4PUOA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 145
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4puoA05
3OJSA 4DFMA 2IM3A 4DS5A 2OPSA 3MEDA 1JL1A 3AVHA 2C28A 3PW0A 4W5TA 1RA7A 4WFYA 2E4LA 4N56A 3NKYA 3AVAA 4EZ9A 3QLHB 1U47A 4B9LA 3HVTB 1WN7A 1LAVA 5C25A 3H4BA 3KHLA 4B9UA 1IKXB 4DG1A 4E1MA 3SQ1A 2KFNA 3M9OB 1JLCA 4K4XA 3QEVA 5I3UB 1J5OB 3FDSA 3AO4A 4HUGA 2P1JA 2JLEA 1C0MA 4N47A 3CM5A 5KFVA 5J1EB 5KG6A 1BHLA 1WAJA 4ELTA 1DTQA 4JV1A 3TAQA 5F8JA 1DLOB 2J6UA 4H8KA 2HW3A 4CGHA 4ZPDA 1SKRA 3DMJA 1NJWA 4FZYA 4Z4HA 4CK3A 4IKAA 2YNIB 3MFIA 4ECRA 1RILA 3TAGA 3OL7A 5KT6A 4CFBA 3DLRA 5J2MB 4CJQA 1QE1B 4ED1A 3BDPA 2XCPA 3LZJA 3K5NA 3NF9A 4IBNA 2BE2B 2VG6A 2YNHA 3PW7A 4DL6A 2FBVA 1YTAA 4KHYA 3OY9A 3M8RA 2E9RX 1HQEA 3V81A 1S1XA 4DL7A 3KK3A 4WYLA 1S9GA 5KG3A 1IM4A 1JX4A 5CY4A 3SZ2A 4C8OA 4BWJA 1TKXB 1W0HA 4IH6A 3HSTB 4IKFA 5DQIA 4CHQA 1HRHA 4FLUA 1UAXA 2PYLA 2VWKA 1SV5A 1J54A 2HHVA 1TKZB 1C1CA 2XC9A 2OPPA 4KTQA 4NRUA 1U04A 2Z1HA 4CHZA 4TYAA 3T1AA 4KREA 3SFUA 4EEYA 3DRSB 4AHVA 3TABA 2W9BA 3GILA 2W7PA 4ED7A 3QIPB 1LW2B 2VG7B 2FVCA 1X9WA 3IG1B 3VN5A 3NFAA 4CEBA 3SV3A 4B3OA 4JUZA 3KK1A 2OPRA 1C0TA 1WLJA 4JV0A 1SL0A 4PUOB 3GIMA 3K5LA 1YT3A 3ZCMA 2WONB 1SKSA 1NJZA 1KFSA 4CJEA 4C8MA 4ZP6A 2D41A 2JEJA 3N6MA 5KG5A 1L5UA 5KFLA 2VA3A 4I2QB 4TY8B 3BJYA 3K5OA 4B9VA 4G1QB 1S9FA 1VSEA 4E89A 2PZSA 3DLEB 3RR7A 4J2AA 5KFAA 2FBTA 3QO9A 2WCXA 4DSKA 2QKBA 2B6AA 4IDKA 4KKOA 2ZKUA 1WNSA 3KD1E 1C0UB 4NYZA 3C95A 3RMDA 2OA8A 3I5BA 5JS1A 1N48A 3K59A 1S1VB 4EBEA 4DL3A 2HAIA 3HPOA 4FK4A 2HVHA 4DTPA 1UWBB 4CGIA 3RMCA 4MIBA 1RT3B 3EPIA 1N56A 4KO0A 4HCCA 2XO7A 3L2VA 3MR3A 1N5YA 3VQQA 3IGNA 1S4FA 4KSEB 3LAMA 5C5JA 2AQ4A 4NLGA 4ZMMA 1TL3B 1JLBB 1S48A 4IH5A 3VQ6A 2IJFA 1NKEA 1YTUA 2FLPA 3ISND 1TK5A 2FVPA 2E9TA 4KV8A 4I9QA 3M8QB 3AA2A 3KHHA 1QAJA 1NJYA 2FJVA 1RT6B 4B9NA 5KFZA 4PWDB 2BR0A 4CHOA 3C6TB 2D5RA 3DOLB 3WNEA 1XR7A 1R0AB 4XIUA 4BWMA 5HLFA 1F21A 3MECA 1QQCA 3OYGA 2WOMB 4MK9A 5CYMB 1RDRA 3NL0A 3TAMA 4E7KA 3DM2B 3S3MA 2Q3SA 3HVRA 1W25A 3FQLA 1VSLA 3NBPB 1A5VA 4ECTA 3MXIA 4WZQA 4IRCA 1L3UA 3AVIA 4KHMA 1LWCA 4TLRA 4KAZA 3KLGB 2OZSA 1BISA 4NLXA 3OJUA 2F8EX 3KLVA 4KPYA 4CK1A 1RTHB 5C24B 1N6QA 5J2PA 3K57A 1U4BA 5EDWA 1RT2A 4ID5A 4GVMA 1CZ9A 3EZUA 4ICLB 1EETA 3KJVA 3MEGB 3HHKA 5HROA 1GOAA 2RF2A 3TWHA 2WRMA 3ZT3A 4OLBA 1U49A 1S9EB 5HP1A 1O1WA 4FJ9A 5EUHA 3V1OA 2KTQA 4Q43A 3LP1A 4EP5A 1S1WB 4EO8A 1RTIB 4QWBA 3S3OA 2BQRA 3OSNA 4NLVA 1EP4B 1QSYA 1BI4B 3RRGA 1JLQA 4IFYB 2JEIA 3RTVA 1I39A 2I5JB 3OHBA 3HPHA 1NNDA 2J6SA 1HARA 3L3VA 5K14B 1KVBA 1S0NA 3DI6A 1QSSA 2D3ZA 1D5AA 4Y34A 4OGCA 3KK2A 5KG2A 5C42B 4NCGA 3SQ2A 1ZBUA 3V4IB 4ZPAA 4F2RA 1LWEB 4ED6A 5D3GB 4OLAA 4FZZA 1LAWA 4FLZA 2V4RA 4I7FB 2ZE2B 1S0MA 4BDYA 1JKHA 2HNDA 4LSNB 4DFKA 3H5XA 3PX6A 4CIEA 4QWCA 1QUVA 4RNNA 2HNYB 4CIGA 3QZ8A 4K50A 3DRPA 5HRNA 3QESA 3ALYA 3GIIA 2G8IA 3OHAA 2B5JA 4DU4A 2DFEA 1VSKA 2OPQA 3SUQA 1A5XA 4CF9A 2KW4A 4M3UA 3MF5A 2XI3A 5HBMA 4O4GB 1RCHA 1KLMA 3VQAA 1XWLA 2D7SA 1WSHA 1HPZB 4OL8A 4J9QA 1JL2A 5L1IA 3UIQA 4IFVB 1B9FA 4M3XA 2E6LA 5JXSA 5HRSA 1A5WA 1QHTA 4B08A 2HNZA 2XGPA 2JGUA 4RU9A 4ECQA 5F8GA 3KD5E 3QGHA 1LWFA 1HNVA 3PO4A 5KFDA 4BACA 4E7JA 2HMIB 3QYYA 2IJNA 4RW8B 1QAIA 2GV9A 1VSHA 2D0CA 1REVB 1BGXT 3QGGA 3MFHA 4WXWA 4NLPA 2X74A 1T8EA 3QLHA 4WFZA 1FKPB 3HVTA 1I3AA 4ECVA 3WNHA 4ZTJA 5KT3A 4LQ9A 5DLFA 1IKXA 3WNFA 4Z4IA 4LH4A 2XI2A 2OZMA 4F8RA 1J53A 4Y1DA 3KHGA 4OJRA 5I3UA 1J5OA 2RN2A 4RG8A 2XCAA 3VQDA 1FK9A 3VQ5A 4FJMA 4LD0A 4CJVA 4BE0A 3PHEA 3Q8QB 3RB3A 4NLDA 5J1EA 4WE1A 4CJFA 2GIRA 5L1LA 5HRPA 1DLOA 1RTJB 3DYAB 4YR3A 1VRUB 3LP0B 5F8LA 3U3GA 4O44A 1B9DA 3VQ4A 1C6VA 5J2MA 3BGRB 1RBRA 4Q5VA 1VSJA 4HYKA 5EU7A 4WFXA 2F8SA 2BE2A 4KHSA 4ECXA 3NH0A 4R5PB 1XC9A 5F8IA 5KFSA 3DLGB 4ZVGA 3G0ZA 1HQUB 4O3SA 4CF0A 1TKTA 3N6NA 1TKXA 4ZTFA 3FQKA 2G8WA 1S49A 2IM2A 4B8CA 3HL8A 1S97A 4Z0UA 4E0DA 4DSLA 4M3TA 3DLBA 3CM6A 1TKZA 5KFOA 2DPIA 2W9AA 1HYSB 4E1NA 3V9UA 2O4GA 1NK6A 4QPXA 3CWJA 3PJXA 5KFNA 3NAEA 2ZD1B 4CJRA 3DRSA 3QIPA 3EPGA 3S9HA 1LW2A 2E9ZA 3A2FA 4CJLA 1TVRB 2HWIA 2R2SA 3IG1A 4AHRA 1K1QA 4M42A 3KLEB 4KB7A 3PY8A 5KFQA 4Q44A 4EYIB 1XHXA 3FFIB 4OKKA 4PUOA 3NAIA 1RYSA 4B9SA 4IR9A 4AH9A 1K6YA 3SPZA 4HHTA 2WONA 3AVNA 4FJNA 4FJHA 4JRPA 5KFYA 4OKJA 4EZ6A 3VA0A 3NGDA 1IKYB 4TY8A 3RB6A 2KZZA 2IGIA 3TAFA 1N4LA 3DOKB 1WAFA 2YNGA 3DLEA 3O3HA 1JXEA 3CDEA 3H2LA 4O5BA 2AGOA 5KTQA 4KI6A 3FSIA 4FK0A 3C6UB 1C0UA 1U45A 1FXXA 1S1TA 1KHVA 5KFXA 4NYNA 1SH2A 2X78A 3RMAA 1S1VA 3E01B 1NJXA 4QWAA 4G3IA 5DQGA 2C2DA 2BANA 4TXSA 4J2BA 4CGJA 4L8RB 1RT3A 2W8KA 3AVKA 3KLFB 3QEXA 2YKMA 4IG0B 4ZP7A 3VQ7A 3L2QA 4NCAA 1CZBA 4J2DA 1BQMA 4FLYA 3JSMB 1C1BB 1JLBA 4DMNA 5CYQB 4BDPA 4J9OA 2CJQA 4AHTA 3V9ZA 4DTMA 1D9DA 1I6JA 4RZRA 1T05A 2IC3B 3CQ8A 4ECYA 3D28A 1NK8A 2ATLA 4ECSA 4CHNA 4CK2A 4DQPA 3BSAA 3IS9B 3OYLA 4U6PA 1RT6A 1SKWA 2JC0A 4K4WA 3G6YA 1WSGA 2RDJA 4ECWA 3ZSYA 4F50A 4WZMA 2F8TA 3C6TA 3DOLA 4CEOA 1R0AA 3MAQA 1D8YA 4DU1A 2WOMA 5L1KA 5CYMA 3RB0A 1GOCA 2QKKA 4Q8EA 1IH7A 1TAUA 1RA6A 4CGFA 4FS1A 3NBPA 3PR5B 1RBTA 3VA3A 3HVAA 3SUNA 5CZ2A 4UQGA 4MFBA 2G8VA 3ZT1A 4FJXA 2ATQA 3LDSA 1NK4A 1RDAA 3KLGA 1CXUA 3HM9A 1TK8A 4DL2A 2PY5A 3CVKA 2R2UA 5C24A 1ZBFA 3OYDA 4DSJA 3T5KA 4FJ5A 3MTKA 3LP2B 1LW0B 4XPCA 1ASVA 3VQEA 4KHUA 1L3SA 1S9EA 4ZVHA 1BQNB 1X1PA 3HK2A 2VG5B 5KFHA 1S1WA 1RTIA 2XY5A 3BREA 1EP4A 3HKWA 1BI4A 3EZ5A 4JRQA 4J9SA 1BIUA 4PA1A 2UVVA 2HB5A 2FLNA 3QETA 5K14A 3OS0A 4DQRA 5F8HA 3KMSA 2W9CB 1JXBA 4H4OA 5DG9A 4Q45A 4F4YA 3GQCA 3E51A 1VSFA 2OH2A 3NF6A 4CJPA 4YR2A 5KFKA 1RDDA 4OVLA 2G8FA 4FJIA 4KRFA 3I0SB 4O3PA 1TL1B 1UA0A 3OL9A 1NKCA 3BQ0A 3I5CA 5DLGA 4CFCA 1LWEA 4F4KA 5D3GA 3I0RA 5KFPA 4RW7B 3L2RA 2ZE2A 4AHCA 3RMBA 3NF8A 4J9PA 4ZHRB 2EHGA 4XO0A 4NZ0A 3HYFA 4XPEA 4H54A 1RT4B 4TY9A 4FLTA 3U6FA 3KKRA 1T94A 3HO1A 1XI1A 1VK0A 3HPGA 2W9BB 4URGA 4CJUA 3PO5A 4IRDA 4CEEA 4OPJA 1KVAA 2UVWA 1TKDA 4Z4CA 4CJSA 1HMVB 4GC6A 3H4DA 4Q0BA 5DGAA 4DU3A 4W5RA 4DQIA 4B3OB 4Y2AA 3KLIA 3PJWA 2XY6A 1BCMA 4LSLB 3SUPA 4LY7A 3H98A 3SI6A 2P5GA 4O4GA 3H5UA 1S0OA 2GIQA 4HVJA 3CFPA 5EWFA 4O3RA 4ZPBA 3RAXA 4H4MB 4DF4A 5SZTA 2BDPA 3D5MA 2JC1A 1HPZA 2CKWA 3ITHB 4MQ3A 4IFVA 4J9RA 1Q9XA 3H08A 1SUQA 5J2QB 1HYZA 2AGPA 4ZPCA 3MXMA 4ID1A 2B6AB 5DG7A 4IDKB 3H5SA 1T03B 3KTQA 3SPYA 3ZSZA 3UPFA 4E7LA 4K4VA 4DQQA 2UUTA 4QW8A 3CJ5A 4M95A 2IDOA 4Z4GA 2HMIA 4RW8A 3BR9A 4O3NA 4RUAA 3ZSQA 5EWGA 3LZIA 3TANA 1REVA 3ICLA 1EXQA 1MU2B 3VQPA 1IKVB 4M45A 1FKPA 4F2SA 4M3YA 3KMQA 3RR8A 3T5JA 3OYCA 5I42B 2P5OA 2E6MA 1TAQA 3AVGA 1SH3A 2VWJA 3IRXB 4KTZA 4CIFA 4FLWA 3D45A 3NGZA 2WTFA 3P5JA 3P83D 1YVFA 4GW6A 4EP4A 2R8HA 2VA2A 4FJGA 1KLNA 4KV8B 4KFBB 3G86A 2ASLA 1IKWA 3GIJA 4NLRA 4BE2A 5KG4A 4Q8FA 1RTJA 1VRUA 3LP0A 2UVUA 3OYMA 3DLHA 2IMWP 2QXFA 1VRTB 3TAMB 4I2PA 2JEGA 3SQ0A 4FVMA 4HKQA 3V9XA 3DDKA 5KG1A 3KHRA 1QTMA 3M8PA 2RKIA 2WB4A 3BGRA 2P51A 3BSOA 3CYMA 1HJRA 3FRZA 4HUEA 3ASMA 3SCXA 2R8JA 4CERA 3LWLA 4CGDA 3OS2A 4ED8A 4CEAA 1ZBLA 3V1QA 3B6PA 3MR6A 3AO3A 5EWEA 1S6PB 1LWCB 3VQ9A 3KKSA 4QWDA 2C2EA 3OYNA 1NOYA 4O0JA 3OYEA 2IOCA 4IR1A 1NOZA 2AGQA 2DTUA 3RRHA 4R8UB 4PQUB 1JLAA 4GC7A 4KI4A 1HQUA 3F9KA 1DTTB 1RTDA 4Z4EA 3QZ7A 3RWUA 4C8NA 3KJVB 5HP1B 4NLTA 3CDWA 3QEWA 5JS2A 3ZSRA 1RBSA 2HHSA 3PX0A 1RNHA 3BSCA 4IG3B 2YKNB 2ZD1A 5KGWA 4FM1A 4CF8A 3ZSVA 2NUBA 5FDLB 3PW2A 5KRTA 3H59A 2BQ3A 1TVRA 2UUWA 2B4JA 3KLEA 4ECZA 3QGIA 2J6TA 1Z4UA 1RT5B 3TAEA 3TQ1A 3KK2B 3OLBA 4JLHA 1RT7B 4TN2A 1S1UB 2QV6A 4NYFA 4NLQA 1ASWA 3PW4A 4K4UA 4CCHA 2GUIA 4RNMA 1FKOB 1IKYA 5F9NA 1D1UA 3DOKA 1JKHB 2RPIA 4TYBA 2HNDB 3M8SA 1CSJA 4FJLA 2GC8A 2D3UA 2YNIA 3C6UA 1JLGB 1NK7A 1GX5A 3O4NA 2R8IA 1QE1A 4RUCA 1KVCA 4O0IA 4FK2A 2EC0A 1JLEB 1RT1B 4DTNA 4NLWA 3IAYA 3E01A 3ZSWA 4C8KA 2FVRA 3PW5A 2G8KA 1JXLA 4Y1CA 5FRMA 1Q9YA 3NH2A 3NAHA 1J9AA 3LP3A 2ALZA 2FC0A 5KFIA 4DFJA 4CJ5A 2GBZA 4MIAA 4NLUA 4TQRA 3BSNA 3CG7A 3PVXA 4KAIA 3MEEB 2HHXA 3AVJA 2FLLA 3JSMA 3TARA 4RW6B 1C1BA 4DTXA 4ZVEA 3ZSOA 5CYQA 2IAJB 1C1AA 2V4QA 3IN5A 4CJ3A 2IC3A 4RW9B 3JYTB 3V6DB 4LH5A 5KGXA 4HUFA 3IS9A 5J2NB 3GIKA 4FXDA 2JEFA 4CGGA 3V9WA 3DLKB 5L1JA 2VG7A 1OS5A 1TV6B 2R2TA 1B92A 3RBDA 4K8XA 4R0EA 2FVQA 4ECUA 4ED0A 5KT5A 4FBTA 1KSPA 3CJ3A 1X9MA 4ZVFA 3IGVA 1C2PA 2HHUA 4M41A 4RW4B 2KFZA 2KQ2A 1JLFB 2PYJA 1RBUA 1XR6A 5KFMA 4NCBA 4JV2A 4IRKA 4I2QA 4G1QA 3Q8SB 2A1RA 1FK9B 4O3OA 4RNFA 2O4IA 4Z4FA 3UR0A 4WE1B 4DTJA 1SL1A 3H40A 3V6KA 3THVA 3QNNA 2V9WA 5SWMA 3LP2A 1LW0A 3BQ2A 4YNQA 2FBYA 1VSDA 3NGYA 4FJKA 3AVFA 4O44B 1BQNA 1UWBA 5KT7A 2FJWA 3SFGA 2VG5A 3OLAA 3PX4A 1S5JA 4KTWA 2ASJA 4CFDA 2G8UA 4N76A 2R8KA 1VSIA 4FCYA 1TK0A 4YMEA 4J9MA 1YVUA 4DS4A 3AVLA 1TL3A 4J9LA 3NE6A 4CFAA 3ZSXA 4DF8A 2YNFB 1KTQA 2D0AA 2W9CA 4GMJB 3QIOA 1ZTTA 3OL8A 4CJTA 4DFPA 2V0NA 4E7HA 3KLHB 3P1GA 3V6HA 3AVBA 3DRRB 4EYHB 3LPUA 3CJ0A 1S6QB 1HNIB 1ZBIA 2QE5A 4QOZB 3M8QA 5KFGA 3I0SA 1TKTB 1TL1A 3HP9A 3K58A 2G8HA 2XGQA 4QCLA 1MMLA 4PWDA 2FJXA 3RBEA 4CEZA 1ITGA 4RW7A 2FVSA 1RYRA 2OPSB 3MEDB 4ZHRA 4FBUA 4MKBA 5DMRA 3MXJA 4K4ZA 1RT4A 4FW2A 3DM2A 2HVIA 4KE5A 1KCFA 1NHUA 5C25B 2EX3A 3AV9A 5T14A 4HCBA 1T3NA 4DG1B 1HMVA 3CJ2A 3HP6A 1JLCB 4RNOA 5KT2A 4ELUA 4LSLA 1ZETA 3NF7A 3EY1A 3OYFA 4H4MA 1RDCA 3CFRA 1RTHA 3PV8A 3HVWA 1BCOA 1DTQB 3L2WA 4N5SA 2AX0A 3ISNC 4F3OA 4CEDA 2DFHA 1L3VA 1U09A 4ICLA 3ITHA 4F3TA 3MEGA 4DLEA 2YNGB 4FLVA 3DMJB 5L9XA 5J2QA 4TQSA 3CFOA 3I8DA 3OS1A 3QERA 4BDZA 3WNGA 1T03A 2ITGA 5F8MA 2X6NA 1S1TB 4KBIA 4OGEA 4Y3CA 4IFYA 4FS2A 4EBCA 2I5JA 4MKAA 2HWHA 4AILC 2VG6B 4QWEA 3VQ8A 2YNHB 2YHAA 4AHUA 2BANB 1L3TA 3OYBA 1ZBHA 3V6JA 3Q8PB 4K8ZA 5KI6A 5KFJA 3NHGA 2XY8A 3G6VA 1KRPA 1MU2A 1TGOA 3SYZA 1HQEB 3V81B 1S1XB 2YKMB 1IKVA 3KK3B 2W42A 1S9GB 3SUOA 4QAGA 2R2RA 1D9FA 3O3FA 5C42A 1BQMB 4AHSA 5KRSA 3OYHA 1X9SA 1CLQA 5I42A 1UOCA 3LAKA 3SV4A 4KB1A 5KG7A 3IRXA 1NK9A 3V4IA 5FROA 2DY4A 3MR5A 4K4TA 4I7FA 1GOBA 4CJ4A 1T05B 1SV5B 3AO5A 1C1CB 4LSNA 2FBXA 3GV8B 4FJ8A 4FJJA 3ZT0A 2OPPB 3AVMA 4IH7A 4KFBA 1W9HA 1WSJA 2HNYA 3CO9A 2LSNA 5KFWA 4EO6A 4M94A 3LALA 3TVKA 5KFCA 4KHRA 1IO2A 3V1RA 3QINA 3TR8A 2AWZA 4MH8A 3KK1B 1VRTA 2ETJA 2OPRB 3I5AA 1C0TB 4W5OA 2W8LA 3OSPA 4IOBA 3SI8A 1WSEA 3D0PA 4DTOA 4CEFA 2F96A 3HXMA 1SH0A 4DTRA 2Z1JA 4FYDA 3NDKA 1RAJA 4MFBB 4ED3A 1S6PA 4CEQA 2YV0X 4IQXA 5KG0A 2W7OA 3RB4A 2YHBA 4URSA 4WYWA 3VQSA 3QO9B 1SL2A 3T5LA 3LANA 4O3QA 4R8UA 3VQBA 2ASDA 4PY5A 4PQUA 4KKOB 1RBVA 1DTTA 1NHVA 3MR2A 2R7YA 4ELVA 4DTSA 3VQCA 3PR4A 3OYJA 1GX6A 4B9MA 4CF2A 2HHQA 2RDIA 2O5DA 2B43A 4O4RA 2XY7A 3H5YA 2AX1A 4F4WA 1Y97A 2Y1JA 3HT3A 5KFUA 3SJJA 3OVNA 3F73A 4B8AB 4KO0B 1K1SA 4RNHA 1N5YB 5DGBA 4KHQA 4IG3A 2YKNA 4FJ7A 3OYKA 4NRTA 5KFTA 5DQHA 3CIZA 5FDLA 2BRLA 3UDLA 5KFBA 3ZT2A 3QEPA 4DSEA 1KFDA 4M3WA 4CESA 1Z25A 1BIZA 1VSMA 1S10A 4H4OB 3BQ1A 1NKBA 2Z1IA 2XHBA 4NLSA 1RT5A 3PZPA 4FZXC 3EYZA 3N6LA 4U7CA 5T7BA 2Y1IA 2KZMA 1RT7A 1S1UA 1KHWA 4CECA 4X2BA 3G10A 3Q8RB 2IM1A 1NK5A 3I0RB 5JUMA 2IBKA 3DYAA 1FKOA 3K2PA 5HLFB 3T3FA 1XR5A 3MECB 3C94A 4E19A 4I9LA 1Z26A 4OKEA 3ULDA 3SNNA 3RAQA 4FM2A 5CZ1A 3KOAA 3OYIA 3V9SA 3T5HA 4J2EA 1JLGA 4CJWA 2WK4A 2DPJA 2HHTA 1ZTWA 3LWMA 2D0BA 1JLEA 1RT1A 4QW9A 4DL5A 4W5NA 4ZP8A 2OYQA 4Q0BB 5FRNA 2BGGA 3TAPA 5E41A 3LPTA 3KLIB 4KB0A 4KHNA 4R5PA 4CF1A 2WHOA 1BL3A 2XRIA 4K4SA 5HRRA 2A1SA 2ZQBA 4OPKA 1XHZA 3DLGA 4FW1A 4EBDA 3L3UA 4N41A 1Q8IA 1N6QB 5J2PB 3MEEA 1ZYQA 3TI0A 1QSLA 4MK7A 3AA4A 3AVCA 1RT2B 4ID5B 4RW6A 1QS4A 1EETB 2IAJA 5HROB 1SUQB 2RF2B 4LQ3A 4NLOA 1EX4A 2IS3A 4RW9A 2Z1GA 3JYTA 2HHWA 3V6DA 2IM0A 1WNEA 4Y2CA 2ILYA 1HYSA 3LP1B 1WSFA 4YFUA 3KIOA 4DLGA 2BQUA 4DWIA 5J2NA 4O55A 1JLQB 3OYAA 4E3SA 1LV5A 1RDBA 3DLKA 1TP7A 4CHPA 5KFEA 1TV6A 4YQWA 4CHYA 4C8LA 1NK0A 4YR0A 4ED2A 4F4XA 3QNOA 3DI6B 3NMAA 4M3ZA 3B6OA 3FFIA 4RW4A 1JIHA 3PUFA 3CDUA 4YP3A 3M9NB 3SQ4A 1D0EA 1JLFA 4NCGB 3AA3A 4M3RA 3GYNA 3L2UA 1IG9A 1ASUA 3GV7B 2DFFA 1WSIA 4FM0A 4MK8A 4E7IA 3OL6A 3K5MA 2X6SA 4FLXA 4BE1A 5F9LA 3GV5B 4DTUA 3UQSA 4DSFA 1IKWB 4ZP9A 4J9NA 1UA1A 3DRPB 1T7PA 3G6XA 2UVRA 3QEIA 3NCIA 3ZT4A 3NGIA 4JS5A 3CJ4A 2ILZA 5DK5A 2B5JB 3O4QA 3S3NA 2BRKA 2C2RA 5KFFA 3O3GA 2I1RA 2OPQB 4I2PB 2QK9A 4TSXA 3M8PB 1U48A 4DL4A 2RKIB 5HBMB 3KLFA 3U3YA 5KT4A 1KLMB 4IG0A 2IA6A 5F8NA 3HJFA 5KFRA 4K4YA 4KHWA 3AO2A 4URQU 3M9MB 4CJKA 2YNFA 3T19A 3AO1A 4B9TA 1G15A 4HTUA 3L8BA 2R8GA 4WXOA 4CE9A 5DG8A 2HNZB 2AJQA 2XWYA 4DEZA 1HYVA 3NH1A 3KLHA 4W5QA 3DRRA 1JLAB 4J9KA 1S6QA 4F4ZA 1HNIA 4JS4A 1RTDB 3QIDA 2C22A 1LWFB 4NLYA 4DQSA 2AU0A 3AA5X 1HNVB 1CXQA 4DSIA 1EKEA 3KNAA 1TQLA
chains in the Genus database with same CATH superfamily
2W2PP 1Q86T 3RAMA 1GLJO 4DS5A 1JL1A 1EZZB 2BVZA 2E4LA 4CZIA 4CZGA 4ZK7M 3HVTB 2PMHA 1V3ZA 4E1MA 1AB8A 4K4XA 4LF5J 5I3UB 1J5OB 2DRDA 3AO4A 1VQ6S 5AQYA 4XTTA 2P1JA 2JLEA 2VF3A 2CVIA 3CM5A 5J1EB 5KG6A 1JJ4A 1Y5IB 4EFHA 2NRXA 2QM1A 4JV1A 4BRLA 1ZAWA 4EGLA 5GINA 2J6UA 2COLA 4H8KA 3E9LA 3DMJA 1WKJA 1NJWA 3W2VA 4IKAA 1WJ9A 4BQLA 3GONA 2OAUA 1W7AA 3MFIA 1IBMK 3OL7A 3ENAA 2YWWA 3DLRA 2GTDA 5K20B 3BDPA 2F7VA 3LZJA 1FO1A 3NF9A 4BR7A 4HR2A 2GIFA 2KYXA 1IBMF 4PQAA 2QSWA 2E9RX 1NJIT 2DRBA 1X7VA 3KK3A 2HVEA 1FJCA 4BRAA 3IM9A 3FRYA 4C8OA 1G2EA 1W0HA 1NH7A 4IH6A 7FD1A 4FLUA 2C42A 1J54A 3UCZP 2OPPA 4NRUA 4DR2J 1URNA 4CI6A 4CHZA 3SFUA 3DRSB 3TABA 2W9BA 3GILA 1IXKA 2NRZA 2FVCA 3THTA 3BF1A 3NFAA 4CEBA 4JUZA 4U67Q 2WW4A 3HM8A 3CHWA 1C0TA 3CTRA 4FWOA 2GVDA 1MWQA 3CMEN 4J9VA 4UY8O 5GVQA 2XWXA 5B8HA 2NCKL 1B7YB 2WONB 3B78A 4DUYF 1D4XA 1CS4B 2LLZA 2O8DA 1QY7A 3DHXA 2D41A 3AA8A 5KG5A 5KFLA 2VA3A 4R0JA 4TY8B 2RE2A 2HQIA 4X4NA 1KAYA 1VSEA 3EZWA 3DLEB 2ZHBA 2RJZA 5KFAA 4CNZA 1PG5B 3RSEA 4DV4F 4DSKA 1T9UA 2QKBA 5IOLA 2ASMA 2U1AA 1RISA 4IQMA 3MCOA 2WVBA 2OA8A 2FB0A 3I5BA 4NPOA 2O8CB 2B7BB 2UUAJ 3K59A 1S1VB 2HHHF 4OYOA 1U1KA 2HAIA 4C23A 3HPOA 2HVHA 4DTPA 2CG4A 1HNXJ 4MIBA 2VB6A 4OYBA 3CCMN 2GAGC 4KIAA 5B0EA 4DZDA 2XO7A 4JN4A 2DHSA 3IGNA 4X64J 4MO4A 2XS2A 1S4FA 1A0OB 2CQ0A 4AXJA 1XERA 4DX8H 2RQ4A 3MM6A 3V5RA 1RP5A 2BW2A 2ASYA 4NWBA 1Q7YO 4IH5A 3UKUA 2JFDA 2Z8QA 1NKEA 4DPWA 1YTUA 1BA1A 1XUPO 1RAFB 1TK5A 2BX6A 2FY1A 1KOHA 1A7GE 3THYA 3KHHA 1NJYA 2A10A 3W65A 4QYZK 3TP2A 3QRQA 5HQ8A 2D5RA 1WG4A 3WNEA 1R0AB 4XIUA 1OPIA 4BWMA 1TMJA 4GV3A 4G9ZA 3MPVA 1WDTA 2VFVA 3CULA 4B1XB 1X3NA 1RDRA 3MURP 3TAMA 1VCTA 3HVRA 4MO5A 2F7TA 1A5VA 2HZAA 4CZHA 4JD2B 3AVIA 3CJTA 3VEYA 4KHMA 3TEGA 2MTLA 3TUPA 1UZHA 1OVYA 1QD1A 4TLRA 3VWSA 2ROEA 3C66A 1BISA 1X31C 4KYZA 1RTHB 2KT2A 3K57A 2QYGA 3SEOA 5EDWA 1EETA 2DNNA 3MEGB 3TWHA 3SDEA 1S9EB 1ZXOA 1O1WA 1QVGM 3N4WA 3V1OA 5AQRA 2GS8A 4Q43A 4ANCA 1RTIB 2BQRA 1H72C 2V5HG 1QSYA 3UVJB 1JLQA 4OJ3A 2I5JB 4W98A 3CDAA 3Q8YA 1XIQA 4NXMK 2O8FA 5HN0A 1XJWB 2J6SA 3D3BJ 4BVPA 1KVBA 1OH5A 3DGVA 2ZH2A 1D5AA 1J5EJ 2CXEA 3BY5A 1XMOK 1KEKA 5C42B 5IWAK 1YI2N 3SQ2A 2G1HA 2XSJA 2P9SB 1ZBUA 3V4IB 4ZPAA 4LFBK 5B0GA 3GFZA 4JAXA 2V4RA 1JKHA 3I31A 2VQEJ 4LSNB 5EGYA 4DFKA 3H5XA 2A6OA 5JVHQ 4UUXA 5BRDA 2JWLA 4L3QA 4DR3J 4K50A 2PDAA 2QYCA 3FZFA 1YRUA 4NZ6A 3OHAA 4ZVSB 1NGAA 2B5JA 3R5CA 4LRDA 2DFEA 2FTRA 3MM9A 5HMWA 2Q36A 1RHRB 4M3UA 3F0NA 2XI3A 3DFEA 1VQNS 1KLMA 1Y11A 2K06A 1VQ4N 5JVGL 4PAAA 3ZXWA 2VZ9A 3UIQA 3EKUA 5D4OA 5HRSA 4CW7B 5AE2A 3OUYA 2HNZA 3OW2R 3CPWM 2XGPA 2JGUA 4C2MA 5CZXA 2W6KA 3QGHA 3SCKE 3KG0A 2DGUA 3PO4A 3EN9A 2NQPA 4J37A 3ENOA 2VHGA 4E7JA 5LMUK 2HMIB 1XNQK 1WHWA 3GPAA 5J1PA 2X3DA 3PACA 1REVB 2PIIA 1FKAF 1RHKB 1N5SA 5G0RA 2X74A 1I3AA 1WOPA 3HFZB 5KT3A 1JMTA 4LQ9A 3IR6B 3O8MA 3QPIA 1J53A 5BYRA 3R3TA 1T02A 4RG8A 1VK8A 3T6JA 2HQGA 1KTVA 1YF5L 4BRQA 4BC4A 2LQBA 3L4IA 3DGPB 4F3MA 1FK9A 1FW6A 4FJMA 1GNKA 2OMOA 3PHEA 3Q8QB 2X7IA 4NLDA 2DNRA 2BEFA 2HBRB 3VMFB 5D15A 4CJFA 3AHPA 3MMCA 2GIRA 1KDNA 3D7SB 1FVSA 4HTJA 3TRGA 1RTJB 2MQPA 4O8KA 3JSBA 2Q1NA 3DNCA 1WTFA 1HBOA 2Q6BA 3VVTA 2DITA 1K8AO 5E0OA 1XK8A 2BUPA 2C1EB 4ZA1A 3IMXA 1K47A 4K7QA 2H5IB 3HFVA 5BPMA 1RBRA 2DB1A 3TZYA 1CG2A 4HYKA 1CJTB 5EU7A 1ELOA 1E6VA 3AJ2A 3PYDA 4ECXA 2QLJB 3FKBA 2OIHA 1BO5O 4DR7J 2DHXA 1RBOB 1ZZNA 2YX6A 3R9PA 4ZVGA 1HPMA 3G0ZA 3DU5A 1HQUB 4O3SA 1D09B 4ILLA 4LR8A 3AQPA 3FQKA 3ET6A 2IM2A 4P9SA 4B8CA 4Z0UA 2P9PA 4B1ZA 5AXLA 3CM6A 1S22A 1HYSB 3M2UB 4FKYA 4AM6A 1NK6A 1X4DA 2KG0A 1RCOB 5BPLA 1NDLA 4I1TA 1LW2A 3A2FA 4CTAA 3IG1A 4K5SA 3ZO7A 1B3TA 3IUCA 4KB7A 1FHTA 3PY8A 5AQFA 4OJGA 4OKKA 1NSPA 4B9SA 4AH9A 3UD4P 2V69A 3AVNA 3MCNA 4LF2A 4BLGA 4FJHA 2MDAA 3BGUA 1KAXA 4YOEA 4DMZA 4ILHA 4EZ6A 1ICEB 3UDEA 2VJUA 3VA0A 5T7LA 2IGIA 1X4BA 4M63A 2UXDK 1N33J 2M2BA 3CDEA 2HMPA 3CE8A 2HGMA 4O5BA 4BHQA 1QZ5A 3CERA 3FSIA 2VU5A 1MA9B 1FTCA 1C0UA 2VFRA 5KFXA 1RWMB 2CA9A 4ZIVA 3RMAA 4B3SJ 1KVJA 2ZZTA 1NJXA 2P9CA 2BANA 2C2ZB 4ED4A 4J2BA 4C97A 4L8RB 4A4JA 2W8KA 4X66K 2LQ5A 3QEXA 2YKMA 3L2QA 2V4JB 2C3OA 3OT9A 1BQMA 2BA9A 2UUBF 2I7PA 1VQPN 1C1BB 3HF5A 5HQLA 1FRLA 1WEYA 2QJ3A 1ATRA 1WF2A 1UWAA 4AHTA 3V9ZA 4BQZA 4RZRA 1M90O 2MLXA 3TJ8A 3CCES 1NK8A 4YOTA 1D3WA 4CZJA 2FIUA 1CJVA 2C2NA 3THWB 2VC1A 3BSAA 2HG4A 3CD7A 1RT6A 2FGCA 4CO2A 3NXZA 4WZMA 3C6TA 4OV6A 3MAQA 2VDIA 5ETLA 4JI5J 2XLKA 2KXFA 4RUBA 2EXUA 2XG8A 1MNEA 5CYMA 3DXMB 1GOCA 2QKKA 1FFGB 1HBNB 2MQLA 2L48A 1H3DA 3M32B 4KGVB 3N9UC 3NVKA 3TUJC 3AARA 3HVAA 5CZ2A 5HOOA 4J9UE 4FJXA 2ATQA 3LDSA 1NK4A 2ZBRA 1RDAA 4ATNA 3KLGA 1RHQB 3H6EA 1TK8A 1BQXA 5IV3A 3BKFA 3NVMA 3JSRA 2ZC3A 1ZBFA 3OYDA 3T5KA 2CUYA 3KKFA 2RE1A 5MAOA 3PRBA 4OI3A 4UT4A 4H0YB 1IJJA 2YKOA 4Y28C 4B17A 4RWTA 4MYUA 2ZHAA 3EXCX 1UVIA 2O8EB 1RAAB 2XY5A 3J81U 4YB6A 4DV2F 3ATVA 4RL1A 1BI4A 2J8AA 3WQPA 3FBBA 5JJBA 4FP9A 1WC1A 1V5IB 3E9OA 1T11A 4G1PA 1TYQB 1HL6A 1BHNA 4JI6K 2MHEA 5F8HA 2W9CB 1ZM9A 2WSFC 1VSFA 1TL5A 1Y4ZB 3NF6A 4CBXA 1EWQA 3WXJA 3OR1B 1RDDA 4FJIA 4KRFA 4O3PA 1TL1B 1UPMB 2BJ7A 1UA0A 3GDQA 4CFCA 5DLGA 1HNWF 1LWEA 4X65J 1RWOB 5D3GA 3US5A 5IT0A 1LOUA 2ZE2A 4USUA 1QVGR 3NF8A 4J9PA 2DKOB 1Y5LB 2EHGA 4XO0A 2OUGA 2N3LA 1OY9A 3A8KA 2AF6A 5BR8F 3J7A1 2BTFA 3B8HA 3ETMA 3NGKA 4C0BA 3PO5A 2CJAA 2UVWA 4Z4CA 1HMVB 4GC6A 4MYTA 3D1HA 2EFOA 4B9QA 3KLIA 1GLEG 3PJWA 5AZIA 1UVKA 3SI6A 2NUHA 1S0OA 4O3RA 2KVQE 2FHKA 3M30A 2DHAA 1S72S 2BDPA 5GAGP 4DI6A 3D5MA 1GLLO 5C12A 1WEZA 3FUYA 3IMQJ 4MQ3A 4H0PA 3O5TB 3M2VB 1SUQA 2QRRA 1BOTO 1HYZA 2AGPA 2B6AB 2E2NA 3L0QA 2V50A 4IDKB 3G8SA 3R1LA 3T9NA 3BH7B 2XMAA 4EI2A 2WW8A 3UPFA 4DQQA 2HQDA 4USKA 3TA2A 4RUAA 3FMWA 3M6WA 3ICLA 2ZH9A 2BE9B 1RBLA 3CJKA 4KQZA 3S1TA 3WIUA 4F2SA 1M5PC 4M3YA 1FFSB 3RR8A 1UJ5A 2EPIA 3T5JA 3CJ8A 4CH0S 4KTZA 3OVSA 2WTFA 3CPWR 4A8YA 3MMBB 4EP4A 2DNGA 2VA2A 2Z0GA 4FJGA 1KLNA 4RKUC 4QR1A 2D9PA 1K8AT 4KFBB 1IKWA 4NO7A 1X8DA 3WQTA 4OHWA 1KQSR 5GMEA 3NCQA 4CLSA 2IYIA 4GV9A 1VRUA 1H7XA 3PDNA 2RDDA 3SCLE 2B51A 3TSUA 2GO8A 4ZVRB 3DLHA 2NS1B 5AQLA 2H5EA 1AYEA 2QXFA 4C1NI 3UKRA 3HHNB 3EE8A 1YJTA 3SQ0A 4HKQA 3O9TA 1N34F 1QTMA 2J9EA 4N7TA 3BGRA 3BSOA 3FRZA 4HUEA 3ASMA 3SCXA 4CGDA 3J7YU 4ED8A 4WF9L 3AO3A 3DLLL 5EWEA 3QT6A 1S6PB 4CLZA 1LWCB 1VK3A 4DR6K 2C2EA 1RDWX 3VERA 1NOYA 1IR2A 2HRTA 2GQ2A 2DTUA 4KI4A 4ZLJA 1DTTB 1OYEA 1V4SA 4Z4EA 3RWUA 3F5TA 1F6TA 2ZH7A 2H9ZA 4BC5A 4CD1A 4C8NA 2NZTA 2QI2A 1B0PA 4JI1F 3ID8A 3CDWA 1RGVA 3QEWA 3DXBA 5JS2A 1U6BA 1RBSA 4JI0K 2DEJA 2HHSA 4MKYA 1RNHA 2P6TA 2YKNB 2ZD1A 5A6PA 3ZNJ1 4CF8A 3PW2A 4PG4A 3I8BA 2PGCA 1TVRA 2UUWA 3KLEA 2M3DA 3QGIA 2LXIA 1F5CA 1QZ6A 3EXYA 4C3MA 2J6TA 3MTJA 4IOAQ 1G99A 1Z4UA 1RT5B 2X3GA 3TQ1A 3QJLA 1RT7B 3A1YG 4NYFA 4OI0A 3L09A 4NLQA 2WFBA 1ASWA 1JJ2M 4FDFA 3VAKA 4X62F 1IKYA 1D1UA 4Q2LA 4TYBA 2DK2A 3BEGB 1ZA1B 1HD0A 2CQHA 2OSQA 1OMSA 5H1SQ 2K3KA 5B0CA 1R7IA 3BN4A 3QBWA 4GKKK 4RUCA 1HJOA 4C7QA 2EC0A 1CEZA 4OX7A 1SB6A 3GG4A 1U1RA 3W2WB 1S6OA 2W4CA 3PG9A 4JI2F 1JNZB 3NH2A 4M5JA 2E1CA 2G2OA 1RXOB 2ALZA 3JAMY 3IAS9 1UKUA 1RSCA 1UZDA 3SLCA 5AXMA 2HHXA 3JSMA 4P7TA 4DTXA 1C1AA 4B3TK 5E7OB 2V4QA 1K8KB 3JYTB 1J27A 4ANDA 1U7LA 2ZOMA 4DZ6A 3OBWA 2Y0BB 1NB7A 2P9EA 1HUXA 4RUHA 3MCMA 5D4PA 4CGGA 4DR5F 1OO0B 4DU7A 3DLKB 2Z57B 2Y1RI 1SJQA 2R2TA 3RBDA 5BYSA 2C2KB 1XMQF 5IQ6A 4ED0A 1X9MA 1REGX 1GFWB 1X5TA 3O9SA 3RYLA 2KQ2A 1TU0B 4OX9K 3LDNA 1CS4A 3AY9A 2BM1A 4LRBA 1WDDA 4OLPA 5A0YA 2KO1A 1PCAA 3Q8SB 4Y00A 2JH3A 4K0KK 1RGIA 4RNFA 2XLJA 4QYZJ 3RBZA 4WE1B 1T44A 1SL1A 3DDIA 3H40A 5SWMA 2QTDA 2FBYA 4OZ1A 4Z2XA 1VSDA 5L46A 1BQNA 4CJ7A 1HBUB 1Z2ZA 1YJUA 2Q0RA 1MSWD 2G8UA 2FHJA 1BLUA 1VSIA 4JI3F 3F9MA 4YMEA 3HMJG 3FLCO 1VLYA 2BJ9A 3CCLS 4CVNE 1F3VA 3EDRB 2YNFB 4RTFD 4BRKA 2LDYA 2D0AA 4ETXA 1VDHA 2NZCA 4CJTA 3P1GA 3W62A 2IRXA 3CJ0A 4QOZB 4M5KA 1RU1A 1P8GA 1QQOA 1HW9A 3RBEA 4CEZA 2OI2A 3ULEA 2D3OR 2OPSB 3C16A 5D0HA 4U7UK 5F0WA 4ZHRA 1SQGA 4FBUA 3WEEB 2YKQA 2P9KB 3RU0A 4NXMJ 3DU6A 1TL7A 4DV3F 1RQ0A 3MK6A 4HHJA 2H4YB 1RHMB 4JD2A 4HCBA 1QAYA 1P27B 4DG1B 1I3OB 1JLCB 4RNOA 3R2DJ 4JYAK 2J9CA 5KT2A 1XMOJ 4UW2A 4LSLA 3JTOA 2ZJQL 5IWAJ 4NMXA 3NF7A 3NCPA 5AE3A 1ZH5A 3EY1A 4H4MA 1RTHA 2YVSA 4LFBJ 3PV8A 1DTQB 5DM6Q 1HHTP 3CC4N 3CCRS 1NDPA 2MY8A 4WBFA 4F3OA 3U9ZA 4CEDA 1L3VA 4TU8A 3MEGA 2IJRA 4DLEA 1FD2A 5L9XA 5J2QA 3VEOA 2AP1A 4M7XA 4EMDA 1HI8A 1SVDA 1WELA 3CCVS 2I5JA 2IRUA 2LQ9A 1FI4A 3VGSA 2VG6B 5E3RA 3PXGa 4QWEA 2N3OA 4AHUA 4I6AA 2WB1D 3FCHA 1JCFA 4ZJOA 4YOXA 4DPYA 2QA4G 3Q8UA 3NHGA 1TGOA 2H65B 3V81B 3CC7S 1S1XB 1SQKA 3JAMO 1TELA 3OXFA 1D9FA 5B0BA 2QWQA 5C42A 4AHSA 1UOCA 1CJUA 1ZPWX 2P9SA 4KB1A 3IRXA 4KRWA 3V4IA 3MHYA 5AQJA 1UP1A 1FRJA 5AJ3F 2Q31A 4CJ4A 1SV5B 1VQ7S 2FXUA 7FDRA 1O5JA 4LSNA 1VFJA 4FJ8A 4BREA 4FJJA 1FRKA 1J2VA 2GX9A 3CO9A 4L3NA 2K7JA 2HS4A 1LWXA 2HFOA 2RRBA 4ILJA 3TJAA 3B82A 4PG5A 3TVKA 3NS6A 1RHUB 5EHHA 3DJCA 4NMLA 5GADP 3KK1B 1VRTA 5CAAA 2A18A 3I5AA 4W5OA 1H0HB 3OSPA 5C0YA 2EWHA 1RADB 4UTGA 2JLFA 3FNNA 3SI8A 2VPYB 2PAVA 4CEFA 2F96A 1OQ3A 4DTRA 1YJVA 4LFCJ 4FYDA 3NDKA 4M5MA 1PSDA 3BZKA 3MDQA 2YV0X 1T3OA 3WXMB 2L41A 2W7OA 3VQSA 4PYDA 3R1XA 4R8UA 3VQBA 1YJRA 1H98A 1RBVA 2M88A 3MCSA 1NHVA 4ELVA 4DTSA 3OYJA 1GK8A 3EGZA 4B9MA 4BG9A 2O5DA 5H1SV 3RW7A 2XY7A 3H5YA 1Y97A 1NPPA 4OYAA 2J0QD 3M1FA 3OVNA 1X60A 2B4VA 2DPNA 3O6QA 2NRWA 1K1SA 1NO8A 1NDCA 2LQ8A 1N5YB 8AT1B 4IG3A 2XMJA 4FJ7A 2QTWA 1H6KX 2KHOA 5AE1A 5FDLA 2V8PA 4C9DA 2IMOA 3ZT2A 3QEPA 1KFDA 4FWKA 4CESA 1BIZA 1VSMA 1S10A 1SPBP 2NRTA 4FZXC 3K9KA 3EYZA 3DOMB 4U7CA 3G2XA 3BO2A 4CLTA 2W2QP 3QNWB 2NRVA 5DDQC 2F9TA 4X2BA 3CT9A 2VKRA 3Q8RB 2DXEA 2IM1A 4LVNP 2IBKA 5HLFB 3MM7B 4E19A 3LDPA 4I9LA 4OKEA 3SNNA 2RUGA 3KOAA 3NGRA 4CJWA 1ZTWA 3LWMA 1KQGB 1WSVA 4QIGA 1P6TA 1RT1A 4DL5A 5DZ6A 1VC5A 4ZP8A 2V9KA 3ZZUA 3LPTA 4ER8A 1U2VB 3AFGA 4CF1A 4WFNQ 2AHOB 1YGYA 2HFZA 2P9GA 3D66A 1U0SA 3HHLB 2NLXA 4H4KA 1M1HA 4N41A 3L3UA 2XYPB 5J2PB 1QSLA 4RW6A 3CMAN 3I4HX 2UXDJ 2F9WA 5ETKA 2IAJA 5HROB 1RAHB 1HI1A 4RW9A 3POTB 1WNEA 4Y2CA 1HYSA 3LP1B 4R79A 4AYBD 1RWKB 5J2NA 3T1YK 1RDBA 4GVEA 2PMWA 4P73A 1TP7A 4YHHF 1FJEB 1HR0K 1IR1A 4CHYA 2FHOB 1WORA 4X66J 3IM8A 1NU4A 2J5AA 1K73O 3QB0A 3PUFA 1PYTA 2CZVC 4IOCQ 1FD8A 1VIOA 4DX6A 5IC6B 1IG9A 1ASUA 3GV7B 3VCDA 4FM0A 4DV0K 3K5MA 3RGIA 1W97L 2FYXA 1U24A 3K0JA 4FLXA 5F9LA 4J5OA 3UQSA 5HL7L 2Q79A 2C3PA 3LGNA 4DJBA 1VQNN 1YTYA 4ZP9A 1UA1A 3DRPB 2GQCA 3P45B 2UVRA 2R42A 3QEIA 4JS5A 3UDVA 1FWKA 1Q18A 2ILZA 3IKMA 3NMUA 3S3NA 3I55N 1VQ9S 2C2RA 2OPQB 2QK9A 4CLFA 3GJRB 1NLKL 2MYFA 4DL4A 5KT4A 4BC3A 4PKHA 1F9EB 4JI7K 1CPZA 3G8QA 1FNXH 3HJFA 1WOQA 3FFKB 4AL7A 4LF7F 4WFAQ 1K44A 1X9JA 4URQU 1RWNB 2W40A 2B7CB 4HI2A 3T19A 3AO1A 3L8BA 2HF4A 3NH1A 3KLHA 1VIXA 1VQYA 3CF5Q 1JLAB 1HNIA 4CT8A 3UI3A 3THWA 3HHDA 1Y10A 2NR0A 3WBZA 4M5GA 5FJ4A 1TQLA 3J7YI 3VESA 3OJSA 2R7RA 1PJ6A 3U1MA 3TTFA 3MEDA 2C28A 4GO7X 3NKYA 3AVAA 4EZ9A 4CO1A 3CQYA 1DEJA 2GELA 3H4BA 3MMVA 5CQGA 4B9UA 3J7AN 3M8YA 3SQ1A 2NYHA 3M9OB 2X1FA 2NRRA 2OLWA 4JNEA 3QEVA 1BA0A 2E5LK 1EIYB 2DHGA 4PEOA 3HULA 2WVFA 1MWZA 5F0XA 1C0MA 3C3LA 4B1VA 2BOAA 3ZETA 2G0JA 1ZOTA 2POKA 4F25A 2J8SA 2GA7A 1BHLA 4KY3A 5B0DA 4ELTA 1WAJA 4HDGA 4KC5A 4PPZA 5F8JA 1NUEA 3C7NB 4HACA 2KL8A 3K89A 1FRXA 4OI1A 4CGHA 4ZPDA 3VEZA 2CQ4A 4UY85 5KPTA 4LF9F 4ECRA 4QOTA 4USJC 3UNGC 1EQMA 3K7RA 1Q79A 1PJ5A 3TVYA 1KWMA 1FFWB 3MM8B 2HBJA 4IBNA 2YNHA 3PW7A 5ETPA 1TYQA 2FBVA 2QA1A 2NSBA 1JB0C 3OY9A 3D0HE 3DXKA 3M8RA 3FGUA 1S6UA 1A6LA 4J8FA 1VQMS 2GQQA 1M0SA 1IM4A 3SZ2A 4ES3A 4BWJA 4DV5K 3KJNB 3HSTB 4H5NA 1HKBA 4CHQA 4Y6IA 3EX7B 2FQQB 3IA0A 3GG0A 3T1HK 2LECA 1TKZB 1C1CA 2XC9A 2YWEA 2ZC4A 1U04A 4J91A 3CJBA 3SJHA 3T1AA 1TR0A 5ADZA 3TYTA 2Z2YB 4AHVA 3GIRA 2W7PA 3QIPB 4X4PA 2FC9A 4ZVQB 3FK4A 2OFGX 3I82A 3VGUA 3SV3A 4CLLA 2MQOA 2OPRA 3GIMA 2B4UA 4CRJA 3K5LA 3EGVA 1OWXA 2KJVA 3ILJA 4QS8A 1KFSA 4CJEA 2JEJA 1TUYA 3GP9A 5AQSA 2AYGA 4I2QB 4ISGA 4QIVA 3K5OA 4C8ZA 1S9FA 4YDUA 4E89A 2PZSA 3RR7A 1Q82T 1AFJA 2AA4A 2CPIA 3VAIA 1SIZA 3H2UB 2HVDA 3K5PA 3C46A 1ZS6A 2B6AA 4IDKA 4KKOA 1WNSA 4NYZA 4FWMA 3TSPA 4KGZB 3RMDA 1BMQB 5JS1A 1HWIA 3M8WA 4OQJA 2YHXA 1B0VA 4EBEA 3BZQA 1IBKK 4FK4A 1UWBB 3HD1A 2PEHA 4Z94A 1RT3B 1CJKA 2XYGB 1SKUB 4KO0A 4HCCA 3CCEN 3S01A 2AQ4A 3LAMA 4NLGA 4DR6J 4ZMMA 4M1KA 3W5XA 3N5BA 1TL3B 5A8RB 1HX1A 1JLBB 2CDQA 2DO4A 3SCIE 4FOEA 4ILGB 2ERRA 3X1LB 2XZTB 3ISND 3UO0A 2EG2A 2E9TA 3MUMP 3M8QB 3AA2A 1QAJA 4WKYA 4LF5F 4PWDB 2BR0A 4CHOA 4C0HA 2EKNA 4UZCA 1QTNB 3W63A 1F21A 1QQCA 1YLXA 4FNIA 4JI0J 2B8QA 5IT4A 1FVQA 4B3MK 3NBPB 4PWUA 3MXIA 3AOCA 4AM7A 1PIEA 2YH0A 2BBEA 3F56A 3HOSA 1WSRA 3RW6A 1LWCA 4KAZA 1SCJB 2OZSA 1LEOA 3OJUA 2YPYA 3KLVA 4KPYA 4ZPVR 5C24B 2R7OA 1N6QA 3C15A 2FJEB 4M5DA 1CZ9A 4ICLB 2ZH4A 2RF2A 2G9OA 2WRMA 4OYIA 3ZT3A 5CYJA 4E98A 2MGZB 4FJ9A 4KGMA 2E1ZA 4GKKJ 4QWBA 1FF2A 2RMLA 5BXIA 4NLVA 1EP4B 1R8BA 1VQ4S 3RRGA 1YKWA 2W01A 3RTVA 1I39A 4OV1A 3U1NA 4U7UD 2AEJA 3QDKA 2P8IA 3U8XA 5K14B 2QLWA 3RG6A 3LQVA 4DR2F 4KH5A 1S0NA 4Y34A 1Y3JA 2DXDA 3J81j 4M63C 3HD2A 1GXTA 3FSYA 5KG2A 4B3TJ 2A1BA 5M1NA 3C6AA 1U8WA 3THXB 2HURA 3EO3A 5HJYA 1GMVA 1S0MA 4BDYA 2Q6CA 3PX6A 2FJBB 3LM2A 1QUVA 1FNOA 3CO0P 2HNYB 1NMNA 1T9TA 4DR1K 1S72N 2XNRA 1WC3A 4FWQA 5HRNA 1DZ5A 1LKZA 4LF6K 4B3RF 4A5BA 3GIIA 2D69A 5THWA 5C15A 4H5TA 3SUQA 3HI9A 1A5XA 3D67A 2DBBA 5HBMA 4OX9J 4O4GB 5KPZA 1RCHA 3KHYA 2UUAF 4IOAL 3EM1A 1XWLA 2XB2D 1WSHA 3M6UA 1HNXF 4OZ2A 4OL8A 2HFVA 4K0KJ 2RUSA 4IFVB 4M3XA 1R89A 3VGVA 4X64F 1U0HA 4G1IA 2CQPA 2QWNA 4ECQA 3MN7A 3CC2S 3FEYB 3K8VA 3TA0A 1LWFA 2MZSA 1NEEA 1HNVA 3MD1A 3PYFA 5EN1A 1OPZA 5KFDA 3EKSA 1X4HA 4IFEA 4ZLLA 2ATCB 3SK3A 2HFSA 5LY3A 5E3CA 2D0CA 2X1GA 2VDHA 3TVZA 2UZAA 2E20A 3ATUA 3QLHA 1FKPB 5BPNA 3A5OC 4ZVPB 3WNHA 3IP0A 2LVWA 4DU8A 1IKXA 4Z4IA 4LH4A 2XI2A 1F5AA 3FCWA 2PFFB 4F8RA 2CGJA 4ZN3A 3H3OB 3WC0A 3VQDA 2XHWA 3MPDA 2E2OA 5JVGQ 4LD0A 3SMSA 4YDXA 4CJVA 4BE0A 5ETNA 4O23A 3RB3A 4WE1A 4X4VA 1MMDA 1RDUA 5AXKA 3M6GA 5HRPA 4MLHA 1DLOA 3MN5A 3EJMA 3LP0B 1VHXA 3U3GA 1B9DA 1H2TZ 1ZM2A 1C6VA 2KRRA 1MROA 3J7ZO 5CABA 5J2MA 4UOFA 3O3LA 3HSCA 4C48A 2P9UB 4JYAJ 4RX6A 2DR6A 3C19A 5ETRA 4WFXA 4CZCA 2BE2A 2Q43A 4CO4A 3ZZRA 1NSKL 4TLQA 5I9EB 3NH0A 1KONA 2HHHJ 5F8IA 3FZMA 2N4DA 2J7UA 2ZNYA 4V19S 3P5TL 1J5EK 1NGHA 3TTCA 2WVCA 1TKXA 3UD3P 5HO4A 4U96A 3M1VB 2ZNZA 2GGPA 1S49A 1VI7A 1S97A 4E0DA 2ZJRL 2MB0B 4M3TA 3DLBA 2UXCK 2GO9A 4E1NA 3PJXA 4B1UB 2P9KA 5E33A 2L3MA 1V3SA 1AZSA 4CJRA 3FZHA 3GSIA 1IQTA 4CJLA 4WYBA 1GEHA 2VQEF 1U1LA 2FZCB 1UJ4A 4AHRA 3A13A 3UDCA 3NS5A 1LCUA 4L73A 2XO6A 5BN8A 4DR3F 4CM2A 1XHXA 1R6YA 2CQCA 4PUOA 1RYSA 4IR9A 2QMUB 3SPZA 2O8BB 4OYZA 4FJNA 4JKAA 1HNZK 4M5IA 1C0GA 1VQ5S 5ETTA 3VF2A 4OKJA 1TTHB 1KOOA 3ZTSA 4ZS6A 3SCJE 1N4LA 3DOKB 1YRTA 2JFKA 1YG0A 3S7RA 3H2LA 1VLOA 1O13A 5KTQA 2DGOA 3UFCX 4KI6A 3CXCM 1U45A 2A41A 2W2MP 2ZWOA 2DISA 5GAEP 3E01B 1QQNA 3DAWA 1DBDA 2L9NA 2MJNA 5DQGA 4CGJA 3KDNA 4OIXA 4IO1A 3KLFB 2GAHC 3VQ7A 3N01A 2OEJA 2V67A 4CO0A 5DRKA 4JKCA 2DR9A 5CYQB 3W5YA 4BR2A 1L3KA 3SIPB 2ALYB 2IC3B 4ECYA 1YJWS 2P9NA 2VGMA 3TU5A 2HBMA 5AQVA 4F0KA 5KQDA 5TKYA 4DQPA 3IS9B 2C3YA 3OYLA 1N52B 1SKWA 4K4WA 4JI4K 4ECWA 3DOLA 4GVBB 3OA9A 2W25A 2WOMA 5FIIA 2DCUB 2QZ8A 4NE9C 3CPEA 3U02A 3GWCA 4MMOA 5EX3A 4UQGA 1UTAA 2G8VA 2OTJN 3A8EA 3ZT1A 3KJFB 2XBPA 2MHNA 1CXUA 4CLKA 3HSDA 1CBKA 3LDLA 2JSXA 3PJ9A 3TZWA 4DSJA 3U9DA 4DR7F 1JJHA 5AZJA 3VQEA 3CCLN 1L3SA 4OYXA 5HMXA 2VICA 1S1WA 3KFWX 2B4OA 4QIWD 3BREA 1NH8A 1C0FA 3GSDA 3HKWA 2WTUA 1BIUA 1IJFB 5HAOA 2UVVA 2LYVA 2HB5A 4DV7K 3MZIA 2MMYA 3KMSA 1JXBA 1FCAA 3MGJA 4Q45A 1WG5A 4F4YA 3GQCA 3MM5A 3E51A 2EEYA 5HSPA 3SBMA 4JK9A 4BGBA 2WUSA 2F3JA 2M7SA 4F26A 1U2FA 3HDSA 3SAGA 3I0SB 3MMAB 2FHMA 4NEZA 1QUPA 1WG1A 1ATNA 3OL9A 1NKCA 2E29A 3BQ0A 4F4KA 3L2RA 2ZBQA 4AHCA 3RMBA 3T1YJ 3HYFA 4XPEA 4LC9B 1FRHA 2LFVA 1FJGK 3KKRA 1T94A 1HR0J 3ULHA 1VK0A 3BF4A 2QGFB 3VF0B 4IRDA 5LSRA 1KVAA 1N33F 2NZ4A 1VQKS 5DGAA 4ZCLA 2LA4A 2YX1A 4LREA 3SQGA 1BCMA 3H3NO 3SUPA 5L9NA 2C2MB 1KQKA 4LY7A 4YN3B 4FSVA 3W8PA 2FSJA 4B3SF 5SZTA 2JOQA 4KH4A 4DV0J 1C4CA 3G96A 1HPZA 3ITHB 3FJ2A 1IBLF 2CQDA 3OTBA 4F02A 4Y2MA 3MX2A 4ZPCA 2LQJA 4HDHA 4RCHA 4LF4F 3DKDA 3CC7N 1T03B 3P6YC 2KT3A 5LMNK 1MWYA 3KTQA 2GMJA 4K4VA 4G65A 2UUTA 4QW8A 3CJ5A 1KR4A 3KG1A 4Z4GA 4RW8A 4LBIA 4TU7A 4O3NA 3H45C 1HBMA 1Q53A 3CQXA 4JI7J 4JI5K 1MU2B 3VQPA 2XMKA 1IKVB 3OTCA 3CGIA 1B64A 4F04B 2QFJA 2ZM6K 4X84A 1NM1A 2VWJA 4I64A 4CIFA 3D45A 2ACMA 4LUBA 4WIQA 5LSLA 3VVUA 2F4VK 2FLOA 2E44A 2MPUA 4KV8B 2J0SD 3G86A 2E8AA 2ASLA 3VAJA 4NLRA 3THPA 3J7ZT 3MPUB 4BE2A 2OHDA 4Q8FA 4RWWA 3MR7A 4TKTA 4LSZB 3IXQA 3EGNA 1N54B 3OYMA 4F36A 4M8LA 4JV5K 2IMWP 4IO9L 5AQIA 2I38A 3KHRA 2CQIA 4ALZA 3R5JB 1BG3A 3LWLA 4USIA 3V1QA 2E5LJ 3B6PA 5B0AA 4YY3K 2HIQA 5EOYA 5AFUA 4QWDA 3OYNA 2PBDA 3O9RA 1RFQA 2IOCA 3P38A 5K8PA 1NOZA 1SXLA 1HHSA 5HJXA 1JLAA 4GC7A 2KM8B 3QZ7A 1HW8A 3HKZD 4EHTA 2JRSA 4LRCA 3ZYYX 3MN9A 4HLBA 4K5RA 4NYOA 3ZSRA 4C1NK 3PEJA 2UYTA 2DR5A 1NMEB 2YWGA 1KNZA 4X65F 4FM1A 4I6MB 3HCXA 3MCAB 2EBGA 3GYXB 2Y8WA 2B4JA 2VV5A 3GBTA 2K1RB 4KBOA 1U6FA 4WJBA 4WF9Q 1WB9A 4JLHA 3DLLQ 2DGQA 4DV5J 2R9LA 1S1UB 2ZHOA 1ZAXA 3O9UA 3PW4A 2DD8S 4XAKA 4WQ4C 4K4UA 2VBZA 3FBCA 3H0PA 3T1HJ 2HKEA 1FKOB 1FJ7A 1SJ4P 2RPIA 2HNDB 2HQ3A 2FSNA 2QA2A 3HOTA 2GC8A 2D3UA 4A8KA 3C6UA 3OV7A 1HFEL 4MLEA 3H8YA 1GX5A 3O4NA 1Y7PA 2R8IA 2D1KA 1KVCA 4FK2A 1R8CA 1NSAA 4HL9A 5E5NA 3NLCA 3MM8A 5IM0B 4DTNA 3EUNA 4NLWA 2DR8A 2G8KA 5IFMA 2AYEA 1M5OC 3UNYA 3L7UA 1J9AA 3QAUA 1NB2A 4LF8K 4YOVA 5KFIA 1FDBA 2G0CA 2VD3A 4MIAA 4NLUA 3PVXA 4DXLA 3E2EA 4DHVA 3LPEA 2FLLA 3AVJA 1GQEA 3NMRA 2G2YA 4HHUA 1RAEB 3ZSOA 3JQJA 4BR4A 3TEHB 1U25A 3V6DB 2GVZB 2IBOA 3U7JA 3KJQB 4AE5A 5IC4B 4QR2A 3TOQA 3LDOA 1EJ7L 4ID8A 1Z6RA 3A5LC 1IBKJ 5A8KA 1QVFM 3QWUA 1TV6B 2UUCK 4MDAA 2RHSB 4R0EA 5LL6d 4QS9A 4FBTA 5JMNA 4DUTA 3IGVA 2V68A 1TUWA 2HHUA 2ZGYA 4RW4B 1FXLA 2YXLA 5EX0A 4RPFA 2MQ8A 2PYJA 1RBUA 1BD6A 2BJ1A 3GOIA 5LM7E 2CWKA 4N8NA 4NCBA 4JV2A 4IRKA 4I2QA 2F5GA 2YI1A 1VQ9N 2DO0A 1W2BR 2A1RA 1J6ZA 4O3OA 3W0LA 4GNIA 1F60B 3AXMA 5CCLA 4DTJA 2GW8A 2PFUA 2GMHA 3QNNA 4OMFG 1NZ8A 4I56A 3LP2A 1B4SA 1LW0A 1RLDA 2IDLA 3BQ2A 3B6BA 4FJKA 3O1WA 3AVFA 4O44B 2XEXA 4OZJA 1UWBA 3SFGA 4B3MJ 2VG5A 1SJRA 3GCWP 3OLAA 2D4WA 3HHLD 2V2VA 3PX4A 1RACB 1S5JA 1NBEB 2N82B 3H7HB 1T6DA 2ASJA 4DX7A 1UEVA 1P8ZA 1SJ3P 1TK0A 3CC4S 5FPNA 4DS4A 1YVUA 3SAFA 4UQTA 1TUVA 1TL3A 4J9LA 5GAGU 4TVAB 4LMZA 3OL8A 5ETQA 1R27B 1AA1B 2V0NA 3VGKA 4EYHB 2VQFK 5AQWA 2EK1A 3M8QA 5KFGA 2YWHA 1KS2A 3HP9A 5ELZA 4FPAA 1EX8A 4PWDA 4JK7A 2PSZA 4RW7A 4PWWA 1GMWA 3ISZA 5EY4A 4I6YA 5SUHA 1H74A 4XEIA 5DMRA 3D0IE 4K4ZA 3R97A 1RT4A 1Y3KA 3ENVA 4KE5A 2MSTA 4H4KC 5E2QA 4FYVB 3ZZ0A 4H0OA 5ETOA 2XZWA 4AXIA 2A6MA 4ELUA 2AEFA 3VF4A 3K9JA 5AQOA 4ZLNA 3L2WA 3JXUA 4JKDA 1N34J 3ISNC 2H3EB 1T9VA 5CHCB 4ICLA 2ZJPL 1Y0HA 4F3TA 4C3LA 2W2OP 2YNGB 3QMLA 3DMJB 1IG8A 3OS1A 3H25A 3ENBA 4DR1J 3CJAA 3EZOA 4B1YB 3NRBA 2DNPA 3D2FA 3QERA 4EUVA 4BDZA 3WNGA 1VQMN 5F8MA 5F3TA 4K2XA 4LF6J 2X6NA 3QMQA 1I94K 4FS2A 2MQMA 3R7NB 3PCOB 4KT0C 2HWHA 3G82A 4AILC 3JSYA 2YHAA 1TUUA 3OYBA 4EU0A 1ZBHA 3B4MA 4DPOA 1U02A 5KI6A 3I6PA 2JWNA 3VENA 3G6VA 3M6VA 1MWMA 2UV8G 2EW9A 3KK3B 2MKSA 4CZKA 2R2RA 1A9NB 1IBCB 2GUPA 2E5JA 3OYHA 1DY3A 5I42A 1YDLA 5D0GA 3AB2B 2BMBA 3SV4A 2ZJQQ 3ENHA 3THXA 3D4JA 3G4SS 4LF1A 4ZPTR 4K4TA 3DLJA 1T05B 2IY5B 5HQMA 2M4MA 2OPPB 3AVMA 3KVGA 2HBKA 2HNYA 1B7FA 5M1FA 2Q66A 4DUZK 3ZZZA 1Q7LB 2JJ4D 2UU9K 4OPAA 5KFCA 2J7WA 1IO2A 2ZUAA 5DO2A 1XNRK 2B9EA 4FWLA 1F5BA 1C0TB 4X62J 3TJ9A 5KPRA 1TFYA 1JNRB 3D0PA 2O67A 2HAFA 1SH0A 1FWLA 1GTHA 4PG8A 2O8DB 2RD5C 1RAJA 2GWKA 2BKNA 1GMUA 3PIPL 2A40A 4CEQA 3ETOA 3Q2SC 4IQXA 4KHPK 4ZOSA 2GWJA 2DIUA 3WXIA 5FPDA 2E5IA 1SL2A 2JLGA 2IIHA 3T5LA 3RSEB 4O3QA 1YQHA 3QSIA 2ASDA 4PQUA 2R7YA 2CFXA 5JMVA 3PR4A 1GX6A 3ILIA 2HHQA 1ZPVA 1GAOA 2V8DA 2XQCA 4A48A 3HT3A 2HSTA 1X5OA 5KFUA 3JB9k 3P31A 5E3AA 4OZNA 5LL6Z 2O3DA 1H38A 3KXDA 4RNHA 5DGBA 3OBIA 1RUSA 5K8MA 3OYKA 4NRTA 2PA3A 2H51B 3CMAS 5KFTA 5DQHA 5DDRC 3UDLA 3MM6B 3L6QA 4QU6A 3MAAA 1Z25A 5D6GA 4H4OB 3BQ1A 1NKBA 2Z1IA 2QMXA 3UKUB 4NXMF 1HLUA 2Y3YA 4K59A 1RWPB 2KZMA 1ATSA 3THYB 5B08A 1KHWA 4CECA 3SAHA 1SJ1A 5D78A 1GLBG 1XMOF 1NK5A 3I0RB 2UXCJ 2XMVA 3W7BA 3KG4A 5IWAF 3AJ1A 1FT8A 1XR5A 1DFDA 3C94A 3QJPA 2K3IA 4Y0FA 3L3CA 4LFBF 3BBBA 5CZ1A 3OYIA 1JLGA 3A8JA 2WK4A 2HHTA 1R8PA 2QWOA 4CWBA 1JLEA 4QW9A 4W5NA 3TAPA 4KHNA 4K43A 1YZ7A 1GH8A 2WVEA 4FWNA 1LFWA 1BL3A 1G4CA 2XRIA 2E5GA 5HRRA 4XDDA 2ZQBA 1HNZJ 1LQ9A 1V3RA 4FW1A 2M5YA 4HVZA 3MEEA 2HF3A 3TI0A 3AA4A 2NNWA 3R6LB 3M1VA 3VAMA 4H03B 1EETB 4FYXB 3I55S 3TZZA 4MKVA 1Q1KA 4V19J 4CD3A 1KBRA 3WXLA 5CD4H 4P72A 2BQUA 4DWIA 1JLQB 4H5VA 3AAPA 5AQXA 3AQOA 4DCPB 2O8FB 2IVFB 4C8LA 1NK0A 4BR9A 3VR1A 1U26A 3QNOA 2EG1A 5LMUF 4YDUC 3VTIA 1XNQF 3CDUA 3P5BP 3SQ4A 1JLFA 4BS2A 3A0IX 4M3RA 2CPFA 2XSJB 1T9YA 3TR5A 2DFFA 1GMWD 4LFCK 4DV3J 1SJFA 2QWPA 4MK8A 2A6AA 5ITHA 1VQOS 3OL6A 4CM0A 4G6VB 1DURA 4BE1A 1KVKA 4DTUA 4JI4J 3NS7B 4WFBL 4J9NA 1X5SA 3UCGA 1T7PA 2XS5A 3EDQB 2MKKA 3NGIA 4P2MA 3CJ4A 5DK5A 2B5JB 3O4QA 2CG8A 3MM9B 2LCWA 5KFFA 4I2PB 2QA4N 4DV1K 2V7YA 3KLFA 3H2VE 2CJYB 1KLMB 3CC2N 1TL4A 5C2FA 2H3GX 2NYIA 2H1YA 4KHWA 3E9PA 3AO2A 3UWTA 2F65A 3CJ9A 2RQCA 2CH5A 4DHYA 4B9TA 3FVYA 4WXOA 2R7SA 4CE9A 1CQMA 2HNZB 3OUYB 3F2KA 2XWYA 1HYVA 4W5QA 3DRRA 4J9KA 1S6QA 1SI9A 1RTDB 1OSDA 2VFUA 4PCQA 2HZCA 4FVCA 1EQYA 2F9DA 2K8GA 2JX2A 1BC6A 5BRHA 2LXUA 1EKEA 4MJKA 2JWKA 1GLDG 4CBUA 5HL7Q 4DFMA 4YUDA 3O4WA 4P2FA 3PW0A 4W5TA 1RA7A 4WFYA 3Q8VA 5G0RB 3LM9A 2PI5A 1U47A 4DV7J 4B9LA 2H5JB 1WN7A 1RE1B 3J8AA 5C25A 2KHCA 5KOWA 4PPDA 4OYPA 3SMZA 4M7YA 1F0XA 3SSQA 1LK5A 1WHVA 2VH7A 2WZ1A 4F7VA 4A46A 1IV0A 3FDSA 2BH1A 4HUGA 3BGOP 1E3MA 3HSZA 3BN7A 1M5VC 3MMCB 3SXLA 3TAQA 3P96A 2LXFA 5CR4A 2HW3A 1HBOB 1XTZA 1QQMA 4ISEA 4Z4HA 4CK3A 1FJGJ 1HWLA 3W3SA 2YNIB 3QT5A 4WK1A 5GADU 2KYZA 4CFBA 2UXDF 3OTOK 2CJ9A 4RU2A 1M5SA 3IAM9 1U1NA 2XCPA 2E7VA 1F2HA 1YSJA 4I6WA 1ZAVA 1RJJA 2VC0A 1YTAA 2YKAA 3GG1A 2F1FA 1AUDA 2OTLN 5ETMA 1HQEA 1RABB 3D2EA 4DL7A 4LR9A 4WYLA 1S9GA 5KG3A 1JX4A 5CY4A 2RAQA 3AA9A 2PFDA 4X66F 4IKFA 1HKCA 3O9QA 5DQIA 3ET6B 4HEA9 1UAXA 2P9PB 4Y2KA 2PYLA 2VWKA 2A2DA 2QC3A 4BRMA 5LMNJ 2IVYA 3HZGA 1VQSA 4KTQA 1MG7A 2Z1HA 3GFHA 4IUFA 4TYAA 4KREA 4JHDA 3LDQA 2DNMA 4RLEA 3CCJN 1LW2B 1VQ5N 2XULA 4CTAB 2UXBJ 3IG1B 3VN5A 4I68A 1HKAA 1NWKA 1RK8A 3QFHA 5GMDA 2ZM6J 4OYWA 5EVZA 2P9IA 4S0MA 3KUEA 1FEHA 1XC3A 3CCUS 5LJVA 4KPCA 4C8MA 1OKJA 2E5HA 1L5UA 4I67A 2F4VJ 2V8VA 4LRFA 5T7LB 4B9VA 1UFLA 3R6GB 4J2AA 3BO3A 2FBTA 3QO9A 3A4TA 2WCXA 3D54A 2ZKUA 5CHIA 2YHWA 1C0UB 3GCXP 5HVHA 3SBTA 2V2QA 2AMCB 1N48A 3A8YA 4HT7A 4JV5J 4QIFA 3IDHA 1RBAA 4LFAK 3OTDA 1YJWN 1N56A 3QBXA 3L2VA 3MR3A 1VBZA 2DH8A 3FEXB 2BM0A 4YY3J 4KSEB 1Q8BA 5C5JA 1CZAN 3D6MB 4DV6K 4XK8C 1UCNA 2MKYA 4GKJK 2E88A 1UFKA 3M2RA 1UAWA 4YHHJ 3E66A 4BVOA 4U8VA 1XQIA 4OZLA 5D8HB 4EHUA 1CJVB 4KV8A 4JI6F 2R3VA 1RWVB 1RT6B 4B9NA 3HJVA 5KFZA 3BPSP 3C6TB 1FXRA 1Y64A 1XR7A 3ZZPA 3MECA 1S3XA 3M7VA 4PRFA 3PSFA 2ROGA 5CYMB 5GAGI 3R27A 4E7KA 2HHPA 3DM2B 2Q1LA 1WC0A 5M1QA 4X4RA 3FQLA 2KJWA 2MKJA 4CYUA 1VSLA 1T9XA 4WZQA 4C3KA 2J76E 2R7XA 2WBRA 1WACA 3Q83A 2EFGA 4AQYK 4PG6A 2FZGB 1N36K 4E1JA 2YJFA 4ZVUB 3KLGB 4NLXA 2F8EX 2V8HA 3EE9A 4ZDNA 3JAMU 1Z05A 3TUIC 1U4BA 2CQGA 1RT2A 4ID5A 3EZUA 1QM9A 4I0WA 2RILA 3HHKA 2KDOA 1GOAA 2QSFA 4LF7J 1PYOB 4MIWA 1CULA 3PKYA 3EL2A 1DRZA 1TFWA 4EP5A 1S57A 2DGWA 1EQ0A 1TZ0A 2FGOA 4D3GA 1BI4B 3UE5A 3ZTPA 3H90A 3HPHA 1T95A 4LF8J 1HARA 3L3VA 2B8PA 3DI6A 1QSSA 2F40A 2DGTA 4OGCA 4ZIWA 2AV5A 4NCGA 5DDOC 2VCPA 2XS7A 4GV6A 3T6BA 4A47A 2RNEA 3VGTA 4F2RA 1LWEB 4ED6A 5D3GB 1VQKN 4OLAA 4FZZA 1LAWA 4FLZA 4I7FB 1C4AA 2ZE2B 1G6BA 3W9JA 2HNDA 1O51A 2Q3PA 5I3PA 4LBHA 3BO4A 2OJ3A 3GR1A 4NA2A 4QWCA 3PKMA 3UE2A 4CIGA 1WD6A 3OD2A 2M0GB 3QJJA 3ZX3A 3VGLA 2UUCJ 5LXYA 5IM0A 3ALYA 2HGLA 3LGMA 3ZLJA 4CO3A 4ZCIA 1KXPA 3SBGA 1VSKA 1FX4A 2AJ1A 4WWSA 5AZIB 2KW4A 4ITSA 4DQ8A 2NRHA 1PAUB 5I4MA 5C10A 3GMGA 1KQFB 3R3LA 3AD8C 2GFFA 2CNOB 2QWLA 1NAQA 4N77A 2XTJP 4BC9A 2DNLA 4QR0A 5LJWA 1CVJA 5IS2A 1JL2A 3PSIA 4J90A 2O01C 4OI2A 3PFEA 2VASA 3VOVA 1A5WA 1QHTA 1PBUA 4RU9A 1S77D 5F8GA 3KD5E 4DR6F 3H46O 3Q0AA 2KT5A 4RR5A 1N32K 1EAYC 4BY9C 3FBFA 3A8IA 3ONQA 4OJ1A 4JBCA 3JTPA 3QYYA 2IJNA 2GV9A 3AD9C 3FEZA 3QGGA 5D4NA 5IQQA 4NLPA 4JKEA 4X4QA 3CJKB 3R5GA 1T8EA 4BRNA 4WFZA 1WTBA 3HVTA 3NGTA 4ECVA 4ZTJA 3ZZYA 4PR6A 5CH7B 3WNFA 4JI0F 4Y1DA 4OJRA 3VHQA 3AB4B 5I3UA 1J5OA 2RN2A 3I56S 2VQFJ 4JI8K 3BV8A 2DGVA 2EI5A 5J1EA 3OW2M 3LA0A 3D3CJ 2ZEJA 5L1LA 3TTDA 1U1PA 1VRUB 5F8LA 4ETZA 4O44A 2ADCA 3ILLA 3UKRB 3BUZB 4PZVA 4BRPA 1RWUA 1FE0A 5GAHP 3BGRB 3FZ2A 4ED5A 1UPPA 1ACMB 4RBTA 4NXNK 2H54B 2F8SA 4KHSA 3WX8A 4GKKF 1WI8A 2CAJA 4CI0B 4P2SA 1XC9A 1ZM4A 4FPRA 5KFSA 3ZFVA 2VWBA 3DLGB 3MDFA 2MKHA 2RS8A 2GHPA 3K17A 1YAGA 1DARA 4USWA 4CF0A 3N6NA 5M2UA 2AD9A 3U4LA 1WUUA 4ZTFA 2HWTA 1NCLA 1U2CA 3NNCA 3PRVA 2FY8A 5KFOA 2DPIA 3DCAA 2W6LA 5HI7A 1I94J 2O4GA 5ADXA 3EE3A 4QPXA 4B3TF 4BRHA 3BGFA 5KFNA 4PL8A 1MW7A 1HD1A 2ZD1B 3DRSA 4HTIA 3WXKA 3HHLC 4F4AA 3WUHA 1T3VA 3PFOA 1OH7A 2QWRA 1TVRB 2HWIA 4NI2B 2V63A 1SQFA 3KLEB 4A62A 5KFQA 4Q44A 3ELHA 1DQAA 2I2YA 2MSSA 4EYIB 2OEKA 3FFIB 2RQKA 5FD1A 2F9JA 2FPHX 5ETVA 1MDUB 2WONA 4CH1A 4JRPA 1YXQA 5KFYA 3CJ7A 4OI6A 2JNJA 4PL7A 3NGDA 1IKYB 2CPDA 4TY8A 2KZZA 5AQPA 3TAFA 1WAFA 3MCPA 2YNGA 3DLEA 3O3HA 1JXEA 2VPZB 1IWAA 4OX9F 2NPFA 3NY0A 1ZZFA 2AGOA 8ATCB 1UFWA 4CO5A 3ZTRA 4FK0A 4DUZJ 5A2QY 2DNYA 3X3UA 1KHVA 2UU9J 4K0KF 4NYNA 1M1GA 2ZJRQ 2O8CA 2X78A 1XNRJ 1S1VA 2OTJS 4IYQA 1V4TA 4QWAA 4G3IA 5AQZA 4BRIA 5H9EJ 4OHZA 4IG0B 2HLUA 4ZP7A 3VAFA 4J2DA 3GE9A 2DNHA 1NMDA 2PE8A 2ZH1A 3JSMB 3A5NC 4IXCA 4KHPJ 4DMNA 3LF0A 1FWPA 4JEPA 4BDPA 4J9OA 2CJQA 1IR0A 4Y0WA 4DTMA 1D9DA 1T05A 4L76A 4FF3A 3CQ8A 1W2IA 2CJKA 3TA1A 4ECSA 1AFIA 4LT6A 2CVEA 4CZMA 3I9V9 3G6YA 2F8TA 3WZ0A 1R0AA 4P74A 2CZ4A 3K8WA 3LOUA 4DU1A 4MDBA 1RU2A 3RB0A 1PO6A 1IWGA 2ROPA 3FBEA 4DUYK 1RA6A 3VV2B 3QAEA 1OSCA 4CGFA 1GXUA 3N0VA 2NREA 1B70B 3PR5B 5KOXA 1SC3B 1RBTA 2AEMA 3CDBA 3SUNA 5CCMA 4DV4K 5FPEA 5A0YB 3VTHA 3VZHA 2QN6B 3UR3C 2AYMA 1QJHA 2QMWA 4B3RJ 3R7SB 4DL2A 5AXNA 2HHHK 3CVKA 2BJEA 4JYAF 4IEIA 4DR4J 2R2UA 1LXNA 3N79A 4F67A 3CI5A 1ASVA 3F44A 4KHUA 3NCRA 3L4BC 1S9EA 4ZVHA 1BQNB 2LEAA 1X1PA 5FLXU 5KFHA 1RTIA 1BU6O 1YRXA 4NLBA 3OHRA 4WQ4A 3EZ5A 4JRQA 3UVJA 5LJ5Y 2CGLA 5KQ8A 1VC0A 2FLNA 2V7ZA 3QETA 4BR5A 4DCHA 4NX9A 4P6QA 3KDOA 4DQRA 4H4OA 2ADBA 4FYYB 4YR2A 1OIAA 4LIRA 2M8DB 2Z2MA 5KFKA 1S76D 3FGVA 3BGLA 5GADI 4F0HA 1E6YB 3I0RA 3ULEB 1MLAA 3C16B 4ZHRB 4W90B 1VRQC 3NNHA 1XQSC 4TY9A 1PBAA 1RLCL 4FLTA 2ZKTA 1NGFA 3HO1A 1TL7B 4C0OC 2DVIA 3HPGA 2YKPA 1N0VC 1YJ7A 3VAGA 4URGA 1TKDA 2WBNA 1N5VA 3CB4A 3H4DA 1BUPA 2HQCA 1SS6A 4B3OB 4Y2AA 1H2VZ 2MXYA 4LSLB 3GJSB 3TX8A 2MKCA 2P5GA 3H5UA 4HVJA 4ZPBA 3RAXA 4H4MB 2CZ9A 2VJVA 4DF4A 3KWGA 2MJUA 3NOGA 2N7CA 2CKWA 4EWTA 4J9RA 3H08A 5J2QB 1WBDA 2RQMA 3PHTA 4QBUA 2IFXA 3LUYA 2ASOA 3SQOP 3CCQS 3SPYA 5A2QO 3ZSZA 4E7LA 1Q82O 4M95A 2EFVA 4F0MA 1RZMA 2HMIA 3G4SN 2HK2A 4DV1J 5EWGA 1REVA 4FZVA 4ZJQA 1EXQA 5HMYA 2MEWA 3I33A 4L6V3 3KMQA 1HWJA 2XHCA 3QGPA 3D1OA 3M8ZA 2PEBA 3ZX0A 1CJUB 1TAQA 3JTNA 2E6MA 3AVGA 3H1QA 3IRXB 2G2ZA 4FLWA 2VBWA 4K8RA 3P5JA 3P83D 4GW6A 2HIYA 3DGPA 2R8HA 1HIYA 2DNOA 6AT1B 3BBFA 4BRFA 1YK9A 4CLYA 2V8GA 5KG4A 1RTJA 1ILYA 5K8OA 3AOAA 3PTWA 4Q2MA 3W64A 2LMIA 1B0TA 2EKYA 1VRTB 4I2PA 1D9AA 4P75A 1R3NA 2Z4PA 5KG1A 3I96A 2P51A 3CYMA 1HJRA 4CERA 3OS2A 1ZBLA 4CEAA 1CJTA 1P1TA 1VBYA 3KKSA 1WBBA 3N4QA 4ZITA 3WT0A 2D1CA 4IR1A 3RRHA 4R8UB 3GFXA 1HQUA 1JJ2R 3F9KA 1RTDA 1FE4A 5FLXY 3KJVB 1KQSM 1DKGD 5AFUH 5HP1B 4E2FB 5GAEU 3M2UA 3OTOJ 1DQ8A 4NZ7A 2QLFB 4IG3B 2OFHX 5KGWA 3ZSVA 5FDLB 5KRTA 4IO9Q 3H59A 2BQ3A 4ECZA 3T1YF 4GMKA 1HR0F 3TAEA 3KK2B 4ANEA 2D3O1 3CJ1A 3Q86A 2V2KA 1S79A 3W5ZA 3G6EN 1KP6A 1LNQA