3ZX2A

Ntpdase1 in complex with decavanadate
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
406
structure length
396
Chain Sequence
NVKYGIVLDAGSSHTNLYIYKWPAEKENVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGSSTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNNSHCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
publication title Crystallographic Evidence for a Domain Motion in Rat Nucleoside Triphosphate Diphosphohydrolase (Ntpdase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 123
structure length 396
sequence length 406
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx2A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx2A02
3IMXA 3WXKA 3VF4A 3FZLA 3VEZA 3FE1A 3A5NC 4L3QA 5AQRA 4O5FA 3M6GA 4FWLA 3CJCA 5LY3A 4IZ9A 3HSCA 3SK3A 4EAHD 5JICA 4FOEA 5F2RA 3QICA 3WUHA 4H03B 4YDUA 4AM6A 5ADXH 5AQQA 3HI0A 4ISGA 4FWNA 2Q0RA 4FWQA 3OHRA 4A2BA 3WQUA 1T6DA 1XUPO 4ISEA 5EXWA 2GTDA 3HM8A 3FR0A 2E88A 1GLFO 2HOEA 2QWPA 3VF2A 3MK6A 5BPMA 1WOQA 5EX5A 1X3NA 3CQYA 5BN8A 2FSJA 3DXKB 3H1VX 1T6CA 4B1ZA 1NGEA 3GG4A 2V51B 2GEMA 3CJ7A 1V4SA 2YHYA 3MCPA 4H0YB 3P4IA 1SQKA 3ATUA 1RDWX 5BREA 1LOTB 3EN9A 3VERA 1NWKA 4BR4A 1BO5O 3WXIA 3UKRB 1GLCG 2H3GX 3O80A 5AQVA 3U4LA 4Y0WA 3SMSA 3FZFA 2P9PB 3DXKA 2GELA 4BRHA 3MN6A 4BC4A 2QWOA 4FL9A 2VCPA 2VYPA 4M7YA 3H46O 2Q31A 3GOIA 4FWRA 3B8AX 4HTLA 3UKRA 3ZETB 4NO7A 1HX1A 2QW9A 1XC3A 4BRKA 2A42A 2HF4A 2P9PA 2QM1A 1GLLO 3EKUA 3QB0A 4Z94A 3QBWA 3CHWA 3ZEUB 3QFPA 1JCEA 1IJJA 2I7NA 2NLXA 2CGJA 2F9WA 1T44A 3BP8A 2ZWHA 3VF6A 4BRCA 3ZETA 4CZKA 1IG8A 3VESA 4MO4A 2IVNA 4M7XA 3ZEUA 5FPEA 4CJ7A 1TUUA 1YAGA 4MO5A 5JMVA 2FSNA 3W0LA 3CETA 3CJ9A 2OANA 3VENA 4CI6A 3EKSA 2E2OA 4BRMA 5E84A 4KBOA 4H0XB 5AQNA 4CZFA 1BA1A 1E4GT 3WXLA 4BQLA 2A6AA 1C0GA 3MN9A 3U9DA 4RTFD 3A5OC 4PKGA 2FXUA 5AQYA 3UE5A 2YJEA 5FPDA 3ID8A 5KPRA 1NGJA 1NGAA 5JLHA 3FGUA 1HJOA 2E1YA 1MA9B 1MDUB 2F9TA 3VEWA 3A5LC 4JN4A 3M3ZA 3I33A 4WQ4A 1CZAN 1U6ZA 2P9UB 1DGKN 4JHDB 2YI1A 4PKHA 5AQZA 4B9QA 4H0VB 1NLVA 2P9NB 4BC5A 1TUYA 4BRNA 4FPAA 2DPNA 3QDKA 4BRGA 4HWIA 4CBWA 5AQKA 4GNIA 3A8YA 3VOVA 1DEJA 3MN5A 4CZLA 1X3MA 5BPLA 3FZHA 3VGMA 5B8HA 4BVPA 1HUXA 4DQ8A 3QBXA 3VGKA 3GDQA 2P9UA 2Q1NA 4JHDA 4FOIA 2P9NA 5F1XA 2J4RA 2QWNA 1ATRA 4FWKA 2BUPA 5BR9A 1YVNA 4CZMA 3U9ZA 4A2AA 1R59O 2A41A 5FPMA 4FWSA 1ATSA 5BRHA 5KPTA 2KHOA 1GLAG 3WXJA 1JCGA 2CH6A 4I6MB 4ISFA 4XH4A 3RSEB 4FWOA 3BF1A 3M1FA 2YHXA 4PL7A 1H1VA 3JXUA 1KAXA 1HKBA 4EFHA 5KPZA 3R9PA 3CQXA 2V7ZA 4CBUA 3CERA 3H6EA 5EOYA 3VGLA 3WEEB 3H1QA 1GLDG 2A3ZA 1NMDA 3O1BA 3ZX0A 3SMPA 2HMPA 4I6MA 3ZX2A 3RSEA 4K41A 3DXMB 1G99A 3FZMA 4H5VA 1D4XA 4BC2A 3HTVA 5AQTA 4WQ4C 1GLEG 4B1XB 1RGIA 4A61A 4A62A 3CJ1A 1J6ZA 4BVOA 3WEEA 2PAVA 4F9OA 3VEXA 1QQOA 4J8FA 5E26A 5FPNA 1JCFA 3CJBA 3S41A 3BF3A 3DXMA 2BTFA 1NGDA 1HLUA 4M63C 3CIPA 3WQTA 3LDNA 2YHWA 4E1JA 4BR7A 4DHYA 1SAZA 1GLJO 3O1WA 4K42A 3ZX3A 3HZ6A 4WYBA 4CZEA 2EWSA 3EL2A 5AFUA 1BU6O 3QMLA 2E2PA 1NBWA 2Q2RA 3LDLA 2P9IB 3D2FB 2I7PA 1YUWA 3TU5A 2Q97A 5BRDA 5BPNA 1YXQA 4BRPA 1EQYA 4EIAA 2ASPA 3H45C 1NGCA 4FSVA 4CZHA 4B1YB 2YJFA 2GWKA 3FLCO 4CD3A 1TYQB 4O8KA 2VWBA 5AQWA 4BG9A 4CZGA 4RCHA 2GUPA 5EY4A 2P9IA 3D2FA 1E4FT 4BG8A 3DJCA 1NGBA 4H5NA 4K43A 4BQZA 1HKGA 3CJAA 2V7YA 3QFUA 1KAYA 1Y64A 1TYQA 1Z6RA 5AQIA 1S3XA 2D4WA 1BOTO 1Q18A 3O4WA 3IUCA 4H0TB 2ZGYA 1S22A 2ITMA 2FF6A 1QZ6A 5AQXA 1BUPA 3VEOA 4B1UB 2IVPA 2NRHA 4XH5A 1QZ5A 1BWFO 1KXPA 3KVGA 3D2EB 2QWQA 2CGLA 4BRFA 3I8BA 2UYTA 5AQMA 4BGAA 4BR2A 2P9KB 4IJAA 2ZF5O 3LL3A 3SJHA 5AQSA 4RWTA 3JS6A 1BDGA 4FWMA 3VPZA 1QQNA 4C23A 4IXCA 5JLFA 4H0PA 3IFRA 4BRLA 2E20A 1NGGA 3D2EA 3BEXA 3AARA 4FO0A 2E1ZA 4JAXA 5AQOA 1HKCA 2P9KA 3H3NO 5AZJB 4BGBA 4PL8A 4EHTA 1QQMA 3MN7A 1BG3A 5AR0A 4BROA 1XQSC 2PBDA 1NGFA 1Z05A 2Q36A 1ZC6A 3GE1A 3BUZB 1RFQA 5EVZA 3VEYA 1HPMA 3VEVA 1P8ZA 4QS7A 3HBTA 3UKUB 3LDOA 2YCHA 4BRIA 5AZJA 1WUAA 4QS8A 3A5MC 4CZJA 2HF3A 4B1WB 2FLOA 5AQGA 4CD1A 3W3DA 2ZGZA 5AQUA 2FF3B 3C7NB 2Q0UA 5BN9A 4WQ5A 3R8EA 2P9LB 4BR0A 1KAZA 1V4TA 4MLEA 1BA0A 2D1KA 4BREA 2D0OA 2GWJA 3D7EO 3H3OB 4FWPA 2CGKA 2P9SB 1GLBG 3MDQA 2A5XA 2ASOA 3UKUA 3L0QA 4H0OA 1ZBSA 2CH5A 3O6WA 4IJNA 4QS9A 4XH1A 3LM9A 2E2NA 5AQJA 5KQDA 3AAQA 3F9MA 4GY2B 5AZIB 3C7NA 3DAWA 5AQHA 1ESVA 1MWMA 5ELZA 2P9LA 2ASMA 1OKJA 2QWMA 4EHUA 4JD2B 2A40A 3C0BA 2QWRA 1QHAA 2P9SA 5AQFA 3AAPA 3SLCA 4B1VA 3LDQA 4CBXA 2D0PA 3L4IA 1LCUA 5AQLA 5AZIA 1K8KB 1DKGD 3LM2A 3ULEB 3DWLA 3LDPA 2QWLA 4JNEA 2FSKA 4IWVA 4JD2A 4BC3A 2QXLA 2IIRA 4BRAA 4BRDA 3FFKB 5CE3A 2V52B 5AFUH 3GBTA 4YDUC 2NZTA 5LJVA 3KZBA 4DCHA 1X9JA 4AM7A 3O5BA 3TPQA 3CI5A 3AY9A 4H5TA 4IO8A 2AA4A 3O08A 3ULEA 3L6QA 1K8KA 5BRFA 2IVOA 1U2VB 5F0XA 5KQ8A 4K25A 1ZXOA 3ENOA 4LC9B 4DB3A 3IDHA 5LJWA 3FZKA 4H5RA 3ATVA 4CZIA 4BRQA 5AQPA 2WUSA 4FPBA 4BR5A 1NGHA 2AP1A 4H5WA 4WQ5C 3KHYA 1MWKA 3ENHA 2E8AA 3A0IX 4XEIA 4BR9A 1U2VA 1NM1A 3MMVA 2W41A 3O8MA 1C0FA 3G25A 3EZWA 2W40A 1NGIA 5I9EB 3U8XA 3VETA 3UB5A 1ATNA 5TKYA 4MLHA 1SZ2A 3WT0A 2E2QA 3R6MA 3EO3A 4NB4A 4PKIA 5ADXA 3J8AA 3GL1A
chains in the Genus database with same CATH superfamily
3IMXA 3WXKA 3VF4A 1XMOK 4G1QA 3S3NA 2RN2A 3FE1A 3TAEA 4J2EA 4O5FA 2ZJRL 4LFCK 4K8XA 1VSFA 3LPUA 3WUHA 1GOAA 4YDUA 1BISA 1JLCA 2ZE2A 4FK0A 3AVFA 3TR8A 2Q0RA 4A2BA 4G9ZA 4ISEA 4IOXA 3J7AP 1S9GA 3FR0A 4OLAA 5BPMA 1WOQA 1X3NA 3CQYA 2UUCK 3ENBA 1T6CA 1NGEA 3GG4A 5I3UA 2V51B 3IRXA 2YNFA 2OPSA 2HNZA 1B9DA 5BREA 1LOTB 5CYMA 1BO5O 1LW0A 3UKRB 3VQAA 4CEQA 4YOYA 1KFSA 4Y0WA 1YJNN 3FZFA 4BRHA 3CMAN 4IDKA 2F7TA 1RDBA 3CFOA 4BC4A 2KTQA 2VYPA 3CD6N 5JS1A 4GV3A 3HXMA 2Q31A 4OGEA 3JSMA 1Q9YA 3PO4A 2I5JA 5CZ2A 3C6AA 2VWKA 3CG7A 1XC9A 2O8EB 2P9PA 3QB0A 4E89A 3AVHA 4YOUA 1SUQA 4BDYA 3QFPA 1JCEA 4NXNK 2CGJA 2F9WA 2I7NA 2ZWHA 2GV9A 3VQBA 2DTUA 2BH1A 3J80O 1NNEA 1NJZA 1LAWA 1IG8A 4C8MA 4MO4A 4YOWA 4IOAL 1YAGA 1K73O 1XWLA 2OANA 3RR8A 3VQQA 4RW6A 5AQNA 4CZFA 1HYSA 2O8CB 4LF6K 4PA1A 1C0GA 3U9DA 1IG9A 1S9EA 3K5LA 2PFUA 5AQYA 1B9FA 3UE5A 4JKCA 1NGJA 5C2FA 1MDUB 2F9TA 1NK5A 3S3OA 4JKAA 3CCVN 1U6ZA 4FYDA 1DGKN 4EP5A 1L3VA 2UXBK 1XNQK 1VQ6N 4DMNA 5GIOA 3OYDA 3QDKA 4BRGA 4HWIA 1NKBA 4CBWA 5AQKA 1A5WA 5CY4A 4GV6A 3FZHA 3RWUA 1KLMA 3VGMA 1I39A 1HUXA 4FLZA 1IKWA 4DQ8A 3VGKA 2VG7A 2RF2A 4JKBA 4JHDA 4FOIA 1YI2N 1W0HA 4DV3K 4M3ZA 3ZT0A 1NU0A 1M1KO 1VQPN 4W5RA 3U9ZA 3SV4A 2DY4A 4IEIA 1HYVA 2A41A 1NK8A 5FPMA 4HUEA 3TAGA 3VQ4A 5BRHA 1Q81O 5KPTA 4C1NI 1GLAG 3WXJA 1JCGA 4I6MB 3AVKA 3CCQN 1Q82O 4FWOA 1S1XA 3TSQA 1QSLA 2DFFA 3WNFA 1HRHA 1JL2A 4JLHA 3ISNC 4HUGA 4KRFA 2UU9K 3G4SN 3JYTA 3KWGA 3LAMA 4DU4A 4CJ3A 2ITGA 4DSLA 1L3UA 2DFEA 3HK2A 1GLDG 3SMPA 2O8DB 1T8EA 2Y1IA 1WBBA 2HMPA 1VQON 3HOTA 4DR1K 3T1HK 3DXMB 4LD0A 5C10A 3HSTB 2QA4N 4E0DA 1SL0A 3HPHA 1IBMK 4DV5K 4IFEA 1RT6A 3WEEA 4J8FA 4C8KA 1VSIA 3CF5L 1T05A 4HVJA 3S41A 3BF3A 4DU1A 4M63C 3LDNA 2YHWA 4E1JA 3DLGA 5HRRA 4JI8K 3O1WA 1TK8A 4WYBA 4DR5K 5JVGL 3SYZA 4CJLA 5AFUA 1NBWA 2Q2RA 2YNHA 3AA3A 3WNGA 5BRDA 4DSFA 4CJEA 1SKWA 3P83D 2ASPA 3H45C 5TKWA 1BGXT 1NJXA 3TWHA 1J5OA 1TYQB 4NLCA 3OYFA 2AJQA 4AHVA 3L8BA 3ZT1A 2GUPA 3OYBA 5EU7A 4F4KA 4KHPK 1NJIO 4H5NA 3QNNA 4BQZA 1JJ2M 2V7YA 3RRHA 4CEFA 2HNDA 3A2FA 1Y64A 5AQIA 4A5AA 5CR4A 4MQ3A 4FLTA 3IUCA 4H0TB 4CK1A 4WF9L 2ZGYA 4M3UA 1S22A 2ITMA 2FF6A 5LMNK 1BUPA 4DR3K 2IVPA 1QZ5A 4B9TA 1BI4B 3I8BA 3KK3A 4BGAA 4BR2A 2E4LA 5SZTA 3JAMO 2X78A 5AQSA 1VSJA 4O44A 4Q5VA 3EZ5A 1N34K 3VQ7A 4IXCA 3C6HA 4E7JA 1D9FA 1ZBUA 1VQ8N 4OGCA 4CGGA 4HTUA 3D2EA 3AARA 4FO0A 1CZ9A 2HHTA 1HKCA 4UY8O 5AR0A 3I0SA 4BROA 2PZSA 2PBDA 3ZT4A 5CZ1A 2D0BA 3TANA 2F8TA 1UA0A 4QS7A 3T3FA 1RT1A 3HBTA 3OS0A 1Q86O 1WUAA 2YNGA 1QSSA 1LV5A 3OYMA 4O55A 4CD1A 2UUBK 4B9NA 5AQUA 2FF3B 5BN9A 2UXCK 4WQ5A 2P9LB 3AGRA 1KAZA 3SAFA 1BA0A 3VTHA 1RBSA 4DV2K 4LF7K 3V9SA 2CGKA 4B3TK 1GLBG 4CJUA 4IJNA 4XH1A 4I7FA 3LM9A 4JKHA 2XO7A 4JI2K 3F9MA 4IOCL 5AZIB 3MXIA 4E7HA 4CHZA 2QWMA 4JD2B 2A40A 3AV9A 1WNSA 1QVGM 4M3YA 2QWRA 2G8VA 1QHAA 3SLCA 4B1VA 1GOBA 4JKGA 4CBXA 4FJIA 3DYAA 1RTJA 1LCUA 4M3XA 3THWB 1ZBHA 3DWLA 2HHUA 2QKBA 2FSKA 2IIRA 5AFUH 3THVA 4YDUC 2NZTA 3KZBA 3MWTA 1RT5A 2WONA 4AM7A 1S72N 3O5BA 3VQCA 4IO8A 1HNZK 3QESA 4DQIA 2AA4A 3ULEA 2RKIA 3L6QA 5BRFA 5E41A 4YY3K 5F0XA 3E66A 4CVNE 3PLAA 3R3LA 1XHXA 3ENOA 4JRQA 5C42A 4QOZB 4BRQA 3MX5A 3DI6A 4DFJA 3HJFA 4CHYA 4X65K 1JLBA 4FPBA 1NGHA 2AP1A 4W5TA 4Z4GA 3KHYA 5HRSA 4CFDA 3A0IX 5BR8K 4LH4A 3G25A 3K58A 3EZWA 2W40A 4JI1K 4FVUA 2E6LA 2HHQA 1RTDA 1KFDA 3O9RA 2IDOA 2E2QA 4CIEA 2VWJA 1OH6A 4NB4A 4DHYA 3KLHA 3J8AA 4KREA 3AGKA 1IO2A 3FZLA 3VEZA 4DQRA 4L3QA 2KKZA 3QNOA 4I2QA 4BE0A 4JI6K 3OVNA 3M6GA 4FWLA 3CJCA 1F21A 4IZ9A 4DF4A 1VQ7N 1QVFM 2O4IA 4O0IA 1WSEA 1ASWA 1CZBA 1C6VA 2P51A 4AM6A 3RVCA 3HI0A 4ISGA 4FWQA 1W9HA 1XUPO 2XRIA 3CMEN 4KHYA 1WSIA 3ID6A 3DMJA 2HOEA 1GLFO 4R5PA 5I42A 2FBYA 5EX5A 2O8BB 2FSJA 3DXKB 1HMVA 4O4GA 3T1YK 3CJ7A 1V4SA 4CJFA 4GVEA 1VQMN 1RDWX 3TAQA 3WXIA 1N32K 1BL3A 3DLLL 1SKRA 3CQ8A 3O80A 3Q7CA 3K5MA 3ZT2A 4DQPA 3OYCA 2XY8A 3MN6A 1XHZA 3O4NA 4KHNA 4IBNA 2VCPA 4DQQA 1K9MO 3I0RA 4YORA 1HJRA 3UKRA 3RRGA 4LF4K 2QW9A 4M3WA 1C1CA 1XC3A 3NF7A 4O0JA 4BRKA 4IFVA 5KRSA 3QBWA 3CHWA 5IWAK 4WCEL 3AVBA 1ZBLA 3NH2A 1IJJA 2NLXA 2ATQA 3BP8A 3VF6A 1KQSM 4ICLA 4JKEA 5DK5A 4DV6K 4C8LA 4U7BA 3OYIA 2O8EA 1VQNN 4CZKA 3V9ZA 4M7XA 5FPEA 4CJ7A 5HRPA 4X64K 1YT3A 3K5NA 4OO1J 4MO5A 3V1OA 3W0LA 1C1AA 3CETA 3MX2A 5C15A 3KLGA 3VENA 4RW8A 2FBXA 5E84A 3DLKA 4H0XB 4A5BA 1NK6A 1E4GT 3OYHA 3WXLA 3NMUA 4BQLA 2A6AA 4KFBA 3L2WA 3AVJA 2VGMA 4CFBA 3A5OC 1RBRA 1EWQA 1QSYA 5JS2A 4JEPA 1W97L 4ELUA 1NGAA 5JLHA 3VEWA 1YHQN 1VSEA 3A5LC 4GW6A 3M3ZA 1CZAN 1E3MA 2P9UB 4B9QA 3CCLN 2O8CA 2P9NB 2DFHA 2G8FA 3OYAA 4GNIA 5HBMA 3KLIA 1N5YA 5B8HA 5KGWA 3QBXA 2OTLN 5M1OA 4NCAA 1VSLA 3MECA 4DSKA 1WB9A 3BZCA 3QLHA 5F1XA 4K0KK 1FKPA 1DLOA 3TSPA 1SL2A 4FWKA 2BUPA 5M1KA 1JLFA 2YKNA 3MEEA 3QERA 3V6DA 1S1WA 3OY9A 3LP3A 1R59O 3OA9A 4FK2A 5J2NA 2X6NA 2HNYA 4CEZA 1H1VA 2F8SA 3HT3A 4CEEA 4FLXA 3CCRN 4DFMA 3CQXA 4GKKK 3SJJA 4CHPA 3AVNA 3H6EA 5EOYA 3H1QA 4BDPA 4FJJA 1CLQA 3K9JA 2A3ZA 1NMDA 3O1BA 4QCLA 1Q9XA 4B9SA 4W5QA 4I6MA 3OYJA 3F73A 3ZX2A 3LZJA 1OH5A 3J7YP 1HYZA 3ITHA 3HPOA 2O8FB 1S6QA 4BC2A 4JI5K 1NJWA 4WQ4C 1GLEG 4OKEA 4B1XB 1RGIA 2JGUA 4DR4K 4WE1A 4BVOA 1J6ZA 5HL7L 5SWMA 4F9OA 2YV0X 4B8CA 3DOLA 3EEQA 3VEXA 4CJ5A 2O8DA 2D5RA 1JCFA 2ZJPL 3DXMA 3KK1A 4CIGA 1HR0K 1SAZA 3WXMB 1YVUA 1J54A 3RMDA 3EL2A 2X74A 1W7AA 4BE2A 1TK5A 3TU5A 3T69A 5BPNA 3KJVA 2F4VK 4FSVA 3TI0A 3ZLJA 4CZHA 4B1YB 4CF0A 3G71N 4FJHA 1S1UA 2YJFA 3PSFA 3SPZA 2YKMA 4O8KA 2VWBA 4BG9A 4DTRA 3PV8A 3MCAB 4N41A 5EY4A 1E4FT 4BG8A 3DJCA 3L2RA 4DR2K 2PY5A 1ITGA 1REVA 3QFUA 1VAZA 1KAYA 1TYQA 1Z6RA 5JVHL 3S9HA 3ZCMA 1J53A 5T7BA 1J9AA 5DMRA 3VEOA 4B1UB 1W2BM 2NRHA 4CESA 4FZXC 1D9DA 4XH5A 1K8AO 3KVGA 3TTDA 4BRFA 1NJYA 1XI1A 4DUZK 3ZSRA 1QQCA 3SJHA 4CGHA 4KH4A 5KI6A 3JS6A 4H4OA 1EXQA 4C23A 4DKWA 3IFRA 4BRLA 2E20A 2B4JA 4R79A 3CFRA 4FLWA 1BI4A 2HHVA 1HNIA 1RT2A 5C2DA 4YOXA 5AQOA 3H3NO 4PL8A 1BG3A 1WSFA 4Z4IA 4EZ6A 1XQSC 4Y1DA 1NGFA 2Q36A 3GE1A 2IS3A 4AF1A 1RDUA 3BUZB 3HVTA 1O13A 1A5XA 1RFQA 4DF8A 1X9MA 5LMUK 1EETA 1HPMA 1WAFA 1P8ZA 3CM5A 3DRPA 4C8OA 4KH6A 3OJSA 4BRIA 3ZSYA 4ZHRA 1MU2A 2HF3A 5AQGA 1IKYA 3BY5A 3W3DA 2ZGZA 3C7NB 1TKDA 3R8EA 5A2QO 4DV7K 2D1KA 4BREA 2OTJN 1EO1A 1LWEA 3H3OB 4FWPA 3QEPA 2P9SB 3B6PA 5HLFA 2ASOA 3LALA 1K6YA 2CH5A 2Z1GA 3O6WA 4OPAA 3SUOA 1SS6A 3NAEA 1Z26A 1CXUA 5AQJA 3THXB 1VQ9N 1N33K 2P5GA 3NFAA 3DAWA 1KCFA 5AQHA 2GUIA 5FLXO 2P9LA 2ASMA 1U49A 3J81O 2GBZA 4JI3K 3HPGA 1TL1A 3SUPA 5AQFA 3P38A 4N47A 4BACA 3L4QA 4NCGA 4E7IA 2D0CA 3L4IA 2B5JA 4LSNA 5AZIA 1K8KB 1N36K 4I9QA 4B3OA 3LDPA 2QWLA 1VHXA 4JD2A 4BC3A 2QXLA 2HVIA 3FFKB 3HVRA 1RT4A 3RTVA 4JKFA 3GBTA 3CCEN 1SL1A 4DCHA 1VQ4N 4GKJK 3E9OA 3CI5A 1BIUA 3RMAA 1YTAA 3O08A 3NE6A 3OYGA 2IVOA 3THWA 4Z4EA 5KQ8A 1CXQA 2FBTA 3SAGA 4NXMK 4K25A 3IS9A 1ZXOA 4LC9B 5J2QA 4DB3A 1S6PA 3IDHA 3K59A 5FRMA 4FLUA 5AQPA 3TTFA 2NNWA 4BR5A 5HOOA 4H5WA 3THYB 4LFBK 2PYJA 1FK9A 1OH7A 3ZT3A 1B92A 4FLYA 2QEXN 2W41A 3O8MA 3TTCA 3DLHA 3PUFA 1NGIA 1YIJN 4DWIA 3MXMA 2P5OA 1YJ9N 2WOMA 5FRNA 3UB5A 1NKCA 4X62K 1KD1O 3CCUN 3OYNA 3EY1A 3DRSA 3I55N 4PKIA 3GL1A 1WN7A 3SBTA 5AQRA 3AVLA 3PSIA 4EAHD 3SK3A 1TK0A 4FOEA 4MDBA 2ETJA 5F2RA 1LW2A 3H08A 3QICA 1TV6A 4LH5A 5ADXH 5AQQA 4B3SK 3O4QA 4LY7A 4FWNA 3WQUA 3J7ZO 4YOVA 4JYAK 3CC2N 4FZYA 2FC0A 1T6DA 4KTWA 2YX6A 3L3VA 2GTDA 3HM8A 2KFNA 3O3GA 2E88A 2QWPA 3VF2A 5GIPA 3LP0A 1JXEA 3D0PA 4B1ZA 3H1VX 4GV9A 3AA5X 2Z1HA 4DUYK 3O3FA 3OS2A 5D3GA 2GEMA 2YHYA 3MCPA 1DTQA 2OZSA 4BDZA 3P4IA 1SQKA 3ATUA 3LANA 4LF5K 3C65A 3V1RA 2HMIA 3EN9A 1KVAA 1NWKA 4BR4A 3KWIA 3CPWM 3QETA 1GLCG 3IKMA 1U4BA 4K8ZA 4CF8A 2BGGA 2O8BA 3OTOK 3DXKA 3HP6A 2GELA 1Z25A 1IBKK 1UWBA 5CYQA 3ZSQA 2QWOA 4FL9A 4M7YA 4CGDA 1WSJA 4NYFA 1RTHA 4YHHK 1S1TA 4FWRA 1VSKA 4HTLA 5KTQA 3ZETB 2QTDA 3F5TA 1HX1A 4FJ7A 2NRZA 2PYLA 2NRXA 2A42A 3SCXA 1Q8IA 2QM1A 1GLLO 3EKUA 2ZM6K 1VQLN 4Z94A 3ZEUB 4DTNA 3K5OA 1DT9A 4HCBA 3DRRA 2VGNA 4BRCA 1NMNA 1RILA 4NYNA 2BANA 4GVMA 3C95A 4DU3A 1WBDA 5DM6L 1VRUA 3VQ6A 4ELVA 4DSIA 1TUUA 4LF8K 5JMVA 4E19A 4OX9K 3CXCM 4KKOA 4FCYA 3NF9A 2E2OA 2HVHA 4BRMA 3DLRA 1RDCA 4DTSA 1WSHA 4O5BA 4CEAA 3AVIA 1BA1A 5HRNA 4CERA 4RTFD 4PKGA 2FXUA 4CHNA 5FPDA 4KAZA 4JI4K 3ID8A 4B9LA 4BE1A 4FJXA 1SV5A 3FGUA 3L2VA 1HJOA 2E1YA 4FK4A 3AVAA 4KV8A 2F96A 1UAXA 5GINA 2NRWA 3I33A 4KHWA 2YI1A 1YJWN 4FLVA 3CFPA 1NLVA 2A1RA 4BC5A 2Z1JA 3KD5E 1TUYA 1QE1A 4BRNA 4FPAA 2DPNA 3NGYA 3VOVA 1DEJA 4CZLA 3AVGA 1X3MA 3HL8A 3WNEA 4E1MA 3E01A 3ASMA 2G8IA 3GDQA 2P9UA 4J2AA 2P9NA 4FW1A 2J4RA 2JLEA 1ATRA 5C25A 3AO4A 5BR9A 2EX3A 5GAEP 4QAGA 4A2AA 4JI7K 1VRTA 3AO3A 1EP4A 3QIOA 2Z1IA 5J1EA 3P39A 2W6KA 2CH6A 1NK0A 4KTQA 3RSEB 3CC4N 4KPYA 2YHXA 4PL7A 1KVBA 3JXUA 1KAXA 1WSGA 2JWLA 4NLBA 3R9PA 1ZBIA 1Q7YO 4RW7A 4JI0K 3CERA 2ZQBA 3VGLA 2OZMA 4E3SA 2QKKA 1EKEA 1ILYA 2IGIA 3EE9A 4CE9A 1G99A 1ASUA 3HTVA 2WTUA 5AQTA 1D5AA 1RBTA 1LWCA 4A62A 3CJ1A 1WLJA 3QEXA 3I8DA 2P1JA 2PAVA 3AO5A 3OYKA 4OJRA 1QQOA 5E26A 3UIQA 5FPNA 2R7YA 3KIOA 3CJBA 3VQ8A 4AHTA 3U6FA 2BDPA 2BTFA 3KTQA 3CIPA 3SQ4A 4CGFA 3P5JA 2O8FA 2XY6A 4BR7A 4C1NK 4B9UA 1LAVA 3KLFA 1GLJO 2QI2A 4K42A 2RPIA 2Y1JA 3HZ6A 4EZ9A 4CZEA 4OVLA 4Z4CA 3T7ZA 2E2PA 4W5OA 3LDLA 2P9IB 4YOTA 4DR7K 3D2FB 1YUWA 2OPRA 3WNHA 2Q97A 1I3AA 1EQYA 1NGCA 1JLQA 3QEVA 4IKFA 3O9UA 4CK3A 4A59A 2GWKA 3FLCO 4CD3A 4N5SA 2VQEK 4CJWA 2HHWA 4H4MA 1X1PA 5M1FA 3NHGA 4ILJA 2IAJA 1NGBA 3LWMA 1HKGA 1T7PA 2HBLA 2D4WA 3BGRA 4BY9C 3ALYA 3O4WA 3PIOL 2G8KA 5DM7L 5IT9O 3AA2A 4DTMA 4AHRA 4FZZA 4CK2A 1QZ6A 1N8RO 1GOCA 3AO2A 2OPPA 1BWFO 1KXPA 3S3MA 4OPJA 2CGLA 1EWRA 2UYTA 5AQMA 4CF9A 2P9KB 4UQGA 1P90A 3MEDA 2ZF5O 3LL3A 3SV3A 2QXFA 3EYZA 4RWTA 1BDGA 4FWMA 3KK2A 3OW2M 1HPZA 1QQNA 4FJNA 1ZYQA 4BWMA 4N76A 4DTJA 1RNHA 5JLFA 1RDAA 1ZBFA 4GMJB 3BEXA 4I2PA 1U48A 3V1QA 5AZJB 4BGBA 4EHTA 4CHQA 3OJUA 3P1GA 4DV1K 1Z05A 2FBVA 4FJGA 1TVRA 3V9XA 1FKOA 5EVZA 3SNNA 3VEYA 3L2QA 4Y1CA 2HHXA 5GAGP 3UKUB 4KH5A 3LDOA 3RR7A 4QS8A 4B1WB 2FLOA 1TL3A 3NH1A 3G0ZA 3IAYA 3K9KA 2VG6A 2KLAA 3DLBA 3HYFA 3ZSOA 4FXDA 2A5XA 3V9WA 4DLGA 5LL6Z 1KC8O 4QS9A 4E7LA 2E2NA 3AAQA 4DR6K 4F3OA 1OVQA 3C7NA 3NCIA 4Q0BA 5KGXA 3O9TA 1TKTA 4I9LA 4L8RB 3BZKA 2ZD1A 3D45A 1C1BA 3SZ2A 4F2RA 4JS4A 1XMQK 2OA8A 4DG1A 1J5EK 2P9SA 3AAPA 1Y97A 1BCOA 4DV0K 3LDQA 4CJ4A 4DLEA 3TABA 4ID5A 4U67L 3L3UA 3THXA 5AQLA 4FM1A 3LM2A 4FJ8A 4JK9A 3VQPA 3O3HA 1FXXA 4M41A 4OPKA 3O9QA 1QHTA 5LJVA 4CGIA 3B6OA 1NK9A 3AY9A 1YTUA 1K8KA 1NG9A 1KVCA 3U3GA 3ZSXA 1U45A 1T03A 1U2VB 3SAHA 3K2PA 1BHLA 5LJWA 3DLEA 3FZKA 3MXJA 4H5RA 4CJRA 3ATVA 1OVYA 3QEIA 4B9MA 2W42A 4E7KA 2QK9A 1JLAA 3G10A 4WQ5C 4AH9A 1MWKA 3ENHA 2E8AA 3SUNA 4IG3A 1NM1A 3MMVA 3KLEA 1C0FA 2KQ2A 3VQ9A 5J2PA 4PHTX 4CCHA 3RMCA 1BCMA 3U8XA 4JS5A 4DS4A 4KTZA 1A5VA 3TARA 1SZ2A 3THYA 3LDSA 3EO3A 4LF9K 2YHAA 5ADXA 3CCJN 3PX0A 1O1WA 3PX4A 4CF1A 3A5NC 2G8UA 1HQUA 4YFUA 3SPYA 1HQEA 5LY3A 3OYEA 2KW4A 4Z4FA 3HSCA 5JICA 4PUOA 1WAJA 4JK8A 1NOZA 1BIZA 4H03B 2KFZA 4DFPA 3OHRA 4CEBA 4B3RK 3KKRA 1FW6A 5EXWA 3HM9A 4DTUA 3FFIA 3MK6A 1EX4A 3SQ2A 4DTPA 3E1YA 5BN8A 3RMBA 3OBWA 4CEDA 5FDLA 4AILC 4O8UA 4H0YB 2HHSA 4JK7A 2OPQA 3VERA 1JL1A 4HCCA 3NGZA 3LP2A 2H3GX 3M5RA 2WC9A 5AQVA 3U4LA 3SMSA 4PY5A 2P9PB 1M90O 1L5UA 3SI6A 3VTIA 1XNRK 3M8RA 5AJ3K 4Z0UA 1JKHA 4CIFA 2IOCA 3H46O 2IC3A 3GOIA 3B8AX 4NO7A 3SBGA 4DSJA 4AHUA 2HF4A 3I56N 3D6RA 3Q7BA 3VA3A 1HNVA 3NGIA 3PX6A 1IBLK 1ASVA 1X9WA 5HROA 3V9UA 1T44A 5KRTA 3VQDA 3ZETA 4ELTA 2NRRA 5K14A 1QS4A 3VESA 4ID1A 2IVNA 3ZEUA 4F8RA 1QTMA 4BWJA 1HNXK 1VSDA 4CJVA 3QINA 2FSNA 4AHCA 3CJ9A 1NKEA 4B3MK 4KHUA 3SQ0A 4ZTFA 2YHBA 4CI6A 5GADP 3EKSA 3HOSA 3CYMA 4IDHA 4KBOA 1L3TA 2ZJQL 1TKXA 4FVMA 4WFBL 3MN9A 2G8HA 3LAKA 4ILGB 3VMFB 4ILHA 2LSNA 2YJEA 5KPRA 1L3SA 2HBKA 1IKVA 1MA9B 4KB1A 4AHSA 4IFYA 3AA4A 4KI4A 3ZYYX 4JN4A 4WQ4A 1DTTA 5AQZA 4JHDB 4PKHA 4H0VB 1VQKN 4C8NA 1HNWK 1N6QA 3ZSVA 4M45A 3A8YA 3MN5A 5BPLA 2OYQA 4BVPA 2EHGA 1T3VA 1YF5L 2Q1NA 2XHBA 1JXBA 3R1XA 4JKDA 3KD1E 3CCMN 3KKSA 2QWNA 2HSTA 3T1AA 4NCBA 3QO9A 5M1QA 1IKXA 1YVNA 4CZMA 4CFCA 4M3RA 1D8YA 3SUQA 4B8AB 4DV4K 1RBVA 4H8KA 1RDDA 4FWSA 4MDAA 1ATSA 2E5LK 4JV5K 2KHOA 3P31A 4OKKA 3TAMA 4FJ9A 4B9VA 4ISFA 4XH4A 4RW9A 1VQ5N 3BF1A 4M42A 3VQ5A 3M1FA 3SQ1A 2E6MA 5GAHP 3VN5A 1HKBA 3TSUA 4EFHA 5KPZA 4X66K 4FM0A 2G8WA 3NBPA 2V7ZA 4CBUA 3KK7A 5C12A 2JWKA 2NUBA 3WEEB 3K57A 3CPEA 4CF2A 4TSXA 1KLNA 3ZX0A 1NOYA 3E9PA 2OCEA 3RSEA 2HW3A 4K41A 5J2MA 3FZMA 1X9SA 4H5VA 1D4XA 1RTIA 4E1NA 3EE8A 4AQYK 4FJ5A 4KB0A 4A61A 2W6LA 3IG1A 4Z4HA 1R0AA 3MEGA 3LWLA 2KZMA 1U04A 1TKZA 2YNIA 3NDKA 1NGDA 1HLUA 3WQTA 4FW2A 3M8PA 4CGJA 1UOCA 4DSEA 3C6UA 1IV0A 3ZX3A 4KHQA 5MLCQ 1JLEA 2EWSA 1BU6O 2HBJA 3QMLA 3V81A 3QEWA 2X6SA 4DTXA 2I7PA 3AVCA 1C0TA 1RT3A 3O9SA 1YXQA 1C0MA 4BRPA 4EIAA 4J2BA 4A57A 4IO9L 2BE2A 4W5NA 4KHSA 1C0UA 4B08A 5AQWA 4CZGA 4RCHA 2P9IA 4FJKA 3D2FA 1JLGA 2WFBA 3HRGA 4WFNL 3VA0A 3DM2A 4K43A 2HHHK 3CJAA 1FJGK 3PO5A 4CW7B 1S3XA 1BOTO 1VK0A 1Q18A 4PQUA 5CHIA 3ULDA 3F9KA 1G15A 4EP4A 4DQSA 5AQXA 3HP9A 4F2SA 1OH8A 3D2EB 1RCHA 1S5JA 2QWQA 4CFAA 4IJAA 4IG0A 1TAQA 4ZTJA 5H1SQ 4FM2A 3M8QA 3VPZA 1S1VA 1TGOA 3PIPL 3MWPA 4N56A 1YITN 4H0PA 3M8SA 5HP1A 1NGGA 2HB5A 2E1ZA 4JAXA 4KI6A 2P9KA 4OPHA 3HO1A 5C0YA 1VSMA 1QQMA 3MN7A 2B6AA 3NVKA 1ZC6A 3QIPA 3VQEA 3NVMA 1BQMA 1NK4A 3LPTA 3VEVA 1I94K 1KSPA 2NRTA 2WBNA 2YCHA 4HUFA 5AZJA 3A5MC 4CZJA 3K0SA 3V4IA 3CCSN 3NF6A 3TAFA 3LZIA 2Q0UA 4CHOA 2O4GA 4BR0A 1V4TA 4MLEA 4CJSA 2A1SA 2RHKA 4V19S 2D0OA 4RW4A 2GWJA 3D7EO 2VG5A 4CJTA 3MDQA 3UKUA 3L0QA 4H0OA 1ZBSA 4OLBA 4JKGB 3NF8A 2Q3SA 3OS1A 3F2KA 5KQDA 3T19A 4GY2B 3TAPA 3AVMA 2GX9A 1ESVA 1MWMA 5ELZA 4YNQA 4XIUA 4CJKA 1OKJA 4EHUA 3C0BA 4CJPA 3ZSZA 4JRPA 4OKJA 1KRPA 1NK7A 2D0PA 1IH7A 4F3TA 3LP1A 2VQFK 4CECA 3ULEB 3MAQA 1DKGD 4IEEA 4DS5A 3CC7N 2KZZA 4JNEA 4IWVA 1UA1A 3CM6A 4BRAA 1LWFA 4BRDA 5FROA 5CE3A 2V52B 4CEOA 4FJMA 5M1PA 3U3YA 3N4QA 4CJQA 1RBUA 2NRVA 1X9JA 1TAUA 4M3TA 3TPQA 3N4PA 4H5TA 5M1NA 3G6EN 3C94A 2HBMA 2XY5A 3OBYA 4FJLA 1SKSA 4J2DA 1BQNA 3BDPA 4HHTA 2XY7A 4CZIA 2UUAK 2WUSA 4DTOA 4LSLA 4WFAL 3L2UA 4MFBA 2D0AA 4RG8A 4XEIA 4BR9A 1U2VA 3OYLA 1VSHA 5C24A 3ZSWA 2RE2A 3PY8A 4PWDA 2UXDK 4DFKA 3AO1A 4KO0A 5I9EB 1KTQA 3C6TA 3VETA 1ATNA 5TKYA 4MLHA 4LFAK 3NH0A 3WT0A 3R6MA 1RT7A 3DOKA 3E9LA 1U47A
chains in the Genus database with same CATH topology
3IMXA 3AGKA 3WXKA 3VF4A 3FZLA 3SBTA 3FE1A 3VEZA 3A5NC 4L3QA 2KKZA 5AQRA 4O5FA 3M6GA 2ZJRL 4FWLA 3CJCA 5LY3A 4IZ9A 3HSCA 3SK3A 4EAHD 4JK8A 5JICA 1VQ7N 1QVFM 4FOEA 4MDBA 5F2RA 3QICA 3WUHA 4H03B 4YDUA 4AM6A 5ADXH 5AQQA 3RVCA 3HI0A 4ISGA 4FWNA 2Q0RA 4FWQA 3OHRA 4A2BA 3WQUA 3J7ZO 4YOVA 3CC2N 4G9ZA 1T6DA 1XUPO 4IOXA 4ISEA 2YX6A 5EXWA 3CMEN 2GTDA 3HM8A 3FR0A 3ID6A 2E88A 1GLFO 2HOEA 2QWPA 3VF2A 3MK6A 5BPMA 1WOQA 5EX5A 1X3NA 5GIPA 3CQYA 3E1YA 3ENBA 5BN8A 2FSJA 3DXKB 3H1VX 1T6CA 3OBWA 4B1ZA 4GV9A 1NGEA 3GG4A 2V51B 2GEMA 3CJ7A 1V4SA 2YHYA 3MCPA 4O8UA 4GVEA 4H0YB 1VQMN 4JK7A 3P4IA 1SQKA 3ATUA 1RDWX 5BREA 3C65A 1LOTB 3EN9A 3VERA 1NWKA 4BR4A 1BO5O 3WXIA 3KWIA 3UKRB 4YOYA 3CPWM 3DLLL 1GLCG 3IKMA 2H3GX 3M5RA 3O80A 2WC9A 3Q7CA 5AQVA 3U4LA 4Y0WA 3SMSA 1YJNN 3FZFA 2P9PB 3DXKA 1M90O 2GELA 4BRHA 3CMAN 3VTIA 2F7TA 3MN6A 4BC4A 2QWOA 4FL9A 2VCPA 2VYPA 1K9MO 4M7YA 3CD6N 4GV3A 3H46O 2Q31A 4YORA 3GOIA 4FWRA 3B8AX 4HTLA 3UKRA 2QTDA 3ZETB 3C6AA 3F5TA 1HX1A 4NO7A 3SBGA 2NRZA 2QW9A 1XC3A 2NRXA 4BRKA 2A42A 2HF4A 3I56N 2P9PA 2QM1A 1GLLO 3D6RA 3EKUA 3Q7BA 3QB0A 1VQLN 4Z94A 3QBWA 3CHWA 4YOUA 3ZEUB 4WCEL 3QFPA 1JCEA 1DT9A 1IJJA 2I7NA 2NLXA 2CGJA 2F9WA 1T44A 3BP8A 2VGNA 2ZWHA 3VF6A 1KQSM 4BRCA 4JKEA 2BH1A 3ZETA 2NRRA 4U7BA 1VQNN 4CZKA 1IG8A 3VESA 4MO4A 2IVNA 4M7XA 3ZEUA 5FPEA 5DM6L 4YOWA 4IOAL 4CJ7A 1TUUA 4OO1J 1YAGA 1K73O 4MO5A 5JMVA 2FSNA 3W0LA 3CXCM 3CETA 3CJ9A 3MX2A 5C15A 2OANA 3VENA 5GADP 4CI6A 3EKSA 2E2OA 3HOSA 4IDHA 4BRMA 5E84A 4KBOA 2ZJQL 4H0XB 5AQNA 4A5BA 4CZFA 1BA1A 1E4GT 3WXLA 3NMUA 4BQLA 2A6AA 4WFBL 1C0GA 3MN9A 2VGMA 3U9DA 4ILGB 3VMFB 4RTFD 3A5OC 4PKGA 2FXUA 2PFUA 4ILHA 5AQYA 3UE5A 2YJEA 5FPDA 4JEPA 3ID8A 4JKCA 5KPRA 1W97L 1NGJA 1NGAA 2HBKA 3FGUA 5JLHA 1HJOA 2E1YA 1MA9B 1MDUB 2F9TA 3VEWA 5C2FA 1YHQN 3A5LC 4JKAA 3ZYYX 4JN4A 5GINA 2NRWA 3I33A 3M3ZA 1CZAN 1U6ZA 2P9UB 1DGKN 4JHDB 2YI1A 4PKHA 4WQ4A 5AQZA 4B9QA 1YJWN 4H0VB 1VQKN 3CCLN 1NLVA 2P9NB 4BC5A 1VQ6N 1TUYA 5GIOA 4BRNA 4FPAA 2DPNA 3QDKA 4BRGA 4HWIA 4CBWA 5AQKA 4GNIA 3A8YA 3VOVA 1DEJA 3MN5A 4CZLA 1X3MA 5BPLA 3FZHA 4GV6A 3VGMA 5B8HA 4BVPA 1HUXA 1T3VA 4DQ8A 3QBXA 3VGKA 1YF5L 3GDQA 2P9UA 2Q1NA 4JKBA 4FOIA 4JHDA 5M1OA 2OTLN 3R1XA 4JKDA 2P9NA 3CCMN 5F1XA 2J4RA 2QWNA 1YI2N 1ATRA 2HSTA 3TSPA 4FWKA 2BUPA 5BR9A 5M1QA 5M1KA 1M1KO 1VQPN 1YVNA 4CZMA 3U9ZA 5GAEP 4A2AA 4IEIA 1R59O 2A41A 3OA9A 5FPMA 4FWSA 4MDAA 1ATSA 5BRHA 1Q81O 5KPTA 2KHOA 3P39A 3P31A 4C1NI 1GLAG 3WXJA 1JCGA 2CH6A 4I6MB 4ISFA 4XH4A 3CCQN 1Q82O 1VQ5N 3RSEB 4FWOA 3BF1A 3TSQA 3CC4N 3M1FA 2YHXA 5GAHP 4PL7A 1H1VA 3JXUA 1KAXA 1HKBA 3TSUA 4EFHA 5KPZA 2JWLA 4NLBA 3R9PA 3CCRN 3G4SN 3CQXA 3KWGA 1Q7YO 2V7ZA 4CBUA 3KK7A 5C12A 2JWKA 3CERA 3H6EA 5EOYA 3VGLA 3CPEA 3WEEB 3H1QA 3K9JA 1GLDG 2A3ZA 1NMDA 3O1BA 3ZX0A 3SMPA 1ILYA 3E9PA 2HMPA 4I6MA 3ZX2A 1VQON 3RSEA 3HOTA 4K41A 3DXMB 3CCJN 3EE9A 5C10A 1G99A 2QA4N 3FZMA 4H5VA 1D4XA 4BC2A 3HTVA 3EE8A 5AQTA 4WQ4C 1GLEG 4B1XB 1RGIA 4A61A 4IFEA 4A62A 3CJ1A 1J6ZA 4BVOA 5HL7L 3WEEA 2PAVA 4F9OA 3VEXA 1QQOA 4J8FA 5E26A 3CF5L 5FPNA 1JCFA 3CJBA 3S41A 3BF3A 3DXMA 2ZJPL 2BTFA 1NGDA 1HLUA 4M63C 3CIPA 3WQTA 3LDNA 4NB4A 2YHWA 4E1JA 4BR7A 4C1NK 4DHYA 1SAZA 3WXMB 1GLJO 2QI2A 3O1WA 4K42A 3ZX3A 3HZ6A 4WYBA 4CZEA 2EWSA 5MLCQ 3EL2A 5JVGL 5AFUA 1BU6O 2HBJA 3QMLA 2E2PA 3T7ZA 1NBWA 2Q2RA 3LDLA 2P9IB 4YOTA 2I7PA 3D2FB 1YUWA 3TU5A 3T69A 2Q97A 5BRDA 3O9SA 5BPNA 1YXQA 4BRPA 1EQYA 4EIAA 2ASPA 3H45C 5TKWA 1NGCA 4A57A 4FSVA 4IO9L 4CZHA 4B1YB 3G71N 3O9UA 4A59A 2YJFA 2GWKA 3FLCO 4CD3A 1TYQB 4NLCA 2VWBA 4O8KA 5AQWA 4BG9A 4CZGA 3MCAB 4RCHA 2GUPA 5EY4A 2P9IA 3D2FA 5M1FA 1E4FT 2WFBA 4BG8A 3HRGA 4WFNL 4ILJA 3DJCA 1NJIO 1NGBA 4H5NA 4K43A 4BQZA 1HKGA 3CJAA 2V7YA 3QFUA 1JJ2M 1VAZA 1KAYA 1Y64A 1TYQA 1Z6RA 2HBLA 5AQIA 1S3XA 4A5AA 2D4WA 1BOTO 5CR4A 1Q18A 4BY9C 3O4WA 3IUCA 3PIOL 4H0TB 5CHIA 4WF9L 5JVHL 2ZGYA 5DM7L 1S22A 2ITMA 2FF6A 1QZ6A 5AQXA 1BUPA 3VEOA 4B1UB 1W2BM 2IVPA 2NRHA 1N8RO 4XH5A 1K8AO 1QZ5A 1BWFO 1KXPA 3KVGA 3D2EB 2QWQA 3TTDA 2CGLA 4BRFA 3I8BA 2UYTA 5AQMA 4BGAA 4BR2A 2P9KB 4IJAA 1P90A 2ZF5O 3LL3A 3SJHA 4KH4A 5AQSA 5H1SQ 4RWTA 3JS6A 1BDGA 4FWMA 3VPZA 3OW2M 1QQNA 4C23A 3PIPL 4IXCA 3C6HA 3MWPA 5JLFA 1YITN 4DKWA 4H0PA 1VQ8N 3IFRA 4BRLA 2E20A 1NGGA 3D2EA 4R79A 3BEXA 3AARA 4FO0A 2E1ZA 5C2DA 4JAXA 4YOXA 5AQOA 1HKCA 2P9KA 3H3NO 4OPHA 5AZJB 4PL8A 4BGBA 4EHTA 5C0YA 1QQMA 3MN7A 1BG3A 5AR0A 4UY8O 4BROA 3NVKA 1XQSC 2PBDA 1NGFA 1Z05A 2Q36A 1ZC6A 3GE1A 4AF1A 1RDUA 3BUZB 1O13A 1RFQA 5EVZA 3NVMA 3VEYA 1HPMA 3VEVA 1P8ZA 4QS7A 5GAGP 2WBNA 2NRTA 3HBTA 4KH6A 3UKUB 4KH5A 3LDOA 2YCHA 4BRIA 5AZJA 1WUAA 4QS8A 3A5MC 4CZJA 1Q86O 2HF3A 4B1WB 2FLOA 3CCSN 5AQGA 4CD1A 3W3DA 2ZGZA 5AQUA 2FF3B 3C7NB 2Q0UA 5BN9A 4WQ5A 3K9KA 3R8EA 2P9LB 3AGRA 1KAZA 1V4TA 2KLAA 4MLEA 4BR0A 2RHKA 3SAFA 1BA0A 2D1KA 3VTHA 2D0OA 4BREA 2GWJA 2OTJN 1EO1A 3D7EO 3H3OB 4FWPA 2CGKA 2P9SB 1GLBG 3MDQA 2A5XA 2ASOA 3UKUA 3L0QA 4H0OA 1ZBSA 2CH5A 4OPAA 3O6WA 4IJNA 4JKGB 1KC8O 4QS9A 4XH1A 1SS6A 3LM9A 2E2NA 4JKHA 3F2KA 5AQJA 1VQ9N 5KQDA 3AAQA 3F9MA 4IOCL 4GY2B 5AZIB 3C7NA 3DAWA 2GX9A 5AQHA 3O9TA 1ESVA 1MWMA 5ELZA 2P9LA 2ASMA 1OKJA 2QWMA 4EHUA 4JD2B 2A40A 3C0BA 1QVGM 2QWRA 1QHAA 2P9SA 5AQFA 3AAPA 3P38A 3SLCA 4B1VA 3L4QA 3LDQA 4JKGA 4CBXA 2D0PA 4U67L 3L4IA 1LCUA 5AQLA 5AZIA 1K8KB 1DKGD 3LM2A 4IEEA 3ULEB 3DWLA 3LDPA 3CC7N 2QWLA 4JNEA 3CCVN 2FSKA 4IWVA 4JD2A 4JK9A 4BC3A 2QXLA 2IIRA 4BRAA 4BRDA 3FFKB 5CE3A 2V52B 5AFUH 4JKFA 3GBTA 5M1PA 3CCEN 3N4QA 3O9QA 4YDUC 2NZTA 5LJVA 2NRVA 3KZBA 3MWTA 4DCHA 1X9JA 4AM7A 1S72N 1VQ4N 3E9OA 3O5BA 3TPQA 3CI5A 3AY9A 3N4PA 4H5TA 4IO8A 2AA4A 3O08A 3ULEA 3L6QA 1K8KA 5BRFA 5M1NA 2IVOA 3G6EN 1U2VB 5F0XA 5KQ8A 3E66A 3SAHA 3SAGA 3PLAA 2HBMA 3R3LA 4K25A 1ZXOA 3OBYA 3ENOA 4LC9B 4DB3A 3IDHA 5LJWA 3FZKA 4H5RA 3ATVA 4CZIA 1OVYA 4BRQA 3MX5A 5AQPA 2WUSA 3TTFA 4FPBA 2NNWA 1NGHA 2AP1A 4H5WA 4BR5A 5HOOA 4WQ5C 3KHYA 4WFAL 1MWKA 3ENHA 2E8AA 3A0IX 4XEIA 4BR9A 1U2VA 2QEXN 1NM1A 3MMVA 2W41A 3O8MA 3TTCA 1C0FA 2RE2A 3G25A 3EZWA 2W40A 4PHTX 4FVUA 1NGIA 1YIJN 5I9EB 1YJ9N 3U8XA 3VETA 3UB5A 1ATNA 5TKYA 3O9RA 4MLHA 1KD1O 3CCUN 1SZ2A 3WT0A 2E2QA 3R6MA 3I55N 3EO3A 3E9LA 4PKIA 5ADXA 3J8AA 3GL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IMX A;  3WXK A;  3VF4 A;  3FZL A;  3VEZ A;  3FE1 A;  3A5N C;  4L3Q A;  5AQR A;  4O5F A;  3M6G A;  4FWL A;  3CJC A;  5LY3 A;  4IZ9 A;  3HSC A;  3SK3 A;  4EAH D;  5JIC A;  4FOE A;  5F2R A;  3QIC A;  3WUH A;  4H03 B;  4YDU A;  4AM6 A;  5ADX H;  5AQQ A;  3HI0 A;  4ISG A;  4FWN A;  2Q0R A;  4FWQ A;  3OHR A;  4A2B A;  3WQU A;  1T6D A;  1XUP O;  4ISE A;  5EXW A;  2GTD A;  3HM8 A;  3FR0 A;  2E88 A;  1GLF O;  2HOE A;  2QWP A;  3VF2 A;  3MK6 A;  5BPM A;  1WOQ A;  5EX5 A;  1X3N A;  3CQY A;  5BN8 A;  2FSJ A;  3DXK B;  3H1V X;  1T6C A;  4B1Z A;  1NGE A;  3GG4 A;  2V51 B;  2GEM A;  3CJ7 A;  1V4S A;  2YHY A;  3MCP A;  4H0Y B;  3P4I A;  1SQK A;  3ATU A;  1RDW X;  5BRE A;  1LOT B;  3EN9 A;  3VER A;  1NWK A;  4BR4 A;  1BO5 O;  3WXI A;  3UKR B;  1GLC G;  2H3G X;  3O80 A;  5AQV A;  3U4L A;  4Y0W A;  3SMS A;  3FZF A;  2P9P B;  3DXK A;  2GEL A;  4BRH A;  3MN6 A;  4BC4 A;  2QWO A;  4FL9 A;  2VCP A;  2VYP A;  4M7Y A;  3H46 O;  2Q31 A;  3GOI A;  4FWR A;  3B8A X;  4HTL A;  3UKR A;  3ZET B;  4NO7 A;  1HX1 A;  2QW9 A;  1XC3 A;  4BRK A;  2A42 A;  2HF4 A;  2P9P A;  2QM1 A;  1GLL O;  3EKU A;  3QB0 A;  4Z94 A;  3QBW A;  3CHW A;  3ZEU B;  3QFP A;  1JCE A;  1IJJ A;  2I7N A;  2NLX A;  2CGJ A;  2F9W A;  1T44 A;  3BP8 A;  2ZWH A;  3VF6 A;  4BRC A;  3ZET A;  4CZK A;  1IG8 A;  3VES A;  4MO4 A;  2IVN A;  4M7X A;  3ZEU A;  5FPE A;  4CJ7 A;  1TUU A;  1YAG A;  4MO5 A;  5JMV A;  2FSN A;  3W0L A;  3CET A;  3CJ9 A;  2OAN A;  3VEN A;  4CI6 A;  3EKS A;  2E2O A;  4BRM A;  5E84 A;  4KBO A;  4H0X B;  5AQN A;  4CZF A;  1BA1 A;  1E4G T;  3WXL A;  4BQL A;  2A6A A;  1C0G A;  3MN9 A;  3U9D A;  4RTF D;  3A5O C;  4PKG A;  2FXU A;  5AQY A;  3UE5 A;  2YJE A;  5FPD A;  3ID8 A;  5KPR A;  1NGJ A;  1NGA A;  5JLH A;  3FGU A;  1HJO A;  2E1Y A;  1MA9 B;  1MDU B;  2F9T A;  3VEW A;  3A5L C;  4JN4 A;  3M3Z A;  3I33 A;  4WQ4 A;  1CZA N;  1U6Z A;  2P9U B;  1DGK N;  4JHD B;  2YI1 A;  4PKH A;  5AQZ A;  4B9Q A;  4H0V B;  1NLV A;  2P9N B;  4BC5 A;  1TUY A;  4BRN A;  4FPA A;  2DPN A;  3QDK A;  4BRG A;  4HWI A;  4CBW A;  5AQK A;  4GNI A;  3A8Y A;  3VOV A;  1DEJ A;  3MN5 A;  4CZL A;  1X3M A;  5BPL A;  3FZH A;  3VGM A;  5B8H A;  4BVP A;  1HUX A;  4DQ8 A;  3QBX A;  3VGK A;  3GDQ A;  2P9U A;  2Q1N A;  4JHD A;  4FOI A;  2P9N A;  5F1X A;  2J4R A;  2QWN A;  1ATR A;  4FWK A;  2BUP A;  5BR9 A;  1YVN A;  4CZM A;  3U9Z A;  4A2A A;  1R59 O;  2A41 A;  5FPM A;  4FWS A;  1ATS A;  5BRH A;  5KPT A;  2KHO A;  1GLA G;  3WXJ A;  1JCG A;  2CH6 A;  4I6M B;  4ISF A;  4XH4 A;  3RSE B;  4FWO A;  3BF1 A;  3M1F A;  2YHX A;  4PL7 A;  1H1V A;  3JXU A;  1KAX A;  1HKB A;  4EFH A;  5KPZ A;  3R9P A;  3CQX A;  2V7Z A;  4CBU A;  3CER A;  3H6E A;  5EOY A;  3VGL A;  3WEE B;  3H1Q A;  1GLD G;  2A3Z A;  1NMD A;  3O1B A;  3ZX0 A;  3SMP A;  2HMP A;  4I6M A;  3ZX2 A;  3RSE A;  4K41 A;  3DXM B;  1G99 A;  3FZM A;  4H5V A;  1D4X A;  4BC2 A;  3HTV A;  5AQT A;  4WQ4 C;  1GLE G;  4B1X B;  1RGI A;  4A61 A;  4A62 A;  3CJ1 A;  1J6Z A;  4BVO A;  3WEE A;  2PAV A;  4F9O A;  3VEX A;  1QQO A;  4J8F A;  5E26 A;  5FPN A;  1JCF A;  3CJB A;  3S41 A;  3BF3 A;  3DXM A;  2BTF A;  1NGD A;  1HLU A;  4M63 C;  3CIP A;  3WQT A;  3LDN A;  2YHW A;  4E1J A;  4BR7 A;  4DHY A;  1SAZ A;  1GLJ O;  3O1W A;  4K42 A;  3ZX3 A;  3HZ6 A;  4WYB A;  4CZE A;  2EWS A;  3EL2 A;  5AFU A;  1BU6 O;  3QML A;  2E2P A;  1NBW A;  2Q2R A;  3LDL A;  2P9I B;  3D2F B;  2I7P A;  1YUW A;  3TU5 A;  2Q97 A;  5BRD A;  5BPN A;  1YXQ A;  4BRP A;  1EQY A;  4EIA A;  2ASP A;  3H45 C;  1NGC A;  4FSV A;  4CZH A;  4B1Y B;  2YJF A;  2GWK A;  3FLC O;  4CD3 A;  1TYQ B;  4O8K A;  2VWB A;  5AQW A;  4BG9 A;  4CZG A;  4RCH A;  2GUP A;  5EY4 A;  2P9I A;  3D2F A;  1E4F T;  4BG8 A;  3DJC A;  1NGB A;  4H5N A;  4K43 A;  4BQZ A;  1HKG A;  3CJA A;  2V7Y A;  3QFU A;  1KAY A;  1Y64 A;  1TYQ A;  1Z6R A;  5AQI A;  1S3X A;  2D4W A;  1BOT O;  1Q18 A;  3O4W A;  3IUC A;  4H0T B;  2ZGY A;  1S22 A;  2ITM A;  2FF6 A;  1QZ6 A;  5AQX A;  1BUP A;  3VEO A;  4B1U B;  2IVP A;  2NRH A;  4XH5 A;  1QZ5 A;  1BWF O;  1KXP A;  3KVG A;  3D2E B;  2QWQ A;  2CGL A;  4BRF A;  3I8B A;  2UYT A;  5AQM A;  4BGA A;  4BR2 A;  2P9K B;  4IJA A;  2ZF5 O;  3LL3 A;  3SJH A;  5AQS A;  4RWT A;  3JS6 A;  1BDG A;  4FWM A;  3VPZ A;  1QQN A;  4C23 A;  4IXC A;  5JLF A;  4H0P A;  3IFR A;  4BRL A;  2E20 A;  1NGG A;  3D2E A;  3BEX A;  3AAR A;  4FO0 A;  2E1Z A;  4JAX A;  5AQO A;  1HKC A;  2P9K A;  3H3N O;  5AZJ B;  4BGB A;  4PL8 A;  4EHT A;  1QQM A;  3MN7 A;  1BG3 A;  5AR0 A;  4BRO A;  1XQS C;  2PBD A;  1NGF A;  1Z05 A;  2Q36 A;  1ZC6 A;  3GE1 A;  3BUZ B;  1RFQ A;  5EVZ A;  3VEY A;  1HPM A;  3VEV A;  1P8Z A;  4QS7 A;  3HBT A;  3UKU B;  3LDO A;  2YCH A;  4BRI A;  5AZJ A;  1WUA A;  4QS8 A;  3A5M C;  4CZJ A;  2HF3 A;  4B1W B;  2FLO A;  5AQG A;  4CD1 A;  3W3D A;  2ZGZ A;  5AQU A;  2FF3 B;  3C7N B;  2Q0U A;  5BN9 A;  4WQ5 A;  3R8E A;  2P9L B;  4BR0 A;  1KAZ A;  1V4T A;  4MLE A;  1BA0 A;  2D1K A;  4BRE A;  2D0O A;  2GWJ A;  3D7E O;  3H3O B;  4FWP A;  2CGK A;  2P9S B;  1GLB G;  3MDQ A;  2A5X A;  2ASO A;  3UKU A;  3L0Q A;  4H0O A;  1ZBS A;  2CH5 A;  3O6W A;  4IJN A;  4QS9 A;  4XH1 A;  3LM9 A;  2E2N A;  5AQJ A;  5KQD A;  3AAQ A;  3F9M A;  4GY2 B;  5AZI B;  3C7N A;  3DAW A;  5AQH A;  1ESV A;  1MWM A;  5ELZ A;  2P9L A;  2ASM A;  1OKJ A;  2QWM A;  4EHU A;  4JD2 B;  2A40 A;  3C0B A;  2QWR A;  1QHA A;  2P9S A;  5AQF A;  3AAP A;  3SLC A;  4B1V A;  3LDQ A;  4CBX A;  2D0P A;  3L4I A;  1LCU A;  5AQL A;  5AZI A;  1K8K B;  1DKG D;  3LM2 A;  3ULE B;  3DWL A;  3LDP A;  2QWL A;  4JNE A;  2FSK A;  4IWV A;  4JD2 A;  4BC3 A;  2QXL A;  2IIR A;  4BRA A;  4BRD A;  3FFK B;  5CE3 A;  2V52 B;  5AFU H;  3GBT A;  4YDU C;  2NZT A;  5LJV A;  3KZB A;  4DCH A;  1X9J A;  4AM7 A;  3O5B A;  3TPQ A;  3CI5 A;  3AY9 A;  4H5T A;  4IO8 A;  2AA4 A;  3O08 A;  3ULE A;  3L6Q A;  1K8K A;  5BRF A;  2IVO A;  1U2V B;  5F0X A;  5KQ8 A;  4K25 A;  1ZXO A;  3ENO A;  4LC9 B;  4DB3 A;  3IDH A;  5LJW A;  3FZK A;  4H5R A;  3ATV A;  4CZI A;  4BRQ A;  5AQP A;  2WUS A;  4FPB A;  4BR5 A;  1NGH A;  2AP1 A;  4H5W A;  4WQ5 C;  3KHY A;  1MWK A;  3ENH A;  2E8A A;  3A0I X;  4XEI A;  4BR9 A;  1U2V A;  1NM1 A;  3MMV A;  2W41 A;  3O8M A;  1C0F A;  3G25 A;  3EZW A;  2W40 A;  1NGI A;  5I9E B;  3U8X A;  3VET A;  3UB5 A;  1ATN A;  5TKY A;  4MLH A;  1SZ2 A;  3WT0 A;  2E2Q A;  3R6M A;  3EO3 A;  4NB4 A;  4PKI A;  5ADX A;  3J8A A;  3GL1 A; 
#chains in the Genus database with same CATH topology
 3IMX A;  3WXK A;  3VF4 A;  1XMO K;  4G1Q A;  3S3N A;  2RN2 A;  3FE1 A;  3TAE A;  4J2E A;  4O5F A;  2ZJR L;  4LFC K;  4K8X A;  1VSF A;  3LPU A;  3WUH A;  1GOA A;  4YDU A;  1BIS A;  1JLC A;  2ZE2 A;  4FK0 A;  3AVF A;  3TR8 A;  2Q0R A;  4A2B A;  4G9Z A;  4ISE A;  4IOX A;  3J7A P;  1S9G A;  3FR0 A;  4OLA A;  5BPM A;  1WOQ A;  1X3N A;  3CQY A;  2UUC K;  3ENB A;  1T6C A;  1NGE A;  3GG4 A;  5I3U A;  2V51 B;  3IRX A;  2YNF A;  2OPS A;  2HNZ A;  1B9D A;  5BRE A;  1LOT B;  5CYM A;  1BO5 O;  1LW0 A;  3UKR B;  3VQA A;  4CEQ A;  4YOY A;  1KFS A;  4Y0W A;  1YJN N;  3FZF A;  4BRH A;  3CMA N;  4IDK A;  2F7T A;  1RDB A;  3CFO A;  4BC4 A;  2KTQ A;  2VYP A;  3CD6 N;  5JS1 A;  4GV3 A;  3HXM A;  2Q31 A;  4OGE A;  3JSM A;  1Q9Y A;  3PO4 A;  2I5J A;  5CZ2 A;  3C6A A;  2VWK A;  3CG7 A;  1XC9 A;  2O8E B;  2P9P A;  3QB0 A;  4E89 A;  3AVH A;  4YOU A;  1SUQ A;  4BDY A;  3QFP A;  1JCE A;  4NXN K;  2CGJ A;  2F9W A;  2I7N A;  2ZWH A;  2GV9 A;  3VQB A;  2DTU A;  2BH1 A;  3J80 O;  1NNE A;  1NJZ A;  1LAW A;  1IG8 A;  4C8M A;  4MO4 A;  4YOW A;  4IOA L;  1YAG A;  1K73 O;  1XWL A;  2OAN A;  3RR8 A;  3VQQ A;  4RW6 A;  5AQN A;  4CZF A;  1HYS A;  2O8C B;  4LF6 K;  4PA1 A;  1C0G A;  3U9D A;  1IG9 A;  1S9E A;  3K5L A;  2PFU A;  5AQY A;  1B9F A;  3UE5 A;  4JKC A;  1NGJ A;  5C2F A;  1MDU B;  2F9T A;  1NK5 A;  3S3O A;  4JKA A;  3CCV N;  1U6Z A;  4FYD A;  1DGK N;  4EP5 A;  1L3V A;  2UXB K;  1XNQ K;  1VQ6 N;  4DMN A;  5GIO A;  3OYD A;  3QDK A;  4BRG A;  4HWI A;  1NKB A;  4CBW A;  5AQK A;  1A5W A;  5CY4 A;  4GV6 A;  3FZH A;  3RWU A;  1KLM A;  3VGM A;  1I39 A;  1HUX A;  4FLZ A;  1IKW A;  4DQ8 A;  3VGK A;  2VG7 A;  2RF2 A;  4JKB A;  4JHD A;  4FOI A;  1YI2 N;  1W0H A;  4DV3 K;  4M3Z A;  3ZT0 A;  1NU0 A;  1M1K O;  1VQP N;  4W5R A;  3U9Z A;  3SV4 A;  2DY4 A;  4IEI A;  1HYV A;  2A41 A;  1NK8 A;  5FPM A;  4HUE A;  3TAG A;  3VQ4 A;  5BRH A;  1Q81 O;  5KPT A;  4C1N I;  1GLA G;  3WXJ A;  1JCG A;  4I6M B;  3AVK A;  3CCQ N;  1Q82 O;  4FWO A;  1S1X A;  3TSQ A;  1QSL A;  2DFF A;  3WNF A;  1HRH A;  1JL2 A;  4JLH A;  3ISN C;  4HUG A;  4KRF A;  2UU9 K;  3G4S N;  3JYT A;  3KWG A;  3LAM A;  4DU4 A;  4CJ3 A;  2ITG A;  4DSL A;  1L3U A;  2DFE A;  3HK2 A;  1GLD G;  3SMP A;  2O8D B;  1T8E A;  2Y1I A;  1WBB A;  2HMP A;  1VQO N;  3HOT A;  4DR1 K;  3T1H K;  3DXM B;  4LD0 A;  5C10 A;  3HST B;  2QA4 N;  4E0D A;  1SL0 A;  3HPH A;  1IBM K;  4DV5 K;  4IFE A;  1RT6 A;  3WEE A;  4J8F A;  4C8K A;  1VSI A;  3CF5 L;  1T05 A;  4HVJ A;  3S41 A;  3BF3 A;  4DU1 A;  4M63 C;  3LDN A;  2YHW A;  4E1J A;  3DLG A;  5HRR A;  4JI8 K;  3O1W A;  1TK8 A;  4WYB A;  4DR5 K;  5JVG L;  3SYZ A;  4CJL A;  5AFU A;  1NBW A;  2Q2R A;  2YNH A;  3AA3 A;  3WNG A;  5BRD A;  4DSF A;  4CJE A;  1SKW A;  3P83 D;  2ASP A;  3H45 C;  5TKW A;  1BGX T;  1NJX A;  3TWH A;  1J5O A;  1TYQ B;  4NLC A;  3OYF A;  2AJQ A;  4AHV A;  3L8B A;  3ZT1 A;  2GUP A;  3OYB A;  5EU7 A;  4F4K A;  4KHP K;  1NJI O;  4H5N A;  3QNN A;  4BQZ A;  1JJ2 M;  2V7Y A;  3RRH A;  4CEF A;  2HND A;  3A2F A;  1Y64 A;  5AQI A;  4A5A A;  5CR4 A;  4MQ3 A;  4FLT A;  3IUC A;  4H0T B;  4CK1 A;  4WF9 L;  2ZGY A;  4M3U A;  1S22 A;  2ITM A;  2FF6 A;  5LMN K;  1BUP A;  4DR3 K;  2IVP A;  1QZ5 A;  4B9T A;  1BI4 B;  3I8B A;  3KK3 A;  4BGA A;  4BR2 A;  2E4L A;  5SZT A;  3JAM O;  2X78 A;  5AQS A;  1VSJ A;  4O44 A;  4Q5V A;  3EZ5 A;  1N34 K;  3VQ7 A;  4IXC A;  3C6H A;  4E7J A;  1D9F A;  1ZBU A;  1VQ8 N;  4OGC A;  4CGG A;  4HTU A;  3D2E A;  3AAR A;  4FO0 A;  1CZ9 A;  2HHT A;  1HKC A;  4UY8 O;  5AR0 A;  3I0S A;  4BRO A;  2PZS A;  2PBD A;  3ZT4 A;  5CZ1 A;  2D0B A;  3TAN A;  2F8T A;  1UA0 A;  4QS7 A;  3T3F A;  1RT1 A;  3HBT A;  3OS0 A;  1Q86 O;  1WUA A;  2YNG A;  1QSS A;  1LV5 A;  3OYM A;  4O55 A;  4CD1 A;  2UUB K;  4B9N A;  5AQU A;  2FF3 B;  5BN9 A;  2UXC K;  4WQ5 A;  2P9L B;  3AGR A;  1KAZ A;  3SAF A;  1BA0 A;  3VTH A;  1RBS A;  4DV2 K;  4LF7 K;  3V9S A;  2CGK A;  4B3T K;  1GLB G;  4CJU A;  4IJN A;  4XH1 A;  4I7F A;  3LM9 A;  4JKH A;  2XO7 A;  4JI2 K;  3F9M A;  4IOC L;  5AZI B;  3MXI A;  4E7H A;  4CHZ A;  2QWM A;  4JD2 B;  2A40 A;  3AV9 A;  1WNS A;  1QVG M;  4M3Y A;  2QWR A;  2G8V A;  1QHA A;  3SLC A;  4B1V A;  1GOB A;  4JKG A;  4CBX A;  4FJI A;  3DYA A;  1RTJ A;  1LCU A;  4M3X A;  3THW B;  1ZBH A;  3DWL A;  2HHU A;  2QKB A;  2FSK A;  2IIR A;  5AFU H;  3THV A;  4YDU C;  2NZT A;  3KZB A;  3MWT A;  1RT5 A;  2WON A;  4AM7 A;  1S72 N;  3O5B A;  3VQC A;  4IO8 A;  1HNZ K;  3QES A;  4DQI A;  2AA4 A;  3ULE A;  2RKI A;  3L6Q A;  5BRF A;  5E41 A;  4YY3 K;  5F0X A;  3E66 A;  4CVN E;  3PLA A;  3R3L A;  1XHX A;  3ENO A;  4JRQ A;  5C42 A;  4QOZ B;  4BRQ A;  3MX5 A;  3DI6 A;  4DFJ A;  3HJF A;  4CHY A;  4X65 K;  1JLB A;  4FPB A;  1NGH A;  2AP1 A;  4W5T A;  4Z4G A;  3KHY A;  5HRS A;  4CFD A;  3A0I X;  5BR8 K;  4LH4 A;  3G25 A;  3K58 A;  3EZW A;  2W40 A;  4JI1 K;  4FVU A;  2E6L A;  2HHQ A;  1RTD A;  1KFD A;  3O9R A;  2IDO A;  2E2Q A;  4CIE A;  2VWJ A;  1OH6 A;  4NB4 A;  4DHY A;  3KLH A;  3J8A A;  4KRE A;  3AGK A;  1IO2 A;  3FZL A;  3VEZ A;  4DQR A;  4L3Q A;  2KKZ A;  3QNO A;  4I2Q A;  4BE0 A;  4JI6 K;  3OVN A;  3M6G A;  4FWL A;  3CJC A;  1F21 A;  4IZ9 A;  4DF4 A;  1VQ7 N;  1QVF M;  2O4I A;  4O0I A;  1WSE A;  1ASW A;  1CZB A;  1C6V A;  2P51 A;  4AM6 A;  3RVC A;  3HI0 A;  4ISG A;  4FWQ A;  1W9H A;  1XUP O;  2XRI A;  3CME N;  4KHY A;  1WSI A;  3ID6 A;  3DMJ A;  2HOE A;  1GLF O;  4R5P A;  5I42 A;  2FBY A;  5EX5 A;  2O8B B;  2FSJ A;  3DXK B;  1HMV A;  4O4G A;  3T1Y K;  3CJ7 A;  1V4S A;  4CJF A;  4GVE A;  1VQM N;  1RDW X;  3TAQ A;  3WXI A;  1N32 K;  1BL3 A;  3DLL L;  1SKR A;  3CQ8 A;  3O80 A;  3Q7C A;  3K5M A;  3ZT2 A;  4DQP A;  3OYC A;  2XY8 A;  3MN6 A;  1XHZ A;  3O4N A;  4KHN A;  4IBN A;  2VCP A;  4DQQ A;  1K9M O;  3I0R A;  4YOR A;  1HJR A;  3UKR A;  3RRG A;  4LF4 K;  2QW9 A;  4M3W A;  1C1C A;  1XC3 A;  3NF7 A;  4O0J A;  4BRK A;  4IFV A;  5KRS A;  3QBW A;  3CHW A;  5IWA K;  4WCE L;  3AVB A;  1ZBL A;  3NH2 A;  1IJJ A;  2NLX A;  2ATQ A;  3BP8 A;  3VF6 A;  1KQS M;  4ICL A;  4JKE A;  5DK5 A;  4DV6 K;  4C8L A;  4U7B A;  3OYI A;  2O8E A;  1VQN N;  4CZK A;  3V9Z A;  4M7X A;  5FPE A;  4CJ7 A;  5HRP A;  4X64 K;  1YT3 A;  3K5N A;  4OO1 J;  4MO5 A;  3V1O A;  3W0L A;  1C1A A;  3CET A;  3MX2 A;  5C15 A;  3KLG A;  3VEN A;  4RW8 A;  2FBX A;  5E84 A;  3DLK A;  4H0X B;  4A5B A;  1NK6 A;  1E4G T;  3OYH A;  3WXL A;  3NMU A;  4BQL A;  2A6A A;  4KFB A;  3L2W A;  3AVJ A;  2VGM A;  4CFB A;  3A5O C;  1RBR A;  1EWQ A;  1QSY A;  5JS2 A;  4JEP A;  1W97 L;  4ELU A;  1NGA A;  5JLH A;  3VEW A;  1YHQ N;  1VSE A;  3A5L C;  4GW6 A;  3M3Z A;  1CZA N;  1E3M A;  2P9U B;  4B9Q A;  3CCL N;  2O8C A;  2P9N B;  2DFH A;  2G8F A;  3OYA A;  4GNI A;  5HBM A;  3KLI A;  1N5Y A;  5B8H A;  5KGW A;  3QBX A;  2OTL N;  5M1O A;  4NCA A;  1VSL A;  3MEC A;  4DSK A;  1WB9 A;  3BZC A;  3QLH A;  5F1X A;  4K0K K;  1FKP A;  1DLO A;  3TSP A;  1SL2 A;  4FWK A;  2BUP A;  5M1K A;  1JLF A;  2YKN A;  3MEE A;  3QER A;  3V6D A;  1S1W A;  3OY9 A;  3LP3 A;  1R59 O;  3OA9 A;  4FK2 A;  5J2N A;  2X6N A;  2HNY A;  4CEZ A;  1H1V A;  2F8S A;  3HT3 A;  4CEE A;  4FLX A;  3CCR N;  4DFM A;  3CQX A;  4GKK K;  3SJJ A;  4CHP A;  3AVN A;  3H6E A;  5EOY A;  3H1Q A;  4BDP A;  4FJJ A;  1CLQ A;  3K9J A;  2A3Z A;  1NMD A;  3O1B A;  4QCL A;  1Q9X A;  4B9S A;  4W5Q A;  4I6M A;  3OYJ A;  3F73 A;  3ZX2 A;  3LZJ A;  1OH5 A;  3J7Y P;  1HYZ A;  3ITH A;  3HPO A;  2O8F B;  1S6Q A;  4BC2 A;  4JI5 K;  1NJW A;  4WQ4 C;  1GLE G;  4OKE A;  4B1X B;  1RGI A;  2JGU A;  4DR4 K;  4WE1 A;  4BVO A;  1J6Z A;  5HL7 L;  5SWM A;  4F9O A;  2YV0 X;  4B8C A;  3DOL A;  3EEQ A;  3VEX A;  4CJ5 A;  2O8D A;  2D5R A;  1JCF A;  2ZJP L;  3DXM A;  3KK1 A;  4CIG A;  1HR0 K;  1SAZ A;  3WXM B;  1YVU A;  1J54 A;  3RMD A;  3EL2 A;  2X74 A;  1W7A A;  4BE2 A;  1TK5 A;  3TU5 A;  3T69 A;  5BPN A;  3KJV A;  2F4V K;  4FSV A;  3TI0 A;  3ZLJ A;  4CZH A;  4B1Y B;  4CF0 A;  3G71 N;  4FJH A;  1S1U A;  2YJF A;  3PSF A;  3SPZ A;  2YKM A;  4O8K A;  2VWB A;  4BG9 A;  4DTR A;  3PV8 A;  3MCA B;  4N41 A;  5EY4 A;  1E4F T;  4BG8 A;  3DJC A;  3L2R A;  4DR2 K;  2PY5 A;  1ITG A;  1REV A;  3QFU A;  1VAZ A;  1KAY A;  1TYQ A;  1Z6R A;  5JVH L;  3S9H A;  3ZCM A;  1J53 A;  5T7B A;  1J9A A;  5DMR A;  3VEO A;  4B1U B;  1W2B M;  2NRH A;  4CES A;  4FZX C;  1D9D A;  4XH5 A;  1K8A O;  3KVG A;  3TTD A;  4BRF A;  1NJY A;  1XI1 A;  4DUZ K;  3ZSR A;  1QQC A;  3SJH A;  4CGH A;  4KH4 A;  5KI6 A;  3JS6 A;  4H4O A;  1EXQ A;  4C23 A;  4DKW A;  3IFR A;  4BRL A;  2E20 A;  2B4J A;  4R79 A;  3CFR A;  4FLW A;  1BI4 A;  2HHV A;  1HNI A;  1RT2 A;  5C2D A;  4YOX A;  5AQO A;  3H3N O;  4PL8 A;  1BG3 A;  1WSF A;  4Z4I A;  4EZ6 A;  1XQS C;  4Y1D A;  1NGF A;  2Q36 A;  3GE1 A;  2IS3 A;  4AF1 A;  1RDU A;  3BUZ B;  3HVT A;  1O13 A;  1A5X A;  1RFQ A;  4DF8 A;  1X9M A;  5LMU K;  1EET A;  1HPM A;  1WAF A;  1P8Z A;  3CM5 A;  3DRP A;  4C8O A;  4KH6 A;  3OJS A;  4BRI A;  3ZSY A;  4ZHR A;  1MU2 A;  2HF3 A;  5AQG A;  1IKY A;  3BY5 A;  3W3D A;  2ZGZ A;  3C7N B;  1TKD A;  3R8E A;  5A2Q O;  4DV7 K;  2D1K A;  4BRE A;  2OTJ N;  1EO1 A;  1LWE A;  3H3O B;  4FWP A;  3QEP A;  2P9S B;  3B6P A;  5HLF A;  2ASO A;  3LAL A;  1K6Y A;  2CH5 A;  2Z1G A;  3O6W A;  4OPA A;  3SUO A;  1SS6 A;  3NAE A;  1Z26 A;  1CXU A;  5AQJ A;  3THX B;  1VQ9 N;  1N33 K;  2P5G A;  3NFA A;  3DAW A;  1KCF A;  5AQH A;  2GUI A;  5FLX O;  2P9L A;  2ASM A;  1U49 A;  3J81 O;  2GBZ A;  4JI3 K;  3HPG A;  1TL1 A;  3SUP A;  5AQF A;  3P38 A;  4N47 A;  4BAC A;  3L4Q A;  4NCG A;  4E7I A;  2D0C A;  3L4I A;  2B5J A;  4LSN A;  5AZI A;  1K8K B;  1N36 K;  4I9Q A;  4B3O A;  3LDP A;  2QWL A;  1VHX A;  4JD2 A;  4BC3 A;  2QXL A;  2HVI A;  3FFK B;  3HVR A;  1RT4 A;  3RTV A;  4JKF A;  3GBT A;  3CCE N;  1SL1 A;  4DCH A;  1VQ4 N;  4GKJ K;  3E9O A;  3CI5 A;  1BIU A;  3RMA A;  1YTA A;  3O08 A;  3NE6 A;  3OYG A;  2IVO A;  3THW A;  4Z4E A;  5KQ8 A;  1CXQ A;  2FBT A;  3SAG A;  4NXM K;  4K25 A;  3IS9 A;  1ZXO A;  4LC9 B;  5J2Q A;  4DB3 A;  1S6P A;  3IDH A;  3K59 A;  5FRM A;  4FLU A;  5AQP A;  3TTF A;  2NNW A;  4BR5 A;  5HOO A;  4H5W A;  3THY B;  4LFB K;  2PYJ A;  1FK9 A;  1OH7 A;  3ZT3 A;  1B92 A;  4FLY A;  2QEX N;  2W41 A;  3O8M A;  3TTC A;  3DLH A;  3PUF A;  1NGI A;  1YIJ N;  4DWI A;  3MXM A;  2P5O A;  1YJ9 N;  2WOM A;  5FRN A;  3UB5 A;  1NKC A;  4X62 K;  1KD1 O;  3CCU N;  3OYN A;  3EY1 A;  3DRS A;  3I55 N;  4PKI A;  3GL1 A;  1WN7 A;  3SBT A;  5AQR A;  3AVL A;  3PSI A;  4EAH D;  3SK3 A;  1TK0 A;  4FOE A;  4MDB A;  2ETJ A;  5F2R A;  1LW2 A;  3H08 A;  3QIC A;  1TV6 A;  4LH5 A;  5ADX H;  5AQQ A;  4B3S K;  3O4Q A;  4LY7 A;  4FWN A;  3WQU A;  3J7Z O;  4YOV A;  4JYA K;  3CC2 N;  4FZY A;  2FC0 A;  1T6D A;  4KTW A;  2YX6 A;  3L3V A;  2GTD A;  3HM8 A;  2KFN A;  3O3G A;  2E88 A;  2QWP A;  3VF2 A;  5GIP A;  3LP0 A;  1JXE A;  3D0P A;  4B1Z A;  3H1V X;  4GV9 A;  3AA5 X;  2Z1H A;  4DUY K;  3O3F A;  3OS2 A;  5D3G A;  2GEM A;  2YHY A;  3MCP A;  1DTQ A;  2OZS A;  4BDZ A;  3P4I A;  1SQK A;  3ATU A;  3LAN A;  4LF5 K;  3C65 A;  3V1R A;  2HMI A;  3EN9 A;  1KVA A;  1NWK A;  4BR4 A;  3KWI A;  3CPW M;  3QET A;  1GLC G;  3IKM A;  1U4B A;  4K8Z A;  4CF8 A;  2BGG A;  2O8B A;  3OTO K;  3DXK A;  3HP6 A;  2GEL A;  1Z25 A;  1IBK K;  1UWB A;  5CYQ A;  3ZSQ A;  2QWO A;  4FL9 A;  4M7Y A;  4CGD A;  1WSJ A;  4NYF A;  1RTH A;  4YHH K;  1S1T A;  4FWR A;  1VSK A;  4HTL A;  5KTQ A;  3ZET B;  2QTD A;  3F5T A;  1HX1 A;  4FJ7 A;  2NRZ A;  2PYL A;  2NRX A;  2A42 A;  3SCX A;  1Q8I A;  2QM1 A;  1GLL O;  3EKU A;  2ZM6 K;  1VQL N;  4Z94 A;  3ZEU B;  4DTN A;  3K5O A;  1DT9 A;  4HCB A;  3DRR A;  2VGN A;  4BRC A;  1NMN A;  1RIL A;  4NYN A;  2BAN A;  4GVM A;  3C95 A;  4DU3 A;  1WBD A;  5DM6 L;  1VRU A;  3VQ6 A;  4ELV A;  4DSI A;  1TUU A;  4LF8 K;  5JMV A;  4E19 A;  4OX9 K;  3CXC M;  4KKO A;  4FCY A;  3NF9 A;  2E2O A;  2HVH A;  4BRM A;  3DLR A;  1RDC A;  4DTS A;  1WSH A;  4O5B A;  4CEA A;  3AVI A;  1BA1 A;  5HRN A;  4CER A;  4RTF D;  4PKG A;  2FXU A;  4CHN A;  5FPD A;  4KAZ A;  4JI4 K;  3ID8 A;  4B9L A;  4BE1 A;  4FJX A;  1SV5 A;  3FGU A;  3L2V A;  1HJO A;  2E1Y A;  4FK4 A;  3AVA A;  4KV8 A;  2F96 A;  1UAX A;  5GIN A;  2NRW A;  3I33 A;  4KHW A;  2YI1 A;  1YJW N;  4FLV A;  3CFP A;  1NLV A;  2A1R A;  4BC5 A;  2Z1J A;  3KD5 E;  1TUY A;  1QE1 A;  4BRN A;  4FPA A;  2DPN A;  3NGY A;  3VOV A;  1DEJ A;  4CZL A;  3AVG A;  1X3M A;  3HL8 A;  3WNE A;  4E1M A;  3E01 A;  3ASM A;  2G8I A;  3GDQ A;  2P9U A;  4J2A A;  2P9N A;  4FW1 A;  2J4R A;  2JLE A;  1ATR A;  5C25 A;  3AO4 A;  5BR9 A;  2EX3 A;  5GAE P;  4QAG A;  4A2A A;  4JI7 K;  1VRT A;  3AO3 A;  1EP4 A;  3QIO A;  2Z1I A;  5J1E A;  3P39 A;  2W6K A;  2CH6 A;  1NK0 A;  4KTQ A;  3RSE B;  3CC4 N;  4KPY A;  2YHX A;  4PL7 A;  1KVB A;  3JXU A;  1KAX A;  1WSG A;  2JWL A;  4NLB A;  3R9P A;  1ZBI A;  1Q7Y O;  4RW7 A;  4JI0 K;  3CER A;  2ZQB A;  3VGL A;  2OZM A;  4E3S A;  2QKK A;  1EKE A;  1ILY A;  2IGI A;  3EE9 A;  4CE9 A;  1G99 A;  1ASU A;  3HTV A;  2WTU A;  5AQT A;  1D5A A;  1RBT A;  1LWC A;  4A62 A;  3CJ1 A;  1WLJ A;  3QEX A;  3I8D A;  2P1J A;  2PAV A;  3AO5 A;  3OYK A;  4OJR A;  1QQO A;  5E26 A;  3UIQ A;  5FPN A;  2R7Y A;  3KIO A;  3CJB A;  3VQ8 A;  4AHT A;  3U6F A;  2BDP A;  2BTF A;  3KTQ A;  3CIP A;  3SQ4 A;  4CGF A;  3P5J A;  2O8F A;  2XY6 A;  4BR7 A;  4C1N K;  4B9U A;  1LAV A;  3KLF A;  1GLJ O;  2QI2 A;  4K42 A;  2RPI A;  2Y1J A;  3HZ6 A;  4EZ9 A;  4CZE A;  4OVL A;  4Z4C A;  3T7Z A;  2E2P A;  4W5O A;  3LDL A;  2P9I B;  4YOT A;  4DR7 K;  3D2F B;  1YUW A;  2OPR A;  3WNH A;  2Q97 A;  1I3A A;  1EQY A;  1NGC A;  1JLQ A;  3QEV A;  4IKF A;  3O9U A;  4CK3 A;  4A59 A;  2GWK A;  3FLC O;  4CD3 A;  4N5S A;  2VQE K;  4CJW A;  2HHW A;  4H4M A;  1X1P A;  5M1F A;  3NHG A;  4ILJ A;  2IAJ A;  1NGB A;  3LWM A;  1HKG A;  1T7P A;  2HBL A;  2D4W A;  3BGR A;  4BY9 C;  3ALY A;  3O4W A;  3PIO L;  2G8K A;  5DM7 L;  5IT9 O;  3AA2 A;  4DTM A;  4AHR A;  4FZZ A;  4CK2 A;  1QZ6 A;  1N8R O;  1GOC A;  3AO2 A;  2OPP A;  1BWF O;  1KXP A;  3S3M A;  4OPJ A;  2CGL A;  1EWR A;  2UYT A;  5AQM A;  4CF9 A;  2P9K B;  4UQG A;  1P90 A;  3MED A;  2ZF5 O;  3LL3 A;  3SV3 A;  2QXF A;  3EYZ A;  4RWT A;  1BDG A;  4FWM A;  3KK2 A;  3OW2 M;  1HPZ A;  1QQN A;  4FJN A;  1ZYQ A;  4BWM A;  4N76 A;  4DTJ A;  1RNH A;  5JLF A;  1RDA A;  1ZBF A;  4GMJ B;  3BEX A;  4I2P A;  1U48 A;  3V1Q A;  5AZJ B;  4BGB A;  4EHT A;  4CHQ A;  3OJU A;  3P1G A;  4DV1 K;  1Z05 A;  2FBV A;  4FJG A;  1TVR A;  3V9X A;  1FKO A;  5EVZ A;  3SNN A;  3VEY A;  3L2Q A;  4Y1C A;  2HHX A;  5GAG P;  3UKU B;  4KH5 A;  3LDO A;  3RR7 A;  4QS8 A;  4B1W B;  2FLO A;  1TL3 A;  3NH1 A;  3G0Z A;  3IAY A;  3K9K A;  2VG6 A;  2KLA A;  3DLB A;  3HYF A;  3ZSO A;  4FXD A;  2A5X A;  3V9W A;  4DLG A;  5LL6 Z;  1KC8 O;  4QS9 A;  4E7L A;  2E2N A;  3AAQ A;  4DR6 K;  4F3O A;  1OVQ A;  3C7N A;  3NCI A;  4Q0B A;  5KGX A;  3O9T A;  1TKT A;  4I9L A;  4L8R B;  3BZK A;  2ZD1 A;  3D45 A;  1C1B A;  3SZ2 A;  4F2R A;  4JS4 A;  1XMQ K;  2OA8 A;  4DG1 A;  1J5E K;  2P9S A;  3AAP A;  1Y97 A;  1BCO A;  4DV0 K;  3LDQ A;  4CJ4 A;  4DLE A;  3TAB A;  4ID5 A;  4U67 L;  3L3U A;  3THX A;  5AQL A;  4FM1 A;  3LM2 A;  4FJ8 A;  4JK9 A;  3VQP A;  3O3H A;  1FXX A;  4M41 A;  4OPK A;  3O9Q A;  1QHT A;  5LJV A;  4CGI A;  3B6O A;  1NK9 A;  3AY9 A;  1YTU A;  1K8K A;  1NG9 A;  1KVC A;  3U3G A;  3ZSX A;  1U45 A;  1T03 A;  1U2V B;  3SAH A;  3K2P A;  1BHL A;  5LJW A;  3DLE A;  3FZK A;  3MXJ A;  4H5R A;  4CJR A;  3ATV A;  1OVY A;  3QEI A;  4B9M A;  2W42 A;  4E7K A;  2QK9 A;  1JLA A;  3G10 A;  4WQ5 C;  4AH9 A;  1MWK A;  3ENH A;  2E8A A;  3SUN A;  4IG3 A;  1NM1 A;  3MMV A;  3KLE A;  1C0F A;  2KQ2 A;  3VQ9 A;  5J2P A;  4PHT X;  4CCH A;  3RMC A;  1BCM A;  3U8X A;  4JS5 A;  4DS4 A;  4KTZ A;  1A5V A;  3TAR A;  1SZ2 A;  3THY A;  3LDS A;  3EO3 A;  4LF9 K;  2YHA A;  5ADX A;  3CCJ N;  3PX0 A;  1O1W A;  3PX4 A;  4CF1 A;  3A5N C;  2G8U A;  1HQU A;  4YFU A;  3SPY A;  1HQE A;  5LY3 A;  3OYE A;  2KW4 A;  4Z4F A;  3HSC A;  5JIC A;  4PUO A;  1WAJ A;  4JK8 A;  1NOZ A;  1BIZ A;  4H03 B;  2KFZ A;  4DFP A;  3OHR A;  4CEB A;  4B3R K;  3KKR A;  1FW6 A;  5EXW A;  3HM9 A;  4DTU A;  3FFI A;  3MK6 A;  1EX4 A;  3SQ2 A;  4DTP A;  3E1Y A;  5BN8 A;  3RMB A;  3OBW A;  4CED A;  5FDL A;  4AIL C;  4O8U A;  4H0Y B;  2HHS A;  4JK7 A;  2OPQ A;  3VER A;  1JL1 A;  4HCC A;  3NGZ A;  3LP2 A;  2H3G X;  3M5R A;  2WC9 A;  5AQV A;  3U4L A;  3SMS A;  4PY5 A;  2P9P B;  1M90 O;  1L5U A;  3SI6 A;  3VTI A;  1XNR K;  3M8R A;  5AJ3 K;  4Z0U A;  1JKH A;  4CIF A;  2IOC A;  3H46 O;  2IC3 A;  3GOI A;  3B8A X;  4NO7 A;  3SBG A;  4DSJ A;  4AHU A;  2HF4 A;  3I56 N;  3D6R A;  3Q7B A;  3VA3 A;  1HNV A;  3NGI A;  3PX6 A;  1IBL K;  1ASV A;  1X9W A;  5HRO A;  3V9U A;  1T44 A;  5KRT A;  3VQD A;  3ZET A;  4ELT A;  2NRR A;  5K14 A;  1QS4 A;  3VES A;  4ID1 A;  2IVN A;  3ZEU A;  4F8R A;  1QTM A;  4BWJ A;  1HNX K;  1VSD A;  4CJV A;  3QIN A;  2FSN A;  4AHC A;  3CJ9 A;  1NKE A;  4B3M K;  4KHU A;  3SQ0 A;  4ZTF A;  2YHB A;  4CI6 A;  5GAD P;  3EKS A;  3HOS A;  3CYM A;  4IDH A;  4KBO A;  1L3T A;  2ZJQ L;  1TKX A;  4FVM A;  4WFB L;  3MN9 A;  2G8H A;  3LAK A;  4ILG B;  3VMF B;  4ILH A;  2LSN A;  2YJE A;  5KPR A;  1L3S A;  2HBK A;  1IKV A;  1MA9 B;  4KB1 A;  4AHS A;  4IFY A;  3AA4 A;  4KI4 A;  3ZYY X;  4JN4 A;  4WQ4 A;  1DTT A;  5AQZ A;  4JHD B;  4PKH A;  4H0V B;  1VQK N;  4C8N A;  1HNW K;  1N6Q A;  3ZSV A;  4M45 A;  3A8Y A;  3MN5 A;  5BPL A;  2OYQ A;  4BVP A;  2EHG A;  1T3V A;  1YF5 L;  2Q1N A;  2XHB A;  1JXB A;  3R1X A;  4JKD A;  3KD1 E;  3CCM N;  3KKS A;  2QWN A;  2HST A;  3T1A A;  4NCB A;  3QO9 A;  5M1Q A;  1IKX A;  1YVN A;  4CZM A;  4CFC A;  4M3R A;  1D8Y A;  3SUQ A;  4B8A B;  4DV4 K;  1RBV A;  4H8K A;  1RDD A;  4FWS A;  4MDA A;  1ATS A;  2E5L K;  4JV5 K;  2KHO A;  3P31 A;  4OKK A;  3TAM A;  4FJ9 A;  4B9V A;  4ISF A;  4XH4 A;  4RW9 A;  1VQ5 N;  3BF1 A;  4M42 A;  3VQ5 A;  3M1F A;  3SQ1 A;  2E6M A;  5GAH P;  3VN5 A;  1HKB A;  3TSU A;  4EFH A;  5KPZ A;  4X66 K;  4FM0 A;  2G8W A;  3NBP A;  2V7Z A;  4CBU A;  3KK7 A;  5C12 A;  2JWK A;  2NUB A;  3WEE B;  3K57 A;  3CPE A;  4CF2 A;  4TSX A;  1KLN A;  3ZX0 A;  1NOY A;  3E9P A;  2OCE A;  3RSE A;  2HW3 A;  4K41 A;  5J2M A;  3FZM A;  1X9S A;  4H5V A;  1D4X A;  1RTI A;  4E1N A;  3EE8 A;  4AQY K;  4FJ5 A;  4KB0 A;  4A61 A;  2W6L A;  3IG1 A;  4Z4H A;  1R0A A;  3MEG A;  3LWL A;  2KZM A;  1U04 A;  1TKZ A;  2YNI A;  3NDK A;  1NGD A;  1HLU A;  3WQT A;  4FW2 A;  3M8P A;  4CGJ A;  1UOC A;  4DSE A;  3C6U A;  1IV0 A;  3ZX3 A;  4KHQ A;  5MLC Q;  1JLE A;  2EWS A;  1BU6 O;  2HBJ A;  3QML A;  3V81 A;  3QEW A;  2X6S A;  4DTX A;  2I7P A;  3AVC A;  1C0T A;  1RT3 A;  3O9S A;  1YXQ A;  1C0M A;  4BRP A;  4EIA A;  4J2B A;  4A57 A;  4IO9 L;  2BE2 A;  4W5N A;  4KHS A;  1C0U A;  4B08 A;  5AQW A;  4CZG A;  4RCH A;  2P9I A;  4FJK A;  3D2F A;  1JLG A;  2WFB A;  3HRG A;  4WFN L;  3VA0 A;  3DM2 A;  4K43 A;  2HHH K;  3CJA A;  1FJG K;  3PO5 A;  4CW7 B;  1S3X A;  1BOT O;  1VK0 A;  1Q18 A;  4PQU A;  5CHI A;  3ULD A;  3F9K A;  1G15 A;  4EP4 A;  4DQS A;  5AQX A;  3HP9 A;  4F2S A;  1OH8 A;  3D2E B;  1RCH A;  1S5J A;  2QWQ A;  4CFA A;  4IJA A;  4IG0 A;  1TAQ A;  4ZTJ A;  5H1S Q;  4FM2 A;  3M8Q A;  3VPZ A;  1S1V A;  1TGO A;  3PIP L;  3MWP A;  4N56 A;  1YIT N;  4H0P A;  3M8S A;  5HP1 A;  1NGG A;  2HB5 A;  2E1Z A;  4JAX A;  4KI6 A;  2P9K A;  4OPH A;  3HO1 A;  5C0Y A;  1VSM A;  1QQM A;  3MN7 A;  2B6A A;  3NVK A;  1ZC6 A;  3QIP A;  3VQE A;  3NVM A;  1BQM A;  1NK4 A;  3LPT A;  3VEV A;  1I94 K;  1KSP A;  2NRT A;  2WBN A;  2YCH A;  4HUF A;  5AZJ A;  3A5M C;  4CZJ A;  3K0S A;  3V4I A;  3CCS N;  3NF6 A;  3TAF A;  3LZI A;  2Q0U A;  4CHO A;  2O4G A;  4BR0 A;  1V4T A;  4MLE A;  4CJS A;  2A1S A;  2RHK A;  4V19 S;  2D0O A;  4RW4 A;  2GWJ A;  3D7E O;  2VG5 A;  4CJT A;  3MDQ A;  3UKU A;  3L0Q A;  4H0O A;  1ZBS A;  4OLB A;  4JKG B;  3NF8 A;  2Q3S A;  3OS1 A;  3F2K A;  5KQD A;  3T19 A;  4GY2 B;  3TAP A;  3AVM A;  2GX9 A;  1ESV A;  1MWM A;  5ELZ A;  4YNQ A;  4XIU A;  4CJK A;  1OKJ A;  4EHU A;  3C0B A;  4CJP A;  3ZSZ A;  4JRP A;  4OKJ A;  1KRP A;  1NK7 A;  2D0P A;  1IH7 A;  4F3T A;  3LP1 A;  2VQF K;  4CEC A;  3ULE B;  3MAQ A;  1DKG D;  4IEE A;  4DS5 A;  3CC7 N;  2KZZ A;  4JNE A;  4IWV A;  1UA1 A;  3CM6 A;  4BRA A;  1LWF A;  4BRD A;  5FRO A;  5CE3 A;  2V52 B;  4CEO A;  4FJM A;  5M1P A;  3U3Y A;  3N4Q A;  4CJQ A;  1RBU A;  2NRV A;  1X9J A;  1TAU A;  4M3T A;  3TPQ A;  3N4P A;  4H5T A;  5M1N A;  3G6E N;  3C94 A;  2HBM A;  2XY5 A;  3OBY A;  4FJL A;  1SKS A;  4J2D A;  1BQN A;  3BDP A;  4HHT A;  2XY7 A;  4CZI A;  2UUA K;  2WUS A;  4DTO A;  4LSL A;  4WFA L;  3L2U A;  4MFB A;  2D0A A;  4RG8 A;  4XEI A;  4BR9 A;  1U2V A;  3OYL A;  1VSH A;  5C24 A;  3ZSW A;  2RE2 A;  3PY8 A;  4PWD A;  2UXD K;  4DFK A;  3AO1 A;  4KO0 A;  5I9E B;  1KTQ A;  3C6T A;  3VET A;  1ATN A;  5TKY A;  4MLH A;  4LFA K;  3NH0 A;  3WT0 A;  3R6M A;  1RT7 A;  3DOK A;  3E9L A;  1U47 A; 
#chains in the Genus database with same CATH homology
 3IMX A;  3AGK A;  3WXK A;  3VF4 A;  3FZL A;  3SBT A;  3FE1 A;  3VEZ A;  3A5N C;  4L3Q A;  2KKZ A;  5AQR A;  4O5F A;  3M6G A;  2ZJR L;  4FWL A;  3CJC A;  5LY3 A;  4IZ9 A;  3HSC A;  3SK3 A;  4EAH D;  4JK8 A;  5JIC A;  1VQ7 N;  1QVF M;  4FOE A;  4MDB A;  5F2R A;  3QIC A;  3WUH A;  4H03 B;  4YDU A;  4AM6 A;  5ADX H;  5AQQ A;  3RVC A;  3HI0 A;  4ISG A;  4FWN A;  2Q0R A;  4FWQ A;  3OHR A;  4A2B A;  3WQU A;  3J7Z O;  4YOV A;  3CC2 N;  4G9Z A;  1T6D A;  1XUP O;  4IOX A;  4ISE A;  2YX6 A;  5EXW A;  3CME N;  2GTD A;  3HM8 A;  3FR0 A;  3ID6 A;  2E88 A;  1GLF O;  2HOE A;  2QWP A;  3VF2 A;  3MK6 A;  5BPM A;  1WOQ A;  5EX5 A;  1X3N A;  5GIP A;  3CQY A;  3E1Y A;  3ENB A;  5BN8 A;  2FSJ A;  3DXK B;  3H1V X;  1T6C A;  3OBW A;  4B1Z A;  4GV9 A;  1NGE A;  3GG4 A;  2V51 B;  2GEM A;  3CJ7 A;  1V4S A;  2YHY A;  3MCP A;  4O8U A;  4GVE A;  4H0Y B;  1VQM N;  4JK7 A;  3P4I A;  1SQK A;  3ATU A;  1RDW X;  5BRE A;  3C65 A;  1LOT B;  3EN9 A;  3VER A;  1NWK A;  4BR4 A;  1BO5 O;  3WXI A;  3KWI A;  3UKR B;  4YOY A;  3CPW M;  3DLL L;  1GLC G;  3IKM A;  2H3G X;  3M5R A;  3O80 A;  2WC9 A;  3Q7C A;  5AQV A;  3U4L A;  4Y0W A;  3SMS A;  1YJN N;  3FZF A;  2P9P B;  3DXK A;  1M90 O;  2GEL A;  4BRH A;  3CMA N;  3VTI A;  2F7T A;  3MN6 A;  4BC4 A;  2QWO A;  4FL9 A;  2VCP A;  2VYP A;  1K9M O;  4M7Y A;  3CD6 N;  4GV3 A;  3H46 O;  2Q31 A;  4YOR A;  3GOI A;  4FWR A;  3B8A X;  4HTL A;  3UKR A;  2QTD A;  3ZET B;  3C6A A;  3F5T A;  1HX1 A;  4NO7 A;  3SBG A;  2NRZ A;  2QW9 A;  1XC3 A;  2NRX A;  4BRK A;  2A42 A;  2HF4 A;  3I56 N;  2P9P A;  2QM1 A;  1GLL O;  3D6R A;  3EKU A;  3Q7B A;  3QB0 A;  1VQL N;  4Z94 A;  3QBW A;  3CHW A;  4YOU A;  3ZEU B;  4WCE L;  3QFP A;  1JCE A;  1DT9 A;  1IJJ A;  2I7N A;  2NLX A;  2CGJ A;  2F9W A;  1T44 A;  3BP8 A;  2VGN A;  2ZWH A;  3VF6 A;  1KQS M;  4BRC A;  4JKE A;  2BH1 A;  3ZET A;  2NRR A;  4U7B A;  1VQN N;  4CZK A;  1IG8 A;  3VES A;  4MO4 A;  2IVN A;  4M7X A;  3ZEU A;  5FPE A;  5DM6 L;  4YOW A;  4IOA L;  4CJ7 A;  1TUU A;  4OO1 J;  1YAG A;  1K73 O;  4MO5 A;  5JMV A;  2FSN A;  3W0L A;  3CXC M;  3CET A;  3CJ9 A;  3MX2 A;  5C15 A;  2OAN A;  3VEN A;  5GAD P;  4CI6 A;  3EKS A;  2E2O A;  3HOS A;  4IDH A;  4BRM A;  5E84 A;  4KBO A;  2ZJQ L;  4H0X B;  5AQN A;  4A5B A;  4CZF A;  1BA1 A;  1E4G T;  3WXL A;  3NMU A;  4BQL A;  2A6A A;  4WFB L;  1C0G A;  3MN9 A;  2VGM A;  3U9D A;  4ILG B;  3VMF B;  4RTF D;  3A5O C;  4PKG A;  2FXU A;  2PFU A;  4ILH A;  5AQY A;  3UE5 A;  2YJE A;  5FPD A;  4JEP A;  3ID8 A;  4JKC A;  5KPR A;  1W97 L;  1NGJ A;  1NGA A;  2HBK A;  3FGU A;  5JLH A;  1HJO A;  2E1Y A;  1MA9 B;  1MDU B;  2F9T A;  3VEW A;  5C2F A;  1YHQ N;  3A5L C;  4JKA A;  3ZYY X;  4JN4 A;  5GIN A;  2NRW A;  3I33 A;  3M3Z A;  1CZA N;  1U6Z A;  2P9U B;  1DGK N;  4JHD B;  2YI1 A;  4PKH A;  4WQ4 A;  5AQZ A;  4B9Q A;  1YJW N;  4H0V B;  1VQK N;  3CCL N;  1NLV A;  2P9N B;  4BC5 A;  1VQ6 N;  1TUY A;  5GIO A;  4BRN A;  4FPA A;  2DPN A;  3QDK A;  4BRG A;  4HWI A;  4CBW A;  5AQK A;  4GNI A;  3A8Y A;  3VOV A;  1DEJ A;  3MN5 A;  4CZL A;  1X3M A;  5BPL A;  3FZH A;  4GV6 A;  3VGM A;  5B8H A;  4BVP A;  1HUX A;  1T3V A;  4DQ8 A;  3QBX A;  3VGK A;  1YF5 L;  3GDQ A;  2P9U A;  2Q1N A;  4JKB A;  4FOI A;  4JHD A;  5M1O A;  2OTL N;  3R1X A;  4JKD A;  2P9N A;  3CCM N;  5F1X A;  2J4R A;  2QWN A;  1YI2 N;  1ATR A;  2HST A;  3TSP A;  4FWK A;  2BUP A;  5BR9 A;  5M1Q A;  5M1K A;  1M1K O;  1VQP N;  1YVN A;  4CZM A;  3U9Z A;  5GAE P;  4A2A A;  4IEI A;  1R59 O;  2A41 A;  3OA9 A;  5FPM A;  4FWS A;  4MDA A;  1ATS A;  5BRH A;  1Q81 O;  5KPT A;  2KHO A;  3P39 A;  3P31 A;  4C1N I;  1GLA G;  3WXJ A;  1JCG A;  2CH6 A;  4I6M B;  4ISF A;  4XH4 A;  3CCQ N;  1Q82 O;  1VQ5 N;  3RSE B;  4FWO A;  3BF1 A;  3TSQ A;  3CC4 N;  3M1F A;  2YHX A;  5GAH P;  4PL7 A;  1H1V A;  3JXU A;  1KAX A;  1HKB A;  3TSU A;  4EFH A;  5KPZ A;  2JWL A;  4NLB A;  3R9P A;  3CCR N;  3G4S N;  3CQX A;  3KWG A;  1Q7Y O;  2V7Z A;  4CBU A;  3KK7 A;  5C12 A;  2JWK A;  3CER A;  3H6E A;  5EOY A;  3VGL A;  3CPE A;  3WEE B;  3H1Q A;  3K9J A;  1GLD G;  2A3Z A;  1NMD A;  3O1B A;  3ZX0 A;  3SMP A;  1ILY A;  3E9P A;  2HMP A;  4I6M A;  3ZX2 A;  1VQO N;  3RSE A;  3HOT A;  4K41 A;  3DXM B;  3CCJ N;  3EE9 A;  5C10 A;  1G99 A;  2QA4 N;  3FZM A;  4H5V A;  1D4X A;  4BC2 A;  3HTV A;  3EE8 A;  5AQT A;  4WQ4 C;  1GLE G;  4B1X B;  1RGI A;  4A61 A;  4IFE A;  4A62 A;  3CJ1 A;  1J6Z A;  4BVO A;  5HL7 L;  3WEE A;  2PAV A;  4F9O A;  3VEX A;  1QQO A;  4J8F A;  5E26 A;  3CF5 L;  5FPN A;  1JCF A;  3CJB A;  3S41 A;  3BF3 A;  3DXM A;  2ZJP L;  2BTF A;  1NGD A;  1HLU A;  4M63 C;  3CIP A;  3WQT A;  3LDN A;  4NB4 A;  2YHW A;  4E1J A;  4BR7 A;  4C1N K;  4DHY A;  1SAZ A;  3WXM B;  1GLJ O;  2QI2 A;  3O1W A;  4K42 A;  3ZX3 A;  3HZ6 A;  4WYB A;  4CZE A;  2EWS A;  5MLC Q;  3EL2 A;  5JVG L;  5AFU A;  1BU6 O;  2HBJ A;  3QML A;  2E2P A;  3T7Z A;  1NBW A;  2Q2R A;  3LDL A;  2P9I B;  4YOT A;  2I7P A;  3D2F B;  1YUW A;  3TU5 A;  3T69 A;  2Q97 A;  5BRD A;  3O9S A;  5BPN A;  1YXQ A;  4BRP A;  1EQY A;  4EIA A;  2ASP A;  3H45 C;  5TKW A;  1NGC A;  4A57 A;  4FSV A;  4IO9 L;  4CZH A;  4B1Y B;  3G71 N;  3O9U A;  4A59 A;  2YJF A;  2GWK A;  3FLC O;  4CD3 A;  1TYQ B;  4NLC A;  2VWB A;  4O8K A;  5AQW A;  4BG9 A;  4CZG A;  3MCA B;  4RCH A;  2GUP A;  5EY4 A;  2P9I A;  3D2F A;  5M1F A;  1E4F T;  2WFB A;  4BG8 A;  3HRG A;  4WFN L;  4ILJ A;  3DJC A;  1NJI O;  1NGB A;  4H5N A;  4K43 A;  4BQZ A;  1HKG A;  3CJA A;  2V7Y A;  3QFU A;  1JJ2 M;  1VAZ A;  1KAY A;  1Y64 A;  1TYQ A;  1Z6R A;  2HBL A;  5AQI A;  1S3X A;  4A5A A;  2D4W A;  1BOT O;  5CR4 A;  1Q18 A;  4BY9 C;  3O4W A;  3IUC A;  3PIO L;  4H0T B;  5CHI A;  4WF9 L;  5JVH L;  2ZGY A;  5DM7 L;  1S22 A;  2ITM A;  2FF6 A;  1QZ6 A;  5AQX A;  1BUP A;  3VEO A;  4B1U B;  1W2B M;  2IVP A;  2NRH A;  1N8R O;  4XH5 A;  1K8A O;  1QZ5 A;  1BWF O;  1KXP A;  3KVG A;  3D2E B;  2QWQ A;  3TTD A;  2CGL A;  4BRF A;  3I8B A;  2UYT A;  5AQM A;  4BGA A;  4BR2 A;  2P9K B;  4IJA A;  1P90 A;  2ZF5 O;  3LL3 A;  3SJH A;  4KH4 A;  5AQS A;  5H1S Q;  4RWT A;  3JS6 A;  1BDG A;  4FWM A;  3VPZ A;  3OW2 M;  1QQN A;  4C23 A;  3PIP L;  4IXC A;  3C6H A;  3MWP A;  5JLF A;  1YIT N;  4DKW A;  4H0P A;  1VQ8 N;  3IFR A;  4BRL A;  2E20 A;  1NGG A;  3D2E A;  4R79 A;  3BEX A;  3AAR A;  4FO0 A;  2E1Z A;  5C2D A;  4JAX A;  4YOX A;  5AQO A;  1HKC A;  2P9K A;  3H3N O;  4OPH A;  5AZJ B;  4PL8 A;  4BGB A;  4EHT A;  5C0Y A;  1QQM A;  3MN7 A;  1BG3 A;  5AR0 A;  4UY8 O;  4BRO A;  3NVK A;  1XQS C;  2PBD A;  1NGF A;  1Z05 A;  2Q36 A;  1ZC6 A;  3GE1 A;  4AF1 A;  1RDU A;  3BUZ B;  1O13 A;  1RFQ A;  5EVZ A;  3NVM A;  3VEY A;  1HPM A;  3VEV A;  1P8Z A;  4QS7 A;  5GAG P;  2WBN A;  2NRT A;  3HBT A;  4KH6 A;  3UKU B;  4KH5 A;  3LDO A;  2YCH A;  4BRI A;  5AZJ A;  1WUA A;  4QS8 A;  3A5M C;  4CZJ A;  1Q86 O;  2HF3 A;  4B1W B;  2FLO A;  3CCS N;  5AQG A;  4CD1 A;  3W3D A;  2ZGZ A;  5AQU A;  2FF3 B;  3C7N B;  2Q0U A;  5BN9 A;  4WQ5 A;  3K9K A;  3R8E A;  2P9L B;  3AGR A;  1KAZ A;  1V4T A;  2KLA A;  4MLE A;  4BR0 A;  2RHK A;  3SAF A;  1BA0 A;  2D1K A;  3VTH A;  2D0O A;  4BRE A;  2GWJ A;  2OTJ N;  1EO1 A;  3D7E O;  3H3O B;  4FWP A;  2CGK A;  2P9S B;  1GLB G;  3MDQ A;  2A5X A;  2ASO A;  3UKU A;  3L0Q A;  4H0O A;  1ZBS A;  2CH5 A;  4OPA A;  3O6W A;  4IJN A;  4JKG B;  1KC8 O;  4QS9 A;  4XH1 A;  1SS6 A;  3LM9 A;  2E2N A;  4JKH A;  3F2K A;  5AQJ A;  1VQ9 N;  5KQD A;  3AAQ A;  3F9M A;  4IOC L;  4GY2 B;  5AZI B;  3C7N A;  3DAW A;  2GX9 A;  5AQH A;  3O9T A;  1ESV A;  1MWM A;  5ELZ A;  2P9L A;  2ASM A;  1OKJ A;  2QWM A;  4EHU A;  4JD2 B;  2A40 A;  3C0B A;  1QVG M;  2QWR A;  1QHA A;  2P9S A;  5AQF A;  3AAP A;  3P38 A;  3SLC A;  4B1V A;  3L4Q A;  3LDQ A;  4JKG A;  4CBX A;  2D0P A;  4U67 L;  3L4I A;  1LCU A;  5AQL A;  5AZI A;  1K8K B;  1DKG D;  3LM2 A;  4IEE A;  3ULE B;  3DWL A;  3LDP A;  3CC7 N;  2QWL A;  4JNE A;  3CCV N;  2FSK A;  4IWV A;  4JD2 A;  4JK9 A;  4BC3 A;  2QXL A;  2IIR A;  4BRA A;  4BRD A;  3FFK B;  5CE3 A;  2V52 B;  5AFU H;  4JKF A;  3GBT A;  5M1P A;  3CCE N;  3N4Q A;  3O9Q A;  4YDU C;  2NZT A;  5LJV A;  2NRV A;  3KZB A;  3MWT A;  4DCH A;  1X9J A;  4AM7 A;  1S72 N;  1VQ4 N;  3E9O A;  3O5B A;  3TPQ A;  3CI5 A;  3AY9 A;  3N4P A;  4H5T A;  4IO8 A;  2AA4 A;  3O08 A;  3ULE A;  3L6Q A;  1K8K A;  5BRF A;  5M1N A;  2IVO A;  3G6E N;  1U2V B;  5F0X A;  5KQ8 A;  3E66 A;  3SAH A;  3SAG A;  3PLA A;  2HBM A;  3R3L A;  4K25 A;  1ZXO A;  3OBY A;  3ENO A;  4LC9 B;  4DB3 A;  3IDH A;  5LJW A;  3FZK A;  4H5R A;  3ATV A;  4CZI A;  1OVY A;  4BRQ A;  3MX5 A;  5AQP A;  2WUS A;  3TTF A;  4FPB A;  2NNW A;  1NGH A;  2AP1 A;  4H5W A;  4BR5 A;  5HOO A;  4WQ5 C;  3KHY A;  4WFA L;  1MWK A;  3ENH A;  2E8A A;  3A0I X;  4XEI A;  4BR9 A;  1U2V A;  2QEX N;  1NM1 A;  3MMV A;  2W41 A;  3O8M A;  3TTC A;  1C0F A;  2RE2 A;  3G25 A;  3EZW A;  2W40 A;  4PHT X;  4FVU A;  1NGI A;  1YIJ N;  5I9E B;  1YJ9 N;  3U8X A;  3VET A;  3UB5 A;  1ATN A;  5TKY A;  3O9R A;  4MLH A;  1KD1 O;  3CCU N;  1SZ2 A;  3WT0 A;  2E2Q A;  3R6M A;  3I55 N;  3EO3 A;  3E9L A;  4PKI A;  5ADX A;  3J8A A;  3GL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...