2UXBK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxbK00
4K0KK 2UU9K 4DV4K 1FJGK 4DR7K 2UXCK 5LL6Z 3J7AP 4JI6K 1N36K 4LF7K 4X62K 3J80O 4DV0K 2UUCK 4NXMK 4JV5K 2ZM6K 4LF8K 4LF5K 3T1HK 4CVNE 4KHPK 4DR2K 4DV2K 4GKJK 5LMUK 4YHHK 4DV6K 1HNZK 4B3SK 4X65K 4DR5K 2UXBK 4OX9K 5BR8K 1I94K 2VQFK 4DV3K 1HNWK 4DV7K 5IWAK 5AJ3K 4JI1K 4AQYK 5A2QO 4LFCK 4DV5K 4LFBK 4X66K 2F4VK 1XNQK 5FLXO 4NXNK 2VQEK 1HR0K 4YY3K 4JYAK 2UUBK 4LF4K 4JI4K 4LFAK 5IT9O 4B3TK 1HNXK 4DR4K 4JI3K 4B3RK 4DR3K 3OTOK 4JI2K 4X64K 2HHHK 2UXDK 4JI8K 1N34K 4JI0K 1N32K 1N33K 3J81O 4JI5K 3J7YP 1IBLK 4DV1K 5LMNK 1J5EK 4DR1K 4LF9K 4JI7K 3JAMO 1IBKK 4DUYK 4DR6K 1IBMK 4B3MK 1XNRK 4LF6K 1XMQK 2E5LK 3T1YK 1XMOK 4CW7B 2UUAK 4GKKK 4V19S 4DUZK
chains in the Genus database with same CATH superfamily
3CIPA 1BGXT 3SAGA 1EKEA 3UB5A 1MA9B 4DTPA 2P1JA 2PYLA 4WCEL 1FK9A 1RDAA 1XC3A 1GLAG 3S9HA 3O4WA 4FPBA 4HCCA 1DT9A 4CJRA 4RW6A 1XI1A 3EO3A 5KTQA 1YTAA 3G10A 4ZHRA 1VSJA 3NF8A 2P9PB 4FWSA 1BI4A 4ISFA 3F73A 4BRMA 3L6QA 3IMXA 1YHQN 4R79A 3MAQA 5HLFA 4H4OA 1NJYA 3LWLA 3SBTA 4OLAA 3W3DA 4JEPA 3TSPA 5HP1A 4CJTA 4NYNA 1YXQA 1KCFA 5JMVA 3THYA 1M90O 4NLBA 2ASPA 3MN9A 5KRTA 3U3YA 1VQ8N 3KJVA 4K8XA 2QK9A 3THYB 1JCGA 1NK0A 3T3FA 4OGCA 3UKUB 2X6SA 3L3VA 2RKIA 3TTDA 1HYSA 1IKXA 4O4GA 4CIEA 3G4SN 1BIZA 4B9UA 4B3TK 1HNXK 4DR4K 4OPKA 4XIUA 3L2RA 4JNEA 3ZT1A 5AQQA 3DJCA 4HTLA 1WAJA 4CJFA 3VA0A 3K57A 4CHOA 3J7YP 3VESA 2UYTA 3UKUA 1XWLA 4JD2B 3BF3A 5AZJA 4CGFA 3O3FA 4KH4A 3KZBA 5F2RA 3TR8A 1S1TA 4CBUA 4PUOA 5BPLA 3H45C 1KC8O 1OVYA 1IBKK 4RW4A 1K73O 3QETA 3LDPA 2GWKA 1RCHA 3NF9A 3CQXA 4CW7B 2UUAK 4KH6A 4CIFA 3S3MA 3R9PA 3D2FA 2P9KA 3HSTB 4WFNL 2OZSA 4ELVA 5AZJB 2O8BA 3AVMA 2KFZA 3VEOA 2A5XA 3DLRA 3H08A 1SKRA 1YTUA 3J80O 3TTCA 5AQMA 2ZF5O 4Y1DA 5GAGP 2PBDA 3C94A 4YORA 3NH0A 2A1RA 1GOCA 3CMEN 4CVNE 3G0ZA 3L2VA 2HVIA 4PA1A 5AQTA 5LMUK 1X3NA 1TAQA 3S3NA 1RTIA 4Z0UA 4DTRA 3RMCA 2NLXA 4ILGB 3ZX3A 5AR0A 3VQAA 3EL2A 4X65K 3QO9A 3OBYA 1RT7A 2EX3A 3OA9A 1BUPA 4DCHA 2ZGYA 2VG7A 3M8SA 1HNWK 4FOEA 1U2VA 1S9EA 3K9KA 5JLFA 4DV5K 3KTQA 3O1WA 4DSLA 3NAEA 3CD6N 3S3OA 3CC2N 1O13A 3KLGA 1KFDA 1T6CA 2OZMA 3N4QA 4A5AA 1YJWN 4JK8A 4JYAK 2Q2RA 1BQNA 5BRFA 4ID1A 5D3GA 2HW3A 2GTDA 4DF4A 1QSSA 3HBTA 4B1WB 2W40A 4M3YA 3UKRA 2VGNA 1YF5L 5AQVA 1KXPA 3H6EA 4B1XB 1C1AA 3ATUA 2G8HA 4FLTA 5AQGA 1B9DA 2FBXA 4E0DA 4IEIA 1JXEA 2E1ZA 1P8ZA 1W0HA 2PZSA 2HHSA 4F8RA 3SQ1A 3C95A 1W97L 1NGCA 2O8EB 3U3GA 3OVNA 4DR6K 5SWMA 3CJBA 4IOCL 3M6GA 1SV5A 1FJGK 2A41A 1NMNA 3AGKA 3VQ4A 3SPZA 4M3UA 4DV4K 1JLQA 1S6PA 4ISGA 3LZIA 3KK1A 2HNZA 3AGRA 3HZ6A 5EXWA 1U04A 3CCEN 4LF7K 4X62K 3K59A 1LV5A 4HCBA 1C6VA 1TKZA 2D0CA 4FCYA 1J54A 2KZZA 3MWTA 4KHPK 4F9OA 4O0IA 4B9QA 4DR2K 2YKNA 3PSIA 2O8DA 2VWJA 3TANA 2P9NA 3CCMN 4FVUA 5BPMA 4DR5K 1S6QA 4KHQA 4BE0A 1HYZA 1HRHA 3D6RA 4NCGA 2YCHA 3FLCO 3ZSXA 3OJSA 2DY4A 4FZYA 4FM0A 2I7PA 1TV6A 1HNVA 3HT3A 5AQHA 2QWOA 4YOTA 1W9HA 2YI1A 1RBSA 2YNHA 1WSJA 1K9MO 4L8RB 3DLEA 4CJQA 3FZFA 4BRKA 2IIRA 3EEQA 1U4BA 4BR0A 1LWFA 4CGDA 1RTJA 1NGFA 3IAYA 4JI2K 5FROA 3OS1A 2ZJQL 3HVRA 3U6FA 1DGKN 3ULEB 1D9FA 4DQRA 4GNIA 4CBWA 4JS5A 4H5TA 3LAMA 4AHSA 3HP9A 1RDUA 4O55A 3OYGA 5FPMA 2D4WA 1A5VA 3DXMB 4MDBA 1IV0A 4BY9C 4B9VA 4H5NA 2P9UB 5AQKA 4CJEA 4CJSA 4W5OA 1D5AA 3VMFB 1NK9A 1NKEA 3DXMA 3ATVA 4R5PA 5CZ1A 4CZIA 4FYDA 4C1NK 5GINA 3CETA 4AM6A 4XH5A 1KQSM 3PX6A 2HMPA 3OBWA 4W5RA 1Z6RA 4OO1J 3HK2A 1WN7A 3H3NO 4PKGA 3HM9A 4CF9A 3CCSN 3O9TA 4H0VB 4KKOA 2P9IA 3B8AX 3O1BA 4BRIA 1NOYA 3QEIA 3O4NA 1JLAA 3CFRA 1FXXA 2P9IB 4MLHA 1Q18A 5FDLA 4JV5K 3QINA 2Z1JA 3U9DA 4C23A 3SJJA 1EWQA 3SBGA 1KLNA 1LCUA 4M7XA 1SUQA 3WXJA 3NGIA 1VQ9N 1LWCA 3V6DA 4WQ4C 1R59O 3EZWA 2YHXA 2ITMA 3O3HA 3SQ4A 1X9WA 3IUCA 2QI2A 4FOIA 4KTQA 4BR7A 3EZ5A 3VOVA 4M3RA 3QFUA 4YHHK 2YNGA 2OA8A 1LOTB 3LDQA 4CIGA 3V4IA 1TYQB 4DFPA 5TKWA 3CERA 3VQPA 3SNNA 3SUNA 4M3TA 3JSMA 4DTXA 1HKGA 1YJ9N 1S72N 1RDDA 1NJZA 1KFSA 2G8IA 1T3VA 4DQPA 2QEXN 1HJRA 4QAGA 3TI0A 4YOXA 1J5OA 2F4VK 4PY5A 3G71N 3SUQA 1RBRA 5MLCQ 5C12A 2KKZA 3VQCA 3I0RA 4B9NA 3TSQA 2W6KA 4FLVA 5ELZA 1Z05A 4KPYA 3VETA 5E26A 3JXUA 4OPJA 1BG3A 3DRRA 4E19A 4JI4K 3ZX0A 1ZYQA 2HBMA 4DR3K 1ASUA 5JICA 4DU4A 1ASVA 4JI8K 4O5FA 4JKEA 3ENOA 3DOKA 5BREA 4FL9A 5K14A 3CG7A 5AQIA 1N32K 2QXLA 5EY4A 3V1RA 4K25A 2KFNA 2OPPA 2QWLA 4E1NA 1XC9A 2NRXA 3CQ8A 3E1YA 3OYFA 1CZAN 3ALYA 1QZ6A 2GV9A 1RT1A 1J5EK 3KLEA 4IJAA 4BRCA 1T03A 1IKYA 1TK0A 4BGBA 3M1FA 1WBBA 4CECA 1XMQK 2E5LK 1NGGA 3SMSA 2GBZA 1XMOK 4GV3A 3VEXA 2VG6A 3QERA 2X6NA 1EETA 1QHAA 4KTZA 3TPQA 4K41A 4BRQA 4CFBA 2E88A 1NM1A 3Q7BA 4RG8A 1HLUA 3CCJN 3R1XA 3ZETB 3QICA 4DWIA 5BRHA 3RVCA 2YHYA 2ZJPL 2NZTA 4IO8A 2HBLA 3Q7CA 2NRZA 3CM5A 3SAFA 4FLYA 4Z4EA 4GV6A 3QESA 3DLHA 3VENA 3HPHA 3IKMA 3SAHA 4IG3A 4BRLA 4YOYA 4DFKA 1WAFA 4I6MA 1HJOA 2F9WA 5GAHP 4N47A 2HSTA 5HBMA 4LC9B 4DLEA 1VQ6N 4JHDA 2QWQA 5LJVA 2XHBA 3NBPA 3SYZA 1T7PA 1J9AA 3IRXA 5M1PA 4BDPA 3MECA 5EX5A 4CEEA 3BGRA 1GLCG 5SZTA 3IS9A 4BVPA 3O4QA 3DXKB 3LANA 4CJ3A 2D1KA 3O9QA 2IC3A 5M1FA 1Z26A 3AO3A 3DXKA 5AQSA 1YAGA 1FW6A 4KHYA 1T6DA 4Q5VA 2P9LA 1IJJA 2KTQA 3AV9A 1JLFA 1TKTA 3V9WA 5AQJA 1ZBFA 4OKEA 3ZSQA 1Y64A 4MLEA 3V1OA 1VSMA 2G8VA 1T8EA 1G99A 3OYMA 4FJIA 5CYQA 3U8XA 4CJKA 3KD5E 3NF6A 4M7YA 3GE1A 1XHXA 3R6MA 3NE6A 4NO7A 2A1SA 3MEDA 4IG0A 3C6TA 4JKAA 3TAQA 5CZ2A 5GADP 4JN4A 3TU5A 3O8MA 4DSIA 4DSJA 1Y97A 2QWNA 3A5MC 4FPAA 5EU7A 3CC4N 5BN8A 5BRDA 2QWRA 5CE3A 2V7YA 3I55N 4GVMA 2G8KA 1XHZA 4DTNA 1UA1A 2I7NA 3SV3A 2PYJA 3AAPA 3G25A 4C8KA 4G1QA 4BRDA 4I9QA 4M3XA 5AFUA 1KVBA 3U4LA 3QEXA 3EE9A 4DQIA 2Z1HA 4KH5A 4CJVA 1RGIA 4WF9L 3HO1A 1YIJN 4LSLA 4CEAA 4JK7A 1VQNN 4AHVA 4RW8A 4FWQA 3PIPL 4DSEA 1TK5A 3ITHA 1D4XA 1EQYA 4FSVA 4AF1A 3CJ9A 5DMRA 3I33A 3F2KA 2FXUA 3L2WA 3VF2A 3ZLJA 2HBJA 2A40A 1NBWA 1K8KA 1JL2A 3ZEUB 4FO0A 3I56N 1NK7A 2FC0A 1TKXA 1K8KB 2DTUA 1NGBA 2QM1A 3ISNC 2RF2A 2ZD1A 1EX4A 4JKBA 4ELTA 1GOAA 2FSNA 2WONA 4CHYA 4BRAA 4CD1A 2O8BB 3DLKA 3EE8A 1EWRA 3M8RA 3LPUA 4ZTJA 1NOZA 1IBLK 4JKHA 3G6EN 3HI0A 1E4GT 3MEGA 3WNFA 4EFHA 5HRNA 1Q86O 4LD0A 2P9SA 4BR5A 4GY2B 1JCEA 4I9LA 4FM1A 3HOSA 3QEPA 4KI4A 4AILC 3D2FB 1BISA 3AVNA 1BCMA 2RHKA 4DUYK 2HNDA 3VGKA 4DLGA 2ZWHA 1XNRK 3VTHA 4WQ5A 2PFUA 4HUFA 4CFCA 2WTUA 4FWOA 4CHZA 1U6ZA 1C0TA 1U49A 2HHWA 4ELUA 4KHWA 3EKUA 5FPEA 4E1MA 3P38A 1EXQA 4GVEA 3AA4A 1SZ2A 1KLMA 1RBVA 5C15A 3WEEA 4CJLA 1NGEA 2A3ZA 2P9KB 3V9ZA 3WEEB 3N4PA 4DF8A 1IG9A 1L3VA 4DSKA 1OH8A 5GIOA 3WNHA 2O8CA 3CCVN 3QLHA 1Q9YA 4O5BA 4NYFA 4CJ4A 4CHNA 2D0AA 4NLCA 1VQMN 3NVMA 1VQPN 5FRNA 3OW2M 1VQLN 4KB1A 2BUPA 2VQFK 2PY5A 3E9LA 2VYPA 2CGJA 2IVPA 3CCLN 2WUSA 4FZXC 1E3MA 4DKWA 4W5QA 4YOVA 1Q81O 4NXNK 4FXDA 5AZIA 4OJRA 1JL1A 4H5VA 4EP4A 4KI6A 3OHRA 1BCOA 4PKIA 1NGIA 5KRSA 1SKWA 3HVTA 2QWPA 2QWMA 5AQNA 1BO5O 1KVAA 4JKGB 2NRTA 3OYHA 5DM7L 4B3RK 3PIOL 2ATQA 3K9JA 3DRSA 4B9MA 2JGUA 3A5OC 4AHUA 2D5RA 3LM9A 4EHUA 4DU3A 5HRPA 3E9OA 2HNYA 1NKBA 3K5NA 3E66A 3HL8A 1NK8A 4J2BA 4F2SA 3O5BA 3P39A 3OY9A 4CZEA 4CERA 3QBXA 2IVNA 4YOWA 4CF1A 3SCXA 3AVKA 4DTMA 3DWLA 1RDWX 3F9MA 1BQMA 4A2AA 4JD2A 1TL3A 3KK2A 1NK5A 3GBTA 1QSLA 4CHQA 1XUPO 3OS0A 3H1QA 5F1XA 1VSKA 4XH1A 3WQUA 4K8ZA 4HWIA 4JRQA 5BN9A 1VHXA 4FK0A 4FWPA 4Z4HA 1C0FA 1BU6O 4DV2K 4GKJK 2AA4A 3UIQA 3H1VX 1WSFA 4DV6K 1HNZK 2J4RA 2ASMA 4M45A 1D8YA 2HF4A 1QVFM 4OX9K 1BIUA 4FWMA 1GLFO 4BWJA 3KK3A 4L3QA 2E6LA 1HKCA 3F5TA 4H0YB 1SS6A 1NGDA 1X9SA 2QXFA 1M1KO 4FJ8A 2P9NB 4PKHA 4GMJB 2D0OA 1K8AO 4X66K 2IGIA 1HPMA 3J8AA 3O9UA 4H03B 5J2QA 1QQMA 3MN6A 2OANA 3ZT4A 4YY3K 3ULEA 4WFAL 5BR9A 4TSXA 2GELA 5T7BA 1TUYA 1TUUA 1R0AA 4BE2A 1DTTA 5FPDA 2Q0UA 3D2EA 1I39A 2Y1IA 4CZKA 3WNGA 3TSUA 4CJWA 4DQ8A 1P90A 2YHBA 1REVA 3AVAA 2OPRA 2HF3A 3C6HA 4Z4IA 4IZ9A 3NDKA 4OPAA 4JKDA 4NCBA 1YITN 4LH4A 3AY9A 4BGAA 4QS9A 3L2QA 4DV1K 3T1AA 4F4KA 2HOEA 2W6LA 1LWEA 2ASOA 4LY7A 1ZBHA 4B3OA 4KTWA 2XY5A 5KPRA 3C0BA 3D7EO 4B3MK 4HVJA 1ZXOA 4KFBA 3F9KA 1MDUB 1S5JA 1BWFO 5C25A 1OVQA 3TTFA 2CH5A 2IOCA 2FBYA 2QTDA 3HOTA 1QZ5A 5AQXA 2Z1GA 1SL2A 2HHUA 4JI6K 3AVLA 4LH5A 5GIPA 4CFAA 4CZMA 2NRRA 2BDPA 4OKJA 3CFOA 3LPTA 3PLAA 2ZQBA 3W0LA 3DM2A 2YKMA 2O8DB 2FBTA 4CGGA 3QBWA 3M5RA 3RRHA 1BA1A 1FKPA 3VEVA 2O4GA 3CCRN 3ENBA 4FWKA 4IO9L 4IKFA 1LAWA 1YVNA 3TAEA 4OLBA 1YJNN 2ZGZA 2XY6A 5B8HA 2F9TA 4BC3A 2FLOA 3ZYYX 3VA3A 3PV8A 1WLJA 4BG8A 1BHLA 1UOCA 1ZBIA 5CR4A 4PQUA 3FFKB 2FSJA 3OYEA 3TAPA 2V7ZA 3HYFA 5JVHL 4FJHA 3H46O 2Z1IA 2BE2A 2KHOA 4O8KA 1A5XA 3DMJA 3AVHA 4CF2A 5C0YA 1X3MA 3MXJA 1Q82O 2UUBK 4B1UB 1BA0A 1C1CA 1Q9XA 3BZCA 4JLHA 3KLIA 4U67L 5F0XA 4FK2A 1ESVA 4CGHA 1DEJA 3VQ5A 5C42A 3V9SA 2HHTA 1A5WA 2O4IA 4YNQA 3V81A 1X1PA 1HUXA 4Z4FA 4EIAA 1JLBA 3K2PA 5CYMA 4ZTFA 3V1QA 5I3UA 4CGJA 4FLXA 2BANA 2KQ2A 3HXMA 3MN7A 3OYAA 1MU2A 2PAVA 5C10A 4XH4A 1Q8IA 1V4TA 1IBMK 3ZSOA 4FW2A 5I9EB 3FFIA 3ZT0A 1C0UA 4ID5A 4DS4A 5KQ8A 2IAJA 1N5YA 3D2EB 3HPOA 3NH1A 4DSFA 2EWSA 2UU9K 2G8FA 4E7HA 2HB5A 3L2UA 3VERA 2NUBA 4KHUA 5C2FA 2P9UA 3CJ1A 2D0PA 4YFUA 2BTFA 3O08A 3WUHA 1HNIA 3MDQA 4NCAA 2GUPA 4NXMK 4RWTA 3NCIA 1UWBA 2ZM6K 3VQBA 3ZX2A 3NGZA 4U7BA 1OH6A 3OYJA 3FGUA 4B8AB 3H3OB 3T1HK 3FZLA 2YX6A 4FW1A 3THWA 3J7ZO 1RILA 2BGGA 2WBNA 3KLFA 4YOUA 2KZMA 2XO7A 3CXCM 5AQFA 4QS8A 5FPNA 1HPZA 4KHNA 3LP3A 3RTVA 4DV7K 4BR9A 1CZBA 5M1NA 2YNFA 2OCEA 1RDCA 3LP1A 4E7LA 1XNQK 4CZGA 2HHXA 2VQEK 3BP8A 1KVCA 1S1VA 4EP5A 4AHTA 1RT5A 3SI6A 2GUIA 1X9MA 4LSNA 3QIPA 4LF4K 4C8NA 3VTIA 4KAZA 1C0MA 4B9TA 4OPHA 4DTUA 4X64K 1YT3A 1WOQA 1QS4A 2I5JA 5AQRA 2WFBA 1U48A 1NU0A 3C7NB 3J81O 5KGXA 3CCUN 3QFPA 1BOTO 3OYLA 3THXA 1LW0A 3LP2A 4IOAL 3AA2A 4CF8A 2W42A 1HYVA 3FR0A 2OTJN 1Z25A 2ZJRL 3OS2A 5AQZA 3EY1A 4N76A 1CLQA 1SQKA 3SMPA 2VG5A 4AM7A 3T1YK 2E2NA 1UAXA 4BRFA 1VRTA 4GKKK 2W41A 4DUZK 4CHPA 3ULDA 4FJJA 5CY4A 4RW7A 5ADXA 4DR7K 2UXCK 2G8UA 1KSPA 4ISEA 5LL6Z 3J7AP 3VF6A 1B9FA 4JKCA 3ZETA 3NMUA 3C6AA 2V52B 4CEFA 5E84A 1NK6A 5KQDA 4RTFD 2ETJA 2HHQA 2HHVA 3CCQN 3ZSZA 4LF5K 2VGMA 3O9SA 1LAVA 4NB4A 2YJEA 1ZBLA 4FLWA 2YJFA 2VWBA 4FJ9A 1QTMA 2UXBK 4FLZA 5AQLA 3P5JA 5BR8K 5KPZA 2IS3A 4B1YB 4DMNA 5IWAK 5AJ3K 1QVGM 4AQYK 1SKSA 4LFCK 4UQGA 1L3UA 1EP4A 3AARA 4E3SA 4FJXA 4BWMA 4QOZB 3KKSA 3ZT3A 1RTHA 2E4LA 5EVZA 5GAEP 5C24A 1KAXA 3MWPA 2YNIA 1NWKA 4FWLA 3UE5A 3KLHA 5HROA 5BPNA 2AJQA 1RTDA 4I6MB 5DK5A 2BH1A 2Q3SA 4A57A 4LFAK 3AA5X 3OYCA 2P9SB 3NF7A 4W5TA 1YI2N 4BC5A 3MCPA 4BROA 2UXDK 3VEZA 1N34K 4PL7A 3GG4A 3RMBA 4N5SA 4BVOA 3C6UA 1Q7YO 2Q97A 4CESA 4H0TB 4F3TA 2NRWA 4CEOA 3L4QA 2G8WA 4DFJA 4FWNA 3KWIA 4BREA 3VGMA 4BDYA 5LMNK 4UY8O 1WB9A 3ASMA 3EN9A 3HSCA 4E1JA 3BUZB 3CPWM 3T19A 4CJPA 3AVIA 1MWMA 2AP1A 1NJIO 2EHGA 3L8BA 3BF1A 5HL7L 1VSIA 4V19S 1WSHA 4E89A 3RRGA 4FJ5A 2HVHA 4WQ4A 4JK9A 3NFAA 4DS5A 1S1WA 2O8CB 3BZKA 1CZ9A 1U47A 4IDKA 4IOXA 4FK4A 3KKRA 3AVBA 3IFRA 4M41A 1QQCA 1WSIA 4M63C 4C8MA 1VSDA 3E9PA 5CHIA 1VAZA 1ITGA 4I2QA 3DLBA 4G9ZA 1ZC6A 2GEMA 3ZSWA 4DTOA 4B3SK 3GOIA 1MWKA 1NLVA 1RNHA 4CEZA 1VQ4N 4FWRA 3OJUA 3O6WA 2KW4A 3RMAA 2H3GX 2E2PA 4BRNA 4MQ3A 1IKWA 4FJLA 4DTJA 5JVGL 3DLGA 4JS4A 4JI1K 4K42A 5A2QO 4KBOA 3UKRB 1RFQA 3VQDA 4Z94A 3D45A 3NVKA 1NJXA 4CI6A 5FLXO 1VSLA 1VSHA 3O3GA 3GL1A 3AO1A 3MEEA 2RE2A 4OKKA 2Y1JA 5M1KA 4M3ZA 4J2EA 1NMDA 3TAFA 3M8QA 2P9PA 2JLEA 3QDKA 3AA3A 1RDBA 2X78A 1ATNA 2O8FB 4JI3K 2OYQA 4WQ5C 4EHTA 1S1XA 4E7IA 5DM6L 3VQ7A 1NG9A 1WNSA 3RR8A 3KD1E 3LZJA 1GLLO 4BRHA 3R8EA 4IFVA 4K43A 4CE9A 3EYZA 4JKGA 2JWLA 4W5NA 1JCFA 3O80A 2NRVA 2A42A 4FJ7A 4B9SA 2O8FA 1SAZA 1KTQA 1T05A 3TABA 4KO0A 3L3UA 4H0XB 4I2PA 3MCAB 1HKBA 3FZKA 2WOMA 4DG1A 5AQUA 4EZ9A 1H1VA 3WT0A 3FZHA 3I8DA 1UA0A 4FM2A 4O8UA 2E6MA 2DPNA 4O44A 3LALA 2UUCK 2RN2A 3LAKA 4H0OA 3OYBA 4A5BA 4LF8K 1RT2A 3HPGA 3IG1A 5J1EA 3BEXA 1SL0A 2OPQA 5JS1A 3VEWA 3SUPA 3ID8A 5LJWA 4H8KA 2KLAA 3ZSVA 2HBKA 3LM2A 1ZBUA 2CGLA 2E2OA 3NHGA 1IG8A 3PY8A 3ENHA 1HQUA 2F96A 4BG9A 1NKCA 3PO5A 3L0QA 1ATSA 3C65A 3WNEA 1J53A 2XY8A 4YDUA 1OH5A 1HQEA 2YV0X 1CXQA 3EKSA 1VQ7N 1HMVA 1L3TA 1WSEA 5E41A 1KRPA 1U2VB 2XY7A 3PX0A 1C1BA 3R3LA 4M42A 2E2QA 1YVUA 1NGHA 1E4FT 1QE1A 5HOOA 2D0BA 2VWKA 3S41A 4M3WA 1KAYA 3SPYA 1DLOA 4WE1A 1RT4A 3CM6A 3WXIA 5AZIB 4OGEA 4JRPA 1L3SA 3L4IA 4YDUC 1NJWA 3PUFA 4XEIA 5JS2A 1F21A 4B8CA 4Z4GA 4MFBA 4A59A 3JAMO 4Z4CA 5J2MA 3ZSYA 3QMLA 2ZE2A 3B6OA 5HRRA 2P5GA 3TAMA 3NH2A 1DTQA 4FZZA 1W7AA 2F8SA 3BDPA 2IDOA 5EOYA 3AAQA 4K0KK 3I8BA 3AVJA 4DU1A 4EAHD 2O8EA 3FZMA 3HTVA 1N6QA 1N36K 3MX2A 2FBVA 3MK6A 1NNEA 3JS6A 4DV0K 4QS7A 4ICLA 2DFFA 3M3ZA 1VSEA 4IFYA 1HX1A 1VSFA 4FJMA 4CFDA 1TGOA 3KK7A 3DAWA 4A2BA 4KV8A 2Q0RA 2Q36A 4GW6A 1DKGD 1TK8A 5AQYA 3RSEB 2Q1NA 5AQPA 3RR7A 1C0GA 3FE1A 3SK3A 4B08A 4BDZA 3NGYA 3RSEA 4C8OA 4CEQA 3RMDA 4AHCA 3MN5A 3LP0A 3MMVA 4CJ5A 2B6AA 5LY3A 1KD1O 3VGLA 3K58A 4MDAA 4E7KA 2P5OA 1GLEG 4CJ7A 3WXLA 2DFHA 3V9XA 4CK2A 5JLHA 4HTUA 3CPEA 1NK4A 1TVRA 3CF5L 4MO5A 2FSKA 3LDNA 4ILHA 1TAUA 3OYDA 2YHWA 2B5JA 1TL1A 1YUWA 3AVCA 1ILYA 4DQSA 3LDLA 2ITGA 4DB3A 3OYKA 1RT6A 4KB0A 5J2PA 4CEBA 2E1YA 3P83D 1ASWA 2HHHK 4DQQA 3CYMA 4O0JA 2CH6A 1O1WA 3DLLL 1N33K 4JI5K 4IXCA 4CGIA 3AVGA 3CFPA 3CC7N 3SQ0A 1KAZA 5AQOA 2IVOA 4IBNA 4CZFA 2NNWA 3CMAN 1SL1A 3THWB 1CXUA 4BQLA 3K5OA 4HUEA 4BQZA 1QSYA 4LF6K 4BR2A 2DFEA 3LWMA 1S3XA 2NRHA 3VF4A 3K0SA 1U45A 4Y1CA 3QIOA 2GX9A 4FLUA 2XRIA 1OKJA 2JWKA 5KGWA 2QKBA 3PX4A 2FF6A 1G15A 3U9ZA 4H5RA 4DHYA 2QA4N 3P1GA 1VQON 1JXBA 4MO4A 3THVA 4CZJA 4IFEA 4DFMA 3HM8A 4OVLA 1VQKN 3SUOA 3K5MA 4E7JA 1V4SA 2B4JA 2CGKA 4CBXA 4I7FA 3CJCA 4PWDA 1JLCA 1T44A 1VK0A 4KHSA 3MX5A 5H1SQ 3BY5A 4BACA 2GWJA 4FJNA 1TKDA 2VCPA 2RPIA 3HP6A 2E20A 3HRGA 5KI6A 3HJFA 1IH7A 4IJNA 4B1VA 4C8LA 4J2AA 4B1ZA 1EO1A 4LFBK 1TYQA 4H0PA 4Q0BA 3QNOA 3VQQA 4HUGA 3ZCMA 1JKHA 1OH7A 3WXMB 2HMIA 5TKYA 1ZBSA 5I42A 1JJ2M 1B92A 4JAXA 1J6ZA 4CCHA 3AO2A 1D9DA 3ZSRA 4IWVA 3A0IX 4A62A 4WFBL 3TWHA 3MXMA 1WSGA 5IT9O 4F2RA 4CK1A 4JKFA 2A6AA 3KIOA 3OTOK 1QHTA 3AVFA 3THXB 1GLJO 1QQOA 3E01A 3SJHA 2X74A 4N41A 2FF3B 3QEWA 3AO4A 1NGJA 4BC2A 3VN5A 3KHYA 4H5WA 5M1QA 1GLBG 1VRUA 2P9LB 5J2NA 3SLCA 4J8FA 2LSNA 1LW2A 3LL3A 3SZ2A 4EZ6A 3CI5A 3TARA 3B6PA 3ZT2A 4DR1K 4JI7K 2QKKA 1VQ5N 4ILJA 3CJ7A 2F8TA 4FVMA 3VQ9A 4B9LA 1ATRA 5AQWA 4AH9A 3DI6A 3T69A 1BI4B 3P4IA 3D0PA 1S9GA 3JYTA 1JLEA 4BRPA 4GV9A 4HHTA 3DRPA 3A8YA 3OYIA 3CQYA 2E8AA 4AHRA 3ID6A 4PL8A 3DOLA 3SV4A 4A61A 3MXIA 4CJUA 4IDHA 4CZHA 5C2DA 3AO5A 3VQEA 1L5UA 3IDHA 3A5LC 3I0SA 4DTSA 3P31A 1FKOA 3PSFA 1JLGA 4BE1A 3WQTA 3KWGA 1IO2A 4C1NI 2WC9A 3PO4A 3A5NC 3SQ2A 2YHAA 3WXKA 1S22A 4RW9A 4CF0A 4N56A 4BR4A 4JHDB 3GDQA 3O9RA 1N8RO 4QCLA 3ZEUA 1K6YA 1W2BM 4Y0WA 3K5LA 3QEVA 4F3OA 4CD3A 3CJAA 4CK3A 4DV3K 1I94K 5ADXH 1GLDG 3QB0A 4FJGA 3VEYA 1RBTA 1BL3A 4IEEA 3LDSA 4CEDA 4RCHA 4BC4A 1HR0K 1XQSC 3RWUA 3A2FA 3M8PA 3OYNA 3CHWA 4BRGA 2F7TA 3QNNA 5FRMA 1X9JA 4PHTX 5HRSA 5M1OA 1BDGA 3DYAA 4JI0K 4KREA 4WYBA 1WUAA 1S1UA 3V9UA 3VQ8A 4J2DA 3VPZA 1NGAA 1RT3A 4CZLA 2OPSA 3LDOA 2P51A 3TAGA 3VQ6A 1I3AA 1QQNA 1WBDA 2QW9A 5KPTA 4LF9K 4KRFA 5AFUH 2Q31A 4FJKA 2R7YA 4H4MA 1GOBA 3KVGA 1IKVA 3C7NA 3T7ZA 1RBUA 2V51B 2OTLN
chains in the Genus database with same CATH topology
4K0KK 2UU9K 4DV4K 1FJGK 4DR7K 2UXCK 5LL6Z 3J7AP 4JI6K 1N36K 4LF7K 4X62K 3J80O 4DV0K 2UUCK 4NXMK 4JV5K 2ZM6K 4LF8K 4LF5K 3T1HK 4CVNE 4KHPK 4DR2K 4DV2K 4GKJK 5LMUK 4YHHK 4DV6K 1HNZK 4B3SK 4X65K 4DR5K 2UXBK 4OX9K 5BR8K 1I94K 2VQFK 4DV3K 1HNWK 4DV7K 5IWAK 5AJ3K 4JI1K 4AQYK 5A2QO 4LFCK 4DV5K 4LFBK 4X66K 2F4VK 1XNQK 5FLXO 4NXNK 2VQEK 1HR0K 4YY3K 4JYAK 2UUBK 4LF4K 4JI4K 4LFAK 5IT9O 4B3TK 1HNXK 4DR4K 4JI3K 4B3RK 4DR3K 3OTOK 4JI2K 4X64K 2HHHK 2UXDK 4JI8K 1N34K 4JI0K 1N32K 1N33K 3J81O 4JI5K 3J7YP 1IBLK 4DV1K 5LMNK 1J5EK 4DR1K 4LF9K 4JI7K 3JAMO 1IBKK 4DUYK 4DR6K 1IBMK 4B3MK 1XNRK 4LF6K 1XMQK 2E5LK 3T1YK 1XMOK 4CW7B 2UUAK 4GKKK 4V19S 4DUZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K K;  2UU9 K;  4DV4 K;  1FJG K;  4DR7 K;  2UXC K;  5LL6 Z;  3J7A P;  4JI6 K;  1N36 K;  4LF7 K;  4X62 K;  3J80 O;  4DV0 K;  2UUC K;  4NXM K;  4JV5 K;  2ZM6 K;  4LF8 K;  4LF5 K;  3T1H K;  4CVN E;  4KHP K;  4DR2 K;  4DV2 K;  4GKJ K;  5LMU K;  4YHH K;  4DV6 K;  1HNZ K;  4B3S K;  4X65 K;  4DR5 K;  2UXB K;  4OX9 K;  5BR8 K;  1I94 K;  2VQF K;  4DV3 K;  1HNW K;  4DV7 K;  5IWA K;  5AJ3 K;  4JI1 K;  4AQY K;  5A2Q O;  4LFC K;  4DV5 K;  4LFB K;  4X66 K;  2F4V K;  1XNQ K;  5FLX O;  4NXN K;  2VQE K;  1HR0 K;  4YY3 K;  4JYA K;  2UUB K;  4LF4 K;  4JI4 K;  4LFA K;  5IT9 O;  4B3T K;  1HNX K;  4DR4 K;  4JI3 K;  4B3R K;  4DR3 K;  3OTO K;  4JI2 K;  4X64 K;  2HHH K;  2UXD K;  4JI8 K;  1N34 K;  4JI0 K;  1N32 K;  1N33 K;  3J81 O;  4JI5 K;  3J7Y P;  1IBL K;  4DV1 K;  5LMN K;  1J5E K;  4DR1 K;  4LF9 K;  4JI7 K;  3JAM O;  1IBK K;  4DUY K;  4DR6 K;  1IBM K;  4B3M K;  1XNR K;  4LF6 K;  1XMQ K;  2E5L K;  3T1Y K;  1XMO K;  4CW7 B;  2UUA K;  4GKK K;  4V19 S;  4DUZ K; 
#chains in the Genus database with same CATH topology
 3CIP A;  1BGX T;  3SAG A;  1EKE A;  3UB5 A;  1MA9 B;  4DTP A;  2P1J A;  2PYL A;  4WCE L;  1FK9 A;  1RDA A;  1XC3 A;  1GLA G;  3S9H A;  3O4W A;  4FPB A;  4HCC A;  1DT9 A;  4CJR A;  4RW6 A;  1XI1 A;  3EO3 A;  5KTQ A;  1YTA A;  3G10 A;  4ZHR A;  1VSJ A;  3NF8 A;  2P9P B;  4FWS A;  1BI4 A;  4ISF A;  3F73 A;  4BRM A;  3L6Q A;  3IMX A;  1YHQ N;  4R79 A;  3MAQ A;  5HLF A;  4H4O A;  1NJY A;  3LWL A;  3SBT A;  4OLA A;  3W3D A;  4JEP A;  3TSP A;  5HP1 A;  4CJT A;  4NYN A;  1YXQ A;  1KCF A;  5JMV A;  3THY A;  1M90 O;  4NLB A;  2ASP A;  3MN9 A;  5KRT A;  3U3Y A;  1VQ8 N;  3KJV A;  4K8X A;  2QK9 A;  3THY B;  1JCG A;  1NK0 A;  3T3F A;  4OGC A;  3UKU B;  2X6S A;  3L3V A;  2RKI A;  3TTD A;  1HYS A;  1IKX A;  4O4G A;  4CIE A;  3G4S N;  1BIZ A;  4B9U A;  4B3T K;  1HNX K;  4DR4 K;  4OPK A;  4XIU A;  3L2R A;  4JNE A;  3ZT1 A;  5AQQ A;  3DJC A;  4HTL A;  1WAJ A;  4CJF A;  3VA0 A;  3K57 A;  4CHO A;  3J7Y P;  3VES A;  2UYT A;  3UKU A;  1XWL A;  4JD2 B;  3BF3 A;  5AZJ A;  4CGF A;  3O3F A;  4KH4 A;  3KZB A;  5F2R A;  3TR8 A;  1S1T A;  4CBU A;  4PUO A;  5BPL A;  3H45 C;  1KC8 O;  1OVY A;  1IBK K;  4RW4 A;  1K73 O;  3QET A;  3LDP A;  2GWK A;  1RCH A;  3NF9 A;  3CQX A;  4CW7 B;  2UUA K;  4KH6 A;  4CIF A;  3S3M A;  3R9P A;  3D2F A;  2P9K A;  3HST B;  4WFN L;  2OZS A;  4ELV A;  5AZJ B;  2O8B A;  3AVM A;  2KFZ A;  3VEO A;  2A5X A;  3DLR A;  3H08 A;  1SKR A;  1YTU A;  3J80 O;  3TTC A;  5AQM A;  2ZF5 O;  4Y1D A;  5GAG P;  2PBD A;  3C94 A;  4YOR A;  3NH0 A;  2A1R A;  1GOC A;  3CME N;  4CVN E;  3G0Z A;  3L2V A;  2HVI A;  4PA1 A;  5AQT A;  5LMU K;  1X3N A;  1TAQ A;  3S3N A;  1RTI A;  4Z0U A;  4DTR A;  3RMC A;  2NLX A;  4ILG B;  3ZX3 A;  5AR0 A;  3VQA A;  3EL2 A;  4X65 K;  3QO9 A;  3OBY A;  1RT7 A;  2EX3 A;  3OA9 A;  1BUP A;  4DCH A;  2ZGY A;  2VG7 A;  3M8S A;  1HNW K;  4FOE A;  1U2V A;  1S9E A;  3K9K A;  5JLF A;  4DV5 K;  3KTQ A;  3O1W A;  4DSL A;  3NAE A;  3CD6 N;  3S3O A;  3CC2 N;  1O13 A;  3KLG A;  1KFD A;  1T6C A;  2OZM A;  3N4Q A;  4A5A A;  1YJW N;  4JK8 A;  4JYA K;  2Q2R A;  1BQN A;  5BRF A;  4ID1 A;  5D3G A;  2HW3 A;  2GTD A;  4DF4 A;  1QSS A;  3HBT A;  4B1W B;  2W40 A;  4M3Y A;  3UKR A;  2VGN A;  1YF5 L;  5AQV A;  1KXP A;  3H6E A;  4B1X B;  1C1A A;  3ATU A;  2G8H A;  4FLT A;  5AQG A;  1B9D A;  2FBX A;  4E0D A;  4IEI A;  1JXE A;  2E1Z A;  1P8Z A;  1W0H A;  2PZS A;  2HHS A;  4F8R A;  3SQ1 A;  3C95 A;  1W97 L;  1NGC A;  2O8E B;  3U3G A;  3OVN A;  4DR6 K;  5SWM A;  3CJB A;  4IOC L;  3M6G A;  1SV5 A;  1FJG K;  2A41 A;  1NMN A;  3AGK A;  3VQ4 A;  3SPZ A;  4M3U A;  4DV4 K;  1JLQ A;  1S6P A;  4ISG A;  3LZI A;  3KK1 A;  2HNZ A;  3AGR A;  3HZ6 A;  5EXW A;  1U04 A;  3CCE N;  4LF7 K;  4X62 K;  3K59 A;  1LV5 A;  4HCB A;  1C6V A;  1TKZ A;  2D0C A;  4FCY A;  1J54 A;  2KZZ A;  3MWT A;  4KHP K;  4F9O A;  4O0I A;  4B9Q A;  4DR2 K;  2YKN A;  3PSI A;  2O8D A;  2VWJ A;  3TAN A;  2P9N A;  3CCM N;  4FVU A;  5BPM A;  4DR5 K;  1S6Q A;  4KHQ A;  4BE0 A;  1HYZ A;  1HRH A;  3D6R A;  4NCG A;  2YCH A;  3FLC O;  3ZSX A;  3OJS A;  2DY4 A;  4FZY A;  4FM0 A;  2I7P A;  1TV6 A;  1HNV A;  3HT3 A;  5AQH A;  2QWO A;  4YOT A;  1W9H A;  2YI1 A;  1RBS A;  2YNH A;  1WSJ A;  1K9M O;  4L8R B;  3DLE A;  4CJQ A;  3FZF A;  4BRK A;  2IIR A;  3EEQ A;  1U4B A;  4BR0 A;  1LWF A;  4CGD A;  1RTJ A;  1NGF A;  3IAY A;  4JI2 K;  5FRO A;  3OS1 A;  2ZJQ L;  3HVR A;  3U6F A;  1DGK N;  3ULE B;  1D9F A;  4DQR A;  4GNI A;  4CBW A;  4JS5 A;  4H5T A;  3LAM A;  4AHS A;  3HP9 A;  1RDU A;  4O55 A;  3OYG A;  5FPM A;  2D4W A;  1A5V A;  3DXM B;  4MDB A;  1IV0 A;  4BY9 C;  4B9V A;  4H5N A;  2P9U B;  5AQK A;  4CJE A;  4CJS A;  4W5O A;  1D5A A;  3VMF B;  1NK9 A;  1NKE A;  3DXM A;  3ATV A;  4R5P A;  5CZ1 A;  4CZI A;  4FYD A;  4C1N K;  5GIN A;  3CET A;  4AM6 A;  4XH5 A;  1KQS M;  3PX6 A;  2HMP A;  3OBW A;  4W5R A;  1Z6R A;  4OO1 J;  3HK2 A;  1WN7 A;  3H3N O;  4PKG A;  3HM9 A;  4CF9 A;  3CCS N;  3O9T A;  4H0V B;  4KKO A;  2P9I A;  3B8A X;  3O1B A;  4BRI A;  1NOY A;  3QEI A;  3O4N A;  1JLA A;  3CFR A;  1FXX A;  2P9I B;  4MLH A;  1Q18 A;  5FDL A;  4JV5 K;  3QIN A;  2Z1J A;  3U9D A;  4C23 A;  3SJJ A;  1EWQ A;  3SBG A;  1KLN A;  1LCU A;  4M7X A;  1SUQ A;  3WXJ A;  3NGI A;  1VQ9 N;  1LWC A;  3V6D A;  4WQ4 C;  1R59 O;  3EZW A;  2YHX A;  2ITM A;  3O3H A;  3SQ4 A;  1X9W A;  3IUC A;  2QI2 A;  4FOI A;  4KTQ A;  4BR7 A;  3EZ5 A;  3VOV A;  4M3R A;  3QFU A;  4YHH K;  2YNG A;  2OA8 A;  1LOT B;  3LDQ A;  4CIG A;  3V4I A;  1TYQ B;  4DFP A;  5TKW A;  3CER A;  3VQP A;  3SNN A;  3SUN A;  4M3T A;  3JSM A;  4DTX A;  1HKG A;  1YJ9 N;  1S72 N;  1RDD A;  1NJZ A;  1KFS A;  2G8I A;  1T3V A;  4DQP A;  2QEX N;  1HJR A;  4QAG A;  3TI0 A;  4YOX A;  1J5O A;  2F4V K;  4PY5 A;  3G71 N;  3SUQ A;  1RBR A;  5MLC Q;  5C12 A;  2KKZ A;  3VQC A;  3I0R A;  4B9N A;  3TSQ A;  2W6K A;  4FLV A;  5ELZ A;  1Z05 A;  4KPY A;  3VET A;  5E26 A;  3JXU A;  4OPJ A;  1BG3 A;  3DRR A;  4E19 A;  4JI4 K;  3ZX0 A;  1ZYQ A;  2HBM A;  4DR3 K;  1ASU A;  5JIC A;  4DU4 A;  1ASV A;  4JI8 K;  4O5F A;  4JKE A;  3ENO A;  3DOK A;  5BRE A;  4FL9 A;  5K14 A;  3CG7 A;  5AQI A;  1N32 K;  2QXL A;  5EY4 A;  3V1R A;  4K25 A;  2KFN A;  2OPP A;  2QWL A;  4E1N A;  1XC9 A;  2NRX A;  3CQ8 A;  3E1Y A;  3OYF A;  1CZA N;  3ALY A;  1QZ6 A;  2GV9 A;  1RT1 A;  1J5E K;  3KLE A;  4IJA A;  4BRC A;  1T03 A;  1IKY A;  1TK0 A;  4BGB A;  3M1F A;  1WBB A;  4CEC A;  1XMQ K;  2E5L K;  1NGG A;  3SMS A;  2GBZ A;  1XMO K;  4GV3 A;  3VEX A;  2VG6 A;  3QER A;  2X6N A;  1EET A;  1QHA A;  4KTZ A;  3TPQ A;  4K41 A;  4BRQ A;  4CFB A;  2E88 A;  1NM1 A;  3Q7B A;  4RG8 A;  1HLU A;  3CCJ N;  3R1X A;  3ZET B;  3QIC A;  4DWI A;  5BRH A;  3RVC A;  2YHY A;  2ZJP L;  2NZT A;  4IO8 A;  2HBL A;  3Q7C A;  2NRZ A;  3CM5 A;  3SAF A;  4FLY A;  4Z4E A;  4GV6 A;  3QES A;  3DLH A;  3VEN A;  3HPH A;  3IKM A;  3SAH A;  4IG3 A;  4BRL A;  4YOY A;  4DFK A;  1WAF A;  4I6M A;  1HJO A;  2F9W A;  5GAH P;  4N47 A;  2HST A;  5HBM A;  4LC9 B;  4DLE A;  1VQ6 N;  4JHD A;  2QWQ A;  5LJV A;  2XHB A;  3NBP A;  3SYZ A;  1T7P A;  1J9A A;  3IRX A;  5M1P A;  4BDP A;  3MEC A;  5EX5 A;  4CEE A;  3BGR A;  1GLC G;  5SZT A;  3IS9 A;  4BVP A;  3O4Q A;  3DXK B;  3LAN A;  4CJ3 A;  2D1K A;  3O9Q A;  2IC3 A;  5M1F A;  1Z26 A;  3AO3 A;  3DXK A;  5AQS A;  1YAG A;  1FW6 A;  4KHY A;  1T6D A;  4Q5V A;  2P9L A;  1IJJ A;  2KTQ A;  3AV9 A;  1JLF A;  1TKT A;  3V9W A;  5AQJ A;  1ZBF A;  4OKE A;  3ZSQ A;  1Y64 A;  4MLE A;  3V1O A;  1VSM A;  2G8V A;  1T8E A;  1G99 A;  3OYM A;  4FJI A;  5CYQ A;  3U8X A;  4CJK A;  3KD5 E;  3NF6 A;  4M7Y A;  3GE1 A;  1XHX A;  3R6M A;  3NE6 A;  4NO7 A;  2A1S A;  3MED A;  4IG0 A;  3C6T A;  4JKA A;  3TAQ A;  5CZ2 A;  5GAD P;  4JN4 A;  3TU5 A;  3O8M A;  4DSI A;  4DSJ A;  1Y97 A;  2QWN A;  3A5M C;  4FPA A;  5EU7 A;  3CC4 N;  5BN8 A;  5BRD A;  2QWR A;  5CE3 A;  2V7Y A;  3I55 N;  4GVM A;  2G8K A;  1XHZ A;  4DTN A;  1UA1 A;  2I7N A;  3SV3 A;  2PYJ A;  3AAP A;  3G25 A;  4C8K A;  4G1Q A;  4BRD A;  4I9Q A;  4M3X A;  5AFU A;  1KVB A;  3U4L A;  3QEX A;  3EE9 A;  4DQI A;  2Z1H A;  4KH5 A;  4CJV A;  1RGI A;  4WF9 L;  3HO1 A;  1YIJ N;  4LSL A;  4CEA A;  4JK7 A;  1VQN N;  4AHV A;  4RW8 A;  4FWQ A;  3PIP L;  4DSE A;  1TK5 A;  3ITH A;  1D4X A;  1EQY A;  4FSV A;  4AF1 A;  3CJ9 A;  5DMR A;  3I33 A;  3F2K A;  2FXU A;  3L2W A;  3VF2 A;  3ZLJ A;  2HBJ A;  2A40 A;  1NBW A;  1K8K A;  1JL2 A;  3ZEU B;  4FO0 A;  3I56 N;  1NK7 A;  2FC0 A;  1TKX A;  1K8K B;  2DTU A;  1NGB A;  2QM1 A;  3ISN C;  2RF2 A;  2ZD1 A;  1EX4 A;  4JKB A;  4ELT A;  1GOA A;  2FSN A;  2WON A;  4CHY A;  4BRA A;  4CD1 A;  2O8B B;  3DLK A;  3EE8 A;  1EWR A;  3M8R A;  3LPU A;  4ZTJ A;  1NOZ A;  1IBL K;  4JKH A;  3G6E N;  3HI0 A;  1E4G T;  3MEG A;  3WNF A;  4EFH A;  5HRN A;  1Q86 O;  4LD0 A;  2P9S A;  4BR5 A;  4GY2 B;  1JCE A;  4I9L A;  4FM1 A;  3HOS A;  3QEP A;  4KI4 A;  4AIL C;  3D2F B;  1BIS A;  3AVN A;  1BCM A;  2RHK A;  4DUY K;  2HND A;  3VGK A;  4DLG A;  2ZWH A;  1XNR K;  3VTH A;  4WQ5 A;  2PFU A;  4HUF A;  4CFC A;  2WTU A;  4FWO A;  4CHZ A;  1U6Z A;  1C0T A;  1U49 A;  2HHW A;  4ELU A;  4KHW A;  3EKU A;  5FPE A;  4E1M A;  3P38 A;  1EXQ A;  4GVE A;  3AA4 A;  1SZ2 A;  1KLM A;  1RBV A;  5C15 A;  3WEE A;  4CJL A;  1NGE A;  2A3Z A;  2P9K B;  3V9Z A;  3WEE B;  3N4P A;  4DF8 A;  1IG9 A;  1L3V A;  4DSK A;  1OH8 A;  5GIO A;  3WNH A;  2O8C A;  3CCV N;  3QLH A;  1Q9Y A;  4O5B A;  4NYF A;  4CJ4 A;  4CHN A;  2D0A A;  4NLC A;  1VQM N;  3NVM A;  1VQP N;  5FRN A;  3OW2 M;  1VQL N;  4KB1 A;  2BUP A;  2VQF K;  2PY5 A;  3E9L A;  2VYP A;  2CGJ A;  2IVP A;  3CCL N;  2WUS A;  4FZX C;  1E3M A;  4DKW A;  4W5Q A;  4YOV A;  1Q81 O;  4NXN K;  4FXD A;  5AZI A;  4OJR A;  1JL1 A;  4H5V A;  4EP4 A;  4KI6 A;  3OHR A;  1BCO A;  4PKI A;  1NGI A;  5KRS A;  1SKW A;  3HVT A;  2QWP A;  2QWM A;  5AQN A;  1BO5 O;  1KVA A;  4JKG B;  2NRT A;  3OYH A;  5DM7 L;  4B3R K;  3PIO L;  2ATQ A;  3K9J A;  3DRS A;  4B9M A;  2JGU A;  3A5O C;  4AHU A;  2D5R A;  3LM9 A;  4EHU A;  4DU3 A;  5HRP A;  3E9O A;  2HNY A;  1NKB A;  3K5N A;  3E66 A;  3HL8 A;  1NK8 A;  4J2B A;  4F2S A;  3O5B A;  3P39 A;  3OY9 A;  4CZE A;  4CER A;  3QBX A;  2IVN A;  4YOW A;  4CF1 A;  3SCX A;  3AVK A;  4DTM A;  3DWL A;  1RDW X;  3F9M A;  1BQM A;  4A2A A;  4JD2 A;  1TL3 A;  3KK2 A;  1NK5 A;  3GBT A;  1QSL A;  4CHQ A;  1XUP O;  3OS0 A;  3H1Q A;  5F1X A;  1VSK A;  4XH1 A;  3WQU A;  4K8Z A;  4HWI A;  4JRQ A;  5BN9 A;  1VHX A;  4FK0 A;  4FWP A;  4Z4H A;  1C0F A;  1BU6 O;  4DV2 K;  4GKJ K;  2AA4 A;  3UIQ A;  3H1V X;  1WSF A;  4DV6 K;  1HNZ K;  2J4R A;  2ASM A;  4M45 A;  1D8Y A;  2HF4 A;  1QVF M;  4OX9 K;  1BIU A;  4FWM A;  1GLF O;  4BWJ A;  3KK3 A;  4L3Q A;  2E6L A;  1HKC A;  3F5T A;  4H0Y B;  1SS6 A;  1NGD A;  1X9S A;  2QXF A;  1M1K O;  4FJ8 A;  2P9N B;  4PKH A;  4GMJ B;  2D0O A;  1K8A O;  4X66 K;  2IGI A;  1HPM A;  3J8A A;  3O9U A;  4H03 B;  5J2Q A;  1QQM A;  3MN6 A;  2OAN A;  3ZT4 A;  4YY3 K;  3ULE A;  4WFA L;  5BR9 A;  4TSX A;  2GEL A;  5T7B A;  1TUY A;  1TUU A;  1R0A A;  4BE2 A;  1DTT A;  5FPD A;  2Q0U A;  3D2E A;  1I39 A;  2Y1I A;  4CZK A;  3WNG A;  3TSU A;  4CJW A;  4DQ8 A;  1P90 A;  2YHB A;  1REV A;  3AVA A;  2OPR A;  2HF3 A;  3C6H A;  4Z4I A;  4IZ9 A;  3NDK A;  4OPA A;  4JKD A;  4NCB A;  1YIT N;  4LH4 A;  3AY9 A;  4BGA A;  4QS9 A;  3L2Q A;  4DV1 K;  3T1A A;  4F4K A;  2HOE A;  2W6L A;  1LWE A;  2ASO A;  4LY7 A;  1ZBH A;  4B3O A;  4KTW A;  2XY5 A;  5KPR A;  3C0B A;  3D7E O;  4B3M K;  4HVJ A;  1ZXO A;  4KFB A;  3F9K A;  1MDU B;  1S5J A;  1BWF O;  5C25 A;  1OVQ A;  3TTF A;  2CH5 A;  2IOC A;  2FBY A;  2QTD A;  3HOT A;  1QZ5 A;  5AQX A;  2Z1G A;  1SL2 A;  2HHU A;  4JI6 K;  3AVL A;  4LH5 A;  5GIP A;  4CFA A;  4CZM A;  2NRR A;  2BDP A;  4OKJ A;  3CFO A;  3LPT A;  3PLA A;  2ZQB A;  3W0L A;  3DM2 A;  2YKM A;  2O8D B;  2FBT A;  4CGG A;  3QBW A;  3M5R A;  3RRH A;  1BA1 A;  1FKP A;  3VEV A;  2O4G A;  3CCR N;  3ENB A;  4FWK A;  4IO9 L;  4IKF A;  1LAW A;  1YVN A;  3TAE A;  4OLB A;  1YJN N;  2ZGZ A;  2XY6 A;  5B8H A;  2F9T A;  4BC3 A;  2FLO A;  3ZYY X;  3VA3 A;  3PV8 A;  1WLJ A;  4BG8 A;  1BHL A;  1UOC A;  1ZBI A;  5CR4 A;  4PQU A;  3FFK B;  2FSJ A;  3OYE A;  3TAP A;  2V7Z A;  3HYF A;  5JVH L;  4FJH A;  3H46 O;  2Z1I A;  2BE2 A;  2KHO A;  4O8K A;  1A5X A;  3DMJ A;  3AVH A;  4CF2 A;  5C0Y A;  1X3M A;  3MXJ A;  1Q82 O;  2UUB K;  4B1U B;  1BA0 A;  1C1C A;  1Q9X A;  3BZC A;  4JLH A;  3KLI A;  4U67 L;  5F0X A;  4FK2 A;  1ESV A;  4CGH A;  1DEJ A;  3VQ5 A;  5C42 A;  3V9S A;  2HHT A;  1A5W A;  2O4I A;  4YNQ A;  3V81 A;  1X1P A;  1HUX A;  4Z4F A;  4EIA A;  1JLB A;  3K2P A;  5CYM A;  4ZTF A;  3V1Q A;  5I3U A;  4CGJ A;  4FLX A;  2BAN A;  2KQ2 A;  3HXM A;  3MN7 A;  3OYA A;  1MU2 A;  2PAV A;  5C10 A;  4XH4 A;  1Q8I A;  1V4T A;  1IBM K;  3ZSO A;  4FW2 A;  5I9E B;  3FFI A;  3ZT0 A;  1C0U A;  4ID5 A;  4DS4 A;  5KQ8 A;  2IAJ A;  1N5Y A;  3D2E B;  3HPO A;  3NH1 A;  4DSF A;  2EWS A;  2UU9 K;  2G8F A;  4E7H A;  2HB5 A;  3L2U A;  3VER A;  2NUB A;  4KHU A;  5C2F A;  2P9U A;  3CJ1 A;  2D0P A;  4YFU A;  2BTF A;  3O08 A;  3WUH A;  1HNI A;  3MDQ A;  4NCA A;  2GUP A;  4NXM K;  4RWT A;  3NCI A;  1UWB A;  2ZM6 K;  3VQB A;  3ZX2 A;  3NGZ A;  4U7B A;  1OH6 A;  3OYJ A;  3FGU A;  4B8A B;  3H3O B;  3T1H K;  3FZL A;  2YX6 A;  4FW1 A;  3THW A;  3J7Z O;  1RIL A;  2BGG A;  2WBN A;  3KLF A;  4YOU A;  2KZM A;  2XO7 A;  3CXC M;  5AQF A;  4QS8 A;  5FPN A;  1HPZ A;  4KHN A;  3LP3 A;  3RTV A;  4DV7 K;  4BR9 A;  1CZB A;  5M1N A;  2YNF A;  2OCE A;  1RDC A;  3LP1 A;  4E7L A;  1XNQ K;  4CZG A;  2HHX A;  2VQE K;  3BP8 A;  1KVC A;  1S1V A;  4EP5 A;  4AHT A;  1RT5 A;  3SI6 A;  2GUI A;  1X9M A;  4LSN A;  3QIP A;  4LF4 K;  4C8N A;  3VTI A;  4KAZ A;  1C0M A;  4B9T A;  4OPH A;  4DTU A;  4X64 K;  1YT3 A;  1WOQ A;  1QS4 A;  2I5J A;  5AQR A;  2WFB A;  1U48 A;  1NU0 A;  3C7N B;  3J81 O;  5KGX A;  3CCU N;  3QFP A;  1BOT O;  3OYL A;  3THX A;  1LW0 A;  3LP2 A;  4IOA L;  3AA2 A;  4CF8 A;  2W42 A;  1HYV A;  3FR0 A;  2OTJ N;  1Z25 A;  2ZJR L;  3OS2 A;  5AQZ A;  3EY1 A;  4N76 A;  1CLQ A;  1SQK A;  3SMP A;  2VG5 A;  4AM7 A;  3T1Y K;  2E2N A;  1UAX A;  4BRF A;  1VRT A;  4GKK K;  2W41 A;  4DUZ K;  4CHP A;  3ULD A;  4FJJ A;  5CY4 A;  4RW7 A;  5ADX A;  4DR7 K;  2UXC K;  2G8U A;  1KSP A;  4ISE A;  5LL6 Z;  3J7A P;  3VF6 A;  1B9F A;  4JKC A;  3ZET A;  3NMU A;  3C6A A;  2V52 B;  4CEF A;  5E84 A;  1NK6 A;  5KQD A;  4RTF D;  2ETJ A;  2HHQ A;  2HHV A;  3CCQ N;  3ZSZ A;  4LF5 K;  2VGM A;  3O9S A;  1LAV A;  4NB4 A;  2YJE A;  1ZBL A;  4FLW A;  2YJF A;  2VWB A;  4FJ9 A;  1QTM A;  2UXB K;  4FLZ A;  5AQL A;  3P5J A;  5BR8 K;  5KPZ A;  2IS3 A;  4B1Y B;  4DMN A;  5IWA K;  5AJ3 K;  1QVG M;  4AQY K;  1SKS A;  4LFC K;  4UQG A;  1L3U A;  1EP4 A;  3AAR A;  4E3S A;  4FJX A;  4BWM A;  4QOZ B;  3KKS A;  3ZT3 A;  1RTH A;  2E4L A;  5EVZ A;  5GAE P;  5C24 A;  1KAX A;  3MWP A;  2YNI A;  1NWK A;  4FWL A;  3UE5 A;  3KLH A;  5HRO A;  5BPN A;  2AJQ A;  1RTD A;  4I6M B;  5DK5 A;  2BH1 A;  2Q3S A;  4A57 A;  4LFA K;  3AA5 X;  3OYC A;  2P9S B;  3NF7 A;  4W5T A;  1YI2 N;  4BC5 A;  3MCP A;  4BRO A;  2UXD K;  3VEZ A;  1N34 K;  4PL7 A;  3GG4 A;  3RMB A;  4N5S A;  4BVO A;  3C6U A;  1Q7Y O;  2Q97 A;  4CES A;  4H0T B;  4F3T A;  2NRW A;  4CEO A;  3L4Q A;  2G8W A;  4DFJ A;  4FWN A;  3KWI A;  4BRE A;  3VGM A;  4BDY A;  5LMN K;  4UY8 O;  1WB9 A;  3ASM A;  3EN9 A;  3HSC A;  4E1J A;  3BUZ B;  3CPW M;  3T19 A;  4CJP A;  3AVI A;  1MWM A;  2AP1 A;  1NJI O;  2EHG A;  3L8B A;  3BF1 A;  5HL7 L;  1VSI A;  4V19 S;  1WSH A;  4E89 A;  3RRG A;  4FJ5 A;  2HVH A;  4WQ4 A;  4JK9 A;  3NFA A;  4DS5 A;  1S1W A;  2O8C B;  3BZK A;  1CZ9 A;  1U47 A;  4IDK A;  4IOX A;  4FK4 A;  3KKR A;  3AVB A;  3IFR A;  4M41 A;  1QQC A;  1WSI A;  4M63 C;  4C8M A;  1VSD A;  3E9P A;  5CHI A;  1VAZ A;  1ITG A;  4I2Q A;  3DLB A;  4G9Z A;  1ZC6 A;  2GEM A;  3ZSW A;  4DTO A;  4B3S K;  3GOI A;  1MWK A;  1NLV A;  1RNH A;  4CEZ A;  1VQ4 N;  4FWR A;  3OJU A;  3O6W A;  2KW4 A;  3RMA A;  2H3G X;  2E2P A;  4BRN A;  4MQ3 A;  1IKW A;  4FJL A;  4DTJ A;  5JVG L;  3DLG A;  4JS4 A;  4JI1 K;  4K42 A;  5A2Q O;  4KBO A;  3UKR B;  1RFQ A;  3VQD A;  4Z94 A;  3D45 A;  3NVK A;  1NJX A;  4CI6 A;  5FLX O;  1VSL A;  1VSH A;  3O3G A;  3GL1 A;  3AO1 A;  3MEE A;  2RE2 A;  4OKK A;  2Y1J A;  5M1K A;  4M3Z A;  4J2E A;  1NMD A;  3TAF A;  3M8Q A;  2P9P A;  2JLE A;  3QDK A;  3AA3 A;  1RDB A;  2X78 A;  1ATN A;  2O8F B;  4JI3 K;  2OYQ A;  4WQ5 C;  4EHT A;  1S1X A;  4E7I A;  5DM6 L;  3VQ7 A;  1NG9 A;  1WNS A;  3RR8 A;  3KD1 E;  3LZJ A;  1GLL O;  4BRH A;  3R8E A;  4IFV A;  4K43 A;  4CE9 A;  3EYZ A;  4JKG A;  2JWL A;  4W5N A;  1JCF A;  3O80 A;  2NRV A;  2A42 A;  4FJ7 A;  4B9S A;  2O8F A;  1SAZ A;  1KTQ A;  1T05 A;  3TAB A;  4KO0 A;  3L3U A;  4H0X B;  4I2P A;  3MCA B;  1HKB A;  3FZK A;  2WOM A;  4DG1 A;  5AQU A;  4EZ9 A;  1H1V A;  3WT0 A;  3FZH A;  3I8D A;  1UA0 A;  4FM2 A;  4O8U A;  2E6M A;  2DPN A;  4O44 A;  3LAL A;  2UUC K;  2RN2 A;  3LAK A;  4H0O A;  3OYB A;  4A5B A;  4LF8 K;  1RT2 A;  3HPG A;  3IG1 A;  5J1E A;  3BEX A;  1SL0 A;  2OPQ A;  5JS1 A;  3VEW A;  3SUP A;  3ID8 A;  5LJW A;  4H8K A;  2KLA A;  3ZSV A;  2HBK A;  3LM2 A;  1ZBU A;  2CGL A;  2E2O A;  3NHG A;  1IG8 A;  3PY8 A;  3ENH A;  1HQU A;  2F96 A;  4BG9 A;  1NKC A;  3PO5 A;  3L0Q A;  1ATS A;  3C65 A;  3WNE A;  1J53 A;  2XY8 A;  4YDU A;  1OH5 A;  1HQE A;  2YV0 X;  1CXQ A;  3EKS A;  1VQ7 N;  1HMV A;  1L3T A;  1WSE A;  5E41 A;  1KRP A;  1U2V B;  2XY7 A;  3PX0 A;  1C1B A;  3R3L A;  4M42 A;  2E2Q A;  1YVU A;  1NGH A;  1E4F T;  1QE1 A;  5HOO A;  2D0B A;  2VWK A;  3S41 A;  4M3W A;  1KAY A;  3SPY A;  1DLO A;  4WE1 A;  1RT4 A;  3CM6 A;  3WXI A;  5AZI B;  4OGE A;  4JRP A;  1L3S A;  3L4I A;  4YDU C;  1NJW A;  3PUF A;  4XEI A;  5JS2 A;  1F21 A;  4B8C A;  4Z4G A;  4MFB A;  4A59 A;  3JAM O;  4Z4C A;  5J2M A;  3ZSY A;  3QML A;  2ZE2 A;  3B6O A;  5HRR A;  2P5G A;  3TAM A;  3NH2 A;  1DTQ A;  4FZZ A;  1W7A A;  2F8S A;  3BDP A;  2IDO A;  5EOY A;  3AAQ A;  4K0K K;  3I8B A;  3AVJ A;  4DU1 A;  4EAH D;  2O8E A;  3FZM A;  3HTV A;  1N6Q A;  1N36 K;  3MX2 A;  2FBV A;  3MK6 A;  1NNE A;  3JS6 A;  4DV0 K;  4QS7 A;  4ICL A;  2DFF A;  3M3Z A;  1VSE A;  4IFY A;  1HX1 A;  1VSF A;  4FJM A;  4CFD A;  1TGO A;  3KK7 A;  3DAW A;  4A2B A;  4KV8 A;  2Q0R A;  2Q36 A;  4GW6 A;  1DKG D;  1TK8 A;  5AQY A;  3RSE B;  2Q1N A;  5AQP A;  3RR7 A;  1C0G A;  3FE1 A;  3SK3 A;  4B08 A;  4BDZ A;  3NGY A;  3RSE A;  4C8O A;  4CEQ A;  3RMD A;  4AHC A;  3MN5 A;  3LP0 A;  3MMV A;  4CJ5 A;  2B6A A;  5LY3 A;  1KD1 O;  3VGL A;  3K58 A;  4MDA A;  4E7K A;  2P5O A;  1GLE G;  4CJ7 A;  3WXL A;  2DFH A;  3V9X A;  4CK2 A;  5JLH A;  4HTU A;  3CPE A;  1NK4 A;  1TVR A;  3CF5 L;  4MO5 A;  2FSK A;  3LDN A;  4ILH A;  1TAU A;  3OYD A;  2YHW A;  2B5J A;  1TL1 A;  1YUW A;  3AVC A;  1ILY A;  4DQS A;  3LDL A;  2ITG A;  4DB3 A;  3OYK A;  1RT6 A;  4KB0 A;  5J2P A;  4CEB A;  2E1Y A;  3P83 D;  1ASW A;  2HHH K;  4DQQ A;  3CYM A;  4O0J A;  2CH6 A;  1O1W A;  3DLL L;  1N33 K;  4JI5 K;  4IXC A;  4CGI A;  3AVG A;  3CFP A;  3CC7 N;  3SQ0 A;  1KAZ A;  5AQO A;  2IVO A;  4IBN A;  4CZF A;  2NNW A;  3CMA N;  1SL1 A;  3THW B;  1CXU A;  4BQL A;  3K5O A;  4HUE A;  4BQZ A;  1QSY A;  4LF6 K;  4BR2 A;  2DFE A;  3LWM A;  1S3X A;  2NRH A;  3VF4 A;  3K0S A;  1U45 A;  4Y1C A;  3QIO A;  2GX9 A;  4FLU A;  2XRI A;  1OKJ A;  2JWK A;  5KGW A;  2QKB A;  3PX4 A;  2FF6 A;  1G15 A;  3U9Z A;  4H5R A;  4DHY A;  2QA4 N;  3P1G A;  1VQO N;  1JXB A;  4MO4 A;  3THV A;  4CZJ A;  4IFE A;  4DFM A;  3HM8 A;  4OVL A;  1VQK N;  3SUO A;  3K5M A;  4E7J A;  1V4S A;  2B4J A;  2CGK A;  4CBX A;  4I7F A;  3CJC A;  4PWD A;  1JLC A;  1T44 A;  1VK0 A;  4KHS A;  3MX5 A;  5H1S Q;  3BY5 A;  4BAC A;  2GWJ A;  4FJN A;  1TKD A;  2VCP A;  2RPI A;  3HP6 A;  2E20 A;  3HRG A;  5KI6 A;  3HJF A;  1IH7 A;  4IJN A;  4B1V A;  4C8L A;  4J2A A;  4B1Z A;  1EO1 A;  4LFB K;  1TYQ A;  4H0P A;  4Q0B A;  3QNO A;  3VQQ A;  4HUG A;  3ZCM A;  1JKH A;  1OH7 A;  3WXM B;  2HMI A;  5TKY A;  1ZBS A;  5I42 A;  1JJ2 M;  1B92 A;  4JAX A;  1J6Z A;  4CCH A;  3AO2 A;  1D9D A;  3ZSR A;  4IWV A;  3A0I X;  4A62 A;  4WFB L;  3TWH A;  3MXM A;  1WSG A;  5IT9 O;  4F2R A;  4CK1 A;  4JKF A;  2A6A A;  3KIO A;  3OTO K;  1QHT A;  3AVF A;  3THX B;  1GLJ O;  1QQO A;  3E01 A;  3SJH A;  2X74 A;  4N41 A;  2FF3 B;  3QEW A;  3AO4 A;  1NGJ A;  4BC2 A;  3VN5 A;  3KHY A;  4H5W A;  5M1Q A;  1GLB G;  1VRU A;  2P9L B;  5J2N A;  3SLC A;  4J8F A;  2LSN A;  1LW2 A;  3LL3 A;  3SZ2 A;  4EZ6 A;  3CI5 A;  3TAR A;  3B6P A;  3ZT2 A;  4DR1 K;  4JI7 K;  2QKK A;  1VQ5 N;  4ILJ A;  3CJ7 A;  2F8T A;  4FVM A;  3VQ9 A;  4B9L A;  1ATR A;  5AQW A;  4AH9 A;  3DI6 A;  3T69 A;  1BI4 B;  3P4I A;  3D0P A;  1S9G A;  3JYT A;  1JLE A;  4BRP A;  4GV9 A;  4HHT A;  3DRP A;  3A8Y A;  3OYI A;  3CQY A;  2E8A A;  4AHR A;  3ID6 A;  4PL8 A;  3DOL A;  3SV4 A;  4A61 A;  3MXI A;  4CJU A;  4IDH A;  4CZH A;  5C2D A;  3AO5 A;  3VQE A;  1L5U A;  3IDH A;  3A5L C;  3I0S A;  4DTS A;  3P31 A;  1FKO A;  3PSF A;  1JLG A;  4BE1 A;  3WQT A;  3KWG A;  1IO2 A;  4C1N I;  2WC9 A;  3PO4 A;  3A5N C;  3SQ2 A;  2YHA A;  3WXK A;  1S22 A;  4RW9 A;  4CF0 A;  4N56 A;  4BR4 A;  4JHD B;  3GDQ A;  3O9R A;  1N8R O;  4QCL A;  3ZEU A;  1K6Y A;  1W2B M;  4Y0W A;  3K5L A;  3QEV A;  4F3O A;  4CD3 A;  3CJA A;  4CK3 A;  4DV3 K;  1I94 K;  5ADX H;  1GLD G;  3QB0 A;  4FJG A;  3VEY A;  1RBT A;  1BL3 A;  4IEE A;  3LDS A;  4CED A;  4RCH A;  4BC4 A;  1HR0 K;  1XQS C;  3RWU A;  3A2F A;  3M8P A;  3OYN A;  3CHW A;  4BRG A;  2F7T A;  3QNN A;  5FRM A;  1X9J A;  4PHT X;  5HRS A;  5M1O A;  1BDG A;  3DYA A;  4JI0 K;  4KRE A;  4WYB A;  1WUA A;  1S1U A;  3V9U A;  3VQ8 A;  4J2D A;  3VPZ A;  1NGA A;  1RT3 A;  4CZL A;  2OPS A;  3LDO A;  2P51 A;  3TAG A;  3VQ6 A;  1I3A A;  1QQN A;  1WBD A;  2QW9 A;  5KPT A;  4LF9 K;  4KRF A;  5AFU H;  2Q31 A;  4FJK A;  2R7Y A;  4H4M A;  1GOB A;  3KVG A;  1IKV A;  3C7N A;  3T7Z A;  1RBU A;  2V51 B;  2OTL N; 
#chains in the Genus database with same CATH homology
 4K0K K;  2UU9 K;  4DV4 K;  1FJG K;  4DR7 K;  2UXC K;  5LL6 Z;  3J7A P;  4JI6 K;  1N36 K;  4LF7 K;  4X62 K;  3J80 O;  4DV0 K;  2UUC K;  4NXM K;  4JV5 K;  2ZM6 K;  4LF8 K;  4LF5 K;  3T1H K;  4CVN E;  4KHP K;  4DR2 K;  4DV2 K;  4GKJ K;  5LMU K;  4YHH K;  4DV6 K;  1HNZ K;  4B3S K;  4X65 K;  4DR5 K;  2UXB K;  4OX9 K;  5BR8 K;  1I94 K;  2VQF K;  4DV3 K;  1HNW K;  4DV7 K;  5IWA K;  5AJ3 K;  4JI1 K;  4AQY K;  5A2Q O;  4LFC K;  4DV5 K;  4LFB K;  4X66 K;  2F4V K;  1XNQ K;  5FLX O;  4NXN K;  2VQE K;  1HR0 K;  4YY3 K;  4JYA K;  2UUB K;  4LF4 K;  4JI4 K;  4LFA K;  5IT9 O;  4B3T K;  1HNX K;  4DR4 K;  4JI3 K;  4B3R K;  4DR3 K;  3OTO K;  4JI2 K;  4X64 K;  2HHH K;  2UXD K;  4JI8 K;  1N34 K;  4JI0 K;  1N32 K;  1N33 K;  3J81 O;  4JI5 K;  3J7Y P;  1IBL K;  4DV1 K;  5LMN K;  1J5E K;  4DR1 K;  4LF9 K;  4JI7 K;  3JAM O;  1IBK K;  4DUY K;  4DR6 K;  1IBM K;  4B3M K;  1XNR K;  4LF6 K;  1XMQ K;  2E5L K;  3T1Y K;  1XMO K;  4CW7 B;  2UUA K;  4GKK K;  4V19 S;  4DUZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...