4PUOA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 145
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4puoA05
4QWCA 2KFNA 5C25B 2KZMA 1MMLA 1QAIA 1NK7A 2JEIA 4DTOA 1XR7A 1C0TA 3H4DA 3MR2A 2OPSA 1IKWB 3NF9A 4O44B 4DSIA 1HRHA 4RW6A 4CJWA 4IOBA 4F3OA 4FJ9A 3CDWA 2R2TA 4ZHRA 3OS0A 3PW5A 3DRSB 3HSTB 2GIRA 1S49A 4F8RA 1RT3A 4DG1A 3OS2A 3OYLA 5DQHA 3N6NA 1SH2A 3KK1A 2XI3A 4B9TA 3VQ4A 3QGIA 1F21A 3TAEA 1TAQA 3AO1A 1BIUA 3OL7A 4NLGA 2RDJA 2RF2A 5KT3A 1DTTA 2XY6A 3ICLA 4KFBA 3DLRA 3RAXA 4OLBA 1JLQA 4AHVA 4M3TA 1GX6A 2ILZA 4URSA 3E01A 3SUOA 3U6FA 3H4BA 4KV8B 1RTDB 4FVMA 4TN2A 5JUMA 1CLQA 1RILA 1NJWA 4LH5A 2XRIA 5E41A 3BGRA 1RBUA 3Q8SB 1RBTA 3QZ7A 4LSLA 4CJQA 3IS9B 1IG9A 1WNSA 5I3UB 4CHNA 4FZYA 2BANA 1JLAB 3V6HA 4CJ3A 3QGGA 2B43A 2B5JA 3OL8A 1QSYA 3VQ5A 3VQ6A 3WNEA 4N5SA 5DMRA 4DS4A 4ID1A 5KGXA 1JLGA 5EWFA 2GBZA 3RB6A 3L8BA 2Y1JA 4I9QA 1RTDA 3G10A 3ZT3A 4DU3A 1VSJA 4B9VA 3HPOA 3LP2A 3CFRA 4I2PB 3V9XA 3O3HA 4TY8B 2BANB 4KHNA 2IJFA 3OYAA 3KLGA 2QXFA 3K59A 4TY9A 3MECB 1S1TA 3DOKB 4DWIA 4ELVA 4LSLB 4FBTA 4FJ5A 1J5OB 3SUQA 1Q9XA 3UPFA 4FCYA 4J2BA 3RBDA 3V6JA 4EYIB 2ASDA 1BCMA 3T5KA 3NL0A 2FVSA 3TAFA 3QNNA 4Y1DA 4OGCA 1FKPA 1GOAA 4CEFA 2VG6A 4FJIA 3M8SA 4RNHA 1XC9A 4WFZA 4YR2A 4J9RA 3SZ2A 2HHTA 3PUFA 5KFCA 1MU2B 1UWBB 3KLFA 3ASMA 3TR8A 1XR6A 1XHXA 3GV7B 4Z4HA 1EP4B 4KE5A 4J9PA 4K8ZA 4CF9A 3BQ1A 3OL9A 5T7BA 4BWJA 2I5JA 2FLLA 1ZBHA 1WLJA 5JS2A 1BQNB 4NCAA 1S1WA 1EX4A 4HCCA 3KLHB 4KI4A 4FK4A 3QZ8A 4ICLA 2IS3A 2VG6B 3T5HA 2HHXA 3T1AA 1TKZB 5EWEA 4CIEA 1U4BA 4TYAA 4XIUA 3LDSA 5KT5A 3V9UA 3JYTA 3CM6A 4CFDA 4CJEA 3FRZA 1N56A 4KO0A 5L1LA 1HNIA 3BSCA 4KHRA 3MF5A 3AVGA 4HKQA 3GYNA 1QHTA 2R2RA 5DGBA 3RTVA 4O4RA 1RAJA 3PV8A 3OYKA 4J9NA 1BL3A 1Q8IA 4Y1CA 4IR1A 4I2PA 5KRTA 1U47A 3DLKA 4AHRA 3CYMA 4G1QB 4DSLA 5FRMA 1JLGB 2Z1JA 3O3FA 4FJMA 4U6PA 1VSKA 4QWEA 1U09A 2JC1A 1U49A 2QKBA 2VG7A 4IDKB 4CK2A 4RW9B 4EEYA 1SV5A 4KTQA 1EXQA 1S6QB 3OYDA 3NFAA 4FJ7A 4KHQA 2P51A 3SI6A 1JLEB 2GC8A 2G8HA 3PR4A 2E6MA 3MECA 1ITGA 2EX3A 1VSLA 4KTZA 2X74A 1RNHA 1REVB 4FJLA 4IFVA 4URQU 4M3RA 4CEQA 3CJ3A 4NYFA 3S3NA 3DM2A 2IM2A 4RW4B 1BI4A 1QSLA 3TABA 2G8FA 4M94A 4JS4A 3QEWA 3QIPA 3LP0A 3QEXA 1XWLA 4NLRA 3LAMA 1C0UA 3VQBA 4BDZA 1C1CB 4Z4CA 4DSJA 2HAIA 2UVRA 3LZIA 1C0MA 4WFXA 1LV5A 3QERA 2WONB 4KREA 4MKAA 4OKEA 2HMIA 3DRPB 5KT4A 5KFWA 1VSFA 4O3SA 1GOCA 2FVQA 1W9HA 3VQEA 5C5JA 4RW4A 1BI4B 3CJ5A 4KSEB 5KFNA 2J6SA 4MIBA 1ZBLA 3OYGA 3SQ2A 3AVBA 2ZD1A 1EETA 4URGA 4N56A 1DLOB 4PQUB 3V9ZA 1JLFA 2UVWA 2ASLA 2D0CA 3OS1A 1LWCA 5KFDA 1T3NA 5CYMB 5KI6A 5KFEA 4RW9A 4DL7A 5D3GB 3GIIA 3TWHA 5KFQA 5FROA 2QE5A 2W9CA 2HVHA 4LQ9A 1Z26A 5JS1A 4H4MA 2F96A 4F4XA 4ZTJA 2BE2B 3DLKB 3OSPA 2RF2B 3VQDA 4CHPA 4I7FB 2VWKA 3KLVA 4BACA 4CK1A 1TV6A 3BQ0A 3PY8A 4R5PB 3AO4A 1ASUA 4M3YA 3OYCA 3NBPA 4KTWA 4W5QA 4J2DA 5HLFB 2VG7B 1N4LA 3C6UB 5KFGA 1A5WA 4W5RA 3HM9A 1HPZA 3D28A 4Q0BA 3KMQA 1G15A 3L2QA 1WSFA 4DQRA 3IG1B 2FLNA 3CFPA 2ZD1B 4AH9A 4HTUA 3G6XA 1IKYB 3TQ1A 3FSIA 1TK5A 1KLMB 2NUBA 2R8IA 1IKXB 3PW0A 1LWCB 1JL1A 2W8LA 1LAWA 2FLPA 1NK4A 1S0OA 4ELUA 5JXSA 3PR5B 1JL2A 2VG5A 3TI0A 3JSMB 2WB4A 2J6UA 4NRTA 4PWDB 2YNFA 2E6LA 3GV5B 4FW2A 3AA3A 4CJUA 3LAKA 4E7IA 3LP0B 1KFDA 4CERA 4F2RA 4Q5VA 2BRKA 3DMJA 5J2MA 1KLNA 5FRNA 3AO3A 3I0RB 2ZQBA 1YT3A 2QKKA 3KJVB 1CXQA 3LWLA 3O3GA 2HHSA 4RNFA 1WSEA 4CJ5A 5F8JA 2KQ2A 4IRKA 4BDYA 3CVKA 5DG8A 1N48A 2Z1IA 3ULDA 5K14B 3BQ2A 2X78A 3QLHA 2FVRA 2IC3A 4NLVA 2ZKUA 3WNFA 1LW2B 4XPCA 3MR3A 2F8SA 3OLBA 4ECUA 1RTHA 1BQMA 1TAUA 3K5NA 4R8UA 1RDAA 3QEVA 2HHWA 1QE1B 3ZSQA 3HPGA 1NNDA 2E9RX 4QWDA 1T05B 1U04A 4LD0A 4M3UA 1OS5A 4ZVFA 4O3PA 3RB3A 4WZMA 3SNNA 4J9OA 1WAFA 4FZXC 4RW7A 4DFPA 4H54A 4IH5A 1EETB 3HK2A 1C2PA 5HROB 3PX0A 1S9EB 4MFBB 1D9FA 3PX6A 3U3YA 2IBKA 4H4OA 4IH7A 4IRDA 1LWEB 5CY4A 5DG7A 4FZZA 2D3UA 3KK1B 3EPGA 4ED8A 4TY8A 4CF1A 1XI1A 2G8KA 1QAJA 4B9LA 4GMJB 1NJYA 3GIJA 3DRSA 5EWGA 4FM0A 2W9AA 4CHYA 2XY8A 2B6AB 3C6TB 3MFHA 1QUVA 4CEBA 3QGHA 1JLAA 3E51A 3ZCMA 1LWFB 3VQQA 1N5YA 1HYVA 4DTSA 4FJJA 3S9HA 2HHVA 3V81B 3FQKA 1R0AA 3RMAA 3OYMA 1NHUA 2WOMA 3S3OA 3AVJA 3L3UA 3K58A 4ZP8A 5HBMA 3IRXB 1FK9B 4O3NA 5HLFA 3DYAA 3DLGA 1RT5A 4W5OA 3QETA 4G1QA 4DU4A 4PUOB 1RT2A 4DQQA 4TSXA 2X6SA 3VQAA 1IKVB 1S1XB 1S1TB 3DOKA 2R8JA 1NK8A 2DFHA 5KG6A 4Q8EA 4C8MA 2YNIA 5KG3A 2YHAA 1A5XA 3PJXA 5D3GA 2W8KA 1RT1A 4CIFA 4EO8A 4CGIA 2WRMA 3SI8A 3HP6A 3V9SA 2YNGA 4JS5A 3PHEA 4NLPA 4W5TA 2O4IA 2D0BA 4FLYA 3KOAA 3BSOA 4TYBA 4OLAA 4KFBB 4NLDA 5HRRA 4CEOA 4MQ3A 4CJVA 2XCPA 1HQUB 2ZE2A 2AX1A 4CEDA 3I0RA 5C25A 3G6VA 4AHCA 4DTPA 3KLGB 3MEDB 1T8EA 3FDSA 4QW9A 4FLWA 1TK0A 4ED1A 1RYSA 4F4WA 2YNFB 4K4VA 1C1CA 5KFFA 5SZTA 2B4JA 1K1QA 5EU7A 3HKWA 3BGRB 4ECYA 4CF2A 3RB0A 1SKWA 3LZJA 1RTIA 2HNYA 4E7HA 3FFIB 5KT7A 2HWIA 1WSHA 3V6DA 2ITGA 1Z25A 4KPYA 2PYJA 1KHVA 4IG3A 1HPZB 3IGVA 5DLGA 4Q0BB 2GUIA 4CGGA 4E0DA 1TL1B 2AJQA 4KHMA 3H59A 2R2UA 2A1RA 1IM4A 1ZBIA 3KTQA 3CO9A 5EUHA 1S10A 3SJJA 4M3ZA 2V4RA 1ASVA 4IKAA 4R8UB 3BR9A 2W9CB 1HARA 5C42B 4Z0UA 3KHRA 4NLYA 3DLEA 3QNOA 1DTQA 1S1UA 3MEEA 1HJRA 2FBTA 3AVIA 3LANA 2UUTA 2WHOA 3H2LA 3M9MB 3K57A 2D41A 2ATQA 2D3ZA 4PQUA 1D0EA 3KKRA 3RR7A 2R7YA 3BDPA 1JLEA 2XGPA 3JYTB 4AHUA 1KFSA 4FS2A 1HNVA 2OPQB 3Q8QB 4ZMMA 3DI6B 3TARA 4B9SA 3OLAA 1B92A 3QEIA 3SQ1A 1RA7A 2GV9A 2V9WA 5J2NB 5HP1A 3IS9A 3I5CA 1WAJA 4JRQA 3N6LA 1TL3B 1JIHA 1JLBB 5I42B 2I5JB 2IM0A 4YFUA 4ECRA 1S6PB 5KG1A 4QCLA 3RAQA 4YQWA 4FJXA 1IH7A 4O4GA 4MKBA 2HNDA 1RT6B 2XI2A 3H08A 3VQPA 2RKIA 1HMVA 2CJQA 4HYKA 1ZTTA 3ZSYA 2KFZA 4IFYB 4WXOA 3QIDA 4B3OB 3RMBA 5KFYA 4TQRA 4CFBA 3HT3A 4DSKA 4FJ8A 4K4WA 1TP7A 4WZQA 3NKYA 3VQ8A 3KIOA 4NLQA 1VRTA 3PX4A 3GILA 2JC0A 1S5JA 3AVHA 3KHLA 1ZBUA 1RT6A 4C8NA 2YKMA 3SQ4A 4NCGB 2KW4A 2AWZA 3TVKA 3DOLA 3SQ0A 3OJSA 5EDWA 3AVNA 4PY5A 4Q44A 4RU9A 4RUAA 2OYQA 4FLTA 3V4IA 3KLEA 1B9DA 4N41A 3RR8A 3MEGA 5CYQB 2IM1A 4DSEA 3OYJA 4NLOA 2DFEA 4NRUA 2YHBA 4Q45A 5KG4A 2P1JA 4H4OB 2OPQA 4DS5A 3I8DA 5J1EB 4MK9A 2BQUA 4DTUA 3C94A 5KFJA 5KFMA 1RBVA 3NH0A 3IGNA 4CGHA 1RT3B 1L5UA 5KFLA 4EP5A 3KLHA 3L2UA 4PWDA 4MH8A 3L3VA 1TL3A 2F8EX 3MXMA 1C0UB 3KK2A 3HVWA 4ZVGA 3M8QA 1C1BA 4NCGA 4J2AA 3N6MA 4DQPA 4O5BA 3PW4A 1X9SA 4O0IA 3L2WA 1YVUA 4J9KA 2KZZA 4ZPCA 1BGXT 5CZ1A 3KD1E 4JV2A 3AVFA 3EZUA 1D1UA 3S3MA 4Z4FA 3VQSA 5KFKA 4M95A 4TLRA 2FJXA 4DF8A 3MTKA 3H5UA 1J9AA 4JV1A 1NJXA 4YNQA 4RW7B 1TKTB 3LPUA 1T03B 1LW0A 5KFAA 1D9DA 3AVKA 3HVTA 3ISNC 4CJ4A 5SWMA 3TAPA 1HQEA 2FBVA 3P83D 3QO9A 2Q3SA 3WNGA 4HUEA 4C8OA 3EYZA 1T94A 1BQMB 3OYFA 3TAMB 3V1QA 1TKZA 4GVMA 2XCAA 3M8QB 4J9MA 4W5NA 3CJ2A 4KO0B 1NOYA 2B6AA 4FLUA 1RT4B 3ZSXA 4KB0A 5L9XA 4ZP6A 1L3UA 3GV8B 5C24B 5KFUA 3F9KA 4CFCA 3NGIA 2FVPA 1DTTB 4GC6A 4DLGA 4DU1A 1RDDA 2ASJA 4DL2A 1SUQA 3QYYA 1CSJA 1J53A 1S9EA 2IAJB 4MFBA 1S9FA 3CJ0A 4CF0A 3DLHA 5DG9A 4BDPA 2UVVA 3I5BA 3ZT4A 5KFZA 1JX4A 3SFGA 4F4ZA 4RNOA 3K5OA 2QK9A 3CG7A 1I39A 5J2PA 2IA6A 1RTJB 2AU0A 1RBRA 2FBXA 4ZVHA 3FQLA 3M8PA 4WE1B 4OPJA 1A5VA 3AO2A 4I2QA 2HWHA 1NK5A 1UA1A 3KKSA 2JGUA 3DLEB 4ZPDA 3ZSOA 4QW8A 4ECSA 3HP9A 1RT1B 5L1JA 3OYHA 3VA3A 1IKYA 3EPIA 4CK3A 3H98A 1JLQB 4IG0A 1I6JA 3P1GA 4DTJA 4F50A 4DL3A 3LP3A 4LH4A 5HBMB 4HCBA 4E7JA 4CJTA 4Q8FA 2P5GA 1GX5A 3H5XA 3DLGB 1S4FA 5L1KA 3OYNA 4F4KA 2YNIB 3GIKA 2G8VA 2C2EA 2JLEA 2YNHB 1LWFA 3SPZA 1LW2A 2DPIA 4RUCA 5KFHA 2E4LA 4K4XA 4YR3A 4XO0A 1VSIA 3L2VA 4ZPAA 3HL8A 5I42A 4HUFA 4CFAA 4IQXA 2YKNB 2VG5B 1KVAA 2WTFA 3Q8RB 1JLFB 5DGAA 3NAEA 3RMDA 2RDIA 1N6QA 1S9GA 4B08A 3IAYA 4J9QA 4MK8A 1ZETA 4ID5A 4M45A 1HNVB 1LW0B 3OVNA 4FJGA 4J2EA 1HQEB 2UVUA 1FKPB 2JEFA 4CIGA 5HRPA 3BJYA 1XR5A 1S1WB 4ED6A 3LP2B 3A2FA 1HYSB 2YKNA 1U48A 1QTMA 4Y34A 4YMEA 4CEEA 3DMJB 4QOZB 4N47A 1NKEA 3PW2A 4B9NA 4BE1A 4FK0A 3QIPB 4H4MB 4ZPBA 4CF8A 4ID5B 1QQCA 4TXSA 2KTQA 4IG0B 2C2RA 5FDLA 3HVRA 3NAIA 3D0PA 5KFSA 1HQUA 2ZE2B 2OPRB 3RB4A 2FC0A 4F2SA 2HVIA 4U7CA 4B9UA 1K1SA 4KBIA 4LY7A 2A1SA 3H5SA 4HHTA 2HB5A 1JKHA 3D5MA 1LWEA 2R2SA 2AGQA 2IGIA 1FK9A 2RN2A 5KG7A 4CECA 3V1OA 2W7OA 1Q9YA 3CFOA 3RMCA 2OPSB 3SUPA 3H40A 1YVFA 2R8HA 4AHSA 3QEPA 1NKCA 2BR0A 4ZP9A 2R8GA 1RCHA 3O4NA 1TKTA 1T03A 3ITHB 1S1VA 3SCXA 4CE9A 1SH0A 3AO5A 4WE1A 4Z4GA 1BQNA 2VA3A 4CCHA 2OZSA 1HMVB 4J9LA 1YTUA 4K8XA 3MEGB 5CYQA 4NLUA 4ECQA 4AHTA 3IRXA 4E3SA 5KFTA 4I2QB 1D8YA 4NCBA 3QLHB 4NYNA 3C95A 4CHQA 4ZTFA 3ZSZA 4NLWA 2XC9A 4FBUA 4BWMA 2X6NA 4Q43A 4ECZA 4B8AB 1TK8A 1ZYQA 4ICLB 1JXLA 3HPHA 1SUQB 5KRSA 2HNZA 4KAIA 3RRGA 4RG8A 4IKFA 1FKOB 1UAXA 3PZPA 2RPIA 3UIQA 3NE6A 4FS1A 4Y2CA 2PZSA 4DFMA 4C8LA 5KG2A 4EBCA 3LWMA 4FLVA 3PO5A 5F9LA 1KCFA 1BCOA 3PVXA 3M8PB 4CJLA 4N76A 3DOLB 1WNEA 5K14A 1RT5B 1ZTWA 2F8TA 4KB7A 2HNZB 1WSJA 4RW6B 4JV0A 1ZBFA 1KLMA 3M9NB 4E1NA 1VRTB 4OL8A 3NAHA 1FKOA 4FLZA 1T7PA 4WFYA 4CJSA 4ZVEA 4LQ3A 4NLSA 4NYZA 3HXMA 3BSAA 4OKJA 3AA2A 2IDOA 1VRUA 1KTQA 2Z1GA 1UA0A 4IDKA 3SV3A 4QWBA 5T14A 2HHQA 3AA5X 1I3AA 4B8CA 4DL6A 4MK7A 3G0ZA 2IJNA 3VQ9A 4E7KA 1IKWA 4H8KA 3KD5E 3HJFA 4GC7A 2W9BA 5CYMA 4KRFA 2R8KA 1S97A 4EYHB 2D5RA 3RWUA 2IMWP 4EBDA 4CGJA 3NGDA 2V0NA 4Z4IA 1O1WA 4WXWA 4WYLA 3AA4A 2G8IA 4K4TA 2IOCA 3V1RA 5DQIA 4MIAA 3IG1A 3L2RA 2XGQA 3OYIA 4ZP7A 3DDKA 3OJUA 4M41A 3Q8PB 1KVCA 3ISND 3K2PA 2FBYA 1ASWA 4DQSA 4CESA 1L3TA 2VWJA 1L3SA 5KFVA 5L1IA 5DQGA 2XY5A 3FFIA 3T3FA 1TKXA 3NMAA 1QE1A 1QS4A 1N6QB 1RDCA 2XO7A 3V6KA 3SUNA 4RNMA 2IC3B 3G86A 4I7FA 1U45A 1RTIB 2AGPA 3BREA 4ELTA 3V9WA 3OYBA 3BSNA 3MR5A 4IFVB 4ED2A 2UUWA 4E1MA 4DEZA 3OYEA 4K4SA 3D45A 4KKOA 5J2QA 4IG3B 1RDBA 4DFKA 1IKXA 1TVRA 1UOCA 4FJHA 1X9MA 1D5AA 1RBSA 3LPTA 1X9WA 5KGWA 4Y2AA 3TANA 4FJNA 1JXBA 1S6QA 2WONA 5KG5A 3ITHA 3MFIA 4M42A 3VQCA 3CJ4A 1JKHB 4ECWA 2E9TA 3DRRA 5F9NA 4ECVA 4DTMA 2AQ4A 5HRNA 4FW1A 3K5LA 3KHGA 2OH2A 2QV6A 4CJPA 3V4IB 4RZRA 4QAGA 4YP3A 3MEDA 4NLXA 3I0SB 1NJZA 5KFBA 2YNGB 5F8IA 1C0TB 3F73A 2B5JB 5F8MA 3NF8A 1RYRA 1C6VA 3KMSA 3ZSWA 5KFRA 3OSNA 1REVA 3OL6A 1EP4A 4DTNA 3H5YA 4CHOA 4X2BA 4K4UA 3EZ5A 3DI6A 1TGOA 1IKVA 1S1XA 3AV9A 3KLIA 3HHKA 3M9OB 4O3RA 3SYZA 2AX0A 3IN5A 4NLTA 3ZSVA 4E7LA 4NZ0A 4DL4A 3V6DB 5C42A 3KLIB 2V4QA 1VSDA 2DY4A 5FDLB 2HNYB 5KFIA 2C28A 1S1UB 3MEEB 2XWYA 3NH2A 2OPPA 1S6PA 2OPRA 1JLCB 3U3GA 2Y1IA 1S48A 4LSNB 5DK5A 3AVAA 3NGYA 3CQ8A 4F4YA 1NK6A 3PO4A 4HVJA 1S0NA 4M3XA 1KHWA 3EY1A 5F8GA 3VQ7A 3ALYA 4O55A 1RT2B 4RW8B 3E01B 4Z4EA 4IH6A 3DM2B 3HYFA 2IM3A 3DYAB 5F8NA 2FJWA 4B9MA 1C1AA 2OPPB 4CHZA 3SPYA 2BGGA 5I3UA 4DL5A 1NK9A 3TAMA 4FLXA 4F3TA 4DSFA 2WOMB 1VK0A 3KHHA 4KAZA 4O0JA 1T05A 4I9LA 3NHGA 1N5YB 2BRLA 1S9GB 3PW7A 2W9BB 4GW6A 3GQCA 2WCXA 1L3VA 5C24A 3GIMA 4IBNA 4O44A 1W25A 4DFJA 3CIZA 4QPXA 4ED3A 1MU2A 2EC0A 2EHGA 2OA8A 4EZ6A 4HUGA 3I5AA 5KTQA 4EBEA 4O3QA 5KFOA 3T5LA 1NK0A 4IR9A 1VRUB 3AVMA 2YNHA 2YKMB 1S1VB 3VN5A 4JRPA 4TQSA 4PUOA 1K6YA 1BIZA 2W7PA 2HHUA 4R5PA 1TVRB 4DTRA 4ED7A 1R0AB 1RT7A 3LALA 4KHYA 4G3IA 4JLHA 4FK2A 3TAGA 4KHWA 1JXEA 5J2MB 3ZT0A 2BQ3A 2PYLA 2CKWA 2DTUA 4DG1B 4Y3CA 4FYDA 2XHBA 3KJVA 5DLFA 1RDRA 3C6TA 3WNHA 3DRRB 4CJFA 2ALZA 4XPEA 2E9ZA 4O4GB 4KV8A 2FVCA 2J6TA 4UQGA 4RW8A 4ECXA 1CXUA 4FM2A 4DQIA 2WK4A 4K4ZA 2DFFA 2G8UA 4ECTA 5HRSA 3NGZA 2D7SA 3ZSRA 4DF4A 2OZMA 3NDKA 3B6PA 3CWJA 2FJVA 1NKBA 3NF7A 2IAJA 1NHVA 1TQLA 1SKSA 4E19A 1SL1A 2ILYA 1RT7B 1EKEA 1CZBA 4OGEA 1TKXB 3QESA 1TV6B 1Z4UA 4OKKA 4FM1A 3UQSA 3HO1A 3DLBA 3K5MA 4KKOB 5J2QB 4KHSA 4CJKA 3C6UA 1BHLA 1RT4A 2PY5A 1S0MA 5KT2A 3MR6A 2ATLA 3NF6A 2XY7A 4BE0A 3TAQA 3OY9A 1JLCA 5KG0A 1VSEA 4E89A 3KK2B 1VSHA 3I0SA 5J2PB 1WN7A 4AILC 3HVTB 2P5OA 5F8HA 1HYZA 5J1EA 3T19A 2YV0X 3B6OA 2I1RA 4EO6A 1SKRA 3VA0A 3CM5A 4EZ9A 4RNNA 3KK3B 1WSGA 1J5OA 1X1PA 2JEGA 4DMNA 3CDEA 4IFYA 2D0AA 3V81A 4WYWA 4K4YA 2LSNA 1RTHB 3UDLA 1NOZA 3ZT2A 5HROA 3NBPB 4EP4A 3KK3A 3MXIA 3RRHA 4KB1A 3SFUA 1SL2A 5KT6A 1GOBA 2Z1HA 1RA6A 4CEAA 3LP1A 3THVA 4KHUA 3AVLA 4O3OA 2HNDB 1WSIA 4DLEA 3KNAA 3NCIA 2AGOA 1DLOA 2HW3A 1RTJA 3SV4A 4CJRA 1YTAA 2BQRA 2DPJA 3AVCA 2C2DA 1XHZA 4BE2A 1J54A 1TL1A 4M3WA 4CEZA 3M8RA 1FXXA 3O4QA 4FXDA 1VSMA 3PJWA 4CGDA 4QWAA 3T5JA 1LAVA 3QIOA 3KLEB 3RBEA 5CZ2A 1W0HA 3QO9B 3ZT1A 2C22A 1KVBA 3JSMA 5KFPA 4C8KA 4PA1A 3G6YA 4JUZA 1Y97A 3QINA 2BE2A 1B9FA 2HMIB 2W42A 2O5DA 1QSSA 2RKIB 1CZ9A 1SL0A 4ED0A 3UR0A 3LP1B 4B3OA 1DTQB 4LSNA 4KI6A 2O4GA 2G8WA 1IO2A 4DTXA 2ETJA 4ZHRB 3P5JA 3OHBA 4YR0A 3NH1A 5F8LA 4OPKA 3MAQA 2JEJA 4OJRA 1BISA 4CGFA 1UWBA 3KLFB 4R0EA 4OVLA 1C1BB 1KRPA 3OHAA 3HVAA 1KSPA 1JLBA 2VA2A 4L8RB 1SV5B 1HYSA 5KFXA 5J2NA 5HP1B 2GIQA 3MXJA 2BDPA 3CDUA 1TKDA 3DRPA 4K50A 4FJKA 1HNIB 4IRCA 4J9SA 1SH3A
chains in the Genus database with same CATH superfamily
5AZIA 1FRJA 4ATNA 1MMLA 1QAIA 1NK7A 1V3SA 3AT1B 2JEIA 4DTOA 3LGHA 2FF6A 2OPSA 4OYBA 1CEZA 3CC2S 4DSIA 1VISA 2LEAA 4RW6A 1MNEA 4CJWA 4F3OA 4NOHA 1CQNA 3OS0A 4IO8A 3WIVA 1BOTO 3HSTB 2GIRA 3WIUA 4F8RA 5E7OB 3CE8A 4DG1A 5DQHA 3KK1A 4PWUA 1ROFA 1FXLA 2ZZTA 2XI3A 3T6BA 3VQ4A 2EFGA 1F21A 1TAQA 2DJWA 3VEWA 3OL7A 4NLGA 2RDJA 1V5VA 2HYIB 1R6VA 4RWWA 1Q0NA 2M0GB 4X62J 5A2QY 3ICLA 3DLRA 3B8AX 4AL5A 2BZ2A 5LMUF 2MMYA 2K2PA 2ILZA 2QMUB 5AXLA 4DZ6A 3H4BA 2VCPA 4X65J 4TN2A 1HX1A 5D0HA 2ZBIA 3MOJB 1SJRA 4LVNP 4Y0WA 1WC1A 3QBWA 4PG5A 1NJWA 3PLAA 3W64A 2XRIA 4ZN1A 3BGRA 2ZFHA 2IIHA 3IS9B 2D74B 3ZTOA 2EBGA 2V8HA 5I3UB 1HA1A 1QAXA 1UVNA 4PG6A 2B43A 3OL8A 3R7BB 1QSYA 2R7XA 2CDRB 3CD6N 2HZAA 5EX0A 1FVQA 2WBMA 3HTVA 2G0CA 4BR7A 1RWVB 2GBZA 3KG4A 5HVGA 2LQJA 3CC7S 4B9VA 3GR1A 3HPOA 2F40A 2NLWA 4IOCQ 3O3HA 2NPFA 4CTAB 2OP5A 2BANB 4TY8B 4KBOA 4CBXA 2KXHA 3TJAA 3W5ZA 2X51A 5GMEA 1F6TA 2P9CA 1SCJB 4DV1J 4LSLB 4FJ5A 3SUQA 2NRZA 4JI1J 3C15A 2AYMA 4FPBA 4FCYA 3CCSN 3RBDA 1U2VB 3BGFA 1BCMA 2EFVA 4IO9Q 3EZOA 3QNNA 2N82B 4OGCA 4CEFA 1B4SA 2G13A 1OSDA 2GIFA 5J1NA 1YG0A 2HHTA 1MU2B 2PDAA 3A13A 3TR8A 2J8SA 1AROP 2A1BA 2EFPA 4D3GA 3D1OA 2KHCA 1K8KA 3WT0A 5AQRA 4JI0K 3UE2A 3OFFA 2I5JA 3CMES 2P9KB 4CNYA 3EN9A 3F5TA 1NG9A 1BQNB 4NCAA 1S1WA 3CJQA 4FNHA 4KI4A 1WC6A 2IS3A 1TYQA 2A3JA 2DGUA 7FDRA 2IBOA 2HRTA 3PSIA 1N52B 1U4BA 5DM6L 4EGLA 1GLFO 5DDQC 2EG1A 3TTDA 4CJEA 1N56A 3N5BA 4KO0A 5L1LA 2Q66A 4KHRA 4I64A 3GYNA 4M5HA 4A8YA 5DGBA 4USIA 2Z57B 3NNHA 4OX6A 4J9NA 4DN9A 2FC9A 2EWSA 1FXDA 4DV1K 1GMVA 4JI5F 4YS2A 3O6WA 1U47A 4ZN3A 1RQ0A 1HR0F 1ACMB 2HQIA 5GAGU 1F3FA 3DXMA 1U49A 2DNRA 5F3TA 2VWBA 4ISEA 3ENHA 4CM0A 4EEYA 4DPTA 1X5SA 1FXRA 4H0XB 2P51A 1U25A 3DXKA 3ZETA 3D2FA 2G8HA 3OBYA 5A2QU 3M6UA 2X74A 1HBUB 2HZVA 3CJ3A 4JI3J 4ZLJA 4PXDA 3VVTA 2DYAA 4LT6A 3K7RA 2AYGA 3DCAA 3QEXA 1XWLA 3MCPA 4RWXA 4NLRA 2V8DA 2E7XA 1C0UA 3CO0P 1C1CB 3GSDA 4DSJA 3SMSA 4BRHA 1K9MT 2UVRA 4BC9A 3R9LA 3LZIA 4HT7A 1C0MA 1LV5A 3AGKA 2DRBA 3QERA 3AOCA 3DRPB 2UUAF 3UNYA 2AEFA 1VSFA 4O3SA 1W9HA 1S99A 5C5JA 3W62A 5KFNA 1WOPA 3OYGA 2VL1A 2C3OA 4GVBA 4IZ9A 3O08A 1F1BB 1X5OA 4XEIA 2CQ1A 3DKDA 4A5AA 2XSJA 4CRJA 4ETZA 4J37A 4LF5F 5CYMB 5KI6A 5KFEA 1MN9A 4I68A 4NMXA 1FRXA 4OZ5A 4NXMF 3TWHA 1FX2A 5KFQA 3DXMB 1HLWA 2HVHA 1IBMK 3CC7N 3W2WB 4ZTJA 2BE2B 1ZBTA 3GZ7A 5AZIB 3D6FB 3LTOA 4BACA 1I3OB 1SZ2A 4BG8A 4W5QA 2GZOA 1OH8A 4HHJA 3C6UB 2P8IA 1A5WA 1HPZA 2J9DE 4Q0BA 3KMQA 1RU2A 2KT5A 4IDHA 2ZD1B 4KR0B 4HTUA 3G6XA 3VQTA 1IKYB 4A8WA 4IOXA 1ZAWA 1KLMB 4CDIA 3E3XA 2R8IA 1WC3A 5ETOA 1S0OA 3VEYA 1AT1B 5BR8J 2WB4A 3TUIC 2ABYA 4E7IA 5JJBA 4Q5VA 1KLNA 5FRNA 2YBVA 2ZGZA 1N36F 1JXVA 4YHHJ 3J7YP 4AM7A 1YT3A 1GLDG 3SDEA 5CR4A 1CXQA 4LBHA 3LPEA 1J6ZA 4L74A 3O3GA 3NOCA 4RNFA 2MLYA 3GB0A 4IRKA 1WHXA 4BR9A 1KD1O 1HD0A 4PKIA 5K14B 3AAWB 1KC8T 3ET6B 4DR6J 3UN3A 4I6AA 2MQLA 1SC3B 3GSIA 1F2GA 4XPCA 2ZWHA 1UVIA 3H3NO 4R8UA 4KH4A 3ZSQA 1HWIA 1T05B 1M1KO 4O3PA 3SNNA 2UU9K 4FZXC 2MKIA 4DFPA 4DR2J 1C2PA 5ETSA 2UUBF 4MFBB 2OJ3A 3SSSA 4KT0C 4PXBA 2IBKA 2B4PA 4CLLA 1PAUB 3AOAA 2QMWA 2HBZB 1VQ9S 4TY8A 3Q2SC 2WBNA 1QAJA 2DXFA 1NJYA 1YJ9N 5JMVA 1U6BA 3ZFVA 5FLXU 2W9AA 2XY8A 1RWNB 4AL7A 1IN0A 2CGLA 1NDCA 2H65B 3THYB 3W60A 4CEBA 2GHVC 1RHUB 3E51A 1DARA 1N5YA 1P8GA 3V81B 5I3QA 2X1AA 3FQKA 1ZXOA 2LU2A 2E88A 4DR1F 3OFEA 4DV6J 1NHUA 4CT9A 1YJRA 7FD1A 3S3OA 2NXUA 1KC8O 1VK3A 1ZBSA 1KS2A 2KT3A 5BJRA 3IRXB 3HZEA 4GKJF 4A8OA 4O3NA 5HLFA 3C7NA 3UCUP 1V5IB 4P73A 4W5OA 3O1BA 2POKA 4DQQA 1OY8A 3DOKA 1NK8A 1FE0A 2VBWA 5K5MA 4Q8EA 1N8RO 2HQCA 4ILHA 2VKRA 2W8KA 3VAIA 1RT1A 1UPMB 2MGZA 4CIFA 3HP6A 2V2VA 2DR8A 4JS5A 4CLFA 1SKUB 3QWUA 1DEJA 4OJGA 4OLAA 5HRRA 4QYZJ 2BOAA 3O4WA 1NMDA 2XCPA 2VUGA 2LEBA 1RDWX 4DV2F 2QIFA 3QT8A 3MEDB 3FCWA 2AJ0A 4FLWA 4DV4J 4ED1A 2N3OA 2HBJA 4F4WA 3AQPA 3CCJS 5SZTA 2VC1A 1IJJA 3AB2B 3AQOA 3HKWA 3DRXA 2JLFA 5HJYA 1SKWA 5T41A 3Q7CA 9ATCB 1APSA 5A8WB 2EWHA 2MTLA 3C6HA 1R59O 4JV5F 1RCXB 1R31A 1CULB 5C7PA 2A40A 1SJFA 2E29A 3EGZA 5ADZA 1VHIA 3EVOA 4LF4J 3IGVA 1TL1B 5HVHA 3GYGA 2A1RA 2MQQA 5FLXY 2RHSB 1IM4A 3PYEA 3CIPA 1ZBIA 5AZJA 5EUHA 1S10A 4BGAA 2YKAA 4B02A 4LF6F 1ASVA 2B56A 1BLUA 4R8UB 1VQNN 2IIRA 4DR1J 3KHRA 1IJFB 3MMVA 4NLYA 4CZFA 4FF4A 3DLEA 2ASOA 4U67Q 5KAKA 3BN7A 2JWKA 4BRMA 5HANA 3H2LA 1FRMA 1YRUA 4JNEA 4FWKA 2HS0A 3BDPA 1HR0J 1P8ZA 4LF9K 2PEBA 4ZMMA 3TARA 3SQ1A 4C8ZA 1R0CB 1FCAA 2V9WA 5HMXA 3EVMA 4JN4A 3OTCA 2GMLA 1WAJA 1IQTA 3N6LA 2OTJN 5LMNK 1JLBB 3G8SA 2IM0A 2ZC4A 5E33A 3KJQB 2F4VK 2JZ5A 2JOQA 1RI7A 1S6PB 4I6WA 5KG1A 3RAQA 4FVUA 1P27B 4LRBA 3M6XA 3T1HK 3H08A 1HMVA 1U2RA 1ZTTA 1YK9A 2K1RA 4IJAA 4CWBA 3RMBA 2C2MB 4NMLA 5LJ5Y 1P9QC 3QICA 2CWXA 4K4WA 3X1LB 4G9ZA 3VF2A 3H1QA 2W41A 4NLQA 2D0PA 3PX4A 3GILA 3MN6A 2U2FA 3J7A1 5DDOC 1RT6A 3D2WA 3PXGa 2YKMA 2OHDA 5CH7B 4NCGB 2AWZA 2HS3A 4DX5A 3F44A 4JEPA 2LQ9A 4Q44A 2QC3A 4RU9A 3C7NB 1O51A 4ILJA 4WFBL 2QI2A 5CYQB 2IM1A 4DSEA 4HL9A 4F9OA 3OBWA 1D3WA 4YOEA 3P5BP 3FGVA 4EI2A 2KDOA 4AL6A 2OPQA 3WUHA 3G2XA 3G8QA 4H4KC 2BQUA 4Z94A 5KFMA 2RQMA 1RBVA 4CJ7A 2HFZA 3MEKA 3NH0A 5KFLA 3J7ZO 1Y5LB 3QGPA 3KLHA 4AD6A 5GVQA 2BA9A 3CUNA 1C0UB 3HVWA 4ZVGA 1BA1A 2FQQB 1C1BA 3MCSA 1BQXA 4XK8C 5AQFA 5CXTA 4GVEA 5HK4A 3HOSA 4IEEA 5A8RB 4YY3F 1A0OB 2N7CA 1BGXT 3KD1E 3AVFA 3EZUA 3S3MA 1NDLA 4OIXA 4TLRA 2HK2A 3TSPA 3A3PB 3H5UA 5L38A 1J9AA 5L46A 2ZEJA 3BH6B 3UCZP 3EGNA 3LPUA 1T03B 1Y7PA 2VPZB 2QWLA 1LNQA 2FBVA 3VAJA 2Q3SA 3WNGA 1QVFM 4C8OA 5AQUA 3OYFA 2VASA 2P9UA 3V1QA 4K5SA 2A3ZA 4EAHD 1FA0A 3DHXA 3N4WA 5E2QA 3CJ2A 1Y11A 1VI7A 4FLUA 1N32F 3VZHA 5L9XA 3TJ9A 5E5NA 5KFUA 1Y5IB 1Q5VA 3U1NA 4EMDA 2D1CA 4GC6A 3I96A 4DU1A 3RW7A 3DDIA 1SUQA 3QYYA 3J7AN 1S9EA 1PC5A 2UUCJ 1S9FA 2CVEA 5B0AA 3K17A 4KH0B 3I5BA 3DFEA 3R3TA 4I67A 3ZT4A 4B1ZA 3PRVA 2AKWB 2ZBQA 4PG8A 1I39A 3ZZYA 2H9ZA 1K73O 2IA6A 4HVZA 1NLVA 4GV6A 2AU0A 1RWMB 1RBRA 2QL7B 3V5RA 4ANEA 1VMBA 3ISZA 2G2YA 3AO2A 3NS7B 2XEXA 1IWAA 3DLEB 1NGCA 1HR0K 1Q86O 4KHPF 2BACA 2D9PA 2MQNA 4CK3A 2Z2YB 5AJ3F 1I6JA 4F50A 3LGNA 1EQYA 2PAVA 5HJXA 2F7TA 4FPAA 4Q8FA 4IOAQ 4ZS6A 1GX5A 3H5XA 3L7UA 3P8BB 1F5CA 1HNZF 2YNIB 2G8VA 2C2EA 1FT8A 2YNHB 1EIYB 3UKUB 5KFHA 1DY3A 4ZPAA 4H4KA 3SAHA 1VJQA 3HL8A 2CG8A 3FC9A 5B09A 3QFWA 2VG5B 2B8PA 2DY1A 4BRQA 5CA5A 3RMDA 2RDIA 2HZCA 4B08A 1GMWD 4J9QA 4MK8A 4Y2IA 2L48A 3IR6B 2FB0A 2NNWA 1LW0B 4IO1A 2FTRA 4FJGA 2UVUA 4CIGA 5HATA 4MYTA 3C16A 4LBPA 1UFLA 3O9UA 2KVIA 2XG8A 3LP2B 2HSTA 1EX8A 3NNCA 5GMDA 1Z2LA 4Y34A 4YMEA 3UR3C 1VLYA 3DMJB 4N47A 1NKEA 5BRFA 1Y9OA 2XSFA 1YJWS 4BE1A 3WC0A 1F0XA 4CF8A 3OVBA 5LMNF 4IG0B 2EK1A 2NRRA 5FDLA 4V19X 2OCEA 3HVRA 2F4VF 3IR5B 3ZTQA 2E66A 2ZE2B 2KYZA 2OPRB 3MPVA 2FC0A 3J81Y 3HMJG 2A1SA 3AJ1A 3KJNB 4OYZA 2ZH8A 3D5MA 4Y28C 3OUYA 1FK9A 1H1VA 5AQVA 2UV8A 1Q9YA 5ADXH 3CFOA 2OPSB 3SUPA 2R8HA 1HKAA 1S76D 4AHSA 3P39A 1PJ6A 4FL9A 5BPLA 2R8GA 1NGGA 1RCHA 1T03A 4DPWA 4ES2A 4YOTA 3AO5A 3IBCB 2ZJRL 1XMQJ 4X65K 4KGMA 3RAMA 3W8GA 1OYDA 1IR2A 4NE9C 5E84A 4LF9J 3VEVA 3CCRN 1Y0HA 4CLWA 4OYWA 1U7LA 2MZSA 5C10A 3ZC4A 3SQOP 3E66A 3CPWM 3ZO7A 4ECQA 2Z0GA 4AHTA 5H1SQ 2CJBA 1O8BA 2W6KA 4PKGA 4ZTFA 3ZSZA 3FZBA 4FBUA 1N36K 2BUPA 4KGKA 1X60A 3BO2A 1B0VA 5B0BA 2HNZA 4L72B 2Y8YA 1OKJA 3RRGA 2P9KA 4DMZA 2DH7A 2DNLA 1IM6A 4I0WA 3JS6A 2Z8QA 3CCES 2RPIA 4DV5J 1GXTA 3FNNA 3UIQA 2YTCA 1VFJA 1WUAA 2QWQA 2OANA 1OQ6A 2PZSA 4DFMA 4C8LA 2QA4N 4FLVA 2V34A 3SCIE 2FHJA 3I32A 2BTFA 1ZTWA 1NZ8A 2CQGA 1WSJA 3GP9A 1OH5A 3P5TL 3CXCR 2Z2LA 4DR5K 4O23A 3BUZB 4FLZA 3A5MC 4WFYA 4NYZA 3H25A 1LK7A 3BSAA 3HXMA 4OKJA 2BEFA 2NZTA 1VRUA 2Z1GA 2GUPA 2MQMA 2VOPA 4IDKA 4QWBA 3AD8C 5JVHL 3TYTA 4JBCA 5LXRA 1M5KC 3UFCX 2OLWA 4PRFA 3CJ9A 4MK7A 3G0ZA 2IJNA 3VQ9A 3EZWA 4FWMA 3EKSA 3MM6A 4H8KA 2GELA 3Q89A 4CO4A 3WC2A 4KRFA 3FMBA 4EYHB 2D5RA 2ACMA 2IMWP 1V3ZA 1O1WA 4WYLA 2C2OB 4K4TA 2IOCA 1SC4B 3DDKA 1YAGA 3CF5L 3TVYA 2UYTA 1UEUA 2GWKA 1WBDA 2VWJA 1L3SA 3EGVA 2UXBK 3T3FA 1TKXA 3NMAA 3C14B 1QS4A 2UXDK 3M8WA 3GJSB 1XBWA 4ZVOB 1RDCA 2XO7A 4RNMA 1FHTA 2IC3B 5D4PA 2ZZMA 4ELTA 3CQXA 3V9WA 2AYBA 3OYBA 4IFVB 2W40A 3KUHA 4DEZA 3OYEA 4DUZF 4KHPK 2CA9A 1V6HA 5J2QA 4KC5A 2NZ4A 3Q7BA 1IKXA 2AIRB 2VHGA 1RWUA 4GKJJ 2E2NA 3M1FA 3PIPL 5K8NA 1P90A 2QJ3A 2WONA 4M42A 4DX6A 3TRGA 4JYAJ 2WVCA 3TA2A 4ECWA 4DTMA 3MM9A 1HKCA 2P9NB 5GAEP 1Q79A 3K5LA 4RZRA 4QAGA 3J7AP 4JI6J 3MEDA 2CGKA 5ETVA 1HPMA 1MA9B 3I0SB 4ERDA 5DDRC 1NJZA 5CD4A 5KFBA 2YNGB 3CCRS 2JFDA 2V8PA 1C0TB 3F73A 2QXLA 1Y3JA 5EX3A 2VODA 4DTNA 2LXIA 2DTJA 3H0PA 3IWNC 4YB6A 4P7VA 4RBVA 3SYZA 2DXDA 2AP6A 3CULA 2OFHX 1RACB 2XS2A 2LVWA 1WWHA 2E1MC 1DAXA 2ROEA 2V4QA 1WI6A 2FHOB 5FDLB 5KFIA 2C28A 1S1UB 2XWYA 3NH2A 2OPPA 2CRLA 3BGOP 4X4RA 4AM6A 2B9WA 4CO2A 2DNGA 5HQ8A 4LSNB 5DK5A 3AVAA 3NGYA 3BB5A 2XTJP 4DV5F 3GFYA 2QYGA 3MX5A 4EHUA 3H7HB 5EN1A 3HBTA 5F8GA 4USVA 1U1QA 2F1FA 4C3KA 2JWNA 4RTFD 3P4IA 3EVWA 1X8DA 2QWNA 3CJ1A 4B9MA 4CHZA 2BGGA 3DU6A 3O3LA 4CQ1A 3TAMA 4DSFA 2FGOA 4A48A 2QX0A 4OQJA 3R5GA 4TKTA 3NHGA 3VMFB 1CG2A 1N5YB 1S9GB 3HD1A 3MMBA 4H5WA 3VAKA 1HHTP 4ED3A 5A8WA 3QMQA 4EZ6A 4EBEA 3L95X 5KFOA 1W2BR 3T5LA 2NR0A 1URNA 3VF6A 2YNHA 2YKMB 1S1VB 1KAZA 1NGHA 4TQSA 1U1NA 4ANDA 4C0HA 2W7PA 4R5PA 2DR7A 1FKAF 1TVRB 2KO1A 1Z05A 1BA0A 2VICA 4BC5A 2A10A 1WEXA 5IV4A 2LQ8A 4QU7A 3MAAB 2XLIA 4Y3CA 2M5YA 1TL7B 3AJ2A 4NA2A 2NQPA 3C6TA 3WNHA 3BKUA 1B7FA 1O13A 4CJFA 1IBLJ 2HIQA 2YI1A 2E9ZA 1K0TA 3FZHA 4UQGA 1TUUA 4RW8A 3FZMA 3W63A 4IEIA 4ZVQB 4FM2A 3ZZUA 4ZLPA 2ADBA 3IWXA 4X64F 1YTYA 2IYGA 4ECTA 1S6OA 3W5XA 5JLHA 4DF4A 3HI0A 2GVDB 3B6PA 2RS8A 4FWSA 2WB1D 3M8ZA 3LH2S 4ENOA 1NKBA 2W01A 4KHPJ 3SK3A 1RKIA 2XYGB 5GADP 4E19A 4Z2XA 2ILYA 3BZCA 5F0UA 1EKEA 1CZBA 4OGEA 2DR9A 4RUBA 3R3LA 3N4QA 4B3SJ 2M8DB 4KKOB 4CJKA 5K20B 2V9KA 3MR6A 3A5OC 2UZAA 3TTCA 3NF6A 3MCMA 4LSZB 2XY7A 2PA8D 4BE0A 3QSIA 5KG0A 2FZKB 4E89A 1R27B 1AUSL 1MLAA 1HYZA 2WSEC 3T69A 3UD4P 1XTZA 2CFXA 2RILA 1LWXA 4WCEQ 3VA0A 1PO6A 3A0IX 2V2ZA 5E3AA 3DOMB 2V68A 4WYWA 2AJ2A 1NOZA 4FDFA 2HVDA 3CT9A 3KK3A 1VC6A 3MXIA 1YF5L 2DNMA 5DO2A 2DBBA 5HQLA 3THVA 4WCEL 2HNDB 4PG7A 2GFFA 1WOSA 2P2CB 3NCIA 2M9KA 1WG4A 1GAOA 4NYPA 4JKHA 3ZLJA 1YTAA 2MZRA 3CD7A 1QVGR 4PZVA 3BZQA 3JTNA 1XHZA 1VSMA 3VF4A 3NCPA 2ZH3A 4KY3A 5GAHP 1XJWB 2C22A 3UKRB 3U7JA 3TEHB 2R7TA 2RE2A 4PA1A 3G6YA 1Y97A 1RADB 3H8YA 5LM7E 2WC9A 2W42A 4M5GA 4ED0A 4DU8A 4H5TA 4B3OA 2P9IA 4KI6A 5IZHA 2GVZB 5M1NA 1PYSB 3AFGA 2BJ7A 4ZHRB 3V4MA 4CGFA 4WQ4A 1UWBA 1SJ3P 3KLFB 1K47A 1UW4A 1KQSM 3B78A 3IO1A 1SPBP 1KOHA 2BX6A 1ZM2A 4G1IA 3O80A 4MKVA 4L8RB 3J7YI 3MR7A 5KFXA 1RHQB 4JB8B 1X4AA 1FTCA 4OHYA 4YN3B 2BDPA 4FJKA 1HNIB 4YY3J 4GNIA 2NS1B 2G0JA 3NY0A 4UOCA 1XR7A 1C0TA 4P72A 2B0GA 4CZMA 2JHEA 2HGMA 1VLOA 5E3QA 2GNKA 4B3RF 1WACA 2J0WA 4JI0J 4ZJLA 1Z6RA 2GVDA 3SBMA 2R2TA 4NXMK 3D2EB 4RJVA 4I56A 5IT4A 3X3UA 5BYSA 1S49A 4WKYA 3RG6A 3GFHA 3N6NA 3HHEA 1SH2A 3FUYA 2R42A 4NXNK 4B9TA 3QGIA 1F9EB 1ZM9A 1IBKJ 3AO1A 1TFYA 5AT1B 2RF2A 2MQ8A 1DTTA 2R9LA 1MWMA 3FKBA 4KFBA 4ED5A 3RAXA 3CD0A 2KYXA 1ATNA 2ZITA 1JLQA 3MPWA 4AHVA 1VK8A 3CCVN 4URSA 2Q1LA 3E01A 1F2HA 4RWTA 4LJMA 3CNQP 2IRYA 1R8CA 5CD4H 4LR7A 4LH5A 2MKJA 1RBUA 2XSJB 2ZJQL 4FXVA 3Q8SB 4LSLA 2YCHA 2DH9A 1WNSA 5BPMA 1RGIA 2W4DA 2Z2MA 5E26A 5M1FA 2BANA 1JLAB 2M8HA 4CJ3A 3QGGA 3ZETB 4AE5A 3I56S 1CVJA 2V51B 2RDDA 3TQEA 5DMRA 5EWFA 2AYEA 4ILMA 1WKLA 1VC0A 1AUDA 2X3GA 4I9QA 1RTDA 3O44A 3DGVA 3N01A 3ZT3A 4DUZJ 3VENA 2ZUGA 3MUVP 3QPIA 1N5TA 1RWPB 2QXFA 1I5OB 4TY9A 3MECB 4DWIA 3MM8B 3D3CJ 2IRXA 3TUZC 1FJ7A 5DM7Q 5LL6d 3OHRA 2O8DB 3IBWA 4JYAF 2ZF5O 4HTIA 3SXLA 4Y1DA 3W9IA 1FKPA 3B4MA 2CJXB 2K1RB 4RNHA 1XC9A 4YR2A 3UDCA 3SZ2A 3PUFA 4LFCK 1XHXA 3FZLA 3AOBA 4F4AA 1SBRA 1U2CA 1B0PA 1S3XA 3WXJA 4CF9A 3BQ1A 5T7BA 4BWJA 1N5QA 1G3OA 1VQ9N 1RABB 4OJ3A 2FLLA 1TFWA 1ZBHA 3FBEA 4CLSA 3KDNA 1N88A 4FK4A 1ESVA 2H3EB 4CBWA 5GAGP 1TKZB 2EXUA 4DV3F 1ULRA 1S4EA 5EWEA 1UJ4A 4CIEA 4TYAA 4XIUA 2LA6A 3LDSA 2V4JA 4BRFA 4GKJK 4C97A 3CM6A 1WF1A 4DR7F 2HSEB 5F41A 4O4RA 2VQFK 3PV8A 3OYKA 4WP8A 1Q8IA 4Y1CA 3M7VA 5L9NA 1OSCA 2ZNZA 1RDUA 1HBNB 2NXCA 5FRMA 1JLGB 2O8EB 4FJMA 4U6PA 3P31A 3MDQA 2VG7A 2CQBA 2RS2A 3E1YA 4DB3A 2RB7A 4RW9B 1SV5A 1J5EF 1K73T 4KTQA 1EXQA 2XMTA 4QS9A 3NFAA 2C3UA 1F3VA 2GC8A 5FD1A 1ZC6A 1U2VA 2XZWA 1VQMS 3PR4A 2CPHA 2CG4A 1VSLA 1RNHA 5C2CA 1REVB 2W2PP 1J2VA 2UXDF 1QVGM 1M1HA 4BHQA 3NGSA 3S3NA 1VQ5N 4BRPA 3DM2A 2IM2A 1CJUB 1KVKA 3CC4S 3TABA 4M94A 3TZXA 1NU4A 2XHWA 3LP0A 3PDNA 4R0JA 4JKCA 3UNGC 4ZITA 5AQIA 1QD1A 2AMCB 4BDZA 4Z4CA 3NMUA 4BBYA 1R89A 2VDHA 5CQGA 2OAUA 1YSJA 3N9UC 4OKEA 1WG1A 2H4WB 4PG4A 5KFWA 4KRWA 1HWKA 1UL3A 3VQEA 1CLFA 1DQ9A 1BI4B 2J6SA 1CQMA 3UN5A 1FRLA 3SQ2A 4UY8T 3AVBA 3WXLA 2X1FA 1EETA 2FY8A 1T9YA 2HFUA 1DLOB 2YX4A 3GG1A 4A4JA 2ITMA 2CQCA 3P49B 1BD6A 1HI1A 3OFGA 1RISA 2MLZA 4BR4A 1KOOA 2GVZA 3TSQA 1K8KB 3NMRA 3GIIA 2MY7A 4BVOA 3THXB 1E6YB 5IT0A 3UD5A 2EVZA 4NWBA 5JS1A 4H4MA 1N5VA 4F4XA 3CF5Q 3DLKB 3WQPA 3W8PA 3VQDA 4CHPA 4I7FB 2VWKA 3KLVA 1TV6A 4R5PB 4M3YA 3Q8UA 3OYCA 2DNYA 1SQEA 4J2DA 2IJRA 4LF9F 5M1QA 2VG7B 1N4LA 3HM9A 4A8FA 4W5RA 1IBKF 3D28A 2HIYA 2PO4A 1Y4ZB 4AH9A 3FSIA 1TL4A 2OEKA 2V8VA 2NUBA 4CT8A 4JI7F 2W2NP 3UDVA 2E1RA 1JL1A 4ZLNA 1UEVA 2GA7A 2Q36A 4X66F 3L4BC 3PR5B 5AQYA 1HNXF 3T1YJ 1GMUA 3JAMU 4DCJB 3MAAA 1VQ4N 3PRBA 1T11A 4NRTA 4LVOP 4USMA 2E6LA 4LFCJ 3AA3A 1XQIA 1S6UA 3JTPA 2LLZA 1KFDA 1SI9A 1MWYA 2BRKA 2GAGC 4DV7F 5J2MA 4ZIWA 5AQJA 3T9ZA 3D0IE 4FF1A 1RXOB 3I0RB 3M32B 1HBOB 3QFHA 1QY7A 5JVGQ 2HRYA 5JICA 3KUEA 1U0HA 4DN0A 2KQ2A 1FDNA 3CVKA 3CB4A 3B54A 1N48A 2ZC3A 3JXUA 1VDHA 1GLJO 3FMWA 2IC3A 2ZKUA 1S0VA 2XULA 3IA0A 1HIYA 2OELA 3LUYA 1JJ4A 4B9QA 1BQMA 1RDAA 3VEXA 3SBGA 1UZHA 1UP1A 4L6V3 2VV5A 2WW4A 2UUAJ 4ZCLA 1BHNA 3LF0A 3R2CJ 3K8VA 1OS5A 1UTAA 4ZVFA 3SLCA 3RB3A 1P9YA 3V2UC 4J9OA 1WAFA 1BUXA 4HDHA 1EZZB 5GAEU 1EETB 1ZZNA 3ENWA 3HK2A 1UVJA 4YORA 3DXSX 5M1PA 1OH7A 2GMHA 3PX0A 1D9FA 3U3YA 3EGWB 4BGBA 5BXIA 4UUXA 1E6VA 1LWEB 2DGTA 2D3UA 3KK1B 4CF1A 2G8KA 3HF5A 4OYOA 3THYA 4GMJB 2PFDA 5EWGA 5B0GA 1FWLA 3FVYA 2R7OA 3MFHA 2C3MA 1IWGA 3M3ZA 1JLAA 5CHIA 4C11B 2A2CA 3ZCMA 1JJ2R 3VQQA 1HYVA 4B17A 3S9HA 2HHVA 2ZNYA 3JQJA 2MEWA 2RQ4A 1TL7A 3RMAA 2FLOA 3OYMA 2IRUA 2CQ3A 4ZP8A 2ZHBA 3RVCA 1LQ9A 4DR7K 3HLUA 5SUHA 2HGLA 5AQOA 2E2OA 3U9DA 4G1QA 4DU4A 2BJDA 1IKVB 1S1TB 4FWLA 4X84A 1A5XA 3TNVA 2E5LJ 2JL9A 4MMOA 3GR0A 4EO8A 4DDFA 4CGIA 2WRMA 3SI8A 2KFYA 2O01C 4W5TA 2QA1A 4E8UA 1T9UA 4KFBB 4WF9L 3HSDA 5E3PA 4FKXA 3FZ2A 1IQZA 3CEDA 5B0CA 1CS4A 1HQUB 4JI8K 4F26A 1TMMA 2ZVIA 5C25A 3G6VA 1Q81O 4DTPA 4QW9A 2DK2A 3D1HA 2CGJA 4LIRA 4OYXA 5DS7A 1C1CA 1NJIT 5EU7A 3VCDA 4ECYA 4HTLA 3RB0A 2P6TA 1LFPA 1W97L 1RTIA 2D0OA 5AE3A 4E7HA 4USWA 2VQFJ 1T3OA 5KT7A 3MGJA 1HQ2A 5CCLA 2YKPA 4QBUA 1RAFB 3KG1A 1Z25A 3TA0A 4FN5A 4IG3A 3S41A 2EG2A 1HPZB 3BBFA 3D2FB 3AA8A 3MI7X 3NS5A 3ETMA 3OT9A 2JH3A 2E5IA 1KN6A 2DISA 4ZCIA 2KJWA 3Q24A 4IKAA 2W9CB 4BR0A 2LMIA 5C42B 4Z0UA 4ZPVR 1WTFA 2P9NA 1OIAA 2DO0A 1XNQF 2RU9A 2KM8B 2DNKA 3WQUA 3LANA 5M1OA 4OHZA 1YRTA 3M9MB 3K57A 3CJ8A 2D41A 1YI2S 3FCHA 4DR5J 4JKAA 2R7YA 1Q82T 3R5JB 3I31A 2FC8A 4QJVA 1NU0A 1KFSA 4XDDA 3PFEA 4RPFA 1RWWB 5IC6B 3KWIA 3DI6B 3OLAA 4UY8O 3QEIA 4QZVB 1VC5A 4DV6K 2RE1A 4HH0A 2HBMA 1RA7A 4FNIA 2M70A 3A8YA 5J2NB 5HP1A 1IBCB 2O8BA 1SJ4P 2LXFA 3I5CA 4I69A 2GEMA 2W2OP 1JIHA 3HOTA 2P9PA 1KWMA 4YQWA 1IH7A 3CDBA 2OMLA 1RT6B 2XI2A 2RKIA 4CO5A 4HYKA 3ZSYA 2VIHA 3TVZA 3ILOA 3CCMS 3LQVA 3QIDA 5KFYA 4LRFA 2K7JA 3HT3A 5C15A 3OTBA 1NPKA 4EFHA 4DR2K 4WZQA 2XMAA 4NA1A 3W65A 1RAIB 1VRTA 2XBPA 1YZ7A 2JC0A 4X65F 4NZ6A 1YITN 2H5EA 1XQSC 1VQYA 3HSJA 2QGFB 1IR0A 2AZ1A 2HHPA 1GMWA 4M63A 2EW9A 2RMLA 2MYFA 3MD1A 5AQQA 2KW4A 3TVKA 4A2BA 1SAZA 1NGBA 3SQ0A 4PY5A 2C2ZB 2B4OA 3PEHA 4B1UB 2GHPA 3KLEA 3L0QA 3JQKA 2P9SA 4C0OC 2CH6A 3MEGA 3M6VA 1NGFA 1NLKL 1IG8A 2E1ZA 4U96A 4NLOA 2DFEA 1BWEA 1VIOA 1X4BA 4Q45A 5KG4A 1WKKA 4P2MA 4P7TA 1GLEG 3DNCA 1Q95G 2M4MA 3SSQA 4MK9A 1E6YA 2HBRB 2MDAA 2MKCA 1FRHA 4DTUA 1L5UA 3IGNA 4CGHA 1RT3B 4NL5A 1LXJA 4PWDA 4M7YA 3MK6A 2IYIA 3L3VA 1TL3A 2CJKA 3MXMA 5AFUH 3KK2A 5F2RA 1XN9A 2B51A 3MZIA 3GOIA 4DQPA 3W5YA 2O8FB 3PW4A 2IFXA 3ELHA 3ZXWA 4U67L 3J7Z5 1W26A 1NSQA 3A5LC 4QIVA 1D1UA 2KB2A 2U1AA 5KFKA 3TP2A 4MAKA 2FJXA 2W25A 4CP5A 2AJ4A 4LFAK 1X4DA 1NJXA 4JV1A 1WSRA 3FEYB 1TKTB 3R5DA 1LW0A 1D9DA 2AA4A 3AVKA 3ISNC 2HQDA 1HQEA 1UVKA 2AHOB 3P83D 2I8EA 2C3PA 4DPXA 2VFUA 2VQEK 4X64J 2A41A 4MDAA 2O8CA 1T94A 1AZSB 2A5XA 1CPZA 4GVLA 2ZH4A 3AGRA 4LC9B 3N5FA 1WDTA 5D6GA 1N34F 3QT7A 4W5NA 3Q2TC 1NOYA 4JKEA 1S72N 3GV8B 4FWPA 1WTBA 2P9GA 3ZNJ1 4IWVA 3VWSA 3F9KA 2RVJA 3KYLA 4XAKA 1PC4A 2FVPA 4A62A 1W7WA 1X4EA 3R5CA 1RDDA 5C0YA 4DL2A 4ZJQA 1RLDA 3T6JA 3IM9A 1ZS6A 4MO4A 1S72S 1CSJA 5LSRA 2QL5B 4DKWA 1FFSB 4BDPA 2UVVA 3R1XA 2VBXA 3GE1A 4MO5A 5KFZA 4DOZA 1JX4A 3SFGA 1VR6A 4LFBK 1QJHA 5J2PA 3MMJA 4CZGA 2FBXA 4C11A 3M2UA 3M8PA 4PYAA 4WE1B 1DURA 4OPJA 1ZA2B 2QFIA 1UA1A 1RAGB 2MZJA 4ZPDA 4QW8A 2MXYA 4J5OA 1RT1B 5L1JA 2AEMA 3GWCA 2NRWA 1IKYA 4UW2A 1NPRA 3MWBA 2KVQE 4IG0A 2VD3A 4DR6F 4YDUC 2ROGA 1J5EK 2IVFB 6AT1B 2L41A 3LP3A 4HCBA 3VAHA 4CJTA 4JI6K 1WEYA 1S4FA 2QA2A 5AQKA 5L1KA 4F4KA 3W2WA 5D4OA 2R3VA 2JLEA 1WKJA 4PPZA 3R9PA 5FPDA 4K4XA 4B3TK 4JKFA 4YR3A 1VSIA 5HQMA 5GAGI 3L2VA 4QQBA 1VQLS 5ELZA 2NXJA 3HKZD 4HUFA 4LF4K 1RAOA 3VTIA 2GX9A 2P9UB 1H73A 2WTFA 3Q8RB 1JLFB 2PFUA 1N6QA 2F3JA 3IAYA 5EY4A 3HFKA 4ID5A 1XMQF 3NG8A 1JJ2M 1RWOB 5I4MA 1JJHA 3PHTA 2YWKA 3I8BA 1EHWA 1SJ1A 3OVNA 1HQEB 1ZPWX 2JEFA 3EO3A 1D8ZA 1WF0A 2J0XA 2Q79A 2DNPA 4X62K 3A2FA 3W7BA 3J81O 2YKNA 2HWTA 2CJYB 3M2RA 4LR9A 2JSXA 3TZZA 2X3DA 4QOZB 2UXDJ 3GYXB 3PW2A 4ILRA 2C42A 1U1PA 2C3YA 3QIPB 4H4MB 1S59A 1Q4RA 4GKKJ 4LF5K 4YHHF 4MKYA 3MM5A 4JI2F 2Q6BA 2ZBCA 1HQUA 3W2VB 2G2OA 4F2SA 2HQFA 2HVIA 4QU6A 3GJRB 1KAXA 4HHTA 3R8EA 1H6KX 3AH6A 2RN2A 5KG7A 3EE3A 2W7OA 2VFVA 1C4CA 2PN6A 1WDDA 4GO5X 4WU2A 1YVFA 2DCUB 4WP9A 4ZP9A 1TKTA 3ITHB 3OW2M 2G1HA 4CE9A 2M3DA 3PYDA 3Q23A 4LRDA 2KXNB 2OZSA 1OO0B 4X66K 1HNXK 3MEGB 1X4FA 2YPZA 2FJEB 4NLUA 4FF3A 3ID6A 5KFTA 1BWVA 2NYIA 2V7YA 2XMJA 5AQLA 5IWAK 1GFWB 4NCBA 1HL6A 4X4PA 3QLHB 5A6PA 1VQMN 2VONA 2XC9A 3OTDA 4Q43A 4F02A 2CPYA 1WC4A 4LF5J 4L76A 3OTEA 1ZYQA 3PACA 1FRIA 3ZZZA 3W61A 4DCHA 2E5JA 3OR2B 3VGKA 5F3ZA 1FKOB 3K9JA 3MM8A 1UAXA 3FZKA 4ZVPB 2NXEA 4K0KF 3I87A 2YVSA 4DXLA 2HAFA 1GLBG 4M5KA 4JKDA 1BCOA 1KCFA 3M8PB 3CC2N 2V2QA 2GV1A 3ADAC 3JAMY 2F8TA 3HT0A 3RJMB 2WAQD 2V52B 3DU5A 4Y2KA 4CLUA 2HNZB 5IM0B 5CE3A 1RKJA 2OO4A 5CZVA 1VRTB 3H45C 4C0BA 4ZVEA 4H0OA 3G96A 4Y0FA 1OPZA 5A8KA 2EC2A 3CTRA 1Q81T 3MCAB 3DXBA 2IA0A 3SV3A 2B7BB 5T14A 1I3AA 1EARA 2LECA 1N32J 5ETPA 5IQ6A 3QBXA 1IKWA 3KD5E 2DIUA 1S97A 3S01A 4CGJA 4USJC 2VKZG 2D3OR 3AA4A 2DGSA 1BU6O 2Q0UA 3AY9A 5ETTA 1RUSA 5DQIA 3IG1A 2CAJA 2CQPA 3OYIA 4M41A 3Q8PB 2DXEA 3WQTA 1ASWA 3ZEUB 1VQKS 2GJIA 2VB6A 2XY5A 1M5HA 4OX8A 4FWNA 1N6QB 1UFKA 5D0EA 1GQEA 1WG5A 4OJHA 5BN9A 1ITPA 1RTIB 3M8YA 3O9SA 3KFWX 1U02A 4OZ0A 1K0VA 3F9MA 1MG7A 1DRZA 3S7RA 3BSNA 3MR5A 4LF2A 4ED2A 1NM1A 3QB0A 4UTGA 2NRVA 1SC6A 3D45A 3H2UB 3MPYA 4KKOA 4DR6K 1BXNA 1UOCA 1KNZA 3QWPA 3OUYB 3D66A 2W1BA 1D5AA 3KG0A 2YPYA 1KQGB 4PYDA 1X9WA 2ZHAA 4Y2AA 3TANA 1RFQA 3ATVA 1S6QA 4ZPTR 1RWXB 3ITHA 1I1GA 3MFIA 4DV2K 4CLZA 1NUEA 1JNRB 2DHXA 3A8EA 4ECVA 4B3TF 4KYZA 1SQKA 4HT5A 1LOTB 2HBYB 4MIWA 2OMOA 2ZH6A 3AARA 3CDAA 1CJUA 2RIJA 1HWUA 4A46A 3OV7A 3O9RA 2GO9A 2DVIA 4PKDB 3THWA 3THTA 5KFRA 3OSNA 2B7CB 3C16B 1REVA 1U1RA 2BYCA 1XEZA 3BYPA 1YIJS 3ID8A 1IKVA 3AV9A 3KLIA 3M9OB 3KHYA 3IN5A 3P96A 4OI2A 4X62F 2E1PA 4UOGA 5LXYA 1FDAA 3KLIB 3CCUS 2DY4A 1Q7YT 2KRRA 4BVPA 2GO8A 3MEEB 5LT5A 3SCJE 1YJ7A 3MMBB 4EIAA 2KH9A 3OFHA 1PBUA 2Q97A 1S0NA 1C0FA 2BJ1A 3EY1A 4O55A 4WFNL 1XNQK 1HW9A 5GADU 3VGMA 5FPMA 3E01B 4Z4EA 1AXQA 2L9DA 4IH6A 3HYFA 5AE2A 2F63A 5F8NA 2DNNA 1J27A 4ISGA 3SPYA 5I3UA 2Q3PA 4DL5A 4KGZB 1VYAA 4FLXA 5AJ3J 2GHWA 3I4HX 3KHHA 4PHTX 4I9LA 2BRLA 2ZH7A 2W9BB 4GW6A 2VC0A 3GQCA 4WYBA 5C24A 4O44A 1U1LA 4QPXA 2JX2A 2AW0A 1TTHB 3WXKA 1HFEL 1UJ5A 3MD3A 2BOPA 2XMWA 5LY3A 3CMAS 3T1HF 4NLCA 2NRXA 1NB2A 2Y1LB 1NHKL 3EXCX 3UO0A 2CZVC 4N8NA 1T95A 2WZ1A 3NVMA 1TUWA 5EGYA 3PIPQ 4A8MP 4KHYA 4G3IA 4JLHA 4FK2A 3TAGA 5J2MB 1OWXA 3ZT0A 2X1GA 4FOIA 2BQ3A 2PYLA 4N8OA 4DG1B 2Z56B 3WX4A 4FYDA 1XNRF 5DLFA 1BE4A 5CHCB 1EB0A 4XPEA 1R7IA 4O4GB 4KV8A 4ED4A 4IO9L 2DHAA 2B9YA 4CO1A 3H3OB 2MLXA 1VGYA 1Q86T 4F3QA 4K4ZA 2CQIA 1T02A 2MKHA 3NGZA 2D7SA 1N0UA 5LJ3Y 2XNQA 2OZMA 2V5HG 2BBEA 4YOUA 1NNEA 4NXNJ 1S57A 1TR0A 2HFOA 3M32A 4DHVA 1SL1A 3R1LA 2L3MA 4CZEA 2VFSA 4JI8J 1TV6B 4JYAK 1Z4UA 4OKKA 2DGXA 2JDJA 1KAYA 4DV7J 1QM9A 3DLBA 4DBQA 3K5MA 5J2QB 1QAYA 2GQCA 2OEJA 4U7UK 1VBYA 3HHLA 2FGCA 5DJBA 4LFCF 2ATLA 4JD2B 4L3KA 2E2PA 3QAEA 1JLCA 2K8GA 3KK2B 4X66J 4YY3K 3HVTB 3OTOJ 4CZCA 4YDDB 2YV0X 2YQ1A 3B6OA 1QTNB 2MJNA 3CM5A 3HFZB 4LFAF 2OKQA 3KK3B 1WSGA 4ZVTB 3QRRA 4M5DA 3CDEA 3VEZA 1RTHB 3NBPB 4J9VA 3LDOA 2HHHJ 1DKGD 3MM6B 4NEZA 2B9EA 3RRHA 2LDYA 4PCQA 4KB1A 1SL2A 1GOBA 3TZYA 4O8KA 5C2GA 3SSRA 4UQTA 4O3OA 4DLEA 2G1DA 4UUWA 1N34K 3RRKA 3BPDA 2HW3A 3FZFA 1RTJA 1RBOB 3I9ZA 3CGIA 4CJRA 3W9JA 1VQNS 2BQRA 3N28A 3AVCA 2GAHC 1G7CB 2FD2A 2QTWA 3M8RA 3W0LA 2APOA 3PJWA 4FO0A 4OZ3A 1TYQB 3QIOA 2DH8A 1W0HA 3MN9A 3JSMA 5KFPA 4C8KA 3R97A 2DNOA 5K8PA 3QINA 2HMIB 2RKIB 1EKSA 3TJ8A 3BS9A 2ZZNA 4RL1A 1NM2A 2DPNA 1Q8LA 1LK5A 3VGVA 1DTQB 1SC1B 4FPRA 4OJ1A 4OX9F 2G8WA 3TSUA 1S7IA 1IO2A 4U8VA 2ETJA 3OHBA 2YWFA 4NASA 2N3LA 3D4JA 3MAQA 1BISA 2YX6A 3ZYYX 1XC3A 4R0EA 1Q18A 1U0HB 2F9JA 2QYCA 2CZ9A 1C1BB 4AF1A 3OHAA 4U9RA 2R7WA 1T6DA 1HUXA 4PR6A 2V50A 4L73A 2ZVSA 3ILIA 3U02A 3F56A 3M05A 2M2BA 2RT3A 5J2NA 5HP1B 2GIQA 4JI6F 4OV1A 2DGQA 4MDBA 1TKDA 3DRPA 4K50A 4IRCA 4J9SA 4OYAA 1PKUA 3MWPA 3ZZTA 4QWCA 4C1NK 1H2VZ 3EKUA 5LMNJ 2O3DA 3H4DA 4DZDA 4IOCL 1IKWB 4KH1B 2MSTA 1OQ3A 3NGKA 3LDLA 1HBNA 5IM0A 3R27A 4W90B 2ZM6K 3CDWA 2YH0A 1EO1A 4UT4A 3OA9A 2EKYA 3OYLA 1UVMA 1XMQK 1HBMA 4CO0A 8AT1B 4JI4K 2QZ8A 3FR0A 2JVRA 1YHQN 4HLBA 2IVOA 2J0SD 4PXEA 1IBKK 2HLTA 1ZM4A 3MPDA 2XY6A 3KJFB 3TOQA 1TUYA 5AFUA 4JI7K 4M3TA 2W7AA 1KEKA 1IR1A 1NB7A 3U6FA 4L3QA 5IS2A 4L3NA 4KV8B 1RTDB 2W4CA 4FVMA 4BREA 2I9SA 5JUMA 5KPZA 4TU9A 1CLQA 4HDGA 4QS7A 1VS3A 3SBTA 3IAM9 3N0VA 1NZAA 1QZ5A 1RBTA 3QZ7A 4CJQA 4DV7K 1VQKN 3PM9A 1WEZA 1EQ0A 4FZYA 2RRNA 4F67A 4M5DB 2UXCF 2GTDA 2B5JA 3OXGA 3AAQA 3VQ5A 3WNEA 4C8YA 2UU9J 3J8AA 1FVSA 4DV0K 4ID1A 5KGXA 2BKOA 2MPUA 4B3MF 1FJGF 2QL9B 1ZAVA 3RB6A 4HWIA 3L8BA 5DM7L 1G4CA 2Y1JA 3EE8A 4LBIA 4F0MA 3K0JA 5F1XA 1K9MO 2QWMA 3LP2A 3CFRA 1VAZA 4I2PB 3V9XA 5HMWA 4H0TB 2IJFA 4JI3F 3OYAA 4PQAA 2QLJB 5D0RA 5IWAJ 2HPUA 1ATSA 1S1TA 1HNWK 3SCKE 5HOOA 1RBLA 4BRDA 1QQNA 1WC5A 4WK1A 3UN2A 2BKNA 3IRWP 3IDHA 1FDBA 3V6JA 2ASDA 4QPTA 4OX7A 1RHRB 3T5KA 1U8SA 2N4DA 1GOAA 4YB5A 1EKRA 1RHMB 3M8SA 1YJNN 3D3BJ 1Z2ZA 3UKUA 5H1SV 3R6LB 2JJ4D 2CQ4A 5HVFA 1B0TA 5C12A 4KE5A 2L9WA 4K8ZA 3SAGA 2EFOA 3CJKA 3CJBA 2VPXB 3TR5A 3IBFB 1NCLA 1WLJA 3ENVA 1IXKA 1EX4A 2HS4A 3MUMP 4HCCA 4PWWA 3QZ8A 4DR5F 4ICLA 1VHFA 2VG6B 4F04B 1V4TA 5HMZA 3JYTA 1VOMA 4CFDA 1F5AA 3E8OA 3NLCA 1HNIA 3AVGA 1ELOA 4HKQA 4BR5A 1QHTA 2R2RA 3RTVA 1LOUA 1TL5A 2R4FA 1RAJA 4YB1P 2VZ9A 3DC2A 1VJWA 1RP5A 4IR1A 2XS5A 5EX5A 1IBMJ 4XDCA 3D68A 2HKEA 5KRTA 4AHRA 1TMJA 3CYMA 4DSLA 2L08A 3FSYA 1VSKA 4O5FA 1E6VB 5BREA 2JC1A 2HF3A 2QKBA 4V1Ak 2CPDA 4IDKB 1DJ0A 1S6QB 3GMGA 1KBRA 3VERA 1ZOTA 3OYDA 2V6AA 2BVZA 1JLEB 6FDRA 4JI1F 2E6MA 4LF7K 3MECA 3OTOK 1ITGA 4KTZA 4BS2A 1YIJN 2DRAA 3IMQJ 4P2XA 1X4HA 4H0PA 3R7SB 1JWWA 4RW4B 3HZGA 2UV8G 1BG3A 2F5GA 2YX1A 2GQQA 3VAMA 3QEWA 1CC8A 4BCAA 1B99A 4OV6A 3VQBA 3TUPA 5LJWA 2CNLB 3MM7A 3LDPA 4FYVB 2HAIA 2HURA 3R6MA 4OYPA 2WONB 2VU5A 4KREA 5AXNA 5KT4A 4FZVA 3FSXA 1A6LA 2FVQA 4RW4A 4PEOA 3CJ5A 4KSEB 4MIBA 3QT6A 5LSOA 4DR3J 4KH6A 4URGA 4N56A 4PQUB 3MMCA 2J9CA 2UVWA 1F60B 3R5AA 4NXMJ 2ZDOA 4CD1A 5KFDA 5AQGA 3THXA 3HSZA 3A8KA 5HAOA 1ZH5A 3CMQA 5K8MA 3ZX0A 4XH5A 5EHHA 3HX9A 4WQ4C 2PA3A 5FROA 1NBWA 4TLQA 2W9CA 3NS6A 2YQ0A 1N5SA 2ZBRA 4LQ9A 4F25A 4WP3A 2LEPA 3ET6A 4A8XA 3OSPA 2RF2B 4CK1A 3BQ0A 2NCKL 3PY8A 3DLLQ 4WJBA 2AJ1A 3AO4A 1ASUA 4KTWA 2HFSA 1RAEB 5HLFB 2E2QA 2DY9A 3L2QA 1G15A 3W3SA 1FNMA 1R3NA 2FLNA 3CFPA 3IUCA 3TQ1A 2EFNA 4USUA 3BF4A 3C2PA 3M30A 2VQEJ 1LWCB 1TZ0A 2W8LA 1LAWA 1JQGA 2FLPA 2DNZA 1NK4A 1NDKA 2VG5A 1FI4A 3JSMB 3KWGA 4BRIA 5U47A 4PWDB 1NMNA 3GV5B 4FW2A 3LAKA 2HHHF 3ILJA 3LP0B 4F2RA 3CJSA 2V69A 2CXEA 3DMJA 1HHQA 2YXLA 4C6AA 2QKKA 2XYPB 1RHJB 1ZA1B 3OVAA 3LWLA 3PIOL 2HRUA 5H9EJ 4CJ5A 3EEQA 5F8JA 4BDYA 4J8FA 5E3CA 5DG8A 3O5BA 4E1JA 2Z1IA 2DEJA 3VTHA 2X78A 4F7VA 2FVRA 1S5ZA 3GLJA 3GCXP 4OO1J 1VBXA 1LW2B 3MR3A 2WTUA 3OLBA 2F8SA 4ECUA 1RTHA 1TAUA 4WF9Q 4I6MB 1M0SA 3OXLA 3HRGA 1MDUB 2VOOA 4QWDA 2E20A 5IT9U 1U04A 4M3UA 3CCTA 3JSBA 1G6BA 4KQZA 2QRRA 2CIMA 2A2DA 3W3DA 5HROB 3RW6A 1S9EB 4ES3A 5KQ8A 1FFGB 3T1YF 3PYFA 4JD2A 2MKSA 5CY4A 5DG7A 2BV3A 3M6WA 1XNRK 2WSFC 3EPGA 4ED8A 4YDUA 5THWA 1XI1A 1P1LA 5D0GA 4HI2A 4OI4A 4B9LA 1S77D 4NO7A 1YDLA 3GIJA 3DRSA 4NPOA 1HI0P 4DHYA 2FHMA 2GX8A 2P6SA 3O9TA 4GO7X 3OXFA 4HHUA 2ZWPA 3QGHA 3NP5A 4FWOA 9RUBA 1FEHA 3C6AA 4FJJA 1CBKA 1NJIO 2UXBJ 2G4BA 2SXLA 1R0AA 1NSAA 2WOMA 4ZCMA 3VGTA 4RX6A 2CQDA 3K58A 3L3UA 3BGLA 5HBMA 2HOEA 2V8GA 1FK9B 4JK7A 2GJ2A 4BQLA 1AYEA 3J7YU 3SCLE 2VQEF 4NA3A 3DLGA 2LKZA 4PUOB 2X6SA 3AB4B 3ZTRA 3HHDA 4W4MA 5ETNA 1Z1ZA 4BC7A 3QBCA 2YNGA 3PHEA 4NLPA 2O4IA 2D0BA 4FLYA 1NPPA 4TYBA 3BSOA 2DGVA 1G2EA 3LOUA 5DZ7A 4MQ3A 2Q0RA 4P2SA 4JI1K 2ZE2A 4CEDA 5H9FJ 3I0RA 1T9VA 5CAAA 3FGUA 1MROB 2H3GX 2AT1B 3F2KA 3KLGB 1T8EA 3FDSA 1KTVA 2CADA 1RYSA 3BM7A 2VJUA 2YNFB 4K4VA 2B4JA 1QQOA 1K1QA 3JTOA 4CF2A 3LZJA 1MWQA 3DDNA 2QA4S 3ULEA 2HNYA 3KXDA 4WTOB 3FFIB 2QG9B 1QDUB 1I94F 4CO3A 4QYZK 1WSHA 2MQOA 2GCFA 5A0YA 4ILGB 3N79A 2YKOA 1Y00A 2WBRA 4KPYA 2ZKTA 1HKGA 3FBFA 2WW8A 2MQPA 2AJQA 4E0DA 4DCPB 4DV0J 3Q83A 4KHMA 1X3MA 4JAXA 3EE9A 2J9DA 2GS8A 3KTQA 4U8YA 3CO9A 4EFAC 2KG0A 3BBBA 2V4RA 3QJJA 3IXQA 4I6MA 1FF2A 5AXMA 2ZJRQ 5EXWA 1FWKA 2OUGA 2BE9B 4LF4F 2PFFB 5B8HA 1PGZA 4K43A 4B3TJ 3A4TA 4DR7J 3JSYA 1WOOA 3QNOA 1DTQA 3MEEA 2DB1A 1HJRA 2FBTA 4C98A 3AVIA 2UUTA 3FEXB 4DV3J 2WHOA 1LEOA 4AXIA 1N8RT 2XZTB 4A57A 5LOQA 2ATQA 4A8QA 3KKRA 1JLEA 3CCSS 2XGPA 1HLUA 3CJCA 3TPQA 1CJVB 3OR1B 4A61A 4AHUA 2HVEA 4FS2A 1HNVA 3BF1A 3CSKA 3Q8QB 3QRQA 1N0VC 4B9SA 3AJDA 2YWHA 4PPDA 3TTFA 2W6LA 1YBAA 5M1KA 3IS9A 2XMVA 1HNWJ 2PMHA 4FYWB 1TL3B 1R0BG 2I5JB 3C66A 4RUHA 3LPYA 3NGUA 4JI2K 4YFUA 2ZM6F 4ECRA 3LDNA 3QSYB 4FJXA 3IAS9 3AAPA 2A18A 4WIIA 2CNKB 2CJQA 2HHHK 2KFZA 3M6GA 4IFYB 4WXOA 4B3OB 4CFBA 3M30B 4DSKA 4MLHA 1N54B 4FJ8A 2C2KB 1TP7A 3D7EO 1Q7LB 1TU0B 4J90A 3NKYA 1FEEA 3TW0A 3HD2A 3VQ8A 3KIOA 2MZTA 2F4FA 4ZCKA 4YOVA 4I4BA 1WBBA 1S5JA 3KHLA 4BROA 3A3NB 5E3RA 4C8NA 5MLCV 1PYTA 3LW5C 4CTAA 3SQ4A 1VBZA 4YUDA 2P9LB 3DOLA 3OJSA 5EDWA 3AVNA 1F9HA 4GVBB 2XLJA 2NZCA 1T0TV 3CJ7A 2OYQA 4FLTA 3V4IA 3J80O 3RR8A 5IWAF 2W2MP 5IQQA 1IV0A 1E4GT 3AA9A 3TEGA 3MN7A 3J81j 5ETRA 1NWKA 3VVUA 3SIPB 1UFWA 3KDOA 1FTRA 4A2AA 4LF8F 4TU7A 3C94A 1Q53A 5KFJA 1F5BA 2OTLS 2NXNA 2I7NA 4IQMA 2F8EX 1NBEB 4LFBJ 1WJ9A 3PJ9A 1ILYA 2PIIA 3M8QA 3PCOB 2E1AA 1T9TA 4NCGA 4J2AA 4ZIVA 2OTLN 4LF7J 2IHR1 4O5BA 5ADXA 4O0IA 3L2WA 3A1YG 4J9KA 4ZPCA 3D67A 1MROA 4JV2A 4JI3K 3VQSA 1HNWF 4MTPA 3MTKA 4K7QA 1KQSR 2EKNA 4QOTA 3C8YA 2D4WA 1MWZA 3K89A 4YNQA 3ZNUA 4RW7B 1KQKA 4C3MA 4CJ4A 4ZVRB 1FE4A 4HI1A 3TAPA 4GKKK 4QIGA 5DETA 1LFWA 3EYZA 4G6VB 4RR5A 3DJCA 5D4LA 4GVMA 2AP1A 3Q22A 2MGZB 2RJZA 4HH1A 2XQCA 4XH4A 5AQTA 2H1YA 4TVAB 4WK3A 4ZVSB 4KO0B 4BRLA 1MMNA 3M1VB 1RT4B 3ZSXA 4ZP6A 5C24B 4PL7A 2QN6B 3M2UB 2Y9HA 1W2IA 1YHQS 4OZ2A 1HWLA 3NGIA 4DLGA 3C19A 2XMMA 5RUBA 4GY2B 5BR8F 3S1TA 4X4TA 1J53A 4MFBA 3CJ0A 4DV3K 5DG9A 5ETLA 4Y65A 4F4ZA 3K5OA 2QK9A 3CG7A 4OLPA 1RTJB 2R7SA 4QIFA 1M5PC 3K5PA 1U1KA 1LCUA 4BRKA 3AODA 3FQLA 4NYOA 3RU0A 3MHYA 2F8MA 1A5VA 2HQGA 1FX4A 1H72C 4I2QA 2IDEA 2HWHA