5HRNA

Hiv integrase catalytic domain containing f185k mutation complexed with gsk0002
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
152
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 148
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrnA00
1KVBA 1WSHA 3SZ2A 3ZSYA 4CJTA 1J53A 4LD0A 4CJSA 3D45A 3L8BA 4DSIA 4KI4A 4BE1A 4Z4IA 3ASMA 3ZSVA 1FKPA 2X78A 4B9UA 5D3GA 4C8LA 3OVNA 3KLFA 1C0MA 2IGIA 4OGCA 4ID5A 4OVLA 1JXBA 1XHXA 4FLWA 2R7YA 1IKWA 4CJ5A 3AO2A 3B6PA 1TK5A 1D9DA 5HROA 4I2PA 1N6QA 1LWFA 3MXMA 4HCBA 4IFYA 4CHPA 4CJFA 3CM6A 4FK0A 3WNFA 3MECA 3AA3A 4BWMA 4KB1A 4H8KA 1NJXA 1Z25A 3CG7A 1ASWA 1RT7A 4GMJB 3DLRA 4O55A 4W5QA 4KB0A 4M42A 1L3VA 1HYZA 4Z4EA 2KZMA 2Y1IA 4YNQA 1XHZA 3ZSOA 3MEDA 5SWMA 3IAYA 4FW1A 4B8AB 4CK1A 3SI6A 4FM2A 4I9LA 1C1AA 1VSMA 1UOCA 1U47A 2HHXA 3V1OA 1RTJA 2HNYA 3TAFA 1RT4A 4RW7A 4DTRA 1CLQA 1ITGA 3O3HA 1HRHA 1EXQA 3LZJA 3I0SA 3JSMA 1UA0A 1KCFA 1LV5A 4J2DA 4CEQA 4CHYA 3V6DA 4FZZA 1RBTA 1WSIA 3KIOA 4CF0A 1HNVA 2HHVA 2D0AA 2E4LA 1RDBA 3WNGA 1IO2A 1WAJA 1UA1A 2BGGA 4M3RA 3K5LA 1RBRA 2OPRA 4M3TA 3HPOA 1RCHA 2OPPA 3AVJA 4N47A 5FRMA 3RRHA 4PWDA 4W5OA 4W5RA 2DFHA 2QK9A 1FXXA 1NJYA 4N76A 1J54A 2HVIA 4KTQA 3I0RA 4O0JA 4C8NA 4DSEA 1O1WA 1RBVA 2VG5A 4KFBA 3LP2A 3LANA 4Y1CA 3VA3A 1JLEA 1KVAA 1NK0A 3ZSRA 1XI1A 1ZBLA 3L2WA 4CJEA 3HVRA 4L8RB 5JS2A 3AVLA 4DTJA 3V9XA 1BGXT 4E89A 1A5WA 1S5JA 4R5PA 1RNHA 3RRGA 1B9FA 2HNDA 3VQ9A 1ZBIA 3RMBA 1B92A 1W9HA 3AO1A 1BCMA 4BDYA 4DTNA 4DTXA 3O4NA 2FBYA 3KK1A 4FCYA 2RPIA 3SUNA 3HK2A 4FK4A 2IS3A 3AA5X 3H08A 3OYNA 4OPJA 1NK9A 1U4BA 3KKRA 3VA0A 4DFKA 5J2QA 4IKFA 1L5UA 5HP1A 3AO5A 1HQUA 4J2AA 3TAQA 2OPSA 5E41A 5K14A 1CZBA 3ZT2A 1CXUA 3AO3A 3SNNA 1Q9YA 4DU1A 3QEXA 1D5AA 4DS4A 4CK3A 3LP3A 4FJ8A 3F73A 4F8RA 1HPZA 4NCGA 4CJVA 4FLVA 4OJRA 2DFFA 4CJLA 4Z4HA 1RTHA 4H4OA 4DFPA 3TAEA 3T1AA 1KVCA 4DSKA 3IRXA 1ZBFA 1TGOA 3S3NA 2Y1JA 3OYDA 5KI6A 4DWIA 1KLNA 1RT1A 5KRSA 3DLKA 4F4KA 3OYMA 1SL2A 4IG3A 5EU7A 1JKHA 2XY7A 1C0UA 4I2QA 3VQ7A 3WNEA 4HUFA 3MEGA 3K5MA 1KSPA 4FZYA 4CJRA 3KLEA 4N41A 2XO7A 1X9SA 3M8QA 5HRNA 3NGIA 1ZBUA 4FJ7A 4OLAA 4W5NA 1YT3A 4FJIA 1KLMA 2YKNA 3MXJA 5CY4A 3KLIA 3QEVA 4CECA 1S1UA 4IBNA 1MU2A 5C24A 4HHTA 4ZTJA 1HYSA 2ZE2A 2P5GA 4KTZA 4KV8A 2FC0A 2HNZA 2HHTA 1UAXA 1QSYA 3C95A 4FLYA 3IG1A 5CZ1A 2I5JA 1C1CA 4CJUA 3L2UA 3VQEA 4DS5A 1JLCA 4FJ9A 1TAUA 2E6LA 1J5OA 1JLFA 4E7KA 3LZIA 1HNIA 4DSLA 3QEWA 4F2SA 1EP4A 1VSFA 1DTQA 4Z4FA 1SKSA 4RW9A 1TKDA 4OLBA 2IC3A 5C25A 1RT2A 3V1RA 4LSLA 3V1QA 3SV3A 1VRTA 3M8SA 1HMVA 3QLHA 2KZZA 4PUOA 4M45A 4CGFA 3DOLA 4RG8A 2KFZA 5J2PA 1GOAA 4IDKA 3ZCMA 1BI4A 3G0ZA 3NH1A 4KHYA 2G8KA 2DY4A 1S6PA 3OS1A 3KK3A 4AHRA 1GOCA 4QAGA 4F2RA 4O4GA 5CYQA 4DTPA 1RTDA 4DQPA 1DTTA 2QKBA 1LW0A 4RW6A 5CZ2A 1RILA 3DLHA 1NKEA 2VG7A 2VWJA 3O4QA 4CEDA 4DTSA 1U04A 1KFSA 4E7IA 3KKSA 4DQQA 3T3FA 4DU4A 1Z26A 4CGGA 3LWLA 4AHCA 4BACA 3CYMA 4CJ4A 1IH7A 3DM2A 3L3UA 2O4IA 3QESA 3C6TA 4O44A 4DF8A 4F3TA 3DOKA 1NOZA 4OGEA 3OJUA 3THVA 4KREA 3ALYA 4NYNA 3A2FA 3QETA 3S3OA 1LWEA 1RT6A 4M3WA 2DFEA 2RN2A 4DG1A 3RMDA 3VQDA 4HCCA 4IFVA 4LSNA 3QO9A 3KTQA 2P5OA 1REVA 4CJQA 2G8IA 1NKBA 1VSJA 3LAKA 2W42A 3EZ5A 5CYMA 3RTVA 3SUOA 1N5YA 2HHUA 1C0TA 4FJJA 1CZ9A 4AHVA 4CJKA 2KTQA 2KQ2A 4H4MA 4C8MA 1LAVA 4CEZA 1NK7A 3OYLA 2NUBA 4CIEA 4JS4A 4AHTA 4CEBA 1U45A 1TL3A 1T8EA 1QE1A 3HVTA 1TV6A 2PYJA 2VG6A 3NF8A 4KTWA 5KRTA 3CQ8A 3LAMA 5KGWA 3ULDA 4B9SA 4KHWA 1C6VA 4E7HA 1QTMA 3HSTB 4CHNA 5JS1A 3IS9A 3NH0A 4IG0A 3DRSA 4AH9A 4E1MA 3HM9A 2XY8A 1F21A 4NCBA 2B4JA 3QIOA 1QS4A 4N5SA 2G8HA 3HL8A 1KRPA 2BE2A 3NF7A 4DFMA 3NBPA 4LH4A 3AVAA 1WLJA 4FVMA 3M8PA 3TI0A 3VN5A 1NK5A 1D9FA 4EZ9A 4EZ6A 4PY5A 4FW2A 4QOZB 3AVNA 4KI6A 3HJFA 1BHLA 1S1XA 4FM0A 4HVJA 4FM1A 4ELUA 5DMRA 4AHSA 2A1SA 4HTUA 1IKYA 1BL3A 4B8CA 4B9LA 4M3YA 4CF1A 4CGIA 4OKKA 3L2QA 2G8FA 4C8OA 4ELVA 4E3SA 1TKXA 1VSIA 3NAEA 3OYJA 1T7PA 1I39A 1I3AA 4KHQA 1WSGA 1X1PA 3CFOA 3P1GA 1K6YA 1BCOA 3K2PA 3L2VA 1C1BA 4DLGA 3V9ZA 1WNSA 2OYQA 4CERA 1IKVA 3HXMA 4E7LA 3HP6A 4CEOA 3ZSZA 5KGXA 3V4IA 3PO5A 2YNGA 4CHZA 1T03A 3S3MA 1TK0A 2QXFA 3HP9A 3ZSWA 3RMAA 4FJGA 3NF9A 4FLTA 4B9TA 3ZSXA 1KFDA 1VSDA 2Z1JA 3VQ4A 3PX6A 3K5NA 4BE0A 3VQPA 2IOCA 1SV5A 2YNFA 3PX0A 3AVMA 3KD5E 3OYBA 3OJSA 4B9VA 2ETJA 4KHNA 4MQ3A 3QERA 3OYIA 3HPHA 3K57A 4Q0BA 1SUQA 3AVFA 1BI4B 2G8UA 2JGUA 1ZYQA 2Z1GA 3K58A 3S9HA 3SUQA 1T05A 3OS0A 4B08A 4DFJA 1BIUA 3LP0A 3ZT0A 1S9GA 5SZTA 2HB5A 3VQQA 4M3XA 3NGYA 3AVIA 3K59A 5FDLA 5J1EA 1RBSA 1LWCA 4RW8A 1EETA 2GUIA 1JLQA 3OYAA 4LY7A 1NK4A 4ZTFA 2F8TA 2AJQA 4DQIA 3P5JA 3K5OA 5HRPA 2Z1IA 4ICLA 4Q5VA 1RDAA 3SJJA 2OPQA 4OKEA 5J2NA 2HHSA 2O4GA 4FXDA 3TAPA 1JLBA 1SL1A 1L3SA 3ZT4A 2ZD1A 3P83D 3O3FA 4WE1A 3VQBA 4JRPA 4GW6A 3AVKA 2ITGA 1HJRA 1XWLA 3RWUA 2X74A 4C8KA 3U6FA 1NK8A 2OA8A 2GBZA 3PUFA 3O3GA 2HW3A 2B5JA 2IAJA 3E01A 3MAQA 4KKOA 4CF2A 1VSKA 5J2MA 2Z1HA 4CJ3A 1NK6A 1VSEA 3SUPA 4CHQA 3NCIA 1R0AA 3SCXA 3VQ8A 2XRIA 2OZSA 4XIUA 3NH2A 1A5XA 3SPYA 4DQSA 3QNNA 4Z4CA 3LP1A 1S9EA 3OY9A 1NJWA 1G15A 3AVHA 1BIZA 4DMNA 4KHSA 3KD1E 3DRPA 4O5BA 3V9UA 3D0PA 3SPZA 3QEIA 4MFBA 3KK2A 3LALA 1NJZA 3OYFA 3DI6A 3AVGA 4CFCA 3V9SA 1W0HA 4UQGA 2YHAA 1BISA 2GV9A 2RKIA 3I8DA 1S6QA 3NDKA 4DLEA 3ZSQA 4CGJA 1JL2A 4CGDA 5HLFA 1QSSA 1FK9A 5FROA 4FLXA 3PV8A 1J9AA 1RBUA 1HYVA 1X9MA 4G1QA 2A1RA 1TK8A 2HVHA 4TSXA 3RR8A 3EYZA 2YNHA 3DLBA 4CF9A 1TKZA 3TAGA 4DQRA 3MXIA 4QCLA 3LPUA 4BWJA 3KLGA 4BDPA 4FJLA 2G8WA 4HUGA 1A5VA 4KO0A 3LWMA 2IDOA 3LDSA 4CK2A 3OYGA 1S1WA 4JS5A 3NFAA 1RDDA 2FBTA 3QIPA 3SQ1A 4FYDA 1XC9A 2KW4A 2WONA 3T19A 4YFUA 2FBVA 3SQ0A 2PY5A 4K8XA 2XY6A 2G8VA 2DTUA 5HRRA 1RTIA 2FBXA 2ZQBA 2XY5A 4LH5A 3RMCA 1WSEA 1SKRA 4FJXA 4CHOA 4CJPA 2HHWA 1EX4A 4BE2A 4GVMA 3ZT1A 3ITHA 3OYCA 1D8YA 4M3ZA 3KLHA 1VSHA 4KAZA 3VQ6A 2YHBA 3QINA 3U3GA 4CFAA 3DMJA 2B6AA 1ASVA 5HRSA 5I42A 1X9WA 2PYLA 4FK2A 4NCAA 4F3OA 3OS2A 2EX3A 4FJHA 4KHUA 3OYEA 1BQMA 2X6NA 1TL1A 3SQ4A 1Q9XA 2XHBA 3TARA 4DTOA 1HQEA 4M41A 3V9WA 4CE9A 1NOYA 2D0BA 3OYKA 4E19A 2D0CA 1DLOA 3B6OA 3TABA 1TKTA 3PO4A 1JXEA 1QQCA 4FJNA 2P51A 4DTMA 4KRFA 2WOMA 3HO1A 4RW4A 4Z0UA 4CGHA 3AA2A 1JL1A 2HMIA 1L3UA 3RR7A 4N56A 3JYTA 1S1TA 4OPKA 4B9NA 4E0DA 3HPGA 4CF8A 4CCHA 3HT3A 4E1NA 4JRQA 4DF4A 1Y97A 4FLZA 1UWBA 4E7JA 4DU3A 3DLEA 3NE6A 4PQUA 3BGRA 4CJWA 1CXQA 1LW2A 3M8RA 3TWHA 4FJMA 1ZBHA 2P1JA 1YTUA 4DTUA 2KFNA 1WSFA 2YV0X 3DLGA 4CEAA 4J2BA 4Y1DA 1TVRA 1RT5A 4ID1A 3VQCA 3AV9A 1RT3A 3F9KA 5I3UA 1QSLA 1RDCA 3PY8A 1U48A 4Z4GA 3C6UA 4FJKA 4J2EA 4CFDA 2VWKA 4I9QA 3ISNC 3CFRA 3AVBA 3L2RA 3SQ2A 3SYZA 2Q3SA 3EY1A 3OYHA 2QKKA 3MEEA 3DYAA 2YKMA 4AHUA 1S1VA 3DRRA 4CEFA 5KTQA 4HUEA 5FRNA 1FKOA 3VQ5A 4FZXC 1IKXA 3VQAA 2YNIA 4CFBA 3NF6A 1WAFA 1NKCA 4AILC 2BDPA 3C94A 3QNOA 1YTAA 4K8ZA 2HHQA 1KTQA 1ASUA 1BQNA 4O0IA 3TANA 1SKWA 3UIQA 1YVUA 4CEEA 3PX4A 3LPTA 2D5RA 1L3TA 4CESA 3ZT3A 1TAQA 1WSJA 4BDZA 3QEPA 4JLHA 2F96A 4PA1A 1JLAA 1QHTA 2ATQA 4W5TA 1WN7A 3TR8A 4B9MA 3U3YA 1IG9A 4DSFA 5C42A 3TAMA 4FJ5A 1GOBA 1Q8IA 5T7BA 3BDPA 4B3OA 2BANA 3CM5A 2OZMA 2RF2A 2X6SA 3FFIA 4FLUA 2PZSA 1JLGA 2EHGA 1EKEA 4KPYA 4DSJA 4EP5A 2JLEA 3V81A 4EP4A 4CIFA 3G10A 3NHGA 5DK5A 3CFPA 4NYFA 3AVCA 1LAWA 3NGZA 3SV4A 1U49A 4CIGA 4ELTA 3HYFA 1VRUA 3L3VA 4OKJA 5HBMA 3WNHA 2LSNA 1VSLA 1B9DA 4ZHRA 2E6MA 4M3UA 2F8SA 1VK0A 1SL0A 3KJVA 4I7FA 3AA4A 3AO4A
chains in the Genus database with same CATH superfamily
3D45A 4DV6K 4GKKK 3U8XA 2IGIA 4ID5A 4OVLA 1GLJO 1JXBA 4RWTA 5LMNK 3UKRA 3JAMO 1NGFA 1NGEA 3P38A 3B6PA 4M63C 1N6QA 3MXMA 3MECA 4KB1A 4NLBA 4GMJB 4O55A 2PFUA 2A6AA 4A59A 2KZMA 1VQ6N 3BZKA 1HR0K 3ZSOA 5SWMA 4B1WB 1ESVA 4CK1A 3SI6A 1UOCA 3VGMA 3V1OA 3Q7BA 2IIRA 2FF3B 4NXMK 5LJVA 4A5AA 4CEQA 4CHYA 3CF5L 4FZZA 1RBTA 4JI3K 4CF0A 5AR0A 2E4LA 5AQJA 2BGGA 2OCEA 3K5LA 3HPOA 1RCHA 5EY4A 3VEWA 4N47A 2NRWA 4W5OA 3O9TA 2QK9A 5M1FA 1HLUA 4KTQA 2A42A 4DSEA 4KFBA 3LP2A 4ILHA 1GLAG 4Y1CA 3VA3A 5IT9O 1NK0A 3ZSRA 1XI1A 4YOWA 1QVFM 4L8RB 3E9PA 4R5PA 1S5JA 3RRGA 1ILYA 1V4TA 1W9HA 4DTNA 4BQZA 3G6EN 3W3DA 4IO9L 2GUPA 2QWLA 2IS3A 4LF4K 1BO5O 1U4BA 4IKFA 5J2QA 3RVCA 3AO3A 4BRFA 3QEXA 4NCGA 3PIOL 2DFFA 4CJLA 3TAEA 3ID8A 3IRXA 1QVGM 4IJAA 2P9KB 4CZGA 3BUZB 3VF6A 5KI6A 4H5RA 1KLNA 1RT1A 3H46O 4DWIA 2O8EB 4BVPA 3OYMA 1W97L 4CVNE 4H0TB 1C0UA 4FZYA 4N41A 3O5BA 3M8QA 5AQOA 5AQTA 1YT3A 4FJIA 3EKSA 3F2KA 1TYQA 3SJHA 3ULEB 1S1UA 4CECA 4BC3A 4KTZA 2FC0A 2HHTA 1QSYA 2HOEA 3CJCA 5M1OA 3L2UA 3LM2A 4DS5A 1JLCA 4BQLA 1T6DA 4GVEA 4E7KA 4BG8A 4DSLA 1EP4A 4BG9A 4YDUA 1SKSA 1TKDA 3J80O 3N4QA 4YOVA 1HMVA 2P9KA 3HOTA 4PKIA 1ATRA 3HM8A 2O8EA 5J2PA 1HKCA 4IDKA 5JMVA 2YX6A 3VPZA 1S6PA 4BR0A 5AQWA 4F2RA 5BRHA 5CYQA 4PKGA 5CZ2A 3DLHA 1NBWA 2VWJA 4DUYK 1KD1O 3CC2N 4CEDA 1KFSA 3TSUA 4CGGA 3EN9A 3CYMA 1RDUA 3SAHA 1RDWX 4CI6A 3G71N 3THVA 3BP8A 2E2OA 4NYNA 5GIPA 4M3WA 1T44A 3VQDA 3ZLJA 4DUZK 4CJQA 2G8IA 1NKBA 3O6WA 1VSJA 5CYMA 3ATUA 4GV6A 1CZ9A 4ILGB 2KTQA 4C8MA 1NK7A 3THYA 3ZX3A 3HVTA 3HZ6A 4FWRA 2PYJA 2PAVA 4KHWA 5KGWA 5BN9A 3NH0A 1VHXA 4AH9A 4C1NK 4E1MA 1F21A 1R59O 4BRKA 3AAQA 5E26A 4NB4A 5HOOA 2G8HA 3NF7A 4EZ9A 2V51B 1Y64A 4YOUA 1YXQA 3FGUA 4FM1A 1U2VB 1DT9A 4AHSA 1N8RO 3D6RA 4HTUA 4B8CA 4CF1A 4CGIA 3L2QA 2G8FA 4ELVA 3M6GA 3OYJA 2QA4N 4AM6A 3P1GA 4CERA 1IKVA 4E7LA 4M7XA 3V4IA 1T03A 3VF2A 4CHZA 1VQMN 4FJGA 3ZSXA 3VQPA 2IOCA 2YNFA 3AVMA 3KD5E 3CMEN 1HNZK 4KHNA 2P9SB 3QERA 4Q0BA 4B3TK 2H3GX 3OHRA 4A62A 1E4GT 3K58A 3S9HA 2O8CA 3F9MA 3THWA 1T05A 3LP0A 1U2VA 4XH4A 2HB5A 3VQQA 4JK8A 3VF4A 3NGYA 1RBSA 4FWKA 4RW8A 1EETA 3OYAA 4DQIA 3P5JA 4Q5VA 3OBWA 1RDAA 1N32K 2HSTA 3PSFA 2W41A 1O13A 2KKZA 2O4GA 2QM1A 3TAPA 3QICA 3U9DA 1HJRA 3RWUA 2P9UA 4FWPA 2E2PA 3U6FA 4C8KA 2GBZA 3VEXA 2W6KA 2IAJA 2YHWA 5C2DA 3J81O 2P9SA 2ZGZA 1NWKA 3CJ1A 3NCIA 2P9PB 2XRIA 1YHQN 2OZSA 5AQHA 3SPYA 4DQSA 1YJWN 3LP1A 4WQ4A 1NJWA 1G15A 4CZEA 4JI5K 1T3VA 5LY3A 4KHSA 3KD1E 3KK2A 4GKJK 3V9SA 2YHAA 3J8AA 3MMVA 3QFUA 2GV9A 4IOAL 3NDKA 4DLEA 5AJ3K 5HLFA 3ZEUB 1BG3A 1HYVA 3CI5A 2YHXA 4G1QA 4CF9A 4DQRA 3LPUA 1VQNN 3KLGA 4KO0A 2IDOA 3WEEB 4CK2A 1S1WA 4BC4A 3DJCA 1S72N 3SQ1A 3IDHA 1XC9A 2KW4A 2PY5A 2DTUA 3VENA 2G8VA 4BRHA 4B1YB 1GLFO 5KQDA 4JI4K 3VESA 4CJPA 4IOXA 1D8YA 3ITHA 1VSHA 3VQ6A 5HRSA 2B6AA 4AF1A 4IZ9A 4F3OA 3OS2A 4FJHA 2X6NA 1TL1A 4FWMA 3CCJN 5EVZA 1HQEA 3PIPL 2YJEA 4CE9A 4H0XB 3ZEUA 3OYKA 2D0CA 1DLOA 3B6OA 3I55N 1TKTA 3TABA 1QQCA 4KRFA 4RW4A 4EHTA 2VGMA 1JL1A 3JYTA 1S1TA 4OPKA 4B9NA 1J5EK 5ADXH 3HT3A 4E1NA 4FLZA 3CJ9A 3WEEA 3D2FA 3BGRA 1ZBHA 2P1JA 3ATVA 4DTUA 3QBXA 1RT5A 4ID1A 5I3UA 2ZJQL 3CCMN 1QSLA 3PY8A 3SMSA 3TPQA 3AVBA 4AM7A 3SYZA 2Q3SA 2QKKA 2IVOA 3MEEA 3DYAA 3KWGA 4BRAA 1S1VA 4HUEA 4DR4K 5KTQA 3GDQA 4CFBA 1FW6A 1NKCA 3CHWA 1ASUA 1BQNA 3TANA 3UIQA 1ZBSA 1YVUA 4ISEA 4CEEA 1P8ZA 1TAQA 4OX9K 1NGJA 1QHTA 2ATQA 2QEXN 3L4QA 1QQMA 4B9MA 4JNEA 1IG9A 5C42A 5DM7L 3BDPA 3CM5A 1NGAA 4LF6K 5F1XA 3V81A 3G10A 3NHGA 3CFPA 1YF5L 3SV4A 4CIGA 1VRUA 3E9LA 4RTFD 2I7NA 2LSNA 4M3UA 4BRCA 2UUBK 3AA4A 2XY5A 5HL7L 1WSHA 3PLAA 2VYPA 4CJTA 1J53A 3TSPA 3S41A 4CJSA 3EL2A 3L8BA 4KI4A 4BE1A 1FKPA 2X78A 3VTIA 3OVNA 3KLFA 3CCQN 3CPEA 1VQKN 1WBBA 1XHXA 4IOCL 2R7YA 3AO2A 1EQYA 1VQLN 1LWFA 4IFYA 4FK0A 3WNFA 4BWMA 3AA3A 3A0IX 1ASWA 2FSJA 3DLRA 3GG4A 1L3VA 2Y1IA 5BR9A 3R3LA 3EO3A 1C1AA 1VSMA 1U47A 3CJBA 3TAFA 4R79A 1RT4A 4IJNA 4RW7A 1CLQA 1ITGA 1QZ5A 1NG9A 4CZIA 5JVGL 2ZWHA 3LZJA 1WBDA 1OKJA 1UA0A 2E88A 4IO8A 1Q7YO 4J2DA 5LL6Z 4A2AA 3IKMA 1RDBA 2V7ZA 3UE5A 4JI6K 4WYBA 5LJWA 5FRMA 3MN7A 4H0YB 2DFHA 4DR3K 1FXXA 4N76A 4U7BA 1NGBA 1X9JA 4B1VA 1O1WA 4CD1A 3LANA 1JLEA 4Y0WA 5AQVA 5AQPA 4IFEA 2VCPA 3L2WA 2OTJN 5JS2A 4DTJA 1B9FA 3VQ9A 1DGKN 1ZBIA 3AO1A 1BCMA 4BDYA 3TTCA 4V19S 1ATSA 2HBJA 3SUNA 3HK2A 3MX2A 1KAZA 1IBLK 3H08A 4IDHA 3VA0A 3CD6N 1P90A 1K8KB 5K14A 4OO1J 3ZT2A 5ADXA 4BY9C 1CXUA 3SNNA 4BC2A 4JI0K 3O9QA 4FJ8A 1HPZA 3IUCA 4OJRA 4H4OA 1RGIA 3SAGA 3IMXA 1ZBFA 4MLHA 1TGOA 1BA1A 2Y1JA 3S3NA 3OYDA 3UKRB 3T1HK 3DLKA 4F4KA 1SL2A 5EU7A 1JKHA 4I2QA 3WNEA 1KSPA 3K5MA 4CJRA 3KLEA 1VQ9N 1X9SA 5HRNA 3NGIA 1ZBUA 4WCEL 2YKNA 5CY4A 1U6ZA 1MU2A 1X3NA 5C24A 4HHTA 3C65A 1UAXA 4KH5A 3C95A 3DWLA 4FLYA 4YHHK 1HNWK 4JHDA 2I5JA 3M3ZA 4CJUA 3LDLA 1K8KA 3VQEA 4FJ9A 4DCHA 2E6LA 4X62K 4BREA 1DTQA 4O5FA 3MWTA 1YAGA 5AFUA 1XMOK 4OLBA 3SV3A 1RT2A 3V1RA 3QLHA 4FO0A 3OW2M 4PUOA 1JCEA 4RG8A 2RE2A 3ZCMA 4JD2B 3NH1A 4FSVA 4B1ZA 1CZAN 5E84A 4O4GA 4DTPA 4K43A 4RW6A 3CC7N 4B3SK 4LF9K 1NKEA 2Q31A 2VG7A 4LFBK 4DTSA 4DV3K 3DM2A 3L3UA 3QESA 1Q18A 3FZKA 4O44A 2F7TA 3VEOA 3DOKA 3E66A 1Z6RA 1GLEG 2HMPA 4OPAA 5BRFA 3QETA 3S3OA 1RT6A 3QMLA 4BRPA 2NZTA 3LDPA 3RMDA 2OTLN 3KTQA 2P5OA 1E3MA 1EO1A 1Q82O 3RTVA 2UXCK 4RCHA 4FOEA 4CJKA 4OPHA 2HHSA 3FE1A 1LAVA 3OYLA 4JD2A 1U45A 4CEBA 3VGKA 1T8EA 1TV6A 1ZXOA 4KTWA 5KRTA 3LAMA 3D2EA 3CQXA 1C6VA 2E2QA 5FPDA 3HSTB 3IS9A 3E1YA 1Z05A 2FSNA 2B4JA 5AZJB 1QS4A 4BR7A 1DEJA 2BE2A 3NBPA 4LH4A 3ID6A 1JCFA 1N34K 4FVMA 2A41A 3VN5A 3TI0A 4I6MA 4QOZB 3HJFA 4KI6A 1BHLA 1S1XA 2CGLA 4FM0A 1OH5A 4HVJA 3O9UA 3L6QA 5DMRA 1TYQB 4LC9B 2A1SA 3WXIA 4B9LA 2DY4A 4CZHA 4E3SA 1TKXA 3NVMA 1I39A 1I3AA 1W2BM 3L4IA 4KHQA 1GLDG 1BCOA 5IWAK 2CGKA 3SBGA 1WNSA 4CBWA 5M1PA 2VQFK 1W7AA 3HP6A 2VWBA 3PO5A 2YNGA 4CZMA 2RHKA 2E1ZA 3B8AX 3ZSWA 4FLTA 4B9TA 1VSDA 2Z1JA 4A57A 4CJ7A 3PX6A 4BE0A 3THXB 1SV5A 3TTDA 2NRHA 4B9VA 4BR5A 4MQ3A 3MX5A 5AQQA 3ZETB 3K57A 2ZJRL 1LCUA 5AZJA 4JAXA 2QWNA 3SUQA 1NGIA 4DFJA 1BIUA 3DXKB 3I56N 3R9PA 1YIJN 4BRMA 4M3XA 3K59A 5FDLA 5J1EA 4LY7A 3J7ZO 3FR0A 1OVQA 2UU9K 2Z1IA 4ICLA 4B1XB 4KH6A 4OKEA 5J2NA 3H6EA 3BY5A 4FXDA 5AQSA 1SL1A 1L3SA 1KQSM 3O3FA 4WE1A 4GW6A 2ITGA 1XWLA 1NGHA 3THXA 2V7YA 2Q2RA 3PUFA 3E01A 3L0QA 1VSKA 1NK6A 3ZETA 4CJ3A 3THYB 3SUPA 2GELA 1NMDA 3VQ8A 3C7NB 3DXKA 3AVHA 1EWQA 4O5BA 4DR7K 3QEIA 4DR6K 4WQ5A 3LALA 1XNRK 4CFCA 3R8EA 1W0HA 4K42A 3J7AP 2W40A 1WB9A 4CGJA 5JLFA 3PV8A 4FLXA 1RBUA 2D0OA 2HVHA 3EYZA 3MXIA 3F5TA 4BWJA 4HUGA 3LWMA 3LDSA 4FWOA 3OYGA 1SQKA 5M1NA 1RDDA 2FBTA 4FYDA 4YFUA 2WONA 2FBVA 2XY6A 4DV2K 1RTIA 4FJXA 3RMCA 1WSEA 3VETA 3C7NA 2JWLA 4ISGA 4YY3K 4BE2A 4GVMA 3ZT1A 4M3ZA 4DKWA 3KLHA 2GX9A 3G4SN 3U3GA 3C6AA 3O9SA 4IEEA 4DV0K 1Q9XA 3SLCA 4DTOA 3V9WA 4M41A 1NOYA 2O8CB 2D0BA 1QQNA 3THWB 3FZLA 2WBNA 4FJNA 3MCPA 4Z0UA 2HMIA 4N56A 3U4LA 3HPGA 4DR1K 4CCHA 4JRQA 4DF4A 3CCLN 2NRRA 3O08A 4PQUA 1CXQA 3TSQA 3WT0A 2YV0X 5AQZA 4CEAA 4Y1DA 1TVRA 3BF3A 4DV7K 3BF1A 1RDCA 4Z4GA 1NM1A 1U48A 4J2EA 2P9UB 2P9NB 3SQ2A 3SBTA 4AHUA 2P9IA 3DRRA 5CR4A 5FRNA 3VQ5A 1S22A 1IKXA 3VQAA 1WAFA 1TUUA 1XUPO 4K8ZA 2HHQA 1KTQA 4O8KA 4FL9A 3ZT3A 4BDZA 4KHPK 4JLHA 4W5TA 5KPZA 3DLLL 4E1JA 3WQUA 2GWJA 1GOBA 1VQON 2BANA 2X6SA 4FLUA 2PZSA 1JLGA 2EHGA 4EP5A 2P9NA 4K25A 3NGZA 4ELTA 4JI8K 1IBKK 2ZM6K 1VSLA 1B9DA 3MDQA 3PSIA 2F8SA 3ENBA 4ILJA 4GY2B 1SL0A 3KJVA 3TTFA 1KVBA 3SZ2A 3ZSYA 1QHAA 4GNIA 4CBXA 4LD0A 5I9EB 4DSIA 3ZSVA 2UUCK 3RSEA 4FWNA 2HBMA 5D3GA 4C8LA 3NVKA 4OGCA 3HTVA 4YOYA 5GINA 2FSKA 4WFAL 4FLWA 2KLAA 4G9ZA 1D9DA 5HROA 4I2PA 4HCBA 3CM6A 1M1KO 4H8KA 1NJXA 3CG7A 4KB0A 3I33A 2AP1A 4Z4EA 3GL1A 3CCVN 4YNQA 4H0OA 1XHZA 4EIAA 3MEDA 2NRZA 2F9WA 5AQUA 3IAYA 5AQRA 4FW1A 4B8AB 2E20A 3D2FB 4FM2A 1D4XA 2HHXA 4FPBA 4DTRA 3WQTA 3O3HA 2HHHK 2GEMA 1KCFA 5AQLA 3V6DA 2D1KA 2P9LA 4JK9A 2D0AA 3CMAN 3H1VX 1UA1A 3P4IA 4M3TA 4PKHA 2O8BA 2ITMA 4PWDA 4W5RA 1IJJA 4X64K 3I0RA 4O0JA 4C8NA 2VG5A 4H03B 1NU0A 4BR4A 1HPMA 3LM9A 3V9XA 1BGXT 3MN9A 1RNHA 2CH6A 2HNDA 2PBDA 3RMBA 4JI1K 4BROA 5ELZA 3K0SA 4DTXA 1YITN 2FBYA 5GAEP 3KK1A 3AGRA 2RPIA 3AARA 4OPJA 1NK9A 3SMPA 4AQYK 4DFKA 3IFRA 4J2AA 5HP1A 3AO5A 1HQUA 2OPSA 5E41A 3EKUA 4LFAK 1Q9YA 2YHYA 1D5AA 4FLVA 4DFPA 4Z4HA 1RTHA 1NGCA 4B9QA 4DSKA 1KAXA 1V4SA 1H1VA 1ATNA 2ZGYA 5AFUH 3VQ7A 4EHUA 3MXJA 3GE1A 2ZE2A 2P5GA 4KV8A 5EXWA 4FVUA 1BOTO 3IG1A 3FZFA 5CZ1A 1C1CA 4X66K 5JICA 4KBOA 5AZIB 1J5OA 1JLFA 3QEWA 4F2SA 4Z4FA 4FOIA 3ENOA 4RW9A 3N4PA 1MDUB 5C25A 4LSLA 1VRTA 2CGJA 4M45A 4CGFA 3DOLA 2KFZA 1GOAA 1BI4A 3G0ZA 4DV4K 3OS1A 3KK3A 4AHRA 1GOCA 2QKBA 4PL8A 3O4QA 3KKSA 1NNEA 3T3FA 4DU4A 1Z26A 4BACA 3LWLA 4JI2K 3C6TA 4DF8A 4KREA 3ALYA 5AZIA 3A2FA 1LWEA 4HCCA 4DG1A 3CPWM 4IFVA 3QO9A 1REVA 3MN5A 2W42A 3LAKA 3SUOA 4FJJA 4H4MA 4AHTA 1BDGA 1IV0A 1QE1A 4QS9A 2VG6A 3NF8A 4H0PA 3CQ8A 3ULDA 1KAYA 1HX1A 4CHNA 5B8HA 3ZX2A 4XEIA 2XY8A 4NCBA 3QIOA 3H1QA 4N5SA 3HL8A 2HBLA 1WLJA 1NK5A 5KQ8A 4MDBA 2WFBA 4FW2A 3AVNA 4BRNA 4YORA 5M1QA 3VMFB 1IKYA 1BL3A 3R1XA 3WUHA 4C8OA 5AQXA 4JEPA 3NAEA 1T7PA 1WSGA 3MN6A 1K6YA 4JHDB 3K2PA 2JWKA 1C1BA 4CD3A 3HXMA 3O1BA 2E2NA 3HP9A 3RMAA 3BEXA 5TKYA 2NRVA 5TKWA 4JN4A 4JKHA 5AQMA 4JKGB 3OJSA 5KPTA 3OYIA 3HPHA 3AVFA 2QWPA 4NXNK 2JGUA 3H45C 5C12A 2Z1GA 5FPNA 4B08A 3J7YP 4BRDA 1S9GA 5SZTA 1HNXK 3AGKA 2Q97A 5BPNA 1E4FT 1LWCA 4Z94A 2GUIA 2AJQA 3LDQA 1NK4A 4ZTFA 4H5VA 5AQIA 3QFPA 3CERA 4MO5A 3ZT4A 2QI2A 3P83D 3VQBA 4PHTX 2QWOA 5FPMA 1XQSC 1VQ8N 2X74A 1NK8A 2OA8A 4JKGA 3O3GA 2B5JA 2FF6A 2HF4A 3MAQA 4KKOA 4CF2A 4IWVA 2D4WA 1BUPA 2Z1HA 1VSEA 1YI2N 3SCXA 4FWSA 3JS6A 3NH2A 3D2EB 4Z4CA 3OY9A 3QBWA 1T6CA 2QTDA 3D0PA 4MFBA 1NJZA 2E8AA 3OYFA 3AVGA 4UQGA 3KVGA 4FPAA 1BISA 2Q1NA 2RKIA 3T69A 3ZSQA 1JL2A 4I6MB 1XNQK 5FROA 5F2RA 4LF8K 2A1RA 1TK8A 4TSXA 1QQOA 2YCHA 3RR8A 1TKZA 3LL3A 4JYAK 3FZHA 1Q86O 4F9OA 3T7ZA 4JS5A 1TUYA 2A3ZA 3T19A 2ZQBA 2HHWA 1EX4A 3FFKB 3OYCA 4MDAA 1HKBA 4KAZA 2PYLA 3DMJA 4FK2A 1ASVA 2YJFA 4CW7B 4NCAA 4JV5K 4XH5A 3SQ4A 4JKDA 3PO4A 5EOYA 3FLCO 2P51A 2WOMA 3HO1A 4CZJA 4B3MK 2ZF5O 1BU6O 4CF8A 1Y97A 4DU3A 3DLEA 4CJWA 1LW2A 3TWHA 3A5LC 3DAWA 1WSFA 3EZWA 4DB3A 5GAHP 3VQCA 1RT3A 3F9KA 1HUXA 3C6UA 4FJKA 4CFDA 2VWKA 4I9QA 3ISNC 3CFRA 1MA9B 3EY1A 3H3NO 3OYHA 2WC9A 3HOSA 3FZMA 1YJ9N 2UUAK 4BR2A 4BRGA 3SAFA 2V52B 5AQYA 4O0IA 1SKWA 1VAZA 3LDNA 3PX4A 4QS7A 2D5RA 1HKGA 1L3TA 4CESA 1WSJA 3CQYA 2FXUA 2F96A 4PA1A 3O9RA 3VOVA 2A40A 3TAMA 5T7BA 1Q8IA 3CXCM 2GTDA 4CZKA 3A5NC 3GOIA 1EKEA 4KPYA 4DSJA 2JLEA 4IXCA 4EP4A 5DK5A 4NYFA 3AVCA 1LAWA 1OVYA 1U49A 3HYFA 4OKJA 3L3VA 5HBMA 4ZHRA 2Q0RA 1NGGA 2Q36A 2RF2A 2BUPA 3U9ZA 1XMQK 4Z4IA 3ASMA 4B9UA 5AQKA 1C0MA 4B3RK 1OH6A 1IKWA 4CJ5A 1TK5A 2BTFA 3VEZA 1K73O 5A2QO 4DV5K 4CHPA 4CJFA 4DHYA 2WTUA 3CC4N 1JJ2M 2YI1A 3ZX0A 1Z25A 1RT7A 4W5QA 3P39A 4M42A 1HYZA 2Q0UA 1J6ZA 3ULEA 1I94K 1SS6A 3CJAA 3C0BA 5BPLA 4I9LA 1ZC6A 1RTJA 3HI0A 4K0KK 2HNYA 1C0FA 2NNWA 4CZFA 4WF9L 1HRHA 1EXQA 3I0SA 3JSMA 1FJGK 5KPRA 1LV5A 1WSIA 5JVHL 3KIOA 3CCUN 4UY8O 1HNVA 2HHVA 5JLHA 3WNGA 1IO2A 1WAJA 2DPNA 4M3RA 1RBRA 2OPRA 2P9IB 2ZJPL 2OPPA 3AVJA 4NLCA 3RRHA 5AQFA 3M5RA 1SZ2A 3KK7A 4ISFA 5GADP 1NJYA 1OH8A 1J54A 2HVIA 5M1KA 1RBVA 1K8AO 3O80A 1KVAA 1ZBLA 3OBYA 3QB0A 4CJEA 3HVRA 3HRGA 4B1UB 3AVLA 4PL7A 4E89A 1A5WA 4H5TA 4O8UA 1B92A 3O1WA 3O4NA 2HF3A 3VGLA 4FCYA 4H5NA 4FK4A 3AA5X 3OYNA 3KKRA 1L5UA 4CBUA 3TAQA 1CZBA 1NLVA 4DU1A 3CIPA 4DS4A 4CK3A 3LP3A 3F73A 4F8RA 3D7EO 3WXJA 4FWQA 4CJVA 3RSEB 3KZBA 3T1AA 1KVCA 4JKCA 3ENHA 5H1SQ 5KRSA 1MWMA 4IG3A 2XY7A 3WXKA 4HUFA 3MEGA 3R6MA 2XO7A 4FJ7A 4OLAA 4W5NA 1KLMA 3VEVA 3QEVA 5C2FA 3KLIA 2I7PA 3ZYYX 4IBNA 2OANA 4ZTJA 4IEIA 1HYSA 1VQ4N 3QDKA 3WXLA 2HNZA 4DR5K 2EWSA 4GV9A 5EX5A 3WXMB 5FLXO 4MLEA 3A8YA 1TAUA 1SAZA 3LZIA 1HNIA 4DR2K 1VSFA 2P9LB 3CETA 4XH1A 2IC3A 3V1QA 2UYTA 2IVPA 3C6HA 3M8SA 2KZZA 4A61A 4YOTA 4FWLA 4BGBA 2O8BB 1N33K 4KHYA 2G8KA 4HWIA 4QAGA 4U67L 5BRDA 1RTDA 4DQPA 1DTTA 1LW0A 1RILA 4JKAA 1IBMK 3E9OA 5C10A 1U04A 4E7IA 3W0LA 4DQQA 2FLOA 3BZCA 3MCAB 4AHCA 4CJ4A 1IH7A 2O4IA 4F3TA 2AA4A 3OJUA 1NOZA 4OGEA 1YUWA 2F9TA 4QS8A 1VQ5N 5F0XA 1KC8O 2DFEA 2RN2A 4LSNA 5BR8K 2UXDK 3EZ5A 2A5XA 1N5YA 2HHUA 1C0TA 2ASOA 4AHVA 3UB5A 4GV3A 2KQ2A 4CEZA 4JS4A 1XC3A 2NUBA 4CIEA 5BREA 4WFBL 4A2BA 1TL3A 2P9PA 1M90O 2CH5A 3P31A 4B9SA 5AQNA 4BRIA 4E7HA 4JK7A 1QTMA 5JS1A 4IG0A 3DRSA 3HM9A 3K9JA 4JI7K 3CCSN 5BN8A 1KRPA 4DFMA 3AVAA 3M8PA 1D9FA 4H0VB 4EZ6A 4PY5A 3NMUA 4EFHA 4DV1K 2NLXA 2QWQA 4ELUA 5CE3A 4M3YA 4OKKA 5GIOA 4C1NI 1VSIA 1X1PA 3CFOA 2UXBK 2D0PA 3L2VA 3V9ZA 4DLGA 1NGDA 2OYQA 4CEOA 3ZSZA 1C0GA 5KGXA 3S3MA 1TK0A 2QXFA 5DM6L 3NF9A 1KFDA 3A5OC 3VQ4A 3K5NA 4WFNL 4BR9A 3PX0A 3OYBA 2ETJA 4BRLA 4EAHD 4BVOA 1BA0A 3AY9A 1SUQA 2GWKA 1HJOA 1BI4B 2G8UA 3AAPA 2ASPA 1ZYQA 3DXMB 2O8DB 4CZLA 3OS0A 2O8FB 3ZT0A 2QWMA 3G25A 1LOTB 3AVIA 1VQ7N 1JLQA 2F8TA 5C15A 4JKEA 3K5OA 5HRPA 1WOQA 3O8MA 3SJJA 2OPQA 4K41A 4LF7K 1JLBA 5FPEA 4YDUC 2ZD1A 4H5WA 4JRPA 3VERA 3AVKA 1DKGD 2HW3A 1IG8A 5J2MA 5LMUK 3GBTA 4JKFA 4BGAA 4CHQA 1JCGA 1R0AA 3DXMA 4XIUA 2O8DA 1A5XA 1X3MA 2QXLA 2O8FA 3QNNA 3OTOK 3SK3A 1S9EA 1S3XA 1BIZA 1YVNA 4WQ5C 4DMNA 3DRPA 3V9UA 3SPZA 1NJIO 3DI6A 3O4WA 1OH7A 4MO4A 3I8DA 1Q81O 1S6QA 4LFCK 4CGDA 1QSSA 2ASMA 1FK9A 1N36K 1J9AA 4L3QA 5GAGP 1X9MA 3TU5A 3DLBA 2YNHA 3TAGA 2HBKA 4YOXA 1QZ6A 3VEYA 4BDPA 4QCLA 3HSCA 2G8WA 4FJLA 1A5VA 3NFAA 3QIPA 3OA9A 1G99A 4K8XA 3SQ0A 2KHOA 5BPMA 3Q7CA 5HRRA 2FBXA 4LH5A 2F4VK 1SKRA 4CHOA 2VGNA 3K9KA 3A5MC 2YHBA 3QINA 4CFAA 5I42A 1X9WA 3CCRN 2EX3A 2QW9A 2W6LA 3EEQA 1K9MO 4KHUA 3OYEA 1BQMA 1KXPA 3CJ7A 2XHBA 3TARA 3T1YK 4E19A 3M1FA 1JXEA 4DTMA 3I8BA 5AQGA 4CGHA 3AA2A 1L3UA 3RR7A 2QWRA 1MWKA 4E0DA 4A5BA 4C23A 5MLCQ 1UWBA 4E7JA 5C0YA 4BC5A 3NE6A 1BWFO 4FJMA 3M8RA 1YTUA 2KFNA 3DLGA 4J8FA 4J2BA 3VTHA 3AV9A 4HTLA 3UKUB 3CCEN 2WUSA 3L2RA 2BH1A 3LDOA 3HBTA 1NMNA 1RFQA 3KWIA 2E1YA 4M7YA 3MK6A 4LF5K 1GLCG 2YKMA 2J4RA 1WUAA 5CHIA 4CEFA 4NO7A 1EWRA 1FKOA 4FZXC 2YNIA 3NF6A 4AILC 2BDPA 3C94A 3MWPA 3QNOA 1YTAA 4X65K 2E5LK 3LPTA 3QEPA 2IVNA 1JLAA 3EE8A 1WN7A 3TR8A 3U3YA 4BRQA 4DSFA 1YJNN 4FJ5A 3EE9A 4B3OA 1VQPN 4KH4A 3KHYA 2OZMA 3FFIA 3JXUA 1GLLO 3UKUA 4CIFA 4JKBA 2NRTA 2VQEK 1GLBG 3WNHA 4DQ8A 2E6MA 2NRXA 3H3OB 1VK0A 4I7FA 4WQ4C 3AO4A
chains in the Genus database with same CATH topology
1KVBA 1WSHA 3SZ2A 3ZSYA 4CJTA 1J53A 4LD0A 4CJSA 3D45A 3L8BA 4DSIA 4KI4A 4BE1A 4Z4IA 3ASMA 3ZSVA 1FKPA 2X78A 4B9UA 5D3GA 4C8LA 3OVNA 3KLFA 1C0MA 2IGIA 4OGCA 4ID5A 4OVLA 1JXBA 1XHXA 4FLWA 2R7YA 1IKWA 4CJ5A 3AO2A 3B6PA 1TK5A 1D9DA 5HROA 4I2PA 1N6QA 1LWFA 3MXMA 4HCBA 4IFYA 4CHPA 4CJFA 3CM6A 4FK0A 3WNFA 3MECA 3AA3A 4BWMA 4KB1A 4H8KA 1NJXA 1Z25A 3CG7A 1ASWA 1RT7A 4GMJB 3DLRA 4O55A 4W5QA 4KB0A 4M42A 1L3VA 1HYZA 4Z4EA 2KZMA 2Y1IA 4YNQA 1XHZA 3ZSOA 3MEDA 5SWMA 3IAYA 4FW1A 4B8AB 4CK1A 3SI6A 4FM2A 4I9LA 1C1AA 1VSMA 1UOCA 1U47A 2HHXA 3V1OA 1RTJA 2HNYA 3TAFA 1RT4A 4RW7A 4DTRA 1CLQA 1ITGA 3O3HA 1HRHA 1EXQA 3LZJA 3I0SA 3JSMA 1UA0A 1KCFA 1LV5A 4J2DA 4CEQA 4CHYA 3V6DA 4FZZA 1RBTA 1WSIA 3KIOA 4CF0A 1HNVA 2HHVA 2D0AA 2E4LA 1RDBA 3WNGA 1IO2A 1WAJA 1UA1A 2BGGA 4M3RA 3K5LA 1RBRA 2OPRA 4M3TA 3HPOA 1RCHA 2OPPA 3AVJA 4N47A 5FRMA 3RRHA 4PWDA 4W5OA 4W5RA 2DFHA 2QK9A 1FXXA 1NJYA 4N76A 1J54A 2HVIA 4KTQA 3I0RA 4O0JA 4C8NA 4DSEA 1O1WA 1RBVA 2VG5A 4KFBA 3LP2A 3LANA 4Y1CA 3VA3A 1JLEA 1KVAA 1NK0A 3ZSRA 1XI1A 1ZBLA 3L2WA 4CJEA 3HVRA 4L8RB 5JS2A 3AVLA 4DTJA 3V9XA 1BGXT 4E89A 1A5WA 1S5JA 4R5PA 1RNHA 3RRGA 1B9FA 2HNDA 3VQ9A 1ZBIA 3RMBA 1B92A 1W9HA 3AO1A 1BCMA 4BDYA 4DTNA 4DTXA 3O4NA 2FBYA 3KK1A 4FCYA 2RPIA 3SUNA 3HK2A 4FK4A 2IS3A 3AA5X 3H08A 3OYNA 4OPJA 1NK9A 1U4BA 3KKRA 3VA0A 4DFKA 5J2QA 4IKFA 1L5UA 5HP1A 3AO5A 1HQUA 4J2AA 3TAQA 2OPSA 5E41A 5K14A 1CZBA 3ZT2A 1CXUA 3AO3A 3SNNA 1Q9YA 4DU1A 3QEXA 1D5AA 4DS4A 4CK3A 3LP3A 4FJ8A 3F73A 4F8RA 1HPZA 4NCGA 4CJVA 4FLVA 4OJRA 2DFFA 4CJLA 4Z4HA 1RTHA 4H4OA 4DFPA 3TAEA 3T1AA 1KVCA 4DSKA 3IRXA 1ZBFA 1TGOA 3S3NA 2Y1JA 3OYDA 5KI6A 4DWIA 1KLNA 1RT1A 5KRSA 3DLKA 4F4KA 3OYMA 1SL2A 4IG3A 5EU7A 1JKHA 2XY7A 1C0UA 4I2QA 3VQ7A 3WNEA 4HUFA 3MEGA 3K5MA 1KSPA 4FZYA 4CJRA 3KLEA 4N41A 2XO7A 1X9SA 3M8QA 5HRNA 3NGIA 1ZBUA 4FJ7A 4OLAA 4W5NA 1YT3A 4FJIA 1KLMA 2YKNA 3MXJA 5CY4A 3KLIA 3QEVA 4CECA 1S1UA 4IBNA 1MU2A 5C24A 4HHTA 4ZTJA 1HYSA 2ZE2A 2P5GA 4KTZA 4KV8A 2FC0A 2HNZA 2HHTA 1UAXA 1QSYA 3C95A 4FLYA 3IG1A 5CZ1A 2I5JA 1C1CA 4CJUA 3L2UA 3VQEA 4DS5A 1JLCA 4FJ9A 1TAUA 2E6LA 1J5OA 1JLFA 4E7KA 3LZIA 1HNIA 4DSLA 3QEWA 4F2SA 1EP4A 1VSFA 1DTQA 4Z4FA 1SKSA 4RW9A 1TKDA 4OLBA 2IC3A 5C25A 1RT2A 3V1RA 4LSLA 3V1QA 3SV3A 1VRTA 3M8SA 1HMVA 3QLHA 2KZZA 4PUOA 4M45A 4CGFA 3DOLA 4RG8A 2KFZA 5J2PA 1GOAA 4IDKA 3ZCMA 1BI4A 3G0ZA 3NH1A 4KHYA 2G8KA 2DY4A 1S6PA 3OS1A 3KK3A 4AHRA 1GOCA 4QAGA 4F2RA 4O4GA 5CYQA 4DTPA 1RTDA 4DQPA 1DTTA 2QKBA 1LW0A 4RW6A 5CZ2A 1RILA 3DLHA 1NKEA 2VG7A 2VWJA 3O4QA 4CEDA 4DTSA 1U04A 1KFSA 4E7IA 3KKSA 4DQQA 3T3FA 4DU4A 1Z26A 4CGGA 3LWLA 4AHCA 4BACA 3CYMA 4CJ4A 1IH7A 3DM2A 3L3UA 2O4IA 3QESA 3C6TA 4O44A 4DF8A 4F3TA 3DOKA 1NOZA 4OGEA 3OJUA 3THVA 4KREA 3ALYA 4NYNA 3A2FA 3QETA 3S3OA 1LWEA 1RT6A 4M3WA 2DFEA 2RN2A 4DG1A 3RMDA 3VQDA 4HCCA 4IFVA 4LSNA 3QO9A 3KTQA 2P5OA 1REVA 4CJQA 2G8IA 1NKBA 1VSJA 3LAKA 2W42A 3EZ5A 5CYMA 3RTVA 3SUOA 1N5YA 2HHUA 1C0TA 4FJJA 1CZ9A 4AHVA 4CJKA 2KTQA 2KQ2A 4H4MA 4C8MA 1LAVA 4CEZA 1NK7A 3OYLA 2NUBA 4CIEA 4JS4A 4AHTA 4CEBA 1U45A 1TL3A 1T8EA 1QE1A 3HVTA 1TV6A 2PYJA 2VG6A 3NF8A 4KTWA 5KRTA 3CQ8A 3LAMA 5KGWA 3ULDA 4B9SA 4KHWA 1C6VA 4E7HA 1QTMA 3HSTB 4CHNA 5JS1A 3IS9A 3NH0A 4IG0A 3DRSA 4AH9A 4E1MA 3HM9A 2XY8A 1F21A 4NCBA 2B4JA 3QIOA 1QS4A 4N5SA 2G8HA 3HL8A 1KRPA 2BE2A 3NF7A 4DFMA 3NBPA 4LH4A 3AVAA 1WLJA 4FVMA 3M8PA 3TI0A 3VN5A 1NK5A 1D9FA 4EZ9A 4EZ6A 4PY5A 4FW2A 4QOZB 3AVNA 4KI6A 3HJFA 1BHLA 1S1XA 4FM0A 4HVJA 4FM1A 4ELUA 5DMRA 4AHSA 2A1SA 4HTUA 1IKYA 1BL3A 4B8CA 4B9LA 4M3YA 4CF1A 4CGIA 4OKKA 3L2QA 2G8FA 4C8OA 4ELVA 4E3SA 1TKXA 1VSIA 3NAEA 3OYJA 1T7PA 1I39A 1I3AA 4KHQA 1WSGA 1X1PA 3CFOA 3P1GA 1K6YA 1BCOA 3K2PA 3L2VA 1C1BA 4DLGA 3V9ZA 1WNSA 2OYQA 4CERA 1IKVA 3HXMA 4E7LA 3HP6A 4CEOA 3ZSZA 5KGXA 3V4IA 3PO5A 2YNGA 4CHZA 1T03A 3S3MA 1TK0A 2QXFA 3HP9A 3ZSWA 3RMAA 4FJGA 3NF9A 4FLTA 4B9TA 3ZSXA 1KFDA 1VSDA 2Z1JA 3VQ4A 3PX6A 3K5NA 4BE0A 3VQPA 2IOCA 1SV5A 2YNFA 3PX0A 3AVMA 3KD5E 3OYBA 3OJSA 4B9VA 2ETJA 4KHNA 4MQ3A 3QERA 3OYIA 3HPHA 3K57A 4Q0BA 1SUQA 3AVFA 1BI4B 2G8UA 2JGUA 1ZYQA 2Z1GA 3K58A 3S9HA 3SUQA 1T05A 3OS0A 4B08A 4DFJA 1BIUA 3LP0A 3ZT0A 1S9GA 5SZTA 2HB5A 3VQQA 4M3XA 3NGYA 3AVIA 3K59A 5FDLA 5J1EA 1RBSA 1LWCA 4RW8A 1EETA 2GUIA 1JLQA 3OYAA 4LY7A 1NK4A 4ZTFA 2F8TA 2AJQA 4DQIA 3P5JA 3K5OA 5HRPA 2Z1IA 4ICLA 4Q5VA 1RDAA 3SJJA 2OPQA 4OKEA 5J2NA 2HHSA 2O4GA 4FXDA 3TAPA 1JLBA 1SL1A 1L3SA 3ZT4A 2ZD1A 3P83D 3O3FA 4WE1A 3VQBA 4JRPA 4GW6A 3AVKA 2ITGA 1HJRA 1XWLA 3RWUA 2X74A 4C8KA 3U6FA 1NK8A 2OA8A 2GBZA 3PUFA 3O3GA 2HW3A 2B5JA 2IAJA 3E01A 3MAQA 4KKOA 4CF2A 1VSKA 5J2MA 2Z1HA 4CJ3A 1NK6A 1VSEA 3SUPA 4CHQA 3NCIA 1R0AA 3SCXA 3VQ8A 2XRIA 2OZSA 4XIUA 3NH2A 1A5XA 3SPYA 4DQSA 3QNNA 4Z4CA 3LP1A 1S9EA 3OY9A 1NJWA 1G15A 3AVHA 1BIZA 4DMNA 4KHSA 3KD1E 3DRPA 4O5BA 3V9UA 3D0PA 3SPZA 3QEIA 4MFBA 3KK2A 3LALA 1NJZA 3OYFA 3DI6A 3AVGA 4CFCA 3V9SA 1W0HA 4UQGA 2YHAA 1BISA 2GV9A 2RKIA 3I8DA 1S6QA 3NDKA 4DLEA 3ZSQA 4CGJA 1JL2A 4CGDA 5HLFA 1QSSA 1FK9A 5FROA 4FLXA 3PV8A 1J9AA 1RBUA 1HYVA 1X9MA 4G1QA 2A1RA 1TK8A 2HVHA 4TSXA 3RR8A 3EYZA 2YNHA 3DLBA 4CF9A 1TKZA 3TAGA 4DQRA 3MXIA 4QCLA 3LPUA 4BWJA 3KLGA 4BDPA 4FJLA 2G8WA 4HUGA 1A5VA 4KO0A 3LWMA 2IDOA 3LDSA 4CK2A 3OYGA 1S1WA 4JS5A 3NFAA 1RDDA 2FBTA 3QIPA 3SQ1A 4FYDA 1XC9A 2KW4A 2WONA 3T19A 4YFUA 2FBVA 3SQ0A 2PY5A 4K8XA 2XY6A 2G8VA 2DTUA 5HRRA 1RTIA 2FBXA 2ZQBA 2XY5A 4LH5A 3RMCA 1WSEA 1SKRA 4FJXA 4CHOA 4CJPA 2HHWA 1EX4A 4BE2A 4GVMA 3ZT1A 3ITHA 3OYCA 1D8YA 4M3ZA 3KLHA 1VSHA 4KAZA 3VQ6A 2YHBA 3QINA 3U3GA 4CFAA 3DMJA 2B6AA 1ASVA 5HRSA 5I42A 1X9WA 2PYLA 4FK2A 4NCAA 4F3OA 3OS2A 2EX3A 4FJHA 4KHUA 3OYEA 1BQMA 2X6NA 1TL1A 3SQ4A 1Q9XA 2XHBA 3TARA 4DTOA 1HQEA 4M41A 3V9WA 4CE9A 1NOYA 2D0BA 3OYKA 4E19A 2D0CA 1DLOA 3B6OA 3TABA 1TKTA 3PO4A 1JXEA 1QQCA 4FJNA 2P51A 4DTMA 4KRFA 2WOMA 3HO1A 4RW4A 4Z0UA 4CGHA 3AA2A 1JL1A 2HMIA 1L3UA 3RR7A 4N56A 3JYTA 1S1TA 4OPKA 4B9NA 4E0DA 3HPGA 4CF8A 4CCHA 3HT3A 4E1NA 4JRQA 4DF4A 1Y97A 4FLZA 1UWBA 4E7JA 4DU3A 3DLEA 3NE6A 4PQUA 3BGRA 4CJWA 1CXQA 1LW2A 3M8RA 3TWHA 4FJMA 1ZBHA 2P1JA 1YTUA 4DTUA 2KFNA 1WSFA 2YV0X 3DLGA 4CEAA 4J2BA 4Y1DA 1TVRA 1RT5A 4ID1A 3VQCA 3AV9A 1RT3A 3F9KA 5I3UA 1QSLA 1RDCA 3PY8A 1U48A 4Z4GA 3C6UA 4FJKA 4J2EA 4CFDA 2VWKA 4I9QA 3ISNC 3CFRA 3AVBA 3L2RA 3SQ2A 3SYZA 2Q3SA 3EY1A 3OYHA 2QKKA 3MEEA 3DYAA 2YKMA 4AHUA 1S1VA 3DRRA 4CEFA 5KTQA 4HUEA 5FRNA 1FKOA 3VQ5A 4FZXC 1IKXA 3VQAA 2YNIA 4CFBA 3NF6A 1WAFA 1NKCA 4AILC 2BDPA 3C94A 3QNOA 1YTAA 4K8ZA 2HHQA 1KTQA 1ASUA 1BQNA 4O0IA 3TANA 1SKWA 3UIQA 1YVUA 4CEEA 3PX4A 3LPTA 2D5RA 1L3TA 4CESA 3ZT3A 1TAQA 1WSJA 4BDZA 3QEPA 4JLHA 2F96A 4PA1A 1JLAA 1QHTA 2ATQA 4W5TA 1WN7A 3TR8A 4B9MA 3U3YA 1IG9A 4DSFA 5C42A 3TAMA 4FJ5A 1GOBA 1Q8IA 5T7BA 3BDPA 4B3OA 2BANA 3CM5A 2OZMA 2RF2A 2X6SA 3FFIA 4FLUA 2PZSA 1JLGA 2EHGA 1EKEA 4KPYA 4DSJA 4EP5A 2JLEA 3V81A 4EP4A 4CIFA 3G10A 3NHGA 5DK5A 3CFPA 4NYFA 3AVCA 1LAWA 3NGZA 3SV4A 1U49A 4CIGA 4ELTA 3HYFA 1VRUA 3L3VA 4OKJA 5HBMA 3WNHA 2LSNA 1VSLA 1B9DA 4ZHRA 2E6MA 4M3UA 2F8SA 1VK0A 1SL0A 3KJVA 4I7FA 3AA4A 3AO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVB A;  1WSH A;  3SZ2 A;  3ZSY A;  4CJT A;  1J53 A;  4LD0 A;  4CJS A;  3D45 A;  3L8B A;  4DSI A;  4KI4 A;  4BE1 A;  4Z4I A;  3ASM A;  3ZSV A;  1FKP A;  2X78 A;  4B9U A;  5D3G A;  4C8L A;  3OVN A;  3KLF A;  1C0M A;  2IGI A;  4OGC A;  4ID5 A;  4OVL A;  1JXB A;  1XHX A;  4FLW A;  2R7Y A;  1IKW A;  4CJ5 A;  3AO2 A;  3B6P A;  1TK5 A;  1D9D A;  5HRO A;  4I2P A;  1N6Q A;  1LWF A;  3MXM A;  4HCB A;  4IFY A;  4CHP A;  4CJF A;  3CM6 A;  4FK0 A;  3WNF A;  3MEC A;  3AA3 A;  4BWM A;  4KB1 A;  4H8K A;  1NJX A;  1Z25 A;  3CG7 A;  1ASW A;  1RT7 A;  4GMJ B;  3DLR A;  4O55 A;  4W5Q A;  4KB0 A;  4M42 A;  1L3V A;  1HYZ A;  4Z4E A;  2KZM A;  2Y1I A;  4YNQ A;  1XHZ A;  3ZSO A;  3MED A;  5SWM A;  3IAY A;  4FW1 A;  4B8A B;  4CK1 A;  3SI6 A;  4FM2 A;  4I9L A;  1C1A A;  1VSM A;  1UOC A;  1U47 A;  2HHX A;  3V1O A;  1RTJ A;  2HNY A;  3TAF A;  1RT4 A;  4RW7 A;  4DTR A;  1CLQ A;  1ITG A;  3O3H A;  1HRH A;  1EXQ A;  3LZJ A;  3I0S A;  3JSM A;  1UA0 A;  1KCF A;  1LV5 A;  4J2D A;  4CEQ A;  4CHY A;  3V6D A;  4FZZ A;  1RBT A;  1WSI A;  3KIO A;  4CF0 A;  1HNV A;  2HHV A;  2D0A A;  2E4L A;  1RDB A;  3WNG A;  1IO2 A;  1WAJ A;  1UA1 A;  2BGG A;  4M3R A;  3K5L A;  1RBR A;  2OPR A;  4M3T A;  3HPO A;  1RCH A;  2OPP A;  3AVJ A;  4N47 A;  5FRM A;  3RRH A;  4PWD A;  4W5O A;  4W5R A;  2DFH A;  2QK9 A;  1FXX A;  1NJY A;  4N76 A;  1J54 A;  2HVI A;  4KTQ A;  3I0R A;  4O0J A;  4C8N A;  4DSE A;  1O1W A;  1RBV A;  2VG5 A;  4KFB A;  3LP2 A;  3LAN A;  4Y1C A;  3VA3 A;  1JLE A;  1KVA A;  1NK0 A;  3ZSR A;  1XI1 A;  1ZBL A;  3L2W A;  4CJE A;  3HVR A;  4L8R B;  5JS2 A;  3AVL A;  4DTJ A;  3V9X A;  1BGX T;  4E89 A;  1A5W A;  1S5J A;  4R5P A;  1RNH A;  3RRG A;  1B9F A;  2HND A;  3VQ9 A;  1ZBI A;  3RMB A;  1B92 A;  1W9H A;  3AO1 A;  1BCM A;  4BDY A;  4DTN A;  4DTX A;  3O4N A;  2FBY A;  3KK1 A;  4FCY A;  2RPI A;  3SUN A;  3HK2 A;  4FK4 A;  2IS3 A;  3AA5 X;  3H08 A;  3OYN A;  4OPJ A;  1NK9 A;  1U4B A;  3KKR A;  3VA0 A;  4DFK A;  5J2Q A;  4IKF A;  1L5U A;  5HP1 A;  3AO5 A;  1HQU A;  4J2A A;  3TAQ A;  2OPS A;  5E41 A;  5K14 A;  1CZB A;  3ZT2 A;  1CXU A;  3AO3 A;  3SNN A;  1Q9Y A;  4DU1 A;  3QEX A;  1D5A A;  4DS4 A;  4CK3 A;  3LP3 A;  4FJ8 A;  3F73 A;  4F8R A;  1HPZ A;  4NCG A;  4CJV A;  4FLV A;  4OJR A;  2DFF A;  4CJL A;  4Z4H A;  1RTH A;  4H4O A;  4DFP A;  3TAE A;  3T1A A;  1KVC A;  4DSK A;  3IRX A;  1ZBF A;  1TGO A;  3S3N A;  2Y1J A;  3OYD A;  5KI6 A;  4DWI A;  1KLN A;  1RT1 A;  5KRS A;  3DLK A;  4F4K A;  3OYM A;  1SL2 A;  4IG3 A;  5EU7 A;  1JKH A;  2XY7 A;  1C0U A;  4I2Q A;  3VQ7 A;  3WNE A;  4HUF A;  3MEG A;  3K5M A;  1KSP A;  4FZY A;  4CJR A;  3KLE A;  4N41 A;  2XO7 A;  1X9S A;  3M8Q A;  5HRN A;  3NGI A;  1ZBU A;  4FJ7 A;  4OLA A;  4W5N A;  1YT3 A;  4FJI A;  1KLM A;  2YKN A;  3MXJ A;  5CY4 A;  3KLI A;  3QEV A;  4CEC A;  1S1U A;  4IBN A;  1MU2 A;  5C24 A;  4HHT A;  4ZTJ A;  1HYS A;  2ZE2 A;  2P5G A;  4KTZ A;  4KV8 A;  2FC0 A;  2HNZ A;  2HHT A;  1UAX A;  1QSY A;  3C95 A;  4FLY A;  3IG1 A;  5CZ1 A;  2I5J A;  1C1C A;  4CJU A;  3L2U A;  3VQE A;  4DS5 A;  1JLC A;  4FJ9 A;  1TAU A;  2E6L A;  1J5O A;  1JLF A;  4E7K A;  3LZI A;  1HNI A;  4DSL A;  3QEW A;  4F2S A;  1EP4 A;  1VSF A;  1DTQ A;  4Z4F A;  1SKS A;  4RW9 A;  1TKD A;  4OLB A;  2IC3 A;  5C25 A;  1RT2 A;  3V1R A;  4LSL A;  3V1Q A;  3SV3 A;  1VRT A;  3M8S A;  1HMV A;  3QLH A;  2KZZ A;  4PUO A;  4M45 A;  4CGF A;  3DOL A;  4RG8 A;  2KFZ A;  5J2P A;  1GOA A;  4IDK A;  3ZCM A;  1BI4 A;  3G0Z A;  3NH1 A;  4KHY A;  2G8K A;  2DY4 A;  1S6P A;  3OS1 A;  3KK3 A;  4AHR A;  1GOC A;  4QAG A;  4F2R A;  4O4G A;  5CYQ A;  4DTP A;  1RTD A;  4DQP A;  1DTT A;  2QKB A;  1LW0 A;  4RW6 A;  5CZ2 A;  1RIL A;  3DLH A;  1NKE A;  2VG7 A;  2VWJ A;  3O4Q A;  4CED A;  4DTS A;  1U04 A;  1KFS A;  4E7I A;  3KKS A;  4DQQ A;  3T3F A;  4DU4 A;  1Z26 A;  4CGG A;  3LWL A;  4AHC A;  4BAC A;  3CYM A;  4CJ4 A;  1IH7 A;  3DM2 A;  3L3U A;  2O4I A;  3QES A;  3C6T A;  4O44 A;  4DF8 A;  4F3T A;  3DOK A;  1NOZ A;  4OGE A;  3OJU A;  3THV A;  4KRE A;  3ALY A;  4NYN A;  3A2F A;  3QET A;  3S3O A;  1LWE A;  1RT6 A;  4M3W A;  2DFE A;  2RN2 A;  4DG1 A;  3RMD A;  3VQD A;  4HCC A;  4IFV A;  4LSN A;  3QO9 A;  3KTQ A;  2P5O A;  1REV A;  4CJQ A;  2G8I A;  1NKB A;  1VSJ A;  3LAK A;  2W42 A;  3EZ5 A;  5CYM A;  3RTV A;  3SUO A;  1N5Y A;  2HHU A;  1C0T A;  4FJJ A;  1CZ9 A;  4AHV A;  4CJK A;  2KTQ A;  2KQ2 A;  4H4M A;  4C8M A;  1LAV A;  4CEZ A;  1NK7 A;  3OYL A;  2NUB A;  4CIE A;  4JS4 A;  4AHT A;  4CEB A;  1U45 A;  1TL3 A;  1T8E A;  1QE1 A;  3HVT A;  1TV6 A;  2PYJ A;  2VG6 A;  3NF8 A;  4KTW A;  5KRT A;  3CQ8 A;  3LAM A;  5KGW A;  3ULD A;  4B9S A;  4KHW A;  1C6V A;  4E7H A;  1QTM A;  3HST B;  4CHN A;  5JS1 A;  3IS9 A;  3NH0 A;  4IG0 A;  3DRS A;  4AH9 A;  4E1M A;  3HM9 A;  2XY8 A;  1F21 A;  4NCB A;  2B4J A;  3QIO A;  1QS4 A;  4N5S A;  2G8H A;  3HL8 A;  1KRP A;  2BE2 A;  3NF7 A;  4DFM A;  3NBP A;  4LH4 A;  3AVA A;  1WLJ A;  4FVM A;  3M8P A;  3TI0 A;  3VN5 A;  1NK5 A;  1D9F A;  4EZ9 A;  4EZ6 A;  4PY5 A;  4FW2 A;  4QOZ B;  3AVN A;  4KI6 A;  3HJF A;  1BHL A;  1S1X A;  4FM0 A;  4HVJ A;  4FM1 A;  4ELU A;  5DMR A;  4AHS A;  2A1S A;  4HTU A;  1IKY A;  1BL3 A;  4B8C A;  4B9L A;  4M3Y A;  4CF1 A;  4CGI A;  4OKK A;  3L2Q A;  2G8F A;  4C8O A;  4ELV A;  4E3S A;  1TKX A;  1VSI A;  3NAE A;  3OYJ A;  1T7P A;  1I39 A;  1I3A A;  4KHQ A;  1WSG A;  1X1P A;  3CFO A;  3P1G A;  1K6Y A;  1BCO A;  3K2P A;  3L2V A;  1C1B A;  4DLG A;  3V9Z A;  1WNS A;  2OYQ A;  4CER A;  1IKV A;  3HXM A;  4E7L A;  3HP6 A;  4CEO A;  3ZSZ A;  5KGX A;  3V4I A;  3PO5 A;  2YNG A;  4CHZ A;  1T03 A;  3S3M A;  1TK0 A;  2QXF A;  3HP9 A;  3ZSW A;  3RMA A;  4FJG A;  3NF9 A;  4FLT A;  4B9T A;  3ZSX A;  1KFD A;  1VSD A;  2Z1J A;  3VQ4 A;  3PX6 A;  3K5N A;  4BE0 A;  3VQP A;  2IOC A;  1SV5 A;  2YNF A;  3PX0 A;  3AVM A;  3KD5 E;  3OYB A;  3OJS A;  4B9V A;  2ETJ A;  4KHN A;  4MQ3 A;  3QER A;  3OYI A;  3HPH A;  3K57 A;  4Q0B A;  1SUQ A;  3AVF A;  1BI4 B;  2G8U A;  2JGU A;  1ZYQ A;  2Z1G A;  3K58 A;  3S9H A;  3SUQ A;  1T05 A;  3OS0 A;  4B08 A;  4DFJ A;  1BIU A;  3LP0 A;  3ZT0 A;  1S9G A;  5SZT A;  2HB5 A;  3VQQ A;  4M3X A;  3NGY A;  3AVI A;  3K59 A;  5FDL A;  5J1E A;  1RBS A;  1LWC A;  4RW8 A;  1EET A;  2GUI A;  1JLQ A;  3OYA A;  4LY7 A;  1NK4 A;  4ZTF A;  2F8T A;  2AJQ A;  4DQI A;  3P5J A;  3K5O A;  5HRP A;  2Z1I A;  4ICL A;  4Q5V A;  1RDA A;  3SJJ A;  2OPQ A;  4OKE A;  5J2N A;  2HHS A;  2O4G A;  4FXD A;  3TAP A;  1JLB A;  1SL1 A;  1L3S A;  3ZT4 A;  2ZD1 A;  3P83 D;  3O3F A;  4WE1 A;  3VQB A;  4JRP A;  4GW6 A;  3AVK A;  2ITG A;  1HJR A;  1XWL A;  3RWU A;  2X74 A;  4C8K A;  3U6F A;  1NK8 A;  2OA8 A;  2GBZ A;  3PUF A;  3O3G A;  2HW3 A;  2B5J A;  2IAJ A;  3E01 A;  3MAQ A;  4KKO A;  4CF2 A;  1VSK A;  5J2M A;  2Z1H A;  4CJ3 A;  1NK6 A;  1VSE A;  3SUP A;  4CHQ A;  3NCI A;  1R0A A;  3SCX A;  3VQ8 A;  2XRI A;  2OZS A;  4XIU A;  3NH2 A;  1A5X A;  3SPY A;  4DQS A;  3QNN A;  4Z4C A;  3LP1 A;  1S9E A;  3OY9 A;  1NJW A;  1G15 A;  3AVH A;  1BIZ A;  4DMN A;  4KHS A;  3KD1 E;  3DRP A;  4O5B A;  3V9U A;  3D0P A;  3SPZ A;  3QEI A;  4MFB A;  3KK2 A;  3LAL A;  1NJZ A;  3OYF A;  3DI6 A;  3AVG A;  4CFC A;  3V9S A;  1W0H A;  4UQG A;  2YHA A;  1BIS A;  2GV9 A;  2RKI A;  3I8D A;  1S6Q A;  3NDK A;  4DLE A;  3ZSQ A;  4CGJ A;  1JL2 A;  4CGD A;  5HLF A;  1QSS A;  1FK9 A;  5FRO A;  4FLX A;  3PV8 A;  1J9A A;  1RBU A;  1HYV A;  1X9M A;  4G1Q A;  2A1R A;  1TK8 A;  2HVH A;  4TSX A;  3RR8 A;  3EYZ A;  2YNH A;  3DLB A;  4CF9 A;  1TKZ A;  3TAG A;  4DQR A;  3MXI A;  4QCL A;  3LPU A;  4BWJ A;  3KLG A;  4BDP A;  4FJL A;  2G8W A;  4HUG A;  1A5V A;  4KO0 A;  3LWM A;  2IDO A;  3LDS A;  4CK2 A;  3OYG A;  1S1W A;  4JS5 A;  3NFA A;  1RDD A;  2FBT A;  3QIP A;  3SQ1 A;  4FYD A;  1XC9 A;  2KW4 A;  2WON A;  3T19 A;  4YFU A;  2FBV A;  3SQ0 A;  2PY5 A;  4K8X A;  2XY6 A;  2G8V A;  2DTU A;  5HRR A;  1RTI A;  2FBX A;  2ZQB A;  2XY5 A;  4LH5 A;  3RMC A;  1WSE A;  1SKR A;  4FJX A;  4CHO A;  4CJP A;  2HHW A;  1EX4 A;  4BE2 A;  4GVM A;  3ZT1 A;  3ITH A;  3OYC A;  1D8Y A;  4M3Z A;  3KLH A;  1VSH A;  4KAZ A;  3VQ6 A;  2YHB A;  3QIN A;  3U3G A;  4CFA A;  3DMJ A;  2B6A A;  1ASV A;  5HRS A;  5I42 A;  1X9W A;  2PYL A;  4FK2 A;  4NCA A;  4F3O A;  3OS2 A;  2EX3 A;  4FJH A;  4KHU A;  3OYE A;  1BQM A;  2X6N A;  1TL1 A;  3SQ4 A;  1Q9X A;  2XHB A;  3TAR A;  4DTO A;  1HQE A;  4M41 A;  3V9W A;  4CE9 A;  1NOY A;  2D0B A;  3OYK A;  4E19 A;  2D0C A;  1DLO A;  3B6O A;  3TAB A;  1TKT A;  3PO4 A;  1JXE A;  1QQC A;  4FJN A;  2P51 A;  4DTM A;  4KRF A;  2WOM A;  3HO1 A;  4RW4 A;  4Z0U A;  4CGH A;  3AA2 A;  1JL1 A;  2HMI A;  1L3U A;  3RR7 A;  4N56 A;  3JYT A;  1S1T A;  4OPK A;  4B9N A;  4E0D A;  3HPG A;  4CF8 A;  4CCH A;  3HT3 A;  4E1N A;  4JRQ A;  4DF4 A;  1Y97 A;  4FLZ A;  1UWB A;  4E7J A;  4DU3 A;  3DLE A;  3NE6 A;  4PQU A;  3BGR A;  4CJW A;  1CXQ A;  1LW2 A;  3M8R A;  3TWH A;  4FJM A;  1ZBH A;  2P1J A;  1YTU A;  4DTU A;  2KFN A;  1WSF A;  2YV0 X;  3DLG A;  4CEA A;  4J2B A;  4Y1D A;  1TVR A;  1RT5 A;  4ID1 A;  3VQC A;  3AV9 A;  1RT3 A;  3F9K A;  5I3U A;  1QSL A;  1RDC A;  3PY8 A;  1U48 A;  4Z4G A;  3C6U A;  4FJK A;  4J2E A;  4CFD A;  2VWK A;  4I9Q A;  3ISN C;  3CFR A;  3AVB A;  3L2R A;  3SQ2 A;  3SYZ A;  2Q3S A;  3EY1 A;  3OYH A;  2QKK A;  3MEE A;  3DYA A;  2YKM A;  4AHU A;  1S1V A;  3DRR A;  4CEF A;  5KTQ A;  4HUE A;  5FRN A;  1FKO A;  3VQ5 A;  4FZX C;  1IKX A;  3VQA A;  2YNI A;  4CFB A;  3NF6 A;  1WAF A;  1NKC A;  4AIL C;  2BDP A;  3C94 A;  3QNO A;  1YTA A;  4K8Z A;  2HHQ A;  1KTQ A;  1ASU A;  1BQN A;  4O0I A;  3TAN A;  1SKW A;  3UIQ A;  1YVU A;  4CEE A;  3PX4 A;  3LPT A;  2D5R A;  1L3T A;  4CES A;  3ZT3 A;  1TAQ A;  1WSJ A;  4BDZ A;  3QEP A;  4JLH A;  2F96 A;  4PA1 A;  1JLA A;  1QHT A;  2ATQ A;  4W5T A;  1WN7 A;  3TR8 A;  4B9M A;  3U3Y A;  1IG9 A;  4DSF A;  5C42 A;  3TAM A;  4FJ5 A;  1GOB A;  1Q8I A;  5T7B A;  3BDP A;  4B3O A;  2BAN A;  3CM5 A;  2OZM A;  2RF2 A;  2X6S A;  3FFI A;  4FLU A;  2PZS A;  1JLG A;  2EHG A;  1EKE A;  4KPY A;  4DSJ A;  4EP5 A;  2JLE A;  3V81 A;  4EP4 A;  4CIF A;  3G10 A;  3NHG A;  5DK5 A;  3CFP A;  4NYF A;  3AVC A;  1LAW A;  3NGZ A;  3SV4 A;  1U49 A;  4CIG A;  4ELT A;  3HYF A;  1VRU A;  3L3V A;  4OKJ A;  5HBM A;  3WNH A;  2LSN A;  1VSL A;  1B9D A;  4ZHR A;  2E6M A;  4M3U A;  2F8S A;  1VK0 A;  1SL0 A;  3KJV A;  4I7F A;  3AA4 A;  3AO4 A; 
#chains in the Genus database with same CATH topology
 3D45 A;  4DV6 K;  4GKK K;  3U8X A;  2IGI A;  4ID5 A;  4OVL A;  1GLJ O;  1JXB A;  4RWT A;  5LMN K;  3UKR A;  3JAM O;  1NGF A;  1NGE A;  3P38 A;  3B6P A;  4M63 C;  1N6Q A;  3MXM A;  3MEC A;  4KB1 A;  4NLB A;  4GMJ B;  4O55 A;  2PFU A;  2A6A A;  4A59 A;  2KZM A;  1VQ6 N;  3BZK A;  1HR0 K;  3ZSO A;  5SWM A;  4B1W B;  1ESV A;  4CK1 A;  3SI6 A;  1UOC A;  3VGM A;  3V1O A;  3Q7B A;  2IIR A;  2FF3 B;  4NXM K;  5LJV A;  4A5A A;  4CEQ A;  4CHY A;  3CF5 L;  4FZZ A;  1RBT A;  4JI3 K;  4CF0 A;  5AR0 A;  2E4L A;  5AQJ A;  2BGG A;  2OCE A;  3K5L A;  3HPO A;  1RCH A;  5EY4 A;  3VEW A;  4N47 A;  2NRW A;  4W5O A;  3O9T A;  2QK9 A;  5M1F A;  1HLU A;  4KTQ A;  2A42 A;  4DSE A;  4KFB A;  3LP2 A;  4ILH A;  1GLA G;  4Y1C A;  3VA3 A;  5IT9 O;  1NK0 A;  3ZSR A;  1XI1 A;  4YOW A;  1QVF M;  4L8R B;  3E9P A;  4R5P A;  1S5J A;  3RRG A;  1ILY A;  1V4T A;  1W9H A;  4DTN A;  4BQZ A;  3G6E N;  3W3D A;  4IO9 L;  2GUP A;  2QWL A;  2IS3 A;  4LF4 K;  1BO5 O;  1U4B A;  4IKF A;  5J2Q A;  3RVC A;  3AO3 A;  4BRF A;  3QEX A;  4NCG A;  3PIO L;  2DFF A;  4CJL A;  3TAE A;  3ID8 A;  3IRX A;  1QVG M;  4IJA A;  2P9K B;  4CZG A;  3BUZ B;  3VF6 A;  5KI6 A;  4H5R A;  1KLN A;  1RT1 A;  3H46 O;  4DWI A;  2O8E B;  4BVP A;  3OYM A;  1W97 L;  4CVN E;  4H0T B;  1C0U A;  4FZY A;  4N41 A;  3O5B A;  3M8Q A;  5AQO A;  5AQT A;  1YT3 A;  4FJI A;  3EKS A;  3F2K A;  1TYQ A;  3SJH A;  3ULE B;  1S1U A;  4CEC A;  4BC3 A;  4KTZ A;  2FC0 A;  2HHT A;  1QSY A;  2HOE A;  3CJC A;  5M1O A;  3L2U A;  3LM2 A;  4DS5 A;  1JLC A;  4BQL A;  1T6D A;  4GVE A;  4E7K A;  4BG8 A;  4DSL A;  1EP4 A;  4BG9 A;  4YDU A;  1SKS A;  1TKD A;  3J80 O;  3N4Q A;  4YOV A;  1HMV A;  2P9K A;  3HOT A;  4PKI A;  1ATR A;  3HM8 A;  2O8E A;  5J2P A;  1HKC A;  4IDK A;  5JMV A;  2YX6 A;  3VPZ A;  1S6P A;  4BR0 A;  5AQW A;  4F2R A;  5BRH A;  5CYQ A;  4PKG A;  5CZ2 A;  3DLH A;  1NBW A;  2VWJ A;  4DUY K;  1KD1 O;  3CC2 N;  4CED A;  1KFS A;  3TSU A;  4CGG A;  3EN9 A;  3CYM A;  1RDU A;  3SAH A;  1RDW X;  4CI6 A;  3G71 N;  3THV A;  3BP8 A;  2E2O A;  4NYN A;  5GIP A;  4M3W A;  1T44 A;  3VQD A;  3ZLJ A;  4DUZ K;  4CJQ A;  2G8I A;  1NKB A;  3O6W A;  1VSJ A;  5CYM A;  3ATU A;  4GV6 A;  1CZ9 A;  4ILG B;  2KTQ A;  4C8M A;  1NK7 A;  3THY A;  3ZX3 A;  3HVT A;  3HZ6 A;  4FWR A;  2PYJ A;  2PAV A;  4KHW A;  5KGW A;  5BN9 A;  3NH0 A;  1VHX A;  4AH9 A;  4C1N K;  4E1M A;  1F21 A;  1R59 O;  4BRK A;  3AAQ A;  5E26 A;  4NB4 A;  5HOO A;  2G8H A;  3NF7 A;  4EZ9 A;  2V51 B;  1Y64 A;  4YOU A;  1YXQ A;  3FGU A;  4FM1 A;  1U2V B;  1DT9 A;  4AHS A;  1N8R O;  3D6R A;  4HTU A;  4B8C A;  4CF1 A;  4CGI A;  3L2Q A;  2G8F A;  4ELV A;  3M6G A;  3OYJ A;  2QA4 N;  4AM6 A;  3P1G A;  4CER A;  1IKV A;  4E7L A;  4M7X A;  3V4I A;  1T03 A;  3VF2 A;  4CHZ A;  1VQM N;  4FJG A;  3ZSX A;  3VQP A;  2IOC A;  2YNF A;  3AVM A;  3KD5 E;  3CME N;  1HNZ K;  4KHN A;  2P9S B;  3QER A;  4Q0B A;  4B3T K;  2H3G X;  3OHR A;  4A62 A;  1E4G T;  3K58 A;  3S9H A;  2O8C A;  3F9M A;  3THW A;  1T05 A;  3LP0 A;  1U2V A;  4XH4 A;  2HB5 A;  3VQQ A;  4JK8 A;  3VF4 A;  3NGY A;  1RBS A;  4FWK A;  4RW8 A;  1EET A;  3OYA A;  4DQI A;  3P5J A;  4Q5V A;  3OBW A;  1RDA A;  1N32 K;  2HST A;  3PSF A;  2W41 A;  1O13 A;  2KKZ A;  2O4G A;  2QM1 A;  3TAP A;  3QIC A;  3U9D A;  1HJR A;  3RWU A;  2P9U A;  4FWP A;  2E2P A;  3U6F A;  4C8K A;  2GBZ A;  3VEX A;  2W6K A;  2IAJ A;  2YHW A;  5C2D A;  3J81 O;  2P9S A;  2ZGZ A;  1NWK A;  3CJ1 A;  3NCI A;  2P9P B;  2XRI A;  1YHQ N;  2OZS A;  5AQH A;  3SPY A;  4DQS A;  1YJW N;  3LP1 A;  4WQ4 A;  1NJW A;  1G15 A;  4CZE A;  4JI5 K;  1T3V A;  5LY3 A;  4KHS A;  3KD1 E;  3KK2 A;  4GKJ K;  3V9S A;  2YHA A;  3J8A A;  3MMV A;  3QFU A;  2GV9 A;  4IOA L;  3NDK A;  4DLE A;  5AJ3 K;  5HLF A;  3ZEU B;  1BG3 A;  1HYV A;  3CI5 A;  2YHX A;  4G1Q A;  4CF9 A;  4DQR A;  3LPU A;  1VQN N;  3KLG A;  4KO0 A;  2IDO A;  3WEE B;  4CK2 A;  1S1W A;  4BC4 A;  3DJC A;  1S72 N;  3SQ1 A;  3IDH A;  1XC9 A;  2KW4 A;  2PY5 A;  2DTU A;  3VEN A;  2G8V A;  4BRH A;  4B1Y B;  1GLF O;  5KQD A;  4JI4 K;  3VES A;  4CJP A;  4IOX A;  1D8Y A;  3ITH A;  1VSH A;  3VQ6 A;  5HRS A;  2B6A A;  4AF1 A;  4IZ9 A;  4F3O A;  3OS2 A;  4FJH A;  2X6N A;  1TL1 A;  4FWM A;  3CCJ N;  5EVZ A;  1HQE A;  3PIP L;  2YJE A;  4CE9 A;  4H0X B;  3ZEU A;  3OYK A;  2D0C A;  1DLO A;  3B6O A;  3I55 N;  1TKT A;  3TAB A;  1QQC A;  4KRF A;  4RW4 A;  4EHT A;  2VGM A;  1JL1 A;  3JYT A;  1S1T A;  4OPK A;  4B9N A;  1J5E K;  5ADX H;  3HT3 A;  4E1N A;  4FLZ A;  3CJ9 A;  3WEE A;  3D2F A;  3BGR A;  1ZBH A;  2P1J A;  3ATV A;  4DTU A;  3QBX A;  1RT5 A;  4ID1 A;  5I3U A;  2ZJQ L;  3CCM N;  1QSL A;  3PY8 A;  3SMS A;  3TPQ A;  3AVB A;  4AM7 A;  3SYZ A;  2Q3S A;  2QKK A;  2IVO A;  3MEE A;  3DYA A;  3KWG A;  4BRA A;  1S1V A;  4HUE A;  4DR4 K;  5KTQ A;  3GDQ A;  4CFB A;  1FW6 A;  1NKC A;  3CHW A;  1ASU A;  1BQN A;  3TAN A;  3UIQ A;  1ZBS A;  1YVU A;  4ISE A;  4CEE A;  1P8Z A;  1TAQ A;  4OX9 K;  1NGJ A;  1QHT A;  2ATQ A;  2QEX N;  3L4Q A;  1QQM A;  4B9M A;  4JNE A;  1IG9 A;  5C42 A;  5DM7 L;  3BDP A;  3CM5 A;  1NGA A;  4LF6 K;  5F1X A;  3V81 A;  3G10 A;  3NHG A;  3CFP A;  1YF5 L;  3SV4 A;  4CIG A;  1VRU A;  3E9L A;  4RTF D;  2I7N A;  2LSN A;  4M3U A;  4BRC A;  2UUB K;  3AA4 A;  2XY5 A;  5HL7 L;  1WSH A;  3PLA A;  2VYP A;  4CJT A;  1J53 A;  3TSP A;  3S41 A;  4CJS A;  3EL2 A;  3L8B A;  4KI4 A;  4BE1 A;  1FKP A;  2X78 A;  3VTI A;  3OVN A;  3KLF A;  3CCQ N;  3CPE A;  1VQK N;  1WBB A;  1XHX A;  4IOC L;  2R7Y A;  3AO2 A;  1EQY A;  1VQL N;  1LWF A;  4IFY A;  4FK0 A;  3WNF A;  4BWM A;  3AA3 A;  3A0I X;  1ASW A;  2FSJ A;  3DLR A;  3GG4 A;  1L3V A;  2Y1I A;  5BR9 A;  3R3L A;  3EO3 A;  1C1A A;  1VSM A;  1U47 A;  3CJB A;  3TAF A;  4R79 A;  1RT4 A;  4IJN A;  4RW7 A;  1CLQ A;  1ITG A;  1QZ5 A;  1NG9 A;  4CZI A;  5JVG L;  2ZWH A;  3LZJ A;  1WBD A;  1OKJ A;  1UA0 A;  2E88 A;  4IO8 A;  1Q7Y O;  4J2D A;  5LL6 Z;  4A2A A;  3IKM A;  1RDB A;  2V7Z A;  3UE5 A;  4JI6 K;  4WYB A;  5LJW A;  5FRM A;  3MN7 A;  4H0Y B;  2DFH A;  4DR3 K;  1FXX A;  4N76 A;  4U7B A;  1NGB A;  1X9J A;  4B1V A;  1O1W A;  4CD1 A;  3LAN A;  1JLE A;  4Y0W A;  5AQV A;  5AQP A;  4IFE A;  2VCP A;  3L2W A;  2OTJ N;  5JS2 A;  4DTJ A;  1B9F A;  3VQ9 A;  1DGK N;  1ZBI A;  3AO1 A;  1BCM A;  4BDY A;  3TTC A;  4V19 S;  1ATS A;  2HBJ A;  3SUN A;  3HK2 A;  3MX2 A;  1KAZ A;  1IBL K;  3H08 A;  4IDH A;  3VA0 A;  3CD6 N;  1P90 A;  1K8K B;  5K14 A;  4OO1 J;  3ZT2 A;  5ADX A;  4BY9 C;  1CXU A;  3SNN A;  4BC2 A;  4JI0 K;  3O9Q A;  4FJ8 A;  1HPZ A;  3IUC A;  4OJR A;  4H4O A;  1RGI A;  3SAG A;  3IMX A;  1ZBF A;  4MLH A;  1TGO A;  1BA1 A;  2Y1J A;  3S3N A;  3OYD A;  3UKR B;  3T1H K;  3DLK A;  4F4K A;  1SL2 A;  5EU7 A;  1JKH A;  4I2Q A;  3WNE A;  1KSP A;  3K5M A;  4CJR A;  3KLE A;  1VQ9 N;  1X9S A;  5HRN A;  3NGI A;  1ZBU A;  4WCE L;  2YKN A;  5CY4 A;  1U6Z A;  1MU2 A;  1X3N A;  5C24 A;  4HHT A;  3C65 A;  1UAX A;  4KH5 A;  3C95 A;  3DWL A;  4FLY A;  4YHH K;  1HNW K;  4JHD A;  2I5J A;  3M3Z A;  4CJU A;  3LDL A;  1K8K A;  3VQE A;  4FJ9 A;  4DCH A;  2E6L A;  4X62 K;  4BRE A;  1DTQ A;  4O5F A;  3MWT A;  1YAG A;  5AFU A;  1XMO K;  4OLB A;  3SV3 A;  1RT2 A;  3V1R A;  3QLH A;  4FO0 A;  3OW2 M;  4PUO A;  1JCE A;  4RG8 A;  2RE2 A;  3ZCM A;  4JD2 B;  3NH1 A;  4FSV A;  4B1Z A;  1CZA N;  5E84 A;  4O4G A;  4DTP A;  4K43 A;  4RW6 A;  3CC7 N;  4B3S K;  4LF9 K;  1NKE A;  2Q31 A;  2VG7 A;  4LFB K;  4DTS A;  4DV3 K;  3DM2 A;  3L3U A;  3QES A;  1Q18 A;  3FZK A;  4O44 A;  2F7T A;  3VEO A;  3DOK A;  3E66 A;  1Z6R A;  1GLE G;  2HMP A;  4OPA A;  5BRF A;  3QET A;  3S3O A;  1RT6 A;  3QML A;  4BRP A;  2NZT A;  3LDP A;  3RMD A;  2OTL N;  3KTQ A;  2P5O A;  1E3M A;  1EO1 A;  1Q82 O;  3RTV A;  2UXC K;  4RCH A;  4FOE A;  4CJK A;  4OPH A;  2HHS A;  3FE1 A;  1LAV A;  3OYL A;  4JD2 A;  1U45 A;  4CEB A;  3VGK A;  1T8E A;  1TV6 A;  1ZXO A;  4KTW A;  5KRT A;  3LAM A;  3D2E A;  3CQX A;  1C6V A;  2E2Q A;  5FPD A;  3HST B;  3IS9 A;  3E1Y A;  1Z05 A;  2FSN A;  2B4J A;  5AZJ B;  1QS4 A;  4BR7 A;  1DEJ A;  2BE2 A;  3NBP A;  4LH4 A;  3ID6 A;  1JCF A;  1N34 K;  4FVM A;  2A41 A;  3VN5 A;  3TI0 A;  4I6M A;  4QOZ B;  3HJF A;  4KI6 A;  1BHL A;  1S1X A;  2CGL A;  4FM0 A;  1OH5 A;  4HVJ A;  3O9U A;  3L6Q A;  5DMR A;  1TYQ B;  4LC9 B;  2A1S A;  3WXI A;  4B9L A;  2DY4 A;  4CZH A;  4E3S A;  1TKX A;  3NVM A;  1I39 A;  1I3A A;  1W2B M;  3L4I A;  4KHQ A;  1GLD G;  1BCO A;  5IWA K;  2CGK A;  3SBG A;  1WNS A;  4CBW A;  5M1P A;  2VQF K;  1W7A A;  3HP6 A;  2VWB A;  3PO5 A;  2YNG A;  4CZM A;  2RHK A;  2E1Z A;  3B8A X;  3ZSW A;  4FLT A;  4B9T A;  1VSD A;  2Z1J A;  4A57 A;  4CJ7 A;  3PX6 A;  4BE0 A;  3THX B;  1SV5 A;  3TTD A;  2NRH A;  4B9V A;  4BR5 A;  4MQ3 A;  3MX5 A;  5AQQ A;  3ZET B;  3K57 A;  2ZJR L;  1LCU A;  5AZJ A;  4JAX A;  2QWN A;  3SUQ A;  1NGI A;  4DFJ A;  1BIU A;  3DXK B;  3I56 N;  3R9P A;  1YIJ N;  4BRM A;  4M3X A;  3K59 A;  5FDL A;  5J1E A;  4LY7 A;  3J7Z O;  3FR0 A;  1OVQ A;  2UU9 K;  2Z1I A;  4ICL A;  4B1X B;  4KH6 A;  4OKE A;  5J2N A;  3H6E A;  3BY5 A;  4FXD A;  5AQS A;  1SL1 A;  1L3S A;  1KQS M;  3O3F A;  4WE1 A;  4GW6 A;  2ITG A;  1XWL A;  1NGH A;  3THX A;  2V7Y A;  2Q2R A;  3PUF A;  3E01 A;  3L0Q A;  1VSK A;  1NK6 A;  3ZET A;  4CJ3 A;  3THY B;  3SUP A;  2GEL A;  1NMD A;  3VQ8 A;  3C7N B;  3DXK A;  3AVH A;  1EWQ A;  4O5B A;  4DR7 K;  3QEI A;  4DR6 K;  4WQ5 A;  3LAL A;  1XNR K;  4CFC A;  3R8E A;  1W0H A;  4K42 A;  3J7A P;  2W40 A;  1WB9 A;  4CGJ A;  5JLF A;  3PV8 A;  4FLX A;  1RBU A;  2D0O A;  2HVH A;  3EYZ A;  3MXI A;  3F5T A;  4BWJ A;  4HUG A;  3LWM A;  3LDS A;  4FWO A;  3OYG A;  1SQK A;  5M1N A;  1RDD A;  2FBT A;  4FYD A;  4YFU A;  2WON A;  2FBV A;  2XY6 A;  4DV2 K;  1RTI A;  4FJX A;  3RMC A;  1WSE A;  3VET A;  3C7N A;  2JWL A;  4ISG A;  4YY3 K;  4BE2 A;  4GVM A;  3ZT1 A;  4M3Z A;  4DKW A;  3KLH A;  2GX9 A;  3G4S N;  3U3G A;  3C6A A;  3O9S A;  4IEE A;  4DV0 K;  1Q9X A;  3SLC A;  4DTO A;  3V9W A;  4M41 A;  1NOY A;  2O8C B;  2D0B A;  1QQN A;  3THW B;  3FZL A;  2WBN A;  4FJN A;  3MCP A;  4Z0U A;  2HMI A;  4N56 A;  3U4L A;  3HPG A;  4DR1 K;  4CCH A;  4JRQ A;  4DF4 A;  3CCL N;  2NRR A;  3O08 A;  4PQU A;  1CXQ A;  3TSQ A;  3WT0 A;  2YV0 X;  5AQZ A;  4CEA A;  4Y1D A;  1TVR A;  3BF3 A;  4DV7 K;  3BF1 A;  1RDC A;  4Z4G A;  1NM1 A;  1U48 A;  4J2E A;  2P9U B;  2P9N B;  3SQ2 A;  3SBT A;  4AHU A;  2P9I A;  3DRR A;  5CR4 A;  5FRN A;  3VQ5 A;  1S22 A;  1IKX A;  3VQA A;  1WAF A;  1TUU A;  1XUP O;  4K8Z A;  2HHQ A;  1KTQ A;  4O8K A;  4FL9 A;  3ZT3 A;  4BDZ A;  4KHP K;  4JLH A;  4W5T A;  5KPZ A;  3DLL L;  4E1J A;  3WQU A;  2GWJ A;  1GOB A;  1VQO N;  2BAN A;  2X6S A;  4FLU A;  2PZS A;  1JLG A;  2EHG A;  4EP5 A;  2P9N A;  4K25 A;  3NGZ A;  4ELT A;  4JI8 K;  1IBK K;  2ZM6 K;  1VSL A;  1B9D A;  3MDQ A;  3PSI A;  2F8S A;  3ENB A;  4ILJ A;  4GY2 B;  1SL0 A;  3KJV A;  3TTF A;  1KVB A;  3SZ2 A;  3ZSY A;  1QHA A;  4GNI A;  4CBX A;  4LD0 A;  5I9E B;  4DSI A;  3ZSV A;  2UUC K;  3RSE A;  4FWN A;  2HBM A;  5D3G A;  4C8L A;  3NVK A;  4OGC A;  3HTV A;  4YOY A;  5GIN A;  2FSK A;  4WFA L;  4FLW A;  2KLA A;  4G9Z A;  1D9D A;  5HRO A;  4I2P A;  4HCB A;  3CM6 A;  1M1K O;  4H8K A;  1NJX A;  3CG7 A;  4KB0 A;  3I33 A;  2AP1 A;  4Z4E A;  3GL1 A;  3CCV N;  4YNQ A;  4H0O A;  1XHZ A;  4EIA A;  3MED A;  2NRZ A;  2F9W A;  5AQU A;  3IAY A;  5AQR A;  4FW1 A;  4B8A B;  2E20 A;  3D2F B;  4FM2 A;  1D4X A;  2HHX A;  4FPB A;  4DTR A;  3WQT A;  3O3H A;  2HHH K;  2GEM A;  1KCF A;  5AQL A;  3V6D A;  2D1K A;  2P9L A;  4JK9 A;  2D0A A;  3CMA N;  3H1V X;  1UA1 A;  3P4I A;  4M3T A;  4PKH A;  2O8B A;  2ITM A;  4PWD A;  4W5R A;  1IJJ A;  4X64 K;  3I0R A;  4O0J A;  4C8N A;  2VG5 A;  4H03 B;  1NU0 A;  4BR4 A;  1HPM A;  3LM9 A;  3V9X A;  1BGX T;  3MN9 A;  1RNH A;  2CH6 A;  2HND A;  2PBD A;  3RMB A;  4JI1 K;  4BRO A;  5ELZ A;  3K0S A;  4DTX A;  1YIT N;  2FBY A;  5GAE P;  3KK1 A;  3AGR A;  2RPI A;  3AAR A;  4OPJ A;  1NK9 A;  3SMP A;  4AQY K;  4DFK A;  3IFR A;  4J2A A;  5HP1 A;  3AO5 A;  1HQU A;  2OPS A;  5E41 A;  3EKU A;  4LFA K;  1Q9Y A;  2YHY A;  1D5A A;  4FLV A;  4DFP A;  4Z4H A;  1RTH A;  1NGC A;  4B9Q A;  4DSK A;  1KAX A;  1V4S A;  1H1V A;  1ATN A;  2ZGY A;  5AFU H;  3VQ7 A;  4EHU A;  3MXJ A;  3GE1 A;  2ZE2 A;  2P5G A;  4KV8 A;  5EXW A;  4FVU A;  1BOT O;  3IG1 A;  3FZF A;  5CZ1 A;  1C1C A;  4X66 K;  5JIC A;  4KBO A;  5AZI B;  1J5O A;  1JLF A;  3QEW A;  4F2S A;  4Z4F A;  4FOI A;  3ENO A;  4RW9 A;  3N4P A;  1MDU B;  5C25 A;  4LSL A;  1VRT A;  2CGJ A;  4M45 A;  4CGF A;  3DOL A;  2KFZ A;  1GOA A;  1BI4 A;  3G0Z A;  4DV4 K;  3OS1 A;  3KK3 A;  4AHR A;  1GOC A;  2QKB A;  4PL8 A;  3O4Q A;  3KKS A;  1NNE A;  3T3F A;  4DU4 A;  1Z26 A;  4BAC A;  3LWL A;  4JI2 K;  3C6T A;  4DF8 A;  4KRE A;  3ALY A;  5AZI A;  3A2F A;  1LWE A;  4HCC A;  4DG1 A;  3CPW M;  4IFV A;  3QO9 A;  1REV A;  3MN5 A;  2W42 A;  3LAK A;  3SUO A;  4FJJ A;  4H4M A;  4AHT A;  1BDG A;  1IV0 A;  1QE1 A;  4QS9 A;  2VG6 A;  3NF8 A;  4H0P A;  3CQ8 A;  3ULD A;  1KAY A;  1HX1 A;  4CHN A;  5B8H A;  3ZX2 A;  4XEI A;  2XY8 A;  4NCB A;  3QIO A;  3H1Q A;  4N5S A;  3HL8 A;  2HBL A;  1WLJ A;  1NK5 A;  5KQ8 A;  4MDB A;  2WFB A;  4FW2 A;  3AVN A;  4BRN A;  4YOR A;  5M1Q A;  3VMF B;  1IKY A;  1BL3 A;  3R1X A;  3WUH A;  4C8O A;  5AQX A;  4JEP A;  3NAE A;  1T7P A;  1WSG A;  3MN6 A;  1K6Y A;  4JHD B;  3K2P A;  2JWK A;  1C1B A;  4CD3 A;  3HXM A;  3O1B A;  2E2N A;  3HP9 A;  3RMA A;  3BEX A;  5TKY A;  2NRV A;  5TKW A;  4JN4 A;  4JKH A;  5AQM A;  4JKG B;  3OJS A;  5KPT A;  3OYI A;  3HPH A;  3AVF A;  2QWP A;  4NXN K;  2JGU A;  3H45 C;  5C12 A;  2Z1G A;  5FPN A;  4B08 A;  3J7Y P;  4BRD A;  1S9G A;  5SZT A;  1HNX K;  3AGK A;  2Q97 A;  5BPN A;  1E4F T;  1LWC A;  4Z94 A;  2GUI A;  2AJQ A;  3LDQ A;  1NK4 A;  4ZTF A;  4H5V A;  5AQI A;  3QFP A;  3CER A;  4MO5 A;  3ZT4 A;  2QI2 A;  3P83 D;  3VQB A;  4PHT X;  2QWO A;  5FPM A;  1XQS C;  1VQ8 N;  2X74 A;  1NK8 A;  2OA8 A;  4JKG A;  3O3G A;  2B5J A;  2FF6 A;  2HF4 A;  3MAQ A;  4KKO A;  4CF2 A;  4IWV A;  2D4W A;  1BUP A;  2Z1H A;  1VSE A;  1YI2 N;  3SCX A;  4FWS A;  3JS6 A;  3NH2 A;  3D2E B;  4Z4C A;  3OY9 A;  3QBW A;  1T6C A;  2QTD A;  3D0P A;  4MFB A;  1NJZ A;  2E8A A;  3OYF A;  3AVG A;  4UQG A;  3KVG A;  4FPA A;  1BIS A;  2Q1N A;  2RKI A;  3T69 A;  3ZSQ A;  1JL2 A;  4I6M B;  1XNQ K;  5FRO A;  5F2R A;  4LF8 K;  2A1R A;  1TK8 A;  4TSX A;  1QQO A;  2YCH A;  3RR8 A;  1TKZ A;  3LL3 A;  4JYA K;  3FZH A;  1Q86 O;  4F9O A;  3T7Z A;  4JS5 A;  1TUY A;  2A3Z A;  3T19 A;  2ZQB A;  2HHW A;  1EX4 A;  3FFK B;  3OYC A;  4MDA A;  1HKB A;  4KAZ A;  2PYL A;  3DMJ A;  4FK2 A;  1ASV A;  2YJF A;  4CW7 B;  4NCA A;  4JV5 K;  4XH5 A;  3SQ4 A;  4JKD A;  3PO4 A;  5EOY A;  3FLC O;  2P51 A;  2WOM A;  3HO1 A;  4CZJ A;  4B3M K;  2ZF5 O;  1BU6 O;  4CF8 A;  1Y97 A;  4DU3 A;  3DLE A;  4CJW A;  1LW2 A;  3TWH A;  3A5L C;  3DAW A;  1WSF A;  3EZW A;  4DB3 A;  5GAH P;  3VQC A;  1RT3 A;  3F9K A;  1HUX A;  3C6U A;  4FJK A;  4CFD A;  2VWK A;  4I9Q A;  3ISN C;  3CFR A;  1MA9 B;  3EY1 A;  3H3N O;  3OYH A;  2WC9 A;  3HOS A;  3FZM A;  1YJ9 N;  2UUA K;  4BR2 A;  4BRG A;  3SAF A;  2V52 B;  5AQY A;  4O0I A;  1SKW A;  1VAZ A;  3LDN A;  3PX4 A;  4QS7 A;  2D5R A;  1HKG A;  1L3T A;  4CES A;  1WSJ A;  3CQY A;  2FXU A;  2F96 A;  4PA1 A;  3O9R A;  3VOV A;  2A40 A;  3TAM A;  5T7B A;  1Q8I A;  3CXC M;  2GTD A;  4CZK A;  3A5N C;  3GOI A;  1EKE A;  4KPY A;  4DSJ A;  2JLE A;  4IXC A;  4EP4 A;  5DK5 A;  4NYF A;  3AVC A;  1LAW A;  1OVY A;  1U49 A;  3HYF A;  4OKJ A;  3L3V A;  5HBM A;  4ZHR A;  2Q0R A;  1NGG A;  2Q36 A;  2RF2 A;  2BUP A;  3U9Z A;  1XMQ K;  4Z4I A;  3ASM A;  4B9U A;  5AQK A;  1C0M A;  4B3R K;  1OH6 A;  1IKW A;  4CJ5 A;  1TK5 A;  2BTF A;  3VEZ A;  1K73 O;  5A2Q O;  4DV5 K;  4CHP A;  4CJF A;  4DHY A;  2WTU A;  3CC4 N;  1JJ2 M;  2YI1 A;  3ZX0 A;  1Z25 A;  1RT7 A;  4W5Q A;  3P39 A;  4M42 A;  1HYZ A;  2Q0U A;  1J6Z A;  3ULE A;  1I94 K;  1SS6 A;  3CJA A;  3C0B A;  5BPL A;  4I9L A;  1ZC6 A;  1RTJ A;  3HI0 A;  4K0K K;  2HNY A;  1C0F A;  2NNW A;  4CZF A;  4WF9 L;  1HRH A;  1EXQ A;  3I0S A;  3JSM A;  1FJG K;  5KPR A;  1LV5 A;  1WSI A;  5JVH L;  3KIO A;  3CCU N;  4UY8 O;  1HNV A;  2HHV A;  5JLH A;  3WNG A;  1IO2 A;  1WAJ A;  2DPN A;  4M3R A;  1RBR A;  2OPR A;  2P9I B;  2ZJP L;  2OPP A;  3AVJ A;  4NLC A;  3RRH A;  5AQF A;  3M5R A;  1SZ2 A;  3KK7 A;  4ISF A;  5GAD P;  1NJY A;  1OH8 A;  1J54 A;  2HVI A;  5M1K A;  1RBV A;  1K8A O;  3O80 A;  1KVA A;  1ZBL A;  3OBY A;  3QB0 A;  4CJE A;  3HVR A;  3HRG A;  4B1U B;  3AVL A;  4PL7 A;  4E89 A;  1A5W A;  4H5T A;  4O8U A;  1B92 A;  3O1W A;  3O4N A;  2HF3 A;  3VGL A;  4FCY A;  4H5N A;  4FK4 A;  3AA5 X;  3OYN A;  3KKR A;  1L5U A;  4CBU A;  3TAQ A;  1CZB A;  1NLV A;  4DU1 A;  3CIP A;  4DS4 A;  4CK3 A;  3LP3 A;  3F73 A;  4F8R A;  3D7E O;  3WXJ A;  4FWQ A;  4CJV A;  3RSE B;  3KZB A;  3T1A A;  1KVC A;  4JKC A;  3ENH A;  5H1S Q;  5KRS A;  1MWM A;  4IG3 A;  2XY7 A;  3WXK A;  4HUF A;  3MEG A;  3R6M A;  2XO7 A;  4FJ7 A;  4OLA A;  4W5N A;  1KLM A;  3VEV A;  3QEV A;  5C2F A;  3KLI A;  2I7P A;  3ZYY X;  4IBN A;  2OAN A;  4ZTJ A;  4IEI A;  1HYS A;  1VQ4 N;  3QDK A;  3WXL A;  2HNZ A;  4DR5 K;  2EWS A;  4GV9 A;  5EX5 A;  3WXM B;  5FLX O;  4MLE A;  3A8Y A;  1TAU A;  1SAZ A;  3LZI A;  1HNI A;  4DR2 K;  1VSF A;  2P9L B;  3CET A;  4XH1 A;  2IC3 A;  3V1Q A;  2UYT A;  2IVP A;  3C6H A;  3M8S A;  2KZZ A;  4A61 A;  4YOT A;  4FWL A;  4BGB A;  2O8B B;  1N33 K;  4KHY A;  2G8K A;  4HWI A;  4QAG A;  4U67 L;  5BRD A;  1RTD A;  4DQP A;  1DTT A;  1LW0 A;  1RIL A;  4JKA A;  1IBM K;  3E9O A;  5C10 A;  1U04 A;  4E7I A;  3W0L A;  4DQQ A;  2FLO A;  3BZC A;  3MCA B;  4AHC A;  4CJ4 A;  1IH7 A;  2O4I A;  4F3T A;  2AA4 A;  3OJU A;  1NOZ A;  4OGE A;  1YUW A;  2F9T A;  4QS8 A;  1VQ5 N;  5F0X A;  1KC8 O;  2DFE A;  2RN2 A;  4LSN A;  5BR8 K;  2UXD K;  3EZ5 A;  2A5X A;  1N5Y A;  2HHU A;  1C0T A;  2ASO A;  4AHV A;  3UB5 A;  4GV3 A;  2KQ2 A;  4CEZ A;  4JS4 A;  1XC3 A;  2NUB A;  4CIE A;  5BRE A;  4WFB L;  4A2B A;  1TL3 A;  2P9P A;  1M90 O;  2CH5 A;  3P31 A;  4B9S A;  5AQN A;  4BRI A;  4E7H A;  4JK7 A;  1QTM A;  5JS1 A;  4IG0 A;  3DRS A;  3HM9 A;  3K9J A;  4JI7 K;  3CCS N;  5BN8 A;  1KRP A;  4DFM A;  3AVA A;  3M8P A;  1D9F A;  4H0V B;  4EZ6 A;  4PY5 A;  3NMU A;  4EFH A;  4DV1 K;  2NLX A;  2QWQ A;  4ELU A;  5CE3 A;  4M3Y A;  4OKK A;  5GIO A;  4C1N I;  1VSI A;  1X1P A;  3CFO A;  2UXB K;  2D0P A;  3L2V A;  3V9Z A;  4DLG A;  1NGD A;  2OYQ A;  4CEO A;  3ZSZ A;  1C0G A;  5KGX A;  3S3M A;  1TK0 A;  2QXF A;  5DM6 L;  3NF9 A;  1KFD A;  3A5O C;  3VQ4 A;  3K5N A;  4WFN L;  4BR9 A;  3PX0 A;  3OYB A;  2ETJ A;  4BRL A;  4EAH D;  4BVO A;  1BA0 A;  3AY9 A;  1SUQ A;  2GWK A;  1HJO A;  1BI4 B;  2G8U A;  3AAP A;  2ASP A;  1ZYQ A;  3DXM B;  2O8D B;  4CZL A;  3OS0 A;  2O8F B;  3ZT0 A;  2QWM A;  3G25 A;  1LOT B;  3AVI A;  1VQ7 N;  1JLQ A;  2F8T A;  5C15 A;  4JKE A;  3K5O A;  5HRP A;  1WOQ A;  3O8M A;  3SJJ A;  2OPQ A;  4K41 A;  4LF7 K;  1JLB A;  5FPE A;  4YDU C;  2ZD1 A;  4H5W A;  4JRP A;  3VER A;  3AVK A;  1DKG D;  2HW3 A;  1IG8 A;  5J2M A;  5LMU K;  3GBT A;  4JKF A;  4BGA A;  4CHQ A;  1JCG A;  1R0A A;  3DXM A;  4XIU A;  2O8D A;  1A5X A;  1X3M A;  2QXL A;  2O8F A;  3QNN A;  3OTO K;  3SK3 A;  1S9E A;  1S3X A;  1BIZ A;  1YVN A;  4WQ5 C;  4DMN A;  3DRP A;  3V9U A;  3SPZ A;  1NJI O;  3DI6 A;  3O4W A;  1OH7 A;  4MO4 A;  3I8D A;  1Q81 O;  1S6Q A;  4LFC K;  4CGD A;  1QSS A;  2ASM A;  1FK9 A;  1N36 K;  1J9A A;  4L3Q A;  5GAG P;  1X9M A;  3TU5 A;  3DLB A;  2YNH A;  3TAG A;  2HBK A;  4YOX A;  1QZ6 A;  3VEY A;  4BDP A;  4QCL A;  3HSC A;  2G8W A;  4FJL A;  1A5V A;  3NFA A;  3QIP A;  3OA9 A;  1G99 A;  4K8X A;  3SQ0 A;  2KHO A;  5BPM A;  3Q7C A;  5HRR A;  2FBX A;  4LH5 A;  2F4V K;  1SKR A;  4CHO A;  2VGN A;  3K9K A;  3A5M C;  2YHB A;  3QIN A;  4CFA A;  5I42 A;  1X9W A;  3CCR N;  2EX3 A;  2QW9 A;  2W6L A;  3EEQ A;  1K9M O;  4KHU A;  3OYE A;  1BQM A;  1KXP A;  3CJ7 A;  2XHB A;  3TAR A;  3T1Y K;  4E19 A;  3M1F A;  1JXE A;  4DTM A;  3I8B A;  5AQG A;  4CGH A;  3AA2 A;  1L3U A;  3RR7 A;  2QWR A;  1MWK A;  4E0D A;  4A5B A;  4C23 A;  5MLC Q;  1UWB A;  4E7J A;  5C0Y A;  4BC5 A;  3NE6 A;  1BWF O;  4FJM A;  3M8R A;  1YTU A;  2KFN A;  3DLG A;  4J8F A;  4J2B A;  3VTH A;  3AV9 A;  4HTL A;  3UKU B;  3CCE N;  2WUS A;  3L2R A;  2BH1 A;  3LDO A;  3HBT A;  1NMN A;  1RFQ A;  3KWI A;  2E1Y A;  4M7Y A;  3MK6 A;  4LF5 K;  1GLC G;  2YKM A;  2J4R A;  1WUA A;  5CHI A;  4CEF A;  4NO7 A;  1EWR A;  1FKO A;  4FZX C;  2YNI A;  3NF6 A;  4AIL C;  2BDP A;  3C94 A;  3MWP A;  3QNO A;  1YTA A;  4X65 K;  2E5L K;  3LPT A;  3QEP A;  2IVN A;  1JLA A;  3EE8 A;  1WN7 A;  3TR8 A;  3U3Y A;  4BRQ A;  4DSF A;  1YJN N;  4FJ5 A;  3EE9 A;  4B3O A;  1VQP N;  4KH4 A;  3KHY A;  2OZM A;  3FFI A;  3JXU A;  1GLL O;  3UKU A;  4CIF A;  4JKB A;  2NRT A;  2VQE K;  1GLB G;  3WNH A;  4DQ8 A;  2E6M A;  2NRX A;  3H3O B;  1VK0 A;  4I7F A;  4WQ4 C;  3AO4 A; 
#chains in the Genus database with same CATH homology
 1KVB A;  1WSH A;  3SZ2 A;  3ZSY A;  4CJT A;  1J53 A;  4LD0 A;  4CJS A;  3D45 A;  3L8B A;  4DSI A;  4KI4 A;  4BE1 A;  4Z4I A;  3ASM A;  3ZSV A;  1FKP A;  2X78 A;  4B9U A;  5D3G A;  4C8L A;  3OVN A;  3KLF A;  1C0M A;  2IGI A;  4OGC A;  4ID5 A;  4OVL A;  1JXB A;  1XHX A;  4FLW A;  2R7Y A;  1IKW A;  4CJ5 A;  3AO2 A;  3B6P A;  1TK5 A;  1D9D A;  5HRO A;  4I2P A;  1N6Q A;  1LWF A;  3MXM A;  4HCB A;  4IFY A;  4CHP A;  4CJF A;  3CM6 A;  4FK0 A;  3WNF A;  3MEC A;  3AA3 A;  4BWM A;  4KB1 A;  4H8K A;  1NJX A;  1Z25 A;  3CG7 A;  1ASW A;  1RT7 A;  4GMJ B;  3DLR A;  4O55 A;  4W5Q A;  4KB0 A;  4M42 A;  1L3V A;  1HYZ A;  4Z4E A;  2KZM A;  2Y1I A;  4YNQ A;  1XHZ A;  3ZSO A;  3MED A;  5SWM A;  3IAY A;  4FW1 A;  4B8A B;  4CK1 A;  3SI6 A;  4FM2 A;  4I9L A;  1C1A A;  1VSM A;  1UOC A;  1U47 A;  2HHX A;  3V1O A;  1RTJ A;  2HNY A;  3TAF A;  1RT4 A;  4RW7 A;  4DTR A;  1CLQ A;  1ITG A;  3O3H A;  1HRH A;  1EXQ A;  3LZJ A;  3I0S A;  3JSM A;  1UA0 A;  1KCF A;  1LV5 A;  4J2D A;  4CEQ A;  4CHY A;  3V6D A;  4FZZ A;  1RBT A;  1WSI A;  3KIO A;  4CF0 A;  1HNV A;  2HHV A;  2D0A A;  2E4L A;  1RDB A;  3WNG A;  1IO2 A;  1WAJ A;  1UA1 A;  2BGG A;  4M3R A;  3K5L A;  1RBR A;  2OPR A;  4M3T A;  3HPO A;  1RCH A;  2OPP A;  3AVJ A;  4N47 A;  5FRM A;  3RRH A;  4PWD A;  4W5O A;  4W5R A;  2DFH A;  2QK9 A;  1FXX A;  1NJY A;  4N76 A;  1J54 A;  2HVI A;  4KTQ A;  3I0R A;  4O0J A;  4C8N A;  4DSE A;  1O1W A;  1RBV A;  2VG5 A;  4KFB A;  3LP2 A;  3LAN A;  4Y1C A;  3VA3 A;  1JLE A;  1KVA A;  1NK0 A;  3ZSR A;  1XI1 A;  1ZBL A;  3L2W A;  4CJE A;  3HVR A;  4L8R B;  5JS2 A;  3AVL A;  4DTJ A;  3V9X A;  1BGX T;  4E89 A;  1A5W A;  1S5J A;  4R5P A;  1RNH A;  3RRG A;  1B9F A;  2HND A;  3VQ9 A;  1ZBI A;  3RMB A;  1B92 A;  1W9H A;  3AO1 A;  1BCM A;  4BDY A;  4DTN A;  4DTX A;  3O4N A;  2FBY A;  3KK1 A;  4FCY A;  2RPI A;  3SUN A;  3HK2 A;  4FK4 A;  2IS3 A;  3AA5 X;  3H08 A;  3OYN A;  4OPJ A;  1NK9 A;  1U4B A;  3KKR A;  3VA0 A;  4DFK A;  5J2Q A;  4IKF A;  1L5U A;  5HP1 A;  3AO5 A;  1HQU A;  4J2A A;  3TAQ A;  2OPS A;  5E41 A;  5K14 A;  1CZB A;  3ZT2 A;  1CXU A;  3AO3 A;  3SNN A;  1Q9Y A;  4DU1 A;  3QEX A;  1D5A A;  4DS4 A;  4CK3 A;  3LP3 A;  4FJ8 A;  3F73 A;  4F8R A;  1HPZ A;  4NCG A;  4CJV A;  4FLV A;  4OJR A;  2DFF A;  4CJL A;  4Z4H A;  1RTH A;  4H4O A;  4DFP A;  3TAE A;  3T1A A;  1KVC A;  4DSK A;  3IRX A;  1ZBF A;  1TGO A;  3S3N A;  2Y1J A;  3OYD A;  5KI6 A;  4DWI A;  1KLN A;  1RT1 A;  5KRS A;  3DLK A;  4F4K A;  3OYM A;  1SL2 A;  4IG3 A;  5EU7 A;  1JKH A;  2XY7 A;  1C0U A;  4I2Q A;  3VQ7 A;  3WNE A;  4HUF A;  3MEG A;  3K5M A;  1KSP A;  4FZY A;  4CJR A;  3KLE A;  4N41 A;  2XO7 A;  1X9S A;  3M8Q A;  5HRN A;  3NGI A;  1ZBU A;  4FJ7 A;  4OLA A;  4W5N A;  1YT3 A;  4FJI A;  1KLM A;  2YKN A;  3MXJ A;  5CY4 A;  3KLI A;  3QEV A;  4CEC A;  1S1U A;  4IBN A;  1MU2 A;  5C24 A;  4HHT A;  4ZTJ A;  1HYS A;  2ZE2 A;  2P5G A;  4KTZ A;  4KV8 A;  2FC0 A;  2HNZ A;  2HHT A;  1UAX A;  1QSY A;  3C95 A;  4FLY A;  3IG1 A;  5CZ1 A;  2I5J A;  1C1C A;  4CJU A;  3L2U A;  3VQE A;  4DS5 A;  1JLC A;  4FJ9 A;  1TAU A;  2E6L A;  1J5O A;  1JLF A;  4E7K A;  3LZI A;  1HNI A;  4DSL A;  3QEW A;  4F2S A;  1EP4 A;  1VSF A;  1DTQ A;  4Z4F A;  1SKS A;  4RW9 A;  1TKD A;  4OLB A;  2IC3 A;  5C25 A;  1RT2 A;  3V1R A;  4LSL A;  3V1Q A;  3SV3 A;  1VRT A;  3M8S A;  1HMV A;  3QLH A;  2KZZ A;  4PUO A;  4M45 A;  4CGF A;  3DOL A;  4RG8 A;  2KFZ A;  5J2P A;  1GOA A;  4IDK A;  3ZCM A;  1BI4 A;  3G0Z A;  3NH1 A;  4KHY A;  2G8K A;  2DY4 A;  1S6P A;  3OS1 A;  3KK3 A;  4AHR A;  1GOC A;  4QAG A;  4F2R A;  4O4G A;  5CYQ A;  4DTP A;  1RTD A;  4DQP A;  1DTT A;  2QKB A;  1LW0 A;  4RW6 A;  5CZ2 A;  1RIL A;  3DLH A;  1NKE A;  2VG7 A;  2VWJ A;  3O4Q A;  4CED A;  4DTS A;  1U04 A;  1KFS A;  4E7I A;  3KKS A;  4DQQ A;  3T3F A;  4DU4 A;  1Z26 A;  4CGG A;  3LWL A;  4AHC A;  4BAC A;  3CYM A;  4CJ4 A;  1IH7 A;  3DM2 A;  3L3U A;  2O4I A;  3QES A;  3C6T A;  4O44 A;  4DF8 A;  4F3T A;  3DOK A;  1NOZ A;  4OGE A;  3OJU A;  3THV A;  4KRE A;  3ALY A;  4NYN A;  3A2F A;  3QET A;  3S3O A;  1LWE A;  1RT6 A;  4M3W A;  2DFE A;  2RN2 A;  4DG1 A;  3RMD A;  3VQD A;  4HCC A;  4IFV A;  4LSN A;  3QO9 A;  3KTQ A;  2P5O A;  1REV A;  4CJQ A;  2G8I A;  1NKB A;  1VSJ A;  3LAK A;  2W42 A;  3EZ5 A;  5CYM A;  3RTV A;  3SUO A;  1N5Y A;  2HHU A;  1C0T A;  4FJJ A;  1CZ9 A;  4AHV A;  4CJK A;  2KTQ A;  2KQ2 A;  4H4M A;  4C8M A;  1LAV A;  4CEZ A;  1NK7 A;  3OYL A;  2NUB A;  4CIE A;  4JS4 A;  4AHT A;  4CEB A;  1U45 A;  1TL3 A;  1T8E A;  1QE1 A;  3HVT A;  1TV6 A;  2PYJ A;  2VG6 A;  3NF8 A;  4KTW A;  5KRT A;  3CQ8 A;  3LAM A;  5KGW A;  3ULD A;  4B9S A;  4KHW A;  1C6V A;  4E7H A;  1QTM A;  3HST B;  4CHN A;  5JS1 A;  3IS9 A;  3NH0 A;  4IG0 A;  3DRS A;  4AH9 A;  4E1M A;  3HM9 A;  2XY8 A;  1F21 A;  4NCB A;  2B4J A;  3QIO A;  1QS4 A;  4N5S A;  2G8H A;  3HL8 A;  1KRP A;  2BE2 A;  3NF7 A;  4DFM A;  3NBP A;  4LH4 A;  3AVA A;  1WLJ A;  4FVM A;  3M8P A;  3TI0 A;  3VN5 A;  1NK5 A;  1D9F A;  4EZ9 A;  4EZ6 A;  4PY5 A;  4FW2 A;  4QOZ B;  3AVN A;  4KI6 A;  3HJF A;  1BHL A;  1S1X A;  4FM0 A;  4HVJ A;  4FM1 A;  4ELU A;  5DMR A;  4AHS A;  2A1S A;  4HTU A;  1IKY A;  1BL3 A;  4B8C A;  4B9L A;  4M3Y A;  4CF1 A;  4CGI A;  4OKK A;  3L2Q A;  2G8F A;  4C8O A;  4ELV A;  4E3S A;  1TKX A;  1VSI A;  3NAE A;  3OYJ A;  1T7P A;  1I39 A;  1I3A A;  4KHQ A;  1WSG A;  1X1P A;  3CFO A;  3P1G A;  1K6Y A;  1BCO A;  3K2P A;  3L2V A;  1C1B A;  4DLG A;  3V9Z A;  1WNS A;  2OYQ A;  4CER A;  1IKV A;  3HXM A;  4E7L A;  3HP6 A;  4CEO A;  3ZSZ A;  5KGX A;  3V4I A;  3PO5 A;  2YNG A;  4CHZ A;  1T03 A;  3S3M A;  1TK0 A;  2QXF A;  3HP9 A;  3ZSW A;  3RMA A;  4FJG A;  3NF9 A;  4FLT A;  4B9T A;  3ZSX A;  1KFD A;  1VSD A;  2Z1J A;  3VQ4 A;  3PX6 A;  3K5N A;  4BE0 A;  3VQP A;  2IOC A;  1SV5 A;  2YNF A;  3PX0 A;  3AVM A;  3KD5 E;  3OYB A;  3OJS A;  4B9V A;  2ETJ A;  4KHN A;  4MQ3 A;  3QER A;  3OYI A;  3HPH A;  3K57 A;  4Q0B A;  1SUQ A;  3AVF A;  1BI4 B;  2G8U A;  2JGU A;  1ZYQ A;  2Z1G A;  3K58 A;  3S9H A;  3SUQ A;  1T05 A;  3OS0 A;  4B08 A;  4DFJ A;  1BIU A;  3LP0 A;  3ZT0 A;  1S9G A;  5SZT A;  2HB5 A;  3VQQ A;  4M3X A;  3NGY A;  3AVI A;  3K59 A;  5FDL A;  5J1E A;  1RBS A;  1LWC A;  4RW8 A;  1EET A;  2GUI A;  1JLQ A;  3OYA A;  4LY7 A;  1NK4 A;  4ZTF A;  2F8T A;  2AJQ A;  4DQI A;  3P5J A;  3K5O A;  5HRP A;  2Z1I A;  4ICL A;  4Q5V A;  1RDA A;  3SJJ A;  2OPQ A;  4OKE A;  5J2N A;  2HHS A;  2O4G A;  4FXD A;  3TAP A;  1JLB A;  1SL1 A;  1L3S A;  3ZT4 A;  2ZD1 A;  3P83 D;  3O3F A;  4WE1 A;  3VQB A;  4JRP A;  4GW6 A;  3AVK A;  2ITG A;  1HJR A;  1XWL A;  3RWU A;  2X74 A;  4C8K A;  3U6F A;  1NK8 A;  2OA8 A;  2GBZ A;  3PUF A;  3O3G A;  2HW3 A;  2B5J A;  2IAJ A;  3E01 A;  3MAQ A;  4KKO A;  4CF2 A;  1VSK A;  5J2M A;  2Z1H A;  4CJ3 A;  1NK6 A;  1VSE A;  3SUP A;  4CHQ A;  3NCI A;  1R0A A;  3SCX A;  3VQ8 A;  2XRI A;  2OZS A;  4XIU A;  3NH2 A;  1A5X A;  3SPY A;  4DQS A;  3QNN A;  4Z4C A;  3LP1 A;  1S9E A;  3OY9 A;  1NJW A;  1G15 A;  3AVH A;  1BIZ A;  4DMN A;  4KHS A;  3KD1 E;  3DRP A;  4O5B A;  3V9U A;  3D0P A;  3SPZ A;  3QEI A;  4MFB A;  3KK2 A;  3LAL A;  1NJZ A;  3OYF A;  3DI6 A;  3AVG A;  4CFC A;  3V9S A;  1W0H A;  4UQG A;  2YHA A;  1BIS A;  2GV9 A;  2RKI A;  3I8D A;  1S6Q A;  3NDK A;  4DLE A;  3ZSQ A;  4CGJ A;  1JL2 A;  4CGD A;  5HLF A;  1QSS A;  1FK9 A;  5FRO A;  4FLX A;  3PV8 A;  1J9A A;  1RBU A;  1HYV A;  1X9M A;  4G1Q A;  2A1R A;  1TK8 A;  2HVH A;  4TSX A;  3RR8 A;  3EYZ A;  2YNH A;  3DLB A;  4CF9 A;  1TKZ A;  3TAG A;  4DQR A;  3MXI A;  4QCL A;  3LPU A;  4BWJ A;  3KLG A;  4BDP A;  4FJL A;  2G8W A;  4HUG A;  1A5V A;  4KO0 A;  3LWM A;  2IDO A;  3LDS A;  4CK2 A;  3OYG A;  1S1W A;  4JS5 A;  3NFA A;  1RDD A;  2FBT A;  3QIP A;  3SQ1 A;  4FYD A;  1XC9 A;  2KW4 A;  2WON A;  3T19 A;  4YFU A;  2FBV A;  3SQ0 A;  2PY5 A;  4K8X A;  2XY6 A;  2G8V A;  2DTU A;  5HRR A;  1RTI A;  2FBX A;  2ZQB A;  2XY5 A;  4LH5 A;  3RMC A;  1WSE A;  1SKR A;  4FJX A;  4CHO A;  4CJP A;  2HHW A;  1EX4 A;  4BE2 A;  4GVM A;  3ZT1 A;  3ITH A;  3OYC A;  1D8Y A;  4M3Z A;  3KLH A;  1VSH A;  4KAZ A;  3VQ6 A;  2YHB A;  3QIN A;  3U3G A;  4CFA A;  3DMJ A;  2B6A A;  1ASV A;  5HRS A;  5I42 A;  1X9W A;  2PYL A;  4FK2 A;  4NCA A;  4F3O A;  3OS2 A;  2EX3 A;  4FJH A;  4KHU A;  3OYE A;  1BQM A;  2X6N A;  1TL1 A;  3SQ4 A;  1Q9X A;  2XHB A;  3TAR A;  4DTO A;  1HQE A;  4M41 A;  3V9W A;  4CE9 A;  1NOY A;  2D0B A;  3OYK A;  4E19 A;  2D0C A;  1DLO A;  3B6O A;  3TAB A;  1TKT A;  3PO4 A;  1JXE A;  1QQC A;  4FJN A;  2P51 A;  4DTM A;  4KRF A;  2WOM A;  3HO1 A;  4RW4 A;  4Z0U A;  4CGH A;  3AA2 A;  1JL1 A;  2HMI A;  1L3U A;  3RR7 A;  4N56 A;  3JYT A;  1S1T A;  4OPK A;  4B9N A;  4E0D A;  3HPG A;  4CF8 A;  4CCH A;  3HT3 A;  4E1N A;  4JRQ A;  4DF4 A;  1Y97 A;  4FLZ A;  1UWB A;  4E7J A;  4DU3 A;  3DLE A;  3NE6 A;  4PQU A;  3BGR A;  4CJW A;  1CXQ A;  1LW2 A;  3M8R A;  3TWH A;  4FJM A;  1ZBH A;  2P1J A;  1YTU A;  4DTU A;  2KFN A;  1WSF A;  2YV0 X;  3DLG A;  4CEA A;  4J2B A;  4Y1D A;  1TVR A;  1RT5 A;  4ID1 A;  3VQC A;  3AV9 A;  1RT3 A;  3F9K A;  5I3U A;  1QSL A;  1RDC A;  3PY8 A;  1U48 A;  4Z4G A;  3C6U A;  4FJK A;  4J2E A;  4CFD A;  2VWK A;  4I9Q A;  3ISN C;  3CFR A;  3AVB A;  3L2R A;  3SQ2 A;  3SYZ A;  2Q3S A;  3EY1 A;  3OYH A;  2QKK A;  3MEE A;  3DYA A;  2YKM A;  4AHU A;  1S1V A;  3DRR A;  4CEF A;  5KTQ A;  4HUE A;  5FRN A;  1FKO A;  3VQ5 A;  4FZX C;  1IKX A;  3VQA A;  2YNI A;  4CFB A;  3NF6 A;  1WAF A;  1NKC A;  4AIL C;  2BDP A;  3C94 A;  3QNO A;  1YTA A;  4K8Z A;  2HHQ A;  1KTQ A;  1ASU A;  1BQN A;  4O0I A;  3TAN A;  1SKW A;  3UIQ A;  1YVU A;  4CEE A;  3PX4 A;  3LPT A;  2D5R A;  1L3T A;  4CES A;  3ZT3 A;  1TAQ A;  1WSJ A;  4BDZ A;  3QEP A;  4JLH A;  2F96 A;  4PA1 A;  1JLA A;  1QHT A;  2ATQ A;  4W5T A;  1WN7 A;  3TR8 A;  4B9M A;  3U3Y A;  1IG9 A;  4DSF A;  5C42 A;  3TAM A;  4FJ5 A;  1GOB A;  1Q8I A;  5T7B A;  3BDP A;  4B3O A;  2BAN A;  3CM5 A;  2OZM A;  2RF2 A;  2X6S A;  3FFI A;  4FLU A;  2PZS A;  1JLG A;  2EHG A;  1EKE A;  4KPY A;  4DSJ A;  4EP5 A;  2JLE A;  3V81 A;  4EP4 A;  4CIF A;  3G10 A;  3NHG A;  5DK5 A;  3CFP A;  4NYF A;  3AVC A;  1LAW A;  3NGZ A;  3SV4 A;  1U49 A;  4CIG A;  4ELT A;  3HYF A;  1VRU A;  3L3V A;  4OKJ A;  5HBM A;  3WNH A;  2LSN A;  1VSL A;  1B9D A;  4ZHR A;  2E6M A;  4M3U A;  2F8S A;  1VK0 A;  1SL0 A;  3KJV A;  4I7F A;  3AA4 A;  3AO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...