5HRNA

Hiv integrase catalytic domain containing f185k mutation complexed with gsk0002
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
152
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
molecule keywords Integrase
total genus 54
structure length 148
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrnA00
3HPHA 3DRRA 5DK5A 4FLUA 3CFOA 4M3ZA 4DQPA 3VQ6A 4Z4CA 4CK1A 4JRQA 4M42A 2F8SA 3L3VA 1QHTA 5KRSA 2B5JA 4FJ9A 3F9KA 1NKEA 1WSHA 3LAKA 3KLEA 1T7PA 4CJFA 2KZZA 1HQUA 1Q9YA 3QEVA 4AH9A 4CJVA 3ZT3A 2WOMA 1A5WA 1CZBA 2LSNA 4CF0A 5E41A 2KQ2A 5T7BA 5SWMA 4N41A 4CEEA 3MXJA 1S1VA 5J1EA 4AILC 4FJLA 1IKXA 1KCFA 5C25A 4FJ8A 4PY5A 3DLEA 1S1XA 2XY6A 1HMVA 1XC9A 1RT6A 1S5JA 2A1SA 1KVCA 1ASWA 2RF2A 4Z4GA 1QE1A 1FXXA 2YNHA 1SL1A 4FJJA 4CHOA 1VSDA 4OPKA 4LH4A 3T1AA 2RPIA 1RTIA 2HHTA 4DQRA 2DFHA 4B9NA 4OLAA 3ZT0A 1U47A 1S1WA 3D0PA 3S3MA 2PZSA 1TAQA 4FCYA 1HRHA 3AO5A 4FW1A 3DOKA 1YTUA 3L3UA 3OYLA 2DFFA 1S6QA 3ITHA 4QOZB 1TGOA 4JS5A 3DRPA 4YFUA 1NK7A 4EP4A 4F8RA 4IDKA 3M8RA 4J2AA 2DTUA 2OPSA 4KHNA 2ZD1A 4N76A 1U4BA 3SQ4A 1WN7A 4M41A 2HVIA 1RBVA 3WNGA 3ZT4A 4DG1A 5FRNA 4ELVA 5JS1A 3OS1A 1QSSA 4RW9A 1J9AA 3HL8A 4DQQA 4I2PA 1NK8A 4MFBA 2Z1IA 1G15A 1A5XA 2YKMA 3AA3A 3DMJA 3NF8A 2X6SA 3KK1A 4FK4A 1TKTA 3V1QA 1ZBHA 4OKJA 4DTSA 3SQ0A 4DU4A 1LWFA 2D0BA 1BHLA 3F73A 1NK9A 3VQ8A 4CJEA 1HYVA 1IH7A 3AA2A 1U48A 1KRPA 3LALA 1LV5A 3TAMA 1IKWA 4JS4A 4ZTFA 1ASVA 1L3TA 4OVLA 3P1GA 1RT5A 3L2QA 1KLNA 3V4IA 1J54A 4DSKA 3CYMA 5KGWA 3VQ9A 4ZTJA 1GOBA 3RMDA 3NF7A 4RW7A 1S1TA 1TK8A 2D0AA 2B4JA 2IDOA 3QIOA 3LP0A 4IFYA 2OZMA 4DSIA 4CECA 3HT3A 3CFRA 4EP5A 3PV8A 3TABA 1D9DA 4LH5A 3V1RA 2XY7A 4B9VA 1D8YA 2PYLA 2E6LA 3SUPA 1JLCA 4CJUA 4NYNA 4DU1A 4KI4A 2HMIA 3RRHA 1QQCA 4M45A 1X9WA 1RT3A 3MEDA 4OGEA 3OYDA 4G1QA 1LW0A 3NAEA 4CFDA 1BCMA 1RT1A 3OYEA 4N5SA 1VSEA 3IG1A 4CGIA 3NF6A 1QS4A 4UQGA 1IKVA 1CZ9A 3OY9A 2QK9A 1RTJA 2B6AA 3DRSA 4DQIA 4CJPA 1UOCA 1T03A 3C6UA 3HJFA 1RDAA 3VQ7A 1RBUA 4KREA 1N5YA 2DY4A 4CK3A 2EHGA 1R0AA 3SPZA 4OPJA 4CGFA 3K59A 2W42A 4DLEA 4FJ5A 3OYBA 1FKOA 1NOZA 2D0CA 1WNSA 3RMBA 4J2BA 3P83D 2HHXA 3ZSWA 4E3SA 1TVRA 1VSKA 3SYZA 2FBXA 3P5JA 3LWMA 3QINA 4DTRA 1I39A 3TAPA 2E6MA 1BCOA 5J2MA 4M3YA 2KTQA 2OZSA 2HHUA 4C8MA 4DWIA 4PQUA 4IG3A 3SUOA 3KLHA 4KHQA 1HYZA 5D3GA 2OPQA 4FLXA 2OA8A 2I5JA 4OJRA 1SL0A 4E7LA 1RDCA 3WNHA 4GMJB 3SQ2A 5HRSA 4FZXC 4KHUA 1NKBA 3K57A 3SPYA 3V9ZA 3D45A 2F96A 3V6DA 1RNHA 3VQDA 1WSEA 2G8UA 3ZSOA 1KVAA 2HHQA 4BE1A 3HXMA 3IAYA 1UA0A 1IO2A 1HNVA 1HJRA 4KKOA 4O5BA 1JKHA 5CY4A 4CJTA 3I8DA 3JYTA 3EZ5A 3NDKA 3SNNA 3FFIA 3ISNC 3RWUA 1RTDA 3SUQA 4CF8A 4ID5A 4Z4HA 1XWLA 1NOYA 3RR8A 1U04A 4MQ3A 1BI4A 3PUFA 2XRIA 2X6NA 1LW2A 1IG9A 1BISA 4FJ7A 4FK0A 2BANA 3L2WA 3VA3A 1YTAA 4AHRA 3HK2A 3AVGA 5DMRA 3LAMA 3LZJA 3ASMA 4DTJA 1KFSA 4NCBA 1RT4A 4HUFA 4CF9A 2QXFA 3B6PA 3CM6A 3ZT2A 4CGGA 3NH0A 4M3UA 2KFZA 3AVJA 3PX0A 5KGXA 1JLEA 1VSJA 4CK2A 4BE0A 4FXDA 1Z26A 5HBMA 3VQ5A 3QEPA 1WSGA 4CJ4A 3AO4A 4W5RA 4KTWA 3TR8A 4CF1A 4CERA 3MAQA 3QNNA 3LDSA 4KRFA 4CHPA 2YNIA 3DYAA 3VQAA 3K5MA 4O44A 3ZSVA 1L3UA 1B9FA 4BWJA 3KK2A 2Z1HA 3KLFA 1Y97A 4PUOA 4CFCA 4JLHA 3ZSZA 4CEBA 4BDYA 4BDZA 4FLZA 3SUNA 3C6TA 4Q5VA 4KTQA 4RG8A 3OS2A 5HRRA 1QSYA 1MU2A 1JLBA 1S1UA 1B9DA 1JLFA 2FBTA 4CEFA 1O1WA 3QETA 4E7KA 1WSFA 1J53A 3AVFA 2FBYA 5HRPA 2OPRA 3LPTA 1NK4A 4KI6A 3V1OA 1X1PA 4C8OA 3KLGA 1REVA 4XIUA 3L8BA 4OKEA 3TAQA 1TKDA 3I0RA 1NJYA 4W5NA 1RT2A 2YNGA 3OYCA 3M8PA 4E7JA 3SCXA 1D5AA 3RTVA 4Z4IA 1Z25A 2KW4A 3QNOA 4NCAA 3VQ4A 1TV6A 3HP6A 3LANA 3PO5A 3L2RA 4IG0A 5EU7A 2VWJA 4FM1A 4B9TA 3G10A 4W5TA 4KPYA 1TK5A 1F21A 4B8AB 3M8SA 5KRTA 4JRPA 3KD1E 3SQ1A 5I3UA 3B6OA 1HYSA 3NH1A 2KFNA 4LY7A 4CJKA 4DFJA 4CHNA 1C6VA 3NBPA 4CF2A 3HM9A 3C95A 4FJKA 2X78A 3CFPA 1ZBIA 3KK3A 4CGDA 4B08A 3RRGA 4HCBA 4CHZA 5FROA 1NJZA 1JLAA 2YHAA 3TAFA 4OGCA 4CJRA 4RW4A 1VSHA 4WE1A 3HPOA 4FVMA 2HHVA 1ZBUA 4BWMA 3PX6A 1NK5A 4QCLA 5KI6A 2BE2A 5HRNA 4OLBA 5K14A 3QEIA 4EZ6A 2ATQA 4M3TA 2GUIA 4Q0BA 4ELTA 1ZBFA 3OJUA 4YNQA 4DQSA 4B9UA 2P5OA 1NJWA 3KTQA 3LZIA 3KJVA 1X9SA 1VRUA 1CLQA 1IKYA 1NKCA 3TAEA 2HW3A 3AV9A 3DLBA 2YHBA 1W9HA 3M8QA 4HHTA 4KB0A 1BQNA 4DMNA 4KFBA 3U3YA 5HLFA 4TSXA 5C24A 4J2DA 4LSLA 4H4OA 4Z4EA 4DS4A 2PY5A 1RT7A 1BI4B 2GBZA 5JS2A 3VQEA 3MXMA 1U45A 1L5UA 4DFMA 4KHWA 4KTZA 1L3SA 4H4MA 3O3GA 2XY8A 4CEOA 4IBNA 2IAJA 3HSTB 3IS9A 4E89A 3AVNA 3WNEA 1XHZA 3DLGA 2F8TA 3HPGA 1TL1A 1BQMA 1S6PA 5CYMA 1TKXA 4AHUA 4DF4A 4N56A 1XI1A 1T8EA 3AO1A 3ZCMA 4FW2A 3ZT1A 1EETA 4DSJA 4F2RA 1EKEA 2ITGA 4M3RA 2R7YA 2FBVA 4FLWA 1LWCA 3DLRA 4HCCA 1C1AA 4KV8A 1X9MA 3AVCA 3V9UA 4HUEA 4EZ9A 3HYFA 4O4GA 1DLOA 3V9SA 1SKRA 4BDPA 3AVBA 3DLKA 4DSFA 3OYAA 2P51A 4M3WA 4NCGA 3OS0A 4L8RB 1I3AA 4HUGA 2QKBA 3TARA 1JXEA 3K2PA 4O0IA 2VG7A 1ASUA 1K6YA 5FDLA 1RDDA 3U3GA 4I7FA 1TAUA 3PX4A 1JL1A 4CEDA 3BGRA 4RW8A 4HTUA 4FJHA 2XHBA 3LP3A 3V9XA 2Y1IA 4I9QA 4CIEA 3TI0A 1VSMA 4Z0UA 4QAGA 3THVA 1A5VA 2G8HA 1RBSA 3VQCA 4DTPA 4KHSA 1N6QA 3KKSA 3LP1A 1RTHA 3K5LA 3NHGA 1SUQA 3AVIA 2G8FA 4KHYA 2Y1JA 5J2QA 4CCHA 3NCIA 3T3FA 4M3XA 4B3OA 1XHXA 3ULDA 4NYFA 1S9EA 4DTNA 4B9MA 3KLIA 1BGXT 4CFBA 2ETJA 4PWDA 5J2NA 4CJ5A 1QTMA 4FK2A 2IOCA 1S9GA 3K5OA 2OYQA 1TK0A 1FK9A 1JLGA 3ZSXA 3NGIA 3VN5A 4CHYA 1WLJA 4H8KA 4FM0A 3ZSQA 2G8WA 2RN2A 3MXIA 3QEWA 4O0JA 2RKIA 4DTXA 2G8IA 2Q3SA 3OVNA 3IRXA 1LAWA 4FM2A 3V9WA 2ZE2A 2Z1GA 1WSJA 1YVUA 2G8KA 1DTQA 4FZYA 3LP2A 3O3FA 3OYKA 3A2FA 3H08A 4CESA 3MEEA 3NFAA 1KFDA 1ITGA 4CEAA 3OYJA 1SL2A 4DSEA 4C8KA 3CM5A 4BE2A 4Y1DA 4AHTA 4E7IA 2BDPA 3RR7A 2G8VA 4ZHRA 1W0HA 5I42A 2E4LA 4E0DA 4FJXA 1NK0A 1CXQA 1FKPA 1VSIA 3OYHA 2P5GA 3RMCA 1VRTA 4IKFA 3NH2A 4GW6A 4ELUA 1EX4A 2NUBA 3AVHA 4I9LA 1Q9XA 2IC3A 3MEGA 5C42A 3QESA 3U6FA 4I2QA 4DU3A 1WAFA 1NJXA 3HO1A 3C94A 1BIZA 3QIPA 4E19A 4CGHA 3LPUA 3QERA 1SKSA 4LSNA 5FRMA 4ICLA 2KZMA 3RMAA 3SI6A 4C8LA 3VQBA 4FJNA 1SKWA 1ZYQA 1C1BA 3MECA 4FJIA 3S3OA 4CEZA 1LWEA 4RW6A 1RILA 4CJLA 1KSPA 1C0TA 3I0SA 3UIQA 3QLHA 3AA5X 2O4IA 4F3TA 3CQ8A 1RBTA 3ALYA 3HP9A 1EP4A 2GV9A 4DTMA 4F4KA 3AA4A 4CFAA 3EYZA 2HNZA 3O4NA 2FC0A 4AHCA 2IGIA 2HB5A 2BGGA 1VSLA 2YKNA 4CJQA 4E7HA 4E1MA 3QEXA 1GOCA 5CYQA 4OKKA 3NE6A 3OYMA 4PA1A 1UA1A 3OYNA 3CG7A 4CHQA 1SV5A 4DLGA 4FLYA 2DFEA 4AHSA 2D5RA 4Z4FA 4HVJA 3ZSRA 1TKZA 5CZ1A 5HROA 1J5OA 5CZ2A 1TL3A 3LWLA 3TAGA 3PY8A 3KIOA 3AVLA 4IFVA 4R5PA 2VG5A 1WAJA 4FLTA 3PO4A 4BACA 3TWHA 3S9HA 4FJMA 5HP1A 2JLEA 2HNYA 4B9SA 1EXQA 4DF8A 3ZSYA 3TANA 4GVMA 4FZZA 4CGJA 2YNFA 1BIUA 1RBRA 2ZQBA 1RDBA 3L2VA 1B92A 2JGUA 4B8CA 4B9LA 3K58A 2O4GA 5KTQA 4KO0A 3T19A 2IS3A 4CIFA 1U49A 1HNIA 3BDPA 3V81A 3SJJA 4DSLA 1KLMA 3HVRA 3VA0A 2VG6A 3EY1A 3DLHA 3SV3A 3DI6A 3AVAA 1D9FA 1UAXA 4E1NA 4C8NA 1LAVA 4AHVA 2YV0X 1T05A 3AVMA 5SZTA 3DM2A 3WNFA 4DS5A 3NF9A 4CIGA 3JSMA 1KVBA 3OYFA 2PYJA 4KAZA 4CJWA 4CEQA 4K8XA 4DFPA 2HHSA 1VSFA 4CJ3A 2XO7A 4K8ZA 3HVTA 1HPZA 3DOLA 4O55A 4DTUA 1Q8IA 2P1JA 3VQQA 3SZ2A 2QKKA 1QSLA 1L3VA 3KKRA 1WSIA 3O4QA 4F2SA 3NGYA 4DTOA 1NK6A 3KD5E 2OPPA 1BL3A 1C1CA 2VWKA 3AO3A 3L2UA 2EX3A 3O3HA 4FYDA 5J2PA 2A1RA 4DFKA 2HNDA 1DTTA 4FLVA 2AJQA 3E01A 4KB1A 4W5OA 1JXBA 4ID1A 1C0MA 1C0UA 1UWBA 3OYGA 3OYIA 4J2EA 1CXUA 4Y1CA 3G0ZA 3S3NA 3NGZA 1RCHA 1ZBLA 2HVHA 2WONA 3VQPA 1JL2A 3OJSA 1KTQA 2X74A 4F3OA 1YT3A 3AVKA 2Z1JA 2XY5A 3AO2A 3QO9A 1HQEA 4W5QA 3K5NA 4LD0A 3SV4A 4CJSA 1JLQA 1VK0A 4CE9A 1GOAA 4N47A 2HHWA 4FJGA
chains in the Genus database with same CATH superfamily
3DRRA 2QWQA 2W6KA 1BUPA 5KRSA 3F9KA 1WSHA 2KZZA 2F9TA 2GX9A 1D4XA 1Q9YA 4AH9A 4CJVA 3A5NC 3ZT3A 1K8KA 5E41A 2KQ2A 3VEYA 4JKHA 5LMUK 4HTLA 2WFBA 3VGKA 3MXJA 5J1EA 3H1QA 1S1XA 1XMOK 2A1SA 5GIOA 3T1AA 2RPIA 2HHTA 4EHTA 4B9NA 3TSPA 1S1WA 3S3MA 3R1XA 3DOKA 3OYLA 2NZTA 1TGOA 2E88A 3M8RA 2OPSA 4JAXA 3SAGA 3SQ4A 4M41A 4BVPA 5FRNA 4GVEA 4ELVA 3FE1A 1J9AA 3HL8A 4YOWA 1HNZK 2X6SA 2OCEA 3V1QA 3SQ0A 1LWFA 1X3MA 1BHLA 3LALA 1LV5A 3TAMA 4JS4A 1ASVA 2IVNA 4OVLA 4DR1K 3G71N 3GE1A 3C65A 4DSKA 4ZTJA 3FLCO 1VQ5N 1C0GA 3IKMA 5AJ3K 4BRFA 3UKRA 1TK8A 3IMXA 2IDOA 4YY3K 3HT3A 4JNEA 3OA9A 1D9DA 3FZFA 2E6LA 4CJUA 4DU1A 4KI4A 2HMIA 4M45A 5AFUH 3MEDA 3ENBA 1GLFO 1LW0A 4CBXA 1KQSM 3GL1A 2PBDA 1J6ZA 3OYEA 4UQGA 3NF6A 2B6AA 3DRSA 4KREA 3J7AP 1T6CA 2EHGA 2W42A 1K9MO 3RMBA 4J2BA 4EAHD 3H3OB 4JKCA 5KPZA 3LWMA 4DTRA 2KTQA 1GLDG 4IG3A 3ID8A 3LDLA 4XH1A 1OVYA 2OA8A 4FLXA 2I5JA 5M1KA 2W6LA 4EHUA 4FOIA 1NGIA 1KC8O 3V6DA 1QQMA 2ZJQL 3PLAA 5M1OA 1VQMN 1BDGA 1W7AA 1UA0A 1HNVA 4KKOA 4J8FA 3WUHA 3I8DA 3SNNA 3VESA 1ZYQA 1NGFA 3OW2M 4JKFA 3JXUA 3PUFA 3HZ6A 1XNRK 4FK0A 3AVGA 2E1YA 3ASMA 1HPMA 4HUFA 3IUCA 4CF9A 4BC2A 2AA4A 3B6PA 3CM6A 4MLEA 2A6AA 4YOYA 3PX0A 1JLEA 1ZC6A 2D0OA 4W5RA 4KTWA 4CF1A 3CD6N 4CI6A 1GLAG 3VQAA 1OVQA 1B9FA 3KZBA 4DR7K 5LJWA 4PUOA 1HNXK 1NGCA 2FBTA 5BR9A 1WSFA 3CC4N 2FBYA 4KI6A 3LPTA 2HBLA 3BZCA 3OBYA 4XIUA 4H5VA 4OKEA 3TAQA 3HRGA 4Z4IA 2UXBK 4XH5A 3QNOA 3VQ4A 5HOOA 2NRRA 3G10A 1MWMA 4K25A 4KPYA 2EWSA 2V52B 4KHPK 1F21A 3VEZA 3H1VX 3AAQA 2D4WA 5BRFA 4CJKA 2WTUA 3BF1A 3AGRA 3E66A 2X78A 3CFPA 4DV3K 3J80O 3KK3A 4L3QA 4CHZA 3VF2A 2PAVA 5FROA 1JLAA 2CH5A 3HPOA 2HHVA 4BWMA 4JD2A 2BE2A 5AR0A 5HRNA 5K14A 3QEIA 4ELTA 4YNQA 5AQQA 1WOQA 3KTQA 5CE3A 1VRUA 1DEJA 1X9SA 4EIAA 3TAEA 4CZJA 1HKBA 3DLBA 3R6MA 4DMNA 3U3YA 5HLFA 1HNWK 3CCLN 4TSXA 5C24A 4Z4EA 4H4OA 4WQ4C 3VQEA 1BI4B 1TUYA 1E4GT 4CD1A 3MXMA 1ATNA 3O3GA 2D1KA 5AQVA 4E89A 3CXCM 3HTVA 1BQMA 4DF4A 3MDQA 3CCMN 4AHUA 1T8EA 2E1ZA 5C12A 4DR2K 4F2RA 1TUUA 3DLRA 4HCCA 2JWLA 3MWPA 3EKUA 4EZ9A 3HYFA 3PSFA 3V9SA 1SKRA 3U9ZA 3O5BA 2F9WA 2QKBA 3CPEA 4ISFA 1RDDA 3MN6A 2IIRA 4BREA 2O8DB 2BTFA 2UYTA 3WT0A 5C2DA 1FW6A 5AQXA 1QHAA 4GV6A 1VSMA 3THVA 1WB9A 4ILGB 3LP1A 3K5LA 4R79A 4NYFA 4DTNA 3KLIA 4CJ5A 1S9GA 4K42A 1IBKK 3ENOA 3LDQA 3MXIA 3QEWA 3H46O 4BRAA 1LAWA 1YVUA 4MLHA 1DTQA 1DT9A 4A2AA 1KFDA 4H0XB 5KQDA 3BUZB 4DR3K 4C8KA 4AHTA 2G8VA 4ZHRA 1W0HA 5I42A 4FJXA 4JN4A 3TTFA 3OYHA 1EX4A 2NUBA 1Q9XA 3MEGA 4WQ5C 3U6FA 4I2QA 4DU3A 3HO1A 1XMQK 2KHOA 3MX2A 4WFBL 3O9SA 3VQBA 1IV0A 3WXKA 3MECA 4RW6A 3CMEN 2O4IA 2NRZA 3ALYA 3HP9A 1EP4A 2GV9A 3AA4A 1VQLN 2HNZA 1OH8A 4B1ZA 1VQ7N 2HB5A 1VSLA 4DUYK 2YKNA 3L6QA 3OYMA 3OYNA 2DPNA 4BROA 5C0YA 4HVJA 4PL7A 1TKZA 3I56N 1Q82O 3PY8A 5CZ2A 3VF6A 3AVLA 2VG5A 3PO4A 1HR0K 3S9HA 3EZWA 2ZJPL 4IEIA 4CVNE 5HP1A 4B9SA 2IVOA 1SS6A 1RDBA 1MDUB 2JGUA 2UXCK 2OANA 3K58A 3OHRA 3ZX3A 1LCUA 3SJJA 2VG6A 5CR4A 1KAZA 3DI6A 1D9FA 1T7PA 4KH4A 4E1NA 4AHVA 3AVMA 4WQ4A 3CPWM 4A62A 3Q7CA 4PKGA 5B8HA 1IG8A 4KAZA 1KVBA 5AQRA 3OYFA 4ILJA 2HHSA 1IBMK 2P9PA 3HVTA 4DTUA 5AQIA 2P9SA 3K0SA 3O4QA 2HSTA 4F2SA 3L2UA 5DM6L 2EX3A 3O3HA 1H1VA 5KPRA 4DFKA 4A5AA 5BN8A 4IOCL 1JXBA 4ID1A 1VQNN 2HVHA 3W3DA 3OJSA 4LF5K 1YT3A 3D2FA 3SV4A 1GOAA 2WBNA 2HHWA 4FJGA 3MN5A 5DK5A 4JI7K 3RSEA 5HL7L 3VQ6A 2F8SA 4M42A 4DV7K 2B5JA 4JI3K 3CCRN 3LAKA 1NKEA 4FPAA 3O9TA 3UKUA 3EE8A 1WBDA 5TKYA 3WXIA 4FWSA 2P9UB 1CZBA 3ID6A 2LSNA 3LDPA 2FXUA 1S1VA 4PY5A 2W41A 4FSVA 4FJLA 1KCFA 3DLEA 1HMVA 1RT6A 2RF2A 2E2QA 1SL1A 1FXXA 4OPKA 1FJGK 4A5BA 4DQRA 2DFHA 2I7NA 4V19S 2PZSA 1HRHA 2NNWA 4FW1A 4G9ZA 4YHHK 4H5WA 1HX1A 3VMFB 3LDNA 5GADP 4YFUA 4F8RA 3FZMA 1T3VA 4N76A 5IT9O 3DXMA 2V7YA 3ZT4A 4DG1A 5JICA 3OS1A 5JS1A 3CCJN 1IBLK 1NGDA 1NK8A 3KK1A 3DMJA 2YKMA 3I33A 1TKTA 1NGGA 4DTSA 3VEXA 4CJEA 3AA2A 1IH7A 3CC2N 1TYQA 3PIOL 2O8CA 2BUPA 3G4SN 4K0KK 1VQ9N 4LFCK 1RT5A 3L2QA 4BY9C 2F7TA 4RCHA 3ZYYX 5AZIA 1S1TA 1E4FT 3WEEB 3KVGA 4QS9A 2B4JA 2OZMA 2Q0RA 4CECA 3PV8A 4EP5A 2E20A 2XY7A 1JLCA 3HOTA 3RRHA 1QQCA 3QDKA 1RT3A 4CZMA 3OYDA 3NAEA 1EO1A 4CFDA 3BF3A 1GLBG 1SZ2A 3CJ9A 1CZ9A 1RTJA 4DQIA 1RDAA 3VQ7A 1RBUA 3IDHA 1R0AA 1VAZA 3SPZA 2P9IB 2P9LB 4CGFA 3K59A 1FKOA 2D0CA 4E3SA 4I6MA 4IDHA 4MDAA 5J2MA 1GLCG 3WEEA 1M90O 2OZSA 4M3YA 3KLHA 5AZIB 5D3GA 3CQYA 2QWMA 2UUCK 1LOTB 4BQZA 3QBWA 4FZXC 5JVHL 3K57A 3V9ZA 2O8CB 3ULEB 1YUWA 1HLUA 3P4IA 4CZGA 1XUPO 2G8UA 3ZSOA 2O8FB 3KWIA 3SMPA 4DR4K 3QB0A 4O5BA 3NDKA 3C7NB 2O8BA 1SQKA 3RR8A 2X6NA 4LFBK 1IG9A 4FJ7A 2BANA 4PL8A 2VQFK 4DQ8A 4OPHA 4M3UA 4LF9K 4X64K 1SAZA 5EVZA 2FF3B 4IO9L 4A59A 5HBMA 3F5TA 4IOAL 5I9EB 4CJ4A 3J8AA 1BWFO 3AO4A 2Q1NA 1Y64A 4CERA 4BRGA 3MAQA 3QNNA 3T7ZA 2ASMA 4CZHA 3K5MA 2P9KB 4O44A 4BWJA 4C1NI 4WQ5A 3ZSZA 4CEBA 4BDZA 3SUNA 4KTQA 3C6TA 5HRRA 1B9DA 3SMSA 4CEFA 4E7KA 3UKUB 5FPMA 1NK4A 1X1PA 3L8BA 3I0RA 2ZGYA 1MA9B 4IJNA 4W5NA 1RT2A 4E7JA 4FWNA 3M8PA 5AQUA 4DCHA 3SCXA 3SAFA 1Z25A 2KW4A 2QEXN 5LMNK 5BPMA 3VTIA 3LM9A 3HP6A 4KH6A 3PO5A 1NU0A 2F4VK 2NRWA 5EU7A 2VWJA 3MWTA 1S22A 1TK5A 3M8SA 5KRTA 1NGAA 2CGJA 3D2EA 3BEXA 4LY7A 4C23A 4CHNA 3C95A 1NJZA 2P9SB 2YHAA 3O9QA 3TAFA 4OGCA 4DB3A 5H1SQ 2Q31A 3PX6A 4BG8A 5C2FA 1VQKN 5KI6A 3T1YK 4OLBA 3THYA 2E2NA 2D0PA 4HWIA 3OJUA 2P5OA 3I55N 1NJWA 3LZIA 5M1PA 1W9HA 5ADXA 2WC9A 3E9LA 4PKIA 3THWB 4KFBA 3JAMO 4J2DA 2I7PA 4KHQA 1RT7A 2GBZA 1U45A 1L5UA 4H0TB 4DFMA 4KTZA 2NRXA 5GAGP 1YXQA 3C7NA 3AVNA 3O1WA 4H5TA 3TSUA 1XHZA 1ATRA 1K8AO 2F8TA 5CYMA 1TKXA 2E8AA 3ULEA 4N56A 5F2RA 3AO1A 1EETA 4JI1K 1EKEA 2ITGA 2VYPA 4M3RA 2R7YA 2FBVA 4FLWA 1LWCA 1RDWX 2O8EB 1Q81O 3L4IA 3AVBA 4DV1K 3GOIA 4M7XA 2V51B 4HUGA 1JXEA 3PX4A 1JL1A 4BC3A 3BGRA 4RW8A 4FJHA 2P9NB 2P9LA 2P9IA 3LP3A 2QM1A 4I9QA 4CIEA 1A5VA 4IOXA 1RBSA 3VQCA 4JI8K 3TSQA 4FOEA 1N6QA 4H0OA 3NHGA 1SUQA 3A5MC 4KHYA 2Y1JA 3IFRA 1U6ZA 4B9MA 2QWPA 2KLAA 2E2PA 4CFBA 2OYQA 3P39A 1JLGA 3PIPL 3VN5A 1WLJA 4FM0A 2RN2A 3V9WA 4YOUA 1Z6RA 2ZE2A 3CC7N 2Z1GA 1WSJA 2HHHK 2QW9A 4FZYA 3LP2A 3TTCA 3H08A 1QQNA 3NFAA 1NM1A 3ZX2A 3M5RA 3OYJA 4RTFD 1TYQB 4Y1DA 4E7IA 4OX9K 4BGAA 1NK0A 2HOEA 1FKPA 3CIPA 2P5GA 1WBBA 1JCEA 1VRTA 4IFEA 3NH2A 4GW6A 1GLJO 2IC3A 3QESA 5C42A 2E5LK 1NJXA 1M1KO 1KXPA 3QIPA 1YJ9N 3QERA 3O08A 3A5OC 4ICLA 3JS6A 4KH5A 3RMAA 4C8LA 4FJNA 4BRMA 1SKWA 1C1BA 4CEZA 4CJLA 1C0TA 3I0SA 3EL2A 4F4KA 4BRKA 4CFAA 1U2VA 3O4NA 2BGGA 4E1MA 1VQ4N 3NE6A 3ZLJA 4OKKA 1UA1A 1SV5A 2DFEA 4AHSA 2D5RA 4JKBA 4AF1A 5HROA 5CZ1A 1J5OA 3TAGA 1TL3A 4R5PA 4BC5A 5EXWA 4BACA 4FJMA 3KWGA 3MN9A 2P9UA 4LF6K 3TANA 4FZZA 3C6AA 3L2VA 1P90A 1HNIA 3RSEB 4DSLA 3HVRA 1NGJA 3VA0A 3AY9A 3EY1A 4N41A 3SV3A 2Q2RA 2Q36A 3AVAA 5EOYA 4C8NA 1T05A 4ISEA 4YDUC 2HBJA 4NB4A 2PYJA 3VENA 2NRVA 4DFPA 4CJ3A 3VERA 1ATSA 4O55A 3T1HK 1Q8IA 2P1JA 3SZ2A 3CCSN 4X66K 4DTOA 2VWBA 1BL3A 1C1CA 2ASPA 4DKWA 5ADXH 1JCFA 2HBKA 2AJQA 4KB1A 3BP8A 3EO3A 1UWBA 1BA1A 1CXUA 4Y1CA 2P9PB 3G0ZA 3S3NA 3NGZA 1ZBLA 4FL9A 4DR5K 1KTQA 2X74A 3FGUA 3MN7A 4LFAK 4F3OA 2KKZA 3HSCA 1DGKN 2Z1JA 4IXCA 3FFKB 4W5QA 1WUAA 4LD0A 3R8EA 4CZKA 5AQJA 3HPHA 4M3ZA 4DQPA 4Z4CA 4CK1A 4JRQA 1QHTA 1YAGA 4YDUA 4FJ9A 3KLEA 4H5RA 3H45C 3EKSA 1MWKA 4CJFA 1NJIO 2A40A 3QEVA 2WOMA 1A5WA 4CF0A 3QFPA 1P8ZA 5SWMA 1IKXA 1NLVA 3CCUN 2XY6A 3ZETB 1S5JA 1KVCA 1ASWA 4BR7A 2YNHA 4CHOA 1VSDA 4H0VB 4LH4A 3CCQN 4YOTA 4OPAA 1Q18A 3ZT0A 1U47A 3BZKA 3D0PA 4FCYA 3AO5A 5JLFA 2RHKA 5AQTA 3L3UA 3ITHA 3R3LA 4BG9A 3CCVN 4B3MK 1S3XA 2CGKA 1NK7A 3DRPA 1BU6O 2DTUA 3P31A 2ZD1A 1U4BA 3SJHA 4JKDA 3WNGA 1Q86O 1QSSA 4RW9A 4DQQA 4I2PA 3MK6A 4DUZK 2Z1IA 1G15A 1A5XA 3AA3A 3NF8A 4FK4A 1XQSC 5C15A 3O8MA 4OKJA 4DU4A 3F73A 1NK9A 3CETA 3VQ8A 1HYVA 4O8UA 1L3TA 3G25A 3O9RA 3P1GA 1KLNA 3OTOK 2YJFA 1J54A 3CI5A 3CYMA 5AQKA 5KGWA 3VQ9A 3RMDA 1OH5A 1O13A 1BO5O 2D0AA 3SLCA 3LP0A 3TABA 3CFRA 1HUXA 4LH5A 3V1RA 2PYLA 2FF6A 4NYNA 4LF4K 4GV9A 1CZAN 5BRDA 2YHWA 5AQOA 4DHYA 5JLHA 5JVGL 3HM8A 1RT1A 4N5SA 1VSEA 3IG1A 1IKVA 3VTHA 2KFZA 3HJFA 1UOCA 2DY4A 1N5YA 1HKCA 4DLEA 5E84A 1NGBA 4IWVA 2HHXA 3ZSWA 1TVRA 2O8DA 3SYZA 2FBXA 3P5JA 3C0BA 1KAXA 3QINA 1RFQA 1BCOA 4BR9A 3U4LA 3H6EA 2HHUA 4C8MA 3QFUA 3SUOA 1HYZA 2OPQA 5AQSA 3F2KA 2YCHA 5BPNA 4DV0K 4E7LA 4GMJB 5HRSA 2QA4N 4MO5A 3SPYA 3GBTA 3O4WA 4DV4K 3IAYA 1IO2A 4CJTA 3JYTA 1JKHA 2GELA 3R9PA 3EZ5A 3RWUA 4B1XB 3FFIA 3ISNC 3PSIA 3SUQA 4CF8A 4ID5A 1V4TA 1XWLA 4QS7A 1GLLO 1OKJA 1U04A 5GIPA 1N32K 4MQ3A 1BI4A 1LW2A 3CJBA 1BISA 3VA3A 1YTAA 4AHRA 3LAMA 4DTJA 1KFSA 4NCBA 4U7BA 2QXFA 4CGGA 3NH0A 3ZT2A 4BR2A 3AVJA 3DLLL 4X65K 4BE0A 3VQ5A 1N33K 3VPZA 1WSGA 5GINA 1QVGM 5BRHA 4CZFA 4CHPA 2YNIA 3DYAA 5E26A 2ASOA 3UE5A 3E1YA 2Z1HA 1Y97A 4CFCA 4JLHA 4BDYA 1NGHA 4JK7A 4FLZA 4RG8A 3OS2A 3WQUA 1QSYA 1BOTO 5GAEP 1C0FA 2FSNA 3O9UA 2OPRA 3KK7A 3V1OA 4C8OA 5AQWA 3WQTA 4FWQA 1REVA 3J7YP 1ILYA 3ENHA 2YNGA 3OYCA 1D5AA 3LL3A 4NCAA 3LDOA 4H0PA 4QS8A 4IG0A 4NXMK 4CW7B 3SQ1A 5I3UA 3B6OA 2OTLN 3NH1A 4B3TK 4PHTX 3ZEUB 3HM9A 2A5XA 4CGDA 3EN9A 3VF4A 1HJOA 4CBUA 4CJRA 4BRPA 4RW4A 1YIJN 4Y0WA 5AQNA 1NK5A 4QCLA 5EY4A 4M3TA 2GUIA 4WFAL 4Q0BA 1JCGA 1ZBFA 4B9UA 3VEWA 4JV5K 3CJ7A 1YJNN 1IKYA 1NKCA 3AV9A 2YHBA 3M8QA 4HHTA 1G99A 1BQNA 4FWPA 4FWRA 1E3MA 4BQLA 4FJIA 2PY5A 5JS2A 2NRTA 4KHWA 3G6EN 4JEPA 4U67L 5FPNA 2IAJA 4YOVA 3WNEA 1EQYA 3DLGA 3EE9A 1XI1A 4H03B 3CF5L 3ZT1A 2IVPA 2VCPA 2YHYA 3BY5A 4KV8A 1X9MA 3AVCA 3V9UA 1DLOA 4BDPA 5FLXO 2P51A 4GV3A 4NCGA 3OS0A 4L8RB 3TARA 3K2PA 4O0IA 5ELZA 1ASUA 1K6YA 1YJWN 1VQ8N 4I7FA 5AQMA 1TAUA 4DV5K 1NGEA 4HTUA 3V9XA 4Z0UA 3VETA 4DTPA 4KHSA 3AVIA 3I8BA 4CCHA 3NCIA 4M3XA 4JK8A 1XHXA 4B3OA 4PWDA 1BGXT 2ETJA 1QTMA 3OBWA 3K5OA 1TK0A 2NLXA 3NGIA 1YF5L 3ZSQA 3SBTA 2G8WA 4O0JA 2QWOA 2G8IA 3UKRB 2Q3SA 4FM2A 4LF8K 3UB5A 4WFNL 2BH1A 4YORA 4NLCA 3MCPA 5AQHA 1NBWA 2UU9K 3OYKA 1QZ6A 4CESA 1ZBSA 1BA0A 4BRIA 2BDPA 3H3NO 3TU5A 4E0DA 2FLOA 4BRCA 3O80A 4DR6K 1JJ2M 4NXNK 4IKFA 4ELUA 3AVHA 2JWKA 1WAFA 4XH4A 2P9NA 3MCAB 4CGHA 3LPUA 5FRMA 4KBOA 3SI6A 2YHXA 4MDBA 3S3OA 1RILA 3VGLA 1KSPA 3UIQA 3NMUA 5AZJB 3QLHA 3CCEN 3HOSA 4DTMA 2FC0A 4AHCA 2IGIA 2O8EA 2ITMA 4NO7A 3T69A 5CYQA 4JKGB 3CG7A 4BR4A 4DLGA 1XNQK 3ZETA 2YX6A 3KIOA 4IFVA 3EEQA 4FLTA 1K8KB 3AGKA 2JLEA 2HNYA 1OH6A 3LM2A 3ZSYA 4GVMA 5LY3A 4CGJA 2YNFA 1BIUA 1RBRA 3N4PA 2J4RA 4EFHA 1B92A 3THWA 4KO0A 2GTDA 1U49A 1YI2N 1N36K 1UAXA 1LAVA 3FZKA 3J81O 4LF7K 4DS5A 2WUSA 3NF9A 4CIGA 4B9QA 4CJWA 4CEQA 1VSFA 3SBGA 2XO7A 3DOLA 1NG9A 3VQQA 2QKKA 3KKRA 4BRNA 1WSIA 3GG4A 2VWKA 3AO3A 5DM7L 1VQPN 2A1RA 5KQ8A 2HNDA 1DTTA 4FLVA 3D2EB 4JKEA 2H3GX 4JI4K 4W5OA 1C0UA 2WONA 3VQPA 3FZHA 2QI2A 5A2QO 3AVKA 3C6HA 2XY5A 4CJSA 1JLQA 3VEVA 4N47A 3N4QA 4FLUA 3CFOA 3L3VA 5BREA 3VEOA 1OH7A 3CHWA 1HQUA 1KAYA 4B1UB 4XEIA 3DWLA 3NVMA 4JKAA 3TPQA 4GKKK 4CZIA 5T7BA 1GLEG 3E9PA 5JMVA 4CEEA 4AILC 4FJ8A 1IJJA 4FWOA 5C25A 1XC9A 4Z4GA 1T44A 5AQGA 2Q97A 2P9KA 5AQLA 1QE1A 4PQUA 4B3RK 4FJJA 5AQYA 1RTIA 1RDUA 3MX5A 4OLAA 1U2VB 4A61A 1TAQA 3VGMA 3F9MA 5TKWA 4GY2B 4FVUA 2DFFA 1S6QA 4QOZB 3CJCA 4JS5A 4EP4A 4IDKA 2A41A 4J2AA 1ESVA 1WN7A 2HVIA 1RBVA 5IWAK 3THXA 4MFBA 3SUPA 3SK3A 1QQOA 4WYBA 2FSJA 1ZBHA 2GEMA 3QICA 2D0BA 1U48A 1KRPA 1IKWA 4ZTFA 1NMNA 3V4IA 1V4SA 1GOBA 3NF7A 3D7EO 1RGIA 4RW7A 4CJ7A 5AQFA 4I6MB 3QIOA 4WF9L 4IFYA 4DSIA 3WXLA 3L4QA 2UXDK 4IEEA 4B9VA 1D8YA 5LJVA 1X9WA 4FWMA 4OGEA 4G1QA 3K9JA 4H0YB 1BCMA 4CGIA 3OY9A 1QS4A 2CGLA 2QK9A 4CJPA 1T03A 2ZM6K 3C6UA 2VGNA 4CK3A 4OPJA 4FJ5A 3OYBA 1NOZA 1WNSA 3TTDA 2VQEK 3P83D 1X9JA 1VSKA 3WXMB 2QWRA 3CQXA 1I94K 1I39A 3TAPA 2E6MA 3QBXA 2RE2A 1VQON 1N8RO 4CD3A 4DWIA 4OJRA 1SL0A 1RDCA 1EWRA 3WNHA 4F9OA 5LL6Z 3SQ2A 4KHUA 1NKBA 3D45A 2F96A 1RNHA 3B8AX 1WSEA 3VQDA 4A2BA 1R59O 1KVAA 4MO4A 2HHQA 3L0QA 5AFUA 4BE1A 3HXMA 4OO1J 5CY4A 1HJRA 1RTDA 4Z4HA 4M7YA 1NOYA 3THXB 2XRIA 5M1NA 3DXKB 3L2WA 1DKGD 4BRLA 3HK2A 3ATVA 5DMRA 3LZJA 1RT4A 3S41A 1W2BM 4BRHA 2PFUA 5GAHP 3GDQA 4ILHA 2ZGZA 1YITN 5KGXA 1VSJA 4CK2A 4FXDA 1Z26A 3QEPA 4IJAA 3MMVA 3THYB 3CJ1A 3TR8A 5BR8K 4H5NA 3CERA 3LDSA 4KRFA 4FO0A 5BPLA 3ZSVA 1L3UA 3KK2A 3KLFA 3FZLA 1YHQN 4Q5VA 1X3NA 1MU2A 2V7ZA 4JI6K 1JLBA 1S1UA 1JLFA 4CZEA 1O1WA 4JHDA 3D6RA 3QETA 1J53A 3AVFA 4C1NK 2YI1A 5HRPA 2QXLA 4GNIA 4DV6K 3KLGA 2GWJA 1ZXOA 1TKDA 1NJYA 3ATUA 2HF4A 3RTVA 3HBTA 1Q7YO 1TV6A 2HBMA 3D2FB 3RVCA 3LANA 3L2RA 4BRQA 3AARA 1VQ6N 3U8XA 4FM1A 4B9TA 4W5TA 3E9OA 3KHYA 1NMDA 4B8AB 2YJEA 4JRPA 5AQZA 5FPEA 4K43A 3KD1E 3O6WA 4JI5K 1HYSA 4JHDB 2KFNA 4DFJA 3VOVA 3WXJA 1C6VA 3NBPA 4CF2A 1ZBIA 4FJKA 4HCBA 3CMAN 4B08A 2FSKA 3RRGA 3SAHA 1HKGA 1VSHA 4WE1A 4FVMA 3QMLA 4JYAK 4AQYK 1ZBUA 4CBWA 5AQPA 4EZ6A 2ATQA 4DQSA 4FWKA 3KJVA 1CLQA 4AM7A 2HW3A 4KB0A 2Q0UA 4O8KA 5CHIA 4WCEL 2QTDA 4LSLA 3DXKA 4DS4A 1YTUA 3A5LC 3M1FA 4M63C 1L3SA 4H4MA 2O8BB 4YOXA 2NRHA 2XY8A 4CEOA 4IBNA 3HSTB 3IS9A 4JI2K 2O8FA 3HPGA 1TL1A 1S6PA 2ZWHA 3CJAA 3ZCMA 4FW2A 4JKGA 1YVNA 4DSJA 2ZJRL 4RWTA 1C1AA 2CH6A 4FWLA 1NNEA 4BR0A 4HUEA 4O4GA 3P38A 4FPBA 2OTJN 3DLKA 4DSFA 4JI0K 3A8YA 3OYAA 5F0XA 3M6GA 4M3WA 4Z94A 1I3AA 5AZJA 3HI0A 2VG7A 5FDLA 2AP1A 1QZ5A 4PKHA 3U3GA 4CEDA 3AAPA 4CZLA 2XHBA 2Y1IA 2GUPA 3TI0A 5M1QA 5M1FA 4QAGA 2G8HA 1BG3A 3KKSA 1RTHA 4B3SK 2G8FA 5J2QA 3T3FA 2QWNA 4O5FA 3ULDA 1KD1O 4IO8A 1S9EA 5J2NA 4FK2A 2IOCA 3M3ZA 1FK9A 3ZSXA 2A42A 4JK9A 4CHYA 2ZF5O 4H8KA 2RKIA 3FR0A 3W0LA 4DTXA 4BGBA 3OVNA 3IRXA 4E1JA 2HF3A 2G8KA 3O3FA 5C10A 3A2FA 3MEEA 4CEAA 3O1BA 1ITGA 1SL2A 4DSEA 3CM5A 4B1YB 4BR5A 4BVOA 4BE2A 2UUBK 3RR7A 3A0IX 2E4LA 1CXQA 1VSIA 3RMCA 5EX5A 4I9LA 3DXMB 3C94A 1BIZA 4X62K 5KPTA 1T6DA 4E19A 1SKSA 2UUAK 4LSNA 2KZMA 3ZX0A 3U9DA 5F1XA 1LWEA 4DV2K 1QVFM 3AA5X 4F3TA 3CQ8A 1RBTA 3J7ZO 1J5EK 3EYZA 4BC4A 2W40A 2GWKA 1S72N 4CJQA 4E7HA 4B1VA 3QEXA 1GOCA 1W97L 1Z05A 4PA1A 3NVKA 1NWKA 4CHQA 4FLYA 4B1WB 4Z4FA 3ZSRA 3LWLA 4ISGA 1WAJA 3TWHA 1EXQA 4DF8A 2ZQBA 4B8CA 4B9LA 2O4GA 5KTQA 3T19A 2E2OA 1N34K 2IS3A 4CIFA 3BDPA 3V81A 1KLMA 4KHNA 3DLHA 4BRDA 2YV0X 5SZTA 3DM2A 3WNFA 1EWQA 1VHXA 4IZ9A 3JSMA 5BN9A 4K8XA 4JD2B 4LC9B 4K8ZA 1HPZA 1XC3A 4NLBA 1QSLA 4K41A 1L3VA 2A3ZA 5MLCQ 3NGYA 1NK6A 3KD5E 2OPPA 4GKJK 3DAWA 4UY8O 4FYDA 5FPDA 4A57A 3ZEUA 3E01A 2QWLA 2HMPA 3Q7BA 4J2EA 3OYGA 1C0MA 3OYIA 4AM6A 1RCHA 3K9KA 1JL2A 3DJCA 2VGMA 1K73O 3AO2A 3QO9A 1HQEA 3K5NA 5J2PA 1VK0A 4CE9A
chains in the Genus database with same CATH topology
3HPHA 3DRRA 5DK5A 4FLUA 3CFOA 4M3ZA 4DQPA 3VQ6A 4Z4CA 4CK1A 4JRQA 4M42A 2F8SA 3L3VA 1QHTA 5KRSA 2B5JA 4FJ9A 3F9KA 1NKEA 1WSHA 3LAKA 3KLEA 1T7PA 4CJFA 2KZZA 1HQUA 1Q9YA 3QEVA 4AH9A 4CJVA 3ZT3A 2WOMA 1A5WA 1CZBA 2LSNA 4CF0A 5E41A 2KQ2A 5T7BA 5SWMA 4N41A 4CEEA 3MXJA 1S1VA 5J1EA 4AILC 4FJLA 1IKXA 1KCFA 5C25A 4FJ8A 4PY5A 3DLEA 1S1XA 2XY6A 1HMVA 1XC9A 1RT6A 1S5JA 2A1SA 1KVCA 1ASWA 2RF2A 4Z4GA 1QE1A 1FXXA 2YNHA 1SL1A 4FJJA 4CHOA 1VSDA 4OPKA 4LH4A 3T1AA 2RPIA 1RTIA 2HHTA 4DQRA 2DFHA 4B9NA 4OLAA 3ZT0A 1U47A 1S1WA 3D0PA 3S3MA 2PZSA 1TAQA 4FCYA 1HRHA 3AO5A 4FW1A 3DOKA 1YTUA 3L3UA 3OYLA 2DFFA 1S6QA 3ITHA 4QOZB 1TGOA 4JS5A 3DRPA 4YFUA 1NK7A 4EP4A 4F8RA 4IDKA 3M8RA 4J2AA 2DTUA 2OPSA 4KHNA 2ZD1A 4N76A 1U4BA 3SQ4A 1WN7A 4M41A 2HVIA 1RBVA 3WNGA 3ZT4A 4DG1A 5FRNA 4ELVA 5JS1A 3OS1A 1QSSA 4RW9A 1J9AA 3HL8A 4DQQA 4I2PA 1NK8A 4MFBA 2Z1IA 1G15A 1A5XA 2YKMA 3AA3A 3DMJA 3NF8A 2X6SA 3KK1A 4FK4A 1TKTA 3V1QA 1ZBHA 4OKJA 4DTSA 3SQ0A 4DU4A 1LWFA 2D0BA 1BHLA 3F73A 1NK9A 3VQ8A 4CJEA 1HYVA 1IH7A 3AA2A 1U48A 1KRPA 3LALA 1LV5A 3TAMA 1IKWA 4JS4A 4ZTFA 1ASVA 1L3TA 4OVLA 3P1GA 1RT5A 3L2QA 1KLNA 3V4IA 1J54A 4DSKA 3CYMA 5KGWA 3VQ9A 4ZTJA 1GOBA 3RMDA 3NF7A 4RW7A 1S1TA 1TK8A 2D0AA 2B4JA 2IDOA 3QIOA 3LP0A 4IFYA 2OZMA 4DSIA 4CECA 3HT3A 3CFRA 4EP5A 3PV8A 3TABA 1D9DA 4LH5A 3V1RA 2XY7A 4B9VA 1D8YA 2PYLA 2E6LA 3SUPA 1JLCA 4CJUA 4NYNA 4DU1A 4KI4A 2HMIA 3RRHA 1QQCA 4M45A 1X9WA 1RT3A 3MEDA 4OGEA 3OYDA 4G1QA 1LW0A 3NAEA 4CFDA 1BCMA 1RT1A 3OYEA 4N5SA 1VSEA 3IG1A 4CGIA 3NF6A 1QS4A 4UQGA 1IKVA 1CZ9A 3OY9A 2QK9A 1RTJA 2B6AA 3DRSA 4DQIA 4CJPA 1UOCA 1T03A 3C6UA 3HJFA 1RDAA 3VQ7A 1RBUA 4KREA 1N5YA 2DY4A 4CK3A 2EHGA 1R0AA 3SPZA 4OPJA 4CGFA 3K59A 2W42A 4DLEA 4FJ5A 3OYBA 1FKOA 1NOZA 2D0CA 1WNSA 3RMBA 4J2BA 3P83D 2HHXA 3ZSWA 4E3SA 1TVRA 1VSKA 3SYZA 2FBXA 3P5JA 3LWMA 3QINA 4DTRA 1I39A 3TAPA 2E6MA 1BCOA 5J2MA 4M3YA 2KTQA 2OZSA 2HHUA 4C8MA 4DWIA 4PQUA 4IG3A 3SUOA 3KLHA 4KHQA 1HYZA 5D3GA 2OPQA 4FLXA 2OA8A 2I5JA 4OJRA 1SL0A 4E7LA 1RDCA 3WNHA 4GMJB 3SQ2A 5HRSA 4FZXC 4KHUA 1NKBA 3K57A 3SPYA 3V9ZA 3D45A 2F96A 3V6DA 1RNHA 3VQDA 1WSEA 2G8UA 3ZSOA 1KVAA 2HHQA 4BE1A 3HXMA 3IAYA 1UA0A 1IO2A 1HNVA 1HJRA 4KKOA 4O5BA 1JKHA 5CY4A 4CJTA 3I8DA 3JYTA 3EZ5A 3NDKA 3SNNA 3FFIA 3ISNC 3RWUA 1RTDA 3SUQA 4CF8A 4ID5A 4Z4HA 1XWLA 1NOYA 3RR8A 1U04A 4MQ3A 1BI4A 3PUFA 2XRIA 2X6NA 1LW2A 1IG9A 1BISA 4FJ7A 4FK0A 2BANA 3L2WA 3VA3A 1YTAA 4AHRA 3HK2A 3AVGA 5DMRA 3LAMA 3LZJA 3ASMA 4DTJA 1KFSA 4NCBA 1RT4A 4HUFA 4CF9A 2QXFA 3B6PA 3CM6A 3ZT2A 4CGGA 3NH0A 4M3UA 2KFZA 3AVJA 3PX0A 5KGXA 1JLEA 1VSJA 4CK2A 4BE0A 4FXDA 1Z26A 5HBMA 3VQ5A 3QEPA 1WSGA 4CJ4A 3AO4A 4W5RA 4KTWA 3TR8A 4CF1A 4CERA 3MAQA 3QNNA 3LDSA 4KRFA 4CHPA 2YNIA 3DYAA 3VQAA 3K5MA 4O44A 3ZSVA 1L3UA 1B9FA 4BWJA 3KK2A 2Z1HA 3KLFA 1Y97A 4PUOA 4CFCA 4JLHA 3ZSZA 4CEBA 4BDYA 4BDZA 4FLZA 3SUNA 3C6TA 4Q5VA 4KTQA 4RG8A 3OS2A 5HRRA 1QSYA 1MU2A 1JLBA 1S1UA 1B9DA 1JLFA 2FBTA 4CEFA 1O1WA 3QETA 4E7KA 1WSFA 1J53A 3AVFA 2FBYA 5HRPA 2OPRA 3LPTA 1NK4A 4KI6A 3V1OA 1X1PA 4C8OA 3KLGA 1REVA 4XIUA 3L8BA 4OKEA 3TAQA 1TKDA 3I0RA 1NJYA 4W5NA 1RT2A 2YNGA 3OYCA 3M8PA 4E7JA 3SCXA 1D5AA 3RTVA 4Z4IA 1Z25A 2KW4A 3QNOA 4NCAA 3VQ4A 1TV6A 3HP6A 3LANA 3PO5A 3L2RA 4IG0A 5EU7A 2VWJA 4FM1A 4B9TA 3G10A 4W5TA 4KPYA 1TK5A 1F21A 4B8AB 3M8SA 5KRTA 4JRPA 3KD1E 3SQ1A 5I3UA 3B6OA 1HYSA 3NH1A 2KFNA 4LY7A 4CJKA 4DFJA 4CHNA 1C6VA 3NBPA 4CF2A 3HM9A 3C95A 4FJKA 2X78A 3CFPA 1ZBIA 3KK3A 4CGDA 4B08A 3RRGA 4HCBA 4CHZA 5FROA 1NJZA 1JLAA 2YHAA 3TAFA 4OGCA 4CJRA 4RW4A 1VSHA 4WE1A 3HPOA 4FVMA 2HHVA 1ZBUA 4BWMA 3PX6A 1NK5A 4QCLA 5KI6A 2BE2A 5HRNA 4OLBA 5K14A 3QEIA 4EZ6A 2ATQA 4M3TA 2GUIA 4Q0BA 4ELTA 1ZBFA 3OJUA 4YNQA 4DQSA 4B9UA 2P5OA 1NJWA 3KTQA 3LZIA 3KJVA 1X9SA 1VRUA 1CLQA 1IKYA 1NKCA 3TAEA 2HW3A 3AV9A 3DLBA 2YHBA 1W9HA 3M8QA 4HHTA 4KB0A 1BQNA 4DMNA 4KFBA 3U3YA 5HLFA 4TSXA 5C24A 4J2DA 4LSLA 4H4OA 4Z4EA 4DS4A 2PY5A 1RT7A 1BI4B 2GBZA 5JS2A 3VQEA 3MXMA 1U45A 1L5UA 4DFMA 4KHWA 4KTZA 1L3SA 4H4MA 3O3GA 2XY8A 4CEOA 4IBNA 2IAJA 3HSTB 3IS9A 4E89A 3AVNA 3WNEA 1XHZA 3DLGA 2F8TA 3HPGA 1TL1A 1BQMA 1S6PA 5CYMA 1TKXA 4AHUA 4DF4A 4N56A 1XI1A 1T8EA 3AO1A 3ZCMA 4FW2A 3ZT1A 1EETA 4DSJA 4F2RA 1EKEA 2ITGA 4M3RA 2R7YA 2FBVA 4FLWA 1LWCA 3DLRA 4HCCA 1C1AA 4KV8A 1X9MA 3AVCA 3V9UA 4HUEA 4EZ9A 3HYFA 4O4GA 1DLOA 3V9SA 1SKRA 4BDPA 3AVBA 3DLKA 4DSFA 3OYAA 2P51A 4M3WA 4NCGA 3OS0A 4L8RB 1I3AA 4HUGA 2QKBA 3TARA 1JXEA 3K2PA 4O0IA 2VG7A 1ASUA 1K6YA 5FDLA 1RDDA 3U3GA 4I7FA 1TAUA 3PX4A 1JL1A 4CEDA 3BGRA 4RW8A 4HTUA 4FJHA 2XHBA 3LP3A 3V9XA 2Y1IA 4I9QA 4CIEA 3TI0A 1VSMA 4Z0UA 4QAGA 3THVA 1A5VA 2G8HA 1RBSA 3VQCA 4DTPA 4KHSA 1N6QA 3KKSA 3LP1A 1RTHA 3K5LA 3NHGA 1SUQA 3AVIA 2G8FA 4KHYA 2Y1JA 5J2QA 4CCHA 3NCIA 3T3FA 4M3XA 4B3OA 1XHXA 3ULDA 4NYFA 1S9EA 4DTNA 4B9MA 3KLIA 1BGXT 4CFBA 2ETJA 4PWDA 5J2NA 4CJ5A 1QTMA 4FK2A 2IOCA 1S9GA 3K5OA 2OYQA 1TK0A 1FK9A 1JLGA 3ZSXA 3NGIA 3VN5A 4CHYA 1WLJA 4H8KA 4FM0A 3ZSQA 2G8WA 2RN2A 3MXIA 3QEWA 4O0JA 2RKIA 4DTXA 2G8IA 2Q3SA 3OVNA 3IRXA 1LAWA 4FM2A 3V9WA 2ZE2A 2Z1GA 1WSJA 1YVUA 2G8KA 1DTQA 4FZYA 3LP2A 3O3FA 3OYKA 3A2FA 3H08A 4CESA 3MEEA 3NFAA 1KFDA 1ITGA 4CEAA 3OYJA 1SL2A 4DSEA 4C8KA 3CM5A 4BE2A 4Y1DA 4AHTA 4E7IA 2BDPA 3RR7A 2G8VA 4ZHRA 1W0HA 5I42A 2E4LA 4E0DA 4FJXA 1NK0A 1CXQA 1FKPA 1VSIA 3OYHA 2P5GA 3RMCA 1VRTA 4IKFA 3NH2A 4GW6A 4ELUA 1EX4A 2NUBA 3AVHA 4I9LA 1Q9XA 2IC3A 3MEGA 5C42A 3QESA 3U6FA 4I2QA 4DU3A 1WAFA 1NJXA 3HO1A 3C94A 1BIZA 3QIPA 4E19A 4CGHA 3LPUA 3QERA 1SKSA 4LSNA 5FRMA 4ICLA 2KZMA 3RMAA 3SI6A 4C8LA 3VQBA 4FJNA 1SKWA 1ZYQA 1C1BA 3MECA 4FJIA 3S3OA 4CEZA 1LWEA 4RW6A 1RILA 4CJLA 1KSPA 1C0TA 3I0SA 3UIQA 3QLHA 3AA5X 2O4IA 4F3TA 3CQ8A 1RBTA 3ALYA 3HP9A 1EP4A 2GV9A 4DTMA 4F4KA 3AA4A 4CFAA 3EYZA 2HNZA 3O4NA 2FC0A 4AHCA 2IGIA 2HB5A 2BGGA 1VSLA 2YKNA 4CJQA 4E7HA 4E1MA 3QEXA 1GOCA 5CYQA 4OKKA 3NE6A 3OYMA 4PA1A 1UA1A 3OYNA 3CG7A 4CHQA 1SV5A 4DLGA 4FLYA 2DFEA 4AHSA 2D5RA 4Z4FA 4HVJA 3ZSRA 1TKZA 5CZ1A 5HROA 1J5OA 5CZ2A 1TL3A 3LWLA 3TAGA 3PY8A 3KIOA 3AVLA 4IFVA 4R5PA 2VG5A 1WAJA 4FLTA 3PO4A 4BACA 3TWHA 3S9HA 4FJMA 5HP1A 2JLEA 2HNYA 4B9SA 1EXQA 4DF8A 3ZSYA 3TANA 4GVMA 4FZZA 4CGJA 2YNFA 1BIUA 1RBRA 2ZQBA 1RDBA 3L2VA 1B92A 2JGUA 4B8CA 4B9LA 3K58A 2O4GA 5KTQA 4KO0A 3T19A 2IS3A 4CIFA 1U49A 1HNIA 3BDPA 3V81A 3SJJA 4DSLA 1KLMA 3HVRA 3VA0A 2VG6A 3EY1A 3DLHA 3SV3A 3DI6A 3AVAA 1D9FA 1UAXA 4E1NA 4C8NA 1LAVA 4AHVA 2YV0X 1T05A 3AVMA 5SZTA 3DM2A 3WNFA 4DS5A 3NF9A 4CIGA 3JSMA 1KVBA 3OYFA 2PYJA 4KAZA 4CJWA 4CEQA 4K8XA 4DFPA 2HHSA 1VSFA 4CJ3A 2XO7A 4K8ZA 3HVTA 1HPZA 3DOLA 4O55A 4DTUA 1Q8IA 2P1JA 3VQQA 3SZ2A 2QKKA 1QSLA 1L3VA 3KKRA 1WSIA 3O4QA 4F2SA 3NGYA 4DTOA 1NK6A 3KD5E 2OPPA 1BL3A 1C1CA 2VWKA 3AO3A 3L2UA 2EX3A 3O3HA 4FYDA 5J2PA 2A1RA 4DFKA 2HNDA 1DTTA 4FLVA 2AJQA 3E01A 4KB1A 4W5OA 1JXBA 4ID1A 1C0MA 1C0UA 1UWBA 3OYGA 3OYIA 4J2EA 1CXUA 4Y1CA 3G0ZA 3S3NA 3NGZA 1RCHA 1ZBLA 2HVHA 2WONA 3VQPA 1JL2A 3OJSA 1KTQA 2X74A 4F3OA 1YT3A 3AVKA 2Z1JA 2XY5A 3AO2A 3QO9A 1HQEA 4W5QA 3K5NA 4LD0A 3SV4A 4CJSA 1JLQA 1VK0A 4CE9A 1GOAA 4N47A 2HHWA 4FJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPH A;  3DRR A;  5DK5 A;  4FLU A;  3CFO A;  4M3Z A;  4DQP A;  3VQ6 A;  4Z4C A;  4CK1 A;  4JRQ A;  4M42 A;  2F8S A;  3L3V A;  1QHT A;  5KRS A;  2B5J A;  4FJ9 A;  3F9K A;  1NKE A;  1WSH A;  3LAK A;  3KLE A;  1T7P A;  4CJF A;  2KZZ A;  1HQU A;  1Q9Y A;  3QEV A;  4AH9 A;  4CJV A;  3ZT3 A;  2WOM A;  1A5W A;  1CZB A;  2LSN A;  4CF0 A;  5E41 A;  2KQ2 A;  5T7B A;  5SWM A;  4N41 A;  4CEE A;  3MXJ A;  1S1V A;  5J1E A;  4AIL C;  4FJL A;  1IKX A;  1KCF A;  5C25 A;  4FJ8 A;  4PY5 A;  3DLE A;  1S1X A;  2XY6 A;  1HMV A;  1XC9 A;  1RT6 A;  1S5J A;  2A1S A;  1KVC A;  1ASW A;  2RF2 A;  4Z4G A;  1QE1 A;  1FXX A;  2YNH A;  1SL1 A;  4FJJ A;  4CHO A;  1VSD A;  4OPK A;  4LH4 A;  3T1A A;  2RPI A;  1RTI A;  2HHT A;  4DQR A;  2DFH A;  4B9N A;  4OLA A;  3ZT0 A;  1U47 A;  1S1W A;  3D0P A;  3S3M A;  2PZS A;  1TAQ A;  4FCY A;  1HRH A;  3AO5 A;  4FW1 A;  3DOK A;  1YTU A;  3L3U A;  3OYL A;  2DFF A;  1S6Q A;  3ITH A;  4QOZ B;  1TGO A;  4JS5 A;  3DRP A;  4YFU A;  1NK7 A;  4EP4 A;  4F8R A;  4IDK A;  3M8R A;  4J2A A;  2DTU A;  2OPS A;  4KHN A;  2ZD1 A;  4N76 A;  1U4B A;  3SQ4 A;  1WN7 A;  4M41 A;  2HVI A;  1RBV A;  3WNG A;  3ZT4 A;  4DG1 A;  5FRN A;  4ELV A;  5JS1 A;  3OS1 A;  1QSS A;  4RW9 A;  1J9A A;  3HL8 A;  4DQQ A;  4I2P A;  1NK8 A;  4MFB A;  2Z1I A;  1G15 A;  1A5X A;  2YKM A;  3AA3 A;  3DMJ A;  3NF8 A;  2X6S A;  3KK1 A;  4FK4 A;  1TKT A;  3V1Q A;  1ZBH A;  4OKJ A;  4DTS A;  3SQ0 A;  4DU4 A;  1LWF A;  2D0B A;  1BHL A;  3F73 A;  1NK9 A;  3VQ8 A;  4CJE A;  1HYV A;  1IH7 A;  3AA2 A;  1U48 A;  1KRP A;  3LAL A;  1LV5 A;  3TAM A;  1IKW A;  4JS4 A;  4ZTF A;  1ASV A;  1L3T A;  4OVL A;  3P1G A;  1RT5 A;  3L2Q A;  1KLN A;  3V4I A;  1J54 A;  4DSK A;  3CYM A;  5KGW A;  3VQ9 A;  4ZTJ A;  1GOB A;  3RMD A;  3NF7 A;  4RW7 A;  1S1T A;  1TK8 A;  2D0A A;  2B4J A;  2IDO A;  3QIO A;  3LP0 A;  4IFY A;  2OZM A;  4DSI A;  4CEC A;  3HT3 A;  3CFR A;  4EP5 A;  3PV8 A;  3TAB A;  1D9D A;  4LH5 A;  3V1R A;  2XY7 A;  4B9V A;  1D8Y A;  2PYL A;  2E6L A;  3SUP A;  1JLC A;  4CJU A;  4NYN A;  4DU1 A;  4KI4 A;  2HMI A;  3RRH A;  1QQC A;  4M45 A;  1X9W A;  1RT3 A;  3MED A;  4OGE A;  3OYD A;  4G1Q A;  1LW0 A;  3NAE A;  4CFD A;  1BCM A;  1RT1 A;  3OYE A;  4N5S A;  1VSE A;  3IG1 A;  4CGI A;  3NF6 A;  1QS4 A;  4UQG A;  1IKV A;  1CZ9 A;  3OY9 A;  2QK9 A;  1RTJ A;  2B6A A;  3DRS A;  4DQI A;  4CJP A;  1UOC A;  1T03 A;  3C6U A;  3HJF A;  1RDA A;  3VQ7 A;  1RBU A;  4KRE A;  1N5Y A;  2DY4 A;  4CK3 A;  2EHG A;  1R0A A;  3SPZ A;  4OPJ A;  4CGF A;  3K59 A;  2W42 A;  4DLE A;  4FJ5 A;  3OYB A;  1FKO A;  1NOZ A;  2D0C A;  1WNS A;  3RMB A;  4J2B A;  3P83 D;  2HHX A;  3ZSW A;  4E3S A;  1TVR A;  1VSK A;  3SYZ A;  2FBX A;  3P5J A;  3LWM A;  3QIN A;  4DTR A;  1I39 A;  3TAP A;  2E6M A;  1BCO A;  5J2M A;  4M3Y A;  2KTQ A;  2OZS A;  2HHU A;  4C8M A;  4DWI A;  4PQU A;  4IG3 A;  3SUO A;  3KLH A;  4KHQ A;  1HYZ A;  5D3G A;  2OPQ A;  4FLX A;  2OA8 A;  2I5J A;  4OJR A;  1SL0 A;  4E7L A;  1RDC A;  3WNH A;  4GMJ B;  3SQ2 A;  5HRS A;  4FZX C;  4KHU A;  1NKB A;  3K57 A;  3SPY A;  3V9Z A;  3D45 A;  2F96 A;  3V6D A;  1RNH A;  3VQD A;  1WSE A;  2G8U A;  3ZSO A;  1KVA A;  2HHQ A;  4BE1 A;  3HXM A;  3IAY A;  1UA0 A;  1IO2 A;  1HNV A;  1HJR A;  4KKO A;  4O5B A;  1JKH A;  5CY4 A;  4CJT A;  3I8D A;  3JYT A;  3EZ5 A;  3NDK A;  3SNN A;  3FFI A;  3ISN C;  3RWU A;  1RTD A;  3SUQ A;  4CF8 A;  4ID5 A;  4Z4H A;  1XWL A;  1NOY A;  3RR8 A;  1U04 A;  4MQ3 A;  1BI4 A;  3PUF A;  2XRI A;  2X6N A;  1LW2 A;  1IG9 A;  1BIS A;  4FJ7 A;  4FK0 A;  2BAN A;  3L2W A;  3VA3 A;  1YTA A;  4AHR A;  3HK2 A;  3AVG A;  5DMR A;  3LAM A;  3LZJ A;  3ASM A;  4DTJ A;  1KFS A;  4NCB A;  1RT4 A;  4HUF A;  4CF9 A;  2QXF A;  3B6P A;  3CM6 A;  3ZT2 A;  4CGG A;  3NH0 A;  4M3U A;  2KFZ A;  3AVJ A;  3PX0 A;  5KGX A;  1JLE A;  1VSJ A;  4CK2 A;  4BE0 A;  4FXD A;  1Z26 A;  5HBM A;  3VQ5 A;  3QEP A;  1WSG A;  4CJ4 A;  3AO4 A;  4W5R A;  4KTW A;  3TR8 A;  4CF1 A;  4CER A;  3MAQ A;  3QNN A;  3LDS A;  4KRF A;  4CHP A;  2YNI A;  3DYA A;  3VQA A;  3K5M A;  4O44 A;  3ZSV A;  1L3U A;  1B9F A;  4BWJ A;  3KK2 A;  2Z1H A;  3KLF A;  1Y97 A;  4PUO A;  4CFC A;  4JLH A;  3ZSZ A;  4CEB A;  4BDY A;  4BDZ A;  4FLZ A;  3SUN A;  3C6T A;  4Q5V A;  4KTQ A;  4RG8 A;  3OS2 A;  5HRR A;  1QSY A;  1MU2 A;  1JLB A;  1S1U A;  1B9D A;  1JLF A;  2FBT A;  4CEF A;  1O1W A;  3QET A;  4E7K A;  1WSF A;  1J53 A;  3AVF A;  2FBY A;  5HRP A;  2OPR A;  3LPT A;  1NK4 A;  4KI6 A;  3V1O A;  1X1P A;  4C8O A;  3KLG A;  1REV A;  4XIU A;  3L8B A;  4OKE A;  3TAQ A;  1TKD A;  3I0R A;  1NJY A;  4W5N A;  1RT2 A;  2YNG A;  3OYC A;  3M8P A;  4E7J A;  3SCX A;  1D5A A;  3RTV A;  4Z4I A;  1Z25 A;  2KW4 A;  3QNO A;  4NCA A;  3VQ4 A;  1TV6 A;  3HP6 A;  3LAN A;  3PO5 A;  3L2R A;  4IG0 A;  5EU7 A;  2VWJ A;  4FM1 A;  4B9T A;  3G10 A;  4W5T A;  4KPY A;  1TK5 A;  1F21 A;  4B8A B;  3M8S A;  5KRT A;  4JRP A;  3KD1 E;  3SQ1 A;  5I3U A;  3B6O A;  1HYS A;  3NH1 A;  2KFN A;  4LY7 A;  4CJK A;  4DFJ A;  4CHN A;  1C6V A;  3NBP A;  4CF2 A;  3HM9 A;  3C95 A;  4FJK A;  2X78 A;  3CFP A;  1ZBI A;  3KK3 A;  4CGD A;  4B08 A;  3RRG A;  4HCB A;  4CHZ A;  5FRO A;  1NJZ A;  1JLA A;  2YHA A;  3TAF A;  4OGC A;  4CJR A;  4RW4 A;  1VSH A;  4WE1 A;  3HPO A;  4FVM A;  2HHV A;  1ZBU A;  4BWM A;  3PX6 A;  1NK5 A;  4QCL A;  5KI6 A;  2BE2 A;  5HRN A;  4OLB A;  5K14 A;  3QEI A;  4EZ6 A;  2ATQ A;  4M3T A;  2GUI A;  4Q0B A;  4ELT A;  1ZBF A;  3OJU A;  4YNQ A;  4DQS A;  4B9U A;  2P5O A;  1NJW A;  3KTQ A;  3LZI A;  3KJV A;  1X9S A;  1VRU A;  1CLQ A;  1IKY A;  1NKC A;  3TAE A;  2HW3 A;  3AV9 A;  3DLB A;  2YHB A;  1W9H A;  3M8Q A;  4HHT A;  4KB0 A;  1BQN A;  4DMN A;  4KFB A;  3U3Y A;  5HLF A;  4TSX A;  5C24 A;  4J2D A;  4LSL A;  4H4O A;  4Z4E A;  4DS4 A;  2PY5 A;  1RT7 A;  1BI4 B;  2GBZ A;  5JS2 A;  3VQE A;  3MXM A;  1U45 A;  1L5U A;  4DFM A;  4KHW A;  4KTZ A;  1L3S A;  4H4M A;  3O3G A;  2XY8 A;  4CEO A;  4IBN A;  2IAJ A;  3HST B;  3IS9 A;  4E89 A;  3AVN A;  3WNE A;  1XHZ A;  3DLG A;  2F8T A;  3HPG A;  1TL1 A;  1BQM A;  1S6P A;  5CYM A;  1TKX A;  4AHU A;  4DF4 A;  4N56 A;  1XI1 A;  1T8E A;  3AO1 A;  3ZCM A;  4FW2 A;  3ZT1 A;  1EET A;  4DSJ A;  4F2R A;  1EKE A;  2ITG A;  4M3R A;  2R7Y A;  2FBV A;  4FLW A;  1LWC A;  3DLR A;  4HCC A;  1C1A A;  4KV8 A;  1X9M A;  3AVC A;  3V9U A;  4HUE A;  4EZ9 A;  3HYF A;  4O4G A;  1DLO A;  3V9S A;  1SKR A;  4BDP A;  3AVB A;  3DLK A;  4DSF A;  3OYA A;  2P51 A;  4M3W A;  4NCG A;  3OS0 A;  4L8R B;  1I3A A;  4HUG A;  2QKB A;  3TAR A;  1JXE A;  3K2P A;  4O0I A;  2VG7 A;  1ASU A;  1K6Y A;  5FDL A;  1RDD A;  3U3G A;  4I7F A;  1TAU A;  3PX4 A;  1JL1 A;  4CED A;  3BGR A;  4RW8 A;  4HTU A;  4FJH A;  2XHB A;  3LP3 A;  3V9X A;  2Y1I A;  4I9Q A;  4CIE A;  3TI0 A;  1VSM A;  4Z0U A;  4QAG A;  3THV A;  1A5V A;  2G8H A;  1RBS A;  3VQC A;  4DTP A;  4KHS A;  1N6Q A;  3KKS A;  3LP1 A;  1RTH A;  3K5L A;  3NHG A;  1SUQ A;  3AVI A;  2G8F A;  4KHY A;  2Y1J A;  5J2Q A;  4CCH A;  3NCI A;  3T3F A;  4M3X A;  4B3O A;  1XHX A;  3ULD A;  4NYF A;  1S9E A;  4DTN A;  4B9M A;  3KLI A;  1BGX T;  4CFB A;  2ETJ A;  4PWD A;  5J2N A;  4CJ5 A;  1QTM A;  4FK2 A;  2IOC A;  1S9G A;  3K5O A;  2OYQ A;  1TK0 A;  1FK9 A;  1JLG A;  3ZSX A;  3NGI A;  3VN5 A;  4CHY A;  1WLJ A;  4H8K A;  4FM0 A;  3ZSQ A;  2G8W A;  2RN2 A;  3MXI A;  3QEW A;  4O0J A;  2RKI A;  4DTX A;  2G8I A;  2Q3S A;  3OVN A;  3IRX A;  1LAW A;  4FM2 A;  3V9W A;  2ZE2 A;  2Z1G A;  1WSJ A;  1YVU A;  2G8K A;  1DTQ A;  4FZY A;  3LP2 A;  3O3F A;  3OYK A;  3A2F A;  3H08 A;  4CES A;  3MEE A;  3NFA A;  1KFD A;  1ITG A;  4CEA A;  3OYJ A;  1SL2 A;  4DSE A;  4C8K A;  3CM5 A;  4BE2 A;  4Y1D A;  4AHT A;  4E7I A;  2BDP A;  3RR7 A;  2G8V A;  4ZHR A;  1W0H A;  5I42 A;  2E4L A;  4E0D A;  4FJX A;  1NK0 A;  1CXQ A;  1FKP A;  1VSI A;  3OYH A;  2P5G A;  3RMC A;  1VRT A;  4IKF A;  3NH2 A;  4GW6 A;  4ELU A;  1EX4 A;  2NUB A;  3AVH A;  4I9L A;  1Q9X A;  2IC3 A;  3MEG A;  5C42 A;  3QES A;  3U6F A;  4I2Q A;  4DU3 A;  1WAF A;  1NJX A;  3HO1 A;  3C94 A;  1BIZ A;  3QIP A;  4E19 A;  4CGH A;  3LPU A;  3QER A;  1SKS A;  4LSN A;  5FRM A;  4ICL A;  2KZM A;  3RMA A;  3SI6 A;  4C8L A;  3VQB A;  4FJN A;  1SKW A;  1ZYQ A;  1C1B A;  3MEC A;  4FJI A;  3S3O A;  4CEZ A;  1LWE A;  4RW6 A;  1RIL A;  4CJL A;  1KSP A;  1C0T A;  3I0S A;  3UIQ A;  3QLH A;  3AA5 X;  2O4I A;  4F3T A;  3CQ8 A;  1RBT A;  3ALY A;  3HP9 A;  1EP4 A;  2GV9 A;  4DTM A;  4F4K A;  3AA4 A;  4CFA A;  3EYZ A;  2HNZ A;  3O4N A;  2FC0 A;  4AHC A;  2IGI A;  2HB5 A;  2BGG A;  1VSL A;  2YKN A;  4CJQ A;  4E7H A;  4E1M A;  3QEX A;  1GOC A;  5CYQ A;  4OKK A;  3NE6 A;  3OYM A;  4PA1 A;  1UA1 A;  3OYN A;  3CG7 A;  4CHQ A;  1SV5 A;  4DLG A;  4FLY A;  2DFE A;  4AHS A;  2D5R A;  4Z4F A;  4HVJ A;  3ZSR A;  1TKZ A;  5CZ1 A;  5HRO A;  1J5O A;  5CZ2 A;  1TL3 A;  3LWL A;  3TAG A;  3PY8 A;  3KIO A;  3AVL A;  4IFV A;  4R5P A;  2VG5 A;  1WAJ A;  4FLT A;  3PO4 A;  4BAC A;  3TWH A;  3S9H A;  4FJM A;  5HP1 A;  2JLE A;  2HNY A;  4B9S A;  1EXQ A;  4DF8 A;  3ZSY A;  3TAN A;  4GVM A;  4FZZ A;  4CGJ A;  2YNF A;  1BIU A;  1RBR A;  2ZQB A;  1RDB A;  3L2V A;  1B92 A;  2JGU A;  4B8C A;  4B9L A;  3K58 A;  2O4G A;  5KTQ A;  4KO0 A;  3T19 A;  2IS3 A;  4CIF A;  1U49 A;  1HNI A;  3BDP A;  3V81 A;  3SJJ A;  4DSL A;  1KLM A;  3HVR A;  3VA0 A;  2VG6 A;  3EY1 A;  3DLH A;  3SV3 A;  3DI6 A;  3AVA A;  1D9F A;  1UAX A;  4E1N A;  4C8N A;  1LAV A;  4AHV A;  2YV0 X;  1T05 A;  3AVM A;  5SZT A;  3DM2 A;  3WNF A;  4DS5 A;  3NF9 A;  4CIG A;  3JSM A;  1KVB A;  3OYF A;  2PYJ A;  4KAZ A;  4CJW A;  4CEQ A;  4K8X A;  4DFP A;  2HHS A;  1VSF A;  4CJ3 A;  2XO7 A;  4K8Z A;  3HVT A;  1HPZ A;  3DOL A;  4O55 A;  4DTU A;  1Q8I A;  2P1J A;  3VQQ A;  3SZ2 A;  2QKK A;  1QSL A;  1L3V A;  3KKR A;  1WSI A;  3O4Q A;  4F2S A;  3NGY A;  4DTO A;  1NK6 A;  3KD5 E;  2OPP A;  1BL3 A;  1C1C A;  2VWK A;  3AO3 A;  3L2U A;  2EX3 A;  3O3H A;  4FYD A;  5J2P A;  2A1R A;  4DFK A;  2HND A;  1DTT A;  4FLV A;  2AJQ A;  3E01 A;  4KB1 A;  4W5O A;  1JXB A;  4ID1 A;  1C0M A;  1C0U A;  1UWB A;  3OYG A;  3OYI A;  4J2E A;  1CXU A;  4Y1C A;  3G0Z A;  3S3N A;  3NGZ A;  1RCH A;  1ZBL A;  2HVH A;  2WON A;  3VQP A;  1JL2 A;  3OJS A;  1KTQ A;  2X74 A;  4F3O A;  1YT3 A;  3AVK A;  2Z1J A;  2XY5 A;  3AO2 A;  3QO9 A;  1HQE A;  4W5Q A;  3K5N A;  4LD0 A;  3SV4 A;  4CJS A;  1JLQ A;  1VK0 A;  4CE9 A;  1GOA A;  4N47 A;  2HHW A;  4FJG A; 
#chains in the Genus database with same CATH topology
 3DRR A;  2QWQ A;  2W6K A;  1BUP A;  5KRS A;  3F9K A;  1WSH A;  2KZZ A;  2F9T A;  2GX9 A;  1D4X A;  1Q9Y A;  4AH9 A;  4CJV A;  3A5N C;  3ZT3 A;  1K8K A;  5E41 A;  2KQ2 A;  3VEY A;  4JKH A;  5LMU K;  4HTL A;  2WFB A;  3VGK A;  3MXJ A;  5J1E A;  3H1Q A;  1S1X A;  1XMO K;  2A1S A;  5GIO A;  3T1A A;  2RPI A;  2HHT A;  4EHT A;  4B9N A;  3TSP A;  1S1W A;  3S3M A;  3R1X A;  3DOK A;  3OYL A;  2NZT A;  1TGO A;  2E88 A;  3M8R A;  2OPS A;  4JAX A;  3SAG A;  3SQ4 A;  4M41 A;  4BVP A;  5FRN A;  4GVE A;  4ELV A;  3FE1 A;  1J9A A;  3HL8 A;  4YOW A;  1HNZ K;  2X6S A;  2OCE A;  3V1Q A;  3SQ0 A;  1LWF A;  1X3M A;  1BHL A;  3LAL A;  1LV5 A;  3TAM A;  4JS4 A;  1ASV A;  2IVN A;  4OVL A;  4DR1 K;  3G71 N;  3GE1 A;  3C65 A;  4DSK A;  4ZTJ A;  3FLC O;  1VQ5 N;  1C0G A;  3IKM A;  5AJ3 K;  4BRF A;  3UKR A;  1TK8 A;  3IMX A;  2IDO A;  4YY3 K;  3HT3 A;  4JNE A;  3OA9 A;  1D9D A;  3FZF A;  2E6L A;  4CJU A;  4DU1 A;  4KI4 A;  2HMI A;  4M45 A;  5AFU H;  3MED A;  3ENB A;  1GLF O;  1LW0 A;  4CBX A;  1KQS M;  3GL1 A;  2PBD A;  1J6Z A;  3OYE A;  4UQG A;  3NF6 A;  2B6A A;  3DRS A;  4KRE A;  3J7A P;  1T6C A;  2EHG A;  2W42 A;  1K9M O;  3RMB A;  4J2B A;  4EAH D;  3H3O B;  4JKC A;  5KPZ A;  3LWM A;  4DTR A;  2KTQ A;  1GLD G;  4IG3 A;  3ID8 A;  3LDL A;  4XH1 A;  1OVY A;  2OA8 A;  4FLX A;  2I5J A;  5M1K A;  2W6L A;  4EHU A;  4FOI A;  1NGI A;  1KC8 O;  3V6D A;  1QQM A;  2ZJQ L;  3PLA A;  5M1O A;  1VQM N;  1BDG A;  1W7A A;  1UA0 A;  1HNV A;  4KKO A;  4J8F A;  3WUH A;  3I8D A;  3SNN A;  3VES A;  1ZYQ A;  1NGF A;  3OW2 M;  4JKF A;  3JXU A;  3PUF A;  3HZ6 A;  1XNR K;  4FK0 A;  3AVG A;  2E1Y A;  3ASM A;  1HPM A;  4HUF A;  3IUC A;  4CF9 A;  4BC2 A;  2AA4 A;  3B6P A;  3CM6 A;  4MLE A;  2A6A A;  4YOY A;  3PX0 A;  1JLE A;  1ZC6 A;  2D0O A;  4W5R A;  4KTW A;  4CF1 A;  3CD6 N;  4CI6 A;  1GLA G;  3VQA A;  1OVQ A;  1B9F A;  3KZB A;  4DR7 K;  5LJW A;  4PUO A;  1HNX K;  1NGC A;  2FBT A;  5BR9 A;  1WSF A;  3CC4 N;  2FBY A;  4KI6 A;  3LPT A;  2HBL A;  3BZC A;  3OBY A;  4XIU A;  4H5V A;  4OKE A;  3TAQ A;  3HRG A;  4Z4I A;  2UXB K;  4XH5 A;  3QNO A;  3VQ4 A;  5HOO A;  2NRR A;  3G10 A;  1MWM A;  4K25 A;  4KPY A;  2EWS A;  2V52 B;  4KHP K;  1F21 A;  3VEZ A;  3H1V X;  3AAQ A;  2D4W A;  5BRF A;  4CJK A;  2WTU A;  3BF1 A;  3AGR A;  3E66 A;  2X78 A;  3CFP A;  4DV3 K;  3J80 O;  3KK3 A;  4L3Q A;  4CHZ A;  3VF2 A;  2PAV A;  5FRO A;  1JLA A;  2CH5 A;  3HPO A;  2HHV A;  4BWM A;  4JD2 A;  2BE2 A;  5AR0 A;  5HRN A;  5K14 A;  3QEI A;  4ELT A;  4YNQ A;  5AQQ A;  1WOQ A;  3KTQ A;  5CE3 A;  1VRU A;  1DEJ A;  1X9S A;  4EIA A;  3TAE A;  4CZJ A;  1HKB A;  3DLB A;  3R6M A;  4DMN A;  3U3Y A;  5HLF A;  1HNW K;  3CCL N;  4TSX A;  5C24 A;  4Z4E A;  4H4O A;  4WQ4 C;  3VQE A;  1BI4 B;  1TUY A;  1E4G T;  4CD1 A;  3MXM A;  1ATN A;  3O3G A;  2D1K A;  5AQV A;  4E89 A;  3CXC M;  3HTV A;  1BQM A;  4DF4 A;  3MDQ A;  3CCM N;  4AHU A;  1T8E A;  2E1Z A;  5C12 A;  4DR2 K;  4F2R A;  1TUU A;  3DLR A;  4HCC A;  2JWL A;  3MWP A;  3EKU A;  4EZ9 A;  3HYF A;  3PSF A;  3V9S A;  1SKR A;  3U9Z A;  3O5B A;  2F9W A;  2QKB A;  3CPE A;  4ISF A;  1RDD A;  3MN6 A;  2IIR A;  4BRE A;  2O8D B;  2BTF A;  2UYT A;  3WT0 A;  5C2D A;  1FW6 A;  5AQX A;  1QHA A;  4GV6 A;  1VSM A;  3THV A;  1WB9 A;  4ILG B;  3LP1 A;  3K5L A;  4R79 A;  4NYF A;  4DTN A;  3KLI A;  4CJ5 A;  1S9G A;  4K42 A;  1IBK K;  3ENO A;  3LDQ A;  3MXI A;  3QEW A;  3H46 O;  4BRA A;  1LAW A;  1YVU A;  4MLH A;  1DTQ A;  1DT9 A;  4A2A A;  1KFD A;  4H0X B;  5KQD A;  3BUZ B;  4DR3 K;  4C8K A;  4AHT A;  2G8V A;  4ZHR A;  1W0H A;  5I42 A;  4FJX A;  4JN4 A;  3TTF A;  3OYH A;  1EX4 A;  2NUB A;  1Q9X A;  3MEG A;  4WQ5 C;  3U6F A;  4I2Q A;  4DU3 A;  3HO1 A;  1XMQ K;  2KHO A;  3MX2 A;  4WFB L;  3O9S A;  3VQB A;  1IV0 A;  3WXK A;  3MEC A;  4RW6 A;  3CME N;  2O4I A;  2NRZ A;  3ALY A;  3HP9 A;  1EP4 A;  2GV9 A;  3AA4 A;  1VQL N;  2HNZ A;  1OH8 A;  4B1Z A;  1VQ7 N;  2HB5 A;  1VSL A;  4DUY K;  2YKN A;  3L6Q A;  3OYM A;  3OYN A;  2DPN A;  4BRO A;  5C0Y A;  4HVJ A;  4PL7 A;  1TKZ A;  3I56 N;  1Q82 O;  3PY8 A;  5CZ2 A;  3VF6 A;  3AVL A;  2VG5 A;  3PO4 A;  1HR0 K;  3S9H A;  3EZW A;  2ZJP L;  4IEI A;  4CVN E;  5HP1 A;  4B9S A;  2IVO A;  1SS6 A;  1RDB A;  1MDU B;  2JGU A;  2UXC K;  2OAN A;  3K58 A;  3OHR A;  3ZX3 A;  1LCU A;  3SJJ A;  2VG6 A;  5CR4 A;  1KAZ A;  3DI6 A;  1D9F A;  1T7P A;  4KH4 A;  4E1N A;  4AHV A;  3AVM A;  4WQ4 A;  3CPW M;  4A62 A;  3Q7C A;  4PKG A;  5B8H A;  1IG8 A;  4KAZ A;  1KVB A;  5AQR A;  3OYF A;  4ILJ A;  2HHS A;  1IBM K;  2P9P A;  3HVT A;  4DTU A;  5AQI A;  2P9S A;  3K0S A;  3O4Q A;  2HST A;  4F2S A;  3L2U A;  5DM6 L;  2EX3 A;  3O3H A;  1H1V A;  5KPR A;  4DFK A;  4A5A A;  5BN8 A;  4IOC L;  1JXB A;  4ID1 A;  1VQN N;  2HVH A;  3W3D A;  3OJS A;  4LF5 K;  1YT3 A;  3D2F A;  3SV4 A;  1GOA A;  2WBN A;  2HHW A;  4FJG A;  3MN5 A;  5DK5 A;  4JI7 K;  3RSE A;  5HL7 L;  3VQ6 A;  2F8S A;  4M42 A;  4DV7 K;  2B5J A;  4JI3 K;  3CCR N;  3LAK A;  1NKE A;  4FPA A;  3O9T A;  3UKU A;  3EE8 A;  1WBD A;  5TKY A;  3WXI A;  4FWS A;  2P9U B;  1CZB A;  3ID6 A;  2LSN A;  3LDP A;  2FXU A;  1S1V A;  4PY5 A;  2W41 A;  4FSV A;  4FJL A;  1KCF A;  3DLE A;  1HMV A;  1RT6 A;  2RF2 A;  2E2Q A;  1SL1 A;  1FXX A;  4OPK A;  1FJG K;  4A5B A;  4DQR A;  2DFH A;  2I7N A;  4V19 S;  2PZS A;  1HRH A;  2NNW A;  4FW1 A;  4G9Z A;  4YHH K;  4H5W A;  1HX1 A;  3VMF B;  3LDN A;  5GAD P;  4YFU A;  4F8R A;  3FZM A;  1T3V A;  4N76 A;  5IT9 O;  3DXM A;  2V7Y A;  3ZT4 A;  4DG1 A;  5JIC A;  3OS1 A;  5JS1 A;  3CCJ N;  1IBL K;  1NGD A;  1NK8 A;  3KK1 A;  3DMJ A;  2YKM A;  3I33 A;  1TKT A;  1NGG A;  4DTS A;  3VEX A;  4CJE A;  3AA2 A;  1IH7 A;  3CC2 N;  1TYQ A;  3PIO L;  2O8C A;  2BUP A;  3G4S N;  4K0K K;  1VQ9 N;  4LFC K;  1RT5 A;  3L2Q A;  4BY9 C;  2F7T A;  4RCH A;  3ZYY X;  5AZI A;  1S1T A;  1E4F T;  3WEE B;  3KVG A;  4QS9 A;  2B4J A;  2OZM A;  2Q0R A;  4CEC A;  3PV8 A;  4EP5 A;  2E20 A;  2XY7 A;  1JLC A;  3HOT A;  3RRH A;  1QQC A;  3QDK A;  1RT3 A;  4CZM A;  3OYD A;  3NAE A;  1EO1 A;  4CFD A;  3BF3 A;  1GLB G;  1SZ2 A;  3CJ9 A;  1CZ9 A;  1RTJ A;  4DQI A;  1RDA A;  3VQ7 A;  1RBU A;  3IDH A;  1R0A A;  1VAZ A;  3SPZ A;  2P9I B;  2P9L B;  4CGF A;  3K59 A;  1FKO A;  2D0C A;  4E3S A;  4I6M A;  4IDH A;  4MDA A;  5J2M A;  1GLC G;  3WEE A;  1M90 O;  2OZS A;  4M3Y A;  3KLH A;  5AZI B;  5D3G A;  3CQY A;  2QWM A;  2UUC K;  1LOT B;  4BQZ A;  3QBW A;  4FZX C;  5JVH L;  3K57 A;  3V9Z A;  2O8C B;  3ULE B;  1YUW A;  1HLU A;  3P4I A;  4CZG A;  1XUP O;  2G8U A;  3ZSO A;  2O8F B;  3KWI A;  3SMP A;  4DR4 K;  3QB0 A;  4O5B A;  3NDK A;  3C7N B;  2O8B A;  1SQK A;  3RR8 A;  2X6N A;  4LFB K;  1IG9 A;  4FJ7 A;  2BAN A;  4PL8 A;  2VQF K;  4DQ8 A;  4OPH A;  4M3U A;  4LF9 K;  4X64 K;  1SAZ A;  5EVZ A;  2FF3 B;  4IO9 L;  4A59 A;  5HBM A;  3F5T A;  4IOA L;  5I9E B;  4CJ4 A;  3J8A A;  1BWF O;  3AO4 A;  2Q1N A;  1Y64 A;  4CER A;  4BRG A;  3MAQ A;  3QNN A;  3T7Z A;  2ASM A;  4CZH A;  3K5M A;  2P9K B;  4O44 A;  4BWJ A;  4C1N I;  4WQ5 A;  3ZSZ A;  4CEB A;  4BDZ A;  3SUN A;  4KTQ A;  3C6T A;  5HRR A;  1B9D A;  3SMS A;  4CEF A;  4E7K A;  3UKU B;  5FPM A;  1NK4 A;  1X1P A;  3L8B A;  3I0R A;  2ZGY A;  1MA9 B;  4IJN A;  4W5N A;  1RT2 A;  4E7J A;  4FWN A;  3M8P A;  5AQU A;  4DCH A;  3SCX A;  3SAF A;  1Z25 A;  2KW4 A;  2QEX N;  5LMN K;  5BPM A;  3VTI A;  3LM9 A;  3HP6 A;  4KH6 A;  3PO5 A;  1NU0 A;  2F4V K;  2NRW A;  5EU7 A;  2VWJ A;  3MWT A;  1S22 A;  1TK5 A;  3M8S A;  5KRT A;  1NGA A;  2CGJ A;  3D2E A;  3BEX A;  4LY7 A;  4C23 A;  4CHN A;  3C95 A;  1NJZ A;  2P9S B;  2YHA A;  3O9Q A;  3TAF A;  4OGC A;  4DB3 A;  5H1S Q;  2Q31 A;  3PX6 A;  4BG8 A;  5C2F A;  1VQK N;  5KI6 A;  3T1Y K;  4OLB A;  3THY A;  2E2N A;  2D0P A;  4HWI A;  3OJU A;  2P5O A;  3I55 N;  1NJW A;  3LZI A;  5M1P A;  1W9H A;  5ADX A;  2WC9 A;  3E9L A;  4PKI A;  3THW B;  4KFB A;  3JAM O;  4J2D A;  2I7P A;  4KHQ A;  1RT7 A;  2GBZ A;  1U45 A;  1L5U A;  4H0T B;  4DFM A;  4KTZ A;  2NRX A;  5GAG P;  1YXQ A;  3C7N A;  3AVN A;  3O1W A;  4H5T A;  3TSU A;  1XHZ A;  1ATR A;  1K8A O;  2F8T A;  5CYM A;  1TKX A;  2E8A A;  3ULE A;  4N56 A;  5F2R A;  3AO1 A;  1EET A;  4JI1 K;  1EKE A;  2ITG A;  2VYP A;  4M3R A;  2R7Y A;  2FBV A;  4FLW A;  1LWC A;  1RDW X;  2O8E B;  1Q81 O;  3L4I A;  3AVB A;  4DV1 K;  3GOI A;  4M7X A;  2V51 B;  4HUG A;  1JXE A;  3PX4 A;  1JL1 A;  4BC3 A;  3BGR A;  4RW8 A;  4FJH A;  2P9N B;  2P9L A;  2P9I A;  3LP3 A;  2QM1 A;  4I9Q A;  4CIE A;  1A5V A;  4IOX A;  1RBS A;  3VQC A;  4JI8 K;  3TSQ A;  4FOE A;  1N6Q A;  4H0O A;  3NHG A;  1SUQ A;  3A5M C;  4KHY A;  2Y1J A;  3IFR A;  1U6Z A;  4B9M A;  2QWP A;  2KLA A;  2E2P A;  4CFB A;  2OYQ A;  3P39 A;  1JLG A;  3PIP L;  3VN5 A;  1WLJ A;  4FM0 A;  2RN2 A;  3V9W A;  4YOU A;  1Z6R A;  2ZE2 A;  3CC7 N;  2Z1G A;  1WSJ A;  2HHH K;  2QW9 A;  4FZY A;  3LP2 A;  3TTC A;  3H08 A;  1QQN A;  3NFA A;  1NM1 A;  3ZX2 A;  3M5R A;  3OYJ A;  4RTF D;  1TYQ B;  4Y1D A;  4E7I A;  4OX9 K;  4BGA A;  1NK0 A;  2HOE A;  1FKP A;  3CIP A;  2P5G A;  1WBB A;  1JCE A;  1VRT A;  4IFE A;  3NH2 A;  4GW6 A;  1GLJ O;  2IC3 A;  3QES A;  5C42 A;  2E5L K;  1NJX A;  1M1K O;  1KXP A;  3QIP A;  1YJ9 N;  3QER A;  3O08 A;  3A5O C;  4ICL A;  3JS6 A;  4KH5 A;  3RMA A;  4C8L A;  4FJN A;  4BRM A;  1SKW A;  1C1B A;  4CEZ A;  4CJL A;  1C0T A;  3I0S A;  3EL2 A;  4F4K A;  4BRK A;  4CFA A;  1U2V A;  3O4N A;  2BGG A;  4E1M A;  1VQ4 N;  3NE6 A;  3ZLJ A;  4OKK A;  1UA1 A;  1SV5 A;  2DFE A;  4AHS A;  2D5R A;  4JKB A;  4AF1 A;  5HRO A;  5CZ1 A;  1J5O A;  3TAG A;  1TL3 A;  4R5P A;  4BC5 A;  5EXW A;  4BAC A;  4FJM A;  3KWG A;  3MN9 A;  2P9U A;  4LF6 K;  3TAN A;  4FZZ A;  3C6A A;  3L2V A;  1P90 A;  1HNI A;  3RSE B;  4DSL A;  3HVR A;  1NGJ A;  3VA0 A;  3AY9 A;  3EY1 A;  4N41 A;  3SV3 A;  2Q2R A;  2Q36 A;  3AVA A;  5EOY A;  4C8N A;  1T05 A;  4ISE A;  4YDU C;  2HBJ A;  4NB4 A;  2PYJ A;  3VEN A;  2NRV A;  4DFP A;  4CJ3 A;  3VER A;  1ATS A;  4O55 A;  3T1H K;  1Q8I A;  2P1J A;  3SZ2 A;  3CCS N;  4X66 K;  4DTO A;  2VWB A;  1BL3 A;  1C1C A;  2ASP A;  4DKW A;  5ADX H;  1JCF A;  2HBK A;  2AJQ A;  4KB1 A;  3BP8 A;  3EO3 A;  1UWB A;  1BA1 A;  1CXU A;  4Y1C A;  2P9P B;  3G0Z A;  3S3N A;  3NGZ A;  1ZBL A;  4FL9 A;  4DR5 K;  1KTQ A;  2X74 A;  3FGU A;  3MN7 A;  4LFA K;  4F3O A;  2KKZ A;  3HSC A;  1DGK N;  2Z1J A;  4IXC A;  3FFK B;  4W5Q A;  1WUA A;  4LD0 A;  3R8E A;  4CZK A;  5AQJ A;  3HPH A;  4M3Z A;  4DQP A;  4Z4C A;  4CK1 A;  4JRQ A;  1QHT A;  1YAG A;  4YDU A;  4FJ9 A;  3KLE A;  4H5R A;  3H45 C;  3EKS A;  1MWK A;  4CJF A;  1NJI O;  2A40 A;  3QEV A;  2WOM A;  1A5W A;  4CF0 A;  3QFP A;  1P8Z A;  5SWM A;  1IKX A;  1NLV A;  3CCU N;  2XY6 A;  3ZET B;  1S5J A;  1KVC A;  1ASW A;  4BR7 A;  2YNH A;  4CHO A;  1VSD A;  4H0V B;  4LH4 A;  3CCQ N;  4YOT A;  4OPA A;  1Q18 A;  3ZT0 A;  1U47 A;  3BZK A;  3D0P A;  4FCY A;  3AO5 A;  5JLF A;  2RHK A;  5AQT A;  3L3U A;  3ITH A;  3R3L A;  4BG9 A;  3CCV N;  4B3M K;  1S3X A;  2CGK A;  1NK7 A;  3DRP A;  1BU6 O;  2DTU A;  3P31 A;  2ZD1 A;  1U4B A;  3SJH A;  4JKD A;  3WNG A;  1Q86 O;  1QSS A;  4RW9 A;  4DQQ A;  4I2P A;  3MK6 A;  4DUZ K;  2Z1I A;  1G15 A;  1A5X A;  3AA3 A;  3NF8 A;  4FK4 A;  1XQS C;  5C15 A;  3O8M A;  4OKJ A;  4DU4 A;  3F73 A;  1NK9 A;  3CET A;  3VQ8 A;  1HYV A;  4O8U A;  1L3T A;  3G25 A;  3O9R A;  3P1G A;  1KLN A;  3OTO K;  2YJF A;  1J54 A;  3CI5 A;  3CYM A;  5AQK A;  5KGW A;  3VQ9 A;  3RMD A;  1OH5 A;  1O13 A;  1BO5 O;  2D0A A;  3SLC A;  3LP0 A;  3TAB A;  3CFR A;  1HUX A;  4LH5 A;  3V1R A;  2PYL A;  2FF6 A;  4NYN A;  4LF4 K;  4GV9 A;  1CZA N;  5BRD A;  2YHW A;  5AQO A;  4DHY A;  5JLH A;  5JVG L;  3HM8 A;  1RT1 A;  4N5S A;  1VSE A;  3IG1 A;  1IKV A;  3VTH A;  2KFZ A;  3HJF A;  1UOC A;  2DY4 A;  1N5Y A;  1HKC A;  4DLE A;  5E84 A;  1NGB A;  4IWV A;  2HHX A;  3ZSW A;  1TVR A;  2O8D A;  3SYZ A;  2FBX A;  3P5J A;  3C0B A;  1KAX A;  3QIN A;  1RFQ A;  1BCO A;  4BR9 A;  3U4L A;  3H6E A;  2HHU A;  4C8M A;  3QFU A;  3SUO A;  1HYZ A;  2OPQ A;  5AQS A;  3F2K A;  2YCH A;  5BPN A;  4DV0 K;  4E7L A;  4GMJ B;  5HRS A;  2QA4 N;  4MO5 A;  3SPY A;  3GBT A;  3O4W A;  4DV4 K;  3IAY A;  1IO2 A;  4CJT A;  3JYT A;  1JKH A;  2GEL A;  3R9P A;  3EZ5 A;  3RWU A;  4B1X B;  3FFI A;  3ISN C;  3PSI A;  3SUQ A;  4CF8 A;  4ID5 A;  1V4T A;  1XWL A;  4QS7 A;  1GLL O;  1OKJ A;  1U04 A;  5GIP A;  1N32 K;  4MQ3 A;  1BI4 A;  1LW2 A;  3CJB A;  1BIS A;  3VA3 A;  1YTA A;  4AHR A;  3LAM A;  4DTJ A;  1KFS A;  4NCB A;  4U7B A;  2QXF A;  4CGG A;  3NH0 A;  3ZT2 A;  4BR2 A;  3AVJ A;  3DLL L;  4X65 K;  4BE0 A;  3VQ5 A;  1N33 K;  3VPZ A;  1WSG A;  5GIN A;  1QVG M;  5BRH A;  4CZF A;  4CHP A;  2YNI A;  3DYA A;  5E26 A;  2ASO A;  3UE5 A;  3E1Y A;  2Z1H A;  1Y97 A;  4CFC A;  4JLH A;  4BDY A;  1NGH A;  4JK7 A;  4FLZ A;  4RG8 A;  3OS2 A;  3WQU A;  1QSY A;  1BOT O;  5GAE P;  1C0F A;  2FSN A;  3O9U A;  2OPR A;  3KK7 A;  3V1O A;  4C8O A;  5AQW A;  3WQT A;  4FWQ A;  1REV A;  3J7Y P;  1ILY A;  3ENH A;  2YNG A;  3OYC A;  1D5A A;  3LL3 A;  4NCA A;  3LDO A;  4H0P A;  4QS8 A;  4IG0 A;  4NXM K;  4CW7 B;  3SQ1 A;  5I3U A;  3B6O A;  2OTL N;  3NH1 A;  4B3T K;  4PHT X;  3ZEU B;  3HM9 A;  2A5X A;  4CGD A;  3EN9 A;  3VF4 A;  1HJO A;  4CBU A;  4CJR A;  4BRP A;  4RW4 A;  1YIJ N;  4Y0W A;  5AQN A;  1NK5 A;  4QCL A;  5EY4 A;  4M3T A;  2GUI A;  4WFA L;  4Q0B A;  1JCG A;  1ZBF A;  4B9U A;  3VEW A;  4JV5 K;  3CJ7 A;  1YJN N;  1IKY A;  1NKC A;  3AV9 A;  2YHB A;  3M8Q A;  4HHT A;  1G99 A;  1BQN A;  4FWP A;  4FWR A;  1E3M A;  4BQL A;  4FJI A;  2PY5 A;  5JS2 A;  2NRT A;  4KHW A;  3G6E N;  4JEP A;  4U67 L;  5FPN A;  2IAJ A;  4YOV A;  3WNE A;  1EQY A;  3DLG A;  3EE9 A;  1XI1 A;  4H03 B;  3CF5 L;  3ZT1 A;  2IVP A;  2VCP A;  2YHY A;  3BY5 A;  4KV8 A;  1X9M A;  3AVC A;  3V9U A;  1DLO A;  4BDP A;  5FLX O;  2P51 A;  4GV3 A;  4NCG A;  3OS0 A;  4L8R B;  3TAR A;  3K2P A;  4O0I A;  5ELZ A;  1ASU A;  1K6Y A;  1YJW N;  1VQ8 N;  4I7F A;  5AQM A;  1TAU A;  4DV5 K;  1NGE A;  4HTU A;  3V9X A;  4Z0U A;  3VET A;  4DTP A;  4KHS A;  3AVI A;  3I8B A;  4CCH A;  3NCI A;  4M3X A;  4JK8 A;  1XHX A;  4B3O A;  4PWD A;  1BGX T;  2ETJ A;  1QTM A;  3OBW A;  3K5O A;  1TK0 A;  2NLX A;  3NGI A;  1YF5 L;  3ZSQ A;  3SBT A;  2G8W A;  4O0J A;  2QWO A;  2G8I A;  3UKR B;  2Q3S A;  4FM2 A;  4LF8 K;  3UB5 A;  4WFN L;  2BH1 A;  4YOR A;  4NLC A;  3MCP A;  5AQH A;  1NBW A;  2UU9 K;  3OYK A;  1QZ6 A;  4CES A;  1ZBS A;  1BA0 A;  4BRI A;  2BDP A;  3H3N O;  3TU5 A;  4E0D A;  2FLO A;  4BRC A;  3O80 A;  4DR6 K;  1JJ2 M;  4NXN K;  4IKF A;  4ELU A;  3AVH A;  2JWK A;  1WAF A;  4XH4 A;  2P9N A;  3MCA B;  4CGH A;  3LPU A;  5FRM A;  4KBO A;  3SI6 A;  2YHX A;  4MDB A;  3S3O A;  1RIL A;  3VGL A;  1KSP A;  3UIQ A;  3NMU A;  5AZJ B;  3QLH A;  3CCE N;  3HOS A;  4DTM A;  2FC0 A;  4AHC A;  2IGI A;  2O8E A;  2ITM A;  4NO7 A;  3T69 A;  5CYQ A;  4JKG B;  3CG7 A;  4BR4 A;  4DLG A;  1XNQ K;  3ZET A;  2YX6 A;  3KIO A;  4IFV A;  3EEQ A;  4FLT A;  1K8K B;  3AGK A;  2JLE A;  2HNY A;  1OH6 A;  3LM2 A;  3ZSY A;  4GVM A;  5LY3 A;  4CGJ A;  2YNF A;  1BIU A;  1RBR A;  3N4P A;  2J4R A;  4EFH A;  1B92 A;  3THW A;  4KO0 A;  2GTD A;  1U49 A;  1YI2 N;  1N36 K;  1UAX A;  1LAV A;  3FZK A;  3J81 O;  4LF7 K;  4DS5 A;  2WUS A;  3NF9 A;  4CIG A;  4B9Q A;  4CJW A;  4CEQ A;  1VSF A;  3SBG A;  2XO7 A;  3DOL A;  1NG9 A;  3VQQ A;  2QKK A;  3KKR A;  4BRN A;  1WSI A;  3GG4 A;  2VWK A;  3AO3 A;  5DM7 L;  1VQP N;  2A1R A;  5KQ8 A;  2HND A;  1DTT A;  4FLV A;  3D2E B;  4JKE A;  2H3G X;  4JI4 K;  4W5O A;  1C0U A;  2WON A;  3VQP A;  3FZH A;  2QI2 A;  5A2Q O;  3AVK A;  3C6H A;  2XY5 A;  4CJS A;  1JLQ A;  3VEV A;  4N47 A;  3N4Q A;  4FLU A;  3CFO A;  3L3V A;  5BRE A;  3VEO A;  1OH7 A;  3CHW A;  1HQU A;  1KAY A;  4B1U B;  4XEI A;  3DWL A;  3NVM A;  4JKA A;  3TPQ A;  4GKK K;  4CZI A;  5T7B A;  1GLE G;  3E9P A;  5JMV A;  4CEE A;  4AIL C;  4FJ8 A;  1IJJ A;  4FWO A;  5C25 A;  1XC9 A;  4Z4G A;  1T44 A;  5AQG A;  2Q97 A;  2P9K A;  5AQL A;  1QE1 A;  4PQU A;  4B3R K;  4FJJ A;  5AQY A;  1RTI A;  1RDU A;  3MX5 A;  4OLA A;  1U2V B;  4A61 A;  1TAQ A;  3VGM A;  3F9M A;  5TKW A;  4GY2 B;  4FVU A;  2DFF A;  1S6Q A;  4QOZ B;  3CJC A;  4JS5 A;  4EP4 A;  4IDK A;  2A41 A;  4J2A A;  1ESV A;  1WN7 A;  2HVI A;  1RBV A;  5IWA K;  3THX A;  4MFB A;  3SUP A;  3SK3 A;  1QQO A;  4WYB A;  2FSJ A;  1ZBH A;  2GEM A;  3QIC A;  2D0B A;  1U48 A;  1KRP A;  1IKW A;  4ZTF A;  1NMN A;  3V4I A;  1V4S A;  1GOB A;  3NF7 A;  3D7E O;  1RGI A;  4RW7 A;  4CJ7 A;  5AQF A;  4I6M B;  3QIO A;  4WF9 L;  4IFY A;  4DSI A;  3WXL A;  3L4Q A;  2UXD K;  4IEE A;  4B9V A;  1D8Y A;  5LJV A;  1X9W A;  4FWM A;  4OGE A;  4G1Q A;  3K9J A;  4H0Y B;  1BCM A;  4CGI A;  3OY9 A;  1QS4 A;  2CGL A;  2QK9 A;  4CJP A;  1T03 A;  2ZM6 K;  3C6U A;  2VGN A;  4CK3 A;  4OPJ A;  4FJ5 A;  3OYB A;  1NOZ A;  1WNS A;  3TTD A;  2VQE K;  3P83 D;  1X9J A;  1VSK A;  3WXM B;  2QWR A;  3CQX A;  1I94 K;  1I39 A;  3TAP A;  2E6M A;  3QBX A;  2RE2 A;  1VQO N;  1N8R O;  4CD3 A;  4DWI A;  4OJR A;  1SL0 A;  1RDC A;  1EWR A;  3WNH A;  4F9O A;  5LL6 Z;  3SQ2 A;  4KHU A;  1NKB A;  3D45 A;  2F96 A;  1RNH A;  3B8A X;  1WSE A;  3VQD A;  4A2B A;  1R59 O;  1KVA A;  4MO4 A;  2HHQ A;  3L0Q A;  5AFU A;  4BE1 A;  3HXM A;  4OO1 J;  5CY4 A;  1HJR A;  1RTD A;  4Z4H A;  4M7Y A;  1NOY A;  3THX B;  2XRI A;  5M1N A;  3DXK B;  3L2W A;  1DKG D;  4BRL A;  3HK2 A;  3ATV A;  5DMR A;  3LZJ A;  1RT4 A;  3S41 A;  1W2B M;  4BRH A;  2PFU A;  5GAH P;  3GDQ A;  4ILH A;  2ZGZ A;  1YIT N;  5KGX A;  1VSJ A;  4CK2 A;  4FXD A;  1Z26 A;  3QEP A;  4IJA A;  3MMV A;  3THY B;  3CJ1 A;  3TR8 A;  5BR8 K;  4H5N A;  3CER A;  3LDS A;  4KRF A;  4FO0 A;  5BPL A;  3ZSV A;  1L3U A;  3KK2 A;  3KLF A;  3FZL A;  1YHQ N;  4Q5V A;  1X3N A;  1MU2 A;  2V7Z A;  4JI6 K;  1JLB A;  1S1U A;  1JLF A;  4CZE A;  1O1W A;  4JHD A;  3D6R A;  3QET A;  1J53 A;  3AVF A;  4C1N K;  2YI1 A;  5HRP A;  2QXL A;  4GNI A;  4DV6 K;  3KLG A;  2GWJ A;  1ZXO A;  1TKD A;  1NJY A;  3ATU A;  2HF4 A;  3RTV A;  3HBT A;  1Q7Y O;  1TV6 A;  2HBM A;  3D2F B;  3RVC A;  3LAN A;  3L2R A;  4BRQ A;  3AAR A;  1VQ6 N;  3U8X A;  4FM1 A;  4B9T A;  4W5T A;  3E9O A;  3KHY A;  1NMD A;  4B8A B;  2YJE A;  4JRP A;  5AQZ A;  5FPE A;  4K43 A;  3KD1 E;  3O6W A;  4JI5 K;  1HYS A;  4JHD B;  2KFN A;  4DFJ A;  3VOV A;  3WXJ A;  1C6V A;  3NBP A;  4CF2 A;  1ZBI A;  4FJK A;  4HCB A;  3CMA N;  4B08 A;  2FSK A;  3RRG A;  3SAH A;  1HKG A;  1VSH A;  4WE1 A;  4FVM A;  3QML A;  4JYA K;  4AQY K;  1ZBU A;  4CBW A;  5AQP A;  4EZ6 A;  2ATQ A;  4DQS A;  4FWK A;  3KJV A;  1CLQ A;  4AM7 A;  2HW3 A;  4KB0 A;  2Q0U A;  4O8K A;  5CHI A;  4WCE L;  2QTD A;  4LSL A;  3DXK A;  4DS4 A;  1YTU A;  3A5L C;  3M1F A;  4M63 C;  1L3S A;  4H4M A;  2O8B B;  4YOX A;  2NRH A;  2XY8 A;  4CEO A;  4IBN A;  3HST B;  3IS9 A;  4JI2 K;  2O8F A;  3HPG A;  1TL1 A;  1S6P A;  2ZWH A;  3CJA A;  3ZCM A;  4FW2 A;  4JKG A;  1YVN A;  4DSJ A;  2ZJR L;  4RWT A;  1C1A A;  2CH6 A;  4FWL A;  1NNE A;  4BR0 A;  4HUE A;  4O4G A;  3P38 A;  4FPB A;  2OTJ N;  3DLK A;  4DSF A;  4JI0 K;  3A8Y A;  3OYA A;  5F0X A;  3M6G A;  4M3W A;  4Z94 A;  1I3A A;  5AZJ A;  3HI0 A;  2VG7 A;  5FDL A;  2AP1 A;  1QZ5 A;  4PKH A;  3U3G A;  4CED A;  3AAP A;  4CZL A;  2XHB A;  2Y1I A;  2GUP A;  3TI0 A;  5M1Q A;  5M1F A;  4QAG A;  2G8H A;  1BG3 A;  3KKS A;  1RTH A;  4B3S K;  2G8F A;  5J2Q A;  3T3F A;  2QWN A;  4O5F A;  3ULD A;  1KD1 O;  4IO8 A;  1S9E A;  5J2N A;  4FK2 A;  2IOC A;  3M3Z A;  1FK9 A;  3ZSX A;  2A42 A;  4JK9 A;  4CHY A;  2ZF5 O;  4H8K A;  2RKI A;  3FR0 A;  3W0L A;  4DTX A;  4BGB A;  3OVN A;  3IRX A;  4E1J A;  2HF3 A;  2G8K A;  3O3F A;  5C10 A;  3A2F A;  3MEE A;  4CEA A;  3O1B A;  1ITG A;  1SL2 A;  4DSE A;  3CM5 A;  4B1Y B;  4BR5 A;  4BVO A;  4BE2 A;  2UUB K;  3RR7 A;  3A0I X;  2E4L A;  1CXQ A;  1VSI A;  3RMC A;  5EX5 A;  4I9L A;  3DXM B;  3C94 A;  1BIZ A;  4X62 K;  5KPT A;  1T6D A;  4E19 A;  1SKS A;  2UUA K;  4LSN A;  2KZM A;  3ZX0 A;  3U9D A;  5F1X A;  1LWE A;  4DV2 K;  1QVF M;  3AA5 X;  4F3T A;  3CQ8 A;  1RBT A;  3J7Z O;  1J5E K;  3EYZ A;  4BC4 A;  2W40 A;  2GWK A;  1S72 N;  4CJQ A;  4E7H A;  4B1V A;  3QEX A;  1GOC A;  1W97 L;  1Z05 A;  4PA1 A;  3NVK A;  1NWK A;  4CHQ A;  4FLY A;  4B1W B;  4Z4F A;  3ZSR A;  3LWL A;  4ISG A;  1WAJ A;  3TWH A;  1EXQ A;  4DF8 A;  2ZQB A;  4B8C A;  4B9L A;  2O4G A;  5KTQ A;  3T19 A;  2E2O A;  1N34 K;  2IS3 A;  4CIF A;  3BDP A;  3V81 A;  1KLM A;  4KHN A;  3DLH A;  4BRD A;  2YV0 X;  5SZT A;  3DM2 A;  3WNF A;  1EWQ A;  1VHX A;  4IZ9 A;  3JSM A;  5BN9 A;  4K8X A;  4JD2 B;  4LC9 B;  4K8Z A;  1HPZ A;  1XC3 A;  4NLB A;  1QSL A;  4K41 A;  1L3V A;  2A3Z A;  5MLC Q;  3NGY A;  1NK6 A;  3KD5 E;  2OPP A;  4GKJ K;  3DAW A;  4UY8 O;  4FYD A;  5FPD A;  4A57 A;  3ZEU A;  3E01 A;  2QWL A;  2HMP A;  3Q7B A;  4J2E A;  3OYG A;  1C0M A;  3OYI A;  4AM6 A;  1RCH A;  3K9K A;  1JL2 A;  3DJC A;  2VGM A;  1K73 O;  3AO2 A;  3QO9 A;  1HQE A;  3K5N A;  5J2P A;  1VK0 A;  4CE9 A; 
#chains in the Genus database with same CATH homology
 3HPH A;  3DRR A;  5DK5 A;  4FLU A;  3CFO A;  4M3Z A;  4DQP A;  3VQ6 A;  4Z4C A;  4CK1 A;  4JRQ A;  4M42 A;  2F8S A;  3L3V A;  1QHT A;  5KRS A;  2B5J A;  4FJ9 A;  3F9K A;  1NKE A;  1WSH A;  3LAK A;  3KLE A;  1T7P A;  4CJF A;  2KZZ A;  1HQU A;  1Q9Y A;  3QEV A;  4AH9 A;  4CJV A;  3ZT3 A;  2WOM A;  1A5W A;  1CZB A;  2LSN A;  4CF0 A;  5E41 A;  2KQ2 A;  5T7B A;  5SWM A;  4N41 A;  4CEE A;  3MXJ A;  1S1V A;  5J1E A;  4AIL C;  4FJL A;  1IKX A;  1KCF A;  5C25 A;  4FJ8 A;  4PY5 A;  3DLE A;  1S1X A;  2XY6 A;  1HMV A;  1XC9 A;  1RT6 A;  1S5J A;  2A1S A;  1KVC A;  1ASW A;  2RF2 A;  4Z4G A;  1QE1 A;  1FXX A;  2YNH A;  1SL1 A;  4FJJ A;  4CHO A;  1VSD A;  4OPK A;  4LH4 A;  3T1A A;  2RPI A;  1RTI A;  2HHT A;  4DQR A;  2DFH A;  4B9N A;  4OLA A;  3ZT0 A;  1U47 A;  1S1W A;  3D0P A;  3S3M A;  2PZS A;  1TAQ A;  4FCY A;  1HRH A;  3AO5 A;  4FW1 A;  3DOK A;  1YTU A;  3L3U A;  3OYL A;  2DFF A;  1S6Q A;  3ITH A;  4QOZ B;  1TGO A;  4JS5 A;  3DRP A;  4YFU A;  1NK7 A;  4EP4 A;  4F8R A;  4IDK A;  3M8R A;  4J2A A;  2DTU A;  2OPS A;  4KHN A;  2ZD1 A;  4N76 A;  1U4B A;  3SQ4 A;  1WN7 A;  4M41 A;  2HVI A;  1RBV A;  3WNG A;  3ZT4 A;  4DG1 A;  5FRN A;  4ELV A;  5JS1 A;  3OS1 A;  1QSS A;  4RW9 A;  1J9A A;  3HL8 A;  4DQQ A;  4I2P A;  1NK8 A;  4MFB A;  2Z1I A;  1G15 A;  1A5X A;  2YKM A;  3AA3 A;  3DMJ A;  3NF8 A;  2X6S A;  3KK1 A;  4FK4 A;  1TKT A;  3V1Q A;  1ZBH A;  4OKJ A;  4DTS A;  3SQ0 A;  4DU4 A;  1LWF A;  2D0B A;  1BHL A;  3F73 A;  1NK9 A;  3VQ8 A;  4CJE A;  1HYV A;  1IH7 A;  3AA2 A;  1U48 A;  1KRP A;  3LAL A;  1LV5 A;  3TAM A;  1IKW A;  4JS4 A;  4ZTF A;  1ASV A;  1L3T A;  4OVL A;  3P1G A;  1RT5 A;  3L2Q A;  1KLN A;  3V4I A;  1J54 A;  4DSK A;  3CYM A;  5KGW A;  3VQ9 A;  4ZTJ A;  1GOB A;  3RMD A;  3NF7 A;  4RW7 A;  1S1T A;  1TK8 A;  2D0A A;  2B4J A;  2IDO A;  3QIO A;  3LP0 A;  4IFY A;  2OZM A;  4DSI A;  4CEC A;  3HT3 A;  3CFR A;  4EP5 A;  3PV8 A;  3TAB A;  1D9D A;  4LH5 A;  3V1R A;  2XY7 A;  4B9V A;  1D8Y A;  2PYL A;  2E6L A;  3SUP A;  1JLC A;  4CJU A;  4NYN A;  4DU1 A;  4KI4 A;  2HMI A;  3RRH A;  1QQC A;  4M45 A;  1X9W A;  1RT3 A;  3MED A;  4OGE A;  3OYD A;  4G1Q A;  1LW0 A;  3NAE A;  4CFD A;  1BCM A;  1RT1 A;  3OYE A;  4N5S A;  1VSE A;  3IG1 A;  4CGI A;  3NF6 A;  1QS4 A;  4UQG A;  1IKV A;  1CZ9 A;  3OY9 A;  2QK9 A;  1RTJ A;  2B6A A;  3DRS A;  4DQI A;  4CJP A;  1UOC A;  1T03 A;  3C6U A;  3HJF A;  1RDA A;  3VQ7 A;  1RBU A;  4KRE A;  1N5Y A;  2DY4 A;  4CK3 A;  2EHG A;  1R0A A;  3SPZ A;  4OPJ A;  4CGF A;  3K59 A;  2W42 A;  4DLE A;  4FJ5 A;  3OYB A;  1FKO A;  1NOZ A;  2D0C A;  1WNS A;  3RMB A;  4J2B A;  3P83 D;  2HHX A;  3ZSW A;  4E3S A;  1TVR A;  1VSK A;  3SYZ A;  2FBX A;  3P5J A;  3LWM A;  3QIN A;  4DTR A;  1I39 A;  3TAP A;  2E6M A;  1BCO A;  5J2M A;  4M3Y A;  2KTQ A;  2OZS A;  2HHU A;  4C8M A;  4DWI A;  4PQU A;  4IG3 A;  3SUO A;  3KLH A;  4KHQ A;  1HYZ A;  5D3G A;  2OPQ A;  4FLX A;  2OA8 A;  2I5J A;  4OJR A;  1SL0 A;  4E7L A;  1RDC A;  3WNH A;  4GMJ B;  3SQ2 A;  5HRS A;  4FZX C;  4KHU A;  1NKB A;  3K57 A;  3SPY A;  3V9Z A;  3D45 A;  2F96 A;  3V6D A;  1RNH A;  3VQD A;  1WSE A;  2G8U A;  3ZSO A;  1KVA A;  2HHQ A;  4BE1 A;  3HXM A;  3IAY A;  1UA0 A;  1IO2 A;  1HNV A;  1HJR A;  4KKO A;  4O5B A;  1JKH A;  5CY4 A;  4CJT A;  3I8D A;  3JYT A;  3EZ5 A;  3NDK A;  3SNN A;  3FFI A;  3ISN C;  3RWU A;  1RTD A;  3SUQ A;  4CF8 A;  4ID5 A;  4Z4H A;  1XWL A;  1NOY A;  3RR8 A;  1U04 A;  4MQ3 A;  1BI4 A;  3PUF A;  2XRI A;  2X6N A;  1LW2 A;  1IG9 A;  1BIS A;  4FJ7 A;  4FK0 A;  2BAN A;  3L2W A;  3VA3 A;  1YTA A;  4AHR A;  3HK2 A;  3AVG A;  5DMR A;  3LAM A;  3LZJ A;  3ASM A;  4DTJ A;  1KFS A;  4NCB A;  1RT4 A;  4HUF A;  4CF9 A;  2QXF A;  3B6P A;  3CM6 A;  3ZT2 A;  4CGG A;  3NH0 A;  4M3U A;  2KFZ A;  3AVJ A;  3PX0 A;  5KGX A;  1JLE A;  1VSJ A;  4CK2 A;  4BE0 A;  4FXD A;  1Z26 A;  5HBM A;  3VQ5 A;  3QEP A;  1WSG A;  4CJ4 A;  3AO4 A;  4W5R A;  4KTW A;  3TR8 A;  4CF1 A;  4CER A;  3MAQ A;  3QNN A;  3LDS A;  4KRF A;  4CHP A;  2YNI A;  3DYA A;  3VQA A;  3K5M A;  4O44 A;  3ZSV A;  1L3U A;  1B9F A;  4BWJ A;  3KK2 A;  2Z1H A;  3KLF A;  1Y97 A;  4PUO A;  4CFC A;  4JLH A;  3ZSZ A;  4CEB A;  4BDY A;  4BDZ A;  4FLZ A;  3SUN A;  3C6T A;  4Q5V A;  4KTQ A;  4RG8 A;  3OS2 A;  5HRR A;  1QSY A;  1MU2 A;  1JLB A;  1S1U A;  1B9D A;  1JLF A;  2FBT A;  4CEF A;  1O1W A;  3QET A;  4E7K A;  1WSF A;  1J53 A;  3AVF A;  2FBY A;  5HRP A;  2OPR A;  3LPT A;  1NK4 A;  4KI6 A;  3V1O A;  1X1P A;  4C8O A;  3KLG A;  1REV A;  4XIU A;  3L8B A;  4OKE A;  3TAQ A;  1TKD A;  3I0R A;  1NJY A;  4W5N A;  1RT2 A;  2YNG A;  3OYC A;  3M8P A;  4E7J A;  3SCX A;  1D5A A;  3RTV A;  4Z4I A;  1Z25 A;  2KW4 A;  3QNO A;  4NCA A;  3VQ4 A;  1TV6 A;  3HP6 A;  3LAN A;  3PO5 A;  3L2R A;  4IG0 A;  5EU7 A;  2VWJ A;  4FM1 A;  4B9T A;  3G10 A;  4W5T A;  4KPY A;  1TK5 A;  1F21 A;  4B8A B;  3M8S A;  5KRT A;  4JRP A;  3KD1 E;  3SQ1 A;  5I3U A;  3B6O A;  1HYS A;  3NH1 A;  2KFN A;  4LY7 A;  4CJK A;  4DFJ A;  4CHN A;  1C6V A;  3NBP A;  4CF2 A;  3HM9 A;  3C95 A;  4FJK A;  2X78 A;  3CFP A;  1ZBI A;  3KK3 A;  4CGD A;  4B08 A;  3RRG A;  4HCB A;  4CHZ A;  5FRO A;  1NJZ A;  1JLA A;  2YHA A;  3TAF A;  4OGC A;  4CJR A;  4RW4 A;  1VSH A;  4WE1 A;  3HPO A;  4FVM A;  2HHV A;  1ZBU A;  4BWM A;  3PX6 A;  1NK5 A;  4QCL A;  5KI6 A;  2BE2 A;  5HRN A;  4OLB A;  5K14 A;  3QEI A;  4EZ6 A;  2ATQ A;  4M3T A;  2GUI A;  4Q0B A;  4ELT A;  1ZBF A;  3OJU A;  4YNQ A;  4DQS A;  4B9U A;  2P5O A;  1NJW A;  3KTQ A;  3LZI A;  3KJV A;  1X9S A;  1VRU A;  1CLQ A;  1IKY A;  1NKC A;  3TAE A;  2HW3 A;  3AV9 A;  3DLB A;  2YHB A;  1W9H A;  3M8Q A;  4HHT A;  4KB0 A;  1BQN A;  4DMN A;  4KFB A;  3U3Y A;  5HLF A;  4TSX A;  5C24 A;  4J2D A;  4LSL A;  4H4O A;  4Z4E A;  4DS4 A;  2PY5 A;  1RT7 A;  1BI4 B;  2GBZ A;  5JS2 A;  3VQE A;  3MXM A;  1U45 A;  1L5U A;  4DFM A;  4KHW A;  4KTZ A;  1L3S A;  4H4M A;  3O3G A;  2XY8 A;  4CEO A;  4IBN A;  2IAJ A;  3HST B;  3IS9 A;  4E89 A;  3AVN A;  3WNE A;  1XHZ A;  3DLG A;  2F8T A;  3HPG A;  1TL1 A;  1BQM A;  1S6P A;  5CYM A;  1TKX A;  4AHU A;  4DF4 A;  4N56 A;  1XI1 A;  1T8E A;  3AO1 A;  3ZCM A;  4FW2 A;  3ZT1 A;  1EET A;  4DSJ A;  4F2R A;  1EKE A;  2ITG A;  4M3R A;  2R7Y A;  2FBV A;  4FLW A;  1LWC A;  3DLR A;  4HCC A;  1C1A A;  4KV8 A;  1X9M A;  3AVC A;  3V9U A;  4HUE A;  4EZ9 A;  3HYF A;  4O4G A;  1DLO A;  3V9S A;  1SKR A;  4BDP A;  3AVB A;  3DLK A;  4DSF A;  3OYA A;  2P51 A;  4M3W A;  4NCG A;  3OS0 A;  4L8R B;  1I3A A;  4HUG A;  2QKB A;  3TAR A;  1JXE A;  3K2P A;  4O0I A;  2VG7 A;  1ASU A;  1K6Y A;  5FDL A;  1RDD A;  3U3G A;  4I7F A;  1TAU A;  3PX4 A;  1JL1 A;  4CED A;  3BGR A;  4RW8 A;  4HTU A;  4FJH A;  2XHB A;  3LP3 A;  3V9X A;  2Y1I A;  4I9Q A;  4CIE A;  3TI0 A;  1VSM A;  4Z0U A;  4QAG A;  3THV A;  1A5V A;  2G8H A;  1RBS A;  3VQC A;  4DTP A;  4KHS A;  1N6Q A;  3KKS A;  3LP1 A;  1RTH A;  3K5L A;  3NHG A;  1SUQ A;  3AVI A;  2G8F A;  4KHY A;  2Y1J A;  5J2Q A;  4CCH A;  3NCI A;  3T3F A;  4M3X A;  4B3O A;  1XHX A;  3ULD A;  4NYF A;  1S9E A;  4DTN A;  4B9M A;  3KLI A;  1BGX T;  4CFB A;  2ETJ A;  4PWD A;  5J2N A;  4CJ5 A;  1QTM A;  4FK2 A;  2IOC A;  1S9G A;  3K5O A;  2OYQ A;  1TK0 A;  1FK9 A;  1JLG A;  3ZSX A;  3NGI A;  3VN5 A;  4CHY A;  1WLJ A;  4H8K A;  4FM0 A;  3ZSQ A;  2G8W A;  2RN2 A;  3MXI A;  3QEW A;  4O0J A;  2RKI A;  4DTX A;  2G8I A;  2Q3S A;  3OVN A;  3IRX A;  1LAW A;  4FM2 A;  3V9W A;  2ZE2 A;  2Z1G A;  1WSJ A;  1YVU A;  2G8K A;  1DTQ A;  4FZY A;  3LP2 A;  3O3F A;  3OYK A;  3A2F A;  3H08 A;  4CES A;  3MEE A;  3NFA A;  1KFD A;  1ITG A;  4CEA A;  3OYJ A;  1SL2 A;  4DSE A;  4C8K A;  3CM5 A;  4BE2 A;  4Y1D A;  4AHT A;  4E7I A;  2BDP A;  3RR7 A;  2G8V A;  4ZHR A;  1W0H A;  5I42 A;  2E4L A;  4E0D A;  4FJX A;  1NK0 A;  1CXQ A;  1FKP A;  1VSI A;  3OYH A;  2P5G A;  3RMC A;  1VRT A;  4IKF A;  3NH2 A;  4GW6 A;  4ELU A;  1EX4 A;  2NUB A;  3AVH A;  4I9L A;  1Q9X A;  2IC3 A;  3MEG A;  5C42 A;  3QES A;  3U6F A;  4I2Q A;  4DU3 A;  1WAF A;  1NJX A;  3HO1 A;  3C94 A;  1BIZ A;  3QIP A;  4E19 A;  4CGH A;  3LPU A;  3QER A;  1SKS A;  4LSN A;  5FRM A;  4ICL A;  2KZM A;  3RMA A;  3SI6 A;  4C8L A;  3VQB A;  4FJN A;  1SKW A;  1ZYQ A;  1C1B A;  3MEC A;  4FJI A;  3S3O A;  4CEZ A;  1LWE A;  4RW6 A;  1RIL A;  4CJL A;  1KSP A;  1C0T A;  3I0S A;  3UIQ A;  3QLH A;  3AA5 X;  2O4I A;  4F3T A;  3CQ8 A;  1RBT A;  3ALY A;  3HP9 A;  1EP4 A;  2GV9 A;  4DTM A;  4F4K A;  3AA4 A;  4CFA A;  3EYZ A;  2HNZ A;  3O4N A;  2FC0 A;  4AHC A;  2IGI A;  2HB5 A;  2BGG A;  1VSL A;  2YKN A;  4CJQ A;  4E7H A;  4E1M A;  3QEX A;  1GOC A;  5CYQ A;  4OKK A;  3NE6 A;  3OYM A;  4PA1 A;  1UA1 A;  3OYN A;  3CG7 A;  4CHQ A;  1SV5 A;  4DLG A;  4FLY A;  2DFE A;  4AHS A;  2D5R A;  4Z4F A;  4HVJ A;  3ZSR A;  1TKZ A;  5CZ1 A;  5HRO A;  1J5O A;  5CZ2 A;  1TL3 A;  3LWL A;  3TAG A;  3PY8 A;  3KIO A;  3AVL A;  4IFV A;  4R5P A;  2VG5 A;  1WAJ A;  4FLT A;  3PO4 A;  4BAC A;  3TWH A;  3S9H A;  4FJM A;  5HP1 A;  2JLE A;  2HNY A;  4B9S A;  1EXQ A;  4DF8 A;  3ZSY A;  3TAN A;  4GVM A;  4FZZ A;  4CGJ A;  2YNF A;  1BIU A;  1RBR A;  2ZQB A;  1RDB A;  3L2V A;  1B92 A;  2JGU A;  4B8C A;  4B9L A;  3K58 A;  2O4G A;  5KTQ A;  4KO0 A;  3T19 A;  2IS3 A;  4CIF A;  1U49 A;  1HNI A;  3BDP A;  3V81 A;  3SJJ A;  4DSL A;  1KLM A;  3HVR A;  3VA0 A;  2VG6 A;  3EY1 A;  3DLH A;  3SV3 A;  3DI6 A;  3AVA A;  1D9F A;  1UAX A;  4E1N A;  4C8N A;  1LAV A;  4AHV A;  2YV0 X;  1T05 A;  3AVM A;  5SZT A;  3DM2 A;  3WNF A;  4DS5 A;  3NF9 A;  4CIG A;  3JSM A;  1KVB A;  3OYF A;  2PYJ A;  4KAZ A;  4CJW A;  4CEQ A;  4K8X A;  4DFP A;  2HHS A;  1VSF A;  4CJ3 A;  2XO7 A;  4K8Z A;  3HVT A;  1HPZ A;  3DOL A;  4O55 A;  4DTU A;  1Q8I A;  2P1J A;  3VQQ A;  3SZ2 A;  2QKK A;  1QSL A;  1L3V A;  3KKR A;  1WSI A;  3O4Q A;  4F2S A;  3NGY A;  4DTO A;  1NK6 A;  3KD5 E;  2OPP A;  1BL3 A;  1C1C A;  2VWK A;  3AO3 A;  3L2U A;  2EX3 A;  3O3H A;  4FYD A;  5J2P A;  2A1R A;  4DFK A;  2HND A;  1DTT A;  4FLV A;  2AJQ A;  3E01 A;  4KB1 A;  4W5O A;  1JXB A;  4ID1 A;  1C0M A;  1C0U A;  1UWB A;  3OYG A;  3OYI A;  4J2E A;  1CXU A;  4Y1C A;  3G0Z A;  3S3N A;  3NGZ A;  1RCH A;  1ZBL A;  2HVH A;  2WON A;  3VQP A;  1JL2 A;  3OJS A;  1KTQ A;  2X74 A;  4F3O A;  1YT3 A;  3AVK A;  2Z1J A;  2XY5 A;  3AO2 A;  3QO9 A;  1HQE A;  4W5Q A;  3K5N A;  4LD0 A;  3SV4 A;  4CJS A;  1JLQ A;  1VK0 A;  4CE9 A;  1GOA A;  4N47 A;  2HHW A;  4FJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...