2UXBK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxbK00
4JI6K 2ZM6K 2UXBK 1FJGK 1N33K 2E5LK 4CVNE 5BR8K 5IT9O 1N32K 4JI7K 4DUZK 1HNZK 2UXCK 4LF8K 5A2QO 4DR7K 4DR4K 5FLXO 4DV6K 4B3SK 4LF7K 4JI4K 4LF4K 4DV5K 4DV0K 1HNXK 4DV1K 3OTOK 3J7YP 5LL6Z 4X62K 4DR6K 2F4VK 4V19S 2UU9K 3J81O 2UUCK 4GKKK 1N34K 4K0KK 4B3RK 1J5EK 1IBLK 1XMQK 3J80O 4AQYK 4DV4K 4GKJK 4DV2K 4NXNK 4X65K 2VQFK 4B3MK 4DR5K 1XMOK 1XNQK 4JV5K 4NXMK 4LF6K 4X66K 1I94K 4JYAK 4DV7K 4JI1K 1HR0K 4DUYK 4LFBK 4DR3K 4JI8K 3J7AP 4KHPK 5IWAK 1HNWK 5LMUK 4OX9K 4LFCK 3T1YK 4DV3K 4LFAK 4LF5K 2UUAK 4JI0K 4LF9K 4DR1K 3T1HK 4JI3K 4YY3K 2VQEK 2UUBK 2UXDK 1IBMK 4B3TK 4X64K 1XNRK 4JI2K 5AJ3K 1N36K 4DR2K 4JI5K 4YHHK 3JAMO 4CW7B 1IBKK 5LMNK 2HHHK
chains in the Genus database with same CATH superfamily
1WNSA 2HHUA 3ASMA 1X3NA 3G25A 4XH4A 3HPGA 5LJVA 1SL1A 1A5VA 3AAPA 2ZD1A 4LH5A 3VQ7A 2D0CA 1OVYA 3FFKB 5CZ2A 1C0MA 1VQNN 3DLLL 5GAGP 2P9UA 2EX3A 1RT5A 1YVUA 3P5JA 1RDWX 2FLOA 3CJ9A 2QWPA 3ZCMA 1E4GT 3OVNA 3MXMA 3CETA 1GLJO 1FXXA 3CMAN 5LL6Z 2HSTA 1HQEA 5AQFA 2HVIA 2UUCK 4B9MA 4DF8A 3OYCA 1NKBA 3EL2A 3QEWA 5J2QA 3C95A 2O8BB 3MEDA 3IRXA 2G8IA 1RT6A 4H5NA 1T7PA 3QO9A 4BC3A 1NKCA 3SV4A 3CHWA 3CJCA 3JSMA 2HNZA 5JS1A 2I7PA 3E66A 4OPHA 3ENHA 4YDUC 4CZMA 4FJLA 2FSKA 2X6SA 1I39A 3HVTA 3AGRA 4O0JA 1WLJA 1SKWA 1ATSA 1OH5A 5HROA 4IFYA 5J2MA 5FPMA 3TAGA 1RTIA 3EE9A 1NLVA 3DAWA 3SBTA 3KWIA 1QE1A 3LAMA 2NZTA 4H0XB 4JKHA 3OYLA 4U7BA 3ISNC 3DLKA 4O8UA 1VQ5N 3CJBA 3K57A 4A62A 4IOCL 1EO1A 4MO4A 5KRTA 1GLEG 3ULEB 3QBWA 1TUYA 4M7YA 3OS1A 2ZM6K 3CI5A 4K41A 3C94A 3AVIA 1HJOA 5AQXA 4Z94A 1VSKA 5BRHA 2E5LK 1G99A 1NMDA 3JYTA 4FJGA 2VGMA 3AA2A 2A41A 1VQ6N 1D8YA 2OTJN 2D0AA 1HLUA 2AP1A 3LDOA 3CPWM 4K42A 4M63C 3R8EA 4WF9L 1BUPA 4B3SK 5SWMA 5FDLA 3SCXA 5JICA 1RGIA 1YJWN 4WFBL 2ZGYA 3AV9A 3ZEUB 5HOOA 3LAKA 2GEMA 4C8KA 3HOTA 1J54A 4NCBA 3J7ZO 2YCHA 2IS3A 1QSLA 2E6LA 3S3MA 3U3YA 1REVA 2GUIA 3VQEA 1Q7YO 3VQ5A 5FROA 1RDBA 3DOKA 1BU6O 5E41A 2BDPA 4QS8A 3V9UA 1S9EA 4JV5K 4LY7A 1NOZA 3OJUA 2YV0X 4OGCA 1HQUA 3L6QA 4O5BA 2G8WA 3HP9A 4M45A 4EZ9A 1K73O 1L3VA 3LANA 4B8AB 3OYNA 1QVGM 3IS9A 4JRQA 1YUWA 4WQ5A 3NF6A 3RSEA 5KRSA 3BDPA 2HB5A 4JKDA 1LV5A 3LDNA 3UIQA 5C12A 3VF4A 1JKHA 3KD1E 4LFCK 3KTQA 1BWFO 3HZ6A 3WEEB 3THYA 1BDGA 1O1WA 3DRSA 4YY3K 1T8EA 3CXCM 4DB3A 1VQ7N 2UXDK 5LY3A 1WSFA 3QETA 1U2VA 3QNNA 4QS9A 4B3TK 3K59A 1Q9XA 4NLBA 2ASMA 2ZE2A 3WXJA 5BREA 3A8YA 3WT0A 1ESVA 5KQDA 1IBKK 4F3TA 1OVQA 2HHHK 3TU5A 2HBLA 4YOTA 3HRGA 4BRIA 1NK0A 3SPYA 3VOVA 4BGBA 3TTDA 2D4WA 3ULDA 1NJZA 2VWBA 3M5RA 4FLUA 2I7NA 3S41A 3LDPA 1T3VA 4KH4A 3U9ZA 3SMSA 2HHVA 5CYQA 1KQSM 5A2QO 2YX6A 4JNEA 1WSEA 2G8FA 5KPRA 3KHYA 4GVMA 3SI6A 1BO5O 3NGZA 4DV5K 1TV6A 3KLGA 2BTFA 1NG9A 4C23A 3C65A 2ZQBA 3WXIA 3LM9A 4EZ6A 1GLAG 3VTHA 1MA9B 5K14A 4WFAL 1ZBIA 4HHTA 1OH8A 4KB0A 2Q1NA 4CJPA 5DM6L 1QQOA 4FWQA 1J53A 3MN9A 3TR8A 3OBWA 3ZT1A 4MLHA 3H45C 1TKXA 3VEVA 3QESA 3MWTA 4B9NA 1RILA 3GOIA 3OS0A 1YJ9N 4X66K 4ID1A 2FBTA 5DM7L 1NGJA 1NU0A 1IH7A 4JI1K 3M8PA 4B9TA 2VCPA 1VAZA 2WOMA 4B8CA 3ID8A 4FJ9A 3BP8A 3OYEA 3G0ZA 4A2BA 4DTJA 3CMEN 3I55N 3IG1A 4GNIA 5D3GA 4DS4A 1LW2A 5F0XA 3UB5A 5LJWA 4M3ZA 4CK1A 1MWMA 2ATQA 4IO8A 2YHYA 2LSNA 2HHTA 4FVUA 4E89A 1HMVA 4RW7A 4FK0A 3PV8A 3ENBA 1S1UA 3D45A 1V4SA 3WQUA 1NMNA 4BVOA 4ELTA 1W9HA 3S3NA 3NMUA 3LL3A 1WB9A 1YVNA 4KHUA 1TK5A 3BGRA 3NFAA 1UA1A 4EAHD 1FJGK 3A5LC 2D0OA 4C1NI 1S22A 3QLHA 3CCJN 1NGBA 3WXLA 2XY8A 1ILYA 3M8QA 5TKYA 3EEQA 3MEEA 3LDSA 1YITN 1YTUA 2KHOA 4AILC 3OYJA 3CQYA 2NRXA 4I9LA 1NM1A 2UXCK 4DR4K 2PZSA 2Q97A 2Y1JA 5FPNA 4DFKA 3I8BA 1UWBA 2P51A 4YDUA 4DLGA 3LDLA 4EFHA 4W5RA 3M8SA 5F1XA 4ZHRA 2HMIA 3UKUB 4BDPA 1S9GA 4CJ5A 4JKCA 1DEJA 4CHZA 2VYPA 4CEZA 2KZMA 4O4GA 4YNQA 1Z05A 1VRUA 3PUFA 5FRMA 3KLIA 1XUPO 3G71N 3PO4A 5ELZA 4O8KA 3CF5L 4GKJK 1CZBA 1SV5A 4GW6A 5AQUA 3Q7CA 2FSNA 3U3GA 1NNEA 3FZHA 1T44A 2QM1A 3WXKA 4FXDA 2F9TA 5ADXH 4FPAA 4I9QA 3DLHA 4CD1A 3CFRA 4GV6A 2O4IA 1ZBUA 2A5XA 3ULEA 3ZT4A 4CGFA 1S1XA 5IWAK 3VGKA 1HNWK 4FWLA 3I8DA 4GVEA 4Z4CA 4O44A 4FSVA 4B1ZA 4KHQA 5TKWA 3QEPA 4GV3A 4W5NA 3MXJA 2UUAK 1VHXA 4NO7A 3PO5A 3QIPA 4CJQA 2VQEK 2QWOA 3QBXA 1KVCA 4KRFA 1WOQA 5C2DA 3ZEUA 3OYBA 4DR2K 3WNGA 1LCUA 4CW7B 4C8MA 1QQNA 2X74A 1KCFA 4OVLA 2YJFA 3P38A 3AVLA 3KLFA 3HK2A 2GX9A 2XY5A 4FWPA 5HRNA 2V7ZA 2Z1GA 5JLFA 1HYSA 4C1NK 1N32K 2HF3A 1IO2A 2HHQA 4JKBA 4BRCA 4IBNA 5AQGA 3T69A 4BACA 5H1SQ 1SKSA 1L3SA 1SUQA 1LW0A 4DV1K 3PLAA 3SLCA 3CCSN 3TAPA 5EY4A 4BR9A 1SQKA 4DTOA 4CJKA 3LWMA 1UA0A 3L3VA 1S1VA 2ITMA 3RMBA 4EIAA 5EU7A 1VRTA 4CHPA 1KD1O 3ZX0A 3THYB 3WEEA 3K5LA 5AQRA 4AM6A 1BQNA 1Q18A 4KHYA 4E7HA 1XNQK 1JCFA 1U2VB 2W6KA 3ZX3A 5B8HA 2Q0RA 1DGKN 4I2PA 1DTQA 2IVPA 3A5OC 2WONA 4KO0A 1TL3A 4FM1A 2HHWA 4DS5A 4DTPA 4WCEL 4IEEA 1VQPN 2E20A 4DUYK 1KAXA 5AQZA 3AO4A 4DR3K 3F2KA 2QKKA 3KD5E 3J8AA 5C2FA 1U45A 2HNYA 4ZTJA 3QICA 1MDUB 4W5TA 4CF2A 2OPPA 1JLEA 1M90O 2YHBA 4CK2A 2FXUA 1IKXA 2KQ2A 1KRPA 1NGAA 3OYIA 1NGHA 1HKCA 3BUZB 2QTDA 1RBTA 3QIOA 4CEDA 4OLBA 3SQ0A 1XC3A 4M3RA 4FOIA 3CJ1A 4PY5A 5AR0A 5BPNA 4LC9B 3ZT3A 4RWTA 4CFDA 1VQ8N 4K8ZA 1MU2A 4WFNL 3VA3A 4JKAA 3C0BA 2YNHA 2OPQA 2RHKA 5JLHA 1B92A 5DK5A 3HL8A 3JXUA 3AY9A 4CGIA 1SL0A 1S5JA 4H5VA 4OLAA 3L3UA 1VSDA 3NH0A 3DM2A 2OZSA 3NVKA 3OYKA 1J9AA 3BY5A 1NGFA 5AFUH 3ZETB 5AQIA 1RBUA 4IWVA 3A5NC 3N4PA 3CCLN 1BQMA 4DV0K 1C6VA 2O8DA 1D9FA 5AZJA 3J7YP 3HT3A 1N6QA 4E1MA 4X62K 2W42A 3WNFA 3VEZA 3K5NA 3AVHA 4ZTFA 4MDAA 1VQ4N 1CLQA 4H4MA 4H03B 4YFUA 3AVNA 3DLGA 2P9NA 1IBLK 5BPLA 1NK4A 1KTQA 2JWLA 4DV4K 4NXNK 4DQIA 4ILGB 3NF9A 3HM8A 4QAGA 4ICLA 2XHBA 2E2QA 4BC2A 3TABA 3AO5A 4NXMK 3TANA 1I94K 2A1SA 4H5WA 1NOYA 4CBUA 1VSFA 1VQON 4HWIA 4F3OA 3SAGA 3O3FA 1O13A 5C42A 2CH5A 4I6MB 3DXMB 4BRFA 3MN6A 1BCMA 5FPDA 1RNHA 4CGHA 1BIZA 3H3OB 4J2EA 1EP4A 3DI6A 3H08A 4QOZB 1GOBA 3CCMN 1X9MA 4B3OA 4KHWA 4LF9K 3PSIA 2Z1HA 2GBZA 1S1TA 4BRLA 3OYGA 5AQOA 1ZBLA 4RTFD 4Z4EA 2CGLA 4K25A 3UKUA 3S3OA 1N36K 4JLHA 3MMVA 4FPBA 3TWHA 4JN4A 2P5OA 4CJVA 2OCEA 1M1KO 1GOCA 3AAQA 4CEFA 4PQUA 1VK0A 2OYQA 3VQ8A 2HBKA 4XIUA 4QCLA 1ASUA 1U6ZA 5DMRA 2NRRA 4B9SA 4NCAA 3EE8A 1TK8A 3O4QA 4JRPA 1UOCA 1U4BA 1KAZA 3U6FA 4AHVA 4J2AA 4AHSA 5AQMA 4FJKA 3T7ZA 4B9LA 2OPRA 2KZZA 4DSIA 1LOTB 4XEIA 3CC4N 4TSXA 4H0VB 3ZX2A 1KVBA 4CI6A 2YNIA 4HUGA 4GKKK 4K0KK 1CXUA 4IKFA 3TTFA 2WFBA 2VWJA 4CJ3A 3HBTA 4BR5A 2HF4A 1U47A 3AO2A 5HL7L 1QZ6A 2WUSA 3NBPA 2KLAA 1LWFA 2RF2A 2VQFK 4N5SA 1KVAA 4UQGA 3K5MA 1JJ2M 1EQYA 3B8AX 4DQPA 4LF6K 4IJAA 3QEIA 3R3LA 3OYMA 1BA0A 2O8CA 4DV7K 3E01A 5AQPA 2NRHA 4Q0BA 4JK9A 2IOCA 3KK1A 4KTQA 3AVMA 4CECA 4IFEA 4YOVA 4FO0A 3NGIA 3J7AP 4KAZA 1KLMA 3HSTB 2Z1JA 5LMUK 2ZGZA 4IEIA 4KTZA 4WE1A 1N5YA 3HVRA 1EKEA 2VG6A 4Y1DA 3LDQA 4CEAA 1KXPA 4FLXA 3OYHA 1HNIA 5J2PA 1JL1A 3PX4A 4CEBA 3U8XA 1D4XA 2B6AA 4NCGA 4ISEA 4M3UA 3C6TA 3HYFA 1IV0A 1QTMA 3OYDA 3ZSWA 1F21A 3CCUN 1T03A 1VSLA 5HRRA 5BN8A 3H6EA 2YHWA 1KFSA 1VSHA 1HYVA 1DLOA 3EN9A 3AA3A 4RCHA 3CERA 1RT4A 1DKGD 4JS5A 4DFMA 1VQ9N 2GWJA 1ZBHA 5F2RA 2NNWA 4EHUA 1Q82O 3OJSA 4GMJB 3RWUA 1D5AA 5C15A 4JI7K 3L2UA 1L5UA 1X3MA 4JD2A 3H1QA 3WQTA 5C25A 4DU1A 4WQ4C 4DR7K 1HPZA 2YJEA 4E1NA 3HXMA 4OPJA 4JS4A 1X9SA 4Z4GA 3O9QA 4A2AA 3O4WA 4KHNA 3K5OA 3MEGA 4CGDA 4CZJA 1TVRA 4BG8A 2QI2A 4HUFA 3SNNA 2AA4A 4F8RA 2FBXA 2YHAA 2W6LA 2QK9A 4W5OA 1RDAA 4HCCA 4RW4A 1BA1A 2X6NA 3E9PA 3RVCA 2VGNA 4AF1A 4EHTA 5JVHL 3TARA 1YF5L 2E8AA 2DFHA 2YKNA 5AQTA 2FF6A 3W3DA 2WTUA 4KHSA 3UKRA 3ZT0A 5HLFA 3CC2N 1C1CA 3I0RA 3AA5X 4B1XB 2GELA 4OPAA 1NJXA 1Q86O 2P9KA 3FFIA 4KTWA 4B1VA 1NWKA 3BF1A 1RCHA 3T1AA 2QWRA 3QEVA 3C7NB 3GL1A 1EWQA 3TTCA 4FK2A 3VGLA 1XHXA 2W41A 2E4LA 3CFOA 2ZJQL 3C6HA 1W7AA 1WSIA 2HMPA 3ZETA 3P31A 1NGCA 1RBVA 3IMXA 5FRNA 2YNFA 2O8DB 5AZJB 1QHAA 5JVGL 1S1WA 2P9PB 2A1RA 3K9KA 4BDYA 4J8FA 1K8KA 3FE1A 3CCQN 4FWOA 3LZJA 3SBGA 3DJCA 2P9NB 3AVJA 3LP0A 3WNEA 3ID6A 4E3SA 1QHTA 3QERA 2P9LA 3OYFA 3ATVA 3H3NO 4DQRA 5IT9O 1TL1A 4HTLA 1ZBFA 4DHYA 2WC9A 3CD6N 3VF6A 1I3AA 3NDKA 2QA4N 5M1QA 4BRNA 3RTVA 3O9SA 4OO1J 2J4RA 4BRDA 2B5JA 4FM2A 4DFJA 1MWKA 4M7XA 4LF4K 2YHXA 4N47A 4FWKA 3H46O 1HNXK 4I6MA 3Q7BA 3CPEA 3DXMA 4H5RA 5E84A 2QXLA 3NH2A 3VMFB 4CF0A 4DR6K 2BUPA 2O8FB 5KPZA 1TKZA 4KI4A 2DTUA 5M1PA 4OKEA 1KAYA 3CJAA 2ASOA 5EXWA 4FZYA 2QXFA 2B4JA 4DTUA 3ZSOA 4M3YA 2JGUA 3OYAA 1YAGA 1YXQA 2Q36A 3NAEA 3K0SA 1JLCA 3TI0A 2FBYA 1VQMN 3CCEN 3NF8A 4DCHA 1C0TA 5GINA 3O1BA 2XO7A 3O8MA 1TKTA 4JKGB 3VQDA 3DWLA 3D2EB 3VTIA 3EY1A 4I2QA 3SPZA 1IG8A 2QWLA 3P1GA 4C8OA 4EP4A 4FLWA 5JMVA 3D0PA 1NKEA 2G8KA 1W0HA 4CF9A 3FZFA 4FJJA 3L2VA 4DSJA 1C0GA 1Z6RA 3F9KA 5AQKA 4IXCA 4FCYA 1EX4A 2OPSA 2G8VA 1OKJA 4Y1CA 4FLVA 1KSPA 2GUPA 1NK7A 4IDKA 1XNRK 2EHGA 2FC0A 5HRSA 1IJJA 2KTQA 2DFFA 3JAMO 3PX6A 2ASPA 3VESA 2A40A 4FW2A 3QNOA 4H8KA 4G9ZA 4K43A 3DYAA 3CM6A 1CZAN 4JI6K 1EWRA 5C24A 3B6OA 2UXBK 4MDBA 3G10A 4U67L 3MECA 1QS4A 3RR7A 2Q3SA 1ITGA 4BWJA 3ZSYA 4BROA 4IG3A 4Z0UA 3NF7A 3THWA 1BI4A 2IVOA 1HUXA 3EKUA 4CZKA 2O8CB 4CBXA 1BIUA 5BPMA 2FSJA 5AFUA 4BGAA 2NUBA 4RG8A 3AA4A 1JCGA 4H0PA 2NRTA 2E1YA 4CJUA 3HPHA 1RDUA 3BZCA 1HRHA 2FF3B 3AO1A 4CIFA 4ELVA 4DFPA 4FL9A 3HTVA 3J80O 2GTDA 3LM2A 3C6AA 3G6EN 3RRGA 4ID5A 2VWKA 1RFQA 5C0YA 3VQAA 1IKVA 4BR0A 3KKSA 5EOYA 1RT3A 3CQ8A 3D2FA 4JYAK 2O4GA 1G15A 3SQ1A 1RT1A 3PIOL 1NJYA 1Y64A 3PX0A 4A5BA 4BQLA 1CZ9A 4JI8K 4OKJA 1JL2A 2ZF5O 3G4SN 2F8TA 2ZJPL 1DT9A 4DV3K 1FKOA 1ASWA 3AO3A 4DR1K 4JD2B 3DRRA 4IOXA 4PA1A 2OZMA 4WQ4A 4BG9A 1Q81O 4CBWA 5M1OA 4YOXA 1GLBG 1OH7A 1IBMK 4CJWA 3DRPA 4Q5VA 3MK6A 4X64K 2GWKA 4JI2K 5AQQA 4PL8A 3LALA 3TAEA 2E6MA 3LZIA 5EVZA 4FWRA 2A3ZA 2HW3A 3EKSA 1U04A 4BRAA 5GIOA 4YOYA 3MX5A 1ZC6A 4DSFA 1YT3A 3MWPA 3V9WA 3KIOA 3V1OA 3QDKA 2D1KA 1L3UA 1VSEA 3MCAB 1N33K 2HHXA 4N56A 5BR8K 2NRVA 3DMJA 3QFUA 1LAVA 1P8ZA 3NVMA 3ZSXA 1C1BA 4M42A 2RE2A 2YI1A 4DUZK 3UKRB 3B6PA 4E7JA 1D9DA 4C8NA 2D5RA 3WNHA 3F9MA 3MN5A 3SJJA 2P9KB 4KPYA 3MAQA 2P1JA 4PKIA 4RW8A 4HVJA 3C7NA 3JS6A 2PYJA 3L4QA 4KH6A 1Q9YA 4DTSA 3V9SA 1HYZA 3O80A 4B9VA 4KI6A 4AQYK 4CJFA 2V7YA 1QVFM 2VG5A 4NYNA 4LH4A 4DR5K 2P9IB 4DSLA 5JS2A 1SZ2A 2CGJA 4BE0A 4N76A 3QB0A 4A57A 4DSKA 4FJXA 4JHDB 5AQNA 1XI1A 4K8XA 4JK8A 2P9PA 1W2BM 4O5FA 5AQHA 1K8KB 4JKEA 4DTRA 1RT2A 4ILJA 1ZYQA 1TYQB 4Z4FA 2HBJA 3EZ5A 3BF3A 4XH1A 3OA9A 3FZMA 4B08A 5CYMA 1SL2A 4E7IA 2P9LB 4MFBA 4CEOA 4OX9K 4BRKA 3VA0A 1NGIA 1X1PA 1LWCA 4AHCA 3TSQA 4JI0K 3K2PA 4M3WA 3MX2A 2UYTA 5I42A 4IZ9A 4CJLA 4L8RB 2F8SA 1HKGA 3O4NA 4N41A 4CZIA 1IKYA 4LD0A 4DQSA 1JLAA 3P39A 2O8FA 2DY4A 1Q8IA 4MLEA 4PWDA 3IKMA 5FPEA 3PIPL 5SZTA 3SAFA 5CHIA 4F2SA 5HRPA 1X9WA 3FZLA 1BISA 3K9JA 3L2QA 1TGOA 4CIEA 4OGEA 5BRDA 5I3UA 2PBDA 3LP2A 3DXKA 3VQPA 1ASVA 5GAEP 4DV6K 4DTXA 3OHRA 1HNVA 4JI4K 1TKDA 2V52B 4JKGA 2YNGA 3QEXA 1NBWA 2XY7A 3D2EA 4GY2B 5C10A 4DMNA 1SS6A 2W40A 4XH5A 1HX1A 4FYDA 1S6QA 4JAXA 1YIJN 1JXBA 3GBTA 2RKIA 4CFCA 3AGKA 2E2OA 2KFNA 4H5TA 3WUHA 3ZSZA 1ATRA 4FW1A 1XQSC 1NJWA 2R7YA 3IFRA 4DG1A 1NGGA 4E19A 4OPKA 3VEYA 4IOAL 1KLNA 1C0FA 1NGDA 3ZT2A 3PSFA 3R9PA 3TAFA 3VN5A 1RDCA 4CZHA 1HR0K 1RT7A 1BG3A 3O5BA 5MLCQ 4CZLA 1ZBSA 1YHQN 1A5XA 2ITGA 1GOAA 2E88A 3KZBA 3A2FA 4CHQA 4RW9A 2PYLA 3O9RA 3R6MA 4BVPA 3TSPA 5HP1A 4KKOA 3OS2A 1K6YA 2P9SA 3THWB 1BI4B 2ZJRL 4LFAK 1JLGA 2IIRA 1ATNA 1FW6A 1EXQA 4BE2A 3FLCO 1C1AA 3L2WA 4A59A 3A0IX 3SUPA 5AZIB 3HO1A 1SAZA 3ALYA 4I7FA 1RBSA 4CFBA 3V81A 4RW6A 4O55A 3L4IA 2Z1IA 2Y1IA 5KPTA 2QWMA 2RN2A 4ILHA 3SAHA 3HP6A 3FGUA 4HCBA 3CJ7A 4FWSA 1IKWA 3VERA 4LSLA 1T05A 3O9UA 4IDHA 5CZ1A 3SK3A 3O6WA 1NK8A 1TK0A 2I5JA 2KKZA 3F73A 3KK7A 4H0OA 2KFZA 1HNZK 1WN7A 1YTAA 3D2FB 3OBYA 3THXA 2PY5A 2FBVA 4LSNA 3I0SA 4AH9A 3VPZA 3VQBA 2QW9A 4KBOA 3DLBA 4BY9C 3D6RA 2F96A 1WSGA 5AQYA 1JLQA 1BOTO 3NCIA 1N34K 1J5EK 3QMLA 4FWMA 3I56N 1P90A 2E1ZA 4H0YB 3CQXA 4X65K 3VQ9A 1XMOK 1GLDG 1YI2N 1L3TA 4GV9A 3DLRA 3KWGA 1X9JA 5KI6A 3F5TA 3P4IA 2EWSA 1ZXOA 4CERA 4BRHA 4CZEA 4BWMA 1RTHA 3SQ4A 4NYFA 3SUOA 4DU4A 2IGIA 3KLHA 3TAQA 3AARA 2F7TA 4HTUA 4JEPA 3CYMA 4CFAA 3TPQA 3VEXA 4OJRA 4JI3K 2UUBK 2H3GX 2D0BA 3MDQA 4ISGA 4CJRA 4FM0A 5ADXA 2PFUA 4KH5A 4CHNA 3V1QA 4CEEA 4FK4A 4AHTA 2NRZA 4B1UB 4JI5K 4YHHK 3NH1A 3O3HA 3MN7A 1U48A 2HHSA 4PKGA 4KV8A 4CE9A 4CJ7A 2OANA 5I9EB 1NK6A 3VETA 3KLEA 1XHZA 5AQSA 3M3ZA 3V6DA 1A5WA 1WSHA 1QSSA 3M6GA 5AQLA 1LAWA 2HOEA 2P5GA 3QFPA 3HOSA 2P9IA 5E26A 4BC4A 1UAXA 3E9OA 3U4LA 2XRIA 3NE6A 4JHDA 3HJFA 3VF2A 3KKRA 4FJMA 2O8EB 5FLXO 3M8RA 4LF7K 3T19A 2KW4A 3RRHA 3RMDA 4WYBA 1S3XA 1TYQA 2NRWA 4YOWA 3ZSRA 3OTOK 3D7EO 3SQ2A 1H1VA 1NK5A 3SMPA 3C6UA 2UU9K 1K9MO 2A42A 4J2BA 1Z26A 4IFVA 1R59O 2Q31A 4FOEA 4AM7A 3ATUA 1U49A 4PUOA 2DFEA 1QQMA 3HPOA 4FJ8A 3ZSQA 4FLYA 3HI0A 4DV2K 1WAFA 3SZ2A 4BR2A 4B3MK 1NGEA 2G8HA 4DKWA 2CGKA 4FVMA 3CFPA 4FJ5A 3RMCA 2P9UB 3LWLA 1DTTA 4M3XA 2IDOA 4F4KA 3GDQA 4DQ8A 4FZZA 1T6DA 3LPTA 3L2RA 4CJSA 2JLEA 4E1JA 1JCEA 1Y97A 3W0LA 1TAUA 3EO3A 1VSJA 4ELUA 2E2PA 3CM5A 3BZKA 3ZLJA 3DLEA 2GV9A 3R1XA 3T1YK 2OA8A 3L0QA 4BDZA 3E1YA 3K58A 1QSYA 3DXKB 5M1NA 2O8BA 3O9TA 2JWKA 4CCHA 1HKBA 1WSJA 2DPNA 5M1FA 3IAYA 3M1FA 2NLXA 1WBDA 1QQCA 4BQZA 5AJ3K 4M41A 5GADP 3AVCA 3SUQA 2BE2A 1VQKN 3AVGA 3RMAA 1FK9A 2RPIA 3HSCA 2IC3A 3SUNA 1XMQK 4CJ4A 4MO5A 1R0AA 4IO9L 4PL7A 4FZXC 1SKRA 4FJHA 2BANA 3LP1A 4F9OA 4CVNE 4O0IA 3LP3A 3N4QA 2QEXN 3AVBA 5CY4A 4BE1A 3GE1A 3SV3A 4QS7A 4DTMA 5BR9A 4LF8K 4CIGA 4FJNA 3VQQA 1FKPA 1IG9A 2QWNA 4BRMA 4BREA 4IG0A 4B9QA 1JLFA 2ETJA 4FJ7A 3VQ4A 2F4VK 5AQWA 4B1YB 4BRQA 4V19S 3J81O 2HNDA 2AJQA 3NGYA 4B3RK 4CGJA 4B9UA 1KC8O 4DF4A 4FWNA 2P9SB 1E3MA 4R79A 2IVNA 2ZWHA 5CE3A 1S72N 3IUCA 3ENOA 4BC5A 1K8AO 3EYZA 4JK7A 1J5OA 4M3TA 3A5MC 4CGGA 1J6ZA 4PKHA 5KQ8A 3VQCA 5AZIA 1V4TA 4CHOA 3KK2A 5BN9A 4KREA 4AHUA 3T3FA 4L3QA 4IJNA 4LFBK 3FR0A 4FLTA 2WBNA 1JXEA 4DLEA 4MQ3A 4KHPK 1RBRA 1WAJA 1EETA 2IAJA 4EP5A 3AVFA 3QINA 2CH6A 4E7KA 4LF5K 4Y0WA 2D0PA 4DSEA 4A61A 4A5AA 4H4OA 3V4IA 1S6PA 2VG7A 3THXB 3KJVA 2G8UA 4CZFA 3GG4A 5J1EA 1VQLN 1KFDA 4CK3A 1BHLA 3UE5A 1WBBA 3P83D 1LWEA 2E2NA 1N8RO 4E7LA 3S9HA 5AQVA 3VEWA 3RR8A 1C0UA 1CXQA 3VEOA 1BL3A 1RTJA 3U9DA 3RSEB 4WQ5C 4NLCA 4CESA 4BR7A 3WXMB 1BCOA 3O08A 4CHYA 1XC9A 1GLFO 1B9DA 4B1WB 2BGGA 3CCRN 4E0DA 5GIPA 4BRGA 4JKFA 2A6AA 2XY6A 4G1QA 4UY8O 4FLZA 3H1VX 4DWIA 3HM9A 4YOUA 4PHTX 4HUEA 4J2DA 1QZ5A 3CIPA 1TUUA 1XWLA 4BRPA 1OH6A 3TSUA 5BRFA 4W5QA 1TAQA 3VQ6A 3ITHA 4CJTA 3NHGA 5J2NA 2HVHA 3V9ZA 1GLLO 3AVKA 3CCVN 3VENA 4CZGA 3CG7A 1HJRA 2YKMA 3ZSVA 4CEQA 4BR4A 2QWQA 2Q0UA 1HPMA 3VGMA 1VSIA 1WUAA 4Z4IA 3CC7N 1T6CA 3SYZA 3PY8A 3AVAA 4CJEA 2F9WA 3ZYYX 3L8BA 3THVA 3TAMA 2Q2RA 5M1KA 5KTQA 3SJHA 1BGXT 5T7BA 5HBMA 3KVGA 4CF1A 3MCPA 3O3GA 1YJNN 1E4FT 3OW2M 3O1WA 3OY9A 3E9LA 4YORA 4NB4A 4DTNA 3DOLA 3BEXA 4DU3A 1GLCG 5KGWA 2HBMA 2PAVA 4CF8A 3LPUA 3MXIA 2QKBA 5GAHP 4DQQA 3V9XA 3T1HK 1B9FA 5KGXA 4KB1A 4AHRA 1Z25A 4C8LA 1NJIO 2O8EA 3EZWA 2OTLN 3KK3A 1VSMA 2V51B 3I33A 4R5PA 1W97L 1NK9A 4KFBA 3IDHA 4OKKA 4FJIA 2BH1A 5AQJA 1JLBA 4CD3A 4F2RA 4Z4HA 5CR4A 2X78A 3V1RA 3FZKA 1RDDA 5EX5A 1RTDA 4ISFA 5LMNK 4H0TB
chains in the Genus database with same CATH topology
4JI6K 2ZM6K 2UXBK 1FJGK 1N33K 2E5LK 4CVNE 5BR8K 5IT9O 1N32K 4JI7K 4DUZK 1HNZK 2UXCK 4LF8K 5A2QO 4DR7K 4DR4K 5FLXO 4DV6K 4B3SK 4LF7K 4JI4K 4LF4K 4DV5K 4DV0K 1HNXK 4DV1K 3OTOK 3J7YP 5LL6Z 4X62K 4DR6K 2F4VK 4V19S 2UU9K 3J81O 2UUCK 4GKKK 1N34K 4K0KK 4B3RK 1J5EK 1IBLK 1XMQK 3J80O 4AQYK 4DV4K 4GKJK 4DV2K 4NXNK 4X65K 2VQFK 4B3MK 4DR5K 1XMOK 1XNQK 4JV5K 4NXMK 4LF6K 4X66K 1I94K 4JYAK 4DV7K 4JI1K 1HR0K 4DUYK 4LFBK 4DR3K 4JI8K 3J7AP 4KHPK 5IWAK 1HNWK 5LMUK 4OX9K 4LFCK 3T1YK 4DV3K 4LFAK 4LF5K 2UUAK 4JI0K 4LF9K 4DR1K 3T1HK 4JI3K 4YY3K 2VQEK 2UUBK 2UXDK 1IBMK 4B3TK 4X64K 1XNRK 4JI2K 5AJ3K 1N36K 4DR2K 4JI5K 4YHHK 3JAMO 4CW7B 1IBKK 5LMNK 2HHHK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 K;  2ZM6 K;  2UXB K;  1FJG K;  1N33 K;  2E5L K;  4CVN E;  5BR8 K;  5IT9 O;  1N32 K;  4JI7 K;  4DUZ K;  1HNZ K;  2UXC K;  4LF8 K;  5A2Q O;  4DR7 K;  4DR4 K;  5FLX O;  4DV6 K;  4B3S K;  4LF7 K;  4JI4 K;  4LF4 K;  4DV5 K;  4DV0 K;  1HNX K;  4DV1 K;  3OTO K;  3J7Y P;  5LL6 Z;  4X62 K;  4DR6 K;  2F4V K;  4V19 S;  2UU9 K;  3J81 O;  2UUC K;  4GKK K;  1N34 K;  4K0K K;  4B3R K;  1J5E K;  1IBL K;  1XMQ K;  3J80 O;  4AQY K;  4DV4 K;  4GKJ K;  4DV2 K;  4NXN K;  4X65 K;  2VQF K;  4B3M K;  4DR5 K;  1XMO K;  1XNQ K;  4JV5 K;  4NXM K;  4LF6 K;  4X66 K;  1I94 K;  4JYA K;  4DV7 K;  4JI1 K;  1HR0 K;  4DUY K;  4LFB K;  4DR3 K;  4JI8 K;  3J7A P;  4KHP K;  5IWA K;  1HNW K;  5LMU K;  4OX9 K;  4LFC K;  3T1Y K;  4DV3 K;  4LFA K;  4LF5 K;  2UUA K;  4JI0 K;  4LF9 K;  4DR1 K;  3T1H K;  4JI3 K;  4YY3 K;  2VQE K;  2UUB K;  2UXD K;  1IBM K;  4B3T K;  4X64 K;  1XNR K;  4JI2 K;  5AJ3 K;  1N36 K;  4DR2 K;  4JI5 K;  4YHH K;  3JAM O;  4CW7 B;  1IBK K;  5LMN K;  2HHH K; 
#chains in the Genus database with same CATH topology
 1WNS A;  2HHU A;  3ASM A;  1X3N A;  3G25 A;  4XH4 A;  3HPG A;  5LJV A;  1SL1 A;  1A5V A;  3AAP A;  2ZD1 A;  4LH5 A;  3VQ7 A;  2D0C A;  1OVY A;  3FFK B;  5CZ2 A;  1C0M A;  1VQN N;  3DLL L;  5GAG P;  2P9U A;  2EX3 A;  1RT5 A;  1YVU A;  3P5J A;  1RDW X;  2FLO A;  3CJ9 A;  2QWP A;  3ZCM A;  1E4G T;  3OVN A;  3MXM A;  3CET A;  1GLJ O;  1FXX A;  3CMA N;  5LL6 Z;  2HST A;  1HQE A;  5AQF A;  2HVI A;  2UUC K;  4B9M A;  4DF8 A;  3OYC A;  1NKB A;  3EL2 A;  3QEW A;  5J2Q A;  3C95 A;  2O8B B;  3MED A;  3IRX A;  2G8I A;  1RT6 A;  4H5N A;  1T7P A;  3QO9 A;  4BC3 A;  1NKC A;  3SV4 A;  3CHW A;  3CJC A;  3JSM A;  2HNZ A;  5JS1 A;  2I7P A;  3E66 A;  4OPH A;  3ENH A;  4YDU C;  4CZM A;  4FJL A;  2FSK A;  2X6S A;  1I39 A;  3HVT A;  3AGR A;  4O0J A;  1WLJ A;  1SKW A;  1ATS A;  1OH5 A;  5HRO A;  4IFY A;  5J2M A;  5FPM A;  3TAG A;  1RTI A;  3EE9 A;  1NLV A;  3DAW A;  3SBT A;  3KWI A;  1QE1 A;  3LAM A;  2NZT A;  4H0X B;  4JKH A;  3OYL A;  4U7B A;  3ISN C;  3DLK A;  4O8U A;  1VQ5 N;  3CJB A;  3K57 A;  4A62 A;  4IOC L;  1EO1 A;  4MO4 A;  5KRT A;  1GLE G;  3ULE B;  3QBW A;  1TUY A;  4M7Y A;  3OS1 A;  2ZM6 K;  3CI5 A;  4K41 A;  3C94 A;  3AVI A;  1HJO A;  5AQX A;  4Z94 A;  1VSK A;  5BRH A;  2E5L K;  1G99 A;  1NMD A;  3JYT A;  4FJG A;  2VGM A;  3AA2 A;  2A41 A;  1VQ6 N;  1D8Y A;  2OTJ N;  2D0A A;  1HLU A;  2AP1 A;  3LDO A;  3CPW M;  4K42 A;  4M63 C;  3R8E A;  4WF9 L;  1BUP A;  4B3S K;  5SWM A;  5FDL A;  3SCX A;  5JIC A;  1RGI A;  1YJW N;  4WFB L;  2ZGY A;  3AV9 A;  3ZEU B;  5HOO A;  3LAK A;  2GEM A;  4C8K A;  3HOT A;  1J54 A;  4NCB A;  3J7Z O;  2YCH A;  2IS3 A;  1QSL A;  2E6L A;  3S3M A;  3U3Y A;  1REV A;  2GUI A;  3VQE A;  1Q7Y O;  3VQ5 A;  5FRO A;  1RDB A;  3DOK A;  1BU6 O;  5E41 A;  2BDP A;  4QS8 A;  3V9U A;  1S9E A;  4JV5 K;  4LY7 A;  1NOZ A;  3OJU A;  2YV0 X;  4OGC A;  1HQU A;  3L6Q A;  4O5B A;  2G8W A;  3HP9 A;  4M45 A;  4EZ9 A;  1K73 O;  1L3V A;  3LAN A;  4B8A B;  3OYN A;  1QVG M;  3IS9 A;  4JRQ A;  1YUW A;  4WQ5 A;  3NF6 A;  3RSE A;  5KRS A;  3BDP A;  2HB5 A;  4JKD A;  1LV5 A;  3LDN A;  3UIQ A;  5C12 A;  3VF4 A;  1JKH A;  3KD1 E;  4LFC K;  3KTQ A;  1BWF O;  3HZ6 A;  3WEE B;  3THY A;  1BDG A;  1O1W A;  3DRS A;  4YY3 K;  1T8E A;  3CXC M;  4DB3 A;  1VQ7 N;  2UXD K;  5LY3 A;  1WSF A;  3QET A;  1U2V A;  3QNN A;  4QS9 A;  4B3T K;  3K59 A;  1Q9X A;  4NLB A;  2ASM A;  2ZE2 A;  3WXJ A;  5BRE A;  3A8Y A;  3WT0 A;  1ESV A;  5KQD A;  1IBK K;  4F3T A;  1OVQ A;  2HHH K;  3TU5 A;  2HBL A;  4YOT A;  3HRG A;  4BRI A;  1NK0 A;  3SPY A;  3VOV A;  4BGB A;  3TTD A;  2D4W A;  3ULD A;  1NJZ A;  2VWB A;  3M5R A;  4FLU A;  2I7N A;  3S41 A;  3LDP A;  1T3V A;  4KH4 A;  3U9Z A;  3SMS A;  2HHV A;  5CYQ A;  1KQS M;  5A2Q O;  2YX6 A;  4JNE A;  1WSE A;  2G8F A;  5KPR A;  3KHY A;  4GVM A;  3SI6 A;  1BO5 O;  3NGZ A;  4DV5 K;  1TV6 A;  3KLG A;  2BTF A;  1NG9 A;  4C23 A;  3C65 A;  2ZQB A;  3WXI A;  3LM9 A;  4EZ6 A;  1GLA G;  3VTH A;  1MA9 B;  5K14 A;  4WFA L;  1ZBI A;  4HHT A;  1OH8 A;  4KB0 A;  2Q1N A;  4CJP A;  5DM6 L;  1QQO A;  4FWQ A;  1J53 A;  3MN9 A;  3TR8 A;  3OBW A;  3ZT1 A;  4MLH A;  3H45 C;  1TKX A;  3VEV A;  3QES A;  3MWT A;  4B9N A;  1RIL A;  3GOI A;  3OS0 A;  1YJ9 N;  4X66 K;  4ID1 A;  2FBT A;  5DM7 L;  1NGJ A;  1NU0 A;  1IH7 A;  4JI1 K;  3M8P A;  4B9T A;  2VCP A;  1VAZ A;  2WOM A;  4B8C A;  3ID8 A;  4FJ9 A;  3BP8 A;  3OYE A;  3G0Z A;  4A2B A;  4DTJ A;  3CME N;  3I55 N;  3IG1 A;  4GNI A;  5D3G A;  4DS4 A;  1LW2 A;  5F0X A;  3UB5 A;  5LJW A;  4M3Z A;  4CK1 A;  1MWM A;  2ATQ A;  4IO8 A;  2YHY A;  2LSN A;  2HHT A;  4FVU A;  4E89 A;  1HMV A;  4RW7 A;  4FK0 A;  3PV8 A;  3ENB A;  1S1U A;  3D45 A;  1V4S A;  3WQU A;  1NMN A;  4BVO A;  4ELT A;  1W9H A;  3S3N A;  3NMU A;  3LL3 A;  1WB9 A;  1YVN A;  4KHU A;  1TK5 A;  3BGR A;  3NFA A;  1UA1 A;  4EAH D;  1FJG K;  3A5L C;  2D0O A;  4C1N I;  1S22 A;  3QLH A;  3CCJ N;  1NGB A;  3WXL A;  2XY8 A;  1ILY A;  3M8Q A;  5TKY A;  3EEQ A;  3MEE A;  3LDS A;  1YIT N;  1YTU A;  2KHO A;  4AIL C;  3OYJ A;  3CQY A;  2NRX A;  4I9L A;  1NM1 A;  2UXC K;  4DR4 K;  2PZS A;  2Q97 A;  2Y1J A;  5FPN A;  4DFK A;  3I8B A;  1UWB A;  2P51 A;  4YDU A;  4DLG A;  3LDL A;  4EFH A;  4W5R A;  3M8S A;  5F1X A;  4ZHR A;  2HMI A;  3UKU B;  4BDP A;  1S9G A;  4CJ5 A;  4JKC A;  1DEJ A;  4CHZ A;  2VYP A;  4CEZ A;  2KZM A;  4O4G A;  4YNQ A;  1Z05 A;  1VRU A;  3PUF A;  5FRM A;  3KLI A;  1XUP O;  3G71 N;  3PO4 A;  5ELZ A;  4O8K A;  3CF5 L;  4GKJ K;  1CZB A;  1SV5 A;  4GW6 A;  5AQU A;  3Q7C A;  2FSN A;  3U3G A;  1NNE A;  3FZH A;  1T44 A;  2QM1 A;  3WXK A;  4FXD A;  2F9T A;  5ADX H;  4FPA A;  4I9Q A;  3DLH A;  4CD1 A;  3CFR A;  4GV6 A;  2O4I A;  1ZBU A;  2A5X A;  3ULE A;  3ZT4 A;  4CGF A;  1S1X A;  5IWA K;  3VGK A;  1HNW K;  4FWL A;  3I8D A;  4GVE A;  4Z4C A;  4O44 A;  4FSV A;  4B1Z A;  4KHQ A;  5TKW A;  3QEP A;  4GV3 A;  4W5N A;  3MXJ A;  2UUA K;  1VHX A;  4NO7 A;  3PO5 A;  3QIP A;  4CJQ A;  2VQE K;  2QWO A;  3QBX A;  1KVC A;  4KRF A;  1WOQ A;  5C2D A;  3ZEU A;  3OYB A;  4DR2 K;  3WNG A;  1LCU A;  4CW7 B;  4C8M A;  1QQN A;  2X74 A;  1KCF A;  4OVL A;  2YJF A;  3P38 A;  3AVL A;  3KLF A;  3HK2 A;  2GX9 A;  2XY5 A;  4FWP A;  5HRN A;  2V7Z A;  2Z1G A;  5JLF A;  1HYS A;  4C1N K;  1N32 K;  2HF3 A;  1IO2 A;  2HHQ A;  4JKB A;  4BRC A;  4IBN A;  5AQG A;  3T69 A;  4BAC A;  5H1S Q;  1SKS A;  1L3S A;  1SUQ A;  1LW0 A;  4DV1 K;  3PLA A;  3SLC A;  3CCS N;  3TAP A;  5EY4 A;  4BR9 A;  1SQK A;  4DTO A;  4CJK A;  3LWM A;  1UA0 A;  3L3V A;  1S1V A;  2ITM A;  3RMB A;  4EIA A;  5EU7 A;  1VRT A;  4CHP A;  1KD1 O;  3ZX0 A;  3THY B;  3WEE A;  3K5L A;  5AQR A;  4AM6 A;  1BQN A;  1Q18 A;  4KHY A;  4E7H A;  1XNQ K;  1JCF A;  1U2V B;  2W6K A;  3ZX3 A;  5B8H A;  2Q0R A;  1DGK N;  4I2P A;  1DTQ A;  2IVP A;  3A5O C;  2WON A;  4KO0 A;  1TL3 A;  4FM1 A;  2HHW A;  4DS5 A;  4DTP A;  4WCE L;  4IEE A;  1VQP N;  2E20 A;  4DUY K;  1KAX A;  5AQZ A;  3AO4 A;  4DR3 K;  3F2K A;  2QKK A;  3KD5 E;  3J8A A;  5C2F A;  1U45 A;  2HNY A;  4ZTJ A;  3QIC A;  1MDU B;  4W5T A;  4CF2 A;  2OPP A;  1JLE A;  1M90 O;  2YHB A;  4CK2 A;  2FXU A;  1IKX A;  2KQ2 A;  1KRP A;  1NGA A;  3OYI A;  1NGH A;  1HKC A;  3BUZ B;  2QTD A;  1RBT A;  3QIO A;  4CED A;  4OLB A;  3SQ0 A;  1XC3 A;  4M3R A;  4FOI A;  3CJ1 A;  4PY5 A;  5AR0 A;  5BPN A;  4LC9 B;  3ZT3 A;  4RWT A;  4CFD A;  1VQ8 N;  4K8Z A;  1MU2 A;  4WFN L;  3VA3 A;  4JKA A;  3C0B A;  2YNH A;  2OPQ A;  2RHK A;  5JLH A;  1B92 A;  5DK5 A;  3HL8 A;  3JXU A;  3AY9 A;  4CGI A;  1SL0 A;  1S5J A;  4H5V A;  4OLA A;  3L3U A;  1VSD A;  3NH0 A;  3DM2 A;  2OZS A;  3NVK A;  3OYK A;  1J9A A;  3BY5 A;  1NGF A;  5AFU H;  3ZET B;  5AQI A;  1RBU A;  4IWV A;  3A5N C;  3N4P A;  3CCL N;  1BQM A;  4DV0 K;  1C6V A;  2O8D A;  1D9F A;  5AZJ A;  3J7Y P;  3HT3 A;  1N6Q A;  4E1M A;  4X62 K;  2W42 A;  3WNF A;  3VEZ A;  3K5N A;  3AVH A;  4ZTF A;  4MDA A;  1VQ4 N;  1CLQ A;  4H4M A;  4H03 B;  4YFU A;  3AVN A;  3DLG A;  2P9N A;  1IBL K;  5BPL A;  1NK4 A;  1KTQ A;  2JWL A;  4DV4 K;  4NXN K;  4DQI A;  4ILG B;  3NF9 A;  3HM8 A;  4QAG A;  4ICL A;  2XHB A;  2E2Q A;  4BC2 A;  3TAB A;  3AO5 A;  4NXM K;  3TAN A;  1I94 K;  2A1S A;  4H5W A;  1NOY A;  4CBU A;  1VSF A;  1VQO N;  4HWI A;  4F3O A;  3SAG A;  3O3F A;  1O13 A;  5C42 A;  2CH5 A;  4I6M B;  3DXM B;  4BRF A;  3MN6 A;  1BCM A;  5FPD A;  1RNH A;  4CGH A;  1BIZ A;  3H3O B;  4J2E A;  1EP4 A;  3DI6 A;  3H08 A;  4QOZ B;  1GOB A;  3CCM N;  1X9M A;  4B3O A;  4KHW A;  4LF9 K;  3PSI A;  2Z1H A;  2GBZ A;  1S1T A;  4BRL A;  3OYG A;  5AQO A;  1ZBL A;  4RTF D;  4Z4E A;  2CGL A;  4K25 A;  3UKU A;  3S3O A;  1N36 K;  4JLH A;  3MMV A;  4FPB A;  3TWH A;  4JN4 A;  2P5O A;  4CJV A;  2OCE A;  1M1K O;  1GOC A;  3AAQ A;  4CEF A;  4PQU A;  1VK0 A;  2OYQ A;  3VQ8 A;  2HBK A;  4XIU A;  4QCL A;  1ASU A;  1U6Z A;  5DMR A;  2NRR A;  4B9S A;  4NCA A;  3EE8 A;  1TK8 A;  3O4Q A;  4JRP A;  1UOC A;  1U4B A;  1KAZ A;  3U6F A;  4AHV A;  4J2A A;  4AHS A;  5AQM A;  4FJK A;  3T7Z A;  4B9L A;  2OPR A;  2KZZ A;  4DSI A;  1LOT B;  4XEI A;  3CC4 N;  4TSX A;  4H0V B;  3ZX2 A;  1KVB A;  4CI6 A;  2YNI A;  4HUG A;  4GKK K;  4K0K K;  1CXU A;  4IKF A;  3TTF A;  2WFB A;  2VWJ A;  4CJ3 A;  3HBT A;  4BR5 A;  2HF4 A;  1U47 A;  3AO2 A;  5HL7 L;  1QZ6 A;  2WUS A;  3NBP A;  2KLA A;  1LWF A;  2RF2 A;  2VQF K;  4N5S A;  1KVA A;  4UQG A;  3K5M A;  1JJ2 M;  1EQY A;  3B8A X;  4DQP A;  4LF6 K;  4IJA A;  3QEI A;  3R3L A;  3OYM A;  1BA0 A;  2O8C A;  4DV7 K;  3E01 A;  5AQP A;  2NRH A;  4Q0B A;  4JK9 A;  2IOC A;  3KK1 A;  4KTQ A;  3AVM A;  4CEC A;  4IFE A;  4YOV A;  4FO0 A;  3NGI A;  3J7A P;  4KAZ A;  1KLM A;  3HST B;  2Z1J A;  5LMU K;  2ZGZ A;  4IEI A;  4KTZ A;  4WE1 A;  1N5Y A;  3HVR A;  1EKE A;  2VG6 A;  4Y1D A;  3LDQ A;  4CEA A;  1KXP A;  4FLX A;  3OYH A;  1HNI A;  5J2P A;  1JL1 A;  3PX4 A;  4CEB A;  3U8X A;  1D4X A;  2B6A A;  4NCG A;  4ISE A;  4M3U A;  3C6T A;  3HYF A;  1IV0 A;  1QTM A;  3OYD A;  3ZSW A;  1F21 A;  3CCU N;  1T03 A;  1VSL A;  5HRR A;  5BN8 A;  3H6E A;  2YHW A;  1KFS A;  1VSH A;  1HYV A;  1DLO A;  3EN9 A;  3AA3 A;  4RCH A;  3CER A;  1RT4 A;  1DKG D;  4JS5 A;  4DFM A;  1VQ9 N;  2GWJ A;  1ZBH A;  5F2R A;  2NNW A;  4EHU A;  1Q82 O;  3OJS A;  4GMJ B;  3RWU A;  1D5A A;  5C15 A;  4JI7 K;  3L2U A;  1L5U A;  1X3M A;  4JD2 A;  3H1Q A;  3WQT A;  5C25 A;  4DU1 A;  4WQ4 C;  4DR7 K;  1HPZ A;  2YJE A;  4E1N A;  3HXM A;  4OPJ A;  4JS4 A;  1X9S A;  4Z4G A;  3O9Q A;  4A2A A;  3O4W A;  4KHN A;  3K5O A;  3MEG A;  4CGD A;  4CZJ A;  1TVR A;  4BG8 A;  2QI2 A;  4HUF A;  3SNN A;  2AA4 A;  4F8R A;  2FBX A;  2YHA A;  2W6L A;  2QK9 A;  4W5O A;  1RDA A;  4HCC A;  4RW4 A;  1BA1 A;  2X6N A;  3E9P A;  3RVC A;  2VGN A;  4AF1 A;  4EHT A;  5JVH L;  3TAR A;  1YF5 L;  2E8A A;  2DFH A;  2YKN A;  5AQT A;  2FF6 A;  3W3D A;  2WTU A;  4KHS A;  3UKR A;  3ZT0 A;  5HLF A;  3CC2 N;  1C1C A;  3I0R A;  3AA5 X;  4B1X B;  2GEL A;  4OPA A;  1NJX A;  1Q86 O;  2P9K A;  3FFI A;  4KTW A;  4B1V A;  1NWK A;  3BF1 A;  1RCH A;  3T1A A;  2QWR A;  3QEV A;  3C7N B;  3GL1 A;  1EWQ A;  3TTC A;  4FK2 A;  3VGL A;  1XHX A;  2W41 A;  2E4L A;  3CFO A;  2ZJQ L;  3C6H A;  1W7A A;  1WSI A;  2HMP A;  3ZET A;  3P31 A;  1NGC A;  1RBV A;  3IMX A;  5FRN A;  2YNF A;  2O8D B;  5AZJ B;  1QHA A;  5JVG L;  1S1W A;  2P9P B;  2A1R A;  3K9K A;  4BDY A;  4J8F A;  1K8K A;  3FE1 A;  3CCQ N;  4FWO A;  3LZJ A;  3SBG A;  3DJC A;  2P9N B;  3AVJ A;  3LP0 A;  3WNE A;  3ID6 A;  4E3S A;  1QHT A;  3QER A;  2P9L A;  3OYF A;  3ATV A;  3H3N O;  4DQR A;  5IT9 O;  1TL1 A;  4HTL A;  1ZBF A;  4DHY A;  2WC9 A;  3CD6 N;  3VF6 A;  1I3A A;  3NDK A;  2QA4 N;  5M1Q A;  4BRN A;  3RTV A;  3O9S A;  4OO1 J;  2J4R A;  4BRD A;  2B5J A;  4FM2 A;  4DFJ A;  1MWK A;  4M7X A;  4LF4 K;  2YHX A;  4N47 A;  4FWK A;  3H46 O;  1HNX K;  4I6M A;  3Q7B A;  3CPE A;  3DXM A;  4H5R A;  5E84 A;  2QXL A;  3NH2 A;  3VMF B;  4CF0 A;  4DR6 K;  2BUP A;  2O8F B;  5KPZ A;  1TKZ A;  4KI4 A;  2DTU A;  5M1P A;  4OKE A;  1KAY A;  3CJA A;  2ASO A;  5EXW A;  4FZY A;  2QXF A;  2B4J A;  4DTU A;  3ZSO A;  4M3Y A;  2JGU A;  3OYA A;  1YAG A;  1YXQ A;  2Q36 A;  3NAE A;  3K0S A;  1JLC A;  3TI0 A;  2FBY A;  1VQM N;  3CCE N;  3NF8 A;  4DCH A;  1C0T A;  5GIN A;  3O1B A;  2XO7 A;  3O8M A;  1TKT A;  4JKG B;  3VQD A;  3DWL A;  3D2E B;  3VTI A;  3EY1 A;  4I2Q A;  3SPZ A;  1IG8 A;  2QWL A;  3P1G A;  4C8O A;  4EP4 A;  4FLW A;  5JMV A;  3D0P A;  1NKE A;  2G8K A;  1W0H A;  4CF9 A;  3FZF A;  4FJJ A;  3L2V A;  4DSJ A;  1C0G A;  1Z6R A;  3F9K A;  5AQK A;  4IXC A;  4FCY A;  1EX4 A;  2OPS A;  2G8V A;  1OKJ A;  4Y1C A;  4FLV A;  1KSP A;  2GUP A;  1NK7 A;  4IDK A;  1XNR K;  2EHG A;  2FC0 A;  5HRS A;  1IJJ A;  2KTQ A;  2DFF A;  3JAM O;  3PX6 A;  2ASP A;  3VES A;  2A40 A;  4FW2 A;  3QNO A;  4H8K A;  4G9Z A;  4K43 A;  3DYA A;  3CM6 A;  1CZA N;  4JI6 K;  1EWR A;  5C24 A;  3B6O A;  2UXB K;  4MDB A;  3G10 A;  4U67 L;  3MEC A;  1QS4 A;  3RR7 A;  2Q3S A;  1ITG A;  4BWJ A;  3ZSY A;  4BRO A;  4IG3 A;  4Z0U A;  3NF7 A;  3THW A;  1BI4 A;  2IVO A;  1HUX A;  3EKU A;  4CZK A;  2O8C B;  4CBX A;  1BIU A;  5BPM A;  2FSJ A;  5AFU A;  4BGA A;  2NUB A;  4RG8 A;  3AA4 A;  1JCG A;  4H0P A;  2NRT A;  2E1Y A;  4CJU A;  3HPH A;  1RDU A;  3BZC A;  1HRH A;  2FF3 B;  3AO1 A;  4CIF A;  4ELV A;  4DFP A;  4FL9 A;  3HTV A;  3J80 O;  2GTD A;  3LM2 A;  3C6A A;  3G6E N;  3RRG A;  4ID5 A;  2VWK A;  1RFQ A;  5C0Y A;  3VQA A;  1IKV A;  4BR0 A;  3KKS A;  5EOY A;  1RT3 A;  3CQ8 A;  3D2F A;  4JYA K;  2O4G A;  1G15 A;  3SQ1 A;  1RT1 A;  3PIO L;  1NJY A;  1Y64 A;  3PX0 A;  4A5B A;  4BQL A;  1CZ9 A;  4JI8 K;  4OKJ A;  1JL2 A;  2ZF5 O;  3G4S N;  2F8T A;  2ZJP L;  1DT9 A;  4DV3 K;  1FKO A;  1ASW A;  3AO3 A;  4DR1 K;  4JD2 B;  3DRR A;  4IOX A;  4PA1 A;  2OZM A;  4WQ4 A;  4BG9 A;  1Q81 O;  4CBW A;  5M1O A;  4YOX A;  1GLB G;  1OH7 A;  1IBM K;  4CJW A;  3DRP A;  4Q5V A;  3MK6 A;  4X64 K;  2GWK A;  4JI2 K;  5AQQ A;  4PL8 A;  3LAL A;  3TAE A;  2E6M A;  3LZI A;  5EVZ A;  4FWR A;  2A3Z A;  2HW3 A;  3EKS A;  1U04 A;  4BRA A;  5GIO A;  4YOY A;  3MX5 A;  1ZC6 A;  4DSF A;  1YT3 A;  3MWP A;  3V9W A;  3KIO A;  3V1O A;  3QDK A;  2D1K A;  1L3U A;  1VSE A;  3MCA B;  1N33 K;  2HHX A;  4N56 A;  5BR8 K;  2NRV A;  3DMJ A;  3QFU A;  1LAV A;  1P8Z A;  3NVM A;  3ZSX A;  1C1B A;  4M42 A;  2RE2 A;  2YI1 A;  4DUZ K;  3UKR B;  3B6P A;  4E7J A;  1D9D A;  4C8N A;  2D5R A;  3WNH A;  3F9M A;  3MN5 A;  3SJJ A;  2P9K B;  4KPY A;  3MAQ A;  2P1J A;  4PKI A;  4RW8 A;  4HVJ A;  3C7N A;  3JS6 A;  2PYJ A;  3L4Q A;  4KH6 A;  1Q9Y A;  4DTS A;  3V9S A;  1HYZ A;  3O80 A;  4B9V A;  4KI6 A;  4AQY K;  4CJF A;  2V7Y A;  1QVF M;  2VG5 A;  4NYN A;  4LH4 A;  4DR5 K;  2P9I B;  4DSL A;  5JS2 A;  1SZ2 A;  2CGJ A;  4BE0 A;  4N76 A;  3QB0 A;  4A57 A;  4DSK A;  4FJX A;  4JHD B;  5AQN A;  1XI1 A;  4K8X A;  4JK8 A;  2P9P A;  1W2B M;  4O5F A;  5AQH A;  1K8K B;  4JKE A;  4DTR A;  1RT2 A;  4ILJ A;  1ZYQ A;  1TYQ B;  4Z4F A;  2HBJ A;  3EZ5 A;  3BF3 A;  4XH1 A;  3OA9 A;  3FZM A;  4B08 A;  5CYM A;  1SL2 A;  4E7I A;  2P9L B;  4MFB A;  4CEO A;  4OX9 K;  4BRK A;  3VA0 A;  1NGI A;  1X1P A;  1LWC A;  4AHC A;  3TSQ A;  4JI0 K;  3K2P A;  4M3W A;  3MX2 A;  2UYT A;  5I42 A;  4IZ9 A;  4CJL A;  4L8R B;  2F8S A;  1HKG A;  3O4N A;  4N41 A;  4CZI A;  1IKY A;  4LD0 A;  4DQS A;  1JLA A;  3P39 A;  2O8F A;  2DY4 A;  1Q8I A;  4MLE A;  4PWD A;  3IKM A;  5FPE A;  3PIP L;  5SZT A;  3SAF A;  5CHI A;  4F2S A;  5HRP A;  1X9W A;  3FZL A;  1BIS A;  3K9J A;  3L2Q A;  1TGO A;  4CIE A;  4OGE A;  5BRD A;  5I3U A;  2PBD A;  3LP2 A;  3DXK A;  3VQP A;  1ASV A;  5GAE P;  4DV6 K;  4DTX A;  3OHR A;  1HNV A;  4JI4 K;  1TKD A;  2V52 B;  4JKG A;  2YNG A;  3QEX A;  1NBW A;  2XY7 A;  3D2E A;  4GY2 B;  5C10 A;  4DMN A;  1SS6 A;  2W40 A;  4XH5 A;  1HX1 A;  4FYD A;  1S6Q A;  4JAX A;  1YIJ N;  1JXB A;  3GBT A;  2RKI A;  4CFC A;  3AGK A;  2E2O A;  2KFN A;  4H5T A;  3WUH A;  3ZSZ A;  1ATR A;  4FW1 A;  1XQS C;  1NJW A;  2R7Y A;  3IFR A;  4DG1 A;  1NGG A;  4E19 A;  4OPK A;  3VEY A;  4IOA L;  1KLN A;  1C0F A;  1NGD A;  3ZT2 A;  3PSF A;  3R9P A;  3TAF A;  3VN5 A;  1RDC A;  4CZH A;  1HR0 K;  1RT7 A;  1BG3 A;  3O5B A;  5MLC Q;  4CZL A;  1ZBS A;  1YHQ N;  1A5X A;  2ITG A;  1GOA A;  2E88 A;  3KZB A;  3A2F A;  4CHQ A;  4RW9 A;  2PYL A;  3O9R A;  3R6M A;  4BVP A;  3TSP A;  5HP1 A;  4KKO A;  3OS2 A;  1K6Y A;  2P9S A;  3THW B;  1BI4 B;  2ZJR L;  4LFA K;  1JLG A;  2IIR A;  1ATN A;  1FW6 A;  1EXQ A;  4BE2 A;  3FLC O;  1C1A A;  3L2W A;  4A59 A;  3A0I X;  3SUP A;  5AZI B;  3HO1 A;  1SAZ A;  3ALY A;  4I7F A;  1RBS A;  4CFB A;  3V81 A;  4RW6 A;  4O55 A;  3L4I A;  2Z1I A;  2Y1I A;  5KPT A;  2QWM A;  2RN2 A;  4ILH A;  3SAH A;  3HP6 A;  3FGU A;  4HCB A;  3CJ7 A;  4FWS A;  1IKW A;  3VER A;  4LSL A;  1T05 A;  3O9U A;  4IDH A;  5CZ1 A;  3SK3 A;  3O6W A;  1NK8 A;  1TK0 A;  2I5J A;  2KKZ A;  3F73 A;  3KK7 A;  4H0O A;  2KFZ A;  1HNZ K;  1WN7 A;  1YTA A;  3D2F B;  3OBY A;  3THX A;  2PY5 A;  2FBV A;  4LSN A;  3I0S A;  4AH9 A;  3VPZ A;  3VQB A;  2QW9 A;  4KBO A;  3DLB A;  4BY9 C;  3D6R A;  2F96 A;  1WSG A;  5AQY A;  1JLQ A;  1BOT O;  3NCI A;  1N34 K;  1J5E K;  3QML A;  4FWM A;  3I56 N;  1P90 A;  2E1Z A;  4H0Y B;  3CQX A;  4X65 K;  3VQ9 A;  1XMO K;  1GLD G;  1YI2 N;  1L3T A;  4GV9 A;  3DLR A;  3KWG A;  1X9J A;  5KI6 A;  3F5T A;  3P4I A;  2EWS A;  1ZXO A;  4CER A;  4BRH A;  4CZE A;  4BWM A;  1RTH A;  3SQ4 A;  4NYF A;  3SUO A;  4DU4 A;  2IGI A;  3KLH A;  3TAQ A;  3AAR A;  2F7T A;  4HTU A;  4JEP A;  3CYM A;  4CFA A;  3TPQ A;  3VEX A;  4OJR A;  4JI3 K;  2UUB K;  2H3G X;  2D0B A;  3MDQ A;  4ISG A;  4CJR A;  4FM0 A;  5ADX A;  2PFU A;  4KH5 A;  4CHN A;  3V1Q A;  4CEE A;  4FK4 A;  4AHT A;  2NRZ A;  4B1U B;  4JI5 K;  4YHH K;  3NH1 A;  3O3H A;  3MN7 A;  1U48 A;  2HHS A;  4PKG A;  4KV8 A;  4CE9 A;  4CJ7 A;  2OAN A;  5I9E B;  1NK6 A;  3VET A;  3KLE A;  1XHZ A;  5AQS A;  3M3Z A;  3V6D A;  1A5W A;  1WSH A;  1QSS A;  3M6G A;  5AQL A;  1LAW A;  2HOE A;  2P5G A;  3QFP A;  3HOS A;  2P9I A;  5E26 A;  4BC4 A;  1UAX A;  3E9O A;  3U4L A;  2XRI A;  3NE6 A;  4JHD A;  3HJF A;  3VF2 A;  3KKR A;  4FJM A;  2O8E B;  5FLX O;  3M8R A;  4LF7 K;  3T19 A;  2KW4 A;  3RRH A;  3RMD A;  4WYB A;  1S3X A;  1TYQ A;  2NRW A;  4YOW A;  3ZSR A;  3OTO K;  3D7E O;  3SQ2 A;  1H1V A;  1NK5 A;  3SMP A;  3C6U A;  2UU9 K;  1K9M O;  2A42 A;  4J2B A;  1Z26 A;  4IFV A;  1R59 O;  2Q31 A;  4FOE A;  4AM7 A;  3ATU A;  1U49 A;  4PUO A;  2DFE A;  1QQM A;  3HPO A;  4FJ8 A;  3ZSQ A;  4FLY A;  3HI0 A;  4DV2 K;  1WAF A;  3SZ2 A;  4BR2 A;  4B3M K;  1NGE A;  2G8H A;  4DKW A;  2CGK A;  4FVM A;  3CFP A;  4FJ5 A;  3RMC A;  2P9U B;  3LWL A;  1DTT A;  4M3X A;  2IDO A;  4F4K A;  3GDQ A;  4DQ8 A;  4FZZ A;  1T6D A;  3LPT A;  3L2R A;  4CJS A;  2JLE A;  4E1J A;  1JCE A;  1Y97 A;  3W0L A;  1TAU A;  3EO3 A;  1VSJ A;  4ELU A;  2E2P A;  3CM5 A;  3BZK A;  3ZLJ A;  3DLE A;  2GV9 A;  3R1X A;  3T1Y K;  2OA8 A;  3L0Q A;  4BDZ A;  3E1Y A;  3K58 A;  1QSY A;  3DXK B;  5M1N A;  2O8B A;  3O9T A;  2JWK A;  4CCH A;  1HKB A;  1WSJ A;  2DPN A;  5M1F A;  3IAY A;  3M1F A;  2NLX A;  1WBD A;  1QQC A;  4BQZ A;  5AJ3 K;  4M41 A;  5GAD P;  3AVC A;  3SUQ A;  2BE2 A;  1VQK N;  3AVG A;  3RMA A;  1FK9 A;  2RPI A;  3HSC A;  2IC3 A;  3SUN A;  1XMQ K;  4CJ4 A;  4MO5 A;  1R0A A;  4IO9 L;  4PL7 A;  4FZX C;  1SKR A;  4FJH A;  2BAN A;  3LP1 A;  4F9O A;  4CVN E;  4O0I A;  3LP3 A;  3N4Q A;  2QEX N;  3AVB A;  5CY4 A;  4BE1 A;  3GE1 A;  3SV3 A;  4QS7 A;  4DTM A;  5BR9 A;  4LF8 K;  4CIG A;  4FJN A;  3VQQ A;  1FKP A;  1IG9 A;  2QWN A;  4BRM A;  4BRE A;  4IG0 A;  4B9Q A;  1JLF A;  2ETJ A;  4FJ7 A;  3VQ4 A;  2F4V K;  5AQW A;  4B1Y B;  4BRQ A;  4V19 S;  3J81 O;  2HND A;  2AJQ A;  3NGY A;  4B3R K;  4CGJ A;  4B9U A;  1KC8 O;  4DF4 A;  4FWN A;  2P9S B;  1E3M A;  4R79 A;  2IVN A;  2ZWH A;  5CE3 A;  1S72 N;  3IUC A;  3ENO A;  4BC5 A;  1K8A O;  3EYZ A;  4JK7 A;  1J5O A;  4M3T A;  3A5M C;  4CGG A;  1J6Z A;  4PKH A;  5KQ8 A;  3VQC A;  5AZI A;  1V4T A;  4CHO A;  3KK2 A;  5BN9 A;  4KRE A;  4AHU A;  3T3F A;  4L3Q A;  4IJN A;  4LFB K;  3FR0 A;  4FLT A;  2WBN A;  1JXE A;  4DLE A;  4MQ3 A;  4KHP K;  1RBR A;  1WAJ A;  1EET A;  2IAJ A;  4EP5 A;  3AVF A;  3QIN A;  2CH6 A;  4E7K A;  4LF5 K;  4Y0W A;  2D0P A;  4DSE A;  4A61 A;  4A5A A;  4H4O A;  3V4I A;  1S6P A;  2VG7 A;  3THX B;  3KJV A;  2G8U A;  4CZF A;  3GG4 A;  5J1E A;  1VQL N;  1KFD A;  4CK3 A;  1BHL A;  3UE5 A;  1WBB A;  3P83 D;  1LWE A;  2E2N A;  1N8R O;  4E7L A;  3S9H A;  5AQV A;  3VEW A;  3RR8 A;  1C0U A;  1CXQ A;  3VEO A;  1BL3 A;  1RTJ A;  3U9D A;  3RSE B;  4WQ5 C;  4NLC A;  4CES A;  4BR7 A;  3WXM B;  1BCO A;  3O08 A;  4CHY A;  1XC9 A;  1GLF O;  1B9D A;  4B1W B;  2BGG A;  3CCR N;  4E0D A;  5GIP A;  4BRG A;  4JKF A;  2A6A A;  2XY6 A;  4G1Q A;  4UY8 O;  4FLZ A;  3H1V X;  4DWI A;  3HM9 A;  4YOU A;  4PHT X;  4HUE A;  4J2D A;  1QZ5 A;  3CIP A;  1TUU A;  1XWL A;  4BRP A;  1OH6 A;  3TSU A;  5BRF A;  4W5Q A;  1TAQ A;  3VQ6 A;  3ITH A;  4CJT A;  3NHG A;  5J2N A;  2HVH A;  3V9Z A;  1GLL O;  3AVK A;  3CCV N;  3VEN A;  4CZG A;  3CG7 A;  1HJR A;  2YKM A;  3ZSV A;  4CEQ A;  4BR4 A;  2QWQ A;  2Q0U A;  1HPM A;  3VGM A;  1VSI A;  1WUA A;  4Z4I A;  3CC7 N;  1T6C A;  3SYZ A;  3PY8 A;  3AVA A;  4CJE A;  2F9W A;  3ZYY X;  3L8B A;  3THV A;  3TAM A;  2Q2R A;  5M1K A;  5KTQ A;  3SJH A;  1BGX T;  5T7B A;  5HBM A;  3KVG A;  4CF1 A;  3MCP A;  3O3G A;  1YJN N;  1E4F T;  3OW2 M;  3O1W A;  3OY9 A;  3E9L A;  4YOR A;  4NB4 A;  4DTN A;  3DOL A;  3BEX A;  4DU3 A;  1GLC G;  5KGW A;  2HBM A;  2PAV A;  4CF8 A;  3LPU A;  3MXI A;  2QKB A;  5GAH P;  4DQQ A;  3V9X A;  3T1H K;  1B9F A;  5KGX A;  4KB1 A;  4AHR A;  1Z25 A;  4C8L A;  1NJI O;  2O8E A;  3EZW A;  2OTL N;  3KK3 A;  1VSM A;  2V51 B;  3I33 A;  4R5P A;  1W97 L;  1NK9 A;  4KFB A;  3IDH A;  4OKK A;  4FJI A;  2BH1 A;  5AQJ A;  1JLB A;  4CD3 A;  4F2R A;  4Z4H A;  5CR4 A;  2X78 A;  3V1R A;  3FZK A;  1RDD A;  5EX5 A;  1RTD A;  4ISF A;  5LMN K;  4H0T B; 
#chains in the Genus database with same CATH homology
 4JI6 K;  2ZM6 K;  2UXB K;  1FJG K;  1N33 K;  2E5L K;  4CVN E;  5BR8 K;  5IT9 O;  1N32 K;  4JI7 K;  4DUZ K;  1HNZ K;  2UXC K;  4LF8 K;  5A2Q O;  4DR7 K;  4DR4 K;  5FLX O;  4DV6 K;  4B3S K;  4LF7 K;  4JI4 K;  4LF4 K;  4DV5 K;  4DV0 K;  1HNX K;  4DV1 K;  3OTO K;  3J7Y P;  5LL6 Z;  4X62 K;  4DR6 K;  2F4V K;  4V19 S;  2UU9 K;  3J81 O;  2UUC K;  4GKK K;  1N34 K;  4K0K K;  4B3R K;  1J5E K;  1IBL K;  1XMQ K;  3J80 O;  4AQY K;  4DV4 K;  4GKJ K;  4DV2 K;  4NXN K;  4X65 K;  2VQF K;  4B3M K;  4DR5 K;  1XMO K;  1XNQ K;  4JV5 K;  4NXM K;  4LF6 K;  4X66 K;  1I94 K;  4JYA K;  4DV7 K;  4JI1 K;  1HR0 K;  4DUY K;  4LFB K;  4DR3 K;  4JI8 K;  3J7A P;  4KHP K;  5IWA K;  1HNW K;  5LMU K;  4OX9 K;  4LFC K;  3T1Y K;  4DV3 K;  4LFA K;  4LF5 K;  2UUA K;  4JI0 K;  4LF9 K;  4DR1 K;  3T1H K;  4JI3 K;  4YY3 K;  2VQE K;  2UUB K;  2UXD K;  1IBM K;  4B3T K;  4X64 K;  1XNR K;  4JI2 K;  5AJ3 K;  1N36 K;  4DR2 K;  4JI5 K;  4YHH K;  3JAM O;  4CW7 B;  1IBK K;  5LMN K;  2HHH K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...