3V9ZA

Crystal structure of rnase t in complex with a product ssdna (acc) with one mg in the active site
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
209
Chain Sequence
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 63
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9zA00
4CF8A 4LY7A 2FBYA 1C1CA 4KB1A 4DSIA 2HHTA 3TR8A 4FK4A 1IG9A 4OLBA 4MFBA 1B9DA 2YNGA 1KLMA 1VSJA 2DFEA 4DMNA 3QERA 1WSEA 2Y1JA 3C6TA 1RBUA 3AVHA 3LAKA 1FK9A 1LWEA 4OKEA 5HBMA 1T7PA 1X9MA 4AHVA 3KIOA 3BGRA 1I39A 3OYHA 2HMIA 3ZSRA 4DQPA 1ZBLA 3IS9A 3CYMA 3NHGA 5JS2A 4O44A 2HHXA 4Z4HA 4CJWA 1QTMA 4DSKA 2PYLA 4HCBA 4C8NA 2G8IA 2OPPA 1RBVA 3NGYA 2WOMA 4O0JA 5JS1A 3SYZA 3CFOA 1D8YA 4K8ZA 3VQQA 4DG1A 4JS4A 4FJLA 3L3VA 3SZ2A 5J2QA 1TL1A 3G0ZA 1XHXA 3HXMA 3HVRA 3TI0A 4CE9A 3LZJA 1U45A 3NFAA 1X1PA 1LWCA 4NCBA 5HROA 1JKHA 1WSJA 4CGGA 4CGIA 1NK6A 1FKPA 1ZBUA 4F3OA 1J9AA 3OS2A 4KTZA 2DFHA 1SV5A 1XHZA 1K6YA 1ZBFA 1L3SA 3U3GA 4DFMA 4FJ7A 4Q5VA 4KTQA 2P51A 1JLCA 1ZBIA 2D0AA 4WE1A 3V1OA 4CJQA 1I3AA 1W9HA 4CF1A 1VSDA 4FM2A 2OZMA 4Q0BA 3O4NA 1QE1A 3ZSOA 4CJKA 4F3TA 4EP5A 4KHQA 4DSEA 3P83D 5I42A 5SWMA 3NH2A 4C8LA 1BIZA 4NYNA 4DF8A 4CEBA 3LP1A 1C0UA 4HUEA 3DRPA 4DTXA 3LP3A 2ITGA 3VQAA 4FZXC 4KHYA 3VN5A 3OYDA 4AHSA 4DTMA 3KD5E 4HCCA 1J53A 3NH0A 2F96A 3IRXA 1YT3A 3NCIA 1R0AA 4CK1A 2XY7A 3KLEA 3SUQA 2KFNA 3VQ7A 3LPTA 3RMCA 1RNHA 1GOAA 1UA1A 5C25A 2VWKA 5FROA 2HHUA 1S6QA 3VQ8A 4CHNA 5J2PA 4DLEA 4PQUA 2AJQA 4FJKA 3DOLA 1S1TA 4R5PA 1FKOA 1NK4A 5J2MA 1HQEA 2VG7A 1TGOA 3QIPA 1NJXA 3CM5A 5HRNA 3NE6A 3VA0A 3LP0A 2GBZA 4FLVA 4C8MA 2KFZA 1LV5A 3CG7A 3M8SA 5KI6A 3PV8A 1MU2A 3JYTA 2G8VA 4CJTA 2P5GA 4DWIA 3QEVA 4K8XA 3QNOA 4B9NA 1JLBA 2HB5A 1ZBHA 3PO5A 4F8RA 4QOZB 4H4OA 1LAWA 4BACA 1LW2A 3K59A 3V9UA 2B4JA 2IC3A 2EX3A 4KI4A 1SL1A 2OPSA 4KREA 1JXBA 3ALYA 1CLQA 1RT7A 4IDKA 2P1JA 4UQGA 3TAPA 3WNHA 1RTJA 1YTAA 4RW8A 1VSEA 1IH7A 5J1EA 4CEFA 4CESA 4AHCA 4IFYA 3ZT3A 1KTQA 1S9EA 3K5LA 4B8CA 4DTOA 4FZZA 4CJRA 4B08A 2QKKA 3DLGA 4FM1A 1U49A 4FW1A 3VQ4A 4CFAA 1TAUA 1EP4A 4FJIA 4HUFA 4CIEA 4B9VA 3EY1A 1GOCA 1NKBA 4Z4GA 2HVHA 2HNDA 3G10A 1RDDA 4FLWA 3I0SA 4CFBA 3H08A 1RDCA 2Z1HA 1KRPA 3EZ5A 4HUGA 3OYBA 3LALA 1CZ9A 1XC9A 3K5MA 3D0PA 3AA2A 3MEEA 4TSXA 1S6PA 4CEQA 1EX4A 4KFBA 4F4KA 1IKVA 2D5RA 3S9HA 2VG6A 1JLEA 1S1VA 3O3FA 1BCMA 2KTQA 2YHBA 4W5QA 2OZSA 1BHLA 1BGXT 3IG1A 2KZMA 1C6VA 1CZBA 4Z4IA 2LSNA 1KCFA 4CFDA 3KTQA 1SUQA 3ASMA 4KKOA 5DMRA 1LW0A 4FLZA 2HHQA 1RBSA 1NJYA 4AHRA 2DFFA 2FBTA 2A1SA 1Q9XA 1D9DA 1C0MA 3TAQA 2OPQA 3VQDA 3HM9A 3V9ZA 3O3GA 1SKWA 3PX0A 4B8AB 1WSIA 3KKSA 2Q3SA 4FM0A 4CECA 3QLHA 3OJUA 4BE1A 3QNNA 3MXMA 1X9WA 2E4LA 3ULDA 3DLHA 3M8QA 2O4IA 4ZHRA 2KZZA 4OPJA 3OYNA 4MQ3A 4KI6A 2JLEA 1NK0A 1YVUA 1C1BA 4DFKA 4ZTJA 2PYJA 4F2SA 1HNIA 4KHWA 3MAQA 2QKBA 3S3OA 1JL1A 2HHVA 3VQ5A 4CHOA 3SQ2A 1JLFA 1RTIA 3HO1A 3VQ6A 4CHYA 4M3TA 2Z1JA 3K2PA 3SPZA 1VSLA 1HMVA 2IDOA 5C42A 3U6FA 4DQSA 2I5JA 3NBPA 4OGEA 3ZT4A 4CEAA 4B9LA 1BI4A 3AO1A 4FJ8A 1NK8A 5KGXA 3KLFA 4FXDA 1HYZA 4ELUA 5CYMA 4FZYA 4CHPA 4YNQA 3RTVA 3O4QA 4CJEA 1QSLA 4CJPA 2D0CA 1YTUA 1HYVA 4H4MA 3MEDA 3L2QA 2R7YA 4I7FA 4N41A 4E1NA 4LH4A 4B9MA 2X78A 3AVJA 4JRPA 1QSSA 4M42A 3ZSYA 2B5JA 4LSLA 1CXQA 2GV9A 3HP6A 4HTUA 1BCOA 3TABA 1DLOA 2ETJA 3P5JA 1Z25A 4DTNA 4ID1A 3NF7A 1S1WA 4CFCA 4Z4EA 1KVAA 2G8HA 4KB0A 1ASWA 3SNNA 3C95A 1WSFA 4G1QA 4DS5A 3K5NA 3CFRA 1VSIA 4O4GA 3ZSZA 3ZT1A 2HHWA 3DMJA 1TKTA 1Z26A 3F9KA 3RMDA 1NK9A 4KHNA 1Q8IA 2QK9A 3EYZA 4IBNA 2JGUA 1RCHA 1HRHA 3QESA 3QEWA 4DQIA 4CGHA 1GOBA 3CFPA 4FJ9A 4CJLA 3QETA 3F73A 3AVKA 1EETA 4JLHA 4RW4A 3VQEA 2W42A 3PX4A 4FW2A 4OPKA 3L2UA 3TWHA 1NJWA 4CHQA 5J2NA 4DQRA 2PY5A 4FJMA 3ZT0A 3O3HA 1L3UA 3WNEA 3AV9A 3OS0A 2G8UA 2YV0X 1HJRA 2YKMA 1IKYA 4CK2A 3JSMA 3VQPA 4NCAA 4AHTA 3D45A 3SQ4A 1HQUA 3TARA 2OA8A 4FJGA 1ASUA 3PUFA 3DLEA 3C6UA 3OYIA 4DFJA 3S3NA 3ZT2A 2Z1GA 4CIFA 1BIUA 4PY5A 2FBXA 4CJVA 2HVIA 2YKNA 1XWLA 4BDYA 1WSHA 3KLHA 1BL3A 4DTUA 1ZYQA 1L5UA 1TVRA 1JLAA 3P1GA 1VK0A 4CHZA 5T7BA 3AO5A 3ISNC 1RILA 3AO4A 3T3FA 3AVFA 1RT3A 2ZE2A 3AVMA 3DLKA 4E0DA 4CF2A 4AILC 1RDBA 1WN7A 3QEIA 4M3WA 4ID5A 1IKWA 3BDPA 4L8RB 3HK2A 4CGDA 4FJJA 1HNVA 4KAZA 1G15A 3HVTA 2Z1IA 3RRHA 3SCXA 4FK0A 3LDSA 3CQ8A 4DLGA 3MXIA 2X6NA 1N6QA 4CEOA 3V6DA 1RTHA 1VRTA 1C0TA 1QHTA 4DSFA 4DU4A 4DTSA 4FJHA 3RR7A 4CIGA 1TV6A 1TKZA 4DTRA 1D9FA 2D0BA 3LP2A 2XRIA 3V4IA 1TKDA 3OVNA 4KHUA 1NOZA 5HRRA 4O55A 1IO2A 1VSMA 2YHAA 1JL2A 4M45A 4CK3A 3M8RA 4NYFA 4OVLA 4EZ9A 5C24A 1B92A 3VQBA 3AO3A 3AVBA 2X6SA 3VQCA 5K14A 4CCHA 4Z4FA 4KHSA 4CERA 4E3SA 1S1XA 3ZSQA 4ELTA 4BWJA 4HVJA 2XY6A 3IAYA 2VWJA 4J2DA 4N5SA 4E1MA 2G8FA 1VRUA 4M3RA 1L3VA 4DFPA 5HRPA 1UWBA 3HPOA 3OYKA 4W5RA 3SJJA 4CEZA 1REVA 2KW4A 3AVIA 3KK2A 1RBRA 4CJSA 2RKIA 4O0IA 1VSFA 1S5JA 4YFUA 3M8PA 4W5NA 3OYLA 3AA4A 1C1AA 2YNHA 3CM6A 4M41A 1N5YA 2VG5A 3V9XA 3V1RA 2ZD1A 5HP1A 4ELVA 5FRNA 4CF9A 1ASVA 1J5OA 2WONA 1HPZA 1WAFA 4LH5A 2IAJA 3AA5X 4W5OA 3L2VA 2KQ2A 4W5TA 4BE2A 4ZTFA 3AVCA 1DTTA 1WAJA 4C8KA 2F8SA 2ATQA 1A5XA 2GUIA 1Y97A 3E01A 1WLJA 2BDPA 4FJNA 1EKEA 2RN2A 3U3YA 3LWLA 1DTQA 4FJXA 2XHBA 3WNGA 2XO7A 2OPRA 4DS4A 4N76A 2OYQA 1BISA 4FK2A 4Y1CA 2PZSA 1NOYA 3OYEA 1J54A 1XI1A 3KD1E 2G8WA 4I9LA 3RMAA 4Z4CA 2BGGA 3I0RA 4NCGA 4KTWA 3WNFA 3ZCMA 4CJ5A 3SV4A 4DU3A 5CZ1A 1ITGA 4KV8A 3L2WA 3KKRA 4N47A 5EU7A 3AVAA 3OYJA 1Q9YA 1NKCA 1KLNA 4PWDA 4AHUA 3LANA 1NJZA 3LAMA 3OYMA 3QO9A 4O5BA 5DK5A 3OYAA 4CGJA 3A2FA 3V9WA 3DRSA 1JXEA 4OLAA 2IS3A 1NKEA 1BQNA 5KGWA 4BWMA 5SZTA 3NGIA 4F2RA 1X9SA 2IOCA 3K57A 2YNFA 4DU1A 3VA3A 1TL3A 4BE0A 3AO2A 4OKJA 3KK1A 4PUOA 1S9GA 3NF9A 4J2EA 3MXJA 3HYFA 4CEEA 3MEGA 4IG3A 2YNIA 3K5OA 1TK5A 2G8KA 2RPIA 1D5AA 1U4BA 1T8EA 3NF8A 5CYQA 3TAGA 2XY5A 1L3TA 2IGIA 1U04A 3AVLA 3TAMA 3FFIA 3DI6A 1B9FA 1QS4A 4CGFA 4EP4A 2RF2A 4DSJA 2F8TA 2Y1IA 4E7JA 4CJ4A 1VSHA 1WNSA 3SV3A 4AH9A 1UOCA 1LWFA 3DLRA 1SL0A 3LPUA 4OJRA 4GW6A 1WSGA 2O4GA 3DM2A 3MECA 4LSNA 3DYAA 3SUPA 1IKXA 3ITHA 4CF0A 4H8KA 5FRMA 5HLFA 3DRRA 1JLGA 3T1AA 4B9UA 2DTUA 1QQCA 3OS1A 3V1QA 4M3XA 1HYSA 5CY4A 3LWMA 3VQ9A 4M3UA 4RG8A 3ZSVA 2NUBA 4I2PA 4Z0UA 3NF6A 5CZ2A 4E7IA 4QAGA 3HL8A 4RW6A 1SKRA 3PY8A 1TAQA 3OYCA 4CJFA 1A5VA 3V81A 3I8DA 1QSYA 3NH1A 3DLBA 2P5OA 4B9SA 3UIQA 1NK5A 1T03A 4J2BA 4KPYA 3HPGA 5D3GA 1U47A 4IFVA 2DY4A 4IG0A 1O1WA 4KO0A 1RTDA 3V9SA 4EZ6A 2FC0A 3QEXA 4E89A 5KRTA 4OGCA 3PX6A 4OKKA 3QEPA 4CJUA 4DQQA 4I2QA 3L3UA 5FDLA 4CEDA 4FLUA 3TANA 4FJ5A 3C94A 3AA3A 4M3ZA 1BI4B 2E6LA 3ZSXA 5HRSA 2HHSA 4FLXA 3TAEA 4GMJB 3QINA 3ZSWA 4JS5A 4C8OA 4Y1DA 1RT1A 3L2RA 3HSTB 2BANA 4DF4A 4DTPA 2HNYA 1TK8A 3S3MA 1FXXA 1RT6A 3RR8A 3NGZA 4DSLA 4IKFA 3HP9A 1W0HA 4RW9A 4DTJA 4E7KA 3AVGA 1KFSA 4E19A 3SUNA 1RT5A 4FLTA 1RT4A 3QIOA 1RT2A 4XIUA 3KK3A 2EHGA 4RW7A 3NAEA 3PO4A 4JRQA 3SQ1A 3SPYA 1U48A 1SKSA 5KTQA 1BQMA 4B9TA 2HW3A 1CXUA 1KFDA 2A1RA 3SI6A 1JLQA 1TK0A 1SL2A 4J2AA 1A5WA 1UAXA 2BE2A 3OY9A 2FBVA 3OYGA 4KRFA 1EXQA 3KLIA 3HJFA 3AVNA 3B6OA 3L8BA 4QCLA 1TKXA 3KLGA 4M3YA 3NDKA 3K58A 4GVMA 2B6AA 1VSKA 1NK7A 4PA1A 3T19A 1RBTA 1UA0A 3DOKA 4E7LA 3RMBA 4FYDA 1KVBA 2X74A 2ZQBA 3OJSA 2E6MA 2HNZA 3RRGA 1LAVA 1T05A 2QXFA 4FLYA 5I3UA 3RWUA 1F21A 2XY8A 1RDAA 3KJVA 3HPHA 4FVMA 5KRSA 4ICLA 1KSPA 3HT3A 4LD0A 4N56A 3SUOA 3THVA 4I9QA 4E7HA 1S1UA 3OYFA 3LZIA 3TAFA 3B6PA 4CJ3A 4HHTA 4BDZA 3SQ0A 4BDPA 4B3OA 5E41A 4FCYA 1KVCA
chains in the Genus database with same CATH superfamily
4H0XB 4CF8A 4CZIA 4KB1A 4DSIA 2HHTA 4C23A 3QERA 4DMNA 3QB0A 3LAKA 3ID8A 4NXMK 2P9PA 3KIOA 4A61A 1VQ5N 2HMIA 3NHGA 4Z4HA 1HJOA 1Q82O 3NGYA 3SYZA 4JKGA 1D8YA 1Q86O 4UY8O 3ENBA 3E1YA 5AQPA 1X3MA 3LZJA 1JKHA 1WSJA 4CGGA 1IBLK 4JD2A 2YCHA 3CC7N 3OS2A 1XHZA 1L3SA 2QEXN 4WE1A 3V1OA 4FWMA 1JCFA 1VSDA 4KH5A 4FM2A 2OTJN 4JAXA 4DSEA 5GAGP 2O8EB 3HRGA 4DTXA 3DRPA 5C2DA 3PIOL 4DTMA 3QMLA 3NH0A 3NCIA 1GLJO 1T3VA 3LPTA 4BRHA 3CCSN 2VGNA 2HHUA 3VQ8A 4DLEA 4FSVA 4R5PA 1HQEA 2VG7A 4HTLA 3VA0A 3LP0A 4C8MA 5AQVA 2KKZA 3JYTA 5AQMA 1DKGD 1W7AA 3T7ZA 4DV6K 5JVHL 4B9NA 1JLBA 4F8RA 4H4OA 4XH1A 1MWKA 2IC3A 3EZWA 3ALYA 5AQNA 1CLQA 1RT7A 2ASOA 4C1NK 4MO4A 3WNHA 4IOCL 3TAPA 4LF7K 1IH7A 3CHWA 2J4RA 3FZHA 5AR0A 4IFYA 3ZT3A 1KTQA 1SZ2A 3K5LA 1S22A 1U49A 4FW1A 1TAUA 4B3MK 4HUFA 4CIEA 1GOCA 1NKBA 1OVQA 4FLWA 2A40A 3UKRA 4IEEA 3H08A 1RDCA 3LALA 1NMDA 3SBGA 3NMUA 3THYA 4CEQA 3AA2A 3MEEA 1S6PA 4JKDA 4MLEA 4A2BA 4TSXA 4F9OA 4H0YB 3S9HA 3ZEUB 3O3FA 1BCMA 3AGKA 4IJNA 2YHBA 3F9MA 3C7NA 1C6VA 4JHDB 3ASMA 4FLZA 1VQ4N 2HHQA 1RBSA 1Q9XA 4DB3A 3LDNA 4GKJK 3O3GA 3PX0A 4B8AB 3I55N 4IO9L 1WSIA 1VQLN 5GINA 3J7AP 3QLHA 4BE1A 1X9WA 2O4IA 3GE1A 4H5WA 5BN8A 5BREA 5BR8K 1NK0A 1C1BA 4DFKA 1HNIA 1JL1A 4CBUA 3CJ9A 1RTIA 2GELA 3LDOA 4GV3A 4CHYA 3CF5L 2Z1JA 4PKIA 1VSLA 3U6FA 4OGEA 4PL8A 3ZT4A 1J6ZA 3AO1A 4BRLA 1NK8A 3U9ZA 5KGXA 4FXDA 4BR4A 1NGJA 4YNQA 1QSLA 4CJPA 2Q31A 3CI5A 2R7YA 4DV5K 2V7ZA 3H6EA 4I7FA 4LH4A 2X78A 3VEZA 3G25A 4M42A 5FLXO 1NGIA 3O6WA 4DTNA 4DR2K 2ZGYA 4Z4EA 1KVAA 3TSUA 1OH7A 3VESA 3CFRA 5AQXA 3FZMA 1NK9A 2QK9A 2JWKA 2JGUA 3QESA 3VGKA 5AZIB 3F73A 3WEEA 1NJWA 5J2NA 2BH1A 4FJMA 3LDLA 4JI8K 3ZETB 3VEWA 3TARA 4DFJA 4NO7A 3ZT2A 3S41A 4PY5A 4CJVA 4DTUA 5M1NA 1S3XA 5JLFA 4MDBA 4CHZA 5E26A 3ISNC 3AVFA 1RT3A 1ATNA 2HBMA 4CF2A 1RDBA 3QEIA 3TSPA 3DLLL 3H45C 2NLXA 3O80A 4L8RB 3HK2A 4CGDA 4FJJA 3RRHA 1QZ5A 2Z1IA 2YJEA 4FK0A 4MO5A 3CQ8A 3ZX3A 2P9KA 4JI6K 4CZJA 4WF9L 4DTSA 5BR9A 3OA9A 1D9FA 4DV1K 2D0BA 3LP2A 4J8FA 3D2EA 3V4IA 4H03B 4JNEA 3OVNA 4X64K 4KHUA 5HRRA 2P9IA 1IO2A 1VSMA 2WTUA 2Q97A 4M45A 3VPZA 2EWSA 4BG8A 4Z4FA 5LY3A 4ELTA 2YHYA 4B3SK 4BWJA 3ULEB 4DHYA 4E1MA 2G8FA 3LDPA 4M3RA 2GEMA 4DFPA 4CBWA 3LDQA 3OYKA 3WUHA 4BR9A 4CEZA 2KW4A 2ITMA 3H3OB 1VSFA 1GLDG 3BP8A 3M8PA 5HOOA 2JWLA 3CM6A 2HBLA 1J5OA 4ZTFA 2IAJA 1XMQK 3AVCA 1WAJA 2F8SA 2GUIA 2BDPA 1EKEA 4DR5K 1Z05A 2XO7A 2XHBA 2OPRA 4OPAA 1YF5L 1NOYA 4BRMA 3KD1E 2G8WA 3N4QA 3RMAA 3CD6N 3PLAA 2O8CA 3THXB 1NLVA 1RGIA 4FWNA 2BGGA 3I0RA 3WNFA 3L0QA 3L2WA 4KV8A 4N47A 5EU7A 1KLNA 4AHUA 3LANA 3LAMA 5AQKA 1H1VA 3A2FA 2IS3A 4GV6A 4LF9K 2P9IB 2YNFA 3AO2A 4YOUA 4CZFA 3K5OA 3P39A 1D5AA 1K8KB 4B1ZA 4IFEA 3ZETA 5C10A 3I8BA 3FFIA 1QS4A 2Q2RA 5AFUH 4DSJA 2RF2A 5AZJA 3SV3A 1UOCA 3DLRA 5CHIA 3UE5A 3DM2A 3HSCA 3SUPA 2YX6A 4H8KA 5HLFA 3WQTA 4WYBA 4JI2K 1ESVA 1VQNN 3OS1A 2FSKA 4JKHA 3DAWA 1GLEG 2NUBA 1KC8O 3AAPA 4Z0UA 1XMOK 1SKRA 1YVNA 3DJCA 4IDHA 3OYCA 4DV2K 3E66A 4B1VA 1A5VA 4J2BA 2CGKA 1NK5A 3EEQA 1NU0A 4IG0A 1HX1A 4EZ6A 4E89A 5KRTA 4OKKA 5EX5A 4FLUA 3AA3A 3WEEB 3ZSXA 5HRSA 3ZEUA 3BEXA 3ZSWA 2P9NA 2BANA 4DR3K 1RDUA 4A59A 4GKKK 1TK8A 2ASMA 3S3MA 1BO5O 3RR8A 4B3TK 4DSLA 2P9UA 4IKFA 3AVGA 4IXCA 3O5BA 3SUNA 1RT5A 2F9TA 4FLTA 3QIOA 4CCHA 5F2RA 3PO4A 4JRQA 3SQ1A 3SPYA 4BGBA 1SKSA 3IUCA 4J2AA 4GY2B 3VERA 3KHYA 3AY9A 3MMVA 2NRWA 3HJFA 3AVNA 3B6OA 2NRVA 4M3YA 3NDKA 3K58A 3HBTA 3MCPA 1UA0A 3DOKA 4E7LA 1KVBA 3KZBA 3F5TA 5GAEP 4A5AA 1HNWK 2WFBA 4FVMA 2HSTA 3HT3A 4N56A 4DV4K 4IJAA 1S1UA 4HHTA 1QQNA 1ZBSA 4FCYA 1L5UA 4LY7A 4C1NI 3FR0A 1VQPN 4B3RK 2D4WA 4FK4A 1B9DA 1VSJA 2DFEA 4FVUA 3AVHA 1LWEA 5FPEA 1X9MA 4AHVA 1NJIO 3VGLA 3D2EB 3VF6A 5ADXA 3CQYA 5JS2A 2HHXA 4DSKA 4CJWA 1N32K 2PYLA 4HCBA 2G8IA 2CGJA 1RBVA 2WOMA 1BOTO 4K25A 4DG1A 3G0ZA 1K73O 4BRIA 3FFKB 4LFBK 4CE9A 1U45A 1LWCA 4BRCA 1NK6A 1ZBUA 4BQZA 2D0OA 1K6YA 4DFMA 4BGAA 2IVPA 3UKRB 1QVFM 4PL7A 5M1KA 3CMAN 1QE1A 4CJKA 2P9NB 3OHRA 4F3TA 3P83D 2E2OA 5SWMA 3IMXA 5AQGA 1RDWX 3LP1A 4HUEA 3LP3A 3VQAA 3VN5A 4AHSA 1J53A 2F96A 4KHPK 2KFNA 1U2VA 3U8XA 4YHHK 3ZX2A 2O8FB 1UA1A 3TTFA 2YHXA 2AJQA 2PFUA 1FKOA 3IDHA 2O8DA 1NJXA 2KFZA 1YXQA 5AZJB 1YIJN 3CG7A 4FOEA 2G8VA 4WQ4A 1XUPO 4DWIA 3I33A 3QNOA 3H1QA 3VTIA 2HB5A 3PO5A 4CZEA 3ULEA 2B4JA 1DEJA 3T69A 4CZHA 4BQLA 1YTAA 4JK9A 3FLCO 5J1EA 1HNZK 1CZAN 1Q18A 1ATRA 4AHCA 4ISGA 4FZZA 1XQSC 5AZIA 4CJRA 4B08A 3DLGA 3VQ4A 3AARA 4FJIA 5BPNA 4Z4GA 3Q7CA 2HNDA 1RDDA 4CVNE 5KPTA 3TPQA 1W97L 3OYBA 3K5MA 1EX4A 2P9LB 3ZX0A 2BTFA 2DPNA 3IG1A 4Y0WA 2KZMA 1CZBA 4Z4IA 2LSNA 3KTQA 1SUQA 1HR0K 5DMRA 4KKOA 1LW0A 4LF5K 5F0XA 1NJYA 3MN7A 2ZJQL 1C0MA 4YY3K 2OPQA 2F9WA 3HM9A 1SKWA 2IIRA 1WBBA 1X3NA 4CECA 2W40A 2QWOA 3QNNA 4Z94A 3ULDA 3SAFA 1I94K 3SBTA 3AAQA 3OYNA 3M1FA 4KI6A 4JI4K 2HHVA 3S3OA 2FF6A 3HO1A 3OW2M 3CPEA 2Q1NA 4WFBL 3SPZA 1DGKN 1MA9B 2P9SB 4DQSA 4B9LA 1BI4A 3J8AA 4YOVA 3VETA 4H5NA 3JXUA 3KLFA 4NXNK 1HYZA 4CHPA 3RTVA 2UU9K 4CJEA 2D0CA 1C0GA 4JI3K 1HYVA 3L2QA 2FXUA 5LMNK 2B5JA 2GV9A 3KWIA 4HTUA 1BCOA 3BY5A 3M3ZA 3VMFB 4ILHA 4KB0A 3C95A 5F1XA 4B9QA 1VSIA 1YJWN 4FWRA 1Z26A 3RMDA 1Q8IA 3EYZA 1RCHA 3VEOA 4CGHA 3CFPA 4JLHA 1EETA 2W42A 5AQLA 3PX4A 4FW2A 3TWHA 3O08A 4DQRA 3ZT0A 3O3HA 3P31A 2E2PA 4FWOA 2YKMA 1TUUA 4CK2A 3JSMA 2QWLA 4FJGA 1ASUA 4LF4K 1TYQB 3R1XA 3C6UA 3CIPA 2Z1GA 3J7YP 1XWLA 1WSHA 1BL3A 3BUZB 1HPMA 1TVRA 1JLAA 2F7TA 3P1GA 3T3FA 4ISFA 3AO4A 4BR2A 5LMUK 4WFNL 1KAZA 2ZGZA 1WN7A 4M3WA 4NB4A 2PAVA 1XNRK 1IKWA 3BDPA 4FWSA 1G15A 3VEVA 4LFAK 1NGHA 1N6QA 4B1WB 1RTHA 1VRTA 1HNXK 3RR7A 3O9QA 3RSEB 4CIGA 1TV6A 2GX9A 3A0IX 2XRIA 4O8KA 4O55A 5M1OA 5FPDA 3M8RA 4BG9A 3AO3A 3VQCA 2X6SA 5K14A 3D2FB 1YJ9N 3QFPA 2W6KA 4E3SA 4WQ4C 4HVJA 2XY6A 1WBDA 1BUPA 1OH8A 4BC5A 1V4TA 3THWA 4JK7A 5GADP 1UWBA 3HPOA 4W5RA 3AVIA 1RBRA 4O0IA 2RKIA 4BRQA 1S5JA 4I6MA 4W5NA 3AA4A 1IJJA 1C1AA 2VG5A 3V9XA 2UUBK 2ZD1A 5HP1A 1JCEA 5AJ3K 5KPRA 3CCLN 2WONA 4FOIA 5AQIA 2KQ2A 3A5OC 3R8EA 3HOTA 4FJXA 3WNGA 3M6GA 4FO0A 2OYQA 1ZC6A 4FK2A 2Q0UA 5AFUA 1J54A 4B1UB 3TSQA 4PKGA 4Z4CA 2E2QA 3FGUA 3VTHA 4NLBA 3ZCMA 4NCGA 4CJ5A 4DU3A 3E9LA 3AVAA 2CH5A 3OYMA 3QO9A 5DK5A 4CGJA 3DRSA 1JXEA 1NKEA 1BQNA 5SZTA 2QWNA 4DU1A 3KK1A 3R6MA 4J2EA 3MXJA 4IG3A 1NG9A 5CYQA 2QXLA 1B9FA 4CGFA 1VSHA 3U4LA 1WNSA 4AH9A 2HMPA 3LPUA 4GW6A 2CH6A 2O8BB 3MECA 3DYAA 1VQ9N 2QA4N 3ITHA 1WB9A 4RWTA 4B9UA 3V1QA 4M3XA 3LWMA 3VQ9A 4ILGB 4BRPA 4WQ5C 4RG8A 3ZSVA 1QZ6A 3M5RA 4RW6A 2YJFA 3VENA 3H1VX 3V81A 3UIQA 4KPYA 4B9SA 1GLCG 5BRDA 4O5FA 1HLUA 1O1WA 1M1KO 3V9SA 3QEXA 5A2QO 1VQKN 3L3UA 4CEDA 3CJ1A 3CJCA 3C94A 5FPNA 4M3ZA 1BI4B 2D1KA 3EL2A 3G6EN 3ATVA 4FWPA 3TTDA 3L2RA 1JCGA 4DTPA 2E88A 1W0HA 4RW9A 4E7KA 4E19A 3PSIA 2VQFK 1RT4A 1RT2A 4B9VA 4WCEL 3T1YK 3P38A 2A1RA 2FSNA 3SI6A 1TK0A 1A5WA 2ZM6K 5KQDA 4KRFA 3KLIA 2YI1A 3L8BA 3WXLA 4X65K 4GVMA 4BR7A 4BREA 2AP1A 3A5NC 5CE3A 2V7YA 4FYDA 2NRHA 2E6MA 2HNZA 4CZMA 4DUZK 4FLYA 5I3UA 1SAZA 1KSPA 3HPHA 3SUOA 3WQUA 3THVA 4I9QA 4E7HA 3OYFA 5JVGL 1NGEA 2NZTA 4CJ3A 4BDZA 1YHQN 5C2FA 4PKHA 4IWVA 2FBYA 1C1CA 3TR8A 1NGCA 4OLBA 1KLMA 1WSEA 2O8FA 1P90A 3C6TA 4JHDA 3KWGA 1RBUA 4OKEA 5HBMA 4BC4A 1I39A 3R9PA 2RHKA 3CYMA 3T1HK 3J80O 4C8NA 4WQ5A 4JKBA 2OPPA 4O0JA 5JS1A 4K8ZA 3L3VA 3SZ2A 2ZJRL 5C12A 1XHXA 4BROA 3NFAA 4NCBA 4BR5A 4KBOA 4CGIA 1FKPA 2I7PA 1U6ZA 3U3GA 4X62K 4KTQA 2O8DB 1OH5A 2D0AA 4OPHA 5AQZA 4CJQA 1I3AA 1W9HA 1MWMA 4JI1K 3Q7BA 5MLCQ 3BZKA 1VQ8N 5I42A 2A42A 1OKJA 4C8LA 1BIZA 4AM6A 4CEBA 3OTOK 1C0UA 1P8ZA 3MX2A 3UKUB 3PSFA 3OYDA 4HCCA 4BRKA 1YT3A 4CK1A 2XY7A 1W2BM 3RMCA 4OO1J 3CMEN 4JK8A 4QS9A 1S6QA 4CHNA 1BU6O 5B8HA 4FJKA 1NK4A 5J2MA 2A5XA 3CCEN 5HRNA 4FLVA 3M8SA 4RTFD 5KI6A 5HL7L 3PV8A 1MU2A 4JKEA 4K8XA 3MCAB 3CXCM 4QOZB 1LAWA 2IVOA 4BACA 1LW2A 3K59A 3SMPA 2EX3A 4KI4A 2OPSA 4KREA 3NVKA 5H1SQ 2P1JA 4UQGA 1GLAG 4RW8A 5KQ8A 4CESA 3I56N 3CQXA 1VAZA 1S9EA 4B8CA 1YUWA 1VHXA 2QKKA 4FM1A 4CFAA 3EO3A 3EY1A 2HVHA 3G10A 1QVGM 3I0SA 2Z1HA 3EZ5A 5BPMA 1CZ9A 3D0PA 3QFUA 5CR4A 2E20A 4CD3A 4F4KA 1IKVA 3UKUA 2VG6A 1JLEA 1S1VA 2OZSA 1BGXT 4R79A 1MDUB 1KAYA 1T6DA 3MDQA 4AHRA 1E3MA 2DFFA 2A1SA 2Q36A 3TAQA 3VQDA 1KXPA 3D7EO 1Y64A 3CJAA 4YOYA 3O4WA 3OJUA 3CCUN 3MXMA 4U7BA 2E4LA 2RE2A 2KZZA 4OPJA 2IVNA 2E5LK 5IWAK 1YVUA 2PYJA 4ZTJA 4KHWA 4F2SA 4JYAK 4YOTA 3VQ5A 3SQ2A 4M3TA 2F4VK 3K2PA 1NGGA 2IDOA 2I5JA 1M90O 4CEAA 3CERA 3ZYYX 4NLCA 4M7XA 3CCMN 5IT9O 2HF3A 4ELUA 4FZYA 2OANA 3O4QA 4H4MA 3MEDA 3IKMA 4N41A 3AVJA 2GWJA 4JRPA 3ZSYA 4LSLA 4A2AA 1CXQA 3HP6A 2GUPA 3N4PA 3TABA 3P5JA 4BC2A 3AGRA 3NF7A 2HBJA 4CFCA 2G8HA 3SNNA 4G1QA 1WSFA 4DS5A 3UB5A 3K5NA 4H5TA 3ZT1A 2HHWA 3DMJA 1TKTA 4KHNA 1N33K 2A3ZA 3SJHA 4DQIA 5EOYA 4CJLA 3QETA 3AVKA 4RW4A 2FF3B 4OPKA 5AQHA 5AQOA 1JJ2M 3RSEA 3PIPL 4IOXA 1L3UA 3O9TA 3WNEA 4A5BA 5DM6L 2YV0X 4K0KK 3VF4A 4JI7K 4NCAA 1GLFO 2NRTA 3D45A 3SQ4A 1HQUA 2OA8A 2V52B 3DLEA 3SMSA 1BIUA 2FBXA 2YKNA 4BDYA 3KLHA 2QI2A 5T7BA 1VK0A 3AO5A 2VGMA 1RILA 4PHTX 4JI0K 3DLKA 4AILC 3O1WA 3H46O 4CD1A 1YI2N 1OH6A 3HVTA 3SCXA 4BRNA 3HTVA 3LDSA 4FPAA 4DR4K 2E1ZA 1C0TA 4DSFA 4FJHA 1TKZA 3SLCA 3C6AA 5AQRA 3VF2A 4LF6K 3LM9A 4AQYK 3TU5A 1JL2A 4CK3A 5FPMA 5C24A 1B92A 2UXDK 3AVBA 3R3LA 4H5VA 4JEPA 4KHSA 4CERA 1S1XA 3ZSQA 3VEXA 2QTDA 2VWJA 4J2DA 1VRUA 3A5MC 1L3VA 5HRPA 1NGFA 2NRZA 3D6RA 1E4FT 4BR0A 4CJSA 4V19S 4L3QA 3O8MA 4IZ9A 3VGMA 2D0PA 3JAMO 4M41A 1KQSM 3SAHA 1VQON 4ELVA 5M1QA 4CF9A 1T6CA 4BE2A 1DTTA 4C8KA 2ATQA 1K9MO 1A5XA 3SAGA 1Y97A 2PBDA 3F2KA 3E01A 1WLJA 1ATSA 2RN2A 4DKWA 3DXMB 1Z6RA 3CCRN 3A8YA 3WXMB 4Y1CA 2PZSA 5DM7L 1XI1A 4I9LA 1IG8A 4KTWA 3KKRA 1NKCA 4DV3K 1U2VB 5AQTA 1NJZA 5EY4A 3OYAA 3V9WA 4JD2B 4FPBA 5KGWA 4BWMA 3NGIA 2IOCA 4BRGA 2VWBA 4PUOA 4BE0A 4OKJA 1S9GA 3L6QA 3HYFA 4CEEA 2YNIA 1TK5A 2V51B 1U4BA 3C7NB 3NF8A 3E9PA 3TAGA 1L3TA 3O9SA 1NGBA 2P9SA 4CZGA 3OBYA 3G71N 3QDKA 1EWQA 3HZ6A 1YITN 4IOAL 3RVCA 1SL0A 3GL1A 2O4GA 4K41A 1K8AO 1IKXA 3LM2A 4CF0A 4GVEA 4M63C 3WT0A 4DV7K 1JLGA 4FWQA 2DTUA 1J5EK 1HYSA 1KD1O 3GDQA 2WBNA 5AQFA 3NF6A 5CZ2A 4E7IA 4QAGA 2HF4A 1TAQA 4EHUA 4CJFA 2HBKA 1QSYA 1HUXA 4JKAA 1TYQA 3DLBA 2P5OA 5D3GA 3HPGA 4DCHA 1XC3A 4IFVA 2DY4A 4KO0A 3PX6A 4OGCA 3QEPA 4I2QA 1S72N 4FJ5A 2H3GX 2E6LA 3QBXA 2UXBK 1NMNA 4FLXA 3TAEA 2UUCK 4JS5A 4C8OA 3HSTB 2HNYA 1RT6A 3NGZA 4XEIA 4YOWA 5E84A 3L4IA 4BRFA 4XIUA 3NAEA 2EHGA 1U48A 5KTQA 2HW3A 1KFDA 1JLQA 3B8AX 3W3DA 2BE2A 3WXIA 1EXQA 1SS6A 2QWMA 4YDUA 2B6AA 1VSKA 4PA1A 3T19A 3EN9A 4XH4A 2X74A 2QWRA 3OJSA 2KLAA 2A6AA 2KHOA 1T05A 2QXFA 4KH6A 3RWUA 2QKBA 1QHAA 4K43A 4BVOA 2GTDA 3LZIA 3TAFA 1KAXA 4BDPA 4B3OA 4EHTA 5E41A 2CGLA 2FSJA 1SQKA 1IG9A 4MFBA 3KVGA 2YNGA 1HKGA 2Y1JA 2ZJPL 4EAHD 1FK9A 4WFAL 1T7PA 5AQWA 3BGRA 4H0PA 3OYHA 4DQPA 3ZSRA 1ZBLA 5TKYA 3IS9A 4YDUC 4O44A 3THYB 5AQSA 1QTMA 1V4SA 3CC2N 3CFOA 3VQQA 4CZKA 4JS4A 4FJLA 3GG4A 5J2QA 1TL1A 4AF1A 3HXMA 3HVRA 3TI0A 4FWLA 1X1PA 5HROA 4ILJA 3BZCA 4F3OA 2GWKA 3O9RA 1J9AA 4KTZA 2DFHA 1SV5A 1ZBFA 4FJ7A 4IO8A 4Q5VA 2P51A 1JLCA 2ASPA 1ZBIA 4CW7B 4LFCK 4H5RA 3EKUA 4CF1A 4A57A 3O4NA 3ZSOA 1X9JA 4EP5A 4KHQA 1O13A 4MLHA 3NH2A 4NYNA 4DF8A 3C65A 4GNIA 5EVZA 5AQUA 5JICA 2ITGA 4DV0K 4BVPA 4FZXC 4KHYA 1DT9A 3KD5E 2W6LA 3IRXA 4GV9A 1R0AA 3WXKA 2HOEA 3SUQA 3KLEA 3VQ7A 2Q0RA 4DUYK 2O8EA 1RNHA 4CZLA 1GOAA 5C25A 2VWKA 5FROA 5KPZA 5J2PA 1VQMN 4PQUA 3DOLA 1S1TA 3G4SN 2O8CB 1TGOA 3QIPA 3CM5A 3NE6A 2GBZA 1LV5A 4CJTA 2P5GA 5LJWA 3QEVA 3FZFA 3DXKA 1ZBHA 1GLBG 3V9UA 1SL1A 2ZWHA 1JXBA 4IDKA 3DXKB 1RTJA 1VSEA 4YORA 3MN5A 4CEFA 3LL3A 1R59O 4DTOA 2UXCK 1NGAA 1YJNN 1D4XA 1EP4A 3O1BA 3WXJA 4CFBA 4JV5K 1KRPA 4HUGA 1XC9A 3VOVA 2QWQA 4QS7A 2E1YA 3EKSA 4KFBA 2D5RA 3P4IA 4A62A 2KTQA 4W5QA 1BHLA 4B1YB 1KCFA 4CFDA 3H3NO 2UYTA 4FWKA 3K0SA 2FBTA 1D9DA 3C0BA 1RFQA 4DR1K 3V9ZA 4XH5A 3KKSA 2Q3SA 4FM0A 3CCVN 3ZLJA 3DLHA 3M8QA 4ZHRA 2VQEK 3ENOA 4MQ3A 4OX9K 1HKBA 2JLEA 3OBWA 3MAQA 5ADXH 2P9UB 4CHOA 1JLFA 3VQ6A 4HWIA 2E2NA 2O8BA 4K42A 1QQOA 4EFHA 1HMVA 5C42A 3NBPA 4KH4A 4FJ8A 2P9PB 1N34K 3C6HA 1IV0A 5CYMA 1OVYA 3DWLA 3CJBA 1NBWA 1YTUA 2VCPA 4JI5K 3ID6A 2ZF5O 5C15A 4E1NA 4B9MA 4BRAA 1QSSA 1DLOA 2ETJA 4H0TB 3CPWM 1Z25A 1ZXOA 4ID1A 2QM1A 4FL9A 1S1WA 1NM1A 5M1PA 1ASWA 1NWKA 5ELZA 4O4GA 3ZSZA 1Q81O 3CCQN 3F9KA 4IBNA 3W0LA 2QWPA 3THXA 1HRHA 3QEWA 1GOBA 3VEYA 4FJ9A 3VQEA 5LJVA 3L2UA 4H0VB 4CHQA 2PY5A 2G8UA 3OS0A 3AV9A 1HJRA 5AQQA 3K9JA 4YOXA 1IKYA 4EIAA 3VQPA 4AHTA 3PUFA 4O8UA 3OYIA 3S3NA 4CIFA 1BWFO 1N36K 2HVIA 5GAHP 1ZYQA 5BPLA 1QQMA 4RCHA 3MN9A 1BDGA 2ZE2A 4QS8A 3AVMA 4E0DA 4X66K 1NNEA 4ID5A 4CBXA 3MWPA 1HNVA 4KAZA 3D2FA 5I9EB 4DLGA 3MXIA 2X6NA 3FZLA 4JN4A 4CEOA 3V6DA 5M1FA 4H0OA 1QHTA 4DU4A 2BUPA 1LOTB 4DTRA 4G9ZA 1TKDA 1NOZA 3FZKA 3FE1A 2OCEA 2HHHK 2YHAA 4NYFA 4OVLA 4EZ9A 2P9KB 3VQBA 4IEIA 2NNWA 1G99A 3IAYA 4N5SA 2QW9A 2WUSA 3CJ7A 3SJJA 1REVA 5TKWA 3KK2A 1N8RO 3E9OA 1BG3A 4YFUA 3OYLA 2NRXA 3DXMA 2OZMA 2YNHA 4Q0BA 1N5YA 5FRNA 3V1RA 1Q7YO 3MK6A 1FW6A 1ASVA 3IFRA 4LH5A 1WAFA 1HPZA 1K8KA 4W5OA 3AA5X 4JKGB 3L2VA 2UUAK 4W5TA 1WOQA 4FJNA 3U3YA 3LWLA 1DTQA 5GIOA 4I6MB 4DS4A 4N76A 2FLOA 1BISA 3HOSA 3OYEA 1EO1A 3JS6A 2AA4A 1GLLO 3THWB 2P9LA 3KK7A 3SV4A 5CZ1A 1ITGA 5BRFA 4BY9C 1EQYA 3OYJA 1Q9YA 4PWDA 1XNQK 1BA1A 3BF3A 4E1JA 4O5BA 2YHWA 2OTLN 4OLAA 4JKCA 4DQ8A 3L4QA 4F2RA 1IBKK 3TTCA 1X9SA 3K57A 1IBMK 2W41A 1TL3A 3VA3A 3U9DA 3NF9A 3MEGA 2G8KA 2RPIA 1T8EA 2XY5A 2IGIA 1U04A 3AVLA 3TAMA 3DI6A 2I7NA 4LF8K 4EP4A 3HI0A 3ATUA 5AQYA 2F8TA 2Y1IA 5GIPA 4E7JA 4CJ4A 3EE8A 1LWFA 3QBWA 5JMVA 1C0FA 4OJRA 1WSGA 2A41A 3BF1A 3GOIA 4LSNA 1WUAA 3MN6A 4M7YA 3QICA 4MDAA 5FRMA 5BN9A 3MWTA 5JLHA 3DRRA 3J7ZO 3T1AA 1QQCA 5CY4A 5AQJA 5LL6Z 5EXWA 4M3UA 4I2PA 2WC9A 3HL8A 3PY8A 5C0YA 3CC4N 4LC9B 4U67L 3I8DA 3NH1A 3HM8A 1T03A 1U47A 1TUYA 1RTDA 1FJGK 2E8AA 1LCUA 2FC0A 4CJUA 4DQQA 5FDLA 3TANA 3A5LC 1E4GT 2HHSA 4GMJB 3QINA 4CI6A 3MX5A 4Y1DA 1T44A 1RT1A 3CETA 3EE9A 3NVMA 4DF4A 2NRRA 1HKCA 1ILYA 1FXXA 1VQ6N 3HP9A 4BRDA 4DTJA 1KFSA 4BC3A 1YAGA 3KK3A 4JKFA 3O9UA 4RW7A 1VQ7N 4AM7A 3ENHA 1BQMA 4B9TA 1CXUA 3CCJN 1SL2A 3SK3A 1UAXA 3OY9A 4DR7K 2FBVA 3OYGA 2VYPA 4ISEA 4B1XB 4QCLA 1TKXA 3KLGA 3GBTA 1NGDA 4CJ7A 1NK7A 1RBTA 3RMBA 2ZQBA 3RRGA 1LAVA 1EWRA 1F21A 1RDAA 2XY8A 3K9KA 5KRSA 3KJVA 4ICLA 4LD0A 1BA0A 5BRHA 3B6PA 3SQ0A 3J81O 4DR6K 1KVCA
chains in the Genus database with same CATH topology
4CF8A 4LY7A 2FBYA 1C1CA 4KB1A 4DSIA 2HHTA 3TR8A 4FK4A 1IG9A 4OLBA 4MFBA 1B9DA 2YNGA 1KLMA 1VSJA 2DFEA 4DMNA 3QERA 1WSEA 2Y1JA 3C6TA 1RBUA 3AVHA 3LAKA 1FK9A 1LWEA 4OKEA 5HBMA 1T7PA 1X9MA 4AHVA 3KIOA 3BGRA 1I39A 3OYHA 2HMIA 3ZSRA 4DQPA 1ZBLA 3IS9A 3CYMA 3NHGA 5JS2A 4O44A 2HHXA 4Z4HA 4CJWA 1QTMA 4DSKA 2PYLA 4HCBA 4C8NA 2G8IA 2OPPA 1RBVA 3NGYA 2WOMA 4O0JA 5JS1A 3SYZA 3CFOA 1D8YA 4K8ZA 3VQQA 4DG1A 4JS4A 4FJLA 3L3VA 3SZ2A 5J2QA 1TL1A 3G0ZA 1XHXA 3HXMA 3HVRA 3TI0A 4CE9A 3LZJA 1U45A 3NFAA 1X1PA 1LWCA 4NCBA 5HROA 1JKHA 1WSJA 4CGGA 4CGIA 1NK6A 1FKPA 1ZBUA 4F3OA 1J9AA 3OS2A 4KTZA 2DFHA 1SV5A 1XHZA 1K6YA 1ZBFA 1L3SA 3U3GA 4DFMA 4FJ7A 4Q5VA 4KTQA 2P51A 1JLCA 1ZBIA 2D0AA 4WE1A 3V1OA 4CJQA 1I3AA 1W9HA 4CF1A 1VSDA 4FM2A 2OZMA 4Q0BA 3O4NA 1QE1A 3ZSOA 4CJKA 4F3TA 4EP5A 4KHQA 4DSEA 3P83D 5I42A 5SWMA 3NH2A 4C8LA 1BIZA 4NYNA 4DF8A 4CEBA 3LP1A 1C0UA 4HUEA 3DRPA 4DTXA 3LP3A 2ITGA 3VQAA 4FZXC 4KHYA 3VN5A 3OYDA 4AHSA 4DTMA 3KD5E 4HCCA 1J53A 3NH0A 2F96A 3IRXA 1YT3A 3NCIA 1R0AA 4CK1A 2XY7A 3KLEA 3SUQA 2KFNA 3VQ7A 3LPTA 3RMCA 1RNHA 1GOAA 1UA1A 5C25A 2VWKA 5FROA 2HHUA 1S6QA 3VQ8A 4CHNA 5J2PA 4DLEA 4PQUA 2AJQA 4FJKA 3DOLA 1S1TA 4R5PA 1FKOA 1NK4A 5J2MA 1HQEA 2VG7A 1TGOA 3QIPA 1NJXA 3CM5A 5HRNA 3NE6A 3VA0A 3LP0A 2GBZA 4FLVA 4C8MA 2KFZA 1LV5A 3CG7A 3M8SA 5KI6A 3PV8A 1MU2A 3JYTA 2G8VA 4CJTA 2P5GA 4DWIA 3QEVA 4K8XA 3QNOA 4B9NA 1JLBA 2HB5A 1ZBHA 3PO5A 4F8RA 4QOZB 4H4OA 1LAWA 4BACA 1LW2A 3K59A 3V9UA 2B4JA 2IC3A 2EX3A 4KI4A 1SL1A 2OPSA 4KREA 1JXBA 3ALYA 1CLQA 1RT7A 4IDKA 2P1JA 4UQGA 3TAPA 3WNHA 1RTJA 1YTAA 4RW8A 1VSEA 1IH7A 5J1EA 4CEFA 4CESA 4AHCA 4IFYA 3ZT3A 1KTQA 1S9EA 3K5LA 4B8CA 4DTOA 4FZZA 4CJRA 4B08A 2QKKA 3DLGA 4FM1A 1U49A 4FW1A 3VQ4A 4CFAA 1TAUA 1EP4A 4FJIA 4HUFA 4CIEA 4B9VA 3EY1A 1GOCA 1NKBA 4Z4GA 2HVHA 2HNDA 3G10A 1RDDA 4FLWA 3I0SA 4CFBA 3H08A 1RDCA 2Z1HA 1KRPA 3EZ5A 4HUGA 3OYBA 3LALA 1CZ9A 1XC9A 3K5MA 3D0PA 3AA2A 3MEEA 4TSXA 1S6PA 4CEQA 1EX4A 4KFBA 4F4KA 1IKVA 2D5RA 3S9HA 2VG6A 1JLEA 1S1VA 3O3FA 1BCMA 2KTQA 2YHBA 4W5QA 2OZSA 1BHLA 1BGXT 3IG1A 2KZMA 1C6VA 1CZBA 4Z4IA 2LSNA 1KCFA 4CFDA 3KTQA 1SUQA 3ASMA 4KKOA 5DMRA 1LW0A 4FLZA 2HHQA 1RBSA 1NJYA 4AHRA 2DFFA 2FBTA 2A1SA 1Q9XA 1D9DA 1C0MA 3TAQA 2OPQA 3VQDA 3HM9A 3V9ZA 3O3GA 1SKWA 3PX0A 4B8AB 1WSIA 3KKSA 2Q3SA 4FM0A 4CECA 3QLHA 3OJUA 4BE1A 3QNNA 3MXMA 1X9WA 2E4LA 3ULDA 3DLHA 3M8QA 2O4IA 4ZHRA 2KZZA 4OPJA 3OYNA 4MQ3A 4KI6A 2JLEA 1NK0A 1YVUA 1C1BA 4DFKA 4ZTJA 2PYJA 4F2SA 1HNIA 4KHWA 3MAQA 2QKBA 3S3OA 1JL1A 2HHVA 3VQ5A 4CHOA 3SQ2A 1JLFA 1RTIA 3HO1A 3VQ6A 4CHYA 4M3TA 2Z1JA 3K2PA 3SPZA 1VSLA 1HMVA 2IDOA 5C42A 3U6FA 4DQSA 2I5JA 3NBPA 4OGEA 3ZT4A 4CEAA 4B9LA 1BI4A 3AO1A 4FJ8A 1NK8A 5KGXA 3KLFA 4FXDA 1HYZA 4ELUA 5CYMA 4FZYA 4CHPA 4YNQA 3RTVA 3O4QA 4CJEA 1QSLA 4CJPA 2D0CA 1YTUA 1HYVA 4H4MA 3MEDA 3L2QA 2R7YA 4I7FA 4N41A 4E1NA 4LH4A 4B9MA 2X78A 3AVJA 4JRPA 1QSSA 4M42A 3ZSYA 2B5JA 4LSLA 1CXQA 2GV9A 3HP6A 4HTUA 1BCOA 3TABA 1DLOA 2ETJA 3P5JA 1Z25A 4DTNA 4ID1A 3NF7A 1S1WA 4CFCA 4Z4EA 1KVAA 2G8HA 4KB0A 1ASWA 3SNNA 3C95A 1WSFA 4G1QA 4DS5A 3K5NA 3CFRA 1VSIA 4O4GA 3ZSZA 3ZT1A 2HHWA 3DMJA 1TKTA 1Z26A 3F9KA 3RMDA 1NK9A 4KHNA 1Q8IA 2QK9A 3EYZA 4IBNA 2JGUA 1RCHA 1HRHA 3QESA 3QEWA 4DQIA 4CGHA 1GOBA 3CFPA 4FJ9A 4CJLA 3QETA 3F73A 3AVKA 1EETA 4JLHA 4RW4A 3VQEA 2W42A 3PX4A 4FW2A 4OPKA 3L2UA 3TWHA 1NJWA 4CHQA 5J2NA 4DQRA 2PY5A 4FJMA 3ZT0A 3O3HA 1L3UA 3WNEA 3AV9A 3OS0A 2G8UA 2YV0X 1HJRA 2YKMA 1IKYA 4CK2A 3JSMA 3VQPA 4NCAA 4AHTA 3D45A 3SQ4A 1HQUA 3TARA 2OA8A 4FJGA 1ASUA 3PUFA 3DLEA 3C6UA 3OYIA 4DFJA 3S3NA 3ZT2A 2Z1GA 4CIFA 1BIUA 4PY5A 2FBXA 4CJVA 2HVIA 2YKNA 1XWLA 4BDYA 1WSHA 3KLHA 1BL3A 4DTUA 1ZYQA 1L5UA 1TVRA 1JLAA 3P1GA 1VK0A 4CHZA 5T7BA 3AO5A 3ISNC 1RILA 3AO4A 3T3FA 3AVFA 1RT3A 2ZE2A 3AVMA 3DLKA 4E0DA 4CF2A 4AILC 1RDBA 1WN7A 3QEIA 4M3WA 4ID5A 1IKWA 3BDPA 4L8RB 3HK2A 4CGDA 4FJJA 1HNVA 4KAZA 1G15A 3HVTA 2Z1IA 3RRHA 3SCXA 4FK0A 3LDSA 3CQ8A 4DLGA 3MXIA 2X6NA 1N6QA 4CEOA 3V6DA 1RTHA 1VRTA 1C0TA 1QHTA 4DSFA 4DU4A 4DTSA 4FJHA 3RR7A 4CIGA 1TV6A 1TKZA 4DTRA 1D9FA 2D0BA 3LP2A 2XRIA 3V4IA 1TKDA 3OVNA 4KHUA 1NOZA 5HRRA 4O55A 1IO2A 1VSMA 2YHAA 1JL2A 4M45A 4CK3A 3M8RA 4NYFA 4OVLA 4EZ9A 5C24A 1B92A 3VQBA 3AO3A 3AVBA 2X6SA 3VQCA 5K14A 4CCHA 4Z4FA 4KHSA 4CERA 4E3SA 1S1XA 3ZSQA 4ELTA 4BWJA 4HVJA 2XY6A 3IAYA 2VWJA 4J2DA 4N5SA 4E1MA 2G8FA 1VRUA 4M3RA 1L3VA 4DFPA 5HRPA 1UWBA 3HPOA 3OYKA 4W5RA 3SJJA 4CEZA 1REVA 2KW4A 3AVIA 3KK2A 1RBRA 4CJSA 2RKIA 4O0IA 1VSFA 1S5JA 4YFUA 3M8PA 4W5NA 3OYLA 3AA4A 1C1AA 2YNHA 3CM6A 4M41A 1N5YA 2VG5A 3V9XA 3V1RA 2ZD1A 5HP1A 4ELVA 5FRNA 4CF9A 1ASVA 1J5OA 2WONA 1HPZA 1WAFA 4LH5A 2IAJA 3AA5X 4W5OA 3L2VA 2KQ2A 4W5TA 4BE2A 4ZTFA 3AVCA 1DTTA 1WAJA 4C8KA 2F8SA 2ATQA 1A5XA 2GUIA 1Y97A 3E01A 1WLJA 2BDPA 4FJNA 1EKEA 2RN2A 3U3YA 3LWLA 1DTQA 4FJXA 2XHBA 3WNGA 2XO7A 2OPRA 4DS4A 4N76A 2OYQA 1BISA 4FK2A 4Y1CA 2PZSA 1NOYA 3OYEA 1J54A 1XI1A 3KD1E 2G8WA 4I9LA 3RMAA 4Z4CA 2BGGA 3I0RA 4NCGA 4KTWA 3WNFA 3ZCMA 4CJ5A 3SV4A 4DU3A 5CZ1A 1ITGA 4KV8A 3L2WA 3KKRA 4N47A 5EU7A 3AVAA 3OYJA 1Q9YA 1NKCA 1KLNA 4PWDA 4AHUA 3LANA 1NJZA 3LAMA 3OYMA 3QO9A 4O5BA 5DK5A 3OYAA 4CGJA 3A2FA 3V9WA 3DRSA 1JXEA 4OLAA 2IS3A 1NKEA 1BQNA 5KGWA 4BWMA 5SZTA 3NGIA 4F2RA 1X9SA 2IOCA 3K57A 2YNFA 4DU1A 3VA3A 1TL3A 4BE0A 3AO2A 4OKJA 3KK1A 4PUOA 1S9GA 3NF9A 4J2EA 3MXJA 3HYFA 4CEEA 3MEGA 4IG3A 2YNIA 3K5OA 1TK5A 2G8KA 2RPIA 1D5AA 1U4BA 1T8EA 3NF8A 5CYQA 3TAGA 2XY5A 1L3TA 2IGIA 1U04A 3AVLA 3TAMA 3FFIA 3DI6A 1B9FA 1QS4A 4CGFA 4EP4A 2RF2A 4DSJA 2F8TA 2Y1IA 4E7JA 4CJ4A 1VSHA 1WNSA 3SV3A 4AH9A 1UOCA 1LWFA 3DLRA 1SL0A 3LPUA 4OJRA 4GW6A 1WSGA 2O4GA 3DM2A 3MECA 4LSNA 3DYAA 3SUPA 1IKXA 3ITHA 4CF0A 4H8KA 5FRMA 5HLFA 3DRRA 1JLGA 3T1AA 4B9UA 2DTUA 1QQCA 3OS1A 3V1QA 4M3XA 1HYSA 5CY4A 3LWMA 3VQ9A 4M3UA 4RG8A 3ZSVA 2NUBA 4I2PA 4Z0UA 3NF6A 5CZ2A 4E7IA 4QAGA 3HL8A 4RW6A 1SKRA 3PY8A 1TAQA 3OYCA 4CJFA 1A5VA 3V81A 3I8DA 1QSYA 3NH1A 3DLBA 2P5OA 4B9SA 3UIQA 1NK5A 1T03A 4J2BA 4KPYA 3HPGA 5D3GA 1U47A 4IFVA 2DY4A 4IG0A 1O1WA 4KO0A 1RTDA 3V9SA 4EZ6A 2FC0A 3QEXA 4E89A 5KRTA 4OGCA 3PX6A 4OKKA 3QEPA 4CJUA 4DQQA 4I2QA 3L3UA 5FDLA 4CEDA 4FLUA 3TANA 4FJ5A 3C94A 3AA3A 4M3ZA 1BI4B 2E6LA 3ZSXA 5HRSA 2HHSA 4FLXA 3TAEA 4GMJB 3QINA 3ZSWA 4JS5A 4C8OA 4Y1DA 1RT1A 3L2RA 3HSTB 2BANA 4DF4A 4DTPA 2HNYA 1TK8A 3S3MA 1FXXA 1RT6A 3RR8A 3NGZA 4DSLA 4IKFA 3HP9A 1W0HA 4RW9A 4DTJA 4E7KA 3AVGA 1KFSA 4E19A 3SUNA 1RT5A 4FLTA 1RT4A 3QIOA 1RT2A 4XIUA 3KK3A 2EHGA 4RW7A 3NAEA 3PO4A 4JRQA 3SQ1A 3SPYA 1U48A 1SKSA 5KTQA 1BQMA 4B9TA 2HW3A 1CXUA 1KFDA 2A1RA 3SI6A 1JLQA 1TK0A 1SL2A 4J2AA 1A5WA 1UAXA 2BE2A 3OY9A 2FBVA 3OYGA 4KRFA 1EXQA 3KLIA 3HJFA 3AVNA 3B6OA 3L8BA 4QCLA 1TKXA 3KLGA 4M3YA 3NDKA 3K58A 4GVMA 2B6AA 1VSKA 1NK7A 4PA1A 3T19A 1RBTA 1UA0A 3DOKA 4E7LA 3RMBA 4FYDA 1KVBA 2X74A 2ZQBA 3OJSA 2E6MA 2HNZA 3RRGA 1LAVA 1T05A 2QXFA 4FLYA 5I3UA 3RWUA 1F21A 2XY8A 1RDAA 3KJVA 3HPHA 4FVMA 5KRSA 4ICLA 1KSPA 3HT3A 4LD0A 4N56A 3SUOA 3THVA 4I9QA 4E7HA 1S1UA 3OYFA 3LZIA 3TAFA 3B6PA 4CJ3A 4HHTA 4BDZA 3SQ0A 4BDPA 4B3OA 5E41A 4FCYA 1KVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CF8 A;  4LY7 A;  2FBY A;  1C1C A;  4KB1 A;  4DSI A;  2HHT A;  3TR8 A;  4FK4 A;  1IG9 A;  4OLB A;  4MFB A;  1B9D A;  2YNG A;  1KLM A;  1VSJ A;  2DFE A;  4DMN A;  3QER A;  1WSE A;  2Y1J A;  3C6T A;  1RBU A;  3AVH A;  3LAK A;  1FK9 A;  1LWE A;  4OKE A;  5HBM A;  1T7P A;  1X9M A;  4AHV A;  3KIO A;  3BGR A;  1I39 A;  3OYH A;  2HMI A;  3ZSR A;  4DQP A;  1ZBL A;  3IS9 A;  3CYM A;  3NHG A;  5JS2 A;  4O44 A;  2HHX A;  4Z4H A;  4CJW A;  1QTM A;  4DSK A;  2PYL A;  4HCB A;  4C8N A;  2G8I A;  2OPP A;  1RBV A;  3NGY A;  2WOM A;  4O0J A;  5JS1 A;  3SYZ A;  3CFO A;  1D8Y A;  4K8Z A;  3VQQ A;  4DG1 A;  4JS4 A;  4FJL A;  3L3V A;  3SZ2 A;  5J2Q A;  1TL1 A;  3G0Z A;  1XHX A;  3HXM A;  3HVR A;  3TI0 A;  4CE9 A;  3LZJ A;  1U45 A;  3NFA A;  1X1P A;  1LWC A;  4NCB A;  5HRO A;  1JKH A;  1WSJ A;  4CGG A;  4CGI A;  1NK6 A;  1FKP A;  1ZBU A;  4F3O A;  1J9A A;  3OS2 A;  4KTZ A;  2DFH A;  1SV5 A;  1XHZ A;  1K6Y A;  1ZBF A;  1L3S A;  3U3G A;  4DFM A;  4FJ7 A;  4Q5V A;  4KTQ A;  2P51 A;  1JLC A;  1ZBI A;  2D0A A;  4WE1 A;  3V1O A;  4CJQ A;  1I3A A;  1W9H A;  4CF1 A;  1VSD A;  4FM2 A;  2OZM A;  4Q0B A;  3O4N A;  1QE1 A;  3ZSO A;  4CJK A;  4F3T A;  4EP5 A;  4KHQ A;  4DSE A;  3P83 D;  5I42 A;  5SWM A;  3NH2 A;  4C8L A;  1BIZ A;  4NYN A;  4DF8 A;  4CEB A;  3LP1 A;  1C0U A;  4HUE A;  3DRP A;  4DTX A;  3LP3 A;  2ITG A;  3VQA A;  4FZX C;  4KHY A;  3VN5 A;  3OYD A;  4AHS A;  4DTM A;  3KD5 E;  4HCC A;  1J53 A;  3NH0 A;  2F96 A;  3IRX A;  1YT3 A;  3NCI A;  1R0A A;  4CK1 A;  2XY7 A;  3KLE A;  3SUQ A;  2KFN A;  3VQ7 A;  3LPT A;  3RMC A;  1RNH A;  1GOA A;  1UA1 A;  5C25 A;  2VWK A;  5FRO A;  2HHU A;  1S6Q A;  3VQ8 A;  4CHN A;  5J2P A;  4DLE A;  4PQU A;  2AJQ A;  4FJK A;  3DOL A;  1S1T A;  4R5P A;  1FKO A;  1NK4 A;  5J2M A;  1HQE A;  2VG7 A;  1TGO A;  3QIP A;  1NJX A;  3CM5 A;  5HRN A;  3NE6 A;  3VA0 A;  3LP0 A;  2GBZ A;  4FLV A;  4C8M A;  2KFZ A;  1LV5 A;  3CG7 A;  3M8S A;  5KI6 A;  3PV8 A;  1MU2 A;  3JYT A;  2G8V A;  4CJT A;  2P5G A;  4DWI A;  3QEV A;  4K8X A;  3QNO A;  4B9N A;  1JLB A;  2HB5 A;  1ZBH A;  3PO5 A;  4F8R A;  4QOZ B;  4H4O A;  1LAW A;  4BAC A;  1LW2 A;  3K59 A;  3V9U A;  2B4J A;  2IC3 A;  2EX3 A;  4KI4 A;  1SL1 A;  2OPS A;  4KRE A;  1JXB A;  3ALY A;  1CLQ A;  1RT7 A;  4IDK A;  2P1J A;  4UQG A;  3TAP A;  3WNH A;  1RTJ A;  1YTA A;  4RW8 A;  1VSE A;  1IH7 A;  5J1E A;  4CEF A;  4CES A;  4AHC A;  4IFY A;  3ZT3 A;  1KTQ A;  1S9E A;  3K5L A;  4B8C A;  4DTO A;  4FZZ A;  4CJR A;  4B08 A;  2QKK A;  3DLG A;  4FM1 A;  1U49 A;  4FW1 A;  3VQ4 A;  4CFA A;  1TAU A;  1EP4 A;  4FJI A;  4HUF A;  4CIE A;  4B9V A;  3EY1 A;  1GOC A;  1NKB A;  4Z4G A;  2HVH A;  2HND A;  3G10 A;  1RDD A;  4FLW A;  3I0S A;  4CFB A;  3H08 A;  1RDC A;  2Z1H A;  1KRP A;  3EZ5 A;  4HUG A;  3OYB A;  3LAL A;  1CZ9 A;  1XC9 A;  3K5M A;  3D0P A;  3AA2 A;  3MEE A;  4TSX A;  1S6P A;  4CEQ A;  1EX4 A;  4KFB A;  4F4K A;  1IKV A;  2D5R A;  3S9H A;  2VG6 A;  1JLE A;  1S1V A;  3O3F A;  1BCM A;  2KTQ A;  2YHB A;  4W5Q A;  2OZS A;  1BHL A;  1BGX T;  3IG1 A;  2KZM A;  1C6V A;  1CZB A;  4Z4I A;  2LSN A;  1KCF A;  4CFD A;  3KTQ A;  1SUQ A;  3ASM A;  4KKO A;  5DMR A;  1LW0 A;  4FLZ A;  2HHQ A;  1RBS A;  1NJY A;  4AHR A;  2DFF A;  2FBT A;  2A1S A;  1Q9X A;  1D9D A;  1C0M A;  3TAQ A;  2OPQ A;  3VQD A;  3HM9 A;  3V9Z A;  3O3G A;  1SKW A;  3PX0 A;  4B8A B;  1WSI A;  3KKS A;  2Q3S A;  4FM0 A;  4CEC A;  3QLH A;  3OJU A;  4BE1 A;  3QNN A;  3MXM A;  1X9W A;  2E4L A;  3ULD A;  3DLH A;  3M8Q A;  2O4I A;  4ZHR A;  2KZZ A;  4OPJ A;  3OYN A;  4MQ3 A;  4KI6 A;  2JLE A;  1NK0 A;  1YVU A;  1C1B A;  4DFK A;  4ZTJ A;  2PYJ A;  4F2S A;  1HNI A;  4KHW A;  3MAQ A;  2QKB A;  3S3O A;  1JL1 A;  2HHV A;  3VQ5 A;  4CHO A;  3SQ2 A;  1JLF A;  1RTI A;  3HO1 A;  3VQ6 A;  4CHY A;  4M3T A;  2Z1J A;  3K2P A;  3SPZ A;  1VSL A;  1HMV A;  2IDO A;  5C42 A;  3U6F A;  4DQS A;  2I5J A;  3NBP A;  4OGE A;  3ZT4 A;  4CEA A;  4B9L A;  1BI4 A;  3AO1 A;  4FJ8 A;  1NK8 A;  5KGX A;  3KLF A;  4FXD A;  1HYZ A;  4ELU A;  5CYM A;  4FZY A;  4CHP A;  4YNQ A;  3RTV A;  3O4Q A;  4CJE A;  1QSL A;  4CJP A;  2D0C A;  1YTU A;  1HYV A;  4H4M A;  3MED A;  3L2Q A;  2R7Y A;  4I7F A;  4N41 A;  4E1N A;  4LH4 A;  4B9M A;  2X78 A;  3AVJ A;  4JRP A;  1QSS A;  4M42 A;  3ZSY A;  2B5J A;  4LSL A;  1CXQ A;  2GV9 A;  3HP6 A;  4HTU A;  1BCO A;  3TAB A;  1DLO A;  2ETJ A;  3P5J A;  1Z25 A;  4DTN A;  4ID1 A;  3NF7 A;  1S1W A;  4CFC A;  4Z4E A;  1KVA A;  2G8H A;  4KB0 A;  1ASW A;  3SNN A;  3C95 A;  1WSF A;  4G1Q A;  4DS5 A;  3K5N A;  3CFR A;  1VSI A;  4O4G A;  3ZSZ A;  3ZT1 A;  2HHW A;  3DMJ A;  1TKT A;  1Z26 A;  3F9K A;  3RMD A;  1NK9 A;  4KHN A;  1Q8I A;  2QK9 A;  3EYZ A;  4IBN A;  2JGU A;  1RCH A;  1HRH A;  3QES A;  3QEW A;  4DQI A;  4CGH A;  1GOB A;  3CFP A;  4FJ9 A;  4CJL A;  3QET A;  3F73 A;  3AVK A;  1EET A;  4JLH A;  4RW4 A;  3VQE A;  2W42 A;  3PX4 A;  4FW2 A;  4OPK A;  3L2U A;  3TWH A;  1NJW A;  4CHQ A;  5J2N A;  4DQR A;  2PY5 A;  4FJM A;  3ZT0 A;  3O3H A;  1L3U A;  3WNE A;  3AV9 A;  3OS0 A;  2G8U A;  2YV0 X;  1HJR A;  2YKM A;  1IKY A;  4CK2 A;  3JSM A;  3VQP A;  4NCA A;  4AHT A;  3D45 A;  3SQ4 A;  1HQU A;  3TAR A;  2OA8 A;  4FJG A;  1ASU A;  3PUF A;  3DLE A;  3C6U A;  3OYI A;  4DFJ A;  3S3N A;  3ZT2 A;  2Z1G A;  4CIF A;  1BIU A;  4PY5 A;  2FBX A;  4CJV A;  2HVI A;  2YKN A;  1XWL A;  4BDY A;  1WSH A;  3KLH A;  1BL3 A;  4DTU A;  1ZYQ A;  1L5U A;  1TVR A;  1JLA A;  3P1G A;  1VK0 A;  4CHZ A;  5T7B A;  3AO5 A;  3ISN C;  1RIL A;  3AO4 A;  3T3F A;  3AVF A;  1RT3 A;  2ZE2 A;  3AVM A;  3DLK A;  4E0D A;  4CF2 A;  4AIL C;  1RDB A;  1WN7 A;  3QEI A;  4M3W A;  4ID5 A;  1IKW A;  3BDP A;  4L8R B;  3HK2 A;  4CGD A;  4FJJ A;  1HNV A;  4KAZ A;  1G15 A;  3HVT A;  2Z1I A;  3RRH A;  3SCX A;  4FK0 A;  3LDS A;  3CQ8 A;  4DLG A;  3MXI A;  2X6N A;  1N6Q A;  4CEO A;  3V6D A;  1RTH A;  1VRT A;  1C0T A;  1QHT A;  4DSF A;  4DU4 A;  4DTS A;  4FJH A;  3RR7 A;  4CIG A;  1TV6 A;  1TKZ A;  4DTR A;  1D9F A;  2D0B A;  3LP2 A;  2XRI A;  3V4I A;  1TKD A;  3OVN A;  4KHU A;  1NOZ A;  5HRR A;  4O55 A;  1IO2 A;  1VSM A;  2YHA A;  1JL2 A;  4M45 A;  4CK3 A;  3M8R A;  4NYF A;  4OVL A;  4EZ9 A;  5C24 A;  1B92 A;  3VQB A;  3AO3 A;  3AVB A;  2X6S A;  3VQC A;  5K14 A;  4CCH A;  4Z4F A;  4KHS A;  4CER A;  4E3S A;  1S1X A;  3ZSQ A;  4ELT A;  4BWJ A;  4HVJ A;  2XY6 A;  3IAY A;  2VWJ A;  4J2D A;  4N5S A;  4E1M A;  2G8F A;  1VRU A;  4M3R A;  1L3V A;  4DFP A;  5HRP A;  1UWB A;  3HPO A;  3OYK A;  4W5R A;  3SJJ A;  4CEZ A;  1REV A;  2KW4 A;  3AVI A;  3KK2 A;  1RBR A;  4CJS A;  2RKI A;  4O0I A;  1VSF A;  1S5J A;  4YFU A;  3M8P A;  4W5N A;  3OYL A;  3AA4 A;  1C1A A;  2YNH A;  3CM6 A;  4M41 A;  1N5Y A;  2VG5 A;  3V9X A;  3V1R A;  2ZD1 A;  5HP1 A;  4ELV A;  5FRN A;  4CF9 A;  1ASV A;  1J5O A;  2WON A;  1HPZ A;  1WAF A;  4LH5 A;  2IAJ A;  3AA5 X;  4W5O A;  3L2V A;  2KQ2 A;  4W5T A;  4BE2 A;  4ZTF A;  3AVC A;  1DTT A;  1WAJ A;  4C8K A;  2F8S A;  2ATQ A;  1A5X A;  2GUI A;  1Y97 A;  3E01 A;  1WLJ A;  2BDP A;  4FJN A;  1EKE A;  2RN2 A;  3U3Y A;  3LWL A;  1DTQ A;  4FJX A;  2XHB A;  3WNG A;  2XO7 A;  2OPR A;  4DS4 A;  4N76 A;  2OYQ A;  1BIS A;  4FK2 A;  4Y1C A;  2PZS A;  1NOY A;  3OYE A;  1J54 A;  1XI1 A;  3KD1 E;  2G8W A;  4I9L A;  3RMA A;  4Z4C A;  2BGG A;  3I0R A;  4NCG A;  4KTW A;  3WNF A;  3ZCM A;  4CJ5 A;  3SV4 A;  4DU3 A;  5CZ1 A;  1ITG A;  4KV8 A;  3L2W A;  3KKR A;  4N47 A;  5EU7 A;  3AVA A;  3OYJ A;  1Q9Y A;  1NKC A;  1KLN A;  4PWD A;  4AHU A;  3LAN A;  1NJZ A;  3LAM A;  3OYM A;  3QO9 A;  4O5B A;  5DK5 A;  3OYA A;  4CGJ A;  3A2F A;  3V9W A;  3DRS A;  1JXE A;  4OLA A;  2IS3 A;  1NKE A;  1BQN A;  5KGW A;  4BWM A;  5SZT A;  3NGI A;  4F2R A;  1X9S A;  2IOC A;  3K57 A;  2YNF A;  4DU1 A;  3VA3 A;  1TL3 A;  4BE0 A;  3AO2 A;  4OKJ A;  3KK1 A;  4PUO A;  1S9G A;  3NF9 A;  4J2E A;  3MXJ A;  3HYF A;  4CEE A;  3MEG A;  4IG3 A;  2YNI A;  3K5O A;  1TK5 A;  2G8K A;  2RPI A;  1D5A A;  1U4B A;  1T8E A;  3NF8 A;  5CYQ A;  3TAG A;  2XY5 A;  1L3T A;  2IGI A;  1U04 A;  3AVL A;  3TAM A;  3FFI A;  3DI6 A;  1B9F A;  1QS4 A;  4CGF A;  4EP4 A;  2RF2 A;  4DSJ A;  2F8T A;  2Y1I A;  4E7J A;  4CJ4 A;  1VSH A;  1WNS A;  3SV3 A;  4AH9 A;  1UOC A;  1LWF A;  3DLR A;  1SL0 A;  3LPU A;  4OJR A;  4GW6 A;  1WSG A;  2O4G A;  3DM2 A;  3MEC A;  4LSN A;  3DYA A;  3SUP A;  1IKX A;  3ITH A;  4CF0 A;  4H8K A;  5FRM A;  5HLF A;  3DRR A;  1JLG A;  3T1A A;  4B9U A;  2DTU A;  1QQC A;  3OS1 A;  3V1Q A;  4M3X A;  1HYS A;  5CY4 A;  3LWM A;  3VQ9 A;  4M3U A;  4RG8 A;  3ZSV A;  2NUB A;  4I2P A;  4Z0U A;  3NF6 A;  5CZ2 A;  4E7I A;  4QAG A;  3HL8 A;  4RW6 A;  1SKR A;  3PY8 A;  1TAQ A;  3OYC A;  4CJF A;  1A5V A;  3V81 A;  3I8D A;  1QSY A;  3NH1 A;  3DLB A;  2P5O A;  4B9S A;  3UIQ A;  1NK5 A;  1T03 A;  4J2B A;  4KPY A;  3HPG A;  5D3G A;  1U47 A;  4IFV A;  2DY4 A;  4IG0 A;  1O1W A;  4KO0 A;  1RTD A;  3V9S A;  4EZ6 A;  2FC0 A;  3QEX A;  4E89 A;  5KRT A;  4OGC A;  3PX6 A;  4OKK A;  3QEP A;  4CJU A;  4DQQ A;  4I2Q A;  3L3U A;  5FDL A;  4CED A;  4FLU A;  3TAN A;  4FJ5 A;  3C94 A;  3AA3 A;  4M3Z A;  1BI4 B;  2E6L A;  3ZSX A;  5HRS A;  2HHS A;  4FLX A;  3TAE A;  4GMJ B;  3QIN A;  3ZSW A;  4JS5 A;  4C8O A;  4Y1D A;  1RT1 A;  3L2R A;  3HST B;  2BAN A;  4DF4 A;  4DTP A;  2HNY A;  1TK8 A;  3S3M A;  1FXX A;  1RT6 A;  3RR8 A;  3NGZ A;  4DSL A;  4IKF A;  3HP9 A;  1W0H A;  4RW9 A;  4DTJ A;  4E7K A;  3AVG A;  1KFS A;  4E19 A;  3SUN A;  1RT5 A;  4FLT A;  1RT4 A;  3QIO A;  1RT2 A;  4XIU A;  3KK3 A;  2EHG A;  4RW7 A;  3NAE A;  3PO4 A;  4JRQ A;  3SQ1 A;  3SPY A;  1U48 A;  1SKS A;  5KTQ A;  1BQM A;  4B9T A;  2HW3 A;  1CXU A;  1KFD A;  2A1R A;  3SI6 A;  1JLQ A;  1TK0 A;  1SL2 A;  4J2A A;  1A5W A;  1UAX A;  2BE2 A;  3OY9 A;  2FBV A;  3OYG A;  4KRF A;  1EXQ A;  3KLI A;  3HJF A;  3AVN A;  3B6O A;  3L8B A;  4QCL A;  1TKX A;  3KLG A;  4M3Y A;  3NDK A;  3K58 A;  4GVM A;  2B6A A;  1VSK A;  1NK7 A;  4PA1 A;  3T19 A;  1RBT A;  1UA0 A;  3DOK A;  4E7L A;  3RMB A;  4FYD A;  1KVB A;  2X74 A;  2ZQB A;  3OJS A;  2E6M A;  2HNZ A;  3RRG A;  1LAV A;  1T05 A;  2QXF A;  4FLY A;  5I3U A;  3RWU A;  1F21 A;  2XY8 A;  1RDA A;  3KJV A;  3HPH A;  4FVM A;  5KRS A;  4ICL A;  1KSP A;  3HT3 A;  4LD0 A;  4N56 A;  3SUO A;  3THV A;  4I9Q A;  4E7H A;  1S1U A;  3OYF A;  3LZI A;  3TAF A;  3B6P A;  4CJ3 A;  4HHT A;  4BDZ A;  3SQ0 A;  4BDP A;  4B3O A;  5E41 A;  4FCY A;  1KVC A; 
#chains in the Genus database with same CATH topology
 4H0X B;  4CF8 A;  4CZI A;  4KB1 A;  4DSI A;  2HHT A;  4C23 A;  3QER A;  4DMN A;  3QB0 A;  3LAK A;  3ID8 A;  4NXM K;  2P9P A;  3KIO A;  4A61 A;  1VQ5 N;  2HMI A;  3NHG A;  4Z4H A;  1HJO A;  1Q82 O;  3NGY A;  3SYZ A;  4JKG A;  1D8Y A;  1Q86 O;  4UY8 O;  3ENB A;  3E1Y A;  5AQP A;  1X3M A;  3LZJ A;  1JKH A;  1WSJ A;  4CGG A;  1IBL K;  4JD2 A;  2YCH A;  3CC7 N;  3OS2 A;  1XHZ A;  1L3S A;  2QEX N;  4WE1 A;  3V1O A;  4FWM A;  1JCF A;  1VSD A;  4KH5 A;  4FM2 A;  2OTJ N;  4JAX A;  4DSE A;  5GAG P;  2O8E B;  3HRG A;  4DTX A;  3DRP A;  5C2D A;  3PIO L;  4DTM A;  3QML A;  3NH0 A;  3NCI A;  1GLJ O;  1T3V A;  3LPT A;  4BRH A;  3CCS N;  2VGN A;  2HHU A;  3VQ8 A;  4DLE A;  4FSV A;  4R5P A;  1HQE A;  2VG7 A;  4HTL A;  3VA0 A;  3LP0 A;  4C8M A;  5AQV A;  2KKZ A;  3JYT A;  5AQM A;  1DKG D;  1W7A A;  3T7Z A;  4DV6 K;  5JVH L;  4B9N A;  1JLB A;  4F8R A;  4H4O A;  4XH1 A;  1MWK A;  2IC3 A;  3EZW A;  3ALY A;  5AQN A;  1CLQ A;  1RT7 A;  2ASO A;  4C1N K;  4MO4 A;  3WNH A;  4IOC L;  3TAP A;  4LF7 K;  1IH7 A;  3CHW A;  2J4R A;  3FZH A;  5AR0 A;  4IFY A;  3ZT3 A;  1KTQ A;  1SZ2 A;  3K5L A;  1S22 A;  1U49 A;  4FW1 A;  1TAU A;  4B3M K;  4HUF A;  4CIE A;  1GOC A;  1NKB A;  1OVQ A;  4FLW A;  2A40 A;  3UKR A;  4IEE A;  3H08 A;  1RDC A;  3LAL A;  1NMD A;  3SBG A;  3NMU A;  3THY A;  4CEQ A;  3AA2 A;  3MEE A;  1S6P A;  4JKD A;  4MLE A;  4A2B A;  4TSX A;  4F9O A;  4H0Y B;  3S9H A;  3ZEU B;  3O3F A;  1BCM A;  3AGK A;  4IJN A;  2YHB A;  3F9M A;  3C7N A;  1C6V A;  4JHD B;  3ASM A;  4FLZ A;  1VQ4 N;  2HHQ A;  1RBS A;  1Q9X A;  4DB3 A;  3LDN A;  4GKJ K;  3O3G A;  3PX0 A;  4B8A B;  3I55 N;  4IO9 L;  1WSI A;  1VQL N;  5GIN A;  3J7A P;  3QLH A;  4BE1 A;  1X9W A;  2O4I A;  3GE1 A;  4H5W A;  5BN8 A;  5BRE A;  5BR8 K;  1NK0 A;  1C1B A;  4DFK A;  1HNI A;  1JL1 A;  4CBU A;  3CJ9 A;  1RTI A;  2GEL A;  3LDO A;  4GV3 A;  4CHY A;  3CF5 L;  2Z1J A;  4PKI A;  1VSL A;  3U6F A;  4OGE A;  4PL8 A;  3ZT4 A;  1J6Z A;  3AO1 A;  4BRL A;  1NK8 A;  3U9Z A;  5KGX A;  4FXD A;  4BR4 A;  1NGJ A;  4YNQ A;  1QSL A;  4CJP A;  2Q31 A;  3CI5 A;  2R7Y A;  4DV5 K;  2V7Z A;  3H6E A;  4I7F A;  4LH4 A;  2X78 A;  3VEZ A;  3G25 A;  4M42 A;  5FLX O;  1NGI A;  3O6W A;  4DTN A;  4DR2 K;  2ZGY A;  4Z4E A;  1KVA A;  3TSU A;  1OH7 A;  3VES A;  3CFR A;  5AQX A;  3FZM A;  1NK9 A;  2QK9 A;  2JWK A;  2JGU A;  3QES A;  3VGK A;  5AZI B;  3F73 A;  3WEE A;  1NJW A;  5J2N A;  2BH1 A;  4FJM A;  3LDL A;  4JI8 K;  3ZET B;  3VEW A;  3TAR A;  4DFJ A;  4NO7 A;  3ZT2 A;  3S41 A;  4PY5 A;  4CJV A;  4DTU A;  5M1N A;  1S3X A;  5JLF A;  4MDB A;  4CHZ A;  5E26 A;  3ISN C;  3AVF A;  1RT3 A;  1ATN A;  2HBM A;  4CF2 A;  1RDB A;  3QEI A;  3TSP A;  3DLL L;  3H45 C;  2NLX A;  3O80 A;  4L8R B;  3HK2 A;  4CGD A;  4FJJ A;  3RRH A;  1QZ5 A;  2Z1I A;  2YJE A;  4FK0 A;  4MO5 A;  3CQ8 A;  3ZX3 A;  2P9K A;  4JI6 K;  4CZJ A;  4WF9 L;  4DTS A;  5BR9 A;  3OA9 A;  1D9F A;  4DV1 K;  2D0B A;  3LP2 A;  4J8F A;  3D2E A;  3V4I A;  4H03 B;  4JNE A;  3OVN A;  4X64 K;  4KHU A;  5HRR A;  2P9I A;  1IO2 A;  1VSM A;  2WTU A;  2Q97 A;  4M45 A;  3VPZ A;  2EWS A;  4BG8 A;  4Z4F A;  5LY3 A;  4ELT A;  2YHY A;  4B3S K;  4BWJ A;  3ULE B;  4DHY A;  4E1M A;  2G8F A;  3LDP A;  4M3R A;  2GEM A;  4DFP A;  4CBW A;  3LDQ A;  3OYK A;  3WUH A;  4BR9 A;  4CEZ A;  2KW4 A;  2ITM A;  3H3O B;  1VSF A;  1GLD G;  3BP8 A;  3M8P A;  5HOO A;  2JWL A;  3CM6 A;  2HBL A;  1J5O A;  4ZTF A;  2IAJ A;  1XMQ K;  3AVC A;  1WAJ A;  2F8S A;  2GUI A;  2BDP A;  1EKE A;  4DR5 K;  1Z05 A;  2XO7 A;  2XHB A;  2OPR A;  4OPA A;  1YF5 L;  1NOY A;  4BRM A;  3KD1 E;  2G8W A;  3N4Q A;  3RMA A;  3CD6 N;  3PLA A;  2O8C A;  3THX B;  1NLV A;  1RGI A;  4FWN A;  2BGG A;  3I0R A;  3WNF A;  3L0Q A;  3L2W A;  4KV8 A;  4N47 A;  5EU7 A;  1KLN A;  4AHU A;  3LAN A;  3LAM A;  5AQK A;  1H1V A;  3A2F A;  2IS3 A;  4GV6 A;  4LF9 K;  2P9I B;  2YNF A;  3AO2 A;  4YOU A;  4CZF A;  3K5O A;  3P39 A;  1D5A A;  1K8K B;  4B1Z A;  4IFE A;  3ZET A;  5C10 A;  3I8B A;  3FFI A;  1QS4 A;  2Q2R A;  5AFU H;  4DSJ A;  2RF2 A;  5AZJ A;  3SV3 A;  1UOC A;  3DLR A;  5CHI A;  3UE5 A;  3DM2 A;  3HSC A;  3SUP A;  2YX6 A;  4H8K A;  5HLF A;  3WQT A;  4WYB A;  4JI2 K;  1ESV A;  1VQN N;  3OS1 A;  2FSK A;  4JKH A;  3DAW A;  1GLE G;  2NUB A;  1KC8 O;  3AAP A;  4Z0U A;  1XMO K;  1SKR A;  1YVN A;  3DJC A;  4IDH A;  3OYC A;  4DV2 K;  3E66 A;  4B1V A;  1A5V A;  4J2B A;  2CGK A;  1NK5 A;  3EEQ A;  1NU0 A;  4IG0 A;  1HX1 A;  4EZ6 A;  4E89 A;  5KRT A;  4OKK A;  5EX5 A;  4FLU A;  3AA3 A;  3WEE B;  3ZSX A;  5HRS A;  3ZEU A;  3BEX A;  3ZSW A;  2P9N A;  2BAN A;  4DR3 K;  1RDU A;  4A59 A;  4GKK K;  1TK8 A;  2ASM A;  3S3M A;  1BO5 O;  3RR8 A;  4B3T K;  4DSL A;  2P9U A;  4IKF A;  3AVG A;  4IXC A;  3O5B A;  3SUN A;  1RT5 A;  2F9T A;  4FLT A;  3QIO A;  4CCH A;  5F2R A;  3PO4 A;  4JRQ A;  3SQ1 A;  3SPY A;  4BGB A;  1SKS A;  3IUC A;  4J2A A;  4GY2 B;  3VER A;  3KHY A;  3AY9 A;  3MMV A;  2NRW A;  3HJF A;  3AVN A;  3B6O A;  2NRV A;  4M3Y A;  3NDK A;  3K58 A;  3HBT A;  3MCP A;  1UA0 A;  3DOK A;  4E7L A;  1KVB A;  3KZB A;  3F5T A;  5GAE P;  4A5A A;  1HNW K;  2WFB A;  4FVM A;  2HST A;  3HT3 A;  4N56 A;  4DV4 K;  4IJA A;  1S1U A;  4HHT A;  1QQN A;  1ZBS A;  4FCY A;  1L5U A;  4LY7 A;  4C1N I;  3FR0 A;  1VQP N;  4B3R K;  2D4W A;  4FK4 A;  1B9D A;  1VSJ A;  2DFE A;  4FVU A;  3AVH A;  1LWE A;  5FPE A;  1X9M A;  4AHV A;  1NJI O;  3VGL A;  3D2E B;  3VF6 A;  5ADX A;  3CQY A;  5JS2 A;  2HHX A;  4DSK A;  4CJW A;  1N32 K;  2PYL A;  4HCB A;  2G8I A;  2CGJ A;  1RBV A;  2WOM A;  1BOT O;  4K25 A;  4DG1 A;  3G0Z A;  1K73 O;  4BRI A;  3FFK B;  4LFB K;  4CE9 A;  1U45 A;  1LWC A;  4BRC A;  1NK6 A;  1ZBU A;  4BQZ A;  2D0O A;  1K6Y A;  4DFM A;  4BGA A;  2IVP A;  3UKR B;  1QVF M;  4PL7 A;  5M1K A;  3CMA N;  1QE1 A;  4CJK A;  2P9N B;  3OHR A;  4F3T A;  3P83 D;  2E2O A;  5SWM A;  3IMX A;  5AQG A;  1RDW X;  3LP1 A;  4HUE A;  3LP3 A;  3VQA A;  3VN5 A;  4AHS A;  1J53 A;  2F96 A;  4KHP K;  2KFN A;  1U2V A;  3U8X A;  4YHH K;  3ZX2 A;  2O8F B;  1UA1 A;  3TTF A;  2YHX A;  2AJQ A;  2PFU A;  1FKO A;  3IDH A;  2O8D A;  1NJX A;  2KFZ A;  1YXQ A;  5AZJ B;  1YIJ N;  3CG7 A;  4FOE A;  2G8V A;  4WQ4 A;  1XUP O;  4DWI A;  3I33 A;  3QNO A;  3H1Q A;  3VTI A;  2HB5 A;  3PO5 A;  4CZE A;  3ULE A;  2B4J A;  1DEJ A;  3T69 A;  4CZH A;  4BQL A;  1YTA A;  4JK9 A;  3FLC O;  5J1E A;  1HNZ K;  1CZA N;  1Q18 A;  1ATR A;  4AHC A;  4ISG A;  4FZZ A;  1XQS C;  5AZI A;  4CJR A;  4B08 A;  3DLG A;  3VQ4 A;  3AAR A;  4FJI A;  5BPN A;  4Z4G A;  3Q7C A;  2HND A;  1RDD A;  4CVN E;  5KPT A;  3TPQ A;  1W97 L;  3OYB A;  3K5M A;  1EX4 A;  2P9L B;  3ZX0 A;  2BTF A;  2DPN A;  3IG1 A;  4Y0W A;  2KZM A;  1CZB A;  4Z4I A;  2LSN A;  3KTQ A;  1SUQ A;  1HR0 K;  5DMR A;  4KKO A;  1LW0 A;  4LF5 K;  5F0X A;  1NJY A;  3MN7 A;  2ZJQ L;  1C0M A;  4YY3 K;  2OPQ A;  2F9W A;  3HM9 A;  1SKW A;  2IIR A;  1WBB A;  1X3N A;  4CEC A;  2W40 A;  2QWO A;  3QNN A;  4Z94 A;  3ULD A;  3SAF A;  1I94 K;  3SBT A;  3AAQ A;  3OYN A;  3M1F A;  4KI6 A;  4JI4 K;  2HHV A;  3S3O A;  2FF6 A;  3HO1 A;  3OW2 M;  3CPE A;  2Q1N A;  4WFB L;  3SPZ A;  1DGK N;  1MA9 B;  2P9S B;  4DQS A;  4B9L A;  1BI4 A;  3J8A A;  4YOV A;  3VET A;  4H5N A;  3JXU A;  3KLF A;  4NXN K;  1HYZ A;  4CHP A;  3RTV A;  2UU9 K;  4CJE A;  2D0C A;  1C0G A;  4JI3 K;  1HYV A;  3L2Q A;  2FXU A;  5LMN K;  2B5J A;  2GV9 A;  3KWI A;  4HTU A;  1BCO A;  3BY5 A;  3M3Z A;  3VMF B;  4ILH A;  4KB0 A;  3C95 A;  5F1X A;  4B9Q A;  1VSI A;  1YJW N;  4FWR A;  1Z26 A;  3RMD A;  1Q8I A;  3EYZ A;  1RCH A;  3VEO A;  4CGH A;  3CFP A;  4JLH A;  1EET A;  2W42 A;  5AQL A;  3PX4 A;  4FW2 A;  3TWH A;  3O08 A;  4DQR A;  3ZT0 A;  3O3H A;  3P31 A;  2E2P A;  4FWO A;  2YKM A;  1TUU A;  4CK2 A;  3JSM A;  2QWL A;  4FJG A;  1ASU A;  4LF4 K;  1TYQ B;  3R1X A;  3C6U A;  3CIP A;  2Z1G A;  3J7Y P;  1XWL A;  1WSH A;  1BL3 A;  3BUZ B;  1HPM A;  1TVR A;  1JLA A;  2F7T A;  3P1G A;  3T3F A;  4ISF A;  3AO4 A;  4BR2 A;  5LMU K;  4WFN L;  1KAZ A;  2ZGZ A;  1WN7 A;  4M3W A;  4NB4 A;  2PAV A;  1XNR K;  1IKW A;  3BDP A;  4FWS A;  1G15 A;  3VEV A;  4LFA K;  1NGH A;  1N6Q A;  4B1W B;  1RTH A;  1VRT A;  1HNX K;  3RR7 A;  3O9Q A;  3RSE B;  4CIG A;  1TV6 A;  2GX9 A;  3A0I X;  2XRI A;  4O8K A;  4O55 A;  5M1O A;  5FPD A;  3M8R A;  4BG9 A;  3AO3 A;  3VQC A;  2X6S A;  5K14 A;  3D2F B;  1YJ9 N;  3QFP A;  2W6K A;  4E3S A;  4WQ4 C;  4HVJ A;  2XY6 A;  1WBD A;  1BUP A;  1OH8 A;  4BC5 A;  1V4T A;  3THW A;  4JK7 A;  5GAD P;  1UWB A;  3HPO A;  4W5R A;  3AVI A;  1RBR A;  4O0I A;  2RKI A;  4BRQ A;  1S5J A;  4I6M A;  4W5N A;  3AA4 A;  1IJJ A;  1C1A A;  2VG5 A;  3V9X A;  2UUB K;  2ZD1 A;  5HP1 A;  1JCE A;  5AJ3 K;  5KPR A;  3CCL N;  2WON A;  4FOI A;  5AQI A;  2KQ2 A;  3A5O C;  3R8E A;  3HOT A;  4FJX A;  3WNG A;  3M6G A;  4FO0 A;  2OYQ A;  1ZC6 A;  4FK2 A;  2Q0U A;  5AFU A;  1J54 A;  4B1U B;  3TSQ A;  4PKG A;  4Z4C A;  2E2Q A;  3FGU A;  3VTH A;  4NLB A;  3ZCM A;  4NCG A;  4CJ5 A;  4DU3 A;  3E9L A;  3AVA A;  2CH5 A;  3OYM A;  3QO9 A;  5DK5 A;  4CGJ A;  3DRS A;  1JXE A;  1NKE A;  1BQN A;  5SZT A;  2QWN A;  4DU1 A;  3KK1 A;  3R6M A;  4J2E A;  3MXJ A;  4IG3 A;  1NG9 A;  5CYQ A;  2QXL A;  1B9F A;  4CGF A;  1VSH A;  3U4L A;  1WNS A;  4AH9 A;  2HMP A;  3LPU A;  4GW6 A;  2CH6 A;  2O8B B;  3MEC A;  3DYA A;  1VQ9 N;  2QA4 N;  3ITH A;  1WB9 A;  4RWT A;  4B9U A;  3V1Q A;  4M3X A;  3LWM A;  3VQ9 A;  4ILG B;  4BRP A;  4WQ5 C;  4RG8 A;  3ZSV A;  1QZ6 A;  3M5R A;  4RW6 A;  2YJF A;  3VEN A;  3H1V X;  3V81 A;  3UIQ A;  4KPY A;  4B9S A;  1GLC G;  5BRD A;  4O5F A;  1HLU A;  1O1W A;  1M1K O;  3V9S A;  3QEX A;  5A2Q O;  1VQK N;  3L3U A;  4CED A;  3CJ1 A;  3CJC A;  3C94 A;  5FPN A;  4M3Z A;  1BI4 B;  2D1K A;  3EL2 A;  3G6E N;  3ATV A;  4FWP A;  3TTD A;  3L2R A;  1JCG A;  4DTP A;  2E88 A;  1W0H A;  4RW9 A;  4E7K A;  4E19 A;  3PSI A;  2VQF K;  1RT4 A;  1RT2 A;  4B9V A;  4WCE L;  3T1Y K;  3P38 A;  2A1R A;  2FSN A;  3SI6 A;  1TK0 A;  1A5W A;  2ZM6 K;  5KQD A;  4KRF A;  3KLI A;  2YI1 A;  3L8B A;  3WXL A;  4X65 K;  4GVM A;  4BR7 A;  4BRE A;  2AP1 A;  3A5N C;  5CE3 A;  2V7Y A;  4FYD A;  2NRH A;  2E6M A;  2HNZ A;  4CZM A;  4DUZ K;  4FLY A;  5I3U A;  1SAZ A;  1KSP A;  3HPH A;  3SUO A;  3WQU A;  3THV A;  4I9Q A;  4E7H A;  3OYF A;  5JVG L;  1NGE A;  2NZT A;  4CJ3 A;  4BDZ A;  1YHQ N;  5C2F A;  4PKH A;  4IWV A;  2FBY A;  1C1C A;  3TR8 A;  1NGC A;  4OLB A;  1KLM A;  1WSE A;  2O8F A;  1P90 A;  3C6T A;  4JHD A;  3KWG A;  1RBU A;  4OKE A;  5HBM A;  4BC4 A;  1I39 A;  3R9P A;  2RHK A;  3CYM A;  3T1H K;  3J80 O;  4C8N A;  4WQ5 A;  4JKB A;  2OPP A;  4O0J A;  5JS1 A;  4K8Z A;  3L3V A;  3SZ2 A;  2ZJR L;  5C12 A;  1XHX A;  4BRO A;  3NFA A;  4NCB A;  4BR5 A;  4KBO A;  4CGI A;  1FKP A;  2I7P A;  1U6Z A;  3U3G A;  4X62 K;  4KTQ A;  2O8D B;  1OH5 A;  2D0A A;  4OPH A;  5AQZ A;  4CJQ A;  1I3A A;  1W9H A;  1MWM A;  4JI1 K;  3Q7B A;  5MLC Q;  3BZK A;  1VQ8 N;  5I42 A;  2A42 A;  1OKJ A;  4C8L A;  1BIZ A;  4AM6 A;  4CEB A;  3OTO K;  1C0U A;  1P8Z A;  3MX2 A;  3UKU B;  3PSF A;  3OYD A;  4HCC A;  4BRK A;  1YT3 A;  4CK1 A;  2XY7 A;  1W2B M;  3RMC A;  4OO1 J;  3CME N;  4JK8 A;  4QS9 A;  1S6Q A;  4CHN A;  1BU6 O;  5B8H A;  4FJK A;  1NK4 A;  5J2M A;  2A5X A;  3CCE N;  5HRN A;  4FLV A;  3M8S A;  4RTF D;  5KI6 A;  5HL7 L;  3PV8 A;  1MU2 A;  4JKE A;  4K8X A;  3MCA B;  3CXC M;  4QOZ B;  1LAW A;  2IVO A;  4BAC A;  1LW2 A;  3K59 A;  3SMP A;  2EX3 A;  4KI4 A;  2OPS A;  4KRE A;  3NVK A;  5H1S Q;  2P1J A;  4UQG A;  1GLA G;  4RW8 A;  5KQ8 A;  4CES A;  3I56 N;  3CQX A;  1VAZ A;  1S9E A;  4B8C A;  1YUW A;  1VHX A;  2QKK A;  4FM1 A;  4CFA A;  3EO3 A;  3EY1 A;  2HVH A;  3G10 A;  1QVG M;  3I0S A;  2Z1H A;  3EZ5 A;  5BPM A;  1CZ9 A;  3D0P A;  3QFU A;  5CR4 A;  2E20 A;  4CD3 A;  4F4K A;  1IKV A;  3UKU A;  2VG6 A;  1JLE A;  1S1V A;  2OZS A;  1BGX T;  4R79 A;  1MDU B;  1KAY A;  1T6D A;  3MDQ A;  4AHR A;  1E3M A;  2DFF A;  2A1S A;  2Q36 A;  3TAQ A;  3VQD A;  1KXP A;  3D7E O;  1Y64 A;  3CJA A;  4YOY A;  3O4W A;  3OJU A;  3CCU N;  3MXM A;  4U7B A;  2E4L A;  2RE2 A;  2KZZ A;  4OPJ A;  2IVN A;  2E5L K;  5IWA K;  1YVU A;  2PYJ A;  4ZTJ A;  4KHW A;  4F2S A;  4JYA K;  4YOT A;  3VQ5 A;  3SQ2 A;  4M3T A;  2F4V K;  3K2P A;  1NGG A;  2IDO A;  2I5J A;  1M90 O;  4CEA A;  3CER A;  3ZYY X;  4NLC A;  4M7X A;  3CCM N;  5IT9 O;  2HF3 A;  4ELU A;  4FZY A;  2OAN A;  3O4Q A;  4H4M A;  3MED A;  3IKM A;  4N41 A;  3AVJ A;  2GWJ A;  4JRP A;  3ZSY A;  4LSL A;  4A2A A;  1CXQ A;  3HP6 A;  2GUP A;  3N4P A;  3TAB A;  3P5J A;  4BC2 A;  3AGR A;  3NF7 A;  2HBJ A;  4CFC A;  2G8H A;  3SNN A;  4G1Q A;  1WSF A;  4DS5 A;  3UB5 A;  3K5N A;  4H5T A;  3ZT1 A;  2HHW A;  3DMJ A;  1TKT A;  4KHN A;  1N33 K;  2A3Z A;  3SJH A;  4DQI A;  5EOY A;  4CJL A;  3QET A;  3AVK A;  4RW4 A;  2FF3 B;  4OPK A;  5AQH A;  5AQO A;  1JJ2 M;  3RSE A;  3PIP L;  4IOX A;  1L3U A;  3O9T A;  3WNE A;  4A5B A;  5DM6 L;  2YV0 X;  4K0K K;  3VF4 A;  4JI7 K;  4NCA A;  1GLF O;  2NRT A;  3D45 A;  3SQ4 A;  1HQU A;  2OA8 A;  2V52 B;  3DLE A;  3SMS A;  1BIU A;  2FBX A;  2YKN A;  4BDY A;  3KLH A;  2QI2 A;  5T7B A;  1VK0 A;  3AO5 A;  2VGM A;  1RIL A;  4PHT X;  4JI0 K;  3DLK A;  4AIL C;  3O1W A;  3H46 O;  4CD1 A;  1YI2 N;  1OH6 A;  3HVT A;  3SCX A;  4BRN A;  3HTV A;  3LDS A;  4FPA A;  4DR4 K;  2E1Z A;  1C0T A;  4DSF A;  4FJH A;  1TKZ A;  3SLC A;  3C6A A;  5AQR A;  3VF2 A;  4LF6 K;  3LM9 A;  4AQY K;  3TU5 A;  1JL2 A;  4CK3 A;  5FPM A;  5C24 A;  1B92 A;  2UXD K;  3AVB A;  3R3L A;  4H5V A;  4JEP A;  4KHS A;  4CER A;  1S1X A;  3ZSQ A;  3VEX A;  2QTD A;  2VWJ A;  4J2D A;  1VRU A;  3A5M C;  1L3V A;  5HRP A;  1NGF A;  2NRZ A;  3D6R A;  1E4F T;  4BR0 A;  4CJS A;  4V19 S;  4L3Q A;  3O8M A;  4IZ9 A;  3VGM A;  2D0P A;  3JAM O;  4M41 A;  1KQS M;  3SAH A;  1VQO N;  4ELV A;  5M1Q A;  4CF9 A;  1T6C A;  4BE2 A;  1DTT A;  4C8K A;  2ATQ A;  1K9M O;  1A5X A;  3SAG A;  1Y97 A;  2PBD A;  3F2K A;  3E01 A;  1WLJ A;  1ATS A;  2RN2 A;  4DKW A;  3DXM B;  1Z6R A;  3CCR N;  3A8Y A;  3WXM B;  4Y1C A;  2PZS A;  5DM7 L;  1XI1 A;  4I9L A;  1IG8 A;  4KTW A;  3KKR A;  1NKC A;  4DV3 K;  1U2V B;  5AQT A;  1NJZ A;  5EY4 A;  3OYA A;  3V9W A;  4JD2 B;  4FPB A;  5KGW A;  4BWM A;  3NGI A;  2IOC A;  4BRG A;  2VWB A;  4PUO A;  4BE0 A;  4OKJ A;  1S9G A;  3L6Q A;  3HYF A;  4CEE A;  2YNI A;  1TK5 A;  2V51 B;  1U4B A;  3C7N B;  3NF8 A;  3E9P A;  3TAG A;  1L3T A;  3O9S A;  1NGB A;  2P9S A;  4CZG A;  3OBY A;  3G71 N;  3QDK A;  1EWQ A;  3HZ6 A;  1YIT N;  4IOA L;  3RVC A;  1SL0 A;  3GL1 A;  2O4G A;  4K41 A;  1K8A O;  1IKX A;  3LM2 A;  4CF0 A;  4GVE A;  4M63 C;  3WT0 A;  4DV7 K;  1JLG A;  4FWQ A;  2DTU A;  1J5E K;  1HYS A;  1KD1 O;  3GDQ A;  2WBN A;  5AQF A;  3NF6 A;  5CZ2 A;  4E7I A;  4QAG A;  2HF4 A;  1TAQ A;  4EHU A;  4CJF A;  2HBK A;  1QSY A;  1HUX A;  4JKA A;  1TYQ A;  3DLB A;  2P5O A;  5D3G A;  3HPG A;  4DCH A;  1XC3 A;  4IFV A;  2DY4 A;  4KO0 A;  3PX6 A;  4OGC A;  3QEP A;  4I2Q A;  1S72 N;  4FJ5 A;  2H3G X;  2E6L A;  3QBX A;  2UXB K;  1NMN A;  4FLX A;  3TAE A;  2UUC K;  4JS5 A;  4C8O A;  3HST B;  2HNY A;  1RT6 A;  3NGZ A;  4XEI A;  4YOW A;  5E84 A;  3L4I A;  4BRF A;  4XIU A;  3NAE A;  2EHG A;  1U48 A;  5KTQ A;  2HW3 A;  1KFD A;  1JLQ A;  3B8A X;  3W3D A;  2BE2 A;  3WXI A;  1EXQ A;  1SS6 A;  2QWM A;  4YDU A;  2B6A A;  1VSK A;  4PA1 A;  3T19 A;  3EN9 A;  4XH4 A;  2X74 A;  2QWR A;  3OJS A;  2KLA A;  2A6A A;  2KHO A;  1T05 A;  2QXF A;  4KH6 A;  3RWU A;  2QKB A;  1QHA A;  4K43 A;  4BVO A;  2GTD A;  3LZI A;  3TAF A;  1KAX A;  4BDP A;  4B3O A;  4EHT A;  5E41 A;  2CGL A;  2FSJ A;  1SQK A;  1IG9 A;  4MFB A;  3KVG A;  2YNG A;  1HKG A;  2Y1J A;  2ZJP L;  4EAH D;  1FK9 A;  4WFA L;  1T7P A;  5AQW A;  3BGR A;  4H0P A;  3OYH A;  4DQP A;  3ZSR A;  1ZBL A;  5TKY A;  3IS9 A;  4YDU C;  4O44 A;  3THY B;  5AQS A;  1QTM A;  1V4S A;  3CC2 N;  3CFO A;  3VQQ A;  4CZK A;  4JS4 A;  4FJL A;  3GG4 A;  5J2Q A;  1TL1 A;  4AF1 A;  3HXM A;  3HVR A;  3TI0 A;  4FWL A;  1X1P A;  5HRO A;  4ILJ A;  3BZC A;  4F3O A;  2GWK A;  3O9R A;  1J9A A;  4KTZ A;  2DFH A;  1SV5 A;  1ZBF A;  4FJ7 A;  4IO8 A;  4Q5V A;  2P51 A;  1JLC A;  2ASP A;  1ZBI A;  4CW7 B;  4LFC K;  4H5R A;  3EKU A;  4CF1 A;  4A57 A;  3O4N A;  3ZSO A;  1X9J A;  4EP5 A;  4KHQ A;  1O13 A;  4MLH A;  3NH2 A;  4NYN A;  4DF8 A;  3C65 A;  4GNI A;  5EVZ A;  5AQU A;  5JIC A;  2ITG A;  4DV0 K;  4BVP A;  4FZX C;  4KHY A;  1DT9 A;  3KD5 E;  2W6L A;  3IRX A;  4GV9 A;  1R0A A;  3WXK A;  2HOE A;  3SUQ A;  3KLE A;  3VQ7 A;  2Q0R A;  4DUY K;  2O8E A;  1RNH A;  4CZL A;  1GOA A;  5C25 A;  2VWK A;  5FRO A;  5KPZ A;  5J2P A;  1VQM N;  4PQU A;  3DOL A;  1S1T A;  3G4S N;  2O8C B;  1TGO A;  3QIP A;  3CM5 A;  3NE6 A;  2GBZ A;  1LV5 A;  4CJT A;  2P5G A;  5LJW A;  3QEV A;  3FZF A;  3DXK A;  1ZBH A;  1GLB G;  3V9U A;  1SL1 A;  2ZWH A;  1JXB A;  4IDK A;  3DXK B;  1RTJ A;  1VSE A;  4YOR A;  3MN5 A;  4CEF A;  3LL3 A;  1R59 O;  4DTO A;  2UXC K;  1NGA A;  1YJN N;  1D4X A;  1EP4 A;  3O1B A;  3WXJ A;  4CFB A;  4JV5 K;  1KRP A;  4HUG A;  1XC9 A;  3VOV A;  2QWQ A;  4QS7 A;  2E1Y A;  3EKS A;  4KFB A;  2D5R A;  3P4I A;  4A62 A;  2KTQ A;  4W5Q A;  1BHL A;  4B1Y B;  1KCF A;  4CFD A;  3H3N O;  2UYT A;  4FWK A;  3K0S A;  2FBT A;  1D9D A;  3C0B A;  1RFQ A;  4DR1 K;  3V9Z A;  4XH5 A;  3KKS A;  2Q3S A;  4FM0 A;  3CCV N;  3ZLJ A;  3DLH A;  3M8Q A;  4ZHR A;  2VQE K;  3ENO A;  4MQ3 A;  4OX9 K;  1HKB A;  2JLE A;  3OBW A;  3MAQ A;  5ADX H;  2P9U B;  4CHO A;  1JLF A;  3VQ6 A;  4HWI A;  2E2N A;  2O8B A;  4K42 A;  1QQO A;  4EFH A;  1HMV A;  5C42 A;  3NBP A;  4KH4 A;  4FJ8 A;  2P9P B;  1N34 K;  3C6H A;  1IV0 A;  5CYM A;  1OVY A;  3DWL A;  3CJB A;  1NBW A;  1YTU A;  2VCP A;  4JI5 K;  3ID6 A;  2ZF5 O;  5C15 A;  4E1N A;  4B9M A;  4BRA A;  1QSS A;  1DLO A;  2ETJ A;  4H0T B;  3CPW M;  1Z25 A;  1ZXO A;  4ID1 A;  2QM1 A;  4FL9 A;  1S1W A;  1NM1 A;  5M1P A;  1ASW A;  1NWK A;  5ELZ A;  4O4G A;  3ZSZ A;  1Q81 O;  3CCQ N;  3F9K A;  4IBN A;  3W0L A;  2QWP A;  3THX A;  1HRH A;  3QEW A;  1GOB A;  3VEY A;  4FJ9 A;  3VQE A;  5LJV A;  3L2U A;  4H0V B;  4CHQ A;  2PY5 A;  2G8U A;  3OS0 A;  3AV9 A;  1HJR A;  5AQQ A;  3K9J A;  4YOX A;  1IKY A;  4EIA A;  3VQP A;  4AHT A;  3PUF A;  4O8U A;  3OYI A;  3S3N A;  4CIF A;  1BWF O;  1N36 K;  2HVI A;  5GAH P;  1ZYQ A;  5BPL A;  1QQM A;  4RCH A;  3MN9 A;  1BDG A;  2ZE2 A;  4QS8 A;  3AVM A;  4E0D A;  4X66 K;  1NNE A;  4ID5 A;  4CBX A;  3MWP A;  1HNV A;  4KAZ A;  3D2F A;  5I9E B;  4DLG A;  3MXI A;  2X6N A;  3FZL A;  4JN4 A;  4CEO A;  3V6D A;  5M1F A;  4H0O A;  1QHT A;  4DU4 A;  2BUP A;  1LOT B;  4DTR A;  4G9Z A;  1TKD A;  1NOZ A;  3FZK A;  3FE1 A;  2OCE A;  2HHH K;  2YHA A;  4NYF A;  4OVL A;  4EZ9 A;  2P9K B;  3VQB A;  4IEI A;  2NNW A;  1G99 A;  3IAY A;  4N5S A;  2QW9 A;  2WUS A;  3CJ7 A;  3SJJ A;  1REV A;  5TKW A;  3KK2 A;  1N8R O;  3E9O A;  1BG3 A;  4YFU A;  3OYL A;  2NRX A;  3DXM A;  2OZM A;  2YNH A;  4Q0B A;  1N5Y A;  5FRN A;  3V1R A;  1Q7Y O;  3MK6 A;  1FW6 A;  1ASV A;  3IFR A;  4LH5 A;  1WAF A;  1HPZ A;  1K8K A;  4W5O A;  3AA5 X;  4JKG B;  3L2V A;  2UUA K;  4W5T A;  1WOQ A;  4FJN A;  3U3Y A;  3LWL A;  1DTQ A;  5GIO A;  4I6M B;  4DS4 A;  4N76 A;  2FLO A;  1BIS A;  3HOS A;  3OYE A;  1EO1 A;  3JS6 A;  2AA4 A;  1GLL O;  3THW B;  2P9L A;  3KK7 A;  3SV4 A;  5CZ1 A;  1ITG A;  5BRF A;  4BY9 C;  1EQY A;  3OYJ A;  1Q9Y A;  4PWD A;  1XNQ K;  1BA1 A;  3BF3 A;  4E1J A;  4O5B A;  2YHW A;  2OTL N;  4OLA A;  4JKC A;  4DQ8 A;  3L4Q A;  4F2R A;  1IBK K;  3TTC A;  1X9S A;  3K57 A;  1IBM K;  2W41 A;  1TL3 A;  3VA3 A;  3U9D A;  3NF9 A;  3MEG A;  2G8K A;  2RPI A;  1T8E A;  2XY5 A;  2IGI A;  1U04 A;  3AVL A;  3TAM A;  3DI6 A;  2I7N A;  4LF8 K;  4EP4 A;  3HI0 A;  3ATU A;  5AQY A;  2F8T A;  2Y1I A;  5GIP A;  4E7J A;  4CJ4 A;  3EE8 A;  1LWF A;  3QBW A;  5JMV A;  1C0F A;  4OJR A;  1WSG A;  2A41 A;  3BF1 A;  3GOI A;  4LSN A;  1WUA A;  3MN6 A;  4M7Y A;  3QIC A;  4MDA A;  5FRM A;  5BN9 A;  3MWT A;  5JLH A;  3DRR A;  3J7Z O;  3T1A A;  1QQC A;  5CY4 A;  5AQJ A;  5LL6 Z;  5EXW A;  4M3U A;  4I2P A;  2WC9 A;  3HL8 A;  3PY8 A;  5C0Y A;  3CC4 N;  4LC9 B;  4U67 L;  3I8D A;  3NH1 A;  3HM8 A;  1T03 A;  1U47 A;  1TUY A;  1RTD A;  1FJG K;  2E8A A;  1LCU A;  2FC0 A;  4CJU A;  4DQQ A;  5FDL A;  3TAN A;  3A5L C;  1E4G T;  2HHS A;  4GMJ B;  3QIN A;  4CI6 A;  3MX5 A;  4Y1D A;  1T44 A;  1RT1 A;  3CET A;  3EE9 A;  3NVM A;  4DF4 A;  2NRR A;  1HKC A;  1ILY A;  1FXX A;  1VQ6 N;  3HP9 A;  4BRD A;  4DTJ A;  1KFS A;  4BC3 A;  1YAG A;  3KK3 A;  4JKF A;  3O9U A;  4RW7 A;  1VQ7 N;  4AM7 A;  3ENH A;  1BQM A;  4B9T A;  1CXU A;  3CCJ N;  1SL2 A;  3SK3 A;  1UAX A;  3OY9 A;  4DR7 K;  2FBV A;  3OYG A;  2VYP A;  4ISE A;  4B1X B;  4QCL A;  1TKX A;  3KLG A;  3GBT A;  1NGD A;  4CJ7 A;  1NK7 A;  1RBT A;  3RMB A;  2ZQB A;  3RRG A;  1LAV A;  1EWR A;  1F21 A;  1RDA A;  2XY8 A;  3K9K A;  5KRS A;  3KJV A;  4ICL A;  4LD0 A;  1BA0 A;  5BRH A;  3B6P A;  3SQ0 A;  3J81 O;  4DR6 K;  1KVC A; 
#chains in the Genus database with same CATH homology
 4CF8 A;  4LY7 A;  2FBY A;  1C1C A;  4KB1 A;  4DSI A;  2HHT A;  3TR8 A;  4FK4 A;  1IG9 A;  4OLB A;  4MFB A;  1B9D A;  2YNG A;  1KLM A;  1VSJ A;  2DFE A;  4DMN A;  3QER A;  1WSE A;  2Y1J A;  3C6T A;  1RBU A;  3AVH A;  3LAK A;  1FK9 A;  1LWE A;  4OKE A;  5HBM A;  1T7P A;  1X9M A;  4AHV A;  3KIO A;  3BGR A;  1I39 A;  3OYH A;  2HMI A;  3ZSR A;  4DQP A;  1ZBL A;  3IS9 A;  3CYM A;  3NHG A;  5JS2 A;  4O44 A;  2HHX A;  4Z4H A;  4CJW A;  1QTM A;  4DSK A;  2PYL A;  4HCB A;  4C8N A;  2G8I A;  2OPP A;  1RBV A;  3NGY A;  2WOM A;  4O0J A;  5JS1 A;  3SYZ A;  3CFO A;  1D8Y A;  4K8Z A;  3VQQ A;  4DG1 A;  4JS4 A;  4FJL A;  3L3V A;  3SZ2 A;  5J2Q A;  1TL1 A;  3G0Z A;  1XHX A;  3HXM A;  3HVR A;  3TI0 A;  4CE9 A;  3LZJ A;  1U45 A;  3NFA A;  1X1P A;  1LWC A;  4NCB A;  5HRO A;  1JKH A;  1WSJ A;  4CGG A;  4CGI A;  1NK6 A;  1FKP A;  1ZBU A;  4F3O A;  1J9A A;  3OS2 A;  4KTZ A;  2DFH A;  1SV5 A;  1XHZ A;  1K6Y A;  1ZBF A;  1L3S A;  3U3G A;  4DFM A;  4FJ7 A;  4Q5V A;  4KTQ A;  2P51 A;  1JLC A;  1ZBI A;  2D0A A;  4WE1 A;  3V1O A;  4CJQ A;  1I3A A;  1W9H A;  4CF1 A;  1VSD A;  4FM2 A;  2OZM A;  4Q0B A;  3O4N A;  1QE1 A;  3ZSO A;  4CJK A;  4F3T A;  4EP5 A;  4KHQ A;  4DSE A;  3P83 D;  5I42 A;  5SWM A;  3NH2 A;  4C8L A;  1BIZ A;  4NYN A;  4DF8 A;  4CEB A;  3LP1 A;  1C0U A;  4HUE A;  3DRP A;  4DTX A;  3LP3 A;  2ITG A;  3VQA A;  4FZX C;  4KHY A;  3VN5 A;  3OYD A;  4AHS A;  4DTM A;  3KD5 E;  4HCC A;  1J53 A;  3NH0 A;  2F96 A;  3IRX A;  1YT3 A;  3NCI A;  1R0A A;  4CK1 A;  2XY7 A;  3KLE A;  3SUQ A;  2KFN A;  3VQ7 A;  3LPT A;  3RMC A;  1RNH A;  1GOA A;  1UA1 A;  5C25 A;  2VWK A;  5FRO A;  2HHU A;  1S6Q A;  3VQ8 A;  4CHN A;  5J2P A;  4DLE A;  4PQU A;  2AJQ A;  4FJK A;  3DOL A;  1S1T A;  4R5P A;  1FKO A;  1NK4 A;  5J2M A;  1HQE A;  2VG7 A;  1TGO A;  3QIP A;  1NJX A;  3CM5 A;  5HRN A;  3NE6 A;  3VA0 A;  3LP0 A;  2GBZ A;  4FLV A;  4C8M A;  2KFZ A;  1LV5 A;  3CG7 A;  3M8S A;  5KI6 A;  3PV8 A;  1MU2 A;  3JYT A;  2G8V A;  4CJT A;  2P5G A;  4DWI A;  3QEV A;  4K8X A;  3QNO A;  4B9N A;  1JLB A;  2HB5 A;  1ZBH A;  3PO5 A;  4F8R A;  4QOZ B;  4H4O A;  1LAW A;  4BAC A;  1LW2 A;  3K59 A;  3V9U A;  2B4J A;  2IC3 A;  2EX3 A;  4KI4 A;  1SL1 A;  2OPS A;  4KRE A;  1JXB A;  3ALY A;  1CLQ A;  1RT7 A;  4IDK A;  2P1J A;  4UQG A;  3TAP A;  3WNH A;  1RTJ A;  1YTA A;  4RW8 A;  1VSE A;  1IH7 A;  5J1E A;  4CEF A;  4CES A;  4AHC A;  4IFY A;  3ZT3 A;  1KTQ A;  1S9E A;  3K5L A;  4B8C A;  4DTO A;  4FZZ A;  4CJR A;  4B08 A;  2QKK A;  3DLG A;  4FM1 A;  1U49 A;  4FW1 A;  3VQ4 A;  4CFA A;  1TAU A;  1EP4 A;  4FJI A;  4HUF A;  4CIE A;  4B9V A;  3EY1 A;  1GOC A;  1NKB A;  4Z4G A;  2HVH A;  2HND A;  3G10 A;  1RDD A;  4FLW A;  3I0S A;  4CFB A;  3H08 A;  1RDC A;  2Z1H A;  1KRP A;  3EZ5 A;  4HUG A;  3OYB A;  3LAL A;  1CZ9 A;  1XC9 A;  3K5M A;  3D0P A;  3AA2 A;  3MEE A;  4TSX A;  1S6P A;  4CEQ A;  1EX4 A;  4KFB A;  4F4K A;  1IKV A;  2D5R A;  3S9H A;  2VG6 A;  1JLE A;  1S1V A;  3O3F A;  1BCM A;  2KTQ A;  2YHB A;  4W5Q A;  2OZS A;  1BHL A;  1BGX T;  3IG1 A;  2KZM A;  1C6V A;  1CZB A;  4Z4I A;  2LSN A;  1KCF A;  4CFD A;  3KTQ A;  1SUQ A;  3ASM A;  4KKO A;  5DMR A;  1LW0 A;  4FLZ A;  2HHQ A;  1RBS A;  1NJY A;  4AHR A;  2DFF A;  2FBT A;  2A1S A;  1Q9X A;  1D9D A;  1C0M A;  3TAQ A;  2OPQ A;  3VQD A;  3HM9 A;  3V9Z A;  3O3G A;  1SKW A;  3PX0 A;  4B8A B;  1WSI A;  3KKS A;  2Q3S A;  4FM0 A;  4CEC A;  3QLH A;  3OJU A;  4BE1 A;  3QNN A;  3MXM A;  1X9W A;  2E4L A;  3ULD A;  3DLH A;  3M8Q A;  2O4I A;  4ZHR A;  2KZZ A;  4OPJ A;  3OYN A;  4MQ3 A;  4KI6 A;  2JLE A;  1NK0 A;  1YVU A;  1C1B A;  4DFK A;  4ZTJ A;  2PYJ A;  4F2S A;  1HNI A;  4KHW A;  3MAQ A;  2QKB A;  3S3O A;  1JL1 A;  2HHV A;  3VQ5 A;  4CHO A;  3SQ2 A;  1JLF A;  1RTI A;  3HO1 A;  3VQ6 A;  4CHY A;  4M3T A;  2Z1J A;  3K2P A;  3SPZ A;  1VSL A;  1HMV A;  2IDO A;  5C42 A;  3U6F A;  4DQS A;  2I5J A;  3NBP A;  4OGE A;  3ZT4 A;  4CEA A;  4B9L A;  1BI4 A;  3AO1 A;  4FJ8 A;  1NK8 A;  5KGX A;  3KLF A;  4FXD A;  1HYZ A;  4ELU A;  5CYM A;  4FZY A;  4CHP A;  4YNQ A;  3RTV A;  3O4Q A;  4CJE A;  1QSL A;  4CJP A;  2D0C A;  1YTU A;  1HYV A;  4H4M A;  3MED A;  3L2Q A;  2R7Y A;  4I7F A;  4N41 A;  4E1N A;  4LH4 A;  4B9M A;  2X78 A;  3AVJ A;  4JRP A;  1QSS A;  4M42 A;  3ZSY A;  2B5J A;  4LSL A;  1CXQ A;  2GV9 A;  3HP6 A;  4HTU A;  1BCO A;  3TAB A;  1DLO A;  2ETJ A;  3P5J A;  1Z25 A;  4DTN A;  4ID1 A;  3NF7 A;  1S1W A;  4CFC A;  4Z4E A;  1KVA A;  2G8H A;  4KB0 A;  1ASW A;  3SNN A;  3C95 A;  1WSF A;  4G1Q A;  4DS5 A;  3K5N A;  3CFR A;  1VSI A;  4O4G A;  3ZSZ A;  3ZT1 A;  2HHW A;  3DMJ A;  1TKT A;  1Z26 A;  3F9K A;  3RMD A;  1NK9 A;  4KHN A;  1Q8I A;  2QK9 A;  3EYZ A;  4IBN A;  2JGU A;  1RCH A;  1HRH A;  3QES A;  3QEW A;  4DQI A;  4CGH A;  1GOB A;  3CFP A;  4FJ9 A;  4CJL A;  3QET A;  3F73 A;  3AVK A;  1EET A;  4JLH A;  4RW4 A;  3VQE A;  2W42 A;  3PX4 A;  4FW2 A;  4OPK A;  3L2U A;  3TWH A;  1NJW A;  4CHQ A;  5J2N A;  4DQR A;  2PY5 A;  4FJM A;  3ZT0 A;  3O3H A;  1L3U A;  3WNE A;  3AV9 A;  3OS0 A;  2G8U A;  2YV0 X;  1HJR A;  2YKM A;  1IKY A;  4CK2 A;  3JSM A;  3VQP A;  4NCA A;  4AHT A;  3D45 A;  3SQ4 A;  1HQU A;  3TAR A;  2OA8 A;  4FJG A;  1ASU A;  3PUF A;  3DLE A;  3C6U A;  3OYI A;  4DFJ A;  3S3N A;  3ZT2 A;  2Z1G A;  4CIF A;  1BIU A;  4PY5 A;  2FBX A;  4CJV A;  2HVI A;  2YKN A;  1XWL A;  4BDY A;  1WSH A;  3KLH A;  1BL3 A;  4DTU A;  1ZYQ A;  1L5U A;  1TVR A;  1JLA A;  3P1G A;  1VK0 A;  4CHZ A;  5T7B A;  3AO5 A;  3ISN C;  1RIL A;  3AO4 A;  3T3F A;  3AVF A;  1RT3 A;  2ZE2 A;  3AVM A;  3DLK A;  4E0D A;  4CF2 A;  4AIL C;  1RDB A;  1WN7 A;  3QEI A;  4M3W A;  4ID5 A;  1IKW A;  3BDP A;  4L8R B;  3HK2 A;  4CGD A;  4FJJ A;  1HNV A;  4KAZ A;  1G15 A;  3HVT A;  2Z1I A;  3RRH A;  3SCX A;  4FK0 A;  3LDS A;  3CQ8 A;  4DLG A;  3MXI A;  2X6N A;  1N6Q A;  4CEO A;  3V6D A;  1RTH A;  1VRT A;  1C0T A;  1QHT A;  4DSF A;  4DU4 A;  4DTS A;  4FJH A;  3RR7 A;  4CIG A;  1TV6 A;  1TKZ A;  4DTR A;  1D9F A;  2D0B A;  3LP2 A;  2XRI A;  3V4I A;  1TKD A;  3OVN A;  4KHU A;  1NOZ A;  5HRR A;  4O55 A;  1IO2 A;  1VSM A;  2YHA A;  1JL2 A;  4M45 A;  4CK3 A;  3M8R A;  4NYF A;  4OVL A;  4EZ9 A;  5C24 A;  1B92 A;  3VQB A;  3AO3 A;  3AVB A;  2X6S A;  3VQC A;  5K14 A;  4CCH A;  4Z4F A;  4KHS A;  4CER A;  4E3S A;  1S1X A;  3ZSQ A;  4ELT A;  4BWJ A;  4HVJ A;  2XY6 A;  3IAY A;  2VWJ A;  4J2D A;  4N5S A;  4E1M A;  2G8F A;  1VRU A;  4M3R A;  1L3V A;  4DFP A;  5HRP A;  1UWB A;  3HPO A;  3OYK A;  4W5R A;  3SJJ A;  4CEZ A;  1REV A;  2KW4 A;  3AVI A;  3KK2 A;  1RBR A;  4CJS A;  2RKI A;  4O0I A;  1VSF A;  1S5J A;  4YFU A;  3M8P A;  4W5N A;  3OYL A;  3AA4 A;  1C1A A;  2YNH A;  3CM6 A;  4M41 A;  1N5Y A;  2VG5 A;  3V9X A;  3V1R A;  2ZD1 A;  5HP1 A;  4ELV A;  5FRN A;  4CF9 A;  1ASV A;  1J5O A;  2WON A;  1HPZ A;  1WAF A;  4LH5 A;  2IAJ A;  3AA5 X;  4W5O A;  3L2V A;  2KQ2 A;  4W5T A;  4BE2 A;  4ZTF A;  3AVC A;  1DTT A;  1WAJ A;  4C8K A;  2F8S A;  2ATQ A;  1A5X A;  2GUI A;  1Y97 A;  3E01 A;  1WLJ A;  2BDP A;  4FJN A;  1EKE A;  2RN2 A;  3U3Y A;  3LWL A;  1DTQ A;  4FJX A;  2XHB A;  3WNG A;  2XO7 A;  2OPR A;  4DS4 A;  4N76 A;  2OYQ A;  1BIS A;  4FK2 A;  4Y1C A;  2PZS A;  1NOY A;  3OYE A;  1J54 A;  1XI1 A;  3KD1 E;  2G8W A;  4I9L A;  3RMA A;  4Z4C A;  2BGG A;  3I0R A;  4NCG A;  4KTW A;  3WNF A;  3ZCM A;  4CJ5 A;  3SV4 A;  4DU3 A;  5CZ1 A;  1ITG A;  4KV8 A;  3L2W A;  3KKR A;  4N47 A;  5EU7 A;  3AVA A;  3OYJ A;  1Q9Y A;  1NKC A;  1KLN A;  4PWD A;  4AHU A;  3LAN A;  1NJZ A;  3LAM A;  3OYM A;  3QO9 A;  4O5B A;  5DK5 A;  3OYA A;  4CGJ A;  3A2F A;  3V9W A;  3DRS A;  1JXE A;  4OLA A;  2IS3 A;  1NKE A;  1BQN A;  5KGW A;  4BWM A;  5SZT A;  3NGI A;  4F2R A;  1X9S A;  2IOC A;  3K57 A;  2YNF A;  4DU1 A;  3VA3 A;  1TL3 A;  4BE0 A;  3AO2 A;  4OKJ A;  3KK1 A;  4PUO A;  1S9G A;  3NF9 A;  4J2E A;  3MXJ A;  3HYF A;  4CEE A;  3MEG A;  4IG3 A;  2YNI A;  3K5O A;  1TK5 A;  2G8K A;  2RPI A;  1D5A A;  1U4B A;  1T8E A;  3NF8 A;  5CYQ A;  3TAG A;  2XY5 A;  1L3T A;  2IGI A;  1U04 A;  3AVL A;  3TAM A;  3FFI A;  3DI6 A;  1B9F A;  1QS4 A;  4CGF A;  4EP4 A;  2RF2 A;  4DSJ A;  2F8T A;  2Y1I A;  4E7J A;  4CJ4 A;  1VSH A;  1WNS A;  3SV3 A;  4AH9 A;  1UOC A;  1LWF A;  3DLR A;  1SL0 A;  3LPU A;  4OJR A;  4GW6 A;  1WSG A;  2O4G A;  3DM2 A;  3MEC A;  4LSN A;  3DYA A;  3SUP A;  1IKX A;  3ITH A;  4CF0 A;  4H8K A;  5FRM A;  5HLF A;  3DRR A;  1JLG A;  3T1A A;  4B9U A;  2DTU A;  1QQC A;  3OS1 A;  3V1Q A;  4M3X A;  1HYS A;  5CY4 A;  3LWM A;  3VQ9 A;  4M3U A;  4RG8 A;  3ZSV A;  2NUB A;  4I2P A;  4Z0U A;  3NF6 A;  5CZ2 A;  4E7I A;  4QAG A;  3HL8 A;  4RW6 A;  1SKR A;  3PY8 A;  1TAQ A;  3OYC A;  4CJF A;  1A5V A;  3V81 A;  3I8D A;  1QSY A;  3NH1 A;  3DLB A;  2P5O A;  4B9S A;  3UIQ A;  1NK5 A;  1T03 A;  4J2B A;  4KPY A;  3HPG A;  5D3G A;  1U47 A;  4IFV A;  2DY4 A;  4IG0 A;  1O1W A;  4KO0 A;  1RTD A;  3V9S A;  4EZ6 A;  2FC0 A;  3QEX A;  4E89 A;  5KRT A;  4OGC A;  3PX6 A;  4OKK A;  3QEP A;  4CJU A;  4DQQ A;  4I2Q A;  3L3U A;  5FDL A;  4CED A;  4FLU A;  3TAN A;  4FJ5 A;  3C94 A;  3AA3 A;  4M3Z A;  1BI4 B;  2E6L A;  3ZSX A;  5HRS A;  2HHS A;  4FLX A;  3TAE A;  4GMJ B;  3QIN A;  3ZSW A;  4JS5 A;  4C8O A;  4Y1D A;  1RT1 A;  3L2R A;  3HST B;  2BAN A;  4DF4 A;  4DTP A;  2HNY A;  1TK8 A;  3S3M A;  1FXX A;  1RT6 A;  3RR8 A;  3NGZ A;  4DSL A;  4IKF A;  3HP9 A;  1W0H A;  4RW9 A;  4DTJ A;  4E7K A;  3AVG A;  1KFS A;  4E19 A;  3SUN A;  1RT5 A;  4FLT A;  1RT4 A;  3QIO A;  1RT2 A;  4XIU A;  3KK3 A;  2EHG A;  4RW7 A;  3NAE A;  3PO4 A;  4JRQ A;  3SQ1 A;  3SPY A;  1U48 A;  1SKS A;  5KTQ A;  1BQM A;  4B9T A;  2HW3 A;  1CXU A;  1KFD A;  2A1R A;  3SI6 A;  1JLQ A;  1TK0 A;  1SL2 A;  4J2A A;  1A5W A;  1UAX A;  2BE2 A;  3OY9 A;  2FBV A;  3OYG A;  4KRF A;  1EXQ A;  3KLI A;  3HJF A;  3AVN A;  3B6O A;  3L8B A;  4QCL A;  1TKX A;  3KLG A;  4M3Y A;  3NDK A;  3K58 A;  4GVM A;  2B6A A;  1VSK A;  1NK7 A;  4PA1 A;  3T19 A;  1RBT A;  1UA0 A;  3DOK A;  4E7L A;  3RMB A;  4FYD A;  1KVB A;  2X74 A;  2ZQB A;  3OJS A;  2E6M A;  2HNZ A;  3RRG A;  1LAV A;  1T05 A;  2QXF A;  4FLY A;  5I3U A;  3RWU A;  1F21 A;  2XY8 A;  1RDA A;  3KJV A;  3HPH A;  4FVM A;  5KRS A;  4ICL A;  1KSP A;  3HT3 A;  4LD0 A;  4N56 A;  3SUO A;  3THV A;  4I9Q A;  4E7H A;  1S1U A;  3OYF A;  3LZI A;  3TAF A;  3B6P A;  4CJ3 A;  4HHT A;  4BDZ A;  3SQ0 A;  4BDP A;  4B3O A;  5E41 A;  4FCY A;  1KVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...