3PIOL

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3pioL01
1N8RO 3CMEN 4UY8O 3PIOL 1VQLN 1YI2N 2OTLN 1QVFM 3J7ZO 1Q81O 1VQON 3CCJN 4IO9L 5GAGP 1K8AO 2QA4N 1YJ9N 1Q86O 3OW2M 3PIPL 4WFAL 1VQ8N 5GAEP 5MLCQ 3CCQN 1VQ5N 1K73O 1VQMN 4WFNL 3CCSN 3G6EN 2OTJN 2QEXN 3CF5L 1M90O 3CPWM 1VQ4N 2ZJPL 3CCVN 3I56N 5JVGL 5GAHP 3G4SN 1Q82O 3CC7N 3I55N 1OVYA 3CCEN 3CCLN 3CC2N 4IOAL 4WF9L 3CC4N 1Q7YO 1NJIO 1YIJN 1ILYA 2ZJQL 1KD1O 1VQ6N 1W2BM 1KQSM 1YITN 1VQPN 1JJ2M 1VQNN 1YHQN 4WFBL 5GADP 1YJWN 1M1KO 1S72N 3CD6N 5HL7L 3CCMN 3CMAN 3CXCM 3CCRN 4WCEL 1VQKN 1QVGM 4U67L 4IOCL 1VQ9N 5DM7L 3G71N 5JVHL 5H1SQ 1K9MO 5DM6L 2ZJRL 3DLLL 3CCUN 1KC8O 1VQ7N 1YJNN
chains in the Genus database with same CATH superfamily
2D4WA 2VWBA 3NE6A 5ELZA 5FPNA 1ASWA 3CERA 4AH9A 3T1HK 2NUBA 4FXDA 1K8KB 2O8BB 3H3OB 4F4KA 2B6AA 5AZIB 4CVNE 3TU5A 2FC0A 1GLCG 3BY5A 4M7XA 1ASUA 1K8AO 3KKSA 3MXMA 1Q86O 3RRHA 4BRQA 4WYBA 3ASMA 3CJCA 4WFAL 2WOMA 5J2NA 4DFKA 3VTHA 4I6MA 3O1WA 1RBSA 4CEQA 4OKEA 5AQUA 4CIGA 1NK6A 1HPMA 4CFDA 3KIOA 4HVJA 4JS4A 3RMAA 5FRNA 3MECA 1QZ5A 2QKBA 3CCVN 2QXLA 4HUGA 1D8YA 1IV0A 5K14A 1NMDA 2KHOA 2F8TA 4FJLA 2X6SA 1OVYA 1RTDA 2UXBK 1HKBA 5AQMA 1E4FT 4I9LA 5LL6Z 3THXA 4CF8A 2E5LK 2I7NA 1KSPA 4W5RA 4I6MB 1P8ZA 1XMOK 1SQKA 3E9PA 1NGJA 4A2BA 1VSFA 4M45A 3EN9A 3MWTA 1BGXT 4NO7A 4KRFA 3KK7A 4E1MA 1U2VA 3QIPA 3VEZA 2IVNA 4NXNK 1HMVA 1K6YA 3FZHA 2GV9A 4FLZA 4AF1A 3QINA 3P5JA 5DK5A 1ZBIA 4BC4A 3AGKA 1SZ2A 1T3VA 1VRTA 2ITMA 3SZ2A 1BO5O 3K58A 4HHTA 2IVOA 4GVEA 1L3UA 3DMJA 3THXB 3FFIA 4C8NA 5AQHA 4JI7K 4IO8A 1OH7A 3DI6A 4LF7K 4B1ZA 3JAMO 2NRRA 3ENOA 3BEXA 5DM7L 4FJIA 4CIFA 1L3SA 2GEMA 1RFQA 2ASOA 3KWIA 3KJVA 4FJ9A 3M6GA 1U2VB 4IDHA 1O13A 2RHKA 2RN2A 4CZEA 4DQRA 4CZLA 1RT5A 3HPHA 4DSEA 1V4SA 3CM5A 3TR8A 1SL2A 3KLHA 3ZSWA 2X78A 3SAFA 5HRPA 3PIOL 1JLFA 3OHRA 3SV3A 3D2FA 2ASMA 3FZMA 2IDOA 2FBYA 3J7ZO 4MQ3A 3WNEA 1X9SA 5JLFA 1LWCA 2XY5A 3S9HA 1VSIA 3CFPA 4H5WA 4W5NA 4CFCA 2GELA 4LH4A 3MDQA 3DOLA 4JI5K 1A5WA 1HYZA 2P9SA 3SQ2A 2DFHA 1EO1A 3VTIA 4BR2A 4K0KK 1XI1A 2CH6A 3U6FA 5ADXH 3NGYA 2G8IA 3VEVA 3D2FB 4CZFA 2YNGA 4BRGA 1RT7A 3E9LA 1JCFA 1WLJA 5LJVA 5M1FA 4JKDA 4EHUA 1S5JA 3WEEA 1H1VA 4DTXA 2HBLA 3KLEA 4BREA 4CHYA 3OYHA 3L2RA 4EZ6A 1WSEA 1DGKN 2WUSA 1NJXA 2P9SB 3CG7A 1U6ZA 3O6WA 3EY1A 4EAHD 2HBMA 2KZMA 3CHWA 4LFBK 3LDQA 1X1PA 1YJWN 1S1XA 4ID5A 4AHUA 4RW4A 1NWKA 2WTUA 4Z4EA 1N5YA 3WEEB 3CJAA 4DTRA 4LSLA 2GUIA 4A5AA 4J2DA 4H5TA 3MN7A 2D0AA 1TYQA 4BWJA 4YOTA 1VSJA 1XNQK 3LANA 3SUNA 4FPAA 3EEQA 1VRUA 2FF3B 5BPMA 4CFBA 4X62K 4DV3K 3IRXA 2O8DA 3DM2A 4BRKA 1T05A 1IKYA 4PY5A 4M3TA 2V7ZA 4L3QA 1X9JA 3ZLJA 4FLYA 3FE1A 3GG4A 3F2KA 3MCPA 4I2PA 2HNYA 1QVFM 3LDPA 3OVNA 4CJRA 4OLBA 2V51B 3THVA 4A62A 2GX9A 4DR4K 5LY3A 4FVUA 1TYQB 2XY7A 4M3YA 4MO4A 3SUOA 2ZQBA 3QICA 2O8DB 1VQ8N 3OYGA 2W6KA 2Q36A 3T69A 1K73O 3ZEUA 4CEDA 5IWAK 3HXMA 3A8YA 4O5BA 3QLHA 2YJFA 4M42A 5CYMA 1WSIA 1HJRA 1LAWA 3I0SA 2D1KA 3CQ8A 4OJRA 4KTQA 5FPDA 2F4VK 4WF9L 3AO2A 1MWKA 3NVKA 1YIJN 5I42A 2G8VA 3RTVA 1XUPO 4HWIA 4BRDA 4BR5A 1RGIA 3ZEUB 3FGUA 2Z1IA 5JS2A 3DLGA 3NHGA 1D4XA 4CW7B 3O8MA 1ZYQA 3JSMA 1RBTA 2F8SA 1BCMA 3GOIA 4DU4A 4B1YB 5JMVA 5CHIA 1KVAA 2HHVA 3AVNA 3LALA 1Z25A 4OPHA 2YNFA 3CXCM 4DG1A 3OJSA 3KLFA 4NLCA 1N6QA 4JKAA 4M3XA 2E1ZA 1ESVA 5LMNK 3VQ7A 1SV5A 1KXPA 4U67L 1W9HA 1X3MA 2PYLA 3F5TA 3LZJA 5EY4A 3SNNA 3O9QA 3JYTA 1SL0A 1SAZA 3ZSQA 5DM6L 3DLLL 1XHXA 1C1BA 4FCYA 3MN9A 3O9SA 3J7AP 4BR9A 3VQAA 1BCOA 3TSUA 2RF2A 1TKZA 4FK4A 3NF6A 4DTUA 3NAEA 2ZWHA 3H08A 3IFRA 3SCXA 2P51A 1YJNN 1HPZA 4DB3A 1VQLN 3V9WA 4LFCK 3TAMA 4EIAA 3ZSYA 4B8AB 2IIRA 3PSIA 5I3UA 3AVGA 1LWEA 2KZZA 3KLIA 2W40A 1QSLA 4A61A 4IG3A 5BR9A 3CYMA 5GIPA 2CGKA 2YI1A 4B1XB 1U04A 4KHPK 3G10A 1U4BA 2VWJA 4Z4GA 2PFUA 3M8PA 2E88A 4XIUA 4FJ5A 3OYCA 1CXUA 4DHYA 3VEOA 3G6EN 4NB4A 4GV9A 3ID8A 4JKCA 3CPWM 3DRPA 3O9RA 4N56A 4KHQA 1VK0A 1VSLA 4KH4A 4Z4IA 5AQZA 4CBUA 4DKWA 3N4PA 3TAEA 1NGGA 1Z6RA 4B1VA 5A2QO 1EQYA 4CESA 2WC9A 4KV8A 3HO1A 3WXKA 4GVMA 4RW9A 1VQPN 4YOVA 2OPQA 1U48A 1B9FA 4K42A 2ETJA 1U45A 3HOSA 3FZLA 1QQMA 2R7YA 3DYAA 3PV8A 2WBNA 3VGMA 4JI8K 1JXEA 5C2FA 4JV5K 2D5RA 1QTMA 4J2BA 3HVTA 4ILGB 1ZBFA 2CGLA 4KH5A 1NJZA 2G8UA 3IDHA 4GKKK 3TPQA 1X9MA 1TAQA 3F73A 1TL3A 4LF9K 4B9VA 2JGUA 4DU1A 1QQNA 3IS9A 4ELVA 3W3DA 3VA0A 1TAUA 3LAMA 1SKWA 4KB0A 1GLEG 1RT1A 4AHVA 4KI4A 1ZXOA 3T7ZA 3ZT4A 3DLBA 3LDSA 4DLEA 4CERA 2V7YA 3DLHA 1W7AA 3EYZA 1NJYA 1S6PA 4HCCA 4FWNA 2B4JA 1QS4A 2GWKA 2E8AA 1HNZK 3VEYA 5SWMA 3CQXA 2HMPA 3M8RA 4LFAK 1NGEA 4FOEA 4JK9A 2F9WA 4Z94A 3SMSA 3DLRA 1VAZA 2DPNA 3BZKA 3MMVA 4DQSA 4FM0A 3TARA 2PBDA 2ZM6K 4NCBA 2A41A 3PUFA 3OYMA 1EETA 3QIOA 4FLVA 4CHPA 2BANA 2IAJA 4JYAK 2G8WA 1EWRA 4PKIA 4E89A 3ISNC 3HP6A 1VQ5N 2HHUA 1VQMN 4E7JA 1N32K 1NKEA 3CCSN 2IC3A 3AAQA 5KI6A 1BA0A 4CHQA 4KHUA 3AO5A 4CJ7A 1M90O 4IBNA 1VQ4N 2ZJPL 4RW6A 2ZD1A 2XHBA 1I39A 3K5LA 2VG5A 2PYJA 1I94K 5M1NA 4FWMA 2BE2A 2HHQA 1Q18A 1L5UA 2QKKA 3K9JA 1HKGA 4BDPA 2NRTA 5BREA 1T8EA 1D5AA 3OYAA 3GBTA 2OYQA 3V1QA 2P9LA 1T03A 1HQEA 2GBZA 2HF4A 4IFVA 4AHTA 4BRNA 5GADP 2KW4A 4A59A 4CZGA 1M1KO 3H1VX 1R59O 3HP9A 4DSJA 4DQIA 2DY4A 1EX4A 4K25A 1FJGK 3L2WA 4C8MA 3OTOK 1J5OA 3AVJA 1CZAN 4KREA 3PLAA 3HSTB 2A1SA 1UWBA 4C8OA 2FF6A 4CF0A 3OYLA 1QZ6A 1QQCA 1TUUA 4PKHA 3OBWA 1HRHA 2QI2A 5H1SQ 4IDKA 2P9LB 1NK9A 1T6CA 3CJBA 3AO4A 4DU3A 1DTQA 3PSFA 4JLHA 1C1AA 2UYTA 3C7NA 1Q8IA 3ATVA 2QWOA 2BGGA 1ITGA 3DLEA 3WXLA 5EXWA 3QEWA 1L3TA 4CJQA 3AA4A 4A57A 3LM2A 3THYA 2FLOA 3TSPA 4CEAA 3QETA 3E01A 3SJJA 3GL1A 4OX9K 2Z1GA 3DLKA 4GKJK 2YHWA 3SAHA 2E2OA 4B3OA 4BRLA 4YHHK 4CJPA 1NNEA 2X74A 5MLCQ 4BC3A 3C7NB 1HR0K 3F9MA 3VN5A 3TAPA 3DXMA 2O8FA 4QS7A 3AAPA 3ULEA 3V1RA 4CE9A 3VGKA 3O3GA 3THYB 1FW6A 3M8QA 2OPPA 4AHCA 3OYIA 2HHXA 2P9PA 3CC7N 4CJKA 4FJJA 3J8AA 4KTZA 3O4QA 3AVLA 2CH5A 5TKWA 5FROA 4CJFA 3J80O 4H0PA 2GTDA 2IS3A 3LP1A 3MXJA 1BDGA 5AQFA 3BGRA 1Z26A 2ASPA 2ZJQL 3SV4A 1C0FA 3P39A 5E26A 5FPMA 3C6AA 3DXMB 2W42A 2O8FB 5KPZA 3ULEB 2FSNA 4X64K 4QOZB 2UUCK 4JI6K 4IOXA 4O55A 3EL2A 4BDYA 1KVBA 5HRSA 4KHNA 2P9PB 3C6TA 2HBKA 1J6ZA 4NYNA 4CZMA 3QEPA 1G15A 5HL7L 4FK2A 1S1UA 3CCRN 4FJNA 3LWLA 3LDOA 4C1NK 4BWMA 3CFRA 1VQKN 4M63C 5EX5A 4DSIA 3BDPA 5AQJA 3A5NC 2XO7A 2HHHK 4B9NA 3SLCA 2HOEA 5JVHL 3MXIA 3U9DA 2PZSA 5CE3A 3QEVA 4FZXC 5BRDA 5AQKA 2A1RA 4EP4A 2HHSA 1N8RO 5C0YA 3PX0A 1BHLA 1LOTB 4DV0K 4G9ZA 3AA2A 3AA3A 1RCHA 1S1WA 4FZYA 4H0YB 5C25A 3OYEA 3ZT0A 3CCJN 1B9DA 1RILA 1YT3A 3AVFA 4LC9B 1C6VA 1XC3A 3V4IA 1RTHA 3LP2A 5JS1A 1TUYA 2EX3A 3OW2M 3WNFA 4DMNA 2HW3A 3D6RA 2XRIA 4KAZA 4E7HA 4KTWA 4JRQA 3KK3A 5HRRA 1BWFO 3NH2A 3B8AX 2JLEA 4N5SA 1R0AA 3CCQN 5F2RA 4DV1K 2OZSA 1KAYA 1TVRA 3AA5X 4NCAA 1LW0A 3UB5A 4W5TA 4CF2A 4FLXA 2HSTA 3EZ5A 3PO5A 5HBMA 3CCLN 3RR7A 4CZHA 4JRPA 4CD3A 2QXFA 4H0XB 3HSCA 1ILYA 4TSXA 1NK7A 4RWTA 1YVUA 3DXKA 3OYDA 4AQYK 3I8DA 1YXQA 4DS4A 1YF5L 1G99A 4PL7A 4ZHRA 1TKTA 4ILHA 4FPBA 3PX4A 4WQ5C 5BPNA 1IO2A 1ZC6A 4H4OA 1RDDA 1T7PA 4H0VB 1WBBA 3UIQA 5KPTA 3V6DA 1HLUA 1NK8A 3C6UA 3S3NA 4LF8K 2I5JA 3DXKB 3G71N 2P9IA 2WONA 5CZ2A 3EE8A 4HTLA 4BR0A 3KLGA 2Q0RA 4E1NA 3FLCO 1RDBA 3B6OA 4FSVA 1UA0A 2DTUA 4FZZA 5M1QA 1GOAA 4GMJB 4H8KA 3AO3A 4RCHA 2FSJA 4UY8O 3QESA 3HM9A 2P5GA 4AHRA 4J2AA 3M3ZA 1IKVA 4PL8A 1WN7A 4DTNA 2OCEA 4G1QA 5FDLA 2QA4N 3MWPA 2OA8A 3H46O 2P9IB 1Y64A 4FW1A 1BG3A 3IG1A 1SKRA 1Q9YA 3ATUA 5AQYA 4BE0A 3O5BA 1NGIA 3HK2A 3B6PA 5SZTA 3QEXA 4Y1CA 4Z0UA 2CGJA 4E3SA 4JAXA 2QEXN 3K2PA 4H0TB 3I56N 4LD0A 4FLUA 3CETA 2XY8A 5T7BA 2ATQA 3BF3A 3LPUA 1QHAA 5KGXA 3Q7BA 4BQZA 3LWMA 4ICLA 4H5RA 5JICA 4MDBA 4IJAA 3H45C 1IG9A 3SAGA 2Q31A 5HLFA 4Y1DA 2D0OA 3L0QA 4B3TK 2D0BA 3JXUA 2KQ2A 3ZETA 1ATSA 3CJ7A 3SUPA 2VG7A 1NGDA 4AM7A 4JI0K 2H3GX 4AHSA 2B5JA 4DQPA 1U49A 3AVBA 4YFUA 1JXBA 3AGRA 1XWLA 3K5MA 1NK0A 1S3XA 2A3ZA 4CGHA 3IKMA 3U9ZA 3OYKA 1KLMA 4WQ5A 5AZJA 4KHSA 2QK9A 4FWLA 1WSGA 4DR6K 1DT9A 1RTIA 3WUHA 4HUFA 2BUPA 4ISGA 4FJ7A 4GNIA 1HYVA 4CZKA 3ZETB 4CEBA 2A40A 4K8XA 4X65K 1VSHA 2ZE2A 2OPRA 1N36K 3ALYA 1EWQA 3TTDA 4CCHA 3KVGA 1FKPA 3VQ8A 1JLQA 1JLAA 1CZ9A 5AZJB 3U3YA 3OJUA 1JLBA 4DV4K 5AJ3K 5AQPA 1HNVA 1IBMK 1J9AA 1GLAG 4KBOA 4YORA 4KHYA 1JLGA 2P9UA 3G25A 3LP3A 3V1OA 2OPSA 3ZX0A 1QQOA 3HOTA 4IWVA 2V52B 4JI1K 4IEEA 4QCLA 1RNHA 4YNQA 1XQSC 1S22A 3HBTA 5KRTA 2BH1A 5I9EB 5J2QA 2E20A 3RMDA 4F8RA 1JL2A 4DR1K 1WNSA 4XH4A 1TK5A 3WQUA 5C2DA 3O08A 4WE1A 1IBLK 1QSYA 4CGDA 3TABA 4LF4K 1JCGA 2ZF5O 3E66A 3QERA 2P9UB 4FWQA 4JD2A 1LCUA 1NGCA 2BDPA 4QS8A 4FLWA 4F2SA 1YITN 4XEIA 1GOBA 3ULDA 4DTJA 4FYDA 4B3RK 4U7BA 3SQ1A 3HYFA 1WSHA 2OZMA 1TV6A 1MDUB 1QSSA 2G8HA 1MA9B 4BGBA 3AVKA 4RW7A 3VERA 1S72N 4M41A 2YHYA 3NGZA 2O8CA 4MLEA 3QDKA 2QW9A 1ZBLA 5BN9A 4CECA 4WCEL 3SBGA 1QVGM 1ZBSA 2IVPA 3QB0A 4JD2B 1UOCA 1TGOA 3VOVA 1LAVA 4BQLA 1FKOA 3HVRA 4CK1A 2E2NA 3TAGA 1XC9A 1NK5A 3HRGA 1RBRA 2FBTA 4KB1A 3ENBA 4FWKA 3D45A 3M1FA 1VSEA 1NK4A 3WXMB 4A2AA 2O8CB 4BRCA 3VENA 2Q1NA 3T1AA 4F3TA 3SBTA 3NF9A 3T19A 5E84A 1YJ9N 3OY9A 3ZT2A 5BR8K 4DSKA 4N76A 3KK2A 2A5XA 4IJNA 3WNHA 3CI5A 5AQQA 1S6QA 4DUZK 2YX6A 3CPEA 1LWFA 3VQ5A 3KHYA 5HROA 1C0GA 3PY8A 1FK9A 3A5MC 3TAQA 2KFZA 3LDLA 1IBKK 3UE5A 1WAFA 4L8RB 2VWKA 3A5LC 2FSKA 4CBWA 4KI6A 3CC2N 4OGEA 3R9PA 2OANA 4M3RA 2AP1A 3CIPA 4BR7A 4K43A 4CJSA 2FBXA 1E4GT 3RMBA 4OO1J 3GE1A 3TAFA 4FK0A 1BI4A 2FXUA 4Z4HA 1QE1A 3D0PA 3VQPA 4C8LA 4NCGA 3QNNA 4CGFA 3NVMA 4OLAA 4CZIA 3HL8A 1TKDA 3UKUA 1NBWA 5AQOA 3LPTA 4XH5A 1NOZA 3AO1A 4PKGA 1XHZA 1NGFA 3VF4A 3R6MA 5TKYA 1GLBG 4JKHA 1NLVA 4FJHA 4MFBA 2DFEA 1X3NA 2NRZA 2KLAA 4OPKA 1VQ9N 1HUXA 4DTSA 4O8KA 3CJ9A 1NOYA 3L6QA 4QAGA 3JS6A 1BISA 1BI4B 4E7IA 2Z1JA 3ZT1A 4B9UA 1NU0A 3ZSRA 5EOYA 1GLDG 1BIUA 3MN5A 2VQFK 1VQ7N 3UKUB 4LH5A 3AVHA 1NM1A 5EU7A 4IFYA 3ZYYX 1T44A 3L4IA 3CM6A 2OTLN 2QWLA 2VCPA 4JEPA 3L3VA 4IG0A 4IO9L 4Z4CA 4OPJA 1OVQA 3NF7A 1WAJA 5CYQA 4BRMA 4CJLA 4FM2A 4C1NI 3ZSOA 2HHTA 4GW6A 1NG9A 1TL1A 4DWIA 4BGAA 1HYSA 3N4QA 4B9TA 3PO4A 1ATRA 2NZTA 4EFHA 4CGGA 4CJTA 1U47A 4O0IA 3A5OC 2YJEA 4OGCA 2NLXA 3C94A 4PHTX 3EKSA 4BRAA 1HKCA 3DWLA 1RDCA 4CFAA 1EKEA 4HTUA 1IJJA 3WXIA 4I7FA 3V9SA 3CC4N 4UQGA 1Q7YO 4KH6A 1C0TA 3LL3A 3T1YK 4H5VA 4JHDA 3SQ4A 4JKFA 2ITGA 3KK1A 1RDUA 1ZBUA 4Z4FA 1RBUA 1VQNN 2HNZA 3THWA 1OH5A 2HVIA 2P9KA 2Z1HA 5KQDA 5C10A 4NXMK 3BZCA 3ZSXA 3SYZA 1Z05A 3QO9A 2HNDA 4MDAA 4BG8A 4I2QA 3ZT3A 5J1EA 3CCMN 1REVA 2E6LA 4B08A 4YY3K 4FWPA 1IKWA 4JHDB 4IOCL 3AV9A 3KZBA 4YDUC 3NF8A 1N33K 3DJCA 3OYFA 1WSJA 2VYPA 3HPGA 4KO0A 2HVHA 4B9SA 1NGAA 3THWB 2ZGYA 4B9MA 2P9KB 5BPLA 3NH0A 4NLBA 5AQIA 4CJ4A 4DQQA 3SPZA 1WUAA 3VPZA 1S9EA 4Q0BA 4CGIA 3VMFB 3O3HA 4BE1A 3K5OA 4FWOA 1KLNA 1XMQK 2W41A 3MK6A 4CIEA 5HRNA 1HJOA 2QWQA 1WBDA 3QBWA 5GAGP 3VESA 5CZ1A 1IH7A 4BE2A 4DSLA 4RTFD 4BACA 1GLLO 4ZTJA 4JK7A 4CBXA 1EXQA 3BUZB 5F1XA 3VQEA 4X66K 3HI0A 4FO0A 5GAEP 4DCHA 1VHXA 2JWLA 4FM1A 4GY2B 1HNXK 1BQMA 3LP0A 4CEEA 2O4IA 1Q9XA 4IKFA 4CK3A 4O4GA 3AVIA 2YNHA 4IFEA 2D0PA 2UXCK 1YAGA 4E0DA 5GIOA 3F9KA 1KVCA 4J2EA 3ITHA 3D7EO 4OKJA 3IAYA 3CQYA 4B9QA 2E2PA 3WXJA 3AARA 3P38A 3SUQA 1OH8A 4CJEA 5KGWA 5JLHA 1ZBHA 4R5PA 5E41A 2Q3SA 4BROA 1RT4A 4FOIA 3QMLA 4O44A 1Y97A 4EZ9A 4CGJA 4DQ8A 4E7LA 4OVLA 4WQ4C 1NMNA 3NH1A 3K9KA 2AJQA 4BRPA 3T3FA 1FXXA 4DUYK 1P90A 4ILJA 5C15A 2YKNA 4BVPA 3V81A 3MEGA 3K59A 3VF2A 4CEOA 1S1VA 2RPIA 3G0ZA 2IGIA 4CF9A 4DF4A 1A5XA 3CCUN 3RRGA 2NNWA 5AQXA 4CJ3A 4DR3K 4FJKA 3LDNA 4YDUA 4FVMA 3H1QA 4M3UA 2UU9K 4CEZA 1KFSA 1RTJA 1S1TA 2HF3A 1JL1A 1GLFO 4O8UA 2FBVA 1YTUA 4E1JA 4DSFA 4CJWA 1Q81O 3VA3A 3RR8A 1KRPA 4RG8A 2RKIA 2XY6A 5LJWA 3HM8A 4GV3A 3R1XA 3E1YA 3UKRA 3SI6A 1SUQA 4K41A 1BL3A 3FZFA 1TK0A 3A2FA 4AM6A 5AQWA 3TSQA 4B3MK 1A5VA 3KKRA 1BOTO 4B3SK 1BA1A 3HJFA 3RVCA 1KFDA 3Q7CA 4I9QA 4BC2A 4FJ8A 4DR7K 1BUPA 3O9UA 2QWMA 4JNEA 1ATNA 1DEJA 2NRXA 3G4SN 3J81O 3ZCMA 2YV0X 4FJGA 4M3WA 4ISEA 2E6MA 4H0OA 4QS9A 5DMRA 3VETA 5AQRA 4CJUA 4FLTA 3R3LA 3EO3A 3UKRB 3TANA 5KPRA 3OS0A 1KAXA 2Q97A 3R8EA 1OKJA 5AQTA 1XNRK 4FJXA 5C24A 4YOYA 4HUEA 4MO5A 3BP8A 3E9OA 4Q5VA 4ZTFA 1NJWA 1KD1O 1KQSM 4JI2K 3TTCA 5J2PA 2QTDA 4YOWA 3P83D 2WFBA 4O5FA 3C6HA 4E7KA 3L2VA 2X6NA 3PX6A 4AILC 4N47A 1IG8A 3NCIA 4PWDA 4DTMA 1W97L 1CLQA 5LMUK 5BRHA 5M1OA 5AFUA 3I8BA 4IZ9A 2Y1IA 3AY9A 2J4RA 4KFBA 3KD5E 4W5OA 2JWKA 3EE9A 4WQ4A 1VSDA 1GLJO 3LZIA 1X9WA 2PAVA 3HT3A 3WNGA 2HHWA 2NRVA 3S3MA 1RBVA 2F9TA 3VQBA 4Y0WA 1NKBA 4CF1A 3TWHA 3CMEN 5BN8A 3RSEA 2Q2RA 1SKSA 4EP5A 3ZX3A 3SJHA 1YI2N 2GUPA 2E4LA 4PQUA 3DRSA 3LAKA 3NDKA 4CI6A 2P5OA 4DV2K 3OYJA 5KRSA 4LF6K 3OYBA 2YHBA 3FFKB 1MU2A 3U4LA 4PA1A 5KQ8A 5CR4A 2GWJA 1RDWX 3IMXA 4DTPA 4BDZA 2KTQA 3MEDA 1E3MA 1RDAA 4FW2A 5IT9O 4MLHA 3K57A 3S3OA 3MEEA 2YCHA 3W0LA 3BF1A 3RSEB 4F3OA 3KD1E 2YNIA 1D9FA 4JI3K 4BC5A 3CF5L 1YVNA 4M3ZA 3SQ0A 1C0MA 1F21A 3ZX2A 3QNOA 3WT0A 3O4WA 2EWSA 4F2RA 3OS1A 1VSKA 2Y1JA 1RT3A 1EP4A 3VQCA 4CJVA 4CEFA 2PY5A 3A0IX 4B9LA 3P4IA 4O0JA 3HTVA 3L4QA 3OA9A 3OBYA 3M5RA 5EVZA 1I3AA 4ELTA 3O4NA 2VQEK 4B1WB 1VQ6N 1W2BM 5BRFA 3DOKA 2LSNA 1B92A 4BR4A 2P1JA 3HZ6A 1YTAA 2A42A 3O1BA 1LW2A 4WFBL 1UAXA 3L2QA 3M8SA 5J2MA 4JS5A 4ID1A 2HMIA 3NBPA 3O80A 3QEIA 4FL9A 4H5NA 4JN4A 3ZSVA 4V19S 2VGMA 2D0CA 3MX2A 3U8XA 2YHAA 3VQ4A 4FWRA 4RW8A 4W5QA 1TKXA 4BRHA 3C0BA 1W0HA 3O9TA 3L8BA 1HNWK 4CJ5A 3V9XA 3GDQA 2E2QA 2YHXA 3FZKA 3C65A 3VF6A 1NGBA 1NGHA 2EHGA 4JKBA 1N34K 1TK8A 2AA4A 4DR2K 3D2EA 4JK8A 4ISFA 2I7PA 3VGLA 4CZJA 5FRMA 4H4MA 3PIPL 4CHNA 3MAQA 4EHTA 3RWUA 3OYNA 3SPYA 2UUBK 1WB9A 3AVMA 3C95A 5AR0A 4LY7A 4DF8A 2IOCA 4WFNL 5AQVA 1BQNA 2DFFA 1SL1A 2OTJN 4DTOA 4C8KA 3NFAA 1HX1A 2O4GA 3J7YP 3D2EB 4A5BA 1OH6A 5HP1A 2O8EA 4JKEA 3MCAB 3H6EA 4K8ZA 3L2UA 4E19A 4BG9A 2E1YA 3SMPA 1VSMA 3VEWA 3P31A 4DFPA 2ZGZA 3AVCA 1D9DA 4DV7K 3O3FA 3HPOA 1DKGD 3NMUA 1JKHA 1JJ2M 3WQTA 4CHOA 4GV6A 4DR5K 4J8FA 5CY4A 2P9NA 5C42A 1YHQN 2QM1A 5AFUH 1NKCA 1ASVA 2RE2A 4HCBA 4DS5A 4BVOA 4M7YA 4JKGA 2UXDK 1QHTA 2O8EB 3QFUA 1JCEA 1S9GA 2NRWA 3CMAN 3AVAA 3S41A 5AQSA 4DV6K 2KKZA 1GOCA 1DLOA 3K5NA 3K0SA 5AQLA 2F96A 3LM9A 2BTFA 4BY9C 2YKMA 3QFPA 5C12A 1RT2A 3RMCA 5M1PA 1K9MO 4N41A 1JLEA 3VQQA 3MX5A 3ID6A 2P9NB 3DAWA 1BU6O 1KC8O 3DRRA 3NGIA 2NRHA 2G8FA 3OS2A 3IUCA 3ENHA 5GINA 5F0XA 4JKGB 1WSFA 3I0RA 1KCFA 3H3NO 4XH1A 1C0UA 2QWPA 4IEIA 1CXQA 3MN6A 5B8HA 3EZWA 1VQON 2G8KA 3KWGA 1J54A 1UA1A 2QWNA 5D3GA 1KAZA 4CK2A 1O1WA 2KFNA 4F9OA 5AQNA 4YOUA 2A6AA 4NYFA 3VEXA 1WOQA 1MWMA 2VG6A 4CD1A 1T6DA 3SK3A 3VQDA 5M1KA 3VQ9A 3ZSZA 3QBXA 3CJ1A 3U3GA 5AQGA 1YUWA 5JVGL 5GAHP 3TI0A 1Q82O 5ADXA 4B1UB 3I55N 4OKKA 3CCEN 4ELUA 4OPAA 1CZBA 4IOAL 2HB5A 4BRFA 1NJIO 2Q0UA 4YOXA 2F7TA 4DFJA 2QWRA 5HOOA 3FR0A 1JLCA 3V9ZA 1KTQA 4H03B 2VGNA 4B8CA 5FLXO 5KTQA 4KHWA 1L3VA 4KPYA 4FWSA 1HNIA 4LF5K 4IXCA 1V4TA 1DTTA 1K8KA 3CD6N 2O8BA 3I33A 1C1CA 3KTQA 2HBJA 4LSNA 1LV5A 5AZIA 1HQUA 4KKOA 4BRIA 1SS6A 3L3UA 2UUAK 2W6LA 4C23A 4R79A 4DV5K 1J5EK 3VQ6A 4DLGA 3P1GA 4CHZA 4JI4K 5FPEA 2ZJRL 3TTFA 1RT6A 4DFMA 1BIZA 3CFOA 3V9UA 4PUOA 4FJMA 1J53A 1IKXA 3EKUA
chains in the Genus database with same CATH topology
2D4WA 2VWBA 5ELZA 5FPNA 3CERA 4FWNA 1K8KB 2GWKA 2E8AA 3TTDA 3VEYA 3H3OB 3KVGA 3CQXA 2HF3A 2HMPA 1GLFO 4O8UA 5AZIB 4E1JA 1NGEA 3TU5A 1Q81O 4FOEA 4JK9A 1GLCG 4M7XA 5AZJB 2F9WA 4Z94A 3SMSA 1VAZA 2DPNA 1K8AO 5LJWA 3HM8A 3MMVA 5AQPA 4GV3A 2PBDA 1Q86O 3R1XA 3E1YA 4BRQA 3UKRA 4WYBA 4K41A 3FZFA 2A41A 1GLAG 4KBOA 3CJCA 4YORA 4WFAL 3VTHA 4I6MA 2P9UA 3G25A 3O1WA 4AM6A 5AQWA 4PKIA 5AQUA 3TSQA 1QQOA 3ZX0A 1VQ5N 3HOTA 1VQMN 4IWVA 1HPMA 2V52B 4IEEA 1BOTO 3CCSN 1BA1A 3AAQA 1BA0A 3RVCA 3Q7CA 1XQSC 1S22A 3HBTA 4BC2A 2BH1A 4CJ7A 5I9EB 2E20A 1M90O 1BUPA 1QZ5A 1VQ4N 2ZJPL 3CCVN 2QXLA 3O9UA 2QWMA 4JNEA 1ATNA 1DEJA 2NRXA 3G4SN 1NMDA 2KHOA 4ISEA 5M1NA 1OVYA 4FWMA 4H0OA 4QS9A 3VETA 4XH4A 5AQRA 3R3LA 3EO3A 3UKRB 3WQUA 5C2DA 1HKBA 1Q18A 3O08A 5KPRA 5AQMA 1KAXA 2Q97A 3K9JA 1E4FT 3R8EA 1OKJA 1JCGA 5AQTA 1HKGA 2ZF5O 3E66A 2I7NA 4YOYA 4I6MB 2NRTA 5BREA 1P8ZA 2P9UB 4FWQA 4MO5A 3BP8A 3E9OA 4JD2A 1SQKA 3E9PA 1LCUA 1NGJA 1NGCA 4A2BA 1KD1O 4QS8A 3EN9A 1KQSM 3GBTA 3TTCA 3MWTA 1YITN 4NO7A 3KK7A 4XEIA 2QTDA 1U2VA 4YOWA 2P9LA 2WFBA 4O5FA 3C6HA 4U7BA 2HF4A 3VEZA 4BRNA 5GADP 2IVNA 1MDUB 1IG8A 3FZHA 1W97L 4A59A 1MA9B 4BGBA 4CZGA 4AF1A 5BRHA 1S72N 3H1VX 1R59O 3VERA 1M1KO 2YHYA 5M1OA 5AFUA 3I8BA 4BC4A 4MLEA 3AGKA 4IZ9A 4K25A 1SZ2A 1T3VA 2QW9A 3AY9A 2J4RA 3QDKA 2ITMA 1BO5O 5BN9A 2IVOA 4GVEA 4WCEL 1CZAN 2JWKA 3SBGA 1QVGM 1ZBSA 3EE9A 4WQ4A 2IVPA 5AQHA 1GLJO 3PLAA 4IO8A 2PAVA 3QB0A 4B1ZA 2NRRA 4JD2B 3ENOA 2FF6A 3BEXA 5DM7L 1QZ6A 1TUUA 3VOVA 2NRVA 2GEMA 1RFQA 2ASOA 3OBWA 4PKHA 2QI2A 3KWIA 5H1SQ 3M6GA 1U2VB 4BQLA 4IDHA 1O13A 2P9LB 2RHKA 2F9TA 1T6CA 4CZEA 4Y0WA 2E2NA 4CZLA 3CJBA 3HRGA 1V4SA 2UYTA 3C7NA 3ATVA 2QWOA 3ENBA 3CMEN 4FWKA 5BN8A 3M1FA 3RSEA 3WXLA 2Q2RA 3WXMB 5EXWA 4A2AA 3SAFA 4BRCA 3VENA 3ZX3A 3OHRA 3SJHA 3PIOL 2Q1NA 1YI2N 3D2FA 2ASMA 3FZMA 4A57A 2GUPA 3LM2A 3J7ZO 2FLOA 3SBTA 3TSPA 4CI6A 5JLFA 3GL1A 5E84A 1YJ9N 2YHWA 3FFKB 3SAHA 4H5WA 3U4LA 2E2OA 5KQ8A 5CR4A 2GWJA 1RDWX 3IMXA 4BRLA 2GELA 3MDQA 2A5XA 4IJNA 3CI5A 5AQQA 4MLHA 2P9SA 5MLCQ 4BC3A 3C7NB 1EO1A 2YX6A 3F9MA 2YCHA 3VTIA 3CPEA 3DXMA 3W0LA 4QS7A 3KHYA 4BR2A 3BF1A 3RSEB 3AAPA 3ULEA 1C0GA 2CH6A 3A5MC 5AQFA 5ADXH 3LDLA 3VEVA 3D2FB 4CZFA 3UE5A 3VGKA 4BC5A 3CF5L 4BRGA 1YVNA 3E9LA 3ZX2A 3A5LC 1JCFA 2P9PA 3WT0A 5LJVA 3CC7N 3O4WA 4JKDA 4EHUA 5M1FA 2FSKA 4CBWA 3J8AA 2EWSA 3WEEA 2CH5A 5TKWA 3CC2N 1H1VA 3R9PA 2HBLA 2GTDA 2OANA 4H0PA 4BREA 3A0IX 3P4IA 1BDGA 3HTVA 3L4QA 3OA9A 1DGKN 2WUSA 3M5RA 2AP1A 3CIPA 2P9SB 2ASPA 3OBYA 1U6ZA 4K43A 5EVZA 4BR7A 3O6WA 2ZJQL 1C0FA 1E4GT 4B1WB 1VQ6N 3P39A 1W2BM 5E26A 4OO1J 5FPMA 3C6AA 3GE1A 4EAHD 5BRFA 2HBMA 3DXMB 5KPZA 3ULEB 4BR4A 2FSNA 2FXUA 3HZ6A 3CHWA 2A42A 4IOXA 3O1BA 3LDQA 3NVMA 3EL2A 4WFBL 1YJWN 4CZIA 3UKUA 1NBWA 2P9PB 5AQOA 4XH5A 2HBKA 1J6ZA 4CZMA 1NWKA 4PKGA 5HL7L 3WEEB 1NGFA 3VF4A 3R6MA 3CJAA 5TKYA 3CCRN 1GLBG 4JKHA 1NLVA 3LDOA 4C1NK 1VQKN 3O80A 4A5AA 4M63C 1X3NA 2NRZA 4H5TA 2KLAA 4FL9A 4H5NA 4JN4A 3MN7A 5EX5A 5AQJA 2VGMA 3MX2A 3U8XA 1HUXA 3A5NC 1VQ9N 1TYQA 4YOTA 4O8KA 3CJ9A 2HOEA 3SLCA 4FPAA 5JVHL 3L6QA 3U9DA 2FF3B 5BPMA 3JS6A 4FWRA 5CE3A 4BRHA 4BRKA 3C0BA 3O9TA 5EOYA 5BRDA 1GLDG 5AQKA 3MN5A 1VQ7N 3GDQA 2E2QA 2YHXA 3UKUB 3FZKA 1N8RO 2V7ZA 5C0YA 1LOTB 4L3QA 1X9JA 3C65A 1NM1A 3VF6A 3FE1A 1NGBA 3F2KA 3GG4A 3MCPA 3ZYYX 1NGHA 1T44A 4JKBA 4G9ZA 3L4IA 2OTLN 1QVFM 4H0YB 2QWLA 3LDPA 2AA4A 2VCPA 4JEPA 3CCJN 2V51B 3D2EA 4JK8A 4IO9L 4BRMA 4ISFA 2I7PA 4A62A 2GX9A 3VGLA 4C1NI 4CZJA 4LC9B 5LY3A 1TYQB 1XC3A 4FVUA 4MO4A 1TUYA 3OW2M 4BGAA 3PIPL 3D6RA 3N4QA 4EHTA 3QICA 1ATRA 1VQ8N 2NZTA 4EFHA 1BWFO 3B8AX 5AR0A 2Q36A 3T69A 3CCQN 5F2RA 1K73O 3ZEUA 4WFNL 3A5OC 2YJEA 3A8YA 2NLXA 5AQVA 2OTJN 2YJFA 4PHTX 1KAYA 3EKSA 1HX1A 4BRAA 1HKCA 3DWLA 3UB5A 3D2EB 4A5BA 2HSTA 2D1KA 4JKEA 1IJJA 5FPDA 3MCAB 3WXIA 3CCLN 3H6EA 4WF9L 3CC4N 1Q7YO 4CZHA 4KH6A 4CD3A 3LL3A 1MWKA 3NVKA 4BG9A 4H0XB 2E1YA 3SMPA 3HSCA 1YIJN 4H5VA 1ILYA 4JHDA 3VEWA 4JKFA 3P31A 2ZGZA 4RWTA 1RDUA 1XUPO 3DXKA 4HWIA 4BRDA 4BR5A 1RGIA 3ZEUB 1DKGD 1YXQA 3NMUA 3FGUA 1JJ2M 3WQTA 4GV6A 1VQNN 1YF5L 4J8FA 1G99A 2P9NA 4PL7A 2P9KA 1YHQN 5KQDA 5C10A 2QM1A 5AFUH 1D4XA 3O8MA 4ILHA 2RE2A 4FPBA 1Z05A 3GOIA 4WQ5C 4B1YB 4BVOA 5BPNA 4M7YA 5JMVA 4JKGA 1ZC6A 5CHIA 4OPHA 4MDAA 4BG8A 4H0VB 3QFUA 3CCMN 1JCEA 2NRWA 5KPTA 3CXCM 1HLUA 3CMAN 4NLCA 4JKAA 3S41A 2E1ZA 5AQSA 1ESVA 4FWPA 1KXPA 2KKZA 4U67L 4JHDB 4IOCL 1X3MA 3F5TA 5AQLA 3KZBA 4YDUC 3DXKB 5EY4A 3LM9A 2BTFA 3O9QA 4BY9C 3DJCA 3QFPA 2VYPA 2P9IA 5C12A 3G71N 1SAZA 3EE8A 4HTLA 5M1PA 4BR0A 1K9MO 5DM6L 2Q0RA 3DLLL 3FLCO 3MX5A 3ID6A 3MN9A 1NGAA 3O9SA 2P9NB 2ZGYA 2P9KB 4FSVA 5BPLA 4BR9A 4NLBA 3DAWA 1BU6O 5AQIA 3TSUA 1KC8O 5M1QA 2ZWHA 3IFRA 2NRHA 1WUAA 1YJNN 3VPZA 3IUCA 3ENHA 5GINA 3VMFB 4RCHA 2FSJA 4JKGB 5F0XA 4UY8O 4FWOA 4DB3A 1VQLN 2W41A 3H3NO 3MK6A 4XH1A 2QWPA 4IEIA 3M3ZA 3MN6A 4EIAA 1HJOA 5B8HA 2IIRA 2QWQA 4PL8A 3EZWA 1VQON 3QBWA 3KWGA 2W40A 5GAGP 4A61A 3MWPA 2QA4N 3H46O 3VESA 5BR9A 2QWNA 2P9IB 1Y64A 1KAZA 5GIPA 4RTFD 1GLLO 2CGKA 2YI1A 4B1XB 4JK7A 4CBXA 4F9OA 3BUZB 5AQNA 5F1XA 1BG3A 4YOUA 2A6AA 3HI0A 4FO0A 5GAEP 4DCHA 2JWLA 3VEXA 3ATUA 2PFUA 5AQYA 3O5BA 1NGIA 1MWMA 1WOQA 4GY2B 2E88A 4CD1A 1T6DA 3SK3A 4DHYA 3VEOA 3G6EN 4NB4A 4GV9A 3ID8A 2CGJA 4JAXA 5M1KA 2QEXN 4H0TB 4JKCA 3CPWM 3QBXA 3CJ1A 4IFEA 5AQGA 1YUWA 2D0PA 3I56N 5JVGL 5GAHP 3O9RA 3CETA 1Q82O 1YAGA 5ADXA 4B1UB 3I55N 3BF3A 5GIOA 4KH4A 1QHAA 5AQZA 3CCEN 4CBUA 4OPAA 4DKWA 3Q7BA 4BQZA 4IOAL 3D7EO 3CQYA 4H5RA 3N4PA 4BRFA 5JICA 1NJIO 2Q0UA 4B9QA 1NGGA 1Z6RA 4IJAA 3H45C 2F7TA 4MDBA 4B1VA 4YOXA 2E2PA 1EQYA 3SAGA 2Q31A 3AARA 2WC9A 2QWRA 3WXJA 2D0OA 5HOOA 3FR0A 3L0QA 3P38A 3WXKA 1VQPN 3JXUA 4H03B 4YOVA 2VGNA 3ZETA 5JLHA 1ATSA 3CJ7A 4BROA 1NGDA 4FOIA 4AM7A 2H3GX 3QMLA 4K42A 4DQ8A 3HOSA 3FZLA 1QQMA 4FWSA 4WQ4C 2WBNA 3VGMA 3K9KA 4IXCA 1V4TA 1K8KA 5C2FA 4BRPA 3CD6N 3AGRA 3I33A 1P90A 4ILJA 2HBJA 5C15A 1S3XA 2A3ZA 3IKMA 4ILGB 5AZIA 3U9ZA 4BVPA 4BRIA 2CGLA 1SS6A 4KH5A 4WQ5A 5AZJA 3IDHA 4C23A 3VF2A 4FWLA 4R79A 3TPQA 1DT9A 3WUHA 2BUPA 1QQNA 4ISGA 5FPEA 3W3DA 3TTFA 4GNIA 4CZKA 2ZJRL 3ZETB 3CCUN 2NNWA 2A40A 5AQXA 1GLEG 3LDNA 4YDUA 1ZXOA 3T7ZA 3H1QA 3EKUA 2V7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R O;  3CME N;  4UY8 O;  3PIO L;  1VQL N;  1YI2 N;  2OTL N;  1QVF M;  3J7Z O;  1Q81 O;  1VQO N;  3CCJ N;  4IO9 L;  5GAG P;  1K8A O;  2QA4 N;  1YJ9 N;  1Q86 O;  3OW2 M;  3PIP L;  4WFA L;  1VQ8 N;  5GAE P;  5MLC Q;  3CCQ N;  1VQ5 N;  1K73 O;  1VQM N;  4WFN L;  3CCS N;  3G6E N;  2OTJ N;  2QEX N;  3CF5 L;  1M90 O;  3CPW M;  1VQ4 N;  2ZJP L;  3CCV N;  3I56 N;  5JVG L;  5GAH P;  3G4S N;  1Q82 O;  3CC7 N;  3I55 N;  1OVY A;  3CCE N;  3CCL N;  3CC2 N;  4IOA L;  4WF9 L;  3CC4 N;  1Q7Y O;  1NJI O;  1YIJ N;  1ILY A;  2ZJQ L;  1KD1 O;  1VQ6 N;  1W2B M;  1KQS M;  1YIT N;  1VQP N;  1JJ2 M;  1VQN N;  1YHQ N;  4WFB L;  5GAD P;  1YJW N;  1M1K O;  1S72 N;  3CD6 N;  5HL7 L;  3CCM N;  3CMA N;  3CXC M;  3CCR N;  4WCE L;  1VQK N;  1QVG M;  4U67 L;  4IOC L;  1VQ9 N;  5DM7 L;  3G71 N;  5JVH L;  5H1S Q;  1K9M O;  5DM6 L;  2ZJR L;  3DLL L;  3CCU N;  1KC8 O;  1VQ7 N;  1YJN N; 
#chains in the Genus database with same CATH topology
 2D4W A;  2VWB A;  3NE6 A;  5ELZ A;  5FPN A;  1ASW A;  3CER A;  4AH9 A;  3T1H K;  2NUB A;  4FXD A;  1K8K B;  2O8B B;  3H3O B;  4F4K A;  2B6A A;  5AZI B;  4CVN E;  3TU5 A;  2FC0 A;  1GLC G;  3BY5 A;  4M7X A;  1ASU A;  1K8A O;  3KKS A;  3MXM A;  1Q86 O;  3RRH A;  4BRQ A;  4WYB A;  3ASM A;  3CJC A;  4WFA L;  2WOM A;  5J2N A;  4DFK A;  3VTH A;  4I6M A;  3O1W A;  1RBS A;  4CEQ A;  4OKE A;  5AQU A;  4CIG A;  1NK6 A;  1HPM A;  4CFD A;  3KIO A;  4HVJ A;  4JS4 A;  3RMA A;  5FRN A;  3MEC A;  1QZ5 A;  2QKB A;  3CCV N;  2QXL A;  4HUG A;  1D8Y A;  1IV0 A;  5K14 A;  1NMD A;  2KHO A;  2F8T A;  4FJL A;  2X6S A;  1OVY A;  1RTD A;  2UXB K;  1HKB A;  5AQM A;  1E4F T;  4I9L A;  5LL6 Z;  3THX A;  4CF8 A;  2E5L K;  2I7N A;  1KSP A;  4W5R A;  4I6M B;  1P8Z A;  1XMO K;  1SQK A;  3E9P A;  1NGJ A;  4A2B A;  1VSF A;  4M45 A;  3EN9 A;  3MWT A;  1BGX T;  4NO7 A;  4KRF A;  3KK7 A;  4E1M A;  1U2V A;  3QIP A;  3VEZ A;  2IVN A;  4NXN K;  1HMV A;  1K6Y A;  3FZH A;  2GV9 A;  4FLZ A;  4AF1 A;  3QIN A;  3P5J A;  5DK5 A;  1ZBI A;  4BC4 A;  3AGK A;  1SZ2 A;  1T3V A;  1VRT A;  2ITM A;  3SZ2 A;  1BO5 O;  3K58 A;  4HHT A;  2IVO A;  4GVE A;  1L3U A;  3DMJ A;  3THX B;  3FFI A;  4C8N A;  5AQH A;  4JI7 K;  4IO8 A;  1OH7 A;  3DI6 A;  4LF7 K;  4B1Z A;  3JAM O;  2NRR A;  3ENO A;  3BEX A;  5DM7 L;  4FJI A;  4CIF A;  1L3S A;  2GEM A;  1RFQ A;  2ASO A;  3KWI A;  3KJV A;  4FJ9 A;  3M6G A;  1U2V B;  4IDH A;  1O13 A;  2RHK A;  2RN2 A;  4CZE A;  4DQR A;  4CZL A;  1RT5 A;  3HPH A;  4DSE A;  1V4S A;  3CM5 A;  3TR8 A;  1SL2 A;  3KLH A;  3ZSW A;  2X78 A;  3SAF A;  5HRP A;  3PIO L;  1JLF A;  3OHR A;  3SV3 A;  3D2F A;  2ASM A;  3FZM A;  2IDO A;  2FBY A;  3J7Z O;  4MQ3 A;  3WNE A;  1X9S A;  5JLF A;  1LWC A;  2XY5 A;  3S9H A;  1VSI A;  3CFP A;  4H5W A;  4W5N A;  4CFC A;  2GEL A;  4LH4 A;  3MDQ A;  3DOL A;  4JI5 K;  1A5W A;  1HYZ A;  2P9S A;  3SQ2 A;  2DFH A;  1EO1 A;  3VTI A;  4BR2 A;  4K0K K;  1XI1 A;  2CH6 A;  3U6F A;  5ADX H;  3NGY A;  2G8I A;  3VEV A;  3D2F B;  4CZF A;  2YNG A;  4BRG A;  1RT7 A;  3E9L A;  1JCF A;  1WLJ A;  5LJV A;  5M1F A;  4JKD A;  4EHU A;  1S5J A;  3WEE A;  1H1V A;  4DTX A;  2HBL A;  3KLE A;  4BRE A;  4CHY A;  3OYH A;  3L2R A;  4EZ6 A;  1WSE A;  1DGK N;  2WUS A;  1NJX A;  2P9S B;  3CG7 A;  1U6Z A;  3O6W A;  3EY1 A;  4EAH D;  2HBM A;  2KZM A;  3CHW A;  4LFB K;  3LDQ A;  1X1P A;  1YJW N;  1S1X A;  4ID5 A;  4AHU A;  4RW4 A;  1NWK A;  2WTU A;  4Z4E A;  1N5Y A;  3WEE B;  3CJA A;  4DTR A;  4LSL A;  2GUI A;  4A5A A;  4J2D A;  4H5T A;  3MN7 A;  2D0A A;  1TYQ A;  4BWJ A;  4YOT A;  1VSJ A;  1XNQ K;  3LAN A;  3SUN A;  4FPA A;  3EEQ A;  1VRU A;  2FF3 B;  5BPM A;  4CFB A;  4X62 K;  4DV3 K;  3IRX A;  2O8D A;  3DM2 A;  4BRK A;  1T05 A;  1IKY A;  4PY5 A;  4M3T A;  2V7Z A;  4L3Q A;  1X9J A;  3ZLJ A;  4FLY A;  3FE1 A;  3GG4 A;  3F2K A;  3MCP A;  4I2P A;  2HNY A;  1QVF M;  3LDP A;  3OVN A;  4CJR A;  4OLB A;  2V51 B;  3THV A;  4A62 A;  2GX9 A;  4DR4 K;  5LY3 A;  4FVU A;  1TYQ B;  2XY7 A;  4M3Y A;  4MO4 A;  3SUO A;  2ZQB A;  3QIC A;  2O8D B;  1VQ8 N;  3OYG A;  2W6K A;  2Q36 A;  3T69 A;  1K73 O;  3ZEU A;  4CED A;  5IWA K;  3HXM A;  3A8Y A;  4O5B A;  3QLH A;  2YJF A;  4M42 A;  5CYM A;  1WSI A;  1HJR A;  1LAW A;  3I0S A;  2D1K A;  3CQ8 A;  4OJR A;  4KTQ A;  5FPD A;  2F4V K;  4WF9 L;  3AO2 A;  1MWK A;  3NVK A;  1YIJ N;  5I42 A;  2G8V A;  3RTV A;  1XUP O;  4HWI A;  4BRD A;  4BR5 A;  1RGI A;  3ZEU B;  3FGU A;  2Z1I A;  5JS2 A;  3DLG A;  3NHG A;  1D4X A;  4CW7 B;  3O8M A;  1ZYQ A;  3JSM A;  1RBT A;  2F8S A;  1BCM A;  3GOI A;  4DU4 A;  4B1Y B;  5JMV A;  5CHI A;  1KVA A;  2HHV A;  3AVN A;  3LAL A;  1Z25 A;  4OPH A;  2YNF A;  3CXC M;  4DG1 A;  3OJS A;  3KLF A;  4NLC A;  1N6Q A;  4JKA A;  4M3X A;  2E1Z A;  1ESV A;  5LMN K;  3VQ7 A;  1SV5 A;  1KXP A;  4U67 L;  1W9H A;  1X3M A;  2PYL A;  3F5T A;  3LZJ A;  5EY4 A;  3SNN A;  3O9Q A;  3JYT A;  1SL0 A;  1SAZ A;  3ZSQ A;  5DM6 L;  3DLL L;  1XHX A;  1C1B A;  4FCY A;  3MN9 A;  3O9S A;  3J7A P;  4BR9 A;  3VQA A;  1BCO A;  3TSU A;  2RF2 A;  1TKZ A;  4FK4 A;  3NF6 A;  4DTU A;  3NAE A;  2ZWH A;  3H08 A;  3IFR A;  3SCX A;  2P51 A;  1YJN N;  1HPZ A;  4DB3 A;  1VQL N;  3V9W A;  4LFC K;  3TAM A;  4EIA A;  3ZSY A;  4B8A B;  2IIR A;  3PSI A;  5I3U A;  3AVG A;  1LWE A;  2KZZ A;  3KLI A;  2W40 A;  1QSL A;  4A61 A;  4IG3 A;  5BR9 A;  3CYM A;  5GIP A;  2CGK A;  2YI1 A;  4B1X B;  1U04 A;  4KHP K;  3G10 A;  1U4B A;  2VWJ A;  4Z4G A;  2PFU A;  3M8P A;  2E88 A;  4XIU A;  4FJ5 A;  3OYC A;  1CXU A;  4DHY A;  3VEO A;  3G6E N;  4NB4 A;  4GV9 A;  3ID8 A;  4JKC A;  3CPW M;  3DRP A;  3O9R A;  4N56 A;  4KHQ A;  1VK0 A;  1VSL A;  4KH4 A;  4Z4I A;  5AQZ A;  4CBU A;  4DKW A;  3N4P A;  3TAE A;  1NGG A;  1Z6R A;  4B1V A;  5A2Q O;  1EQY A;  4CES A;  2WC9 A;  4KV8 A;  3HO1 A;  3WXK A;  4GVM A;  4RW9 A;  1VQP N;  4YOV A;  2OPQ A;  1U48 A;  1B9F A;  4K42 A;  2ETJ A;  1U45 A;  3HOS A;  3FZL A;  1QQM A;  2R7Y A;  3DYA A;  3PV8 A;  2WBN A;  3VGM A;  4JI8 K;  1JXE A;  5C2F A;  4JV5 K;  2D5R A;  1QTM A;  4J2B A;  3HVT A;  4ILG B;  1ZBF A;  2CGL A;  4KH5 A;  1NJZ A;  2G8U A;  3IDH A;  4GKK K;  3TPQ A;  1X9M A;  1TAQ A;  3F73 A;  1TL3 A;  4LF9 K;  4B9V A;  2JGU A;  4DU1 A;  1QQN A;  3IS9 A;  4ELV A;  3W3D A;  3VA0 A;  1TAU A;  3LAM A;  1SKW A;  4KB0 A;  1GLE G;  1RT1 A;  4AHV A;  4KI4 A;  1ZXO A;  3T7Z A;  3ZT4 A;  3DLB A;  3LDS A;  4DLE A;  4CER A;  2V7Y A;  3DLH A;  1W7A A;  3EYZ A;  1NJY A;  1S6P A;  4HCC A;  4FWN A;  2B4J A;  1QS4 A;  2GWK A;  2E8A A;  1HNZ K;  3VEY A;  5SWM A;  3CQX A;  2HMP A;  3M8R A;  4LFA K;  1NGE A;  4FOE A;  4JK9 A;  2F9W A;  4Z94 A;  3SMS A;  3DLR A;  1VAZ A;  2DPN A;  3BZK A;  3MMV A;  4DQS A;  4FM0 A;  3TAR A;  2PBD A;  2ZM6 K;  4NCB A;  2A41 A;  3PUF A;  3OYM A;  1EET A;  3QIO A;  4FLV A;  4CHP A;  2BAN A;  2IAJ A;  4JYA K;  2G8W A;  1EWR A;  4PKI A;  4E89 A;  3ISN C;  3HP6 A;  1VQ5 N;  2HHU A;  1VQM N;  4E7J A;  1N32 K;  1NKE A;  3CCS N;  2IC3 A;  3AAQ A;  5KI6 A;  1BA0 A;  4CHQ A;  4KHU A;  3AO5 A;  4CJ7 A;  1M90 O;  4IBN A;  1VQ4 N;  2ZJP L;  4RW6 A;  2ZD1 A;  2XHB A;  1I39 A;  3K5L A;  2VG5 A;  2PYJ A;  1I94 K;  5M1N A;  4FWM A;  2BE2 A;  2HHQ A;  1Q18 A;  1L5U A;  2QKK A;  3K9J A;  1HKG A;  4BDP A;  2NRT A;  5BRE A;  1T8E A;  1D5A A;  3OYA A;  3GBT A;  2OYQ A;  3V1Q A;  2P9L A;  1T03 A;  1HQE A;  2GBZ A;  2HF4 A;  4IFV A;  4AHT A;  4BRN A;  5GAD P;  2KW4 A;  4A59 A;  4CZG A;  1M1K O;  3H1V X;  1R59 O;  3HP9 A;  4DSJ A;  4DQI A;  2DY4 A;  1EX4 A;  4K25 A;  1FJG K;  3L2W A;  4C8M A;  3OTO K;  1J5O A;  3AVJ A;  1CZA N;  4KRE A;  3PLA A;  3HST B;  2A1S A;  1UWB A;  4C8O A;  2FF6 A;  4CF0 A;  3OYL A;  1QZ6 A;  1QQC A;  1TUU A;  4PKH A;  3OBW A;  1HRH A;  2QI2 A;  5H1S Q;  4IDK A;  2P9L B;  1NK9 A;  1T6C A;  3CJB A;  3AO4 A;  4DU3 A;  1DTQ A;  3PSF A;  4JLH A;  1C1A A;  2UYT A;  3C7N A;  1Q8I A;  3ATV A;  2QWO A;  2BGG A;  1ITG A;  3DLE A;  3WXL A;  5EXW A;  3QEW A;  1L3T A;  4CJQ A;  3AA4 A;  4A57 A;  3LM2 A;  3THY A;  2FLO A;  3TSP A;  4CEA A;  3QET A;  3E01 A;  3SJJ A;  3GL1 A;  4OX9 K;  2Z1G A;  3DLK A;  4GKJ K;  2YHW A;  3SAH A;  2E2O A;  4B3O A;  4BRL A;  4YHH K;  4CJP A;  1NNE A;  2X74 A;  5MLC Q;  4BC3 A;  3C7N B;  1HR0 K;  3F9M A;  3VN5 A;  3TAP A;  3DXM A;  2O8F A;  4QS7 A;  3AAP A;  3ULE A;  3V1R A;  4CE9 A;  3VGK A;  3O3G A;  3THY B;  1FW6 A;  3M8Q A;  2OPP A;  4AHC A;  3OYI A;  2HHX A;  2P9P A;  3CC7 N;  4CJK A;  4FJJ A;  3J8A A;  4KTZ A;  3O4Q A;  3AVL A;  2CH5 A;  5TKW A;  5FRO A;  4CJF A;  3J80 O;  4H0P A;  2GTD A;  2IS3 A;  3LP1 A;  3MXJ A;  1BDG A;  5AQF A;  3BGR A;  1Z26 A;  2ASP A;  2ZJQ L;  3SV4 A;  1C0F A;  3P39 A;  5E26 A;  5FPM A;  3C6A A;  3DXM B;  2W42 A;  2O8F B;  5KPZ A;  3ULE B;  2FSN A;  4X64 K;  4QOZ B;  2UUC K;  4JI6 K;  4IOX A;  4O55 A;  3EL2 A;  4BDY A;  1KVB A;  5HRS A;  4KHN A;  2P9P B;  3C6T A;  2HBK A;  1J6Z A;  4NYN A;  4CZM A;  3QEP A;  1G15 A;  5HL7 L;  4FK2 A;  1S1U A;  3CCR N;  4FJN A;  3LWL A;  3LDO A;  4C1N K;  4BWM A;  3CFR A;  1VQK N;  4M63 C;  5EX5 A;  4DSI A;  3BDP A;  5AQJ A;  3A5N C;  2XO7 A;  2HHH K;  4B9N A;  3SLC A;  2HOE A;  5JVH L;  3MXI A;  3U9D A;  2PZS A;  5CE3 A;  3QEV A;  4FZX C;  5BRD A;  5AQK A;  2A1R A;  4EP4 A;  2HHS A;  1N8R O;  5C0Y A;  3PX0 A;  1BHL A;  1LOT B;  4DV0 K;  4G9Z A;  3AA2 A;  3AA3 A;  1RCH A;  1S1W A;  4FZY A;  4H0Y B;  5C25 A;  3OYE A;  3ZT0 A;  3CCJ N;  1B9D A;  1RIL A;  1YT3 A;  3AVF A;  4LC9 B;  1C6V A;  1XC3 A;  3V4I A;  1RTH A;  3LP2 A;  5JS1 A;  1TUY A;  2EX3 A;  3OW2 M;  3WNF A;  4DMN A;  2HW3 A;  3D6R A;  2XRI A;  4KAZ A;  4E7H A;  4KTW A;  4JRQ A;  3KK3 A;  5HRR A;  1BWF O;  3NH2 A;  3B8A X;  2JLE A;  4N5S A;  1R0A A;  3CCQ N;  5F2R A;  4DV1 K;  2OZS A;  1KAY A;  1TVR A;  3AA5 X;  4NCA A;  1LW0 A;  3UB5 A;  4W5T A;  4CF2 A;  4FLX A;  2HST A;  3EZ5 A;  3PO5 A;  5HBM A;  3CCL N;  3RR7 A;  4CZH A;  4JRP A;  4CD3 A;  2QXF A;  4H0X B;  3HSC A;  1ILY A;  4TSX A;  1NK7 A;  4RWT A;  1YVU A;  3DXK A;  3OYD A;  4AQY K;  3I8D A;  1YXQ A;  4DS4 A;  1YF5 L;  1G99 A;  4PL7 A;  4ZHR A;  1TKT A;  4ILH A;  4FPB A;  3PX4 A;  4WQ5 C;  5BPN A;  1IO2 A;  1ZC6 A;  4H4O A;  1RDD A;  1T7P A;  4H0V B;  1WBB A;  3UIQ A;  5KPT A;  3V6D A;  1HLU A;  1NK8 A;  3C6U A;  3S3N A;  4LF8 K;  2I5J A;  3DXK B;  3G71 N;  2P9I A;  2WON A;  5CZ2 A;  3EE8 A;  4HTL A;  4BR0 A;  3KLG A;  2Q0R A;  4E1N A;  3FLC O;  1RDB A;  3B6O A;  4FSV A;  1UA0 A;  2DTU A;  4FZZ A;  5M1Q A;  1GOA A;  4GMJ B;  4H8K A;  3AO3 A;  4RCH A;  2FSJ A;  4UY8 O;  3QES A;  3HM9 A;  2P5G A;  4AHR A;  4J2A A;  3M3Z A;  1IKV A;  4PL8 A;  1WN7 A;  4DTN A;  2OCE A;  4G1Q A;  5FDL A;  2QA4 N;  3MWP A;  2OA8 A;  3H46 O;  2P9I B;  1Y64 A;  4FW1 A;  1BG3 A;  3IG1 A;  1SKR A;  1Q9Y A;  3ATU A;  5AQY A;  4BE0 A;  3O5B A;  1NGI A;  3HK2 A;  3B6P A;  5SZT A;  3QEX A;  4Y1C A;  4Z0U A;  2CGJ A;  4E3S A;  4JAX A;  2QEX N;  3K2P A;  4H0T B;  3I56 N;  4LD0 A;  4FLU A;  3CET A;  2XY8 A;  5T7B A;  2ATQ A;  3BF3 A;  3LPU A;  1QHA A;  5KGX A;  3Q7B A;  4BQZ A;  3LWM A;  4ICL A;  4H5R A;  5JIC A;  4MDB A;  4IJA A;  3H45 C;  1IG9 A;  3SAG A;  2Q31 A;  5HLF A;  4Y1D A;  2D0O A;  3L0Q A;  4B3T K;  2D0B A;  3JXU A;  2KQ2 A;  3ZET A;  1ATS A;  3CJ7 A;  3SUP A;  2VG7 A;  1NGD A;  4AM7 A;  4JI0 K;  2H3G X;  4AHS A;  2B5J A;  4DQP A;  1U49 A;  3AVB A;  4YFU A;  1JXB A;  3AGR A;  1XWL A;  3K5M A;  1NK0 A;  1S3X A;  2A3Z A;  4CGH A;  3IKM A;  3U9Z A;  3OYK A;  1KLM A;  4WQ5 A;  5AZJ A;  4KHS A;  2QK9 A;  4FWL A;  1WSG A;  4DR6 K;  1DT9 A;  1RTI A;  3WUH A;  4HUF A;  2BUP A;  4ISG A;  4FJ7 A;  4GNI A;  1HYV A;  4CZK A;  3ZET B;  4CEB A;  2A40 A;  4K8X A;  4X65 K;  1VSH A;  2ZE2 A;  2OPR A;  1N36 K;  3ALY A;  1EWQ A;  3TTD A;  4CCH A;  3KVG A;  1FKP A;  3VQ8 A;  1JLQ A;  1JLA A;  1CZ9 A;  5AZJ B;  3U3Y A;  3OJU A;  1JLB A;  4DV4 K;  5AJ3 K;  5AQP A;  1HNV A;  1IBM K;  1J9A A;  1GLA G;  4KBO A;  4YOR A;  4KHY A;  1JLG A;  2P9U A;  3G25 A;  3LP3 A;  3V1O A;  2OPS A;  3ZX0 A;  1QQO A;  3HOT A;  4IWV A;  2V52 B;  4JI1 K;  4IEE A;  4QCL A;  1RNH A;  4YNQ A;  1XQS C;  1S22 A;  3HBT A;  5KRT A;  2BH1 A;  5I9E B;  5J2Q A;  2E20 A;  3RMD A;  4F8R A;  1JL2 A;  4DR1 K;  1WNS A;  4XH4 A;  1TK5 A;  3WQU A;  5C2D A;  3O08 A;  4WE1 A;  1IBL K;  1QSY A;  4CGD A;  3TAB A;  4LF4 K;  1JCG A;  2ZF5 O;  3E66 A;  3QER A;  2P9U B;  4FWQ A;  4JD2 A;  1LCU A;  1NGC A;  2BDP A;  4QS8 A;  4FLW A;  4F2S A;  1YIT N;  4XEI A;  1GOB A;  3ULD A;  4DTJ A;  4FYD A;  4B3R K;  4U7B A;  3SQ1 A;  3HYF A;  1WSH A;  2OZM A;  1TV6 A;  1MDU B;  1QSS A;  2G8H A;  1MA9 B;  4BGB A;  3AVK A;  4RW7 A;  3VER A;  1S72 N;  4M41 A;  2YHY A;  3NGZ A;  2O8C A;  4MLE A;  3QDK A;  2QW9 A;  1ZBL A;  5BN9 A;  4CEC A;  4WCE L;  3SBG A;  1QVG M;  1ZBS A;  2IVP A;  3QB0 A;  4JD2 B;  1UOC A;  1TGO A;  3VOV A;  1LAV A;  4BQL A;  1FKO A;  3HVR A;  4CK1 A;  2E2N A;  3TAG A;  1XC9 A;  1NK5 A;  3HRG A;  1RBR A;  2FBT A;  4KB1 A;  3ENB A;  4FWK A;  3D45 A;  3M1F A;  1VSE A;  1NK4 A;  3WXM B;  4A2A A;  2O8C B;  4BRC A;  3VEN A;  2Q1N A;  3T1A A;  4F3T A;  3SBT A;  3NF9 A;  3T19 A;  5E84 A;  1YJ9 N;  3OY9 A;  3ZT2 A;  5BR8 K;  4DSK A;  4N76 A;  3KK2 A;  2A5X A;  4IJN A;  3WNH A;  3CI5 A;  5AQQ A;  1S6Q A;  4DUZ K;  2YX6 A;  3CPE A;  1LWF A;  3VQ5 A;  3KHY A;  5HRO A;  1C0G A;  3PY8 A;  1FK9 A;  3A5M C;  3TAQ A;  2KFZ A;  3LDL A;  1IBK K;  3UE5 A;  1WAF A;  4L8R B;  2VWK A;  3A5L C;  2FSK A;  4CBW A;  4KI6 A;  3CC2 N;  4OGE A;  3R9P A;  2OAN A;  4M3R A;  2AP1 A;  3CIP A;  4BR7 A;  4K43 A;  4CJS A;  2FBX A;  1E4G T;  3RMB A;  4OO1 J;  3GE1 A;  3TAF A;  4FK0 A;  1BI4 A;  2FXU A;  4Z4H A;  1QE1 A;  3D0P A;  3VQP A;  4C8L A;  4NCG A;  3QNN A;  4CGF A;  3NVM A;  4OLA A;  4CZI A;  3HL8 A;  1TKD A;  3UKU A;  1NBW A;  5AQO A;  3LPT A;  4XH5 A;  1NOZ A;  3AO1 A;  4PKG A;  1XHZ A;  1NGF A;  3VF4 A;  3R6M A;  5TKY A;  1GLB G;  4JKH A;  1NLV A;  4FJH A;  4MFB A;  2DFE A;  1X3N A;  2NRZ A;  2KLA A;  4OPK A;  1VQ9 N;  1HUX A;  4DTS A;  4O8K A;  3CJ9 A;  1NOY A;  3L6Q A;  4QAG A;  3JS6 A;  1BIS A;  1BI4 B;  4E7I A;  2Z1J A;  3ZT1 A;  4B9U A;  1NU0 A;  3ZSR A;  5EOY A;  1GLD G;  1BIU A;  3MN5 A;  2VQF K;  1VQ7 N;  3UKU B;  4LH5 A;  3AVH A;  1NM1 A;  5EU7 A;  4IFY A;  3ZYY X;  1T44 A;  3L4I A;  3CM6 A;  2OTL N;  2QWL A;  2VCP A;  4JEP A;  3L3V A;  4IG0 A;  4IO9 L;  4Z4C A;  4OPJ A;  1OVQ A;  3NF7 A;  1WAJ A;  5CYQ A;  4BRM A;  4CJL A;  4FM2 A;  4C1N I;  3ZSO A;  2HHT A;  4GW6 A;  1NG9 A;  1TL1 A;  4DWI A;  4BGA A;  1HYS A;  3N4Q A;  4B9T A;  3PO4 A;  1ATR A;  2NZT A;  4EFH A;  4CGG A;  4CJT A;  1U47 A;  4O0I A;  3A5O C;  2YJE A;  4OGC A;  2NLX A;  3C94 A;  4PHT X;  3EKS A;  4BRA A;  1HKC A;  3DWL A;  1RDC A;  4CFA A;  1EKE A;  4HTU A;  1IJJ A;  3WXI A;  4I7F A;  3V9S A;  3CC4 N;  4UQG A;  1Q7Y O;  4KH6 A;  1C0T A;  3LL3 A;  3T1Y K;  4H5V A;  4JHD A;  3SQ4 A;  4JKF A;  2ITG A;  3KK1 A;  1RDU A;  1ZBU A;  4Z4F A;  1RBU A;  1VQN N;  2HNZ A;  3THW A;  1OH5 A;  2HVI A;  2P9K A;  2Z1H A;  5KQD A;  5C10 A;  4NXM K;  3BZC A;  3ZSX A;  3SYZ A;  1Z05 A;  3QO9 A;  2HND A;  4MDA A;  4BG8 A;  4I2Q A;  3ZT3 A;  5J1E A;  3CCM N;  1REV A;  2E6L A;  4B08 A;  4YY3 K;  4FWP A;  1IKW A;  4JHD B;  4IOC L;  3AV9 A;  3KZB A;  4YDU C;  3NF8 A;  1N33 K;  3DJC A;  3OYF A;  1WSJ A;  2VYP A;  3HPG A;  4KO0 A;  2HVH A;  4B9S A;  1NGA A;  3THW B;  2ZGY A;  4B9M A;  2P9K B;  5BPL A;  3NH0 A;  4NLB A;  5AQI A;  4CJ4 A;  4DQQ A;  3SPZ A;  1WUA A;  3VPZ A;  1S9E A;  4Q0B A;  4CGI A;  3VMF B;  3O3H A;  4BE1 A;  3K5O A;  4FWO A;  1KLN A;  1XMQ K;  2W41 A;  3MK6 A;  4CIE A;  5HRN A;  1HJO A;  2QWQ A;  1WBD A;  3QBW A;  5GAG P;  3VES A;  5CZ1 A;  1IH7 A;  4BE2 A;  4DSL A;  4RTF D;  4BAC A;  1GLL O;  4ZTJ A;  4JK7 A;  4CBX A;  1EXQ A;  3BUZ B;  5F1X A;  3VQE A;  4X66 K;  3HI0 A;  4FO0 A;  5GAE P;  4DCH A;  1VHX A;  2JWL A;  4FM1 A;  4GY2 B;  1HNX K;  1BQM A;  3LP0 A;  4CEE A;  2O4I A;  1Q9X A;  4IKF A;  4CK3 A;  4O4G A;  3AVI A;  2YNH A;  4IFE A;  2D0P A;  2UXC K;  1YAG A;  4E0D A;  5GIO A;  3F9K A;  1KVC A;  4J2E A;  3ITH A;  3D7E O;  4OKJ A;  3IAY A;  3CQY A;  4B9Q A;  2E2P A;  3WXJ A;  3AAR A;  3P38 A;  3SUQ A;  1OH8 A;  4CJE A;  5KGW A;  5JLH A;  1ZBH A;  4R5P A;  5E41 A;  2Q3S A;  4BRO A;  1RT4 A;  4FOI A;  3QML A;  4O44 A;  1Y97 A;  4EZ9 A;  4CGJ A;  4DQ8 A;  4E7L A;  4OVL A;  4WQ4 C;  1NMN A;  3NH1 A;  3K9K A;  2AJQ A;  4BRP A;  3T3F A;  1FXX A;  4DUY K;  1P90 A;  4ILJ A;  5C15 A;  2YKN A;  4BVP A;  3V81 A;  3MEG A;  3K59 A;  3VF2 A;  4CEO A;  1S1V A;  2RPI A;  3G0Z A;  2IGI A;  4CF9 A;  4DF4 A;  1A5X A;  3CCU N;  3RRG A;  2NNW A;  5AQX A;  4CJ3 A;  4DR3 K;  4FJK A;  3LDN A;  4YDU A;  4FVM A;  3H1Q A;  4M3U A;  2UU9 K;  4CEZ A;  1KFS A;  1RTJ A;  1S1T A;  2HF3 A;  1JL1 A;  1GLF O;  4O8U A;  2FBV A;  1YTU A;  4E1J A;  4DSF A;  4CJW A;  1Q81 O;  3VA3 A;  3RR8 A;  1KRP A;  4RG8 A;  2RKI A;  2XY6 A;  5LJW A;  3HM8 A;  4GV3 A;  3R1X A;  3E1Y A;  3UKR A;  3SI6 A;  1SUQ A;  4K41 A;  1BL3 A;  3FZF A;  1TK0 A;  3A2F A;  4AM6 A;  5AQW A;  3TSQ A;  4B3M K;  1A5V A;  3KKR A;  1BOT O;  4B3S K;  1BA1 A;  3HJF A;  3RVC A;  1KFD A;  3Q7C A;  4I9Q A;  4BC2 A;  4FJ8 A;  4DR7 K;  1BUP A;  3O9U A;  2QWM A;  4JNE A;  1ATN A;  1DEJ A;  2NRX A;  3G4S N;  3J81 O;  3ZCM A;  2YV0 X;  4FJG A;  4M3W A;  4ISE A;  2E6M A;  4H0O A;  4QS9 A;  5DMR A;  3VET A;  5AQR A;  4CJU A;  4FLT A;  3R3L A;  3EO3 A;  3UKR B;  3TAN A;  5KPR A;  3OS0 A;  1KAX A;  2Q97 A;  3R8E A;  1OKJ A;  5AQT A;  1XNR K;  4FJX A;  5C24 A;  4YOY A;  4HUE A;  4MO5 A;  3BP8 A;  3E9O A;  4Q5V A;  4ZTF A;  1NJW A;  1KD1 O;  1KQS M;  4JI2 K;  3TTC A;  5J2P A;  2QTD A;  4YOW A;  3P83 D;  2WFB A;  4O5F A;  3C6H A;  4E7K A;  3L2V A;  2X6N A;  3PX6 A;  4AIL C;  4N47 A;  1IG8 A;  3NCI A;  4PWD A;  4DTM A;  1W97 L;  1CLQ A;  5LMU K;  5BRH A;  5M1O A;  5AFU A;  3I8B A;  4IZ9 A;  2Y1I A;  3AY9 A;  2J4R A;  4KFB A;  3KD5 E;  4W5O A;  2JWK A;  3EE9 A;  4WQ4 A;  1VSD A;  1GLJ O;  3LZI A;  1X9W A;  2PAV A;  3HT3 A;  3WNG A;  2HHW A;  2NRV A;  3S3M A;  1RBV A;  2F9T A;  3VQB A;  4Y0W A;  1NKB A;  4CF1 A;  3TWH A;  3CME N;  5BN8 A;  3RSE A;  2Q2R A;  1SKS A;  4EP5 A;  3ZX3 A;  3SJH A;  1YI2 N;  2GUP A;  2E4L A;  4PQU A;  3DRS A;  3LAK A;  3NDK A;  4CI6 A;  2P5O A;  4DV2 K;  3OYJ A;  5KRS A;  4LF6 K;  3OYB A;  2YHB A;  3FFK B;  1MU2 A;  3U4L A;  4PA1 A;  5KQ8 A;  5CR4 A;  2GWJ A;  1RDW X;  3IMX A;  4DTP A;  4BDZ A;  2KTQ A;  3MED A;  1E3M A;  1RDA A;  4FW2 A;  5IT9 O;  4MLH A;  3K57 A;  3S3O A;  3MEE A;  2YCH A;  3W0L A;  3BF1 A;  3RSE B;  4F3O A;  3KD1 E;  2YNI A;  1D9F A;  4JI3 K;  4BC5 A;  3CF5 L;  1YVN A;  4M3Z A;  3SQ0 A;  1C0M A;  1F21 A;  3ZX2 A;  3QNO A;  3WT0 A;  3O4W A;  2EWS A;  4F2R A;  3OS1 A;  1VSK A;  2Y1J A;  1RT3 A;  1EP4 A;  3VQC A;  4CJV A;  4CEF A;  2PY5 A;  3A0I X;  4B9L A;  3P4I A;  4O0J A;  3HTV A;  3L4Q A;  3OA9 A;  3OBY A;  3M5R A;  5EVZ A;  1I3A A;  4ELT A;  3O4N A;  2VQE K;  4B1W B;  1VQ6 N;  1W2B M;  5BRF A;  3DOK A;  2LSN A;  1B92 A;  4BR4 A;  2P1J A;  3HZ6 A;  1YTA A;  2A42 A;  3O1B A;  1LW2 A;  4WFB L;  1UAX A;  3L2Q A;  3M8S A;  5J2M A;  4JS5 A;  4ID1 A;  2HMI A;  3NBP A;  3O80 A;  3QEI A;  4FL9 A;  4H5N A;  4JN4 A;  3ZSV A;  4V19 S;  2VGM A;  2D0C A;  3MX2 A;  3U8X A;  2YHA A;  3VQ4 A;  4FWR A;  4RW8 A;  4W5Q A;  1TKX A;  4BRH A;  3C0B A;  1W0H A;  3O9T A;  3L8B A;  1HNW K;  4CJ5 A;  3V9X A;  3GDQ A;  2E2Q A;  2YHX A;  3FZK A;  3C65 A;  3VF6 A;  1NGB A;  1NGH A;  2EHG A;  4JKB A;  1N34 K;  1TK8 A;  2AA4 A;  4DR2 K;  3D2E A;  4JK8 A;  4ISF A;  2I7P A;  3VGL A;  4CZJ A;  5FRM A;  4H4M A;  3PIP L;  4CHN A;  3MAQ A;  4EHT A;  3RWU A;  3OYN A;  3SPY A;  2UUB K;  1WB9 A;  3AVM A;  3C95 A;  5AR0 A;  4LY7 A;  4DF8 A;  2IOC A;  4WFN L;  5AQV A;  1BQN A;  2DFF A;  1SL1 A;  2OTJ N;  4DTO A;  4C8K A;  3NFA A;  1HX1 A;  2O4G A;  3J7Y P;  3D2E B;  4A5B A;  1OH6 A;  5HP1 A;  2O8E A;  4JKE A;  3MCA B;  3H6E A;  4K8Z A;  3L2U A;  4E19 A;  4BG9 A;  2E1Y A;  3SMP A;  1VSM A;  3VEW A;  3P31 A;  4DFP A;  2ZGZ A;  3AVC A;  1D9D A;  4DV7 K;  3O3F A;  3HPO A;  1DKG D;  3NMU A;  1JKH A;  1JJ2 M;  3WQT A;  4CHO A;  4GV6 A;  4DR5 K;  4J8F A;  5CY4 A;  2P9N A;  5C42 A;  1YHQ N;  2QM1 A;  5AFU H;  1NKC A;  1ASV A;  2RE2 A;  4HCB A;  4DS5 A;  4BVO A;  4M7Y A;  4JKG A;  2UXD K;  1QHT A;  2O8E B;  3QFU A;  1JCE A;  1S9G A;  2NRW A;  3CMA N;  3AVA A;  3S41 A;  5AQS A;  4DV6 K;  2KKZ A;  1GOC A;  1DLO A;  3K5N A;  3K0S A;  5AQL A;  2F96 A;  3LM9 A;  2BTF A;  4BY9 C;  2YKM A;  3QFP A;  5C12 A;  1RT2 A;  3RMC A;  5M1P A;  1K9M O;  4N41 A;  1JLE A;  3VQQ A;  3MX5 A;  3ID6 A;  2P9N B;  3DAW A;  1BU6 O;  1KC8 O;  3DRR A;  3NGI A;  2NRH A;  2G8F A;  3OS2 A;  3IUC A;  3ENH A;  5GIN A;  5F0X A;  4JKG B;  1WSF A;  3I0R A;  1KCF A;  3H3N O;  4XH1 A;  1C0U A;  2QWP A;  4IEI A;  1CXQ A;  3MN6 A;  5B8H A;  3EZW A;  1VQO N;  2G8K A;  3KWG A;  1J54 A;  1UA1 A;  2QWN A;  5D3G A;  1KAZ A;  4CK2 A;  1O1W A;  2KFN A;  4F9O A;  5AQN A;  4YOU A;  2A6A A;  4NYF A;  3VEX A;  1WOQ A;  1MWM A;  2VG6 A;  4CD1 A;  1T6D A;  3SK3 A;  3VQD A;  5M1K A;  3VQ9 A;  3ZSZ A;  3QBX A;  3CJ1 A;  3U3G A;  5AQG A;  1YUW A;  5JVG L;  5GAH P;  3TI0 A;  1Q82 O;  5ADX A;  4B1U B;  3I55 N;  4OKK A;  3CCE N;  4ELU A;  4OPA A;  1CZB A;  4IOA L;  2HB5 A;  4BRF A;  1NJI O;  2Q0U A;  4YOX A;  2F7T A;  4DFJ A;  2QWR A;  5HOO A;  3FR0 A;  1JLC A;  3V9Z A;  1KTQ A;  4H03 B;  2VGN A;  4B8C A;  5FLX O;  5KTQ A;  4KHW A;  1L3V A;  4KPY A;  4FWS A;  1HNI A;  4LF5 K;  4IXC A;  1V4T A;  1DTT A;  1K8K A;  3CD6 N;  2O8B A;  3I33 A;  1C1C A;  3KTQ A;  2HBJ A;  4LSN A;  1LV5 A;  5AZI A;  1HQU A;  4KKO A;  4BRI A;  1SS6 A;  3L3U A;  2UUA K;  2W6L A;  4C23 A;  4R79 A;  4DV5 K;  1J5E K;  3VQ6 A;  4DLG A;  3P1G A;  4CHZ A;  4JI4 K;  5FPE A;  2ZJR L;  3TTF A;  1RT6 A;  4DFM A;  1BIZ A;  3CFO A;  3V9U A;  4PUO A;  4FJM A;  1J53 A;  1IKX A;  3EKU A; 
#chains in the Genus database with same CATH homology
 2D4W A;  2VWB A;  5ELZ A;  5FPN A;  3CER A;  4FWN A;  1K8K B;  2GWK A;  2E8A A;  3TTD A;  3VEY A;  3H3O B;  3KVG A;  3CQX A;  2HF3 A;  2HMP A;  1GLF O;  4O8U A;  5AZI B;  4E1J A;  1NGE A;  3TU5 A;  1Q81 O;  4FOE A;  4JK9 A;  1GLC G;  4M7X A;  5AZJ B;  2F9W A;  4Z94 A;  3SMS A;  1VAZ A;  2DPN A;  1K8A O;  5LJW A;  3HM8 A;  3MMV A;  5AQP A;  4GV3 A;  2PBD A;  1Q86 O;  3R1X A;  3E1Y A;  4BRQ A;  3UKR A;  4WYB A;  4K41 A;  3FZF A;  2A41 A;  1GLA G;  4KBO A;  3CJC A;  4YOR A;  4WFA L;  3VTH A;  4I6M A;  2P9U A;  3G25 A;  3O1W A;  4AM6 A;  5AQW A;  4PKI A;  5AQU A;  3TSQ A;  1QQO A;  3ZX0 A;  1VQ5 N;  3HOT A;  1VQM N;  4IWV A;  1HPM A;  2V52 B;  4IEE A;  1BOT O;  3CCS N;  1BA1 A;  3AAQ A;  1BA0 A;  3RVC A;  3Q7C A;  1XQS C;  1S22 A;  3HBT A;  4BC2 A;  2BH1 A;  4CJ7 A;  5I9E B;  2E20 A;  1M90 O;  1BUP A;  1QZ5 A;  1VQ4 N;  2ZJP L;  3CCV N;  2QXL A;  3O9U A;  2QWM A;  4JNE A;  1ATN A;  1DEJ A;  2NRX A;  3G4S N;  1NMD A;  2KHO A;  4ISE A;  5M1N A;  1OVY A;  4FWM A;  4H0O A;  4QS9 A;  3VET A;  4XH4 A;  5AQR A;  3R3L A;  3EO3 A;  3UKR B;  3WQU A;  5C2D A;  1HKB A;  1Q18 A;  3O08 A;  5KPR A;  5AQM A;  1KAX A;  2Q97 A;  3K9J A;  1E4F T;  3R8E A;  1OKJ A;  1JCG A;  5AQT A;  1HKG A;  2ZF5 O;  3E66 A;  2I7N A;  4YOY A;  4I6M B;  2NRT A;  5BRE A;  1P8Z A;  2P9U B;  4FWQ A;  4MO5 A;  3BP8 A;  3E9O A;  4JD2 A;  1SQK A;  3E9P A;  1LCU A;  1NGJ A;  1NGC A;  4A2B A;  1KD1 O;  4QS8 A;  3EN9 A;  1KQS M;  3GBT A;  3TTC A;  3MWT A;  1YIT N;  4NO7 A;  3KK7 A;  4XEI A;  2QTD A;  1U2V A;  4YOW A;  2P9L A;  2WFB A;  4O5F A;  3C6H A;  4U7B A;  2HF4 A;  3VEZ A;  4BRN A;  5GAD P;  2IVN A;  1MDU B;  1IG8 A;  3FZH A;  1W97 L;  4A59 A;  1MA9 B;  4BGB A;  4CZG A;  4AF1 A;  5BRH A;  1S72 N;  3H1V X;  1R59 O;  3VER A;  1M1K O;  2YHY A;  5M1O A;  5AFU A;  3I8B A;  4BC4 A;  4MLE A;  3AGK A;  4IZ9 A;  4K25 A;  1SZ2 A;  1T3V A;  2QW9 A;  3AY9 A;  2J4R A;  3QDK A;  2ITM A;  1BO5 O;  5BN9 A;  2IVO A;  4GVE A;  4WCE L;  1CZA N;  2JWK A;  3SBG A;  1QVG M;  1ZBS A;  3EE9 A;  4WQ4 A;  2IVP A;  5AQH A;  1GLJ O;  3PLA A;  4IO8 A;  2PAV A;  3QB0 A;  4B1Z A;  2NRR A;  4JD2 B;  3ENO A;  2FF6 A;  3BEX A;  5DM7 L;  1QZ6 A;  1TUU A;  3VOV A;  2NRV A;  2GEM A;  1RFQ A;  2ASO A;  3OBW A;  4PKH A;  2QI2 A;  3KWI A;  5H1S Q;  3M6G A;  1U2V B;  4BQL A;  4IDH A;  1O13 A;  2P9L B;  2RHK A;  2F9T A;  1T6C A;  4CZE A;  4Y0W A;  2E2N A;  4CZL A;  3CJB A;  3HRG A;  1V4S A;  2UYT A;  3C7N A;  3ATV A;  2QWO A;  3ENB A;  3CME N;  4FWK A;  5BN8 A;  3M1F A;  3RSE A;  3WXL A;  2Q2R A;  3WXM B;  5EXW A;  4A2A A;  3SAF A;  4BRC A;  3VEN A;  3ZX3 A;  3OHR A;  3SJH A;  3PIO L;  2Q1N A;  1YI2 N;  3D2F A;  2ASM A;  3FZM A;  4A57 A;  2GUP A;  3LM2 A;  3J7Z O;  2FLO A;  3SBT A;  3TSP A;  4CI6 A;  5JLF A;  3GL1 A;  5E84 A;  1YJ9 N;  2YHW A;  3FFK B;  3SAH A;  4H5W A;  3U4L A;  2E2O A;  5KQ8 A;  5CR4 A;  2GWJ A;  1RDW X;  3IMX A;  4BRL A;  2GEL A;  3MDQ A;  2A5X A;  4IJN A;  3CI5 A;  5AQQ A;  4MLH A;  2P9S A;  5MLC Q;  4BC3 A;  3C7N B;  1EO1 A;  2YX6 A;  3F9M A;  2YCH A;  3VTI A;  3CPE A;  3DXM A;  3W0L A;  4QS7 A;  3KHY A;  4BR2 A;  3BF1 A;  3RSE B;  3AAP A;  3ULE A;  1C0G A;  2CH6 A;  3A5M C;  5AQF A;  5ADX H;  3LDL A;  3VEV A;  3D2F B;  4CZF A;  3UE5 A;  3VGK A;  4BC5 A;  3CF5 L;  4BRG A;  1YVN A;  3E9L A;  3ZX2 A;  3A5L C;  1JCF A;  2P9P A;  3WT0 A;  5LJV A;  3CC7 N;  3O4W A;  4JKD A;  4EHU A;  5M1F A;  2FSK A;  4CBW A;  3J8A A;  2EWS A;  3WEE A;  2CH5 A;  5TKW A;  3CC2 N;  1H1V A;  3R9P A;  2HBL A;  2GTD A;  2OAN A;  4H0P A;  4BRE A;  3A0I X;  3P4I A;  1BDG A;  3HTV A;  3L4Q A;  3OA9 A;  1DGK N;  2WUS A;  3M5R A;  2AP1 A;  3CIP A;  2P9S B;  2ASP A;  3OBY A;  1U6Z A;  4K43 A;  5EVZ A;  4BR7 A;  3O6W A;  2ZJQ L;  1C0F A;  1E4G T;  4B1W B;  1VQ6 N;  3P39 A;  1W2B M;  5E26 A;  4OO1 J;  5FPM A;  3C6A A;  3GE1 A;  4EAH D;  5BRF A;  2HBM A;  3DXM B;  5KPZ A;  3ULE B;  4BR4 A;  2FSN A;  2FXU A;  3HZ6 A;  3CHW A;  2A42 A;  4IOX A;  3O1B A;  3LDQ A;  3NVM A;  3EL2 A;  4WFB L;  1YJW N;  4CZI A;  3UKU A;  1NBW A;  2P9P B;  5AQO A;  4XH5 A;  2HBK A;  1J6Z A;  4CZM A;  1NWK A;  4PKG A;  5HL7 L;  3WEE B;  1NGF A;  3VF4 A;  3R6M A;  3CJA A;  5TKY A;  3CCR N;  1GLB G;  4JKH A;  1NLV A;  3LDO A;  4C1N K;  1VQK N;  3O80 A;  4A5A A;  4M63 C;  1X3N A;  2NRZ A;  4H5T A;  2KLA A;  4FL9 A;  4H5N A;  4JN4 A;  3MN7 A;  5EX5 A;  5AQJ A;  2VGM A;  3MX2 A;  3U8X A;  1HUX A;  3A5N C;  1VQ9 N;  1TYQ A;  4YOT A;  4O8K A;  3CJ9 A;  2HOE A;  3SLC A;  4FPA A;  5JVH L;  3L6Q A;  3U9D A;  2FF3 B;  5BPM A;  3JS6 A;  4FWR A;  5CE3 A;  4BRH A;  4BRK A;  3C0B A;  3O9T A;  5EOY A;  5BRD A;  1GLD G;  5AQK A;  3MN5 A;  1VQ7 N;  3GDQ A;  2E2Q A;  2YHX A;  3UKU B;  3FZK A;  1N8R O;  2V7Z A;  5C0Y A;  1LOT B;  4L3Q A;  1X9J A;  3C65 A;  1NM1 A;  3VF6 A;  3FE1 A;  1NGB A;  3F2K A;  3GG4 A;  3MCP A;  3ZYY X;  1NGH A;  1T44 A;  4JKB A;  4G9Z A;  3L4I A;  2OTL N;  1QVF M;  4H0Y B;  2QWL A;  3LDP A;  2AA4 A;  2VCP A;  4JEP A;  3CCJ N;  2V51 B;  3D2E A;  4JK8 A;  4IO9 L;  4BRM A;  4ISF A;  2I7P A;  4A62 A;  2GX9 A;  3VGL A;  4C1N I;  4CZJ A;  4LC9 B;  5LY3 A;  1TYQ B;  1XC3 A;  4FVU A;  4MO4 A;  1TUY A;  3OW2 M;  4BGA A;  3PIP L;  3D6R A;  3N4Q A;  4EHT A;  3QIC A;  1ATR A;  1VQ8 N;  2NZT A;  4EFH A;  1BWF O;  3B8A X;  5AR0 A;  2Q36 A;  3T69 A;  3CCQ N;  5F2R A;  1K73 O;  3ZEU A;  4WFN L;  3A5O C;  2YJE A;  3A8Y A;  2NLX A;  5AQV A;  2OTJ N;  2YJF A;  4PHT X;  1KAY A;  3EKS A;  1HX1 A;  4BRA A;  1HKC A;  3DWL A;  3UB5 A;  3D2E B;  4A5B A;  2HST A;  2D1K A;  4JKE A;  1IJJ A;  5FPD A;  3MCA B;  3WXI A;  3CCL N;  3H6E A;  4WF9 L;  3CC4 N;  1Q7Y O;  4CZH A;  4KH6 A;  4CD3 A;  3LL3 A;  1MWK A;  3NVK A;  4BG9 A;  4H0X B;  2E1Y A;  3SMP A;  3HSC A;  1YIJ N;  4H5V A;  1ILY A;  4JHD A;  3VEW A;  4JKF A;  3P31 A;  2ZGZ A;  4RWT A;  1RDU A;  1XUP O;  3DXK A;  4HWI A;  4BRD A;  4BR5 A;  1RGI A;  3ZEU B;  1DKG D;  1YXQ A;  3NMU A;  3FGU A;  1JJ2 M;  3WQT A;  4GV6 A;  1VQN N;  1YF5 L;  4J8F A;  1G99 A;  2P9N A;  4PL7 A;  2P9K A;  1YHQ N;  5KQD A;  5C10 A;  2QM1 A;  5AFU H;  1D4X A;  3O8M A;  4ILH A;  2RE2 A;  4FPB A;  1Z05 A;  3GOI A;  4WQ5 C;  4B1Y B;  4BVO A;  5BPN A;  4M7Y A;  5JMV A;  4JKG A;  1ZC6 A;  5CHI A;  4OPH A;  4MDA A;  4BG8 A;  4H0V B;  3QFU A;  3CCM N;  1JCE A;  2NRW A;  5KPT A;  3CXC M;  1HLU A;  3CMA N;  4NLC A;  4JKA A;  3S41 A;  2E1Z A;  5AQS A;  1ESV A;  4FWP A;  1KXP A;  2KKZ A;  4U67 L;  4JHD B;  4IOC L;  1X3M A;  3F5T A;  5AQL A;  3KZB A;  4YDU C;  3DXK B;  5EY4 A;  3LM9 A;  2BTF A;  3O9Q A;  4BY9 C;  3DJC A;  3QFP A;  2VYP A;  2P9I A;  5C12 A;  3G71 N;  1SAZ A;  3EE8 A;  4HTL A;  5M1P A;  4BR0 A;  1K9M O;  5DM6 L;  2Q0R A;  3DLL L;  3FLC O;  3MX5 A;  3ID6 A;  3MN9 A;  1NGA A;  3O9S A;  2P9N B;  2ZGY A;  2P9K B;  4FSV A;  5BPL A;  4BR9 A;  4NLB A;  3DAW A;  1BU6 O;  5AQI A;  3TSU A;  1KC8 O;  5M1Q A;  2ZWH A;  3IFR A;  2NRH A;  1WUA A;  1YJN N;  3VPZ A;  3IUC A;  3ENH A;  5GIN A;  3VMF B;  4RCH A;  2FSJ A;  4JKG B;  5F0X A;  4UY8 O;  4FWO A;  4DB3 A;  1VQL N;  2W41 A;  3H3N O;  3MK6 A;  4XH1 A;  2QWP A;  4IEI A;  3M3Z A;  3MN6 A;  4EIA A;  1HJO A;  5B8H A;  2IIR A;  2QWQ A;  4PL8 A;  3EZW A;  1VQO N;  3QBW A;  3KWG A;  2W40 A;  5GAG P;  4A61 A;  3MWP A;  2QA4 N;  3H46 O;  3VES A;  5BR9 A;  2QWN A;  2P9I B;  1Y64 A;  1KAZ A;  5GIP A;  4RTF D;  1GLL O;  2CGK A;  2YI1 A;  4B1X B;  4JK7 A;  4CBX A;  4F9O A;  3BUZ B;  5AQN A;  5F1X A;  1BG3 A;  4YOU A;  2A6A A;  3HI0 A;  4FO0 A;  5GAE P;  4DCH A;  2JWL A;  3VEX A;  3ATU A;  2PFU A;  5AQY A;  3O5B A;  1NGI A;  1MWM A;  1WOQ A;  4GY2 B;  2E88 A;  4CD1 A;  1T6D A;  3SK3 A;  4DHY A;  3VEO A;  3G6E N;  4NB4 A;  4GV9 A;  3ID8 A;  2CGJ A;  4JAX A;  5M1K A;  2QEX N;  4H0T B;  4JKC A;  3CPW M;  3QBX A;  3CJ1 A;  4IFE A;  5AQG A;  1YUW A;  2D0P A;  3I56 N;  5JVG L;  5GAH P;  3O9R A;  3CET A;  1Q82 O;  1YAG A;  5ADX A;  4B1U B;  3I55 N;  3BF3 A;  5GIO A;  4KH4 A;  1QHA A;  5AQZ A;  3CCE N;  4CBU A;  4OPA A;  4DKW A;  3Q7B A;  4BQZ A;  4IOA L;  3D7E O;  3CQY A;  4H5R A;  3N4P A;  4BRF A;  5JIC A;  1NJI O;  2Q0U A;  4B9Q A;  1NGG A;  1Z6R A;  4IJA A;  3H45 C;  2F7T A;  4MDB A;  4B1V A;  4YOX A;  2E2P A;  1EQY A;  3SAG A;  2Q31 A;  3AAR A;  2WC9 A;  2QWR A;  3WXJ A;  2D0O A;  5HOO A;  3FR0 A;  3L0Q A;  3P38 A;  3WXK A;  1VQP N;  3JXU A;  4H03 B;  4YOV A;  2VGN A;  3ZET A;  5JLH A;  1ATS A;  3CJ7 A;  4BRO A;  1NGD A;  4FOI A;  4AM7 A;  2H3G X;  3QML A;  4K42 A;  4DQ8 A;  3HOS A;  3FZL A;  1QQM A;  4FWS A;  4WQ4 C;  2WBN A;  3VGM A;  3K9K A;  4IXC A;  1V4T A;  1K8K A;  5C2F A;  4BRP A;  3CD6 N;  3AGR A;  3I33 A;  1P90 A;  4ILJ A;  2HBJ A;  5C15 A;  1S3X A;  2A3Z A;  3IKM A;  4ILG B;  5AZI A;  3U9Z A;  4BVP A;  4BRI A;  2CGL A;  1SS6 A;  4KH5 A;  4WQ5 A;  5AZJ A;  3IDH A;  4C23 A;  3VF2 A;  4FWL A;  4R79 A;  3TPQ A;  1DT9 A;  3WUH A;  2BUP A;  1QQN A;  4ISG A;  5FPE A;  3W3D A;  3TTF A;  4GNI A;  4CZK A;  2ZJR L;  3ZET B;  3CCU N;  2NNW A;  2A40 A;  5AQX A;  1GLE G;  3LDN A;  4YDU A;  1ZXO A;  3T7Z A;  3H1Q A;  3EKU A;  2V7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...