3ZX2A

Ntpdase1 in complex with decavanadate
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
406
structure length
396
Chain Sequence
b'NVKYGIVLDAGSSHTNLYIYKWPAEKENVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGSSTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNNSHCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
publication title Crystallographic Evidence for a Domain Motion in Rat Nucleoside Triphosphate Diphosphohydrolase (Ntpdase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 123
structure length 396
sequence length 406
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx2A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx2A02
4CZIA 1YVNA 3CJ9A 1NBWA 2NZTA 3LM9A 5ADXH 1K8KB 4FWQA 2V52B 4HTLA 4EAHD 3VOVA 4H0VB 4BR9A 4IXCA 1BG3A 3H1VX 5AQQA 1HLUA 2E2PA 1GLJO 4BR2A 3SK3A 3SLCA 4K43A 1JCGA 4CZGA 4YDUA 5AZJB 4K41A 2E2QA 2HOEA 5AQWA 2QXLA 3WQUA 3HZ6A 2Q31A 3FE1A 3KHYA 1Q18A 5AQJA 3GL1A 2VYPA 3ID8A 2ASMA 4PKIA 1YAGA 5AQVA 2GELA 2GUPA 4H0TB 5ELZA 4JD2B 4ISGA 2QM1A 3VENA 3O6WA 2VCPA 3WUHA 3IFRA 5AQNA 3ULEB 2V51B 3QBXA 2NRHA 5EXWA 5FPDA 2WUSA 4CZKA 4BRKA 3CERA 2V7YA 4M63C 2QWNA 4XH5A 3M1FA 3LM2A 3MN5A 4BRLA 4PL7A 1KAYA 1DGKN 4BROA 1ZXOA 1JCEA 2IVOA 3U9ZA 2Q97A 1MA9B 5AQPA 3DJCA 3H1QA 4CZJA 4WQ4A 2BUPA 3FZKA 1NGFA 2P9KB 3MCPA 2HMPA 2YI1A 4IJNA 5E26A 4FWLA 4YDUC 4BQZA 2CGJA 1NGIA 3HM8A 4FOEA 5AQRA 2P9PA 3AAQA 3GDQA 2ZWHA 3ENOA 3CQYA 4O8KA 3DAWA 1G99A 1H1VA 1ATRA 3SMPA 4DQ8A 4WYBA 1ATSA 3O1WA 1BU6O 4A2AA 3D2EB 2Q1NA 4BQLA 2I7PA 1TUYA 1XQSC 1V4TA 1KAZA 3QB0A 4FWOA 3WXLA 4B1ZA 1LOTB 3CIPA 2P9IA 2UYTA 3GOIA 3O1BA 4ISEA 3MK6A 3VGMA 4FWRA 3ZEUA 2QWLA 3WEEA 1U6ZA 4JAXA 3CJCA 5AZIB 3UE5A 4H03B 3BEXA 4XH1A 5FPMA 2ZGYA 2QWMA 1K8KA 1C0GA 1CZAN 1QQNA 2PBDA 1HPMA 2GWKA 4K42A 5EOYA 1GLDG 1BUPA 4L3QA 5LY3A 3WXJA 5FPEA 4BC4A 4BGBA 5AQXA 4WQ4C 2A42A 3GBTA 3A5OC 3FFKB 4K25A 3DXMB 2I7NA 4BREA 1DEJA 3TU5A 4DCHA 1QHAA 3A5LC 4AM6A 2VWBA 3QFUA 2A6AA 2FF3B 4RTFD 4GY2B 2FLOA 5I9EB 4CJ7A 4IWVA 1MDUB 3M3ZA 4FWMA 4FPBA 4FWNA 1U2VA 3DWLA 3O5BA 1ESVA 2P9UB 5F2RA 2PAVA 5AQUA 4XEIA 4CZLA 1C0FA 3BF3A 3H3NO 3CJ1A 1TYQB 3EL2A 3QICA 3ZETB 5AQLA 4B1YB 3ATVA 1X3NA 5AQOA 4B1WB 4QS9A 5AQYA 2P9NA 2YHXA 2YCHA 3H6EA 3MN9A 3WXIA 5BREA 2E1YA 3QBWA 5JLHA 1GLBG 5TKYA 4CI6A 1WUAA 2CGLA 3H45C 5BRDA 1BO5O 3AARA 1NGGA 1E4GT 4BR4A 3UKUB 2GEMA 3I8BA 3QFPA 4BRQA 5LJWA 4JNEA 1R59O 2Q0UA 3OHRA 3RSEB 2P9KA 4CZFA 3R9PA 2FSNA 3D2FB 2CH5A 3BP8A 1YXQA 1X9JA 3AAPA 4IZ9A 2A41A 1HKCA 2D0OA 4C23A 3SJHA 4B9QA 4PL8A 4EIAA 5KQDA 3LDOA 5AR0A 3FZFA 4EHTA 1NGAA 3VERA 4CD1A 5F1XA 1NGEA 1RGIA 4RCHA 4BGAA 2Q0RA 4DHYA 5AFUH 4B1UB 1NGHA 3D2EA 4MO4A 1HJOA 5AQMA 1GLCG 3GE1A 3VGLA 4FL9A 5EVZA 5B8HA 1HUXA 3I33A 3FGUA 1KXPA 2ITMA 3IDHA 2QWPA 2P9SA 5F0XA 4MLHA 1BA0A 3FLCO 4H5TA 4FWSA 1ATNA 2ZF5O 3A5NC 5AZIA 3TPQA 3VEZA 4MO5A 5KPRA 1OKJA 3H46O 1D4XA 3VEWA 1Y64A 3VEOA 4NB4A 3QMLA 2E88A 3G25A 4H0PA 3VEYA 1Z05A 3A8YA 3P4IA 4CBXA 4I6MA 4WQ5A 3VF4A 4JHDA 1KAXA 5EX5A 3LL3A 4BVOA 3DXMA 4B1XB 2A3ZA 4PKGA 1X3MA 4EHUA 3CQXA 4BR0A 2F9WA 1GLFO 4E1JA 4H0YB 1GLAG 2E2NA 3CJBA 3CJAA 5AQHA 5AQIA 5BN8A 4ISFA 4FWKA 4CZEA 1DKGD 3GG4A 1GLLO 1S22A 2KHOA 3O8MA 2P9UA 4CD3A 1NLVA 1BWFO 2D1KA 5E84A 1RFQA 3UKRB 4MLEA 4Y0WA 1TYQA 4BRMA 3ZETA 4FO0A 1NWKA 3L4IA 2E1ZA 5AZJA 4BRCA 1JCFA 3HI0A 4H5NA 2YHWA 3VGKA 4F9OA 4QS7A 2E2OA 1HKGA 3LDNA 3JXUA 3DXKB 3UKUA 2A40A 1HX1A 3AY9A 3C0BA 4JD2A 3RSEA 5JLFA 3VEXA 2A5XA 3D2FA 4M7XA 3KZBA 2D4WA 2YHYA 4FPAA 5AQGA 4BC3A 1LCUA 3ULEA 2W40A 4BRFA 3R8EA 5BR9A 3VF6A 4FWPA 4RWTA 1NGBA 4H5RA 5BPMA 5KPZA 1NGCA 1QZ5A 2BTFA 3LDLA 1QQMA 3MMVA 4BRHA 4NO7A 4PKHA 5AQKA 2EWSA 3VPZA 1MWKA 1SQKA 3M6GA 3IUCA 5KQ8A 4CBUA 3ZEUB 3R6MA 3WEEB 4BRPA 1SZ2A 4A61A 3H3OB 3O80A 1YUWA 2IIRA 4CZMA 5BRHA 3FZMA 2IVNA 3MN6A 2CGKA 3F9MA 3WT0A 3S41A 1Z6RA 3O4WA 4XH4A 3CJ7A 1EQYA 5LJVA 4BRDA 5ADXA 3EKUA 2H3GX 5KPTA 3C7NB 3VEVA 5BPNA 3BUZB 3U8XA 2Q36A 1T6DA 3MN7A 3KVGA 1T6CA 2QWRA 5AQFA 2P9LB 1RDWX 2F9TA 3EO3A 1IG8A 4BR7A 1J6ZA 4J8FA 3ZX0A 2FSJA 4IO8A 3BF1A 4BRGA 3L6QA 1NM1A 2E20A 3L0QA 2ASOA 1QZ6A 5EY4A 3CI5A 1MWMA 2GTDA 3B8AX 2AA4A 1U2VB 1BOTO 2YJFA 1S3XA 1NMDA 4AM7A 1T44A 3HBTA 3JS6A 4GNIA 3ENHA 2DPNA 4FOIA 4BC2A 4CZHA 1BDGA 2GWJA 2P9NB 1P8ZA 3FZHA 3QDKA 3U9DA 3VESA 5AQZA 4EFHA 3UKRA 4H0OA 5AQTA 5AFUA 1WOQA 3W3DA 3W0LA 4BR5A 5CE3A 2OANA 2HF3A 5BN9A 1E4FT 1HKBA 4FSVA 1GLEG 1XUPO 2W41A 4BG9A 3VETA 1SAZA 2E8AA 3DXKA 3IMXA 5AQSA 3FZLA 4H5WA 1IJJA 1NGJA 3U4LA 4BRAA 2ASPA 1XC3A 3O08A 3J8AA 1TUUA 5JMVA 4BRNA 2ZGZA 2V7ZA 3MDQA 4BC5A 3WQTA 4Z94A 2QW9A 4H5VA 5BPLA 3HTVA 2P9SB 2FXUA 2J4RA 3SMSA 4IJAA 4A2BA 2QWQA 4BVPA 2HF4A 4KBOA 4O5FA 3FR0A 5FPNA 3A5MC 2AP1A 3WXKA 4A62A 4JN4A 5BRFA 3ZX2A 4LC9B 4M7YA 3ZX3A 1ZC6A 2YJEA 5JICA 2QWOA 2P9PB 3LDQA 3LDPA 4HWIA 3CETA 3C7NA 2FSKA 3EN9A 1QQOA 3HSCA 1NGDA 2CH6A 4WQ5C 3A0IX 4I6MB 4B1VA 4JHDB 2P9LA 1V4SA 3EKSA 2IVPA 2FF6A 4BG8A 2D0PA 3VF2A 4DB3A 4H0XB 3CHWA 3D7EO 3UB5A 2P9IB 4CBWA 2Q2RA 2NLXA 4BRIA 4QS8A 1BA1A 3ATUA 1ZBSA 3EZWA
chains in the Genus database with same CATH superfamily
5MLCQ 1EO1A 3LM9A 3VOVA 1C1AA 4DUZK 3H1VX 5AQQA 4DV5K 5JS2A 3SBGA 3AVCA 1GLJO 4BR2A 1JLFA 4FLTA 5FRNA 1C0MA 1JCGA 4CZGA 2XY6A 4LF4K 3L4QA 4K41A 4FLXA 5AQWA 2QXLA 3KWIA 5LMUK 1TV6A 1JKHA 1Q18A 3RRHA 1OH5A 3TSQA 1C0UA 2HBLA 3N4PA 4PKIA 3N4QA 4E7HA 2GELA 2GUPA 3KK1A 4LFAK 4JD2B 1RNHA 4JEPA 2XO7A 4BDZA 4KH4A 2QM1A 3C6AA 3WUHA 4YNQA 3G71N 3I0RA 1TKDA 3T7ZA 5HOOA 5J1EA 3QLHA 1U04A 3QBXA 2WUSA 3AVIA 3NBPA 2OPRA 3B6PA 3WNEA 4XH5A 3SQ0A 3KLEA 4IDKA 4ZTJA 4LSLA 1X9MA 4W5NA 3MN5A 4BRLA 1DGKN 4U7BA 2FBXA 4BROA 3K5OA 1XNQK 4JK8A 4B3OA 4CGDA 4WFNL 4CZJA 1G15A 4JRQA 1WNSA 2IAJA 4A57A 1L3SA 3SPYA 2YI1A 3L8BA 4FWLA 3LPUA 2P9PA 4CIGA 1A5XA 3CCQN 3THWB 2I5JA 3NMUA 5HRRA 3DAWA 3BY5A 4CHOA 3SMPA 4DQ8A 1CXQA 3VQAA 1TUYA 1V4TA 4CW7B 3QB0A 3NF9A 4OKJA 3I8DA 3CIPA 1JJ2M 1YITN 3GOIA 4FLVA 3VGMA 4JI3K 3KKRA 2QWLA 3DI6A 3CJCA 2IDOA 3DLRA 1C0GA 1HPMA 2PBDA 4JKCA 1FXXA 1D8YA 1BUPA 5LY3A 4N76A 5AQXA 4WQ4C 3RR7A 2I7NA 4CEQA 3TU5A 5C24A 4RW4A 4AM6A 4E1NA 3QFUA 3ZLJA 1KLMA 2FF3B 1IBMK 4CK3A 4Z0UA 4IWVA 3TI0A 2XHBA 4FPBA 2P5OA 4FZZA 2NRXA 4B9MA 4DTMA 1QVFM 3O9UA 1TYQB 3E66A 2GV9A 3EL2A 3ZETB 4O8UA 4B1YB 1N6QA 1T3VA 4OJRA 5AQOA 4CF2A 4ID1A 2P9NA 3DMJA 4B08A 3RMAA 4DWIA 4YFUA 3ASMA 3H6EA 3MN9A 1YF5L 1TKTA 3OYKA 3ISNC 4YOTA 4ZTFA 3H45C 4CF8A 3QINA 5BRDA 3MX5A 3UKUB 3I8BA 4JKGA 1DTTA 3V9WA 5DM7L 4JNEA 4FZXC 3ZSWA 1YT3A 4FLWA 2FSNA 2CH5A 3BP8A 1YXQA 1X9JA 4IG3A 1TAQA 1IBKK 1E3MA 2QKBA 3QIOA 1WB9A 4C23A 2O4GA 1JXEA 2BGGA 1FK9A 4CD1A 1NK6A 1UA1A 3PX0A 4RCHA 4DHYA 4YHHK 1SKRA 5AFUH 1NJWA 5FROA 1VQ5N 3C95A 3D2EA 2KQ2A 1LWEA 3CC4N 1NK9A 1GLCG 4FL9A 5EVZA 2EX3A 1Q81O 3I33A 3FGUA 3IDHA 1CZBA 3SAHA 5F0XA 1SS6A 1EWQA 4MLHA 1BA0A 2OTJN 4DTPA 1BQNA 1IO2A 4MO5A 3VQ9A 2UU9K 2DTUA 1Q82O 4NB4A 2E88A 3RMBA 4N56A 1CZ9A 4ZHRA 5A2QO 3A8YA 4FK0A 2VWKA 4CJPA 3P4IA 4FXDA 4CBXA 3KLIA 1KAXA 4F3TA 4BVOA 4HCCA 3OS2A 4GKKK 3G4SN 3LAMA 1X3MA 1I94K 4M3ZA 3K2PA 3CQXA 1D9DA 2P1JA 2PZSA 2OCEA 3KD1E 1IBLK 2QK9A 4H0YB 2E2NA 1IKYA 4CHPA 3KLFA 2O8FA 4ISFA 2JWKA 5DK5A 5C15A 4ILGB 1S22A 3AVKA 2KHOA 1NLVA 1GOCA 3VQ4A 4CE9A 1RFQA 3L2UA 4BRMA 1S6QA 1NWKA 2HNZA 3I56N 1RILA 3O9SA 3HP6A 4JLHA 3HI0A 1A5WA 2WBNA 3VGKA 4FJ8A 2OPSA 4IEEA 2KZZA 3ZT3A 3JXUA 3P1GA 1A5VA 4DR2K 1FW6A 2OTLN 1J5OA 4JI5K 3C0BA 2G8HA 4JD2A 3RSEA 3D2FA 3KZBA 4CFBA 5KGXA 3VF6A 1YI2N 3NDKA 1NGBA 4CJ5A 5KPZA 1U49A 3WNFA 1TAUA 3LDLA 1FKOA 4LH4A 4CFAA 2GBZA 3PLAA 1IH7A 4PKHA 2EWSA 5AQKA 4KB0A 3VN5A 1SQKA 4UQGA 4DTXA 3V9ZA 3VA3A 4FJHA 4NLCA 3ZEUB 3EE8A 1XHXA 3R6MA 1SZ2A 4IOXA 4DR4K 3H3OB 1YUWA 3DRPA 5BRHA 1SL2A 1N5YA 1O1WA 2CGKA 5J2NA 3S41A 1Z6RA 2X6NA 3DRSA 3O4WA 3LPTA 2UXCK 1VSEA 3CMEN 3LZJA 1J53A 4F2SA 1RT7A 1GOAA 3C7NB 3G6EN 1XC9A 3BUZB 1T6DA 1T6CA 4DF4A 2QKKA 1RDWX 4CGHA 3OVNA 3CCJN 1KFSA 2OYQA 2PFUA 2E20A 1IKXA 2ASOA 1QZ6A 5EY4A 2GTDA 1ZBIA 3LALA 5M1OA 2VQEK 1ITGA 2IGIA 1S3XA 1NMDA 4DFMA 4X64K 1NK8A 2E5LK 3OYNA 3ENHA 2DPNA 4A5AA 4YOXA 3BZKA 2G8UA 4CZHA 3V6DA 1BDGA 3FZHA 3QDKA 2OZSA 3U9DA 3VESA 4CHNA 2G8KA 3UKRA 2RE2A 3AA4A 3NAEA 1WOQA 5CYMA 1BCOA 1WSGA 2VWJA 3HVTA 1NG9A 3OA9A 4Q5VA 2FBTA 1BCMA 4FSVA 3CCUN 1N34K 2HBMA 2W41A 3OS1A 4NCBA 3VETA 1U48A 1SAZA 4W5RA 3DXKA 3IMXA 3FZLA 3OYCA 3MWPA 4DS5A 3JYTA 3V81A 3O08A 4BRNA 2ZGZA 4H4OA 3WXMB 2NRVA 4Z94A 4CJ4A 1W0HA 3OYHA 2P9SB 2J4RA 4IJAA 3ZT4A 4R5PA 4RW7A 4KBOA 4O5FA 5HLFA 4CF0A 2FC0A 2AP1A 4N41A 4DR3K 1ZC6A 3HT3A 1BGXT 5JICA 2P9PB 1QTMA 2E4LA 2NUBA 4FW2A 3CCLN 2QXFA 2B6AA 1VQON 4DMNA 3HPOA 4KHYA 2O8BB 3A0IX 4JHDB 3CYMA 4AQYK 1HNWK 4O0JA 1WN7A 1J5EK 3AA2A 4H0XB 3RR8A 3CHWA 3TTDA 4C1NK 3D7EO 4WFBL 4MDBA 5GINA 3C6TA 3KLHA 4AHTA 4C8LA 1Q9XA 2EHGA 1BA1A 3EZWA 3DLEA 1YVNA 4FJGA 1NBWA 2HVIA 1BISA 3IAYA 4FWQA 3MEDA 4NYFA 1ASUA 4BR9A 4H0VB 1WBDA 1BG3A 4J2EA 4KHPK 4N5SA 1JLQA 4GVMA 1NMNA 4GW6A 3VQ7A 1B9DA 4Y1DA 3SK3A 4KHWA 4K43A 1C1BA 5CHIA 2HOEA 1LW2A 2Q31A 3FE1A 3OW2M 2ASMA 3EZ5A 1YAGA 4WE1A 4OGEA 4I2QA 4IDHA 5AQVA 4FJ7A 4H0TB 2VQFK 1K9MO 3VENA 3O6WA 1S9GA 4CJ3A 3NF7A 1WSHA 3IFRA 5AQNA 3ULEB 3RMCA 4OLBA 1HR0K 5EXWA 3KKSA 4E7KA 3CERA 2V7YA 4M63C 5M1QA 3SQ2A 4H8KA 4M3TA 4DQIA 4KAZA 1NK5A 4JV5K 1VSFA 3HSTB 3UIQA 5CZ2A 1MA9B 1KC8O 4OKEA 3AO1A 1S1VA 3H1QA 1QHTA 4JKGB 2BUPA 3FZKA 3SAFA 4X65K 3AGRA 2YNFA 4K8XA 3H08A 1X9WA 1Y97A 3PSFA 1VAZA 1HYSA 3HOSA 4B9NA 4YDUC 2CGJA 1NGIA 3OYIA 4FOEA 4CEBA 5C42A 3AAQA 4C8KA 3AVAA 3CQYA 1G99A 1H1VA 4KRFA 1NJZA 4WYBA 3O1WA 1BU6O 3TTFA 3D2EB 2WOMA 2UUBK 2Q1NA 1XQSC 4GVEA 4JYAK 1DT9A 4FWOA 3WXLA 2UYTA 3O1BA 4ISEA 4FWRA 3ZEUA 3PIOL 4DSIA 1U6ZA 4JAXA 1YTAA 4XH1A 2KZMA 3VQ5A 4MFBA 1QQNA 4WCEL 4KH5A 2XY8A 3QEWA 4OPAA 2BH1A 5FPEA 2A42A 3GBTA 3A5OC 3FFKB 5D3GA 2KFNA 2YNIA 5KRSA 4DCHA 3J7AP 5K14A 3CQ8A 4GY2B 2O8FB 2OA8A 4DR5K 4OKKA 1JLAA 5GIOA 1MDUB 1OVQA 2RKIA 3O4NA 3NGYA 4MQ3A 4U67L 4LD0A 4OO1J 3MECA 2ZJPL 3MXJA 3BF3A 4M45A 1WSFA 3J7ZO 5AQLA 3ATVA 1X3NA 5IWAK 4YOWA 3KK2A 1JL2A 3QESA 4IFEA 1RDAA 5C2FA 3L2QA 1S6PA 1LWFA 4IOAL 2O4IA 3QBWA 4J2AA 3NHGA 4CJUA 3HM9A 2HHUA 3AGKA 1BO5O 3AARA 4YOVA 3ENBA 4ID5A 4BR4A 5LJWA 3OYBA 4AILC 3K0SA 2RPIA 3RSEB 1VQMN 2P9KA 3ZSYA 5HP1A 4JK7A 3D2FB 4IZ9A 3AAPA 3P31A 1HKCA 5KTQA 1J54A 2D0OA 3BGRA 3I0SA 4PL8A 5AR0A 4FVMA 3V9XA 3VERA 5F1XA 3F2KA 2UXDK 1VSJA 2UUAK 4BGAA 3ZSOA 1KLNA 4B1UB 1T05A 3LWMA 4GKJK 1HJOA 3GE1A 3NH0A 3V1OA 3SAGA 3CD6N 3OJSA 2Z1IA 2P9SA 3SQ4A 3CPEA 1RTHA 4FWSA 5AZIA 3AA5X 5KPRA 3H46O 3CXCM 1D4XA 3VEWA 3DLBA 1Y64A 3OYLA 4DSLA 2O8EA 3QMLA 4DV1K 4H0PA 1DLOA 4CJFA 4FJ5A 2O8BA 1HPZA 5GAGP 4JHDA 1NK0A 3DYAA 3LL3A 3AVNA 3DXMA 4DLEA 3HPGA 2PYJA 5I42A 2KKZA 2F9WA 2WFBA 1SL0A 4FLYA 3G10A 1UA0A 5SWMA 1GLAG 5AQHA 3CJBA 1HMVA 4CZEA 1VQLN 4BE1A 5E41A 2Y1JA 3O4QA 3CC2N 3O8MA 1KRPA 2D1KA 4PHTX 3OBWA 2VG5A 3UKRB 4KHQA 1HYVA 4FO0A 3EEQA 4ILJA 4OX9K 4CIFA 2X74A 4N47A 4BRCA 3PY8A 1T03A 4NXMK 4E7LA 4QS7A 4BWMA 3ZSRA 2YNGA 1HKGA 4OGCA 2HHSA 3LDNA 3DXKB 3P38A 2XY7A 2A40A 4FJKA 4B9VA 1WSEA 1RBSA 3VEXA 1R0AA 4M7XA 3SQ1A 2YHYA 4Y1CA 1C1CA 5AQGA 1LCUA 3ULEA 1EX4A 4DTUA 2W40A 4Q0BA 3R8EA 5BR9A 3SUQA 4RWTA 4H5RA 1NOZA 1GOBA 3TAMA 1RDDA 2BTFA 1NJXA 4NO7A 1ZBUA 2PY5A 3IUCA 4CBUA 3WEEB 4CEOA 3LDSA 4CZMA 3DLLL 3FZMA 3SI6A 5C25A 1KQSM 1EQYA 1XNRK 5LJVA 5ADXA 4GV3A 3Q7CA 4I2PA 4FLZA 5KPTA 3VEVA 2O8CB 3U8XA 2Q36A 3MN7A 3M5RA 2QWRA 2ETJA 1RCHA 3BDPA 1RTJA 4BE0A 3AO2A 5DMRA 1IG8A 1J6ZA 1YTUA 3P83D 3BF1A 3L6QA 3V9SA 1ASVA 4QCLA 4ILHA 4NCGA 1U2VB 1Z25A 1BOTO 3PV8A 1S5JA 2YJFA 2KTQA 1M1KO 4CJRA 3NGIA 3SBTA 1T44A 4MDAA 3JS6A 3MEEA 3S9HA 4BC2A 3RRGA 1IG9A 5CYQA 4FZYA 4JS5A 5AQZA 1Q9YA 5AQTA 3MCAB 1L3VA 3NF6A 4O5BA 4CJKA 3W3DA 5CE3A 5BN9A 2HF3A 3DM2A 1RBRA 1TK8A 1E4FT 1HKBA 2NRWA 1GLEG 3VTIA 4A59A 3SV3A 4BG9A 3QEXA 2E8AA 1XI1A 4Z4CA 3ZSZA 1RDBA 4CGGA 2JGUA 1RBVA 1RT3A 1TUUA 3AVLA 2HSTA 4KREA 4CESA 2ITGA 2R7YA 2GX9A 4Z4FA 4LFBK 5BPLA 5JVHL 2P5GA 2F4VK 2OPQA 3OTOK 3HJFA 1NJIO 2FXUA 4CEDA 1VSDA 1HQUA 2HF4A 1OH8A 2WTUA 4HUGA 5H1SQ 4AHVA 3O9QA 4A62A 4X66K 4CEAA 1REVA 2YJEA 1VSMA 5CZ1A 1FJGK 3TR8A 3OY9A 3LDQA 3LDPA 3HO1A 2BANA 3CETA 3PX6A 2FSKA 3EN9A 4JI0K 1T8EA 4Z4EA 4IFYA 4HUEA 1NGDA 4WQ5C 4B1VA 4OPHA 3EKSA 1V4SA 2IVPA 2FF6A 1IKVA 4CHYA 2D0PA 1XHZA 3VF2A 2UUCK 3K9KA 2NRRA 4KHSA 1B92A 3PX4A 2G8IA 2NLXA 4HVJA 3QNOA 3CCSN 4BRIA 3ATUA 1ZBSA 4CZIA 4PUOA 2ZJRL 4O0IA 5ADXH 3CPWM 4HTLA 4EP4A 1BQMA 1EETA 1QSYA 4IXCA 4E19A 4WF9L 1YHQN 5I3UA 1N8RO 3HOTA 1HLUA 2E2PA 1NU0A 2YKNA 3SLCA 3F73A 2D0CA 3WQUA 4KO0A 5AQJA 3GL1A 2VYPA 4FM1A 2FBYA 3ID8A 3NFAA 3THYA 2A1SA 3TAEA 4CK1A 3T3FA 3IKMA 3T69A 4E1MA 5GAHP 2VCPA 4OPKA 4LF7K 4Z4IA 3J81O 3NF8A 2NRHA 4M3WA 5FPDA 4CZKA 3ITHA 3AO5A 1LAWA 4IKFA 1VSKA 2QWNA 4DR6K 3M1FA 1LWCA 3LM2A 4RW6A 3LP0A 1KAYA 1XWLA 4NLBA 1ZXOA 1JCEA 2IVOA 1P90A 3CFRA 2Y1IA 1RTDA 1F21A 4XIUA 4WQ4A 4DTRA 1EKEA 1NGFA 4I9LA 2P9KB 4DV4K 1Q7YO 1BL3A 1K6YA 1WLJA 5J2MA 4J2BA 3SZ2A 1SV5A 4BQZA 4JRPA 5AQRA 2DFFA 3HM8A 4AF1A 4DV3K 4DTNA 4DTJA 3OYGA 4PWDA 1JXBA 4C8OA 3GDQA 2VG7A 2ZWHA 3AO4A 3CC7N 3OJUA 1ATRA 2XRIA 4BY9C 1ATSA 2ZM6K 2HHVA 3KK3A 2I7PA 2HHXA 4PQUA 1KAZA 5AJ3K 4B1ZA 4DV7K 3TSUA 3MXIA 4JI8K 3PIPL 3MK6A 4CFCA 4GMJB 4CJVA 3WEEA 5AZIB 4H03B 1ILYA 5FPMA 1K8KA 1CZAN 4DS4A 5EOYA 4CJWA 5HRPA 2O8EB 4W5TA 3CCRN 4I7FA 5DM6L 4CF9A 2O8CA 2Q3SA 2B4JA 4DV6K 4BGBA 5GIPA 1NNEA 4B3TK 2HHHK 3V9UA 3OYJA 3I55N 1VQ4N 3DXMB 4BREA 3ID6A 4CJSA 1QHAA 3A5LC 5M1NA 2VWBA 2QA4N 4RTFD 3QETA 2FLOA 5LL6Z 4IOCL 1U2VA 1BI4B 3DWLA 3O5BA 3AVJA 3PO5A 2WC9A 1QVGM 5AQUA 4JI7K 3NVMA 5KGWA 4CZLA 1C0FA 3H3NO 3M8RA 4B3RK 5BR8K 3QICA 5AQYA 1UAXA 3E9PA 3WXIA 1W9HA 5BREA 4TSXA 5JLHA 2DFHA 5TKYA 3T19A 4CI6A 1WUAA 2CGLA 4DFPA 3KLGA 2QEXN 2GEMA 1LV5A 4CERA 2Q0UA 3MEGA 3DOLA 3K9JA 4CZFA 4YOYA 3L2WA 1WAFA 4YOUA 4B9QA 4YORA 4EIAA 1S1WA 5KQDA 3LDOA 3FZFA 2VGMA 1OVYA 1S9EA 2Q0RA 5GADP 2GUIA 1JL1A 1NGHA 1KCFA 4MO4A 3VGLA 3VQPA 5B8HA 3TAFA 4FJXA 1RT4A 1KFDA 1KXPA 2QWPA 4EZ6A 4JI2K 2YKMA 1ASWA 2HHWA 3DOKA 4B9UA 1ATNA 1W7AA 3A5NC 1D9FA 3VEOA 3AA3A 1RT6A 3G25A 1QQCA 2W6LA 3VEYA 3U3YA 1U4BA 4DQQA 3KD5E 4WQ5A 5EX5A 4B1XB 3NE6A 4L8RB 2A3ZA 4DTOA 4EHUA 3C6UA 5HL7L 1N32K 1N36K 4DU3A 4E1JA 5M1FA 3S3OA 5AQIA 1U47A 4KV8A 1SKSA 3GG4A 1GLLO 1NK4A 4LH5A 2P9UA 1BWFO 3AVHA 1T7PA 5CY4A 1VQ9N 4FK4A 1DTQA 4CEZA 1S1TA 3L4IA 4OVLA 3J80O 4E7JA 4DTSA 2OPPA 3V4IA 3O9TA 2A1RA 5HBMA 3AVFA 4F9OA 4E0DA 3T1HK 1K8AO 4FLUA 2E6MA 3DLGA 2VGNA 1L5UA 1VQ6N 1HNXK 4IBNA 2ZE2A 4FPAA 2DFEA 4FK2A 4B9LA 4BRFA 4CK2A 4H4MA 3MMVA 2F7TA 3QEIA 2FBVA 4JKAA 1RBUA 1MWKA 4AHUA 3HVRA 4AH9A 4BRPA 4CGJA 1JLCA 4B8CA 5KRTA 3MN6A 3F9MA 5JVGL 3CM5A 5C10A 1S72N 1W2BM 1KD1O 4XH4A 4LFCK 2KLAA 3EKUA 4IG0A 2H3GX 4FVUA 5BPNA 3WNHA 1VRUA 5AQFA 3T1YK 3A2FA 4JKEA 3EO3A 3HRGA 3ZCMA 4AHRA 1HYZA 4KH6A 4ELTA 3R3LA 5CR4A 1RT1A 2FSJA 2O8DA 3E1YA 4IO8A 4JI1K 1NM1A 1ZYQA 4FJLA 3CI5A 1MWMA 3F9KA 3TAQA 4M3UA 3B8AX 2AA4A 4FJ9A 1KTQA 3HBTA 3K59A 1S1XA 3VQ6A 4GNIA 3WNGA 4FOIA 3KJVA 4KI6A 3LP1A 3CCMN 1C0TA 4CJTA 1NK7A 4NYNA 1KVBA 3CFPA 1O13A 4F2RA 4G9ZA 4FJMA 4DV0K 3VQCA 4W5OA 4EFHA 3LANA 1L3UA 4F8RA 5AFUA 2NRTA 3OYMA 1B9FA 4Z4HA 1FKPA 3THYB 3W0LA 4CF1A 4CEEA 1VRTA 1RTIA 2Z1GA 3AVGA 5M1KA 5HRSA 1CLQA 1EP4A 1XUPO 1VQNN 1VQ8N 5AQSA 1C6VA 4BWJA 4RW8A 4H5WA 1IJJA 4BRAA 3U4LA 2ASPA 4M3YA 4E7IA 3HK2A 1BI4A 3IG1A 4DV2K 2V7ZA 2AJQA 4BC5A 1ZBFA 3WQTA 3M8SA 5IT9O 4H5VA 3QO9A 4DQSA 3QEVA 1TVRA 3VQ8A 4A2BA 1BIZA 3ZT1A 3ZT0A 3J7YP 2HHTA 3HPHA 3M8QA 3QEPA 4I9QA 3FR0A 1M90O 4BDYA 3VQBA 4KTWA 5FPNA 3A5MC 3G0ZA 1YVUA 3WXKA 5BRFA 3ZX2A 3ZX3A 4M41A 2D5RA 4LSNA 2QWOA 4K0KK 3QIPA 3IRXA 2DY4A 2HNYA 4HWIA 4KKOA 1SL1A 1YIJN 1K73O 4I6MB 2P9LA 1RT5A 3K5LA 1TL3A 2XY5A 3CMAN 3TABA 2IC3A 3UB5A 4CBWA 2Q2RA 1RDUA 3LP2A 4QS8A 4BACA 3OBYA 3CF5L 2ITMA 4CFDA 3CJ9A 3VQEA 2NZTA 3O3HA 1K8KB 4IO9L 3SUPA 2V52B 4KTQA 1UWBA 2YNHA 4EAHD 4F4KA 3OYEA 4FJNA 3LWLA 5C0YA 3B6OA 3TANA 1QS4A 4YDUA 5AZJB 2E2QA 2KW4A 3HZ6A 3KHYA 3SJJA 2ZQBA 4KTZA 4HUFA 1HNZK 2HVHA 5C2DA 1WSJA 2ZD1A 3NGZA 5FRMA 5ELZA 3SUNA 3OS0A 2QI2A 4ISGA 2QTDA 3OYFA 1WBBA 3JAMO 2V51B 1YJWN 4FYDA 1KVCA 3P39A 1YJNN 4A5BA 2D0BA 3EY1A 1ZBLA 4BRKA 4RW9A 1U45A 2RN2A 1VSLA 4PL7A 3S3NA 4J2DA 1OH7A 2VG6A 4NXNK 3V1QA 3OYDA 2HMIA 4LF9K 3U9ZA 4RG8A 1RDCA 2Q97A 4E3SA 4BE2A 5AQPA 1Q8IA 2W6KA 3DJCA 3TAGA 3ZSVA 1J9AA 3MCPA 3THXA 2HMPA 3SNNA 1I39A 4BDPA 3MX2A 4IJNA 5E26A 5FDLA 3AV9A 2F8TA 3E9OA 4LF6K 4F3OA 4B9TA 4LY7A 2PYLA 3ENOA 4DUYK 1QSSA 1QE1A 4O8KA 3PSIA 5TKWA 4A2AA 1VSIA 3OYAA 4BQLA 3AO3A 3CFOA 3VTHA 1HQEA 1NOYA 3KWGA 1LAVA 1LOTB 2P9IA 3K57A 4FJJA 1SUQA 2RHKA 4C8MA 4DFJA 2WONA 4CEFA 3UE5A 3BEXA 2ZGYA 2QWMA 5HROA 3KIOA 2GWKA 4K42A 4GV6A 1GLDG 2OZMA 4L3QA 1I3AA 3WXJA 4HCBA 1WSIA 4BC4A 4UY8O 1S1UA 2X78A 4K25A 3RWUA 4FM0A 3P5JA 3VQDA 2X6SA 1DEJA 3K58A 3SPZA 3M8PA 1TL1A 2LSNA 4PA1A 4CHZA 4DLGA 4LF8K 1JLEA 2NNWA 5KI6A 2A6AA 2NRZA 4WFAL 3TAPA 1EWRA 4JI4K 4CJ7A 5I9EB 4CCHA 3M3ZA 2F8SA 4FWMA 3U3GA 1UOCA 4FWNA 1RT2A 4JKFA 1ESVA 2P9UB 3D6RA 3KK7A 5F2RA 2PAVA 4XEIA 3CJ1A 4DU4A 1D5AA 1BIUA 4QAGA 4B1WB 3L2RA 4V19S 4QS9A 3C94A 4DU1A 3VA0A 4CJLA 3VQQA 2YCHA 2E1YA 4QOZB 1GLBG 2ZJQL 3CM6A 1NGGA 4Z4GA 1E4GT 2Z1JA 4BRQA 3LAKA 3QFPA 1R59O 3TARA 3DRRA 3OHRA 1NKEA 3R9PA 4M3XA 2A41A 3U6FA 5J2QA 3SJHA 4R79A 4KI4A 3NH2A 3Q7BA 3THWA 4EHTA 1NGAA 3E9LA 1NGEA 4E89A 1RGIA 4DSFA 4PY5A 4ELUA 2ATQA 4AHCA 3C6HA 1XMOK 5AQMA 2Z1HA 3HP9A 1HUXA 3NVKA 3VMFB 2HNDA 3FLCO 2D0AA 4H5TA 1Z26A 3AVBA 3CG7A 2ZF5O 3TPQA 4C8NA 3VEZA 3THVA 3SYZA 1OKJA 4DSJA 1VSHA 3L2VA 4JK9A 4K8ZA 1Z05A 4KHNA 4B3MK 1HNIA 2O8DB 4I6MA 3VF4A 5LMNK 4FCYA 3ZT2A 1JLGA 5J2PA 3NCIA 3JSMA 4G1QA 2YHBA 4PKGA 4DQPA 1OH6A 4FW1A 4IEIA 4BR0A 2YX6A 1GLFO 1VQKN 4CIEA 4FJIA 1VHXA 3D0PA 3CJAA 5BN8A 4FWKA 4CGFA 1DKGD 3D45A 4DG1A 3CCVN 4OPJA 4KHUA 3ZSXA 3HYFA 4CD3A 4CJEA 4CGIA 1VQ7N 1YJ9N 3V1RA 4NCAA 2JLEA 5E84A 4MLEA 3RTVA 4Y0WA 2IOCA 4LF5K 1TYQA 4CHQA 1TKZA 3ZETA 5T7BA 1JLBA 4O55A 2RF2A 2KFZA 2YHAA 2E1ZA 5AZJA 1TK0A 1JCFA 3DLHA 3PO4A 1WAJA 4H5NA 2YHWA 2B5JA 2G8VA 2E2OA 3O3GA 3HL8A 1CXUA 3F5TA 3LZIA 4W5QA 3UKUA 4CECA 1HX1A 3AY9A 4O4GA 5JLFA 2A5XA 2D4WA 4BC3A 1HJRA 3S3MA 4FWPA 5BPMA 1QSLA 1NGCA 4B9SA 1QZ5A 2BDPA 1QQMA 4BRHA 3R1XA 2W42A 2HW3A 2YV0X 3VPZA 3M6GA 4JS4A 5KQ8A 2HBKA 1IKWA 4A61A 4B8AB 3BZCA 3O80A 4JKBA 2IIRA 2BE2A 2IVNA 3T1AA 3WT0A 3L3VA 1HNVA 4JI6K 4KPYA 3CJ7A 4DR1K 3TTCA 4BRDA 3SCXA 1LW0A 1NKBA 1BHLA 3K5MA 3O9RA 2IS3A 1EXQA 3KVGA 2P9LB 1TKXA 3SV4A 2F9TA 3QNNA 3FFIA 2G8WA 4BR7A 5EU7A 3RVCA 3MAQA 4J8FA 4BRGA 3L0QA 4JKDA 4DF8A 4YY3K 4HHTA 5GAEP 2F96A 4FM2A 3DLKA 2JWLA 3QERA 4EZ9A 3C65A 4AM7A 4DSKA 3HXMA 4GV9A 3AVMA 5C12A 5HRNA 4M3RA 3TSPA 1L3TA 2GWJA 2P9NB 1TK5A 1P8ZA 4B3SK 4DSEA 3PUFA 1Q86O 4CVNE 4H0OA 4OLAA 3E01A 4KFBA 2HB5A 5FLXO 3TWHA 4BR5A 1NJYA 3K5NA 2P51A 4HTUA 2OANA 1W97L 4DKWA 2HBJA 4DQRA 5JS1A 1VQPN 1SKWA 3ZSQA 1XMQK 3LP3A 3MXMA 1NGJA 1XC3A 3ZYYX 3MWTA 3ULDA 3J8AA 4DR7K 4IFVA 5JMVA 3IS9A 3KTQA 3MDQA 1X9SA 4EP5A 2QW9A 4JKHA 3HTVA 4ELVA 2G8FA 4X62K 4AHSA 3EYZA 3NH1A 3SMSA 1NKCA 5M1PA 2QWQA 4BVPA 1HRHA 1MU2A 3THXB 4CJQA 4ICLA 4DFKA 4JN4A 4LC9B 4M7YA 3EE9A 1KSPA 1RBTA 1TGOA 3C7NA 3SUOA 1QQOA 1KVAA 3HSCA 2E6LA 1VK0A 1N33K 2CH6A 1ZBHA 4KB1A 5SZTA 3RMDA 3L3UA 4BG8A 4DB3A 3CCEN 2UXBK 1IV0A 4C1NI 3O3FA 2P9IB 4M42A 3ALYA 2HHQA 2YHXA 4O44A 3ZX0A 1X1PA
chains in the Genus database with same CATH topology
4CZIA 1YVNA 3CJ9A 5MLCQ 1NBWA 2ZJRL 2NZTA 1EO1A 3LM9A 5ADXH 4IO9L 1K8KB 4FWQA 3CPWM 2V52B 4HTLA 4EAHD 3VOVA 4H0VB 4BR9A 4IXCA 1BG3A 4WF9L 1YHQN 3H1VX 5AQQA 1N8RO 3SBGA 3HOTA 1HLUA 2E2PA 1GLJO 4BR2A 3SK3A 3SLCA 4K43A 5C0YA 1JCGA 4CZGA 4YDUA 5AZJB 3L4QA 4K41A 2E2QA 2HOEA 5CHIA 5AQWA 2QXLA 3KWIA 3WQUA 3HZ6A 2Q31A 3FE1A 3KHYA 3OW2M 1Q18A 5AQJA 3GL1A 2VYPA 3TSQA 3ID8A 2HBLA 3N4PA 2ASMA 3N4QA 4PKIA 1YAGA 5C2DA 4IDHA 5AQVA 2GELA 2GUPA 4H0TB 3IKMA 4JD2B 5ELZA 4JEPA 2QI2A 3T69A 4ISGA 4KH4A 1K9MO 2QM1A 3VENA 2QTDA 3C6AA 3O6WA 5GAHP 2VCPA 3WUHA 3G71N 3IFRA 5AQNA 3T7ZA 3ULEB 5HOOA 1YJWN 2V51B 3P39A 2NRHA 3QBXA 1YJNN 5EXWA 5FPDA 2WUSA 4CZKA 4A5BA 4BRKA 3CERA 2V7YA 4M63C 5M1QA 2QWNA 4XH5A 3M1FA 3LM2A 3MN5A 4BRLA 4PL7A 1KAYA 1DGKN 4U7BA 4NLBA 4BROA 1ZXOA 1JCEA 2IVOA 3U9ZA 1P90A 2Q97A 1MA9B 1KC8O 4JK8A 5AQPA 3DJCA 3H1QA 4WFNL 4CZJA 4WQ4A 4JKGB 2BUPA 3FZKA 1NGFA 4A57A 2P9KB 3SAFA 3MCPA 1Q7YO 2HMPA 3AGRA 2YI1A 3MX2A 4IJNA 5E26A 4FWLA 1VAZA 3HOSA 4YDUC 3E9OA 2CGJA 1NGIA 3HM8A 4FOEA 5AQRA 4AF1A 4BQZA 2P9PA 3AAQA 3GDQA 3CCQN 2ZWHA 3ENOA 3CQYA 4O8KA 3CC7N 3NMUA 3DAWA 1G99A 1H1VA 1ATRA 3SMPA 4BY9C 4DQ8A 5TKWA 4WYBA 1ATSA 3O1WA 1BU6O 3TTFA 4A2AA 3D2EB 2Q1NA 4BQLA 2I7PA 1TUYA 1XQSC 3VTHA 1V4TA 4GVEA 1KAZA 1DT9A 3QB0A 4FWOA 3WXLA 3KWGA 4B1ZA 1LOTB 3CIPA 3TSUA 1JJ2M 1YITN 2P9IA 2UYTA 3GOIA 3O1BA 3PIPL 4ISEA 3MK6A 3VGMA 4FWRA 2RHKA 3ZEUA 2QWLA 3PIOL 3WEEA 1U6ZA 4JAXA 3CJCA 5AZIB 3UE5A 4H03B 3BEXA 4XH1A 5FPMA 1ILYA 2ZGYA 2QWMA 1K8KA 1C0GA 1CZAN 1QQNA 2PBDA 1HPMA 2GWKA 4K42A 5EOYA 4JKCA 4GV6A 4WCEL 1GLDG 1BUPA 4KH5A 3CCRN 4OPAA 4L3QA 5LY3A 5DM6L 2BH1A 3WXJA 5FPEA 4BC4A 4UY8O 4BGBA 5AQXA 4WQ4C 5GIPA 2A42A 3GBTA 3I55N 3A5OC 3FFKB 4K25A 1VQ4N 3DXMB 2I7NA 4BREA 1DEJA 3TU5A 3ID6A 4DCHA 1QHAA 3A5LC 4AM6A 5M1NA 2NNWA 2VWBA 2A6AA 3QFUA 2NRZA 2QA4N 2FF3B 4RTFD 4GY2B 4WFAL 2FLOA 5I9EB 4CJ7A 4IWVA 5GIOA 1MDUB 3M3ZA 4FWMA 4FPBA 4FWNA 3CF5L 1U2VA 3DWLA 3O5BA 1ESVA 2NRXA 4JKFA 4U67L 4IOCL 2P9UB 3D6RA 3KK7A 4OO1J 2WC9A 5F2RA 2PAVA 2ZJPL 5AQUA 1QVGM 3NVMA 4XEIA 1QVFM 4CZLA 1C0FA 3BF3A 3H3NO 3O9UA 3CJ1A 1TYQB 3E66A 3J7ZO 3EL2A 3QICA 3ZETB 4O8UA 5AQLA 3ATVA 1X3NA 4B1YB 1T3VA 5AQOA 4B1WB 4QS9A 4YOWA 5AQYA 2P9NA 4IFEA 2YHXA 3E9PA 5C2FA 2YCHA 3H6EA 3MN9A 3WXIA 4IOAL 5BREA 2E1YA 3QBWA 1YF5L 5JLHA 1GLBG 5TKYA 2ZJQL 4CI6A 1WUAA 2CGLA 4YOTA 3H45C 3AGKA 5BRDA 1BO5O 3AARA 4YOVA 3ENBA 1NGGA 2QEXN 3MX5A 1E4GT 4BR4A 3UKUB 2GEMA 3I8BA 3QFPA 4JKGA 4BRQA 5LJWA 5DM7L 4JNEA 1R59O 2Q0UA 3OHRA 3RSEB 1VQMN 2P9KA 3K9JA 4CZFA 3R9PA 4YOYA 4JK7A 2FSNA 3D2FB 2CH5A 3BP8A 1YXQA 1X9JA 3AAPA 4IZ9A 2A41A 3P31A 1HKCA 4YOUA 2D0OA 4C23A 3SJHA 4B9QA 4R79A 4YORA 4PL8A 4EIAA 5KQDA 3LDOA 5AR0A 3Q7BA 3FZFA 4EHTA 1NGAA 3VERA 4CD1A 3F2KA 3E9LA 1NGEA 2VGMA 5F1XA 1OVYA 1RGIA 4RCHA 4BGAA 2Q0RA 4DHYA 3C6HA 5GADP 5AFUH 1VQ5N 4B1UB 1NGHA 3D2EA 4MO4A 1HJOA 5AQMA 1GLCG 3GE1A 3VGLA 4FL9A 5EVZA 5B8HA 3CC4N 1HUXA 3I33A 3FGUA 1KXPA 3SAGA 1Q81O 2ITMA 3IDHA 3NVKA 3CD6N 2QWPA 2P9SA 3SAHA 5F0XA 1SS6A 4MLHA 1BA0A 3VMFB 3FLCO 2OTJN 3CPEA 4H5TA 4FWSA 1ATNA 2ZF5O 3A5NC 5AZIA 3TPQA 3VEZA 4MO5A 5KPRA 1OKJA 3H46O 3CXCM 1D4XA 3VEWA 1Y64A 3VEOA 1Q82O 4NB4A 3QMLA 2E88A 3G25A 4H0PA 3VEYA 4JK9A 1Z05A 3A8YA 3P4IA 4CBXA 4I6MA 4WQ5A 3VF4A 4JHDA 5GAGP 1KAXA 5EX5A 3LL3A 4BVOA 3DXMA 4B1XB 2A3ZA 3G4SN 4PKGA 1X3MA 4EHUA 5HL7L 2KKZA 3CQXA 4IEIA 2F9WA 2WFBA 2YX6A 4BR0A 1GLFO 4E1JA 1VQKN 5M1FA 4H0YB 1GLAG 2E2NA 3CJBA 3CJAA 5AQHA 5AQIA 5BN8A 4ISFA 4FWKA 2JWKA 4CZEA 1VQLN 1DKGD 5C15A 3GG4A 3CCVN 4ILGB 1GLLO 1S22A 3CC2N 2KHOA 3O8MA 2P9UA 4CD3A 1NLVA 1BWFO 1VQ7N 1YJ9N 2D1KA 4PHTX 3OBWA 5E84A 3OBYA 1RFQA 3UKRB 4MLEA 4Y0WA 1TYQA 4BRMA 3ZETA 1VQ9N 4FO0A 1NWKA 4ILJA 3I56N 3O9SA 3L4IA 2E1ZA 5AZJA 4BRCA 1JCFA 3HI0A 3O9TA 4H5NA 2YHWA 2WBNA 3VGKA 4F9OA 4QS7A 4IEEA 2E2OA 1K8AO 1HKGA 3LDNA 3JXUA 3F5TA 3DXKB 3P38A 3UKUA 2OTLN 2A40A 2VGNA 1HX1A 3AY9A 3C0BA 4JD2A 3RSEA 1VQ6N 5JLFA 3VEXA 2A5XA 3D2FA 4M7XA 3KZBA 2D4WA 2YHYA 4FPAA 5AQGA 4BC3A 1LCUA 3ULEA 2W40A 4BRFA 3R8EA 5BR9A 3VF6A 1YI2N 4FWPA 4RWTA 1NGBA 4H5RA 5BPMA 5KPZA 1NGCA 1QZ5A 2BTFA 3LDLA 1QQMA 2F7TA 3MMVA 3PLAA 4BRHA 3R1XA 4NO7A 4JKAA 4PKHA 2EWSA 5AQKA 3VPZA 1MWKA 1SQKA 3M6GA 3IUCA 5KQ8A 2HBKA 4CBUA 4NLCA 3ZEUB 3EE8A 3R6MA 3WEEB 4BRPA 1SZ2A 4IOXA 4A61A 3H3OB 3O80A 1YUWA 2IIRA 4JKBA 4CZMA 5BRHA 3DLLL 3FZMA 2IVNA 3MN6A 2CGKA 3F9MA 3WT0A 3S41A 5JVGL 1W2BM 1Z6RA 5C10A 1S72N 1KD1O 1KQSM 3O4WA 4XH4A 3CJ7A 1EQYA 3TTCA 4BRDA 2KLAA 5LJVA 5ADXA 3CMEN 4GV3A 3EKUA 3Q7CA 2H3GX 5KPTA 3C7NB 3VEVA 3G6EN 4FVUA 3O9RA 5BPNA 3BUZB 3U8XA 2Q36A 1T6DA 3MN7A 3KVGA 1T6CA 3M5RA 2QWRA 5AQFA 2P9LB 1RDWX 4JKEA 2F9TA 3EO3A 3HRGA 1IG8A 4BR7A 4KH6A 3RVCA 1J6ZA 3CCJN 4J8FA 3R3LA 3ZX0A 5CR4A 2FSJA 3E1YA 2PFUA 4IO8A 3BF1A 4BRGA 3L6QA 1NM1A 2E20A 3L0QA 4JKDA 2ASOA 1QZ6A 5EY4A 3CI5A 1MWMA 2GTDA 3B8AX 2AA4A 5GAEP 4ILHA 5M1OA 1U2VB 1BOTO 2JWLA 2YJFA 1S3XA 1NMDA 3C65A 1M1KO 3SBTA 1T44A 3HBTA 4MDAA 3JS6A 4AM7A 4GNIA 3ENHA 2DPNA 4FOIA 4A5AA 4YOXA 4BC2A 4GV9A 4CZHA 3CCMN 5C12A 3TSPA 1BDGA 2GWJA 1O13A 2P9NB 1P8ZA 3FZHA 3QDKA 4G9ZA 3U9DA 3VESA 5AQZA 1Q86O 4EFHA 3UKRA 2RE2A 4H0OA 5AQTA 3MCAB 5AFUA 1WOQA 2NRTA 3W3DA 3W0LA 4BR5A 5CE3A 3OA9A 2OANA 2HF3A 5BN9A 1W97L 1E4FT 1HKBA 2HBJA 2NRWA 4FSVA 4DKWA 5M1KA 3CCUN 1GLEG 2HBMA 3VTIA 4A59A 1XUPO 1VQPN 2W41A 4BG9A 1VQNN 1VQ8N 3VETA 1SAZA 2E8AA 3DXKA 3IMXA 5AQSA 3FZLA 3MWPA 4H5WA 1IJJA 1NGJA 3U4LA 4BRAA 2ASPA 1XC3A 3ZYYX 3O08A 3MWTA 3J8AA 1TUUA 5JMVA 2HSTA 2ZGZA 4BRNA 3WXMB 2V7ZA 3MDQA 2GX9A 2NRVA 4BC5A 3WQTA 4Z94A 2QW9A 4H5VA 5BPLA 5JVHL 4JKHA 3HTVA 1NJIO 2P9SB 2FXUA 2J4RA 3SMSA 4IJAA 4A2BA 5M1PA 2QWQA 4BVPA 2HF4A 4KBOA 4O5FA 3FR0A 5H1SQ 1M90O 5FPNA 3A5MC 2AP1A 3O9QA 3WXKA 4A62A 4JN4A 5BRFA 3ZX2A 4LC9B 4M7YA 3ZX3A 1ZC6A 3EE9A 2YJEA 5JICA 2QWOA 2P9PB 3LDQA 3LDPA 4HWIA 3CCLN 3CETA 3C7NA 2FSKA 1YIJN 3EN9A 1QQOA 1VQON 3HSCA 1K73O 1NGDA 2CH6A 4WQ5C 3A0IX 4I6MB 4B1VA 4JHDB 2P9LA 1V4SA 3EKSA 2IVPA 4OPHA 2FF6A 4BG8A 2D0PA 3VF2A 4DB3A 3CCEN 3CMAN 3K9KA 4H0XB 2NRRA 3CHWA 3TTDA 4C1NK 4C1NI 3D7EO 3UB5A 2P9IB 4MDBA 4CBWA 5GINA 4WFBL 2Q2RA 2NLXA 1RDUA 3CCSN 4BRIA 4QS8A 1BA1A 3ATUA 1ZBSA 3EZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZI A;  1YVN A;  3CJ9 A;  1NBW A;  2NZT A;  3LM9 A;  5ADX H;  1K8K B;  4FWQ A;  2V52 B;  4HTL A;  4EAH D;  3VOV A;  4H0V B;  4BR9 A;  4IXC A;  1BG3 A;  3H1V X;  5AQQ A;  1HLU A;  2E2P A;  1GLJ O;  4BR2 A;  3SK3 A;  3SLC A;  4K43 A;  1JCG A;  4CZG A;  4YDU A;  5AZJ B;  4K41 A;  2E2Q A;  2HOE A;  5AQW A;  2QXL A;  3WQU A;  3HZ6 A;  2Q31 A;  3FE1 A;  3KHY A;  1Q18 A;  5AQJ A;  3GL1 A;  2VYP A;  3ID8 A;  2ASM A;  4PKI A;  1YAG A;  5AQV A;  2GEL A;  2GUP A;  4H0T B;  5ELZ A;  4JD2 B;  4ISG A;  2QM1 A;  3VEN A;  3O6W A;  2VCP A;  3WUH A;  3IFR A;  5AQN A;  3ULE B;  2V51 B;  3QBX A;  2NRH A;  5EXW A;  5FPD A;  2WUS A;  4CZK A;  4BRK A;  3CER A;  2V7Y A;  4M63 C;  2QWN A;  4XH5 A;  3M1F A;  3LM2 A;  3MN5 A;  4BRL A;  4PL7 A;  1KAY A;  1DGK N;  4BRO A;  1ZXO A;  1JCE A;  2IVO A;  3U9Z A;  2Q97 A;  1MA9 B;  5AQP A;  3DJC A;  3H1Q A;  4CZJ A;  4WQ4 A;  2BUP A;  3FZK A;  1NGF A;  2P9K B;  3MCP A;  2HMP A;  2YI1 A;  4IJN A;  5E26 A;  4FWL A;  4YDU C;  4BQZ A;  2CGJ A;  1NGI A;  3HM8 A;  4FOE A;  5AQR A;  2P9P A;  3AAQ A;  3GDQ A;  2ZWH A;  3ENO A;  3CQY A;  4O8K A;  3DAW A;  1G99 A;  1H1V A;  1ATR A;  3SMP A;  4DQ8 A;  4WYB A;  1ATS A;  3O1W A;  1BU6 O;  4A2A A;  3D2E B;  2Q1N A;  4BQL A;  2I7P A;  1TUY A;  1XQS C;  1V4T A;  1KAZ A;  3QB0 A;  4FWO A;  3WXL A;  4B1Z A;  1LOT B;  3CIP A;  2P9I A;  2UYT A;  3GOI A;  3O1B A;  4ISE A;  3MK6 A;  3VGM A;  4FWR A;  3ZEU A;  2QWL A;  3WEE A;  1U6Z A;  4JAX A;  3CJC A;  5AZI B;  3UE5 A;  4H03 B;  3BEX A;  4XH1 A;  5FPM A;  2ZGY A;  2QWM A;  1K8K A;  1C0G A;  1CZA N;  1QQN A;  2PBD A;  1HPM A;  2GWK A;  4K42 A;  5EOY A;  1GLD G;  1BUP A;  4L3Q A;  5LY3 A;  3WXJ A;  5FPE A;  4BC4 A;  4BGB A;  5AQX A;  4WQ4 C;  2A42 A;  3GBT A;  3A5O C;  3FFK B;  4K25 A;  3DXM B;  2I7N A;  4BRE A;  1DEJ A;  3TU5 A;  4DCH A;  1QHA A;  3A5L C;  4AM6 A;  2VWB A;  3QFU A;  2A6A A;  2FF3 B;  4RTF D;  4GY2 B;  2FLO A;  5I9E B;  4CJ7 A;  4IWV A;  1MDU B;  3M3Z A;  4FWM A;  4FPB A;  4FWN A;  1U2V A;  3DWL A;  3O5B A;  1ESV A;  2P9U B;  5F2R A;  2PAV A;  5AQU A;  4XEI A;  4CZL A;  1C0F A;  3BF3 A;  3H3N O;  3CJ1 A;  1TYQ B;  3EL2 A;  3QIC A;  3ZET B;  5AQL A;  4B1Y B;  3ATV A;  1X3N A;  5AQO A;  4B1W B;  4QS9 A;  5AQY A;  2P9N A;  2YHX A;  2YCH A;  3H6E A;  3MN9 A;  3WXI A;  5BRE A;  2E1Y A;  3QBW A;  5JLH A;  1GLB G;  5TKY A;  4CI6 A;  1WUA A;  2CGL A;  3H45 C;  5BRD A;  1BO5 O;  3AAR A;  1NGG A;  1E4G T;  4BR4 A;  3UKU B;  2GEM A;  3I8B A;  3QFP A;  4BRQ A;  5LJW A;  4JNE A;  1R59 O;  2Q0U A;  3OHR A;  3RSE B;  2P9K A;  4CZF A;  3R9P A;  2FSN A;  3D2F B;  2CH5 A;  3BP8 A;  1YXQ A;  1X9J A;  3AAP A;  4IZ9 A;  2A41 A;  1HKC A;  2D0O A;  4C23 A;  3SJH A;  4B9Q A;  4PL8 A;  4EIA A;  5KQD A;  3LDO A;  5AR0 A;  3FZF A;  4EHT A;  1NGA A;  3VER A;  4CD1 A;  5F1X A;  1NGE A;  1RGI A;  4RCH A;  4BGA A;  2Q0R A;  4DHY A;  5AFU H;  4B1U B;  1NGH A;  3D2E A;  4MO4 A;  1HJO A;  5AQM A;  1GLC G;  3GE1 A;  3VGL A;  4FL9 A;  5EVZ A;  5B8H A;  1HUX A;  3I33 A;  3FGU A;  1KXP A;  2ITM A;  3IDH A;  2QWP A;  2P9S A;  5F0X A;  4MLH A;  1BA0 A;  3FLC O;  4H5T A;  4FWS A;  1ATN A;  2ZF5 O;  3A5N C;  5AZI A;  3TPQ A;  3VEZ A;  4MO5 A;  5KPR A;  1OKJ A;  3H46 O;  1D4X A;  3VEW A;  1Y64 A;  3VEO A;  4NB4 A;  3QML A;  2E88 A;  3G25 A;  4H0P A;  3VEY A;  1Z05 A;  3A8Y A;  3P4I A;  4CBX A;  4I6M A;  4WQ5 A;  3VF4 A;  4JHD A;  1KAX A;  5EX5 A;  3LL3 A;  4BVO A;  3DXM A;  4B1X B;  2A3Z A;  4PKG A;  1X3M A;  4EHU A;  3CQX A;  4BR0 A;  2F9W A;  1GLF O;  4E1J A;  4H0Y B;  1GLA G;  2E2N A;  3CJB A;  3CJA A;  5AQH A;  5AQI A;  5BN8 A;  4ISF A;  4FWK A;  4CZE A;  1DKG D;  3GG4 A;  1GLL O;  1S22 A;  2KHO A;  3O8M A;  2P9U A;  4CD3 A;  1NLV A;  1BWF O;  2D1K A;  5E84 A;  1RFQ A;  3UKR B;  4MLE A;  4Y0W A;  1TYQ A;  4BRM A;  3ZET A;  4FO0 A;  1NWK A;  3L4I A;  2E1Z A;  5AZJ A;  4BRC A;  1JCF A;  3HI0 A;  4H5N A;  2YHW A;  3VGK A;  4F9O A;  4QS7 A;  2E2O A;  1HKG A;  3LDN A;  3JXU A;  3DXK B;  3UKU A;  2A40 A;  1HX1 A;  3AY9 A;  3C0B A;  4JD2 A;  3RSE A;  5JLF A;  3VEX A;  2A5X A;  3D2F A;  4M7X A;  3KZB A;  2D4W A;  2YHY A;  4FPA A;  5AQG A;  4BC3 A;  1LCU A;  3ULE A;  2W40 A;  4BRF A;  3R8E A;  5BR9 A;  3VF6 A;  4FWP A;  4RWT A;  1NGB A;  4H5R A;  5BPM A;  5KPZ A;  1NGC A;  1QZ5 A;  2BTF A;  3LDL A;  1QQM A;  3MMV A;  4BRH A;  4NO7 A;  4PKH A;  5AQK A;  2EWS A;  3VPZ A;  1MWK A;  1SQK A;  3M6G A;  3IUC A;  5KQ8 A;  4CBU A;  3ZEU B;  3R6M A;  3WEE B;  4BRP A;  1SZ2 A;  4A61 A;  3H3O B;  3O80 A;  1YUW A;  2IIR A;  4CZM A;  5BRH A;  3FZM A;  2IVN A;  3MN6 A;  2CGK A;  3F9M A;  3WT0 A;  3S41 A;  1Z6R A;  3O4W A;  4XH4 A;  3CJ7 A;  1EQY A;  5LJV A;  4BRD A;  5ADX A;  3EKU A;  2H3G X;  5KPT A;  3C7N B;  3VEV A;  5BPN A;  3BUZ B;  3U8X A;  2Q36 A;  1T6D A;  3MN7 A;  3KVG A;  1T6C A;  2QWR A;  5AQF A;  2P9L B;  1RDW X;  2F9T A;  3EO3 A;  1IG8 A;  4BR7 A;  1J6Z A;  4J8F A;  3ZX0 A;  2FSJ A;  4IO8 A;  3BF1 A;  4BRG A;  3L6Q A;  1NM1 A;  2E20 A;  3L0Q A;  2ASO A;  1QZ6 A;  5EY4 A;  3CI5 A;  1MWM A;  2GTD A;  3B8A X;  2AA4 A;  1U2V B;  1BOT O;  2YJF A;  1S3X A;  1NMD A;  4AM7 A;  1T44 A;  3HBT A;  3JS6 A;  4GNI A;  3ENH A;  2DPN A;  4FOI A;  4BC2 A;  4CZH A;  1BDG A;  2GWJ A;  2P9N B;  1P8Z A;  3FZH A;  3QDK A;  3U9D A;  3VES A;  5AQZ A;  4EFH A;  3UKR A;  4H0O A;  5AQT A;  5AFU A;  1WOQ A;  3W3D A;  3W0L A;  4BR5 A;  5CE3 A;  2OAN A;  2HF3 A;  5BN9 A;  1E4F T;  1HKB A;  4FSV A;  1GLE G;  1XUP O;  2W41 A;  4BG9 A;  3VET A;  1SAZ A;  2E8A A;  3DXK A;  3IMX A;  5AQS A;  3FZL A;  4H5W A;  1IJJ A;  1NGJ A;  3U4L A;  4BRA A;  2ASP A;  1XC3 A;  3O08 A;  3J8A A;  1TUU A;  5JMV A;  4BRN A;  2ZGZ A;  2V7Z A;  3MDQ A;  4BC5 A;  3WQT A;  4Z94 A;  2QW9 A;  4H5V A;  5BPL A;  3HTV A;  2P9S B;  2FXU A;  2J4R A;  3SMS A;  4IJA A;  4A2B A;  2QWQ A;  4BVP A;  2HF4 A;  4KBO A;  4O5F A;  3FR0 A;  5FPN A;  3A5M C;  2AP1 A;  3WXK A;  4A62 A;  4JN4 A;  5BRF A;  3ZX2 A;  4LC9 B;  4M7Y A;  3ZX3 A;  1ZC6 A;  2YJE A;  5JIC A;  2QWO A;  2P9P B;  3LDQ A;  3LDP A;  4HWI A;  3CET A;  3C7N A;  2FSK A;  3EN9 A;  1QQO A;  3HSC A;  1NGD A;  2CH6 A;  4WQ5 C;  3A0I X;  4I6M B;  4B1V A;  4JHD B;  2P9L A;  1V4S A;  3EKS A;  2IVP A;  2FF6 A;  4BG8 A;  2D0P A;  3VF2 A;  4DB3 A;  4H0X B;  3CHW A;  3D7E O;  3UB5 A;  2P9I B;  4CBW A;  2Q2R A;  2NLX A;  4BRI A;  4QS8 A;  1BA1 A;  3ATU A;  1ZBS A;  3EZW A; 
#chains in the Genus database with same CATH topology
 5MLC Q;  1EO1 A;  3LM9 A;  3VOV A;  1C1A A;  4DUZ K;  3H1V X;  5AQQ A;  4DV5 K;  5JS2 A;  3SBG A;  3AVC A;  1GLJ O;  4BR2 A;  1JLF A;  4FLT A;  5FRN A;  1C0M A;  1JCG A;  4CZG A;  2XY6 A;  4LF4 K;  3L4Q A;  4K41 A;  4FLX A;  5AQW A;  2QXL A;  3KWI A;  5LMU K;  1TV6 A;  1JKH A;  1Q18 A;  3RRH A;  1OH5 A;  3TSQ A;  1C0U A;  2HBL A;  3N4P A;  4PKI A;  3N4Q A;  4E7H A;  2GEL A;  2GUP A;  3KK1 A;  4LFA K;  4JD2 B;  1RNH A;  4JEP A;  2XO7 A;  4BDZ A;  4KH4 A;  2QM1 A;  3C6A A;  3WUH A;  4YNQ A;  3G71 N;  3I0R A;  1TKD A;  3T7Z A;  5HOO A;  5J1E A;  3QLH A;  1U04 A;  3QBX A;  2WUS A;  3AVI A;  3NBP A;  2OPR A;  3B6P A;  3WNE A;  4XH5 A;  3SQ0 A;  3KLE A;  4IDK A;  4ZTJ A;  4LSL A;  1X9M A;  4W5N A;  3MN5 A;  4BRL A;  1DGK N;  4U7B A;  2FBX A;  4BRO A;  3K5O A;  1XNQ K;  4JK8 A;  4B3O A;  4CGD A;  4WFN L;  4CZJ A;  1G15 A;  4JRQ A;  1WNS A;  2IAJ A;  4A57 A;  1L3S A;  3SPY A;  2YI1 A;  3L8B A;  4FWL A;  3LPU A;  2P9P A;  4CIG A;  1A5X A;  3CCQ N;  3THW B;  2I5J A;  3NMU A;  5HRR A;  3DAW A;  3BY5 A;  4CHO A;  3SMP A;  4DQ8 A;  1CXQ A;  3VQA A;  1TUY A;  1V4T A;  4CW7 B;  3QB0 A;  3NF9 A;  4OKJ A;  3I8D A;  3CIP A;  1JJ2 M;  1YIT N;  3GOI A;  4FLV A;  3VGM A;  4JI3 K;  3KKR A;  2QWL A;  3DI6 A;  3CJC A;  2IDO A;  3DLR A;  1C0G A;  1HPM A;  2PBD A;  4JKC A;  1FXX A;  1D8Y A;  1BUP A;  5LY3 A;  4N76 A;  5AQX A;  4WQ4 C;  3RR7 A;  2I7N A;  4CEQ A;  3TU5 A;  5C24 A;  4RW4 A;  4AM6 A;  4E1N A;  3QFU A;  3ZLJ A;  1KLM A;  2FF3 B;  1IBM K;  4CK3 A;  4Z0U A;  4IWV A;  3TI0 A;  2XHB A;  4FPB A;  2P5O A;  4FZZ A;  2NRX A;  4B9M A;  4DTM A;  1QVF M;  3O9U A;  1TYQ B;  3E66 A;  2GV9 A;  3EL2 A;  3ZET B;  4O8U A;  4B1Y B;  1N6Q A;  1T3V A;  4OJR A;  5AQO A;  4CF2 A;  4ID1 A;  2P9N A;  3DMJ A;  4B08 A;  3RMA A;  4DWI A;  4YFU A;  3ASM A;  3H6E A;  3MN9 A;  1YF5 L;  1TKT A;  3OYK A;  3ISN C;  4YOT A;  4ZTF A;  3H45 C;  4CF8 A;  3QIN A;  5BRD A;  3MX5 A;  3UKU B;  3I8B A;  4JKG A;  1DTT A;  3V9W A;  5DM7 L;  4JNE A;  4FZX C;  3ZSW A;  1YT3 A;  4FLW A;  2FSN A;  2CH5 A;  3BP8 A;  1YXQ A;  1X9J A;  4IG3 A;  1TAQ A;  1IBK K;  1E3M A;  2QKB A;  3QIO A;  1WB9 A;  4C23 A;  2O4G A;  1JXE A;  2BGG A;  1FK9 A;  4CD1 A;  1NK6 A;  1UA1 A;  3PX0 A;  4RCH A;  4DHY A;  4YHH K;  1SKR A;  5AFU H;  1NJW A;  5FRO A;  1VQ5 N;  3C95 A;  3D2E A;  2KQ2 A;  1LWE A;  3CC4 N;  1NK9 A;  1GLC G;  4FL9 A;  5EVZ A;  2EX3 A;  1Q81 O;  3I33 A;  3FGU A;  3IDH A;  1CZB A;  3SAH A;  5F0X A;  1SS6 A;  1EWQ A;  4MLH A;  1BA0 A;  2OTJ N;  4DTP A;  1BQN A;  1IO2 A;  4MO5 A;  3VQ9 A;  2UU9 K;  2DTU A;  1Q82 O;  4NB4 A;  2E88 A;  3RMB A;  4N56 A;  1CZ9 A;  4ZHR A;  5A2Q O;  3A8Y A;  4FK0 A;  2VWK A;  4CJP A;  3P4I A;  4FXD A;  4CBX A;  3KLI A;  1KAX A;  4F3T A;  4BVO A;  4HCC A;  3OS2 A;  4GKK K;  3G4S N;  3LAM A;  1X3M A;  1I94 K;  4M3Z A;  3K2P A;  3CQX A;  1D9D A;  2P1J A;  2PZS A;  2OCE A;  3KD1 E;  1IBL K;  2QK9 A;  4H0Y B;  2E2N A;  1IKY A;  4CHP A;  3KLF A;  2O8F A;  4ISF A;  2JWK A;  5DK5 A;  5C15 A;  4ILG B;  1S22 A;  3AVK A;  2KHO A;  1NLV A;  1GOC A;  3VQ4 A;  4CE9 A;  1RFQ A;  3L2U A;  4BRM A;  1S6Q A;  1NWK A;  2HNZ A;  3I56 N;  1RIL A;  3O9S A;  3HP6 A;  4JLH A;  3HI0 A;  1A5W A;  2WBN A;  3VGK A;  4FJ8 A;  2OPS A;  4IEE A;  2KZZ A;  3ZT3 A;  3JXU A;  3P1G A;  1A5V A;  4DR2 K;  1FW6 A;  2OTL N;  1J5O A;  4JI5 K;  3C0B A;  2G8H A;  4JD2 A;  3RSE A;  3D2F A;  3KZB A;  4CFB A;  5KGX A;  3VF6 A;  1YI2 N;  3NDK A;  1NGB A;  4CJ5 A;  5KPZ A;  1U49 A;  3WNF A;  1TAU A;  3LDL A;  1FKO A;  4LH4 A;  4CFA A;  2GBZ A;  3PLA A;  1IH7 A;  4PKH A;  2EWS A;  5AQK A;  4KB0 A;  3VN5 A;  1SQK A;  4UQG A;  4DTX A;  3V9Z A;  3VA3 A;  4FJH A;  4NLC A;  3ZEU B;  3EE8 A;  1XHX A;  3R6M A;  1SZ2 A;  4IOX A;  4DR4 K;  3H3O B;  1YUW A;  3DRP A;  5BRH A;  1SL2 A;  1N5Y A;  1O1W A;  2CGK A;  5J2N A;  3S41 A;  1Z6R A;  2X6N A;  3DRS A;  3O4W A;  3LPT A;  2UXC K;  1VSE A;  3CME N;  3LZJ A;  1J53 A;  4F2S A;  1RT7 A;  1GOA A;  3C7N B;  3G6E N;  1XC9 A;  3BUZ B;  1T6D A;  1T6C A;  4DF4 A;  2QKK A;  1RDW X;  4CGH A;  3OVN A;  3CCJ N;  1KFS A;  2OYQ A;  2PFU A;  2E20 A;  1IKX A;  2ASO A;  1QZ6 A;  5EY4 A;  2GTD A;  1ZBI A;  3LAL A;  5M1O A;  2VQE K;  1ITG A;  2IGI A;  1S3X A;  1NMD A;  4DFM A;  4X64 K;  1NK8 A;  2E5L K;  3OYN A;  3ENH A;  2DPN A;  4A5A A;  4YOX A;  3BZK A;  2G8U A;  4CZH A;  3V6D A;  1BDG A;  3FZH A;  3QDK A;  2OZS A;  3U9D A;  3VES A;  4CHN A;  2G8K A;  3UKR A;  2RE2 A;  3AA4 A;  3NAE A;  1WOQ A;  5CYM A;  1BCO A;  1WSG A;  2VWJ A;  3HVT A;  1NG9 A;  3OA9 A;  4Q5V A;  2FBT A;  1BCM A;  4FSV A;  3CCU N;  1N34 K;  2HBM A;  2W41 A;  3OS1 A;  4NCB A;  3VET A;  1U48 A;  1SAZ A;  4W5R A;  3DXK A;  3IMX A;  3FZL A;  3OYC A;  3MWP A;  4DS5 A;  3JYT A;  3V81 A;  3O08 A;  4BRN A;  2ZGZ A;  4H4O A;  3WXM B;  2NRV A;  4Z94 A;  4CJ4 A;  1W0H A;  3OYH A;  2P9S B;  2J4R A;  4IJA A;  3ZT4 A;  4R5P A;  4RW7 A;  4KBO A;  4O5F A;  5HLF A;  4CF0 A;  2FC0 A;  2AP1 A;  4N41 A;  4DR3 K;  1ZC6 A;  3HT3 A;  1BGX T;  5JIC A;  2P9P B;  1QTM A;  2E4L A;  2NUB A;  4FW2 A;  3CCL N;  2QXF A;  2B6A A;  1VQO N;  4DMN A;  3HPO A;  4KHY A;  2O8B B;  3A0I X;  4JHD B;  3CYM A;  4AQY K;  1HNW K;  4O0J A;  1WN7 A;  1J5E K;  3AA2 A;  4H0X B;  3RR8 A;  3CHW A;  3TTD A;  4C1N K;  3D7E O;  4WFB L;  4MDB A;  5GIN A;  3C6T A;  3KLH A;  4AHT A;  4C8L A;  1Q9X A;  2EHG A;  1BA1 A;  3EZW A;  3DLE A;  1YVN A;  4FJG A;  1NBW A;  2HVI A;  1BIS A;  3IAY A;  4FWQ A;  3MED A;  4NYF A;  1ASU A;  4BR9 A;  4H0V B;  1WBD A;  1BG3 A;  4J2E A;  4KHP K;  4N5S A;  1JLQ A;  4GVM A;  1NMN A;  4GW6 A;  3VQ7 A;  1B9D A;  4Y1D A;  3SK3 A;  4KHW A;  4K43 A;  1C1B A;  5CHI A;  2HOE A;  1LW2 A;  2Q31 A;  3FE1 A;  3OW2 M;  2ASM A;  3EZ5 A;  1YAG A;  4WE1 A;  4OGE A;  4I2Q A;  4IDH A;  5AQV A;  4FJ7 A;  4H0T B;  2VQF K;  1K9M O;  3VEN A;  3O6W A;  1S9G A;  4CJ3 A;  3NF7 A;  1WSH A;  3IFR A;  5AQN A;  3ULE B;  3RMC A;  4OLB A;  1HR0 K;  5EXW A;  3KKS A;  4E7K A;  3CER A;  2V7Y A;  4M63 C;  5M1Q A;  3SQ2 A;  4H8K A;  4M3T A;  4DQI A;  4KAZ A;  1NK5 A;  4JV5 K;  1VSF A;  3HST B;  3UIQ A;  5CZ2 A;  1MA9 B;  1KC8 O;  4OKE A;  3AO1 A;  1S1V A;  3H1Q A;  1QHT A;  4JKG B;  2BUP A;  3FZK A;  3SAF A;  4X65 K;  3AGR A;  2YNF A;  4K8X A;  3H08 A;  1X9W A;  1Y97 A;  3PSF A;  1VAZ A;  1HYS A;  3HOS A;  4B9N A;  4YDU C;  2CGJ A;  1NGI A;  3OYI A;  4FOE A;  4CEB A;  5C42 A;  3AAQ A;  4C8K A;  3AVA A;  3CQY A;  1G99 A;  1H1V A;  4KRF A;  1NJZ A;  4WYB A;  3O1W A;  1BU6 O;  3TTF A;  3D2E B;  2WOM A;  2UUB K;  2Q1N A;  1XQS C;  4GVE A;  4JYA K;  1DT9 A;  4FWO A;  3WXL A;  2UYT A;  3O1B A;  4ISE A;  4FWR A;  3ZEU A;  3PIO L;  4DSI A;  1U6Z A;  4JAX A;  1YTA A;  4XH1 A;  2KZM A;  3VQ5 A;  4MFB A;  1QQN A;  4WCE L;  4KH5 A;  2XY8 A;  3QEW A;  4OPA A;  2BH1 A;  5FPE A;  2A42 A;  3GBT A;  3A5O C;  3FFK B;  5D3G A;  2KFN A;  2YNI A;  5KRS A;  4DCH A;  3J7A P;  5K14 A;  3CQ8 A;  4GY2 B;  2O8F B;  2OA8 A;  4DR5 K;  4OKK A;  1JLA A;  5GIO A;  1MDU B;  1OVQ A;  2RKI A;  3O4N A;  3NGY A;  4MQ3 A;  4U67 L;  4LD0 A;  4OO1 J;  3MEC A;  2ZJP L;  3MXJ A;  3BF3 A;  4M45 A;  1WSF A;  3J7Z O;  5AQL A;  3ATV A;  1X3N A;  5IWA K;  4YOW A;  3KK2 A;  1JL2 A;  3QES A;  4IFE A;  1RDA A;  5C2F A;  3L2Q A;  1S6P A;  1LWF A;  4IOA L;  2O4I A;  3QBW A;  4J2A A;  3NHG A;  4CJU A;  3HM9 A;  2HHU A;  3AGK A;  1BO5 O;  3AAR A;  4YOV A;  3ENB A;  4ID5 A;  4BR4 A;  5LJW A;  3OYB A;  4AIL C;  3K0S A;  2RPI A;  3RSE B;  1VQM N;  2P9K A;  3ZSY A;  5HP1 A;  4JK7 A;  3D2F B;  4IZ9 A;  3AAP A;  3P31 A;  1HKC A;  5KTQ A;  1J54 A;  2D0O A;  3BGR A;  3I0S A;  4PL8 A;  5AR0 A;  4FVM A;  3V9X A;  3VER A;  5F1X A;  3F2K A;  2UXD K;  1VSJ A;  2UUA K;  4BGA A;  3ZSO A;  1KLN A;  4B1U B;  1T05 A;  3LWM A;  4GKJ K;  1HJO A;  3GE1 A;  3NH0 A;  3V1O A;  3SAG A;  3CD6 N;  3OJS A;  2Z1I A;  2P9S A;  3SQ4 A;  3CPE A;  1RTH A;  4FWS A;  5AZI A;  3AA5 X;  5KPR A;  3H46 O;  3CXC M;  1D4X A;  3VEW A;  3DLB A;  1Y64 A;  3OYL A;  4DSL A;  2O8E A;  3QML A;  4DV1 K;  4H0P A;  1DLO A;  4CJF A;  4FJ5 A;  2O8B A;  1HPZ A;  5GAG P;  4JHD A;  1NK0 A;  3DYA A;  3LL3 A;  3AVN A;  3DXM A;  4DLE A;  3HPG A;  2PYJ A;  5I42 A;  2KKZ A;  2F9W A;  2WFB A;  1SL0 A;  4FLY A;  3G10 A;  1UA0 A;  5SWM A;  1GLA G;  5AQH A;  3CJB A;  1HMV A;  4CZE A;  1VQL N;  4BE1 A;  5E41 A;  2Y1J A;  3O4Q A;  3CC2 N;  3O8M A;  1KRP A;  2D1K A;  4PHT X;  3OBW A;  2VG5 A;  3UKR B;  4KHQ A;  1HYV A;  4FO0 A;  3EEQ A;  4ILJ A;  4OX9 K;  4CIF A;  2X74 A;  4N47 A;  4BRC A;  3PY8 A;  1T03 A;  4NXM K;  4E7L A;  4QS7 A;  4BWM A;  3ZSR A;  2YNG A;  1HKG A;  4OGC A;  2HHS A;  3LDN A;  3DXK B;  3P38 A;  2XY7 A;  2A40 A;  4FJK A;  4B9V A;  1WSE A;  1RBS A;  3VEX A;  1R0A A;  4M7X A;  3SQ1 A;  2YHY A;  4Y1C A;  1C1C A;  5AQG A;  1LCU A;  3ULE A;  1EX4 A;  4DTU A;  2W40 A;  4Q0B A;  3R8E A;  5BR9 A;  3SUQ A;  4RWT A;  4H5R A;  1NOZ A;  1GOB A;  3TAM A;  1RDD A;  2BTF A;  1NJX A;  4NO7 A;  1ZBU A;  2PY5 A;  3IUC A;  4CBU A;  3WEE B;  4CEO A;  3LDS A;  4CZM A;  3DLL L;  3FZM A;  3SI6 A;  5C25 A;  1KQS M;  1EQY A;  1XNR K;  5LJV A;  5ADX A;  4GV3 A;  3Q7C A;  4I2P A;  4FLZ A;  5KPT A;  3VEV A;  2O8C B;  3U8X A;  2Q36 A;  3MN7 A;  3M5R A;  2QWR A;  2ETJ A;  1RCH A;  3BDP A;  1RTJ A;  4BE0 A;  3AO2 A;  5DMR A;  1IG8 A;  1J6Z A;  1YTU A;  3P83 D;  3BF1 A;  3L6Q A;  3V9S A;  1ASV A;  4QCL A;  4ILH A;  4NCG A;  1U2V B;  1Z25 A;  1BOT O;  3PV8 A;  1S5J A;  2YJF A;  2KTQ A;  1M1K O;  4CJR A;  3NGI A;  3SBT A;  1T44 A;  4MDA A;  3JS6 A;  3MEE A;  3S9H A;  4BC2 A;  3RRG A;  1IG9 A;  5CYQ A;  4FZY A;  4JS5 A;  5AQZ A;  1Q9Y A;  5AQT A;  3MCA B;  1L3V A;  3NF6 A;  4O5B A;  4CJK A;  3W3D A;  5CE3 A;  5BN9 A;  2HF3 A;  3DM2 A;  1RBR A;  1TK8 A;  1E4F T;  1HKB A;  2NRW A;  1GLE G;  3VTI A;  4A59 A;  3SV3 A;  4BG9 A;  3QEX A;  2E8A A;  1XI1 A;  4Z4C A;  3ZSZ A;  1RDB A;  4CGG A;  2JGU A;  1RBV A;  1RT3 A;  1TUU A;  3AVL A;  2HST A;  4KRE A;  4CES A;  2ITG A;  2R7Y A;  2GX9 A;  4Z4F A;  4LFB K;  5BPL A;  5JVH L;  2P5G A;  2F4V K;  2OPQ A;  3OTO K;  3HJF A;  1NJI O;  2FXU A;  4CED A;  1VSD A;  1HQU A;  2HF4 A;  1OH8 A;  2WTU A;  4HUG A;  5H1S Q;  4AHV A;  3O9Q A;  4A62 A;  4X66 K;  4CEA A;  1REV A;  2YJE A;  1VSM A;  5CZ1 A;  1FJG K;  3TR8 A;  3OY9 A;  3LDQ A;  3LDP A;  3HO1 A;  2BAN A;  3CET A;  3PX6 A;  2FSK A;  3EN9 A;  4JI0 K;  1T8E A;  4Z4E A;  4IFY A;  4HUE A;  1NGD A;  4WQ5 C;  4B1V A;  4OPH A;  3EKS A;  1V4S A;  2IVP A;  2FF6 A;  1IKV A;  4CHY A;  2D0P A;  1XHZ A;  3VF2 A;  2UUC K;  3K9K A;  2NRR A;  4KHS A;  1B92 A;  3PX4 A;  2G8I A;  2NLX A;  4HVJ A;  3QNO A;  3CCS N;  4BRI A;  3ATU A;  1ZBS A;  4CZI A;  4PUO A;  2ZJR L;  4O0I A;  5ADX H;  3CPW M;  4HTL A;  4EP4 A;  1BQM A;  1EET A;  1QSY A;  4IXC A;  4E19 A;  4WF9 L;  1YHQ N;  5I3U A;  1N8R O;  3HOT A;  1HLU A;  2E2P A;  1NU0 A;  2YKN A;  3SLC A;  3F73 A;  2D0C A;  3WQU A;  4KO0 A;  5AQJ A;  3GL1 A;  2VYP A;  4FM1 A;  2FBY A;  3ID8 A;  3NFA A;  3THY A;  2A1S A;  3TAE A;  4CK1 A;  3T3F A;  3IKM A;  3T69 A;  4E1M A;  5GAH P;  2VCP A;  4OPK A;  4LF7 K;  4Z4I A;  3J81 O;  3NF8 A;  2NRH A;  4M3W A;  5FPD A;  4CZK A;  3ITH A;  3AO5 A;  1LAW A;  4IKF A;  1VSK A;  2QWN A;  4DR6 K;  3M1F A;  1LWC A;  3LM2 A;  4RW6 A;  3LP0 A;  1KAY A;  1XWL A;  4NLB A;  1ZXO A;  1JCE A;  2IVO A;  1P90 A;  3CFR A;  2Y1I A;  1RTD A;  1F21 A;  4XIU A;  4WQ4 A;  4DTR A;  1EKE A;  1NGF A;  4I9L A;  2P9K B;  4DV4 K;  1Q7Y O;  1BL3 A;  1K6Y A;  1WLJ A;  5J2M A;  4J2B A;  3SZ2 A;  1SV5 A;  4BQZ A;  4JRP A;  5AQR A;  2DFF A;  3HM8 A;  4AF1 A;  4DV3 K;  4DTN A;  4DTJ A;  3OYG A;  4PWD A;  1JXB A;  4C8O A;  3GDQ A;  2VG7 A;  2ZWH A;  3AO4 A;  3CC7 N;  3OJU A;  1ATR A;  2XRI A;  4BY9 C;  1ATS A;  2ZM6 K;  2HHV A;  3KK3 A;  2I7P A;  2HHX A;  4PQU A;  1KAZ A;  5AJ3 K;  4B1Z A;  4DV7 K;  3TSU A;  3MXI A;  4JI8 K;  3PIP L;  3MK6 A;  4CFC A;  4GMJ B;  4CJV A;  3WEE A;  5AZI B;  4H03 B;  1ILY A;  5FPM A;  1K8K A;  1CZA N;  4DS4 A;  5EOY A;  4CJW A;  5HRP A;  2O8E B;  4W5T A;  3CCR N;  4I7F A;  5DM6 L;  4CF9 A;  2O8C A;  2Q3S A;  2B4J A;  4DV6 K;  4BGB A;  5GIP A;  1NNE A;  4B3T K;  2HHH K;  3V9U A;  3OYJ A;  3I55 N;  1VQ4 N;  3DXM B;  4BRE A;  3ID6 A;  4CJS A;  1QHA A;  3A5L C;  5M1N A;  2VWB A;  2QA4 N;  4RTF D;  3QET A;  2FLO A;  5LL6 Z;  4IOC L;  1U2V A;  1BI4 B;  3DWL A;  3O5B A;  3AVJ A;  3PO5 A;  2WC9 A;  1QVG M;  5AQU A;  4JI7 K;  3NVM A;  5KGW A;  4CZL A;  1C0F A;  3H3N O;  3M8R A;  4B3R K;  5BR8 K;  3QIC A;  5AQY A;  1UAX A;  3E9P A;  3WXI A;  1W9H A;  5BRE A;  4TSX A;  5JLH A;  2DFH A;  5TKY A;  3T19 A;  4CI6 A;  1WUA A;  2CGL A;  4DFP A;  3KLG A;  2QEX N;  2GEM A;  1LV5 A;  4CER A;  2Q0U A;  3MEG A;  3DOL A;  3K9J A;  4CZF A;  4YOY A;  3L2W A;  1WAF A;  4YOU A;  4B9Q A;  4YOR A;  4EIA A;  1S1W A;  5KQD A;  3LDO A;  3FZF A;  2VGM A;  1OVY A;  1S9E A;  2Q0R A;  5GAD P;  2GUI A;  1JL1 A;  1NGH A;  1KCF A;  4MO4 A;  3VGL A;  3VQP A;  5B8H A;  3TAF A;  4FJX A;  1RT4 A;  1KFD A;  1KXP A;  2QWP A;  4EZ6 A;  4JI2 K;  2YKM A;  1ASW A;  2HHW A;  3DOK A;  4B9U A;  1ATN A;  1W7A A;  3A5N C;  1D9F A;  3VEO A;  3AA3 A;  1RT6 A;  3G25 A;  1QQC A;  2W6L A;  3VEY A;  3U3Y A;  1U4B A;  4DQQ A;  3KD5 E;  4WQ5 A;  5EX5 A;  4B1X B;  3NE6 A;  4L8R B;  2A3Z A;  4DTO A;  4EHU A;  3C6U A;  5HL7 L;  1N32 K;  1N36 K;  4DU3 A;  4E1J A;  5M1F A;  3S3O A;  5AQI A;  1U47 A;  4KV8 A;  1SKS A;  3GG4 A;  1GLL O;  1NK4 A;  4LH5 A;  2P9U A;  1BWF O;  3AVH A;  1T7P A;  5CY4 A;  1VQ9 N;  4FK4 A;  1DTQ A;  4CEZ A;  1S1T A;  3L4I A;  4OVL A;  3J80 O;  4E7J A;  4DTS A;  2OPP A;  3V4I A;  3O9T A;  2A1R A;  5HBM A;  3AVF A;  4F9O A;  4E0D A;  3T1H K;  1K8A O;  4FLU A;  2E6M A;  3DLG A;  2VGN A;  1L5U A;  1VQ6 N;  1HNX K;  4IBN A;  2ZE2 A;  4FPA A;  2DFE A;  4FK2 A;  4B9L A;  4BRF A;  4CK2 A;  4H4M A;  3MMV A;  2F7T A;  3QEI A;  2FBV A;  4JKA A;  1RBU A;  1MWK A;  4AHU A;  3HVR A;  4AH9 A;  4BRP A;  4CGJ A;  1JLC A;  4B8C A;  5KRT A;  3MN6 A;  3F9M A;  5JVG L;  3CM5 A;  5C10 A;  1S72 N;  1W2B M;  1KD1 O;  4XH4 A;  4LFC K;  2KLA A;  3EKU A;  4IG0 A;  2H3G X;  4FVU A;  5BPN A;  3WNH A;  1VRU A;  5AQF A;  3T1Y K;  3A2F A;  4JKE A;  3EO3 A;  3HRG A;  3ZCM A;  4AHR A;  1HYZ A;  4KH6 A;  4ELT A;  3R3L A;  5CR4 A;  1RT1 A;  2FSJ A;  2O8D A;  3E1Y A;  4IO8 A;  4JI1 K;  1NM1 A;  1ZYQ A;  4FJL A;  3CI5 A;  1MWM A;  3F9K A;  3TAQ A;  4M3U A;  3B8A X;  2AA4 A;  4FJ9 A;  1KTQ A;  3HBT A;  3K59 A;  1S1X A;  3VQ6 A;  4GNI A;  3WNG A;  4FOI A;  3KJV A;  4KI6 A;  3LP1 A;  3CCM N;  1C0T A;  4CJT A;  1NK7 A;  4NYN A;  1KVB A;  3CFP A;  1O13 A;  4F2R A;  4G9Z A;  4FJM A;  4DV0 K;  3VQC A;  4W5O A;  4EFH A;  3LAN A;  1L3U A;  4F8R A;  5AFU A;  2NRT A;  3OYM A;  1B9F A;  4Z4H A;  1FKP A;  3THY B;  3W0L A;  4CF1 A;  4CEE A;  1VRT A;  1RTI A;  2Z1G A;  3AVG A;  5M1K A;  5HRS A;  1CLQ A;  1EP4 A;  1XUP O;  1VQN N;  1VQ8 N;  5AQS A;  1C6V A;  4BWJ A;  4RW8 A;  4H5W A;  1IJJ A;  4BRA A;  3U4L A;  2ASP A;  4M3Y A;  4E7I A;  3HK2 A;  1BI4 A;  3IG1 A;  4DV2 K;  2V7Z A;  2AJQ A;  4BC5 A;  1ZBF A;  3WQT A;  3M8S A;  5IT9 O;  4H5V A;  3QO9 A;  4DQS A;  3QEV A;  1TVR A;  3VQ8 A;  4A2B A;  1BIZ A;  3ZT1 A;  3ZT0 A;  3J7Y P;  2HHT A;  3HPH A;  3M8Q A;  3QEP A;  4I9Q A;  3FR0 A;  1M90 O;  4BDY A;  3VQB A;  4KTW A;  5FPN A;  3A5M C;  3G0Z A;  1YVU A;  3WXK A;  5BRF A;  3ZX2 A;  3ZX3 A;  4M41 A;  2D5R A;  4LSN A;  2QWO A;  4K0K K;  3QIP A;  3IRX A;  2DY4 A;  2HNY A;  4HWI A;  4KKO A;  1SL1 A;  1YIJ N;  1K73 O;  4I6M B;  2P9L A;  1RT5 A;  3K5L A;  1TL3 A;  2XY5 A;  3CMA N;  3TAB A;  2IC3 A;  3UB5 A;  4CBW A;  2Q2R A;  1RDU A;  3LP2 A;  4QS8 A;  4BAC A;  3OBY A;  3CF5 L;  2ITM A;  4CFD A;  3CJ9 A;  3VQE A;  2NZT A;  3O3H A;  1K8K B;  4IO9 L;  3SUP A;  2V52 B;  4KTQ A;  1UWB A;  2YNH A;  4EAH D;  4F4K A;  3OYE A;  4FJN A;  3LWL A;  5C0Y A;  3B6O A;  3TAN A;  1QS4 A;  4YDU A;  5AZJ B;  2E2Q A;  2KW4 A;  3HZ6 A;  3KHY A;  3SJJ A;  2ZQB A;  4KTZ A;  4HUF A;  1HNZ K;  2HVH A;  5C2D A;  1WSJ A;  2ZD1 A;  3NGZ A;  5FRM A;  5ELZ A;  3SUN A;  3OS0 A;  2QI2 A;  4ISG A;  2QTD A;  3OYF A;  1WBB A;  3JAM O;  2V51 B;  1YJW N;  4FYD A;  1KVC A;  3P39 A;  1YJN N;  4A5B A;  2D0B A;  3EY1 A;  1ZBL A;  4BRK A;  4RW9 A;  1U45 A;  2RN2 A;  1VSL A;  4PL7 A;  3S3N A;  4J2D A;  1OH7 A;  2VG6 A;  4NXN K;  3V1Q A;  3OYD A;  2HMI A;  4LF9 K;  3U9Z A;  4RG8 A;  1RDC A;  2Q97 A;  4E3S A;  4BE2 A;  5AQP A;  1Q8I A;  2W6K A;  3DJC A;  3TAG A;  3ZSV A;  1J9A A;  3MCP A;  3THX A;  2HMP A;  3SNN A;  1I39 A;  4BDP A;  3MX2 A;  4IJN A;  5E26 A;  5FDL A;  3AV9 A;  2F8T A;  3E9O A;  4LF6 K;  4F3O A;  4B9T A;  4LY7 A;  2PYL A;  3ENO A;  4DUY K;  1QSS A;  1QE1 A;  4O8K A;  3PSI A;  5TKW A;  4A2A A;  1VSI A;  3OYA A;  4BQL A;  3AO3 A;  3CFO A;  3VTH A;  1HQE A;  1NOY A;  3KWG A;  1LAV A;  1LOT B;  2P9I A;  3K57 A;  4FJJ A;  1SUQ A;  2RHK A;  4C8M A;  4DFJ A;  2WON A;  4CEF A;  3UE5 A;  3BEX A;  2ZGY A;  2QWM A;  5HRO A;  3KIO A;  2GWK A;  4K42 A;  4GV6 A;  1GLD G;  2OZM A;  4L3Q A;  1I3A A;  3WXJ A;  4HCB A;  1WSI A;  4BC4 A;  4UY8 O;  1S1U A;  2X78 A;  4K25 A;  3RWU A;  4FM0 A;  3P5J A;  3VQD A;  2X6S A;  1DEJ A;  3K58 A;  3SPZ A;  3M8P A;  1TL1 A;  2LSN A;  4PA1 A;  4CHZ A;  4DLG A;  4LF8 K;  1JLE A;  2NNW A;  5KI6 A;  2A6A A;  2NRZ A;  4WFA L;  3TAP A;  1EWR A;  4JI4 K;  4CJ7 A;  5I9E B;  4CCH A;  3M3Z A;  2F8S A;  4FWM A;  3U3G A;  1UOC A;  4FWN A;  1RT2 A;  4JKF A;  1ESV A;  2P9U B;  3D6R A;  3KK7 A;  5F2R A;  2PAV A;  4XEI A;  3CJ1 A;  4DU4 A;  1D5A A;  1BIU A;  4QAG A;  4B1W B;  3L2R A;  4V19 S;  4QS9 A;  3C94 A;  4DU1 A;  3VA0 A;  4CJL A;  3VQQ A;  2YCH A;  2E1Y A;  4QOZ B;  1GLB G;  2ZJQ L;  3CM6 A;  1NGG A;  4Z4G A;  1E4G T;  2Z1J A;  4BRQ A;  3LAK A;  3QFP A;  1R59 O;  3TAR A;  3DRR A;  3OHR A;  1NKE A;  3R9P A;  4M3X A;  2A41 A;  3U6F A;  5J2Q A;  3SJH A;  4R79 A;  4KI4 A;  3NH2 A;  3Q7B A;  3THW A;  4EHT A;  1NGA A;  3E9L A;  1NGE A;  4E89 A;  1RGI A;  4DSF A;  4PY5 A;  4ELU A;  2ATQ A;  4AHC A;  3C6H A;  1XMO K;  5AQM A;  2Z1H A;  3HP9 A;  1HUX A;  3NVK A;  3VMF B;  2HND A;  3FLC O;  2D0A A;  4H5T A;  1Z26 A;  3AVB A;  3CG7 A;  2ZF5 O;  3TPQ A;  4C8N A;  3VEZ A;  3THV A;  3SYZ A;  1OKJ A;  4DSJ A;  1VSH A;  3L2V A;  4JK9 A;  4K8Z A;  1Z05 A;  4KHN A;  4B3M K;  1HNI A;  2O8D B;  4I6M A;  3VF4 A;  5LMN K;  4FCY A;  3ZT2 A;  1JLG A;  5J2P A;  3NCI A;  3JSM A;  4G1Q A;  2YHB A;  4PKG A;  4DQP A;  1OH6 A;  4FW1 A;  4IEI A;  4BR0 A;  2YX6 A;  1GLF O;  1VQK N;  4CIE A;  4FJI A;  1VHX A;  3D0P A;  3CJA A;  5BN8 A;  4FWK A;  4CGF A;  1DKG D;  3D45 A;  4DG1 A;  3CCV N;  4OPJ A;  4KHU A;  3ZSX A;  3HYF A;  4CD3 A;  4CJE A;  4CGI A;  1VQ7 N;  1YJ9 N;  3V1R A;  4NCA A;  2JLE A;  5E84 A;  4MLE A;  3RTV A;  4Y0W A;  2IOC A;  4LF5 K;  1TYQ A;  4CHQ A;  1TKZ A;  3ZET A;  5T7B A;  1JLB A;  4O55 A;  2RF2 A;  2KFZ A;  2YHA A;  2E1Z A;  5AZJ A;  1TK0 A;  1JCF A;  3DLH A;  3PO4 A;  1WAJ A;  4H5N A;  2YHW A;  2B5J A;  2G8V A;  2E2O A;  3O3G A;  3HL8 A;  1CXU A;  3F5T A;  3LZI A;  4W5Q A;  3UKU A;  4CEC A;  1HX1 A;  3AY9 A;  4O4G A;  5JLF A;  2A5X A;  2D4W A;  4BC3 A;  1HJR A;  3S3M A;  4FWP A;  5BPM A;  1QSL A;  1NGC A;  4B9S A;  1QZ5 A;  2BDP A;  1QQM A;  4BRH A;  3R1X A;  2W42 A;  2HW3 A;  2YV0 X;  3VPZ A;  3M6G A;  4JS4 A;  5KQ8 A;  2HBK A;  1IKW A;  4A61 A;  4B8A B;  3BZC A;  3O80 A;  4JKB A;  2IIR A;  2BE2 A;  2IVN A;  3T1A A;  3WT0 A;  3L3V A;  1HNV A;  4JI6 K;  4KPY A;  3CJ7 A;  4DR1 K;  3TTC A;  4BRD A;  3SCX A;  1LW0 A;  1NKB A;  1BHL A;  3K5M A;  3O9R A;  2IS3 A;  1EXQ A;  3KVG A;  2P9L B;  1TKX A;  3SV4 A;  2F9T A;  3QNN A;  3FFI A;  2G8W A;  4BR7 A;  5EU7 A;  3RVC A;  3MAQ A;  4J8F A;  4BRG A;  3L0Q A;  4JKD A;  4DF8 A;  4YY3 K;  4HHT A;  5GAE P;  2F96 A;  4FM2 A;  3DLK A;  2JWL A;  3QER A;  4EZ9 A;  3C65 A;  4AM7 A;  4DSK A;  3HXM A;  4GV9 A;  3AVM A;  5C12 A;  5HRN A;  4M3R A;  3TSP A;  1L3T A;  2GWJ A;  2P9N B;  1TK5 A;  1P8Z A;  4B3S K;  4DSE A;  3PUF A;  1Q86 O;  4CVN E;  4H0O A;  4OLA A;  3E01 A;  4KFB A;  2HB5 A;  5FLX O;  3TWH A;  4BR5 A;  1NJY A;  3K5N A;  2P51 A;  4HTU A;  2OAN A;  1W97 L;  4DKW A;  2HBJ A;  4DQR A;  5JS1 A;  1VQP N;  1SKW A;  3ZSQ A;  1XMQ K;  3LP3 A;  3MXM A;  1NGJ A;  1XC3 A;  3ZYY X;  3MWT A;  3ULD A;  3J8A A;  4DR7 K;  4IFV A;  5JMV A;  3IS9 A;  3KTQ A;  3MDQ A;  1X9S A;  4EP5 A;  2QW9 A;  4JKH A;  3HTV A;  4ELV A;  2G8F A;  4X62 K;  4AHS A;  3EYZ A;  3NH1 A;  3SMS A;  1NKC A;  5M1P A;  2QWQ A;  4BVP A;  1HRH A;  1MU2 A;  3THX B;  4CJQ A;  4ICL A;  4DFK A;  4JN4 A;  4LC9 B;  4M7Y A;  3EE9 A;  1KSP A;  1RBT A;  1TGO A;  3C7N A;  3SUO A;  1QQO A;  1KVA A;  3HSC A;  2E6L A;  1VK0 A;  1N33 K;  2CH6 A;  1ZBH A;  4KB1 A;  5SZT A;  3RMD A;  3L3U A;  4BG8 A;  4DB3 A;  3CCE N;  2UXB K;  1IV0 A;  4C1N I;  3O3F A;  2P9I B;  4M42 A;  3ALY A;  2HHQ A;  2YHX A;  4O44 A;  3ZX0 A;  1X1P A; 
#chains in the Genus database with same CATH homology
 4CZI A;  1YVN A;  3CJ9 A;  5MLC Q;  1NBW A;  2ZJR L;  2NZT A;  1EO1 A;  3LM9 A;  5ADX H;  4IO9 L;  1K8K B;  4FWQ A;  3CPW M;  2V52 B;  4HTL A;  4EAH D;  3VOV A;  4H0V B;  4BR9 A;  4IXC A;  1BG3 A;  4WF9 L;  1YHQ N;  3H1V X;  5AQQ A;  1N8R O;  3SBG A;  3HOT A;  1HLU A;  2E2P A;  1GLJ O;  4BR2 A;  3SK3 A;  3SLC A;  4K43 A;  5C0Y A;  1JCG A;  4CZG A;  4YDU A;  5AZJ B;  3L4Q A;  4K41 A;  2E2Q A;  2HOE A;  5CHI A;  5AQW A;  2QXL A;  3KWI A;  3WQU A;  3HZ6 A;  2Q31 A;  3FE1 A;  3KHY A;  3OW2 M;  1Q18 A;  5AQJ A;  3GL1 A;  2VYP A;  3TSQ A;  3ID8 A;  2HBL A;  3N4P A;  2ASM A;  3N4Q A;  4PKI A;  1YAG A;  5C2D A;  4IDH A;  5AQV A;  2GEL A;  2GUP A;  4H0T B;  3IKM A;  4JD2 B;  5ELZ A;  4JEP A;  2QI2 A;  3T69 A;  4ISG A;  4KH4 A;  1K9M O;  2QM1 A;  3VEN A;  2QTD A;  3C6A A;  3O6W A;  5GAH P;  2VCP A;  3WUH A;  3G71 N;  3IFR A;  5AQN A;  3T7Z A;  3ULE B;  5HOO A;  1YJW N;  2V51 B;  3P39 A;  2NRH A;  3QBX A;  1YJN N;  5EXW A;  5FPD A;  2WUS A;  4CZK A;  4A5B A;  4BRK A;  3CER A;  2V7Y A;  4M63 C;  5M1Q A;  2QWN A;  4XH5 A;  3M1F A;  3LM2 A;  3MN5 A;  4BRL A;  4PL7 A;  1KAY A;  1DGK N;  4U7B A;  4NLB A;  4BRO A;  1ZXO A;  1JCE A;  2IVO A;  3U9Z A;  1P90 A;  2Q97 A;  1MA9 B;  1KC8 O;  4JK8 A;  5AQP A;  3DJC A;  3H1Q A;  4WFN L;  4CZJ A;  4WQ4 A;  4JKG B;  2BUP A;  3FZK A;  1NGF A;  4A57 A;  2P9K B;  3SAF A;  3MCP A;  1Q7Y O;  2HMP A;  3AGR A;  2YI1 A;  3MX2 A;  4IJN A;  5E26 A;  4FWL A;  1VAZ A;  3HOS A;  4YDU C;  3E9O A;  2CGJ A;  1NGI A;  3HM8 A;  4FOE A;  5AQR A;  4AF1 A;  4BQZ A;  2P9P A;  3AAQ A;  3GDQ A;  3CCQ N;  2ZWH A;  3ENO A;  3CQY A;  4O8K A;  3CC7 N;  3NMU A;  3DAW A;  1G99 A;  1H1V A;  1ATR A;  3SMP A;  4BY9 C;  4DQ8 A;  5TKW A;  4WYB A;  1ATS A;  3O1W A;  1BU6 O;  3TTF A;  4A2A A;  3D2E B;  2Q1N A;  4BQL A;  2I7P A;  1TUY A;  1XQS C;  3VTH A;  1V4T A;  4GVE A;  1KAZ A;  1DT9 A;  3QB0 A;  4FWO A;  3WXL A;  3KWG A;  4B1Z A;  1LOT B;  3CIP A;  3TSU A;  1JJ2 M;  1YIT N;  2P9I A;  2UYT A;  3GOI A;  3O1B A;  3PIP L;  4ISE A;  3MK6 A;  3VGM A;  4FWR A;  2RHK A;  3ZEU A;  2QWL A;  3PIO L;  3WEE A;  1U6Z A;  4JAX A;  3CJC A;  5AZI B;  3UE5 A;  4H03 B;  3BEX A;  4XH1 A;  5FPM A;  1ILY A;  2ZGY A;  2QWM A;  1K8K A;  1C0G A;  1CZA N;  1QQN A;  2PBD A;  1HPM A;  2GWK A;  4K42 A;  5EOY A;  4JKC A;  4GV6 A;  4WCE L;  1GLD G;  1BUP A;  4KH5 A;  3CCR N;  4OPA A;  4L3Q A;  5LY3 A;  5DM6 L;  2BH1 A;  3WXJ A;  5FPE A;  4BC4 A;  4UY8 O;  4BGB A;  5AQX A;  4WQ4 C;  5GIP A;  2A42 A;  3GBT A;  3I55 N;  3A5O C;  3FFK B;  4K25 A;  1VQ4 N;  3DXM B;  2I7N A;  4BRE A;  1DEJ A;  3TU5 A;  3ID6 A;  4DCH A;  1QHA A;  3A5L C;  4AM6 A;  5M1N A;  2NNW A;  2VWB A;  2A6A A;  3QFU A;  2NRZ A;  2QA4 N;  2FF3 B;  4RTF D;  4GY2 B;  4WFA L;  2FLO A;  5I9E B;  4CJ7 A;  4IWV A;  5GIO A;  1MDU B;  3M3Z A;  4FWM A;  4FPB A;  4FWN A;  3CF5 L;  1U2V A;  3DWL A;  3O5B A;  1ESV A;  2NRX A;  4JKF A;  4U67 L;  4IOC L;  2P9U B;  3D6R A;  3KK7 A;  4OO1 J;  2WC9 A;  5F2R A;  2PAV A;  2ZJP L;  5AQU A;  1QVG M;  3NVM A;  4XEI A;  1QVF M;  4CZL A;  1C0F A;  3BF3 A;  3H3N O;  3O9U A;  3CJ1 A;  1TYQ B;  3E66 A;  3J7Z O;  3EL2 A;  3QIC A;  3ZET B;  4O8U A;  5AQL A;  3ATV A;  1X3N A;  4B1Y B;  1T3V A;  5AQO A;  4B1W B;  4QS9 A;  4YOW A;  5AQY A;  2P9N A;  4IFE A;  2YHX A;  3E9P A;  5C2F A;  2YCH A;  3H6E A;  3MN9 A;  3WXI A;  4IOA L;  5BRE A;  2E1Y A;  3QBW A;  1YF5 L;  5JLH A;  1GLB G;  5TKY A;  2ZJQ L;  4CI6 A;  1WUA A;  2CGL A;  4YOT A;  3H45 C;  3AGK A;  5BRD A;  1BO5 O;  3AAR A;  4YOV A;  3ENB A;  1NGG A;  2QEX N;  3MX5 A;  1E4G T;  4BR4 A;  3UKU B;  2GEM A;  3I8B A;  3QFP A;  4JKG A;  4BRQ A;  5LJW A;  5DM7 L;  4JNE A;  1R59 O;  2Q0U A;  3OHR A;  3RSE B;  1VQM N;  2P9K A;  3K9J A;  4CZF A;  3R9P A;  4YOY A;  4JK7 A;  2FSN A;  3D2F B;  2CH5 A;  3BP8 A;  1YXQ A;  1X9J A;  3AAP A;  4IZ9 A;  2A41 A;  3P31 A;  1HKC A;  4YOU A;  2D0O A;  4C23 A;  3SJH A;  4B9Q A;  4R79 A;  4YOR A;  4PL8 A;  4EIA A;  5KQD A;  3LDO A;  5AR0 A;  3Q7B A;  3FZF A;  4EHT A;  1NGA A;  3VER A;  4CD1 A;  3F2K A;  3E9L A;  1NGE A;  2VGM A;  5F1X A;  1OVY A;  1RGI A;  4RCH A;  4BGA A;  2Q0R A;  4DHY A;  3C6H A;  5GAD P;  5AFU H;  1VQ5 N;  4B1U B;  1NGH A;  3D2E A;  4MO4 A;  1HJO A;  5AQM A;  1GLC G;  3GE1 A;  3VGL A;  4FL9 A;  5EVZ A;  5B8H A;  3CC4 N;  1HUX A;  3I33 A;  3FGU A;  1KXP A;  3SAG A;  1Q81 O;  2ITM A;  3IDH A;  3NVK A;  3CD6 N;  2QWP A;  2P9S A;  3SAH A;  5F0X A;  1SS6 A;  4MLH A;  1BA0 A;  3VMF B;  3FLC O;  2OTJ N;  3CPE A;  4H5T A;  4FWS A;  1ATN A;  2ZF5 O;  3A5N C;  5AZI A;  3TPQ A;  3VEZ A;  4MO5 A;  5KPR A;  1OKJ A;  3H46 O;  3CXC M;  1D4X A;  3VEW A;  1Y64 A;  3VEO A;  1Q82 O;  4NB4 A;  3QML A;  2E88 A;  3G25 A;  4H0P A;  3VEY A;  4JK9 A;  1Z05 A;  3A8Y A;  3P4I A;  4CBX A;  4I6M A;  4WQ5 A;  3VF4 A;  4JHD A;  5GAG P;  1KAX A;  5EX5 A;  3LL3 A;  4BVO A;  3DXM A;  4B1X B;  2A3Z A;  3G4S N;  4PKG A;  1X3M A;  4EHU A;  5HL7 L;  2KKZ A;  3CQX A;  4IEI A;  2F9W A;  2WFB A;  2YX6 A;  4BR0 A;  1GLF O;  4E1J A;  1VQK N;  5M1F A;  4H0Y B;  1GLA G;  2E2N A;  3CJB A;  3CJA A;  5AQH A;  5AQI A;  5BN8 A;  4ISF A;  4FWK A;  2JWK A;  4CZE A;  1VQL N;  1DKG D;  5C15 A;  3GG4 A;  3CCV N;  4ILG B;  1GLL O;  1S22 A;  3CC2 N;  2KHO A;  3O8M A;  2P9U A;  4CD3 A;  1NLV A;  1BWF O;  1VQ7 N;  1YJ9 N;  2D1K A;  4PHT X;  3OBW A;  5E84 A;  3OBY A;  1RFQ A;  3UKR B;  4MLE A;  4Y0W A;  1TYQ A;  4BRM A;  3ZET A;  1VQ9 N;  4FO0 A;  1NWK A;  4ILJ A;  3I56 N;  3O9S A;  3L4I A;  2E1Z A;  5AZJ A;  4BRC A;  1JCF A;  3HI0 A;  3O9T A;  4H5N A;  2YHW A;  2WBN A;  3VGK A;  4F9O A;  4QS7 A;  4IEE A;  2E2O A;  1K8A O;  1HKG A;  3LDN A;  3JXU A;  3F5T A;  3DXK B;  3P38 A;  3UKU A;  2OTL N;  2A40 A;  2VGN A;  1HX1 A;  3AY9 A;  3C0B A;  4JD2 A;  3RSE A;  1VQ6 N;  5JLF A;  3VEX A;  2A5X A;  3D2F A;  4M7X A;  3KZB A;  2D4W A;  2YHY A;  4FPA A;  5AQG A;  4BC3 A;  1LCU A;  3ULE A;  2W40 A;  4BRF A;  3R8E A;  5BR9 A;  3VF6 A;  1YI2 N;  4FWP A;  4RWT A;  1NGB A;  4H5R A;  5BPM A;  5KPZ A;  1NGC A;  1QZ5 A;  2BTF A;  3LDL A;  1QQM A;  2F7T A;  3MMV A;  3PLA A;  4BRH A;  3R1X A;  4NO7 A;  4JKA A;  4PKH A;  2EWS A;  5AQK A;  3VPZ A;  1MWK A;  1SQK A;  3M6G A;  3IUC A;  5KQ8 A;  2HBK A;  4CBU A;  4NLC A;  3ZEU B;  3EE8 A;  3R6M A;  3WEE B;  4BRP A;  1SZ2 A;  4IOX A;  4A61 A;  3H3O B;  3O80 A;  1YUW A;  2IIR A;  4JKB A;  4CZM A;  5BRH A;  3DLL L;  3FZM A;  2IVN A;  3MN6 A;  2CGK A;  3F9M A;  3WT0 A;  3S41 A;  5JVG L;  1W2B M;  1Z6R A;  5C10 A;  1S72 N;  1KD1 O;  1KQS M;  3O4W A;  4XH4 A;  3CJ7 A;  1EQY A;  3TTC A;  4BRD A;  2KLA A;  5LJV A;  5ADX A;  3CME N;  4GV3 A;  3EKU A;  3Q7C A;  2H3G X;  5KPT A;  3C7N B;  3VEV A;  3G6E N;  4FVU A;  3O9R A;  5BPN A;  3BUZ B;  3U8X A;  2Q36 A;  1T6D A;  3MN7 A;  3KVG A;  1T6C A;  3M5R A;  2QWR A;  5AQF A;  2P9L B;  1RDW X;  4JKE A;  2F9T A;  3EO3 A;  3HRG A;  1IG8 A;  4BR7 A;  4KH6 A;  3RVC A;  1J6Z A;  3CCJ N;  4J8F A;  3R3L A;  3ZX0 A;  5CR4 A;  2FSJ A;  3E1Y A;  2PFU A;  4IO8 A;  3BF1 A;  4BRG A;  3L6Q A;  1NM1 A;  2E20 A;  3L0Q A;  4JKD A;  2ASO A;  1QZ6 A;  5EY4 A;  3CI5 A;  1MWM A;  2GTD A;  3B8A X;  2AA4 A;  5GAE P;  4ILH A;  5M1O A;  1U2V B;  1BOT O;  2JWL A;  2YJF A;  1S3X A;  1NMD A;  3C65 A;  1M1K O;  3SBT A;  1T44 A;  3HBT A;  4MDA A;  3JS6 A;  4AM7 A;  4GNI A;  3ENH A;  2DPN A;  4FOI A;  4A5A A;  4YOX A;  4BC2 A;  4GV9 A;  4CZH A;  3CCM N;  5C12 A;  3TSP A;  1BDG A;  2GWJ A;  1O13 A;  2P9N B;  1P8Z A;  3FZH A;  3QDK A;  4G9Z A;  3U9D A;  3VES A;  5AQZ A;  1Q86 O;  4EFH A;  3UKR A;  2RE2 A;  4H0O A;  5AQT A;  3MCA B;  5AFU A;  1WOQ A;  2NRT A;  3W3D A;  3W0L A;  4BR5 A;  5CE3 A;  3OA9 A;  2OAN A;  2HF3 A;  5BN9 A;  1W97 L;  1E4F T;  1HKB A;  2HBJ A;  2NRW A;  4FSV A;  4DKW A;  5M1K A;  3CCU N;  1GLE G;  2HBM A;  3VTI A;  4A59 A;  1XUP O;  1VQP N;  2W41 A;  4BG9 A;  1VQN N;  1VQ8 N;  3VET A;  1SAZ A;  2E8A A;  3DXK A;  3IMX A;  5AQS A;  3FZL A;  3MWP A;  4H5W A;  1IJJ A;  1NGJ A;  3U4L A;  4BRA A;  2ASP A;  1XC3 A;  3ZYY X;  3O08 A;  3MWT A;  3J8A A;  1TUU A;  5JMV A;  2HST A;  2ZGZ A;  4BRN A;  3WXM B;  2V7Z A;  3MDQ A;  2GX9 A;  2NRV A;  4BC5 A;  3WQT A;  4Z94 A;  2QW9 A;  4H5V A;  5BPL A;  5JVH L;  4JKH A;  3HTV A;  1NJI O;  2P9S B;  2FXU A;  2J4R A;  3SMS A;  4IJA A;  4A2B A;  5M1P A;  2QWQ A;  4BVP A;  2HF4 A;  4KBO A;  4O5F A;  3FR0 A;  5H1S Q;  1M90 O;  5FPN A;  3A5M C;  2AP1 A;  3O9Q A;  3WXK A;  4A62 A;  4JN4 A;  5BRF A;  3ZX2 A;  4LC9 B;  4M7Y A;  3ZX3 A;  1ZC6 A;  3EE9 A;  2YJE A;  5JIC A;  2QWO A;  2P9P B;  3LDQ A;  3LDP A;  4HWI A;  3CCL N;  3CET A;  3C7N A;  2FSK A;  1YIJ N;  3EN9 A;  1QQO A;  1VQO N;  3HSC A;  1K73 O;  1NGD A;  2CH6 A;  4WQ5 C;  3A0I X;  4I6M B;  4B1V A;  4JHD B;  2P9L A;  1V4S A;  3EKS A;  2IVP A;  4OPH A;  2FF6 A;  4BG8 A;  2D0P A;  3VF2 A;  4DB3 A;  3CCE N;  3CMA N;  3K9K A;  4H0X B;  2NRR A;  3CHW A;  3TTD A;  4C1N K;  4C1N I;  3D7E O;  3UB5 A;  2P9I B;  4MDB A;  4CBW A;  5GIN A;  4WFB L;  2Q2R A;  2NLX A;  1RDU A;  3CCS N;  4BRI A;  4QS8 A;  1BA1 A;  3ATU A;  1ZBS A;  3EZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...