH2 A;  4E7H A;  3M8P A;  3TAQ A;  5HRP A;  4EP5 A;  3QEP A;  2G8H A;  4CJR A;  3OYA A;  1BI4 B;  2Z1J A;  4C8N A;  4DF4 A;  3OYK A;  2OA8 A;  2PZS A;  4EZ6 A;  1RT6 A;  4FJL A;  3B6P A;  4CF8 A;  3ZT2 A;  1L3T A;  1HNV A;  2FBX A;  2Y1I A;  3S3N A;  3OYJ A;  2FBY A;  3ZSW A;  1S1X A;  3E01 A;  3TAB A;  4BDY A;  5I3U A;  2OZM A;  3OVN A;  5DMR A;  4CEA A;  2OPS A;  4KHQ A;  4MQ3 A;  2QXF A;  4AHT A;  3T19 A;  5HRS A;  4DF8 A;  4J2D A;  4W5N A;  2Z1I A;  2X78 A;  1JL2 A;  1WSI A;  4KHN A;  4FK4 A;  1XWL A;  3ZT4 A;  3VQ4 A;  1C1B A;  5I42 A;  2JLE A;  4CEF A;  1BL3 A;  4CGJ A;  1BIZ A;  2Q3S A;  1A5V A;  2W42 A;  1TK0 A;  1IKW A;  3TAF A;  3VQA A;  3KKR A;  4N76 A;  3DLB A;  3LWL A;  3HK2 A;  4FLT A;  2G8W A;  1DTT A;  4Q5V A;  5C24 A;  2E6M A;  4FJG A;  3IAY A;  4FLZ A;  4KHY A;  5FDL A;  1Q9Y A;  3L2U A;  4CF9 A;  3AVA A;  3SYZ A;  1RBS A;  4DSE A;  4AHR A;  2FBV A;  3OS0 A;  1VRU A;  4KRE A;  4LD0 A;  1XHZ A;  5HRR A;  1ASW A;  3AO1 A;  4FXD A;  1Z25 A;  1K6Y A;  4I9L A;  4RW6 A;  2IGI A;  4FJK A;  3K2P A;  1WAJ A;  2IDO A;  4KB1 A;  4ZHR A;  2G8I A;  1KFS A;  4IG3 A;  3O3F A;  2YNG A;  1IG9 A;  4M3Y A;  2YHA A;  3ULD A;  4M3R A;  3RMB A;  4FLV A;  1ASV A;  1YTA A;  3K5M A;  3QES A;  3SPZ A;  4CHZ A;  2GUI A;  4Z0U A;  1RT3 A;  2Z1G A;  4DS5 A;  5J2M A;  4Q0B A;  3ZSV A;  2G8F A;  2R7Y A;  1RT1 A;  3NFA A;  3QER A;  4E1N A;  1X1P A;  4M41 A;  3DI6 A;  3NBP A;  3AVH A;  3KK1 A;  1ZBF A;  4CIF A;  1CXQ A;  2DFH A;  3KLH A;  2XHB A;  4ELV A;  1I3A A;  1QSY A;  1SKW A;  3CFO A;  3OYH A;  4DLG A;  4E7J A;  2HND A;  3EY1 A;  4AHS A;  2P5O A;  3CM5 A;  4N47 A;  1HQE A;  4CHQ A;  1BGX T;  1HQU A;  2OPR A;  3AVI A;  4KHU A;  5CYQ A;  4NCG A;  4CEO A;  4CK1 A;  3SUQ A;  3OYI A;  4FJI A;  1HYS A;  4HHT A;  1S1V A;  1WSF A;  4CEE A;  3HT3 A;  3SUN A;  4F2S A;  3C95 A;  4YNQ A;  4PWD A;  5SZT A;  4FVM A;  5C42 A;  4DTP A;  1KTQ A;  3V1Q A;  3KD5 E;  1QSL A;  4WE1 A;  3I8D A;  4DFM A;  1RTJ A;  3KIO A;  1UWB A;  2HHQ A;  3HM9 A;  4B9T A;  2HMI A;  4FJN A;  2XY5 A;  1IH7 A;  1LW0 A;  4FZZ A;  4CEC A;  3ISN C;  3VQD A;  5KGX A;  4CEZ A;  4J2B A;  4FW2 A;  4HUG A;  1U45 A;  3HPG A;  4KI6 A;  1YVU A;  3AO2 A;  3I0S A;  4B8C A;  5KTQ A;  1KLN A;  2HVI A;  1CLQ A;  1KSP A;  4DTJ A;  3SUO A;  3VQP A;  1VSE A;  4PQU A;  4R5P A;  1SKS A;  4J2E A;  3QET A;  4DFJ A;  1A5X A;  4B9M A;  1A5W A;  3RMA A;  4FM2 A;  4CHY A;  1JLB A;  3MXM A;  4BWJ A;  4C8L A;  3D45 A;  1F21 A;  2RKI A;  5CYM A;  1GOA A;  2WON A;  4B9L A;  1WAF A;  4KKO A;  4BE1 A;  1RT5 A;  1NKC A;  4CHN A;  4Z4H A;  4J2A A;  4MFB A;  5DK5 A;  4HUE A;  2PYJ A;  1ASU A;  3MEC A;  4Z4F A;  2OPQ A;  3QIO A;  2HVH A;  1NOZ A;  5J2Q A;  1VSJ A;  4PA1 A;  3AVC A;  4LSL A;  1SUQ A;  4FLX A;  3DMJ A;  3PV8 A;  3DRS A;  1RT2 A;  1TK5 A;  1XHX A;  1O1W A;  4CEB A;  1TAQ A;  4OPK A;  3DRR A;  4DU4 A;  1BI4 A;  3T3F A;  1QE1 A;  2X74 A;  5CY4 A;  3RR7 A;  1JXE A;  3L2R A;  3SNN A;  4LSN A;  3DLH A;  1EXQ A;  1WSG A;  3LAN A;  1WLJ A;  4C8M A;  3VQ7 A;  1QTM A;  1ZBH A;  1NK4 A;  3CG7 A;  5FRN A;  3KLG A;  5KGW A;  1ZBL A;  2YNF A;  4B9S A;  4W5Q A;  4FLW A;  1WSH A;  3RTV A;  1BHL A;  1J53 A;  3CFP A;  1D8Y A;  4KB0 A;  4CK2 A;  3O3G A;  1TAU A;  2GBZ A;  3MEG A;  1JKH A;  1KCF A;  1KFD A;  1UA0 A;  3NAE A;  3LAK A;  2D0B A;  1XI1 A;  1EKE A;  4JRP A;  1REV A;  2DFF A;  2BAN A;  1U04 A;  1J9A A;  4CF2 A;  1ZYQ A;  3OYC A;  3OYL A;  5EU7 A;  3TAP A;  4F3T A;  4E7K A;  3VQ6 A;  1LWC A;  1S9G A;  4CJK A;  1JLE A;  3CYM A;  3RMC A;  1IKV A;  3HJF A;  4DU3 A;  4BE0 A;  2JGU A;  4AHV A;  2OYQ A;  4CHO A;  1KVA A;  3TAR A;  3KD1 E;  2YNH A;  3AVK A;  3AO5 A;  1TKX A;  4E1M A;  4I2Q A;  4ID5 A;  4RW7 A;  2ITG A;  2VG6 A;  4E7I A;  3AA5 X;  1SKR A;  4DSL A;  3O4Q A;  1NJY A;  1D9D A;  1NKE A;  5T7B A;  2YKN A;  4CIE A;  2XY6 A;  1NJZ A;  4DWI A;  4DS4 A;  2F8T A;  1Z26 A;  4Z4C A;  3PUF A;  4HCB A;  2HHU A;  4LH5 A;  2G8K A;  1DTQ A;  3LP0 A;  5CZ1 A;  4CJF A;  4DFP A;  3CFR A;  3PX0 A;  3QIP A;  3KK3 A;  3TAN A;  4CFC A;  1X9M A;  1VSL A;  2DTU A;  4IKF A;  4CGD A;  3QEV A;  1LWF A;  1RCH A;  2ATQ A;  1C0M A;  4DSI A;  1Y97 A;  4DTX A;  5KRS A;  2KZM A;  1NJX A;  1RBT A;  1NK8 A;  3LAL A;  3KLI A;  4JS5 A;  4FJJ A;  1W0H A;  3QIN A;  3K59 A;  3LP3 A;  3NH0 A;  1U48 A;  2ZE2 A;  3D0P A;  4FCY A;  4OGC A;  4OKJ A;  3ZSY A;  4CJQ A;  4W5R A;  1RT4 A;  1YTU A;  2ETJ A;  1VK0 A;  3WNF A;  3NF6 A;  1U4B A;  4FK2 A; 
#chains in the Genus database with same CATH topology
 3VQB A;  1K8K A;  3R3L A;  4FJ7 A;  1RTD A;  3OBY A;  1VSI A;  3ZSZ A;  1UOC A;  4BRH A;  1NK6 A;  3D2F B;  1QS4 A;  2Q2R A;  4DSJ A;  4DR4 K;  3BEX A;  4H03 B;  5H1S Q;  1N6Q A;  3P39 A;  1TUY A;  4M7X A;  3AGR A;  2ZJQ L;  5A2Q O;  3KLF A;  1TGO A;  4FWM A;  2Q97 A;  1RBV A;  3K57 A;  1NGC A;  4X62 K;  1NGH A;  3D2E A;  3V1O A;  1B92 A;  3PSI A;  4OX9 K;  1RIL A;  1QQC A;  4JKB A;  1NGG A;  5GAD P;  4F3O A;  4B9U A;  2FBT A;  5J2N A;  1VSH A;  2UYT A;  2GV9 A;  4M45 A;  2O8F B;  1VQL N;  2P51 A;  5IWA K;  3MMV A;  3OTO K;  2QWQ A;  3OYN A;  3O1B A;  3WQU A;  1ATN A;  2VG5 A;  4B9N A;  4GW6 A;  3BDP A;  3RWU A;  1S1U A;  4FPA A;  2F8S A;  1HJR A;  1ZXO A;  4BC2 A;  4DQQ A;  4KTZ A;  4JI5 K;  4PKH A;  1JJ2 M;  3CXC M;  1HNI A;  1NK9 A;  2HHV A;  3P83 D;  4O44 A;  4RTF D;  4UQG A;  3SI6 A;  3HTV A;  3TTF A;  3VTI A;  3VA3 A;  3F73 A;  3ZET A;  3R8E A;  3ZX3 A;  4B9V A;  1BCO A;  1EP4 A;  3MCP A;  4FO0 A;  3U3Y A;  2ZF5 O;  1B9D A;  3LPU A;  4YOY A;  1TL1 A;  3L3U A;  4KTW A;  2WBN A;  2PYL A;  4M3W A;  4KO0 A;  2Q31 A;  2HMP A;  2NRV A;  3SV3 A;  3KZB A;  4AH9 A;  3R1X A;  5BN9 A;  3J8A A;  4YHH K;  1BWF O;  3EKU A;  4CIG A;  1E4F T;  4WF9 L;  4X64 K;  3AVF A;  1S9E A;  4BRN A;  1MWM A;  4HTU A;  3IG1 A;  3OYM A;  3CQ8 A;  4BGA A;  4BC5 A;  5F1X A;  3EL2 A;  2P9L A;  3L2W A;  3P5J A;  1S1W A;  1NWK A;  1MA9 B;  2KHO A;  3W3D A;  4AIL C;  1XC3 A;  1GLA G;  4IJN A;  5GAG P;  3FZK A;  4CGH A;  4IFY A;  1G99 A;  1KD1 O;  4IOA L;  4IEI A;  4BRC A;  3HPO A;  3NF9 A;  4PUO A;  4CFD A;  5CZ2 A;  2VWJ A;  4BRF A;  4ZTF A;  3AVJ A;  4AM6 A;  3MX2 A;  1BCM A;  5BR8 K;  1CZ9 A;  1DLO A;  3CJ1 A;  2QXL A;  3TTD A;  4BRE A;  2HF3 A;  5KPZ A;  4H5W A;  3TR8 A;  4B8A B;  4LF7 K;  4JI6 K;  2WUS A;  3D7E O;  4CF1 A;  4DR7 K;  4CEQ A;  4FK0 A;  3WXJ A;  4KH6 A;  4DTO A;  3U8X A;  4CI6 A;  1P90 A;  3AVN A;  2HOE A;  3KWI A;  3CCL N;  3SCX A;  4FL9 A;  5AZJ A;  3U4L A;  4FWS A;  1CZB A;  5BRE A;  3V4I A;  2FLO A;  3MEE A;  4IFV A;  3LM9 A;  2E4L A;  4DTU A;  3DM2 A;  4DSK A;  1C0F A;  1YXQ A;  3NF8 A;  4JLH A;  2YNI A;  3CJC A;  1ITG A;  1U2V A;  1KC8 O;  3SQ0 A;  2E1Z A;  2EX3 A;  2WTU A;  5IT9 O;  3DLR A;  3CQY A;  3NH1 A;  3SV4 A;  4NYF A;  2NUB A;  1VQN N;  4OKK A;  3AV9 A;  2I7P A;  3IRX A;  4H4M A;  3S3M A;  4KI4 A;  2NLX A;  3SLC A;  3MDQ A;  4E19 A;  3C94 A;  1NOY A;  1BO5 O;  1FK9 A;  4ISE A;  2X6N A;  3V9S A;  2ZJR L;  2BDP A;  4CGF A;  1TKZ A;  2QTD A;  3O4N A;  1IBL K;  4FJH A;  4LF8 K;  4DQR A;  4Z4E A;  5AFU H;  3KK7 A;  2PBD A;  5GIP A;  4BRQ A;  4DFK A;  1FKO A;  4BRL A;  3T69 A;  3VER A;  2YV0 X;  1N8R O;  3C6H A;  3OYF A;  4FZY A;  2D0C A;  1RNH A;  4O0J A;  3K9K A;  3JSM A;  1IBK K;  4I6M A;  1RDD A;  3L8B A;  2NRR A;  3ZCM A;  3CC7 N;  4M3X A;  3PX4 A;  1LV5 A;  3TAE A;  4JI7 K;  2E1Y A;  1IKX A;  1WUA A;  1OKJ A;  2QKK A;  1NGB A;  1KXP A;  3CCU N;  3SJJ A;  4I2P A;  4K41 A;  4K8Z A;  4HVJ A;  1D5A A;  4IWV A;  3HM8 A;  4CE9 A;  3SQ2 A;  3DXK B;  2KQ2 A;  4FJL A;  3PY8 A;  4JS4 A;  1R0A A;  4ELT A;  4KHS A;  4DU1 A;  4FJX A;  3EKS A;  1W2B M;  4OKE A;  3C6U A;  4YY3 K;  1TV6 A;  3HP9 A;  3NH2 A;  2G8H A;  1YI2 N;  4CJR A;  4EIA A;  1BOT O;  2Z1J A;  4C8N A;  3WXI A;  3O9R A;  1HNV A;  3WXL A;  1K8A O;  2QA4 N;  1YJN N;  3OVN A;  4BC3 A;  3T19 A;  4CW7 B;  4CZL A;  3F9M A;  1JCG A;  4X66 K;  4CEF A;  1A5V A;  1GLB G;  1IKW A;  3TAF A;  1K73 O;  3HK2 A;  1QHA A;  3VOV A;  4FLT A;  1IJJ A;  2I7N A;  1OH5 A;  2G8W A;  1VQ8 N;  1YVN A;  1HNZ K;  2EWS A;  3O08 A;  1Q9Y A;  4FOE A;  4CD1 A;  3OS0 A;  1VRU A;  1N36 K;  1ASW A;  5LY3 A;  1K6Y A;  5C12 A;  2F9W A;  4M3Y A;  4DR6 K;  1XMQ K;  3H1V X;  4M3R A;  3RMB A;  4FLV A;  1ASV A;  5AQI A;  3FFK B;  1YTA A;  3K5M A;  5BN8 A;  4Z0U A;  1RT3 A;  2Z1G A;  2R7Y A;  4E1N A;  2DFH A;  2XHB A;  1J6Z A;  2P5O A;  3EY1 A;  3CM5 A;  4N47 A;  1HQE A;  3AVI A;  3FE1 A;  4YOV A;  4FJI A;  4NCG A;  1HYS A;  2DPN A;  1S1V A;  3SUN A;  2VWB A;  4FVM A;  3O1W A;  2VQE K;  4DTP A;  3OHR A;  1QSL A;  3I8D A;  4JI2 K;  1X3N A;  4B9T A;  2HHQ A;  4FJN A;  2XY5 A;  2YCH A;  4CEC A;  3MX5 A;  4BY9 C;  5KGX A;  4JI8 K;  4FW2 A;  4KI6 A;  4FWL A;  3AO2 A;  1OH6 A;  1M1K O;  3LDN A;  3SUO A;  3VQP A;  3LM2 A;  4PQU A;  4LF6 K;  4J2E A;  2O8C A;  3RSE B;  1A5W A;  1ESV A;  2P9S B;  2QWO A;  3D45 A;  2O8B B;  5CYM A;  2WON A;  4IFE A;  3E1Y A;  4BE1 A;  1E3M A;  1TUU A;  4Z4H A;  1KAX A;  2PYJ A;  2HVH A;  4Z4F A;  2OPQ A;  1NOZ A;  2NRZ A;  4JKA A;  5J2Q A;  3AVC A;  4LSL A;  2E88 A;  4FVU A;  1N32 K;  3DRR A;  1BI4 A;  2E5L K;  3T3F A;  2UU9 K;  3DLH A;  1ZBH A;  1EXQ A;  1WSG A;  1ZC6 A;  5KGW A;  1VHX A;  4B9S A;  4PHT X;  3RTV A;  1D8Y A;  4KB0 A;  1Q18 A;  3O3G A;  2GBZ A;  2RHK A;  1UA0 A;  3NAE A;  3LAK A;  2D0B A;  3VET A;  2YJF A;  2BAN A;  1U04 A;  1J9A A;  4CF2 A;  1HLU A;  3OYC A;  2ASM A;  1S9G A;  1JLE A;  3TSQ A;  5AQF A;  1IKV A;  4DU3 A;  4BE0 A;  4CHO A;  4JI4 K;  3KD1 E;  2YNH A;  3AVK A;  3AO5 A;  4BG8 A;  2D0O A;  1S3X A;  2ITG A;  2VG6 A;  4E1J A;  4DSL A;  1NKE A;  2YKN A;  5AQK A;  1NJZ A;  3O4W A;  2F8T A;  1Z26 A;  5AQY A;  1X9M A;  3D2F A;  4CFC A;  1X9J A;  3VF6 A;  4IKF A;  1P8Z A;  3CME N;  2ATQ A;  3GG4 A;  3UE5 A;  2YJE A;  4QS7 A;  4GY2 B;  4DTX A;  4BRM A;  4BRI A;  4JS5 A;  3QB0 A;  5FPE A;  3K59 A;  3NH0 A;  1XMO K;  4OGC A;  4CJQ A;  2UUC K;  3WNF A;  2ZJP L;  3BF1 A;  2HHW A;  3GOI A;  4DG1 A;  3M3Z A;  4KRF A;  3MN7 A;  3KKS A;  3DLE A;  3ZYY X;  4PL7 A;  3QDK A;  4QS9 A;  1YUW A;  4BDP A;  4GKK K;  5B8H A;  4BR7 A;  1Q81 O;  3VEV A;  2O8F A;  1EWR A;  3TSP A;  1U6Z A;  2O8E B;  2P9K B;  3AVM A;  2V7Y A;  3K58 A;  4DHY A;  3I56 N;  1FXX A;  4B3O A;  3THY B;  1Q8I A;  3PSF A;  2VCP A;  5BRD A;  3ZSQ A;  1KRP A;  3NVK A;  1HMV A;  3DXM B;  3L4I A;  3K5L A;  2ASO A;  4ELU A;  3F9K A;  3T7Z A;  3L2V A;  3OYE A;  1KVC A;  1VQK N;  4JNE A;  4DSF A;  3BP8 A;  3DAW A;  1Z05 A;  4FWP A;  1T05 A;  4NXN K;  2QEX N;  3ALY A;  4AF1 A;  1C0U A;  5HBM A;  3O3H A;  2FSK A;  1C0T A;  4X65 K;  3Q7B A;  1EX4 A;  5GAH P;  4ID1 A;  3UB5 A;  4JK8 A;  3BF3 A;  4H5R A;  4FLY A;  4DLE A;  3HST B;  2ZGY A;  3FR0 A;  1HYZ A;  4O0I A;  4DQI A;  1RTI A;  3I33 A;  3CI5 A;  4N41 A;  3CCJ N;  3J7A P;  4MLH A;  5KI6 A;  1Q7Y O;  3WNH A;  4GV6 A;  2F96 A;  1BIU A;  4DV4 K;  3VEX A;  1QVF M;  3DYA A;  5HRO A;  5D3G A;  3ITH A;  2VQF K;  1S6Q A;  3K0S A;  2IVP A;  4M3Z A;  4FJ5 A;  3ASM A;  3MWP A;  5AR0 A;  4RW4 A;  4IXC A;  4DTR A;  1RTH A;  1L3U A;  2UXB K;  2P9P B;  1VQO N;  4C8O A;  2HB5 A;  3EYZ A;  1BG3 A;  3CER A;  1XQS C;  2QM1 A;  1VQ5 N;  3N4Q A;  3C7N B;  1S72 N;  4KHW A;  3VQQ A;  1HJO A;  3NDK A;  3HYF A;  4CED A;  4WFB L;  1CZA N;  1GLC G;  3MXJ A;  1T8E A;  5AQP A;  4WQ5 A;  5M1F A;  1I39 A;  3SAG A;  3IUC A;  5TKY A;  5LL6 Z;  3VF2 A;  3F2K A;  3AVL A;  3L3V A;  4H0V B;  4IBN A;  2XY8 A;  3M8R A;  4FJ8 A;  4H5V A;  4Z4G A;  3ZX2 A;  3U6F A;  4CBU A;  2FF6 A;  1NGA A;  4BGB A;  1FJG K;  2NNW A;  2OAN A;  2Q0U A;  3O6W A;  4NYN A;  3QNO A;  4BQZ A;  1TVR A;  4ICL A;  1IV0 A;  3V1R A;  2Q1N A;  3DOL A;  2UUB K;  3ZLJ A;  5MLC Q;  4KBO A;  2GUP A;  4CBX A;  3V9U A;  1JLC A;  1QQO A;  3QIC A;  4YDU A;  5AQS A;  1NU0 A;  1Q9X A;  5FPM A;  1FW6 A;  2GTD A;  3AVG A;  3LZI A;  1GOB A;  3HVR A;  3CQX A;  4YOR A;  2B6A A;  3K5N A;  2P9I B;  2E6L A;  3CPW M;  2KKZ A;  4B9Q A;  3P31 A;  4FSV A;  3DWL A;  4B1U B;  3OS2 A;  4NCA A;  3EO3 A;  4WYB A;  1M90 O;  5ELZ A;  1NGJ A;  3SPY A;  4LY7 A;  4ZTJ A;  5EX5 A;  3DXK A;  3LZJ A;  4R79 A;  2OTJ N;  4OGE A;  4GVM A;  3S9H A;  4M3T A;  5HRN A;  2LSN A;  5CR4 A;  3MN6 A;  3H6E A;  3J7Y P;  3QBX A;  4L3Q A;  2QI2 A;  3VQ5 A;  3J81 O;  3Q7C A;  3TAM A;  3NGY A;  1HPZ A;  4DV3 K;  4M63 C;  4JKE A;  4C1N I;  3OW2 M;  3P1G A;  4F8R A;  4CGI A;  4KAZ A;  2H3G X;  2HBJ A;  4H5N A;  1MU2 A;  3V6D A;  4LFA K;  5KPT A;  1OH7 A;  2FSJ A;  1ATR A;  3HPH A;  3J80 O;  3SMS A;  5HL7 L;  3ID8 A;  2KW4 A;  4Y1D A;  4C1N K;  3OYB A;  2UXC K;  4F2R A;  4CZF A;  4B1W B;  1TKD A;  1OH8 A;  4MO4 A;  1RDW X;  3QEI A;  4GVE A;  1WN7 A;  5LJV A;  1YF5 L;  3AY9 A;  2ZQB A;  1VQM N;  4DV6 K;  2QK9 A;  1UA1 A;  4BR2 A;  3T1H K;  3EE9 A;  3TAQ A;  2P9U A;  3SAH A;  4F9O A;  2PZS A;  2OA8 A;  1RT6 A;  3B6P A;  4A62 A;  4GV3 A;  3OYJ A;  5E26 A;  3ZSW A;  3ULE B;  3E01 A;  5ADX A;  4EFH A;  3J7Z O;  4BDY A;  5I3U A;  4KHQ A;  2QXF A;  5HRS A;  4W5N A;  5GAE P;  3CJ9 A;  2X78 A;  1WSI A;  3FLC O;  4FK4 A;  2YHY A;  3TU5 A;  1XWL A;  3VQ4 A;  5KPR A;  2JLE A;  3UKU B;  1BL3 A;  2A6A A;  1DGK N;  3KKR A;  2E2N A;  1DTT A;  4BR0 A;  5C24 A;  2E6M A;  4FJG A;  3CCE N;  3L2U A;  1RBS A;  4DSE A;  1HNX K;  4KRE A;  4LD0 A;  1XHZ A;  5HRR A;  4FXD A;  3ENO A;  3SBT A;  4RWT A;  4JHD B;  4I9L A;  4A61 A;  4RW6 A;  2IGI A;  5M1Q A;  3K2P A;  2IDO A;  5AQV A;  4KB1 A;  2G8I A;  3O3F A;  2YNG A;  1IG9 A;  3WXM B;  3H1Q A;  5EOY A;  1NGE A;  4Q0B A;  5J2M A;  4M41 A;  3DI6 A;  4NB4 A;  3AVH A;  3KK1 A;  1ZBF A;  1SKW A;  3RSE A;  4DLG A;  2HND A;  4OPH A;  4AHS A;  2P9S A;  3WUH A;  2O8B A;  1T3V A;  4CK1 A;  3O9T A;  1YJW N;  2IVN A;  1WSF A;  1N34 K;  5EY4 A;  5C42 A;  1E4G T;  2UXD K;  3QFU A;  1UWB A;  3HM9 A;  3C0B A;  1IH7 A;  1LW0 A;  2D4W A;  2E20 A;  3VQD A;  4HUG A;  3GBT A;  1WBD A;  3I0S A;  5KTQ A;  4JAX A;  1KLN A;  1KSP A;  1OVQ A;  4R5P A;  1SKS A;  3QET A;  1A5X A;  1TYQ B;  4FM2 A;  3HOT A;  4C8L A;  2A42 A;  2RKI A;  4Y0W A;  1WBB A;  1RT5 A;  5DK5 A;  5AQT A;  4PA1 A;  3UKR B;  3PIP L;  4FWK A;  3DMJ A;  2YHX A;  3DRS A;  3FZF A;  3FGU A;  3SJH A;  1BDG A;  1O1W A;  1XHX A;  3TPQ A;  5C10 A;  5AQR A;  3RR7 A;  1JXE A;  3L2R A;  1NMN A;  3LAN A;  4C8M A;  2GEM A;  3C6A A;  5FRN A;  3KLG A;  1BU6 O;  2YNF A;  2FXU A;  4FLW A;  1V4S A;  5AQZ A;  3BZK A;  3MEG A;  4DCH A;  3U9Z A;  1N33 K;  2HBL A;  2DFF A;  3H3O B;  3P4I A;  1ZYQ A;  4CVN E;  3PIO L;  4CJK A;  3HJF A;  4KH4 A;  3LDP A;  4AHV A;  3JXU A;  2OYQ A;  3TSU A;  3TAR A;  2AP1 A;  3BUZ B;  4RW7 A;  4ILJ A;  4E7I A;  3CCM N;  3O4Q A;  4QS8 A;  1GLJ O;  5T7B A;  1EQY A;  3AAQ A;  4DS4 A;  3THW B;  1SAZ A;  3PUF A;  4HCB A;  1J5O A;  3CFR A;  4BC4 A;  1DEJ A;  4JKG B;  4CGD A;  3WQT A;  4WQ4 C;  1V4T A;  4MDB A;  2O8E A;  1C0M A;  2P9K A;  2GWK A;  2KZM A;  5KRS A;  5AQQ A;  4FJJ A;  1U48 A;  2ZE2 A;  3D0P A;  4FCY A;  4OKJ A;  1GLL O;  3THY A;  1YTU A;  3QFP A;  1U4B A;  3JAM O;  4EHT A;  1J5E K;  5BR9 A;  4CBW A;  3DXM A;  3C65 A;  5BRF A;  5SWM A;  4JKC A;  1X9W A;  2HW3 A;  1MDU B;  3LAM A;  4FM1 A;  4B08 A;  4OO1 J;  5C25 A;  3G25 A;  4FLU A;  1NKB A;  2F9T A;  1LAV A;  1FKP A;  4IJA A;  4CJP A;  4DB3 A;  4HUF A;  3QEW A;  3OY9 A;  3NCI A;  3QNN A;  4RW9 A;  1SL2 A;  1SL0 A;  3ENB A;  1TL3 A;  4CCH A;  1LW2 A;  2XY7 A;  4H0T B;  1C6V A;  3TI0 A;  3MN5 A;  4O8K A;  2HNY A;  2HNZ A;  3WNE A;  2DFE A;  3RR8 A;  4DTS A;  2QWL A;  3D6R A;  3RRG A;  4N5S A;  2O8D B;  5AQH A;  1DT9 A;  3CHW A;  4OJR A;  1BQM A;  2QKB A;  3KWG A;  4CJT A;  5AQX A;  4IOC L;  3DOK A;  2V51 B;  3AA2 A;  4JKD A;  5AQU A;  5DM6 L;  2G8V A;  4FWQ A;  4HWI A;  3CJA A;  4JRQ A;  3LP1 A;  4CHP A;  5KRT A;  4QCL A;  4YFU A;  4XH5 A;  4YOX A;  1KAZ A;  4CJ5 A;  4WFA L;  1CXU A;  4JI0 K;  3PO4 A;  4OLB A;  4FWO A;  3NF7 A;  3OYD A;  3KLE A;  3LDL A;  2IAJ A;  1SQK A;  3DJC A;  5M1K A;  4YDU C;  4JD2 B;  3VEY A;  4DV1 K;  2P9P A;  1HR0 K;  5JS1 A;  1JXB A;  3C6T A;  3AVB A;  1JCF A;  4CJE A;  3CC4 N;  2NRX A;  3AO4 A;  3O5B A;  3SAF A;  1LAW A;  5JMV A;  3HOS A;  3NMU A;  1HYV A;  2IC3 A;  3C7N A;  1JL1 A;  4CJ3 A;  4IOX A;  3VN5 A;  5HOO A;  2O4G A;  1ZBI A;  3IS9 A;  1NLV A;  2KFN A;  2X6S A;  3MK6 A;  1KLM A;  5JLH A;  3OJS A;  4B3M K;  3ZSX A;  3CET A;  4DTN A;  2A1S A;  3U3G A;  2OZS A;  3RMD A;  2RF2 A;  1YT3 A;  2HST A;  3FFI A;  1S1T A;  1G15 A;  4CF0 A;  1NK5 A;  1X3M A;  4IZ9 A;  3VA0 A;  2QWM A;  4CFA A;  3FZH A;  1NMD A;  4E0D A;  2E2O A;  2E2Q A;  2OPP A;  2HHS A;  1VQ6 N;  3BGR A;  4B1X B;  3F5T A;  3G10 A;  4H5T A;  1ZBS A;  3RRH A;  3CF5 L;  3AAP A;  3SZ2 A;  1U49 A;  4MO5 A;  3VQC A;  4CZM A;  2XO7 A;  4LF5 K;  4RCH A;  5GIN A;  5K14 A;  2YKM A;  2Z1H A;  4M3U A;  3UIQ A;  3AGK A;  3CD6 N;  2GX9 A;  2F4V K;  4H0X B;  4HCC A;  4DV7 K;  4L8R B;  4OPJ A;  2KTQ A;  2FC0 A;  1C1A A;  5E84 A;  1NJW A;  3AA4 A;  4DV2 K;  3A5N C;  3OA9 A;  4YOU A;  3VMF B;  1NM1 A;  5F0X A;  2QWR A;  4LF9 K;  2OTL N;  4BVP A;  5E41 A;  4G1Q A;  5FRM A;  4B1Z A;  3HO1 A;  4UY8 O;  2P9I A;  2A1R A;  2BGG A;  3ZT1 A;  1S5J A;  3VQ8 A;  1WB9 A;  4EP4 A;  3QO9 A;  1NBW A;  3QBW A;  1VQ4 N;  5GIO A;  1VSK A;  1RGI A;  3HZ6 A;  4BE2 A;  4W5T A;  3V9Z A;  1BA0 A;  2DY4 A;  3A2F A;  3LDS A;  4DQS A;  4Z4I A;  1T03 A;  1NGF A;  2NRH A;  3ZSO A;  2CGK A;  2A3Z A;  4CJS A;  4JYA K;  3MAQ A;  4KTQ A;  4FYD A;  4O4G A;  4H8K A;  4CZE A;  2HBM A;  4CJU A;  1NGD A;  3THV A;  1D4X A;  1J54 A;  1YHQ N;  4DR5 K;  4E89 A;  4XEI A;  1W97 L;  1NK0 A;  1BUP A;  5KQD A;  5HP1 A;  4CZJ A;  1VSM A;  3MCA B;  3G6E N;  2P5G A;  3QEX A;  3E66 A;  3VQ9 A;  2J4R A;  1EET A;  4DUY K;  2HHX A;  1S6P A;  3KVG A;  3O9U A;  1VQ9 N;  2E2P A;  3LDQ A;  4K8X A;  2VG7 A;  1QQM A;  3QLH A;  3MXI A;  1QHT A;  3THX B;  2B4J A;  3E9L A;  5FPN A;  1LCU A;  1D9F A;  4JK9 A;  3IFR A;  3ULE A;  4CGG A;  3CM6 A;  4BDZ A;  3DLL L;  4HTL A;  3HP6 A;  1DKG D;  2RN2 A;  3V9W A;  1XUP O;  3TAG A;  3AA3 A;  5JLF A;  3HL8 A;  4GMJ B;  3SQ4 A;  2NZT A;  2YHW A;  4DMN A;  1IBM K;  2ASP A;  1JLQ A;  3UKU A;  1UAX A;  1RDC A;  3WNG A;  3IKM A;  4E7L A;  4Y1C A;  2CGL A;  4KPY A;  1T7P A;  2WOM A;  4M7Y A;  2XRI A;  3VEO A;  4E7H A;  3P38 A;  4EP5 A;  5HRP A;  3QEP A;  4A2B A;  1BI4 B;  4EZ6 A;  3OYK A;  3A5L C;  4NLC A;  1K9M O;  4JHD A;  1GLE G;  4CF8 A;  4JI3 K;  4U67 L;  1L3T A;  2FBY A;  3SMP A;  1S1X A;  2OZM A;  5DMR A;  2OPS A;  3ZEU B;  4J2D A;  1JL2 A;  4K25 A;  4AQY K;  3ZT4 A;  1C1B A;  5I42 A;  2WFB A;  2A40 A;  4CGJ A;  2PFU A;  2Q3S A;  4N76 A;  3LWL A;  4A2A A;  4Q5V A;  3IAY A;  2HF4 A;  1KQS M;  3A5O C;  4KHY A;  5FDL A;  3I55 N;  4CF9 A;  3AVA A;  3SYZ A;  4AHR A;  3AAR A;  4MLE A;  4ZHR A;  1KFS A;  3E9O A;  4XH1 A;  3QES A;  1QQN A;  3SPZ A;  1RDU A;  4CHZ A;  4WFN L;  2A41 A;  4DS5 A;  1ILY A;  3ZSV A;  3QER A;  1S22 A;  4K42 A;  1VAZ A;  1X1P A;  3NBP A;  4LF4 K;  4DV5 K;  4CIF A;  1CXQ A;  4ELV A;  1SS6 A;  1I3A A;  4E7J A;  1TYQ A;  4O5F A;  1HQU A;  2AA4 A;  2OPR A;  4B1V A;  1NNE A;  4CEO A;  3OYI A;  3EN9 A;  5F2R A;  3C95 A;  4YNQ A;  1IG8 A;  3VGK A;  3V1Q A;  3KD5 E;  4DFM A;  3VEW A;  1RTJ A;  3KIO A;  3UKR A;  2HMI A;  3ISN C;  3W0L A;  4CEZ A;  4J2B A;  3TTC A;  5AQL A;  4ILG B;  3CMA N;  4B8C A;  4O8U A;  2VGN A;  4NO7 A;  4DFJ A;  4B9M A;  4CHY A;  5AJ3 K;  4BWJ A;  1F21 A;  1GOA A;  2F7T A;  5AZI B;  5BPM A;  1XNR K;  4MFB A;  3BZC A;  1WOQ A;  3A5M C;  3QIO A;  1VSJ A;  4GNI A;  4JKH A;  3PV8 A;  4V19 S;  5BPN A;  4CEB A;  1TAQ A;  4DU4 A;  1Z6R A;  4JK7 A;  3VTH A;  1QE1 A;  5CY4 A;  5EVZ A;  3HRG A;  1NGI A;  4JEP A;  3SNN A;  4LSN A;  3VQ7 A;  1QTM A;  2NRT A;  1Q82 O;  4Z94 A;  1EO1 A;  4W5Q A;  1WSH A;  3CFP A;  4CK2 A;  1TAU A;  2RE2 A;  5AQJ A;  3THW A;  1QZ5 A;  3H46 O;  3OYL A;  4JKG A;  3HI0 A;  4F3T A;  4PL8 A;  3VQ6 A;  1LWC A;  5ADX H;  4C23 A;  2CGJ A;  3CYM A;  2WC9 A;  3RMC A;  5BPL A;  5BRH A;  3GL1 A;  3VEZ A;  2JGU A;  4ISF A;  4A5A A;  1KVA A;  2GEL A;  3B8A X;  3GDQ A;  3ATU A;  4JI1 K;  4E1M A;  4I2Q A;  1T6D A;  4WCE L;  1MWK A;  1NJY A;  5JIC A;  4BQL A;  1D9D A;  1GLF O;  4BR5 A;  4DWI A;  5JVG L;  4DV0 K;  4LH5 A;  2KZZ A;  4DFP A;  5CZ1 A;  1TK5 A;  3QIP A;  3KK3 A;  1VSL A;  3WEE B;  2VYP A;  5AQG A;  4DSI A;  1VQP N;  3MWT A;  1W0H A;  3LP3 A;  2BH1 A;  3ZSY A;  1RT4 A;  3HBT A;  4FK2 A;  2P9N B;  4KV8 A;  2O8D A;  4CZG A;  4DTM A;  4CES A;  1HNW K;  1HUX A;  3FZM A;  3R9P A;  3I8B A;  3NHG A;  2D0A A;  4NCB A;  1TKT A;  2QWP A;  2D5R A;  1NK7 A;  2HBK A;  2IS3 A;  1IO2 A;  3MED A;  4H0P A;  4CZH A;  4QOZ B;  3HXM A;  3JYT A;  2VGM A;  3K5O A;  4B3R K;  3V9X A;  1VQ7 N;  3ZSR A;  3EZ5 A;  4H4O A;  4XH4 A;  4DUZ K;  3NGI A;  4CK3 A;  1W7A A;  3SQ1 A;  5JVH L;  1K8K B;  3VGM A;  5CHI A;  3VQE A;  1LOT B;  1YAG A;  1WNS A;  2IOC A;  1JLG A;  3U9D A;  1SZ2 A;  2D1K A;  3NE6 A;  1HRH A;  5C2F A;  4BRG A;  4JD2 A;  2HHT A;  1XC9 A;  1B9F A;  3LWM A;  3OYG A;  1N5Y A;  2VWK A;  3ENH A;  3H3N O;  4BRK A;  1C0G A;  4G9Z A;  2RPI A;  3V81 A;  1I94 K;  4E3S A;  3D2E B;  4MDA A;  1OVY A;  2ZWH A;  1TK8 A;  4CJW A;  3OJU A;  4IEE A;  3ZT0 A;  5J2P A;  4LFB K;  1L5U A;  2O4I A;  4OPA A;  4RW8 A;  2PY5 A;  3AO3 A;  5AFU A;  1RFQ A;  1IKY A;  1WSJ A;  1QZ6 A;  3PLA A;  3TWH A;  3A8Y A;  1WSE A;  4LFC K;  1W9H A;  3E9P A;  1VSD A;  2AJQ A;  3T1A A;  3DLK A;  1VRT A;  3FZL A;  3KHY A;  4O5B A;  2JWL A;  3OS1 A;  4I9Q A;  4A5B A;  5HLF A;  3L4Q A;  3LL3 A;  3ZET B;  3CPE A;  4FW1 A;  1SV5 A;  1VSF A;  2Y1J A;  2YHB A;  4ILH A;  4CJL A;  3DRP A;  4DR3 K;  1JLA A;  5DM7 L;  4DQP A;  3MN9 A;  4BR4 A;  3RVC A;  5LMU K;  2OCE A;  2ZGZ A;  4FM0 A;  1ZBU A;  1X9S A;  1Y64 A;  4EHU A;  3VGL A;  3EE8 A;  5JS2 A;  5M1O A;  4BAC A;  4I7F A;  4CJV A;  1XNQ K;  1QVG M;  4H0O A;  2EHG A;  2I5J A;  4C8K A;  4GKJ K;  5FRO A;  3CCR N;  4B3T K;  4FJ9 A;  3M5R A;  4F4K A;  5LMN K;  3GE1 A;  4CZI A;  3CCV N;  4BRP A;  1U47 A;  2ITM A;  4K43 A;  2P9L B;  3LPT A;  3M8Q A;  2ZM6 K;  3N4P A;  3SUP A;  4LH4 A;  3M8S A;  2P9U B;  5AQM A;  3K9J A;  4TSX A;  3PO5 A;  1SL1 A;  4IDK A;  4CJ7 A;  4M42 A;  3KK2 A;  2ZD1 A;  1C1C A;  4JKF A;  3L2Q A;  3PX6 A;  2W6L A;  3G0Z A;  1NJI O;  1RDB A;  1RDA A;  1RT7 A;  4JV5 K;  3SK3 A;  1GOC A;  1BA1 A;  4AHC A;  1QSS A;  4AHU A;  2KFZ A;  4O55 A;  2UUA K;  2V7Z A;  2BUP A;  4QAG A;  1JCE A;  5M1N A;  1L3V A;  4FOI A;  5CE3 A;  5M1P A;  4WQ5 C;  4N56 A;  1KAY A;  3R6M A;  2FF3 B;  1JLF A;  1L3S A;  5AZJ B;  3B6O A;  2PAV A;  4W5O A;  4GV9 A;  4IO9 L;  2D0P A;  3CJ7 A;  4XIU A;  3THX A;  4BWM A;  3H08 A;  4CER A;  3L0Q A;  3JS6 A;  4PKG A;  4RG8 A;  1U2V B;  4IO8 A;  1HPM A;  4BR9 A;  5J1E A;  3L6Q A;  3NGZ A;  3CC2 N;  1LWE A;  4U7B A;  3HVT A;  4A57 A;  1BIS A;  4OLA A;  4FPB A;  4KFB A;  3O9Q A;  3G4S N;  2Q36 A;  4FJM A;  2FSN A;  1H1V A;  2B5J A;  4CJ4 A;  3IDH A;  3I0R A;  2P1J A;  2KLA A;  3WT0 A;  4A59 A;  3T1Y K;  3DLG A;  4PY5 A;  4CFB A;  1KVB A;  1BQN A;  3S3O A;  1RBU A;  4IDH A;  4EZ9 A;  2IIR A;  4OVL A;  3ZT3 A;  4PKI A;  3O8M A;  3ZEU A;  2W41 A;  2W6K A;  2BE2 A;  4IG0 A;  4KHP K;  5AQO A;  3KTQ A;  2QW9 A;  4I6M B;  1RBR A;  3KJV A;  2GWJ A;  3LP2 A;  2G8U A;  4FZX C;  4LC9 B;  3IMX A;  3M8P A;  3OYA A;  3ATV A;  5FPD A;  4DF4 A;  3CJB A;  5EXW A;  3ID6 A;  3CCS N;  4BRA A;  4BRO A;  3ZT2 A;  2FBX A;  4FWN A;  2Y1I A;  3S3N A;  3QML A;  3TAB A;  2IVO A;  4CEA A;  4BG9 A;  4MQ3 A;  4AHT A;  4J8F A;  3BY5 A;  4DF8 A;  2Z1I A;  1Q86 O;  4KHN A;  1T6C A;  1TK0 A;  1BIZ A;  5I9E B;  2W42 A;  4DKW A;  3VQA A;  3DLB A;  4H0Y B;  4FLZ A;  3CIP A;  3SBG A;  2FBV A;  2NRW A;  3AO1 A;  1Z25 A;  3O9S A;  4B3S K;  4FJK A;  1WAJ A;  4IG3 A;  5KQ8 A;  4FWR A;  2YHA A;  3ULD A;  4CZK A;  5C0Y A;  5TKW A;  2GUI A;  4NXM K;  5LJW A;  1NG9 A;  1HKG A;  2G8F A;  1RT1 A;  2QWN A;  3NFA A;  4JN4 A;  3KLH A;  1QSY A;  3CFO A;  3OYH A;  4CHQ A;  1BGX T;  5C15 A;  4BRD A;  4KHU A;  4EAH D;  5CYQ A;  3SUQ A;  1ATS A;  5AZI A;  4HHT A;  4CEE A;  3HT3 A;  4F2S A;  4PWD A;  3A0I X;  3HSC A;  5SZT A;  1KTQ A;  4WE1 A;  3LDO A;  3M1F A;  3WXK A;  3ZX0 A;  4FZZ A;  2Q0R A;  1U45 A;  3HPG A;  1YVU A;  5AQW A;  5AQN A;  2CH5 A;  2YI1 A;  2HVI A;  1CLQ A;  4DTJ A;  2V52 B;  1VSE A;  3NVM A;  3S41 A;  4DR2 K;  1EWQ A;  1GLD G;  2CH6 A;  3VES A;  3RMA A;  1JLB A;  1R59 O;  3MXM A;  1HX1 A;  3VEN A;  4B9L A;  3VF4 A;  1WAF A;  4KKO A;  4DR1 K;  1NKC A;  4CHN A;  3M6G A;  4J2A A;  4HUE A;  1ASU A;  3MEC A;  1SUQ A;  4FLX A;  1YJ9 N;  3OBW A;  1RT2 A;  4OPK A;  2BTF A;  2X74 A;  1WLJ A;  1YIJ N;  1NK4 A;  3CG7 A;  1ZBL A;  2O8C B;  1YIT N;  1BHL A;  1J53 A;  4B1Y B;  1JKH A;  1KCF A;  1KFD A;  3CCQ N;  1XI1 A;  1EKE A;  4JRP A;  1REV A;  5C2D A;  4WQ4 A;  2HHH K;  5EU7 A;  3TAP A;  4KH5 A;  4E7K A;  4YOT A;  1O13 A;  3WEE A;  1HKB A;  2A5X A;  2JWK A;  4CD3 A;  1TKX A;  4ID5 A;  3AA5 X;  2E8A A;  1SKR A;  2P9N A;  3EEQ A;  4BVO A;  4K0K K;  4CIE A;  2XY6 A;  4Z4C A;  3VPZ A;  2YX6 A;  4NLB A;  2G8K A;  5FLX O;  1DTQ A;  3LP0 A;  4CJF A;  3PX0 A;  3TAN A;  2HHU A;  2DTU A;  1HKC A;  4ISG A;  3QEV A;  3EZW A;  1LWF A;  1RCH A;  1Y97 A;  4AM7 A;  1NJX A;  1RBT A;  1NK8 A;  3LAL A;  3KLI A;  3QIN A;  2W40 A;  3H45 C;  4W5R A;  1T44 A;  3G71 N;  4DQ8 A;  4YOW A;  2ETJ A;  1VK0 A;  3O80 A;  3NF6 A; 
#chains in the Genus database with same CATH homology
 4KV8 A;  3VQB A;  4FJ7 A;  4DG1 A;  1RTD A;  4DTM A;  4CES A;  4KRF A;  1VSI A;  3KKS A;  3DLE A;  5SWM A;  3ZSZ A;  1X9W A;  2HW3 A;  1UOC A;  1NK6 A;  3LAM A;  4FM1 A;  4B08 A;  4BDP A;  5C25 A;  4FLU A;  1QS4 A;  3NHG A;  1NKB A;  1LAV A;  2D0A A;  1FKP A;  4NCB A;  4DSJ A;  1TKT A;  2D5R A;  1NK7 A;  4CJP A;  1N6Q A;  2IS3 A;  1IO2 A;  3MED A;  4HUF A;  3OY9 A;  3NCI A;  3QEW A;  4RW9 A;  3HXM A;  3JYT A;  3KLF A;  3QNN A;  1TGO A;  1SL0 A;  1SL2 A;  1TL3 A;  1J5O A;  4CCH A;  3AVM A;  3K5O A;  3V9X A;  1LW2 A;  2XY7 A;  3K58 A;  3ZSR A;  3EZ5 A;  1C6V A;  4H4O A;  1FXX A;  3TI0 A;  2HNY A;  1RBV A;  2HNZ A;  3WNE A;  3K57 A;  4B3O A;  3NGI A;  2DFE A;  4CK3 A;  1Q8I A;  3SQ1 A;  3RR8 A;  4DTS A;  3RRG A;  3V1O A;  1B92 A;  4N5S A;  3ZSQ A;  1KRP A;  1RIL A;  3VQE A;  1HMV A;  1QQC A;  3K5L A;  4ELU A;  1WNS A;  4OJR A;  3F9K A;  2IOC A;  1JLG A;  1BQM A;  4F3O A;  3NE6 A;  3L2V A;  4B9U A;  2QKB A;  1HRH A;  2FBT A;  5J2N A;  3OYE A;  1KVC A;  4CJT A;  1VSH A;  3DOK A;  3AA2 A;  4DSF A;  2GV9 A;  4M45 A;  2G8V A;  2HHT A;  1XC9 A;  1B9F A;  3LWM A;  2P51 A;  3OYG A;  3LP1 A;  4JRQ A;  1N5Y A;  4CHP A;  3OYN A;  2VWK A;  1T05 A;  2VG5 A;  5KRT A;  4QCL A;  4B9N A;  4GW6 A;  4YFU A;  3BDP A;  3RWU A;  1S1U A;  3ALY A;  2F8S A;  1HJR A;  2RPI A;  3V81 A;  4DQQ A;  4KTZ A;  4CJ5 A;  4E3S A;  1CXU A;  1HNI A;  1NK9 A;  3PO4 A;  2HHV A;  1TK8 A;  1C0U A;  3P83 D;  4O44 A;  5HBM A;  4CJW A;  4UQG A;  3O3H A;  4OLB A;  3SI6 A;  2HHW A;  3OJU A;  3VA3 A;  1C0T A;  3ZT0 A;  3F73 A;  3NF7 A;  3OYD A;  5J2P A;  4B9V A;  3KLE A;  1BCO A;  1EP4 A;  1EX4 A;  4ID1 A;  1L5U A;  2O4I A;  2IAJ A;  4FLY A;  4DLE A;  3HST B;  4RW8 A;  2PY5 A;  3AO3 A;  1IKY A;  3U3Y A;  1WSJ A;  1HYZ A;  4O0I A;  4DQI A;  1RTI A;  5JS1 A;  4N41 A;  1JXB A;  3C6T A;  1B9D A;  3AVB A;  3LPU A;  5KI6 A;  3TWH A;  4CJE A;  1TL1 A;  2KZZ A;  3AO4 A;  3L3U A;  3WNH A;  1WSE A;  1LAW A;  4KTW A;  1W9H A;  1VSD A;  2PYL A;  1HYV A;  4M3W A;  2F96 A;  1BIU A;  2IC3 A;  2AJQ A;  3T1A A;  3DLK A;  4KO0 A;  1JL1 A;  1VRT A;  3DYA A;  4CJ3 A;  3SV3 A;  4AH9 A;  5HRO A;  3VN5 A;  5D3G A;  4O5B A;  3OS1 A;  3ITH A;  4I9Q A;  1S6Q A;  5HLF A;  2O4G A;  4CIG A;  4M3Z A;  4FJ5 A;  3ASM A;  1ZBI A;  4FW1 A;  3IS9 A;  1SV5 A;  2KFN A;  2X6S A;  1S9E A;  1KLM A;  1VSF A;  3AVF A;  4RW4 A;  3OJS A;  3IG1 A;  3OYM A;  4HTU A;  3CQ8 A;  3ZSX A;  2Y1J A;  2YHB A;  4CJL A;  3DRP A;  4DTR A;  3L2W A;  3P5J A;  1RTH A;  4DTN A;  1L3U A;  1JLA A;  2A1S A;  1S1W A;  4DQP A;  4C8O A;  4AIL C;  3U3G A;  2HB5 A;  2OZS A;  3RMD A;  4CGH A;  2RF2 A;  4FM0 A;  1ZBU A;  1YT3 A;  4IFY A;  3EYZ A;  1X9S A;  3FFI A;  1S1T A;  1G15 A;  4CF0 A;  1NK5 A;  5JS2 A;  3HPO A;  4KHW A;  3NF9 A;  4BAC A;  4I7F A;  5CZ2 A;  3VQQ A;  4CJV A;  4CFD A;  2VWJ A;  4PUO A;  4ZTF A;  3AVJ A;  3NDK A;  3VA0 A;  2EHG A;  2I5J A;  4CFA A;  3HYF A;  1BCM A;  4CED A;  1CZ9 A;  1DLO A;  4C8K A;  4E0D A;  5FRO A;  2OPP A;  4FJ9 A;  2HHS A;  3TR8 A;  4B8A B;  3BGR A;  3MXJ A;  4F4K A;  3G10 A;  3RRH A;  4CF1 A;  3SZ2 A;  4CEQ A;  1U47 A;  1U49 A;  1T8E A;  3VQC A;  4FK0 A;  2XO7 A;  5K14 A;  2YKM A;  2Z1H A;  4DTO A;  4M3U A;  3UIQ A;  3LPT A;  1I39 A;  3M8Q A;  3SUP A;  3AVN A;  4HCC A;  4LH4 A;  4L8R B;  3AVL A;  3L3V A;  4IBN A;  4OPJ A;  2XY8 A;  2FC0 A;  3M8R A;  1C1A A;  3M8S A;  3SCX A;  4FJ8 A;  4TSX A;  3PO5 A;  2KTQ A;  1SL1 A;  4IDK A;  1NJW A;  4M42 A;  3KK2 A;  4Z4G A;  2ZD1 A;  3AA4 A;  3U6F A;  1C1C A;  1CZB A;  3L2Q A;  3V4I A;  3PX6 A;  3G0Z A;  3MEE A;  1RDB A;  1RDA A;  1RT7 A;  4IFV A;  2E4L A;  4G1Q A;  5E41 A;  4DTU A;  1GOC A;  4NYN A;  5FRM A;  3DM2 A;  3QNO A;  3HO1 A;  2A1R A;  4DSK A;  2BGG A;  1TVR A;  3NF8 A;  4AHC A;  3ZT1 A;  4ICL A;  1QSS A;  1S5J A;  3V1R A;  4JLH A;  3VQ8 A;  4AHU A;  2YNI A;  4O55 A;  3DOL A;  1ITG A;  4EP4 A;  2KFZ A;  3SQ0 A;  3QO9 A;  4QAG A;  1L3V A;  2EX3 A;  1VSK A;  4BE2 A;  4W5T A;  4N56 A;  3V9Z A;  2DY4 A;  3V9U A;  1JLC A;  3A2F A;  3LDS A;  3DLR A;  3NH1 A;  3SV4 A;  4NYF A;  1JLF A;  4DQS A;  1L3S A;  4Z4I A;  2NUB A;  3B6O A;  4OKK A;  3AV9 A;  1Q9X A;  4W5O A;  1T03 A;  3IRX A;  4H4M A;  3S3M A;  3ZSO A;  4KI4 A;  4E19 A;  3AVG A;  3C94 A;  3LZI A;  1GOB A;  3HVR A;  1FK9 A;  4CJS A;  1NOY A;  4XIU A;  2X6N A;  3V9S A;  4BWM A;  4CGF A;  2BDP A;  3H08 A;  3MAQ A;  4CER A;  2B6A A;  3K5N A;  4KTQ A;  4FYD A;  4O4G A;  1TKZ A;  4H8K A;  2E6L A;  4CJU A;  3THV A;  3O4N A;  1J54 A;  4RG8 A;  3OS2 A;  4NCA A;  4FJH A;  4E89 A;  4DQR A;  4Z4E A;  5J1E A;  3NGZ A;  4LY7 A;  3SPY A;  1LWE A;  4ZTJ A;  1NK0 A;  3HVT A;  1FKO A;  4DFK A;  5HP1 A;  2YV0 X;  4FZY A;  3OYF A;  3LZJ A;  1VSM A;  1BIS A;  4OGE A;  2D0C A;  4OLA A;  1RNH A;  4GVM A;  4O0J A;  3S9H A;  4M3T A;  5HRN A;  4KFB A;  2LSN A;  3JSM A;  2P5G A;  3QEX A;  3VQ9 A;  1RDD A;  4FJM A;  1EET A;  2HHX A;  1S6P A;  2B5J A;  3VQ5 A;  4CJ4 A;  3L8B A;  3ZCM A;  2VG7 A;  2P1J A;  3I0R A;  4K8X A;  4M3X A;  3PX4 A;  3TAM A;  3DLG A;  4PY5 A;  4CFB A;  1LV5 A;  3QLH A;  3MXI A;  1QHT A;  1KVB A;  3NGY A;  1HPZ A;  3TAE A;  1BQN A;  2B4J A;  3S3O A;  1RBU A;  3P1G A;  1IKX A;  4F8R A;  4CGI A;  4KAZ A;  1D9F A;  4EZ9 A;  1MU2 A;  4OVL A;  3V6D A;  2QKK A;  3ZT3 A;  4CGG A;  3CM6 A;  4I2P A;  3SJJ A;  4BDZ A;  4K8Z A;  4HVJ A;  4QOZ B;  3HPH A;  1D5A A;  3HP6 A;  2RN2 A;  4CE9 A;  3V9W A;  3TAG A;  3SQ2 A;  2KW4 A;  2KQ2 A;  3AA3 A;  3HL8 A;  4Y1D A;  3PY8 A;  4GMJ B;  3OYB A;  4JS4 A;  3SQ4 A;  4DMN A;  1R0A A;  4ELT A;  4F2R A;  2BE2 A;  4IG0 A;  1TKD A;  4KHS A;  1JLQ A;  4DU1 A;  4FJX A;  3KTQ A;  1UAX A;  1RDC A;  1RBR A;  3WNG A;  3KJV A;  3QEI A;  4E7L A;  1WN7 A;  4Y1C A;  3LP2 A;  2ZQB A;  4KPY A;  1T7P A;  2G8U A;  2QK9 A;  1UA1 A;  2WOM A;  4FZX C;  4OKE A;  3C6U A;  1TV6 A;  3HP9 A;  2XRI A;  3NH2 A;  4E7H A;  3M8P A;  3TAQ A;  5HRP A;  4EP5 A;  3QEP A;  2G8H A;  4CJR A;  3OYA A;  1BI4 B;  2Z1J A;  4C8N A;  4DF4 A;  3OYK A;  2OA8 A;  2PZS A;  4EZ6 A;  1RT6 A;  4FJL A;  3B6P A;  4CF8 A;  3ZT2 A;  1L3T A;  1HNV A;  2FBX A;  2Y1I A;  3S3N A;  3OYJ A;  2FBY A;  3ZSW A;  1S1X A;  3E01 A;  3TAB A;  4BDY A;  5I3U A;  2OZM A;  3OVN A;  5DMR A;  4CEA A;  2OPS A;  4KHQ A;  4MQ3 A;  2QXF A;  4AHT A;  3T19 A;  5HRS A;  4DF8 A;  4J2D A;  4W5N A;  2Z1I A;  2X78 A;  1JL2 A;  1WSI A;  4KHN A;  4FK4 A;  1XWL A;  3ZT4 A;  3VQ4 A;  1C1B A;  5I42 A;  2JLE A;  4CEF A;  1BL3 A;  4CGJ A;  1BIZ A;  2Q3S A;  1A5V A;  2W42 A;  1TK0 A;  1IKW A;  3TAF A;  3VQA A;  3KKR A;  4N76 A;  3DLB A;  3LWL A;  3HK2 A;  4FLT A;  2G8W A;  1DTT A;  4Q5V A;  5C24 A;  2E6M A;  4FJG A;  3IAY A;  4FLZ A;  4KHY A;  5FDL A;  1Q9Y A;  3L2U A;  4CF9 A;  3AVA A;  3SYZ A;  1RBS A;  4DSE A;  4AHR A;  2FBV A;  3OS0 A;  1VRU A;  4KRE A;  4LD0 A;  1XHZ A;  5HRR A;  1ASW A;  3AO1 A;  4FXD A;  1Z25 A;  1K6Y A;  4I9L A;  4RW6 A;  2IGI A;  4FJK A;  3K2P A;  1WAJ A;  2IDO A;  4KB1 A;  4ZHR A;  2G8I A;  1KFS A;  4IG3 A;  3O3F A;  2YNG A;  1IG9 A;  4M3Y A;  2YHA A;  3ULD A;  4M3R A;  3RMB A;  4FLV A;  1ASV A;  1YTA A;  3K5M A;  3QES A;  3SPZ A;  4CHZ A;  2GUI A;  4Z0U A;  1RT3 A;  2Z1G A;  4DS5 A;  5J2M A;  4Q0B A;  3ZSV A;  2G8F A;  2R7Y A;  1RT1 A;  3NFA A;  3QER A;  4E1N A;  1X1P A;  4M41 A;  3DI6 A;  3NBP A;  3AVH A;  3KK1 A;  1ZBF A;  4CIF A;  1CXQ A;  2DFH A;  3KLH A;  2XHB A;  4ELV A;  1I3A A;  1QSY A;  1SKW A;  3CFO A;  3OYH A;  4DLG A;  4E7J A;  2HND A;  3EY1 A;  4AHS A;  2P5O A;  3CM5 A;  4N47 A;  1HQE A;  4CHQ A;  1BGX T;  1HQU A;  2OPR A;  3AVI A;  4KHU A;  5CYQ A;  4NCG A;  4CEO A;  4CK1 A;  3SUQ A;  3OYI A;  4FJI A;  1HYS A;  4HHT A;  1S1V A;  1WSF A;  4CEE A;  3HT3 A;  3SUN A;  4F2S A;  3C95 A;  4YNQ A;  4PWD A;  5SZT A;  4FVM A;  5C42 A;  4DTP A;  1KTQ A;  3V1Q A;  3KD5 E;  1QSL A;  4WE1 A;  3I8D A;  4DFM A;  1RTJ A;  3KIO A;  1UWB A;  2HHQ A;  3HM9 A;  4B9T A;  2HMI A;  4FJN A;  2XY5 A;  1IH7 A;  1LW0 A;  4FZZ A;  4CEC A;  3ISN C;  3VQD A;  5KGX A;  4CEZ A;  4J2B A;  4FW2 A;  4HUG A;  1U45 A;  3HPG A;  4KI6 A;  1YVU A;  3AO2 A;  3I0S A;  4B8C A;  5KTQ A;  1KLN A;  2HVI A;  1CLQ A;  1KSP A;  4DTJ A;  3SUO A;  3VQP A;  1VSE A;  4PQU A;  4R5P A;  1SKS A;  4J2E A;  3QET A;  4DFJ A;  1A5X A;  4B9M A;  1A5W A;  3RMA A;  4FM2 A;  4CHY A;  1JLB A;  3MXM A;  4BWJ A;  4C8L A;  3D45 A;  1F21 A;  2RKI A;  5CYM A;  1GOA A;  2WON A;  4B9L A;  1WAF A;  4KKO A;  4BE1 A;  1RT5 A;  1NKC A;  4CHN A;  4Z4H A;  4J2A A;  4MFB A;  5DK5 A;  4HUE A;  2PYJ A;  1ASU A;  3MEC A;  4Z4F A;  2OPQ A;  3QIO A;  2HVH A;  1NOZ A;  5J2Q A;  1VSJ A;  4PA1 A;  3AVC A;  4LSL A;  1SUQ A;  4FLX A;  3DMJ A;  3PV8 A;  3DRS A;  1RT2 A;  1TK5 A;  1XHX A;  1O1W A;  4CEB A;  1TAQ A;  4OPK A;  3DRR A;  4DU4 A;  1BI4 A;  3T3F A;  1QE1 A;  2X74 A;  5CY4 A;  3RR7 A;  1JXE A;  3L2R A;  3SNN A;  4LSN A;  3DLH A;  1EXQ A;  1WSG A;  3LAN A;  1WLJ A;  4C8M A;  3VQ7 A;  1QTM A;  1ZBH A;  1NK4 A;  3CG7 A;  5FRN A;  3KLG A;  5KGW A;  1ZBL A;  2YNF A;  4B9S A;  4W5Q A;  4FLW A;  1WSH A;  3RTV A;  1BHL A;  1J53 A;  3CFP A;  1D8Y A;  4KB0 A;  4CK2 A;  3O3G A;  1TAU A;  2GBZ A;  3MEG A;  1JKH A;  1KCF A;  1KFD A;  1UA0 A;  3NAE A;  3LAK A;  2D0B A;  1XI1 A;  1EKE A;  4JRP A;  1REV A;  2DFF A;  2BAN A;  1U04 A;  1J9A A;  4CF2 A;  1ZYQ A;  3OYC A;  3OYL A;  5EU7 A;  3TAP A;  4F3T A;  4E7K A;  3VQ6 A;  1LWC A;  1S9G A;  4CJK A;  1JLE A;  3CYM A;  3RMC A;  1IKV A;  3HJF A;  4DU3 A;  4BE0 A;  2JGU A;  4AHV A;  2OYQ A;  4CHO A;  1KVA A;  3TAR A;  3KD1 E;  2YNH A;  3AVK A;  3AO5 A;  1TKX A;  4E1M A;  4I2Q A;  4ID5 A;  4RW7 A;  2ITG A;  2VG6 A;  4E7I A;  3AA5 X;  1SKR A;  4DSL A;  3O4Q A;  1NJY A;  1D9D A;  1NKE A;  5T7B A;  2YKN A;  4CIE A;  2XY6 A;  1NJZ A;  4DWI A;  4DS4 A;  2F8T A;  1Z26 A;  4Z4C A;  3PUF A;  4HCB A;  2HHU A;  4LH5 A;  2G8K A;  1DTQ A;  3LP0 A;  5CZ1 A;  4CJF A;  4DFP A;  3CFR A;  3PX0 A;  3QIP A;  3KK3 A;  3TAN A;  4CFC A;  1X9M A;  1VSL A;  2DTU A;  4IKF A;  4CGD A;  3QEV A;  1LWF A;  1RCH A;  2ATQ A;  1C0M A;  4DSI A;  1Y97 A;  4DTX A;  5KRS A;  2KZM A;  1NJX A;  1RBT A;  1NK8 A;  3LAL A;  3KLI A;  4JS5 A;  4FJJ A;  1W0H A;  3QIN A;  3K59 A;  3LP3 A;  3NH0 A;  1U48 A;  2ZE2 A;  3D0P A;  4FCY A;  4OGC A;  4OKJ A;  3ZSY A;  4CJQ A;  4W5R A;  1RT4 A;  1YTU A;  2ETJ A;  1VK0 A;  3WNF A;  3NF6 A;  1U4B A;  4FK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...