3V9ZA

Crystal structure of rnase t in complex with a product ssdna (acc) with one mg in the active site
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
209
Chain Sequence
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
total genus 63
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9zA00
3WNFA 4H4OA 1DTTA 1VSKA 4AHVA 4CERA 2G8KA 4O0IA 3SUNA 2AJQA 2WOMA 4HCBA 2KZZA 2RN2A 4DLEA 4EZ6A 5J2PA 4FJNA 1NK5A 2YNGA 2B4JA 4W5QA 4ZHRA 3M8RA 1TAUA 1S9GA 4KHQA 4CK1A 2FBYA 2OA8A 3K57A 3SUOA 4L8RB 2ZE2A 4N56A 2O4IA 3D45A 4H4MA 3LPUA 2G8HA 3VQPA 4FJIA 4AH9A 4CEQA 4I2PA 1C1AA 1JLEA 2PYLA 4M3WA 4EP5A 4CIEA 3MXJA 4R5PA 1NKCA 3LAKA 2X6NA 4J2AA 3V81A 3AA2A 4Z4EA 1S1WA 1DTQA 2Z1JA 2VWKA 3HP9A 4IKFA 2EHGA 3LALA 4E7LA 3E01A 3NGZA 1U47A 3ASMA 3NGYA 5J1EA 2P1JA 3HPGA 4CJQA 2RKIA 2XRIA 3VQ9A 5KTQA 3AO1A 3KTQA 3RR8A 2IGIA 1U48A 1BCOA 4FJJA 2HHXA 3VA3A 1Z26A 1IG9A 2VG7A 4W5TA 4RW6A 4KB0A 4CEFA 1VRUA 1RDCA 1VSFA 4CK2A 4IG3A 4OJRA 1WN7A 3QESA 2HHVA 3AO5A 4DG1A 5I42A 4DU3A 3NDKA 1JXEA 4CGGA 4ELVA 4HUEA 4CESA 2G8FA 5C24A 4CEBA 4TSXA 1TK0A 3AVMA 1XC9A 1X9WA 1C0MA 1KLMA 1LW0A 1BI4B 1C6VA 1S1XA 3AVIA 3LP1A 1L3SA 1SV5A 4C8MA 2FC0A 1X9SA 1HYVA 3I0SA 4I7FA 3PX4A 1U49A 3HJFA 5KRTA 2KFZA 4E1MA 3RMDA 3DLBA 4DTMA 1LWFA 4FJMA 2VG5A 3NF9A 4DQRA 1RBSA 3DRPA 3QEWA 1J5OA 1FKOA 1ZBFA 5CZ2A 4B9LA 1Q9YA 2G8IA 2Z1IA 4HUFA 4FZXC 4B9TA 4W5OA 2YNFA 3HP6A 4QOZB 1G15A 1GOBA 2HNYA 4B8AB 4CFBA 1IKWA 2P51A 3HPHA 4AHTA 4M3RA 3O3FA 4M3XA 1A5VA 4FW2A 3KK2A 1S1UA 1WAFA 1RCHA 3LDSA 3HO1A 1EETA 3TR8A 1WSEA 4LH5A 4I9LA 4NYFA 4CJ5A 4AILC 4F8RA 3C95A 1TKZA 3AO3A 3NF7A 3NFAA 1XHXA 4KKOA 1RBUA 4PA1A 3QINA 2GBZA 2YHBA 5KGXA 2HHUA 4NCAA 4B8CA 4CJVA 3ZSZA 4M3TA 3ISNC 4CEZA 1LV5A 1FK9A 1BGXT 2BDPA 2FBXA 4CHZA 2FBVA 4DQPA 2HB5A 4CGIA 1T8EA 3K5NA 1CZBA 3OYLA 5CYQA 3DM2A 3AO4A 3DRSA 3AVBA 4CJKA 1D9FA 4WE1A 4CJ4A 4CCHA 4M42A 4CGJA 1BHLA 3HL8A 2W42A 5HRPA 4DTPA 4KPYA 4FLTA 4DFMA 4IBNA 2OZMA 3KKSA 5T7BA 4CJ3A 1WLJA 3QIOA 4FJLA 3AVCA 4RW4A 2YNHA 3VQ6A 3SQ4A 1LAVA 1ZBUA 1QE1A 2G8WA 1TKTA 2YKMA 2RF2A 1RT7A 3O4NA 4OLAA 2O4GA 4GW6A 2GUIA 4RW7A 4CJRA 1TKXA 1CZ9A 4LY7A 2KQ2A 4DSKA 1BQNA 3K5LA 3VQAA 1TL1A 4OPKA 3DLRA 3MEEA 1SUQA 4CFCA 3QETA 4CFDA 5C42A 2G8VA 1JLGA 1R0AA 5FRNA 1IKVA 1JXBA 4CHNA 3P1GA 3F9KA 3LZJA 1WAJA 1ITGA 2NUBA 1S6QA 3G0ZA 4O55A 3LANA 1KRPA 4Q0BA 4H8KA 3S3OA 3ZT2A 1VSJA 4FK2A 4KI6A 4DS5A 2QXFA 4KTZA 4FJ9A 1KVBA 2Q3SA 4PWDA 4E7HA 3LP2A 3OYMA 3PX6A 1WSIA 3KKRA 2HVIA 4W5RA 3L2UA 4LSNA 3SQ1A 4C8LA 4CECA 3KJVA 2A1RA 1NJZA 3RWUA 1VSMA 4DTUA 3KLHA 4DSLA 4O44A 4MQ3A 2Z1HA 4CIGA 4KO0A 1D8YA 1QSYA 1KFSA 1FXXA 2IC3A 3DLKA 4FW1A 5K14A 4E1NA 4Z4HA 3NF6A 5JS2A 3HYFA 1HYSA 4AHSA 3KLEA 3KD1E 2HHSA 3VQBA 4KI4A 3U3GA 5HLFA 3LPTA 1B92A 1JLQA 5SZTA 3TWHA 4FM2A 4DQSA 4CJSA 1D5AA 4M41A 3SI6A 5CY4A 1BIUA 3RRHA 2QKKA 4Z4GA 3OYEA 3C6TA 4JRPA 1S1TA 4F4KA 1IO2A 1GOCA 5DK5A 2KW4A 1RT6A 3V9SA 1BCMA 3DMJA 3NBPA 3LWLA 4AHRA 1KVCA 3QERA 3O3GA 2KZMA 1EXQA 1ZBIA 3AVJA 3O4QA 4LSLA 2ZD1A 4NCGA 4AHCA 4CGFA 3HT3A 4DS4A 4DTOA 1NK0A 1A5WA 4ICLA 4ZTFA 4B3OA 3P5JA 1RBVA 3MXIA 3PV8A 1QTMA 4O5BA 1HJRA 2XO7A 1C0TA 1FKPA 3SYZA 3OYGA 3LAMA 1QSSA 3V4IA 3L2WA 3DOKA 5J2MA 3CM5A 1KFDA 1Q8IA 3WNHA 4GVMA 4DU1A 1HYZA 1RT1A 2XY7A 3VQEA 4OGCA 4CJWA 2VWJA 1WNSA 3NE6A 4FJGA 3PX0A 4Z4FA 3QEVA 4E7IA 4FZYA 1Q9XA 3V9XA 4KV8A 2E6LA 4CF8A 4FK4A 2B6AA 1UA1A 4PY5A 2HHWA 4LD0A 3OYNA 4DFPA 4OGEA 3OYJA 1RTDA 4C8NA 3VQ7A 3M8QA 1UA0A 3DRRA 3VQQA 3NH0A 4HTUA 4FJ8A 1JLCA 4BWJA 5J2NA 2D0BA 3EYZA 4IDKA 3U6FA 3DLGA 2QK9A 1BI4A 3C94A 5FROA 3OS2A 3V9WA 3OYBA 3VQCA 2XY5A 1YT3A 3SV3A 3AO2A 1NK9A 3KK1A 1CXQA 1LWEA 2Z1GA 4DQIA 4M3YA 4JLHA 3VQ5A 2X74A 3AVNA 4Z0UA 4CIFA 3ZSOA 5HBMA 1ASVA 1RT5A 1NKEA 1SKRA 4BE1A 4C8OA 3AA5X 4CF9A 1J53A 4CHQA 4KHWA 4KTWA 4FZZA 1J54A 4HCCA 4I9QA 3KIOA 2ETJA 5KI6A 3SQ0A 1JL1A 3CG7A 4YFUA 4RW8A 5FDLA 4N41A 3EZ5A 4G1QA 2E6MA 2DFFA 1RTIA 3V9ZA 1N5YA 4CJPA 4DFKA 1QS4A 2ZQBA 1WSHA 3NH2A 1HQUA 1NOZA 4FVMA 3IG1A 4OKEA 2A1SA 3CFPA 3AVFA 3ZCMA 4KFBA 3VQ8A 2D0AA 4CE9A 4J2EA 4IG0A 4CJEA 4CF0A 1YTUA 5EU7A 2LSNA 3ZSRA 1MU2A 4CF2A 1LAWA 5SWMA 3OYFA 3KD5E 3SPYA 4E3SA 4HUGA 1JLFA 1TKDA 1ASWA 2PY5A 3V1RA 1L3UA 5HP1A 2I5JA 1VSEA 4OKKA 4FLVA 4FJXA 2HHQA 4N47A 3MEDA 1RILA 2E4LA 3A2FA 4N5SA 3OYAA 4DLGA 3ZSQA 3RMBA 3K2PA 4CEOA 5HRRA 3S3MA 4KTQA 3PUFA 4E19A 1X9MA 3ZSYA 4K8ZA 2DFEA 3ITHA 1EX4A 3OY9A 4OKJA 5HRSA 1K6YA 3RTVA 3V9UA 1SKWA 1Y97A 4M3ZA 3TAEA 1TV6A 3QIPA 4CJLA 4M3UA 3K59A 4FK0A 4DSJA 1JL2A 4J2BA 4PUOA 1JLAA 1B9FA 1TVRA 3AA4A 3OYDA 4FM0A 4JRQA 1S9EA 4KRFA 4ID1A 3SJJA 4FXDA 4RW9A 2HVHA 4ID5A 1WSFA 2YHAA 3KLFA 1RDAA 5KRSA 3K5OA 1NJYA 4CGHA 4DTJA 1ZYQA 1EP4A 2OPPA 4EP4A 4QAGA 5E41A 1HRHA 2F8TA 2DY4A 3NGIA 1HNVA 3JYTA 1SL1A 2EX3A 4HVJA 4C8KA 2F8SA 3HK2A 3V1OA 4ELUA 4BDPA 4B08A 3LP3A 3THVA 2B5JA 3RR7A 2JGUA 2RPIA 3H08A 3O3HA 1VSLA 2IS3A 4IFVA 3ZT0A 3K58A 2PYJA 3IAYA 1ZBHA 3CYMA 4K8XA 4O4GA 4B9SA 2KFNA 3AVKA 1RTJA 3SUQA 3ZSXA 1RBRA 1J9AA 1VSHA 2OPQA 3C6UA 3SNNA 2OZSA 4DSFA 4DFJA 1BQMA 1LWCA 1DLOA 4Q5VA 3K5MA 3VQ4A 3V6DA 4KHUA 4W5NA 4CHPA 4KREA 4CF1A 3B6PA 3T1AA 1Z25A 4CK3A 4CJUA 3LZIA 3HSTB 3JSMA 3VA0A 4KHNA 3AV9A 1L5UA 2HHTA 4CFAA 1NK8A 3BGRA 3ZT3A 4ELTA 3RRGA 1U45A 1TGOA 3TI0A 1U04A 1YTAA 1XHZA 4DTRA 4HHTA 1T7PA 3NAEA 3I8DA 5I3UA 3TANA 1SL2A 3OS0A 2D0CA 3L3UA 1UAXA 1YVUA 1SKSA 3MECA 2HMIA 5FRMA 3DI6A 3QO9A 1NK7A 4ZTJA 5DMRA 3MEGA 3P83D 4BWMA 3ZT4A 2YNIA 4FJKA 3DOLA 1A5XA 1IH7A 1WSJA 2GV9A 2IDOA 3KK3A 4M45A 2F96A 4XIUA 2HNZA 4CHYA 3KLIA 4LH4A 1WSGA 4NYNA 1ASUA 1REVA 3G10A 1XWLA 4DMNA 3OJUA 3MAQA 3L8BA 3T3FA 4DSIA 4KAZA 4Z4IA 3VN5A 1F21A 3L3VA 4CEEA 5KGWA 4CJTA 3OYIA 3MXMA 4IFYA 1NKBA 5D3GA 1SL0A 4B9VA 3PY8A 2X6SA 1IKYA 4JS4A 3SQ2A 1TAQA 1RT2A 4OLBA 1NJWA 4FM1A 3M8PA 2P5OA 1S1VA 3DYAA 1W9HA 3NCIA 3D0PA 2OPRA 3U3YA 1XI1A 4GMJB 4FJ5A 1KSPA 1RTHA 2DFHA 4CGDA 2YV0X 2HW3A 1RT4A 3SUPA 1C1BA 3SV4A 4DTNA 2WONA 4MFBA 3KLGA 3AVLA 3CFOA 4DTXA 2OYQA 4PQUA 2BGGA 4OVLA 1C1CA 1I39A 4E89A 1IKXA 5CZ1A 2R7YA 1RNHA 3LP0A 3OJSA 1VRTA 2X78A 1QQCA 3IRXA 1LW2A 4BDZA 1T03A 2Y1JA 1N6QA 2PZSA 4FCYA 2DTUA 1I3AA 3HM9A 3QNOA 3QEIA 4OPJA 3S3NA 3TAGA 1NOYA 1O1WA 2XHBA 5JS1A 2P5GA 3OYKA 5CYMA 3F73A 3SZ2A 1GOAA 3PO4A 2ITGA 1NK6A 1KTQA 2Y1IA 4F3TA 4O0JA 4EZ9A 3TABA 4Z4CA 3NH1A 4FLXA 2QKBA 3HVRA 2IAJA 4BE0A 1UOCA 2XY8A 4RG8A 1X1PA 3ULDA 4KHSA 3HXMA 3DLHA 4DWIA 1EKEA 1D9DA 2YKNA 2G8UA 3AVGA 1HPZA 3OS1A 4FLUA 4B9NA 4F2RA 4B9UA 1UWBA 4NCBA 4YNQA 3B6OA 3ZT1A 4KHYA 1CXUA 3EY1A 2HNDA 1B9DA 4DU4A 2OPSA 5HROA 4I2QA 3TAQA 2XY6A 3PO5A 3QEPA 1TK8A 1KVAA 3OYCA 5J2QA 4FLZA 4FLWA 4FJHA 4DSEA 4F2SA 4DQQA 4DTSA 1L3TA 3BDPA 1NJXA 2ATQA 4FYDA 4CHOA 3RMAA 1CLQA 1S5JA 1BISA 3RMCA 1W0HA 5C25A 3M8SA 3DLEA 4DF4A 1QSLA 4QCLA 1QHTA 3QEXA 2FBTA 3V1QA 3TAFA 4E7JA 4E0DA 1BIZA 3I0RA 3FFIA 1RDBA 1JKHA 1NK4A 4FLYA 4BACA 3CM6A 4FJ7A 1RBTA 4AHUA 2IOCA 3HPOA 1JLBA 3SPZA 3L2VA 3UIQA 3QNNA 4BE2A 1TL3A 1BL3A 1RDDA 1TK5A 1VSIA 3ALYA 3QLHA 3VQDA 1ZBLA 4F3OA 1KCFA 3NF8A 3L2QA 2D5RA 2VG6A 3AVHA 3ZSVA 3SCXA 3OYHA 4CEAA 1HMVA 3AVAA 3IS9A 1U4BA 4CEDA 3NHGA 1C0UA 4KB1A 3HVTA 5HRNA 3L2RA 4N76A 2BANA 3S9HA 1VK0A 1HQEA 4UQGA 1KLNA 3OVNA 1HNIA 4E7KA 3AA3A 3TAMA 4Y1DA 3WNEA 4BDYA 4J2DA 4B9MA 3TAPA 2KTQA 1T05A 1L3VA 1S6PA 4CJFA 4Y1CA 3LWMA 4JS5A 2JLEA 1VSDA 3CQ8A 3WNGA 3TARA 3ZSWA 2BE2A 3CFRA 1RT3A 3T19A 4DF8A
chains in the Genus database with same CATH superfamily
3WEEA 3WNFA 3VERA 4H4OA 1DTTA 4KH4A 2IVNA 4O0IA 3CJ1A 4DLEA 1VQNN 3VF6A 2YNGA 4W5QA 3M8RA 2OA8A 2V51B 3C6AA 3K57A 2O4IA 4FOEA 4H4MA 3RVCA 3QICA 4CZLA 3VQPA 4EAHD 4FSVA 4YDUC 4CIEA 2X6NA 4Z4EA 4B1UB 3SAFA 3CF5L 2CH5A 1DTQA 3CHWA 3MCAB 5FLXO 1QQMA 1S22A 4EIAA 4B1YB 4E7LA 3HPGA 2A5XA 3KTQA 1U48A 5ELZA 3VENA 3T1YK 2O8FA 4W5TA 2E2PA 1VRUA 4O5FA 1KAYA 4CK2A 4IG3A 3EKUA 3KWGA 4BREA 3U8XA 4TSXA 1TK0A 1X9WA 1XC9A 1KLMA 3KWIA 3AVIA 1L3SA 2PFUA 4CZGA 4JAXA 3PX4A 2KFZA 5KRTA 5AJ3K 4JI7K 5AQMA 4DQRA 4JI2K 1J5OA 1FKOA 4M63C 1Q9YA 3A5NC 3L0QA 5EX5A 4AF1A 4BRHA 1G15A 4PL8A 1GOBA 3FZHA 3DXMB 4B8AB 3JAMO 4A61A 1ZBSA 2E2OA 3H3NO 1WAFA 1RCHA 4MO5A 4BQLA 1K9MO 4CJ5A 4WFNL 3C95A 2P9SB 3NFAA 1XHXA 3BF3A 3QINA 2GBZA 2YHBA 5KGXA 4NCAA 4B8CA 4M3TA 3ZSZA 4IDHA 1LV5A 1BGXT 2BDPA 4FL9A 4DV1K 1CZBA 3DM2A 3CCLN 3ZEUB 4CJ4A 1HKGA 2UXDK 4FLTA 2OZMA 5BREA 4BGBA 2HMPA 1BDGA 4CBWA 2GTDA 4A2AA 4FJLA 2YNHA 4DR7K 4LF8K 3DLLL 1ZBUA 1U2VB 2O4GA 4GW6A 4RW7A 1BQNA 3DJCA 3K5LA 1TL1A 3DLRA 3QETA 4CFCA 4CFDA 1NGIA 1NGGA 4H0TB 4DQ8A 4O55A 2NUBA 1KRPA 4B3TK 2WC9A 4H8KA 1KVBA 3J7AP 4FPAA 4DR4K 1N8RO 4C8LA 1MDUB 1VSMA 3KLHA 1GLBG 1EQYA 4O44A 1QHAA 4EHUA 4RTFD 5BR9A 1QSYA 2AP1A 1FXXA 2IC3A 3DLKA 5K14A 4CZEA 4E1NA 3NF6A 4Z4HA 1H1VA 5JS2A 4QS9A 4AHSA 2HHSA 1P90A 3U3GA 5SZTA 4DQSA 2BUPA 4CJ7A 3R3LA 2FLOA 1GOCA 2Q97A 1BCMA 1NWKA 3NBPA 3LWLA 1DEJA 4A62A 1QVGM 3QERA 3L4QA 4AHCA 3FZKA 3O8MA 3VEVA 4BC4A 1A5WA 3P5JA 1XMQK 3QMLA 4O5BA 1HJRA 4O8UA 1C0TA 3MN9A 3LAMA 3CM5A 1Q8IA 4DU1A 1RT1A 5F2RA 2VWJA 4NO7A 4FZYA 2OTLN 2E6LA 4CF8A 4PY5A 1NGAA 3OYNA 4OGEA 3VGKA 3OYJA 4DV0K 3M8QA 1UA0A 3DRRA 3VQQA 4FJ8A 5LJVA 4WF9L 5J2NA 3EYZA 1NGBA 1BI4A 2XY5A 1YT3A 1NK9A 3KK1A 1GLEG 4BGAA 2X74A 3WQUA 3AVNA 5AQYA 3ZSOA 3W3DA 4BR7A 2P9UB 3ENOA 2A3ZA 5HBMA 3CQYA 3TU5A 4CF9A 2J4RA 3SQ0A 1JL1A 3CG7A 4YFUA 4RW8A 3QBWA 2D0PA 2DFFA 1RTIA 4BC5A 4DFKA 2ZQBA 3ZCMA 4B1WB 5C2DA 1NU0A 4IG0A 2QM1A 4U7BA 5AQUA 4RWTA 3L4IA 4CF2A 4A57A 5SWMA 1TKDA 1ASWA 5KQ8A 1YUWA 2PY5A 2I5JA 1TYQB 4OKKA 4FLVA 1FJGK 3MEDA 1RILA 3ZX3A 1NGCA 3K2PA 4CEOA 3S3MA 3PUFA 4E19A 4AQYK 1EX4A 1N33K 3BZCA 5AQIA 3TAEA 1NMNA 3VTIA 3QIPA 4JI8K 3K59A 1BO5O 3HOTA 4FK0A 1JL2A 3A8YA 3U9DA 3HOSA 1QQOA 1B9FA 3AA4A 3OYDA 2P9NB 4ID1A 3SJJA 2HVHA 2YHYA 1WSFA 4DTJA 1KAXA 4GKKK 3GE1A 3NGIA 1HNVA 3RSEA 1SL1A 3R9PA 4C8KA 4LFAK 3M1FA 4ELUA 4BDPA 4B08A 3O3HA 2PYJA 1VSLA 4IFVA 3U9ZA 2YJEA 4O4GA 1RTJA 3ENBA 3SUQA 1RBRA 3BEXA 2OZSA 3WEEB 4DFJA 1DLOA 4Q5VA 3Q7BA 1N32K 3D2EA 4CF1A 3E9OA 4K41A 4OO1J 2QWNA 1VQ9N 3RRGA 3PLAA 2EWSA 1XHZA 4YOWA 3K0SA 4HHTA 1SL2A 3OS0A 1UAXA 1SKSA 5FRMA 3JXUA 5DMRA 3MEGA 3ZT4A 3I33A 3DOLA 1IH7A 2GV9A 3KK3A 4CD1A 2F96A 4BQZA 1VQKN 2HNZA 4JEPA 3LL3A 1XWLA 4DMNA 3L8BA 5AQWA 4K0KK 5AQNA 4CJTA 1NKBA 4B9VA 4FM1A 1SZ2A 2P5OA 1S1VA 1IBLK 1XC3A 3D0PA 3U3YA 1HX1A 5BPMA 2OYQA 5AQTA 1C1CA 4BDZA 5AQJA 2PZSA 3VMFB 5JMVA 3K9KA 4WQ4A 3NVKA 2P9KA 5CYMA 1KTQA 4F3TA 4Z4CA 4FLXA 2YX6A 3HVRA 5B8HA 1UOCA 2XY8A 3ULDA 1I94K 4JKEA 4B9QA 4KHSA 3HXMA 2P9IA 3WXIA 1EKEA 2G8UA 4JI0K 3AVGA 4FLUA 1UWBA 2ZGZA 2RE2A 1T3VA 5M1NA 4NCBA 2ZJRL 4B3RK 3B6OA 3EY1A 4BVOA 4JI4K 1VQMN 2XY6A 1MWMA 4FLWA 3P4IA 1TUUA 4DQQA 1NJXA 1JJ2M 1SQKA 4MLHA 1BISA 2WUSA 1QSLA 3MWTA 3CJ9A 3TAFA 3OW2M 4DV6K 5FPMA 1JKHA 5EVZA 1W2BM 4BR2A 4FJ7A 1RBTA 2UUAK 2IOCA 4BE2A 1TK5A 3UE5A 1ZBLA 3VESA 2D5RA 4ILGB 3AVAA 3F5TA 2E2NA 1C0UA 2FSKA 3HVTA 1NNEA 2BANA 4BRAA 4FWLA 3S9HA 4UQGA 1XNQK 4E7KA 3WNEA 1SS6A 4BDYA 4J2DA 2P9PA 4B9MA 3TAPA 1T05A 4NLBA 1S6PA 5GINA 3FR0A 1Q82O 3LWMA 3ZSWA 1RT3A 5DM7L 4CERA 3G71N 3F9MA 2G8KA 3CI5A 2ITMA 3WXKA 4JV5K 4LF6K 4WYBA 1TAUA 4KHQA 1IG8A 1QQNA 1OH6A 4DR3K 4CVNE 2FF3B 4DUYK 4LF9K 2QI2A 4M7YA 2PYLA 3G6EN 2YI1A 2UUBK 1NKCA 1YAGA 3AA2A 4X62K 2VWKA 1VQLN 4IKFA 3ASMA 3NGYA 3AAPA 3VQ9A 3RR8A 3P31A 3AO1A 1VQ8N 3VEZA 1Z26A 2VG7A 4RW6A 3IKMA 5FPNA 3ATVA 1RDCA 4DCHA 1WN7A 2NRHA 3NDKA 4ELVA 3SMSA 4YOVA 4HUEA 5C24A 4CEBA 2IVPA 1CZAN 1BI4B 1C6VA 1S1XA 5A2QO 2Q0UA 3HZ6A 5M1OA 5BRFA 1HYVA 3HJFA 4BR5A 4DTMA 1OH5A 3NF9A 2GELA 2W41A 4EFHA 1IBKK 3DRPA 1ZBFA 4B9LA 4HUFA 1X3MA 3VEWA 4B9TA 4W5OA 3HP6A 2W6KA 4QOZB 3FE1A 2HNYA 2O8EA 1IKWA 3O3FA 2PAVA 4M3XA 3KK2A 2WBNA 3LDSA 1MA9B 1EETA 3O08A 4NYFA 1HJOA 1TKZA 3EZWA 4PA1A 5E84A 3CCJN 4FWOA 3FGUA 3N4PA 4CEZA 2O8CA 3AY9A 4CGIA 3HSCA 3T1HK 4IOXA 3AVBA 3P38A 4M42A 1BHLA 2D1KA 5HRPA 4FWQA 3M6GA 4IBNA 3KKSA 2A6AA 1VQ4N 4YDUA 4RW4A 4K42A 4GV9A 2G8WA 2RF2A 3O4NA 1ESVA 4OLAA 3MX5A 3WXLA 4CJRA 3CCMN 2ZGYA 2KQ2A 5AQGA 4OPKA 3MEEA 4V19S 2G8VA 1R0AA 1IKVA 1JXBA 3F9KA 4Q0BA 3LANA 5AFUH 3EKSA 4PWDA 4LSNA 3SQ1A 4CECA 1NJZA 3RSEB 5I9EB 3RWUA 4DTUA 3H1VX 2Z1HA 4CIGA 1ZC6A 5IT9O 4FW1A 3CCVN 3HYFA 1ILYA 4H03B 3H46O 3GDQA 3CPWM 5HLFA 1EWQA 1D5AA 4L3QA 1KD1O 5CY4A 1BIUA 2QWQA 3OYEA 1S1TA 1IO2A 4IOAL 1KQSM 4H0YB 5DK5A 1RT6A 3D2EB 3V9SA 3TSUA 3D2FA 4KH5A 1IBMK 3O3GA 2KZMA 3SAHA 3AVJA 3O4QA 4LSLA 4A2BA 4DS4A 1C0FA 4DTOA 4ZTFA 1RBVA 2PBDA 5JICA 5MLCQ 3MXIA 1QTMA 2XO7A 1VQPN 5J2MA 1KFDA 3CMAN 3WNHA 4GVMA 4OGCA 5GAHP 1WNSA 3OHRA 5CR4A 3PX0A 4AM7A 4FWPA 3V9XA 1Q9XA 2B6AA 1UA1A 3C6HA 1K8KA 1YVNA 1JLCA 3U6FA 4IDKA 2QK9A 1XUPO 3O5BA 1V4SA 1CXQA 1LWEA 4M3YA 5IWAK 4Z0UA 3R8EA 4CIFA 3BP8A 1SKRA 1NKEA 4C8OA 1J53A 2FSJA 4KHWA 4KTWA 1J54A 3CCRN 4HCCA 4FPBA 5KI6A 1SAZA 5EXWA 3FZFA 5JLFA 5FDLA 1N5YA 5HL7L 1WSHA 1HQUA 1NOZA 4FVMA 3IG1A 4GKJK 4JN4A 3CCUN 2D0AA 4CE9A 4CW7B 2P9IB 4O8KA 2LSNA 5C0YA 4DV2K 3KD5E 3WT0A 4E3SA 1JLFA 3HBTA 1HNWK 5HP1A 2OANA 2HHQA 1VSEA 2NRVA 3A2FA 3ZSQA 3RMBA 5HRRA 1X9MA 3ITHA 1Y64A 1R59O 1BOTO 5HRSA 3RTVA 2HF3A 4M3ZA 4CJLA 4DSJA 4CZKA 1TVRA 5EOYA 4KRFA 4C1NK 4JKAA 4R79A 4JI5K 3JS6A 4IJNA 1DGKN 2DY4A 4HVJA 4QS8A 3CC7N 3V1OA 2YHWA 2B5JA 5AR0A 2JGUA 2RPIA 3K58A 3ZT0A 1RFQA 3CYMA 4MO4A 2P9PB 4K8XA 2O8BA 1VQON 4B9SA 3AVKA 1BG3A 2E20A 4I6MA 3SMPA 3SNNA 4DSFA 3K5MA 3V6DA 3CPEA 1WBBA 4BRGA 4CK3A 3HSTB 2VWBA 4CFAA 3CC4N 1TGOA 3CJ7A 1T7PA 1VAZA 5I3UA 3L3UA 2YJFA 5AZJB 1YIJN 3MECA 1NMDA 3HI0A 1BWFO 3QO9A 4PKIA 4CI6A 4ZTJA 1NK7A 4BWMA 1YJWN 2YNIA 3THYA 3SJHA 4M45A 5CE3A 4XIUA 4NYNA 4LH4A 2VGNA 3OJUA 5AZIA 4Z4IA 4HWIA 5AQPA 3O9UA 3VN5A 3L3VA 3MXMA 5KGWA 4PHTX 4DV5K 4IFYA 4JS4A 4CBXA 1TAQA 1RT2A 4OLBA 2NRZA 5ADXH 3MN6A 2Q0RA 3DYAA 1W9HA 2FSNA 2OPRA 1XI1A 1RTHA 2DFHA 4CGDA 2YV0X 1RT4A 1C1BA 4DTNA 4MFBA 3CFOA 1ATSA 2R7YA 4OPHA 1VRTA 1T03A 1QQCA 5AFUA 3DXKA 1NOYA 3TAGA 5JS1A 1XQSC 3OYKA 3F73A 4ISGA 4O0JA 2QKBA 1NG9A 3DLHA 4LF4K 3OBWA 1D9DA 4F2RA 2O8EB 1GLDG 3WXMB 3ZT1A 4ISEA 4CZIA 1IV0A 1B9DA 1S72N 1DKGD 2GUPA 4C1NI 3MN5A 1LCUA 4X65K 3BDPA 3N4QA 4CHOA 3RMAA 2D0OA 1X3NA 1W0HA 3VF2A 4QCLA 1QHTA 4MLEA 3QEXA 2E1YA 3CERA 1OVQA 3MK6A 1BIZA 4JK8A 1P8ZA 1NK4A 4LF7K 3K9JA 1JLBA 1E3MA 1KXPA 3MX2A 4F3OA 3VQDA 1OVYA 2VGMA 2VG6A 3A5OC 3OYHA 2NRRA 1U4BA 2FXUA 4KB1A 4UY8O 2VQEK 2VCPA 2ZF5O 2F9WA 4IO8A 1KLNA 3OVNA 1HNIA 3AA3A 4YY3K 4DV7K 1L3VA 4CJFA 4Y1CA 5F0XA 5EY4A 3VEXA 4CZFA 3CQ8A 3WUHA 4FWNA 4YORA 2E8AA 4DF8A 1BA1A 2QWPA 4MDAA 2F7TA 5AQOA 1BA0A 4IFEA 2WOMA 5JVGL 3O6WA 2KZZA 2RN2A 4EZ6A 5KPZA 5J2PA 1NK5A 2B4JA 2YHXA 4BR0A 4CK1A 3SUOA 4N56A 3FZMA 3ULEA 3LPUA 2HOEA 4I2PA 4KBOA 1C1AA 4EP5A 3D2FB 3KHYA 3V81A 2BH1A 3LALA 1G99A 3NGZA 3ZYYX 5J1EA 2P1JA 2Q2RA 2RKIA 2XRIA 3VEYA 2IGIA 4ILHA 4FJJA 2HHXA 3VA3A 1IG9A 2O8FB 2DPNA 4B1XB 3O80A 2HHVA 3SBTA 1JXEA 4CGGA 4CESA 2G8FA 1K8KB 3AVMA 1LW0A 3LP1A 3H45C 2ZJPL 1SV5A 1WOQA 4C8MA 3I0SA 4JK9A 1U49A 3DLBA 3LM2A 1LWFA 4FJMA 1RBSA 2OCEA 2G8IA 5BN8A 2YNFA 1W97L 1XNRK 2P9LA 4G9ZA 1NM1A 4CFBA 2P51A 1S1UA 1NGFA 1EO1A 3TR8A 1WSEA 4AILC 3THWA 3NF7A 2HHUA 4CJVA 5FPDA 1FK9A 2QWLA 4DR2K 1K73O 2HB5A 1T8EA 3K5NA 4CJKA 3UB5A 1D9FA 4WE1A 4A5BA 4CGJA 3HL8A 4DTPA 4KPYA 3AGKA 5AQRA 3TPQA 1WLJA 1ATRA 3QIOA 3AVCA 3VQ6A 3SQ4A 3GBTA 1QE1A 2IIRA 1TKTA 5C10A 2GX9A 1RT7A 1U2VA 2VYPA 3CQXA 4PL7A 3VETA 2ZM6K 1HLUA 1TKXA 4LY7A 4XEIA 1OKJA 3VQAA 4LC9B 2GWJA 3C65A 5C42A 5ADXA 3H6EA 1J6ZA 5FRNA 4CHNA 3P1GA 3LZJA 3G0ZA 3ZT2A 4JKCA 4FK2A 4DS5A 2QXFA 4KTZA 4KI6A 2Q3SA 3VTHA 3LP2A 3VGMA 3OYMA 1WSIA 4BRFA 3PX6A 3L2UA 3KJVA 4H0VB 3Q7CA 2CGLA 1LOTB 5AQZA 3VQBA 4KI4A 3QDKA 3TWHA 4CJSA 4YOYA 3L6QA 4M41A 4I6MB 4DHYA 2QKKA 4Z4GA 5AQKA 4JRPA 4F4KA 2KW4A 3TSPA 4WFAL 3M3ZA 4AHRA 4NCGA 4CGFA 3EL2A 4ICLA 5AQXA 5TKWA 3UKUA 3SYZA 2QWRA 1QSSA 1HR0K 3V4IA 1NGDA 3L2WA 1HYZA 1Q81O 4CJWA 4FJGA 3THYB 1O13A 4CZHA 4FK4A 4KV8A 2HHWA 4LD0A 5AZIB 4DFPA 1RTDA 5BRHA 3NH0A 4HTUA 3O4WA 5LL6Z 3THXA 3DLGA 5C2FA 3J7YP 3OS2A 5FROA 3VQCA 5AQFA 3SV3A 2Z1GA 4BRKA 5KPTA 4DQIA 3AGRA 4JI3K 3NMUA 1YHQN 4FWSA 1RT5A 3BF1A 3DWLA 1EWRA 3AA5X 3CJAA 4I9QA 3KIOA 2ETJA 3D6RA 4H5WA 3DXKB 1NGJA 4N41A 4CJPA 2JWLA 3VEOA 2F9TA 3CFPA 3KVGA 3EO3A 5DM6L 4CJEA 2UU9K 4WQ5C 5EU7A 3G4SN 3E9LA 4DR6K 4RCHA 1MU2A 4BRLA 1GLFO 4EHTA 3OYFA 4HUGA 1C0GA 5CHIA 1QZ6A 1T6DA 1L3UA 1NLVA 1RGIA 4N47A 3SAGA 3QBXA 1GLCG 3ZSYA 2DFEA 4K8ZA 3QB0A 3V9UA 1SKWA 1VQ5N 4JD2A 1TV6A 4BVPA 2V7YA 4YOXA 1JLAA 5M1FA 2YHAA 1RDAA 1ZYQA 2OPPA 4QAGA 2V7ZA 4BG8A 2KHOA 2EX3A 2IVOA 2F8SA 5GADP 3LP3A 1FW6A 2IS3A 3IAYA 4FWKA 2KFNA 2FF6A 3KK7A 1VSHA 3C6UA 4CBUA 4QS7A 4W5NA 3VQ4A 4KHUA 4CHPA 4KREA 3B6PA 4OPAA 3JSMA 4KHNA 1L5UA 3CC2N 3MDQA 1D4XA 4ELTA 4XH5A 3U4LA 3TI0A 1U04A 2E88A 2KKZA 3NAEA 5KPRA 3ULEB 2D0CA 3D7EO 3IDHA 4CZMA 4B1VA 1M90O 3CJCA 1OH7A 2HMIA 4F9OA 4BR9A 2OTJN 3P83D 4BRIA 4JHDA 1A5XA 1WSJA 4GV6A 4CHYA 3T3FA 4DSIA 4LFBK 3LDPA 4JKGA 4CEEA 5D3GA 2ASOA 2W40A 1J5EK 4KH6A 3PY8A 3C7NA 2ZJQL 4BR4A 4BRDA 1NJWA 3CCSN 1DT9A 2E1ZA 5HOOA 2E2QA 2E5LK 1KSPA 3J80O 1HNXK 1D8YA 3KLGA 3AVLA 4PQUA 3LP0A 2X78A 3IRXA 1LW2A 3SLCA 2O8DA 2DTUA 2QWOA 3E1YA 3HM9A 4OPJA 3S3NA 2XHBA 2P9KB 3ATUA 2P5GA 3PO4A 1GOAA 5BPNA 2NRTA 2Y1IA 4EZ9A 3NH1A 4BE0A 4RG8A 2P9LB 4DWIA 2YKNA 1HPZA 3VF4A 3SK3A 4FOIA 2GWKA 5C15A 3ZETA 2HNDA 2QEXN 4DU4A 2OPSA 3THWB 3PSFA 4I2QA 3TAQA 4H0OA 2YCHA 3PO5A 3J7ZO 4FLZA 4FJHA 4DSEA 4F2SA 3O9QA 4DTSA 1RDUA 1N36K 1Q7YO 1CLQA 4MDBA 3E66A 5H1SQ 1S5JA 4PKHA 4H5VA 3TTFA 3SBGA 5C25A 3RMCA 3B8AX 3MN7A 4E7JA 1XMOK 3I0RA 3FFIA 4BACA 3CM6A 4LFCK 3FZLA 3HPOA 3SPZA 3W0LA 4E1JA 2UXBK 3QNNA 1TL3A 3MMVA 1BL3A 1RDDA 3ALYA 3QLHA 1KCFA 3NF8A 4IOCL 3SCXA 3AVHA 3IS9A 3CCEN 3TSQA 3NHGA 3L2RA 1VK0A 1HQEA 1QZ5A 4ISFA 4BC3A 5M1KA 2I7PA 2Q1NA 3T7ZA 2JLEA 3WNGA 3CFRA 3T19A 1VSKA 4AHVA 4IXCA 3SUNA 2AJQA 4JKBA 2HSTA 5GIOA 1YF5L 4FJNA 4ZHRA 1S9GA 4K43A 2FBYA 4L8RB 2ZE2A 3D45A 4WFBL 2NLXA 2G8HA 3BY5A 4FJIA 4AH9A 4CEQA 1JLEA 4M3WA 3LDOA 4BRPA 3MXJA 4R5PA 3LAKA 4J2AA 1S1WA 1RDWX 2Z1JA 3HP9A 2EHGA 1OH8A 3E01A 4Y0WA 4BY9C 1U47A 3UKUB 4CJQA 5KTQA 3IUCA 2ZWHA 1BCOA 4JYAK 4GY2B 5BN9A 2HHHK 4XH4A 4KB0A 4CEFA 1GLJO 3OA9A 3UKRA 1VSFA 4JNEA 1KC8O 4OJRA 3QESA 3AO5A 4DG1A 5I42A 4DU3A 5M1QA 4GV3A 4GNIA 3THXB 1C0MA 1TUYA 1KAZA 3H1QA 4JKHA 4YOTA 4B3MK 2FC0A 2HBKA 2I7NA 4I7FA 1X9SA 3ID6A 4E1MA 5GIPA 3RMDA 2VG5A 3VOVA 3QEWA 5CZ2A 3WQTA 2Z1IA 2WFBA 3M5RA 4FZXC 3R1XA 3VPZA 1Z6RA 4NXNK 3QFPA 4DUZK 3HPHA 4AHTA 4M3RA 4U67L 4DV3K 1A5VA 4FW2A 4ILJA 4DKWA 1Z05A 3HO1A 1WUAA 2QWMA 3O1WA 4LH5A 4I9LA 1WB9A 4F8RA 3AO3A 4KKOA 1RBUA 3I55N 3WXJA 3ISNC 5TKYA 2O8CB 3OBYA 3A5MC 3BZKA 2FBXA 2NRWA 4CHZA 2FBVA 4DQPA 4BG9A 3OYLA 5CYQA 4CCHA 3AO4A 3DRSA 3H3OB 4X66K 2W42A 4JKDA 4DFMA 5T7BA 2D4WA 4CJ3A 4PKGA 5LMNK 2A40A 1LAVA 3O1BA 2YKMA 3G25A 5JLHA 3O9SA 4FVUA 3PSIA 2GUIA 4DR5K 4JD2B 1CZ9A 3CD6N 3C0BA 4DSKA 3CETA 1SUQA 1JLGA 3PIPL 2RHKA 1WAJA 1ITGA 3HM8A 1S6QA 3S3OA 1VSJA 4FJ9A 2QW9A 1E4GT 4E7HA 3KKRA 2HVIA 4W5RA 4IEIA 2A1RA 1YJ9N 4DSLA 4MQ3A 4KO0A 1KFSA 4JI6K 3HTVA 2NNWA 1NGEA 5BPLA 1HYSA 3KLEA 3KD1E 5BR8K 4BROA 3GL1A 3LPTA 1VQ7N 1B92A 1JLQA 2A41A 4FM2A 3ENHA 3CXCM 3SI6A 3RRHA 3C6TA 3PIOL 3ID8A 3DMJA 1KVCA 3FFKB 2CGJA 4IWVA 1EXQA 1ZBIA 5LMUK 1YXQA 3HT3A 2ZD1A 4DV4K 3O9TA 3MCPA 1NK0A 4JK7A 1QVFM 4B3OA 3PV8A 1FKPA 1GLAG 2V52B 3OYGA 3DOKA 3KZBA 3A0IX 2XY7A 1N34K 4KHPK 3VQEA 4H0XB 3NE6A 4JHDB 4Z4FA 3QEVA 4E7IA 1M1KO 5C12A 1JCFA 4BRQA 4C8NA 3VQ7A 4JKGB 2UYTA 4BWJA 2D0BA 3C94A 1U6ZA 3V9WA 3OYBA 3C7NB 1HPMA 3AO2A 1IJJA 4JLHA 3VQ5A 3EE8A 1JCEA 1W7AA 2JWKA 1ASVA 4BE1A 2H3GX 2HF4A 4CHQA 5GAEP 3GG4A 3DXMA 3IMXA 4X64K 4IJAA 2O8DB 4Z94A 3EZ5A 4G1QA 2E6MA 2P9SA 3CCQN 5AQSA 3V9ZA 1QS4A 3NH2A 4OKEA 2A1SA 4H5TA 3AVFA 4KFBA 3VQ8A 4JI1K 4A59A 4J2EA 4HTLA 4LF5K 1YITN 4OX9K 2NZTA 3EE9A 4CF0A 3O9RA 1YTUA 3ZSRA 3ZEUA 3P39A 5LJWA 1LAWA 2KLAA 3ZETB 3SPYA 4FWMA 3V1RA 5AQQA 4FJXA 4H5NA 3EEQA 5AQVA 2E4LA 1GLLO 4N5SA 3OYAA 4DLGA 3LM9A 1NJIO 3CJBA 4KTQA 2Q36A 4JKFA 4BRNA 3OY9A 4OKJA 4J8FA 1K6YA 4NXMK 1Y97A 4IO9L 2A42A 4M3UA 4J2BA 4PUOA 3F2KA 4FO0A 4FM0A 3I56N 4JRQA 1T6CA 1S9EA 4FXDA 4RW9A 2BTFA 3VGLA 4ID5A 3KLFA 5KRSA 3K5OA 3S41A 1NJYA 4CGHA 1EP4A 3EN9A 2ASPA 4EP4A 4WQ4C 3IFRA 5E41A 1HRHA 2F8TA 1T44A 4FWRA 5F1XA 3JYTA 3HK2A 2W6LA 3THVA 3RR7A 3H08A 3CMEN 4IEEA 1ZBHA 1BU6O 4BRCA 5AQLA 5KQDA 2O8BB 2WTUA 1BUPA 4DB3A 3HRGA 3ZSXA 1J9AA 3AARA 4M7XA 2OPQA 1YJNN 4A5AA 1BQMA 1LWCA 4GVEA 4H5RA 3T1AA 1Z25A 4CJUA 3LZIA 3VA0A 2HHTA 3AAQA 3AV9A 1HKBA 4AM6A 1NK8A 3BGRA 3ZT3A 1U45A 2AA4A 1YTAA 4XH1A 4DTRA 2VQFK 3TANA 3I8DA 1Q18A 4WQ5A 4YHHK 1Q86O 1YVUA 5AZJA 1VHXA 3DI6A 4FJKA 1E4FT 1HUXA 2IDOA 3KLIA 1WSGA 4B3SK 4YOUA 1ASUA 1REVA 2NRXA 3G10A 3MAQA 4KAZA 3GOIA 1F21A 5AQHA 3OYIA 1SL0A 4C23A 2X6SA 1IKYA 3SQ2A 3ZLJA 1K8AO 3M8PA 3QFUA 2QA4N 2QXLA 5BRDA 3NCIA 3OTOK 2GEMA 4GMJB 2HBLA 4FJ5A 3UKRB 2P9UA 4WCEL 2HW3A 3SUPA 3SV4A 2WONA 2ASMA 3DAWA 3NVMA 4DTXA 2UXCK 2BGGA 4OVLA 1I39A 4E89A 1IKXA 1NGHA 5CZ1A 1RNHA 4CD3A 3J81O 3OJSA 1MWKA 3BUZB 1N6QA 2Y1JA 4FCYA 1I3AA 3TTDA 3QNOA 4NLCA 3QEIA 1O1WA 3LDQA 3A5LC 3SZ2A 2UUCK 2ITGA 5GAGP 1NBWA 1NK6A 3E9PA 3TABA 3I8BA 4IZ9A 2IAJA 4CZJA 1X1PA 4HCBA 4FYDA 4B9NA 2F4VK 3OS1A 2CH6A 4B9UA 4YNQA 4KHYA 1CXUA 3R6MA 5HROA 1TYQA 3QEPA 2HBMA 1S3XA 1TK8A 1KVAA 3OYCA 1VQ6N 5J2QA 2QTDA 5E26A 1L3TA 1YI2N 3J8AA 2ATQA 3M8SA 3DLEA 4DF4A 3CIPA 4BRMA 1V4TA 2FBTA 3V1QA 4E0DA 3ZX0A 1HNZK 1RDBA 4FLYA 1HKCA 2P9NA 4AHUA 1ZXOA 1WBDA 3L2VA 3UIQA 3LDLA 3MWPA 3TTCA 4K25A 5M1PA 1VSIA 5LY3A 4NB4A 2CGKA 3L2QA 2HBJA 3ZSVA 3FLCO 4CEAA 1HMVA 4H0PA 4CEDA 4N76A 5HRNA 1X9JA 2Q31A 3ZX2A 3T69A 5JVHL 4B1ZA 4BC2A 5FPEA 3TAMA 4Y1DA 2KTQA 4DR1K 4JS5A 1VSDA 1JCGA 3TARA 2BE2A 1ATNA 4FZZA 3LDNA
chains in the Genus database with same CATH topology
3WNFA 4H4OA 1DTTA 1VSKA 4AHVA 4CERA 2G8KA 4O0IA 3SUNA 2AJQA 2WOMA 4HCBA 2KZZA 2RN2A 4DLEA 4EZ6A 5J2PA 4FJNA 1NK5A 2YNGA 2B4JA 4W5QA 4ZHRA 3M8RA 1TAUA 1S9GA 4KHQA 4CK1A 2FBYA 2OA8A 3K57A 3SUOA 4L8RB 2ZE2A 4N56A 2O4IA 3D45A 4H4MA 3LPUA 2G8HA 3VQPA 4FJIA 4AH9A 4CEQA 4I2PA 1C1AA 1JLEA 2PYLA 4M3WA 4EP5A 4CIEA 3MXJA 4R5PA 1NKCA 3LAKA 2X6NA 4J2AA 3V81A 3AA2A 4Z4EA 1S1WA 1DTQA 2Z1JA 2VWKA 3HP9A 4IKFA 2EHGA 3LALA 4E7LA 3E01A 3NGZA 1U47A 3ASMA 3NGYA 5J1EA 2P1JA 3HPGA 4CJQA 2RKIA 2XRIA 3VQ9A 5KTQA 3AO1A 3KTQA 3RR8A 2IGIA 1U48A 1BCOA 4FJJA 2HHXA 3VA3A 1Z26A 1IG9A 2VG7A 4W5TA 4RW6A 4KB0A 4CEFA 1VRUA 1RDCA 1VSFA 4CK2A 4IG3A 4OJRA 1WN7A 3QESA 2HHVA 3AO5A 4DG1A 5I42A 4DU3A 3NDKA 1JXEA 4CGGA 4ELVA 4HUEA 4CESA 2G8FA 5C24A 4CEBA 4TSXA 1TK0A 3AVMA 1XC9A 1X9WA 1C0MA 1KLMA 1LW0A 1BI4B 1C6VA 1S1XA 3AVIA 3LP1A 1L3SA 1SV5A 4C8MA 2FC0A 1X9SA 1HYVA 3I0SA 4I7FA 3PX4A 1U49A 3HJFA 5KRTA 2KFZA 4E1MA 3RMDA 3DLBA 4DTMA 1LWFA 4FJMA 2VG5A 3NF9A 4DQRA 1RBSA 3DRPA 3QEWA 1J5OA 1FKOA 1ZBFA 5CZ2A 4B9LA 1Q9YA 2G8IA 2Z1IA 4HUFA 4FZXC 4B9TA 4W5OA 2YNFA 3HP6A 4QOZB 1G15A 1GOBA 2HNYA 4B8AB 4CFBA 1IKWA 2P51A 3HPHA 4AHTA 4M3RA 3O3FA 4M3XA 1A5VA 4FW2A 3KK2A 1S1UA 1WAFA 1RCHA 3LDSA 3HO1A 1EETA 3TR8A 1WSEA 4LH5A 4I9LA 4NYFA 4CJ5A 4AILC 4F8RA 3C95A 1TKZA 3AO3A 3NF7A 3NFAA 1XHXA 4KKOA 1RBUA 4PA1A 3QINA 2GBZA 2YHBA 5KGXA 2HHUA 4NCAA 4B8CA 4CJVA 3ZSZA 4M3TA 3ISNC 4CEZA 1LV5A 1FK9A 1BGXT 2BDPA 2FBXA 4CHZA 2FBVA 4DQPA 2HB5A 4CGIA 1T8EA 3K5NA 1CZBA 3OYLA 5CYQA 3DM2A 3AO4A 3DRSA 3AVBA 4CJKA 1D9FA 4WE1A 4CJ4A 4CCHA 4M42A 4CGJA 1BHLA 3HL8A 2W42A 5HRPA 4DTPA 4KPYA 4FLTA 4DFMA 4IBNA 2OZMA 3KKSA 5T7BA 4CJ3A 1WLJA 3QIOA 4FJLA 3AVCA 4RW4A 2YNHA 3VQ6A 3SQ4A 1LAVA 1ZBUA 1QE1A 2G8WA 1TKTA 2YKMA 2RF2A 1RT7A 3O4NA 4OLAA 2O4GA 4GW6A 2GUIA 4RW7A 4CJRA 1TKXA 1CZ9A 4LY7A 2KQ2A 4DSKA 1BQNA 3K5LA 3VQAA 1TL1A 4OPKA 3DLRA 3MEEA 1SUQA 4CFCA 3QETA 4CFDA 5C42A 2G8VA 1JLGA 1R0AA 5FRNA 1IKVA 1JXBA 4CHNA 3P1GA 3F9KA 3LZJA 1WAJA 1ITGA 2NUBA 1S6QA 3G0ZA 4O55A 3LANA 1KRPA 4Q0BA 4H8KA 3S3OA 3ZT2A 1VSJA 4FK2A 4KI6A 4DS5A 2QXFA 4KTZA 4FJ9A 1KVBA 2Q3SA 4PWDA 4E7HA 3LP2A 3OYMA 3PX6A 1WSIA 3KKRA 2HVIA 4W5RA 3L2UA 4LSNA 3SQ1A 4C8LA 4CECA 3KJVA 2A1RA 1NJZA 3RWUA 1VSMA 4DTUA 3KLHA 4DSLA 4O44A 4MQ3A 2Z1HA 4CIGA 4KO0A 1D8YA 1QSYA 1KFSA 1FXXA 2IC3A 3DLKA 4FW1A 5K14A 4E1NA 4Z4HA 3NF6A 5JS2A 3HYFA 1HYSA 4AHSA 3KLEA 3KD1E 2HHSA 3VQBA 4KI4A 3U3GA 5HLFA 3LPTA 1B92A 1JLQA 5SZTA 3TWHA 4FM2A 4DQSA 4CJSA 1D5AA 4M41A 3SI6A 5CY4A 1BIUA 3RRHA 2QKKA 4Z4GA 3OYEA 3C6TA 4JRPA 1S1TA 4F4KA 1IO2A 1GOCA 5DK5A 2KW4A 1RT6A 3V9SA 1BCMA 3DMJA 3NBPA 3LWLA 4AHRA 1KVCA 3QERA 3O3GA 2KZMA 1EXQA 1ZBIA 3AVJA 3O4QA 4LSLA 2ZD1A 4NCGA 4AHCA 4CGFA 3HT3A 4DS4A 4DTOA 1NK0A 1A5WA 4ICLA 4ZTFA 4B3OA 3P5JA 1RBVA 3MXIA 3PV8A 1QTMA 4O5BA 1HJRA 2XO7A 1C0TA 1FKPA 3SYZA 3OYGA 3LAMA 1QSSA 3V4IA 3L2WA 3DOKA 5J2MA 3CM5A 1KFDA 1Q8IA 3WNHA 4GVMA 4DU1A 1HYZA 1RT1A 2XY7A 3VQEA 4OGCA 4CJWA 2VWJA 1WNSA 3NE6A 4FJGA 3PX0A 4Z4FA 3QEVA 4E7IA 4FZYA 1Q9XA 3V9XA 4KV8A 2E6LA 4CF8A 4FK4A 2B6AA 1UA1A 4PY5A 2HHWA 4LD0A 3OYNA 4DFPA 4OGEA 3OYJA 1RTDA 4C8NA 3VQ7A 3M8QA 1UA0A 3DRRA 3VQQA 3NH0A 4HTUA 4FJ8A 1JLCA 4BWJA 5J2NA 2D0BA 3EYZA 4IDKA 3U6FA 3DLGA 2QK9A 1BI4A 3C94A 5FROA 3OS2A 3V9WA 3OYBA 3VQCA 2XY5A 1YT3A 3SV3A 3AO2A 1NK9A 3KK1A 1CXQA 1LWEA 2Z1GA 4DQIA 4M3YA 4JLHA 3VQ5A 2X74A 3AVNA 4Z0UA 4CIFA 3ZSOA 5HBMA 1ASVA 1RT5A 1NKEA 1SKRA 4BE1A 4C8OA 3AA5X 4CF9A 1J53A 4CHQA 4KHWA 4KTWA 4FZZA 1J54A 4HCCA 4I9QA 3KIOA 2ETJA 5KI6A 3SQ0A 1JL1A 3CG7A 4YFUA 4RW8A 5FDLA 4N41A 3EZ5A 4G1QA 2E6MA 2DFFA 1RTIA 3V9ZA 1N5YA 4CJPA 4DFKA 1QS4A 2ZQBA 1WSHA 3NH2A 1HQUA 1NOZA 4FVMA 3IG1A 4OKEA 2A1SA 3CFPA 3AVFA 3ZCMA 4KFBA 3VQ8A 2D0AA 4CE9A 4J2EA 4IG0A 4CJEA 4CF0A 1YTUA 5EU7A 2LSNA 3ZSRA 1MU2A 4CF2A 1LAWA 5SWMA 3OYFA 3KD5E 3SPYA 4E3SA 4HUGA 1JLFA 1TKDA 1ASWA 2PY5A 3V1RA 1L3UA 5HP1A 2I5JA 1VSEA 4OKKA 4FLVA 4FJXA 2HHQA 4N47A 3MEDA 1RILA 2E4LA 3A2FA 4N5SA 3OYAA 4DLGA 3ZSQA 3RMBA 3K2PA 4CEOA 5HRRA 3S3MA 4KTQA 3PUFA 4E19A 1X9MA 3ZSYA 4K8ZA 2DFEA 3ITHA 1EX4A 3OY9A 4OKJA 5HRSA 1K6YA 3RTVA 3V9UA 1SKWA 1Y97A 4M3ZA 3TAEA 1TV6A 3QIPA 4CJLA 4M3UA 3K59A 4FK0A 4DSJA 1JL2A 4J2BA 4PUOA 1JLAA 1B9FA 1TVRA 3AA4A 3OYDA 4FM0A 4JRQA 1S9EA 4KRFA 4ID1A 3SJJA 4FXDA 4RW9A 2HVHA 4ID5A 1WSFA 2YHAA 3KLFA 1RDAA 5KRSA 3K5OA 1NJYA 4CGHA 4DTJA 1ZYQA 1EP4A 2OPPA 4EP4A 4QAGA 5E41A 1HRHA 2F8TA 2DY4A 3NGIA 1HNVA 3JYTA 1SL1A 2EX3A 4HVJA 4C8KA 2F8SA 3HK2A 3V1OA 4ELUA 4BDPA 4B08A 3LP3A 3THVA 2B5JA 3RR7A 2JGUA 2RPIA 3H08A 3O3HA 1VSLA 2IS3A 4IFVA 3ZT0A 3K58A 2PYJA 3IAYA 1ZBHA 3CYMA 4K8XA 4O4GA 4B9SA 2KFNA 3AVKA 1RTJA 3SUQA 3ZSXA 1RBRA 1J9AA 1VSHA 2OPQA 3C6UA 3SNNA 2OZSA 4DSFA 4DFJA 1BQMA 1LWCA 1DLOA 4Q5VA 3K5MA 3VQ4A 3V6DA 4KHUA 4W5NA 4CHPA 4KREA 4CF1A 3B6PA 3T1AA 1Z25A 4CK3A 4CJUA 3LZIA 3HSTB 3JSMA 3VA0A 4KHNA 3AV9A 1L5UA 2HHTA 4CFAA 1NK8A 3BGRA 3ZT3A 4ELTA 3RRGA 1U45A 1TGOA 3TI0A 1U04A 1YTAA 1XHZA 4DTRA 4HHTA 1T7PA 3NAEA 3I8DA 5I3UA 3TANA 1SL2A 3OS0A 2D0CA 3L3UA 1UAXA 1YVUA 1SKSA 3MECA 2HMIA 5FRMA 3DI6A 3QO9A 1NK7A 4ZTJA 5DMRA 3MEGA 3P83D 4BWMA 3ZT4A 2YNIA 4FJKA 3DOLA 1A5XA 1IH7A 1WSJA 2GV9A 2IDOA 3KK3A 4M45A 2F96A 4XIUA 2HNZA 4CHYA 3KLIA 4LH4A 1WSGA 4NYNA 1ASUA 1REVA 3G10A 1XWLA 4DMNA 3OJUA 3MAQA 3L8BA 3T3FA 4DSIA 4KAZA 4Z4IA 3VN5A 1F21A 3L3VA 4CEEA 5KGWA 4CJTA 3OYIA 3MXMA 4IFYA 1NKBA 5D3GA 1SL0A 4B9VA 3PY8A 2X6SA 1IKYA 4JS4A 3SQ2A 1TAQA 1RT2A 4OLBA 1NJWA 4FM1A 3M8PA 2P5OA 1S1VA 3DYAA 1W9HA 3NCIA 3D0PA 2OPRA 3U3YA 1XI1A 4GMJB 4FJ5A 1KSPA 1RTHA 2DFHA 4CGDA 2YV0X 2HW3A 1RT4A 3SUPA 1C1BA 3SV4A 4DTNA 2WONA 4MFBA 3KLGA 3AVLA 3CFOA 4DTXA 2OYQA 4PQUA 2BGGA 4OVLA 1C1CA 1I39A 4E89A 1IKXA 5CZ1A 2R7YA 1RNHA 3LP0A 3OJSA 1VRTA 2X78A 1QQCA 3IRXA 1LW2A 4BDZA 1T03A 2Y1JA 1N6QA 2PZSA 4FCYA 2DTUA 1I3AA 3HM9A 3QNOA 3QEIA 4OPJA 3S3NA 3TAGA 1NOYA 1O1WA 2XHBA 5JS1A 2P5GA 3OYKA 5CYMA 3F73A 3SZ2A 1GOAA 3PO4A 2ITGA 1NK6A 1KTQA 2Y1IA 4F3TA 4O0JA 4EZ9A 3TABA 4Z4CA 3NH1A 4FLXA 2QKBA 3HVRA 2IAJA 4BE0A 1UOCA 2XY8A 4RG8A 1X1PA 3ULDA 4KHSA 3HXMA 3DLHA 4DWIA 1EKEA 1D9DA 2YKNA 2G8UA 3AVGA 1HPZA 3OS1A 4FLUA 4B9NA 4F2RA 4B9UA 1UWBA 4NCBA 4YNQA 3B6OA 3ZT1A 4KHYA 1CXUA 3EY1A 2HNDA 1B9DA 4DU4A 2OPSA 5HROA 4I2QA 3TAQA 2XY6A 3PO5A 3QEPA 1TK8A 1KVAA 3OYCA 5J2QA 4FLZA 4FLWA 4FJHA 4DSEA 4F2SA 4DQQA 4DTSA 1L3TA 3BDPA 1NJXA 2ATQA 4FYDA 4CHOA 3RMAA 1CLQA 1S5JA 1BISA 3RMCA 1W0HA 5C25A 3M8SA 3DLEA 4DF4A 1QSLA 4QCLA 1QHTA 3QEXA 2FBTA 3V1QA 3TAFA 4E7JA 4E0DA 1BIZA 3I0RA 3FFIA 1RDBA 1JKHA 1NK4A 4FLYA 4BACA 3CM6A 4FJ7A 1RBTA 4AHUA 2IOCA 3HPOA 1JLBA 3SPZA 3L2VA 3UIQA 3QNNA 4BE2A 1TL3A 1BL3A 1RDDA 1TK5A 1VSIA 3ALYA 3QLHA 3VQDA 1ZBLA 4F3OA 1KCFA 3NF8A 3L2QA 2D5RA 2VG6A 3AVHA 3ZSVA 3SCXA 3OYHA 4CEAA 1HMVA 3AVAA 3IS9A 1U4BA 4CEDA 3NHGA 1C0UA 4KB1A 3HVTA 5HRNA 3L2RA 4N76A 2BANA 3S9HA 1VK0A 1HQEA 4UQGA 1KLNA 3OVNA 1HNIA 4E7KA 3AA3A 3TAMA 4Y1DA 3WNEA 4BDYA 4J2DA 4B9MA 3TAPA 2KTQA 1T05A 1L3VA 1S6PA 4CJFA 4Y1CA 3LWMA 4JS5A 2JLEA 1VSDA 3CQ8A 3WNGA 3TARA 3ZSWA 2BE2A 3CFRA 1RT3A 3T19A 4DF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNF A;  4H4O A;  1DTT A;  1VSK A;  4AHV A;  4CER A;  2G8K A;  4O0I A;  3SUN A;  2AJQ A;  2WOM A;  4HCB A;  2KZZ A;  2RN2 A;  4DLE A;  4EZ6 A;  5J2P A;  4FJN A;  1NK5 A;  2YNG A;  2B4J A;  4W5Q A;  4ZHR A;  3M8R A;  1TAU A;  1S9G A;  4KHQ A;  4CK1 A;  2FBY A;  2OA8 A;  3K57 A;  3SUO A;  4L8R B;  2ZE2 A;  4N56 A;  2O4I A;  3D45 A;  4H4M A;  3LPU A;  2G8H A;  3VQP A;  4FJI A;  4AH9 A;  4CEQ A;  4I2P A;  1C1A A;  1JLE A;  2PYL A;  4M3W A;  4EP5 A;  4CIE A;  3MXJ A;  4R5P A;  1NKC A;  3LAK A;  2X6N A;  4J2A A;  3V81 A;  3AA2 A;  4Z4E A;  1S1W A;  1DTQ A;  2Z1J A;  2VWK A;  3HP9 A;  4IKF A;  2EHG A;  3LAL A;  4E7L A;  3E01 A;  3NGZ A;  1U47 A;  3ASM A;  3NGY A;  5J1E A;  2P1J A;  3HPG A;  4CJQ A;  2RKI A;  2XRI A;  3VQ9 A;  5KTQ A;  3AO1 A;  3KTQ A;  3RR8 A;  2IGI A;  1U48 A;  1BCO A;  4FJJ A;  2HHX A;  3VA3 A;  1Z26 A;  1IG9 A;  2VG7 A;  4W5T A;  4RW6 A;  4KB0 A;  4CEF A;  1VRU A;  1RDC A;  1VSF A;  4CK2 A;  4IG3 A;  4OJR A;  1WN7 A;  3QES A;  2HHV A;  3AO5 A;  4DG1 A;  5I42 A;  4DU3 A;  3NDK A;  1JXE A;  4CGG A;  4ELV A;  4HUE A;  4CES A;  2G8F A;  5C24 A;  4CEB A;  4TSX A;  1TK0 A;  3AVM A;  1XC9 A;  1X9W A;  1C0M A;  1KLM A;  1LW0 A;  1BI4 B;  1C6V A;  1S1X A;  3AVI A;  3LP1 A;  1L3S A;  1SV5 A;  4C8M A;  2FC0 A;  1X9S A;  1HYV A;  3I0S A;  4I7F A;  3PX4 A;  1U49 A;  3HJF A;  5KRT A;  2KFZ A;  4E1M A;  3RMD A;  3DLB A;  4DTM A;  1LWF A;  4FJM A;  2VG5 A;  3NF9 A;  4DQR A;  1RBS A;  3DRP A;  3QEW A;  1J5O A;  1FKO A;  1ZBF A;  5CZ2 A;  4B9L A;  1Q9Y A;  2G8I A;  2Z1I A;  4HUF A;  4FZX C;  4B9T A;  4W5O A;  2YNF A;  3HP6 A;  4QOZ B;  1G15 A;  1GOB A;  2HNY A;  4B8A B;  4CFB A;  1IKW A;  2P51 A;  3HPH A;  4AHT A;  4M3R A;  3O3F A;  4M3X A;  1A5V A;  4FW2 A;  3KK2 A;  1S1U A;  1WAF A;  1RCH A;  3LDS A;  3HO1 A;  1EET A;  3TR8 A;  1WSE A;  4LH5 A;  4I9L A;  4NYF A;  4CJ5 A;  4AIL C;  4F8R A;  3C95 A;  1TKZ A;  3AO3 A;  3NF7 A;  3NFA A;  1XHX A;  4KKO A;  1RBU A;  4PA1 A;  3QIN A;  2GBZ A;  2YHB A;  5KGX A;  2HHU A;  4NCA A;  4B8C A;  4CJV A;  3ZSZ A;  4M3T A;  3ISN C;  4CEZ A;  1LV5 A;  1FK9 A;  1BGX T;  2BDP A;  2FBX A;  4CHZ A;  2FBV A;  4DQP A;  2HB5 A;  4CGI A;  1T8E A;  3K5N A;  1CZB A;  3OYL A;  5CYQ A;  3DM2 A;  3AO4 A;  3DRS A;  3AVB A;  4CJK A;  1D9F A;  4WE1 A;  4CJ4 A;  4CCH A;  4M42 A;  4CGJ A;  1BHL A;  3HL8 A;  2W42 A;  5HRP A;  4DTP A;  4KPY A;  4FLT A;  4DFM A;  4IBN A;  2OZM A;  3KKS A;  5T7B A;  4CJ3 A;  1WLJ A;  3QIO A;  4FJL A;  3AVC A;  4RW4 A;  2YNH A;  3VQ6 A;  3SQ4 A;  1LAV A;  1ZBU A;  1QE1 A;  2G8W A;  1TKT A;  2YKM A;  2RF2 A;  1RT7 A;  3O4N A;  4OLA A;  2O4G A;  4GW6 A;  2GUI A;  4RW7 A;  4CJR A;  1TKX A;  1CZ9 A;  4LY7 A;  2KQ2 A;  4DSK A;  1BQN A;  3K5L A;  3VQA A;  1TL1 A;  4OPK A;  3DLR A;  3MEE A;  1SUQ A;  4CFC A;  3QET A;  4CFD A;  5C42 A;  2G8V A;  1JLG A;  1R0A A;  5FRN A;  1IKV A;  1JXB A;  4CHN A;  3P1G A;  3F9K A;  3LZJ A;  1WAJ A;  1ITG A;  2NUB A;  1S6Q A;  3G0Z A;  4O55 A;  3LAN A;  1KRP A;  4Q0B A;  4H8K A;  3S3O A;  3ZT2 A;  1VSJ A;  4FK2 A;  4KI6 A;  4DS5 A;  2QXF A;  4KTZ A;  4FJ9 A;  1KVB A;  2Q3S A;  4PWD A;  4E7H A;  3LP2 A;  3OYM A;  3PX6 A;  1WSI A;  3KKR A;  2HVI A;  4W5R A;  3L2U A;  4LSN A;  3SQ1 A;  4C8L A;  4CEC A;  3KJV A;  2A1R A;  1NJZ A;  3RWU A;  1VSM A;  4DTU A;  3KLH A;  4DSL A;  4O44 A;  4MQ3 A;  2Z1H A;  4CIG A;  4KO0 A;  1D8Y A;  1QSY A;  1KFS A;  1FXX A;  2IC3 A;  3DLK A;  4FW1 A;  5K14 A;  4E1N A;  4Z4H A;  3NF6 A;  5JS2 A;  3HYF A;  1HYS A;  4AHS A;  3KLE A;  3KD1 E;  2HHS A;  3VQB A;  4KI4 A;  3U3G A;  5HLF A;  3LPT A;  1B92 A;  1JLQ A;  5SZT A;  3TWH A;  4FM2 A;  4DQS A;  4CJS A;  1D5A A;  4M41 A;  3SI6 A;  5CY4 A;  1BIU A;  3RRH A;  2QKK A;  4Z4G A;  3OYE A;  3C6T A;  4JRP A;  1S1T A;  4F4K A;  1IO2 A;  1GOC A;  5DK5 A;  2KW4 A;  1RT6 A;  3V9S A;  1BCM A;  3DMJ A;  3NBP A;  3LWL A;  4AHR A;  1KVC A;  3QER A;  3O3G A;  2KZM A;  1EXQ A;  1ZBI A;  3AVJ A;  3O4Q A;  4LSL A;  2ZD1 A;  4NCG A;  4AHC A;  4CGF A;  3HT3 A;  4DS4 A;  4DTO A;  1NK0 A;  1A5W A;  4ICL A;  4ZTF A;  4B3O A;  3P5J A;  1RBV A;  3MXI A;  3PV8 A;  1QTM A;  4O5B A;  1HJR A;  2XO7 A;  1C0T A;  1FKP A;  3SYZ A;  3OYG A;  3LAM A;  1QSS A;  3V4I A;  3L2W A;  3DOK A;  5J2M A;  3CM5 A;  1KFD A;  1Q8I A;  3WNH A;  4GVM A;  4DU1 A;  1HYZ A;  1RT1 A;  2XY7 A;  3VQE A;  4OGC A;  4CJW A;  2VWJ A;  1WNS A;  3NE6 A;  4FJG A;  3PX0 A;  4Z4F A;  3QEV A;  4E7I A;  4FZY A;  1Q9X A;  3V9X A;  4KV8 A;  2E6L A;  4CF8 A;  4FK4 A;  2B6A A;  1UA1 A;  4PY5 A;  2HHW A;  4LD0 A;  3OYN A;  4DFP A;  4OGE A;  3OYJ A;  1RTD A;  4C8N A;  3VQ7 A;  3M8Q A;  1UA0 A;  3DRR A;  3VQQ A;  3NH0 A;  4HTU A;  4FJ8 A;  1JLC A;  4BWJ A;  5J2N A;  2D0B A;  3EYZ A;  4IDK A;  3U6F A;  3DLG A;  2QK9 A;  1BI4 A;  3C94 A;  5FRO A;  3OS2 A;  3V9W A;  3OYB A;  3VQC A;  2XY5 A;  1YT3 A;  3SV3 A;  3AO2 A;  1NK9 A;  3KK1 A;  1CXQ A;  1LWE A;  2Z1G A;  4DQI A;  4M3Y A;  4JLH A;  3VQ5 A;  2X74 A;  3AVN A;  4Z0U A;  4CIF A;  3ZSO A;  5HBM A;  1ASV A;  1RT5 A;  1NKE A;  1SKR A;  4BE1 A;  4C8O A;  3AA5 X;  4CF9 A;  1J53 A;  4CHQ A;  4KHW A;  4KTW A;  4FZZ A;  1J54 A;  4HCC A;  4I9Q A;  3KIO A;  2ETJ A;  5KI6 A;  3SQ0 A;  1JL1 A;  3CG7 A;  4YFU A;  4RW8 A;  5FDL A;  4N41 A;  3EZ5 A;  4G1Q A;  2E6M A;  2DFF A;  1RTI A;  3V9Z A;  1N5Y A;  4CJP A;  4DFK A;  1QS4 A;  2ZQB A;  1WSH A;  3NH2 A;  1HQU A;  1NOZ A;  4FVM A;  3IG1 A;  4OKE A;  2A1S A;  3CFP A;  3AVF A;  3ZCM A;  4KFB A;  3VQ8 A;  2D0A A;  4CE9 A;  4J2E A;  4IG0 A;  4CJE A;  4CF0 A;  1YTU A;  5EU7 A;  2LSN A;  3ZSR A;  1MU2 A;  4CF2 A;  1LAW A;  5SWM A;  3OYF A;  3KD5 E;  3SPY A;  4E3S A;  4HUG A;  1JLF A;  1TKD A;  1ASW A;  2PY5 A;  3V1R A;  1L3U A;  5HP1 A;  2I5J A;  1VSE A;  4OKK A;  4FLV A;  4FJX A;  2HHQ A;  4N47 A;  3MED A;  1RIL A;  2E4L A;  3A2F A;  4N5S A;  3OYA A;  4DLG A;  3ZSQ A;  3RMB A;  3K2P A;  4CEO A;  5HRR A;  3S3M A;  4KTQ A;  3PUF A;  4E19 A;  1X9M A;  3ZSY A;  4K8Z A;  2DFE A;  3ITH A;  1EX4 A;  3OY9 A;  4OKJ A;  5HRS A;  1K6Y A;  3RTV A;  3V9U A;  1SKW A;  1Y97 A;  4M3Z A;  3TAE A;  1TV6 A;  3QIP A;  4CJL A;  4M3U A;  3K59 A;  4FK0 A;  4DSJ A;  1JL2 A;  4J2B A;  4PUO A;  1JLA A;  1B9F A;  1TVR A;  3AA4 A;  3OYD A;  4FM0 A;  4JRQ A;  1S9E A;  4KRF A;  4ID1 A;  3SJJ A;  4FXD A;  4RW9 A;  2HVH A;  4ID5 A;  1WSF A;  2YHA A;  3KLF A;  1RDA A;  5KRS A;  3K5O A;  1NJY A;  4CGH A;  4DTJ A;  1ZYQ A;  1EP4 A;  2OPP A;  4EP4 A;  4QAG A;  5E41 A;  1HRH A;  2F8T A;  2DY4 A;  3NGI A;  1HNV A;  3JYT A;  1SL1 A;  2EX3 A;  4HVJ A;  4C8K A;  2F8S A;  3HK2 A;  3V1O A;  4ELU A;  4BDP A;  4B08 A;  3LP3 A;  3THV A;  2B5J A;  3RR7 A;  2JGU A;  2RPI A;  3H08 A;  3O3H A;  1VSL A;  2IS3 A;  4IFV A;  3ZT0 A;  3K58 A;  2PYJ A;  3IAY A;  1ZBH A;  3CYM A;  4K8X A;  4O4G A;  4B9S A;  2KFN A;  3AVK A;  1RTJ A;  3SUQ A;  3ZSX A;  1RBR A;  1J9A A;  1VSH A;  2OPQ A;  3C6U A;  3SNN A;  2OZS A;  4DSF A;  4DFJ A;  1BQM A;  1LWC A;  1DLO A;  4Q5V A;  3K5M A;  3VQ4 A;  3V6D A;  4KHU A;  4W5N A;  4CHP A;  4KRE A;  4CF1 A;  3B6P A;  3T1A A;  1Z25 A;  4CK3 A;  4CJU A;  3LZI A;  3HST B;  3JSM A;  3VA0 A;  4KHN A;  3AV9 A;  1L5U A;  2HHT A;  4CFA A;  1NK8 A;  3BGR A;  3ZT3 A;  4ELT A;  3RRG A;  1U45 A;  1TGO A;  3TI0 A;  1U04 A;  1YTA A;  1XHZ A;  4DTR A;  4HHT A;  1T7P A;  3NAE A;  3I8D A;  5I3U A;  3TAN A;  1SL2 A;  3OS0 A;  2D0C A;  3L3U A;  1UAX A;  1YVU A;  1SKS A;  3MEC A;  2HMI A;  5FRM A;  3DI6 A;  3QO9 A;  1NK7 A;  4ZTJ A;  5DMR A;  3MEG A;  3P83 D;  4BWM A;  3ZT4 A;  2YNI A;  4FJK A;  3DOL A;  1A5X A;  1IH7 A;  1WSJ A;  2GV9 A;  2IDO A;  3KK3 A;  4M45 A;  2F96 A;  4XIU A;  2HNZ A;  4CHY A;  3KLI A;  4LH4 A;  1WSG A;  4NYN A;  1ASU A;  1REV A;  3G10 A;  1XWL A;  4DMN A;  3OJU A;  3MAQ A;  3L8B A;  3T3F A;  4DSI A;  4KAZ A;  4Z4I A;  3VN5 A;  1F21 A;  3L3V A;  4CEE A;  5KGW A;  4CJT A;  3OYI A;  3MXM A;  4IFY A;  1NKB A;  5D3G A;  1SL0 A;  4B9V A;  3PY8 A;  2X6S A;  1IKY A;  4JS4 A;  3SQ2 A;  1TAQ A;  1RT2 A;  4OLB A;  1NJW A;  4FM1 A;  3M8P A;  2P5O A;  1S1V A;  3DYA A;  1W9H A;  3NCI A;  3D0P A;  2OPR A;  3U3Y A;  1XI1 A;  4GMJ B;  4FJ5 A;  1KSP A;  1RTH A;  2DFH A;  4CGD A;  2YV0 X;  2HW3 A;  1RT4 A;  3SUP A;  1C1B A;  3SV4 A;  4DTN A;  2WON A;  4MFB A;  3KLG A;  3AVL A;  3CFO A;  4DTX A;  2OYQ A;  4PQU A;  2BGG A;  4OVL A;  1C1C A;  1I39 A;  4E89 A;  1IKX A;  5CZ1 A;  2R7Y A;  1RNH A;  3LP0 A;  3OJS A;  1VRT A;  2X78 A;  1QQC A;  3IRX A;  1LW2 A;  4BDZ A;  1T03 A;  2Y1J A;  1N6Q A;  2PZS A;  4FCY A;  2DTU A;  1I3A A;  3HM9 A;  3QNO A;  3QEI A;  4OPJ A;  3S3N A;  3TAG A;  1NOY A;  1O1W A;  2XHB A;  5JS1 A;  2P5G A;  3OYK A;  5CYM A;  3F73 A;  3SZ2 A;  1GOA A;  3PO4 A;  2ITG A;  1NK6 A;  1KTQ A;  2Y1I A;  4F3T A;  4O0J A;  4EZ9 A;  3TAB A;  4Z4C A;  3NH1 A;  4FLX A;  2QKB A;  3HVR A;  2IAJ A;  4BE0 A;  1UOC A;  2XY8 A;  4RG8 A;  1X1P A;  3ULD A;  4KHS A;  3HXM A;  3DLH A;  4DWI A;  1EKE A;  1D9D A;  2YKN A;  2G8U A;  3AVG A;  1HPZ A;  3OS1 A;  4FLU A;  4B9N A;  4F2R A;  4B9U A;  1UWB A;  4NCB A;  4YNQ A;  3B6O A;  3ZT1 A;  4KHY A;  1CXU A;  3EY1 A;  2HND A;  1B9D A;  4DU4 A;  2OPS A;  5HRO A;  4I2Q A;  3TAQ A;  2XY6 A;  3PO5 A;  3QEP A;  1TK8 A;  1KVA A;  3OYC A;  5J2Q A;  4FLZ A;  4FLW A;  4FJH A;  4DSE A;  4F2S A;  4DQQ A;  4DTS A;  1L3T A;  3BDP A;  1NJX A;  2ATQ A;  4FYD A;  4CHO A;  3RMA A;  1CLQ A;  1S5J A;  1BIS A;  3RMC A;  1W0H A;  5C25 A;  3M8S A;  3DLE A;  4DF4 A;  1QSL A;  4QCL A;  1QHT A;  3QEX A;  2FBT A;  3V1Q A;  3TAF A;  4E7J A;  4E0D A;  1BIZ A;  3I0R A;  3FFI A;  1RDB A;  1JKH A;  1NK4 A;  4FLY A;  4BAC A;  3CM6 A;  4FJ7 A;  1RBT A;  4AHU A;  2IOC A;  3HPO A;  1JLB A;  3SPZ A;  3L2V A;  3UIQ A;  3QNN A;  4BE2 A;  1TL3 A;  1BL3 A;  1RDD A;  1TK5 A;  1VSI A;  3ALY A;  3QLH A;  3VQD A;  1ZBL A;  4F3O A;  1KCF A;  3NF8 A;  3L2Q A;  2D5R A;  2VG6 A;  3AVH A;  3ZSV A;  3SCX A;  3OYH A;  4CEA A;  1HMV A;  3AVA A;  3IS9 A;  1U4B A;  4CED A;  3NHG A;  1C0U A;  4KB1 A;  3HVT A;  5HRN A;  3L2R A;  4N76 A;  2BAN A;  3S9H A;  1VK0 A;  1HQE A;  4UQG A;  1KLN A;  3OVN A;  1HNI A;  4E7K A;  3AA3 A;  3TAM A;  4Y1D A;  3WNE A;  4BDY A;  4J2D A;  4B9M A;  3TAP A;  2KTQ A;  1T05 A;  1L3V A;  1S6P A;  4CJF A;  4Y1C A;  3LWM A;  4JS5 A;  2JLE A;  1VSD A;  3CQ8 A;  3WNG A;  3TAR A;  3ZSW A;  2BE2 A;  3CFR A;  1RT3 A;  3T19 A;  4DF8 A; 
#chains in the Genus database with same CATH topology
 3WEE A;  3WNF A;  3VER A;  4H4O A;  1DTT A;  4KH4 A;  2IVN A;  4O0I A;  3CJ1 A;  4DLE A;  1VQN N;  3VF6 A;  2YNG A;  4W5Q A;  3M8R A;  2OA8 A;  2V51 B;  3C6A A;  3K57 A;  2O4I A;  4FOE A;  4H4M A;  3RVC A;  3QIC A;  4CZL A;  3VQP A;  4EAH D;  4FSV A;  4YDU C;  4CIE A;  2X6N A;  4Z4E A;  4B1U B;  3SAF A;  3CF5 L;  2CH5 A;  1DTQ A;  3CHW A;  3MCA B;  5FLX O;  1QQM A;  1S22 A;  4EIA A;  4B1Y B;  4E7L A;  3HPG A;  2A5X A;  3KTQ A;  1U48 A;  5ELZ A;  3VEN A;  3T1Y K;  2O8F A;  4W5T A;  2E2P A;  1VRU A;  4O5F A;  1KAY A;  4CK2 A;  4IG3 A;  3EKU A;  3KWG A;  4BRE A;  3U8X A;  4TSX A;  1TK0 A;  1X9W A;  1XC9 A;  1KLM A;  3KWI A;  3AVI A;  1L3S A;  2PFU A;  4CZG A;  4JAX A;  3PX4 A;  2KFZ A;  5KRT A;  5AJ3 K;  4JI7 K;  5AQM A;  4DQR A;  4JI2 K;  1J5O A;  1FKO A;  4M63 C;  1Q9Y A;  3A5N C;  3L0Q A;  5EX5 A;  4AF1 A;  4BRH A;  1G15 A;  4PL8 A;  1GOB A;  3FZH A;  3DXM B;  4B8A B;  3JAM O;  4A61 A;  1ZBS A;  2E2O A;  3H3N O;  1WAF A;  1RCH A;  4MO5 A;  4BQL A;  1K9M O;  4CJ5 A;  4WFN L;  3C95 A;  2P9S B;  3NFA A;  1XHX A;  3BF3 A;  3QIN A;  2GBZ A;  2YHB A;  5KGX A;  4NCA A;  4B8C A;  4M3T A;  3ZSZ A;  4IDH A;  1LV5 A;  1BGX T;  2BDP A;  4FL9 A;  4DV1 K;  1CZB A;  3DM2 A;  3CCL N;  3ZEU B;  4CJ4 A;  1HKG A;  2UXD K;  4FLT A;  2OZM A;  5BRE A;  4BGB A;  2HMP A;  1BDG A;  4CBW A;  2GTD A;  4A2A A;  4FJL A;  2YNH A;  4DR7 K;  4LF8 K;  3DLL L;  1ZBU A;  1U2V B;  2O4G A;  4GW6 A;  4RW7 A;  1BQN A;  3DJC A;  3K5L A;  1TL1 A;  3DLR A;  3QET A;  4CFC A;  4CFD A;  1NGI A;  1NGG A;  4H0T B;  4DQ8 A;  4O55 A;  2NUB A;  1KRP A;  4B3T K;  2WC9 A;  4H8K A;  1KVB A;  3J7A P;  4FPA A;  4DR4 K;  1N8R O;  4C8L A;  1MDU B;  1VSM A;  3KLH A;  1GLB G;  1EQY A;  4O44 A;  1QHA A;  4EHU A;  4RTF D;  5BR9 A;  1QSY A;  2AP1 A;  1FXX A;  2IC3 A;  3DLK A;  5K14 A;  4CZE A;  4E1N A;  3NF6 A;  4Z4H A;  1H1V A;  5JS2 A;  4QS9 A;  4AHS A;  2HHS A;  1P90 A;  3U3G A;  5SZT A;  4DQS A;  2BUP A;  4CJ7 A;  3R3L A;  2FLO A;  1GOC A;  2Q97 A;  1BCM A;  1NWK A;  3NBP A;  3LWL A;  1DEJ A;  4A62 A;  1QVG M;  3QER A;  3L4Q A;  4AHC A;  3FZK A;  3O8M A;  3VEV A;  4BC4 A;  1A5W A;  3P5J A;  1XMQ K;  3QML A;  4O5B A;  1HJR A;  4O8U A;  1C0T A;  3MN9 A;  3LAM A;  3CM5 A;  1Q8I A;  4DU1 A;  1RT1 A;  5F2R A;  2VWJ A;  4NO7 A;  4FZY A;  2OTL N;  2E6L A;  4CF8 A;  4PY5 A;  1NGA A;  3OYN A;  4OGE A;  3VGK A;  3OYJ A;  4DV0 K;  3M8Q A;  1UA0 A;  3DRR A;  3VQQ A;  4FJ8 A;  5LJV A;  4WF9 L;  5J2N A;  3EYZ A;  1NGB A;  1BI4 A;  2XY5 A;  1YT3 A;  1NK9 A;  3KK1 A;  1GLE G;  4BGA A;  2X74 A;  3WQU A;  3AVN A;  5AQY A;  3ZSO A;  3W3D A;  4BR7 A;  2P9U B;  3ENO A;  2A3Z A;  5HBM A;  3CQY A;  3TU5 A;  4CF9 A;  2J4R A;  3SQ0 A;  1JL1 A;  3CG7 A;  4YFU A;  4RW8 A;  3QBW A;  2D0P A;  2DFF A;  1RTI A;  4BC5 A;  4DFK A;  2ZQB A;  3ZCM A;  4B1W B;  5C2D A;  1NU0 A;  4IG0 A;  2QM1 A;  4U7B A;  5AQU A;  4RWT A;  3L4I A;  4CF2 A;  4A57 A;  5SWM A;  1TKD A;  1ASW A;  5KQ8 A;  1YUW A;  2PY5 A;  2I5J A;  1TYQ B;  4OKK A;  4FLV A;  1FJG K;  3MED A;  1RIL A;  3ZX3 A;  1NGC A;  3K2P A;  4CEO A;  3S3M A;  3PUF A;  4E19 A;  4AQY K;  1EX4 A;  1N33 K;  3BZC A;  5AQI A;  3TAE A;  1NMN A;  3VTI A;  3QIP A;  4JI8 K;  3K59 A;  1BO5 O;  3HOT A;  4FK0 A;  1JL2 A;  3A8Y A;  3U9D A;  3HOS A;  1QQO A;  1B9F A;  3AA4 A;  3OYD A;  2P9N B;  4ID1 A;  3SJJ A;  2HVH A;  2YHY A;  1WSF A;  4DTJ A;  1KAX A;  4GKK K;  3GE1 A;  3NGI A;  1HNV A;  3RSE A;  1SL1 A;  3R9P A;  4C8K A;  4LFA K;  3M1F A;  4ELU A;  4BDP A;  4B08 A;  3O3H A;  2PYJ A;  1VSL A;  4IFV A;  3U9Z A;  2YJE A;  4O4G A;  1RTJ A;  3ENB A;  3SUQ A;  1RBR A;  3BEX A;  2OZS A;  3WEE B;  4DFJ A;  1DLO A;  4Q5V A;  3Q7B A;  1N32 K;  3D2E A;  4CF1 A;  3E9O A;  4K41 A;  4OO1 J;  2QWN A;  1VQ9 N;  3RRG A;  3PLA A;  2EWS A;  1XHZ A;  4YOW A;  3K0S A;  4HHT A;  1SL2 A;  3OS0 A;  1UAX A;  1SKS A;  5FRM A;  3JXU A;  5DMR A;  3MEG A;  3ZT4 A;  3I33 A;  3DOL A;  1IH7 A;  2GV9 A;  3KK3 A;  4CD1 A;  2F96 A;  4BQZ A;  1VQK N;  2HNZ A;  4JEP A;  3LL3 A;  1XWL A;  4DMN A;  3L8B A;  5AQW A;  4K0K K;  5AQN A;  4CJT A;  1NKB A;  4B9V A;  4FM1 A;  1SZ2 A;  2P5O A;  1S1V A;  1IBL K;  1XC3 A;  3D0P A;  3U3Y A;  1HX1 A;  5BPM A;  2OYQ A;  5AQT A;  1C1C A;  4BDZ A;  5AQJ A;  2PZS A;  3VMF B;  5JMV A;  3K9K A;  4WQ4 A;  3NVK A;  2P9K A;  5CYM A;  1KTQ A;  4F3T A;  4Z4C A;  4FLX A;  2YX6 A;  3HVR A;  5B8H A;  1UOC A;  2XY8 A;  3ULD A;  1I94 K;  4JKE A;  4B9Q A;  4KHS A;  3HXM A;  2P9I A;  3WXI A;  1EKE A;  2G8U A;  4JI0 K;  3AVG A;  4FLU A;  1UWB A;  2ZGZ A;  2RE2 A;  1T3V A;  5M1N A;  4NCB A;  2ZJR L;  4B3R K;  3B6O A;  3EY1 A;  4BVO A;  4JI4 K;  1VQM N;  2XY6 A;  1MWM A;  4FLW A;  3P4I A;  1TUU A;  4DQQ A;  1NJX A;  1JJ2 M;  1SQK A;  4MLH A;  1BIS A;  2WUS A;  1QSL A;  3MWT A;  3CJ9 A;  3TAF A;  3OW2 M;  4DV6 K;  5FPM A;  1JKH A;  5EVZ A;  1W2B M;  4BR2 A;  4FJ7 A;  1RBT A;  2UUA K;  2IOC A;  4BE2 A;  1TK5 A;  3UE5 A;  1ZBL A;  3VES A;  2D5R A;  4ILG B;  3AVA A;  3F5T A;  2E2N A;  1C0U A;  2FSK A;  3HVT A;  1NNE A;  2BAN A;  4BRA A;  4FWL A;  3S9H A;  4UQG A;  1XNQ K;  4E7K A;  3WNE A;  1SS6 A;  4BDY A;  4J2D A;  2P9P A;  4B9M A;  3TAP A;  1T05 A;  4NLB A;  1S6P A;  5GIN A;  3FR0 A;  1Q82 O;  3LWM A;  3ZSW A;  1RT3 A;  5DM7 L;  4CER A;  3G71 N;  3F9M A;  2G8K A;  3CI5 A;  2ITM A;  3WXK A;  4JV5 K;  4LF6 K;  4WYB A;  1TAU A;  4KHQ A;  1IG8 A;  1QQN A;  1OH6 A;  4DR3 K;  4CVN E;  2FF3 B;  4DUY K;  4LF9 K;  2QI2 A;  4M7Y A;  2PYL A;  3G6E N;  2YI1 A;  2UUB K;  1NKC A;  1YAG A;  3AA2 A;  4X62 K;  2VWK A;  1VQL N;  4IKF A;  3ASM A;  3NGY A;  3AAP A;  3VQ9 A;  3RR8 A;  3P31 A;  3AO1 A;  1VQ8 N;  3VEZ A;  1Z26 A;  2VG7 A;  4RW6 A;  3IKM A;  5FPN A;  3ATV A;  1RDC A;  4DCH A;  1WN7 A;  2NRH A;  3NDK A;  4ELV A;  3SMS A;  4YOV A;  4HUE A;  5C24 A;  4CEB A;  2IVP A;  1CZA N;  1BI4 B;  1C6V A;  1S1X A;  5A2Q O;  2Q0U A;  3HZ6 A;  5M1O A;  5BRF A;  1HYV A;  3HJF A;  4BR5 A;  4DTM A;  1OH5 A;  3NF9 A;  2GEL A;  2W41 A;  4EFH A;  1IBK K;  3DRP A;  1ZBF A;  4B9L A;  4HUF A;  1X3M A;  3VEW A;  4B9T A;  4W5O A;  3HP6 A;  2W6K A;  4QOZ B;  3FE1 A;  2HNY A;  2O8E A;  1IKW A;  3O3F A;  2PAV A;  4M3X A;  3KK2 A;  2WBN A;  3LDS A;  1MA9 B;  1EET A;  3O08 A;  4NYF A;  1HJO A;  1TKZ A;  3EZW A;  4PA1 A;  5E84 A;  3CCJ N;  4FWO A;  3FGU A;  3N4P A;  4CEZ A;  2O8C A;  3AY9 A;  4CGI A;  3HSC A;  3T1H K;  4IOX A;  3AVB A;  3P38 A;  4M42 A;  1BHL A;  2D1K A;  5HRP A;  4FWQ A;  3M6G A;  4IBN A;  3KKS A;  2A6A A;  1VQ4 N;  4YDU A;  4RW4 A;  4K42 A;  4GV9 A;  2G8W A;  2RF2 A;  3O4N A;  1ESV A;  4OLA A;  3MX5 A;  3WXL A;  4CJR A;  3CCM N;  2ZGY A;  2KQ2 A;  5AQG A;  4OPK A;  3MEE A;  4V19 S;  2G8V A;  1R0A A;  1IKV A;  1JXB A;  3F9K A;  4Q0B A;  3LAN A;  5AFU H;  3EKS A;  4PWD A;  4LSN A;  3SQ1 A;  4CEC A;  1NJZ A;  3RSE B;  5I9E B;  3RWU A;  4DTU A;  3H1V X;  2Z1H A;  4CIG A;  1ZC6 A;  5IT9 O;  4FW1 A;  3CCV N;  3HYF A;  1ILY A;  4H03 B;  3H46 O;  3GDQ A;  3CPW M;  5HLF A;  1EWQ A;  1D5A A;  4L3Q A;  1KD1 O;  5CY4 A;  1BIU A;  2QWQ A;  3OYE A;  1S1T A;  1IO2 A;  4IOA L;  1KQS M;  4H0Y B;  5DK5 A;  1RT6 A;  3D2E B;  3V9S A;  3TSU A;  3D2F A;  4KH5 A;  1IBM K;  3O3G A;  2KZM A;  3SAH A;  3AVJ A;  3O4Q A;  4LSL A;  4A2B A;  4DS4 A;  1C0F A;  4DTO A;  4ZTF A;  1RBV A;  2PBD A;  5JIC A;  5MLC Q;  3MXI A;  1QTM A;  2XO7 A;  1VQP N;  5J2M A;  1KFD A;  3CMA N;  3WNH A;  4GVM A;  4OGC A;  5GAH P;  1WNS A;  3OHR A;  5CR4 A;  3PX0 A;  4AM7 A;  4FWP A;  3V9X A;  1Q9X A;  2B6A A;  1UA1 A;  3C6H A;  1K8K A;  1YVN A;  1JLC A;  3U6F A;  4IDK A;  2QK9 A;  1XUP O;  3O5B A;  1V4S A;  1CXQ A;  1LWE A;  4M3Y A;  5IWA K;  4Z0U A;  3R8E A;  4CIF A;  3BP8 A;  1SKR A;  1NKE A;  4C8O A;  1J53 A;  2FSJ A;  4KHW A;  4KTW A;  1J54 A;  3CCR N;  4HCC A;  4FPB A;  5KI6 A;  1SAZ A;  5EXW A;  3FZF A;  5JLF A;  5FDL A;  1N5Y A;  5HL7 L;  1WSH A;  1HQU A;  1NOZ A;  4FVM A;  3IG1 A;  4GKJ K;  4JN4 A;  3CCU N;  2D0A A;  4CE9 A;  4CW7 B;  2P9I B;  4O8K A;  2LSN A;  5C0Y A;  4DV2 K;  3KD5 E;  3WT0 A;  4E3S A;  1JLF A;  3HBT A;  1HNW K;  5HP1 A;  2OAN A;  2HHQ A;  1VSE A;  2NRV A;  3A2F A;  3ZSQ A;  3RMB A;  5HRR A;  1X9M A;  3ITH A;  1Y64 A;  1R59 O;  1BOT O;  5HRS A;  3RTV A;  2HF3 A;  4M3Z A;  4CJL A;  4DSJ A;  4CZK A;  1TVR A;  5EOY A;  4KRF A;  4C1N K;  4JKA A;  4R79 A;  4JI5 K;  3JS6 A;  4IJN A;  1DGK N;  2DY4 A;  4HVJ A;  4QS8 A;  3CC7 N;  3V1O A;  2YHW A;  2B5J A;  5AR0 A;  2JGU A;  2RPI A;  3K58 A;  3ZT0 A;  1RFQ A;  3CYM A;  4MO4 A;  2P9P B;  4K8X A;  2O8B A;  1VQO N;  4B9S A;  3AVK A;  1BG3 A;  2E20 A;  4I6M A;  3SMP A;  3SNN A;  4DSF A;  3K5M A;  3V6D A;  3CPE A;  1WBB A;  4BRG A;  4CK3 A;  3HST B;  2VWB A;  4CFA A;  3CC4 N;  1TGO A;  3CJ7 A;  1T7P A;  1VAZ A;  5I3U A;  3L3U A;  2YJF A;  5AZJ B;  1YIJ N;  3MEC A;  1NMD A;  3HI0 A;  1BWF O;  3QO9 A;  4PKI A;  4CI6 A;  4ZTJ A;  1NK7 A;  4BWM A;  1YJW N;  2YNI A;  3THY A;  3SJH A;  4M45 A;  5CE3 A;  4XIU A;  4NYN A;  4LH4 A;  2VGN A;  3OJU A;  5AZI A;  4Z4I A;  4HWI A;  5AQP A;  3O9U A;  3VN5 A;  3L3V A;  3MXM A;  5KGW A;  4PHT X;  4DV5 K;  4IFY A;  4JS4 A;  4CBX A;  1TAQ A;  1RT2 A;  4OLB A;  2NRZ A;  5ADX H;  3MN6 A;  2Q0R A;  3DYA A;  1W9H A;  2FSN A;  2OPR A;  1XI1 A;  1RTH A;  2DFH A;  4CGD A;  2YV0 X;  1RT4 A;  1C1B A;  4DTN A;  4MFB A;  3CFO A;  1ATS A;  2R7Y A;  4OPH A;  1VRT A;  1T03 A;  1QQC A;  5AFU A;  3DXK A;  1NOY A;  3TAG A;  5JS1 A;  1XQS C;  3OYK A;  3F73 A;  4ISG A;  4O0J A;  2QKB A;  1NG9 A;  3DLH A;  4LF4 K;  3OBW A;  1D9D A;  4F2R A;  2O8E B;  1GLD G;  3WXM B;  3ZT1 A;  4ISE A;  4CZI A;  1IV0 A;  1B9D A;  1S72 N;  1DKG D;  2GUP A;  4C1N I;  3MN5 A;  1LCU A;  4X65 K;  3BDP A;  3N4Q A;  4CHO A;  3RMA A;  2D0O A;  1X3N A;  1W0H A;  3VF2 A;  4QCL A;  1QHT A;  4MLE A;  3QEX A;  2E1Y A;  3CER A;  1OVQ A;  3MK6 A;  1BIZ A;  4JK8 A;  1P8Z A;  1NK4 A;  4LF7 K;  3K9J A;  1JLB A;  1E3M A;  1KXP A;  3MX2 A;  4F3O A;  3VQD A;  1OVY A;  2VGM A;  2VG6 A;  3A5O C;  3OYH A;  2NRR A;  1U4B A;  2FXU A;  4KB1 A;  4UY8 O;  2VQE K;  2VCP A;  2ZF5 O;  2F9W A;  4IO8 A;  1KLN A;  3OVN A;  1HNI A;  3AA3 A;  4YY3 K;  4DV7 K;  1L3V A;  4CJF A;  4Y1C A;  5F0X A;  5EY4 A;  3VEX A;  4CZF A;  3CQ8 A;  3WUH A;  4FWN A;  4YOR A;  2E8A A;  4DF8 A;  1BA1 A;  2QWP A;  4MDA A;  2F7T A;  5AQO A;  1BA0 A;  4IFE A;  2WOM A;  5JVG L;  3O6W A;  2KZZ A;  2RN2 A;  4EZ6 A;  5KPZ A;  5J2P A;  1NK5 A;  2B4J A;  2YHX A;  4BR0 A;  4CK1 A;  3SUO A;  4N56 A;  3FZM A;  3ULE A;  3LPU A;  2HOE A;  4I2P A;  4KBO A;  1C1A A;  4EP5 A;  3D2F B;  3KHY A;  3V81 A;  2BH1 A;  3LAL A;  1G99 A;  3NGZ A;  3ZYY X;  5J1E A;  2P1J A;  2Q2R A;  2RKI A;  2XRI A;  3VEY A;  2IGI A;  4ILH A;  4FJJ A;  2HHX A;  3VA3 A;  1IG9 A;  2O8F B;  2DPN A;  4B1X B;  3O80 A;  2HHV A;  3SBT A;  1JXE A;  4CGG A;  4CES A;  2G8F A;  1K8K B;  3AVM A;  1LW0 A;  3LP1 A;  3H45 C;  2ZJP L;  1SV5 A;  1WOQ A;  4C8M A;  3I0S A;  4JK9 A;  1U49 A;  3DLB A;  3LM2 A;  1LWF A;  4FJM A;  1RBS A;  2OCE A;  2G8I A;  5BN8 A;  2YNF A;  1W97 L;  1XNR K;  2P9L A;  4G9Z A;  1NM1 A;  4CFB A;  2P51 A;  1S1U A;  1NGF A;  1EO1 A;  3TR8 A;  1WSE A;  4AIL C;  3THW A;  3NF7 A;  2HHU A;  4CJV A;  5FPD A;  1FK9 A;  2QWL A;  4DR2 K;  1K73 O;  2HB5 A;  1T8E A;  3K5N A;  4CJK A;  3UB5 A;  1D9F A;  4WE1 A;  4A5B A;  4CGJ A;  3HL8 A;  4DTP A;  4KPY A;  3AGK A;  5AQR A;  3TPQ A;  1WLJ A;  1ATR A;  3QIO A;  3AVC A;  3VQ6 A;  3SQ4 A;  3GBT A;  1QE1 A;  2IIR A;  1TKT A;  5C10 A;  2GX9 A;  1RT7 A;  1U2V A;  2VYP A;  3CQX A;  4PL7 A;  3VET A;  2ZM6 K;  1HLU A;  1TKX A;  4LY7 A;  4XEI A;  1OKJ A;  3VQA A;  4LC9 B;  2GWJ A;  3C65 A;  5C42 A;  5ADX A;  3H6E A;  1J6Z A;  5FRN A;  4CHN A;  3P1G A;  3LZJ A;  3G0Z A;  3ZT2 A;  4JKC A;  4FK2 A;  4DS5 A;  2QXF A;  4KTZ A;  4KI6 A;  2Q3S A;  3VTH A;  3LP2 A;  3VGM A;  3OYM A;  1WSI A;  4BRF A;  3PX6 A;  3L2U A;  3KJV A;  4H0V B;  3Q7C A;  2CGL A;  1LOT B;  5AQZ A;  3VQB A;  4KI4 A;  3QDK A;  3TWH A;  4CJS A;  4YOY A;  3L6Q A;  4M41 A;  4I6M B;  4DHY A;  2QKK A;  4Z4G A;  5AQK A;  4JRP A;  4F4K A;  2KW4 A;  3TSP A;  4WFA L;  3M3Z A;  4AHR A;  4NCG A;  4CGF A;  3EL2 A;  4ICL A;  5AQX A;  5TKW A;  3UKU A;  3SYZ A;  2QWR A;  1QSS A;  1HR0 K;  3V4I A;  1NGD A;  3L2W A;  1HYZ A;  1Q81 O;  4CJW A;  4FJG A;  3THY B;  1O13 A;  4CZH A;  4FK4 A;  4KV8 A;  2HHW A;  4LD0 A;  5AZI B;  4DFP A;  1RTD A;  5BRH A;  3NH0 A;  4HTU A;  3O4W A;  5LL6 Z;  3THX A;  3DLG A;  5C2F A;  3J7Y P;  3OS2 A;  5FRO A;  3VQC A;  5AQF A;  3SV3 A;  2Z1G A;  4BRK A;  5KPT A;  4DQI A;  3AGR A;  4JI3 K;  3NMU A;  1YHQ N;  4FWS A;  1RT5 A;  3BF1 A;  3DWL A;  1EWR A;  3AA5 X;  3CJA A;  4I9Q A;  3KIO A;  2ETJ A;  3D6R A;  4H5W A;  3DXK B;  1NGJ A;  4N41 A;  4CJP A;  2JWL A;  3VEO A;  2F9T A;  3CFP A;  3KVG A;  3EO3 A;  5DM6 L;  4CJE A;  2UU9 K;  4WQ5 C;  5EU7 A;  3G4S N;  3E9L A;  4DR6 K;  4RCH A;  1MU2 A;  4BRL A;  1GLF O;  4EHT A;  3OYF A;  4HUG A;  1C0G A;  5CHI A;  1QZ6 A;  1T6D A;  1L3U A;  1NLV A;  1RGI A;  4N47 A;  3SAG A;  3QBX A;  1GLC G;  3ZSY A;  2DFE A;  4K8Z A;  3QB0 A;  3V9U A;  1SKW A;  1VQ5 N;  4JD2 A;  1TV6 A;  4BVP A;  2V7Y A;  4YOX A;  1JLA A;  5M1F A;  2YHA A;  1RDA A;  1ZYQ A;  2OPP A;  4QAG A;  2V7Z A;  4BG8 A;  2KHO A;  2EX3 A;  2IVO A;  2F8S A;  5GAD P;  3LP3 A;  1FW6 A;  2IS3 A;  3IAY A;  4FWK A;  2KFN A;  2FF6 A;  3KK7 A;  1VSH A;  3C6U A;  4CBU A;  4QS7 A;  4W5N A;  3VQ4 A;  4KHU A;  4CHP A;  4KRE A;  3B6P A;  4OPA A;  3JSM A;  4KHN A;  1L5U A;  3CC2 N;  3MDQ A;  1D4X A;  4ELT A;  4XH5 A;  3U4L A;  3TI0 A;  1U04 A;  2E88 A;  2KKZ A;  3NAE A;  5KPR A;  3ULE B;  2D0C A;  3D7E O;  3IDH A;  4CZM A;  4B1V A;  1M90 O;  3CJC A;  1OH7 A;  2HMI A;  4F9O A;  4BR9 A;  2OTJ N;  3P83 D;  4BRI A;  4JHD A;  1A5X A;  1WSJ A;  4GV6 A;  4CHY A;  3T3F A;  4DSI A;  4LFB K;  3LDP A;  4JKG A;  4CEE A;  5D3G A;  2ASO A;  2W40 A;  1J5E K;  4KH6 A;  3PY8 A;  3C7N A;  2ZJQ L;  4BR4 A;  4BRD A;  1NJW A;  3CCS N;  1DT9 A;  2E1Z A;  5HOO A;  2E2Q A;  2E5L K;  1KSP A;  3J80 O;  1HNX K;  1D8Y A;  3KLG A;  3AVL A;  4PQU A;  3LP0 A;  2X78 A;  3IRX A;  1LW2 A;  3SLC A;  2O8D A;  2DTU A;  2QWO A;  3E1Y A;  3HM9 A;  4OPJ A;  3S3N A;  2XHB A;  2P9K B;  3ATU A;  2P5G A;  3PO4 A;  1GOA A;  5BPN A;  2NRT A;  2Y1I A;  4EZ9 A;  3NH1 A;  4BE0 A;  4RG8 A;  2P9L B;  4DWI A;  2YKN A;  1HPZ A;  3VF4 A;  3SK3 A;  4FOI A;  2GWK A;  5C15 A;  3ZET A;  2HND A;  2QEX N;  4DU4 A;  2OPS A;  3THW B;  3PSF A;  4I2Q A;  3TAQ A;  4H0O A;  2YCH A;  3PO5 A;  3J7Z O;  4FLZ A;  4FJH A;  4DSE A;  4F2S A;  3O9Q A;  4DTS A;  1RDU A;  1N36 K;  1Q7Y O;  1CLQ A;  4MDB A;  3E66 A;  5H1S Q;  1S5J A;  4PKH A;  4H5V A;  3TTF A;  3SBG A;  5C25 A;  3RMC A;  3B8A X;  3MN7 A;  4E7J A;  1XMO K;  3I0R A;  3FFI A;  4BAC A;  3CM6 A;  4LFC K;  3FZL A;  3HPO A;  3SPZ A;  3W0L A;  4E1J A;  2UXB K;  3QNN A;  1TL3 A;  3MMV A;  1BL3 A;  1RDD A;  3ALY A;  3QLH A;  1KCF A;  3NF8 A;  4IOC L;  3SCX A;  3AVH A;  3IS9 A;  3CCE N;  3TSQ A;  3NHG A;  3L2R A;  1VK0 A;  1HQE A;  1QZ5 A;  4ISF A;  4BC3 A;  5M1K A;  2I7P A;  2Q1N A;  3T7Z A;  2JLE A;  3WNG A;  3CFR A;  3T19 A;  1VSK A;  4AHV A;  4IXC A;  3SUN A;  2AJQ A;  4JKB A;  2HST A;  5GIO A;  1YF5 L;  4FJN A;  4ZHR A;  1S9G A;  4K43 A;  2FBY A;  4L8R B;  2ZE2 A;  3D45 A;  4WFB L;  2NLX A;  2G8H A;  3BY5 A;  4FJI A;  4AH9 A;  4CEQ A;  1JLE A;  4M3W A;  3LDO A;  4BRP A;  3MXJ A;  4R5P A;  3LAK A;  4J2A A;  1S1W A;  1RDW X;  2Z1J A;  3HP9 A;  2EHG A;  1OH8 A;  3E01 A;  4Y0W A;  4BY9 C;  1U47 A;  3UKU B;  4CJQ A;  5KTQ A;  3IUC A;  2ZWH A;  1BCO A;  4JYA K;  4GY2 B;  5BN9 A;  2HHH K;  4XH4 A;  4KB0 A;  4CEF A;  1GLJ O;  3OA9 A;  3UKR A;  1VSF A;  4JNE A;  1KC8 O;  4OJR A;  3QES A;  3AO5 A;  4DG1 A;  5I42 A;  4DU3 A;  5M1Q A;  4GV3 A;  4GNI A;  3THX B;  1C0M A;  1TUY A;  1KAZ A;  3H1Q A;  4JKH A;  4YOT A;  4B3M K;  2FC0 A;  2HBK A;  2I7N A;  4I7F A;  1X9S A;  3ID6 A;  4E1M A;  5GIP A;  3RMD A;  2VG5 A;  3VOV A;  3QEW A;  5CZ2 A;  3WQT A;  2Z1I A;  2WFB A;  3M5R A;  4FZX C;  3R1X A;  3VPZ A;  1Z6R A;  4NXN K;  3QFP A;  4DUZ K;  3HPH A;  4AHT A;  4M3R A;  4U67 L;  4DV3 K;  1A5V A;  4FW2 A;  4ILJ A;  4DKW A;  1Z05 A;  3HO1 A;  1WUA A;  2QWM A;  3O1W A;  4LH5 A;  4I9L A;  1WB9 A;  4F8R A;  3AO3 A;  4KKO A;  1RBU A;  3I55 N;  3WXJ A;  3ISN C;  5TKY A;  2O8C B;  3OBY A;  3A5M C;  3BZK A;  2FBX A;  2NRW A;  4CHZ A;  2FBV A;  4DQP A;  4BG9 A;  3OYL A;  5CYQ A;  4CCH A;  3AO4 A;  3DRS A;  3H3O B;  4X66 K;  2W42 A;  4JKD A;  4DFM A;  5T7B A;  2D4W A;  4CJ3 A;  4PKG A;  5LMN K;  2A40 A;  1LAV A;  3O1B A;  2YKM A;  3G25 A;  5JLH A;  3O9S A;  4FVU A;  3PSI A;  2GUI A;  4DR5 K;  4JD2 B;  1CZ9 A;  3CD6 N;  3C0B A;  4DSK A;  3CET A;  1SUQ A;  1JLG A;  3PIP L;  2RHK A;  1WAJ A;  1ITG A;  3HM8 A;  1S6Q A;  3S3O A;  1VSJ A;  4FJ9 A;  2QW9 A;  1E4G T;  4E7H A;  3KKR A;  2HVI A;  4W5R A;  4IEI A;  2A1R A;  1YJ9 N;  4DSL A;  4MQ3 A;  4KO0 A;  1KFS A;  4JI6 K;  3HTV A;  2NNW A;  1NGE A;  5BPL A;  1HYS A;  3KLE A;  3KD1 E;  5BR8 K;  4BRO A;  3GL1 A;  3LPT A;  1VQ7 N;  1B92 A;  1JLQ A;  2A41 A;  4FM2 A;  3ENH A;  3CXC M;  3SI6 A;  3RRH A;  3C6T A;  3PIO L;  3ID8 A;  3DMJ A;  1KVC A;  3FFK B;  2CGJ A;  4IWV A;  1EXQ A;  1ZBI A;  5LMU K;  1YXQ A;  3HT3 A;  2ZD1 A;  4DV4 K;  3O9T A;  3MCP A;  1NK0 A;  4JK7 A;  1QVF M;  4B3O A;  3PV8 A;  1FKP A;  1GLA G;  2V52 B;  3OYG A;  3DOK A;  3KZB A;  3A0I X;  2XY7 A;  1N34 K;  4KHP K;  3VQE A;  4H0X B;  3NE6 A;  4JHD B;  4Z4F A;  3QEV A;  4E7I A;  1M1K O;  5C12 A;  1JCF A;  4BRQ A;  4C8N A;  3VQ7 A;  4JKG B;  2UYT A;  4BWJ A;  2D0B A;  3C94 A;  1U6Z A;  3V9W A;  3OYB A;  3C7N B;  1HPM A;  3AO2 A;  1IJJ A;  4JLH A;  3VQ5 A;  3EE8 A;  1JCE A;  1W7A A;  2JWK A;  1ASV A;  4BE1 A;  2H3G X;  2HF4 A;  4CHQ A;  5GAE P;  3GG4 A;  3DXM A;  3IMX A;  4X64 K;  4IJA A;  2O8D B;  4Z94 A;  3EZ5 A;  4G1Q A;  2E6M A;  2P9S A;  3CCQ N;  5AQS A;  3V9Z A;  1QS4 A;  3NH2 A;  4OKE A;  2A1S A;  4H5T A;  3AVF A;  4KFB A;  3VQ8 A;  4JI1 K;  4A59 A;  4J2E A;  4HTL A;  4LF5 K;  1YIT N;  4OX9 K;  2NZT A;  3EE9 A;  4CF0 A;  3O9R A;  1YTU A;  3ZSR A;  3ZEU A;  3P39 A;  5LJW A;  1LAW A;  2KLA A;  3ZET B;  3SPY A;  4FWM A;  3V1R A;  5AQQ A;  4FJX A;  4H5N A;  3EEQ A;  5AQV A;  2E4L A;  1GLL O;  4N5S A;  3OYA A;  4DLG A;  3LM9 A;  1NJI O;  3CJB A;  4KTQ A;  2Q36 A;  4JKF A;  4BRN A;  3OY9 A;  4OKJ A;  4J8F A;  1K6Y A;  4NXM K;  1Y97 A;  4IO9 L;  2A42 A;  4M3U A;  4J2B A;  4PUO A;  3F2K A;  4FO0 A;  4FM0 A;  3I56 N;  4JRQ A;  1T6C A;  1S9E A;  4FXD A;  4RW9 A;  2BTF A;  3VGL A;  4ID5 A;  3KLF A;  5KRS A;  3K5O A;  3S41 A;  1NJY A;  4CGH A;  1EP4 A;  3EN9 A;  2ASP A;  4EP4 A;  4WQ4 C;  3IFR A;  5E41 A;  1HRH A;  2F8T A;  1T44 A;  4FWR A;  5F1X A;  3JYT A;  3HK2 A;  2W6L A;  3THV A;  3RR7 A;  3H08 A;  3CME N;  4IEE A;  1ZBH A;  1BU6 O;  4BRC A;  5AQL A;  5KQD A;  2O8B B;  2WTU A;  1BUP A;  4DB3 A;  3HRG A;  3ZSX A;  1J9A A;  3AAR A;  4M7X A;  2OPQ A;  1YJN N;  4A5A A;  1BQM A;  1LWC A;  4GVE A;  4H5R A;  3T1A A;  1Z25 A;  4CJU A;  3LZI A;  3VA0 A;  2HHT A;  3AAQ A;  3AV9 A;  1HKB A;  4AM6 A;  1NK8 A;  3BGR A;  3ZT3 A;  1U45 A;  2AA4 A;  1YTA A;  4XH1 A;  4DTR A;  2VQF K;  3TAN A;  3I8D A;  1Q18 A;  4WQ5 A;  4YHH K;  1Q86 O;  1YVU A;  5AZJ A;  1VHX A;  3DI6 A;  4FJK A;  1E4F T;  1HUX A;  2IDO A;  3KLI A;  1WSG A;  4B3S K;  4YOU A;  1ASU A;  1REV A;  2NRX A;  3G10 A;  3MAQ A;  4KAZ A;  3GOI A;  1F21 A;  5AQH A;  3OYI A;  1SL0 A;  4C23 A;  2X6S A;  1IKY A;  3SQ2 A;  3ZLJ A;  1K8A O;  3M8P A;  3QFU A;  2QA4 N;  2QXL A;  5BRD A;  3NCI A;  3OTO K;  2GEM A;  4GMJ B;  2HBL A;  4FJ5 A;  3UKR B;  2P9U A;  4WCE L;  2HW3 A;  3SUP A;  3SV4 A;  2WON A;  2ASM A;  3DAW A;  3NVM A;  4DTX A;  2UXC K;  2BGG A;  4OVL A;  1I39 A;  4E89 A;  1IKX A;  1NGH A;  5CZ1 A;  1RNH A;  4CD3 A;  3J81 O;  3OJS A;  1MWK A;  3BUZ B;  1N6Q A;  2Y1J A;  4FCY A;  1I3A A;  3TTD A;  3QNO A;  4NLC A;  3QEI A;  1O1W A;  3LDQ A;  3A5L C;  3SZ2 A;  2UUC K;  2ITG A;  5GAG P;  1NBW A;  1NK6 A;  3E9P A;  3TAB A;  3I8B A;  4IZ9 A;  2IAJ A;  4CZJ A;  1X1P A;  4HCB A;  4FYD A;  4B9N A;  2F4V K;  3OS1 A;  2CH6 A;  4B9U A;  4YNQ A;  4KHY A;  1CXU A;  3R6M A;  5HRO A;  1TYQ A;  3QEP A;  2HBM A;  1S3X A;  1TK8 A;  1KVA A;  3OYC A;  1VQ6 N;  5J2Q A;  2QTD A;  5E26 A;  1L3T A;  1YI2 N;  3J8A A;  2ATQ A;  3M8S A;  3DLE A;  4DF4 A;  3CIP A;  4BRM A;  1V4T A;  2FBT A;  3V1Q A;  4E0D A;  3ZX0 A;  1HNZ K;  1RDB A;  4FLY A;  1HKC A;  2P9N A;  4AHU A;  1ZXO A;  1WBD A;  3L2V A;  3UIQ A;  3LDL A;  3MWP A;  3TTC A;  4K25 A;  5M1P A;  1VSI A;  5LY3 A;  4NB4 A;  2CGK A;  3L2Q A;  2HBJ A;  3ZSV A;  3FLC O;  4CEA A;  1HMV A;  4H0P A;  4CED A;  4N76 A;  5HRN A;  1X9J A;  2Q31 A;  3ZX2 A;  3T69 A;  5JVH L;  4B1Z A;  4BC2 A;  5FPE A;  3TAM A;  4Y1D A;  2KTQ A;  4DR1 K;  4JS5 A;  1VSD A;  1JCG A;  3TAR A;  2BE2 A;  1ATN A;  4FZZ A;  3LDN A; 
#chains in the Genus database with same CATH homology
 3WNF A;  4H4O A;  1DTT A;  1VSK A;  4AHV A;  4CER A;  2G8K A;  4O0I A;  3SUN A;  2AJQ A;  2WOM A;  4HCB A;  2KZZ A;  2RN2 A;  4DLE A;  4EZ6 A;  5J2P A;  4FJN A;  1NK5 A;  2YNG A;  2B4J A;  4W5Q A;  4ZHR A;  3M8R A;  1TAU A;  1S9G A;  4KHQ A;  4CK1 A;  2FBY A;  2OA8 A;  3K57 A;  3SUO A;  4L8R B;  2ZE2 A;  4N56 A;  2O4I A;  3D45 A;  4H4M A;  3LPU A;  2G8H A;  3VQP A;  4FJI A;  4AH9 A;  4CEQ A;  4I2P A;  1C1A A;  1JLE A;  2PYL A;  4M3W A;  4EP5 A;  4CIE A;  3MXJ A;  4R5P A;  1NKC A;  3LAK A;  2X6N A;  4J2A A;  3V81 A;  3AA2 A;  4Z4E A;  1S1W A;  1DTQ A;  2Z1J A;  2VWK A;  3HP9 A;  4IKF A;  2EHG A;  3LAL A;  4E7L A;  3E01 A;  3NGZ A;  1U47 A;  3ASM A;  3NGY A;  5J1E A;  2P1J A;  3HPG A;  4CJQ A;  2RKI A;  2XRI A;  3VQ9 A;  5KTQ A;  3AO1 A;  3KTQ A;  3RR8 A;  2IGI A;  1U48 A;  1BCO A;  4FJJ A;  2HHX A;  3VA3 A;  1Z26 A;  1IG9 A;  2VG7 A;  4W5T A;  4RW6 A;  4KB0 A;  4CEF A;  1VRU A;  1RDC A;  1VSF A;  4CK2 A;  4IG3 A;  4OJR A;  1WN7 A;  3QES A;  2HHV A;  3AO5 A;  4DG1 A;  5I42 A;  4DU3 A;  3NDK A;  1JXE A;  4CGG A;  4ELV A;  4HUE A;  4CES A;  2G8F A;  5C24 A;  4CEB A;  4TSX A;  1TK0 A;  3AVM A;  1XC9 A;  1X9W A;  1C0M A;  1KLM A;  1LW0 A;  1BI4 B;  1C6V A;  1S1X A;  3AVI A;  3LP1 A;  1L3S A;  1SV5 A;  4C8M A;  2FC0 A;  1X9S A;  1HYV A;  3I0S A;  4I7F A;  3PX4 A;  1U49 A;  3HJF A;  5KRT A;  2KFZ A;  4E1M A;  3RMD A;  3DLB A;  4DTM A;  1LWF A;  4FJM A;  2VG5 A;  3NF9 A;  4DQR A;  1RBS A;  3DRP A;  3QEW A;  1J5O A;  1FKO A;  1ZBF A;  5CZ2 A;  4B9L A;  1Q9Y A;  2G8I A;  2Z1I A;  4HUF A;  4FZX C;  4B9T A;  4W5O A;  2YNF A;  3HP6 A;  4QOZ B;  1G15 A;  1GOB A;  2HNY A;  4B8A B;  4CFB A;  1IKW A;  2P51 A;  3HPH A;  4AHT A;  4M3R A;  3O3F A;  4M3X A;  1A5V A;  4FW2 A;  3KK2 A;  1S1U A;  1WAF A;  1RCH A;  3LDS A;  3HO1 A;  1EET A;  3TR8 A;  1WSE A;  4LH5 A;  4I9L A;  4NYF A;  4CJ5 A;  4AIL C;  4F8R A;  3C95 A;  1TKZ A;  3AO3 A;  3NF7 A;  3NFA A;  1XHX A;  4KKO A;  1RBU A;  4PA1 A;  3QIN A;  2GBZ A;  2YHB A;  5KGX A;  2HHU A;  4NCA A;  4B8C A;  4CJV A;  3ZSZ A;  4M3T A;  3ISN C;  4CEZ A;  1LV5 A;  1FK9 A;  1BGX T;  2BDP A;  2FBX A;  4CHZ A;  2FBV A;  4DQP A;  2HB5 A;  4CGI A;  1T8E A;  3K5N A;  1CZB A;  3OYL A;  5CYQ A;  3DM2 A;  3AO4 A;  3DRS A;  3AVB A;  4CJK A;  1D9F A;  4WE1 A;  4CJ4 A;  4CCH A;  4M42 A;  4CGJ A;  1BHL A;  3HL8 A;  2W42 A;  5HRP A;  4DTP A;  4KPY A;  4FLT A;  4DFM A;  4IBN A;  2OZM A;  3KKS A;  5T7B A;  4CJ3 A;  1WLJ A;  3QIO A;  4FJL A;  3AVC A;  4RW4 A;  2YNH A;  3VQ6 A;  3SQ4 A;  1LAV A;  1ZBU A;  1QE1 A;  2G8W A;  1TKT A;  2YKM A;  2RF2 A;  1RT7 A;  3O4N A;  4OLA A;  2O4G A;  4GW6 A;  2GUI A;  4RW7 A;  4CJR A;  1TKX A;  1CZ9 A;  4LY7 A;  2KQ2 A;  4DSK A;  1BQN A;  3K5L A;  3VQA A;  1TL1 A;  4OPK A;  3DLR A;  3MEE A;  1SUQ A;  4CFC A;  3QET A;  4CFD A;  5C42 A;  2G8V A;  1JLG A;  1R0A A;  5FRN A;  1IKV A;  1JXB A;  4CHN A;  3P1G A;  3F9K A;  3LZJ A;  1WAJ A;  1ITG A;  2NUB A;  1S6Q A;  3G0Z A;  4O55 A;  3LAN A;  1KRP A;  4Q0B A;  4H8K A;  3S3O A;  3ZT2 A;  1VSJ A;  4FK2 A;  4KI6 A;  4DS5 A;  2QXF A;  4KTZ A;  4FJ9 A;  1KVB A;  2Q3S A;  4PWD A;  4E7H A;  3LP2 A;  3OYM A;  3PX6 A;  1WSI A;  3KKR A;  2HVI A;  4W5R A;  3L2U A;  4LSN A;  3SQ1 A;  4C8L A;  4CEC A;  3KJV A;  2A1R A;  1NJZ A;  3RWU A;  1VSM A;  4DTU A;  3KLH A;  4DSL A;  4O44 A;  4MQ3 A;  2Z1H A;  4CIG A;  4KO0 A;  1D8Y A;  1QSY A;  1KFS A;  1FXX A;  2IC3 A;  3DLK A;  4FW1 A;  5K14 A;  4E1N A;  4Z4H A;  3NF6 A;  5JS2 A;  3HYF A;  1HYS A;  4AHS A;  3KLE A;  3KD1 E;  2HHS A;  3VQB A;  4KI4 A;  3U3G A;  5HLF A;  3LPT A;  1B92 A;  1JLQ A;  5SZT A;  3TWH A;  4FM2 A;  4DQS A;  4CJS A;  1D5A A;  4M41 A;  3SI6 A;  5CY4 A;  1BIU A;  3RRH A;  2QKK A;  4Z4G A;  3OYE A;  3C6T A;  4JRP A;  1S1T A;  4F4K A;  1IO2 A;  1GOC A;  5DK5 A;  2KW4 A;  1RT6 A;  3V9S A;  1BCM A;  3DMJ A;  3NBP A;  3LWL A;  4AHR A;  1KVC A;  3QER A;  3O3G A;  2KZM A;  1EXQ A;  1ZBI A;  3AVJ A;  3O4Q A;  4LSL A;  2ZD1 A;  4NCG A;  4AHC A;  4CGF A;  3HT3 A;  4DS4 A;  4DTO A;  1NK0 A;  1A5W A;  4ICL A;  4ZTF A;  4B3O A;  3P5J A;  1RBV A;  3MXI A;  3PV8 A;  1QTM A;  4O5B A;  1HJR A;  2XO7 A;  1C0T A;  1FKP A;  3SYZ A;  3OYG A;  3LAM A;  1QSS A;  3V4I A;  3L2W A;  3DOK A;  5J2M A;  3CM5 A;  1KFD A;  1Q8I A;  3WNH A;  4GVM A;  4DU1 A;  1HYZ A;  1RT1 A;  2XY7 A;  3VQE A;  4OGC A;  4CJW A;  2VWJ A;  1WNS A;  3NE6 A;  4FJG A;  3PX0 A;  4Z4F A;  3QEV A;  4E7I A;  4FZY A;  1Q9X A;  3V9X A;  4KV8 A;  2E6L A;  4CF8 A;  4FK4 A;  2B6A A;  1UA1 A;  4PY5 A;  2HHW A;  4LD0 A;  3OYN A;  4DFP A;  4OGE A;  3OYJ A;  1RTD A;  4C8N A;  3VQ7 A;  3M8Q A;  1UA0 A;  3DRR A;  3VQQ A;  3NH0 A;  4HTU A;  4FJ8 A;  1JLC A;  4BWJ A;  5J2N A;  2D0B A;  3EYZ A;  4IDK A;  3U6F A;  3DLG A;  2QK9 A;  1BI4 A;  3C94 A;  5FRO A;  3OS2 A;  3V9W A;  3OYB A;  3VQC A;  2XY5 A;  1YT3 A;  3SV3 A;  3AO2 A;  1NK9 A;  3KK1 A;  1CXQ A;  1LWE A;  2Z1G A;  4DQI A;  4M3Y A;  4JLH A;  3VQ5 A;  2X74 A;  3AVN A;  4Z0U A;  4CIF A;  3ZSO A;  5HBM A;  1ASV A;  1RT5 A;  1NKE A;  1SKR A;  4BE1 A;  4C8O A;  3AA5 X;  4CF9 A;  1J53 A;  4CHQ A;  4KHW A;  4KTW A;  4FZZ A;  1J54 A;  4HCC A;  4I9Q A;  3KIO A;  2ETJ A;  5KI6 A;  3SQ0 A;  1JL1 A;  3CG7 A;  4YFU A;  4RW8 A;  5FDL A;  4N41 A;  3EZ5 A;  4G1Q A;  2E6M A;  2DFF A;  1RTI A;  3V9Z A;  1N5Y A;  4CJP A;  4DFK A;  1QS4 A;  2ZQB A;  1WSH A;  3NH2 A;  1HQU A;  1NOZ A;  4FVM A;  3IG1 A;  4OKE A;  2A1S A;  3CFP A;  3AVF A;  3ZCM A;  4KFB A;  3VQ8 A;  2D0A A;  4CE9 A;  4J2E A;  4IG0 A;  4CJE A;  4CF0 A;  1YTU A;  5EU7 A;  2LSN A;  3ZSR A;  1MU2 A;  4CF2 A;  1LAW A;  5SWM A;  3OYF A;  3KD5 E;  3SPY A;  4E3S A;  4HUG A;  1JLF A;  1TKD A;  1ASW A;  2PY5 A;  3V1R A;  1L3U A;  5HP1 A;  2I5J A;  1VSE A;  4OKK A;  4FLV A;  4FJX A;  2HHQ A;  4N47 A;  3MED A;  1RIL A;  2E4L A;  3A2F A;  4N5S A;  3OYA A;  4DLG A;  3ZSQ A;  3RMB A;  3K2P A;  4CEO A;  5HRR A;  3S3M A;  4KTQ A;  3PUF A;  4E19 A;  1X9M A;  3ZSY A;  4K8Z A;  2DFE A;  3ITH A;  1EX4 A;  3OY9 A;  4OKJ A;  5HRS A;  1K6Y A;  3RTV A;  3V9U A;  1SKW A;  1Y97 A;  4M3Z A;  3TAE A;  1TV6 A;  3QIP A;  4CJL A;  4M3U A;  3K59 A;  4FK0 A;  4DSJ A;  1JL2 A;  4J2B A;  4PUO A;  1JLA A;  1B9F A;  1TVR A;  3AA4 A;  3OYD A;  4FM0 A;  4JRQ A;  1S9E A;  4KRF A;  4ID1 A;  3SJJ A;  4FXD A;  4RW9 A;  2HVH A;  4ID5 A;  1WSF A;  2YHA A;  3KLF A;  1RDA A;  5KRS A;  3K5O A;  1NJY A;  4CGH A;  4DTJ A;  1ZYQ A;  1EP4 A;  2OPP A;  4EP4 A;  4QAG A;  5E41 A;  1HRH A;  2F8T A;  2DY4 A;  3NGI A;  1HNV A;  3JYT A;  1SL1 A;  2EX3 A;  4HVJ A;  4C8K A;  2F8S A;  3HK2 A;  3V1O A;  4ELU A;  4BDP A;  4B08 A;  3LP3 A;  3THV A;  2B5J A;  3RR7 A;  2JGU A;  2RPI A;  3H08 A;  3O3H A;  1VSL A;  2IS3 A;  4IFV A;  3ZT0 A;  3K58 A;  2PYJ A;  3IAY A;  1ZBH A;  3CYM A;  4K8X A;  4O4G A;  4B9S A;  2KFN A;  3AVK A;  1RTJ A;  3SUQ A;  3ZSX A;  1RBR A;  1J9A A;  1VSH A;  2OPQ A;  3C6U A;  3SNN A;  2OZS A;  4DSF A;  4DFJ A;  1BQM A;  1LWC A;  1DLO A;  4Q5V A;  3K5M A;  3VQ4 A;  3V6D A;  4KHU A;  4W5N A;  4CHP A;  4KRE A;  4CF1 A;  3B6P A;  3T1A A;  1Z25 A;  4CK3 A;  4CJU A;  3LZI A;  3HST B;  3JSM A;  3VA0 A;  4KHN A;  3AV9 A;  1L5U A;  2HHT A;  4CFA A;  1NK8 A;  3BGR A;  3ZT3 A;  4ELT A;  3RRG A;  1U45 A;  1TGO A;  3TI0 A;  1U04 A;  1YTA A;  1XHZ A;  4DTR A;  4HHT A;  1T7P A;  3NAE A;  3I8D A;  5I3U A;  3TAN A;  1SL2 A;  3OS0 A;  2D0C A;  3L3U A;  1UAX A;  1YVU A;  1SKS A;  3MEC A;  2HMI A;  5FRM A;  3DI6 A;  3QO9 A;  1NK7 A;  4ZTJ A;  5DMR A;  3MEG A;  3P83 D;  4BWM A;  3ZT4 A;  2YNI A;  4FJK A;  3DOL A;  1A5X A;  1IH7 A;  1WSJ A;  2GV9 A;  2IDO A;  3KK3 A;  4M45 A;  2F96 A;  4XIU A;  2HNZ A;  4CHY A;  3KLI A;  4LH4 A;  1WSG A;  4NYN A;  1ASU A;  1REV A;  3G10 A;  1XWL A;  4DMN A;  3OJU A;  3MAQ A;  3L8B A;  3T3F A;  4DSI A;  4KAZ A;  4Z4I A;  3VN5 A;  1F21 A;  3L3V A;  4CEE A;  5KGW A;  4CJT A;  3OYI A;  3MXM A;  4IFY A;  1NKB A;  5D3G A;  1SL0 A;  4B9V A;  3PY8 A;  2X6S A;  1IKY A;  4JS4 A;  3SQ2 A;  1TAQ A;  1RT2 A;  4OLB A;  1NJW A;  4FM1 A;  3M8P A;  2P5O A;  1S1V A;  3DYA A;  1W9H A;  3NCI A;  3D0P A;  2OPR A;  3U3Y A;  1XI1 A;  4GMJ B;  4FJ5 A;  1KSP A;  1RTH A;  2DFH A;  4CGD A;  2YV0 X;  2HW3 A;  1RT4 A;  3SUP A;  1C1B A;  3SV4 A;  4DTN A;  2WON A;  4MFB A;  3KLG A;  3AVL A;  3CFO A;  4DTX A;  2OYQ A;  4PQU A;  2BGG A;  4OVL A;  1C1C A;  1I39 A;  4E89 A;  1IKX A;  5CZ1 A;  2R7Y A;  1RNH A;  3LP0 A;  3OJS A;  1VRT A;  2X78 A;  1QQC A;  3IRX A;  1LW2 A;  4BDZ A;  1T03 A;  2Y1J A;  1N6Q A;  2PZS A;  4FCY A;  2DTU A;  1I3A A;  3HM9 A;  3QNO A;  3QEI A;  4OPJ A;  3S3N A;  3TAG A;  1NOY A;  1O1W A;  2XHB A;  5JS1 A;  2P5G A;  3OYK A;  5CYM A;  3F73 A;  3SZ2 A;  1GOA A;  3PO4 A;  2ITG A;  1NK6 A;  1KTQ A;  2Y1I A;  4F3T A;  4O0J A;  4EZ9 A;  3TAB A;  4Z4C A;  3NH1 A;  4FLX A;  2QKB A;  3HVR A;  2IAJ A;  4BE0 A;  1UOC A;  2XY8 A;  4RG8 A;  1X1P A;  3ULD A;  4KHS A;  3HXM A;  3DLH A;  4DWI A;  1EKE A;  1D9D A;  2YKN A;  2G8U A;  3AVG A;  1HPZ A;  3OS1 A;  4FLU A;  4B9N A;  4F2R A;  4B9U A;  1UWB A;  4NCB A;  4YNQ A;  3B6O A;  3ZT1 A;  4KHY A;  1CXU A;  3EY1 A;  2HND A;  1B9D A;  4DU4 A;  2OPS A;  5HRO A;  4I2Q A;  3TAQ A;  2XY6 A;  3PO5 A;  3QEP A;  1TK8 A;  1KVA A;  3OYC A;  5J2Q A;  4FLZ A;  4FLW A;  4FJH A;  4DSE A;  4F2S A;  4DQQ A;  4DTS A;  1L3T A;  3BDP A;  1NJX A;  2ATQ A;  4FYD A;  4CHO A;  3RMA A;  1CLQ A;  1S5J A;  1BIS A;  3RMC A;  1W0H A;  5C25 A;  3M8S A;  3DLE A;  4DF4 A;  1QSL A;  4QCL A;  1QHT A;  3QEX A;  2FBT A;  3V1Q A;  3TAF A;  4E7J A;  4E0D A;  1BIZ A;  3I0R A;  3FFI A;  1RDB A;  1JKH A;  1NK4 A;  4FLY A;  4BAC A;  3CM6 A;  4FJ7 A;  1RBT A;  4AHU A;  2IOC A;  3HPO A;  1JLB A;  3SPZ A;  3L2V A;  3UIQ A;  3QNN A;  4BE2 A;  1TL3 A;  1BL3 A;  1RDD A;  1TK5 A;  1VSI A;  3ALY A;  3QLH A;  3VQD A;  1ZBL A;  4F3O A;  1KCF A;  3NF8 A;  3L2Q A;  2D5R A;  2VG6 A;  3AVH A;  3ZSV A;  3SCX A;  3OYH A;  4CEA A;  1HMV A;  3AVA A;  3IS9 A;  1U4B A;  4CED A;  3NHG A;  1C0U A;  4KB1 A;  3HVT A;  5HRN A;  3L2R A;  4N76 A;  2BAN A;  3S9H A;  1VK0 A;  1HQE A;  4UQG A;  1KLN A;  3OVN A;  1HNI A;  4E7K A;  3AA3 A;  3TAM A;  4Y1D A;  3WNE A;  4BDY A;  4J2D A;  4B9M A;  3TAP A;  2KTQ A;  1T05 A;  1L3V A;  1S6P A;  4CJF A;  4Y1C A;  3LWM A;  4JS5 A;  2JLE A;  1VSD A;  3CQ8 A;  3WNG A;  3TAR A;  3ZSW A;  2BE2 A;  3CFR A;  1RT3 A;  3T19 A;  4DF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...