4PUOA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 145
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4puoA05
3KD1E 4C8KA 3K58A 3LP3A 5KT3A 4LSLA 2R8JA 2KFZA 4J2EA 3DMJA 3ASMA 4LSLB 2WTFA 4QWDA 3TQ1A 1JLEA 4JRQA 4N41A 1L3UA 2WONA 2ZE2A 4O5BA 1J5OA 1S49A 3P1GA 5DQHA 1S10A 1JXLA 4DQSA 3AVGA 3IRXA 1YVUA 1EETA 2W9BA 4M3WA 2HVIA 4ZPBA 3AO3A 3OL7A 3PR4A 1Z4UA 4J9KA 4TY8A 3O4QA 4TY9A 1U47A 4MFBA 4FJ8A 3QGGA 3N6MA 4DL7A 4Z4GA 1C6VA 5F8NA 1N6QB 1S6QB 1TKTA 3BGRB 2HHVA 1RTIB 4UQGA 4ECYA 1S5JA 3M8PB 4CHQA 3AV9A 4CIFA 1CZ9A 1B9DA 4WYLA 4DF8A 4ZMMA 4F2RA 3H5UA 4KREA 3RMCA 3KLHA 1W25A 5CY4A 1UA0A 5KT2A 1TKXB 4E1NA 3TAMA 3I5BA 4KTQA 4RW4A 4B9UA 1IKVA 4NCGA 3SPZA 5DGBA 5KGXA 5J2MA 3LP1A 2XI3A 3HVRA 4EBDA 3GV7B 4CF0A 5KG1A 3NF9A 3MEGA 4Q0BB 2JC0A 4Y3CA 4M3XA 2O4IA 1GOBA 4LD0A 4K4WA 4B9MA 5JXSA 1RT7A 4PWDB 1BQNA 4CERA 1S4FA 3CQ8A 4KTWA 2VG5B 3HPHA 4EO8A 1RT5A 3QEWA 2R8KA 2IDOA 4IBNA 4WFYA 3QINA 5KFAA 1T05A 3LAMA 4RW4B 3G6VA 1VRTA 3UDLA 3TAMB 1S48A 3SI6A 5KFGA 2W7OA 3LANA 3PW5A 4CJ3A 1RBRA 4CGGA 3BREA 1LWEA 3NF6A 5HRSA 1S1VB 4FJJA 3MAQA 1J54A 4CEZA 2E9ZA 3UR0A 4QWAA 2FJWA 4KHMA 2BGGA 3H2LA 4TQRA 3CFOA 1NK8A 4ZTFA 4Y34A 4ECSA 3K5OA 4K8ZA 4XO0A 4ZP9A 1SKRA 4OGEA 4CJ5A 1CXUA 1N6QA 5FRNA 3O4NA 2GIQA 3FQKA 2D7SA 4J9NA 4WFZA 4N56A 4CGFA 4BACA 5SZTA 4RU9A 1ZTTA 2YKNA 3CFPA 4FK4A 3DOLA 4DTNA 4IR1A 3NGIA 1HYVA 3C95A 4CEOA 1S1UB 3SUQA 4J9SA 4ZPCA 1N56A 2G8VA 4LSNB 4U7CA 3PX4A 3DLKA 1FXXA 1QHTA 3K2PA 1FKPB 5DQGA 1HNVB 3M8RA 1T94A 4ECTA 2GV9A 3V9XA 5FDLB 3ISND 3GIKA 1SL0A 2XY5A 4YQWA 3VQSA 4PA1A 1KLMB 2JEFA 4K4VA 3NAIA 3M9OB 3OJSA 4W5TA 4ZHRA 1RDBA 4F8RA 1EP4A 4R5PA 3SQ4A 5HP1B 3FDSA 4M94A 2FVSA 3FFIA 4O3NA 2AU0A 4F4YA 5K14A 3RR7A 4QCLA 2YNHA 4DU4A 4CJUA 1LWFB 2FBTA 4PQUB 4DLGA 4CFAA 1BQMB 4IFVB 3OS2A 3KD5E 1RBTA 2D3ZA 3OLBA 3N6LA 3IG1A 2DPJA 1QSYA 4DEZA 3QGHA 4KKOA 1HYSA 5EWFA 4AHRA 3O3GA 3NGYA 5DG8A 5D3GB 1C1CB 1S1WB 2IM2A 3M8QB 3P5JA 4KAIA 3T5JA 4ZPAA 1T8EA 3LDSA 4WFXA 3KK3B 3OSNA 1FK9A 2WK4A 3GILA 3WNHA 1J53A 4KFBA 5CYQA 1HQEB 5KT5A 4MIAA 3OL8A 3MR5A 2X78A 1RA7A 4ED3A 3LZJA 1SKWA 1U09A 2WHOA 4DFPA 1S9EA 3IGVA 3NGDA 4B9TA 4O4GB 5F8MA 5J1EB 4LH5A 3OYHA 2YKNB 4AHVA 3H5SA 1VSJA 2KQ2A 3FSIA 4Z4FA 3JYTB 1QUVA 2C2DA 4YMEA 2V4QA 4FK0A 5L1IA 2IJNA 3ZSOA 2HHQA 4C8OA 4EBCA 4O4GA 3OL6A 3MFIA 1MU2A 1X9MA 4K4XA 1BGXT 4F2SA 1NNDA 4F50A 4KO0A 2NUBA 2W8LA 1HQEA 3L3VA 4FJNA 2V4RA 5CYMA 4HTUA 1SKSA 3NE6A 1TKZA 3CJ4A 4Z0UA 4IH7A 4TYBA 4CHNA 4KHQA 4M45A 2VG7B 2VA2A 4KB0A 4KHSA 3E01B 2B6AB 3G6YA 2B5JA 1T7PA 4ED6A 1NK9A 4G1QA 2E4LA 2DPIA 1D8YA 4IRDA 3AVAA 1YTAA 4DG1B 4RW8B 1QS4A 1VSLA 4N5SA 1Y97A 4ED8A 3L3UA 2QKBA 1ASVA 4KV8B 1S9EB 4CF2A 4DTRA 4KFBB 3O3HA 4E3SA 3PZPA 3CM5A 2UVRA 2AGQA 1RDAA 2YNFB 4CEDA 2G8UA 4CHPA 4OJRA 4HCCA 4MKAA 1D5AA 4AILC 4Y2CA 3VQ8A 2UUTA 5J2PA 5KRSA 1FKOA 3QESA 1FKOB 1WSHA 3ZT2A 2E6MA 1XR7A 1YVFA 3KMSA 1BQMA 3CVKA 4AHTA 5EU7A 1QAIA 1HNIB 4IOBA 1TV6B 3D0PA 2HVHA 4DS4A 1EP4B 1XR6A 2VWKA 1JKHA 3N6NA 5I42B 3UPFA 4DL2A 2BQUA 3C6UB 3K57A 2W8KA 4FM1A 5C25B 1C1BB 3OYFA 1BI4B 4OL8A 4NCBA 4C8NA 3QGIA 4LQ9A 3NHGA 2B6AA 2ZE2B 4CHOA 5KFOA 1KLMA 3V9SA 2KTQA 4J9PA 4W5QA 4F4XA 5FDLA 2IA6A 3B6OA 4LSNA 2YHBA 4HVJA 4QW9A 1QE1A 2VA3A 5F8GA 3F9KA 3DLKB 5KFIA 1S1VA 4KTZA 1TL1A 4Z4HA 3ITHB 1WSGA 2B5JB 2W42A 3KHHA 4FJGA 2HNDB 1I3AA 2F8SA 5J2NB 1BCMA 4HUEA 4EEYA 3V1QA 3SUNA 4DQPA 1RBUA 3K59A 3PV8A 4Z4IA 1C0MA 1OS5A 4DS5A 4FJ9A 4IH5A 1HPZA 3LZIA 5KG2A 4CJRA 5I3UB 4R0EA 1C1AA 3RBEA 3BQ2A 4FK2A 3M9MB 4B08A 1RT6B 3LP0A 4FLTA 3KK2B 3PVXA 4EO6A 1ZBUA 3OVNA 2VG5A 2F96A 3V4IA 1TKTB 2JEJA 3VQQA 1C1CA 1S1WA 1RT7B 4DFJA 3IAYA 4IQXA 2W9CA 4FBTA 1KFDA 1VSIA 4CGDA 3NL0A 4CJWA 3VQPA 4PQUA 2W9AA 5KFEA 4QWCA 2P5OA 3FRZA 3OYBA 3LPTA 5HP1A 1S9GA 3L8BA 3KJVB 3QZ7A 4CFBA 3KLHB 4CEQA 4FJ7A 4CESA 4CJFA 3S9HA 1RT3A 4E7KA 4O0JA 4IDKA 4E7IA 4ED7A 1C2PA 2IOCA 1JLFB 3DOKA 4KHUA 4URGA 4IFVA 3LWMA 2PZSA 1JXEA 4OKEA 1FKPA 3NAEA 4K4YA 1DTTB 2YNHB 3OLAA 4KHWA 3V81B 5K14B 4IG0A 2CKWA 4WXWA 2C2EA 1TK8A 1J5OB 3LP2A 3V1RA 2E9TA 4KB7A 1BCOA 1JLEB 4B8CA 1RILA 1VRUA 5JS1A 5KFPA 3AO4A 3HVAA 3V9UA 4FJKA 2I1RA 3LALA 1RTDA 4IFYB 3VQ7A 3ICLA 3MEDB 3DMJB 4RNNA 2ZD1B 4FXDA 4NYZA 3GV8B 4MKBA 4L8RB 5KG6A 4Z4EA 2PYJA 1K1SA 4GMJB 2C22A 4NLOA 2BRLA 3DRPB 3I5AA 4H54A 1KVBA 5FRMA 1DLOA 3QO9B 4DSIA 1XWLA 3M8SA 2R7YA 1VSKA 1IKYA 1KHWA 3ZT4A 4FLVA 2R2TA 4CK3A 4FCYA 3ZT3A 2BANB 1Q9XA 4DFKA 2DFEA 1TAUA 4B3OA 4ELUA 3BSCA 3KHRA 4JV2A 3VQ6A 4NYNA 3NFAA 3SQ1A 2X6SA 2BRKA 3QETA 3H59A 5C24A 5L1JA 5KFHA 3LP1B 2FBXA 1RTHB 3KHGA 3ISNC 2RDIA 3IGNA 3IN5A 4I7FB 4DTUA 1VSDA 4BE0A 2HNYB 3ALYA 4DSEA 2Y1JA 4ZTJA 3TAPA 2YNIB 3U6FA 4RW7B 3DRRB 3D28A 3MR2A 3CDEA 4HCBA 4RW6A 4M95A 1X9WA 2D5RA 4B3OB 3TAGA 1X1PA 5J2MB 2HNDA 4RUCA 4JV0A 2B4JA 1TL3A 4OPKA 4FLYA 3JSMB 1JLCA 5KFFA 2W7PA 2IMWP 4NLWA 1BL3A 3QO9A 2C28A 3AVIA 4CJTA 4PY5A 4M3UA 4MIBA 2YKMB 4NLXA 3S3MA 2GC8A 4G3IA 3G6XA 1N48A 2ZKUA 4NRTA 1U48A 1JLBB 2FBVA 1UWBB 1REVA 2J6UA 1KRPA 2BR0A 3BGRA 3RRHA 1IKXB 3RAXA 3M9NB 3H40A 4KAZA 1IKWA 1KFSA 5KFJA 2ATQA 1EX4A 4KI6A 4Y2AA 4C8MA 4KPYA 4TY8B 5C5JA 2Y1IA 4QWBA 5C25A 3PW7A 4ECXA 4FBUA 4OLBA 4MK9A 1JXBA 3THVA 4QPXA 2R2UA 5F8JA 2WONB 3V81A 2ASJA 1SH0A 2Z1HA 5HBMB 4CCHA 4URQU 4TQSA 1IO2A 3HYFA 4IKAA 4BWMA 3HK2A 2C2RA 3DOKB 3NBPA 4YFUA 3ZT0A 4CF1A 4JRPA 3GIIA 3QIPB 3GQCA 5J2PB 3MEEA 2OZMA 1D9FA 3PX0A 3VQBA 4DQQA 4DL6A 4OLAA 1RYRA 4CGJA 4DTPA 2DFHA 1U04A 5KG5A 2AX0A 4RNOA 2FVCA 3OYEA 4O0IA 5FROA 2HHTA 2HHSA 3PX6A 4LH4A 2IAJA 1JL2A 3WNFA 4CFDA 4FS1A 2YNGB 2OYQA 4DG1A 1U4BA 5DGAA 4NZ0A 3RMDA 1HNIA 1KSPA 1UAXA 4EBEA 3V4IB 1L3SA 4H8KA 3CM6A 2HMIB 4CEFA 1S1XA 1Q8IA 1RA6A 4DSLA 4WXOA 3V6JA 3AA2A 3EPGA 3KLIB 2BDPA 4JUZA 1TKZB 3KLEA 4I2PA 4DL4A 4E19A 2PYLA 1RDDA 4CJSA 3OYIA 4DTMA 3B6PA 4AHCA 3L2RA 4IH6A 3TWHA 1MU2B 1TAQA 3H5YA 1ITGA 3S3OA 3NF7A 1RDCA 3CDWA 4I2QA 1WN7A 3PW2A 2A1SA 2KZMA 3WNGA 3QEVA 1IH7A 1WSEA 3BR9A 3SI8A 2R8IA 4E7JA 4OKJA 1G15A 4DTXA 3I0RB 2IJFA 4DFMA 5KFBA 4RG8A 5KFDA 3CFRA 4ZP8A 1TVRB 3C94A 3AVKA 4NYFA 3MTKA 4H4OB 4YR0A 4FS2A 3RMAA 1KVAA 4QW8A 3CO9A 5CYQB 3PUFA 3DM2A 1QE1B 1JIHA 4F4ZA 1ASUA 4E0DA 1NHUA 1HMVA 3UQSA 3SPYA 2E9RX 1TVRA 1A5XA 4B9SA 1LW2B 3DLEB 2OPRB 3OHAA 2VG6A 4J9LA 4XIUA 1B9FA 3NH0A 3MXMA 5KI6A 2XC9A 1ASWA 3KLEB 4ZP6A 1C0TB 1HYSB 5KFSA 4H4MB 4TN2A 5CZ1A 3JYTA 3GV5B 3KMQA 3VQDA 3L2VA 5I42A 3AVCA 1NKBA 3OYDA 2AWZA 1D1UA 1KTQA 2D0BA 4CJ4A 1LWFA 5J1EA 3K5LA 4M3YA 4KHYA 2X6NA 4BE2A 5KGWA 1WAJA 3FFIB 1S97A 1C0UA 2HWIA 3RWUA 5T14A 2YNGA 3PHEA 5KFVA 3HVTB 1SUQB 4CJKA 2P51A 2IAJB 1QTMA 4F4WA 1ZBHA 4JLHA 3D45A 2FC0A 2WRMA 3RRGA 4X2BA 2ILZA 1HNVA 1I6JA 1S6PB 5CZ2A 3Q8PB 1S1XB 1RT4B 4O3PA 4BDYA 2XHBA 4YNQA 3AA4A 5D3GA 3VQCA 1C1BA 3NKYA 5DQIA 2OPPA 4RNMA 3AA3A 4DSKA 3EYZA 1I39A 2P1JA 1TGOA 4ECZA 4EP5A 2G8HA 1HARA 4MH8A 1Z26A 1C0TA 1LW0A 3ULDA 3T3FA 1LV5A 2JC1A 2ASLA 1TP7A 3HO1A 5KRTA 4IR9A 4Q8FA 1RNHA 3ZCMA 1SL2A 4ID5B 5F8LA 4CE9A 4E89A 5KG7A 2YV0X 4ED1A 4JV1A 1S9FA 2JLEA 1GX6A 3I0SA 1BIZA 4URSA 2HHXA 4W5OA 1QSLA 1RT5B 3AO2A 2XO7A 2RKIB 4O4RA 3C6TB 3OYGA 4RW8A 2YKMA 4WZQA 3HL8A 3MXIA 1TK5A 1NK6A 1LWCA 4O3OA 2R2SA 1S1TA 3MFHA 1KLNA 3DLGB 3K5NA 2VG6B 4FZZA 3I0RA 5KT4A 5EWEA 5DLFA 4FLXA 1IKXA 3KHLA 2IGIA 3OL9A 3SFUA 1VSFA 2CJQA 3BQ0A 1JLBA 4GVMA 1XC9A 4HYKA 1QQCA 2WCXA 3SQ2A 2QK9A 5F9LA 4ECRA 3QEPA 1CLQA 3DRSA 1DTQB 2YNIA 2BQRA 4CJQA 3MF5A 2KFNA 1XR5A 4HHTA 2RF2B 5KT6A 3RTVA 1RTIA 3PO4A 3BQ1A 5HLFA 4CJVA 1LW0B 2BE2B 1RYSA 2JGUA 2GBZA 3O3FA 4FJMA 3DI6B 2VWJA 4RZRA 4CJPA 1T03B 2GUIA 3CWJA 4NLYA 3U3GA 5T7BA 4CEEA 3ZSZA 2ITGA 4K4ZA 3HT3A 4DWIA 3AVMA 5F9NA 3KKSA 1CZBA 2HNZB 5JUMA 4J9QA 4NLGA 5KFTA 2Q3SA 2ALZA 1LAVA 2G8FA 4FM2A 5HRNA 3ZT1A 3HP6A 1S0MA 5KFQA 4DTOA 2BANA 4E7HA 2FVRA 3HHKA 3KIOA 4MFBB 2ILYA 4EYIB 3L2WA 4ED0A 3VQEA 2DY4A 1KCFA 3WNEA 4DQRA 4WE1B 4WE1A 1YTUA 2HWHA 4I9QA 1RAJA 4F4KA 4M41A 2ETJA 3IRXB 1S0OA 3QEIA 1U45A 4J2BA 3LP2B 1VSMA 3V9ZA 3NAHA 1HRHA 1WSIA 3MXJA 5DG9A 3ZSXA 3MEEB 3OS0A 4NLPA 3SJJA 4PUOB 3VQ9A 3I8DA 1IM4A 4KHRA 3HKWA 1JLFA 3CJ2A 4B9NA 5HBMA 1NK4A 5L1KA 3KLFB 4IRCA 4ICLA 3CG7A 4NRUA 2IM3A 1UWBA 3OYKA 3QIDA 2WB4A 2ASDA 4KE5A 3KTQA 1JLCB 1BQNB 4J2DA 4Q45A 1WNEA 4CJLA 2ZQBA 4FJXA 2QXFA 3DDKA 3VQ5A 3NH1A 2D41A 3KNAA 3KKRA 3OSPA 4ZVEA 3QNNA 3DLRA 5KFYA 3HJFA 4IG3A 3RB3A 3SUPA 1RTJA 3UIQA 4B9LA 4B9VA 1IKVB 2HHWA 4N76A 4K4TA 5C42A 1WSJA 4CHYA 1S9GB 3CDUA 2IC3B 3KLGA 4Y1DA 4R8UA 1R0AB 4RUAA 1NOZA 1NJZA 1RTHA 3BSNA 4I2PB 3KK2A 3HSTB 3KLGB 1U49A 5EDWA 4EYHB 4DSFA 4I7FA 3TAEA 3M8PA 2BQ3A 2OH2A 3EY1A 1WLJA 4FJHA 3PO5A 3DLBA 1S6QA 1SH3A 3PW4A 2RN2A 4RW9B 2IS3A 2J6SA 3H98A 4FW2A 1RCHA 4RW6B 3HP9A 3DYAA 3SNNA 4CFCA 2HW3A 4RW7A 2W9BB 2ATLA 2XY7A 4BDPA 3KLFA 3LP0B 2XI2A 3NMAA 2V0NA 3G86A 4M42A 3TAQA 4ICLB 2QE5A 1LAWA 5I3UA 4DMNA 1TKXA 4GC7A 4FLWA 4HUGA 4Q44A 4CECA 4IFYA 3AVLA 4DL5A 4CJEA 3K5MA 3RB6A 2Z1GA 1K6YA 2HNZA 3ZSRA 1VRUB 4O44A 4U6PA 2DTUA 3OYJA 4LY7A 1W0HA 3NF8A 4ECUA 1IKYB 3T5LA 2KW4A 3HPGA 3VN5A 2XCAA 1TK0A 3H4BA 4Z4CA 2HB5A 1GX5A 2F8TA 4TYAA 2V9WA 2UVUA 5E41A 2EX3A 3GYNA 4J9RA 5DG7A 4ECVA 4CHZA 2I5JA 1Z25A 2R2RA 3SCXA 1RT4A 1CXQA 4I9LA 2Z1IA 1ZYQA 4NLSA 4CIGA 4EP4A 1BI4A 2IM1A 5KT7A 4IDKB 1ZETA 3V6KA 4FLZA 3V6DB 1T03A 1BIUA 3IS9B 3MR6A 3NGZA 4EZ6A 3DRSB 2XGQA 4ECQA 1A5WA 3TABA 1TV6A 5C42B 3E51A 5KG3A 2GIRA 4CGIA 1RTJB 4LQ3A 3SUOA 1ZBIA 4K50A 5DK5A 3CYMA 4IG3B 5HRPA 3F73A 3GIMA 3LWLA 1MMLA 2RF2A 1TQLA 2W9CB 4H4MA 4MQ3A 1IG9A 4ELVA 3SYZA 2HHUA 2O4GA 4CEAA 1R0AA 3QLHA 4XPEA 4NLUA 1QSSA 1A5VA 3DLEA 4K4SA 1ZBLA 4Y1CA 4J9MA 4E1MA 4NLTA 1NK7A 4J9OA 3AVBA 3DM2B 1RT6A 1JX4A 4AH9A 2OPSA 4NLDA 1EKEA 3DLGA 5KFMA 4PUOA 2D0CA 3OYAA 2LSNA 1JLAB 3QYYA 3OS1A 1HQUA 5DLGA 4YR3A 2RPIA 4DTSA 4O3RA 3SV3A 3ZSQA 4CK1A 3C6TA 2RKIA 4DU3A 1Q9YA 1VSHA 3BJYA 4O3QA 2OPPB 2EC0A 3T19A 3Q8QB 4ID5A 3I0SB 4E7LA 2XY6A 1HPZB 1TKDA 1GOCA 4OVLA 4ZVFA 2B43A 5J2QA 4FW1A 5KTQA 3QZ8A 4Q5VA 2OPQB 3KK1B 5J2NA 3KK3A 3OY9A 4AHUA 4DL3A 4NLRA 3QIOA 2HMIA 3VQAA 2FVPA 1JKHB 2FBYA 4GC6A 3M8QA 2QV6A 4TLRA 1TL1B 2AJQA 3HVWA 4Q8EA 1N5YA 5HRRA 3LPUA 3QERA 3DI6A 3PY8A 4RNHA 4TXSA 4CEBA 1S6PA 1ZTWA 4WZMA 4O3SA 1JLQB 3BSOA 2DFFA 2IM0A 1RT3B 4CF9A 2BE2A 1WNSA 1KVCA 4AHSA 3HXMA 5HLFB 5J2QB 4XPCA 3SFGA 3EZ5A 3KLVA 4W5RA 4OGCA 3EPIA 3KJVA 4KKOB 4FVMA 1C0UB 1ZBFA 3AVHA 4KB1A 3C6UA 5L1LA 4ZPDA 1JLQA 1S0NA 2WOMB 2YNFA 2E6LA 1SUQA 2XRIA 1SH2A 1N5YB 4H4OA 5KFZA 1BHLA 4IKFA 4R5PB 4ZVGA 3H4DA 1HYZA 1WSFA 3D5MA 4KV8A 1HQUB 4ZHRB 2UVVA 4ELTA 1S1TB 1LW2A 1LWCB 5HROA 3T5HA 2FLPA 1SV5A 3Q8RB 2G8KA 4QWEA 1DTQA 2OPQA 4OPJA 1NKEA 4I2QB 4WYWA 2OPRA 3NH2A 1IKWB 5F8IA 3OHBA 3ZSWA 4KO0B 3VQ4A 1K1QA 1XHZA 4FJIA 3PW0A 3MECB 1REVB 4GW6A 4ECWA 1D9DA 4FYDA 1NJXA 3FQLA 2AGPA 4KRFA 3AVJA 4B8AB 3Q8SB 2O5DA 4HUFA 1NHVA 1T05B 1JL1A 4DU1A 2FJVA 2XGPA 3JSMA 4F3OA 4C8LA 3T1AA 5KFKA 2JEIA 4BWJA 3EZUA 3DRRA 4Q0BA 2WOMA 2OPSB 4CIEA 2HNYA 3TI0A 3V6DA 3MECA 1GOAA 3BDPA 1UOCA 3CIZA 3HPOA 3I5CA 4EZ9A 4MK8A 3KOAA 3AO1A 4N47A 4CF8A 4M3RA 4DSJA 5C24B 4CK2A 3G0ZA 1O1WA 3L2UA 1NK0A 3G10A 1SV5B 5F8HA 2FLLA 1VSEA 5HROB 3AO5A 1BISA 1NKCA 1N4LA 1RBSA 2OA8A 5KFNA 3IG1B 2R8HA 4K8XA 3SV4A 3TR8A 5KFWA 3T5KA 4QAGA 3OYLA 3AA5X 5DMRA 4FJLA 2QKKA 2KZZA 3H08A 2D3UA 5KFCA 4FLUA 3NDKA 3OYCA 5KG4A 2XCPA 1FK9B 3DLHA 3KK1A 4FZXC 1YT3A 4BE1A 4Q43A 2IBKA 1NOYA 4FJ5A 3OJUA 1RBVA 4IRKA 1XHXA 1NK5A 3PR5B 3HVTA 1RTDB 3QIPA 4M3ZA 4JS5A 4OKKA 3NBPB 1L5UA 4ZVHA 2AGOA 3RBDA 2FJXA 5EUHA 3RAQA 2AX1A 3GIJA 3H5XA 4NCAA 3RMBA 1L3TA 4YP3A 1EETB 4KI4A 2F8EX 3PJXA 2FVQA 4DTJA 1X9SA 3TAFA 3OYNA 1VK0A 5KG0A 3CJ5A 1EXQA 5KFUA 3AVFA 1T3NA 3DYAB 1S1UA 4G1QB 1RT1A 2P5GA 1JLGA 1JLAA 4RNFA 4IG0B 4YR2A 3E01A 1TL3B 4QOZB 2EHGA 2VG7A 1DTTA 4RW9A 5EWGA 3RB0A 1HMVB 2UUWA 2OZSA 4W5NA 3V1OA 2RDJA 5KFLA 1XI1A 4F3TA 3QEXA 4CGHA 5CYMB 3SZ2A 4O55A 4NLVA 1NJYA 4BDZA 1LWEB 2HAIA 2D0AA 4MK7A 3QNOA 1RT2A 4DF4A 1UA1A 4K4UA 4ZP7A 1NJWA 3RR8A 3DOLB 4TSXA 2JEGA 3VA0A 1B92A 1VRTB 4J2AA 3TANA 2G8WA 1D0EA 3U3YA 2FLNA 4DLEA 4JS4A 1WAFA 4KBIA 1KHVA 2A1RA 3MEGB 1CSJA 3LAKA 2AQ4A 4FM0A 3ZSVA 2J6TA 2YHAA 3CJ3A 3HM9A 2Z1JA 5KFXA 2X74A 3NCIA 4NCGB 3CJ0A 1DLOB 3BSAA 3ZSYA 4KHNA 2G8IA 2R8GA 3V6HA 3VA3A 3KLIA 4R8UB 2IC3A 4DQIA 2XWYA 4NLQA 1RT2B 3RB4A 3QLHB 3MEDA 3AVNA 2I5JB 3TARA 2XY8A 4PWDA 3P83D 5L9XA 1HJRA 3L2QA 5JS2A 1L3VA 3PJWA 3A2FA 4KSEB 3SQ0A 5KFRA 3OYMA 2PY5A 1QAJA 3DRPA 3TVKA 4ED2A 1W9HA 3S3NA 4HKQA 3V9WA 1RDRA 4FZYA 1JLGB 1RT1B 4ID1A 1F21A 4M3TA 3ITHA 2UVWA 5SWMA 2ZD1A 1J9AA 4O44B 3IS9A 3MR3A 1SL1A
chains in the Genus database with same CATH superfamily
3MN6A 1H2UX 4B1ZA 3LP3A 4LSLA 4ETXA 4PCQA 2XYPB 5B0EA 5F3ZA 4J2EA 3JSBA 1NU0A 2P9LA 3NCQA 2WTFA 4EUVA 1GXTA 2KXNB 4WIQA 4DQSA 2P9SA 5A2QU 3IRXA 2DTJA 1HI1A 3Q24A 3AO3A 1NGAA 1NMEB 2RU3A 3G82B 1H98A 4LIRA 3N6MA 4V19X 2CPYA 1N6QB 4JAXA 4DI6A 3CJ1A 1S6QB 4JKBA 1TKTA 1LCUA 5JMVA 4CHQA 1CZAN 3DLLL 3FGVA 4ZMMA 7FDRA 3EXYA 5EX5A 3RMCA 4FDFA 4E1NA 3I5BA 3QAUA 4L72B 5M1KA 1RCXB 3MWBA 3LP1A 3CCUS 2BH1A 2E1MC 1NCLA 1UPMB 5G0RB 4LD0A 3CPWM 4JI2J 2KU7A 1RT7A 3M3ZA 3HDSA 4PWDB 1BQNA 1P27B 4CERA 1M0SA 3BGOP 3CQ8A 1VQ4N 1NH8A 3JXUA 2R8KA 2HQDA 3TU5A 4OX8A 4IBNA 3IFRA 4JN4A 3QINA 3LAMA 4ZVRB 5HK4A 1SBRA 1S48A 3R6LB 1VQ7S 3M6XA 3MD3A 2ZVSA 1X60A 1M5KC 4A8WA 4HACA 1J54A 3WQPA 3UR0A 4FP9A 1FCAA 3C6HA 1NK8A 2ZBIA 4Y34A 3K5OA 1H2TZ 3NVKA 2Z30B 1CBKA 1N6QA 2CQ1A 3O4NA 4FOEA 4LF8F 1CEZA 1G2EA 3FQKA 2UUBF 4YB7A 1ULRA 1CJVB 3AAPA 4CGFA 1WC6A 3V5RA 4RU9A 2BJDA 3IMQJ 2Q97A 3NGIA 2D1KA 4CZEA 2CZVC 4J9SA 2UXCK 5B0DA 4N8OA 2RQ4A 2GELA 2HGNA 3OFHA 4ZS6A 1W2BM 1FKPB 3P5TL 3FEXB 1HNVB 4H5VA 4FNHA 3VAJA 2I9SA 4U7UK 4C4WA 2W6LA 5HQLA 3NAIA 3M9OB 4OYWA 2C2KB 4CZFA 1NG9A 4NA2A 1Q7LB 3FDSA 1M90T 3FFIA 1WC5A 3OBYA 4DLGA 3GYXB 4IFVB 3KD5E 4X66K 4F4AA 3N6LA 1SJRA 2DPJA 1VQ5S 2LP4A 1KOHA 5EWFA 3CD6S 2Q79A 5DG8A 1C1CB 1S1WB 2X51A 4CZIA 4KAIA 3D6TB 2O01C 1XNRK 3LDSA 4WFXA 3KK3B 4M5DB 2ACYA 3BKUA 1W2BR 5KT5A 4MIAA 2E5LK 3M30A 4ED3A 2J7UA 2QSWA 3H45C 2WHOA 4FPIA 1S9EA 3IGVA 2HQFA 2CQ4A 2HBMA 2OCEA 3CCLS 5CYJA 5F8MA 3X3UA 3IWXA 3K0SA 2RAQA 1N33K 2KQ2A 3FSIA 1UP1A 2J9DE 5H9EK 1U1QA 5G4DA 2IJNA 3ZSOA 1YJWN 1VGYA 3DKDA 4EBCA 4E2FB 4FYXB 3MFIA 1MU2A 2WFBA 2FZKB 4CZMA 2Z58B 3G71S 4F50A 5ETKA 4X4OA 3L3VA 2DD8S 3TZZA 3PRDA 2OEKA 4TYBA 4KHQA 4KHSA 3UD3P 2ZWOA 2UXCJ 2IIRA 1NK9A 4BG8A 2DPIA 4IRDA 4RW8B 2YTCA 1QS4A 3EEQA 3L3UA 3MUTP 4LRAA 8RUCA 4KV8B 4G6VB 5LMUJ 3JSRA 3UKRA 4E3SA 5IOLA 3PZPA 3CM5A 1FEHA 2YNFB 4KGKA 2JX2A 2UUCJ 3NNAA 2GVDA 1P6TA 4CHPA 4OJRA 4HCCA 1C0FA 2KL8A 5F3TA 2JOQA 4JI6F 2M8HA 4MKAA 4Y2CA 3VQ8A 1KAXA 4Y65A 1IR0A 3THYA 1FESA 2E6MA 4JI8F 4YUDA 3HHLC 1XR7A 4CLYA 3L7OA 2OMOA 3CVKA 2CQ3A 2BXJA 3NGRA 4AHTA 2DXFA 3VAFA 1QAIA 3UNYA 5D8HB 2ZOGA 5JMNA 2VWKA 1JKHA 1N5VA 3UPFA 3VALA 4DL2A 2BQUA 3C6UB 1KQSM 2W8KA 5FD1A 4NYPA 2VF3A 1IQZA 2FGCA 2OANA 3O5BA 1HQ2A 1LQ9A 2HFVA 3I96A 3V9SA 4I6YA 5MLCV 3ENQA 5FDLA 2IA6A 2WBNA 1RGIA 1VQON 4QW9A 3I56S 3NNHA 1R27B 3F9KA 3DLKB 2FDNA 1S1VA 1NBWA 2GV1A 1VQKN 4B3TJ 1TL1A 1FX4A 2F4FA 3BH6B 4ZDNA 1XQIA 5C2GA 3MCOA 2B5JB 4OHZA 2QWRA 1VQMN 2PSZA 3KHHA 3W64A 3D66A 1LFWA 2HNDB 1WI8A 3LGMA 2V7YA 3SBGA 3U4LA 4LF7K 2CJKA 5JJBA 1BCMA 3V1QA 4RUBA 1W7WA 1RBUA 1KXPA 3AA9A 3PV8A 2UUAJ 4Z4IA 4UY8O 2RIJA 5I4MA 4OMFG 5KG2A 2B56A 4IWVA 4R25A 2HURA 3BQ2A 5H9FJ 2YKOA 1GTEA 4B08A 2NZ4A 1O8BA 3TZXA 4OX9J 4CLTA 1SS6A 2VV5A 3GDQA 5ETQA 3GG4A 1M5SA 1WG1A 1HLUA 2VG5A 4DV2F 3MWPA 3IKMA 3QJJA 1C1CA 1S1WA 4DHVA 5K8PA 2CPZA 1WTFA 2P9UB 1NUEA 3UCGA 1PSDA 2W9CA 4FBTA 1KFDA 4NLBA 1RAGB 4CZJA 4CGDA 3NL0A 4OLPA 3GLJA 3E1YA 2W9AA 4QWCA 3OYBA 3CTRA 1S9GA 4CFBA 2J8AA 4CZCA 5M1PA 2NUUG 4IDKA 4ZVUB 4GVBA 4RPFA 4B3SJ 3LWMA 2PZSA 3LDPA 4DR3K 1FKPA 1DTTB 3ENWA 4OJGA 2CKWA 4WXWA 2C2EA 3HCXA 3V1RA 1ZAWA 1HWUA 1K9MO 5F0UA 2FJBB 1JLEB 3VAGA 3V9UA 1TUGB 2UXDJ 3CDAA 3U27A 3UD5A 4LF6K 3ICLA 3MEDB 3D4JA 4RNNA 2ZD1B 4DV6F 3M2UA 4MKBA 2M52A 2ZH7A 3MN5A 1XJWB 3MPWA 4HHUA 5KG6A 3KDOA 2QMXA 4UF4A 2NZTA 4H54A 3QB0A 5FRMA 3NGKA 1FDNA 2MKHA 3CMAS 1VQNN 3F0NA 4FLVA 4F7VA 2PI4A 5CHIA 1NGJA 2DFEA 3RBZA 4B3OA 2XYHB 4PWWA 3F56A 2X6SA 3CW2C 2BRKA 4OX6A 2H3EB 2LECA 3ZX0A 2F8MA 5EGYA 2XHWA 2CJBA 3LP1B 3I6PA 1TELA 4YB5A 1WEYA 2YJFA 2COLA 3VEOA 3ISNC 1UZHA 4H0VB 2PA3A 5IT0A 4M7XA 4DTUA 1VSDA 5DM7Q 3R6MA 4KY3A 2V51B 3FNNA 3ALYA 4MMOA 5LY3A 1UFWA 5LJ5Y 2OTJS 4J9UE 3W5XA 5HOOA 2P9IA 4HCBA 2M7SA 3W3SA 3P45B 4GV9A 3TAGA 1AFIA 3EDQB 1X1PA 3M1VA 3A0IX 4KH1B 4RUCA 1TL3A 3JSMB 5KFFA 3R1LA 1XC3A 1X8DA 3PKYA 2IMWP 4ILLA 4WKYA 2MZRA 3QO9A 2C28A 3J7YU 3MM5A 4NLXA 3U1LA 3G6XA 1Y7PA 2ZC4A 4LF2A 3ETMA 3KWMA 4FWQA 1U48A 4P6QA 1QJHA 4DDFA 1UWBB 2JFDA 4KHPJ 2QFJA 3BGRA 1OQ6A 2ZWPA 3RRHA 3FZMA 5CQGA 3ULHA 2PMZD 3W9JA 2VONA 4KPYA 1LFPA 4PPZA 2GAGC 5C5JA 4BY9C 2IDLA 4WF9L 1IBKF 5C25A 3TRGA 2UU9J 1NB7A 4FBUA 2VPXB 3THVA 1SC6A 1AYEA 3ILLA 1MA9B 1IR2A 3TA1A 3HOTA 2R2UA 3PIOL 3V81A 2NRZA 4YY3K 2F4VK 2YJEA 4URQU 5C2DA 1YBUA 2YX6A 3SDEB 3DOKB 2QA2A 3NBPA 2CWKA 2RQMA 2DNNA 3MEEA 4P73A 4R0JA 5BPMA 4DL6A 1TMMA 4OLAA 5ETTA 1DURA 4CGJA 2C3PA 1IBLJ 1RP5A 4RNOA 5JLHA 1HHSA 1Q95G 3BBCA 4FKXA 3OYEA 1S0VA 2HHTA 1Y9OA 3PX6A 4QR0A 3M2RB 2IYIA 4DR7J 5HVFA 3F9MA 1VJWA 2F5GA 5ETNA 2FHMA 2J0SD 3W2VA 3SLCA 2OYQA 2KKHA 4DG1A 5J1NA 2IVNA 3RMDA 5C7PA 5A76A 4OPHA 2ZJQQ 4HEA9 3BZKA 1L3SA 2HQGA 4BROA 2FD2A 1RHKB 4OLOA 1NWKA 1UVKA 3NY0A 2M88A 2O8FA 3EPGA 3MCSA 1S59A 4JUZA 2CGKA 3MDFA 4KBOA 1YRUA 2PYLA 3EVMA 3L2RA 4IH6A 3H7HB 1IG8A 2IIHA 3HD2A 3FZKA 4X4RA 4P7VA 3NS6A 3H5YA 3NF7A 1V5IB 3CNQP 3UKRB 3CDWA 5AQZA 4KT0C 2MKCA 3PW2A 2PN6A 2A1SA 4I1TA 3WNGA 3MTJA 1G15A 2IJFA 3CCRS 3AA8A 4RG8A 1TMJA 5KFDA 2ZBQA 4ZP8A 1QVFM 4NYFA 3MTKA 4YR0A 4B02A 3RMAA 5LSOA 1KVAA 2AEFA 4IOXA 4LRBA 1ASUA 1NHUA 1HMVA 4MTPA 4LF7F 2E9RX 1TVRA 1ZM9A 1A5XA 4DV0K 3O4WA 2DGUA 2OPRB 3MCMA 4XIUA 1WKKA 3P4UB 4FXVA 2DGWA 1UMJA 4ZP6A 1C0TB 4TN2A 3GV5B 3B54A 3MM9B 4PZVA 4DV0F 1RGVA 3ZTQA 3L2VA 3FBFA 3AVCA 2EWHA 2AWZA 1ESVA 4TVAB 1P90A 2HWIA 2JDJA 2KVIA 3RWUA 3N9UC 4ETZA 3M30B 4FF4A 5KFVA 2JNJA 1JQGA 2P51A 4ZPVR 2YI1A 2RDDA 3MOJB 2F63A 2BTFA 2WTUA 4JLHA 2Q1NA 3LTOA 2WRMA 4LVNP 3RRGA 1NZ8A 1I94J 4F0MA 1S1XB 1YJ9S 2BKPA 2CJXB 4O3PA 4JI5J 4GMKA 3AT1B 5M1FA 2B51A 4FWLA 2W4PA 2HQCA 1Y4ZB 3AA3A 1HW9A 4DSKA 1UETA 3OFGA 4YOEA 2D3O1 2P1JA 2J9CA 1F2GA 1HARA 1P1TA 1Z26A 1C0TA 4IXCA 3TEGA 3W61A 2QLJB 4IYQA 2JC1A 3CJQA 4JI1K 3LM2A 2CA9A 1FEEA 4DV5F 1B0TA 4Q8FA 3ZCMA 1SL2A 4ID5B 3OBIA 5F8LA 2QW9A 1UFKA 3U9ZA 1VQ6N 4GKJF 2CJAA 2R7RA 4B3MK 4ED1A 3Q2SC 1S9FA 5IWAF 3G87A 1BWVA 2M70A 1I1GA 2FY1A 1VQNS 1YITN 1UPPA 1QSLA 3S7RA 2GVZB 2H1YA 4NYOA 1FRJA 1PIEA 4X4NA 4WZQA 1TK5A 1R0CB 5AQRA 2R2SA 3D2EA 2MDAA 2DH9A 3QMQA 3PRBA 4MKVA 2DPNA 4Z94A 2CG4A 5DLFA 2OJ3A 3CCSS 1LK7A 5ELZA 2VL1A 4H5TA 3KHLA 3OL9A 4LR9A 3JS9A 3BQ0A 2O66A 3AJDA 1XC9A 2ADCA 1QQCA 3SQ2A 4CQ1A 2EBEA 4ECRA 3VEWA 3A8JA 5LJWA 2RMLA 3WZ0A 2RD5C 2BQRA 3G96A 4CJQA 1NPKA 2HOEA 2E66A 5KT6A 3RTVA 1RTIA 1PJ5A 3C15B 1N36J 3BQ1A 4XDDA 1YIJN 3M32B 5M1NA 1CJTB 5AZIB 2KI2A 4FJMA 5EHHA 3JQKA 2C3YA 4CJPA 3K8VA 3CWJA 2FHJA 4Y2KA 2DGVA 3VGVA 1A9NB 2KM8B 2Q0RA 2HBRB 1J27A 4TLQA 3HT3A 4DWIA 3SEOA 4M5JA 3OVAA 1YJUA 1RWUA 4E8UA 4J9VA 3GFYA 4JV5F 2EW9A 1EQMA 3WC0A 1GAOA 1VQPN 4DTOA 4YDUA 4E7HA 2QA4N 2XNRA 4C1NK 4Y0FA 3L9ZA 4OFZA 3L2WA 3PIOQ 4NASA 3WNEA 3GG0A 3Q2TC 3A5OC 4WE1A 4UY85 4I9QA 2DHSA 4CVNE 3IRXB 4OI4A 3QEIA 1U45A 3M7VA 3V9ZA 2HF3A 3NAHA 1QDUB 2G2YA 2E1RA 2DR8A 1YJWS 2NZCA 3UE2A 5AQQA 3D9BA 4AL5A 4BHQA 3BF3A 1AA1B 2J5AA 4A8MP 1LKZA 1NK4A 2I7PA 1VBKA 2E20A 4YDDB 2VJVA 3EGVA 3MM6A 4LFBF 4M63C 1SC1B 2IRXA 2VGNA 3EX7B 4JI1J 1S4EA 3CJSA 3ZEUB 2E1YA 4ATNA 4J2DA 2EFOA 2ZQBA 1M5OC 2QXFA 4JYAJ 3MAAB 3KKRA 3S01A 3HHLA 3QNNA 3DLRA 3HJFA 1BUXA 4IG3A 1HNWK 2UXDF 4IEEA 3IFEA 4B9VA 1MMNA 3FZLA 1NRKA 2HHWA 1KOOA 4K4TA 5DETA 4JI5K 2QFIA 4R8UA 1R0AB 1NOZA 1NJZA 3BSNA 4I2PB 4RWXA 4EYHB 1XMOK 3OXGA 2V8HA 2G1HA 3M6WA 3EY1A 2HIQA 2CNKB 1Q18A 2RN2A 3QFUA 5ADXA 3GPAA 2J6SA 5I3PA 4FW2A 4K5SA 1H1VA 4DCHA 4DV1F 3HP9A 4HH1A 3NP5A 3SNNA 4CFCA 4RW7A 2W9BB 3MCAB 2KHCA 1ELOA 1IBMF 2XI2A 3CERA 2V67A 3G86A 3B82A 3H1QA 1YDLA 3NCRA 2OD4A 5I3UA 2MMYA 5GMEA 1F9EB 2UXBK 5AZJB 1WKJA 1FRIA 1F0XA 4MIWA 2OI2A 5I3QA 1K6YA 3C16B 4X62K 5IC4B 1XEZA 1UW4A 4CI6A 1OYDA 3NF8A 2FSKA 4HR2A 3EE3A 4LFAF 1IKYB 2DNLA 2ZBRA 1MLAA 3VN5A 3W9HA 3BM7A 2P9KB 2AV5A 2F8TA 4TYAA 2XYGB 3A12A 2HSTA 4JI4K 4OIXA 3GYNA 2RSQA 4J9RA 3ADAC 2BOPA 5CABA 1S72N 4ECVA 3PYFA 4LF9J 1T9VA 2R2RA 2UUAF 1RT4A 1KTVA 4K2XA 5KT7A 1TL7B 4FLZA 3V6DB 1T03A 2XS7A 1BIUA 3IS9B 2XEXA 1NGFA 2JFKA 3UFCX 3W2WA 1G6BA 2DHHA 1RUSA 1WACA 3US5A 2UZAA 3H42A 3UO0A 2P9UA 1W2IA 1RTJB 2FZGB 3FBBA 4WQ4A 2VC0A 2ZDPA 1ZAVA 1Q86T 1IG9A 1HBMA 2HHUA 2O4GA 2OKQA 1UAWA 4A62A 2CNNB 3CE8A 3DLEA 1X7VA 3UDCA 1OH8A 3CMEN 2EVZA 3ENOA 3HTVA 4BC7A 3VWSA 2O8CB 1TU0B 2BZ2A 2NXEA 3CCVS 4X66J 4IEIA 4PUOA 3OYAA 2LSNA 1T3OA 3QYYA 2MKKA 3OS1A 1HQUA 4YR3A 2KG1A 3ZSQA 5IT9O 1P9QC 4BGAA 3AXMA 4WQ5A 4HHJA 4BR0A 5BR9A 4IJNA 2YQ3A 2DR5A 3DWLA 2LEPA 1E6YA 3AY9A 2VQEJ 4C2MA 4FF3A 3FE1A 3IC1A 4ZVFA 5CCMA 1BQXA 1FO1A 3R5BA 1H7XA 4JI3F 3CC7N 5L39A 3E9OA 4Q5VA 3C8YA 3P4IA 5J2NA 3KK3A 2UXCF 2AJFE 2VFTA 3VQAA 3EXCX 3H1VX 1JKHB 4USUA 2L48A 2DH8A 4N77A 1WSRA 5IFMA 2F65A 1WC3A 3HVWA 3A3OB 2MEWA 4EFAC 1G1XA 3KG1A 1QY7A 2XSFA 1SJ3P 4YOTA 3SQOP 4TXSA 2J76E 1WOOA 1FJEB 1WSVA 3VEVA 1R59O 4IJAA 2HZCA 1TFWA 1WNSA 5HLFB 4DPXA 2JSXA 4CTAA 4XPCA 1V3RA 5SUHA 4CO3A 4GRSA 3KJVA 2GMJA 4FVMA 1EAYC 4AQYJ 3D2FB 2MLXA 2MLYA 2GMHA 3TYTA 2WOMB 2YNFA 4BVPA 4KGVB 2Q6CA 5IC6B 2NNWA 4V19J 2CYYA 4IKFA 4JK7A 3A4TA 3CIPA 2O8EB 4ZHRB 2VASA 4ELTA 2IVFB 2QO3A 2ZGYA 3A5MC 1S1TB 4M5IA 5HROA 4ILJA 2FLPA 1SV5A 2N4CA 2DK2A 3ZLJA 4QWEA 3IM8A 3R6GB 1NKEA 4WYWA 2DJWA 3OTOJ 3ZSWA 3MN9A 2HVZA 5DRKA 1M1GA 3KKFA 4OZ5A 2K7KA 2YXLA 2JL9A 4GW6A 4B3RJ 2H51B 1MN9A 1M5VC 3GE9A 5JICA 4HUFA 1NHVA 1JL1A 4DU1A 2W25A 3P38A 1HBNA 1S79A 3WQTA 4DB3A 4O23A 5CAAA 4JYAF 4ID8A 2HRTA 2Z2YB 2VFSA 4HDHA 4WQ4C 1R6YA 1B70B 2V8GA 3MEKA 2K8GA 4YB6A 3W0LA 2IPOB 1U8WA 1GT8A 5HMWA 1UFLA 4CIEA 2FC9A 2W4CA 4C97A 3UN2A 1OH6A 3BDPA 2QEXN 2FHJD 2BJ7A 4M5HA 4UT4A 5GAHU 3M6UA 1CQMA 4N47A 3GYGA 4M3RA 1NK0A 3MXHP 3G10A 5C10A 3MM7B 1VSEA 4OYAA 1NKCA 1N4LA 1RBSA 1S7IA 1TFYA 3TQEA 4ZCKA 2FJAB 3NGSA 2CVIA 4M7YA 5KFWA 2R7SA 1NGHA 3T5KA 2Z2ZA 5AJ3K 3O6WA 5DMRA 2FSJA 4BR4A 1ZH5A 2QKKA 2KZZA 5KFCA 3BZCA 4UOHA 4NMXA 5KOWA 2XCPA 4G1IA 1J5EJ 3GCXP 1XHXA 4OX9K 3CC4S 1RTDB 1V3SA 4PKGA 4JS5A 4X65K 4OKKA 1L5UA 1Q16B 4ZVHA 2ACMA 3RBDA 3D1QA 2Z2LA 1LK5A 4NCAA 3RMBA 2CQHA 1EETB 4A5BA 1N34F 2FVQA 2WC9A 3TAFA 3OYNA 1YHQS 3CF5Q 3CJ5A 1EXQA 3RG6A 1T3NA 4FPBA 1S1UA 4ZVOB 3C3LA 2P5GA 1NDLA 2MQNA 4IG0B 1TL3B 2FUG9 2VG7A 4RW9A 2F7VA 2UV8G 2NLWA 3DXBA 4LSZB 4W5NA 3V1OA 1HBOB 3LGNA 4A4JA 2BE9B 3RSEA 4JI8J 1KBRA 2CPJA 3SZ2A 1CQNA 1NJYA 4DV7F 4BDZA 4I6MA 2HAIA 1RT2A 2M5YA 5GAHP 1N34K 2IVMA 3IWLA 4PR6A 1NJWA 2BJ9A 4FYYB 4ED4A 5E33A 3DOLB 1P9YA 2N7YA 2HGLA 2VQFK 4UOFA 4FF1A 4J2AA 1BY9A 3U3YA 2FLNA 4DLEA 4RCHA 1RAFB 1WAFA 3PIPQ 2NPIA 1NGEA 5L8RC 4MJKA 2J6TA 3H8YA 1U1NA 4CBUA 3QDKA 2Z1JA 4JD2B 5AQPA 2MKIA 3P96A 3CJ0A 2DNHA 4JP8A 2EK1A 2CQBA 3ZSYA 1HHTP 2XMTA 2G8IA 1NGIA 2OEJA 2O8DA 2IC3A 2E7WA 2VPYB 4CYUB 1GQEA 1SI9A 3MEDA 3TARA 1KEKA 3P83D 5D0GA 3WHIA 5JS2A 3FZBA 1K73O 3D68A 4ZPWR 2FF3B 5HN0A 2AP1A 4JI0F 5D0HA 3DRPA 1WEXA 3S3NA 5AFUA 1FD2A 1RDRA 1ZM4A 1RT1B 3ITHA 3SMPA 1J9AA 4IO9Q 4O44B 2AJ4A 4ZIWA 5FPNA 4J37A 3K58A 3UN5A 3NMUA 3UNGC 5KT3A 1VJQA 2R8JA 3DMJA 1NGDA 4LSLB 4QWDA 2ZH6A 2CQ2A 4JRQA 1O51A 1W7AA 3JAMY 2WONA 2ZE2A 2EFVA 1MDUB 2HFNA 1G3OA 1AZSA 3PFOA 4BBYA 3P1GA 1S10A 2MZ1A 3QAEA 4ZVTB 3NMRA 1FXRA 1GLEG 5E0OA 1OSCA 3PR4A 4TY8A 5CR4A 4TY9A 3H20A 1V9OA 1U47A 4PXDA 4B1XB 3PFEA 4DL7A 4N7TA 1YJVA 2ZC3A 2ATCB 3M8PB 4LF5F 4HI2A 2QTWA 3ZX2A 4DF8A 5AQHA 5ETSA 2MZSA 3KLHA 5CY4A 1TKXB 4FYWB 4DV3F 3CMQA 4CO4A 2OMLA 3SPZA 3H2VE 5DGBA 3D2WA 3NWGA 1N52B 2XI3A 3ID8A 4P72A 3GU0A 3GV7B 3VOVA 3NF9A 5B0BA 3MEGA 4M3XA 1GOBA 4K4WA 2A1BA 3QFWA 4K0KF 3JTPA 3M8YA 2PFDA 1HR0F 1AT1B 1CULA 4OYIA 5BN9A 1RDUA 4M1KA 4WFYA 2XQCA 4JB8B 4NI2B 3S6EA 1VRTA 3TAMB 3TJ8A 3Q0AA 4WU2A 5KFGA 3TUZC 2OFGX 1RBRA 1S1VB 4DPOA 3R7SB 4QWAA 4QYZK 3H2LA 4TQRA 3CFOA 3LL3A 2GGPA 3G71N 3T1HK 4ECSA 4K2JA 4XO0A 1JJCB 1VRQC 3VGUA 1CXUA 5FRNA 2DGSA 1UWAA 2FPHX 2NXCA 3N4PA 3E8OA 2OO4A 3CFPA 3DOLA 4DTNA 1HYVA 2CGJA 3SUQA 1GLLO 2F9TA 4ZPCA 4DR7F 3CC4N 4LSNB 3FFKB 3A5LC 3TUJC 1X9JA 1FXXA 4WFNQ 3D0HE 3C66A 4JI4F 5LL6d 1T94A 1FDBA 2LQBA 1ICEB 1VQLS 2GV9A 2YVSA 2LFVA 3ISND 3GIKA 1HIYA 1YGYA 1RDWX 2Q36A 4YQWA 1OY6A 3VQSA 2ASOA 3QWUA 4K4VA 4JI6K 4KIAA 1V3ZA 4KPCA 2IVOA 1WG5A 2GQ2A 1FVSA 4R5PA 2A2CA 5HP1B 4O3NA 2HQ3A 1EB0A 4QCLA 4DU4A 1YI2S 4CJUA 2FBTA 4PQUB 4CFAA 3Q83A 3OS2A 2D3ZA 2YX7A 1YUWA 3R3LA 5EY4A 4JI3K 4DEZA 3QGHA 3T9NA 4KKOA 2BV3A 3O3GA 3NGYA 3KG0A 3M8QB 1S77D 1H0HB 1QVGR 4ZPAA 2HRYA 2KDOA 2AIRB 2WK4A 3VVTA 3G8QA 2M0GB 4X84A 4KFBA 3VGMA 2YQ0A 4ITSA 3H3NO 3CJKA 1U09A 4ZVQB 6AT1B 4PKHA 4LUBA 4B9TA 3OYHA 4LH5A 3J7YP 2YKNB 2HF4A 3CJCA 3H5SA 1VIOA 2FZCB 5IV4A 4OHYA 1L3KA 3H90A 4YOWA 1KQFB 4C8OA 1HKCA 5DM6L 1X9MA 4X64F 2B4PA 3VEZA 3NOCA 1BGXT 1Z2LA 2D3OR 4F2SA 2E2OA 2ZNYA 2PD1A 2W8LA 4FOIA 1I5OB 2RU9A 1SKSA 1HNZJ 4IH7A 3EJMA 2WVDA 4WP3A 3LPYA 2H5JB 3M2VB 3H6EA 3PRVA 3PEHA 4UZBA 3VPZA 4CHNA 4HI1A 1I3OB 2VIHA 2VA2A 4P2FA 2DCUB 2KYXA 4X4PA 2B6AB 2J0WA 1JCGA 1T7PA 1WG4A 1Y5NB 3HZGA 3PM9A 4G1QA 4ED6A 1D9AA 4PKIA 3AD7C 3M6GA 2KHDA 4DX8H 4N5SA 1VSLA 2QKBA 2MJUA 3WXMB 4QYRA 2UVRA 2ZVIA 1FNXH 2G8UA 4N8NA 1Q78A 3R5DA 1SQKA 4JKCA 1VHFA 3A8YA 4RO0A 2JJ4D 2UUTA 5LJ3Y 4F3QA 1NGCA 1FKOB 2G13A 1JXVA 2Q2RA 4DV2K 3ZT2A 2FXUA 3MMBB 3W9IA 1BQMA 2W4DA 2VJUA 4Z7YA 3OR2B 4C11A 5EU7A 4DPTA 2B7CB 1HNIB 4IOBA 2HVHA 4M5MA 1EP4B 4ZVSB 3N6NA 4BRGA 1X5TA 5I42B 3ZFVA 3R2CJ 1C1BB 4AD6A 2JLGA 1BI4B 4OL8A 2E5GA 4NCBA 1N34J 3VAKA 1TL5A 4C8NA 1HFEL 5GIOA 3NHGA 4DV6K 5KFOA 4NO7A 2KTQA 2GWJA 4W5QA 1M1KT 4BR9A 3DC2A 1VC6A 2VKZG 3DCAA 3B6OA 3GE1A 3UR3C 2YHBA 1ZS6A 1QE1A 3UW1A 4OYXA 2DXEA 1KKHA 2NRTA 3FC9A 2QN6B 1WSGA 2KT5A 4PG4A 3ZC4A 2W42A 1NSPA 1IJEB 2HWTA 4B1VA 1T11A 2MZQA 5J2NB 2MYFA 5BRDA 4HUEA 2QL9B 3SUNA 4DQPA 3CHWA 1DRZA 1HI8A 3K59A 3IBCB 4FJ9A 1R89A 1X5PA 3VEYA 4IH5A 2X3GA 2QLFB 2F40A 1F9HA 2QX0A 1N5SA 4R0EA 3RVCA 3CCRN 5A8WA 3RBEA 1E6YB 4EMDA 1N8RT 4K0KK 1RT6B 2OTJN 3LP0A 3UDVA 2H54B 3KK2B 3PVXA 4EO6A 1CS4A 4BR2A 1FD8A 3D54A 1ZBUA 4B1WB 1BE4A 1VQOS 5MAOA 1YIJS 3RYLA 2IHR1 4CJ7A 1TKTB 1NBEB 2BKOA 4DJBA 3AGRA 1FF2A 4MAKA 2CGLA 2CPEA 1WHYA 3HLUA 4CJWA 2QIFA 3BP8A 7AT1B 2HZAA 3D3BJ 5KFEA 3KJQB 3LPTA 3KLHB 4P2MA 4CEQA 2CAJA 4FJ7A 1KAYA 1FWLA 4HTJA 1RT3A 4E7IA 4O0JA 1VI7A 1JLFB 5IT4A 2GQQA 4KHUA 3BO2A 1JXEA 2HQIA 2B9XA 4KHWA 3GJTB 4X65F 5CXTA 3SMZA 4ANDA 3ET6B 4LF1A 5K9FA 1J5OB 2A6AA 5K5MA 1FXLA 2E9TA 1ITPA 1R31A 3MM8A 2V63A 4LVOP 3PDNA 2DY9A 4JI5F 1BCOA 4B8CA 1Y3JA 2EFQA 2HS4A 4NA1A 3O5TB 3J81U 1RTZA 2LA6A 5KFPA 4HTLA 4DUYJ 1TUYA 4JKAA 3DMJB 2QLBB 3S8SA 2DIUA 3PJ9A 4FXDA 3OTCA 3PG9A 2ZH8A 2Q31A 4OYBA 1PC5A 2BRLA 2RJZA 1FJCA 3M8SA 3Q7BA 4DV3K 1IKYA 1KHWA 4P7TA 3ZT4A 2R2TA 1ACMB 4P52A 4LF5J 2E2NA 2QTDA 3ZT3A 3Q22A 2XMKA 4A8FA 5E3QA 5FLXY 2D1CA 1G7CB 1RZMA 1TAUA 1K8AT 3KHRA 4JV2A 1DBDA 4NYNA 4NX9A 3SQ1A 3H3OB 2VODA 3QETA 4AQYK 5C24A 4DCPB 3TSUA 1LEOA 2GA7A 1RTHB 3ILJA 2MLZA 4WQ5C 4BG9A 3IGNA 5HVHA 2QEXS 4I7FB 1QTNB 3THWB 1HD1A 2YNIB 4RW7B 3MZIA 3ENBA 1MMDA 1HBUA 1X9WA 2D5RA 2EG2A 2CQDA 2HGMA 1SXLA 1PAEX 1BWFO 4JV0A 4QIFA 4FLYA 2W2NP 2ROEA 3TEHB 1BL3A 2WW8A 3OV7A 3CQXA 4CJTA 4PY5A 4K7QA 3MK6A 4MIBA 1BHNA 4AQYF 3S3MA 5D78A 1N48A 1RWKB 4UW2A 2B4VA 2FQQB 2D0OA 4LFAK 4A5AA 4NRTA 3R5JB 2ASPA 1D09B 1REVA 2DNZA 2BR0A 1F9FA 1RHQB 1OY8A 2VQEK 3E9LA 1IBKK 3QSIA 1U25A 4C0HA 4MLEA 3QPIA 1HJOA 1EX4A 4KI6A 3LUYA 3K7RA 4TY8B 3CETA 4L73A 5A8RA 4MK9A 5DM7L 1GLCG 1WF2A 2KN4A 1SVDA 4OZ2A 1VQPS 4QPXA 4BVOA 2WONB 3DLLQ 1SH0A 2NPFA 2W01A 4CCHA 2EBGA 3H0PA 5GVQA 4BWMA 1YHQN 4XH4A 4OJ3A 3WQUA 4YHHJ 4YFUA 1LXNA 5J2PB 3TO8A 1D9FA 1BG3A 3PX0A 3J81j 1YZ7A 1RADB 4DQQA 3W1YC 1UVNA 4DTPA 2DFHA 3VF2A 2XMJA 1YJTA 3O1LA 2HHSA 4LF9F 2JZ5A 2IAJA 1JL2A 3WNFA 4FS1A 2F3JA 2YNGB 3O80A 3X1LB 4DR1J 2C3MA 1U4BA 2DRBA 4HT7A 4CIOA 4EBEA 4H8KA 2HMIB 1Q8IA 1RA6A 3GMGA 4DSLA 4WXOA 1FVQA 2N4DA 3SAHA 2O8DB 1CC7A 2RVJA 4BRIA 1TKZB 2ZH9A 4M5LA 3KLEA 1CJUB 1Z6RA 3OYIA 2VB6A 2HG4A 4AHCA 2XSJB 5E3AA 3TWHA 3MMVA 4WWSA 2YHWA 2VICA 2EKNA 3EE8A 5AJ3F 3KDNA 1OIAA 4RX6A 1S7HA 2O67A 1JMTA 4F0KA 2KZMA 3HULA 1FFGB 1IH7A 2EKYA 1YITS 4OKJA 4DTXA 3I0RB 5LSRA 3H25A 5ADXH 1IR1A 1XQSC 3CFRA 1K0VA 4QS7A 4C8ZA 3VQTA 3AVKA 2HS0A 4H4OB 4FS2A 4AL6A 4DR6K 3CO9A 2CJYB 1T6CA 5CYQB 4PWUA 3PUFA 1QE1B 2CUYA 5HL7L 3D0GE 4NEZA 2ZBCA 1VOMA 1RWPB 2CG8A 4EGLA 5DZ7A 1GLBG 4CH7A 1S3XA 1XNQK 3NH0A 2LU2A 2XC9A 2WSEC 4DV4K 1BOTO 1HYSB 2GHWA 3M6VA 5E84A 5I42A 1TUVA 1H3DA 2AEMA 4WP9A 8ATCB 3OYDA 1YJNN 4OHWA 1D1UA 2W2QP 1LWFA 1WOQA 3VAMA 2VFUA 4BE2A 1EKRA 2IJRA 4OV6A 4K43A 1KVIA 2XSJA 5T14A 3R27A 3PHEA 2HHHF 4CJKA 5KQ8A 4NXNK 2A2DA 3D45A 4LR7A 5AQIA 1VQYA 3GFHA 2HK3A 2QL5B 3F44A 2CWXA 1XMQK 4FWOA 3Q8PB 1F2HA 2KXFA 2P9GA 2XHBA 3RAMA 4YNQA 3NLCA 3FK4A 3KUHA 3AA4A 5D3GA 1FJ7A 4OYMA 4A8YA 4DPYA 3ZZZA 2JH3A 3L4BC 3ATUA 4FVCA 3HOSA 2X1FA 5IZHA 3PACA 5K20B 3J7YI 4RNMA 2XMUA 3HI0A 2N3LA 2V69A 5EXWA 3EYZA 2QM1A 4ECZA 1HWIA 4PXEA 2YKPA 3ULDA 2V52B 3MD1A 1RHUB 2ASLA 3J8AA 2ASYA 3HO1A 4IR9A 4JV5K 1RNHA 3HSDA 3VTHA 5LXYA 4JV5J 1REGX 2OP5A 3CC2S 3D3CJ 3GB0A 4E89A 1M1HA 1URRA 4DR2J 4KQZA 4NWBA 2DNYA 4UOGA 2HHXA 2U1AA 4KGMA 2ZJRQ 3AD8C 3AQOA 1K8KA 1RT5B 2XO7A 3CD0A 1Y64A 4O4RA 1WI6A 3OYGA 2YKMA 3MXIA 4JI1F 1LWCA 1EHWA 5FJ4A 1IM6A 3AOCA 3NGTA 3E9PA 3DLGB 1RBAA 4EK2A 4F04B 5KT4A 2HS3A 4CT9A 4FLXA 4H0OA 3SFUA 1VSFA 2WB1D 2CJQA 3LQVA 4HYKA 3HSGA 2X1BA 3ZZOA 3DRSA 2V6AA 4WTOB 2KFNA 2AZ1A 3BYPA 2WBMA 4HHTA 3B8AX 2N82B 2RF2B 1S5ZA 3ZTPA 1HNZF 1APSA 2O8BA 3SCLE 2R7TA 1LW0B 3B8HA 1Q1KA 2JGUA 3KHYA 3O3FA 1HKBA 4RZRA 5EN1A 1WUUA 4NLYA 3U3GA 5T7BA 2GJIA 3ILOA 4CTAB 1IV0A 2KRRA 2HLTA 4OYZA 3FKBA 1U2CA 5F9NA 5AQUA 2Z56B 4J9QA 1VS3A 1GH8A 5KFTA 2Q3SA 4NLCA 2ALZA 3UCZP 1LAVA 5HRNA 1OPIA 3TTDA 1RCOB 4AL7A 1J5EF 4AM6A 3CCMS 3U02A 1MG7A 2MKSA 5AQNA 2ILYA 2MQLA 4QBUA 2E44A 1MWYA 1Z2ZA 4F4KA 1EJ7L 4J2BA 1HRHA 3MXJA 1QZ6A 1B0VA 3MEEB 3OS0A 2XMWA 4NLPA 3VQ9A 1FTCA 4A59A 3QFPA 3A3PB 3CJ2A 3R9PA 3TA0A 1MWZA 3MX5A 3CG7A 5LMUF 3CMES 1W97L 4NRUA 3OT9A 4A48A 3KTQA 1RWWB 3TTCA 1IWAA 4Q45A 3DNCA 4FJXA 1VDHA 3VGSA 3EN9A 3TVYA 4ZVEA 3RB3A 2B4UA 3BPDA 1WJ9A 4B9LA 1DZ5A 2AJ0A 1RFQA 3D67A 2D74B 3V2UC 1WSJA 5C42A 5K8OA 4CHYA 3CDUA 3TSPA 4CP5A 4DHYA 2VBXA 1U49A 3VR1A 3TAEA 3M8PA 2BMBA 2BJ3A 1WLJA 4FJHA 1NLVA 3DLBA 1QAYA 3PW4A 2C2ZB 2J7KA 2IS3A 2RUSA 3MAAA 1SJQA 3TVZA 3KWIA 3DYAA 2HW3A 3QNWB 2ATLA 4BDPA 1O13A 2PFUA 4PABA 4LC9B 3LP0B 4A8SA 2H48B 1HR0J 3GG1A 2OHDA 2Y8YA 3TAQA 2Y3YA 4DMNA 4GC7A 4M63A 1X5SA 4IO9L 1PBAA 4OI6A 2RNEA 2DISA 5C12A 4L76A 3IO1A 4CD3A 4O44A 2QYCA 3T41A 4CWBA 3PEJA 1RAEB 3T5LA 2DO4A 3UVJA 5BJRA 1TK0A 3H4BA 4Z4CA 2HB5A 3C16A 3CULA 4JI7F 2EX3A 1S57A 2LDYA 5DG7A 1XNQF 4CD1A 4JOUA 4NEYA 1O6XA 2BX6A 1ZYQA 4CIGA 2M3DA 3GZ7A 4A46A 4ZLJA 1BI4A 2NRHA 3V6KA 2QMWA 4DCOB 1UEVA 5HJXA 4OZ3A 2HZVA 1Q82O 3ILIA 1A5WA 4ZN1A 3UDEA 4C11B 3ZZYA 4QZVB 2V68A 3D1OA 5EVZA 2DO0A 5HRPA 3F73A 1YJNS 5HSPA 1MMLA 3SSSA 2RF2A 1TQLA 1H72C 1RWNB 2G4BA 4USMA 1R0AA 3HHLD 3QLHA 4GO5X 3L7PA 2HBYB 2QRRA 1ZBLA 4J9MA 3CD6N 4I6MB 3MR7A 1NK7A 5ITHA 3H46O 1FWPA 2LEAA 3AVBA 3GJRB 3O1WA 3QBXA 2DNMA 1FX2A 2OEMA 4NLDA 3DLGA 1SIWB 1KDNA 2KYZA 3R8EA 4ILGB 2QMUB 5DLGA 2ZM6F 1K8KB 2RPIA 4DTSA 2E2PA 3CCZA 4GKJK 3DRXA 1GLJO 4FWRA 4DU3A 4GVEA 1IBLF 3U7JA 1ZPVA 1VSHA 4LMZA 3BJYA 2OPPB 3FR0A 3T19A 3Q8QB 3T6JA 1N32F 3KJFB 2XY6A 3VV2B 1TKDA 1RBLA 1YVNA 3N01A 2D69A 2KLAA 1RWVB 2B43A 2BUNA 5KTQA 2DVIA 1U2VB 5KOXA 4WIIA 3EVWA 2NUHA 2HHHK 4DL3A 3N5FA 3R7BB 2VD3A 5F2RA 2HMIA 4F36A 1PAUB 3JSYA 4TLRA 1TL1B 4CLLA 3AH6A 2GQCA 1H7WA 3O6QA 3LPUA 3DI6A 2XLJA 1VIXA 3IR7B 3QERA 4RNHA 1ZTWA 3L09A 3O08A 2BE2A 2Z8QA 3NVMA 3HXMA 1KR4A 1N8RO 1N0UA 1WBDA 4KYZA 1NXIA 5LMNJ 4DX5A 1VAZA 3ID6A 2HIYA 4KKOB 2JVRA 1PC4A 3OQ2A 5B0CA 1ZBFA 3AVHA 4KB1A 3C6UA 2POKA 1U0HB 4ZPDA 1JLQA 1S0NA 1WC0A 5E3RA 1WDDA 1M5HA 3AQPA 4KRWA 5IWAK 1N5YB 1NGGA 1U8SA 4DZ6A 4R5PB 3Q8UA 3H4DA 1HYZA 3D5MA 2QWPA 2YKAA 2NR0A 2FJEB 2HBZB 1MWQA 1KAZA 2MHNA 2QLXA 3T5HA 5EX3A 3CQYA 2G8KA 1C0GA 4FWKA 2KXHA 1XBWA 2OPQA 4I2QB 2GHVC 2HFZA 3M05A 2OPRA 4LF6J 5B0GA 3R1XA 2KG0A 4ZLNA 3OHBA 1WC4A 4KO0B 1K1QA 2EI5A 3AOAA 3VEXA 3MECB 1REVB 1M1KO 1T9TA 2ZHOA 1BC6A 1R8BA 2EC2A 4QIGA 1X5OA 2AGPA 4RTFD 3CCJS 1V4TA 5AXNA 2G2ZA 2BW7A 4C8LA 2DR9A 3FRYA 2XTJP 4NE9C 1XERA 2JEIA 4DU8A 2YWWA 2MGZA 3I55S 3OFFA 2V4JB 1N54B 3O8MA 4A61A 1NJIT 4DV2J 4Q0BA 2WOMA 1KVKA 2NSBA 4DV4J 2OPSB 2ZHAA 1TZ0A 1XNQJ 1N36K 3ELHA 3MECA 1GOAA 1Q7YO 3R5GA 3MAHA 3CIZA 3VETA 6FD1A 5LL6Z 3AO1A 4B3RF 3KUGA 4DSJA 5C24B 3L2UA 2O8FB 1NPPA 2FLLA 2VZ9A 2Y8WA 2XM3A 3IG1B 1RHMB 2R8HA 2H4YB 4WPAA 2N7CA 2XLIA 3D1HA 3THXB 1UTAA 3THPA 2QGFB 2KRBA 4OHXA 4UQTA 4B3SF 2D3UA 3IM9A 1YLXA 2VYPA 2CVEA 5KG4A 3DLHA 1FXDA 2W7AA 1YT3A 2ZH3A 4BE1A 3AB4B 1RLDA 2CH5A 3OJUA 4QU7A 5F41A 4IRKA 4J8FA 2NLXA 4OZ0A 1NK5A 4X4VA 3Q8VA 4GVLA 3NBPB 1HHQA 2DHGA 2PEHA 3SDEA 5LOQA 1AW0A 5EUHA 3RAQA 5BYRA 2A5XA 3H5XA 3L4QA 1X9SA 2ASMA 4AUKA 4RWTA 4UTGA 1K8AO 5GADP 3AVFA 3DYAB 2ZBPA 4DR1K 4RNFA 1VC5A 3PHTA 4B3TK 3E01A 4QOZB 4ES3A 2EHGA 2GIFA 2D0PA 5EWGA 3RB0A 1HMVB 2YKQA 3CPWR 5KFLA 4DR1F 3D6RA 5CD4A 1U2VA 1EQYA 3QEXA 4CGHA 4ISEA 3NEKA 5CYMB 2RHSB 4X4TA 4O55A 2QYGA 4LR8A 1LWEB 3QT7A 3QNOA 1ROFA 2DNPA 2XO6A 4DF4A 3K9KA 5CA5A 1JJ4A 3BZQA 3OFEA 2ZITA 3AARA 4W4MA 3K2YA 2CIMA 2MPUA 4JI3J 2PGCA 3LO3A 3TANA 1D0EA 1AB8A 1R43A 1X4FA 1DQ9A 4ZCMA 4KBIA 1H74A 4FM0A 2H3GX 2YHAA 2HFSA 3RJMB 5KFXA 3TNVA 2KT3A 4DOZA 2VDIA 2HPUA 1CS4B 1GFWB 2G0JA 1DLOB 3JTOA 1KD1O 3RGIA 2ZJQL 4U9RA 2R8GA 2ZM6J 2CQGA 4LF4K 1T0TV 2QWNA 2V2QA 4WU3A 4PYDA 1IBKJ 2UU9F 2XWYA 5FPMA 1U7LA 3TSQA 2UUCK 4BGBA 3QLHB 4DR5K 4PWDA 1HJRA 1L3VA 2GWKA 2ZJPL 4FKYA 3CCQN 3ULEB 5HANA 4KHPF 5AQVA 3OYMA 1U2RA 4ED2A 3TVKA 1W9HA 4H5WA 3I31A 3QGPA 2YY3A 4W98A 1JLGB 1YWXA 1N88A 4ID1A 5ETLA 4NXMK 4BREA 1HL6A 4Q7AA 2FY8A 5HJYA 9ATCB 3PIPL 2L9NA 1JCFA 3MR3A 1SL1A 3KD1E 2DT9A 4C8KA 4H0XB 3JTNA 1FRHA 2ZM6K 4S0MA 2CRLA 5AE1A 3TQ1A 2KT2A 4AT1B 2OTLS 1L3UA 1YK9A 2QT7A 3GJSB 4O5BA 1J5OA 1S49A 5GMDA 1E4FT 4FXWA 2V2KA 5GADU 3BO3A 3AVGA 4QIVA 4DUZK 1B64A 1YVUA 1FE4A 1EETA 2W9BA 2Y0SD 1KQKA 1HPMA 2HVIA 4ZPBA 2CDRB 1BXNA 3OL7A 4J9KA 3QMLA 4D3GA 3O4QA 1NDKA 3U1NA 4MFBA 3I33A 3DFEA 3R3TA 3CPEA 3QGGA 4LF5K 4Z4GA 3QT5A 5F8NA 4DR7K 5AXKA 3Q8YA 3BGRB 5DDPC 4GVBB 4M5GA 3MUMP 4ECYA 1CVJA 1IBLK 3G9CA 1Y3KA 5CD4H 2C3UA 3W60A 3TP2A 1HNXK 4KTQA 4RW4A 1B3TA 4NCGA 3WXLA 5KGXA 4GKKF 3HVRA 2P9EA 1NM1A 4EBDA 3F5TA 2H4WB 2EEYA 1HWJA 3DOMB 4Y3CA 3I4PA 3ZNUA 1U1LA 4B9MA 1WF0A 3DOMA 1SC4B 4KTWA 2VG5B 1RT5A 2YWHA 2IDOA 1BO5O 1VBYA 3B4DA 4E1JA 1C4CA 5KFAA 1T05A 4A2AA 2DRDA 4RW4B 3UDLA 3RW6A 2GW8A 3SI6A 2W7OA 3LANA 3PW5A 1VQLN 3BREA 5HRSA 4FJJA 1VCTA 1FNOA 3OBWA 2IVYA 2W2OP 2FJWA 4KHMA 2AW0A 2BGGA 1T95A 4ZTFA 4K8ZA 4ZP9A 4OGEA 1UEKA 4CZKA 2YPYA 5EOYA 2GIQA 3IR5B 2D7SA 2GO9A 2L08A 4WFZA 3TUIC 2AYMA 4QS9A 2EFNA 4BACA 5SZTA 4OJHA 1PYSB 2YKNA 4FK4A 2W41A 2DR6A 2IBOA 4IR1A 3GSIA 3C95A 4CEOA 5BYQA 2BBEA 4OI0A 1N56A 2G8VA 4ISFA 4U7CA 2NRXA 3PX4A 3DLKA 3MI7X 1QHTA 3K2PA 3SSRA 1F60B 3N5BA 2KKZA 5FDLB 1JNRB 1SL0A 2XY5A 4PA1A 1Q8BA 3AD9C 1KD1T 4ZHRA 1RDBA 4F8RA 1EP4A 4M94A 1BD6A 4F4YA 3OR2A 1LWFB 5E5NA 5LXRA 1BQMB 3N79A 2VQFJ 5IM0B 3OLBA 1YI2N 1SQGA 2ZGZA 3D2FA 1T44A 3FUYA 1JCEA 1HYSA 4MLHA 1FRLA 1MN7A 2IM2A 3HI9A 3C15A 3T5JA 2WUSA 3MMJA 3THYB 4ED5A 2A42A 3TJAA 1FK9A 1OSDA 5CYQA 2Z2MA 1EARA 4PHTX 3OL8A 4WCEL 4ZLLA 2UXDK 1RA7A 2ZUGA 3LZJA 5AQMA 4DFPA 3NGDA 4O4GB 3KG4A 1ZM2A 3IAS9 5J1EB 4BC9A 3C2PA 3HT0A 3UKUB 3M2VA 3JYTB 1UJ5A 2C2DA 3QWPA 1CLFA 1WUAA 3WBZA 4FK0A 4RBTA 2O8BB 1EO1A 2X3DA 4LRCA 1Q8LA 4USKA 3AXKA 4DUTA 4WTYA 1NNDA 3J7ZT 1DGKN 2AF6A 1A0OB 2OUGA 2NUBA 4Q2MA 1HQEA 2V4RA 5CYMA 2LVWA 3NE6A 1TKZA 2NYIA 1N36F 1T6DA 4IOCQ 4M45A 4YOXA 4P2SA 2FGOA 3E01B 1WOPA 2Y0BB 2B5JA 1D4XA 3IR6B 2E4LA 4W92B 4Z2XA 1YTAA 1Y97A 2ZJRL 1ASVA 4CO2A 1Z1ZA 4QOTA 1K44A 5M2RA 3IWNC 1S9EB 4DTRA 4KFBB 5L38A 3O3HA 3CCUN 1RDAA 4PPDA 1LOUA 3GJQB 2GX9A 3AJ1A 4A2BA 2G0CA 3HD1A 4DKWA 4L3NA 4AILC 4ILMA 5J2PA 2YWGA 3A8EA 5KRSA 3QESA 4F26A 3J7AN 3J7AP 1YVFA 3KMSA 1VFJA 3ENAA 1XTZA 1IVZA 4GKJJ 1FNMA 5HO4A 5BREA 3D0PA 4DS4A 2ZUAA 3BKFA 4LFBK 4RWWA 4PG5A 3K57A 1CJKA 1PILA 4HL9A 1EIYB 3OYFA 4BS2A 1Y5IB 3BS9A 4LQ9A 2ZE2B 4CHOA 4J9PA 3OTOK 4F4XA 1S76D 3VAIA 2K06A 4LSNA 1HNXJ 4HVJA 1U1PA 4OI1A 2VA3A 1DQ8A 4B9QA 1UJ4A 3HX9A 4JK9A 5F8GA 4GNIA 5KFIA 4KTZA 2ROGA 2ZZNA 5TKYA 4Z4HA 3ITHB 2DGXA 5DS7A 2RRAA 3CCMN 2SXLA 1DJ0A 4FJGA 2P6TA 4AF1A 1PYOB 5JVGL 3KZBA 4TU7A 2J9DA 1C0MA 2R4FA 1OS5A 1YKWA 3THWA 4CJRA 5I3UB 4WFBQ 4HACB 4WF9Q 1MWKA 4FK2A 4ZPTR 4ZJOA 3M9MB 4KH5A 1CULB 3TTFA 4FLTA 2RHQB 5AE3A 2PBDA 3PNIA 3U1MA 1RHRB 3SQGA 5LMUK 1RT7B 2CQPA 1VSIA 4LF8K 5G0RA 3EWGA 2DHXA 5IT9U 4C6AA 5AT1B 1G4CA 3VGLA 3IBWA 2VPWB 2I0XA 1LWXA 3FRZA 4B3TF 3L8BA 1F3VA 1NGBA 5GAEU 4A8XA 2H5IB 3P49B 4CESA 1RAHB 8AT1B 1MSWD 3RSEB 4JI7K 1C2PA 3DOKA 4OYPA 4IFVA 5AE2A 3G6ES 2VFRA 2GJ2A 2HRUA 4OX7A 3V81B 4IG0A 3PXGa 2Z57B 5H9EJ 2CNLB 3IMXA 2QZ8A 3MM6B 3LP2A 4ERDA 2PEBA 2YWFA 4KB7A 3QSYB 1RILA 2K2PA 1X3MA 1VRUA 3C6AA 3AO4A 1H73A 3HVAA 3TWZA 2O1PA 4IOAL 5THWA 3LALA 1X4EA 1RTDA 4IFYB 4ENOA 3VQ7A 3L6QA 3GR1A 1M5PC 1A7GE 2FF6A 1K1SA 4W90B 4GMJB 4H0TB 4NLOA 1KQSR 3DRPB 3ATVA 3QO9B 4DSIA 2R7YA 1CJVA 1VSKA 4CK3A 4FCYA 2AKWB 5H1SQ 1OH7A 1Q9XA 4YHHF 4DFKA 3K9JA 3J81O 3OA9A 4ELUA 3BSCA 2VBWA 3NFAA 3JAMU 3OVBA 5KPRA 1U2FA 4PXBA 5IV3A 1Q82T 4O8UA 3W3DA 3N28A 2QWLA 1PJ6A 1CG2A 2FBXA 3KHGA 4USJC 2G9OA 3IN5A 4LF9K 4BE0A 3ZX3A 4ZTJA 2J4RA 3U6FA 2Y9HA 1RAIB 1FKAF 3O2IA 4CLSA 4V19S 2MJNA 4RW6A 1GMWA 2XBPA 4B3OB 4ZKAA 1GXUA 3SQGB 4OPKA 2AJ1A 2VOPA 1JLCA 1HNXF 2RS8A 4MT1A 4NLWA 2CZ4A 3AVIA 3EGZA 5E7OB 2AP6A 5B8HA 2BUPA 4R79A 4NZ7A 5LM7E 1URNA 3EKUA 4JHDB 5M1OA 1KRPA 2ADBA 1Q7YT 3HKZD 4L74A 2ATQA 3QFHA 1GK8A 4AE5A 4Y2AA 3ENHA 2YQ1A 4C0OC 1NJIO 3ETOA 4WFBL 3K17A 4WBFA 3PW7A 4OLBA 3T7ZA 1IUJA 1Y11A 3HSZA 4C3KA 2RE1A 2CFXA 3ENVA 1Q5YA 3BF4A 3WIUA 4GO7X 1QLNA 3DU6A 2QG9B 2R9LA 3F41A 2ASJA 3W66A 2Z1HA 5HBMB 3MMBA 3HYFA 4IKAA 1XMOJ 2DEJA 1OWXA 3HK2A 2C2RA 2NRRA 4MDAA 3ZT0A 4CF1A 2ABYA 3GIIA 3QIPB 1RLCL 3GQCA 1G99A 1TTHB 2FTRA 2NSCA 3ZZRA 4TU8A 3VQBA 5LJVA 2DH7A 5FIIA 1U04A 2AX0A 1WDTA 5FROA 2YCHA 1RXOB 2HSEB 2BJ1A 3MM8B 4LH4A 4XAKA 2QLWA 2KM8C 4U95A 1RWMB 4UUXA 5C2FA 3ET6A 3BYRA 3MMCA 4I6WA 5DGAA 1KSPA 2VDHA 1UAXA 2W2MP 3CM6A 4CEFA 1YSJA 1S1XA 2M8DB 1XUPO 3EICA 3K5PA 2ROPA 2OLWA 2OIHA 1KNZA 4ZN3A 4DZDA 2XZDB 3FZHA 3SCKE 1TUUA 4DL4A 4X65J 3IBFB 1WD6A 2OSQA 2PO4A 4USTA 4DTMA 3W7BA 3TR5A 2XZWA 1GMVA 2VBYA 3FBCA 3CMAN 1VK3A 2V8DA 1RDCA 1U0SA 3EUNA 2I38A 4NB4A 2A10A 9RUBA 2VKRA 3BR9A 3L0QA 3SI8A 3SCJE 2R8IA 2LXUA 2P8IA 1SQEA 3PYDA 2VU5A 4DFMA 5KFBA 1JWWA 4Y00A 1DEJA 1CPZA 1FI4A 4DR4F 1TVRB 3EKSA 4IO8A 3CC2N 4TU9A 2MY7A 2O8CA 2HHHJ 3O9UA 4QW8A 2DXDA 3UB5A 4ZJLA 3K89A 4F4ZA 2PI5A 4NXNJ 4JKHA 2Q66A 3DLEB 5C2CA 2QXLA 3L4IA 2DNGA 5KI6A 1ASWA 1N5QA 3DU5A 3DHXA 3R1HA 3JYTA 1R8AA 5I9EB 4KH4A 3KMQA 1NKBA 1KTQA 4CJ4A 5J1EA 3K5LA 4X4QA 4KHYA 1S97A 2E5JA 2PC6A 3D6HB 3ZO7A 1IBCB 5D77A 3THXA 3HVTB 1SUQB 1OO0B 3BN4A 3Q89A 2UUBK 2NS1B 2MHEA 1Q4RA 1KP6A 2AZ3A 2FC0A 3R5AA 1VK8A 1XIQA 1FJGJ 2DNOA 4DR6J 2YH1A 4X2BA 6FDRA 2AHOB 2VCPA 1I6JA 4YORA 3WXKA 1YAGA 1RT4B 4BDYA 3IDHA 2GS8A 4UZCA 3WXJA 3VQCA 1C1BA 3NKYA 2AYBA 1ZOTA 5DQIA 3M2RA 2XMAA 2BVZA 2V2ZA 1TGOA 4EP5A 5U47A 2ZHBA 3ZZ0A 2G8HA 4MH8A 5AQFA 1LW0A 2UXBF 2Q0UA 3T3FA 4XK8C 1LV5A 2NRVA 3NXZA 2HK2A 3NCPA 1WF1A 4AYBD 1XMQF 4OV1A 5M1QA 2BA9A 1C4AA 2GTDA 1OKJA 4CE9A 4CW7B 3ONQA 3O44A 4TNOA 3PSIA 3J7Z5 2HVDA 5KG7A 2YV0X 4JV1A 4I67A 2JLEA 2LCWA 1GX6A 4NI2A 4JHDA 4EHUA 3AO2A 3G6EN 3GFZA 2CADA 5GADI 5IS2A 1NK6A 4I0WA 4O3OA 2BACA 1KLNA 2HYIB 1QHAA 2VG6B 2B7BB 4ALZA 4FZZA 3I0RA 2PMWA 1ZBSA 4I56A 3HFVA 2WAQD 2J7WA 4FL9A 1I94K 1PG5B 2JVOA 4J91A 1T9UA 4GVMA 1PKUA 4K42A 2QK9A 3QEPA 1BA1A 1CLQA 2H9ZA 1XR5A 5CZVA 2IRUA 2Q6BA 3HBTA 3AJ2A 3PO4A 1RB0A 4CJVA 2DR7A 3I32A 2BE2B 4DX7A 4XH1A 3CI5A 3MMCB 3DI6B 4X64J 2VQEF 2VWJA 1YBAA 1JJHA 2AYGA 1T03B 1R8PA 3CJKB 1RK8A 3ZSZA 2ITGA 2WBRA