3VQ9A

Hiv-1 in core domain in complex with 6-fluoro-1,3-benzothiazol-2-amine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 53
structure length 142
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq9A00
3TAQA 1TK8A 3HJFA 4PY5A 1Z25A 4E7KA 1N5YA 4FLZA 3WNHA 1RNHA 1S1XA 3V9SA 3V4IA 3K2PA 1C1AA 1BGXT 3ZT1A 3LZIA 4KHUA 1WAFA 2YNFA 4CJRA 2X6SA 1T8EA 2HHSA 3LWMA 1S6PA 4DF4A 3RTVA 3TAPA 4N47A 4CJ4A 1WSJA 3DRSA 3VQPA 5CYQA 4AHTA 4K8ZA 3QEXA 2I5JA 2QKKA 3AA2A 3RRHA 1O1WA 4CHOA 3SUQA 3HT3A 4OJRA 5HRRA 3SV3A 5C42A 2G8HA 2G8KA 4KHNA 3NGZA 3RR8A 1Q8IA 3IAYA 3RMAA 4CHYA 4KHSA 3JYTA 4W5RA 4Z0UA 1TKTA 4GVMA 4O4GA 3TAFA 5HRSA 1RILA 4FJ7A 2OZMA 4CJPA 4CF9A 4KO0A 4ZTFA 1T03A 1SL1A 3RRGA 4QCLA 3AO3A 4IG0A 1RT2A 3ZSOA 1S5JA 2BANA 4W5TA 4DTNA 1C1CA 1WAJA 1IKXA 4FLXA 4FJ5A 4M3YA 3V1OA 5D3GA 1BHLA 3KJVA 2IC3A 4KHQA 3HM9A 4KTZA 1REVA 4TSXA 1TKDA 4I9QA 3KKSA 3VQ5A 4OPJA 4FLTA 1J5OA 2B6AA 3L2QA 1ZBHA 4DF8A 2XO7A 3RR7A 3ZCMA 3LAMA 3DLHA 4XIUA 3OYMA 3NF9A 3C6TA 4OVLA 1RTJA 5C25A 3CFOA 5J2NA 3TR8A 4ID1A 1WSEA 1NK4A 1A5VA 4HHTA 3QETA 2JLEA 3RMBA 3M8PA 4W5OA 4BDYA 4F3OA 1TAUA 2D5RA 3G0ZA 2FC0A 3HPGA 3VQQA 4I9LA 3SPYA 1LV5A 3NDKA 4JS4A 4Z4EA 1LWEA 5HRPA 4N56A 3RMDA 4CJQA 3NE6A 4B9UA 3PV8A 1RT5A 1VSKA 3ZT2A 2Y1JA 3ZSXA 4CK3A 4M3TA 4FJHA 4O5BA 1XI1A 3KLHA 3NF8A 2BE2A 3QINA 1IKYA 4HCCA 1X9WA 1VSHA 2HHVA 3DI6A 1C6VA 1XWLA 1SKWA 1VSMA 1DLOA 1RDBA 4Y1DA 1K6YA 1C0MA 1S1VA 4CJFA 1Y97A 4CJVA 4DSJA 2AJQA 4DSFA 5J1EA 4F3TA 4ID5A 4ICLA 5SWMA 1BCOA 1C0TA 4FW1A 2P5OA 4DTPA 4FJGA 5FROA 4YNQA 3BGRA 4IFVA 3CM5A 4JS5A 1R0AA 4KB0A 3PX0A 5HBMA 1RDAA 3OY9A 2P51A 1ZBLA 1L3TA 5KGWA 1D8YA 3VQ9A 4KI4A 4CJLA 3KLEA 1Z26A 3MXJA 1UA1A 1XHZA 2OZSA 1U45A 3V9WA 4NCGA 3QESA 1VSFA 1BIUA 2E4LA 3WNGA 3U6FA 3OYHA 4C8NA 1L3UA 4F2RA 2D0AA 4RW6A 4Z4FA 1RCHA 1IO2A 1HNIA 3DYAA 3VQDA 1ZYQA 4CECA 2HNYA 3PY8A 4PUOA 3MXIA 1W9HA 4IG3A 3AA3A 3VA3A 3V1QA 3MEDA 3K5LA 4LH5A 3AVLA 1KLNA 3K5OA 3NH1A 3SCXA 3L3VA 3LP0A 4RW7A 3OYCA 3V9ZA 3HVTA 2OPRA 5CZ1A 4DTXA 3QEWA 5JS1A 1LWCA 4OGCA 1U49A 3AVKA 4KHYA 4C8LA 3KK2A 2HNZA 3L2WA 3KTQA 4MFBA 5KTQA 4FXDA 4H4OA 4CJWA 3KKRA 3F73A 4BE1A 3V9XA 4DQQA 4AHUA 1NJZA 2A1SA 4CGFA 3CQ8A 1T05A 3KD5E 3VQAA 2YKNA 3SUPA 1B9FA 4N41A 3JSMA 4F4KA 1TK0A 4CERA 1JLQA 5HROA 2HHUA 5FDLA 2YHAA 4DQPA 1VRUA 4QOZB 4CEAA 5DMRA 3LP3A 4DQRA 3ISNC 4FJMA 4DS5A 1HRHA 1WN7A 4Z4CA 4BWMA 3ZSWA 1RT3A 4H8KA 1DTTA 1JXEA 2GBZA 1FKOA 1BL3A 3B6PA 2VWJA 3C94A 3L2RA 1NOZA 3SV4A 4KI6A 1EETA 4FW2A 1Q9YA 4F8RA 3AVNA 2W42A 1T7PA 2X78A 3TANA 3LZJA 1IH7A 2P1JA 3DRPA 4Z4GA 1N6QA 1X1PA 3I8DA 1VSEA 2Z1HA 3QEPA 1JKHA 4G1QA 1HNVA 2VG5A 1L3SA 3SPZA 3HSTB 1LAVA 3NF6A 4W5QA 3ZSVA 4PQUA 4CGGA 3CFPA 1HQUA 3O3HA 1NK0A 3OS0A 3VA0A 4CF1A 2Q3SA 5KGXA 3S3MA 1B9DA 3E01A 4DWIA 5E41A 4M3WA 2G8UA 4B9VA 4DU4A 5I3UA 1WSHA 1QHTA 2IS3A 3O4NA 1J53A 1GOAA 3MXMA 4N5SA 2PY5A 4FK0A 3NCIA 3OYIA 1FK9A 1MU2A 4QAGA 2IGIA 1LW0A 3KIOA 1KTQA 3NAEA 1KLMA 4FLUA 3TWHA 1CZBA 2F96A 1TKXA 2F8TA 2HHWA 4OKEA 1QS4A 3ZT3A 3U3YA 3TARA 1BQMA 3AVIA 3HXMA 4E7HA 4YFUA 4DFJA 3SUNA 2ATQA 4BDZA 4FCYA 2HVHA 3CYMA 1NK6A 2OPPA 4L8RB 4M45A 3LANA 1UA0A 4FJJA 4O55A 3RMCA 3H08A 3ZT4A 1QTMA 2F8SA 1RTDA 1WSIA 4FK2A 4CEBA 1ZBIA 4M3UA 3L3UA 4C8OA 2Z1GA 3VQ7A 4KKOA 1VSIA 1YVUA 2OPSA 3LP1A 4PWDA 2ETJA 1HJRA 4CE9A 2OPQA 4CK1A 1U4BA 4DSLA 4FJNA 4M42A 5FRNA 2KZZA 1QSSA 4C8KA 3DMJA 2YNGA 2ZE2A 4FLVA 3L2UA 3LWLA 4FM2A 1D9FA 1TL1A 1S1TA 3K5MA 4DTJA 3C95A 1ASVA 1CXUA 1EP4A 1UAXA 4OLBA 3PX4A 4KHWA 3DLEA 4DQIA 3EY1A 3L8BA 4J2AA 4CEEA 1QSYA 3QEVA 4KB1A 1WNSA 4CGDA 3KK3A 4DFMA 4I2PA 3PO4A 1JLCA 1FKPA 3S9HA 1LWFA 3KLIA 2P5GA 3KD1E 5J2PA 3O3FA 3T19A 3I0RA 3SUOA 1NK5A 1BI4B 1RBSA 4B8CA 3F9KA 2G8FA 1CLQA 4LSNA 4JRPA 3T3FA 3TABA 3OYGA 1KRPA 4HUEA 2YHBA 5CZ2A 4ELTA 4Q0BA 4AILC 3CM6A 3AO4A 3QLHA 4GMJB 4CJSA 2JGUA 3SI6A 2OA8A 2WONA 3TAMA 3EZ5A 3DLGA 3MAQA 4R5PA 3ULDA 2XY7A 4M3XA 2EX3A 1WLJA 2DFFA 4OKKA 1VRTA 3FFIA 5CY4A 4RW9A 4E7LA 4KPYA 3WNEA 4IDKA 4FJLA 3I0SA 4KRFA 3AA4A 3T1AA 3SJJA 2RN2A 2D0BA 4DFPA 4K8XA 3NBPA 1S9EA 3DLRA 4CGHA 2XRIA 4NCAA 3WNFA 4ELVA 4Y1CA 4E19A 2FBTA 4JRQA 2YNIA 4FJKA 5CYMA 2IAJA 3QIPA 3NHGA 3CFRA 1SUQA 3MEEA 1BIZA 4O0JA 1HYVA 4KFBA 4ZHRA 4O0IA 4FM1A 3VQ4A 3V9UA 4LH4A 2PZSA 3U3GA 1HYZA 2Z1JA 3QEIA 1D9DA 3ALYA 1RBVA 1S9GA 2VG7A 5EU7A 3IRXA 4CFDA 4IFYA 3QERA 3THVA 1C0UA 3DOKA 4HTUA 1J54A 1GOCA 5HLFA 4FJ8A 2X74A 1L3VA 1SKRA 2QK9A 1RTHA 2XY5A 1B92A 5I42A 1TKZA 4M3RA 3K57A 4IKFA 4CHNA 4NCBA 1A5WA 2ZD1A 4DMNA 2HNDA 4Q5VA 2HVIA 4FJXA 4CJ5A 2R7YA 1IG9A 3HYFA 2HHTA 2O4IA 4CEQA 3M8QA 3MEGA 1FXXA 3OVNA 4DFKA 1XC9A 5SZTA 4FVMA 3VQ6A 3O4QA 1CXQA 5KI6A 3VN5A 1KCFA 3AVFA 3TAEA 1NJYA 1S6QA 2OYQA 4RG8A 4BACA 5FRMA 2HW3A 2RKIA 1TV6A 2XHBA 4CESA 4HVJA 1CZ9A 4CEDA 1LAWA 2EHGA 3HP6A 3LAKA 2FBYA 3VQ8A 1XHXA 5JS2A 1JLAA 3K5NA 1X9SA 3AVBA 4DLGA 1S1UA 4C8MA 3NGYA 3DOLA 4CFAA 4CHQA 4EP5A 4LY7A 4KTQA 2YV0X 3AO2A 3CG7A 4J2BA 2VG6A 3LPUA 4BE0A 3S3NA 1SL2A 3ZSYA 4E3SA 3BDPA 1TGOA 4WE1A 4OLAA 1VSJA 3KLFA 3TI0A 3ZT0A 2DFEA 2O4GA 3TAGA 3P5JA 1JL1A 3OYEA 5J2MA 5K14A 4CEFA 4J2EA 3PX6A 2BDPA 4M41A 4KAZA 3SQ0A 4B9MA 1NJXA 2DY4A 4CCHA 1KVCA 4KV8A 4DS4A 4CIFA 4DTOA 4IBNA 2DTUA 4B08A 3KLGA 1BISA 1NKBA 4FLWA 4CEZA 3AVJA 2LSNA 1F21A 1RDCA 3AO1A 2HMIA 4RW4A 3OYFA 1L5UA 4CJEA 1WSGA 1NJWA 1I3AA 4UQGA 2QXFA 4DTMA 4CFCA 4E1MA 1ASUA 4CJTA 3M8SA 1U04A 3D0PA 1KVAA 1SKSA 4FJ9A 2KW4A 1RT6A 1UOCA 4OPKA 4RW8A 3AVMA 1RBTA 4KTWA 1ASWA 3HVRA 3QNOA 5J2QA 1HPZA 3QNNA 3NH2A 3OJUA 4CJ3A 4NYNA 1UWBA 2HHQA 1TK5A 1NK7A 1S1WA 4CEOA 1HYSA 5DK5A 1RTIA 3SNNA 1X9MA 1BCMA 1KFDA 4HUGA 3HP9A 1NOYA 4B9TA 4FLYA 1NK8A 4JLHA 3HPOA 1LW2A 4CHZA 4CGIA 2PYLA 2KZMA 1G15A 3A2FA 3VQEA 4CIEA 1KSPA 2B5JA 4CF0A 2NUBA 4EP4A 4FK4A 3LALA 3NH0A 3AVAA 3NF7A 3OJSA 3OYLA 3K58A 3UIQA 1VK0A 4MQ3A 4FZYA 1JXBA 3O3GA 4DU1A 4CJUA 4NYFA 3HO1A 4CF8A 2RPIA 3S3OA 4HCBA 2YKMA 2GV9A 2IOCA 4KREA 4OKJA 4AH9A 3HK2A 4AHSA 1NKCA 1KVBA 2PYJA 4DTUA 3QIOA 3B6OA 4CIGA 4O44A 1SV5A 4N76A 1QE1A 4ZTJA 3HPHA 3LP2A 3AO5A 1VSDA 1QSLA 3SZ2A 3AV9A 4CJKA 4FM0A 1JLGA 2E6MA 4DTRA 4ELUA 4M3ZA 2XY6A 3OS2A 3SYZA 2X6NA 3VQCA 1NK9A 4E89A 2G8IA 4H4MA 2Y1IA 4BDPA 3OYJA 1IKWA 1RT7A 3P1GA 4CHPA 3NFAA 3DLKA 3M8RA 2QKBA 1TAQA 4PA1A 5HRNA 2BGGA 2HHXA 4LD0A 4DTSA 3C6UA 3AVCA 1W0HA 3IS9A 4BWJA 3OYNA 1IKVA 1U48A 1DTQA 1ZBFA 2XY8A 4DSKA 5KRSA 4FJIA 5C24A 3ZSZA 4B9NA 3L2VA 1JLFA 1HQEA 3RWUA 1C1BA 4CGJA 3ASMA 3DLBA 4W5NA 3LPTA 3V1RA 3HL8A 3EYZA 4FZZA 4B3OA 3DRRA 4I2QA 2YNHA 2FBXA 1A5XA 3G10A 3OYAA 2DFHA 3DM2A 3ZSRA 3KK1A 1NKEA 3QO9A 3OYKA 4CK2A 3LDSA 4BE2A 3AVGA 3ITHA 3ZSQA 3PUFA 1EX4A 1EKEA 1JL2A 1TL3A 1I39A 4E0DA 1ZBUA 2G8VA 4Z4IA 1EXQA 1YT3A 4GW6A 3K59A 4E7IA 4DSEA 3SQ4A 2KTQA 1RDDA 4E1NA 1JLBA 1VSLA 3SQ1A 1TVRA 2ZQBA 1BQNA 4CFBA 4E7JA 2A1RA 4EZ9A 4DSIA 2KFNA 2KFZA 1HMVA 3V6DA 5HP1A 2VWKA 1RBUA 1D5AA 3OYDA 1U47A 2B4JA 2HB5A 2WOMA 2IDOA 4EZ6A 1BI4A 4AHCA 3MECA 4F2SA 5T7BA 2FBVA 4DG1A 1SL0A 1ITGA 2G8WA 4AHRA 4B9SA 3AVHA 1RT1A 2RF2A 2E6LA 3NGIA 4B9LA 1WSFA 3V81A 1KFSA 3PO5A 1J9AA 2Z1IA 2KQ2A 3AA5X 1RBRA 1YTAA 2ITGA 3D45A 3OYBA 4HUFA 4DLEA 4OGEA 4B8AB 4LSLA 1GOBA 4J2DA 1JLEA 1YTUA 4CF2A 3VQBA 3SQ2A 1Q9XA 3OS1A 2GUIA 3P83D 4FZXC 4I7FA 4Z4HA 3IG1A 2D0CA 1QQCA 1RT4A 4DQSA 5KRTA 4DU3A 4AHVA 4FYDA
chains in the Genus database with same CATH superfamily
3TSUA 4BC3A 4JKGB 4FLZA 1RNHA 2E20A 5BRFA 3V4IA 1C1AA 4KHUA 3LZIA 1WAFA 4DF4A 1VQ7N 4N47A 4CJ4A 2NZTA 3DRSA 2A40A 2A42A 2QKKA 3J81O 2ASPA 3SUQA 2UUCK 4IOXA 4R79A 5JVHL 2G8KA 1Q82O 4W5RA 4GVMA 4O4GA 3TAFA 4J8FA 4FJ7A 4IXCA 4KO0A 3CJAA 4IG0A 1RT2A 4W5TA 2BANA 4BC2A 3V1OA 5D3GA 1BHLA 3KJVA 3CJ1A 2IC3A 3BF3A 3VQ5A 3P39A 1Z6RA 3DJCA 3RR7A 4XIUA 2Q2RA 4OVLA 2I7PA 1NK4A 1V4SA 4HHTA 3M8PA 3MDQA 3J8AA 2D5RA 1WB9A 4JI0K 5ADXH 4BY9C 3NDKA 4JS4A 3B8AX 3PV8A 1VSKA 4CBUA 3IKMA 4FJHA 4BRKA 1XMQK 1XI1A 2W6KA 2BE2A 1IKYA 1X9WA 4X64K 3TU5A 4CJFA 1K6YA 1QVFM 1S1VA 3TTFA 4DSFA 2D0OA 1XQSC 2FF3B 4FW1A 1C0TA 3PIPL 5FROA 1R0AA 3OY9A 5KGWA 4IDHA 3KK7A 3KLEA 1UA1A 2OZSA 1U45A 2E4LA 3U6FA 3T7ZA 1V4TA 4RW6A 3M6GA 2V52B 3PY8A 3MXIA 4IG3A 4GV3A 4IO8A 4LH5A 1YI2N 1HX1A 5CZ1A 4ISGA 4KHYA 5AZIB 3L2WA 5KTQA 4FXDA 3H1QA 3EKSA 4JKFA 3KKRA 4BE1A 4DQQA 3V9XA 5AQPA 1NJZA 2W40A 3CQ8A 3KD5E 3SUPA 2BTFA 4N41A 4F4KA 2FF6A 4CERA 2HHUA 2YHAA 3E9PA 4DQPA 4QOZB 4KBOA 4BWMA 3TSPA 3FZKA 1DTTA 1N8RO 1FKOA 4AM6A 4KI6A 3SV4A 2QWOA 1Q9YA 2X78A 3I33A 3DRPA 2P1JA 5I9EB 1BDGA 2D0PA 2Z1HA 4MDAA 1G99A 2VG5A 3SPZA 1C0GA 4FPAA 1LAVA 3CHWA 5CR4A 3O3HA 3OS0A 2UU9K 2RHKA 1B9DA 4M3WA 4B9VA 3M5RA 4KHPK 1WSHA 1WBBA 4FVUA 3MXMA 4FK0A 2HF4A 1FK9A 4FWPA 4QAGA 4BRHA 3NAEA 2F96A 2F8TA 3U3YA 3O9UA 1T6DA 3AVIA 4E7HA 5LMNK 3CYMA 1NK6A 2OPPA 3OW2M 3ZT4A 1RTDA 2GTDA 4CEBA 3SMSA 3OA9A 4KKOA 1HJRA 2OPQA 4HWIA 2QW9A 3P31A 4IWVA 2KZZA 4FLVA 4Z94A 3IMXA 1D9FA 2P9IB 3C95A 3CCEN 2O8DA 3PX4A 3CQYA 4J2AA 4KB1A 3PO4A 4I2PA 2CGKA 3N4PA 1ZC6A 3KLIA 4YY3K 3KD1E 3I0RA 3SUOA 1RBSA 4JI8K 4B8CA 4BR0A 2QEXN 4JRPA 4AILC 3AO4A 4CJSA 2OA8A 2WONA 3DLGA 3M3ZA 4DV7K 3A8YA 2DFFA 3FFIA 4ISFA 4BRQA 2QWPA 4KPYA 3T1AA 2D0BA 4DFPA 1S9EA 3WNFA 4Y1CA 4E19A 4IEIA 3QIPA 4H0VB 1E4GT 1NGAA 1SUQA 4LF5K 2PZSA 3U3GA 1HYZA 3R9PA 3O8MA 5AQZA 5EU7A 4IFYA 5A2QO 4DB3A 3H3OB 4FJ8A 2X74A 2F4VK 1L3VA 4M3RA 4Q5VA 4DMNA 2HNDA 2HVIA 1IG9A 1Z05A 3MX5A 4LC9B 3MEGA 5BREA 3OVNA 2A41A 3Q7BA 4B1ZA 2QWLA 4FVMA 5KI6A 5IWAK 2WC9A 1NJYA 3A5OC 4CZMA 4BACA 4H0TB 2XHBA 3VEZA 2NRZA 2EHGA 3U4LA 3GL1A 3VQ8A 5JS2A 3A5NC 3D6RA 4C8MA 4KTQA 3NVKA 4EP5A 4LY7A 3VEWA 2E1YA 4E3SA 3BDPA 5M1NA 3H46O 1NGHA 3PX6A 3I56N 1ATSA 1BU6O 2WBNA 4A2AA 4A5AA 1XNRK 4KV8A 3VTIA 4DS4A 1HR0K 4CEZA 1RDCA 4YDUA 3MWPA 1BO5O 2VGNA 1VAZA 1L5UA 4CJEA 1WSGA 2QXFA 3BY5A 3J7ZO 4CJTA 3M8SA 2OTLN 4BROA 4DV2K 1RT6A 1UOCA 1VQ4N 1ASWA 1HPZA 3NH2A 3RSEA 4BR9A 3BZCA 2HHQA 1S1WA 1HYSA 3SNNA 3VOVA 1BCMA 1DEJA 3FGUA 4B9TA 4FLYA 3OTOK 4A61A 1G15A 3A2FA 3R3LA 1ATRA 4JI5K 2NUBA 2VYPA 5EX5A 3LALA 3NH0A 3AARA 3OYLA 4BC4A 3U9ZA 3SAFA 4JI3K 3S3OA 1YVNA 1JCGA 4KREA 4DUYK 3LM2A 1KD1O 4AHSA 1NKCA 2YJEA 4CIGA 4O44A 4CZFA 3EN9A 3AO5A 3I55N 1VSDA 4FM0A 1JLGA 2GELA 5TKWA 2X6NA 1QZ6A 3VQCA 4H0YB 1XUPO 1VQPN 4EHUA 4BDPA 4LF4K 3VERA 4FWRA 2OCEA 1NM1A 3DLKA 4OX9K 2QKBA 4LD0A 4K43A 3C6UA 1VQ8N 4DR5K 3D2EA 3BZKA 1M90O 5KRSA 5C24A 4B9NA 4IOAL 3MCPA 1WOQA 3Q7CA 3L2VA 1JLFA 1HQEA 4CZJA 3QBXA 3ASMA 3KHYA 4OPAA 4W5NA 3EYZA 4FZZA 3DRRA 4GKJK 2E1ZA 2DFHA 3KK1A 3QO9A 1P8ZA 1GLFO 3MN7A 1EKEA 4B1XB 1KAXA 4GW6A 4JI2K 4E7IA 1QHAA 4JD2A 1RGIA 1JLBA 1FW6A 1BQNA 2A1RA 3MX2A 3CJ9A 1HMVA 3MN9A 1EQYA 2FSNA 4EZ6A 3VMFB 3QBWA 4DR7K 1ITGA 3ENHA 1XNQK 2GWKA 5F0XA 1RT1A 4BRPA 1QQNA 4FO0A 1J9AA 1HKGA 1OH7A 1YTAA 3OYBA 4OGEA 2ASOA 4B8AB 3O1WA 5AR0A 4CF2A 1Q9XA 1VQNN 4YOYA 2O8DB 1HJOA 4DV5K 4DU3A 1TK8A 4V19S 4E7KA 3GDQA 3SAGA 3VENA 1BGXT 4DR4K 4JKDA 4CJRA 1RFQA 2X6SA 1T8EA 5BPNA 1S6PA 2VWBA 3LDLA 5AQVA 5GAGP 5CYQA 4DR3K 1K9MO 4H5NA 3SV3A 4OJRA 1P90A 5HRRA 5C42A 5FPDA 5BRHA 2ZGZA 1YJNN 3NGZA 3RR8A 3IAYA 4CHYA 3F2KA 4YOUA 2VCPA 2E2QA 4ZTFA 2HMPA 1T03A 4QCLA 1SL1A 3T69A 4DTNA 1C1CA 1WAJA 2HBKA 4FLXA 4FJ5A 4M3YA 2WFBA 4EFHA 3HM9A 4H5VA 3CPEA 3KKSA 1J5OA 3C7NA 2XO7A 3DLHA 5C25A 5AQIA 3CFOA 1WSEA 4AM7A 3QETA 2D1KA 4BDYA 1TAUA 2P9SA 3JS6A 2FC0A 3SPYA 1LV5A 5E26A 4Z4EA 1LWEA 3RMDA 3P4IA 3NE6A 4A5BA 3ZSXA 4CK3A 4M3TA 3L4IA 2CGJA 3FZFA 3I8BA 5GADP 3DI6A 1C6VA 1XWLA 1SKWA 1VSMA 1DT9A 3FZMA 3OBYA 1C0MA 2AJQA 1Y97A 1D4XA 5J1EA 4F3TA 4ID5A 3VPZA 3JAMO 1BCOA 4FZYA 4YNQA 3CM5A 5AQSA 3MK6A 1RDAA 4NB4A 1L3TA 2JWLA 3VQ9A 1XHZA 4HTLA 5C15A 4NCGA 4QS8A 1VSFA 1BIUA 2QTDA 4H0PA 4F2RA 4Z4FA 3MN6A 4CZHA 3DYAA 5GIOA 2W41A 3F9MA 3LL3A 4CECA 3EE9A 2HNYA 3SBGA 3CXCM 4MLHA 3VA3A 3MEDA 3AVLA 1KLNA 5FPMA 3NH1A 3L3VA 2KHOA 4DTXA 3QEWA 4C8LA 4H4OA 3F73A 5C2FA 4AHUA 3RSEB 1ATNA 5EY4A 2IIRA 3JSMA 1VQ9N 2AP1A 5HROA 3HOSA 5LMUK 1OKJA 4FJMA 5DMRA 3LP3A 3T1HK 4DS5A 4GKKK 1XC3A 2GBZA 2NRWA 3HRGA 4KH6A 3B6PA 1SS6A 1T7PA 2ZM6K 1X1PA 3I8DA 3QEPA 3NMUA 4MO5A 3CFPA 1HNZK 1HQUA 4CF1A 2Q3SA 3S3MA 3E01A 4JYAK 2O8EA 3FZHA 2HF3A 3VEXA 4BG8A 3KIOA 1KLMA 5AQHA 1KAYA 2V51B 4OKEA 1QS4A 5EOYA 5KQDA 3D2EB 2Q0UA 4C1NI 4UY8O 5JLHA 3CQXA 4FCYA 2HVHA 4L8RB 4M45A 1UA0A 5BPLA 3E1YA 4O55A 4FJJA 3H08A 2F8SA 1WSIA 3ZLJA 2Z1GA 3VQ7A 5JICA 1VSIA 5BPMA 2OPSA 1MWKA 2ETJA 4CK1A 4FJNA 5FRNA 3DLLL 4M42A 1QSSA 2YNGA 3L2UA 3K5MA 4JD2B 2OTJN 4JKBA 3DLEA 4JKHA 3EY1A 4DQIA 4BRNA 4JI7K 3KK3A 4DFMA 4GV6A 3S9HA 2KKZA 3O3FA 3L0QA 4WYBA 3F9KA 4B1WB 4GY2B 4LSNA 3T3FA 4HUEA 2YHBA 5CZ2A 1X3NA 5BN8A 3QDKA 4DV4K 1HUXA 3SI6A 2JGUA 4EHTA 3ULDA 4R5PA 1RDUA 1WLJA 4OKKA 5AQJA 4IDKA 1N36K 2E5LK 3AA4A 4NLCA 2RN2A 4BRFA 4K8XA 3NBPA 2XRIA 4NCAA 3EE8A 2FBTA 1YITN 2YNIA 4AF1A 4FJKA 3KVGA 3CFRA 3CJ7A 4O0JA 4O8KA 4KFBA 4ZHRA 4O0IA 1NGGA 3LM9A 5CE3A 3V9UA 1NMDA 1BA1A 3QEIA 1D9DA 1HPMA 1RBVA 4ILHA 2VG7A 4BQLA 1FJGK 2NLXA 3QERA 4CD1A 3THVA 3DOKA 4HTUA 1J54A 1GOCA 4BRAA 2CH5A 2QWQA 2O8FA 1SKRA 4C23A 1B92A 5I42A 4IKFA 2O8CA 3H6EA 5F1XA 2R7YA 1U2VA 1KAZA 5M1PA 3TTDA 3KZBA 4DFKA 3HTVA 5SZTA 3VQ6A 3O4QA 3R1XA 3TAEA 1S6QA 3SAHA 2IVOA 4MLEA 3K9JA 2HW3A 1CZ9A 3VTHA 4BREA 1KQSM 5LY3A 3LAKA 2FBYA 3SMPA 1XHXA 1JLAA 3C7NB 4JV5K 4NO7A 4B3RK 5C0YA 3CI5A 2YV0X 3CG7A 3AAQA 4YOWA 3S3NA 1SL2A 3WQUA 4ILJA 1LOTB 2E8AA 2DFEA 1HKCA 2P9SB 2UYTA 3P5JA 2H3GX 4CEFA 3E66A 3WXLA 5DM7L 4M41A 1YJWN 4B9MA 1NJXA 3CCJN 1KVCA 5AJ3K 4CIFA 2DTUA 3KLGA 3HSCA 3AVJA 3AO1A 4UQGA 1TUYA 4WQ4A 3CCSN 1U04A 3D0PA 1VQON 1YHQN 3IFRA 5BR8K 4KTWA 3HVRA 3CD6N 3QNNA 1IG8A 1JJ2M 3OJUA 4JI4K 4U67L 1TK5A 4EIAA 1J5EK 2E88A 4BGAA 3A0IX 1NOYA 4M63C 1LW2A 5AZJA 3WEEA 5HOOA 2Q0RA 4CF0A 4EP4A 1OVYA 4DR2K 3AVAA 2QXLA 3NF7A 3DXMA 3OJSA 3M1FA 3UIQA 1EWQA 1JXBA 1BOTO 3D2FB 4DU1A 4NYFA 4BG9A 5ELZA 2RPIA 1W7AA 4HCBA 3PIOL 2YKMA 1NGJA 2ZJRL 4WQ5A 2V7YA 4OKJA 1KVBA 3QIOA 3B6OA 4N76A 4ZTJA 1NGDA 3LP2A 4K41A 4BRMA 4LFAK 1QSLA 4XH1A 4AQYK 1RDWX 1NGCA 2XY6A 3SYZA 3FE1A 4CZEA 1NK9A 4E89A 2G8IA 4MO4A 4B1UB 3O9TA 1RT7A 3NFAA 3M8RA 1HNXK 5HRNA 3AVCA 3IS9A 1IKVA 2XY8A 4FJIA 3ZSZA 3ZX2A 5JMVA 4CGJA 3RWUA 2ZWHA 3LPTA 3HL8A 3ZX3A 4LF6K 3ATUA 4JKEA 4WFAL 2O8EB 1R59O 2NRTA 3AVGA 1GLEG 3PUFA 2UXCK 1EX4A 1I39A 3HZ6A 1YT3A 4DSEA 3SQ4A 4E7JA 4EZ9A 2KFZA 3CCMN 5HP1A 3CERA 4B9QA 5TKYA 1RBUA 5LL6Z 1D5AA 2E2OA 2B4JA 2HB5A 3QICA 3OYDA 2ZJQL 2WOMA 3SJHA 2OANA 4AHCA 3MWTA 3MECA 3G25A 5T7BA 2FBVA 3DAWA 2Q97A 4CBXA 4BR5A 4JK7A 3NVMA 3OHRA 4B9LA 3ATVA 1N32K 5AQMA 3V81A 1KFSA 2ITGA 3D45A 3FLCO 4DLEA 4FWSA 4IEEA 3SQ2A 4JKCA 3H3NO 4I7FA 4Z4HA 3IG1A 1RT4A 5H1SQ 4DUZK 3TAQA 4PY5A 1Z25A 2ZGYA 1S1XA 3K2PA 3WQTA 2FXUA 2HHSA 5AQOA 4CZKA 3C0BA 4DV3K 2EWSA 3QEXA 5JLFA 3RRHA 1O1WA 2P9LA 3S41A 2CH6A 3DXKA 3LDPA 3RMAA 2O8BA 4KHSA 2QA4N 5C2DA 2RE2A 1NGIA 4M7XA 1RILA 4OO1J 4CJPA 3AO3A 3CCQN 1S5JA 4WQ5C 1IKXA 4IJNA 1SAZA 1REVA 4TSXA 1TKDA 4FL9A 4I9QA 4WFBL 4FLTA 1ZBHA 3VESA 3ZCMA 3LAMA 3OYMA 3NF9A 3C6TA 5J2NA 2O8FB 3TR8A 4ID1A 1A5VA 4CD3A 3RMBA 2O8CB 4CZGA 3G0ZA 3VQQA 4I9LA 1U2VB 4N56A 3THWA 4B9UA 4RWTA 2Y1JA 1OH6A 2QWMA 4HCCA 3FR0A 4PKIA 4DCHA 5AFUA 3BF1A 1DLOA 4Y1DA 4DSJA 5F2RA 2VGMA 5SWMA 3O08A 4X66K 5GAEP 3BGRA 4JS5A 4KB0A 1IBKK 5HBMA 1NNEA 1D8YA 2JWKA 3MN5A 1Z26A 3V9WA 3ZEUA 3WNGA 3EO3A 4KH5A 2D0AA 1ZYQA 4O8UA 1HNIA 1YF5L 1W9HA 5E84A 3AA3A 2YHXA 3V1QA 4A62A 3K5LA 2P9PA 3THXA 3SCXA 3V9ZA 3HVTA 5JS1A 1LWCA 4OGCA 4DKWA 4IO9L 1U49A 3AVKA 3KK2A 2HNZA 1TYQA 3KTQA 4IZ9A 4CJWA 3MCAB 2HHHK 1NGBA 2A1SA 5AQFA 1T05A 3VQAA 2YKNA 1B9FA 1JLQA 5FDLA 5AZJB 3ISNC 1WN7A 1KXPA 3WEEB 4Z4CA 3UKRA 5M1FA 3ID8A 4YDUC 1BL3A 3DXMB 1NOZA 1EETA 4FW2A 2BUPA 3AVNA 4MDBA 2W42A 5EXWA 5GAHP 1IH7A 3UE5A 4CI6A 3GOIA 4BGBA 1JKHA 4G1QA 2YJFA 1HNVA 4H0OA 1EO1A 1L3SA 3O5BA 1IBMK 3ZSVA 1QZ5A 3KWIA 4NLBA 5IT9O 2QWNA 4K0KK 5M1OA 2G8UA 2IVPA 1I94K 2A5XA 5AQWA 1GOAA 3CC7N 3H45C 5AQGA 4N5SA 2UUAK 3OYIA 3G6EN 1LW0A 1NGEA 3CCLN 4FLUA 3TWHA 3BUZB 1OH5A 3ZT3A 3TARA 3RVCA 1BQMA 3CMAN 5AQQA 4YFUA 4F9OA 3SUNA 3WXKA 2ATQA 3J7YP 3RMCA 4FWQA 1ZBIA 2YX6A 1YVUA 4CW7B 4PWDA 2HHXA 3QMLA 5AQTA 5M1KA 2QM1A 3DMJA 2QI2A 4FM2A 1TL1A 4BRCA 1ASVA 4M7YA 4BQZA 3CPWM 3L8BA 3QEVA 4IFEA 1FKPA 2QWRA 3T19A 1CZAN 4FWLA 2ZF5O 1NK5A 4JN4A 2F9TA 3BP8A 3SK3A 1CLQA 3TABA 1KRPA 3OYGA 1NJIO 1U6ZA 4ISEA 3TAMA 3EZ5A 2XY7A 3MAQA 2EX3A 4E7LA 3WNEA 4FJLA 3I0SA 4KRFA 2HBMA 5BN9A 4IJAA 3DLRA 4CGHA 4JI6K 1NBWA 1Y64A 4ELVA 2E2PA 5B8HA 1OH8A 1DKGD 5CYMA 3NHGA 3MEEA 1VQLN 1HYVA 1MA9B 2FSKA 4LH4A 3A5MC 3D2FA 2Z1JA 4FWNA 1NGFA 3CCUN 4GVEA 1S9GA 4CFDA 5AFUH 4WFNL 5HLFA 3H1VX 1K73O 2XY5A 4FWMA 2P9LB 4CHNA 1A5WA 1EWRA 2HHTA 3M8QA 3DXKB 4BR7A 2O8BB 1ZXOA 3O80A 1XC9A 3VN5A 1KCFA 4WCEL 4RG8A 4JEPA 3G71N 1TV6A 2I7NA 3P38A 1E3MA 1H1VA 3K5NA 1X9SA 1GLCG 3DOLA 2HBJA 1WBDA 3EZWA 4WF9L 2VG6A 3LPUA 4JK9A 4PKGA 4BE0A 4KH4A 4OLAA 1TGOA 4WE1A 1VSJA 3TI0A 3ZT0A 2AA4A 3E9OA 3TAGA 1GLAG 1JL1A 4J2EA 4LFBK 3THWB 4KAZA 2W6LA 4CJ7A 1Q86O 2DY4A 4CCHA 1K8AO 4DTOA 4B08A 1BISA 1NKBA 4FLWA 4K42A 2PBDA 2LSNA 4ILGB 2HMIA 4RW4A 3OYFA 3VEVA 1ASUA 4FJ9A 1IV0A 1QQMA 3AVMA 3QNOA 4CJ3A 1UWBA 3O6WA 4BRDA 4CEOA 1NK7A 1W97L 5DK5A 1RTIA 5CHIA 3ZEUB 4HUGA 3HP9A 1NK8A 3HPOA 4CGIA 2PYLA 2KZMA 4OPHA 1KSPA 2B5JA 1SZ2A 4I6MA 4JK8A 2A6AA 4CBWA 1VK0A 2HOEA 2P9PB 4MQ3A 3O3GA 3THXB 1S72N 4YOXA 3HO1A 2Q31A 4BR2A 1TYQB 2GV9A 1VQ6N 2PYJA 5AQXA 1QE1A 3SZ2A 3AV9A 4CJKA 3FFKB 1X3MA 2NNWA 4DTRA 4ELUA 4YHHK 4M3ZA 1Q7YO 3JXUA 5AQKA 3LDOA 3HOTA 4PKHA 3UKRB 2Y1IA 4FWKA 3W3DA 1IKWA 3P1GA 4C1NK 2BGGA 4DTSA 1VQ5N 4BWJA 5BR9A 1NLVA 1DTQA 1ZBFA 2P9UA 1C1BA 1JCEA 3V1RA 4I2QA 2A3ZA 2FSJA 2HBLA 5C10A 5FPEA 3OYAA 3ZSRA 4BE2A 3BEXA 3IDHA 3ZSQA 1M1KO 1TL3A 4E0DA 2HSTA 4Z4IA 2G8VA 3K59A 1RDDA 4E1NA 3SQ1A 2ZQBA 3N4QA 1K8KA 1J6ZA 4L3QA 4DSIA 3V6DA 2VWKA 3HI0A 1BI4A 2ZJPL 4DR6K 5KQ8A 2PAVA 4AHRA 2G8WA 4B9SA 2RF2A 3WXMB 3AA5X 2GX9A 1O13A 4YOTA 1JLEA 3VEYA 2V7ZA 4AHVA 4FOIA 5MLCQ 3SLCA 3HJFA 1N5YA 3O4WA 3VF2A 3WNHA 3V9SA 3ZT1A 3VETA 2P9KA 2YNFA 4FOEA 3LWMA 3TTCA 5KPZA 4B3TK 3RTVA 3TAPA 4JNEA 1WSJA 5BRDA 3VQPA 4AHTA 4K8ZA 2I5JA 3AA2A 3CMEN 4CHOA 3HT3A 4BRIA 2G8HA 4KHNA 4LF7K 1Q8IA 2NRVA 3JYTA 4Z0UA 1TKTA 4DR1K 5HRSA 2BH1A 4DHYA 2OZMA 4CF9A 4IOCL 3RRGA 3G4SN 3ZSOA 4JAXA 3R6MA 3U8XA 4KHQA 1IJJA 4KTZA 1HKBA 2UXBK 4OPJA 2B6AA 2NRXA 3L2QA 4DF8A 3KWGA 1YIJN 1T3VA 2KLAA 3HBTA 4FWOA 1RTJA 5HL7L 3VGKA 3D7EO 4CVNE 1T6CA 2JLEA 1QVGM 4LFCK 4W5OA 4F3OA 1T44A 3HPGA 3L6QA 5HRPA 4CZIA 3UB5A 4CJQA 1RT5A 3ZT2A 4O5BA 2ITMA 3KLHA 3NF8A 3QINA 1VSHA 3AAPA 2HHVA 1RDBA 2WTUA 4RCHA 4CJVA 3F5TA 3LDNA 4ICLA 1Q81O 4FJGA 2P5OA 4DTPA 1DGKN 4IFVA 3J80O 2UUBK 3ULEA 3OBWA 3PX0A 2F9WA 2P51A 1ZBLA 2CGLA 4GV9A 1YXQA 4KI4A 4CJLA 3MXJA 4H03B 3CETA 3VEOA 3QESA 3OYHA 1ESVA 4C8NA 1L3UA 3E9LA 1RCHA 1IO2A 3VQDA 1C0FA 4PUOA 4JI1K 3IUCA 3QFPA 4CZLA 3K5OA 3LP0A 4RW7A 3OYCA 2OPRA 4B1YB 4MFBA 3O9RA 2D4WA 5KPTA 4CGFA 3THYA 4XEIA 1TK0A 5M1QA 1VRUA 4CEAA 4DQRA 3C6HA 1HRHA 3ZSWA 4H8KA 1RT3A 2P9NA 4JHDA 1JXEA 4I6MB 2VWJA 3C94A 3L2RA 1TUUA 4F8RA 4WQ4C 5AQYA 3TANA 3LZJA 2Q36A 2GUPA 4YORA 4H0XB 4Z4GA 1N6QA 1VSEA 4EAHD 3DWLA 3HSTB 5AQNA 2YHYA 3NF6A 3T1YK 4W5QA 4PQUA 5EVZA 4CGGA 3PSFA 3UKUA 3ZYYX 1NK0A 3VA0A 5KGXA 4DWIA 4DV6K 5E41A 3TSQA 4H5RA 4DU4A 5I3UA 2IS3A 1QHTA 3O4NA 1J53A 1S22A 2F7TA 4H5TA 2PY5A 1NU0A 4A2BA 3NCIA 1MU2A 3WXIA 2IGIA 1LCUA 1KTQA 1CZBA 1MWMA 1TKXA 3VGMA 2HHWA 4XH4A 3HXMA 2P9UB 4DFJA 2GEMA 4BDZA 4PL8A 4X62K 3LANA 1QTMA 3ZETA 4FK2A 1X9JA 5GIPA 3O1BA 5AQLA 3L3UA 1BWFO 4BR4A 4C8OA 4M3UA 4B3SK 3LP1A 4CE9A 4DSLA 1U4BA 1QQOA 4C8KA 5LJVA 3C6AA 1XMOK 3U9DA 2ZE2A 3LWLA 1S1TA 4DTJA 1CXUA 1EP4A 1UAXA 4OLBA 3CJCA 4KHWA 1GLLO 1K8KB 1BUPA 4CEEA 1QSYA 1WNSA 4CGDA 1ILYA 1JLCA 5C12A 4A59A 1LWFA 4JKGA 1VQMN 2P5GA 3AY9A 5J2PA 1BI4B 5LJWA 3PSIA 2G8FA 4ELTA 4Q0BA 1BG3A 3CIPA 1S3XA 3CM6A 4GMJB 3QLHA 1N34K 4PHTX 5AQRA 4M3XA 1GLJO 1VRTA 5CY4A 3GBTA 4RW9A 3QFUA 4FSVA 3SJJA 3VF4A 2E2NA 4JRQA 5FLXO 1Q18A 4Y0WA 2IAJA 4A57A 3CCRN 4FM1A 1BIZA 3W0LA 4NXMK 5AQUA 3ZX0A 3VQ4A 5FPNA 2P9KB 4G9ZA 3ALYA 3IRXA 1ZBSA 4QS7A 1C0UA 3EL2A 3ID6A 2QK9A 1RTHA 2NRHA 1TKZA 3K57A 2YI1A 2GWJA 4NCBA 2ZD1A 4BRLA 4FPBA 4CJ5A 4FJXA 3HYFA 1HLUA 2O4IA 4CEQA 1FXXA 1CXQA 3AVFA 4BRGA 1YUWA 2OYQA 5FRMA 2RKIA 1HNWK 3HM8A 2NRRA 3O9QA 4CESA 2WUSA 3EEQA 4HVJA 4CEDA 1LAWA 3HP6A 1KC8O 4O5FA 2PFUA 3ENOA 3WXJA 3AVBA 4DLGA 1S1UA 4H5WA 3NGYA 4CFAA 4CHQA 3AO2A 4BVPA 4J2BA 4YOVA 3TPQA 3ZSYA 3KLFA 2O4GA 3OYEA 5J2MA 5K14A 5KPRA 2BDPA 5GINA 3SQ0A 2IVNA 3CF5L 2ASMA 4E1JA 4IBNA 3MMVA 3CC2N 4U7BA 1F21A 2VQFK 4LF8K 1VQKN 1IBLK 4B3MK 3K9KA 4BVOA 1NJWA 1I3AA 4DTMA 4CFCA 4E1MA 1E4FT 5AZIA 1KVAA 1SQKA 1SKSA 2KW4A 4OPKA 3ULEB 4RW8A 3K0SA 1RBTA 4DSKA 1VHXA 5ADXA 5J2QA 2VQEK 4NYNA 3GG4A 3CC4N 3CCVN 2DPNA 1X9MA 1KFDA 3EKUA 4JLHA 4GNIA 4DV1K 4CHZA 1GLBG 4JKAA 3VQEA 4CIEA 4FK4A 4NXNK 3WT0A 3L4QA 1NG9A 4BC5A 3K58A 1N33K 3LDQA 4CJUA 1JCFA 1BA0A 4CF8A 2IOCA 3AGKA 1OVQA 3HK2A 4AH9A 3ENBA 3AGRA 2J4RA 3CJBA 4DTUA 3PLAA 2YHWA 3THYB 1SV5A 3HPHA 1NWKA 2E6MA 2Q1NA 4K25A 3OS2A 4H4MA 2P9NB 4JHDB 3J7AP 3OYJA 1WUAA 4CHPA 1TAQA 4PA1A 1W0HA 3OYNA 1U48A 3C65A 4QS9A 4X65K 3O9SA 1W2BM 3DLBA 4B3OA 3R8EA 2YNHA 2FBXA 1A5XA 3G10A 3UKUB 4XH5A 3DM2A 1NKEA 3OYKA 3WUHA 4CK2A 3LDSA 3FZLA 3ITHA 3SBTA 4RTFD 1JL2A 1ZBUA 1EXQA 2KTQA 2P9IA 1VSLA 1TVRA 4CFBA 4DQ8A 1YAGA 2KFNA 3QB0A 1YJ9N 1GLDG 1U47A 4DV0K 1NMNA 2IDOA 2UXDK 4F2SA 4DG1A 3ZETB 1SL0A 2FLOA 3AVHA 4PL7A 3NGIA 2E6LA 3GE1A 1MDUB 1WSFA 3PO5A 2Z1IA 2KQ2A 1RBRA 4HUFA 3VF6A 5JVGL 2YCHA 4LF9K 4LSLA 1GOBA 4J2DA 5DM6L 1YTUA 3VQBA 3OS1A 2GUIA 3P83D 4FZXC 2D0CA 1QQCA 3A5LC 4DQSA 4B1VA 5KRTA 3VGLA 4FYDA
chains in the Genus database with same CATH topology
3TAQA 1TK8A 3HJFA 4PY5A 1Z25A 4E7KA 1N5YA 4FLZA 3WNHA 1RNHA 1S1XA 3V9SA 3V4IA 3K2PA 1C1AA 1BGXT 3ZT1A 3LZIA 4KHUA 1WAFA 2YNFA 4CJRA 2X6SA 1T8EA 2HHSA 3LWMA 1S6PA 4DF4A 3RTVA 3TAPA 4N47A 4CJ4A 1WSJA 3DRSA 3VQPA 5CYQA 4AHTA 4K8ZA 3QEXA 2I5JA 2QKKA 3AA2A 3RRHA 1O1WA 4CHOA 3SUQA 3HT3A 4OJRA 5HRRA 3SV3A 5C42A 2G8HA 2G8KA 4KHNA 3NGZA 3RR8A 1Q8IA 3IAYA 3RMAA 4CHYA 4KHSA 3JYTA 4W5RA 4Z0UA 1TKTA 4GVMA 4O4GA 3TAFA 5HRSA 1RILA 4FJ7A 2OZMA 4CJPA 4CF9A 4KO0A 4ZTFA 1T03A 1SL1A 3RRGA 4QCLA 3AO3A 4IG0A 1RT2A 3ZSOA 1S5JA 2BANA 4W5TA 4DTNA 1C1CA 1WAJA 1IKXA 4FLXA 4FJ5A 4M3YA 3V1OA 5D3GA 1BHLA 3KJVA 2IC3A 4KHQA 3HM9A 4KTZA 1REVA 4TSXA 1TKDA 4I9QA 3KKSA 3VQ5A 4OPJA 4FLTA 1J5OA 2B6AA 3L2QA 1ZBHA 4DF8A 2XO7A 3RR7A 3ZCMA 3LAMA 3DLHA 4XIUA 3OYMA 3NF9A 3C6TA 4OVLA 1RTJA 5C25A 3CFOA 5J2NA 3TR8A 4ID1A 1WSEA 1NK4A 1A5VA 4HHTA 3QETA 2JLEA 3RMBA 3M8PA 4W5OA 4BDYA 4F3OA 1TAUA 2D5RA 3G0ZA 2FC0A 3HPGA 3VQQA 4I9LA 3SPYA 1LV5A 3NDKA 4JS4A 4Z4EA 1LWEA 5HRPA 4N56A 3RMDA 4CJQA 3NE6A 4B9UA 3PV8A 1RT5A 1VSKA 3ZT2A 2Y1JA 3ZSXA 4CK3A 4M3TA 4FJHA 4O5BA 1XI1A 3KLHA 3NF8A 2BE2A 3QINA 1IKYA 4HCCA 1X9WA 1VSHA 2HHVA 3DI6A 1C6VA 1XWLA 1SKWA 1VSMA 1DLOA 1RDBA 4Y1DA 1K6YA 1C0MA 1S1VA 4CJFA 1Y97A 4CJVA 4DSJA 2AJQA 4DSFA 5J1EA 4F3TA 4ID5A 4ICLA 5SWMA 1BCOA 1C0TA 4FW1A 2P5OA 4DTPA 4FJGA 5FROA 4YNQA 3BGRA 4IFVA 3CM5A 4JS5A 1R0AA 4KB0A 3PX0A 5HBMA 1RDAA 3OY9A 2P51A 1ZBLA 1L3TA 5KGWA 1D8YA 3VQ9A 4KI4A 4CJLA 3KLEA 1Z26A 3MXJA 1UA1A 1XHZA 2OZSA 1U45A 3V9WA 4NCGA 3QESA 1VSFA 1BIUA 2E4LA 3WNGA 3U6FA 3OYHA 4C8NA 1L3UA 4F2RA 2D0AA 4RW6A 4Z4FA 1RCHA 1IO2A 1HNIA 3DYAA 3VQDA 1ZYQA 4CECA 2HNYA 3PY8A 4PUOA 3MXIA 1W9HA 4IG3A 3AA3A 3VA3A 3V1QA 3MEDA 3K5LA 4LH5A 3AVLA 1KLNA 3K5OA 3NH1A 3SCXA 3L3VA 3LP0A 4RW7A 3OYCA 3V9ZA 3HVTA 2OPRA 5CZ1A 4DTXA 3QEWA 5JS1A 1LWCA 4OGCA 1U49A 3AVKA 4KHYA 4C8LA 3KK2A 2HNZA 3L2WA 3KTQA 4MFBA 5KTQA 4FXDA 4H4OA 4CJWA 3KKRA 3F73A 4BE1A 3V9XA 4DQQA 4AHUA 1NJZA 2A1SA 4CGFA 3CQ8A 1T05A 3KD5E 3VQAA 2YKNA 3SUPA 1B9FA 4N41A 3JSMA 4F4KA 1TK0A 4CERA 1JLQA 5HROA 2HHUA 5FDLA 2YHAA 4DQPA 1VRUA 4QOZB 4CEAA 5DMRA 3LP3A 4DQRA 3ISNC 4FJMA 4DS5A 1HRHA 1WN7A 4Z4CA 4BWMA 3ZSWA 1RT3A 4H8KA 1DTTA 1JXEA 2GBZA 1FKOA 1BL3A 3B6PA 2VWJA 3C94A 3L2RA 1NOZA 3SV4A 4KI6A 1EETA 4FW2A 1Q9YA 4F8RA 3AVNA 2W42A 1T7PA 2X78A 3TANA 3LZJA 1IH7A 2P1JA 3DRPA 4Z4GA 1N6QA 1X1PA 3I8DA 1VSEA 2Z1HA 3QEPA 1JKHA 4G1QA 1HNVA 2VG5A 1L3SA 3SPZA 3HSTB 1LAVA 3NF6A 4W5QA 3ZSVA 4PQUA 4CGGA 3CFPA 1HQUA 3O3HA 1NK0A 3OS0A 3VA0A 4CF1A 2Q3SA 5KGXA 3S3MA 1B9DA 3E01A 4DWIA 5E41A 4M3WA 2G8UA 4B9VA 4DU4A 5I3UA 1WSHA 1QHTA 2IS3A 3O4NA 1J53A 1GOAA 3MXMA 4N5SA 2PY5A 4FK0A 3NCIA 3OYIA 1FK9A 1MU2A 4QAGA 2IGIA 1LW0A 3KIOA 1KTQA 3NAEA 1KLMA 4FLUA 3TWHA 1CZBA 2F96A 1TKXA 2F8TA 2HHWA 4OKEA 1QS4A 3ZT3A 3U3YA 3TARA 1BQMA 3AVIA 3HXMA 4E7HA 4YFUA 4DFJA 3SUNA 2ATQA 4BDZA 4FCYA 2HVHA 3CYMA 1NK6A 2OPPA 4L8RB 4M45A 3LANA 1UA0A 4FJJA 4O55A 3RMCA 3H08A 3ZT4A 1QTMA 2F8SA 1RTDA 1WSIA 4FK2A 4CEBA 1ZBIA 4M3UA 3L3UA 4C8OA 2Z1GA 3VQ7A 4KKOA 1VSIA 1YVUA 2OPSA 3LP1A 4PWDA 2ETJA 1HJRA 4CE9A 2OPQA 4CK1A 1U4BA 4DSLA 4FJNA 4M42A 5FRNA 2KZZA 1QSSA 4C8KA 3DMJA 2YNGA 2ZE2A 4FLVA 3L2UA 3LWLA 4FM2A 1D9FA 1TL1A 1S1TA 3K5MA 4DTJA 3C95A 1ASVA 1CXUA 1EP4A 1UAXA 4OLBA 3PX4A 4KHWA 3DLEA 4DQIA 3EY1A 3L8BA 4J2AA 4CEEA 1QSYA 3QEVA 4KB1A 1WNSA 4CGDA 3KK3A 4DFMA 4I2PA 3PO4A 1JLCA 1FKPA 3S9HA 1LWFA 3KLIA 2P5GA 3KD1E 5J2PA 3O3FA 3T19A 3I0RA 3SUOA 1NK5A 1BI4B 1RBSA 4B8CA 3F9KA 2G8FA 1CLQA 4LSNA 4JRPA 3T3FA 3TABA 3OYGA 1KRPA 4HUEA 2YHBA 5CZ2A 4ELTA 4Q0BA 4AILC 3CM6A 3AO4A 3QLHA 4GMJB 4CJSA 2JGUA 3SI6A 2OA8A 2WONA 3TAMA 3EZ5A 3DLGA 3MAQA 4R5PA 3ULDA 2XY7A 4M3XA 2EX3A 1WLJA 2DFFA 4OKKA 1VRTA 3FFIA 5CY4A 4RW9A 4E7LA 4KPYA 3WNEA 4IDKA 4FJLA 3I0SA 4KRFA 3AA4A 3T1AA 3SJJA 2RN2A 2D0BA 4DFPA 4K8XA 3NBPA 1S9EA 3DLRA 4CGHA 2XRIA 4NCAA 3WNFA 4ELVA 4Y1CA 4E19A 2FBTA 4JRQA 2YNIA 4FJKA 5CYMA 2IAJA 3QIPA 3NHGA 3CFRA 1SUQA 3MEEA 1BIZA 4O0JA 1HYVA 4KFBA 4ZHRA 4O0IA 4FM1A 3VQ4A 3V9UA 4LH4A 2PZSA 3U3GA 1HYZA 2Z1JA 3QEIA 1D9DA 3ALYA 1RBVA 1S9GA 2VG7A 5EU7A 3IRXA 4CFDA 4IFYA 3QERA 3THVA 1C0UA 3DOKA 4HTUA 1J54A 1GOCA 5HLFA 4FJ8A 2X74A 1L3VA 1SKRA 2QK9A 1RTHA 2XY5A 1B92A 5I42A 1TKZA 4M3RA 3K57A 4IKFA 4CHNA 4NCBA 1A5WA 2ZD1A 4DMNA 2HNDA 4Q5VA 2HVIA 4FJXA 4CJ5A 2R7YA 1IG9A 3HYFA 2HHTA 2O4IA 4CEQA 3M8QA 3MEGA 1FXXA 3OVNA 4DFKA 1XC9A 5SZTA 4FVMA 3VQ6A 3O4QA 1CXQA 5KI6A 3VN5A 1KCFA 3AVFA 3TAEA 1NJYA 1S6QA 2OYQA 4RG8A 4BACA 5FRMA 2HW3A 2RKIA 1TV6A 2XHBA 4CESA 4HVJA 1CZ9A 4CEDA 1LAWA 2EHGA 3HP6A 3LAKA 2FBYA 3VQ8A 1XHXA 5JS2A 1JLAA 3K5NA 1X9SA 3AVBA 4DLGA 1S1UA 4C8MA 3NGYA 3DOLA 4CFAA 4CHQA 4EP5A 4LY7A 4KTQA 2YV0X 3AO2A 3CG7A 4J2BA 2VG6A 3LPUA 4BE0A 3S3NA 1SL2A 3ZSYA 4E3SA 3BDPA 1TGOA 4WE1A 4OLAA 1VSJA 3KLFA 3TI0A 3ZT0A 2DFEA 2O4GA 3TAGA 3P5JA 1JL1A 3OYEA 5J2MA 5K14A 4CEFA 4J2EA 3PX6A 2BDPA 4M41A 4KAZA 3SQ0A 4B9MA 1NJXA 2DY4A 4CCHA 1KVCA 4KV8A 4DS4A 4CIFA 4DTOA 4IBNA 2DTUA 4B08A 3KLGA 1BISA 1NKBA 4FLWA 4CEZA 3AVJA 2LSNA 1F21A 1RDCA 3AO1A 2HMIA 4RW4A 3OYFA 1L5UA 4CJEA 1WSGA 1NJWA 1I3AA 4UQGA 2QXFA 4DTMA 4CFCA 4E1MA 1ASUA 4CJTA 3M8SA 1U04A 3D0PA 1KVAA 1SKSA 4FJ9A 2KW4A 1RT6A 1UOCA 4OPKA 4RW8A 3AVMA 1RBTA 4KTWA 1ASWA 3HVRA 3QNOA 5J2QA 1HPZA 3QNNA 3NH2A 3OJUA 4CJ3A 4NYNA 1UWBA 2HHQA 1TK5A 1NK7A 1S1WA 4CEOA 1HYSA 5DK5A 1RTIA 3SNNA 1X9MA 1BCMA 1KFDA 4HUGA 3HP9A 1NOYA 4B9TA 4FLYA 1NK8A 4JLHA 3HPOA 1LW2A 4CHZA 4CGIA 2PYLA 2KZMA 1G15A 3A2FA 3VQEA 4CIEA 1KSPA 2B5JA 4CF0A 2NUBA 4EP4A 4FK4A 3LALA 3NH0A 3AVAA 3NF7A 3OJSA 3OYLA 3K58A 3UIQA 1VK0A 4MQ3A 4FZYA 1JXBA 3O3GA 4DU1A 4CJUA 4NYFA 3HO1A 4CF8A 2RPIA 3S3OA 4HCBA 2YKMA 2GV9A 2IOCA 4KREA 4OKJA 4AH9A 3HK2A 4AHSA 1NKCA 1KVBA 2PYJA 4DTUA 3QIOA 3B6OA 4CIGA 4O44A 1SV5A 4N76A 1QE1A 4ZTJA 3HPHA 3LP2A 3AO5A 1VSDA 1QSLA 3SZ2A 3AV9A 4CJKA 4FM0A 1JLGA 2E6MA 4DTRA 4ELUA 4M3ZA 2XY6A 3OS2A 3SYZA 2X6NA 3VQCA 1NK9A 4E89A 2G8IA 4H4MA 2Y1IA 4BDPA 3OYJA 1IKWA 1RT7A 3P1GA 4CHPA 3NFAA 3DLKA 3M8RA 2QKBA 1TAQA 4PA1A 5HRNA 2BGGA 2HHXA 4LD0A 4DTSA 3C6UA 3AVCA 1W0HA 3IS9A 4BWJA 3OYNA 1IKVA 1U48A 1DTQA 1ZBFA 2XY8A 4DSKA 5KRSA 4FJIA 5C24A 3ZSZA 4B9NA 3L2VA 1JLFA 1HQEA 3RWUA 1C1BA 4CGJA 3ASMA 3DLBA 4W5NA 3LPTA 3V1RA 3HL8A 3EYZA 4FZZA 4B3OA 3DRRA 4I2QA 2YNHA 2FBXA 1A5XA 3G10A 3OYAA 2DFHA 3DM2A 3ZSRA 3KK1A 1NKEA 3QO9A 3OYKA 4CK2A 3LDSA 4BE2A 3AVGA 3ITHA 3ZSQA 3PUFA 1EX4A 1EKEA 1JL2A 1TL3A 1I39A 4E0DA 1ZBUA 2G8VA 4Z4IA 1EXQA 1YT3A 4GW6A 3K59A 4E7IA 4DSEA 3SQ4A 2KTQA 1RDDA 4E1NA 1JLBA 1VSLA 3SQ1A 1TVRA 2ZQBA 1BQNA 4CFBA 4E7JA 2A1RA 4EZ9A 4DSIA 2KFNA 2KFZA 1HMVA 3V6DA 5HP1A 2VWKA 1RBUA 1D5AA 3OYDA 1U47A 2B4JA 2HB5A 2WOMA 2IDOA 4EZ6A 1BI4A 4AHCA 3MECA 4F2SA 5T7BA 2FBVA 4DG1A 1SL0A 1ITGA 2G8WA 4AHRA 4B9SA 3AVHA 1RT1A 2RF2A 2E6LA 3NGIA 4B9LA 1WSFA 3V81A 1KFSA 3PO5A 1J9AA 2Z1IA 2KQ2A 3AA5X 1RBRA 1YTAA 2ITGA 3D45A 3OYBA 4HUFA 4DLEA 4OGEA 4B8AB 4LSLA 1GOBA 4J2DA 1JLEA 1YTUA 4CF2A 3VQBA 3SQ2A 1Q9XA 3OS1A 2GUIA 3P83D 4FZXC 4I7FA 4Z4HA 3IG1A 2D0CA 1QQCA 1RT4A 4DQSA 5KRTA 4DU3A 4AHVA 4FYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAQ A;  1TK8 A;  3HJF A;  4PY5 A;  1Z25 A;  4E7K A;  1N5Y A;  4FLZ A;  3WNH A;  1RNH A;  1S1X A;  3V9S A;  3V4I A;  3K2P A;  1C1A A;  1BGX T;  3ZT1 A;  3LZI A;  4KHU A;  1WAF A;  2YNF A;  4CJR A;  2X6S A;  1T8E A;  2HHS A;  3LWM A;  1S6P A;  4DF4 A;  3RTV A;  3TAP A;  4N47 A;  4CJ4 A;  1WSJ A;  3DRS A;  3VQP A;  5CYQ A;  4AHT A;  4K8Z A;  3QEX A;  2I5J A;  2QKK A;  3AA2 A;  3RRH A;  1O1W A;  4CHO A;  3SUQ A;  3HT3 A;  4OJR A;  5HRR A;  3SV3 A;  5C42 A;  2G8H A;  2G8K A;  4KHN A;  3NGZ A;  3RR8 A;  1Q8I A;  3IAY A;  3RMA A;  4CHY A;  4KHS A;  3JYT A;  4W5R A;  4Z0U A;  1TKT A;  4GVM A;  4O4G A;  3TAF A;  5HRS A;  1RIL A;  4FJ7 A;  2OZM A;  4CJP A;  4CF9 A;  4KO0 A;  4ZTF A;  1T03 A;  1SL1 A;  3RRG A;  4QCL A;  3AO3 A;  4IG0 A;  1RT2 A;  3ZSO A;  1S5J A;  2BAN A;  4W5T A;  4DTN A;  1C1C A;  1WAJ A;  1IKX A;  4FLX A;  4FJ5 A;  4M3Y A;  3V1O A;  5D3G A;  1BHL A;  3KJV A;  2IC3 A;  4KHQ A;  3HM9 A;  4KTZ A;  1REV A;  4TSX A;  1TKD A;  4I9Q A;  3KKS A;  3VQ5 A;  4OPJ A;  4FLT A;  1J5O A;  2B6A A;  3L2Q A;  1ZBH A;  4DF8 A;  2XO7 A;  3RR7 A;  3ZCM A;  3LAM A;  3DLH A;  4XIU A;  3OYM A;  3NF9 A;  3C6T A;  4OVL A;  1RTJ A;  5C25 A;  3CFO A;  5J2N A;  3TR8 A;  4ID1 A;  1WSE A;  1NK4 A;  1A5V A;  4HHT A;  3QET A;  2JLE A;  3RMB A;  3M8P A;  4W5O A;  4BDY A;  4F3O A;  1TAU A;  2D5R A;  3G0Z A;  2FC0 A;  3HPG A;  3VQQ A;  4I9L A;  3SPY A;  1LV5 A;  3NDK A;  4JS4 A;  4Z4E A;  1LWE A;  5HRP A;  4N56 A;  3RMD A;  4CJQ A;  3NE6 A;  4B9U A;  3PV8 A;  1RT5 A;  1VSK A;  3ZT2 A;  2Y1J A;  3ZSX A;  4CK3 A;  4M3T A;  4FJH A;  4O5B A;  1XI1 A;  3KLH A;  3NF8 A;  2BE2 A;  3QIN A;  1IKY A;  4HCC A;  1X9W A;  1VSH A;  2HHV A;  3DI6 A;  1C6V A;  1XWL A;  1SKW A;  1VSM A;  1DLO A;  1RDB A;  4Y1D A;  1K6Y A;  1C0M A;  1S1V A;  4CJF A;  1Y97 A;  4CJV A;  4DSJ A;  2AJQ A;  4DSF A;  5J1E A;  4F3T A;  4ID5 A;  4ICL A;  5SWM A;  1BCO A;  1C0T A;  4FW1 A;  2P5O A;  4DTP A;  4FJG A;  5FRO A;  4YNQ A;  3BGR A;  4IFV A;  3CM5 A;  4JS5 A;  1R0A A;  4KB0 A;  3PX0 A;  5HBM A;  1RDA A;  3OY9 A;  2P51 A;  1ZBL A;  1L3T A;  5KGW A;  1D8Y A;  3VQ9 A;  4KI4 A;  4CJL A;  3KLE A;  1Z26 A;  3MXJ A;  1UA1 A;  1XHZ A;  2OZS A;  1U45 A;  3V9W A;  4NCG A;  3QES A;  1VSF A;  1BIU A;  2E4L A;  3WNG A;  3U6F A;  3OYH A;  4C8N A;  1L3U A;  4F2R A;  2D0A A;  4RW6 A;  4Z4F A;  1RCH A;  1IO2 A;  1HNI A;  3DYA A;  3VQD A;  1ZYQ A;  4CEC A;  2HNY A;  3PY8 A;  4PUO A;  3MXI A;  1W9H A;  4IG3 A;  3AA3 A;  3VA3 A;  3V1Q A;  3MED A;  3K5L A;  4LH5 A;  3AVL A;  1KLN A;  3K5O A;  3NH1 A;  3SCX A;  3L3V A;  3LP0 A;  4RW7 A;  3OYC A;  3V9Z A;  3HVT A;  2OPR A;  5CZ1 A;  4DTX A;  3QEW A;  5JS1 A;  1LWC A;  4OGC A;  1U49 A;  3AVK A;  4KHY A;  4C8L A;  3KK2 A;  2HNZ A;  3L2W A;  3KTQ A;  4MFB A;  5KTQ A;  4FXD A;  4H4O A;  4CJW A;  3KKR A;  3F73 A;  4BE1 A;  3V9X A;  4DQQ A;  4AHU A;  1NJZ A;  2A1S A;  4CGF A;  3CQ8 A;  1T05 A;  3KD5 E;  3VQA A;  2YKN A;  3SUP A;  1B9F A;  4N41 A;  3JSM A;  4F4K A;  1TK0 A;  4CER A;  1JLQ A;  5HRO A;  2HHU A;  5FDL A;  2YHA A;  4DQP A;  1VRU A;  4QOZ B;  4CEA A;  5DMR A;  3LP3 A;  4DQR A;  3ISN C;  4FJM A;  4DS5 A;  1HRH A;  1WN7 A;  4Z4C A;  4BWM A;  3ZSW A;  1RT3 A;  4H8K A;  1DTT A;  1JXE A;  2GBZ A;  1FKO A;  1BL3 A;  3B6P A;  2VWJ A;  3C94 A;  3L2R A;  1NOZ A;  3SV4 A;  4KI6 A;  1EET A;  4FW2 A;  1Q9Y A;  4F8R A;  3AVN A;  2W42 A;  1T7P A;  2X78 A;  3TAN A;  3LZJ A;  1IH7 A;  2P1J A;  3DRP A;  4Z4G A;  1N6Q A;  1X1P A;  3I8D A;  1VSE A;  2Z1H A;  3QEP A;  1JKH A;  4G1Q A;  1HNV A;  2VG5 A;  1L3S A;  3SPZ A;  3HST B;  1LAV A;  3NF6 A;  4W5Q A;  3ZSV A;  4PQU A;  4CGG A;  3CFP A;  1HQU A;  3O3H A;  1NK0 A;  3OS0 A;  3VA0 A;  4CF1 A;  2Q3S A;  5KGX A;  3S3M A;  1B9D A;  3E01 A;  4DWI A;  5E41 A;  4M3W A;  2G8U A;  4B9V A;  4DU4 A;  5I3U A;  1WSH A;  1QHT A;  2IS3 A;  3O4N A;  1J53 A;  1GOA A;  3MXM A;  4N5S A;  2PY5 A;  4FK0 A;  3NCI A;  3OYI A;  1FK9 A;  1MU2 A;  4QAG A;  2IGI A;  1LW0 A;  3KIO A;  1KTQ A;  3NAE A;  1KLM A;  4FLU A;  3TWH A;  1CZB A;  2F96 A;  1TKX A;  2F8T A;  2HHW A;  4OKE A;  1QS4 A;  3ZT3 A;  3U3Y A;  3TAR A;  1BQM A;  3AVI A;  3HXM A;  4E7H A;  4YFU A;  4DFJ A;  3SUN A;  2ATQ A;  4BDZ A;  4FCY A;  2HVH A;  3CYM A;  1NK6 A;  2OPP A;  4L8R B;  4M45 A;  3LAN A;  1UA0 A;  4FJJ A;  4O55 A;  3RMC A;  3H08 A;  3ZT4 A;  1QTM A;  2F8S A;  1RTD A;  1WSI A;  4FK2 A;  4CEB A;  1ZBI A;  4M3U A;  3L3U A;  4C8O A;  2Z1G A;  3VQ7 A;  4KKO A;  1VSI A;  1YVU A;  2OPS A;  3LP1 A;  4PWD A;  2ETJ A;  1HJR A;  4CE9 A;  2OPQ A;  4CK1 A;  1U4B A;  4DSL A;  4FJN A;  4M42 A;  5FRN A;  2KZZ A;  1QSS A;  4C8K A;  3DMJ A;  2YNG A;  2ZE2 A;  4FLV A;  3L2U A;  3LWL A;  4FM2 A;  1D9F A;  1TL1 A;  1S1T A;  3K5M A;  4DTJ A;  3C95 A;  1ASV A;  1CXU A;  1EP4 A;  1UAX A;  4OLB A;  3PX4 A;  4KHW A;  3DLE A;  4DQI A;  3EY1 A;  3L8B A;  4J2A A;  4CEE A;  1QSY A;  3QEV A;  4KB1 A;  1WNS A;  4CGD A;  3KK3 A;  4DFM A;  4I2P A;  3PO4 A;  1JLC A;  1FKP A;  3S9H A;  1LWF A;  3KLI A;  2P5G A;  3KD1 E;  5J2P A;  3O3F A;  3T19 A;  3I0R A;  3SUO A;  1NK5 A;  1BI4 B;  1RBS A;  4B8C A;  3F9K A;  2G8F A;  1CLQ A;  4LSN A;  4JRP A;  3T3F A;  3TAB A;  3OYG A;  1KRP A;  4HUE A;  2YHB A;  5CZ2 A;  4ELT A;  4Q0B A;  4AIL C;  3CM6 A;  3AO4 A;  3QLH A;  4GMJ B;  4CJS A;  2JGU A;  3SI6 A;  2OA8 A;  2WON A;  3TAM A;  3EZ5 A;  3DLG A;  3MAQ A;  4R5P A;  3ULD A;  2XY7 A;  4M3X A;  2EX3 A;  1WLJ A;  2DFF A;  4OKK A;  1VRT A;  3FFI A;  5CY4 A;  4RW9 A;  4E7L A;  4KPY A;  3WNE A;  4IDK A;  4FJL A;  3I0S A;  4KRF A;  3AA4 A;  3T1A A;  3SJJ A;  2RN2 A;  2D0B A;  4DFP A;  4K8X A;  3NBP A;  1S9E A;  3DLR A;  4CGH A;  2XRI A;  4NCA A;  3WNF A;  4ELV A;  4Y1C A;  4E19 A;  2FBT A;  4JRQ A;  2YNI A;  4FJK A;  5CYM A;  2IAJ A;  3QIP A;  3NHG A;  3CFR A;  1SUQ A;  3MEE A;  1BIZ A;  4O0J A;  1HYV A;  4KFB A;  4ZHR A;  4O0I A;  4FM1 A;  3VQ4 A;  3V9U A;  4LH4 A;  2PZS A;  3U3G A;  1HYZ A;  2Z1J A;  3QEI A;  1D9D A;  3ALY A;  1RBV A;  1S9G A;  2VG7 A;  5EU7 A;  3IRX A;  4CFD A;  4IFY A;  3QER A;  3THV A;  1C0U A;  3DOK A;  4HTU A;  1J54 A;  1GOC A;  5HLF A;  4FJ8 A;  2X74 A;  1L3V A;  1SKR A;  2QK9 A;  1RTH A;  2XY5 A;  1B92 A;  5I42 A;  1TKZ A;  4M3R A;  3K57 A;  4IKF A;  4CHN A;  4NCB A;  1A5W A;  2ZD1 A;  4DMN A;  2HND A;  4Q5V A;  2HVI A;  4FJX A;  4CJ5 A;  2R7Y A;  1IG9 A;  3HYF A;  2HHT A;  2O4I A;  4CEQ A;  3M8Q A;  3MEG A;  1FXX A;  3OVN A;  4DFK A;  1XC9 A;  5SZT A;  4FVM A;  3VQ6 A;  3O4Q A;  1CXQ A;  5KI6 A;  3VN5 A;  1KCF A;  3AVF A;  3TAE A;  1NJY A;  1S6Q A;  2OYQ A;  4RG8 A;  4BAC A;  5FRM A;  2HW3 A;  2RKI A;  1TV6 A;  2XHB A;  4CES A;  4HVJ A;  1CZ9 A;  4CED A;  1LAW A;  2EHG A;  3HP6 A;  3LAK A;  2FBY A;  3VQ8 A;  1XHX A;  5JS2 A;  1JLA A;  3K5N A;  1X9S A;  3AVB A;  4DLG A;  1S1U A;  4C8M A;  3NGY A;  3DOL A;  4CFA A;  4CHQ A;  4EP5 A;  4LY7 A;  4KTQ A;  2YV0 X;  3AO2 A;  3CG7 A;  4J2B A;  2VG6 A;  3LPU A;  4BE0 A;  3S3N A;  1SL2 A;  3ZSY A;  4E3S A;  3BDP A;  1TGO A;  4WE1 A;  4OLA A;  1VSJ A;  3KLF A;  3TI0 A;  3ZT0 A;  2DFE A;  2O4G A;  3TAG A;  3P5J A;  1JL1 A;  3OYE A;  5J2M A;  5K14 A;  4CEF A;  4J2E A;  3PX6 A;  2BDP A;  4M41 A;  4KAZ A;  3SQ0 A;  4B9M A;  1NJX A;  2DY4 A;  4CCH A;  1KVC A;  4KV8 A;  4DS4 A;  4CIF A;  4DTO A;  4IBN A;  2DTU A;  4B08 A;  3KLG A;  1BIS A;  1NKB A;  4FLW A;  4CEZ A;  3AVJ A;  2LSN A;  1F21 A;  1RDC A;  3AO1 A;  2HMI A;  4RW4 A;  3OYF A;  1L5U A;  4CJE A;  1WSG A;  1NJW A;  1I3A A;  4UQG A;  2QXF A;  4DTM A;  4CFC A;  4E1M A;  1ASU A;  4CJT A;  3M8S A;  1U04 A;  3D0P A;  1KVA A;  1SKS A;  4FJ9 A;  2KW4 A;  1RT6 A;  1UOC A;  4OPK A;  4RW8 A;  3AVM A;  1RBT A;  4KTW A;  1ASW A;  3HVR A;  3QNO A;  5J2Q A;  1HPZ A;  3QNN A;  3NH2 A;  3OJU A;  4CJ3 A;  4NYN A;  1UWB A;  2HHQ A;  1TK5 A;  1NK7 A;  1S1W A;  4CEO A;  1HYS A;  5DK5 A;  1RTI A;  3SNN A;  1X9M A;  1BCM A;  1KFD A;  4HUG A;  3HP9 A;  1NOY A;  4B9T A;  4FLY A;  1NK8 A;  4JLH A;  3HPO A;  1LW2 A;  4CHZ A;  4CGI A;  2PYL A;  2KZM A;  1G15 A;  3A2F A;  3VQE A;  4CIE A;  1KSP A;  2B5J A;  4CF0 A;  2NUB A;  4EP4 A;  4FK4 A;  3LAL A;  3NH0 A;  3AVA A;  3NF7 A;  3OJS A;  3OYL A;  3K58 A;  3UIQ A;  1VK0 A;  4MQ3 A;  4FZY A;  1JXB A;  3O3G A;  4DU1 A;  4CJU A;  4NYF A;  3HO1 A;  4CF8 A;  2RPI A;  3S3O A;  4HCB A;  2YKM A;  2GV9 A;  2IOC A;  4KRE A;  4OKJ A;  4AH9 A;  3HK2 A;  4AHS A;  1NKC A;  1KVB A;  2PYJ A;  4DTU A;  3QIO A;  3B6O A;  4CIG A;  4O44 A;  1SV5 A;  4N76 A;  1QE1 A;  4ZTJ A;  3HPH A;  3LP2 A;  3AO5 A;  1VSD A;  1QSL A;  3SZ2 A;  3AV9 A;  4CJK A;  4FM0 A;  1JLG A;  2E6M A;  4DTR A;  4ELU A;  4M3Z A;  2XY6 A;  3OS2 A;  3SYZ A;  2X6N A;  3VQC A;  1NK9 A;  4E89 A;  2G8I A;  4H4M A;  2Y1I A;  4BDP A;  3OYJ A;  1IKW A;  1RT7 A;  3P1G A;  4CHP A;  3NFA A;  3DLK A;  3M8R A;  2QKB A;  1TAQ A;  4PA1 A;  5HRN A;  2BGG A;  2HHX A;  4LD0 A;  4DTS A;  3C6U A;  3AVC A;  1W0H A;  3IS9 A;  4BWJ A;  3OYN A;  1IKV A;  1U48 A;  1DTQ A;  1ZBF A;  2XY8 A;  4DSK A;  5KRS A;  4FJI A;  5C24 A;  3ZSZ A;  4B9N A;  3L2V A;  1JLF A;  1HQE A;  3RWU A;  1C1B A;  4CGJ A;  3ASM A;  3DLB A;  4W5N A;  3LPT A;  3V1R A;  3HL8 A;  3EYZ A;  4FZZ A;  4B3O A;  3DRR A;  4I2Q A;  2YNH A;  2FBX A;  1A5X A;  3G10 A;  3OYA A;  2DFH A;  3DM2 A;  3ZSR A;  3KK1 A;  1NKE A;  3QO9 A;  3OYK A;  4CK2 A;  3LDS A;  4BE2 A;  3AVG A;  3ITH A;  3ZSQ A;  3PUF A;  1EX4 A;  1EKE A;  1JL2 A;  1TL3 A;  1I39 A;  4E0D A;  1ZBU A;  2G8V A;  4Z4I A;  1EXQ A;  1YT3 A;  4GW6 A;  3K59 A;  4E7I A;  4DSE A;  3SQ4 A;  2KTQ A;  1RDD A;  4E1N A;  1JLB A;  1VSL A;  3SQ1 A;  1TVR A;  2ZQB A;  1BQN A;  4CFB A;  4E7J A;  2A1R A;  4EZ9 A;  4DSI A;  2KFN A;  2KFZ A;  1HMV A;  3V6D A;  5HP1 A;  2VWK A;  1RBU A;  1D5A A;  3OYD A;  1U47 A;  2B4J A;  2HB5 A;  2WOM A;  2IDO A;  4EZ6 A;  1BI4 A;  4AHC A;  3MEC A;  4F2S A;  5T7B A;  2FBV A;  4DG1 A;  1SL0 A;  1ITG A;  2G8W A;  4AHR A;  4B9S A;  3AVH A;  1RT1 A;  2RF2 A;  2E6L A;  3NGI A;  4B9L A;  1WSF A;  3V81 A;  1KFS A;  3PO5 A;  1J9A A;  2Z1I A;  2KQ2 A;  3AA5 X;  1RBR A;  1YTA A;  2ITG A;  3D45 A;  3OYB A;  4HUF A;  4DLE A;  4OGE A;  4B8A B;  4LSL A;  1GOB A;  4J2D A;  1JLE A;  1YTU A;  4CF2 A;  3VQB A;  3SQ2 A;  1Q9X A;  3OS1 A;  2GUI A;  3P83 D;  4FZX C;  4I7F A;  4Z4H A;  3IG1 A;  2D0C A;  1QQC A;  1RT4 A;  4DQS A;  5KRT A;  4DU3 A;  4AHV A;  4FYD A; 
#chains in the Genus database with same CATH topology
 3TSU A;  4BC3 A;  4JKG B;  4FLZ A;  1RNH A;  2E20 A;  5BRF A;  3V4I A;  1C1A A;  4KHU A;  3LZI A;  1WAF A;  4DF4 A;  1VQ7 N;  4N47 A;  4CJ4 A;  2NZT A;  3DRS A;  2A40 A;  2A42 A;  2QKK A;  3J81 O;  2ASP A;  3SUQ A;  2UUC K;  4IOX A;  4R79 A;  5JVH L;  2G8K A;  1Q82 O;  4W5R A;  4GVM A;  4O4G A;  3TAF A;  4J8F A;  4FJ7 A;  4IXC A;  4KO0 A;  3CJA A;  4IG0 A;  1RT2 A;  4W5T A;  2BAN A;  4BC2 A;  3V1O A;  5D3G A;  1BHL A;  3KJV A;  3CJ1 A;  2IC3 A;  3BF3 A;  3VQ5 A;  3P39 A;  1Z6R A;  3DJC A;  3RR7 A;  4XIU A;  2Q2R A;  4OVL A;  2I7P A;  1NK4 A;  1V4S A;  4HHT A;  3M8P A;  3MDQ A;  3J8A A;  2D5R A;  1WB9 A;  4JI0 K;  5ADX H;  4BY9 C;  3NDK A;  4JS4 A;  3B8A X;  3PV8 A;  1VSK A;  4CBU A;  3IKM A;  4FJH A;  4BRK A;  1XMQ K;  1XI1 A;  2W6K A;  2BE2 A;  1IKY A;  1X9W A;  4X64 K;  3TU5 A;  4CJF A;  1K6Y A;  1QVF M;  1S1V A;  3TTF A;  4DSF A;  2D0O A;  1XQS C;  2FF3 B;  4FW1 A;  1C0T A;  3PIP L;  5FRO A;  1R0A A;  3OY9 A;  5KGW A;  4IDH A;  3KK7 A;  3KLE A;  1UA1 A;  2OZS A;  1U45 A;  2E4L A;  3U6F A;  3T7Z A;  1V4T A;  4RW6 A;  3M6G A;  2V52 B;  3PY8 A;  3MXI A;  4IG3 A;  4GV3 A;  4IO8 A;  4LH5 A;  1YI2 N;  1HX1 A;  5CZ1 A;  4ISG A;  4KHY A;  5AZI B;  3L2W A;  5KTQ A;  4FXD A;  3H1Q A;  3EKS A;  4JKF A;  3KKR A;  4BE1 A;  4DQQ A;  3V9X A;  5AQP A;  1NJZ A;  2W40 A;  3CQ8 A;  3KD5 E;  3SUP A;  2BTF A;  4N41 A;  4F4K A;  2FF6 A;  4CER A;  2HHU A;  2YHA A;  3E9P A;  4DQP A;  4QOZ B;  4KBO A;  4BWM A;  3TSP A;  3FZK A;  1DTT A;  1N8R O;  1FKO A;  4AM6 A;  4KI6 A;  3SV4 A;  2QWO A;  1Q9Y A;  2X78 A;  3I33 A;  3DRP A;  2P1J A;  5I9E B;  1BDG A;  2D0P A;  2Z1H A;  4MDA A;  1G99 A;  2VG5 A;  3SPZ A;  1C0G A;  4FPA A;  1LAV A;  3CHW A;  5CR4 A;  3O3H A;  3OS0 A;  2UU9 K;  2RHK A;  1B9D A;  4M3W A;  4B9V A;  3M5R A;  4KHP K;  1WSH A;  1WBB A;  4FVU A;  3MXM A;  4FK0 A;  2HF4 A;  1FK9 A;  4FWP A;  4QAG A;  4BRH A;  3NAE A;  2F96 A;  2F8T A;  3U3Y A;  3O9U A;  1T6D A;  3AVI A;  4E7H A;  5LMN K;  3CYM A;  1NK6 A;  2OPP A;  3OW2 M;  3ZT4 A;  1RTD A;  2GTD A;  4CEB A;  3SMS A;  3OA9 A;  4KKO A;  1HJR A;  2OPQ A;  4HWI A;  2QW9 A;  3P31 A;  4IWV A;  2KZZ A;  4FLV A;  4Z94 A;  3IMX A;  1D9F A;  2P9I B;  3C95 A;  3CCE N;  2O8D A;  3PX4 A;  3CQY A;  4J2A A;  4KB1 A;  3PO4 A;  4I2P A;  2CGK A;  3N4P A;  1ZC6 A;  3KLI A;  4YY3 K;  3KD1 E;  3I0R A;  3SUO A;  1RBS A;  4JI8 K;  4B8C A;  4BR0 A;  2QEX N;  4JRP A;  4AIL C;  3AO4 A;  4CJS A;  2OA8 A;  2WON A;  3DLG A;  3M3Z A;  4DV7 K;  3A8Y A;  2DFF A;  3FFI A;  4ISF A;  4BRQ A;  2QWP A;  4KPY A;  3T1A A;  2D0B A;  4DFP A;  1S9E A;  3WNF A;  4Y1C A;  4E19 A;  4IEI A;  3QIP A;  4H0V B;  1E4G T;  1NGA A;  1SUQ A;  4LF5 K;  2PZS A;  3U3G A;  1HYZ A;  3R9P A;  3O8M A;  5AQZ A;  5EU7 A;  4IFY A;  5A2Q O;  4DB3 A;  3H3O B;  4FJ8 A;  2X74 A;  2F4V K;  1L3V A;  4M3R A;  4Q5V A;  4DMN A;  2HND A;  2HVI A;  1IG9 A;  1Z05 A;  3MX5 A;  4LC9 B;  3MEG A;  5BRE A;  3OVN A;  2A41 A;  3Q7B A;  4B1Z A;  2QWL A;  4FVM A;  5KI6 A;  5IWA K;  2WC9 A;  1NJY A;  3A5O C;  4CZM A;  4BAC A;  4H0T B;  2XHB A;  3VEZ A;  2NRZ A;  2EHG A;  3U4L A;  3GL1 A;  3VQ8 A;  5JS2 A;  3A5N C;  3D6R A;  4C8M A;  4KTQ A;  3NVK A;  4EP5 A;  4LY7 A;  3VEW A;  2E1Y A;  4E3S A;  3BDP A;  5M1N A;  3H46 O;  1NGH A;  3PX6 A;  3I56 N;  1ATS A;  1BU6 O;  2WBN A;  4A2A A;  4A5A A;  1XNR K;  4KV8 A;  3VTI A;  4DS4 A;  1HR0 K;  4CEZ A;  1RDC A;  4YDU A;  3MWP A;  1BO5 O;  2VGN A;  1VAZ A;  1L5U A;  4CJE A;  1WSG A;  2QXF A;  3BY5 A;  3J7Z O;  4CJT A;  3M8S A;  2OTL N;  4BRO A;  4DV2 K;  1RT6 A;  1UOC A;  1VQ4 N;  1ASW A;  1HPZ A;  3NH2 A;  3RSE A;  4BR9 A;  3BZC A;  2HHQ A;  1S1W A;  1HYS A;  3SNN A;  3VOV A;  1BCM A;  1DEJ A;  3FGU A;  4B9T A;  4FLY A;  3OTO K;  4A61 A;  1G15 A;  3A2F A;  3R3L A;  1ATR A;  4JI5 K;  2NUB A;  2VYP A;  5EX5 A;  3LAL A;  3NH0 A;  3AAR A;  3OYL A;  4BC4 A;  3U9Z A;  3SAF A;  4JI3 K;  3S3O A;  1YVN A;  1JCG A;  4KRE A;  4DUY K;  3LM2 A;  1KD1 O;  4AHS A;  1NKC A;  2YJE A;  4CIG A;  4O44 A;  4CZF A;  3EN9 A;  3AO5 A;  3I55 N;  1VSD A;  4FM0 A;  1JLG A;  2GEL A;  5TKW A;  2X6N A;  1QZ6 A;  3VQC A;  4H0Y B;  1XUP O;  1VQP N;  4EHU A;  4BDP A;  4LF4 K;  3VER A;  4FWR A;  2OCE A;  1NM1 A;  3DLK A;  4OX9 K;  2QKB A;  4LD0 A;  4K43 A;  3C6U A;  1VQ8 N;  4DR5 K;  3D2E A;  3BZK A;  1M90 O;  5KRS A;  5C24 A;  4B9N A;  4IOA L;  3MCP A;  1WOQ A;  3Q7C A;  3L2V A;  1JLF A;  1HQE A;  4CZJ A;  3QBX A;  3ASM A;  3KHY A;  4OPA A;  4W5N A;  3EYZ A;  4FZZ A;  3DRR A;  4GKJ K;  2E1Z A;  2DFH A;  3KK1 A;  3QO9 A;  1P8Z A;  1GLF O;  3MN7 A;  1EKE A;  4B1X B;  1KAX A;  4GW6 A;  4JI2 K;  4E7I A;  1QHA A;  4JD2 A;  1RGI A;  1JLB A;  1FW6 A;  1BQN A;  2A1R A;  3MX2 A;  3CJ9 A;  1HMV A;  3MN9 A;  1EQY A;  2FSN A;  4EZ6 A;  3VMF B;  3QBW A;  4DR7 K;  1ITG A;  3ENH A;  1XNQ K;  2GWK A;  5F0X A;  1RT1 A;  4BRP A;  1QQN A;  4FO0 A;  1J9A A;  1HKG A;  1OH7 A;  1YTA A;  3OYB A;  4OGE A;  2ASO A;  4B8A B;  3O1W A;  5AR0 A;  4CF2 A;  1Q9X A;  1VQN N;  4YOY A;  2O8D B;  1HJO A;  4DV5 K;  4DU3 A;  1TK8 A;  4V19 S;  4E7K A;  3GDQ A;  3SAG A;  3VEN A;  1BGX T;  4DR4 K;  4JKD A;  4CJR A;  1RFQ A;  2X6S A;  1T8E A;  5BPN A;  1S6P A;  2VWB A;  3LDL A;  5AQV A;  5GAG P;  5CYQ A;  4DR3 K;  1K9M O;  4H5N A;  3SV3 A;  4OJR A;  1P90 A;  5HRR A;  5C42 A;  5FPD A;  5BRH A;  2ZGZ A;  1YJN N;  3NGZ A;  3RR8 A;  3IAY A;  4CHY A;  3F2K A;  4YOU A;  2VCP A;  2E2Q A;  4ZTF A;  2HMP A;  1T03 A;  4QCL A;  1SL1 A;  3T69 A;  4DTN A;  1C1C A;  1WAJ A;  2HBK A;  4FLX A;  4FJ5 A;  4M3Y A;  2WFB A;  4EFH A;  3HM9 A;  4H5V A;  3CPE A;  3KKS A;  1J5O A;  3C7N A;  2XO7 A;  3DLH A;  5C25 A;  5AQI A;  3CFO A;  1WSE A;  4AM7 A;  3QET A;  2D1K A;  4BDY A;  1TAU A;  2P9S A;  3JS6 A;  2FC0 A;  3SPY A;  1LV5 A;  5E26 A;  4Z4E A;  1LWE A;  3RMD A;  3P4I A;  3NE6 A;  4A5B A;  3ZSX A;  4CK3 A;  4M3T A;  3L4I A;  2CGJ A;  3FZF A;  3I8B A;  5GAD P;  3DI6 A;  1C6V A;  1XWL A;  1SKW A;  1VSM A;  1DT9 A;  3FZM A;  3OBY A;  1C0M A;  2AJQ A;  1Y97 A;  1D4X A;  5J1E A;  4F3T A;  4ID5 A;  3VPZ A;  3JAM O;  1BCO A;  4FZY A;  4YNQ A;  3CM5 A;  5AQS A;  3MK6 A;  1RDA A;  4NB4 A;  1L3T A;  2JWL A;  3VQ9 A;  1XHZ A;  4HTL A;  5C15 A;  4NCG A;  4QS8 A;  1VSF A;  1BIU A;  2QTD A;  4H0P A;  4F2R A;  4Z4F A;  3MN6 A;  4CZH A;  3DYA A;  5GIO A;  2W41 A;  3F9M A;  3LL3 A;  4CEC A;  3EE9 A;  2HNY A;  3SBG A;  3CXC M;  4MLH A;  3VA3 A;  3MED A;  3AVL A;  1KLN A;  5FPM A;  3NH1 A;  3L3V A;  2KHO A;  4DTX A;  3QEW A;  4C8L A;  4H4O A;  3F73 A;  5C2F A;  4AHU A;  3RSE B;  1ATN A;  5EY4 A;  2IIR A;  3JSM A;  1VQ9 N;  2AP1 A;  5HRO A;  3HOS A;  5LMU K;  1OKJ A;  4FJM A;  5DMR A;  3LP3 A;  3T1H K;  4DS5 A;  4GKK K;  1XC3 A;  2GBZ A;  2NRW A;  3HRG A;  4KH6 A;  3B6P A;  1SS6 A;  1T7P A;  2ZM6 K;  1X1P A;  3I8D A;  3QEP A;  3NMU A;  4MO5 A;  3CFP A;  1HNZ K;  1HQU A;  4CF1 A;  2Q3S A;  3S3M A;  3E01 A;  4JYA K;  2O8E A;  3FZH A;  2HF3 A;  3VEX A;  4BG8 A;  3KIO A;  1KLM A;  5AQH A;  1KAY A;  2V51 B;  4OKE A;  1QS4 A;  5EOY A;  5KQD A;  3D2E B;  2Q0U A;  4C1N I;  4UY8 O;  5JLH A;  3CQX A;  4FCY A;  2HVH A;  4L8R B;  4M45 A;  1UA0 A;  5BPL A;  3E1Y A;  4O55 A;  4FJJ A;  3H08 A;  2F8S A;  1WSI A;  3ZLJ A;  2Z1G A;  3VQ7 A;  5JIC A;  1VSI A;  5BPM A;  2OPS A;  1MWK A;  2ETJ A;  4CK1 A;  4FJN A;  5FRN A;  3DLL L;  4M42 A;  1QSS A;  2YNG A;  3L2U A;  3K5M A;  4JD2 B;  2OTJ N;  4JKB A;  3DLE A;  4JKH A;  3EY1 A;  4DQI A;  4BRN A;  4JI7 K;  3KK3 A;  4DFM A;  4GV6 A;  3S9H A;  2KKZ A;  3O3F A;  3L0Q A;  4WYB A;  3F9K A;  4B1W B;  4GY2 B;  4LSN A;  3T3F A;  4HUE A;  2YHB A;  5CZ2 A;  1X3N A;  5BN8 A;  3QDK A;  4DV4 K;  1HUX A;  3SI6 A;  2JGU A;  4EHT A;  3ULD A;  4R5P A;  1RDU A;  1WLJ A;  4OKK A;  5AQJ A;  4IDK A;  1N36 K;  2E5L K;  3AA4 A;  4NLC A;  2RN2 A;  4BRF A;  4K8X A;  3NBP A;  2XRI A;  4NCA A;  3EE8 A;  2FBT A;  1YIT N;  2YNI A;  4AF1 A;  4FJK A;  3KVG A;  3CFR A;  3CJ7 A;  4O0J A;  4O8K A;  4KFB A;  4ZHR A;  4O0I A;  1NGG A;  3LM9 A;  5CE3 A;  3V9U A;  1NMD A;  1BA1 A;  3QEI A;  1D9D A;  1HPM A;  1RBV A;  4ILH A;  2VG7 A;  4BQL A;  1FJG K;  2NLX A;  3QER A;  4CD1 A;  3THV A;  3DOK A;  4HTU A;  1J54 A;  1GOC A;  4BRA A;  2CH5 A;  2QWQ A;  2O8F A;  1SKR A;  4C23 A;  1B92 A;  5I42 A;  4IKF A;  2O8C A;  3H6E A;  5F1X A;  2R7Y A;  1U2V A;  1KAZ A;  5M1P A;  3TTD A;  3KZB A;  4DFK A;  3HTV A;  5SZT A;  3VQ6 A;  3O4Q A;  3R1X A;  3TAE A;  1S6Q A;  3SAH A;  2IVO A;  4MLE A;  3K9J A;  2HW3 A;  1CZ9 A;  3VTH A;  4BRE A;  1KQS M;  5LY3 A;  3LAK A;  2FBY A;  3SMP A;  1XHX A;  1JLA A;  3C7N B;  4JV5 K;  4NO7 A;  4B3R K;  5C0Y A;  3CI5 A;  2YV0 X;  3CG7 A;  3AAQ A;  4YOW A;  3S3N A;  1SL2 A;  3WQU A;  4ILJ A;  1LOT B;  2E8A A;  2DFE A;  1HKC A;  2P9S B;  2UYT A;  3P5J A;  2H3G X;  4CEF A;  3E66 A;  3WXL A;  5DM7 L;  4M41 A;  1YJW N;  4B9M A;  1NJX A;  3CCJ N;  1KVC A;  5AJ3 K;  4CIF A;  2DTU A;  3KLG A;  3HSC A;  3AVJ A;  3AO1 A;  4UQG A;  1TUY A;  4WQ4 A;  3CCS N;  1U04 A;  3D0P A;  1VQO N;  1YHQ N;  3IFR A;  5BR8 K;  4KTW A;  3HVR A;  3CD6 N;  3QNN A;  1IG8 A;  1JJ2 M;  3OJU A;  4JI4 K;  4U67 L;  1TK5 A;  4EIA A;  1J5E K;  2E88 A;  4BGA A;  3A0I X;  1NOY A;  4M63 C;  1LW2 A;  5AZJ A;  3WEE A;  5HOO A;  2Q0R A;  4CF0 A;  4EP4 A;  1OVY A;  4DR2 K;  3AVA A;  2QXL A;  3NF7 A;  3DXM A;  3OJS A;  3M1F A;  3UIQ A;  1EWQ A;  1JXB A;  1BOT O;  3D2F B;  4DU1 A;  4NYF A;  4BG9 A;  5ELZ A;  2RPI A;  1W7A A;  4HCB A;  3PIO L;  2YKM A;  1NGJ A;  2ZJR L;  4WQ5 A;  2V7Y A;  4OKJ A;  1KVB A;  3QIO A;  3B6O A;  4N76 A;  4ZTJ A;  1NGD A;  3LP2 A;  4K41 A;  4BRM A;  4LFA K;  1QSL A;  4XH1 A;  4AQY K;  1RDW X;  1NGC A;  2XY6 A;  3SYZ A;  3FE1 A;  4CZE A;  1NK9 A;  4E89 A;  2G8I A;  4MO4 A;  4B1U B;  3O9T A;  1RT7 A;  3NFA A;  3M8R A;  1HNX K;  5HRN A;  3AVC A;  3IS9 A;  1IKV A;  2XY8 A;  4FJI A;  3ZSZ A;  3ZX2 A;  5JMV A;  4CGJ A;  3RWU A;  2ZWH A;  3LPT A;  3HL8 A;  3ZX3 A;  4LF6 K;  3ATU A;  4JKE A;  4WFA L;  2O8E B;  1R59 O;  2NRT A;  3AVG A;  1GLE G;  3PUF A;  2UXC K;  1EX4 A;  1I39 A;  3HZ6 A;  1YT3 A;  4DSE A;  3SQ4 A;  4E7J A;  4EZ9 A;  2KFZ A;  3CCM N;  5HP1 A;  3CER A;  4B9Q A;  5TKY A;  1RBU A;  5LL6 Z;  1D5A A;  2E2O A;  2B4J A;  2HB5 A;  3QIC A;  3OYD A;  2ZJQ L;  2WOM A;  3SJH A;  2OAN A;  4AHC A;  3MWT A;  3MEC A;  3G25 A;  5T7B A;  2FBV A;  3DAW A;  2Q97 A;  4CBX A;  4BR5 A;  4JK7 A;  3NVM A;  3OHR A;  4B9L A;  3ATV A;  1N32 K;  5AQM A;  3V81 A;  1KFS A;  2ITG A;  3D45 A;  3FLC O;  4DLE A;  4FWS A;  4IEE A;  3SQ2 A;  4JKC A;  3H3N O;  4I7F A;  4Z4H A;  3IG1 A;  1RT4 A;  5H1S Q;  4DUZ K;  3TAQ A;  4PY5 A;  1Z25 A;  2ZGY A;  1S1X A;  3K2P A;  3WQT A;  2FXU A;  2HHS A;  5AQO A;  4CZK A;  3C0B A;  4DV3 K;  2EWS A;  3QEX A;  5JLF A;  3RRH A;  1O1W A;  2P9L A;  3S41 A;  2CH6 A;  3DXK A;  3LDP A;  3RMA A;  2O8B A;  4KHS A;  2QA4 N;  5C2D A;  2RE2 A;  1NGI A;  4M7X A;  1RIL A;  4OO1 J;  4CJP A;  3AO3 A;  3CCQ N;  1S5J A;  4WQ5 C;  1IKX A;  4IJN A;  1SAZ A;  1REV A;  4TSX A;  1TKD A;  4FL9 A;  4I9Q A;  4WFB L;  4FLT A;  1ZBH A;  3VES A;  3ZCM A;  3LAM A;  3OYM A;  3NF9 A;  3C6T A;  5J2N A;  2O8F B;  3TR8 A;  4ID1 A;  1A5V A;  4CD3 A;  3RMB A;  2O8C B;  4CZG A;  3G0Z A;  3VQQ A;  4I9L A;  1U2V B;  4N56 A;  3THW A;  4B9U A;  4RWT A;  2Y1J A;  1OH6 A;  2QWM A;  4HCC A;  3FR0 A;  4PKI A;  4DCH A;  5AFU A;  3BF1 A;  1DLO A;  4Y1D A;  4DSJ A;  5F2R A;  2VGM A;  5SWM A;  3O08 A;  4X66 K;  5GAE P;  3BGR A;  4JS5 A;  4KB0 A;  1IBK K;  5HBM A;  1NNE A;  1D8Y A;  2JWK A;  3MN5 A;  1Z26 A;  3V9W A;  3ZEU A;  3WNG A;  3EO3 A;  4KH5 A;  2D0A A;  1ZYQ A;  4O8U A;  1HNI A;  1YF5 L;  1W9H A;  5E84 A;  3AA3 A;  2YHX A;  3V1Q A;  4A62 A;  3K5L A;  2P9P A;  3THX A;  3SCX A;  3V9Z A;  3HVT A;  5JS1 A;  1LWC A;  4OGC A;  4DKW A;  4IO9 L;  1U49 A;  3AVK A;  3KK2 A;  2HNZ A;  1TYQ A;  3KTQ A;  4IZ9 A;  4CJW A;  3MCA B;  2HHH K;  1NGB A;  2A1S A;  5AQF A;  1T05 A;  3VQA A;  2YKN A;  1B9F A;  1JLQ A;  5FDL A;  5AZJ B;  3ISN C;  1WN7 A;  1KXP A;  3WEE B;  4Z4C A;  3UKR A;  5M1F A;  3ID8 A;  4YDU C;  1BL3 A;  3DXM B;  1NOZ A;  1EET A;  4FW2 A;  2BUP A;  3AVN A;  4MDB A;  2W42 A;  5EXW A;  5GAH P;  1IH7 A;  3UE5 A;  4CI6 A;  3GOI A;  4BGB A;  1JKH A;  4G1Q A;  2YJF A;  1HNV A;  4H0O A;  1EO1 A;  1L3S A;  3O5B A;  1IBM K;  3ZSV A;  1QZ5 A;  3KWI A;  4NLB A;  5IT9 O;  2QWN A;  4K0K K;  5M1O A;  2G8U A;  2IVP A;  1I94 K;  2A5X A;  5AQW A;  1GOA A;  3CC7 N;  3H45 C;  5AQG A;  4N5S A;  2UUA K;  3OYI A;  3G6E N;  1LW0 A;  1NGE A;  3CCL N;  4FLU A;  3TWH A;  3BUZ B;  1OH5 A;  3ZT3 A;  3TAR A;  3RVC A;  1BQM A;  3CMA N;  5AQQ A;  4YFU A;  4F9O A;  3SUN A;  3WXK A;  2ATQ A;  3J7Y P;  3RMC A;  4FWQ A;  1ZBI A;  2YX6 A;  1YVU A;  4CW7 B;  4PWD A;  2HHX A;  3QML A;  5AQT A;  5M1K A;  2QM1 A;  3DMJ A;  2QI2 A;  4FM2 A;  1TL1 A;  4BRC A;  1ASV A;  4M7Y A;  4BQZ A;  3CPW M;  3L8B A;  3QEV A;  4IFE A;  1FKP A;  2QWR A;  3T19 A;  1CZA N;  4FWL A;  2ZF5 O;  1NK5 A;  4JN4 A;  2F9T A;  3BP8 A;  3SK3 A;  1CLQ A;  3TAB A;  1KRP A;  3OYG A;  1NJI O;  1U6Z A;  4ISE A;  3TAM A;  3EZ5 A;  2XY7 A;  3MAQ A;  2EX3 A;  4E7L A;  3WNE A;  4FJL A;  3I0S A;  4KRF A;  2HBM A;  5BN9 A;  4IJA A;  3DLR A;  4CGH A;  4JI6 K;  1NBW A;  1Y64 A;  4ELV A;  2E2P A;  5B8H A;  1OH8 A;  1DKG D;  5CYM A;  3NHG A;  3MEE A;  1VQL N;  1HYV A;  1MA9 B;  2FSK A;  4LH4 A;  3A5M C;  3D2F A;  2Z1J A;  4FWN A;  1NGF A;  3CCU N;  4GVE A;  1S9G A;  4CFD A;  5AFU H;  4WFN L;  5HLF A;  3H1V X;  1K73 O;  2XY5 A;  4FWM A;  2P9L B;  4CHN A;  1A5W A;  1EWR A;  2HHT A;  3M8Q A;  3DXK B;  4BR7 A;  2O8B B;  1ZXO A;  3O80 A;  1XC9 A;  3VN5 A;  1KCF A;  4WCE L;  4RG8 A;  4JEP A;  3G71 N;  1TV6 A;  2I7N A;  3P38 A;  1E3M A;  1H1V A;  3K5N A;  1X9S A;  1GLC G;  3DOL A;  2HBJ A;  1WBD A;  3EZW A;  4WF9 L;  2VG6 A;  3LPU A;  4JK9 A;  4PKG A;  4BE0 A;  4KH4 A;  4OLA A;  1TGO A;  4WE1 A;  1VSJ A;  3TI0 A;  3ZT0 A;  2AA4 A;  3E9O A;  3TAG A;  1GLA G;  1JL1 A;  4J2E A;  4LFB K;  3THW B;  4KAZ A;  2W6L A;  4CJ7 A;  1Q86 O;  2DY4 A;  4CCH A;  1K8A O;  4DTO A;  4B08 A;  1BIS A;  1NKB A;  4FLW A;  4K42 A;  2PBD A;  2LSN A;  4ILG B;  2HMI A;  4RW4 A;  3OYF A;  3VEV A;  1ASU A;  4FJ9 A;  1IV0 A;  1QQM A;  3AVM A;  3QNO A;  4CJ3 A;  1UWB A;  3O6W A;  4BRD A;  4CEO A;  1NK7 A;  1W97 L;  5DK5 A;  1RTI A;  5CHI A;  3ZEU B;  4HUG A;  3HP9 A;  1NK8 A;  3HPO A;  4CGI A;  2PYL A;  2KZM A;  4OPH A;  1KSP A;  2B5J A;  1SZ2 A;  4I6M A;  4JK8 A;  2A6A A;  4CBW A;  1VK0 A;  2HOE A;  2P9P B;  4MQ3 A;  3O3G A;  3THX B;  1S72 N;  4YOX A;  3HO1 A;  2Q31 A;  4BR2 A;  1TYQ B;  2GV9 A;  1VQ6 N;  2PYJ A;  5AQX A;  1QE1 A;  3SZ2 A;  3AV9 A;  4CJK A;  3FFK B;  1X3M A;  2NNW A;  4DTR A;  4ELU A;  4YHH K;  4M3Z A;  1Q7Y O;  3JXU A;  5AQK A;  3LDO A;  3HOT A;  4PKH A;  3UKR B;  2Y1I A;  4FWK A;  3W3D A;  1IKW A;  3P1G A;  4C1N K;  2BGG A;  4DTS A;  1VQ5 N;  4BWJ A;  5BR9 A;  1NLV A;  1DTQ A;  1ZBF A;  2P9U A;  1C1B A;  1JCE A;  3V1R A;  4I2Q A;  2A3Z A;  2FSJ A;  2HBL A;  5C10 A;  5FPE A;  3OYA A;  3ZSR A;  4BE2 A;  3BEX A;  3IDH A;  3ZSQ A;  1M1K O;  1TL3 A;  4E0D A;  2HST A;  4Z4I A;  2G8V A;  3K59 A;  1RDD A;  4E1N A;  3SQ1 A;  2ZQB A;  3N4Q A;  1K8K A;  1J6Z A;  4L3Q A;  4DSI A;  3V6D A;  2VWK A;  3HI0 A;  1BI4 A;  2ZJP L;  4DR6 K;  5KQ8 A;  2PAV A;  4AHR A;  2G8W A;  4B9S A;  2RF2 A;  3WXM B;  3AA5 X;  2GX9 A;  1O13 A;  4YOT A;  1JLE A;  3VEY A;  2V7Z A;  4AHV A;  4FOI A;  5MLC Q;  3SLC A;  3HJF A;  1N5Y A;  3O4W A;  3VF2 A;  3WNH A;  3V9S A;  3ZT1 A;  3VET A;  2P9K A;  2YNF A;  4FOE A;  3LWM A;  3TTC A;  5KPZ A;  4B3T K;  3RTV A;  3TAP A;  4JNE A;  1WSJ A;  5BRD A;  3VQP A;  4AHT A;  4K8Z A;  2I5J A;  3AA2 A;  3CME N;  4CHO A;  3HT3 A;  4BRI A;  2G8H A;  4KHN A;  4LF7 K;  1Q8I A;  2NRV A;  3JYT A;  4Z0U A;  1TKT A;  4DR1 K;  5HRS A;  2BH1 A;  4DHY A;  2OZM A;  4CF9 A;  4IOC L;  3RRG A;  3G4S N;  3ZSO A;  4JAX A;  3R6M A;  3U8X A;  4KHQ A;  1IJJ A;  4KTZ A;  1HKB A;  2UXB K;  4OPJ A;  2B6A A;  2NRX A;  3L2Q A;  4DF8 A;  3KWG A;  1YIJ N;  1T3V A;  2KLA A;  3HBT A;  4FWO A;  1RTJ A;  5HL7 L;  3VGK A;  3D7E O;  4CVN E;  1T6C A;  2JLE A;  1QVG M;  4LFC K;  4W5O A;  4F3O A;  1T44 A;  3HPG A;  3L6Q A;  5HRP A;  4CZI A;  3UB5 A;  4CJQ A;  1RT5 A;  3ZT2 A;  4O5B A;  2ITM A;  3KLH A;  3NF8 A;  3QIN A;  1VSH A;  3AAP A;  2HHV A;  1RDB A;  2WTU A;  4RCH A;  4CJV A;  3F5T A;  3LDN A;  4ICL A;  1Q81 O;  4FJG A;  2P5O A;  4DTP A;  1DGK N;  4IFV A;  3J80 O;  2UUB K;  3ULE A;  3OBW A;  3PX0 A;  2F9W A;  2P51 A;  1ZBL A;  2CGL A;  4GV9 A;  1YXQ A;  4KI4 A;  4CJL A;  3MXJ A;  4H03 B;  3CET A;  3VEO A;  3QES A;  3OYH A;  1ESV A;  4C8N A;  1L3U A;  3E9L A;  1RCH A;  1IO2 A;  3VQD A;  1C0F A;  4PUO A;  4JI1 K;  3IUC A;  3QFP A;  4CZL A;  3K5O A;  3LP0 A;  4RW7 A;  3OYC A;  2OPR A;  4B1Y B;  4MFB A;  3O9R A;  2D4W A;  5KPT A;  4CGF A;  3THY A;  4XEI A;  1TK0 A;  5M1Q A;  1VRU A;  4CEA A;  4DQR A;  3C6H A;  1HRH A;  3ZSW A;  4H8K A;  1RT3 A;  2P9N A;  4JHD A;  1JXE A;  4I6M B;  2VWJ A;  3C94 A;  3L2R A;  1TUU A;  4F8R A;  4WQ4 C;  5AQY A;  3TAN A;  3LZJ A;  2Q36 A;  2GUP A;  4YOR A;  4H0X B;  4Z4G A;  1N6Q A;  1VSE A;  4EAH D;  3DWL A;  3HST B;  5AQN A;  2YHY A;  3NF6 A;  3T1Y K;  4W5Q A;  4PQU A;  5EVZ A;  4CGG A;  3PSF A;  3UKU A;  3ZYY X;  1NK0 A;  3VA0 A;  5KGX A;  4DWI A;  4DV6 K;  5E41 A;  3TSQ A;  4H5R A;  4DU4 A;  5I3U A;  2IS3 A;  1QHT A;  3O4N A;  1J53 A;  1S22 A;  2F7T A;  4H5T A;  2PY5 A;  1NU0 A;  4A2B A;  3NCI A;  1MU2 A;  3WXI A;  2IGI A;  1LCU A;  1KTQ A;  1CZB A;  1MWM A;  1TKX A;  3VGM A;  2HHW A;  4XH4 A;  3HXM A;  2P9U B;  4DFJ A;  2GEM A;  4BDZ A;  4PL8 A;  4X62 K;  3LAN A;  1QTM A;  3ZET A;  4FK2 A;  1X9J A;  5GIP A;  3O1B A;  5AQL A;  3L3U A;  1BWF O;  4BR4 A;  4C8O A;  4M3U A;  4B3S K;  3LP1 A;  4CE9 A;  4DSL A;  1U4B A;  1QQO A;  4C8K A;  5LJV A;  3C6A A;  1XMO K;  3U9D A;  2ZE2 A;  3LWL A;  1S1T A;  4DTJ A;  1CXU A;  1EP4 A;  1UAX A;  4OLB A;  3CJC A;  4KHW A;  1GLL O;  1K8K B;  1BUP A;  4CEE A;  1QSY A;  1WNS A;  4CGD A;  1ILY A;  1JLC A;  5C12 A;  4A59 A;  1LWF A;  4JKG A;  1VQM N;  2P5G A;  3AY9 A;  5J2P A;  1BI4 B;  5LJW A;  3PSI A;  2G8F A;  4ELT A;  4Q0B A;  1BG3 A;  3CIP A;  1S3X A;  3CM6 A;  4GMJ B;  3QLH A;  1N34 K;  4PHT X;  5AQR A;  4M3X A;  1GLJ O;  1VRT A;  5CY4 A;  3GBT A;  4RW9 A;  3QFU A;  4FSV A;  3SJJ A;  3VF4 A;  2E2N A;  4JRQ A;  5FLX O;  1Q18 A;  4Y0W A;  2IAJ A;  4A57 A;  3CCR N;  4FM1 A;  1BIZ A;  3W0L A;  4NXM K;  5AQU A;  3ZX0 A;  3VQ4 A;  5FPN A;  2P9K B;  4G9Z A;  3ALY A;  3IRX A;  1ZBS A;  4QS7 A;  1C0U A;  3EL2 A;  3ID6 A;  2QK9 A;  1RTH A;  2NRH A;  1TKZ A;  3K57 A;  2YI1 A;  2GWJ A;  4NCB A;  2ZD1 A;  4BRL A;  4FPB A;  4CJ5 A;  4FJX A;  3HYF A;  1HLU A;  2O4I A;  4CEQ A;  1FXX A;  1CXQ A;  3AVF A;  4BRG A;  1YUW A;  2OYQ A;  5FRM A;  2RKI A;  1HNW K;  3HM8 A;  2NRR A;  3O9Q A;  4CES A;  2WUS A;  3EEQ A;  4HVJ A;  4CED A;  1LAW A;  3HP6 A;  1KC8 O;  4O5F A;  2PFU A;  3ENO A;  3WXJ A;  3AVB A;  4DLG A;  1S1U A;  4H5W A;  3NGY A;  4CFA A;  4CHQ A;  3AO2 A;  4BVP A;  4J2B A;  4YOV A;  3TPQ A;  3ZSY A;  3KLF A;  2O4G A;  3OYE A;  5J2M A;  5K14 A;  5KPR A;  2BDP A;  5GIN A;  3SQ0 A;  2IVN A;  3CF5 L;  2ASM A;  4E1J A;  4IBN A;  3MMV A;  3CC2 N;  4U7B A;  1F21 A;  2VQF K;  4LF8 K;  1VQK N;  1IBL K;  4B3M K;  3K9K A;  4BVO A;  1NJW A;  1I3A A;  4DTM A;  4CFC A;  4E1M A;  1E4F T;  5AZI A;  1KVA A;  1SQK A;  1SKS A;  2KW4 A;  4OPK A;  3ULE B;  4RW8 A;  3K0S A;  1RBT A;  4DSK A;  1VHX A;  5ADX A;  5J2Q A;  2VQE K;  4NYN A;  3GG4 A;  3CC4 N;  3CCV N;  2DPN A;  1X9M A;  1KFD A;  3EKU A;  4JLH A;  4GNI A;  4DV1 K;  4CHZ A;  1GLB G;  4JKA A;  3VQE A;  4CIE A;  4FK4 A;  4NXN K;  3WT0 A;  3L4Q A;  1NG9 A;  4BC5 A;  3K58 A;  1N33 K;  3LDQ A;  4CJU A;  1JCF A;  1BA0 A;  4CF8 A;  2IOC A;  3AGK A;  1OVQ A;  3HK2 A;  4AH9 A;  3ENB A;  3AGR A;  2J4R A;  3CJB A;  4DTU A;  3PLA A;  2YHW A;  3THY B;  1SV5 A;  3HPH A;  1NWK A;  2E6M A;  2Q1N A;  4K25 A;  3OS2 A;  4H4M A;  2P9N B;  4JHD B;  3J7A P;  3OYJ A;  1WUA A;  4CHP A;  1TAQ A;  4PA1 A;  1W0H A;  3OYN A;  1U48 A;  3C65 A;  4QS9 A;  4X65 K;  3O9S A;  1W2B M;  3DLB A;  4B3O A;  3R8E A;  2YNH A;  2FBX A;  1A5X A;  3G10 A;  3UKU B;  4XH5 A;  3DM2 A;  1NKE A;  3OYK A;  3WUH A;  4CK2 A;  3LDS A;  3FZL A;  3ITH A;  3SBT A;  4RTF D;  1JL2 A;  1ZBU A;  1EXQ A;  2KTQ A;  2P9I A;  1VSL A;  1TVR A;  4CFB A;  4DQ8 A;  1YAG A;  2KFN A;  3QB0 A;  1YJ9 N;  1GLD G;  1U47 A;  4DV0 K;  1NMN A;  2IDO A;  2UXD K;  4F2S A;  4DG1 A;  3ZET B;  1SL0 A;  2FLO A;  3AVH A;  4PL7 A;  3NGI A;  2E6L A;  3GE1 A;  1MDU B;  1WSF A;  3PO5 A;  2Z1I A;  2KQ2 A;  1RBR A;  4HUF A;  3VF6 A;  5JVG L;  2YCH A;  4LF9 K;  4LSL A;  1GOB A;  4J2D A;  5DM6 L;  1YTU A;  3VQB A;  3OS1 A;  2GUI A;  3P83 D;  4FZX C;  2D0C A;  1QQC A;  3A5L C;  4DQS A;  4B1V A;  5KRT A;  3VGL A;  4FYD A; 
#chains in the Genus database with same CATH homology
 3TAQ A;  1TK8 A;  3HJF A;  4PY5 A;  1Z25 A;  4E7K A;  1N5Y A;  4FLZ A;  3WNH A;  1RNH A;  1S1X A;  3V9S A;  3V4I A;  3K2P A;  1C1A A;  1BGX T;  3ZT1 A;  3LZI A;  4KHU A;  1WAF A;  2YNF A;  4CJR A;  2X6S A;  1T8E A;  2HHS A;  3LWM A;  1S6P A;  4DF4 A;  3RTV A;  3TAP A;  4N47 A;  4CJ4 A;  1WSJ A;  3DRS A;  3VQP A;  5CYQ A;  4AHT A;  4K8Z A;  3QEX A;  2I5J A;  2QKK A;  3AA2 A;  3RRH A;  1O1W A;  4CHO A;  3SUQ A;  3HT3 A;  4OJR A;  5HRR A;  3SV3 A;  5C42 A;  2G8H A;  2G8K A;  4KHN A;  3NGZ A;  3RR8 A;  1Q8I A;  3IAY A;  3RMA A;  4CHY A;  4KHS A;  3JYT A;  4W5R A;  4Z0U A;  1TKT A;  4GVM A;  4O4G A;  3TAF A;  5HRS A;  1RIL A;  4FJ7 A;  2OZM A;  4CJP A;  4CF9 A;  4KO0 A;  4ZTF A;  1T03 A;  1SL1 A;  3RRG A;  4QCL A;  3AO3 A;  4IG0 A;  1RT2 A;  3ZSO A;  1S5J A;  2BAN A;  4W5T A;  4DTN A;  1C1C A;  1WAJ A;  1IKX A;  4FLX A;  4FJ5 A;  4M3Y A;  3V1O A;  5D3G A;  1BHL A;  3KJV A;  2IC3 A;  4KHQ A;  3HM9 A;  4KTZ A;  1REV A;  4TSX A;  1TKD A;  4I9Q A;  3KKS A;  3VQ5 A;  4OPJ A;  4FLT A;  1J5O A;  2B6A A;  3L2Q A;  1ZBH A;  4DF8 A;  2XO7 A;  3RR7 A;  3ZCM A;  3LAM A;  3DLH A;  4XIU A;  3OYM A;  3NF9 A;  3C6T A;  4OVL A;  1RTJ A;  5C25 A;  3CFO A;  5J2N A;  3TR8 A;  4ID1 A;  1WSE A;  1NK4 A;  1A5V A;  4HHT A;  3QET A;  2JLE A;  3RMB A;  3M8P A;  4W5O A;  4BDY A;  4F3O A;  1TAU A;  2D5R A;  3G0Z A;  2FC0 A;  3HPG A;  3VQQ A;  4I9L A;  3SPY A;  1LV5 A;  3NDK A;  4JS4 A;  4Z4E A;  1LWE A;  5HRP A;  4N56 A;  3RMD A;  4CJQ A;  3NE6 A;  4B9U A;  3PV8 A;  1RT5 A;  1VSK A;  3ZT2 A;  2Y1J A;  3ZSX A;  4CK3 A;  4M3T A;  4FJH A;  4O5B A;  1XI1 A;  3KLH A;  3NF8 A;  2BE2 A;  3QIN A;  1IKY A;  4HCC A;  1X9W A;  1VSH A;  2HHV A;  3DI6 A;  1C6V A;  1XWL A;  1SKW A;  1VSM A;  1DLO A;  1RDB A;  4Y1D A;  1K6Y A;  1C0M A;  1S1V A;  4CJF A;  1Y97 A;  4CJV A;  4DSJ A;  2AJQ A;  4DSF A;  5J1E A;  4F3T A;  4ID5 A;  4ICL A;  5SWM A;  1BCO A;  1C0T A;  4FW1 A;  2P5O A;  4DTP A;  4FJG A;  5FRO A;  4YNQ A;  3BGR A;  4IFV A;  3CM5 A;  4JS5 A;  1R0A A;  4KB0 A;  3PX0 A;  5HBM A;  1RDA A;  3OY9 A;  2P51 A;  1ZBL A;  1L3T A;  5KGW A;  1D8Y A;  3VQ9 A;  4KI4 A;  4CJL A;  3KLE A;  1Z26 A;  3MXJ A;  1UA1 A;  1XHZ A;  2OZS A;  1U45 A;  3V9W A;  4NCG A;  3QES A;  1VSF A;  1BIU A;  2E4L A;  3WNG A;  3U6F A;  3OYH A;  4C8N A;  1L3U A;  4F2R A;  2D0A A;  4RW6 A;  4Z4F A;  1RCH A;  1IO2 A;  1HNI A;  3DYA A;  3VQD A;  1ZYQ A;  4CEC A;  2HNY A;  3PY8 A;  4PUO A;  3MXI A;  1W9H A;  4IG3 A;  3AA3 A;  3VA3 A;  3V1Q A;  3MED A;  3K5L A;  4LH5 A;  3AVL A;  1KLN A;  3K5O A;  3NH1 A;  3SCX A;  3L3V A;  3LP0 A;  4RW7 A;  3OYC A;  3V9Z A;  3HVT A;  2OPR A;  5CZ1 A;  4DTX A;  3QEW A;  5JS1 A;  1LWC A;  4OGC A;  1U49 A;  3AVK A;  4KHY A;  4C8L A;  3KK2 A;  2HNZ A;  3L2W A;  3KTQ A;  4MFB A;  5KTQ A;  4FXD A;  4H4O A;  4CJW A;  3KKR A;  3F73 A;  4BE1 A;  3V9X A;  4DQQ A;  4AHU A;  1NJZ A;  2A1S A;  4CGF A;  3CQ8 A;  1T05 A;  3KD5 E;  3VQA A;  2YKN A;  3SUP A;  1B9F A;  4N41 A;  3JSM A;  4F4K A;  1TK0 A;  4CER A;  1JLQ A;  5HRO A;  2HHU A;  5FDL A;  2YHA A;  4DQP A;  1VRU A;  4QOZ B;  4CEA A;  5DMR A;  3LP3 A;  4DQR A;  3ISN C;  4FJM A;  4DS5 A;  1HRH A;  1WN7 A;  4Z4C A;  4BWM A;  3ZSW A;  1RT3 A;  4H8K A;  1DTT A;  1JXE A;  2GBZ A;  1FKO A;  1BL3 A;  3B6P A;  2VWJ A;  3C94 A;  3L2R A;  1NOZ A;  3SV4 A;  4KI6 A;  1EET A;  4FW2 A;  1Q9Y A;  4F8R A;  3AVN A;  2W42 A;  1T7P A;  2X78 A;  3TAN A;  3LZJ A;  1IH7 A;  2P1J A;  3DRP A;  4Z4G A;  1N6Q A;  1X1P A;  3I8D A;  1VSE A;  2Z1H A;  3QEP A;  1JKH A;  4G1Q A;  1HNV A;  2VG5 A;  1L3S A;  3SPZ A;  3HST B;  1LAV A;  3NF6 A;  4W5Q A;  3ZSV A;  4PQU A;  4CGG A;  3CFP A;  1HQU A;  3O3H A;  1NK0 A;  3OS0 A;  3VA0 A;  4CF1 A;  2Q3S A;  5KGX A;  3S3M A;  1B9D A;  3E01 A;  4DWI A;  5E41 A;  4M3W A;  2G8U A;  4B9V A;  4DU4 A;  5I3U A;  1WSH A;  1QHT A;  2IS3 A;  3O4N A;  1J53 A;  1GOA A;  3MXM A;  4N5S A;  2PY5 A;  4FK0 A;  3NCI A;  3OYI A;  1FK9 A;  1MU2 A;  4QAG A;  2IGI A;  1LW0 A;  3KIO A;  1KTQ A;  3NAE A;  1KLM A;  4FLU A;  3TWH A;  1CZB A;  2F96 A;  1TKX A;  2F8T A;  2HHW A;  4OKE A;  1QS4 A;  3ZT3 A;  3U3Y A;  3TAR A;  1BQM A;  3AVI A;  3HXM A;  4E7H A;  4YFU A;  4DFJ A;  3SUN A;  2ATQ A;  4BDZ A;  4FCY A;  2HVH A;  3CYM A;  1NK6 A;  2OPP A;  4L8R B;  4M45 A;  3LAN A;  1UA0 A;  4FJJ A;  4O55 A;  3RMC A;  3H08 A;  3ZT4 A;  1QTM A;  2F8S A;  1RTD A;  1WSI A;  4FK2 A;  4CEB A;  1ZBI A;  4M3U A;  3L3U A;  4C8O A;  2Z1G A;  3VQ7 A;  4KKO A;  1VSI A;  1YVU A;  2OPS A;  3LP1 A;  4PWD A;  2ETJ A;  1HJR A;  4CE9 A;  2OPQ A;  4CK1 A;  1U4B A;  4DSL A;  4FJN A;  4M42 A;  5FRN A;  2KZZ A;  1QSS A;  4C8K A;  3DMJ A;  2YNG A;  2ZE2 A;  4FLV A;  3L2U A;  3LWL A;  4FM2 A;  1D9F A;  1TL1 A;  1S1T A;  3K5M A;  4DTJ A;  3C95 A;  1ASV A;  1CXU A;  1EP4 A;  1UAX A;  4OLB A;  3PX4 A;  4KHW A;  3DLE A;  4DQI A;  3EY1 A;  3L8B A;  4J2A A;  4CEE A;  1QSY A;  3QEV A;  4KB1 A;  1WNS A;  4CGD A;  3KK3 A;  4DFM A;  4I2P A;  3PO4 A;  1JLC A;  1FKP A;  3S9H A;  1LWF A;  3KLI A;  2P5G A;  3KD1 E;  5J2P A;  3O3F A;  3T19 A;  3I0R A;  3SUO A;  1NK5 A;  1BI4 B;  1RBS A;  4B8C A;  3F9K A;  2G8F A;  1CLQ A;  4LSN A;  4JRP A;  3T3F A;  3TAB A;  3OYG A;  1KRP A;  4HUE A;  2YHB A;  5CZ2 A;  4ELT A;  4Q0B A;  4AIL C;  3CM6 A;  3AO4 A;  3QLH A;  4GMJ B;  4CJS A;  2JGU A;  3SI6 A;  2OA8 A;  2WON A;  3TAM A;  3EZ5 A;  3DLG A;  3MAQ A;  4R5P A;  3ULD A;  2XY7 A;  4M3X A;  2EX3 A;  1WLJ A;  2DFF A;  4OKK A;  1VRT A;  3FFI A;  5CY4 A;  4RW9 A;  4E7L A;  4KPY A;  3WNE A;  4IDK A;  4FJL A;  3I0S A;  4KRF A;  3AA4 A;  3T1A A;  3SJJ A;  2RN2 A;  2D0B A;  4DFP A;  4K8X A;  3NBP A;  1S9E A;  3DLR A;  4CGH A;  2XRI A;  4NCA A;  3WNF A;  4ELV A;  4Y1C A;  4E19 A;  2FBT A;  4JRQ A;  2YNI A;  4FJK A;  5CYM A;  2IAJ A;  3QIP A;  3NHG A;  3CFR A;  1SUQ A;  3MEE A;  1BIZ A;  4O0J A;  1HYV A;  4KFB A;  4ZHR A;  4O0I A;  4FM1 A;  3VQ4 A;  3V9U A;  4LH4 A;  2PZS A;  3U3G A;  1HYZ A;  2Z1J A;  3QEI A;  1D9D A;  3ALY A;  1RBV A;  1S9G A;  2VG7 A;  5EU7 A;  3IRX A;  4CFD A;  4IFY A;  3QER A;  3THV A;  1C0U A;  3DOK A;  4HTU A;  1J54 A;  1GOC A;  5HLF A;  4FJ8 A;  2X74 A;  1L3V A;  1SKR A;  2QK9 A;  1RTH A;  2XY5 A;  1B92 A;  5I42 A;  1TKZ A;  4M3R A;  3K57 A;  4IKF A;  4CHN A;  4NCB A;  1A5W A;  2ZD1 A;  4DMN A;  2HND A;  4Q5V A;  2HVI A;  4FJX A;  4CJ5 A;  2R7Y A;  1IG9 A;  3HYF A;  2HHT A;  2O4I A;  4CEQ A;  3M8Q A;  3MEG A;  1FXX A;  3OVN A;  4DFK A;  1XC9 A;  5SZT A;  4FVM A;  3VQ6 A;  3O4Q A;  1CXQ A;  5KI6 A;  3VN5 A;  1KCF A;  3AVF A;  3TAE A;  1NJY A;  1S6Q A;  2OYQ A;  4RG8 A;  4BAC A;  5FRM A;  2HW3 A;  2RKI A;  1TV6 A;  2XHB A;  4CES A;  4HVJ A;  1CZ9 A;  4CED A;  1LAW A;  2EHG A;  3HP6 A;  3LAK A;  2FBY A;  3VQ8 A;  1XHX A;  5JS2 A;  1JLA A;  3K5N A;  1X9S A;  3AVB A;  4DLG A;  1S1U A;  4C8M A;  3NGY A;  3DOL A;  4CFA A;  4CHQ A;  4EP5 A;  4LY7 A;  4KTQ A;  2YV0 X;  3AO2 A;  3CG7 A;  4J2B A;  2VG6 A;  3LPU A;  4BE0 A;  3S3N A;  1SL2 A;  3ZSY A;  4E3S A;  3BDP A;  1TGO A;  4WE1 A;  4OLA A;  1VSJ A;  3KLF A;  3TI0 A;  3ZT0 A;  2DFE A;  2O4G A;  3TAG A;  3P5J A;  1JL1 A;  3OYE A;  5J2M A;  5K14 A;  4CEF A;  4J2E A;  3PX6 A;  2BDP A;  4M41 A;  4KAZ A;  3SQ0 A;  4B9M A;  1NJX A;  2DY4 A;  4CCH A;  1KVC A;  4KV8 A;  4DS4 A;  4CIF A;  4DTO A;  4IBN A;  2DTU A;  4B08 A;  3KLG A;  1BIS A;  1NKB A;  4FLW A;  4CEZ A;  3AVJ A;  2LSN A;  1F21 A;  1RDC A;  3AO1 A;  2HMI A;  4RW4 A;  3OYF A;  1L5U A;  4CJE A;  1WSG A;  1NJW A;  1I3A A;  4UQG A;  2QXF A;  4DTM A;  4CFC A;  4E1M A;  1ASU A;  4CJT A;  3M8S A;  1U04 A;  3D0P A;  1KVA A;  1SKS A;  4FJ9 A;  2KW4 A;  1RT6 A;  1UOC A;  4OPK A;  4RW8 A;  3AVM A;  1RBT A;  4KTW A;  1ASW A;  3HVR A;  3QNO A;  5J2Q A;  1HPZ A;  3QNN A;  3NH2 A;  3OJU A;  4CJ3 A;  4NYN A;  1UWB A;  2HHQ A;  1TK5 A;  1NK7 A;  1S1W A;  4CEO A;  1HYS A;  5DK5 A;  1RTI A;  3SNN A;  1X9M A;  1BCM A;  1KFD A;  4HUG A;  3HP9 A;  1NOY A;  4B9T A;  4FLY A;  1NK8 A;  4JLH A;  3HPO A;  1LW2 A;  4CHZ A;  4CGI A;  2PYL A;  2KZM A;  1G15 A;  3A2F A;  3VQE A;  4CIE A;  1KSP A;  2B5J A;  4CF0 A;  2NUB A;  4EP4 A;  4FK4 A;  3LAL A;  3NH0 A;  3AVA A;  3NF7 A;  3OJS A;  3OYL A;  3K58 A;  3UIQ A;  1VK0 A;  4MQ3 A;  4FZY A;  1JXB A;  3O3G A;  4DU1 A;  4CJU A;  4NYF A;  3HO1 A;  4CF8 A;  2RPI A;  3S3O A;  4HCB A;  2YKM A;  2GV9 A;  2IOC A;  4KRE A;  4OKJ A;  4AH9 A;  3HK2 A;  4AHS A;  1NKC A;  1KVB A;  2PYJ A;  4DTU A;  3QIO A;  3B6O A;  4CIG A;  4O44 A;  1SV5 A;  4N76 A;  1QE1 A;  4ZTJ A;  3HPH A;  3LP2 A;  3AO5 A;  1VSD A;  1QSL A;  3SZ2 A;  3AV9 A;  4CJK A;  4FM0 A;  1JLG A;  2E6M A;  4DTR A;  4ELU A;  4M3Z A;  2XY6 A;  3OS2 A;  3SYZ A;  2X6N A;  3VQC A;  1NK9 A;  4E89 A;  2G8I A;  4H4M A;  2Y1I A;  4BDP A;  3OYJ A;  1IKW A;  1RT7 A;  3P1G A;  4CHP A;  3NFA A;  3DLK A;  3M8R A;  2QKB A;  1TAQ A;  4PA1 A;  5HRN A;  2BGG A;  2HHX A;  4LD0 A;  4DTS A;  3C6U A;  3AVC A;  1W0H A;  3IS9 A;  4BWJ A;  3OYN A;  1IKV A;  1U48 A;  1DTQ A;  1ZBF A;  2XY8 A;  4DSK A;  5KRS A;  4FJI A;  5C24 A;  3ZSZ A;  4B9N A;  3L2V A;  1JLF A;  1HQE A;  3RWU A;  1C1B A;  4CGJ A;  3ASM A;  3DLB A;  4W5N A;  3LPT A;  3V1R A;  3HL8 A;  3EYZ A;  4FZZ A;  4B3O A;  3DRR A;  4I2Q A;  2YNH A;  2FBX A;  1A5X A;  3G10 A;  3OYA A;  2DFH A;  3DM2 A;  3ZSR A;  3KK1 A;  1NKE A;  3QO9 A;  3OYK A;  4CK2 A;  3LDS A;  4BE2 A;  3AVG A;  3ITH A;  3ZSQ A;  3PUF A;  1EX4 A;  1EKE A;  1JL2 A;  1TL3 A;  1I39 A;  4E0D A;  1ZBU A;  2G8V A;  4Z4I A;  1EXQ A;  1YT3 A;  4GW6 A;  3K59 A;  4E7I A;  4DSE A;  3SQ4 A;  2KTQ A;  1RDD A;  4E1N A;  1JLB A;  1VSL A;  3SQ1 A;  1TVR A;  2ZQB A;  1BQN A;  4CFB A;  4E7J A;  2A1R A;  4EZ9 A;  4DSI A;  2KFN A;  2KFZ A;  1HMV A;  3V6D A;  5HP1 A;  2VWK A;  1RBU A;  1D5A A;  3OYD A;  1U47 A;  2B4J A;  2HB5 A;  2WOM A;  2IDO A;  4EZ6 A;  1BI4 A;  4AHC A;  3MEC A;  4F2S A;  5T7B A;  2FBV A;  4DG1 A;  1SL0 A;  1ITG A;  2G8W A;  4AHR A;  4B9S A;  3AVH A;  1RT1 A;  2RF2 A;  2E6L A;  3NGI A;  4B9L A;  1WSF A;  3V81 A;  1KFS A;  3PO5 A;  1J9A A;  2Z1I A;  2KQ2 A;  3AA5 X;  1RBR A;  1YTA A;  2ITG A;  3D45 A;  3OYB A;  4HUF A;  4DLE A;  4OGE A;  4B8A B;  4LSL A;  1GOB A;  4J2D A;  1JLE A;  1YTU A;  4CF2 A;  3VQB A;  3SQ2 A;  1Q9X A;  3OS1 A;  2GUI A;  3P83 D;  4FZX C;  4I7F A;  4Z4H A;  3IG1 A;  2D0C A;  1QQC A;  1RT4 A;  4DQS A;  5KRT A;  4DU3 A;  4AHV A;  4FYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...