4PUOA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
total genus 145
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4puoA05
4DSIA 1N4LA 1RBVA 2R8HA 3EY1A 1ZTWA 3OLAA 4KI4A 4M3YA 4W5QA 2BRLA 1QSYA 3QLHB 3D45A 5HROA 3GIIA 4CEEA 4CEZA 2RDJA 1KVCA 1XHZA 3NF9A 2JGUA 1LW0A 4KKOB 3I5AA 2YHAA 2WONB 4ED1A 3S9HA 4R8UA 4KHWA 4ECXA 1HYVA 3IS9B 4NLVA 1VRTA 4HKQA 4CJWA 3QGHA 4HUGA 4JV2A 2XY5A 4OJRA 1RTDA 4MKBA 4RNNA 1YTUA 2A1SA 2FBTA 2JC0A 3M9MB 4AHCA 4BE2A 1IM4A 4NLOA 2B6AB 4RW4B 4ZVGA 1JLGB 3UQSA 5CYMA 1HARA 4CHYA 3FQKA 3V9WA 4DTUA 3RR7A 2O5DA 3NGYA 4C8KA 2PY5A 3U3YA 5EU7A 5KFUA 1HMVB 4FJ9A 3G0ZA 4MIBA 3EZUA 3PO4A 4ECQA 3MEEA 3PVXA 1A5VA 4NCGB 4FJXA 2EX3A 4U7CA 3V81B 1LWEB 1RTHB 3QESA 1D1UA 4KFBB 3P5JA 1KFSA 5I42A 3KK3A 5F8IA 5CZ1A 1LW2A 1ZBIA 1EETB 2E6LA 5JXSA 4QW8A 1SL0A 4IR9A 4I2QA 4NLWA 4CHPA 5KFDA 2FC0A 1JLQB 3T3FA 3CM6A 3L2WA 3DI6B 1EP4B 4RG8A 1RA6A 4DTNA 1RTJA 4H4MB 2ILYA 3AO4A 4CJSA 3NMAA 2KQ2A 3V9UA 1RT4A 2ASJA 1U4BA 3Q8SB 3CG7A 2YKMA 4WFZA 3M8QB 3QIDA 5KRTA 4OKKA 3BSOA 3DLKA 4FJIA 4LSNA 1RDCA 3KLGA 1XR6A 3QEVA 4O3OA 3GILA 4RW7B 2W8KA 3OS0A 4Y2CA 4ID1A 4RUAA 4DL7A 4IFVB 5DMRA 4I7FA 5HLFB 3K2PA 3MTKA 2C22A 4TY9A 1LAVA 2BE2A 4IH6A 4F4ZA 4JV0A 4F4WA 3DM2A 5KFPA 5C24A 4CJFA 3IGNA 3DRRA 2ZE2B 4IR1A 1WN7A 2BDPA 4CJLA 1KHWA 3GIMA 5KRSA 4MKAA 3IG1A 5FDLB 4PA1A 2Z1IA 4ED3A 4FM1A 4K4YA 3KK2A 3TAEA 2Y1IA 4ID5B 4Q0BB 4W5NA 4CHOA 2G8WA 3H5YA 1HQUA 4ECTA 2AU0A 1C0TB 1FK9B 3V6KA 3UPFA 1SV5A 1HJRA 1HNIB 2OH2A 4XIUA 1JLEB 3PV8A 5DLGA 4FJLA 4GC7A 2IAJB 2CKWA 5J2NB 2FVRA 2IS3A 1DLOB 4JRPA 3OYIA 5KFSA 3D0PA 1IKWA 3NAEA 3HVRA 4B9TA 1SKWA 1WNSA 2YNGB 1UOCA 3CWJA 2JEJA 4JS4A 4WXOA 5K14B 4YQWA 1IKXA 1VSKA 4N41A 3JSMB 5D3GB 3S3MA 1S0OA 4FLWA 4YFUA 1UA1A 4RNOA 2WK4A 1RT2B 2JLEA 3RWUA 1DTQB 3V6DB 3LP2A 5F8GA 4O0JA 3H98A 3TI0A 4TQRA 1KTQA 3ZT3A 3MXMA 4RW6B 3AV9A 2HHXA 4OPJA 4KB7A 4BE1A 2PZSA 2O4IA 5KFQA 3RMAA 4EBDA 5F9LA 5DG7A 3NFAA 4HHTA 3HVAA 5HBMB 4DL3A 1S6QB 3S3NA 3SFUA 4ICLB 4CEOA 2DFEA 2BANB 4ED0A 4FK0A 5DQHA 4FLVA 2KFNA 4BDPA 4ED7A 3V9XA 1XWLA 5F9NA 2X74A 3OYMA 2JEIA 3NL0A 1K1SA 3PW2A 4F3TA 4TY8B 1BQNA 2HNYA 4EZ9A 3MEDB 3HJFA 4LSLA 1F21A 4RW9B 3DOLA 3SYZA 1HRHA 4IH5A 2RF2A 2BR0A 1VSHA 4K4UA 3AVJA 1S1VB 2DPJA 3PZPA 1RILA 3QIPA 1S9GA 4QOZB 1SL1A 4FBUA 3K59A 4RNFA 3AA2A 2F8SA 2XC9A 4IG3B 4CCHA 1KLMA 4CHQA 3ZSZA 2W9AA 1K1QA 3EYZA 4F8RA 4ZPDA 3QEXA 2V4QA 4LD0A 4CHZA 4CJUA 3MEGA 4LH4A 4ZHRA 4IRKA 3HP6A 1SKRA 4DQIA 3OS1A 2GIRA 1EX4A 3CDUA 4CJTA 2IC3B 1A5WA 5KG5A 4KI6A 2IBKA 4X2BA 3V4IB 1MU2B 2I5JB 3PUFA 2JEGA 3NAIA 1C1CB 3KK1B 4QAGA 2QKKA 1TL1B 1XHXA 4CF8A 4KO0A 5C5JA 4JV1A 3HT3A 1S1TA 3BQ1A 1X9MA 4CGIA 5I3UB 4ZTFA 4NCBA 1I39A 4DF4A 4IBNA 5C42B 1LAWA 4WXWA 1BI4B 5KFKA 3NGZA 4FCYA 3GV7B 1LWCB 2IM2A 1RBUA 1CXUA 4M3UA 4FK4A 3TAPA 1QQCA 4NLUA 3TWHA 3C95A 1IH7A 5KFAA 4YR3A 4KHYA 2R8KA 4CFBA 4DTOA 4OKJA 1WSIA 1L3VA 4YMEA 3PHEA 3GIJA 3ULDA 4NLRA 3AVHA 4HYKA 3BSNA 1D0EA 3AVFA 1T05A 3ALYA 2W9CB 1QE1B 2C2RA 2HHTA 1TL3B 1GX6A 2KW4A 2VA3A 4FJ8A 3HL8A 1WSEA 3DYAA 3NGDA 3TVKA 2JC1A 4KPYA 2C2EA 3JYTA 1U49A 4DL5A 2R2TA 5FRMA 3I0SB 4WYWA 1T8EA 3V9SA 5J2MB 3I0RA 3LWMA 2VG5A 3I5BA 1Q8IA 3PW5A 4IG0B 4BE0A 1FKOB 4HUEA 1LWFB 5L1JA 4KB1A 3OYKA 1IKVB 4O3RA 1S1WB 4Y1DA 3RAQA 4CK3A 3AO3A 3KLHA 4F50A 1KCFA 4DU1A 3HYFA 3DDKA 1NOZA 2R8GA 1J9AA 4OGEA 2OPSB 3QO9B 2DPIA 3C6TA 4JS5A 3T19A 1NHVA 1JIHA 1UAXA 3IRXA 4G1QB 1S0MA 3SQ2A 1XC9A 3M8PB 3OJSA 1KHVA 2KZMA 2R2UA 3NH0A 5DLFA 1LW0B 3H40A 1XI1A 4B08A 4CEQA 3B6PA 3DRPA 5KFIA 2AJQA 4PY5A 3DMJA 4J9SA 4DSFA 2XO7A 3CFRA 3RB3A 1S1UA 3HVTB 3Q8PB 4EO6A 4U6PA 1RTDB 3QNOA 5J2PA 4J9LA 3LP0A 1RT7B 4DTXA 2B5JA 4LQ9A 5KG7A 4B3OA 4E7KA 4CK1A 4ZVEA 1NJZA 3AVIA 2FLNA 4Z4IA 1UWBA 4E1NA 1J5OA 2XI2A 5KTQA 4FJ5A 4KHMA 3G6XA 3E01B 3KNAA 1C0MA 3I8DA 1Y97A 4KHRA 4YR0A 3TANA 3O3GA 4DS5A 1VSDA 3GIKA 4E7LA 2XRIA 4ELUA 1C2PA 3MEEB 4O3SA 2OYQA 4IRCA 2AX0A 4E3SA 3KLFA 2YKNA 2VA2A 2W9BA 5I42B 5KFYA 3PX4A 4F3OA 2UUTA 3D5MA 2HHSA 4BWJA 2IOCA 3LAMA 5KFCA 4DU3A 4I2QB 1QUVA 2QKBA 4DQPA 4AHTA 1ASUA 4EBEA 1VRUB 2UVUA 3TABA 4KV8A 4RNMA 3VA0A 4F4YA 4XPCA 1SH3A 5CYQB 1HPZA 5KT5A 4C8OA 3OYBA 2P51A 4OL8A 3BREA 4Z4EA 1KVBA 3C6UB 1GOCA 3K57A 4ZPBA 5DGBA 4CGGA 3F73A 3AVLA 4DU4A 4PWDB 3AA3A 3WNGA 1JLFB 4CF9A 5DQGA 4GW6A 3KHHA 1YVUA 2F8EX 1S9FA 3HP9A 4QWBA 1NK0A 1C0UA 4KHUA 4HVJA 2XY8A 4I7FB 4DSKA 4M3RA 4PUOB 2BE2B 3RB6A 2ALZA 1HQEB 3FDSA 4NLXA 3NF8A 4FS2A 3H5UA 2PYLA 3DM2B 5C24B 4H4OA 3RBDA 4G3IA 3U3GA 2ZD1B 1IG9A 3IG1B 4FS1A 4KAZA 3OYLA 4NYZA 2P5GA 2OPPB 3KLIB 4K4WA 3LZIA 3DRSA 4NLTA 3BSAA 4DQSA 1UA0A 5KFEA 4CF0A 4URSA 5T14A 4M45A 3TAFA 3SQ4A 4O3NA 1HNVA 3G6VA 3LP1B 5J2QB 1GOBA 2HVIA 1JXBA 4RW8A 3O4QA 4O0IA 5F8MA 4ECYA 3ITHB 1W25A 1RT3A 2C28A 2GIQA 3KD5E 1SV5B 4WFYA 4NYFA 3ZT4A 3SQ0A 1L3TA 1RT5A 1NJYA 4FXDA 3FRZA 2Z1HA 1C6VA 1BIUA 4MFBA 3T1AA 1TK0A 3KJVA 5KFGA 1IKWB 5L1KA 4CIEA 5KT4A 2OPQA 3RMDA 3FSIA 4QWDA 2D0CA 1B9FA 4OGCA 4EZ6A 4J2DA 4I9LA 3MXJA 1S48A 1T3NA 4Q44A 3ZSYA 1BL3A 4IDKB 2VG6A 5KFMA 4DQQA 3QLHA 3OLBA 3HPHA 4GMJB 4I9QA 4K4VA 4KHNA 4K8XA 2YHBA 3H4BA 4KREA 4EBCA 3OYHA 4KKOA 3AVMA 2WONA 3DOKB 4ECSA 2VWJA 3KMQA 2W7PA 1VSIA 3GYNA 2IA6A 3AVKA 1BGXT 3EPGA 2FLPA 3ICLA 4M41A 3VA3A 1WSHA 4CGJA 1T94A 2EC0A 5KFOA 2X6SA 1U47A 1NOYA 1SUQB 2FJVA 1YVFA 3SNNA 2R7YA 4CEAA 4CEDA 2WOMB 2HNZA 4CFDA 2B6AA 4RW4A 1TKZB 4J2EA 1JLBB 4FZXC 4NYNA 2HNYB 2PYJA 2D0AA 2FJWA 3DOLB 1NKEA 3UR0A 1ZTTA 5KFVA 1B9DA 1HMVA 1G15A 4WE1A 4MK9A 2HHUA 4C8NA 4OLAA 1ITGA 2ATQA 3M9NB 1D9FA 1IKYB 4NCGA 1NK8A 1JXEA 4EYIB 3V81A 4DFJA 2QK9A 1LWEA 1RTHA 1QS4A 4KFBA 1S9GB 4W5RA 1TVRA 4PQUB 1RT6B 4R5PB 3VQBA 2ASDA 1EETA 4GVMA 2W42A 4CIFA 3RMCA 1Z26A 4WYLA 1JLQA 1CZBA 4FZYA 1N5YB 2WHOA 2E6MA 3DI6A 4ZHRB 1S49A 3RAXA 1S4FA 3O4NA 3KLEA 4H4MA 4W5OA 4BWMA 3THVA 1RDRA 3KHRA 3P83D 2WCXA 1EXQA 3HXMA 5SWMA 4EP4A 1NHUA 1JLAB 4ZMMA 4MK7A 2AGPA 3DLGB 2AWZA 4FK2A 1FKPB 5J1EB 5KFLA 3AVBA 3ASMA 4KO0B 4URGA 3M8QA 1S1TB 3H5XA 3ZT1A 1S10A 5L9XA 1D5AA 4TN2A 3ZSRA 3V9ZA 4O44A 1CXQA 3VQ8A 4E7HA 3N6MA 4J9OA 1REVB 3EPIA 5EWGA 3AO5A 2YNFB 3OY9A 3T5HA 3BGRB 3PO5A 5KFRA 3KLVA 4MK8A 1WSJA 3T5LA 4FJHA 1RT1B 3SUPA 4NLSA 4ZP6A 5KGWA 3OYEA 4DEZA 3SI6A 2WRMA 4B9LA 1EKEA 1J53A 4M3XA 4FJ7A 2QV6A 3L3VA 4NLDA 3MECB 1TAQA 3BR9A 1CLQA 2HMIB 2RN2A 4K4SA 4NRTA 4FW2A 2XWYA 1TK8A 2NUBA 4ZVFA 1O1WA 2QE5A 5EUHA 3TAMA 3SI8A 3DYAB 3VQ4A 1TKXB 3OYDA 3LALA 3KMSA 1Z4UA 2CJQA 1DTTA 1QAJA 4TXSA 2Z1JA 1C0TA 1T03B 1FK9A 3TAQA 3I0RB 2V9WA 1JL1A 2ZQBA 1WAFA 5KT6A 2VG5B 3NBPB 1Q9YA 2WB4A 2IAJA 5SZTA 4I2PB 3H5SA 5J2NA 2IMWP 4CGHA 4B9SA 1NKCA 2D3UA 4QPXA 3QINA 1S1XB 2YNGA 4KTZA 4IFYA 4E89A 3QGGA 1HYSB 3ZSVA 2YNIB 2A1RA 1U45A 3O3FA 2UVWA 2C2DA 3I5CA 2ASLA 2GV9A 4CJ5A 4B9MA 1R0AB 4E7IA 3JSMA 5D3GA 5HRPA 3G6YA 3IRXB 2HHVA 4DLGA 2VG7B 3GQCA 3CO9A 4M3TA 3NCIA 4JUZA 5DQIA 1BCMA 1RT2A 4DL6A 1DTQA 1BIZA 1RBSA 3KKRA 4FJGA 4XO0A 4Y34A 4RW6A 5KT3A 1S0NA 1ZBFA 3MR6A 3DRPB 5HP1B 1S5JA 4FJNA 4EEYA 3AO2A 2ITGA 5T7BA 1C1BA 4OVLA 2RDIA 2HHQA 1L3UA 4Z4GA 1S6QA 3S3OA 4ICLA 4ZP9A 4DS4A 3SPYA 5E41A 2BGGA 1JL2A 1QSLA 3ZSOA 4CJRA 3Q8QB 5C25B 2B5JB 4NLQA 2YNHB 3G10A 1KSPA 4NZ0A 1T7PA 5KG4A 1ZYQA 3L3UA 1RA7A 5KT7A 3HPGA 2XY6A 4O4GB 3MEDA 3OYCA 1J5OB 4CJQA 4RW9A 3M8RA 2FJXA 2RKIB 4B8AB 3PJWA 1TV6B 4FZZA 3FFIB 3PJXA 4WZQA 1I6JA 3P1GA 3UIQA 2AGOA 4K50A 3V6HA 3IAYA 3N6NA 1X9SA 3NF6A 3OSNA 2YKNB 3RB4A 4RNHA 4IG3A 5KFJA 4Y2AA 3RTVA 3H2LA 3VN5A 4OLBA 2DFFA 3WNEA 3V1RA 4Z4FA 5F8NA 3HK2A 3CDEA 1B92A 5L1IA 1S97A 1LV5A 4R0EA 1YT3A 4KV8B 4FJMA 5HROB 4F4XA 2IC3A 3AVNA 1S6PA 1WSFA 4K4TA 4K4ZA 2R2RA 4M95A 3V4IA 4KTWA 4Z0UA 1MU2A 2IDOA 3LZJA 2I5JA 3SQ1A 4FJKA 1C1CA 4KRFA 1OS5A 1TL1A 4R8UB 1TGOA 1YTAA 3CJ2A 5I3UA 1L3SA 2HHWA 1VRTB 2J6TA 3N6LA 4H54A 1KLNA 5C42A 2HNDA 1JX4A 1BI4A 1LWCA 4J9KA 4EO8A 2GC8A 2BQ3A 4HCBA 4TYAA 3SUNA 2XCAA 4FJJA 3DLEA 3QGIA 3HM9A 3ISND 4IKFA 4CEFA 3RRGA 3L2RA 5EWEA 2B43A 5CYMB 4B9UA 4ELVA 5KFHA 3OHAA 1TQLA 5FRNA 4CJVA 3TQ1A 2D0BA 1Z25A 4J9MA 2J6SA 1RDDA 4Z4CA 3PX0A 2FVPA 1TKTA 4DG1A 2XGPA 4FM0A 3G86A 4YNQA 1N6QA 2W9CA 1QE1A 2W8LA 2UVVA 1TL3A 3K5NA 4FM2A 2IJNA 3ZSWA 3QEPA 4RW8B 3I0SA 3KK3B 5J2MA 1RT3B 4QCLA 1LW2B 1RYSA 4IG0A 2VWKA 3NF7A 4DFMA 4FBTA 1FKOA 4B9VA 1RBTA 1I3AA 1RT5B 5KFBA 1IKVA 5DG8A 4MFBB 3OYGA 3KJVB 3D28A 1S1WA 4LY7A 2OZSA 1RTJB 2OPQB 3LPUA 2W7OA 2FVQA 1RT4B 2OPSA 5F8JA 2YV0X 3QO9A 1BQMA 2YKMB 1RCHA 1TK5A 5KFWA 4N47A 4G1QA 4CJKA 2VG6B 1TAUA 3M8PA 4DL4A 5KG3A 3SJJA 3H4DA 4FLTA 3DLKB 4LSNB 3KLGB 1JKHA 4QWAA 2E9TA 5F8HA 3AVAA 5EDWA 3CJ3A 3SZ2A 4CEBA 3HVTA 3MR5A 4AHSA 4IRDA 5KGXA 2X78A 1S9EA 2I1RA 2OPRA 4ED2A 1NK7A 1SL2A 1NJXA 3DRRB 4KAIA 1RT7A 1NK5A 3T5KA 1VSMA 2HNZB 3PX6A 1U48A 3MF5A 3PY8A 4QW9A 3VQEA 3RRHA 3KK2B 4Q8FA 3TR8A 3VQCA 3CJ5A 4IQXA 4ECRA 1WAJA 5JUMA 3UDLA 3E01A 1J54A 3VQ5A 1HQUB 4IH7A 3RB0A 3B6OA 3V1OA 1JLCA 3NGIA 4WE1B 3NKYA 4CIGA 3CDWA 1ZBHA 1RTIA 3BQ0A 4CE9A 5FROA 4E19A 2UUWA 4QWCA 1TVRB 3SUQA 2HWHA 4KB0A 3U6FA 4NCAA 4NLPA 1W0HA 4CGDA 2IGIA 4N56A 1BISA 3IGVA 3VQ9A 3OYJA 2Y1JA 2XHBA 3GV5B 4M94A 3AVGA 1FXXA 4KHSA 4Z4HA 1VRUA 5L1LA 3OVNA 4WZMA 1IKXB 4ZTJA 4E7JA 3KLEB 4AHUA 1KFDA 1SKSA 5CYQA 4ECUA 1C1AA 4BDZA 3OL8A 4CFCA 2IJFA 4KSEB 4FW1A 2XI3A 2KZZA 3LP2B 3E51A 2V4RA 1U09A 1KVAA 3L8BA 2DTUA 3C6UA 3IS9A 1BCOA 4FVMA 4FLUA 4PWDA 1D8YA 4J9NA 5KG0A 2OA8A 2ATLA 4O44B 1JLFA 3RMBA 4O4RA 3KOAA 3AA5X 3HO1A 4OPKA 3NHGA 4ECVA 4O5BA 3QEWA 3A2FA 4PUOA 4HTUA 2KFZA 1HQEA 4KE5A 4TYBA 1JLGA 4KTQA 1SH0A 1VSJA 1BQNB 1N56A 1VSFA 5DK5A 4LSLB 4E0DA 1XR7A 2ZD1A 3CJ0A 2RF2B 4YP3A 3OYAA 4DL2A 2OPPA 3KLIA 1W9HA 2AX1A 3KD1E 4RZRA 4CK2A 4W5TA 4JLHA 5HRSA 3QYYA 5HRNA 1K6YA 3QIPB 3LP1A 5J2QA 3SPZA 3TAMB 1TKDA 1WNEA 3T5JA 2G8IA 4LH5A 3ITHA 4L8RB 3VQ6A 1DTTB 1KLMB 2UVRA 3HKWA 5KFFA 4Y3CA 3OS2A 4MQ3A 3NAHA 3CM5A 4ZP7A 3OYFA 4K4XA 3MEGB 3KKSA 4ELTA 2FLLA 1EP4A 2IM0A 3OL7A 4QWEA 4Y1CA 4FLYA 1RDBA 2G8UA 3K5LA 4IFYB 4DTRA 3MR2A 1ZBUA 4CFAA 3DLBA 4DWIA 4YR2A 1BHLA 3OJUA 5F8LA 1NK4A 4IDKA 3KHGA 4M42A 3MR3A 1QHTA 3GV8B 4ECZA 2RPIA 1HYZA 5DG9A 4RW7A 4DLEA 2D7SA 3ZSXA 3L2QA 3BSCA 4B8CA 3DOKA 3ZT0A 4IFVA 4F2RA 5HRRA 3OYNA 2HW3A 5HLFA 4UQGA 2G8KA 4DSEA 1C1BB 2Q3SA 3K5OA 4CECA 4NLYA 2AQ4A 3DLHA 1SUQA 2ZE2A 2G8FA 3AO1A 2Z1GA 3SUOA 2WTFA 2FBVA 2WOMA 1QTMA 5FDLA 2FVSA 1NJWA 4O3PA 3VQDA 1T05B 1TP7A 1TKZA 2HWIA 1WSGA 4EP5A 2R8JA 4ID5A 1JLBA 4C8MA 3NE6A 4Q0BA 1QSSA 3K58A 4M3ZA 3CYMA 3BJYA 3AVCA 3JYTB 2HVHA 5CZ2A 4B9NA 4DMNA 1HNIA 1JLEA 4CF1A 1IKYA 3LP3A 2R8IA 2B4JA 3L2VA 2BQRA 1DLOA 3FQLA 3MAQA 1VK0A 4PQUA 5KFTA 1RT6A 4WFXA 3TARA 4R5PA 1X1PA 4K8ZA 2JEFA 3BQ2A 3KLHB 2E4LA 3LDSA 2XGQA 4CJ4A 4BACA 2J6UA 4DQRA 3WNFA 3VQAA 3C6TB 2DFHA 4M3WA 5CY4A 1Q9XA 1N5YA 5K14A 4C8LA 1NK6A 3NH2A 4F2SA 1SH2A 4H8KA 1WLJA 3CFOA 2IM1A 3QIOA 4CJPA 4DSLA 4Q45A 1S6PB 3F9KA 1JLAA 3V6DA 4MIAA 4O3QA 2XCPA 2ZKUA 5JS1A 5KFXA 3DLGA 1FKPA 5J1EA 4AHRA 3PW0A 4CESA 4FLZA 3CJ4A 4N5SA 2G8VA 2BQUA 3QZ8A 4BDYA 3PR5B 2LSNA 3DMJB 3M8SA 3ZSQA 4J9RA 1KRPA 2HNDB 5HBMA 1XR5A 1CSJA 1S1UB 1ASVA 4DFKA 3VQQA 3OHBA 1REVA 3ZT2A 2BANA 2YNFA 4DTPA 5J2PB 3BGRA 3VQ7A 3SFGA 1VSLA 3LP0B 2V0NA 3PW4A 1QAIA 4AHVA 4Q5VA 3MXIA 4CJEA 4J2BA 3ZCMA 4B3OB 2GBZA 2P1JA 1RT1A 1IO2A 3DLEB 3V6JA 3NH1A 3QEIA 4DTMA 4Q43A 3RBEA 2O4GA 4IKAA 4CHNA 4TY8A 3LWLA 1UWBB 2OZMA 4FLXA 4N76A 2HB5A 5DGAA 4NLGA 3MECA 2R2SA 1TKTB 1S1VA 4DG1B 3QETA 3HHKA 2HMIA 1N6QB 3OL6A 3M9OB 3ISNC 2FBXA 4Q8EA 1RAJA 4AILC 1L5UA 3WNHA 4ZPCA 2D41A 3QNNA 3CVKA 2IM3A 1NK9A 4CERA 5KG1A 3HVWA 3PW7A 1U04A 3KLFB 4ZVHA 1TKXA 2W9BB 4ECWA 4LQ3A 2F8TA 4J2AA 1T03A 4IOBA 1MMLA 4J9QA 2XY7A 4CJ3A 2E9ZA 3QERA 5EWFA 3NBPA 1X9WA 3SV4A 4TSXA 2BRKA 2E9RX 4HCCA 5KT2A 4I2PA 1RDAA 4O55A 2GUIA 2F96A 1CZ9A 3MFIA 3OL9A 2FVCA 3AA4A 1S1XA 4CF2A 1HPZB 1HYSA 2EHGA 2YNIA 3DLRA 2G8HA 3KK1A 3CFPA 1BQMB 4RUCA 1RBRA 3MFHA 5KG6A 3BDPA 4ED8A 1R0AA 1NNDA 4KBIA 2D5RA 3SV3A 2VG7A 3H59A 4TQSA 1RNHA 4GC6A 3KHLA 3RR8A 1JKHB 2FBYA 2AGQA 4DTJA 3LANA 1C0UB 2ILZA 5KFNA 3VQSA 3CIZA 4DTSA 4MH8A 4CGFA 3SCXA 1VSEA 4ED6A 5HP1A 2X6NA 3PR4A 1GOAA 3LAKA 3OSPA 4FYDA 2ETJA 3KIOA 3H08A 3IN5A 5KFZA 1S9EB 2OPRB 4ZPAA 1ZBLA 4H4OB 3O3HA 2DY4A 2KTQA 5C25A 2QXFA 4AH9A 1JXLA 4DF8A 1RYRA 2YNHA 3VQPA 4F4KA 2HAIA 3DRSB 4DSJA 4O4GA 1HNVB 5KI6A 4E1MA 1N48A 3C94A 4KHQA 3NDKA 3HPOA 2D3ZA 4XPEA 1ZETA 2P5OA 2RKIA 1NKBA 3K5MA 1D9DA 4RU9A 1TV6A 3QZ7A 1JLCB 3V1QA 3FFIA 3CQ8A 3EZ5A 5JS2A 3TAGA 4DFPA 4URQU 4ZP8A 4JRQA 4TLRA 4J9PA 1RTIB 1LWFA 1ASWA 3HSTB 4NRUA 1GX5A 3LPTA 3Q8RB 3KTQA 4OKEA 3L2UA 5KG2A 4HUFA 4EYHB 1A5XA
chains in the Genus database with same CATH superfamily
1D9AA 1UPPA 1E4FT 3RG6A 4W5QA 1AXQA 1BO5O 1QSYA 4AE5A 1RHJB 5HROA 2QWLA 3GIIA 1PSDA 4CEEA 4CEZA 1XHZA 2BZ2A 2JGUA 1LW0A 2QL9B 4AQYJ 2YHAA 4DR1J 5CD4H 4ED1A 2ZBCA 1UCNA 3S9HA 1U2CA 4UQTA 2HRUA 4NLVA 1VRTA 4O8UA 3JQMA 4JV2A 2J0XA 3CJTA 1I3OB 4A8WA 3GFHA 1X9JA 2QMXA 4BRIA 3T1YJ 4B17A 2CAJA 2XSJA 1C0FA 1RWVB 1HHTP 2DEIA 4DUYJ 5BYQA 3ZTQA 3CXCR 5CYMA 2W4DA 1HARA 3NS7B 4USIA 4DTUA 1NU4A 3NS6A 4BCAA 5A6WA 1UPMB 3U3YA 3UW1A 2UUBF 2NRZA 3EGVA 4ERDA 3G0ZA 4PXCA 4C3MA 2MLZA 7FD1A 3JAMO 2J0QD 1RHRB 1VQON 3EZUA 3PO4A 3FZFA 4ECQA 5KPRA 3N01A 1A5VA 4NCGB 2EX3A 1P6TA 4U7CA 2OCEA 1DT9A 2E20A 1LWEB 4USHA 3QESA 1D1UA 4KFBB 2K1RB 2A0FB 4JI2J 1VQLS 3ZETB 4GKJK 1ZA2B 3O9UA 5CZ1A 4QW8A 1X5PA 4I2QA 2JDJA 2DHXA 3NMRA 4PKHA 2Z30B 5KFDA 4PXEA 1QQOA 1JLQB 4R0JA 1RU1A 3L2WA 4U67L 2BJ3A 4H4MB 1RKJA 2HIQA 4CJSA 3IBWA 2KQ2A 3I55S 2LQ5A 1NGDA 2VWBA 1FD8A 2HHHK 2V2VA 3CCQS 1RWWB 4QPTA 1FWPA 3L4QA 4MJKA 4OKKA 3BSOA 4DCJB 3DLKA 4LSNA 3QEVA 1UZHA 4JI3K 4QIFA 2XLKA 4DV2F 4YY3F 3D4JA 5C0YA 1X4EA 3OS0A 3AB4B 5MAOA 3AA8A 5HLFB 3K2PA 2NSBA 3MTKA 1LAVA 4IH6A 4JV0A 5HMYA 4JYAJ 1WKJA 1XNRK 3IGNA 2ZDOA 3DRRA 2ZE2B 2RRAA 1KHWA 4NYPA 1VQ7N 5DM7L 3GIMA 4MKAA 3IG1A 4PA1A 1J6ZA 1C0GA 1R27B 3DNCA 3WC2A 4KR0B 1O6XA 1K0VA 3I32A 4Q0BB 4FNHA 5CR4A 2WSEC 4JKFA 4JHDB 2ZM6J 5M1PA 4ECTA 2AU0A 1FEHA 3CEDA 1Q53A 3IKMA 2RRNA 2D69A 1NPPA 3KK7A 1SV5A 3IP0A 2IAJB 1VK3A 3RW6A 5A8WA 2FVRA 4DR3J 3IM8A 1DLOB 4JRPA 1IUJA 1OQ6A 1IKWA 5DDRC 3GJRB 1UFWA 4B9TA 1NB2A 3B8HA 3BF1A 2LQ8A 4P9SA 2VQEF 5D15A 2ZH5A 2MKIA 3BYPA 5BR8K 3HFKA 3VGLA 2HG4A 4F36A 1G3OA 1CJKA 4JP8A 4RNOA 3RWUA 3VGMA 4ITSA 5J1NA 3WQPA 4LIWA 3H98A 3TI0A 3EKSA 3R1LA 1FRIA 3AV9A 2AJ4A 3I4HX 4BE1A 1G4CA 2QA4S 4PWUA 1TR0A 5DG7A 1LOUA 3HVAA 5LJ5Y 1S6QB 4ANEA 2LDYA 2UU9F 2FHMA 2DFEA 4ED0A 2P9PA 4FK0A 4LRFA 2KFNA 2CJYB 4ED7A 3V9XA 4YHHK 1XWLA 2VBWA 3EXCX 3TJ8A 2V2ZA 2CQ2A 3OYMA 4WQ5A 3NL0A 1Q7YT 2NSCA 3PW2A 2J7UA 3DHWC 5HQLA 3MEDB 2MKKA 3HJFA 4RW9B 3DOLA 1IN0A 1XNQK 2BJ1A 1WI6A 2RF2A 4B3RF 2KT5A 2BR0A 1A9NB 1S1VB 4KHPF 4FWKA 2DPJA 1MW7A 1N5TA 3I9V9 3JAMU 1Q82O 4LIRA 5AXLA 4A47A 4QOZB 3CC2S 4FBUA 3K59A 2QFIA 4ZVOB 1ZAXA 5M1QA 1WBDA 2QN6B 2E1ZA 3C16A 3K7RA 3JTNA 4ZPDA 5AXMA 4IJNA 3L4IA 2XMKA 2CQ1A 4FYXB 4CHZA 3T1YF 2E1MC 2G0CA 1MWKA 3QRPA 4DQIA 2FSJA 1PYTA 3U1NA 1UJ4A 1EX4A 4JKGA 2VC0A 3CDUA 4OFZA 3H2VE 3ZEUB 1T9TA 1MU2B 2KHCA 2QSFA 2JEGA 5GAHP 3KK1B 1IBMK 4IJAA 1XHXA 3HFVA 4BHQA 1S1TA 2AJ0A 1X9MA 5I3UB 1U7LA 2Q2RA 2MYFA 1RACB 4DF4A 4IBNA 5C42B 1LAWA 3MCSA 3E9OA 4WXWA 3NGZA 3GV7B 2YX6A 2MJUA 5HMWA 1RBUA 2DNQA 1XMOF 3TWHA 1HBNB 3C95A 4C9DA 4YR3A 5GADU 4XEIA 4M5GA 1ZC6A 4CFBA 4DTOA 3D2EA 3PHEA 1LXNA 2Q3PA 4NA2A 1IBLF 4DR7J 1T05A 2HGNA 4WFNQ 3H2UB 2EK6A 1EHWA 1FVQA 3ALYA 1NHKL 2W9CB 3TZZA 2C2RA 2YBVA 1KVKA 4FJ8A 3W9JA 3R5BA 3DYAA 5JVHL 4DV0K 3TVKA 2R9LA 5FRMA 1ZM4A 1T8EA 3LTOA 3LWMA 1EIYB 4LRCA 3QFWA 4ZKAA 3O6QA 4IG0B 4B3SJ 1W26A 2HZAA 4DR2K 4KH6A 1IKVB 5ETMA 1PAEX 1S1WB 1S22A 4Y1DA 4NE9C 3RAQA 1HI8A 3KLHA 4F50A 4C97A 4DV4K 4OGEA 1HNXF 3DXSX 2IVOA 4ED5A 1NHVA 4QR1A 2DNZA 3D2FB 1JIHA 1S0MA 5JICA 1VMBA 1WHYA 2ZH7A 3S41A 2RUGA 5EX5A 1LEOA 4HH1A 3H40A 2ZM6F 4NB4A 2GEMA 3OFFA 3FGUA 4Y2IA 4KGMA 3DRPA 3NNCA 3WUHA 3DMJA 3I96A 4CWBA 3T1HJ 2RHQB 4H0VB 4EO6A 1VQ9S 1U1NA 4UZBA 3H46O 2WBMA 5M1NA 1AUDA 2YH0A 3SJHA 3O80A 5BPLA 2IFXA 2J8SA 4U95A 4CK1A 4FF1A 3G8QA 2DIUA 4BR4A 2FY1A 1UWBA 4HLBA 4FJ5A 5CYJA 1JJ4A 1C0MA 2CQDA 1RAFB 1Y97A 1I94J 2WTUA 2J0WA 4DS5A 3GIKA 1H74A 3VVUA 4X64J 3MEEB 4O3SA 8RUCA 2OYQA 3J80O 2AX0A 3BZKA 2YKNA 2QA1A 2W9BA 3VGVA 4C23A 3PX4A 2FPHX 2UUTA 3LAMA 2KXHA 5K8MA 5KFCA 1QUVA 4USWA 4FOEA 1WC4A 2DNRA 1ASUA 4DOZA 5C2CA 3PDNA 2YKOA 2Y9HA 1FCAA 4EMDA 3VA0A 2HK2A 2A40A 1HPZA 2NYHA 3SAFA 1HLWA 1TUGB 3GPAA 1WSRA 1XBWA 5KT5A 3OYBA 2GJIA 4OYBA 5GAGU 3PRBA 1O5JA 3BREA 3MI7X 3MM7B 2VBXA 3AVLA 4DU4A 4HWIA 1YRTA 4PWDB 1WTFA 5HI7A 3SAHA 3I56S 1JLFB 5DQGA 1WG4A 3MX2A 1C0UA 2K8GA 4HVJA 3HSCA 3P4UB 2UP1A 3MMBB 4UW2A 2ALZA 3H5UA 5C24B 3POTA 4G3IA 3KHYA 3U3GA 2GWKA 1QVFM 3D9BA 4FS1A 2PEBA 3OYLA 2X7IA 3D6MB 3AGKA 2OPPB 4K4WA 3LZIA 1B70B 1FJEB 4ETXA 2V8DA 5T14A 3TA0A 4O3NA 2AJ2A 3E3XA 5TKWA 3A5OC 4D3GA 1JXBA 4O0IA 3H90A 3VERA 1PAUB 4YDXA 4U67Q 3PLAA 1UAWA 3EGWB 2RE1A 1FDBA 2MKHA 4NYFA 1RT5A 4FXDA 5BRFA 1IQTA 4CO5A 1Q81O 1TK0A 3Q7BA 3KJVA 2NZCA 4LBPA 4A62A 2FJEB 2QSWA 3AD7C 1S57A 2D0CA 3UNYA 2HFNA 4M5MA 1X5OA 3R7BB 4J2DA 4IOAL 4USMA 2OKQA 4KPCA 4P52A 1T3NA 2IY5B 3ZSYA 3CPWR 1BL3A 4IDKB 4W98A 4DR7F 2C1EB 4QBUA 4H0TB 1KQFB 3H4BA 1JJCB 5CAAA 4EBCA 4ECSA 2VWJA 2W7PA 1VSIA 3GYNA 2IA6A 3AVKA 2KVIA 5DM7Q 1VQMN 5D0RA 4JI6J 1NBWA 2N4CA 4FWQA 4KH4A 1DQAA 2CPIA 1YJUA 4G6VB 3LOUA 5AE3A 2WOMB 3KUHA 1Q82T 2VD3A 2QFJA 5CQGA 2JLFA 1TKZB 3LQVA 2H4WB 4CLSA 4FZXC 4A4JA 3U02A 2XZDB 4PRFA 2PYJA 1NKEA 1M1HA 4GO7X 4OLAA 1ITGA 1PJ6A 2R42A 4FPAA 4FYVB 2BA9A 2Q6BA 4NCGA 3ID8A 4EYIB 3EUNA 1LWEA 3MPYA 1H38A 4KFBA 5JLHA 2K1RA 1F3FA 3NWGA 4OX9K 1RT6B 2ASDA 3CETA 2W42A 4CIFA 2Z2YB 3PFOA 5A8KA 5BYSA 1FRXA 4WYLA 1JLQA 1BC6A 4BRMA 4HEA9 2CJAA 1CZBA 4GV3A 5DZ6A 3LPYA 2O8DB 1S4FA 2RHKA 4H4MA 5AR0A 2WCXA 2DGSA 4FPBA 1JLAB 4MK7A 3DLGB 5KFLA 3AVBA 2UZAA 3J7YP 1UMJA 2C3PA 5L9XA 4X64F 4TN2A 1IBKK 4O44A 1CXQA 2HURA 2W24A 3W66A 4LF6J 2C2KB 1KR4A 3BGRB 2XHWA 4MK8A 3T5LA 4NLSA 4ZP6A 3OYEA 4DEZA 1RFQA 1YJ7A 4V1Ak 2QA2A 3ZZTA 1T44A 1GLJO 1J53A 4YOEA 4K0KF 2FF6A 1P1TA 1AROP 4FJ7A 4NXMK 4FKXA 3TUJC 3QRRA 1TAQA 2E7XA 3BR9A 1CLQA 4WFBL 4C98A 2DIVA 3BPSP 2A3ZA 2XWYA 4BVOA 1SQFA 3NLCA 3HZEA 3OYDA 3VQ4A 4J9VA 4ZCIA 2IPOB 4HVZA 1WOPA 1XMQF 3MDFA 3TAQA 3I0RB 2HQFA 2VG5B 2LLZA 2EK1A 5E0OA 3AB2B 3CCLS 1Q9YA 2IAJA 4P74A 2A10A 4JI0F 4ZJOA 4I2PB 2IMWP 4B9SA 3FEZA 2ZBRA 2DR5A 1OYEA 4S0MA 3TZXA 4EWTA 4KTZA 4IFYA 5GAEP 2V7ZA 2ZC4A 4LFBJ 1SS6A 4UOGA 1HL6A 2CQHA 3Q2SC 3A8YA 3O3FA 2C2DA 4EFHA 1CEZA 4CLLA 2W2QP 5HRPA 2R7XA 3DGVA 4DLGA 4GKKJ 2GGPB 4K2XA 2NRVA 4IUFA 2GO9A 3HHLA 5DQIA 5F3ZA 3PHTA 1EZZB 2FIUA 2VPXB 4Y34A 5KT3A 2J7KA 4QQBA 1KP6A 3QT7A 4EEYA 3AO2A 4N7TA 4OVLA 2YX7A 1HNZK 1S6QA 4P72A 2LKZA 3MR7A 2V8GA 3TWZA 1XIQA 4CJRA 2BW2A 3TUPA 3G71N 3H7HB 5ETNA 5D4LA 5JVHQ 3DXBA 3G10A 5ITHA 1ZYQA 3W60A 4YOTA 1KOOA 3RW7A 2FJDB 3MEDA 2ROPA 2KXFA 2MZJA 4RW9A 1IR1A 4NI2B 1NLVA 2CZ9A 2RKIB 1XERA 3PJWA 2UXDK 1TV6B 3CMES 3FFIB 2D9PA 3PJXA 3MN6A 1YIJN 1I6JA 4K50A 1XUPO 3IAYA 4D3HA 3OSNA 1HD1A 4RNHA 3IFEA 3KUGA 3SQGB 4OX8A 2EPIA 5CHCB 2B4VA 2ZFHA 4QIVA 3VV2B 2M8DB 3UKRA 5KAKA 2VOPA 3GFYA 3HK2A 3CDEA 1QHAA 1U02A 3AODA 3HZGA 4PWWA 1S97A 4XH4A 4R0EA 4DZ6A 1WWHA 2KDOA 3AAQA 2NUUG 2RD5C 5E84A 4K4TA 2H65B 4KTWA 3ZEUA 1MU2A 2IDOA 1FKAF 1E4GT 4KRFA 3K9JA 2POKA 2WW8A 2HQ3A 2RSQA 3CJ2A 5I3UA 4X66K 3IUCA 3HMJG 3N6LA 3CCUS 1KLNA 5C42A 4WFAL 1H7WA 3SLCA 3T9NA 2GVZB 3CE8A 4EO8A 1YHQN 2GC8A 3HSJA 2VKRA 1QAYA 4XTTA 4TYAA 4WQ4C 1HBNA 4JOUA 5KOWA 4Q7AA 3ISND 4IKFA 4CEFA 1B4SA 3KXDA 1N34F 3DRXA 4YDUA 2NZ4A 1KD1O 2XS7A 1RLDA 4WTYA 1CJVA 3CCWA 4HL9A 5KFHA 3OHAA 5AXKA 4A59A 4WU3A 1DFDA 2AKWB 2L3MA 3QAUA 3PX0A 1RDDA 5ADXH 2FVPA 1TKTA 2BV3A 1BQXA 2OMOA 1N6QA 3UCUP 2W9CA 3OUYB 1Q81T 1FA0A 3I6PA 3H20A 4HTJA 1ZAVA 1V5VA 1VBZA 4QCLA 1LW2B 2ZHOA 1RYSA 4IG0A 3J7Z5 2QTWA 1RBTA 3NGKA 1NSPA 3RBXA 5KFBA 1IKVA 4MFBB 3DWLA 3A0IX 1S1WA 2Y1LB 1RTJB 1N33J 3LPUA 4HI1A 2FVQA 5F8JA 2ZF5O 5AQWA 4DJBA 1G6BA 1TMMA 3W2WB 3KFWX 3E2EA 1FDNA 5KFWA 3SXLA 3QAEA 2VQFJ 4CJKA 5GMKa 1TAUA 2RE2A 1R59O 1V4TA 3H4DA 4FLTA 1VQ7S 4LMZA 3KLGB 2OELA 2WBNA 1WUUA 1S7IA 2B4UA 3MEKA 2DGOA 1Y10A 5LMNK 1EB0A 1YLXA 2E9TA 4AM6A 2R7WA 2RQKA 4CBXA 1RWPB 1FRLA 3EDRB 5F0XA 3CJ3A 2BUPA 3SEOA 3NCPA 4BC7A 3SCKE 5KGXA 2UXCF 1RCOB 4E1JA 4Z37A 2GJ2A 4M5DB 1DEJA 5BXIA 4K41A 3C66A 2HNZB 3MF5A 3W1YC 2YKAA 4IO1A 2HVZA 4NZ6A 4W4MA 3VQEA 3RRHA 4F0MA 1WORA 4DHYA 3FRYA 3Q24A 3GL1A 2F1FA 1KBRA 5BN8A 4GKKF 4JKCA 4LRBA 3DFEA 1KOHA 4YDUC 4CYUB 1HQUB 2VASA 3RB0A 5AQIA 3V1OA 2O8CB 4NO7A 1MROB 3EX7B 4CIGA 1HNWJ 3U1MA 3BQ0A 2YWGA 2MZTA 3ZX2A 2JVRA 1VQNS 3PIOL 2Q1NA 3IMQJ 4OZ3A 2OP5A 2F9WA 3Q89A 3SUQA 3WXLA 3U6FA 1W0HA 1F9HA 3IGVA 3OYJA 2QMWA 1V3RA 2VGMA 4H5WA 2EFOA 4Z4HA 2CUYA 5L1LA 3W3SA 3OVNA 4WZMA 4ZTJA 2HBYB 3LM2A 4OZ0A 5G0RB 3BBFA 2PGCA 4FW1A 2CPDA 3PIPQ 3NCRA 5IS2A 2LA6A 2V4RA 4L74A 1U09A 3BV8A 1UL3A 1S6UA 3O9RA 3MK6A 3GBTA 2YWWA 1B0TA 2ZBPA 4PWDA 4J9NA 5KG0A 2OA8A 4USVA 4LBIA 1JLFA 5AQLA 4ISEA 3AA5X 4FWMA 4YS2A 3TSQA 2O8BA 3JQJA 3NHGA 4IFEA 5M2PA 1NM1A 3MMBA 2F9JA 2RDDA 3M1FA 3D6HB 1SBRA 1M5PC 1WUAA 1PYSB 3BUZB 3R6GB 3G25A 4KTQA 3EICA 4BGAA 1BQNB 2HKEA 1N56A 2G4BA 3UVJB 4LSLB 2HQIA 3VEXA 3KG4A 3CJ0A 2HFZA 1YJTA 4B3TK 2E2OA 3GFXA 2DGTA 2OPPA 2Z57B 5ELZA 3J7AP 5DZ7A 4DV3F 1X4HA 1E6VB 5A2QO 3IC1A 2D0PA 1WNEA 2VFTA 4DR6F 1MA9B 3HKWA 2LQBA 4DV7K 4MQ3A 1WB9A 4A57A 3FMBA 3K0JA 4NXNJ 3OYFA 5KQ8A 4C3LA 1OMSA 1EP4A 2RB7A 1CJUB 4DV5F 2AP1A 1ZA1B 3OPKA 5IV4A 1AUSL 4OYOA 3MR2A 2UUAF 4FZVA 4JEPA 3D1HA 3OXFA 3OJUA 3I31A 1NK4A 4IDKA 2NS1B 3MR3A 1VHXA 3GV8B 1VJWA 3GYGA 3ATUA 4IO8A 1Z1ZA 5AQKA 3KWIA 2EG1A 3ZSXA 3L2QA 2GA7A 5D4OA 5U47A 3QBCA 3G8TA 4IFVA 5HRRA 3VGKA 1KNZA 3KZBA 1YJRA 5K9FA 4CZEA 2XM3A 4WIQA 5AZIB 3BN4A 3WXMB 1YSJA 3MPUB 3Q86A 4I69A 1OY6A 4NLYA 3P39A 2AQ4A 1U6ZA 3MHYA 2G8FA 2BOPA 1K9MO 2A18A 5AQMA 1N33F 2WOMA 2V2KA 1LCUA 3CPEA 3L6QA 2PAVA 3VQDA 5ETKA 2A42A 1TKZA 4C11B 3J81j 4P75A 1BLUA 1WSGA 4EP5A 4ID5A 3K58A 4M3ZA 3ELHA 2ROEA 3ZZ0A 2IVFB 2EFVA 2IVMA 3QFHA 1FERA 2F4VJ 1JLEA 4TU9A 1RAGB 3GWCA 2CDRB 3FQLA 2HFUA 1RT6A 4L75A 3AXMA 4F0HA 1HIYA 1OSDA 4LF5J 3AJ1A 3KJNB 5HQMA 3M1VB 3HJVA 2J6UA 3S7RA 2V68A 4DQRA 4BR5A 3CPWM 4M3WA 4V19J 4WYBA 2A2DA 1VLYA 4A46A 3HKZD 1NK6A 3RU0A 4H8KA 2JFDA 2IM1A 5T7LB 5AQGA 1S6PB 3F9KA 5HQ8A 1JLAA 4MIAA 3DLGA 5D0HA 2G0JA 4AHRA 3PW0A 1KD1T 1MMNA 2F8HA 1VISA 2YI1A 1HNWF 3PR5B 2LSNA 4I6YA 1FNMA 4WP8A 4WCEQ 3M8SA 3ZSQA 2W2OP 5HBMA 1XR5A 4HT5A 1X3MA 2OSRA 3OHBA 3W65A 2UYTA 4CLUA 5LM7E 3BGRA 4ZN3A 4CO1A 4QIWD 5GAHI 3NMUA 4YB7A 1VRQC 4B3OB 3OA9A 1E3MA 3DLEB 4Y2MA 3MWPA 3QEIA 4DTMA 3RBEA 1UWAA 4TY8A 2OZMA 1RXOB 2OTLN 4DB3A 2BX6A 1Q5YA 2YJFA 5HK4A 3ENOA 4JK9A 5EX3A 1PC5A 4AILC 3WNHA 2KU7A 4ZPCA 2JL9A 2F65A 4CERA 5KG1A 3HVWA 3PW7A 4WK1A 3KLFB 4ZVHA 5A2QU 2VL1A 2EBEA 1RAAB 4IOBA 4LFAJ 1Z2LA 5IM0B 2GCFA 2AJ1A 5FLXO 3KKFA 5EWFA 1CULA 1X9WA 4I2PA 1RDAA 2MPUA 2F96A 1CZ9A 3MFIA 1ATRA 3AA4A 2WBRA 4A8KA 4KGXB 2MTLA 4CF2A 4X62J 1NSKL 3Q2TC 4WFAQ 3BDPA 3OR2A 2ZBQA 2VJVA 3BDEA 4FNIA 3D6FB 1RNHA 4N8OA 3D6RA 3KHLA 3T69A 2C3UA 4AYBD 1JKHB 2YH1A 4X65K 3HSZA 3WXKA 3VQSA 1VSEA 4EHTA 3PR4A 3R5AA 2ZH9A 5C15A 4P7VA 3OSPA 4NXNF 3BO2A 2L08A 2ZH4A 4OPHA 1S9EB 2FB0A 3PKYA 2OPRB 1LKZA 1YVNA 1ZBLA 3GE1A 4YOYA 3MURP 3ONQA 5T41A 4AH9A 2OI2A 1JXLA 1SPBP 3AGRA 4HDGA 1RYRA 1OPIA 2W6KA 3DRSB 4JI4K 3J81Y 1UKUA 1HNVB 3HF5A 4NI2A 3LDNA 2EFQA 3MUVP 1SQEA 3PNIA 2RKIA 1QTNB 4H5RA 4ILRA 4RU9A 1TV6A 1BMQB 1JLCB 2CQIA 3FFIA 4ZP8A 4JRQA 4TLRA 4J9PA 1FE0A 4PYAA 1V3ZA 3ZNUA 4WKYA 2DR7A 3JXOA 3Q8RB 4M5LA 2F63A 2DNYA 3GJQB 4I56A 2QWOA 4OKEA 3VPZA 4HUFA 1NDKA 1X0PA 2ZNYA 4U7BA 3CTRA 1VQMS 1RBVA 2R8HA 3EY1A 3E9LA 4KI4A 4F4AA 3MPWA 2EKYA 4C4WA 2QLBB 3H0PA 3P38A 3O2IA 4LRDA 4BRPA 1VK8A 2NLXA 2M4MA 2GWJA 4DV1K 5BR9A 2KO1A 1YZ7A 1KVCA 2X1AA 4RO0A 3OXGA 4KKOB 2DITA 1JMTA 4LF4K 3N28A 3C0BA 5D4PA 3IO1A 4KHWA 3QATA 3IS9B 1BD6A 5M1FA 1YITS 4HKQA 3QGHA 3Q8VA 2HFVA 1AFJA 1NGCA 4BC3A 2XY5A 4OJRA 5BPNA 3QQCD 4AM7A 2G2OA 3UD3P 1KAYA 8ATCB 2A1SA 2FBTA 2E5LK 3M9MB 4LF5F 1K8KA 4C6AA 1Q7LB 3PKMA 5HATA 1APSA 1FX4A 4BE2A 3LA0A 3W9HA 1IM4A 2DGWA 2VPYB 2B6AB 4RW4B 3LDLA 2OHDA 1F6TA 3FQKA 5DDPC 3RR7A 2O5DA 4C8KA 2EVZA 2YKQA 3FBEA 1SJRA 2FJBB 2DEJA 3PIOQ 3SDEB 1F0XA 1TUWA 5EU7A 5KFUA 2QM1A 4MIBA 4ANCA 3AOCA 3ZFVA 3OUYA 1RTHB 4UUWA 1ZS6A 2AA4A 5F2RA 3R6LB 1NGAA 5I42A 1LW2A 1UJ5A 1UVNA 1EETB 1SL0A 1P1LA 3QICA 3LGMA 2OANA 4CLKA 4NLWA 5D4NA 1WC1A 4CHPA 5FLXU 2YWHA 2F5GA 3DJCA 4LF7K 4CI6A 3T3FA 1RAEB 3U4LA 1NZAA 3DI6B 1RTJA 5SUHA 2ILYA 3ZC4A 1FRMA 3AO4A 2A5XA 4GKJJ 3NMAA 2HVDA 2HWTA 1OYDA 5IT0A 3CG7A 3AD8C 3M8ZA 2L9DA 3C7NB 5LL6Z 2LCWA 2PC6A 5CD4A 1RWMB 3QIDA 4FKYA 1RTZA 4FXVA 3KLGA 2EWHA 2YX1A 4O3OA 4YOUA 1K9MT 1E6YB 1PBAA 3GILA 4RW7B 2KVQE 2W8KA 4QZVB 4YN3B 4DL7A 2AIRB 2HHHJ 4M63C 2C22A 4TY9A 1AZSB 3CIPA 2HIYA 3D2WA 4F4ZA 4F4WA 2VBZA 2X1FA 3U27A 2VHGA 1HBUA 3DM2A 2M9KA 4JI3J 4CJLA 1XMBA 3IBCB 1MNEA 1NG9A 3TW0A 5FDLB 4X62F 2H1YA 3TVZA 2Z1IA 3PXGa 3TAEA 1IG8A 2CFXA 4W5NA 1XNRJ 3H5YA 1HQUA 4M8LA 1MROA 2H5EA 3N5FA 1FK9B 1HNIB 2F7TA 5DLGA 3I8BA 4GNIA 3ZZRA 4GC7A 3VF4A 2CKWA 4DR4F 5J2NB 2I7NA 3A8IA 4DN0A 2M88A 3D0PA 1YTYA 4V19S 2O1PA 1SKWA 1WNSA 4CO2A 4DZDA 3PYDA 3HHNB 3CJRA 4JV5K 2G2ZA 4JAXA 3WXIA 4KIAA 1HFEL 4QOTA 3A3NB 4B1YB 4YQWA 2HQCA 4N41A 3JSMB 3G71S 1Y7PA 3BBBA 5G0RA 4FLWA 1UA1A 1HX1A 4CZHA 1KAXA 1XEZA 4Y2KA 3UN3A 1RSCA 4JKDA 1VQLN 2KL8A 3VEOA 4RW6B 1YXQA 4BROA 1WF2A 1X3NA 2G13A 5BR8J 3NNHA 4K7QA 2O4IA 1N36F 3O08A 4EBDA 3A8KA 4ZCMA 4DL3A 1U8WA 3SFUA 1U1RA 5A76A 1NPRA 1YIJS 2DHGA 3TA2A 1TMJA 4KJIA 1MWMA 2W2MP 3BY5A 4OYZA 3VAIA 2GIFA 2LEAA 3J7YI 4TLQA 1CS4B 2O66A 4LR9A 2JEIA 1RHQB 2L9WA 3CCQN 3QPIA 3FMWA 1BQNA 2HNYA 1TL5A 3PACA 3MMCB 3UVJA 4LSLA 3SYZA 4M7YA 4KH5A 5F3TA 4IH5A 5BYRA 3WEEB 1VSHA 3L95X 4IYQA 4K4UA 4ATNA 2FLOA 1S99A 4YHHJ 4JK8A 1SIWB 3O9QA 2E44A 1E6VA 3VF0B 1S9GA 3D66A 2Q1LA 3AA2A 2UUBK 2F8SA 4IG3B 4CCHA 1XNQJ 1YRXA 2BKPA 3MM6B 2KHOA 1VS3A 5LSOA 2UXBF 2E1CA 4CLWA 3OFEA 1VQ6N 1RGIA 1SKRA 2CPXA 1CJUA 1U1QA 4OI2A 1S79A 4PG8A 2XLJA 1VC6A 3MWBA 1RK8A 2IBKA 1WEZA 2D4WA 1C1CB 2FGCA 3UWTA 2QKKA 4KO0A 5C5JA 4JV1A 1YF5L 3FZHA 5H9FK 4NCBA 1I39A 1DRZA 3SBTA 1YX2A 2YCHA 5E3QA 5GAEI 5KFKA 1UJ6A 2IM2A 3WHIA 3A4TA 2E2PA 3U8XA 4FK4A 3BM7A 3M2UA 2BBEA 3L7UA 2DNLA 1IH7A 5AZIA 3UD4P 5KFAA 1EKSA 4DV2K 3KDOA 3M6XA 4YY3K 5LT5A 4PL7A 4UTGA 1WSIA 1L3VA 2X1GA 4BRHA 1HBMB 4NLRA 3AVHA 3BSNA 1R31A 2ZVSA 3CCZA 5D0EA 3VGSA 1X4AA 1QE1B 4Y0WA 3CC4N 1TL3B 1G7CB 3CC7N 2KW4A 2VA3A 3FEYB 1NUEA 3HL8A 2QJ3A 5AQYA 2QA4N 1U49A 1B0VA 2KRBA 3V9SA 1OQ3A 3FVYA 3I5BA 1Q8IA 1GLLO 4BE0A 1FF2A 3C6HA 1FKOB 4KB1A 3ETOA 3SSRA 2DNPA 1EARA 2DHHA 4DV0J 1G99A 1R6YA 1KKHA 1KCFA 3DDKA 4JI3F 1OH7A 3M1VA 2R8GA 3M2VB 4P2SA 2X51A 3QB0A 1RWNB 3B78A 4DR2J 1RUSA 3OJSA 2XYHB 2KZMA 4DX7A 2PEHA 2VQEK 5K8PA 2WSFC 5DLFA 4BR9A 1LW0B 1XNRF 1VQKN 4B08A 1S77D 4ZVRB 4CEQA 2V8HA 2Q79A 4NYOA 1FD2A 2AJQA 2CPHA 4J9SA 1RISA 3CFRA 3HVTB 3Q8PB 4U6PA 1NO8A 5F0UA 5M1OA 4L76A 2B5JA 2AD9A 4C8ZA 2B8PA 2J8AA 4B3OA 1Y3KA 4ZPTR 3QBWA 4ZVEA 5HVGA 1NJZA 3FJ2A 3AVIA 3AY0A 2DH7A 3A8JA 2GTDA 4ZLNA 4E1NA 1J5OA 1OVYA 3S01A 2D1CA 3OR1A 3E01B 3I8DA 4DX6A 3O3GA 4BGBA 2XRIA 2CJKA 3BZCA 4IRCA 3O8WA 3KLFA 2VA2A 4B3RK 4K25A 4ZCKA 3VEYA 4KHPK 5A8RB 3RVCA 1WF1A 4I2QB 2QKBA 4TU7A 1RWKB 2FHJA 1GH8A 3DAWA 3CGIA 5B09A 4CBUA 3TABA 4KV8A 5A0YA 5K20B 3ET6B 3GFZA 4MLHA 2ADBA 3VGTA 4FYYB 3C6UB 3K57A 2X1BA 4CGGA 3F73A 1HJOA 1BY9A 1Y64A 3M30A 3WNGA 2NPFA 4LF8F 2F8EX 2DHSA 3SCLE 4QWBA 2WVBA 2P9UB 2DNOA 4KHUA 1XNQF 3QFUA 2XY8A 2ZDPA 3CCJN 4CZLA 4ZCLA 4PUOB 4B3MJ 1LFWA 3RB6A 2PIIA 2WFBA 3NF8A 2PYLA 4JI5J 3RBDA 2ASOA 1XMOK 3OTCA 5LMUJ 4ZVTB 3IG1B 4KAZA 2HBQB 4NYZA 2P5GA 3RGIA 3BO3A 3DRSA 4NLTA 3CMQA 2F9TA 3BSAA 1UA0A 3L0QA 3TAFA 3SQ4A 1HNVA 4L6V3 3G6VA 3VESA 3ENWA 1FJCA 2QC3A 1RCXB 3O4QA 2EFGA 4ECYA 1IBLK 3ITHB 1W25A 2C28A 3ULHA 3W0LA 1SV5B 1KAZA 4WFYA 1L3TA 2Q97A 1NJYA 2MKSA 2Z1HA 3T1AA 3UCZP 1IKWB 4CIEA 3RMDA 2W6LA 4QWDA 2MQMA 2IVYA 4LR7A 4BR7A 2BH1A 3CF5L 4I9LA 1O8BA 2DXFA 2R7RA 3ETMA 3AJDA 5AT1B 2VONA 3M7VA 1Y5IB 1Q79A 2LXIA 3L3CA 3OLBA 1YJ9N 4I9QA 3R5DA 4M1KA 3ENVA 3G96A 2NRTA 3U1LA 6FD1A 4K8XA 4KHNA 4HH0A 1CJKB 1HNXK 4KKOA 3M6WA 3AVMA 1NDCA 3CJ8A 4WWSA 4USKA 1Q16B 5DM6L 2MB0B 3R9PA 4M41A 1T94A 1I1GA 5FIIA 2Z4PA 3LPEA 1U47A 2ZM6K 1SUQB 2P9PB 4OIXA 2DCUB 2YY3A 3GIRA 3GJTB 4LR8A 2DKOB 5EN1A 4U7UK 4CFDA 2B6AA 4RW4A 3C65A 1JLBB 2F9DA 5CA5A 3UE5A 3GR0A 3DOLB 5KFVA 4WE1A 4MK9A 2HHUA 5IXUA 4ZK7M 1IKYB 1JXEA 1FE4A 4DFJA 2QK9A 1RTHA 4PEOA 1ZM2A 3RJMB 4W5RA 1TVRA 3R7NB 5C2DA 3JTPA 5AZJA 4R5PB 3VQBA 1EETA 3MMVA 3DKDA 4MKVA 3RMCA 1B7FA 3H25A 2PO4A 2GS8A 4CO3A 4JI7F 2BVZA 4EU0A 1N5YB 5CXTA 3DI6A 1HHSA 3RAXA 3KLEA 3THVA 4BWMA 2OEKA 4OX9J 3HHDA 3P83D 3HXMA 2HRTA 1FJGF 1NHUA 4ZMMA 3VALA 4J9UE 2AGPA 3C7NA 5CCMA 4FK2A 3EE8A 1GLAG 4URGA 1W97L 1S1TB 3H5XA 1D5AA 2OTLS 1RQ0A 2JWNA 3TVYA 2DY9A 1QM9A 4HACB 2M70A 1E6YA 3VQ8A 2HMPA 3EPIA 5EWGA 3CERA 1FFSB 2YNFB 3ZYYX 4OYXA 3OY9A 3T5HA 2D1KA 3T6JA 4ZLLA 2QI2A 3OTDA 5HSPA 4FJHA 1RT1B 3SUPA 1AZSA 2CG4A 3GB0A 1YBAA 2QL5B 2XMMA 2DJWA 4M3XA 2QV6A 4NLDA 3MECB 2C42A 5I9EB 3M6VA 2NYIA 1SJ1A 4NRTA 3FZ2A 4OQJA 1O1WA 1B7YB 1FRJA 3DYAB 3AOAA 1DTTA 1QAJA 4NXMJ 4A8FA 1S59A 2JSXA 2Z1JA 2G1DA 1FK9A 2YQ0A 2OO4A 3CJAA 5SZTA 3TPQA 1DQ9A 5J2NA 1NKCA 4QPXA 3QINA 4B3MF 3ENAA 4GY2B 3BGOP 2FF3B 2PT0A 1MN9A 3ZSVA 2CDQA 2YNIB 2A1RA 1OWXA 4JI5F 3E66A 4BQLA 3EKUA 3A5MC 1X31C 1KVIA 5LMUF 4B9MA 1M90O 3JSMA 1GTHA 1X4FA 4DDFA 4ZLJA 2HHVA 4WF9Q 3JSRA 2NCKL 2VG7B 1L3KA 4FPIA 3GQCA 4M3TA 3TQEA 1BIZA 1P9YA 4FJGA 2XSFA 1KDNA 2CZVC 3NG8A 4XO0A 3I4PA 4RBUA 4RW6A 1S0NA 2KI2A 3MR6A 1ZOTA 3DRPB 5HP1B 4FJNA 4BQZA 3MCPA 2HHQA 1Q1KA 4NLBA 1Q18A 4NMLA 3SPYA 1M1GA 1NH7A 5E41A 1FDAA 1N5VA 3ILIA 2XS5A 2BJ8A 5C25B 1R89A 4GV9A 1YKWA 4ID8A 4RPFA 2YNHB 4OJHA 4NZ0A 4KRWA 3L3UA 1TUUA 4ZJQA 1QD1A 5KT7A 3M8YA 2XMTA 3PEJA 2XY6A 4O4GB 4OJGA 1HNZJ 3OYCA 4CJQA 3M8RA 3FNNA 3VZHA 2LEPA 4FZZA 3OTOK 4WZQA 3R3LA 2MKCA 4PZVA 4ANDA 3N6NA 2YKNB 2HZVA 3CCSS 3BP8A 3ENQA 4IG3A 5KFJA 1NLKL 2UXDJ 1J27A 2BEFA 2C2ZB 3V1RA 5F8NA 2MQNA 5AE1A 5AQUA 1U2RA 3L7OA 5L1IA 1T6CA 3EVOA 4JK7A 2IMOA 4RBVA 4FJMA 5HVFA 2ZZMA 1BXNA 3MPDA 1WSFA 2VH7A 4K4ZA 3LH2S 4I0WA 4Z0UA 3LZJA 3SQ1A 3MTJA 1C1CA 1SJQA 2IDEA 3T41A 4R8UB 1TGOA 1YTAA 3P96A 4DPXA 4IOXA 1FO1A 4B9QA 2HNDA 3BB5A 4FXWA 4BRNA 4CLYA 2XCAA 4ALZA 4FJJA 1Q4RA 3QGIA 3HM9A 3CJQA 3RRGA 2H5JB 3L2RA 3G82A 2B43A 1T0TV 1J5EF 4ZOSA 3WBZA 3R27A 4OYWA 1DJ0A 5FRNA 1HBMA 2D0BA 2EC2A 1VC5A 4DG1A 2XGPA 4FM0A 3G86A 4YNQA 4CNYA 2V51B 2M0GB 2MZ1A 4DV6F 1QE1A 2W8LA 1D4XA 1TL3A 3K5NA 2PFUA 4K0KK 2VDHA 2KJWA 3CCTA 2Y3YA 5AJ3F 3QEPA 2IYIA 3MCNA 2EI5A 5I3PA 4BR2A 3TTCA 2W7AA 4JI8J 4NWBA 3MCAB 3O9SA 4X4PA 5JLFA 1FKOA 4C3KA 1I3AA 1RT5B 1WBBA 2EKNA 2P9LB 3N4PA 3CCRN 1RDWX 1MMDA 2HLTA 4FWSA 3MCMA 4FSVA 3KJVB 2ZJQQ 1DARA 4X84A 4UY8O 1XMQK 3DN9A 1RT4B 1QQNA 3ZNJ1 1BQMA 4JI0K 2RILA 1MG7A 2GHPA 3ZTOA 1YJWS 2GX8A 3D0IE 4OYPA 4N47A 3CMEN 5IT9O 4X4QA 3A1YG 5FD1A 4NL5A 3FCVA 4I68A 4UF4A 2P2CB 5TKYA 2A6OA 3BN7A 4QWAA 4NXMF 2KH9A 1JJHA 3OTBA 5EDWA 4RCHA 4A48A 4CEBA 1N5QA 4A2BA 3HVTA 2KM8C 3MR5A 4CTAB 4IRDA 1B64A 5IT4A 3AQOA 5KPZA 1NK7A 2WVDA 4YOWA 1Y5LB 3PYGA 1VOMA 2DNKA 3TRGA 3PX6A 1U48A 1MSWD 5ADXA 3PTWA 4IEEA 1JK9B 2Q0RA 2JHEA 3KK2B 2YVSA 1DZ5A 4GVLA 4PL8A 3VQCA 1AB8A 2RQMA 3E01A 2ACMA 4F0KA 1J54A 3VQ5A 2YQ3A 3CCUN 1H6KX 4IH7A 3PYEA 4HHJA 3NKYA 3EGZA 5C10A 3MCOA 1RTIA 2CGJA 2BXJA 4LF9F 2ZJRL 3CF5Q 5CZVA 4DU7A 4QWCA 3TSUA 4DR5F 2F3JA 1PCAA 2NPIA 1H98A 5A8RA 3OXLA 3S6EA 4CGDA 2IGIA 3UI3A 4F9OA 3VQ9A 2M5YA 2QEXN 2P9CA 4C1NI 5A8KB 4KHSA 4CD1A 2HF3A 2D3OR 4I67A 4JI1J 1UVLA 4YB1P 1KFDA 5DM6Q 1YJNN 4BDZA 3ET6A 3R5GA 3OL8A 2KHDA 4CFCA 3A5NC 5BRDA 3LP2B 2XBPA 2UV8G 1KVAA 1QJHA 3M4XA 3C6UA 1Q78A 4QYRA 2B4PA 1D8YA 2GVDB 2UUCF 5DDQC 2D3O1 2GW8A 5IQQA 5HN0A 2ATLA 1SAZA 3F41A 4O44B 3V4MA 3RMBA 4O4RA 1K73O 3T9ZA 3WT0A 4K42A 2P9UA 3I87A 2DT9A 4O5BA 2UXDF 3PG9A 4PUOA 4HTUA 4IO9L 2ZITA 4CBWA 3CMAN 1JLGA 5E26A 3WQTA 1PJ7A 1VSFA 2E2NA 5DK5A 2CH6A 1V5IB 4CZGA 4NPOA 4ZVPB 1VQ6S 4YP3A 3OYAA 3MX5A 4CZMA 1N34K 3HD2A 4RZRA 2PA3A 4W5TA 4JLHA 1U1LA 2J0SD 5HRNA 2CG8A 1K6YA 8AT1B 3JXUA 3SPZA 1R8AA 1RJJA 1ZM9A 3T5JA 3ITHA 4L8RB 1TYQA 2CZ4A 5KFFA 1NJIO 2RJZA 4FVCA 4NOHA 5L46A 1IWGA 1M90T 2BMBA 3D68A 3B4MA 1NU0A 2IM0A 3P45B 3OL7A 3MMAB 3M32B 1EWRA 3FEXB 4IFYB 3BGLA 4DWIA 4DV7J 1SJ4P 4MAKA 2JNJA 3BGUA 2QLWA 1XQSC 5F8LA 3BKTA 3S1TA 3KHGA 4M42A 1U2VA 3NY0A 1URNA 4K59A 3DHXA 5IT9U 4C0OC 1GLDG 1D8ZA 4P2MA 1VQNN 1TUVA 3HHLB 4DLEA 2GNKA 3BSCA 3ZZPA 2NNWA 1EO1A 3ZT0A 3CC4S 3AA9A 3OYNA 3DLLL 1YBUA 2A6AA 3ATVA 3BF3A 3CC7S 1U25A 3GSIA 4JI8F 1G1XA 3NVKA 3CDBA 1UW4A 5AQPA 1SUQA 3MM5B 3E8OA 5I4MA 2Z1GA 4OYMA 3AAPA 1WJ9A 1NJWA 2HQDA 3ILJA 4OI6A 5LY3A 2UXCK 1QSSA 1JLBA 4X4VA 3CT9A 4FYWB 4OLPA 3AH6A 3CW2C 4XDDA 3JYTB 1T3OA 2U2FA 4P10A 3UE2A 3BKUA 4OMFG 2ZUAA 3TSPA 1ILYA 4AQYF 4DR1F 1IKYA 4CO0A 3LP3A 3L2VA 3NGUA 2BQRA 4CM0A 1YUWA 1VQKS 4R5PA 2HVEA 5B0GA 4ILGB 2R7TA 3BQ2A 3LDSA 3HHEA 2XGQA 3O1WA 4NA1A 4BACA 1UTAA 3VQAA 3C6TB 3UKRB 3GOIA 3U7JA 5CY4A 2RH3A 1N5YA 5K14A 4C8LA 3TNVA 4F2SA 1FNOA 3CJSA 4DUYF 5CZXA 1WLJA 1H2VZ 3QIOA 4CJPA 3GONA 4Q45A 3KWMA 4I6MB 4O3QA 3V6DA 4KH0B 2VODA 5BRHA 4LBHA 3NP5A 1ATSA 2BQUA 4ILHA 4BG9A 4F25A 1GLBG 5B7WA 4HACA 3I9ZA 3MWTA 2QRRA 2BANA 2YNFA 4DTPA 4JI2F 4RUHA 5J2PB 2CPYA 1VSLA 3CJBA 3LP0B 4FF3A 3PW4A 1QAIA 4CNZA 4Q5VA 1MN7A 2CPFA 3FLCO 1RT1A 4K5RA 2DTJA 5EGYA 3V6JA 2QLFB 3F44A 1HR0J 1UETA 1R3NA 2O4GA 1CJVB 4CRJA 3HX9A 2VICA 5DETA 2I9SA 2E1PA 3CJCA 1UP1A 4JI1F 1RHUB 4NLGA 3MECA 2DNHA 3BH6B 4LVOP 3DGPB 2CA9A 1TKTB 3HHKA 2OD6A 5M2RA 1N6QB 3K2YA 4CLPA 3M9OB 2E88A 3ISNC 2IDLA 1RAJA 1L5UA 2D41A 4CIOA 4UUXA 1M5SA 1PC4A 4UY8T 2W40A 2F8TA 2GZOA 1MMLA 1WG5A 3B8AX 1IJFB 3O44A 1HKGA 4DV3K 4TSXA 4HCCA 5JVGL 4TKTA 2PDAA 4DR6K 2FVCA 4U9RA 3QDKA 4JYAF 2MJNA 3CCJS 2V9KA 2YNIA 7FDRA 3IR5B 3D0GE 2NZTA 5IQ6A 3MFHA 3THXA 3ZTPA 3SV3A 4DV5K 1SZ2A 2VG7A 1IBCB 3H59A 3LO3A 3OVSA 2UUAK 5AFUH 1YBTA 4HT7A 4DQ8A 5CH7B 2AGQA 5HANA 3LANA 4B1VA 4DTSA 4CGFA 3SCXA 4PKIA 2IHR1 5HP1A 3TO8A 1X8DA 2ALYB 1KS2A 2ETJA 2PI4A 4DR3F 1U1OA 4H4OB 3CQXA 2CQ4A 3PYFA 2DY4A 5C25A 3PCOB 4X65J 3JQKA 2YNHA 2V34A 2B0GA 4L73A 5EX0A 3VEVA 4QS9A 4O4GA 1WD6A 5KI6A 3NDKA 2D3ZA 2P5OA 1NKBA 4A2AA 2G0IA 2P9KA 1RHMB 3EZ5A 1YJ9S 2ZHBA 3C2PA 2VZ9A 3UCGA 2VF3A 1LWFA 1ASWA 4JI4J 5B0EA 4NRUA 1GX5A 1BWVA 3KTQA 3L2UA 1F5CA 1A5XA 4CZKA 4JN4A 3IR6B 3LL3A 2LQ9A 1N4LA 4M3YA 1FX2A 1M5KC 1S6OA 3NS5A 3QLHB 2ACYA 1K73T 2RDJA 4DUTA 3NF9A 1TELA 3W2VB 1ZZNA 4R8UA 4ECXA 4Z7CA 1IR2A 4CJWA 4HUGA 3C14A 1R0BG 1RTDA 4DV1J 4X4OA 2ZNZA 2O8BB 2JC0A 1JCFA 1NXIA 4LF4J 4B02A 2IIHA 2Z8QA 1TTHB 4WP9A 4CHYA 3NGYA 4BBYA 2PY5A 4YB6A 2ZJRQ 1PYOB 4PQAA 2E5LJ 1NJIT 1HMVB 4FJ9A 2QGFB 4J8FA 1NSQA 3VTIA 3V81B 1SC6A 2VFSA 2E7WA 3P5JA 4JB8B 4RJVA 2VPZB 1SJ3P 1ZBIA 5JXSA 3OBWA 4IR9A 2B7BB 2BACA 1FXRA 2CNKB 3TJAA 2I7PA 2P9LA 2FC0A 3CM6A 1O0PA 1HR0F 1EP4B 4DTNA 4OHVA 5C12A 4NZ7A 3MUMP 4A8SA 3NNAA 3SMPA 2IA0A 1RT4A 2ASJA 3MD3A 3HRGA 4J7CA 4BRFA 1U4BA 4WFZA 2ZGZA 2ASPA 4LF7J 3MMJA 4OZLA 1WC5A 2XWXA 1XR6A 4WPAA 1GFWB 2MQ8A 2RHSB 3THYA 2AYGA 4U7UD 4ID1A 4CT9A 4IFVB 4I7FA 1AFIA 4I1TA 2QO3A 2BE2A 4B3SF 4CTAA 2YHXA 3BYRA 4CJFA 5D0GA 4IR1A 2BDPA 3MXHP 5KRSA 1AT1B 2HBRB 2V4JA 1TL7B 1PG5B 1MLAA 4FM1A 4DI6A 3KK2A 2Y1IA 4RX6A 4ID5B 3P4IA 2HEKA 1P90A 2QW9A 5B0AA 4PCQA 4FVUA 1YITN 2DH8A 7AT1B 5I3QA 3R6MA 4JD2A 4H03B 1HJRA 2OH2A 1JLEB 2Q66A 5E3PA 2JJ4D 3L09A 3CIMA 2APOA 3J80U 2IS3A 3T1HF 5KFSA 3NAEA 4PPZA 3BF4A 1XTZA 3HVRA 2B3TB 3AT1B 4P2XA 2Y8WA 3O4WA 2KRRA 4JS4A 3VAKA 3FBCA 2VFRA 1VSKA 5LOQA 5D3GB 3D0HE 3K8WA 1S0OA 3TUIC 3DLLQ 2B9YA 3KUEA 2WK4A 1HI1A 1RT2B 2JLEA 2O8FA 1DTQB 1T3VA 3LP2A 5F8GA 1H0HB 2RIJA 4TQRA 1KTQA 1I94F 1CPZA 2H51B 3IAS9 3RMAA 2EW9A 2GVDA 2M52A 3G6EN 4G1IA 3NFAA 4HHTA 2DRBA 5HBMB 3ZO7A 5IWAJ 3S3NA 4ICLB 3AFGA 2V7YA 1CC8A 2QYCA 4FLVA 3AD9C 3QNWB 2Y0SD 4ISFA 1K1SA 4I64A 4F3TA 4TY8B 1GMUA 1F21A 3QBXA 1HRHA 3HULA 3AVJA 4KY3A 1HWIA 1HWLA 5GAHU 2V2QA 1SL1A 3IWXA 4X4NA 2XC9A 4CHQA 3ZSZA 3ID6A 2W9AA 3EYZA 4F8RA 3QEXA 2V4QA 2WVFA 2QWRA 3RSEB 1CULB 3NOGA 4A8OA 1RBLA 4LH4A 3VEZA 3VCDA 5C2FA 4ZHRA 2VJUA 2ZKTA 3MMAA 3M32A 2NXJA 2VGNA 1U1PA 2GIRA 3TR5A 3JAMY 3HLUA 2UUBJ 2J5AA 1A0OB 1QUPA 2GV1A 1GQEA 4KI6A 3LM9A 3PUFA 4CZIA 3NAIA 4QAGA 1TL1B 3TTDA 3OR2B 4BREA 5KPTA 3BQ1A 1BWEA 2FSKA 3OT9A 4WQ4A 1KTVA 1BI4B 1DY3A 1Y0HA 4FCYA 3CD6N 3O6WA 5CHIA 1CXUA 3R1HA 1RU2A 1U1KA 1WF0A 4LVNP 4NLUA 4CJ7A 1HHQA 3UFCX 3KDNA 5H9FJ 4KHYA 5B0BA 2B9XA 4QIGA 4OKJA 4HDHA 2Y1RI 3MM5A 3IMXA 2RQCA 2CNOB 1JWWA 4QU6A 1BDGA 2M3DA 3CCRS 2E5GA 1GMWD 3AVFA 3ZTRA 1UVMA 4OZNA 1C4CA 4ER8A 3F0NA 3OTEA 4DV2J 4YY3J 1WSEA 3NGDA 1KQSM 2JC1A 4KPYA 5JVGQ 3JYTA 3OBYA 2R2TA 2B4OA 4WYWA 4P2FA 5GADP 5AQSA 1X5TA 3A3PB 4OZ1A 2LXFA 3ZX0A 4HUEA 2LDIA 4O3RA 2XMWA 1SC3B 4JI6F 3HYFA 1NOZA 1J9AA 3ZTSA 5HJYA 3C6TA 3W3DA 4DR4K 3T19A 2CNLB 3CJKB 4BRGA 1K47A 1UAXA 3IRXA 4G1QB 1XC9A 3M8PB 4Y28C 1GAOA 2MXYA 3QJPA 5FPNA 1NGEA 2VYPA 4I6MA 2BUNA 3NH0A 1NZ8A 2HBMA 3ZLJA 2HQGA 2MHNA 2HFOA 3B6PA 4C8YA 5KFIA 1RKIA 4PY5A 2C2NA 4QYZK 2L9NA 3RB3A 4FWNA 5H1SV 4NLCA 3QNOA 5J2PA 4J9LA 2VQEJ 3LP0A 1FEEA 3HT0A 1RT7B 1VHIA 2AZ3A 5KG7A 1K8KB 1RP5A 3WX4A 4FPRA 4E7KA 4NEZA 1IJJA 1N36K 2DXDA 3AXKA 3FC9A 3O3LA 1KXPA 2XO6A 2VOOA 2E2QA 2QEXS 3KNAA 2AEFA 2EWSA 4YR0A 3DGPA 1VSDA 2AV5A 2PBDA 4E7LA 4ELUA 1QY7A 4JKEA 1Z2ZA 1YJNS 2IVPA 4E3SA 2V5HG 4AT1B 4EIAA 3ZZUA 5I42B 3O1BA 4NASA 5IWAF 3K0SA 3D5MA 2HHSA 3ENHA 4LF6F 3CULA 4DU3A 3P6YC 4AUKA 1UEVA 2AMCB 2UVUA 2HSTA 4RNMA 4F4YA 3DDIA 4XPCA 2G2YA 4B3RJ 4DMZA 1SC4B 4O23A 3P49B 4LT6A 3R9LA 4KHPJ 1FVSA 2UXBK 3TUZC 3CMAS 2P51A 4XH1A 1ESVA 3RAMA 1KVBA 4NEYA 4J91A 2KYXA 2E5IA 4ZLPA 2GMHA 3FSYA 3JS6A 3IDHA 3QSIA 2KYZA 4CF9A 3WIUA 4GW6A 1YVUA 3HP9A 2W2PP 2NR0A 1NK0A 1NEEA 1N54B 2P8IA 2P9GA 3CD7A 1ROFA 5DJBA 3HM8A 4H5NA 2BJ7A 3LGNA 5BPMA 1HQEB 1FRHA 4FS2A 1N0UA 1VQ8N 1DURA 1VHFA 3EZOA 1HBUB 5GAGP 3DM2B 5MLCV 4H4OA 2XZTB 1FJ7A 4RLEA 4E2FB 3B82A 2AT1B 2K06A 4PKDB 4RWTA 2F4FA 3DU6A 4LFBF 2B9WA 1VBKA 4DQSA 4CF0A 4M45A 2KT3A 3IWLA 1VAZA 2MY7A 5J2QB 3MDQA 1GOBA 2HVIA 4UOCA 4RW8A 2JZ5A 2ZWPA 1RT3A 1XMOJ 2GIQA 1FWLA 2VFUA 3ZT4A 2MQLA 3SQ0A 3RUBL 1MDUB 4IOAQ 1WDDA 2R7VA 1C6VA 1Y00A 2LP4A 2V8VA 4P73A 2MSTA 3UNGC 3CCVN 5L1KA 5KT4A 2OPQA 3FSIA 3FR0A 1IBLJ 4B1XB 4EZ6A 2DB1A 3MXJA 1VFJA 4GRSA 3C8YA 5LXRA 2VG6A 3QLHA 3HPHA 4GMJB 4K4VA 2LU2A 1RLCL 1M0SA 2YHBA 3W2VA 3P5TL 2ZWOA 3DOKB 3KMQA 5E5NA 2PD1A 3EVWA 3EPGA 2V6AA 5AQJA 3VA3A 1RZMA 1WSHA 5KFOA 3R2CJ 4DPYA 2X6SA 3H1VX 1U0HA 1HNXJ 1YVFA 1PBUA 2BJ9A 4CEAA 4P6QA 1T9WA 2GMJA 3EN9A 1M5VC 5AQZA 3DOMB 2HNYB 3TYTA 2FJWA 3UR0A 1ZTTA 5J1PA 1B9DA 1HMVA 1G15A 5AXNA 3K5PA 1WHVA 3T7ZA 2ATQA 2YQ1A 1VLOA 4I6WA 5ETTA 5AQVA 4CDIA 1WG1A 1NK8A 3V81A 1S9GB 1WKKA 5C2GA 3J7YU 4PQUB 1VI7A 4LFCK 2FHJD 2NRXA 3IFRA 3GU0A 4MO5A 1Z26A 1IR0A 2FZKB 3R8YA 2FZGB 2E6MA 1S49A 3O4NA 4CLZA 4H0XB 4W5OA 2ZH2A 2WSCC 4M5NA 4JNEA 3KHRA 4PAAA 1EXQA 2C2OB 5SWMA 2N7CA 3J80Y 5K8OA 2Q31A 2HHPA 1FKPB 5J1EB 3BS9A 3ASMA 4KO0B 1VBXA 1A6LA 3FBBA 4OJ3A 1QAXA 4J9OA 4BRAA 4WU2A 1REVB 4CZJA 1GXTA 1NGIA 3PO5A 9ATCB 3KLVA 3W64A 4B1ZA 4H0YB 3M2UB 1F60B 4G65A 2BJDA 5HVHA 3M6UA 1ZXOA 4B9LA 3I82A 4LF8K 4WFBQ 3RBZA 3UKUA 1BA0A 1DHMA 3L3VA 4L3NA 3VVTA 2GFFA 5GAEU 1TL7A 5L9NA 2DK2A 4K4SA 1TUYA 1TK8A 2NUBA 2VQFF 2XB2D 3TAMA 3GG4A 1WACA 4DBQA 1T9UA 3LALA 4GV6A 2CJQA 2J4RA 1ZM3A 3BKFA 3CUNA 4Q2MA 3PSIA 1WAFA 5KT6A 4LJMA 1MWZA 3NBPB 1WDTA 3K17A 1FW6A 4E98A 3OQ2A 2QX0A 4LUBA 1FDDA 4CGHA 2E7VA 1Q8BA 1KQKA 2P6TA 1NGJA 3OBIA 1S1XB 1IV0A 2HRYA 2GUPA 4CO4A 2MQQA 2ASLA 1U8SA 3A8EA 2CJ9A 1UVIA 1R0AB 4TU8A 4E7IA 3D54A 5D3GA 4N77A 2P9IB 4BRDA 5ETSA 3CO9A 4Z94A 3Q8UA 1BA1A 4JUZA 3QWPA 4DUZJ 1BCMA 1RT2A 4DL6A 1DTQA 3KKRA 1XK8A 2MMYA 2H4YB 2RU9A 1ZBFA 2F7VA 1Y3JA 2QLXA 3OD2A 1I5OB 2ITGA 5T7BA 1C1BA 1IJEB 4H5TA 4H5VA 4Z4GA 4ICLA 1RAOA 3VAGA 2CVIA 2LFVA 3HZ6A 2BGGA 1JL2A 3ZSOA 3GDQA 5G4DA 1SQGA 2BKNA 1FFGB 2B5JB 5AQRA 4QR2A 3WZ0A 2DNGA 5KG4A 3B54A 1G2EA 2ZZTA 1RA7A 1LK7A 4ZVSB 1J5OB 3OR1B 4WQ5C 2HS3A 3HCXA 3L7PA 2CGKA 2W4CA 5RUBA 1JJ2M 1IXKA 1MWQA 1U6BA 1PILA 4WTOB 2CQGA 3RB4A 1B0PA 2H9ZA 3UD5A 4Y2AA 3RTVA 3GYXB 3H2LA 3VN5A 3OTOJ 3RSEA 3DXKA 1YZ6A 3KVGA 4Z4FA 4LREA 4FP9A 2U1AA 1N32J 1LV5A 2DBBA 5HMXA 4KV8B 1DKGD 2WUSA 4F4XA 3MOZA 1S3XA 2R2RA 5A0YB 4M95A 5BN9A 4JI7K 1OS5A 1TL1A 3DXMB 2Z2ZA 4OYIA 2I6WA