4JLHA

Hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
138
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEFESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Integrase catalytic core domain
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 45
structure length 138
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4jlhA00
1A5VA 1EETA 3AVLA 4NCBA 1S6QA 4OPJA 3I8DA 3VQ9A 3VQCA 1W0HA 3ZSWA 3LDSA 3JYTA 4Z4FA 1TAUA 3ASMA 1JLFA 3H08A 4AHCA 4XIUA 1TKDA 1ASWA 4FJ9A 4KHQA 4C8LA 2R7YA 4F2SA 3LZIA 1T03A 3HXMA 4AHRA 4KAZA 1NJZA 5FRMA 1ASUA 3V81A 1VSIA 3M8SA 1QS4A 1HYVA 4M3RA 4IDKA 3WNHA 1ZBIA 2WOMA 1FKOA 4OKKA 3ZSYA 4W5RA 4KRFA 4PUOA 3NF6A 2WONA 4CJLA 2Z1IA 4PA1A 2P51A 3SPYA 3MXIA 4HUFA 2B5JA 5KTQA 4OLBA 3O4NA 3HP9A 2DY4A 2HHXA 1BCOA 1RBRA 1C1BA 4YNQA 1RILA 4CHQA 1JLEA 1IKVA 2E6MA 2JGUA 2VWKA 3AA2A 1J9AA 4CJTA 4B9LA 1S9EA 3AA4A 1LAWA 1RNHA 3AVAA 3VQ5A 3VQQA 2PZSA 2HHVA 1B92A 4HCCA 1VK0A 1CXUA 3QESA 4CFCA 4M45A 3O3FA 1JL2A 4UQGA 4CERA 4Y1CA 4CEQA 3SYZA 2Y1JA 3SQ4A 3RR7A 2OZMA 4KREA 3DM2A 2EX3A 4EP4A 3CFRA 4FZZA 4WE1A 4CGHA 4M3XA 1VSMA 4BDYA 1S1XA 2KQ2A 1WSEA 3EY1A 4M3WA 3AVBA 4FJ8A 2VG7A 3C95A 1QSSA 4F3OA 1VSFA 3VQBA 2D0BA 1TKXA 3AO3A 1NJWA 3DMJA 3QEPA 4PWDA 2OPRA 2IGIA 3CG7A 1UA0A 3AVJA 1BIZA 5J2MA 3NE6A 4M3YA 2HVHA 3DOLA 1C1AA 2E4LA 2RN2A 1NK7A 2W42A 4N76A 3QNOA 1UAXA 2OZSA 3KLEA 2VWJA 3OS2A 3OYAA 4CJPA 4KTZA 5HROA 1LV5A 1QSLA 1LWFA 1Y97A 3QLHA 3THVA 1CXQA 3ZT0A 4QCLA 1NK4A 2EHGA 4PY5A 1I3AA 1QSYA 4FZXC 1Q9YA 4FLTA 4B9TA 1YT3A 1IH7A 4KHNA 1RDAA 3KD1E 4ID5A 4RW7A 5J2PA 4L8RB 2HVIA 2HHSA 4I9QA 3ZSVA 4CJQA 4AHUA 4DMNA 1S6PA 3ZT2A 3D0PA 3TAQA 1KVBA 4CF1A 2F8SA 2F96A 2A1SA 3LAMA 3OY9A 1WN7A 1HRHA 4DS5A 3SJJA 3A2FA 3DRRA 4CGFA 1IKXA 1XWLA 3K59A 3AVHA 4RG8A 3ZT3A 3DLGA 3ZSRA 1GOBA 3OYHA 3V6DA 1C0UA 1FKPA 1RTHA 2O4GA 1LW0A 1SV5A 4FJNA 3MXMA 3RR8A 4MQ3A 3V1OA 1XHZA 1NKBA 2DFHA 1RTJA 3LANA 4Z4HA 1GOCA 3MXJA 1TAQA 4HVJA 1U45A 3CYMA 4N41A 3OYGA 5KRSA 2HNZA 4HHTA 3AA3A 3K2PA 1BCMA 3AVMA 1X9MA 1CLQA 3OYIA 5KGWA 3AVNA 1JLAA 3V1RA 4CJRA 5KI6A 1JLQA 3G0ZA 3AA5X 4CEOA 1ZBHA 4CF2A 1REVA 4FLVA 4E7HA 2G8HA 3ULDA 3SV4A 3OYEA 4DQSA 1L3UA 2KW4A 2KZZA 1RBUA 1QE1A 1WSIA 2YNFA 2BDPA 4LSLA 4OVLA 4M3TA 4OJRA 3TANA 3CM5A 3CFPA 4DQQA 2OPPA 5J2QA 4J2DA 2G8FA 1HQUA 1HNIA 4O0IA 3M8RA 1K6YA 1BHLA 4W5OA 1X1PA 1BIUA 3DI6A 4DTUA 2P1JA 1VRUA 4CJUA 3NH2A 5SWMA 4E89A 1SUQA 3K5OA 1L5UA 3ZCMA 1SL1A 3PO4A 3ISNC 4KTWA 1HQEA 1D9FA 1EXQA 2FC0A 4PQUA 1VSKA 2HW3A 4I9LA 4W5NA 1WSGA 3U3GA 3MAQA 1JXEA 2YHBA 3OYCA 4I2QA 4E7KA 5CYMA 3MECA 4Z4GA 1HNVA 1W9HA 1QTMA 4RW9A 1ZYQA 3B6OA 3K57A 1BISA 2OYQA 1RBTA 4IKFA 4G1QA 4CGJA 1NK6A 1JLCA 4GW6A 2KTQA 3I0SA 4EZ9A 3NCIA 4FJXA 3HT3A 4KHWA 4FCYA 2HHWA 4CEBA 3PX6A 4JRPA 1T8EA 2F8TA 4LH5A 4KKOA 4FJGA 1C0TA 1O1WA 3NF8A 4QAGA 2E6LA 4DQPA 2HHQA 5DK5A 4ELVA 3TABA 3KKSA 1VSDA 2ZD1A 4TSXA 3SUQA 1YTUA 1C6VA 4DFJA 4Z0UA 4DTMA 4FM2A 5SZTA 4GMJB 1J5OA 3MEEA 4CEFA 1UOCA 2JLEA 1XHXA 3NH0A 5DMRA 2I5JA 4DSJA 1J53A 1NJXA 4IBNA 3PX0A 4CHOA 1C1CA 4CEEA 2XO7A 5CZ1A 1WSFA 3NBPA 2IOCA 3HO1A 3M8PA 1RT1A 2NUBA 1U4BA 3QINA 2YKNA 2QKKA 1DTTA 3OYMA 3T3FA 1D8YA 3LALA 4CEAA 1T7PA 1LWCA 4O4GA 4DG1A 2X6NA 3V9WA 4C8NA 4KO0A 3TAEA 1KFSA 4CE9A 1B9DA 3L3UA 4CGIA 3V9ZA 2ITGA 1B9FA 3LZJA 1RBSA 1L3TA 1X9WA 4ELTA 4CJ3A 4M3UA 1UWBA 1KTQA 4O44A 4KHUA 4HUGA 3HVTA 2B6AA 5HRPA 3QERA 3O3GA 3DLRA 2B4JA 3NFAA 3NH1A 3K5NA 2OA8A 5HRRA 4IG3A 4CK3A 3HK2A 3U6FA 1EKEA 5C24A 4CFBA 1X9SA 4JS5A 1XI1A 4O5BA 2FBYA 3KLHA 3V9UA 3VA3A 4EP5A 5T7BA 4DTNA 3OJSA 5CZ2A 2IC3A 3OYLA 3MEGA 4OGEA 3SQ2A 3SUPA 5HP1A 4F2RA 1U48A 3VQAA 1Q9XA 3PX4A 1MU2A 3NGIA 4RW8A 4FJJA 4QOZB 4B8CA 2KFNA 4C8KA 1A5XA 3AVFA 3AO5A 3LWMA 4FW2A 4DSEA 4NYNA 1EP4A 3KK2A 4LH4A 3OVNA 4DF4A 3V4IA 3NF7A 4KV8A 4FLUA 3TAFA 3RMDA 2DTUA 2VG5A 1WSHA 3G10A 4AILC 1NK9A 3QIOA 4FK4A 3VQ8A 4JS4A 1L3VA 3DLHA 1LW2A 5HBMA 1RT2A 4OKEA 2RPIA 1VSHA 1YVUA 3AVGA 4E1NA 4M41A 4E7JA 2XY6A 4DQIA 4Y1DA 1VSJA 3LP2A 2YKMA 4H4MA 3E01A 1WAJA 2RKIA 3C6UA 3EZ5A 1KFDA 4J2BA 5FDLA 1Z25A 4BE2A 3CQ8A 3AO2A 3NGYA 1NK8A 4CFDA 3AO1A 3P1GA 2BANA 4CEDA 1L3SA 4CK1A 4E0DA 1RDDA 3IAYA 1VSEA 3VA0A 3ZSOA 3VQ4A 4NCGA 1G15A 3HPHA 3L2UA 4FJKA 1JKHA 3VQPA 3OS0A 2XY8A 3NDKA 4CIGA 1R0AA 3TARA 3HJFA 1BI4A 1RT7A 3KK1A 4DLGA 2GV9A 4DTRA 1U49A 2A1RA 3L3VA 3LWLA 3UIQA 2KZMA 4IFVA 3KLGA 3QNNA 1N5YA 3RMBA 4CHYA 1HMVA 1WAFA 3C6TA 4DF8A 1U47A 3IS9A 1ZBFA 3P83D 3LAKA 4DFPA 1BL3A 2IS3A 5I3UA 1TK8A 1RT6A 2HNYA 4CF0A 4E7IA 1NKEA 2BGGA 4FK2A 2HB5A 2X78A 4Q0BA 1NKCA 3K5MA 1A5WA 2P5GA 1VSLA 4CF8A 4FK0A 1RT5A 3QIPA 2RF2A 2FBVA 3LP0A 4N47A 4AH9A 2FBXA 4I2PA 1NK0A 2KFZA 4N56A 3WNEA 2QXFA 4CHPA 1Q8IA 3KD5E 1SKRA 1JL1A 3F9KA 5CYQA 3DOKA 1I39A 4B9MA 2Z1GA 2G8IA 3L2QA 2BE2A 4AHVA 2G8KA 1N6QA 4IFYA 5J1EA 2HHUA 3ZT4A 4B9VA 1HYZA 3CFOA 4CIFA 4BE1A 2ZE2A 3S3NA 4FLYA 3PY8A 4R5PA 1TGOA 1BQMA 4FJIA 5JS1A 5KGXA 3L2RA 1QHTA 3LPTA 1JXBA 4E7LA 4K8XA 1ZBUA 5C25A 4Q5VA 4RW4A 2PYJA 4FZYA 1TKTA 4CJSA 1KCFA 2HMIA 4FJ5A 2ATQA 4FM1A 3HSTB 1JLBA 1F21A 3VQDA 4CHNA 3OYKA 2XHBA 1NJYA 4C8OA 1VRTA 3KIOA 4DSIA 1EX4A 2GBZA 1S1UA 3LP1A 4OGCA 3SQ0A 3DYAA 2YNHA 3D45A 3ALYA 3HPOA 1TV6A 1HPZA 2GUIA 2Z1JA 4CJKA 4FLWA 3SV3A 4FXDA 1S1VA 5JS2A 1ITGA 3V1QA 4DQRA 4CECA 4CHZA 2LSNA 4YFUA 4DTSA 5I42A 2D0CA 3KK3A 3TI0A 3TAMA 4DFKA 4F3TA 5J2NA 3WNGA 4E19A 5D3GA 5KRTA 4KTQA 4LD0A 3QETA 4ZHRA 3SUNA 4AHTA 2VG6A 3MEDA 4B9NA 4DWIA 5C42A 4W5QA 3DLKA 3O4QA 4FM0A 2XY7A 1NK5A 4KHYA 4FVMA 4HTUA 1RDBA 3HM9A 4LSNA 4CJWA 3U3YA 4CJ4A 1LWEA 3OYFA 4J2EA 1BQNA 4Z4IA 2QKBA 1S1WA 1DLOA 4MFBA 3RTVA 1DTQA 4O55A 4BE0A 4OLAA 1UA1A 3VQ6A 3L8BA 4B3OA 4DFMA 4O0JA 1CZBA 1T05A 1WNSA 3KJVA 3F73A 2P5OA 1ZBLA 3HVRA 3V9XA 3TAGA 2HHTA 2PY5A 3KLFA 1KSPA 2IAJA 3HYFA 3PV8A 3WNFA 3OYDA 4F8RA 2DFEA 1KLNA 4FJ7A 2Y1IA 4H4OA 5E41A 4W5TA 2ZQBA 4ELUA 1JLGA 2OPSA 3HL8A 4DU4A 4CGGA 4FLXA 4B08A 4DTPA 1CZ9A 3AV9A 3DRSA 4CESA 3IG1A 1NOZA 4DU1A 2X6SA 3BDPA 1RT4A 4FLZA 3CM6A 3JSMA 1SL0A 4N5SA 3AVCA 1YTAA 3PO5A 4CGDA 4HUEA 1J54A 3TR8A 3TWHA 1QQCA 4GVMA 1LAVA 2D0AA 4IG0A 1D5AA 5EU7A 5K14A 4CK2A 4JRQA 1D9DA 2PYLA 3IRXA 3M8QA 3SPZA 4E1MA 4RW6A 4B9UA 2X74A 2OPQA 3NAEA 3DRPA 2IDOA 4CJVA 3SZ2A 4M42A 1TKZA 1RCHA 2Q3SA 3VQEA 3LPUA 3SQ1A 3OYNA 1C0MA 3K58A 4DU3A 3TAPA 4J2AA 3QO9A 3RRHA 1TK0A 4CF9A 4HCBA 3S3MA 1ASVA 4EZ6A 3ZSQA 1S1TA 2ETJA 4BWJA 5FROA 5HRNA 3QEVA 2YNIA 3LP3A 3OYJA 3L2VA 4KI6A 1U04A 4C8MA 1RT3A 4JLHA 4DSKA 1RDCA 3B6PA 4KHSA 1RBVA 3RWUA 2QK9A 3T19A 3S9HA 1XC9A 1KVAA 5HRSA 4CEZA 1IKYA 2XRIA 1SL2A 4BDZA 4DSFA 2FBTA 3NGZA 2G8VA 4DSLA 3SUOA 2G8UA 2O4IA 3I0RA 3DLEA 3HPGA 4ID1A 4NCAA 1RTIA 1GOAA 4CFAA 4DTJA 3SCXA 4BWMA 5FRNA 3ZSXA 4KFBA 4ICLA 4H8KA 3HP6A 1Z26A 1WLJA 4E3SA 3EYZA 1TL3A 4DS4A 3NF9A 3P5JA 3V9SA 4CIEA 4BACA 4FJMA 2Z1HA 1HJRA 4DTXA 1HYSA 4KB1A 4ZTFA 4M3ZA 3L2WA 2G8WA 1TL1A 3S3OA 3ZSZA 3K5LA 1WSJA 3DLBA 3ITHA 3OS1A 4FJLA 3RRGA 2HNDA 3C94A 2AJQA 2YHAA 5CY4A 5HLFA 1RTDA 1TVRA 1S9GA 4DTOA 4F4KA 4CJEA 1SKSA 3T1AA 3NHGA 3AO4A 4KPYA 3KKRA 4CJFA 3O3HA 3QEIA 3RMAA 1IKWA 1BGXT 4FW1A 4I7FA 4LY7A 3VN5A 3OYBA 3QEXA 4B9SA 3VQ7A 4Z4CA 2XY5A 1BI4B 4NYFA 1S5JA 3SNNA 1FK9A 1FXXA 3ZT1A 4AHSA 4OPKA 3OJUA 2YV0X 3QEWA 1SKWA 1KRPA 4BDPA 4Z4EA 1TK5A 1KVCA 2D5RA 3AVKA 3RMCA 4K8ZA 4OKJA 4ZTJA 2YNGA 2DFFA 1KLMA 1IO2A 4FJHA 4B8AB 4CJ5A 3AVIA 1IG9A 4CCHA 4KB0A 3BGRA 3SI6A 3PUFA 4FYDA 3FFIA 1NOYA 3KTQA 4KI4A 3KLIA 4DLEA
chains in the Genus database with same CATH superfamily
5FPDA 4NCBA 1S6QA 3CCLN 4Z4FA 3JYTA 3H46O 5HL7L 3ASMA 1HLUA 4X65K 5AJ3K 3SMPA 4C8LA 3HOSA 3LZIA 4KAZA 2HMPA 3V81A 3WXLA 1QS4A 1SAZA 1FKOA 4MO4A 4PUOA 3MXIA 2P51A 5BPLA 3O4NA 3CQYA 3EE9A 2DY4A 4YNQA 1XMQK 3E1YA 4CHQA 2E6MA 1IKVA 2JGUA 3FFKB 1OH8A 4JI8K 4CJTA 4ISEA 1S9EA 3AVAA 2P9LA 3R1XA 1N8RO 4LFBK 3ID6A 4M45A 3O3FA 1JL2A 4UQGA 4JI2K 3RR7A 2EX3A 2OTLN 4O5FA 2KQ2A 4J8FA 4M3WA 4FJ8A 1NNEA 3BY5A 2CH6A 2A42A 1BIZA 2HVHA 2O8FB 4EIAA 1GLCG 5AQZA 1WB9A 1JJ2M 1O13A 2VWJA 3OS2A 4BRQA 3OYAA 1QSLA 4OO1J 1LWFA 3THYB 1QSYA 4JI1K 4FZXC 2A40A 4CW7B 4FLTA 1YT3A 1IH7A 1RDAA 3KD1E 4L8RB 2HVIA 4I9QA 1ATNA 3G25A 4CD1A 2OANA 1ATRA 4H0VB 3LAMA 5AQSA 3L6QA 3K59A 1VQ7N 1BO5O 4EAHD 3U9ZA 1GOBA 1IBKK 2VGNA 4B3TK 1QQOA 3MXMA 3RR8A 1NKBA 2DFHA 1U45A 3E9LA 4N41A 3AA3A 1QHAA 3K2PA 4FWSA 4WCEL 3OYIA 3V1RA 4CJRA 5I9EB 1JLQA 5AQKA 4BY9C 4FLVA 3SJHA 2KZZA 1L3UA 2KW4A 1RBUA 4IFEA 4IEIA 2YNFA 2BDPA 5E26A 1P90A 1HQUA 1HNIA 3M8RA 4W5OA 1VRUA 5SWMA 4E89A 1K8KA 3J7YP 1L5UA 1X3NA 3A5NC 3E9PA 1SL1A 3ISNC 1HQEA 3E66A 1EXQA 1D9FA 1VSKA 4KH4A 2VQEK 1JXEA 1KC8O 2P9NB 3OYCA 1QTMA 1ZYQA 2HBKA 3B6OA 3L4QA 3M3ZA 4FPBA 4IKFA 4G1QA 4CGJA 1JLCA 2KTQA 3I0SA 2HHWA 1YXQA 4CEBA 2F8TA 1FJGK 4LH5A 4KKOA 3O08A 1C0TA 1ILYA 4CD3A 4NO7A 5DK5A 2HOEA 3TABA 1YTUA 3MWTA 1C6VA 4DFJA 4FM2A 3C6HA 4GMJB 4Y0WA 1UOCA 2I5JA 1NJXA 1V4SA 3OBYA 3W3DA 3KZBA 3P38A 4BRHA 1J6ZA 1U4BA 1U6ZA 2QKKA 1DTTA 4BRKA 3LALA 2WC9A 2O8DA 5M1NA 3L3UA 3V9ZA 1RBSA 1ATSA 4BQZA 1KTQA 5HRPA 3QERA 2ZF5O 3O3GA 3NFAA 4GY2B 3NH1A 4H5TA 3U6FA 1EKEA 5C24A 4JD2B 2FBYA 4H5VA 3G6EN 3FGUA 4F2RA 2IC3A 4OGEA 3LDLA 5HP1A 3DXMA 3VQAA 2W6KA 1MU2A 4RW8A 2YJFA 4KHPK 3FZMA 1A5XA 3AVFA 4O8KA 4BC3A 3PIPL 4CZMA 3D6RA 2HSTA 4LH4A 2OCEA 4FLUA 3ENOA 3HI0A 3G10A 4A5BA 1NK9A 4JS4A 1Y64A 5M1PA 3VGLA 1YVUA 4M41A 4Y1DA 4BRMA 1VSJA 4H4MA 2RKIA 2HF3A 5AZJA 1TYQB 5FDLA 4BE2A 4FOIA 4CFDA 4E0DA 1RDDA 3U9DA 4IOCL 1VSEA 5C15A 3VA0A 2QWQA 3L2UA 4FJKA 2J4RA 3DWLA 3F9MA 4YOYA 1R0AA 1BI4A 2GV9A 4DTRA 5LMUK 3L3VA 3LWLA 3TPQA 4IFVA 3UB5A 3QNNA 1N5YA 4CHYA 5AQJA 3C6TA 2D1KA 3LAKA 1BL3A 3KK7A 3FE1A 2X78A 3C7NB 1A5WA 2Q2RA 3IDHA 4FL9A 2RF2A 3LP0A 4N47A 1S72N 4AH9A 2FBXA 2P9UA 3F9KA 3DOKA 2G8IA 3L2QA 3DAWA 1KQSM 4YOWA 3CCRN 2HHUA 4B9VA 3VESA 4FLYA 3PY8A 4R5PA 1TGOA 4BR4A 1QHTA 5C10A 1R59O 1VHXA 1BDGA 4BG8A 3DLLL 4CHNA 2XHBA 4BVPA 3LL3A 5EXWA 1S1UA 5M1OA 1VQ6N 1EWQA 4MLEA 4K42A 3DYAA 4NXNK 2YNHA 4CJKA 1S1VA 4YFUA 3FR0A 2D0CA 2YHWA 3AAQA 1ZC6A 3WNGA 1YVNA 4ZHRA 4BRNA 4FO0A 4W5QA 2XY7A 4HTUA 3B8AX 3HM9A 4LSNA 4CJWA 4DR2K 4J2EA 3MK6A 1DLOA 2E88A 2QXLA 1HUXA 4A62A 3RTVA 4YDUA 2Q97A 3VQ6A 3L8BA 3MN5A 5AQHA 4IOXA 3KJVA 2P5OA 3T1YK 3TAGA 2HHTA 1KSPA 1VQ9N 3HYFA 2DPNA 1N34K 3CC7N 4CZEA 4F8RA 3CF5L 1JCFA 3AGKA 4DU4A 2Q0UA 4CBXA 4CGGA 1WBDA 4DTPA 1CZ9A 3DRSA 4YDUC 3JSMA 3CMAN 3TR8A 4BRGA 3TWHA 1LAVA 5K14A 1D5AA 3VERA 3IRXA 4OPHA 5ADXA 3M8QA 4E1MA 1BUPA 4FWQA 3NAEA 3DRPA 2A6AA 2Q3SA 4DR5K 4DB3A 2QWRA 4JNEA 3ZSQA 1S1TA 5JICA 5IWAK 3LP3A 3L2VA 4YOVA 4C1NI 4JKBA 3L0QA 3RSEA 5HRSA 2XRIA 5JVHL 2FF3B 3HOTA 3SAHA 3THXA 4JKFA 1RGIA 1GOAA 1RTIA 3O5BA 4BWMA 2P9IA 4KH6A 3ZSXA 4ICLA 4MLHA 4H8KA 3I33A 3HP6A 3O4WA 3S41A 3K9KA 4FJMA 4BACA 1HYSA 4KB1A 2G8WA 1XQSC 3DLBA 2F4VK 2P9NA 3OS1A 1KAZA 4K43A 2YHAA 2P9SA 1RTDA 1K73O 4CJEA 1SKSA 1GLDG 4KPYA 3AO4A 1VQLN 3CJ9A 4CJFA 3RMAA 1IKWA 4LY7A 4IZ9A 3QEXA 4B9SA 3VQ7A 2XY5A 3CD6N 1HR0K 1FK9A 3AAPA 1VQON 3CQXA 3SAFA 4RWTA 4ZTJA 2YNGA 4BC5A 4KB0A 1IG9A 3BGRA 4RCHA 3SI6A 3H6EA 4LFCK 3NVMA 3QLHA 3KLIA 5JS1A 2FF6A 3LM2A 2NRRA 5GAGP 4OPJA 3I8DA 3VQ9A 1JLFA 3H08A 4AHCA 4GV6A 1IBLK 3VGMA 1ASUA 1VSIA 3M8SA 3WNHA 1XC3A 1VQKN 4KRFA 3ZSYA 3NF6A 1X9JA 4CJLA 3CETA 4HUFA 2B5JA 2IVNA 4JHDB 1DEJA 5KTQA 2NRVA 3WXIA 4C23A 1IJJA 1JLEA 4DR6K 3AA2A 3AA4A 3G71N 1X3MA 5CR4A 3VQ5A 3AY9A 2PZSA 3CCVN 1YITN 1CXUA 3D7EO 4Y1CA 4CEQA 2OZMA 4GKKK 4WE1A 4YORA 1VSMA 3BF3A 1HNXK 3AVBA 2VG7A 3ZETB 1VSFA 1P8ZA 3VQBA 3CHWA 2OPRA 2BUPA 3CG7A 3AVJA 3A8YA 4H5RA 1WBBA 2E4LA 1NGCA 4ISFA 1HNZK 2OZSA 2GWKA 2UXDK 4KTZA 3CCSN 2UXCK 1WOQA 1Y97A 5F1XA 1CXQA 2EHGA 1QQNA 3IMXA 4PKHA 5AQMA 3C0BA 5AFUH 5JLFA 5AQVA 4IJAA 4IWVA 2F96A 2CH5A 1WN7A 1HRHA 4DS5A 4X64K 5AR0A 3UKRA 5BPMA 3AVHA 3ZSRA 3V6DA 4LF9K 5LY3A 3BZKA 3SLCA 4MQ3A 3V1OA 1XHZA 1RTJA 3LANA 1GOCA 3MXJA 1BU6O 4HVJA 3CYMA 4A59A 3CCMN 1NMNA 4XH1A 5KGWA 2QEXN 3AVNA 3ENHA 2WTUA 2FSNA 5KI6A 4CF2A 1REVA 1CZAN 1QE1A 3EE8A 3HBTA 4M7YA 2OPPA 1W7AA 4J2DA 5TKWA 1X1PA 5JLHA 1BIUA 4MDBA 2FSJA 3ZCMA 4PQUA 4I9LA 4W5NA 3U3GA 4DR4K 2OTJN 5CYMA 2F9WA 1HNVA 2QTDA 4RW9A 5BR8K 3WEEB 1NK6A 4GW6A 4EHTA 3EL2A 4JI5K 5BR9A 3PX6A 1RDUA 3PSIA 1T8EA 3TU5A 3CCJN 3CCEN 4GVEA 1VSDA 2ZD1A 3SUQA 1XMOK 4XEIA 4DCHA 4DR7K 5SZTA 3MEEA 2JLEA 1XHXA 3HSCA 4DSJA 4CHOA 3CCQN 5M1QA 1RT1A 2NUBA 3T3FA 4WFAL 1LWCA 4O4GA 4DG1A 2X6NA 3V9WA 4FPAA 2ITGA 1B9FA 1E4FT 3O6WA 1L3TA 1UWBA 3CIPA 3HVTA 3DLRA 5HRRA 4CK3A 2JWLA 4CFBA 2GTDA 3QDKA 1XI1A 3DXKA 4FWLA 4JKDA 3KLHA 3V9UA 4EP5A 3OJSA 3OYLA 3MEGA 2A3ZA 1U48A 1Q9XA 4UY8O 3MN6A 3TTCA 4BRLA 2KFNA 4C8KA 5LMNK 3AO5A 4B1YB 4DSEA 2Q1NA 2E2PA 4O8UA 2E2QA 3OA9A 4DV7K 3V4IA 3VEXA 1WSHA 1T6DA 1L3VA 4BVOA 4CVNE 1QZ6A 4DQIA 2NRXA 4DV2K 4MO5A 1WAJA 5GAHP 1KFDA 3QFUA 4MDAA 3AO2A 3AO1A 3P1GA 2BANA 4CEDA 1L3SA 4CK1A 3ZSOA 1G15A 2FXUA 1JKHA 2PAVA 4KH5A 3OS0A 3NDKA 4X66K 3KK1A 5JMVA 2A1RA 3ENBA 2V7ZA 3RMBA 2UYTA 1ZBFA 4DFPA 1TK8A 4CF0A 2BGGA 5BN9A 5GIOA 2HB5A 1TUYA 2IVPA 1NKCA 3K5MA 4CF8A 1RT5A 1W97L 2FBVA 3SBGA 5AQIA 1Z6RA 4I2PA 3QB0A 1NK0A 2KFZA 4CHPA 3KD5E 4JAXA 3A5LC 1SKRA 3ZLJA 4A5AA 2Z1GA 1QQMA 2BE2A 4AHVA 1N6QA 3ZX2A 3ZT4A 4HTLA 1HYZA 3CFOA 4CIFA 1C0GA 4EFHA 1BQMA 4JHDA 3L2RA 3A5MC 1T3VA 3MMVA 1JXBA 4Q5VA 5C25A 4RW4A 4FJ5A 2ATQA 4YY3K 2F7TA 1NGEA 2WBNA 3CJBA 3VTIA 2GBZA 3LP1A 4ISGA 3D45A 4BR5A 1HPZA 4FLWA 3M5RA 3V1QA 4KBOA 1GLJO 3KK3A 3TI0A 4Z94A 3UE5A 5EVZA 3R8EA 4LD0A 4PKGA 3QETA 4RTFD 4AHTA 5GADP 3SUNA 3MEDA 4H03B 3IFRA 3DLKA 3O4QA 5AQWA 5BRFA 3M6GA 4DR3K 1NWKA 3OYFA 4MFBA 4PKIA 1DTQA 2QWOA 4U67L 1HKBA 3RVCA 1CZBA 1WNSA 2JWKA 5M1KA 2PY5A 4JEPA 3VGKA 2E1YA 2CGKA 1GLFO 2DFEA 3TSQA 2Y1IA 4H4OA 3T69A 4W5TA 3ZEUB 4IDHA 3M1FA 1I94K 3H3OB 4DV0K 3T7ZA 3WXKA 3AV9A 2UU9K 1NOZA 4B1WB 4DU1A 2X6SA 3BDPA 1RT4A 1VQNN 3AVCA 4CGDA 3CI5A 3EN9A 3CXCM 4HUEA 1J54A 4N76A 3ID8A 3BUZB 4FWMA 3F5TA 1Q82O 2IDOA 4IO9L 4CJVA 1YF5L 5GINA 3G4SN 3SZ2A 4WQ5A 1TKZA 2YX6A 3O9UA 3SQ1A 3OYNA 1Q86O 4J2AA 3GL1A 1TK0A 1VQ8N 4HCBA 3S3MA 2ETJA 4BWJA 3QBWA 4JN4A 4KI6A 1U04A 3J81O 1DT9A 4K25A 3S9HA 1KVAA 4CEZA 2P9KB 2FBTA 4DSLA 2G8UA 2O4IA 3HPGA 4ID1A 4WQ5C 4FSVA 4CFAA 3SCXA 5HOOA 2GELA 4KFBA 1SZ2A 4E3SA 1YI2N 5DM6L 3UKUB 3NF9A 3V9SA 1EWRA 5GAEP 3K5LA 3ITHA 2D4WA 3FZLA 2HNDA 3H1VX 5CE3A 2VQFK 4AM6A 1U2VB 5HLFA 1TVRA 4LF4K 1S9GA 4BROA 3T1AA 3NHGA 3KKRA 3QEIA 3N4QA 3BEXA 3QMLA 4I7FA 4NYFA 4ILJA 1FXXA 4DKWA 4PL7A 4AHSA 4BDPA 3CERA 3OJUA 1SKWA 4JKHA 1TK5A 1KVCA 3RMCA 4QS8A 3CC4N 2RE2A 5A2QO 4B8AB 4CCHA 3LDQA 4FYDA 3FFIA 2Q36A 3R9PA 4FWNA 3AVLA 3VQCA 3ZSWA 1ASWA 4FJ9A 4F2SA 4WYBA 4AHRA 5AQOA 4JI0K 1HYVA 4M3RA 4IDKA 2E20A 2WOMA 4W5RA 2Z1IA 3W0LA 2D0OA 2O8FA 5BRDA 4NLCA 1BCOA 1RBRA 2YHYA 1C1BA 2HHXA 1RILA 1EO1A 4B9LA 3OHRA 4CZJA 1LAWA 1RNHA 3VQQA 1SQKA 3THYA 2WUSA 1B92A 1VK0A 4H5WA 3QESA 3U4LA 2BTFA 4CERA 3VEOA 5BRHA 3SYZA 2Y1JA 3SQ4A 4KREA 4AF1A 4ILGB 3TTDA 1C0FA 3CFRA 4M3XA 4FZZA 2UUBK 1S1XA 3E9OA 1WSEA 3EY1A 3C95A 4JV5K 2Q0RA 1TKXA 3AO3A 1NJWA 3DMJA 4PWDA 2ZJRL 1BA1A 2A5XA 3AGRA 3NE6A 4M3YA 3DOLA 1C1AA 1S3XA 3KWIA 2W42A 3EO3A 4IXCA 1J5EK 1OVQA 4M7XA 5HROA 1LV5A 3HM8A 1N32K 1HX1A 2P9PB 3THVA 1NK4A 1E3MA 4AQYK 2NNWA 3KHYA 1Q9YA 4ID5A 4RW7A 5J2PA 4LFAK 2HHSA 3VEVA 4AHUA 3ZT2A 3D0PA 3P39A 3MDQA 3OY9A 4B9QA 3SJJA 1SS6A 4BGBA 3O80A 5IT9O 3DRRA 4L3QA 2O8EB 1XWLA 4RG8A 3ZT3A 1FKPA 2UUAK 1RTHA 4FJNA 3SMSA 3PIOL 4Z4HA 1TAQA 3ZYYX 5AQPA 5KPRA 2HNZA 4HHTA 2PBDA 3AVMA 1CLQA 3VEZA 4BR7A 2KLAA 2QWNA 1BWFO 3MX2A 1ZXOA 2KKZA 4JI3K 3VPZA 1NGHA 4CEOA 1ZBHA 2G8HA 3ULDA 4DQSA 4LC9B 2ASPA 1WSIA 2HF4A 3K0SA 4M3TA 4BR2A 3TANA 5FPEA 4O0IA 1K6YA 1BHLA 2E5LK 3NH2A 1SUQA 3PO4A 2WFBA 4KTWA 1XNQK 1FW6A 2HW3A 4JK9A 3MAQA 5TKYA 5F2RA 4I2QA 1VQ5N 3MECA 1W9HA 3K57A 1BISA 3T1HK 2OYQA 4FJXA 1KAYA 4KHWA 1S22A 4FCYA 2HBJA 4BREA 4DQPA 2HHQA 2E6LA 1Q81O 4ELVA 1K9MO 4Z0UA 4JD2A 4DTMA 4JKAA 1J5OA 5FPNA 3LDOA 3ZEUA 4AM7A 5DMRA 1OH5A 1HKGA 3PX0A 2O8CB 1C1CA 4OPAA 1EQYA 1WSFA 3CJAA 3KVGA 5CZ1A 3HO1A 3M8PA 3ULEB 3QINA 2YKNA 3A5OC 2QWLA 5AQYA 4BR9A 4CEAA 3OYMA 2QA4N 1D8YA 1T7PA 4C8NA 4KO0A 1B9DA 4H0PA 5C2FA 4CJ3A 1KD1O 3CCUN 4HUGA 3J8AA 2QWPA 5LL6Z 2B4JA 3HK2A 1TYQA 1X9SA 4DR1K 4BG9A 3VA3A 5B8HA 5T7BA 4DTNA 3SUPA 1YJNN 3PX4A 3NGIA 1DKGD 4B8CA 3MWPA 4G9ZA 1NLVA 2P9KA 4H0OA 4WF9L 1EP4A 3VF2A 3NF7A 2O8DB 2VG5A 4AILC 3QIOA 3VQ8A 3WUHA 3DLHA 4GV3A 1JCEA 1VAZA 4BRPA 5AQXA 1LW2A 1RT2A 2ASMA 1VSHA 1W2BM 4X62K 3C7NA 3E01A 4BGAA 3H45C 2NRWA 1Z25A 4JI6K 3D2FB 3ATUA 3NGYA 4HWIA 4JKGB 3BP8A 3IAYA 2QWMA 3VQ4A 3HPHA 3VQPA 2XY8A 3TARA 3EKSA 1RT7A 3UIQA 2KZMA 3O9TA 3KLGA 1HMVA 1TUUA 1WAFA 3CJ7A 1U47A 3IS9A 3JAMO 3P83D 3NVKA 3TSUA 2IS3A 5M1FA 1NKEA 2CGJA 4DV5K 4Q0BA 1LOTB 4DUYK 1NGGA 3O9RA 4FK0A 4N56A 3WNEA 2QXFA 2ZJPL 1Q8IA 1RDWX 4FWPA 4LF5K 5CYQA 4B9MA 2CGLA 4CZLA 3C65A 2VCPA 2G8KA 2NRZA 5J1EA 4BE1A 3S3NA 5DM7L 1IV0A 4FJIA 4WQ4A 4K8XA 5EOYA 2PYJA 4FZYA 3N4PA 4CJSA 1KCFA 4CZGA 4FM1A 1JLBA 1F21A 3VQDA 3OYKA 1VRTA 3KIOA 5AQQA 4F9OA 4DUZK 4OGCA 3SQ0A 1NG9A 1RFQA 3O1BA 4BRCA 5KQDA 2YCHA 4DV1K 5AQLA 3HPOA 1TV6A 2Z1JA 3SV3A 4FXDA 4DQRA 1ITGA 2P9UB 4CECA 2YI1A 2LSNA 4CHZA 4DTSA 3FZKA 2O8BB 5I42A 3TAMA 4DFKA 4F3TA 4WQ4C 4E19A 5D3GA 1MDUB 3CMEN 2VG6A 4B9NA 4KHYA 1NK5A 3ZX3A 2HBLA 1HKCA 2EWSA 3R3LA 3I8BA 4K0KK 1RDBA 3Q7BA 3U3YA 2ZM6K 4Z4IA 4BC2A 3H3NO 5MLCQ 4BE0A 4CZHA 4OLAA 1UA1A 2AP1A 4K41A 4B3OA 2V52B 4DFMA 2P9PA 3F73A 1IG8A 1ZBLA 3HVRA 3V9XA 3O8MA 5AQRA 2IAJA 2YJEA 3WNFA 4FJ7A 3I55N 3LDNA 5E41A 2ZQBA 4ELUA 1M1KO 1JLGA 2OPSA 4FLXA 3A0IX 5C12A 2O8EA 4R79A 1NGJA 1QQCA 5AQFA 3VMFB 2D0AA 4M3ZA 1D9DA 4JRQA 5FPMA 3WXJA 4B9UA 2X74A 4FVUA 2Q31A 4M42A 4QCLA 3TAPA 1HJOA 3LPUA 2IIRA 1C0MA 3K58A 4DU3A 3NMUA 4YOTA 1YJWN 4CF9A 1NGAA 2GX9A 5FROA 5HRNA 3QEVA 2YNIA 2QM1A 4CI6A 4C8MA 3FLCO 1RT3A 4JLHA 4DV6K 3D2EB 3F2KA 5AFUA 2FSKA 3B6PA 4KHSA 1OH6A 2QK9A 3RWUA 3T19A 1XC9A 1SL2A 4LF7K 4A2BA 4CZIA 3NGZA 4OX9K 3SUOA 3DLEA 4NCAA 4DTJA 5FRNA 1OH7A 2HBMA 3O1WA 1MWMA 4XH4A 1WLJA 4DS4A 1TL3A 3P5JA 4B1VA 1NMDA 2Z1HA 1HJRA 4DTXA 4FWKA 4ZTFA 3ZSZA 1WSJA 1YAGA 4CJ7A 3C94A 2AJQA 5CY4A 2GWJA 3O9SA 4H0TB 4NLBA 4EHUA 4H0YB 3RSEB 1HPMA 3SK3A 3O3HA 4JYAK 1BGXT 4FW1A 4FWRA 2GUPA 3SNNA 4OPKA 3THXB 3QEWA 2YV0X 1KRPA 4B3MK 3Q7CA 3AVKA 2D5RA 2P9IB 4K8ZA 2W6LA 4OKJA 3FZFA 1QVFM 2DFFA 4CJ5A 3AVIA 4XH5A 3WQTA 5KPZA 4V19S 2UXBK 4DLEA 1A5VA 1EETA 1H1VA 3AARA 5AQTA 2O8CA 1NBWA 3LDSA 1W0HA 1TAUA 3CC2N 2P9SB 4XIUA 1TKDA 3ULEA 4KHQA 2R7YA 1XNRK 1T03A 3HXMA 1NJZA 2VYPA 5FRMA 3ZETA 3GDQA 1VQPN 3HZ6A 1ZBIA 4OKKA 3H1QA 2WONA 4PA1A 3SPYA 4JK7A 2QW9A 1BA0A 4BRIA 4OLBA 3HP9A 3BZCA 2V51B 3MCPA 2VWKA 1J9AA 4I6MB 2HHVA 4HCCA 4CFCA 2ZWHA 3J7ZO 3CPWM 4IO8A 3DM2A 4EP4A 2PFUA 4CGHA 4BDYA 4F3OA 1QSSA 2D0BA 3QEPA 2UUCK 2RHKA 3K9JA 2IGIA 3I56N 1UA0A 2NRHA 5J2MA 2RN2A 1JCGA 1NK7A 2I7PA 5ADXH 5C0YA 2KHOA 3QNOA 1UAXA 3KLEA 1Z05A 3D2FA 2QI2A 4CJPA 4JKGA 3R6MA 1T44A 4BC4A 3ZT0A 2AA4A 4PY5A 3ATVA 1I3AA 4PHTX 4B9TA 3CJCA 4KHNA 4PL8A 5FLXO 3ZSVA 4CJQA 2YHXA 4DMNA 1S6PA 3TAQA 1KVBA 4CF1A 2HHHK 2F8SA 2A1SA 3A2FA 4CGFA 3CJ1A 3P31A 1IKXA 3DLGA 4H0XB 3OYHA 1V4TA 1C0UA 2O4GA 1LW0A 5AZIB 1SV5A 1D4XA 3THWB 2E1ZA 1E4GT 2ITMA 1YHQN 3OYGA 3EZWA 5KRSA 2VGMA 1BCMA 1X9MA 4B1UB 1JLAA 3WEEA 3G0ZA 4YOUA 3AA5X 3MCAB 4LF8K 4JKEA 4E7HA 3SV4A 3OYEA 1NGFA 4LSLA 4OVLA 4OJRA 1ZBSA 2ASOA 3UKRB 5C2DA 3CM5A 3CFPA 4DQQA 1YJ9N 5J2QA 2G8FA 4H5NA 4DTUA 3DI6A 2P1JA 4CJUA 3K5OA 4GNIA 2O8BA 2FC0A 1WSGA 2YHBA 1M90O 4E7KA 5GIPA 4Z4GA 4B3SK 3QBXA 4DV3K 1RBTA 4BRFA 4EZ9A 3NCIA 3HT3A 3OW2M 4JRPA 1VQMN 1GLEG 4FJGA 1O1WA 3NF8A 4QAGA 3SAGA 3GOIA 4JI4K 4WFNL 3KKSA 4TSXA 3MN7A 5H1SQ 5AQNA 3GG4A 4CEFA 3NH0A 3PLAA 1Q18A 1J53A 2NZTA 4IBNA 4A57A 4CEEA 2XO7A 3NBPA 2IOCA 4LF6K 3OTOK 1LCUA 3TAEA 1KFSA 4CE9A 1ESVA 4CGIA 3LZJA 2E2OA 1X9WA 4ELTA 1WUAA 4M3UA 4O44A 4KHUA 2B6AA 2NRTA 4FOEA 2OA8A 3K5NA 5AQUA 4IG3A 2W41A 4JS5A 4O5BA 1MWKA 1N33K 5ELZA 2P9LB 5CZ2A 3SQ2A 3D2EA 3DJCA 4QS7A 3J80O 5F0XA 4FJJA 2D0PA 4QOZB 3TSPA 2VWBA 3LWMA 4FW2A 4NYNA 3P4IA 3KK2A 3FZHA 3OVNA 4CZKA 4DF4A 4KV8A 3RMDA 3TAFA 2DTUA 4FK4A 4GKJK 4BQLA 4ILHA 3VF6A 3LM9A 3VTHA 5BPNA 1XUPO 5HBMA 4OKEA 2RPIA 4BRAA 3AVGA 4E1NA 4E7JA 2XY6A 5EY4A 5EX5A 3LP2A 2YKMA 3EZ5A 1NJIO 4J2BA 3C6UA 3C6AA 3DXKB 3CQ8A 1NK8A 4BRDA 1VQ4N 3L4IA 4NCGA 3TTFA 4CIGA 4CZFA 3HJFA 4DLGA 1U49A 3VETA 3LDPA 4DF8A 1Q7YO 2NLXA 5LJWA 5I3UA 1RT6A 2HNYA 4E7IA 1OKJA 4FK2A 3SBTA 2P5GA 1VSLA 4NB4A 2BH1A 4C1NK 2I7NA 3QIPA 3QFPA 3MN9A 3WXMB 1JL1A 1G99A 4IEEA 1I39A 4DQ8A 1BOTO 4IFYA 3GE1A 1NM1A 4NXMK 3JS6A 2ZE2A 1GLLO 2V7YA 3KWGA 5BREA 4JK8A 3HTVA 5KGXA 2IVOA 3MX5A 3LPTA 1BG3A 1YUWA 4IJNA 4E7LA 1ZBUA 3VF4A 1TKTA 2HMIA 3HSTB 1NJYA 4C8OA 5KPTA 3IUCA 4I6MA 1EX4A 3EKUA 3VEWA 4DSIA 4B1ZA 3ALYA 1K8KB 2GUIA 5JS2A 1MA9B 4A61A 3PSFA 5J2NA 4GV9A 1NGIA 3U8XA 1NGBA 5KRTA 4KTQA 4U7BA 4DWIA 1N36K 5C42A 4FWOA 4FM0A 4FVMA 4M63C 4CJ4A 1LWEA 1BQNA 2QKBA 1S1WA 1NU0A 4O55A 1OVYA 3HRGA 4O0JA 3GBTA 1T05A 1IBMK 4CBWA 2A41A 5BN8A 3KLFA 1K8AO 5AQGA 3PV8A 2E8AA 3WT0A 3OYDA 1KLNA 4DV4K 2E2NA 2GEMA 3HL8A 3JXUA 4B08A 1KXPA 4WFBL 4CESA 3IG1A 4E1JA 4JI7K 4FLZA 3CM6A 1SL0A 4N5SA 3PO5A 1YTAA 2ZGYA 3OBWA 4IG0A 4GVMA 5EU7A 2PYLA 5AZIA 4CK2A 3BF1A 3VEYA 3SPZA 3THWA 4RW6A 5KQ8A 2OPQA 3UKUA 4YOXA 3VQEA 1RCHA 5CHIA 3VOVA 3VENA 2H3GX 3QO9A 3RRHA 3CPEA 1QZ5A 4JKCA 1ASVA 4EZ6A 2F9TA 3O9QA 3OYJA 4DSKA 1U2VA 1RDCA 3DXMB 4YHHK 1RBVA 1T6CA 1IKYA 4BDZA 2ZJQL 4DSFA 1QVGM 2G8VA 1YIJN 2FLOA 4B3RK 4DHYA 3I0RA 3J7AP 4A2AA 1GLBG 1Z26A 4B1XB 3EYZA 4CIEA 5JVGL 3L2WA 1TL1A 3S3OA 5AZJB 4FJLA 3RRGA 1DGKN 5E84A 1GLAG 5LJVA 4IOAL 3IKMA 4DTOA 4F4KA 1HNWK 3VN5A 3OYBA 4Z4CA 3EEQA 1BI4B 1S5JA 1NGDA 1KAXA 3ZT1A 2W40A 4BR0A 4Z4EA 3QICA 4CBUA 4QS9A 1KLMA 3WQUA 1IO2A 4FJHA 2ZGZA 3ZX0A 3PUFA 1NOYA 3KTQA 4KI4A
chains in the Genus database with same CATH topology
1A5VA 1EETA 3AVLA 4NCBA 1S6QA 4OPJA 3I8DA 3VQ9A 3VQCA 1W0HA 3ZSWA 3LDSA 3JYTA 4Z4FA 1TAUA 3ASMA 1JLFA 3H08A 4AHCA 4XIUA 1TKDA 1ASWA 4FJ9A 4KHQA 4C8LA 2R7YA 4F2SA 3LZIA 1T03A 3HXMA 4AHRA 4KAZA 1NJZA 5FRMA 1ASUA 3V81A 1VSIA 3M8SA 1QS4A 1HYVA 4M3RA 4IDKA 3WNHA 1ZBIA 2WOMA 1FKOA 4OKKA 3ZSYA 4W5RA 4KRFA 4PUOA 3NF6A 2WONA 4CJLA 2Z1IA 4PA1A 2P51A 3SPYA 3MXIA 4HUFA 2B5JA 5KTQA 4OLBA 3O4NA 3HP9A 2DY4A 2HHXA 1BCOA 1RBRA 1C1BA 4YNQA 1RILA 4CHQA 1JLEA 1IKVA 2E6MA 2JGUA 2VWKA 3AA2A 1J9AA 4CJTA 4B9LA 1S9EA 3AA4A 1LAWA 1RNHA 3AVAA 3VQ5A 3VQQA 2PZSA 2HHVA 1B92A 4HCCA 1VK0A 1CXUA 3QESA 4CFCA 4M45A 3O3FA 1JL2A 4UQGA 4CERA 4Y1CA 4CEQA 3SYZA 2Y1JA 3SQ4A 3RR7A 2OZMA 4KREA 3DM2A 2EX3A 4EP4A 3CFRA 4FZZA 4WE1A 4CGHA 4M3XA 1VSMA 4BDYA 1S1XA 2KQ2A 1WSEA 3EY1A 4M3WA 3AVBA 4FJ8A 2VG7A 3C95A 1QSSA 4F3OA 1VSFA 3VQBA 2D0BA 1TKXA 3AO3A 1NJWA 3DMJA 3QEPA 4PWDA 2OPRA 2IGIA 3CG7A 1UA0A 3AVJA 1BIZA 5J2MA 3NE6A 4M3YA 2HVHA 3DOLA 1C1AA 2E4LA 2RN2A 1NK7A 2W42A 4N76A 3QNOA 1UAXA 2OZSA 3KLEA 2VWJA 3OS2A 3OYAA 4CJPA 4KTZA 5HROA 1LV5A 1QSLA 1LWFA 1Y97A 3QLHA 3THVA 1CXQA 3ZT0A 4QCLA 1NK4A 2EHGA 4PY5A 1I3AA 1QSYA 4FZXC 1Q9YA 4FLTA 4B9TA 1YT3A 1IH7A 4KHNA 1RDAA 3KD1E 4ID5A 4RW7A 5J2PA 4L8RB 2HVIA 2HHSA 4I9QA 3ZSVA 4CJQA 4AHUA 4DMNA 1S6PA 3ZT2A 3D0PA 3TAQA 1KVBA 4CF1A 2F8SA 2F96A 2A1SA 3LAMA 3OY9A 1WN7A 1HRHA 4DS5A 3SJJA 3A2FA 3DRRA 4CGFA 1IKXA 1XWLA 3K59A 3AVHA 4RG8A 3ZT3A 3DLGA 3ZSRA 1GOBA 3OYHA 3V6DA 1C0UA 1FKPA 1RTHA 2O4GA 1LW0A 1SV5A 4FJNA 3MXMA 3RR8A 4MQ3A 3V1OA 1XHZA 1NKBA 2DFHA 1RTJA 3LANA 4Z4HA 1GOCA 3MXJA 1TAQA 4HVJA 1U45A 3CYMA 4N41A 3OYGA 5KRSA 2HNZA 4HHTA 3AA3A 3K2PA 1BCMA 3AVMA 1X9MA 1CLQA 3OYIA 5KGWA 3AVNA 1JLAA 3V1RA 4CJRA 5KI6A 1JLQA 3G0ZA 3AA5X 4CEOA 1ZBHA 4CF2A 1REVA 4FLVA 4E7HA 2G8HA 3ULDA 3SV4A 3OYEA 4DQSA 1L3UA 2KW4A 2KZZA 1RBUA 1QE1A 1WSIA 2YNFA 2BDPA 4LSLA 4OVLA 4M3TA 4OJRA 3TANA 3CM5A 3CFPA 4DQQA 2OPPA 5J2QA 4J2DA 2G8FA 1HQUA 1HNIA 4O0IA 3M8RA 1K6YA 1BHLA 4W5OA 1X1PA 1BIUA 3DI6A 4DTUA 2P1JA 1VRUA 4CJUA 3NH2A 5SWMA 4E89A 1SUQA 3K5OA 1L5UA 3ZCMA 1SL1A 3PO4A 3ISNC 4KTWA 1HQEA 1D9FA 1EXQA 2FC0A 4PQUA 1VSKA 2HW3A 4I9LA 4W5NA 1WSGA 3U3GA 3MAQA 1JXEA 2YHBA 3OYCA 4I2QA 4E7KA 5CYMA 3MECA 4Z4GA 1HNVA 1W9HA 1QTMA 4RW9A 1ZYQA 3B6OA 3K57A 1BISA 2OYQA 1RBTA 4IKFA 4G1QA 4CGJA 1NK6A 1JLCA 4GW6A 2KTQA 3I0SA 4EZ9A 3NCIA 4FJXA 3HT3A 4KHWA 4FCYA 2HHWA 4CEBA 3PX6A 4JRPA 1T8EA 2F8TA 4LH5A 4KKOA 4FJGA 1C0TA 1O1WA 3NF8A 4QAGA 2E6LA 4DQPA 2HHQA 5DK5A 4ELVA 3TABA 3KKSA 1VSDA 2ZD1A 4TSXA 3SUQA 1YTUA 1C6VA 4DFJA 4Z0UA 4DTMA 4FM2A 5SZTA 4GMJB 1J5OA 3MEEA 4CEFA 1UOCA 2JLEA 1XHXA 3NH0A 5DMRA 2I5JA 4DSJA 1J53A 1NJXA 4IBNA 3PX0A 4CHOA 1C1CA 4CEEA 2XO7A 5CZ1A 1WSFA 3NBPA 2IOCA 3HO1A 3M8PA 1RT1A 2NUBA 1U4BA 3QINA 2YKNA 2QKKA 1DTTA 3OYMA 3T3FA 1D8YA 3LALA 4CEAA 1T7PA 1LWCA 4O4GA 4DG1A 2X6NA 3V9WA 4C8NA 4KO0A 3TAEA 1KFSA 4CE9A 1B9DA 3L3UA 4CGIA 3V9ZA 2ITGA 1B9FA 3LZJA 1RBSA 1L3TA 1X9WA 4ELTA 4CJ3A 4M3UA 1UWBA 1KTQA 4O44A 4KHUA 4HUGA 3HVTA 2B6AA 5HRPA 3QERA 3O3GA 3DLRA 2B4JA 3NFAA 3NH1A 3K5NA 2OA8A 5HRRA 4IG3A 4CK3A 3HK2A 3U6FA 1EKEA 5C24A 4CFBA 1X9SA 4JS5A 1XI1A 4O5BA 2FBYA 3KLHA 3V9UA 3VA3A 4EP5A 5T7BA 4DTNA 3OJSA 5CZ2A 2IC3A 3OYLA 3MEGA 4OGEA 3SQ2A 3SUPA 5HP1A 4F2RA 1U48A 3VQAA 1Q9XA 3PX4A 1MU2A 3NGIA 4RW8A 4FJJA 4QOZB 4B8CA 2KFNA 4C8KA 1A5XA 3AVFA 3AO5A 3LWMA 4FW2A 4DSEA 4NYNA 1EP4A 3KK2A 4LH4A 3OVNA 4DF4A 3V4IA 3NF7A 4KV8A 4FLUA 3TAFA 3RMDA 2DTUA 2VG5A 1WSHA 3G10A 4AILC 1NK9A 3QIOA 4FK4A 3VQ8A 4JS4A 1L3VA 3DLHA 1LW2A 5HBMA 1RT2A 4OKEA 2RPIA 1VSHA 1YVUA 3AVGA 4E1NA 4M41A 4E7JA 2XY6A 4DQIA 4Y1DA 1VSJA 3LP2A 2YKMA 4H4MA 3E01A 1WAJA 2RKIA 3C6UA 3EZ5A 1KFDA 4J2BA 5FDLA 1Z25A 4BE2A 3CQ8A 3AO2A 3NGYA 1NK8A 4CFDA 3AO1A 3P1GA 2BANA 4CEDA 1L3SA 4CK1A 4E0DA 1RDDA 3IAYA 1VSEA 3VA0A 3ZSOA 3VQ4A 4NCGA 1G15A 3HPHA 3L2UA 4FJKA 1JKHA 3VQPA 3OS0A 2XY8A 3NDKA 4CIGA 1R0AA 3TARA 3HJFA 1BI4A 1RT7A 3KK1A 4DLGA 2GV9A 4DTRA 1U49A 2A1RA 3L3VA 3LWLA 3UIQA 2KZMA 4IFVA 3KLGA 3QNNA 1N5YA 3RMBA 4CHYA 1HMVA 1WAFA 3C6TA 4DF8A 1U47A 3IS9A 1ZBFA 3P83D 3LAKA 4DFPA 1BL3A 2IS3A 5I3UA 1TK8A 1RT6A 2HNYA 4CF0A 4E7IA 1NKEA 2BGGA 4FK2A 2HB5A 2X78A 4Q0BA 1NKCA 3K5MA 1A5WA 2P5GA 1VSLA 4CF8A 4FK0A 1RT5A 3QIPA 2RF2A 2FBVA 3LP0A 4N47A 4AH9A 2FBXA 4I2PA 1NK0A 2KFZA 4N56A 3WNEA 2QXFA 4CHPA 1Q8IA 3KD5E 1SKRA 1JL1A 3F9KA 5CYQA 3DOKA 1I39A 4B9MA 2Z1GA 2G8IA 3L2QA 2BE2A 4AHVA 2G8KA 1N6QA 4IFYA 5J1EA 2HHUA 3ZT4A 4B9VA 1HYZA 3CFOA 4CIFA 4BE1A 2ZE2A 3S3NA 4FLYA 3PY8A 4R5PA 1TGOA 1BQMA 4FJIA 5JS1A 5KGXA 3L2RA 1QHTA 3LPTA 1JXBA 4E7LA 4K8XA 1ZBUA 5C25A 4Q5VA 4RW4A 2PYJA 4FZYA 1TKTA 4CJSA 1KCFA 2HMIA 4FJ5A 2ATQA 4FM1A 3HSTB 1JLBA 1F21A 3VQDA 4CHNA 3OYKA 2XHBA 1NJYA 4C8OA 1VRTA 3KIOA 4DSIA 1EX4A 2GBZA 1S1UA 3LP1A 4OGCA 3SQ0A 3DYAA 2YNHA 3D45A 3ALYA 3HPOA 1TV6A 1HPZA 2GUIA 2Z1JA 4CJKA 4FLWA 3SV3A 4FXDA 1S1VA 5JS2A 1ITGA 3V1QA 4DQRA 4CECA 4CHZA 2LSNA 4YFUA 4DTSA 5I42A 2D0CA 3KK3A 3TI0A 3TAMA 4DFKA 4F3TA 5J2NA 3WNGA 4E19A 5D3GA 5KRTA 4KTQA 4LD0A 3QETA 4ZHRA 3SUNA 4AHTA 2VG6A 3MEDA 4B9NA 4DWIA 5C42A 4W5QA 3DLKA 3O4QA 4FM0A 2XY7A 1NK5A 4KHYA 4FVMA 4HTUA 1RDBA 3HM9A 4LSNA 4CJWA 3U3YA 4CJ4A 1LWEA 3OYFA 4J2EA 1BQNA 4Z4IA 2QKBA 1S1WA 1DLOA 4MFBA 3RTVA 1DTQA 4O55A 4BE0A 4OLAA 1UA1A 3VQ6A 3L8BA 4B3OA 4DFMA 4O0JA 1CZBA 1T05A 1WNSA 3KJVA 3F73A 2P5OA 1ZBLA 3HVRA 3V9XA 3TAGA 2HHTA 2PY5A 3KLFA 1KSPA 2IAJA 3HYFA 3PV8A 3WNFA 3OYDA 4F8RA 2DFEA 1KLNA 4FJ7A 2Y1IA 4H4OA 5E41A 4W5TA 2ZQBA 4ELUA 1JLGA 2OPSA 3HL8A 4DU4A 4CGGA 4FLXA 4B08A 4DTPA 1CZ9A 3AV9A 3DRSA 4CESA 3IG1A 1NOZA 4DU1A 2X6SA 3BDPA 1RT4A 4FLZA 3CM6A 3JSMA 1SL0A 4N5SA 3AVCA 1YTAA 3PO5A 4CGDA 4HUEA 1J54A 3TR8A 3TWHA 1QQCA 4GVMA 1LAVA 2D0AA 4IG0A 1D5AA 5EU7A 5K14A 4CK2A 4JRQA 1D9DA 2PYLA 3IRXA 3M8QA 3SPZA 4E1MA 4RW6A 4B9UA 2X74A 2OPQA 3NAEA 3DRPA 2IDOA 4CJVA 3SZ2A 4M42A 1TKZA 1RCHA 2Q3SA 3VQEA 3LPUA 3SQ1A 3OYNA 1C0MA 3K58A 4DU3A 3TAPA 4J2AA 3QO9A 3RRHA 1TK0A 4CF9A 4HCBA 3S3MA 1ASVA 4EZ6A 3ZSQA 1S1TA 2ETJA 4BWJA 5FROA 5HRNA 3QEVA 2YNIA 3LP3A 3OYJA 3L2VA 4KI6A 1U04A 4C8MA 1RT3A 4JLHA 4DSKA 1RDCA 3B6PA 4KHSA 1RBVA 3RWUA 2QK9A 3T19A 3S9HA 1XC9A 1KVAA 5HRSA 4CEZA 1IKYA 2XRIA 1SL2A 4BDZA 4DSFA 2FBTA 3NGZA 2G8VA 4DSLA 3SUOA 2G8UA 2O4IA 3I0RA 3DLEA 3HPGA 4ID1A 4NCAA 1RTIA 1GOAA 4CFAA 4DTJA 3SCXA 4BWMA 5FRNA 3ZSXA 4KFBA 4ICLA 4H8KA 3HP6A 1Z26A 1WLJA 4E3SA 3EYZA 1TL3A 4DS4A 3NF9A 3P5JA 3V9SA 4CIEA 4BACA 4FJMA 2Z1HA 1HJRA 4DTXA 1HYSA 4KB1A 4ZTFA 4M3ZA 3L2WA 2G8WA 1TL1A 3S3OA 3ZSZA 3K5LA 1WSJA 3DLBA 3ITHA 3OS1A 4FJLA 3RRGA 2HNDA 3C94A 2AJQA 2YHAA 5CY4A 5HLFA 1RTDA 1TVRA 1S9GA 4DTOA 4F4KA 4CJEA 1SKSA 3T1AA 3NHGA 3AO4A 4KPYA 3KKRA 4CJFA 3O3HA 3QEIA 3RMAA 1IKWA 1BGXT 4FW1A 4I7FA 4LY7A 3VN5A 3OYBA 3QEXA 4B9SA 3VQ7A 4Z4CA 2XY5A 1BI4B 4NYFA 1S5JA 3SNNA 1FK9A 1FXXA 3ZT1A 4AHSA 4OPKA 3OJUA 2YV0X 3QEWA 1SKWA 1KRPA 4BDPA 4Z4EA 1TK5A 1KVCA 2D5RA 3AVKA 3RMCA 4K8ZA 4OKJA 4ZTJA 2YNGA 2DFFA 1KLMA 1IO2A 4FJHA 4B8AB 4CJ5A 3AVIA 1IG9A 4CCHA 4KB0A 3BGRA 3SI6A 3PUFA 4FYDA 3FFIA 1NOYA 3KTQA 4KI4A 3KLIA 4DLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5V A;  1EET A;  3AVL A;  4NCB A;  1S6Q A;  4OPJ A;  3I8D A;  3VQ9 A;  3VQC A;  1W0H A;  3ZSW A;  3LDS A;  3JYT A;  4Z4F A;  1TAU A;  3ASM A;  1JLF A;  3H08 A;  4AHC A;  4XIU A;  1TKD A;  1ASW A;  4FJ9 A;  4KHQ A;  4C8L A;  2R7Y A;  4F2S A;  3LZI A;  1T03 A;  3HXM A;  4AHR A;  4KAZ A;  1NJZ A;  5FRM A;  1ASU A;  3V81 A;  1VSI A;  3M8S A;  1QS4 A;  1HYV A;  4M3R A;  4IDK A;  3WNH A;  1ZBI A;  2WOM A;  1FKO A;  4OKK A;  3ZSY A;  4W5R A;  4KRF A;  4PUO A;  3NF6 A;  2WON A;  4CJL A;  2Z1I A;  4PA1 A;  2P51 A;  3SPY A;  3MXI A;  4HUF A;  2B5J A;  5KTQ A;  4OLB A;  3O4N A;  3HP9 A;  2DY4 A;  2HHX A;  1BCO A;  1RBR A;  1C1B A;  4YNQ A;  1RIL A;  4CHQ A;  1JLE A;  1IKV A;  2E6M A;  2JGU A;  2VWK A;  3AA2 A;  1J9A A;  4CJT A;  4B9L A;  1S9E A;  3AA4 A;  1LAW A;  1RNH A;  3AVA A;  3VQ5 A;  3VQQ A;  2PZS A;  2HHV A;  1B92 A;  4HCC A;  1VK0 A;  1CXU A;  3QES A;  4CFC A;  4M45 A;  3O3F A;  1JL2 A;  4UQG A;  4CER A;  4Y1C A;  4CEQ A;  3SYZ A;  2Y1J A;  3SQ4 A;  3RR7 A;  2OZM A;  4KRE A;  3DM2 A;  2EX3 A;  4EP4 A;  3CFR A;  4FZZ A;  4WE1 A;  4CGH A;  4M3X A;  1VSM A;  4BDY A;  1S1X A;  2KQ2 A;  1WSE A;  3EY1 A;  4M3W A;  3AVB A;  4FJ8 A;  2VG7 A;  3C95 A;  1QSS A;  4F3O A;  1VSF A;  3VQB A;  2D0B A;  1TKX A;  3AO3 A;  1NJW A;  3DMJ A;  3QEP A;  4PWD A;  2OPR A;  2IGI A;  3CG7 A;  1UA0 A;  3AVJ A;  1BIZ A;  5J2M A;  3NE6 A;  4M3Y A;  2HVH A;  3DOL A;  1C1A A;  2E4L A;  2RN2 A;  1NK7 A;  2W42 A;  4N76 A;  3QNO A;  1UAX A;  2OZS A;  3KLE A;  2VWJ A;  3OS2 A;  3OYA A;  4CJP A;  4KTZ A;  5HRO A;  1LV5 A;  1QSL A;  1LWF A;  1Y97 A;  3QLH A;  3THV A;  1CXQ A;  3ZT0 A;  4QCL A;  1NK4 A;  2EHG A;  4PY5 A;  1I3A A;  1QSY A;  4FZX C;  1Q9Y A;  4FLT A;  4B9T A;  1YT3 A;  1IH7 A;  4KHN A;  1RDA A;  3KD1 E;  4ID5 A;  4RW7 A;  5J2P A;  4L8R B;  2HVI A;  2HHS A;  4I9Q A;  3ZSV A;  4CJQ A;  4AHU A;  4DMN A;  1S6P A;  3ZT2 A;  3D0P A;  3TAQ A;  1KVB A;  4CF1 A;  2F8S A;  2F96 A;  2A1S A;  3LAM A;  3OY9 A;  1WN7 A;  1HRH A;  4DS5 A;  3SJJ A;  3A2F A;  3DRR A;  4CGF A;  1IKX A;  1XWL A;  3K59 A;  3AVH A;  4RG8 A;  3ZT3 A;  3DLG A;  3ZSR A;  1GOB A;  3OYH A;  3V6D A;  1C0U A;  1FKP A;  1RTH A;  2O4G A;  1LW0 A;  1SV5 A;  4FJN A;  3MXM A;  3RR8 A;  4MQ3 A;  3V1O A;  1XHZ A;  1NKB A;  2DFH A;  1RTJ A;  3LAN A;  4Z4H A;  1GOC A;  3MXJ A;  1TAQ A;  4HVJ A;  1U45 A;  3CYM A;  4N41 A;  3OYG A;  5KRS A;  2HNZ A;  4HHT A;  3AA3 A;  3K2P A;  1BCM A;  3AVM A;  1X9M A;  1CLQ A;  3OYI A;  5KGW A;  3AVN A;  1JLA A;  3V1R A;  4CJR A;  5KI6 A;  1JLQ A;  3G0Z A;  3AA5 X;  4CEO A;  1ZBH A;  4CF2 A;  1REV A;  4FLV A;  4E7H A;  2G8H A;  3ULD A;  3SV4 A;  3OYE A;  4DQS A;  1L3U A;  2KW4 A;  2KZZ A;  1RBU A;  1QE1 A;  1WSI A;  2YNF A;  2BDP A;  4LSL A;  4OVL A;  4M3T A;  4OJR A;  3TAN A;  3CM5 A;  3CFP A;  4DQQ A;  2OPP A;  5J2Q A;  4J2D A;  2G8F A;  1HQU A;  1HNI A;  4O0I A;  3M8R A;  1K6Y A;  1BHL A;  4W5O A;  1X1P A;  1BIU A;  3DI6 A;  4DTU A;  2P1J A;  1VRU A;  4CJU A;  3NH2 A;  5SWM A;  4E89 A;  1SUQ A;  3K5O A;  1L5U A;  3ZCM A;  1SL1 A;  3PO4 A;  3ISN C;  4KTW A;  1HQE A;  1D9F A;  1EXQ A;  2FC0 A;  4PQU A;  1VSK A;  2HW3 A;  4I9L A;  4W5N A;  1WSG A;  3U3G A;  3MAQ A;  1JXE A;  2YHB A;  3OYC A;  4I2Q A;  4E7K A;  5CYM A;  3MEC A;  4Z4G A;  1HNV A;  1W9H A;  1QTM A;  4RW9 A;  1ZYQ A;  3B6O A;  3K57 A;  1BIS A;  2OYQ A;  1RBT A;  4IKF A;  4G1Q A;  4CGJ A;  1NK6 A;  1JLC A;  4GW6 A;  2KTQ A;  3I0S A;  4EZ9 A;  3NCI A;  4FJX A;  3HT3 A;  4KHW A;  4FCY A;  2HHW A;  4CEB A;  3PX6 A;  4JRP A;  1T8E A;  2F8T A;  4LH5 A;  4KKO A;  4FJG A;  1C0T A;  1O1W A;  3NF8 A;  4QAG A;  2E6L A;  4DQP A;  2HHQ A;  5DK5 A;  4ELV A;  3TAB A;  3KKS A;  1VSD A;  2ZD1 A;  4TSX A;  3SUQ A;  1YTU A;  1C6V A;  4DFJ A;  4Z0U A;  4DTM A;  4FM2 A;  5SZT A;  4GMJ B;  1J5O A;  3MEE A;  4CEF A;  1UOC A;  2JLE A;  1XHX A;  3NH0 A;  5DMR A;  2I5J A;  4DSJ A;  1J53 A;  1NJX A;  4IBN A;  3PX0 A;  4CHO A;  1C1C A;  4CEE A;  2XO7 A;  5CZ1 A;  1WSF A;  3NBP A;  2IOC A;  3HO1 A;  3M8P A;  1RT1 A;  2NUB A;  1U4B A;  3QIN A;  2YKN A;  2QKK A;  1DTT A;  3OYM A;  3T3F A;  1D8Y A;  3LAL A;  4CEA A;  1T7P A;  1LWC A;  4O4G A;  4DG1 A;  2X6N A;  3V9W A;  4C8N A;  4KO0 A;  3TAE A;  1KFS A;  4CE9 A;  1B9D A;  3L3U A;  4CGI A;  3V9Z A;  2ITG A;  1B9F A;  3LZJ A;  1RBS A;  1L3T A;  1X9W A;  4ELT A;  4CJ3 A;  4M3U A;  1UWB A;  1KTQ A;  4O44 A;  4KHU A;  4HUG A;  3HVT A;  2B6A A;  5HRP A;  3QER A;  3O3G A;  3DLR A;  2B4J A;  3NFA A;  3NH1 A;  3K5N A;  2OA8 A;  5HRR A;  4IG3 A;  4CK3 A;  3HK2 A;  3U6F A;  1EKE A;  5C24 A;  4CFB A;  1X9S A;  4JS5 A;  1XI1 A;  4O5B A;  2FBY A;  3KLH A;  3V9U A;  3VA3 A;  4EP5 A;  5T7B A;  4DTN A;  3OJS A;  5CZ2 A;  2IC3 A;  3OYL A;  3MEG A;  4OGE A;  3SQ2 A;  3SUP A;  5HP1 A;  4F2R A;  1U48 A;  3VQA A;  1Q9X A;  3PX4 A;  1MU2 A;  3NGI A;  4RW8 A;  4FJJ A;  4QOZ B;  4B8C A;  2KFN A;  4C8K A;  1A5X A;  3AVF A;  3AO5 A;  3LWM A;  4FW2 A;  4DSE A;  4NYN A;  1EP4 A;  3KK2 A;  4LH4 A;  3OVN A;  4DF4 A;  3V4I A;  3NF7 A;  4KV8 A;  4FLU A;  3TAF A;  3RMD A;  2DTU A;  2VG5 A;  1WSH A;  3G10 A;  4AIL C;  1NK9 A;  3QIO A;  4FK4 A;  3VQ8 A;  4JS4 A;  1L3V A;  3DLH A;  1LW2 A;  5HBM A;  1RT2 A;  4OKE A;  2RPI A;  1VSH A;  1YVU A;  3AVG A;  4E1N A;  4M41 A;  4E7J A;  2XY6 A;  4DQI A;  4Y1D A;  1VSJ A;  3LP2 A;  2YKM A;  4H4M A;  3E01 A;  1WAJ A;  2RKI A;  3C6U A;  3EZ5 A;  1KFD A;  4J2B A;  5FDL A;  1Z25 A;  4BE2 A;  3CQ8 A;  3AO2 A;  3NGY A;  1NK8 A;  4CFD A;  3AO1 A;  3P1G A;  2BAN A;  4CED A;  1L3S A;  4CK1 A;  4E0D A;  1RDD A;  3IAY A;  1VSE A;  3VA0 A;  3ZSO A;  3VQ4 A;  4NCG A;  1G15 A;  3HPH A;  3L2U A;  4FJK A;  1JKH A;  3VQP A;  3OS0 A;  2XY8 A;  3NDK A;  4CIG A;  1R0A A;  3TAR A;  3HJF A;  1BI4 A;  1RT7 A;  3KK1 A;  4DLG A;  2GV9 A;  4DTR A;  1U49 A;  2A1R A;  3L3V A;  3LWL A;  3UIQ A;  2KZM A;  4IFV A;  3KLG A;  3QNN A;  1N5Y A;  3RMB A;  4CHY A;  1HMV A;  1WAF A;  3C6T A;  4DF8 A;  1U47 A;  3IS9 A;  1ZBF A;  3P83 D;  3LAK A;  4DFP A;  1BL3 A;  2IS3 A;  5I3U A;  1TK8 A;  1RT6 A;  2HNY A;  4CF0 A;  4E7I A;  1NKE A;  2BGG A;  4FK2 A;  2HB5 A;  2X78 A;  4Q0B A;  1NKC A;  3K5M A;  1A5W A;  2P5G A;  1VSL A;  4CF8 A;  4FK0 A;  1RT5 A;  3QIP A;  2RF2 A;  2FBV A;  3LP0 A;  4N47 A;  4AH9 A;  2FBX A;  4I2P A;  1NK0 A;  2KFZ A;  4N56 A;  3WNE A;  2QXF A;  4CHP A;  1Q8I A;  3KD5 E;  1SKR A;  1JL1 A;  3F9K A;  5CYQ A;  3DOK A;  1I39 A;  4B9M A;  2Z1G A;  2G8I A;  3L2Q A;  2BE2 A;  4AHV A;  2G8K A;  1N6Q A;  4IFY A;  5J1E A;  2HHU A;  3ZT4 A;  4B9V A;  1HYZ A;  3CFO A;  4CIF A;  4BE1 A;  2ZE2 A;  3S3N A;  4FLY A;  3PY8 A;  4R5P A;  1TGO A;  1BQM A;  4FJI A;  5JS1 A;  5KGX A;  3L2R A;  1QHT A;  3LPT A;  1JXB A;  4E7L A;  4K8X A;  1ZBU A;  5C25 A;  4Q5V A;  4RW4 A;  2PYJ A;  4FZY A;  1TKT A;  4CJS A;  1KCF A;  2HMI A;  4FJ5 A;  2ATQ A;  4FM1 A;  3HST B;  1JLB A;  1F21 A;  3VQD A;  4CHN A;  3OYK A;  2XHB A;  1NJY A;  4C8O A;  1VRT A;  3KIO A;  4DSI A;  1EX4 A;  2GBZ A;  1S1U A;  3LP1 A;  4OGC A;  3SQ0 A;  3DYA A;  2YNH A;  3D45 A;  3ALY A;  3HPO A;  1TV6 A;  1HPZ A;  2GUI A;  2Z1J A;  4CJK A;  4FLW A;  3SV3 A;  4FXD A;  1S1V A;  5JS2 A;  1ITG A;  3V1Q A;  4DQR A;  4CEC A;  4CHZ A;  2LSN A;  4YFU A;  4DTS A;  5I42 A;  2D0C A;  3KK3 A;  3TI0 A;  3TAM A;  4DFK A;  4F3T A;  5J2N A;  3WNG A;  4E19 A;  5D3G A;  5KRT A;  4KTQ A;  4LD0 A;  3QET A;  4ZHR A;  3SUN A;  4AHT A;  2VG6 A;  3MED A;  4B9N A;  4DWI A;  5C42 A;  4W5Q A;  3DLK A;  3O4Q A;  4FM0 A;  2XY7 A;  1NK5 A;  4KHY A;  4FVM A;  4HTU A;  1RDB A;  3HM9 A;  4LSN A;  4CJW A;  3U3Y A;  4CJ4 A;  1LWE A;  3OYF A;  4J2E A;  1BQN A;  4Z4I A;  2QKB A;  1S1W A;  1DLO A;  4MFB A;  3RTV A;  1DTQ A;  4O55 A;  4BE0 A;  4OLA A;  1UA1 A;  3VQ6 A;  3L8B A;  4B3O A;  4DFM A;  4O0J A;  1CZB A;  1T05 A;  1WNS A;  3KJV A;  3F73 A;  2P5O A;  1ZBL A;  3HVR A;  3V9X A;  3TAG A;  2HHT A;  2PY5 A;  3KLF A;  1KSP A;  2IAJ A;  3HYF A;  3PV8 A;  3WNF A;  3OYD A;  4F8R A;  2DFE A;  1KLN A;  4FJ7 A;  2Y1I A;  4H4O A;  5E41 A;  4W5T A;  2ZQB A;  4ELU A;  1JLG A;  2OPS A;  3HL8 A;  4DU4 A;  4CGG A;  4FLX A;  4B08 A;  4DTP A;  1CZ9 A;  3AV9 A;  3DRS A;  4CES A;  3IG1 A;  1NOZ A;  4DU1 A;  2X6S A;  3BDP A;  1RT4 A;  4FLZ A;  3CM6 A;  3JSM A;  1SL0 A;  4N5S A;  3AVC A;  1YTA A;  3PO5 A;  4CGD A;  4HUE A;  1J54 A;  3TR8 A;  3TWH A;  1QQC A;  4GVM A;  1LAV A;  2D0A A;  4IG0 A;  1D5A A;  5EU7 A;  5K14 A;  4CK2 A;  4JRQ A;  1D9D A;  2PYL A;  3IRX A;  3M8Q A;  3SPZ A;  4E1M A;  4RW6 A;  4B9U A;  2X74 A;  2OPQ A;  3NAE A;  3DRP A;  2IDO A;  4CJV A;  3SZ2 A;  4M42 A;  1TKZ A;  1RCH A;  2Q3S A;  3VQE A;  3LPU A;  3SQ1 A;  3OYN A;  1C0M A;  3K58 A;  4DU3 A;  3TAP A;  4J2A A;  3QO9 A;  3RRH A;  1TK0 A;  4CF9 A;  4HCB A;  3S3M A;  1ASV A;  4EZ6 A;  3ZSQ A;  1S1T A;  2ETJ A;  4BWJ A;  5FRO A;  5HRN A;  3QEV A;  2YNI A;  3LP3 A;  3OYJ A;  3L2V A;  4KI6 A;  1U04 A;  4C8M A;  1RT3 A;  4JLH A;  4DSK A;  1RDC A;  3B6P A;  4KHS A;  1RBV A;  3RWU A;  2QK9 A;  3T19 A;  3S9H A;  1XC9 A;  1KVA A;  5HRS A;  4CEZ A;  1IKY A;  2XRI A;  1SL2 A;  4BDZ A;  4DSF A;  2FBT A;  3NGZ A;  2G8V A;  4DSL A;  3SUO A;  2G8U A;  2O4I A;  3I0R A;  3DLE A;  3HPG A;  4ID1 A;  4NCA A;  1RTI A;  1GOA A;  4CFA A;  4DTJ A;  3SCX A;  4BWM A;  5FRN A;  3ZSX A;  4KFB A;  4ICL A;  4H8K A;  3HP6 A;  1Z26 A;  1WLJ A;  4E3S A;  3EYZ A;  1TL3 A;  4DS4 A;  3NF9 A;  3P5J A;  3V9S A;  4CIE A;  4BAC A;  4FJM A;  2Z1H A;  1HJR A;  4DTX A;  1HYS A;  4KB1 A;  4ZTF A;  4M3Z A;  3L2W A;  2G8W A;  1TL1 A;  3S3O A;  3ZSZ A;  3K5L A;  1WSJ A;  3DLB A;  3ITH A;  3OS1 A;  4FJL A;  3RRG A;  2HND A;  3C94 A;  2AJQ A;  2YHA A;  5CY4 A;  5HLF A;  1RTD A;  1TVR A;  1S9G A;  4DTO A;  4F4K A;  4CJE A;  1SKS A;  3T1A A;  3NHG A;  3AO4 A;  4KPY A;  3KKR A;  4CJF A;  3O3H A;  3QEI A;  3RMA A;  1IKW A;  1BGX T;  4FW1 A;  4I7F A;  4LY7 A;  3VN5 A;  3OYB A;  3QEX A;  4B9S A;  3VQ7 A;  4Z4C A;  2XY5 A;  1BI4 B;  4NYF A;  1S5J A;  3SNN A;  1FK9 A;  1FXX A;  3ZT1 A;  4AHS A;  4OPK A;  3OJU A;  2YV0 X;  3QEW A;  1SKW A;  1KRP A;  4BDP A;  4Z4E A;  1TK5 A;  1KVC A;  2D5R A;  3AVK A;  3RMC A;  4K8Z A;  4OKJ A;  4ZTJ A;  2YNG A;  2DFF A;  1KLM A;  1IO2 A;  4FJH A;  4B8A B;  4CJ5 A;  3AVI A;  1IG9 A;  4CCH A;  4KB0 A;  3BGR A;  3SI6 A;  3PUF A;  4FYD A;  3FFI A;  1NOY A;  3KTQ A;  4KI4 A;  3KLI A;  4DLE A; 
#chains in the Genus database with same CATH topology
 5FPD A;  4NCB A;  1S6Q A;  3CCL N;  4Z4F A;  3JYT A;  3H46 O;  5HL7 L;  3ASM A;  1HLU A;  4X65 K;  5AJ3 K;  3SMP A;  4C8L A;  3HOS A;  3LZI A;  4KAZ A;  2HMP A;  3V81 A;  3WXL A;  1QS4 A;  1SAZ A;  1FKO A;  4MO4 A;  4PUO A;  3MXI A;  2P51 A;  5BPL A;  3O4N A;  3CQY A;  3EE9 A;  2DY4 A;  4YNQ A;  1XMQ K;  3E1Y A;  4CHQ A;  2E6M A;  1IKV A;  2JGU A;  3FFK B;  1OH8 A;  4JI8 K;  4CJT A;  4ISE A;  1S9E A;  3AVA A;  2P9L A;  3R1X A;  1N8R O;  4LFB K;  3ID6 A;  4M45 A;  3O3F A;  1JL2 A;  4UQG A;  4JI2 K;  3RR7 A;  2EX3 A;  2OTL N;  4O5F A;  2KQ2 A;  4J8F A;  4M3W A;  4FJ8 A;  1NNE A;  3BY5 A;  2CH6 A;  2A42 A;  1BIZ A;  2HVH A;  2O8F B;  4EIA A;  1GLC G;  5AQZ A;  1WB9 A;  1JJ2 M;  1O13 A;  2VWJ A;  3OS2 A;  4BRQ A;  3OYA A;  1QSL A;  4OO1 J;  1LWF A;  3THY B;  1QSY A;  4JI1 K;  4FZX C;  2A40 A;  4CW7 B;  4FLT A;  1YT3 A;  1IH7 A;  1RDA A;  3KD1 E;  4L8R B;  2HVI A;  4I9Q A;  1ATN A;  3G25 A;  4CD1 A;  2OAN A;  1ATR A;  4H0V B;  3LAM A;  5AQS A;  3L6Q A;  3K59 A;  1VQ7 N;  1BO5 O;  4EAH D;  3U9Z A;  1GOB A;  1IBK K;  2VGN A;  4B3T K;  1QQO A;  3MXM A;  3RR8 A;  1NKB A;  2DFH A;  1U45 A;  3E9L A;  4N41 A;  3AA3 A;  1QHA A;  3K2P A;  4FWS A;  4WCE L;  3OYI A;  3V1R A;  4CJR A;  5I9E B;  1JLQ A;  5AQK A;  4BY9 C;  4FLV A;  3SJH A;  2KZZ A;  1L3U A;  2KW4 A;  1RBU A;  4IFE A;  4IEI A;  2YNF A;  2BDP A;  5E26 A;  1P90 A;  1HQU A;  1HNI A;  3M8R A;  4W5O A;  1VRU A;  5SWM A;  4E89 A;  1K8K A;  3J7Y P;  1L5U A;  1X3N A;  3A5N C;  3E9P A;  1SL1 A;  3ISN C;  1HQE A;  3E66 A;  1EXQ A;  1D9F A;  1VSK A;  4KH4 A;  2VQE K;  1JXE A;  1KC8 O;  2P9N B;  3OYC A;  1QTM A;  1ZYQ A;  2HBK A;  3B6O A;  3L4Q A;  3M3Z A;  4FPB A;  4IKF A;  4G1Q A;  4CGJ A;  1JLC A;  2KTQ A;  3I0S A;  2HHW A;  1YXQ A;  4CEB A;  2F8T A;  1FJG K;  4LH5 A;  4KKO A;  3O08 A;  1C0T A;  1ILY A;  4CD3 A;  4NO7 A;  5DK5 A;  2HOE A;  3TAB A;  1YTU A;  3MWT A;  1C6V A;  4DFJ A;  4FM2 A;  3C6H A;  4GMJ B;  4Y0W A;  1UOC A;  2I5J A;  1NJX A;  1V4S A;  3OBY A;  3W3D A;  3KZB A;  3P38 A;  4BRH A;  1J6Z A;  1U4B A;  1U6Z A;  2QKK A;  1DTT A;  4BRK A;  3LAL A;  2WC9 A;  2O8D A;  5M1N A;  3L3U A;  3V9Z A;  1RBS A;  1ATS A;  4BQZ A;  1KTQ A;  5HRP A;  3QER A;  2ZF5 O;  3O3G A;  3NFA A;  4GY2 B;  3NH1 A;  4H5T A;  3U6F A;  1EKE A;  5C24 A;  4JD2 B;  2FBY A;  4H5V A;  3G6E N;  3FGU A;  4F2R A;  2IC3 A;  4OGE A;  3LDL A;  5HP1 A;  3DXM A;  3VQA A;  2W6K A;  1MU2 A;  4RW8 A;  2YJF A;  4KHP K;  3FZM A;  1A5X A;  3AVF A;  4O8K A;  4BC3 A;  3PIP L;  4CZM A;  3D6R A;  2HST A;  4LH4 A;  2OCE A;  4FLU A;  3ENO A;  3HI0 A;  3G10 A;  4A5B A;  1NK9 A;  4JS4 A;  1Y64 A;  5M1P A;  3VGL A;  1YVU A;  4M41 A;  4Y1D A;  4BRM A;  1VSJ A;  4H4M A;  2RKI A;  2HF3 A;  5AZJ A;  1TYQ B;  5FDL A;  4BE2 A;  4FOI A;  4CFD A;  4E0D A;  1RDD A;  3U9D A;  4IOC L;  1VSE A;  5C15 A;  3VA0 A;  2QWQ A;  3L2U A;  4FJK A;  2J4R A;  3DWL A;  3F9M A;  4YOY A;  1R0A A;  1BI4 A;  2GV9 A;  4DTR A;  5LMU K;  3L3V A;  3LWL A;  3TPQ A;  4IFV A;  3UB5 A;  3QNN A;  1N5Y A;  4CHY A;  5AQJ A;  3C6T A;  2D1K A;  3LAK A;  1BL3 A;  3KK7 A;  3FE1 A;  2X78 A;  3C7N B;  1A5W A;  2Q2R A;  3IDH A;  4FL9 A;  2RF2 A;  3LP0 A;  4N47 A;  1S72 N;  4AH9 A;  2FBX A;  2P9U A;  3F9K A;  3DOK A;  2G8I A;  3L2Q A;  3DAW A;  1KQS M;  4YOW A;  3CCR N;  2HHU A;  4B9V A;  3VES A;  4FLY A;  3PY8 A;  4R5P A;  1TGO A;  4BR4 A;  1QHT A;  5C10 A;  1R59 O;  1VHX A;  1BDG A;  4BG8 A;  3DLL L;  4CHN A;  2XHB A;  4BVP A;  3LL3 A;  5EXW A;  1S1U A;  5M1O A;  1VQ6 N;  1EWQ A;  4MLE A;  4K42 A;  3DYA A;  4NXN K;  2YNH A;  4CJK A;  1S1V A;  4YFU A;  3FR0 A;  2D0C A;  2YHW A;  3AAQ A;  1ZC6 A;  3WNG A;  1YVN A;  4ZHR A;  4BRN A;  4FO0 A;  4W5Q A;  2XY7 A;  4HTU A;  3B8A X;  3HM9 A;  4LSN A;  4CJW A;  4DR2 K;  4J2E A;  3MK6 A;  1DLO A;  2E88 A;  2QXL A;  1HUX A;  4A62 A;  3RTV A;  4YDU A;  2Q97 A;  3VQ6 A;  3L8B A;  3MN5 A;  5AQH A;  4IOX A;  3KJV A;  2P5O A;  3T1Y K;  3TAG A;  2HHT A;  1KSP A;  1VQ9 N;  3HYF A;  2DPN A;  1N34 K;  3CC7 N;  4CZE A;  4F8R A;  3CF5 L;  1JCF A;  3AGK A;  4DU4 A;  2Q0U A;  4CBX A;  4CGG A;  1WBD A;  4DTP A;  1CZ9 A;  3DRS A;  4YDU C;  3JSM A;  3CMA N;  3TR8 A;  4BRG A;  3TWH A;  1LAV A;  5K14 A;  1D5A A;  3VER A;  3IRX A;  4OPH A;  5ADX A;  3M8Q A;  4E1M A;  1BUP A;  4FWQ A;  3NAE A;  3DRP A;  2A6A A;  2Q3S A;  4DR5 K;  4DB3 A;  2QWR A;  4JNE A;  3ZSQ A;  1S1T A;  5JIC A;  5IWA K;  3LP3 A;  3L2V A;  4YOV A;  4C1N I;  4JKB A;  3L0Q A;  3RSE A;  5HRS A;  2XRI A;  5JVH L;  2FF3 B;  3HOT A;  3SAH A;  3THX A;  4JKF A;  1RGI A;  1GOA A;  1RTI A;  3O5B A;  4BWM A;  2P9I A;  4KH6 A;  3ZSX A;  4ICL A;  4MLH A;  4H8K A;  3I33 A;  3HP6 A;  3O4W A;  3S41 A;  3K9K A;  4FJM A;  4BAC A;  1HYS A;  4KB1 A;  2G8W A;  1XQS C;  3DLB A;  2F4V K;  2P9N A;  3OS1 A;  1KAZ A;  4K43 A;  2YHA A;  2P9S A;  1RTD A;  1K73 O;  4CJE A;  1SKS A;  1GLD G;  4KPY A;  3AO4 A;  1VQL N;  3CJ9 A;  4CJF A;  3RMA A;  1IKW A;  4LY7 A;  4IZ9 A;  3QEX A;  4B9S A;  3VQ7 A;  2XY5 A;  3CD6 N;  1HR0 K;  1FK9 A;  3AAP A;  1VQO N;  3CQX A;  3SAF A;  4RWT A;  4ZTJ A;  2YNG A;  4BC5 A;  4KB0 A;  1IG9 A;  3BGR A;  4RCH A;  3SI6 A;  3H6E A;  4LFC K;  3NVM A;  3QLH A;  3KLI A;  5JS1 A;  2FF6 A;  3LM2 A;  2NRR A;  5GAG P;  4OPJ A;  3I8D A;  3VQ9 A;  1JLF A;  3H08 A;  4AHC A;  4GV6 A;  1IBL K;  3VGM A;  1ASU A;  1VSI A;  3M8S A;  3WNH A;  1XC3 A;  1VQK N;  4KRF A;  3ZSY A;  3NF6 A;  1X9J A;  4CJL A;  3CET A;  4HUF A;  2B5J A;  2IVN A;  4JHD B;  1DEJ A;  5KTQ A;  2NRV A;  3WXI A;  4C23 A;  1IJJ A;  1JLE A;  4DR6 K;  3AA2 A;  3AA4 A;  3G71 N;  1X3M A;  5CR4 A;  3VQ5 A;  3AY9 A;  2PZS A;  3CCV N;  1YIT N;  1CXU A;  3D7E O;  4Y1C A;  4CEQ A;  2OZM A;  4GKK K;  4WE1 A;  4YOR A;  1VSM A;  3BF3 A;  1HNX K;  3AVB A;  2VG7 A;  3ZET B;  1VSF A;  1P8Z A;  3VQB A;  3CHW A;  2OPR A;  2BUP A;  3CG7 A;  3AVJ A;  3A8Y A;  4H5R A;  1WBB A;  2E4L A;  1NGC A;  4ISF A;  1HNZ K;  2OZS A;  2GWK A;  2UXD K;  4KTZ A;  3CCS N;  2UXC K;  1WOQ A;  1Y97 A;  5F1X A;  1CXQ A;  2EHG A;  1QQN A;  3IMX A;  4PKH A;  5AQM A;  3C0B A;  5AFU H;  5JLF A;  5AQV A;  4IJA A;  4IWV A;  2F96 A;  2CH5 A;  1WN7 A;  1HRH A;  4DS5 A;  4X64 K;  5AR0 A;  3UKR A;  5BPM A;  3AVH A;  3ZSR A;  3V6D A;  4LF9 K;  5LY3 A;  3BZK A;  3SLC A;  4MQ3 A;  3V1O A;  1XHZ A;  1RTJ A;  3LAN A;  1GOC A;  3MXJ A;  1BU6 O;  4HVJ A;  3CYM A;  4A59 A;  3CCM N;  1NMN A;  4XH1 A;  5KGW A;  2QEX N;  3AVN A;  3ENH A;  2WTU A;  2FSN A;  5KI6 A;  4CF2 A;  1REV A;  1CZA N;  1QE1 A;  3EE8 A;  3HBT A;  4M7Y A;  2OPP A;  1W7A A;  4J2D A;  5TKW A;  1X1P A;  5JLH A;  1BIU A;  4MDB A;  2FSJ A;  3ZCM A;  4PQU A;  4I9L A;  4W5N A;  3U3G A;  4DR4 K;  2OTJ N;  5CYM A;  2F9W A;  1HNV A;  2QTD A;  4RW9 A;  5BR8 K;  3WEE B;  1NK6 A;  4GW6 A;  4EHT A;  3EL2 A;  4JI5 K;  5BR9 A;  3PX6 A;  1RDU A;  3PSI A;  1T8E A;  3TU5 A;  3CCJ N;  3CCE N;  4GVE A;  1VSD A;  2ZD1 A;  3SUQ A;  1XMO K;  4XEI A;  4DCH A;  4DR7 K;  5SZT A;  3MEE A;  2JLE A;  1XHX A;  3HSC A;  4DSJ A;  4CHO A;  3CCQ N;  5M1Q A;  1RT1 A;  2NUB A;  3T3F A;  4WFA L;  1LWC A;  4O4G A;  4DG1 A;  2X6N A;  3V9W A;  4FPA A;  2ITG A;  1B9F A;  1E4F T;  3O6W A;  1L3T A;  1UWB A;  3CIP A;  3HVT A;  3DLR A;  5HRR A;  4CK3 A;  2JWL A;  4CFB A;  2GTD A;  3QDK A;  1XI1 A;  3DXK A;  4FWL A;  4JKD A;  3KLH A;  3V9U A;  4EP5 A;  3OJS A;  3OYL A;  3MEG A;  2A3Z A;  1U48 A;  1Q9X A;  4UY8 O;  3MN6 A;  3TTC A;  4BRL A;  2KFN A;  4C8K A;  5LMN K;  3AO5 A;  4B1Y B;  4DSE A;  2Q1N A;  2E2P A;  4O8U A;  2E2Q A;  3OA9 A;  4DV7 K;  3V4I A;  3VEX A;  1WSH A;  1T6D A;  1L3V A;  4BVO A;  4CVN E;  1QZ6 A;  4DQI A;  2NRX A;  4DV2 K;  4MO5 A;  1WAJ A;  5GAH P;  1KFD A;  3QFU A;  4MDA A;  3AO2 A;  3AO1 A;  3P1G A;  2BAN A;  4CED A;  1L3S A;  4CK1 A;  3ZSO A;  1G15 A;  2FXU A;  1JKH A;  2PAV A;  4KH5 A;  3OS0 A;  3NDK A;  4X66 K;  3KK1 A;  5JMV A;  2A1R A;  3ENB A;  2V7Z A;  3RMB A;  2UYT A;  1ZBF A;  4DFP A;  1TK8 A;  4CF0 A;  2BGG A;  5BN9 A;  5GIO A;  2HB5 A;  1TUY A;  2IVP A;  1NKC A;  3K5M A;  4CF8 A;  1RT5 A;  1W97 L;  2FBV A;  3SBG A;  5AQI A;  1Z6R A;  4I2P A;  3QB0 A;  1NK0 A;  2KFZ A;  4CHP A;  3KD5 E;  4JAX A;  3A5L C;  1SKR A;  3ZLJ A;  4A5A A;  2Z1G A;  1QQM A;  2BE2 A;  4AHV A;  1N6Q A;  3ZX2 A;  3ZT4 A;  4HTL A;  1HYZ A;  3CFO A;  4CIF A;  1C0G A;  4EFH A;  1BQM A;  4JHD A;  3L2R A;  3A5M C;  1T3V A;  3MMV A;  1JXB A;  4Q5V A;  5C25 A;  4RW4 A;  4FJ5 A;  2ATQ A;  4YY3 K;  2F7T A;  1NGE A;  2WBN A;  3CJB A;  3VTI A;  2GBZ A;  3LP1 A;  4ISG A;  3D45 A;  4BR5 A;  1HPZ A;  4FLW A;  3M5R A;  3V1Q A;  4KBO A;  1GLJ O;  3KK3 A;  3TI0 A;  4Z94 A;  3UE5 A;  5EVZ A;  3R8E A;  4LD0 A;  4PKG A;  3QET A;  4RTF D;  4AHT A;  5GAD P;  3SUN A;  3MED A;  4H03 B;  3IFR A;  3DLK A;  3O4Q A;  5AQW A;  5BRF A;  3M6G A;  4DR3 K;  1NWK A;  3OYF A;  4MFB A;  4PKI A;  1DTQ A;  2QWO A;  4U67 L;  1HKB A;  3RVC A;  1CZB A;  1WNS A;  2JWK A;  5M1K A;  2PY5 A;  4JEP A;  3VGK A;  2E1Y A;  2CGK A;  1GLF O;  2DFE A;  3TSQ A;  2Y1I A;  4H4O A;  3T69 A;  4W5T A;  3ZEU B;  4IDH A;  3M1F A;  1I94 K;  3H3O B;  4DV0 K;  3T7Z A;  3WXK A;  3AV9 A;  2UU9 K;  1NOZ A;  4B1W B;  4DU1 A;  2X6S A;  3BDP A;  1RT4 A;  1VQN N;  3AVC A;  4CGD A;  3CI5 A;  3EN9 A;  3CXC M;  4HUE A;  1J54 A;  4N76 A;  3ID8 A;  3BUZ B;  4FWM A;  3F5T A;  1Q82 O;  2IDO A;  4IO9 L;  4CJV A;  1YF5 L;  5GIN A;  3G4S N;  3SZ2 A;  4WQ5 A;  1TKZ A;  2YX6 A;  3O9U A;  3SQ1 A;  3OYN A;  1Q86 O;  4J2A A;  3GL1 A;  1TK0 A;  1VQ8 N;  4HCB A;  3S3M A;  2ETJ A;  4BWJ A;  3QBW A;  4JN4 A;  4KI6 A;  1U04 A;  3J81 O;  1DT9 A;  4K25 A;  3S9H A;  1KVA A;  4CEZ A;  2P9K B;  2FBT A;  4DSL A;  2G8U A;  2O4I A;  3HPG A;  4ID1 A;  4WQ5 C;  4FSV A;  4CFA A;  3SCX A;  5HOO A;  2GEL A;  4KFB A;  1SZ2 A;  4E3S A;  1YI2 N;  5DM6 L;  3UKU B;  3NF9 A;  3V9S A;  1EWR A;  5GAE P;  3K5L A;  3ITH A;  2D4W A;  3FZL A;  2HND A;  3H1V X;  5CE3 A;  2VQF K;  4AM6 A;  1U2V B;  5HLF A;  1TVR A;  4LF4 K;  1S9G A;  4BRO A;  3T1A A;  3NHG A;  3KKR A;  3QEI A;  3N4Q A;  3BEX A;  3QML A;  4I7F A;  4NYF A;  4ILJ A;  1FXX A;  4DKW A;  4PL7 A;  4AHS A;  4BDP A;  3CER A;  3OJU A;  1SKW A;  4JKH A;  1TK5 A;  1KVC A;  3RMC A;  4QS8 A;  3CC4 N;  2RE2 A;  5A2Q O;  4B8A B;  4CCH A;  3LDQ A;  4FYD A;  3FFI A;  2Q36 A;  3R9P A;  4FWN A;  3AVL A;  3VQC A;  3ZSW A;  1ASW A;  4FJ9 A;  4F2S A;  4WYB A;  4AHR A;  5AQO A;  4JI0 K;  1HYV A;  4M3R A;  4IDK A;  2E20 A;  2WOM A;  4W5R A;  2Z1I A;  3W0L A;  2D0O A;  2O8F A;  5BRD A;  4NLC A;  1BCO A;  1RBR A;  2YHY A;  1C1B A;  2HHX A;  1RIL A;  1EO1 A;  4B9L A;  3OHR A;  4CZJ A;  1LAW A;  1RNH A;  3VQQ A;  1SQK A;  3THY A;  2WUS A;  1B92 A;  1VK0 A;  4H5W A;  3QES A;  3U4L A;  2BTF A;  4CER A;  3VEO A;  5BRH A;  3SYZ A;  2Y1J A;  3SQ4 A;  4KRE A;  4AF1 A;  4ILG B;  3TTD A;  1C0F A;  3CFR A;  4M3X A;  4FZZ A;  2UUB K;  1S1X A;  3E9O A;  1WSE A;  3EY1 A;  3C95 A;  4JV5 K;  2Q0R A;  1TKX A;  3AO3 A;  1NJW A;  3DMJ A;  4PWD A;  2ZJR L;  1BA1 A;  2A5X A;  3AGR A;  3NE6 A;  4M3Y A;  3DOL A;  1C1A A;  1S3X A;  3KWI A;  2W42 A;  3EO3 A;  4IXC A;  1J5E K;  1OVQ A;  4M7X A;  5HRO A;  1LV5 A;  3HM8 A;  1N32 K;  1HX1 A;  2P9P B;  3THV A;  1NK4 A;  1E3M A;  4AQY K;  2NNW A;  3KHY A;  1Q9Y A;  4ID5 A;  4RW7 A;  5J2P A;  4LFA K;  2HHS A;  3VEV A;  4AHU A;  3ZT2 A;  3D0P A;  3P39 A;  3MDQ A;  3OY9 A;  4B9Q A;  3SJJ A;  1SS6 A;  4BGB A;  3O80 A;  5IT9 O;  3DRR A;  4L3Q A;  2O8E B;  1XWL A;  4RG8 A;  3ZT3 A;  1FKP A;  2UUA K;  1RTH A;  4FJN A;  3SMS A;  3PIO L;  4Z4H A;  1TAQ A;  3ZYY X;  5AQP A;  5KPR A;  2HNZ A;  4HHT A;  2PBD A;  3AVM A;  1CLQ A;  3VEZ A;  4BR7 A;  2KLA A;  2QWN A;  1BWF O;  3MX2 A;  1ZXO A;  2KKZ A;  4JI3 K;  3VPZ A;  1NGH A;  4CEO A;  1ZBH A;  2G8H A;  3ULD A;  4DQS A;  4LC9 B;  2ASP A;  1WSI A;  2HF4 A;  3K0S A;  4M3T A;  4BR2 A;  3TAN A;  5FPE A;  4O0I A;  1K6Y A;  1BHL A;  2E5L K;  3NH2 A;  1SUQ A;  3PO4 A;  2WFB A;  4KTW A;  1XNQ K;  1FW6 A;  2HW3 A;  4JK9 A;  3MAQ A;  5TKY A;  5F2R A;  4I2Q A;  1VQ5 N;  3MEC A;  1W9H A;  3K57 A;  1BIS A;  3T1H K;  2OYQ A;  4FJX A;  1KAY A;  4KHW A;  1S22 A;  4FCY A;  2HBJ A;  4BRE A;  4DQP A;  2HHQ A;  2E6L A;  1Q81 O;  4ELV A;  1K9M O;  4Z0U A;  4JD2 A;  4DTM A;  4JKA A;  1J5O A;  5FPN A;  3LDO A;  3ZEU A;  4AM7 A;  5DMR A;  1OH5 A;  1HKG A;  3PX0 A;  2O8C B;  1C1C A;  4OPA A;  1EQY A;  1WSF A;  3CJA A;  3KVG A;  5CZ1 A;  3HO1 A;  3M8P A;  3ULE B;  3QIN A;  2YKN A;  3A5O C;  2QWL A;  5AQY A;  4BR9 A;  4CEA A;  3OYM A;  2QA4 N;  1D8Y A;  1T7P A;  4C8N A;  4KO0 A;  1B9D A;  4H0P A;  5C2F A;  4CJ3 A;  1KD1 O;  3CCU N;  4HUG A;  3J8A A;  2QWP A;  5LL6 Z;  2B4J A;  3HK2 A;  1TYQ A;  1X9S A;  4DR1 K;  4BG9 A;  3VA3 A;  5B8H A;  5T7B A;  4DTN A;  3SUP A;  1YJN N;  3PX4 A;  3NGI A;  1DKG D;  4B8C A;  3MWP A;  4G9Z A;  1NLV A;  2P9K A;  4H0O A;  4WF9 L;  1EP4 A;  3VF2 A;  3NF7 A;  2O8D B;  2VG5 A;  4AIL C;  3QIO A;  3VQ8 A;  3WUH A;  3DLH A;  4GV3 A;  1JCE A;  1VAZ A;  4BRP A;  5AQX A;  1LW2 A;  1RT2 A;  2ASM A;  1VSH A;  1W2B M;  4X62 K;  3C7N A;  3E01 A;  4BGA A;  3H45 C;  2NRW A;  1Z25 A;  4JI6 K;  3D2F B;  3ATU A;  3NGY A;  4HWI A;  4JKG B;  3BP8 A;  3IAY A;  2QWM A;  3VQ4 A;  3HPH A;  3VQP A;  2XY8 A;  3TAR A;  3EKS A;  1RT7 A;  3UIQ A;  2KZM A;  3O9T A;  3KLG A;  1HMV A;  1TUU A;  1WAF A;  3CJ7 A;  1U47 A;  3IS9 A;  3JAM O;  3P83 D;  3NVK A;  3TSU A;  2IS3 A;  5M1F A;  1NKE A;  2CGJ A;  4DV5 K;  4Q0B A;  1LOT B;  4DUY K;  1NGG A;  3O9R A;  4FK0 A;  4N56 A;  3WNE A;  2QXF A;  2ZJP L;  1Q8I A;  1RDW X;  4FWP A;  4LF5 K;  5CYQ A;  4B9M A;  2CGL A;  4CZL A;  3C65 A;  2VCP A;  2G8K A;  2NRZ A;  5J1E A;  4BE1 A;  3S3N A;  5DM7 L;  1IV0 A;  4FJI A;  4WQ4 A;  4K8X A;  5EOY A;  2PYJ A;  4FZY A;  3N4P A;  4CJS A;  1KCF A;  4CZG A;  4FM1 A;  1JLB A;  1F21 A;  3VQD A;  3OYK A;  1VRT A;  3KIO A;  5AQQ A;  4F9O A;  4DUZ K;  4OGC A;  3SQ0 A;  1NG9 A;  1RFQ A;  3O1B A;  4BRC A;  5KQD A;  2YCH A;  4DV1 K;  5AQL A;  3HPO A;  1TV6 A;  2Z1J A;  3SV3 A;  4FXD A;  4DQR A;  1ITG A;  2P9U B;  4CEC A;  2YI1 A;  2LSN A;  4CHZ A;  4DTS A;  3FZK A;  2O8B B;  5I42 A;  3TAM A;  4DFK A;  4F3T A;  4WQ4 C;  4E19 A;  5D3G A;  1MDU B;  3CME N;  2VG6 A;  4B9N A;  4KHY A;  1NK5 A;  3ZX3 A;  2HBL A;  1HKC A;  2EWS A;  3R3L A;  3I8B A;  4K0K K;  1RDB A;  3Q7B A;  3U3Y A;  2ZM6 K;  4Z4I A;  4BC2 A;  3H3N O;  5MLC Q;  4BE0 A;  4CZH A;  4OLA A;  1UA1 A;  2AP1 A;  4K41 A;  4B3O A;  2V52 B;  4DFM A;  2P9P A;  3F73 A;  1IG8 A;  1ZBL A;  3HVR A;  3V9X A;  3O8M A;  5AQR A;  2IAJ A;  2YJE A;  3WNF A;  4FJ7 A;  3I55 N;  3LDN A;  5E41 A;  2ZQB A;  4ELU A;  1M1K O;  1JLG A;  2OPS A;  4FLX A;  3A0I X;  5C12 A;  2O8E A;  4R79 A;  1NGJ A;  1QQC A;  5AQF A;  3VMF B;  2D0A A;  4M3Z A;  1D9D A;  4JRQ A;  5FPM A;  3WXJ A;  4B9U A;  2X74 A;  4FVU A;  2Q31 A;  4M42 A;  4QCL A;  3TAP A;  1HJO A;  3LPU A;  2IIR A;  1C0M A;  3K58 A;  4DU3 A;  3NMU A;  4YOT A;  1YJW N;  4CF9 A;  1NGA A;  2GX9 A;  5FRO A;  5HRN A;  3QEV A;  2YNI A;  2QM1 A;  4CI6 A;  4C8M A;  3FLC O;  1RT3 A;  4JLH A;  4DV6 K;  3D2E B;  3F2K A;  5AFU A;  2FSK A;  3B6P A;  4KHS A;  1OH6 A;  2QK9 A;  3RWU A;  3T19 A;  1XC9 A;  1SL2 A;  4LF7 K;  4A2B A;  4CZI A;  3NGZ A;  4OX9 K;  3SUO A;  3DLE A;  4NCA A;  4DTJ A;  5FRN A;  1OH7 A;  2HBM A;  3O1W A;  1MWM A;  4XH4 A;  1WLJ A;  4DS4 A;  1TL3 A;  3P5J A;  4B1V A;  1NMD A;  2Z1H A;  1HJR A;  4DTX A;  4FWK A;  4ZTF A;  3ZSZ A;  1WSJ A;  1YAG A;  4CJ7 A;  3C94 A;  2AJQ A;  5CY4 A;  2GWJ A;  3O9S A;  4H0T B;  4NLB A;  4EHU A;  4H0Y B;  3RSE B;  1HPM A;  3SK3 A;  3O3H A;  4JYA K;  1BGX T;  4FW1 A;  4FWR A;  2GUP A;  3SNN A;  4OPK A;  3THX B;  3QEW A;  2YV0 X;  1KRP A;  4B3M K;  3Q7C A;  3AVK A;  2D5R A;  2P9I B;  4K8Z A;  2W6L A;  4OKJ A;  3FZF A;  1QVF M;  2DFF A;  4CJ5 A;  3AVI A;  4XH5 A;  3WQT A;  5KPZ A;  4V19 S;  2UXB K;  4DLE A;  1A5V A;  1EET A;  1H1V A;  3AAR A;  5AQT A;  2O8C A;  1NBW A;  3LDS A;  1W0H A;  1TAU A;  3CC2 N;  2P9S B;  4XIU A;  1TKD A;  3ULE A;  4KHQ A;  2R7Y A;  1XNR K;  1T03 A;  3HXM A;  1NJZ A;  2VYP A;  5FRM A;  3ZET A;  3GDQ A;  1VQP N;  3HZ6 A;  1ZBI A;  4OKK A;  3H1Q A;  2WON A;  4PA1 A;  3SPY A;  4JK7 A;  2QW9 A;  1BA0 A;  4BRI A;  4OLB A;  3HP9 A;  3BZC A;  2V51 B;  3MCP A;  2VWK A;  1J9A A;  4I6M B;  2HHV A;  4HCC A;  4CFC A;  2ZWH A;  3J7Z O;  3CPW M;  4IO8 A;  3DM2 A;  4EP4 A;  2PFU A;  4CGH A;  4BDY A;  4F3O A;  1QSS A;  2D0B A;  3QEP A;  2UUC K;  2RHK A;  3K9J A;  2IGI A;  3I56 N;  1UA0 A;  2NRH A;  5J2M A;  2RN2 A;  1JCG A;  1NK7 A;  2I7P A;  5ADX H;  5C0Y A;  2KHO A;  3QNO A;  1UAX A;  3KLE A;  1Z05 A;  3D2F A;  2QI2 A;  4CJP A;  4JKG A;  3R6M A;  1T44 A;  4BC4 A;  3ZT0 A;  2AA4 A;  4PY5 A;  3ATV A;  1I3A A;  4PHT X;  4B9T A;  3CJC A;  4KHN A;  4PL8 A;  5FLX O;  3ZSV A;  4CJQ A;  2YHX A;  4DMN A;  1S6P A;  3TAQ A;  1KVB A;  4CF1 A;  2HHH K;  2F8S A;  2A1S A;  3A2F A;  4CGF A;  3CJ1 A;  3P31 A;  1IKX A;  3DLG A;  4H0X B;  3OYH A;  1V4T A;  1C0U A;  2O4G A;  1LW0 A;  5AZI B;  1SV5 A;  1D4X A;  3THW B;  2E1Z A;  1E4G T;  2ITM A;  1YHQ N;  3OYG A;  3EZW A;  5KRS A;  2VGM A;  1BCM A;  1X9M A;  4B1U B;  1JLA A;  3WEE A;  3G0Z A;  4YOU A;  3AA5 X;  3MCA B;  4LF8 K;  4JKE A;  4E7H A;  3SV4 A;  3OYE A;  1NGF A;  4LSL A;  4OVL A;  4OJR A;  1ZBS A;  2ASO A;  3UKR B;  5C2D A;  3CM5 A;  3CFP A;  4DQQ A;  1YJ9 N;  5J2Q A;  2G8F A;  4H5N A;  4DTU A;  3DI6 A;  2P1J A;  4CJU A;  3K5O A;  4GNI A;  2O8B A;  2FC0 A;  1WSG A;  2YHB A;  1M90 O;  4E7K A;  5GIP A;  4Z4G A;  4B3S K;  3QBX A;  4DV3 K;  1RBT A;  4BRF A;  4EZ9 A;  3NCI A;  3HT3 A;  3OW2 M;  4JRP A;  1VQM N;  1GLE G;  4FJG A;  1O1W A;  3NF8 A;  4QAG A;  3SAG A;  3GOI A;  4JI4 K;  4WFN L;  3KKS A;  4TSX A;  3MN7 A;  5H1S Q;  5AQN A;  3GG4 A;  4CEF A;  3NH0 A;  3PLA A;  1Q18 A;  1J53 A;  2NZT A;  4IBN A;  4A57 A;  4CEE A;  2XO7 A;  3NBP A;  2IOC A;  4LF6 K;  3OTO K;  1LCU A;  3TAE A;  1KFS A;  4CE9 A;  1ESV A;  4CGI A;  3LZJ A;  2E2O A;  1X9W A;  4ELT A;  1WUA A;  4M3U A;  4O44 A;  4KHU A;  2B6A A;  2NRT A;  4FOE A;  2OA8 A;  3K5N A;  5AQU A;  4IG3 A;  2W41 A;  4JS5 A;  4O5B A;  1MWK A;  1N33 K;  5ELZ A;  2P9L B;  5CZ2 A;  3SQ2 A;  3D2E A;  3DJC A;  4QS7 A;  3J80 O;  5F0X A;  4FJJ A;  2D0P A;  4QOZ B;  3TSP A;  2VWB A;  3LWM A;  4FW2 A;  4NYN A;  3P4I A;  3KK2 A;  3FZH A;  3OVN A;  4CZK A;  4DF4 A;  4KV8 A;  3RMD A;  3TAF A;  2DTU A;  4FK4 A;  4GKJ K;  4BQL A;  4ILH A;  3VF6 A;  3LM9 A;  3VTH A;  5BPN A;  1XUP O;  5HBM A;  4OKE A;  2RPI A;  4BRA A;  3AVG A;  4E1N A;  4E7J A;  2XY6 A;  5EY4 A;  5EX5 A;  3LP2 A;  2YKM A;  3EZ5 A;  1NJI O;  4J2B A;  3C6U A;  3C6A A;  3DXK B;  3CQ8 A;  1NK8 A;  4BRD A;  1VQ4 N;  3L4I A;  4NCG A;  3TTF A;  4CIG A;  4CZF A;  3HJF A;  4DLG A;  1U49 A;  3VET A;  3LDP A;  4DF8 A;  1Q7Y O;  2NLX A;  5LJW A;  5I3U A;  1RT6 A;  2HNY A;  4E7I A;  1OKJ A;  4FK2 A;  3SBT A;  2P5G A;  1VSL A;  4NB4 A;  2BH1 A;  4C1N K;  2I7N A;  3QIP A;  3QFP A;  3MN9 A;  3WXM B;  1JL1 A;  1G99 A;  4IEE A;  1I39 A;  4DQ8 A;  1BOT O;  4IFY A;  3GE1 A;  1NM1 A;  4NXM K;  3JS6 A;  2ZE2 A;  1GLL O;  2V7Y A;  3KWG A;  5BRE A;  4JK8 A;  3HTV A;  5KGX A;  2IVO A;  3MX5 A;  3LPT A;  1BG3 A;  1YUW A;  4IJN A;  4E7L A;  1ZBU A;  3VF4 A;  1TKT A;  2HMI A;  3HST B;  1NJY A;  4C8O A;  5KPT A;  3IUC A;  4I6M A;  1EX4 A;  3EKU A;  3VEW A;  4DSI A;  4B1Z A;  3ALY A;  1K8K B;  2GUI A;  5JS2 A;  1MA9 B;  4A61 A;  3PSF A;  5J2N A;  4GV9 A;  1NGI A;  3U8X A;  1NGB A;  5KRT A;  4KTQ A;  4U7B A;  4DWI A;  1N36 K;  5C42 A;  4FWO A;  4FM0 A;  4FVM A;  4M63 C;  4CJ4 A;  1LWE A;  1BQN A;  2QKB A;  1S1W A;  1NU0 A;  4O55 A;  1OVY A;  3HRG A;  4O0J A;  3GBT A;  1T05 A;  1IBM K;  4CBW A;  2A41 A;  5BN8 A;  3KLF A;  1K8A O;  5AQG A;  3PV8 A;  2E8A A;  3WT0 A;  3OYD A;  1KLN A;  4DV4 K;  2E2N A;  2GEM A;  3HL8 A;  3JXU A;  4B08 A;  1KXP A;  4WFB L;  4CES A;  3IG1 A;  4E1J A;  4JI7 K;  4FLZ A;  3CM6 A;  1SL0 A;  4N5S A;  3PO5 A;  1YTA A;  2ZGY A;  3OBW A;  4IG0 A;  4GVM A;  5EU7 A;  2PYL A;  5AZI A;  4CK2 A;  3BF1 A;  3VEY A;  3SPZ A;  3THW A;  4RW6 A;  5KQ8 A;  2OPQ A;  3UKU A;  4YOX A;  3VQE A;  1RCH A;  5CHI A;  3VOV A;  3VEN A;  2H3G X;  3QO9 A;  3RRH A;  3CPE A;  1QZ5 A;  4JKC A;  1ASV A;  4EZ6 A;  2F9T A;  3O9Q A;  3OYJ A;  4DSK A;  1U2V A;  1RDC A;  3DXM B;  4YHH K;  1RBV A;  1T6C A;  1IKY A;  4BDZ A;  2ZJQ L;  4DSF A;  1QVG M;  2G8V A;  1YIJ N;  2FLO A;  4B3R K;  4DHY A;  3I0R A;  3J7A P;  4A2A A;  1GLB G;  1Z26 A;  4B1X B;  3EYZ A;  4CIE A;  5JVG L;  3L2W A;  1TL1 A;  3S3O A;  5AZJ B;  4FJL A;  3RRG A;  1DGK N;  5E84 A;  1GLA G;  5LJV A;  4IOA L;  3IKM A;  4DTO A;  4F4K A;  1HNW K;  3VN5 A;  3OYB A;  4Z4C A;  3EEQ A;  1BI4 B;  1S5J A;  1NGD A;  1KAX A;  3ZT1 A;  2W40 A;  4BR0 A;  4Z4E A;  3QIC A;  4CBU A;  4QS9 A;  1KLM A;  3WQU A;  1IO2 A;  4FJH A;  2ZGZ A;  3ZX0 A;  3PUF A;  1NOY A;  3KTQ A;  4KI4 A; 
#chains in the Genus database with same CATH homology
 1A5V A;  1EET A;  3AVL A;  4NCB A;  1S6Q A;  4OPJ A;  3I8D A;  3VQ9 A;  3VQC A;  1W0H A;  3ZSW A;  3LDS A;  3JYT A;  4Z4F A;  1TAU A;  3ASM A;  1JLF A;  3H08 A;  4AHC A;  4XIU A;  1TKD A;  1ASW A;  4FJ9 A;  4KHQ A;  4C8L A;  2R7Y A;  4F2S A;  3LZI A;  1T03 A;  3HXM A;  4AHR A;  4KAZ A;  1NJZ A;  5FRM A;  1ASU A;  3V81 A;  1VSI A;  3M8S A;  1QS4 A;  1HYV A;  4M3R A;  4IDK A;  3WNH A;  1ZBI A;  2WOM A;  1FKO A;  4OKK A;  3ZSY A;  4W5R A;  4KRF A;  4PUO A;  3NF6 A;  2WON A;  4CJL A;  2Z1I A;  4PA1 A;  2P51 A;  3SPY A;  3MXI A;  4HUF A;  2B5J A;  5KTQ A;  4OLB A;  3O4N A;  3HP9 A;  2DY4 A;  2HHX A;  1BCO A;  1RBR A;  1C1B A;  4YNQ A;  1RIL A;  4CHQ A;  1JLE A;  1IKV A;  2E6M A;  2JGU A;  2VWK A;  3AA2 A;  1J9A A;  4CJT A;  4B9L A;  1S9E A;  3AA4 A;  1LAW A;  1RNH A;  3AVA A;  3VQ5 A;  3VQQ A;  2PZS A;  2HHV A;  1B92 A;  4HCC A;  1VK0 A;  1CXU A;  3QES A;  4CFC A;  4M45 A;  3O3F A;  1JL2 A;  4UQG A;  4CER A;  4Y1C A;  4CEQ A;  3SYZ A;  2Y1J A;  3SQ4 A;  3RR7 A;  2OZM A;  4KRE A;  3DM2 A;  2EX3 A;  4EP4 A;  3CFR A;  4FZZ A;  4WE1 A;  4CGH A;  4M3X A;  1VSM A;  4BDY A;  1S1X A;  2KQ2 A;  1WSE A;  3EY1 A;  4M3W A;  3AVB A;  4FJ8 A;  2VG7 A;  3C95 A;  1QSS A;  4F3O A;  1VSF A;  3VQB A;  2D0B A;  1TKX A;  3AO3 A;  1NJW A;  3DMJ A;  3QEP A;  4PWD A;  2OPR A;  2IGI A;  3CG7 A;  1UA0 A;  3AVJ A;  1BIZ A;  5J2M A;  3NE6 A;  4M3Y A;  2HVH A;  3DOL A;  1C1A A;  2E4L A;  2RN2 A;  1NK7 A;  2W42 A;  4N76 A;  3QNO A;  1UAX A;  2OZS A;  3KLE A;  2VWJ A;  3OS2 A;  3OYA A;  4CJP A;  4KTZ A;  5HRO A;  1LV5 A;  1QSL A;  1LWF A;  1Y97 A;  3QLH A;  3THV A;  1CXQ A;  3ZT0 A;  4QCL A;  1NK4 A;  2EHG A;  4PY5 A;  1I3A A;  1QSY A;  4FZX C;  1Q9Y A;  4FLT A;  4B9T A;  1YT3 A;  1IH7 A;  4KHN A;  1RDA A;  3KD1 E;  4ID5 A;  4RW7 A;  5J2P A;  4L8R B;  2HVI A;  2HHS A;  4I9Q A;  3ZSV A;  4CJQ A;  4AHU A;  4DMN A;  1S6P A;  3ZT2 A;  3D0P A;  3TAQ A;  1KVB A;  4CF1 A;  2F8S A;  2F96 A;  2A1S A;  3LAM A;  3OY9 A;  1WN7 A;  1HRH A;  4DS5 A;  3SJJ A;  3A2F A;  3DRR A;  4CGF A;  1IKX A;  1XWL A;  3K59 A;  3AVH A;  4RG8 A;  3ZT3 A;  3DLG A;  3ZSR A;  1GOB A;  3OYH A;  3V6D A;  1C0U A;  1FKP A;  1RTH A;  2O4G A;  1LW0 A;  1SV5 A;  4FJN A;  3MXM A;  3RR8 A;  4MQ3 A;  3V1O A;  1XHZ A;  1NKB A;  2DFH A;  1RTJ A;  3LAN A;  4Z4H A;  1GOC A;  3MXJ A;  1TAQ A;  4HVJ A;  1U45 A;  3CYM A;  4N41 A;  3OYG A;  5KRS A;  2HNZ A;  4HHT A;  3AA3 A;  3K2P A;  1BCM A;  3AVM A;  1X9M A;  1CLQ A;  3OYI A;  5KGW A;  3AVN A;  1JLA A;  3V1R A;  4CJR A;  5KI6 A;  1JLQ A;  3G0Z A;  3AA5 X;  4CEO A;  1ZBH A;  4CF2 A;  1REV A;  4FLV A;  4E7H A;  2G8H A;  3ULD A;  3SV4 A;  3OYE A;  4DQS A;  1L3U A;  2KW4 A;  2KZZ A;  1RBU A;  1QE1 A;  1WSI A;  2YNF A;  2BDP A;  4LSL A;  4OVL A;  4M3T A;  4OJR A;  3TAN A;  3CM5 A;  3CFP A;  4DQQ A;  2OPP A;  5J2Q A;  4J2D A;  2G8F A;  1HQU A;  1HNI A;  4O0I A;  3M8R A;  1K6Y A;  1BHL A;  4W5O A;  1X1P A;  1BIU A;  3DI6 A;  4DTU A;  2P1J A;  1VRU A;  4CJU A;  3NH2 A;  5SWM A;  4E89 A;  1SUQ A;  3K5O A;  1L5U A;  3ZCM A;  1SL1 A;  3PO4 A;  3ISN C;  4KTW A;  1HQE A;  1D9F A;  1EXQ A;  2FC0 A;  4PQU A;  1VSK A;  2HW3 A;  4I9L A;  4W5N A;  1WSG A;  3U3G A;  3MAQ A;  1JXE A;  2YHB A;  3OYC A;  4I2Q A;  4E7K A;  5CYM A;  3MEC A;  4Z4G A;  1HNV A;  1W9H A;  1QTM A;  4RW9 A;  1ZYQ A;  3B6O A;  3K57 A;  1BIS A;  2OYQ A;  1RBT A;  4IKF A;  4G1Q A;  4CGJ A;  1NK6 A;  1JLC A;  4GW6 A;  2KTQ A;  3I0S A;  4EZ9 A;  3NCI A;  4FJX A;  3HT3 A;  4KHW A;  4FCY A;  2HHW A;  4CEB A;  3PX6 A;  4JRP A;  1T8E A;  2F8T A;  4LH5 A;  4KKO A;  4FJG A;  1C0T A;  1O1W A;  3NF8 A;  4QAG A;  2E6L A;  4DQP A;  2HHQ A;  5DK5 A;  4ELV A;  3TAB A;  3KKS A;  1VSD A;  2ZD1 A;  4TSX A;  3SUQ A;  1YTU A;  1C6V A;  4DFJ A;  4Z0U A;  4DTM A;  4FM2 A;  5SZT A;  4GMJ B;  1J5O A;  3MEE A;  4CEF A;  1UOC A;  2JLE A;  1XHX A;  3NH0 A;  5DMR A;  2I5J A;  4DSJ A;  1J53 A;  1NJX A;  4IBN A;  3PX0 A;  4CHO A;  1C1C A;  4CEE A;  2XO7 A;  5CZ1 A;  1WSF A;  3NBP A;  2IOC A;  3HO1 A;  3M8P A;  1RT1 A;  2NUB A;  1U4B A;  3QIN A;  2YKN A;  2QKK A;  1DTT A;  3OYM A;  3T3F A;  1D8Y A;  3LAL A;  4CEA A;  1T7P A;  1LWC A;  4O4G A;  4DG1 A;  2X6N A;  3V9W A;  4C8N A;  4KO0 A;  3TAE A;  1KFS A;  4CE9 A;  1B9D A;  3L3U A;  4CGI A;  3V9Z A;  2ITG A;  1B9F A;  3LZJ A;  1RBS A;  1L3T A;  1X9W A;  4ELT A;  4CJ3 A;  4M3U A;  1UWB A;  1KTQ A;  4O44 A;  4KHU A;  4HUG A;  3HVT A;  2B6A A;  5HRP A;  3QER A;  3O3G A;  3DLR A;  2B4J A;  3NFA A;  3NH1 A;  3K5N A;  2OA8 A;  5HRR A;  4IG3 A;  4CK3 A;  3HK2 A;  3U6F A;  1EKE A;  5C24 A;  4CFB A;  1X9S A;  4JS5 A;  1XI1 A;  4O5B A;  2FBY A;  3KLH A;  3V9U A;  3VA3 A;  4EP5 A;  5T7B A;  4DTN A;  3OJS A;  5CZ2 A;  2IC3 A;  3OYL A;  3MEG A;  4OGE A;  3SQ2 A;  3SUP A;  5HP1 A;  4F2R A;  1U48 A;  3VQA A;  1Q9X A;  3PX4 A;  1MU2 A;  3NGI A;  4RW8 A;  4FJJ A;  4QOZ B;  4B8C A;  2KFN A;  4C8K A;  1A5X A;  3AVF A;  3AO5 A;  3LWM A;  4FW2 A;  4DSE A;  4NYN A;  1EP4 A;  3KK2 A;  4LH4 A;  3OVN A;  4DF4 A;  3V4I A;  3NF7 A;  4KV8 A;  4FLU A;  3TAF A;  3RMD A;  2DTU A;  2VG5 A;  1WSH A;  3G10 A;  4AIL C;  1NK9 A;  3QIO A;  4FK4 A;  3VQ8 A;  4JS4 A;  1L3V A;  3DLH A;  1LW2 A;  5HBM A;  1RT2 A;  4OKE A;  2RPI A;  1VSH A;  1YVU A;  3AVG A;  4E1N A;  4M41 A;  4E7J A;  2XY6 A;  4DQI A;  4Y1D A;  1VSJ A;  3LP2 A;  2YKM A;  4H4M A;  3E01 A;  1WAJ A;  2RKI A;  3C6U A;  3EZ5 A;  1KFD A;  4J2B A;  5FDL A;  1Z25 A;  4BE2 A;  3CQ8 A;  3AO2 A;  3NGY A;  1NK8 A;  4CFD A;  3AO1 A;  3P1G A;  2BAN A;  4CED A;  1L3S A;  4CK1 A;  4E0D A;  1RDD A;  3IAY A;  1VSE A;  3VA0 A;  3ZSO A;  3VQ4 A;  4NCG A;  1G15 A;  3HPH A;  3L2U A;  4FJK A;  1JKH A;  3VQP A;  3OS0 A;  2XY8 A;  3NDK A;  4CIG A;  1R0A A;  3TAR A;  3HJF A;  1BI4 A;  1RT7 A;  3KK1 A;  4DLG A;  2GV9 A;  4DTR A;  1U49 A;  2A1R A;  3L3V A;  3LWL A;  3UIQ A;  2KZM A;  4IFV A;  3KLG A;  3QNN A;  1N5Y A;  3RMB A;  4CHY A;  1HMV A;  1WAF A;  3C6T A;  4DF8 A;  1U47 A;  3IS9 A;  1ZBF A;  3P83 D;  3LAK A;  4DFP A;  1BL3 A;  2IS3 A;  5I3U A;  1TK8 A;  1RT6 A;  2HNY A;  4CF0 A;  4E7I A;  1NKE A;  2BGG A;  4FK2 A;  2HB5 A;  2X78 A;  4Q0B A;  1NKC A;  3K5M A;  1A5W A;  2P5G A;  1VSL A;  4CF8 A;  4FK0 A;  1RT5 A;  3QIP A;  2RF2 A;  2FBV A;  3LP0 A;  4N47 A;  4AH9 A;  2FBX A;  4I2P A;  1NK0 A;  2KFZ A;  4N56 A;  3WNE A;  2QXF A;  4CHP A;  1Q8I A;  3KD5 E;  1SKR A;  1JL1 A;  3F9K A;  5CYQ A;  3DOK A;  1I39 A;  4B9M A;  2Z1G A;  2G8I A;  3L2Q A;  2BE2 A;  4AHV A;  2G8K A;  1N6Q A;  4IFY A;  5J1E A;  2HHU A;  3ZT4 A;  4B9V A;  1HYZ A;  3CFO A;  4CIF A;  4BE1 A;  2ZE2 A;  3S3N A;  4FLY A;  3PY8 A;  4R5P A;  1TGO A;  1BQM A;  4FJI A;  5JS1 A;  5KGX A;  3L2R A;  1QHT A;  3LPT A;  1JXB A;  4E7L A;  4K8X A;  1ZBU A;  5C25 A;  4Q5V A;  4RW4 A;  2PYJ A;  4FZY A;  1TKT A;  4CJS A;  1KCF A;  2HMI A;  4FJ5 A;  2ATQ A;  4FM1 A;  3HST B;  1JLB A;  1F21 A;  3VQD A;  4CHN A;  3OYK A;  2XHB A;  1NJY A;  4C8O A;  1VRT A;  3KIO A;  4DSI A;  1EX4 A;  2GBZ A;  1S1U A;  3LP1 A;  4OGC A;  3SQ0 A;  3DYA A;  2YNH A;  3D45 A;  3ALY A;  3HPO A;  1TV6 A;  1HPZ A;  2GUI A;  2Z1J A;  4CJK A;  4FLW A;  3SV3 A;  4FXD A;  1S1V A;  5JS2 A;  1ITG A;  3V1Q A;  4DQR A;  4CEC A;  4CHZ A;  2LSN A;  4YFU A;  4DTS A;  5I42 A;  2D0C A;  3KK3 A;  3TI0 A;  3TAM A;  4DFK A;  4F3T A;  5J2N A;  3WNG A;  4E19 A;  5D3G A;  5KRT A;  4KTQ A;  4LD0 A;  3QET A;  4ZHR A;  3SUN A;  4AHT A;  2VG6 A;  3MED A;  4B9N A;  4DWI A;  5C42 A;  4W5Q A;  3DLK A;  3O4Q A;  4FM0 A;  2XY7 A;  1NK5 A;  4KHY A;  4FVM A;  4HTU A;  1RDB A;  3HM9 A;  4LSN A;  4CJW A;  3U3Y A;  4CJ4 A;  1LWE A;  3OYF A;  4J2E A;  1BQN A;  4Z4I A;  2QKB A;  1S1W A;  1DLO A;  4MFB A;  3RTV A;  1DTQ A;  4O55 A;  4BE0 A;  4OLA A;  1UA1 A;  3VQ6 A;  3L8B A;  4B3O A;  4DFM A;  4O0J A;  1CZB A;  1T05 A;  1WNS A;  3KJV A;  3F73 A;  2P5O A;  1ZBL A;  3HVR A;  3V9X A;  3TAG A;  2HHT A;  2PY5 A;  3KLF A;  1KSP A;  2IAJ A;  3HYF A;  3PV8 A;  3WNF A;  3OYD A;  4F8R A;  2DFE A;  1KLN A;  4FJ7 A;  2Y1I A;  4H4O A;  5E41 A;  4W5T A;  2ZQB A;  4ELU A;  1JLG A;  2OPS A;  3HL8 A;  4DU4 A;  4CGG A;  4FLX A;  4B08 A;  4DTP A;  1CZ9 A;  3AV9 A;  3DRS A;  4CES A;  3IG1 A;  1NOZ A;  4DU1 A;  2X6S A;  3BDP A;  1RT4 A;  4FLZ A;  3CM6 A;  3JSM A;  1SL0 A;  4N5S A;  3AVC A;  1YTA A;  3PO5 A;  4CGD A;  4HUE A;  1J54 A;  3TR8 A;  3TWH A;  1QQC A;  4GVM A;  1LAV A;  2D0A A;  4IG0 A;  1D5A A;  5EU7 A;  5K14 A;  4CK2 A;  4JRQ A;  1D9D A;  2PYL A;  3IRX A;  3M8Q A;  3SPZ A;  4E1M A;  4RW6 A;  4B9U A;  2X74 A;  2OPQ A;  3NAE A;  3DRP A;  2IDO A;  4CJV A;  3SZ2 A;  4M42 A;  1TKZ A;  1RCH A;  2Q3S A;  3VQE A;  3LPU A;  3SQ1 A;  3OYN A;  1C0M A;  3K58 A;  4DU3 A;  3TAP A;  4J2A A;  3QO9 A;  3RRH A;  1TK0 A;  4CF9 A;  4HCB A;  3S3M A;  1ASV A;  4EZ6 A;  3ZSQ A;  1S1T A;  2ETJ A;  4BWJ A;  5FRO A;  5HRN A;  3QEV A;  2YNI A;  3LP3 A;  3OYJ A;  3L2V A;  4KI6 A;  1U04 A;  4C8M A;  1RT3 A;  4JLH A;  4DSK A;  1RDC A;  3B6P A;  4KHS A;  1RBV A;  3RWU A;  2QK9 A;  3T19 A;  3S9H A;  1XC9 A;  1KVA A;  5HRS A;  4CEZ A;  1IKY A;  2XRI A;  1SL2 A;  4BDZ A;  4DSF A;  2FBT A;  3NGZ A;  2G8V A;  4DSL A;  3SUO A;  2G8U A;  2O4I A;  3I0R A;  3DLE A;  3HPG A;  4ID1 A;  4NCA A;  1RTI A;  1GOA A;  4CFA A;  4DTJ A;  3SCX A;  4BWM A;  5FRN A;  3ZSX A;  4KFB A;  4ICL A;  4H8K A;  3HP6 A;  1Z26 A;  1WLJ A;  4E3S A;  3EYZ A;  1TL3 A;  4DS4 A;  3NF9 A;  3P5J A;  3V9S A;  4CIE A;  4BAC A;  4FJM A;  2Z1H A;  1HJR A;  4DTX A;  1HYS A;  4KB1 A;  4ZTF A;  4M3Z A;  3L2W A;  2G8W A;  1TL1 A;  3S3O A;  3ZSZ A;  3K5L A;  1WSJ A;  3DLB A;  3ITH A;  3OS1 A;  4FJL A;  3RRG A;  2HND A;  3C94 A;  2AJQ A;  2YHA A;  5CY4 A;  5HLF A;  1RTD A;  1TVR A;  1S9G A;  4DTO A;  4F4K A;  4CJE A;  1SKS A;  3T1A A;  3NHG A;  3AO4 A;  4KPY A;  3KKR A;  4CJF A;  3O3H A;  3QEI A;  3RMA A;  1IKW A;  1BGX T;  4FW1 A;  4I7F A;  4LY7 A;  3VN5 A;  3OYB A;  3QEX A;  4B9S A;  3VQ7 A;  4Z4C A;  2XY5 A;  1BI4 B;  4NYF A;  1S5J A;  3SNN A;  1FK9 A;  1FXX A;  3ZT1 A;  4AHS A;  4OPK A;  3OJU A;  2YV0 X;  3QEW A;  1SKW A;  1KRP A;  4BDP A;  4Z4E A;  1TK5 A;  1KVC A;  2D5R A;  3AVK A;  3RMC A;  4K8Z A;  4OKJ A;  4ZTJ A;  2YNG A;  2DFF A;  1KLM A;  1IO2 A;  4FJH A;  4B8A B;  4CJ5 A;  3AVI A;  1IG9 A;  4CCH A;  4KB0 A;  3BGR A;  3SI6 A;  3PUF A;  4FYD A;  3FFI A;  1NOY A;  3KTQ A;  4KI4 A;  3KLI A;  4DLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...