2UXBK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxbK00
3J7AP 1HNWK 1I94K 2F4VK 4B3TK 1FJGK 4DUZK 5FLXO 2UXCK 4DV3K 4LFAK 4NXNK 4LFBK 4GKKK 4LFCK 4LF5K 4JI8K 1J5EK 4DV1K 4JI1K 5IWAK 5LL6Z 4AQYK 1N33K 4LF6K 1IBKK 1N36K 4X65K 4GKJK 4JI0K 4X64K 4DR3K 3T1HK 4DR6K 3J80O 5LMNK 4B3SK 4JI5K 4B3RK 4CW7B 1IBLK 5AJ3K 1N32K 4X66K 1IBMK 4DUYK 2UUAK 4K0KK 4LF9K 4LF4K 2UUBK 4LF8K 4DV4K 5IT9O 4DV6K 3J81O 4LF7K 4JI2K 1HNZK 3T1YK 2VQFK 2UXBK 1XNRK 2UUCK 4DR2K 2ZM6K 3JAMO 4KHPK 4JI4K 3OTOK 2E5LK 4JI7K 3J7YP 1N34K 4NXMK 2UU9K 4DV0K 2VQEK 1HR0K 1XMOK 4YY3K 4DV2K 4X62K 4YHHK 4DR5K 4DR4K 4JV5K 4OX9K 5LMUK 4JYAK 4DV5K 4CVNE 2HHHK 2UXDK 1XNQK 4DR1K 4JI6K 4DR7K 4V19S 4B3MK 5BR8K 1XMQK 4DV7K 1HNXK 4JI3K 5A2QO
chains in the Genus database with same CATH superfamily
4WCEL 4E1NA 5AQWA 3EZWA 3P39A 4KPYA 2F96A 5KQDA 1BU6O 5AFUA 4RWTA 1BQNA 3E1YA 2NUBA 4I7FA 3AVGA 3PSFA 1RDAA 5BR9A 3AVJA 4LF5K 4JI8K 1KVBA 4EZ9A 3RR8A 4BROA 3UB5A 3U6FA 1RT4A 4BRDA 3ZT1A 5CHIA 3D2FB 3RMBA 3AARA 1RBRA 2RPIA 3K5MA 2G8IA 1YVUA 2KFZA 1JLAA 5C10A 3JXUA 4CD1A 3ZT3A 1TAQA 1L3SA 4M3XA 3AVMA 2V52B 4DF4A 3CJ9A 4LH4A 1GLCG 3HVRA 4HTUA 3HP9A 1HRHA 4BR7A 1K8KA 1X1PA 5HLFA 4UY8O 3KWGA 4CJWA 3AVCA 3AV9A 1NK5A 1L3VA 3TAMA 4DS5A 3VETA 1TKTA 3FR0A 3QERA 4KTZA 5EU7A 1JLCA 2PZSA 2HMPA 4EAHD 3HPGA 3M8SA 4OLBA 4A59A 3CC7N 2JGUA 3JYTA 4Z0UA 2PBDA 2G8HA 1U47A 3KKRA 2OCEA 1BG3A 4WQ5A 1RDWX 3TARA 1QVGM 1K6YA 4HCBA 4IO8A 2HHVA 3THWA 3CFOA 3OYCA 1B9DA 1JXEA 2O8CA 1J6ZA 4JKHA 3SUQA 2CH6A 4H4MA 2XY8A 2HW3A 1CZ9A 1K9MO 4OX9K 4DV5K 4CVNE 2HHHK 5LY3A 4JLHA 1VK0A 1RNHA 2YJFA 3WEEB 4CJ5A 4YORA 5BR8K 3QO9A 1XMQK 4DV7K 4O44A 1HNXK 5A2QO 4JKCA 1KLNA 3NVKA 1O13A 1LWCA 3AVFA 3NF9A 4FM0A 3THVA 3LPTA 1A5VA 1V4TA 2NRHA 1KAXA 2P9UA 2YHWA 1Q8IA 5AR0A 4C8KA 1QZ6A 1GLAG 4BWMA 4DUZK 1K73O 3TAQA 2PY5A 2VGMA 1ZXOA 1RDDA 1VSMA 3HBTA 3H3NO 3SQ0A 5I42A 3ZX2A 1M90O 5E26A 3BGRA 4FJJA 4OPKA 1YTAA 3QETA 3G10A 2F8TA 2BUPA 3VF2A 3BUZB 4BRCA 3D2EB 3NFAA 3G25A 1HMVA 2I7NA 1KVAA 3HM8A 1S72N 1HYVA 2BDPA 2FBVA 4CEDA 4FCYA 1VQLN 3M5RA 3A5LC 3K9JA 3A5MC 1HNVA 1HPMA 1B92A 4CBWA 5BREA 4CJRA 3PX6A 3QBXA 3CYMA 4BRQA 4KHUA 4B8CA 4BRAA 1ASUA 3VEXA 1OVQA 1RFQA 4PKIA 1VQ8N 3VERA 3KTQA 1GOAA 4M3WA 4AHTA 1I39A 2BANA 4Q5VA 3O9TA 2YX6A 4O0IA 4FLUA 4JK9A 3ASMA 4DWIA 3EL2A 1HNZK 2D0AA 5AQQA 1HKBA 1J5OA 2YNFA 1SS6A 2E8AA 2VCPA 3V9SA 4LSNA 5AZIB 3LWMA 4KHPK 4JI7K 3O3GA 3ATVA 3IMXA 1BCOA 3R3LA 3D7EO 4DR4K 4DTOA 4GV9A 1Q18A 4E3SA 4E89A 2QWQA 4FWSA 1MWMA 3ID8A 1H1VA 1NGDA 3L2QA 3HM9A 3CM6A 1YUWA 3NGYA 4FJLA 2P9NB 3V9UA 1LW0A 2Q3SA 1BI4A 1BIZA 1KD1O 4E7LA 3F9KA 5DMRA 4HUFA 4E1MA 2E2PA 1K8AO 4DU1A 4HWIA 4H0XB 1O1WA 3D6RA 4BRNA 2VG5A 1NJIO 3M8QA 1JLQA 2YKMA 3C7NA 3QIPA 1GLDG 3AA3A 4DFJA 3ZETA 2VWKA 3AAQA 2OA8A 3GDQA 3OJSA 5HRPA 2RF2A 1IBKK 4B9UA 4FLWA 4BY9C 4CGHA 4X64K 1GLLO 4AHCA 4JD2B 3RRHA 2G8WA 4DU3A 1YXQA 3OYBA 4AILC 3VQPA 2ZGZA 2X74A 4Y1DA 3ULEB 3F9MA 2XY7A 1IBMK 4Z4CA 1VSDA 2OPSA 4K0KK 1E4GT 2VGNA 1T03A 4LF4K 2AA4A 4FZXC 4CZIA 2E2OA 4CIFA 4DHYA 1ZC6A 1VQMN 3G71N 3LP0A 4XH1A 5F0XA 3H1VX 4LF7K 2Q0RA 3WXJA 3P4IA 4AM7A 4CGIA 2QEXN 3THXB 3CPEA 4QS9A 2DPNA 4M3YA 5K14A 1X9JA 4DKWA 3TSQA 4DF8A 2QXLA 3S3OA 5GIOA 2E5LK 2P5OA 3CI5A 2RKIA 1J53A 3OBWA 4RW8A 3ULDA 2XY6A 4YHHK 4I9QA 4JKBA 1XC9A 4K25A 2OPPA 1S1UA 3OYHA 1IKVA 2IVPA 2QW9A 3MCPA 3VOVA 3MXIA 2WFBA 4KFBA 4CCHA 1Z05A 3ZLJA 3LZJA 4NCGA 5GINA 3ZT4A 3LDQA 1Q9YA 4GV3A 3ZT0A 3CFPA 4CD3A 4DFKA 4JRQA 1VQNN 4DQPA 3SLCA 3CXCM 4LFCK 3FGUA 1OH7A 4U7BA 3CCRN 3QLHA 4DCHA 4M3RA 4DU4A 4F3OA 1Q86O 3LL3A 3ZYYX 5LL6Z 5C2DA 3LAMA 1R59O 3D0PA 1EETA 1BDGA 2W42A 3SNNA 1C6VA 2ITGA 4I6MB 1GOBA 1QE1A 1CXUA 4YOVA 1N5YA 3MXJA 3QEIA 2WOMA 1RDBA 4FOEA 2O8EA 4ILHA 2P9LA 5KTQA 5GAHP 3NGZA 4BDYA 1EQYA 4HTLA 3Q7BA 2FF3B 1YAGA 1OKJA 1S9GA 2DTUA 4BREA 5BPLA 3V81A 2HBJA 3I8DA 3P83D 4BE1A 4B1VA 4WFAL 2RE2A 4NCBA 4DUYK 2FBXA 3SPZA 5EOYA 5LJVA 3EY1A 3V4IA 2IAJA 4BRLA 1TGOA 1HUXA 2HVHA 3KZBA 1L3UA 3J81O 4ELVA 3PX0A 1TK8A 5JS1A 5C0YA 5EVZA 3AO1A 4MDBA 1VQPN 5C24A 3CCQN 1JLBA 1YI2N 4ISFA 3ZX3A 2UU9K 3R6MA 4BG8A 3U8XA 3QB0A 3WXIA 3L2RA 5HP1A 2YHAA 1SL2A 1YIJN 4H03B 4FJIA 4GV6A 2OZSA 3VESA 4CJUA 3MMVA 3J8AA 4QAGA 1W0HA 4DSJA 1JXBA 5BN9A 4IFVA 1NU0A 3O9RA 4E19A 5CYQA 2DFHA 4J8FA 2O8BA 1C1BA 5J2QA 3OBYA 3DLBA 1V4SA 3HL8A 3P1GA 2F4VK 1K8KB 2EHGA 4OLAA 2O8FB 3VQ6A 3QEXA 3ZSVA 3H08A 2Q31A 1XHZA 3T1AA 3OVNA 3I33A 2FF6A 4JAXA 2OANA 1X9SA 3SJHA 3CQ8A 2PFUA 2GV9A 3IFRA 1ATNA 4O5FA 1GOCA 3LDOA 4XH5A 3UKRA 3CF5L 3OYAA 1DEJA 1KAZA 3KK7A 5CR4A 5HBMA 3MCAB 3CCSN 4JHDA 1C0FA 1JLFA 3UIQA 4X65K 1P8ZA 4AF1A 2Q36A 5HRSA 3THWB 1KRPA 4CESA 4JK7A 4BR2A 3T3FA 1NMDA 4RG8A 4ICLA 2O4GA 3NF7A 4CJQA 2O8CB 1IO2A 4JI5K 3VGLA 2A5XA 4B3RK 2NZTA 3WT0A 3QEPA 2FBYA 4CFBA 3CMAN 4QCLA 3A0IX 4IO9L 1E3MA 2YHYA 1IKXA 1S6QA 2I7PA 3HOSA 1VQON 5JVGL 1ILYA 1LWFA 2P9UB 4FWQA 1M1KO 3DAWA 3VQCA 1YJNN 2GBZA 5ELZA 1SZ2A 4IG0A 3C65A 1TKDA 4JI4K 4BC3A 1DTTA 3NAEA 3VPZA 5JMVA 3THYA 2KZMA 3DXMB 5AQMA 2HNDA 4AM6A 2CGLA 3IG1A 3QICA 1RBVA 3L4QA 3QNNA 1KCFA 3PO4A 4JV5K 4JYAK 5C12A 4A61A 3TAPA 3LAKA 3DLEA 4CEAA 4Z94A 3SAHA 2VG7A 4KHWA 4DR7K 4V19S 3GG4A 1TYQA 4F8RA 1HKCA 3ITHA 2HVIA 3O8MA 3J7AP 4Z4HA 3S3MA 2PYJA 3OJUA 1KSPA 1WLJA 4AHSA 3AVIA 4C23A 3AVNA 2Y1JA 2CH5A 3HYFA 2DFFA 3QEVA 3EE9A 4M42A 4BDZA 1ITGA 1SL0A 3ZSRA 2XY5A 1I3AA 1D4XA 2I5JA 1SKSA 3WNHA 3AA5X 3FE1A 2OPRA 3VQAA 2GWKA 3CCJN 4KHNA 2JLEA 1D5AA 1KTQA 4NLBA 5C2FA 1QSLA 3MN5A 3V1QA 4GNIA 1RBSA 3PIOL 4DTRA 3ZSOA 3O5BA 5BPNA 3CCEN 2G8UA 1X3MA 4JNEA 4JI0K 4DLGA 3H1QA 2DFEA 3TAGA 3L8BA 5KRSA 3K59A 1QQCA 4H0TB 1VSEA 4H5VA 1IBLK 5KPRA 3VTIA 4RCHA 4MQ3A 3TSPA 4N41A 4FW2A 2NRVA 3A5NC 4W5NA 4KB0A 5ADXH 4KKOA 3HO1A 2WUSA 3PSIA 4DV4K 5IT9O 5KGWA 2X6SA 3CC2N 1NMNA 1X9WA 1NK4A 2UXBK 4FJ7A 3EYZA 3VA3A 1XNRK 1NJWA 1LAVA 3HZ6A 4M7XA 3E9PA 4DR2K 3L2VA 4GY2B 3V9WA 3PX4A 3C7NB 3M8PA 3UE5A 1IH7A 3ZETB 2HNYA 3SQ2A 1BQMA 4W5OA 3SBGA 4AHUA 2VWJA 4CF0A 5LMUK 2NRWA 3P38A 1QQNA 1Q82O 3ENBA 3ZEUB 3LDLA 4FOIA 3O4NA 3LANA 1DTQA 3AGKA 3F5TA 3K9KA 1GLJO 3VEWA 4BWJA 4B9TA 3HXMA 1ZBUA 3A5OC 4E7KA 3ZSQA 2CGKA 1NGHA 3O1WA 4NB4A 3FZHA 5FLXO 3RWUA 4CJFA 3SQ4A 4CZLA 4E7IA 4GVEA 2G8FA 4IFEA 3TSUA 1NLVA 2KW4A 2IGIA 4ILJA 5AQZA 4CF8A 4FWMA 1VSKA 1XHXA 2O4IA 3I55N 3MEDA 4AHVA 5F1XA 3LDNA 3OW2M 3I0RA 5ADXA 4K42A 2KKZA 3LM2A 5GAGP 4AQYK 1BCMA 1GLBG 1N36K 4KHSA 2OPQA 4WYBA 1U2VA 1BOTO 1W2BM 4EHUA 1KXPA 3KHYA 3CCLN 3RVCA 4FK4A 4DLEA 4FM1A 3NH0A 3Q7CA 3KD5E 1YITN 1JCFA 1RCHA 4J2BA 1EO1A 5FPNA 4OGCA 5J2NA 1LOTB 3DLHA 3LM9A 1MDUB 2FC0A 4K41A 5TKYA 2V51B 5LJWA 1HLUA 1RTDA 1VQKN 3TWHA 1VHXA 3MEEA 1WBBA 1VQ7N 3OYDA 4CEOA 4RW4A 4IJAA 3AVLA 3S41A 1HQUA 5BRFA 3C6HA 4CHQA 4FWLA 4JKGB 4Z4EA 4ELTA 2ZE2A 1RT6A 1DT9A 4BC4A 4CZMA 2BGGA 5SWMA 3V6DA 2ZM6K 2FLOA 2YNHA 2YNIA 4CEZA 3CHWA 2D4WA 2Q2RA 3OS1A 2HBKA 3SV3A 3KWIA 4CJSA 3FZLA 1BHLA 3E9OA 4LD0A 3QNOA 4ID1A 3HT3A 2ZJRL 4IOXA 3B6PA 2ETJA 1ATSA 4FW1A 2P9IB 3MWTA 4WFBL 4FLYA 3FFKB 1IG9A 1YJWN 2O8EB 4PKHA 2YCHA 4FWOA 4H4OA 5M1FA 1HKGA 3LP3A 3N4QA 2P9SA 4KBOA 3VEYA 4DG1A 4HUEA 2Z1JA 1KQSM 2XRIA 3VTHA 4B08A 1QQOA 3CJ7A 1HJRA 2CGJA 3KK3A 1ATRA 3OYNA 2HHSA 1CZBA 1ZBIA 1NGBA 4KH5A 1X3NA 3P31A 4WE1A 2W41A 4CBXA 3E9LA 2Q97A 3JS6A 2OTLN 4I2QA 1W9HA 1T05A 4Q0BA 1ZYQA 3N4PA 4GKJK 1XI1A 5KGXA 2GUIA 3LDPA 1NK7A 3D2FA 1NJYA 4LSLA 2D0PA 4FVMA 3CQYA 4HUGA 4O55A 2BH1A 4FWNA 1NK8A 4DSEA 2E1YA 4E1JA 3CC4N 3T69A 4B3OA 4N76A 4FJMA 4IXCA 4B1ZA 4FJKA 3OYJA 2UUAK 1DLOA 2HF3A 4ZTFA 3BEXA 3CMEN 3G0ZA 2O8BB 3HSTB 2D0OA 4CE9A 2YKNA 2P9PB 3O4WA 4G9ZA 3DOLA 5E41A 3ENHA 3AA2A 1C0TA 3QFUA 2A42A 1VQ6N 3WQTA 1NNEA 2WTUA 3FZFA 2W6KA 4NXMK 4UQGA 3SBTA 3EE8A 1XMOK 5CZ1A 3EZ5A 4X62K 4CHNA 3NMUA 2FSKA 4CFAA 4CZEA 3QEWA 4DQ8A 4K8XA 1BO5O 1XNQK 3CERA 1TVRA 3NVMA 4MLEA 2ATQA 3RMDA 3HK2A 1XWLA 3TANA 1Q9XA 3GL1A 4J2EA 3MAQA 3MK6A 3BDPA 4WQ4C 2P9KB 3DJCA 2H3GX 4OKKA 1U49A 4FZYA 4FJXA 1I94K 1HYSA 1IKYA 4Z4FA 3SZ2A 1QTMA 2QI2A 1FJGK 1KVCA 3WEEA 1J54A 1SKRA 4CHOA 2NRRA 2YJEA 3GBTA 4GKKK 1RT7A 4YOXA 4OPJA 3BY5A 1QHTA 3CJBA 3SPYA 4KH4A 1J5EK 3CIPA 1KLMA 3LPUA 2ZF5O 4B9VA 5CE3A 3LWLA 1NKBA 1N6QA 4FJNA 1U48A 4DTPA 2BTFA 3W3DA 1N33K 4BR4A 1U45A 4BVOA 5AQKA 2ZQBA 1HJOA 3ZSWA 4FZZA 3R8EA 4GW6A 4O8KA 4JKAA 5FPEA 3AO4A 1F21A 5KI6A 2A40A 1NGGA 2E4LA 4JK8A 4TSXA 4NYFA 1WAFA 4JKEA 1D9DA 4KRFA 4YOYA 3RSEB 2IS3A 1BIUA 3VEZA 1NKCA 3CPWM 4FJ5A 2EX3A 4ILGB 4RTFD 4CIEA 1VQ5N 4CF2A 5AQFA 3IRXA 4CJ3A 3AO2A 4CI6A 2ASMA 4DB3A 3DI6A 1NOZA 3MN9A 5FPMA 2X78A 1C1CA 3GE1A 1WSFA 2NLXA 3KLGA 2VQFK 5EXWA 3V1RA 1S22A 5M1NA 4NLCA 2LSNA 3VMFB 3OYKA 1EX4A 5M1OA 5AQJA 4BE0A 3TAEA 4H0OA 4BRGA 3ALYA 3OS2A 4B9QA 3RRGA 5AZJA 4B9SA 2HHQA 4F3TA 3TAFA 4CJKA 4PWDA 3MN6A 4F2SA 2QWNA 1C0GA 3FZKA 2KTQA 4B3MK 5AZIA 4E7JA 3TABA 1TK5A 4FLTA 4BR5A 5FPDA 2IC3A 3BZCA 3MX2A 3ZT2A 3NH2A 1NG9A 2WBNA 4YOTA 3WNFA 4AH9A 5AQHA 5CY4A 4OJRA 3HVTA 3MXMA 3DXKA 4FK2A 1SKWA 2PAVA 4BRFA 5KPTA 4KTQA 3R1XA 2RHKA 4CFDA 1IJJA 2HB5A 1RTHA 4G1QA 2P9NA 4HHTA 3S9HA 2A3ZA 3KLIA 4B1YB 5AQXA 4CEBA 1WSIA 3TU5A 4IG3A 4MFBA 3KKSA 4YOWA 4A2BA 3DYAA 1VQ9N 1IG8A 1NM1A 3SYZA 2A6AA 3L4IA 3WNGA 5HRRA 4CK1A 1BA1A 1OVYA 3ZSZA 3BF1A 4YDUC 3QESA 3SI6A 3HP6A 5M1PA 5TKWA 4OKJA 3C94A 4HCCA 4IEIA 4FJ8A 2VYPA 3DLRA 2V7YA 4JD2A 3NCIA 1XQSC 2YNGA 2VG6A 4CJ4A 4FLXA 1FW6A 5KQ8A 4HVJA 3AGRA 3I56N 3VN5A 3NE6A 3T1YK 3T19A 3CQXA 2IVNA 5C15A 4M3ZA 1VSFA 3OY9A 4FJGA 1U04A 4QS8A 2ITMA 1JCEA 4PHTX 4I9LA 4M3TA 2F9WA 1B9FA 4DQQA 2Z1GA 4IEEA 1NK9A 2BE2A 2ZD1A 4EP4A 2B5JA 1A5XA 1KAYA 3HTVA 1WSGA 3MDQA 3THXA 2O8DA 2Z1HA 2NRTA 3FLCO 4YNQA 4H5TA 1S6PA 4FPBA 2W6LA 3UKUA 4BRKA 4O8UA 1HPZA 4CGFA 4AHRA 2HF4A 3C95A 1C1AA 4L3QA 3ISNC 4IDHA 4RW6A 5J1EA 3VEVA 4KHYA 2QM1A 3CD6N 1LAWA 4LFBK 3M1FA 4Z4IA 5BRHA 3KD1E 1S9EA 1W7AA 1S1WA 1T44A 5IWAK 1GLFO 3MEGA 3DRRA 1HX1A 4BVPA 4W5TA 4M3UA 3B8AX 5CZ2A 2QKBA 3IS9A 4H5NA 1MA9B 1TL1A 1XUPO 1ZBFA 3J7ZO 3CCUN 5LMNK 4IBNA 4CECA 2FSNA 1KC8O 5BN8A 4CHPA 4WQ5C 2UYTA 3F73A 4JEPA 4DSKA 2YHBA 4YFUA 3RTVA 4DSIA 3EEQA 2QTDA 2G8KA 1QZ5A 4KI6A 4H0YB 4FSVA 3VQ4A 3VQ9A 2AJQA 4QS7A 2D5RA 3ATUA 3OHRA 4I2PA 3PY8A 3HOTA 4JKDA 2DY4A 1P90A 3K5NA 4LF8K 1EWQA 4JRPA 4DV6K 4DS4A 4H0PA 4Y1CA 4DSLA 1BA0A 4YOUA 4KH6A 5T7BA 5BRDA 2FXUA 1QQMA 2HBMA 2NRXA 1OH8A 3C6AA 1LCUA 1NGIA 1LW2A 1N34K 5AQVA 1EXQA 2QWPA 3LP1A 4YY3K 4FJ9A 4H8KA 4CK2A 3HPOA 4IJNA 5KPZA 3CJCA 1BI4B 3PUFA 3C6UA 3QDKA 3VQQA 1S1VA 3NGIA 4JI6K 2QA4N 2E2NA 2ASOA 4JI3K 1UA0A 3U9DA 4CGDA 3H3OB 1RBTA 5AQPA 4FJHA 3AAPA 1S1TA 4B1UB 5H1SQ 3KK2A 2GX9A 1UOCA 5AQRA 1TKXA 3AVHA 4JKFA 2ZWHA 4GMJB 1L3TA 2P51A 4KI4A 3VQEA 4MO5A 3O3HA 4L8RB 1TV6A 1WOQA 3WXKA 4PUOA 3L6QA 4Z4GA 1GLEG 3KIOA 4CZJA 3V1OA 3VA0A 4M45A 1HQEA 2EWSA 3AA4A 2O8FA 4DV1K 3BF3A 5DK5A 2G8VA 1T3VA 1IV0A 4B1XB 1RT1A 1RILA 4BG9A 1N8RO 1FKOA 3PO5A 1TAUA 2NNWA 3AY9A 3NDKA 1Z25A 1C0MA 3P5JA 4B3SK 4LY7A 5F2RA 3C6TA 3U3YA 2QKKA 1X9MA 3AVAA 2QXFA 2F7TA 1TK0A 4KREA 4A5BA 4C8MA 4BACA 3B6OA 3RR7A 4X66K 1EP4A 5M1KA 5HL7L 4CEFA 3CG7A 1MU2A 1VRUA 4JS4A 5EX5A 4DTJA 4LH5A 3KVGA 1BISA 4CJLA 2HMIA 4BC2A 1L5UA 1JL2A 1QVFM 2QWLA 4ZTJA 4M7YA 1SQKA 2ASPA 2B4JA 3SJJA 1YHQN 3O3FA 1KFDA 4A62A 4DTNA 3NF6A 4BRPA 2VQEK 2WONA 1NJXA 1ZBHA 1HR0K 3OA9A 3VENA 5KRTA 4CHZA 1VSIA 3PIPL 2F8SA 4K43A 3ENOA 1RDUA 3ZSXA 5FRNA 1NK0A 3V9ZA 3G6EN 4A2AA 1MWKA 4FWPA 1ASWA 4IFYA 3KLFA 4XH4A 4FO0A 4M63C 5C25A 1NKEA 3DXMA 3BP8A 2HHUA 2J4RA 3VF6A 1HYZA 3DMJA 1OH5A 4RW9A 5AQSA 1LWEA 1CLQA 2KLAA 2FBTA 2GELA 3O6WA 1T8EA 3FZMA 4H5RA 4MO4A 4DTSA 3MX5A 4GVMA 4DFMA 3EO3A 4CJTA 3WUHA 5C42A 3HI0A 2P9LB 3LALA 3O9SA 1G15A 3M3ZA 3LZIA 1YF5L 5D3GA 3H45C 5JVHL 2ZJPL 1T6DA 3DWLA 3AO5A 5HOOA 4XEIA 1JCGA 3KLHA 1UAXA 4DR3K 4CZGA 3OYEA 4WFNL 3M8RA 4DR6K 2A41A 5AZJB 4O4GA 3C0BA 4B8AB 2P5GA 1G99A 1TL3A 2E2QA 3ZSYA 3A2FA 1QSYA 3I8BA 4DMNA 3EKSA 4BQZA 1N32K 3QINA 3U4LA 1RT2A 1TKZA 4NYNA 3A8YA 2YI1A 4OKEA 4CJVA 3L2WA 2QWOA 4J2AA 3D45A 4N5SA 1WB9A 1ESVA 4NO7A 4J2DA 1NGAA 1FKPA 3DRPA 4EHTA 4BDPA 4IWVA 1E4FT 3TTDA 3DXKB 5EY4A 1D9FA 1RDCA 3K5LA 3R9PA 4CJ7A 4KAZA 4KB1A 2UUCK 3T7ZA 3SUNA 4IKFA 2Q1NA 1DKGD 2NRZA 4BE2A 3QIOA 5B8HA 5SZTA 5AQTA 3J7YP 3F2KA 2E6LA 1Y64A 3WQUA 2Z1IA 4BRHA 2PYLA 4JN4A 2A1RA 1NGFA 4DR5K 2KQ2A 5J2MA 3FFIA 1J9AA 2KHOA 3K0SA 2UXDK 3MN7A 4JS5A 3VQ5A 4FK0A 2KZZA 4FVUA 5FDLA 3TTFA 4BRMA 1UWBA 2HSTA 3QFPA 3CETA 1FK9A 5JLFA 2QWMA 1VRTA 4C1NK 3JSMA 4O0JA 3ZEUA 3SMSA 3PLAA 4ISEA 4PKGA 3UKRB 4W5QA 5AQUA 2UXCK 1SV5A 2AP1A 1ZBSA 5JS2A 2QK9A 3VQ7A 1Y97A 4JHDB 4NXNK 5GAEP 1YVNA 3GOIA 2D0BA 4CIGA 1CXQA 3NBPA 4CK3A 4PL7A 2QWRA 1LV5A 2YV0X 3RMAA 4PL8A 5MLCQ 1NWKA 4IZ9A 5AQYA 4CHYA 5FRMA 4PA1A 3DRSA 1TUUA 1YTUA 3VEOA 4BQLA 5DM7L 3SUPA 4F2RA 4ELUA 1JLEA 1WSEA 3L3UA 1JJ2M 5JLHA 1Z6RA 3E66A 5DM6L 3HRGA 2O8DB 1VSJA 2JWLA 2P1JA 2GTDA 3QBWA 2HHXA 5GADP 4FPAA 1SAZA 5AJ3K 3AVKA 3W0LA 3UKUB 3VQBA 3E01A 4LF9K 4A57A 2UUBK 2E1ZA 3ID6A 4C1NI 3M6GA 1S1XA 1Z26A 2IVOA 3CJAA 3H6EA 4CF1A 3RMCA 2OYQA 2IDOA 3MECA 1WNSA 4OGEA 4RW7A 3U3GA 5CYMA 4BR9A 3THYB 3V9XA 3OYFA 4FXDA 3D2EA 4DSFA 1W97L 5JICA 5AQOA 3O9UA 4NCAA 2XHBA 3NH1A 2HHWA 3K2PA 3JAMO 4CF9A 3VQ8A 1TYQB 2IIRA 4JKGA 4CZHA 5AQNA 5FROA 3WXMB 1BUPA 3KJVA 1WAJA 2E20A 4IOCL 4PY5A 2A1SA 2E6MA 2Q0UA 4FWKA 4KV8A 4DR1K 3SUOA 1U6ZA 4FWRA 3SAGA 1QS4A 4DQRA 5J2PA 4FLVA 1UA1A 5AQIA 2KFNA 3VGMA 4BC5A 4C8OA 1U4BA 1WUAA 1BWFO 4BGBA 2JWKA 3SQ1A 2P9IA 4B9NA 1NJZA 1NGJA 3SV4A 2F9TA 1WSJA 4C8LA 4DV3K 4CEEA 1NGEA 4WF9L 5AQLA 4LFAK 1SL1A 1BL3A 2HNZA 4CZFA 3QMLA 4H5WA 4C8NA 2IOCA 4JI1K 1D8YA 4WQ4A 5I3UA 3DM2A 5E84A 5BPMA 2W40A 4LF6K 1HNIA 4N56A 3HSCA 3OYMA 1JLGA 2OZMA 1DGKN 1VSLA 4CGGA 3CCVN 3KLEA 3VQDA 3SK3A 3J80O 1ASVA 1EKEA 1RT5A 3L0QA 3EKUA 1OH6A 1WSHA 3OYGA 4U67L 4CERA 1VAZA 3KK1A 1NGCA 4CW7B 1YT3A 3IUCA 3LP2A 4CEQA 3TPQA 4DTUA 4BR0A 1IKWA 3S3NA 5M1QA 4CFCA 3HJFA 1RTJA 1CZAN 4R5PA 5HROA 2Y1IA 3SCXA 3G4SN 3K57A 4B9MA 4DFPA 1KFSA 4PQUA 4CZKA 2V7ZA 1ZBLA 5GIPA 1RTIA 1YJ9N 4DTMA 1XC3A 1A5WA 4F4KA 3PV8A 4W5RA 4FM2A 3WXLA 3DOKA 4ID5A 5AQGA 4KHQA 4B9LA 4MLHA 1BGXT 1C0UA 2GUPA 1JKHA 2P9PA 3SAFA 4DTXA 4QOZB 3O4QA 4IOAL 4BRIA 1RBUA 3OYLA 3VF4A 1S5JA 3SMPA 1Q7YO 3OS0A 4Y0WA 3ULEA 3TR8A 4OPHA 2OTJN 3O1BA 2RN2A 1TUYA 3L2UA 2ZGYA 3DLLL 1NOYA 4EZ6A 1HNWK 2HHTA 3IKMA 3CFRA 4OVLA 4F9OA 3K58A 1RT3A 4B3TK 3IAYA 1SUQA 3OYIA 4EIAA 3BZKA 2X6NA 2D1KA 2P9KA 3EN9A 3WNEA 1VSHA 1U2VB 2HOEA 1REVA 3DLGA 2VWBA 2D0CA 3HPHA 4EFHA 2R7YA 3ZX0A 3O80A 4ZHRA 4CBUA 4R79A 4E7HA 3LDSA 4BGAA 2B6AA 4H0VB 5HRNA 3ZCMA 4FLZA 3DLKA 1RGIA 4O5BA 4K8ZA 3TI0A 4M41A 4DQSA 4ISGA 2GWJA 4EP5A 3T1HK 3AVBA 5AFUH 3IDHA 1QHAA 3O9QA 3U9ZA 4OPAA 4CJEA 4XIUA 1T6CA 4IDKA 3CM5A 2HBLA 4CJPA 3O08A 1VQ4N 1WN7A 3TTCA 3AO3A 3MWPA 2YHXA 4N47A 3RSEA 1Q81O 4DQIA 3NHGA 1EWRA 1NBWA 2WC9A 4JI2K 4CGJA 4LC9B 4YDUA 1S3XA 1FXXA 4I6MA 2E88A 4E0DA 1QSSA 3L3VA 1T7PA 1R0AA 3I0SA 4KTWA 3OTOK 2XO7A 4B1WB 4MDAA 4DV0K 3CJ1A 2ZJQL 4DV2K 1WBDA 2GEMA 2P9SB 4FL9A 3H46O 4A5AA 4FYDA 3VGKA 4OO1J 3K5OA 4KO0A 1JL1A 1NK6A 3CCMN 5I9EB 2FSJA 3NF8A
chains in the Genus database with same CATH topology
3J7AP 1HNWK 1I94K 2F4VK 4B3TK 1FJGK 4DUZK 5FLXO 2UXCK 4DV3K 4LFAK 4NXNK 4LFBK 4GKKK 4LFCK 4LF5K 4JI8K 1J5EK 4DV1K 4JI1K 5IWAK 5LL6Z 4AQYK 1N33K 4LF6K 1IBKK 1N36K 4X65K 4GKJK 4JI0K 4X64K 4DR3K 3T1HK 4DR6K 3J80O 5LMNK 4B3SK 4JI5K 4B3RK 4CW7B 1IBLK 5AJ3K 1N32K 4X66K 1IBMK 4DUYK 2UUAK 4K0KK 4LF9K 4LF4K 2UUBK 4LF8K 4DV4K 5IT9O 4DV6K 3J81O 4LF7K 4JI2K 1HNZK 3T1YK 2VQFK 2UXBK 1XNRK 2UUCK 4DR2K 2ZM6K 3JAMO 4KHPK 4JI4K 3OTOK 2E5LK 4JI7K 3J7YP 1N34K 4NXMK 2UU9K 4DV0K 2VQEK 1HR0K 1XMOK 4YY3K 4DV2K 4X62K 4YHHK 4DR5K 4DR4K 4JV5K 4OX9K 5LMUK 4JYAK 4DV5K 4CVNE 2HHHK 2UXDK 1XNQK 4DR1K 4JI6K 4DR7K 4V19S 4B3MK 5BR8K 1XMQK 4DV7K 1HNXK 4JI3K 5A2QO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A P;  1HNW K;  1I94 K;  2F4V K;  4B3T K;  1FJG K;  4DUZ K;  5FLX O;  2UXC K;  4DV3 K;  4LFA K;  4NXN K;  4LFB K;  4GKK K;  4LFC K;  4LF5 K;  4JI8 K;  1J5E K;  4DV1 K;  4JI1 K;  5IWA K;  5LL6 Z;  4AQY K;  1N33 K;  4LF6 K;  1IBK K;  1N36 K;  4X65 K;  4GKJ K;  4JI0 K;  4X64 K;  4DR3 K;  3T1H K;  4DR6 K;  3J80 O;  5LMN K;  4B3S K;  4JI5 K;  4B3R K;  4CW7 B;  1IBL K;  5AJ3 K;  1N32 K;  4X66 K;  1IBM K;  4DUY K;  2UUA K;  4K0K K;  4LF9 K;  4LF4 K;  2UUB K;  4LF8 K;  4DV4 K;  5IT9 O;  4DV6 K;  3J81 O;  4LF7 K;  4JI2 K;  1HNZ K;  3T1Y K;  2VQF K;  2UXB K;  1XNR K;  2UUC K;  4DR2 K;  2ZM6 K;  3JAM O;  4KHP K;  4JI4 K;  3OTO K;  2E5L K;  4JI7 K;  3J7Y P;  1N34 K;  4NXM K;  2UU9 K;  4DV0 K;  2VQE K;  1HR0 K;  1XMO K;  4YY3 K;  4DV2 K;  4X62 K;  4YHH K;  4DR5 K;  4DR4 K;  4JV5 K;  4OX9 K;  5LMU K;  4JYA K;  4DV5 K;  4CVN E;  2HHH K;  2UXD K;  1XNQ K;  4DR1 K;  4JI6 K;  4DR7 K;  4V19 S;  4B3M K;  5BR8 K;  1XMQ K;  4DV7 K;  1HNX K;  4JI3 K;  5A2Q O; 
#chains in the Genus database with same CATH topology
 4WCE L;  4E1N A;  5AQW A;  3EZW A;  3P39 A;  4KPY A;  2F96 A;  5KQD A;  1BU6 O;  5AFU A;  4RWT A;  1BQN A;  3E1Y A;  2NUB A;  4I7F A;  3AVG A;  3PSF A;  1RDA A;  5BR9 A;  3AVJ A;  4LF5 K;  4JI8 K;  1KVB A;  4EZ9 A;  3RR8 A;  4BRO A;  3UB5 A;  3U6F A;  1RT4 A;  4BRD A;  3ZT1 A;  5CHI A;  3D2F B;  3RMB A;  3AAR A;  1RBR A;  2RPI A;  3K5M A;  2G8I A;  1YVU A;  2KFZ A;  1JLA A;  5C10 A;  3JXU A;  4CD1 A;  3ZT3 A;  1TAQ A;  1L3S A;  4M3X A;  3AVM A;  2V52 B;  4DF4 A;  3CJ9 A;  4LH4 A;  1GLC G;  3HVR A;  4HTU A;  3HP9 A;  1HRH A;  4BR7 A;  1K8K A;  1X1P A;  5HLF A;  4UY8 O;  3KWG A;  4CJW A;  3AVC A;  3AV9 A;  1NK5 A;  1L3V A;  3TAM A;  4DS5 A;  3VET A;  1TKT A;  3FR0 A;  3QER A;  4KTZ A;  5EU7 A;  1JLC A;  2PZS A;  2HMP A;  4EAH D;  3HPG A;  3M8S A;  4OLB A;  4A59 A;  3CC7 N;  2JGU A;  3JYT A;  4Z0U A;  2PBD A;  2G8H A;  1U47 A;  3KKR A;  2OCE A;  1BG3 A;  4WQ5 A;  1RDW X;  3TAR A;  1QVG M;  1K6Y A;  4HCB A;  4IO8 A;  2HHV A;  3THW A;  3CFO A;  3OYC A;  1B9D A;  1JXE A;  2O8C A;  1J6Z A;  4JKH A;  3SUQ A;  2CH6 A;  4H4M A;  2XY8 A;  2HW3 A;  1CZ9 A;  1K9M O;  4OX9 K;  4DV5 K;  4CVN E;  2HHH K;  5LY3 A;  4JLH A;  1VK0 A;  1RNH A;  2YJF A;  3WEE B;  4CJ5 A;  4YOR A;  5BR8 K;  3QO9 A;  1XMQ K;  4DV7 K;  4O44 A;  1HNX K;  5A2Q O;  4JKC A;  1KLN A;  3NVK A;  1O13 A;  1LWC A;  3AVF A;  3NF9 A;  4FM0 A;  3THV A;  3LPT A;  1A5V A;  1V4T A;  2NRH A;  1KAX A;  2P9U A;  2YHW A;  1Q8I A;  5AR0 A;  4C8K A;  1QZ6 A;  1GLA G;  4BWM A;  4DUZ K;  1K73 O;  3TAQ A;  2PY5 A;  2VGM A;  1ZXO A;  1RDD A;  1VSM A;  3HBT A;  3H3N O;  3SQ0 A;  5I42 A;  3ZX2 A;  1M90 O;  5E26 A;  3BGR A;  4FJJ A;  4OPK A;  1YTA A;  3QET A;  3G10 A;  2F8T A;  2BUP A;  3VF2 A;  3BUZ B;  4BRC A;  3D2E B;  3NFA A;  3G25 A;  1HMV A;  2I7N A;  1KVA A;  3HM8 A;  1S72 N;  1HYV A;  2BDP A;  2FBV A;  4CED A;  4FCY A;  1VQL N;  3M5R A;  3A5L C;  3K9J A;  3A5M C;  1HNV A;  1HPM A;  1B92 A;  4CBW A;  5BRE A;  4CJR A;  3PX6 A;  3QBX A;  3CYM A;  4BRQ A;  4KHU A;  4B8C A;  4BRA A;  1ASU A;  3VEX A;  1OVQ A;  1RFQ A;  4PKI A;  1VQ8 N;  3VER A;  3KTQ A;  1GOA A;  4M3W A;  4AHT A;  1I39 A;  2BAN A;  4Q5V A;  3O9T A;  2YX6 A;  4O0I A;  4FLU A;  4JK9 A;  3ASM A;  4DWI A;  3EL2 A;  1HNZ K;  2D0A A;  5AQQ A;  1HKB A;  1J5O A;  2YNF A;  1SS6 A;  2E8A A;  2VCP A;  3V9S A;  4LSN A;  5AZI B;  3LWM A;  4KHP K;  4JI7 K;  3O3G A;  3ATV A;  3IMX A;  1BCO A;  3R3L A;  3D7E O;  4DR4 K;  4DTO A;  4GV9 A;  1Q18 A;  4E3S A;  4E89 A;  2QWQ A;  4FWS A;  1MWM A;  3ID8 A;  1H1V A;  1NGD A;  3L2Q A;  3HM9 A;  3CM6 A;  1YUW A;  3NGY A;  4FJL A;  2P9N B;  3V9U A;  1LW0 A;  2Q3S A;  1BI4 A;  1BIZ A;  1KD1 O;  4E7L A;  3F9K A;  5DMR A;  4HUF A;  4E1M A;  2E2P A;  1K8A O;  4DU1 A;  4HWI A;  4H0X B;  1O1W A;  3D6R A;  4BRN A;  2VG5 A;  1NJI O;  3M8Q A;  1JLQ A;  2YKM A;  3C7N A;  3QIP A;  1GLD G;  3AA3 A;  4DFJ A;  3ZET A;  2VWK A;  3AAQ A;  2OA8 A;  3GDQ A;  3OJS A;  5HRP A;  2RF2 A;  1IBK K;  4B9U A;  4FLW A;  4BY9 C;  4CGH A;  4X64 K;  1GLL O;  4AHC A;  4JD2 B;  3RRH A;  2G8W A;  4DU3 A;  1YXQ A;  3OYB A;  4AIL C;  3VQP A;  2ZGZ A;  2X74 A;  4Y1D A;  3ULE B;  3F9M A;  2XY7 A;  1IBM K;  4Z4C A;  1VSD A;  2OPS A;  4K0K K;  1E4G T;  2VGN A;  1T03 A;  4LF4 K;  2AA4 A;  4FZX C;  4CZI A;  2E2O A;  4CIF A;  4DHY A;  1ZC6 A;  1VQM N;  3G71 N;  3LP0 A;  4XH1 A;  5F0X A;  3H1V X;  4LF7 K;  2Q0R A;  3WXJ A;  3P4I A;  4AM7 A;  4CGI A;  2QEX N;  3THX B;  3CPE A;  4QS9 A;  2DPN A;  4M3Y A;  5K14 A;  1X9J A;  4DKW A;  3TSQ A;  4DF8 A;  2QXL A;  3S3O A;  5GIO A;  2E5L K;  2P5O A;  3CI5 A;  2RKI A;  1J53 A;  3OBW A;  4RW8 A;  3ULD A;  2XY6 A;  4YHH K;  4I9Q A;  4JKB A;  1XC9 A;  4K25 A;  2OPP A;  1S1U A;  3OYH A;  1IKV A;  2IVP A;  2QW9 A;  3MCP A;  3VOV A;  3MXI A;  2WFB A;  4KFB A;  4CCH A;  1Z05 A;  3ZLJ A;  3LZJ A;  4NCG A;  5GIN A;  3ZT4 A;  3LDQ A;  1Q9Y A;  4GV3 A;  3ZT0 A;  3CFP A;  4CD3 A;  4DFK A;  4JRQ A;  1VQN N;  4DQP A;  3SLC A;  3CXC M;  4LFC K;  3FGU A;  1OH7 A;  4U7B A;  3CCR N;  3QLH A;  4DCH A;  4M3R A;  4DU4 A;  4F3O A;  1Q86 O;  3LL3 A;  3ZYY X;  5LL6 Z;  5C2D A;  3LAM A;  1R59 O;  3D0P A;  1EET A;  1BDG A;  2W42 A;  3SNN A;  1C6V A;  2ITG A;  4I6M B;  1GOB A;  1QE1 A;  1CXU A;  4YOV A;  1N5Y A;  3MXJ A;  3QEI A;  2WOM A;  1RDB A;  4FOE A;  2O8E A;  4ILH A;  2P9L A;  5KTQ A;  5GAH P;  3NGZ A;  4BDY A;  1EQY A;  4HTL A;  3Q7B A;  2FF3 B;  1YAG A;  1OKJ A;  1S9G A;  2DTU A;  4BRE A;  5BPL A;  3V81 A;  2HBJ A;  3I8D A;  3P83 D;  4BE1 A;  4B1V A;  4WFA L;  2RE2 A;  4NCB A;  4DUY K;  2FBX A;  3SPZ A;  5EOY A;  5LJV A;  3EY1 A;  3V4I A;  2IAJ A;  4BRL A;  1TGO A;  1HUX A;  2HVH A;  3KZB A;  1L3U A;  3J81 O;  4ELV A;  3PX0 A;  1TK8 A;  5JS1 A;  5C0Y A;  5EVZ A;  3AO1 A;  4MDB A;  1VQP N;  5C24 A;  3CCQ N;  1JLB A;  1YI2 N;  4ISF A;  3ZX3 A;  2UU9 K;  3R6M A;  4BG8 A;  3U8X A;  3QB0 A;  3WXI A;  3L2R A;  5HP1 A;  2YHA A;  1SL2 A;  1YIJ N;  4H03 B;  4FJI A;  4GV6 A;  2OZS A;  3VES A;  4CJU A;  3MMV A;  3J8A A;  4QAG A;  1W0H A;  4DSJ A;  1JXB A;  5BN9 A;  4IFV A;  1NU0 A;  3O9R A;  4E19 A;  5CYQ A;  2DFH A;  4J8F A;  2O8B A;  1C1B A;  5J2Q A;  3OBY A;  3DLB A;  1V4S A;  3HL8 A;  3P1G A;  2F4V K;  1K8K B;  2EHG A;  4OLA A;  2O8F B;  3VQ6 A;  3QEX A;  3ZSV A;  3H08 A;  2Q31 A;  1XHZ A;  3T1A A;  3OVN A;  3I33 A;  2FF6 A;  4JAX A;  2OAN A;  1X9S A;  3SJH A;  3CQ8 A;  2PFU A;  2GV9 A;  3IFR A;  1ATN A;  4O5F A;  1GOC A;  3LDO A;  4XH5 A;  3UKR A;  3CF5 L;  3OYA A;  1DEJ A;  1KAZ A;  3KK7 A;  5CR4 A;  5HBM A;  3MCA B;  3CCS N;  4JHD A;  1C0F A;  1JLF A;  3UIQ A;  4X65 K;  1P8Z A;  4AF1 A;  2Q36 A;  5HRS A;  3THW B;  1KRP A;  4CES A;  4JK7 A;  4BR2 A;  3T3F A;  1NMD A;  4RG8 A;  4ICL A;  2O4G A;  3NF7 A;  4CJQ A;  2O8C B;  1IO2 A;  4JI5 K;  3VGL A;  2A5X A;  4B3R K;  2NZT A;  3WT0 A;  3QEP A;  2FBY A;  4CFB A;  3CMA N;  4QCL A;  3A0I X;  4IO9 L;  1E3M A;  2YHY A;  1IKX A;  1S6Q A;  2I7P A;  3HOS A;  1VQO N;  5JVG L;  1ILY A;  1LWF A;  2P9U B;  4FWQ A;  1M1K O;  3DAW A;  3VQC A;  1YJN N;  2GBZ A;  5ELZ A;  1SZ2 A;  4IG0 A;  3C65 A;  1TKD A;  4JI4 K;  4BC3 A;  1DTT A;  3NAE A;  3VPZ A;  5JMV A;  3THY A;  2KZM A;  3DXM B;  5AQM A;  2HND A;  4AM6 A;  2CGL A;  3IG1 A;  3QIC A;  1RBV A;  3L4Q A;  3QNN A;  1KCF A;  3PO4 A;  4JV5 K;  4JYA K;  5C12 A;  4A61 A;  3TAP A;  3LAK A;  3DLE A;  4CEA A;  4Z94 A;  3SAH A;  2VG7 A;  4KHW A;  4DR7 K;  4V19 S;  3GG4 A;  1TYQ A;  4F8R A;  1HKC A;  3ITH A;  2HVI A;  3O8M A;  3J7A P;  4Z4H A;  3S3M A;  2PYJ A;  3OJU A;  1KSP A;  1WLJ A;  4AHS A;  3AVI A;  4C23 A;  3AVN A;  2Y1J A;  2CH5 A;  3HYF A;  2DFF A;  3QEV A;  3EE9 A;  4M42 A;  4BDZ A;  1ITG A;  1SL0 A;  3ZSR A;  2XY5 A;  1I3A A;  1D4X A;  2I5J A;  1SKS A;  3WNH A;  3AA5 X;  3FE1 A;  2OPR A;  3VQA A;  2GWK A;  3CCJ N;  4KHN A;  2JLE A;  1D5A A;  1KTQ A;  4NLB A;  5C2F A;  1QSL A;  3MN5 A;  3V1Q A;  4GNI A;  1RBS A;  3PIO L;  4DTR A;  3ZSO A;  3O5B A;  5BPN A;  3CCE N;  2G8U A;  1X3M A;  4JNE A;  4JI0 K;  4DLG A;  3H1Q A;  2DFE A;  3TAG A;  3L8B A;  5KRS A;  3K59 A;  1QQC A;  4H0T B;  1VSE A;  4H5V A;  1IBL K;  5KPR A;  3VTI A;  4RCH A;  4MQ3 A;  3TSP A;  4N41 A;  4FW2 A;  2NRV A;  3A5N C;  4W5N A;  4KB0 A;  5ADX H;  4KKO A;  3HO1 A;  2WUS A;  3PSI A;  4DV4 K;  5IT9 O;  5KGW A;  2X6S A;  3CC2 N;  1NMN A;  1X9W A;  1NK4 A;  2UXB K;  4FJ7 A;  3EYZ A;  3VA3 A;  1XNR K;  1NJW A;  1LAV A;  3HZ6 A;  4M7X A;  3E9P A;  4DR2 K;  3L2V A;  4GY2 B;  3V9W A;  3PX4 A;  3C7N B;  3M8P A;  3UE5 A;  1IH7 A;  3ZET B;  2HNY A;  3SQ2 A;  1BQM A;  4W5O A;  3SBG A;  4AHU A;  2VWJ A;  4CF0 A;  5LMU K;  2NRW A;  3P38 A;  1QQN A;  1Q82 O;  3ENB A;  3ZEU B;  3LDL A;  4FOI A;  3O4N A;  3LAN A;  1DTQ A;  3AGK A;  3F5T A;  3K9K A;  1GLJ O;  3VEW A;  4BWJ A;  4B9T A;  3HXM A;  1ZBU A;  3A5O C;  4E7K A;  3ZSQ A;  2CGK A;  1NGH A;  3O1W A;  4NB4 A;  3FZH A;  5FLX O;  3RWU A;  4CJF A;  3SQ4 A;  4CZL A;  4E7I A;  4GVE A;  2G8F A;  4IFE A;  3TSU A;  1NLV A;  2KW4 A;  2IGI A;  4ILJ A;  5AQZ A;  4CF8 A;  4FWM A;  1VSK A;  1XHX A;  2O4I A;  3I55 N;  3MED A;  4AHV A;  5F1X A;  3LDN A;  3OW2 M;  3I0R A;  5ADX A;  4K42 A;  2KKZ A;  3LM2 A;  5GAG P;  4AQY K;  1BCM A;  1GLB G;  1N36 K;  4KHS A;  2OPQ A;  4WYB A;  1U2V A;  1BOT O;  1W2B M;  4EHU A;  1KXP A;  3KHY A;  3CCL N;  3RVC A;  4FK4 A;  4DLE A;  4FM1 A;  3NH0 A;  3Q7C A;  3KD5 E;  1YIT N;  1JCF A;  1RCH A;  4J2B A;  1EO1 A;  5FPN A;  4OGC A;  5J2N A;  1LOT B;  3DLH A;  3LM9 A;  1MDU B;  2FC0 A;  4K41 A;  5TKY A;  2V51 B;  5LJW A;  1HLU A;  1RTD A;  1VQK N;  3TWH A;  1VHX A;  3MEE A;  1WBB A;  1VQ7 N;  3OYD A;  4CEO A;  4RW4 A;  4IJA A;  3AVL A;  3S41 A;  1HQU A;  5BRF A;  3C6H A;  4CHQ A;  4FWL A;  4JKG B;  4Z4E A;  4ELT A;  2ZE2 A;  1RT6 A;  1DT9 A;  4BC4 A;  4CZM A;  2BGG A;  5SWM A;  3V6D A;  2ZM6 K;  2FLO A;  2YNH A;  2YNI A;  4CEZ A;  3CHW A;  2D4W A;  2Q2R A;  3OS1 A;  2HBK A;  3SV3 A;  3KWI A;  4CJS A;  3FZL A;  1BHL A;  3E9O A;  4LD0 A;  3QNO A;  4ID1 A;  3HT3 A;  2ZJR L;  4IOX A;  3B6P A;  2ETJ A;  1ATS A;  4FW1 A;  2P9I B;  3MWT A;  4WFB L;  4FLY A;  3FFK B;  1IG9 A;  1YJW N;  2O8E B;  4PKH A;  2YCH A;  4FWO A;  4H4O A;  5M1F A;  1HKG A;  3LP3 A;  3N4Q A;  2P9S A;  4KBO A;  3VEY A;  4DG1 A;  4HUE A;  2Z1J A;  1KQS M;  2XRI A;  3VTH A;  4B08 A;  1QQO A;  3CJ7 A;  1HJR A;  2CGJ A;  3KK3 A;  1ATR A;  3OYN A;  2HHS A;  1CZB A;  1ZBI A;  1NGB A;  4KH5 A;  1X3N A;  3P31 A;  4WE1 A;  2W41 A;  4CBX A;  3E9L A;  2Q97 A;  3JS6 A;  2OTL N;  4I2Q A;  1W9H A;  1T05 A;  4Q0B A;  1ZYQ A;  3N4P A;  4GKJ K;  1XI1 A;  5KGX A;  2GUI A;  3LDP A;  1NK7 A;  3D2F A;  1NJY A;  4LSL A;  2D0P A;  4FVM A;  3CQY A;  4HUG A;  4O55 A;  2BH1 A;  4FWN A;  1NK8 A;  4DSE A;  2E1Y A;  4E1J A;  3CC4 N;  3T69 A;  4B3O A;  4N76 A;  4FJM A;  4IXC A;  4B1Z A;  4FJK A;  3OYJ A;  2UUA K;  1DLO A;  2HF3 A;  4ZTF A;  3BEX A;  3CME N;  3G0Z A;  2O8B B;  3HST B;  2D0O A;  4CE9 A;  2YKN A;  2P9P B;  3O4W A;  4G9Z A;  3DOL A;  5E41 A;  3ENH A;  3AA2 A;  1C0T A;  3QFU A;  2A42 A;  1VQ6 N;  3WQT A;  1NNE A;  2WTU A;  3FZF A;  2W6K A;  4NXM K;  4UQG A;  3SBT A;  3EE8 A;  1XMO K;  5CZ1 A;  3EZ5 A;  4X62 K;  4CHN A;  3NMU A;  2FSK A;  4CFA A;  4CZE A;  3QEW A;  4DQ8 A;  4K8X A;  1BO5 O;  1XNQ K;  3CER A;  1TVR A;  3NVM A;  4MLE A;  2ATQ A;  3RMD A;  3HK2 A;  1XWL A;  3TAN A;  1Q9X A;  3GL1 A;  4J2E A;  3MAQ A;  3MK6 A;  3BDP A;  4WQ4 C;  2P9K B;  3DJC A;  2H3G X;  4OKK A;  1U49 A;  4FZY A;  4FJX A;  1I94 K;  1HYS A;  1IKY A;  4Z4F A;  3SZ2 A;  1QTM A;  2QI2 A;  1FJG K;  1KVC A;  3WEE A;  1J54 A;  1SKR A;  4CHO A;  2NRR A;  2YJE A;  3GBT A;  4GKK K;  1RT7 A;  4YOX A;  4OPJ A;  3BY5 A;  1QHT A;  3CJB A;  3SPY A;  4KH4 A;  1J5E K;  3CIP A;  1KLM A;  3LPU A;  2ZF5 O;  4B9V A;  5CE3 A;  3LWL A;  1NKB A;  1N6Q A;  4FJN A;  1U48 A;  4DTP A;  2BTF A;  3W3D A;  1N33 K;  4BR4 A;  1U45 A;  4BVO A;  5AQK A;  2ZQB A;  1HJO A;  3ZSW A;  4FZZ A;  3R8E A;  4GW6 A;  4O8K A;  4JKA A;  5FPE A;  3AO4 A;  1F21 A;  5KI6 A;  2A40 A;  1NGG A;  2E4L A;  4JK8 A;  4TSX A;  4NYF A;  1WAF A;  4JKE A;  1D9D A;  4KRF A;  4YOY A;  3RSE B;  2IS3 A;  1BIU A;  3VEZ A;  1NKC A;  3CPW M;  4FJ5 A;  2EX3 A;  4ILG B;  4RTF D;  4CIE A;  1VQ5 N;  4CF2 A;  5AQF A;  3IRX A;  4CJ3 A;  3AO2 A;  4CI6 A;  2ASM A;  4DB3 A;  3DI6 A;  1NOZ A;  3MN9 A;  5FPM A;  2X78 A;  1C1C A;  3GE1 A;  1WSF A;  2NLX A;  3KLG A;  2VQF K;  5EXW A;  3V1R A;  1S22 A;  5M1N A;  4NLC A;  2LSN A;  3VMF B;  3OYK A;  1EX4 A;  5M1O A;  5AQJ A;  4BE0 A;  3TAE A;  4H0O A;  4BRG A;  3ALY A;  3OS2 A;  4B9Q A;  3RRG A;  5AZJ A;  4B9S A;  2HHQ A;  4F3T A;  3TAF A;  4CJK A;  4PWD A;  3MN6 A;  4F2S A;  2QWN A;  1C0G A;  3FZK A;  2KTQ A;  4B3M K;  5AZI A;  4E7J A;  3TAB A;  1TK5 A;  4FLT A;  4BR5 A;  5FPD A;  2IC3 A;  3BZC A;  3MX2 A;  3ZT2 A;  3NH2 A;  1NG9 A;  2WBN A;  4YOT A;  3WNF A;  4AH9 A;  5AQH A;  5CY4 A;  4OJR A;  3HVT A;  3MXM A;  3DXK A;  4FK2 A;  1SKW A;  2PAV A;  4BRF A;  5KPT A;  4KTQ A;  3R1X A;  2RHK A;  4CFD A;  1IJJ A;  2HB5 A;  1RTH A;  4G1Q A;  2P9N A;  4HHT A;  3S9H A;  2A3Z A;  3KLI A;  4B1Y B;  5AQX A;  4CEB A;  1WSI A;  3TU5 A;  4IG3 A;  4MFB A;  3KKS A;  4YOW A;  4A2B A;  3DYA A;  1VQ9 N;  1IG8 A;  1NM1 A;  3SYZ A;  2A6A A;  3L4I A;  3WNG A;  5HRR A;  4CK1 A;  1BA1 A;  1OVY A;  3ZSZ A;  3BF1 A;  4YDU C;  3QES A;  3SI6 A;  3HP6 A;  5M1P A;  5TKW A;  4OKJ A;  3C94 A;  4HCC A;  4IEI A;  4FJ8 A;  2VYP A;  3DLR A;  2V7Y A;  4JD2 A;  3NCI A;  1XQS C;  2YNG A;  2VG6 A;  4CJ4 A;  4FLX A;  1FW6 A;  5KQ8 A;  4HVJ A;  3AGR A;  3I56 N;  3VN5 A;  3NE6 A;  3T1Y K;  3T19 A;  3CQX A;  2IVN A;  5C15 A;  4M3Z A;  1VSF A;  3OY9 A;  4FJG A;  1U04 A;  4QS8 A;  2ITM A;  1JCE A;  4PHT X;  4I9L A;  4M3T A;  2F9W A;  1B9F A;  4DQQ A;  2Z1G A;  4IEE A;  1NK9 A;  2BE2 A;  2ZD1 A;  4EP4 A;  2B5J A;  1A5X A;  1KAY A;  3HTV A;  1WSG A;  3MDQ A;  3THX A;  2O8D A;  2Z1H A;  2NRT A;  3FLC O;  4YNQ A;  4H5T A;  1S6P A;  4FPB A;  2W6L A;  3UKU A;  4BRK A;  4O8U A;  1HPZ A;  4CGF A;  4AHR A;  2HF4 A;  3C95 A;  1C1A A;  4L3Q A;  3ISN C;  4IDH A;  4RW6 A;  5J1E A;  3VEV A;  4KHY A;  2QM1 A;  3CD6 N;  1LAW A;  4LFB K;  3M1F A;  4Z4I A;  5BRH A;  3KD1 E;  1S9E A;  1W7A A;  1S1W A;  1T44 A;  5IWA K;  1GLF O;  3MEG A;  3DRR A;  1HX1 A;  4BVP A;  4W5T A;  4M3U A;  3B8A X;  5CZ2 A;  2QKB A;  3IS9 A;  4H5N A;  1MA9 B;  1TL1 A;  1XUP O;  1ZBF A;  3J7Z O;  3CCU N;  5LMN K;  4IBN A;  4CEC A;  2FSN A;  1KC8 O;  5BN8 A;  4CHP A;  4WQ5 C;  2UYT A;  3F73 A;  4JEP A;  4DSK A;  2YHB A;  4YFU A;  3RTV A;  4DSI A;  3EEQ A;  2QTD A;  2G8K A;  1QZ5 A;  4KI6 A;  4H0Y B;  4FSV A;  3VQ4 A;  3VQ9 A;  2AJQ A;  4QS7 A;  2D5R A;  3ATU A;  3OHR A;  4I2P A;  3PY8 A;  3HOT A;  4JKD A;  2DY4 A;  1P90 A;  3K5N A;  4LF8 K;  1EWQ A;  4JRP A;  4DV6 K;  4DS4 A;  4H0P A;  4Y1C A;  4DSL A;  1BA0 A;  4YOU A;  4KH6 A;  5T7B A;  5BRD A;  2FXU A;  1QQM A;  2HBM A;  2NRX A;  1OH8 A;  3C6A A;  1LCU A;  1NGI A;  1LW2 A;  1N34 K;  5AQV A;  1EXQ A;  2QWP A;  3LP1 A;  4YY3 K;  4FJ9 A;  4H8K A;  4CK2 A;  3HPO A;  4IJN A;  5KPZ A;  3CJC A;  1BI4 B;  3PUF A;  3C6U A;  3QDK A;  3VQQ A;  1S1V A;  3NGI A;  4JI6 K;  2QA4 N;  2E2N A;  2ASO A;  4JI3 K;  1UA0 A;  3U9D A;  4CGD A;  3H3O B;  1RBT A;  5AQP A;  4FJH A;  3AAP A;  1S1T A;  4B1U B;  5H1S Q;  3KK2 A;  2GX9 A;  1UOC A;  5AQR A;  1TKX A;  3AVH A;  4JKF A;  2ZWH A;  4GMJ B;  1L3T A;  2P51 A;  4KI4 A;  3VQE A;  4MO5 A;  3O3H A;  4L8R B;  1TV6 A;  1WOQ A;  3WXK A;  4PUO A;  3L6Q A;  4Z4G A;  1GLE G;  3KIO A;  4CZJ A;  3V1O A;  3VA0 A;  4M45 A;  1HQE A;  2EWS A;  3AA4 A;  2O8F A;  4DV1 K;  3BF3 A;  5DK5 A;  2G8V A;  1T3V A;  1IV0 A;  4B1X B;  1RT1 A;  1RIL A;  4BG9 A;  1N8R O;  1FKO A;  3PO5 A;  1TAU A;  2NNW A;  3AY9 A;  3NDK A;  1Z25 A;  1C0M A;  3P5J A;  4B3S K;  4LY7 A;  5F2R A;  3C6T A;  3U3Y A;  2QKK A;  1X9M A;  3AVA A;  2QXF A;  2F7T A;  1TK0 A;  4KRE A;  4A5B A;  4C8M A;  4BAC A;  3B6O A;  3RR7 A;  4X66 K;  1EP4 A;  5M1K A;  5HL7 L;  4CEF A;  3CG7 A;  1MU2 A;  1VRU A;  4JS4 A;  5EX5 A;  4DTJ A;  4LH5 A;  3KVG A;  1BIS A;  4CJL A;  2HMI A;  4BC2 A;  1L5U A;  1JL2 A;  1QVF M;  2QWL A;  4ZTJ A;  4M7Y A;  1SQK A;  2ASP A;  2B4J A;  3SJJ A;  1YHQ N;  3O3F A;  1KFD A;  4A62 A;  4DTN A;  3NF6 A;  4BRP A;  2VQE K;  2WON A;  1NJX A;  1ZBH A;  1HR0 K;  3OA9 A;  3VEN A;  5KRT A;  4CHZ A;  1VSI A;  3PIP L;  2F8S A;  4K43 A;  3ENO A;  1RDU A;  3ZSX A;  5FRN A;  1NK0 A;  3V9Z A;  3G6E N;  4A2A A;  1MWK A;  4FWP A;  1ASW A;  4IFY A;  3KLF A;  4XH4 A;  4FO0 A;  4M63 C;  5C25 A;  1NKE A;  3DXM A;  3BP8 A;  2HHU A;  2J4R A;  3VF6 A;  1HYZ A;  3DMJ A;  1OH5 A;  4RW9 A;  5AQS A;  1LWE A;  1CLQ A;  2KLA A;  2FBT A;  2GEL A;  3O6W A;  1T8E A;  3FZM A;  4H5R A;  4MO4 A;  4DTS A;  3MX5 A;  4GVM A;  4DFM A;  3EO3 A;  4CJT A;  3WUH A;  5C42 A;  3HI0 A;  2P9L B;  3LAL A;  3O9S A;  1G15 A;  3M3Z A;  3LZI A;  1YF5 L;  5D3G A;  3H45 C;  5JVH L;  2ZJP L;  1T6D A;  3DWL A;  3AO5 A;  5HOO A;  4XEI A;  1JCG A;  3KLH A;  1UAX A;  4DR3 K;  4CZG A;  3OYE A;  4WFN L;  3M8R A;  4DR6 K;  2A41 A;  5AZJ B;  4O4G A;  3C0B A;  4B8A B;  2P5G A;  1G99 A;  1TL3 A;  2E2Q A;  3ZSY A;  3A2F A;  1QSY A;  3I8B A;  4DMN A;  3EKS A;  4BQZ A;  1N32 K;  3QIN A;  3U4L A;  1RT2 A;  1TKZ A;  4NYN A;  3A8Y A;  2YI1 A;  4OKE A;  4CJV A;  3L2W A;  2QWO A;  4J2A A;  3D45 A;  4N5S A;  1WB9 A;  1ESV A;  4NO7 A;  4J2D A;  1NGA A;  1FKP A;  3DRP A;  4EHT A;  4BDP A;  4IWV A;  1E4F T;  3TTD A;  3DXK B;  5EY4 A;  1D9F A;  1RDC A;  3K5L A;  3R9P A;  4CJ7 A;  4KAZ A;  4KB1 A;  2UUC K;  3T7Z A;  3SUN A;  4IKF A;  2Q1N A;  1DKG D;  2NRZ A;  4BE2 A;  3QIO A;  5B8H A;  5SZT A;  5AQT A;  3J7Y P;  3F2K A;  2E6L A;  1Y64 A;  3WQU A;  2Z1I A;  4BRH A;  2PYL A;  4JN4 A;  2A1R A;  1NGF A;  4DR5 K;  2KQ2 A;  5J2M A;  3FFI A;  1J9A A;  2KHO A;  3K0S A;  2UXD K;  3MN7 A;  4JS5 A;  3VQ5 A;  4FK0 A;  2KZZ A;  4FVU A;  5FDL A;  3TTF A;  4BRM A;  1UWB A;  2HST A;  3QFP A;  3CET A;  1FK9 A;  5JLF A;  2QWM A;  1VRT A;  4C1N K;  3JSM A;  4O0J A;  3ZEU A;  3SMS A;  3PLA A;  4ISE A;  4PKG A;  3UKR B;  4W5Q A;  5AQU A;  2UXC K;  1SV5 A;  2AP1 A;  1ZBS A;  5JS2 A;  2QK9 A;  3VQ7 A;  1Y97 A;  4JHD B;  4NXN K;  5GAE P;  1YVN A;  3GOI A;  2D0B A;  4CIG A;  1CXQ A;  3NBP A;  4CK3 A;  4PL7 A;  2QWR A;  1LV5 A;  2YV0 X;  3RMA A;  4PL8 A;  5MLC Q;  1NWK A;  4IZ9 A;  5AQY A;  4CHY A;  5FRM A;  4PA1 A;  3DRS A;  1TUU A;  1YTU A;  3VEO A;  4BQL A;  5DM7 L;  3SUP A;  4F2R A;  4ELU A;  1JLE A;  1WSE A;  3L3U A;  1JJ2 M;  5JLH A;  1Z6R A;  3E66 A;  5DM6 L;  3HRG A;  2O8D B;  1VSJ A;  2JWL A;  2P1J A;  2GTD A;  3QBW A;  2HHX A;  5GAD P;  4FPA A;  1SAZ A;  5AJ3 K;  3AVK A;  3W0L A;  3UKU B;  3VQB A;  3E01 A;  4LF9 K;  4A57 A;  2UUB K;  2E1Z A;  3ID6 A;  4C1N I;  3M6G A;  1S1X A;  1Z26 A;  2IVO A;  3CJA A;  3H6E A;  4CF1 A;  3RMC A;  2OYQ A;  2IDO A;  3MEC A;  1WNS A;  4OGE A;  4RW7 A;  3U3G A;  5CYM A;  4BR9 A;  3THY B;  3V9X A;  3OYF A;  4FXD A;  3D2E A;  4DSF A;  1W97 L;  5JIC A;  5AQO A;  3O9U A;  4NCA A;  2XHB A;  3NH1 A;  2HHW A;  3K2P A;  3JAM O;  4CF9 A;  3VQ8 A;  1TYQ B;  2IIR A;  4JKG A;  4CZH A;  5AQN A;  5FRO A;  3WXM B;  1BUP A;  3KJV A;  1WAJ A;  2E20 A;  4IOC L;  4PY5 A;  2A1S A;  2E6M A;  2Q0U A;  4FWK A;  4KV8 A;  4DR1 K;  3SUO A;  1U6Z A;  4FWR A;  3SAG A;  1QS4 A;  4DQR A;  5J2P A;  4FLV A;  1UA1 A;  5AQI A;  2KFN A;  3VGM A;  4BC5 A;  4C8O A;  1U4B A;  1WUA A;  1BWF O;  4BGB A;  2JWK A;  3SQ1 A;  2P9I A;  4B9N A;  1NJZ A;  1NGJ A;  3SV4 A;  2F9T A;  1WSJ A;  4C8L A;  4DV3 K;  4CEE A;  1NGE A;  4WF9 L;  5AQL A;  4LFA K;  1SL1 A;  1BL3 A;  2HNZ A;  4CZF A;  3QML A;  4H5W A;  4C8N A;  2IOC A;  4JI1 K;  1D8Y A;  4WQ4 A;  5I3U A;  3DM2 A;  5E84 A;  5BPM A;  2W40 A;  4LF6 K;  1HNI A;  4N56 A;  3HSC A;  3OYM A;  1JLG A;  2OZM A;  1DGK N;  1VSL A;  4CGG A;  3CCV N;  3KLE A;  3VQD A;  3SK3 A;  3J80 O;  1ASV A;  1EKE A;  1RT5 A;  3L0Q A;  3EKU A;  1OH6 A;  1WSH A;  3OYG A;  4U67 L;  4CER A;  1VAZ A;  3KK1 A;  1NGC A;  4CW7 B;  1YT3 A;  3IUC A;  3LP2 A;  4CEQ A;  3TPQ A;  4DTU A;  4BR0 A;  1IKW A;  3S3N A;  5M1Q A;  4CFC A;  3HJF A;  1RTJ A;  1CZA N;  4R5P A;  5HRO A;  2Y1I A;  3SCX A;  3G4S N;  3K57 A;  4B9M A;  4DFP A;  1KFS A;  4PQU A;  4CZK A;  2V7Z A;  1ZBL A;  5GIP A;  1RTI A;  1YJ9 N;  4DTM A;  1XC3 A;  1A5W A;  4F4K A;  3PV8 A;  4W5R A;  4FM2 A;  3WXL A;  3DOK A;  4ID5 A;  5AQG A;  4KHQ A;  4B9L A;  4MLH A;  1BGX T;  1C0U A;  2GUP A;  1JKH A;  2P9P A;  3SAF A;  4DTX A;  4QOZ B;  3O4Q A;  4IOA L;  4BRI A;  1RBU A;  3OYL A;  3VF4 A;  1S5J A;  3SMP A;  1Q7Y O;  3OS0 A;  4Y0W A;  3ULE A;  3TR8 A;  4OPH A;  2OTJ N;  3O1B A;  2RN2 A;  1TUY A;  3L2U A;  2ZGY A;  3DLL L;  1NOY A;  4EZ6 A;  1HNW K;  2HHT A;  3IKM A;  3CFR A;  4OVL A;  4F9O A;  3K58 A;  1RT3 A;  4B3T K;  3IAY A;  1SUQ A;  3OYI A;  4EIA A;  3BZK A;  2X6N A;  2D1K A;  2P9K A;  3EN9 A;  3WNE A;  1VSH A;  1U2V B;  2HOE A;  1REV A;  3DLG A;  2VWB A;  2D0C A;  3HPH A;  4EFH A;  2R7Y A;  3ZX0 A;  3O80 A;  4ZHR A;  4CBU A;  4R79 A;  4E7H A;  3LDS A;  4BGA A;  2B6A A;  4H0V B;  5HRN A;  3ZCM A;  4FLZ A;  3DLK A;  1RGI A;  4O5B A;  4K8Z A;  3TI0 A;  4M41 A;  4DQS A;  4ISG A;  2GWJ A;  4EP5 A;  3T1H K;  3AVB A;  5AFU H;  3IDH A;  1QHA A;  3O9Q A;  3U9Z A;  4OPA A;  4CJE A;  4XIU A;  1T6C A;  4IDK A;  3CM5 A;  2HBL A;  4CJP A;  3O08 A;  1VQ4 N;  1WN7 A;  3TTC A;  3AO3 A;  3MWP A;  2YHX A;  4N47 A;  3RSE A;  1Q81 O;  4DQI A;  3NHG A;  1EWR A;  1NBW A;  2WC9 A;  4JI2 K;  4CGJ A;  4LC9 B;  4YDU A;  1S3X A;  1FXX A;  4I6M A;  2E88 A;  4E0D A;  1QSS A;  3L3V A;  1T7P A;  1R0A A;  3I0S A;  4KTW A;  3OTO K;  2XO7 A;  4B1W B;  4MDA A;  4DV0 K;  3CJ1 A;  2ZJQ L;  4DV2 K;  1WBD A;  2GEM A;  2P9S B;  4FL9 A;  3H46 O;  4A5A A;  4FYD A;  3VGK A;  4OO1 J;  3K5O A;  4KO0 A;  1JL1 A;  1NK6 A;  3CCM N;  5I9E B;  2FSJ A;  3NF8 A; 
#chains in the Genus database with same CATH homology
 3J7A P;  1HNW K;  1I94 K;  2F4V K;  4B3T K;  1FJG K;  4DUZ K;  5FLX O;  2UXC K;  4DV3 K;  4LFA K;  4NXN K;  4LFB K;  4GKK K;  4LFC K;  4LF5 K;  4JI8 K;  1J5E K;  4DV1 K;  4JI1 K;  5IWA K;  5LL6 Z;  4AQY K;  1N33 K;  4LF6 K;  1IBK K;  1N36 K;  4X65 K;  4GKJ K;  4JI0 K;  4X64 K;  4DR3 K;  3T1H K;  4DR6 K;  3J80 O;  5LMN K;  4B3S K;  4JI5 K;  4B3R K;  4CW7 B;  1IBL K;  5AJ3 K;  1N32 K;  4X66 K;  1IBM K;  4DUY K;  2UUA K;  4K0K K;  4LF9 K;  4LF4 K;  2UUB K;  4LF8 K;  4DV4 K;  5IT9 O;  4DV6 K;  3J81 O;  4LF7 K;  4JI2 K;  1HNZ K;  3T1Y K;  2VQF K;  2UXB K;  1XNR K;  2UUC K;  4DR2 K;  2ZM6 K;  3JAM O;  4KHP K;  4JI4 K;  3OTO K;  2E5L K;  4JI7 K;  3J7Y P;  1N34 K;  4NXM K;  2UU9 K;  4DV0 K;  2VQE K;  1HR0 K;  1XMO K;  4YY3 K;  4DV2 K;  4X62 K;  4YHH K;  4DR5 K;  4DR4 K;  4JV5 K;  4OX9 K;  5LMU K;  4JYA K;  4DV5 K;  4CVN E;  2HHH K;  2UXD K;  1XNQ K;  4DR1 K;  4JI6 K;  4DR7 K;  4V19 S;  4B3M K;  5BR8 K;  1XMQ K;  4DV7 K;  1HNX K;  4JI3 K;  5A2Q O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...