5HRNA

Hiv integrase catalytic domain containing f185k mutation complexed with gsk0002
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
152
structure length
148
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
total genus 54
structure length 148
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrnA00
3MXMA 4Y1DA 3CM6A 4I9LA 1VRTA 4E1NA 2VG6A 2VWKA 3ZT0A 2IS3A 3NF7A 4FVMA 4DS4A 3QESA 2FC0A 1TL1A 1BGXT 3JYTA 1WSJA 4CHNA 4KHWA 4LD0A 3CM5A 3MAQA 1EKEA 1UA1A 1Q9XA 4CJWA 2Z1HA 5K14A 4C8MA 3NH0A 4IFVA 4CJ4A 1B92A 3KK2A 2YNIA 4I7FA 3DOLA 1BIUA 3DLGA 2VG7A 4IFYA 3ZSRA 4CJ3A 4FLYA 1NK5A 1RTIA 2RN2A 1EETA 1I39A 2BANA 3HSTB 5J1EA 4KRFA 2BDPA 1X1PA 3AA3A 3KD1E 3HK2A 3A2FA 3T1AA 4PUOA 4CJQA 2IDOA 4CF1A 5T7BA 1GOAA 4DTXA 3HO1A 4L8RB 3AA5X 3LPUA 4OPJA 1LWEA 1KVAA 1UAXA 3ITHA 4O4GA 5KGXA 4ELUA 2O4GA 4RW7A 1N5YA 3S3OA 3K5LA 4CEOA 1BQNA 4DLGA 1S1WA 1YTUA 1QHTA 3QEWA 3RWUA 1WSHA 2XY7A 5J2QA 1NJYA 2KFNA 2HNYA 4RW4A 3M8RA 4F3OA 3LP2A 1QQCA 4J2AA 1D9DA 4FK2A 3K5NA 4IBNA 1JLFA 4OKKA 5KGWA 3V9WA 1SKWA 2F96A 3V1RA 4CJUA 4FLVA 3CYMA 4JRPA 1CXQA 1EX4A 4B9SA 1A5VA 3SV3A 1BI4B 1QSLA 4DSLA 2EHGA 2Z1IA 3HPGA 4F2SA 2X6NA 1RNHA 3NHGA 1JKHA 4ELTA 4FYDA 2GV9A 4JS4A 2G8WA 2XO7A 3QNOA 4FJKA 3WNFA 5J2PA 3SPYA 5JS1A 2BE2A 3ZT1A 1XHZA 3MXIA 4PA1A 3NCIA 1Q9YA 1Z25A 1WSGA 4DU1A 2XRIA 3AV9A 3QERA 4B9MA 2KTQA 3TABA 3TWHA 4DF4A 3RRHA 4DTNA 3ZSQA 1NOZA 1U49A 3DI6A 3IRXA 1ASWA 1DLOA 1WAFA 3ZSXA 4MFBA 1TKDA 2G8VA 4DQQA 1RBTA 3RMCA 1TAUA 3AVJA 1U48A 3KJVA 3P83D 4CJ5A 3OYNA 4Z4IA 1EP4A 4F3TA 1VSKA 1NOYA 3RRGA 1EXQA 4TSXA 4AHTA 1KTQA 1W9HA 1BCMA 4BWMA 3IAYA 3AO2A 3HM9A 2XY8A 4WE1A 5HRNA 4HHTA 4CERA 2DTUA 5C24A 4EP5A 4AHRA 4LH5A 4DTRA 3SUPA 2RPIA 2YHAA 3OJUA 1TVRA 3L3VA 5KRSA 1D8YA 2B5JA 4DSJA 4KKOA 1WSEA 2IGIA 3TAFA 3KTQA 4AILC 3WNHA 4B9TA 3LP0A 4NCBA 3ZSZA 4BACA 1XHXA 1NJWA 4FJGA 1S6PA 2HMIA 4DTSA 1L3TA 4C8LA 1TAQA 4FJIA 3DRPA 2KZZA 1J53A 2RF2A 3LAMA 3DRRA 3AO4A 3HPHA 1ITGA 3THVA 4J2DA 1WLJA 2WOMA 2VG5A 3LZIA 4DU3A 3DYAA 3WNGA 4KTWA 5FDLA 5CYQA 2YNGA 3KK3A 3L2UA 3PO5A 3ZT2A 3U3YA 5FROA 4Z4CA 4N76A 3NF8A 3HXMA 4C8OA 3VQ7A 3OYAA 3LANA 4Z4GA 4OKEA 4M3RA 1NKEA 4I2PA 1VRUA 4KREA 4OLBA 4FJHA 1CZ9A 3CFOA 3B6OA 4Q5VA 1SV5A 5CZ1A 4FW2A 5C25A 1JL2A 1JXEA 1J9AA 3SV4A 4HUFA 1RDCA 3VQPA 3DLBA 1ZBIA 5HBMA 4IKFA 3AVNA 3LAKA 3SQ2A 3P1GA 4AHVA 4KB0A 1TL3A 2FBXA 4CEFA 1TK5A 3AVCA 2YKMA 4M3WA 4DFMA 1KFDA 1R0AA 1IG9A 3DMJA 3ZT3A 4HUEA 1T7PA 4CCHA 2OZMA 5HRRA 3TANA 5FRMA 4KV8A 4DSKA 3L2QA 1D9FA 1DTTA 4Z4FA 3AA2A 4M42A 3V9SA 3VQEA 1L3SA 1VSFA 3SQ1A 1HNVA 1L3UA 1QE1A 4QOZB 2B4JA 4Z4EA 3LZJA 4E7IA 4EZ9A 4FJ9A 1WSIA 3EZ5A 1LW0A 4I2QA 4H4OA 4W5OA 4M3YA 4B3OA 1HPZA 1S1UA 3L2RA 3JSMA 3EY1A 2YNFA 4OGCA 4OJRA 4LSLA 1MU2A 4GMJB 3IS9A 2ITGA 3K5OA 3HP9A 4O55A 1BHLA 1KCFA 1REVA 1BQMA 2XY5A 1RT2A 3BGRA 3VQ5A 3OVNA 2W42A 3SUOA 2OPPA 1NK7A 2HHWA 3VQCA 3LALA 3M8SA 3PX6A 4M41A 3KIOA 4HCBA 1XWLA 3NFAA 1K6YA 1IKXA 1IO2A 1SKSA 1RCHA 1RT4A 2E6MA 3HPOA 1KVCA 2PZSA 1Q8IA 1WN7A 2QXFA 1W0HA 4RW6A 4DFKA 4KHSA 5KTQA 1YT3A 3NAEA 2R7YA 1HNIA 4OPKA 3D0PA 1LAVA 4OLAA 2P5OA 2PYJA 3RTVA 2LSNA 1WAJA 3OY9A 1BCOA 4AHCA 4DSFA 4IG0A 4CJVA 4CEBA 1FXXA 4B8AB 1TK8A 3KD5E 3QEVA 2XY6A 3H08A 1NK4A 2WONA 4AHSA 1ZBUA 3O4NA 4G1QA 4HVJA 4BDZA 4DTJA 3SZ2A 5J2NA 5I42A 1HQUA 3AVFA 4KI4A 1WSFA 2I5JA 4CHQA 4FLXA 4ZTFA 4ZTJA 4JS5A 3IG1A 1KLNA 4DLEA 3L2VA 3HVTA 4FJMA 4OVLA 3S3MA 4FJNA 1HMVA 1HJRA 4ID1A 2NUBA 4O5BA 4DMNA 3K58A 4O44A 4M45A 4Z4HA 4DFPA 1KSPA 1S9GA 4FZYA 4DSEA 2OZSA 4CJLA 3F73A 3VQQA 2EX3A 4FJ7A 5EU7A 4Q0BA 4H4MA 1KLMA 3DLKA 3C94A 4BE2A 4DFJA 4E0DA 2HHXA 3AVIA 1C0TA 3OS0A 2KFZA 2YV0X 1GOBA 3PUFA 1UOCA 3VN5A 3MEGA 5HROA 4B9NA 1ASVA 4GW6A 4XIUA 3AA4A 3E01A 4LSNA 4CHZA 1Z26A 3L8BA 4CK3A 4PWDA 4KB1A 3ZSOA 4CHOA 1JLQA 3SUQA 3VQDA 4E1MA 3OYGA 2DFEA 3HT3A 1J5OA 4CFCA 2QKBA 2HNZA 3B6PA 3QLHA 4CIEA 4IDKA 4CF8A 4N5SA 1L3VA 1O1WA 1DTQA 2D0AA 1IKVA 1RBSA 4B8CA 3VA0A 1YVUA 1NK6A 3CQ8A 3P5JA 4EP4A 1JLEA 2X78A 2O4IA 1SL0A 4KI6A 4N56A 1L5UA 3NGZA 4CGFA 2VWJA 2QK9A 2YKNA 2DFHA 1HYVA 2A1SA 2ETJA 4FJLA 1KVBA 2DFFA 4DQRA 3K2PA 4CGGA 3QNNA 3O3GA 3TARA 4B9VA 2HVIA 4ELVA 4CF2A 1BI4A 4DSIA 3OS1A 3OYCA 1BISA 1VSIA 4O0JA 4E7HA 3DLRA 1D5AA 4FLUA 3OYDA 3VQ8A 1WNSA 4DTPA 1QSSA 1A5XA 4UQGA 4CFAA 5SWMA 4FK0A 2P51A 1C1AA 3C6TA 4CESA 1NK8A 3MEEA 3CFPA 1ZBLA 5FRNA 4ZHRA 1NK9A 1RT6A 3QIOA 4DF8A 4FM0A 1SKRA 4JLHA 3OYLA 4R5PA 3LWMA 3DLEA 4CJKA 1S1XA 4FLWA 1C6VA 2ATQA 1RT5A 3SNNA 1RTDA 2IOCA 1HYZA 4CIFA 3F9KA 3AVKA 4C8KA 2KW4A 3DRSA 3DLHA 1U04A 2OPRA 1LWFA 3VA3A 5HLFA 5C42A 4BDPA 3SQ0A 3AVAA 1SL2A 5I3UA 3ZCMA 3HL8A 5CY4A 4E19A 4BDYA 1QS4A 3RMAA 3SJJA 3UIQA 4Y1CA 4QCLA 3OYBA 5CYMA 2Z1GA 3SQ4A 2IC3A 3QIPA 3KKSA 4CGJA 2E6LA 3L3UA 3U6FA 3TAMA 2XHBA 3D45A 2OYQA 4PQUA 1VSHA 3MECA 3V1QA 3ZSVA 3OJSA 2GUIA 3LDSA 3HJFA 4W5NA 4H8KA 4HTUA 5HP1A 2OPSA 3O3FA 3HVRA 1QSYA 4FJXA 4CFBA 2HHSA 4EZ6A 3OYEA 1TKZA 4DQSA 3RMBA 1HRHA 2OPQA 2ZE2A 4KO0A 3ZSYA 1T8EA 4B9LA 4E7KA 2HHTA 3LP1A 1XI1A 3SI6A 2HNDA 3V81A 3I0SA 2Y1IA 1NJXA 1KRPA 4NCAA 1ZBHA 3AVMA 2D5RA 3VQ6A 1I3AA 4AH9A 4FLTA 3QEPA 1S5JA 1CLQA 3ALYA 3SUNA 3KLIA 1X9WA 3LP3A 2P1JA 4KHQA 4KTQA 5CZ2A 4AHUA 4B08A 2FBYA 3M8PA 2PYLA 3M8QA 2F8SA 4K8ZA 1VSMA 4CF9A 1B9DA 3NGYA 4F2RA 3KLHA 1CXUA 1JLGA 3C6UA 2G8KA 3V6DA 1XC9A 4DG1A 1G15A 5JS2A 1ZYQA 2AJQA 3NE6A 4DTUA 4HCCA 4CF0A 1T03A 1RTHA 2Y1JA 5SZTA 1X9MA 2BGGA 4CEDA 4FJ8A 2HHUA 3K59A 1RBRA 4I9QA 3QINA 4C8NA 1BIZA 1JXBA 4CJRA 1J54A 3LPTA 3QEXA 4MQ3A 4FK4A 5E41A 1NK0A 1RTJA 1VSEA 3V4IA 3AVBA 4E3SA 4E89A 4M3XA 4CEQA 2HB5A 4CK1A 4DQIA 3AVGA 3V9ZA 3AVLA 3O4QA 3TI0A 4J2EA 3PV8A 4KFBA 2ZD1A 2JLEA 3OYFA 1JLAA 4IG3A 4FJJA 2DY4A 1RBUA 1NKBA 1QTMA 1YTAA 4RW8A 4DTMA 4CHPA 3S9HA 3CFRA 4CEZA 2YHBA 3S3NA 1X9SA 4K8XA 1FKPA 4ID5A 3G0ZA 4ICLA 4CHYA 1TKXA 3K57A 1C0MA 4FW1A 4NYNA 1U45A 3ZT4A 2B6AA 1LAWA 1JL1A 3CG7A 3I8DA 2D0BA 3KLGA 3K5MA 3L2WA 4KPYA 4E7LA 3NH2A 3QEIA 3PX4A 4KHUA 1IH7A 3ULDA 1C0UA 1VSJA 3RMDA 3ZSWA 3KK1A 2RKIA 4QAGA 4CEAA 4CIGA 3NH1A 4DWIA 1ASUA 2HHVA 4KTZA 1JLCA 4CGIA 3T3FA 1HYSA 2PY5A 4W5TA 1N6QA 3VQAA 1SL1A 4DQPA 3NGIA 1GOCA 1RDAA 4DU4A 2D0CA 1UWBA 3AO3A 2IAJA 4CECA 1LV5A 3RR7A 3FFIA 2HW3A 2FBTA 1IKYA 4N41A 1LWCA 1RBVA 4CJEA 5DK5A 3OYHA 2YNHA 1RT1A 1S9EA 1FKOA 5J2MA 4J2BA 4N47A 4BWJA 3BDPA 4NYFA 3ISNC 1F21A 3U3GA 3VQ9A 1CZBA 4CK2A 1NKCA 1U47A 4YFUA 4FM1A 1IKWA 3HP6A 2A1RA 2JGUA 2Q3SA 3V9XA 4LY7A 3G10A 1VSDA 4BE1A 4PY5A 1BL3A 1UA0A 4KHYA 2G8FA 3TR8A 4W5RA 1S1VA 1KFSA 2G8HA 2X74A 1RT3A 1A5WA 4LH4A 5D3GA 1TGOA 2FBVA 4Z0UA 1U4BA 4CJPA 3NF6A 1C1CA 3EYZA 2OA8A 1C1BA 4RW9A 3LWLA 3T19A 4YNQA 3OYMA 1TKTA 3WNEA 1HQEA 1NJZA 4FM2A 3OYJA 1RT7A 1S1TA 3AO5A 3MEDA 4CEEA 4M3TA 4CJFA 1RDDA 3VQ4A 3DOKA 4FLZA 3OS2A 3TAQA 4B9UA 4CFDA 5HRPA 1B9FA 4HUGA 3DM2A 3AO1A 3PX0A 1VSLA 3TAEA 3KLEA 1SUQA 2ZQBA 4F4KA 3C95A 4CGDA 3PY8A 4CGHA 4BE0A 1LW2A 4OKJA 1TK0A 4NCGA 3V9UA 3AVHA 3RR8A 4FZZA 1TV6A 2P5GA 4KAZA 2G8IA 4FCYA 2KZMA 3QETA 2Z1JA 5HRSA 4CE9A 3OYIA 2X6SA 4CJSA 1FK9A 4F8RA 2HHQA 3TAPA 4W5QA 2F8TA 4M3ZA 4FXDA 4O0IA 3SCXA 5KRTA 3V1OA 3SYZA 3NDKA 4FZXC 3QO9A 5DMRA 1JLBA 4FJ5A 2QKKA 1ZBFA 2GBZA 1VK0A 3ASMA 1Y97A 3KKRA 3VQBA 3SPZA 3NBPA 1RILA 2HVHA 4E7JA 4RG8A 3PO4A 4OGEA 4JRQA 3NF9A 2E4LA 3I0RA 4GVMA 3TAGA 5KI6A 3KLFA 4KHNA 2KQ2A 3MXJA 4CJTA 3OYKA 2G8UA 4DTOA 4M3UA 1S6QA 3O3HA 1RDBA 4DS5A 3HYFA 1T05A
chains in the Genus database with same CATH superfamily
4FWMA 3MXMA 3HBTA 4BR9A 2A6AA 1V4SA 1VRTA 4E1NA 2VWKA 2IS3A 3NF7A 2J4RA 4BVPA 2FC0A 1TL1A 4JKHA 1Q9XA 3MAQA 1UA1A 4JV5K 3QMLA 3CC7N 4WQ5A 2P5OA 3ZSRA 3HK2A 3HSTB 3NMUA 3A2FA 1QQMA 4CJQA 4DTXA 1GOAA 1VQ5N 3KZBA 2JWLA 5AQSA 1UAXA 4FWRA 1KXPA 2O4GA 4B3RK 3BP8A 3OTOK 3FZFA 4IO9L 1HNWK 4CEOA 4BQZA 1NBWA 3JXUA 3QEWA 2HBLA 5J2QA 4LC9B 4GKJK 3M8RA 2RHKA 4JKCA 4IBNA 3PIPL 4CJUA 4J8FA 3CYMA 4B9SA 1CXQA 3O08A 1BA0A 2Z1IA 3HPGA 1EWQA 4YOUA 1IBMK 4FYDA 3FLCO 4DHYA 2V51B 2G8WA 2XO7A 3QNOA 4KH5A 3SPYA 1TYQA 3U9DA 1XHZA 3O6WA 4PA1A 4WCEL 3MMVA 4DU1A 4MLEA 1N34K 2ZGYA 4DTNA 1NOZA 3AARA 3SAFA 3ZSXA 3CJ1A 3O9RA 1TAUA 3HOSA 2P9UA 4HTLA 1W9HA 1N36K 3IAYA 4JI6K 3DXKA 3EO3A 5AQJA 3R8EA 1S72N 2HF4A 2P9SA 3OJUA 1TVRA 5KRSA 2B5JA 2KHOA 1WSEA 1ATNA 3AY9A 3WNHA 1YF5L 4NCBA 4BACA 1T6DA 1XHXA 3EE8A 5LMNK 1NJWA 4FWSA 4FJGA 4CW7B 1TAQA 1J53A 3AGRA 3LAMA 3DRRA 5IWAK 4DR3K 4J2DA 2WOMA 1J5EK 3BF1A 4KTWA 3CMAN 3KK3A 3U3YA 5FROA 3MK6A 3C7NA 3U9ZA 4RWTA 4C8OA 4BC2A 3VQ7A 3OYAA 1VQMN 4M3RA 4FJHA 2O8EA 3CFOA 3D2FA 5C25A 1J9AA 4JK7A 2FSNA 2DPNA 5I9EB 1ZBIA 3LAKA 3VTHA 3P1GA 4CEFA 5KQDA 1KFDA 2O8FA 1T7PA 1W7AA 4RTFD 1VQ9N 4ILHA 3T1HK 4Z4FA 3AA2A 4K43A 1VSFA 1XUPO 1HKBA 1L3UA 2A5XA 4B1WB 4QOZB 4Z4EA 1YHQN 4EZ9A 1WSIA 2CH6A 1G99A 4DR5K 1D4XA 4OJRA 4B1ZA 3K5OA 2E2OA 2I7NA 3VQCA 3M8SA 3PX6A 4PHTX 2P9NA 1XWLA 2QWRA 3SAHA 4BR0A 1SKSA 1RCHA 2E6MA 4RW6A 1WN7A 4KHSA 5EY4A 3DWLA 3NAEA 2R7YA 2NRTA 1X3MA 4M7XA 2O8CB 3R6MA 3OY9A 2OCEA 4CJVA 1FXXA 3EKSA 1RGIA 1ZBUA 4AHSA 4G1QA 4FPBA 4DTJA 2YHXA 4CHQA 4FLXA 4JS5A 1WBDA 3L2VA 3HVTA 4OPHA 4OVLA 3J8AA 5GADP 1HMVA 1E4FT 1HJRA 4O5BA 4B9QA 2ASOA 4IZ9A 4M45A 4MDAA 1KSPA 4FZYA 4CJLA 2EX3A 5EU7A 3SMSA 5JLFA 4H4MA 1KLMA 4BE2A 3C94A 2EWSA 4QS8A 4H5VA 1SS6A 1NG9A 4MO4A 3LDQA 2ASMA 4JK8A 1Z26A 3L8BA 4PWDA 3MX2A 3ZEUB 1JLQA 3SUQA 4E1MA 2DFEA 2QWNA 3CI5A 3CCRN 3QLHA 4CF8A 1DTQA 1RBSA 3OA9A 2O4IA 3L0QA 2YJEA 4KI6A 4N56A 1L5UA 3N4PA 2VWJA 1WB9A 1HYVA 2A1SA 2ETJA 1VQNN 4DQRA 3QNNA 2HVIA 3TARA 2E2NA 3A0IX 4E7HA 4FLUA 3OYDA 5SWMA 3HOTA 1C1AA 1ZBLA 4H03B 1C0GA 1RT6A 4WFAL 4DF8A 1YVNA 1S1XA 3JAMO 1RT5A 2IOCA 4BGAA 4CZFA 3F9KA 2KW4A 3DRSA 4PKIA 1U04A 2QI2A 3G25A 3FZLA 5AQXA 3SQ0A 5EOYA 3MWTA 3ID8A 4FOIA 2QA4N 3HL8A 5CY4A 3SJJA 2OTJN 2Z1GA 3SQ4A 4NLBA 5B8HA 2IC3A 2UUBK 3L3UA 2XHBA 3D45A 4H0PA 2AP1A 3MECA 3OJSA 3TSQA 5M1NA 4HTUA 5HP1A 2OPSA 4A2AA 4FJXA 4LF4K 4H0XB 1T8EA 3RMBA 1K8KB 1BOTO 4NCAA 3THYB 1NJXA 4CD1A 1I3AA 4AF1A 4FLTA 1R59O 3M3ZA 3SUNA 4YOWA 1X9WA 1JJ2M 4KTQA 4FOEA 2PYLA 5C0YA 3SMPA 3NGYA 4F2RA 3LDPA 2CGKA 1QVGM 3V6DA 4HCCA 3NVKA 2Y1JA 2BGGA 3QINA 4NLCA 3D2EB 4CZEA 1NK0A 1RTJA 1GLDG 3V4IA 4E89A 2HB5A 2OANA 3ATUA 4B1XB 1GLAG 2Q1NA 3V9ZA 4U7BA 4NXNK 3CJBA 1JLAA 3WQUA 4KHPK 1NKBA 5BREA 3K9KA 3S3NA 3LDOA 4K8XA 2VQFK 4NYNA 4BRHA 1U45A 3ZT4A 1JL1A 2UU9K 1EWRA 2UYTA 5M1OA 1MWMA 3H46O 3K5MA 3NH2A 5F0XA 3PX4A 3CQXA 2HHVA 4KTZA 1JLCA 4CGIA 3T3FA 1N6QA 3VQAA 4A5AA 5MLCQ 1GOCA 4CECA 1EO1A 4B3TK 4JKAA 3O1BA 3TTDA 5J2MA 3KWIA 3ISNC 3P31A 3U3GA 4CZMA 2O8CA 4CK2A 3ULEA 3CJ7A 5AQIA 2A1RA 4LY7A 3BF3A 2HMPA 5M1QA 1BL3A 3T69A 2W6LA 2ZF5O 1KFSA 4BR4A 1WUAA 3GG4A 1RT3A 5D3GA 1TGOA 4IOXA 4MLHA 4Z0UA 4A57A 4CJPA 1C1BA 4RW9A 4YNQA 2KLAA 4BG8A 1U6ZA 1YITN 3WNEA 4BREA 1NJZA 1S1TA 4A59A 3MWPA 1RDDA 1YJWN 3TAQA 4CFDA 2NRZA 4F4KA 3TAEA 3KLEA 1SUQA 2ZQBA 1YIJN 1NGCA 5AQGA 4CGDA 4BE0A 1TK0A 3AVHA 4FZZA 5KPZA 1TV6A 4KAZA 3ZEUA 2HOEA 1YAGA 4H5RA 3QETA 1X9JA 3OYIA 4CE9A 1FK9A 4BRNA 5LJVA 1HNZK 3N4QA 4M3ZA 3SCXA 3V1OA 2ZJQL 1N8RO 3A5OC 1ZBFA 1Y97A 1RILA 3FZHA 1S3XA 3A8YA 3P39A 3QBXA 1XNRK 4CZJA 3KLFA 4CJTA 2G8UA 4DV1K 4DTOA 4LFCK 1IJJA 4DS5A 1RDBA 2JWKA 3VESA 1FW6A 4Y1DA 5GINA 2W6KA 4DS4A 3U8XA 4CHNA 4DV6K 3CM5A 2CGLA 1EKEA 3SLCA 1TYQB 5BPLA 2Z1HA 1P8ZA 4C8MA 3KWGA 3KK2A 1BIUA 4CJ3A 2F7TA 1RTIA 1HKCA 4ISEA 1NGDA 5AQTA 3I55N 5ADXA 2V7YA 1KD1O 3VGLA 5GAGP 3GL1A 5T7BA 3HO1A 3GE1A 2GELA 4L8RB 3JS6A 4G9ZA 1VQ6N 3VEXA 4X65K 4RW7A 2P9UB 1N5YA 2PBDA 1ATSA 3UB5A 5AQZA 3DXKB 2D0PA 3RWUA 3C6HA 2KFNA 2E2QA 2P9SB 1E3MA 2WFBA 2QXLA 3K5NA 1JLFA 5KGWA 3V1RA 4JRPA 1EX4A 2GX9A 4DSLA 2EHGA 2O8BA 4F2SA 4ELTA 4BRLA 1Z6RA 5C12A 5JS1A 1H1VA 4JKBA 1Z25A 3GBTA 1WSGA 3SJHA 1K9MO 4JI7K 3DLLL 4CVNE 3D2EA 3TWHA 3RRHA 1U49A 4IXCA 4BVOA 4OO1J 1VQ7N 3IRXA 2FSKA 4MFBA 3MCPA 2VQEK 2G8VA 1RBTA 1EQYA 1SZ2A 1U48A 3WXLA 2P9KB 1VSKA 1NOYA 3RRGA 4TSXA 3P38A 5C2DA 4CERA 2DTUA 5C24A 4EP5A 3G4SN 3AAQA 4LH5A 3SUPA 3LM9A 2QWQA 2UUCK 3HZ6A 4DV7K 3CD6N 4DSJA 4AILC 1LOTB 3L6QA 2VWBA 3CXCM 4LFBK 2FF3B 2HMIA 4FJIA 1S22A 3DRPA 2KZZA 3HPHA 1JCGA 3H6EA 4DU3A 4YOXA 3DYAA 1NNEA 1VAZA 1NGBA 2YNGA 4GV9A 1Q18A 3NF8A 3LANA 3E9LA 4R79A 4EIAA 1NKEA 4I2PA 4OLBA 1SV5A 4FW2A 3SV4A 4H0TB 4IJNA 5BR8K 5BRFA 4AHVA 4KB0A 4EFHA 2FBXA 1TK5A 3AVCA 3FR0A 1R0AA 1IG9A 1NGFA 3ZT3A 3TANA 5FRMA 4M42A 3V9SA 3H1VX 2WTUA 4C23A 4BQLA 3EL2A 1YXQA 4JEPA 2B4JA 3M6GA 4FSVA 3LZJA 4E7IA 4FJ9A 1LW0A 4M3YA 4B3OA 4JKFA 1HPZA 1S1UA 3CJCA 3H45C 4DB3A 1QHAA 3IS9A 3HTVA 3CETA 1KCFA 2XY5A 4B1YB 1RT2A 4DV5K 3BGRA 3VQ5A 3OVNA 1YUWA 2W42A 2OPPA 4M41A 5GIPA 1K6YA 3VETA 1IKXA 1RT4A 1KVCA 5KTQA 1MWKA 1X3NA 3ZETA 1HNIA 4OPKA 4OLAA 1LAVA 2V7ZA 4B1UB 4CBXA 3RSEA 4X66K 4QS7A 1BCOA 5AJ3K 4IG0A 4FWQA 2NZTA 1TK8A 1IG8A 3O9TA 3CERA 1T44A 4WQ5C 2WONA 1HQUA 1WSFA 4ZTJA 5FPNA 4DLEA 4FJNA 1RDUA 4O44A 4DFPA 1S9GA 1BU6O 1FJGK 3LDNA 3QFPA 3DLKA 4DFJA 4E0DA 1BUPA 3AVIA 3R1XA 2YV0X 1GOBA 3PUFA 4IOCL 2H3GX 3AA4A 3E01A 4LSNA 2F9TA 3ENOA 2GTDA 4KB1A 4CHOA 2UXDK 3PSFA 4EAHD 3OYGA 3F5TA 3FFKB 3B6PA 4YY3K 4IDKA 1L3VA 1O1WA 2D0AA 5ELZA 1NK6A 3CQ8A 2X78A 4CGFA 4DV3K 3O1WA 1SAZA 1GLLO 4BRIA 5AQLA 4FK0A 1N32K 4UQGA 4CFAA 4RCHA 3WQTA 4CESA 4JI2K 2OTLN 3CFPA 5F1XA 4ZHRA 3O9UA 5AFUA 1GLJO 1NGIA 1SKRA 4JKDA 4CJKA 1C6VA 1RTDA 1IV0A 1HYZA 1YJ9N 3I33A 3VA3A 1LWFA 2BH1A 3E9PA 5C42A 1SL2A 4E19A 2P9KA 3RMAA 3UIQA 4Y1CA 2FLOA 5CYMA 1K73O 5LY3A 3KKSA 2E6LA 2OYQA 3F2KA 3WT0A 1M90O 2Q36A 4O8UA 4H8KA 4W5NA 4KH4A 1QSYA 3BZKA 4CFBA 3ENHA 4DQSA 2A41A 3ZSYA 4B9LA 4E7KA 1ZC6A 3LP1A 3SBGA 3SI6A 1OVQA 4WQ4A 1KRPA 3IUCA 3M5RA 2I7PA 1Q86O 3ALYA 1CLQA 4KHQA 4BY9C 4AHUA 5LJWA 3O4WA 4CF9A 4ISGA 3KLHA 3J7ZO 1CXUA 3C6UA 3QICA 3VPZA 3ATVA 1G15A 3HRGA 5JS2A 1ZYQA 3NE6A 3O80A 1OH7A 4CF0A 5SZTA 1X9MA 4FJ8A 3K59A 2FSJA 1DKGD 5AQPA 4C8NA 3QEXA 4XH4A 4E3SA 4OX9K 3TSPA 4DQIA 3ULEB 3WXJA 3O4QA 4WFNL 3CJAA 3PV8A 2ZD1A 5AQVA 4LF6K 1RBUA 1QTMA 1YTAA 2CGJA 4U67L 4JI0K 4CEZA 4IDHA 1ZXOA 1FKPA 4X62K 4FWKA 3K57A 1C0MA 4FW1A 3I8DA 1LAWA 3FZKA 3KLGA 1BO5O 1HPMA 4E7LA 4KHUA 1IH7A 1C0UA 2D1KA 3A5MC 4DU4A 2D0CA 1UWBA 2IAJA 4YOYA 1LV5A 1IKYA 4A61A 4YDUA 1RBVA 5DK5A 1RT1A 1S9EA 4N47A 4BRAA 1NKCA 4YFUA 2YX6A 4FM1A 5IT9O 2JGUA 1BG3A 3V9XA 3G10A 4PY5A 3CC4N 5ADXH 1U2VB 4FO0A 3CCEN 3VEOA 4CBUA 3T19A 3CCSN 4FM2A 1RT7A 4CEEA 4M3TA 3CHWA 4A62A 3VQ4A 4FLZA 3LDLA 3OS2A 4ILGB 4HUGA 2NLXA 4H0YB 1LW2A 4OKJA 3RR8A 4NCGA 2G8IA 2ZJPL 2KZMA 1NGGA 2ASPA 4FWNA 4F8RA 4OPAA 2Q2RA 3TAPA 1YJNN 5AQRA 4FZXC 3QO9A 2GWKA 4FJ5A 2GBZA 3ASMA 2GUPA 2HVHA 1TUYA 3VEVA 4JRQA 2E4LA 4KHNA 3WXKA 4L3QA 4KRFA 3T7ZA 3H3OB 2CH5A 4DR6K 2O8BB 2YCHA 1NGEA 3CM6A 5AQOA 2VG6A 2HHHK 3QESA 4EHUA 5AZJA 3JYTA 1WOQA 1WSJA 1GLEG 1BWFO 4CJWA 1DT9A 1XC3A 5K14A 3NH0A 4IFVA 4GVEA 4M7YA 4CJ4A 4JHDA 3DOLA 2VG7A 4IFYA 2RN2A 5J1EA 1EETA 2BANA 2QWOA 4JI8K 1KC8O 2NRHA 1X1PA 3AA3A 3KD1E 1C0FA 4OPJA 1LWEA 1KVAA 4ELUA 3ITHA 3QDKA 4O4GA 5KGXA 5AQWA 5BRHA 3S3OA 1BQNA 4DLGA 4K25A 1S1WA 1WSHA 1NJYA 2HNYA 2IVPA 1QQCA 4J2AA 1D9DA 4LF8K 4OKKA 3V9WA 2F96A 4BROA 4C1NI 3D7EO 3MDQA 1BI4B 1QSLA 2V52B 3NHGA 1JKHA 4JS4A 1BDGA 4JNEA 5J2PA 4FJKA 2BE2A 3MXIA 4CJ7A 3QERA 4KH6A 1RDWX 4DF4A 1J6ZA 1ASWA 4LFAK 4BRGA 1TKDA 2ZWHA 1XMOK 1KAYA 1YI2N 2Q0RA 2GEMA 4H0VB 2HBKA 5BRDA 3OYNA 4F3TA 1EXQA 3MN7A 1Q82O 3AO2A 2XY8A 1NM1A 4WE1A 5HRNA 4HHTA 5AQYA 4IOAL 4PKGA 1HNXK 2RPIA 2YHAA 3E66A 1ZBSA 3L3VA 1D8YA 2GWJA 4KKOA 3KTQA 2AA4A 4B9TA 5AR0A 1S6PA 4DTSA 1L3TA 4C8LA 4XH1A 4IO8A 3THVA 3LZIA 3WNGA 5FDLA 3WEEA 3J7YP 3L2UA 3ZT2A 3CJ9A 4Z4GA 4LF5K 1VRUA 4YOVA 4KREA 3ZETB 1CZ9A 3B6OA 4HUFA 3RSEB 4IKFA 3M1FA 1U2VA 5AQUA 4K41A 4C1NK 1TL3A 5FPMA 4YHHK 5GAEP 3FE1A 2YKMA 2KKZA 3DMJA 4CCHA 4GNIA 2OZMA 1HR0K 4KV8A 4DSKA 5KPRA 3ID6A 2E1ZA 1L3SA 3SQ1A 4B1VA 1QE1A 4A5BA 1CZAN 4JI1K 1QZ5A 4GKKK 1K8AO 3L2RA 3TSUA 4LSLA 4O55A 1BHLA 2F4VK 1REVA 3HSCA 1HLUA 1Q81O 3SUOA 1NK7A 2HHWA 3DXMB 3LALA 3KIOA 4Y0WA 3TU5A 1HJOA 3HPOA 2O8DA 4Z94A 1Q8IA 2QXFA 4DFKA 5BR9A 4QS9A 1YT3A 5AFUH 4DUYK 2LSNA 1Q7YO 3VERA 5AQKA 4WF9L 3OW2M 2P9LB 4CEBA 3O8MA 3MN6A 3QEVA 1NK4A 4BDZA 3O4NA 5I42A 2YHYA 3SZ2A 3AVFA 2W41A 3IG1A 3P4IA 4O5FA 4FJMA 4DR4K 4DQ8A 3K58A 4DMNA 3J80O 1T3VA 4DSEA 2OZSA 3VQQA 4FJ7A 4Q0BA 3UKRB 3SAGA 3OS0A 2KFZA 1UOCA 3MEGA 4B9NA 1ASVA 4XIUA 1WBBA 5EXWA 5AQFA 4CHZA 4CK3A 3HT3A 1J5OA 3J7AP 4CFCA 4CIEA 4PL7A 1IBKK 4B8CA 1YVUA 4AM6A 4EP4A 1OKJA 3RVCA 3DAWA 4FWLA 2QK9A 4YOTA 1NLVA 2DFHA 1GLFO 1KVBA 4JD2A 4B9VA 4ELVA 1BI4A 3BZCA 2E20A 3OYCA 5JVHL 4O0JA 2E1YA 4GV6A 3VQ8A 4JI5K 2P51A 3C6TA 1P90A 1NK8A 3MEEA 5FRNA 5BN8A 3S41A 5E84A 4FM0A 3A5LC 4JLHA 3OYLA 2E8AA 3DLEA 2ATQA 5AQNA 3F9MA 3ENBA 3AVKA 3MN5A 1HUXA 3DLHA 5H1SQ 2OPRA 4BDPA 1Y64A 2HF3A 5HOOA 5I3UA 4NXMK 4BDYA 1QS4A 2VGNA 1GLBG 4BRKA 3OYBA 2ZM6K 4DV4K 1MA9B 3U6FA 2YJFA 3TAMA 2HBMA 2NNWA 1N33K 1VSHA 2PFUA 3ZSVA 3HJFA 2GUIA 1TKZA 4BR7A 5AZIA 5AQHA 1HX1A 3I56N 3BEXA 2HHTA 1XI1A 4DR7K 2HNDA 1NWKA 2D5RA 1MDUB 3LP3A 2P1JA 4BC5A 3KHYA 5CZ2A 2VGMA 4B08A 2FBYA 2P9PB 3M8PA 2F8SA 3M8QA 3VEWA 4K8ZA 1VSMA 3VEZA 1B9DA 5A2QO 4BRFA 2G8KA 1XC9A 3OHRA 1VQ4N 4DG1A 3CMEN 4CZHA 1RTHA 2HHUA 1E4GT 2NRXA 1JXBA 3VF4A 3LPTA 1NGAA 5E41A 1VSEA 3AVBA 4M3XA 2E2PA 4CEQA 3VENA 3AVGA 3AVLA 2RE2A 3BY5A 4J2EA 5CE3A 4KFBA 4IG3A 4FJJA 2DY4A 1XQSC 4RW8A 3S9HA 1QVFM 3H1QA 4BRDA 4ID5A 1VQLN 3G0ZA 1TKXA 5C2FA 4NB4A 2QWMA 4DCHA 2B6AA 3CG7A 2D0BA 3QEIA 3GDQA 3ULDA 1VSJA 3RMDA 2Q0UA 3ZSWA 2RKIA 4QAGA 3NH1A 4I6MB 1ASUA 3ZYYX 4A2BA 3DXMA 5C15A 5GIOA 2W40A 1SL1A 4DQPA 4CZGA 1W97L 3D6RA 3MN9A 4JN4A 3RR7A 3W3DA 3FFIA 2FBTA 3ZX3A 1M1KO 1LWCA 4CJEA 4BWJA 4NYFA 3VQ9A 1F21A 1CZBA 1U47A 2P9LA 5DM7L 2E88A 4CD3A 1OH5A 1I94K 1VSDA 3ZLJA 4BE1A 3IFRA 1UA0A 4KHYA 5JVGL 1S1VA 3FZMA 1A5WA 2FBVA 2QTDA 3ZX0A 3CIPA 3NF6A 3EE9A 3EYZA 2QWPA 3WXIA 3L4IA 5AZJB 3E9OA 3LM2A 3OYJA 3AO5A 3MEDA 3UKRA 5BPNA 3DOKA 5M1KA 4JHDB 2NRWA 1B9FA 5AQMA 3DM2A 1VSLA 3IDHA 3AAPA 3PY8A 4K0KK 1JCFA 3V9UA 2WUSA 2IVOA 4EHTA 4DV0K 4FCYA 3T1YK 2UXCK 2QM1A 2Z1JA 5HRSA 3E1YA 2X6SA 4CJSA 2F8TA 4FXDA 1DGKN 3EEQA 2P9IB 3SYZA 3NDKA 3VQBA 1VK0A 3PO4A 3NF9A 3I0RA 4GVMA 5C10A 5KI6A 3MXJA 4M3UA 4M63C 2QWLA 3O3HA 3EKUA 4JI4K 4IEEA 3CCJN 4I9LA 1U4BA 3ZT0A 4FVMA 4BRPA 3G71N 1BGXT 4UY8O 4KHWA 4LD0A 1KAXA 1NU0A 2HSTA 3VOVA 2ZJRL 4CBWA 1B92A 2YNIA 4I7FA 3GOIA 1NK5A 3DLGA 2OA8A 4FLYA 4BRQA 1I39A 2A40A 3LL3A 2BDPA 3T1AA 1T6CA 5JICA 4PUOA 2IDOA 4CF1A 5JMVA 3AA5X 3LPUA 4BR2A 3TTCA 4WQ4C 3ZX2A 3K5LA 2HBJA 1QQOA 3QB0A 1YTUA 1QHTA 2XY7A 3PIOL 4RW4A 4F3OA 3LP2A 5CR4A 4FK2A 1SKWA 1BA1A 4B3MK 4FLVA 4IWVA 1A5VA 3HM8A 3SV3A 2P9PA 2X6NA 4CZLA 5LMUK 1RNHA 4JKGB 2GV9A 3EZWA 3CPEA 3WNFA 5M1PA 3ZT1A 3NCIA 1Q9YA 2XRIA 3AV9A 4B9MA 2KTQA 3TABA 2YI1A 3WEEB 5GAHP 1SQKA 3ZSQA 3DI6A 4H5WA 1DLOA 1WAFA 4ISFA 5LL6Z 4K42A 5BN9A 4DQQA 4FPAA 3RMCA 3AVJA 3R9PA 3KJVA 3P83D 4CJ5A 4Z4IA 1EP4A 4BGBA 4AHTA 1KTQA 1BCMA 4BWMA 4AM7A 3H3NO 3HM9A 1GLCG 3FGUA 4DTRA 4AHRA 2NRVA 4DKWA 4XEIA 4DUZK 2FF6A 3TAFA 2IGIA 1OH8A 4BRMA 3LP0A 3DJCA 1ILYA 1QZ6A 2Q97A 3ZSZA 2D0OA 1TUUA 4I6MA 4YDUC 3NVMA 2UUAK 5E26A 3J81O 2RF2A 3AO4A 4KBOA 1ITGA 1WLJA 2VG5A 2VCPA 5CYQA 3CCQN 3PO5A 4Z4CA 4N76A 3HXMA 4JKEA 2O8DB 4OKEA 2YHWA 3CF5L 4Q5VA 5CZ1A 1JL2A 1JXEA 1RDCA 3VQPA 1V4TA 4JAXA 3DLBA 5HBMA 3CPWM 3AVNA 4YORA 3SQ2A 1VQPN 1LCUA 4M3WA 4DFMA 3A5NC 4HUEA 5HRRA 3PLAA 3L2QA 5TKWA 1D9FA 1DTTA 3SBTA 3VQEA 4GY2B 2FXUA 1HNVA 3AGKA 2QW9A 3EZ5A 4I2QA 4W5OA 4H4OA 3MX5A 3O9SA 3JSMA 3EY1A 2YNFA 4OGCA 4WYBA 5FPEA 1Z05A 1IBLK 1MU2A 4GMJB 2ITGA 4WFBL 3HP9A 3QFUA 3BUZB 1BQMA 4BC3A 3QBWA 2A3ZA 3THXB 5TKYA 1VQON 4HCBA 2P9IA 3NFAA 1IO2A 2ZGZA 4CZKA 2PZSA 1W0HA 3THWB 3D0PA 1QQNA 4GV3A 2PYJA 2IVNA 3RTVA 4FWPA 1WAJA 4AHCA 4DSFA 1NMNA 3VF2A 4JD2B 4B8AB 3KD5E 2XY6A 3H08A 4HVJA 5J2NA 4KI4A 1DEJA 2I5JA 4ZTFA 1KLNA 3PSIA 4B3SK 3G6EN 3S3MA 4ID1A 2NUBA 3C65A 4Z4HA 3KK7A 3F73A 3U4LA 4DR1K 4DV2K 4IEIA 5KQ8A 2HHXA 4LF7K 1C0TA 2A42A 3VN5A 3K9JA 5HROA 4GW6A 4BRCA 3VF6A 2F9WA 4H5NA 1ATRA 3ZSOA 3VQDA 2QKBA 2HNZA 4N5SA 2WC9A 1IKVA 3UKUB 3VA0A 3P5JA 1JLEA 4BG9A 4PL8A 1SL0A 2ITMA 4LF9K 1KAZA 3NGZA 2YKNA 5AZIB 4FJLA 2DFFA 5EX5A 2E5LK 3K2PA 4CGGA 3CCLN 3O3GA 1VQKN 4CF2A 4DSIA 3OS1A 4CI6A 1BISA 1VSIA 3DLRA 1D5AA 3Q7BA 1WNSA 4DTPA 1QSSA 1A5XA 3TPQA 4JKGA 3KVGA 3R3LA 5F2RA 1NK9A 3QIOA 4E1JA 4R5PA 3LWMA 4FLWA 2NRRA 3SNNA 4CIFA 2VYPA 1O13A 4C8KA 1OH6A 3UE5A 4FL9A 5HLFA 3AVAA 3ZCMA 4QCLA 1ESVA 1NMDA 3QIPA 4CGJA 5FPDA 5KPTA 4PQUA 3V1QA 3LDSA 1NGHA 4AQYK 3O3FA 3HVRA 2HHSA 2Q31A 3OYEA 5DM6L 4EZ6A 1HRHA 1HKGA 2OPQA 2ZE2A 4KO0A 4MDBA 4X64K 3V81A 4BC4A 3I0SA 5M1FA 2Y1IA 1ZBHA 5JLHA 3AVMA 3VQ6A 3QEPA 4AH9A 1S5JA 3KLIA 4BR5A 3O9QA 3EN9A 3IKMA 2QEXN 1OVYA 2BTFA 3VEYA 4O8KA 3CCMN 4H0OA 1VQ8N 1JLGA 4CZIA 2AJQA 3L4QA 4DTUA 3CC2N 1VHXA 1T03A 4CEDA 1RBRA 4I9QA 1BIZA 4CJRA 1J54A 4FK4A 4MQ3A 5AQQA 1JCEA 5EVZA 2PAVA 4CK1A 3Q7CA 3WXMB 1RFQA 3TI0A 1W2BM 2JLEA 4IFEA 3OYFA 3MCAB 4JYAK 4DTMA 4CHPA 3CFRA 1K8KA 2YHBA 4H5TA 4ILJA 3WUHA 4XH5A 1X9SA 4F9OA 4ICLA 5FLXO 4CHYA 3THYA 3K0SA 3CCVN 4PKHA 3L2WA 1XMQK 1KQSM 4KPYA 2WBNA 3KK1A 3C6AA 4CEAA 3I8BA 3IMXA 4CIGA 4DWIA 3THXA 1HYSA 2PY5A 4W5TA 3C0BA 2D4WA 3NGIA 3VTIA 1RDAA 3AO3A 2HW3A 3THWA 4N41A 3O5BA 3C7NB 3OYHA 2YNHA 3VGKA 4J2BA 1FKOA 2UXBK 3BDPA 3VMFB 5HL7L 1XNQK 1IKWA 3HP6A 2O8EB 3D2FB 2Q3SA 2G8FA 3TR8A 4W5RA 2G8HA 2X74A 4JI3K 4LH4A 4FWOA 1NJIO 1C1CA 2O8FB 3LWLA 3OYMA 1NGJA 4V19S 4MO5A 1TKTA 3HI0A 1HQEA 5CHIA 3OBYA 3CCUN 4CJFA 4DR2K 2BUPA 4B9UA 5HRPA 5BPMA 3AO1A 3PX0A 3C95A 3SK3A 4CGHA 2P5GA 3CQYA 3B8AX 4JK9A 4FVUA 2HHQA 3UKUA 3OBWA 4W5QA 2P9NB 3W0LA 4O0IA 5KRTA 5DMRA 1JLBA 3VGMA 2QKKA 3SPZA 4HWIA 3KKRA 3NBPA 2IIRA 4E7JA 4RG8A 4OGEA 4IJAA 3TAGA 3TTFA 2KQ2A 4NO7A 3OYKA 1S6QA 3HYFA 1T05A
chains in the Genus database with same CATH topology
3MXMA 4Y1DA 3CM6A 4I9LA 1VRTA 4E1NA 2VG6A 2VWKA 3ZT0A 2IS3A 3NF7A 4FVMA 4DS4A 3QESA 2FC0A 1TL1A 1BGXT 3JYTA 1WSJA 4CHNA 4KHWA 4LD0A 3CM5A 3MAQA 1EKEA 1UA1A 1Q9XA 4CJWA 2Z1HA 5K14A 4C8MA 3NH0A 4IFVA 4CJ4A 1B92A 3KK2A 2YNIA 4I7FA 3DOLA 1BIUA 3DLGA 2VG7A 4IFYA 3ZSRA 4CJ3A 4FLYA 1NK5A 1RTIA 2RN2A 1EETA 1I39A 2BANA 3HSTB 5J1EA 4KRFA 2BDPA 1X1PA 3AA3A 3KD1E 3HK2A 3A2FA 3T1AA 4PUOA 4CJQA 2IDOA 4CF1A 5T7BA 1GOAA 4DTXA 3HO1A 4L8RB 3AA5X 3LPUA 4OPJA 1LWEA 1KVAA 1UAXA 3ITHA 4O4GA 5KGXA 4ELUA 2O4GA 4RW7A 1N5YA 3S3OA 3K5LA 4CEOA 1BQNA 4DLGA 1S1WA 1YTUA 1QHTA 3QEWA 3RWUA 1WSHA 2XY7A 5J2QA 1NJYA 2KFNA 2HNYA 4RW4A 3M8RA 4F3OA 3LP2A 1QQCA 4J2AA 1D9DA 4FK2A 3K5NA 4IBNA 1JLFA 4OKKA 5KGWA 3V9WA 1SKWA 2F96A 3V1RA 4CJUA 4FLVA 3CYMA 4JRPA 1CXQA 1EX4A 4B9SA 1A5VA 3SV3A 1BI4B 1QSLA 4DSLA 2EHGA 2Z1IA 3HPGA 4F2SA 2X6NA 1RNHA 3NHGA 1JKHA 4ELTA 4FYDA 2GV9A 4JS4A 2G8WA 2XO7A 3QNOA 4FJKA 3WNFA 5J2PA 3SPYA 5JS1A 2BE2A 3ZT1A 1XHZA 3MXIA 4PA1A 3NCIA 1Q9YA 1Z25A 1WSGA 4DU1A 2XRIA 3AV9A 3QERA 4B9MA 2KTQA 3TABA 3TWHA 4DF4A 3RRHA 4DTNA 3ZSQA 1NOZA 1U49A 3DI6A 3IRXA 1ASWA 1DLOA 1WAFA 3ZSXA 4MFBA 1TKDA 2G8VA 4DQQA 1RBTA 3RMCA 1TAUA 3AVJA 1U48A 3KJVA 3P83D 4CJ5A 3OYNA 4Z4IA 1EP4A 4F3TA 1VSKA 1NOYA 3RRGA 1EXQA 4TSXA 4AHTA 1KTQA 1W9HA 1BCMA 4BWMA 3IAYA 3AO2A 3HM9A 2XY8A 4WE1A 5HRNA 4HHTA 4CERA 2DTUA 5C24A 4EP5A 4AHRA 4LH5A 4DTRA 3SUPA 2RPIA 2YHAA 3OJUA 1TVRA 3L3VA 5KRSA 1D8YA 2B5JA 4DSJA 4KKOA 1WSEA 2IGIA 3TAFA 3KTQA 4AILC 3WNHA 4B9TA 3LP0A 4NCBA 3ZSZA 4BACA 1XHXA 1NJWA 4FJGA 1S6PA 2HMIA 4DTSA 1L3TA 4C8LA 1TAQA 4FJIA 3DRPA 2KZZA 1J53A 2RF2A 3LAMA 3DRRA 3AO4A 3HPHA 1ITGA 3THVA 4J2DA 1WLJA 2WOMA 2VG5A 3LZIA 4DU3A 3DYAA 3WNGA 4KTWA 5FDLA 5CYQA 2YNGA 3KK3A 3L2UA 3PO5A 3ZT2A 3U3YA 5FROA 4Z4CA 4N76A 3NF8A 3HXMA 4C8OA 3VQ7A 3OYAA 3LANA 4Z4GA 4OKEA 4M3RA 1NKEA 4I2PA 1VRUA 4KREA 4OLBA 4FJHA 1CZ9A 3CFOA 3B6OA 4Q5VA 1SV5A 5CZ1A 4FW2A 5C25A 1JL2A 1JXEA 1J9AA 3SV4A 4HUFA 1RDCA 3VQPA 3DLBA 1ZBIA 5HBMA 4IKFA 3AVNA 3LAKA 3SQ2A 3P1GA 4AHVA 4KB0A 1TL3A 2FBXA 4CEFA 1TK5A 3AVCA 2YKMA 4M3WA 4DFMA 1KFDA 1R0AA 1IG9A 3DMJA 3ZT3A 4HUEA 1T7PA 4CCHA 2OZMA 5HRRA 3TANA 5FRMA 4KV8A 4DSKA 3L2QA 1D9FA 1DTTA 4Z4FA 3AA2A 4M42A 3V9SA 3VQEA 1L3SA 1VSFA 3SQ1A 1HNVA 1L3UA 1QE1A 4QOZB 2B4JA 4Z4EA 3LZJA 4E7IA 4EZ9A 4FJ9A 1WSIA 3EZ5A 1LW0A 4I2QA 4H4OA 4W5OA 4M3YA 4B3OA 1HPZA 1S1UA 3L2RA 3JSMA 3EY1A 2YNFA 4OGCA 4OJRA 4LSLA 1MU2A 4GMJB 3IS9A 2ITGA 3K5OA 3HP9A 4O55A 1BHLA 1KCFA 1REVA 1BQMA 2XY5A 1RT2A 3BGRA 3VQ5A 3OVNA 2W42A 3SUOA 2OPPA 1NK7A 2HHWA 3VQCA 3LALA 3M8SA 3PX6A 4M41A 3KIOA 4HCBA 1XWLA 3NFAA 1K6YA 1IKXA 1IO2A 1SKSA 1RCHA 1RT4A 2E6MA 3HPOA 1KVCA 2PZSA 1Q8IA 1WN7A 2QXFA 1W0HA 4RW6A 4DFKA 4KHSA 5KTQA 1YT3A 3NAEA 2R7YA 1HNIA 4OPKA 3D0PA 1LAVA 4OLAA 2P5OA 2PYJA 3RTVA 2LSNA 1WAJA 3OY9A 1BCOA 4AHCA 4DSFA 4IG0A 4CJVA 4CEBA 1FXXA 4B8AB 1TK8A 3KD5E 3QEVA 2XY6A 3H08A 1NK4A 2WONA 4AHSA 1ZBUA 3O4NA 4G1QA 4HVJA 4BDZA 4DTJA 3SZ2A 5J2NA 5I42A 1HQUA 3AVFA 4KI4A 1WSFA 2I5JA 4CHQA 4FLXA 4ZTFA 4ZTJA 4JS5A 3IG1A 1KLNA 4DLEA 3L2VA 3HVTA 4FJMA 4OVLA 3S3MA 4FJNA 1HMVA 1HJRA 4ID1A 2NUBA 4O5BA 4DMNA 3K58A 4O44A 4M45A 4Z4HA 4DFPA 1KSPA 1S9GA 4FZYA 4DSEA 2OZSA 4CJLA 3F73A 3VQQA 2EX3A 4FJ7A 5EU7A 4Q0BA 4H4MA 1KLMA 3DLKA 3C94A 4BE2A 4DFJA 4E0DA 2HHXA 3AVIA 1C0TA 3OS0A 2KFZA 2YV0X 1GOBA 3PUFA 1UOCA 3VN5A 3MEGA 5HROA 4B9NA 1ASVA 4GW6A 4XIUA 3AA4A 3E01A 4LSNA 4CHZA 1Z26A 3L8BA 4CK3A 4PWDA 4KB1A 3ZSOA 4CHOA 1JLQA 3SUQA 3VQDA 4E1MA 3OYGA 2DFEA 3HT3A 1J5OA 4CFCA 2QKBA 2HNZA 3B6PA 3QLHA 4CIEA 4IDKA 4CF8A 4N5SA 1L3VA 1O1WA 1DTQA 2D0AA 1IKVA 1RBSA 4B8CA 3VA0A 1YVUA 1NK6A 3CQ8A 3P5JA 4EP4A 1JLEA 2X78A 2O4IA 1SL0A 4KI6A 4N56A 1L5UA 3NGZA 4CGFA 2VWJA 2QK9A 2YKNA 2DFHA 1HYVA 2A1SA 2ETJA 4FJLA 1KVBA 2DFFA 4DQRA 3K2PA 4CGGA 3QNNA 3O3GA 3TARA 4B9VA 2HVIA 4ELVA 4CF2A 1BI4A 4DSIA 3OS1A 3OYCA 1BISA 1VSIA 4O0JA 4E7HA 3DLRA 1D5AA 4FLUA 3OYDA 3VQ8A 1WNSA 4DTPA 1QSSA 1A5XA 4UQGA 4CFAA 5SWMA 4FK0A 2P51A 1C1AA 3C6TA 4CESA 1NK8A 3MEEA 3CFPA 1ZBLA 5FRNA 4ZHRA 1NK9A 1RT6A 3QIOA 4DF8A 4FM0A 1SKRA 4JLHA 3OYLA 4R5PA 3LWMA 3DLEA 4CJKA 1S1XA 4FLWA 1C6VA 2ATQA 1RT5A 3SNNA 1RTDA 2IOCA 1HYZA 4CIFA 3F9KA 3AVKA 4C8KA 2KW4A 3DRSA 3DLHA 1U04A 2OPRA 1LWFA 3VA3A 5HLFA 5C42A 4BDPA 3SQ0A 3AVAA 1SL2A 5I3UA 3ZCMA 3HL8A 5CY4A 4E19A 4BDYA 1QS4A 3RMAA 3SJJA 3UIQA 4Y1CA 4QCLA 3OYBA 5CYMA 2Z1GA 3SQ4A 2IC3A 3QIPA 3KKSA 4CGJA 2E6LA 3L3UA 3U6FA 3TAMA 2XHBA 3D45A 2OYQA 4PQUA 1VSHA 3MECA 3V1QA 3ZSVA 3OJSA 2GUIA 3LDSA 3HJFA 4W5NA 4H8KA 4HTUA 5HP1A 2OPSA 3O3FA 3HVRA 1QSYA 4FJXA 4CFBA 2HHSA 4EZ6A 3OYEA 1TKZA 4DQSA 3RMBA 1HRHA 2OPQA 2ZE2A 4KO0A 3ZSYA 1T8EA 4B9LA 4E7KA 2HHTA 3LP1A 1XI1A 3SI6A 2HNDA 3V81A 3I0SA 2Y1IA 1NJXA 1KRPA 4NCAA 1ZBHA 3AVMA 2D5RA 3VQ6A 1I3AA 4AH9A 4FLTA 3QEPA 1S5JA 1CLQA 3ALYA 3SUNA 3KLIA 1X9WA 3LP3A 2P1JA 4KHQA 4KTQA 5CZ2A 4AHUA 4B08A 2FBYA 3M8PA 2PYLA 3M8QA 2F8SA 4K8ZA 1VSMA 4CF9A 1B9DA 3NGYA 4F2RA 3KLHA 1CXUA 1JLGA 3C6UA 2G8KA 3V6DA 1XC9A 4DG1A 1G15A 5JS2A 1ZYQA 2AJQA 3NE6A 4DTUA 4HCCA 4CF0A 1T03A 1RTHA 2Y1JA 5SZTA 1X9MA 2BGGA 4CEDA 4FJ8A 2HHUA 3K59A 1RBRA 4I9QA 3QINA 4C8NA 1BIZA 1JXBA 4CJRA 1J54A 3LPTA 3QEXA 4MQ3A 4FK4A 5E41A 1NK0A 1RTJA 1VSEA 3V4IA 3AVBA 4E3SA 4E89A 4M3XA 4CEQA 2HB5A 4CK1A 4DQIA 3AVGA 3V9ZA 3AVLA 3O4QA 3TI0A 4J2EA 3PV8A 4KFBA 2ZD1A 2JLEA 3OYFA 1JLAA 4IG3A 4FJJA 2DY4A 1RBUA 1NKBA 1QTMA 1YTAA 4RW8A 4DTMA 4CHPA 3S9HA 3CFRA 4CEZA 2YHBA 3S3NA 1X9SA 4K8XA 1FKPA 4ID5A 3G0ZA 4ICLA 4CHYA 1TKXA 3K57A 1C0MA 4FW1A 4NYNA 1U45A 3ZT4A 2B6AA 1LAWA 1JL1A 3CG7A 3I8DA 2D0BA 3KLGA 3K5MA 3L2WA 4KPYA 4E7LA 3NH2A 3QEIA 3PX4A 4KHUA 1IH7A 3ULDA 1C0UA 1VSJA 3RMDA 3ZSWA 3KK1A 2RKIA 4QAGA 4CEAA 4CIGA 3NH1A 4DWIA 1ASUA 2HHVA 4KTZA 1JLCA 4CGIA 3T3FA 1HYSA 2PY5A 4W5TA 1N6QA 3VQAA 1SL1A 4DQPA 3NGIA 1GOCA 1RDAA 4DU4A 2D0CA 1UWBA 3AO3A 2IAJA 4CECA 1LV5A 3RR7A 3FFIA 2HW3A 2FBTA 1IKYA 4N41A 1LWCA 1RBVA 4CJEA 5DK5A 3OYHA 2YNHA 1RT1A 1S9EA 1FKOA 5J2MA 4J2BA 4N47A 4BWJA 3BDPA 4NYFA 3ISNC 1F21A 3U3GA 3VQ9A 1CZBA 4CK2A 1NKCA 1U47A 4YFUA 4FM1A 1IKWA 3HP6A 2A1RA 2JGUA 2Q3SA 3V9XA 4LY7A 3G10A 1VSDA 4BE1A 4PY5A 1BL3A 1UA0A 4KHYA 2G8FA 3TR8A 4W5RA 1S1VA 1KFSA 2G8HA 2X74A 1RT3A 1A5WA 4LH4A 5D3GA 1TGOA 2FBVA 4Z0UA 1U4BA 4CJPA 3NF6A 1C1CA 3EYZA 2OA8A 1C1BA 4RW9A 3LWLA 3T19A 4YNQA 3OYMA 1TKTA 3WNEA 1HQEA 1NJZA 4FM2A 3OYJA 1RT7A 1S1TA 3AO5A 3MEDA 4CEEA 4M3TA 4CJFA 1RDDA 3VQ4A 3DOKA 4FLZA 3OS2A 3TAQA 4B9UA 4CFDA 5HRPA 1B9FA 4HUGA 3DM2A 3AO1A 3PX0A 1VSLA 3TAEA 3KLEA 1SUQA 2ZQBA 4F4KA 3C95A 4CGDA 3PY8A 4CGHA 4BE0A 1LW2A 4OKJA 1TK0A 4NCGA 3V9UA 3AVHA 3RR8A 4FZZA 1TV6A 2P5GA 4KAZA 2G8IA 4FCYA 2KZMA 3QETA 2Z1JA 5HRSA 4CE9A 3OYIA 2X6SA 4CJSA 1FK9A 4F8RA 2HHQA 3TAPA 4W5QA 2F8TA 4M3ZA 4FXDA 4O0IA 3SCXA 5KRTA 3V1OA 3SYZA 3NDKA 4FZXC 3QO9A 5DMRA 1JLBA 4FJ5A 2QKKA 1ZBFA 2GBZA 1VK0A 3ASMA 1Y97A 3KKRA 3VQBA 3SPZA 3NBPA 1RILA 2HVHA 4E7JA 4RG8A 3PO4A 4OGEA 4JRQA 3NF9A 2E4LA 3I0RA 4GVMA 3TAGA 5KI6A 3KLFA 4KHNA 2KQ2A 3MXJA 4CJTA 3OYKA 2G8UA 4DTOA 4M3UA 1S6QA 3O3HA 1RDBA 4DS5A 3HYFA 1T05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXM A;  4Y1D A;  3CM6 A;  4I9L A;  1VRT A;  4E1N A;  2VG6 A;  2VWK A;  3ZT0 A;  2IS3 A;  3NF7 A;  4FVM A;  4DS4 A;  3QES A;  2FC0 A;  1TL1 A;  1BGX T;  3JYT A;  1WSJ A;  4CHN A;  4KHW A;  4LD0 A;  3CM5 A;  3MAQ A;  1EKE A;  1UA1 A;  1Q9X A;  4CJW A;  2Z1H A;  5K14 A;  4C8M A;  3NH0 A;  4IFV A;  4CJ4 A;  1B92 A;  3KK2 A;  2YNI A;  4I7F A;  3DOL A;  1BIU A;  3DLG A;  2VG7 A;  4IFY A;  3ZSR A;  4CJ3 A;  4FLY A;  1NK5 A;  1RTI A;  2RN2 A;  1EET A;  1I39 A;  2BAN A;  3HST B;  5J1E A;  4KRF A;  2BDP A;  1X1P A;  3AA3 A;  3KD1 E;  3HK2 A;  3A2F A;  3T1A A;  4PUO A;  4CJQ A;  2IDO A;  4CF1 A;  5T7B A;  1GOA A;  4DTX A;  3HO1 A;  4L8R B;  3AA5 X;  3LPU A;  4OPJ A;  1LWE A;  1KVA A;  1UAX A;  3ITH A;  4O4G A;  5KGX A;  4ELU A;  2O4G A;  4RW7 A;  1N5Y A;  3S3O A;  3K5L A;  4CEO A;  1BQN A;  4DLG A;  1S1W A;  1YTU A;  1QHT A;  3QEW A;  3RWU A;  1WSH A;  2XY7 A;  5J2Q A;  1NJY A;  2KFN A;  2HNY A;  4RW4 A;  3M8R A;  4F3O A;  3LP2 A;  1QQC A;  4J2A A;  1D9D A;  4FK2 A;  3K5N A;  4IBN A;  1JLF A;  4OKK A;  5KGW A;  3V9W A;  1SKW A;  2F96 A;  3V1R A;  4CJU A;  4FLV A;  3CYM A;  4JRP A;  1CXQ A;  1EX4 A;  4B9S A;  1A5V A;  3SV3 A;  1BI4 B;  1QSL A;  4DSL A;  2EHG A;  2Z1I A;  3HPG A;  4F2S A;  2X6N A;  1RNH A;  3NHG A;  1JKH A;  4ELT A;  4FYD A;  2GV9 A;  4JS4 A;  2G8W A;  2XO7 A;  3QNO A;  4FJK A;  3WNF A;  5J2P A;  3SPY A;  5JS1 A;  2BE2 A;  3ZT1 A;  1XHZ A;  3MXI A;  4PA1 A;  3NCI A;  1Q9Y A;  1Z25 A;  1WSG A;  4DU1 A;  2XRI A;  3AV9 A;  3QER A;  4B9M A;  2KTQ A;  3TAB A;  3TWH A;  4DF4 A;  3RRH A;  4DTN A;  3ZSQ A;  1NOZ A;  1U49 A;  3DI6 A;  3IRX A;  1ASW A;  1DLO A;  1WAF A;  3ZSX A;  4MFB A;  1TKD A;  2G8V A;  4DQQ A;  1RBT A;  3RMC A;  1TAU A;  3AVJ A;  1U48 A;  3KJV A;  3P83 D;  4CJ5 A;  3OYN A;  4Z4I A;  1EP4 A;  4F3T A;  1VSK A;  1NOY A;  3RRG A;  1EXQ A;  4TSX A;  4AHT A;  1KTQ A;  1W9H A;  1BCM A;  4BWM A;  3IAY A;  3AO2 A;  3HM9 A;  2XY8 A;  4WE1 A;  5HRN A;  4HHT A;  4CER A;  2DTU A;  5C24 A;  4EP5 A;  4AHR A;  4LH5 A;  4DTR A;  3SUP A;  2RPI A;  2YHA A;  3OJU A;  1TVR A;  3L3V A;  5KRS A;  1D8Y A;  2B5J A;  4DSJ A;  4KKO A;  1WSE A;  2IGI A;  3TAF A;  3KTQ A;  4AIL C;  3WNH A;  4B9T A;  3LP0 A;  4NCB A;  3ZSZ A;  4BAC A;  1XHX A;  1NJW A;  4FJG A;  1S6P A;  2HMI A;  4DTS A;  1L3T A;  4C8L A;  1TAQ A;  4FJI A;  3DRP A;  2KZZ A;  1J53 A;  2RF2 A;  3LAM A;  3DRR A;  3AO4 A;  3HPH A;  1ITG A;  3THV A;  4J2D A;  1WLJ A;  2WOM A;  2VG5 A;  3LZI A;  4DU3 A;  3DYA A;  3WNG A;  4KTW A;  5FDL A;  5CYQ A;  2YNG A;  3KK3 A;  3L2U A;  3PO5 A;  3ZT2 A;  3U3Y A;  5FRO A;  4Z4C A;  4N76 A;  3NF8 A;  3HXM A;  4C8O A;  3VQ7 A;  3OYA A;  3LAN A;  4Z4G A;  4OKE A;  4M3R A;  1NKE A;  4I2P A;  1VRU A;  4KRE A;  4OLB A;  4FJH A;  1CZ9 A;  3CFO A;  3B6O A;  4Q5V A;  1SV5 A;  5CZ1 A;  4FW2 A;  5C25 A;  1JL2 A;  1JXE A;  1J9A A;  3SV4 A;  4HUF A;  1RDC A;  3VQP A;  3DLB A;  1ZBI A;  5HBM A;  4IKF A;  3AVN A;  3LAK A;  3SQ2 A;  3P1G A;  4AHV A;  4KB0 A;  1TL3 A;  2FBX A;  4CEF A;  1TK5 A;  3AVC A;  2YKM A;  4M3W A;  4DFM A;  1KFD A;  1R0A A;  1IG9 A;  3DMJ A;  3ZT3 A;  4HUE A;  1T7P A;  4CCH A;  2OZM A;  5HRR A;  3TAN A;  5FRM A;  4KV8 A;  4DSK A;  3L2Q A;  1D9F A;  1DTT A;  4Z4F A;  3AA2 A;  4M42 A;  3V9S A;  3VQE A;  1L3S A;  1VSF A;  3SQ1 A;  1HNV A;  1L3U A;  1QE1 A;  4QOZ B;  2B4J A;  4Z4E A;  3LZJ A;  4E7I A;  4EZ9 A;  4FJ9 A;  1WSI A;  3EZ5 A;  1LW0 A;  4I2Q A;  4H4O A;  4W5O A;  4M3Y A;  4B3O A;  1HPZ A;  1S1U A;  3L2R A;  3JSM A;  3EY1 A;  2YNF A;  4OGC A;  4OJR A;  4LSL A;  1MU2 A;  4GMJ B;  3IS9 A;  2ITG A;  3K5O A;  3HP9 A;  4O55 A;  1BHL A;  1KCF A;  1REV A;  1BQM A;  2XY5 A;  1RT2 A;  3BGR A;  3VQ5 A;  3OVN A;  2W42 A;  3SUO A;  2OPP A;  1NK7 A;  2HHW A;  3VQC A;  3LAL A;  3M8S A;  3PX6 A;  4M41 A;  3KIO A;  4HCB A;  1XWL A;  3NFA A;  1K6Y A;  1IKX A;  1IO2 A;  1SKS A;  1RCH A;  1RT4 A;  2E6M A;  3HPO A;  1KVC A;  2PZS A;  1Q8I A;  1WN7 A;  2QXF A;  1W0H A;  4RW6 A;  4DFK A;  4KHS A;  5KTQ A;  1YT3 A;  3NAE A;  2R7Y A;  1HNI A;  4OPK A;  3D0P A;  1LAV A;  4OLA A;  2P5O A;  2PYJ A;  3RTV A;  2LSN A;  1WAJ A;  3OY9 A;  1BCO A;  4AHC A;  4DSF A;  4IG0 A;  4CJV A;  4CEB A;  1FXX A;  4B8A B;  1TK8 A;  3KD5 E;  3QEV A;  2XY6 A;  3H08 A;  1NK4 A;  2WON A;  4AHS A;  1ZBU A;  3O4N A;  4G1Q A;  4HVJ A;  4BDZ A;  4DTJ A;  3SZ2 A;  5J2N A;  5I42 A;  1HQU A;  3AVF A;  4KI4 A;  1WSF A;  2I5J A;  4CHQ A;  4FLX A;  4ZTF A;  4ZTJ A;  4JS5 A;  3IG1 A;  1KLN A;  4DLE A;  3L2V A;  3HVT A;  4FJM A;  4OVL A;  3S3M A;  4FJN A;  1HMV A;  1HJR A;  4ID1 A;  2NUB A;  4O5B A;  4DMN A;  3K58 A;  4O44 A;  4M45 A;  4Z4H A;  4DFP A;  1KSP A;  1S9G A;  4FZY A;  4DSE A;  2OZS A;  4CJL A;  3F73 A;  3VQQ A;  2EX3 A;  4FJ7 A;  5EU7 A;  4Q0B A;  4H4M A;  1KLM A;  3DLK A;  3C94 A;  4BE2 A;  4DFJ A;  4E0D A;  2HHX A;  3AVI A;  1C0T A;  3OS0 A;  2KFZ A;  2YV0 X;  1GOB A;  3PUF A;  1UOC A;  3VN5 A;  3MEG A;  5HRO A;  4B9N A;  1ASV A;  4GW6 A;  4XIU A;  3AA4 A;  3E01 A;  4LSN A;  4CHZ A;  1Z26 A;  3L8B A;  4CK3 A;  4PWD A;  4KB1 A;  3ZSO A;  4CHO A;  1JLQ A;  3SUQ A;  3VQD A;  4E1M A;  3OYG A;  2DFE A;  3HT3 A;  1J5O A;  4CFC A;  2QKB A;  2HNZ A;  3B6P A;  3QLH A;  4CIE A;  4IDK A;  4CF8 A;  4N5S A;  1L3V A;  1O1W A;  1DTQ A;  2D0A A;  1IKV A;  1RBS A;  4B8C A;  3VA0 A;  1YVU A;  1NK6 A;  3CQ8 A;  3P5J A;  4EP4 A;  1JLE A;  2X78 A;  2O4I A;  1SL0 A;  4KI6 A;  4N56 A;  1L5U A;  3NGZ A;  4CGF A;  2VWJ A;  2QK9 A;  2YKN A;  2DFH A;  1HYV A;  2A1S A;  2ETJ A;  4FJL A;  1KVB A;  2DFF A;  4DQR A;  3K2P A;  4CGG A;  3QNN A;  3O3G A;  3TAR A;  4B9V A;  2HVI A;  4ELV A;  4CF2 A;  1BI4 A;  4DSI A;  3OS1 A;  3OYC A;  1BIS A;  1VSI A;  4O0J A;  4E7H A;  3DLR A;  1D5A A;  4FLU A;  3OYD A;  3VQ8 A;  1WNS A;  4DTP A;  1QSS A;  1A5X A;  4UQG A;  4CFA A;  5SWM A;  4FK0 A;  2P51 A;  1C1A A;  3C6T A;  4CES A;  1NK8 A;  3MEE A;  3CFP A;  1ZBL A;  5FRN A;  4ZHR A;  1NK9 A;  1RT6 A;  3QIO A;  4DF8 A;  4FM0 A;  1SKR A;  4JLH A;  3OYL A;  4R5P A;  3LWM A;  3DLE A;  4CJK A;  1S1X A;  4FLW A;  1C6V A;  2ATQ A;  1RT5 A;  3SNN A;  1RTD A;  2IOC A;  1HYZ A;  4CIF A;  3F9K A;  3AVK A;  4C8K A;  2KW4 A;  3DRS A;  3DLH A;  1U04 A;  2OPR A;  1LWF A;  3VA3 A;  5HLF A;  5C42 A;  4BDP A;  3SQ0 A;  3AVA A;  1SL2 A;  5I3U A;  3ZCM A;  3HL8 A;  5CY4 A;  4E19 A;  4BDY A;  1QS4 A;  3RMA A;  3SJJ A;  3UIQ A;  4Y1C A;  4QCL A;  3OYB A;  5CYM A;  2Z1G A;  3SQ4 A;  2IC3 A;  3QIP A;  3KKS A;  4CGJ A;  2E6L A;  3L3U A;  3U6F A;  3TAM A;  2XHB A;  3D45 A;  2OYQ A;  4PQU A;  1VSH A;  3MEC A;  3V1Q A;  3ZSV A;  3OJS A;  2GUI A;  3LDS A;  3HJF A;  4W5N A;  4H8K A;  4HTU A;  5HP1 A;  2OPS A;  3O3F A;  3HVR A;  1QSY A;  4FJX A;  4CFB A;  2HHS A;  4EZ6 A;  3OYE A;  1TKZ A;  4DQS A;  3RMB A;  1HRH A;  2OPQ A;  2ZE2 A;  4KO0 A;  3ZSY A;  1T8E A;  4B9L A;  4E7K A;  2HHT A;  3LP1 A;  1XI1 A;  3SI6 A;  2HND A;  3V81 A;  3I0S A;  2Y1I A;  1NJX A;  1KRP A;  4NCA A;  1ZBH A;  3AVM A;  2D5R A;  3VQ6 A;  1I3A A;  4AH9 A;  4FLT A;  3QEP A;  1S5J A;  1CLQ A;  3ALY A;  3SUN A;  3KLI A;  1X9W A;  3LP3 A;  2P1J A;  4KHQ A;  4KTQ A;  5CZ2 A;  4AHU A;  4B08 A;  2FBY A;  3M8P A;  2PYL A;  3M8Q A;  2F8S A;  4K8Z A;  1VSM A;  4CF9 A;  1B9D A;  3NGY A;  4F2R A;  3KLH A;  1CXU A;  1JLG A;  3C6U A;  2G8K A;  3V6D A;  1XC9 A;  4DG1 A;  1G15 A;  5JS2 A;  1ZYQ A;  2AJQ A;  3NE6 A;  4DTU A;  4HCC A;  4CF0 A;  1T03 A;  1RTH A;  2Y1J A;  5SZT A;  1X9M A;  2BGG A;  4CED A;  4FJ8 A;  2HHU A;  3K59 A;  1RBR A;  4I9Q A;  3QIN A;  4C8N A;  1BIZ A;  1JXB A;  4CJR A;  1J54 A;  3LPT A;  3QEX A;  4MQ3 A;  4FK4 A;  5E41 A;  1NK0 A;  1RTJ A;  1VSE A;  3V4I A;  3AVB A;  4E3S A;  4E89 A;  4M3X A;  4CEQ A;  2HB5 A;  4CK1 A;  4DQI A;  3AVG A;  3V9Z A;  3AVL A;  3O4Q A;  3TI0 A;  4J2E A;  3PV8 A;  4KFB A;  2ZD1 A;  2JLE A;  3OYF A;  1JLA A;  4IG3 A;  4FJJ A;  2DY4 A;  1RBU A;  1NKB A;  1QTM A;  1YTA A;  4RW8 A;  4DTM A;  4CHP A;  3S9H A;  3CFR A;  4CEZ A;  2YHB A;  3S3N A;  1X9S A;  4K8X A;  1FKP A;  4ID5 A;  3G0Z A;  4ICL A;  4CHY A;  1TKX A;  3K57 A;  1C0M A;  4FW1 A;  4NYN A;  1U45 A;  3ZT4 A;  2B6A A;  1LAW A;  1JL1 A;  3CG7 A;  3I8D A;  2D0B A;  3KLG A;  3K5M A;  3L2W A;  4KPY A;  4E7L A;  3NH2 A;  3QEI A;  3PX4 A;  4KHU A;  1IH7 A;  3ULD A;  1C0U A;  1VSJ A;  3RMD A;  3ZSW A;  3KK1 A;  2RKI A;  4QAG A;  4CEA A;  4CIG A;  3NH1 A;  4DWI A;  1ASU A;  2HHV A;  4KTZ A;  1JLC A;  4CGI A;  3T3F A;  1HYS A;  2PY5 A;  4W5T A;  1N6Q A;  3VQA A;  1SL1 A;  4DQP A;  3NGI A;  1GOC A;  1RDA A;  4DU4 A;  2D0C A;  1UWB A;  3AO3 A;  2IAJ A;  4CEC A;  1LV5 A;  3RR7 A;  3FFI A;  2HW3 A;  2FBT A;  1IKY A;  4N41 A;  1LWC A;  1RBV A;  4CJE A;  5DK5 A;  3OYH A;  2YNH A;  1RT1 A;  1S9E A;  1FKO A;  5J2M A;  4J2B A;  4N47 A;  4BWJ A;  3BDP A;  4NYF A;  3ISN C;  1F21 A;  3U3G A;  3VQ9 A;  1CZB A;  4CK2 A;  1NKC A;  1U47 A;  4YFU A;  4FM1 A;  1IKW A;  3HP6 A;  2A1R A;  2JGU A;  2Q3S A;  3V9X A;  4LY7 A;  3G10 A;  1VSD A;  4BE1 A;  4PY5 A;  1BL3 A;  1UA0 A;  4KHY A;  2G8F A;  3TR8 A;  4W5R A;  1S1V A;  1KFS A;  2G8H A;  2X74 A;  1RT3 A;  1A5W A;  4LH4 A;  5D3G A;  1TGO A;  2FBV A;  4Z0U A;  1U4B A;  4CJP A;  3NF6 A;  1C1C A;  3EYZ A;  2OA8 A;  1C1B A;  4RW9 A;  3LWL A;  3T19 A;  4YNQ A;  3OYM A;  1TKT A;  3WNE A;  1HQE A;  1NJZ A;  4FM2 A;  3OYJ A;  1RT7 A;  1S1T A;  3AO5 A;  3MED A;  4CEE A;  4M3T A;  4CJF A;  1RDD A;  3VQ4 A;  3DOK A;  4FLZ A;  3OS2 A;  3TAQ A;  4B9U A;  4CFD A;  5HRP A;  1B9F A;  4HUG A;  3DM2 A;  3AO1 A;  3PX0 A;  1VSL A;  3TAE A;  3KLE A;  1SUQ A;  2ZQB A;  4F4K A;  3C95 A;  4CGD A;  3PY8 A;  4CGH A;  4BE0 A;  1LW2 A;  4OKJ A;  1TK0 A;  4NCG A;  3V9U A;  3AVH A;  3RR8 A;  4FZZ A;  1TV6 A;  2P5G A;  4KAZ A;  2G8I A;  4FCY A;  2KZM A;  3QET A;  2Z1J A;  5HRS A;  4CE9 A;  3OYI A;  2X6S A;  4CJS A;  1FK9 A;  4F8R A;  2HHQ A;  3TAP A;  4W5Q A;  2F8T A;  4M3Z A;  4FXD A;  4O0I A;  3SCX A;  5KRT A;  3V1O A;  3SYZ A;  3NDK A;  4FZX C;  3QO9 A;  5DMR A;  1JLB A;  4FJ5 A;  2QKK A;  1ZBF A;  2GBZ A;  1VK0 A;  3ASM A;  1Y97 A;  3KKR A;  3VQB A;  3SPZ A;  3NBP A;  1RIL A;  2HVH A;  4E7J A;  4RG8 A;  3PO4 A;  4OGE A;  4JRQ A;  3NF9 A;  2E4L A;  3I0R A;  4GVM A;  3TAG A;  5KI6 A;  3KLF A;  4KHN A;  2KQ2 A;  3MXJ A;  4CJT A;  3OYK A;  2G8U A;  4DTO A;  4M3U A;  1S6Q A;  3O3H A;  1RDB A;  4DS5 A;  3HYF A;  1T05 A; 
#chains in the Genus database with same CATH topology
 4FWM A;  3MXM A;  3HBT A;  4BR9 A;  2A6A A;  1V4S A;  1VRT A;  4E1N A;  2VWK A;  2IS3 A;  3NF7 A;  2J4R A;  4BVP A;  2FC0 A;  1TL1 A;  4JKH A;  1Q9X A;  3MAQ A;  1UA1 A;  4JV5 K;  3QML A;  3CC7 N;  4WQ5 A;  2P5O A;  3ZSR A;  3HK2 A;  3HST B;  3NMU A;  3A2F A;  1QQM A;  4CJQ A;  4DTX A;  1GOA A;  1VQ5 N;  3KZB A;  2JWL A;  5AQS A;  1UAX A;  4FWR A;  1KXP A;  2O4G A;  4B3R K;  3BP8 A;  3OTO K;  3FZF A;  4IO9 L;  1HNW K;  4CEO A;  4BQZ A;  1NBW A;  3JXU A;  3QEW A;  2HBL A;  5J2Q A;  4LC9 B;  4GKJ K;  3M8R A;  2RHK A;  4JKC A;  4IBN A;  3PIP L;  4CJU A;  4J8F A;  3CYM A;  4B9S A;  1CXQ A;  3O08 A;  1BA0 A;  2Z1I A;  3HPG A;  1EWQ A;  4YOU A;  1IBM K;  4FYD A;  3FLC O;  4DHY A;  2V51 B;  2G8W A;  2XO7 A;  3QNO A;  4KH5 A;  3SPY A;  1TYQ A;  3U9D A;  1XHZ A;  3O6W A;  4PA1 A;  4WCE L;  3MMV A;  4DU1 A;  4MLE A;  1N34 K;  2ZGY A;  4DTN A;  1NOZ A;  3AAR A;  3SAF A;  3ZSX A;  3CJ1 A;  3O9R A;  1TAU A;  3HOS A;  2P9U A;  4HTL A;  1W9H A;  1N36 K;  3IAY A;  4JI6 K;  3DXK A;  3EO3 A;  5AQJ A;  3R8E A;  1S72 N;  2HF4 A;  2P9S A;  3OJU A;  1TVR A;  5KRS A;  2B5J A;  2KHO A;  1WSE A;  1ATN A;  3AY9 A;  3WNH A;  1YF5 L;  4NCB A;  4BAC A;  1T6D A;  1XHX A;  3EE8 A;  5LMN K;  1NJW A;  4FWS A;  4FJG A;  4CW7 B;  1TAQ A;  1J53 A;  3AGR A;  3LAM A;  3DRR A;  5IWA K;  4DR3 K;  4J2D A;  2WOM A;  1J5E K;  3BF1 A;  4KTW A;  3CMA N;  3KK3 A;  3U3Y A;  5FRO A;  3MK6 A;  3C7N A;  3U9Z A;  4RWT A;  4C8O A;  4BC2 A;  3VQ7 A;  3OYA A;  1VQM N;  4M3R A;  4FJH A;  2O8E A;  3CFO A;  3D2F A;  5C25 A;  1J9A A;  4JK7 A;  2FSN A;  2DPN A;  5I9E B;  1ZBI A;  3LAK A;  3VTH A;  3P1G A;  4CEF A;  5KQD A;  1KFD A;  2O8F A;  1T7P A;  1W7A A;  4RTF D;  1VQ9 N;  4ILH A;  3T1H K;  4Z4F A;  3AA2 A;  4K43 A;  1VSF A;  1XUP O;  1HKB A;  1L3U A;  2A5X A;  4B1W B;  4QOZ B;  4Z4E A;  1YHQ N;  4EZ9 A;  1WSI A;  2CH6 A;  1G99 A;  4DR5 K;  1D4X A;  4OJR A;  4B1Z A;  3K5O A;  2E2O A;  2I7N A;  3VQC A;  3M8S A;  3PX6 A;  4PHT X;  2P9N A;  1XWL A;  2QWR A;  3SAH A;  4BR0 A;  1SKS A;  1RCH A;  2E6M A;  4RW6 A;  1WN7 A;  4KHS A;  5EY4 A;  3DWL A;  3NAE A;  2R7Y A;  2NRT A;  1X3M A;  4M7X A;  2O8C B;  3R6M A;  3OY9 A;  2OCE A;  4CJV A;  1FXX A;  3EKS A;  1RGI A;  1ZBU A;  4AHS A;  4G1Q A;  4FPB A;  4DTJ A;  2YHX A;  4CHQ A;  4FLX A;  4JS5 A;  1WBD A;  3L2V A;  3HVT A;  4OPH A;  4OVL A;  3J8A A;  5GAD P;  1HMV A;  1E4F T;  1HJR A;  4O5B A;  4B9Q A;  2ASO A;  4IZ9 A;  4M45 A;  4MDA A;  1KSP A;  4FZY A;  4CJL A;  2EX3 A;  5EU7 A;  3SMS A;  5JLF A;  4H4M A;  1KLM A;  4BE2 A;  3C94 A;  2EWS A;  4QS8 A;  4H5V A;  1SS6 A;  1NG9 A;  4MO4 A;  3LDQ A;  2ASM A;  4JK8 A;  1Z26 A;  3L8B A;  4PWD A;  3MX2 A;  3ZEU B;  1JLQ A;  3SUQ A;  4E1M A;  2DFE A;  2QWN A;  3CI5 A;  3CCR N;  3QLH A;  4CF8 A;  1DTQ A;  1RBS A;  3OA9 A;  2O4I A;  3L0Q A;  2YJE A;  4KI6 A;  4N56 A;  1L5U A;  3N4P A;  2VWJ A;  1WB9 A;  1HYV A;  2A1S A;  2ETJ A;  1VQN N;  4DQR A;  3QNN A;  2HVI A;  3TAR A;  2E2N A;  3A0I X;  4E7H A;  4FLU A;  3OYD A;  5SWM A;  3HOT A;  1C1A A;  1ZBL A;  4H03 B;  1C0G A;  1RT6 A;  4WFA L;  4DF8 A;  1YVN A;  1S1X A;  3JAM O;  1RT5 A;  2IOC A;  4BGA A;  4CZF A;  3F9K A;  2KW4 A;  3DRS A;  4PKI A;  1U04 A;  2QI2 A;  3G25 A;  3FZL A;  5AQX A;  3SQ0 A;  5EOY A;  3MWT A;  3ID8 A;  4FOI A;  2QA4 N;  3HL8 A;  5CY4 A;  3SJJ A;  2OTJ N;  2Z1G A;  3SQ4 A;  4NLB A;  5B8H A;  2IC3 A;  2UUB K;  3L3U A;  2XHB A;  3D45 A;  4H0P A;  2AP1 A;  3MEC A;  3OJS A;  3TSQ A;  5M1N A;  4HTU A;  5HP1 A;  2OPS A;  4A2A A;  4FJX A;  4LF4 K;  4H0X B;  1T8E A;  3RMB A;  1K8K B;  1BOT O;  4NCA A;  3THY B;  1NJX A;  4CD1 A;  1I3A A;  4AF1 A;  4FLT A;  1R59 O;  3M3Z A;  3SUN A;  4YOW A;  1X9W A;  1JJ2 M;  4KTQ A;  4FOE A;  2PYL A;  5C0Y A;  3SMP A;  3NGY A;  4F2R A;  3LDP A;  2CGK A;  1QVG M;  3V6D A;  4HCC A;  3NVK A;  2Y1J A;  2BGG A;  3QIN A;  4NLC A;  3D2E B;  4CZE A;  1NK0 A;  1RTJ A;  1GLD G;  3V4I A;  4E89 A;  2HB5 A;  2OAN A;  3ATU A;  4B1X B;  1GLA G;  2Q1N A;  3V9Z A;  4U7B A;  4NXN K;  3CJB A;  1JLA A;  3WQU A;  4KHP K;  1NKB A;  5BRE A;  3K9K A;  3S3N A;  3LDO A;  4K8X A;  2VQF K;  4NYN A;  4BRH A;  1U45 A;  3ZT4 A;  1JL1 A;  2UU9 K;  1EWR A;  2UYT A;  5M1O A;  1MWM A;  3H46 O;  3K5M A;  3NH2 A;  5F0X A;  3PX4 A;  3CQX A;  2HHV A;  4KTZ A;  1JLC A;  4CGI A;  3T3F A;  1N6Q A;  3VQA A;  4A5A A;  5MLC Q;  1GOC A;  4CEC A;  1EO1 A;  4B3T K;  4JKA A;  3O1B A;  3TTD A;  5J2M A;  3KWI A;  3ISN C;  3P31 A;  3U3G A;  4CZM A;  2O8C A;  4CK2 A;  3ULE A;  3CJ7 A;  5AQI A;  2A1R A;  4LY7 A;  3BF3 A;  2HMP A;  5M1Q A;  1BL3 A;  3T69 A;  2W6L A;  2ZF5 O;  1KFS A;  4BR4 A;  1WUA A;  3GG4 A;  1RT3 A;  5D3G A;  1TGO A;  4IOX A;  4MLH A;  4Z0U A;  4A57 A;  4CJP A;  1C1B A;  4RW9 A;  4YNQ A;  2KLA A;  4BG8 A;  1U6Z A;  1YIT N;  3WNE A;  4BRE A;  1NJZ A;  1S1T A;  4A59 A;  3MWP A;  1RDD A;  1YJW N;  3TAQ A;  4CFD A;  2NRZ A;  4F4K A;  3TAE A;  3KLE A;  1SUQ A;  2ZQB A;  1YIJ N;  1NGC A;  5AQG A;  4CGD A;  4BE0 A;  1TK0 A;  3AVH A;  4FZZ A;  5KPZ A;  1TV6 A;  4KAZ A;  3ZEU A;  2HOE A;  1YAG A;  4H5R A;  3QET A;  1X9J A;  3OYI A;  4CE9 A;  1FK9 A;  4BRN A;  5LJV A;  1HNZ K;  3N4Q A;  4M3Z A;  3SCX A;  3V1O A;  2ZJQ L;  1N8R O;  3A5O C;  1ZBF A;  1Y97 A;  1RIL A;  3FZH A;  1S3X A;  3A8Y A;  3P39 A;  3QBX A;  1XNR K;  4CZJ A;  3KLF A;  4CJT A;  2G8U A;  4DV1 K;  4DTO A;  4LFC K;  1IJJ A;  4DS5 A;  1RDB A;  2JWK A;  3VES A;  1FW6 A;  4Y1D A;  5GIN A;  2W6K A;  4DS4 A;  3U8X A;  4CHN A;  4DV6 K;  3CM5 A;  2CGL A;  1EKE A;  3SLC A;  1TYQ B;  5BPL A;  2Z1H A;  1P8Z A;  4C8M A;  3KWG A;  3KK2 A;  1BIU A;  4CJ3 A;  2F7T A;  1RTI A;  1HKC A;  4ISE A;  1NGD A;  5AQT A;  3I55 N;  5ADX A;  2V7Y A;  1KD1 O;  3VGL A;  5GAG P;  3GL1 A;  5T7B A;  3HO1 A;  3GE1 A;  2GEL A;  4L8R B;  3JS6 A;  4G9Z A;  1VQ6 N;  3VEX A;  4X65 K;  4RW7 A;  2P9U B;  1N5Y A;  2PBD A;  1ATS A;  3UB5 A;  5AQZ A;  3DXK B;  2D0P A;  3RWU A;  3C6H A;  2KFN A;  2E2Q A;  2P9S B;  1E3M A;  2WFB A;  2QXL A;  3K5N A;  1JLF A;  5KGW A;  3V1R A;  4JRP A;  1EX4 A;  2GX9 A;  4DSL A;  2EHG A;  2O8B A;  4F2S A;  4ELT A;  4BRL A;  1Z6R A;  5C12 A;  5JS1 A;  1H1V A;  4JKB A;  1Z25 A;  3GBT A;  1WSG A;  3SJH A;  1K9M O;  4JI7 K;  3DLL L;  4CVN E;  3D2E A;  3TWH A;  3RRH A;  1U49 A;  4IXC A;  4BVO A;  4OO1 J;  1VQ7 N;  3IRX A;  2FSK A;  4MFB A;  3MCP A;  2VQE K;  2G8V A;  1RBT A;  1EQY A;  1SZ2 A;  1U48 A;  3WXL A;  2P9K B;  1VSK A;  1NOY A;  3RRG A;  4TSX A;  3P38 A;  5C2D A;  4CER A;  2DTU A;  5C24 A;  4EP5 A;  3G4S N;  3AAQ A;  4LH5 A;  3SUP A;  3LM9 A;  2QWQ A;  2UUC K;  3HZ6 A;  4DV7 K;  3CD6 N;  4DSJ A;  4AIL C;  1LOT B;  3L6Q A;  2VWB A;  3CXC M;  4LFB K;  2FF3 B;  2HMI A;  4FJI A;  1S22 A;  3DRP A;  2KZZ A;  3HPH A;  1JCG A;  3H6E A;  4DU3 A;  4YOX A;  3DYA A;  1NNE A;  1VAZ A;  1NGB A;  2YNG A;  4GV9 A;  1Q18 A;  3NF8 A;  3LAN A;  3E9L A;  4R79 A;  4EIA A;  1NKE A;  4I2P A;  4OLB A;  1SV5 A;  4FW2 A;  3SV4 A;  4H0T B;  4IJN A;  5BR8 K;  5BRF A;  4AHV A;  4KB0 A;  4EFH A;  2FBX A;  1TK5 A;  3AVC A;  3FR0 A;  1R0A A;  1IG9 A;  1NGF A;  3ZT3 A;  3TAN A;  5FRM A;  4M42 A;  3V9S A;  3H1V X;  2WTU A;  4C23 A;  4BQL A;  3EL2 A;  1YXQ A;  4JEP A;  2B4J A;  3M6G A;  4FSV A;  3LZJ A;  4E7I A;  4FJ9 A;  1LW0 A;  4M3Y A;  4B3O A;  4JKF A;  1HPZ A;  1S1U A;  3CJC A;  3H45 C;  4DB3 A;  1QHA A;  3IS9 A;  3HTV A;  3CET A;  1KCF A;  2XY5 A;  4B1Y B;  1RT2 A;  4DV5 K;  3BGR A;  3VQ5 A;  3OVN A;  1YUW A;  2W42 A;  2OPP A;  4M41 A;  5GIP A;  1K6Y A;  3VET A;  1IKX A;  1RT4 A;  1KVC A;  5KTQ A;  1MWK A;  1X3N A;  3ZET A;  1HNI A;  4OPK A;  4OLA A;  1LAV A;  2V7Z A;  4B1U B;  4CBX A;  3RSE A;  4X66 K;  4QS7 A;  1BCO A;  5AJ3 K;  4IG0 A;  4FWQ A;  2NZT A;  1TK8 A;  1IG8 A;  3O9T A;  3CER A;  1T44 A;  4WQ5 C;  2WON A;  1HQU A;  1WSF A;  4ZTJ A;  5FPN A;  4DLE A;  4FJN A;  1RDU A;  4O44 A;  4DFP A;  1S9G A;  1BU6 O;  1FJG K;  3LDN A;  3QFP A;  3DLK A;  4DFJ A;  4E0D A;  1BUP A;  3AVI A;  3R1X A;  2YV0 X;  1GOB A;  3PUF A;  4IOC L;  2H3G X;  3AA4 A;  3E01 A;  4LSN A;  2F9T A;  3ENO A;  2GTD A;  4KB1 A;  4CHO A;  2UXD K;  3PSF A;  4EAH D;  3OYG A;  3F5T A;  3FFK B;  3B6P A;  4YY3 K;  4IDK A;  1L3V A;  1O1W A;  2D0A A;  5ELZ A;  1NK6 A;  3CQ8 A;  2X78 A;  4CGF A;  4DV3 K;  3O1W A;  1SAZ A;  1GLL O;  4BRI A;  5AQL A;  4FK0 A;  1N32 K;  4UQG A;  4CFA A;  4RCH A;  3WQT A;  4CES A;  4JI2 K;  2OTL N;  3CFP A;  5F1X A;  4ZHR A;  3O9U A;  5AFU A;  1GLJ O;  1NGI A;  1SKR A;  4JKD A;  4CJK A;  1C6V A;  1RTD A;  1IV0 A;  1HYZ A;  1YJ9 N;  3I33 A;  3VA3 A;  1LWF A;  2BH1 A;  3E9P A;  5C42 A;  1SL2 A;  4E19 A;  2P9K A;  3RMA A;  3UIQ A;  4Y1C A;  2FLO A;  5CYM A;  1K73 O;  5LY3 A;  3KKS A;  2E6L A;  2OYQ A;  3F2K A;  3WT0 A;  1M90 O;  2Q36 A;  4O8U A;  4H8K A;  4W5N A;  4KH4 A;  1QSY A;  3BZK A;  4CFB A;  3ENH A;  4DQS A;  2A41 A;  3ZSY A;  4B9L A;  4E7K A;  1ZC6 A;  3LP1 A;  3SBG A;  3SI6 A;  1OVQ A;  4WQ4 A;  1KRP A;  3IUC A;  3M5R A;  2I7P A;  1Q86 O;  3ALY A;  1CLQ A;  4KHQ A;  4BY9 C;  4AHU A;  5LJW A;  3O4W A;  4CF9 A;  4ISG A;  3KLH A;  3J7Z O;  1CXU A;  3C6U A;  3QIC A;  3VPZ A;  3ATV A;  1G15 A;  3HRG A;  5JS2 A;  1ZYQ A;  3NE6 A;  3O80 A;  1OH7 A;  4CF0 A;  5SZT A;  1X9M A;  4FJ8 A;  3K59 A;  2FSJ A;  1DKG D;  5AQP A;  4C8N A;  3QEX A;  4XH4 A;  4E3S A;  4OX9 K;  3TSP A;  4DQI A;  3ULE B;  3WXJ A;  3O4Q A;  4WFN L;  3CJA A;  3PV8 A;  2ZD1 A;  5AQV A;  4LF6 K;  1RBU A;  1QTM A;  1YTA A;  2CGJ A;  4U67 L;  4JI0 K;  4CEZ A;  4IDH A;  1ZXO A;  1FKP A;  4X62 K;  4FWK A;  3K57 A;  1C0M A;  4FW1 A;  3I8D A;  1LAW A;  3FZK A;  3KLG A;  1BO5 O;  1HPM A;  4E7L A;  4KHU A;  1IH7 A;  1C0U A;  2D1K A;  3A5M C;  4DU4 A;  2D0C A;  1UWB A;  2IAJ A;  4YOY A;  1LV5 A;  1IKY A;  4A61 A;  4YDU A;  1RBV A;  5DK5 A;  1RT1 A;  1S9E A;  4N47 A;  4BRA A;  1NKC A;  4YFU A;  2YX6 A;  4FM1 A;  5IT9 O;  2JGU A;  1BG3 A;  3V9X A;  3G10 A;  4PY5 A;  3CC4 N;  5ADX H;  1U2V B;  4FO0 A;  3CCE N;  3VEO A;  4CBU A;  3T19 A;  3CCS N;  4FM2 A;  1RT7 A;  4CEE A;  4M3T A;  3CHW A;  4A62 A;  3VQ4 A;  4FLZ A;  3LDL A;  3OS2 A;  4ILG B;  4HUG A;  2NLX A;  4H0Y B;  1LW2 A;  4OKJ A;  3RR8 A;  4NCG A;  2G8I A;  2ZJP L;  2KZM A;  1NGG A;  2ASP A;  4FWN A;  4F8R A;  4OPA A;  2Q2R A;  3TAP A;  1YJN N;  5AQR A;  4FZX C;  3QO9 A;  2GWK A;  4FJ5 A;  2GBZ A;  3ASM A;  2GUP A;  2HVH A;  1TUY A;  3VEV A;  4JRQ A;  2E4L A;  4KHN A;  3WXK A;  4L3Q A;  4KRF A;  3T7Z A;  3H3O B;  2CH5 A;  4DR6 K;  2O8B B;  2YCH A;  1NGE A;  3CM6 A;  5AQO A;  2VG6 A;  2HHH K;  3QES A;  4EHU A;  5AZJ A;  3JYT A;  1WOQ A;  1WSJ A;  1GLE G;  1BWF O;  4CJW A;  1DT9 A;  1XC3 A;  5K14 A;  3NH0 A;  4IFV A;  4GVE A;  4M7Y A;  4CJ4 A;  4JHD A;  3DOL A;  2VG7 A;  4IFY A;  2RN2 A;  5J1E A;  1EET A;  2BAN A;  2QWO A;  4JI8 K;  1KC8 O;  2NRH A;  1X1P A;  3AA3 A;  3KD1 E;  1C0F A;  4OPJ A;  1LWE A;  1KVA A;  4ELU A;  3ITH A;  3QDK A;  4O4G A;  5KGX A;  5AQW A;  5BRH A;  3S3O A;  1BQN A;  4DLG A;  4K25 A;  1S1W A;  1WSH A;  1NJY A;  2HNY A;  2IVP A;  1QQC A;  4J2A A;  1D9D A;  4LF8 K;  4OKK A;  3V9W A;  2F96 A;  4BRO A;  4C1N I;  3D7E O;  3MDQ A;  1BI4 B;  1QSL A;  2V52 B;  3NHG A;  1JKH A;  4JS4 A;  1BDG A;  4JNE A;  5J2P A;  4FJK A;  2BE2 A;  3MXI A;  4CJ7 A;  3QER A;  4KH6 A;  1RDW X;  4DF4 A;  1J6Z A;  1ASW A;  4LFA K;  4BRG A;  1TKD A;  2ZWH A;  1XMO K;  1KAY A;  1YI2 N;  2Q0R A;  2GEM A;  4H0V B;  2HBK A;  5BRD A;  3OYN A;  4F3T A;  1EXQ A;  3MN7 A;  1Q82 O;  3AO2 A;  2XY8 A;  1NM1 A;  4WE1 A;  5HRN A;  4HHT A;  5AQY A;  4IOA L;  4PKG A;  1HNX K;  2RPI A;  2YHA A;  3E66 A;  1ZBS A;  3L3V A;  1D8Y A;  2GWJ A;  4KKO A;  3KTQ A;  2AA4 A;  4B9T A;  5AR0 A;  1S6P A;  4DTS A;  1L3T A;  4C8L A;  4XH1 A;  4IO8 A;  3THV A;  3LZI A;  3WNG A;  5FDL A;  3WEE A;  3J7Y P;  3L2U A;  3ZT2 A;  3CJ9 A;  4Z4G A;  4LF5 K;  1VRU A;  4YOV A;  4KRE A;  3ZET B;  1CZ9 A;  3B6O A;  4HUF A;  3RSE B;  4IKF A;  3M1F A;  1U2V A;  5AQU A;  4K41 A;  4C1N K;  1TL3 A;  5FPM A;  4YHH K;  5GAE P;  3FE1 A;  2YKM A;  2KKZ A;  3DMJ A;  4CCH A;  4GNI A;  2OZM A;  1HR0 K;  4KV8 A;  4DSK A;  5KPR A;  3ID6 A;  2E1Z A;  1L3S A;  3SQ1 A;  4B1V A;  1QE1 A;  4A5B A;  1CZA N;  4JI1 K;  1QZ5 A;  4GKK K;  1K8A O;  3L2R A;  3TSU A;  4LSL A;  4O55 A;  1BHL A;  2F4V K;  1REV A;  3HSC A;  1HLU A;  1Q81 O;  3SUO A;  1NK7 A;  2HHW A;  3DXM B;  3LAL A;  3KIO A;  4Y0W A;  3TU5 A;  1HJO A;  3HPO A;  2O8D A;  4Z94 A;  1Q8I A;  2QXF A;  4DFK A;  5BR9 A;  4QS9 A;  1YT3 A;  5AFU H;  4DUY K;  2LSN A;  1Q7Y O;  3VER A;  5AQK A;  4WF9 L;  3OW2 M;  2P9L B;  4CEB A;  3O8M A;  3MN6 A;  3QEV A;  1NK4 A;  4BDZ A;  3O4N A;  5I42 A;  2YHY A;  3SZ2 A;  3AVF A;  2W41 A;  3IG1 A;  3P4I A;  4O5F A;  4FJM A;  4DR4 K;  4DQ8 A;  3K58 A;  4DMN A;  3J80 O;  1T3V A;  4DSE A;  2OZS A;  3VQQ A;  4FJ7 A;  4Q0B A;  3UKR B;  3SAG A;  3OS0 A;  2KFZ A;  1UOC A;  3MEG A;  4B9N A;  1ASV A;  4XIU A;  1WBB A;  5EXW A;  5AQF A;  4CHZ A;  4CK3 A;  3HT3 A;  1J5O A;  3J7A P;  4CFC A;  4CIE A;  4PL7 A;  1IBK K;  4B8C A;  1YVU A;  4AM6 A;  4EP4 A;  1OKJ A;  3RVC A;  3DAW A;  4FWL A;  2QK9 A;  4YOT A;  1NLV A;  2DFH A;  1GLF O;  1KVB A;  4JD2 A;  4B9V A;  4ELV A;  1BI4 A;  3BZC A;  2E20 A;  3OYC A;  5JVH L;  4O0J A;  2E1Y A;  4GV6 A;  3VQ8 A;  4JI5 K;  2P51 A;  3C6T A;  1P90 A;  1NK8 A;  3MEE A;  5FRN A;  5BN8 A;  3S41 A;  5E84 A;  4FM0 A;  3A5L C;  4JLH A;  3OYL A;  2E8A A;  3DLE A;  2ATQ A;  5AQN A;  3F9M A;  3ENB A;  3AVK A;  3MN5 A;  1HUX A;  3DLH A;  5H1S Q;  2OPR A;  4BDP A;  1Y64 A;  2HF3 A;  5HOO A;  5I3U A;  4NXM K;  4BDY A;  1QS4 A;  2VGN A;  1GLB G;  4BRK A;  3OYB A;  2ZM6 K;  4DV4 K;  1MA9 B;  3U6F A;  2YJF A;  3TAM A;  2HBM A;  2NNW A;  1N33 K;  1VSH A;  2PFU A;  3ZSV A;  3HJF A;  2GUI A;  1TKZ A;  4BR7 A;  5AZI A;  5AQH A;  1HX1 A;  3I56 N;  3BEX A;  2HHT A;  1XI1 A;  4DR7 K;  2HND A;  1NWK A;  2D5R A;  1MDU B;  3LP3 A;  2P1J A;  4BC5 A;  3KHY A;  5CZ2 A;  2VGM A;  4B08 A;  2FBY A;  2P9P B;  3M8P A;  2F8S A;  3M8Q A;  3VEW A;  4K8Z A;  1VSM A;  3VEZ A;  1B9D A;  5A2Q O;  4BRF A;  2G8K A;  1XC9 A;  3OHR A;  1VQ4 N;  4DG1 A;  3CME N;  4CZH A;  1RTH A;  2HHU A;  1E4G T;  2NRX A;  1JXB A;  3VF4 A;  3LPT A;  1NGA A;  5E41 A;  1VSE A;  3AVB A;  4M3X A;  2E2P A;  4CEQ A;  3VEN A;  3AVG A;  3AVL A;  2RE2 A;  3BY5 A;  4J2E A;  5CE3 A;  4KFB A;  4IG3 A;  4FJJ A;  2DY4 A;  1XQS C;  4RW8 A;  3S9H A;  1QVF M;  3H1Q A;  4BRD A;  4ID5 A;  1VQL N;  3G0Z A;  1TKX A;  5C2F A;  4NB4 A;  2QWM A;  4DCH A;  2B6A A;  3CG7 A;  2D0B A;  3QEI A;  3GDQ A;  3ULD A;  1VSJ A;  3RMD A;  2Q0U A;  3ZSW A;  2RKI A;  4QAG A;  3NH1 A;  4I6M B;  1ASU A;  3ZYY X;  4A2B A;  3DXM A;  5C15 A;  5GIO A;  2W40 A;  1SL1 A;  4DQP A;  4CZG A;  1W97 L;  3D6R A;  3MN9 A;  4JN4 A;  3RR7 A;  3W3D A;  3FFI A;  2FBT A;  3ZX3 A;  1M1K O;  1LWC A;  4CJE A;  4BWJ A;  4NYF A;  3VQ9 A;  1F21 A;  1CZB A;  1U47 A;  2P9L A;  5DM7 L;  2E88 A;  4CD3 A;  1OH5 A;  1I94 K;  1VSD A;  3ZLJ A;  4BE1 A;  3IFR A;  1UA0 A;  4KHY A;  5JVG L;  1S1V A;  3FZM A;  1A5W A;  2FBV A;  2QTD A;  3ZX0 A;  3CIP A;  3NF6 A;  3EE9 A;  3EYZ A;  2QWP A;  3WXI A;  3L4I A;  5AZJ B;  3E9O A;  3LM2 A;  3OYJ A;  3AO5 A;  3MED A;  3UKR A;  5BPN A;  3DOK A;  5M1K A;  4JHD B;  2NRW A;  1B9F A;  5AQM A;  3DM2 A;  1VSL A;  3IDH A;  3AAP A;  3PY8 A;  4K0K K;  1JCF A;  3V9U A;  2WUS A;  2IVO A;  4EHT A;  4DV0 K;  4FCY A;  3T1Y K;  2UXC K;  2QM1 A;  2Z1J A;  5HRS A;  3E1Y A;  2X6S A;  4CJS A;  2F8T A;  4FXD A;  1DGK N;  3EEQ A;  2P9I B;  3SYZ A;  3NDK A;  3VQB A;  1VK0 A;  3PO4 A;  3NF9 A;  3I0R A;  4GVM A;  5C10 A;  5KI6 A;  3MXJ A;  4M3U A;  4M63 C;  2QWL A;  3O3H A;  3EKU A;  4JI4 K;  4IEE A;  3CCJ N;  4I9L A;  1U4B A;  3ZT0 A;  4FVM A;  4BRP A;  3G71 N;  1BGX T;  4UY8 O;  4KHW A;  4LD0 A;  1KAX A;  1NU0 A;  2HST A;  3VOV A;  2ZJR L;  4CBW A;  1B92 A;  2YNI A;  4I7F A;  3GOI A;  1NK5 A;  3DLG A;  2OA8 A;  4FLY A;  4BRQ A;  1I39 A;  2A40 A;  3LL3 A;  2BDP A;  3T1A A;  1T6C A;  5JIC A;  4PUO A;  2IDO A;  4CF1 A;  5JMV A;  3AA5 X;  3LPU A;  4BR2 A;  3TTC A;  4WQ4 C;  3ZX2 A;  3K5L A;  2HBJ A;  1QQO A;  3QB0 A;  1YTU A;  1QHT A;  2XY7 A;  3PIO L;  4RW4 A;  4F3O A;  3LP2 A;  5CR4 A;  4FK2 A;  1SKW A;  1BA1 A;  4B3M K;  4FLV A;  4IWV A;  1A5V A;  3HM8 A;  3SV3 A;  2P9P A;  2X6N A;  4CZL A;  5LMU K;  1RNH A;  4JKG B;  2GV9 A;  3EZW A;  3CPE A;  3WNF A;  5M1P A;  3ZT1 A;  3NCI A;  1Q9Y A;  2XRI A;  3AV9 A;  4B9M A;  2KTQ A;  3TAB A;  2YI1 A;  3WEE B;  5GAH P;  1SQK A;  3ZSQ A;  3DI6 A;  4H5W A;  1DLO A;  1WAF A;  4ISF A;  5LL6 Z;  4K42 A;  5BN9 A;  4DQQ A;  4FPA A;  3RMC A;  3AVJ A;  3R9P A;  3KJV A;  3P83 D;  4CJ5 A;  4Z4I A;  1EP4 A;  4BGB A;  4AHT A;  1KTQ A;  1BCM A;  4BWM A;  4AM7 A;  3H3N O;  3HM9 A;  1GLC G;  3FGU A;  4DTR A;  4AHR A;  2NRV A;  4DKW A;  4XEI A;  4DUZ K;  2FF6 A;  3TAF A;  2IGI A;  1OH8 A;  4BRM A;  3LP0 A;  3DJC A;  1ILY A;  1QZ6 A;  2Q97 A;  3ZSZ A;  2D0O A;  1TUU A;  4I6M A;  4YDU C;  3NVM A;  2UUA K;  5E26 A;  3J81 O;  2RF2 A;  3AO4 A;  4KBO A;  1ITG A;  1WLJ A;  2VG5 A;  2VCP A;  5CYQ A;  3CCQ N;  3PO5 A;  4Z4C A;  4N76 A;  3HXM A;  4JKE A;  2O8D B;  4OKE A;  2YHW A;  3CF5 L;  4Q5V A;  5CZ1 A;  1JL2 A;  1JXE A;  1RDC A;  3VQP A;  1V4T A;  4JAX A;  3DLB A;  5HBM A;  3CPW M;  3AVN A;  4YOR A;  3SQ2 A;  1VQP N;  1LCU A;  4M3W A;  4DFM A;  3A5N C;  4HUE A;  5HRR A;  3PLA A;  3L2Q A;  5TKW A;  1D9F A;  1DTT A;  3SBT A;  3VQE A;  4GY2 B;  2FXU A;  1HNV A;  3AGK A;  2QW9 A;  3EZ5 A;  4I2Q A;  4W5O A;  4H4O A;  3MX5 A;  3O9S A;  3JSM A;  3EY1 A;  2YNF A;  4OGC A;  4WYB A;  5FPE A;  1Z05 A;  1IBL K;  1MU2 A;  4GMJ B;  2ITG A;  4WFB L;  3HP9 A;  3QFU A;  3BUZ B;  1BQM A;  4BC3 A;  3QBW A;  2A3Z A;  3THX B;  5TKY A;  1VQO N;  4HCB A;  2P9I A;  3NFA A;  1IO2 A;  2ZGZ A;  4CZK A;  2PZS A;  1W0H A;  3THW B;  3D0P A;  1QQN A;  4GV3 A;  2PYJ A;  2IVN A;  3RTV A;  4FWP A;  1WAJ A;  4AHC A;  4DSF A;  1NMN A;  3VF2 A;  4JD2 B;  4B8A B;  3KD5 E;  2XY6 A;  3H08 A;  4HVJ A;  5J2N A;  4KI4 A;  1DEJ A;  2I5J A;  4ZTF A;  1KLN A;  3PSI A;  4B3S K;  3G6E N;  3S3M A;  4ID1 A;  2NUB A;  3C65 A;  4Z4H A;  3KK7 A;  3F73 A;  3U4L A;  4DR1 K;  4DV2 K;  4IEI A;  5KQ8 A;  2HHX A;  4LF7 K;  1C0T A;  2A42 A;  3VN5 A;  3K9J A;  5HRO A;  4GW6 A;  4BRC A;  3VF6 A;  2F9W A;  4H5N A;  1ATR A;  3ZSO A;  3VQD A;  2QKB A;  2HNZ A;  4N5S A;  2WC9 A;  1IKV A;  3UKU B;  3VA0 A;  3P5J A;  1JLE A;  4BG9 A;  4PL8 A;  1SL0 A;  2ITM A;  4LF9 K;  1KAZ A;  3NGZ A;  2YKN A;  5AZI B;  4FJL A;  2DFF A;  5EX5 A;  2E5L K;  3K2P A;  4CGG A;  3CCL N;  3O3G A;  1VQK N;  4CF2 A;  4DSI A;  3OS1 A;  4CI6 A;  1BIS A;  1VSI A;  3DLR A;  1D5A A;  3Q7B A;  1WNS A;  4DTP A;  1QSS A;  1A5X A;  3TPQ A;  4JKG A;  3KVG A;  3R3L A;  5F2R A;  1NK9 A;  3QIO A;  4E1J A;  4R5P A;  3LWM A;  4FLW A;  2NRR A;  3SNN A;  4CIF A;  2VYP A;  1O13 A;  4C8K A;  1OH6 A;  3UE5 A;  4FL9 A;  5HLF A;  3AVA A;  3ZCM A;  4QCL A;  1ESV A;  1NMD A;  3QIP A;  4CGJ A;  5FPD A;  5KPT A;  4PQU A;  3V1Q A;  3LDS A;  1NGH A;  4AQY K;  3O3F A;  3HVR A;  2HHS A;  2Q31 A;  3OYE A;  5DM6 L;  4EZ6 A;  1HRH A;  1HKG A;  2OPQ A;  2ZE2 A;  4KO0 A;  4MDB A;  4X64 K;  3V81 A;  4BC4 A;  3I0S A;  5M1F A;  2Y1I A;  1ZBH A;  5JLH A;  3AVM A;  3VQ6 A;  3QEP A;  4AH9 A;  1S5J A;  3KLI A;  4BR5 A;  3O9Q A;  3EN9 A;  3IKM A;  2QEX N;  1OVY A;  2BTF A;  3VEY A;  4O8K A;  3CCM N;  4H0O A;  1VQ8 N;  1JLG A;  4CZI A;  2AJQ A;  3L4Q A;  4DTU A;  3CC2 N;  1VHX A;  1T03 A;  4CED A;  1RBR A;  4I9Q A;  1BIZ A;  4CJR A;  1J54 A;  4FK4 A;  4MQ3 A;  5AQQ A;  1JCE A;  5EVZ A;  2PAV A;  4CK1 A;  3Q7C A;  3WXM B;  1RFQ A;  3TI0 A;  1W2B M;  2JLE A;  4IFE A;  3OYF A;  3MCA B;  4JYA K;  4DTM A;  4CHP A;  3CFR A;  1K8K A;  2YHB A;  4H5T A;  4ILJ A;  3WUH A;  4XH5 A;  1X9S A;  4F9O A;  4ICL A;  5FLX O;  4CHY A;  3THY A;  3K0S A;  3CCV N;  4PKH A;  3L2W A;  1XMQ K;  1KQS M;  4KPY A;  2WBN A;  3KK1 A;  3C6A A;  4CEA A;  3I8B A;  3IMX A;  4CIG A;  4DWI A;  3THX A;  1HYS A;  2PY5 A;  4W5T A;  3C0B A;  2D4W A;  3NGI A;  3VTI A;  1RDA A;  3AO3 A;  2HW3 A;  3THW A;  4N41 A;  3O5B A;  3C7N B;  3OYH A;  2YNH A;  3VGK A;  4J2B A;  1FKO A;  2UXB K;  3BDP A;  3VMF B;  5HL7 L;  1XNQ K;  1IKW A;  3HP6 A;  2O8E B;  3D2F B;  2Q3S A;  2G8F A;  3TR8 A;  4W5R A;  2G8H A;  2X74 A;  4JI3 K;  4LH4 A;  4FWO A;  1NJI O;  1C1C A;  2O8F B;  3LWL A;  3OYM A;  1NGJ A;  4V19 S;  4MO5 A;  1TKT A;  3HI0 A;  1HQE A;  5CHI A;  3OBY A;  3CCU N;  4CJF A;  4DR2 K;  2BUP A;  4B9U A;  5HRP A;  5BPM A;  3AO1 A;  3PX0 A;  3C95 A;  3SK3 A;  4CGH A;  2P5G A;  3CQY A;  3B8A X;  4JK9 A;  4FVU A;  2HHQ A;  3UKU A;  3OBW A;  4W5Q A;  2P9N B;  3W0L A;  4O0I A;  5KRT A;  5DMR A;  1JLB A;  3VGM A;  2QKK A;  3SPZ A;  4HWI A;  3KKR A;  3NBP A;  2IIR A;  4E7J A;  4RG8 A;  4OGE A;  4IJA A;  3TAG A;  3TTF A;  2KQ2 A;  4NO7 A;  3OYK A;  1S6Q A;  3HYF A;  1T05 A; 
#chains in the Genus database with same CATH homology
 3MXM A;  4Y1D A;  3CM6 A;  4I9L A;  1VRT A;  4E1N A;  2VG6 A;  2VWK A;  3ZT0 A;  2IS3 A;  3NF7 A;  4FVM A;  4DS4 A;  3QES A;  2FC0 A;  1TL1 A;  1BGX T;  3JYT A;  1WSJ A;  4CHN A;  4KHW A;  4LD0 A;  3CM5 A;  3MAQ A;  1EKE A;  1UA1 A;  1Q9X A;  4CJW A;  2Z1H A;  5K14 A;  4C8M A;  3NH0 A;  4IFV A;  4CJ4 A;  1B92 A;  3KK2 A;  2YNI A;  4I7F A;  3DOL A;  1BIU A;  3DLG A;  2VG7 A;  4IFY A;  3ZSR A;  4CJ3 A;  4FLY A;  1NK5 A;  1RTI A;  2RN2 A;  1EET A;  1I39 A;  2BAN A;  3HST B;  5J1E A;  4KRF A;  2BDP A;  1X1P A;  3AA3 A;  3KD1 E;  3HK2 A;  3A2F A;  3T1A A;  4PUO A;  4CJQ A;  2IDO A;  4CF1 A;  5T7B A;  1GOA A;  4DTX A;  3HO1 A;  4L8R B;  3AA5 X;  3LPU A;  4OPJ A;  1LWE A;  1KVA A;  1UAX A;  3ITH A;  4O4G A;  5KGX A;  4ELU A;  2O4G A;  4RW7 A;  1N5Y A;  3S3O A;  3K5L A;  4CEO A;  1BQN A;  4DLG A;  1S1W A;  1YTU A;  1QHT A;  3QEW A;  3RWU A;  1WSH A;  2XY7 A;  5J2Q A;  1NJY A;  2KFN A;  2HNY A;  4RW4 A;  3M8R A;  4F3O A;  3LP2 A;  1QQC A;  4J2A A;  1D9D A;  4FK2 A;  3K5N A;  4IBN A;  1JLF A;  4OKK A;  5KGW A;  3V9W A;  1SKW A;  2F96 A;  3V1R A;  4CJU A;  4FLV A;  3CYM A;  4JRP A;  1CXQ A;  1EX4 A;  4B9S A;  1A5V A;  3SV3 A;  1BI4 B;  1QSL A;  4DSL A;  2EHG A;  2Z1I A;  3HPG A;  4F2S A;  2X6N A;  1RNH A;  3NHG A;  1JKH A;  4ELT A;  4FYD A;  2GV9 A;  4JS4 A;  2G8W A;  2XO7 A;  3QNO A;  4FJK A;  3WNF A;  5J2P A;  3SPY A;  5JS1 A;  2BE2 A;  3ZT1 A;  1XHZ A;  3MXI A;  4PA1 A;  3NCI A;  1Q9Y A;  1Z25 A;  1WSG A;  4DU1 A;  2XRI A;  3AV9 A;  3QER A;  4B9M A;  2KTQ A;  3TAB A;  3TWH A;  4DF4 A;  3RRH A;  4DTN A;  3ZSQ A;  1NOZ A;  1U49 A;  3DI6 A;  3IRX A;  1ASW A;  1DLO A;  1WAF A;  3ZSX A;  4MFB A;  1TKD A;  2G8V A;  4DQQ A;  1RBT A;  3RMC A;  1TAU A;  3AVJ A;  1U48 A;  3KJV A;  3P83 D;  4CJ5 A;  3OYN A;  4Z4I A;  1EP4 A;  4F3T A;  1VSK A;  1NOY A;  3RRG A;  1EXQ A;  4TSX A;  4AHT A;  1KTQ A;  1W9H A;  1BCM A;  4BWM A;  3IAY A;  3AO2 A;  3HM9 A;  2XY8 A;  4WE1 A;  5HRN A;  4HHT A;  4CER A;  2DTU A;  5C24 A;  4EP5 A;  4AHR A;  4LH5 A;  4DTR A;  3SUP A;  2RPI A;  2YHA A;  3OJU A;  1TVR A;  3L3V A;  5KRS A;  1D8Y A;  2B5J A;  4DSJ A;  4KKO A;  1WSE A;  2IGI A;  3TAF A;  3KTQ A;  4AIL C;  3WNH A;  4B9T A;  3LP0 A;  4NCB A;  3ZSZ A;  4BAC A;  1XHX A;  1NJW A;  4FJG A;  1S6P A;  2HMI A;  4DTS A;  1L3T A;  4C8L A;  1TAQ A;  4FJI A;  3DRP A;  2KZZ A;  1J53 A;  2RF2 A;  3LAM A;  3DRR A;  3AO4 A;  3HPH A;  1ITG A;  3THV A;  4J2D A;  1WLJ A;  2WOM A;  2VG5 A;  3LZI A;  4DU3 A;  3DYA A;  3WNG A;  4KTW A;  5FDL A;  5CYQ A;  2YNG A;  3KK3 A;  3L2U A;  3PO5 A;  3ZT2 A;  3U3Y A;  5FRO A;  4Z4C A;  4N76 A;  3NF8 A;  3HXM A;  4C8O A;  3VQ7 A;  3OYA A;  3LAN A;  4Z4G A;  4OKE A;  4M3R A;  1NKE A;  4I2P A;  1VRU A;  4KRE A;  4OLB A;  4FJH A;  1CZ9 A;  3CFO A;  3B6O A;  4Q5V A;  1SV5 A;  5CZ1 A;  4FW2 A;  5C25 A;  1JL2 A;  1JXE A;  1J9A A;  3SV4 A;  4HUF A;  1RDC A;  3VQP A;  3DLB A;  1ZBI A;  5HBM A;  4IKF A;  3AVN A;  3LAK A;  3SQ2 A;  3P1G A;  4AHV A;  4KB0 A;  1TL3 A;  2FBX A;  4CEF A;  1TK5 A;  3AVC A;  2YKM A;  4M3W A;  4DFM A;  1KFD A;  1R0A A;  1IG9 A;  3DMJ A;  3ZT3 A;  4HUE A;  1T7P A;  4CCH A;  2OZM A;  5HRR A;  3TAN A;  5FRM A;  4KV8 A;  4DSK A;  3L2Q A;  1D9F A;  1DTT A;  4Z4F A;  3AA2 A;  4M42 A;  3V9S A;  3VQE A;  1L3S A;  1VSF A;  3SQ1 A;  1HNV A;  1L3U A;  1QE1 A;  4QOZ B;  2B4J A;  4Z4E A;  3LZJ A;  4E7I A;  4EZ9 A;  4FJ9 A;  1WSI A;  3EZ5 A;  1LW0 A;  4I2Q A;  4H4O A;  4W5O A;  4M3Y A;  4B3O A;  1HPZ A;  1S1U A;  3L2R A;  3JSM A;  3EY1 A;  2YNF A;  4OGC A;  4OJR A;  4LSL A;  1MU2 A;  4GMJ B;  3IS9 A;  2ITG A;  3K5O A;  3HP9 A;  4O55 A;  1BHL A;  1KCF A;  1REV A;  1BQM A;  2XY5 A;  1RT2 A;  3BGR A;  3VQ5 A;  3OVN A;  2W42 A;  3SUO A;  2OPP A;  1NK7 A;  2HHW A;  3VQC A;  3LAL A;  3M8S A;  3PX6 A;  4M41 A;  3KIO A;  4HCB A;  1XWL A;  3NFA A;  1K6Y A;  1IKX A;  1IO2 A;  1SKS A;  1RCH A;  1RT4 A;  2E6M A;  3HPO A;  1KVC A;  2PZS A;  1Q8I A;  1WN7 A;  2QXF A;  1W0H A;  4RW6 A;  4DFK A;  4KHS A;  5KTQ A;  1YT3 A;  3NAE A;  2R7Y A;  1HNI A;  4OPK A;  3D0P A;  1LAV A;  4OLA A;  2P5O A;  2PYJ A;  3RTV A;  2LSN A;  1WAJ A;  3OY9 A;  1BCO A;  4AHC A;  4DSF A;  4IG0 A;  4CJV A;  4CEB A;  1FXX A;  4B8A B;  1TK8 A;  3KD5 E;  3QEV A;  2XY6 A;  3H08 A;  1NK4 A;  2WON A;  4AHS A;  1ZBU A;  3O4N A;  4G1Q A;  4HVJ A;  4BDZ A;  4DTJ A;  3SZ2 A;  5J2N A;  5I42 A;  1HQU A;  3AVF A;  4KI4 A;  1WSF A;  2I5J A;  4CHQ A;  4FLX A;  4ZTF A;  4ZTJ A;  4JS5 A;  3IG1 A;  1KLN A;  4DLE A;  3L2V A;  3HVT A;  4FJM A;  4OVL A;  3S3M A;  4FJN A;  1HMV A;  1HJR A;  4ID1 A;  2NUB A;  4O5B A;  4DMN A;  3K58 A;  4O44 A;  4M45 A;  4Z4H A;  4DFP A;  1KSP A;  1S9G A;  4FZY A;  4DSE A;  2OZS A;  4CJL A;  3F73 A;  3VQQ A;  2EX3 A;  4FJ7 A;  5EU7 A;  4Q0B A;  4H4M A;  1KLM A;  3DLK A;  3C94 A;  4BE2 A;  4DFJ A;  4E0D A;  2HHX A;  3AVI A;  1C0T A;  3OS0 A;  2KFZ A;  2YV0 X;  1GOB A;  3PUF A;  1UOC A;  3VN5 A;  3MEG A;  5HRO A;  4B9N A;  1ASV A;  4GW6 A;  4XIU A;  3AA4 A;  3E01 A;  4LSN A;  4CHZ A;  1Z26 A;  3L8B A;  4CK3 A;  4PWD A;  4KB1 A;  3ZSO A;  4CHO A;  1JLQ A;  3SUQ A;  3VQD A;  4E1M A;  3OYG A;  2DFE A;  3HT3 A;  1J5O A;  4CFC A;  2QKB A;  2HNZ A;  3B6P A;  3QLH A;  4CIE A;  4IDK A;  4CF8 A;  4N5S A;  1L3V A;  1O1W A;  1DTQ A;  2D0A A;  1IKV A;  1RBS A;  4B8C A;  3VA0 A;  1YVU A;  1NK6 A;  3CQ8 A;  3P5J A;  4EP4 A;  1JLE A;  2X78 A;  2O4I A;  1SL0 A;  4KI6 A;  4N56 A;  1L5U A;  3NGZ A;  4CGF A;  2VWJ A;  2QK9 A;  2YKN A;  2DFH A;  1HYV A;  2A1S A;  2ETJ A;  4FJL A;  1KVB A;  2DFF A;  4DQR A;  3K2P A;  4CGG A;  3QNN A;  3O3G A;  3TAR A;  4B9V A;  2HVI A;  4ELV A;  4CF2 A;  1BI4 A;  4DSI A;  3OS1 A;  3OYC A;  1BIS A;  1VSI A;  4O0J A;  4E7H A;  3DLR A;  1D5A A;  4FLU A;  3OYD A;  3VQ8 A;  1WNS A;  4DTP A;  1QSS A;  1A5X A;  4UQG A;  4CFA A;  5SWM A;  4FK0 A;  2P51 A;  1C1A A;  3C6T A;  4CES A;  1NK8 A;  3MEE A;  3CFP A;  1ZBL A;  5FRN A;  4ZHR A;  1NK9 A;  1RT6 A;  3QIO A;  4DF8 A;  4FM0 A;  1SKR A;  4JLH A;  3OYL A;  4R5P A;  3LWM A;  3DLE A;  4CJK A;  1S1X A;  4FLW A;  1C6V A;  2ATQ A;  1RT5 A;  3SNN A;  1RTD A;  2IOC A;  1HYZ A;  4CIF A;  3F9K A;  3AVK A;  4C8K A;  2KW4 A;  3DRS A;  3DLH A;  1U04 A;  2OPR A;  1LWF A;  3VA3 A;  5HLF A;  5C42 A;  4BDP A;  3SQ0 A;  3AVA A;  1SL2 A;  5I3U A;  3ZCM A;  3HL8 A;  5CY4 A;  4E19 A;  4BDY A;  1QS4 A;  3RMA A;  3SJJ A;  3UIQ A;  4Y1C A;  4QCL A;  3OYB A;  5CYM A;  2Z1G A;  3SQ4 A;  2IC3 A;  3QIP A;  3KKS A;  4CGJ A;  2E6L A;  3L3U A;  3U6F A;  3TAM A;  2XHB A;  3D45 A;  2OYQ A;  4PQU A;  1VSH A;  3MEC A;  3V1Q A;  3ZSV A;  3OJS A;  2GUI A;  3LDS A;  3HJF A;  4W5N A;  4H8K A;  4HTU A;  5HP1 A;  2OPS A;  3O3F A;  3HVR A;  1QSY A;  4FJX A;  4CFB A;  2HHS A;  4EZ6 A;  3OYE A;  1TKZ A;  4DQS A;  3RMB A;  1HRH A;  2OPQ A;  2ZE2 A;  4KO0 A;  3ZSY A;  1T8E A;  4B9L A;  4E7K A;  2HHT A;  3LP1 A;  1XI1 A;  3SI6 A;  2HND A;  3V81 A;  3I0S A;  2Y1I A;  1NJX A;  1KRP A;  4NCA A;  1ZBH A;  3AVM A;  2D5R A;  3VQ6 A;  1I3A A;  4AH9 A;  4FLT A;  3QEP A;  1S5J A;  1CLQ A;  3ALY A;  3SUN A;  3KLI A;  1X9W A;  3LP3 A;  2P1J A;  4KHQ A;  4KTQ A;  5CZ2 A;  4AHU A;  4B08 A;  2FBY A;  3M8P A;  2PYL A;  3M8Q A;  2F8S A;  4K8Z A;  1VSM A;  4CF9 A;  1B9D A;  3NGY A;  4F2R A;  3KLH A;  1CXU A;  1JLG A;  3C6U A;  2G8K A;  3V6D A;  1XC9 A;  4DG1 A;  1G15 A;  5JS2 A;  1ZYQ A;  2AJQ A;  3NE6 A;  4DTU A;  4HCC A;  4CF0 A;  1T03 A;  1RTH A;  2Y1J A;  5SZT A;  1X9M A;  2BGG A;  4CED A;  4FJ8 A;  2HHU A;  3K59 A;  1RBR A;  4I9Q A;  3QIN A;  4C8N A;  1BIZ A;  1JXB A;  4CJR A;  1J54 A;  3LPT A;  3QEX A;  4MQ3 A;  4FK4 A;  5E41 A;  1NK0 A;  1RTJ A;  1VSE A;  3V4I A;  3AVB A;  4E3S A;  4E89 A;  4M3X A;  4CEQ A;  2HB5 A;  4CK1 A;  4DQI A;  3AVG A;  3V9Z A;  3AVL A;  3O4Q A;  3TI0 A;  4J2E A;  3PV8 A;  4KFB A;  2ZD1 A;  2JLE A;  3OYF A;  1JLA A;  4IG3 A;  4FJJ A;  2DY4 A;  1RBU A;  1NKB A;  1QTM A;  1YTA A;  4RW8 A;  4DTM A;  4CHP A;  3S9H A;  3CFR A;  4CEZ A;  2YHB A;  3S3N A;  1X9S A;  4K8X A;  1FKP A;  4ID5 A;  3G0Z A;  4ICL A;  4CHY A;  1TKX A;  3K57 A;  1C0M A;  4FW1 A;  4NYN A;  1U45 A;  3ZT4 A;  2B6A A;  1LAW A;  1JL1 A;  3CG7 A;  3I8D A;  2D0B A;  3KLG A;  3K5M A;  3L2W A;  4KPY A;  4E7L A;  3NH2 A;  3QEI A;  3PX4 A;  4KHU A;  1IH7 A;  3ULD A;  1C0U A;  1VSJ A;  3RMD A;  3ZSW A;  3KK1 A;  2RKI A;  4QAG A;  4CEA A;  4CIG A;  3NH1 A;  4DWI A;  1ASU A;  2HHV A;  4KTZ A;  1JLC A;  4CGI A;  3T3F A;  1HYS A;  2PY5 A;  4W5T A;  1N6Q A;  3VQA A;  1SL1 A;  4DQP A;  3NGI A;  1GOC A;  1RDA A;  4DU4 A;  2D0C A;  1UWB A;  3AO3 A;  2IAJ A;  4CEC A;  1LV5 A;  3RR7 A;  3FFI A;  2HW3 A;  2FBT A;  1IKY A;  4N41 A;  1LWC A;  1RBV A;  4CJE A;  5DK5 A;  3OYH A;  2YNH A;  1RT1 A;  1S9E A;  1FKO A;  5J2M A;  4J2B A;  4N47 A;  4BWJ A;  3BDP A;  4NYF A;  3ISN C;  1F21 A;  3U3G A;  3VQ9 A;  1CZB A;  4CK2 A;  1NKC A;  1U47 A;  4YFU A;  4FM1 A;  1IKW A;  3HP6 A;  2A1R A;  2JGU A;  2Q3S A;  3V9X A;  4LY7 A;  3G10 A;  1VSD A;  4BE1 A;  4PY5 A;  1BL3 A;  1UA0 A;  4KHY A;  2G8F A;  3TR8 A;  4W5R A;  1S1V A;  1KFS A;  2G8H A;  2X74 A;  1RT3 A;  1A5W A;  4LH4 A;  5D3G A;  1TGO A;  2FBV A;  4Z0U A;  1U4B A;  4CJP A;  3NF6 A;  1C1C A;  3EYZ A;  2OA8 A;  1C1B A;  4RW9 A;  3LWL A;  3T19 A;  4YNQ A;  3OYM A;  1TKT A;  3WNE A;  1HQE A;  1NJZ A;  4FM2 A;  3OYJ A;  1RT7 A;  1S1T A;  3AO5 A;  3MED A;  4CEE A;  4M3T A;  4CJF A;  1RDD A;  3VQ4 A;  3DOK A;  4FLZ A;  3OS2 A;  3TAQ A;  4B9U A;  4CFD A;  5HRP A;  1B9F A;  4HUG A;  3DM2 A;  3AO1 A;  3PX0 A;  1VSL A;  3TAE A;  3KLE A;  1SUQ A;  2ZQB A;  4F4K A;  3C95 A;  4CGD A;  3PY8 A;  4CGH A;  4BE0 A;  1LW2 A;  4OKJ A;  1TK0 A;  4NCG A;  3V9U A;  3AVH A;  3RR8 A;  4FZZ A;  1TV6 A;  2P5G A;  4KAZ A;  2G8I A;  4FCY A;  2KZM A;  3QET A;  2Z1J A;  5HRS A;  4CE9 A;  3OYI A;  2X6S A;  4CJS A;  1FK9 A;  4F8R A;  2HHQ A;  3TAP A;  4W5Q A;  2F8T A;  4M3Z A;  4FXD A;  4O0I A;  3SCX A;  5KRT A;  3V1O A;  3SYZ A;  3NDK A;  4FZX C;  3QO9 A;  5DMR A;  1JLB A;  4FJ5 A;  2QKK A;  1ZBF A;  2GBZ A;  1VK0 A;  3ASM A;  1Y97 A;  3KKR A;  3VQB A;  3SPZ A;  3NBP A;  1RIL A;  2HVH A;  4E7J A;  4RG8 A;  3PO4 A;  4OGE A;  4JRQ A;  3NF9 A;  2E4L A;  3I0R A;  4GVM A;  3TAG A;  5KI6 A;  3KLF A;  4KHN A;  2KQ2 A;  3MXJ A;  4CJT A;  3OYK A;  2G8U A;  4DTO A;  4M3U A;  1S6Q A;  3O3H A;  1RDB A;  4DS5 A;  3HYF A;  1T05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...