4JLHA

Hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
138
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEFESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 Integrase catalytic core domain
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 45
structure length 138
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4jlhA00
1VRTA 3D45A 2BDPA 1TL1A 2VG6A 4RW9A 3T1AA 3U6FA 3TAQA 3ITHA 3M8SA 2FC0A 4CF0A 3ZCMA 3KD5E 4E1MA 1VSIA 1C0TA 4KKOA 4RW6A 4AHUA 4CIGA 2HHWA 1ASUA 2Z1IA 4OKEA 3OYLA 3LZJA 4DQIA 2VG7A 2G8FA 4Q5VA 4F3OA 1LWEA 5HBMA 3LPUA 1VSHA 4CJTA 4F2SA 1U48A 2HVIA 1IKXA 1KRPA 3QINA 1RT1A 4DF4A 5HROA 3QO9A 3OY9A 3HPGA 2X78A 1S1VA 4RW8A 4BWJA 1YT3A 1X9MA 2DFEA 4RW4A 4CJKA 3HM9A 1S6QA 3WNEA 1VSKA 1TL3A 1J5OA 4Z4IA 4H4OA 1NK8A 2ZE2A 1Z26A 4UQGA 4C8NA 1B9DA 4CJ4A 4CFDA 1SKSA 2IC3A 2WOMA 3ZSXA 3ZSZA 5T7BA 2RF2A 3D0PA 4DFKA 2HMIA 2NUBA 4ELTA 1VSDA 4MQ3A 3L2WA 4YFUA 4M3XA 2HHTA 4PA1A 3G10A 2HHVA 3C94A 3KLHA 4I9LA 4C8MA 3WNGA 3AVIA 3BGRA 3VQPA 4H4MA 1BGXT 1U47A 3OYKA 2IGIA 4FJHA 4CEEA 4KTZA 3TAEA 4KHSA 3G0ZA 2XY6A 3IS9A 4AHVA 2HNDA 5HRPA 3OYEA 1GOAA 4N5SA 3QETA 4HCBA 4N76A 3VQEA 3AO2A 4CIEA 3S3OA 3K5OA 4DS5A 3KKSA 3HK2A 4NCBA 2ATQA 1WSIA 3VQAA 1BCOA 4G1QA 1NK9A 3NF9A 4W5NA 4KFBA 4FJKA 4FW2A 2QK9A 1TV6A 4Z0UA 3QEPA 3A2FA 4OLBA 3RMDA 2HHQA 3RR8A 1DTQA 4CHNA 4PY5A 4DTSA 2P1JA 2VWJA 4O4GA 1QTMA 1C6VA 3MXJA 4JS5A 2QKKA 4KB1A 3M8RA 3THVA 4C8LA 4DTJA 1RNHA 2GV9A 3ZT3A 2A1SA 3P83D 3NHGA 2D0CA 1A5WA 3SQ4A 2KTQA 5J2NA 3JSMA 4FLZA 4FK4A 1JLQA 3K5NA 3V9UA 3QERA 3CM5A 3DOLA 2BGGA 4CIFA 1QHTA 2KFNA 2VG5A 5J2MA 3V81A 3FFIA 3QLHA 4WE1A 3HP9A 3SQ0A 1NJZA 5JS2A 1SKRA 4FZXC 2EHGA 5J1EA 4CEDA 2PY5A 3HL8A 2ITGA 4C8KA 3C95A 1BI4A 4OGEA 1NJXA 4JRQA 1RBUA 3OVNA 1MU2A 2AJQA 4OLAA 4CJ3A 4YNQA 5FROA 3LP0A 4FLXA 3DMJA 4DTPA 1XHXA 3DI6A 2RPIA 2OYQA 1TGOA 1D9FA 4M3WA 1L3UA 2X74A 1RT7A 2RN2A 4KO0A 2R7YA 4KHQA 3OYGA 1LW2A 5K14A 4HUGA 3PO5A 4J2BA 3U3YA 4DU3A 4F8RA 3AVLA 2DY4A 1J53A 2DFFA 3B6OA 3QIPA 4FJIA 1Y97A 2ZD1A 4B9SA 3B6PA 3HVTA 4CK3A 4FJXA 4Z4EA 3AO5A 5SZTA 2XRIA 3DLKA 4ZHRA 1G15A 4FJNA 3OS0A 4CJ5A 3WNHA 4DFPA 3K2PA 1Q9YA 1D8YA 4DWIA 4E7JA 3DLHA 2KZZA 1HYVA 3LWLA 3ZT2A 4CF9A 3SUOA 1L5UA 4B9UA 3CFPA 3L2VA 2I5JA 3ZSYA 1QE1A 1B92A 4FVMA 1REVA 4OVLA 1WN7A 3OYBA 4KAZA 4CGHA 4KHWA 4K8XA 2HW3A 2FBTA 1KSPA 2O4IA 1O1WA 4Z4HA 4DTUA 4ZTFA 4CJEA 4QCLA 3V1QA 1JLCA 1JXEA 2HNYA 4CK2A 4IG3A 3DLGA 4M3TA 1EETA 4AH9A 2YKNA 1CXQA 3ZT1A 4Y1DA 2HHUA 3OYFA 4K8ZA 1RBVA 3LPTA 1D5AA 3OYHA 1ASWA 3NAEA 2YNHA 1EXQA 3MECA 2IAJA 4DTOA 1BISA 1D9DA 1BI4B 4BWMA 1QSLA 1JLEA 3KJVA 1SKWA 4Q0BA 4W5OA 3SV3A 2HNZA 3OJUA 1CXUA 4GVMA 4DQRA 1NKCA 3LDSA 1S1WA 4BE1A 4CJFA 4DQQA 4CECA 1U4BA 1HQEA 5DK5A 1SUQA 4E1NA 4OPKA 3L2QA 4DLGA 4DQSA 3PV8A 3QEIA 4DSLA 1Q8IA 1JL1A 1C0UA 2X6NA 4QAGA 4B8CA 1NK5A 3QEWA 4KI4A 4E7LA 3LZIA 4FM0A 1IO2A 1C0MA 3SV4A 4I7FA 4DMNA 3HPHA 1L3TA 1HYZA 1RDBA 5JS1A 5C25A 2Y1IA 1WSGA 4N56A 4LSLA 3HO1A 3AA2A 4DS4A 2GBZA 1LWFA 3KK1A 5KTQA 3OS1A 1RDAA 3I8DA 1KFDA 1RTJA 4JS4A 4IKFA 3VQQA 2GUIA 4CF1A 1LWCA 3AVKA 3TAPA 3NBPA 1TKZA 2YNFA 4HHTA 5C42A 3QEVA 1IKYA 3LP1A 2YV0X 2BE2A 4I2QA 5FRMA 3DRSA 3E01A 4IG0A 2FBVA 5CZ1A 1TK8A 4FJGA 3UIQA 1QS4A 1X9SA 1SV5A 4DTRA 2Y1JA 3ZT0A 3OYMA 3SQ1A 3AO3A 2G8WA 4C8OA 1ASVA 4FJMA 2OZMA 1BL3A 3L2RA 3LP3A 1TAQA 4MFBA 3SUNA 1NKBA 2B4JA 3JYTA 3ALYA 4DF8A 1HJRA 2FBYA 3V9ZA 3NF8A 4KRFA 4CK1A 3CG7A 3S9HA 3BDPA 3NFAA 1RBSA 4CEAA 4CJRA 3V9WA 3S3NA 3K59A 1X9WA 1X1PA 3TAMA 4DTXA 4FJ8A 4CEQA 4M3YA 4CEOA 5HP1A 1WAJA 4KTQA 3K5LA 1KVBA 3RRGA 4F4KA 1WNSA 3KLIA 1WLJA 5KRTA 1JL2A 1T7PA 1I3AA 2B5JA 2XY8A 3AV9A 1UOCA 1VSMA 5HRNA 4AILC 1LV5A 4NCGA 1DTTA 2IS3A 1UWBA 3PX4A 2D0AA 2FBXA 3P5JA 5CZ2A 3S3MA 1QSSA 3PO4A 1BCMA 1ZBUA 4CJUA 3KK2A 1NJWA 3DLRA 3O4QA 3EZ5A 1HYSA 2D0BA 3RR7A 3VQ6A 2G8VA 1T05A 3NE6A 4F2RA 3AO4A 1ZBFA 3ISNC 1VRUA 4LH4A 5KRSA 2YHAA 2G8IA 1VK0A 4XIUA 1U04A 4FM1A 3SPYA 4OGCA 5C24A 4CHQA 1NOYA 1XI1A 4M42A 1YTUA 1RT5A 4B3OA 5I3UA 5FDLA 3NH2A 2KQ2A 3ZT4A 3SUQA 2KFZA 4DSFA 5KI6A 1FKOA 4DG1A 4ICLA 3HSTB 1IKWA 2VWKA 4FW1A 3SQ2A 2P5OA 3VA0A 5HRRA 2F96A 1CZ9A 5EU7A 1W0HA 3TI0A 3IAYA 4BE2A 2YKMA 3DM2A 3V4IA 1RT6A 3LP2A 3NH1A 5FRNA 1RT2A 3RTVA 2E4LA 1JKHA 3TABA 4CFCA 2A1RA 1BQNA 1SL1A 3OYDA 1B9FA 3HPOA 4ID5A 2P5GA 5D3GA 2RKIA 5CY4A 4NYFA 3KKRA 1XWLA 3ASMA 1JLAA 2Z1JA 3OYIA 3TR8A 4AHCA 2G8UA 1CLQA 1KLNA 3L2UA 1HPZA 1RBTA 4DSJA 3VQ7A 1KCFA 1JLBA 3ZSOA 4FK2A 4Y1CA 3KLFA 1J54A 1RT4A 2OPPA 4CHZA 4E89A 1XC9A 3O3FA 2XO7A 1WSEA 1A5VA 3V1RA 4FLWA 2PYLA 1S9GA 4LSNA 4O0IA 3KLGA 1S1XA 2D5RA 4CJLA 3LWMA 4B9VA 4LH5A 4FK0A 1RDCA 4GW6A 4DSKA 3ZSWA 1S5JA 3L3UA 4CFAA 4EP4A 4CF2A 3NGZA 3O3HA 1ZBIA 2Z1GA 3ZSRA 4EZ6A 4CJWA 4RG8A 1RTIA 1ZBHA 1IH7A 1TKDA 1TAUA 1ZBLA 5SWMA 3AVGA 1KLMA 4DTNA 4ELUA 3AA3A 4TSXA 3V9XA 4LD0A 3RMCA 3NCIA 1W9HA 3VA3A 1FXXA 3K5MA 4KV8A 3RWUA 3L8BA 1S6PA 3SYZA 2F8TA 3K58A 3SCXA 1RILA 5E41A 2ETJA 4IBNA 4KHNA 4CEFA 4PQUA 4CF8A 3KLEA 4B9NA 4Z4GA 5HLFA 2F8SA 4FXDA 4FZYA 1EKEA 2OPQA 3QESA 2E6LA 1KVCA 1HMVA 2O4GA 1VSEA 4M3RA 1YVUA 2XY7A 2IOCA 4HTUA 1CZBA 1RBRA 4B9TA 1BQMA 1JLGA 1U49A 2WONA 3OYAA 3AVAA 1S1UA 4CFBA 3TARA 3KK3A 3DLEA 4Z4FA 1C1BA 1WSJA 3AO1A 4AHRA 3AVNA 3NF6A 2HHXA 3QIOA 2PZSA 3HXMA 4CCHA 2IDOA 2OPSA 4J2DA 3F73A 1JLFA 3OYCA 1TKXA 3EYZA 1ITGA 4FJ9A 3MEDA 2KW4A 1SL2A 5DMRA 1KTQA 3P1GA 3VQ8A 3OS2A 3TAFA 3V9SA 4PWDA 3CM6A 4JRPA 4O5BA 3HT3A 2HHSA 1NOZA 1VSFA 2DFHA 4BE0A 3H08A 3OYNA 3ULDA 4KB0A 3NGIA 2KZMA 2EX3A 4IFYA 3LAKA 1LAVA 5KGXA 2X6SA 4ZTJA 1NK6A 4L8RB 3NH0A 3T3FA 3V1OA 3F9KA 4CHPA 3PY8A 2PYJA 4CGDA 1FKPA 2G8HA 4OPJA 4F3TA 4B9MA 3DRPA 2HVHA 4J2AA 5CYMA 3LAMA 1F21A 4E0DA 1GOCA 1S9EA 3I0RA 1UA1A 3AA5X 1BIZA 4OJRA 4E3SA 3AVJA 4KHUA 2B6AA 4ID1A 4FCYA 1HNVA 4JLHA 3PUFA 3AVMA 4R5PA 4BACA 4FLTA 3CYMA 4N47A 1HNIA 4AHTA 3QNOA 5I42A 3DRRA 1TVRA 1XHZA 3LALA 3L3VA 3HYFA 4M3UA 4CJQA 4O0JA 3TWHA 2QKBA 2HB5A 4B9LA 3VQ9A 4B8AB 4E19A 3V6DA 5CYQA 4FYDA 1QQCA 1WAFA 1ZYQA 2OZSA 4FZZA 4QOZB 3VN5A 4DU4A 4NYNA 4FLUA 1NKEA 4CJPA 1C1CA 1NJYA 4DFMA 3CQ8A 1TK5A 4ELVA 1EP4A 4FJJA 1KFSA 1L3VA 1UAXA 1J9AA 3RRHA 3TAGA 2LSNA 3U3GA 1RCHA 4NCAA 1Z25A 5HRSA 1JXBA 3O4NA 1LW0A 3KD1E 4CEBA 2OA8A 1RDDA 1LAWA 3O3GA 4BDZA 4KPYA 4KHYA 3CFOA 4J2EA 1VSLA 3CFRA 4IDKA 4DSEA 3OYJA 4N41A 3IRXA 4E7IA 3QNNA 3DLBA 1N5YA 3DOKA 3MEGA 3SPZA 3SUPA 1A5XA 3KIOA 3VQ4A 4LY7A 1IG9A 1WSFA 4EZ9A 5KGWA 4HCCA 3HJFA 3TANA 4PUOA 4KTWA 2Q3SA 4GMJB 4I2PA 3DYAA 2XHBA 4IFVA 3NDKA 4DTMA 2QXFA 1KVAA 4H8KA 4FLYA 1N6QA 4FJ5A 2DTUA 3HP6A 4DQPA 3KTQA 2JGUA 3QEXA 3C6UA 3M8QA 1NK0A 1BIUA 1HQUA 5J2PA 4W5TA 4EP5A 2P51A 4HUFA 2ZQBA 1RTDA 1NK4A 4BDYA 3AVCA 4M3ZA 4O44A 4CGFA 1K6YA 4M45A 4CE9A 3M8PA 1BHLA 4CGIA 4CJSA 4FJ7A 4CJVA 4BDPA 3AVFA 3PX0A 3VQDA 3SNNA 2W42A 1RTHA 4FM2A 4FLVA 4DSIA 4CGJA 4DFJA 2G8KA 3T19A 3VQ5A 4Z4CA 4B08A 1C1AA 1L3SA 1QSYA 4CHYA 3SZ2A 3VQCA 4W5QA 1UA0A 1TKTA 3AVBA 3C6TA 4CGGA 1NK7A 1Q9XA 2YNGA 3MEEA 4O55A 3MXIA 1DLOA 2JLEA 3SI6A 2BANA 3MAQA 3MXMA 1R0AA 4CERA 3PX6A 3I0SA 4CESA 1GOBA 4E7HA 4OKJA 1SL0A 1IKVA 3RMAA 4HVJA 4E7KA 1YTAA 4KREA 3AVHA 3NF7A 3EY1A 4W5RA 3K57A 3VQBA 1TK0A 4OKKA 4M41A 4DLEA 3ZSVA 1T03A 2E6MA 2XY5A 3NGYA 4HUEA 1S1TA 1U45A 1FK9A 4DU1A 1RT3A 5J2QA 2Z1HA 3HVRA 1T8EA 1I39A 2YHBA 4CEZA 2OPRA 3SJJA 1EX4A 1HRHA 1WSHA 3AA4A 3IG1A 3WNFA 3LANA 4CHOA 3RMBA 4FJLA 3OJSA 4KI6A 4I9QA 4AHSA 4RW7A 3ZSQA 1VSJA 2YNIA
chains in the Genus database with same CATH superfamily
3TTFA 3ZCMA 3KD5E 4E1MA 2HHWA 2NRHA 4AHUA 2YHWA 3OYLA 3LZJA 1WBBA 1U6ZA 2VG7A 5C15A 2G8FA 1LWEA 2YI1A 3LM2A 5M1NA 5HROA 2X78A 4RW8A 3H3NO 1X9MA 5AZIB 4CJKA 4FSVA 1TL3A 1JCEA 1Z26A 4UQGA 1SKSA 4CJ4A 3ZSZA 2IVPA 2RF2A 4GKJK 3U4LA 4MQ3A 3G4SN 3OW2M 2PBDA 4M3XA 1VHXA 4B1WB 2WBNA 4PL8A 1WOQA 2P9NA 1XMOK 2GUPA 2XY6A 3THWB 5FPMA 3E66A 3T69A 4CIEA 3K5OA 5BRFA 3O9TA 3KWGA 1WSIA 2NZTA 4G1QA 5BN9A 1H1VA 3CMEN 1S22A 3WQTA 4FJKA 1YAGA 3CQYA 4CHNA 2HBLA 3WUHA 4JS5A 3M8RA 3THVA 1RNHA 5LY3A 4WYBA 3P83D 3ZT3A 3SQ4A 3TSQA 5F2RA 3VMFB 1JLQA 2GELA 4JD2B 3CM5A 3DOLA 2BGGA 2V51B 2UU9K 2JWKA 3J7YP 1QQNA 2ZGZA 3HOSA 5J2MA 1YITN 5JS2A 4FZXC 4CEDA 4FWSA 1BI4A 2CGLA 1RBUA 3OVNA 1MU2A 5LJWA 4RTFD 4CJ3A 5FROA 4FLXA 3DMJA 4DTPA 4CD3A 4IOAL 2X74A 1RT7A 2R7YA 3PO5A 4FJIA 3QIPA 1V4SA 4BRDA 5E84A 5AQIA 2QWOA 2XRIA 3LM9A 4FJNA 3OS0A 4DFPA 1N36K 2QEXN 3K2PA 4E7JA 3DLHA 4B9UA 1L5UA 1KC8O 5M1QA 1QE1A 1WN7A 3OBWA 4CI6A 4CZIA 3GBTA 3O9UA 1GLEG 4LFAK 4Z4HA 2P9SA 4CJEA 4QCLA 4DKWA 4M3TA 3O1WA 1EETA 2E2PA 2YKNA 5C0YA 2VYPA 2HHUA 4FWRA 4YOXA 1D5AA 3GOIA 1NU0A 5E26A 3MECA 4A59A 4CBWA 1BISA 4BWMA 1P90A 1QSLA 1JLEA 5AQSA 1SKWA 2O8FA 4W5OA 3SV3A 4DQRA 3T1HK 1NKCA 3RVCA 4BE1A 4DLGA 1SUQA 3QEIA 1JL1A 1NMDA 1SZ2A 1SAZA 4PKGA 4E7LA 3LZIA 1C0MA 2HBKA 2KHOA 2P9PB 1NGFA 5HL7L 3HO1A 3AY9A 4GV9A 3OS1A 1RDAA 3I8DA 1JCGA 3VQQA 3TAPA 1BU6O 2I7PA 5AQKA 3CCQN 4HHTA 1IKYA 2YHXA 5FRMA 4I2QA 5AFUA 3CCRN 3DRSA 4IG0A 3UIQA 1X9SA 3R6MA 1SQKA 3ZT0A 5LMUK 1BL3A 1NKBA 4MFBA 2FSNA 3ALYA 1HJRA 5KPRA 3V9ZA 3NF8A 4MDAA 3S9HA 4FWMA 4BQLA 3S3NA 1X9WA 2A3ZA 4X66K 4DTXA 4FJ8A 1BWFO 4CEOA 4B9QA 1WAJA 1IG8A 2BTFA 3KLIA 1JL2A 4QS8A 1UOCA 4R79A 1LV5A 4WQ4A 2D0AA 3PO4A 3P5JA 3NVMA 5CZ2A 3E9PA 4CJUA 1NJWA 3DLRA 3O4QA 1HYSA 1WUAA 2P9LA 1KQSM 3RR7A 1ZBSA 1T05A 3WQUA 5KRSA 1GLDG 1YUWA 1VK0A 2D4WA 3SPYA 2NRVA 4OGCA 1NOYA 4M42A 4B3OA 4CZHA 3D2FB 4BG8A 4DSFA 2ZWHA 2KFZA 4BRNA 2E5LK 1FKOA 4JI4K 4ISEA 4JI3K 5EU7A 2YKMA 4LF4K 3NH1A 1RT2A 2E4LA 4RWTA 4BRPA 2A1RA 1SL1A 2P5GA 2UYTA 4NYFA 1XWLA 3ASMA 3IUCA 1RFQA 4AF1A 4AHCA 1KLNA 3KWIA 1J5EK 3D7EO 3WEEA 4V19S 4Y1CA 4CHZA 4E89A 4LF6K 5AQTA 4FLWA 1S9GA 4LSNA 1ATNA 5AQWA 1S1XA 4B9VA 4LH5A 2F7TA 3VOVA 3L3UA 3K9JA 4LF8K 2Z1GA 3EE9A 1I94K 1EWQA 3IMXA 3ZX0A 1J6ZA 4RG8A 1ZBHA 2YCHA 1XNRK 3LL3A 1NGCA 1KLMA 4DTNA 3NCIA 3FZKA 3VA3A 3U9ZA 2KKZA 3L8BA 3SYZA 2F8TA 4JAXA 2O8BA 4JN4A 3EO3A 5E41A 3UKRB 4AQYK 4FZYA 3MWPA 3QESA 3J7AP 2O4GA 5GAEP 1VSEA 1YVUA 2IOCA 1CZBA 2RHKA 2NRRA 3A5OC 3DLEA 4Z4FA 1WSJA 3PLAA 3AO1A 2Q36A 3AVNA 3QIOA 2PZSA 2IDOA 2QWNA 4J2DA 3IFRA 4MLEA 4JKHA 2KW4A 1KTQA 1QZ5A 4FO0A 2A6AA 3L4QA 4QS9A 2NLXA 3HT3A 2FSJA 4BR5A 3H45C 4BE0A 1IBKK 3M6GA 2P9IA 5LMNK 4L8RB 4ZTJA 1NK6A 3T3FA 3MN7A 4YOVA 2G8HA 1RDWX 5A2QO 4J2AA 3LAMA 3LDNA 4B3TK 3E1YA 2Q0RA 1V4TA 3AA5X 3AVJA 4ID1A 3PUFA 2HF3A 4O8UA 1HNIA 3QNOA 1TVRA 4A5AA 3HYFA 2HB5A 3P38A 3G71N 4B8AB 1HUXA 4KH6A 3C6AA 1XMQK 4FZZA 4DR3K 5DM6L 5GIOA 1C1CA 2ZJQL 1NJYA 5AZJA 4JI5K 3U3GA 1YXQA 3S41A 4H0PA 3KD1E 1LW0A 4CEBA 4KHYA 3HI0A 5IT9O 4J2EA 3CFRA 3QNNA 3R8EA 2UXDK 2VQEK 2IVOA 3SUPA 1Q86O 1WSFA 2Q0UA 5KGWA 2FF3B 2AA4A 3EEQA 3A5NC 2CGJA 2QXFA 1KVAA 3IKMA 1OH8A 4BY9C 2JGUA 5J2PA 3CQXA 4HUFA 1RTDA 2QA4N 3SBTA 1ATSA 4M3ZA 4CBXA 1K6YA 4M45A 4CE9A 4FJ7A 4BDPA 4EHTA 2W42A 3CETA 5JLFA 4DSIA 4Z4CA 4B08A 2WTUA 5C12A 2W40A 3E9OA 3CXCM 1BA0A 4MO5A 3A0IX 4FWKA 4O55A 5M1OA 5KPTA 2BANA 3MXMA 4CERA 3PX6A 1GOBA 4H5NA 3FZLA 4BRCA 4BRQA 3RMAA 4KREA 3DXMA 3HM8A 3EY1A 1TK0A 2QWLA 4M41A 3CC4N 4DLEA 1T03A 4H5VA 2E6MA 4HUEA 5HOOA 1FK9A 3GG4A 2Z1HA 3HVRA 1T8EA 2YHBA 1WSHA 4FJLA 3OJSA 2W41A 1TL1A 2VG6A 4BRFA 3TAQA 2D0PA 3HZ6A 1OVYA 1C0FA 3SJHA 1LCUA 1NJIO 4X65K 4IZ9A 1GLBG 4Q5VA 1BO5O 5TKYA 5HBMA 2E20A 2HVIA 1IKXA 2D1KA 2EWSA 3QINA 4ILJA 1RT1A 3ENBA 4DF4A 3CCLN 3HPGA 1VQ4N 2DFEA 3KVGA 4K43A 4RW4A 3RSEA 4BC5A 3WNEA 1BA1A 1VSKA 1J5OA 2ZE2A 4C8NA 1IG9A 3J8AA 4CFDA 4BREA 2IC3A 3ZSXA 3CJAA 5JMVA 3A8YA 4H0XB 4YDUA 3D0PA 2O8CA 3VF2A 2NRTA 1VSDA 3L2WA 4YFUA 2HHTA 3THYA 3GDQA 2HHVA 3C94A 3BGRA 3VQPA 4H4MA 3ZLJA 2HF4A 1BGXT 3DWLA 4KHSA 2HNDA 5HRPA 2ASMA 4N76A 3S3OA 1W2BM 1BCOA 1NK9A 2E2QA 3NF9A 2E2OA 4W5NA 4KFBA 4Z0UA 3A2FA 2ASPA 4IXCA 4MLHA 1GLJO 3RMDA 1DTQA 4PY5A 2P1JA 1C6VA 2HMPA 3MXJA 4BR9A 4X62K 1ILYA 2GV9A 2D0CA 3JSMA 4CIFA 1QHTA 4F9OA 4U7BA 1K8KB 2KFNA 3V81A 4FWQA 3FFIA 3HP9A 1NJZA 1SKRA 4DR1K 3VEZA 5JLHA 1XHXA 1YJNN 3DI6A 2OYQA 1TGOA 3M5RA 4JI8K 1L3UA 2GWJA 3OYGA 2P9NB 1LW2A 2P9UA 2DY4A 4DU3A 3J7ZO 3HBTA 3R1XA 1M1KO 3SAGA 2ZD1A 4B9SA 3B6PA 5SZTA 1HKCA 4FL9A 1Q9YA 4DWIA 4XH1A 1HYVA 4CF9A 3CFPA 3ZSYA 2ZJPL 4FVMA 3OYBA 1T6DA 4CGHA 4KHWA 4K8XA 2HW3A 2FBTA 2QI2A 5EY4A 1JLCA 2HNYA 3VETA 1BOTO 5F1XA 3L6QA 2UUCK 4Y1DA 4JKDA 3F9MA 3LPTA 3OYHA 3C65A 1EXQA 3KK7A 3O9QA 1BI4B 3KJVA 3ID6A 1Y64A 4Q0BA 2UXBK 1KXPA 4CJFA 5BPMA 4CECA 1U4BA 1HQEA 5DK5A 4YY3K 4OPKA 3L2QA 4DSLA 4XH4A 1NK5A 5AQUA 1C0UA 2X6NA 1IO2A 2H3GX 4I7FA 3HPHA 4A61A 1L3TA 4N56A 4LSLA 4JI2K 2GBZA 1MWMA 3AGKA 1KFDA 1YHQN 4JS4A 1BDGA 4BR2A 5EOYA 2GUIA 4CF1A 2YNFA 3LP1A 5AQGA 2YV0X 2P9SB 4FJGA 5LL6Z 3VTIA 1TK8A 1VQPN 3VEWA 3L2RA 2B4JA 2ASOA 4CZGA 5FPNA 4A5BA 1VQ9N 1QQMA 4KRFA 3UKUA 2F4VK 3BDPA 1RBSA 3I33A 1NLVA 2O8DA 1EO1A 1X1PA 2O8FB 5AQXA 4CEQA 2E2NA 3VGLA 4KTQA 1YVNA 3RRGA 5KRTA 1I3AA 1XNQK 4O8KA 2XY8A 4DR5K 5BRHA 4JI0K 1VAZA 1DKGD 3S3MA 1ZBUA 3A5LC 3KK2A 4PHTX 5AR0A 2G8VA 1NBWA 3NE6A 3DJCA 4F2RA 3AO4A 1X9JA 1ZBFA 4BQZA 3FZMA 2G8IA 4XIUA 1U04A 4CHQA 1XI1A 1RT5A 2HBMA 5KI6A 4DG1A 4YHHK 4CZLA 3HSTB 3T7ZA 2VWKA 4FW1A 3SQ2A 3VA0A 4DV2K 3TI0A 4BE2A 3DM2A 1RT6A 5FRNA 3RTVA 5AFUH 3TABA 4CFCA 1BQNA 5MLCQ 5D3GA 4B1UB 3KKRA 1RDUA 1JLAA 3OYIA 2G8UA 3L2UA 1HPZA 4DSJA 1JLBA 1P8ZA 4H0YB 3LDLA 3K0SA 3SK3A 1SS6A 5JVHL 4LF9K 2KLAA 2P9LB 3G6EN 4FK0A 1RDCA 3D6RA 4CFAA 1S5JA 4EP4A 3O3HA 1WB9A 4NLCA 1MA9B 5AZIA 3FFKB 3QFPA 4LF7K 1RTIA 5EXWA 3C7NA 1ZBLA 1W7AA 3AVGA 2W6KA 4YOUA 3AA3A 4TSXA 3V9XA 3BZCA 3RMCA 3RWUA 3BF1A 3K58A 2YJFA 4KHNA 2QWRA 3KLEA 3CF5L 3O4WA 4M7XA 3CHWA 4FXDA 1EKEA 4AM7A 2OPQA 3F5TA 4M3RA 1ESVA 4HTUA 1BQMA 2Q1NA 5GADP 3N4PA 3AVAA 3WEEB 4CFBA 3TARA 1C1BA 3NF6A 2HHXA 4CCHA 3HXMA 2OPSA 3A5MC 3CMAN 4J8FA 1TKXA 4BR0A 3QMLA 4H5TA 5CE3A 4JKEA 3V9SA 1GLAG 4JRPA 3SBGA 3DLLL 1HLUA 3ULDA 4KB0A 2EX3A 3LAKA 5KGXA 2X6SA 4RCHA 3F9KA 3EE8A 1FKPA 3ULEA 1NNEA 4CD1A 1GOCA 1E4FT 3I0RA 2O8BB 1BIZA 2UUAK 2QWPA 2B6AA 4KHUA 1HJOA 1HNVA 4R5PA 5M1FA 4BACA 4B3RK 3CYMA 2A41A 5I42A 1XC3A 3L3VA 4ISFA 4M3UA 3CCSN 2BUPA 1S72N 4E19A 1YIJN 1NGIA 5CYQA 4FYDA 1ZYQA 3VN5A 4DU4A 4ILHA 4FLUA 4CJPA 4GVEA 4DFMA 3CQ8A 1EP4A 3D2EB 1U2VA 1KFSA 3ATUA 1J9AA 4B1VA 4NCAA 1KAXA 5B8HA 1X3MA 5HRSA 1JXBA 2RE2A 2P9KA 2OA8A 4KPYA 1LAWA 3O3GA 4LFBK 1HNZK 3CFOA 2QWQA 4EAHD 4DSEA 4N41A 1N5YA 3DOKA 2P9IB 1N8RO 3KIOA 3VQ4A 4EZ9A 4HCCA 4GMJB 4I2PA 3DYAA 4A2AA 4IFVA 3NDKA 3HTVA 4DQPA 1EQYA 5GINA 1NK0A 1BIUA 1HQUA 4BG9A 1S3XA 2P51A 2VGNA 2ZQBA 4BDYA 4CGFA 2FSKA 3WT0A 1YF5L 4CJVA 3MWTA 4CW7B 1Q81O 4CZMA 1QSYA 4CHYA 3ZETA 3CD6N 3SZ2A 1NK7A 3AVBA 3C6TA 4BGAA 5M1KA 3MXIA 4L3QA 5KQ8A 3SI6A 4DV4K 4BRIA 3I0SA 4CESA 5AQOA 3HRGA 4E7HA 1SL0A 2A5XA 3GE1A 3VENA 3ENHA 4DV5K 4H5RA 3AVHA 4OPHA 3R9PA 3NF7A 3LDPA 1HNWK 5IWAK 4CZKA 3ZSVA 2XY5A 1U45A 3TPQA 2ITMA 4DU1A 1I39A 3CCMN 1Q82O 1HRHA 3IG1A 3ZSQA 1VRTA 3D45A 4BRHA 2BDPA 2HSTA 2WUSA 3T1AA 3ITHA 2FC0A 1VSIA 1C0TA 3OA9A 4KKOA 4CIGA 1ASUA 3O5BA 2Z1IA 3AAQA 4DQIA 3LPUA 1VSHA 3AAPA 1U48A 1VQ8N 3MK6A 3OY9A 4BWJA 3SLCA 2QXLA 1YT3A 3IDHA 3THXA 4NXNK 2A42A 3O1BA 3MN5A 3HM9A 1S6QA 3VF6A 1QVFM 4Z4IA 2CH5A 4H4OA 1NK8A 2WOMA 4ILGB 5T7BA 2ZM6K 5F0XA 3DXMB 3TTDA 1VQKN 4PA1A 3G10A 3KLHA 3DAWA 3WNGA 3AVIA 3OBYA 2CH6A 3OYKA 2IGIA 4MO4A 4FJHA 4KTZA 3TAEA 1JJ2M 3G0ZA 4Y0WA 3IS9A 3CIPA 4AHVA 3OYEA 4N5SA 3QETA 4H0OA 1ZXOA 3HK2A 2HBJA 4IWVA 1GLLO 2Q97A 3VQAA 4PKIA 3FLCO 4IO8A 5AQQA 4FW2A 2NRZA 1N34K 2QK9A 4B3SK 1TUUA 4BC2A 4CVNE 3RR8A 4DTSA 2VWJA 4O4GA 1QTMA 5DM7L 2DPNA 4KB1A 4DTJA 3NHGA 1A5WA 4FLZA 5AQJA 3B8AX 1GLCG 2VG5A 2EHGA 5J1EA 2PY5A 3HL8A 4OGEA 3PSIA 1NJXA 4JRQA 2O8EA 3THYB 2AJQA 4JNEA 4YNQA 2ZGYA 3LP0A 2RPIA 4M3WA 4DV3K 1Z6RA 3GL1A 2FXUA 4KO0A 4KHQA 5K14A 4J2BA 3U3YA 1BUPA 3CJBA 1J53A 3B6OA 1Y97A 2BH1A 4CK3A 3HVTA 4Z4EA 3AO5A 1VQLN 3MN9A 1GLFO 4ZHRA 3WNHA 3JAMO 2KZZA 3VF4A 3LWLA 3ZT2A 2FF6A 5CHIA 4OVLA 5FPDA 4KAZA 1OH5A 3V1QA 1JXEA 3EN9A 2CGKA 4IG3A 3DLGA 3MX2A 1TYQA 5AJ3K 4OO1J 1O13A 1RBVA 4K41A 4WQ5C 1ASWA 3NAEA 2YNHA 2IAJA 3WXJA 3ZX3A 4DTOA 1DEJA 1D9DA 2IIRA 2I7NA 4GV3A 1XQSC 4H03B 3OJUA 1CXUA 1FJGK 3LDSA 1S1WA 3WXMB 5BPLA 5KPZA 3PIOL 5GAHP 4E1NA 4DQSA 2P9UB 4QAGA 4KI4A 4BVPA 3MMVA 3QFUA 4DCHA 4FM0A 5AQHA 3H6EA 4DMNA 2OTLN 1T3VA 1HYZA 1RDBA 5JS1A 5C25A 4JV5K 1KAYA 3AA2A 4WQ4C 4DS4A 3KK1A 5KTQA 1K8AO 1RTJA 3H1VX 3NBPA 3QEVA 4FWNA 5GAGP 2BE2A 5C2DA 3E01A 2FBVA 1QS4A 4DB3A 4DTRA 2Y1JA 3SQ1A 3AO3A 4JK7A 2G8WA 4C8OA 4FJMA 3SUNA 1IBMK 4BRLA 2AP1A 4DF8A 3LDQA 1NMNA 4CK1A 3FE1A 2QWMA 3NFAA 4CEAA 1Q7YO 3V9WA 3K59A 1Z05A 5KQDA 4BR7A 1K9MO 4K42A 4F4KA 4WF9L 1WLJA 1YI2N 1VSMA 4AILC 4NCGA 1CZAN 1DTTA 1UWBA 4JKFA 1QSSA 1BCMA 3VQ6A 5AQRA 3ISNC 4GKKK 1VRUA 2YHAA 3VESA 1OH7A 5I3UA 3L4IA 2KQ2A 3ZT4A 5JVGL 3SUQA 1VQON 2NNWA 4ICLA 3ID8A 1CZ9A 3UKUB 3AGRA 4IFEA 1HNXK 1JKHA 5AQVA 2GX9A 3OYDA 1B9FA 2YHYA 3HPOA 2RKIA 1CLQA 3TR8A 4BRMA 1KCFA 3CI5A 2A40A 1ATRA 1KD1O 3KLFA 1J54A 1RT4A 3C6HA 3O3FA 2XO7A 1WSEA 4DUYK 1A5VA 4I6MA 3L0QA 3TSPA 4CJLA 3LWMA 3ZSWA 4CF2A 5BPNA 4CZJA 5GIPA 4CJWA 4FWPA 4HWIA 4H0TB 5SWMA 5ELZA 4O5FA 4KH4A 3ZEUA 4WCEL 1W9HA 4IJAA 1FXXA 1S6PA 2PFUA 1RILA 4JKGA 4CF8A 3OTOK 4B9NA 5LJVA 4Z4GA 3P4IA 1KVCA 2XY7A 1RBRA 4B9TA 1JLGA 1S1UA 3JS6A 3O9RA 3CPEA 1G99A 4C23A 4C1NI 1JLFA 1RGIA 1ITGA 4CZFA 3EKUA 3OHRA 5DMRA 3P1GA 3SMPA 4JHDA 3OS2A 2E1ZA 3TAFA 1DT9A 2HHSA 1NOZA 1VSFA 4A2BA 4PL7A 3H08A 5AQYA 1HKBA 3NGIA 1K8KA 3C7NB 1LAVA 5CR4A 3VERA 4CHPA 3PY8A 2PYJA 4OPJA 4B9MA 3DXKA 3W3DA 3DRPA 5C2FA 5CYMA 1NGBA 2VWBA 1QHAA 1S9EA 1UA1A 2F9TA 4FVUA 3G25A 2Q31A 4FCYA 3O08A 4N47A 5FPEA 4AHTA 3QBXA 3DRRA 5I9EB 3LALA 2E1YA 3CCEN 4CJQA 2QKBA 4B9LA 3VQ9A 2OANA 1EWRA 3V6DA 2OZSA 4DHYA 4NYNA 1NKEA 3CJCA 4FPBA 4WFNL 1TK5A 1K73O 4ELVA 5ADXH 4A57A 1L3VA 3RRHA 4DV1K 3TAGA 2LSNA 4M7YA 1RCHA 3SMSA 1Z25A 1YJWN 3O4NA 1RDDA 4DR6K 3M3ZA 3BF3A 4IDKA 4YOYA 4E7IA 4LFCK 3SPZA 1A5XA 3HJFA 4PUOA 4KTWA 2Q3SA 3ULEB 3VGKA 4H8KA 1D4XA 3WXLA 3HP6A 3KTQA 3M8QA 1FW6A 3SAFA 4EP5A 1NK4A 2ZJRL 4YOWA 4CZEA 4E1JA 3UE5A 4CJSA 3M8PA 3BP8A 3AVFA 3PX0A 3VQDA 4FLVA 2W6LA 1NWKA 2G8KA 3T19A 2NRXA 2GEMA 3VQCA 4B3MK 4JKAA 4W5QA 4B1YB 1UA0A 4CGGA 3WXIA 2YNGA 1NM1A 3MEEA 3CPWM 2JLEA 1U2VB 3MAQA 1R0AA 2VCPA 4YORA 5BREA 1IKVA 2P9KB 3F2KA 4YDUC 5AQFA 4W5RA 3VQBA 3VPZA 4OKKA 3K57A 3KHYA 3CERA 3E9LA 3NGYA 1S1TA 1RT3A 5J2QA 5ADXA 2V7YA 1IBLK 3SJJA 3WNFA 3AA4A 1NGJA 3LANA 4H0VB 3THWA 1E3MA 4AHSA 1VSJA 3U6FA 4RW9A 1E4GT 3M8SA 4CF0A 5AQPA 4RW6A 4OKEA 4IJNA 4F3OA 1DGKN 4DV7K 4F2SA 4CJTA 1KRPA 2VQFK 3QO9A 3MDQA 1S1VA 3EL2A 3ZETB 4XH5A 5M1PA 4KBOA 1HKGA 3HSCA 4IO9L 4JD2A 3CJ7A 4DV6K 1B9DA 1QZ6A 1Q18A 2HMIA 2PAVA 4DFKA 2NUBA 4ELTA 3PSFA 2WFBA 4I9LA 4C8MA 5AQNA 4WQ5A 1U47A 4DQ8A 3ZYYX 4CEEA 3C0BA 1NGEA 1OKJA 4YOTA 1GOAA 5BR9A 3I8BA 4HCBA 3VQEA 3AO2A 4DS5A 3KKSA 4KH5A 4NCBA 2ATQA 5FLXO 1ZC6A 3AARA 3FR0A 3QBWA 4BC4A 1TV6A 3KZBA 3QEPA 4IOCL 4OLBA 4JKCA 2HHQA 1NG9A 2QKKA 1VQMN 4C8LA 3BY5A 2A1SA 3THXB 2KTQA 5J2NA 4FK4A 4DUZK 3K5NA 3V9UA 3QERA 4JKBA 3R3LA 4WE1A 3QLHA 3SQ0A 4HTLA 4EHUA 2ITGA 4C8KA 3C95A 1IV0A 2OCEA 4OLAA 3VEOA 1OVQA 4FOIA 1D9FA 2RN2A 4C1NK 4HUGA 4X64K 4F8RA 3AVLA 4XEIA 2DFFA 4LF5K 1X3NA 3I55N 1M90O 4K0KK 2P9PA 4IDHA 2V7ZA 4FJXA 1VQNN 3DLKA 1G15A 2D0OA 4CJ5A 1D8YA 4WFAL 3SUOA 3I56N 3L2VA 2I5JA 5JICA 5TKWA 1B92A 1REVA 4U67L 3BZKA 5AZJB 3K9KA 4GY2B 1KSPA 2O4IA 1O1WA 4DTUA 4ZTFA 1QVGM 2JWLA 4CK2A 4A62A 4AH9A 1CXQA 3ZT1A 2HHHK 3OYFA 4GNIA 4K8ZA 2WC9A 2O8EB 4IOXA 3MCAB 2HNZA 5AQLA 4GVMA 3LDOA 4DQQA 3PV8A 3U8XA 1Q8IA 4B8CA 3VGMA 3QEWA 3SV4A 3W0LA 4FWLA 4EFHA 5H1SQ 2Y1IA 1WSGA 1XUPO 4K25A 3H46O 1LWFA 3MCPA 4IKFA 1LWCA 3AVKA 3VEYA 1TKZA 5C42A 1T44A 1N32K 4UY8O 3D2EA 5CZ1A 3D2FA 1WBDA 1C0GA 1SV5A 3OYMA 4BROA 1ASVA 1KAZA 1TYQB 2OZMA 3LP3A 1TAQA 3JYTA 2FBYA 3CG7A 4CJRA 1NGDA 1QQOA 3TAMA 4M3YA 3ENOA 1NGAA 3Q7CA 5HP1A 3K5LA 1KVBA 1WNSA 1T7PA 2V52B 1T6CA 2B5JA 3EKSA 3AV9A 5HRNA 2IS3A 4CBUA 3H1QA 3VEXA 3EZWA 3PX4A 3VEVA 2FBXA 1MWKA 3CJ1A 3EZ5A 1NGHA 2D0BA 3Q7BA 3O9SA 2IVNA 3CJ9A 3RSEB 4LH4A 3CCVN 1YJ9N 3FZFA 3TSUA 1TUYA 4FM1A 3WXKA 5C24A 2O8CB 1YTUA 4G9ZA 4IEIA 4BRAA 5FDLA 2HOEA 3NH2A 3U9DA 1VQ6N 1IKWA 4QS7A 2P5OA 5HRRA 2F96A 1NGGA 3IAYA 1W0HA 5EX5A 5BRDA 3V4IA 3LP2A 3UKRA 4JI7K 1N33K 4ID5A 5CY4A 4JI1K 2Z1JA 3CCUN 1RBTA 3VQ7A 3ZSOA 4FK2A 4CJ7A 3SAHA 2OPPA 1XC9A 4NLBA 3QDKA 3V1RA 4BR4A 2PYLA 4NO7A 4O0IA 3KLGA 2D5RA 4OPAA 4GW6A 4DSKA 1ZBIA 3O6WA 3NGZA 2GTDA 4JYAK 3CC2N 3ZSRA 1HR0K 4EZ6A 2NRWA 2UUBK 1IH7A 1TKDA 1TAUA 3ZX2A 1VQ5N 3O80A 4ELUA 4LD0A 3QB0A 3K5MA 4KV8A 4BGBA 5BR8K 3SCXA 5BN8A 2ETJA 4IBNA 4PQUA 4CEFA 2F8SA 5HLFA 3TTCA 4IEEA 2QW9A 2E6LA 1HMVA 3J81O 3CC7N 4NXMK 1U49A 2WONA 3OYAA 3KK3A 4BC3A 4AHRA 3QICA 1IJJA 3BEXA 4I6MB 4BRGA 3F73A 3OYCA 2OTJN 3EYZA 5C10A 4FJ9A 3MEDA 1OH6A 1SL2A 3VQ8A 4PWDA 3FGUA 3CM6A 5AQZA 4NB4A 4O5BA 3CCJN 3MX5A 4AM6A 2DFHA 3OYNA 3HOTA 2KZMA 4IFYA 3NH0A 3V1OA 4DR7K 4CGDA 4F3TA 3P39A 3ZEUB 2HVHA 3ATVA 1F21A 4JEPA 4E0DA 3NVKA 3O8MA 4OJRA 4E3SA 4JKGB 3MN6A 4JK9A 4LC9B 4JLHA 3AVMA 4FLTA 3T1YK 2J4RA 3P31A 1XHZA 4B1XB 3PIPL 4O0JA 3TWHA 2ZF5O 5EVZA 2Q2RA 4GV6A 1R59O 4EIAA 1QQCA 1WAFA 4QOZB 2FLOA 1HPMA 1VQ7N 4Z94A 4MDBA 4FJJA 2YX6A 1UAXA 3FZHA 3TU5A 1JCFA 2GWKA 1BG3A 4JHDB 4ISGA 4BDZA 1VSLA 3OYJA 3IRXA 3DLBA 3N4QA 2E88A 1MDUB 4DV0K 2QTDA 3MEGA 4DR4K 4LY7A 2O8DB 3TANA 4DTMA 2XHBA 3DXKB 1N6QA 4FLYA 4FJ5A 1W97L 5AQMA 3QEXA 3C6UA 4W5TA 4BVOA 3AVCA 4OX9K 4O44A 2DTUA 4FOEA 4CGIA 1BHLA 1HX1A 3SNNA 1RTHA 3UB5A 4FM2A 3JXUA 4CGJA 4DFJA 4WFBL 1L3SA 3VQ5A 4KHPK 1C1AA 1LOTB 2F9WA 4BRKA 4DR2K 1TKTA 1Q9XA 1DLOA 3VTHA 3J80O 4FWOA 4OKJA 4JK8A 2QM1A 4H5WA 4HVJA 4E7KA 1YTAA 2UXCK 3BUZB 2E8AA 3M1FA 4M63C 3NMUA 2VGMA 4CEZA 2YJEA 4PKHA 4FPAA 2OPRA 3H3OB 1EX4A 4CHOA 3RMBA 4B1ZA 4KI6A 4I9QA 4RW7A 2YNIA 4JI6K
chains in the Genus database with same CATH topology
1VRTA 3D45A 2BDPA 1TL1A 2VG6A 4RW9A 3T1AA 3U6FA 3TAQA 3ITHA 3M8SA 2FC0A 4CF0A 3ZCMA 3KD5E 4E1MA 1VSIA 1C0TA 4KKOA 4RW6A 4AHUA 4CIGA 2HHWA 1ASUA 2Z1IA 4OKEA 3OYLA 3LZJA 4DQIA 2VG7A 2G8FA 4Q5VA 4F3OA 1LWEA 5HBMA 3LPUA 1VSHA 4CJTA 4F2SA 1U48A 2HVIA 1IKXA 1KRPA 3QINA 1RT1A 4DF4A 5HROA 3QO9A 3OY9A 3HPGA 2X78A 1S1VA 4RW8A 4BWJA 1YT3A 1X9MA 2DFEA 4RW4A 4CJKA 3HM9A 1S6QA 3WNEA 1VSKA 1TL3A 1J5OA 4Z4IA 4H4OA 1NK8A 2ZE2A 1Z26A 4UQGA 4C8NA 1B9DA 4CJ4A 4CFDA 1SKSA 2IC3A 2WOMA 3ZSXA 3ZSZA 5T7BA 2RF2A 3D0PA 4DFKA 2HMIA 2NUBA 4ELTA 1VSDA 4MQ3A 3L2WA 4YFUA 4M3XA 2HHTA 4PA1A 3G10A 2HHVA 3C94A 3KLHA 4I9LA 4C8MA 3WNGA 3AVIA 3BGRA 3VQPA 4H4MA 1BGXT 1U47A 3OYKA 2IGIA 4FJHA 4CEEA 4KTZA 3TAEA 4KHSA 3G0ZA 2XY6A 3IS9A 4AHVA 2HNDA 5HRPA 3OYEA 1GOAA 4N5SA 3QETA 4HCBA 4N76A 3VQEA 3AO2A 4CIEA 3S3OA 3K5OA 4DS5A 3KKSA 3HK2A 4NCBA 2ATQA 1WSIA 3VQAA 1BCOA 4G1QA 1NK9A 3NF9A 4W5NA 4KFBA 4FJKA 4FW2A 2QK9A 1TV6A 4Z0UA 3QEPA 3A2FA 4OLBA 3RMDA 2HHQA 3RR8A 1DTQA 4CHNA 4PY5A 4DTSA 2P1JA 2VWJA 4O4GA 1QTMA 1C6VA 3MXJA 4JS5A 2QKKA 4KB1A 3M8RA 3THVA 4C8LA 4DTJA 1RNHA 2GV9A 3ZT3A 2A1SA 3P83D 3NHGA 2D0CA 1A5WA 3SQ4A 2KTQA 5J2NA 3JSMA 4FLZA 4FK4A 1JLQA 3K5NA 3V9UA 3QERA 3CM5A 3DOLA 2BGGA 4CIFA 1QHTA 2KFNA 2VG5A 5J2MA 3V81A 3FFIA 3QLHA 4WE1A 3HP9A 3SQ0A 1NJZA 5JS2A 1SKRA 4FZXC 2EHGA 5J1EA 4CEDA 2PY5A 3HL8A 2ITGA 4C8KA 3C95A 1BI4A 4OGEA 1NJXA 4JRQA 1RBUA 3OVNA 1MU2A 2AJQA 4OLAA 4CJ3A 4YNQA 5FROA 3LP0A 4FLXA 3DMJA 4DTPA 1XHXA 3DI6A 2RPIA 2OYQA 1TGOA 1D9FA 4M3WA 1L3UA 2X74A 1RT7A 2RN2A 4KO0A 2R7YA 4KHQA 3OYGA 1LW2A 5K14A 4HUGA 3PO5A 4J2BA 3U3YA 4DU3A 4F8RA 3AVLA 2DY4A 1J53A 2DFFA 3B6OA 3QIPA 4FJIA 1Y97A 2ZD1A 4B9SA 3B6PA 3HVTA 4CK3A 4FJXA 4Z4EA 3AO5A 5SZTA 2XRIA 3DLKA 4ZHRA 1G15A 4FJNA 3OS0A 4CJ5A 3WNHA 4DFPA 3K2PA 1Q9YA 1D8YA 4DWIA 4E7JA 3DLHA 2KZZA 1HYVA 3LWLA 3ZT2A 4CF9A 3SUOA 1L5UA 4B9UA 3CFPA 3L2VA 2I5JA 3ZSYA 1QE1A 1B92A 4FVMA 1REVA 4OVLA 1WN7A 3OYBA 4KAZA 4CGHA 4KHWA 4K8XA 2HW3A 2FBTA 1KSPA 2O4IA 1O1WA 4Z4HA 4DTUA 4ZTFA 4CJEA 4QCLA 3V1QA 1JLCA 1JXEA 2HNYA 4CK2A 4IG3A 3DLGA 4M3TA 1EETA 4AH9A 2YKNA 1CXQA 3ZT1A 4Y1DA 2HHUA 3OYFA 4K8ZA 1RBVA 3LPTA 1D5AA 3OYHA 1ASWA 3NAEA 2YNHA 1EXQA 3MECA 2IAJA 4DTOA 1BISA 1D9DA 1BI4B 4BWMA 1QSLA 1JLEA 3KJVA 1SKWA 4Q0BA 4W5OA 3SV3A 2HNZA 3OJUA 1CXUA 4GVMA 4DQRA 1NKCA 3LDSA 1S1WA 4BE1A 4CJFA 4DQQA 4CECA 1U4BA 1HQEA 5DK5A 1SUQA 4E1NA 4OPKA 3L2QA 4DLGA 4DQSA 3PV8A 3QEIA 4DSLA 1Q8IA 1JL1A 1C0UA 2X6NA 4QAGA 4B8CA 1NK5A 3QEWA 4KI4A 4E7LA 3LZIA 4FM0A 1IO2A 1C0MA 3SV4A 4I7FA 4DMNA 3HPHA 1L3TA 1HYZA 1RDBA 5JS1A 5C25A 2Y1IA 1WSGA 4N56A 4LSLA 3HO1A 3AA2A 4DS4A 2GBZA 1LWFA 3KK1A 5KTQA 3OS1A 1RDAA 3I8DA 1KFDA 1RTJA 4JS4A 4IKFA 3VQQA 2GUIA 4CF1A 1LWCA 3AVKA 3TAPA 3NBPA 1TKZA 2YNFA 4HHTA 5C42A 3QEVA 1IKYA 3LP1A 2YV0X 2BE2A 4I2QA 5FRMA 3DRSA 3E01A 4IG0A 2FBVA 5CZ1A 1TK8A 4FJGA 3UIQA 1QS4A 1X9SA 1SV5A 4DTRA 2Y1JA 3ZT0A 3OYMA 3SQ1A 3AO3A 2G8WA 4C8OA 1ASVA 4FJMA 2OZMA 1BL3A 3L2RA 3LP3A 1TAQA 4MFBA 3SUNA 1NKBA 2B4JA 3JYTA 3ALYA 4DF8A 1HJRA 2FBYA 3V9ZA 3NF8A 4KRFA 4CK1A 3CG7A 3S9HA 3BDPA 3NFAA 1RBSA 4CEAA 4CJRA 3V9WA 3S3NA 3K59A 1X9WA 1X1PA 3TAMA 4DTXA 4FJ8A 4CEQA 4M3YA 4CEOA 5HP1A 1WAJA 4KTQA 3K5LA 1KVBA 3RRGA 4F4KA 1WNSA 3KLIA 1WLJA 5KRTA 1JL2A 1T7PA 1I3AA 2B5JA 2XY8A 3AV9A 1UOCA 1VSMA 5HRNA 4AILC 1LV5A 4NCGA 1DTTA 2IS3A 1UWBA 3PX4A 2D0AA 2FBXA 3P5JA 5CZ2A 3S3MA 1QSSA 3PO4A 1BCMA 1ZBUA 4CJUA 3KK2A 1NJWA 3DLRA 3O4QA 3EZ5A 1HYSA 2D0BA 3RR7A 3VQ6A 2G8VA 1T05A 3NE6A 4F2RA 3AO4A 1ZBFA 3ISNC 1VRUA 4LH4A 5KRSA 2YHAA 2G8IA 1VK0A 4XIUA 1U04A 4FM1A 3SPYA 4OGCA 5C24A 4CHQA 1NOYA 1XI1A 4M42A 1YTUA 1RT5A 4B3OA 5I3UA 5FDLA 3NH2A 2KQ2A 3ZT4A 3SUQA 2KFZA 4DSFA 5KI6A 1FKOA 4DG1A 4ICLA 3HSTB 1IKWA 2VWKA 4FW1A 3SQ2A 2P5OA 3VA0A 5HRRA 2F96A 1CZ9A 5EU7A 1W0HA 3TI0A 3IAYA 4BE2A 2YKMA 3DM2A 3V4IA 1RT6A 3LP2A 3NH1A 5FRNA 1RT2A 3RTVA 2E4LA 1JKHA 3TABA 4CFCA 2A1RA 1BQNA 1SL1A 3OYDA 1B9FA 3HPOA 4ID5A 2P5GA 5D3GA 2RKIA 5CY4A 4NYFA 3KKRA 1XWLA 3ASMA 1JLAA 2Z1JA 3OYIA 3TR8A 4AHCA 2G8UA 1CLQA 1KLNA 3L2UA 1HPZA 1RBTA 4DSJA 3VQ7A 1KCFA 1JLBA 3ZSOA 4FK2A 4Y1CA 3KLFA 1J54A 1RT4A 2OPPA 4CHZA 4E89A 1XC9A 3O3FA 2XO7A 1WSEA 1A5VA 3V1RA 4FLWA 2PYLA 1S9GA 4LSNA 4O0IA 3KLGA 1S1XA 2D5RA 4CJLA 3LWMA 4B9VA 4LH5A 4FK0A 1RDCA 4GW6A 4DSKA 3ZSWA 1S5JA 3L3UA 4CFAA 4EP4A 4CF2A 3NGZA 3O3HA 1ZBIA 2Z1GA 3ZSRA 4EZ6A 4CJWA 4RG8A 1RTIA 1ZBHA 1IH7A 1TKDA 1TAUA 1ZBLA 5SWMA 3AVGA 1KLMA 4DTNA 4ELUA 3AA3A 4TSXA 3V9XA 4LD0A 3RMCA 3NCIA 1W9HA 3VA3A 1FXXA 3K5MA 4KV8A 3RWUA 3L8BA 1S6PA 3SYZA 2F8TA 3K58A 3SCXA 1RILA 5E41A 2ETJA 4IBNA 4KHNA 4CEFA 4PQUA 4CF8A 3KLEA 4B9NA 4Z4GA 5HLFA 2F8SA 4FXDA 4FZYA 1EKEA 2OPQA 3QESA 2E6LA 1KVCA 1HMVA 2O4GA 1VSEA 4M3RA 1YVUA 2XY7A 2IOCA 4HTUA 1CZBA 1RBRA 4B9TA 1BQMA 1JLGA 1U49A 2WONA 3OYAA 3AVAA 1S1UA 4CFBA 3TARA 3KK3A 3DLEA 4Z4FA 1C1BA 1WSJA 3AO1A 4AHRA 3AVNA 3NF6A 2HHXA 3QIOA 2PZSA 3HXMA 4CCHA 2IDOA 2OPSA 4J2DA 3F73A 1JLFA 3OYCA 1TKXA 3EYZA 1ITGA 4FJ9A 3MEDA 2KW4A 1SL2A 5DMRA 1KTQA 3P1GA 3VQ8A 3OS2A 3TAFA 3V9SA 4PWDA 3CM6A 4JRPA 4O5BA 3HT3A 2HHSA 1NOZA 1VSFA 2DFHA 4BE0A 3H08A 3OYNA 3ULDA 4KB0A 3NGIA 2KZMA 2EX3A 4IFYA 3LAKA 1LAVA 5KGXA 2X6SA 4ZTJA 1NK6A 4L8RB 3NH0A 3T3FA 3V1OA 3F9KA 4CHPA 3PY8A 2PYJA 4CGDA 1FKPA 2G8HA 4OPJA 4F3TA 4B9MA 3DRPA 2HVHA 4J2AA 5CYMA 3LAMA 1F21A 4E0DA 1GOCA 1S9EA 3I0RA 1UA1A 3AA5X 1BIZA 4OJRA 4E3SA 3AVJA 4KHUA 2B6AA 4ID1A 4FCYA 1HNVA 4JLHA 3PUFA 3AVMA 4R5PA 4BACA 4FLTA 3CYMA 4N47A 1HNIA 4AHTA 3QNOA 5I42A 3DRRA 1TVRA 1XHZA 3LALA 3L3VA 3HYFA 4M3UA 4CJQA 4O0JA 3TWHA 2QKBA 2HB5A 4B9LA 3VQ9A 4B8AB 4E19A 3V6DA 5CYQA 4FYDA 1QQCA 1WAFA 1ZYQA 2OZSA 4FZZA 4QOZB 3VN5A 4DU4A 4NYNA 4FLUA 1NKEA 4CJPA 1C1CA 1NJYA 4DFMA 3CQ8A 1TK5A 4ELVA 1EP4A 4FJJA 1KFSA 1L3VA 1UAXA 1J9AA 3RRHA 3TAGA 2LSNA 3U3GA 1RCHA 4NCAA 1Z25A 5HRSA 1JXBA 3O4NA 1LW0A 3KD1E 4CEBA 2OA8A 1RDDA 1LAWA 3O3GA 4BDZA 4KPYA 4KHYA 3CFOA 4J2EA 1VSLA 3CFRA 4IDKA 4DSEA 3OYJA 4N41A 3IRXA 4E7IA 3QNNA 3DLBA 1N5YA 3DOKA 3MEGA 3SPZA 3SUPA 1A5XA 3KIOA 3VQ4A 4LY7A 1IG9A 1WSFA 4EZ9A 5KGWA 4HCCA 3HJFA 3TANA 4PUOA 4KTWA 2Q3SA 4GMJB 4I2PA 3DYAA 2XHBA 4IFVA 3NDKA 4DTMA 2QXFA 1KVAA 4H8KA 4FLYA 1N6QA 4FJ5A 2DTUA 3HP6A 4DQPA 3KTQA 2JGUA 3QEXA 3C6UA 3M8QA 1NK0A 1BIUA 1HQUA 5J2PA 4W5TA 4EP5A 2P51A 4HUFA 2ZQBA 1RTDA 1NK4A 4BDYA 3AVCA 4M3ZA 4O44A 4CGFA 1K6YA 4M45A 4CE9A 3M8PA 1BHLA 4CGIA 4CJSA 4FJ7A 4CJVA 4BDPA 3AVFA 3PX0A 3VQDA 3SNNA 2W42A 1RTHA 4FM2A 4FLVA 4DSIA 4CGJA 4DFJA 2G8KA 3T19A 3VQ5A 4Z4CA 4B08A 1C1AA 1L3SA 1QSYA 4CHYA 3SZ2A 3VQCA 4W5QA 1UA0A 1TKTA 3AVBA 3C6TA 4CGGA 1NK7A 1Q9XA 2YNGA 3MEEA 4O55A 3MXIA 1DLOA 2JLEA 3SI6A 2BANA 3MAQA 3MXMA 1R0AA 4CERA 3PX6A 3I0SA 4CESA 1GOBA 4E7HA 4OKJA 1SL0A 1IKVA 3RMAA 4HVJA 4E7KA 1YTAA 4KREA 3AVHA 3NF7A 3EY1A 4W5RA 3K57A 3VQBA 1TK0A 4OKKA 4M41A 4DLEA 3ZSVA 1T03A 2E6MA 2XY5A 3NGYA 4HUEA 1S1TA 1U45A 1FK9A 4DU1A 1RT3A 5J2QA 2Z1HA 3HVRA 1T8EA 1I39A 2YHBA 4CEZA 2OPRA 3SJJA 1EX4A 1HRHA 1WSHA 3AA4A 3IG1A 3WNFA 3LANA 4CHOA 3RMBA 4FJLA 3OJSA 4KI6A 4I9QA 4AHSA 4RW7A 3ZSQA 1VSJA 2YNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRT A;  3D45 A;  2BDP A;  1TL1 A;  2VG6 A;  4RW9 A;  3T1A A;  3U6F A;  3TAQ A;  3ITH A;  3M8S A;  2FC0 A;  4CF0 A;  3ZCM A;  3KD5 E;  4E1M A;  1VSI A;  1C0T A;  4KKO A;  4RW6 A;  4AHU A;  4CIG A;  2HHW A;  1ASU A;  2Z1I A;  4OKE A;  3OYL A;  3LZJ A;  4DQI A;  2VG7 A;  2G8F A;  4Q5V A;  4F3O A;  1LWE A;  5HBM A;  3LPU A;  1VSH A;  4CJT A;  4F2S A;  1U48 A;  2HVI A;  1IKX A;  1KRP A;  3QIN A;  1RT1 A;  4DF4 A;  5HRO A;  3QO9 A;  3OY9 A;  3HPG A;  2X78 A;  1S1V A;  4RW8 A;  4BWJ A;  1YT3 A;  1X9M A;  2DFE A;  4RW4 A;  4CJK A;  3HM9 A;  1S6Q A;  3WNE A;  1VSK A;  1TL3 A;  1J5O A;  4Z4I A;  4H4O A;  1NK8 A;  2ZE2 A;  1Z26 A;  4UQG A;  4C8N A;  1B9D A;  4CJ4 A;  4CFD A;  1SKS A;  2IC3 A;  2WOM A;  3ZSX A;  3ZSZ A;  5T7B A;  2RF2 A;  3D0P A;  4DFK A;  2HMI A;  2NUB A;  4ELT A;  1VSD A;  4MQ3 A;  3L2W A;  4YFU A;  4M3X A;  2HHT A;  4PA1 A;  3G10 A;  2HHV A;  3C94 A;  3KLH A;  4I9L A;  4C8M A;  3WNG A;  3AVI A;  3BGR A;  3VQP A;  4H4M A;  1BGX T;  1U47 A;  3OYK A;  2IGI A;  4FJH A;  4CEE A;  4KTZ A;  3TAE A;  4KHS A;  3G0Z A;  2XY6 A;  3IS9 A;  4AHV A;  2HND A;  5HRP A;  3OYE A;  1GOA A;  4N5S A;  3QET A;  4HCB A;  4N76 A;  3VQE A;  3AO2 A;  4CIE A;  3S3O A;  3K5O A;  4DS5 A;  3KKS A;  3HK2 A;  4NCB A;  2ATQ A;  1WSI A;  3VQA A;  1BCO A;  4G1Q A;  1NK9 A;  3NF9 A;  4W5N A;  4KFB A;  4FJK A;  4FW2 A;  2QK9 A;  1TV6 A;  4Z0U A;  3QEP A;  3A2F A;  4OLB A;  3RMD A;  2HHQ A;  3RR8 A;  1DTQ A;  4CHN A;  4PY5 A;  4DTS A;  2P1J A;  2VWJ A;  4O4G A;  1QTM A;  1C6V A;  3MXJ A;  4JS5 A;  2QKK A;  4KB1 A;  3M8R A;  3THV A;  4C8L A;  4DTJ A;  1RNH A;  2GV9 A;  3ZT3 A;  2A1S A;  3P83 D;  3NHG A;  2D0C A;  1A5W A;  3SQ4 A;  2KTQ A;  5J2N A;  3JSM A;  4FLZ A;  4FK4 A;  1JLQ A;  3K5N A;  3V9U A;  3QER A;  3CM5 A;  3DOL A;  2BGG A;  4CIF A;  1QHT A;  2KFN A;  2VG5 A;  5J2M A;  3V81 A;  3FFI A;  3QLH A;  4WE1 A;  3HP9 A;  3SQ0 A;  1NJZ A;  5JS2 A;  1SKR A;  4FZX C;  2EHG A;  5J1E A;  4CED A;  2PY5 A;  3HL8 A;  2ITG A;  4C8K A;  3C95 A;  1BI4 A;  4OGE A;  1NJX A;  4JRQ A;  1RBU A;  3OVN A;  1MU2 A;  2AJQ A;  4OLA A;  4CJ3 A;  4YNQ A;  5FRO A;  3LP0 A;  4FLX A;  3DMJ A;  4DTP A;  1XHX A;  3DI6 A;  2RPI A;  2OYQ A;  1TGO A;  1D9F A;  4M3W A;  1L3U A;  2X74 A;  1RT7 A;  2RN2 A;  4KO0 A;  2R7Y A;  4KHQ A;  3OYG A;  1LW2 A;  5K14 A;  4HUG A;  3PO5 A;  4J2B A;  3U3Y A;  4DU3 A;  4F8R A;  3AVL A;  2DY4 A;  1J53 A;  2DFF A;  3B6O A;  3QIP A;  4FJI A;  1Y97 A;  2ZD1 A;  4B9S A;  3B6P A;  3HVT A;  4CK3 A;  4FJX A;  4Z4E A;  3AO5 A;  5SZT A;  2XRI A;  3DLK A;  4ZHR A;  1G15 A;  4FJN A;  3OS0 A;  4CJ5 A;  3WNH A;  4DFP A;  3K2P A;  1Q9Y A;  1D8Y A;  4DWI A;  4E7J A;  3DLH A;  2KZZ A;  1HYV A;  3LWL A;  3ZT2 A;  4CF9 A;  3SUO A;  1L5U A;  4B9U A;  3CFP A;  3L2V A;  2I5J A;  3ZSY A;  1QE1 A;  1B92 A;  4FVM A;  1REV A;  4OVL A;  1WN7 A;  3OYB A;  4KAZ A;  4CGH A;  4KHW A;  4K8X A;  2HW3 A;  2FBT A;  1KSP A;  2O4I A;  1O1W A;  4Z4H A;  4DTU A;  4ZTF A;  4CJE A;  4QCL A;  3V1Q A;  1JLC A;  1JXE A;  2HNY A;  4CK2 A;  4IG3 A;  3DLG A;  4M3T A;  1EET A;  4AH9 A;  2YKN A;  1CXQ A;  3ZT1 A;  4Y1D A;  2HHU A;  3OYF A;  4K8Z A;  1RBV A;  3LPT A;  1D5A A;  3OYH A;  1ASW A;  3NAE A;  2YNH A;  1EXQ A;  3MEC A;  2IAJ A;  4DTO A;  1BIS A;  1D9D A;  1BI4 B;  4BWM A;  1QSL A;  1JLE A;  3KJV A;  1SKW A;  4Q0B A;  4W5O A;  3SV3 A;  2HNZ A;  3OJU A;  1CXU A;  4GVM A;  4DQR A;  1NKC A;  3LDS A;  1S1W A;  4BE1 A;  4CJF A;  4DQQ A;  4CEC A;  1U4B A;  1HQE A;  5DK5 A;  1SUQ A;  4E1N A;  4OPK A;  3L2Q A;  4DLG A;  4DQS A;  3PV8 A;  3QEI A;  4DSL A;  1Q8I A;  1JL1 A;  1C0U A;  2X6N A;  4QAG A;  4B8C A;  1NK5 A;  3QEW A;  4KI4 A;  4E7L A;  3LZI A;  4FM0 A;  1IO2 A;  1C0M A;  3SV4 A;  4I7F A;  4DMN A;  3HPH A;  1L3T A;  1HYZ A;  1RDB A;  5JS1 A;  5C25 A;  2Y1I A;  1WSG A;  4N56 A;  4LSL A;  3HO1 A;  3AA2 A;  4DS4 A;  2GBZ A;  1LWF A;  3KK1 A;  5KTQ A;  3OS1 A;  1RDA A;  3I8D A;  1KFD A;  1RTJ A;  4JS4 A;  4IKF A;  3VQQ A;  2GUI A;  4CF1 A;  1LWC A;  3AVK A;  3TAP A;  3NBP A;  1TKZ A;  2YNF A;  4HHT A;  5C42 A;  3QEV A;  1IKY A;  3LP1 A;  2YV0 X;  2BE2 A;  4I2Q A;  5FRM A;  3DRS A;  3E01 A;  4IG0 A;  2FBV A;  5CZ1 A;  1TK8 A;  4FJG A;  3UIQ A;  1QS4 A;  1X9S A;  1SV5 A;  4DTR A;  2Y1J A;  3ZT0 A;  3OYM A;  3SQ1 A;  3AO3 A;  2G8W A;  4C8O A;  1ASV A;  4FJM A;  2OZM A;  1BL3 A;  3L2R A;  3LP3 A;  1TAQ A;  4MFB A;  3SUN A;  1NKB A;  2B4J A;  3JYT A;  3ALY A;  4DF8 A;  1HJR A;  2FBY A;  3V9Z A;  3NF8 A;  4KRF A;  4CK1 A;  3CG7 A;  3S9H A;  3BDP A;  3NFA A;  1RBS A;  4CEA A;  4CJR A;  3V9W A;  3S3N A;  3K59 A;  1X9W A;  1X1P A;  3TAM A;  4DTX A;  4FJ8 A;  4CEQ A;  4M3Y A;  4CEO A;  5HP1 A;  1WAJ A;  4KTQ A;  3K5L A;  1KVB A;  3RRG A;  4F4K A;  1WNS A;  3KLI A;  1WLJ A;  5KRT A;  1JL2 A;  1T7P A;  1I3A A;  2B5J A;  2XY8 A;  3AV9 A;  1UOC A;  1VSM A;  5HRN A;  4AIL C;  1LV5 A;  4NCG A;  1DTT A;  2IS3 A;  1UWB A;  3PX4 A;  2D0A A;  2FBX A;  3P5J A;  5CZ2 A;  3S3M A;  1QSS A;  3PO4 A;  1BCM A;  1ZBU A;  4CJU A;  3KK2 A;  1NJW A;  3DLR A;  3O4Q A;  3EZ5 A;  1HYS A;  2D0B A;  3RR7 A;  3VQ6 A;  2G8V A;  1T05 A;  3NE6 A;  4F2R A;  3AO4 A;  1ZBF A;  3ISN C;  1VRU A;  4LH4 A;  5KRS A;  2YHA A;  2G8I A;  1VK0 A;  4XIU A;  1U04 A;  4FM1 A;  3SPY A;  4OGC A;  5C24 A;  4CHQ A;  1NOY A;  1XI1 A;  4M42 A;  1YTU A;  1RT5 A;  4B3O A;  5I3U A;  5FDL A;  3NH2 A;  2KQ2 A;  3ZT4 A;  3SUQ A;  2KFZ A;  4DSF A;  5KI6 A;  1FKO A;  4DG1 A;  4ICL A;  3HST B;  1IKW A;  2VWK A;  4FW1 A;  3SQ2 A;  2P5O A;  3VA0 A;  5HRR A;  2F96 A;  1CZ9 A;  5EU7 A;  1W0H A;  3TI0 A;  3IAY A;  4BE2 A;  2YKM A;  3DM2 A;  3V4I A;  1RT6 A;  3LP2 A;  3NH1 A;  5FRN A;  1RT2 A;  3RTV A;  2E4L A;  1JKH A;  3TAB A;  4CFC A;  2A1R A;  1BQN A;  1SL1 A;  3OYD A;  1B9F A;  3HPO A;  4ID5 A;  2P5G A;  5D3G A;  2RKI A;  5CY4 A;  4NYF A;  3KKR A;  1XWL A;  3ASM A;  1JLA A;  2Z1J A;  3OYI A;  3TR8 A;  4AHC A;  2G8U A;  1CLQ A;  1KLN A;  3L2U A;  1HPZ A;  1RBT A;  4DSJ A;  3VQ7 A;  1KCF A;  1JLB A;  3ZSO A;  4FK2 A;  4Y1C A;  3KLF A;  1J54 A;  1RT4 A;  2OPP A;  4CHZ A;  4E89 A;  1XC9 A;  3O3F A;  2XO7 A;  1WSE A;  1A5V A;  3V1R A;  4FLW A;  2PYL A;  1S9G A;  4LSN A;  4O0I A;  3KLG A;  1S1X A;  2D5R A;  4CJL A;  3LWM A;  4B9V A;  4LH5 A;  4FK0 A;  1RDC A;  4GW6 A;  4DSK A;  3ZSW A;  1S5J A;  3L3U A;  4CFA A;  4EP4 A;  4CF2 A;  3NGZ A;  3O3H A;  1ZBI A;  2Z1G A;  3ZSR A;  4EZ6 A;  4CJW A;  4RG8 A;  1RTI A;  1ZBH A;  1IH7 A;  1TKD A;  1TAU A;  1ZBL A;  5SWM A;  3AVG A;  1KLM A;  4DTN A;  4ELU A;  3AA3 A;  4TSX A;  3V9X A;  4LD0 A;  3RMC A;  3NCI A;  1W9H A;  3VA3 A;  1FXX A;  3K5M A;  4KV8 A;  3RWU A;  3L8B A;  1S6P A;  3SYZ A;  2F8T A;  3K58 A;  3SCX A;  1RIL A;  5E41 A;  2ETJ A;  4IBN A;  4KHN A;  4CEF A;  4PQU A;  4CF8 A;  3KLE A;  4B9N A;  4Z4G A;  5HLF A;  2F8S A;  4FXD A;  4FZY A;  1EKE A;  2OPQ A;  3QES A;  2E6L A;  1KVC A;  1HMV A;  2O4G A;  1VSE A;  4M3R A;  1YVU A;  2XY7 A;  2IOC A;  4HTU A;  1CZB A;  1RBR A;  4B9T A;  1BQM A;  1JLG A;  1U49 A;  2WON A;  3OYA A;  3AVA A;  1S1U A;  4CFB A;  3TAR A;  3KK3 A;  3DLE A;  4Z4F A;  1C1B A;  1WSJ A;  3AO1 A;  4AHR A;  3AVN A;  3NF6 A;  2HHX A;  3QIO A;  2PZS A;  3HXM A;  4CCH A;  2IDO A;  2OPS A;  4J2D A;  3F73 A;  1JLF A;  3OYC A;  1TKX A;  3EYZ A;  1ITG A;  4FJ9 A;  3MED A;  2KW4 A;  1SL2 A;  5DMR A;  1KTQ A;  3P1G A;  3VQ8 A;  3OS2 A;  3TAF A;  3V9S A;  4PWD A;  3CM6 A;  4JRP A;  4O5B A;  3HT3 A;  2HHS A;  1NOZ A;  1VSF A;  2DFH A;  4BE0 A;  3H08 A;  3OYN A;  3ULD A;  4KB0 A;  3NGI A;  2KZM A;  2EX3 A;  4IFY A;  3LAK A;  1LAV A;  5KGX A;  2X6S A;  4ZTJ A;  1NK6 A;  4L8R B;  3NH0 A;  3T3F A;  3V1O A;  3F9K A;  4CHP A;  3PY8 A;  2PYJ A;  4CGD A;  1FKP A;  2G8H A;  4OPJ A;  4F3T A;  4B9M A;  3DRP A;  2HVH A;  4J2A A;  5CYM A;  3LAM A;  1F21 A;  4E0D A;  1GOC A;  1S9E A;  3I0R A;  1UA1 A;  3AA5 X;  1BIZ A;  4OJR A;  4E3S A;  3AVJ A;  4KHU A;  2B6A A;  4ID1 A;  4FCY A;  1HNV A;  4JLH A;  3PUF A;  3AVM A;  4R5P A;  4BAC A;  4FLT A;  3CYM A;  4N47 A;  1HNI A;  4AHT A;  3QNO A;  5I42 A;  3DRR A;  1TVR A;  1XHZ A;  3LAL A;  3L3V A;  3HYF A;  4M3U A;  4CJQ A;  4O0J A;  3TWH A;  2QKB A;  2HB5 A;  4B9L A;  3VQ9 A;  4B8A B;  4E19 A;  3V6D A;  5CYQ A;  4FYD A;  1QQC A;  1WAF A;  1ZYQ A;  2OZS A;  4FZZ A;  4QOZ B;  3VN5 A;  4DU4 A;  4NYN A;  4FLU A;  1NKE A;  4CJP A;  1C1C A;  1NJY A;  4DFM A;  3CQ8 A;  1TK5 A;  4ELV A;  1EP4 A;  4FJJ A;  1KFS A;  1L3V A;  1UAX A;  1J9A A;  3RRH A;  3TAG A;  2LSN A;  3U3G A;  1RCH A;  4NCA A;  1Z25 A;  5HRS A;  1JXB A;  3O4N A;  1LW0 A;  3KD1 E;  4CEB A;  2OA8 A;  1RDD A;  1LAW A;  3O3G A;  4BDZ A;  4KPY A;  4KHY A;  3CFO A;  4J2E A;  1VSL A;  3CFR A;  4IDK A;  4DSE A;  3OYJ A;  4N41 A;  3IRX A;  4E7I A;  3QNN A;  3DLB A;  1N5Y A;  3DOK A;  3MEG A;  3SPZ A;  3SUP A;  1A5X A;  3KIO A;  3VQ4 A;  4LY7 A;  1IG9 A;  1WSF A;  4EZ9 A;  5KGW A;  4HCC A;  3HJF A;  3TAN A;  4PUO A;  4KTW A;  2Q3S A;  4GMJ B;  4I2P A;  3DYA A;  2XHB A;  4IFV A;  3NDK A;  4DTM A;  2QXF A;  1KVA A;  4H8K A;  4FLY A;  1N6Q A;  4FJ5 A;  2DTU A;  3HP6 A;  4DQP A;  3KTQ A;  2JGU A;  3QEX A;  3C6U A;  3M8Q A;  1NK0 A;  1BIU A;  1HQU A;  5J2P A;  4W5T A;  4EP5 A;  2P51 A;  4HUF A;  2ZQB A;  1RTD A;  1NK4 A;  4BDY A;  3AVC A;  4M3Z A;  4O44 A;  4CGF A;  1K6Y A;  4M45 A;  4CE9 A;  3M8P A;  1BHL A;  4CGI A;  4CJS A;  4FJ7 A;  4CJV A;  4BDP A;  3AVF A;  3PX0 A;  3VQD A;  3SNN A;  2W42 A;  1RTH A;  4FM2 A;  4FLV A;  4DSI A;  4CGJ A;  4DFJ A;  2G8K A;  3T19 A;  3VQ5 A;  4Z4C A;  4B08 A;  1C1A A;  1L3S A;  1QSY A;  4CHY A;  3SZ2 A;  3VQC A;  4W5Q A;  1UA0 A;  1TKT A;  3AVB A;  3C6T A;  4CGG A;  1NK7 A;  1Q9X A;  2YNG A;  3MEE A;  4O55 A;  3MXI A;  1DLO A;  2JLE A;  3SI6 A;  2BAN A;  3MAQ A;  3MXM A;  1R0A A;  4CER A;  3PX6 A;  3I0S A;  4CES A;  1GOB A;  4E7H A;  4OKJ A;  1SL0 A;  1IKV A;  3RMA A;  4HVJ A;  4E7K A;  1YTA A;  4KRE A;  3AVH A;  3NF7 A;  3EY1 A;  4W5R A;  3K57 A;  3VQB A;  1TK0 A;  4OKK A;  4M41 A;  4DLE A;  3ZSV A;  1T03 A;  2E6M A;  2XY5 A;  3NGY A;  4HUE A;  1S1T A;  1U45 A;  1FK9 A;  4DU1 A;  1RT3 A;  5J2Q A;  2Z1H A;  3HVR A;  1T8E A;  1I39 A;  2YHB A;  4CEZ A;  2OPR A;  3SJJ A;  1EX4 A;  1HRH A;  1WSH A;  3AA4 A;  3IG1 A;  3WNF A;  3LAN A;  4CHO A;  3RMB A;  4FJL A;  3OJS A;  4KI6 A;  4I9Q A;  4AHS A;  4RW7 A;  3ZSQ A;  1VSJ A;  2YNI A; 
#chains in the Genus database with same CATH topology
 3TTF A;  3ZCM A;  3KD5 E;  4E1M A;  2HHW A;  2NRH A;  4AHU A;  2YHW A;  3OYL A;  3LZJ A;  1WBB A;  1U6Z A;  2VG7 A;  5C15 A;  2G8F A;  1LWE A;  2YI1 A;  3LM2 A;  5M1N A;  5HRO A;  2X78 A;  4RW8 A;  3H3N O;  1X9M A;  5AZI B;  4CJK A;  4FSV A;  1TL3 A;  1JCE A;  1Z26 A;  4UQG A;  1SKS A;  4CJ4 A;  3ZSZ A;  2IVP A;  2RF2 A;  4GKJ K;  3U4L A;  4MQ3 A;  3G4S N;  3OW2 M;  2PBD A;  4M3X A;  1VHX A;  4B1W B;  2WBN A;  4PL8 A;  1WOQ A;  2P9N A;  1XMO K;  2GUP A;  2XY6 A;  3THW B;  5FPM A;  3E66 A;  3T69 A;  4CIE A;  3K5O A;  5BRF A;  3O9T A;  3KWG A;  1WSI A;  2NZT A;  4G1Q A;  5BN9 A;  1H1V A;  3CME N;  1S22 A;  3WQT A;  4FJK A;  1YAG A;  3CQY A;  4CHN A;  2HBL A;  3WUH A;  4JS5 A;  3M8R A;  3THV A;  1RNH A;  5LY3 A;  4WYB A;  3P83 D;  3ZT3 A;  3SQ4 A;  3TSQ A;  5F2R A;  3VMF B;  1JLQ A;  2GEL A;  4JD2 B;  3CM5 A;  3DOL A;  2BGG A;  2V51 B;  2UU9 K;  2JWK A;  3J7Y P;  1QQN A;  2ZGZ A;  3HOS A;  5J2M A;  1YIT N;  5JS2 A;  4FZX C;  4CED A;  4FWS A;  1BI4 A;  2CGL A;  1RBU A;  3OVN A;  1MU2 A;  5LJW A;  4RTF D;  4CJ3 A;  5FRO A;  4FLX A;  3DMJ A;  4DTP A;  4CD3 A;  4IOA L;  2X74 A;  1RT7 A;  2R7Y A;  3PO5 A;  4FJI A;  3QIP A;  1V4S A;  4BRD A;  5E84 A;  5AQI A;  2QWO A;  2XRI A;  3LM9 A;  4FJN A;  3OS0 A;  4DFP A;  1N36 K;  2QEX N;  3K2P A;  4E7J A;  3DLH A;  4B9U A;  1L5U A;  1KC8 O;  5M1Q A;  1QE1 A;  1WN7 A;  3OBW A;  4CI6 A;  4CZI A;  3GBT A;  3O9U A;  1GLE G;  4LFA K;  4Z4H A;  2P9S A;  4CJE A;  4QCL A;  4DKW A;  4M3T A;  3O1W A;  1EET A;  2E2P A;  2YKN A;  5C0Y A;  2VYP A;  2HHU A;  4FWR A;  4YOX A;  1D5A A;  3GOI A;  1NU0 A;  5E26 A;  3MEC A;  4A59 A;  4CBW A;  1BIS A;  4BWM A;  1P90 A;  1QSL A;  1JLE A;  5AQS A;  1SKW A;  2O8F A;  4W5O A;  3SV3 A;  4DQR A;  3T1H K;  1NKC A;  3RVC A;  4BE1 A;  4DLG A;  1SUQ A;  3QEI A;  1JL1 A;  1NMD A;  1SZ2 A;  1SAZ A;  4PKG A;  4E7L A;  3LZI A;  1C0M A;  2HBK A;  2KHO A;  2P9P B;  1NGF A;  5HL7 L;  3HO1 A;  3AY9 A;  4GV9 A;  3OS1 A;  1RDA A;  3I8D A;  1JCG A;  3VQQ A;  3TAP A;  1BU6 O;  2I7P A;  5AQK A;  3CCQ N;  4HHT A;  1IKY A;  2YHX A;  5FRM A;  4I2Q A;  5AFU A;  3CCR N;  3DRS A;  4IG0 A;  3UIQ A;  1X9S A;  3R6M A;  1SQK A;  3ZT0 A;  5LMU K;  1BL3 A;  1NKB A;  4MFB A;  2FSN A;  3ALY A;  1HJR A;  5KPR A;  3V9Z A;  3NF8 A;  4MDA A;  3S9H A;  4FWM A;  4BQL A;  3S3N A;  1X9W A;  2A3Z A;  4X66 K;  4DTX A;  4FJ8 A;  1BWF O;  4CEO A;  4B9Q A;  1WAJ A;  1IG8 A;  2BTF A;  3KLI A;  1JL2 A;  4QS8 A;  1UOC A;  4R79 A;  1LV5 A;  4WQ4 A;  2D0A A;  3PO4 A;  3P5J A;  3NVM A;  5CZ2 A;  3E9P A;  4CJU A;  1NJW A;  3DLR A;  3O4Q A;  1HYS A;  1WUA A;  2P9L A;  1KQS M;  3RR7 A;  1ZBS A;  1T05 A;  3WQU A;  5KRS A;  1GLD G;  1YUW A;  1VK0 A;  2D4W A;  3SPY A;  2NRV A;  4OGC A;  1NOY A;  4M42 A;  4B3O A;  4CZH A;  3D2F B;  4BG8 A;  4DSF A;  2ZWH A;  2KFZ A;  4BRN A;  2E5L K;  1FKO A;  4JI4 K;  4ISE A;  4JI3 K;  5EU7 A;  2YKM A;  4LF4 K;  3NH1 A;  1RT2 A;  2E4L A;  4RWT A;  4BRP A;  2A1R A;  1SL1 A;  2P5G A;  2UYT A;  4NYF A;  1XWL A;  3ASM A;  3IUC A;  1RFQ A;  4AF1 A;  4AHC A;  1KLN A;  3KWI A;  1J5E K;  3D7E O;  3WEE A;  4V19 S;  4Y1C A;  4CHZ A;  4E89 A;  4LF6 K;  5AQT A;  4FLW A;  1S9G A;  4LSN A;  1ATN A;  5AQW A;  1S1X A;  4B9V A;  4LH5 A;  2F7T A;  3VOV A;  3L3U A;  3K9J A;  4LF8 K;  2Z1G A;  3EE9 A;  1I94 K;  1EWQ A;  3IMX A;  3ZX0 A;  1J6Z A;  4RG8 A;  1ZBH A;  2YCH A;  1XNR K;  3LL3 A;  1NGC A;  1KLM A;  4DTN A;  3NCI A;  3FZK A;  3VA3 A;  3U9Z A;  2KKZ A;  3L8B A;  3SYZ A;  2F8T A;  4JAX A;  2O8B A;  4JN4 A;  3EO3 A;  5E41 A;  3UKR B;  4AQY K;  4FZY A;  3MWP A;  3QES A;  3J7A P;  2O4G A;  5GAE P;  1VSE A;  1YVU A;  2IOC A;  1CZB A;  2RHK A;  2NRR A;  3A5O C;  3DLE A;  4Z4F A;  1WSJ A;  3PLA A;  3AO1 A;  2Q36 A;  3AVN A;  3QIO A;  2PZS A;  2IDO A;  2QWN A;  4J2D A;  3IFR A;  4MLE A;  4JKH A;  2KW4 A;  1KTQ A;  1QZ5 A;  4FO0 A;  2A6A A;  3L4Q A;  4QS9 A;  2NLX A;  3HT3 A;  2FSJ A;  4BR5 A;  3H45 C;  4BE0 A;  1IBK K;  3M6G A;  2P9I A;  5LMN K;  4L8R B;  4ZTJ A;  1NK6 A;  3T3F A;  3MN7 A;  4YOV A;  2G8H A;  1RDW X;  5A2Q O;  4J2A A;  3LAM A;  3LDN A;  4B3T K;  3E1Y A;  2Q0R A;  1V4T A;  3AA5 X;  3AVJ A;  4ID1 A;  3PUF A;  2HF3 A;  4O8U A;  1HNI A;  3QNO A;  1TVR A;  4A5A A;  3HYF A;  2HB5 A;  3P38 A;  3G71 N;  4B8A B;  1HUX A;  4KH6 A;  3C6A A;  1XMQ K;  4FZZ A;  4DR3 K;  5DM6 L;  5GIO A;  1C1C A;  2ZJQ L;  1NJY A;  5AZJ A;  4JI5 K;  3U3G A;  1YXQ A;  3S41 A;  4H0P A;  3KD1 E;  1LW0 A;  4CEB A;  4KHY A;  3HI0 A;  5IT9 O;  4J2E A;  3CFR A;  3QNN A;  3R8E A;  2UXD K;  2VQE K;  2IVO A;  3SUP A;  1Q86 O;  1WSF A;  2Q0U A;  5KGW A;  2FF3 B;  2AA4 A;  3EEQ A;  3A5N C;  2CGJ A;  2QXF A;  1KVA A;  3IKM A;  1OH8 A;  4BY9 C;  2JGU A;  5J2P A;  3CQX A;  4HUF A;  1RTD A;  2QA4 N;  3SBT A;  1ATS A;  4M3Z A;  4CBX A;  1K6Y A;  4M45 A;  4CE9 A;  4FJ7 A;  4BDP A;  4EHT A;  2W42 A;  3CET A;  5JLF A;  4DSI A;  4Z4C A;  4B08 A;  2WTU A;  5C12 A;  2W40 A;  3E9O A;  3CXC M;  1BA0 A;  4MO5 A;  3A0I X;  4FWK A;  4O55 A;  5M1O A;  5KPT A;  2BAN A;  3MXM A;  4CER A;  3PX6 A;  1GOB A;  4H5N A;  3FZL A;  4BRC A;  4BRQ A;  3RMA A;  4KRE A;  3DXM A;  3HM8 A;  3EY1 A;  1TK0 A;  2QWL A;  4M41 A;  3CC4 N;  4DLE A;  1T03 A;  4H5V A;  2E6M A;  4HUE A;  5HOO A;  1FK9 A;  3GG4 A;  2Z1H A;  3HVR A;  1T8E A;  2YHB A;  1WSH A;  4FJL A;  3OJS A;  2W41 A;  1TL1 A;  2VG6 A;  4BRF A;  3TAQ A;  2D0P A;  3HZ6 A;  1OVY A;  1C0F A;  3SJH A;  1LCU A;  1NJI O;  4X65 K;  4IZ9 A;  1GLB G;  4Q5V A;  1BO5 O;  5TKY A;  5HBM A;  2E20 A;  2HVI A;  1IKX A;  2D1K A;  2EWS A;  3QIN A;  4ILJ A;  1RT1 A;  3ENB A;  4DF4 A;  3CCL N;  3HPG A;  1VQ4 N;  2DFE A;  3KVG A;  4K43 A;  4RW4 A;  3RSE A;  4BC5 A;  3WNE A;  1BA1 A;  1VSK A;  1J5O A;  2ZE2 A;  4C8N A;  1IG9 A;  3J8A A;  4CFD A;  4BRE A;  2IC3 A;  3ZSX A;  3CJA A;  5JMV A;  3A8Y A;  4H0X B;  4YDU A;  3D0P A;  2O8C A;  3VF2 A;  2NRT A;  1VSD A;  3L2W A;  4YFU A;  2HHT A;  3THY A;  3GDQ A;  2HHV A;  3C94 A;  3BGR A;  3VQP A;  4H4M A;  3ZLJ A;  2HF4 A;  1BGX T;  3DWL A;  4KHS A;  2HND A;  5HRP A;  2ASM A;  4N76 A;  3S3O A;  1W2B M;  1BCO A;  1NK9 A;  2E2Q A;  3NF9 A;  2E2O A;  4W5N A;  4KFB A;  4Z0U A;  3A2F A;  2ASP A;  4IXC A;  4MLH A;  1GLJ O;  3RMD A;  1DTQ A;  4PY5 A;  2P1J A;  1C6V A;  2HMP A;  3MXJ A;  4BR9 A;  4X62 K;  1ILY A;  2GV9 A;  2D0C A;  3JSM A;  4CIF A;  1QHT A;  4F9O A;  4U7B A;  1K8K B;  2KFN A;  3V81 A;  4FWQ A;  3FFI A;  3HP9 A;  1NJZ A;  1SKR A;  4DR1 K;  3VEZ A;  5JLH A;  1XHX A;  1YJN N;  3DI6 A;  2OYQ A;  1TGO A;  3M5R A;  4JI8 K;  1L3U A;  2GWJ A;  3OYG A;  2P9N B;  1LW2 A;  2P9U A;  2DY4 A;  4DU3 A;  3J7Z O;  3HBT A;  3R1X A;  1M1K O;  3SAG A;  2ZD1 A;  4B9S A;  3B6P A;  5SZT A;  1HKC A;  4FL9 A;  1Q9Y A;  4DWI A;  4XH1 A;  1HYV A;  4CF9 A;  3CFP A;  3ZSY A;  2ZJP L;  4FVM A;  3OYB A;  1T6D A;  4CGH A;  4KHW A;  4K8X A;  2HW3 A;  2FBT A;  2QI2 A;  5EY4 A;  1JLC A;  2HNY A;  3VET A;  1BOT O;  5F1X A;  3L6Q A;  2UUC K;  4Y1D A;  4JKD A;  3F9M A;  3LPT A;  3OYH A;  3C65 A;  1EXQ A;  3KK7 A;  3O9Q A;  1BI4 B;  3KJV A;  3ID6 A;  1Y64 A;  4Q0B A;  2UXB K;  1KXP A;  4CJF A;  5BPM A;  4CEC A;  1U4B A;  1HQE A;  5DK5 A;  4YY3 K;  4OPK A;  3L2Q A;  4DSL A;  4XH4 A;  1NK5 A;  5AQU A;  1C0U A;  2X6N A;  1IO2 A;  2H3G X;  4I7F A;  3HPH A;  4A61 A;  1L3T A;  4N56 A;  4LSL A;  4JI2 K;  2GBZ A;  1MWM A;  3AGK A;  1KFD A;  1YHQ N;  4JS4 A;  1BDG A;  4BR2 A;  5EOY A;  2GUI A;  4CF1 A;  2YNF A;  3LP1 A;  5AQG A;  2YV0 X;  2P9S B;  4FJG A;  5LL6 Z;  3VTI A;  1TK8 A;  1VQP N;  3VEW A;  3L2R A;  2B4J A;  2ASO A;  4CZG A;  5FPN A;  4A5B A;  1VQ9 N;  1QQM A;  4KRF A;  3UKU A;  2F4V K;  3BDP A;  1RBS A;  3I33 A;  1NLV A;  2O8D A;  1EO1 A;  1X1P A;  2O8F B;  5AQX A;  4CEQ A;  2E2N A;  3VGL A;  4KTQ A;  1YVN A;  3RRG A;  5KRT A;  1I3A A;  1XNQ K;  4O8K A;  2XY8 A;  4DR5 K;  5BRH A;  4JI0 K;  1VAZ A;  1DKG D;  3S3M A;  1ZBU A;  3A5L C;  3KK2 A;  4PHT X;  5AR0 A;  2G8V A;  1NBW A;  3NE6 A;  3DJC A;  4F2R A;  3AO4 A;  1X9J A;  1ZBF A;  4BQZ A;  3FZM A;  2G8I A;  4XIU A;  1U04 A;  4CHQ A;  1XI1 A;  1RT5 A;  2HBM A;  5KI6 A;  4DG1 A;  4YHH K;  4CZL A;  3HST B;  3T7Z A;  2VWK A;  4FW1 A;  3SQ2 A;  3VA0 A;  4DV2 K;  3TI0 A;  4BE2 A;  3DM2 A;  1RT6 A;  5FRN A;  3RTV A;  5AFU H;  3TAB A;  4CFC A;  1BQN A;  5MLC Q;  5D3G A;  4B1U B;  3KKR A;  1RDU A;  1JLA A;  3OYI A;  2G8U A;  3L2U A;  1HPZ A;  4DSJ A;  1JLB A;  1P8Z A;  4H0Y B;  3LDL A;  3K0S A;  3SK3 A;  1SS6 A;  5JVH L;  4LF9 K;  2KLA A;  2P9L B;  3G6E N;  4FK0 A;  1RDC A;  3D6R A;  4CFA A;  1S5J A;  4EP4 A;  3O3H A;  1WB9 A;  4NLC A;  1MA9 B;  5AZI A;  3FFK B;  3QFP A;  4LF7 K;  1RTI A;  5EXW A;  3C7N A;  1ZBL A;  1W7A A;  3AVG A;  2W6K A;  4YOU A;  3AA3 A;  4TSX A;  3V9X A;  3BZC A;  3RMC A;  3RWU A;  3BF1 A;  3K58 A;  2YJF A;  4KHN A;  2QWR A;  3KLE A;  3CF5 L;  3O4W A;  4M7X A;  3CHW A;  4FXD A;  1EKE A;  4AM7 A;  2OPQ A;  3F5T A;  4M3R A;  1ESV A;  4HTU A;  1BQM A;  2Q1N A;  5GAD P;  3N4P A;  3AVA A;  3WEE B;  4CFB A;  3TAR A;  1C1B A;  3NF6 A;  2HHX A;  4CCH A;  3HXM A;  2OPS A;  3A5M C;  3CMA N;  4J8F A;  1TKX A;  4BR0 A;  3QML A;  4H5T A;  5CE3 A;  4JKE A;  3V9S A;  1GLA G;  4JRP A;  3SBG A;  3DLL L;  1HLU A;  3ULD A;  4KB0 A;  2EX3 A;  3LAK A;  5KGX A;  2X6S A;  4RCH A;  3F9K A;  3EE8 A;  1FKP A;  3ULE A;  1NNE A;  4CD1 A;  1GOC A;  1E4F T;  3I0R A;  2O8B B;  1BIZ A;  2UUA K;  2QWP A;  2B6A A;  4KHU A;  1HJO A;  1HNV A;  4R5P A;  5M1F A;  4BAC A;  4B3R K;  3CYM A;  2A41 A;  5I42 A;  1XC3 A;  3L3V A;  4ISF A;  4M3U A;  3CCS N;  2BUP A;  1S72 N;  4E19 A;  1YIJ N;  1NGI A;  5CYQ A;  4FYD A;  1ZYQ A;  3VN5 A;  4DU4 A;  4ILH A;  4FLU A;  4CJP A;  4GVE A;  4DFM A;  3CQ8 A;  1EP4 A;  3D2E B;  1U2V A;  1KFS A;  3ATU A;  1J9A A;  4B1V A;  4NCA A;  1KAX A;  5B8H A;  1X3M A;  5HRS A;  1JXB A;  2RE2 A;  2P9K A;  2OA8 A;  4KPY A;  1LAW A;  3O3G A;  4LFB K;  1HNZ K;  3CFO A;  2QWQ A;  4EAH D;  4DSE A;  4N41 A;  1N5Y A;  3DOK A;  2P9I B;  1N8R O;  3KIO A;  3VQ4 A;  4EZ9 A;  4HCC A;  4GMJ B;  4I2P A;  3DYA A;  4A2A A;  4IFV A;  3NDK A;  3HTV A;  4DQP A;  1EQY A;  5GIN A;  1NK0 A;  1BIU A;  1HQU A;  4BG9 A;  1S3X A;  2P51 A;  2VGN A;  2ZQB A;  4BDY A;  4CGF A;  2FSK A;  3WT0 A;  1YF5 L;  4CJV A;  3MWT A;  4CW7 B;  1Q81 O;  4CZM A;  1QSY A;  4CHY A;  3ZET A;  3CD6 N;  3SZ2 A;  1NK7 A;  3AVB A;  3C6T A;  4BGA A;  5M1K A;  3MXI A;  4L3Q A;  5KQ8 A;  3SI6 A;  4DV4 K;  4BRI A;  3I0S A;  4CES A;  5AQO A;  3HRG A;  4E7H A;  1SL0 A;  2A5X A;  3GE1 A;  3VEN A;  3ENH A;  4DV5 K;  4H5R A;  3AVH A;  4OPH A;  3R9P A;  3NF7 A;  3LDP A;  1HNW K;  5IWA K;  4CZK A;  3ZSV A;  2XY5 A;  1U45 A;  3TPQ A;  2ITM A;  4DU1 A;  1I39 A;  3CCM N;  1Q82 O;  1HRH A;  3IG1 A;  3ZSQ A;  1VRT A;  3D45 A;  4BRH A;  2BDP A;  2HST A;  2WUS A;  3T1A A;  3ITH A;  2FC0 A;  1VSI A;  1C0T A;  3OA9 A;  4KKO A;  4CIG A;  1ASU A;  3O5B A;  2Z1I A;  3AAQ A;  4DQI A;  3LPU A;  1VSH A;  3AAP A;  1U48 A;  1VQ8 N;  3MK6 A;  3OY9 A;  4BWJ A;  3SLC A;  2QXL A;  1YT3 A;  3IDH A;  3THX A;  4NXN K;  2A42 A;  3O1B A;  3MN5 A;  3HM9 A;  1S6Q A;  3VF6 A;  1QVF M;  4Z4I A;  2CH5 A;  4H4O A;  1NK8 A;  2WOM A;  4ILG B;  5T7B A;  2ZM6 K;  5F0X A;  3DXM B;  3TTD A;  1VQK N;  4PA1 A;  3G10 A;  3KLH A;  3DAW A;  3WNG A;  3AVI A;  3OBY A;  2CH6 A;  3OYK A;  2IGI A;  4MO4 A;  4FJH A;  4KTZ A;  3TAE A;  1JJ2 M;  3G0Z A;  4Y0W A;  3IS9 A;  3CIP A;  4AHV A;  3OYE A;  4N5S A;  3QET A;  4H0O A;  1ZXO A;  3HK2 A;  2HBJ A;  4IWV A;  1GLL O;  2Q97 A;  3VQA A;  4PKI A;  3FLC O;  4IO8 A;  5AQQ A;  4FW2 A;  2NRZ A;  1N34 K;  2QK9 A;  4B3S K;  1TUU A;  4BC2 A;  4CVN E;  3RR8 A;  4DTS A;  2VWJ A;  4O4G A;  1QTM A;  5DM7 L;  2DPN A;  4KB1 A;  4DTJ A;  3NHG A;  1A5W A;  4FLZ A;  5AQJ A;  3B8A X;  1GLC G;  2VG5 A;  2EHG A;  5J1E A;  2PY5 A;  3HL8 A;  4OGE A;  3PSI A;  1NJX A;  4JRQ A;  2O8E A;  3THY B;  2AJQ A;  4JNE A;  4YNQ A;  2ZGY A;  3LP0 A;  2RPI A;  4M3W A;  4DV3 K;  1Z6R A;  3GL1 A;  2FXU A;  4KO0 A;  4KHQ A;  5K14 A;  4J2B A;  3U3Y A;  1BUP A;  3CJB A;  1J53 A;  3B6O A;  1Y97 A;  2BH1 A;  4CK3 A;  3HVT A;  4Z4E A;  3AO5 A;  1VQL N;  3MN9 A;  1GLF O;  4ZHR A;  3WNH A;  3JAM O;  2KZZ A;  3VF4 A;  3LWL A;  3ZT2 A;  2FF6 A;  5CHI A;  4OVL A;  5FPD A;  4KAZ A;  1OH5 A;  3V1Q A;  1JXE A;  3EN9 A;  2CGK A;  4IG3 A;  3DLG A;  3MX2 A;  1TYQ A;  5AJ3 K;  4OO1 J;  1O13 A;  1RBV A;  4K41 A;  4WQ5 C;  1ASW A;  3NAE A;  2YNH A;  2IAJ A;  3WXJ A;  3ZX3 A;  4DTO A;  1DEJ A;  1D9D A;  2IIR A;  2I7N A;  4GV3 A;  1XQS C;  4H03 B;  3OJU A;  1CXU A;  1FJG K;  3LDS A;  1S1W A;  3WXM B;  5BPL A;  5KPZ A;  3PIO L;  5GAH P;  4E1N A;  4DQS A;  2P9U B;  4QAG A;  4KI4 A;  4BVP A;  3MMV A;  3QFU A;  4DCH A;  4FM0 A;  5AQH A;  3H6E A;  4DMN A;  2OTL N;  1T3V A;  1HYZ A;  1RDB A;  5JS1 A;  5C25 A;  4JV5 K;  1KAY A;  3AA2 A;  4WQ4 C;  4DS4 A;  3KK1 A;  5KTQ A;  1K8A O;  1RTJ A;  3H1V X;  3NBP A;  3QEV A;  4FWN A;  5GAG P;  2BE2 A;  5C2D A;  3E01 A;  2FBV A;  1QS4 A;  4DB3 A;  4DTR A;  2Y1J A;  3SQ1 A;  3AO3 A;  4JK7 A;  2G8W A;  4C8O A;  4FJM A;  3SUN A;  1IBM K;  4BRL A;  2AP1 A;  4DF8 A;  3LDQ A;  1NMN A;  4CK1 A;  3FE1 A;  2QWM A;  3NFA A;  4CEA A;  1Q7Y O;  3V9W A;  3K59 A;  1Z05 A;  5KQD A;  4BR7 A;  1K9M O;  4K42 A;  4F4K A;  4WF9 L;  1WLJ A;  1YI2 N;  1VSM A;  4AIL C;  4NCG A;  1CZA N;  1DTT A;  1UWB A;  4JKF A;  1QSS A;  1BCM A;  3VQ6 A;  5AQR A;  3ISN C;  4GKK K;  1VRU A;  2YHA A;  3VES A;  1OH7 A;  5I3U A;  3L4I A;  2KQ2 A;  3ZT4 A;  5JVG L;  3SUQ A;  1VQO N;  2NNW A;  4ICL A;  3ID8 A;  1CZ9 A;  3UKU B;  3AGR A;  4IFE A;  1HNX K;  1JKH A;  5AQV A;  2GX9 A;  3OYD A;  1B9F A;  2YHY A;  3HPO A;  2RKI A;  1CLQ A;  3TR8 A;  4BRM A;  1KCF A;  3CI5 A;  2A40 A;  1ATR A;  1KD1 O;  3KLF A;  1J54 A;  1RT4 A;  3C6H A;  3O3F A;  2XO7 A;  1WSE A;  4DUY K;  1A5V A;  4I6M A;  3L0Q A;  3TSP A;  4CJL A;  3LWM A;  3ZSW A;  4CF2 A;  5BPN A;  4CZJ A;  5GIP A;  4CJW A;  4FWP A;  4HWI A;  4H0T B;  5SWM A;  5ELZ A;  4O5F A;  4KH4 A;  3ZEU A;  4WCE L;  1W9H A;  4IJA A;  1FXX A;  1S6P A;  2PFU A;  1RIL A;  4JKG A;  4CF8 A;  3OTO K;  4B9N A;  5LJV A;  4Z4G A;  3P4I A;  1KVC A;  2XY7 A;  1RBR A;  4B9T A;  1JLG A;  1S1U A;  3JS6 A;  3O9R A;  3CPE A;  1G99 A;  4C23 A;  4C1N I;  1JLF A;  1RGI A;  1ITG A;  4CZF A;  3EKU A;  3OHR A;  5DMR A;  3P1G A;  3SMP A;  4JHD A;  3OS2 A;  2E1Z A;  3TAF A;  1DT9 A;  2HHS A;  1NOZ A;  1VSF A;  4A2B A;  4PL7 A;  3H08 A;  5AQY A;  1HKB A;  3NGI A;  1K8K A;  3C7N B;  1LAV A;  5CR4 A;  3VER A;  4CHP A;  3PY8 A;  2PYJ A;  4OPJ A;  4B9M A;  3DXK A;  3W3D A;  3DRP A;  5C2F A;  5CYM A;  1NGB A;  2VWB A;  1QHA A;  1S9E A;  1UA1 A;  2F9T A;  4FVU A;  3G25 A;  2Q31 A;  4FCY A;  3O08 A;  4N47 A;  5FPE A;  4AHT A;  3QBX A;  3DRR A;  5I9E B;  3LAL A;  2E1Y A;  3CCE N;  4CJQ A;  2QKB A;  4B9L A;  3VQ9 A;  2OAN A;  1EWR A;  3V6D A;  2OZS A;  4DHY A;  4NYN A;  1NKE A;  3CJC A;  4FPB A;  4WFN L;  1TK5 A;  1K73 O;  4ELV A;  5ADX H;  4A57 A;  1L3V A;  3RRH A;  4DV1 K;  3TAG A;  2LSN A;  4M7Y A;  1RCH A;  3SMS A;  1Z25 A;  1YJW N;  3O4N A;  1RDD A;  4DR6 K;  3M3Z A;  3BF3 A;  4IDK A;  4YOY A;  4E7I A;  4LFC K;  3SPZ A;  1A5X A;  3HJF A;  4PUO A;  4KTW A;  2Q3S A;  3ULE B;  3VGK A;  4H8K A;  1D4X A;  3WXL A;  3HP6 A;  3KTQ A;  3M8Q A;  1FW6 A;  3SAF A;  4EP5 A;  1NK4 A;  2ZJR L;  4YOW A;  4CZE A;  4E1J A;  3UE5 A;  4CJS A;  3M8P A;  3BP8 A;  3AVF A;  3PX0 A;  3VQD A;  4FLV A;  2W6L A;  1NWK A;  2G8K A;  3T19 A;  2NRX A;  2GEM A;  3VQC A;  4B3M K;  4JKA A;  4W5Q A;  4B1Y B;  1UA0 A;  4CGG A;  3WXI A;  2YNG A;  1NM1 A;  3MEE A;  3CPW M;  2JLE A;  1U2V B;  3MAQ A;  1R0A A;  2VCP A;  4YOR A;  5BRE A;  1IKV A;  2P9K B;  3F2K A;  4YDU C;  5AQF A;  4W5R A;  3VQB A;  3VPZ A;  4OKK A;  3K57 A;  3KHY A;  3CER A;  3E9L A;  3NGY A;  1S1T A;  1RT3 A;  5J2Q A;  5ADX A;  2V7Y A;  1IBL K;  3SJJ A;  3WNF A;  3AA4 A;  1NGJ A;  3LAN A;  4H0V B;  3THW A;  1E3M A;  4AHS A;  1VSJ A;  3U6F A;  4RW9 A;  1E4G T;  3M8S A;  4CF0 A;  5AQP A;  4RW6 A;  4OKE A;  4IJN A;  4F3O A;  1DGK N;  4DV7 K;  4F2S A;  4CJT A;  1KRP A;  2VQF K;  3QO9 A;  3MDQ A;  1S1V A;  3EL2 A;  3ZET B;  4XH5 A;  5M1P A;  4KBO A;  1HKG A;  3HSC A;  4IO9 L;  4JD2 A;  3CJ7 A;  4DV6 K;  1B9D A;  1QZ6 A;  1Q18 A;  2HMI A;  2PAV A;  4DFK A;  2NUB A;  4ELT A;  3PSF A;  2WFB A;  4I9L A;  4C8M A;  5AQN A;  4WQ5 A;  1U47 A;  4DQ8 A;  3ZYY X;  4CEE A;  3C0B A;  1NGE A;  1OKJ A;  4YOT A;  1GOA A;  5BR9 A;  3I8B A;  4HCB A;  3VQE A;  3AO2 A;  4DS5 A;  3KKS A;  4KH5 A;  4NCB A;  2ATQ A;  5FLX O;  1ZC6 A;  3AAR A;  3FR0 A;  3QBW A;  4BC4 A;  1TV6 A;  3KZB A;  3QEP A;  4IOC L;  4OLB A;  4JKC A;  2HHQ A;  1NG9 A;  2QKK A;  1VQM N;  4C8L A;  3BY5 A;  2A1S A;  3THX B;  2KTQ A;  5J2N A;  4FK4 A;  4DUZ K;  3K5N A;  3V9U A;  3QER A;  4JKB A;  3R3L A;  4WE1 A;  3QLH A;  3SQ0 A;  4HTL A;  4EHU A;  2ITG A;  4C8K A;  3C95 A;  1IV0 A;  2OCE A;  4OLA A;  3VEO A;  1OVQ A;  4FOI A;  1D9F A;  2RN2 A;  4C1N K;  4HUG A;  4X64 K;  4F8R A;  3AVL A;  4XEI A;  2DFF A;  4LF5 K;  1X3N A;  3I55 N;  1M90 O;  4K0K K;  2P9P A;  4IDH A;  2V7Z A;  4FJX A;  1VQN N;  3DLK A;  1G15 A;  2D0O A;  4CJ5 A;  1D8Y A;  4WFA L;  3SUO A;  3I56 N;  3L2V A;  2I5J A;  5JIC A;  5TKW A;  1B92 A;  1REV A;  4U67 L;  3BZK A;  5AZJ B;  3K9K A;  4GY2 B;  1KSP A;  2O4I A;  1O1W A;  4DTU A;  4ZTF A;  1QVG M;  2JWL A;  4CK2 A;  4A62 A;  4AH9 A;  1CXQ A;  3ZT1 A;  2HHH K;  3OYF A;  4GNI A;  4K8Z A;  2WC9 A;  2O8E B;  4IOX A;  3MCA B;  2HNZ A;  5AQL A;  4GVM A;  3LDO A;  4DQQ A;  3PV8 A;  3U8X A;  1Q8I A;  4B8C A;  3VGM A;  3QEW A;  3SV4 A;  3W0L A;  4FWL A;  4EFH A;  5H1S Q;  2Y1I A;  1WSG A;  1XUP O;  4K25 A;  3H46 O;  1LWF A;  3MCP A;  4IKF A;  1LWC A;  3AVK A;  3VEY A;  1TKZ A;  5C42 A;  1T44 A;  1N32 K;  4UY8 O;  3D2E A;  5CZ1 A;  3D2F A;  1WBD A;  1C0G A;  1SV5 A;  3OYM A;  4BRO A;  1ASV A;  1KAZ A;  1TYQ B;  2OZM A;  3LP3 A;  1TAQ A;  3JYT A;  2FBY A;  3CG7 A;  4CJR A;  1NGD A;  1QQO A;  3TAM A;  4M3Y A;  3ENO A;  1NGA A;  3Q7C A;  5HP1 A;  3K5L A;  1KVB A;  1WNS A;  1T7P A;  2V52 B;  1T6C A;  2B5J A;  3EKS A;  3AV9 A;  5HRN A;  2IS3 A;  4CBU A;  3H1Q A;  3VEX A;  3EZW A;  3PX4 A;  3VEV A;  2FBX A;  1MWK A;  3CJ1 A;  3EZ5 A;  1NGH A;  2D0B A;  3Q7B A;  3O9S A;  2IVN A;  3CJ9 A;  3RSE B;  4LH4 A;  3CCV N;  1YJ9 N;  3FZF A;  3TSU A;  1TUY A;  4FM1 A;  3WXK A;  5C24 A;  2O8C B;  1YTU A;  4G9Z A;  4IEI A;  4BRA A;  5FDL A;  2HOE A;  3NH2 A;  3U9D A;  1VQ6 N;  1IKW A;  4QS7 A;  2P5O A;  5HRR A;  2F96 A;  1NGG A;  3IAY A;  1W0H A;  5EX5 A;  5BRD A;  3V4I A;  3LP2 A;  3UKR A;  4JI7 K;  1N33 K;  4ID5 A;  5CY4 A;  4JI1 K;  2Z1J A;  3CCU N;  1RBT A;  3VQ7 A;  3ZSO A;  4FK2 A;  4CJ7 A;  3SAH A;  2OPP A;  1XC9 A;  4NLB A;  3QDK A;  3V1R A;  4BR4 A;  2PYL A;  4NO7 A;  4O0I A;  3KLG A;  2D5R A;  4OPA A;  4GW6 A;  4DSK A;  1ZBI A;  3O6W A;  3NGZ A;  2GTD A;  4JYA K;  3CC2 N;  3ZSR A;  1HR0 K;  4EZ6 A;  2NRW A;  2UUB K;  1IH7 A;  1TKD A;  1TAU A;  3ZX2 A;  1VQ5 N;  3O80 A;  4ELU A;  4LD0 A;  3QB0 A;  3K5M A;  4KV8 A;  4BGB A;  5BR8 K;  3SCX A;  5BN8 A;  2ETJ A;  4IBN A;  4PQU A;  4CEF A;  2F8S A;  5HLF A;  3TTC A;  4IEE A;  2QW9 A;  2E6L A;  1HMV A;  3J81 O;  3CC7 N;  4NXM K;  1U49 A;  2WON A;  3OYA A;  3KK3 A;  4BC3 A;  4AHR A;  3QIC A;  1IJJ A;  3BEX A;  4I6M B;  4BRG A;  3F73 A;  3OYC A;  2OTJ N;  3EYZ A;  5C10 A;  4FJ9 A;  3MED A;  1OH6 A;  1SL2 A;  3VQ8 A;  4PWD A;  3FGU A;  3CM6 A;  5AQZ A;  4NB4 A;  4O5B A;  3CCJ N;  3MX5 A;  4AM6 A;  2DFH A;  3OYN A;  3HOT A;  2KZM A;  4IFY A;  3NH0 A;  3V1O A;  4DR7 K;  4CGD A;  4F3T A;  3P39 A;  3ZEU B;  2HVH A;  3ATV A;  1F21 A;  4JEP A;  4E0D A;  3NVK A;  3O8M A;  4OJR A;  4E3S A;  4JKG B;  3MN6 A;  4JK9 A;  4LC9 B;  4JLH A;  3AVM A;  4FLT A;  3T1Y K;  2J4R A;  3P31 A;  1XHZ A;  4B1X B;  3PIP L;  4O0J A;  3TWH A;  2ZF5 O;  5EVZ A;  2Q2R A;  4GV6 A;  1R59 O;  4EIA A;  1QQC A;  1WAF A;  4QOZ B;  2FLO A;  1HPM A;  1VQ7 N;  4Z94 A;  4MDB A;  4FJJ A;  2YX6 A;  1UAX A;  3FZH A;  3TU5 A;  1JCF A;  2GWK A;  1BG3 A;  4JHD B;  4ISG A;  4BDZ A;  1VSL A;  3OYJ A;  3IRX A;  3DLB A;  3N4Q A;  2E88 A;  1MDU B;  4DV0 K;  2QTD A;  3MEG A;  4DR4 K;  4LY7 A;  2O8D B;  3TAN A;  4DTM A;  2XHB A;  3DXK B;  1N6Q A;  4FLY A;  4FJ5 A;  1W97 L;  5AQM A;  3QEX A;  3C6U A;  4W5T A;  4BVO A;  3AVC A;  4OX9 K;  4O44 A;  2DTU A;  4FOE A;  4CGI A;  1BHL A;  1HX1 A;  3SNN A;  1RTH A;  3UB5 A;  4FM2 A;  3JXU A;  4CGJ A;  4DFJ A;  4WFB L;  1L3S A;  3VQ5 A;  4KHP K;  1C1A A;  1LOT B;  2F9W A;  4BRK A;  4DR2 K;  1TKT A;  1Q9X A;  1DLO A;  3VTH A;  3J80 O;  4FWO A;  4OKJ A;  4JK8 A;  2QM1 A;  4H5W A;  4HVJ A;  4E7K A;  1YTA A;  2UXC K;  3BUZ B;  2E8A A;  3M1F A;  4M63 C;  3NMU A;  2VGM A;  4CEZ A;  2YJE A;  4PKH A;  4FPA A;  2OPR A;  3H3O B;  1EX4 A;  4CHO A;  3RMB A;  4B1Z A;  4KI6 A;  4I9Q A;  4RW7 A;  2YNI A;  4JI6 K; 
#chains in the Genus database with same CATH homology
 1VRT A;  3D45 A;  2BDP A;  1TL1 A;  2VG6 A;  4RW9 A;  3T1A A;  3U6F A;  3TAQ A;  3ITH A;  3M8S A;  2FC0 A;  4CF0 A;  3ZCM A;  3KD5 E;  4E1M A;  1VSI A;  1C0T A;  4KKO A;  4RW6 A;  4AHU A;  4CIG A;  2HHW A;  1ASU A;  2Z1I A;  4OKE A;  3OYL A;  3LZJ A;  4DQI A;  2VG7 A;  2G8F A;  4Q5V A;  4F3O A;  1LWE A;  5HBM A;  3LPU A;  1VSH A;  4CJT A;  4F2S A;  1U48 A;  2HVI A;  1IKX A;  1KRP A;  3QIN A;  1RT1 A;  4DF4 A;  5HRO A;  3QO9 A;  3OY9 A;  3HPG A;  2X78 A;  1S1V A;  4RW8 A;  4BWJ A;  1YT3 A;  1X9M A;  2DFE A;  4RW4 A;  4CJK A;  3HM9 A;  1S6Q A;  3WNE A;  1VSK A;  1TL3 A;  1J5O A;  4Z4I A;  4H4O A;  1NK8 A;  2ZE2 A;  1Z26 A;  4UQG A;  4C8N A;  1B9D A;  4CJ4 A;  4CFD A;  1SKS A;  2IC3 A;  2WOM A;  3ZSX A;  3ZSZ A;  5T7B A;  2RF2 A;  3D0P A;  4DFK A;  2HMI A;  2NUB A;  4ELT A;  1VSD A;  4MQ3 A;  3L2W A;  4YFU A;  4M3X A;  2HHT A;  4PA1 A;  3G10 A;  2HHV A;  3C94 A;  3KLH A;  4I9L A;  4C8M A;  3WNG A;  3AVI A;  3BGR A;  3VQP A;  4H4M A;  1BGX T;  1U47 A;  3OYK A;  2IGI A;  4FJH A;  4CEE A;  4KTZ A;  3TAE A;  4KHS A;  3G0Z A;  2XY6 A;  3IS9 A;  4AHV A;  2HND A;  5HRP A;  3OYE A;  1GOA A;  4N5S A;  3QET A;  4HCB A;  4N76 A;  3VQE A;  3AO2 A;  4CIE A;  3S3O A;  3K5O A;  4DS5 A;  3KKS A;  3HK2 A;  4NCB A;  2ATQ A;  1WSI A;  3VQA A;  1BCO A;  4G1Q A;  1NK9 A;  3NF9 A;  4W5N A;  4KFB A;  4FJK A;  4FW2 A;  2QK9 A;  1TV6 A;  4Z0U A;  3QEP A;  3A2F A;  4OLB A;  3RMD A;  2HHQ A;  3RR8 A;  1DTQ A;  4CHN A;  4PY5 A;  4DTS A;  2P1J A;  2VWJ A;  4O4G A;  1QTM A;  1C6V A;  3MXJ A;  4JS5 A;  2QKK A;  4KB1 A;  3M8R A;  3THV A;  4C8L A;  4DTJ A;  1RNH A;  2GV9 A;  3ZT3 A;  2A1S A;  3P83 D;  3NHG A;  2D0C A;  1A5W A;  3SQ4 A;  2KTQ A;  5J2N A;  3JSM A;  4FLZ A;  4FK4 A;  1JLQ A;  3K5N A;  3V9U A;  3QER A;  3CM5 A;  3DOL A;  2BGG A;  4CIF A;  1QHT A;  2KFN A;  2VG5 A;  5J2M A;  3V81 A;  3FFI A;  3QLH A;  4WE1 A;  3HP9 A;  3SQ0 A;  1NJZ A;  5JS2 A;  1SKR A;  4FZX C;  2EHG A;  5J1E A;  4CED A;  2PY5 A;  3HL8 A;  2ITG A;  4C8K A;  3C95 A;  1BI4 A;  4OGE A;  1NJX A;  4JRQ A;  1RBU A;  3OVN A;  1MU2 A;  2AJQ A;  4OLA A;  4CJ3 A;  4YNQ A;  5FRO A;  3LP0 A;  4FLX A;  3DMJ A;  4DTP A;  1XHX A;  3DI6 A;  2RPI A;  2OYQ A;  1TGO A;  1D9F A;  4M3W A;  1L3U A;  2X74 A;  1RT7 A;  2RN2 A;  4KO0 A;  2R7Y A;  4KHQ A;  3OYG A;  1LW2 A;  5K14 A;  4HUG A;  3PO5 A;  4J2B A;  3U3Y A;  4DU3 A;  4F8R A;  3AVL A;  2DY4 A;  1J53 A;  2DFF A;  3B6O A;  3QIP A;  4FJI A;  1Y97 A;  2ZD1 A;  4B9S A;  3B6P A;  3HVT A;  4CK3 A;  4FJX A;  4Z4E A;  3AO5 A;  5SZT A;  2XRI A;  3DLK A;  4ZHR A;  1G15 A;  4FJN A;  3OS0 A;  4CJ5 A;  3WNH A;  4DFP A;  3K2P A;  1Q9Y A;  1D8Y A;  4DWI A;  4E7J A;  3DLH A;  2KZZ A;  1HYV A;  3LWL A;  3ZT2 A;  4CF9 A;  3SUO A;  1L5U A;  4B9U A;  3CFP A;  3L2V A;  2I5J A;  3ZSY A;  1QE1 A;  1B92 A;  4FVM A;  1REV A;  4OVL A;  1WN7 A;  3OYB A;  4KAZ A;  4CGH A;  4KHW A;  4K8X A;  2HW3 A;  2FBT A;  1KSP A;  2O4I A;  1O1W A;  4Z4H A;  4DTU A;  4ZTF A;  4CJE A;  4QCL A;  3V1Q A;  1JLC A;  1JXE A;  2HNY A;  4CK2 A;  4IG3 A;  3DLG A;  4M3T A;  1EET A;  4AH9 A;  2YKN A;  1CXQ A;  3ZT1 A;  4Y1D A;  2HHU A;  3OYF A;  4K8Z A;  1RBV A;  3LPT A;  1D5A A;  3OYH A;  1ASW A;  3NAE A;  2YNH A;  1EXQ A;  3MEC A;  2IAJ A;  4DTO A;  1BIS A;  1D9D A;  1BI4 B;  4BWM A;  1QSL A;  1JLE A;  3KJV A;  1SKW A;  4Q0B A;  4W5O A;  3SV3 A;  2HNZ A;  3OJU A;  1CXU A;  4GVM A;  4DQR A;  1NKC A;  3LDS A;  1S1W A;  4BE1 A;  4CJF A;  4DQQ A;  4CEC A;  1U4B A;  1HQE A;  5DK5 A;  1SUQ A;  4E1N A;  4OPK A;  3L2Q A;  4DLG A;  4DQS A;  3PV8 A;  3QEI A;  4DSL A;  1Q8I A;  1JL1 A;  1C0U A;  2X6N A;  4QAG A;  4B8C A;  1NK5 A;  3QEW A;  4KI4 A;  4E7L A;  3LZI A;  4FM0 A;  1IO2 A;  1C0M A;  3SV4 A;  4I7F A;  4DMN A;  3HPH A;  1L3T A;  1HYZ A;  1RDB A;  5JS1 A;  5C25 A;  2Y1I A;  1WSG A;  4N56 A;  4LSL A;  3HO1 A;  3AA2 A;  4DS4 A;  2GBZ A;  1LWF A;  3KK1 A;  5KTQ A;  3OS1 A;  1RDA A;  3I8D A;  1KFD A;  1RTJ A;  4JS4 A;  4IKF A;  3VQQ A;  2GUI A;  4CF1 A;  1LWC A;  3AVK A;  3TAP A;  3NBP A;  1TKZ A;  2YNF A;  4HHT A;  5C42 A;  3QEV A;  1IKY A;  3LP1 A;  2YV0 X;  2BE2 A;  4I2Q A;  5FRM A;  3DRS A;  3E01 A;  4IG0 A;  2FBV A;  5CZ1 A;  1TK8 A;  4FJG A;  3UIQ A;  1QS4 A;  1X9S A;  1SV5 A;  4DTR A;  2Y1J A;  3ZT0 A;  3OYM A;  3SQ1 A;  3AO3 A;  2G8W A;  4C8O A;  1ASV A;  4FJM A;  2OZM A;  1BL3 A;  3L2R A;  3LP3 A;  1TAQ A;  4MFB A;  3SUN A;  1NKB A;  2B4J A;  3JYT A;  3ALY A;  4DF8 A;  1HJR A;  2FBY A;  3V9Z A;  3NF8 A;  4KRF A;  4CK1 A;  3CG7 A;  3S9H A;  3BDP A;  3NFA A;  1RBS A;  4CEA A;  4CJR A;  3V9W A;  3S3N A;  3K59 A;  1X9W A;  1X1P A;  3TAM A;  4DTX A;  4FJ8 A;  4CEQ A;  4M3Y A;  4CEO A;  5HP1 A;  1WAJ A;  4KTQ A;  3K5L A;  1KVB A;  3RRG A;  4F4K A;  1WNS A;  3KLI A;  1WLJ A;  5KRT A;  1JL2 A;  1T7P A;  1I3A A;  2B5J A;  2XY8 A;  3AV9 A;  1UOC A;  1VSM A;  5HRN A;  4AIL C;  1LV5 A;  4NCG A;  1DTT A;  2IS3 A;  1UWB A;  3PX4 A;  2D0A A;  2FBX A;  3P5J A;  5CZ2 A;  3S3M A;  1QSS A;  3PO4 A;  1BCM A;  1ZBU A;  4CJU A;  3KK2 A;  1NJW A;  3DLR A;  3O4Q A;  3EZ5 A;  1HYS A;  2D0B A;  3RR7 A;  3VQ6 A;  2G8V A;  1T05 A;  3NE6 A;  4F2R A;  3AO4 A;  1ZBF A;  3ISN C;  1VRU A;  4LH4 A;  5KRS A;  2YHA A;  2G8I A;  1VK0 A;  4XIU A;  1U04 A;  4FM1 A;  3SPY A;  4OGC A;  5C24 A;  4CHQ A;  1NOY A;  1XI1 A;  4M42 A;  1YTU A;  1RT5 A;  4B3O A;  5I3U A;  5FDL A;  3NH2 A;  2KQ2 A;  3ZT4 A;  3SUQ A;  2KFZ A;  4DSF A;  5KI6 A;  1FKO A;  4DG1 A;  4ICL A;  3HST B;  1IKW A;  2VWK A;  4FW1 A;  3SQ2 A;  2P5O A;  3VA0 A;  5HRR A;  2F96 A;  1CZ9 A;  5EU7 A;  1W0H A;  3TI0 A;  3IAY A;  4BE2 A;  2YKM A;  3DM2 A;  3V4I A;  1RT6 A;  3LP2 A;  3NH1 A;  5FRN A;  1RT2 A;  3RTV A;  2E4L A;  1JKH A;  3TAB A;  4CFC A;  2A1R A;  1BQN A;  1SL1 A;  3OYD A;  1B9F A;  3HPO A;  4ID5 A;  2P5G A;  5D3G A;  2RKI A;  5CY4 A;  4NYF A;  3KKR A;  1XWL A;  3ASM A;  1JLA A;  2Z1J A;  3OYI A;  3TR8 A;  4AHC A;  2G8U A;  1CLQ A;  1KLN A;  3L2U A;  1HPZ A;  1RBT A;  4DSJ A;  3VQ7 A;  1KCF A;  1JLB A;  3ZSO A;  4FK2 A;  4Y1C A;  3KLF A;  1J54 A;  1RT4 A;  2OPP A;  4CHZ A;  4E89 A;  1XC9 A;  3O3F A;  2XO7 A;  1WSE A;  1A5V A;  3V1R A;  4FLW A;  2PYL A;  1S9G A;  4LSN A;  4O0I A;  3KLG A;  1S1X A;  2D5R A;  4CJL A;  3LWM A;  4B9V A;  4LH5 A;  4FK0 A;  1RDC A;  4GW6 A;  4DSK A;  3ZSW A;  1S5J A;  3L3U A;  4CFA A;  4EP4 A;  4CF2 A;  3NGZ A;  3O3H A;  1ZBI A;  2Z1G A;  3ZSR A;  4EZ6 A;  4CJW A;  4RG8 A;  1RTI A;  1ZBH A;  1IH7 A;  1TKD A;  1TAU A;  1ZBL A;  5SWM A;  3AVG A;  1KLM A;  4DTN A;  4ELU A;  3AA3 A;  4TSX A;  3V9X A;  4LD0 A;  3RMC A;  3NCI A;  1W9H A;  3VA3 A;  1FXX A;  3K5M A;  4KV8 A;  3RWU A;  3L8B A;  1S6P A;  3SYZ A;  2F8T A;  3K58 A;  3SCX A;  1RIL A;  5E41 A;  2ETJ A;  4IBN A;  4KHN A;  4CEF A;  4PQU A;  4CF8 A;  3KLE A;  4B9N A;  4Z4G A;  5HLF A;  2F8S A;  4FXD A;  4FZY A;  1EKE A;  2OPQ A;  3QES A;  2E6L A;  1KVC A;  1HMV A;  2O4G A;  1VSE A;  4M3R A;  1YVU A;  2XY7 A;  2IOC A;  4HTU A;  1CZB A;  1RBR A;  4B9T A;  1BQM A;  1JLG A;  1U49 A;  2WON A;  3OYA A;  3AVA A;  1S1U A;  4CFB A;  3TAR A;  3KK3 A;  3DLE A;  4Z4F A;  1C1B A;  1WSJ A;  3AO1 A;  4AHR A;  3AVN A;  3NF6 A;  2HHX A;  3QIO A;  2PZS A;  3HXM A;  4CCH A;  2IDO A;  2OPS A;  4J2D A;  3F73 A;  1JLF A;  3OYC A;  1TKX A;  3EYZ A;  1ITG A;  4FJ9 A;  3MED A;  2KW4 A;  1SL2 A;  5DMR A;  1KTQ A;  3P1G A;  3VQ8 A;  3OS2 A;  3TAF A;  3V9S A;  4PWD A;  3CM6 A;  4JRP A;  4O5B A;  3HT3 A;  2HHS A;  1NOZ A;  1VSF A;  2DFH A;  4BE0 A;  3H08 A;  3OYN A;  3ULD A;  4KB0 A;  3NGI A;  2KZM A;  2EX3 A;  4IFY A;  3LAK A;  1LAV A;  5KGX A;  2X6S A;  4ZTJ A;  1NK6 A;  4L8R B;  3NH0 A;  3T3F A;  3V1O A;  3F9K A;  4CHP A;  3PY8 A;  2PYJ A;  4CGD A;  1FKP A;  2G8H A;  4OPJ A;  4F3T A;  4B9M A;  3DRP A;  2HVH A;  4J2A A;  5CYM A;  3LAM A;  1F21 A;  4E0D A;  1GOC A;  1S9E A;  3I0R A;  1UA1 A;  3AA5 X;  1BIZ A;  4OJR A;  4E3S A;  3AVJ A;  4KHU A;  2B6A A;  4ID1 A;  4FCY A;  1HNV A;  4JLH A;  3PUF A;  3AVM A;  4R5P A;  4BAC A;  4FLT A;  3CYM A;  4N47 A;  1HNI A;  4AHT A;  3QNO A;  5I42 A;  3DRR A;  1TVR A;  1XHZ A;  3LAL A;  3L3V A;  3HYF A;  4M3U A;  4CJQ A;  4O0J A;  3TWH A;  2QKB A;  2HB5 A;  4B9L A;  3VQ9 A;  4B8A B;  4E19 A;  3V6D A;  5CYQ A;  4FYD A;  1QQC A;  1WAF A;  1ZYQ A;  2OZS A;  4FZZ A;  4QOZ B;  3VN5 A;  4DU4 A;  4NYN A;  4FLU A;  1NKE A;  4CJP A;  1C1C A;  1NJY A;  4DFM A;  3CQ8 A;  1TK5 A;  4ELV A;  1EP4 A;  4FJJ A;  1KFS A;  1L3V A;  1UAX A;  1J9A A;  3RRH A;  3TAG A;  2LSN A;  3U3G A;  1RCH A;  4NCA A;  1Z25 A;  5HRS A;  1JXB A;  3O4N A;  1LW0 A;  3KD1 E;  4CEB A;  2OA8 A;  1RDD A;  1LAW A;  3O3G A;  4BDZ A;  4KPY A;  4KHY A;  3CFO A;  4J2E A;  1VSL A;  3CFR A;  4IDK A;  4DSE A;  3OYJ A;  4N41 A;  3IRX A;  4E7I A;  3QNN A;  3DLB A;  1N5Y A;  3DOK A;  3MEG A;  3SPZ A;  3SUP A;  1A5X A;  3KIO A;  3VQ4 A;  4LY7 A;  1IG9 A;  1WSF A;  4EZ9 A;  5KGW A;  4HCC A;  3HJF A;  3TAN A;  4PUO A;  4KTW A;  2Q3S A;  4GMJ B;  4I2P A;  3DYA A;  2XHB A;  4IFV A;  3NDK A;  4DTM A;  2QXF A;  1KVA A;  4H8K A;  4FLY A;  1N6Q A;  4FJ5 A;  2DTU A;  3HP6 A;  4DQP A;  3KTQ A;  2JGU A;  3QEX A;  3C6U A;  3M8Q A;  1NK0 A;  1BIU A;  1HQU A;  5J2P A;  4W5T A;  4EP5 A;  2P51 A;  4HUF A;  2ZQB A;  1RTD A;  1NK4 A;  4BDY A;  3AVC A;  4M3Z A;  4O44 A;  4CGF A;  1K6Y A;  4M45 A;  4CE9 A;  3M8P A;  1BHL A;  4CGI A;  4CJS A;  4FJ7 A;  4CJV A;  4BDP A;  3AVF A;  3PX0 A;  3VQD A;  3SNN A;  2W42 A;  1RTH A;  4FM2 A;  4FLV A;  4DSI A;  4CGJ A;  4DFJ A;  2G8K A;  3T19 A;  3VQ5 A;  4Z4C A;  4B08 A;  1C1A A;  1L3S A;  1QSY A;  4CHY A;  3SZ2 A;  3VQC A;  4W5Q A;  1UA0 A;  1TKT A;  3AVB A;  3C6T A;  4CGG A;  1NK7 A;  1Q9X A;  2YNG A;  3MEE A;  4O55 A;  3MXI A;  1DLO A;  2JLE A;  3SI6 A;  2BAN A;  3MAQ A;  3MXM A;  1R0A A;  4CER A;  3PX6 A;  3I0S A;  4CES A;  1GOB A;  4E7H A;  4OKJ A;  1SL0 A;  1IKV A;  3RMA A;  4HVJ A;  4E7K A;  1YTA A;  4KRE A;  3AVH A;  3NF7 A;  3EY1 A;  4W5R A;  3K57 A;  3VQB A;  1TK0 A;  4OKK A;  4M41 A;  4DLE A;  3ZSV A;  1T03 A;  2E6M A;  2XY5 A;  3NGY A;  4HUE A;  1S1T A;  1U45 A;  1FK9 A;  4DU1 A;  1RT3 A;  5J2Q A;  2Z1H A;  3HVR A;  1T8E A;  1I39 A;  2YHB A;  4CEZ A;  2OPR A;  3SJJ A;  1EX4 A;  1HRH A;  1WSH A;  3AA4 A;  3IG1 A;  3WNF A;  3LAN A;  4CHO A;  3RMB A;  4FJL A;  3OJS A;  4KI6 A;  4I9Q A;  4AHS A;  4RW7 A;  3ZSQ A;  1VSJ A;  2YNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...