3ZX2A

Ntpdase1 in complex with decavanadate
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
406
structure length
396
Chain Sequence
NVKYGIVLDAGSSHTNLYIYKWPAEKENVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGSSTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNNSHCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
publication title Crystallographic Evidence for a Domain Motion in Rat Nucleoside Triphosphate Diphosphohydrolase (Ntpdase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 123
structure length 396
sequence length 406
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx2A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx2A02
1SQKA 3BP8A 4YDUA 2QWQA 3HSCA 5AQTA 3O4WA 2P9SB 1Q18A 3ENOA 2D4WA 3QICA 4A62A 4WQ5C 2QW9A 2D0PA 1HKBA 4A2AA 1HUXA 1QQMA 1S22A 4FOIA 4JD2A 4J8FA 3M6GA 3CJ9A 5BRHA 1ATNA 1NGHA 3O1WA 3ZEUA 3VEVA 2ASMA 3GL1A 4KBOA 4BREA 2IVNA 2VYPA 2FSKA 1HX1A 4C23A 4BC4A 3MDQA 1QZ6A 3VPZA 1NGAA 1OKJA 2V51B 3O08A 3A5NC 1MA9B 4BR7A 2GWJA 5AQOA 2P9LB 2A41A 3FGUA 3CIPA 3UE5A 4CD1A 1YUWA 2P9IA 1DGKN 4BR0A 4BROA 2HF4A 3LM9A 2A5XA 3VF6A 2A3ZA 3DXKA 3HTVA 2E2QA 3FZMA 3VGKA 4CZMA 4BQZA 5KPTA 5LY3A 1H1VA 3IFRA 3VEOA 2FF6A 3HM8A 2E8AA 2KHOA 3VESA 1DEJA 3LL3A 5AQKA 1NGDA 4BGBA 4WYBA 3ZX3A 4FWRA 4BRNA 5BREA 1V4SA 3WXIA 1NGBA 2H3GX 4Y0WA 1ZBSA 3D2EA 5KQ8A 4JD2B 4E1JA 4FWMA 5E26A 2ITMA 4YDUC 3O8MA 2YI1A 1GLEG 3ENHA 4LC9B 3W0LA 4B1XB 3O1BA 1TYQA 1IG8A 4JAXA 2HF3A 4K25A 4ISFA 2A6AA 4FPAA 4WQ5A 1SAZA 3UKRB 5ELZA 4BR9A 1LOTB 3LDNA 3TU5A 1E4FT 1X3MA 4H5VA 3S41A 2YJFA 3U8XA 3MN5A 3VEZA 5BPLA 4ISEA 2P9KA 3CI5A 3VEXA 3WQTA 3GE1A 3QBWA 1NGFA 4IJNA 5AR0A 2E2NA 3G25A 3VF4A 3M1FA 5BN8A 1T44A 3FLCO 5AQQA 4Z94A 5EOYA 1HKCA 4MLEA 3DXKB 2ZGYA 4CD3A 5BPNA 3QFPA 5E84A 1ZXOA 5AQVA 3FZHA 4BG8A 3A0IX 1GLDG 1KAYA 4BG9A 1RFQA 5BRDA 3BEXA 5EXWA 3CERA 3SK3A 3CETA 4A61A 1NWKA 3A5OC 4CJ7A 3D2EB 3LDLA 4BRLA 3D7EO 3P4IA 2Q31A 2CH6A 3MMVA 5JMVA 2CGKA 2CH5A 1TYQB 4BVOA 2GWKA 4M7XA 4NB4A 1SZ2A 4B1UB 4FWOA 1JCEA 2GEMA 1NGJA 5TKYA 4BR2A 3GOIA 4I6MB 3VENA 1U2VA 2ZF5O 3H3OB 4HTLA 3I8BA 3EKSA 1GLAG 1YVNA 2CGJA 3UKUB 2ASOA 2P9KB 1IJJA 4FSVA 4M63C 4B1VA 4CBUA 2FF3B 1S3XA 5BPMA 4MLHA 1QZ5A 2I7PA 3CHWA 1HKGA 4IZ9A 5FPNA 3BF1A 3VGLA 4QS8A 2Q97A 1BU6O 2A40A 4FWLA 4H5WA 4DQ8A 1BG3A 1Z05A 3D2FB 4GNIA 3MN6A 3KHYA 1QHAA 4IWVA 5FPDA 3LM2A 3R8EA 1HLUA 3VEYA 3R9PA 2Q2RA 1NGIA 4H0YB 3WXKA 4H5TA 3VETA 2Q0RA 3CJ7A 5AQYA 4BRAA 2W41A 4CZGA 1TUYA 2WUSA 4GY2B 1JCFA 3IDHA 1HPMA 4CBWA 5JICA 3DXMA 4H0TB 2P9UA 5AQLA 3SJHA 5AQUA 4MO5A 3W3DA 1XC3A 2QXLA 3U9DA 2P9PB 4B1ZA 2V7YA 4NO7A 3SLCA 5AQXA 2A42A 1DKGD 5KQDA 4BRIA 4PKIA 2FSJA 4JHDA 1ATRA 3DJCA 4FO0A 4BQLA 4EHTA 2GUPA 1RDWX 3VERA 1U2VB 1GLBG 1TUUA 3CQXA 4BRFA 3WEEA 4QS9A 1MWMA 5AQZA 4QS7A 2NZTA 2BTFA 2NLXA 3FE1A 2VWBA 4A2BA 1NGCA 3OHRA 2V7ZA 3TPQA 4F9OA 4WQ4C 4JN4A 2PBDA 1XUPO 4XH1A 1CZAN 3O5BA 3ZEUB 4BC3A 5AZJA 3FR0A 5I9EB 3AY9A 3GDQA 4CZLA 4CZJA 2F9TA 1BO5O 3I33A 3SMPA 2GELA 4H0XB 5FPEA 2QM1A 4B1WB 1NLVA 4FWQA 4FWSA 3VEWA 1YXQA 1KAXA 4BR5A 2QWRA 3WQUA 3GBTA 5F2RA 2QWNA 3KVGA 1G99A 5AQRA 3ZX0A 1GLFO 2NRHA 3AAQA 3DXMB 2P9NA 3IUCA 1V4TA 2D0OA 2P9IB 1WOQA 5BN9A 5LJWA 4IJAA 2QWMA 1KXPA 4BRDA 2QWOA 1ZC6A 2E20A 4EAHD 5EY4A 1J6ZA 3HBTA 3LDPA 5AZIA 3WXJA 4JHDB 2P9SA 5AQFA 4FL9A 1T6CA 4BRPA 3QDKA 5KPRA 1X9JA 5AQNA 3LDQA 4FPBA 1U6ZA 2UYTA 4ISGA 3KZBA 5BR9A 3CJ1A 4PL7A 4JNEA 4AM7A 2PAVA 2D1KA 2GTDA 1R59O 4B9QA 4BRHA 1D4XA 3EL2A 3ID8A 4XH5A 4DHYA 4H0OA 1YAGA 4BC5A 1C0GA 3C7NA 1RGIA 3GG4A 4EIAA 1BA0A 4WQ4A 5AFUH 4BVPA 1E4GT 3C0BA 5AQWA 2YJEA 3R6MA 2P9LA 4K42A 3DAWA 3QMLA 1GLLO 5BRFA 2ZWHA 2P9NB 3O80A 3EKUA 3MN9A 2QWLA 2BUPA 4CZHA 4K43A 3VOVA 2CGLA 2F9WA 3L6QA 1XQSC 1C0FA 2E88A 5AZIB 4BRCA 4RWTA 2EWSA 1BOTO 3U4LA 5KPZA 3CJAA 4AM6A 3BF3A 4K41A 3DWLA 4FWPA 3QFUA 3O6WA 3VF2A 1GLJO 5CE3A 4M7YA 2AA4A 2OANA 1Y64A 3ZX2A 3QB0A 4B1YB 2YHWA 3FZLA 4BC2A 3AAPA 3HZ6A 2E2PA 4BRGA 5AQSA 2W40A 5EVZA 5ADXH 1MDUB 1BUPA 1JCGA 3HI0A 3J8AA 3UKRA 3H3NO 1EQYA 3C7NB 3EZWA 5AQGA 3WT0A 5B8HA 2I7NA 4FOEA 3ATVA 3IMXA 1LCUA 2J4RA 1NMDA 2IIRA 3H46O 4FWKA 1MWKA 4L3QA 3H1QA 5AQPA 4CI6A 3M3ZA 3EN9A 2Q36A 1NBWA 4H0PA 5AQMA 4IXCA 3ZETA 1GLCG 4CZKA 2FSNA 3EO3A 4DCHA 3A5LC 3MK6A 3WXLA 3VGMA 4O8KA 5EX5A 2YHYA 1WUAA 1NGGA 3ULEA 2DPNA 4RTFD 2FLOA 3A5MC 1K8KA 3B8AX 5AQHA 4CZEA 2HOEA 3CQYA 4H03B 4XEIA 4H0VB 4PL8A 3FZFA 3JXUA 4CBXA 2P9UB 1QQNA 3RSEA 1BWFO 5AQJA 5AQIA 2IVPA 4BGAA 3CJCA 4I6MA 1QQOA 4BR4A 3JS6A 4HWIA 4BRKA 2IVOA 3UKUA 4RCHA 2Q1NA 5AFUA 3F9MA 3WEEB 3MN7A 2YCHA 4BRQA 4EFHA 3CJBA 4CZIA 1ESVA 5F0XA 2HMPA 5JLFA 1P8ZA 4O5FA 1BA1A 1HJOA 2E2OA 2E1ZA 3AARA 3H1VX 3D2FA 4BRMA 3A8YA 2AP1A 3QBXA 3U9ZA 3ZETB 3MCPA 5F1XA 2VCPA 5JLHA 4PKHA 5AZJB 3WUHA 1BDGA 2QWPA 3LDOA 2Q0UA 3H6EA 1T6DA 4XH4A 3FFKB 1KAZA 3SMSA 1Z6RA 4MO4A 2E1YA 4H5NA 3ULEB 1NGEA 3BUZB 4FWNA 2V52B 4CZFA 1K8KB 5FPMA 4EHUA 4H5RA 2YHXA 4IO8A 3H45C 2ASPA 3UB5A 4DB3A 5LJVA 3ATUA 3L4IA 2FXUA 2ZGZA 3L0QA 2P9PA 5ADXA 3FZKA 3RSEB 1X3NA 1NM1A 1ATSA 4PKGA
chains in the Genus database with same CATH superfamily
3E9LA 1SQKA 1NK9A 3BP8A 5I42A 4J2BA 4YDUA 4DFMA 2KZMA 3HSCA 3TAQA 1Q18A 3C95A 3ENOA 4A59A 1I39A 4CHZA 4A62A 1N8RO 1JXEA 4LH5A 3H08A 3TSUA 1S22A 4FOIA 1K73O 4M3UA 3CJ9A 1HYSA 5HRPA 4WFAL 3ZEUA 3MXJA 3HSTB 1RTHA 4KBOA 4BREA 1K9MO 2UXBK 4KFBA 1VSFA 2F8SA 4FJ9A 3MDQA 5HRNA 3VA0A 1NGAA 1UA1A 5FROA 4PQUA 2DY4A 4C8OA 4YHHK 4IFYA 2GWJA 4RG8A 5AQOA 2E5LK 3Q7CA 4E1MA 2KZZA 3ZT4A 3LP0A 4DTOA 1SL2A 4DV6K 3ZT2A 2QK9A 3AVBA 4CIFA 4Z4IA 4O5BA 2DFFA 3DRRA 3VF6A 4BY9C 5KPTA 3QESA 2FF6A 2E8AA 2KHOA 1DEJA 2BANA 4BRNA 5CR4A 5BREA 3LPTA 5TKWA 3T7ZA 1YJ9N 3D2EA 3F9KA 3P1GA 5J2QA 5KQ8A 4E1JA 4FWMA 5GADP 3VQBA 4GKKK 1GLEG 2PFUA 3O1BA 1TYQA 4JAXA 3K5MA 1JLEA 2F4VK 2HF3A 4K25A 4FPAA 4ZHRA 3UKRB 4BR9A 3LDNA 1JKHA 1J53A 3MX2A 2XY5A 4Y1CA 4DV3K 2GBZA 4ISEA 1KD1O 1NGFA 5AR0A 2E2NA 3SCXA 3M1FA 1IKWA 1S9GA 4F8RA 1XI1A 1T44A 3L4QA 5AQQA 1VRUA 1BIZA 4Z94A 4KHNA 4MLEA 1CZBA 4F2RA 1YT3A 2VGNA 5BPNA 3V81A 3HPOA 3QFPA 5E84A 3A0IX 3HM9A 1GLDG 4ILJA 4N47A 4BG9A 1U4BA 1RFQA 4JI2K 5BRDA 3K59A 3CERA 3HOTA 3OBYA 3A5OC 5SWMA 4OPKA 3QEPA 3D2EB 3LDLA 5IWAK 1TVRA 3NE6A 4GVMA 3THXA 4GVEA 2CGKA 5M1QA 1NK8A 3SPZA 2CH5A 3CG7A 4CJFA 1TYQB 3EE8A 3CFOA 4I7FA 3AVHA 4CJ5A 4NB4A 3CPEA 1NKEA 1JCEA 1K6YA 1VQ9N 4Y1DA 3VENA 4NXNK 2ZF5O 1YVNA 3UKUB 2W42A 2ASOA 4DSEA 2PYLA 4CF2A 4FJGA 1QZ5A 3CHWA 3KWIA 1IKYA 1BU6O 4U67L 2A40A 3TI0A 4H5WA 3D2FB 3G6EN 4YNQA 4M3XA 4CHYA 3VEYA 3R9PA 2Q2RA 4H0YB 4M3RA 4H5TA 4GV3A 4PUOA 2Q0RA 5J1EA 4BRAA 3E9OA 4X62K 4GY2B 3U3YA 1NK6A 3OJSA 3DXMA 1LV5A 5M1FA 3THXB 1GOAA 1UAXA 4OGCA 3AA3A 4YOTA 2P9PB 4B1ZA 4NO7A 4WFBL 1QE1A 1IBMK 4DMNA 3DJCA 4EHTA 2NRZA 3VERA 3ZT0A 1Q8IA 4HTUA 3WEEA 1BQMA 3AVJA 4EP4A 3V9SA 3ZSXA 3KKSA 5D3GA 2G8HA 2BTFA 3UIQA 2NLXA 4PA1A 3OW2M 5JVHL 1NGCA 1RDAA 2V7ZA 2HBMA 3TPQA 4F9OA 3CM6A 1CZAN 4FLTA 3F2KA 5AZJA 4EZ9A 4PY5A 3PO5A 3AVCA 3I33A 4CJKA 5FRNA 2GELA 5FPEA 1J54A 2UXDK 2HB5A 1NLVA 1KAXA 3ASMA 2UUBK 3KD5E 2QWRA 3GBTA 4N76A 3AGKA 5BR8K 1VSJA 3OS0A 1RT6A 3OYBA 3DXMB 2P9NA 3VQ9A 2P51A 1KFDA 3BY5A 3VQ8A 3HK2A 4E1NA 4CK3A 4CFDA 1CXQA 3O9UA 5MLCQ 4IJAA 2OTLN 2ITGA 4BRDA 3AGRA 2A1RA 3TARA 4MDAA 1ZC6A 1VSLA 3LDPA 5K14A 3WNGA 4I2PA 3S3MA 3HT3A 5HRRA 4FL9A 3VQAA 3O3GA 5DM7L 3ZSOA 1X9JA 5AQNA 3TTDA 1U6ZA 3KWGA 2O8BA 3MXIA 1VQ5N 3AO5A 4LFAK 4AM7A 1WSIA 5C10A 1ASUA 2D1KA 2YHAA 2GTDA 4MFBA 4B9QA 1D4XA 4DSIA 3ID8A 3L3VA 4FW2A 4KHYA 1KRPA 1NG9A 4BC5A 3J81O 1T7PA 1RGIA 4EIAA 3NH2A 3LP1A 3U3GA 4WQ4A 1QSYA 1JL2A 4O8UA 3O4QA 2Y1JA 4JKGA 5KRSA 3R6MA 4K42A 3JYTA 5GIOA 1GLLO 4ELVA 4CW7B 1WAFA 3WNHA 4B9MA 1B9DA 4IBNA 1FXXA 4FJJA 4OJRA 2P9NB 5E41A 3CCJN 3VOVA 2CGLA 2F9WA 2GUIA 2YX6A 1R0AA 3NHGA 1VSKA 1WLJA 2KFZA 2YNFA 1HMVA 2HSTA 1BOTO 3FFIA 1WBBA 5KPZA 3M8SA 3AVFA 4AM6A 1VQMN 1RTDA 1FK9A 3O6WA 2O8BB 4B3MK 3QB0A 3V1RA 1TAQA 1EETA 3CCVN 5ADXH 4KREA 1REVA 2W40A 5EVZA 4LF4K 2YKMA 3H3NO 1WAJA 1ZBHA 5AQGA 3G4SN 2IGIA 1OH7A 2XY7A 2I7NA 2O8EB 4JKGB 3ATVA 2UUCK 1LCUA 3T3FA 1NK7A 1NMDA 1VSDA 4EZ6A 2Q36A 1NBWA 5AQMA 1SKWA 3I0RA 4DWIA 3SUNA 3ZETA 3RTVA 4FCYA 1YITN 1TKXA 3EO3A 1CZ9A 3A5LC 4LFCK 3WXLA 4B8CA 4W5OA 4KHPK 2IDOA 3DRPA 5GAEP 2YHYA 3ULEA 4DV2K 5A2QO 3CCSN 4B3RK 2F7TA 3DOKA 3A5MC 5AQHA 4H03B 4XEIA 1HQEA 2HBKA 3NDKA 4CBXA 2XHBA 4DTJA 1D9DA 2HHVA 3MXMA 5AQIA 4A5AA 1EWRA 4E7LA 2JWKA 3C6AA 4I6MA 4CJ3A 4IEIA 1QQOA 3IS9A 3HVTA 3JS6A 3TR8A 1JXBA 1IH7A 4LFBK 3F9MA 4M3WA 5HRSA 3E1YA 3KJVA 4JI7K 4DF4A 3NBPA 4M41A 1ESVA 5JLFA 4O5FA 1BGXT 4QCLA 1W2BM 4KHUA 1RNHA 2E1ZA 1Q7YO 3ZETB 2AP1A 1NNEA 5C25A 1S5JA 3R1XA 4CHOA 4PKHA 5JLHA 1U45A 3LZJA 3OYJA 3H6EA 2HHXA 4IG3A 3JAMO 3FFKB 1VHXA 1L3UA 3SMSA 4CJPA 4MO4A 4TSXA 4OKJA 3CCUN 1W7AA 3VQCA 4CEAA 3ULEB 1NGEA 3BUZB 1C1AA 1YHQN 1X1PA 1Z26A 3LAKA 1XC9A 2YHXA 4IO8A 4AQYK 3T1HK 1L5UA 5ADXA 1YIJN 2D0BA 2VWKA 1ATSA 5KTQA 2HHTA 3ZYYX 4DTXA 4FLZA 4IEEA 4B3SK 4ZTJA 3DMJA 2XO7A 3O4WA 3IG1A 1NJYA 3EYZA 3THYA 3SV3A 1HKBA 1S6PA 4ID1A 4KKOA 2BDPA 4DQRA 5BRHA 3RMAA 4UY8O 3TAMA 1NGHA 4AHRA 3VEVA 1RBSA 3HYFA 3QEXA 2XRIA 2FBVA 1EP4A 2FSKA 4WCEL 1HX1A 1KVBA 3VPZA 4YOYA 2YHBA 1KC8O 3O08A 1WB9A 3CCMN 4FJ8A 2OTJN 4CVNE 3TANA 2P9LB 3SAHA 3FGUA 5JS2A 1ZYQA 3AVGA 1DGKN 4FJ7A 1SKSA 1KTQA 3K5LA 5SZTA 1F21A 3FZMA 4CZMA 4BQZA 1VSIA 1T03A 3TAFA 3JSMA 3VEOA 3HM8A 2NRXA 4DU4A 1U47A 1U49A 4BGBA 4WYBA 5JVGL 3RR8A 1KVAA 1QTMA 1V4SA 4B3OA 3QIOA 4Z4CA 1VQNN 4G1QA 2BE2A 3L2VA 1NKBA 2W6LA 4OPAA 1B9FA 2YI1A 4LC9B 1ITGA 4Z4HA 4Q5VA 4YY3K 3LWMA 2A6AA 3HL8A 4WQ5A 3OVNA 4KB0A 2IS3A 4IDKA 1TAUA 3TU5A 3VA3A 1N33K 2O8DA 2GV9A 3HPHA 2YJFA 5C2FA 3MN5A 5J2NA 2P9KA 3VEXA 3WQTA 3GE1A 3QEIA 3AV9A 3QBWA 2G8UA 3G25A 3VF4A 3PSFA 4YOWA 3K5OA 2RPIA 4RW7A 1YTUA 1RBUA 4A57A 3ZSVA 4JI0K 2OPQA 4O44A 4AHVA 4H4OA 5LL6Z 4CD3A 2VG7A 3V9XA 4LF7K 5C12A 1ZXOA 4BG8A 3ZT3A 3THWB 3QLHA 3PX0A 2OPRA 3SK3A 3CETA 4A61A 4O55A 4CJ7A 1IKXA 1BISA 2NUBA 3D7EO 3P4IA 3MMVA 3LP3A 3PV8A 3SNNA 3AVKA 1WSGA 4FM2A 3TTFA 4BVOA 4WF9L 4B1UB 3M8QA 2GEMA 1JLGA 4UQGA 2HHSA 5TKYA 2FBXA 3DYAA 1RDDA 4JI5K 1KLNA 5CYQA 2O8DB 3EKSA 1VQKN 1BHLA 4W5QA 2P9KB 4FSVA 4CBUA 2HW3A 2FF3B 2WOMA 1VQ8N 1HKGA 2OCEA 4QS8A 2Q97A 2KLAA 3OYNA 4I9QA 5T7BA 4DQ8A 4K8XA 4GNIA 4L8RB 3MECA 1HYVA 1QHAA 3SQ0A 1Q9YA 3MEDA 3R8EA 3WXKA 4B9NA 1VSHA 3ZSZA 3PLAA 3SYZA 2W41A 4OVLA 1WSHA 3AVMA 3KK3A 2E6MA 5JICA 1TL1A 3C6UA 4H0TB 2P9UA 3SJHA 3THVA 1KLMA 5AQUA 2O8CB 4M45A 2HNZA 4FZYA 1VQPN 5AQXA 4E89A 4CGDA 4BRIA 4PKIA 2FSJA 1RT5A 4OKKA 2OZSA 4LF9K 1ATRA 4FO0A 3QNNA 3O3FA 4FJXA 2GUPA 3EE9A 3CQXA 3OYCA 4B3TK 4JI8K 3IRXA 5AQZA 4QS7A 4ID5A 4C8KA 3HP9A 3T1AA 3DRSA 3SZ2A 1GOBA 4Q0BA 1JL1A 1D9FA 1RDCA 4WQ4C 3LPUA 2PBDA 4JN4A 3ZEUB 1HNVA 4LF5K 3AY9A 4CZJA 5HROA 2P5OA 2F9TA 4OGEA 1LWCA 4J2AA 3TTCA 4FWSA 4DFPA 3CC2N 3V9WA 3L2UA 3WQUA 5F2RA 5DM6L 1G99A 1GLFO 3V9ZA 1WSFA 1BL3A 4C1NK 3RMBA 3SQ4A 3O9TA 1G15A 2FBYA 4DG1A 4Z0UA 4ICLA 2QWOA 5HP1A 3ZT1A 3OS2A 3OBWA 4JKAA 3WXJA 4DTPA 2I5JA 4CGIA 2P9SA 5AQFA 4DSFA 4E7JA 1T6CA 4CFCA 1S1VA 3J80O 4B08A 1HRHA 2WONA 4FPBA 2UYTA 4PL7A 2VQFK 1HQUA 3MWTA 4DR7K 4DU3A 3NVKA 1Y97A 4AHCA 3OA9A 1C0GA 2X6SA 2HVHA 3GG4A 2HMIA 4LH4A 2Y1IA 3PX4A 1S1TA 4BVPA 3SJJA 4PWDA 3J7YP 3RVCA 3DAWA 3RRHA 4YOVA 5BRFA 3ENBA 1XNRK 4GMJB 2ZWHA 3PO4A 3T19A 4KB1A 2VG5A 4N56A 3BGRA 4HCCA 2F96A 1NK5A 3DLRA 2QXFA 3O3HA 1IG9A 1C0FA 2E88A 3SI6A 4JV5K 4BRCA 4CEZA 2EWSA 2QEXN 1EKEA 2G8WA 3NF8A 3DWLA 3QFUA 4OX9K 5C0YA 1VK0A 2FC0A 3VF2A 1GLJO 3EEQA 5CE3A 2AA4A 3ZX2A 4IDHA 4JI4K 4JS5A 1VAZA 3CYMA 3KLIA 4W5RA 3AAPA 3HZ6A 4BRGA 4HUEA 1JCGA 4FK2A 1MU2A 2D0AA 3HI0A 4CEEA 1X9MA 1Q9XA 1J5OA 4BE1A 4DR3K 1FKPA 2KKZA 2O4GA 1TK5A 3AO2A 3WT0A 4DKWA 4KTQA 1OH5A 1EO1A 3CXCM 4FOEA 3O9SA 3H46O 4FWKA 1MWKA 4CI6A 2VGMA 4R79A 2E6LA 1U48A 3L2RA 2FSNA 4LSLA 3DOLA 4JKEA 4DTMA 3K0SA 1NGGA 3O9RA 3R3LA 1O13A 4FLYA 4RTFD 3I0SA 1JJ2M 1BCMA 3TWHA 4H0VB 4PL8A 4E19A 1KVCA 4FM1A 1TV6A 3AO4A 5AQJA 4BDYA 2PY5A 4DFJA 4CJWA 2Z1GA 3CJCA 4DLEA 2IVOA 4CJSA 2KTQA 2QA4N 1T3VA 3WEEB 2YCHA 1BCOA 1RT7A 4FLXA 4EFHA 3CJBA 4V19S 5F0XA 2HMPA 1QQCA 4HHTA 4X65K 3K57A 2WC9A 4JLHA 1J9AA 1HJOA 3AARA 4FM0A 3QBXA 3IAYA 1IO2A 1W9HA 2EHGA 2ZE2A 5AZJB 3WUHA 1BDGA 2AJQA 4AILC 1KAZA 4JKFA 1N32K 3B6PA 4CF8A 1EX4A 3PUFA 2E1YA 4DS4A 4GV9A 1DT9A 5FPMA 3C6HA 3T69A 4DUYK 3OYAA 4H5RA 3AVAA 4DTNA 3UB5A 1QSLA 3L4IA 1IBKK 1X3NA 4I2QA 3PIPL 3LWLA 4CCHA 3HO1A 3K2PA 4YOUA 2QWQA 3SPYA 4CGFA 2D4WA 1ILYA 4WQ5C 4DSKA 4EP5A 4A2AA 3NGZA 1QQMA 1KFSA 1WBDA 4J8FA 3M6GA 1LWFA 2ASMA 4F3OA 4YFUA 3GL1A 2IVNA 3CCEN 4KRFA 2YKNA 4O4GA 4C23A 4NCBA 1QZ6A 5I3UA 3OYIA 2V51B 2ZD1A 3KD1E 3KKRA 1RTIA 4IFEA 4E7IA 4BR7A 3AVIA 4DV5K 2A41A 3V9UA 2HBLA 4CD1A 2P9IA 4BR0A 3NF7A 4GV6A 3HRGA 3T1YK 1YJWN 4CECA 2HF4A 3LM9A 2A5XA 4FZXC 1N5YA 2A3ZA 3DXKA 3VGKA 2E2QA 4FW1A 4CFBA 1H1VA 3I55N 3IFRA 4JKDA 3VESA 1XMOK 4HUGA 4DUZK 4FWRA 2GX9A 2Z1IA 3WXIA 1NGBA 2H3GX 3D45A 3ZLJA 4Y0WA 1ZBSA 1S1WA 4CEOA 1CXUA 4CJEA 4DQSA 5E26A 2G8IA 3HXMA 2ITMA 1FJGK 4YDUC 2O4IA 3O8MA 4B1XB 3W0LA 4O0JA 1NK0A 4DU1A 1IG8A 4KAZA 5M1KA 3AA2A 3LALA 4ISFA 3NCIA 1SAZA 4JRPA 4RW8A 3SAGA 4LF8K 3PY8A 1E4FT 3AVLA 4H5VA 4JK7A 2JLEA 3CMEN 3S41A 3VEZA 3U8XA 5BPLA 2OA8A 3CC7N 3CI5A 1JLBA 1HNIA 1K8AO 2HVIA 3FLCO 1NJWA 3C94A 3E66A 5CZ1A 3CD6N 4DR4K 4GKJK 3DXKB 2ZGYA 3B6OA 3M5RA 3LZIA 5AQVA 3FZHA 1WN7A 4FK0A 3BEXA 4QAGA 3MAQA 4FK4A 4CK2A 2CH6A 5JMVA 3ZSYA 4CJQA 4DQIA 5EU7A 4RW6A 4B9VA 3SUPA 3S9HA 4M7XA 1RT2A 1SV5A 4FWOA 4LF6K 1NGJA 1RBVA 4KHWA 1OVYA 2YNIA 3RR7A 4I6MB 3NF6A 1TL3A 1QVFM 1U2VA 3CPWM 3H3OB 1C0MA 3I8BA 4JRQA 4DFKA 2YNGA 4DSJA 4JS4A 4M63C 1IJJA 4B1VA 1ZBLA 5BPMA 3PIOL 4J2EA 4MLHA 3OS1A 4AHUA 2UXCK 5CYMA 4IZ9A 4CHQA 3OYEA 4DS5A 4KI4A 1BG3A 3TAPA 4CGGA 4FLWA 1C0UA 1S1XA 3HP6A 3KHYA 2DFEA 4IWVA 2QI2A 3LM2A 5FPDA 1HLUA 3ALYA 2BGGA 1HJRA 4CIGA 3VETA 3ID6A 1M90O 1KSPA 3OY9A 1QVGM 2PZSA 1BQNA 1HPMA 4CBWA 5AQLA 4OKEA 3OTOK 4MO5A 3W3DA 4BE2A 2G8KA 1XC3A 5FLXO 5HLFA 2QTDA 3V1QA 2A42A 1KQSM 4B9LA 4JHDA 3VN5A 3VQEA 1TKZA 4CIEA 1RDWX 4JI6K 1U2VB 1TUUA 4BRFA 3S3NA 3NF9A 4JKHA 4QS9A 3THYB 2JGUA 3EZ5A 2B4JA 3V4IA 3P83D 1YI2N 2OPPA 5KGWA 4CE9A 3OHRA 5CY4A 3CM5A 1XUPO 4BC3A 3CQ8A 5I9EB 4AF1A 1BO5O 2RF2A 3CF5L 2RN2A 1TK8A 3AA4A 2QM1A 2F8TA 1RBTA 5IT9O 1YXQA 1LW0A 1P90A 2IC3A 3WNFA 2E4LA 3KVGA 3ZX0A 3AO3A 3ULDA 2HNYA 2NRHA 1HPZA 3IUCA 3M8PA 4OPJA 3HPGA 3MX5A 3M8RA 1WOQA 2W6KA 1XHZA 4BE0A 4H4MA 3BZCA 5LJWA 2HNDA 4JKBA 1N34K 4FJKA 2QWMA 1KXPA 2E20A 4EAHD 4M3ZA 1YVUA 3DM2A 3HBTA 4JHDB 5J2MA 4KH5A 1NJIO 1RT1A 4BRPA 4DV1K 3QDKA 5KPRA 3I8DA 1DLOA 3L2QA 3LDQA 4IG0A 3ZSQA 4ISGA 5BR9A 4FJ5A 3CJ1A 2O8FA 1X9WA 4NLCA 5H1SQ 4AHTA 4JEPA 1SUQA 4BWJA 3F5TA 3EL2A 3ZSRA 4G9ZA 3F73A 3HVRA 4Z4FA 2YNHA 4H0OA 3CFRA 1YF5L 4H8KA 5AFUH 5C15A 2KW4A 2YJEA 1U04A 3QMLA 1YJNN 3I56N 4IOXA 4NYNA 3O80A 4AHSA 3EKUA 4CHNA 3CCRN 3MN9A 4FLVA 4K43A 1NOYA 4ELUA 1L3VA 3DLKA 3L6QA 1QS4A 4BDZA 1XQSC 3J7AP 2KFNA 1C0TA 3KK1A 3P31A 3SUOA 4M3YA 2X78A 4FVMA 4DR5K 4FWPA 1C6VA 3K58A 1VQ6N 4B1YB 2O8FB 3VQDA 3O9QA 4BC2A 3D6RA 1ZBIA 5FRMA 2E2PA 4MQ3A 5AQSA 1SS6A 1MDUB 4N5SA 1WNSA 2B6AA 3J8AA 3UKRA 4R5PA 3LAMA 4JYAK 5C2DA 1EQYA 4IFVA 1LAWA 3SQ1A 5B8HA 1LAVA 3IMXA 2J4RA 3VTIA 3VQ6A 2IIRA 5C42A 3H1QA 4QOZB 2WFBA 3M3ZA 3EN9A 4O0IA 1W97L 4CZKA 3KLHA 3TSPA 4FJIA 3VGMA 4K8ZA 4OLBA 1S1UA 4O8KA 5EX5A 4FLUA 3L2WA 4IOAL 2DPNA 2FLOA 4E7HA 3OJUA 3B8AX 2HOEA 3CQYA 3OYDA 1DTTA 1TK0A 1VQ7N 1VQLN 3FZFA 2UUAK 2P9UB 3BDPA 1HNWK 5LMNK 4W5TA 3HOSA 3CMAN 2R7YA 3PSIA 1JLAA 1M1KO 1D8YA 1TKDA 1IKVA 2IVPA 2KQ2A 5C24A 4BR4A 2X6NA 4HWIA 3UKUA 4RCHA 2Q1NA 5AFUA 1VQON 4HVJA 3MN7A 1XMQK 4KTZA 4DV0K 4NCAA 1P8ZA 1Q82O 5HOOA 2E2OA 3D2FA 1RBRA 1D5AA 2EX3A 3A8YA 3P38A 4JK8A 3MCPA 2XY8A 2VCPA 4CJVA 4CHPA 1WSEA 2QWPA 2Q0UA 4FJHA 2P5GA 4CEDA 4XH4A 3KTQA 4DQPA 3NMUA 3VQQA 4JI1K 4KTWA 3G0ZA 4FWNA 4CZFA 4FVUA 4EHUA 3H45C 1UA0A 4C8LA 5LJVA 1A5VA 5HBMA 3V6DA 1E3MA 2ZGZA 3CCQN 2P9PA 3FZKA 4IOCL 3QIPA 4PKGA 4JK9A 4WFNL 1A5XA 5AQTA 5M1OA 2VG6A 1ASVA 2P9SB 1NKCA 1HYZA 4DTSA 4KHQA 3QICA 4MDBA 4XIUA 2XY6A 2QW9A 2D0PA 5DK5A 1HUXA 4K0KK 4YOXA 1RILA 4JD2A 4BDPA 3HJFA 1ATNA 3O1WA 4AH9A 2ZM6K 5HL7L 1RDUA 2VYPA 4DR2K 4C8NA 3QNOA 1RTJA 1GOCA 3AA5X 3K5NA 2DFHA 4BC4A 4E0DA 4N41A 1OKJA 1S72N 3A5NC 2PYJA 1MA9B 4B9TA 2Z1JA 4DR6K 3CIPA 2ZJRL 5GAGP 3UE5A 1YUWA 2NRTA 1B92A 4BROA 1S6QA 1W0HA 3E9PA 4CF9A 3HTVA 3VMFB 5LY3A 1Z25A 4NLBA 1TKTA 3TAGA 3LL3A 4FJLA 5AQKA 3SQ2A 1NGDA 3ZX3A 4NYFA 3K9JA 5KRTA 3MWPA 4CEFA 1JLCA 3DLGA 3DLEA 3ISNC 4JD2B 3G10A 4IKFA 4Z4EA 1RCHA 4U7BA 3ENHA 1C1CA 4FJMA 5GAHP 3QINA 4DTRA 4RW4A 5ELZA 1LOTB 3MEGA 4ILGB 1IV0A 5DMRA 1X3MA 3OYKA 2OYQA 4CJUA 3DLLL 4FXDA 4FJNA 4IJNA 4DQQA 4KV8A 5BN8A 3EY1A 2HBJA 3LANA 3OYHA 1L3TA 1OH8A 4CF0A 1HNXK 5EOYA 1HKCA 4DF8A 2RHKA 2NRVA 3D0PA 4X66K 1KAYA 4FYDA 4CJTA 5EXWA 4J2DA 3QERA 1NWKA 2WTUA 1S9EA 4BRLA 3OYMA 1VSMA 2Q31A 4CEBA 1J5EK 3NH0A 4BACA 4IO9L 3KK7A 2GWKA 2IOCA 1SZ2A 4FZZA 4LD0A 4JKCA 5LMUK 3C6TA 4BR2A 3KLEA 3GOIA 4PHTX 1NOZA 3NGIA 1XWLA 3KK2A 2QKKA 2O8EA 4HTLA 1GLAG 2CGJA 1SL0A 1DTQA 1LWEA 1BI4A 1S3XA 1YTAA 2IAJA 2I7PA 4W5NA 5FPNA 3BF1A 3VGLA 3VQPA 1SL1A 4FWLA 4A5BA 1Z05A 4CGJA 3RMCA 2HHQA 4E7KA 3MN6A 1NK4A 2DTUA 1FKOA 4B9SA 2BH1A 1NGIA 3LP2A 3PX6A 4CJ4A 3AO1A 3CJ7A 5AQYA 4CZGA 3DLHA 1TUYA 2WUSA 4Z4GA 1JCFA 3IDHA 3SBTA 3Q7BA 3QO9A 4KO0A 2Z1HA 3U9DA 2QXLA 2RE2A 2Q3SA 2V7YA 3SLCA 4DV7K 1DKGD 5KQDA 1SKRA 1I94K 2D0CA 4DV4K 4BQLA 1KCFA 1T05A 2HHWA 4M42A 1GLBG 4CF1A 4CK1A 1MWMA 1LW2A 1BI4B 2NZTA 3J7ZO 1RT3A 4M3TA 3FE1A 4WE1A 2VWBA 4NXMK 1UOCA 4A2BA 3N4PA 1ZBFA 3MCAB 4XH1A 3O5BA 3FR0A 1IBLK 3GDQA 4CZLA 1N36K 2B5JA 3NAEA 3SMPA 4X64K 4H0XB 2HHHK 2VQEK 4B1WB 3RWUA 2RKIA 4FWQA 3VEWA 2NNWA 3NVMA 2YV0X 4DR1K 3SV4A 3K9KA 3OYGA 4BR5A 3OYFA 5KGXA 4CJRA 2QWNA 3KLGA 5AQRA 4KI6A 3AAQA 5CZ2A 3NFAA 1V4TA 2D0OA 2P9IB 5BN9A 4F3TA 5EY4A 1CLQA 1J6ZA 5AZIA 3TSQA 1NJZA 4OO1J 3S3OA 3N4QA 3QEWA 2QKBA 3WNEA 1WSJA 1UWBA 4CFAA 2ZJPL 3KZBA 3QETA 4JNEA 1Q81O 2PAVA 2A1SA 5GINA 1TGOA 4NCGA 3WXMB 1R59O 4BRHA 2WBNA 3SAFA 4JI3K 2P1JA 4XH5A 3VTHA 4DHYA 3VQ5A 1YAGA 4I9LA 4CEQA 2FBTA 3A2FA 3C7NA 4DLGA 1BA0A 1E4GT 3C0BA 5AQWA 5CHIA 5JS1A 4C8MA 2P9LA 3SUQA 4OPHA 2JWLA 2QWLA 2BUPA 4CZHA 1I3AA 1NU0A 3P5JA 1O1WA 2UU9K 1FW6A 3KIOA 1XHXA 4BWMA 5AZIB 3VQ4A 4ZTFA 4RWTA 1N6QA 4C1NI 1RT4A 3U4LA 1VRTA 3CJAA 3BF3A 4K41A 3CFPA 4F4KA 4CJLA 3TAEA 4HUFA 4M7YA 3L3UA 4YORA 2OANA 1Y64A 5AJ3K 2YHWA 3FZLA 3C65A 3NH1A 5M1PA 2ATQA 2ETJA 1BUPA 1A5WA 4ELTA 1ZBUA 1EWQA 1HNZK 4ILHA 4B8AB 1C1BA 3U6FA 3C7NB 1JLFA 1L3SA 3EZWA 3ITHA 1JLQA 2NRWA 4RW9A 4F2SA 4KH6A 4L3QA 2OZMA 5AQPA 4E3SA 2LSNA 4LY7A 4H0PA 1QHTA 4IXCA 1QSSA 1GLCG 2HHUA 4KH4A 4CESA 2G8FA 4DCHA 3MK6A 4GW6A 4DSLA 3OYLA 3THWA 5KI6A 4OLAA 3AVNA 4B9UA 1WUAA 2OPSA 1X9SA 3DLBA 3RRGA 1K8KA 4CZEA 3KLFA 3QEVA 1Q86O 2X74A 3JXUA 1BIUA 3RMDA 1QQNA 1XNQK 3RSEA 2ZJQL 4CGHA 1BWFO 1NMNA 3CC4N 1RDBA 4BGAA 1VSEA 3SBGA 3L8BA 3MEEA 4BRKA 3DI6A 4BRQA 2ZQBA 4KHSA 4CZIA 5GIPA 4CERA 5FDLA 1BA1A 3H1VX 1HR0K 1ASWA 4BRMA 3ZCMA 1NJXA 1VQ4N 3U9ZA 4LSNA 5F1XA 4DTUA 4HCBA 3O4NA 3LDOA 2G8VA 1T6DA 3BZKA 3IKMA 1OH6A 2D5RA 2VWJA 1Z6RA 5M1NA 4H5NA 1EXQA 2V52B 1K8KB 3G71N 1T8EA 5J2PA 4DB3A 3ZSWA 2ASPA 3P39A 4KPYA 2O8CA 3TABA 1OVQA 3ATUA 3VQ7A 2FXUA 3NGYA 3L0QA 3CCLN 3RSEB 3E01A 3LDSA 3V1OA 1NM1A 2NRRA
chains in the Genus database with same CATH topology
3E9LA 4JK9A 1SQKA 3BP8A 4YOUA 4IEEA 4WFNL 4YDUA 2QWQA 3HSCA 5AQTA 5M1OA 3O4WA 2P9SB 1Q18A 3ENOA 4A59A 2D4WA 1ILYA 3QICA 4MDBA 4A62A 4WQ5C 1N8RO 2QW9A 2D0PA 1HKBA 4A2AA 1HUXA 1QQMA 4YOXA 3TSUA 1S22A 4FOIA 4JD2A 1K73O 4J8FA 3M6GA 3CJ9A 5BRHA 4UY8O 1ATNA 1NGHA 3O1WA 3ZEUA 3VEVA 4WFAL 2ASMA 5HL7L 3GL1A 4KBOA 1RDUA 2IVNA 4BREA 2VYPA 1K9MO 3CCEN 2FSKA 4WCEL 1HX1A 4C23A 4BC4A 3MDQA 1QZ6A 3VPZA 1NGAA 4YOYA 1OKJA 1S72N 2V51B 1KC8O 3O08A 3A5NC 3CCMN 1MA9B 2OTJN 4IFEA 4BR7A 2GWJA 5AQOA 2P9LB 3Q7CA 3SAHA 2A41A 3FGUA 2HBLA 3CIPA 2ZJRL 5GAGP 3UE5A 4CD1A 1YUWA 2P9IA 1DGKN 2NRTA 4BR0A 4GV6A 4BROA 3HRGA 1YJWN 2HF4A 3LM9A 2A5XA 3E9PA 3VF6A 2A3ZA 3DXKA 3HTVA 2E2QA 3FZMA 3VGKA 3VMFB 4BQZA 4CZMA 5KPTA 5LY3A 1H1VA 4BY9C 3I55N 3IFRA 4NLBA 3VEOA 2FF6A 2NRXA 2E8AA 2KHOA 3HM8A 4JKDA 3VESA 1DEJA 3LL3A 5AQKA 1NGDA 4BGBA 4WYBA 3ZX3A 4FWRA 2GX9A 5CR4A 4BRNA 5JVGL 5BREA 1V4SA 3K9JA 3WXIA 1NGBA 5TKWA 2H3GX 3MWPA 4Y0WA 3T7ZA 1YJ9N 1VQNN 1ZBSA 3D2EA 5KQ8A 4JD2B 4E1JA 4FWMA 5E26A 5GADP 4OPAA 2ITMA 4YDUC 4U7BA 3O8MA 2YI1A 1GLEG 2PFUA 3ENHA 4LC9B 3W0LA 3O1BA 4B1XB 5GAHP 1TYQA 1IG8A 4JAXA 5M1KA 2HF3A 4K25A 4ISFA 2A6AA 4FPAA 4WQ5A 1SAZA 3UKRB 5ELZA 3SAGA 4BR9A 1LOTB 3LDNA 3TU5A 4ILGB 1E4FT 3MX2A 1X3MA 4H5VA 4JK7A 3CMEN 3S41A 2YJFA 3U8XA 3MN5A 3VEZA 5BPLA 4ISEA 5C2FA 2P9KA 3CI5A 3VEXA 3WQTA 3GE1A 3DLLL 1KD1O 3CC7N 3QBWA 1NGFA 4IJNA 5AR0A 2E2NA 3G25A 3VF4A 3M1FA 4YOWA 5BN8A 4A57A 1T44A 3L4QA 1K8AO 3FLCO 2HBJA 5AQQA 4Z94A 3E66A 3CD6N 5EOYA 1HKCA 4MLEA 3DXKB 2VGNA 2ZGYA 4CD3A 5BPNA 2RHKA 2NRVA 3M5RA 3QFPA 5E84A 5C12A 1ZXOA 5AQVA 3FZHA 4BG8A 3A0IX 1GLDG 1KAYA 4ILJA 4BG9A 1RFQA 5BRDA 3BEXA 5EXWA 3CERA 3SK3A 3HOTA 3OBYA 3CETA 4A61A 1NWKA 3A5OC 4CJ7A 3D2EB 3LDLA 4BRLA 3D7EO 3P4IA 2Q31A 2CH6A 3MMVA 5JMVA 4GVEA 2CGKA 5M1QA 2CH5A 4IO9L 1TYQB 3EE8A 3KK7A 3TTFA 2GWKA 4BVOA 4WF9L 4M7XA 4NB4A 1SZ2A 3CPEA 4B1UB 4FWOA 1JCEA 2GEMA 1NGJA 4JKCA 5TKYA 1OVYA 1VQ9N 4BR2A 3GOIA 4I6MB 4PHTX 3VENA 1QVFM 1U2VA 2ZF5O 3CPWM 3H3OB 4HTLA 3I8BA 3EKSA 1GLAG 1YVNA 2CGJA 3UKUB 1VQKN 2ASOA 2P9KB 1IJJA 4FSVA 4M63C 4B1VA 4CBUA 2FF3B 1S3XA 5BPMA 3PIOL 4MLHA 1QZ5A 2I7PA 3CHWA 1VQ8N 1HKGA 3KWIA 4IZ9A 5FPNA 3BF1A 3VGLA 4QS8A 2Q97A 2KLAA 1BU6O 4U67L 2A40A 4FWLA 4H5WA 4DQ8A 4A5BA 1BG3A 1Z05A 3D2FB 4GNIA 3MN6A 3G6EN 3KHYA 1QHAA 4IWVA 2QI2A 3LM2A 5FPDA 3R8EA 1HLUA 2BH1A 3VEYA 3R9PA 2Q2RA 1NGIA 4H0YB 3WXKA 4H5TA 4GV3A 3PLAA 3VETA 3ID6A 2Q0RA 1M90O 3CJ7A 5AQYA 4BRAA 2W41A 3E9OA 1QVGM 4CZGA 1TUYA 2WUSA 4GY2B 1JCFA 3IDHA 1HPMA 4CBWA 3SBTA 3DXMA 3Q7BA 4H0TB 5JICA 2P9UA 5AQLA 3SJHA 5M1FA 5AQUA 4MO5A 3W3DA 4YOTA 1XC3A 2QXLA 3U9DA 2RE2A 2P9PB 2QTDA 4B1ZA 1VQPN 2V7YA 4NO7A 3SLCA 4WFBL 5AQXA 2A42A 1KQSM 1DKGD 5KQDA 4BRIA 4PKIA 2FSJA 4JHDA 1ATRA 3DJCA 4FO0A 4BQLA 4EHTA 2GUPA 1RDWX 2NRZA 3VERA 1U2VB 1GLBG 1TUUA 3EE9A 3CQXA 4BRFA 3WEEA 4QS9A 4JKHA 1MWMA 5AQZA 4QS7A 2NZTA 2BTFA 2NLXA 3J7ZO 3FE1A 3OW2M 2VWBA 1YI2N 4A2BA 5JVHL 1NGCA 3N4PA 3OHRA 2V7ZA 2HBMA 3TPQA 4WQ4C 4F9OA 4JN4A 2PBDA 1XUPO 3MCAB 4XH1A 1CZAN 3O5BA 3ZEUB 3F2KA 4BC3A 5AZJA 3FR0A 5I9EB 3AY9A 3GDQA 4AF1A 4CZLA 4CZJA 2F9TA 1BO5O 3I33A 3SMPA 3CF5L 2GELA 4H0XB 5FPEA 2QM1A 4B1WB 3TTCA 1NLVA 4FWQA 2NNWA 3NVMA 4FWSA 3VEWA 1YXQA 1KAXA 1P90A 3K9KA 3CC2N 4BR5A 2QWRA 3WQUA 3GBTA 5F2RA 2QWNA 3KVGA 1G99A 5DM6L 5AQRA 3ZX0A 1GLFO 3AGKA 2NRHA 3AAQA 4C1NK 3DXMB 2P9NA 3IUCA 1V4TA 2D0OA 2P9IB 1WOQA 3MX5A 5BN9A 3O9TA 5LJWA 3O9UA 5MLCQ 4IJAA 2OTLN 4JKBA 2QWMA 1KXPA 4BRDA 3AGRA 2QWOA 4MDAA 1ZC6A 2E20A 4EAHD 5EY4A 1J6ZA 3HBTA 3LDPA 5AZIA 3OBWA 4JKAA 3TSQA 4JHDB 3WXJA 4OO1J 4KH5A 1NJIO 2P9SA 5AQFA 4FL9A 1T6CA 3N4QA 4BRPA 3QDKA 5DM7L 5KPRA 1X9JA 5AQNA 3LDQA 4FPBA 3TTDA 1U6ZA 3KWGA 2UYTA 4ISGA 3KZBA 2ZJPL 5BR9A 1VQ5N 3CJ1A 4PL7A 4JNEA 4AM7A 1Q81O 2PAVA 5C10A 4NLCA 5GINA 2D1KA 5H1SQ 4JEPA 2GTDA 3WXMB 3NVKA 3F5TA 1R59O 4B9QA 4BRHA 1D4XA 3EL2A 2WBNA 3SAFA 4G9ZA 3ID8A 3OA9A 4XH5A 3VTHA 4DHYA 4H0OA 1YAGA 4BC5A 1C0GA 1YF5L 1RGIA 3C7NA 3GG4A 4EIAA 1BA0A 4WQ4A 5AFUH 4BVPA 5C15A 1E4GT 3C0BA 4O8UA 5AQWA 5CHIA 4JKGA 2YJEA 3RVCA 3R6MA 2P9LA 4K42A 3DAWA 3QMLA 5GIOA 1GLLO 4YOVA 3I56N 1YJNN 5BRFA 3ENBA 2ZWHA 4OPHA 2JWLA 4IOXA 2P9NB 3O80A 3EKUA 3CCRN 3MN9A 2QWLA 2BUPA 4CZHA 3CCJN 4K43A 3VOVA 2CGLA 2F9WA 3L6QA 2YX6A 1XQSC 1C0FA 2E88A 5AZIB 4BRCA 3P31A 4RWTA 2EWSA 2HSTA 1BOTO 4C1NI 2QEXN 3U4LA 5KPZA 3CJAA 4AM6A 3BF3A 4K41A 3DWLA 1VQMN 4FWPA 3QFUA 1VQ6N 5C0YA 3O6WA 3VF2A 1GLJO 5CE3A 4M7YA 2AA4A 4YORA 2OANA 1Y64A 4IDHA 3QB0A 3ZX2A 4B1YB 1VAZA 2YHWA 3FZLA 3O9QA 4BC2A 3C65A 3D6RA 5M1PA 3AAPA 3HZ6A 2E2PA 3CCVN 4BRGA 5AQSA 1SS6A 2W40A 5EVZA 1MDUB 1BUPA 1JCGA 5ADXH 3HI0A 3J8AA 3UKRA 4ILHA 3H3NO 2KKZA 5C2DA 1EQYA 3C7NB 3EZWA 5AQGA 3WT0A 4DKWA 3G4SN 2NRWA 5B8HA 1EO1A 2I7NA 3CXCM 4FOEA 3ATVA 3IMXA 4JKGB 1LCUA 2J4RA 3O9SA 3VTIA 1NMDA 2IIRA 3H46O 4FWKA 4KH6A 1MWKA 4L3QA 3H1QA 5AQPA 4CI6A 2VGMA 4R79A 2WFBA 3M3ZA 3EN9A 2Q36A 1NBWA 4H0PA 5AQMA 1W97L 4IXCA 3ZETA 1GLCG 4CZKA 2FSNA 4KH4A 3TSPA 1YITN 3EO3A 4DCHA 3A5LC 3MK6A 3WXLA 3VGMA 4JKEA 4O8KA 5EX5A 5GAEP 2YHYA 1WUAA 1NGGA 3O9RA 3R3LA 1O13A 3ULEA 4IOAL 2DPNA 4RTFD 2FLOA 3CCSN 2F7TA 3A5MC 1JJ2M 1K8KA 3B8AX 5AQHA 4CZEA 2HOEA 3CQYA 4H03B 4XEIA 1VQ7N 2HBKA 4H0VB 1VQLN 1Q86O 4PL8A 3FZFA 3JXUA 4CBXA 2P9UB 1QQNA 3HOSA 3CMAN 3RSEA 2ZJQL 3CC4N 1BWFO 5AQJA 5AQIA 4A5AA 1M1KO 2JWKA 2IVPA 4BGAA 3C6AA 3CJCA 4I6MA 3SBGA 4IEIA 1QQOA 4BR4A 3JS6A 4HWIA 4BRKA 2IVOA 3UKUA 4RCHA 2QA4N 2Q1NA 5AFUA 1T3VA 3F9MA 1VQON 3WEEB 3MN7A 3E1YA 2YCHA 4BRQA 4EFHA 3CJBA 4CZIA 1ESVA 5F0XA 5GIPA 2HMPA 5JLFA 1P8ZA 4O5FA 1Q82O 1BA1A 2WC9A 5HOOA 1W2BM 1HJOA 2E2OA 2E1ZA 3AARA 3H1VX 3D2FA 4BRMA 1Q7YO 3A8YA 2AP1A 3P38A 3QBXA 4JK8A 3U9ZA 3ZETB 3MCPA 5F1XA 1VQ4N 3R1XA 2VCPA 5JLHA 4PKHA 5AZJB 3WUHA 1BDGA 2QWPA 3LDOA 2Q0UA 3H6EA 1T6DA 4XH4A 3FFKB 3IKMA 1KAZA 3NMUA 4JKFA 3SMSA 1Z6RA 4MO4A 3CCUN 5M1NA 2E1YA 4H5NA 3ULEB 1NGEA 4GV9A 3BUZB 4FWNA 1DT9A 2V52B 1K8KB 4CZFA 5FPMA 1YHQN 3C6HA 3G71N 3T69A 4FVUA 4EHUA 4H5RA 2YHXA 4IO8A 3H45C 2ASPA 3P39A 3UB5A 4DB3A 5LJVA 3ATUA 3L4IA 2FXUA 2ZGZA 3L0QA 3CCQN 2P9PA 5ADXA 3FZKA 3RSEB 1X3NA 3PIPL 4IOCL 1YIJN 3CCLN 3MWTA 1NM1A 2NRRA 1ATSA 4PKGA 3ZYYX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQK A;  3BP8 A;  4YDU A;  2QWQ A;  3HSC A;  5AQT A;  3O4W A;  2P9S B;  1Q18 A;  3ENO A;  2D4W A;  3QIC A;  4A62 A;  4WQ5 C;  2QW9 A;  2D0P A;  1HKB A;  4A2A A;  1HUX A;  1QQM A;  1S22 A;  4FOI A;  4JD2 A;  4J8F A;  3M6G A;  3CJ9 A;  5BRH A;  1ATN A;  1NGH A;  3O1W A;  3ZEU A;  3VEV A;  2ASM A;  3GL1 A;  4KBO A;  4BRE A;  2IVN A;  2VYP A;  2FSK A;  1HX1 A;  4C23 A;  4BC4 A;  3MDQ A;  1QZ6 A;  3VPZ A;  1NGA A;  1OKJ A;  2V51 B;  3O08 A;  3A5N C;  1MA9 B;  4BR7 A;  2GWJ A;  5AQO A;  2P9L B;  2A41 A;  3FGU A;  3CIP A;  3UE5 A;  4CD1 A;  1YUW A;  2P9I A;  1DGK N;  4BR0 A;  4BRO A;  2HF4 A;  3LM9 A;  2A5X A;  3VF6 A;  2A3Z A;  3DXK A;  3HTV A;  2E2Q A;  3FZM A;  3VGK A;  4CZM A;  4BQZ A;  5KPT A;  5LY3 A;  1H1V A;  3IFR A;  3VEO A;  2FF6 A;  3HM8 A;  2E8A A;  2KHO A;  3VES A;  1DEJ A;  3LL3 A;  5AQK A;  1NGD A;  4BGB A;  4WYB A;  3ZX3 A;  4FWR A;  4BRN A;  5BRE A;  1V4S A;  3WXI A;  1NGB A;  2H3G X;  4Y0W A;  1ZBS A;  3D2E A;  5KQ8 A;  4JD2 B;  4E1J A;  4FWM A;  5E26 A;  2ITM A;  4YDU C;  3O8M A;  2YI1 A;  1GLE G;  3ENH A;  4LC9 B;  3W0L A;  4B1X B;  3O1B A;  1TYQ A;  1IG8 A;  4JAX A;  2HF3 A;  4K25 A;  4ISF A;  2A6A A;  4FPA A;  4WQ5 A;  1SAZ A;  3UKR B;  5ELZ A;  4BR9 A;  1LOT B;  3LDN A;  3TU5 A;  1E4F T;  1X3M A;  4H5V A;  3S41 A;  2YJF A;  3U8X A;  3MN5 A;  3VEZ A;  5BPL A;  4ISE A;  2P9K A;  3CI5 A;  3VEX A;  3WQT A;  3GE1 A;  3QBW A;  1NGF A;  4IJN A;  5AR0 A;  2E2N A;  3G25 A;  3VF4 A;  3M1F A;  5BN8 A;  1T44 A;  3FLC O;  5AQQ A;  4Z94 A;  5EOY A;  1HKC A;  4MLE A;  3DXK B;  2ZGY A;  4CD3 A;  5BPN A;  3QFP A;  5E84 A;  1ZXO A;  5AQV A;  3FZH A;  4BG8 A;  3A0I X;  1GLD G;  1KAY A;  4BG9 A;  1RFQ A;  5BRD A;  3BEX A;  5EXW A;  3CER A;  3SK3 A;  3CET A;  4A61 A;  1NWK A;  3A5O C;  4CJ7 A;  3D2E B;  3LDL A;  4BRL A;  3D7E O;  3P4I A;  2Q31 A;  2CH6 A;  3MMV A;  5JMV A;  2CGK A;  2CH5 A;  1TYQ B;  4BVO A;  2GWK A;  4M7X A;  4NB4 A;  1SZ2 A;  4B1U B;  4FWO A;  1JCE A;  2GEM A;  1NGJ A;  5TKY A;  4BR2 A;  3GOI A;  4I6M B;  3VEN A;  1U2V A;  2ZF5 O;  3H3O B;  4HTL A;  3I8B A;  3EKS A;  1GLA G;  1YVN A;  2CGJ A;  3UKU B;  2ASO A;  2P9K B;  1IJJ A;  4FSV A;  4M63 C;  4B1V A;  4CBU A;  2FF3 B;  1S3X A;  5BPM A;  4MLH A;  1QZ5 A;  2I7P A;  3CHW A;  1HKG A;  4IZ9 A;  5FPN A;  3BF1 A;  3VGL A;  4QS8 A;  2Q97 A;  1BU6 O;  2A40 A;  4FWL A;  4H5W A;  4DQ8 A;  1BG3 A;  1Z05 A;  3D2F B;  4GNI A;  3MN6 A;  3KHY A;  1QHA A;  4IWV A;  5FPD A;  3LM2 A;  3R8E A;  1HLU A;  3VEY A;  3R9P A;  2Q2R A;  1NGI A;  4H0Y B;  3WXK A;  4H5T A;  3VET A;  2Q0R A;  3CJ7 A;  5AQY A;  4BRA A;  2W41 A;  4CZG A;  1TUY A;  2WUS A;  4GY2 B;  1JCF A;  3IDH A;  1HPM A;  4CBW A;  5JIC A;  3DXM A;  4H0T B;  2P9U A;  5AQL A;  3SJH A;  5AQU A;  4MO5 A;  3W3D A;  1XC3 A;  2QXL A;  3U9D A;  2P9P B;  4B1Z A;  2V7Y A;  4NO7 A;  3SLC A;  5AQX A;  2A42 A;  1DKG D;  5KQD A;  4BRI A;  4PKI A;  2FSJ A;  4JHD A;  1ATR A;  3DJC A;  4FO0 A;  4BQL A;  4EHT A;  2GUP A;  1RDW X;  3VER A;  1U2V B;  1GLB G;  1TUU A;  3CQX A;  4BRF A;  3WEE A;  4QS9 A;  1MWM A;  5AQZ A;  4QS7 A;  2NZT A;  2BTF A;  2NLX A;  3FE1 A;  2VWB A;  4A2B A;  1NGC A;  3OHR A;  2V7Z A;  3TPQ A;  4F9O A;  4WQ4 C;  4JN4 A;  2PBD A;  1XUP O;  4XH1 A;  1CZA N;  3O5B A;  3ZEU B;  4BC3 A;  5AZJ A;  3FR0 A;  5I9E B;  3AY9 A;  3GDQ A;  4CZL A;  4CZJ A;  2F9T A;  1BO5 O;  3I33 A;  3SMP A;  2GEL A;  4H0X B;  5FPE A;  2QM1 A;  4B1W B;  1NLV A;  4FWQ A;  4FWS A;  3VEW A;  1YXQ A;  1KAX A;  4BR5 A;  2QWR A;  3WQU A;  3GBT A;  5F2R A;  2QWN A;  3KVG A;  1G99 A;  5AQR A;  3ZX0 A;  1GLF O;  2NRH A;  3AAQ A;  3DXM B;  2P9N A;  3IUC A;  1V4T A;  2D0O A;  2P9I B;  1WOQ A;  5BN9 A;  5LJW A;  4IJA A;  2QWM A;  1KXP A;  4BRD A;  2QWO A;  1ZC6 A;  2E20 A;  4EAH D;  5EY4 A;  1J6Z A;  3HBT A;  3LDP A;  5AZI A;  3WXJ A;  4JHD B;  2P9S A;  5AQF A;  4FL9 A;  1T6C A;  4BRP A;  3QDK A;  5KPR A;  1X9J A;  5AQN A;  3LDQ A;  4FPB A;  1U6Z A;  2UYT A;  4ISG A;  3KZB A;  5BR9 A;  3CJ1 A;  4PL7 A;  4JNE A;  4AM7 A;  2PAV A;  2D1K A;  2GTD A;  1R59 O;  4B9Q A;  4BRH A;  1D4X A;  3EL2 A;  3ID8 A;  4XH5 A;  4DHY A;  4H0O A;  1YAG A;  4BC5 A;  1C0G A;  3C7N A;  1RGI A;  3GG4 A;  4EIA A;  1BA0 A;  4WQ4 A;  5AFU H;  4BVP A;  1E4G T;  3C0B A;  5AQW A;  2YJE A;  3R6M A;  2P9L A;  4K42 A;  3DAW A;  3QML A;  1GLL O;  5BRF A;  2ZWH A;  2P9N B;  3O80 A;  3EKU A;  3MN9 A;  2QWL A;  2BUP A;  4CZH A;  4K43 A;  3VOV A;  2CGL A;  2F9W A;  3L6Q A;  1XQS C;  1C0F A;  2E88 A;  5AZI B;  4BRC A;  4RWT A;  2EWS A;  1BOT O;  3U4L A;  5KPZ A;  3CJA A;  4AM6 A;  3BF3 A;  4K41 A;  3DWL A;  4FWP A;  3QFU A;  3O6W A;  3VF2 A;  1GLJ O;  5CE3 A;  4M7Y A;  2AA4 A;  2OAN A;  1Y64 A;  3ZX2 A;  3QB0 A;  4B1Y B;  2YHW A;  3FZL A;  4BC2 A;  3AAP A;  3HZ6 A;  2E2P A;  4BRG A;  5AQS A;  2W40 A;  5EVZ A;  5ADX H;  1MDU B;  1BUP A;  1JCG A;  3HI0 A;  3J8A A;  3UKR A;  3H3N O;  1EQY A;  3C7N B;  3EZW A;  5AQG A;  3WT0 A;  5B8H A;  2I7N A;  4FOE A;  3ATV A;  3IMX A;  1LCU A;  2J4R A;  1NMD A;  2IIR A;  3H46 O;  4FWK A;  1MWK A;  4L3Q A;  3H1Q A;  5AQP A;  4CI6 A;  3M3Z A;  3EN9 A;  2Q36 A;  1NBW A;  4H0P A;  5AQM A;  4IXC A;  3ZET A;  1GLC G;  4CZK A;  2FSN A;  3EO3 A;  4DCH A;  3A5L C;  3MK6 A;  3WXL A;  3VGM A;  4O8K A;  5EX5 A;  2YHY A;  1WUA A;  1NGG A;  3ULE A;  2DPN A;  4RTF D;  2FLO A;  3A5M C;  1K8K A;  3B8A X;  5AQH A;  4CZE A;  2HOE A;  3CQY A;  4H03 B;  4XEI A;  4H0V B;  4PL8 A;  3FZF A;  3JXU A;  4CBX A;  2P9U B;  1QQN A;  3RSE A;  1BWF O;  5AQJ A;  5AQI A;  2IVP A;  4BGA A;  3CJC A;  4I6M A;  1QQO A;  4BR4 A;  3JS6 A;  4HWI A;  4BRK A;  2IVO A;  3UKU A;  4RCH A;  2Q1N A;  5AFU A;  3F9M A;  3WEE B;  3MN7 A;  2YCH A;  4BRQ A;  4EFH A;  3CJB A;  4CZI A;  1ESV A;  5F0X A;  2HMP A;  5JLF A;  1P8Z A;  4O5F A;  1BA1 A;  1HJO A;  2E2O A;  2E1Z A;  3AAR A;  3H1V X;  3D2F A;  4BRM A;  3A8Y A;  2AP1 A;  3QBX A;  3U9Z A;  3ZET B;  3MCP A;  5F1X A;  2VCP A;  5JLH A;  4PKH A;  5AZJ B;  3WUH A;  1BDG A;  2QWP A;  3LDO A;  2Q0U A;  3H6E A;  1T6D A;  4XH4 A;  3FFK B;  1KAZ A;  3SMS A;  1Z6R A;  4MO4 A;  2E1Y A;  4H5N A;  3ULE B;  1NGE A;  3BUZ B;  4FWN A;  2V52 B;  4CZF A;  1K8K B;  5FPM A;  4EHU A;  4H5R A;  2YHX A;  4IO8 A;  3H45 C;  2ASP A;  3UB5 A;  4DB3 A;  5LJV A;  3ATU A;  3L4I A;  2FXU A;  2ZGZ A;  3L0Q A;  2P9P A;  5ADX A;  3FZK A;  3RSE B;  1X3N A;  1NM1 A;  1ATS A;  4PKG A; 
#chains in the Genus database with same CATH topology
 3E9L A;  1SQK A;  1NK9 A;  3BP8 A;  5I42 A;  4J2B A;  4YDU A;  4DFM A;  2KZM A;  3HSC A;  3TAQ A;  1Q18 A;  3C95 A;  3ENO A;  4A59 A;  1I39 A;  4CHZ A;  4A62 A;  1N8R O;  1JXE A;  4LH5 A;  3H08 A;  3TSU A;  1S22 A;  4FOI A;  1K73 O;  4M3U A;  3CJ9 A;  1HYS A;  5HRP A;  4WFA L;  3ZEU A;  3MXJ A;  3HST B;  1RTH A;  4KBO A;  4BRE A;  1K9M O;  2UXB K;  4KFB A;  1VSF A;  2F8S A;  4FJ9 A;  3MDQ A;  5HRN A;  3VA0 A;  1NGA A;  1UA1 A;  5FRO A;  4PQU A;  2DY4 A;  4C8O A;  4YHH K;  4IFY A;  2GWJ A;  4RG8 A;  5AQO A;  2E5L K;  3Q7C A;  4E1M A;  2KZZ A;  3ZT4 A;  3LP0 A;  4DTO A;  1SL2 A;  4DV6 K;  3ZT2 A;  2QK9 A;  3AVB A;  4CIF A;  4Z4I A;  4O5B A;  2DFF A;  3DRR A;  3VF6 A;  4BY9 C;  5KPT A;  3QES A;  2FF6 A;  2E8A A;  2KHO A;  1DEJ A;  2BAN A;  4BRN A;  5CR4 A;  5BRE A;  3LPT A;  5TKW A;  3T7Z A;  1YJ9 N;  3D2E A;  3F9K A;  3P1G A;  5J2Q A;  5KQ8 A;  4E1J A;  4FWM A;  5GAD P;  3VQB A;  4GKK K;  1GLE G;  2PFU A;  3O1B A;  1TYQ A;  4JAX A;  3K5M A;  1JLE A;  2F4V K;  2HF3 A;  4K25 A;  4FPA A;  4ZHR A;  3UKR B;  4BR9 A;  3LDN A;  1JKH A;  1J53 A;  3MX2 A;  2XY5 A;  4Y1C A;  4DV3 K;  2GBZ A;  4ISE A;  1KD1 O;  1NGF A;  5AR0 A;  2E2N A;  3SCX A;  3M1F A;  1IKW A;  1S9G A;  4F8R A;  1XI1 A;  1T44 A;  3L4Q A;  5AQQ A;  1VRU A;  1BIZ A;  4Z94 A;  4KHN A;  4MLE A;  1CZB A;  4F2R A;  1YT3 A;  2VGN A;  5BPN A;  3V81 A;  3HPO A;  3QFP A;  5E84 A;  3A0I X;  3HM9 A;  1GLD G;  4ILJ A;  4N47 A;  4BG9 A;  1U4B A;  1RFQ A;  4JI2 K;  5BRD A;  3K59 A;  3CER A;  3HOT A;  3OBY A;  3A5O C;  5SWM A;  4OPK A;  3QEP A;  3D2E B;  3LDL A;  5IWA K;  1TVR A;  3NE6 A;  4GVM A;  3THX A;  4GVE A;  2CGK A;  5M1Q A;  1NK8 A;  3SPZ A;  2CH5 A;  3CG7 A;  4CJF A;  1TYQ B;  3EE8 A;  3CFO A;  4I7F A;  3AVH A;  4CJ5 A;  4NB4 A;  3CPE A;  1NKE A;  1JCE A;  1K6Y A;  1VQ9 N;  4Y1D A;  3VEN A;  4NXN K;  2ZF5 O;  1YVN A;  3UKU B;  2W42 A;  2ASO A;  4DSE A;  2PYL A;  4CF2 A;  4FJG A;  1QZ5 A;  3CHW A;  3KWI A;  1IKY A;  1BU6 O;  4U67 L;  2A40 A;  3TI0 A;  4H5W A;  3D2F B;  3G6E N;  4YNQ A;  4M3X A;  4CHY A;  3VEY A;  3R9P A;  2Q2R A;  4H0Y B;  4M3R A;  4H5T A;  4GV3 A;  4PUO A;  2Q0R A;  5J1E A;  4BRA A;  3E9O A;  4X62 K;  4GY2 B;  3U3Y A;  1NK6 A;  3OJS A;  3DXM A;  1LV5 A;  5M1F A;  3THX B;  1GOA A;  1UAX A;  4OGC A;  3AA3 A;  4YOT A;  2P9P B;  4B1Z A;  4NO7 A;  4WFB L;  1QE1 A;  1IBM K;  4DMN A;  3DJC A;  4EHT A;  2NRZ A;  3VER A;  3ZT0 A;  1Q8I A;  4HTU A;  3WEE A;  1BQM A;  3AVJ A;  4EP4 A;  3V9S A;  3ZSX A;  3KKS A;  5D3G A;  2G8H A;  2BTF A;  3UIQ A;  2NLX A;  4PA1 A;  3OW2 M;  5JVH L;  1NGC A;  1RDA A;  2V7Z A;  2HBM A;  3TPQ A;  4F9O A;  3CM6 A;  1CZA N;  4FLT A;  3F2K A;  5AZJ A;  4EZ9 A;  4PY5 A;  3PO5 A;  3AVC A;  3I33 A;  4CJK A;  5FRN A;  2GEL A;  5FPE A;  1J54 A;  2UXD K;  2HB5 A;  1NLV A;  1KAX A;  3ASM A;  2UUB K;  3KD5 E;  2QWR A;  3GBT A;  4N76 A;  3AGK A;  5BR8 K;  1VSJ A;  3OS0 A;  1RT6 A;  3OYB A;  3DXM B;  2P9N A;  3VQ9 A;  2P51 A;  1KFD A;  3BY5 A;  3VQ8 A;  3HK2 A;  4E1N A;  4CK3 A;  4CFD A;  1CXQ A;  3O9U A;  5MLC Q;  4IJA A;  2OTL N;  2ITG A;  4BRD A;  3AGR A;  2A1R A;  3TAR A;  4MDA A;  1ZC6 A;  1VSL A;  3LDP A;  5K14 A;  3WNG A;  4I2P A;  3S3M A;  3HT3 A;  5HRR A;  4FL9 A;  3VQA A;  3O3G A;  5DM7 L;  3ZSO A;  1X9J A;  5AQN A;  3TTD A;  1U6Z A;  3KWG A;  2O8B A;  3MXI A;  1VQ5 N;  3AO5 A;  4LFA K;  4AM7 A;  1WSI A;  5C10 A;  1ASU A;  2D1K A;  2YHA A;  2GTD A;  4MFB A;  4B9Q A;  1D4X A;  4DSI A;  3ID8 A;  3L3V A;  4FW2 A;  4KHY A;  1KRP A;  1NG9 A;  4BC5 A;  3J81 O;  1T7P A;  1RGI A;  4EIA A;  3NH2 A;  3LP1 A;  3U3G A;  4WQ4 A;  1QSY A;  1JL2 A;  4O8U A;  3O4Q A;  2Y1J A;  4JKG A;  5KRS A;  3R6M A;  4K42 A;  3JYT A;  5GIO A;  1GLL O;  4ELV A;  4CW7 B;  1WAF A;  3WNH A;  4B9M A;  1B9D A;  4IBN A;  1FXX A;  4FJJ A;  4OJR A;  2P9N B;  5E41 A;  3CCJ N;  3VOV A;  2CGL A;  2F9W A;  2GUI A;  2YX6 A;  1R0A A;  3NHG A;  1VSK A;  1WLJ A;  2KFZ A;  2YNF A;  1HMV A;  2HST A;  1BOT O;  3FFI A;  1WBB A;  5KPZ A;  3M8S A;  3AVF A;  4AM6 A;  1VQM N;  1RTD A;  1FK9 A;  3O6W A;  2O8B B;  4B3M K;  3QB0 A;  3V1R A;  1TAQ A;  1EET A;  3CCV N;  5ADX H;  4KRE A;  1REV A;  2W40 A;  5EVZ A;  4LF4 K;  2YKM A;  3H3N O;  1WAJ A;  1ZBH A;  5AQG A;  3G4S N;  2IGI A;  1OH7 A;  2XY7 A;  2I7N A;  2O8E B;  4JKG B;  3ATV A;  2UUC K;  1LCU A;  3T3F A;  1NK7 A;  1NMD A;  1VSD A;  4EZ6 A;  2Q36 A;  1NBW A;  5AQM A;  1SKW A;  3I0R A;  4DWI A;  3SUN A;  3ZET A;  3RTV A;  4FCY A;  1YIT N;  1TKX A;  3EO3 A;  1CZ9 A;  3A5L C;  4LFC K;  3WXL A;  4B8C A;  4W5O A;  4KHP K;  2IDO A;  3DRP A;  5GAE P;  2YHY A;  3ULE A;  4DV2 K;  5A2Q O;  3CCS N;  4B3R K;  2F7T A;  3DOK A;  3A5M C;  5AQH A;  4H03 B;  4XEI A;  1HQE A;  2HBK A;  3NDK A;  4CBX A;  2XHB A;  4DTJ A;  1D9D A;  2HHV A;  3MXM A;  5AQI A;  4A5A A;  1EWR A;  4E7L A;  2JWK A;  3C6A A;  4I6M A;  4CJ3 A;  4IEI A;  1QQO A;  3IS9 A;  3HVT A;  3JS6 A;  3TR8 A;  1JXB A;  1IH7 A;  4LFB K;  3F9M A;  4M3W A;  5HRS A;  3E1Y A;  3KJV A;  4JI7 K;  4DF4 A;  3NBP A;  4M41 A;  1ESV A;  5JLF A;  4O5F A;  1BGX T;  4QCL A;  1W2B M;  4KHU A;  1RNH A;  2E1Z A;  1Q7Y O;  3ZET B;  2AP1 A;  1NNE A;  5C25 A;  1S5J A;  3R1X A;  4CHO A;  4PKH A;  5JLH A;  1U45 A;  3LZJ A;  3OYJ A;  3H6E A;  2HHX A;  4IG3 A;  3JAM O;  3FFK B;  1VHX A;  1L3U A;  3SMS A;  4CJP A;  4MO4 A;  4TSX A;  4OKJ A;  3CCU N;  1W7A A;  3VQC A;  4CEA A;  3ULE B;  1NGE A;  3BUZ B;  1C1A A;  1YHQ N;  1X1P A;  1Z26 A;  3LAK A;  1XC9 A;  2YHX A;  4IO8 A;  4AQY K;  3T1H K;  1L5U A;  5ADX A;  1YIJ N;  2D0B A;  2VWK A;  1ATS A;  5KTQ A;  2HHT A;  3ZYY X;  4DTX A;  4FLZ A;  4IEE A;  4B3S K;  4ZTJ A;  3DMJ A;  2XO7 A;  3O4W A;  3IG1 A;  1NJY A;  3EYZ A;  3THY A;  3SV3 A;  1HKB A;  1S6P A;  4ID1 A;  4KKO A;  2BDP A;  4DQR A;  5BRH A;  3RMA A;  4UY8 O;  3TAM A;  1NGH A;  4AHR A;  3VEV A;  1RBS A;  3HYF A;  3QEX A;  2XRI A;  2FBV A;  1EP4 A;  2FSK A;  4WCE L;  1HX1 A;  1KVB A;  3VPZ A;  4YOY A;  2YHB A;  1KC8 O;  3O08 A;  1WB9 A;  3CCM N;  4FJ8 A;  2OTJ N;  4CVN E;  3TAN A;  2P9L B;  3SAH A;  3FGU A;  5JS2 A;  1ZYQ A;  3AVG A;  1DGK N;  4FJ7 A;  1SKS A;  1KTQ A;  3K5L A;  5SZT A;  1F21 A;  3FZM A;  4CZM A;  4BQZ A;  1VSI A;  1T03 A;  3TAF A;  3JSM A;  3VEO A;  3HM8 A;  2NRX A;  4DU4 A;  1U47 A;  1U49 A;  4BGB A;  4WYB A;  5JVG L;  3RR8 A;  1KVA A;  1QTM A;  1V4S A;  4B3O A;  3QIO A;  4Z4C A;  1VQN N;  4G1Q A;  2BE2 A;  3L2V A;  1NKB A;  2W6L A;  4OPA A;  1B9F A;  2YI1 A;  4LC9 B;  1ITG A;  4Z4H A;  4Q5V A;  4YY3 K;  3LWM A;  2A6A A;  3HL8 A;  4WQ5 A;  3OVN A;  4KB0 A;  2IS3 A;  4IDK A;  1TAU A;  3TU5 A;  3VA3 A;  1N33 K;  2O8D A;  2GV9 A;  3HPH A;  2YJF A;  5C2F A;  3MN5 A;  5J2N A;  2P9K A;  3VEX A;  3WQT A;  3GE1 A;  3QEI A;  3AV9 A;  3QBW A;  2G8U A;  3G25 A;  3VF4 A;  3PSF A;  4YOW A;  3K5O A;  2RPI A;  4RW7 A;  1YTU A;  1RBU A;  4A57 A;  3ZSV A;  4JI0 K;  2OPQ A;  4O44 A;  4AHV A;  4H4O A;  5LL6 Z;  4CD3 A;  2VG7 A;  3V9X A;  4LF7 K;  5C12 A;  1ZXO A;  4BG8 A;  3ZT3 A;  3THW B;  3QLH A;  3PX0 A;  2OPR A;  3SK3 A;  3CET A;  4A61 A;  4O55 A;  4CJ7 A;  1IKX A;  1BIS A;  2NUB A;  3D7E O;  3P4I A;  3MMV A;  3LP3 A;  3PV8 A;  3SNN A;  3AVK A;  1WSG A;  4FM2 A;  3TTF A;  4BVO A;  4WF9 L;  4B1U B;  3M8Q A;  2GEM A;  1JLG A;  4UQG A;  2HHS A;  5TKY A;  2FBX A;  3DYA A;  1RDD A;  4JI5 K;  1KLN A;  5CYQ A;  2O8D B;  3EKS A;  1VQK N;  1BHL A;  4W5Q A;  2P9K B;  4FSV A;  4CBU A;  2HW3 A;  2FF3 B;  2WOM A;  1VQ8 N;  1HKG A;  2OCE A;  4QS8 A;  2Q97 A;  2KLA A;  3OYN A;  4I9Q A;  5T7B A;  4DQ8 A;  4K8X A;  4GNI A;  4L8R B;  3MEC A;  1HYV A;  1QHA A;  3SQ0 A;  1Q9Y A;  3MED A;  3R8E A;  3WXK A;  4B9N A;  1VSH A;  3ZSZ A;  3PLA A;  3SYZ A;  2W41 A;  4OVL A;  1WSH A;  3AVM A;  3KK3 A;  2E6M A;  5JIC A;  1TL1 A;  3C6U A;  4H0T B;  2P9U A;  3SJH A;  3THV A;  1KLM A;  5AQU A;  2O8C B;  4M45 A;  2HNZ A;  4FZY A;  1VQP N;  5AQX A;  4E89 A;  4CGD A;  4BRI A;  4PKI A;  2FSJ A;  1RT5 A;  4OKK A;  2OZS A;  4LF9 K;  1ATR A;  4FO0 A;  3QNN A;  3O3F A;  4FJX A;  2GUP A;  3EE9 A;  3CQX A;  3OYC A;  4B3T K;  4JI8 K;  3IRX A;  5AQZ A;  4QS7 A;  4ID5 A;  4C8K A;  3HP9 A;  3T1A A;  3DRS A;  3SZ2 A;  1GOB A;  4Q0B A;  1JL1 A;  1D9F A;  1RDC A;  4WQ4 C;  3LPU A;  2PBD A;  4JN4 A;  3ZEU B;  1HNV A;  4LF5 K;  3AY9 A;  4CZJ A;  5HRO A;  2P5O A;  2F9T A;  4OGE A;  1LWC A;  4J2A A;  3TTC A;  4FWS A;  4DFP A;  3CC2 N;  3V9W A;  3L2U A;  3WQU A;  5F2R A;  5DM6 L;  1G99 A;  1GLF O;  3V9Z A;  1WSF A;  1BL3 A;  4C1N K;  3RMB A;  3SQ4 A;  3O9T A;  1G15 A;  2FBY A;  4DG1 A;  4Z0U A;  4ICL A;  2QWO A;  5HP1 A;  3ZT1 A;  3OS2 A;  3OBW A;  4JKA A;  3WXJ A;  4DTP A;  2I5J A;  4CGI A;  2P9S A;  5AQF A;  4DSF A;  4E7J A;  1T6C A;  4CFC A;  1S1V A;  3J80 O;  4B08 A;  1HRH A;  2WON A;  4FPB A;  2UYT A;  4PL7 A;  2VQF K;  1HQU A;  3MWT A;  4DR7 K;  4DU3 A;  3NVK A;  1Y97 A;  4AHC A;  3OA9 A;  1C0G A;  2X6S A;  2HVH A;  3GG4 A;  2HMI A;  4LH4 A;  2Y1I A;  3PX4 A;  1S1T A;  4BVP A;  3SJJ A;  4PWD A;  3J7Y P;  3RVC A;  3DAW A;  3RRH A;  4YOV A;  5BRF A;  3ENB A;  1XNR K;  4GMJ B;  2ZWH A;  3PO4 A;  3T19 A;  4KB1 A;  2VG5 A;  4N56 A;  3BGR A;  4HCC A;  2F96 A;  1NK5 A;  3DLR A;  2QXF A;  3O3H A;  1IG9 A;  1C0F A;  2E88 A;  3SI6 A;  4JV5 K;  4BRC A;  4CEZ A;  2EWS A;  2QEX N;  1EKE A;  2G8W A;  3NF8 A;  3DWL A;  3QFU A;  4OX9 K;  5C0Y A;  1VK0 A;  2FC0 A;  3VF2 A;  1GLJ O;  3EEQ A;  5CE3 A;  2AA4 A;  3ZX2 A;  4IDH A;  4JI4 K;  4JS5 A;  1VAZ A;  3CYM A;  3KLI A;  4W5R A;  3AAP A;  3HZ6 A;  4BRG A;  4HUE A;  1JCG A;  4FK2 A;  1MU2 A;  2D0A A;  3HI0 A;  4CEE A;  1X9M A;  1Q9X A;  1J5O A;  4BE1 A;  4DR3 K;  1FKP A;  2KKZ A;  2O4G A;  1TK5 A;  3AO2 A;  3WT0 A;  4DKW A;  4KTQ A;  1OH5 A;  1EO1 A;  3CXC M;  4FOE A;  3O9S A;  3H46 O;  4FWK A;  1MWK A;  4CI6 A;  2VGM A;  4R79 A;  2E6L A;  1U48 A;  3L2R A;  2FSN A;  4LSL A;  3DOL A;  4JKE A;  4DTM A;  3K0S A;  1NGG A;  3O9R A;  3R3L A;  1O13 A;  4FLY A;  4RTF D;  3I0S A;  1JJ2 M;  1BCM A;  3TWH A;  4H0V B;  4PL8 A;  4E19 A;  1KVC A;  4FM1 A;  1TV6 A;  3AO4 A;  5AQJ A;  4BDY A;  2PY5 A;  4DFJ A;  4CJW A;  2Z1G A;  3CJC A;  4DLE A;  2IVO A;  4CJS A;  2KTQ A;  2QA4 N;  1T3V A;  3WEE B;  2YCH A;  1BCO A;  1RT7 A;  4FLX A;  4EFH A;  3CJB A;  4V19 S;  5F0X A;  2HMP A;  1QQC A;  4HHT A;  4X65 K;  3K57 A;  2WC9 A;  4JLH A;  1J9A A;  1HJO A;  3AAR A;  4FM0 A;  3QBX A;  3IAY A;  1IO2 A;  1W9H A;  2EHG A;  2ZE2 A;  5AZJ B;  3WUH A;  1BDG A;  2AJQ A;  4AIL C;  1KAZ A;  4JKF A;  1N32 K;  3B6P A;  4CF8 A;  1EX4 A;  3PUF A;  2E1Y A;  4DS4 A;  4GV9 A;  1DT9 A;  5FPM A;  3C6H A;  3T69 A;  4DUY K;  3OYA A;  4H5R A;  3AVA A;  4DTN A;  3UB5 A;  1QSL A;  3L4I A;  1IBK K;  1X3N A;  4I2Q A;  3PIP L;  3LWL A;  4CCH A;  3HO1 A;  3K2P A;  4YOU A;  2QWQ A;  3SPY A;  4CGF A;  2D4W A;  1ILY A;  4WQ5 C;  4DSK A;  4EP5 A;  4A2A A;  3NGZ A;  1QQM A;  1KFS A;  1WBD A;  4J8F A;  3M6G A;  1LWF A;  2ASM A;  4F3O A;  4YFU A;  3GL1 A;  2IVN A;  3CCE N;  4KRF A;  2YKN A;  4O4G A;  4C23 A;  4NCB A;  1QZ6 A;  5I3U A;  3OYI A;  2V51 B;  2ZD1 A;  3KD1 E;  3KKR A;  1RTI A;  4IFE A;  4E7I A;  4BR7 A;  3AVI A;  4DV5 K;  2A41 A;  3V9U A;  2HBL A;  4CD1 A;  2P9I A;  4BR0 A;  3NF7 A;  4GV6 A;  3HRG A;  3T1Y K;  1YJW N;  4CEC A;  2HF4 A;  3LM9 A;  2A5X A;  4FZX C;  1N5Y A;  2A3Z A;  3DXK A;  3VGK A;  2E2Q A;  4FW1 A;  4CFB A;  1H1V A;  3I55 N;  3IFR A;  4JKD A;  3VES A;  1XMO K;  4HUG A;  4DUZ K;  4FWR A;  2GX9 A;  2Z1I A;  3WXI A;  1NGB A;  2H3G X;  3D45 A;  3ZLJ A;  4Y0W A;  1ZBS A;  1S1W A;  4CEO A;  1CXU A;  4CJE A;  4DQS A;  5E26 A;  2G8I A;  3HXM A;  2ITM A;  1FJG K;  4YDU C;  2O4I A;  3O8M A;  4B1X B;  3W0L A;  4O0J A;  1NK0 A;  4DU1 A;  1IG8 A;  4KAZ A;  5M1K A;  3AA2 A;  3LAL A;  4ISF A;  3NCI A;  1SAZ A;  4JRP A;  4RW8 A;  3SAG A;  4LF8 K;  3PY8 A;  1E4F T;  3AVL A;  4H5V A;  4JK7 A;  2JLE A;  3CME N;  3S41 A;  3VEZ A;  3U8X A;  5BPL A;  2OA8 A;  3CC7 N;  3CI5 A;  1JLB A;  1HNI A;  1K8A O;  2HVI A;  3FLC O;  1NJW A;  3C94 A;  3E66 A;  5CZ1 A;  3CD6 N;  4DR4 K;  4GKJ K;  3DXK B;  2ZGY A;  3B6O A;  3M5R A;  3LZI A;  5AQV A;  3FZH A;  1WN7 A;  4FK0 A;  3BEX A;  4QAG A;  3MAQ A;  4FK4 A;  4CK2 A;  2CH6 A;  5JMV A;  3ZSY A;  4CJQ A;  4DQI A;  5EU7 A;  4RW6 A;  4B9V A;  3SUP A;  3S9H A;  4M7X A;  1RT2 A;  1SV5 A;  4FWO A;  4LF6 K;  1NGJ A;  1RBV A;  4KHW A;  1OVY A;  2YNI A;  3RR7 A;  4I6M B;  3NF6 A;  1TL3 A;  1QVF M;  1U2V A;  3CPW M;  3H3O B;  1C0M A;  3I8B A;  4JRQ A;  4DFK A;  2YNG A;  4DSJ A;  4JS4 A;  4M63 C;  1IJJ A;  4B1V A;  1ZBL A;  5BPM A;  3PIO L;  4J2E A;  4MLH A;  3OS1 A;  4AHU A;  2UXC K;  5CYM A;  4IZ9 A;  4CHQ A;  3OYE A;  4DS5 A;  4KI4 A;  1BG3 A;  3TAP A;  4CGG A;  4FLW A;  1C0U A;  1S1X A;  3HP6 A;  3KHY A;  2DFE A;  4IWV A;  2QI2 A;  3LM2 A;  5FPD A;  1HLU A;  3ALY A;  2BGG A;  1HJR A;  4CIG A;  3VET A;  3ID6 A;  1M90 O;  1KSP A;  3OY9 A;  1QVG M;  2PZS A;  1BQN A;  1HPM A;  4CBW A;  5AQL A;  4OKE A;  3OTO K;  4MO5 A;  3W3D A;  4BE2 A;  2G8K A;  1XC3 A;  5FLX O;  5HLF A;  2QTD A;  3V1Q A;  2A42 A;  1KQS M;  4B9L A;  4JHD A;  3VN5 A;  3VQE A;  1TKZ A;  4CIE A;  1RDW X;  4JI6 K;  1U2V B;  1TUU A;  4BRF A;  3S3N A;  3NF9 A;  4JKH A;  4QS9 A;  3THY B;  2JGU A;  3EZ5 A;  2B4J A;  3V4I A;  3P83 D;  1YI2 N;  2OPP A;  5KGW A;  4CE9 A;  3OHR A;  5CY4 A;  3CM5 A;  1XUP O;  4BC3 A;  3CQ8 A;  5I9E B;  4AF1 A;  1BO5 O;  2RF2 A;  3CF5 L;  2RN2 A;  1TK8 A;  3AA4 A;  2QM1 A;  2F8T A;  1RBT A;  5IT9 O;  1YXQ A;  1LW0 A;  1P90 A;  2IC3 A;  3WNF A;  2E4L A;  3KVG A;  3ZX0 A;  3AO3 A;  3ULD A;  2HNY A;  2NRH A;  1HPZ A;  3IUC A;  3M8P A;  4OPJ A;  3HPG A;  3MX5 A;  3M8R A;  1WOQ A;  2W6K A;  1XHZ A;  4BE0 A;  4H4M A;  3BZC A;  5LJW A;  2HND A;  4JKB A;  1N34 K;  4FJK A;  2QWM A;  1KXP A;  2E20 A;  4EAH D;  4M3Z A;  1YVU A;  3DM2 A;  3HBT A;  4JHD B;  5J2M A;  4KH5 A;  1NJI O;  1RT1 A;  4BRP A;  4DV1 K;  3QDK A;  5KPR A;  3I8D A;  1DLO A;  3L2Q A;  3LDQ A;  4IG0 A;  3ZSQ A;  4ISG A;  5BR9 A;  4FJ5 A;  3CJ1 A;  2O8F A;  1X9W A;  4NLC A;  5H1S Q;  4AHT A;  4JEP A;  1SUQ A;  4BWJ A;  3F5T A;  3EL2 A;  3ZSR A;  4G9Z A;  3F73 A;  3HVR A;  4Z4F A;  2YNH A;  4H0O A;  3CFR A;  1YF5 L;  4H8K A;  5AFU H;  5C15 A;  2KW4 A;  2YJE A;  1U04 A;  3QML A;  1YJN N;  3I56 N;  4IOX A;  4NYN A;  3O80 A;  4AHS A;  3EKU A;  4CHN A;  3CCR N;  3MN9 A;  4FLV A;  4K43 A;  1NOY A;  4ELU A;  1L3V A;  3DLK A;  3L6Q A;  1QS4 A;  4BDZ A;  1XQS C;  3J7A P;  2KFN A;  1C0T A;  3KK1 A;  3P31 A;  3SUO A;  4M3Y A;  2X78 A;  4FVM A;  4DR5 K;  4FWP A;  1C6V A;  3K58 A;  1VQ6 N;  4B1Y B;  2O8F B;  3VQD A;  3O9Q A;  4BC2 A;  3D6R A;  1ZBI A;  5FRM A;  2E2P A;  4MQ3 A;  5AQS A;  1SS6 A;  1MDU B;  4N5S A;  1WNS A;  2B6A A;  3J8A A;  3UKR A;  4R5P A;  3LAM A;  4JYA K;  5C2D A;  1EQY A;  4IFV A;  1LAW A;  3SQ1 A;  5B8H A;  1LAV A;  3IMX A;  2J4R A;  3VTI A;  3VQ6 A;  2IIR A;  5C42 A;  3H1Q A;  4QOZ B;  2WFB A;  3M3Z A;  3EN9 A;  4O0I A;  1W97 L;  4CZK A;  3KLH A;  3TSP A;  4FJI A;  3VGM A;  4K8Z A;  4OLB A;  1S1U A;  4O8K A;  5EX5 A;  4FLU A;  3L2W A;  4IOA L;  2DPN A;  2FLO A;  4E7H A;  3OJU A;  3B8A X;  2HOE A;  3CQY A;  3OYD A;  1DTT A;  1TK0 A;  1VQ7 N;  1VQL N;  3FZF A;  2UUA K;  2P9U B;  3BDP A;  1HNW K;  5LMN K;  4W5T A;  3HOS A;  3CMA N;  2R7Y A;  3PSI A;  1JLA A;  1M1K O;  1D8Y A;  1TKD A;  1IKV A;  2IVP A;  2KQ2 A;  5C24 A;  4BR4 A;  2X6N A;  4HWI A;  3UKU A;  4RCH A;  2Q1N A;  5AFU A;  1VQO N;  4HVJ A;  3MN7 A;  1XMQ K;  4KTZ A;  4DV0 K;  4NCA A;  1P8Z A;  1Q82 O;  5HOO A;  2E2O A;  3D2F A;  1RBR A;  1D5A A;  2EX3 A;  3A8Y A;  3P38 A;  4JK8 A;  3MCP A;  2XY8 A;  2VCP A;  4CJV A;  4CHP A;  1WSE A;  2QWP A;  2Q0U A;  4FJH A;  2P5G A;  4CED A;  4XH4 A;  3KTQ A;  4DQP A;  3NMU A;  3VQQ A;  4JI1 K;  4KTW A;  3G0Z A;  4FWN A;  4CZF A;  4FVU A;  4EHU A;  3H45 C;  1UA0 A;  4C8L A;  5LJV A;  1A5V A;  5HBM A;  3V6D A;  1E3M A;  2ZGZ A;  3CCQ N;  2P9P A;  3FZK A;  4IOC L;  3QIP A;  4PKG A;  4JK9 A;  4WFN L;  1A5X A;  5AQT A;  5M1O A;  2VG6 A;  1ASV A;  2P9S B;  1NKC A;  1HYZ A;  4DTS A;  4KHQ A;  3QIC A;  4MDB A;  4XIU A;  2XY6 A;  2QW9 A;  2D0P A;  5DK5 A;  1HUX A;  4K0K K;  4YOX A;  1RIL A;  4JD2 A;  4BDP A;  3HJF A;  1ATN A;  3O1W A;  4AH9 A;  2ZM6 K;  5HL7 L;  1RDU A;  2VYP A;  4DR2 K;  4C8N A;  3QNO A;  1RTJ A;  1GOC A;  3AA5 X;  3K5N A;  2DFH A;  4BC4 A;  4E0D A;  4N41 A;  1OKJ A;  1S72 N;  3A5N C;  2PYJ A;  1MA9 B;  4B9T A;  2Z1J A;  4DR6 K;  3CIP A;  2ZJR L;  5GAG P;  3UE5 A;  1YUW A;  2NRT A;  1B92 A;  4BRO A;  1S6Q A;  1W0H A;  3E9P A;  4CF9 A;  3HTV A;  3VMF B;  5LY3 A;  1Z25 A;  4NLB A;  1TKT A;  3TAG A;  3LL3 A;  4FJL A;  5AQK A;  3SQ2 A;  1NGD A;  3ZX3 A;  4NYF A;  3K9J A;  5KRT A;  3MWP A;  4CEF A;  1JLC A;  3DLG A;  3DLE A;  3ISN C;  4JD2 B;  3G10 A;  4IKF A;  4Z4E A;  1RCH A;  4U7B A;  3ENH A;  1C1C A;  4FJM A;  5GAH P;  3QIN A;  4DTR A;  4RW4 A;  5ELZ A;  1LOT B;  3MEG A;  4ILG B;  1IV0 A;  5DMR A;  1X3M A;  3OYK A;  2OYQ A;  4CJU A;  3DLL L;  4FXD A;  4FJN A;  4IJN A;  4DQQ A;  4KV8 A;  5BN8 A;  3EY1 A;  2HBJ A;  3LAN A;  3OYH A;  1L3T A;  1OH8 A;  4CF0 A;  1HNX K;  5EOY A;  1HKC A;  4DF8 A;  2RHK A;  2NRV A;  3D0P A;  4X66 K;  1KAY A;  4FYD A;  4CJT A;  5EXW A;  4J2D A;  3QER A;  1NWK A;  2WTU A;  1S9E A;  4BRL A;  3OYM A;  1VSM A;  2Q31 A;  4CEB A;  1J5E K;  3NH0 A;  4BAC A;  4IO9 L;  3KK7 A;  2GWK A;  2IOC A;  1SZ2 A;  4FZZ A;  4LD0 A;  4JKC A;  5LMU K;  3C6T A;  4BR2 A;  3KLE A;  3GOI A;  4PHT X;  1NOZ A;  3NGI A;  1XWL A;  3KK2 A;  2QKK A;  2O8E A;  4HTL A;  1GLA G;  2CGJ A;  1SL0 A;  1DTQ A;  1LWE A;  1BI4 A;  1S3X A;  1YTA A;  2IAJ A;  2I7P A;  4W5N A;  5FPN A;  3BF1 A;  3VGL A;  3VQP A;  1SL1 A;  4FWL A;  4A5B A;  1Z05 A;  4CGJ A;  3RMC A;  2HHQ A;  4E7K A;  3MN6 A;  1NK4 A;  2DTU A;  1FKO A;  4B9S A;  2BH1 A;  1NGI A;  3LP2 A;  3PX6 A;  4CJ4 A;  3AO1 A;  3CJ7 A;  5AQY A;  4CZG A;  3DLH A;  1TUY A;  2WUS A;  4Z4G A;  1JCF A;  3IDH A;  3SBT A;  3Q7B A;  3QO9 A;  4KO0 A;  2Z1H A;  3U9D A;  2QXL A;  2RE2 A;  2Q3S A;  2V7Y A;  3SLC A;  4DV7 K;  1DKG D;  5KQD A;  1SKR A;  1I94 K;  2D0C A;  4DV4 K;  4BQL A;  1KCF A;  1T05 A;  2HHW A;  4M42 A;  1GLB G;  4CF1 A;  4CK1 A;  1MWM A;  1LW2 A;  1BI4 B;  2NZT A;  3J7Z O;  1RT3 A;  4M3T A;  3FE1 A;  4WE1 A;  2VWB A;  4NXM K;  1UOC A;  4A2B A;  3N4P A;  1ZBF A;  3MCA B;  4XH1 A;  3O5B A;  3FR0 A;  1IBL K;  3GDQ A;  4CZL A;  1N36 K;  2B5J A;  3NAE A;  3SMP A;  4X64 K;  4H0X B;  2HHH K;  2VQE K;  4B1W B;  3RWU A;  2RKI A;  4FWQ A;  3VEW A;  2NNW A;  3NVM A;  2YV0 X;  4DR1 K;  3SV4 A;  3K9K A;  3OYG A;  4BR5 A;  3OYF A;  5KGX A;  4CJR A;  2QWN A;  3KLG A;  5AQR A;  4KI6 A;  3AAQ A;  5CZ2 A;  3NFA A;  1V4T A;  2D0O A;  2P9I B;  5BN9 A;  4F3T A;  5EY4 A;  1CLQ A;  1J6Z A;  5AZI A;  3TSQ A;  1NJZ A;  4OO1 J;  3S3O A;  3N4Q A;  3QEW A;  2QKB A;  3WNE A;  1WSJ A;  1UWB A;  4CFA A;  2ZJP L;  3KZB A;  3QET A;  4JNE A;  1Q81 O;  2PAV A;  2A1S A;  5GIN A;  1TGO A;  4NCG A;  3WXM B;  1R59 O;  4BRH A;  2WBN A;  3SAF A;  4JI3 K;  2P1J A;  4XH5 A;  3VTH A;  4DHY A;  3VQ5 A;  1YAG A;  4I9L A;  4CEQ A;  2FBT A;  3A2F A;  3C7N A;  4DLG A;  1BA0 A;  1E4G T;  3C0B A;  5AQW A;  5CHI A;  5JS1 A;  4C8M A;  2P9L A;  3SUQ A;  4OPH A;  2JWL A;  2QWL A;  2BUP A;  4CZH A;  1I3A A;  1NU0 A;  3P5J A;  1O1W A;  2UU9 K;  1FW6 A;  3KIO A;  1XHX A;  4BWM A;  5AZI B;  3VQ4 A;  4ZTF A;  4RWT A;  1N6Q A;  4C1N I;  1RT4 A;  3U4L A;  1VRT A;  3CJA A;  3BF3 A;  4K41 A;  3CFP A;  4F4K A;  4CJL A;  3TAE A;  4HUF A;  4M7Y A;  3L3U A;  4YOR A;  2OAN A;  1Y64 A;  5AJ3 K;  2YHW A;  3FZL A;  3C65 A;  3NH1 A;  5M1P A;  2ATQ A;  2ETJ A;  1BUP A;  1A5W A;  4ELT A;  1ZBU A;  1EWQ A;  1HNZ K;  4ILH A;  4B8A B;  1C1B A;  3U6F A;  3C7N B;  1JLF A;  1L3S A;  3EZW A;  3ITH A;  1JLQ A;  2NRW A;  4RW9 A;  4F2S A;  4KH6 A;  4L3Q A;  2OZM A;  5AQP A;  4E3S A;  2LSN A;  4LY7 A;  4H0P A;  1QHT A;  4IXC A;  1QSS A;  1GLC G;  2HHU A;  4KH4 A;  4CES A;  2G8F A;  4DCH A;  3MK6 A;  4GW6 A;  4DSL A;  3OYL A;  3THW A;  5KI6 A;  4OLA A;  3AVN A;  4B9U A;  1WUA A;  2OPS A;  1X9S A;  3DLB A;  3RRG A;  1K8K A;  4CZE A;  3KLF A;  3QEV A;  1Q86 O;  2X74 A;  3JXU A;  1BIU A;  3RMD A;  1QQN A;  1XNQ K;  3RSE A;  2ZJQ L;  4CGH A;  1BWF O;  1NMN A;  3CC4 N;  1RDB A;  4BGA A;  1VSE A;  3SBG A;  3L8B A;  3MEE A;  4BRK A;  3DI6 A;  4BRQ A;  2ZQB A;  4KHS A;  4CZI A;  5GIP A;  4CER A;  5FDL A;  1BA1 A;  3H1V X;  1HR0 K;  1ASW A;  4BRM A;  3ZCM A;  1NJX A;  1VQ4 N;  3U9Z A;  4LSN A;  5F1X A;  4DTU A;  4HCB A;  3O4N A;  3LDO A;  2G8V A;  1T6D A;  3BZK A;  3IKM A;  1OH6 A;  2D5R A;  2VWJ A;  1Z6R A;  5M1N A;  4H5N A;  1EXQ A;  2V52 B;  1K8K B;  3G71 N;  1T8E A;  5J2P A;  4DB3 A;  3ZSW A;  2ASP A;  3P39 A;  4KPY A;  2O8C A;  3TAB A;  1OVQ A;  3ATU A;  3VQ7 A;  2FXU A;  3NGY A;  3L0Q A;  3CCL N;  3RSE B;  3E01 A;  3LDS A;  3V1O A;  1NM1 A;  2NRR A; 
#chains in the Genus database with same CATH homology
 3E9L A;  4JK9 A;  1SQK A;  3BP8 A;  4YOU A;  4IEE A;  4WFN L;  4YDU A;  2QWQ A;  3HSC A;  5AQT A;  5M1O A;  3O4W A;  2P9S B;  1Q18 A;  3ENO A;  4A59 A;  2D4W A;  1ILY A;  3QIC A;  4MDB A;  4A62 A;  4WQ5 C;  1N8R O;  2QW9 A;  2D0P A;  1HKB A;  4A2A A;  1HUX A;  1QQM A;  4YOX A;  3TSU A;  1S22 A;  4FOI A;  4JD2 A;  1K73 O;  4J8F A;  3M6G A;  3CJ9 A;  5BRH A;  4UY8 O;  1ATN A;  1NGH A;  3O1W A;  3ZEU A;  3VEV A;  4WFA L;  2ASM A;  5HL7 L;  3GL1 A;  4KBO A;  1RDU A;  2IVN A;  4BRE A;  2VYP A;  1K9M O;  3CCE N;  2FSK A;  4WCE L;  1HX1 A;  4C23 A;  4BC4 A;  3MDQ A;  1QZ6 A;  3VPZ A;  1NGA A;  4YOY A;  1OKJ A;  1S72 N;  2V51 B;  1KC8 O;  3O08 A;  3A5N C;  3CCM N;  1MA9 B;  2OTJ N;  4IFE A;  4BR7 A;  2GWJ A;  5AQO A;  2P9L B;  3Q7C A;  3SAH A;  2A41 A;  3FGU A;  2HBL A;  3CIP A;  2ZJR L;  5GAG P;  3UE5 A;  4CD1 A;  1YUW A;  2P9I A;  1DGK N;  2NRT A;  4BR0 A;  4GV6 A;  4BRO A;  3HRG A;  1YJW N;  2HF4 A;  3LM9 A;  2A5X A;  3E9P A;  3VF6 A;  2A3Z A;  3DXK A;  3HTV A;  2E2Q A;  3FZM A;  3VGK A;  3VMF B;  4BQZ A;  4CZM A;  5KPT A;  5LY3 A;  1H1V A;  4BY9 C;  3I55 N;  3IFR A;  4NLB A;  3VEO A;  2FF6 A;  2NRX A;  2E8A A;  2KHO A;  3HM8 A;  4JKD A;  3VES A;  1DEJ A;  3LL3 A;  5AQK A;  1NGD A;  4BGB A;  4WYB A;  3ZX3 A;  4FWR A;  2GX9 A;  5CR4 A;  4BRN A;  5JVG L;  5BRE A;  1V4S A;  3K9J A;  3WXI A;  1NGB A;  5TKW A;  2H3G X;  3MWP A;  4Y0W A;  3T7Z A;  1YJ9 N;  1VQN N;  1ZBS A;  3D2E A;  5KQ8 A;  4JD2 B;  4E1J A;  4FWM A;  5E26 A;  5GAD P;  4OPA A;  2ITM A;  4YDU C;  4U7B A;  3O8M A;  2YI1 A;  1GLE G;  2PFU A;  3ENH A;  4LC9 B;  3W0L A;  3O1B A;  4B1X B;  5GAH P;  1TYQ A;  1IG8 A;  4JAX A;  5M1K A;  2HF3 A;  4K25 A;  4ISF A;  2A6A A;  4FPA A;  4WQ5 A;  1SAZ A;  3UKR B;  5ELZ A;  3SAG A;  4BR9 A;  1LOT B;  3LDN A;  3TU5 A;  4ILG B;  1E4F T;  3MX2 A;  1X3M A;  4H5V A;  4JK7 A;  3CME N;  3S41 A;  2YJF A;  3U8X A;  3MN5 A;  3VEZ A;  5BPL A;  4ISE A;  5C2F A;  2P9K A;  3CI5 A;  3VEX A;  3WQT A;  3GE1 A;  3DLL L;  1KD1 O;  3CC7 N;  3QBW A;  1NGF A;  4IJN A;  5AR0 A;  2E2N A;  3G25 A;  3VF4 A;  3M1F A;  4YOW A;  5BN8 A;  4A57 A;  1T44 A;  3L4Q A;  1K8A O;  3FLC O;  2HBJ A;  5AQQ A;  4Z94 A;  3E66 A;  3CD6 N;  5EOY A;  1HKC A;  4MLE A;  3DXK B;  2VGN A;  2ZGY A;  4CD3 A;  5BPN A;  2RHK A;  2NRV A;  3M5R A;  3QFP A;  5E84 A;  5C12 A;  1ZXO A;  5AQV A;  3FZH A;  4BG8 A;  3A0I X;  1GLD G;  1KAY A;  4ILJ A;  4BG9 A;  1RFQ A;  5BRD A;  3BEX A;  5EXW A;  3CER A;  3SK3 A;  3HOT A;  3OBY A;  3CET A;  4A61 A;  1NWK A;  3A5O C;  4CJ7 A;  3D2E B;  3LDL A;  4BRL A;  3D7E O;  3P4I A;  2Q31 A;  2CH6 A;  3MMV A;  5JMV A;  4GVE A;  2CGK A;  5M1Q A;  2CH5 A;  4IO9 L;  1TYQ B;  3EE8 A;  3KK7 A;  3TTF A;  2GWK A;  4BVO A;  4WF9 L;  4M7X A;  4NB4 A;  1SZ2 A;  3CPE A;  4B1U B;  4FWO A;  1JCE A;  2GEM A;  1NGJ A;  4JKC A;  5TKY A;  1OVY A;  1VQ9 N;  4BR2 A;  3GOI A;  4I6M B;  4PHT X;  3VEN A;  1QVF M;  1U2V A;  2ZF5 O;  3CPW M;  3H3O B;  4HTL A;  3I8B A;  3EKS A;  1GLA G;  1YVN A;  2CGJ A;  3UKU B;  1VQK N;  2ASO A;  2P9K B;  1IJJ A;  4FSV A;  4M63 C;  4B1V A;  4CBU A;  2FF3 B;  1S3X A;  5BPM A;  3PIO L;  4MLH A;  1QZ5 A;  2I7P A;  3CHW A;  1VQ8 N;  1HKG A;  3KWI A;  4IZ9 A;  5FPN A;  3BF1 A;  3VGL A;  4QS8 A;  2Q97 A;  2KLA A;  1BU6 O;  4U67 L;  2A40 A;  4FWL A;  4H5W A;  4DQ8 A;  4A5B A;  1BG3 A;  1Z05 A;  3D2F B;  4GNI A;  3MN6 A;  3G6E N;  3KHY A;  1QHA A;  4IWV A;  2QI2 A;  3LM2 A;  5FPD A;  3R8E A;  1HLU A;  2BH1 A;  3VEY A;  3R9P A;  2Q2R A;  1NGI A;  4H0Y B;  3WXK A;  4H5T A;  4GV3 A;  3PLA A;  3VET A;  3ID6 A;  2Q0R A;  1M90 O;  3CJ7 A;  5AQY A;  4BRA A;  2W41 A;  3E9O A;  1QVG M;  4CZG A;  1TUY A;  2WUS A;  4GY2 B;  1JCF A;  3IDH A;  1HPM A;  4CBW A;  3SBT A;  3DXM A;  3Q7B A;  4H0T B;  5JIC A;  2P9U A;  5AQL A;  3SJH A;  5M1F A;  5AQU A;  4MO5 A;  3W3D A;  4YOT A;  1XC3 A;  2QXL A;  3U9D A;  2RE2 A;  2P9P B;  2QTD A;  4B1Z A;  1VQP N;  2V7Y A;  4NO7 A;  3SLC A;  4WFB L;  5AQX A;  2A42 A;  1KQS M;  1DKG D;  5KQD A;  4BRI A;  4PKI A;  2FSJ A;  4JHD A;  1ATR A;  3DJC A;  4FO0 A;  4BQL A;  4EHT A;  2GUP A;  1RDW X;  2NRZ A;  3VER A;  1U2V B;  1GLB G;  1TUU A;  3EE9 A;  3CQX A;  4BRF A;  3WEE A;  4QS9 A;  4JKH A;  1MWM A;  5AQZ A;  4QS7 A;  2NZT A;  2BTF A;  2NLX A;  3J7Z O;  3FE1 A;  3OW2 M;  2VWB A;  1YI2 N;  4A2B A;  5JVH L;  1NGC A;  3N4P A;  3OHR A;  2V7Z A;  2HBM A;  3TPQ A;  4WQ4 C;  4F9O A;  4JN4 A;  2PBD A;  1XUP O;  3MCA B;  4XH1 A;  1CZA N;  3O5B A;  3ZEU B;  3F2K A;  4BC3 A;  5AZJ A;  3FR0 A;  5I9E B;  3AY9 A;  3GDQ A;  4AF1 A;  4CZL A;  4CZJ A;  2F9T A;  1BO5 O;  3I33 A;  3SMP A;  3CF5 L;  2GEL A;  4H0X B;  5FPE A;  2QM1 A;  4B1W B;  3TTC A;  1NLV A;  4FWQ A;  2NNW A;  3NVM A;  4FWS A;  3VEW A;  1YXQ A;  1KAX A;  1P90 A;  3K9K A;  3CC2 N;  4BR5 A;  2QWR A;  3WQU A;  3GBT A;  5F2R A;  2QWN A;  3KVG A;  1G99 A;  5DM6 L;  5AQR A;  3ZX0 A;  1GLF O;  3AGK A;  2NRH A;  3AAQ A;  4C1N K;  3DXM B;  2P9N A;  3IUC A;  1V4T A;  2D0O A;  2P9I B;  1WOQ A;  3MX5 A;  5BN9 A;  3O9T A;  5LJW A;  3O9U A;  5MLC Q;  4IJA A;  2OTL N;  4JKB A;  2QWM A;  1KXP A;  4BRD A;  3AGR A;  2QWO A;  4MDA A;  1ZC6 A;  2E20 A;  4EAH D;  5EY4 A;  1J6Z A;  3HBT A;  3LDP A;  5AZI A;  3OBW A;  4JKA A;  3TSQ A;  4JHD B;  3WXJ A;  4OO1 J;  4KH5 A;  1NJI O;  2P9S A;  5AQF A;  4FL9 A;  1T6C A;  3N4Q A;  4BRP A;  3QDK A;  5DM7 L;  5KPR A;  1X9J A;  5AQN A;  3LDQ A;  4FPB A;  3TTD A;  1U6Z A;  3KWG A;  2UYT A;  4ISG A;  3KZB A;  2ZJP L;  5BR9 A;  1VQ5 N;  3CJ1 A;  4PL7 A;  4JNE A;  4AM7 A;  1Q81 O;  2PAV A;  5C10 A;  4NLC A;  5GIN A;  2D1K A;  5H1S Q;  4JEP A;  2GTD A;  3WXM B;  3NVK A;  3F5T A;  1R59 O;  4B9Q A;  4BRH A;  1D4X A;  3EL2 A;  2WBN A;  3SAF A;  4G9Z A;  3ID8 A;  3OA9 A;  4XH5 A;  3VTH A;  4DHY A;  4H0O A;  1YAG A;  4BC5 A;  1C0G A;  1YF5 L;  1RGI A;  3C7N A;  3GG4 A;  4EIA A;  1BA0 A;  4WQ4 A;  5AFU H;  4BVP A;  5C15 A;  1E4G T;  3C0B A;  4O8U A;  5AQW A;  5CHI A;  4JKG A;  2YJE A;  3RVC A;  3R6M A;  2P9L A;  4K42 A;  3DAW A;  3QML A;  5GIO A;  1GLL O;  4YOV A;  3I56 N;  1YJN N;  5BRF A;  3ENB A;  2ZWH A;  4OPH A;  2JWL A;  4IOX A;  2P9N B;  3O80 A;  3EKU A;  3CCR N;  3MN9 A;  2QWL A;  2BUP A;  4CZH A;  3CCJ N;  4K43 A;  3VOV A;  2CGL A;  2F9W A;  3L6Q A;  2YX6 A;  1XQS C;  1C0F A;  2E88 A;  5AZI B;  4BRC A;  3P31 A;  4RWT A;  2EWS A;  2HST A;  1BOT O;  4C1N I;  2QEX N;  3U4L A;  5KPZ A;  3CJA A;  4AM6 A;  3BF3 A;  4K41 A;  3DWL A;  1VQM N;  4FWP A;  3QFU A;  1VQ6 N;  5C0Y A;  3O6W A;  3VF2 A;  1GLJ O;  5CE3 A;  4M7Y A;  2AA4 A;  4YOR A;  2OAN A;  1Y64 A;  4IDH A;  3QB0 A;  3ZX2 A;  4B1Y B;  1VAZ A;  2YHW A;  3FZL A;  3O9Q A;  4BC2 A;  3C65 A;  3D6R A;  5M1P A;  3AAP A;  3HZ6 A;  2E2P A;  3CCV N;  4BRG A;  5AQS A;  1SS6 A;  2W40 A;  5EVZ A;  1MDU B;  1BUP A;  1JCG A;  5ADX H;  3HI0 A;  3J8A A;  3UKR A;  4ILH A;  3H3N O;  2KKZ A;  5C2D A;  1EQY A;  3C7N B;  3EZW A;  5AQG A;  3WT0 A;  4DKW A;  3G4S N;  2NRW A;  5B8H A;  1EO1 A;  2I7N A;  3CXC M;  4FOE A;  3ATV A;  3IMX A;  4JKG B;  1LCU A;  2J4R A;  3O9S A;  3VTI A;  1NMD A;  2IIR A;  3H46 O;  4FWK A;  4KH6 A;  1MWK A;  4L3Q A;  3H1Q A;  5AQP A;  4CI6 A;  2VGM A;  4R79 A;  2WFB A;  3M3Z A;  3EN9 A;  2Q36 A;  1NBW A;  4H0P A;  5AQM A;  1W97 L;  4IXC A;  3ZET A;  1GLC G;  4CZK A;  2FSN A;  4KH4 A;  3TSP A;  1YIT N;  3EO3 A;  4DCH A;  3A5L C;  3MK6 A;  3WXL A;  3VGM A;  4JKE A;  4O8K A;  5EX5 A;  5GAE P;  2YHY A;  1WUA A;  1NGG A;  3O9R A;  3R3L A;  1O13 A;  3ULE A;  4IOA L;  2DPN A;  4RTF D;  2FLO A;  3CCS N;  2F7T A;  3A5M C;  1JJ2 M;  1K8K A;  3B8A X;  5AQH A;  4CZE A;  2HOE A;  3CQY A;  4H03 B;  4XEI A;  1VQ7 N;  2HBK A;  4H0V B;  1VQL N;  1Q86 O;  4PL8 A;  3FZF A;  3JXU A;  4CBX A;  2P9U B;  1QQN A;  3HOS A;  3CMA N;  3RSE A;  2ZJQ L;  3CC4 N;  1BWF O;  5AQJ A;  5AQI A;  4A5A A;  1M1K O;  2JWK A;  2IVP A;  4BGA A;  3C6A A;  3CJC A;  4I6M A;  3SBG A;  4IEI A;  1QQO A;  4BR4 A;  3JS6 A;  4HWI A;  4BRK A;  2IVO A;  3UKU A;  4RCH A;  2QA4 N;  2Q1N A;  5AFU A;  1T3V A;  3F9M A;  1VQO N;  3WEE B;  3MN7 A;  3E1Y A;  2YCH A;  4BRQ A;  4EFH A;  3CJB A;  4CZI A;  1ESV A;  5F0X A;  5GIP A;  2HMP A;  5JLF A;  1P8Z A;  4O5F A;  1Q82 O;  1BA1 A;  2WC9 A;  5HOO A;  1W2B M;  1HJO A;  2E2O A;  2E1Z A;  3AAR A;  3H1V X;  3D2F A;  4BRM A;  1Q7Y O;  3A8Y A;  2AP1 A;  3P38 A;  3QBX A;  4JK8 A;  3U9Z A;  3ZET B;  3MCP A;  5F1X A;  1VQ4 N;  3R1X A;  2VCP A;  5JLH A;  4PKH A;  5AZJ B;  3WUH A;  1BDG A;  2QWP A;  3LDO A;  2Q0U A;  3H6E A;  1T6D A;  4XH4 A;  3FFK B;  3IKM A;  1KAZ A;  3NMU A;  4JKF A;  3SMS A;  1Z6R A;  4MO4 A;  3CCU N;  5M1N A;  2E1Y A;  4H5N A;  3ULE B;  1NGE A;  4GV9 A;  3BUZ B;  4FWN A;  1DT9 A;  2V52 B;  1K8K B;  4CZF A;  5FPM A;  1YHQ N;  3C6H A;  3G71 N;  3T69 A;  4FVU A;  4EHU A;  4H5R A;  2YHX A;  4IO8 A;  3H45 C;  2ASP A;  3P39 A;  3UB5 A;  4DB3 A;  5LJV A;  3ATU A;  3L4I A;  2FXU A;  2ZGZ A;  3L0Q A;  3CCQ N;  2P9P A;  5ADX A;  3FZK A;  3RSE B;  1X3N A;  3PIP L;  4IOC L;  1YIJ N;  3CCL N;  3MWT A;  1NM1 A;  2NRR A;  1ATS A;  4PKG A;  3ZYY X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...