3ZX2A

Ntpdase1 in complex with decavanadate
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
406
structure length
396
Chain Sequence
NVKYGIVLDAGSSHTNLYIYKWPAEKENVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGSSTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNNSHCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Evidence for a Domain Motion in Rat Nucleoside Triphosphate Diphosphohydrolase (Ntpdase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
total genus 123
structure length 396
sequence length 406
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx2A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx2A02
3O80A 2PBDA 1BG3A 1ZC6A 1RFQA 4EFHA 2QW9A 1GLBG 3P4IA 1QQMA 3CJBA 2F9TA 1QQNA 2CH5A 3WQUA 1BO5O 3VERA 1SAZA 3HSCA 4FSVA 5F2RA 2HF3A 3HI0A 3EKSA 4Z94A 5E26A 4A62A 3LM9A 3R6MA 4CZHA 5AQSA 2VWBA 2P9KB 3QICA 2Q0UA 4NO7A 3TPQA 4CI6A 5JLFA 2IVOA 3ZX3A 4B9QA 5ADXH 4BC3A 1ATSA 4A2BA 2GTDA 1G99A 1V4SA 3H46O 5E84A 1ATNA 5EVZA 2FSNA 2ITMA 3CERA 4H0XB 5LJVA 5AQUA 2GELA 4B1ZA 1NGJA 4BVPA 3U9DA 4BG8A 1U2VA 3VPZA 2A5XA 1BUPA 1NGAA 1JCGA 3CHWA 1EQYA 2A41A 1HJOA 5EX5A 4WQ4A 1X3NA 1JCFA 4K42A 1J6ZA 3D2EA 3GE1A 4FWRA 1TUYA 2E20A 2A3ZA 4CZMA 4ISEA 2P9LA 1P8ZA 2E1ZA 3CJ1A 2P9IB 5LJWA 3D2EB 1SZ2A 4H03B 5B8HA 1GLEG 2HF4A 2ASOA 1GLAG 4BR4A 2FXUA 3O6WA 3WEEA 1ESVA 3IDHA 1BA1A 4H0TB 3KZBA 2NLXA 4EHTA 2FSKA 3VETA 3H1VX 3A0IX 4FWKA 1ATRA 1TUUA 2P9NB 2GUPA 3KVGA 3ZX2A 4MO4A 3O8MA 1KAXA 4GNIA 2Q97A 3JS6A 3LDLA 4ISFA 2GWKA 3C7NB 4XH5A 2EWSA 5AQWA 4B1UB 4Y0WA 3SMPA 3CQXA 5JMVA 5CE3A 4H5WA 2NZTA 5EXWA 4BROA 4CZFA 3ULEB 1NGFA 2W41A 4H5TA 2HOEA 3HTVA 4FPAA 1ZBSA 3VEOA 3M6GA 3J8AA 3FZLA 4BRDA 2QWOA 4E1JA 4BRHA 5BPMA 1S22A 4NB4A 3RSEA 2I7NA 2YJEA 2A40A 5AQKA 3ULEA 4IZ9A 1YAGA 3UB5A 5AQFA 2P9SB 5AQPA 4BRCA 1GLJO 2A42A 1MDUB 4BQZA 5JLHA 4WQ5C 3A5MC 2KHOA 1NGHA 5KQDA 5AFUH 3WT0A 1K8KB 1Z05A 3QB0A 4JHDB 5F0XA 4YDUA 3SJHA 5AZJB 4IXCA 4EHUA 4AM6A 5FPNA 1NGCA 1C0GA 4O8KA 4FL9A 5EOYA 3ZEUB 5I9EB 3OHRA 3O08A 1YXQA 1H1VA 3TU5A 4CD3A 1Y64A 2CGKA 4RWTA 3GDQA 2Q0RA 4BGBA 3G25A 1T6CA 3BUZB 5AR0A 1KXPA 2V52B 1HUXA 3MCPA 1YUWA 3CJ9A 4M7XA 4HWIA 3CQYA 3WQTA 1T44A 1OKJA 2I7PA 2QXLA 4H5NA 4FWNA 1MWMA 3VEYA 3CJ7A 3VEVA 2V7ZA 3C7NA 4A61A 3H6EA 3VEWA 1RGIA 3SLCA 3WXIA 5EY4A 1NGBA 3FE1A 4EAHD 1BU6O 1LOTB 1NGEA 4PL8A 2E2QA 4BR2A 4BREA 4CD1A 4CZJA 2NRHA 5BREA 2F9WA 4BC5A 3LDPA 5AQHA 3U9ZA 4BC4A 4BR0A 2QWPA 5KQ8A 4FWOA 3BF1A 5AQYA 3QBXA 3SK3A 3VGKA 4M63C 4BG9A 5AQXA 1S3XA 4GY2B 3VOVA 3DXKA 3VF2A 4O5FA 2P9SA 3C0BA 5AZIB 4BRKA 4H0YB 2E2PA 2E1YA 2QWQA 4H5VA 3WUHA 5BPLA 5BRHA 5ELZA 4PKGA 2E8AA 4JD2B 5FPDA 3WXKA 4BQLA 3D2FB 3O4WA 4FOEA 4MO5A 4RCHA 5AQRA 5BN8A 3F9MA 3LM2A 4WQ4C 1BOTO 3LL3A 3W3DA 1WUAA 1XQSC 3IMXA 3LDOA 4CZKA 4ISGA 1GLDG 2FF3B 1QZ5A 4BRPA 3EN9A 4B1YB 4H0PA 5BRDA 4XEIA 2P9UA 2DPNA 3VGLA 4RTFD 4JHDA 3ATVA 2E2OA 3AY9A 1TYQB 2BTFA 5F1XA 4FWLA 3FFKB 1CZAN 3AAQA 4J8FA 3FZHA 1U6ZA 3O1BA 3B8AX 1NWKA 4L3QA 5AQNA 2QWMA 4B1VA 1WOQA 4CZLA 5LY3A 4BRLA 1KAYA 3CIPA 1R59O 3UE5A 2H3GX 3QFPA 4H5RA 3ZX0A 3EL2A 4FWPA 2ZF5O 5JICA 4CBXA 2VCPA 3MN5A 5KPRA 1DGKN 2CGLA 3UKUB 1XC3A 5KPTA 5AQOA 2YI1A 3VEXA 3LDQA 5AQIA 1ZXOA 2ZGZA 3DAWA 1C0FA 3EKUA 2V7YA 3BF3A 2VYPA 3QFUA 1RDWX 1MWKA 2P9NA 1KAZA 4CBUA 1BWFO 4C23A 1HKCA 4FOIA 1YVNA 4F9OA 4I6MA 2IIRA 4JNEA 3CETA 4LC9B 3QBWA 5FPEA 3QDKA 3ATUA 3H45C 4I6MB 4WYBA 3VF4A 4BC2A 4BRGA 3DWLA 2GWJA 4H0VB 3IFRA 3A5LC 1K8KA 3A8YA 5AFUA 5AQLA 3A5OC 2UYTA 3D2FA 5AZIA 3DJCA 3L4IA 4BR5A 2GEMA 3JXUA 3HM8A 3SMSA 3FGUA 1HKGA 3KHYA 1NLVA 4BVOA 3MN7A 1HLUA 3BEXA 4QS8A 3FZMA 3UKRA 4XH4A 2YHXA 1DEJA 3L6QA 3LDNA 4FWMA 5AQZA 5BPNA 4K25A 3VEZA 4DCHA 1HKBA 1GLFO 4K41A 3VF6A 3FLCO 5AQJA 1SQKA 2P9PB 2ASMA 2QWRA 1NGDA 1QZ6A 5FPMA 3HBTA 4IO8A 2AA4A 2YJFA 4BR9A 2FLOA 3WXJA 2P9LB 4H0OA 4QS7A 3ID8A 4A2AA 3U8XA 3U4LA 1U2VB 3D7EO 2E88A 5BRFA 2D1KA 2Q36A 4JN4A 1Q18A 3IUCA 1XUPO 5AQGA 5AQQA 2Q31A 4BGAA 5KPZA 5AQVA 3R8EA 3CJCA 4BRFA 3FR0A 2ZWHA 4PL7A 1E4FT 2P9IA 1GLCG 4QS9A 3ZETA 3MN6A 3MK6A 3R9PA 3CI5A 4DB3A 1JCEA 5AQTA 4BRQA 2YHYA 4IJAA 4BRAA 2CGJA 1GLLO 1X3MA 2CH6A 3L0QA 3ZETB 2ZGYA 3I8BA 3H1QA 4JD2A 1QQOA 1T6DA 1BDGA 3DXKB 4BRIA 4FWQA 3M3ZA 3MDQA 5ADXA 2AP1A 4FPBA 4PKHA 4CZGA 3WXLA 4K43A 4B1XB 4CBWA 2WUSA 2D4WA 1NBWA 4XH1A 4MLEA 3RSEB 3O1WA 3CJAA 1HPMA 1NGGA 4FO0A 1IJJA 2QWLA 2P9UB 2V51B 5AQMA 2P9KA 2W40A 3AAPA 3AARA 4JAXA 3GG4A 3ZEUA 4M7YA 4IWVA 4EIAA 1NMDA 2D0PA 2D0OA 3UKRB 2FSJA 4HTLA 1TYQA 2BUPA 5TKYA 5AZJA 3DXMA 3MMVA 4IJNA 1BA0A 3A5NC 2YHWA 3ENOA 4CZIA 2Q1NA 3W0LA 2P9PA 1E4GT 1HX1A 1MA9B 4PKIA 4CZEA 3EZWA 3M1FA 2IVNA 3MN9A 3DXMB 4BRNA 3UKUA 5BN9A 4WQ5A 1Z6RA 4BRMA 2OANA 2QM1A 4B1WB 1V4TA 3ENHA 3GBTA 3VESA 2A6AA 3VENA 1NM1A 3S41A 3WEEB 3BP8A 2FF6A 4CJ7A 4AM7A 4YDUC 2YCHA 1NGIA 2HMPA 4DQ8A 4KBOA 3QMLA 3GOIA 3VGMA 4MLHA 1QHAA 2E2NA 4FWSA 2Q2RA 3HZ6A 4BR7A 1X9JA 3EO3A 1LCUA 3H3NO 2J4RA 3FZKA 2PAVA 1DKGD 4DHYA 2QWNA 2IVPA 1IG8A 1D4XA 2ASPA 3H3OB 3FZFA 5BR9A 3GL1A 3O5BA 3I33A
chains in the Genus database with same CATH superfamily
1WSHA 5CZ1A 3R3LA 1YHQN 4WF9L 2QW9A 4FM2A 1Q9YA 5C42A 3WQUA 3HSCA 3AVKA 5F2RA 3L2RA 3HI0A 3EKSA 5E41A 3R6MA 2P9KB 2IVOA 4KHQA 4B9QA 3OYJA 1RTDA 3CC7N 2GTDA 1NK5A 2FC0A 2FSNA 3HOTA 3ID6A 4B1ZA 1NGJA 4BVPA 3MEEA 3VPZA 4LF4K 4R79A 4CIFA 3DLLL 4KTZA 5GAEP 4F3TA 2O8DA 4CGHA 2QKBA 1X3NA 4KH5A 1KLMA 1J6ZA 3NGZA 3TABA 2E1ZA 4OKKA 3N4PA 3D2EB 3HK2A 1BQMA 1WSEA 4LSNA 1UAXA 1IV0A 1GLEG 3THXA 4HCCA 4IOCL 1RT3A 1VQ7N 3KZBA 3BZKA 4CK3A 3CCUN 1IBKK 2HNDA 3A0IX 4CESA 2YKNA 2ZM6K 3ZX2A 3KVGA 1CXUA 3LPTA 4MO4A 3VQDA 2O8BB 3VA0A 1KAXA 3K0SA 3JS6A 4ISFA 2GWKA 2EWSA 3NF7A 3CPWM 4H5WA 4AHTA 1S9GA 3AA3A 2HW3A 1OH7A 4DFPA 3O9QA 1A5XA 4DTMA 2W41A 4DR1K 4FVUA 2VQFK 4BACA 4IKFA 3FZLA 1K73O 1RTIA 4JKGA 3RSEA 1JLGA 2A40A 4DF8A 1DLOA 4IZ9A 3L2QA 4M3RA 5AQFA 3DLHA 1S1UA 5AQPA 3R1XA 2A42A 5JLHA 2IDOA 5KQDA 1BL3A 3C65A 3QEIA 3D0PA 3J80O 4C8LA 4IEEA 3QETA 5TKWA 4X66K 4CHPA 4F4KA 2QK9A 3BGRA 3KK2A 4EHUA 2ZJPL 4AM6A 4KV8A 1BISA 1NOZA 1C0GA 1OH6A 5EOYA 4DV5K 1IO2A 1GOBA 4RWTA 4WFNL 4JI8K 3BUZB 4EP4A 1KXPA 3CYMA 4JI5K 3N4QA 4HWIA 3CFPA 3OTOK 3V9XA 4H5NA 1MWMA 3H6EA 3HRGA 3ZSYA 2OTJN 5EY4A 3LZIA 3FE1A 4EAHD 1UA1A 1LOTB 4CD1A 4BREA 2W6KA 5M1QA 3CXCM 1X9WA 2F9WA 1RDAA 1JJ2M 4B9MA 5AJ3K 1VSDA 3AVLA 2D0AA 4HUEA 3U9ZA 3OJSA 4FWOA 2RHKA 3VQ4A 4RW4A 5AQYA 3SK3A 3MXIA 3ZYYX 4B9SA 3TSPA 4E1MA 3AVMA 1Q7YO 4GY2B 3VOVA 1OH5A 1ZBLA 4O5FA 1I94K 2RF2A 4KRFA 4YOVA 1HNWK 3O4QA 4M41A 4AILC 5BPLA 3KLIA 4BQLA 5FRMA 2HBJA 3LM2A 5GAHP 1BOTO 4FJLA 1VAZA 3W3DA 3EY1A 3IMXA 1QTMA 1BCMA 3DRRA 1QVFM 1GLDG 4B9TA 1Q8IA 3WNHA 3EN9A 3FFIA 4ID5A 3DYAA 4E7JA 4N76A 1X9MA 2P9UA 5D3GA 1VQ9N 4JKBA 4JHDA 3ATVA 4JEPA 1SUQA 5F1XA 4FWLA 1U48A 3PLAA 3FFKB 4ILGB 1U6ZA 2F8TA 4L3QA 3VQAA 3K58A 4YOTA 4KPYA 4BRLA 3SYZA 1KAYA 3VQPA 3OYDA 3UE5A 3QFPA 3TI0A 5HL7L 3ZX0A 3NE6A 3LP0A 2ZF5O 3VQCA 3ISNC 2VCPA 4CBXA 3NF6A 4MQ3A 2FBXA 2A1RA 3OA9A 3LDQA 2ZGZA 5HROA 1ZBUA 3CCVN 2HHTA 4J2BA 3QFUA 2W6LA 4GMJB 1MWKA 3DLBA 1KAZA 4CBUA 3T1AA 1WSJA 3V9ZA 1VQ6N 1RDUA 5DMRA 2KZMA 2RN2A 3QBWA 3CC2N 4CEDA 1LWEA 3ZSZA 4OLAA 4I6MB 4PA1A 4WYBA 3VF4A 5C25A 2QTDA 3IFRA 3NVKA 1K8KA 3A8YA 5AFUA 3A5OC 5AZIA 1N32K 3JXUA 3M8SA 3KHYA 3KJVA 4BVOA 1HLUA 2OZMA 4A59A 4O4GA 3VMFB 4XH4A 1HPZA 3Q7BA 4FK4A 3L6QA 3LDNA 3E9LA 4C8KA 2G8FA 3VEZA 4DCHA 1GLFO 1Q81O 3SJJA 3FLCO 1X9SA 1EX4A 1SQKA 2P9PB 5C12A 3HYFA 4JKDA 1C0UA 5FPMA 3OBWA 5M1PA 3LDSA 3A2FA 3B6OA 3U3GA 3ID8A 2HB5A 2O8CA 1JL1A 4A2AA 4J2DA 3LANA 2YNHA 3U4LA 1S1TA 4BWJA 1U2VB 4CFAA 2E88A 1ZBFA 2D1KA 4LFCK 4IG0A 5AQGA 4DTUA 2Q31A 3HP9A 5AQVA 3RMAA 4CHNA 3THYA 2DFEA 3P83D 2OPQA 1KVBA 2EHGA 4FLTA 3MK6A 3CI5A 4LFBK 4DB3A 3ZT3A 1JCEA 3RVCA 4IJAA 2O8FA 3WXMB 1X3MA 2G8VA 1NOYA 4AHUA 5J2PA 1SV5A 2ZGYA 4JRPA 1QE1A 1BDGA 1HNVA 3M3ZA 3MDQA 3KK1A 4OKJA 4HTUA 4MLEA 1Z26A 3ZT1A 4FXDA 4FO0A 2Z1IA 1ITGA 1SL2A 2QWLA 2OTLN 1U4BA 2P9KA 3DLRA 4X64K 3TAGA 4FJ8A 3AARA 1VSLA 3GG4A 3ZEUA 1YTAA 4NCGA 4DSEA 4GVMA 4EIAA 3ZSRA 2D0PA 4BDZA 1ILYA 2FSJA 4G1QA 4N5SA 4MFBA 4UQGA 3OYFA 5TKYA 1L3SA 1A5VA 3A5NC 4CZIA 2Q1NA 3V4IA 3HO1A 1MA9B 1RDBA 2OA8A 1BQNA 1S1VA 4CZEA 3M1FA 4NYFA 3OYAA 3SV3A 3AO5A 4W5RA 3U6FA 1D8YA 4RW6A 4JS5A 1NK8A 1VK0A 4B3TK 3MAQA 2QM1A 4B1WB 3VESA 1KLNA 3K2PA 4EZ9A 4YOUA 4JKAA 3MEGA 4O55A 3T7ZA 1BHLA 1FJGK 2IGIA 4AM7A 4CJLA 3K9KA 4DQ8A 4M45A 5A2QO 3CFRA 1VRUA 3QEVA 4JRQA 2Y1JA 1NK4A 1QHAA 2E2NA 4JYAK 4ELUA 1YJNN 4FZZA 4DFJA 1OVYA 1J5OA 1S5JA 4KAZA 2PAVA 2D0BA 4DHYA 4CJ5A 4LF5K 3E66A 3FZFA 3I33A 3AGRA 1Z25A 1L3UA 1IKYA 1FK9A 4M3ZA 2G8HA 3AA5X 1GLBG 4O44A 1T03A 4DR6K 1QQNA 2CH5A 2F8SA 1BO5O 1VSFA 4C8OA 3PUFA 4C8NA 4DTXA 4DV7K 2HHSA 3IS9A 2HF3A 3S9HA 3SPYA 4FLUA 3QEPA 3V1QA 2Q0UA 4ELVA 5JLFA 2IC3A 3ZX3A 2WTUA 4BC3A 4E0DA 1HYVA 1ATSA 4FJNA 4K8ZA 1G99A 3QNNA 4C1NK 5E84A 1ATNA 3HPGA 3T19A 3CERA 4H0XB 5AQUA 2GELA 4DQRA 1GOAA 4BDYA 3K5OA 1BUPA 1JCGA 1KCFA 4M3WA 3CHWA 1EQYA 2A41A 1HJOA 4ID1A 5EX5A 3PO5A 1JCFA 2XY5A 2LSNA 3OYHA 2F96A 1TUYA 1U04A 2A3ZA 1LV5A 2P9LA 1WN7A 3CJ1A 3DMJA 1RDDA 1N34K 4DMNA 3G71N 5B8HA 4LFAK 3K5NA 2YHAA 3DOLA 4DU3A 4O0IA 5J2QA 4LH4A 3E01A 2HHVA 1BA1A 2UUBK 1XMQK 3V81A 3H1VX 1ATRA 1TUUA 3KIOA 5IT9O 3VQBA 4NLCA 3O8MA 1R0AA 1EWRA 2JGUA 3S3OA 3LDLA 3C7NB 4B1UB 2O8EB 5JMVA 5CE3A 5I3UA 4CE9A 5EXWA 4U7BA 1D9DA 3HTVA 3QNOA 1XHXA 4FPAA 1ZBSA 5JS2A 2P51A 1GOCA 2QWOA 2I7NA 3AVNA 3OJUA 4O5BA 1YAGA 4C8MA 3SCXA 3QESA 1D5AA 4OO1J 4WQ5C 2ZJRL 4B3SK 4Q5VA 4BWMA 1S6PA 5EU7A 1JLEA 3VQQA 1KC8O 1K8KB 1RBVA 2BH1A 2RKIA 3QB0A 4JHDB 3BZCA 3SJHA 4M42A 1TKZA 2VG6A 4HUGA 3KLFA 3JSMA 4M3TA 5FPNA 4FL9A 5I9EB 4K8XA 3AVCA 4CD3A 1IKXA 4DS5A 1T6CA 5AR0A 4CEEA 3CCEN 4KI6A 4KHNA 1JLBA 3CCSN 1HUXA 3MCPA 3CJ9A 3I0RA 4IFEA 3CQYA 3WQTA 5KI6A 3HJFA 1DT9A 1T44A 4FWNA 5HBMA 3THXB 2KTQA 3ALYA 4A61A 4I2PA 5M1NA 4CFDA 4LF9K 1RGIA 5DK5A 3D45A 3SLCA 2E6MA 3WXIA 1NGBA 2X6SA 4PL8A 1NGEA 1TK0A 2E2QA 3OYEA 3HVTA 5HRPA 1LW2A 4DV3K 4DV6K 5AQHA 3PX6A 4BC4A 3NDKA 3NH2A 4JLHA 3TSQA 3QBXA 2BE2A 3VGKA 3VQ6A 1JXBA 3SAFA 4DV2K 3V1RA 4AHRA 5AQXA 2F7TA 2XHBA 5AZIB 4H0YB 2E2PA 5GINA 4DTNA 1CXQA 2ZD1A 4B8CA 1JXEA 5ELZA 1EKEA 4PKGA 2E8AA 3WXKA 4LD0A 2G8WA 1KFSA 5AQRA 4CF1A 2GBZA 4PHTX 1ASUA 1WUAA 2D5RA 3PSFA 4CHQA 4YOWA 3LDOA 4CZKA 4OPKA 2FF3B 4DTOA 1IBMK 4BRPA 4DTPA 4B9LA 4B1YB 4H0PA 3L3UA 2PYJA 3OYBA 4K0KK 4LSLA 3VGLA 4RTFD 1BI4A 1RT7A 4KB0A 3AY9A 2BTFA 4O8UA 3AAQA 4J8FA 3KWIA 1QQCA 4DR2K 3PX4A 1IH7A 4Z4GA 3OYNA 1NWKA 5J1EA 4LY7A 3ZCMA 1WOQA 4CZLA 3SQ1A 4PQUA 3TARA 4H5RA 1RDCA 2JWLA 4OKEA 2KW4A 5JICA 4DSJA 2YX6A 2OPSA 4KO0A 3SAHA 4CHYA 2KFNA 2JLEA 5AQOA 4JI0K 5AQIA 5HOOA 2O4GA 4GKKK 3VN5A 3DRPA 3HL8A 1M1KO 3EKUA 1EXQA 5LL6Z 2R7YA 4LF6K 3E9PA 3IKMA 4DFKA 2P9NA 3L8BA 4C23A 1VRTA 1W2BM 1IG9A 2B4JA 2HBMA 3LWLA 4BY9C 1KFDA 5FPEA 4DSFA 1KD1O 3ATUA 4DTJA 4BRGA 4JKFA 1TKXA 3DWLA 4Z4EA 2GWJA 4H0VB 3A5LC 4HCBA 4N47A 1N6QA 2UYTA 3DJCA 3C6TA 3L4IA 1NKBA 3AVBA 3S3MA 4CFCA 5JVGL 1NK6A 3T1HK 3MN7A 1VQPN 5SZTA 1QHTA 3O3FA 4UY8O 3UKRA 3G10A 3MXMA 3AGKA 4K25A 3TTDA 3KTQA 1HKBA 2OCEA 3VF6A 1RT4A 2HMIA 3PO4A 1NNEA 2QWRA 4IO8A 5HLFA 2YJFA 1HNZK 4BR9A 2XRIA 4AHCA 4FLWA 4FJ5A 2P9LB 4IDHA 3KD1E 3U3YA 4WCEL 3MX2A 3H08A 4FZXC 4H8KA 2BGGA 4CJVA 4Z4FA 2Q36A 1Q18A 3NGIA 3OYLA 4FJMA 1XUPO 3K9JA 5AQQA 5KPZA 1RNHA 3MX5A 4CK1A 3EE8A 4PL7A 1E4FT 4M3UA 4IEIA 1GLCG 4QS9A 3ZETA 3CG7A 3NGYA 3MN6A 3J7YP 3R9PA 4CCHA 4DR7K 2VGMA 5AQTA 2YHYA 3RMCA 4BRAA 1NJWA 1HQUA 2B6AA 2CH6A 2HHWA 4JKHA 4CEZA 3J7ZO 3L0QA 4AQYK 3CM6A 1OVQA 4BRIA 3DXKB 3OYCA 4U67L 4FJIA 4FWQA 4PKHA 3AVFA 3HOSA 3OS0A 1YITN 5LMNK 4CBWA 2VG7A 3Q7CA 1NBWA 4C1NI 3LP1A 3O1WA 1RT2A 1HPMA 1RILA 1T3VA 1C0TA 4E19A 3PIPL 4KFBA 1X1PA 5AQMA 4CEQA 1D9FA 4DV4K 1Y97A 3CPEA 4AHSA 1RBSA 3QEXA 4FLYA 5DM6L 1WBBA 3KD5E 2GX9A 2D0OA 1JLFA 2X74A 5FLXO 4A5AA 4HTLA 1TYQA 3MMVA 1NMNA 3ENOA 4MDBA 1SKWA 4X62K 2P9PA 1E4GT 4ZHRA 4JI2K 1HX1A 3OY9A 3HT3A 4O0JA 2OYQA 3EZWA 1SKSA 2IVNA 1DTTA 4BRNA 3QIPA 3SPZA 4DR4K 4WQ5A 2O8CB 2YNFA 4FJXA 1JL2A 3RR7A 2A6AA 4BE2A 3VQEA 3VENA 1N8RO 2WONA 3WEEB 3AV9A 3EYZA 2NNWA 1ZBIA 4DU4A 4J2AA 2X6NA 4MLHA 3O3GA 1WSFA 1FKPA 2NRRA 3THYB 1VQON 4CF8A 3SQ2A 1HQEA 1Q9XA 1RCHA 1X9JA 3EO3A 1L5UA 1IKWA 1S6QA 5FROA 3H3OB 4CJQA 4WFBL 4I9LA 2HHQA 2PBDA 5C15A 1BG3A 3T1YK 1SKRA 1ZC6A 1RFQA 5HRNA 1FW6A 4EFHA 3M8QA 3CJBA 1VHXA 2F9TA 3L3VA 3VERA 3NAEA 3OS1A 4DWIA 1KTQA 5JVHL 1NJXA 4F8RA 3DLGA 4M3XA 4Z94A 4A62A 5BR8K 1VQLN 3TAMA 2NRVA 2WOMA 1LAVA 2VWBA 3QICA 3CCRN 2QXFA 4CI6A 5ADXH 4A2BA 1YF5L 4AHVA 4DG1A 4CJPA 3L4QA 1HMVA 1S1WA 1HNXK 1VSMA 3O9RA 5EVZA 3OVNA 4CJRA 1O13A 2UXBK 3V9WA 1U2VA 3CMEN 2A5XA 2PY5A 3JAMO 5HP1A 4K42A 3S3NA 3D2EA 2P1JA 3GE1A 4W5OA 3TAQA 2E20A 1J54A 1RBTA 4ISEA 4NCBA 2P9IB 4NCAA 4DSIA 1TGOA 1F21A 1SZ2A 4H03B 3SUNA 4IFVA 4E7IA 2ASOA 3ZLJA 3B6PA 1E3MA 4CFBA 2O8BA 4IDKA 1ESVA 2YKMA 4CW7B 2NLXA 1XI1A 3SQ4A 2FSKA 3VETA 4BE0A 1TKTA 5C2DA 1VQNN 4FWKA 3I55N 2P9NB 2GUPA 5HRRA 4J2EA 1NJIO 4CHZA 3WNGA 2Q97A 3AVHA 2DFHA 3PSIA 4XH5A 4YNQA 4Y0WA 3SMPA 4BDPA 3THVA 1W7AA 3MXJA 5SWMA 4TSXA 1C0MA 1HRHA 4CZFA 4WE1A 3NHGA 4E7HA 3V1OA 3LALA 4H5TA 1TVRA 2HOEA 2G8KA 1J5EK 4ILJA 3VEOA 4JI7K 3AA2A 3P39A 1S22A 4NB4A 2YJEA 3E1YA 4ZTJA 1NKEA 5AQKA 3C6UA 2IS3A 3L2WA 3CCMN 4ELTA 4ZTFA 1B9DA 5LMUK 3ZSQA 3TTFA 2DY4A 3WT0A 4RW7A 4JI1K 4QOZB 1CLQA 2DFFA 4KHYA 1YJ9N 4CJSA 1VQKN 4YDUA 4AH9A 3G4SN 5AZJB 4IXCA 4E89A 4FJKA 4KHUA 4O8KA 1ZYQA 2QA4N 4G9ZA 3OHRA 4NLBA 1YXQA 1H1VA 1Y64A 2CGKA 1OH8A 5C2FA 2Q0RA 4BGBA 3WNEA 3SUPA 3G25A 4DSLA 2KQ2A 4M7XA 3VA3A 2I7PA 2QXLA 1NK7A 3AVIA 3QIOA 1WAFA 3VEVA 3ZSOA 4GKJK 2NRZA 4RW9A 3VEWA 3O3HA 1WBDA 4NXNK 1IKVA 3EZ5A 4KREA 3ULDA 1BU6O 1W9HA 4KB1A 4BR2A 4YOYA 1M90O 3V9UA 2ITGA 4DU1A 3UIQA 4CZJA 5J2MA 5BREA 1EWQA 1NJYA 4Y1CA 3LWMA 3LDPA 3QERA 2NRWA 2E4LA 4BR0A 5KQ8A 3BF1A 4M63C 3J81O 3NF8A 1W0HA 3KK7A 3DXKA 3VF2A 4DLGA 3C0BA 4CJ3A 3CD6N 2QWQA 2E1YA 5GADP 2O4IA 1DTQA 4CVNE 4CGJA 2PFUA 4JD2B 2AJQA 4FOEA 3AO2A 1TL3A 4WQ4C 1U49A 1XC9A 3O9TA 4ISGA 4JI4K 3PIOL 3TSUA 1J9AA 4DF4A 1VSIA 2DPNA 4CEBA 4EZ6A 1TYQB 4FLZA 1YVUA 3FZHA 2ZE2A 3O1BA 2Z1JA 3TANA 2QWMA 3M5RA 3LAMA 4CGGA 5FDLA 5LY3A 3I56N 3KK3A 4CJFA 4OGCA 2Z1HA 3EL2A 1JLQA 2E5LK 1P90A 3IRXA 3MN5A 3KLEA 2RE2A 5KPRA 3ZSXA 2CGLA 3O9SA 1XC3A 5C24A 5M1KA 4OJRA 2KLAA 1JLCA 3VTIA 1ZXOA 1C0FA 2V7YA 3BF3A 2XY8A 4CJTA 1W97L 1G15A 1RDWX 2IAJA 3OYGA 1SL1A 4DTSA 4KHPK 2PZSA 1YVNA 4I6MA 4Z4CA 1RBUA 3CETA 3I0SA 2HHUA 3RRHA 3NH1A 4IOAL 3DLEA 3QDKA 4HVJA 1RT6A 3H45C 3OYKA 4FCYA 3TTCA 4BC2A 3V9SA 1QS4A 4X65K 1LWFA 1EETA 1LAWA 4DR5K 3ZSVA 3D2FA 1T7PA 4DV0K 4B9VA 2GEMA 4OLBA 3HM8A 3SMSA 5KRSA 1HKGA 4FK2A 1NLVA 3SUOA 2HHHK 1QVGM 4DV1K 4N56A 4QS8A 1ASVA 3FZMA 4FWMA 5AQZA 3HVRA 2E6LA 3MWPA 4K41A 5AQJA 1VQ5N 2ASMA 4DSKA 3KWGA 5IWAK 4W5TA 2FLOA 3WXJA 3AO3A 2VWJA 5M1OA 4H0OA 4B9UA 3CCJN 3NMUA 4FJ7A 3SI6A 3M8RA 1TKDA 2BANA 1Q86O 3D7EO 3K5MA 1I39A 1C1CA 3M8PA 3E9OA 2GV9A 3ZT0A 2P5OA 4Z0UA 4JN4A 1C6VA 5KGXA 3NBPA 3RMDA 2XY7A 2A1SA 4BRFA 3FR0A 2YHBA 3TWHA 2ZWHA 2P9IA 3CFOA 4E1NA 4BRQA 1XMOK 2CGJA 2EX3A 4YY3K 1GLLO 1CZBA 1SL0A 1B92A 3I8BA 3H1QA 2HNYA 1T6DA 4IFYA 2UU9K 3OYIA 4NXMK 5ADXA 2AP1A 4FPBA 4CZGA 3WXLA 4K43A 4B1XB 4DLEA 3C6HA 4JKGB 3RSEB 2FBTA 3CJAA 4B8AB 1MU2A 1NG9A 1IJJA 4GV3A 2ZQBA 2V51B 4CHOA 3AAPA 2NUBA 4IWVA 1NMDA 1RBRA 1TK5A 3O4NA 4IOXA 3UKRB 1BIUA 4YOXA 4DFMA 5AZJA 4IJNA 1BA0A 3T69A 3RR8A 2YHWA 3OW2M 1HYZA 3IG1A 4NYNA 3W0LA 2W42A 1KRPA 4JK8A 4PKIA 4FK0A 3MN9A 3K59A 3UKUA 4OPAA 5BN9A 1XNQK 3ITHA 1V4TA 3ENHA 1O1WA 1KVCA 1VQ4N 3O9UA 1VSKA 3LP3A 4CJ7A 4YDUC 4B3MK 2YCHA 1L3VA 2HMPA 3IAYA 3QMLA 3GOIA 2FBVA 4BR7A 3H3NO 4M3YA 4R5PA 3G6EN 1DKGD 2QWNA 2IVPA 3SQ0A 1D4XA 5BR9A 3GL1A 1EP4A 3O80A 3AO4A 1TL1A 3MECA 2GUIA 4LF8K 2VGNA 1NKCA 4CEFA 4FVMA 3P4IA 4FJGA 4KI4A 1QQMA 1XNRK 3P1GA 5H1SQ 4JS4A 3F9KA 1SAZA 1YT3A 3QEWA 4FSVA 3VQ5A 5E26A 3LM9A 4CZHA 3VTHA 2F4VK 5AQSA 2Q3SA 3TPQA 4NO7A 4FJ9A 2Z1GA 4JK7A 3HM9A 3NFAA 1V4SA 4ILHA 3H46O 3ASMA 2ITMA 5HRSA 4ICLA 1FXXA 5LJVA 3AA4A 2YNIA 2UXDK 4W5QA 3K5LA 3U9DA 3MCAB 4BG8A 4KTQA 4B3OA 4FJHA 4LH5A 1NGAA 1FKOA 5CR4A 3TR8A 4WQ4A 2VQEK 5C0YA 4JKCA 4PUOA 2KFZA 4FWRA 4JKEA 4PY5A 4CZMA 5GIPA 1P8ZA 1JKHA 4DS4A 4H4OA 1RT1A 4FYDA 5LJWA 2HSTA 1UOCA 4IBNA 1RTHA 5I42A 3I8DA 2HF4A 1GLAG 4BR4A 4KHSA 2FXUA 3O6WA 3WEEA 3IDHA 1T8EA 4H0TB 2Y1IA 4EHTA 4CEOA 3C6AA 3VQ7A 4GV9A 4OPJA 3NVMA 3THWA 4DUYK 4LF7K 4JI6K 4GNIA 1YI2N 2VWKA 5AQWA 3LZJA 3NH0A 3CQXA 4CJ4A 4I2QA 2NZTA 5FRNA 4Z4IA 4Q0BA 1WSIA 4CIGA 4BROA 3TAPA 3ULEB 2HNZA 1NGFA 5CYMA 2HBKA 1TK8A 3KLGA 2D0CA 4Z4HA 3M6GA 3J8AA 4BRDA 5BPMA 4E1JA 4BRHA 3V6DA 5CY4A 3ULEA 2DTUA 1HR0K 3UB5A 2P9SB 1YIJN 2HVIA 4BRCA 1GLJO 4BQZA 1MDUB 3CF5L 4I9QA 3A5MC 2KHOA 1NGHA 2HBLA 1T05A 4MDAA 1UA0A 5AFUH 3C95A 3F73A 2UUCK 1Z05A 3SZ2A 5F0XA 4CJKA 4OGEA 3KLHA 3SAGA 1NGCA 1LWCA 3DI6A 3SNNA 4CIEA 3ZEUB 4OVLA 3LP2A 5KGWA 4IO9L 3O08A 3TU5A 1U47A 3GDQA 1BI4B 3JYTA 4L8RB 1QSYA 2V52B 1YUWA 4B3RK 1S72N 5J2NA 1OKJA 3P31A 3VEYA 5CZ2A 4YORA 3CJ7A 2V7ZA 3C7NA 4CF9A 1QSLA 1TAUA 4DQSA 3LPUA 2O8FB 2NRHA 3ENBA 1QSSA 4CECA 4BC5A 5M1FA 4YFUA 1LW0A 4RG8A 3RTVA 2QWPA 1TV6A 2XO7A 4BG9A 1S3XA 1RTJA 4F3OA 2P9SA 3LAKA 4BRKA 2G8UA 3AO1A 1KVAA 4H4MA 4QCLA 4GVEA 3RMBA 4H5VA 3WUHA 3OYMA 5BRHA 2NRTA 3HP6A 2OZSA 5FPDA 1TAQA 3D2FB 3O4WA 4MO5A 4RCHA 3TAFA 5BN8A 4HUFA 3F9MA 5CYQA 3LL3A 1WSGA 1XQSC 3EE9A 4FW2A 1YTUA 1QZ5A 2YNGA 5BRDA 2OPRA 3CC4N 4XEIA 1NU0A 2E2OA 3L2UA 5KRTA 2JWKA 4KHWA 1CZAN 4B08A 1VSHA 5CHIA 1N5YA 3ZSWA 1KSPA 3CM5A 3B8AX 5AQNA 3DOKA 4CGDA 4FM0A 5JS1A 4FW1A 4B1VA 2ZJQL 3SBGA 1EO1A 2RPIA 1VQMN 4KTWA 3G0ZA 3HPHA 1JLAA 3CIPA 1C1AA 1R59O 2H3GX 3F5TA 2QKKA 3QINA 3PV8A 4DQPA 4FWPA 2QI2A 3NF9A 3L2VA 3SV4A 4CF0A 1VSEA 1DGKN 3UKUB 5KPTA 2YI1A 3VEXA 3C94A 1HJRA 2NRXA 3NCIA 1IBLK 3DAWA 3F2KA 3CMAN 2P5GA 2VYPA 3KKSA 4CJUA 4KH6A 1VSJA 4CF2A 4CJEA 1BWFO 2WBNA 1HKCA 4FOIA 5T7BA 3QO9A 4F9OA 3QLHA 3HPOA 1WLJA 2IIRA 4JNEA 1NK0A 4LC9B 3VQ8A 4CGFA 4PWDA 3HXMA 4JK9A 4KH4A 3OS2A 4BE1A 2UUAK 1NJZA 3AVGA 1VQ8N 1J53A 3BDPA 4EP5A 4E3SA 5AQLA 3J7AP 2O8DB 4BR5A 2XY6A 4YHHK 1U45A 5K14A 3FGUA 4AF1A 4GV6A 4WFAL 1N33K 3BEXA 5KTQA 2YHXA 4FZYA 1DEJA 1REVA 4F2RA 5BPNA 1S1XA 1B9FA 1NK9A 4GW6A 2VG5A 2KKZA 2FBYA 4F2SA 1NGDA 1QZ6A 1L3TA 3HBTA 2AA4A 2OPPA 2UXCK 4QS7A 4DR3K 2HHXA 1BGXT 1ZBHA 3U8XA 4XIUA 1HNIA 2I5JA 5BRFA 3WNFA 3IUCA 2BDPA 2QEXN 3CCLN 3CQ8A 4BGAA 5GAGP 3R8EA 1N36K 3CJCA 4FLVA 4V19S 3MWTA 3OBYA 4Y1DA 3SUQA 4OPHA 3DM2A 1RT5A 1I3AA 2B5JA 1SS6A 5C10A 4I7FA 4B9NA 4DQQA 4QAGA 4CGIA 3VQ9A 4W5NA 3THWB 3T3FA 4HHTA 4CEAA 3ZETB 4JD2A 2ETJA 1QQOA 3DRSA 5GIOA 4E7LA 1WAJA 1BCOA 4N41A 4KKOA 2IOCA 2WUSA 4CERA 2D4WA 4XH1A 3BY5A 1WB9A 1C1BA 1NGGA 5DM7L 2P9UB 3K57A 1K6YA 2HVHA 1HYSA 2W40A 2KZZA 4FLXA 1CZ9A 2PYLA 3MEDA 4JAXA 3SBTA 4M7YA 4RW8A 3P38A 1K9MO 1WNSA 4IG3A 3P5JA 1YJWN 2BUPA 3DXMA 2ATQA 3HSTB 3PY8A 3ZT2A 4OX9K 4CJWA 3KKRA 3DXMB 4JI3K 3PX0A 3ZT4A 1Z6RA 4A5BA 4BRMA 4CK2A 2OANA 1S9EA 3GBTA 1A5WA 2WFBA 1NM1A 4E7KA 3S41A 3AVAA 3BP8A 2X78A 2FF6A 4A57A 2G8IA 3EEQA 1KQSM 4FJJA 3TAEA 2YV0X 4DUZK 1K8AO 1NGIA 4DQIA 4KBOA 3DLKA 3RWUA 3VGMA 3RRGA 4FWSA 1BIZA 4JV5K 2Q2RA 1XHZA 3HZ6A 2WC9A 3D6RA 3CCQN 1LCUA 2O8EA 2J4RA 4FM1A 3FZKA 1Q82O 4DTRA 5MLCQ 3AVJA 1IG8A 1XWLA 2ASPA 1ASWA 4DKWA 1UWBA 3O5BA
chains in the Genus database with same CATH topology
3O80A 2PBDA 3AGRA 1BG3A 5C15A 1ZC6A 3R3LA 1RFQA 1YHQN 2VGNA 4WF9L 4EFHA 2QW9A 1GLBG 3P4IA 1QQMA 3CJBA 2F9TA 1QQNA 2CH5A 3WQUA 1BO5O 3VERA 5H1SQ 1SAZA 3HSCA 4FSVA 5F2RA 5JVHL 2HF3A 3HI0A 3EKSA 4Z94A 5E26A 4A62A 3LM9A 1VQLN 3R6MA 2NRVA 4CZHA 3VTHA 5AQSA 2VWBA 2P9KB 3QICA 2Q0UA 4NO7A 3TPQA 3CCRN 4CI6A 5JLFA 2IVOA 3ZX3A 4B9QA 5ADXH 4BC3A 4JK7A 1ATSA 4A2BA 1YF5L 3CC7N 2GTDA 3L4QA 1G99A 1V4SA 4ILHA 4C1NK 3H46O 5E84A 1ATNA 3O9RA 5EVZA 2FSNA 2ITMA 3HOTA 3ID6A 3CERA 4H0XB 5LJVA 5AQUA 2GELA 4B1ZA 1O13A 1NGJA 4BVPA 3U9DA 3MCAB 4BG8A 1U2VA 3VPZA 3CMEN 4R79A 3DLLL 2A5XA 1BUPA 1NGAA 5GAEP 1JCGA 3CHWA 5CR4A 1EQYA 2A41A 1HJOA 5EX5A 4WQ4A 1X3NA 1JCFA 4KH5A 4K42A 5C0YA 1J6ZA 4JKCA 3D2EA 3GE1A 4FWRA 4JKEA 1TUYA 2E20A 2A3ZA 4CZMA 4ISEA 5GIPA 2P9LA 1P8ZA 2E1ZA 3CJ1A 2P9IB 3N4PA 5LJWA 2HSTA 3D2EB 1SZ2A 4H03B 3G71N 5B8HA 1GLEG 2HF4A 2ASOA 1GLAG 4BR4A 2FXUA 3O6WA 3WEEA 1ESVA 3IDHA 4IOCL 1VQ7N 1BA1A 4H0TB 3KZBA 2NLXA 4EHTA 2FSKA 3VETA 3CCUN 5C2DA 3C6AA 3H1VX 3A0IX 4FWKA 1ATRA 1VQNN 3I55N 1TUUA 2P9NB 2GUPA 3KVGA 3ZX2A 4GV9A 1NJIO 3NVMA 4MO4A 4NLCA 3O8MA 1KAXA 4GNIA 2Q97A 3JS6A 1YI2N 3LDLA 4ISFA 2GWKA 3C7NB 4XH5A 2EWSA 5AQWA 4B1UB 4Y0WA 3SMPA 3CPWM 3CQXA 5JMVA 5CE3A 4H5WA 2NZTA 5EXWA 4BROA 4CZFA 4U7BA 3ULEB 3O9QA 1NGFA 2W41A 4H5TA 4FVUA 2HBKA 2HOEA 3HTVA 4FPAA 1ZBSA 4ILJA 3VEOA 3M6GA 3FZLA 3J8AA 4BRDA 2QWOA 4E1JA 3P39A 4BRHA 5BPMA 1K73O 1S22A 4NB4A 4JKGA 2I7NA 2YJEA 3E1YA 2A40A 3RSEA 5AQKA 3ULEA 3CCMN 4IZ9A 1YAGA 3UB5A 5AQFA 2P9SB 1YIJN 5AQPA 3R1XA 1GLJO 2A42A 1MDUB 4BRCA 4BQZA 5JLHA 3TTFA 4WQ5C 2ZJRL 3CF5L 4OO1J 3A5MC 2KHOA 1NGHA 2HBLA 3C65A 4MDAA 5KQDA 5AFUH 3WT0A 1KC8O 1K8KB 2BH1A 4IEEA 1Z05A 3QB0A 4JHDB 1YJ9N 5TKWA 5F0XA 1VQKN 4YDUA 3SJHA 3G4SN 5AZJB 4IXCA 4EHUA 2ZJPL 4AM6A 3SAGA 5FPNA 1NGCA 1C0GA 4O8KA 4FL9A 5EOYA 3ZEUB 2QA4N 5I9EB 4G9ZA 4IO9L 3OHRA 3O08A 1YXQA 1H1VA 4NLBA 3TU5A 1Y64A 2CGKA 4CD3A 4RWTA 4WFNL 3GDQA 5C2FA 2Q0RA 4BGBA 3G25A 1T6CA 3BUZB 5AR0A 1KXPA 3CCEN 3CCSN 2V52B 1HUXA 3MCPA 1YUWA 3N4QA 3CJ9A 4M7XA 1S72N 4HWIA 4IFEA 3CQYA 3WQTA 1DT9A 1OKJA 1T44A 2I7PA 2QXLA 3P31A 4H5NA 4FWNA 1MWMA 3VEYA 4YORA 3CJ7A 3VEVA 2V7ZA 3C7NA 2NRZA 3H6EA 3VEWA 4A61A 3HRGA 5M1NA 1RGIA 3SLCA 3WXIA 5EY4A 2OTJN 1NGBA 3FE1A 4EAHD 1BU6O 1LOTB 1NGEA 4PL8A 2E2QA 4BR2A 4BREA 4CD1A 4YOYA 5M1QA 1M90O 3CXCM 4CZJA 2NRHA 3ENBA 5BREA 2F9WA 1JJ2M 4BC5A 5M1FA 3LDPA 5AQHA 2NRWA 3U9ZA 4BC4A 4BR0A 2QWPA 5KQ8A 4FWOA 2RHKA 3BF1A 5AQYA 3TSQA 3QBXA 3SK3A 3VGKA 3SAFA 3ZYYX 4M63C 3TSPA 4BG9A 5AQXA 1S3XA 2F7TA 4GY2B 3VOVA 3KK7A 3DXKA 3VF2A 1Q7YO 4O5FA 2P9SA 3C0BA 5AZIB 4BRKA 4H0YB 2E2PA 2E1YA 2QWQA 5GADP 3CD6N 5GINA 4GVEA 4YOVA 4H5VA 3WUHA 5BPLA 5BRHA 2NRTA 5ELZA 4PKGA 2E8AA 2PFUA 4JD2B 5FPDA 3WXKA 4BQLA 3D2FB 3O4WA 4FOEA 4MO5A 2HBJA 4RCHA 5AQRA 5BN8A 3F9MA 3LM2A 5GAHP 4WQ4C 1BOTO 1VAZA 3LL3A 4PHTX 3W3DA 1WUAA 1XQSC 4YOWA 3IMXA 3O9TA 3LDOA 4CZKA 4ISGA 3EE9A 1QVFM 1GLDG 2FF3B 3PIOL 3TSUA 1QZ5A 4BRPA 3EN9A 4B1YB 4H0PA 5BRDA 3CC4N 4XEIA 2P9UA 2DPNA 3VGLA 1VQ9N 4JKBA 4RTFD 4JHDA 3ATVA 4JEPA 2E2OA 3AY9A 1TYQB 2BTFA 4O8UA 2JWKA 5F1XA 4FWLA 3PLAA 3FFKB 1CZAN 3AAQA 4J8FA 3KWIA 4ILGB 5CHIA 3FZHA 1U6ZA 3O1BA 3B8AX 1NWKA 4L3QA 5AQNA 2QWMA 3M5RA 4B1VA 2ZJQL 3SBGA 1WOQA 4CZLA 1VQMN 1EO1A 5LY3A 3I56N 4YOTA 4BRLA 1KAYA 3CIPA 1R59O 3UE5A 2H3GX 3QFPA 3F5TA 4H5RA 5HL7L 2JWLA 3ZX0A 3EL2A 4FWPA 1P90A 2QI2A 2ZF5O 5JICA 4CBXA 2VCPA 3MN5A 2YX6A 2RE2A 5KPRA 3SAHA 1DGKN 2CGLA 3O9SA 1XC3A 3UKUB 5KPTA 5M1KA 5AQOA 2YI1A 3VEXA 2KLAA 3OA9A 3VTIA 3LDQA 5AQIA 5HOOA 2NRXA 1ZXOA 2ZGZA 1M1KO 3DAWA 1C0FA 3EKUA 3F2KA 2V7YA 3BF3A 3CMAN 2VYPA 3CCVN 3E9PA 3IKMA 3QFUA 1W97L 4KH6A 1RDWX 1MWKA 2P9NA 1KAZA 4CBUA 1BWFO 4C23A 2WBNA 1HKCA 4FOIA 1W2BM 1YVNA 4F9OA 2HBMA 4I6MA 2IIRA 4JNEA 1VQ6N 3CETA 1RDUA 4LC9B 4BY9C 3QBWA 5FPEA 4IOAL 4JK9A 3CC2N 3QDKA 4KH4A 1KD1O 3ATUA 3H45C 4I6MB 4WYBA 3TTCA 4JKFA 3VF4A 4BC2A 4BRGA 3DWLA 2QTDA 1VQ8N 2GWJA 4H0VB 3IFRA 3NVKA 3A5LC 1K8KA 3A8YA 5AFUA 5AQLA 3A5OC 2UYTA 3D2FA 5AZIA 3DJCA 3L4IA 4BR5A 2GEMA 3JXUA 3HM8A 3SMSA 3FGUA 1HKGA 3KHYA 1NLVA 4AF1A 4BVOA 5JVGL 4GV6A 1QVGM 3MN7A 1HLUA 4WFAL 1VQPN 3BEXA 4QS8A 4A59A 4UY8O 3FZMA 3UKRA 3VMFB 4XH4A 2YHXA 1DEJA 3Q7BA 3L6QA 3LDNA 3E9LA 4FWMA 5AQZA 5BPNA 3AGKA 4K25A 3TTDA 3VEZA 4DCHA 1HKBA 1GLFO 3MWPA 4K41A 1Q81O 3VF6A 3FLCO 5AQJA 2KKZA 1VQ5N 1SQKA 2P9PB 2ASMA 5C12A 2QWRA 4JKDA 1NGDA 1QZ6A 3KWGA 3OBWA 5FPMA 5M1PA 3HBTA 4IO8A 2AA4A 2YJFA 4BR9A 2FLOA 3WXJA 2P9LB 5M1OA 4H0OA 4IDHA 4QS7A 3ID8A 4A2AA 4WCEL 3MX2A 3CCJN 3NMUA 3U8XA 3U4LA 1U2VB 1Q86O 3D7EO 2E88A 5BRFA 3E9OA 2D1KA 2Q36A 4JN4A 1Q18A 3IUCA 2QEXN 3CCLN 1XUPO 3K9JA 5AQGA 5AQQA 2Q31A 4BGAA 5KPZA 5GAGP 5AQVA 3R8EA 3CJCA 4BRFA 3MX5A 3FR0A 3EE8A 3MWTA 3OBYA 2ZWHA 4PL7A 1E4FT 2P9IA 4IEIA 4OPHA 1GLCG 4QS9A 3ZETA 1SS6A 3MN6A 5C10A 3MK6A 3R9PA 3CI5A 4DB3A 1JCEA 2VGMA 5AQTA 4BRQA 3RVCA 2YHYA 4IJAA 4BRAA 2CGJA 3WXMB 1GLLO 1X3MA 2CH6A 4JKHA 3J7ZO 3L0QA 3ZETB 2ZGYA 3I8BA 3H1QA 4JD2A 5GIOA 1QQOA 1T6DA 1BDGA 3DXKB 4BRIA 4U67L 4FWQA 3M3ZA 3MDQA 5ADXA 2AP1A 4FPBA 4PKHA 4CZGA 3HOSA 3WXLA 4K43A 4B1XB 1YITN 4CBWA 2WUSA 3Q7CA 2D4WA 1NBWA 4XH1A 3C6HA 4JKGB 4MLEA 3O1WA 3CJAA 3RSEB 4C1NI 1HPMA 1NGGA 1T3VA 4FO0A 1IJJA 3PIPL 5DM7L 4GV3A 2QWLA 2P9UB 2OTLN 2V51B 5AQMA 2P9KA 2W40A 3AAPA 3CPEA 3AARA 4JAXA 3SBTA 3GG4A 3ZEUA 4M7YA 4IWVA 5DM6L 4EIAA 1NMDA 3P38A 2GX9A 2D0PA 2D0OA 4IOXA 3UKRB 1K9MO 1ILYA 2FSJA 4A5AA 4HTLA 1TYQA 4YOXA 1YJWN 2BUPA 5TKYA 5AZJA 3DXMA 3MMVA 4IJNA 1BA0A 3T69A 3A5NC 2YHWA 3ENOA 4MDBA 4CZIA 2Q1NA 3OW2M 3W0LA 2P9PA 1E4GT 1HX1A 1MA9B 4JK8A 4PKIA 4CZEA 3EZWA 3M1FA 2IVNA 3MN9A 3DXMB 4BRNA 3UKUA 4OPAA 5BN9A 4WQ5A 1Z6RA 4A5BA 4BRMA 2OANA 2QM1A 4B1WB 1V4TA 3ENHA 3GBTA 3VESA 2A6AA 2WFBA 4YOUA 3VENA 4JKAA 1N8RO 1NM1A 1VQ4N 3S41A 3T7ZA 3BP8A 3WEEB 3O9UA 2NNWA 4A57A 2FF6A 4CJ7A 4AM7A 1KQSM 4YDUC 2YCHA 3K9KA 1K8AO 1NGIA 2HMPA 4DQ8A 4KBOA 3QMLA 3GOIA 3VGMA 4MLHA 1VQON 2NRRA 1QHAA 2E2NA 4FWSA 1YJNN 2Q2RA 1OVYA 3HZ6A 4BR7A 1X9JA 2WC9A 3D6RA 1LCUA 3EO3A 3H3NO 2J4RA 3CCQN 3FZKA 1Q82O 2PAVA 3G6EN 5MLCQ 1DKGD 4DHYA 2QWNA 2IVPA 1IG8A 1D4XA 3E66A 2ASPA 3H3OB 3FZFA 4DKWA 5BR9A 4WFBL 3GL1A 3O5BA 3I33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O80 A;  2PBD A;  1BG3 A;  1ZC6 A;  1RFQ A;  4EFH A;  2QW9 A;  1GLB G;  3P4I A;  1QQM A;  3CJB A;  2F9T A;  1QQN A;  2CH5 A;  3WQU A;  1BO5 O;  3VER A;  1SAZ A;  3HSC A;  4FSV A;  5F2R A;  2HF3 A;  3HI0 A;  3EKS A;  4Z94 A;  5E26 A;  4A62 A;  3LM9 A;  3R6M A;  4CZH A;  5AQS A;  2VWB A;  2P9K B;  3QIC A;  2Q0U A;  4NO7 A;  3TPQ A;  4CI6 A;  5JLF A;  2IVO A;  3ZX3 A;  4B9Q A;  5ADX H;  4BC3 A;  1ATS A;  4A2B A;  2GTD A;  1G99 A;  1V4S A;  3H46 O;  5E84 A;  1ATN A;  5EVZ A;  2FSN A;  2ITM A;  3CER A;  4H0X B;  5LJV A;  5AQU A;  2GEL A;  4B1Z A;  1NGJ A;  4BVP A;  3U9D A;  4BG8 A;  1U2V A;  3VPZ A;  2A5X A;  1BUP A;  1NGA A;  1JCG A;  3CHW A;  1EQY A;  2A41 A;  1HJO A;  5EX5 A;  4WQ4 A;  1X3N A;  1JCF A;  4K42 A;  1J6Z A;  3D2E A;  3GE1 A;  4FWR A;  1TUY A;  2E20 A;  2A3Z A;  4CZM A;  4ISE A;  2P9L A;  1P8Z A;  2E1Z A;  3CJ1 A;  2P9I B;  5LJW A;  3D2E B;  1SZ2 A;  4H03 B;  5B8H A;  1GLE G;  2HF4 A;  2ASO A;  1GLA G;  4BR4 A;  2FXU A;  3O6W A;  3WEE A;  1ESV A;  3IDH A;  1BA1 A;  4H0T B;  3KZB A;  2NLX A;  4EHT A;  2FSK A;  3VET A;  3H1V X;  3A0I X;  4FWK A;  1ATR A;  1TUU A;  2P9N B;  2GUP A;  3KVG A;  3ZX2 A;  4MO4 A;  3O8M A;  1KAX A;  4GNI A;  2Q97 A;  3JS6 A;  3LDL A;  4ISF A;  2GWK A;  3C7N B;  4XH5 A;  2EWS A;  5AQW A;  4B1U B;  4Y0W A;  3SMP A;  3CQX A;  5JMV A;  5CE3 A;  4H5W A;  2NZT A;  5EXW A;  4BRO A;  4CZF A;  3ULE B;  1NGF A;  2W41 A;  4H5T A;  2HOE A;  3HTV A;  4FPA A;  1ZBS A;  3VEO A;  3M6G A;  3J8A A;  3FZL A;  4BRD A;  2QWO A;  4E1J A;  4BRH A;  5BPM A;  1S22 A;  4NB4 A;  3RSE A;  2I7N A;  2YJE A;  2A40 A;  5AQK A;  3ULE A;  4IZ9 A;  1YAG A;  3UB5 A;  5AQF A;  2P9S B;  5AQP A;  4BRC A;  1GLJ O;  2A42 A;  1MDU B;  4BQZ A;  5JLH A;  4WQ5 C;  3A5M C;  2KHO A;  1NGH A;  5KQD A;  5AFU H;  3WT0 A;  1K8K B;  1Z05 A;  3QB0 A;  4JHD B;  5F0X A;  4YDU A;  3SJH A;  5AZJ B;  4IXC A;  4EHU A;  4AM6 A;  5FPN A;  1NGC A;  1C0G A;  4O8K A;  4FL9 A;  5EOY A;  3ZEU B;  5I9E B;  3OHR A;  3O08 A;  1YXQ A;  1H1V A;  3TU5 A;  4CD3 A;  1Y64 A;  2CGK A;  4RWT A;  3GDQ A;  2Q0R A;  4BGB A;  3G25 A;  1T6C A;  3BUZ B;  5AR0 A;  1KXP A;  2V52 B;  1HUX A;  3MCP A;  1YUW A;  3CJ9 A;  4M7X A;  4HWI A;  3CQY A;  3WQT A;  1T44 A;  1OKJ A;  2I7P A;  2QXL A;  4H5N A;  4FWN A;  1MWM A;  3VEY A;  3CJ7 A;  3VEV A;  2V7Z A;  3C7N A;  4A61 A;  3H6E A;  3VEW A;  1RGI A;  3SLC A;  3WXI A;  5EY4 A;  1NGB A;  3FE1 A;  4EAH D;  1BU6 O;  1LOT B;  1NGE A;  4PL8 A;  2E2Q A;  4BR2 A;  4BRE A;  4CD1 A;  4CZJ A;  2NRH A;  5BRE A;  2F9W A;  4BC5 A;  3LDP A;  5AQH A;  3U9Z A;  4BC4 A;  4BR0 A;  2QWP A;  5KQ8 A;  4FWO A;  3BF1 A;  5AQY A;  3QBX A;  3SK3 A;  3VGK A;  4M63 C;  4BG9 A;  5AQX A;  1S3X A;  4GY2 B;  3VOV A;  3DXK A;  3VF2 A;  4O5F A;  2P9S A;  3C0B A;  5AZI B;  4BRK A;  4H0Y B;  2E2P A;  2E1Y A;  2QWQ A;  4H5V A;  3WUH A;  5BPL A;  5BRH A;  5ELZ A;  4PKG A;  2E8A A;  4JD2 B;  5FPD A;  3WXK A;  4BQL A;  3D2F B;  3O4W A;  4FOE A;  4MO5 A;  4RCH A;  5AQR A;  5BN8 A;  3F9M A;  3LM2 A;  4WQ4 C;  1BOT O;  3LL3 A;  3W3D A;  1WUA A;  1XQS C;  3IMX A;  3LDO A;  4CZK A;  4ISG A;  1GLD G;  2FF3 B;  1QZ5 A;  4BRP A;  3EN9 A;  4B1Y B;  4H0P A;  5BRD A;  4XEI A;  2P9U A;  2DPN A;  3VGL A;  4RTF D;  4JHD A;  3ATV A;  2E2O A;  3AY9 A;  1TYQ B;  2BTF A;  5F1X A;  4FWL A;  3FFK B;  1CZA N;  3AAQ A;  4J8F A;  3FZH A;  1U6Z A;  3O1B A;  3B8A X;  1NWK A;  4L3Q A;  5AQN A;  2QWM A;  4B1V A;  1WOQ A;  4CZL A;  5LY3 A;  4BRL A;  1KAY A;  3CIP A;  1R59 O;  3UE5 A;  2H3G X;  3QFP A;  4H5R A;  3ZX0 A;  3EL2 A;  4FWP A;  2ZF5 O;  5JIC A;  4CBX A;  2VCP A;  3MN5 A;  5KPR A;  1DGK N;  2CGL A;  3UKU B;  1XC3 A;  5KPT A;  5AQO A;  2YI1 A;  3VEX A;  3LDQ A;  5AQI A;  1ZXO A;  2ZGZ A;  3DAW A;  1C0F A;  3EKU A;  2V7Y A;  3BF3 A;  2VYP A;  3QFU A;  1RDW X;  1MWK A;  2P9N A;  1KAZ A;  4CBU A;  1BWF O;  4C23 A;  1HKC A;  4FOI A;  1YVN A;  4F9O A;  4I6M A;  2IIR A;  4JNE A;  3CET A;  4LC9 B;  3QBW A;  5FPE A;  3QDK A;  3ATU A;  3H45 C;  4I6M B;  4WYB A;  3VF4 A;  4BC2 A;  4BRG A;  3DWL A;  2GWJ A;  4H0V B;  3IFR A;  3A5L C;  1K8K A;  3A8Y A;  5AFU A;  5AQL A;  3A5O C;  2UYT A;  3D2F A;  5AZI A;  3DJC A;  3L4I A;  4BR5 A;  2GEM A;  3JXU A;  3HM8 A;  3SMS A;  3FGU A;  1HKG A;  3KHY A;  1NLV A;  4BVO A;  3MN7 A;  1HLU A;  3BEX A;  4QS8 A;  3FZM A;  3UKR A;  4XH4 A;  2YHX A;  1DEJ A;  3L6Q A;  3LDN A;  4FWM A;  5AQZ A;  5BPN A;  4K25 A;  3VEZ A;  4DCH A;  1HKB A;  1GLF O;  4K41 A;  3VF6 A;  3FLC O;  5AQJ A;  1SQK A;  2P9P B;  2ASM A;  2QWR A;  1NGD A;  1QZ6 A;  5FPM A;  3HBT A;  4IO8 A;  2AA4 A;  2YJF A;  4BR9 A;  2FLO A;  3WXJ A;  2P9L B;  4H0O A;  4QS7 A;  3ID8 A;  4A2A A;  3U8X A;  3U4L A;  1U2V B;  3D7E O;  2E88 A;  5BRF A;  2D1K A;  2Q36 A;  4JN4 A;  1Q18 A;  3IUC A;  1XUP O;  5AQG A;  5AQQ A;  2Q31 A;  4BGA A;  5KPZ A;  5AQV A;  3R8E A;  3CJC A;  4BRF A;  3FR0 A;  2ZWH A;  4PL7 A;  1E4F T;  2P9I A;  1GLC G;  4QS9 A;  3ZET A;  3MN6 A;  3MK6 A;  3R9P A;  3CI5 A;  4DB3 A;  1JCE A;  5AQT A;  4BRQ A;  2YHY A;  4IJA A;  4BRA A;  2CGJ A;  1GLL O;  1X3M A;  2CH6 A;  3L0Q A;  3ZET B;  2ZGY A;  3I8B A;  3H1Q A;  4JD2 A;  1QQO A;  1T6D A;  1BDG A;  3DXK B;  4BRI A;  4FWQ A;  3M3Z A;  3MDQ A;  5ADX A;  2AP1 A;  4FPB A;  4PKH A;  4CZG A;  3WXL A;  4K43 A;  4B1X B;  4CBW A;  2WUS A;  2D4W A;  1NBW A;  4XH1 A;  4MLE A;  3RSE B;  3O1W A;  3CJA A;  1HPM A;  1NGG A;  4FO0 A;  1IJJ A;  2QWL A;  2P9U B;  2V51 B;  5AQM A;  2P9K A;  2W40 A;  3AAP A;  3AAR A;  4JAX A;  3GG4 A;  3ZEU A;  4M7Y A;  4IWV A;  4EIA A;  1NMD A;  2D0P A;  2D0O A;  3UKR B;  2FSJ A;  4HTL A;  1TYQ A;  2BUP A;  5TKY A;  5AZJ A;  3DXM A;  3MMV A;  4IJN A;  1BA0 A;  3A5N C;  2YHW A;  3ENO A;  4CZI A;  2Q1N A;  3W0L A;  2P9P A;  1E4G T;  1HX1 A;  1MA9 B;  4PKI A;  4CZE A;  3EZW A;  3M1F A;  2IVN A;  3MN9 A;  3DXM B;  4BRN A;  3UKU A;  5BN9 A;  4WQ5 A;  1Z6R A;  4BRM A;  2OAN A;  2QM1 A;  4B1W B;  1V4T A;  3ENH A;  3GBT A;  3VES A;  2A6A A;  3VEN A;  1NM1 A;  3S41 A;  3WEE B;  3BP8 A;  2FF6 A;  4CJ7 A;  4AM7 A;  4YDU C;  2YCH A;  1NGI A;  2HMP A;  4DQ8 A;  4KBO A;  3QML A;  3GOI A;  3VGM A;  4MLH A;  1QHA A;  2E2N A;  4FWS A;  2Q2R A;  3HZ6 A;  4BR7 A;  1X9J A;  3EO3 A;  1LCU A;  3H3N O;  2J4R A;  3FZK A;  2PAV A;  1DKG D;  4DHY A;  2QWN A;  2IVP A;  1IG8 A;  1D4X A;  2ASP A;  3H3O B;  3FZF A;  5BR9 A;  3GL1 A;  3O5B A;  3I33 A; 
#chains in the Genus database with same CATH topology
 1WSH A;  5CZ1 A;  3R3L A;  1YHQ N;  4WF9 L;  2QW9 A;  4FM2 A;  1Q9Y A;  5C42 A;  3WQU A;  3HSC A;  3AVK A;  5F2R A;  3L2R A;  3HI0 A;  3EKS A;  5E41 A;  3R6M A;  2P9K B;  2IVO A;  4KHQ A;  4B9Q A;  3OYJ A;  1RTD A;  3CC7 N;  2GTD A;  1NK5 A;  2FC0 A;  2FSN A;  3HOT A;  3ID6 A;  4B1Z A;  1NGJ A;  4BVP A;  3MEE A;  3VPZ A;  4LF4 K;  4R79 A;  4CIF A;  3DLL L;  4KTZ A;  5GAE P;  4F3T A;  2O8D A;  4CGH A;  2QKB A;  1X3N A;  4KH5 A;  1KLM A;  1J6Z A;  3NGZ A;  3TAB A;  2E1Z A;  4OKK A;  3N4P A;  3D2E B;  3HK2 A;  1BQM A;  1WSE A;  4LSN A;  1UAX A;  1IV0 A;  1GLE G;  3THX A;  4HCC A;  4IOC L;  1RT3 A;  1VQ7 N;  3KZB A;  3BZK A;  4CK3 A;  3CCU N;  1IBK K;  2HND A;  3A0I X;  4CES A;  2YKN A;  2ZM6 K;  3ZX2 A;  3KVG A;  1CXU A;  3LPT A;  4MO4 A;  3VQD A;  2O8B B;  3VA0 A;  1KAX A;  3K0S A;  3JS6 A;  4ISF A;  2GWK A;  2EWS A;  3NF7 A;  3CPW M;  4H5W A;  4AHT A;  1S9G A;  3AA3 A;  2HW3 A;  1OH7 A;  4DFP A;  3O9Q A;  1A5X A;  4DTM A;  2W41 A;  4DR1 K;  4FVU A;  2VQF K;  4BAC A;  4IKF A;  3FZL A;  1K73 O;  1RTI A;  4JKG A;  3RSE A;  1JLG A;  2A40 A;  4DF8 A;  1DLO A;  4IZ9 A;  3L2Q A;  4M3R A;  5AQF A;  3DLH A;  1S1U A;  5AQP A;  3R1X A;  2A42 A;  5JLH A;  2IDO A;  5KQD A;  1BL3 A;  3C65 A;  3QEI A;  3D0P A;  3J80 O;  4C8L A;  4IEE A;  3QET A;  5TKW A;  4X66 K;  4CHP A;  4F4K A;  2QK9 A;  3BGR A;  3KK2 A;  4EHU A;  2ZJP L;  4AM6 A;  4KV8 A;  1BIS A;  1NOZ A;  1C0G A;  1OH6 A;  5EOY A;  4DV5 K;  1IO2 A;  1GOB A;  4RWT A;  4WFN L;  4JI8 K;  3BUZ B;  4EP4 A;  1KXP A;  3CYM A;  4JI5 K;  3N4Q A;  4HWI A;  3CFP A;  3OTO K;  3V9X A;  4H5N A;  1MWM A;  3H6E A;  3HRG A;  3ZSY A;  2OTJ N;  5EY4 A;  3LZI A;  3FE1 A;  4EAH D;  1UA1 A;  1LOT B;  4CD1 A;  4BRE A;  2W6K A;  5M1Q A;  3CXC M;  1X9W A;  2F9W A;  1RDA A;  1JJ2 M;  4B9M A;  5AJ3 K;  1VSD A;  3AVL A;  2D0A A;  4HUE A;  3U9Z A;  3OJS A;  4FWO A;  2RHK A;  3VQ4 A;  4RW4 A;  5AQY A;  3SK3 A;  3MXI A;  3ZYY X;  4B9S A;  3TSP A;  4E1M A;  3AVM A;  1Q7Y O;  4GY2 B;  3VOV A;  1OH5 A;  1ZBL A;  4O5F A;  1I94 K;  2RF2 A;  4KRF A;  4YOV A;  1HNW K;  3O4Q A;  4M41 A;  4AIL C;  5BPL A;  3KLI A;  4BQL A;  5FRM A;  2HBJ A;  3LM2 A;  5GAH P;  1BOT O;  4FJL A;  1VAZ A;  3W3D A;  3EY1 A;  3IMX A;  1QTM A;  1BCM A;  3DRR A;  1QVF M;  1GLD G;  4B9T A;  1Q8I A;  3WNH A;  3EN9 A;  3FFI A;  4ID5 A;  3DYA A;  4E7J A;  4N76 A;  1X9M A;  2P9U A;  5D3G A;  1VQ9 N;  4JKB A;  4JHD A;  3ATV A;  4JEP A;  1SUQ A;  5F1X A;  4FWL A;  1U48 A;  3PLA A;  3FFK B;  4ILG B;  1U6Z A;  2F8T A;  4L3Q A;  3VQA A;  3K58 A;  4YOT A;  4KPY A;  4BRL A;  3SYZ A;  1KAY A;  3VQP A;  3OYD A;  3UE5 A;  3QFP A;  3TI0 A;  5HL7 L;  3ZX0 A;  3NE6 A;  3LP0 A;  2ZF5 O;  3VQC A;  3ISN C;  2VCP A;  4CBX A;  3NF6 A;  4MQ3 A;  2FBX A;  2A1R A;  3OA9 A;  3LDQ A;  2ZGZ A;  5HRO A;  1ZBU A;  3CCV N;  2HHT A;  4J2B A;  3QFU A;  2W6L A;  4GMJ B;  1MWK A;  3DLB A;  1KAZ A;  4CBU A;  3T1A A;  1WSJ A;  3V9Z A;  1VQ6 N;  1RDU A;  5DMR A;  2KZM A;  2RN2 A;  3QBW A;  3CC2 N;  4CED A;  1LWE A;  3ZSZ A;  4OLA A;  4I6M B;  4PA1 A;  4WYB A;  3VF4 A;  5C25 A;  2QTD A;  3IFR A;  3NVK A;  1K8K A;  3A8Y A;  5AFU A;  3A5O C;  5AZI A;  1N32 K;  3JXU A;  3M8S A;  3KHY A;  3KJV A;  4BVO A;  1HLU A;  2OZM A;  4A59 A;  4O4G A;  3VMF B;  4XH4 A;  1HPZ A;  3Q7B A;  4FK4 A;  3L6Q A;  3LDN A;  3E9L A;  4C8K A;  2G8F A;  3VEZ A;  4DCH A;  1GLF O;  1Q81 O;  3SJJ A;  3FLC O;  1X9S A;  1EX4 A;  1SQK A;  2P9P B;  5C12 A;  3HYF A;  4JKD A;  1C0U A;  5FPM A;  3OBW A;  5M1P A;  3LDS A;  3A2F A;  3B6O A;  3U3G A;  3ID8 A;  2HB5 A;  2O8C A;  1JL1 A;  4A2A A;  4J2D A;  3LAN A;  2YNH A;  3U4L A;  1S1T A;  4BWJ A;  1U2V B;  4CFA A;  2E88 A;  1ZBF A;  2D1K A;  4LFC K;  4IG0 A;  5AQG A;  4DTU A;  2Q31 A;  3HP9 A;  5AQV A;  3RMA A;  4CHN A;  3THY A;  2DFE A;  3P83 D;  2OPQ A;  1KVB A;  2EHG A;  4FLT A;  3MK6 A;  3CI5 A;  4LFB K;  4DB3 A;  3ZT3 A;  1JCE A;  3RVC A;  4IJA A;  2O8F A;  3WXM B;  1X3M A;  2G8V A;  1NOY A;  4AHU A;  5J2P A;  1SV5 A;  2ZGY A;  4JRP A;  1QE1 A;  1BDG A;  1HNV A;  3M3Z A;  3MDQ A;  3KK1 A;  4OKJ A;  4HTU A;  4MLE A;  1Z26 A;  3ZT1 A;  4FXD A;  4FO0 A;  2Z1I A;  1ITG A;  1SL2 A;  2QWL A;  2OTL N;  1U4B A;  2P9K A;  3DLR A;  4X64 K;  3TAG A;  4FJ8 A;  3AAR A;  1VSL A;  3GG4 A;  3ZEU A;  1YTA A;  4NCG A;  4DSE A;  4GVM A;  4EIA A;  3ZSR A;  2D0P A;  4BDZ A;  1ILY A;  2FSJ A;  4G1Q A;  4N5S A;  4MFB A;  4UQG A;  3OYF A;  5TKY A;  1L3S A;  1A5V A;  3A5N C;  4CZI A;  2Q1N A;  3V4I A;  3HO1 A;  1MA9 B;  1RDB A;  2OA8 A;  1BQN A;  1S1V A;  4CZE A;  3M1F A;  4NYF A;  3OYA A;  3SV3 A;  3AO5 A;  4W5R A;  3U6F A;  1D8Y A;  4RW6 A;  4JS5 A;  1NK8 A;  1VK0 A;  4B3T K;  3MAQ A;  2QM1 A;  4B1W B;  3VES A;  1KLN A;  3K2P A;  4EZ9 A;  4YOU A;  4JKA A;  3MEG A;  4O55 A;  3T7Z A;  1BHL A;  1FJG K;  2IGI A;  4AM7 A;  4CJL A;  3K9K A;  4DQ8 A;  4M45 A;  5A2Q O;  3CFR A;  1VRU A;  3QEV A;  4JRQ A;  2Y1J A;  1NK4 A;  1QHA A;  2E2N A;  4JYA K;  4ELU A;  1YJN N;  4FZZ A;  4DFJ A;  1OVY A;  1J5O A;  1S5J A;  4KAZ A;  2PAV A;  2D0B A;  4DHY A;  4CJ5 A;  4LF5 K;  3E66 A;  3FZF A;  3I33 A;  3AGR A;  1Z25 A;  1L3U A;  1IKY A;  1FK9 A;  4M3Z A;  2G8H A;  3AA5 X;  1GLB G;  4O44 A;  1T03 A;  4DR6 K;  1QQN A;  2CH5 A;  2F8S A;  1BO5 O;  1VSF A;  4C8O A;  3PUF A;  4C8N A;  4DTX A;  4DV7 K;  2HHS A;  3IS9 A;  2HF3 A;  3S9H A;  3SPY A;  4FLU A;  3QEP A;  3V1Q A;  2Q0U A;  4ELV A;  5JLF A;  2IC3 A;  3ZX3 A;  2WTU A;  4BC3 A;  4E0D A;  1HYV A;  1ATS A;  4FJN A;  4K8Z A;  1G99 A;  3QNN A;  4C1N K;  5E84 A;  1ATN A;  3HPG A;  3T19 A;  3CER A;  4H0X B;  5AQU A;  2GEL A;  4DQR A;  1GOA A;  4BDY A;  3K5O A;  1BUP A;  1JCG A;  1KCF A;  4M3W A;  3CHW A;  1EQY A;  2A41 A;  1HJO A;  4ID1 A;  5EX5 A;  3PO5 A;  1JCF A;  2XY5 A;  2LSN A;  3OYH A;  2F96 A;  1TUY A;  1U04 A;  2A3Z A;  1LV5 A;  2P9L A;  1WN7 A;  3CJ1 A;  3DMJ A;  1RDD A;  1N34 K;  4DMN A;  3G71 N;  5B8H A;  4LFA K;  3K5N A;  2YHA A;  3DOL A;  4DU3 A;  4O0I A;  5J2Q A;  4LH4 A;  3E01 A;  2HHV A;  1BA1 A;  2UUB K;  1XMQ K;  3V81 A;  3H1V X;  1ATR A;  1TUU A;  3KIO A;  5IT9 O;  3VQB A;  4NLC A;  3O8M A;  1R0A A;  1EWR A;  2JGU A;  3S3O A;  3LDL A;  3C7N B;  4B1U B;  2O8E B;  5JMV A;  5CE3 A;  5I3U A;  4CE9 A;  5EXW A;  4U7B A;  1D9D A;  3HTV A;  3QNO A;  1XHX A;  4FPA A;  1ZBS A;  5JS2 A;  2P51 A;  1GOC A;  2QWO A;  2I7N A;  3AVN A;  3OJU A;  4O5B A;  1YAG A;  4C8M A;  3SCX A;  3QES A;  1D5A A;  4OO1 J;  4WQ5 C;  2ZJR L;  4B3S K;  4Q5V A;  4BWM A;  1S6P A;  5EU7 A;  1JLE A;  3VQQ A;  1KC8 O;  1K8K B;  1RBV A;  2BH1 A;  2RKI A;  3QB0 A;  4JHD B;  3BZC A;  3SJH A;  4M42 A;  1TKZ A;  2VG6 A;  4HUG A;  3KLF A;  3JSM A;  4M3T A;  5FPN A;  4FL9 A;  5I9E B;  4K8X A;  3AVC A;  4CD3 A;  1IKX A;  4DS5 A;  1T6C A;  5AR0 A;  4CEE A;  3CCE N;  4KI6 A;  4KHN A;  1JLB A;  3CCS N;  1HUX A;  3MCP A;  3CJ9 A;  3I0R A;  4IFE A;  3CQY A;  3WQT A;  5KI6 A;  3HJF A;  1DT9 A;  1T44 A;  4FWN A;  5HBM A;  3THX B;  2KTQ A;  3ALY A;  4A61 A;  4I2P A;  5M1N A;  4CFD A;  4LF9 K;  1RGI A;  5DK5 A;  3D45 A;  3SLC A;  2E6M A;  3WXI A;  1NGB A;  2X6S A;  4PL8 A;  1NGE A;  1TK0 A;  2E2Q A;  3OYE A;  3HVT A;  5HRP A;  1LW2 A;  4DV3 K;  4DV6 K;  5AQH A;  3PX6 A;  4BC4 A;  3NDK A;  3NH2 A;  4JLH A;  3TSQ A;  3QBX A;  2BE2 A;  3VGK A;  3VQ6 A;  1JXB A;  3SAF A;  4DV2 K;  3V1R A;  4AHR A;  5AQX A;  2F7T A;  2XHB A;  5AZI B;  4H0Y B;  2E2P A;  5GIN A;  4DTN A;  1CXQ A;  2ZD1 A;  4B8C A;  1JXE A;  5ELZ A;  1EKE A;  4PKG A;  2E8A A;  3WXK A;  4LD0 A;  2G8W A;  1KFS A;  5AQR A;  4CF1 A;  2GBZ A;  4PHT X;  1ASU A;  1WUA A;  2D5R A;  3PSF A;  4CHQ A;  4YOW A;  3LDO A;  4CZK A;  4OPK A;  2FF3 B;  4DTO A;  1IBM K;  4BRP A;  4DTP A;  4B9L A;  4B1Y B;  4H0P A;  3L3U A;  2PYJ A;  3OYB A;  4K0K K;  4LSL A;  3VGL A;  4RTF D;  1BI4 A;  1RT7 A;  4KB0 A;  3AY9 A;  2BTF A;  4O8U A;  3AAQ A;  4J8F A;  3KWI A;  1QQC A;  4DR2 K;  3PX4 A;  1IH7 A;  4Z4G A;  3OYN A;  1NWK A;  5J1E A;  4LY7 A;  3ZCM A;  1WOQ A;  4CZL A;  3SQ1 A;  4PQU A;  3TAR A;  4H5R A;  1RDC A;  2JWL A;  4OKE A;  2KW4 A;  5JIC A;  4DSJ A;  2YX6 A;  2OPS A;  4KO0 A;  3SAH A;  4CHY A;  2KFN A;  2JLE A;  5AQO A;  4JI0 K;  5AQI A;  5HOO A;  2O4G A;  4GKK K;  3VN5 A;  3DRP A;  3HL8 A;  1M1K O;  3EKU A;  1EXQ A;  5LL6 Z;  2R7Y A;  4LF6 K;  3E9P A;  3IKM A;  4DFK A;  2P9N A;  3L8B A;  4C23 A;  1VRT A;  1W2B M;  1IG9 A;  2B4J A;  2HBM A;  3LWL A;  4BY9 C;  1KFD A;  5FPE A;  4DSF A;  1KD1 O;  3ATU A;  4DTJ A;  4BRG A;  4JKF A;  1TKX A;  3DWL A;  4Z4E A;  2GWJ A;  4H0V B;  3A5L C;  4HCB A;  4N47 A;  1N6Q A;  2UYT A;  3DJC A;  3C6T A;  3L4I A;  1NKB A;  3AVB A;  3S3M A;  4CFC A;  5JVG L;  1NK6 A;  3T1H K;  3MN7 A;  1VQP N;  5SZT A;  1QHT A;  3O3F A;  4UY8 O;  3UKR A;  3G10 A;  3MXM A;  3AGK A;  4K25 A;  3TTD A;  3KTQ A;  1HKB A;  2OCE A;  3VF6 A;  1RT4 A;  2HMI A;  3PO4 A;  1NNE A;  2QWR A;  4IO8 A;  5HLF A;  2YJF A;  1HNZ K;  4BR9 A;  2XRI A;  4AHC A;  4FLW A;  4FJ5 A;  2P9L B;  4IDH A;  3KD1 E;  3U3Y A;  4WCE L;  3MX2 A;  3H08 A;  4FZX C;  4H8K A;  2BGG A;  4CJV A;  4Z4F A;  2Q36 A;  1Q18 A;  3NGI A;  3OYL A;  4FJM A;  1XUP O;  3K9J A;  5AQQ A;  5KPZ A;  1RNH A;  3MX5 A;  4CK1 A;  3EE8 A;  4PL7 A;  1E4F T;  4M3U A;  4IEI A;  1GLC G;  4QS9 A;  3ZET A;  3CG7 A;  3NGY A;  3MN6 A;  3J7Y P;  3R9P A;  4CCH A;  4DR7 K;  2VGM A;  5AQT A;  2YHY A;  3RMC A;  4BRA A;  1NJW A;  1HQU A;  2B6A A;  2CH6 A;  2HHW A;  4JKH A;  4CEZ A;  3J7Z O;  3L0Q A;  4AQY K;  3CM6 A;  1OVQ A;  4BRI A;  3DXK B;  3OYC A;  4U67 L;  4FJI A;  4FWQ A;  4PKH A;  3AVF A;  3HOS A;  3OS0 A;  1YIT N;  5LMN K;  4CBW A;  2VG7 A;  3Q7C A;  1NBW A;  4C1N I;  3LP1 A;  3O1W A;  1RT2 A;  1HPM A;  1RIL A;  1T3V A;  1C0T A;  4E19 A;  3PIP L;  4KFB A;  1X1P A;  5AQM A;  4CEQ A;  1D9F A;  4DV4 K;  1Y97 A;  3CPE A;  4AHS A;  1RBS A;  3QEX A;  4FLY A;  5DM6 L;  1WBB A;  3KD5 E;  2GX9 A;  2D0O A;  1JLF A;  2X74 A;  5FLX O;  4A5A A;  4HTL A;  1TYQ A;  3MMV A;  1NMN A;  3ENO A;  4MDB A;  1SKW A;  4X62 K;  2P9P A;  1E4G T;  4ZHR A;  4JI2 K;  1HX1 A;  3OY9 A;  3HT3 A;  4O0J A;  2OYQ A;  3EZW A;  1SKS A;  2IVN A;  1DTT A;  4BRN A;  3QIP A;  3SPZ A;  4DR4 K;  4WQ5 A;  2O8C B;  2YNF A;  4FJX A;  1JL2 A;  3RR7 A;  2A6A A;  4BE2 A;  3VQE A;  3VEN A;  1N8R O;  2WON A;  3WEE B;  3AV9 A;  3EYZ A;  2NNW A;  1ZBI A;  4DU4 A;  4J2A A;  2X6N A;  4MLH A;  3O3G A;  1WSF A;  1FKP A;  2NRR A;  3THY B;  1VQO N;  4CF8 A;  3SQ2 A;  1HQE A;  1Q9X A;  1RCH A;  1X9J A;  3EO3 A;  1L5U A;  1IKW A;  1S6Q A;  5FRO A;  3H3O B;  4CJQ A;  4WFB L;  4I9L A;  2HHQ A;  2PBD A;  5C15 A;  1BG3 A;  3T1Y K;  1SKR A;  1ZC6 A;  1RFQ A;  5HRN A;  1FW6 A;  4EFH A;  3M8Q A;  3CJB A;  1VHX A;  2F9T A;  3L3V A;  3VER A;  3NAE A;  3OS1 A;  4DWI A;  1KTQ A;  5JVH L;  1NJX A;  4F8R A;  3DLG A;  4M3X A;  4Z94 A;  4A62 A;  5BR8 K;  1VQL N;  3TAM A;  2NRV A;  2WOM A;  1LAV A;  2VWB A;  3QIC A;  3CCR N;  2QXF A;  4CI6 A;  5ADX H;  4A2B A;  1YF5 L;  4AHV A;  4DG1 A;  4CJP A;  3L4Q A;  1HMV A;  1S1W A;  1HNX K;  1VSM A;  3O9R A;  5EVZ A;  3OVN A;  4CJR A;  1O13 A;  2UXB K;  3V9W A;  1U2V A;  3CME N;  2A5X A;  2PY5 A;  3JAM O;  5HP1 A;  4K42 A;  3S3N A;  3D2E A;  2P1J A;  3GE1 A;  4W5O A;  3TAQ A;  2E20 A;  1J54 A;  1RBT A;  4ISE A;  4NCB A;  2P9I B;  4NCA A;  4DSI A;  1TGO A;  1F21 A;  1SZ2 A;  4H03 B;  3SUN A;  4IFV A;  4E7I A;  2ASO A;  3ZLJ A;  3B6P A;  1E3M A;  4CFB A;  2O8B A;  4IDK A;  1ESV A;  2YKM A;  4CW7 B;  2NLX A;  1XI1 A;  3SQ4 A;  2FSK A;  3VET A;  4BE0 A;  1TKT A;  5C2D A;  1VQN N;  4FWK A;  3I55 N;  2P9N B;  2GUP A;  5HRR A;  4J2E A;  1NJI O;  4CHZ A;  3WNG A;  2Q97 A;  3AVH A;  2DFH A;  3PSI A;  4XH5 A;  4YNQ A;  4Y0W A;  3SMP A;  4BDP A;  3THV A;  1W7A A;  3MXJ A;  5SWM A;  4TSX A;  1C0M A;  1HRH A;  4CZF A;  4WE1 A;  3NHG A;  4E7H A;  3V1O A;  3LAL A;  4H5T A;  1TVR A;  2HOE A;  2G8K A;  1J5E K;  4ILJ A;  3VEO A;  4JI7 K;  3AA2 A;  3P39 A;  1S22 A;  4NB4 A;  2YJE A;  3E1Y A;  4ZTJ A;  1NKE A;  5AQK A;  3C6U A;  2IS3 A;  3L2W A;  3CCM N;  4ELT A;  4ZTF A;  1B9D A;  5LMU K;  3ZSQ A;  3TTF A;  2DY4 A;  3WT0 A;  4RW7 A;  4JI1 K;  4QOZ B;  1CLQ A;  2DFF A;  4KHY A;  1YJ9 N;  4CJS A;  1VQK N;  4YDU A;  4AH9 A;  3G4S N;  5AZJ B;  4IXC A;  4E89 A;  4FJK A;  4KHU A;  4O8K A;  1ZYQ A;  2QA4 N;  4G9Z A;  3OHR A;  4NLB A;  1YXQ A;  1H1V A;  1Y64 A;  2CGK A;  1OH8 A;  5C2F A;  2Q0R A;  4BGB A;  3WNE A;  3SUP A;  3G25 A;  4DSL A;  2KQ2 A;  4M7X A;  3VA3 A;  2I7P A;  2QXL A;  1NK7 A;  3AVI A;  3QIO A;  1WAF A;  3VEV A;  3ZSO A;  4GKJ K;  2NRZ A;  4RW9 A;  3VEW A;  3O3H A;  1WBD A;  4NXN K;  1IKV A;  3EZ5 A;  4KRE A;  3ULD A;  1BU6 O;  1W9H A;  4KB1 A;  4BR2 A;  4YOY A;  1M90 O;  3V9U A;  2ITG A;  4DU1 A;  3UIQ A;  4CZJ A;  5J2M A;  5BRE A;  1EWQ A;  1NJY A;  4Y1C A;  3LWM A;  3LDP A;  3QER A;  2NRW A;  2E4L A;  4BR0 A;  5KQ8 A;  3BF1 A;  4M63 C;  3J81 O;  3NF8 A;  1W0H A;  3KK7 A;  3DXK A;  3VF2 A;  4DLG A;  3C0B A;  4CJ3 A;  3CD6 N;  2QWQ A;  2E1Y A;  5GAD P;  2O4I A;  1DTQ A;  4CVN E;  4CGJ A;  2PFU A;  4JD2 B;  2AJQ A;  4FOE A;  3AO2 A;  1TL3 A;  4WQ4 C;  1U49 A;  1XC9 A;  3O9T A;  4ISG A;  4JI4 K;  3PIO L;  3TSU A;  1J9A A;  4DF4 A;  1VSI A;  2DPN A;  4CEB A;  4EZ6 A;  1TYQ B;  4FLZ A;  1YVU A;  3FZH A;  2ZE2 A;  3O1B A;  2Z1J A;  3TAN A;  2QWM A;  3M5R A;  3LAM A;  4CGG A;  5FDL A;  5LY3 A;  3I56 N;  3KK3 A;  4CJF A;  4OGC A;  2Z1H A;  3EL2 A;  1JLQ A;  2E5L K;  1P90 A;  3IRX A;  3MN5 A;  3KLE A;  2RE2 A;  5KPR A;  3ZSX A;  2CGL A;  3O9S A;  1XC3 A;  5C24 A;  5M1K A;  4OJR A;  2KLA A;  1JLC A;  3VTI A;  1ZXO A;  1C0F A;  2V7Y A;  3BF3 A;  2XY8 A;  4CJT A;  1W97 L;  1G15 A;  1RDW X;  2IAJ A;  3OYG A;  1SL1 A;  4DTS A;  4KHP K;  2PZS A;  1YVN A;  4I6M A;  4Z4C A;  1RBU A;  3CET A;  3I0S A;  2HHU A;  3RRH A;  3NH1 A;  4IOA L;  3DLE A;  3QDK A;  4HVJ A;  1RT6 A;  3H45 C;  3OYK A;  4FCY A;  3TTC A;  4BC2 A;  3V9S A;  1QS4 A;  4X65 K;  1LWF A;  1EET A;  1LAW A;  4DR5 K;  3ZSV A;  3D2F A;  1T7P A;  4DV0 K;  4B9V A;  2GEM A;  4OLB A;  3HM8 A;  3SMS A;  5KRS A;  1HKG A;  4FK2 A;  1NLV A;  3SUO A;  2HHH K;  1QVG M;  4DV1 K;  4N56 A;  4QS8 A;  1ASV A;  3FZM A;  4FWM A;  5AQZ A;  3HVR A;  2E6L A;  3MWP A;  4K41 A;  5AQJ A;  1VQ5 N;  2ASM A;  4DSK A;  3KWG A;  5IWA K;  4W5T A;  2FLO A;  3WXJ A;  3AO3 A;  2VWJ A;  5M1O A;  4H0O A;  4B9U A;  3CCJ N;  3NMU A;  4FJ7 A;  3SI6 A;  3M8R A;  1TKD A;  2BAN A;  1Q86 O;  3D7E O;  3K5M A;  1I39 A;  1C1C A;  3M8P A;  3E9O A;  2GV9 A;  3ZT0 A;  2P5O A;  4Z0U A;  4JN4 A;  1C6V A;  5KGX A;  3NBP A;  3RMD A;  2XY7 A;  2A1S A;  4BRF A;  3FR0 A;  2YHB A;  3TWH A;  2ZWH A;  2P9I A;  3CFO A;  4E1N A;  4BRQ A;  1XMO K;  2CGJ A;  2EX3 A;  4YY3 K;  1GLL O;  1CZB A;  1SL0 A;  1B92 A;  3I8B A;  3H1Q A;  2HNY A;  1T6D A;  4IFY A;  2UU9 K;  3OYI A;  4NXM K;  5ADX A;  2AP1 A;  4FPB A;  4CZG A;  3WXL A;  4K43 A;  4B1X B;  4DLE A;  3C6H A;  4JKG B;  3RSE B;  2FBT A;  3CJA A;  4B8A B;  1MU2 A;  1NG9 A;  1IJJ A;  4GV3 A;  2ZQB A;  2V51 B;  4CHO A;  3AAP A;  2NUB A;  4IWV A;  1NMD A;  1RBR A;  1TK5 A;  3O4N A;  4IOX A;  3UKR B;  1BIU A;  4YOX A;  4DFM A;  5AZJ A;  4IJN A;  1BA0 A;  3T69 A;  3RR8 A;  2YHW A;  3OW2 M;  1HYZ A;  3IG1 A;  4NYN A;  3W0L A;  2W42 A;  1KRP A;  4JK8 A;  4PKI A;  4FK0 A;  3MN9 A;  3K59 A;  3UKU A;  4OPA A;  5BN9 A;  1XNQ K;  3ITH A;  1V4T A;  3ENH A;  1O1W A;  1KVC A;  1VQ4 N;  3O9U A;  1VSK A;  3LP3 A;  4CJ7 A;  4YDU C;  4B3M K;  2YCH A;  1L3V A;  2HMP A;  3IAY A;  3QML A;  3GOI A;  2FBV A;  4BR7 A;  3H3N O;  4M3Y A;  4R5P A;  3G6E N;  1DKG D;  2QWN A;  2IVP A;  3SQ0 A;  1D4X A;  5BR9 A;  3GL1 A;  1EP4 A;  3O80 A;  3AO4 A;  1TL1 A;  3MEC A;  2GUI A;  4LF8 K;  2VGN A;  1NKC A;  4CEF A;  4FVM A;  3P4I A;  4FJG A;  4KI4 A;  1QQM A;  1XNR K;  3P1G A;  5H1S Q;  4JS4 A;  3F9K A;  1SAZ A;  1YT3 A;  3QEW A;  4FSV A;  3VQ5 A;  5E26 A;  3LM9 A;  4CZH A;  3VTH A;  2F4V K;  5AQS A;  2Q3S A;  3TPQ A;  4NO7 A;  4FJ9 A;  2Z1G A;  4JK7 A;  3HM9 A;  3NFA A;  1V4S A;  4ILH A;  3H46 O;  3ASM A;  2ITM A;  5HRS A;  4ICL A;  1FXX A;  5LJV A;  3AA4 A;  2YNI A;  2UXD K;  4W5Q A;  3K5L A;  3U9D A;  3MCA B;  4BG8 A;  4KTQ A;  4B3O A;  4FJH A;  4LH5 A;  1NGA A;  1FKO A;  5CR4 A;  3TR8 A;  4WQ4 A;  2VQE K;  5C0Y A;  4JKC A;  4PUO A;  2KFZ A;  4FWR A;  4JKE A;  4PY5 A;  4CZM A;  5GIP A;  1P8Z A;  1JKH A;  4DS4 A;  4H4O A;  1RT1 A;  4FYD A;  5LJW A;  2HST A;  1UOC A;  4IBN A;  1RTH A;  5I42 A;  3I8D A;  2HF4 A;  1GLA G;  4BR4 A;  4KHS A;  2FXU A;  3O6W A;  3WEE A;  3IDH A;  1T8E A;  4H0T B;  2Y1I A;  4EHT A;  4CEO A;  3C6A A;  3VQ7 A;  4GV9 A;  4OPJ A;  3NVM A;  3THW A;  4DUY K;  4LF7 K;  4JI6 K;  4GNI A;  1YI2 N;  2VWK A;  5AQW A;  3LZJ A;  3NH0 A;  3CQX A;  4CJ4 A;  4I2Q A;  2NZT A;  5FRN A;  4Z4I A;  4Q0B A;  1WSI A;  4CIG A;  4BRO A;  3TAP A;  3ULE B;  2HNZ A;  1NGF A;  5CYM A;  2HBK A;  1TK8 A;  3KLG A;  2D0C A;  4Z4H A;  3M6G A;  3J8A A;  4BRD A;  5BPM A;  4E1J A;  4BRH A;  3V6D A;  5CY4 A;  3ULE A;  2DTU A;  1HR0 K;  3UB5 A;  2P9S B;  1YIJ N;  2HVI A;  4BRC A;  1GLJ O;  4BQZ A;  1MDU B;  3CF5 L;  4I9Q A;  3A5M C;  2KHO A;  1NGH A;  2HBL A;  1T05 A;  4MDA A;  1UA0 A;  5AFU H;  3C95 A;  3F73 A;  2UUC K;  1Z05 A;  3SZ2 A;  5F0X A;  4CJK A;  4OGE A;  3KLH A;  3SAG A;  1NGC A;  1LWC A;  3DI6 A;  3SNN A;  4CIE A;  3ZEU B;  4OVL A;  3LP2 A;  5KGW A;  4IO9 L;  3O08 A;  3TU5 A;  1U47 A;  3GDQ A;  1BI4 B;  3JYT A;  4L8R B;  1QSY A;  2V52 B;  1YUW A;  4B3R K;  1S72 N;  5J2N A;  1OKJ A;  3P31 A;  3VEY A;  5CZ2 A;  4YOR A;  3CJ7 A;  2V7Z A;  3C7N A;  4CF9 A;  1QSL A;  1TAU A;  4DQS A;  3LPU A;  2O8F B;  2NRH A;  3ENB A;  1QSS A;  4CEC A;  4BC5 A;  5M1F A;  4YFU A;  1LW0 A;  4RG8 A;  3RTV A;  2QWP A;  1TV6 A;  2XO7 A;  4BG9 A;  1S3X A;  1RTJ A;  4F3O A;  2P9S A;  3LAK A;  4BRK A;  2G8U A;  3AO1 A;  1KVA A;  4H4M A;  4QCL A;  4GVE A;  3RMB A;  4H5V A;  3WUH A;  3OYM A;  5BRH A;  2NRT A;  3HP6 A;  2OZS A;  5FPD A;  1TAQ A;  3D2F B;  3O4W A;  4MO5 A;  4RCH A;  3TAF A;  5BN8 A;  4HUF A;  3F9M A;  5CYQ A;  3LL3 A;  1WSG A;  1XQS C;  3EE9 A;  4FW2 A;  1YTU A;  1QZ5 A;  2YNG A;  5BRD A;  2OPR A;  3CC4 N;  4XEI A;  1NU0 A;  2E2O A;  3L2U A;  5KRT A;  2JWK A;  4KHW A;  1CZA N;  4B08 A;  1VSH A;  5CHI A;  1N5Y A;  3ZSW A;  1KSP A;  3CM5 A;  3B8A X;  5AQN A;  3DOK A;  4CGD A;  4FM0 A;  5JS1 A;  4FW1 A;  4B1V A;  2ZJQ L;  3SBG A;  1EO1 A;  2RPI A;  1VQM N;  4KTW A;  3G0Z A;  3HPH A;  1JLA A;  3CIP A;  1C1A A;  1R59 O;  2H3G X;  3F5T A;  2QKK A;  3QIN A;  3PV8 A;  4DQP A;  4FWP A;  2QI2 A;  3NF9 A;  3L2V A;  3SV4 A;  4CF0 A;  1VSE A;  1DGK N;  3UKU B;  5KPT A;  2YI1 A;  3VEX A;  3C94 A;  1HJR A;  2NRX A;  3NCI A;  1IBL K;  3DAW A;  3F2K A;  3CMA N;  2P5G A;  2VYP A;  3KKS A;  4CJU A;  4KH6 A;  1VSJ A;  4CF2 A;  4CJE A;  1BWF O;  2WBN A;  1HKC A;  4FOI A;  5T7B A;  3QO9 A;  4F9O A;  3QLH A;  3HPO A;  1WLJ A;  2IIR A;  4JNE A;  1NK0 A;  4LC9 B;  3VQ8 A;  4CGF A;  4PWD A;  3HXM A;  4JK9 A;  4KH4 A;  3OS2 A;  4BE1 A;  2UUA K;  1NJZ A;  3AVG A;  1VQ8 N;  1J53 A;  3BDP A;  4EP5 A;  4E3S A;  5AQL A;  3J7A P;  2O8D B;  4BR5 A;  2XY6 A;  4YHH K;  1U45 A;  5K14 A;  3FGU A;  4AF1 A;  4GV6 A;  4WFA L;  1N33 K;  3BEX A;  5KTQ A;  2YHX A;  4FZY A;  1DEJ A;  1REV A;  4F2R A;  5BPN A;  1S1X A;  1B9F A;  1NK9 A;  4GW6 A;  2VG5 A;  2KKZ A;  2FBY A;  4F2S A;  1NGD A;  1QZ6 A;  1L3T A;  3HBT A;  2AA4 A;  2OPP A;  2UXC K;  4QS7 A;  4DR3 K;  2HHX A;  1BGX T;  1ZBH A;  3U8X A;  4XIU A;  1HNI A;  2I5J A;  5BRF A;  3WNF A;  3IUC A;  2BDP A;  2QEX N;  3CCL N;  3CQ8 A;  4BGA A;  5GAG P;  3R8E A;  1N36 K;  3CJC A;  4FLV A;  4V19 S;  3MWT A;  3OBY A;  4Y1D A;  3SUQ A;  4OPH A;  3DM2 A;  1RT5 A;  1I3A A;  2B5J A;  1SS6 A;  5C10 A;  4I7F A;  4B9N A;  4DQQ A;  4QAG A;  4CGI A;  3VQ9 A;  4W5N A;  3THW B;  3T3F A;  4HHT A;  4CEA A;  3ZET B;  4JD2 A;  2ETJ A;  1QQO A;  3DRS A;  5GIO A;  4E7L A;  1WAJ A;  1BCO A;  4N41 A;  4KKO A;  2IOC A;  2WUS A;  4CER A;  2D4W A;  4XH1 A;  3BY5 A;  1WB9 A;  1C1B A;  1NGG A;  5DM7 L;  2P9U B;  3K57 A;  1K6Y A;  2HVH A;  1HYS A;  2W40 A;  2KZZ A;  4FLX A;  1CZ9 A;  2PYL A;  3MED A;  4JAX A;  3SBT A;  4M7Y A;  4RW8 A;  3P38 A;  1K9M O;  1WNS A;  4IG3 A;  3P5J A;  1YJW N;  2BUP A;  3DXM A;  2ATQ A;  3HST B;  3PY8 A;  3ZT2 A;  4OX9 K;  4CJW A;  3KKR A;  3DXM B;  4JI3 K;  3PX0 A;  3ZT4 A;  1Z6R A;  4A5B A;  4BRM A;  4CK2 A;  2OAN A;  1S9E A;  3GBT A;  1A5W A;  2WFB A;  1NM1 A;  4E7K A;  3S41 A;  3AVA A;  3BP8 A;  2X78 A;  2FF6 A;  4A57 A;  2G8I A;  3EEQ A;  1KQS M;  4FJJ A;  3TAE A;  2YV0 X;  4DUZ K;  1K8A O;  1NGI A;  4DQI A;  4KBO A;  3DLK A;  3RWU A;  3VGM A;  3RRG A;  4FWS A;  1BIZ A;  4JV5 K;  2Q2R A;  1XHZ A;  3HZ6 A;  2WC9 A;  3D6R A;  3CCQ N;  1LCU A;  2O8E A;  2J4R A;  4FM1 A;  3FZK A;  1Q82 O;  4DTR A;  5MLC Q;  3AVJ A;  1IG8 A;  1XWL A;  2ASP A;  1ASW A;  4DKW A;  1UWB A;  3O5B A; 
#chains in the Genus database with same CATH homology
 3O80 A;  2PBD A;  3AGR A;  1BG3 A;  5C15 A;  1ZC6 A;  3R3L A;  1RFQ A;  1YHQ N;  2VGN A;  4WF9 L;  4EFH A;  2QW9 A;  1GLB G;  3P4I A;  1QQM A;  3CJB A;  2F9T A;  1QQN A;  2CH5 A;  3WQU A;  1BO5 O;  3VER A;  5H1S Q;  1SAZ A;  3HSC A;  4FSV A;  5F2R A;  5JVH L;  2HF3 A;  3HI0 A;  3EKS A;  4Z94 A;  5E26 A;  4A62 A;  3LM9 A;  1VQL N;  3R6M A;  2NRV A;  4CZH A;  3VTH A;  5AQS A;  2VWB A;  2P9K B;  3QIC A;  2Q0U A;  4NO7 A;  3TPQ A;  3CCR N;  4CI6 A;  5JLF A;  2IVO A;  3ZX3 A;  4B9Q A;  5ADX H;  4BC3 A;  4JK7 A;  1ATS A;  4A2B A;  1YF5 L;  3CC7 N;  2GTD A;  3L4Q A;  1G99 A;  1V4S A;  4ILH A;  4C1N K;  3H46 O;  5E84 A;  1ATN A;  3O9R A;  5EVZ A;  2FSN A;  2ITM A;  3HOT A;  3ID6 A;  3CER A;  4H0X B;  5LJV A;  5AQU A;  2GEL A;  4B1Z A;  1O13 A;  1NGJ A;  4BVP A;  3U9D A;  3MCA B;  4BG8 A;  1U2V A;  3VPZ A;  3CME N;  4R79 A;  3DLL L;  2A5X A;  1BUP A;  1NGA A;  5GAE P;  1JCG A;  3CHW A;  5CR4 A;  1EQY A;  2A41 A;  1HJO A;  5EX5 A;  4WQ4 A;  1X3N A;  1JCF A;  4KH5 A;  4K42 A;  5C0Y A;  1J6Z A;  4JKC A;  3D2E A;  3GE1 A;  4FWR A;  4JKE A;  1TUY A;  2E20 A;  2A3Z A;  4CZM A;  4ISE A;  5GIP A;  2P9L A;  1P8Z A;  2E1Z A;  3CJ1 A;  2P9I B;  3N4P A;  5LJW A;  2HST A;  3D2E B;  1SZ2 A;  4H03 B;  3G71 N;  5B8H A;  1GLE G;  2HF4 A;  2ASO A;  1GLA G;  4BR4 A;  2FXU A;  3O6W A;  3WEE A;  1ESV A;  3IDH A;  4IOC L;  1VQ7 N;  1BA1 A;  4H0T B;  3KZB A;  2NLX A;  4EHT A;  2FSK A;  3VET A;  3CCU N;  5C2D A;  3C6A A;  3H1V X;  3A0I X;  4FWK A;  1ATR A;  1VQN N;  3I55 N;  1TUU A;  2P9N B;  2GUP A;  3KVG A;  3ZX2 A;  4GV9 A;  1NJI O;  3NVM A;  4MO4 A;  4NLC A;  3O8M A;  1KAX A;  4GNI A;  2Q97 A;  3JS6 A;  1YI2 N;  3LDL A;  4ISF A;  2GWK A;  3C7N B;  4XH5 A;  2EWS A;  5AQW A;  4B1U B;  4Y0W A;  3SMP A;  3CPW M;  3CQX A;  5JMV A;  5CE3 A;  4H5W A;  2NZT A;  5EXW A;  4BRO A;  4CZF A;  4U7B A;  3ULE B;  3O9Q A;  1NGF A;  2W41 A;  4H5T A;  4FVU A;  2HBK A;  2HOE A;  3HTV A;  4FPA A;  1ZBS A;  4ILJ A;  3VEO A;  3M6G A;  3FZL A;  3J8A A;  4BRD A;  2QWO A;  4E1J A;  3P39 A;  4BRH A;  5BPM A;  1K73 O;  1S22 A;  4NB4 A;  4JKG A;  2I7N A;  2YJE A;  3E1Y A;  2A40 A;  3RSE A;  5AQK A;  3ULE A;  3CCM N;  4IZ9 A;  1YAG A;  3UB5 A;  5AQF A;  2P9S B;  1YIJ N;  5AQP A;  3R1X A;  1GLJ O;  2A42 A;  1MDU B;  4BRC A;  4BQZ A;  5JLH A;  3TTF A;  4WQ5 C;  2ZJR L;  3CF5 L;  4OO1 J;  3A5M C;  2KHO A;  1NGH A;  2HBL A;  3C65 A;  4MDA A;  5KQD A;  5AFU H;  3WT0 A;  1KC8 O;  1K8K B;  2BH1 A;  4IEE A;  1Z05 A;  3QB0 A;  4JHD B;  1YJ9 N;  5TKW A;  5F0X A;  1VQK N;  4YDU A;  3SJH A;  3G4S N;  5AZJ B;  4IXC A;  4EHU A;  2ZJP L;  4AM6 A;  3SAG A;  5FPN A;  1NGC A;  1C0G A;  4O8K A;  4FL9 A;  5EOY A;  3ZEU B;  2QA4 N;  5I9E B;  4G9Z A;  4IO9 L;  3OHR A;  3O08 A;  1YXQ A;  1H1V A;  4NLB A;  3TU5 A;  1Y64 A;  2CGK A;  4CD3 A;  4RWT A;  4WFN L;  3GDQ A;  5C2F A;  2Q0R A;  4BGB A;  3G25 A;  1T6C A;  3BUZ B;  5AR0 A;  1KXP A;  3CCE N;  3CCS N;  2V52 B;  1HUX A;  3MCP A;  1YUW A;  3N4Q A;  3CJ9 A;  4M7X A;  1S72 N;  4HWI A;  4IFE A;  3CQY A;  3WQT A;  1DT9 A;  1OKJ A;  1T44 A;  2I7P A;  2QXL A;  3P31 A;  4H5N A;  4FWN A;  1MWM A;  3VEY A;  4YOR A;  3CJ7 A;  3VEV A;  2V7Z A;  3C7N A;  2NRZ A;  3H6E A;  3VEW A;  4A61 A;  3HRG A;  5M1N A;  1RGI A;  3SLC A;  3WXI A;  5EY4 A;  2OTJ N;  1NGB A;  3FE1 A;  4EAH D;  1BU6 O;  1LOT B;  1NGE A;  4PL8 A;  2E2Q A;  4BR2 A;  4BRE A;  4CD1 A;  4YOY A;  5M1Q A;  1M90 O;  3CXC M;  4CZJ A;  2NRH A;  3ENB A;  5BRE A;  2F9W A;  1JJ2 M;  4BC5 A;  5M1F A;  3LDP A;  5AQH A;  2NRW A;  3U9Z A;  4BC4 A;  4BR0 A;  2QWP A;  5KQ8 A;  4FWO A;  2RHK A;  3BF1 A;  5AQY A;  3TSQ A;  3QBX A;  3SK3 A;  3VGK A;  3SAF A;  3ZYY X;  4M63 C;  3TSP A;  4BG9 A;  5AQX A;  1S3X A;  2F7T A;  4GY2 B;  3VOV A;  3KK7 A;  3DXK A;  3VF2 A;  1Q7Y O;  4O5F A;  2P9S A;  3C0B A;  5AZI B;  4BRK A;  4H0Y B;  2E2P A;  2E1Y A;  2QWQ A;  5GAD P;  3CD6 N;  5GIN A;  4GVE A;  4YOV A;  4H5V A;  3WUH A;  5BPL A;  5BRH A;  2NRT A;  5ELZ A;  4PKG A;  2E8A A;  2PFU A;  4JD2 B;  5FPD A;  3WXK A;  4BQL A;  3D2F B;  3O4W A;  4FOE A;  4MO5 A;  2HBJ A;  4RCH A;  5AQR A;  5BN8 A;  3F9M A;  3LM2 A;  5GAH P;  4WQ4 C;  1BOT O;  1VAZ A;  3LL3 A;  4PHT X;  3W3D A;  1WUA A;  1XQS C;  4YOW A;  3IMX A;  3O9T A;  3LDO A;  4CZK A;  4ISG A;  3EE9 A;  1QVF M;  1GLD G;  2FF3 B;  3PIO L;  3TSU A;  1QZ5 A;  4BRP A;  3EN9 A;  4B1Y B;  4H0P A;  5BRD A;  3CC4 N;  4XEI A;  2P9U A;  2DPN A;  3VGL A;  1VQ9 N;  4JKB A;  4RTF D;  4JHD A;  3ATV A;  4JEP A;  2E2O A;  3AY9 A;  1TYQ B;  2BTF A;  4O8U A;  2JWK A;  5F1X A;  4FWL A;  3PLA A;  3FFK B;  1CZA N;  3AAQ A;  4J8F A;  3KWI A;  4ILG B;  5CHI A;  3FZH A;  1U6Z A;  3O1B A;  3B8A X;  1NWK A;  4L3Q A;  5AQN A;  2QWM A;  3M5R A;  4B1V A;  2ZJQ L;  3SBG A;  1WOQ A;  4CZL A;  1VQM N;  1EO1 A;  5LY3 A;  3I56 N;  4YOT A;  4BRL A;  1KAY A;  3CIP A;  1R59 O;  3UE5 A;  2H3G X;  3QFP A;  3F5T A;  4H5R A;  5HL7 L;  2JWL A;  3ZX0 A;  3EL2 A;  4FWP A;  1P90 A;  2QI2 A;  2ZF5 O;  5JIC A;  4CBX A;  2VCP A;  3MN5 A;  2YX6 A;  2RE2 A;  5KPR A;  3SAH A;  1DGK N;  2CGL A;  3O9S A;  1XC3 A;  3UKU B;  5KPT A;  5M1K A;  5AQO A;  2YI1 A;  3VEX A;  2KLA A;  3OA9 A;  3VTI A;  3LDQ A;  5AQI A;  5HOO A;  2NRX A;  1ZXO A;  2ZGZ A;  1M1K O;  3DAW A;  1C0F A;  3EKU A;  3F2K A;  2V7Y A;  3BF3 A;  3CMA N;  2VYP A;  3CCV N;  3E9P A;  3IKM A;  3QFU A;  1W97 L;  4KH6 A;  1RDW X;  1MWK A;  2P9N A;  1KAZ A;  4CBU A;  1BWF O;  4C23 A;  2WBN A;  1HKC A;  4FOI A;  1W2B M;  1YVN A;  4F9O A;  2HBM A;  4I6M A;  2IIR A;  4JNE A;  1VQ6 N;  3CET A;  1RDU A;  4LC9 B;  4BY9 C;  3QBW A;  5FPE A;  4IOA L;  4JK9 A;  3CC2 N;  3QDK A;  4KH4 A;  1KD1 O;  3ATU A;  3H45 C;  4I6M B;  4WYB A;  3TTC A;  4JKF A;  3VF4 A;  4BC2 A;  4BRG A;  3DWL A;  2QTD A;  1VQ8 N;  2GWJ A;  4H0V B;  3IFR A;  3NVK A;  3A5L C;  1K8K A;  3A8Y A;  5AFU A;  5AQL A;  3A5O C;  2UYT A;  3D2F A;  5AZI A;  3DJC A;  3L4I A;  4BR5 A;  2GEM A;  3JXU A;  3HM8 A;  3SMS A;  3FGU A;  1HKG A;  3KHY A;  1NLV A;  4AF1 A;  4BVO A;  5JVG L;  4GV6 A;  1QVG M;  3MN7 A;  1HLU A;  4WFA L;  1VQP N;  3BEX A;  4QS8 A;  4A59 A;  4UY8 O;  3FZM A;  3UKR A;  3VMF B;  4XH4 A;  2YHX A;  1DEJ A;  3Q7B A;  3L6Q A;  3LDN A;  3E9L A;  4FWM A;  5AQZ A;  5BPN A;  3AGK A;  4K25 A;  3TTD A;  3VEZ A;  4DCH A;  1HKB A;  1GLF O;  3MWP A;  4K41 A;  1Q81 O;  3VF6 A;  3FLC O;  5AQJ A;  2KKZ A;  1VQ5 N;  1SQK A;  2P9P B;  2ASM A;  5C12 A;  2QWR A;  4JKD A;  1NGD A;  1QZ6 A;  3KWG A;  3OBW A;  5FPM A;  5M1P A;  3HBT A;  4IO8 A;  2AA4 A;  2YJF A;  4BR9 A;  2FLO A;  3WXJ A;  2P9L B;  5M1O A;  4H0O A;  4IDH A;  4QS7 A;  3ID8 A;  4A2A A;  4WCE L;  3MX2 A;  3CCJ N;  3NMU A;  3U8X A;  3U4L A;  1U2V B;  1Q86 O;  3D7E O;  2E88 A;  5BRF A;  3E9O A;  2D1K A;  2Q36 A;  4JN4 A;  1Q18 A;  3IUC A;  2QEX N;  3CCL N;  1XUP O;  3K9J A;  5AQG A;  5AQQ A;  2Q31 A;  4BGA A;  5KPZ A;  5GAG P;  5AQV A;  3R8E A;  3CJC A;  4BRF A;  3MX5 A;  3FR0 A;  3EE8 A;  3MWT A;  3OBY A;  2ZWH A;  4PL7 A;  1E4F T;  2P9I A;  4IEI A;  4OPH A;  1GLC G;  4QS9 A;  3ZET A;  1SS6 A;  3MN6 A;  5C10 A;  3MK6 A;  3R9P A;  3CI5 A;  4DB3 A;  1JCE A;  2VGM A;  5AQT A;  4BRQ A;  3RVC A;  2YHY A;  4IJA A;  4BRA A;  2CGJ A;  3WXM B;  1GLL O;  1X3M A;  2CH6 A;  4JKH A;  3J7Z O;  3L0Q A;  3ZET B;  2ZGY A;  3I8B A;  3H1Q A;  4JD2 A;  5GIO A;  1QQO A;  1T6D A;  1BDG A;  3DXK B;  4BRI A;  4U67 L;  4FWQ A;  3M3Z A;  3MDQ A;  5ADX A;  2AP1 A;  4FPB A;  4PKH A;  4CZG A;  3HOS A;  3WXL A;  4K43 A;  4B1X B;  1YIT N;  4CBW A;  2WUS A;  3Q7C A;  2D4W A;  1NBW A;  4XH1 A;  3C6H A;  4JKG B;  4MLE A;  3O1W A;  3CJA A;  3RSE B;  4C1N I;  1HPM A;  1NGG A;  1T3V A;  4FO0 A;  1IJJ A;  3PIP L;  5DM7 L;  4GV3 A;  2QWL A;  2P9U B;  2OTL N;  2V51 B;  5AQM A;  2P9K A;  2W40 A;  3AAP A;  3CPE A;  3AAR A;  4JAX A;  3SBT A;  3GG4 A;  3ZEU A;  4M7Y A;  4IWV A;  5DM6 L;  4EIA A;  1NMD A;  3P38 A;  2GX9 A;  2D0P A;  2D0O A;  4IOX A;  3UKR B;  1K9M O;  1ILY A;  2FSJ A;  4A5A A;  4HTL A;  1TYQ A;  4YOX A;  1YJW N;  2BUP A;  5TKY A;  5AZJ A;  3DXM A;  3MMV A;  4IJN A;  1BA0 A;  3T69 A;  3A5N C;  2YHW A;  3ENO A;  4MDB A;  4CZI A;  2Q1N A;  3OW2 M;  3W0L A;  2P9P A;  1E4G T;  1HX1 A;  1MA9 B;  4JK8 A;  4PKI A;  4CZE A;  3EZW A;  3M1F A;  2IVN A;  3MN9 A;  3DXM B;  4BRN A;  3UKU A;  4OPA A;  5BN9 A;  4WQ5 A;  1Z6R A;  4A5B A;  4BRM A;  2OAN A;  2QM1 A;  4B1W B;  1V4T A;  3ENH A;  3GBT A;  3VES A;  2A6A A;  2WFB A;  4YOU A;  3VEN A;  4JKA A;  1N8R O;  1NM1 A;  1VQ4 N;  3S41 A;  3T7Z A;  3BP8 A;  3WEE B;  3O9U A;  2NNW A;  4A57 A;  2FF6 A;  4CJ7 A;  4AM7 A;  1KQS M;  4YDU C;  2YCH A;  3K9K A;  1K8A O;  1NGI A;  2HMP A;  4DQ8 A;  4KBO A;  3QML A;  3GOI A;  3VGM A;  4MLH A;  1VQO N;  2NRR A;  1QHA A;  2E2N A;  4FWS A;  1YJN N;  2Q2R A;  1OVY A;  3HZ6 A;  4BR7 A;  1X9J A;  2WC9 A;  3D6R A;  1LCU A;  3EO3 A;  3H3N O;  2J4R A;  3CCQ N;  3FZK A;  1Q82 O;  2PAV A;  3G6E N;  5MLC Q;  1DKG D;  4DHY A;  2QWN A;  2IVP A;  1IG8 A;  1D4X A;  3E66 A;  2ASP A;  3H3O B;  3FZF A;  4DKW A;  5BR9 A;  4WFB L;  3GL1 A;  3O5B A;  3I33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...