5HRNA

Hiv integrase catalytic domain containing f185k mutation complexed with gsk0002
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
152
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
total genus 54
structure length 148
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrnA00
4YFUA 1HMVA 1X1PA 3TAQA 3DOKA 1S5JA 3ZSZA 2ETJA 2Q3SA 3AA2A 2I5JA 3OYCA 3VQDA 3V1QA 4RW9A 3KLFA 3L2VA 4HCCA 1C1CA 3NDKA 3C95A 1RBSA 1Q9YA 1BCMA 2YHBA 4HHTA 2HHTA 2X74A 4F4KA 3SPYA 2PY5A 1B9FA 4FVMA 1TL1A 3PV8A 1D9FA 3TAFA 1BIZA 4DG1A 3O3FA 1SKWA 4M3ZA 1VSMA 1WLJA 1G15A 4J2DA 4CIFA 5E41A 3AVNA 4Z4CA 4CIGA 1D8YA 4FJJA 2XY7A 4OLBA 1HRHA 4DU3A 1RDBA 3IRXA 4KO0A 3SQ0A 4ID5A 2IS3A 3ITHA 4LH4A 4E0DA 3TAGA 1A5XA 3TANA 4DTJA 4XIUA 2KZZA 1KRPA 4B9NA 1L3UA 1WSIA 4CJPA 2AJQA 3DOLA 4O4GA 4E19A 3NGIA 4K8ZA 2HHSA 5I42A 1FK9A 1S1WA 4W5QA 3NF6A 3M8RA 5J2MA 1RDAA 4KHSA 4DQSA 3AVKA 3PO5A 4E1NA 4FJLA 2G8VA 3RWUA 1ZYQA 2KZMA 4KHUA 5HROA 3AVGA 3E01A 4CERA 4PUOA 1ZBFA 2DTUA 1U49A 2HHQA 4DU4A 3NF8A 1QSSA 1A5VA 3LP2A 4HCBA 3HJFA 3AVLA 1IKXA 4DS5A 3L8BA 4F2RA 3OYEA 3LAKA 1X9SA 1RTDA 2Y1JA 4CJRA 3RRGA 4J2AA 4CHZA 3V6DA 1BQMA 3C94A 1FKPA 3MECA 4H4OA 4RG8A 3OY9A 1I39A 1TK0A 3LP3A 1IH7A 4KHWA 1T05A 3KIOA 4CFBA 3ZT4A 1HYSA 1HNIA 4HVJA 2RPIA 1C6VA 5CYQA 4OPJA 2W42A 4CEAA 4FJGA 1N5YA 4ID1A 4CGIA 4F3TA 1HJRA 1S1UA 2GUIA 4CIEA 4CHQA 1J54A 3HYFA 1C1BA 3O3HA 4EZ6A 2YKMA 1TAQA 1SL2A 3WNGA 4M3TA 4Z4FA 4FJIA 1RDDA 3HSTB 3KK1A 4KREA 1RT6A 3ZT3A 3NH0A 1LWFA 3JYTA 4H4MA 1DTTA 4KHQA 1J53A 2ZD1A 3HP6A 4B3OA 3EY1A 1HYZA 3OYNA 4BE0A 1TK8A 5CZ2A 4KFBA 3VQCA 4PWDA 1TKZA 3ZT1A 2DFFA 5HRPA 5C24A 1ASUA 1NJXA 1TV6A 3K5OA 3VQ5A 4ZTFA 5FRNA 1SUQA 1JLBA 4DWIA 4OKKA 1RT7A 1TKTA 2OPRA 1XHZA 3KD5E 3V1OA 4FCYA 1FKOA 4C8KA 1RT1A 4FZXC 2HHVA 3KLHA 3HPGA 1JLFA 1XHXA 5JS2A 4CFCA 5HRNA 4C8OA 1WAFA 4KTQA 4Z4IA 1VSIA 4OPKA 3NFAA 3V9ZA 4DSEA 3NF9A 3TARA 2QKKA 3B6OA 4B9UA 3K2PA 1RBRA 3VA3A 4OVLA 1JXBA 3SUNA 1TAUA 4DTOA 1LW2A 3C6TA 4PA1A 5EU7A 3VQBA 3MXJA 3OYHA 3MAQA 3QETA 4JS5A 3K58A 1NOYA 3MXIA 3LAMA 1XWLA 2G8KA 3RMAA 4KI4A 1VSLA 2DFHA 3AV9A 5CZ1A 4BDZA 4N56A 1QSLA 5C25A 1L5UA 3VQEA 3O3GA 3AVFA 4NCBA 4CF1A 4ZTJA 3AA3A 3THVA 2D5RA 4LH5A 3NBPA 3VQ8A 4CJVA 2EHGA 2IC3A 4DQRA 4DFMA 3QEVA 3V4IA 4KAZA 3K57A 3QEIA 3OYBA 1EXQA 1XC9A 3V9XA 2XO7A 4CFAA 1SL0A 3KLEA 4EZ9A 4CGFA 3KKRA 1VSHA 4CGDA 1QE1A 1WSGA 3CM5A 2FBTA 4GW6A 3LDSA 4DTMA 1CZ9A 3HT3A 4J2BA 5J1EA 2PYLA 1NJYA 4NYFA 2OZMA 2O4IA 3OJSA 1DLOA 3LZIA 1S1TA 4EP5A 1LWEA 4E7LA 2FBYA 4B9MA 1JL2A 4FK4A 3OYDA 3K5LA 4CHOA 5T7BA 3O4NA 4H8KA 2KFNA 1GOAA 1TKXA 4GMJB 3F73A 5HLFA 4FJ8A 2NUBA 1NK5A 4G1QA 4CJKA 4CHPA 3KD1E 3CG7A 3QLHA 4DSLA 4FJ7A 3KJVA 2YHAA 1C0TA 2E6LA 3L2RA 3EZ5A 5KGWA 5JS1A 1VRTA 3M8QA 5FRMA 1A5WA 3L3UA 4KTZA 1KFSA 3M8PA 3ZSOA 4DQPA 3OS1A 4RW8A 4CGHA 3VN5A 3OS2A 3HXMA 2HHUA 3AO2A 2HW3A 1KLMA 4B9TA 5KRSA 3RMCA 3SQ1A 3NGYA 3T3FA 1NK0A 1YVUA 2FBXA 3MEGA 2FBVA 3HL8A 3FFIA 4DQQA 4DTSA 3QEXA 2BE2A 1RTHA 4CEZA 3V9SA 3AO3A 1JLAA 3AA4A 3TAEA 4M3UA 4AILC 3T19A 3NHGA 1VSEA 1LAVA 3AO5A 4Y1DA 4ZHRA 1WSEA 4KTWA 3ZT0A 4R5PA 2JLEA 3RMDA 3S9HA 5HP1A 2XY8A 2G8WA 1EP4A 1RTIA 4FXDA 4GVMA 2P51A 4FK2A 2HHWA 4AHTA 3O4QA 4EP4A 3PO4A 1EX4A 3ZSXA 3OYGA 1WSHA 3OS0A 4PY5A 2KTQA 1RT4A 3NH2A 3QNOA 2GV9A 4BE1A 5K14A 2E4LA 3DLBA 4B9LA 2IAJA 4FJNA 1FXXA 1NKCA 1NKBA 4C8NA 4FLVA 2HVHA 1JLGA 4HUGA 3OYKA 2D0BA 1WN7A 3H08A 5DK5A 1KLNA 4MQ3A 3TAMA 3L2WA 3QESA 2X6NA 2JGUA 3K5NA 4KI6A 2EX3A 4E89A 4DTRA 3V1RA 3HO1A 4OLAA 1Z25A 3LP0A 1KCFA 4I2QA 1I3AA 1F21A 2ATQA 3CM6A 4IG0A 1SL1A 3RR8A 4B8CA 1Z26A 4Y1CA 5HRSA 2BDPA 4CCHA 2G8HA 2ITGA 4O55A 3JSMA 5HBMA 4ELUA 1TL3A 4DSJA 1C0MA 4DS4A 1DTQA 1HPZA 3QIPA 3SZ2A 3ISNC 5DMRA 1RT5A 4DTUA 3SJJA 3PX0A 4M3WA 3NE6A 3CFRA 4DLEA 3IAYA 1S1XA 4B08A 1RDCA 4KRFA 1K6YA 2KW4A 3TR8A 3AVJA 5KTQA 3K59A 2FC0A 3AVBA 3SQ2A 3IS9A 3L3VA 4O0JA 1QHTA 1QQCA 1RTJA 4AHVA 4DFKA 4NCAA 2VG6A 3DLEA 1S6PA 3WNFA 4FZYA 3A2FA 1JLCA 3ZT2A 1CXQA 3I0RA 3RTVA 2Y1IA 5D3GA 2R7YA 1T7PA 4CJTA 3V9WA 4CEQA 1LV5A 4CJLA 3ZSWA 4OGCA 5FDLA 4CHNA 5SWMA 5J2QA 1J5OA 1W0HA 1WNSA 3MEDA 3D0PA 2PYJA 1JKHA 1YTAA 2X78A 4RW4A 1BQNA 4YNQA 4E7KA 1T03A 1KSPA 3RMBA 3DYAA 1D9DA 3BDPA 2VG7A 2HNZA 1NK6A 3QNNA 4IDKA 1SKRA 3LANA 1S9GA 4IFYA 4FJMA 2KFZA 3WNHA 3QEPA 1JLEA 4LSNA 3SUQA 2YKNA 3OYIA 5CY4A 3U6FA 3QO9A 4N76A 1EKEA 4F2SA 3P1GA 4JRPA 1X9MA 4FJKA 3QIOA 3I0SA 2Z1HA 4MFBA 3SV4A 3PX4A 3VQ9A 1B92A 4AHRA 3S3OA 3P5JA 3AO4A 1ASWA 1TK5A 4ELTA 1NK4A 1KVBA 2HMIA 3NGZA 4C8LA 1GOBA 3U3YA 1IKWA 1NK7A 2WOMA 2OYQA 1VSKA 2OPSA 1MU2A 2RF2A 3G0ZA 4M3RA 1R0AA 1Q9XA 3IG1A 1ZBIA 4CK3A 1IO2A 1BIUA 3DLHA 1U4BA 1IG9A 1KFDA 3OYFA 1LWCA 3VA0A 3CFPA 4DF8A 2B4JA 3L2UA 2IOCA 3ALYA 1UA0A 3ASMA 4QCLA 4M45A 4FM2A 1UAXA 1S6QA 4FJ5A 1QS4A 5J2PA 2B6AA 1NK9A 4CJ3A 4I9LA 3D45A 4FJHA 1QSYA 2XHBA 4CF0A 3OYLA 4DTNA 1YTUA 4DQIA 2YNIA 5KRTA 4M42A 2VG5A 4DF4A 4KB0A 2XY6A 2KQ2A 4FYDA 3AVCA 1RCHA 3DRPA 4IBNA 1HNVA 3QEWA 1C0UA 2DFEA 2D0CA 4F8RA 1CLQA 1U04A 4CJ5A 1CXUA 3DI6A 4M41A 4B8AB 4CJ4A 4HTUA 5SZTA 2HNDA 1BI4B 4Z4HA 4BWJA 3OYMA 3P83D 4LD0A 3NH1A 4FW2A 4BWMA 1RBVA 1HQEA 4NYNA 2YNHA 1O1WA 1BGXT 4CECA 4DLGA 1B9DA 3OJUA 3KK2A 1RNHA 4AHUA 3ZSRA 4CEDA 2OPQA 1TKDA 3LPUA 4KPYA 4CHYA 1JL1A 3K5MA 2B5JA 4UQGA 2QK9A 4DTPA 4O5BA 4AH9A 2X6SA 2YNFA 3RR7A 1QTMA 4M3XA 3VQPA 4AHCA 3QINA 4OKJA 3KLIA 1RBUA 4IFVA 4J2EA 3KTQA 4JS4A 3DLKA 4N5SA 3NF7A 2QXFA 3BGRA 1LW0A 3AA5X 3NAEA 4CEEA 2BANA 3KKSA 1VSFA 4LSLA 1NJWA 1REVA 3B6PA 3VQQA 5C42A 3SCXA 4FK0A 4FLWA 1XI1A 4KB1A 4Z4EA 4E7JA 3AVHA 4E1MA 4OGEA 3M8SA 3HM9A 3KLGA 1YT3A 1NKEA 4CF2A 3S3NA 1JXEA 4CGGA 1NJZA 3ZSQA 2F8TA 4N41A 3ULDA 4F3OA 2OPPA 2WONA 4JLHA 4CF9A 2E6MA 4PQUA 2DY4A 3ZSYA 2VWKA 4CFDA 2HB5A 4CEOA 1VSDA 3LP1A 3DMJA 5HRRA 3DRSA 3KK3A 4DTXA 4W5OA 3SUOA 3C6UA 3QERA 2LSNA 5CYMA 4CJUA 2HHXA 1KVAA 4E3SA 3VQAA 4CGJA 4CF8A 4FJXA 2ZE2A 4BE2A 1BCOA 2G8IA 1VK0A 4DSKA 3TWHA 1T8EA 2QKBA 2O4GA 3VQ4A 3OYJA 3TAPA 4DSFA 3F9KA 2Z1GA 4FLYA 1JLQA 1SKSA 1CZBA 3DLGA 3ZSVA 1D5AA 4CE9A 4BDYA 3PY8A 2YV0X 4L8RB 4IG3A 3ZCMA 1KTQA 4FLXA 1IKYA 3VQ6A 3OVNA 2G8UA 2GBZA 4CK1A 3DLRA 4DMNA 1X9WA 1WSFA 4CK2A 1L3SA 3L2QA 4DFPA 3V81A 3DRRA 1C1AA 4RW7A 1HYVA 3EYZA 4HUFA 4Q0BA 1UWBA 4ELVA 5I3UA 4DSIA 1Q8IA 3SV3A 1RT3A 2RKIA 3DM2A 1J9AA 2OA8A 4B9SA 2G8FA 1RT2A 2HNYA 3CFOA 3OYAA 1L3VA 2P5GA 4RW6A 3SUPA 2RN2A 4O44A 4IKFA 2F8SA 4CEFA 1BISA 1RILA 4FLZA 2YNGA 3V9UA 2A1SA 4WE1A 4KV8A 2D0AA 1BHLA 4CJFA 3AVAA 1U45A 4I2PA 4CJWA 1RBTA 3AVMA 1UA1A 4W5NA 5J2NA 4AHSA 3SI6A 1TGOA 4HUEA 4JRQA 1U47A 4C8MA 3WNEA 5KGXA 3AVIA 3U3GA 4Q5VA 3LZJA 3UIQA 3T1AA 4FLUA 3TI0A 1WAJA 4FM1A 1Y97A 1NOZA 3RRHA 4KHYA 3CYMA 2A1RA 3VQ7A 4W5TA 3NCIA 4KHNA 4TSXA 1LAWA 4I7FA 3LWLA 3SNNA 2OZSA 3I8DA 4FZZA 4FLTA 3SQ4A 4DU1A 4CJEA 3HVRA 1L3TA 3PUFA 4FW1A 1VRUA 3CQ8A 3SPZA 2Z1JA 4N47A 2P1JA 5KI6A 3S3MA 3MXMA 1ZBUA 4KKOA 1NK8A 1N6QA 2PZSA 1S9EA 1BL3A 4B9VA 3LWMA 1UOCA 4BACA 2XY5A 1VSJA 4CESA 4NCGA 4QAGA 4K8XA 3LALA 1WSJA 3HK2A 4DFJA 4CEBA 4M3YA 2F96A 1GOCA 3AO1A 3HP9A 4Z0UA 1S1VA 3LPTA 4BDPA 4Z4GA 1EETA 4FM0A 1W9HA 4I9QA 4QOZB 2BGGA 1ZBLA 2IDOA 1HQUA 2Z1IA 4CJSA 4E7IA 3HVTA 3HPHA 4CJQA 4OKEA 1ZBHA 2XRIA 4LY7A 3G10A 5FROA 4W5RA 3PX6A 3SYZA 3TABA 3MEEA 2ZQBA 1ASVA 2P5OA 1SV5A 4O0IA 1IKVA 4ICLA 4E7HA 1U48A 2IGIA 1KVCA 1ITGA 1BI4A 3HPOA 2VWJA 4OJRA 1TVRA 4FJ9A 2HVIA
chains in the Genus database with same CATH superfamily
4YFUA 3EKSA 3ZSZA 2ETJA 4BC4A 1GLEG 4WCEL 3V1QA 2QXLA 3NDKA 3E1YA 1IJJA 4BRCA 3SK3A 2HHTA 2PY5A 1B9FA 3UKUB 3L4IA 4DG1A 4FWRA 5ADXH 2I7PA 4ILHA 4A5AA 4CIFA 4CIGA 1D8YA 4FJJA 2ZGYA 1OVQA 4KO0A 3O9SA 1YJWN 1A5XA 4XIUA 2KZZA 3OBYA 1XC3A 4CJPA 4O4GA 4OX9K 2HHSA 5C2FA 1S1WA 4YDUC 2P9LA 1RDAA 5M1OA 1GLAG 1QZ5A 3ZLJA 3PO5A 2G8VA 1MWMA 3O6WA 4JV5K 1JCEA 3AVLA 1IKXA 3L8BA 4F2RA 2HBLA 1NG9A 4RG8A 2OTJN 4MDAA 3HOTA 4FL9A 4DR5K 1HNIA 4JKHA 4JI2K 4FJGA 1N5YA 3WQUA 4BRLA 4CIEA 4EZ6A 3WUHA 1J54A 3HYFA 1C1BA 3WEEB 2YKMA 2GX9A 4Z4FA 5EVZA 3HSTB 3ZT3A 3NH0A 1LWFA 4QS9A 1DTTA 2ZD1A 1K8KB 3OYNA 4BE0A 1TK8A 4PWDA 3VEWA 1YUWA 4OPHA 1NJXA 2P9PB 3ZX2A 1VHXA 3KD5E 1TKTA 1XHZA 4BR9A 2P9UB 4CVNE 2HHVA 5AQUA 1XHXA 5JS2A 4KTQA 2HVIA 1VSIA 1ATSA 3NF9A 3K2PA 4G9ZA 3OYHA 3K58A 5C15A 3LAMA 1XWLA 4NXNK 1QQNA 4BRQA 2DFHA 5CZ1A 4BDZA 4N56A 5C25A 4B3MK 3O3GA 2GTDA 4LH5A 4CJVA 3NBPA 4DQRA 2IC3A 5AR0A 3K57A 2ZJPL 1SL0A 4PL7A 2O8DA 4H5RA 1CZ9A 3E9OA 4J2BA 2OZMA 1DLOA 2V7YA 4B9MA 3K5LA 4H0XB 1BOTO 4GV6A 4GMJB 4FJ8A 3UKRB 3QLHA 3CJ1A 1SS6A 4H5WA 2E1ZA 3EZ5A 2F9WA 5FRMA 1A5WA 3A5LC 3SBGA 3PSFA 4DQPA 4CGHA 2HHUA 3AO2A 2NRZA 5HL7L 4IOCL 3QFUA 3CPWM 1U2VB 3MEGA 1EWRA 4DQQA 4DTSA 2YHXA 4GKKK 4M3UA 4AILC 3T19A 1VQON 2JLEA 5I9EB 5HP1A 1EP4A 3NVMA 4FXDA 2HHWA 1P8ZA 1EX4A 4JI6K 1NGFA 3OS0A 1RT4A 3D2EA 2YI1A 5K14A 1N36K 4FJNA 4FLVA 2A41A 2HVHA 4H0YB 1JLGA 1C0FA 1N8RO 5JICA 2QEXN 4LF7K 3TAMA 3JS6A 3QESA 2X6NA 2JGUA 5AZJA 4OLAA 3LP0A 1I3AA 3ID8A 4CZLA 1TL3A 4DSJA 5LL6Z 1C0MA 3FGUA 4B1ZA 1HPZA 4DS4A 4DV3K 1W97L 3CFRA 4DUYK 3ENOA 5KTQA 3CCRN 3SQ2A 3IS9A 4JK9A 4CZGA 3R1XA 4NCAA 5AQNA 3RTVA 4KBOA 2Y1IA 2R7YA 1VQ4N 1T7PA 2QA4N 4FWNA 1XNQK 2ZM6K 5H1SQ 1W0HA 4BC5A 2PYJA 3D0PA 4LF8K 1YTAA 2X78A 1RDWX 4RW4A 3WXIA 4X65K 3DYAA 1VQ6N 2VG7A 1NK6A 4IDKA 1SKRA 3LANA 1NU0A 4IFYA 2KFZA 5M1NA 3QEPA 2FSKA 5C12A 3QO9A 4RWTA 1EKEA 3HOSA 4FJKA 3QIOA 2P9KB 3S3OA 5EX5A 3AO4A 1NK4A 5CR4A 3NGZA 1GOBA 1IKWA 4BQLA 4M3RA 1MU2A 2RF2A 3BY5A 4CD3A 3IG1A 4IWVA 1KFDA 4BRMA 3VA0A 3ASMA 4M45A 1S6QA 5J2PA 2B6AA 4CJ3A 4FJHA 1VQ9N 4PKGA 4DTNA 4LF9K 3D2FA 1RGIA 5AJ3K 2BUPA 4LFCK 4IBNA 5AQVA 1HNVA 3QEWA 1OH7A 2DFEA 4DV6K 1CLQA 2YX6A 1CXUA 4B8AB 4L3QA 2FXUA 1IV0A 2UUAK 4FW2A 3K0SA 4NYNA 4CECA 3TTDA 3G6EN 1RNHA 3CMEN 5LJVA 4BR4A 3K5MA 2B5JA 2ZF5O 3HTVA 4AH9A 2V51B 1QTMA 3O9TA 3PIPL 3CJ9A 4HTLA 4YDUA 1LW0A 3MN7A 1VSFA 1NJWA 3SCXA 5C42A 3CCEN 1XI1A 4KB1A 3G71N 1LCUA 3N4PA 2RE2A 3MX5A 3TSQA 4JKCA 4CF2A 1JXEA 3ULDA 4F3OA 2W41A 4CFDA 2HB5A 2Q0RA 4IO9L 4C1NK 2RHKA 5HRRA 2VWBA 4DTXA 4LFAK 2LSNA 4BC2A 5LY3A 2G8IA 3TWHA 3F9KA 4LF6K 1GLDG 4FLYA 1JLQA 3MN6A 1CZBA 3DLGA 3ZSVA 3PY8A 3TSPA 1KTQA 1IKYA 4A57A 3VQ6A 1J5EK 2G8UA 2ZJQL 4DV1K 4DFPA 3QMLA 2A42A 4DR7K 4JI8K 4DSIA 4JKFA 4GY2B 3WXJA 3RSEA 2HNYA 3CPEA 3OYAA 5JMVA 3ENHA 3SUPA 2RN2A 4O44A 4CEFA 1BISA 1RILA 3O4WA 1JJ2M 3H1QA 4BR5A 2YNGA 2D0AA 1RBTA 3BP8A 2E2NA 3M5RA 4AHSA 5JLHA 3SI6A 4JRQA 2A6AA 4C8MA 5AQMA 4B3SK 3UIQA 4YHHK 1WAJA 5GIPA 4W5TA 3NCIA 4TSXA 1LAWA 3SMPA 3LWLA 2E1YA 4CJEA 1E3MA 1VRUA 5KI6A 4Y0WA 3MXMA 2VGMA 1N6QA 1JCGA 3LWMA 1M1KO 4NCGA 2UUBK 1WSJA 4DFJA 2F96A 4BDPA 1EETA 4FM0A 3D6RA 3IFRA 2Z1IA 3HVTA 1CZAN 4OKEA 2XRIA 4FOIA 4LY7A 3PX6A 3MX2A 3SYZA 3TABA 1ASVA 2P5OA 1SV5A 2DPNA 1QQOA 1C0GA 1U48A 1ITGA 3F2KA 4CZEA 4H0VB 3LDNA 1FW6A 3H3NO 1X1PA 1HKCA 1NGIA 1X3MA 3EO3A 1S5JA 1VQ8N 2GEMA 3AARA 1HKBA 4JI3K 3VQDA 3W3DA 3KLFA 4HCCA 3WQTA 3C95A 3J81O 3VGKA 1KC8O 3CQYA 1XMOK 2X74A 1TL1A 3R3LA 3TAFA 4BRKA 5GAGP 1WLJA 4Z4CA 2P9SA 2XY7A 4CZMA 3IRXA 3SQ0A 4ID5A 2IS3A 4E0DA 4O8UA 4DTJA 3TANA 3K9KA 3E66A 4B9NA 1WSIA 3DOLA 4E19A 1O13A 5HOOA 5KPTA 4BG8A 3M8RA 2QWMA 3HBTA 1H1VA 4H03B 5AQSA 2CH5A 4PUOA 4DU4A 1A5VA 2YHYA 3ZX3A 3IMXA 1RTDA 2Y1JA 3RRGA 3P31A 3BUZB 2FF3B 3I8BA 3DWLA 5F0XA 1IH7A 1HYSA 2FSJA 3S41A 3TPQA 2ASMA 4JHDA 4CHQA 1OH6A 3THWB 1YF5L 3O3HA 4EIAA 3MK6A 4LF4K 1IBLK 4FJIA 3LL3A 1RT6A 2NRVA 1J53A 3HP6A 4B3OA 3EY1A 1HYZA 3VQCA 3BF3A 5HRPA 1T44A 5C24A 3K5OA 4I6MA 4ZTFA 2D4WA 2HBKA 5F2RA 2AA4A 3AGRA 4FCYA 2W6LA 3KHYA 1R59O 3HPGA 1K9MO 4H5TA 4Z4IA 4OPKA 3NFAA 3V9ZA 1HNWK 3TARA 1RBRA 4OVLA 1JXBA 4DTOA 3C6TA 3VQBA 1T6DA 3BZKA 3CCQN 4BRNA 4AF1A 3RVCA 3VQEA 4BC3A 4H0OA 4NCBA 4FWQA 4ZTJA 1OH5A 4DV7K 4KAZA 2EHGA 3SAFA 4DR4K 1E4GT 1EXQA 3V9XA 4CFAA 3KLEA 4EZ9A 4A59A 1QE1A 3LDSA 3CM5A 2FBTA 5TKYA 5AFUH 5J1EA 1VQ7N 2O4IA 3OJSA 2YCHA 2PBDA 2P9IA 1S1TA 1Q18A 5AQZA 2O8FB 4MDBA 1VQPN 4FK4A 2KFNA 5BRFA 1TKXA 5HLFA 3ENBA 4B1XB 1V4TA 1NK5A 4DCHA 4IXCA 4DSLA 4JI7K 1MWKA 1C0TA 1Z6RA 3U9DA 5IWAK 5KGWA 4DR6K 4KTZA 3M8PA 3OS1A 3VN5A 2HW3A 2QW9A 3LDOA 4NLCA 2NNWA 4B9TA 5KRSA 3SQ1A 3LDLA 1YVUA 2FBXA 3G4SN 1NGJA 3QEXA 2O8EB 2BE2A 1RTHA 4RCHA 4B9QA 3TAEA 3NHGA 1LAVA 3DAWA 4ZHRA 2VQFK 4R5PA 3VETA 4FK2A 2P51A 4O8KA 3OYGA 5BPMA 5JVHL 3ATVA 3CQXA 4CZHA 4K25A 3NH2A 3M1FA 2IAJA 1FXXA 1HUXA 3HSCA 4JD2B 4HUGA 2E2QA 5DK5A 2A5XA 5BPNA 4KI6A 5F1XA 1KCFA 4I2QA 2ATQA 3CM6A 2GELA 1SL1A 4IOAL 2D1KA 2BDPA 4CCHA 3VTHA 2ITGA 4BQZA 5CHIA 3JSMA 3CXCM 3H1VX 5HBMA 4BVOA 4ILJA 4X64K 1XMQK 3J7AP 5KPRA 4YOVA 3NE6A 4BRGA 3IAYA 3J80O 4B08A 2A40A 1ESVA 4KRFA 3K59A 2FC0A 4FWOA 3QICA 4O0JA 1QQCA 3C7NB 1RTJA 4AHVA 2VG6A 3WNFA 1S6PA 3ZEUA 4FZYA 1CXQA 5D3GA 4BRAA 1HNZK 3V9WA 1LV5A 4FSVA 4B1YB 1BDGA 4FOEA 4E7KA 1T03A 2HMPA 1TYQA 1D9DA 2HNZA 3QNNA 4FJMA 1S9GA 2E8AA 3AY9A 3DXMB 1JLEA 4LSNA 4B1WB 3QB0A 3OYIA 3SUQA 4WFNL 3P1GA 4CZFA 4JRPA 4C23A 1X9MA 4H0PA 3PX4A 3EN9A 1TK5A 4BY9C 1ASWA 2HMIA 1KVBA 4GKJK 4YY3K 2QWOA 2WOMA 2OPSA 3H3OB 3CERA 3G0ZA 5GAHP 1ZBIA 2P5GA 4WF9L 1LWCA 3CFPA 3L2UA 1UA0A 3ALYA 3O9QA 4YOWA 1QS4A 1NK9A 4BGBA 4NB4A 4I9LA 4A2BA 1QSYA 3TTFA 3OYLA 4DQIA 2I7NA 5KRTA 4DF4A 2PFUA 2XY6A 3C65A 2GWJA 1NM1A 5AZIB 5AQQA 4M41A 1Z05A 3UKUA 5SZTA 2HNDA 1BI4B 3NH1A 4BWMA 1W7AA 1ATNA 1O1WA 2YNHA 4DV2K 4FWLA 2F4VK 1NGCA 3EEQA 1M90O 4FPBA 5M1PA 1KAYA 3LPUA 4IJAA 3P38A 3NVKA 2YNFA 3ULEB 3QINA 4OKJA 3LM9A 1RBUA 4J2EA 2E2OA 4KH4A 3AA5X 4O5FA 1DGKN 1REVA 3H45C 2NRXA 3VQQA 4FK0A 4Z4EA 4E7JA 3AAQA 4ILGB 4MLHA 4IJNA 4PKIA 1YT3A 1NKEA 1MDUB 3S3NA 4CGGA 1NJZA 4DR1K 2PAVA 4CF9A 2E6MA 3ZSYA 4JD2A 4CEOA 3VGMA 4F9OA 3DMJA 4W5OA 3C6UA 5MLCQ 2O8CB 2Q36A 5CYMA 4CJUA 2HHXA 4E3SA 4CGJA 2ZWHA 4CF8A 2ZE2A 5BPLA 4BE2A 1BCOA 1K73O 1T8EA 4BRPA 4DSFA 2Z1GA 5AQJA 1D5AA 4CE9A 4FLXA 3WEEA 3WXKA 3C6AA 4CK1A 3DLRA 1X9WA 5B8HA 3V81A 2V7ZA 3MMVA 5C0YA 3EYZA 3TU5A 1UWBA 1K8KA 2QWPA 1KAZA 1Q8IA 3VF6A 3D7EO 2OA8A 4B1VA 4B9SA 3MN5A 3CFOA 1L3VA 4IZ9A 2P9PA 4K43A 2D0OA 2ASOA 4IKFA 4KH5A 3OW2M 2WUSA 3AVAA 4CJWA 2P9UA 3PIOL 1TGOA 1U47A 3FZKA 5KGXA 3LZJA 3U3GA 4JK8A 3TI0A 3VQ7A 4KHNA 1OKJA 4FZZA 4FLTA 3HVRA 2JWLA 2EWSA 3THXB 3CQ8A 3SPZA 4K42A 2P1JA 3HM8A 3S3MA 1Q7YO 1ZBUA 4KKOA 3HI0A 4CJ7A 2VCPA 4B9VA 3CMAN 3CCJN 4CESA 4QAGA 4Z94A 1EQYA 3LALA 2D0PA 2NRHA 3AO1A 3GE1A 4R79A 4Z0UA 1S1VA 4CBWA 5IT9O 1W9HA 4I9QA 2BGGA 3R6MA 1HQUA 4CJQA 1ZBHA 1N33K 3ZYYX 3G10A 2UXCK 4W5RA 5AQTA 5BRHA 3UKRA 2ZQBA 3I33A 1IKVA 2VGNA 4ICLA 4DV0K 4E7HA 1QVGM 1KVCA 1BI4A 2WTUA 4FJ9A 5KPZA 3CD6N 3DOKA 2Q3SA 3AA2A 3OYCA 2H3GX 4RW9A 5FPNA 3L2VA 1U2VA 5FPEA 1S72N 1WBBA 1RBSA 3H6EA 4V19S 1Q9YA 1NBWA 2YHBA 4HHTA 4WYBA 4F4KA 3SPYA 2UYTA 1BIZA 5AQXA 3O3FA 1SKWA 1VSMA 1G15A 5E41A 1IBKK 1YXQA 4A5BA 2IIRA 3J7YP 4OLBA 3CCVN 4CZJA 4CZKA 4DU3A 1RDBA 5AQIA 3LDPA 3VMFB 3ID6A 3ITHA 1YHQN 4H0TB 3HRGA 1KRPA 1L3UA 2AJQA 4K8ZA 2WFBA 2P9NB 3O5BA 1NMDA 1NGHA 2KZMA 4KHUA 3AVGA 5AQYA 5GADP 3VERA 3E01A 1QSSA 1SZ2A 4DS5A 4IOXA 4CJRA 4J2AA 4CHZA 3V6DA 1BQMA 1FKPA 2HBMA 3OY9A 2NRRA 4IEIA 5BN9A 4WQ4C 1TK0A 4ISFA 3KIOA 4CZIA 3MWPA 3FLCO 4HVJA 3A8YA 1C6VA 4OPJA 3U8XA 4CEAA 4DR2K 3A0IX 4CGIA 4K41A 1G99A 1HJRA 2GUIA 1TAQA 3WNGA 4M3TA 2OTLN 4KHPK 3KK1A 4KH6A 4KREA 4KHQA 3ZETB 4JKGB 3CI5A 3H46O 2IVNA 5CZ2A 4KFBA 2DFFA 3THYB 2GUPA 4WFAL 2P9KA 3A5NC 4A2AA 1ZXOA 5FRNA 1SUQA 1VQ5N 1NGBA 1KXPA 1RT7A 2OPRA 3FE1A 3V1OA 5GINA 1FKOA 4C8KA 1RT1A 3KLHA 1JLFA 4CFCA 4C8OA 1WAFA 4DSEA 4DB3A 3B6OA 1YAGA 3CC7N 3VA3A 3OA9A 1ZBSA 3T69A 3SUNA 3DJCA 1TAUA 4BG9A 1LW2A 5EU7A 2Q0UA 3MAQA 3QETA 2ZGZA 4LC9B 3A5MC 3RMAA 4KI4A 1QSLA 5BN8A 1L5UA 5DM6L 3AVFA 4CF1A 3AA3A 3THVA 2VYPA 2D5RA 3MDQA 3V4IA 3QEIA 3OYBA 3B8AX 2ITMA 4BRIA 2XO7A 3PLAA 4CGFA 3KKRA 1VSHA 1WSGA 4GW6A 4DTMA 4LF5K 3HT3A 2PYLA 2AP1A 4NYFA 1JL2A 2Q31A 3OYDA 4H5NA 3O4NA 4H8KA 5T7BA 3F73A 1HX1A 2KKZA 1WUAA 1VAZA 4CJKA 4CHPA 5AQOA 3KD1E 3CG7A 1U6ZA 4BREA 3L2RA 2E6LA 3VENA 5JS1A 3M8QA 3L3UA 4MO5A 3HXMA 3C0BA 1WB9A 4EHUA 3EE8A 1KAXA 1KLMA 1N34K 1NNEA 3T3FA 3CJBA 3HL8A 2J4RA 4CEZA 3V9SA 3AA4A 2F9TA 5BRDA 3AO5A 1GLFO 4Y1DA 3EE9A 4KTWA 5JVGL 3ZT0A 3FFKB 2A3ZA 4GVMA 4AHTA 3J8AA 1WSHA 2KTQA 4PKHA 2E4LA 3DLBA 3Q7BA 4JI4K 1NKBA 4C8NA 3MCAB 5AQPA 4JN4A 2P9LB 5E84A 3OYKA 1WN7A 4X62K 1KLNA 4MQ3A 3K5NA 4E89A 1Z25A 4CBXA 4NLBA 1F21A 1HPMA 4EAHD 1Z26A 4Y1CA 5HRSA 2G8HA 2FSNA 4O55A 4JI1K 4J8FA 1DTQA 5AQRA 4DTUA 3ISNC 5DMRA 4E1JA 1S1XA 1RDCA 1NGAA 3TR8A 3ZETA 2HHHK 3L3VA 1QHTA 4DFKA 3O80A 3A2FA 1JLCA 3ZT2A 3I0RA 2YHWA 4WFBL 2Q97A 2QWRA 1BUPA 3E9PA 4CJLA 3O08A 5FDLA 4CHNA 4BROA 1WNSA 1TUUA 1BQNA 2NZTA 4YNQA 3BDPA 3WNHA 2YKNA 3U6FA 5CY4A 4OPAA 4JK7A 3EL2A 4N76A 1IBMK 4NO7A 3L4QA 5C2DA 3SV4A 1X3NA 4ELTA 4XH4A 2Q2RA 4C8LA 3U3YA 3A5OC 1YITN 1NK7A 1VSKA 1R0AA 1DEJA 1Q9XA 1BG3A 4CK3A 1IO2A 1BIUA 1NGEA 1IG9A 2QWLA 3OYFA 3FZMA 4DF8A 2B4JA 5ADXA 2IOCA 4QCLA 3DXKB 3O9UA 1UAXA 4H5VA 3CCMN 4PHTX 2XHBA 1GLLO 1YTUA 2YNIA 4M42A 1V4SA 2QWQA 2VG5A 3QFPA 4KB0A 4EHTA 5M1KA 1GLBG 3DRPA 5FPMA 2UUCK 3FZLA 1C0UA 4F8RA 2D0CA 1U04A 4CJ5A 3CCUN 3DI6A 4JKEA 4CBUA 1ILYA 2VQEK 4Z4HA 4ISEA 4BWJA 4LD0A 1W2BM 1RBVA 1HQEA 4NXMK 2O8DB 4DLGA 1Q81O 3KK2A 4AHUA 2ZJRL 3IKMA 3ZSRA 3O9RA 4CHYA 4FWKA 1X9JA 4UQGA 4B3RK 2O8BB 4DTPA 4O5BA 2X6SA 4IFVA 3KTQA 5FPDA 4JS4A 3DLKA 4N5SA 1LOTB 3NF7A 2QXFA 3BGRA 3T1HK 4CEEA 3QBWA 1OVYA 3KKSA 4LSLA 3B6PA 3I56N 1KQSM 3AVHA 4E1MA 1GLJO 4OGEA 3M8SA 3HM9A 1XNRK 3KLGA 3W0LA 1XQSC 3WT0A 3CCSN 2F8TA 2UXBK 2WONA 4JLHA 3JAMO 4CI6A 1HR0K 1VSDA 3DRSA 4JKAA 3KK3A 3SLCA 3SUOA 3QERA 1YIJN 2FF6A 2UXDK 1YVNA 1KVAA 3VQAA 4WQ4A 4FVUA 3VEXA 4IFEA 3R9PA 4DSKA 1T3VA 3D2EB 3CF5L 1OH8A 4GV9A 1SKSA 4K0KK 4YOYA 3TTCA 2YV0X 4IG3A 3THWA 3CCLN 2NRWA 3OVNA 4GV3A 4DMNA 1L3SA 4CK2A 5AQWA 3TSUA 1RDUA 4JKBA 4CD1A 3L2QA 1C1AA 4RW7A 4HUFA 5AZJB 5TKWA 3SV3A 2RKIA 4FPAA 4FWPA 1RT2A 3QBXA 2IVOA 4RW6A 5JLFA 3GOIA 4WQ5C 1WOQA 4FLZA 3V9UA 4XEIA 1IG8A 4KV8A 1BHLA 1U45A 4I2PA 3T1YK 2CGKA 4B3TK 3F5TA 3MWTA 3WNEA 1QQMA 3AVIA 4Q5VA 4FLUA 1Y97A 4BGAA 3CYMA 3SNNA 3I8DA 3SQ4A 4DU1A 1L3TA 1HKGA 4N47A 5A2QO 1NK8A 4MO4A 1QZ6A 2W6KA 4FWSA 3VESA 1S9EA 1BL3A 1UOCA 3GL1A 4BACA 1VSJA 3BF1A 2IVPA 3DXKA 3KK7A 4CEBA 4M3YA 1GOCA 3O8MA 3HP9A 5AQLA 2JWKA 4Z4GA 5ELZA 4QOZB 4U67L 2O8FA 1ZBLA 4JEPA 5FROA 1NWKA 3MEEA 1GLCG 2IGIA 1T6CA 2VWJA 4RTFD 3QDKA 1TVRA 4BR0A 4BRFA 3F9MA 1HMVA 3TAQA 4U7BA 3D2FB 3ZX0A 2HSTA 2I5JA 3I55N 2O8BA 1C1CA 4B1UB 2HBJA 4CW7B 4BR2A 1YI2N 1BCMA 2O8EA 4FVMA 1HNXK 3PV8A 1D9FA 4DV5K 3UE5A 2FLOA 4M3ZA 4J2DA 3AVNA 1EWQA 4QS7A 1HRHA 2E88A 4LH4A 3TAGA 1Q82O 1DT9A 1NMNA 3NGIA 4AM6A 5AQHA 5I42A 1FK9A 4W5QA 3FZHA 3NF6A 4YORA 5J2MA 2QTDA 3PSIA 4KHSA 4DQSA 3AVKA 4E1NA 3HZ6A 4FJLA 3RWUA 1ZYQA 1VQLN 5HROA 3BEXA 3KZBA 1VQNN 4CERA 1ZBFA 1U49A 3NF8A 3LP2A 2BH1A 4HCBA 3HJFA 3OYEA 3LAKA 3P39A 4XH5A 1X9SA 1NLVA 3SMSA 3U4LA 3C94A 3MECA 4H4OA 2HOEA 1I39A 4M7YA 1S3XA 4A62A 3LP3A 4JI5K 4KHWA 1J6ZA 4M7XA 1T05A 4CFBA 3C7NA 3ZT4A 2RPIA 5CYQA 2W42A 4ID1A 4F3TA 1XUPO 1S1UA 3VEOA 3JXUA 3CJAA 1SL2A 4JI0K 1RDDA 4LFBK 3JYTA 4H4MA 1BA0A 5BR9A 3DXMA 1TKZA 3Q7CA 3ZT1A 3RSEB 3N4QA 1ASUA 1TV6A 1S22A 3VQ5A 2KLAA 5AQGA 1JLBA 4DWIA 4OKKA 2HF4A 1KD1O 1NGGA 4FZXC 3CIPA 5HRNA 3VGLA 2QKKA 3CC2N 4B9UA 1FJGK 1EO1A 2KHOA 4PA1A 3PO4A 1BA1A 1NOYA 4DHYA 3MXJA 4M63C 4JS5A 5GIOA 3MXIA 2G8KA 3ATUA 1VSLA 3AV9A 2YJEA 3VQ8A 4DFMA 5AZIA 5M1QA 3QEVA 4EFHA 4JYAK 1XC9A 3WXMB 3VEYA 1E4FT 2YJFA 4CGDA 2QKBA 1NJYA 2CGLA 3LZIA 3NMUA 4EP5A 1LWEA 4E7LA 2FBYA 4CHOA 1GOAA 3CC4N 3ULEA 1DKGD 1NJIO 2NUBA 4G1QA 3LM2A 1HLUA 4FJ7A 3KJVA 2YHAA 4UY8O 1BU6O 1VRTA 1KFSA 4DV4K 3ZSOA 1RFQA 3OS2A 4RW8A 5LMUK 3UB5A 1QHAA 3RMCA 4YOUA 3NGYA 1NK0A 2FBVA 4XH1A 3VTIA 3FFIA 3AO3A 1JLAA 3J7ZO 1VSEA 3OHRA 3M6GA 1WSEA 5KQ8A 3G25A 3KVGA 5E26A 1NGDA 5EOYA 3RMDA 2O8CA 3CHWA 3S9HA 2XY8A 2G8WA 1RTIA 2P9SB 3O4QA 4EP4A 5LJWA 3ZSXA 1ZC6A 4PY5A 3QNOA 2GV9A 4BE1A 4B9LA 5AQKA 1NKCA 5AQFA 2D0BA 3H08A 3R8EA 5BR8K 3L2WA 2EX3A 4DTRA 3V1RA 3HO1A 1JCFA 4IG0A 3RR8A 4B8CA 3VF2A 4ELUA 4IEEA 3QIPA 4WQ5A 3SZ2A 3SJJA 1RT5A 3PX0A 4JKDA 4M3WA 4DLEA 3AGKA 1YJNN 1K6YA 2KW4A 3AVJA 3AVBA 3DLEA 3OBWA 4JHDB 4CEQA 4CJTA 4HWIA 3THXA 2CH6A 3ZSWA 4OGCA 5J2QA 5SWMA 1J5OA 1P90A 3DLHA 3MEDA 3CJ7A 3KWIA 2DTUA 1JKHA 1KSPA 3T7ZA 1BO5O 3RMBA 5KQDA 3BZCA 5M1FA 3GDQA 4F2SA 4JNEA 3I0SA 3EKUA 4MFBA 2Z1HA 3VQ9A 1B92A 4I6MB 4AHRA 3P5JA 2OCEA 1YJ9N 4BRHA 5EXWA 2E20A 2QWNA 2OYQA 4QS8A 3K9JA 2CGJA 1U4BA 2BTFA 3VEVA 4DQ8A 1VQKN 4FM2A 1N32K 1Y64A 4FJ5A 2HF3A 5BREA 3AAPA 3D45A 3CJCA 4CF0A 4MLEA 2KQ2A 4FYDA 3IDHA 3AVCA 2UU9K 1RCHA 3E9LA 4ISGA 4CJ4A 4YOTA 4HTUA 3VF4A 3OYMA 3P83D 1VQMN 3L6QA 4BVPA 1BGXT 1TUYA 1B9DA 3OJUA 2P9IB 3VOVA 4CEDA 2OPQA 5CE3A 4YOXA 1TKDA 4KPYA 1JL1A 3LDQA 2QK9A 3RR7A 4M3XA 4GVEA 3VQPA 4AHCA 3KLIA 4BRDA 4DUZK 2P9NA 3VEZA 3NAEA 2BANA 3L0QA 2QI2A 4FLWA 2Q1NA 3FR0A 4AQYK 2GWKA 2W40A 3ZSQA 4JAXA 4N41A 2OPPA 3U9ZA 4PQUA 2DY4A 5EY4A 2VWKA 5GAEP 1BWFO 3LP1A 4FWMA 3CETA 4PL8A 4DR3K 1SAZA 4FO0A 4FJXA 1VK0A 2F7TA 1QVFM 3WXLA 2O4GA 4C1NI 3VQ4A 3OYJA 2WC9A 3TAPA 1MA9B 4L8RB 2E2PA 4BDYA 3MCPA 3ZCMA 2GBZA 4GNIA 3MN9A 1WSFA 2NLXA 2NRTA 3DRRA 3P4IA 1HYVA 4AM7A 1I94K 4Q0BA 4ELVA 4JKGA 5I3UA 4A61A 1RT3A 3C6HA 3DM2A 1J9AA 2V52B 3THYA 2G8FA 4OO1J 5C10A 3SAGA 2F8SA 2A1SA 4WE1A 4CJFA 3IUCA 2WBNA 1SQKA 3AVMA 1UA1A 4W5NA 5J2NA 3FZFA 4HUEA 1HJOA 3GBTA 4IDHA 3T1AA 4BR7A 5AFUA 3ZEUB 3SAHA 1NOZA 4FM1A 3RRHA 3SBTA 4KHYA 2A1RA 2HHQA 3M3ZA 4I7FA 2OZSA 5FLXO 3O1BA 3PUFA 4FW1A 1D4XA 2Z1JA 1TYQB 2PZSA 2XY5A 2QM1A 4K8XA 3HK2A 3OTOK 4DKWA 3LPTA 3O1WA 3SJHA 4X66K 1ATRA 2IDOA 1K8AO 4CJSA 4E7IA 3HPHA 5LMNK 3KWGA 4IO8A 2E5LK 2ASPA 4O0IA 1Q86O 2OANA 3HPOA 3VPZA 3DLLL 1WBDA 3GG4A 4OJRA 3EZWA 5DM7L
chains in the Genus database with same CATH topology
4YFUA 1HMVA 1X1PA 3TAQA 3DOKA 1S5JA 3ZSZA 2ETJA 2Q3SA 3AA2A 2I5JA 3OYCA 3VQDA 3V1QA 4RW9A 3KLFA 3L2VA 4HCCA 1C1CA 3NDKA 3C95A 1RBSA 1Q9YA 1BCMA 2YHBA 4HHTA 2HHTA 2X74A 4F4KA 3SPYA 2PY5A 1B9FA 4FVMA 1TL1A 3PV8A 1D9FA 3TAFA 1BIZA 4DG1A 3O3FA 1SKWA 4M3ZA 1VSMA 1WLJA 1G15A 4J2DA 4CIFA 5E41A 3AVNA 4Z4CA 4CIGA 1D8YA 4FJJA 2XY7A 4OLBA 1HRHA 4DU3A 1RDBA 3IRXA 4KO0A 3SQ0A 4ID5A 2IS3A 3ITHA 4LH4A 4E0DA 3TAGA 1A5XA 3TANA 4DTJA 4XIUA 2KZZA 1KRPA 4B9NA 1L3UA 1WSIA 4CJPA 2AJQA 3DOLA 4O4GA 4E19A 3NGIA 4K8ZA 2HHSA 5I42A 1FK9A 1S1WA 4W5QA 3NF6A 3M8RA 5J2MA 1RDAA 4KHSA 4DQSA 3AVKA 3PO5A 4E1NA 4FJLA 2G8VA 3RWUA 1ZYQA 2KZMA 4KHUA 5HROA 3AVGA 3E01A 4CERA 4PUOA 1ZBFA 2DTUA 1U49A 2HHQA 4DU4A 3NF8A 1QSSA 1A5VA 3LP2A 4HCBA 3HJFA 3AVLA 1IKXA 4DS5A 3L8BA 4F2RA 3OYEA 3LAKA 1X9SA 1RTDA 2Y1JA 4CJRA 3RRGA 4J2AA 4CHZA 3V6DA 1BQMA 3C94A 1FKPA 3MECA 4H4OA 4RG8A 3OY9A 1I39A 1TK0A 3LP3A 1IH7A 4KHWA 1T05A 3KIOA 4CFBA 3ZT4A 1HYSA 1HNIA 4HVJA 2RPIA 1C6VA 5CYQA 4OPJA 2W42A 4CEAA 4FJGA 1N5YA 4ID1A 4CGIA 4F3TA 1HJRA 1S1UA 2GUIA 4CIEA 4CHQA 1J54A 3HYFA 1C1BA 3O3HA 4EZ6A 2YKMA 1TAQA 1SL2A 3WNGA 4M3TA 4Z4FA 4FJIA 1RDDA 3HSTB 3KK1A 4KREA 1RT6A 3ZT3A 3NH0A 1LWFA 3JYTA 4H4MA 1DTTA 4KHQA 1J53A 2ZD1A 3HP6A 4B3OA 3EY1A 1HYZA 3OYNA 4BE0A 1TK8A 5CZ2A 4KFBA 3VQCA 4PWDA 1TKZA 3ZT1A 2DFFA 5HRPA 5C24A 1ASUA 1NJXA 1TV6A 3K5OA 3VQ5A 4ZTFA 5FRNA 1SUQA 1JLBA 4DWIA 4OKKA 1RT7A 1TKTA 2OPRA 1XHZA 3KD5E 3V1OA 4FCYA 1FKOA 4C8KA 1RT1A 4FZXC 2HHVA 3KLHA 3HPGA 1JLFA 1XHXA 5JS2A 4CFCA 5HRNA 4C8OA 1WAFA 4KTQA 4Z4IA 1VSIA 4OPKA 3NFAA 3V9ZA 4DSEA 3NF9A 3TARA 2QKKA 3B6OA 4B9UA 3K2PA 1RBRA 3VA3A 4OVLA 1JXBA 3SUNA 1TAUA 4DTOA 1LW2A 3C6TA 4PA1A 5EU7A 3VQBA 3MXJA 3OYHA 3MAQA 3QETA 4JS5A 3K58A 1NOYA 3MXIA 3LAMA 1XWLA 2G8KA 3RMAA 4KI4A 1VSLA 2DFHA 3AV9A 5CZ1A 4BDZA 4N56A 1QSLA 5C25A 1L5UA 3VQEA 3O3GA 3AVFA 4NCBA 4CF1A 4ZTJA 3AA3A 3THVA 2D5RA 4LH5A 3NBPA 3VQ8A 4CJVA 2EHGA 2IC3A 4DQRA 4DFMA 3QEVA 3V4IA 4KAZA 3K57A 3QEIA 3OYBA 1EXQA 1XC9A 3V9XA 2XO7A 4CFAA 1SL0A 3KLEA 4EZ9A 4CGFA 3KKRA 1VSHA 4CGDA 1QE1A 1WSGA 3CM5A 2FBTA 4GW6A 3LDSA 4DTMA 1CZ9A 3HT3A 4J2BA 5J1EA 2PYLA 1NJYA 4NYFA 2OZMA 2O4IA 3OJSA 1DLOA 3LZIA 1S1TA 4EP5A 1LWEA 4E7LA 2FBYA 4B9MA 1JL2A 4FK4A 3OYDA 3K5LA 4CHOA 5T7BA 3O4NA 4H8KA 2KFNA 1GOAA 1TKXA 4GMJB 3F73A 5HLFA 4FJ8A 2NUBA 1NK5A 4G1QA 4CJKA 4CHPA 3KD1E 3CG7A 3QLHA 4DSLA 4FJ7A 3KJVA 2YHAA 1C0TA 2E6LA 3L2RA 3EZ5A 5KGWA 5JS1A 1VRTA 3M8QA 5FRMA 1A5WA 3L3UA 4KTZA 1KFSA 3M8PA 3ZSOA 4DQPA 3OS1A 4RW8A 4CGHA 3VN5A 3OS2A 3HXMA 2HHUA 3AO2A 2HW3A 1KLMA 4B9TA 5KRSA 3RMCA 3SQ1A 3NGYA 3T3FA 1NK0A 1YVUA 2FBXA 3MEGA 2FBVA 3HL8A 3FFIA 4DQQA 4DTSA 3QEXA 2BE2A 1RTHA 4CEZA 3V9SA 3AO3A 1JLAA 3AA4A 3TAEA 4M3UA 4AILC 3T19A 3NHGA 1VSEA 1LAVA 3AO5A 4Y1DA 4ZHRA 1WSEA 4KTWA 3ZT0A 4R5PA 2JLEA 3RMDA 3S9HA 5HP1A 2XY8A 2G8WA 1EP4A 1RTIA 4FXDA 4GVMA 2P51A 4FK2A 2HHWA 4AHTA 3O4QA 4EP4A 3PO4A 1EX4A 3ZSXA 3OYGA 1WSHA 3OS0A 4PY5A 2KTQA 1RT4A 3NH2A 3QNOA 2GV9A 4BE1A 5K14A 2E4LA 3DLBA 4B9LA 2IAJA 4FJNA 1FXXA 1NKCA 1NKBA 4C8NA 4FLVA 2HVHA 1JLGA 4HUGA 3OYKA 2D0BA 1WN7A 3H08A 5DK5A 1KLNA 4MQ3A 3TAMA 3L2WA 3QESA 2X6NA 2JGUA 3K5NA 4KI6A 2EX3A 4E89A 4DTRA 3V1RA 3HO1A 4OLAA 1Z25A 3LP0A 1KCFA 4I2QA 1I3AA 1F21A 2ATQA 3CM6A 4IG0A 1SL1A 3RR8A 4B8CA 1Z26A 4Y1CA 5HRSA 2BDPA 4CCHA 2G8HA 2ITGA 4O55A 3JSMA 5HBMA 4ELUA 1TL3A 4DSJA 1C0MA 4DS4A 1DTQA 1HPZA 3QIPA 3SZ2A 3ISNC 5DMRA 1RT5A 4DTUA 3SJJA 3PX0A 4M3WA 3NE6A 3CFRA 4DLEA 3IAYA 1S1XA 4B08A 1RDCA 4KRFA 1K6YA 2KW4A 3TR8A 3AVJA 5KTQA 3K59A 2FC0A 3AVBA 3SQ2A 3IS9A 3L3VA 4O0JA 1QHTA 1QQCA 1RTJA 4AHVA 4DFKA 4NCAA 2VG6A 3DLEA 1S6PA 3WNFA 4FZYA 3A2FA 1JLCA 3ZT2A 1CXQA 3I0RA 3RTVA 2Y1IA 5D3GA 2R7YA 1T7PA 4CJTA 3V9WA 4CEQA 1LV5A 4CJLA 3ZSWA 4OGCA 5FDLA 4CHNA 5SWMA 5J2QA 1J5OA 1W0HA 1WNSA 3MEDA 3D0PA 2PYJA 1JKHA 1YTAA 2X78A 4RW4A 1BQNA 4YNQA 4E7KA 1T03A 1KSPA 3RMBA 3DYAA 1D9DA 3BDPA 2VG7A 2HNZA 1NK6A 3QNNA 4IDKA 1SKRA 3LANA 1S9GA 4IFYA 4FJMA 2KFZA 3WNHA 3QEPA 1JLEA 4LSNA 3SUQA 2YKNA 3OYIA 5CY4A 3U6FA 3QO9A 4N76A 1EKEA 4F2SA 3P1GA 4JRPA 1X9MA 4FJKA 3QIOA 3I0SA 2Z1HA 4MFBA 3SV4A 3PX4A 3VQ9A 1B92A 4AHRA 3S3OA 3P5JA 3AO4A 1ASWA 1TK5A 4ELTA 1NK4A 1KVBA 2HMIA 3NGZA 4C8LA 1GOBA 3U3YA 1IKWA 1NK7A 2WOMA 2OYQA 1VSKA 2OPSA 1MU2A 2RF2A 3G0ZA 4M3RA 1R0AA 1Q9XA 3IG1A 1ZBIA 4CK3A 1IO2A 1BIUA 3DLHA 1U4BA 1IG9A 1KFDA 3OYFA 1LWCA 3VA0A 3CFPA 4DF8A 2B4JA 3L2UA 2IOCA 3ALYA 1UA0A 3ASMA 4QCLA 4M45A 4FM2A 1UAXA 1S6QA 4FJ5A 1QS4A 5J2PA 2B6AA 1NK9A 4CJ3A 4I9LA 3D45A 4FJHA 1QSYA 2XHBA 4CF0A 3OYLA 4DTNA 1YTUA 4DQIA 2YNIA 5KRTA 4M42A 2VG5A 4DF4A 4KB0A 2XY6A 2KQ2A 4FYDA 3AVCA 1RCHA 3DRPA 4IBNA 1HNVA 3QEWA 1C0UA 2DFEA 2D0CA 4F8RA 1CLQA 1U04A 4CJ5A 1CXUA 3DI6A 4M41A 4B8AB 4CJ4A 4HTUA 5SZTA 2HNDA 1BI4B 4Z4HA 4BWJA 3OYMA 3P83D 4LD0A 3NH1A 4FW2A 4BWMA 1RBVA 1HQEA 4NYNA 2YNHA 1O1WA 1BGXT 4CECA 4DLGA 1B9DA 3OJUA 3KK2A 1RNHA 4AHUA 3ZSRA 4CEDA 2OPQA 1TKDA 3LPUA 4KPYA 4CHYA 1JL1A 3K5MA 2B5JA 4UQGA 2QK9A 4DTPA 4O5BA 4AH9A 2X6SA 2YNFA 3RR7A 1QTMA 4M3XA 3VQPA 4AHCA 3QINA 4OKJA 3KLIA 1RBUA 4IFVA 4J2EA 3KTQA 4JS4A 3DLKA 4N5SA 3NF7A 2QXFA 3BGRA 1LW0A 3AA5X 3NAEA 4CEEA 2BANA 3KKSA 1VSFA 4LSLA 1NJWA 1REVA 3B6PA 3VQQA 5C42A 3SCXA 4FK0A 4FLWA 1XI1A 4KB1A 4Z4EA 4E7JA 3AVHA 4E1MA 4OGEA 3M8SA 3HM9A 3KLGA 1YT3A 1NKEA 4CF2A 3S3NA 1JXEA 4CGGA 1NJZA 3ZSQA 2F8TA 4N41A 3ULDA 4F3OA 2OPPA 2WONA 4JLHA 4CF9A 2E6MA 4PQUA 2DY4A 3ZSYA 2VWKA 4CFDA 2HB5A 4CEOA 1VSDA 3LP1A 3DMJA 5HRRA 3DRSA 3KK3A 4DTXA 4W5OA 3SUOA 3C6UA 3QERA 2LSNA 5CYMA 4CJUA 2HHXA 1KVAA 4E3SA 3VQAA 4CGJA 4CF8A 4FJXA 2ZE2A 4BE2A 1BCOA 2G8IA 1VK0A 4DSKA 3TWHA 1T8EA 2QKBA 2O4GA 3VQ4A 3OYJA 3TAPA 4DSFA 3F9KA 2Z1GA 4FLYA 1JLQA 1SKSA 1CZBA 3DLGA 3ZSVA 1D5AA 4CE9A 4BDYA 3PY8A 2YV0X 4L8RB 4IG3A 3ZCMA 1KTQA 4FLXA 1IKYA 3VQ6A 3OVNA 2G8UA 2GBZA 4CK1A 3DLRA 4DMNA 1X9WA 1WSFA 4CK2A 1L3SA 3L2QA 4DFPA 3V81A 3DRRA 1C1AA 4RW7A 1HYVA 3EYZA 4HUFA 4Q0BA 1UWBA 4ELVA 5I3UA 4DSIA 1Q8IA 3SV3A 1RT3A 2RKIA 3DM2A 1J9AA 2OA8A 4B9SA 2G8FA 1RT2A 2HNYA 3CFOA 3OYAA 1L3VA 2P5GA 4RW6A 3SUPA 2RN2A 4O44A 4IKFA 2F8SA 4CEFA 1BISA 1RILA 4FLZA 2YNGA 3V9UA 2A1SA 4WE1A 4KV8A 2D0AA 1BHLA 4CJFA 3AVAA 1U45A 4I2PA 4CJWA 1RBTA 3AVMA 1UA1A 4W5NA 5J2NA 4AHSA 3SI6A 1TGOA 4HUEA 4JRQA 1U47A 4C8MA 3WNEA 5KGXA 3AVIA 3U3GA 4Q5VA 3LZJA 3UIQA 3T1AA 4FLUA 3TI0A 1WAJA 4FM1A 1Y97A 1NOZA 3RRHA 4KHYA 3CYMA 2A1RA 3VQ7A 4W5TA 3NCIA 4KHNA 4TSXA 1LAWA 4I7FA 3LWLA 3SNNA 2OZSA 3I8DA 4FZZA 4FLTA 3SQ4A 4DU1A 4CJEA 3HVRA 1L3TA 3PUFA 4FW1A 1VRUA 3CQ8A 3SPZA 2Z1JA 4N47A 2P1JA 5KI6A 3S3MA 3MXMA 1ZBUA 4KKOA 1NK8A 1N6QA 2PZSA 1S9EA 1BL3A 4B9VA 3LWMA 1UOCA 4BACA 2XY5A 1VSJA 4CESA 4NCGA 4QAGA 4K8XA 3LALA 1WSJA 3HK2A 4DFJA 4CEBA 4M3YA 2F96A 1GOCA 3AO1A 3HP9A 4Z0UA 1S1VA 3LPTA 4BDPA 4Z4GA 1EETA 4FM0A 1W9HA 4I9QA 4QOZB 2BGGA 1ZBLA 2IDOA 1HQUA 2Z1IA 4CJSA 4E7IA 3HVTA 3HPHA 4CJQA 4OKEA 1ZBHA 2XRIA 4LY7A 3G10A 5FROA 4W5RA 3PX6A 3SYZA 3TABA 3MEEA 2ZQBA 1ASVA 2P5OA 1SV5A 4O0IA 1IKVA 4ICLA 4E7HA 1U48A 2IGIA 1KVCA 1ITGA 1BI4A 3HPOA 2VWJA 4OJRA 1TVRA 4FJ9A 2HVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFU A;  1HMV A;  1X1P A;  3TAQ A;  3DOK A;  1S5J A;  3ZSZ A;  2ETJ A;  2Q3S A;  3AA2 A;  2I5J A;  3OYC A;  3VQD A;  3V1Q A;  4RW9 A;  3KLF A;  3L2V A;  4HCC A;  1C1C A;  3NDK A;  3C95 A;  1RBS A;  1Q9Y A;  1BCM A;  2YHB A;  4HHT A;  2HHT A;  2X74 A;  4F4K A;  3SPY A;  2PY5 A;  1B9F A;  4FVM A;  1TL1 A;  3PV8 A;  1D9F A;  3TAF A;  1BIZ A;  4DG1 A;  3O3F A;  1SKW A;  4M3Z A;  1VSM A;  1WLJ A;  1G15 A;  4J2D A;  4CIF A;  5E41 A;  3AVN A;  4Z4C A;  4CIG A;  1D8Y A;  4FJJ A;  2XY7 A;  4OLB A;  1HRH A;  4DU3 A;  1RDB A;  3IRX A;  4KO0 A;  3SQ0 A;  4ID5 A;  2IS3 A;  3ITH A;  4LH4 A;  4E0D A;  3TAG A;  1A5X A;  3TAN A;  4DTJ A;  4XIU A;  2KZZ A;  1KRP A;  4B9N A;  1L3U A;  1WSI A;  4CJP A;  2AJQ A;  3DOL A;  4O4G A;  4E19 A;  3NGI A;  4K8Z A;  2HHS A;  5I42 A;  1FK9 A;  1S1W A;  4W5Q A;  3NF6 A;  3M8R A;  5J2M A;  1RDA A;  4KHS A;  4DQS A;  3AVK A;  3PO5 A;  4E1N A;  4FJL A;  2G8V A;  3RWU A;  1ZYQ A;  2KZM A;  4KHU A;  5HRO A;  3AVG A;  3E01 A;  4CER A;  4PUO A;  1ZBF A;  2DTU A;  1U49 A;  2HHQ A;  4DU4 A;  3NF8 A;  1QSS A;  1A5V A;  3LP2 A;  4HCB A;  3HJF A;  3AVL A;  1IKX A;  4DS5 A;  3L8B A;  4F2R A;  3OYE A;  3LAK A;  1X9S A;  1RTD A;  2Y1J A;  4CJR A;  3RRG A;  4J2A A;  4CHZ A;  3V6D A;  1BQM A;  3C94 A;  1FKP A;  3MEC A;  4H4O A;  4RG8 A;  3OY9 A;  1I39 A;  1TK0 A;  3LP3 A;  1IH7 A;  4KHW A;  1T05 A;  3KIO A;  4CFB A;  3ZT4 A;  1HYS A;  1HNI A;  4HVJ A;  2RPI A;  1C6V A;  5CYQ A;  4OPJ A;  2W42 A;  4CEA A;  4FJG A;  1N5Y A;  4ID1 A;  4CGI A;  4F3T A;  1HJR A;  1S1U A;  2GUI A;  4CIE A;  4CHQ A;  1J54 A;  3HYF A;  1C1B A;  3O3H A;  4EZ6 A;  2YKM A;  1TAQ A;  1SL2 A;  3WNG A;  4M3T A;  4Z4F A;  4FJI A;  1RDD A;  3HST B;  3KK1 A;  4KRE A;  1RT6 A;  3ZT3 A;  3NH0 A;  1LWF A;  3JYT A;  4H4M A;  1DTT A;  4KHQ A;  1J53 A;  2ZD1 A;  3HP6 A;  4B3O A;  3EY1 A;  1HYZ A;  3OYN A;  4BE0 A;  1TK8 A;  5CZ2 A;  4KFB A;  3VQC A;  4PWD A;  1TKZ A;  3ZT1 A;  2DFF A;  5HRP A;  5C24 A;  1ASU A;  1NJX A;  1TV6 A;  3K5O A;  3VQ5 A;  4ZTF A;  5FRN A;  1SUQ A;  1JLB A;  4DWI A;  4OKK A;  1RT7 A;  1TKT A;  2OPR A;  1XHZ A;  3KD5 E;  3V1O A;  4FCY A;  1FKO A;  4C8K A;  1RT1 A;  4FZX C;  2HHV A;  3KLH A;  3HPG A;  1JLF A;  1XHX A;  5JS2 A;  4CFC A;  5HRN A;  4C8O A;  1WAF A;  4KTQ A;  4Z4I A;  1VSI A;  4OPK A;  3NFA A;  3V9Z A;  4DSE A;  3NF9 A;  3TAR A;  2QKK A;  3B6O A;  4B9U A;  3K2P A;  1RBR A;  3VA3 A;  4OVL A;  1JXB A;  3SUN A;  1TAU A;  4DTO A;  1LW2 A;  3C6T A;  4PA1 A;  5EU7 A;  3VQB A;  3MXJ A;  3OYH A;  3MAQ A;  3QET A;  4JS5 A;  3K58 A;  1NOY A;  3MXI A;  3LAM A;  1XWL A;  2G8K A;  3RMA A;  4KI4 A;  1VSL A;  2DFH A;  3AV9 A;  5CZ1 A;  4BDZ A;  4N56 A;  1QSL A;  5C25 A;  1L5U A;  3VQE A;  3O3G A;  3AVF A;  4NCB A;  4CF1 A;  4ZTJ A;  3AA3 A;  3THV A;  2D5R A;  4LH5 A;  3NBP A;  3VQ8 A;  4CJV A;  2EHG A;  2IC3 A;  4DQR A;  4DFM A;  3QEV A;  3V4I A;  4KAZ A;  3K57 A;  3QEI A;  3OYB A;  1EXQ A;  1XC9 A;  3V9X A;  2XO7 A;  4CFA A;  1SL0 A;  3KLE A;  4EZ9 A;  4CGF A;  3KKR A;  1VSH A;  4CGD A;  1QE1 A;  1WSG A;  3CM5 A;  2FBT A;  4GW6 A;  3LDS A;  4DTM A;  1CZ9 A;  3HT3 A;  4J2B A;  5J1E A;  2PYL A;  1NJY A;  4NYF A;  2OZM A;  2O4I A;  3OJS A;  1DLO A;  3LZI A;  1S1T A;  4EP5 A;  1LWE A;  4E7L A;  2FBY A;  4B9M A;  1JL2 A;  4FK4 A;  3OYD A;  3K5L A;  4CHO A;  5T7B A;  3O4N A;  4H8K A;  2KFN A;  1GOA A;  1TKX A;  4GMJ B;  3F73 A;  5HLF A;  4FJ8 A;  2NUB A;  1NK5 A;  4G1Q A;  4CJK A;  4CHP A;  3KD1 E;  3CG7 A;  3QLH A;  4DSL A;  4FJ7 A;  3KJV A;  2YHA A;  1C0T A;  2E6L A;  3L2R A;  3EZ5 A;  5KGW A;  5JS1 A;  1VRT A;  3M8Q A;  5FRM A;  1A5W A;  3L3U A;  4KTZ A;  1KFS A;  3M8P A;  3ZSO A;  4DQP A;  3OS1 A;  4RW8 A;  4CGH A;  3VN5 A;  3OS2 A;  3HXM A;  2HHU A;  3AO2 A;  2HW3 A;  1KLM A;  4B9T A;  5KRS A;  3RMC A;  3SQ1 A;  3NGY A;  3T3F A;  1NK0 A;  1YVU A;  2FBX A;  3MEG A;  2FBV A;  3HL8 A;  3FFI A;  4DQQ A;  4DTS A;  3QEX A;  2BE2 A;  1RTH A;  4CEZ A;  3V9S A;  3AO3 A;  1JLA A;  3AA4 A;  3TAE A;  4M3U A;  4AIL C;  3T19 A;  3NHG A;  1VSE A;  1LAV A;  3AO5 A;  4Y1D A;  4ZHR A;  1WSE A;  4KTW A;  3ZT0 A;  4R5P A;  2JLE A;  3RMD A;  3S9H A;  5HP1 A;  2XY8 A;  2G8W A;  1EP4 A;  1RTI A;  4FXD A;  4GVM A;  2P51 A;  4FK2 A;  2HHW A;  4AHT A;  3O4Q A;  4EP4 A;  3PO4 A;  1EX4 A;  3ZSX A;  3OYG A;  1WSH A;  3OS0 A;  4PY5 A;  2KTQ A;  1RT4 A;  3NH2 A;  3QNO A;  2GV9 A;  4BE1 A;  5K14 A;  2E4L A;  3DLB A;  4B9L A;  2IAJ A;  4FJN A;  1FXX A;  1NKC A;  1NKB A;  4C8N A;  4FLV A;  2HVH A;  1JLG A;  4HUG A;  3OYK A;  2D0B A;  1WN7 A;  3H08 A;  5DK5 A;  1KLN A;  4MQ3 A;  3TAM A;  3L2W A;  3QES A;  2X6N A;  2JGU A;  3K5N A;  4KI6 A;  2EX3 A;  4E89 A;  4DTR A;  3V1R A;  3HO1 A;  4OLA A;  1Z25 A;  3LP0 A;  1KCF A;  4I2Q A;  1I3A A;  1F21 A;  2ATQ A;  3CM6 A;  4IG0 A;  1SL1 A;  3RR8 A;  4B8C A;  1Z26 A;  4Y1C A;  5HRS A;  2BDP A;  4CCH A;  2G8H A;  2ITG A;  4O55 A;  3JSM A;  5HBM A;  4ELU A;  1TL3 A;  4DSJ A;  1C0M A;  4DS4 A;  1DTQ A;  1HPZ A;  3QIP A;  3SZ2 A;  3ISN C;  5DMR A;  1RT5 A;  4DTU A;  3SJJ A;  3PX0 A;  4M3W A;  3NE6 A;  3CFR A;  4DLE A;  3IAY A;  1S1X A;  4B08 A;  1RDC A;  4KRF A;  1K6Y A;  2KW4 A;  3TR8 A;  3AVJ A;  5KTQ A;  3K59 A;  2FC0 A;  3AVB A;  3SQ2 A;  3IS9 A;  3L3V A;  4O0J A;  1QHT A;  1QQC A;  1RTJ A;  4AHV A;  4DFK A;  4NCA A;  2VG6 A;  3DLE A;  1S6P A;  3WNF A;  4FZY A;  3A2F A;  1JLC A;  3ZT2 A;  1CXQ A;  3I0R A;  3RTV A;  2Y1I A;  5D3G A;  2R7Y A;  1T7P A;  4CJT A;  3V9W A;  4CEQ A;  1LV5 A;  4CJL A;  3ZSW A;  4OGC A;  5FDL A;  4CHN A;  5SWM A;  5J2Q A;  1J5O A;  1W0H A;  1WNS A;  3MED A;  3D0P A;  2PYJ A;  1JKH A;  1YTA A;  2X78 A;  4RW4 A;  1BQN A;  4YNQ A;  4E7K A;  1T03 A;  1KSP A;  3RMB A;  3DYA A;  1D9D A;  3BDP A;  2VG7 A;  2HNZ A;  1NK6 A;  3QNN A;  4IDK A;  1SKR A;  3LAN A;  1S9G A;  4IFY A;  4FJM A;  2KFZ A;  3WNH A;  3QEP A;  1JLE A;  4LSN A;  3SUQ A;  2YKN A;  3OYI A;  5CY4 A;  3U6F A;  3QO9 A;  4N76 A;  1EKE A;  4F2S A;  3P1G A;  4JRP A;  1X9M A;  4FJK A;  3QIO A;  3I0S A;  2Z1H A;  4MFB A;  3SV4 A;  3PX4 A;  3VQ9 A;  1B92 A;  4AHR A;  3S3O A;  3P5J A;  3AO4 A;  1ASW A;  1TK5 A;  4ELT A;  1NK4 A;  1KVB A;  2HMI A;  3NGZ A;  4C8L A;  1GOB A;  3U3Y A;  1IKW A;  1NK7 A;  2WOM A;  2OYQ A;  1VSK A;  2OPS A;  1MU2 A;  2RF2 A;  3G0Z A;  4M3R A;  1R0A A;  1Q9X A;  3IG1 A;  1ZBI A;  4CK3 A;  1IO2 A;  1BIU A;  3DLH A;  1U4B A;  1IG9 A;  1KFD A;  3OYF A;  1LWC A;  3VA0 A;  3CFP A;  4DF8 A;  2B4J A;  3L2U A;  2IOC A;  3ALY A;  1UA0 A;  3ASM A;  4QCL A;  4M45 A;  4FM2 A;  1UAX A;  1S6Q A;  4FJ5 A;  1QS4 A;  5J2P A;  2B6A A;  1NK9 A;  4CJ3 A;  4I9L A;  3D45 A;  4FJH A;  1QSY A;  2XHB A;  4CF0 A;  3OYL A;  4DTN A;  1YTU A;  4DQI A;  2YNI A;  5KRT A;  4M42 A;  2VG5 A;  4DF4 A;  4KB0 A;  2XY6 A;  2KQ2 A;  4FYD A;  3AVC A;  1RCH A;  3DRP A;  4IBN A;  1HNV A;  3QEW A;  1C0U A;  2DFE A;  2D0C A;  4F8R A;  1CLQ A;  1U04 A;  4CJ5 A;  1CXU A;  3DI6 A;  4M41 A;  4B8A B;  4CJ4 A;  4HTU A;  5SZT A;  2HND A;  1BI4 B;  4Z4H A;  4BWJ A;  3OYM A;  3P83 D;  4LD0 A;  3NH1 A;  4FW2 A;  4BWM A;  1RBV A;  1HQE A;  4NYN A;  2YNH A;  1O1W A;  1BGX T;  4CEC A;  4DLG A;  1B9D A;  3OJU A;  3KK2 A;  1RNH A;  4AHU A;  3ZSR A;  4CED A;  2OPQ A;  1TKD A;  3LPU A;  4KPY A;  4CHY A;  1JL1 A;  3K5M A;  2B5J A;  4UQG A;  2QK9 A;  4DTP A;  4O5B A;  4AH9 A;  2X6S A;  2YNF A;  3RR7 A;  1QTM A;  4M3X A;  3VQP A;  4AHC A;  3QIN A;  4OKJ A;  3KLI A;  1RBU A;  4IFV A;  4J2E A;  3KTQ A;  4JS4 A;  3DLK A;  4N5S A;  3NF7 A;  2QXF A;  3BGR A;  1LW0 A;  3AA5 X;  3NAE A;  4CEE A;  2BAN A;  3KKS A;  1VSF A;  4LSL A;  1NJW A;  1REV A;  3B6P A;  3VQQ A;  5C42 A;  3SCX A;  4FK0 A;  4FLW A;  1XI1 A;  4KB1 A;  4Z4E A;  4E7J A;  3AVH A;  4E1M A;  4OGE A;  3M8S A;  3HM9 A;  3KLG A;  1YT3 A;  1NKE A;  4CF2 A;  3S3N A;  1JXE A;  4CGG A;  1NJZ A;  3ZSQ A;  2F8T A;  4N41 A;  3ULD A;  4F3O A;  2OPP A;  2WON A;  4JLH A;  4CF9 A;  2E6M A;  4PQU A;  2DY4 A;  3ZSY A;  2VWK A;  4CFD A;  2HB5 A;  4CEO A;  1VSD A;  3LP1 A;  3DMJ A;  5HRR A;  3DRS A;  3KK3 A;  4DTX A;  4W5O A;  3SUO A;  3C6U A;  3QER A;  2LSN A;  5CYM A;  4CJU A;  2HHX A;  1KVA A;  4E3S A;  3VQA A;  4CGJ A;  4CF8 A;  4FJX A;  2ZE2 A;  4BE2 A;  1BCO A;  2G8I A;  1VK0 A;  4DSK A;  3TWH A;  1T8E A;  2QKB A;  2O4G A;  3VQ4 A;  3OYJ A;  3TAP A;  4DSF A;  3F9K A;  2Z1G A;  4FLY A;  1JLQ A;  1SKS A;  1CZB A;  3DLG A;  3ZSV A;  1D5A A;  4CE9 A;  4BDY A;  3PY8 A;  2YV0 X;  4L8R B;  4IG3 A;  3ZCM A;  1KTQ A;  4FLX A;  1IKY A;  3VQ6 A;  3OVN A;  2G8U A;  2GBZ A;  4CK1 A;  3DLR A;  4DMN A;  1X9W A;  1WSF A;  4CK2 A;  1L3S A;  3L2Q A;  4DFP A;  3V81 A;  3DRR A;  1C1A A;  4RW7 A;  1HYV A;  3EYZ A;  4HUF A;  4Q0B A;  1UWB A;  4ELV A;  5I3U A;  4DSI A;  1Q8I A;  3SV3 A;  1RT3 A;  2RKI A;  3DM2 A;  1J9A A;  2OA8 A;  4B9S A;  2G8F A;  1RT2 A;  2HNY A;  3CFO A;  3OYA A;  1L3V A;  2P5G A;  4RW6 A;  3SUP A;  2RN2 A;  4O44 A;  4IKF A;  2F8S A;  4CEF A;  1BIS A;  1RIL A;  4FLZ A;  2YNG A;  3V9U A;  2A1S A;  4WE1 A;  4KV8 A;  2D0A A;  1BHL A;  4CJF A;  3AVA A;  1U45 A;  4I2P A;  4CJW A;  1RBT A;  3AVM A;  1UA1 A;  4W5N A;  5J2N A;  4AHS A;  3SI6 A;  1TGO A;  4HUE A;  4JRQ A;  1U47 A;  4C8M A;  3WNE A;  5KGX A;  3AVI A;  3U3G A;  4Q5V A;  3LZJ A;  3UIQ A;  3T1A A;  4FLU A;  3TI0 A;  1WAJ A;  4FM1 A;  1Y97 A;  1NOZ A;  3RRH A;  4KHY A;  3CYM A;  2A1R A;  3VQ7 A;  4W5T A;  3NCI A;  4KHN A;  4TSX A;  1LAW A;  4I7F A;  3LWL A;  3SNN A;  2OZS A;  3I8D A;  4FZZ A;  4FLT A;  3SQ4 A;  4DU1 A;  4CJE A;  3HVR A;  1L3T A;  3PUF A;  4FW1 A;  1VRU A;  3CQ8 A;  3SPZ A;  2Z1J A;  4N47 A;  2P1J A;  5KI6 A;  3S3M A;  3MXM A;  1ZBU A;  4KKO A;  1NK8 A;  1N6Q A;  2PZS A;  1S9E A;  1BL3 A;  4B9V A;  3LWM A;  1UOC A;  4BAC A;  2XY5 A;  1VSJ A;  4CES A;  4NCG A;  4QAG A;  4K8X A;  3LAL A;  1WSJ A;  3HK2 A;  4DFJ A;  4CEB A;  4M3Y A;  2F96 A;  1GOC A;  3AO1 A;  3HP9 A;  4Z0U A;  1S1V A;  3LPT A;  4BDP A;  4Z4G A;  1EET A;  4FM0 A;  1W9H A;  4I9Q A;  4QOZ B;  2BGG A;  1ZBL A;  2IDO A;  1HQU A;  2Z1I A;  4CJS A;  4E7I A;  3HVT A;  3HPH A;  4CJQ A;  4OKE A;  1ZBH A;  2XRI A;  4LY7 A;  3G10 A;  5FRO A;  4W5R A;  3PX6 A;  3SYZ A;  3TAB A;  3MEE A;  2ZQB A;  1ASV A;  2P5O A;  1SV5 A;  4O0I A;  1IKV A;  4ICL A;  4E7H A;  1U48 A;  2IGI A;  1KVC A;  1ITG A;  1BI4 A;  3HPO A;  2VWJ A;  4OJR A;  1TVR A;  4FJ9 A;  2HVI A; 
#chains in the Genus database with same CATH topology
 4YFU A;  3EKS A;  3ZSZ A;  2ETJ A;  4BC4 A;  1GLE G;  4WCE L;  3V1Q A;  2QXL A;  3NDK A;  3E1Y A;  1IJJ A;  4BRC A;  3SK3 A;  2HHT A;  2PY5 A;  1B9F A;  3UKU B;  3L4I A;  4DG1 A;  4FWR A;  5ADX H;  2I7P A;  4ILH A;  4A5A A;  4CIF A;  4CIG A;  1D8Y A;  4FJJ A;  2ZGY A;  1OVQ A;  4KO0 A;  3O9S A;  1YJW N;  1A5X A;  4XIU A;  2KZZ A;  3OBY A;  1XC3 A;  4CJP A;  4O4G A;  4OX9 K;  2HHS A;  5C2F A;  1S1W A;  4YDU C;  2P9L A;  1RDA A;  5M1O A;  1GLA G;  1QZ5 A;  3ZLJ A;  3PO5 A;  2G8V A;  1MWM A;  3O6W A;  4JV5 K;  1JCE A;  3AVL A;  1IKX A;  3L8B A;  4F2R A;  2HBL A;  1NG9 A;  4RG8 A;  2OTJ N;  4MDA A;  3HOT A;  4FL9 A;  4DR5 K;  1HNI A;  4JKH A;  4JI2 K;  4FJG A;  1N5Y A;  3WQU A;  4BRL A;  4CIE A;  4EZ6 A;  3WUH A;  1J54 A;  3HYF A;  1C1B A;  3WEE B;  2YKM A;  2GX9 A;  4Z4F A;  5EVZ A;  3HST B;  3ZT3 A;  3NH0 A;  1LWF A;  4QS9 A;  1DTT A;  2ZD1 A;  1K8K B;  3OYN A;  4BE0 A;  1TK8 A;  4PWD A;  3VEW A;  1YUW A;  4OPH A;  1NJX A;  2P9P B;  3ZX2 A;  1VHX A;  3KD5 E;  1TKT A;  1XHZ A;  4BR9 A;  2P9U B;  4CVN E;  2HHV A;  5AQU A;  1XHX A;  5JS2 A;  4KTQ A;  2HVI A;  1VSI A;  1ATS A;  3NF9 A;  3K2P A;  4G9Z A;  3OYH A;  3K58 A;  5C15 A;  3LAM A;  1XWL A;  4NXN K;  1QQN A;  4BRQ A;  2DFH A;  5CZ1 A;  4BDZ A;  4N56 A;  5C25 A;  4B3M K;  3O3G A;  2GTD A;  4LH5 A;  4CJV A;  3NBP A;  4DQR A;  2IC3 A;  5AR0 A;  3K57 A;  2ZJP L;  1SL0 A;  4PL7 A;  2O8D A;  4H5R A;  1CZ9 A;  3E9O A;  4J2B A;  2OZM A;  1DLO A;  2V7Y A;  4B9M A;  3K5L A;  4H0X B;  1BOT O;  4GV6 A;  4GMJ B;  4FJ8 A;  3UKR B;  3QLH A;  3CJ1 A;  1SS6 A;  4H5W A;  2E1Z A;  3EZ5 A;  2F9W A;  5FRM A;  1A5W A;  3A5L C;  3SBG A;  3PSF A;  4DQP A;  4CGH A;  2HHU A;  3AO2 A;  2NRZ A;  5HL7 L;  4IOC L;  3QFU A;  3CPW M;  1U2V B;  3MEG A;  1EWR A;  4DQQ A;  4DTS A;  2YHX A;  4GKK K;  4M3U A;  4AIL C;  3T19 A;  1VQO N;  2JLE A;  5I9E B;  5HP1 A;  1EP4 A;  3NVM A;  4FXD A;  2HHW A;  1P8Z A;  1EX4 A;  4JI6 K;  1NGF A;  3OS0 A;  1RT4 A;  3D2E A;  2YI1 A;  5K14 A;  1N36 K;  4FJN A;  4FLV A;  2A41 A;  2HVH A;  4H0Y B;  1JLG A;  1C0F A;  1N8R O;  5JIC A;  2QEX N;  4LF7 K;  3TAM A;  3JS6 A;  3QES A;  2X6N A;  2JGU A;  5AZJ A;  4OLA A;  3LP0 A;  1I3A A;  3ID8 A;  4CZL A;  1TL3 A;  4DSJ A;  5LL6 Z;  1C0M A;  3FGU A;  4B1Z A;  1HPZ A;  4DS4 A;  4DV3 K;  1W97 L;  3CFR A;  4DUY K;  3ENO A;  5KTQ A;  3CCR N;  3SQ2 A;  3IS9 A;  4JK9 A;  4CZG A;  3R1X A;  4NCA A;  5AQN A;  3RTV A;  4KBO A;  2Y1I A;  2R7Y A;  1VQ4 N;  1T7P A;  2QA4 N;  4FWN A;  1XNQ K;  2ZM6 K;  5H1S Q;  1W0H A;  4BC5 A;  2PYJ A;  3D0P A;  4LF8 K;  1YTA A;  2X78 A;  1RDW X;  4RW4 A;  3WXI A;  4X65 K;  3DYA A;  1VQ6 N;  2VG7 A;  1NK6 A;  4IDK A;  1SKR A;  3LAN A;  1NU0 A;  4IFY A;  2KFZ A;  5M1N A;  3QEP A;  2FSK A;  5C12 A;  3QO9 A;  4RWT A;  1EKE A;  3HOS A;  4FJK A;  3QIO A;  2P9K B;  3S3O A;  5EX5 A;  3AO4 A;  1NK4 A;  5CR4 A;  3NGZ A;  1GOB A;  1IKW A;  4BQL A;  4M3R A;  1MU2 A;  2RF2 A;  3BY5 A;  4CD3 A;  3IG1 A;  4IWV A;  1KFD A;  4BRM A;  3VA0 A;  3ASM A;  4M45 A;  1S6Q A;  5J2P A;  2B6A A;  4CJ3 A;  4FJH A;  1VQ9 N;  4PKG A;  4DTN A;  4LF9 K;  3D2F A;  1RGI A;  5AJ3 K;  2BUP A;  4LFC K;  4IBN A;  5AQV A;  1HNV A;  3QEW A;  1OH7 A;  2DFE A;  4DV6 K;  1CLQ A;  2YX6 A;  1CXU A;  4B8A B;  4L3Q A;  2FXU A;  1IV0 A;  2UUA K;  4FW2 A;  3K0S A;  4NYN A;  4CEC A;  3TTD A;  3G6E N;  1RNH A;  3CME N;  5LJV A;  4BR4 A;  3K5M A;  2B5J A;  2ZF5 O;  3HTV A;  4AH9 A;  2V51 B;  1QTM A;  3O9T A;  3PIP L;  3CJ9 A;  4HTL A;  4YDU A;  1LW0 A;  3MN7 A;  1VSF A;  1NJW A;  3SCX A;  5C42 A;  3CCE N;  1XI1 A;  4KB1 A;  3G71 N;  1LCU A;  3N4P A;  2RE2 A;  3MX5 A;  3TSQ A;  4JKC A;  4CF2 A;  1JXE A;  3ULD A;  4F3O A;  2W41 A;  4CFD A;  2HB5 A;  2Q0R A;  4IO9 L;  4C1N K;  2RHK A;  5HRR A;  2VWB A;  4DTX A;  4LFA K;  2LSN A;  4BC2 A;  5LY3 A;  2G8I A;  3TWH A;  3F9K A;  4LF6 K;  1GLD G;  4FLY A;  1JLQ A;  3MN6 A;  1CZB A;  3DLG A;  3ZSV A;  3PY8 A;  3TSP A;  1KTQ A;  1IKY A;  4A57 A;  3VQ6 A;  1J5E K;  2G8U A;  2ZJQ L;  4DV1 K;  4DFP A;  3QML A;  2A42 A;  4DR7 K;  4JI8 K;  4DSI A;  4JKF A;  4GY2 B;  3WXJ A;  3RSE A;  2HNY A;  3CPE A;  3OYA A;  5JMV A;  3ENH A;  3SUP A;  2RN2 A;  4O44 A;  4CEF A;  1BIS A;  1RIL A;  3O4W A;  1JJ2 M;  3H1Q A;  4BR5 A;  2YNG A;  2D0A A;  1RBT A;  3BP8 A;  2E2N A;  3M5R A;  4AHS A;  5JLH A;  3SI6 A;  4JRQ A;  2A6A A;  4C8M A;  5AQM A;  4B3S K;  3UIQ A;  4YHH K;  1WAJ A;  5GIP A;  4W5T A;  3NCI A;  4TSX A;  1LAW A;  3SMP A;  3LWL A;  2E1Y A;  4CJE A;  1E3M A;  1VRU A;  5KI6 A;  4Y0W A;  3MXM A;  2VGM A;  1N6Q A;  1JCG A;  3LWM A;  1M1K O;  4NCG A;  2UUB K;  1WSJ A;  4DFJ A;  2F96 A;  4BDP A;  1EET A;  4FM0 A;  3D6R A;  3IFR A;  2Z1I A;  3HVT A;  1CZA N;  4OKE A;  2XRI A;  4FOI A;  4LY7 A;  3PX6 A;  3MX2 A;  3SYZ A;  3TAB A;  1ASV A;  2P5O A;  1SV5 A;  2DPN A;  1QQO A;  1C0G A;  1U48 A;  1ITG A;  3F2K A;  4CZE A;  4H0V B;  3LDN A;  1FW6 A;  3H3N O;  1X1P A;  1HKC A;  1NGI A;  1X3M A;  3EO3 A;  1S5J A;  1VQ8 N;  2GEM A;  3AAR A;  1HKB A;  4JI3 K;  3VQD A;  3W3D A;  3KLF A;  4HCC A;  3WQT A;  3C95 A;  3J81 O;  3VGK A;  1KC8 O;  3CQY A;  1XMO K;  2X74 A;  1TL1 A;  3R3L A;  3TAF A;  4BRK A;  5GAG P;  1WLJ A;  4Z4C A;  2P9S A;  2XY7 A;  4CZM A;  3IRX A;  3SQ0 A;  4ID5 A;  2IS3 A;  4E0D A;  4O8U A;  4DTJ A;  3TAN A;  3K9K A;  3E66 A;  4B9N A;  1WSI A;  3DOL A;  4E19 A;  1O13 A;  5HOO A;  5KPT A;  4BG8 A;  3M8R A;  2QWM A;  3HBT A;  1H1V A;  4H03 B;  5AQS A;  2CH5 A;  4PUO A;  4DU4 A;  1A5V A;  2YHY A;  3ZX3 A;  3IMX A;  1RTD A;  2Y1J A;  3RRG A;  3P31 A;  3BUZ B;  2FF3 B;  3I8B A;  3DWL A;  5F0X A;  1IH7 A;  1HYS A;  2FSJ A;  3S41 A;  3TPQ A;  2ASM A;  4JHD A;  4CHQ A;  1OH6 A;  3THW B;  1YF5 L;  3O3H A;  4EIA A;  3MK6 A;  4LF4 K;  1IBL K;  4FJI A;  3LL3 A;  1RT6 A;  2NRV A;  1J53 A;  3HP6 A;  4B3O A;  3EY1 A;  1HYZ A;  3VQC A;  3BF3 A;  5HRP A;  1T44 A;  5C24 A;  3K5O A;  4I6M A;  4ZTF A;  2D4W A;  2HBK A;  5F2R A;  2AA4 A;  3AGR A;  4FCY A;  2W6L A;  3KHY A;  1R59 O;  3HPG A;  1K9M O;  4H5T A;  4Z4I A;  4OPK A;  3NFA A;  3V9Z A;  1HNW K;  3TAR A;  1RBR A;  4OVL A;  1JXB A;  4DTO A;  3C6T A;  3VQB A;  1T6D A;  3BZK A;  3CCQ N;  4BRN A;  4AF1 A;  3RVC A;  3VQE A;  4BC3 A;  4H0O A;  4NCB A;  4FWQ A;  4ZTJ A;  1OH5 A;  4DV7 K;  4KAZ A;  2EHG A;  3SAF A;  4DR4 K;  1E4G T;  1EXQ A;  3V9X A;  4CFA A;  3KLE A;  4EZ9 A;  4A59 A;  1QE1 A;  3LDS A;  3CM5 A;  2FBT A;  5TKY A;  5AFU H;  5J1E A;  1VQ7 N;  2O4I A;  3OJS A;  2YCH A;  2PBD A;  2P9I A;  1S1T A;  1Q18 A;  5AQZ A;  2O8F B;  4MDB A;  1VQP N;  4FK4 A;  2KFN A;  5BRF A;  1TKX A;  5HLF A;  3ENB A;  4B1X B;  1V4T A;  1NK5 A;  4DCH A;  4IXC A;  4DSL A;  4JI7 K;  1MWK A;  1C0T A;  1Z6R A;  3U9D A;  5IWA K;  5KGW A;  4DR6 K;  4KTZ A;  3M8P A;  3OS1 A;  3VN5 A;  2HW3 A;  2QW9 A;  3LDO A;  4NLC A;  2NNW A;  4B9T A;  5KRS A;  3SQ1 A;  3LDL A;  1YVU A;  2FBX A;  3G4S N;  1NGJ A;  3QEX A;  2O8E B;  2BE2 A;  1RTH A;  4RCH A;  4B9Q A;  3TAE A;  3NHG A;  1LAV A;  3DAW A;  4ZHR A;  2VQF K;  4R5P A;  3VET A;  4FK2 A;  2P51 A;  4O8K A;  3OYG A;  5BPM A;  5JVH L;  3ATV A;  3CQX A;  4CZH A;  4K25 A;  3NH2 A;  3M1F A;  2IAJ A;  1FXX A;  1HUX A;  3HSC A;  4JD2 B;  4HUG A;  2E2Q A;  5DK5 A;  2A5X A;  5BPN A;  4KI6 A;  5F1X A;  1KCF A;  4I2Q A;  2ATQ A;  3CM6 A;  2GEL A;  1SL1 A;  4IOA L;  2D1K A;  2BDP A;  4CCH A;  3VTH A;  2ITG A;  4BQZ A;  5CHI A;  3JSM A;  3CXC M;  3H1V X;  5HBM A;  4BVO A;  4ILJ A;  4X64 K;  1XMQ K;  3J7A P;  5KPR A;  4YOV A;  3NE6 A;  4BRG A;  3IAY A;  3J80 O;  4B08 A;  2A40 A;  1ESV A;  4KRF A;  3K59 A;  2FC0 A;  4FWO A;  3QIC A;  4O0J A;  1QQC A;  3C7N B;  1RTJ A;  4AHV A;  2VG6 A;  3WNF A;  1S6P A;  3ZEU A;  4FZY A;  1CXQ A;  5D3G A;  4BRA A;  1HNZ K;  3V9W A;  1LV5 A;  4FSV A;  4B1Y B;  1BDG A;  4FOE A;  4E7K A;  1T03 A;  2HMP A;  1TYQ A;  1D9D A;  2HNZ A;  3QNN A;  4FJM A;  1S9G A;  2E8A A;  3AY9 A;  3DXM B;  1JLE A;  4LSN A;  4B1W B;  3QB0 A;  3OYI A;  3SUQ A;  4WFN L;  3P1G A;  4CZF A;  4JRP A;  4C23 A;  1X9M A;  4H0P A;  3PX4 A;  3EN9 A;  1TK5 A;  4BY9 C;  1ASW A;  2HMI A;  1KVB A;  4GKJ K;  4YY3 K;  2QWO A;  2WOM A;  2OPS A;  3H3O B;  3CER A;  3G0Z A;  5GAH P;  1ZBI A;  2P5G A;  4WF9 L;  1LWC A;  3CFP A;  3L2U A;  1UA0 A;  3ALY A;  3O9Q A;  4YOW A;  1QS4 A;  1NK9 A;  4BGB A;  4NB4 A;  4I9L A;  4A2B A;  1QSY A;  3TTF A;  3OYL A;  4DQI A;  2I7N A;  5KRT A;  4DF4 A;  2PFU A;  2XY6 A;  3C65 A;  2GWJ A;  1NM1 A;  5AZI B;  5AQQ A;  4M41 A;  1Z05 A;  3UKU A;  5SZT A;  2HND A;  1BI4 B;  3NH1 A;  4BWM A;  1W7A A;  1ATN A;  1O1W A;  2YNH A;  4DV2 K;  4FWL A;  2F4V K;  1NGC A;  3EEQ A;  1M90 O;  4FPB A;  5M1P A;  1KAY A;  3LPU A;  4IJA A;  3P38 A;  3NVK A;  2YNF A;  3ULE B;  3QIN A;  4OKJ A;  3LM9 A;  1RBU A;  4J2E A;  2E2O A;  4KH4 A;  3AA5 X;  4O5F A;  1DGK N;  1REV A;  3H45 C;  2NRX A;  3VQQ A;  4FK0 A;  4Z4E A;  4E7J A;  3AAQ A;  4ILG B;  4MLH A;  4IJN A;  4PKI A;  1YT3 A;  1NKE A;  1MDU B;  3S3N A;  4CGG A;  1NJZ A;  4DR1 K;  2PAV A;  4CF9 A;  2E6M A;  3ZSY A;  4JD2 A;  4CEO A;  3VGM A;  4F9O A;  3DMJ A;  4W5O A;  3C6U A;  5MLC Q;  2O8C B;  2Q36 A;  5CYM A;  4CJU A;  2HHX A;  4E3S A;  4CGJ A;  2ZWH A;  4CF8 A;  2ZE2 A;  5BPL A;  4BE2 A;  1BCO A;  1K73 O;  1T8E A;  4BRP A;  4DSF A;  2Z1G A;  5AQJ A;  1D5A A;  4CE9 A;  4FLX A;  3WEE A;  3WXK A;  3C6A A;  4CK1 A;  3DLR A;  1X9W A;  5B8H A;  3V81 A;  2V7Z A;  3MMV A;  5C0Y A;  3EYZ A;  3TU5 A;  1UWB A;  1K8K A;  2QWP A;  1KAZ A;  1Q8I A;  3VF6 A;  3D7E O;  2OA8 A;  4B1V A;  4B9S A;  3MN5 A;  3CFO A;  1L3V A;  4IZ9 A;  2P9P A;  4K43 A;  2D0O A;  2ASO A;  4IKF A;  4KH5 A;  3OW2 M;  2WUS A;  3AVA A;  4CJW A;  2P9U A;  3PIO L;  1TGO A;  1U47 A;  3FZK A;  5KGX A;  3LZJ A;  3U3G A;  4JK8 A;  3TI0 A;  3VQ7 A;  4KHN A;  1OKJ A;  4FZZ A;  4FLT A;  3HVR A;  2JWL A;  2EWS A;  3THX B;  3CQ8 A;  3SPZ A;  4K42 A;  2P1J A;  3HM8 A;  3S3M A;  1Q7Y O;  1ZBU A;  4KKO A;  3HI0 A;  4CJ7 A;  2VCP A;  4B9V A;  3CMA N;  3CCJ N;  4CES A;  4QAG A;  4Z94 A;  1EQY A;  3LAL A;  2D0P A;  2NRH A;  3AO1 A;  3GE1 A;  4R79 A;  4Z0U A;  1S1V A;  4CBW A;  5IT9 O;  1W9H A;  4I9Q A;  2BGG A;  3R6M A;  1HQU A;  4CJQ A;  1ZBH A;  1N33 K;  3ZYY X;  3G10 A;  2UXC K;  4W5R A;  5AQT A;  5BRH A;  3UKR A;  2ZQB A;  3I33 A;  1IKV A;  2VGN A;  4ICL A;  4DV0 K;  4E7H A;  1QVG M;  1KVC A;  1BI4 A;  2WTU A;  4FJ9 A;  5KPZ A;  3CD6 N;  3DOK A;  2Q3S A;  3AA2 A;  3OYC A;  2H3G X;  4RW9 A;  5FPN A;  3L2V A;  1U2V A;  5FPE A;  1S72 N;  1WBB A;  1RBS A;  3H6E A;  4V19 S;  1Q9Y A;  1NBW A;  2YHB A;  4HHT A;  4WYB A;  4F4K A;  3SPY A;  2UYT A;  1BIZ A;  5AQX A;  3O3F A;  1SKW A;  1VSM A;  1G15 A;  5E41 A;  1IBK K;  1YXQ A;  4A5B A;  2IIR A;  3J7Y P;  4OLB A;  3CCV N;  4CZJ A;  4CZK A;  4DU3 A;  1RDB A;  5AQI A;  3LDP A;  3VMF B;  3ID6 A;  3ITH A;  1YHQ N;  4H0T B;  3HRG A;  1KRP A;  1L3U A;  2AJQ A;  4K8Z A;  2WFB A;  2P9N B;  3O5B A;  1NMD A;  1NGH A;  2KZM A;  4KHU A;  3AVG A;  5AQY A;  5GAD P;  3VER A;  3E01 A;  1QSS A;  1SZ2 A;  4DS5 A;  4IOX A;  4CJR A;  4J2A A;  4CHZ A;  3V6D A;  1BQM A;  1FKP A;  2HBM A;  3OY9 A;  2NRR A;  4IEI A;  5BN9 A;  4WQ4 C;  1TK0 A;  4ISF A;  3KIO A;  4CZI A;  3MWP A;  3FLC O;  4HVJ A;  3A8Y A;  1C6V A;  4OPJ A;  3U8X A;  4CEA A;  4DR2 K;  3A0I X;  4CGI A;  4K41 A;  1G99 A;  1HJR A;  2GUI A;  1TAQ A;  3WNG A;  4M3T A;  2OTL N;  4KHP K;  3KK1 A;  4KH6 A;  4KRE A;  4KHQ A;  3ZET B;  4JKG B;  3CI5 A;  3H46 O;  2IVN A;  5CZ2 A;  4KFB A;  2DFF A;  3THY B;  2GUP A;  4WFA L;  2P9K A;  3A5N C;  4A2A A;  1ZXO A;  5FRN A;  1SUQ A;  1VQ5 N;  1NGB A;  1KXP A;  1RT7 A;  2OPR A;  3FE1 A;  3V1O A;  5GIN A;  1FKO A;  4C8K A;  1RT1 A;  3KLH A;  1JLF A;  4CFC A;  4C8O A;  1WAF A;  4DSE A;  4DB3 A;  3B6O A;  1YAG A;  3CC7 N;  3VA3 A;  3OA9 A;  1ZBS A;  3T69 A;  3SUN A;  3DJC A;  1TAU A;  4BG9 A;  1LW2 A;  5EU7 A;  2Q0U A;  3MAQ A;  3QET A;  2ZGZ A;  4LC9 B;  3A5M C;  3RMA A;  4KI4 A;  1QSL A;  5BN8 A;  1L5U A;  5DM6 L;  3AVF A;  4CF1 A;  3AA3 A;  3THV A;  2VYP A;  2D5R A;  3MDQ A;  3V4I A;  3QEI A;  3OYB A;  3B8A X;  2ITM A;  4BRI A;  2XO7 A;  3PLA A;  4CGF A;  3KKR A;  1VSH A;  1WSG A;  4GW6 A;  4DTM A;  4LF5 K;  3HT3 A;  2PYL A;  2AP1 A;  4NYF A;  1JL2 A;  2Q31 A;  3OYD A;  4H5N A;  3O4N A;  4H8K A;  5T7B A;  3F73 A;  1HX1 A;  2KKZ A;  1WUA A;  1VAZ A;  4CJK A;  4CHP A;  5AQO A;  3KD1 E;  3CG7 A;  1U6Z A;  4BRE A;  3L2R A;  2E6L A;  3VEN A;  5JS1 A;  3M8Q A;  3L3U A;  4MO5 A;  3HXM A;  3C0B A;  1WB9 A;  4EHU A;  3EE8 A;  1KAX A;  1KLM A;  1N34 K;  1NNE A;  3T3F A;  3CJB A;  3HL8 A;  2J4R A;  4CEZ A;  3V9S A;  3AA4 A;  2F9T A;  5BRD A;  3AO5 A;  1GLF O;  4Y1D A;  3EE9 A;  4KTW A;  5JVG L;  3ZT0 A;  3FFK B;  2A3Z A;  4GVM A;  4AHT A;  3J8A A;  1WSH A;  2KTQ A;  4PKH A;  2E4L A;  3DLB A;  3Q7B A;  4JI4 K;  1NKB A;  4C8N A;  3MCA B;  5AQP A;  4JN4 A;  2P9L B;  5E84 A;  3OYK A;  1WN7 A;  4X62 K;  1KLN A;  4MQ3 A;  3K5N A;  4E89 A;  1Z25 A;  4CBX A;  4NLB A;  1F21 A;  1HPM A;  4EAH D;  1Z26 A;  4Y1C A;  5HRS A;  2G8H A;  2FSN A;  4O55 A;  4JI1 K;  4J8F A;  1DTQ A;  5AQR A;  4DTU A;  3ISN C;  5DMR A;  4E1J A;  1S1X A;  1RDC A;  1NGA A;  3TR8 A;  3ZET A;  2HHH K;  3L3V A;  1QHT A;  4DFK A;  3O80 A;  3A2F A;  1JLC A;  3ZT2 A;  3I0R A;  2YHW A;  4WFB L;  2Q97 A;  2QWR A;  1BUP A;  3E9P A;  4CJL A;  3O08 A;  5FDL A;  4CHN A;  4BRO A;  1WNS A;  1TUU A;  1BQN A;  2NZT A;  4YNQ A;  3BDP A;  3WNH A;  2YKN A;  3U6F A;  5CY4 A;  4OPA A;  4JK7 A;  3EL2 A;  4N76 A;  1IBM K;  4NO7 A;  3L4Q A;  5C2D A;  3SV4 A;  1X3N A;  4ELT A;  4XH4 A;  2Q2R A;  4C8L A;  3U3Y A;  3A5O C;  1YIT N;  1NK7 A;  1VSK A;  1R0A A;  1DEJ A;  1Q9X A;  1BG3 A;  4CK3 A;  1IO2 A;  1BIU A;  1NGE A;  1IG9 A;  2QWL A;  3OYF A;  3FZM A;  4DF8 A;  2B4J A;  5ADX A;  2IOC A;  4QCL A;  3DXK B;  3O9U A;  1UAX A;  4H5V A;  3CCM N;  4PHT X;  2XHB A;  1GLL O;  1YTU A;  2YNI A;  4M42 A;  1V4S A;  2QWQ A;  2VG5 A;  3QFP A;  4KB0 A;  4EHT A;  5M1K A;  1GLB G;  3DRP A;  5FPM A;  2UUC K;  3FZL A;  1C0U A;  4F8R A;  2D0C A;  1U04 A;  4CJ5 A;  3CCU N;  3DI6 A;  4JKE A;  4CBU A;  1ILY A;  2VQE K;  4Z4H A;  4ISE A;  4BWJ A;  4LD0 A;  1W2B M;  1RBV A;  1HQE A;  4NXM K;  2O8D B;  4DLG A;  1Q81 O;  3KK2 A;  4AHU A;  2ZJR L;  3IKM A;  3ZSR A;  3O9R A;  4CHY A;  4FWK A;  1X9J A;  4UQG A;  4B3R K;  2O8B B;  4DTP A;  4O5B A;  2X6S A;  4IFV A;  3KTQ A;  5FPD A;  4JS4 A;  3DLK A;  4N5S A;  1LOT B;  3NF7 A;  2QXF A;  3BGR A;  3T1H K;  4CEE A;  3QBW A;  1OVY A;  3KKS A;  4LSL A;  3B6P A;  3I56 N;  1KQS M;  3AVH A;  4E1M A;  1GLJ O;  4OGE A;  3M8S A;  3HM9 A;  1XNR K;  3KLG A;  3W0L A;  1XQS C;  3WT0 A;  3CCS N;  2F8T A;  2UXB K;  2WON A;  4JLH A;  3JAM O;  4CI6 A;  1HR0 K;  1VSD A;  3DRS A;  4JKA A;  3KK3 A;  3SLC A;  3SUO A;  3QER A;  1YIJ N;  2FF6 A;  2UXD K;  1YVN A;  1KVA A;  3VQA A;  4WQ4 A;  4FVU A;  3VEX A;  4IFE A;  3R9P A;  4DSK A;  1T3V A;  3D2E B;  3CF5 L;  1OH8 A;  4GV9 A;  1SKS A;  4K0K K;  4YOY A;  3TTC A;  2YV0 X;  4IG3 A;  3THW A;  3CCL N;  2NRW A;  3OVN A;  4GV3 A;  4DMN A;  1L3S A;  4CK2 A;  5AQW A;  3TSU A;  1RDU A;  4JKB A;  4CD1 A;  3L2Q A;  1C1A A;  4RW7 A;  4HUF A;  5AZJ B;  5TKW A;  3SV3 A;  2RKI A;  4FPA A;  4FWP A;  1RT2 A;  3QBX A;  2IVO A;  4RW6 A;  5JLF A;  3GOI A;  4WQ5 C;  1WOQ A;  4FLZ A;  3V9U A;  4XEI A;  1IG8 A;  4KV8 A;  1BHL A;  1U45 A;  4I2P A;  3T1Y K;  2CGK A;  4B3T K;  3F5T A;  3MWT A;  3WNE A;  1QQM A;  3AVI A;  4Q5V A;  4FLU A;  1Y97 A;  4BGA A;  3CYM A;  3SNN A;  3I8D A;  3SQ4 A;  4DU1 A;  1L3T A;  1HKG A;  4N47 A;  5A2Q O;  1NK8 A;  4MO4 A;  1QZ6 A;  2W6K A;  4FWS A;  3VES A;  1S9E A;  1BL3 A;  1UOC A;  3GL1 A;  4BAC A;  1VSJ A;  3BF1 A;  2IVP A;  3DXK A;  3KK7 A;  4CEB A;  4M3Y A;  1GOC A;  3O8M A;  3HP9 A;  5AQL A;  2JWK A;  4Z4G A;  5ELZ A;  4QOZ B;  4U67 L;  2O8F A;  1ZBL A;  4JEP A;  5FRO A;  1NWK A;  3MEE A;  1GLC G;  2IGI A;  1T6C A;  2VWJ A;  4RTF D;  3QDK A;  1TVR A;  4BR0 A;  4BRF A;  3F9M A;  1HMV A;  3TAQ A;  4U7B A;  3D2F B;  3ZX0 A;  2HST A;  2I5J A;  3I55 N;  2O8B A;  1C1C A;  4B1U B;  2HBJ A;  4CW7 B;  4BR2 A;  1YI2 N;  1BCM A;  2O8E A;  4FVM A;  1HNX K;  3PV8 A;  1D9F A;  4DV5 K;  3UE5 A;  2FLO A;  4M3Z A;  4J2D A;  3AVN A;  1EWQ A;  4QS7 A;  1HRH A;  2E88 A;  4LH4 A;  3TAG A;  1Q82 O;  1DT9 A;  1NMN A;  3NGI A;  4AM6 A;  5AQH A;  5I42 A;  1FK9 A;  4W5Q A;  3FZH A;  3NF6 A;  4YOR A;  5J2M A;  2QTD A;  3PSI A;  4KHS A;  4DQS A;  3AVK A;  4E1N A;  3HZ6 A;  4FJL A;  3RWU A;  1ZYQ A;  1VQL N;  5HRO A;  3BEX A;  3KZB A;  1VQN N;  4CER A;  1ZBF A;  1U49 A;  3NF8 A;  3LP2 A;  2BH1 A;  4HCB A;  3HJF A;  3OYE A;  3LAK A;  3P39 A;  4XH5 A;  1X9S A;  1NLV A;  3SMS A;  3U4L A;  3C94 A;  3MEC A;  4H4O A;  2HOE A;  1I39 A;  4M7Y A;  1S3X A;  4A62 A;  3LP3 A;  4JI5 K;  4KHW A;  1J6Z A;  4M7X A;  1T05 A;  4CFB A;  3C7N A;  3ZT4 A;  2RPI A;  5CYQ A;  2W42 A;  4ID1 A;  4F3T A;  1XUP O;  1S1U A;  3VEO A;  3JXU A;  3CJA A;  1SL2 A;  4JI0 K;  1RDD A;  4LFB K;  3JYT A;  4H4M A;  1BA0 A;  5BR9 A;  3DXM A;  1TKZ A;  3Q7C A;  3ZT1 A;  3RSE B;  3N4Q A;  1ASU A;  1TV6 A;  1S22 A;  3VQ5 A;  2KLA A;  5AQG A;  1JLB A;  4DWI A;  4OKK A;  2HF4 A;  1KD1 O;  1NGG A;  4FZX C;  3CIP A;  5HRN A;  3VGL A;  2QKK A;  3CC2 N;  4B9U A;  1FJG K;  1EO1 A;  2KHO A;  4PA1 A;  3PO4 A;  1BA1 A;  1NOY A;  4DHY A;  3MXJ A;  4M63 C;  4JS5 A;  5GIO A;  3MXI A;  2G8K A;  3ATU A;  1VSL A;  3AV9 A;  2YJE A;  3VQ8 A;  4DFM A;  5AZI A;  5M1Q A;  3QEV A;  4EFH A;  4JYA K;  1XC9 A;  3WXM B;  3VEY A;  1E4F T;  2YJF A;  4CGD A;  2QKB A;  1NJY A;  2CGL A;  3LZI A;  3NMU A;  4EP5 A;  1LWE A;  4E7L A;  2FBY A;  4CHO A;  1GOA A;  3CC4 N;  3ULE A;  1DKG D;  1NJI O;  2NUB A;  4G1Q A;  3LM2 A;  1HLU A;  4FJ7 A;  3KJV A;  2YHA A;  4UY8 O;  1BU6 O;  1VRT A;  1KFS A;  4DV4 K;  3ZSO A;  1RFQ A;  3OS2 A;  4RW8 A;  5LMU K;  3UB5 A;  1QHA A;  3RMC A;  4YOU A;  3NGY A;  1NK0 A;  2FBV A;  4XH1 A;  3VTI A;  3FFI A;  3AO3 A;  1JLA A;  3J7Z O;  1VSE A;  3OHR A;  3M6G A;  1WSE A;  5KQ8 A;  3G25 A;  3KVG A;  5E26 A;  1NGD A;  5EOY A;  3RMD A;  2O8C A;  3CHW A;  3S9H A;  2XY8 A;  2G8W A;  1RTI A;  2P9S B;  3O4Q A;  4EP4 A;  5LJW A;  3ZSX A;  1ZC6 A;  4PY5 A;  3QNO A;  2GV9 A;  4BE1 A;  4B9L A;  5AQK A;  1NKC A;  5AQF A;  2D0B A;  3H08 A;  3R8E A;  5BR8 K;  3L2W A;  2EX3 A;  4DTR A;  3V1R A;  3HO1 A;  1JCF A;  4IG0 A;  3RR8 A;  4B8C A;  3VF2 A;  4ELU A;  4IEE A;  3QIP A;  4WQ5 A;  3SZ2 A;  3SJJ A;  1RT5 A;  3PX0 A;  4JKD A;  4M3W A;  4DLE A;  3AGK A;  1YJN N;  1K6Y A;  2KW4 A;  3AVJ A;  3AVB A;  3DLE A;  3OBW A;  4JHD B;  4CEQ A;  4CJT A;  4HWI A;  3THX A;  2CH6 A;  3ZSW A;  4OGC A;  5J2Q A;  5SWM A;  1J5O A;  1P90 A;  3DLH A;  3MED A;  3CJ7 A;  3KWI A;  2DTU A;  1JKH A;  1KSP A;  3T7Z A;  1BO5 O;  3RMB A;  5KQD A;  3BZC A;  5M1F A;  3GDQ A;  4F2S A;  4JNE A;  3I0S A;  3EKU A;  4MFB A;  2Z1H A;  3VQ9 A;  1B92 A;  4I6M B;  4AHR A;  3P5J A;  2OCE A;  1YJ9 N;  4BRH A;  5EXW A;  2E20 A;  2QWN A;  2OYQ A;  4QS8 A;  3K9J A;  2CGJ A;  1U4B A;  2BTF A;  3VEV A;  4DQ8 A;  1VQK N;  4FM2 A;  1N32 K;  1Y64 A;  4FJ5 A;  2HF3 A;  5BRE A;  3AAP A;  3D45 A;  3CJC A;  4CF0 A;  4MLE A;  2KQ2 A;  4FYD A;  3IDH A;  3AVC A;  2UU9 K;  1RCH A;  3E9L A;  4ISG A;  4CJ4 A;  4YOT A;  4HTU A;  3VF4 A;  3OYM A;  3P83 D;  1VQM N;  3L6Q A;  4BVP A;  1BGX T;  1TUY A;  1B9D A;  3OJU A;  2P9I B;  3VOV A;  4CED A;  2OPQ A;  5CE3 A;  4YOX A;  1TKD A;  4KPY A;  1JL1 A;  3LDQ A;  2QK9 A;  3RR7 A;  4M3X A;  4GVE A;  3VQP A;  4AHC A;  3KLI A;  4BRD A;  4DUZ K;  2P9N A;  3VEZ A;  3NAE A;  2BAN A;  3L0Q A;  2QI2 A;  4FLW A;  2Q1N A;  3FR0 A;  4AQY K;  2GWK A;  2W40 A;  3ZSQ A;  4JAX A;  4N41 A;  2OPP A;  3U9Z A;  4PQU A;  2DY4 A;  5EY4 A;  2VWK A;  5GAE P;  1BWF O;  3LP1 A;  4FWM A;  3CET A;  4PL8 A;  4DR3 K;  1SAZ A;  4FO0 A;  4FJX A;  1VK0 A;  2F7T A;  1QVF M;  3WXL A;  2O4G A;  4C1N I;  3VQ4 A;  3OYJ A;  2WC9 A;  3TAP A;  1MA9 B;  4L8R B;  2E2P A;  4BDY A;  3MCP A;  3ZCM A;  2GBZ A;  4GNI A;  3MN9 A;  1WSF A;  2NLX A;  2NRT A;  3DRR A;  3P4I A;  1HYV A;  4AM7 A;  1I94 K;  4Q0B A;  4ELV A;  4JKG A;  5I3U A;  4A61 A;  1RT3 A;  3C6H A;  3DM2 A;  1J9A A;  2V52 B;  3THY A;  2G8F A;  4OO1 J;  5C10 A;  3SAG A;  2F8S A;  2A1S A;  4WE1 A;  4CJF A;  3IUC A;  2WBN A;  1SQK A;  3AVM A;  1UA1 A;  4W5N A;  5J2N A;  3FZF A;  4HUE A;  1HJO A;  3GBT A;  4IDH A;  3T1A A;  4BR7 A;  5AFU A;  3ZEU B;  3SAH A;  1NOZ A;  4FM1 A;  3RRH A;  3SBT A;  4KHY A;  2A1R A;  2HHQ A;  3M3Z A;  4I7F A;  2OZS A;  5FLX O;  3O1B A;  3PUF A;  4FW1 A;  1D4X A;  2Z1J A;  1TYQ B;  2PZS A;  2XY5 A;  2QM1 A;  4K8X A;  3HK2 A;  3OTO K;  4DKW A;  3LPT A;  3O1W A;  3SJH A;  4X66 K;  1ATR A;  2IDO A;  1K8A O;  4CJS A;  4E7I A;  3HPH A;  5LMN K;  3KWG A;  4IO8 A;  2E5L K;  2ASP A;  4O0I A;  1Q86 O;  2OAN A;  3HPO A;  3VPZ A;  3DLL L;  1WBD A;  3GG4 A;  4OJR A;  3EZW A;  5DM7 L; 
#chains in the Genus database with same CATH homology
 4YFU A;  1HMV A;  1X1P A;  3TAQ A;  3DOK A;  1S5J A;  3ZSZ A;  2ETJ A;  2Q3S A;  3AA2 A;  2I5J A;  3OYC A;  3VQD A;  3V1Q A;  4RW9 A;  3KLF A;  3L2V A;  4HCC A;  1C1C A;  3NDK A;  3C95 A;  1RBS A;  1Q9Y A;  1BCM A;  2YHB A;  4HHT A;  2HHT A;  2X74 A;  4F4K A;  3SPY A;  2PY5 A;  1B9F A;  4FVM A;  1TL1 A;  3PV8 A;  1D9F A;  3TAF A;  1BIZ A;  4DG1 A;  3O3F A;  1SKW A;  4M3Z A;  1VSM A;  1WLJ A;  1G15 A;  4J2D A;  4CIF A;  5E41 A;  3AVN A;  4Z4C A;  4CIG A;  1D8Y A;  4FJJ A;  2XY7 A;  4OLB A;  1HRH A;  4DU3 A;  1RDB A;  3IRX A;  4KO0 A;  3SQ0 A;  4ID5 A;  2IS3 A;  3ITH A;  4LH4 A;  4E0D A;  3TAG A;  1A5X A;  3TAN A;  4DTJ A;  4XIU A;  2KZZ A;  1KRP A;  4B9N A;  1L3U A;  1WSI A;  4CJP A;  2AJQ A;  3DOL A;  4O4G A;  4E19 A;  3NGI A;  4K8Z A;  2HHS A;  5I42 A;  1FK9 A;  1S1W A;  4W5Q A;  3NF6 A;  3M8R A;  5J2M A;  1RDA A;  4KHS A;  4DQS A;  3AVK A;  3PO5 A;  4E1N A;  4FJL A;  2G8V A;  3RWU A;  1ZYQ A;  2KZM A;  4KHU A;  5HRO A;  3AVG A;  3E01 A;  4CER A;  4PUO A;  1ZBF A;  2DTU A;  1U49 A;  2HHQ A;  4DU4 A;  3NF8 A;  1QSS A;  1A5V A;  3LP2 A;  4HCB A;  3HJF A;  3AVL A;  1IKX A;  4DS5 A;  3L8B A;  4F2R A;  3OYE A;  3LAK A;  1X9S A;  1RTD A;  2Y1J A;  4CJR A;  3RRG A;  4J2A A;  4CHZ A;  3V6D A;  1BQM A;  3C94 A;  1FKP A;  3MEC A;  4H4O A;  4RG8 A;  3OY9 A;  1I39 A;  1TK0 A;  3LP3 A;  1IH7 A;  4KHW A;  1T05 A;  3KIO A;  4CFB A;  3ZT4 A;  1HYS A;  1HNI A;  4HVJ A;  2RPI A;  1C6V A;  5CYQ A;  4OPJ A;  2W42 A;  4CEA A;  4FJG A;  1N5Y A;  4ID1 A;  4CGI A;  4F3T A;  1HJR A;  1S1U A;  2GUI A;  4CIE A;  4CHQ A;  1J54 A;  3HYF A;  1C1B A;  3O3H A;  4EZ6 A;  2YKM A;  1TAQ A;  1SL2 A;  3WNG A;  4M3T A;  4Z4F A;  4FJI A;  1RDD A;  3HST B;  3KK1 A;  4KRE A;  1RT6 A;  3ZT3 A;  3NH0 A;  1LWF A;  3JYT A;  4H4M A;  1DTT A;  4KHQ A;  1J53 A;  2ZD1 A;  3HP6 A;  4B3O A;  3EY1 A;  1HYZ A;  3OYN A;  4BE0 A;  1TK8 A;  5CZ2 A;  4KFB A;  3VQC A;  4PWD A;  1TKZ A;  3ZT1 A;  2DFF A;  5HRP A;  5C24 A;  1ASU A;  1NJX A;  1TV6 A;  3K5O A;  3VQ5 A;  4ZTF A;  5FRN A;  1SUQ A;  1JLB A;  4DWI A;  4OKK A;  1RT7 A;  1TKT A;  2OPR A;  1XHZ A;  3KD5 E;  3V1O A;  4FCY A;  1FKO A;  4C8K A;  1RT1 A;  4FZX C;  2HHV A;  3KLH A;  3HPG A;  1JLF A;  1XHX A;  5JS2 A;  4CFC A;  5HRN A;  4C8O A;  1WAF A;  4KTQ A;  4Z4I A;  1VSI A;  4OPK A;  3NFA A;  3V9Z A;  4DSE A;  3NF9 A;  3TAR A;  2QKK A;  3B6O A;  4B9U A;  3K2P A;  1RBR A;  3VA3 A;  4OVL A;  1JXB A;  3SUN A;  1TAU A;  4DTO A;  1LW2 A;  3C6T A;  4PA1 A;  5EU7 A;  3VQB A;  3MXJ A;  3OYH A;  3MAQ A;  3QET A;  4JS5 A;  3K58 A;  1NOY A;  3MXI A;  3LAM A;  1XWL A;  2G8K A;  3RMA A;  4KI4 A;  1VSL A;  2DFH A;  3AV9 A;  5CZ1 A;  4BDZ A;  4N56 A;  1QSL A;  5C25 A;  1L5U A;  3VQE A;  3O3G A;  3AVF A;  4NCB A;  4CF1 A;  4ZTJ A;  3AA3 A;  3THV A;  2D5R A;  4LH5 A;  3NBP A;  3VQ8 A;  4CJV A;  2EHG A;  2IC3 A;  4DQR A;  4DFM A;  3QEV A;  3V4I A;  4KAZ A;  3K57 A;  3QEI A;  3OYB A;  1EXQ A;  1XC9 A;  3V9X A;  2XO7 A;  4CFA A;  1SL0 A;  3KLE A;  4EZ9 A;  4CGF A;  3KKR A;  1VSH A;  4CGD A;  1QE1 A;  1WSG A;  3CM5 A;  2FBT A;  4GW6 A;  3LDS A;  4DTM A;  1CZ9 A;  3HT3 A;  4J2B A;  5J1E A;  2PYL A;  1NJY A;  4NYF A;  2OZM A;  2O4I A;  3OJS A;  1DLO A;  3LZI A;  1S1T A;  4EP5 A;  1LWE A;  4E7L A;  2FBY A;  4B9M A;  1JL2 A;  4FK4 A;  3OYD A;  3K5L A;  4CHO A;  5T7B A;  3O4N A;  4H8K A;  2KFN A;  1GOA A;  1TKX A;  4GMJ B;  3F73 A;  5HLF A;  4FJ8 A;  2NUB A;  1NK5 A;  4G1Q A;  4CJK A;  4CHP A;  3KD1 E;  3CG7 A;  3QLH A;  4DSL A;  4FJ7 A;  3KJV A;  2YHA A;  1C0T A;  2E6L A;  3L2R A;  3EZ5 A;  5KGW A;  5JS1 A;  1VRT A;  3M8Q A;  5FRM A;  1A5W A;  3L3U A;  4KTZ A;  1KFS A;  3M8P A;  3ZSO A;  4DQP A;  3OS1 A;  4RW8 A;  4CGH A;  3VN5 A;  3OS2 A;  3HXM A;  2HHU A;  3AO2 A;  2HW3 A;  1KLM A;  4B9T A;  5KRS A;  3RMC A;  3SQ1 A;  3NGY A;  3T3F A;  1NK0 A;  1YVU A;  2FBX A;  3MEG A;  2FBV A;  3HL8 A;  3FFI A;  4DQQ A;  4DTS A;  3QEX A;  2BE2 A;  1RTH A;  4CEZ A;  3V9S A;  3AO3 A;  1JLA A;  3AA4 A;  3TAE A;  4M3U A;  4AIL C;  3T19 A;  3NHG A;  1VSE A;  1LAV A;  3AO5 A;  4Y1D A;  4ZHR A;  1WSE A;  4KTW A;  3ZT0 A;  4R5P A;  2JLE A;  3RMD A;  3S9H A;  5HP1 A;  2XY8 A;  2G8W A;  1EP4 A;  1RTI A;  4FXD A;  4GVM A;  2P51 A;  4FK2 A;  2HHW A;  4AHT A;  3O4Q A;  4EP4 A;  3PO4 A;  1EX4 A;  3ZSX A;  3OYG A;  1WSH A;  3OS0 A;  4PY5 A;  2KTQ A;  1RT4 A;  3NH2 A;  3QNO A;  2GV9 A;  4BE1 A;  5K14 A;  2E4L A;  3DLB A;  4B9L A;  2IAJ A;  4FJN A;  1FXX A;  1NKC A;  1NKB A;  4C8N A;  4FLV A;  2HVH A;  1JLG A;  4HUG A;  3OYK A;  2D0B A;  1WN7 A;  3H08 A;  5DK5 A;  1KLN A;  4MQ3 A;  3TAM A;  3L2W A;  3QES A;  2X6N A;  2JGU A;  3K5N A;  4KI6 A;  2EX3 A;  4E89 A;  4DTR A;  3V1R A;  3HO1 A;  4OLA A;  1Z25 A;  3LP0 A;  1KCF A;  4I2Q A;  1I3A A;  1F21 A;  2ATQ A;  3CM6 A;  4IG0 A;  1SL1 A;  3RR8 A;  4B8C A;  1Z26 A;  4Y1C A;  5HRS A;  2BDP A;  4CCH A;  2G8H A;  2ITG A;  4O55 A;  3JSM A;  5HBM A;  4ELU A;  1TL3 A;  4DSJ A;  1C0M A;  4DS4 A;  1DTQ A;  1HPZ A;  3QIP A;  3SZ2 A;  3ISN C;  5DMR A;  1RT5 A;  4DTU A;  3SJJ A;  3PX0 A;  4M3W A;  3NE6 A;  3CFR A;  4DLE A;  3IAY A;  1S1X A;  4B08 A;  1RDC A;  4KRF A;  1K6Y A;  2KW4 A;  3TR8 A;  3AVJ A;  5KTQ A;  3K59 A;  2FC0 A;  3AVB A;  3SQ2 A;  3IS9 A;  3L3V A;  4O0J A;  1QHT A;  1QQC A;  1RTJ A;  4AHV A;  4DFK A;  4NCA A;  2VG6 A;  3DLE A;  1S6P A;  3WNF A;  4FZY A;  3A2F A;  1JLC A;  3ZT2 A;  1CXQ A;  3I0R A;  3RTV A;  2Y1I A;  5D3G A;  2R7Y A;  1T7P A;  4CJT A;  3V9W A;  4CEQ A;  1LV5 A;  4CJL A;  3ZSW A;  4OGC A;  5FDL A;  4CHN A;  5SWM A;  5J2Q A;  1J5O A;  1W0H A;  1WNS A;  3MED A;  3D0P A;  2PYJ A;  1JKH A;  1YTA A;  2X78 A;  4RW4 A;  1BQN A;  4YNQ A;  4E7K A;  1T03 A;  1KSP A;  3RMB A;  3DYA A;  1D9D A;  3BDP A;  2VG7 A;  2HNZ A;  1NK6 A;  3QNN A;  4IDK A;  1SKR A;  3LAN A;  1S9G A;  4IFY A;  4FJM A;  2KFZ A;  3WNH A;  3QEP A;  1JLE A;  4LSN A;  3SUQ A;  2YKN A;  3OYI A;  5CY4 A;  3U6F A;  3QO9 A;  4N76 A;  1EKE A;  4F2S A;  3P1G A;  4JRP A;  1X9M A;  4FJK A;  3QIO A;  3I0S A;  2Z1H A;  4MFB A;  3SV4 A;  3PX4 A;  3VQ9 A;  1B92 A;  4AHR A;  3S3O A;  3P5J A;  3AO4 A;  1ASW A;  1TK5 A;  4ELT A;  1NK4 A;  1KVB A;  2HMI A;  3NGZ A;  4C8L A;  1GOB A;  3U3Y A;  1IKW A;  1NK7 A;  2WOM A;  2OYQ A;  1VSK A;  2OPS A;  1MU2 A;  2RF2 A;  3G0Z A;  4M3R A;  1R0A A;  1Q9X A;  3IG1 A;  1ZBI A;  4CK3 A;  1IO2 A;  1BIU A;  3DLH A;  1U4B A;  1IG9 A;  1KFD A;  3OYF A;  1LWC A;  3VA0 A;  3CFP A;  4DF8 A;  2B4J A;  3L2U A;  2IOC A;  3ALY A;  1UA0 A;  3ASM A;  4QCL A;  4M45 A;  4FM2 A;  1UAX A;  1S6Q A;  4FJ5 A;  1QS4 A;  5J2P A;  2B6A A;  1NK9 A;  4CJ3 A;  4I9L A;  3D45 A;  4FJH A;  1QSY A;  2XHB A;  4CF0 A;  3OYL A;  4DTN A;  1YTU A;  4DQI A;  2YNI A;  5KRT A;  4M42 A;  2VG5 A;  4DF4 A;  4KB0 A;  2XY6 A;  2KQ2 A;  4FYD A;  3AVC A;  1RCH A;  3DRP A;  4IBN A;  1HNV A;  3QEW A;  1C0U A;  2DFE A;  2D0C A;  4F8R A;  1CLQ A;  1U04 A;  4CJ5 A;  1CXU A;  3DI6 A;  4M41 A;  4B8A B;  4CJ4 A;  4HTU A;  5SZT A;  2HND A;  1BI4 B;  4Z4H A;  4BWJ A;  3OYM A;  3P83 D;  4LD0 A;  3NH1 A;  4FW2 A;  4BWM A;  1RBV A;  1HQE A;  4NYN A;  2YNH A;  1O1W A;  1BGX T;  4CEC A;  4DLG A;  1B9D A;  3OJU A;  3KK2 A;  1RNH A;  4AHU A;  3ZSR A;  4CED A;  2OPQ A;  1TKD A;  3LPU A;  4KPY A;  4CHY A;  1JL1 A;  3K5M A;  2B5J A;  4UQG A;  2QK9 A;  4DTP A;  4O5B A;  4AH9 A;  2X6S A;  2YNF A;  3RR7 A;  1QTM A;  4M3X A;  3VQP A;  4AHC A;  3QIN A;  4OKJ A;  3KLI A;  1RBU A;  4IFV A;  4J2E A;  3KTQ A;  4JS4 A;  3DLK A;  4N5S A;  3NF7 A;  2QXF A;  3BGR A;  1LW0 A;  3AA5 X;  3NAE A;  4CEE A;  2BAN A;  3KKS A;  1VSF A;  4LSL A;  1NJW A;  1REV A;  3B6P A;  3VQQ A;  5C42 A;  3SCX A;  4FK0 A;  4FLW A;  1XI1 A;  4KB1 A;  4Z4E A;  4E7J A;  3AVH A;  4E1M A;  4OGE A;  3M8S A;  3HM9 A;  3KLG A;  1YT3 A;  1NKE A;  4CF2 A;  3S3N A;  1JXE A;  4CGG A;  1NJZ A;  3ZSQ A;  2F8T A;  4N41 A;  3ULD A;  4F3O A;  2OPP A;  2WON A;  4JLH A;  4CF9 A;  2E6M A;  4PQU A;  2DY4 A;  3ZSY A;  2VWK A;  4CFD A;  2HB5 A;  4CEO A;  1VSD A;  3LP1 A;  3DMJ A;  5HRR A;  3DRS A;  3KK3 A;  4DTX A;  4W5O A;  3SUO A;  3C6U A;  3QER A;  2LSN A;  5CYM A;  4CJU A;  2HHX A;  1KVA A;  4E3S A;  3VQA A;  4CGJ A;  4CF8 A;  4FJX A;  2ZE2 A;  4BE2 A;  1BCO A;  2G8I A;  1VK0 A;  4DSK A;  3TWH A;  1T8E A;  2QKB A;  2O4G A;  3VQ4 A;  3OYJ A;  3TAP A;  4DSF A;  3F9K A;  2Z1G A;  4FLY A;  1JLQ A;  1SKS A;  1CZB A;  3DLG A;  3ZSV A;  1D5A A;  4CE9 A;  4BDY A;  3PY8 A;  2YV0 X;  4L8R B;  4IG3 A;  3ZCM A;  1KTQ A;  4FLX A;  1IKY A;  3VQ6 A;  3OVN A;  2G8U A;  2GBZ A;  4CK1 A;  3DLR A;  4DMN A;  1X9W A;  1WSF A;  4CK2 A;  1L3S A;  3L2Q A;  4DFP A;  3V81 A;  3DRR A;  1C1A A;  4RW7 A;  1HYV A;  3EYZ A;  4HUF A;  4Q0B A;  1UWB A;  4ELV A;  5I3U A;  4DSI A;  1Q8I A;  3SV3 A;  1RT3 A;  2RKI A;  3DM2 A;  1J9A A;  2OA8 A;  4B9S A;  2G8F A;  1RT2 A;  2HNY A;  3CFO A;  3OYA A;  1L3V A;  2P5G A;  4RW6 A;  3SUP A;  2RN2 A;  4O44 A;  4IKF A;  2F8S A;  4CEF A;  1BIS A;  1RIL A;  4FLZ A;  2YNG A;  3V9U A;  2A1S A;  4WE1 A;  4KV8 A;  2D0A A;  1BHL A;  4CJF A;  3AVA A;  1U45 A;  4I2P A;  4CJW A;  1RBT A;  3AVM A;  1UA1 A;  4W5N A;  5J2N A;  4AHS A;  3SI6 A;  1TGO A;  4HUE A;  4JRQ A;  1U47 A;  4C8M A;  3WNE A;  5KGX A;  3AVI A;  3U3G A;  4Q5V A;  3LZJ A;  3UIQ A;  3T1A A;  4FLU A;  3TI0 A;  1WAJ A;  4FM1 A;  1Y97 A;  1NOZ A;  3RRH A;  4KHY A;  3CYM A;  2A1R A;  3VQ7 A;  4W5T A;  3NCI A;  4KHN A;  4TSX A;  1LAW A;  4I7F A;  3LWL A;  3SNN A;  2OZS A;  3I8D A;  4FZZ A;  4FLT A;  3SQ4 A;  4DU1 A;  4CJE A;  3HVR A;  1L3T A;  3PUF A;  4FW1 A;  1VRU A;  3CQ8 A;  3SPZ A;  2Z1J A;  4N47 A;  2P1J A;  5KI6 A;  3S3M A;  3MXM A;  1ZBU A;  4KKO A;  1NK8 A;  1N6Q A;  2PZS A;  1S9E A;  1BL3 A;  4B9V A;  3LWM A;  1UOC A;  4BAC A;  2XY5 A;  1VSJ A;  4CES A;  4NCG A;  4QAG A;  4K8X A;  3LAL A;  1WSJ A;  3HK2 A;  4DFJ A;  4CEB A;  4M3Y A;  2F96 A;  1GOC A;  3AO1 A;  3HP9 A;  4Z0U A;  1S1V A;  3LPT A;  4BDP A;  4Z4G A;  1EET A;  4FM0 A;  1W9H A;  4I9Q A;  4QOZ B;  2BGG A;  1ZBL A;  2IDO A;  1HQU A;  2Z1I A;  4CJS A;  4E7I A;  3HVT A;  3HPH A;  4CJQ A;  4OKE A;  1ZBH A;  2XRI A;  4LY7 A;  3G10 A;  5FRO A;  4W5R A;  3PX6 A;  3SYZ A;  3TAB A;  3MEE A;  2ZQB A;  1ASV A;  2P5O A;  1SV5 A;  4O0I A;  1IKV A;  4ICL A;  4E7H A;  1U48 A;  2IGI A;  1KVC A;  1ITG A;  1BI4 A;  3HPO A;  2VWJ A;  4OJR A;  1TVR A;  4FJ9 A;  2HVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...