5HRNA

Hiv integrase catalytic domain containing f185k mutation complexed with gsk0002
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
152
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
total genus 54
structure length 148
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrnA00
5CYMA 3SV4A 1RT5A 2WONA 3RTVA 4Y1CA 3NFAA 1J54A 3AA3A 4NCAA 1NKEA 1LW0A 2YKNA 5HRRA 4EZ9A 4RW6A 1S9EA 2DFFA 4FM1A 4G1QA 1TK5A 4ZTFA 4TSXA 4CGDA 3JYTA 1MU2A 1T03A 2QKKA 1JLAA 4DSKA 5KTQA 4CK1A 1JXEA 2WOMA 4KAZA 3TARA 4DTSA 2X78A 4C8NA 3S3MA 3HJFA 2HHVA 1RT4A 3PX6A 3VQ6A 4BE1A 4KTWA 3AVLA 3O3FA 3K5LA 2OPSA 4ID5A 1WAJA 4RG8A 3B6OA 3JSMA 1NK5A 1HNVA 4KO0A 1VSDA 3F73A 1Q8IA 2Y1JA 2HNYA 3O4NA 4LD0A 4O55A 3L2UA 3SV3A 1X9SA 4QOZB 2HHQA 1NK0A 3LP2A 1DTQA 4FLXA 1EP4A 5JS1A 1VSEA 4CECA 3KKRA 3K57A 2GV9A 3NF6A 4BDYA 4CEFA 3ZT1A 2X6SA 3ZT0A 4B08A 1NJXA 3V9XA 4PA1A 4DTXA 4KHYA 4BWMA 1C1BA 1JLFA 3AO1A 4JS5A 4FLZA 4KKOA 1RT6A 4DFMA 3WNGA 3QERA 3AVFA 3M8PA 4E1MA 3SQ1A 1SKSA 3PV8A 4DMNA 3BDPA 2PYJA 1HJRA 3DYAA 2F8TA 3QLHA 1X9MA 2HB5A 4KTQA 2DFEA 4DQPA 4I9QA 4B9VA 3VN5A 2VG7A 4CEZA 4CF9A 3AVKA 3K5OA 3OVNA 1VSLA 1KRPA 1QHTA 1L3VA 2PYLA 1IKYA 1LW2A 3SUPA 4PUOA 4Z4EA 3NBPA 1QSSA 4CJTA 3NE6A 4OKKA 3LWMA 4FJJA 1TKZA 5HLFA 2KFZA 4DF8A 2HVIA 4RW7A 4CJFA 3U6FA 1BQNA 4ZTJA 2F8SA 2YV0X 2FC0A 3V9SA 1FKPA 5KGWA 1RT7A 2HHUA 4MFBA 4BDZA 2D5RA 3TAFA 3UIQA 1VSIA 1N6QA 1CXQA 2DFHA 3HL8A 4J2EA 4DQQA 3MXJA 4HHTA 4BDPA 5HRNA 3M8SA 4CK2A 2O4GA 3CM6A 3O3GA 3L3UA 1SL2A 4N41A 4KHWA 3WNFA 4CGGA 4E1NA 4Q5VA 3OYCA 3AVGA 1Q9XA 4CF2A 5J2PA 3KLFA 1NK8A 1S5JA 1N5YA 1KFSA 2OA8A 1HYVA 4K8XA 1TVRA 3IRXA 2ETJA 4HCCA 4I2QA 3AO3A 1JL1A 1WNSA 4LH5A 4DSJA 2HNDA 5J1EA 3LAMA 1NK9A 2IC3A 3AVAA 3LDSA 4W5NA 2VG5A 2X74A 3MECA 4F3OA 2ITGA 1BI4B 4K8ZA 4R5PA 4Y1DA 3RWUA 4IFVA 3V1RA 1VSMA 1WN7A 1LWFA 2XY7A 3DOKA 4FJGA 4DTJA 4M3TA 4CEQA 1KVBA 1JLGA 4IG3A 5K14A 1NKBA 1VSJA 3MAQA 3V1QA 2OZSA 2QK9A 4E3SA 2O4IA 3EY1A 1RT3A 3MEGA 1IG9A 2BE2A 4FM0A 4LY7A 4KB1A 3PY8A 1REVA 4OGEA 5I42A 1T8EA 3VQCA 3MEEA 3LPUA 4CJWA 3I0SA 3LPTA 4W5OA 3EYZA 3K59A 3HPGA 1WSFA 5CZ1A 3NAEA 2AJQA 2XO7A 2YNIA 4E7IA 1X9WA 3RR7A 1ASUA 1Y97A 4ICLA 4CHPA 3OJSA 4FJ8A 4CJLA 3V9UA 2OPRA 4CF8A 4IDKA 4FCYA 3PX0A 4DU3A 4AHTA 2YNGA 3DRPA 1U04A 1RBSA 3V1OA 1TK8A 3KIOA 4DF4A 2JLEA 4FJ7A 2XHBA 1RT2A 3HXMA 1BGXT 3ZT3A 3LAKA 1S1WA 4CJEA 2RKIA 5C42A 4BE0A 4FLWA 1KFDA 4E89A 1ZBHA 3OYFA 1S1TA 2B5JA 3VQQA 4W5TA 3LWLA 1RTDA 3PO4A 1HNIA 4HVJA 1RBUA 4DTNA 3C95A 3NHGA 4QAGA 4IKFA 1ZYQA 2G8VA 2B4JA 3KLHA 1TGOA 4OLAA 1U48A 1NJZA 2FBVA 3AVNA 3L2WA 4KHSA 2G8FA 1JKHA 3OYBA 4HUEA 4E0DA 4Q0BA 1BIUA 4Z4CA 4W5RA 4CJ5A 3ULDA 3KLIA 3ZSOA 3OJUA 4C8OA 1FKOA 1S1VA 4I2PA 3LZIA 3AA5X 2EHGA 3NGZA 1BL3A 4HCBA 4KRFA 3HK2A 1VSFA 3HYFA 2VWKA 3NF8A 3VQAA 2IGIA 4DLGA 4FLYA 3PO5A 4FJHA 1C0TA 4FZXC 1ASWA 1BCMA 2YHAA 5C25A 3AA4A 2ZQBA 4FJKA 2E4LA 2BDPA 4CEEA 3DLRA 1TAUA 3QEWA 4CFBA 3TWHA 4Z0UA 4CE9A 3T3FA 1C0UA 2D0BA 1GOCA 2LSNA 1KVAA 3QIPA 1QE1A 4DU4A 4NYNA 3CQ8A 1B92A 4JRQA 2P1JA 1D9DA 4B9SA 1R0AA 1ITGA 4B9TA 3MXMA 1HYSA 2HHWA 4H4MA 5CZ2A 1Z25A 2KTQA 3DOLA 4PY5A 1TK0A 4N56A 1D9FA 3QEXA 4B9MA 4FK4A 4CHOA 3DRSA 1KTQA 5JS2A 4AH9A 1WLJA 1XWLA 3HP9A 4NCGA 3RR8A 1NKCA 1S6QA 4N47A 4N5SA 4C8KA 4KHQA 4M3XA 1D5AA 2Z1GA 4E7HA 3SQ2A 4DSFA 1CZ9A 3DLEA 1D8YA 1SV5A 4LSNA 4JLHA 1YT3A 4KFBA 1HQUA 3E01A 2DY4A 4Z4FA 1YTAA 1S6PA 3DRRA 1LAWA 1U45A 1L3UA 5KRTA 3OYIA 4DTUA 1QQCA 2Z1JA 4KTZA 2B6AA 1RNHA 1IH7A 1U47A 1TL1A 1DTTA 5J2NA 3PX4A 1W9HA 3ZSYA 4FK2A 1VSHA 4CERA 4CGJA 3AVCA 3QEPA 1XHXA 3P1GA 3VQ8A 1YTUA 4DG1A 4OKEA 2FBYA 4PQUA 1BHLA 4M42A 3WNHA 3CM5A 3LALA 4I9LA 4DWIA 3K2PA 1NOYA 3NH2A 3QEVA 1UOCA 4DSLA 4Z4IA 5CYQA 1HPZA 1U49A 4CJ3A 3TI0A 4B8AB 3NGYA 4CHNA 4E7LA 4FJ5A 1HRHA 4Z4HA 4DU1A 4I7FA 4JRPA 4FYDA 4EZ6A 3A2FA 3VA0A 4M3WA 3ASMA 3SZ2A 3AO5A 3V6DA 1RDCA 2GUIA 3OYDA 2RPIA 4RW4A 4AHVA 4KI6A 1L5UA 1ZBIA 3P5JA 2QXFA 4IFYA 4NCBA 4M41A 4OLBA 1Z26A 4LSLA 4PWDA 2VG6A 4CIFA 2OYQA 1RBRA 1WSEA 1ZBFA 4DFKA 4CGIA 3RRGA 3AA2A 2HW3A 2E6LA 1RBTA 4CFDA 4F4KA 3TR8A 3ZSQA 4CJ4A 1I3AA 3OYNA 1IKXA 1JLCA 2X6NA 3QESA 3MXIA 5J2QA 3SNNA 3L2RA 3OS2A 3TAMA 1CXUA 1RBVA 2YNHA 4CK3A 3QNOA 3VQ4A 1U4BA 4DQRA 4M3UA 1IKWA 3HVTA 2XY5A 1XC9A 1RT1A 2IS3A 3HP6A 4DQSA 4E7JA 3IAYA 3KD5E 1TV6A 4FM2A 4E7KA 3TAEA 3LP1A 3EZ5A 2ZE2A 2YKMA 3LP3A 4IG0A 3VQPA 4DTOA 2OPPA 4CCHA 4BACA 4CJVA 4F3TA 1JLQA 1S1UA 3KKSA 1IKVA 3O3HA 1RDDA 3AO2A 3VA3A 3CYMA 2Z1HA 3ZSRA 5HRPA 1T7PA 1KLMA 4B3OA 1J9AA 4FZZA 2HHXA 4ELTA 3I8DA 1KCFA 3SPYA 4DQIA 3DI6A 3ZSVA 4OPKA 3RMBA 2KW4A 3WNEA 3S9HA 4DTMA 4FW1A 5CY4A 2EX3A 3U3YA 3QEIA 4O44A 3VQDA 3SJJA 4RW8A 3SPZA 2G8UA 1JL2A 1LWEA 1SL0A 2G8KA 1ZBLA 1T05A 2VWJA 4B9NA 4CEBA 4CF0A 4OJRA 1EXQA 4OPJA 4KPYA 4QCLA 1C1AA 4WE1A 2GBZA 3C6UA 3NF7A 4CHQA 4MQ3A 3LZJA 1VK0A 1RILA 3LP0A 3VQEA 4F8RA 3KK3A 5SZTA 2Q3SA 1W0HA 2G8HA 4KHNA 4DSIA 2BANA 1DLOA 3OYKA 1XI1A 1C0MA 3HPOA 1LV5A 3SUQA 1RTHA 1Q9YA 1HYZA 4M3ZA 1K6YA 1J53A 3IG1A 4FK0A 3VQBA 1UAXA 3HM9A 2P5GA 4CEDA 4CJKA 3D0PA 4FLVA 4B9UA 1S9GA 2A1RA 4OVLA 3V9ZA 4CHYA 1RDBA 1X1PA 3OYGA 5D3GA 5FRNA 1GOBA 3F9KA 2G8IA 5HRSA 3KD1E 5HP1A 4CJQA 3SQ4A 3ITHA 1VSKA 1TKXA 1B9FA 2XY8A 3KLGA 4FJIA 3M8RA 4DLEA 1WSGA 2QKBA 4DTRA 2HVHA 1ASVA 1SUQA 3U3GA 4ID1A 3S3OA 3BGRA 3D45A 2HMIA 5KGXA 2G8WA 1UA1A 1TKDA 2HHTA 4HUFA 3P83D 4FLUA 5C24A 1QS4A 3K5NA 3TAPA 2Y1IA 1S1XA 4CHZA 1G15A 2ATQA 2XY6A 3KJVA 4KREA 2A1SA 4DS4A 1TKTA 1WSHA 2HNZA 5KI6A 4CEAA 3DLGA 3ZSWA 4ZHRA 3OS0A 1L3TA 5FRMA 3H08A 4AHRA 1EX4A 4FJNA 4FJ9A 5HBMA 3QETA 1QSYA 1B9DA 1RCHA 3AVBA 4Z4GA 1GOAA 2OZMA 1WSIA 3KK1A 2P5OA 4J2BA 1JLEA 3ZSZA 1RTJA 1A5WA 2IDOA 4CGFA 3SQ0A 1CLQA 3B6PA 1BQMA 3VQ5A 3O4QA 2PZSA 2HHSA 3CFPA 4J2DA 2FBTA 3G0ZA 1A5VA 2IAJA 3AVHA 3TAGA 4AHCA 4YNQA 4CJRA 1L3SA 4ELUA 3K58A 4O0JA 1NK6A 1A5XA 1WAFA 1BIZA 1JXBA 4CFAA 3TANA 3RMAA 1UWBA 2IOCA 1KVCA 3DM2A 5E41A 1SKRA 5KRSA 4HTUA 4F2RA 4H4OA 2RF2A 3AVIA 3C94A 5EU7A 4IBNA 3OS1A 4J2AA 3HVRA 1NK4A 4JS4A 3L3VA 2XRIA 3VQ9A 4C8LA 1VRTA 4CFCA 1KSPA 1EKEA 2DTUA 3HSTB 4CJSA 4GMJB 3ZCMA 3SI6A 4GW6A 4DFJA 3TABA 3KTQA 1HQEA 1ZBUA 3CG7A 3OYHA 1BI4A 4CF1A 1F21A 1RTIA 3NGIA 3M8QA 4EP5A 3NH0A 3NCIA 5J2MA 4M45A 1NJWA 1KLNA 1NOZA 3DLHA 4FJXA 4B8CA 3V9WA 1O1WA 3MEDA 1IO2A 4O0IA 4DTPA 2D0AA 1SL1A 4CEOA 4M3YA 3ALYA 4O4GA 4FVMA 1LWCA 2E6MA 1TL3A 5T7BA 2R7YA 5SWMA 3HO1A 3NF9A 3HPHA 4C8MA 4FLTA 1SKWA 4CIGA 5I3UA 2JGUA 4XIUA 3ISNC 3LANA 3ZSXA 1C1CA 3G10A 1QSLA 4O5BA 4M3RA 1HMVA 1VRUA 4LH4A 4DS5A 4BWJA 3RMDA 3T1AA 3SUOA 3QINA 4DSEA 2F96A 3I0RA 3QO9A 5FDLA 4F2SA 5FROA 2I5JA 4E19A 3DMJA 1FK9A 2KZZA 3C6TA 1LAVA 4HUGA 4DFPA 4UQGA 4YFUA 4OGCA 3OYMA 3KK2A 1NK7A 4KHUA 4KV8A 3RRHA 3T19A 4NYFA 2YHBA 3OYJA 3L2QA 4FJLA 3OY9A 3SCXA 1NJYA 4CJPA 2KFNA 5DMRA 4AHSA 3S3NA 2ZD1A 1C6VA 3CFRA 1WSJA 3NDKA 4RW9A 1CZBA 1EETA 4AHUA 3DLBA 4FW2A 3VQ7A 2NUBA 3CFOA 4EP4A 4B9LA 1QTMA 3OYEA 3DLKA 3QIOA 4L8RB 4ELVA 3K5MA 4FXDA 3SUNA 3OYAA 4H8KA 1RDAA 2W42A 1UA0A 3AVJA 3L8BA 1TAQA 3PUFA 2KQ2A 3AO4A 4KI4A 4N76A 3RMCA 1BISA 3AV9A 5HROA 3NH1A 1BCOA 1YVUA 4CESA 2PY5A 4CIEA 3HT3A 3TAQA 1XHZA 4GVMA 3FFIA 3THVA 3OYLA 1FXXA 2D0CA 4KB0A 3AVMA 2YNFA 4FJMA 4AILC 2BGGA 4CJUA 2RN2A 3ZT4A 2OPQA 2FBXA 3ZT2A 3SYZA 1I39A 3V4IA 4BE2A 4CGHA 1JLBA 4W5QA 3IS9A 3L2VA 2KZMA 2Z1IA 3QNNA 2P51A 3V81A 1J5OA 4OKJA 3KLEA 5DK5A 4FZYA
chains in the Genus database with same CATH superfamily
3VEWA 3WXLA 3SV4A 2WONA 3RTVA 3GG4A 4IEIA 4JEPA 4BRAA 2NRHA 2YKNA 3WT0A 4DR7K 1S9EA 4FM1A 3DLLL 4X66K 4G1QA 3OW2M 2WBNA 1T03A 5KTQA 1S72N 1H1VA 4H5TA 3TARA 1RT4A 3PX6A 3D2EB 4BE1A 3K5LA 3VTHA 4JKAA 4AF1A 3F73A 4KH4A 2Y1JA 3O4NA 4B1UB 3L2UA 3SV3A 3LP2A 1Z05A 1EP4A 4WQ4A 1NGJA 1VSEA 2AP1A 3K57A 3NF6A 1YJNN 2X6SA 4B08A 4PA1A 4DTXA 4BWMA 1C1BA 1X3NA 3AO1A 3JS6A 4DFMA 3SQ1A 3PV8A 1YITN 3LDNA 3QDKA 2A41A 4DV3K 4KTQA 5AQLA 3ZX3A 3WQUA 4CF9A 3AVKA 2ASPA 4PUOA 2PYLA 4CD3A 1IKYA 2E88A 2O8EB 5AJ3K 4FJJA 4OKKA 4BRFA 2NRRA 3U6FA 2P9IA 2HHUA 1SZ2A 1OKJA 3UIQA 2DFHA 3OTOK 4J2EA 4CK2A 1YUWA 2UYTA 1SL2A 4N41A 4KHWA 4E1NA 3RSEA 3AVGA 3KLFA 1FW6A 4DV0K 3Q7BA 1TVRA 4CVNE 3THYB 2H3GX 2QXLA 3AO3A 2P9LB 4LH5A 2I7NA 3LAMA 4CZLA 3LDSA 4W5NA 4CZMA 3MECA 4K8ZA 3O1WA 2W41A 3D2FA 4RTFD 4Y1DA 4B9QA 4IFVA 4CEQA 2QWLA 3H1QA 1VQ7N 2QK9A 4E3SA 4LY7A 1ZC6A 4OGEA 3AY9A 3Q7CA 4CJWA 3NAEA 3LPTA 3K59A 3OJSA 4M63C 3PX0A 4DU3A 4AHTA 2YNGA 3DRPA 1HNWK 2KHOA 2UUBK 4LF6K 2QWOA 3FZFA 1RT2A 5CR4A 4LF8K 1OVQA 5C42A 1HR0K 2VGMA 5HL7L 4FLWA 1ZBHA 1S1TA 1RTDA 1HNIA 4HVJA 2YJFA 4X62K 3U8XA 4QAGA 2B4JA 3KLHA 4OLAA 4A59A 1C0FA 3L2WA 2G8FA 1QQMA 1JKHA 3IUCA 2GTDA 1BIUA 3ULDA 3DJCA 2FSNA 4JI3K 3VEYA 1S1VA 3UKUB 2Q0UA 4HCBA 1NG9A 5AZIA 3HYFA 3VQAA 4FZXC 1ASWA 3AA4A 2O8CA 3HSCA 3UKRA 4BR4A 4H5VA 2JWLA 4Z0UA 4CE9A 2D0BA 3QIPA 1VQ9N 4A61A 4CBXA 1NMDA 1D9DA 2D0OA 2HHWA 3JAMO 2KTQA 1W7AA 2V51B 2WTUA 4PY5A 1RDUA 1TK0A 3QEXA 4FK4A 1GLDG 5JS2A 1XWLA 1FJGK 4YY3K 1NKCA 4N5SA 4C8KA 4M3XA 3F5TA 1SV5A 4LSNA 2UXCK 4BRGA 3SBTA 1HQUA 4JI1K 1YTAA 1S6PA 5AQMA 3DRRA 1LAWA 1U45A 1RNHA 5F1XA 2E2NA 5F2RA 2E20A 3ZSYA 3H6EA 4BR2A 1GLBG 1XHXA 2FBYA 4M42A 1NGFA 4H0XB 4DWIA 1NOYA 4DSLA 5CYQA 4FWQA 3C7NB 4FJ5A 1ILYA 4Z4HA 4DU1A 4JRPA 3VA0A 1NGIA 1OH8A 1KXPA 1N36K 4OLBA 1Z26A 3MX5A 2OTLN 2VG6A 2OYQA 1ZBFA 1WSEA 4DFKA 4PL7A 2ZF5O 2NRWA 3R3LA 5ADXA 1JCFA 2HSTA 1T3VA 5J2QA 3OS2A 3TAMA 1CXUA 4CK3A 5C15A 4NO7A 1IKWA 3KD5E 1IJJA 4FPBA 4FM2A 3LP1A 2YKMA 4IZ9A 3VETA 4BACA 4WQ5C 1S1UA 1YI2N 1M1KO 3AO2A 3CYMA 1T7PA 2P9UB 1KLMA 4H0PA 4WFBL 4B3OA 5LJVA 3I8DA 3SPYA 3DI6A 2KW4A 4XH1A 4FW1A 1VQ5N 3E9OA 1JL2A 1EXQA 2QWNA 4OPJA 3D6RA 1XMQK 4KPYA 1C1AA 4WE1A 4CHQA 4DUYK 3VQEA 5SZTA 1NGCA 1C0MA 2P9PA 4JKGA 1Q9YA 3VGLA 1K6YA 4CEDA 3D0PA 1YAGA 4BRPA 4CHYA 1RDBA 3OYGA 2G8IA 4B1WB 1GOBA 1P8ZA 5HRSA 3KD1E 5HP1A 2RE2A 4BQZA 1TKXA 3N4PA 5JMVA 2HVHA 1SUQA 1QQOA 5JICA 3U3GA 3D45A 3NVKA 5KGXA 4FLUA 1QS4A 4YHHK 1NGEA 1HKGA 3SJHA 1QZ6A 3QBWA 2QWPA 5AQQA 2A1SA 3CQXA 4DS4A 4BC2A 3THWA 2HNZA 4ZHRA 3DLGA 3ZSWA 3O08A 3CPWM 5GADP 2P5OA 1JLEA 2W6LA 5AQRA 3EKSA 3SQ0A 1ATRA 4J2DA 2FBTA 3TAGA 4YNQA 1L3SA 4OX9K 3K58A 4O0JA 1A5XA 4CFAA 1JXBA 2QM1A 3FFKB 3DM2A 3E9LA 5KQDA 5KRSA 1EWRA 4H4OA 1VQPN 5EU7A 2O8BB 3O5BA 3OS1A 3HVRA 1NK4A 4CZKA 3L3VA 2XRIA 4JS4A 4IOXA 1VRTA 1EQYA 2FF3B 4MO4A 4CJSA 3ZCMA 3SI6A 4DFJA 2E2PA 3CG7A 3IKMA 1RTIA 3BF1A 3M8QA 4EP5A 1NOZA 4FJXA 4AQYK 1RFQA 4B8CA 1O1WA 4DTPA 1HLUA 2BUPA 3DXMA 1MA9B 4FVMA 4JI0K 5SWMA 1MWKA 3HPHA 1YIJN 1K8KB 2P9NB 1C1CA 3SMSA 1VRUA 3RMDA 3SUOA 1VQ6N 2NZTA 4GV6A 3QO9A 5FDLA 5FROA 4DKWA 3ZETA 3C6TA 3EZWA 4HUGA 4IXCA 4A62A 1KAXA 4EAHD 4YFUA 3KK2A 4KHUA 3OYJA 4IWVA 3SCXA 1OH6A 5EVZA 3ZYYX 1T44A 4RW9A 4FW2A 1IBLK 3OYEA 3DLKA 3QIOA 4ELVA 4WYBA 1RDAA 3D7EO 1TAQA 3PUFA 4GV9A 2KQ2A 2W6KA 4NXNK 3MN7A 3RMCA 1BISA 3NH1A 4JD2B 1BCOA 1JCEA 2A3ZA 1YVUA 5AQXA 5EOYA 4JI5K 4GVMA 2HF3A 5LY3A 2D0CA 4AILC 4CJUA 3ZT4A 1WBBA 2OPQA 2FBXA 4LFBK 1I39A 3V4IA 3VTIA 2KZMA 2Z1IA 4OKJA 5DK5A 4K42A 1D4XA 3E66A 4Y1CA 5GAEP 1J54A 3AA3A 5C2FA 4CZIA 4RW6A 2DFFA 3A5NC 1TK5A 4ZTFA 2F7TA 4DQ8A 1MU2A 3THXB 4DSKA 3BZKA 4CK1A 5ADXH 1N34K 5GINA 2WOMA 3HJFA 2HHVA 4DTSA 1QVGM 2GUPA 3AVLA 3TTDA 3JSMA 1WAJA 4IEEA 4KO0A 1Q8IA 3EN9A 4B3TK 2NRZA 2YJEA 4DV7K 1E4GT 3U9ZA 5AQWA 3KKRA 4MDBA 4FWKA 4DCHA 3ZT1A 4CBWA 3M1FA 1NJXA 3V9XA 2VYPA 2F9WA 4JS5A 4FLZA 3QERA 1IG8A 1YXQA 4KKOA 3WNGA 3BDPA 3M8PA 4DMNA 3QBXA 4FSVA 2F8TA 3QLHA 1NM1A 2DFEA 4DQPA 3LDOA 4I9QA 2I7PA 3VN5A 4DR4K 3E9PA 4CEZA 3OVNA 2P9KA 3K5OA 1KRPA 2GWJA 1L3VA 1LW2A 4MLEA 3NBPA 4CJTA 1TKZA 4PKHA 4MLHA 5HLFA 4RW7A 4CJFA 4ZTJA 3VMFB 1V4SA 4CJ7A 5KGWA 4MFBA 3C65A 2D5RA 2BTFA 5M1PA 4HHTA 3P4IA 3CM6A 3QFUA 4CGGA 2V7ZA 5CHIA 1Q82O 5J2PA 1X3MA 1N5YA 1HYVA 3A0IX 1XUPO 2ETJA 1DGKN 1JL1A 1WNSA 4DSJA 5J1EA 1N33K 1NK9A 2IC3A 4YORA 5GAHP 3VPZA 4F3OA 5IT9O 1BI4B 2A40A 4R5PA 1WN7A 3DOKA 5K14A 1KVBA 4IG3A 4JI7K 3H3NO 2P9IB 2CH6A 3EY1A 3MEGA 3PY8A 1REVA 4IFEA 5I42A 1T8EA 4H0OA 2KLAA 4BC3A 3UB5A 3I0SA 3HPGA 1WSFA 5CZ1A 1VQKN 3MX2A 2YNIA 5A2QO 1ASUA 1Y97A 4CZFA 4FJ8A 4CJLA 2FF6A 1RBSA 3RSEB 1TK8A 4FJ7A 1W97L 2RKIA 4DB3A 1Y64A 3K0SA 4W5TA 1GLEG 4Z94A 3J7ZO 3PO4A 3CQYA 4A5AA 4DTNA 3C95A 2UU9K 4MO5A 2G8VA 1U6ZA 2FBVA 1VQON 3CJ9A 1YJ9N 2ASOA 5LL6Z 4HUEA 1LOTB 4W5RA 3GL1A 3KLIA 2V7YA 3WEEA 4JK7A 3CIPA 5EX5A 3GBTA 3LZIA 1SS6A 1X9JA 2RHKA 4KRFA 3SAFA 3NF8A 4DLGA 2IGIA 4HWIA 3PO5A 3PLAA 5BN8A 2NLXA 1HKBA 4JAXA 3VF6A 5C25A 2HBJA 2ZQBA 4CEEA 1SQKA 3TWHA 2LSNA 2P1JA 4FPAA 1R0AA 3BZCA 3ULEA 1DKGD 2F4VK 5CZ2A 4QS7A 4N56A 3HP9A 4NCGA 1MDUB 1S6QA 1HJOA 3SQ2A 5JVHL 3EE8A 4BROA 3T1YK 4BRHA 3O9UA 4DTUA 4KTZA 5AZIB 5J2NA 1VSHA 4CERA 3AVCA 3P1GA 4FL9A 2CH5A 2O8CB 3BEXA 3UKRB 3WNHA 3LALA 3K2PA 4Z4IA 2VQFK 1HPZA 4H5WA 1VQ4N 1U49A 1MWMA 3DWLA 3TI0A 3MN9A 3VF4A 3NGYA 4E7LA 4BRCA 4I7FA 4YOYA 4EZ6A 3BF3A 4BGAA 5HOOA 1RDCA 3CC7N 4B3SK 4KI6A 3R1XA 2GELA 1XNRK 2QEXN 3AA2A 2HW3A 2QTDA 2E6LA 4CFDA 4DV1K 3ZSQA 1IKXA 2X6NA 3QESA 3SNNA 3CJCA 3QNOA 1ESVA 1IV0A 3VEOA 4DQRA 2XY5A 1RT1A 4M3UA 4E7KA 1NWKA 2ZE2A 3LP3A 4IG0A 5AZJA 4CJVA 1NLVA 2PBDA 3KKSA 1IKVA 4OO1J 1RDDA 2Z1HA 3I8BA 4FZZA 4ELTA 3VERA 4I6MB 4OPKA 4BR9A 2EX3A 3U3YA 2IVPA 3J7YP 1LWEA 4JI6K 3WUHA 3HBTA 5AQZA 4CEBA 3MN5A 4CF0A 4CZHA 1E4FT 3N4QA 3D2EA 3C6UA 1IBKK 1NNEA 3LZJA 3WXIA 1HPMA 4F8RA 2G8HA 4KHNA 1T6DA 2E5LK 3HPOA 3KWGA 3IG1A 1J53A 3EO3A 3HM9A 1UAXA 4CJKA 3VENA 2O8DA 4B3RK 5FRNA 1X1PA 4CZGA 4CJQA 1VSKA 4FJIA 3M8RA 1NJIO 4BRQA 3O9RA 1TKDA 2HBKA 1GLFO 3P83D 1ZBSA 2OTJN 3VEZA 2Y1IA 1G15A 4WQ5A 2QWQA 3KJVA 3P38A 5KI6A 3OS0A 5FRMA 1L3TA 4AHRA 1EX4A 4FJ9A 4JKGB 1B9DA 1GOAA 3KK1A 4J2BA 2IDOA 1CLQA 2WFBA 1BQMA 1Q81O 2PZSA 2HHSA 2Q0RA 3G0ZA 3AVHA 4CJRA 4CBUA 3TANA 1UWBA 3SLCA 1KVCA 3SMPA 1OH5A 4J2AA 3THYA 4JNEA 4FVUA 2IIRA 2P9LA 3HSTB 1VQLN 3KTQA 3TABA 2A5XA 2O8FA 4CF1A 1F21A 2YCHA 3DAWA 3J8AA 3MEDA 3QFPA 1SL1A 4YOWA 4FOIA 2R7YA 1TL3A 4FWLA 1XC3A 5KPRA 1E3MA 3J80O 2JGUA 3CI5A 3LM2A 4XIUA 3ZSXA 1QSLA 4BR5A 4O5BA 1ATSA 4LH4A 1BUPA 1VQ8N 1RDWX 1HNXK 3VGMA 5E26A 2EWSA 2NRTA 3OYMA 4KV8A 4NYFA 3OY9A 1NJYA 3FGUA 5DMRA 4EIAA 1NGAA 1C6VA 3CFRA 1BOTO 1WSJA 3NDKA 4AHUA 3DLBA 4BR7A 4BRKA 1XMOK 3L4QA 4B1ZA 3K5MA 4FXDA 4H8KA 3VOVA 2W42A 3L0QA 1UA0A 3AVJA 3L8BA 4RCHA 3AO4A 3DXMB 4N76A 3DXKA 4BREA 3CC4N 3AV9A 3ZEUB 3UKUA 3VEXA 4CIEA 3HT3A 4IOAL 4LC9B 3OYLA 1FXXA 4KB0A 2YNFA 2ITMA 4JKHA 1U2VB 4IO8A 5AR0A 3TU5A 5AQTA 5M1OA 4E1JA 3SYZA 4BE2A 1JLBA 2IVNA 1TUUA 3L2VA 3EEQA 3QNNA 3WXMB 3KLEA 5CYMA 3H3OB 3NFAA 4NCAA 4CW7B 5FLXO 5HRRA 4EZ9A 3ENHA 4ILHA 4CGDA 1TYQA 2YI1A 4KAZA 2W40A 1J6ZA 4H0VB 1YF5L 5KQ8A 4KTWA 5H1SQ 4RG8A 1BA1A 4BVPA 3B6OA 1NK5A 1HNVA 5LMUK 4U67L 4JHDA 3H45C 4Y0WA 3O4WA 1NK0A 1DTQA 4FLXA 3CCEN 3C7NA 4BDYA 1XNQK 4J8FA 1WOQA 3HRGA 5BR9A 1HKCA 3MWTA 4PKIA 1SKSA 4E1MA 4JKFA 3G4SN 1HJRA 3DYAA 3WXJA 1X9MA 2HB5A 3OBWA 3FZHA 3WXKA 1VSLA 4Z4EA 1QHTA 1QSSA 3NE6A 4LF9K 2KFZA 4DF8A 3J7AP 4KHPK 2F8SA 2FC0A 1FKPA 5AQSA 3M5RA 1VSIA 1N6QA 3HL8A 5KPTA 4DQQA 4BDPA 5HRNA 4DR2K 2QA4N 3O3GA 2P9UA 1Q9XA 5F0XA 2VQEK 4K8XA 1BWFO 2D0PA 4HCCA 3HM8A 3AVAA 5CE3A 2X74A 1KAYA 2ITGA 1VQMN 3RWUA 3V1RA 3ID8A 4M3TA 4FJGA 4DTJA 1JLGA 1NKBA 1VSJA 3MAQA 1OVYA 3QB0A 5AQFA 3FR0A 5M1KA 3VGKA 4FM0A 1NMNA 4KB1A 3VQCA 3EYZA 4W5OA 1K8AO 2NRXA 4E7IA 3RR7A 4NLCA 3TSUA 5C0YA 1U04A 3V1OA 2HMPA 3TTCA 4DF4A 2E8AA 1WUAA 2HBLA 2XHBA 3HXMA 3ZT3A 4E89A 5TKYA 1V4TA 2B5JA 5BREA 3VQQA 4IDHA 3NHGA 3CD6N 1EWQA 4WFNL 5BPMA 1NJZA 2Q2RA 3CHWA 3CCSN 3CPEA 3R8EA 3W3DA 5C2DA 4Q0BA 3OJUA 1FKOA 4I2PA 3TSPA 2Q31A 2E1YA 1VSFA 2VWKA 4FLYA 4FJHA 4DV2K 3T1HK 2CGJA 4K41A 4ISEA 2E4LA 3DLRA 3QEWA 4CFBA 2O8BA 4X64K 3FZKA 3R6MA 3T3FA 2NRVA 1GOCA 4DU4A 1QE1A 1IBMK 4BC4A 2HF4A 3CQ8A 3MDQA 4JRQA 4B9SA 5M1FA 1ITGA 3HOSA 4H4MA 3SK3A 2GEMA 1S22A 4B9MA 3F2KA 3DRSA 4CHOA 3M6GA 4AH9A 1WLJA 4KHQA 2FSJA 4IJAA 5FPMA 1D5AA 1HUXA 2Z1GA 3WQTA 4JKEA 4DSFA 1CZ9A 3DLEA 1D8YA 4ILGB 2DY4A 4JLHA 1YT3A 4KFBA 3E01A 5TKWA 4Z4FA 3LDPA 3I55N 1K8KA 3LL3A 4BRLA 2P9NA 1L3UA 1O13A 5KRTA 3OYIA 2Z1JA 3KZBA 3LM9A 1U47A 5MLCQ 1W9HA 3P31A 5AQUA 3VQ8A 4DG1A 4OKEA 4PQUA 3C0BA 4CJ3A 4B8AB 4YOUA 3ULEB 1K9MO 4FYDA 3A2FA 4M3WA 3ASMA 3AO5A 3ATVA 3OYDA 2RPIA 4AHVA 3CERA 2A42A 3NMUA 3MCAB 1ZBIA 4IFYA 4NCBA 4IO9L 4LSLA 4CIFA 1RBRA 2HOEA 3MN6A 4CGIA 3RRGA 4B1XB 3MMVA 5BRHA 3M3ZA 1RBTA 4F4KA 3TR8A 4CJ4A 3EL2A 4BRDA 1I3AA 3OYNA 5AQIA 2GWKA 3CCLN 2YNHA 4M7YA 1U4BA 3VQ4A 3CCMN 3IDHA 1XC9A 3IAYA 4E7JA 4DTOA 3EZ5A 1DEJA 3VQPA 4IOCL 1Q7YO 2OPPA 3CCQN 1JLQA 5KPZA 2IVOA 3VA3A 1J9AA 2HHXA 3UE5A 1KCFA 2E1ZA 3I33A 2CGLA 3WNEA 3S9HA 2UXDK 5CY4A 5C12A 4O44A 2P9SA 3VQDA 4RW8A 2G8UA 2G8KA 1T05A 4A2BA 2GBZA 2FSKA 3D2FB 3LP0A 1RILA 3O9SA 3MCPA 2ZGZA 1W0HA 4DSIA 2BANA 3T69A 1LV5A 4XEIA 5BRFA 3SUQA 1RTHA 3PIPL 4CZJA 3VQBA 2P5GA 3BY5A 4FLVA 4PKGA 4B9UA 4NB4A 1S9GA 3QMLA 5D3GA 3F9KA 3SQ4A 3ITHA 2XY8A 3KLGA 1WSGA 2QKBA 1VHXA 1ASVA 2JWKA 3CXCM 3S3OA 3BGRA 2HMIA 1SAZA 4JV5K 3O1BA 4HUFA 5FPNA 3K5NA 1S1XA 1EO1A 4KREA 3AAPA 3CJ1A 1TKTA 1WSHA 3FZMA 3ZX2A 1Q18A 4WCEL 2BH1A 3FE1A 3QETA 1QSYA 1RCHA 4K0KK 2NNWA 5GIOA 2OZMA 3ZSZA 1RTJA 3A5MC 2O8DB 4JKCA 3CFPA 4LF4K 4YDUC 1A5VA 4AHCA 4YOTA 3SAGA 3A8YA 1NK6A 1BIZA 4C1NK 5E41A 1SKRA 2ASMA 2RF2A 3AVIA 3C94A 4MDAA 4CFCA 1KSPA 1EKEA 2DTUA 4GMJB 4GW6A 1ZBUA 3AAQA 3OYHA 1BI4A 1BO5O 1XQSC 3NGIA 3NCIA 5J2MA 3DLHA 4M45A 2UUCK 3V9WA 1IO2A 4C23A 4A57A 5BPLA 4M3YA 3ALYA 1LWCA 4BGBA 2YX6A 1SKWA 4C8MA 4FLTA 3CCVN 4CIGA 5I3UA 1CZAN 3S41A 3LANA 3G10A 1T6CA 3ZLJA 4DSEA 4F2SA 2I5JA 2D4WA 4E19A 3DMJA 4EFHA 4FO0A 1R59O 4XH4A 2KZZA 1LAVA 4OGCA 1NK7A 2YHBA 4FJLA 5GIPA 4AHSA 3VESA 3S3NA 1KC8O 3FZLA 1TUYA 2WUSA 2O8FB 1CZBA 1EETA 1LCUA 4BG8A 4UY8O 2NUBA 3CFOA 4EP4A 2A6AA 2ZJQL 1QTMA 4B9LA 4L8RB 3ENBA 3E1YA 3OYAA 3CETA 2D1KA 5JLFA 4KI4A 3FLCO 1BA0A 4WQ4C 1VAZA 3K9JA 3TSQA 4CESA 3TTFA 3HZ6A 3TAQA 4A5BA 1XHZA 1N32K 2E2QA 4JKBA 3U9DA 1BU6O 4DR3K 3THVA 4FJMA 3C6AA 2RN2A 5AFUH 4A2AA 3ZT2A 4BR0A 3LDQA 4CGHA 4W5QA 1J5OA 4CCHA 2YHWA 2ZWHA 1RT5A 4ISFA 1NKEA 5ELZA 1LW0A 4TSXA 3JYTA 1QQNA 2QKKA 4RWTA 1JLAA 4LF7K 3IMXA 4JI2K 3DXKB 1JXEA 3KHYA 3CCRN 2X78A 4C8NA 5BPNA 1YVNA 3I56N 3S3MA 3VQ6A 4FWMA 3O3FA 2OPSA 4ID5A 5AQYA 2O8EA 1Z6RA 4G9ZA 1VSDA 5AQPA 5LJWA 3KK7A 2HNYA 3PIOL 2KKZA 2P9PB 4DV5K 4LD0A 4O55A 5M1NA 1X9SA 4QOZB 2HHQA 2Q97A 2VCPA 5JS1A 4B3MK 4CECA 2GV9A 4CEFA 4ILJA 3A5LC 4CD1A 3OHRA 3ZT0A 5AQNA 4KHYA 3MK6A 5AQVA 1JLFA 1RT6A 3AVFA 1JCGA 4LFCK 2PYJA 3HI0A 3GOIA 1VQNN 2QWMA 1TYQB 4B9VA 5FPEA 2VG7A 4PL8A 1KAZA 3MWPA 3PSFA 3THWB 3RVCA 3SUPA 5AQKA 2QWRA 3LWMA 4BQLA 3VF2A 2HVIA 4BRNA 4EHTA 1BQNA 2YV0X 3VEVA 3V9SA 1RT7A 4JHDB 4YOXA 4BDZA 4DHYA 3TAFA 3L4IA 1CXQA 3T7ZA 3MXJA 3M8SA 2O4GA 3L3UA 4OPHA 1K73O 5EXWA 3WNFA 3P39A 4Q5VA 3OYCA 2YHYA 4CF2A 3G6EN 1NK8A 1KFSA 1S5JA 4I6MA 3U4LA 2OA8A 2HHHK 4DR6K 5BN9A 2QW9A 4FWOA 3IRXA 3H1VX 4H0TB 4I2QA 4GV3A 2HNDA 3AARA 2VG5A 3W0LA 3ATUA 2CGKA 3OBYA 1HNZK 1G99A 4WF9L 1VSMA 2XY7A 1LWFA 1HX1A 2PFUA 3V1QA 2OZSA 2O4IA 5DM7L 1RT3A 1IG9A 2BE2A 3NVMA 2Q36A 5IWAK 3MEEA 3LPUA 2AJQA 4GNIA 4CZEA 2XO7A 4O8KA 1QHAA 1X9WA 1M90O 4ICLA 4CHPA 3V9UA 2OPRA 4CF8A 4IDKA 4FCYA 4FWPA 4FWSA 1WBDA 3ZETB 3KIOA 1NGBA 4FOEA 2JLEA 1J5EK 4JI4K 1BGXT 4CJEA 3LAKA 1S1WA 1GLJO 4L3QA 4BE0A 1KFDA 3OYFA 2FLOA 3PSIA 3LWLA 4BY9C 3OA9A 3O6WA 1RBUA 2UUAK 4IKFA 1ZYQA 2HBMA 1TGOA 1U48A 3AVNA 4FWRA 2YHXA 4KHSA 5DM6L 4H5RA 3ID6A 3OYBA 4E0DA 4Z4CA 4CJ5A 4B1YB 2ZGYA 3ZSOA 4C8OA 1Q86O 1YHQN 3AA5X 2EHGA 3NGZA 1BL3A 3AGKA 4NLBA 1YJWN 3HK2A 5JVGL 4IJNA 1C0TA 1BCMA 3CF5L 2YHAA 3CJAA 4CI6A 4FJKA 4FWNA 4H03B 2BDPA 2AA4A 1TAUA 1C0UA 3KWIA 1KVAA 4NYNA 1B92A 4B9TA 3MXMA 1HYSA 1Z25A 4DUZK 3DOLA 4K43A 1D9FA 1KTQA 4Z4GA 3RR8A 4N47A 4C1NI 4E7HA 3JXUA 4GKKK 5AQGA 1C0GA 1NGDA 1QQCA 2B6AA 1IH7A 1TL1A 1DTTA 2V52B 3PX4A 3O9TA 4FK2A 4CGJA 3QEPA 3IFRA 3GE1A 1YTUA 1RGIA 1BHLA 4F9OA 4DR5K 4ISGA 3CM5A 4I9LA 3NH2A 3QEVA 1UOCA 2F9TA 3G71N 5E84A 3LDLA 4CHNA 1HRHA 3CJ7A 4B1VA 1QZ5A 3SZ2A 4DR1K 3V6DA 2GUIA 4BRIA 5FPDA 4RW4A 1L5UA 3P5JA 2QXFA 1ZXOA 2OCEA 5AQJA 4M41A 4PWDA 4O8UA 1NGHA 4QS8A 4YOVA 3ZEUA 3J81O 4X65K 1N8RO 3O8MA 2P9KB 4AM6A 1I94K 3SAHA 3MXIA 1JLCA 4GKJK 4GY2B 3L2RA 1U2VA 3CCJN 1RBVA 3HVTA 3BP8A 2IS3A 3HP6A 4DQSA 1TV6A 5M1QA 3TAEA 3H46O 4F3TA 5LMNK 1GLCG 3F9MA 3O3HA 2ZJRL 1W2BM 3ZSRA 5HRPA 4DQIA 3ZSVA 3RMBA 3TPQA 2FXUA 4DTMA 4JN4A 3QEIA 1WB9A 3SPZA 3SJJA 1SL0A 1ZBLA 2VWJA 4B9NA 4LF5K 4OJRA 1NBWA 2ZJPL 4QCLA 3NF7A 4MQ3A 1VK0A 3KK3A 1BDGA 2Q3SA 1DLOA 3OYKA 1XI1A 2VGNA 5BRDA 1HYZA 4M3ZA 4FK0A 3CC2N 4BG9A 3CJBA 4AM7A 5BR8K 2A1RA 3EKUA 4OVLA 4DV6K 3V9ZA 4OPAA 4EHUA 2GX9A 1B9FA 5EY4A 4DLEA 4DTRA 1NU0A 4ID1A 1P90A 2G8WA 1JJ2M 2P9SB 1UA1A 2HHTA 1OH7A 4WFAL 5C24A 4H5NA 1S3XA 3TAPA 4CHZA 5C10A 2DPNA 2ATQA 2XY6A 4CEAA 1DT9A 2VWBA 3H08A 2WC9A 4FJNA 5HBMA 1NGGA 5AQHA 3AVBA 4QS9A 3SBGA 1WSIA 3WEEB 1A5WA 3O80A 4JKDA 4CGFA 3B6PA 4V19S 3VQ5A 3O4QA 2E2OA 2IAJA 4LFAK 4ELUA 1WAFA 3RMAA 2IOCA 1KQSM 4F2RA 4HTUA 3C6HA 4R79A 3HOTA 4IBNA 5AFUA 3VQ9A 4C8LA 3BUZB 3O9QA 5AQOA 1ATNA 1HQEA 3KVGA 1KLNA 4JK9A 3NH0A 1NJWA 2Q1NA 3CCUN 4O0IA 4M7XA 2QI2A 2D0AA 4BVOA 5B8HA 4CEOA 4DV4K 4O4GA 1BG3A 2E6MA 2PAVA 3HO1A 5T7BA 3ZX0A 3NF9A 3QICA 4BC5A 4GVEA 4JD2A 3HTVA 3ISNC 4JK8A 3AGRA 4M3RA 1HMVA 4DS5A 4BWJA 4BRMA 3T1AA 3QINA 2F96A 3I0RA 4H0YB 2OANA 1FK9A 4K25A 3B8AX 3A5OC 4DFPA 4UQGA 5GAGP 2ZM6K 4NXMK 3RRHA 3T19A 3L2QA 4KH5A 4JYAK 4CJPA 2KFNA 3G25A 2ZD1A 4YDUA 4HTLA 1GLAG 3VQ7A 4PHTX 3CMEN 3SUNA 3THXA 4JI8K 3CMAN 1KD1O 3L6QA 3ENOA 5HROA 4O5FA 4KH6A 1QVFM 2PY5A 5JLHA 2J4RA 3FFIA 3GDQA 1GLLO 3AVMA 3EE9A 2BGGA 4U7BA 3R9PA 2UXBK 4XH5A 5I9EB 3IS9A 4KBOA 3K9KA 3V81A 2P51A 5AZJB 4FZYA
chains in the Genus database with same CATH topology
5CYMA 3SV4A 1RT5A 2WONA 3RTVA 4Y1CA 3NFAA 1J54A 3AA3A 4NCAA 1NKEA 1LW0A 2YKNA 5HRRA 4EZ9A 4RW6A 1S9EA 2DFFA 4FM1A 4G1QA 1TK5A 4ZTFA 4TSXA 4CGDA 3JYTA 1MU2A 1T03A 2QKKA 1JLAA 4DSKA 5KTQA 4CK1A 1JXEA 2WOMA 4KAZA 3TARA 4DTSA 2X78A 4C8NA 3S3MA 3HJFA 2HHVA 1RT4A 3PX6A 3VQ6A 4BE1A 4KTWA 3AVLA 3O3FA 3K5LA 2OPSA 4ID5A 1WAJA 4RG8A 3B6OA 3JSMA 1NK5A 1HNVA 4KO0A 1VSDA 3F73A 1Q8IA 2Y1JA 2HNYA 3O4NA 4LD0A 4O55A 3L2UA 3SV3A 1X9SA 4QOZB 2HHQA 1NK0A 3LP2A 1DTQA 4FLXA 1EP4A 5JS1A 1VSEA 4CECA 3KKRA 3K57A 2GV9A 3NF6A 4BDYA 4CEFA 3ZT1A 2X6SA 3ZT0A 4B08A 1NJXA 3V9XA 4PA1A 4DTXA 4KHYA 4BWMA 1C1BA 1JLFA 3AO1A 4JS5A 4FLZA 4KKOA 1RT6A 4DFMA 3WNGA 3QERA 3AVFA 3M8PA 4E1MA 3SQ1A 1SKSA 3PV8A 4DMNA 3BDPA 2PYJA 1HJRA 3DYAA 2F8TA 3QLHA 1X9MA 2HB5A 4KTQA 2DFEA 4DQPA 4I9QA 4B9VA 3VN5A 2VG7A 4CEZA 4CF9A 3AVKA 3K5OA 3OVNA 1VSLA 1KRPA 1QHTA 1L3VA 2PYLA 1IKYA 1LW2A 3SUPA 4PUOA 4Z4EA 3NBPA 1QSSA 4CJTA 3NE6A 4OKKA 3LWMA 4FJJA 1TKZA 5HLFA 2KFZA 4DF8A 2HVIA 4RW7A 4CJFA 3U6FA 1BQNA 4ZTJA 2F8SA 2YV0X 2FC0A 3V9SA 1FKPA 5KGWA 1RT7A 2HHUA 4MFBA 4BDZA 2D5RA 3TAFA 3UIQA 1VSIA 1N6QA 1CXQA 2DFHA 3HL8A 4J2EA 4DQQA 3MXJA 4HHTA 4BDPA 5HRNA 3M8SA 4CK2A 2O4GA 3CM6A 3O3GA 3L3UA 1SL2A 4N41A 4KHWA 3WNFA 4CGGA 4E1NA 4Q5VA 3OYCA 3AVGA 1Q9XA 4CF2A 5J2PA 3KLFA 1NK8A 1S5JA 1N5YA 1KFSA 2OA8A 1HYVA 4K8XA 1TVRA 3IRXA 2ETJA 4HCCA 4I2QA 3AO3A 1JL1A 1WNSA 4LH5A 4DSJA 2HNDA 5J1EA 3LAMA 1NK9A 2IC3A 3AVAA 3LDSA 4W5NA 2VG5A 2X74A 3MECA 4F3OA 2ITGA 1BI4B 4K8ZA 4R5PA 4Y1DA 3RWUA 4IFVA 3V1RA 1VSMA 1WN7A 1LWFA 2XY7A 3DOKA 4FJGA 4DTJA 4M3TA 4CEQA 1KVBA 1JLGA 4IG3A 5K14A 1NKBA 1VSJA 3MAQA 3V1QA 2OZSA 2QK9A 4E3SA 2O4IA 3EY1A 1RT3A 3MEGA 1IG9A 2BE2A 4FM0A 4LY7A 4KB1A 3PY8A 1REVA 4OGEA 5I42A 1T8EA 3VQCA 3MEEA 3LPUA 4CJWA 3I0SA 3LPTA 4W5OA 3EYZA 3K59A 3HPGA 1WSFA 5CZ1A 3NAEA 2AJQA 2XO7A 2YNIA 4E7IA 1X9WA 3RR7A 1ASUA 1Y97A 4ICLA 4CHPA 3OJSA 4FJ8A 4CJLA 3V9UA 2OPRA 4CF8A 4IDKA 4FCYA 3PX0A 4DU3A 4AHTA 2YNGA 3DRPA 1U04A 1RBSA 3V1OA 1TK8A 3KIOA 4DF4A 2JLEA 4FJ7A 2XHBA 1RT2A 3HXMA 1BGXT 3ZT3A 3LAKA 1S1WA 4CJEA 2RKIA 5C42A 4BE0A 4FLWA 1KFDA 4E89A 1ZBHA 3OYFA 1S1TA 2B5JA 3VQQA 4W5TA 3LWLA 1RTDA 3PO4A 1HNIA 4HVJA 1RBUA 4DTNA 3C95A 3NHGA 4QAGA 4IKFA 1ZYQA 2G8VA 2B4JA 3KLHA 1TGOA 4OLAA 1U48A 1NJZA 2FBVA 3AVNA 3L2WA 4KHSA 2G8FA 1JKHA 3OYBA 4HUEA 4E0DA 4Q0BA 1BIUA 4Z4CA 4W5RA 4CJ5A 3ULDA 3KLIA 3ZSOA 3OJUA 4C8OA 1FKOA 1S1VA 4I2PA 3LZIA 3AA5X 2EHGA 3NGZA 1BL3A 4HCBA 4KRFA 3HK2A 1VSFA 3HYFA 2VWKA 3NF8A 3VQAA 2IGIA 4DLGA 4FLYA 3PO5A 4FJHA 1C0TA 4FZXC 1ASWA 1BCMA 2YHAA 5C25A 3AA4A 2ZQBA 4FJKA 2E4LA 2BDPA 4CEEA 3DLRA 1TAUA 3QEWA 4CFBA 3TWHA 4Z0UA 4CE9A 3T3FA 1C0UA 2D0BA 1GOCA 2LSNA 1KVAA 3QIPA 1QE1A 4DU4A 4NYNA 3CQ8A 1B92A 4JRQA 2P1JA 1D9DA 4B9SA 1R0AA 1ITGA 4B9TA 3MXMA 1HYSA 2HHWA 4H4MA 5CZ2A 1Z25A 2KTQA 3DOLA 4PY5A 1TK0A 4N56A 1D9FA 3QEXA 4B9MA 4FK4A 4CHOA 3DRSA 1KTQA 5JS2A 4AH9A 1WLJA 1XWLA 3HP9A 4NCGA 3RR8A 1NKCA 1S6QA 4N47A 4N5SA 4C8KA 4KHQA 4M3XA 1D5AA 2Z1GA 4E7HA 3SQ2A 4DSFA 1CZ9A 3DLEA 1D8YA 1SV5A 4LSNA 4JLHA 1YT3A 4KFBA 1HQUA 3E01A 2DY4A 4Z4FA 1YTAA 1S6PA 3DRRA 1LAWA 1U45A 1L3UA 5KRTA 3OYIA 4DTUA 1QQCA 2Z1JA 4KTZA 2B6AA 1RNHA 1IH7A 1U47A 1TL1A 1DTTA 5J2NA 3PX4A 1W9HA 3ZSYA 4FK2A 1VSHA 4CERA 4CGJA 3AVCA 3QEPA 1XHXA 3P1GA 3VQ8A 1YTUA 4DG1A 4OKEA 2FBYA 4PQUA 1BHLA 4M42A 3WNHA 3CM5A 3LALA 4I9LA 4DWIA 3K2PA 1NOYA 3NH2A 3QEVA 1UOCA 4DSLA 4Z4IA 5CYQA 1HPZA 1U49A 4CJ3A 3TI0A 4B8AB 3NGYA 4CHNA 4E7LA 4FJ5A 1HRHA 4Z4HA 4DU1A 4I7FA 4JRPA 4FYDA 4EZ6A 3A2FA 3VA0A 4M3WA 3ASMA 3SZ2A 3AO5A 3V6DA 1RDCA 2GUIA 3OYDA 2RPIA 4RW4A 4AHVA 4KI6A 1L5UA 1ZBIA 3P5JA 2QXFA 4IFYA 4NCBA 4M41A 4OLBA 1Z26A 4LSLA 4PWDA 2VG6A 4CIFA 2OYQA 1RBRA 1WSEA 1ZBFA 4DFKA 4CGIA 3RRGA 3AA2A 2HW3A 2E6LA 1RBTA 4CFDA 4F4KA 3TR8A 3ZSQA 4CJ4A 1I3AA 3OYNA 1IKXA 1JLCA 2X6NA 3QESA 3MXIA 5J2QA 3SNNA 3L2RA 3OS2A 3TAMA 1CXUA 1RBVA 2YNHA 4CK3A 3QNOA 3VQ4A 1U4BA 4DQRA 4M3UA 1IKWA 3HVTA 2XY5A 1XC9A 1RT1A 2IS3A 3HP6A 4DQSA 4E7JA 3IAYA 3KD5E 1TV6A 4FM2A 4E7KA 3TAEA 3LP1A 3EZ5A 2ZE2A 2YKMA 3LP3A 4IG0A 3VQPA 4DTOA 2OPPA 4CCHA 4BACA 4CJVA 4F3TA 1JLQA 1S1UA 3KKSA 1IKVA 3O3HA 1RDDA 3AO2A 3VA3A 3CYMA 2Z1HA 3ZSRA 5HRPA 1T7PA 1KLMA 4B3OA 1J9AA 4FZZA 2HHXA 4ELTA 3I8DA 1KCFA 3SPYA 4DQIA 3DI6A 3ZSVA 4OPKA 3RMBA 2KW4A 3WNEA 3S9HA 4DTMA 4FW1A 5CY4A 2EX3A 3U3YA 3QEIA 4O44A 3VQDA 3SJJA 4RW8A 3SPZA 2G8UA 1JL2A 1LWEA 1SL0A 2G8KA 1ZBLA 1T05A 2VWJA 4B9NA 4CEBA 4CF0A 4OJRA 1EXQA 4OPJA 4KPYA 4QCLA 1C1AA 4WE1A 2GBZA 3C6UA 3NF7A 4CHQA 4MQ3A 3LZJA 1VK0A 1RILA 3LP0A 3VQEA 4F8RA 3KK3A 5SZTA 2Q3SA 1W0HA 2G8HA 4KHNA 4DSIA 2BANA 1DLOA 3OYKA 1XI1A 1C0MA 3HPOA 1LV5A 3SUQA 1RTHA 1Q9YA 1HYZA 4M3ZA 1K6YA 1J53A 3IG1A 4FK0A 3VQBA 1UAXA 3HM9A 2P5GA 4CEDA 4CJKA 3D0PA 4FLVA 4B9UA 1S9GA 2A1RA 4OVLA 3V9ZA 4CHYA 1RDBA 1X1PA 3OYGA 5D3GA 5FRNA 1GOBA 3F9KA 2G8IA 5HRSA 3KD1E 5HP1A 4CJQA 3SQ4A 3ITHA 1VSKA 1TKXA 1B9FA 2XY8A 3KLGA 4FJIA 3M8RA 4DLEA 1WSGA 2QKBA 4DTRA 2HVHA 1ASVA 1SUQA 3U3GA 4ID1A 3S3OA 3BGRA 3D45A 2HMIA 5KGXA 2G8WA 1UA1A 1TKDA 2HHTA 4HUFA 3P83D 4FLUA 5C24A 1QS4A 3K5NA 3TAPA 2Y1IA 1S1XA 4CHZA 1G15A 2ATQA 2XY6A 3KJVA 4KREA 2A1SA 4DS4A 1TKTA 1WSHA 2HNZA 5KI6A 4CEAA 3DLGA 3ZSWA 4ZHRA 3OS0A 1L3TA 5FRMA 3H08A 4AHRA 1EX4A 4FJNA 4FJ9A 5HBMA 3QETA 1QSYA 1B9DA 1RCHA 3AVBA 4Z4GA 1GOAA 2OZMA 1WSIA 3KK1A 2P5OA 4J2BA 1JLEA 3ZSZA 1RTJA 1A5WA 2IDOA 4CGFA 3SQ0A 1CLQA 3B6PA 1BQMA 3VQ5A 3O4QA 2PZSA 2HHSA 3CFPA 4J2DA 2FBTA 3G0ZA 1A5VA 2IAJA 3AVHA 3TAGA 4AHCA 4YNQA 4CJRA 1L3SA 4ELUA 3K58A 4O0JA 1NK6A 1A5XA 1WAFA 1BIZA 1JXBA 4CFAA 3TANA 3RMAA 1UWBA 2IOCA 1KVCA 3DM2A 5E41A 1SKRA 5KRSA 4HTUA 4F2RA 4H4OA 2RF2A 3AVIA 3C94A 5EU7A 4IBNA 3OS1A 4J2AA 3HVRA 1NK4A 4JS4A 3L3VA 2XRIA 3VQ9A 4C8LA 1VRTA 4CFCA 1KSPA 1EKEA 2DTUA 3HSTB 4CJSA 4GMJB 3ZCMA 3SI6A 4GW6A 4DFJA 3TABA 3KTQA 1HQEA 1ZBUA 3CG7A 3OYHA 1BI4A 4CF1A 1F21A 1RTIA 3NGIA 3M8QA 4EP5A 3NH0A 3NCIA 5J2MA 4M45A 1NJWA 1KLNA 1NOZA 3DLHA 4FJXA 4B8CA 3V9WA 1O1WA 3MEDA 1IO2A 4O0IA 4DTPA 2D0AA 1SL1A 4CEOA 4M3YA 3ALYA 4O4GA 4FVMA 1LWCA 2E6MA 1TL3A 5T7BA 2R7YA 5SWMA 3HO1A 3NF9A 3HPHA 4C8MA 4FLTA 1SKWA 4CIGA 5I3UA 2JGUA 4XIUA 3ISNC 3LANA 3ZSXA 1C1CA 3G10A 1QSLA 4O5BA 4M3RA 1HMVA 1VRUA 4LH4A 4DS5A 4BWJA 3RMDA 3T1AA 3SUOA 3QINA 4DSEA 2F96A 3I0RA 3QO9A 5FDLA 4F2SA 5FROA 2I5JA 4E19A 3DMJA 1FK9A 2KZZA 3C6TA 1LAVA 4HUGA 4DFPA 4UQGA 4YFUA 4OGCA 3OYMA 3KK2A 1NK7A 4KHUA 4KV8A 3RRHA 3T19A 4NYFA 2YHBA 3OYJA 3L2QA 4FJLA 3OY9A 3SCXA 1NJYA 4CJPA 2KFNA 5DMRA 4AHSA 3S3NA 2ZD1A 1C6VA 3CFRA 1WSJA 3NDKA 4RW9A 1CZBA 1EETA 4AHUA 3DLBA 4FW2A 3VQ7A 2NUBA 3CFOA 4EP4A 4B9LA 1QTMA 3OYEA 3DLKA 3QIOA 4L8RB 4ELVA 3K5MA 4FXDA 3SUNA 3OYAA 4H8KA 1RDAA 2W42A 1UA0A 3AVJA 3L8BA 1TAQA 3PUFA 2KQ2A 3AO4A 4KI4A 4N76A 3RMCA 1BISA 3AV9A 5HROA 3NH1A 1BCOA 1YVUA 4CESA 2PY5A 4CIEA 3HT3A 3TAQA 1XHZA 4GVMA 3FFIA 3THVA 3OYLA 1FXXA 2D0CA 4KB0A 3AVMA 2YNFA 4FJMA 4AILC 2BGGA 4CJUA 2RN2A 3ZT4A 2OPQA 2FBXA 3ZT2A 3SYZA 1I39A 3V4IA 4BE2A 4CGHA 1JLBA 4W5QA 3IS9A 3L2VA 2KZMA 2Z1IA 3QNNA 2P51A 3V81A 1J5OA 4OKJA 3KLEA 5DK5A 4FZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CYM A;  3SV4 A;  1RT5 A;  2WON A;  3RTV A;  4Y1C A;  3NFA A;  1J54 A;  3AA3 A;  4NCA A;  1NKE A;  1LW0 A;  2YKN A;  5HRR A;  4EZ9 A;  4RW6 A;  1S9E A;  2DFF A;  4FM1 A;  4G1Q A;  1TK5 A;  4ZTF A;  4TSX A;  4CGD A;  3JYT A;  1MU2 A;  1T03 A;  2QKK A;  1JLA A;  4DSK A;  5KTQ A;  4CK1 A;  1JXE A;  2WOM A;  4KAZ A;  3TAR A;  4DTS A;  2X78 A;  4C8N A;  3S3M A;  3HJF A;  2HHV A;  1RT4 A;  3PX6 A;  3VQ6 A;  4BE1 A;  4KTW A;  3AVL A;  3O3F A;  3K5L A;  2OPS A;  4ID5 A;  1WAJ A;  4RG8 A;  3B6O A;  3JSM A;  1NK5 A;  1HNV A;  4KO0 A;  1VSD A;  3F73 A;  1Q8I A;  2Y1J A;  2HNY A;  3O4N A;  4LD0 A;  4O55 A;  3L2U A;  3SV3 A;  1X9S A;  4QOZ B;  2HHQ A;  1NK0 A;  3LP2 A;  1DTQ A;  4FLX A;  1EP4 A;  5JS1 A;  1VSE A;  4CEC A;  3KKR A;  3K57 A;  2GV9 A;  3NF6 A;  4BDY A;  4CEF A;  3ZT1 A;  2X6S A;  3ZT0 A;  4B08 A;  1NJX A;  3V9X A;  4PA1 A;  4DTX A;  4KHY A;  4BWM A;  1C1B A;  1JLF A;  3AO1 A;  4JS5 A;  4FLZ A;  4KKO A;  1RT6 A;  4DFM A;  3WNG A;  3QER A;  3AVF A;  3M8P A;  4E1M A;  3SQ1 A;  1SKS A;  3PV8 A;  4DMN A;  3BDP A;  2PYJ A;  1HJR A;  3DYA A;  2F8T A;  3QLH A;  1X9M A;  2HB5 A;  4KTQ A;  2DFE A;  4DQP A;  4I9Q A;  4B9V A;  3VN5 A;  2VG7 A;  4CEZ A;  4CF9 A;  3AVK A;  3K5O A;  3OVN A;  1VSL A;  1KRP A;  1QHT A;  1L3V A;  2PYL A;  1IKY A;  1LW2 A;  3SUP A;  4PUO A;  4Z4E A;  3NBP A;  1QSS A;  4CJT A;  3NE6 A;  4OKK A;  3LWM A;  4FJJ A;  1TKZ A;  5HLF A;  2KFZ A;  4DF8 A;  2HVI A;  4RW7 A;  4CJF A;  3U6F A;  1BQN A;  4ZTJ A;  2F8S A;  2YV0 X;  2FC0 A;  3V9S A;  1FKP A;  5KGW A;  1RT7 A;  2HHU A;  4MFB A;  4BDZ A;  2D5R A;  3TAF A;  3UIQ A;  1VSI A;  1N6Q A;  1CXQ A;  2DFH A;  3HL8 A;  4J2E A;  4DQQ A;  3MXJ A;  4HHT A;  4BDP A;  5HRN A;  3M8S A;  4CK2 A;  2O4G A;  3CM6 A;  3O3G A;  3L3U A;  1SL2 A;  4N41 A;  4KHW A;  3WNF A;  4CGG A;  4E1N A;  4Q5V A;  3OYC A;  3AVG A;  1Q9X A;  4CF2 A;  5J2P A;  3KLF A;  1NK8 A;  1S5J A;  1N5Y A;  1KFS A;  2OA8 A;  1HYV A;  4K8X A;  1TVR A;  3IRX A;  2ETJ A;  4HCC A;  4I2Q A;  3AO3 A;  1JL1 A;  1WNS A;  4LH5 A;  4DSJ A;  2HND A;  5J1E A;  3LAM A;  1NK9 A;  2IC3 A;  3AVA A;  3LDS A;  4W5N A;  2VG5 A;  2X74 A;  3MEC A;  4F3O A;  2ITG A;  1BI4 B;  4K8Z A;  4R5P A;  4Y1D A;  3RWU A;  4IFV A;  3V1R A;  1VSM A;  1WN7 A;  1LWF A;  2XY7 A;  3DOK A;  4FJG A;  4DTJ A;  4M3T A;  4CEQ A;  1KVB A;  1JLG A;  4IG3 A;  5K14 A;  1NKB A;  1VSJ A;  3MAQ A;  3V1Q A;  2OZS A;  2QK9 A;  4E3S A;  2O4I A;  3EY1 A;  1RT3 A;  3MEG A;  1IG9 A;  2BE2 A;  4FM0 A;  4LY7 A;  4KB1 A;  3PY8 A;  1REV A;  4OGE A;  5I42 A;  1T8E A;  3VQC A;  3MEE A;  3LPU A;  4CJW A;  3I0S A;  3LPT A;  4W5O A;  3EYZ A;  3K59 A;  3HPG A;  1WSF A;  5CZ1 A;  3NAE A;  2AJQ A;  2XO7 A;  2YNI A;  4E7I A;  1X9W A;  3RR7 A;  1ASU A;  1Y97 A;  4ICL A;  4CHP A;  3OJS A;  4FJ8 A;  4CJL A;  3V9U A;  2OPR A;  4CF8 A;  4IDK A;  4FCY A;  3PX0 A;  4DU3 A;  4AHT A;  2YNG A;  3DRP A;  1U04 A;  1RBS A;  3V1O A;  1TK8 A;  3KIO A;  4DF4 A;  2JLE A;  4FJ7 A;  2XHB A;  1RT2 A;  3HXM A;  1BGX T;  3ZT3 A;  3LAK A;  1S1W A;  4CJE A;  2RKI A;  5C42 A;  4BE0 A;  4FLW A;  1KFD A;  4E89 A;  1ZBH A;  3OYF A;  1S1T A;  2B5J A;  3VQQ A;  4W5T A;  3LWL A;  1RTD A;  3PO4 A;  1HNI A;  4HVJ A;  1RBU A;  4DTN A;  3C95 A;  3NHG A;  4QAG A;  4IKF A;  1ZYQ A;  2G8V A;  2B4J A;  3KLH A;  1TGO A;  4OLA A;  1U48 A;  1NJZ A;  2FBV A;  3AVN A;  3L2W A;  4KHS A;  2G8F A;  1JKH A;  3OYB A;  4HUE A;  4E0D A;  4Q0B A;  1BIU A;  4Z4C A;  4W5R A;  4CJ5 A;  3ULD A;  3KLI A;  3ZSO A;  3OJU A;  4C8O A;  1FKO A;  1S1V A;  4I2P A;  3LZI A;  3AA5 X;  2EHG A;  3NGZ A;  1BL3 A;  4HCB A;  4KRF A;  3HK2 A;  1VSF A;  3HYF A;  2VWK A;  3NF8 A;  3VQA A;  2IGI A;  4DLG A;  4FLY A;  3PO5 A;  4FJH A;  1C0T A;  4FZX C;  1ASW A;  1BCM A;  2YHA A;  5C25 A;  3AA4 A;  2ZQB A;  4FJK A;  2E4L A;  2BDP A;  4CEE A;  3DLR A;  1TAU A;  3QEW A;  4CFB A;  3TWH A;  4Z0U A;  4CE9 A;  3T3F A;  1C0U A;  2D0B A;  1GOC A;  2LSN A;  1KVA A;  3QIP A;  1QE1 A;  4DU4 A;  4NYN A;  3CQ8 A;  1B92 A;  4JRQ A;  2P1J A;  1D9D A;  4B9S A;  1R0A A;  1ITG A;  4B9T A;  3MXM A;  1HYS A;  2HHW A;  4H4M A;  5CZ2 A;  1Z25 A;  2KTQ A;  3DOL A;  4PY5 A;  1TK0 A;  4N56 A;  1D9F A;  3QEX A;  4B9M A;  4FK4 A;  4CHO A;  3DRS A;  1KTQ A;  5JS2 A;  4AH9 A;  1WLJ A;  1XWL A;  3HP9 A;  4NCG A;  3RR8 A;  1NKC A;  1S6Q A;  4N47 A;  4N5S A;  4C8K A;  4KHQ A;  4M3X A;  1D5A A;  2Z1G A;  4E7H A;  3SQ2 A;  4DSF A;  1CZ9 A;  3DLE A;  1D8Y A;  1SV5 A;  4LSN A;  4JLH A;  1YT3 A;  4KFB A;  1HQU A;  3E01 A;  2DY4 A;  4Z4F A;  1YTA A;  1S6P A;  3DRR A;  1LAW A;  1U45 A;  1L3U A;  5KRT A;  3OYI A;  4DTU A;  1QQC A;  2Z1J A;  4KTZ A;  2B6A A;  1RNH A;  1IH7 A;  1U47 A;  1TL1 A;  1DTT A;  5J2N A;  3PX4 A;  1W9H A;  3ZSY A;  4FK2 A;  1VSH A;  4CER A;  4CGJ A;  3AVC A;  3QEP A;  1XHX A;  3P1G A;  3VQ8 A;  1YTU A;  4DG1 A;  4OKE A;  2FBY A;  4PQU A;  1BHL A;  4M42 A;  3WNH A;  3CM5 A;  3LAL A;  4I9L A;  4DWI A;  3K2P A;  1NOY A;  3NH2 A;  3QEV A;  1UOC A;  4DSL A;  4Z4I A;  5CYQ A;  1HPZ A;  1U49 A;  4CJ3 A;  3TI0 A;  4B8A B;  3NGY A;  4CHN A;  4E7L A;  4FJ5 A;  1HRH A;  4Z4H A;  4DU1 A;  4I7F A;  4JRP A;  4FYD A;  4EZ6 A;  3A2F A;  3VA0 A;  4M3W A;  3ASM A;  3SZ2 A;  3AO5 A;  3V6D A;  1RDC A;  2GUI A;  3OYD A;  2RPI A;  4RW4 A;  4AHV A;  4KI6 A;  1L5U A;  1ZBI A;  3P5J A;  2QXF A;  4IFY A;  4NCB A;  4M41 A;  4OLB A;  1Z26 A;  4LSL A;  4PWD A;  2VG6 A;  4CIF A;  2OYQ A;  1RBR A;  1WSE A;  1ZBF A;  4DFK A;  4CGI A;  3RRG A;  3AA2 A;  2HW3 A;  2E6L A;  1RBT A;  4CFD A;  4F4K A;  3TR8 A;  3ZSQ A;  4CJ4 A;  1I3A A;  3OYN A;  1IKX A;  1JLC A;  2X6N A;  3QES A;  3MXI A;  5J2Q A;  3SNN A;  3L2R A;  3OS2 A;  3TAM A;  1CXU A;  1RBV A;  2YNH A;  4CK3 A;  3QNO A;  3VQ4 A;  1U4B A;  4DQR A;  4M3U A;  1IKW A;  3HVT A;  2XY5 A;  1XC9 A;  1RT1 A;  2IS3 A;  3HP6 A;  4DQS A;  4E7J A;  3IAY A;  3KD5 E;  1TV6 A;  4FM2 A;  4E7K A;  3TAE A;  3LP1 A;  3EZ5 A;  2ZE2 A;  2YKM A;  3LP3 A;  4IG0 A;  3VQP A;  4DTO A;  2OPP A;  4CCH A;  4BAC A;  4CJV A;  4F3T A;  1JLQ A;  1S1U A;  3KKS A;  1IKV A;  3O3H A;  1RDD A;  3AO2 A;  3VA3 A;  3CYM A;  2Z1H A;  3ZSR A;  5HRP A;  1T7P A;  1KLM A;  4B3O A;  1J9A A;  4FZZ A;  2HHX A;  4ELT A;  3I8D A;  1KCF A;  3SPY A;  4DQI A;  3DI6 A;  3ZSV A;  4OPK A;  3RMB A;  2KW4 A;  3WNE A;  3S9H A;  4DTM A;  4FW1 A;  5CY4 A;  2EX3 A;  3U3Y A;  3QEI A;  4O44 A;  3VQD A;  3SJJ A;  4RW8 A;  3SPZ A;  2G8U A;  1JL2 A;  1LWE A;  1SL0 A;  2G8K A;  1ZBL A;  1T05 A;  2VWJ A;  4B9N A;  4CEB A;  4CF0 A;  4OJR A;  1EXQ A;  4OPJ A;  4KPY A;  4QCL A;  1C1A A;  4WE1 A;  2GBZ A;  3C6U A;  3NF7 A;  4CHQ A;  4MQ3 A;  3LZJ A;  1VK0 A;  1RIL A;  3LP0 A;  3VQE A;  4F8R A;  3KK3 A;  5SZT A;  2Q3S A;  1W0H A;  2G8H A;  4KHN A;  4DSI A;  2BAN A;  1DLO A;  3OYK A;  1XI1 A;  1C0M A;  3HPO A;  1LV5 A;  3SUQ A;  1RTH A;  1Q9Y A;  1HYZ A;  4M3Z A;  1K6Y A;  1J53 A;  3IG1 A;  4FK0 A;  3VQB A;  1UAX A;  3HM9 A;  2P5G A;  4CED A;  4CJK A;  3D0P A;  4FLV A;  4B9U A;  1S9G A;  2A1R A;  4OVL A;  3V9Z A;  4CHY A;  1RDB A;  1X1P A;  3OYG A;  5D3G A;  5FRN A;  1GOB A;  3F9K A;  2G8I A;  5HRS A;  3KD1 E;  5HP1 A;  4CJQ A;  3SQ4 A;  3ITH A;  1VSK A;  1TKX A;  1B9F A;  2XY8 A;  3KLG A;  4FJI A;  3M8R A;  4DLE A;  1WSG A;  2QKB A;  4DTR A;  2HVH A;  1ASV A;  1SUQ A;  3U3G A;  4ID1 A;  3S3O A;  3BGR A;  3D45 A;  2HMI A;  5KGX A;  2G8W A;  1UA1 A;  1TKD A;  2HHT A;  4HUF A;  3P83 D;  4FLU A;  5C24 A;  1QS4 A;  3K5N A;  3TAP A;  2Y1I A;  1S1X A;  4CHZ A;  1G15 A;  2ATQ A;  2XY6 A;  3KJV A;  4KRE A;  2A1S A;  4DS4 A;  1TKT A;  1WSH A;  2HNZ A;  5KI6 A;  4CEA A;  3DLG A;  3ZSW A;  4ZHR A;  3OS0 A;  1L3T A;  5FRM A;  3H08 A;  4AHR A;  1EX4 A;  4FJN A;  4FJ9 A;  5HBM A;  3QET A;  1QSY A;  1B9D A;  1RCH A;  3AVB A;  4Z4G A;  1GOA A;  2OZM A;  1WSI A;  3KK1 A;  2P5O A;  4J2B A;  1JLE A;  3ZSZ A;  1RTJ A;  1A5W A;  2IDO A;  4CGF A;  3SQ0 A;  1CLQ A;  3B6P A;  1BQM A;  3VQ5 A;  3O4Q A;  2PZS A;  2HHS A;  3CFP A;  4J2D A;  2FBT A;  3G0Z A;  1A5V A;  2IAJ A;  3AVH A;  3TAG A;  4AHC A;  4YNQ A;  4CJR A;  1L3S A;  4ELU A;  3K58 A;  4O0J A;  1NK6 A;  1A5X A;  1WAF A;  1BIZ A;  1JXB A;  4CFA A;  3TAN A;  3RMA A;  1UWB A;  2IOC A;  1KVC A;  3DM2 A;  5E41 A;  1SKR A;  5KRS A;  4HTU A;  4F2R A;  4H4O A;  2RF2 A;  3AVI A;  3C94 A;  5EU7 A;  4IBN A;  3OS1 A;  4J2A A;  3HVR A;  1NK4 A;  4JS4 A;  3L3V A;  2XRI A;  3VQ9 A;  4C8L A;  1VRT A;  4CFC A;  1KSP A;  1EKE A;  2DTU A;  3HST B;  4CJS A;  4GMJ B;  3ZCM A;  3SI6 A;  4GW6 A;  4DFJ A;  3TAB A;  3KTQ A;  1HQE A;  1ZBU A;  3CG7 A;  3OYH A;  1BI4 A;  4CF1 A;  1F21 A;  1RTI A;  3NGI A;  3M8Q A;  4EP5 A;  3NH0 A;  3NCI A;  5J2M A;  4M45 A;  1NJW A;  1KLN A;  1NOZ A;  3DLH A;  4FJX A;  4B8C A;  3V9W A;  1O1W A;  3MED A;  1IO2 A;  4O0I A;  4DTP A;  2D0A A;  1SL1 A;  4CEO A;  4M3Y A;  3ALY A;  4O4G A;  4FVM A;  1LWC A;  2E6M A;  1TL3 A;  5T7B A;  2R7Y A;  5SWM A;  3HO1 A;  3NF9 A;  3HPH A;  4C8M A;  4FLT A;  1SKW A;  4CIG A;  5I3U A;  2JGU A;  4XIU A;  3ISN C;  3LAN A;  3ZSX A;  1C1C A;  3G10 A;  1QSL A;  4O5B A;  4M3R A;  1HMV A;  1VRU A;  4LH4 A;  4DS5 A;  4BWJ A;  3RMD A;  3T1A A;  3SUO A;  3QIN A;  4DSE A;  2F96 A;  3I0R A;  3QO9 A;  5FDL A;  4F2S A;  5FRO A;  2I5J A;  4E19 A;  3DMJ A;  1FK9 A;  2KZZ A;  3C6T A;  1LAV A;  4HUG A;  4DFP A;  4UQG A;  4YFU A;  4OGC A;  3OYM A;  3KK2 A;  1NK7 A;  4KHU A;  4KV8 A;  3RRH A;  3T19 A;  4NYF A;  2YHB A;  3OYJ A;  3L2Q A;  4FJL A;  3OY9 A;  3SCX A;  1NJY A;  4CJP A;  2KFN A;  5DMR A;  4AHS A;  3S3N A;  2ZD1 A;  1C6V A;  3CFR A;  1WSJ A;  3NDK A;  4RW9 A;  1CZB A;  1EET A;  4AHU A;  3DLB A;  4FW2 A;  3VQ7 A;  2NUB A;  3CFO A;  4EP4 A;  4B9L A;  1QTM A;  3OYE A;  3DLK A;  3QIO A;  4L8R B;  4ELV A;  3K5M A;  4FXD A;  3SUN A;  3OYA A;  4H8K A;  1RDA A;  2W42 A;  1UA0 A;  3AVJ A;  3L8B A;  1TAQ A;  3PUF A;  2KQ2 A;  3AO4 A;  4KI4 A;  4N76 A;  3RMC A;  1BIS A;  3AV9 A;  5HRO A;  3NH1 A;  1BCO A;  1YVU A;  4CES A;  2PY5 A;  4CIE A;  3HT3 A;  3TAQ A;  1XHZ A;  4GVM A;  3FFI A;  3THV A;  3OYL A;  1FXX A;  2D0C A;  4KB0 A;  3AVM A;  2YNF A;  4FJM A;  4AIL C;  2BGG A;  4CJU A;  2RN2 A;  3ZT4 A;  2OPQ A;  2FBX A;  3ZT2 A;  3SYZ A;  1I39 A;  3V4I A;  4BE2 A;  4CGH A;  1JLB A;  4W5Q A;  3IS9 A;  3L2V A;  2KZM A;  2Z1I A;  3QNN A;  2P51 A;  3V81 A;  1J5O A;  4OKJ A;  3KLE A;  5DK5 A;  4FZY A; 
#chains in the Genus database with same CATH topology
 3VEW A;  3WXL A;  3SV4 A;  2WON A;  3RTV A;  3GG4 A;  4IEI A;  4JEP A;  4BRA A;  2NRH A;  2YKN A;  3WT0 A;  4DR7 K;  1S9E A;  4FM1 A;  3DLL L;  4X66 K;  4G1Q A;  3OW2 M;  2WBN A;  1T03 A;  5KTQ A;  1S72 N;  1H1V A;  4H5T A;  3TAR A;  1RT4 A;  3PX6 A;  3D2E B;  4BE1 A;  3K5L A;  3VTH A;  4JKA A;  4AF1 A;  3F73 A;  4KH4 A;  2Y1J A;  3O4N A;  4B1U B;  3L2U A;  3SV3 A;  3LP2 A;  1Z05 A;  1EP4 A;  4WQ4 A;  1NGJ A;  1VSE A;  2AP1 A;  3K57 A;  3NF6 A;  1YJN N;  2X6S A;  4B08 A;  4PA1 A;  4DTX A;  4BWM A;  1C1B A;  1X3N A;  3AO1 A;  3JS6 A;  4DFM A;  3SQ1 A;  3PV8 A;  1YIT N;  3LDN A;  3QDK A;  2A41 A;  4DV3 K;  4KTQ A;  5AQL A;  3ZX3 A;  3WQU A;  4CF9 A;  3AVK A;  2ASP A;  4PUO A;  2PYL A;  4CD3 A;  1IKY A;  2E88 A;  2O8E B;  5AJ3 K;  4FJJ A;  4OKK A;  4BRF A;  2NRR A;  3U6F A;  2P9I A;  2HHU A;  1SZ2 A;  1OKJ A;  3UIQ A;  2DFH A;  3OTO K;  4J2E A;  4CK2 A;  1YUW A;  2UYT A;  1SL2 A;  4N41 A;  4KHW A;  4E1N A;  3RSE A;  3AVG A;  3KLF A;  1FW6 A;  4DV0 K;  3Q7B A;  1TVR A;  4CVN E;  3THY B;  2H3G X;  2QXL A;  3AO3 A;  2P9L B;  4LH5 A;  2I7N A;  3LAM A;  4CZL A;  3LDS A;  4W5N A;  4CZM A;  3MEC A;  4K8Z A;  3O1W A;  2W41 A;  3D2F A;  4RTF D;  4Y1D A;  4B9Q A;  4IFV A;  4CEQ A;  2QWL A;  3H1Q A;  1VQ7 N;  2QK9 A;  4E3S A;  4LY7 A;  1ZC6 A;  4OGE A;  3AY9 A;  3Q7C A;  4CJW A;  3NAE A;  3LPT A;  3K59 A;  3OJS A;  4M63 C;  3PX0 A;  4DU3 A;  4AHT A;  2YNG A;  3DRP A;  1HNW K;  2KHO A;  2UUB K;  4LF6 K;  2QWO A;  3FZF A;  1RT2 A;  5CR4 A;  4LF8 K;  1OVQ A;  5C42 A;  1HR0 K;  2VGM A;  5HL7 L;  4FLW A;  1ZBH A;  1S1T A;  1RTD A;  1HNI A;  4HVJ A;  2YJF A;  4X62 K;  3U8X A;  4QAG A;  2B4J A;  3KLH A;  4OLA A;  4A59 A;  1C0F A;  3L2W A;  2G8F A;  1QQM A;  1JKH A;  3IUC A;  2GTD A;  1BIU A;  3ULD A;  3DJC A;  2FSN A;  4JI3 K;  3VEY A;  1S1V A;  3UKU B;  2Q0U A;  4HCB A;  1NG9 A;  5AZI A;  3HYF A;  3VQA A;  4FZX C;  1ASW A;  3AA4 A;  2O8C A;  3HSC A;  3UKR A;  4BR4 A;  4H5V A;  2JWL A;  4Z0U A;  4CE9 A;  2D0B A;  3QIP A;  1VQ9 N;  4A61 A;  4CBX A;  1NMD A;  1D9D A;  2D0O A;  2HHW A;  3JAM O;  2KTQ A;  1W7A A;  2V51 B;  2WTU A;  4PY5 A;  1RDU A;  1TK0 A;  3QEX A;  4FK4 A;  1GLD G;  5JS2 A;  1XWL A;  1FJG K;  4YY3 K;  1NKC A;  4N5S A;  4C8K A;  4M3X A;  3F5T A;  1SV5 A;  4LSN A;  2UXC K;  4BRG A;  3SBT A;  1HQU A;  4JI1 K;  1YTA A;  1S6P A;  5AQM A;  3DRR A;  1LAW A;  1U45 A;  1RNH A;  5F1X A;  2E2N A;  5F2R A;  2E20 A;  3ZSY A;  3H6E A;  4BR2 A;  1GLB G;  1XHX A;  2FBY A;  4M42 A;  1NGF A;  4H0X B;  4DWI A;  1NOY A;  4DSL A;  5CYQ A;  4FWQ A;  3C7N B;  4FJ5 A;  1ILY A;  4Z4H A;  4DU1 A;  4JRP A;  3VA0 A;  1NGI A;  1OH8 A;  1KXP A;  1N36 K;  4OLB A;  1Z26 A;  3MX5 A;  2OTL N;  2VG6 A;  2OYQ A;  1ZBF A;  1WSE A;  4DFK A;  4PL7 A;  2ZF5 O;  2NRW A;  3R3L A;  5ADX A;  1JCF A;  2HST A;  1T3V A;  5J2Q A;  3OS2 A;  3TAM A;  1CXU A;  4CK3 A;  5C15 A;  4NO7 A;  1IKW A;  3KD5 E;  1IJJ A;  4FPB A;  4FM2 A;  3LP1 A;  2YKM A;  4IZ9 A;  3VET A;  4BAC A;  4WQ5 C;  1S1U A;  1YI2 N;  1M1K O;  3AO2 A;  3CYM A;  1T7P A;  2P9U B;  1KLM A;  4H0P A;  4WFB L;  4B3O A;  5LJV A;  3I8D A;  3SPY A;  3DI6 A;  2KW4 A;  4XH1 A;  4FW1 A;  1VQ5 N;  3E9O A;  1JL2 A;  1EXQ A;  2QWN A;  4OPJ A;  3D6R A;  1XMQ K;  4KPY A;  1C1A A;  4WE1 A;  4CHQ A;  4DUY K;  3VQE A;  5SZT A;  1NGC A;  1C0M A;  2P9P A;  4JKG A;  1Q9Y A;  3VGL A;  1K6Y A;  4CED A;  3D0P A;  1YAG A;  4BRP A;  4CHY A;  1RDB A;  3OYG A;  2G8I A;  4B1W B;  1GOB A;  1P8Z A;  5HRS A;  3KD1 E;  5HP1 A;  2RE2 A;  4BQZ A;  1TKX A;  3N4P A;  5JMV A;  2HVH A;  1SUQ A;  1QQO A;  5JIC A;  3U3G A;  3D45 A;  3NVK A;  5KGX A;  4FLU A;  1QS4 A;  4YHH K;  1NGE A;  1HKG A;  3SJH A;  1QZ6 A;  3QBW A;  2QWP A;  5AQQ A;  2A1S A;  3CQX A;  4DS4 A;  4BC2 A;  3THW A;  2HNZ A;  4ZHR A;  3DLG A;  3ZSW A;  3O08 A;  3CPW M;  5GAD P;  2P5O A;  1JLE A;  2W6L A;  5AQR A;  3EKS A;  3SQ0 A;  1ATR A;  4J2D A;  2FBT A;  3TAG A;  4YNQ A;  1L3S A;  4OX9 K;  3K58 A;  4O0J A;  1A5X A;  4CFA A;  1JXB A;  2QM1 A;  3FFK B;  3DM2 A;  3E9L A;  5KQD A;  5KRS A;  1EWR A;  4H4O A;  1VQP N;  5EU7 A;  2O8B B;  3O5B A;  3OS1 A;  3HVR A;  1NK4 A;  4CZK A;  3L3V A;  2XRI A;  4JS4 A;  4IOX A;  1VRT A;  1EQY A;  2FF3 B;  4MO4 A;  4CJS A;  3ZCM A;  3SI6 A;  4DFJ A;  2E2P A;  3CG7 A;  3IKM A;  1RTI A;  3BF1 A;  3M8Q A;  4EP5 A;  1NOZ A;  4FJX A;  4AQY K;  1RFQ A;  4B8C A;  1O1W A;  4DTP A;  1HLU A;  2BUP A;  3DXM A;  1MA9 B;  4FVM A;  4JI0 K;  5SWM A;  1MWK A;  3HPH A;  1YIJ N;  1K8K B;  2P9N B;  1C1C A;  3SMS A;  1VRU A;  3RMD A;  3SUO A;  1VQ6 N;  2NZT A;  4GV6 A;  3QO9 A;  5FDL A;  5FRO A;  4DKW A;  3ZET A;  3C6T A;  3EZW A;  4HUG A;  4IXC A;  4A62 A;  1KAX A;  4EAH D;  4YFU A;  3KK2 A;  4KHU A;  3OYJ A;  4IWV A;  3SCX A;  1OH6 A;  5EVZ A;  3ZYY X;  1T44 A;  4RW9 A;  4FW2 A;  1IBL K;  3OYE A;  3DLK A;  3QIO A;  4ELV A;  4WYB A;  1RDA A;  3D7E O;  1TAQ A;  3PUF A;  4GV9 A;  2KQ2 A;  2W6K A;  4NXN K;  3MN7 A;  3RMC A;  1BIS A;  3NH1 A;  4JD2 B;  1BCO A;  1JCE A;  2A3Z A;  1YVU A;  5AQX A;  5EOY A;  4JI5 K;  4GVM A;  2HF3 A;  5LY3 A;  2D0C A;  4AIL C;  4CJU A;  3ZT4 A;  1WBB A;  2OPQ A;  2FBX A;  4LFB K;  1I39 A;  3V4I A;  3VTI A;  2KZM A;  2Z1I A;  4OKJ A;  5DK5 A;  4K42 A;  1D4X A;  3E66 A;  4Y1C A;  5GAE P;  1J54 A;  3AA3 A;  5C2F A;  4CZI A;  4RW6 A;  2DFF A;  3A5N C;  1TK5 A;  4ZTF A;  2F7T A;  4DQ8 A;  1MU2 A;  3THX B;  4DSK A;  3BZK A;  4CK1 A;  5ADX H;  1N34 K;  5GIN A;  2WOM A;  3HJF A;  2HHV A;  4DTS A;  1QVG M;  2GUP A;  3AVL A;  3TTD A;  3JSM A;  1WAJ A;  4IEE A;  4KO0 A;  1Q8I A;  3EN9 A;  4B3T K;  2NRZ A;  2YJE A;  4DV7 K;  1E4G T;  3U9Z A;  5AQW A;  3KKR A;  4MDB A;  4FWK A;  4DCH A;  3ZT1 A;  4CBW A;  3M1F A;  1NJX A;  3V9X A;  2VYP A;  2F9W A;  4JS5 A;  4FLZ A;  3QER A;  1IG8 A;  1YXQ A;  4KKO A;  3WNG A;  3BDP A;  3M8P A;  4DMN A;  3QBX A;  4FSV A;  2F8T A;  3QLH A;  1NM1 A;  2DFE A;  4DQP A;  3LDO A;  4I9Q A;  2I7P A;  3VN5 A;  4DR4 K;  3E9P A;  4CEZ A;  3OVN A;  2P9K A;  3K5O A;  1KRP A;  2GWJ A;  1L3V A;  1LW2 A;  4MLE A;  3NBP A;  4CJT A;  1TKZ A;  4PKH A;  4MLH A;  5HLF A;  4RW7 A;  4CJF A;  4ZTJ A;  3VMF B;  1V4S A;  4CJ7 A;  5KGW A;  4MFB A;  3C65 A;  2D5R A;  2BTF A;  5M1P A;  4HHT A;  3P4I A;  3CM6 A;  3QFU A;  4CGG A;  2V7Z A;  5CHI A;  1Q82 O;  5J2P A;  1X3M A;  1N5Y A;  1HYV A;  3A0I X;  1XUP O;  2ETJ A;  1DGK N;  1JL1 A;  1WNS A;  4DSJ A;  5J1E A;  1N33 K;  1NK9 A;  2IC3 A;  4YOR A;  5GAH P;  3VPZ A;  4F3O A;  5IT9 O;  1BI4 B;  2A40 A;  4R5P A;  1WN7 A;  3DOK A;  5K14 A;  1KVB A;  4IG3 A;  4JI7 K;  3H3N O;  2P9I B;  2CH6 A;  3EY1 A;  3MEG A;  3PY8 A;  1REV A;  4IFE A;  5I42 A;  1T8E A;  4H0O A;  2KLA A;  4BC3 A;  3UB5 A;  3I0S A;  3HPG A;  1WSF A;  5CZ1 A;  1VQK N;  3MX2 A;  2YNI A;  5A2Q O;  1ASU A;  1Y97 A;  4CZF A;  4FJ8 A;  4CJL A;  2FF6 A;  1RBS A;  3RSE B;  1TK8 A;  4FJ7 A;  1W97 L;  2RKI A;  4DB3 A;  1Y64 A;  3K0S A;  4W5T A;  1GLE G;  4Z94 A;  3J7Z O;  3PO4 A;  3CQY A;  4A5A A;  4DTN A;  3C95 A;  2UU9 K;  4MO5 A;  2G8V A;  1U6Z A;  2FBV A;  1VQO N;  3CJ9 A;  1YJ9 N;  2ASO A;  5LL6 Z;  4HUE A;  1LOT B;  4W5R A;  3GL1 A;  3KLI A;  2V7Y A;  3WEE A;  4JK7 A;  3CIP A;  5EX5 A;  3GBT A;  3LZI A;  1SS6 A;  1X9J A;  2RHK A;  4KRF A;  3SAF A;  3NF8 A;  4DLG A;  2IGI A;  4HWI A;  3PO5 A;  3PLA A;  5BN8 A;  2NLX A;  1HKB A;  4JAX A;  3VF6 A;  5C25 A;  2HBJ A;  2ZQB A;  4CEE A;  1SQK A;  3TWH A;  2LSN A;  2P1J A;  4FPA A;  1R0A A;  3BZC A;  3ULE A;  1DKG D;  2F4V K;  5CZ2 A;  4QS7 A;  4N56 A;  3HP9 A;  4NCG A;  1MDU B;  1S6Q A;  1HJO A;  3SQ2 A;  5JVH L;  3EE8 A;  4BRO A;  3T1Y K;  4BRH A;  3O9U A;  4DTU A;  4KTZ A;  5AZI B;  5J2N A;  1VSH A;  4CER A;  3AVC A;  3P1G A;  4FL9 A;  2CH5 A;  2O8C B;  3BEX A;  3UKR B;  3WNH A;  3LAL A;  3K2P A;  4Z4I A;  2VQF K;  1HPZ A;  4H5W A;  1VQ4 N;  1U49 A;  1MWM A;  3DWL A;  3TI0 A;  3MN9 A;  3VF4 A;  3NGY A;  4E7L A;  4BRC A;  4I7F A;  4YOY A;  4EZ6 A;  3BF3 A;  4BGA A;  5HOO A;  1RDC A;  3CC7 N;  4B3S K;  4KI6 A;  3R1X A;  2GEL A;  1XNR K;  2QEX N;  3AA2 A;  2HW3 A;  2QTD A;  2E6L A;  4CFD A;  4DV1 K;  3ZSQ A;  1IKX A;  2X6N A;  3QES A;  3SNN A;  3CJC A;  3QNO A;  1ESV A;  1IV0 A;  3VEO A;  4DQR A;  2XY5 A;  1RT1 A;  4M3U A;  4E7K A;  1NWK A;  2ZE2 A;  3LP3 A;  4IG0 A;  5AZJ A;  4CJV A;  1NLV A;  2PBD A;  3KKS A;  1IKV A;  4OO1 J;  1RDD A;  2Z1H A;  3I8B A;  4FZZ A;  4ELT A;  3VER A;  4I6M B;  4OPK A;  4BR9 A;  2EX3 A;  3U3Y A;  2IVP A;  3J7Y P;  1LWE A;  4JI6 K;  3WUH A;  3HBT A;  5AQZ A;  4CEB A;  3MN5 A;  4CF0 A;  4CZH A;  1E4F T;  3N4Q A;  3D2E A;  3C6U A;  1IBK K;  1NNE A;  3LZJ A;  3WXI A;  1HPM A;  4F8R A;  2G8H A;  4KHN A;  1T6D A;  2E5L K;  3HPO A;  3KWG A;  3IG1 A;  1J53 A;  3EO3 A;  3HM9 A;  1UAX A;  4CJK A;  3VEN A;  2O8D A;  4B3R K;  5FRN A;  1X1P A;  4CZG A;  4CJQ A;  1VSK A;  4FJI A;  3M8R A;  1NJI O;  4BRQ A;  3O9R A;  1TKD A;  2HBK A;  1GLF O;  3P83 D;  1ZBS A;  2OTJ N;  3VEZ A;  2Y1I A;  1G15 A;  4WQ5 A;  2QWQ A;  3KJV A;  3P38 A;  5KI6 A;  3OS0 A;  5FRM A;  1L3T A;  4AHR A;  1EX4 A;  4FJ9 A;  4JKG B;  1B9D A;  1GOA A;  3KK1 A;  4J2B A;  2IDO A;  1CLQ A;  2WFB A;  1BQM A;  1Q81 O;  2PZS A;  2HHS A;  2Q0R A;  3G0Z A;  3AVH A;  4CJR A;  4CBU A;  3TAN A;  1UWB A;  3SLC A;  1KVC A;  3SMP A;  1OH5 A;  4J2A A;  3THY A;  4JNE A;  4FVU A;  2IIR A;  2P9L A;  3HST B;  1VQL N;  3KTQ A;  3TAB A;  2A5X A;  2O8F A;  4CF1 A;  1F21 A;  2YCH A;  3DAW A;  3J8A A;  3MED A;  3QFP A;  1SL1 A;  4YOW A;  4FOI A;  2R7Y A;  1TL3 A;  4FWL A;  1XC3 A;  5KPR A;  1E3M A;  3J80 O;  2JGU A;  3CI5 A;  3LM2 A;  4XIU A;  3ZSX A;  1QSL A;  4BR5 A;  4O5B A;  1ATS A;  4LH4 A;  1BUP A;  1VQ8 N;  1RDW X;  1HNX K;  3VGM A;  5E26 A;  2EWS A;  2NRT A;  3OYM A;  4KV8 A;  4NYF A;  3OY9 A;  1NJY A;  3FGU A;  5DMR A;  4EIA A;  1NGA A;  1C6V A;  3CFR A;  1BOT O;  1WSJ A;  3NDK A;  4AHU A;  3DLB A;  4BR7 A;  4BRK A;  1XMO K;  3L4Q A;  4B1Z A;  3K5M A;  4FXD A;  4H8K A;  3VOV A;  2W42 A;  3L0Q A;  1UA0 A;  3AVJ A;  3L8B A;  4RCH A;  3AO4 A;  3DXM B;  4N76 A;  3DXK A;  4BRE A;  3CC4 N;  3AV9 A;  3ZEU B;  3UKU A;  3VEX A;  4CIE A;  3HT3 A;  4IOA L;  4LC9 B;  3OYL A;  1FXX A;  4KB0 A;  2YNF A;  2ITM A;  4JKH A;  1U2V B;  4IO8 A;  5AR0 A;  3TU5 A;  5AQT A;  5M1O A;  4E1J A;  3SYZ A;  4BE2 A;  1JLB A;  2IVN A;  1TUU A;  3L2V A;  3EEQ A;  3QNN A;  3WXM B;  3KLE A;  5CYM A;  3H3O B;  3NFA A;  4NCA A;  4CW7 B;  5FLX O;  5HRR A;  4EZ9 A;  3ENH A;  4ILH A;  4CGD A;  1TYQ A;  2YI1 A;  4KAZ A;  2W40 A;  1J6Z A;  4H0V B;  1YF5 L;  5KQ8 A;  4KTW A;  5H1S Q;  4RG8 A;  1BA1 A;  4BVP A;  3B6O A;  1NK5 A;  1HNV A;  5LMU K;  4U67 L;  4JHD A;  3H45 C;  4Y0W A;  3O4W A;  1NK0 A;  1DTQ A;  4FLX A;  3CCE N;  3C7N A;  4BDY A;  1XNQ K;  4J8F A;  1WOQ A;  3HRG A;  5BR9 A;  1HKC A;  3MWT A;  4PKI A;  1SKS A;  4E1M A;  4JKF A;  3G4S N;  1HJR A;  3DYA A;  3WXJ A;  1X9M A;  2HB5 A;  3OBW A;  3FZH A;  3WXK A;  1VSL A;  4Z4E A;  1QHT A;  1QSS A;  3NE6 A;  4LF9 K;  2KFZ A;  4DF8 A;  3J7A P;  4KHP K;  2F8S A;  2FC0 A;  1FKP A;  5AQS A;  3M5R A;  1VSI A;  1N6Q A;  3HL8 A;  5KPT A;  4DQQ A;  4BDP A;  5HRN A;  4DR2 K;  2QA4 N;  3O3G A;  2P9U A;  1Q9X A;  5F0X A;  2VQE K;  4K8X A;  1BWF O;  2D0P A;  4HCC A;  3HM8 A;  3AVA A;  5CE3 A;  2X74 A;  1KAY A;  2ITG A;  1VQM N;  3RWU A;  3V1R A;  3ID8 A;  4M3T A;  4FJG A;  4DTJ A;  1JLG A;  1NKB A;  1VSJ A;  3MAQ A;  1OVY A;  3QB0 A;  5AQF A;  3FR0 A;  5M1K A;  3VGK A;  4FM0 A;  1NMN A;  4KB1 A;  3VQC A;  3EYZ A;  4W5O A;  1K8A O;  2NRX A;  4E7I A;  3RR7 A;  4NLC A;  3TSU A;  5C0Y A;  1U04 A;  3V1O A;  2HMP A;  3TTC A;  4DF4 A;  2E8A A;  1WUA A;  2HBL A;  2XHB A;  3HXM A;  3ZT3 A;  4E89 A;  5TKY A;  1V4T A;  2B5J A;  5BRE A;  3VQQ A;  4IDH A;  3NHG A;  3CD6 N;  1EWQ A;  4WFN L;  5BPM A;  1NJZ A;  2Q2R A;  3CHW A;  3CCS N;  3CPE A;  3R8E A;  3W3D A;  5C2D A;  4Q0B A;  3OJU A;  1FKO A;  4I2P A;  3TSP A;  2Q31 A;  2E1Y A;  1VSF A;  2VWK A;  4FLY A;  4FJH A;  4DV2 K;  3T1H K;  2CGJ A;  4K41 A;  4ISE A;  2E4L A;  3DLR A;  3QEW A;  4CFB A;  2O8B A;  4X64 K;  3FZK A;  3R6M A;  3T3F A;  2NRV A;  1GOC A;  4DU4 A;  1QE1 A;  1IBM K;  4BC4 A;  2HF4 A;  3CQ8 A;  3MDQ A;  4JRQ A;  4B9S A;  5M1F A;  1ITG A;  3HOS A;  4H4M A;  3SK3 A;  2GEM A;  1S22 A;  4B9M A;  3F2K A;  3DRS A;  4CHO A;  3M6G A;  4AH9 A;  1WLJ A;  4KHQ A;  2FSJ A;  4IJA A;  5FPM A;  1D5A A;  1HUX A;  2Z1G A;  3WQT A;  4JKE A;  4DSF A;  1CZ9 A;  3DLE A;  1D8Y A;  4ILG B;  2DY4 A;  4JLH A;  1YT3 A;  4KFB A;  3E01 A;  5TKW A;  4Z4F A;  3LDP A;  3I55 N;  1K8K A;  3LL3 A;  4BRL A;  2P9N A;  1L3U A;  1O13 A;  5KRT A;  3OYI A;  2Z1J A;  3KZB A;  3LM9 A;  1U47 A;  5MLC Q;  1W9H A;  3P31 A;  5AQU A;  3VQ8 A;  4DG1 A;  4OKE A;  4PQU A;  3C0B A;  4CJ3 A;  4B8A B;  4YOU A;  3ULE B;  1K9M O;  4FYD A;  3A2F A;  4M3W A;  3ASM A;  3AO5 A;  3ATV A;  3OYD A;  2RPI A;  4AHV A;  3CER A;  2A42 A;  3NMU A;  3MCA B;  1ZBI A;  4IFY A;  4NCB A;  4IO9 L;  4LSL A;  4CIF A;  1RBR A;  2HOE A;  3MN6 A;  4CGI A;  3RRG A;  4B1X B;  3MMV A;  5BRH A;  3M3Z A;  1RBT A;  4F4K A;  3TR8 A;  4CJ4 A;  3EL2 A;  4BRD A;  1I3A A;  3OYN A;  5AQI A;  2GWK A;  3CCL N;  2YNH A;  4M7Y A;  1U4B A;  3VQ4 A;  3CCM N;  3IDH A;  1XC9 A;  3IAY A;  4E7J A;  4DTO A;  3EZ5 A;  1DEJ A;  3VQP A;  4IOC L;  1Q7Y O;  2OPP A;  3CCQ N;  1JLQ A;  5KPZ A;  2IVO A;  3VA3 A;  1J9A A;  2HHX A;  3UE5 A;  1KCF A;  2E1Z A;  3I33 A;  2CGL A;  3WNE A;  3S9H A;  2UXD K;  5CY4 A;  5C12 A;  4O44 A;  2P9S A;  3VQD A;  4RW8 A;  2G8U A;  2G8K A;  1T05 A;  4A2B A;  2GBZ A;  2FSK A;  3D2F B;  3LP0 A;  1RIL A;  3O9S A;  3MCP A;  2ZGZ A;  1W0H A;  4DSI A;  2BAN A;  3T69 A;  1LV5 A;  4XEI A;  5BRF A;  3SUQ A;  1RTH A;  3PIP L;  4CZJ A;  3VQB A;  2P5G A;  3BY5 A;  4FLV A;  4PKG A;  4B9U A;  4NB4 A;  1S9G A;  3QML A;  5D3G A;  3F9K A;  3SQ4 A;  3ITH A;  2XY8 A;  3KLG A;  1WSG A;  2QKB A;  1VHX A;  1ASV A;  2JWK A;  3CXC M;  3S3O A;  3BGR A;  2HMI A;  1SAZ A;  4JV5 K;  3O1B A;  4HUF A;  5FPN A;  3K5N A;  1S1X A;  1EO1 A;  4KRE A;  3AAP A;  3CJ1 A;  1TKT A;  1WSH A;  3FZM A;  3ZX2 A;  1Q18 A;  4WCE L;  2BH1 A;  3FE1 A;  3QET A;  1QSY A;  1RCH A;  4K0K K;  2NNW A;  5GIO A;  2OZM A;  3ZSZ A;  1RTJ A;  3A5M C;  2O8D B;  4JKC A;  3CFP A;  4LF4 K;  4YDU C;  1A5V A;  4AHC A;  4YOT A;  3SAG A;  3A8Y A;  1NK6 A;  1BIZ A;  4C1N K;  5E41 A;  1SKR A;  2ASM A;  2RF2 A;  3AVI A;  3C94 A;  4MDA A;  4CFC A;  1KSP A;  1EKE A;  2DTU A;  4GMJ B;  4GW6 A;  1ZBU A;  3AAQ A;  3OYH A;  1BI4 A;  1BO5 O;  1XQS C;  3NGI A;  3NCI A;  5J2M A;  3DLH A;  4M45 A;  2UUC K;  3V9W A;  1IO2 A;  4C23 A;  4A57 A;  5BPL A;  4M3Y A;  3ALY A;  1LWC A;  4BGB A;  2YX6 A;  1SKW A;  4C8M A;  4FLT A;  3CCV N;  4CIG A;  5I3U A;  1CZA N;  3S41 A;  3LAN A;  3G10 A;  1T6C A;  3ZLJ A;  4DSE A;  4F2S A;  2I5J A;  2D4W A;  4E19 A;  3DMJ A;  4EFH A;  4FO0 A;  1R59 O;  4XH4 A;  2KZZ A;  1LAV A;  4OGC A;  1NK7 A;  2YHB A;  4FJL A;  5GIP A;  4AHS A;  3VES A;  3S3N A;  1KC8 O;  3FZL A;  1TUY A;  2WUS A;  2O8F B;  1CZB A;  1EET A;  1LCU A;  4BG8 A;  4UY8 O;  2NUB A;  3CFO A;  4EP4 A;  2A6A A;  2ZJQ L;  1QTM A;  4B9L A;  4L8R B;  3ENB A;  3E1Y A;  3OYA A;  3CET A;  2D1K A;  5JLF A;  4KI4 A;  3FLC O;  1BA0 A;  4WQ4 C;  1VAZ A;  3K9J A;  3TSQ A;  4CES A;  3TTF A;  3HZ6 A;  3TAQ A;  4A5B A;  1XHZ A;  1N32 K;  2E2Q A;  4JKB A;  3U9D A;  1BU6 O;  4DR3 K;  3THV A;  4FJM A;  3C6A A;  2RN2 A;  5AFU H;  4A2A A;  3ZT2 A;  4BR0 A;  3LDQ A;  4CGH A;  4W5Q A;  1J5O A;  4CCH A;  2YHW A;  2ZWH A;  1RT5 A;  4ISF A;  1NKE A;  5ELZ A;  1LW0 A;  4TSX A;  3JYT A;  1QQN A;  2QKK A;  4RWT A;  1JLA A;  4LF7 K;  3IMX A;  4JI2 K;  3DXK B;  1JXE A;  3KHY A;  3CCR N;  2X78 A;  4C8N A;  5BPN A;  1YVN A;  3I56 N;  3S3M A;  3VQ6 A;  4FWM A;  3O3F A;  2OPS A;  4ID5 A;  5AQY A;  2O8E A;  1Z6R A;  4G9Z A;  1VSD A;  5AQP A;  5LJW A;  3KK7 A;  2HNY A;  3PIO L;  2KKZ A;  2P9P B;  4DV5 K;  4LD0 A;  4O55 A;  5M1N A;  1X9S A;  4QOZ B;  2HHQ A;  2Q97 A;  2VCP A;  5JS1 A;  4B3M K;  4CEC A;  2GV9 A;  4CEF A;  4ILJ A;  3A5L C;  4CD1 A;  3OHR A;  3ZT0 A;  5AQN A;  4KHY A;  3MK6 A;  5AQV A;  1JLF A;  1RT6 A;  3AVF A;  1JCG A;  4LFC K;  2PYJ A;  3HI0 A;  3GOI A;  1VQN N;  2QWM A;  1TYQ B;  4B9V A;  5FPE A;  2VG7 A;  4PL8 A;  1KAZ A;  3MWP A;  3PSF A;  3THW B;  3RVC A;  3SUP A;  5AQK A;  2QWR A;  3LWM A;  4BQL A;  3VF2 A;  2HVI A;  4BRN A;  4EHT A;  1BQN A;  2YV0 X;  3VEV A;  3V9S A;  1RT7 A;  4JHD B;  4YOX A;  4BDZ A;  4DHY A;  3TAF A;  3L4I A;  1CXQ A;  3T7Z A;  3MXJ A;  3M8S A;  2O4G A;  3L3U A;  4OPH A;  1K73 O;  5EXW A;  3WNF A;  3P39 A;  4Q5V A;  3OYC A;  2YHY A;  4CF2 A;  3G6E N;  1NK8 A;  1KFS A;  1S5J A;  4I6M A;  3U4L A;  2OA8 A;  2HHH K;  4DR6 K;  5BN9 A;  2QW9 A;  4FWO A;  3IRX A;  3H1V X;  4H0T B;  4I2Q A;  4GV3 A;  2HND A;  3AAR A;  2VG5 A;  3W0L A;  3ATU A;  2CGK A;  3OBY A;  1HNZ K;  1G99 A;  4WF9 L;  1VSM A;  2XY7 A;  1LWF A;  1HX1 A;  2PFU A;  3V1Q A;  2OZS A;  2O4I A;  5DM7 L;  1RT3 A;  1IG9 A;  2BE2 A;  3NVM A;  2Q36 A;  5IWA K;  3MEE A;  3LPU A;  2AJQ A;  4GNI A;  4CZE A;  2XO7 A;  4O8K A;  1QHA A;  1X9W A;  1M90 O;  4ICL A;  4CHP A;  3V9U A;  2OPR A;  4CF8 A;  4IDK A;  4FCY A;  4FWP A;  4FWS A;  1WBD A;  3ZET B;  3KIO A;  1NGB A;  4FOE A;  2JLE A;  1J5E K;  4JI4 K;  1BGX T;  4CJE A;  3LAK A;  1S1W A;  1GLJ O;  4L3Q A;  4BE0 A;  1KFD A;  3OYF A;  2FLO A;  3PSI A;  3LWL A;  4BY9 C;  3OA9 A;  3O6W A;  1RBU A;  2UUA K;  4IKF A;  1ZYQ A;  2HBM A;  1TGO A;  1U48 A;  3AVN A;  4FWR A;  2YHX A;  4KHS A;  5DM6 L;  4H5R A;  3ID6 A;  3OYB A;  4E0D A;  4Z4C A;  4CJ5 A;  4B1Y B;  2ZGY A;  3ZSO A;  4C8O A;  1Q86 O;  1YHQ N;  3AA5 X;  2EHG A;  3NGZ A;  1BL3 A;  3AGK A;  4NLB A;  1YJW N;  3HK2 A;  5JVG L;  4IJN A;  1C0T A;  1BCM A;  3CF5 L;  2YHA A;  3CJA A;  4CI6 A;  4FJK A;  4FWN A;  4H03 B;  2BDP A;  2AA4 A;  1TAU A;  1C0U A;  3KWI A;  1KVA A;  4NYN A;  1B92 A;  4B9T A;  3MXM A;  1HYS A;  1Z25 A;  4DUZ K;  3DOL A;  4K43 A;  1D9F A;  1KTQ A;  4Z4G A;  3RR8 A;  4N47 A;  4C1N I;  4E7H A;  3JXU A;  4GKK K;  5AQG A;  1C0G A;  1NGD A;  1QQC A;  2B6A A;  1IH7 A;  1TL1 A;  1DTT A;  2V52 B;  3PX4 A;  3O9T A;  4FK2 A;  4CGJ A;  3QEP A;  3IFR A;  3GE1 A;  1YTU A;  1RGI A;  1BHL A;  4F9O A;  4DR5 K;  4ISG A;  3CM5 A;  4I9L A;  3NH2 A;  3QEV A;  1UOC A;  2F9T A;  3G71 N;  5E84 A;  3LDL A;  4CHN A;  1HRH A;  3CJ7 A;  4B1V A;  1QZ5 A;  3SZ2 A;  4DR1 K;  3V6D A;  2GUI A;  4BRI A;  5FPD A;  4RW4 A;  1L5U A;  3P5J A;  2QXF A;  1ZXO A;  2OCE A;  5AQJ A;  4M41 A;  4PWD A;  4O8U A;  1NGH A;  4QS8 A;  4YOV A;  3ZEU A;  3J81 O;  4X65 K;  1N8R O;  3O8M A;  2P9K B;  4AM6 A;  1I94 K;  3SAH A;  3MXI A;  1JLC A;  4GKJ K;  4GY2 B;  3L2R A;  1U2V A;  3CCJ N;  1RBV A;  3HVT A;  3BP8 A;  2IS3 A;  3HP6 A;  4DQS A;  1TV6 A;  5M1Q A;  3TAE A;  3H46 O;  4F3T A;  5LMN K;  1GLC G;  3F9M A;  3O3H A;  2ZJR L;  1W2B M;  3ZSR A;  5HRP A;  4DQI A;  3ZSV A;  3RMB A;  3TPQ A;  2FXU A;  4DTM A;  4JN4 A;  3QEI A;  1WB9 A;  3SPZ A;  3SJJ A;  1SL0 A;  1ZBL A;  2VWJ A;  4B9N A;  4LF5 K;  4OJR A;  1NBW A;  2ZJP L;  4QCL A;  3NF7 A;  4MQ3 A;  1VK0 A;  3KK3 A;  1BDG A;  2Q3S A;  1DLO A;  3OYK A;  1XI1 A;  2VGN A;  5BRD A;  1HYZ A;  4M3Z A;  4FK0 A;  3CC2 N;  4BG9 A;  3CJB A;  4AM7 A;  5BR8 K;  2A1R A;  3EKU A;  4OVL A;  4DV6 K;  3V9Z A;  4OPA A;  4EHU A;  2GX9 A;  1B9F A;  5EY4 A;  4DLE A;  4DTR A;  1NU0 A;  4ID1 A;  1P90 A;  2G8W A;  1JJ2 M;  2P9S B;  1UA1 A;  2HHT A;  1OH7 A;  4WFA L;  5C24 A;  4H5N A;  1S3X A;  3TAP A;  4CHZ A;  5C10 A;  2DPN A;  2ATQ A;  2XY6 A;  4CEA A;  1DT9 A;  2VWB A;  3H08 A;  2WC9 A;  4FJN A;  5HBM A;  1NGG A;  5AQH A;  3AVB A;  4QS9 A;  3SBG A;  1WSI A;  3WEE B;  1A5W A;  3O80 A;  4JKD A;  4CGF A;  3B6P A;  4V19 S;  3VQ5 A;  3O4Q A;  2E2O A;  2IAJ A;  4LFA K;  4ELU A;  1WAF A;  3RMA A;  2IOC A;  1KQS M;  4F2R A;  4HTU A;  3C6H A;  4R79 A;  3HOT A;  4IBN A;  5AFU A;  3VQ9 A;  4C8L A;  3BUZ B;  3O9Q A;  5AQO A;  1ATN A;  1HQE A;  3KVG A;  1KLN A;  4JK9 A;  3NH0 A;  1NJW A;  2Q1N A;  3CCU N;  4O0I A;  4M7X A;  2QI2 A;  2D0A A;  4BVO A;  5B8H A;  4CEO A;  4DV4 K;  4O4G A;  1BG3 A;  2E6M A;  2PAV A;  3HO1 A;  5T7B A;  3ZX0 A;  3NF9 A;  3QIC A;  4BC5 A;  4GVE A;  4JD2 A;  3HTV A;  3ISN C;  4JK8 A;  3AGR A;  4M3R A;  1HMV A;  4DS5 A;  4BWJ A;  4BRM A;  3T1A A;  3QIN A;  2F96 A;  3I0R A;  4H0Y B;  2OAN A;  1FK9 A;  4K25 A;  3B8A X;  3A5O C;  4DFP A;  4UQG A;  5GAG P;  2ZM6 K;  4NXM K;  3RRH A;  3T19 A;  3L2Q A;  4KH5 A;  4JYA K;  4CJP A;  2KFN A;  3G25 A;  2ZD1 A;  4YDU A;  4HTL A;  1GLA G;  3VQ7 A;  4PHT X;  3CME N;  3SUN A;  3THX A;  4JI8 K;  3CMA N;  1KD1 O;  3L6Q A;  3ENO A;  5HRO A;  4O5F A;  4KH6 A;  1QVF M;  2PY5 A;  5JLH A;  2J4R A;  3FFI A;  3GDQ A;  1GLL O;  3AVM A;  3EE9 A;  2BGG A;  4U7B A;  3R9P A;  2UXB K;  4XH5 A;  5I9E B;  3IS9 A;  4KBO A;  3K9K A;  3V81 A;  2P51 A;  5AZJ B;  4FZY A; 
#chains in the Genus database with same CATH homology
 5CYM A;  3SV4 A;  1RT5 A;  2WON A;  3RTV A;  4Y1C A;  3NFA A;  1J54 A;  3AA3 A;  4NCA A;  1NKE A;  1LW0 A;  2YKN A;  5HRR A;  4EZ9 A;  4RW6 A;  1S9E A;  2DFF A;  4FM1 A;  4G1Q A;  1TK5 A;  4ZTF A;  4TSX A;  4CGD A;  3JYT A;  1MU2 A;  1T03 A;  2QKK A;  1JLA A;  4DSK A;  5KTQ A;  4CK1 A;  1JXE A;  2WOM A;  4KAZ A;  3TAR A;  4DTS A;  2X78 A;  4C8N A;  3S3M A;  3HJF A;  2HHV A;  1RT4 A;  3PX6 A;  3VQ6 A;  4BE1 A;  4KTW A;  3AVL A;  3O3F A;  3K5L A;  2OPS A;  4ID5 A;  1WAJ A;  4RG8 A;  3B6O A;  3JSM A;  1NK5 A;  1HNV A;  4KO0 A;  1VSD A;  3F73 A;  1Q8I A;  2Y1J A;  2HNY A;  3O4N A;  4LD0 A;  4O55 A;  3L2U A;  3SV3 A;  1X9S A;  4QOZ B;  2HHQ A;  1NK0 A;  3LP2 A;  1DTQ A;  4FLX A;  1EP4 A;  5JS1 A;  1VSE A;  4CEC A;  3KKR A;  3K57 A;  2GV9 A;  3NF6 A;  4BDY A;  4CEF A;  3ZT1 A;  2X6S A;  3ZT0 A;  4B08 A;  1NJX A;  3V9X A;  4PA1 A;  4DTX A;  4KHY A;  4BWM A;  1C1B A;  1JLF A;  3AO1 A;  4JS5 A;  4FLZ A;  4KKO A;  1RT6 A;  4DFM A;  3WNG A;  3QER A;  3AVF A;  3M8P A;  4E1M A;  3SQ1 A;  1SKS A;  3PV8 A;  4DMN A;  3BDP A;  2PYJ A;  1HJR A;  3DYA A;  2F8T A;  3QLH A;  1X9M A;  2HB5 A;  4KTQ A;  2DFE A;  4DQP A;  4I9Q A;  4B9V A;  3VN5 A;  2VG7 A;  4CEZ A;  4CF9 A;  3AVK A;  3K5O A;  3OVN A;  1VSL A;  1KRP A;  1QHT A;  1L3V A;  2PYL A;  1IKY A;  1LW2 A;  3SUP A;  4PUO A;  4Z4E A;  3NBP A;  1QSS A;  4CJT A;  3NE6 A;  4OKK A;  3LWM A;  4FJJ A;  1TKZ A;  5HLF A;  2KFZ A;  4DF8 A;  2HVI A;  4RW7 A;  4CJF A;  3U6F A;  1BQN A;  4ZTJ A;  2F8S A;  2YV0 X;  2FC0 A;  3V9S A;  1FKP A;  5KGW A;  1RT7 A;  2HHU A;  4MFB A;  4BDZ A;  2D5R A;  3TAF A;  3UIQ A;  1VSI A;  1N6Q A;  1CXQ A;  2DFH A;  3HL8 A;  4J2E A;  4DQQ A;  3MXJ A;  4HHT A;  4BDP A;  5HRN A;  3M8S A;  4CK2 A;  2O4G A;  3CM6 A;  3O3G A;  3L3U A;  1SL2 A;  4N41 A;  4KHW A;  3WNF A;  4CGG A;  4E1N A;  4Q5V A;  3OYC A;  3AVG A;  1Q9X A;  4CF2 A;  5J2P A;  3KLF A;  1NK8 A;  1S5J A;  1N5Y A;  1KFS A;  2OA8 A;  1HYV A;  4K8X A;  1TVR A;  3IRX A;  2ETJ A;  4HCC A;  4I2Q A;  3AO3 A;  1JL1 A;  1WNS A;  4LH5 A;  4DSJ A;  2HND A;  5J1E A;  3LAM A;  1NK9 A;  2IC3 A;  3AVA A;  3LDS A;  4W5N A;  2VG5 A;  2X74 A;  3MEC A;  4F3O A;  2ITG A;  1BI4 B;  4K8Z A;  4R5P A;  4Y1D A;  3RWU A;  4IFV A;  3V1R A;  1VSM A;  1WN7 A;  1LWF A;  2XY7 A;  3DOK A;  4FJG A;  4DTJ A;  4M3T A;  4CEQ A;  1KVB A;  1JLG A;  4IG3 A;  5K14 A;  1NKB A;  1VSJ A;  3MAQ A;  3V1Q A;  2OZS A;  2QK9 A;  4E3S A;  2O4I A;  3EY1 A;  1RT3 A;  3MEG A;  1IG9 A;  2BE2 A;  4FM0 A;  4LY7 A;  4KB1 A;  3PY8 A;  1REV A;  4OGE A;  5I42 A;  1T8E A;  3VQC A;  3MEE A;  3LPU A;  4CJW A;  3I0S A;  3LPT A;  4W5O A;  3EYZ A;  3K59 A;  3HPG A;  1WSF A;  5CZ1 A;  3NAE A;  2AJQ A;  2XO7 A;  2YNI A;  4E7I A;  1X9W A;  3RR7 A;  1ASU A;  1Y97 A;  4ICL A;  4CHP A;  3OJS A;  4FJ8 A;  4CJL A;  3V9U A;  2OPR A;  4CF8 A;  4IDK A;  4FCY A;  3PX0 A;  4DU3 A;  4AHT A;  2YNG A;  3DRP A;  1U04 A;  1RBS A;  3V1O A;  1TK8 A;  3KIO A;  4DF4 A;  2JLE A;  4FJ7 A;  2XHB A;  1RT2 A;  3HXM A;  1BGX T;  3ZT3 A;  3LAK A;  1S1W A;  4CJE A;  2RKI A;  5C42 A;  4BE0 A;  4FLW A;  1KFD A;  4E89 A;  1ZBH A;  3OYF A;  1S1T A;  2B5J A;  3VQQ A;  4W5T A;  3LWL A;  1RTD A;  3PO4 A;  1HNI A;  4HVJ A;  1RBU A;  4DTN A;  3C95 A;  3NHG A;  4QAG A;  4IKF A;  1ZYQ A;  2G8V A;  2B4J A;  3KLH A;  1TGO A;  4OLA A;  1U48 A;  1NJZ A;  2FBV A;  3AVN A;  3L2W A;  4KHS A;  2G8F A;  1JKH A;  3OYB A;  4HUE A;  4E0D A;  4Q0B A;  1BIU A;  4Z4C A;  4W5R A;  4CJ5 A;  3ULD A;  3KLI A;  3ZSO A;  3OJU A;  4C8O A;  1FKO A;  1S1V A;  4I2P A;  3LZI A;  3AA5 X;  2EHG A;  3NGZ A;  1BL3 A;  4HCB A;  4KRF A;  3HK2 A;  1VSF A;  3HYF A;  2VWK A;  3NF8 A;  3VQA A;  2IGI A;  4DLG A;  4FLY A;  3PO5 A;  4FJH A;  1C0T A;  4FZX C;  1ASW A;  1BCM A;  2YHA A;  5C25 A;  3AA4 A;  2ZQB A;  4FJK A;  2E4L A;  2BDP A;  4CEE A;  3DLR A;  1TAU A;  3QEW A;  4CFB A;  3TWH A;  4Z0U A;  4CE9 A;  3T3F A;  1C0U A;  2D0B A;  1GOC A;  2LSN A;  1KVA A;  3QIP A;  1QE1 A;  4DU4 A;  4NYN A;  3CQ8 A;  1B92 A;  4JRQ A;  2P1J A;  1D9D A;  4B9S A;  1R0A A;  1ITG A;  4B9T A;  3MXM A;  1HYS A;  2HHW A;  4H4M A;  5CZ2 A;  1Z25 A;  2KTQ A;  3DOL A;  4PY5 A;  1TK0 A;  4N56 A;  1D9F A;  3QEX A;  4B9M A;  4FK4 A;  4CHO A;  3DRS A;  1KTQ A;  5JS2 A;  4AH9 A;  1WLJ A;  1XWL A;  3HP9 A;  4NCG A;  3RR8 A;  1NKC A;  1S6Q A;  4N47 A;  4N5S A;  4C8K A;  4KHQ A;  4M3X A;  1D5A A;  2Z1G A;  4E7H A;  3SQ2 A;  4DSF A;  1CZ9 A;  3DLE A;  1D8Y A;  1SV5 A;  4LSN A;  4JLH A;  1YT3 A;  4KFB A;  1HQU A;  3E01 A;  2DY4 A;  4Z4F A;  1YTA A;  1S6P A;  3DRR A;  1LAW A;  1U45 A;  1L3U A;  5KRT A;  3OYI A;  4DTU A;  1QQC A;  2Z1J A;  4KTZ A;  2B6A A;  1RNH A;  1IH7 A;  1U47 A;  1TL1 A;  1DTT A;  5J2N A;  3PX4 A;  1W9H A;  3ZSY A;  4FK2 A;  1VSH A;  4CER A;  4CGJ A;  3AVC A;  3QEP A;  1XHX A;  3P1G A;  3VQ8 A;  1YTU A;  4DG1 A;  4OKE A;  2FBY A;  4PQU A;  1BHL A;  4M42 A;  3WNH A;  3CM5 A;  3LAL A;  4I9L A;  4DWI A;  3K2P A;  1NOY A;  3NH2 A;  3QEV A;  1UOC A;  4DSL A;  4Z4I A;  5CYQ A;  1HPZ A;  1U49 A;  4CJ3 A;  3TI0 A;  4B8A B;  3NGY A;  4CHN A;  4E7L A;  4FJ5 A;  1HRH A;  4Z4H A;  4DU1 A;  4I7F A;  4JRP A;  4FYD A;  4EZ6 A;  3A2F A;  3VA0 A;  4M3W A;  3ASM A;  3SZ2 A;  3AO5 A;  3V6D A;  1RDC A;  2GUI A;  3OYD A;  2RPI A;  4RW4 A;  4AHV A;  4KI6 A;  1L5U A;  1ZBI A;  3P5J A;  2QXF A;  4IFY A;  4NCB A;  4M41 A;  4OLB A;  1Z26 A;  4LSL A;  4PWD A;  2VG6 A;  4CIF A;  2OYQ A;  1RBR A;  1WSE A;  1ZBF A;  4DFK A;  4CGI A;  3RRG A;  3AA2 A;  2HW3 A;  2E6L A;  1RBT A;  4CFD A;  4F4K A;  3TR8 A;  3ZSQ A;  4CJ4 A;  1I3A A;  3OYN A;  1IKX A;  1JLC A;  2X6N A;  3QES A;  3MXI A;  5J2Q A;  3SNN A;  3L2R A;  3OS2 A;  3TAM A;  1CXU A;  1RBV A;  2YNH A;  4CK3 A;  3QNO A;  3VQ4 A;  1U4B A;  4DQR A;  4M3U A;  1IKW A;  3HVT A;  2XY5 A;  1XC9 A;  1RT1 A;  2IS3 A;  3HP6 A;  4DQS A;  4E7J A;  3IAY A;  3KD5 E;  1TV6 A;  4FM2 A;  4E7K A;  3TAE A;  3LP1 A;  3EZ5 A;  2ZE2 A;  2YKM A;  3LP3 A;  4IG0 A;  3VQP A;  4DTO A;  2OPP A;  4CCH A;  4BAC A;  4CJV A;  4F3T A;  1JLQ A;  1S1U A;  3KKS A;  1IKV A;  3O3H A;  1RDD A;  3AO2 A;  3VA3 A;  3CYM A;  2Z1H A;  3ZSR A;  5HRP A;  1T7P A;  1KLM A;  4B3O A;  1J9A A;  4FZZ A;  2HHX A;  4ELT A;  3I8D A;  1KCF A;  3SPY A;  4DQI A;  3DI6 A;  3ZSV A;  4OPK A;  3RMB A;  2KW4 A;  3WNE A;  3S9H A;  4DTM A;  4FW1 A;  5CY4 A;  2EX3 A;  3U3Y A;  3QEI A;  4O44 A;  3VQD A;  3SJJ A;  4RW8 A;  3SPZ A;  2G8U A;  1JL2 A;  1LWE A;  1SL0 A;  2G8K A;  1ZBL A;  1T05 A;  2VWJ A;  4B9N A;  4CEB A;  4CF0 A;  4OJR A;  1EXQ A;  4OPJ A;  4KPY A;  4QCL A;  1C1A A;  4WE1 A;  2GBZ A;  3C6U A;  3NF7 A;  4CHQ A;  4MQ3 A;  3LZJ A;  1VK0 A;  1RIL A;  3LP0 A;  3VQE A;  4F8R A;  3KK3 A;  5SZT A;  2Q3S A;  1W0H A;  2G8H A;  4KHN A;  4DSI A;  2BAN A;  1DLO A;  3OYK A;  1XI1 A;  1C0M A;  3HPO A;  1LV5 A;  3SUQ A;  1RTH A;  1Q9Y A;  1HYZ A;  4M3Z A;  1K6Y A;  1J53 A;  3IG1 A;  4FK0 A;  3VQB A;  1UAX A;  3HM9 A;  2P5G A;  4CED A;  4CJK A;  3D0P A;  4FLV A;  4B9U A;  1S9G A;  2A1R A;  4OVL A;  3V9Z A;  4CHY A;  1RDB A;  1X1P A;  3OYG A;  5D3G A;  5FRN A;  1GOB A;  3F9K A;  2G8I A;  5HRS A;  3KD1 E;  5HP1 A;  4CJQ A;  3SQ4 A;  3ITH A;  1VSK A;  1TKX A;  1B9F A;  2XY8 A;  3KLG A;  4FJI A;  3M8R A;  4DLE A;  1WSG A;  2QKB A;  4DTR A;  2HVH A;  1ASV A;  1SUQ A;  3U3G A;  4ID1 A;  3S3O A;  3BGR A;  3D45 A;  2HMI A;  5KGX A;  2G8W A;  1UA1 A;  1TKD A;  2HHT A;  4HUF A;  3P83 D;  4FLU A;  5C24 A;  1QS4 A;  3K5N A;  3TAP A;  2Y1I A;  1S1X A;  4CHZ A;  1G15 A;  2ATQ A;  2XY6 A;  3KJV A;  4KRE A;  2A1S A;  4DS4 A;  1TKT A;  1WSH A;  2HNZ A;  5KI6 A;  4CEA A;  3DLG A;  3ZSW A;  4ZHR A;  3OS0 A;  1L3T A;  5FRM A;  3H08 A;  4AHR A;  1EX4 A;  4FJN A;  4FJ9 A;  5HBM A;  3QET A;  1QSY A;  1B9D A;  1RCH A;  3AVB A;  4Z4G A;  1GOA A;  2OZM A;  1WSI A;  3KK1 A;  2P5O A;  4J2B A;  1JLE A;  3ZSZ A;  1RTJ A;  1A5W A;  2IDO A;  4CGF A;  3SQ0 A;  1CLQ A;  3B6P A;  1BQM A;  3VQ5 A;  3O4Q A;  2PZS A;  2HHS A;  3CFP A;  4J2D A;  2FBT A;  3G0Z A;  1A5V A;  2IAJ A;  3AVH A;  3TAG A;  4AHC A;  4YNQ A;  4CJR A;  1L3S A;  4ELU A;  3K58 A;  4O0J A;  1NK6 A;  1A5X A;  1WAF A;  1BIZ A;  1JXB A;  4CFA A;  3TAN A;  3RMA A;  1UWB A;  2IOC A;  1KVC A;  3DM2 A;  5E41 A;  1SKR A;  5KRS A;  4HTU A;  4F2R A;  4H4O A;  2RF2 A;  3AVI A;  3C94 A;  5EU7 A;  4IBN A;  3OS1 A;  4J2A A;  3HVR A;  1NK4 A;  4JS4 A;  3L3V A;  2XRI A;  3VQ9 A;  4C8L A;  1VRT A;  4CFC A;  1KSP A;  1EKE A;  2DTU A;  3HST B;  4CJS A;  4GMJ B;  3ZCM A;  3SI6 A;  4GW6 A;  4DFJ A;  3TAB A;  3KTQ A;  1HQE A;  1ZBU A;  3CG7 A;  3OYH A;  1BI4 A;  4CF1 A;  1F21 A;  1RTI A;  3NGI A;  3M8Q A;  4EP5 A;  3NH0 A;  3NCI A;  5J2M A;  4M45 A;  1NJW A;  1KLN A;  1NOZ A;  3DLH A;  4FJX A;  4B8C A;  3V9W A;  1O1W A;  3MED A;  1IO2 A;  4O0I A;  4DTP A;  2D0A A;  1SL1 A;  4CEO A;  4M3Y A;  3ALY A;  4O4G A;  4FVM A;  1LWC A;  2E6M A;  1TL3 A;  5T7B A;  2R7Y A;  5SWM A;  3HO1 A;  3NF9 A;  3HPH A;  4C8M A;  4FLT A;  1SKW A;  4CIG A;  5I3U A;  2JGU A;  4XIU A;  3ISN C;  3LAN A;  3ZSX A;  1C1C A;  3G10 A;  1QSL A;  4O5B A;  4M3R A;  1HMV A;  1VRU A;  4LH4 A;  4DS5 A;  4BWJ A;  3RMD A;  3T1A A;  3SUO A;  3QIN A;  4DSE A;  2F96 A;  3I0R A;  3QO9 A;  5FDL A;  4F2S A;  5FRO A;  2I5J A;  4E19 A;  3DMJ A;  1FK9 A;  2KZZ A;  3C6T A;  1LAV A;  4HUG A;  4DFP A;  4UQG A;  4YFU A;  4OGC A;  3OYM A;  3KK2 A;  1NK7 A;  4KHU A;  4KV8 A;  3RRH A;  3T19 A;  4NYF A;  2YHB A;  3OYJ A;  3L2Q A;  4FJL A;  3OY9 A;  3SCX A;  1NJY A;  4CJP A;  2KFN A;  5DMR A;  4AHS A;  3S3N A;  2ZD1 A;  1C6V A;  3CFR A;  1WSJ A;  3NDK A;  4RW9 A;  1CZB A;  1EET A;  4AHU A;  3DLB A;  4FW2 A;  3VQ7 A;  2NUB A;  3CFO A;  4EP4 A;  4B9L A;  1QTM A;  3OYE A;  3DLK A;  3QIO A;  4L8R B;  4ELV A;  3K5M A;  4FXD A;  3SUN A;  3OYA A;  4H8K A;  1RDA A;  2W42 A;  1UA0 A;  3AVJ A;  3L8B A;  1TAQ A;  3PUF A;  2KQ2 A;  3AO4 A;  4KI4 A;  4N76 A;  3RMC A;  1BIS A;  3AV9 A;  5HRO A;  3NH1 A;  1BCO A;  1YVU A;  4CES A;  2PY5 A;  4CIE A;  3HT3 A;  3TAQ A;  1XHZ A;  4GVM A;  3FFI A;  3THV A;  3OYL A;  1FXX A;  2D0C A;  4KB0 A;  3AVM A;  2YNF A;  4FJM A;  4AIL C;  2BGG A;  4CJU A;  2RN2 A;  3ZT4 A;  2OPQ A;  2FBX A;  3ZT2 A;  3SYZ A;  1I39 A;  3V4I A;  4BE2 A;  4CGH A;  1JLB A;  4W5Q A;  3IS9 A;  3L2V A;  2KZM A;  2Z1I A;  3QNN A;  2P51 A;  3V81 A;  1J5O A;  4OKJ A;  3KLE A;  5DK5 A;  4FZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...