4PUOA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
555
structure length
555
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
total genus 145
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4puoA05
1IKVA 3CM5A 1RTJA 4TLRA 4K50A 4CGGA 1N5YB 4ZTJA 4EEYA 2YHBA 3L3UA 4CF0A 3HVTA 2BRLA 3EZUA 4KI6A 4AHUA 4M3ZA 2RDIA 4L8RB 3OS1A 3DYAA 3OY9A 4Y1DA 4CHZA 4KKOA 2WCXA 4G1QB 4B8AB 4XIUA 4HCBA 5D3GB 1U04A 5FDLA 4OLAA 5SZTA 3PW7A 1LWEA 5KFXA 4Z4IA 4O3NA 1CSJA 2KZMA 2YNFB 3AVNA 1RT7B 1JLGB 3KLVA 1RBTA 3MR2A 4WE1B 4NLRA 3D45A 5HP1A 4ICLB 4DL5A 1XC9A 1SKSA 2XI2A 3CDUA 3NCIA 3MEDB 4FJIA 1NKCA 4AH9A 1NK4A 2HMIA 3DI6A 1DTQA 3ULDA 1WN7A 1ZTWA 1NJZA 4O4GA 1T7PA 5I42B 1Q8IA 4CEDA 5F8IA 1KHVA 3QETA 1RYRA 3RRGA 1BCMA 4ZP8A 4Y1CA 3OS2A 4TY9A 4IFVA 3ZSOA 4CK2A 4K8ZA 3JYTA 5KFMA 1HYSA 3TAFA 1HQEA 4DFPA 4DU1A 1HNVA 3M9NB 2YNHB 4W5QA 3PX4A 5JXSA 2IAJA 1HYVA 1S1WB 2E6LA 3NGYA 3SJJA 2ALZA 3VQ8A 1DTTB 2RN2A 3DM2A 1KRPA 2HHTA 1LWCA 3DOLA 4F4YA 4PY5A 1JL1A 4E19A 1S4FA 1VSJA 4DTSA 4KHMA 1TKXA 3DRSB 2OPSA 5J1EA 4OGEA 4CFDA 3GV5B 1SL0A 2IC3B 4DSIA 4C8NA 4DTMA 3KK3B 3OL7A 1W0HA 4DTJA 2XCAA 4MFBB 4M42A 5CYQA 1CZ9A 5KG0A 3OYDA 4KB0A 1U49A 4DFKA 4N47A 2EC0A 1S6PB 1QAIA 1TKZB 3OYGA 1T8EA 2VWJA 4CEOA 1SH2A 2ATQA 4Q5VA 2GUIA 3G6YA 3OYMA 3V4IA 4QWAA 3ZT3A 1NK8A 4NLTA 2JEIA 4CEZA 3MEGB 1RDBA 2PYLA 2DFHA 3KKRA 3TAGA 1C0UA 3MR3A 3BR9A 3H98A 4IKAA 2KZZA 2XY6A 1TV6A 3DMJA 3ITHB 1RTHB 1YTUA 2KFNA 4CJUA 4RW8B 4KO0B 3Q8PB 3A2FA 3NBPB 3H4BA 1CXUA 5HRRA 2VWKA 3ZT0A 3U3YA 2LSNA 3KK1B 4XO0A 3L2RA 5DQGA 3OYAA 1ASWA 3BSAA 4EP5A 5EWFA 4QW8A 3SCXA 3LP0A 3S3OA 4EZ6A 3I5AA 4W5NA 1S9EA 5DMRA 1LAWA 3TABA 3PJWA 3AVIA 1DLOB 3DLKB 4R5PA 4RW7A 3C6TB 3AV9A 4ELUA 3T1AA 3QIDA 4H8KA 1YVUA 3BQ1A 4Q0BB 3RMCA 3CG7A 3HP6A 1YVFA 4HUFA 4OKKA 4U6PA 1TK0A 5JS1A 2FBXA 4CIGA 4DLEA 1BI4A 1JLBB 4EO6A 2F8EX 3CIZA 3BSCA 4JV0A 4FW2A 4DSJA 4FJXA 4KV8B 3TAMA 3KLFB 4FLVA 3OYHA 2FBVA 2D0AA 4B9TA 4NYNA 4YP3A 1REVA 3GIJA 4O0IA 3PO4A 3M8QB 3O3HA 3MTKA 1XR7A 2UVWA 4IH7A 4OJRA 4WFXA 2Z1HA 3AVLA 3OYEA 4TY8A 4ECUA 1RTIB 1Y97A 1QSSA 3V6DA 4CJ5A 5I3UB 4DG1A 4N56A 1JLQB 1QE1B 1S1XB 4C8MA 1UOCA 2OYQA 4IDKA 2OPRB 5KFOA 4IRKA 3PJXA 3FQKA 3PZPA 3SZ2A 5FRNA 3ISND 1I6JA 2WOMB 2OA8A 1RAJA 3MECA 4HTUA 3TARA 2GBZA 4DQIA 2CJQA 1O1WA 1T94A 4QCLA 5HLFA 1MU2A 4H4OB 4N5SA 4URGA 1JLEA 3V9ZA 1J5OA 1TK8A 1WAJA 4R8UA 3BSOA 1W25A 4IH5A 3OJSA 1TL1A 4CIFA 3E51A 3DLHA 4KFBA 2KQ2A 3ZSZA 4KHUA 3AVHA 1HQUA 5EUHA 5J2NA 2D5RA 4CGIA 2FVCA 3K58A 2R7YA 3SI8A 4IG3B 4YMEA 1KLNA 1Z26A 2HNZB 3HPHA 3OS0A 3IS9B 2J6UA 3UPFA 1C0TA 3QO9A 4DQQA 5KFKA 3CYMA 3NGDA 1EKEA 4C8LA 4B3OA 3RWUA 3SQ0A 3IRXB 5C42B 1N56A 4PA1A 3LZJA 3AO5A 1X9MA 1R0AA 1CZBA 4DQSA 4OPKA 1RCHA 3BJYA 2QE5A 4FK4A 3TQ1A 4KE5A 1RT1A 2FVRA 3NF6A 1KLMB 3KLGB 1B92A 2B43A 1GOCA 5J2PB 3V1QA 3AO4A 1NJYA 4MKBA 4IRDA 4CJEA 3DRRA 3M8RA 1TKTB 4MKAA 3LALA 3V6KA 4Q8EA 1A5XA 4URSA 4ECYA 2VG6A 4B9LA 1TL3A 3I0SB 1S1TB 3H2LA 4B9VA 3MFHA 4CCHA 1KTQA 1IKWA 3ICLA 4FJJA 2G8HA 1GX6A 4F50A 3KLEA 1BL3A 5KFQA 3AVGA 3GILA 3QLHB 4RW6B 2UUWA 3UQSA 5KFYA 1N6QA 4CGJA 1Z4UA 1HPZB 3ZSXA 5KFAA 4CF1A 4FXDA 3OLBA 1U48A 5KFDA 2C28A 5JS2A 3LWMA 1G15A 5KG1A 4LQ9A 1NK5A 4YR3A 4QW9A 4GC7A 4FZZA 3KLHB 4DTOA 3N6LA 4J9PA 3CFPA 1VSIA 5KG5A 1D9DA 4E0DA 3CJ5A 3RBDA 2R8GA 2PY5A 3FQLA 4ECXA 3B6PA 3DLGB 4YR2A 3C6UB 2HNDB 2W42A 2C2RA 4PQUA 3SV3A 4PWDB 1BHLA 2OZMA 2X6SA 3GIMA 4IQXA 3AVFA 4M95A 3C95A 4ID5B 4CJRA 1JKHA 4KHQA 2ILZA 3IG1B 2AGPA 4DQPA 4NRUA 4AHRA 1TAUA 3QEVA 1IKVB 3L2WA 3FFIB 4FZYA 2V4QA 1HRHA 4J2EA 4B9MA 3N6NA 4PUOB 2I5JA 3LP1B 2JGUA 4MIAA 4CFBA 4FJHA 4EBDA 2GIRA 3Q8RB 3DYAB 2J6SA 3OSPA 2NUBA 3NF9A 2J6TA 3OYIA 4KKOB 3QESA 1EETA 3HKWA 4H4MA 2XO7A 4RNMA 1J9AA 4I2PB 3SPZA 2E9TA 4ECRA 2R8HA 4Z4CA 2XWYA 1Z25A 2P5OA 5L1KA 3E01A 5C25A 4QWEA 2IM1A 4C8KA 4KHRA 2V4RA 4XPCA 1RT5A 4TQRA 3NL0A 1RT2B 4Q8FA 3QEPA 1KFSA 1RBUA 3K5OA 3LAMA 1EX4A 3KIOA 1VRTA 4HKQA 4IG0B 4FLUA 3FSIA 1ASVA 1ITGA 4FS2A 3M8PB 4O44A 3KHHA 1DTQB 3I8DA 1EXQA 3BGRA 1JLCA 3OYCA 1IH7A 2G8UA 3KJVB 3DDKA 1SH0A 3K5LA 3HL8A 4DL4A 2W8LA 1U47A 2QKKA 2OPQB 3KLIB 2R8IA 2IOCA 4FYDA 1IKYB 4RNOA 3QZ8A 2HW3A 1RDAA 3AVCA 3MEEA 3NH2A 3NE6A 3AVBA 3D5MA 5HRPA 1T03A 1CLQA 1L3SA 3KMSA 4QWBA 4DQRA 1D0EA 3QGGA 2ZE2A 3NHGA 4W5OA 3RB4A 4KI4A 1KFDA 1FK9B 3BREA 3AVAA 1X1PA 2DFFA 5DQIA 4LSNB 3AO3A 4CHOA 4NLUA 4WYWA 4QWDA 3LPUA 3CJ0A 2WONA 3L3VA 5J1EB 4B08A 1BISA 1IKXA 3RMAA 4MK8A 3IN5A 4OL8A 4DU3A 5KT3A 4ZVFA 5DLFA 4FLZA 2RF2A 1UAXA 3SV4A 4GW6A 3N6MA 3WNFA 3DLEB 2XGQA 2WB4A 3T5LA 2BQ3A 4C8OA 3K59A 1F21A 4RU9A 4E7HA 4O55A 5J2MA 3MXJA 2JC0A 1S97A 2VA3A 3K57A 3H08A 1WSJA 3RAXA 4F8RA 5KGWA 1S48A 3VQAA 2QV6A 3DOKB 2OPPA 1S6QA 2IMWP 3LP2B 4XPEA 4Y2AA 4CERA 2YKNB 4MIBA 2VG5A 4KPYA 4CGFA 4DS4A 4CHQA 2RKIA 4DTNA 1WNSA 2R2UA 1LWFB 2W9BB 1HJRA 3C94A 3HPGA 1HNIA 3RB0A 3OLAA 4NLWA 1BQMA 3CJ4A 1RT4A 4EP4A 1C0UB 4M41A 1ASUA 4ZHRA 3LAKA 4WXOA 4ED1A 3MFIA 3TR8A 1SV5A 3QIPA 4I2QA 3UDLA 3V1OA 3SI6A 1BGXT 3SQ2A 3EYZA 2FVQA 4OKEA 4CJTA 5DK5A 4DSEA 3ZCMA 1KVBA 3S9HA 5HRSA 3PO5A 4CJPA 4CFAA 1N5YA 5F8NA 5KG3A 2XY8A 3H5XA 1S9FA 4FJ8A 4N76A 3RR7A 4J9NA 2G8VA 3KHGA 3GIIA 3RB6A 1TGOA 2P5GA 3T5KA 2XI3A 3FDSA 3OSNA 3Q8QB 4EBEA 1S10A 4ECTA 1IO2A 4BDYA 4G1QA 4CJKA 5D3GA 5F9NA 1BI4B 4F3OA 4CHYA 2B6AB 4CGDA 3OYLA 5L1IA 3QYYA 1L3TA 1ZBFA 4O3RA 3QNOA 4MH8A 1RT7A 3QGIA 1JLGA 2BQUA 3WNEA 4M45A 4WE1A 4ICLA 5KRSA 1RTDB 1VK0A 3ALYA 1S1UA 3CVKA 4E7JA 1L3UA 2GV9A 4K4WA 3SUPA 4TXSA 5C24B 3OYJA 4KRFA 4MK9A 3BDPA 4DF8A 5T14A 3HM9A 4FBUA 3IAYA 2HB5A 2ZKUA 1WSIA 1JIHA 1JXBA 3EY1A 3HT3A 3MXMA 3DRPB 3V6DB 3PHEA 4YNQA 3PY8A 4FJMA 5L9XA 5I42A 4CJ4A 3VA3A 4FK2A 4ZP9A 4BWJA 1VSEA 3AA5X 3HYFA 2G8WA 4CJLA 1L3VA 4TSXA 2I1RA 4HHTA 2JEJA 1I3AA 2RPIA 4WZMA 2Z1GA 4ECZA 4NCGB 3SUOA 3PX0A 4O3OA 5HLFB 2YNHA 4EBCA 3AA2A 1MU2B 3O4NA 5KFBA 1S1WA 3KK2B 3TVKA 3MXIA 1Q9XA 1DTTA 1J53A 5KFUA 3PR5B 2O5DA 3WNGA 3OL9A 4CEFA 1LW0B 2F8TA 2R8JA 1QAJA 4CF8A 1TL1B 4ZP7A 3DRSA 1YT3A 3TANA 4CHNA 1RBSA 4CE9A 4CK3A 3TAPA 5KFIA 2Y1IA 5KT7A 2BANA 4I7FB 2B5JB 3RR8A 1RYSA 3KK3A 3THVA 3HO1A 2P51A 4MFBA 4I9LA 1KHWA 5CZ1A 3PW5A 3VQ7A 2HWHA 4CJWA 3HSTB 2HVHA 4MK7A 3MR5A 1BQNB 5KG7A 2AJQA 5HBMB 3CDWA 2A1RA 4ZP6A 4RZRA 1XHXA 4AHVA 3NF7A 1S6PA 1TKZA 1RDRA 1RNHA 4O3SA 3LDSA 1C0MA 4TYBA 1TVRB 1C1BB 3M8SA 4F3TA 3P5JA 4GC6A 4EYIB 3V81B 3PR4A 3QGHA 2CKWA 2FVPA 3EZ5A 1JL2A 4LQ3A 4NLQA 4Z4HA 5HROA 1LV5A 3MEGA 1KCFA 1U45A 4DFMA 3RTVA 5KG6A 4CJ3A 1FKOB 3DRRB 4ECVA 3ITHA 1RTHA 4I9QA 4RNFA 4E89A 5JUMA 3GIKA 4RW8A 4KO0A 2PZSA 3NBPA 2Z1JA 3HVRA 5HRNA 3KK1A 2DTUA 1JLFB 2ZQBA 2VG6B 1XWLA 3VQBA 4DTRA 1RA6A 3ZSQA 4KBIA 1KVAA 2WTFA 4WFYA 1UA1A 2R2SA 4NYZA 2YNIB 4KAIA 1JLAB 4KB1A 1DLOA 2Z1IA 3DLKA 3C6TA 1N6QB 2JEGA 1N48A 3RBEA 4Q0BA 4LY7A 2ZD1B 4B8CA 3H5SA 3QNNA 4B9SA 2W9CA 2ASDA 1T05B 3VQ4A 4M3YA 4DMNA 2OZSA 5KT5A 4ZPAA 1SL1A 3NH0A 3SFUA 3GYNA 4FM0A 4KV8A 3ZSVA 4JRQA 4E1MA 1ZYQA 3KLFA 4OVLA 4FLXA 1NHUA 2C22A 4RW4B 5KFJA 2IM2A 4E7IA 3L2QA 3M9MB 5FRMA 4YFUA 4RUAA 4K4XA 3KMQA 3M8QA 3RRHA 1NOYA 5F8GA 2R2RA 3I0RA 4ZVEA 1HMVB 4E7LA 4J9SA 2IDOA 4AHSA 1RTIA 2O4GA 3ZT4A 2VG7A 4O0JA 5CY4A 1NJWA 2YNGB 1JLQA 1QE1A 1S1XA 4CEBA 3K5NA 2XC9A 3ISNC 5KGXA 4GVMA 4NLVA 2XGPA 3SQ4A 1LW2A 4RW9A 2R8KA 2OPRA 4OKJA 4QOZB 2Y1JA 1GOBA 3OJUA 5KFPA 3RB3A 4WYLA 2FLNA 2WOMA 2HNYA 2HWIA 4BDZA 3SQ1A 5F8LA 3V6JA 1EP4A 4N41A 4Z4GA 2YKMB 3G6XA 3O4QA 4H4OA 2AU0A 1RDCA 4EZ9A 1D8YA 2V0NA 5K14B 2D0BA 2FVSA 4K4TA 1JX4A 3HHKA 4BE1A 5DG9A 2XRIA 3G10A 3WNHA 4HUEA 4CJSA 4FCYA 4ZPBA 1VRTB 4G3IA 1FKPB 4KAZA 1SUQB 3G0ZA 3TAQA 2V9WA 5EWGA 3ZT1A 1WSFA 3D28A 4FLYA 2G8IA 3T5JA 1MMLA 1SKWA 1SH3A 5J2QB 4IR1A 2HNZA 3BGRB 1RILA 4LSLA 4NRTA 3IS9A 4NCBA 3NAEA 2UUTA 2A1SA 1GOAA 3H59A 3L2VA 4LH5A 1UA0A 3BQ0A 3B6OA 3FRZA 5KFLA 5F8JA 2X78A 4O5BA 3PX6A 4ELTA 3JSMB 4FM2A 1S49A 2BE2B 4ED0A 1ZBIA 1XI1A 1UWBA 5C42A 1QTMA 3VA0A 3AO1A 1RTJB 1I39A 4K4ZA 3OYBA 3QEWA 4FS1A 1U09A 2IBKA 4Q43A 3CFOA 4OGCA 3HVTB 2HHVA 1KLMA 3KLGA 1U4BA 5J2PA 1BIZA 1VSHA 4FLTA 3EPIA 1VSKA 3P83D 5EWEA 1TKTA 3NAIA 3HPOA 1NKBA 4J2DA 3O3GA 2WONB 5FDLB 4CJVA 2BDPA 3PW2A 4IFYA 1IKXB 3I0SA 1S1TA 2AGOA 3DLRA 4CF2A 1LWEB 4NYFA 4ZPDA 3VQQA 3O3FA 1TQLA 5J2MB 1WAFA 5HP1B 1BCOA 3CM6A 1ZTTA 3F73A 4M3RA 5KFFA 3QLHA 2ILYA 4RW6A 2B4JA 4K4SA 5CYMA 3ZSWA 3TI0A 4KHSA 4KHWA 2HMIB 3DI6B 5KT6A 5L1LA 4ED3A 3PUFA 3KLHA 4NLSA 4IKFA 4ECSA 4O4GB 3G86A 3IGVA 4TYAA 3KHLA 1RT3A 3HP9A 2JC1A 1TK5A 4E3SA 3CDEA 3VQCA 1RT4B 1S1VA 4FJ9A 2KFZA 1C1CA 3DLGA 4IFVB 5T7BA 3C6UA 1ZBHA 2HNDA 4J9RA 3JYTB 1HYSB 3CO9A 1HQEB 4CECA 2BR0A 4PWDA 1HNVB 2KW4A 2AGQA 3QIPB 3KTQA 3NDKA 4ID5A 2IAJB 4DL2A 4NLYA 3PW0A 4HCCA 3IG1A 1S9GA 2VA2A 4NLXA 3DM2B 4J9QA 1C6VA 4DS5A 1D5AA 4NLDA 1LWCB 3DOLB 3FFIA 1SKRA 2XCPA 1TKXB 4CGHA 4PUOA 2OPSB 5DQHA 3VQPA 4YR0A 3LP1A 5E41A 1IG9A 5KFZA 1XHZA 4DU4A 5CYQB 4DEZA 4I2PA 1QSYA 1RT6A 3QZ7A 1T3NA 3CWJA 2JLEA 2X6NA 4TN2A 1RT2A 4KTQA 1XR6A 2XY5A 5EU7A 1VRUA 4URQU 3GV8B 3V4IB 1S1UB 4BDPA 2OH2A 2HHUA 3QIOA 2W8KA 4IG0A 4O4RA 4CJQA 3CJ2A 2IJNA 2D41A 4CEQA 3K2PA 3M8PA 4QPXA 3IGNA 3NGZA 4DL7A 4DTXA 3D0PA 4RNHA 1TV6B 3DMJB 3HXMA 5DGBA 1GX5A 3KJVA 4E7KA 3AVMA 4FJ7A 2AX1A 4K8XA 5L1JA 1NNDA 2F96A 2OPQA 3KLIA 2HVIA 1FXXA 1IKYA 4Y3CA 4CEAA 4BACA 4KHNA 2D3UA 5KG4A 3LP0B 2E6MA 1S9EB 5KFRA 4DLGA 4R5PB 4RW7B 4AILC 4BE2A 3M9OB 1FK9A 3MR6A 4IOBA 3T3FA 1NJXA 1HARA 2AQ4A 1QQCA 4LSNA 4IH6A 2ITGA 1TAQA 4F2RA 2F8SA 2HAIA 4FJNA 2D7SA 2BANB 4FBTA 3LPTA 4J2BA 2BQRA 3T19A 5KT2A 4CEEA 4FK0A 3DLEA 3TAMB 5KG2A 2YNFA 1Q9YA 4CFCA 4Q45A 2W9AA 4WFZA 3OYNA 1REVB 3QERA 4WXWA 2E9RX 4RNNA 4UQGA 3U6FA 3RMBA 2C2EA 2AWZA 1KSPA 1ZETA 5KI6A 3I5BA 3NFAA 3DOKA 3MEDA 3LP2A 1TP7A 1YTAA 2FJWA 1D1UA 2YKNA 4HYKA 2UVUA 4TY8B 3UR0A 3NF8A 4J9LA 1B9DA 3OYKA 2W7PA 1LWFA 2W9BA 4DG1B 3RAQA 1RA7A 3KHRA 3NKYA 2FLLA 1W9HA 4IDKB 5HROB 2ASLA 4NLPA 2DPIA 4DL6A 4JUZA 3MECB 2G8FA 3HJFA 4CHPA 3LWLA 1WNEA 3SPYA 3V9SA 3LZIA 3K5MA 1JLEB 2DPJA 1X9SA 4GMJB 1J5OB 4MQ3A 4IRCA 3Q8SB 4R8UB 3SNNA 1IM4A 1NOZA 4DTUA 1D9FA 3QEXA 5KTQA 4KFBB 1TKDA 1HQUB 2YHAA 2IC3A 5J2NB 2EHGA 4W5TA 2WRMA 4M3UA 4KSEB 3OHAA 4Z0UA 2QKBA 4X2BA 1JXEA 1CXQA 5F8MA 3NAHA 4ZTFA 2W9CB 1J54A 1WSHA 3KD1E 3MF5A 4ED2A 1SL2A 3V1RA 2B6AA 4RUCA 1C0TB 3ZSYA 3QO9B 4TQSA 1S0MA 5DG8A 4B3OB 4F2SA 4ECWA 1QSLA 4F4KA 1RTDA 3HVWA 4FJGA 3VQSA 3AVJA 1C2PA 4B9NA 4HVJA 4JS4A 3U3GA 3T5HA 1K1QA 3KKSA 5C24A 1R0AB 4Y2CA 5DG7A 4FJLA 2E9ZA 3HK2A 4KHYA 1RBVA 2HHQA 1RT1B 3I0RB 3QEIA 1NK7A 1JXLA 4KTZA 5DLGA 3BSNA 4M3TA 1C1AA 4QWCA 2VG7B 3DRPA 4Y34A 4FLWA 4JS5A 4Q44A 2IS3A 3L2UA 3SFGA 1LW2B 4RW9B 1BIUA 1TL3B 3NGIA 1VSLA 2HNYB 3I5CA 4Z4EA 1IKWB 2C2DA 1S5JA 2XHBA 1VSMA 4NCGA 4AHCA 4M94A 1EP4B 1QS4A 3KLEB 2IGIA 4BWMA 4CJFA 3L8BA 3P1GA 3CJ3A 4CESA 3KK2A 1N4LA 4RG8A 4ZMMA 1B9FA 5KFNA 3GQCA 4JV2A 4IBNA 1LW0A 4FVMA 4J9MA 3NH1A 4DSLA 3OVNA 2X74A 4ED7A 1JLBA 4I7FA 2B5JA 2HHSA 4Z4FA 1K1SA 2W7OA 2G8KA 5EDWA 2GIQA 3PV8A 1A5WA 2QXFA 4ID1A 1BQNA 2IA6A 5HBMA 3AA4A 4PQUB 2D0CA 4LSLB 3KNAA 4CIEA 3V6HA 5F8HA 5C5JA 3VQEA 3S3MA 4H54A 4F4WA 4FJKA 3ASMA 1NHVA 1JKHB 5KFHA 4QAGA 1TVRA 1C1BA 4OPJA 5KFCA 4DSKA 2KTQA 1LAVA 1VSDA 2FC0A 3V9WA 4BE0A 4FM1A 5I3UA 1UWBB 5KRTA 3V81A 5DGAA 4FW1A 2R2TA 5KT4A 3VQ9A 3G6VA 5SWMA 2I5JB 3TAEA 4DWIA 2ATLA 5KFVA 2YV0X 4AHTA 3H5YA 4HUGA 1FKOA 2UVRA 2PYJA 4M3XA 4JRPA 1KVCA 1RDDA 1EETB 4H4MB 5KFEA 1RBRA 4LD0A 1JLFA 1OS5A 3CFRA 2P1JA 4IFYB 3OL6A 3OYFA 3E01B 5C25B 3GV7B 1A5VA 4NLGA 2BGGA 1RT5B 2FJXA 2YNIA 4KB7A 1S0NA 1JLAA 1NK6A 4OLBA 2GC8A 2FBYA 1WLJA 5CYMB 1ZBLA 2ZD1A 3OHBA 4B9UA 3BQ2A 1QHTA 3QINA 4FJ5A 4O44B 4IG3A 4IR9A 2IM0A 4U7CA 2EX3A 3MAQA 3KD5E 4K4YA 1WSGA 4KREA 3AA3A 1JLCB 1T05A 4J9OA 4YQWA 4E1NA 4NZ0A 1S0OA 1RT3B 4NLOA 2IJFA 2IM3A 1S1VB 2FJVA 3UIQA 2BRKA 1NK0A 1C1CB 4DL3A 3DLBA 2QK9A 4RW4A 3IRXA 4O3PA 1QUVA 3MEEB 2FLPA 3TWHA 4R0EA 2UVVA 1T03B 5KFWA 2WK4A 2Q3SA 2ZE2B 1HMVA 2ASJA 1NK9A 4FZXC 2JEFA 3SUNA 1K6YA 1ZBUA 5CZ2A 1S9GB 3S3NA 4ECQA 3F9KA 2YNGA 4F4ZA 3AO2A 4DSFA 1WSEA 4ED8A 2FBTA 1NKEA 4CF9A 2RF2B 2O4IA 3LP3A 3VQ6A 3ZT2A 4M3WA 2DY4A 2ETJA 3AVKA 4WZQA 3HVAA 4DFJA 4J2AA 3V9UA 2YKMA 5KFTA 4DTPA 3V9XA 2D3ZA 4ED6A 3H4DA 3NMAA 1RT6B 3LANA 3RMDA 5K14A 2XY7A 2HHWA 1HPZA 4JLHA 1XR5A 2OPPB 1S6QB 1X9WA 4KTWA 5KFSA 4DF4A 2VG5B 4K4UA 4ZPCA 4J9KA 4W5RA 4EYHB 3PW4A 2RKIB 2WHOA 3PVXA 3H5UA 3ZSRA 2DFEA 3CQ8A 1VRUB 5KFGA 3VQDA 4K4VA 1L5UA 1HNIB 4NCAA 1FKPA 1SUQA 4LH4A 4ELVA 1BQMB 3KOAA 5F9LA 4CK1A 4F4XA 1VSFA 4ZHRB 3SUQA 5J2QA 2RDJA 4EO8A 2E4LA 1SV5B 4I2QB 2HHXA 4ZVGA 3VN5A 4JV1A 2AX0A 3EPGA 4ZVHA 5FROA 3SYZA 3JSMA 3OL8A 3VQ5A 3H40A 1HYZA 2BE2A 4O3QA
chains in the Genus database with same CATH superfamily
4H5TA 2OI2A 2XWXA 4K50A 5LMNK 1S5ZA 2K7KA 2IHR1 4RBVA 5HI7A 3K9JA 2MKCA 4PYAA 5D0EA 3D3BJ 3CJQA 3OTBA 4F7VA 3WEEB 2U2FA 1Q86O 2WC9A 1XBWA 1NGBA 3CQYA 4OLAA 3TW0A 1RTZA 1LWEA 3OFFA 3UKUA 4U96A 2I2YA 4Z4IA 3B54A 1RT7B 3KLVA 1IWGA 5HP1A 4ICLB 1Y11A 2OEKA 2ACMA 5IT0A 3J7AN 2E5LF 4AQYF 1OH7A 3KG0A 3CDUA 3MEDB 4FJIA 1NKCA 4AH9A 8ATCB 1X0PA 3TUZC 3ULDA 4JK9A 1T7PA 2N4DA 3HZEA 4LRBA 1RB0A 2DHGA 2QT7A 1OH5A 5F8IA 3QETA 3P5TL 1BCMA 3N4QA 2RQ4A 5KFMA 4DU1A 2MZTA 2HQIA 4J9UE 3OBIA 2OANA 2IRUA 4G65A 2YNHB 3PX4A 1H2TZ 1R8HA 1HYVA 8AT1B 4NI2B 3SJJA 3ULHA 3CJCA 2ZJQL 3EL2A 2FGCA 4AXJA 5AE2A 1X4EA 3TP2A 4HT5A 4E19A 1P1LA 3MD3A 1VK8A 2K7JA 3SBGA 4YOWA 3OL7A 3MAAA 2RJZA 3T1YF 1W0HA 4USVA 1ROFA 3CETA 4Y2MA 4A8KA 3D1QA 1U49A 4DFKA 3BO4A 1T9UA 3OTDA 4DV4K 1QAIA 5JMNA 1FJGF 1U25A 1T8EA 1PSDA 2CPFA 4K42A 2VWJA 3H3OB 1FX2A 2BV3A 4KGXB 4BRPA 3DJCA 2ATQA 1WC6A 3ZT3A 1NK8A 2GCFA 4NLTA 2JEIA 3MEGB 2PYLA 3KKRA 1FE0A 3MM5A 1C0UA 1JCFA 3MWPA 4IKAA 2KZZA 2XY6A 5KAKA 1IBMF 2XLKA 3ITHB 2P9SA 4CM2A 3UD5A 1NGHA 4ZCKA 5HRRA 4BR4A 1Q5YA 1DRZA 3EGZA 4XO0A 4DB3A 5DQGA 2FY1A 1X9JA 3GJSB 4PG8A 3CCJS 1UCNA 1UJ4A 2Z2MA 4M5NA 4ED5A 4O23A 2XS2A 2I9SA 4W5NA 4X4UA 2FSKA 2V94A 3PJWA 3AY9A 1DLOB 4R5PA 3CD6S 2B3TB 4FXVA 3T1AA 4ZLPA 1VBYA 4Q0BB 3CG7A 1ZPWX 4DN0A 2UXDJ 5E2QA 3KKFA 4R0JA 5JS1A 3SCKE 3SAFA 2FBXA 1S76D 1KONA 3UVJA 1KVJA 2Z58B 4E1JA 3W3SA 1D8ZA 2N3LA 1IVZA 2KHOA 4BC5A 4YP3A 4X4PA 2O8BA 3PO4A 4CZFA 3M8QB 4PG7A 2EVZA 2CADA 1RZMA 2UVWA 5LMNF 2ZGYA 1NHKL 3TSPA 1N33F 4FWMA 4N56A 1S1XB 3HSJA 4C8MA 1UTAA 1WDDA 3MCPA 2JFKA 4FZVA 2EEYA 4B3TJ 2AJ2A 3LGMA 3T41A 1NGDA 1VQKN 2WVCA 1Z6RA 4HTUA 3AA9A 4DQIA 1O1WA 4A8MP 4UOCA 4QCLA 1FWKA 4RR5A 2DXEA 3M2VA 2JOQA 1J5OA 2DGQA 2IFXA 4ZLNA 3BSOA 2NYIA 2L9DA 3UR3C 4B3SF 2FJEB 1TL1A 3E51A 1AUDA 1BQXA 2HZCA 1HQUA 1WI6A 4PKGA 1QTNB 3BN7A 5AQZA 1AZSA 3TX8A 5L38A 4C48A 2ZOGA 1SJFA 2XMUA 3R5JB 1C0GA 4OZ5A 4JI7J 2YHYA 3I55S 3KZBA 3C16A 4K25A 3QO9A 4OYBA 4U7UK 1K0TA 1RHRB 5M1NA 1EKEA 1FXRA 1N34J 3GDQA 2P9IB 2QWLA 1CJTA 3RWUA 5CQGA 3SQ0A 4DR3F 3BYPA 4L75A 3BJYA 3TQ1A 3HHDA 4KE5A 1T6CA 1KLMB 3D68A 1VBZA 4QYRA 1NZAA 4RX6A 3IMXA 4IOXA 4CJEA 3DRRA 3D9BA 4YB7A 1TKTB 1V3SA 5MLCV 1TL5A 2HZAA 1EX8A 1A5XA 1GMUA 3DRXA 1K8AO 3WC2A 1HNWJ 3EDRB 1TL3A 1HKCA 2UU9J 4B9VA 1SC3B 1IKWA 3ICLA 3LPEA 3NGTA 3GU0A 1RBAA 2PDAA 5LXRA 1VIOA 4XH1A 3TJ8A 2RNEA 4OYXA 2BBEA 3S01A 1X5PA 1RU1A 3UQSA 2YKAA 2FQQB 5KFAA 4CF1A 4FXDA 1HBMA 3NGSA 3OLBA 1IQTA 4ES3A 5JS2A 4YY3K 4LF7K 3LWMA 1G15A 1NK5A 5F3ZA 4YR3A 2QWNA 3KLHB 2G1HA 4J9PA 1GXLA 2BKPA 4JKGB 2HF3A 4NX9A 1RBOB 4CD3A 2HPUA 1G2EA 3V5RA 1FE4A 4OZ0A 1NWKA 3B6PA 3C6UB 2OFHX 4M5IA 1RDWX 2W42A 3C14B 4DUYK 1S59A 3UO0A 3CCSS 1LNQA 4YB5A 3NP5A 1R89A 2HF4A 5ETPA 4M5JA 1G1XA 3EWGA 1UVLA 4DR4J 4Z94A 4NRUA 1CZAN 2GX9A 2CQHA 2F8HA 4KJIA 1HLUA 1K9MT 5AQHA 4FZYA 3D67A 1HRHA 4J2EA 4B9MA 5FPDA 2MEWA 2QLJB 2I5JA 3CDBA 2BABA 4CFBA 5A2QO 3IM9A 2J0QD 2J6SA 3OSPA 5IFMA 3NF9A 3OYIA 4IOAQ 2PMZD 1EETA 3DU6A 2XO7A 4R25A 1J9AA 1APSA 1RWWB 4UOGA 1OO0B 2SXLA 3N01A 1R0CB 5L1KA 2Y1RI 5C25A 4B1VA 4KHRA 2V4RA 3UE2A 4XPCA 2H5JB 4YOXA 2A5XA 2CH6A 1U1OA 2BXJA 3E66A 4W90B 2F3JA 3M1VA 3K5OA 1MWQA 3GFZA 3KIOA 2RD5C 3QMQA 4FLUA 1ITGA 3NEKA 4FS2A 3DGPB 4YHHF 4F02A 1Y9OA 1FJ7A 1JCEA 2KKZA 2XYGB 3I8DA 4WK1A 2MGZB 3O8MA 1VDHA 2MY7A 3M8YA 4FF2A 4DL4A 1M5VC 1VQMN 5EX5A 5A8KA 2R8IA 1IKYB 3K8VA 2OAUA 1QQNA 2MKJA 3F5TA 4WQ5C 1RDAA 3OFHA 3GSDA 3K7RA 2O8DB 2ZE2A 3NHGA 4W5OA 3RB4A 2G2ZA 1WG4A 2V5HG 4KI4A 1FK9B 3BREA 3O9QA 3IP0A 2WB1D 1X1PA 2M52A 2VBZA 4NLUA 1CS4B 1RI7A 4WYWA 3TVYA 4IO9Q 2D9PA 3CJ0A 5ETMA 5J1EB 4USHA 4DKWA 1M5KC 4NL5A 3IN5A 2XLIA 2ZEJA 5AE3A 5KT3A 5IWAK 2HFVA 3LDOA 3N6MA 3DLEB 2HHPA 2EKYA 3K59A 3WQTA 2FGOA 3NWGA 2JC0A 3WXJA 4A5AA 3H08A 1WSJA 5AXLA 1VQ6S 1DT9A 4MJKA 2M8HA 3CHWA 2QV6A 3O5TB 3DOKB 4XPEA 4MIBA 2MLZA 2VG5A 2CPHA 4DTNA 1VYAA 4USUA 2GHPA 2GGPB 2W9BB 3JAMU 1IR1A 1HNIA 4CTAB 3OLAA 2QA1A 4G9ZA 3QSIA 1ASUA 3CCUN 4WXOA 3MCMA 1HR0J 4DUZK 1SV5A 3TA2A 3UDLA 4WP8A 1WBDA 2FVQA 4LFBJ 4CJTA 4QQBA 3ZZRA 4F0HA 8RUCA 3ZCMA 2RILA 1KVBA 4LBPA 3SSQA 2VJUA 5KQ8A 4CJPA 2O8EB 4KIAA 4CFAA 1SQEA 2RMLA 4KC5A 4YY3F 2J8AA 3TTCA 1Q8LA 3UKRB 3CIPA 3MXHP 1FTCA 2QZ8A 2GS8A 2AEMA 4CLSA 4K0KJ 4EBEA 4GVBB 3IAS9 1IO2A 1M5OC 1P27B 1WI8A 1HKAA 2CZVC 1EWRA 3ZTRA 3TO8A 4F3OA 4CHYA 2B6AB 4DUYF 2UXBJ 4H4KA 4MH8A 4JI0J 4AE5A 1RHJB 3AJDA 1GXUA 4C8ZA 3CQXA 4WE1A 3MPDA 4NOHA 3G8QA 1SJ3P 1UPMB 2CG8A 1S1UA 4E7JA 2GV9A 5GAEP 3RU0A 2LMIA 1R6VA 4ISGA 5T14A 3HM9A 4FBUA 3IAYA 1EIYB 2HB5A 2ZKUA 1XNRJ 1JXBA 2HWTA 4JI4K 3JB9k 2IVPA 2KRRA 3PY8A 5I42A 1YZ6A 3VA3A 1ZM9A 4FK2A 4ZP9A 4BWJA 4OX6A 2JWKA 1RHKB 2A10A 4TSXA 4HHTA 2P5VA 1I3AA 2Z1GA 4CYUB 3PX0A 4PQAA 4PR6A 4EBCA 3AA2A 2QSFA 3KK2B 3TVKA 4Z7YA 4Y2KA 4LT6A 1D4XA 4ZCMA 4X65K 3OTOK 3BKTA 2O5DA 3WNGA 4CEFA 5T41A 2WW8A 3M1FA 4B3MK 3ENQA 4PXDA 1VLOA 3TAPA 4V19X 5KFIA 2D3O1 2GMLA 5KT7A 2GVZA 4I7FB 2ZGZA 3VGKA 3VQTA 1Z05A 3EE8A 3VQ7A 3HSTB 3DGVA 2A1RA 4HH1A 1U2FA 4ZS6A 1UJ5A 1WB9A 2Y0SD 3A4TA 1RNHA 2H4WB 4O3SA 2PFUA 4LFCJ 1C0MA 2OCEA 4F3TA 4GC6A 2DT9A 2MMYA 1HKGA 3PR4A 3QGHA 2FSNA 2Q43A 1PBAA 2FVPA 2CKWA 4NLQA 1O0PA 2A40A 5H1SV 1T95A 1KCFA 2XSJB 1HX1A 3PRDA 3I56N 4J7CA 1Q81O 2V8DA 4RNFA 4RW8A 1J6ZA 4KO0A 4DV3K 2PZSA 3NBPA 3HFKA 4A2BA 4X62J 1S3XA 4LIRA 1PG5B 2P9NB 1QY7A 1O8BA 1XNQF 5AJ3K 4IQMA 2IIRA 3SQGA 3LDNA 3CPWR 2HBYB 1ZOTA 3QT7A 4CT9A 2Z1IA 3MUTP 4KB1A 4DPUA 1N6QB 3DDNA 2QA2A 4DV0K 4C0HA 3P96A 4LY7A 2ZH9A 2DRAA 5G0RB 1TMMA 4DHYA 2AF6A 4DL0C 1V5IB 4PG6A 3FJ2A 4M3YA 2OZSA 4ZPAA 4MYUA 2FHOB 4KV8A 4JYAJ 3D6FB 3ZSVA 4FM0A 1RABB 4OVLA 4FLXA 3W62A 2C22A 5A0YA 2IM2A 4E7IA 3OV7A 1HQ2A 4YFUA 4K4XA 1NOYA 5F8GA 1YHQN 2R2RA 3FGUA 3VESA 4MYTA 3AQPA 2G4BA 3ULEA 4XEIA 1RWNB 3VEVA 2L08A 4J9SA 1YX2A 3WXKA 3PYFA 4AHSA 1M90T 4U67Q 3ZT4A 1NJWA 4JI8J 3PDNA 4A8SA 2YNGB 1QE1A 3D2FA 3C7NB 2AMCB 4HTLA 5KGXA 2YBVA 2XGPA 2R8KA 3GOIA 3BBFA 3OJUA 3BZKA 5KFPA 1SJ4P 4GKJK 1T9WA 2W2NP 2Z57B 5CR4A 1Z1ZA 3MCOA 4BDZA 3SQ1A 3R1HA 2HBQB 5F8LA 1EWQA 2L48A 2KN4A 1RDCA 4K59A 3LF0A 3US5A 2HRUA 2O8CB 1NGEA 1E3MA 2ZVIA 1BLUA 2HBZB 4JI5J 4HT7A 1QAXA 1SJRA 3FBFA 3HHKA 1MSWD 1WELA 4BE1A 3Q22A 3WNHA 1E4FT 1RAHB 1Q82T 4ZK7M 2LU1A 1SIWB 2OSRA 4JKAA 5EWGA 1MLAA 1WSFA 3RYLA 4FLYA 2D1CA 3T5JA 4WF9Q 5J2QB 2HNZA 1AFJA 5FD1A 1GTHA 3OVSA 1RILA 4LSLA 5GAHP 5ETOA 3QJJA 4LRAA 1UA0A 5LSLA 4LH5A 3B6OA 3FRZA 3PX6A 2XM3A 5F8JA 3BO3A 3O9SA 4ELTA 3O9TA 1ZBIA 1XI1A 2FHKA 1I39A 3OYBA 2AJ4A 3CFOA 5EGYA 2B7CB 2G0IA 3KLGA 4DR7F 2UZAA 3IWXA 4B3MF 3HMJG 4FLTA 3EPIA 1DGKN 1B64A 4C3MA 3I4PA 1CBKA 3MGJA 1NKBA 3B8AX 3J7ZT 3AJ1A 4BRGA 3PW2A 5H9FK 3UN5A 1IKXB 3G4SS 5BREA 5AFUA 3VF6A 1LWEB 3UKUB 4ZPDA 3O9RA 5D6GA 2J7UA 4CO3A 1GEHA 5HP1B 4UW2A 3M6XA 1VQPS 3O5BA 4RW6A 2FLOA 3FBBA 4LMZA 2VFUA 4CLKA 2LXIA 3H20A 3BN4A 1WSRA 2HIQA 1Q7YO 1FEHA 3W66A 2GQ2A 3H1VX 4IKFA 2YH1A 3IGVA 1R31A 1FD8A 4I68A 5HVHA 4DV3F 3NNHA 2KFZA 5AQIA 4FWLA 3RRKA 2HNDA 2JJ4D 2YPYA 1IUJA 1W2BM 4B1ZA 5AJ3F 2KW4A 2JVRA 4JB8B 2KVQE 3FLCO 2ZWOA 4RO0A 3CMQA 2ZM6J 4JKHA 4DL2A 4OYIA 3QICA 3ZTOA 4J9QA 2F65A 1KC8T 2BW7A 4DV0F 4NLDA 3DWLA 1SKRA 2XCPA 4CGHA 3HT0A 3NVMA 3L4BC 1XQSC 5DQHA 3VQPA 2J4RA 1IG9A 1KP6A 5KFZA 4ZPVR 2BKNA 5JMVA 2Y3YA 5EHHA 4MMOA 4LVOP 1QSYA 1WBBA 3G2XA 1RT6A 4XH4A 4H0XB 3JS6A 4DUZJ 4UY85 4CZIA 4MDBA 4JN4A 4CO2A 1VRUA 3FMWA 2WBNA 4URQU 1OSDA 3G9CA 3TX0A 4YN3B 3R2DJ 5THWA 2OH2A 1YJVA 3QIOA 4O4RA 3WX8A 1VR6A 3M8PA 2HG4A 3NGZA 4DL7A 2MLXA 4DTXA 2UP1A 2XMTA 5GMDA 4AFFA 1XTZA 4DDFA 4GKJF 2P9SB 4X4RA 2KKHA 4E7KA 3A0IX 5L1JA 2OPQA 1Y7PA 3QWPA 2EI5A 5K8MA 4M7YA 1VK3A 4CEAA 2PA8D 4KHNA 5KG4A 2E6MA 4PL7A 2PAVA 4ZA1A 1GMWA 4R5PB 4AILC 3IC1A 2G9OA 3M9OB 3PCOB 3OUYA 3T3FA 1FWPA 2IDEA 1OY9A 3W63A 3LDQA 2ITGA 4FN5A 1UJ6A 2R7RA 1ZH5A 2D7SA 4Z37A 5BR8K 3RBXA 3PG9A 3D0HE 2BANB 1IBLJ 3LPTA 2BQRA 2DJWA 3UVJB 4JI4J 3R7SB 3BUZB 3J8AA 4ZOSA 5BJRA 5KG2A 3K2YA 4CFCA 4YOTA 4Q45A 2W9AA 1YUWA 3MX5A 2DK2A 3MMBA 1GLFO 4WFZA 4WXWA 2O8BB 4YOVA 5KI6A 2KXHA 3W9IA 2EBGA 5CHCB 1YTAA 2GVDA 2YKNA 4DZDA 3UR0A 1F2HA 1LWFA 1RA7A 2OGUA 4A8WA 4DV5F 2HK2A 3H7HB 3GG4A 2UV8G 2FLLA 5LL6Z 2PN6A 5HROB 4NEYA 1WG1A 3NG8A 3R5GA 3QNWB 2Y8WA 4V19S 4JUZA 2FJDB 2FUG9 2G8FA 1BOTO 3RGIA 3H1QA 1WNEA 3MD1A 1GLEG 4UOHA 1Q16B 3LZIA 1UEKA 2DPJA 3O3LA 4GMJB 1J5OB 3UW1A 5AXMA 4QZVB 3SNNA 1EKRA 3HCXA 2N4CA 1ZXOA 4EFHA 1MWKA 3ZTQA 1HQUB 2R7UA 3DCAA 3U8XA 4KSEB 2V67A 1OQ6A 1AZSB 2AJ1A 4X2BA 2H3GX 2P9KA 3NAHA 3FZBA 2W9CB 4H5NA 2MHEA 2DIVA 4B1WB 3MF5A 1OSCA 3ZEUA 1SL2A 3C16B 3V1RA 3QO9B 1CJKA 2CQ1A 3I9V9 4TQSA 1S0MA 2HRYA 3AQOA 1CJTB 4ECWA 1QSLA 1KN6A 4UF4A 1K73O 4HVJA 2CWKA 1FTRA 3A12A 2GMJA 1K1QA 3A3PB 2E9ZA 4KHYA 2JH3A 4LRCA 1ITPA 1AB8A 4LJMA 2ZJPQ 3RBZA 3HSDA 1P9QC 1NK7A 1FI4A 4YEAA 2JWNA 4KTZA 4OYOA 1C1AA 5ELZA 3LQVA 2VG7B 2AKWB 1M1HA 4ZVPB 3U7JA 3UI3A 4PL8A 5AFUH 3SMZA 2U1AA 4ES1A 1FKAF 3TEHB 1FRXA 3BM7A 1TL3B 1HBUA 3VCDA 1IKWB 4I6AA 4DOZA 4NCGA 2PBDA 1EP4B 1ATSA 4LVNP 4OMFG 5HMYA 4CJFA 4C98A 3L8BA 2W24A 5DZ7A 3GQCA 3NCPA 4IBNA 4QS9A 3R5AA 1JJCB 1LW0A 2W4DA 3J81j 4FVMA 4JV5J 2YY3A 4DSLA 2YQ3A 5BN8A 3NH1A 2X3GA 2X74A 3QGPA 5E3RA 1V9OA 1JLBA 5K8NA 2CIMA 2YHWA 3VERA 2B5JA 2HHSA 5AQWA 3AGRA 2AYBA 5EDWA 3ET6B 4PXBA 2P2CB 4OHVA 2NRZA 3CXCR 1HHSA 2QXFA 1UAWA 4LF6K 3AODA 2O67A 3GE9A 2QGFB 2P6TA 2VQFK 4FJKA 3MM7A 1WD6A 1OKJA 4WP3A 4QAGA 1TVRA 1C1BA 4OPJA 1TTHB 2MKSA 3TJAA 1VSDA 2FC0A 2Z56B 3V9WA 4BE0A 3TUIC 1GLDG 2E1YA 4FKYA 2ZF5O 2DGXA 2J9EA 1H98A 4K5RA 3G6VA 2I5JB 2ATLA 2YV0X 1U1PA 2PYJA 2C1EB 4M3XA 1RDDA 1EETB 1RBLA 1SBRA 5A8RA 3AFGA 3D66A 1JXVA 4UUWA 3OL6A 5C25B 1G3OA 2QMUB 5DETA 2QL5B 3GJTB 3J7AP 3J7YP 1JLAA 4I6YA 1NK6A 4J90A 2OMOA 4OLBA 2GC8A 2HSEB 2GTDA 3VEWA 5BYRA 2BM0A 4IG3A 4IR9A 4BRKA 2EX3A 3MAQA 1YF5L 6FDRA 1YJUA 5I4MA 4J9OA 2EFVA 5IT9Y 2DGWA 4NZ0A 2CGLA 4XDCA 4BHQA 4UUXA 1S1VB 3BF3A 1AA1B 2D0OA 5A8KB 2BRKA 3P31A 1C1CB 1OY8A 4J91A 1UFWA 4BGBA 3T9NA 5AQQA 2GWKA 1NGCA 3AA8A 5KFWA 3I33A 2ZE2B 1HMVA 2ASJA 4DXLA 4WFNQ 5AQNA 1K6YA 4JHDA 5CZ2A 1S9GB 3S3NA 3D4JA 5E5NA 1FDNA 3HFVA 4F4ZA 4CLWA 4XH5A 1OYEA 3MTJA 1DHMA 1WACA 3CPEA 3AO2A 2HBMA 1TFYA 4ED8A 3VPZA 2ROEA 4I6MB 1WTFA 2ETJA 4H5VA 1F3FA 3HVAA 2PT0A 4GKKJ 4DTPA 4B1UB 4JI3K 2AD9A 5K14A 5HVGA 2EFNA 3DN9A 4OYAA 4KTWA 3M32A 3ADAC 2VG5B 4OI0A 2EG2A 2KB2A 4EYHB 3IFRA 3H5UA 3CQ8A 3HI0A 3B4DA 1PKUA 2ASYA 4K4VA 1HNIB 5FLXU 3Q23A 1FKPA 3VAJA 1IBKJ 5KPZA 1PYTA 1N5VA 2LDYA 1Y64A 5AZIA 4MLHA 1REGX 1SV5B 1SC4B 3HLUA 5HOOA 2XZDB 4ZVHA 5FROA 3BH7B 5DDQC 1V3RA 2DNHA 1IKVA 3CM5A 1H72C 2DGOA 4IFEA 4CGGA 4RBUA 2P6SA 4ZTJA 3CULA 1Z2LA 2VBWA 3JTOA 4EEYA 2YHBA 3HVTA 2BRLA 1T3OA 3VEYA 3QATA 1NMEB 3OY9A 3R6MA 2P8IA 1HHTP 1FO1A 2HZVA 1E6YA 2WCXA 2FTRA 2KYZA 3EGVA 4AL7A 1EQMA 4B8AB 4HCBA 2CWXA 3I8BA 3O6WA 1ZM2A 1LK5A 1U04A 3CCLN 3ONQA 5CCLA 4LF6F 1BO5O 3SDEB 3JXUA 1UVKA 2W4CA 5KFXA 1X4FA 4O3NA 2ZH7A 2KZMA 3AVNA 2VQFF 4WE1B 3W7BA 4DL5A 3U02A 1XC9A 2X1AA 5JVHL 4LBHA 4IEEA 4HEA9 4JYAF 1PJ7A 3AB4B 1VC0A 3UNGC 2YI1A 1X31C 4CO1A 2HVDA 1HBNB 2CJBA 4IO8A 1NK4A 2HMIA 4PKDB 1WN7A 1HNXJ 4WF9L 2E44A 5KPRA 5I42B 5IZHA 1KHVA 1F6TA 3ZX0A 2J8SA 4Y1CA 3BF4A 5B0EA 4JI8F 2O1PA 1VJQA 3OS2A 4TY9A 4IFVA 4CK2A 4KH6A 3AGKA 3JYTA 3TAFA 3OVAA 5BR8J 5FLXY 9ATCB 2CQIA 2I7PA 3VEOA 4I6WA 1ZA2B 2F40A 3BB5A 1T44A 7FD1A 2E6LA 2EFQA 3NGYA 2ALZA 2Y1LB 2B9WA 4D3HA 3QAUA 3DM2A 1NU4A 5IQ6A 2MKYA 1JL1A 3U1NA 4KHMA 1TKXA 3O2IA 4QS7A 2FHJA 2OPSA 4CFDA 4JI5F 1WOSA 4DR1K 2PMWA 2GVZB 2J9DE 2IVOA 1YJWS 3VAMA 2UXCJ 2VPWB 4DTJA 2ADBA 2PMHA 3KUHA 5BYSA 4FNHA 3ZLJA 4DR5J 1RCOB 1U1QA 1NGIA 2WUSA 4KY3A 2P9PA 1SH2A 3E1YA 1CQMA 3OYMA 1IQZA 1BWVA 1XMOK 2F9WA 2WBRA 2HOEA 1Y10A 1RDBA 2DFHA 3TAGA 3MR3A 1GNKA 2Z30B 1N8RT 4ILHA 1K8KA 2KFNA 1F9FA 4CJUA 4RW8B 4KO0B 3NBPB 1CXUA 2VWKA 3U3YA 1NRKA 1RXOB 1TUWA 1ASWA 4JI3F 1NJIT 2M70A 2JHEA 2G2OA 4QW8A 1B7YB 5DRKA 3SQGB 1A9NB 3LP0A 3S3OA 4C97A 4EZ6A 2V7YA 3I5AA 3MPWA 3TABA 5AQVA 1MWYA 5B08A 1GLJO 3AV9A 3QIDA 3BQ1A 3B4MA 4OX9F 2DNZA 3DXMA 2LQJA 2FF6A 1VQ8S 5D0HA 1NZ8A 2H9ZA 4H0TB 1R27B 1BI4A 4QR1A 1HL6A 3CIZA 4FW2A 4RJVA 4KV8B 3R8YA 2NZTA 2ITMA 2QTDA 3OYHA 2ZWPA 3JXOA 2FBVA 2D0AA 3MN5A 4B9TA 5A0YB 3S1TA 4YDXA 4O0IA 1WC3A 3DOMB 3GYXB 4IH7A 2HQGA 3ULEB 1S79A 2C2OB 4WFXA 2Z1HA 5E3CA 4TY8A 3VEXA 3BGLA 1QSSA 4OJ3A 4DG1A 1S12A 2OYQA 1QE1B 2YHXA 1UOCA 3D2FB 2D1KA 1SVDA 2F9TA 1SKUB 3LH2S 4IDKA 3PJXA 1H1VA 3PZPA 3SZ2A 5AQJA 5IC6B 3ISND 3THXA 4EGLA 3MECA 3CXCM 3UWTA 1UKUA 5AQRA 2CJQA 4QU6A 1T94A 2JWLA 3R5CA 1X8DA 1VQ6N 1R43A 3BR8A 4P2FA 1VQMS 1JLEA 1ULRA 5LJ3Y 1CLFA 1TK8A 2XYHB 3ILLA 1QVGR 4CIFA 4QBUA 2OJ3A 1CVJA 2J0XA 4NE9C 3K58A 2DBBA 2KT3A 5D4PA 3NS6A 1DY3A 3QBWA 3HSZA 2FY8A 2HNZB 5B0CA 2YVSA 2NRWA 1NDCA 1P9YA 2P9LA 2XNRA 2J6UA 1C0TA 4ZLLA 1RE1B 5KFKA 3WIVA 1YDLA 2C2ZB 4ZVRB 3IR7B 4F9OA 3IRXB 3H6EA 4PA1A 4DX5A 2UUCJ 3AO5A 4N77A 4PAAA 4OPKA 2HSTA 4FK4A 4CRJA 4BR9A 3NF6A 2G1DA 3KLGB 2DY9A 2B43A 1U6BA 3V1QA 1NJYA 3ZNJ1 4MKBA 4IRDA 4DR1F 1F1BB 3M8RA 2XB2D 3K89A 3LALA 2CGJA 2VOPA 1Y5IB 4Q8EA 4URSA 4EU0A 3BS9A 4ECYA 5DM7L 2VG6A 4B9LA 4L3KA 3GG0A 3P38A 1KTQA 4FJJA 3VAGA 1PBUA 4F0KA 3CCUS 2I8EA 3W9HA 1I1GA 4L73A 5KFQA 3AVGA 4RW6B 3D1HA 4CBWA 5EVZA 4CGJA 1Z4UA 1HPZB 2E88A 3ZSXA 1U48A 3WHIA 1DURA 3HHLA 1XMOF 5A6WA 3W5YA 5KFDA 2F4VF 1UVNA 4QW9A 1UEUA 2JX2A 3N6LA 2LVWA 3CFPA 2LQ8A 4OZ1A 3CJKB 3VALA 3HZGA 4CZHA 2XMKA 1EZZB 1WWHA 4ECXA 2WSCC 4CLPA 1Q79A 2AYEA 1S57A 1GAOA 2HNDB 1VHFA 5IT4A 1FRIA 3B6BA 4PQUA 5GAEI 5BRFA 4CH7A 2OZMA 2X6SA 4NA3A 3C95A 5A2QU 4CJRA 1BUPA 1WUUA 2M88A 2ZJPL 2UUAJ 4DQPA 1CEZA 2O01C 1Q18A 2UUBK 1F60B 2V4QA 1HI1A 1V4SA 3VENA 5CE3A 1CC8A 2JGUA 4MIAA 4BRHA 2GIRA 2DRDA 4X64K 3DYAB 4JP8A 1KAXA 3DAWA 3FR0A 2AV5A 4KKOB 5A8WA 4PPZA 1EQ0A 4OI2A 4JBCA 4RNMA 2UV8A 1M0SA 1MNEA 2MZ1A 3R9LA 2E9TA 3L9ZA 1RK8A 2Q36A 4EHUA 1M1KT 5LM7E 1FXLA 3E01A 2IM1A 4KQZA 3WQUA 1FVSA 1GLCG 1B70B 4FF1A 3G6EN 1KDNA 1X0FA 4Q8FA 2HIYA 3QEPA 1KFSA 5B0FA 1X3MA 4JI6J 4OX8A 2Q66A 4ED4A 3FSIA 2PEBA 4NASA 3M8PB 1CPZA 2QFIA 5ETTA 2ZH8A 4I69A 2MLYA 3VMFB 2WZ1A 1DTQB 2VPZB 4JKCA 1EXQA 3Q2SC 3WDOA 5C7PA 3OYCA 2M0GB 3BZCA 3W8PA 1U1LA 4UT4A 3DDKA 5E0OA 1E6VA 5GAEU 1SH0A 3CDAA 3K5LA 1XMQJ 2OPQB 1ZM3A 4RNOA 1SCJB 1IM6A 2KRBA 4JI2K 1JJ2M 4JOUA 3D5MA 1X60A 4QWBA 4NLCA 4DQRA 1D0EA 2BJDA 3GJQB 1X5SA 4Z2XA 1KFDA 2CNNB 3AHPA 1TMJA 3OUYB 3DU5A 5LSOA 2LEAA 3AT1B 3W3DA 3MM8A 2HHHK 2X1FA 4DR6J 2WONA 3QT6A 2P9UA 5A2QY 4CQ1A 1WF1A 4B08A 4A61A 4A2AA 2CJAA 5M1KA 4FLZA 1UAXA 1FRMA 3T5LA 2BQ3A 3AH6A 4U9RA 4O5FA 5J2MA 3WXIA 3MXJA 3R7NB 3AD7C 4LFAJ 5KGWA 4A46A 1MMNA 1S48A 5ETQA 2CQ2A 3SCIE 4CO0A 2GVDB 2YKNB 4B3RK 4CHQA 1WNSA 2CFXA 1LWFB 2FDNA 1HJRA 3NOCA 1KKHA 2E8AA 3HPGA 1Q8BA 3MM6A 2Q6BA 1YG0A 4NZ7A 1BQMA 1RT4A 3VGTA 2JFDA 1YAGA 1NG9A 3ZTSA 4ED1A 1TZ0A 3HF5A 3MHYA 1S0VA 4L74A 2EBEA 2EK6A 3V1OA 3SI6A 5DK5A 4FL9A 4X66J 4K41A 1N5TA 4Y65A 4WFNL 5AQMA 2ZVSA 5JVGQ 4K43A 1N5YA 4NA2A 5F8NA 4B9QA 2QLFB 2XY8A 1S9FA 3V4MA 1YHQS 4BRLA 1YXQA 2CVIA 4G6VB 3IWNC 3OSNA 3Q8QB 5AQXA 2VU5A 4J37A 4ECTA 4G1QA 2P9KB 2ZHOA 5D3GA 2XLJA 4P74A 4Q7AA 5F9NA 3ZEUB 1T9VA 1RAOA 1WTBA 2J76E 4NXMJ 4CGDA 3OYLA 5L1IA 1CJKB 3GONA 1ZBFA 4P73A 3CTRA 2WW4A 3SCLE 3ILOA 1NSQA 1HWKA 4DJBA 1L3UA 4LF5K 4K4WA 2OSQA 1OPZA 4MK9A 3ETOA 4ZKAA 3WQPA 2UUBF 4DF8A 2I6WA 3CMAS 1X4HA 4OYWA 1JIHA 3CD5A 3MXMA 3HT3A 2DO0A 5IS2A 3V6DB 5GAHI 2V6AA 1J5EK 4YNQA 3ENOA 5L9XA 4CJ4A 1N36J 1O13A 1UZHA 2YWGA 4JKBA 1T3VA 3G4SN 3AA5X 2ZH4A 2XMWA 1HBUB 2G8WA 5DM6Q 3EVMA 1R8BA 4CJLA 1L3VA 3I87A 2RPIA 1TYQA 4DV6F 1VQ4N 4ECZA 1VQ7S 4QYZK 4NCGB 1FNXH 4LF4K 5HLFB 1XEZA 2MJNA 1MU2B 1IWAA 5KFBA 1S1WA 2NREA 1HWIA 3MXIA 3GTYX 2DR7A 1DTTA 1UMJA 1J53A 1W26A 1U1NA 2WBMA 2KLAA 3GMGA 2ZITA 3OL9A 1LW0B 3S6EA 2NPIA 3TTFA 2R8JA 1KEKA 1QAJA 4HTJA 2COLA 4ZP7A 3TANA 2W6LA 4ZPTR 1NSAA 4CK3A 1VQNN 4KGKA 2B5JB 2GQQA 1JNZB 2J9CA 3HO1A 5LJVA 3PIPQ 4MFBA 5CXTA 4GVLA 3PW5A 2IRXA 3UFCX 2HWHA 2K2PA 3Q89A 2W25A 2AJQA 3CDWA 4RZRA 3QJPA 4ILGB 1SB6A 4CLUA 3R7BB 1RDRA 2L9NA 5AQLA 2BEFA 2FJBB 5SUHA 3IBWA 5HN0A 2HFOA 3LDSA 3MM7B 1TVRB 1C1BB 3M8SA 3P5JA 3BBBA 2V52B 3UD3P 4ER8A 4DV7K 3UCGA 4C3KA 5GAHU 1JL2A 4LQ3A 3VETA 3DC2A 3FZMA 2CJKA 4M5DA 1U02A 2YWKA 1N32K 4OHXA 3CC2N 2CJXB 1RTHA 4I9QA 2DYAA 1BA1A 3KK1A 1S77D 3VQBA 1RA6A 5GVQA 1TUVA 3ZSQA 4KBIA 1UA1A 1BE4A 3OBWA 2FYXA 2R2SA 1B7FA 2C3OA 2BOPA 2MZJA 1JLAB 3L3CA 1WEXA 2V8HA 3C6TA 3X1LB 4OFZA 3RBEA 2ZH3A 1FJCA 4O8KA 2PIIA 3N5BA 4DCPB 3IM8A 4MIWA 3MDQA 3K5PA 1UVMA 2DNNA 5IT9O 4ITSA 3HHEA 2NNWA 3NH0A 1ZYQA 1HNXF 4A8FA 1NHUA 5KOXA 5C2CA 2DNOA 5KFJA 3L2QA 2I0XA 4ISEA 3GR0A 4NYPA 1XUPO 4Y0FA 4ANEA 4ZVEA 3J7A1 1HMVB 4KGVB 3PYEA 4JHDB 3T1HK 2IDOA 3PNIA 3HSCA 1RTIA 2O4GA 3KVGA 4AQYK 1U7LA 1JLQA 2VICA 4WQ4A 4NLVA 1LW2A 2OPRA 4QOZB 2KJWA 3RB3A 3AOBA 2FLNA 3L4QA 2WOMA 2HWIA 3RG6A 1F9EB 1YJTA 3V6JA 3G6XA 3VR1A 2UXCF 4EZ9A 1D8YA 3T7ZA 1VBXA 1HWJA 5K14B 2ZKTA 2D0BA 4LF5F 4JAXA 2VHGA 3M32B 2VFRA 4DR5F 3AARA 5AQOA 3E9PA 3VF0B 5F1XA 3G10A 3U4LA 4FCYA 4ZPBA 2RRNA 1VRTB 3CCQS 1FKPB 1VMBA 1FHTA 3CCVS 1J5EF 2V9WA 2WTUA 4OHZA 3DXKA 3ZT1A 2G8IA 3IR6B 4CZJA 3SQOP 3EGNA 1SKWA 4HACA 1SH3A 1BUXA 2YQ0A 4IR1A 3BGRB 4BR2A 5AZIB 3TZWA 3POTA 3IS9A 2UUTA 3QRPA 4X64J 3H59A 2ZZTA 3L6QA 2CNLB 3BQ0A 2O8FA 3FVYA 4BC9A 3LGNA 1VAZA 5AE1A 1S49A 2AJFE 2WVBA 5IV3A 1QUPA 4ED0A 2PC6A 1RAEB 1QTMA 4FWQA 3VA0A 5K5MA 1FJGK 3W61A 3CC7N 3QEWA 2YKPA 1U09A 4Q43A 2RE2A 4X4VA 3OBYA 4UQTA 3PEHA 1WORA 3HVTB 2HHVA 1HIYA 3N5FA 2BM1A 5J2PA 1BIZA 3BF1A 3Q7CA 4PABA 3P83D 5EWEA 2CQDA 3NAIA 4CO4A 3HPOA 2M4MA 4J2DA 4RCHA 3G82A 1IBCB 1X7VA 2DRBA 4IFYA 3R3TA 1IBMK 2AGOA 3OQ2A 2XZWA 4NYFA 5C15A 3OW2M 3VQQA 2PFFB 3IMQJ 3SAHA 1AUSL 4FPBA 2DEJA 2J5AA 2XQCA 1WAFA 4LF8J 2QG9B 3F73A 4LREA 2DTJA 5K8OA 1RHUB 2DNMA 4ZVOB 3W65A 3QLHA 2IRYA 2ERRA 4K4SA 3W60A 4WTOB 4KHWA 1RWPB 4RUBA 2E2PA 2HMIB 2KXFA 3IWLA 3PHTA 4HI2A 5E7OB 2O3DA 4NLSA 1FT8A 4WKRA 1RT3A 2JC1A 2BUNA 2LDIA 1URRA 1GLAG 2RHKA 2DXFA 3RVCA 2X1BA 4FJ9A 4IFVB 3EVWA 3ZZUA 4RWXA 2R7OA 4BREA 3WZ0A 1HJOA 1I94J 3JYTB 3WXMB 3C15A 3H90A 4CECA 2CXEA 4PWDA 3WXLA 2AGQA 3QIPB 2KO1A 3NDKA 4F26A 2EXUA 4ID5A 4B1XB 3PKMA 4A62A 2BTFA 1AYEA 1VC6A 3DM2B 2B0GA 1EJ7L 1D5AA 2AIRB 3FFIA 1Y5LB 3ZZZA 4K2JA 1TKXB 2IVNA 3PRBA 1C4AA 2OPSB 1N33K 3LP1A 1HWLA 4M7XA 3VGVA 3EKUA 3D7SB 1LK7A 1H7XA 4OIXA 2E5IA 3P4UB 4HHUA 5AQKA 4I2PA 1RHQB 4BRIA 2NQPA 2CUYA 3W64A 4DV1F 3THWA 1LXNA 3QZ7A 1NGGA 3CWJA 4WU2A 2JLEA 4F0MA 4YS2A 4TN2A 4ZVSB 2P9PB 4KTQA 5EU7A 3SMPA 3T1HF 3MAHA 3GV8B 1ZBTA 2HFSA 1CJUA 2J0WA 1U6FA 2HHUA 1KQGB 3AJ2A 2W8KA 2HFUA 2IJNA 2D41A 4B3SK 2WSFC 3K2PA 4QPXA 1U1MA 2UUCF 4ZCIA 5HJYA 2BA9A 1UP1A 2M3DA 4RNHA 3ZX2A 4WKYA 2QLXA 1GX5A 3KJVA 3VGSA 4QJVA 4F67A 3PFEA 2CPZA 3KLIA 4FF4A 4Y3CA 5AQFA 3J81O 4WU3A 3A3NB 4BACA 2JL9A 2YWEA 1X4DA 3GWCA 2LCWA 3A5LC 3LP0B 1KOHA 2OELA 1DJ0A 1PIEA 3BO2A 4DR3K 2XZTB 2R7WA 3CMEN 1L3KA 4OQJA 4UTGA 4ZVUB 3NMRA 3DXMB 2AQ4A 2Z2LA 1QQCA 2QYCA 4MDAA 4JI1J 3WEEA 2F8SA 3I6PA 4AL6A 4P10A 3JS9A 4J2BA 5KT2A 4BS2A 2VPYB 1Q9YA 1NLKL 4M5KA 1DQ8A 3J7YI 1PAUB 3OYNA 3QERA 2E9RX 1J27A 2QLWA 4UQGA 3RMBA 2C2EA 2CNOB 3Q2TC 2AWZA 1ZETA 3I5BA 3MEDA 3N9UC 2W7AA 3LP2A 1TP7A 3O1BA 3C6AA 1YWXA 1D1UA 4HYKA 2UVUA 3BKFA 3C0BA 5AQSA 4TY8B 4DV2F 4J9LA 3OYKA 2V50A 1X4BA 3D7EO 1DEJA 4DG1B 2L9WA 3RAQA 3KHRA 4DR2J 1EQYA 4IDKB 4NXNK 1Q1KA 3AD9C 5C10A 1ELOA 2DPIA 3MECB 2F4FA 1HFEL 5JJBA 1Q86T 3LWLA 3KJQB 3B82A 4G1IA 4FWRA 4NI2A 1JLEB 1NDPA 4MQ3A 4KHPJ 4WWSA 2KXNB 2CZ9A 5BYQA 2EHGA 3FCVA 4W5TA 3GYGA 1MMDA 4M3UA 2ZOFA 4FWSA 5CCMA 1R8AA 3HTVA 4KRWA 7AT1B 2CJYB 1AW0A 3O1LA 1J54A 3J7YU 3AY0A 2V9KA 2P9LB 4ENOA 2M9KA 4RUCA 1C0TB 1N32J 1GLBG 2KT2A 1RTDA 3HVWA 2AA4A 2MQMA 1C2PA 4B9NA 7FDRA 3T5HA 3KKSA 4Y2CA 5DG7A 4FJLA 2OO4A 3TZXA 3SSRA 1RBVA 3I0RB 3QEIA 2MXYA 3CNQP 2HS4A 2E1CA 3TUJC 3DRPA 4GV9A 5F0XA 4JS5A 4LF2A 2IS3A 4DI6A 4YHHK 1QDUB 2ZBCA 5CZXA 4RW9B 1OY6A 1DAXA 3IAM9 3A3OB 2HNYB 4WFBQ 4Z4EA 2C2DA 4RL1A 1LFWA 3D3CJ 3NVKA 1S5JA 4DR6F 2LP4A 1YJ7A 4AHCA 4M94A 4TU8A 5LMUK 3ENVA 2F9DA 2IGIA 4BWMA 1HI0P 5MAOA 1YBUA 3P1GA 1FCAA 2HFZA 2XULA 5IXUA 4RG8A 1D09B 4DPTA 1YITN 1ILYA 3HHLB 3JTPA 3C2PA 3MI7X 2K1RA 2EFPA 2MQOA 1K1SA 2GAGC 1FRJA 4PKIA 2G8KA 3LM2A 3PV8A 2E5LJ 4AQYJ 2BJ3A 4BVPA 4ID1A 4RLEA 1BQNA 2VFVA 1PYSB 1GH8A 3AA4A 4PQUB 3LGHA 4CIEA 3V6HA 3CCLS 5C5JA 3QBCA 3VQEA 3S3MA 1N0UA 4A8XA 4F4WA 5KFHA 4X4OA 5KFCA 2YKQA 2V8GA 1UWBB 4KYZA 3MUVP 2A6OA 4A59A 1ICEB 2RRBA 1WF2A 2Q3PA 4DWIA 1YJWN 2X51A 5ETNA 2VB6A 3DXBA 5DM6L 1FKOA 4HUGA 4PWUA 1ESVA 3GB0A 4H4KC 1KVCA 2CQGA 5A8WB 4CBXA 1KAYA 5KFEA 3C66A 1RBRA 5F0UA 1QJHA 5IM0A 1JLFA 3CFRA 2P1JA 2VQEJ 3E01B 2ZZNA 1N5SA 1F5CA 1YBTA 3U1MA 3M2RA 4NLGA 2BGGA 2FJXA 1G4CA 3T1YJ 3J80Y 3M6VA 2DNKA 2YNIA 5A6PA 2FBYA 4DZ6A 2C2KB 1WLJA 5CYMB 3D2EA 1ZBLA 3UN2A 3VWSA 3OHBA 3UN3A 4B9UA 2PGCA 2GJIA 4FJ5A 1S99A 4KGZB 4U7CA 4NXNF 1WSGA 3L4IA 2CYYA 3AA3A 3PACA 4FXWA 2YQ1A 2HAFA 2E1PA 3SSSA 1E6VB 4BCAA 3P45B 4CJ7A 3CJTA 2MYFA 3CGIA 2IM3A 1HW8A 2FJVA 3DLBA 4RW4A 4O3PA 3E9LA 1QUVA 2B56A 3TWHA 2ASOA 3UDCA 4LF9J 5K20B 1GK8A 2CQPA 2H54B 2Q3SA 2ZJQQ 1LOTB 3OR1A 3SUNA 1ZBUA 1UW9A 3HDSA 4AF1A 4ECQA 4ZCLA 3F2KA 4DU7A 3F9KA 2QJ3A 3CCRS 5BRHA 1VQ8N 3BPSP 4DSFA 2P9UB 4EFAC 3OR2B 3EN9A 4CF9A 1XK8A 3LO3A 2HGNA 2QMWA 4M3WA 5LOQA 4U8VA 4WZQA 3QRRA 1HNZF 4NB4A 2YKMA 1YI2N 5KFTA 2CPIA 2VL1A 2DHSA 5H9EJ 1VFJA 5I3QA 3NMAA 3LANA 2HHWA 3SBTA 1X9WA 2EK1A 1KQSR 1ZC6A 2H3EB 3QMLA 3PVXA 3JQKA 1Y4ZB 1Y0HA 1L5UA 1P1TA 3BBCA 1SUQA 1D3WA 2K06A 1BQMB 5F9LA 3RSEA 3BGUA 5LMNJ 4FDFA 1O6XA 1N33J 5K9FA 4EO8A 9RUBA 2NRRA 1K8AT 1K0VA 3LM9A 1GFWB 3KDOA 3ZZOA 4ZVGA 4JV1A 3EPGA 2YX6A 3Q86A 1V3ZA 2ZUGA 5LMUF 1X4AA 5CAAA 3SYZA 2H5EA 2BE2A 1RTJA 6AT1B 4TLRA 5E3AA 1Z2ZA 1N5YB 1T9YA 2HQFA 5E3PA 4F3QA 3L3UA 3MMJA 2CQ3A 2MDAA 4M3ZA 4JKFA 2RDIA 4M5GA 2V68A 3THTA 1TFWA 4G1QB 5D3GB 5FDLA 2QL9B 3C65A 3L09A 5SZTA 3MX2A 4CW7B 3R1XA 1CSJA 2O66A 2YNFB 1CULA 3MR2A 4Y28C 2R3VA 3H2UB 4CZKA 1SKSA 1XNQK 3G8SA 4RWWA 2XI2A 4BY9C 3H25A 3NCIA 4IWVA 3K9KA 5AT1B 1OVYA 3OXFA 1YVNA 3M8ZA 5M2UA 5HMXA 3CJRA 1TUGB 2DH7A 2JNJA 1ZTWA 1NJZA 3NNCA 4OZNA 4O4GA 3N4WA 1Q8IA 1SC1B 1RYRA 4W98A 4FPAA 5CHIA 2CQ0A 5GADP 1H0HB 4FO0A 1K47A 1KQKA 3ZSOA 4PCQA 4K8ZA 2XMMA 1TYQB 1HYSA 2R7VA 2LKZA 4DFPA 4B02A 3OTCA 1HNVA 3M9NB 2CA9A 2AT1B 3LW5C 2O8DA 3ZZTA 3JSRA 5JXSA 4JNEA 2OTJN 4A48A 2AP1A 3C6HA 1S1WB 1PILA 1DTTB 4J5OA 2ZBRA 2GJFA 4FWNA 4OZ3A 2RN2A 1ACMB 2KI2A 1KRPA 1LWCA 3DOLA 4F4YA 4DV4J 4PY5A 3MUMP 1S4FA 1VSJA 3CF5L 4DTSA 5J1EA 4OGEA 4K8RA 2C2NA 1SL0A 2IC3B 2RQKA 4C8NA 4DTMA 5MLCQ 1N54B 2XCAA 4MFBB 4QIWD 5IQQA 4TU7A 5CYQA 2AJ0A 5KG0A 2BUPA 1RKIA 2X3DA 4KB0A 3MWBA 2OMLA 4L3NA 4BBYA 5D0GA 4RU2A 3BEXA 3OYGA 2DR5A 3LA0A 2GGPA 1F2GA 1R3NA 4Q5VA 2JZ5A 2GUIA 3V4IA 4CZCA 2DNQA 5GMEA 3CJBA 2ZWHA 4ERDA 4CEZA 4HTIA 2NZCA 1I5OB 4M5DB 3BR9A 1YJ9N 4FVUA 2K8GA 1RTHB 4A8YA 4BR0A 3A2FA 3KK1B 2HVZA 3RAMA 4EP5A 3EZWA 4FWKA 3PFOA 3K8WA 4WP9A 3MCNA 1UVJA 3KXDA 3OVBA 4CM0A 4DPYA 3AAPA 3AVIA 3UKRA 3C6TB 4WYBA 4H8KA 1U2VA 1YVUA 3RMCA 4LF8F 1X4GA 1ZZNA 4U6PA 2LXUA 4DR7K 3FZ2A 4DLEA 4EO6A 2F8EX 4DSJA 3C46A 3TAMA 3MPUB 4FLVA 4EAHD 3GPAA 4NYNA 3CB4A 2UXDK 5HANA 3EZOA 3MTKA 4LUBA 3U1LA 3JQJA 2DNLA 3FNNA 4OJRA 3AVLA 1CQNA 4ECUA 1RTIB 1AFIA 1Y97A 3UDVA 3G6ES 3D6HB 4CJ5A 5I3UB 2MQNA 1JLQB 2QM1A 5KFOA 2OPRB 2V34A 3FQKA 2Q31A 3P6YC 3OD2A 2WOMB 5DDPC 2OA8A 4XDDA 3G8TA 3P8BB 2X1GA 2GBZA 4EIAA 4CYUA 2GA7A 2D3OR 1PO6A 3QFUA 4WBFA 4FOIA 1KVIA 4ANDA 2CDQA 4QU7A 4R8UA 4B3TK 1RCXB 2QWOA 5CH7B 2CPDA 1BWFO 5HATA 3ID6A 3QPIA 3NNAA 3P5BP 3OJSA 3ZSZA 1U2RA 2VFTA 1Y00A 3AVHA 3E9OA 1M5HA 3VZHA 2D5RA 4LSZB 4BC2A 1KNZA 2YJFA 4CGIA 5HL7Q 3DXKB 2YWHA 3CCTA 4YOYA 2Q79A 4YMEA 1KLNA 1Z26A 1B0VA 4HACB 4ZJQA 1P8GA 3MCSA 1FFWB 3HPHA 3POTB 4QR0A 4X4TA 3OS0A 3IS9B 1NH8A 2Y9HA 3FEZA 1HBOB 4BQLA 2QWRA 1Q53A 3BGFA 3L7OA 2VKZG 3NGDA 3NY0A 2CPXA 4B3OA 1N56A 3LZJA 1X9MA 1MWZA 3ZC4A 1FDBA 1CZBA 2QE5A 1N0VC 1RT1A 4JI7K 3QFHA 5KQDA 1B92A 1GOCA 5J2PB 3MMCB 3UCUP 3MN6A 1CJVB 1DBDA 3PLAA 1X4CA 1N34K 1X3NA 2BOAA 4KR0B 3V6KA 2PA3A 4M63A 5ETVA 4YY3J 4LF7J 1H2VZ 3MFHA 1M5PC 1GX6A 3HOTA 1OPIA 4CI0B 3VGLA 4ZPWR 4OHWA 3GILA 3QLHB 2HVEA 2A3ZA 1N6QA 5F0WA 3W9JA 5HK4A 2VH7A 2ASMA 3SJHA 1HNWK 2C28A 3CMAN 4DUYJ 2YCHA 2UU9K 3A8EA 5KG1A 4LQ9A 2HQCA 1TU0B 2KM8B 3K0JA 1BXNA 2V63A 4GC7A 3ENBA 1BY9A 4GV6A 4DTOA 3HSGA 2IJRA 5B0BA 1NSPA 3PYDA 1D9DA 4E0DA 2VFSA 3CJ5A 3RBDA 4H0PA 1Q81T 3FQLA 1QM9A 3TJ9A 1C0FA 5FJ4A 4EHTA 3CUNA 2C2RA 1VQ7N 4LC9B 3C15B 1HD0A 4PWDB 1BHLA 2WSEC 1EHWA 4IQXA 3CCEN 3AVFA 2HBLA 4ID5B 4KHQA 1JKHA 3DDIA 2ILZA 3OTEA 2BJ1A 1TAUA 3QEVA 3TOQA 3WIUA 1T0TV 4BVOA 3FFIB 3L7PA 4PKHA 3LP1B 3M4XA 1ZAXA 4FJHA 1BHNA 1RAIB 1NCLA 3KYLA 2NUBA 4DV5K 4WFBL 4F36A 3QESA 3HKWA 4H4MA 3FBEA 4DR4K 4WPAA 2B9XA 1NGFA 4ZLJA 4I2PB 1NEEA 3MCAB 1TR0A 4ECRA 2R8HA 4Z4CA 2XWYA 1Z25A 2OKQA 2Z8QA 1OMSA 4QWEA 1LEOA 2V2ZA 2R7XA 2UXDF 3Q7BA 3MEKA 1PYOB 1B4SA 3S41A 1RT5A 3NL0A 1VQ4S 4BRQA 1Y3KA 1WF0A 1FW6A 1EX4A 1CJUB 3K17A 2C3YA 1RSCA 1ASVA 3CD0A 4O44A 3MM9A 4PXCA 1S7IA 3F41A 1JLCA 1IH7A 3KJVB 5M2PA 4BLGA 2NSCA 4FKXA 1VQNS 3A5NC 1N5QA 2QKKA 4MT1A 4TKTA 3KLIB 4C0OC 1PC5A 1H2UX 1VLYA 2KHCA 4BR7A 4HVZA 2NXNA 3AVCA 1P90A 3NH2A 2QXLA 4B3TF 3NE6A 5HRPA 5IWAJ 3KMSA 2ZHAA 2RE1A 3QGGA 3LPYA 3DKDA 2NLXA 2MY8A 3MK6A 1F9HA 2C3MA 2K3IA 5DQIA 1XNQJ 5ADZA 1VHXA 5H1SQ 3H45C 1QZ6A 4QWDA 3PM9A 2BJ7A 4IJNA 3NCRA 1BISA 1IKXA 3RMAA 4MK8A 4OL8A 2AEFA 5LT5A 2PI5A 4O8UA 2RF2A 3MAAB 3Q8UA 2XGQA 4C8OA 5B8HA 4E7HA 4RU9A 2Z0GA 3CC2S 3W2VA 3K57A 2PI4A 2ALYB 4F8RA 1VQ5S 2VPXB 1XMBA 2GZOA 3D6RA 2IMWP 3LP2B 2QEXS 4Y2AA 4ZJOA 4ZN1A 2XBPA 4B17A 4JI7F 5DDRC 3DLLQ 2YWWA 4GVEA 3C94A 2J7KA 4GO7X 1N34F 3CJ4A 4YB1P 3MM5B 1B99A 1FFGB 1C0UB 4L3QA 1NPKA 4M41A 3THPA 3LAKA 3MFIA 1VS3A 4PG4A 4I2QA 3I9ZA 2IPOB 3SQ2A 2CVEA 4OKEA 4DN9A 4DSEA 1NDLA 3QB0A 5BPNA 5HRSA 3T9ZA 3PO5A 3UB5A 1Q8KA 2P9GA 3FZLA 2NZ4A 1QAYA 2JDJA 4PG5A 1HNWF 2VBXA 2XHCA 3H5XA 5KG3A 4FOEA 4N76A 4FJ8A 2VQEF 2PFDA 2UU9F 3RR7A 1HR0K 5JICA 4J9NA 2G8VA 3CCQN 3FUYA 4GY2B 2WVEA 2W2PP 3CCVN 2Q97A 3TUPA 3GIIA 1Q7YT 4LFBK 3T5KA 5GAGP 2VUGA 4ILJA 5EN1A 4IOAL 4CIOA 2R7SA 4DPXA 5DDOC 2V4JA 2LU2A 4CNYA 3R9PA 3QYYA 2J0SD 1L3TA 4E2FB 4O3RA 2ZH2A 1JLGA 2IY5B 3WNEA 4M45A 5KRSA 5AQGA 1RTDB 3ISZA 2KL8A 5GIOA 4K0KK 2KU7A 3ELHA 1DFDA 2HGMA 2DGSA 3BDPA 3BYRA 4Y6IA 1FD2A 3OFGA 2W2MP 2UXBK 3KHYA 4LF9F 1VQ9N 3DRPB 4JI0K 3EUNA 3IXQA 2DHHA 2CGKA 5DJBA 3T6JA 1RWXB 4DR4F 4X65J 2GFFA 3OTOJ 2HBJA 4QIEA 4DR7J 3GJRB 2A41A 3TZYA 4B3MJ 2FC9A 3ENAA 2ZBPA 3PTWA 1RADB 3SUOA 1XNRK 4JEPA 3M2VB 2QLBB 1H74A 2RHSB 2POKA 5KFUA 4CNZA 2H65B 3PKYA 4XTTA 2CPYA 3AOCA 2RQMA 3CC7S 4CF8A 2K1RB 1HI8A 4BR5A 1TL1B 3DRSA 1YT3A 3EKSA 4CHNA 1RBSA 1YRTA 2Y1IA 5HJXA 4IO9L 4YUDA 4I67A 2BANA 3FCWA 3RR8A 1RYSA 3IDHA 3KK3A 2IMOA 3GFHA 5ETLA 2LEBA 2VCPA 3CCMS 2Q0RA 2VGNA 4I9LA 5BN9A 1ZZFA 4RKUC 4CJWA 2HVHA 4BC3A 4MK7A 3MR5A 1BQNB 1JB0C 4CZEA 4ZP6A 1S22A 4GNIA 1S6PA 1TKZA 3VGUA 1NMNA 3AOAA 4TYBA 4DV3J 2FHJD 3CE8A 4EYIB 1SJ1A 1G7CB 3KWGA 3CPWM 3ZFVA 1EO1A 5HROA 5AJ3J 5D4LA 1SZ2A 5M1PA 2GQCA 3RTVA 5KG6A 1FKOB 3DRRB 4ECVA 4LFCK 2QWPA 5DS7A 4TLQA 1TELA 1R8PA 4DV0J 3FCHA 5IM0B 3HVRA 3AXKA 1JLFB 2XMVA 4OZ2A 5C0YA 1WHWA 1JQGA 5HMZA 3M2RB 4WFYA 4EMDA 2YNIB 1K9MO 2ZOMA 3J80O 4AYBD 3DLKA 3D6MB 2JEGA 1N48A 5IT9U 3D2EB 3MN7A 3KK7A 4X62K 3C19A 1HBMB 1YLXA 4B8CA 4CO5A 3H5SA 3FZHA 3MMVA 2W9CA 2NLWA 2QIFA 4DMNA 5KT5A 3SFUA 3GYNA 1XJWB 4E1MA 3KLFA 3CIMA 2Q0UA 4RW4B 5FRMA 4CLZA 4RUAA 1IJJA 3FZFA 3KMQA 2HKEA 3RRHA 4GKJJ 4KH4A 1SC6A 3N0VA 3L7UA 3OR1B 3QFPA 1HR0F 4AUKA 2VG7A 4JYAK 3MN9A 5CY4A 5B7WA 4IXCA 3S8SA 3IKMA 4CEBA 5AXKA 4LFBF 3SQ4A 1LXJA 2Y1JA 1X5OA 4WYLA 2AP6A 2RS2A 3A5OC 1GLLO 4DV4F 4I4BA 1R59O 5AR0A 4OV1A 1EP4A 4BRDA 5BPMA 2YKMB 3TRGA 1RGVA 4JI8K 4H4OA 2Z4PA 4I64A 4FYYB 1EAYC 2F5GA 4K0KF 4K4TA 1JX4A 3ZZYA 5C12A 1K73T 2UYTA 5DG9A 2XRIA 5AZJA 5AXNA 3M1VB