4JLHA

Hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
138
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEFESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 Integrase catalytic core domain
total genus 45
structure length 138
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4jlhA00
4FJGA 3ZSRA 2F96A 3LP3A 4BDZA 3AVNA 3O4NA 2Y1IA 4FJLA 3V9ZA 3ZSVA 1HNVA 2D5RA 1O1WA 4OGCA 5KGWA 1S1WA 3DRRA 4CJ3A 4GVMA 4KI6A 1JLQA 4AHUA 3OYMA 4O0JA 3VQ5A 1KSPA 3CM5A 5JS2A 4B3OA 4O55A 3MECA 4I2PA 4GMJB 3NHGA 1F21A 3HP6A 4KV8A 4FJ8A 1IG9A 3KKRA 1BCOA 1TGOA 3HPHA 4ID5A 1VSEA 4CGFA 3QETA 1KVBA 4HVJA 4OVLA 3S3NA 3VQ9A 4FLWA 4JS5A 3QEXA 4Z4EA 4DQRA 2X6NA 1B9DA 3HM9A 1JLAA 1EX4A 3NGIA 4BE2A 3VQDA 1JLCA 3V9UA 3VQAA 3SZ2A 3MEDA 4B9NA 4M3UA 4FJIA 3SJJA 1C6VA 1JXBA 3KLIA 3OVNA 4ID1A 3QERA 4FJHA 3NAEA 4DQPA 3MXIA 2A1RA 3P1GA 4DFMA 4B08A 2FBVA 4KHQA 1SKSA 4KHWA 2IAJA 4W5RA 4KTZA 4I2QA 2EX3A 4G1QA 3LAKA 3V81A 1TV6A 1RBRA 3KK2A 5KRTA 3IRXA 3L3UA 1A5VA 4NCGA 4E89A 4OKJA 3H08A 2W42A 3OYBA 3KIOA 1MU2A 3HO1A 5E41A 1X9MA 1B92A 4IG3A 3ULDA 1ZBFA 4MQ3A 4CJ5A 5KRSA 4OPKA 4FW2A 4DSEA 3V9WA 4KTQA 3B6OA 1LW0A 3V1OA 5KGXA 4FJKA 3ZSXA 4FLUA 4FJ5A 2XRIA 1JLEA 1NJZA 2KQ2A 4KO0A 4RW9A 1ASUA 3OYNA 5SZTA 2B4JA 4LSNA 4M41A 1J5OA 4BE0A 2PYJA 4FJ7A 5CZ2A 2KW4A 1NOYA 2R7YA 1KLNA 1J54A 4LD0A 2FBXA 3WNFA 4Z4IA 4M42A 1RTHA 1LV5A 2YHBA 5FRNA 1DTQA 2WOMA 1D5AA 1I39A 5SWMA 2LSNA 2BANA 1BCMA 3SQ1A 4FW1A 4CECA 1WNSA 3L2UA 4E7JA 2E6LA 1NK0A 1S9EA 3TR8A 4EZ6A 2GV9A 3VQQA 4QOZB 1A5XA 1Z25A 4LH4A 2ITGA 5KTQA 3VQEA 1U47A 1SL1A 4JRPA 3OYDA 3AO1A 2ATQA 3ZT1A 1NK5A 2ZD1A 5EU7A 4DLEA 3OYIA 1ZYQA 1RT4A 3F73A 2HNZA 4FM1A 2VG5A 4WE1A 4CEOA 2DFFA 3KKSA 1I3AA 4R5PA 1XC9A 3HL8A 4OPJA 2HVHA 1UWBA 2D0CA 1TVRA 3K5MA 4L8RB 3TARA 1TAQA 3AVJA 3DM2A 2YNHA 3VQ8A 4CJEA 2G8FA 1NKBA 2PZSA 1NK7A 2ETJA 3NF8A 3DLGA 4AHVA 3SV3A 4FJNA 3AV9A 2QKBA 3V4IA 3NE6A 3PX6A 2G8IA 2Y1JA 1L5UA 4KREA 2NUBA 1KTQA 4CESA 4Z0UA 2XO7A 4CJQA 4J2BA 4DSFA 2F8TA 3HJFA 4CF1A 3V9SA 3C6TA 4CIFA 3DMJA 3VQ4A 3SQ2A 3VQ7A 2IC3A 3U6FA 4CJKA 3LP2A 3VQPA 2ZE2A 3OYKA 1WLJA 4IFVA 3NH0A 3LPTA 5CYQA 1RTDA 3K59A 5J1EA 4KTWA 5FRMA 3DOKA 2X78A 1YTAA 3IG1A 3L2QA 3SUNA 4CJRA 3CFPA 3AO4A 4DQSA 3TAFA 1RTIA 3EY1A 2P51A 1C1CA 1BI4B 1U04A 1D9FA 1C1AA 1EXQA 1IO2A 3LWMA 2QKKA 1QSYA 3PO5A 1BGXT 3LP1A 4M3RA 3ZCMA 4M3YA 4DMNA 4HHTA 3SUPA 2YV0X 5CYMA 1XWLA 1NJWA 1NK6A 3JYTA 1U49A 3KTQA 2HW3A 5HBMA 1UA0A 3HP9A 4CGGA 2OYQA 4DF4A 1BIZA 4E7HA 1L3TA 3HSTB 4F2SA 1T05A 4CIGA 3VN5A 4YNQA 4HUFA 4IKFA 2KTQA 3HT3A 2PYLA 3OYEA 4KHNA 3DYAA 4Z4GA 4F4KA 1JLBA 1SL0A 5J2QA 3AA2A 2YKNA 4Z4CA 1TK8A 1ITGA 1L3VA 1VSFA 3P5JA 3SQ0A 3LANA 1KLMA 2KZZA 4PY5A 4KKOA 5FDLA 1JLFA 2DTUA 3B6PA 1VRTA 2BDPA 3CFRA 1QQCA 3NF7A 1LW2A 4FK4A 1ASWA 4DTMA 2HMIA 1SL2A 3QEPA 4Z4FA 1RBTA 4CJ4A 1Y97A 3KLEA 2G8UA 1EETA 1XHZA 1R0AA 1NKEA 2XY8A 1RT3A 4IBNA 3K2PA 4CK1A 5I42A 1SKWA 4BDPA 3VQBA 5K14A 1HYZA 5HP1A 4KAZA 4TSXA 4FJXA 3T19A 5C25A 3PX0A 4M3XA 1X1PA 1EP4A 1REVA 3ALYA 5HRNA 3SV4A 2YKMA 5CY4A 4DU1A 3MXMA 4E3SA 1S1TA 1L3SA 3RMBA 2QXFA 3MXJA 3QO9A 4FLYA 3AO5A 4E7KA 2IS3A 3LWLA 4OJRA 3SNNA 2GUIA 1RDAA 4DTNA 1RT7A 4B9LA 4HCBA 3M8QA 4QCLA 1GOBA 4C8MA 4HTUA 4ZTJA 1U45A 1X9WA 3QEWA 4DS4A 4C8OA 3AVCA 3K5LA 3TAPA 4B9TA 4W5QA 5FROA 1UA1A 4CJPA 4B9SA 2JLEA 1C0TA 3TAGA 3ZT3A 3AO3A 1GOAA 3DLRA 4E19A 4CHQA 3T3FA 2P5GA 1N6QA 2FBYA 2O4GA 1BL3A 1VSMA 3DRSA 3TANA 1NJYA 3HVTA 1S5JA 1W9HA 5D3GA 1WAFA 3ZSOA 5J2PA 1KRPA 4N5SA 4NCBA 5DK5A 1J53A 3IS9A 4CJLA 4CEZA 3OY9A 3LZIA 4DFJA 2XY6A 2XY7A 1HRHA 3TI0A 1WSGA 3VA3A 3CM6A 4PUOA 3HPGA 3HK2A 4KI4A 2X74A 5J2MA 2VG6A 2JGUA 3LAMA 3QEIA 3SPZA 3G10A 2G8KA 3PUFA 2PY5A 3NCIA 4CHZA 3I8DA 1DLOA 3D0PA 3S3MA 1HYSA 1RDBA 4FLVA 3F9KA 1TKXA 4CFAA 4CIEA 3RMAA 1TKTA 4QAGA 3THVA 4HCCA 1WSIA 1VSKA 4JLHA 3WNHA 2KFNA 1FKPA 4PA1A 2DFEA 3FFIA 4H8KA 4IG0A 4C8NA 3ZSYA 3ZT4A 3OS0A 4AHTA 1RT5A 1Z26A 3OS2A 3JSMA 4JRQA 4ELUA 4KB1A 3HXMA 3PO4A 1IH7A 3AVAA 4FM0A 4KHUA 2YNGA 4KHSA 3L2RA 4FM2A 3NH1A 1NKCA 1K6YA 4HUEA 4YFUA 3AA5X 1DTTA 4RW7A 1IKWA 1YVUA 4AILC 3SQ4A 4B9UA 4OLAA 3DOLA 3KJVA 2HVIA 1A5WA 1TKZA 2E6MA 2I5JA 4IDKA 4B8CA 4CGIA 3CQ8A 4OKEA 3EZ5A 3OYAA 3KK1A 2HNYA 4B9VA 3S3OA 4M3WA 2VWKA 3MEGA 4AH9A 4DF8A 3RRGA 4B9MA 5HLFA 3LPUA 3OYJA 1XHXA 1BISA 3LDSA 3RMCA 1TAUA 2IGIA 3AVIA 4OGEA 2D0BA 2DFHA 4CEFA 4CJSA 1S9GA 3LALA 1CZ9A 4FJJA 3AA3A 1KFSA 4B8AB 3U3GA 3CG7A 1S1UA 2P5OA 3S9HA 5C42A 3T1AA 1C0MA 1JLGA 3TAMA 4ICLA 3O4QA 4DU4A 4BACA 2B6AA 4DQIA 4DFKA 3L8BA 1SV5A 4LH5A 3OJUA 3PX4A 1QSLA 1VK0A 1ZBLA 2RPIA 3QIOA 4H4OA 4CE9A 3OYHA 4KHYA 1IKYA 4DTPA 4DFPA 1Q9XA 3QIPA 4Q5VA 3V6DA 1LAWA 4FLXA 2HNDA 3G0ZA 3NF6A 2HHVA 3NBPA 4W5OA 4OKKA 1N5YA 1ZBUA 3RRHA 1BQNA 3HPOA 3DLKA 4BWMA 1SKRA 1JXEA 3TABA 1Q9YA 4OLBA 1U4BA 4N47A 4RW8A 1T03A 3QNOA 1NK4A 2G8HA 1QSSA 4J2EA 4PQUA 1BIUA 3VQ6A 2HHWA 2ZQBA 3TAEA 1JL2A 3QINA 4NCAA 1HQEA 1CZBA 2RF2A 4DWIA 2OA8A 3ASMA 3C6UA 2B5JA 4CJWA 4FLZA 3AVKA 3I0SA 5I3UA 4W5TA 3V1RA 4KFBA 3KK3A 2HHUA 3OYLA 1ZBHA 4PWDA 1HMVA 1HQUA 2E4LA 4ZHRA 4UQGA 4BDYA 4K8ZA 3SI6A 4FZXC 2RKIA 3AA4A 4CK3A 4CF2A 3AVLA 3I0RA 4GW6A 2QK9A 3OYGA 1CXQA 3SUQA 1TK0A 1WAJA 3AO2A 4CEQA 3BDPA 2KZMA 3MEEA 1JL1A 1RBVA 1VSDA 3ISNC 2OPQA 5CZ1A 4CERA 4M3TA 4IFYA 4LSLA 2YHAA 1BI4A 3ZSWA 4FZZA 4CGHA 4I9QA 2HHSA 1WSFA 1G15A 1LWFA 5J2NA 4O44A 4F2RA 5C24A 3CYMA 4DSIA 3ZT0A 1Q8IA 1VSHA 4CFBA 4E7IA 3RMDA 1GOCA 3SYZA 2OPSA 1T8EA 4HUGA 1FXXA 4O5BA 3V1QA 2HHQA 4N76A 2DY4A 1RBSA 4DTUA 4NYFA 4CHPA 3RR7A 4O4GA 1VSJA 1NK9A 4CEBA 4CF0A 4FJ9A 3MAQA 4RW6A 1C1BA 2OPPA 4I7FA 3ZSZA 1C0UA 2OZMA 4MFBA 2Z1HA 3WNGA 4RG8A 3SCXA 3E01A 4AHCA 1LWCA 4M3ZA 4KRFA 2IOCA 4CCHA 4F3OA 4DS5A 1RCHA 1B9FA 4Y1DA 3OYCA 3AVHA 4CHYA 3U3YA 4W5NA 3AVMA 1KCFA 4NYNA 4FJMA 1J9AA 3IAYA 4CF8A 4CEDA 1RDDA 4N41A 1LAVA 1EKEA 3AVGA 3A2FA 4FVMA 1RT1A 2YNFA 5HRPA 3AVFA 3OS1A 1D8YA 4M45A 4F8RA 1HPZA 1WSHA 5HRSA 4CJVA 1UAXA 1VSLA 4N56A 1LWEA 4JS4A 3KLFA 3VA0A 3ITHA 3KD5E 2GBZA 1QTMA 4EZ9A 3OYFA 1RDCA 4FK2A 4Q0BA 3O3GA 1RT2A 3L3VA 2XHBA 3M8RA 3L2WA 3DLHA 2HHTA 3DRPA 5DMRA 4EP4A 3NF9A 4C8KA 1QE1A 3K5OA 1TL1A 1NJXA 1FK9A 4DTJA 1IKVA 1HJRA 2XY5A 2F8SA 4XIUA 3NFAA 1WSJA 3O3HA 4K8XA 4CFDA 2O4IA 3KLGA 4CEAA 3KLHA 3RWUA 1TK5A 4E0DA 4KB0A 1RILA 3ZT2A 2YNIA 2G8VA 3C94A 4ZTFA 4DSLA 4EP5A 1U48A 5T7BA 3V9XA 4DTXA 3ZSQA 4CEEA 1BHLA 3L2VA 3NGZA 3K57A 1FKOA 1SUQA 4DG1A 1T7PA 4CJFA 3HYFA 2HHXA 3TAQA 1VSIA 2P1JA 4H4MA 3O3FA 2VG7A 4BE1A 3LZJA 1KFDA 1NK8A 4FYDA 4RW4A 3RTVA 1TKDA 4DLGA 2HB5A 1L3UA 1X9SA 4CHOA 3D45A 4FK0A 4CJUA 2KFZA 4J2DA 2WONA 4I9LA 1S6QA 3M8PA 1RTJA 1BQMA 4CGDA 1YT3A 3LP0A 1RBUA 2Q3SA 1D9DA 1QS4A 3UIQA 1S1XA 4AHRA 1RNHA 2EHGA 3DLBA 3C95A 2D0AA 3QEVA 4DSKA 4CK2A 3KD1E 4DTSA 2X6SA 4DTRA 1HNIA 2Z1IA 3SPYA 2Z1GA 1CXUA 2FBTA 4E7LA 4F3TA 4CHNA 4FZYA 4J2AA 1KVAA 1VRUA 3NH2A 4Y1CA 1XI1A 4C8LA 1YTUA 4CFCA 4KPYA 4DSJA 3M8SA 3QLHA 3P83D 4DU3A 4ELTA 1KVCA 1TL3A 1HYVA 3HVRA 3AVBA 5HROA 3QNNA 1WN7A 2OPRA 2Z1JA 1S1VA 2A1SA 3WNEA 4CJTA 3TWHA 4ELVA 4DTOA 5JS1A 1ASVA 1S6PA 2IDOA 4DQQA 2BGGA 3K5NA 4FXDA 2G8WA 1QHTA 3PV8A 2RN2A 2BE2A 1W0HA 4LY7A 1RT6A 5HRRA 4E1MA 1WSEA 4E1NA 2VWJA 5KI6A 3DLEA 4FCYA 1CLQA 2FC0A 4AHSA 3VQCA 1IKXA 3NDKA 3K58A 1JKHA 1UOCA 4BWJA 4CGJA 4FLTA 4CF9A 4O0IA 2AJQA 3DI6A 3NGYA 2OZSA 3PY8A 3EYZA 3SUOA 1ZBIA 3OJSA 3QESA 3RR8A 4Z4HA 3CFOA 3BGRA 1NOZA
chains in the Genus database with same CATH superfamily
4BDZA 4LF9K 2HSTA 3ZSVA 1HNVA 5B8HA 2D5RA 1S1WA 3WUHA 4AHUA 3OYMA 5JS2A 4I2PA 1IBMK 2H3GX 3DAWA 1IG8A 1QQNA 1TGOA 2YJFA 1VSEA 3QETA 4BRHA 4LC9B 4OVLA 4YORA 4FLWA 2ZF5O 3HM9A 1JLAA 4OPAA 4NB4A 2P9PA 1C6VA 4ID1A 3QERA 3MXIA 2ZM6K 4DFMA 2Q31A 2FBVA 4I2QA 2EX3A 3VF2A 3LAKA 1TV6A 3MX5A 4FWMA 1BA1A 3WEEA 2YX6A 4LF5K 4E89A 4MQ3A 4CJ5A 4DSEA 4KTQA 3ZSXA 4PKHA 4FLUA 1ESVA 2XRIA 2P9UB 4RW9A 3OYNA 1ASUA 4BRMA 4BE0A 2PYJA 3SJHA 3VF4A 4Y0WA 4Z4IA 4M42A 2W6KA 5FRNA 2V7YA 4JK8A 3U9ZA 3THYB 3VESA 1QZ6A 5SWMA 2BANA 1BCMA 1S9EA 3TR8A 2D0PA 2GV9A 3UB5A 4WQ5C 1NGBA 5KTQA 3RVCA 1RFQA 2QEXN 4F9OA 4U7BA 1RT4A 4FM1A 1XC9A 3MDQA 4OPJA 1UWBA 4U67L 4L8RB 3TARA 3WQTA 1TAQA 3AVJA 3VQ8A 4CJEA 1NKBA 1NK7A 2ETJA 3AGKA 4FJNA 4AHVA 2BUPA 3PX6A 3NE6A 2Y1JA 4J2BA 4Z0UA 1NGAA 3CCVN 1HPMA 3V9SA 3C6TA 4CIFA 3VQ4A 5DM6L 4LF6K 3VQPA 2ZE2A 3C6HA 3N4QA 3LPTA 4BR5A 4BRPA 1YTAA 3L2QA 1K8AO 3QFUA 3CFPA 3CC7N 2P9IB 1U04A 4K42A 1D9FA 2NRWA 3O9QA 1BGXT 4M3RA 5IT9O 4M3YA 4DMNA 4HHTA 5CYMA 2O8FA 3THXA 5AQVA 2O8EA 1BIZA 3HSTB 3O6WA 4JN4A 4PL8A 4YNQA 4JHDB 2KTQA 3HT3A 4FWSA 3OYEA 1V4SA 3CCLN 1SL0A 3WXLA 2YKNA 4BR4A 4Z4CA 1TK8A 5KPRA 1K8KA 3KVGA 3ZX2A 3F2KA 1YJNN 4GY2B 1VRTA 1QQCA 5BRDA 1ASWA 2UXBK 4RWTA 4CZGA 1EETA 1XHZA 4BC5A 2XY8A 2EWSA 1BU6O 2W6LA 2ASOA 3FZLA 1EP4A 3ALYA 3SV4A 2W40A 4E3SA 4GV3A 3RMBA 4OX9K 2NRHA 1GLLO 3ENHA 4FLYA 3EEQA 3AO5A 4E7KA 3GOIA 4OJRA 4JKCA 2GUIA 1RT7A 3AAPA 1GOBA 4C8MA 2E2QA 4DS4A 3AVCA 3TAPA 1HNZK 3QMLA 5F0XA 4B9TA 5FROA 1UA1A 1U6ZA 2JLEA 1S22A 3TAGA 3T3FA 5JVGL 3D7EO 1BL3A 4LF4K 4QS9A 1S5JA 5D3GA 4LF8K 1KRPA 4BRAA 5GAEP 5AFUA 4NXNK 1LOTB 1J53A 4CEZA 1QVGM 1HRHA 5M1PA 3VA3A 2E1YA 2X74A 5J2MA 4JI0K 2JGUA 4K0KK 2PY5A 1OH6A 3FFKB 4IO9L 4IZ9A 4FLVA 3M6GA 4QAGA 4JLHA 2UXCK 3CIPA 1FW6A 4IG0A 4JS5A 1RT5A 4ELUA 1IH7A 4FM0A 2PAVA 3ENOA 1NKCA 1K6YA 2O8DA 4PL7A 2HVIA 3R8EA 1TKZA 2NRZA 2I5JA 1NMDA 4OKEA 2HNYA 4AH9A 3IMXA 3OYJA 3LDLA 4BRLA 3RMCA 3SMPA 1TAUA 3AVIA 4JYAK 4FSVA 5GAGP 3NVKA 3LALA 1KFSA 3HBTA 2P5OA 3S9HA 1HNXK 1JLGA 4BRNA 1T6CA 3UKRA 2KZZA 2AJQA 1ZBLA 3QIOA 4DFPA 3LDQA 3QIPA 4A5BA 2Q1NA 4WYBA 1BQNA 3HPOA 4CJ7A 4OLBA 2QWOA 3OW2M 3QNOA 3CCUN 3ATUA 4FWRA 4NCAA 1JL2A 4BG8A 3UKUB 4FLZA 3AVKA 3I0SA 3CF5L 4W5TA 3KK3A 3BF3A 4ZHRA 1NJIO 2RKIA 1VHXA 3AA4A 4WFNL 4FO0A 5EXWA 1NGFA 3AVLA 5AQTA 5M1OA 1CXQA 2KZMA 3AO2A 3ISNC 5CZ1A 2OPQA 4M3TA 4BRIA 2D4WA 4H5WA 4JKGB 4LSLA 1Q82O 3ZSWA 2GWJA 4MLHA 1G15A 1Q81O 2E8AA 3BZCA 4E7IA 5AQZA 3MWPA 3CJBA 3SYZA 3V1QA 2HHQA 1NK9A 4CF0A 3RSEB 3ZSZA 4JKHA 1LWCA 4M3ZA 4OO1J 4KRFA 4F3OA 4GNIA 4Y1DA 1IV0A 3U3YA 4W5NA 4FJMA 1J9AA 3O9UA 3IAYA 4DHYA 4DR2K 2JWKA 3ATVA 4N41A 3OS2A 4DQSA 3AVGA 3A2FA 3VEYA 1RT1A 2YNFA 4WFAL 3CC4N 3DXKB 1VSLA 1LWEA 4H0PA 4JEPA 3VA0A 5LL6Z 3KD5E 2GBZA 1NM1A 3KHYA 4FK2A 1TYQB 1RT2A 2RHKA 3DRPA 5DMRA 1TL1A 1NJXA 1IKVA 1VQ8N 4DV0K 1WSJA 3O3HA 4CFDA 2W41A 3KLGA 4CEAA 3DWLA 4BQZA 5LMUK 1YJWN 4DTXA 5AR0A 1T7PA 1SUQA 1NMNA 4DR7K 3WT0A 2P1JA 3O3FA 3MCAB 3SK3A 1TKDA 4BVPA 3WXKA 3D45A 2E2OA 3IUCA 4CZFA 2P9SB 3BZKA 1BQMA 2VQEK 5BR8K 3LP0A 4DV1K 1RBUA 2Q3SA 1QS4A 3UIQA 4AHRA 2V7ZA 2EHGA 3SPYA 2Z1GA 5BRFA 4CHNA 4H5TA 4BGBA 1YTUA 4B1ZA 4DSJA 4JI4K 3M8SA 3I8BA 1HYVA 2OPRA 1K9MO 1S1VA 3GBTA 4DTOA 5JS1A 4IOCL 4DQQA 4X66K 3PV8A 4LY7A 2GELA 5HRRA 4E1MA 1CLQA 4AHSA 4FWPA 3W0LA 1UOCA 4CGJA 4YDUA 4FLTA 4KH4A 4H0VB 4BGAA 2OZSA 3R9PA 4JNEA 1BWFO 4NLBA 2Y1IA 3L4QA 1SAZA 5KGWA 3ZX0A 1Q7YO 4KI6A 1JLQA 1R59O 3W3DA 1WOQA 4FWNA 3CM5A 3MECA 3A5MC 4GMJB 3THXB 4KV8A 4MLEA 5BREA 5C0YA 1T44A 4FJ8A 1IG9A 4FWLA 3E9PA 1BCOA 3KKRA 4CGFA 1GLEG 4HVJA 1BA0A 3S3NA 3VQ9A 2FSJA 3FE1A 4Z4EA 4DQRA 2FLOA 3NGIA 5EVZA 2Q0UA 3VQAA 4M3UA 4FJIA 5KQDA 5AFUH 5CHIA 1C0FA 2A1RA 1KXPA 4JI5K 2IAJA 4KTZA 3TSPA 4G1QA 4DCHA 4CZMA 3KK2A 2AP1A 4YY3K 3H08A 2W42A 3LDNA 4JI7K 3HO1A 5E41A 4FOIA 4JKFA 4FW2A 4QS7A 3V9WA 3B6OA 1LW0A 3V1OA 4FJKA 4JI3K 4FJ5A 2UUAK 4PHTX 4KO0A 1C0GA 2RE2A 1HUXA 4YOVA 4JK9A 3G71N 2KW4A 2OCEA 1NOYA 1KLNA 3SAHA 3ZYYX 4FPBA 2UXDK 1LV5A 2YHBA 1D5AA 2WBNA 2LSNA 3SQ1A 4FW1A 4CECA 5AQGA 2ZWHA 1NK0A 3OTOK 5HOOA 2VYPA 4QOZB 1Z25A 4LH4A 5F2RA 4JRPA 3OYDA 4DLEA 3WXIA 3F73A 4WE1A 2DFFA 3KKSA 1U2VB 3OA9A 4ILGB 2A41A 2ZGZA 1JCGA 2G8FA 2P9NB 4L3QA 3SV3A 4X62K 2F9WA 1KTQA 4CESA 4CJQA 2CH6A 4DSFA 3DMJA 4A2BA 3SQ2A 3VQ7A 2IC3A 1SQKA 3OYKA 4IFVA 4YDUC 3NH0A 3CD6N 1LCUA 1XC3A 3DXMA 5J1EA 4CZIA 5FRMA 3DOKA 1ATSA 3CC2N 3EKSA 4CJRA 4KH5A 3EY1A 3LM2A 1BI4B 1C1AA 1EXQA 3LWMA 3PO5A 4DV2K 5C2DA 1HKCA 1XNRK 2HOEA 4O8KA 1JJ2M 1WUAA 1NJWA 1U49A 4BC3A 3HP9A 4XH4A 4CGGA 4B1XB 2OYQA 4E7HA 4HUFA 2PYLA 3DYAA 1BG3A 4F4KA 5AZIA 3C6AA 1WBDA 1L3VA 4CD3A 4JKBA 3SQ0A 2Q0RA 1KLMA 2O8CA 1IBKK 5FDLA 1JLFA 4A59A 5GINA 3I56N 5TKWA 4DTMA 1SL2A 3QEPA 2E2NA 3MN5A 1RBTA 4CJ4A 1Y97A 2G8UA 5JLFA 1R0AA 1NKEA 4IFEA 5I42A 3C7NB 3CCQN 4BDPA 4DV6K 4KAZA 4H5RA 3SAGA 3PX0A 4M3XA 1X1PA 1REVA 4DU1A 5CY4A 1L3SA 1Y64A 3QO9A 5AZJA 3LWLA 5KPZA 3O1WA 4B9LA 4DTNA 3CPWM 4QCLA 5H1SQ 1U45A 3PLAA 3K5LA 4CZEA 4BRGA 3EN9A 5FPNA 3VPZA 2QA4N 1CZAN 4W5QA 1TYQA 3ZT3A 2P5GA 5BN9A 2FBYA 4NXMK 1HLUA 2P9SA 3DRSA 2Q97A 3TANA 1VQLN 3HVTA 3UE5A 2WFBA 4JI1K 3B8AX 3T1HK 2QWLA 1WAFA 5J2PA 1DEJA 4N5SA 5DK5A 2XY6A 1YJ9N 3TI0A 4PUOA 3CM6A 1N32K 2J4RA 2VG6A 3FZMA 3QEIA 3G10A 2G8KA 3QBWA 2QWQA 4FPAA 3I8DA 2Q36A 3CI5A 1HYSA 4CIEA 1TKXA 3R6MA 4CFAA 4HCCA 1WSIA 3HI0A 2KFNA 2D1KA 2DFEA 4H8KA 3ZT4A 4C8NA 5J2QA 3CCMN 1Z26A 3JSMA 4JRQA 1MA9B 3PO4A 3AVAA 4KHSA 3L2RA 4FM2A 4EHTA 1N33K 1M1KO 3JXUA 1OH5A 4HUEA 1DTTA 4RW7A 1P8ZA 4M7YA 1IKWA 3D2EB 2FXUA 3DXKA 2OTJN 5AQRA 2GUPA 4IDKA 2ZJPL 1Q18A 4B8CA 5AQPA 4BG9A 1IBLK 3OYAA 4B9VA 1ILYA 3J81O 2O8BB 3UKUA 3RRGA 4B9MA 3O1BA 3LPUA 4JKAA 1BISA 3LDSA 4BREA 2DFHA 3ULEA 1S9GA 3RSEA 4IXCA 3CG7A 3T1AA 3TAMA 4ICLA 3C7NA 3O4QA 4DQIA 1QSLA 3PX4A 3OJUA 4E1JA 4KHYA 1Q9XA 3V6DA 4H0YB 5JICA 4JKGA 4BRFA 4CVNE 4OKKA 2HBKA 3RRHA 1SKRA 4BWMA 2VWBA 1KC8O 1U4BA 1NNEA 2O8CB 4RW8A 1T03A 4PQUA 2ZQBA 3QINA 1CZBA 1VQMN 1Z05A 4DWIA 2OA8A 2QWRA 5AQSA 2E1ZA 5I3UA 3T7ZA 3OYLA 4PWDA 1HMVA 2QXLA 4K8ZA 3BEXA 3GG4A 4BRDA 2YHWA 4CF2A 3Q7CA 3OYGA 4B9QA 3SUQA 1NGCA 1TK0A 2CH5A 3BDPA 4CEQA 2O8DB 4CERA 2NRVA 1VSDA 3KWIA 4IFYA 1NGIA 3CCSN 4KBOA 5J2NA 1GLCG 5C24A 3RMDA 1GOCA 3ZETB 3MWTA 4HUGA 1FXXA 4O5BA 2Q2RA 3DXMB 4JK7A 2KLAA 3RR7A 5M1NA 1VSJA 4RW6A 3SLCA 2YI1A 4MFBA 3E01A 4AHCA 4CCHA 1NGDA 4DS5A 3C0BA 4CHYA 5JLHA 1VQNN 3AVMA 3D6RA 4NYNA 4DKWA 1NGGA 4G9ZA 4CF8A 4YOTA 4YOWA 4IDHA 4DUYK 1RDDA 2NNWA 4FVMA 3OS1A 1D8YA 3VTHA 4F8RA 1U2VA 5HRSA 4AM6A 5C10A 3CMEN 3IDHA 4EZ9A 1Z6RA 2V52B 3M8RA 3L2WA 3NF9A 3K5OA 4DTJA 3AAQA 4H5VA 4XIUA 2F8SA 4DQ8A 3VEWA 4K8XA 5BPNA 3KLHA 3J7AP 4E0DA 3CERA 2G8VA 5T7BA 3V9XA 5E84A 3P4IA 5KQ8A 3K57A 3NGZA 4DG1A 3HYFA 5AQIA 2I7PA 1NK8A 4FYDA 5A2QO 1L3UA 3LL3A 4XEIA 4JI8K 1QHAA 2WONA 4AF1A 1RTJA 4CGDA 1OVYA 3QEVA 4LFBK 1VAZA 2Z1IA 4E7LA 1CXUA 1NBWA 1KVAA 4A5AA 4ILJA 5LY3A 4BROA 1XI1A 5EX5A 4CFCA 4KPYA 4LFCK 2ZGYA 4JV5K 2O8EB 1KVCA 1TL3A 3AVBA 5HROA 3QNNA 1WN7A 2A1SA 3TWHA 2NRTA 1FJGK 1ASVA 2IDOA 3VEOA 2BGGA 4GKJK 2IVPA 3TPQA 2G8WA 2KHOA 2RN2A 1RT6A 3TTDA 3O4WA 5C15A 3VQCA 1IKXA 3MN9A 1E3MA 5LJVA 3HTVA 3EYZA 3SUOA 3WEEB 5AQKA 3EL2A 3ENBA 3CFOA 1NOZA 1K8KB 2F96A 3LP3A 3AVNA 3O4NA 3V9ZA 4EHUA 5TKYA 4JKDA 4OGCA 4JHDA 4CJ3A 2HF3A 4B3MK 1GLJO 3VQ5A 4YHHK 1YI2N 1QQOA 3NHGA 1F21A 3HP6A 1ZXOA 5M1FA 3TSUA 2YHYA 4BRCA 4MO4A 4IEIA 1EX4A 3T69A 3VMFB 3HRGA 1JLCA 3V9UA 3SZ2A 3MEDA 4B9NA 3H1VX 3SJJA 3E1YA 4FJHA 4DQPA 1G99A 3P1GA 4B08A 4W5RA 3U9DA 3R1XA 4H5NA 3V81A 1RBRA 2WC9A 3KWGA 5KRTA 3IRXA 3L3UA 3E9LA 4J8FA 4OKJA 3OYBA 3U8XA 3KIOA 3Q7BA 1X9MA 1B92A 4IG3A 5E26A 2F4VK 4OPKA 5KRSA 1EO1A 2GWKA 3VGLA 1JLEA 4BR9A 1NJZA 1VQ4N 4LSNA 4M41A 1J5OA 4FJ7A 2R7YA 1J54A 2HBLA 3KZBA 3FGUA 4ILHA 3KK7A 3H6EA 3P38A 1WNSA 3L2UA 4E7JA 1GLAG 3BP8A 2ITMA 3CMAN 3VQQA 1A5XA 2ITGA 4UY8O 1XMQK 3AO1A 1NK5A 1ZYQA 3WQUA 2YCHA 2HNZA 4CEOA 2VG5A 4X65K 3VGKA 1P90A 2D0CA 1TVRA 3K5MA 4R79A 2ZJQL 2YNHA 2WUSA 3NF8A 3DLGA 3T1YK 3AV9A 4CBUA 2G8IA 3NVMA 2F8TA 4CF1A 3K0SA 1MWKA 3U6FA 4CJKA 3LP2A 3SBTA 5CYQA 4CW7B 3K59A 4WCEL 3AO4A 3TAFA 1RTIA 3F5TA 4WQ5A 2HBMA 2DPNA 3VTIA 3SUPA 1XWLA 1NK6A 3KTQA 3JS6A 1WB9A 1UA0A 1L3TA 1T05A 5AQXA 4X64K 4KHNA 2HMPA 1DKGD 1YXQA 1VSFA 5M1KA 1SS6A 3P5JA 4V19S 4NO7A 4MO5A 4KKOA 2VGNA 2DTUA 3B6PA 2BDPA 3CFRA 1KD1O 1LW2A 4K25A 4FK4A 3QB0A 4DV7K 3KLEA 2F7TA 4IBNA 1RT3A 1XNQK 3K2PA 1QQMA 3VQBA 4HWIA 5CR4A 4YOUA 2P9LA 4TSXA 3T19A 1VQPN 3MCPA 3ULEB 2YKMA 3MXMA 3MXJA 2OTLN 3MX2A 3SNNA 2YHXA 2PFUA 4PKGA 1RDAA 3M8QA 5BN8A 1VQ6N 4HTUA 3MN6A 3QEWA 4C8OA 3EE8A 4M7XA 1C0TA 3K9JA 5ADXH 1H1VA 1XMOK 4E19A 4CHQA 1GOAA 3EZWA 3VF6A 3QDKA 2O4GA 4DV3K 1VSMA 4CBWA 4IOAL 3SAFA 1KQSM 3EKUA 3ZSOA 1YF5L 4FVUA 3CHWA 4DR5K 3OBWA 3OY9A 4DFJA 3AGRA 2XY7A 1M90O 5AQWA 1WSGA 3HPGA 4KI4A 3SPZA 3OBYA 3CXCM 3PUFA 4CHZA 1DLOA 4HTLA 2HF4A 3L6QA 3F9KA 3RMAA 1TKTA 4MDBA 3LM9A 1VSKA 3R3LA 2E5LK 1FKPA 1O13A 3FFIA 3FZHA 3M3ZA 4KB1A 1W7AA 2VGMA 4EFHA 2HHHK 3HOSA 3NH1A 1EQYA 3AA5X 3SQ4A 4OLAA 1A5WA 2E6MA 4CGIA 3CQ8A 4BC2A 1VQKN 3S3OA 4M3WA 2VWKA 3MEGA 4JI6K 2OANA 5AZJB 5HLFA 2UUBK 1T6DA 1X3MA 4Z94A 4CEFA 4OGEA 2D0BA 4CJSA 3G6EN 1CZ9A 4FJJA 3AA3A 5JMVA 3L4IA 1KAYA 5AQFA 5C42A 1C0MA 4DU4A 4M63C 4BACA 5AQUA 1N36K 4LH5A 1VK0A 2RPIA 4FWKA 4H4OA 4H0XB 1YAGA 3LDPA 4Q5VA 1LAWA 3QBXA 2HHVA 3NBPA 3DLKA 5FLXO 1Q9YA 1JXEA 3TABA 3DJCA 3VENA 3O9RA 4J2EA 1NK4A 2G8HA 1QSSA 2HHWA 1BIUA 3VQ6A 5IWAK 1HQEA 5C2FA 5AQQA 3ASMA 5AZIB 1RGIA 4KFBA 1ZBHA 1HQUA 2E4LA 4BR2A 2BTFA 4UQGA 2A6AA 5M1QA 1BOTO 4CK3A 1NG9A 3QICA 4B3RK 1WAJA 3MEEA 2QWNA 1JL1A 1RBVA 4NLCA 4BR7A 5KPTA 1BI4A 4CGHA 4I9QA 1QZ5A 2HHSA 1WSFA 1LWFA 3K9KA 4O44A 4F2RA 3CYMA 3ZT0A 1Q8IA 4QS8A 1E4GT 1T8EA 3I33A 2DY4A 4N76A 1RBSA 2GTDA 3M5RA 2OPPA 1NGEA 1OKJA 2Z1HA 4RG8A 3PSIA 3CJ9A 2IOCA 3ID8A 4XH1A 3GE1A 1B9FA 4BR0A 3AVHA 3O8MA 2P9NA 1ATNA 5FPMA 1DT9A 1WSHA 4IJAA 2FSKA 4BY9C 5BRHA 1RDCA 4Q0BA 2HHTA 4ISEA 3L3VA 3O3GA 2XHBA 4EP4A 4LF7K 1QE1A 1FK9A 2XY5A 3NFAA 3EE9A 4B1UB 2O4IA 1MWMA 4KB0A 2QWMA 3ZT2A 3ZLJA 4I6MB 1SZ2A 1FKOA 3G25A 4IJNA 1OH7A 1HR0K 3TAQA 3MK6A 3P39A 4H4MA 3A5NC 5LMNK 2VG7A 3O9TA 4O5FA 3CCEN 3RTVA 2HB5A 3MMVA 4CHOA 4FWQA 4FK0A 2KFZA 4ISFA 4I9LA 1S6QA 3ZEUB 2E20A 3CQYA 3I55N 1HKBA 1S1XA 1RNHA 4DSKA 3DLBA 3KD1E 4ISGA 4DTRA 1S3XA 1NU0A 4A2AA 1N8RO 4IOXA 4FZYA 5LJWA 4J2AA 4Y1CA 3QLHA 3VERA 3E9OA 3P83D 4ELTA 3HVRA 2Z1JA 3CPEA 4CJTA 3HOTA 1HKGA 3K5NA 4FXDA 1QHTA 4C1NK 4CZKA 2BE2A 4CD1A 1WSEA 2VWJA 3EO3A 3DLEA 4FCYA 5GIOA 1JKHA 2HBJA 3CJCA 3DI6A 2VQFK 3OJSA 3QESA 1T3VA 2AA4A 4CBXA 3BGRA 2IVNA 4FJGA 2QTDA 3ZSRA 5AQYA 4FJLA 4B3SK 3O08A 1O1WA 3D2FB 1WBBA 3DRRA 2FF6A 4GVMA 4FL9A 2FF3B 4O0JA 3A5LC 4DUZK 1KSPA 1EWRA 4B3OA 4O55A 3WXJA 4BRQA 4MDAA 5AQLA 4DV4K 3HPHA 4ID5A 3TU5A 1KVBA 3H3OB 3QEXA 2X6NA 1B9DA 5FPEA 2FSNA 4BE2A 3VQDA 1W2BM 2NZTA 1YIJN 3A5OC 1JXBA 3KLIA 3OVNA 3NAEA 3THYA 4CZLA 1VQ7N 4KHQA 1SKSA 4KHWA 4A61A 3OHRA 3H1QA 3G4SN 4DR4K 2A3ZA 3CJ7A 1X3NA 1A5VA 4NCGA 2D0OA 2P9UA 1HX1A 1NWKA 2KKZA 1MU2A 1NLVA 1J5EK 3ULDA 1ZBFA 2QM1A 5KGXA 3FZFA 4JD2A 2KQ2A 5SZTA 2B4JA 2CGLA 3M1FA 3J7YP 4BVOA 4BQLA 5CZ2A 5C12A 3WNFA 4LD0A 2FBXA 1RTHA 1HNWK 1DTQA 2WOMA 1I39A 3NMUA 3BY5A 4BC4A 2E6LA 3VOVA 2P9PB 3VGMA 2WTUA 3LDOA 4EZ6A 4KHPK 1I94K 1U47A 1JCEA 3VQEA 5AQMA 1SL1A 2ATQA 3A0IX 3ZT1A 5CE3A 3H46O 2ZD1A 5EU7A 3OYIA 4K43A 4FWOA 4B1YB 4JD2B 4R5PA 1I3AA 3HL8A 2HVHA 4LFAK 1K73O 4CI6A 1RDUA 3DM2A 4CZHA 2PZSA 3P31A 1YVNA 3PIPL 2QKBA 3V4IA 1L5UA 4JAXA 2UUCK 4KREA 2NUBA 2XO7A 3TTFA 3HJFA 4I6MA 1ATRA 2ASPA 1WLJA 5EY4A 1RTDA 5DM7L 3A8YA 4KTWA 2PBDA 2X78A 3IG1A 3SUNA 2P51A 1C1CA 4GV6A 1IO2A 2A40A 2QKKA 1QSYA 3LP1A 4DV5K 3ZCMA 2A42A 2YV0X 4RCHA 3CCRN 3JYTA 4A62A 2UU9K 2HW3A 5HBMA 3PIOL 4DF4A 2VCPA 4F2SA 4CIGA 3VN5A 4IKFA 4Z4GA 4PKIA 1JLBA 3AA2A 1ITGA 3BUZB 3LANA 4PY5A 3FLCO 3THWA 3NF7A 1XQSC 1GLBG 2HMIA 3N4PA 3JAMO 4Z4FA 1OH8A 4DR3K 4KH6A 3UKRB 2QWPA 4CK1A 1SKWA 5K14A 1HYZA 5HP1A 3DLLL 4FJXA 5C25A 4H0TB 5HRNA 3AY9A 1S1TA 4FOEA 4WQ4C 2QXFA 4WFBL 2IS3A 4HCBA 4ZTJA 1X9WA 1TUYA 2QI2A 3VEVA 2P9KA 2E88A 1YHQN 4CJPA 4B9SA 3AO3A 3DLRA 1VQ5N 1N6QA 3ZEUA 1XUPO 1NJYA 5MLCQ 1YITN 1W9HA 3H3NO 2ASMA 3O80A 3SBGA 4NCBA 3ID6A 3IS9A 4DR6K 4CJLA 4H03B 3LZIA 4WF9L 2CGKA 3BF1A 1D4XA 3VEZA 3HK2A 1VQON 3LAMA 5AQOA 1W97L 3J7ZO 3NCIA 4GKKK 4RTFD 4CZJA 1YUWA 3D0PA 3ZX3A 3S3MA 1RDBA 4C1NI 3THVA 3L0QA 3WNHA 4PA1A 3ZSYA 2GEMA 3OS0A 4AHTA 3HXMA 4KHUA 2YNGA 2NRXA 1Q86O 4YFUA 1YVUA 4AILC 3AARA 2P9KB 4B9UA 1KAXA 3DOLA 3KJVA 3CJ1A 4K41A 4YOXA 3EZ5A 3KK1A 5ELZA 4DF8A 1J6ZA 1XHXA 2BH1A 2IGIA 3GDQA 4GV9A 4B8AB 3U3GA 1S1UA 5HL7L 1VQ9N 1BDGA 1V4TA 2CGJA 3O9SA 3TSQA 3ZETA 2B6AA 4DFKA 3L8BA 1SV5A 3S41A 3OYHA 4CE9A 1IKYA 4DTPA 4FLXA 5JVHL 2HNDA 3G0ZA 3NF6A 4W5OA 1N5YA 1ZBUA 3O5BA 4A57A 3PSFA 1EWQA 4N47A 3IFRA 1BO5O 4H0OA 4AM7A 3TAEA 2RF2A 1E4FT 3C6UA 2B5JA 4O8UA 1RDWX 4CJWA 1BUPA 3E66A 3V1RA 2HHUA 1X9JA 2GX9A 4BDYA 3VETA 4B1WB 3SI6A 4FZXC 2O8FB 4WQ4A 3I0RA 3QFPA 4GW6A 2QK9A 4JI2K 3FZKA 2P9LB 4BRKA 4IO8A 2YJEA 2E2PA 2YHAA 5F1XA 2P9IA 4FZZA 1OVQA 1GLDG 4DB3A 4DSIA 3HZ6A 1VSHA 4CFBA 4AQYK 1GLFO 2OPSA 5I9EB 2F9TA 4JKEA 3GL1A 4DTUA 4NYFA 4CHPA 4O4GA 1ZBSA 4IWVA 4GVEA 4CEBA 3THWB 3MAQA 3VEXA 4FJ9A 1C1BA 4I7FA 2OZMA 1C0UA 1NGHA 3WNGA 3SCXA 3HSCA 1RCHA 3OYCA 4IEEA 2O8BA 1QVFM 1KCFA 1HJOA 1S72N 4CEDA 1LAVA 1EKEA 5HRPA 3AVFA 1DGKN 4M45A 3CCJN 3D2EA 1HPZA 4N56A 2QW9A 1UAXA 3IKMA 4CJVA 1IJJA 5BPMA 3KLFA 4JS4A 3ITHA 3TTCA 1QTMA 3CETA 3OYFA 3DLHA 4C8KA 1HJRA 5AQNA 4B3TK 3CJAA 3RWUA 2V51B 3WXMB 1TK5A 1RILA 2JWLA 2YNIA 3C94A 2ZJRL 4ZTFA 5BR9A 4DSLA 4EP5A 4YOYA 4C23A 1U48A 3ZSQA 4CEEA 1BHLA 5BPLA 3L2VA 4CJFA 2HHXA 1VSIA 4EIAA 3F9MA 1KAZA 4BE1A 3H45C 1KFDA 3LZJA 5EOYA 4RW4A 3J80O 4DLGA 5ADXA 3U4LA 5GADP 1X9SA 2I7NA 1JCFA 4B1VA 3J8AA 4CJUA 4J2DA 3SMSA 2UYTA 3M8PA 1MDUB 1YT3A 1D9DA 3HM8A 2NRRA 5AJ3K 3CQXA 3C95A 2D0AA 4CK2A 3FR0A 1NGJA 5GAHP 2X6SA 4DTSA 1HNIA 4F3TA 2FBTA 1VRUA 4EAHD 3NH2A 1N34K 3C65A 4C8LA 2NLXA 3MN7A 4DU3A 2A5XA 4XH5A 3WNEA 4ELVA 1S6PA 4OPHA 2IVOA 1TUUA 1W0HA 4E1NA 5KI6A 2FC0A 3K58A 3NDKA 4DR1K 4BWJA 4CF9A 5AQHA 4O0IA 3D2FA 3NGYA 1ZC6A 5AQJA 2IIRA 3PY8A 1ZBIA 5FPDA 5GIPA 3RR8A 4Z4HA
chains in the Genus database with same CATH topology
4FJGA 3ZSRA 2F96A 3LP3A 4BDZA 3AVNA 3O4NA 2Y1IA 4FJLA 3V9ZA 3ZSVA 1HNVA 2D5RA 1O1WA 4OGCA 5KGWA 1S1WA 3DRRA 4CJ3A 4GVMA 4KI6A 1JLQA 4AHUA 3OYMA 4O0JA 3VQ5A 1KSPA 3CM5A 5JS2A 4B3OA 4O55A 3MECA 4I2PA 4GMJB 3NHGA 1F21A 3HP6A 4KV8A 4FJ8A 1IG9A 3KKRA 1BCOA 1TGOA 3HPHA 4ID5A 1VSEA 4CGFA 3QETA 1KVBA 4HVJA 4OVLA 3S3NA 3VQ9A 4FLWA 4JS5A 3QEXA 4Z4EA 4DQRA 2X6NA 1B9DA 3HM9A 1JLAA 1EX4A 3NGIA 4BE2A 3VQDA 1JLCA 3V9UA 3VQAA 3SZ2A 3MEDA 4B9NA 4M3UA 4FJIA 3SJJA 1C6VA 1JXBA 3KLIA 3OVNA 4ID1A 3QERA 4FJHA 3NAEA 4DQPA 3MXIA 2A1RA 3P1GA 4DFMA 4B08A 2FBVA 4KHQA 1SKSA 4KHWA 2IAJA 4W5RA 4KTZA 4I2QA 2EX3A 4G1QA 3LAKA 3V81A 1TV6A 1RBRA 3KK2A 5KRTA 3IRXA 3L3UA 1A5VA 4NCGA 4E89A 4OKJA 3H08A 2W42A 3OYBA 3KIOA 1MU2A 3HO1A 5E41A 1X9MA 1B92A 4IG3A 3ULDA 1ZBFA 4MQ3A 4CJ5A 5KRSA 4OPKA 4FW2A 4DSEA 3V9WA 4KTQA 3B6OA 1LW0A 3V1OA 5KGXA 4FJKA 3ZSXA 4FLUA 4FJ5A 2XRIA 1JLEA 1NJZA 2KQ2A 4KO0A 4RW9A 1ASUA 3OYNA 5SZTA 2B4JA 4LSNA 4M41A 1J5OA 4BE0A 2PYJA 4FJ7A 5CZ2A 2KW4A 1NOYA 2R7YA 1KLNA 1J54A 4LD0A 2FBXA 3WNFA 4Z4IA 4M42A 1RTHA 1LV5A 2YHBA 5FRNA 1DTQA 2WOMA 1D5AA 1I39A 5SWMA 2LSNA 2BANA 1BCMA 3SQ1A 4FW1A 4CECA 1WNSA 3L2UA 4E7JA 2E6LA 1NK0A 1S9EA 3TR8A 4EZ6A 2GV9A 3VQQA 4QOZB 1A5XA 1Z25A 4LH4A 2ITGA 5KTQA 3VQEA 1U47A 1SL1A 4JRPA 3OYDA 3AO1A 2ATQA 3ZT1A 1NK5A 2ZD1A 5EU7A 4DLEA 3OYIA 1ZYQA 1RT4A 3F73A 2HNZA 4FM1A 2VG5A 4WE1A 4CEOA 2DFFA 3KKSA 1I3AA 4R5PA 1XC9A 3HL8A 4OPJA 2HVHA 1UWBA 2D0CA 1TVRA 3K5MA 4L8RB 3TARA 1TAQA 3AVJA 3DM2A 2YNHA 3VQ8A 4CJEA 2G8FA 1NKBA 2PZSA 1NK7A 2ETJA 3NF8A 3DLGA 4AHVA 3SV3A 4FJNA 3AV9A 2QKBA 3V4IA 3NE6A 3PX6A 2G8IA 2Y1JA 1L5UA 4KREA 2NUBA 1KTQA 4CESA 4Z0UA 2XO7A 4CJQA 4J2BA 4DSFA 2F8TA 3HJFA 4CF1A 3V9SA 3C6TA 4CIFA 3DMJA 3VQ4A 3SQ2A 3VQ7A 2IC3A 3U6FA 4CJKA 3LP2A 3VQPA 2ZE2A 3OYKA 1WLJA 4IFVA 3NH0A 3LPTA 5CYQA 1RTDA 3K59A 5J1EA 4KTWA 5FRMA 3DOKA 2X78A 1YTAA 3IG1A 3L2QA 3SUNA 4CJRA 3CFPA 3AO4A 4DQSA 3TAFA 1RTIA 3EY1A 2P51A 1C1CA 1BI4B 1U04A 1D9FA 1C1AA 1EXQA 1IO2A 3LWMA 2QKKA 1QSYA 3PO5A 1BGXT 3LP1A 4M3RA 3ZCMA 4M3YA 4DMNA 4HHTA 3SUPA 2YV0X 5CYMA 1XWLA 1NJWA 1NK6A 3JYTA 1U49A 3KTQA 2HW3A 5HBMA 1UA0A 3HP9A 4CGGA 2OYQA 4DF4A 1BIZA 4E7HA 1L3TA 3HSTB 4F2SA 1T05A 4CIGA 3VN5A 4YNQA 4HUFA 4IKFA 2KTQA 3HT3A 2PYLA 3OYEA 4KHNA 3DYAA 4Z4GA 4F4KA 1JLBA 1SL0A 5J2QA 3AA2A 2YKNA 4Z4CA 1TK8A 1ITGA 1L3VA 1VSFA 3P5JA 3SQ0A 3LANA 1KLMA 2KZZA 4PY5A 4KKOA 5FDLA 1JLFA 2DTUA 3B6PA 1VRTA 2BDPA 3CFRA 1QQCA 3NF7A 1LW2A 4FK4A 1ASWA 4DTMA 2HMIA 1SL2A 3QEPA 4Z4FA 1RBTA 4CJ4A 1Y97A 3KLEA 2G8UA 1EETA 1XHZA 1R0AA 1NKEA 2XY8A 1RT3A 4IBNA 3K2PA 4CK1A 5I42A 1SKWA 4BDPA 3VQBA 5K14A 1HYZA 5HP1A 4KAZA 4TSXA 4FJXA 3T19A 5C25A 3PX0A 4M3XA 1X1PA 1EP4A 1REVA 3ALYA 5HRNA 3SV4A 2YKMA 5CY4A 4DU1A 3MXMA 4E3SA 1S1TA 1L3SA 3RMBA 2QXFA 3MXJA 3QO9A 4FLYA 3AO5A 4E7KA 2IS3A 3LWLA 4OJRA 3SNNA 2GUIA 1RDAA 4DTNA 1RT7A 4B9LA 4HCBA 3M8QA 4QCLA 1GOBA 4C8MA 4HTUA 4ZTJA 1U45A 1X9WA 3QEWA 4DS4A 4C8OA 3AVCA 3K5LA 3TAPA 4B9TA 4W5QA 5FROA 1UA1A 4CJPA 4B9SA 2JLEA 1C0TA 3TAGA 3ZT3A 3AO3A 1GOAA 3DLRA 4E19A 4CHQA 3T3FA 2P5GA 1N6QA 2FBYA 2O4GA 1BL3A 1VSMA 3DRSA 3TANA 1NJYA 3HVTA 1S5JA 1W9HA 5D3GA 1WAFA 3ZSOA 5J2PA 1KRPA 4N5SA 4NCBA 5DK5A 1J53A 3IS9A 4CJLA 4CEZA 3OY9A 3LZIA 4DFJA 2XY6A 2XY7A 1HRHA 3TI0A 1WSGA 3VA3A 3CM6A 4PUOA 3HPGA 3HK2A 4KI4A 2X74A 5J2MA 2VG6A 2JGUA 3LAMA 3QEIA 3SPZA 3G10A 2G8KA 3PUFA 2PY5A 3NCIA 4CHZA 3I8DA 1DLOA 3D0PA 3S3MA 1HYSA 1RDBA 4FLVA 3F9KA 1TKXA 4CFAA 4CIEA 3RMAA 1TKTA 4QAGA 3THVA 4HCCA 1WSIA 1VSKA 4JLHA 3WNHA 2KFNA 1FKPA 4PA1A 2DFEA 3FFIA 4H8KA 4IG0A 4C8NA 3ZSYA 3ZT4A 3OS0A 4AHTA 1RT5A 1Z26A 3OS2A 3JSMA 4JRQA 4ELUA 4KB1A 3HXMA 3PO4A 1IH7A 3AVAA 4FM0A 4KHUA 2YNGA 4KHSA 3L2RA 4FM2A 3NH1A 1NKCA 1K6YA 4HUEA 4YFUA 3AA5X 1DTTA 4RW7A 1IKWA 1YVUA 4AILC 3SQ4A 4B9UA 4OLAA 3DOLA 3KJVA 2HVIA 1A5WA 1TKZA 2E6MA 2I5JA 4IDKA 4B8CA 4CGIA 3CQ8A 4OKEA 3EZ5A 3OYAA 3KK1A 2HNYA 4B9VA 3S3OA 4M3WA 2VWKA 3MEGA 4AH9A 4DF8A 3RRGA 4B9MA 5HLFA 3LPUA 3OYJA 1XHXA 1BISA 3LDSA 3RMCA 1TAUA 2IGIA 3AVIA 4OGEA 2D0BA 2DFHA 4CEFA 4CJSA 1S9GA 3LALA 1CZ9A 4FJJA 3AA3A 1KFSA 4B8AB 3U3GA 3CG7A 1S1UA 2P5OA 3S9HA 5C42A 3T1AA 1C0MA 1JLGA 3TAMA 4ICLA 3O4QA 4DU4A 4BACA 2B6AA 4DQIA 4DFKA 3L8BA 1SV5A 4LH5A 3OJUA 3PX4A 1QSLA 1VK0A 1ZBLA 2RPIA 3QIOA 4H4OA 4CE9A 3OYHA 4KHYA 1IKYA 4DTPA 4DFPA 1Q9XA 3QIPA 4Q5VA 3V6DA 1LAWA 4FLXA 2HNDA 3G0ZA 3NF6A 2HHVA 3NBPA 4W5OA 4OKKA 1N5YA 1ZBUA 3RRHA 1BQNA 3HPOA 3DLKA 4BWMA 1SKRA 1JXEA 3TABA 1Q9YA 4OLBA 1U4BA 4N47A 4RW8A 1T03A 3QNOA 1NK4A 2G8HA 1QSSA 4J2EA 4PQUA 1BIUA 3VQ6A 2HHWA 2ZQBA 3TAEA 1JL2A 3QINA 4NCAA 1HQEA 1CZBA 2RF2A 4DWIA 2OA8A 3ASMA 3C6UA 2B5JA 4CJWA 4FLZA 3AVKA 3I0SA 5I3UA 4W5TA 3V1RA 4KFBA 3KK3A 2HHUA 3OYLA 1ZBHA 4PWDA 1HMVA 1HQUA 2E4LA 4ZHRA 4UQGA 4BDYA 4K8ZA 3SI6A 4FZXC 2RKIA 3AA4A 4CK3A 4CF2A 3AVLA 3I0RA 4GW6A 2QK9A 3OYGA 1CXQA 3SUQA 1TK0A 1WAJA 3AO2A 4CEQA 3BDPA 2KZMA 3MEEA 1JL1A 1RBVA 1VSDA 3ISNC 2OPQA 5CZ1A 4CERA 4M3TA 4IFYA 4LSLA 2YHAA 1BI4A 3ZSWA 4FZZA 4CGHA 4I9QA 2HHSA 1WSFA 1G15A 1LWFA 5J2NA 4O44A 4F2RA 5C24A 3CYMA 4DSIA 3ZT0A 1Q8IA 1VSHA 4CFBA 4E7IA 3RMDA 1GOCA 3SYZA 2OPSA 1T8EA 4HUGA 1FXXA 4O5BA 3V1QA 2HHQA 4N76A 2DY4A 1RBSA 4DTUA 4NYFA 4CHPA 3RR7A 4O4GA 1VSJA 1NK9A 4CEBA 4CF0A 4FJ9A 3MAQA 4RW6A 1C1BA 2OPPA 4I7FA 3ZSZA 1C0UA 2OZMA 4MFBA 2Z1HA 3WNGA 4RG8A 3SCXA 3E01A 4AHCA 1LWCA 4M3ZA 4KRFA 2IOCA 4CCHA 4F3OA 4DS5A 1RCHA 1B9FA 4Y1DA 3OYCA 3AVHA 4CHYA 3U3YA 4W5NA 3AVMA 1KCFA 4NYNA 4FJMA 1J9AA 3IAYA 4CF8A 4CEDA 1RDDA 4N41A 1LAVA 1EKEA 3AVGA 3A2FA 4FVMA 1RT1A 2YNFA 5HRPA 3AVFA 3OS1A 1D8YA 4M45A 4F8RA 1HPZA 1WSHA 5HRSA 4CJVA 1UAXA 1VSLA 4N56A 1LWEA 4JS4A 3KLFA 3VA0A 3ITHA 3KD5E 2GBZA 1QTMA 4EZ9A 3OYFA 1RDCA 4FK2A 4Q0BA 3O3GA 1RT2A 3L3VA 2XHBA 3M8RA 3L2WA 3DLHA 2HHTA 3DRPA 5DMRA 4EP4A 3NF9A 4C8KA 1QE1A 3K5OA 1TL1A 1NJXA 1FK9A 4DTJA 1IKVA 1HJRA 2XY5A 2F8SA 4XIUA 3NFAA 1WSJA 3O3HA 4K8XA 4CFDA 2O4IA 3KLGA 4CEAA 3KLHA 3RWUA 1TK5A 4E0DA 4KB0A 1RILA 3ZT2A 2YNIA 2G8VA 3C94A 4ZTFA 4DSLA 4EP5A 1U48A 5T7BA 3V9XA 4DTXA 3ZSQA 4CEEA 1BHLA 3L2VA 3NGZA 3K57A 1FKOA 1SUQA 4DG1A 1T7PA 4CJFA 3HYFA 2HHXA 3TAQA 1VSIA 2P1JA 4H4MA 3O3FA 2VG7A 4BE1A 3LZJA 1KFDA 1NK8A 4FYDA 4RW4A 3RTVA 1TKDA 4DLGA 2HB5A 1L3UA 1X9SA 4CHOA 3D45A 4FK0A 4CJUA 2KFZA 4J2DA 2WONA 4I9LA 1S6QA 3M8PA 1RTJA 1BQMA 4CGDA 1YT3A 3LP0A 1RBUA 2Q3SA 1D9DA 1QS4A 3UIQA 1S1XA 4AHRA 1RNHA 2EHGA 3DLBA 3C95A 2D0AA 3QEVA 4DSKA 4CK2A 3KD1E 4DTSA 2X6SA 4DTRA 1HNIA 2Z1IA 3SPYA 2Z1GA 1CXUA 2FBTA 4E7LA 4F3TA 4CHNA 4FZYA 4J2AA 1KVAA 1VRUA 3NH2A 4Y1CA 1XI1A 4C8LA 1YTUA 4CFCA 4KPYA 4DSJA 3M8SA 3QLHA 3P83D 4DU3A 4ELTA 1KVCA 1TL3A 1HYVA 3HVRA 3AVBA 5HROA 3QNNA 1WN7A 2OPRA 2Z1JA 1S1VA 2A1SA 3WNEA 4CJTA 3TWHA 4ELVA 4DTOA 5JS1A 1ASVA 1S6PA 2IDOA 4DQQA 2BGGA 3K5NA 4FXDA 2G8WA 1QHTA 3PV8A 2RN2A 2BE2A 1W0HA 4LY7A 1RT6A 5HRRA 4E1MA 1WSEA 4E1NA 2VWJA 5KI6A 3DLEA 4FCYA 1CLQA 2FC0A 4AHSA 3VQCA 1IKXA 3NDKA 3K58A 1JKHA 1UOCA 4BWJA 4CGJA 4FLTA 4CF9A 4O0IA 2AJQA 3DI6A 3NGYA 2OZSA 3PY8A 3EYZA 3SUOA 1ZBIA 3OJSA 3QESA 3RR8A 4Z4HA 3CFOA 3BGRA 1NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJG A;  3ZSR A;  2F96 A;  3LP3 A;  4BDZ A;  3AVN A;  3O4N A;  2Y1I A;  4FJL A;  3V9Z A;  3ZSV A;  1HNV A;  2D5R A;  1O1W A;  4OGC A;  5KGW A;  1S1W A;  3DRR A;  4CJ3 A;  4GVM A;  4KI6 A;  1JLQ A;  4AHU A;  3OYM A;  4O0J A;  3VQ5 A;  1KSP A;  3CM5 A;  5JS2 A;  4B3O A;  4O55 A;  3MEC A;  4I2P A;  4GMJ B;  3NHG A;  1F21 A;  3HP6 A;  4KV8 A;  4FJ8 A;  1IG9 A;  3KKR A;  1BCO A;  1TGO A;  3HPH A;  4ID5 A;  1VSE A;  4CGF A;  3QET A;  1KVB A;  4HVJ A;  4OVL A;  3S3N A;  3VQ9 A;  4FLW A;  4JS5 A;  3QEX A;  4Z4E A;  4DQR A;  2X6N A;  1B9D A;  3HM9 A;  1JLA A;  1EX4 A;  3NGI A;  4BE2 A;  3VQD A;  1JLC A;  3V9U A;  3VQA A;  3SZ2 A;  3MED A;  4B9N A;  4M3U A;  4FJI A;  3SJJ A;  1C6V A;  1JXB A;  3KLI A;  3OVN A;  4ID1 A;  3QER A;  4FJH A;  3NAE A;  4DQP A;  3MXI A;  2A1R A;  3P1G A;  4DFM A;  4B08 A;  2FBV A;  4KHQ A;  1SKS A;  4KHW A;  2IAJ A;  4W5R A;  4KTZ A;  4I2Q A;  2EX3 A;  4G1Q A;  3LAK A;  3V81 A;  1TV6 A;  1RBR A;  3KK2 A;  5KRT A;  3IRX A;  3L3U A;  1A5V A;  4NCG A;  4E89 A;  4OKJ A;  3H08 A;  2W42 A;  3OYB A;  3KIO A;  1MU2 A;  3HO1 A;  5E41 A;  1X9M A;  1B92 A;  4IG3 A;  3ULD A;  1ZBF A;  4MQ3 A;  4CJ5 A;  5KRS A;  4OPK A;  4FW2 A;  4DSE A;  3V9W A;  4KTQ A;  3B6O A;  1LW0 A;  3V1O A;  5KGX A;  4FJK A;  3ZSX A;  4FLU A;  4FJ5 A;  2XRI A;  1JLE A;  1NJZ A;  2KQ2 A;  4KO0 A;  4RW9 A;  1ASU A;  3OYN A;  5SZT A;  2B4J A;  4LSN A;  4M41 A;  1J5O A;  4BE0 A;  2PYJ A;  4FJ7 A;  5CZ2 A;  2KW4 A;  1NOY A;  2R7Y A;  1KLN A;  1J54 A;  4LD0 A;  2FBX A;  3WNF A;  4Z4I A;  4M42 A;  1RTH A;  1LV5 A;  2YHB A;  5FRN A;  1DTQ A;  2WOM A;  1D5A A;  1I39 A;  5SWM A;  2LSN A;  2BAN A;  1BCM A;  3SQ1 A;  4FW1 A;  4CEC A;  1WNS A;  3L2U A;  4E7J A;  2E6L A;  1NK0 A;  1S9E A;  3TR8 A;  4EZ6 A;  2GV9 A;  3VQQ A;  4QOZ B;  1A5X A;  1Z25 A;  4LH4 A;  2ITG A;  5KTQ A;  3VQE A;  1U47 A;  1SL1 A;  4JRP A;  3OYD A;  3AO1 A;  2ATQ A;  3ZT1 A;  1NK5 A;  2ZD1 A;  5EU7 A;  4DLE A;  3OYI A;  1ZYQ A;  1RT4 A;  3F73 A;  2HNZ A;  4FM1 A;  2VG5 A;  4WE1 A;  4CEO A;  2DFF A;  3KKS A;  1I3A A;  4R5P A;  1XC9 A;  3HL8 A;  4OPJ A;  2HVH A;  1UWB A;  2D0C A;  1TVR A;  3K5M A;  4L8R B;  3TAR A;  1TAQ A;  3AVJ A;  3DM2 A;  2YNH A;  3VQ8 A;  4CJE A;  2G8F A;  1NKB A;  2PZS A;  1NK7 A;  2ETJ A;  3NF8 A;  3DLG A;  4AHV A;  3SV3 A;  4FJN A;  3AV9 A;  2QKB A;  3V4I A;  3NE6 A;  3PX6 A;  2G8I A;  2Y1J A;  1L5U A;  4KRE A;  2NUB A;  1KTQ A;  4CES A;  4Z0U A;  2XO7 A;  4CJQ A;  4J2B A;  4DSF A;  2F8T A;  3HJF A;  4CF1 A;  3V9S A;  3C6T A;  4CIF A;  3DMJ A;  3VQ4 A;  3SQ2 A;  3VQ7 A;  2IC3 A;  3U6F A;  4CJK A;  3LP2 A;  3VQP A;  2ZE2 A;  3OYK A;  1WLJ A;  4IFV A;  3NH0 A;  3LPT A;  5CYQ A;  1RTD A;  3K59 A;  5J1E A;  4KTW A;  5FRM A;  3DOK A;  2X78 A;  1YTA A;  3IG1 A;  3L2Q A;  3SUN A;  4CJR A;  3CFP A;  3AO4 A;  4DQS A;  3TAF A;  1RTI A;  3EY1 A;  2P51 A;  1C1C A;  1BI4 B;  1U04 A;  1D9F A;  1C1A A;  1EXQ A;  1IO2 A;  3LWM A;  2QKK A;  1QSY A;  3PO5 A;  1BGX T;  3LP1 A;  4M3R A;  3ZCM A;  4M3Y A;  4DMN A;  4HHT A;  3SUP A;  2YV0 X;  5CYM A;  1XWL A;  1NJW A;  1NK6 A;  3JYT A;  1U49 A;  3KTQ A;  2HW3 A;  5HBM A;  1UA0 A;  3HP9 A;  4CGG A;  2OYQ A;  4DF4 A;  1BIZ A;  4E7H A;  1L3T A;  3HST B;  4F2S A;  1T05 A;  4CIG A;  3VN5 A;  4YNQ A;  4HUF A;  4IKF A;  2KTQ A;  3HT3 A;  2PYL A;  3OYE A;  4KHN A;  3DYA A;  4Z4G A;  4F4K A;  1JLB A;  1SL0 A;  5J2Q A;  3AA2 A;  2YKN A;  4Z4C A;  1TK8 A;  1ITG A;  1L3V A;  1VSF A;  3P5J A;  3SQ0 A;  3LAN A;  1KLM A;  2KZZ A;  4PY5 A;  4KKO A;  5FDL A;  1JLF A;  2DTU A;  3B6P A;  1VRT A;  2BDP A;  3CFR A;  1QQC A;  3NF7 A;  1LW2 A;  4FK4 A;  1ASW A;  4DTM A;  2HMI A;  1SL2 A;  3QEP A;  4Z4F A;  1RBT A;  4CJ4 A;  1Y97 A;  3KLE A;  2G8U A;  1EET A;  1XHZ A;  1R0A A;  1NKE A;  2XY8 A;  1RT3 A;  4IBN A;  3K2P A;  4CK1 A;  5I42 A;  1SKW A;  4BDP A;  3VQB A;  5K14 A;  1HYZ A;  5HP1 A;  4KAZ A;  4TSX A;  4FJX A;  3T19 A;  5C25 A;  3PX0 A;  4M3X A;  1X1P A;  1EP4 A;  1REV A;  3ALY A;  5HRN A;  3SV4 A;  2YKM A;  5CY4 A;  4DU1 A;  3MXM A;  4E3S A;  1S1T A;  1L3S A;  3RMB A;  2QXF A;  3MXJ A;  3QO9 A;  4FLY A;  3AO5 A;  4E7K A;  2IS3 A;  3LWL A;  4OJR A;  3SNN A;  2GUI A;  1RDA A;  4DTN A;  1RT7 A;  4B9L A;  4HCB A;  3M8Q A;  4QCL A;  1GOB A;  4C8M A;  4HTU A;  4ZTJ A;  1U45 A;  1X9W A;  3QEW A;  4DS4 A;  4C8O A;  3AVC A;  3K5L A;  3TAP A;  4B9T A;  4W5Q A;  5FRO A;  1UA1 A;  4CJP A;  4B9S A;  2JLE A;  1C0T A;  3TAG A;  3ZT3 A;  3AO3 A;  1GOA A;  3DLR A;  4E19 A;  4CHQ A;  3T3F A;  2P5G A;  1N6Q A;  2FBY A;  2O4G A;  1BL3 A;  1VSM A;  3DRS A;  3TAN A;  1NJY A;  3HVT A;  1S5J A;  1W9H A;  5D3G A;  1WAF A;  3ZSO A;  5J2P A;  1KRP A;  4N5S A;  4NCB A;  5DK5 A;  1J53 A;  3IS9 A;  4CJL A;  4CEZ A;  3OY9 A;  3LZI A;  4DFJ A;  2XY6 A;  2XY7 A;  1HRH A;  3TI0 A;  1WSG A;  3VA3 A;  3CM6 A;  4PUO A;  3HPG A;  3HK2 A;  4KI4 A;  2X74 A;  5J2M A;  2VG6 A;  2JGU A;  3LAM A;  3QEI A;  3SPZ A;  3G10 A;  2G8K A;  3PUF A;  2PY5 A;  3NCI A;  4CHZ A;  3I8D A;  1DLO A;  3D0P A;  3S3M A;  1HYS A;  1RDB A;  4FLV A;  3F9K A;  1TKX A;  4CFA A;  4CIE A;  3RMA A;  1TKT A;  4QAG A;  3THV A;  4HCC A;  1WSI A;  1VSK A;  4JLH A;  3WNH A;  2KFN A;  1FKP A;  4PA1 A;  2DFE A;  3FFI A;  4H8K A;  4IG0 A;  4C8N A;  3ZSY A;  3ZT4 A;  3OS0 A;  4AHT A;  1RT5 A;  1Z26 A;  3OS2 A;  3JSM A;  4JRQ A;  4ELU A;  4KB1 A;  3HXM A;  3PO4 A;  1IH7 A;  3AVA A;  4FM0 A;  4KHU A;  2YNG A;  4KHS A;  3L2R A;  4FM2 A;  3NH1 A;  1NKC A;  1K6Y A;  4HUE A;  4YFU A;  3AA5 X;  1DTT A;  4RW7 A;  1IKW A;  1YVU A;  4AIL C;  3SQ4 A;  4B9U A;  4OLA A;  3DOL A;  3KJV A;  2HVI A;  1A5W A;  1TKZ A;  2E6M A;  2I5J A;  4IDK A;  4B8C A;  4CGI A;  3CQ8 A;  4OKE A;  3EZ5 A;  3OYA A;  3KK1 A;  2HNY A;  4B9V A;  3S3O A;  4M3W A;  2VWK A;  3MEG A;  4AH9 A;  4DF8 A;  3RRG A;  4B9M A;  5HLF A;  3LPU A;  3OYJ A;  1XHX A;  1BIS A;  3LDS A;  3RMC A;  1TAU A;  2IGI A;  3AVI A;  4OGE A;  2D0B A;  2DFH A;  4CEF A;  4CJS A;  1S9G A;  3LAL A;  1CZ9 A;  4FJJ A;  3AA3 A;  1KFS A;  4B8A B;  3U3G A;  3CG7 A;  1S1U A;  2P5O A;  3S9H A;  5C42 A;  3T1A A;  1C0M A;  1JLG A;  3TAM A;  4ICL A;  3O4Q A;  4DU4 A;  4BAC A;  2B6A A;  4DQI A;  4DFK A;  3L8B A;  1SV5 A;  4LH5 A;  3OJU A;  3PX4 A;  1QSL A;  1VK0 A;  1ZBL A;  2RPI A;  3QIO A;  4H4O A;  4CE9 A;  3OYH A;  4KHY A;  1IKY A;  4DTP A;  4DFP A;  1Q9X A;  3QIP A;  4Q5V A;  3V6D A;  1LAW A;  4FLX A;  2HND A;  3G0Z A;  3NF6 A;  2HHV A;  3NBP A;  4W5O A;  4OKK A;  1N5Y A;  1ZBU A;  3RRH A;  1BQN A;  3HPO A;  3DLK A;  4BWM A;  1SKR A;  1JXE A;  3TAB A;  1Q9Y A;  4OLB A;  1U4B A;  4N47 A;  4RW8 A;  1T03 A;  3QNO A;  1NK4 A;  2G8H A;  1QSS A;  4J2E A;  4PQU A;  1BIU A;  3VQ6 A;  2HHW A;  2ZQB A;  3TAE A;  1JL2 A;  3QIN A;  4NCA A;  1HQE A;  1CZB A;  2RF2 A;  4DWI A;  2OA8 A;  3ASM A;  3C6U A;  2B5J A;  4CJW A;  4FLZ A;  3AVK A;  3I0S A;  5I3U A;  4W5T A;  3V1R A;  4KFB A;  3KK3 A;  2HHU A;  3OYL A;  1ZBH A;  4PWD A;  1HMV A;  1HQU A;  2E4L A;  4ZHR A;  4UQG A;  4BDY A;  4K8Z A;  3SI6 A;  4FZX C;  2RKI A;  3AA4 A;  4CK3 A;  4CF2 A;  3AVL A;  3I0R A;  4GW6 A;  2QK9 A;  3OYG A;  1CXQ A;  3SUQ A;  1TK0 A;  1WAJ A;  3AO2 A;  4CEQ A;  3BDP A;  2KZM A;  3MEE A;  1JL1 A;  1RBV A;  1VSD A;  3ISN C;  2OPQ A;  5CZ1 A;  4CER A;  4M3T A;  4IFY A;  4LSL A;  2YHA A;  1BI4 A;  3ZSW A;  4FZZ A;  4CGH A;  4I9Q A;  2HHS A;  1WSF A;  1G15 A;  1LWF A;  5J2N A;  4O44 A;  4F2R A;  5C24 A;  3CYM A;  4DSI A;  3ZT0 A;  1Q8I A;  1VSH A;  4CFB A;  4E7I A;  3RMD A;  1GOC A;  3SYZ A;  2OPS A;  1T8E A;  4HUG A;  1FXX A;  4O5B A;  3V1Q A;  2HHQ A;  4N76 A;  2DY4 A;  1RBS A;  4DTU A;  4NYF A;  4CHP A;  3RR7 A;  4O4G A;  1VSJ A;  1NK9 A;  4CEB A;  4CF0 A;  4FJ9 A;  3MAQ A;  4RW6 A;  1C1B A;  2OPP A;  4I7F A;  3ZSZ A;  1C0U A;  2OZM A;  4MFB A;  2Z1H A;  3WNG A;  4RG8 A;  3SCX A;  3E01 A;  4AHC A;  1LWC A;  4M3Z A;  4KRF A;  2IOC A;  4CCH A;  4F3O A;  4DS5 A;  1RCH A;  1B9F A;  4Y1D A;  3OYC A;  3AVH A;  4CHY A;  3U3Y A;  4W5N A;  3AVM A;  1KCF A;  4NYN A;  4FJM A;  1J9A A;  3IAY A;  4CF8 A;  4CED A;  1RDD A;  4N41 A;  1LAV A;  1EKE A;  3AVG A;  3A2F A;  4FVM A;  1RT1 A;  2YNF A;  5HRP A;  3AVF A;  3OS1 A;  1D8Y A;  4M45 A;  4F8R A;  1HPZ A;  1WSH A;  5HRS A;  4CJV A;  1UAX A;  1VSL A;  4N56 A;  1LWE A;  4JS4 A;  3KLF A;  3VA0 A;  3ITH A;  3KD5 E;  2GBZ A;  1QTM A;  4EZ9 A;  3OYF A;  1RDC A;  4FK2 A;  4Q0B A;  3O3G A;  1RT2 A;  3L3V A;  2XHB A;  3M8R A;  3L2W A;  3DLH A;  2HHT A;  3DRP A;  5DMR A;  4EP4 A;  3NF9 A;  4C8K A;  1QE1 A;  3K5O A;  1TL1 A;  1NJX A;  1FK9 A;  4DTJ A;  1IKV A;  1HJR A;  2XY5 A;  2F8S A;  4XIU A;  3NFA A;  1WSJ A;  3O3H A;  4K8X A;  4CFD A;  2O4I A;  3KLG A;  4CEA A;  3KLH A;  3RWU A;  1TK5 A;  4E0D A;  4KB0 A;  1RIL A;  3ZT2 A;  2YNI A;  2G8V A;  3C94 A;  4ZTF A;  4DSL A;  4EP5 A;  1U48 A;  5T7B A;  3V9X A;  4DTX A;  3ZSQ A;  4CEE A;  1BHL A;  3L2V A;  3NGZ A;  3K57 A;  1FKO A;  1SUQ A;  4DG1 A;  1T7P A;  4CJF A;  3HYF A;  2HHX A;  3TAQ A;  1VSI A;  2P1J A;  4H4M A;  3O3F A;  2VG7 A;  4BE1 A;  3LZJ A;  1KFD A;  1NK8 A;  4FYD A;  4RW4 A;  3RTV A;  1TKD A;  4DLG A;  2HB5 A;  1L3U A;  1X9S A;  4CHO A;  3D45 A;  4FK0 A;  4CJU A;  2KFZ A;  4J2D A;  2WON A;  4I9L A;  1S6Q A;  3M8P A;  1RTJ A;  1BQM A;  4CGD A;  1YT3 A;  3LP0 A;  1RBU A;  2Q3S A;  1D9D A;  1QS4 A;  3UIQ A;  1S1X A;  4AHR A;  1RNH A;  2EHG A;  3DLB A;  3C95 A;  2D0A A;  3QEV A;  4DSK A;  4CK2 A;  3KD1 E;  4DTS A;  2X6S A;  4DTR A;  1HNI A;  2Z1I A;  3SPY A;  2Z1G A;  1CXU A;  2FBT A;  4E7L A;  4F3T A;  4CHN A;  4FZY A;  4J2A A;  1KVA A;  1VRU A;  3NH2 A;  4Y1C A;  1XI1 A;  4C8L A;  1YTU A;  4CFC A;  4KPY A;  4DSJ A;  3M8S A;  3QLH A;  3P83 D;  4DU3 A;  4ELT A;  1KVC A;  1TL3 A;  1HYV A;  3HVR A;  3AVB A;  5HRO A;  3QNN A;  1WN7 A;  2OPR A;  2Z1J A;  1S1V A;  2A1S A;  3WNE A;  4CJT A;  3TWH A;  4ELV A;  4DTO A;  5JS1 A;  1ASV A;  1S6P A;  2IDO A;  4DQQ A;  2BGG A;  3K5N A;  4FXD A;  2G8W A;  1QHT A;  3PV8 A;  2RN2 A;  2BE2 A;  1W0H A;  4LY7 A;  1RT6 A;  5HRR A;  4E1M A;  1WSE A;  4E1N A;  2VWJ A;  5KI6 A;  3DLE A;  4FCY A;  1CLQ A;  2FC0 A;  4AHS A;  3VQC A;  1IKX A;  3NDK A;  3K58 A;  1JKH A;  1UOC A;  4BWJ A;  4CGJ A;  4FLT A;  4CF9 A;  4O0I A;  2AJQ A;  3DI6 A;  3NGY A;  2OZS A;  3PY8 A;  3EYZ A;  3SUO A;  1ZBI A;  3OJS A;  3QES A;  3RR8 A;  4Z4H A;  3CFO A;  3BGR A;  1NOZ A; 
#chains in the Genus database with same CATH topology
 4BDZ A;  4LF9 K;  2HST A;  3ZSV A;  1HNV A;  5B8H A;  2D5R A;  1S1W A;  3WUH A;  4AHU A;  3OYM A;  5JS2 A;  4I2P A;  1IBM K;  2H3G X;  3DAW A;  1IG8 A;  1QQN A;  1TGO A;  2YJF A;  1VSE A;  3QET A;  4BRH A;  4LC9 B;  4OVL A;  4YOR A;  4FLW A;  2ZF5 O;  3HM9 A;  1JLA A;  4OPA A;  4NB4 A;  2P9P A;  1C6V A;  4ID1 A;  3QER A;  3MXI A;  2ZM6 K;  4DFM A;  2Q31 A;  2FBV A;  4I2Q A;  2EX3 A;  3VF2 A;  3LAK A;  1TV6 A;  3MX5 A;  4FWM A;  1BA1 A;  3WEE A;  2YX6 A;  4LF5 K;  4E89 A;  4MQ3 A;  4CJ5 A;  4DSE A;  4KTQ A;  3ZSX A;  4PKH A;  4FLU A;  1ESV A;  2XRI A;  2P9U B;  4RW9 A;  3OYN A;  1ASU A;  4BRM A;  4BE0 A;  2PYJ A;  3SJH A;  3VF4 A;  4Y0W A;  4Z4I A;  4M42 A;  2W6K A;  5FRN A;  2V7Y A;  4JK8 A;  3U9Z A;  3THY B;  3VES A;  1QZ6 A;  5SWM A;  2BAN A;  1BCM A;  1S9E A;  3TR8 A;  2D0P A;  2GV9 A;  3UB5 A;  4WQ5 C;  1NGB A;  5KTQ A;  3RVC A;  1RFQ A;  2QEX N;  4F9O A;  4U7B A;  1RT4 A;  4FM1 A;  1XC9 A;  3MDQ A;  4OPJ A;  1UWB A;  4U67 L;  4L8R B;  3TAR A;  3WQT A;  1TAQ A;  3AVJ A;  3VQ8 A;  4CJE A;  1NKB A;  1NK7 A;  2ETJ A;  3AGK A;  4FJN A;  4AHV A;  2BUP A;  3PX6 A;  3NE6 A;  2Y1J A;  4J2B A;  4Z0U A;  1NGA A;  3CCV N;  1HPM A;  3V9S A;  3C6T A;  4CIF A;  3VQ4 A;  5DM6 L;  4LF6 K;  3VQP A;  2ZE2 A;  3C6H A;  3N4Q A;  3LPT A;  4BR5 A;  4BRP A;  1YTA A;  3L2Q A;  1K8A O;  3QFU A;  3CFP A;  3CC7 N;  2P9I B;  1U04 A;  4K42 A;  1D9F A;  2NRW A;  3O9Q A;  1BGX T;  4M3R A;  5IT9 O;  4M3Y A;  4DMN A;  4HHT A;  5CYM A;  2O8F A;  3THX A;  5AQV A;  2O8E A;  1BIZ A;  3HST B;  3O6W A;  4JN4 A;  4PL8 A;  4YNQ A;  4JHD B;  2KTQ A;  3HT3 A;  4FWS A;  3OYE A;  1V4S A;  3CCL N;  1SL0 A;  3WXL A;  2YKN A;  4BR4 A;  4Z4C A;  1TK8 A;  5KPR A;  1K8K A;  3KVG A;  3ZX2 A;  3F2K A;  1YJN N;  4GY2 B;  1VRT A;  1QQC A;  5BRD A;  1ASW A;  2UXB K;  4RWT A;  4CZG A;  1EET A;  1XHZ A;  4BC5 A;  2XY8 A;  2EWS A;  1BU6 O;  2W6L A;  2ASO A;  3FZL A;  1EP4 A;  3ALY A;  3SV4 A;  2W40 A;  4E3S A;  4GV3 A;  3RMB A;  4OX9 K;  2NRH A;  1GLL O;  3ENH A;  4FLY A;  3EEQ A;  3AO5 A;  4E7K A;  3GOI A;  4OJR A;  4JKC A;  2GUI A;  1RT7 A;  3AAP A;  1GOB A;  4C8M A;  2E2Q A;  4DS4 A;  3AVC A;  3TAP A;  1HNZ K;  3QML A;  5F0X A;  4B9T A;  5FRO A;  1UA1 A;  1U6Z A;  2JLE A;  1S22 A;  3TAG A;  3T3F A;  5JVG L;  3D7E O;  1BL3 A;  4LF4 K;  4QS9 A;  1S5J A;  5D3G A;  4LF8 K;  1KRP A;  4BRA A;  5GAE P;  5AFU A;  4NXN K;  1LOT B;  1J53 A;  4CEZ A;  1QVG M;  1HRH A;  5M1P A;  3VA3 A;  2E1Y A;  2X74 A;  5J2M A;  4JI0 K;  2JGU A;  4K0K K;  2PY5 A;  1OH6 A;  3FFK B;  4IO9 L;  4IZ9 A;  4FLV A;  3M6G A;  4QAG A;  4JLH A;  2UXC K;  3CIP A;  1FW6 A;  4IG0 A;  4JS5 A;  1RT5 A;  4ELU A;  1IH7 A;  4FM0 A;  2PAV A;  3ENO A;  1NKC A;  1K6Y A;  2O8D A;  4PL7 A;  2HVI A;  3R8E A;  1TKZ A;  2NRZ A;  2I5J A;  1NMD A;  4OKE A;  2HNY A;  4AH9 A;  3IMX A;  3OYJ A;  3LDL A;  4BRL A;  3RMC A;  3SMP A;  1TAU A;  3AVI A;  4JYA K;  4FSV A;  5GAG P;  3NVK A;  3LAL A;  1KFS A;  3HBT A;  2P5O A;  3S9H A;  1HNX K;  1JLG A;  4BRN A;  1T6C A;  3UKR A;  2KZZ A;  2AJQ A;  1ZBL A;  3QIO A;  4DFP A;  3LDQ A;  3QIP A;  4A5B A;  2Q1N A;  4WYB A;  1BQN A;  3HPO A;  4CJ7 A;  4OLB A;  2QWO A;  3OW2 M;  3QNO A;  3CCU N;  3ATU A;  4FWR A;  4NCA A;  1JL2 A;  4BG8 A;  3UKU B;  4FLZ A;  3AVK A;  3I0S A;  3CF5 L;  4W5T A;  3KK3 A;  3BF3 A;  4ZHR A;  1NJI O;  2RKI A;  1VHX A;  3AA4 A;  4WFN L;  4FO0 A;  5EXW A;  1NGF A;  3AVL A;  5AQT A;  5M1O A;  1CXQ A;  2KZM A;  3AO2 A;  3ISN C;  5CZ1 A;  2OPQ A;  4M3T A;  4BRI A;  2D4W A;  4H5W A;  4JKG B;  4LSL A;  1Q82 O;  3ZSW A;  2GWJ A;  4MLH A;  1G15 A;  1Q81 O;  2E8A A;  3BZC A;  4E7I A;  5AQZ A;  3MWP A;  3CJB A;  3SYZ A;  3V1Q A;  2HHQ A;  1NK9 A;  4CF0 A;  3RSE B;  3ZSZ A;  4JKH A;  1LWC A;  4M3Z A;  4OO1 J;  4KRF A;  4F3O A;  4GNI A;  4Y1D A;  1IV0 A;  3U3Y A;  4W5N A;  4FJM A;  1J9A A;  3O9U A;  3IAY A;  4DHY A;  4DR2 K;  2JWK A;  3ATV A;  4N41 A;  3OS2 A;  4DQS A;  3AVG A;  3A2F A;  3VEY A;  1RT1 A;  2YNF A;  4WFA L;  3CC4 N;  3DXK B;  1VSL A;  1LWE A;  4H0P A;  4JEP A;  3VA0 A;  5LL6 Z;  3KD5 E;  2GBZ A;  1NM1 A;  3KHY A;  4FK2 A;  1TYQ B;  1RT2 A;  2RHK A;  3DRP A;  5DMR A;  1TL1 A;  1NJX A;  1IKV A;  1VQ8 N;  4DV0 K;  1WSJ A;  3O3H A;  4CFD A;  2W41 A;  3KLG A;  4CEA A;  3DWL A;  4BQZ A;  5LMU K;  1YJW N;  4DTX A;  5AR0 A;  1T7P A;  1SUQ A;  1NMN A;  4DR7 K;  3WT0 A;  2P1J A;  3O3F A;  3MCA B;  3SK3 A;  1TKD A;  4BVP A;  3WXK A;  3D45 A;  2E2O A;  3IUC A;  4CZF A;  2P9S B;  3BZK A;  1BQM A;  2VQE K;  5BR8 K;  3LP0 A;  4DV1 K;  1RBU A;  2Q3S A;  1QS4 A;  3UIQ A;  4AHR A;  2V7Z A;  2EHG A;  3SPY A;  2Z1G A;  5BRF A;  4CHN A;  4H5T A;  4BGB A;  1YTU A;  4B1Z A;  4DSJ A;  4JI4 K;  3M8S A;  3I8B A;  1HYV A;  2OPR A;  1K9M O;  1S1V A;  3GBT A;  4DTO A;  5JS1 A;  4IOC L;  4DQQ A;  4X66 K;  3PV8 A;  4LY7 A;  2GEL A;  5HRR A;  4E1M A;  1CLQ A;  4AHS A;  4FWP A;  3W0L A;  1UOC A;  4CGJ A;  4YDU A;  4FLT A;  4KH4 A;  4H0V B;  4BGA A;  2OZS A;  3R9P A;  4JNE A;  1BWF O;  4NLB A;  2Y1I A;  3L4Q A;  1SAZ A;  5KGW A;  3ZX0 A;  1Q7Y O;  4KI6 A;  1JLQ A;  1R59 O;  3W3D A;  1WOQ A;  4FWN A;  3CM5 A;  3MEC A;  3A5M C;  4GMJ B;  3THX B;  4KV8 A;  4MLE A;  5BRE A;  5C0Y A;  1T44 A;  4FJ8 A;  1IG9 A;  4FWL A;  3E9P A;  1BCO A;  3KKR A;  4CGF A;  1GLE G;  4HVJ A;  1BA0 A;  3S3N A;  3VQ9 A;  2FSJ A;  3FE1 A;  4Z4E A;  4DQR A;  2FLO A;  3NGI A;  5EVZ A;  2Q0U A;  3VQA A;  4M3U A;  4FJI A;  5KQD A;  5AFU H;  5CHI A;  1C0F A;  2A1R A;  1KXP A;  4JI5 K;  2IAJ A;  4KTZ A;  3TSP A;  4G1Q A;  4DCH A;  4CZM A;  3KK2 A;  2AP1 A;  4YY3 K;  3H08 A;  2W42 A;  3LDN A;  4JI7 K;  3HO1 A;  5E41 A;  4FOI A;  4JKF A;  4FW2 A;  4QS7 A;  3V9W A;  3B6O A;  1LW0 A;  3V1O A;  4FJK A;  4JI3 K;  4FJ5 A;  2UUA K;  4PHT X;  4KO0 A;  1C0G A;  2RE2 A;  1HUX A;  4YOV A;  4JK9 A;  3G71 N;  2KW4 A;  2OCE A;  1NOY A;  1KLN A;  3SAH A;  3ZYY X;  4FPB A;  2UXD K;  1LV5 A;  2YHB A;  1D5A A;  2WBN A;  2LSN A;  3SQ1 A;  4FW1 A;  4CEC A;  5AQG A;  2ZWH A;  1NK0 A;  3OTO K;  5HOO A;  2VYP A;  4QOZ B;  1Z25 A;  4LH4 A;  5F2R A;  4JRP A;  3OYD A;  4DLE A;  3WXI A;  3F73 A;  4WE1 A;  2DFF A;  3KKS A;  1U2V B;  3OA9 A;  4ILG B;  2A41 A;  2ZGZ A;  1JCG A;  2G8F A;  2P9N B;  4L3Q A;  3SV3 A;  4X62 K;  2F9W A;  1KTQ A;  4CES A;  4CJQ A;  2CH6 A;  4DSF A;  3DMJ A;  4A2B A;  3SQ2 A;  3VQ7 A;  2IC3 A;  1SQK A;  3OYK A;  4IFV A;  4YDU C;  3NH0 A;  3CD6 N;  1LCU A;  1XC3 A;  3DXM A;  5J1E A;  4CZI A;  5FRM A;  3DOK A;  1ATS A;  3CC2 N;  3EKS A;  4CJR A;  4KH5 A;  3EY1 A;  3LM2 A;  1BI4 B;  1C1A A;  1EXQ A;  3LWM A;  3PO5 A;  4DV2 K;  5C2D A;  1HKC A;  1XNR K;  2HOE A;  4O8K A;  1JJ2 M;  1WUA A;  1NJW A;  1U49 A;  4BC3 A;  3HP9 A;  4XH4 A;  4CGG A;  4B1X B;  2OYQ A;  4E7H A;  4HUF A;  2PYL A;  3DYA A;  1BG3 A;  4F4K A;  5AZI A;  3C6A A;  1WBD A;  1L3V A;  4CD3 A;  4JKB A;  3SQ0 A;  2Q0R A;  1KLM A;  2O8C A;  1IBK K;  5FDL A;  1JLF A;  4A59 A;  5GIN A;  3I56 N;  5TKW A;  4DTM A;  1SL2 A;  3QEP A;  2E2N A;  3MN5 A;  1RBT A;  4CJ4 A;  1Y97 A;  2G8U A;  5JLF A;  1R0A A;  1NKE A;  4IFE A;  5I42 A;  3C7N B;  3CCQ N;  4BDP A;  4DV6 K;  4KAZ A;  4H5R A;  3SAG A;  3PX0 A;  4M3X A;  1X1P A;  1REV A;  4DU1 A;  5CY4 A;  1L3S A;  1Y64 A;  3QO9 A;  5AZJ A;  3LWL A;  5KPZ A;  3O1W A;  4B9L A;  4DTN A;  3CPW M;  4QCL A;  5H1S Q;  1U45 A;  3PLA A;  3K5L A;  4CZE A;  4BRG A;  3EN9 A;  5FPN A;  3VPZ A;  2QA4 N;  1CZA N;  4W5Q A;  1TYQ A;  3ZT3 A;  2P5G A;  5BN9 A;  2FBY A;  4NXM K;  1HLU A;  2P9S A;  3DRS A;  2Q97 A;  3TAN A;  1VQL N;  3HVT A;  3UE5 A;  2WFB A;  4JI1 K;  3B8A X;  3T1H K;  2QWL A;  1WAF A;  5J2P A;  1DEJ A;  4N5S A;  5DK5 A;  2XY6 A;  1YJ9 N;  3TI0 A;  4PUO A;  3CM6 A;  1N32 K;  2J4R A;  2VG6 A;  3FZM A;  3QEI A;  3G10 A;  2G8K A;  3QBW A;  2QWQ A;  4FPA A;  3I8D A;  2Q36 A;  3CI5 A;  1HYS A;  4CIE A;  1TKX A;  3R6M A;  4CFA A;  4HCC A;  1WSI A;  3HI0 A;  2KFN A;  2D1K A;  2DFE A;  4H8K A;  3ZT4 A;  4C8N A;  5J2Q A;  3CCM N;  1Z26 A;  3JSM A;  4JRQ A;  1MA9 B;  3PO4 A;  3AVA A;  4KHS A;  3L2R A;  4FM2 A;  4EHT A;  1N33 K;  1M1K O;  3JXU A;  1OH5 A;  4HUE A;  1DTT A;  4RW7 A;  1P8Z A;  4M7Y A;  1IKW A;  3D2E B;  2FXU A;  3DXK A;  2OTJ N;  5AQR A;  2GUP A;  4IDK A;  2ZJP L;  1Q18 A;  4B8C A;  5AQP A;  4BG9 A;  1IBL K;  3OYA A;  4B9V A;  1ILY A;  3J81 O;  2O8B B;  3UKU A;  3RRG A;  4B9M A;  3O1B A;  3LPU A;  4JKA A;  1BIS A;  3LDS A;  4BRE A;  2DFH A;  3ULE A;  1S9G A;  3RSE A;  4IXC A;  3CG7 A;  3T1A A;  3TAM A;  4ICL A;  3C7N A;  3O4Q A;  4DQI A;  1QSL A;  3PX4 A;  3OJU A;  4E1J A;  4KHY A;  1Q9X A;  3V6D A;  4H0Y B;  5JIC A;  4JKG A;  4BRF A;  4CVN E;  4OKK A;  2HBK A;  3RRH A;  1SKR A;  4BWM A;  2VWB A;  1KC8 O;  1U4B A;  1NNE A;  2O8C B;  4RW8 A;  1T03 A;  4PQU A;  2ZQB A;  3QIN A;  1CZB A;  1VQM N;  1Z05 A;  4DWI A;  2OA8 A;  2QWR A;  5AQS A;  2E1Z A;  5I3U A;  3T7Z A;  3OYL A;  4PWD A;  1HMV A;  2QXL A;  4K8Z A;  3BEX A;  3GG4 A;  4BRD A;  2YHW A;  4CF2 A;  3Q7C A;  3OYG A;  4B9Q A;  3SUQ A;  1NGC A;  1TK0 A;  2CH5 A;  3BDP A;  4CEQ A;  2O8D B;  4CER A;  2NRV A;  1VSD A;  3KWI A;  4IFY A;  1NGI A;  3CCS N;  4KBO A;  5J2N A;  1GLC G;  5C24 A;  3RMD A;  1GOC A;  3ZET B;  3MWT A;  4HUG A;  1FXX A;  4O5B A;  2Q2R A;  3DXM B;  4JK7 A;  2KLA A;  3RR7 A;  5M1N A;  1VSJ A;  4RW6 A;  3SLC A;  2YI1 A;  4MFB A;  3E01 A;  4AHC A;  4CCH A;  1NGD A;  4DS5 A;  3C0B A;  4CHY A;  5JLH A;  1VQN N;  3AVM A;  3D6R A;  4NYN A;  4DKW A;  1NGG A;  4G9Z A;  4CF8 A;  4YOT A;  4YOW A;  4IDH A;  4DUY K;  1RDD A;  2NNW A;  4FVM A;  3OS1 A;  1D8Y A;  3VTH A;  4F8R A;  1U2V A;  5HRS A;  4AM6 A;  5C10 A;  3CME N;  3IDH A;  4EZ9 A;  1Z6R A;  2V52 B;  3M8R A;  3L2W A;  3NF9 A;  3K5O A;  4DTJ A;  3AAQ A;  4H5V A;  4XIU A;  2F8S A;  4DQ8 A;  3VEW A;  4K8X A;  5BPN A;  3KLH A;  3J7A P;  4E0D A;  3CER A;  2G8V A;  5T7B A;  3V9X A;  5E84 A;  3P4I A;  5KQ8 A;  3K57 A;  3NGZ A;  4DG1 A;  3HYF A;  5AQI A;  2I7P A;  1NK8 A;  4FYD A;  5A2Q O;  1L3U A;  3LL3 A;  4XEI A;  4JI8 K;  1QHA A;  2WON A;  4AF1 A;  1RTJ A;  4CGD A;  1OVY A;  3QEV A;  4LFB K;  1VAZ A;  2Z1I A;  4E7L A;  1CXU A;  1NBW A;  1KVA A;  4A5A A;  4ILJ A;  5LY3 A;  4BRO A;  1XI1 A;  5EX5 A;  4CFC A;  4KPY A;  4LFC K;  2ZGY A;  4JV5 K;  2O8E B;  1KVC A;  1TL3 A;  3AVB A;  5HRO A;  3QNN A;  1WN7 A;  2A1S A;  3TWH A;  2NRT A;  1FJG K;  1ASV A;  2IDO A;  3VEO A;  2BGG A;  4GKJ K;  2IVP A;  3TPQ A;  2G8W A;  2KHO A;  2RN2 A;  1RT6 A;  3TTD A;  3O4W A;  5C15 A;  3VQC A;  1IKX A;  3MN9 A;  1E3M A;  5LJV A;  3HTV A;  3EYZ A;  3SUO A;  3WEE B;  5AQK A;  3EL2 A;  3ENB A;  3CFO A;  1NOZ A;  1K8K B;  2F96 A;  3LP3 A;  3AVN A;  3O4N A;  3V9Z A;  4EHU A;  5TKY A;  4JKD A;  4OGC A;  4JHD A;  4CJ3 A;  2HF3 A;  4B3M K;  1GLJ O;  3VQ5 A;  4YHH K;  1YI2 N;  1QQO A;  3NHG A;  1F21 A;  3HP6 A;  1ZXO A;  5M1F A;  3TSU A;  2YHY A;  4BRC A;  4MO4 A;  4IEI A;  1EX4 A;  3T69 A;  3VMF B;  3HRG A;  1JLC A;  3V9U A;  3SZ2 A;  3MED A;  4B9N A;  3H1V X;  3SJJ A;  3E1Y A;  4FJH A;  4DQP A;  1G99 A;  3P1G A;  4B08 A;  4W5R A;  3U9D A;  3R1X A;  4H5N A;  3V81 A;  1RBR A;  2WC9 A;  3KWG A;  5KRT A;  3IRX A;  3L3U A;  3E9L A;  4J8F A;  4OKJ A;  3OYB A;  3U8X A;  3KIO A;  3Q7B A;  1X9M A;  1B92 A;  4IG3 A;  5E26 A;  2F4V K;  4OPK A;  5KRS A;  1EO1 A;  2GWK A;  3VGL A;  1JLE A;  4BR9 A;  1NJZ A;  1VQ4 N;  4LSN A;  4M41 A;  1J5O A;  4FJ7 A;  2R7Y A;  1J54 A;  2HBL A;  3KZB A;  3FGU A;  4ILH A;  3KK7 A;  3H6E A;  3P38 A;  1WNS A;  3L2U A;  4E7J A;  1GLA G;  3BP8 A;  2ITM A;  3CMA N;  3VQQ A;  1A5X A;  2ITG A;  4UY8 O;  1XMQ K;  3AO1 A;  1NK5 A;  1ZYQ A;  3WQU A;  2YCH A;  2HNZ A;  4CEO A;  2VG5 A;  4X65 K;  3VGK A;  1P90 A;  2D0C A;  1TVR A;  3K5M A;  4R79 A;  2ZJQ L;  2YNH A;  2WUS A;  3NF8 A;  3DLG A;  3T1Y K;  3AV9 A;  4CBU A;  2G8I A;  3NVM A;  2F8T A;  4CF1 A;  3K0S A;  1MWK A;  3U6F A;  4CJK A;  3LP2 A;  3SBT A;  5CYQ A;  4CW7 B;  3K59 A;  4WCE L;  3AO4 A;  3TAF A;  1RTI A;  3F5T A;  4WQ5 A;  2HBM A;  2DPN A;  3VTI A;  3SUP A;  1XWL A;  1NK6 A;  3KTQ A;  3JS6 A;  1WB9 A;  1UA0 A;  1L3T A;  1T05 A;  5AQX A;  4X64 K;  4KHN A;  2HMP A;  1DKG D;  1YXQ A;  1VSF A;  5M1K A;  1SS6 A;  3P5J A;  4V19 S;  4NO7 A;  4MO5 A;  4KKO A;  2VGN A;  2DTU A;  3B6P A;  2BDP A;  3CFR A;  1KD1 O;  1LW2 A;  4K25 A;  4FK4 A;  3QB0 A;  4DV7 K;  3KLE A;  2F7T A;  4IBN A;  1RT3 A;  1XNQ K;  3K2P A;  1QQM A;  3VQB A;  4HWI A;  5CR4 A;  4YOU A;  2P9L A;  4TSX A;  3T19 A;  1VQP N;  3MCP A;  3ULE B;  2YKM A;  3MXM A;  3MXJ A;  2OTL N;  3MX2 A;  3SNN A;  2YHX A;  2PFU A;  4PKG A;  1RDA A;  3M8Q A;  5BN8 A;  1VQ6 N;  4HTU A;  3MN6 A;  3QEW A;  4C8O A;  3EE8 A;  4M7X A;  1C0T A;  3K9J A;  5ADX H;  1H1V A;  1XMO K;  4E19 A;  4CHQ A;  1GOA A;  3EZW A;  3VF6 A;  3QDK A;  2O4G A;  4DV3 K;  1VSM A;  4CBW A;  4IOA L;  3SAF A;  1KQS M;  3EKU A;  3ZSO A;  1YF5 L;  4FVU A;  3CHW A;  4DR5 K;  3OBW A;  3OY9 A;  4DFJ A;  3AGR A;  2XY7 A;  1M90 O;  5AQW A;  1WSG A;  3HPG A;  4KI4 A;  3SPZ A;  3OBY A;  3CXC M;  3PUF A;  4CHZ A;  1DLO A;  4HTL A;  2HF4 A;  3L6Q A;  3F9K A;  3RMA A;  1TKT A;  4MDB A;  3LM9 A;  1VSK A;  3R3L A;  2E5L K;  1FKP A;  1O13 A;  3FFI A;  3FZH A;  3M3Z A;  4KB1 A;  1W7A A;  2VGM A;  4EFH A;  2HHH K;  3HOS A;  3NH1 A;  1EQY A;  3AA5 X;  3SQ4 A;  4OLA A;  1A5W A;  2E6M A;  4CGI A;  3CQ8 A;  4BC2 A;  1VQK N;  3S3O A;  4M3W A;  2VWK A;  3MEG A;  4JI6 K;  2OAN A;  5AZJ B;  5HLF A;  2UUB K;  1T6D A;  1X3M A;  4Z94 A;  4CEF A;  4OGE A;  2D0B A;  4CJS A;  3G6E N;  1CZ9 A;  4FJJ A;  3AA3 A;  5JMV A;  3L4I A;  1KAY A;  5AQF A;  5C42 A;  1C0M A;  4DU4 A;  4M63 C;  4BAC A;  5AQU A;  1N36 K;  4LH5 A;  1VK0 A;  2RPI A;  4FWK A;  4H4O A;  4H0X B;  1YAG A;  3LDP A;  4Q5V A;  1LAW A;  3QBX A;  2HHV A;  3NBP A;  3DLK A;  5FLX O;  1Q9Y A;  1JXE A;  3TAB A;  3DJC A;  3VEN A;  3O9R A;  4J2E A;  1NK4 A;  2G8H A;  1QSS A;  2HHW A;  1BIU A;  3VQ6 A;  5IWA K;  1HQE A;  5C2F A;  5AQQ A;  3ASM A;  5AZI B;  1RGI A;  4KFB A;  1ZBH A;  1HQU A;  2E4L A;  4BR2 A;  2BTF A;  4UQG A;  2A6A A;  5M1Q A;  1BOT O;  4CK3 A;  1NG9 A;  3QIC A;  4B3R K;  1WAJ A;  3MEE A;  2QWN A;  1JL1 A;  1RBV A;  4NLC A;  4BR7 A;  5KPT A;  1BI4 A;  4CGH A;  4I9Q A;  1QZ5 A;  2HHS A;  1WSF A;  1LWF A;  3K9K A;  4O44 A;  4F2R A;  3CYM A;  3ZT0 A;  1Q8I A;  4QS8 A;  1E4G T;  1T8E A;  3I33 A;  2DY4 A;  4N76 A;  1RBS A;  2GTD A;  3M5R A;  2OPP A;  1NGE A;  1OKJ A;  2Z1H A;  4RG8 A;  3PSI A;  3CJ9 A;  2IOC A;  3ID8 A;  4XH1 A;  3GE1 A;  1B9F A;  4BR0 A;  3AVH A;  3O8M A;  2P9N A;  1ATN A;  5FPM A;  1DT9 A;  1WSH A;  4IJA A;  2FSK A;  4BY9 C;  5BRH A;  1RDC A;  4Q0B A;  2HHT A;  4ISE A;  3L3V A;  3O3G A;  2XHB A;  4EP4 A;  4LF7 K;  1QE1 A;  1FK9 A;  2XY5 A;  3NFA A;  3EE9 A;  4B1U B;  2O4I A;  1MWM A;  4KB0 A;  2QWM A;  3ZT2 A;  3ZLJ A;  4I6M B;  1SZ2 A;  1FKO A;  3G25 A;  4IJN A;  1OH7 A;  1HR0 K;  3TAQ A;  3MK6 A;  3P39 A;  4H4M A;  3A5N C;  5LMN K;  2VG7 A;  3O9T A;  4O5F A;  3CCE N;  3RTV A;  2HB5 A;  3MMV A;  4CHO A;  4FWQ A;  4FK0 A;  2KFZ A;  4ISF A;  4I9L A;  1S6Q A;  3ZEU B;  2E20 A;  3CQY A;  3I55 N;  1HKB A;  1S1X A;  1RNH A;  4DSK A;  3DLB A;  3KD1 E;  4ISG A;  4DTR A;  1S3X A;  1NU0 A;  4A2A A;  1N8R O;  4IOX A;  4FZY A;  5LJW A;  4J2A A;  4Y1C A;  3QLH A;  3VER A;  3E9O A;  3P83 D;  4ELT A;  3HVR A;  2Z1J A;  3CPE A;  4CJT A;  3HOT A;  1HKG A;  3K5N A;  4FXD A;  1QHT A;  4C1N K;  4CZK A;  2BE2 A;  4CD1 A;  1WSE A;  2VWJ A;  3EO3 A;  3DLE A;  4FCY A;  5GIO A;  1JKH A;  2HBJ A;  3CJC A;  3DI6 A;  2VQF K;  3OJS A;  3QES A;  1T3V A;  2AA4 A;  4CBX A;  3BGR A;  2IVN A;  4FJG A;  2QTD A;  3ZSR A;  5AQY A;  4FJL A;  4B3S K;  3O08 A;  1O1W A;  3D2F B;  1WBB A;  3DRR A;  2FF6 A;  4GVM A;  4FL9 A;  2FF3 B;  4O0J A;  3A5L C;  4DUZ K;  1KSP A;  1EWR A;  4B3O A;  4O55 A;  3WXJ A;  4BRQ A;  4MDA A;  5AQL A;  4DV4 K;  3HPH A;  4ID5 A;  3TU5 A;  1KVB A;  3H3O B;  3QEX A;  2X6N A;  1B9D A;  5FPE A;  2FSN A;  4BE2 A;  3VQD A;  1W2B M;  2NZT A;  1YIJ N;  3A5O C;  1JXB A;  3KLI A;  3OVN A;  3NAE A;  3THY A;  4CZL A;  1VQ7 N;  4KHQ A;  1SKS A;  4KHW A;  4A61 A;  3OHR A;  3H1Q A;  3G4S N;  4DR4 K;  2A3Z A;  3CJ7 A;  1X3N A;  1A5V A;  4NCG A;  2D0O A;  2P9U A;  1HX1 A;  1NWK A;  2KKZ A;  1MU2 A;  1NLV A;  1J5E K;  3ULD A;  1ZBF A;  2QM1 A;  5KGX A;  3FZF A;  4JD2 A;  2KQ2 A;  5SZT A;  2B4J A;  2CGL A;  3M1F A;  3J7Y P;  4BVO A;  4BQL A;  5CZ2 A;  5C12 A;  3WNF A;  4LD0 A;  2FBX A;  1RTH A;  1HNW K;  1DTQ A;  2WOM A;  1I39 A;  3NMU A;  3BY5 A;  4BC4 A;  2E6L A;  3VOV A;  2P9P B;  3VGM A;  2WTU A;  3LDO A;  4EZ6 A;  4KHP K;  1I94 K;  1U47 A;  1JCE A;  3VQE A;  5AQM A;  1SL1 A;  2ATQ A;  3A0I X;  3ZT1 A;  5CE3 A;  3H46 O;  2ZD1 A;  5EU7 A;  3OYI A;  4K43 A;  4FWO A;  4B1Y B;  4JD2 B;  4R5P A;  1I3A A;  3HL8 A;  2HVH A;  4LFA K;  1K73 O;  4CI6 A;  1RDU A;  3DM2 A;  4CZH A;  2PZS A;  3P31 A;  1YVN A;  3PIP L;  2QKB A;  3V4I A;  1L5U A;  4JAX A;  2UUC K;  4KRE A;  2NUB A;  2XO7 A;  3TTF A;  3HJF A;  4I6M A;  1ATR A;  2ASP A;  1WLJ A;  5EY4 A;  1RTD A;  5DM7 L;  3A8Y A;  4KTW A;  2PBD A;  2X78 A;  3IG1 A;  3SUN A;  2P51 A;  1C1C A;  4GV6 A;  1IO2 A;  2A40 A;  2QKK A;  1QSY A;  3LP1 A;  4DV5 K;  3ZCM A;  2A42 A;  2YV0 X;  4RCH A;  3CCR N;  3JYT A;  4A62 A;  2UU9 K;  2HW3 A;  5HBM A;  3PIO L;  4DF4 A;  2VCP A;  4F2S A;  4CIG A;  3VN5 A;  4IKF A;  4Z4G A;  4PKI A;  1JLB A;  3AA2 A;  1ITG A;  3BUZ B;  3LAN A;  4PY5 A;  3FLC O;  3THW A;  3NF7 A;  1XQS C;  1GLB G;  2HMI A;  3N4P A;  3JAM O;  4Z4F A;  1OH8 A;  4DR3 K;  4KH6 A;  3UKR B;  2QWP A;  4CK1 A;  1SKW A;  5K14 A;  1HYZ A;  5HP1 A;  3DLL L;  4FJX A;  5C25 A;  4H0T B;  5HRN A;  3AY9 A;  1S1T A;  4FOE A;  4WQ4 C;  2QXF A;  4WFB L;  2IS3 A;  4HCB A;  4ZTJ A;  1X9W A;  1TUY A;  2QI2 A;  3VEV A;  2P9K A;  2E88 A;  1YHQ N;  4CJP A;  4B9S A;  3AO3 A;  3DLR A;  1VQ5 N;  1N6Q A;  3ZEU A;  1XUP O;  1NJY A;  5MLC Q;  1YIT N;  1W9H A;  3H3N O;  2ASM A;  3O80 A;  3SBG A;  4NCB A;  3ID6 A;  3IS9 A;  4DR6 K;  4CJL A;  4H03 B;  3LZI A;  4WF9 L;  2CGK A;  3BF1 A;  1D4X A;  3VEZ A;  3HK2 A;  1VQO N;  3LAM A;  5AQO A;  1W97 L;  3J7Z O;  3NCI A;  4GKK K;  4RTF D;  4CZJ A;  1YUW A;  3D0P A;  3ZX3 A;  3S3M A;  1RDB A;  4C1N I;  3THV A;  3L0Q A;  3WNH A;  4PA1 A;  3ZSY A;  2GEM A;  3OS0 A;  4AHT A;  3HXM A;  4KHU A;  2YNG A;  2NRX A;  1Q86 O;  4YFU A;  1YVU A;  4AIL C;  3AAR A;  2P9K B;  4B9U A;  1KAX A;  3DOL A;  3KJV A;  3CJ1 A;  4K41 A;  4YOX A;  3EZ5 A;  3KK1 A;  5ELZ A;  4DF8 A;  1J6Z A;  1XHX A;  2BH1 A;  2IGI A;  3GDQ A;  4GV9 A;  4B8A B;  3U3G A;  1S1U A;  5HL7 L;  1VQ9 N;  1BDG A;  1V4T A;  2CGJ A;  3O9S A;  3TSQ A;  3ZET A;  2B6A A;  4DFK A;  3L8B A;  1SV5 A;  3S41 A;  3OYH A;  4CE9 A;  1IKY A;  4DTP A;  4FLX A;  5JVH L;  2HND A;  3G0Z A;  3NF6 A;  4W5O A;  1N5Y A;  1ZBU A;  3O5B A;  4A57 A;  3PSF A;  1EWQ A;  4N47 A;  3IFR A;  1BO5 O;  4H0O A;  4AM7 A;  3TAE A;  2RF2 A;  1E4F T;  3C6U A;  2B5J A;  4O8U A;  1RDW X;  4CJW A;  1BUP A;  3E66 A;  3V1R A;  2HHU A;  1X9J A;  2GX9 A;  4BDY A;  3VET A;  4B1W B;  3SI6 A;  4FZX C;  2O8F B;  4WQ4 A;  3I0R A;  3QFP A;  4GW6 A;  2QK9 A;  4JI2 K;  3FZK A;  2P9L B;  4BRK A;  4IO8 A;  2YJE A;  2E2P A;  2YHA A;  5F1X A;  2P9I A;  4FZZ A;  1OVQ A;  1GLD G;  4DB3 A;  4DSI A;  3HZ6 A;  1VSH A;  4CFB A;  4AQY K;  1GLF O;  2OPS A;  5I9E B;  2F9T A;  4JKE A;  3GL1 A;  4DTU A;  4NYF A;  4CHP A;  4O4G A;  1ZBS A;  4IWV A;  4GVE A;  4CEB A;  3THW B;  3MAQ A;  3VEX A;  4FJ9 A;  1C1B A;  4I7F A;  2OZM A;  1C0U A;  1NGH A;  3WNG A;  3SCX A;  3HSC A;  1RCH A;  3OYC A;  4IEE A;  2O8B A;  1QVF M;  1KCF A;  1HJO A;  1S72 N;  4CED A;  1LAV A;  1EKE A;  5HRP A;  3AVF A;  1DGK N;  4M45 A;  3CCJ N;  3D2E A;  1HPZ A;  4N56 A;  2QW9 A;  1UAX A;  3IKM A;  4CJV A;  1IJJ A;  5BPM A;  3KLF A;  4JS4 A;  3ITH A;  3TTC A;  1QTM A;  3CET A;  3OYF A;  3DLH A;  4C8K A;  1HJR A;  5AQN A;  4B3T K;  3CJA A;  3RWU A;  2V51 B;  3WXM B;  1TK5 A;  1RIL A;  2JWL A;  2YNI A;  3C94 A;  2ZJR L;  4ZTF A;  5BR9 A;  4DSL A;  4EP5 A;  4YOY A;  4C23 A;  1U48 A;  3ZSQ A;  4CEE A;  1BHL A;  5BPL A;  3L2V A;  4CJF A;  2HHX A;  1VSI A;  4EIA A;  3F9M A;  1KAZ A;  4BE1 A;  3H45 C;  1KFD A;  3LZJ A;  5EOY A;  4RW4 A;  3J80 O;  4DLG A;  5ADX A;  3U4L A;  5GAD P;  1X9S A;  2I7N A;  1JCF A;  4B1V A;  3J8A A;  4CJU A;  4J2D A;  3SMS A;  2UYT A;  3M8P A;  1MDU B;  1YT3 A;  1D9D A;  3HM8 A;  2NRR A;  5AJ3 K;  3CQX A;  3C95 A;  2D0A A;  4CK2 A;  3FR0 A;  1NGJ A;  5GAH P;  2X6S A;  4DTS A;  1HNI A;  4F3T A;  2FBT A;  1VRU A;  4EAH D;  3NH2 A;  1N34 K;  3C65 A;  4C8L A;  2NLX A;  3MN7 A;  4DU3 A;  2A5X A;  4XH5 A;  3WNE A;  4ELV A;  1S6P A;  4OPH A;  2IVO A;  1TUU A;  1W0H A;  4E1N A;  5KI6 A;  2FC0 A;  3K58 A;  3NDK A;  4DR1 K;  4BWJ A;  4CF9 A;  5AQH A;  4O0I A;  3D2F A;  3NGY A;  1ZC6 A;  5AQJ A;  2IIR A;  3PY8 A;  1ZBI A;  5FPD A;  5GIP A;  3RR8 A;  4Z4H A; 
#chains in the Genus database with same CATH homology
 4FJG A;  3ZSR A;  2F96 A;  3LP3 A;  4BDZ A;  3AVN A;  3O4N A;  2Y1I A;  4FJL A;  3V9Z A;  3ZSV A;  1HNV A;  2D5R A;  1O1W A;  4OGC A;  5KGW A;  1S1W A;  3DRR A;  4CJ3 A;  4GVM A;  4KI6 A;  1JLQ A;  4AHU A;  3OYM A;  4O0J A;  3VQ5 A;  1KSP A;  3CM5 A;  5JS2 A;  4B3O A;  4O55 A;  3MEC A;  4I2P A;  4GMJ B;  3NHG A;  1F21 A;  3HP6 A;  4KV8 A;  4FJ8 A;  1IG9 A;  3KKR A;  1BCO A;  1TGO A;  3HPH A;  4ID5 A;  1VSE A;  4CGF A;  3QET A;  1KVB A;  4HVJ A;  4OVL A;  3S3N A;  3VQ9 A;  4FLW A;  4JS5 A;  3QEX A;  4Z4E A;  4DQR A;  2X6N A;  1B9D A;  3HM9 A;  1JLA A;  1EX4 A;  3NGI A;  4BE2 A;  3VQD A;  1JLC A;  3V9U A;  3VQA A;  3SZ2 A;  3MED A;  4B9N A;  4M3U A;  4FJI A;  3SJJ A;  1C6V A;  1JXB A;  3KLI A;  3OVN A;  4ID1 A;  3QER A;  4FJH A;  3NAE A;  4DQP A;  3MXI A;  2A1R A;  3P1G A;  4DFM A;  4B08 A;  2FBV A;  4KHQ A;  1SKS A;  4KHW A;  2IAJ A;  4W5R A;  4KTZ A;  4I2Q A;  2EX3 A;  4G1Q A;  3LAK A;  3V81 A;  1TV6 A;  1RBR A;  3KK2 A;  5KRT A;  3IRX A;  3L3U A;  1A5V A;  4NCG A;  4E89 A;  4OKJ A;  3H08 A;  2W42 A;  3OYB A;  3KIO A;  1MU2 A;  3HO1 A;  5E41 A;  1X9M A;  1B92 A;  4IG3 A;  3ULD A;  1ZBF A;  4MQ3 A;  4CJ5 A;  5KRS A;  4OPK A;  4FW2 A;  4DSE A;  3V9W A;  4KTQ A;  3B6O A;  1LW0 A;  3V1O A;  5KGX A;  4FJK A;  3ZSX A;  4FLU A;  4FJ5 A;  2XRI A;  1JLE A;  1NJZ A;  2KQ2 A;  4KO0 A;  4RW9 A;  1ASU A;  3OYN A;  5SZT A;  2B4J A;  4LSN A;  4M41 A;  1J5O A;  4BE0 A;  2PYJ A;  4FJ7 A;  5CZ2 A;  2KW4 A;  1NOY A;  2R7Y A;  1KLN A;  1J54 A;  4LD0 A;  2FBX A;  3WNF A;  4Z4I A;  4M42 A;  1RTH A;  1LV5 A;  2YHB A;  5FRN A;  1DTQ A;  2WOM A;  1D5A A;  1I39 A;  5SWM A;  2LSN A;  2BAN A;  1BCM A;  3SQ1 A;  4FW1 A;  4CEC A;  1WNS A;  3L2U A;  4E7J A;  2E6L A;  1NK0 A;  1S9E A;  3TR8 A;  4EZ6 A;  2GV9 A;  3VQQ A;  4QOZ B;  1A5X A;  1Z25 A;  4LH4 A;  2ITG A;  5KTQ A;  3VQE A;  1U47 A;  1SL1 A;  4JRP A;  3OYD A;  3AO1 A;  2ATQ A;  3ZT1 A;  1NK5 A;  2ZD1 A;  5EU7 A;  4DLE A;  3OYI A;  1ZYQ A;  1RT4 A;  3F73 A;  2HNZ A;  4FM1 A;  2VG5 A;  4WE1 A;  4CEO A;  2DFF A;  3KKS A;  1I3A A;  4R5P A;  1XC9 A;  3HL8 A;  4OPJ A;  2HVH A;  1UWB A;  2D0C A;  1TVR A;  3K5M A;  4L8R B;  3TAR A;  1TAQ A;  3AVJ A;  3DM2 A;  2YNH A;  3VQ8 A;  4CJE A;  2G8F A;  1NKB A;  2PZS A;  1NK7 A;  2ETJ A;  3NF8 A;  3DLG A;  4AHV A;  3SV3 A;  4FJN A;  3AV9 A;  2QKB A;  3V4I A;  3NE6 A;  3PX6 A;  2G8I A;  2Y1J A;  1L5U A;  4KRE A;  2NUB A;  1KTQ A;  4CES A;  4Z0U A;  2XO7 A;  4CJQ A;  4J2B A;  4DSF A;  2F8T A;  3HJF A;  4CF1 A;  3V9S A;  3C6T A;  4CIF A;  3DMJ A;  3VQ4 A;  3SQ2 A;  3VQ7 A;  2IC3 A;  3U6F A;  4CJK A;  3LP2 A;  3VQP A;  2ZE2 A;  3OYK A;  1WLJ A;  4IFV A;  3NH0 A;  3LPT A;  5CYQ A;  1RTD A;  3K59 A;  5J1E A;  4KTW A;  5FRM A;  3DOK A;  2X78 A;  1YTA A;  3IG1 A;  3L2Q A;  3SUN A;  4CJR A;  3CFP A;  3AO4 A;  4DQS A;  3TAF A;  1RTI A;  3EY1 A;  2P51 A;  1C1C A;  1BI4 B;  1U04 A;  1D9F A;  1C1A A;  1EXQ A;  1IO2 A;  3LWM A;  2QKK A;  1QSY A;  3PO5 A;  1BGX T;  3LP1 A;  4M3R A;  3ZCM A;  4M3Y A;  4DMN A;  4HHT A;  3SUP A;  2YV0 X;  5CYM A;  1XWL A;  1NJW A;  1NK6 A;  3JYT A;  1U49 A;  3KTQ A;  2HW3 A;  5HBM A;  1UA0 A;  3HP9 A;  4CGG A;  2OYQ A;  4DF4 A;  1BIZ A;  4E7H A;  1L3T A;  3HST B;  4F2S A;  1T05 A;  4CIG A;  3VN5 A;  4YNQ A;  4HUF A;  4IKF A;  2KTQ A;  3HT3 A;  2PYL A;  3OYE A;  4KHN A;  3DYA A;  4Z4G A;  4F4K A;  1JLB A;  1SL0 A;  5J2Q A;  3AA2 A;  2YKN A;  4Z4C A;  1TK8 A;  1ITG A;  1L3V A;  1VSF A;  3P5J A;  3SQ0 A;  3LAN A;  1KLM A;  2KZZ A;  4PY5 A;  4KKO A;  5FDL A;  1JLF A;  2DTU A;  3B6P A;  1VRT A;  2BDP A;  3CFR A;  1QQC A;  3NF7 A;  1LW2 A;  4FK4 A;  1ASW A;  4DTM A;  2HMI A;  1SL2 A;  3QEP A;  4Z4F A;  1RBT A;  4CJ4 A;  1Y97 A;  3KLE A;  2G8U A;  1EET A;  1XHZ A;  1R0A A;  1NKE A;  2XY8 A;  1RT3 A;  4IBN A;  3K2P A;  4CK1 A;  5I42 A;  1SKW A;  4BDP A;  3VQB A;  5K14 A;  1HYZ A;  5HP1 A;  4KAZ A;  4TSX A;  4FJX A;  3T19 A;  5C25 A;  3PX0 A;  4M3X A;  1X1P A;  1EP4 A;  1REV A;  3ALY A;  5HRN A;  3SV4 A;  2YKM A;  5CY4 A;  4DU1 A;  3MXM A;  4E3S A;  1S1T A;  1L3S A;  3RMB A;  2QXF A;  3MXJ A;  3QO9 A;  4FLY A;  3AO5 A;  4E7K A;  2IS3 A;  3LWL A;  4OJR A;  3SNN A;  2GUI A;  1RDA A;  4DTN A;  1RT7 A;  4B9L A;  4HCB A;  3M8Q A;  4QCL A;  1GOB A;  4C8M A;  4HTU A;  4ZTJ A;  1U45 A;  1X9W A;  3QEW A;  4DS4 A;  4C8O A;  3AVC A;  3K5L A;  3TAP A;  4B9T A;  4W5Q A;  5FRO A;  1UA1 A;  4CJP A;  4B9S A;  2JLE A;  1C0T A;  3TAG A;  3ZT3 A;  3AO3 A;  1GOA A;  3DLR A;  4E19 A;  4CHQ A;  3T3F A;  2P5G A;  1N6Q A;  2FBY A;  2O4G A;  1BL3 A;  1VSM A;  3DRS A;  3TAN A;  1NJY A;  3HVT A;  1S5J A;  1W9H A;  5D3G A;  1WAF A;  3ZSO A;  5J2P A;  1KRP A;  4N5S A;  4NCB A;  5DK5 A;  1J53 A;  3IS9 A;  4CJL A;  4CEZ A;  3OY9 A;  3LZI A;  4DFJ A;  2XY6 A;  2XY7 A;  1HRH A;  3TI0 A;  1WSG A;  3VA3 A;  3CM6 A;  4PUO A;  3HPG A;  3HK2 A;  4KI4 A;  2X74 A;  5J2M A;  2VG6 A;  2JGU A;  3LAM A;  3QEI A;  3SPZ A;  3G10 A;  2G8K A;  3PUF A;  2PY5 A;  3NCI A;  4CHZ A;  3I8D A;  1DLO A;  3D0P A;  3S3M A;  1HYS A;  1RDB A;  4FLV A;  3F9K A;  1TKX A;  4CFA A;  4CIE A;  3RMA A;  1TKT A;  4QAG A;  3THV A;  4HCC A;  1WSI A;  1VSK A;  4JLH A;  3WNH A;  2KFN A;  1FKP A;  4PA1 A;  2DFE A;  3FFI A;  4H8K A;  4IG0 A;  4C8N A;  3ZSY A;  3ZT4 A;  3OS0 A;  4AHT A;  1RT5 A;  1Z26 A;  3OS2 A;  3JSM A;  4JRQ A;  4ELU A;  4KB1 A;  3HXM A;  3PO4 A;  1IH7 A;  3AVA A;  4FM0 A;  4KHU A;  2YNG A;  4KHS A;  3L2R A;  4FM2 A;  3NH1 A;  1NKC A;  1K6Y A;  4HUE A;  4YFU A;  3AA5 X;  1DTT A;  4RW7 A;  1IKW A;  1YVU A;  4AIL C;  3SQ4 A;  4B9U A;  4OLA A;  3DOL A;  3KJV A;  2HVI A;  1A5W A;  1TKZ A;  2E6M A;  2I5J A;  4IDK A;  4B8C A;  4CGI A;  3CQ8 A;  4OKE A;  3EZ5 A;  3OYA A;  3KK1 A;  2HNY A;  4B9V A;  3S3O A;  4M3W A;  2VWK A;  3MEG A;  4AH9 A;  4DF8 A;  3RRG A;  4B9M A;  5HLF A;  3LPU A;  3OYJ A;  1XHX A;  1BIS A;  3LDS A;  3RMC A;  1TAU A;  2IGI A;  3AVI A;  4OGE A;  2D0B A;  2DFH A;  4CEF A;  4CJS A;  1S9G A;  3LAL A;  1CZ9 A;  4FJJ A;  3AA3 A;  1KFS A;  4B8A B;  3U3G A;  3CG7 A;  1S1U A;  2P5O A;  3S9H A;  5C42 A;  3T1A A;  1C0M A;  1JLG A;  3TAM A;  4ICL A;  3O4Q A;  4DU4 A;  4BAC A;  2B6A A;  4DQI A;  4DFK A;  3L8B A;  1SV5 A;  4LH5 A;  3OJU A;  3PX4 A;  1QSL A;  1VK0 A;  1ZBL A;  2RPI A;  3QIO A;  4H4O A;  4CE9 A;  3OYH A;  4KHY A;  1IKY A;  4DTP A;  4DFP A;  1Q9X A;  3QIP A;  4Q5V A;  3V6D A;  1LAW A;  4FLX A;  2HND A;  3G0Z A;  3NF6 A;  2HHV A;  3NBP A;  4W5O A;  4OKK A;  1N5Y A;  1ZBU A;  3RRH A;  1BQN A;  3HPO A;  3DLK A;  4BWM A;  1SKR A;  1JXE A;  3TAB A;  1Q9Y A;  4OLB A;  1U4B A;  4N47 A;  4RW8 A;  1T03 A;  3QNO A;  1NK4 A;  2G8H A;  1QSS A;  4J2E A;  4PQU A;  1BIU A;  3VQ6 A;  2HHW A;  2ZQB A;  3TAE A;  1JL2 A;  3QIN A;  4NCA A;  1HQE A;  1CZB A;  2RF2 A;  4DWI A;  2OA8 A;  3ASM A;  3C6U A;  2B5J A;  4CJW A;  4FLZ A;  3AVK A;  3I0S A;  5I3U A;  4W5T A;  3V1R A;  4KFB A;  3KK3 A;  2HHU A;  3OYL A;  1ZBH A;  4PWD A;  1HMV A;  1HQU A;  2E4L A;  4ZHR A;  4UQG A;  4BDY A;  4K8Z A;  3SI6 A;  4FZX C;  2RKI A;  3AA4 A;  4CK3 A;  4CF2 A;  3AVL A;  3I0R A;  4GW6 A;  2QK9 A;  3OYG A;  1CXQ A;  3SUQ A;  1TK0 A;  1WAJ A;  3AO2 A;  4CEQ A;  3BDP A;  2KZM A;  3MEE A;  1JL1 A;  1RBV A;  1VSD A;  3ISN C;  2OPQ A;  5CZ1 A;  4CER A;  4M3T A;  4IFY A;  4LSL A;  2YHA A;  1BI4 A;  3ZSW A;  4FZZ A;  4CGH A;  4I9Q A;  2HHS A;  1WSF A;  1G15 A;  1LWF A;  5J2N A;  4O44 A;  4F2R A;  5C24 A;  3CYM A;  4DSI A;  3ZT0 A;  1Q8I A;  1VSH A;  4CFB A;  4E7I A;  3RMD A;  1GOC A;  3SYZ A;  2OPS A;  1T8E A;  4HUG A;  1FXX A;  4O5B A;  3V1Q A;  2HHQ A;  4N76 A;  2DY4 A;  1RBS A;  4DTU A;  4NYF A;  4CHP A;  3RR7 A;  4O4G A;  1VSJ A;  1NK9 A;  4CEB A;  4CF0 A;  4FJ9 A;  3MAQ A;  4RW6 A;  1C1B A;  2OPP A;  4I7F A;  3ZSZ A;  1C0U A;  2OZM A;  4MFB A;  2Z1H A;  3WNG A;  4RG8 A;  3SCX A;  3E01 A;  4AHC A;  1LWC A;  4M3Z A;  4KRF A;  2IOC A;  4CCH A;  4F3O A;  4DS5 A;  1RCH A;  1B9F A;  4Y1D A;  3OYC A;  3AVH A;  4CHY A;  3U3Y A;  4W5N A;  3AVM A;  1KCF A;  4NYN A;  4FJM A;  1J9A A;  3IAY A;  4CF8 A;  4CED A;  1RDD A;  4N41 A;  1LAV A;  1EKE A;  3AVG A;  3A2F A;  4FVM A;  1RT1 A;  2YNF A;  5HRP A;  3AVF A;  3OS1 A;  1D8Y A;  4M45 A;  4F8R A;  1HPZ A;  1WSH A;  5HRS A;  4CJV A;  1UAX A;  1VSL A;  4N56 A;  1LWE A;  4JS4 A;  3KLF A;  3VA0 A;  3ITH A;  3KD5 E;  2GBZ A;  1QTM A;  4EZ9 A;  3OYF A;  1RDC A;  4FK2 A;  4Q0B A;  3O3G A;  1RT2 A;  3L3V A;  2XHB A;  3M8R A;  3L2W A;  3DLH A;  2HHT A;  3DRP A;  5DMR A;  4EP4 A;  3NF9 A;  4C8K A;  1QE1 A;  3K5O A;  1TL1 A;  1NJX A;  1FK9 A;  4DTJ A;  1IKV A;  1HJR A;  2XY5 A;  2F8S A;  4XIU A;  3NFA A;  1WSJ A;  3O3H A;  4K8X A;  4CFD A;  2O4I A;  3KLG A;  4CEA A;  3KLH A;  3RWU A;  1TK5 A;  4E0D A;  4KB0 A;  1RIL A;  3ZT2 A;  2YNI A;  2G8V A;  3C94 A;  4ZTF A;  4DSL A;  4EP5 A;  1U48 A;  5T7B A;  3V9X A;  4DTX A;  3ZSQ A;  4CEE A;  1BHL A;  3L2V A;  3NGZ A;  3K57 A;  1FKO A;  1SUQ A;  4DG1 A;  1T7P A;  4CJF A;  3HYF A;  2HHX A;  3TAQ A;  1VSI A;  2P1J A;  4H4M A;  3O3F A;  2VG7 A;  4BE1 A;  3LZJ A;  1KFD A;  1NK8 A;  4FYD A;  4RW4 A;  3RTV A;  1TKD A;  4DLG A;  2HB5 A;  1L3U A;  1X9S A;  4CHO A;  3D45 A;  4FK0 A;  4CJU A;  2KFZ A;  4J2D A;  2WON A;  4I9L A;  1S6Q A;  3M8P A;  1RTJ A;  1BQM A;  4CGD A;  1YT3 A;  3LP0 A;  1RBU A;  2Q3S A;  1D9D A;  1QS4 A;  3UIQ A;  1S1X A;  4AHR A;  1RNH A;  2EHG A;  3DLB A;  3C95 A;  2D0A A;  3QEV A;  4DSK A;  4CK2 A;  3KD1 E;  4DTS A;  2X6S A;  4DTR A;  1HNI A;  2Z1I A;  3SPY A;  2Z1G A;  1CXU A;  2FBT A;  4E7L A;  4F3T A;  4CHN A;  4FZY A;  4J2A A;  1KVA A;  1VRU A;  3NH2 A;  4Y1C A;  1XI1 A;  4C8L A;  1YTU A;  4CFC A;  4KPY A;  4DSJ A;  3M8S A;  3QLH A;  3P83 D;  4DU3 A;  4ELT A;  1KVC A;  1TL3 A;  1HYV A;  3HVR A;  3AVB A;  5HRO A;  3QNN A;  1WN7 A;  2OPR A;  2Z1J A;  1S1V A;  2A1S A;  3WNE A;  4CJT A;  3TWH A;  4ELV A;  4DTO A;  5JS1 A;  1ASV A;  1S6P A;  2IDO A;  4DQQ A;  2BGG A;  3K5N A;  4FXD A;  2G8W A;  1QHT A;  3PV8 A;  2RN2 A;  2BE2 A;  1W0H A;  4LY7 A;  1RT6 A;  5HRR A;  4E1M A;  1WSE A;  4E1N A;  2VWJ A;  5KI6 A;  3DLE A;  4FCY A;  1CLQ A;  2FC0 A;  4AHS A;  3VQC A;  1IKX A;  3NDK A;  3K58 A;  1JKH A;  1UOC A;  4BWJ A;  4CGJ A;  4FLT A;  4CF9 A;  4O0I A;  2AJQ A;  3DI6 A;  3NGY A;  2OZS A;  3PY8 A;  3EYZ A;  3SUO A;  1ZBI A;  3OJS A;  3QES A;  3RR8 A;  4Z4H A;  3CFO A;  3BGR A;  1NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...