4PUOA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 145
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4puoA05
1GOAA 1SL2A 1KCFA 3DOLA 3AA2A 3AVGA 3NFAA 1DTTA 1JLQB 3CFRA 2ZKUA 5C25B 4MK8A 4ZPBA 2IC3A 1JKHB 2OPSA 4OL8A 3L2QA 3H98A 2F8EX 2JC1A 1S0MA 4IQXA 4KHRA 4ED1A 4BDZA 3HPOA 3RWUA 5J2MA 1RDAA 1S6QB 3KK3B 5KFTA 1IKWB 1HPZA 2BQRA 3E01B 2W9BB 1JLFB 5KFVA 2R2UA 1ITGA 3L3VA 3QLHA 3VQ7A 3HVWA 5KGWA 1UWBB 3L8BA 3EZUA 1B9DA 1IM4A 4CF0A 1U49A 1WSEA 4KV8B 4ICLA 1RTHB 3PVXA 3DLKA 2P5GA 4K4SA 1Y97A 4KB1A 1D0EA 3OYMA 4IR1A 5KG3A 1B92A 1S1VA 2FVCA 3LP1A 4TY9A 3S9HA 1XHXA 2HHXA 3LPUA 2XGQA 2F96A 1GOBA 1J9AA 4E7LA 1XHZA 2YNGA 4R5PA 2O4GA 1EKEA 3VQAA 5EDWA 4K4VA 3KHGA 3VQQA 3LP0A 1WSHA 4OJRA 3RBEA 3KHLA 3QGGA 3MEDB 4OKEA 4FM2A 3UDLA 5C5JA 2W8KA 1RCHA 1T8EA 3TARA 2W7OA 3G6VA 3CG7A 3D45A 2G8HA 4CEZA 3O3FA 4B9LA 3NCIA 4K4UA 4CEBA 4PY5A 1KHVA 4JRQA 5KFGA 3OJSA 3K57A 4TN2A 4I7FA 3EPGA 1QQCA 1SKWA 4B08A 1ZTWA 2V9WA 3QIOA 1NK4A 4NLSA 2YNIA 3TAFA 1KLNA 3CO9A 5L1JA 2VWJA 3GIMA 3V1OA 4IDKB 4ED6A 4MKAA 3K5OA 3QNNA 1R0AB 1RTIA 1RDRA 3OLAA 3KIOA 2XY6A 4WE1A 5DG9A 5F8JA 2VG5B 4CFCA 1IKVB 2XHBA 2QKBA 1JXLA 3KHRA 4FYDA 1QE1B 3OHAA 3RTVA 2W9CA 4MFBB 3ULDA 1WSFA 3DI6A 4DG1A 2AGOA 1IKXB 2DFEA 4F2SA 1DTQA 2G8KA 3CJ0A 5KT3A 1S0OA 3AVAA 1RT5A 4CHZA 3LAKA 3IGNA 3IRXA 1JLEA 2FJWA 2C2EA 4HHTA 3FQLA 4OVLA 3OYFA 1Z25A 4BDYA 4EBCA 4DS5A 5J2QB 3LWMA 3DRPA 2B5JA 1FXXA 3OYIA 5HROB 4DTJA 3SCXA 4MQ3A 2XI3A 5F8NA 1HJRA 4DL6A 3M8QB 4OKKA 4J9QA 4RW8B 3NGIA 1VRTA 3SQ4A 3AVKA 3T19A 1S9FA 3CIZA 2FVQA 3OY9A 1VSFA 4XPEA 2R8KA 4O5BA 3HK2A 2C28A 4ZPCA 1TGOA 4O4GA 3AA4A 5KG6A 5C42A 5F8HA 3TAQA 4FJXA 1ZTTA 4ECZA 3PR5B 4AHRA 2WCXA 2FJVA 3T5KA 3IAYA 1TQLA 4WYWA 2XCPA 3F73A 3NKYA 1BQNB 4FCYA 3PX6A 4URQU 3HKWA 4W5OA 3QIPA 4DFKA 4KE5A 2HNDA 5CYQB 1CLQA 4NYZA 3DRRA 3M8PA 1TKXA 5EWFA 3L2RA 4K8ZA 3OYLA 3ZSZA 3PX0A 3SQ0A 1TK5A 4RU9A 4IFYB 4CJPA 3CFPA 1REVA 2BRKA 3ZT4A 4BACA 1HYSA 2QXFA 3QEXA 5KFBA 2E6MA 3JYTB 4Q45A 1U04A 2IBKA 3MEGB 2IJNA 3VQ5A 3VN5A 1C0TA 1RT1B 3KK1B 4JV2A 4R8UA 2BQUA 1T7PA 3HJFA 4LSNA 1BIUA 4PA1A 1WNEA 4Z4GA 1VRUB 1HNVA 3SUOA 1J53A 3OSNA 2FLPA 3Q8PB 2JEJA 5I42B 4O3OA 4NRUA 3V9XA 1LAWA 1N4LA 1HNIB 2D41A 2IJFA 4KREA 3KKRA 5F9NA 3SQ1A 3KMSA 3PUFA 1BQMB 3NBPB 3N6MA 3CVKA 5DMRA 1G15A 3OS2A 3ITHA 1ZETA 4H4MB 2HHSA 3G0ZA 1BIZA 1RDBA 1S5JA 3QINA 3HXMA 3QZ7A 2ZD1A 1JXEA 2RKIA 4IG3B 3IGVA 5KFOA 2BRLA 4ZVGA 3KK2B 4J9PA 4ZVFA 1I3AA 4RW6A 2WONB 3NF7A 1S1TB 3RR8A 2OPQA 3AVNA 4DQRA 3LP2A 3TANA 2WHOA 3NF8A 4FJ9A 1NOZA 5DGAA 3KLHB 4FM0A 3PW2A 2OPPA 1JLCB 4NYNA 4CEFA 4EYIB 3F9KA 3TR8A 4K4YA 4F50A 4KAZA 1KRPA 3EY1A 3H4BA 2ZQBA 1A5VA 1FKOA 2J6TA 4OGCA 4CJFA 3SV3A 3QNOA 5HBMA 4CGFA 1Q9YA 4KBIA 4KPYA 4CERA 4J2EA 3BSOA 5KG0A 1QTMA 1HMVA 2J6UA 1L3TA 2D0CA 3Q8SB 3NAEA 2YV0X 1U47A 1KVBA 5CY4A 4IR9A 2FLLA 3VA3A 4M95A 4EBDA 4C8MA 3OL7A 3WNEA 5F8GA 1LAVA 4CJQA 3TQ1A 2BDPA 3KTQA 3I0SB 3ZSVA 5KRTA 5J1EB 3GILA 3SPYA 1HMVB 5KG2A 1B9FA 1VSMA 5HP1B 1RT2B 5HBMB 4HVJA 4LSLB 2X6NA 4HUEA 1SH0A 2B43A 3GIKA 1GX5A 1VSJA 1ZYQA 3NF9A 3CM6A 3FRZA 4K4XA 4AHTA 1WAFA 3H2LA 5EWEA 2D0AA 1TL3B 4CHPA 3S3NA 2Y1IA 1KLMB 3DMJB 4MIBA 5KFQA 1RBSA 4CGIA 3MFHA 2BE2A 4N56A 3ZT3A 4J2AA 3KK2A 1RBVA 3TAPA 4M3UA 2OPRB 1HQEB 4DSEA 4J9NA 2X6SA 1EP4A 3MXJA 1CSJA 5KG7A 1Z4UA 1S97A 2JEIA 2QE5A 3ITHB 2VWKA 5HLFA 3TAEA 2P51A 3NBPA 3HYFA 1BI4B 5KT5A 3KLEA 4M94A 4CHQA 2HHQA 4ZHRA 4ECYA 3MTKA 3KJVB 3NDKA 1K1QA 2E6LA 2YKMA 4Z4HA 5I42A 4LY7A 1QAIA 1S10A 4BWJA 4MIAA 1C1AA 2Z1IA 3H40A 5I3UA 2UVUA 4O3SA 4G3IA 1LWFA 1LWCA 1UOCA 1C0TB 3KK1A 2C2RA 2AX0A 4I2PB 1T05A 3DRSB 4ID5A 3THVA 4Z4CA 4JV0A 2DPJA 4DQIA 3QEVA 5KFJA 4J2BA 1HYSB 3PZPA 1RT6A 3M9OB 4ID1A 4UQGA 3DYAB 1BGXT 3SUPA 4IOBA 4F4ZA 4IFYA 4FLWA 3ISNC 1W0HA 4PUOA 3DRRB 3M8PB 1NK7A 4Q43A 2P1JA 3NE6A 4DLGA 1GOCA 3OS0A 4GW6A 2UVRA 4CJ5A 4RZRA 4OLBA 4LQ9A 1BQNA 5SWMA 4ECVA 3I5CA 1S6PA 1XR7A 1JX4A 4FXDA 4U7CA 3S3OA 5F8IA 3MR2A 4ED2A 3U3GA 4E1NA 3WNHA 3IG1B 5J2NB 4O4GB 1S6PB 4M41A 1ASWA 4M45A 3VQ6A 4R0EA 1NJZA 4FJJA 1N5YA 3MAQA 4OKJA 4ED0A 1WN7A 2R2RA 1VRTB 3RMCA 4KHMA 4RNFA 1QAJA 2ILYA 3M8QA 4ELUA 4YR2A 3K2PA 4O3QA 1UA0A 5KFZA 3OYGA 2IM3A 4QWCA 5HROA 3CM5A 1A5WA 3G6YA 4YR3A 5J2QA 4DSIA 4KTWA 5FDLB 4YMEA 4O3RA 4QCLA 4DL3A 5HRSA 3MXIA 3QO9B 4KFBB 3IRXB 3NH2A 3SI8A 3MR6A 1T05B 3QESA 4WXWA 1NK9A 2FBYA 3AO5A 4KRFA 3CJ3A 1HARA 4RNHA 1NK0A 1IKXA 3C6UB 2W9AA 3PW7A 3LZIA 5I3UB 5L1LA 2W9CB 4J9SA 3AO3A 1RAJA 1SUQB 1D1UA 4RNOA 1MMLA 4L8RB 4FW2A 4ZP9A 1IKVA 4CJUA 2KZZA 4ZHRB 4DQSA 1S1XB 3C6TA 3BQ0A 4IDKA 4E7HA 5KFAA 2ASLA 4AH9A 1ZBHA 3T5HA 3H5YA 1WLJA 2HNZA 2YNHB 5KFFA 2RN2A 4ELTA 4WFXA 3MR3A 4ZMMA 4EBEA 2KFZA 4NCGA 1RT3B 1EP4B 1NKBA 1NJWA 4DTOA 3UR0A 2XO7A 3AA3A 1D9DA 2G8FA 4NLVA 3RRHA 4LQ3A 5HRPA 4YNQA 2R2SA 4K4TA 1KVAA 4FZZA 4WZMA 4IH5A 4CF9A 4O0IA 3MEDA 1XI1A 4JS4A 3Q8RB 3KMQA 1RT3A 1NKEA 3CQ8A 2I5JB 5E41A 1TL3A 2JEFA 4R5PB 3AVIA 5JUMA 2WOMB 2YNHA 3BR9A 2HB5A 4O3NA 3RAXA 4TQRA 1TVRB 5JS1A 2XC9A 1XWLA 2IOCA 3K59A 3LP1B 1I6JA 5KFLA 4FLYA 4E89A 4F4XA 3PY8A 3AO1A 3AVHA 2X78A 2LSNA 3D5MA 2FBXA 2HHUA 2G8WA 3CFOA 4KHUA 3DLKB 3V81A 5DQGA 4CHNA 3EYZA 3C6UA 3SNNA 3QGHA 4ICLB 4KV8A 3BSAA 1U45A 1L5UA 4KHNA 2GUIA 3RBDA 3OSPA 4KFBA 2R2TA 4CJ4A 5T7BA 3G86A 3MEEA 4FW1A 1TKZA 1JLFA 1X9WA 2HHWA 2A1SA 3E01A 4NLDA 4CJ3A 1HRHA 1HPZB 1IKWA 3DLGA 3I0RA 3M9MB 5L1KA 2IM2A 2HHTA 2C2DA 5KFIA 3FQKA 4CIGA 2G8UA 3N6NA 4DTNA 3T1AA 1N5YB 2WRMA 4ZTFA 1J54A 5KG4A 1DTTB 4E7KA 1SH3A 3IS9B 1RBTA 3DLEA 4B9MA 3VQSA 3IG1A 5J2NA 4HCCA 4FM1A 3OYBA 3KLHA 3FSIA 1U09A 4RW4A 4NLOA 2XGPA 3V1RA 3G6XA 3MECA 3NH0A 3LALA 3PO4A 3KD1E 1S1TA 3U3YA 3FFIA 2WONA 4C8OA 1RA7A 3KLFA 4I9LA 3VQPA 4KO0A 2D3UA 4CHYA 1SH2A 4FK4A 1DLOA 1Z26A 2XWYA 4DS4A 3ZSOA 1CXQA 5EUHA 4F4YA 3DYAA 3HPGA 5J2PA 1RTDB 1RT6B 1VSHA 4BE1A 4XIUA 2IM0A 5KFNA 2PYJA 3OS1A 2UUTA 4ID5B 1SL1A 4I2PA 1K6YA 1HNIA 3DOKA 1C1CB 5KFKA 5KFMA 4FLUA 3QYYA 4CJSA 3NMAA 4MKBA 3OYAA 2DPIA 4K8XA 3SJJA 1C0MA 1VRUA 2YKMB 1S9GB 4LSNB 4Q8EA 4B9NA 2KQ2A 4NLGA 2OZSA 1RT1A 3MEGA 3MXMA 4CHOA 5SZTA 1KTQA 4KSEB 3LP3A 4WYLA 4OGEA 1C0UA 1ZBLA 2XY8A 5J2PB 1REVB 4DF4A 3IN5A 2V0NA 2FLNA 2UVVA 3LDSA 4E0DA 4O0JA 2IS3A 4FZYA 1TKXB 1DLOB 1YTUA 5KFPA 3GV5B 2E9TA 4B8CA 4FLZA 4KO0B 3KLFB 2QV6A 4HCBA 3PW5A 5FRNA 2BE2B 4PQUB 3TABA 3L2WA 3VQDA 3OYHA 3DMJA 4RW4B 1KLMA 2I1RA 4ECXA 2JEGA 2V4QA 1WSJA 3IS9A 4RG8A 3KLIB 1W25A 4JS5A 4LH4A 4NCAA 2FC0A 3O4QA 4KB0A 4TSXA 4W5QA 4GVMA 1XR6A 1YTAA 4FBTA 1WSGA 4IFVA 2HVIA 3I0RB 4FJ5A 3HVAA 3BSNA 4CF8A 2PZSA 3DLGB 4F4WA 2UVWA 5J1EA 3I0SA 3RB3A 1S9EB 1NOYA 3H08A 1TKZB 3MEEB 3VQ8A 2HHVA 4QAGA 1IO2A 2Z1JA 3RR7A 1DTQB 1RNHA 4CK3A 4G1QB 5KFXA 3NF6A 3DI6B 3V81B 1IH7A 3H5XA 3L2UA 5L1IA 2CJQA 3KHHA 4B9TA 4KTZA 1QE1A 2EHGA 1JLBA 1NHUA 1R0AA 4M3YA 1FKOB 4CEQA 2GV9A 1NK5A 4M3TA 4WZQA 4CEOA 2XY7A 1TVRA 3UIQA 1QSLA 4GMJB 3GQCA 1CZBA 2JLEA 3EPIA 2FBVA 2YNIB 2WOMA 2D0BA 3L2VA 1JLCA 1S49A 3T5JA 2I5JA 3CJ2A 2WK4A 2IA6A 5KI6A 4N5SA 2O4IA 1LV5A 3ZT0A 1WNSA 4Y2CA 1HYVA 4QWBA 3SV4A 4AHUA 3AVFA 4RW6B 4DMNA 1TKTB 4IG3A 2ZD1B 4B9UA 5KFRA 2AJQA 4IG0B 2AWZA 3KKSA 3SYZA 3LP0B 4NCGB 2OH2A 2KTQA 3OYJA 4LH5A 4H4MA 1JL1A 1C1BA 4DU4A 3V6DB 2WTFA 2HNZB 2BR0A 4MK9A 2YNFA 4IRDA 1BQMA 4ECSA 1BISA 3HL8A 4XPCA 3C6TB 4CE9A 1S1XA 3V6JA 1X9SA 3Q8QB 4ECRA 5JXSA 4CGHA 3UPFA 3BGRA 1RT7A 4ELVA 3M8SA 4F8RA 1SUQA 4O55A 4FJ8A 3K5NA 4AHSA 1HNVB 3VQ9A 4KB7A 3AVLA 4DL7A 4B8AB 3CWJA 1Q9XA 1RTHA 3H5SA 3QIDA 4R8UB 4CK2A 3T3FA 1WAJA 3HO1A 1UWBA 4U6PA 1JL2A 3QO9A 3PR4A 2EC0A 2XI2A 4Y3CA 5DQHA 4Y1CA 5FDLA 4ZPAA 4HTUA 3OYNA 2IDOA 2BQ3A 4W5TA 3LAMA 1LW0A 4DFPA 4DTSA 2HNDB 3B6PA 2OPSB 4DF8A 2GC8A 4W5RA 2IC3B 4DU1A 4DSFA 3V4IB 4DTUA 3SUNA 1VSIA 2ITGA 3ZT2A 3GIJA 3DOLB 4DSLA 1JXBA 2DFHA 2R8IA 3VQEA 3ZSYA 4WXOA 4TYBA 1N6QB 5DG8A 2XCAA 5KT7A 4NLYA 3BQ2A 3DM2A 3I8DA 5C42B 4TXSA 4ED3A 3SZ2A 3AVCA 2ILZA 4GC7A 1D8YA 2F8SA 5KFSA 1FK9A 5KG5A 1NJXA 1S1UB 4JUZA 4DFJA 4C8LA 1RYSA 1TV6B 5KFWA 1X9MA 3PW4A 3V6HA 1NK6A 4PUOB 5DK5A 4NRTA 1TK0A 3TI0A 3OYDA 4EZ9A 2B5JB 2DFFA 4TQSA 1KFDA 2R8JA 2RDIA 1S48A 1QSYA 1IKYB 3ASMA 5HRRA 3NAIA 1JLEB 4JRPA 1HQUA 3DRSA 3WNFA 3OL9A 3H4DA 4WFYA 3VA0A 1LWCB 1LWFB 4DG1B 4N76A 4LD0A 1UA1A 2G8VA 2PY5A 1RDCA 3QEPA 1J5OB 3HSTB 1A5XA 3O3GA 2ETJA 3LANA 1RDDA 2AGQA 3KJVA 2VG5A 5DLFA 1RTIB 4CJWA 5F9LA 3KLEB 4ECQA 5T14A 5CZ1A 1BI4A 1MU2B 4I9QA 5HLFB 4E7IA 2DY4A 1KVCA 3HVTB 3GV8B 1VSDA 3RAQA 2VA3A 1VSLA 4RW7B 4IH7A 4NZ0A 5HRNA 3PW0A 1HQEA 3CJ4A 4F2RA 1TP7A 2OPRA 2G8IA 2V4RA 3BQ1A 4CEDA 3SUQA 3ZSRA 4BE2A 3CDEA 1XR5A 4F4KA 5KTQA 4J9RA 3CDWA 1JLAA 4RW9A 5KFYA 4Y34A 2ASDA 4BE0A 4NLPA 2RPIA 4Y2AA 2ATQA 4ZTJA 2YNGB 4Q44A 3PJXA 4BDPA 5D3GA 4DTMA 1S4FA 4F3TA 1TAUA 4N41A 1RYRA 1RT4A 1L3VA 1T03B 4KHWA 3BDPA 3PV8A 1KHWA 2VG7B 4LSLA 1BCOA 2R8GA 5L9XA 1S1VB 4NLWA 4B3OB 1RT2A 2FBTA 2BANA 5HP1A 3SQ2A 4CEAA 4CFDA 1TK8A 4ECUA 2DTUA 2GIRA 2HVHA 1I39A 5KFUA 4EYHB 4CGDA 3M8RA 1RBRA 2NUBA 4M3RA 4CEEA 3QERA 3CJ5A 4JV1A 4FS2A 4M3XA 4KHQA 3LWLA 2HNYA 4DTPA 4URGA 2W9BA 4ED8A 4B9SA 1S6QA 3KK3A 1CXUA 3OL6A 3DLRA 3KLVA 4KI4A 4DU3A 3D28A 3C95A 1JKHA 4E1MA 1T3NA 1BCMA 1L3SA 5C25A 3DLBA 4URSA 4O4RA 1U4BA 3A2FA 3KOAA 2BANB 4FJNA 2RDJA 3C94A 2OPPB 3KNAA 2VG7A 1NKCA 2IAJA 1ZBFA 2Q3SA 3V6KA 5KT2A 1T03A 4CFAA 3HM9A 5CYMA 3LP2B 2OPQB 5FROA 1LW2A 2XRIA 5D3GB 4CIFA 3OHBA 1T94A 3I5AA 3RB4A 2RF2B 2RKIB 4DQPA 1C2PA 4AILC 4ZPDA 3VQCA 2B6AA 2IMWP 4FZXC 3RMBA 5C24A 1OS5A 4QW9A 3MR5A 2FVRA 1VSEA 3P83D 4DSKA 4QW8A 4J9MA 4EO6A 4CJKA 4TY8A 4DL2A 1EETB 3NGYA 3BREA 4QPXA 5KT4A 3CYMA 2Z1GA 2EX3A 4E3SA 1F21A 3HVTA 3AVJA 1TAQA 1QSSA 2Z1HA 4KKOA 3NGDA 4Q5VA 3M9NB 2XY5A 3DLHA 3AVMA 4H4OB 3AO2A 4YR0A 2X74A 4HKQA 3AV9A 4CECA 4ED7A 3H59A 3H5UA 5JS2A 3NL0A 5KFEA 2W42A 3PX4A 3BSCA 3OJUA 4J2DA 3JYTA 4RNNA 3V9WA 2PYLA 4IRKA 5FRMA 1HYZA 1X1PA 4Q8FA 4EEYA 2OYQA 1EXQA 1RTJB 1NK8A 4CJEA 1CZ9A 1SV5A 5KG1A 2KW4A 5CYQA 4C8NA 4ECWA 1IKYA 3QIPB 3MF5A 4K50A 1QUVA 4DL4A 3QZ8A 3ALYA 4CJRA 4ZVHA 4PWDB 1JIHA 1NHVA 3AVBA 2HW3A 4Q0BB 5CZ2A 4E7JA 4GC6A 3RMDA 3JSMB 4O44A 3V9ZA 4DTXA 1BL3A 4JLHA 4NLXA 2YKNB 1S1UA 1D5AA 1W9HA 1FK9B 3HP9A 2FJXA 3DM2B 2YKNA 3DDKA 4QOZB 2GBZA 3OLBA 4RW8A 3JSMA 4IRCA 3RB0A 4NCBA 3ZT1A 4RUCA 1TL1A 3SFGA 4PWDA 3DRPB 1N56A 3V4IA 3S3MA 4ZP6A 4IBNA 4HUFA 2R8HA 3TAGA 4Y1DA 2VA2A 4AHCA 1RT5B 1SV5B 1LW0B 2J6SA 3SFUA 4Z4IA 5F8MA 5EWGA 4MFBA 5K14B 4Z0UA 3U6FA 4IH6A 4RUAA 4EP4A 4FJKA 4J9LA 2AU0A 2VG6B 2D3ZA 3T5LA 4QWDA 4WE1B 4FJGA 1FKPB 1VK0A 3HPHA 4FVMA 4H4OA 2KFNA 1SL0A 3TAMB 4RNMA 4IKFA 2QKKA 2IGIA 3OVNA 1RILA 4J9KA 4EP5A 4FLVA 4FS1A 1RT7B 3BGRB 1RA6A 4ZVEA 1GX6A 3QETA 1LWEA 4I7FB 4CJLA 3L3UA 4M42A 2HMIB 1TKDA 2IM1A 2YNFB 4CK1A 4KAIA 5F8LA 3N6LA 2ASJA 3AA5X 3V6DA 3NAHA 3PHEA 1C1BB 4Z4FA 3NGZA 4C8KA 4Z4EA 4H54A 2QK9A 1UAXA 2W7PA 3HVRA 4IG0A 2JC0A 4KI6A 1K1SA 1TKTA 3ZCMA 4KHSA 4KHYA 2HMIA 5DGBA 1ZBIA 3O3HA 2YHBA 2FVSA 2D7SA 3ISND 4YQWA 4NLTA 4WFZA 4FJIA 3O4NA 1LWEB 3LPTA 3QEWA 4FJHA 4K4WA 3K58A 3WNGA 3SI6A 1EX4A 4CF1A 4M3ZA 1Q8IA 3FDSA 3TAMA 3D0PA 4M3WA 5KFCA 4CIEA 4XO0A 1FKPA 3ICLA 4FJ7A 5KFDA 3MFIA 2HWHA 4NLUA 3VQBA 5DQIA 1JLBB 3GIIA 5KT6A 2VG6A 3QLHB 1BHLA 3V9SA 4CGJA 5K14A 4IKAA 4KTQA 2HNYB 4CCHA 4CFBA 4OPKA 5KRSA 4G1QA 4AHVA 5J2MB 3EZ5A 2P5OA 3V1QA 4B9VA 2AQ4A 5DLGA 4FJMA 4NLQA 3P5JA 4FK2A 5KGXA 4FK0A 1S9EA 3VQ4A 1JLQA 2Y1JA 5DG7A 1ASUA 1TL1B 3V9UA 1YT3A 2E9ZA 4MH8A 4IFVB 4B3OA 4CF2A 1ASVA 4X2BA 3LZJA 3NH1A 3KD5E 4YFUA 3QEIA 3BJYA 3I5BA 4J9OA 1RT4B 2KZMA 4BWMA 3KLIA 4DL5A 4I2QA 2C22A 3RRGA 3SPZA 4O44B 2ZE2B 3K5LA 2OA8A 3AO4A 1U48A 4Q0BA 2WB4A 1IG9A 1JLAB 4RW9B 5KFHA 4CGGA 4CJTA 3PO5A 4FLTA 4O3PA 2D5RA 4PQUA 4W5NA 1JLGB 2YHAA 1NNDA 1YVFA 3ZSWA 3OYEA 4FBUA 3K5MA 1S1WA 3KLGB 2R7YA 1QHTA 4DFMA 3ZSQA 1VSKA 2W8LA 1XC9A 1YVUA 2BGGA 4ZP8A 4E19A 1S0NA 3CDUA 1SKRA 4K4ZA 4RW7A 3NHGA 1RTJA 1QS4A 1SKSA 2UUWA 3TWHA 3RB6A 4DTRA 1L3UA 2E4LA 4CJVA 1D9FA 1C0UB 3ZSXA 1MU2A 1C6VA 4F3OA 3RMAA 4DQQA 3UQSA 3TVKA 4NLRA 3PJWA 2ATLA 4QWAA 4DLEA 1S9GA 4QWEA 2JGUA 2F8TA 3HHKA 1J5OA 3OYKA 2HAIA 2FVPA 4KKOB 2GIQA 1N48A 3GYNA 1RBUA 3B6OA 1KSPA 1O1WA 3P1GA 4HYKA 3E51A 1C1CA 1NJYA 3DOKB 3HT3A 4TLRA 2OZMA 4OPJA 4HUGA 1HQUB 1EETA 3QGIA 4TY8B 4NYFA 2AX1A 2HWIA 2ALZA 4CESA 3KLGA 1S1WB 2A1RA 1RTDA 4DWIA 5C24B 4TYAA 4DEZA 3OL8A 3HP6A 1JLGA 2B6AB 3G10A 4DSJA 4N47A 4MK7A 4ECTA 4YP3A 3GV7B 4H8KA 2ZE2A 2RF2A 1ZBUA 4I2QB 1TV6A 2AGPA 3FFIB 1LW2B 2E9RX 5EU7A 2CKWA 4OLAA 5CYMB 2O5DA 3MECB 2IAJB 4FJLA 4ZP7A 1KFSA 1N6QA 4EZ6A 4EO8A 4FLXA 1WSIA 3OYCA 3DLEB 2B4JA
chains in the Genus database with same CATH superfamily
2JWLA 2B8QA 3AA2A 4OMFG 3AVGA 4WJBA 1ZAXA 2ZKUA 1K73O 3QNWB 1JKHB 2PN6A 1BDGA 3MAAB 3OVSA 2JC1A 3ZZOA 2RRAA 2ZEJA 4BDZA 1GMWD 3HPOA 1RDAA 4ZJOA 3M2RA 2BQRA 1H98A 4C0OC 1JLFB 4B3RJ 2NR0A 1ITGA 3UO0A 3L3VA 3EXYA 3WXJA 3F0NA 1WDDA 3GG4A 1D09B 4L76A 4ICLA 2MLZA 1RB0A 1RTHB 3GMGA 2YJEA 1R31A 4QS9A 4CLKA 1HIYA 2P5GA 3VGLA 2F8MA 1HI8A 5DETA 5A8WA 4FF3A 3OYMA 3ZNJ1 1KTVA 3MPUB 1XNRF 3QSIA 4GRSA 4I64A 3LP1A 3S9HA 2HHXA 3T1YK 4YORA 2HURA 1U6BA 2FZCB 4JK8A 2OO4A 1CJVA 3EJMA 2YCHA 2XG8A 1GOBA 1J9AA 4CO1A 1N5QA 2QLBB 2O4GA 4R5PA 1PILA 1OSDA 1WSHA 4JI6K 4OKEA 5C5JA 2W8KA 2H1YA 1IBMJ 3GOIA 3EVMA 4UQTA 3IA0A 5A8RB 3VAGA 4CEZA 1Y10A 2B4PA 4C98A 4CYUA 4PY5A 1KHVA 2W2QP 4TN2A 1K9MT 4I7FA 1VQ6S 3R8YA 2V9WA 2KI2A 2DKOB 4IO8A 3D0GE 5LJVA 5HSPA 1N88A 3CO9A 4DUZK 4P2XA 1RAOA 2VWJA 4ED6A 3QNNA 2Q6BA 4OJGA 3C14B 1X5OA 1RTIA 3KIOA 2A0FB 5DG9A 4O23A 2R7XA 2B9WA 3M6GA 1QE1B 1HWLA 4DV3F 4O5FA 4LT6A 3KWMA 1V3SA 1IKXB 1DTQA 2G8KA 3ZZRA 1VQ9N 1F9FA 1RT5A 4CHZA 1HBMA 1X4DA 3LAKA 5AQKA 2E7XA 1JLEA 4M5IA 2C2EA 3IKMA 4HHTA 5JJBA 2RS2A 2LP4A 2FSKA 2DXEA 1FXXA 4JI4J 3CIMA 4KJIA 4DTJA 3SAGA 3QRRA 4OI1A 3CUNA 4B3MF 1G1XA 2VFSA 4DL6A 2AYBA 3W8GA 3M8QB 4B3SK 2WC9A 5AJ3K 3CJ9A 2JOQA 5EX5A 3WEEB 4E1JA 1R59O 1ROFA 1S9FA 1D8ZA 3CIZA 3R2CJ 2YTCA 4WTYA 3A8KA 4O5BA 5AQNA 3L95X 2ADBA 1N8RT 1OQ6A 1H3DA 1VR6A 4X4SA 4ECZA 3PR5B 4LR8A 4OYAA 2WCXA 3LGNA 1R89A 2E1ZA 3IAYA 1TQLA 8ATCB 3TTCA 3HKWA 4BR0A 2DT9A 3QIPA 4KRWA 1TU0B 2CWKA 4DFKA 1HHTP 1KWMA 4S0MA 3QDKA 1JK9B 4NYZA 1TKXA 3L2RA 1B3TA 4RU9A 3D2EA 3JQMA 3OFGA 4BACA 1HYSA 5AE3A 3M8WA 2FY1A 2DXFA 2DO0A 5KFBA 2EWHA 2YY3A 1U04A 2IBKA 3M1VB 3MEGB 3KK1B 1UJ6A 4LSNA 2MKSA 3FZ2A 1FTRA 1WNEA 2XMWA 1HNVA 2NS1B 2R4FA 1F9HA 3K7RA 1J53A 3UKRB 3IAS9 4O3OA 1XTZA 1NSKL 1LAWA 3FC9A 1HNIB 1WBBA 1U1LA 4NZ6A 1PC5A 3SQ1A 4WK1A 4RKUC 1BQMB 3N6MA 4QIWD 2ZJQQ 2FJDB 1G15A 2MKCA 1U8SA 1BIZA 2EKNA 3CC7N 3C8YA 3QINA 1HR0K 2GWJA 4QYZK 2VBWA 3HZ6A 3QZ7A 1JXEA 4IXCA 4IG3B 2BRLA 4QYZJ 1VI7A 4J9PA 3KK2B 2QTWA 3C2PA 3J7YP 1SQKA 3WXMB 1KQFB 1SQFA 2OPQA 3V2UC 4DQRA 1YSJA 2VL1A 3BB5A 3PW2A 3LPYA 1HBNB 2CNKB 2K1RA 1K8KA 5GMKa 2VQEJ 3D6RA 1S5ZA 2ZWPA 4NWBA 4OZ0A 2ACYA 3I82A 4OX9F 4ISFA 4LVNP 3HBTA 3FZKA 2J6TA 3MCOA 2YH0A 1Q9YA 4KPYA 1B70B 1NMDA 3Q8SB 4IR9A 5AQJA 1MROA 4C8MA 4F04B 3BPSP 1UL3A 3OL7A 4OYMA 3FSYA 2MKHA 3GYGA 4DV0J 2BDPA 3KTQA 2GWKA 5J1EB 1AT1B 2GX9A 3NMRA 2E7WA 5HP1B 4UZCA 1VQ4N 3BGOP 3U8XA 1AW0A 3P4UB 4HVJA 5ETMA 2X6NA 4DDFA 3BYRA 2ZBQA 1EJ7L 4M63C 3CMES 3D2FB 2B43A 4IYQA 2BJ7A 4L74A 2D3O1 3CMAS 3CM6A 1WF0A 4FN5A 2QEXN 1YBTA 1WAFA 2HRUA 3RRKA 5I9EB 2K1RB 1K8KB 3M6VA 2L48A 3TA2A 1CBKA 3NVMA 5BYSA 1BLUA 3AGKA 2XBPA 3R8EA 1V5IB 4LF6F 1B7YB 3KK2A 1HQEB 4DSEA 3D6FB 5KQ8A 4USUA 1EP4A 2DR6A 4DR2J 2VHGA 1Z4UA 4LF8F 5HLFA 1YVNA 2CJ9A 1JJ2M 3HKZD 3ATUA 2P51A 2K2PA 3AAWB 2BE9B 2WUSA 1VIOA 1RAHB 4M94A 4I4BA 4CHQA 3MTKA 2D69A 3HSGA 1JJHA 3U9ZA 2UUAK 1K1QA 3MOJB 3OBWA 4LY7A 4MIAA 3VENA 1Z05A 3CCVN 1MW7A 5I3UA 2UVUA 5IWAF 2GGPA 1LWCA 2CWXA 3WX4A 1UOCA 1C0TB 3H3OB 3MPWA 2HVZA 4B3SF 2YX6A 4ID5A 2ZOMA 1ITPA 1PYSB 4Z4CA 3QEVA 3EUNA 2D1CA 4BRNA 4J2BA 3PZPA 1Q8BA 3M9OB 2P6SA 3THPA 3DYAB 2A10A 1BGXT 3SUPA 4IOBA 3D2EB 1W0HA 3D2WA 4MLHA 3M8PB 1OY6A 1NK7A 1P9QC 2ZWOA 4ILLA 4HTJA 1GOCA 2UVRA 4OV6A 1BQNA 4ECVA 3US5A 2Q31A 4K5SA 5CCMA 2DGVA 4OYIA 1JX4A 3UKUB 3WXIA 4OLPA 3HHLD 3L3CA 4CI6A 2X3DA 5HN0A 5H9EK 3CJ7A 2GQCA 4DCOB 2FTRA 4M41A 2G1HA 1ASWA 4Y65A 3VQ6A 3TEGA 4LF7K 1S7IA 4A8OA 1NMNA 3C66A 1WN7A 4FWLA 3WEEA 1PYOB 5ITHA 2ILYA 3M8QA 3MN6A 3PEJA 4H4KC 3OYGA 1EKSA 2IM3A 1GFWB 3DXKB 3TO8A 3JXUA 2FXUA 4YMEA 3R6GB 5IT4A 4DL3A 4FNHA 5HRSA 3QO9B 3U7JA 4KFBB 4KH0B 2FBYA 3CQYA 3CJ3A 1NK0A 2Z56B 1IBMK 3R7NB 4ILGB 5L1LA 5L8RC 5L38A 1RAJA 1KOOA 4TLQA 3R5DA 1D1UA 4RNOA 3NMUA 4FW2A 2DCUB 1IKVA 3KDOA 4CJUA 1Z6RA 3J7Z5 3F56A 1SQEA 5CH7B 2OTJN 3BQ0A 4DUYK 3LDOA 3CCWA 1NO8A 4ELTA 3ZX2A 2ROEA 3MR3A 2DITA 3NS5A 2KFZA 1EP4B 1NKBA 3G82A 2GW8A 4DV7K 3HULA 4J90A 2UUBF 4FOIA 1T9XA 4GKJF 4NLCA 4YNQA 2UV8G 1ZM9A 3UNGC 4K4TA 4FZZA 4BROA 4C9DA 4IH5A 2XLIA 4JS4A 1MNEA 1T9UA 3KMQA 1VQNN 4N77A 5EHHA 5E41A 1Q81T 2JEFA 4R5PB 3AVIA 3O9TA 1M5PC 4BR2A 3E3XA 3RAXA 4B1YB 1CJVB 4DMZA 2ZH1A 2M5YA 5JVHQ 2EKYA 4H5TA 1RUSA 4NL5A 2KG1A 2XC9A 2DO4A 3NWRA 4DPYA 1NLVA 4YOYA 3PYFA 1OVYA 1LKZA 2Z8QA 1SZ2A 4NZ7A 2LU1A 5A8WB 4OHWA 2HHUA 1RU2A 4KV8A 5BRDA 2YXLA 3BSAA 4OZ3A 3RBDA 4KFBA 4CJ4A 1URRA 3G86A 3R5AA 2C2ZB 3MM9B 3MM5A 2DEJA 1VJQA 4CJ3A 3D0IE 3M2RB 3DLGA 4XAKA 3I0RA 1P9YA 5A0YB 5L1KA 2IM2A 1SJ1A 5HQMA 4JI0F 2E2NA 4DTNA 1VQ6N 2GVZB 2J8SA 2WRMA 5F3ZA 4ZTFA 1J54A 4E7KA 5C2DA 2PC6A 2R7QA 3MUMP 4FPIA 2KN4A 4B9MA 3VQSA 3N28A 1ACMB 4FM1A 3MECA 1QUPA 3GJRB 4X4QA 2V94A 3FFIA 3D68A 1K8AT 2KG0A 3KLFA 3W2VB 4ILHA 4UW2A 1DLOA 4DS4A 4FWSA 5EUHA 4F4YA 3QAUA 3DYAA 1RTDB 1RT6B 4X62J 4AQYJ 1E6VB 2NLWA 3OS1A 1TL7A 4CBWA 2JVRA 5HL7L 4ID5B 1SL1A 3AH6A 4I2PA 3NNHA 1I94K 4WU3A 3MN5A 3DOKA 1C1CB 2JHEA 1GLCG 4CJSA 3NMAA 1UEUA 4ES1A 1HHSA 1Q86T 4LF4J 5M1NA 4B9NA 4Q8EA 4NLGA 4CBXA 5KPTA 3MEGA 3BZKA 4YEAA 1RADB 5DS7A 1IBLF 3QAEA 2DR9A 1KTQA 2OEJA 1PG5B 4TVAB 4WYLA 1KVKA 3KFWX 3WBZA 1OY8A 4JKGB 2E29A 4QIVA 1REVB 1QAXA 4LFCK 5ETLA 3IN5A 1NGHA 1VCTA 5D78A 1DLOB 1YTUA 3DWLA 2E9TA 2XNRA 3KLFB 3SDEB 4P2MA 3PW5A 5FRNA 2KHCA 2BE2B 4JI6J 3TABA 1LXJA 9RUBA 3DMJA 1N32J 4DV4K 2VBXA 4FNIA 5CA5A 4X65J 4ECXA 2BOPA 3MEKA 2JEGA 1FA0A 4LH4A 4IOCQ 4CO2A 4Q2LA 5AE1A 1CULB 3WIUA 4KB0A 4W5QA 2UUCJ 1YTAA 2WAQD 1BQXA 3IDHA 3SXLA 2F4FA 2LXIA 3CD6N 3J81O 3I0RB 4LVOP 3VAFA 4FJ5A 2OTJS 3HVAA 3DLGB 3CO0P 5J1EA 3I0SA 3SEOA 3QWUA 3R6LB 4KPCA 1S9EB 4YDUC 3VQ8A 3PRBA 1N34J 3Q22A 3IP0A 4QAGA 1IO2A 3B78A 2Z1JA 3JTPA 1RNHA 4WIQA 2ZH8A 3NF6A 3DI6B 4HHUA 1ULRA 1IH7A 3V5RA 2MKJA 3H5XA 3A3NB 2GIFA 1H7WA 3NGSA 3MCSA 1UW4A 2DGQA 3GR1A 1IR1A 2MKKA 2OMOA 4P2FA 1Z2ZA 2GV9A 4WZQA 2Z4PA 3UIQA 1QSLA 5TKWA 2XS7A 4U8VA 3OT9A 1X4HA 1YTYA 4BG9A 3WQTA 4BGAA 4HDGA 1S49A 4PAAA 3T1YF 4CZJA 3PDNA 5KI6A 3VF0B 5THWA 4AHUA 3M8ZA 1ZAWA 3AVFA 3ZX0A 2ZBCA 2AJQA 2NZ4A 1NBEB 2N82B 4NCGB 2OH2A 2YQ0A 3U27A 4DU4A 3V6DB 4EMDA 4EUVA 2CJAA 4KC5A 2BR0A 3DJCA 4MK9A 2YNFA 4LF9J 2HIQA 4WCEL 1OIAA 1UJ4A 2R7OA 3W2WA 1S1XA 3V6JA 3AODA 2BJ1A 4ECRA 3BGRA 1RT7A 3CERA 4F8RA 2W6KA 4RBUA 3NNCA 4AHSA 4QS7A 1HNVB 3VQ9A 4IEEA 4B8AB 2QA4S 1RTHA 2BJ8A 1M1HA 3S7RA 1J5EF 4DV2F 2DTJA 3BF3A 5B0GA 3ETMA 4U6PA 3QO9A 2XI2A 4HTUA 3OYNA 3M2VA 3AJ2A 1FRHA 1VQSA 4CZIA 4V1Ak 2AMCB 4WFAL 3RAMA 4PZVA 5AQXA 2HNDB 4C3MA 3B6PA 3ZTQA 4DF8A 3SQGB 5HANA 4ZN1A 4XDDA 3BBFA 2HK2A 1VQLS 2XTJP 2VWBA 2Q0RA 1N8RO 3GIJA 3DOLB 3BO4A 3B82A 1JXBA 4TU7A 1M5VC 1O51A 1HLUA 1FEHA 3GG0A 2MQLA 4MLEA 5KT7A 4NLYA 3BQ2A 3DM2A 4TXSA 5EN1A 3BZCA 3SBMA 4EHTA 2OTLS 1FK9A 5AE2A 4EHUA 3TUPA 1Q78A 3Q83A 3PW4A 3V6HA 2PEHA 4BG8A 4NRTA 3BKFA 3CT9A 3O3LA 1EWRA 3OYDA 3O44A 2LYVA 2X51A 3TA0A 3FCWA 2DH8A 4TQSA 4JI4F 4DR1K 1KFDA 1S48A 3D7EO 4FVUA 1JLEB 3K9JA 1HBMB 1YJTA 3OL9A 2GHVC 2DY1A 2BJ3A 4QR0A 1LWFB 3KYLA 1U6FA 2PY5A 2QEXS 2WW8A 5D6GA 3R1HA 1NGCA 3HZEA 3A4TA 3FUYA 3QEPA 1R0CB 3LW5C 1RDDA 2V6AA 1S3XA 2HGNA 3BBCA 4J5OA 2F65A 4M8LA 1RTIB 4PYAA 5LMNK 4ECQA 2F4VK 2ZM6K 2RMLA 4KGXB 2RQKA 4FWPA 4WQ4C 2ZBPA 4BQZA 3QMQA 3VEOA 3W63A 3AQOA 2LEBA 1W7WA 3I6PA 1VSLA 3UCGA 2L9NA 4NZ0A 3WXLA 1FFSB 3CJ4A 4F2RA 2G8IA 1C0FA 3IM9A 3SUQA 3PRDA 3CDEA 1IQZA 4DR7K 3RW7A 2OGUA 1U8WA 2WFBA 1KDNA 4A47A 4NLPA 2X3GA 3FJ2A 2DRBA 2XYHB 3GP9A 4BDPA 3ID6A 4IOAL 2C2NA 1S4FA 2VPWB 5AQGA 4C2MA 5EX3A 3CCSS 4O0NA 3HMJG 5DJBA 1XQSC 4GY2B 3J81j 5T41A 2F9TA 3UCUP 5L9XA 5CZXA 1S1VB 4NLWA 4B3OB 5L9NA 5HP1A 4BCAA 1VHXA 4CEAA 3OPKA 3O5BA 1TK8A 2LXFA 3KJQB 2ZFHA 3ET6B 3RBXA 1JB0C 2BEFA 4CNZA 4EYHB 4HLBA 7FDRA 3ENBA 2NUBA 4M3RA 3E9LA 1MROB 3QERA 4WF9L 5DZ6A 1VMBA 4A59A 1IM6A 4B9SA 3KK3A 2CPYA 3DLRA 3KLVA 2QWRA 3E9PA 4IWVA 4BC9A 1CJTB 2C3MA 1JKHA 4E1MA 3OTBA 1T3NA 3VEZA 4URSA 4O4RA 1U4BA 2BZ2A 2ZH3A 3CETA 4FJNA 3C94A 2IVOA 1HBNA 1AZSB 1MMNA 1OJ4A 3HX9A 3VF4A 2VG7A 2C3PA 3M32A 2C3UA 4DV1J 2EG1A 2VONA 2Q3SA 3AD8C 2ABYA 5KT2A 1T03A 4CLZA 2VB6A 1N34K 1AA1B 2OPQB 4CIOA 3MMJA 3DFEA 2C1EB 5D3GB 4L75A 1T6DA 1Y7PA 4A62A 1WHWA 4DQPA 2UXDF 3R1XA 4AILC 4ANCA 4FZXC 5C24A 2HBQB 4LJMA 2FVRA 1GK8A 4QW8A 3O9UA 2UV8A 1DGKN 3NGYA 1Q8KA 2LU2A 1VFJA 3CYMA 3ADAC 1F21A 3HVTA 3AVJA 3T69A 4FYVB 1XNQF 3NGDA 3UKRA 2E20A 4DPUA 1Y64A 3JAMY 3IWNC 3FRYA 3UN3A 2X74A 4CECA 2KDOA 3UN2A 4DR7F 2F5GA 1SC1B 2W42A 4U67Q 1ZC6A 3AAQA 2PYLA 5FRMA 2CPZA 3PYGA 4OHZA 3LM9A 4BVPA 3DNCA 2R7RA 2PMZD 5KG1A 1B0VA 4JBCA 4X65F 4IO9L 2NNWA 2ZF5O 3T41A 3QIPB 2BABA 2AJ1A 3QZ8A 3D54A 1I51B 2DHXA 2QLFB 4EWTA 3PG9A 5CZ2A 4MYTA 2C2KB 3V9ZA 4JI8J 1NLKL 1JCFA 4JLHA 4NLXA 3VAIA 1NDCA 4NXNK 4V19X 4BR4A 1JNRB 3BH6B 3HP9A 5DRKA 4X4UA 3KHYA 2YKNA 2GVDB 8AT1B 5IT9O 2KRBA 4QOZB 2PSZA 3JSMA 1KS2A 2P2CB 1FDAA 5JLHA 3Q2TC 2B9EA 2P9UA 4C7QA 2W7AA 4LF4F 1RABB 2MSTA 4IBNA 1DQ9A 5IV3A 1RLCL 4AHCA 3GFYA 1RT5B 1FJCA 3HSDA 1DQAA 3I56S 4KHPJ 4DQ8A 4CLLA 3U4LA 2HQGA 1PKUA 2FGCA 4J7CA 4IH6A 3MPVA 2HFZA 3T5LA 3H2VE 1V9OA 3GJSB 2W2MP 3HSJA 3MM7B 2RQ4A 2E8AA 4KH5A 2KFNA 1SL0A 3VV2B 2B56A 2R7TA 4RNMA 1O13A 4PPDA 1U1KA 2QKKA 1IBKJ 5JVGL 5C2CA 3Q24A 3POTB 2CA9A 4X84A 3GBTA 1RHJB 4DHVA 2GFFA 4CD3A 1KXPA 2CQBA 5A8RA 1X0PA 3PCOB 2ASJA 1SIWB 1C1BB 3O6QA 3IR6B 5C2GA 4WFNQ 4H54A 2QK9A 3Q8VA 4LRCA 3HVRA 1BMQB 1DURA 4YHHK 2GO8A 1TKTA 1SCJB 1WSRA 1DBDA 5DGBA 3O3HA 5BREA 2YHBA 4IFEA 2MEWA 4NEZA 4NLTA 4YQWA 1FERA 1CS4B 3TP2A 2EFQA 1EX4A 4CF1A 4K0KJ 3GG1A 3FDSA 4Y2KA 1K0TA 4CRJA 2P9SA 1FKPA 3ICLA 4FJ7A 2W1BA 3P3DA 2HWHA 2RRNA 5DQIA 2ZZMA 4DV4F 5KT6A 2QM1A 3V9SA 3OXFA 3B8HA 5K14A 5H1SQ 4DR3F 2HNYB 4OPKA 1C0GA 4AHVA 2DGWA 5J2MB 3GFZA 5LMNF 2BW2A 3EZ5A 2YX4A 4P9SA 5DLGA 5GADI 3UDEA 4NXMJ 4FK2A 4I6YA 4ANDA 6FDRA 4WU2A 3FMBA 4XDCA 2X1BA 3AA9A 3VQ4A 3MM6B 5HJXA 3G96A 1DAXA 4G1IA 2Y1JA 1ZBSA 1HBOA 2VC1A 1ASUA 2FB0A 4MH8A 2M8DB 2DBBA 1FFWB 2QI2A 4JB8B 4X2BA 4A8WA 4JK9A 1N5TA 1GLJO 4YFUA 4J9OA 4JOUA 3FZHA 2KZMA 4V19S 1X7VA 2P9LA 4WKRA 3I87A 2Z2LA 3SPZA 1AYEA 2HF3A 2OA8A 3FGVA 3AO4A 1X3MA 4Q0BA 1IG9A 1NCLA 4RW9B 3CCUS 3O8WA 2D5RA 4G65A 3D3CJ 2ZH2A 4DFMA 4DV7J 3ZSQA 1VSKA 1S59A 2BGGA 3Q23A 2MPUA 3MTJA 2UUCK 5B0BA 5E84A 4CO0A 1FDBA 2UUWA 3ZXWA 3DAWA 2W4DA 1C0UB 1MU2A 4F3OA 3G4SN 2O8FB 2XWXA 2KT2A 3MDFA 3O6WA 2B9XA 4DV7F 4RL1A 3O80A 3DXMA 3FVYA 2NRRA 3A12A 1SB6A 2JGUA 2F8TA 3AOBA 1U02A 2VKZG 3P1GA 2JLFA 3E51A 4NOHA 3EE8A 4TLRA 1SI9A 2XZDB 4A8MP 4TY8B 3R9PA 2VF3A 3PHTA 2AX1A 1L3KA 3G6EN 4ISEA 3TWZA 2ALZA 4CESA 3KLGA 2A1RA 4DWIA 3QFPA 4TYAA 2KHOA 4HVZA 5E3QA 4DSJA 3Q8YA 4ECTA 3GV7B 4BBYA 4NASA 2UUAJ 2ZE2A 4KR0B 4BRLA 3MMBB 5E33A 1D3WA 1WC6A 2J9EA 4R0JA 2CKWA 1YG0A 3M30B 4CZHA 2YH1A 2Z0GA 3IMXA 4OI3A 5C12A 3NCPA 4FJLA 4K25A 4FLXA 4E2FB 3OYCA 3SK3A 1SL2A 3CCJS 3NFAA 4LF7F 4U8YA 2IC3A 2O01C 5LJ5Y 2VKRA 2F8EX 1S0MA 2N4DA 1S6QB 5KFTA 3MD3A 4CZCA 1HPZA 2PI5A 3E01B 2W9BB 2R2UA 1ZM2A 2ZITA 3R5GA 1UCNA 3HVWA 4EI2A 1UWBB 2GMHA 4WBFA 4CM2A 1G99A 1IM4A 2AP6A 4CF0A 3EE9A 1U49A 1WSEA 3EGZA 4CJ7A 1Y4ZB 5DDRC 3MCAB 3S1TA 4LF5F 3E66A 4KB1A 4A2AA 2BKNA 2J8AA 3VGVA 5KG3A 4B3TJ 2IA0A 3OR2A 1HWKA 2EFGA 3BGUA 4MJKA 3LPUA 4YB6A 1UVKA 2O8BA 2F96A 2GEMA 1LNQA 2Q66A 3FBEA 4ED4A 3ENOA 2I7PA 2E7VA 3TA1A 3OQ2A 3KHGA 4HH1A 2NQPA 4K4VA 2QL7B 3VQQA 4NA3A 5MAOA 2CQGA 2VQFJ 2OLWA 3KHLA 2GTDA 1RCHA 4X4OA 3D45A 2PMWA 2IYGA 2BKOA 3BH7B 4B9LA 3OA9A 4IZ9A 1XJWB 3OVBA 5AQSA 5KFGA 5HQ8A 4JRQA 3OJSA 1XMQK 3C6HA 3EPGA 3T9ZA 2VQEK 3Q7BA 4PEOA 4H5WA 2QFIA 5FPNA 2MYFA 3KXDA 2W01A 2M9KA 1KLNA 4CZMA 3MURP 3DXBA 4IOXA 4BRFA 2BUNA 3OTOJ 5B0AA 2ZWHA 1SVDA 2W9CA 4MFBB 1WSFA 4DG1A 4QJVA 1U1NA 4M1KA 1F0XA 5IM0B 2H3GX 2LQ8A 1ATRA 3AVAA 5AQMA 3IGNA 3IRXA 2FJWA 5CE3A 1GLDG 4CZGA 2ZJRL 4OVLA 3OYFA 1Z25A 4BDYA 1TUVA 4TNOA 4EBCA 1JXVA 1HBUA 4GKKJ 3CC2S 2DNMA 2XI3A 1HJRA 4ZVQB 4X4RA 2J7KA 4J9QA 4RW8B 2ZJPQ 1VRTA 3PM9A 2OD4A 3AVKA 1UVMA 5AQUA 1FJGF 4XPEA 3FZFA 5HMZA 2R8KA 3HK2A 2A1BA 4EU0A 4DR5K 1NBWA 3AY0A 1TGOA 5EOYA 3PFEA 3AA4A 3RVCA 1F2HA 5AZIA 2IRYA 2G9OA 4K5RA 1MN7A 4U95A 3T5KA 2XCPA 4WYWA 4FCYA 1IUJA 1ZOTA 2DRDA 1HJOA 3N9UC 4TU9A 4KE5A 2DIVA 4O8KA 3WIVA 5CYQB 1CLQA 3DRRA 5EWFA 1MMDA 4K8ZA 3PX0A 3ZSZA 3OYLA 3AXMA 2FHJD 1TK5A 5IXUA 1T0TV 4IFYB 4HI2A 2QXFA 3TJAA 1YITS 3GFXA 2QXLA 2FPHX 2VJVA 2NSBA 1LCUA 2QX0A 2H54B 5LMUJ 3VN5A 1YAGA 3C3LA 2BQUA 1T7PA 5AJ3J 2W25A 1BIUA 1HFEL 4PA1A 3I55N 1VRUB 4JKDA 1VHIA 2FHKA 2FLPA 1FW6A 2JEJA 2FC8A 4JI4K 4OHVA 3HHLA 4OYOA 5IS2A 2CQ4A 3IC1A 3THYB 1X4FA 2FGOA 4C1NK 2V9KA 2D41A 4KREA 4DN0A 3CCJN 4FP9A 3CCLS 5DMRA 2J0WA 4H4MB 1TYQA 1RDBA 4GMKA 2OELA 4JYAJ 1D9AA 2ZD1A 1X8DA 3IGVA 2E5LK 5HAOA 1SJ4P 4ZVFA 3NWGA 3RR8A 2PO4A 3DDNA 4CZLA 1HW8A 4KIAA 4P7TA 5U47A 4DUZJ 3V4MA 1LFPA 3NF8A 1VQ8S 5DGAA 2EBGA 1JLCB 2AZ3A 4CEFA 4EYIB 3N4QA 4DR1F 3F9KA 3TR8A 4K4YA 2H5JB 4F50A 2YI1A 3GE1A 4KAZA 3H25A 4F02A 5CQGA 4FO0A 4OGCA 4CJFA 3QNOA 1WUUA 2E2OA 4KBIA 5T7LA 5E3PA 4J2EA 5LSRA 5MLCV 1YIJS 3BSOA 1QTMA 4WF9Q 2J6UA 4GVBB 1ZAVA 3UB5A 2ASPA 1U47A 3QPIA 2YV0X 5CY4A 2A18A 5LJWA 4L72B 4IUFA 3ZZZA 2PT0A 2DXDA 3WNEA 5F8GA 4JN4A 3B4DA 3LDPA 1IBMF 4Z37A 5KG2A 3NG8A 1B9FA 1FFGB 4N8NA 5H9FK 5BPLA 1K9MO 3BN7A 4LSLB 4L6V3 3PKYA 2PFFB 1SH0A 3NRBA 2IHR1 4FF2A 2UYTA 3H45C 4RLEA 2AYEA 3W66A 1GX5A 1VSJA 2A2CA 1U0HB 2W4PA 3BEGB 3BY5A 1VYAA 5EWEA 4ID8A 2D0AA 2HRTA 2AYMA 4CHPA 3ZTPA 1J5EK 5KFQA 5AQQA 3N79A 2XYPB 2L3MA 2DHAA 1ILYA 1YIJN 3LGMA 3VCDA 3ZT3A 5D4PA 3QICA 3ZX3A 1PC4A 1KD1T 2GQQA 1FWPA 2OPRB 2M8HA 4J9NA 2H4WB 3RSEA 2X6SA 3ILJA 4C97A 1CSJA 1HNZK 2HFVA 5AT1B 4RR5A 2X1AA 4F67A 3VPZA 2QE5A 4LF1A 2NXUA 1S72S 4Y6IA 3GYXB 3NBPA 1WC0A 1RGIA 3A8YA 4WP9A 2EEYA 2O8CA 2DD8S 3KLEA 4CO5A 1VQ4S 2DNHA 3X3UA 3Q7CA 5LY3A 4KBOA 2E6LA 4P10A 4Z4HA 2HKEA 5B0EA 4GVEA 1C1AA 2Y0BB 2Z1IA 1YRUA 4PRFA 3DRSB 5M2UA 2W41A 4JV0A 2DPJA 4DQIA 5KFJA 5AQWA 1UJ5A 3LGHA 3LUYA 2IYIA 2UU9F 4IFYA 1G4CA 2J0QD 3ISNC 4PUOA 1X4EA 3GJTB 1R8HA 4P75A 2NRXA 5G0RB 3EGNA 3NE6A 2C2MB 4CJ5A 3FZMA 1U2RA 2VDIA 1V3RA 4HR2A 4CBUA 1IWAA 4P52A 1XR7A 3MCPA 5LXRA 1QY7A 1ZH5A 1VBZA 2J0XA 4PG5A 4ZLLA 4X64F 3ZZYA 4O4GB 1SS6A 5IC6B 1XK8A 4M45A 2CXEA 1VQLN 4YB7A 1NJZA 2XMMA 1E3MA 3MAQA 2NZTA 5A2QY 2JFKA 4UOCA 1DARA 1RHQB 4B1UB 2RHKA 3OUYB 1QAJA 4ELUA 4O8UA 4O3QA 3FCHA 2QMWA 3CM5A 1X60A 3A5OC 3A8IA 4O3RA 3HFZB 1Y5NB 4QCLA 2KB2A 1E6YB 3MXIA 3IRXB 3SI8A 1NK9A 2WBRA 4WXWA 1RACB 3EZOA 4IO9Q 3QESA 3W62A 5RUBA 3J80U 2OI2A 1R8PA 2W2NP 3ZZPA 3LZIA 4YS2A 5DM7L 1U26A 3AO3A 1P27B 1TUUA 4EIAA 4CZKA 2V68A 4YY3F 2F7VA 4L8RB 1U2FA 4JI7K 4ZP9A 3HSCA 2COLA 1XNRK 3HOTA 2V2ZA 4DPWA 2ASLA 1ZBHA 5L39A 4IOCL 2BE7D 2YNHB 5KFFA 3LF0A 2RN2A 1LEOA 1VOMA 3G8TA 2JL9A 1PSDA 1RT3B 2JH3A 4DTOA 2VFTA 3UR0A 1OH8A 1MA9B 3LPEA 3AA3A 2G8FA 4NLVA 2V2QA 3RRHA 2JZ5A 4LQ3A 1WKLA 2YPZA 1H72C 2EI5A 1KVAA 3DKDA 3HHEA 3OV7A 1CJKB 2GQ2A 4WZMA 1O8BA 3Q8RB 3QT7A 1RT3A 3R3TA 3CQ8A 2I5JB 2GMJA 4JI0K 1FVQA 3AOCA 3HZGA 3VZHA 3QJPA 4RCHA 2HB5A 3AJ1A 5FPEA 4LFBJ 2AIRB 5K20B 5JS1A 2IOCA 4HHHA 4E89A 3D6MB 2CQCA 3AO1A 2X78A 4I6MA 2FBXA 4BVOA 3QFHA 4B9QA 2ZZTA 5DQGA 3ILIA 1BA0A 2G13A 3SNNA 4K0KF 5D4OA 1U1OA 1RBLA 1WEXA 4KHNA 1X4CA 2IY5B 5HJYA 1RWUA 1XBWA 4UOHA 5ELZA 4NLDA 1HRHA 1HPZB 1IKWA 2W40A 4LF5J 3I9ZA 3SMPA 3W1YC 3FQKA 4ZLNA 4CIGA 4U7UK 4LBHA 2W6LA 1N5YB 4KT0C 4HH0A 5KG4A 4JI3F 1RCOB 4LFCJ 4ETXA 2ZJQL 4GKJK 4CZFA 3MWPA 3U02A 4HCCA 4FYXB 1U09A 2GO9A 1N33K 5EX0A 3G6XA 3MGJA 1K0VA 3T6BA 4KGKA 3LALA 5HVHA 2XMVA 3PO4A 2V63A 4C8OA 2W4CA 3VQPA 2D3UA 4CHYA 5GAHU 1SH2A 2ATCB 1VQMS 4JI2J 5AR0A 3FCVA 4FK4A 2P9IB 2OMLA 2XWYA 5JMNA 1G6BA 1CXQA 4ZK7M 5IQQA 3HPGA 2UU9J 3RYLA 4XIUA 2IM0A 1SKUB 4R25A 5KFNA 2PYJA 3MAHA 4JK7A 3PYEA 2OD6A 4I67A 2MQNA 3DOMA 2ERRA 2B3TB 2Y9HA 3OYAA 2DPIA 3SJJA 3A1YG 3DRXA 1C0MA 2YKMB 1GEHA 4GV9A 4BRHA 3THXB 5BN8A 5A6PA 4X4TA 1RT1A 3DGPB 4MO4A 1FJGJ 2KU7A 2HHHJ 4KSEB 2HS4A 2BJ9A 1ZBLA 1X3NA 1WI8A 5J2PB 3P38A 5E2QA 2GJIA 2XM3A 4FZYA 2V8DA 5KFPA 3GV5B 2GJFA 3BUZB 5KQDA 3M05A 5IT9U 4HCBA 1T9WA 2CH6A 1FHTA 4PQUB 2GUPA 3VF2A 4RBTA 4AXIA 4ZVOB 4RG8A 4FPRA 3A8JA 1W25A 2EWSA 4NCAA 3O4QA 1B4SA 2VZ9A 4BS2A 4M5HA 1RCXB 3SLCA 1NB7A 2UXBJ 1HI0P 1WSGA 2E1MC 3OFHA 1HBOB 2KM8B 2PZSA 4F4WA 1KAYA 4WP8A 3RB3A 1XNQJ 3DU6A 1TKZB 2E44A 1NNEA 4H5RA 2HHVA 1RFQA 3TSPA 1A9NB 4JKCA 2HWTA 4LF9K 5GIOA 4GVBA 2HHHK 3ZZTA 5L1IA 2VICA 3KHHA 3K0SA 4B9TA 2NXJA 2EHGA 1CQMA 2XHWA 4JI5F 4CEQA 4CEOA 4EGLA 2P9SB 4QIGA 1SQGA 2VJUA 4K7QA 4LF5K 2NUUG 1FRKA 2VV5A 2WOMA 2D0BA 2VYPA 3G4SS 1JLCA 1CS4A 1AXQA 3UI3A 1H38A 2YKAA 2I5JA 3WZ0A 2IA6A 1CZAN 3EICA 1LV5A 2O4IA 1HNWJ 4C8ZA 4U7BA 4QWBA 4F36A 2HYIB 4CVNE 1TKTB 2YWFA 1IJEB 5KAKA 3LDQA 3I32A 2MLXA 5KFRA 4OYXA 1TYQB 1VC5A 1M0SA 4H4MA 1JL1A 1YJ7A 5TKYA 4PHTX 3E2EA 3QRPA 4IRDA 3G2XA 1QVGR 2ZUGA 4XPCA 3C6TB 4CE9A 2HVDA 2Q2RA 4KGVB 2O67A 2LDIA 2DIUA 2CRLA 2GELA 3Q8QB 5JXSA 1OKJA 3HHLB 3P5BP 3UR3C 2HIYA 4AE5A 2E5LF 3CXCM 4DL7A 1Q9XA 3CWJA 3H1QA 1PAUB 4R8UB 3F2KA 1WAJA 3FMWA 3CCMS 4KY3A 1UWBA 5HVGA 1JL2A 3VAKA 4QIFA 4IDHA 4Y3CA 4Y1CA 5FDLA 2GHPA 4Y2MA 4HTLA 1UFLA 2BQ3A 4X65K 4USKA 4DX7A 4W5TA 3LAMA 4PWUA 1OSCA 4DFPA 2VD3A 4DTSA 1YWXA 2HS3A 2IC3B 3W7BA 4DU1A 1T3VA 3V4IB 4UY8T 5GADU 3SUNA 1FX2A 2LQBA 1VSIA 1SJ3P 1NSQA 3ZT2A 1WHVA 2QA2A 5FIIA 3JTNA 2RD5C 2DFHA 2R8IA 4W92B 3VQEA 3ZSYA 4WXOA 1APSA 1HR0F 3I8DA 5C42B 2B7CB 4PXDA 3SZ2A 2EFVA 1YJUA 2MZTA 3AVCA 2P9KB 4CO4A 1D8YA 3MN9A 5KG5A 3K8WA 1V5VA 4JUZA 2QA4N 2QL5B 4K2XA 2CQPA 2HOEA 1S12A 4P72A 4PUOB 2J0SD 4JI1F 4EZ9A 4LSZB 1QSYA 3CMAN 4WKYA 4U96A 2B4OA 4DX6A 1N32F 3P49B 3DRSA 3OW2R 1ICEB 2DGOA 1N54B 1OMSA 2G0CA 3SCLE 4AQYK 2NZCA 3VA0A 5A76A 1WJ9A 1QQMA 3VGMA 4LD0A 1UA1A 2G8VA 5GINA 1RDCA 5CD4A 3HSTB 4JI1J 4LF6K 3CEDA 4JKFA 4OJ1A 2QMXA 4U9RA 5DLFA 1NMEB 4QS8A 1RWWB 3KLEB 3Q2SC 2O8CB 4ZVTB 4DR4K 3HVTB 1YI2S 1VK8A 1KQKA 5HRNA 2MZ1A 3PW0A 1TP7A 2OPRA 4BRKA 3BQ1A 3A8EA 3AY9A 3ZSRA 1VQ5N 4F4KA 1XR5A 4AXJA 3LQVA 4BRMA 3O9QA 2M0GB 4JYAK 3B4MA 3CCRS 2XYGB 2ASDA 1AB8A 4ZTJA 3OTEA 1NU4A 5DO2A 2HBRB 3FEXB 3MR7A 3GCWP 1A0OB 5AFUH 2NXNA 1L3VA 3T9NA 1U1PA 4OI2A 3ZLJA 1KHWA 3W5XA 1BCOA 2KYZA 1AZSA 5F41A 4Z94A 4JP8A 3VWSA 2ZZNA 5HO4A 2Q0UA 4OZLA 2F1FA 5LMUK 5JLFA 4YDUA 1I39A 2P9NA 2XLKA 4CGDA 1RBRA 3LDNA 2V4JB 3VZIA 3M5RA 3QBCA 1J5EJ 4I69A 2G0JA 1IXKA 2HVEA 4M63A 4CTAB 4DTPA 4URGA 4ED8A 2VFUA 5DM6L 3GE9A 3C46A 3DU5A 2Q1LA 1Q53A 2YQ3A 3OL6A 2ITMA 3CD0A 1WOOA 1ZS6A 4KI4A 4DU3A 3D28A 3CJCA 3T6JA 4LFAF 1KAZA 2MJUA 2BANB 4JI3K 2LQ9A 4AF1A 4I68A 3HHNB 1ZBFA 2NRHA 3V6KA 1XMQJ 3C15B 3LP2B 4DR2F 3A5MC 1UZDA 5CHCB 4J9UE 3LOUA 4CIFA 1NJIO 3PRVA 1GAOA 2RKIB 1F2GA 2P5VA 3VEVA 1Q5VA 3CJTA 1YLXA 3VQCA 1GTEA 4CLWA 2M2BA 3RMBA 3TX8A 3WC0A 1OS5A 3MR5A 1VSEA 3P83D 2KH9A 2GZOA 4EO6A 4NEYA 4CJKA 4TY8A 2KXFA 4H03B 4OJ3A 1SIZA 4IOAQ 2DH9A 3THYA 4L3KA 1BWVA 2PDAA 3QWPA 2V69A 2X7IA 2UUBJ 4M5NA 3NOCA 1WOSA 3VAHA 4Q5VA 2A6OA 1QZ5A 2XY5A 3P8BB 3MWTA 2FLOA 3AO2A 4HKQA 3AV9A 4ED7A 3EDRB 2HZCA 1E4GT 4H0PA 3ZETB 1VIXA 3H5UA 1Y0HA 4WTOB 3FBCA 3E1YA 1VC0A 5BR8J 2RE2A 1T9TA 3CB4A 3L9ZA 1Q82T 4IRKA 4DCHA 1P1LA 1U2VB 5AQPA 4Q8FA 3BM7A 2FSJA 3NEKA 1EXQA 4JV5K 1CZ9A 4MKYA 4GO7X 2E1CA 4DKWA 3AGRA 5CYQA 3Q89A 2EK6A 4ECWA 1IKYA 3HD2A 3D67A 2BTFA 3MF5A 4K50A 4R79A 1ATSA 1U6ZA 3ALYA 1A7GE 4PXBA 4CJRA 5L46A 1D4XA 1RSCA 4QBUA 4DR6J 1KD1O 2A41A 2AJFE 3U1MA 2FUG9 4E7JA 1ZPWX 3RMDA 1NU0A 3JSMB 3KUHA 5AZIB 3QQCD 2EFPA 3BF4A 4C6AA 1S1UA 2D4WA 4PQAA 1LWXA 1HLWA 1FK9B 1HD1A 4U7UD 5ADXH 2MZQA 2FJXA 3I4PA 1VQ7S 2GBZA 1P8GA 2E1AA 3JSRA 2RQMA 3ZFVA 3GIRA 5AQIA 4HDHA 4D3HA 1N56A 2OSQA 2GS8A 3MHYA 3SQGA 3AFGA 4HUFA 5CABA 1YJNN 3TAGA 2KFYA 4DV0K 4M5JA 2CNOB 3FEYB 1XUPO 1LW0B 5GVQA 1FRIA 2J6SA 5EY4A 2CVEA 5GAEP 2U1AA 1BD6A 4Z4IA 4MFBA 5K14B 5DDQC 4EP4A 4J9LA 4DR2K 2AU0A 5I4MA 1N34F 1VQ8N 2RJZA 4QWDA 1BXNA 4WE1B 2BBEA 1FKPB 4FVMA 4H4OA 2H5IB 3H6EA 2GHWA 4IKFA 5GAHP 4J9KA 2DVIA 4EP5A 4FS1A 3BGRB 3QETA 2MQQA 2WZ1A 1YJ9N 1O6XA 4CJLA 1N52B 3W5ZA 3PYDA 1P8ZA 5ETRA 4M42A 4H0YB 4NXMF 5BJRA 2HMIB 1TKDA 2YNFB 3BS9A 4CK1A 4KAIA 1HNXJ 3NAHA 4XTTA 4HHJA 1WSVA 1B0PA 4C8KA 1WUAA 2Z58B 3ENQA 3TVYA 4Z4EA 2GAGC 2N3OA 2J7WA 1UAXA 2H9ZA 3SCKE 4KI6A 4E98A 4QR2A 1S99A 2QA1A 3OTOK 4KHSA 3JTOA 5K8PA 2K06A 3SAFA 4GV6A 4X4VA 2Z2YB 3UE5A 2D7SA 1PBUA 4AL6A 2PAVA 3M32B 3O4NA 1Q81O 3TTDA 3FGUA 4USWA 3K58A 3WNGA 3FBBA 2RE1A 3VEYA 1Q8IA 3TAMA 4DZ6A 5A8KA 4J8FA 3C19A 3ZO7A 3MFIA 1CJTA 4GKKK 1JLBB 1W7AA 4LRBA 4MKVA 1T3OA 2VG6A 2VQFK 1RHRB 2BXJA 2FSNA 2E88A 1XQIA 1AROP 2MMYA 4CCHA 1NEEA 4CFBA 5KRSA 2CGJA 5LM7E 4DZDA 1WOPA 3V1QA 2E66A 4B9VA 4YHHF 1CJUB 4FJMA 4NLQA 3P5JA 4NMLA 4ED5A 1BO5O 1SAZA 3NP5A 2POKA 3AB4B 2VASA 2WVEA 1YT3A 5GAGP 4IFVB 4CF2A 1EQYA 3O08A 3KD5E 2E2PA 3VMFB 1CULA 4QYRA 2BH1A 4FZVA 4BWMA 3U9DA 1OVQA 2QSFA 1VAZA 3CC4S 4LMZA 4DL5A 2C22A 3RRGA 2CPFA 1B99A 4O44B 1U48A 5M1PA 2O3DA 1RU1A 2E5IA 2WB4A 2VIHA 5KFHA 4CGGA 3L7UA 4B3SJ 2AKWB 1JLGB 2YHAA 1KQSM 3ZSWA 2NXEA 4FBUA 2R7YA 3KLGB 4CLTA 1QHTA 4JI1K 3CD5A 1NGJA 4IEIA 4ZP8A 1WKKA 1S0NA 3CDUA 2Y1LB 2FJBB 1SKRA 1VQON 4FWQA 3FE1A 3NHGA 2WTUA 4UUXA 3TWHA 1YK9A 3RB6A 3EL2A 4ES2A 4CLPA 1L3UA 4JKGA 1JWWA 2E4LA 2AJ0A 1OYEA 3LO3A 3CJRA 2CYYA 3QFWA 3CC2N 3BKTA 2DHHA 4YOXA 5H1SV 3TVKA 4NLRA 4YDXA 2ATLA 1RDWX 4DR6K 3CDAA 1S9GA 3FSXA 3HHKA 2ZH5A 3BO3A 2AEMA 4BRDA 4KKOB 4KYZA 4W4MA 3GYNA 1RBUA 1HNZF 1C1CA 1NJYA 3DOKB 2OZMA 4HL9A 3TZWA 3QGIA 4FL9A 4NYFA 4ZCKA 3AJDA 2ZKTA 2KRRA 4N47A 1J6ZA 4MK7A 4YP3A 3VAJA 4UF4A 4FDFA 1EQ0A 1ZBUA 1KR4A 2K8GA 3W2VA 1HX1A 5BR9A 3D1HA 4NPOA 4A8KA 2AEFA 1LW2B 4A4JA 1GLBG 3D1OA 2E9RX 5EU7A 3KK7A 2O5DA 3UN5A 3MECB 4PABA 2I7NA 2BOAA 4DXLA 5FD1A 1KFSA 1GOAA 2J9DA 3DOLA 2EVZA 4ALZA 2R7SA 2VC0A 3CFRA 4MK8A 4ZPBA 5AZJB 3A13A 4K8RA 1FD8A 4YY3J 5CAAA 4LIWA 4OL8A 5DM6Q 3L2QA 4UY8O 3H98A 2PA3A 3MMAB 5KPZA 3RWUA 5J2MA 3KK3B 3W3DA 1R8CA 5KFVA 2QTDA 3MD1A 2E1RA 4JI3J 3GWCA 5KGWA 3L8BA 3EZUA 1QHAA 4KV8B 4OV1A 1QTNB 3PVXA 2LLZA 3CC4N 1Y97A 2HQFA 3M6WA 3ULHA 4IR1A 1S1VA 2E5GA 2QWQA 1HNWK 3T7ZA 4TY9A 1XHXA 3TPQA 1HKBA 3VGUA 3W2WB 2YJFA 2RVJA 4OX8A 4LFAK 1VQ9S 2YNGA 1EKEA 2Z2MA 3VQAA 4Z2XA 3GTYX 5EDWA 1X31C 3LP0A 3RBEA 3VVUA 1UETA 3MEDB 3UDLA 1DEJA 3CG7A 3MM8A 4FWNA 2O8DB 3O3FA 1YBAA 4DV2K 4J37A 4K4UA 4CEBA 4C1NI 3KJFB 3K57A 3OTCA 1SKWA 4DV1K 2UZAA 3LTOA 1GXUA 1ZTWA 2AJ2A 4F0MA 1NK4A 3QIOA 1UEKA 1WC5A 1UP1A 3VTIA 5LMUF 2YNIA 1EX8A 3TAFA 3MZIA 5L1JA 4KH4A 3V1OA 4IDKB 5ETQA 3A5LC 3K5OA 2UUCF 2V8GA 1RDRA 3OLAA 2MZSA 4CFCA 1IKVB 2QKBA 5I3QA 1FJ7A 5DM7Q 1JXLA 2CPXA 3M6UA 3AOAA 5M1KA 5KOXA 2KO1A 1U7LA 2OAUA 4RWWA 3S01A 3DI6A 4ZITA 4NXMK 1QAYA 4EFAC 4F2SA 2RH3A 3J7AN 3SMZA 3FZLA 2IDEA 4NI2B 1S0OA 1GMVA 3H3NO 2DNNA 4RX6A 3L4BC 5J2QB 3LWMA 2B5JA 4OPHA 3WQUA 3OYIA 5HROB 3O4WA 2BM0A 1RJJA 2IFXA 2DR7A 4P71A 3DRYA 4OKKA 2BUPA 1VQPN 5AFUA 2KXHA 2ZH9A 1XMOK 2FVQA 3OY9A 3C7NA 2RNEA 4K0KK 4CO3A 3WT0A 4BQLA 3H7HB 1Z1ZA 5KG6A 2CAJA 3VR1A 3AA8A 3CGIA 3CJQA 3TAQA 2ZBRA 2CZVC 2NRVA 2FJVA 1Y3KA 3C0BA 3NKYA 1BQNB 2I6WA 3PX6A 4URQU 2DRAA 3CPWM 1JQGA 3DLJA 3EN9A 2HNDA 1VRQC 1NRKA 3M8PA 3SQ0A 4CJPA 1FCAA 1REVA 2F3JA 2EFOA 3IO1A 3OTOF 5C10A 3C6AA 4HWIA 3MXHP 2E6MA 3JYTB 1F60B 4M5MA 1VC6A 4Q45A 1QJHA 3EKSA 1CLFA 2IJNA 2F4VJ 4A48A 1C0TA 2L41A 4JV2A 3JSYA 2N7CA 4Z4GA 2EFNA 3GSIA 1Q16B 3OSNA 4GV3A 1WF2A 2MTLA 4B1ZA 2MB0B 1WF1A 4NRUA 2L08A 2QGFB 4LRFA 2D3OR 4RWTA 2D0PA 5C2FA 4RTFD 3SSSA 4DUYF 2I8EA 4ZIVA 1N33J 2IJFA 5F9NA 3PUFA 5B0FA 2CQ1A 3CVKA 1TTHB 2HG4A 2VPXB 3NVKA 3IFEA 1ZETA 2JLGA 2VBZA 2BW7A 3WQPA 3HXMA 4J9VA 2OFHX 3BKUA 3VERA 5KFOA 3CCMN 3RG6A 4ZVGA 3ENHA 3B6BA 1S1TB 1A6LA 2E5HA 2QLWA 4F7VA 3TANA 4Y2IA 2WHOA 1FRLA 4FJ9A 1NOZA 1DY3A 2OPPA 3IRWP 1IR0A 1B64A 4OX9K 3BGFA 5SUHA 4XEIA 1PJ6A 2A6AA 5D77A 1KRPA 3D2FA 4JI8K 3H4BA 1A5VA 1EARA 4CH1A 1GLFO 1FKOA 1V4TA 3W0LA 3SV3A 2WSFC 2MJNA 2OSRA 3OFFA 2OJ3A 3H0PA 4K2JA 5KG0A 1IBKF 1HMVA 4PG6A 1X4GA 3MM5B 1L3TA 2D0CA 1YRTA 3K2YA 3UCZP 3TYTA 2CDQA 4M95A 3ATVA 2XO6A 1LAVA 4CJQA 3TQ1A 3I0SB 2AEJA 3BP8A 2BA9A 1HMVB 4PXEA 2HSTA 1GNKA 5D0HA 2YKPA 1RT2B 4F26A 4CT8A 4JI7F 1MLAA 2VCPA 3NY0A 3CULA 1NGDA 5IV4A 5BPNA 2C3YA 4WQ5A 3TZZA 4K4XA 4AHTA 3H2LA 2IVNA 2DR5A 1RAFB 1TL3B 2HQIA 4HT7A 3S3NA 3CJ8A 3DMJB 3L4QA 1RBSA 1XNRJ 4ZLJA 4CGIA 1XC3A 2BE2A 4N56A 2UXDJ 2NREA 1K47A 3O1BA 1W97L 1VBXA 2UXDK 1MWMA 3OHRA 1NDPA 4LF8K 2Q6CA 1WDTA 9ATCB 4UT4A 1HUXA 2DNKA 3FFKB 1S97A 2P9PA 5LL6Z 3HYFA 4ZJLA 1BI4B 5KT5A 2HBYB 4H5NA 2LECA 4ZHRA 4WFBL 1PYTA 3IMQJ 3KJVB 1GMUA 5IT9Y 2FHOB 1H2VZ 2QA4G 4AL7A 1PIEA 1KKHA 3I9V9 4NA1A 4BWJA 4WFBQ 3GCXP 3H40A 1NGAA 2GX8A 4G3IA 3VGSA 5A2QU 1LWFA 4I56A 3KK1A 1CPZA 2NPFA 2C2RA 4JAXA 4M5GA 4B3MK 4I2PB 1T05A 5DDOC 3THVA 2A5XA 3N5BA 4B17A 1HYSB 2A40A 1RT6A 3EEQA 4RBVA 4UQGA 3DXKA 1FJGK 2ZNYA 1Q8LA 3G25A 4EAHD 4FLWA 1GXLA 2FIUA 2ZUAA 1HWJA 2CADA 5D4LA 3M3ZA 1H6KX 4DLGA 3OS0A 4DCJB 4GW6A 3THWA 4GNIA 2M88A 4LQ9A 2AD9A 5SWMA 4PKIA 2HGLA 4U7CA 2MY7A 3S3OA 4LC9B 3MI7X 3K5PA 1RE1B 1W26A 1EAYC 3MPYA 3MR2A 4ED2A 3U3GA 3WNHA 4CW7B 1N32K 4DJBA 5K8NA 4R0EA 4JEPA 4FJJA 1UFKA 2GVZA 4DR1J 1YI2N 4A8XA 2ZJRQ 2OEKA 4ED0A 1FNMA 2R2RA 3RMCA 1RWMB 1WHYA 1RK8A 3UNYA 4YR2A 4LF2A 5B08A 1BG3A 3K2PA 5CR4A 3MCNA 1WHXA 4QWCA 5HROA 4YR3A 5J2QA 4DSIA 4JI2F 1YXQA 1RWOB 4K41A 1Q1KA 2EG2A 3DHXA 2MSSA 1VQNS 1T05B 1ZZFA 4BR5A 4NI2A 4UOFA 4JYAF 4KRFA 4RNHA 1IKXA 2MHEA 2GGPB 5I3UB 2YPYA 2P8IA 3CJSA 2W24A 1SUQB 4QQBA 2B4UA 3UFCX 2DH7A 1HWIA 3TNVA 1ATNA 1SPBP 4ZHRB 3IBFB 3C14A 4ERDA 1S1XB 4IDKA 2LVWA 4AH9A 5JVHL 2G4BA 3T5HA 3CJKA 1VHFA 3CTRA 3H5YA 1WLJA 4LR9A 2P9PB 2V51B 1Q5YA 4P74A 4JHDA 5HL7Q 4EBEA 2ADCA 3IAM9 4NCGA 4ES3A 2XO7A 2V5HG 1D9DA 4YOTA 5HRPA 4RU2A 2R2SA 1B0TA 2CQDA 4ENOA 2FZGB 4O0IA 3MEDA 1XI1A 2DISA 3G82B 3VF6A 1NKEA 3MN7A 2MQ8A 1TL3A 4UY85 4AM7A 4K42A 4JHDB 4AT1B 5JUMA 2VH7A 3BR9A 4BRIA 3CJKB 4O3NA 3H20A 2QSWA 3UDCA 4TQRA 2MKIA 3D6HB 1XWLA 3G9CA 3LP1B 1I6JA 5KFLA 4WYBA 2CPEA 4A46A 4F4XA 4PG4A 2LSNA 3D5MA 2DK2A 1YUWA 2HBMA 2G2YA 1RWKB 2QWNA 1RQ0A 2G8WA 3CFOA 3V81A 4CHNA 3R5JB 4ICLB 1NJIT 1FE0A 1L5UA 1N36J 3NLCA 4USJC 1PAEX 1E4FT 5T7BA 4DV6F 3MEEA 1OQ3A 1QVFR 1JLFA 5JVGQ 4Y0FA 5IC4B 1XEZA 1RDUA 2HFNA 4CH7A 3M9MB 2HHTA 4X66J 5KFIA 4TU8A 1VLYA 3TR5A 2XULA 1UMJA 3W61A 2G8UA 1VDHA 3J80Y 3T1AA 5FPMA 2Q43A 3FNNA 3AD9C 2Q79A 3IS9B 3DLEA 4DR6F 1UVIA 2D74B 1WG5A 3FSIA 5M1QA 1MN9A 4RW4A 4NLOA 2XGPA 3UKUA 3FKBA 3V1RA 2P6TA 3NH0A 3GZ7A 5AJ3F 2XB2D 3KD1E 1S1TA 3U3YA 1RA7A 3THWB 4I9LA 3P31A 2WW4A 3J81Y 1LQ9A 3ZSOA 2CIMA 1NHKL 4UTGA 1YBUA 3M8YA 1BUPA 2YKOA 1MG7A 7FD1A 4DUYJ 1SXLA 1K6YA 4C48A 2VQFF 1HNIA 1YDLA 5KFMA 4FLUA 2VOPA 3QYYA 4DR5F 3K0JA 3RW6A 2RDDA 5BYQA 3L0QA 1ESVA 3KG1A 1S9GB 2OCEA 4LSNB 2KQ2A 4QOTA 1Q7YT 4CHOA 3D0HE 3LP3A 5K8OA 1E6VA 1YJNS 3QFUA 5CXTA 2V0NA 3BDEA 3BO2A 3CD7A 2FLNA 2UVVA 4BRPA 4JI5K 3MWBA 3UD3P 2IS3A 1TKXB 4DV2J 2AA4A 4B8CA 4FLZA 2QV6A 1PBAA 2N7YA 3QSYB 3GONA 4C0HA 3VQDA 3L2WA 3OYHA 1SJQA 1WC1A 4RW4B 5D0EA 3W9IA 4LFAJ 2I1RA 1WSJA 3IS9A 4USHA 3KLIB 4DR3K 4NYPA 4JS5A 2WSCC 2RT3A 2FC0A 1KONA 3C7NB 4TSXA 1LXNA 1XR6A 3DDIA 1HL6A 2NCKL 3J80O 2W2PP 5HK4A 4FBTA 4IFVA 1U24A 2EPIA 3AAPA 2F9JA 5A0YA 8RUCA 4H0TB 2E1YA 4IJAA 2LMIA 1QQNA 4CD1A 3KJNB 3MM9A 1NOYA 4KQZA 3MEEB 2Q1NA 3QJLA 3TU5A 3MMCB 4CLUA 3RR7A 1DTQB 4G1QB 3EKUA 3EX7B 3V81B 2CJQA 3DLLQ 4KTZA 1QE1A 3OBYA 2FF6A 1JLBA 1NHUA 2XLJA 5H9FJ 3A0IX 2V52B 3CCRN 5LL6d 4M3YA 1FKOB 3TX0A 4XH5A 4XH1A 3VETA 3GQCA 2JWKA 5A8KB 1CZBA 4DUTA 2JLEA 3KWIA 2YNIB 2EW9A 2YX7A 5IZHA 3L2VA 4ZVPB 3CJ2A 4RWXA 2YHXA 2FD2A 4X62K 4Y2CA 1HYVA 3SV4A 2CJKA 2O8DA 5IFMA 2IVPA 1YKWA 4IG3A 4B9UA 4IG0B 1WWHA 3M7VA 4A8YA 2AWZA 3SYZA 5DDPC 4DV6K 2DNPA 3LP0B 4LF9F 1KBRA 2KTQA 2LCWA 3OYJA 4LH5A 2Q36A 2WTFA 5ETTA 3PFOA 2KVQE 1BQMA 3A3PB 3HL8A 3H42A 2J76E 5LJ3Y 4Q2MA 3UPFA 3M8SA 4OYZA 1SUQA 1CC8A 4O55A 3K5NA 2ZGYA 2QZ8A 4BC3A 4KB7A 2QW9A 2QN6B 1PO6A 3QATA 5AQYA 4DX8H 2HZVA 3LL3A 3OTDA 3M1VA 1Q7YO 2F40A 3HO1A 2V2KA 2DGSA 4LBIA 1NPKA 1RWXB 5DQHA