2UXBK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxbK00
4V19S 4JI4K 4DR3K 4DV7K 4YY3K 4NXNK 4DR4K 4DV6K 1XMQK 4AQYK 1I94K 4X66K 4JI1K 1IBLK 3T1HK 3OTOK 2UUBK 4LFAK 4JI0K 2VQFK 5LMNK 3T1YK 4LF7K 4DR2K 4OX9K 4K0KK 2F4VK 4LFCK 4DV1K 4NXMK 5A2QO 1J5EK 4CVNE 1XNQK 1N34K 1HNXK 4DUYK 4DV3K 1N32K 1N36K 4LF9K 4DV4K 1IBKK 4X65K 5IWAK 1HNZK 4JYAK 4GKKK 2UXBK 5LL6Z 4LFBK 1XMOK 4LF5K 4JI5K 4JI7K 4DR7K 4LF8K 2ZM6K 5LMUK 4JI6K 4DV2K 2UUAK 4DV0K 4X62K 4DR5K 5BR8K 4DUZK 3J81O 1HR0K 3J7AP 2HHHK 4LF4K 2VQEK 1FJGK 4JI8K 1N33K 4DR1K 4KHPK 4CW7B 4JV5K 4B3SK 4DV5K 5IT9O 3J7YP 5AJ3K 4B3MK 4JI3K 5FLXO 3JAMO 2UXCK 1HNWK 4YHHK 4LF6K 4GKJK 4X64K 3J80O 2UUCK 2UXDK 4DR6K 2E5LK 4JI2K 1IBMK 4B3RK 1XNRK 4B3TK 2UU9K
chains in the Genus database with same CATH superfamily
4CZGA 4DTSA 4CJRA 4UY8O 4YOWA 2IDOA 1ATSA 1XMQK 4HUGA 3G10A 2RE2A 3V9UA 4DLGA 3ZT1A 1VQPN 4ELUA 4I2PA 3P39A 3B8AX 3VOVA 4IO9L 2YJFA 3ZSXA 4AM6A 4CHNA 4F8RA 1MDUB 4JKGB 1I3AA 1U49A 3LL3A 3OS1A 1LCUA 4B1YB 4IFYA 4F2SA 4MLHA 2NRTA 3CPWM 3LAMA 3FZFA 4ELVA 3K2PA 1NKCA 4E7IA 1NMDA 3CCJN 2ETJA 2RHKA 2ASMA 3LP3A 2ASPA 1V4TA 1JXEA 3VGMA 3OYHA 4GW6A 1U6ZA 4BR7A 4FZZA 1L3UA 1U47A 3V1QA 4CF0A 1HKCA 3D7EO 3CXCM 1Q8IA 3K9JA 1UOCA 3T7ZA 4FLXA 2P9SA 1XC3A 1HPMA 2I7PA 4CF1A 1L3TA 1JLAA 4C1NI 1D5AA 3FZHA 2PYJA 4DF8A 1RT7A 2B6AA 5SWMA 1TAQA 4JKCA 3M1FA 2HHQA 3VESA 3CQ8A 4E19A 4C8LA 5M1KA 4ICLA 3M5RA 1H1VA 5AQUA 2BUPA 4GMJB 4ISEA 4CJ3A 4EHTA 1RTIA 4CEZA 1BI4A 4RW7A 4BC2A 1YHQN 4H5WA 1RBSA 3VENA 1G99A 2HHHK 2RKIA 4FJLA 4BGAA 3QB0A 3M3ZA 3G4SN 3DLEA 4Z94A 2BGGA 4CJQA 4KRFA 1NK6A 4G1QA 4KREA 2RPIA 3L2WA 2OANA 3OJSA 2I5JA 3EEQA 3NHGA 1C1AA 3CERA 1Q7YO 3A5MC 2YNFA 3PIPL 1KAYA 3C0BA 4GKJK 3AVHA 1MA9B 4JI2K 4DWIA 1A5XA 3HVTA 5T7BA 3SMPA 2D4WA 4FJHA 3CCSN 2WONA 3UB5A 3D2EB 3LDNA 1VHXA 4QCLA 4DFMA 5HRSA 1QZ6A 1EX4A 1RT5A 3D6RA 3DYAA 1BQNA 3VQQA 3DRSA 1NGDA 4JI0K 2NNWA 1HNVA 3LPTA 3RRGA 2Z1HA 4ILHA 4DU1A 5AFUH 4OJRA 4DTRA 4JNEA 3DRRA 3CCUN 2O8EA 1GOAA 4FLWA 3MN9A 1W2BM 1EP4A 1VQ8N 3QNNA 4BRIA 3TABA 1RDAA 1XNQK 5HRNA 1TVRA 3L8BA 2FLOA 3PSIA 1X9SA 1SKRA 4DQPA 4CHYA 5M1PA 4M3TA 2ITMA 4EP5A 3O3HA 1JL1A 4FO0A 3MX2A 5FPDA 4DSFA 1YJ9N 3C7NA 2Y1IA 2XY8A 2UXBK 3CMEN 3VQ4A 1W7AA 3C6UA 2DFHA 1J5OA 1TK5A 4NB4A 3PUFA 3LM9A 4JKGA 5C2DA 4FWNA 3LDOA 3ALYA 4IG0A 4JAXA 4NCGA 3T1AA 5LMUK 1XQSC 3ZETB 1CZBA 2G8HA 3DLHA 1WBDA 4RW9A 5BR8K 3OYJA 4CBWA 4KAZA 4QOZB 4C1NK 3SBGA 5C12A 2KHOA 1S6QA 2JWLA 3RMAA 2E2NA 2Q0RA 3BF1A 4BR4A 4CEEA 4B9TA 4B9LA 2G8IA 3JS6A 3G0ZA 1GOCA 1NGFA 2AP1A 1IH7A 3K9KA 4DR1K 2G8UA 3I8DA 4KBOA 4FJNA 1J9AA 2HSTA 4FWRA 4K43A 3AO1A 1NJZA 1Q82O 4JI3K 1ASWA 4DSLA 3NVKA 2RF2A 2GWKA 5AQKA 3H1VX 1HNWK 4W5QA 4YHHK 4YOYA 1C0UA 4NCAA 3CQXA 1EXQA 4FLYA 4DQQA 4CERA 2HHUA 3MN6A 4H0OA 4JK9A 5BRDA 3R3LA 4B9QA 3HJFA 1YT3A 4I7FA 2UU9K 3V9SA 4IFVA 3QEXA 1UAXA 5I3UA 3NVMA 5LY3A 4FWLA 5CHIA 4J2AA 4CBUA 5SZTA 2ZQBA 3CJAA 4IZ9A 3WT0A 4FJXA 2F96A 1RT1A 3T1YK 1ZXOA 1SAZA 1K8KB 3BP8A 4FLTA 3E1YA 1D9FA 4BRGA 4CEDA 2OPSA 5C2FA 3EZ5A 3DOLA 2VWKA 4I2QA 4AILC 1CZ9A 5BR9A 2O4GA 3TAEA 1J5EK 3L6QA 4KHNA 2QWQA 2LSNA 2YV0X 1X9JA 3OY9A 3M8SA 3D2EA 2HMIA 2YNIA 1N32K 4BG9A 4PKHA 4WQ5A 3ENOA 1BCOA 3RMBA 4GKKK 4C8NA 5J1EA 3O1BA 1NGEA 3NF8A 5BPLA 3V9XA 4GV3A 4Q5VA 3R8EA 2IOCA 4LF8K 4FJ8A 1NK5A 3O1WA 4NYFA 1KLMA 1OH5A 4OPAA 4FLZA 4DFPA 4FM1A 4JS5A 2E6LA 2E2QA 3HP6A 1NK4A 3WUHA 1C0TA 3I55N 3V1RA 1Q86O 4H0VB 1ESVA 1FJGK 3IKMA 1VSMA 2W41A 4CD1A 3FZKA 3OJUA 3BZCA 4JKDA 3MAQA 2GX9A 1YJWN 3AA3A 4IFEA 3KWGA 3IDHA 1YI2N 5E26A 1DLOA 2CH5A 1IG8A 4BRPA 2ZWHA 2E5LK 1KVAA 1KQSM 2XRIA 1Z05A 3OYEA 1GOBA 1SS6A 4I6MB 3TR8A 1TK0A 2QI2A 3ZETA 4HHTA 3OYDA 1HQUA 4DR4K 2GBZA 4EHUA 5HBMA 4E0DA 4J8FA 3NGZA 4CF9A 1JLBA 3T1HK 1JJ2M 1LV5A 4OGCA 2GEMA 3RSEB 3SV3A 4RW6A 1T3VA 2VQFK 3LP2A 1RNHA 1U2VA 3AAQA 4K0KK 2P9UB 2WTUA 1VQ7N 4FWOA 3VETA 3GE1A 3F9KA 2XHBA 3DWLA 3LZIA 5CR4A 1IO2A 4XH5A 3O4QA 3AVMA 3LM2A 4O8UA 3AV9A 3SUPA 1NGCA 1ZBUA 3DLGA 3AVGA 4FPAA 4CZEA 3HK2A 2OPPA 4E1JA 3TAGA 3F5TA 4QS9A 2NRHA 3VTHA 3RWUA 4CIGA 1WN7A 4H0PA 3K5OA 1T7PA 3LWMA 4J2DA 2YKNA 4BRMA 1REVA 4BY9C 5KPZA 3IS9A 2BH1A 5ADXH 3MX5A 1EWRA 4BR5A 4DV2K 1RBRA 3K59A 1IJJA 4A5BA 4FJMA 2FBTA 4AHTA 1JLEA 2NRWA 3VQAA 4ZHRA 3FZLA 5HRRA 4BR0A 3EKSA 3T69A 2A40A 5ELZA 1NGIA 1XHZA 4GVMA 3RVCA 4M7XA 3PV8A 1ATRA 4IOAL 1S1VA 3T3FA 2ZD1A 1L3VA 3WNGA 1JLGA 3ASMA 4CW7B 4JV5K 4W5OA 4CCHA 2F8TA 4B3SK 4CK1A 1S1WA 4JD2B 4CGGA 3DI6A 3JAMO 4JRPA 2WC9A 4CJFA 4OLBA 1X9MA 3S9HA 4YDUC 4IO8A 4DHYA 2ZF5O 3WEEA 1T44A 4XIUA 4RW8A 2EX3A 4Z4EA 2Z1GA 1D4XA 4IJNA 1YF5L 2CGLA 4H0YB 4IEEA 3IAYA 2FF6A 4C8MA 2F9TA 4FK2A 4ISFA 1WBBA 1FK9A 2PYLA 1KTQA 1XC9A 3NH1A 5AR0A 1GLDG 2OTLN 3OS0A 4BRFA 4CEQA 1NJIO 3D2FB 4E1NA 3L2RA 3JSMA 1JL2A 4PKIA 4BDYA 4I9LA 1QSSA 3OBWA 1KXPA 1RBVA 4IWVA 1VRUA 4HUFA 4PA1A 3VTIA 2OA8A 3DMJA 4C8KA 4OPHA 1S22A 1O13A 2YHBA 4PUOA 2VWBA 1ZC6A 3CJCA 3VPZA 3KLHA 2GTDA 3O4WA 4I6MA 4PL8A 1QZ5A 1W97L 1JKHA 4LSNA 1IBKK 1NBWA 2G8VA 4X65K 3CQYA 5E41A 2X6NA 1LAWA 4FWQA 3WXIA 4DU4A 3PO4A 4NO7A 4B9MA 4KPYA 3KKSA 3RSEA 3ZSZA 3SV4A 4DQRA 2NLXA 3ID6A 4M3XA 4O4GA 4JS4A 3D0PA 3SPZA 1U4BA 3HT3A 5AQMA 3EYZA 2HF4A 3HYFA 1S72N 3P38A 2QWPA 3VEYA 1KC8O 4DLEA 3MMVA 2HBJA 3AY9A 4MO5A 1NGGA 2P5OA 5HROA 5AZIB 4BRCA 4CJEA 3OW2M 3PX6A 2VQEK 3UE5A 2FBYA 1GLEG 3LDLA 5AJ3K 4BE1A 3HL8A 2Q0UA 3M6GA 1SL0A 1RDDA 2Z1IA 4YOTA 1DEJA 1QQMA 3LALA 3VQDA 4WFAL 1GLBG 2RN2A 1RTJA 3L4QA 2VYPA 2ZGYA 1TL3A 3NH0A 2BTFA 1EKEA 4B8CA 4AHSA 3HP9A 3V9ZA 3V9WA 4N41A 1JXBA 3R6MA 1RGIA 4AQYK 4CJ5A 5I9EB 3RR7A 4DQIA 2P9LB 1VQ9N 1TKXA 3VQBA 3CJBA 1YTAA 4RW4A 4DTJA 4F3TA 1P90A 4JD2A 1IG9A 3DOKA 3VQ5A 5BN8A 3MN7A 3LP1A 3OA9A 1YAGA 3BY5A 3HBTA 4GV6A 4CK2A 4PL7A 2VG7A 3AA5X 4GNIA 3K5LA 2JLEA 2P51A 1GLJO 1RDWX 1XHXA 3CF5L 3WNHA 1NGAA 1LWFA 3OYBA 1VRTA 2YHYA 1Y64A 3CM5A 4B08A 1DKGD 3AARA 4NLBA 1O1WA 4R79A 1N5YA 4FCYA 3ISNC 1HJRA 5BPNA 3D2FA 3FFIA 3HOTA 2H3GX 3QEWA 3CETA 3DLLL 5AFUA 3VF2A 5B8HA 3U8XA 4CJLA 5JS2A 3JXUA 3M8PA 2DTUA 4IOXA 4YNQA 5J2QA 1M1KO 1S9EA 4FZYA 3AO4A 1HR0K 2E4LA 4Z4CA 2O8FB 1WSEA 5AQFA 5C0YA 5DM6L 5AQSA 3ZT4A 4IOCL 1E4FT 3Q7CA 2AJQA 3N4PA 1N33K 2HHTA 1HKBA 1G15A 3CM6A 1K6YA 5I42A 1T05A 4QS8A 4B3MK 3WXKA 3TAMA 1GLFO 1M90O 1KRPA 3FZMA 3LP0A 1VQKN 4CZMA 1BQMA 2YNHA 1VSFA 4F9OA 3K5MA 3DLBA 1ZBSA 3VEVA 1I94K 3ENBA 3CCVN 3GDQA 3FR0A 5AZIA 2OYQA 2GELA 3G71N 4MDAA 3M8RA 1VQMN 3GG4A 3ZX0A 2ZGZA 4FLUA 3H08A 1TGOA 3P4IA 4IEIA 5J2MA 4DR2K 3LAKA 4OPKA 3TSQA 1TV6A 3C6AA 1YITN 4OX9K 4HTLA 2A1SA 2FBVA 3DLRA 5HP1A 3QO9A 1U48A 2QXFA 4QAGA 2E88A 1FW6A 1B9DA 2HHXA 1WSJA 5J2NA 3OBYA 4YOUA 1CZAN 4H4MA 4BC4A 3KWIA 4HWIA 1X9WA 4FXDA 3FFKB 4DTUA 2QXLA 3OVNA 3MCPA 3DXKB 3ENHA 2FSNA 1C1CA 1OVQA 4Z4IA 1KVBA 3L4IA 2P9LA 4WQ4C 2CH6A 2VG6A 5AQQA 4HVJA 4FM0A 4JK8A 4IDKA 1YJNN 1NJYA 3TSUA 1ZBLA 1VAZA 4JLHA 3VA0A 3O9RA 3C65A 4BRLA 4WF9L 1QSLA 4BQZA 3SUQA 5BRHA 1QHTA 5AQYA 3S41A 4B9UA 3J7AP 1P8ZA 5CZ2A 1UA1A 4WFBL 3SJHA 3KLEA 1SQKA 3V81A 4BVPA 3Q7BA 3SAHA 4BE2A 4CI6A 4TSXA 3CD6N 1OH6A 3OYNA 3O3GA 1B92A 2IIRA 4B1VA 1W0HA 5AQOA 3H3OB 4CJ7A 3D45A 1VSHA 1KSPA 3RRHA 5EXWA 3BGRA 4O5FA 5FPNA 4DTNA 3CC2N 4BR2A 4FOIA 3AVIA 1HPZA 4CFCA 3VQ9A 1TKDA 4FW2A 2PZSA 4MO4A 2O8FA 3WXMB 4PHTX 4K8ZA 4A59A 4LF7K 1HRHA 3IRXA 3A5OC 4N76A 2F4VK 3AGRA 3O6WA 4F3OA 4DQ8A 3SMSA 1RCHA 2IAJA 2IGIA 2XY7A 2D1KA 4ILJA 2F7TA 3P83D 4MFBA 3AVLA 3O9UA 4GVEA 3ZSOA 3SI6A 3SQ4A 1N36K 1VSEA 1S1XA 1TK8A 3PY8A 2D5RA 3IUCA 3OYLA 1U45A 1VK0A 4H0TB 5JLFA 3S3MA 1WSIA 2E20A 1QVFM 4JK7A 1XMOK 4DTPA 4MLEA 2P9NB 3S3OA 4M3UA 4IDHA 1NJXA 2KLAA 3SYZA 3WXJA 3VQEA 1MWMA 5EY4A 3BUZB 2DPNA 1VQNN 3O9TA 1E4GT 3KVGA 1SL1A 1WSGA 4B9NA 4U7BA 1R59O 4BC5A 4CZIA 1OKJA 4W5NA 3DXKA 4FZXC 3A8YA 5EVZA 1DT9A 3QLHA 4FWMA 5M1QA 4F4KA 1X3MA 3VEWA 3TAQA 1LWEA 3O08A 4DR6K 3HZ6A 4B3RK 5ADXA 4HCCA 3ZSWA 3E9OA 1ZBFA 1F21A 1NMNA 3VQPA 5GAEP 3VF4A 4BVOA 1HJOA 1E3MA 4M45A 4CHPA 1J53A 1Q9XA 4FOEA 3ULEB 3OYGA 1K73O 3SNNA 3MWPA 3ZX2A 4PY5A 3HXMA 4FPBA 3MEDA 2E2PA 3OTOK 3LWLA 3QICA 1RBTA 4LFAK 4DSIA 4BWMA 1WOQA 3A5NC 3OYAA 3PO5A 3O9QA 1KLNA 3F2KA 3AA2A 4A5AA 1VQ4N 5BN9A 5BPMA 4FJ9A 4CZLA 1EWQA 5AQRA 1BL3A 2J4RA 1XI1A 4CVNE 4M41A 1HNXK 1QQNA 3CJ1A 3TAPA 5HRPA 3C6HA 3THVA 2VCPA 2KW4A 5IWAK 3CCEN 2OPRA 1KVCA 1MWKA 4JYAK 2FF3B 2ZJRL 3SQ1A 5LL6Z 4B1XB 4YOVA 1QE1A 3QEPA 3QESA 3R1XA 2D0BA 3N4QA 1NWKA 1W9HA 2ZM6K 4BREA 5C10A 3AO3A 3BDPA 4DS4A 5M1FA 2WOMA 4N5SA 3SPYA 4KH4A 2HB5A 2GWJA 3M8QA 1VQ5N 3GOIA 1WAJA 3NF9A 2B5JA 4M63C 2Z1JA 3F73A 2QWMA 1GLAG 3MEGA 4LF4K 3OHRA 3VQ6A 2PBDA 3NH2A 4KHPK 4XH4A 2UYTA 4ID5A 2EWSA 2P9IB 1K8KA 3KD1E 1YVUA 4KH6A 4O44A 1I39A 1ZBIA 2A42A 3HPGA 3SAGA 4LF6K 3VGKA 3QIPA 1VQON 1TYQB 2UXDK 2Q3SA 3AO2A 4B9SA 4BG8A 1CLQA 1IBMK 4H5NA 4DSKA 3R9PA 4O0JA 4B9VA 1CXUA 5KGWA 3HM9A 1NK9A 3MEEA 3THWB 4OVLA 4DFKA 3H46O 4X66K 3VA3A 4CJSA 3H1QA 3H45C 4KV8A 1IV0A 1GLCG 4FJ7A 4FWPA 3MXMA 4QS7A 5GINA 1WSFA 2QKKA 5AZJB 2A1RA 4NXMK 4CJUA 4JKEA 4DG1A 4K42A 3SK3A 3FE1A 4CZHA 4CZJA 2BDPA 3ZSQA 1VSKA 2Q36A 3MDQA 5GAHP 1YXQA 4DCHA 2ATQA 1WLJA 2QWRA 4JHDB 4CESA 1U04A 3ZSYA 4PWDA 5FRNA 2VGMA 5JVHL 3SJJA 2NRZA 1NKEA 3DAWA 1OH7A 5EOYA 5KRSA 4FSVA 3K5NA 3GBTA 1RTDA 2YCHA 4Y0WA 4BGBA 3BEXA 1QHAA 5TKWA 3CIPA 3SQ2A 3O5BA 4HUEA 1LAVA 3TTDA 3WQUA 2X78A 4DR7K 2O8CB 2WUSA 4CEAA 2DFEA 3NMUA 3PIOL 3ITHA 4BC3A 3OS2A 1D9DA 4JKFA 3I0SA 3IFRA 4LH5A 5DMRA 1TUUA 4B8AB 3HM8A 1JLQA 1VSLA 3EZWA 3B6OA 3ZCMA 2PY5A 3TU5A 3OYCA 2YI1A 3ATVA 4M3RA 1RDBA 5AQVA 4OKJA 4Z4GA 2UXCK 1K9MO 2P9UA 1RILA 2HMPA 1HQEA 1RTHA 5JVGL 3DLKA 2O8DB 2OPQA 3QFUA 3O8MA 3AVFA 3QFPA 1IKYA 4I9QA 1BISA 4RWTA 3RMDA 1X3NA 2NRVA 4BDZA 2R7YA 4FJIA 5AQNA 2F8SA 1HKGA 3KLGA 1JCGA 2KKZA 1BI4B 1UWBA 1S5JA 5E84A 1S3XA 2YX6A 4IG3A 3J7ZO 5FRMA 1A5VA 1DGKN 2D0OA 2KZMA 2QEXN 1OH8A 3QIOA 5DM7L 3CCRN 3CCLN 4BWJA 4KKOA 4LH4A 2P9IA 5CZ1A 3NFAA 3CC7N 3TARA 4Z4HA 2V7ZA 3TAFA 4JEPA 1TYQA 1BA1A 5HOOA 2P9KB 4H5RA 1TUYA 1N6QA 1ATNA 5AQTA 4AHRA 4BRKA 2OZMA 2D0AA 4MQ3A 2Q2RA 4DTOA 2QW9A 3HTVA 3CJ7A 1T03A 1BGXT 3CJ9A 2VGNA 1UA0A 2A6AA 3I33A 3U9ZA 3P5JA 2PAVA 4OGEA 3CG7A 3U4LA 2Q97A 3CMAN 2ASOA 4K25A 2AA4A 2B4JA 2G8KA 5K14A 1TAUA 3DM2A 2XO7A 5FDLA 4DV0K 1SUQA 3TSPA 4MDBA 3VQ8A 5MLCQ 1RT4A 1RDUA 3W3DA 3KK3A 1L3SA 4O55A 1BO5O 3BF3A 4NCBA 4FYDA 3PSFA 4JHDA 3NBPA 5AQZA 3C7NB 5IT9O 5JS1A 2YHAA 3UKUB 1JCEA 2HHVA 4BDPA 1BHLA 3H6EA 3ZT3A 4CJVA 4HCBA 4FK0A 3WNFA 1RT2A 4CGHA 3G25A 4LY7A 3QMLA 1DTQA 2P5GA 3HOSA 2O8CA 2JGUA 1NNEA 1JCFA 4Y1DA 4Q0BA 2GV9A 2FXUA 3A0IX 2JWKA 4B1WB 1TKZA 4CFBA 4NXNK 3SUOA 2QA4N 1C6VA 4CGIA 3BZKA 1YIJN 3LDQA 2YHXA 4DFJA 4ILGB 3VEZA 4A61A 4OPJA 4DQSA 3K57A 3HSTB 2BANA 4CE9A 2UUBK 4CJTA 4G9ZA 2HF3A 5LMNK 1EQYA 1X1PA 2I7NA 4L8RB 3VF6A 1HLUA 3MXIA 4KHWA 4FW1A 5GADP 3AA4A 3WXLA 4LFCK 4WE1A 4CFDA 2NUBA 5EX5A 1NGBA 2O8DA 3U6FA 5F0XA 3B6PA 3V4IA 3W0LA 3EE8A 3U9DA 3C95A 4H8KA 1N8RO 1VSJA 3CC4N 3ZX3A 3ZSVA 1HYSA 3ZSRA 3QETA 4B1ZA 2NRRA 4CGDA 5CE3A 4EZ9A 4CHOA 4KFBA 1BCMA 2YJEA 4DSJA 4FVUA 4BQLA 1K8AO 1NK7A 5M1NA 3KLIA 3VQ7A 4FJKA 4KTZA 3V6DA 3ZT0A 4JI5K 3KK7A 3IG1A 2XY5A 5AQWA 1QS4A 2E8AA 4CJWA 5KQ8A 4AH9A 2HVHA 5AQHA 3C94A 1NOZA 1KAZA 2P9KA 2CGKA 4M3ZA 2Q31A 3IMXA 3ZYYX 5KQDA 3J81O 1J54A 3O3FA 5C24A 1R0AA 3SUNA 1Y97A 4CIEA 5KRTA 4OLAA 1NJWA 4A57A 2HBMA 5HLFA 1FKPA 5GAGP 1EO1A 4CEOA 3QBWA 5GIPA 4N47A 3FLCO 4JKHA 5LJWA 1SKSA 1BDGA 4CGFA 3AVJA 4PQUA 2FSJA 1NGJA 4F2RA 2E1YA 4EIAA 1QQCA 4NLCA 4K8XA 4O0IA 4V19S 4WYBA 4JI4K 4FJGA 4FK4A 4DTXA 3TTFA 4AHUA 1L5UA 3O80A 3F9MA 4EAHD 4JI1K 3L0QA 2E1ZA 2QTDA 4FJJA 4O5BA 5CYMA 3K58A 5KI6A 4CBXA 3H3NO 3HPOA 1NKBA 1JLCA 3NGIA 4CHQA 4CEFA 2O8BB 4H5VA 3DRPA 3UKUA 3TANA 4JKBA 2P1JA 4WQ4A 3ID8A 4OKEA 2QM1A 4B1UB 3A2FA 4E7HA 1NK0A 1SL2A 3L2VA 1Q81O 3KTQA 3S3NA 5HL7L 3RR8A 3MK6A 4E7JA 1IKVA 5FPMA 1J6ZA 3KK1A 3DXMB 4LFBK 4J2BA 3SAFA 3J8AA 1MU2A 1U2VB 3P1GA 1SV5A 5AQPA 4BR9A 4JI7K 3UKRB 4E89A 4IKFA 4JRQA 4ISGA 3AVCA 3NF6A 4B3OA 1ASUA 1C0GA 2HBLA 3NDKA 1HNIA 2HBKA 4WQ5C 1RT3A 4LC9B 3I56N 2ZJPL 2A5XA 5F1XA 1ZBHA 4IXCA 3HO1A 1NOYA 3PLAA 3WNEA 5C25A 3SLCA 2W42A 5LJVA 4DV5K 3OYMA 3AVKA 2HOEA 1C0MA 2HHSA 2HVIA 2IC3A 4LD0A 4BRNA 3E66A 3DJCA 2V51B 2FC0A 5KGXA 4WFNL 4BRDA 5TKYA 5CY4A 3NGYA 3CPEA 4Z0UA 4A2AA 4RCHA 1XNRK 3VEOA 3NAEA 4B3TK 4W5RA 5M1OA 3E9LA 3QNOA 2VWJA 1BG3A 3V1OA 1RT6A 4DU3A 2D0CA 4PKGA 3E9PA 1WB9A 4RTFD 3KD5E 4DV6K 2W6KA 2W6LA 3AVNA 4M7YA 1NGHA 1IBLK 1TL1A 1T6DA 1BU6O 5JMVA 1HX1A 3KJVA 1ZYQA 1Z26A 3PX0A 3MWTA 2Y1JA 3RTVA 4CK3A 1BWFO 4EP4A 4FM2A 1TKTA 1BIUA 5BREA 3UIQA 3MCAB 3ZEUB 3WEEB 5C15A 1BOTO 4H03B 4YOXA 3QEIA 4CFAA 3A5LC 2HNYA 2XY6A 4Z4FA 3CI5A 1S1TA 4CHZA 1Q9YA 2FBXA 2FSKA 4DV3K 2E6MA 4KI6A 2HNDA 1Z25A 4LF9K 3KKRA 1YTUA 1SZ2A 2E2OA 5BRFA 2YHWA 4O8KA 4YORA 3HRGA 1JLFA 4FWKA 1DTTA 1C1BA 4OO1J 4CECA 1ITGA 4J2EA 1HYZA 1LW2A 3VN5A 4CD3A 3VGLA 3EO3A 1B9FA 3WQTA 1T6CA 2UUAK 4FJ5A 4KHQA 2O8BA 3KK2A 5KTQA 4JN4A 1NG9A 3THYB 3HI0A 3OYIA 4DR5K 4GY2B 2F9WA 2X6SA 2G8FA 3AVAA 3LDSA 3EKUA 4EZ6A 1CXQA 3THXB 1D8YA 4KO0A 2KFNA 5F2RA 1BIZA 3EL2A 3SBTA 4CJKA 4CZFA 1VQLN 3JYTA 3SQ0A 4KHYA 3LDPA 1KCFA 3LPUA 4ELTA 3J7YP 3NE6A 4Y1CA 2V7YA 1HMVA 4KTWA 1KFSA 3KLFA 1NU0A 3DXMA 4XEIA 4X64K 1YVNA 2QWNA 4E3SA 2QK9A 4H0XB 1XUPO 2NRXA 2NZTA 1ILYA 2QKBA 4DMNA 4R5PA 1RDCA 3UKRA 1ASVA 2G8WA 4KB0A 1BUPA 4E7KA 4YY3K 3TPQA 4FLVA 3P31A 2KTQA 1T8EA 5AQJA 4K41A 4GV9A 1EETA 3KZBA 4AHVA 1RFQA 4ID1A 3CHWA 2WBNA 1WSHA 1LWCA 3L3VA 5C42A 3FGUA 3QEVA 2P9NA 2CGJA 4KH5A 5H1SQ 1RBUA 1IKXA 4KI4A 3CFRA 1V4SA 4ZTJA 4E1MA 3SZ2A 3AGKA 3NF7A 5A2QO 4C23A 4CIFA 4FWSA 1FXXA 3LANA 1NM1A 2IVNA 3VEXA 3U3YA 4BRQA 1WAFA 2ZJQL 3ULDA 2P9PB 4DV4K 2EHGA 3G6EN 4BRHA 4LSLA 3AAPA 3TWHA 2IS3A 4CF8A 2GUPA 1KFDA 2VG5A 3MECA 4H4OA 4LF5K 1S6PA 2V52B 2A41A 4BRAA 5FPEA 5FROA 2KFZA 4JI6K 3VQCA 3HSCA 3QERA 3I8BA 2ITGA 3ZEUA 2YKMA 4HTUA 4M42A 4C8OA 3ATUA 1BA0A 4AF1A 3VMFB 3ULEA 3L3UA 1A5WA 4ZTFA 2Q1NA 5CYQA 4NYNA 1LOTB 5GIOA 1GLLO 2D0PA 4CGJA 1LW0A 2A3ZA 3CCQN 1VQ6N 2KZZA 3KHYA 1WUAA 1WNSA 2BE2A 2PFUA 3EN9A 3TTCA 1S9GA 2IVPA 2DFFA 2UUCK 3C6TA 4IBNA 3HVRA 1IKWA 3AO5A 4YDUA 2OTJN 4CJ4A 3VERA 3QBXA 3K0SA 1Z6RA 4FL9A 1OVYA 4A62A 2IVOA 1QVGM 2HNZA 4DR3K 4DV7K 5DK5A 3THYA 4CZKA 4KTQA 4WCEL 2GUIA 5AQGA 2P9SB 1QSYA 4KHSA 4KB1A 4DF4A 1C0FA 2WFBA 1YUWA 3QINA 3THXA 3RMCA 1NK8A 3O4NA 3QDKA 3CCMN 5JICA 3LZJA 1KAXA 2HHWA 4DB3A 4M3WA 1QQOA 4DSEA 3OYKA 4L3QA 1KD1O 4A2BA 4BACA 4FVMA 3MN5A 3TI0A 4DV1K 3OYFA 1VSDA 4DS5A 4OKKA 5KPRA 5D3GA 4CJPA 4W5TA 1N34K 1NLVA 1HUXA 4DUYK 3EY1A 3PX4A 3I0RA 3GL1A 1QTMA 4AHCA 2QWOA 4EFHA 4N56A 4U67L 1SKWA 3EE9A 3L2QA 1HNZK 5J2PA 4RG8A 1XWLA 1VSIA 3CFPA 3AVBA 5AQXA 2HW3A 5AQIA 2O4IA 4KHUA 4XH1A 2YNGA 2ZE2A 1Q18A 2OCEA 4YFUA 2KQ2A 3MXJA 4CF2A 3O9SA 5EU7A 3L2UA 5AQLA 3KIOA 4E7LA 2DY4A 5JLHA 4X62K 4AM7A 3CFOA 4DKWA 4DUZK 3NCIA 3THWA 3ZLJA 1HYVA 4H5TA 4UQGA 4DTMA 4M3YA 4IJAA 4JI8K 2W40A 2P9PA 3U3GA 5KPTA 3CYMA 2O8EB 5FLXO 4JKAA 3ZT2A 1FKOA 2QWLA 3SCXA 4CEBA 5AZJA 3J80O 3E01A 3T19A 4BROA 2X74A 1S1UA 2OZSA 4BE0A 3HPHA
chains in the Genus database with same CATH topology
4V19S 4JI4K 4DR3K 4DV7K 4YY3K 4NXNK 4DR4K 4DV6K 1XMQK 4AQYK 1I94K 4X66K 4JI1K 1IBLK 3T1HK 3OTOK 2UUBK 4LFAK 4JI0K 2VQFK 5LMNK 3T1YK 4LF7K 4DR2K 4OX9K 4K0KK 2F4VK 4LFCK 4DV1K 4NXMK 5A2QO 1J5EK 4CVNE 1XNQK 1N34K 1HNXK 4DUYK 4DV3K 1N32K 1N36K 4LF9K 4DV4K 1IBKK 4X65K 5IWAK 1HNZK 4JYAK 4GKKK 2UXBK 5LL6Z 4LFBK 1XMOK 4LF5K 4JI5K 4JI7K 4DR7K 4LF8K 2ZM6K 5LMUK 4JI6K 4DV2K 2UUAK 4DV0K 4X62K 4DR5K 5BR8K 4DUZK 3J81O 1HR0K 3J7AP 2HHHK 4LF4K 2VQEK 1FJGK 4JI8K 1N33K 4DR1K 4KHPK 4CW7B 4JV5K 4B3SK 4DV5K 5IT9O 3J7YP 5AJ3K 4B3MK 4JI3K 5FLXO 3JAMO 2UXCK 1HNWK 4YHHK 4LF6K 4GKJK 4X64K 3J80O 2UUCK 2UXDK 4DR6K 2E5LK 4JI2K 1IBMK 4B3RK 1XNRK 4B3TK 2UU9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 S;  4JI4 K;  4DR3 K;  4DV7 K;  4YY3 K;  4NXN K;  4DR4 K;  4DV6 K;  1XMQ K;  4AQY K;  1I94 K;  4X66 K;  4JI1 K;  1IBL K;  3T1H K;  3OTO K;  2UUB K;  4LFA K;  4JI0 K;  2VQF K;  5LMN K;  3T1Y K;  4LF7 K;  4DR2 K;  4OX9 K;  4K0K K;  2F4V K;  4LFC K;  4DV1 K;  4NXM K;  5A2Q O;  1J5E K;  4CVN E;  1XNQ K;  1N34 K;  1HNX K;  4DUY K;  4DV3 K;  1N32 K;  1N36 K;  4LF9 K;  4DV4 K;  1IBK K;  4X65 K;  5IWA K;  1HNZ K;  4JYA K;  4GKK K;  2UXB K;  5LL6 Z;  4LFB K;  1XMO K;  4LF5 K;  4JI5 K;  4JI7 K;  4DR7 K;  4LF8 K;  2ZM6 K;  5LMU K;  4JI6 K;  4DV2 K;  2UUA K;  4DV0 K;  4X62 K;  4DR5 K;  5BR8 K;  4DUZ K;  3J81 O;  1HR0 K;  3J7A P;  2HHH K;  4LF4 K;  2VQE K;  1FJG K;  4JI8 K;  1N33 K;  4DR1 K;  4KHP K;  4CW7 B;  4JV5 K;  4B3S K;  4DV5 K;  5IT9 O;  3J7Y P;  5AJ3 K;  4B3M K;  4JI3 K;  5FLX O;  3JAM O;  2UXC K;  1HNW K;  4YHH K;  4LF6 K;  4GKJ K;  4X64 K;  3J80 O;  2UUC K;  2UXD K;  4DR6 K;  2E5L K;  4JI2 K;  1IBM K;  4B3R K;  1XNR K;  4B3T K;  2UU9 K; 
#chains in the Genus database with same CATH topology
 4CZG A;  4DTS A;  4CJR A;  4UY8 O;  4YOW A;  2IDO A;  1ATS A;  1XMQ K;  4HUG A;  3G10 A;  2RE2 A;  3V9U A;  4DLG A;  3ZT1 A;  1VQP N;  4ELU A;  4I2P A;  3P39 A;  3B8A X;  3VOV A;  4IO9 L;  2YJF A;  3ZSX A;  4AM6 A;  4CHN A;  4F8R A;  1MDU B;  4JKG B;  1I3A A;  1U49 A;  3LL3 A;  3OS1 A;  1LCU A;  4B1Y B;  4IFY A;  4F2S A;  4MLH A;  2NRT A;  3CPW M;  3LAM A;  3FZF A;  4ELV A;  3K2P A;  1NKC A;  4E7I A;  1NMD A;  3CCJ N;  2ETJ A;  2RHK A;  2ASM A;  3LP3 A;  2ASP A;  1V4T A;  1JXE A;  3VGM A;  3OYH A;  4GW6 A;  1U6Z A;  4BR7 A;  4FZZ A;  1L3U A;  1U47 A;  3V1Q A;  4CF0 A;  1HKC A;  3D7E O;  3CXC M;  1Q8I A;  3K9J A;  1UOC A;  3T7Z A;  4FLX A;  2P9S A;  1XC3 A;  1HPM A;  2I7P A;  4CF1 A;  1L3T A;  1JLA A;  4C1N I;  1D5A A;  3FZH A;  2PYJ A;  4DF8 A;  1RT7 A;  2B6A A;  5SWM A;  1TAQ A;  4JKC A;  3M1F A;  2HHQ A;  3VES A;  3CQ8 A;  4E19 A;  4C8L A;  5M1K A;  4ICL A;  3M5R A;  1H1V A;  5AQU A;  2BUP A;  4GMJ B;  4ISE A;  4CJ3 A;  4EHT A;  1RTI A;  4CEZ A;  1BI4 A;  4RW7 A;  4BC2 A;  1YHQ N;  4H5W A;  1RBS A;  3VEN A;  1G99 A;  2HHH K;  2RKI A;  4FJL A;  4BGA A;  3QB0 A;  3M3Z A;  3G4S N;  3DLE A;  4Z94 A;  2BGG A;  4CJQ A;  4KRF A;  1NK6 A;  4G1Q A;  4KRE A;  2RPI A;  3L2W A;  2OAN A;  3OJS A;  2I5J A;  3EEQ A;  3NHG A;  1C1A A;  3CER A;  1Q7Y O;  3A5M C;  2YNF A;  3PIP L;  1KAY A;  3C0B A;  4GKJ K;  3AVH A;  1MA9 B;  4JI2 K;  4DWI A;  1A5X A;  3HVT A;  5T7B A;  3SMP A;  2D4W A;  4FJH A;  3CCS N;  2WON A;  3UB5 A;  3D2E B;  3LDN A;  1VHX A;  4QCL A;  4DFM A;  5HRS A;  1QZ6 A;  1EX4 A;  1RT5 A;  3D6R A;  3DYA A;  1BQN A;  3VQQ A;  3DRS A;  1NGD A;  4JI0 K;  2NNW A;  1HNV A;  3LPT A;  3RRG A;  2Z1H A;  4ILH A;  4DU1 A;  5AFU H;  4OJR A;  4DTR A;  4JNE A;  3DRR A;  3CCU N;  2O8E A;  1GOA A;  4FLW A;  3MN9 A;  1W2B M;  1EP4 A;  1VQ8 N;  3QNN A;  4BRI A;  3TAB A;  1RDA A;  1XNQ K;  5HRN A;  1TVR A;  3L8B A;  2FLO A;  3PSI A;  1X9S A;  1SKR A;  4DQP A;  4CHY A;  5M1P A;  4M3T A;  2ITM A;  4EP5 A;  3O3H A;  1JL1 A;  4FO0 A;  3MX2 A;  5FPD A;  4DSF A;  1YJ9 N;  3C7N A;  2Y1I A;  2XY8 A;  2UXB K;  3CME N;  3VQ4 A;  1W7A A;  3C6U A;  2DFH A;  1J5O A;  1TK5 A;  4NB4 A;  3PUF A;  3LM9 A;  4JKG A;  5C2D A;  4FWN A;  3LDO A;  3ALY A;  4IG0 A;  4JAX A;  4NCG A;  3T1A A;  5LMU K;  1XQS C;  3ZET B;  1CZB A;  2G8H A;  3DLH A;  1WBD A;  4RW9 A;  5BR8 K;  3OYJ A;  4CBW A;  4KAZ A;  4QOZ B;  4C1N K;  3SBG A;  5C12 A;  2KHO A;  1S6Q A;  2JWL A;  3RMA A;  2E2N A;  2Q0R A;  3BF1 A;  4BR4 A;  4CEE A;  4B9T A;  4B9L A;  2G8I A;  3JS6 A;  3G0Z A;  1GOC A;  1NGF A;  2AP1 A;  1IH7 A;  3K9K A;  4DR1 K;  2G8U A;  3I8D A;  4KBO A;  4FJN A;  1J9A A;  2HST A;  4FWR A;  4K43 A;  3AO1 A;  1NJZ A;  1Q82 O;  4JI3 K;  1ASW A;  4DSL A;  3NVK A;  2RF2 A;  2GWK A;  5AQK A;  3H1V X;  1HNW K;  4W5Q A;  4YHH K;  4YOY A;  1C0U A;  4NCA A;  3CQX A;  1EXQ A;  4FLY A;  4DQQ A;  4CER A;  2HHU A;  3MN6 A;  4H0O A;  4JK9 A;  5BRD A;  3R3L A;  4B9Q A;  3HJF A;  1YT3 A;  4I7F A;  2UU9 K;  3V9S A;  4IFV A;  3QEX A;  1UAX A;  5I3U A;  3NVM A;  5LY3 A;  4FWL A;  5CHI A;  4J2A A;  4CBU A;  5SZT A;  2ZQB A;  3CJA A;  4IZ9 A;  3WT0 A;  4FJX A;  2F96 A;  1RT1 A;  3T1Y K;  1ZXO A;  1SAZ A;  1K8K B;  3BP8 A;  4FLT A;  3E1Y A;  1D9F A;  4BRG A;  4CED A;  2OPS A;  5C2F A;  3EZ5 A;  3DOL A;  2VWK A;  4I2Q A;  4AIL C;  1CZ9 A;  5BR9 A;  2O4G A;  3TAE A;  1J5E K;  3L6Q A;  4KHN A;  2QWQ A;  2LSN A;  2YV0 X;  1X9J A;  3OY9 A;  3M8S A;  3D2E A;  2HMI A;  2YNI A;  1N32 K;  4BG9 A;  4PKH A;  4WQ5 A;  3ENO A;  1BCO A;  3RMB A;  4GKK K;  4C8N A;  5J1E A;  3O1B A;  1NGE A;  3NF8 A;  5BPL A;  3V9X A;  4GV3 A;  4Q5V A;  3R8E A;  2IOC A;  4LF8 K;  4FJ8 A;  1NK5 A;  3O1W A;  4NYF A;  1KLM A;  1OH5 A;  4OPA A;  4FLZ A;  4DFP A;  4FM1 A;  4JS5 A;  2E6L A;  2E2Q A;  3HP6 A;  1NK4 A;  3WUH A;  1C0T A;  3I55 N;  3V1R A;  1Q86 O;  4H0V B;  1ESV A;  1FJG K;  3IKM A;  1VSM A;  2W41 A;  4CD1 A;  3FZK A;  3OJU A;  3BZC A;  4JKD A;  3MAQ A;  2GX9 A;  1YJW N;  3AA3 A;  4IFE A;  3KWG A;  3IDH A;  1YI2 N;  5E26 A;  1DLO A;  2CH5 A;  1IG8 A;  4BRP A;  2ZWH A;  2E5L K;  1KVA A;  1KQS M;  2XRI A;  1Z05 A;  3OYE A;  1GOB A;  1SS6 A;  4I6M B;  3TR8 A;  1TK0 A;  2QI2 A;  3ZET A;  4HHT A;  3OYD A;  1HQU A;  4DR4 K;  2GBZ A;  4EHU A;  5HBM A;  4E0D A;  4J8F A;  3NGZ A;  4CF9 A;  1JLB A;  3T1H K;  1JJ2 M;  1LV5 A;  4OGC A;  2GEM A;  3RSE B;  3SV3 A;  4RW6 A;  1T3V A;  2VQF K;  3LP2 A;  1RNH A;  1U2V A;  3AAQ A;  4K0K K;  2P9U B;  2WTU A;  1VQ7 N;  4FWO A;  3VET A;  3GE1 A;  3F9K A;  2XHB A;  3DWL A;  3LZI A;  5CR4 A;  1IO2 A;  4XH5 A;  3O4Q A;  3AVM A;  3LM2 A;  4O8U A;  3AV9 A;  3SUP A;  1NGC A;  1ZBU A;  3DLG A;  3AVG A;  4FPA A;  4CZE A;  3HK2 A;  2OPP A;  4E1J A;  3TAG A;  3F5T A;  4QS9 A;  2NRH A;  3VTH A;  3RWU A;  4CIG A;  1WN7 A;  4H0P A;  3K5O A;  1T7P A;  3LWM A;  4J2D A;  2YKN A;  4BRM A;  1REV A;  4BY9 C;  5KPZ A;  3IS9 A;  2BH1 A;  5ADX H;  3MX5 A;  1EWR A;  4BR5 A;  4DV2 K;  1RBR A;  3K59 A;  1IJJ A;  4A5B A;  4FJM A;  2FBT A;  4AHT A;  1JLE A;  2NRW A;  3VQA A;  4ZHR A;  3FZL A;  5HRR A;  4BR0 A;  3EKS A;  3T69 A;  2A40 A;  5ELZ A;  1NGI A;  1XHZ A;  4GVM A;  3RVC A;  4M7X A;  3PV8 A;  1ATR A;  4IOA L;  1S1V A;  3T3F A;  2ZD1 A;  1L3V A;  3WNG A;  1JLG A;  3ASM A;  4CW7 B;  4JV5 K;  4W5O A;  4CCH A;  2F8T A;  4B3S K;  4CK1 A;  1S1W A;  4JD2 B;  4CGG A;  3DI6 A;  3JAM O;  4JRP A;  2WC9 A;  4CJF A;  4OLB A;  1X9M A;  3S9H A;  4YDU C;  4IO8 A;  4DHY A;  2ZF5 O;  3WEE A;  1T44 A;  4XIU A;  4RW8 A;  2EX3 A;  4Z4E A;  2Z1G A;  1D4X A;  4IJN A;  1YF5 L;  2CGL A;  4H0Y B;  4IEE A;  3IAY A;  2FF6 A;  4C8M A;  2F9T A;  4FK2 A;  4ISF A;  1WBB A;  1FK9 A;  2PYL A;  1KTQ A;  1XC9 A;  3NH1 A;  5AR0 A;  1GLD G;  2OTL N;  3OS0 A;  4BRF A;  4CEQ A;  1NJI O;  3D2F B;  4E1N A;  3L2R A;  3JSM A;  1JL2 A;  4PKI A;  4BDY A;  4I9L A;  1QSS A;  3OBW A;  1KXP A;  1RBV A;  4IWV A;  1VRU A;  4HUF A;  4PA1 A;  3VTI A;  2OA8 A;  3DMJ A;  4C8K A;  4OPH A;  1S22 A;  1O13 A;  2YHB A;  4PUO A;  2VWB A;  1ZC6 A;  3CJC A;  3VPZ A;  3KLH A;  2GTD A;  3O4W A;  4I6M A;  4PL8 A;  1QZ5 A;  1W97 L;  1JKH A;  4LSN A;  1IBK K;  1NBW A;  2G8V A;  4X65 K;  3CQY A;  5E41 A;  2X6N A;  1LAW A;  4FWQ A;  3WXI A;  4DU4 A;  3PO4 A;  4NO7 A;  4B9M A;  4KPY A;  3KKS A;  3RSE A;  3ZSZ A;  3SV4 A;  4DQR A;  2NLX A;  3ID6 A;  4M3X A;  4O4G A;  4JS4 A;  3D0P A;  3SPZ A;  1U4B A;  3HT3 A;  5AQM A;  3EYZ A;  2HF4 A;  3HYF A;  1S72 N;  3P38 A;  2QWP A;  3VEY A;  1KC8 O;  4DLE A;  3MMV A;  2HBJ A;  3AY9 A;  4MO5 A;  1NGG A;  2P5O A;  5HRO A;  5AZI B;  4BRC A;  4CJE A;  3OW2 M;  3PX6 A;  2VQE K;  3UE5 A;  2FBY A;  1GLE G;  3LDL A;  5AJ3 K;  4BE1 A;  3HL8 A;  2Q0U A;  3M6G A;  1SL0 A;  1RDD A;  2Z1I A;  4YOT A;  1DEJ A;  1QQM A;  3LAL A;  3VQD A;  4WFA L;  1GLB G;  2RN2 A;  1RTJ A;  3L4Q A;  2VYP A;  2ZGY A;  1TL3 A;  3NH0 A;  2BTF A;  1EKE A;  4B8C A;  4AHS A;  3HP9 A;  3V9Z A;  3V9W A;  4N41 A;  1JXB A;  3R6M A;  1RGI A;  4AQY K;  4CJ5 A;  5I9E B;  3RR7 A;  4DQI A;  2P9L B;  1VQ9 N;  1TKX A;  3VQB A;  3CJB A;  1YTA A;  4RW4 A;  4DTJ A;  4F3T A;  1P90 A;  4JD2 A;  1IG9 A;  3DOK A;  3VQ5 A;  5BN8 A;  3MN7 A;  3LP1 A;  3OA9 A;  1YAG A;  3BY5 A;  3HBT A;  4GV6 A;  4CK2 A;  4PL7 A;  2VG7 A;  3AA5 X;  4GNI A;  3K5L A;  2JLE A;  2P51 A;  1GLJ O;  1RDW X;  1XHX A;  3CF5 L;  3WNH A;  1NGA A;  1LWF A;  3OYB A;  1VRT A;  2YHY A;  1Y64 A;  3CM5 A;  4B08 A;  1DKG D;  3AAR A;  4NLB A;  1O1W A;  4R79 A;  1N5Y A;  4FCY A;  3ISN C;  1HJR A;  5BPN A;  3D2F A;  3FFI A;  3HOT A;  2H3G X;  3QEW A;  3CET A;  3DLL L;  5AFU A;  3VF2 A;  5B8H A;  3U8X A;  4CJL A;  5JS2 A;  3JXU A;  3M8P A;  2DTU A;  4IOX A;  4YNQ A;  5J2Q A;  1M1K O;  1S9E A;  4FZY A;  3AO4 A;  1HR0 K;  2E4L A;  4Z4C A;  2O8F B;  1WSE A;  5AQF A;  5C0Y A;  5DM6 L;  5AQS A;  3ZT4 A;  4IOC L;  1E4F T;  3Q7C A;  2AJQ A;  3N4P A;  1N33 K;  2HHT A;  1HKB A;  1G15 A;  3CM6 A;  1K6Y A;  5I42 A;  1T05 A;  4QS8 A;  4B3M K;  3WXK A;  3TAM A;  1GLF O;  1M90 O;  1KRP A;  3FZM A;  3LP0 A;  1VQK N;  4CZM A;  1BQM A;  2YNH A;  1VSF A;  4F9O A;  3K5M A;  3DLB A;  1ZBS A;  3VEV A;  1I94 K;  3ENB A;  3CCV N;  3GDQ A;  3FR0 A;  5AZI A;  2OYQ A;  2GEL A;  3G71 N;  4MDA A;  3M8R A;  1VQM N;  3GG4 A;  3ZX0 A;  2ZGZ A;  4FLU A;  3H08 A;  1TGO A;  3P4I A;  4IEI A;  5J2M A;  4DR2 K;  3LAK A;  4OPK A;  3TSQ A;  1TV6 A;  3C6A A;  1YIT N;  4OX9 K;  4HTL A;  2A1S A;  2FBV A;  3DLR A;  5HP1 A;  3QO9 A;  1U48 A;  2QXF A;  4QAG A;  2E88 A;  1FW6 A;  1B9D A;  2HHX A;  1WSJ A;  5J2N A;  3OBY A;  4YOU A;  1CZA N;  4H4M A;  4BC4 A;  3KWI A;  4HWI A;  1X9W A;  4FXD A;  3FFK B;  4DTU A;  2QXL A;  3OVN A;  3MCP A;  3DXK B;  3ENH A;  2FSN A;  1C1C A;  1OVQ A;  4Z4I A;  1KVB A;  3L4I A;  2P9L A;  4WQ4 C;  2CH6 A;  2VG6 A;  5AQQ A;  4HVJ A;  4FM0 A;  4JK8 A;  4IDK A;  1YJN N;  1NJY A;  3TSU A;  1ZBL A;  1VAZ A;  4JLH A;  3VA0 A;  3O9R A;  3C65 A;  4BRL A;  4WF9 L;  1QSL A;  4BQZ A;  3SUQ A;  5BRH A;  1QHT A;  5AQY A;  3S41 A;  4B9U A;  3J7A P;  1P8Z A;  5CZ2 A;  1UA1 A;  4WFB L;  3SJH A;  3KLE A;  1SQK A;  3V81 A;  4BVP A;  3Q7B A;  3SAH A;  4BE2 A;  4CI6 A;  4TSX A;  3CD6 N;  1OH6 A;  3OYN A;  3O3G A;  1B92 A;  2IIR A;  4B1V A;  1W0H A;  5AQO A;  3H3O B;  4CJ7 A;  3D45 A;  1VSH A;  1KSP A;  3RRH A;  5EXW A;  3BGR A;  4O5F A;  5FPN A;  4DTN A;  3CC2 N;  4BR2 A;  4FOI A;  3AVI A;  1HPZ A;  4CFC A;  3VQ9 A;  1TKD A;  4FW2 A;  2PZS A;  4MO4 A;  2O8F A;  3WXM B;  4PHT X;  4K8Z A;  4A59 A;  4LF7 K;  1HRH A;  3IRX A;  3A5O C;  4N76 A;  2F4V K;  3AGR A;  3O6W A;  4F3O A;  4DQ8 A;  3SMS A;  1RCH A;  2IAJ A;  2IGI A;  2XY7 A;  2D1K A;  4ILJ A;  2F7T A;  3P83 D;  4MFB A;  3AVL A;  3O9U A;  4GVE A;  3ZSO A;  3SI6 A;  3SQ4 A;  1N36 K;  1VSE A;  1S1X A;  1TK8 A;  3PY8 A;  2D5R A;  3IUC A;  3OYL A;  1U45 A;  1VK0 A;  4H0T B;  5JLF A;  3S3M A;  1WSI A;  2E20 A;  1QVF M;  4JK7 A;  1XMO K;  4DTP A;  4MLE A;  2P9N B;  3S3O A;  4M3U A;  4IDH A;  1NJX A;  2KLA A;  3SYZ A;  3WXJ A;  3VQE A;  1MWM A;  5EY4 A;  3BUZ B;  2DPN A;  1VQN N;  3O9T A;  1E4G T;  3KVG A;  1SL1 A;  1WSG A;  4B9N A;  4U7B A;  1R59 O;  4BC5 A;  4CZI A;  1OKJ A;  4W5N A;  3DXK A;  4FZX C;  3A8Y A;  5EVZ A;  1DT9 A;  3QLH A;  4FWM A;  5M1Q A;  4F4K A;  1X3M A;  3VEW A;  3TAQ A;  1LWE A;  3O08 A;  4DR6 K;  3HZ6 A;  4B3R K;  5ADX A;  4HCC A;  3ZSW A;  3E9O A;  1ZBF A;  1F21 A;  1NMN A;  3VQP A;  5GAE P;  3VF4 A;  4BVO A;  1HJO A;  1E3M A;  4M45 A;  4CHP A;  1J53 A;  1Q9X A;  4FOE A;  3ULE B;  3OYG A;  1K73 O;  3SNN A;  3MWP A;  3ZX2 A;  4PY5 A;  3HXM A;  4FPB A;  3MED A;  2E2P A;  3OTO K;  3LWL A;  3QIC A;  1RBT A;  4LFA K;  4DSI A;  4BWM A;  1WOQ A;  3A5N C;  3OYA A;  3PO5 A;  3O9Q A;  1KLN A;  3F2K A;  3AA2 A;  4A5A A;  1VQ4 N;  5BN9 A;  5BPM A;  4FJ9 A;  4CZL A;  1EWQ A;  5AQR A;  1BL3 A;  2J4R A;  1XI1 A;  4CVN E;  4M41 A;  1HNX K;  1QQN A;  3CJ1 A;  3TAP A;  5HRP A;  3C6H A;  3THV A;  2VCP A;  2KW4 A;  5IWA K;  3CCE N;  2OPR A;  1KVC A;  1MWK A;  4JYA K;  2FF3 B;  2ZJR L;  3SQ1 A;  5LL6 Z;  4B1X B;  4YOV A;  1QE1 A;  3QEP A;  3QES A;  3R1X A;  2D0B A;  3N4Q A;  1NWK A;  1W9H A;  2ZM6 K;  4BRE A;  5C10 A;  3AO3 A;  3BDP A;  4DS4 A;  5M1F A;  2WOM A;  4N5S A;  3SPY A;  4KH4 A;  2HB5 A;  2GWJ A;  3M8Q A;  1VQ5 N;  3GOI A;  1WAJ A;  3NF9 A;  2B5J A;  4M63 C;  2Z1J A;  3F73 A;  2QWM A;  1GLA G;  3MEG A;  4LF4 K;  3OHR A;  3VQ6 A;  2PBD A;  3NH2 A;  4KHP K;  4XH4 A;  2UYT A;  4ID5 A;  2EWS A;  2P9I B;  1K8K A;  3KD1 E;  1YVU A;  4KH6 A;  4O44 A;  1I39 A;  1ZBI A;  2A42 A;  3HPG A;  3SAG A;  4LF6 K;  3VGK A;  3QIP A;  1VQO N;  1TYQ B;  2UXD K;  2Q3S A;  3AO2 A;  4B9S A;  4BG8 A;  1CLQ A;  1IBM K;  4H5N A;  4DSK A;  3R9P A;  4O0J A;  4B9V A;  1CXU A;  5KGW A;  3HM9 A;  1NK9 A;  3MEE A;  3THW B;  4OVL A;  4DFK A;  3H46 O;  4X66 K;  3VA3 A;  4CJS A;  3H1Q A;  3H45 C;  4KV8 A;  1IV0 A;  1GLC G;  4FJ7 A;  4FWP A;  3MXM A;  4QS7 A;  5GIN A;  1WSF A;  2QKK A;  5AZJ B;  2A1R A;  4NXM K;  4CJU A;  4JKE A;  4DG1 A;  4K42 A;  3SK3 A;  3FE1 A;  4CZH A;  4CZJ A;  2BDP A;  3ZSQ A;  1VSK A;  2Q36 A;  3MDQ A;  5GAH P;  1YXQ A;  4DCH A;  2ATQ A;  1WLJ A;  2QWR A;  4JHD B;  4CES A;  1U04 A;  3ZSY A;  4PWD A;  5FRN A;  2VGM A;  5JVH L;  3SJJ A;  2NRZ A;  1NKE A;  3DAW A;  1OH7 A;  5EOY A;  5KRS A;  4FSV A;  3K5N A;  3GBT A;  1RTD A;  2YCH A;  4Y0W A;  4BGB A;  3BEX A;  1QHA A;  5TKW A;  3CIP A;  3SQ2 A;  3O5B A;  4HUE A;  1LAV A;  3TTD A;  3WQU A;  2X78 A;  4DR7 K;  2O8C B;  2WUS A;  4CEA A;  2DFE A;  3NMU A;  3PIO L;  3ITH A;  4BC3 A;  3OS2 A;  1D9D A;  4JKF A;  3I0S A;  3IFR A;  4LH5 A;  5DMR A;  1TUU A;  4B8A B;  3HM8 A;  1JLQ A;  1VSL A;  3EZW A;  3B6O A;  3ZCM A;  2PY5 A;  3TU5 A;  3OYC A;  2YI1 A;  3ATV A;  4M3R A;  1RDB A;  5AQV A;  4OKJ A;  4Z4G A;  2UXC K;  1K9M O;  2P9U A;  1RIL A;  2HMP A;  1HQE A;  1RTH A;  5JVG L;  3DLK A;  2O8D B;  2OPQ A;  3QFU A;  3O8M A;  3AVF A;  3QFP A;  1IKY A;  4I9Q A;  1BIS A;  4RWT A;  3RMD A;  1X3N A;  2NRV A;  4BDZ A;  2R7Y A;  4FJI A;  5AQN A;  2F8S A;  1HKG A;  3KLG A;  1JCG A;  2KKZ A;  1BI4 B;  1UWB A;  1S5J A;  5E84 A;  1S3X A;  2YX6 A;  4IG3 A;  3J7Z O;  5FRM A;  1A5V A;  1DGK N;  2D0O A;  2KZM A;  2QEX N;  1OH8 A;  3QIO A;  5DM7 L;  3CCR N;  3CCL N;  4BWJ A;  4KKO A;  4LH4 A;  2P9I A;  5CZ1 A;  3NFA A;  3CC7 N;  3TAR A;  4Z4H A;  2V7Z A;  3TAF A;  4JEP A;  1TYQ A;  1BA1 A;  5HOO A;  2P9K B;  4H5R A;  1TUY A;  1N6Q A;  1ATN A;  5AQT A;  4AHR A;  4BRK A;  2OZM A;  2D0A A;  4MQ3 A;  2Q2R A;  4DTO A;  2QW9 A;  3HTV A;  3CJ7 A;  1T03 A;  1BGX T;  3CJ9 A;  2VGN A;  1UA0 A;  2A6A A;  3I33 A;  3U9Z A;  3P5J A;  2PAV A;  4OGE A;  3CG7 A;  3U4L A;  2Q97 A;  3CMA N;  2ASO A;  4K25 A;  2AA4 A;  2B4J A;  2G8K A;  5K14 A;  1TAU A;  3DM2 A;  2XO7 A;  5FDL A;  4DV0 K;  1SUQ A;  3TSP A;  4MDB A;  3VQ8 A;  5MLC Q;  1RT4 A;  1RDU A;  3W3D A;  3KK3 A;  1L3S A;  4O55 A;  1BO5 O;  3BF3 A;  4NCB A;  4FYD A;  3PSF A;  4JHD A;  3NBP A;  5AQZ A;  3C7N B;  5IT9 O;  5JS1 A;  2YHA A;  3UKU B;  1JCE A;  2HHV A;  4BDP A;  1BHL A;  3H6E A;  3ZT3 A;  4CJV A;  4HCB A;  4FK0 A;  3WNF A;  1RT2 A;  4CGH A;  3G25 A;  4LY7 A;  3QML A;  1DTQ A;  2P5G A;  3HOS A;  2O8C A;  2JGU A;  1NNE A;  1JCF A;  4Y1D A;  4Q0B A;  2GV9 A;  2FXU A;  3A0I X;  2JWK A;  4B1W B;  1TKZ A;  4CFB A;  4NXN K;  3SUO A;  2QA4 N;  1C6V A;  4CGI A;  3BZK A;  1YIJ N;  3LDQ A;  2YHX A;  4DFJ A;  4ILG B;  3VEZ A;  4A61 A;  4OPJ A;  4DQS A;  3K57 A;  3HST B;  2BAN A;  4CE9 A;  2UUB K;  4CJT A;  4G9Z A;  2HF3 A;  5LMN K;  1EQY A;  1X1P A;  2I7N A;  4L8R B;  3VF6 A;  1HLU A;  3MXI A;  4KHW A;  4FW1 A;  5GAD P;  3AA4 A;  3WXL A;  4LFC K;  4WE1 A;  4CFD A;  2NUB A;  5EX5 A;  1NGB A;  2O8D A;  3U6F A;  5F0X A;  3B6P A;  3V4I A;  3W0L A;  3EE8 A;  3U9D A;  3C95 A;  4H8K A;  1N8R O;  1VSJ A;  3CC4 N;  3ZX3 A;  3ZSV A;  1HYS A;  3ZSR A;  3QET A;  4B1Z A;  2NRR A;  4CGD A;  5CE3 A;  4EZ9 A;  4CHO A;  4KFB A;  1BCM A;  2YJE A;  4DSJ A;  4FVU A;  4BQL A;  1K8A O;  1NK7 A;  5M1N A;  3KLI A;  3VQ7 A;  4FJK A;  4KTZ A;  3V6D A;  3ZT0 A;  4JI5 K;  3KK7 A;  3IG1 A;  2XY5 A;  5AQW A;  1QS4 A;  2E8A A;  4CJW A;  5KQ8 A;  4AH9 A;  2HVH A;  5AQH A;  3C94 A;  1NOZ A;  1KAZ A;  2P9K A;  2CGK A;  4M3Z A;  2Q31 A;  3IMX A;  3ZYY X;  5KQD A;  3J81 O;  1J54 A;  3O3F A;  5C24 A;  1R0A A;  3SUN A;  1Y97 A;  4CIE A;  5KRT A;  4OLA A;  1NJW A;  4A57 A;  2HBM A;  5HLF A;  1FKP A;  5GAG P;  1EO1 A;  4CEO A;  3QBW A;  5GIP A;  4N47 A;  3FLC O;  4JKH A;  5LJW A;  1SKS A;  1BDG A;  4CGF A;  3AVJ A;  4PQU A;  2FSJ A;  1NGJ A;  4F2R A;  2E1Y A;  4EIA A;  1QQC A;  4NLC A;  4K8X A;  4O0I A;  4V19 S;  4WYB A;  4JI4 K;  4FJG A;  4FK4 A;  4DTX A;  3TTF A;  4AHU A;  1L5U A;  3O80 A;  3F9M A;  4EAH D;  4JI1 K;  3L0Q A;  2E1Z A;  2QTD A;  4FJJ A;  4O5B A;  5CYM A;  3K58 A;  5KI6 A;  4CBX A;  3H3N O;  3HPO A;  1NKB A;  1JLC A;  3NGI A;  4CHQ A;  4CEF A;  2O8B B;  4H5V A;  3DRP A;  3UKU A;  3TAN A;  4JKB A;  2P1J A;  4WQ4 A;  3ID8 A;  4OKE A;  2QM1 A;  4B1U B;  3A2F A;  4E7H A;  1NK0 A;  1SL2 A;  3L2V A;  1Q81 O;  3KTQ A;  3S3N A;  5HL7 L;  3RR8 A;  3MK6 A;  4E7J A;  1IKV A;  5FPM A;  1J6Z A;  3KK1 A;  3DXM B;  4LFB K;  4J2B A;  3SAF A;  3J8A A;  1MU2 A;  1U2V B;  3P1G A;  1SV5 A;  5AQP A;  4BR9 A;  4JI7 K;  3UKR B;  4E89 A;  4IKF A;  4JRQ A;  4ISG A;  3AVC A;  3NF6 A;  4B3O A;  1ASU A;  1C0G A;  2HBL A;  3NDK A;  1HNI A;  2HBK A;  4WQ5 C;  1RT3 A;  4LC9 B;  3I56 N;  2ZJP L;  2A5X A;  5F1X A;  1ZBH A;  4IXC A;  3HO1 A;  1NOY A;  3PLA A;  3WNE A;  5C25 A;  3SLC A;  2W42 A;  5LJV A;  4DV5 K;  3OYM A;  3AVK A;  2HOE A;  1C0M A;  2HHS A;  2HVI A;  2IC3 A;  4LD0 A;  4BRN A;  3E66 A;  3DJC A;  2V51 B;  2FC0 A;  5KGX A;  4WFN L;  4BRD A;  5TKY A;  5CY4 A;  3NGY A;  3CPE A;  4Z0U A;  4A2A A;  4RCH A;  1XNR K;  3VEO A;  3NAE A;  4B3T K;  4W5R A;  5M1O A;  3E9L A;  3QNO A;  2VWJ A;  1BG3 A;  3V1O A;  1RT6 A;  4DU3 A;  2D0C A;  4PKG A;  3E9P A;  1WB9 A;  4RTF D;  3KD5 E;  4DV6 K;  2W6K A;  2W6L A;  3AVN A;  4M7Y A;  1NGH A;  1IBL K;  1TL1 A;  1T6D A;  1BU6 O;  5JMV A;  1HX1 A;  3KJV A;  1ZYQ A;  1Z26 A;  3PX0 A;  3MWT A;  2Y1J A;  3RTV A;  4CK3 A;  1BWF O;  4EP4 A;  4FM2 A;  1TKT A;  1BIU A;  5BRE A;  3UIQ A;  3MCA B;  3ZEU B;  3WEE B;  5C15 A;  1BOT O;  4H03 B;  4YOX A;  3QEI A;  4CFA A;  3A5L C;  2HNY A;  2XY6 A;  4Z4F A;  3CI5 A;  1S1T A;  4CHZ A;  1Q9Y A;  2FBX A;  2FSK A;  4DV3 K;  2E6M A;  4KI6 A;  2HND A;  1Z25 A;  4LF9 K;  3KKR A;  1YTU A;  1SZ2 A;  2E2O A;  5BRF A;  2YHW A;  4O8K A;  4YOR A;  3HRG A;  1JLF A;  4FWK A;  1DTT A;  1C1B A;  4OO1 J;  4CEC A;  1ITG A;  4J2E A;  1HYZ A;  1LW2 A;  3VN5 A;  4CD3 A;  3VGL A;  3EO3 A;  1B9F A;  3WQT A;  1T6C A;  2UUA K;  4FJ5 A;  4KHQ A;  2O8B A;  3KK2 A;  5KTQ A;  4JN4 A;  1NG9 A;  3THY B;  3HI0 A;  3OYI A;  4DR5 K;  4GY2 B;  2F9W A;  2X6S A;  2G8F A;  3AVA A;  3LDS A;  3EKU A;  4EZ6 A;  1CXQ A;  3THX B;  1D8Y A;  4KO0 A;  2KFN A;  5F2R A;  1BIZ A;  3EL2 A;  3SBT A;  4CJK A;  4CZF A;  1VQL N;  3JYT A;  3SQ0 A;  4KHY A;  3LDP A;  1KCF A;  3LPU A;  4ELT A;  3J7Y P;  3NE6 A;  4Y1C A;  2V7Y A;  1HMV A;  4KTW A;  1KFS A;  3KLF A;  1NU0 A;  3DXM A;  4XEI A;  4X64 K;  1YVN A;  2QWN A;  4E3S A;  2QK9 A;  4H0X B;  1XUP O;  2NRX A;  2NZT A;  1ILY A;  2QKB A;  4DMN A;  4R5P A;  1RDC A;  3UKR A;  1ASV A;  2G8W A;  4KB0 A;  1BUP A;  4E7K A;  4YY3 K;  3TPQ A;  4FLV A;  3P31 A;  2KTQ A;  1T8E A;  5AQJ A;  4K41 A;  4GV9 A;  1EET A;  3KZB A;  4AHV A;  1RFQ A;  4ID1 A;  3CHW A;  2WBN A;  1WSH A;  1LWC A;  3L3V A;  5C42 A;  3FGU A;  3QEV A;  2P9N A;  2CGJ A;  4KH5 A;  5H1S Q;  1RBU A;  1IKX A;  4KI4 A;  3CFR A;  1V4S A;  4ZTJ A;  4E1M A;  3SZ2 A;  3AGK A;  3NF7 A;  5A2Q O;  4C23 A;  4CIF A;  4FWS A;  1FXX A;  3LAN A;  1NM1 A;  2IVN A;  3VEX A;  3U3Y A;  4BRQ A;  1WAF A;  2ZJQ L;  3ULD A;  2P9P B;  4DV4 K;  2EHG A;  3G6E N;  4BRH A;  4LSL A;  3AAP A;  3TWH A;  2IS3 A;  4CF8 A;  2GUP A;  1KFD A;  2VG5 A;  3MEC A;  4H4O A;  4LF5 K;  1S6P A;  2V52 B;  2A41 A;  4BRA A;  5FPE A;  5FRO A;  2KFZ A;  4JI6 K;  3VQC A;  3HSC A;  3QER A;  3I8B A;  2ITG A;  3ZEU A;  2YKM A;  4HTU A;  4M42 A;  4C8O A;  3ATU A;  1BA0 A;  4AF1 A;  3VMF B;  3ULE A;  3L3U A;  1A5W A;  4ZTF A;  2Q1N A;  5CYQ A;  4NYN A;  1LOT B;  5GIO A;  1GLL O;  2D0P A;  4CGJ A;  1LW0 A;  2A3Z A;  3CCQ N;  1VQ6 N;  2KZZ A;  3KHY A;  1WUA A;  1WNS A;  2BE2 A;  2PFU A;  3EN9 A;  3TTC A;  1S9G A;  2IVP A;  2DFF A;  2UUC K;  3C6T A;  4IBN A;  3HVR A;  1IKW A;  3AO5 A;  4YDU A;  2OTJ N;  4CJ4 A;  3VER A;  3QBX A;  3K0S A;  1Z6R A;  4FL9 A;  1OVY A;  4A62 A;  2IVO A;  1QVG M;  2HNZ A;  4DR3 K;  4DV7 K;  5DK5 A;  3THY A;  4CZK A;  4KTQ A;  4WCE L;  2GUI A;  5AQG A;  2P9S B;  1QSY A;  4KHS A;  4KB1 A;  4DF4 A;  1C0F A;  2WFB A;  1YUW A;  3QIN A;  3THX A;  3RMC A;  1NK8 A;  3O4N A;  3QDK A;  3CCM N;  5JIC A;  3LZJ A;  1KAX A;  2HHW A;  4DB3 A;  4M3W A;  1QQO A;  4DSE A;  3OYK A;  4L3Q A;  1KD1 O;  4A2B A;  4BAC A;  4FVM A;  3MN5 A;  3TI0 A;  4DV1 K;  3OYF A;  1VSD A;  4DS5 A;  4OKK A;  5KPR A;  5D3G A;  4CJP A;  4W5T A;  1N34 K;  1NLV A;  1HUX A;  4DUY K;  3EY1 A;  3PX4 A;  3I0R A;  3GL1 A;  1QTM A;  4AHC A;  2QWO A;  4EFH A;  4N56 A;  4U67 L;  1SKW A;  3EE9 A;  3L2Q A;  1HNZ K;  5J2P A;  4RG8 A;  1XWL A;  1VSI A;  3CFP A;  3AVB A;  5AQX A;  2HW3 A;  5AQI A;  2O4I A;  4KHU A;  4XH1 A;  2YNG A;  2ZE2 A;  1Q18 A;  2OCE A;  4YFU A;  2KQ2 A;  3MXJ A;  4CF2 A;  3O9S A;  5EU7 A;  3L2U A;  5AQL A;  3KIO A;  4E7L A;  2DY4 A;  5JLH A;  4X62 K;  4AM7 A;  3CFO A;  4DKW A;  4DUZ K;  3NCI A;  3THW A;  3ZLJ A;  1HYV A;  4H5T A;  4UQG A;  4DTM A;  4M3Y A;  4IJA A;  4JI8 K;  2W40 A;  2P9P A;  3U3G A;  5KPT A;  3CYM A;  2O8E B;  5FLX O;  4JKA A;  3ZT2 A;  1FKO A;  2QWL A;  3SCX A;  4CEB A;  5AZJ A;  3J80 O;  3E01 A;  3T19 A;  4BRO A;  2X74 A;  1S1U A;  2OZS A;  4BE0 A;  3HPH A; 
#chains in the Genus database with same CATH homology
 4V19 S;  4JI4 K;  4DR3 K;  4DV7 K;  4YY3 K;  4NXN K;  4DR4 K;  4DV6 K;  1XMQ K;  4AQY K;  1I94 K;  4X66 K;  4JI1 K;  1IBL K;  3T1H K;  3OTO K;  2UUB K;  4LFA K;  4JI0 K;  2VQF K;  5LMN K;  3T1Y K;  4LF7 K;  4DR2 K;  4OX9 K;  4K0K K;  2F4V K;  4LFC K;  4DV1 K;  4NXM K;  5A2Q O;  1J5E K;  4CVN E;  1XNQ K;  1N34 K;  1HNX K;  4DUY K;  4DV3 K;  1N32 K;  1N36 K;  4LF9 K;  4DV4 K;  1IBK K;  4X65 K;  5IWA K;  1HNZ K;  4JYA K;  4GKK K;  2UXB K;  5LL6 Z;  4LFB K;  1XMO K;  4LF5 K;  4JI5 K;  4JI7 K;  4DR7 K;  4LF8 K;  2ZM6 K;  5LMU K;  4JI6 K;  4DV2 K;  2UUA K;  4DV0 K;  4X62 K;  4DR5 K;  5BR8 K;  4DUZ K;  3J81 O;  1HR0 K;  3J7A P;  2HHH K;  4LF4 K;  2VQE K;  1FJG K;  4JI8 K;  1N33 K;  4DR1 K;  4KHP K;  4CW7 B;  4JV5 K;  4B3S K;  4DV5 K;  5IT9 O;  3J7Y P;  5AJ3 K;  4B3M K;  4JI3 K;  5FLX O;  3JAM O;  2UXC K;  1HNW K;  4YHH K;  4LF6 K;  4GKJ K;  4X64 K;  3J80 O;  2UUC K;  2UXD K;  4DR6 K;  2E5L K;  4JI2 K;  1IBM K;  4B3R K;  1XNR K;  4B3T K;  2UU9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...