1TL3A

Crystal structure of hiv-1 reverse transcriptase in complex with gw450557
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 147
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tl3A05
1YTUA 3AO4A 2AX1A 2HVHA 4CJLA 2WOMB 3V1OA 4CJKA 4E19A 4W5RA 1L5UA 4RW7B 1R0AA 5KFCA 4J9SA 1U09A 3SUPA 4B9TA 5KFJA 4ZHRB 2O4IA 2Z1GA 4KKOB 2HNYB 3MEGB 4CK2A 2PYJA 1GOBA 2UVRA 3NF7A 2XCPA 3O4NA 1YVUA 5FRNA 2IM2A 1N5YA 3I0SB 5EDWA 2DFEA 1BI4A 4ECTA 4ICLA 2VWJA 4ID5A 4KV8A 3LP2B 1HRHA 2FLLA 4PQUB 3RB6A 1VSHA 2AGOA 2YKNA 5KGWA 1W25A 5EWEA 3DMJB 4DTSA 4WZQA 4UQGA 3TVKA 1RT3B 5KFLA 4O0IA 4K4XA 1EETA 4FJ9A 3V6HA 1ASWA 3OS2A 4PUOA 4HVJA 4BWMA 1VSDA 4OGCA 3FFIB 1T03A 1KTQA 1TAQA 4CGHA 1RYSA 4OVLA 4NRTA 5D3GB 4URQU 3V81B 2IC3B 4IRCA 3DM2B 4H54A 4Y1CA 3MF5A 1EKEA 2VG6B 1EX4A 4CE9A 4ED2A 1O1WA 3GV7B 4ECQA 1QSYA 1NK0A 3NGIA 2BE2A 1RTJB 4KO0A 4ZP6A 1N6QA 1WAJA 1TV6B 4I2PA 3HPOA 4Y2CA 1KFSA 5KFUA 4FCYA 3KLEA 2C2DA 3RMBA 2HWIA 1HARA 2ATLA 4LQ9A 2RDJA 4I2QA 3CFRA 5CYMB 4RW9B 2YKMB 4NRUA 2W7OA 4Z4IA 1KVCA 1S49A 4FZYA 4K50A 5KFVA 1S9EB 4KTWA 4NCGA 5J2MA 3VQ8A 3SQ2A 1JLGA 3NAHA 1SKSA 1TP7A 1S1UB 1RT7B 2FLNA 1JLCB 4FLTA 3UPFA 1RT6A 2WTFA 4OJRA 1TL3A 1NK7A 3QEWA 4DSKA 3SPYA 3KJVA 3G10A 3L2UA 2D0BA 5KG7A 1UAXA 4CECA 2D0CA 3PUFA 3EPGA 1RCHA 1Q9YA 4O3NA 3WNEA 1BQNB 1RT2A 1Z4UA 3U3GA 2GUIA 3EZUA 1TL1A 4FJXA 3AV9A 4Z4GA 4QWCA 3ZSOA 1VSJA 3DRRB 4DU1A 4CIGA 1B9DA 4CEBA 3HP9A 1DTTB 1HQUB 5KFSA 2FBXA 1JXBA 3ISND 4CJQA 4F50A 1L3VA 4KAZA 2BR0A 4DTUA 3PX0A 3DI6B 3H5YA 3NF8A 3CJ3A 4CFAA 3M8RA 4K8XA 2WOMA 3T3FA 2ALZA 1FK9B 2HB5A 1IKVB 4R8UB 4RW7A 4DTXA 3CG7A 3TAGA 3N6NA 1RBRA 1XR5A 4FBUA 3VQ5A 2V4QA 2FC0A 1NOYA 5EWGA 4ZHRA 4KI4A 4KKOA 3O4QA 4TXSA 2HNYA 4FJNA 3MEGA 4CF1A 5KFXA 3RB0A 2QKBA 4RU9A 2DPJA 1WLJA 3D45A 4HUEA 3OYFA 2R2RA 3EYZA 3I0SA 4ED1A 3SPZA 4BE0A 1UA1A 3LP2A 3L2RA 5KG5A 4PQUA 2GV9A 3RB4A 3FSIA 4DLGA 5DG9A 5C25B 1XR6A 3C6TB 3BR9A 3DMJA 5FROA 1RT3A 2XHBA 5KFTA 3DLKB 4IR9A 4OPJA 4IFVB 1WSGA 1SH2A 1W9HA 4WFXA 3VA0A 4QW9A 3AVJA 1ZTWA 1S10A 3FFIA 1QAIA 4NLGA 3T5LA 1NK8A 4ED6A 3BSCA 1ITGA 2KTQA 4JLHA 2I5JB 5D3GA 5KFDA 3K58A 3V81A 4PY5A 2IC3A 3DM2A 4TQRA 3LWMA 1S0OA 1TGOA 4GW6A 4C8OA 2VG6A 5I3UB 4AHRA 2R2UA 2HHXA 4ZP9A 3VQ4A 2UVUA 4EBDA 4FXDA 5KT3A 4O3RA 3CJ4A 1ZBLA 4O3SA 5HP1B 2QE5A 4DSFA 1RTJA 4WFYA 3SYZA 4URGA 4Q8FA 1TV6A 1SH3A 4IQXA 5KG6A 4FJ5A 4CJ4A 4BE1A 2E9ZA 2G8HA 5CYMA 3CO9A 4RW9A 2YKMA 4N5SA 5F8IA 3PR4A 4M3TA 1S9EA 1EP4B 3RMCA 1X1PA 5E41A 4DQQA 4M3ZA 4JV0A 2D3UA 1S1UA 1RT7A 3QETA 1JLCA 2V0NA 1QQCA 4B08A 3QINA 2VG5B 2IMWP 3CJ0A 3IN5A 4E1NA 4Z4EA 5DGAA 5CZ2A 3NAIA 3AVIA 1YVFA 3OSPA 3HXMA 2ETJA 1LAVA 3M8SA 2FBYA 4C8KA 3OYLA 4J2AA 2HNZB 4FW2A 1HYVA 4KAIA 1BQNA 4EBCA 4F3TA 4WE1B 3SFGA 4FJ7A 5C5JA 5KFAA 3OYAA 3IGVA 3TWHA 3DRRA 3PO4A 1HNVB 3LALA 1DTTA 1WSEA 4FLZA 3K5NA 3DI6A 3PHEA 3AA5X 4OGEA 3OL8A 1CSJA 4RNFA 3H5SA 1FK9A 2G8WA 4O44B 2FVSA 1IKVA 4DTOA 4R8UA 3BDPA 4DWIA 2CKWA 3K59A 1YT3A 1IG9A 4LSNB 4EO6A 3I5AA 4DTJA 3NGYA 2G8IA 2XI3A 4WXOA 4WFZA 4CJUA 5SWMA 4ED3A 3OL6A 5KFPA 3VQEA 2YNHB 4CJRA 3H2LA 4QWEA 2FJXA 2IBKA 4FK0A 1SKRA 4CHNA 1WSJA 2Y1IA 3G6XA 2G8UA 3RMAA 2JGUA 4O55A 2WCXA 3BQ2A 5KFKA 4OPKA 4J2DA 5C25A 2UUWA 3PW4A 3C6TA 1J53A 2ILZA 2BRKA 3FRZA 3DLKA 3TAMB 4W5OA 4IFVA 4CGJA 3LP0B 3F73A 3ISNC 2DY4A 3OJUA 1BQMB 3NBPB 4YFUA 4KFBB 2I5JA 4KI6A 3SFUA 3L2QA 1L3UA 4AH9A 4ZVFA 3VQ9A 3HVTA 3E51A 2WRMA 2OH2A 4QWDA 3K5LA 5I3UA 1GOCA 1S9FA 4GMJB 1XWLA 1U4BA 4EYHB 3S9HA 3ZSYA 3Q8PB 4YNQA 1JIHA 3ULDA 3KLIB 4NLRA 4J9PA 5HP1A 3NH0A 1L3SA 5L9XA 3NF6A 5KFGA 1HYZA 4K4TA 5K14B 4AHSA 5DQHA 2XRIA 1NK6A 4FLXA 4YP3A 5DK5A 4OLAA 2HNDB 5HROB 1A5VA 1EP4A 3KLFB 1B9FA 5KFWA 3LZIA 4O4GB 3HHKA 4L8RB 3QESA 2KZMA 1FKOB 3CDWA 1ZETA 4O5BA 5HBMB 2FBTA 2VG5A 2B6AA 5KFFA 2HWHA 5DQGA 2X6SA 4TY9A 5J2NB 4Y2AA 3NGDA 3GYNA 2QK9A 3UIQA 2HNZA 1BIZA 3M8PB 1XC9A 2VWKA 4FK2A 4WE1A 3HYFA 4RNOA 3PY8A 5F8GA 4B3OB 2AJQA 4IH5A 1UWBB 4JS5A 1HNVA 3VQCA 3MXIA 4K4YA 2C2RA 2ATQA 3MFHA 3I0RB 1D5AA 1BL3A 1S6QB 2VA3A 2ZKUA 3GIIA 1JLFB 4CEOA 3RRHA 4ED0A 2FVQA 2AX0A 1RTDB 2I1RA 1VK0A 4O44A 1ZYQA 4LSNA 4MIBA 3SQ1A 1FKPB 4CJVA 5DLGA 3PW5A 3PJXA 2YNHA 3QEIA 4MK8A 1D9FA 2A1RA 3LAKA 4B9UA 3GIKA 5KT7A 3OHAA 4HUFA 3OY9A 4TY8B 4E7JA 1RYRA 1Y97A 3DRPB 4W5NA 4ELTA 4DFPA 3ZSZA 3V9WA 5CYQB 2A1SA 3TAMA 4NLDA 4RZRA 4MKAA 3CWJA 3LP0A 5KTQA 2FVCA 3M8QB 4CHZA 2HW3A 4FZZA 1BQMA 3NBPA 4M3RA 2XI2A 4KFBA 2BQUA 1JL2A 3VQBA 1JL1A 5KG3A 4EP5A 3DLHA 2RF2B 5KI6A 3SQ4A 5HRSA 3BQ0A 3MAQA 2IA6A 2P51A 4E89A 4HHTA 3AVKA 1JLQB 2KW4A 4ZPBA 5KFZA 2PY5A 4RW6B 2YHBA 4C8NA 2RKIB 3QEPA 3KLIA 4RUCA 2AGQA 2HMIB 4IKAA 2XY8A 1LV5A 4DL7A 1NJXA 2HAIA 4CGIA 4ID1A 4FJJA 3K5MA 5K14A 1LW0B 3DDKA 1VSFA 4B9MA 2IJNA 4F4ZA 3WNFA 1D0EA 4J9NA 2HNDA 3IG1B 2GC8A 5KG4A 4J2BA 1VRTB 4NLVA 1ASVA 3D28A 3HM9A 3NHGA 5HROA 3KLFA 2XY5A 4KB1A 3L8BA 4O4GA 4F8RA 1FKOA 5HRRA 4O3PA 4JS4A 5HBMA 1SKWA 3GQCA 3PO5A 2FLPA 4MKBA 4DS5A 4FS1A 3AVMA 5KFNA 4LY7A 5J2NA 5DGBA 1Z26A 1IH7A 1DTQB 4RUAA 3KHHA 1TK8A 3HPHA 1LW2B 1RDRA 1QHTA 3HVWA 3M8PA 3H4DA 1I39A 2IGIA 4M41A 1SL1A 1VSMA 3LANA 3RRGA 3HVAA 4Y1DA 3OSNA 4E7KA 3OYKA 4B3OA 1S5JA 4QPXA 2NUBA 4FM1A 4Q5VA 5F8LA 1UWBA 4CIEA 3QGIA 4IRDA 2AGPA 3I0RA 1S6QA 3TAPA 3NFAA 1JLFA 5EU7A 4E3SA 4O0JA 4U7CA 2UUTA 1IKYB 1RTDA 1XR7A 4FBTA 3LAMA 4CJ5A 3U3YA 4EYIB 3AVAA 3MEDB 3OLBA 4CEQA 1U49A 4RW8B 3TARA 4C8MA 2YV0X 1FKPA 3HP6A 2Q3SA 2HHUA 5KT6A 3ZT1A 2BGGA 4BDZA 2JEFA 3V9SA 5KRTA 3FDSA 4F4WA 3AO5A 4AHVA 4NCAA 3QNNA 4IRKA 3GV8B 5F9NA 4AILC 1S1VB 3BREA 4K4ZA 2Z1JA 3V9UA 3DLGB 4OKKA 4TY8A 3DLEB 3FQKA 5KFRA 1CZ9A 1D8YA 1DLOB 3DRPA 3UR0A 3RR8A 2EHGA 5J2QB 3SUQA 1ASUA 5CYQA 3N6MA 4J9MA 3KHGA 2Z1IA 3M9NB 3M8QA 3SQ0A 3HT3A 4CFBA 2E9TA 1G15A 3K57A 1IM4A 1BCMA 2R7YA 2W9BB 4IG0B 2IJFA 2GIRA 4ZP8A 3V1RA 1S6PB 4DSIA 2FVRA 4O3OA 1NK9A 2RF2A 1J54A 5L1JA 3QO9B 4NLPA 2J6UA 4U6PA 3CJ2A 1JLQA 1RT4B 1S48A 4F4YA 1C2PA 1TKZB 4RW6A 1S4FA 4CGGA 2RKIA 4IH6A 2XC9A 3OJSA 2R8IA 1RTIB 4JRPA 2HMIA 1ZBUA 3NE6A 2QXFA 3H08A 2JEJA 1LW0A 3CM5A 4ECXA 4Z4FA 1C0TB 3S3OA 1MU2B 4LH4A 4E7HA 3VQDA 3OYDA 3KK1B 4NLTA 2J6TA 3IG1A 4FLWA 3MTKA 3ITHB 4KTQA 4CF0A 3UDLA 1VRTA 1HNIB 4CJPA 1K1SA 1RILA 2W9CB 1N4LA 3VQSA 3KK2B 5DG8A 1IO2A 3ZT2A 4CHQA 2W42A 1TKTB 4ZPDA 4URSA 1QTMA 1RDDA 1RBSA 4HUGA 3OYBA 4DF4A 2ASJA 3CFPA 1RA6A 4DQIA 4N41A 5F8NA 4DFMA 3TANA 4KHYA 1NKCA 1U47A 1DTQA 4RW4B 1LW2A 5L1KA 3VA3A 3KK3B 4NLSA 3ZSXA 1TK0A 1EXQA 2E4LA 2EX3A 3B6OA 1W0HA 4GC6A 1NKEA 3V6KA 3RAXA 3LDSA 2JLEA 2FBVA 1J9AA 4F4XA 4CCHA 2W8KA 4H4MB 2XO7A 3AVNA 4ECRA 3Q8SB 5KFEA 4K4VA 2JEGA 1LWCB 1IKYA 1Q9XA 2OPSB 3MEDA 3N6LA 1RDCA 2ZD1B 1RDBA 3G0ZA 4RW8A 4Q44A 4HTUA 3TAFA 2J6SA 3AVBA 4DFKA 4FS2A 4CJFA 3OYHA 4DQSA 3TAEA 1JLEB 2FJVA 3O3HA 3EPIA 3RB3A 3OHBA 1REVB 4XPCA 3QLHB 3NKYA 1S0NA 3LPTA 5JS1A 1S9GB 1S1VA 3OYJA 1C0MA 4E7IA 1HQUA 3DLGA 5KG1A 1KFDA 3K5OA 4QWBA 3DLEA 4ZTFA 3V6DB 1DLOA 4ZPCA 4XIUA 3T5JA 3C6UB 5L1IA 3KHLA 5J2QA 3KIOA 1RTHB 1SL0A 3HJFA 5JUMA 2OPPB 1NJZA 3KLHB 4CFDA 5KFMA 3H4BA 4CHOA 3PJWA 4H4OB 4F3OA 1WSHA 4CJ3A 3LZJA 3DRSB 2OA8A 2R2TA 3NH1A 3P1GA 4Q43A 4DL3A 4ZMMA 3BJYA 2IAJB 5KFHA 4IH7A 2W9BA 4FVMA 4IG0A 4NZ0A 2GBZA 5EUHA 1U45A 3NH2A 1S6PA 5J2PB 3DLBA 4CEFA 4NLXA 1VSLA 4YR0A 3HVRA 1Z25A 1C1BB 4BWJA 4CK1A 3QO9A 1D1UA 1RT5B 3CYMA 3VQPA 3KD1E 1RT4A 1X9WA 2ASLA 4RNNA 1TKZA 3KMSA 2HHQA 3E01B 3KKSA 4CJSA 1X9MA 3RAQA 1RTIA 2RDIA 4FLUA 3RTVA 3ZT4A 2KZZA 1TKDA 2P5OA 3AVFA 5JXSA 3LPUA 1C0TA 4MK9A 3NCIA 2X6NA 4CEEA 3M9OB 1MU2A 4AHTA 2ITGA 1NK4A 1ZTTA 3KK1A 1BCOA 3NDKA 3ITHA 2P1JA 4I9LA 4KREA 1HNIA 4DEZA 4I9QA 1GX5A 2W9CA 4Q45A 3KK2A 1NJYA 2XY6A 5KT2A 2W7PA 3HSTB 4ZP7A 1TKTA 2AQ4A 3OL9A 4QCLA 5FRMA 3FQLA 4RNHA 3QERA 1KHVA 2R8JA 3EZ5A 4Y3CA 3MXMA 3OYMA 2P5GA 1X9SA 3ALYA 3PW0A 1QUVA 4GVMA 4RW4A 3VQ7A 5T14A 3H98A 3KK3A 4QAGA 2C28A 2IM3A 4IOBA 4DQPA 3OYCA 1RAJA 3CM6A 4FLYA 1KSPA 4NCBA 4H4MA 4LD0A 2WK4A 4NLQA 2LSNA 1U04A 4HYKA 4CESA 4PWDB 1LWCA 3ZSQA 1UA0A 4CFCA 2OPSA 4IDKB 4KB7A 2B5JB 2ZD1A 2V9WA 5J1EB 1WNSA 3C94A 4CEZA 4EP4A 1WSFA 1K6YA 1RNHA 1JLEA 2R2SA 1TK5A 2HHWA 3SZ2A 5KG0A 2KFNA 4ED8A 1GX6A 2ZQBA 1REVA 3OYGA 4ECVA 3QLHA 1BGXT 3ASMA 4JV1A 1S9GA 3A2FA 3PW2A 3OVNA 3CJ5A 1T7PA 1RBUA 2DPIA 2YNFB 4ECWA 3V6DA 4DTRA 3H5XA 3C6UA 3MECB 3I5CA 3BQ1A 1RTHA 1XHZA 2OPQB 4DQRA 4DF8A 2OPPA 1JXLA 3KLHA 1S1WB 1HYSB 2HHVA 2F8SA 4KRFA 3DOKB 3L3VA 4DU4A 4H4OA 3NF9A 2PZSA 3L2VA 4E7LA 3DRSA 1WNEA 4MH8A 2UVWA 3HK2A 2Y1JA 3LWLA 2WONB 4KTZA 2IS3A 3GV5B 2IAJA 2CJQA 4KHQA 3SUNA 2HVIA 4J9QA 4KE5A 5C42B 5J2PA 2HHSA 2HHTA 2WHOA 1C1BA 4OLBA 2YNIB 2E9RX 2XGQA 1HPZB 1HMVB 2IDOA 3RMDA 2YNGB 4CEAA 1RT5A 4WYLA 2ILYA 4R0EA 3E01A 2BQ3A 5KFBA 1JLAB 3JYTB 4CF2A 3AVGA 4Q8EA 4DSEA 1BHLA 4ZVHA 1T3NA 4CERA 3DLRA 4QWAA 4GC7A 4M95A 1CXQA 4ED7A 2G8FA 3KTQA 3H40A 4DU3A 2F8EX 3SI8A 2B4JA 3PX6A 4B8CA 3O3FA 2O4GA 3GILA 3G86A 1I6JA 3CDEA 3CDUA 4DSLA 4N76A 3AO2A 4F4KA 4NLUA 2XY7A 1L3TA 3LP1B 2DTUA 4YR3A 4KHRA 4TN2A 4CJEA 2C2EA 5HRNA 3GIJA 3Q8RB 1QSSA 1F21A 3T19A 5KFYA 3SJJA 2XCAA 4O3QA 4E0DA 3O3GA 1BISA 4CHYA 4M3WA 2BRLA 3SI6A 1C1CB 3NL0A 4PWDA 4FJIA 4G3IA 3MR3A 2DFFA 2OPRB 1JLBB 4IDKA 4ECSA 1ZBFA 4Z4HA 3QIOA 2BANB 2B5JA 1SL2A 5J1EA 4DL6A 3QIPB 1IKWB 3H59A 5EWFA 2D5RA 3IGNA 4JV2A 4ZPAA 4J9OA 3ICLA 3KLVA 1C6VA 3T1AA 3LP3A 1LWEB 2YNFA 5KRSA 2OZMA 4B9VA 3D0PA 1SV5B 3MECA 4TSXA 4LSLB 3UQSA 2OPQA 3RBEA 4FK4A 4B9LA 1S1WA 2E6LA 2V4RA 1S97A 3OS0A 1HYSA 2BQRA 4KHWA 4KHSA 3DOKA 1HQEB 3WNHA 5F8JA 2VG7B 1KRPA 3MFIA 3BGRB 1S1TB 4O4RA 3SV4A 2WONA 4B9NA 3THVA 2G8KA 4M3YA 1ZBIA 1QE1B 4NLOA 5C42A 1SUQB 1RT1B 2YNIA 1FXXA 5DMRA 3QGGA 1HPZA 1HMVA 4YR2A 4FZXC 3QZ7A 5CZ1A 2YNGA 3S3MA 1UOCA 4KHNA 1KCFA 3SV3A 4KBIA 2KQ2A 3MXJA 4DMNA 4FJHA 1WAFA 1KVAA 4F2RA 5L1LA 4J2EA 3EY1A 4Z0UA 4KHUA 1JLAA 3JYTA 4MQ3A 5DG7A 1NNDA 5KG2A 4LQ3A 3JSMB 3I5BA 3AVLA 2OZSA 3K2PA 2R8GA 1NJWA 4M94A 5HLFB 2KFZA 2JC0A 4J9RA 3SUOA 3QNOA 1S1XB 3QZ8A 3U6FA 2E6MA 4I7FB 4OKJA 3KKRA 5C24B 3OLAA 4Q0BB 2R8HA 2VA2A 1C1AA 4K4UA 4CJTA 1CXUA 3ZSRA 2RN2A 3BSOA 4J9LA 4DTPA 1OS5A 2AWZA 4WZMA 3LP1A 4C8LA 4B8AB 1JKHB 2IM1A 4DL5A 4OL8A 2ZE2B 4DTMA 4XO0A 3TI0A 1WSIA 2UVVA 4EBEA 2D3ZA 1KLMB 2RPIA 3CFOA 4NYNA 2IOCA 3NAEA 4J9KA 4CK3A 3KD5E 4NLYA 1U48A 3G6YA 1C1CA 5KFOA 4TYAA 3TR8A 4IFYB 4ZVEA 3IS9B 3AO1A 2JC1A 2OPRA 1JLBA 3AA3A 2BANA 4ZVGA 4BDYA 4DL4A 3QIPA 3F9KA 5SZTA 1IKWA 4FW1A 3HVTB 4YQWA 5KFQA 3HPGA 5KFIA 5F8HA 3B6PA 3OL7A 2QV6A 1LWEA 3OS1A 4CF8A 4HCCA 2YHAA 1MMLA 1TAUA 3ZT3A 3OYIA 4DLEA 3L3UA 3KHRA 1VSIA 3L2WA 2BDPA 4ZTJA 4IG3B 3T5HA 1SV5A 2AU0A 4HCBA 2DFHA 4ECYA 1IKXB 4BE2A 4CIFA 4LSLA 4MIAA 1GOAA 2QKKA 1QS4A 1LWFB 3PW7A 1HQEA 3BSNA 4WYWA 2VG7A 2B43A 3BGRA 1S1TA 4EEYA 4R5PB 4W5QA 5KGXA 1C0UB 2PYLA 4PA1A 5F9LA 4CF9A 4F2SA 1QE1A 2B6AB 1K1QA 4DG1B 1SUQA 4KB0A 3P83D 1I3AA 4LH5A 1RT1A 4FJ8A 4HKQA 1NHUA 1HJRA 4FM2A 1NK5A 4YMEA 3KLGB 3P5JA 4FJKA 4KSEB 4OKEA 2D41A 3VQAA 4G1QB 4TQSA 4RNMA 4KPYA 5I42B 1XI1A 4DS4A 3DOLB 2XWYA 3JSMA 1NKBA 5FDLB 1T05B 4K8ZA 4AHUA 3TQ1A 4ELVA 4ECUA 1TVRB 1T94A 2GIQA 5HLFA 3S3NA 4JUZA 3V4IB 1Q8IA 1S1XA 4I7FA 2X78A 3HKWA 5C24A 4Q0BA 1VRUB 2W9AA 1A5XA 3MEEB 4FYDA 4MFBB 4IBNA 4AHCA 4CGFA 3IRXB 4CJWA 3VN5A 4JRQA 2WB4A 4XPEA 5DLFA 1JXEA 1J5OB 3DYAB 3KMQA 3GIMA 3NMAA 3PVXA 1YTAA 1JX4A 1CZBA 2C22A 1S0MA 4BACA 1JKHA 1TKXB 2EC0A 1XHXA 1CLQA 3SCXA 3D5MA 2ZE2A 3KOAA 3ZSWA 4DFJA 3AVHA 2W8LA 1KLMA 2D7SA 3RWUA 3AVCA 3IAYA 3T5KA 1SH0A 1R0AB 2JEIA 3ZT0A 4EZ6A 3AA2A 3AA4A 4M3XA 4ECZA 4IFYA 4N47A 3QEVA 3IS9A 1RBVA 5HRPA 1RA7A 3WNGA 4M45A 4ELUA 3MR2A 1N5YB 2G8VA 4NYFA 3HO1A 1N56A 4IR1A 1BI4B 4Y34A 3CVKA 4WXWA 4ICLB 3TABA 1VSKA 2FJWA 4ID5B 4KV8B 3C95A 3MR5A 3ZCMA 3ZSVA 2YKNB 3OYEA 1T8EA 4Z4CA 4DTNA 3MR6A 5CY4A 1NOZA 1QSLA 2ASDA 2Z1HA 1EETB 3PX4A 4PUOB 4TYBA 3NGZA 4QOZB 3QIDA 4IG3A 4FJMA 1N48A 1KHWA 1T03B 1IKXA 3V9ZA 4W5TA 5DQIA 3I8DA 3RBDA 1LWFA 4FJGA 3CQ8A 4BDPA 4DL2A 3VQ6A 4NLWA 4N56A 4IKFA 4TLRA 4R5PA 4K4SA 1C0UA 1QAJA 2IM0A 2R8KA 2D0AA 4EZ9A 2X74A 4MK7A 4DG1A 4QW8A 3HL8A 3Q8QB 3QYYA 3CIZA 1VSEA 3PV8A 4RG8A 2BE2B 4KO0B 3PR5B 1N6QB 3KLGA 4I2PB 3M9MB 3V6JA 3AO3A 3KLEB 3V1QA 1WN7A 3RR7A 3BSAA 2OYQA 4EO8A 4E1MA 4I2QB 3H5UA 5KT4A 3KNAA 1BIUA 4G1QA 3TAQA 1NHVA 3VQQA 4CHPA 5I42A 4NCGB 5J2MB 3SNNA 3OYNA 3DOLA 1JLGB 5F8MA 3QEXA 1TQLA 1KLNA 5FDLA 1T05A 4H8KA 1KVBA 4CEDA 1ZBHA 1D9DA 1TVRA 1RT6B 4NYZA 1TL3B 2F96A 2XGPA 3KJVB 5T7BA 3V4IA 3QGHA 4FLVA 4KHMA 4FM0A 3G6VA 5KT5A 4M3UA 4DSJA 4M42A 1VRUA 3MEEA 3V9XA 4MFBA 1RDAA 5JS2A 3IRXA 1RT2B 4FJLA 4K4WA 2FVPA 1TL1B 1J5OA 1LAWA 3DYAA 4B9SA 2F8TA 1TKXA 4X2BA 1B92A 3PZPA 4CGDA 2O5DA 1RBTA 1A5WA
chains in the Genus database with same CATH superfamily
3TEHB 1YTUA 2W4CA 2WOMB 4JBCA 2DGUA 4CJKA 5I4MA 4CRJA 2AKWB 2WW4A 1JNRB 5E26A 2DNRA 4DPWA 4PQAA 5KFJA 4LF8F 4ZPWR 4CK2A 5HOOA 4DV6K 5FRNA 2P8IA 1MLAA 4I1TA 2OANA 2HRYA 3D6MB 4MKYA 4FWNA 3R7BB 3Q8VA 5EDWA 2DFEA 1BI4A 1HWUA 1ELOA 3K2YA 4ECTA 3IC1A 2JWKA 5HK4A 2W2OP 4ID5A 3LP2B 1DZ5A 2VC1A 1UKUA 5JMNA 4DR2K 2RUSA 4C0HA 3GBTA 2ACMA 2VQEK 4YORA 3IR7B 3TVKA 2Y8YA 5KFLA 2R9LA 4K4XA 4CO1A 4JKAA 1VSDA 5IWAF 4QU6A 3CJQA 2CYYA 1RAIB 1VK8A 3I4PA 1PC4A 3O8MA 3VESA 1RYSA 1SI9A 4NRTA 1VLYA 4DX7A 2A42A 3U9ZA 2IC3B 2ZC3A 2VG6B 4DHVA 5HMYA 3KG1A 2D69A 3THPA 5GIPA 1NU4A 2BE2A 1RTJB 4I2PA 4ES1A 2FSKA 3HPOA 5D8HB 4C7QA 2VGMA 5AXNA 4FCYA 1TUYA 2COLA 2HWIA 1HARA 2RDJA 3IBCB 5ITHA 4I2QA 5CYMB 4NRUA 4NOHA 2KU7A 3ZX3A 3AA9A 2P5VA 4B3RF 1S9EB 4NCGA 2ZZMA 1JLGA 4UOHA 4XH5A 4KGXB 2FLNA 2R7UA 4FLTA 4CYUB 4OJRA 4KHPF 4YOXA 3SPYA 2HVZA 1VQKS 3O1LA 3G10A 1A7GE 2CAJA 3ILIA 3LPEA 1REGX 4MIWA 2XMKA 5LSLA 5E2QA 2GQCA 1U02A 3U3GA 2UXBJ 3D2FA 4LF4F 3EZUA 2RHQB 4NZ6A 1WOOA 4EWTA 2ZOGA 1VSJA 4CIGA 2WC9A 5FJ4A 5F3TA 1Z2ZA 3ISND 1L3VA 5F0XA 1NSAA 2BR0A 3PX0A 3N9UC 3A5OC 3CJ3A 4CFAA 1IJJA 1RU1A 1FK9B 3WEEB 4R8UB 2BYCA 4DTXA 1V4SA 1IBMJ 1NOYA 4ZHRA 4KKOA 3O4QA 4TXSA 2HNYA 3UNYA 3MEGA 4WFAQ 1QTNB 3BYPA 3GCXP 3RB0A 3W9IA 3D45A 4HUEA 3OYFA 1Q0NA 2R2RA 3ZTQA 3JSRA 4U9RA 3EYZA 3I0SA 4ED1A 1HWLA 4L3NA 2RSQA 3J7ZT 1G2EA 5LJ5Y 4MKVA 3MM5B 5KG5A 1UVLA 5A8WB 3FSIA 4DLGA 4IZ9A 4P72A 5C25B 3CETA 3C6TB 5ETMA 5FROA 1FVSA 1RT3A 2ZZNA 5BR9A 2JX2A 2D1KA 1U1QA 4IFVB 1WSGA 3M7VA 3WBZA 4WFXA 1SQFA 2VOPA 4QW9A 3AVJA 1S10A 2WZ1A 2XZTB 1Q86O 3FFIA 1QAIA 1LK7A 3CCJS 4NLGA 2J7KA 1ITGA 1YVNA 1SB6A 4JLHA 5D3GA 3K58A 1FX4A 2QYCA 3T1YJ 3ENWA 2QYGA 4C8OA 1B3TA 2HBZB 5MLCQ 3OR1B 3O9SA 2SXLA 5AQUA 4AHRA 3AFGA 1VQNN 3P31A 2UVUA 1HBUB 2E1PA 4PHTX 1Y9OA 4JKEA 4O3SA 5HP1B 2QE5A 4WFYA 4URGA 1TV6A 4X62J 3MM6B 4IQXA 5KG6A 4FJ5A 4WP9A 4JV5F 3LW5C 3J80O 4CJ4A 3A1YG 2KO1A 2YPZA 4YS2A 2E9ZA 3CO9A 3PR4A 4X66J 1YSJA 4JI7J 4C3KA 1WJ9A 1EP4B 3RMCA 4M3ZA 3GG0A 5E41A 3W64A 4JV0A 4P2MA 3O1BA 4X4RA 3WHIA 4LFCF 3P3DA 3CJ0A 5D4PA 2NZ4A 1YVFA 3EE9A 3OYLA 3CDBA 1WHYA 1HYVA 3CJTA 4KAIA 3Q2SC 1M90T 1BQNA 2IVOA 4EBCA 4MMOA 2G2OA 1Q8BA 5KFAA 3OYAA 3IGVA 3DRRA 1WC3A 2OFGX 2OUGA 4HHJA 1HNVB 1LKZA 5F0WA 4FLZA 1MROB 1QAYA 3ZZUA 3A3NB 3AARA 4DR1F 4WWSA 5AXKA 1NMDA 4KQZA 2K1RA 3PHEA 3DGVA 2VQFK 1DURA 1IR1A 2G8WA 2VC0A 4HTIA 2Z4PA 2CKWA 2FJBB 4LSNB 2VOOA 3I5AA 1BG3A 4DV5F 4BRGA 4PXBA 3QBWA 4ED3A 4FNHA 1S0VA 3OL6A 5KFPA 4I6AA 3J8AA 1KEKA 1MW7A 3GP9A 3J7ZO 2IBKA 4LFAF 3C15B 1IVZA 1KD1T 2EKYA 3RMAA 4FWQA 2WCXA 4IO8A 3Q8YA 4OIXA 4FYYB 3FRZA 3D6HB 3DLKA 5IT9O 1FESA 4YY3K 4P2FA 4KT0C 3PLAA 2CGKA 4V19J 3F73A 2DNOA 3W61A 1D8ZA 4OFZA 4HDGA 1LFPA 1Y3KA 1BQXA 1PYOB 2E5LJ 4ER8A 1BQMB 3SQOP 3NBPB 3M32A 4C11B 2V2QA 3RAMA 1ZZFA 2YWWA 1VQ4N 3HVTA 3E51A 2MKSA 2WRMA 2YPYA 2OH2A 3K5LA 5I3UA 2EG2A 2LDIA 2CFXA 3BR8A 3S9HA 3ZSYA 4JOUA 3Q8PB 3CJ9A 2GQ2A 3ULDA 1KKHA 1O6XA 4OHWA 5KFGA 3AOBA 5I3PA 4K4TA 3JQMA 2P2CB 3CJKA 4MAKA 4YP3A 1U8WA 4OLAA 1QJHA 3AOCA 1YHQS 5HROB 4IO9L 2H51B 3CDWA 2IPOB 2VG5A 3CXCM 3LDOA 5KFFA 3BDEA 1Y3JA 4V1Ak 2KHCA 1OVQA 2LQBA 3GYNA 1NJIT 3UIQA 2AJ0A 6AT1B 3FGVA 2HNZA 1DKGD 1AFIA 2MPUA 1M90O 1BIZA 3M8PB 1XC9A 2HFNA 3R6LB 3AOAA 4WE1A 3HYFA 2V63A 4GNIA 5HVGA 3PY8A 3EZWA 2YH0A 4BG9A 3D66A 3PRDA 3TX8A 4ZKAA 3MXIA 2FPHX 3CC2S 4K4YA 2AJFE 3G25A 2VA3A 2ZKUA 2LLZA 2QTWA 4CEOA 4AL5A 3DXKB 1WD6A 2CJYB 3RRHA 3H3OB 4ED0A 2FVQA 1RTDB 4O44A 2QO3A 3W2VA 1ZYQA 1YRXA 4JKCA 3BS9A 4LR8A 3G6EN 4ZCIA 2U1AA 3OT9A 3GCWP 2Q1LA 2CVEA 1NDPA 3J7AP 2UXCF 5M1NA 1RHMB 2QLJB 4DX5A 3OHAA 4QS7A 2JHEA 1KD1O 1EWQA 1W26A 1BA1A 3MX2A 3LTOA 2CZVC 1UVJA 3WXKA 2YCHA 4USJC 2EWHA 5FD1A 5ETQA 3TAMA 1FWPA 4RZRA 2DVIA 2OMOA 2DR8A 5DDRC 2AP1A 2V5HG 4X4NA 3LF0A 3PG9A 4X4UA 4B3MF 4M3RA 4KFBA 1JL2A 2DD8S 3C66A 5T41A 2RF2B 3SQ4A 4NEYA 3VALA 3PIOQ 2M5YA 1ATRA 2Z2ZA 1KBRA 4E89A 1RCXB 3W5YA 4ZPBA 2PY5A 2KDOA 4JI2J 1U26A 2YHBA 2RKIB 4HI2A 3QEPA 4ZN3A 4OZ2A 3PIPL 2O8DA 2AGQA 5JMVA 1IUJA 4YDUC 4CGIA 3KHYA 1LW0B 3DDKA 4B9MA 5CD4A 3QFUA 2HNDA 3IG1B 4K5SA 1ASVA 4FWMA 1P1TA 3R2CJ 1OKJA 2XY5A 4KB1A 1Y0HA 4WKYA 1HKCA 3KK7A 2PDAA 2DO0A 3HMJG 4BRKA 4F8RA 1FKOA 4JS4A 2X3DA 5HBMA 4OX6A 1AFJA 3PO5A 4MKBA 4DS5A 5KFNA 5J2NA 2BH1A 4WF9L 2VL1A 3AA8A 4Y2KA 1NJIO 3ID8A 1ICEB 4BGBA 2J9DA 2XB2D 4LF8K 3PEJA 3KHHA 2HS0A 1QHTA 1I39A 3H4DA 1VISA 2OEMA 3FE1A 4B3RJ 3LANA 2E2OA 3K7RA 1DGKN 1DBDA 4Y0FA 3HVAA 4DV2F 4E7KA 4B3OA 3TTDA 2J7UA 2OCEA 5FPNA 3QGIA 2QIFA 1FJGJ 5L9NA 3PFEA 3BH6B 1F5CA 3NFAA 4G1IA 5EU7A 4U7CA 1U1RA 2UUTA 2CJAA 2BOAA 4KH4A 1FFGB 1E4GT 5LL6Z 4LF4J 4RW8B 3TARA 1KQKA 4C8MA 2VJVA 2YV0X 1NGJA 2XULA 3HP6A 1AB8A 2Q3SA 5IWAK 1VQ8N 4M5HA 2FGOA 4BDZA 3VF4A 5KRTA 4R25A 3FDSA 3MD1A 4FPBA 1UJ4A 3POTA 1WWHA 4AHVA 3KNGA 2A2CA 2IVPA 5F41A 5DRKA 3DLGB 4TY8A 3VZHA 1C0FA 4MLHA 4DCHA 1Q81T 1CZ9A 1V9OA 1K0VA 3UR0A 5J2QB 5AE2A 4CJ7A 2W41A 2DCUB 3I6PA 3M8QA 4LF5J 4CFBA 1Y4ZB 4A61A 4HVZA 1IM4A 4PXCA 1BCMA 2JFKA 5AQSA 2IJFA 2G2YA 5GADI 2YHXA 3HHDA 1YJNN 3TRGA 2X51A 1NSPA 4NLPA 4U6PA 2ZH4A 1JLQA 4KHPK 1C2PA 4RW6A 4CGGA 4IO9Q 4IH6A 1MWMA 2BTFA 4WKRA 2F63A 2XMJA 2KYXA 3NE6A 2QXFA 3H08A 1BC6A 4Z4FA 1MU2B 2GCFA 3QJLA 4LH4A 1Z1ZA 4B17A 5HSPA 2FIUA 3L0QA 3ITHB 4O0NA 4CF0A 4EK2A 3GJQB 2VWBA 3BP8A 2C1EB 2LQ5A 3ENVA 5LMNF 1FF2A 2W9CB 3EE8A 5DG8A 1CJVB 1GLJO 1B99A 4DV1F 1ULRA 4URSA 1QTMA 4HUGA 3P6YC 4FF2A 3D2EB 2H54B 1AUSL 3CFPA 3FBCA 1KP6A 2W40A 4X65F 1LOUA 4KHYA 1DTQA 3PRVA 3VA3A 3AH6A 2OKQA 4NLSA 3ZSXA 5ETLA 3K17A 3PACA 4AE5A 1TK0A 4JI8J 1EXQA 4EAHD 2EX3A 2C42A 2H9ZA 1W0HA 2OAUA 2RVJA 1NPKA 4CWBA 3Q8SB 2YWHA 1PYSB 4BBYA 3L3CA 4K4VA 3NRBA 2RU9A 1IKYA 2KI2A 3MEDA 2FSNA 2BEFA 3DCAA 3MGJA 1RDCA 1RDBA 2ERRA 2J6SA 5GADU 1RAHB 3TAEA 4EUVA 1JLEB 2FJVA 3O3HA 3IWXA 2X1GA 3UCGA 3BGFA 4XPCA 4LRBA 3VZIA 3QLHB 3CCUS 1S1VA 3KFWX 2RE2A 1MN9A 3K5PA 1Q81O 3V6DB 5LJVA 1DLOA 3T5JA 1R31A 3C6UB 3HRGA 4GY2B 4JKBA 2HHHF 1YI2N 2OPPB 1NJZA 3W65A 4LF9J 1TUGB 3V5RA 4E1JA 4H4OB 1UEKA 3LZJA 3SMZA 4JV5K 2EFQA 3PIPQ 2LXIA 3FSYA 4DL3A 2P9SB 2GVZB 2PAVA 3D0HE 5AQGA 4FVMA 4NZ0A 1S77D 5EUHA 1U45A 3QFWA 1K0TA 2RUGA 3HVRA 2AEMA 1CC8A 3QT6A 4BWJA 2GAHC 2AYEA 3DGPA 3BO3A 3KD1E 5ADXA 2XS7A 4LFCK 3R27A 2ASLA 1CJKA 1TKZA 3KMSA 2HHQA 2OEKA 4FKXA 1CVJA 3O9RA 3RAQA 1RTIA 2RDIA 1WBDA 1FXRA 1AW0A 3FSXA 1HBNB 2CDQA 4WF9Q 3VPZA 4MK9A 1UVMA 3B8AX 4CEEA 2RQCA 2P9NA 2ITGA 4I9LA 2P1JA 4A48A 4KREA 4DEZA 9RUBA 1S4EA 3TVYA 4DR1K 2J76E 2XY6A 1H72C 1S6OA 3O2IA 5KT2A 1T44A 3X1LB 3P38A 4QCLA 3VR1A 3OL9A 5FRMA 3M8ZA 4RNHA 3IO1A 5EN1A 3I82A 5H9EJ 5E0OA 2CQGA 2R8JA 1VQPN 1RAEB 3CMEN 2CPXA 1X0PA 1KXPA 1QUVA 2P9PA 4RUBA 4DV5K 4RW4A 3VQ7A 2IRYA 1N5VA 3PSIA 2PFUA 4QAGA 2O1PA 2X1FA 1YUWA 1HLWA 4C8YA 2BKNA 1WHVA 4IOBA 2YBVA 4FLYA 1KSPA 1VQYA 4LFAK 3NXZA 4HLBA 4H4MA 4LD0A 2WK4A 4FZVA 5G0RA 4HYKA 4JI5J 4GVEA 1VC6A 4O8UA 2LDYA 3D68A 2MB0B 3TPQA 4KB7A 4FVCA 4LBPA 2ZD1A 3Q7BA 1WNSA 1RTZA 1YTYA 3C94A 4K0KJ 3M30B 1RNHA 1M5SA 2GHVC 2E20A 1RE1B 2DEJA 2KFNA 1BU6O 1XJWB 1GX6A 2EKNA 1FW6A 3K0SA 1KS2A 3CC4S 1TTHB 2VFUA 3GIRA 3A2FA 3PW2A 2XHCA 2DPIA 4ECWA 3UB5A 2ZH1A 3WXMB 3MMJA 4NYOA 1YRTA 2I6WA 3G4SN 3TNVA 3L4IA 2Q31A 1JXLA 5B0AA 2F8SA 4KRFA 1ZPVA 3L3VA 1RBAA 3OFFA 4QIVA 1WNEA 5E7OB 3SAHA 5A8RB 4A8KA 4ILGB 2IAJA 2CNLB 3W5XA 4J9QA 2DCLA 5J2PA 2DH9A 4RWTA 1UPMB 1VQ6N 1C1BA 3HD1A 1HMVB 3GFHA 2ZH6A 4CEAA 3AQOA 2HBLA 2NUUG 4JI6J 1B0PA 3IDHA 2AYGA 4V19S 3NNAA 4I6WA 2P9UB 4BQZA 2DGQA 1TL5A 5BRHA 1F5BA 2ZOFA 5IC6B 1KR4A 1RWKB 3AVGA 2MSTA 1OO0B 2E66A 3T1HF 5E3AA 1FJ7A 2NXEA 4JP8A 2NLXA 1YWXA 4GC7A 4M95A 1R8BA 1CXQA 4EMDA 2BJ7A 3J81U 4ZPVR 2F8EX 2QA1A 3PX6A 2ASPA 4OJGA 4P2SA 3O3FA 2ZJPL 3CDEA 1K8KA 2KVIA 2D3O1 1UFLA 1NPRA 1VI7A 3N28A 4KHRA 4DN9A 1N34F 4CJEA 4NA3A 3M2RA 1S72S 1H1VA 1QSSA 5SUHA 2UXCK 3RJMB 1QVFM 1W7AA 3O3GA 2VPYB 2O8FB 1N8RT 2F9WA 1VQMN 4WJBA 2P9CA 2MKCA 2CRLA 3VEXA 2BANB 2CPZA 4GRSA 3QIPB 3UVJB 3MMCB 3R5JB 1ZA2B 1YJ9N 2D5RA 4B1ZA 3IGNA 4ZPAA 3TUJC 2PO4A 4UY8O 4B3MK 1JJ4A 2O67A 3T1AA 1RK8A 3WIUA 5HJXA 2FB0A 3SMPA 4PZVA 5DJBA 4USUA 1TUWA 2OZMA 4ED5A 1Q53A 1SV5B 3MECA 4NMLA 4TSXA 5FLXY 2C2NA 1F3FA 2R7TA 1B70B 3RBEA 4FK4A 2Z56B 1S97A 3OS0A 2BQRA 3DOKA 5CCMA 3G8QA 4EHUA 4PWUA 1DJ0A 2WONA 4KBOA 1HBMB 5C42A 3DU5A 3MCOA 2AYMA 4C23A 4Y2MA 2FHMA 3R9LA 1HPZA 2GEMA 3C6HA 4JI1F 5J1PA 4FZXC 5CZ1A 3S3MA 4NI2B 1X7VA 2OJ3A 1UOCA 4H0VB 2NRXA 1BHNA 1M5OC 5D6GA 2MQOA 3T6JA 1OSCA 3QSIA 2KQ2A 1F3VA 1XEZA 2B3TB 4FJHA 4J2EA 1VQSA 3CF5L 1T0TV 1I3OB 1JLAA 5C2GA 1NNDA 3SIPB 2ZKTA 4DR4J 4OYOA 3OXFA 2OTJN 3OVAA 2RU3A 4YHHF 3K2PA 4DV2K 1NJWA 2HEKA 3WT0A 4WYBA 3H7HB 2JC0A 5AT1B 1XBWA 3QNOA 3QZ8A 3U7JA 3QBXA 3GPAA 4F26A 2HVEA 4DOZA 4Q0BB 2R8HA 2VA2A 2EFPA 2C2ZB 2ZNZA 4F9OA 5DO2A 3US5A 4CI6A 3ZSRA 3L7UA 1TUUA 1ZAVA 3RRKA 1V3ZA 2AWZA 2I0XA 1L3KA 1UVKA 1GFWB 4OL8A 2V8GA 3EDRB 1WSIA 3VEZA 1KLMB 2J4RA 2NXCA 3ZO7A 3SQGA 2NCKL 1UJ5A 1N8RO 2IYIA 3G6YA 2QN6B 2HK2A 4IFYB 4PL8A 2XNQA 2OPRA 2V4JA 2DY9A 1GMVA 5A0YA 4P75A 5L38A 3HVTB 3CMES 1UEVA 3A3PB 4K59A 4YQWA 3HPGA 3MMAB 3AB2B 2V2VA 2QV6A 4CF8A 2PT0A 2YHAA 1MMLA 1TAUA 2HURA 4DLEA 1NZ8A 3L3UA 3PDNA 3G82A 5CA5A 2CQBA 1QDUB 4BVPA 2LYVA 1FO1A 4ECYA 4BE2A 4LSLA 4MIAA 2Z2MA 3F2KA 1EQMA 1RDUA 1IQZA 2UU9F 3BSNA 2KM8B 2B43A 3VGVA 1U8SA 3BGRA 4RWXA 4R5PB 4W5QA 3JAMY 5KOXA 1XMOJ 4USVA 1UPPA 4OYAA 4CNZA 3LUYA 1Q8LA 4GVBA 5D0GA 4NLCA 1RT1A 1X4CA 2QMWA 5LMNK 5KAKA 3CD5A 5K8MA 4DV1K 3P5JA 5HQLA 1T9VA 3HHLA 4ZN1A 2CDRB 2VH7A 2ZJPQ 4OKEA 2JSXA 1HD0A 3VQAA 5KQDA 4X65K 4G65A 4TQSA 1TL7B 1M1KT 4RNMA 1YX2A 3DOLB 3JSMA 1NKBA 1B7FA 2CQDA 4WFNL 4ZLNA 4AM7A 4FWLA 4DV0F 2F4VF 4BROA 2B0GA 3S3NA 4JUZA 1S1XA 3THXA 4I7FA 3HKWA 2G2ZA 1JJ2M 1VQ6S 4IBNA 4CGFA 3OTBA 2ZWOA 4IO1A 3IRXB 1NPPA 1CJTA 3VENA 4XPEA 2RB7A 3BF1A 3I32A 2DHAA 1NDCA 1IBKF 3GIMA 1S0MA 1QVFR 1JKHA 2UXDF 2EC0A 1XHXA 3D5MA 3KOAA 3ZSWA 5H9FK 2W8LA 4ZS6A 1CLFA 3AAPA 3IAYA 1N33F 1R0AB 4USHA 1VDHA 4ENOA 2YJEA 2Z57B 3WDOA 3CCVN 2D74B 3WQTA 5HRPA 3AAWB 1H0HB 4ELUA 3HT0A 2HHHK 2V2KA 2G1DA 2B4OA 5EX3A 3HO1A 4Y34A 3CVKA 4WXWA 1VSKA 2W2QP 2IVYA 3MR5A 4CLPA 2WVDA 4RBTA 3ZSVA 1CG2A 2PSZA 1T8EA 4DTNA 4CH0S 3MR6A 3HHLC 3B8HA 1V3SA 3PX4A 1OJ4A 4PUOB 4TYBA 4QOZB 5M2RA 2HS4A 2WAQD 3TA1A 3VMFB 2V67A 2ZVSA 3W60A 1YBAA 4Q7AA 4NXMJ 4USIA 4IWVA 3GONA 1HWIA 3CQ8A 4DL2A 3CF5Q 2IY5B 1Z6RA 2YKAA 2IM0A 3H42A 3TZZA 1I94F 1OH7A 4MK7A 3ZETB 2HHPA 1BO5O 3QJJA 1OY9A 3Q8QB 1VQ5N 3TSQA 4FWSA 4CT8A 1XNQJ 3KLGA 4N8OA 5IM0B 3M9MB 2RT3A 4LR9A 3AO3A 1OQ6A 4QIGA 5E3PA 4AFFA 1WN7A 3RR7A 2M4MA 3KWMA 1RJJA 5KT4A 3KNAA 4GKKJ 4CHPA 1T3OA 5J2MB 1T9WA 2DJWA 1WACA 5FDLA 5CCLA 4H8KA 2DNGA 2M88A 1D9DA 1RT6B 4NXNJ 1VBKA 4PG6A 1VQ9S 2FY8A 3S8SA 3QWPA 1URNA 1IBLF 3KJVB 2AA4A 3V4IA 4FLVA 4FM0A 2C2OB 4JK8A 3PXGa 2KVQE 2HS3A 1HHTP 4DKWA 3MEEA 4MFBA 4X64J 4FJLA 4Z37A 4K4WA 4BQLA 1NEEA 4I6MA 4B9SA 2DNHA 2K7KA 4LF6J 2K3KA 4CZMA 3OW2M 4QQBA 3TO8A 3LA0A 1A5WA 5EXWA 4CJLA 4I69A 1LWXA 2X7IA 1L5UA 4RW7B 2YH1A 5KFCA 1FXLA 1YK9A 2FTRA 1LNQA 2O4IA 4YDXA 3MWBA 4TU8A 2H3GX 1GOBA 2UVRA 5ETTA 1PO6A 1YVUA 1YG0A 1N5YA 2MY7A 3O6WA 1ZZNA 3CE8A 4KY3A 3C14A 4ANEA 4C8ZA 4R0JA 4ICLA 2N4CA 5AQRA 2R7WA 1EZZB 1U0SA 4PXDA 4OYBA 4C1NK 3RB6A 2MZQA 5MAOA 1W25A 3DMJB 4WZQA 3KDNA 4B3TJ 1EETA 1HHSA 5JVHL 4ZVQB 3V6HA 3IFRA 2QA2A 3G8TA 4HVJA 4U95A 2I2YA 4OGCA 1KTQA 4W90B 1TAQA 4F4AA 1FX2A 4OVLA 4URQU 2GHWA 3QMQA 3R1LA 3DWLA 4Z2XA 1PYTA 2NXUA 3T1HK 5HANA 2ZJQL 1EKEA 2P9LB 2RMLA 3EL2A 1RP5A 2UUCJ 4CE9A 4J5OA 3R97A 3VGUA 1CJUB 2N4DA 4NB4A 4ED2A 1O1WA 4YOVA 3GV7B 2E5IA 4WFNQ 2XMVA 5C2FA 2XNRA 2YWGA 1FEHA 3H90A 1FI4A 4RO0A 1K47A 1WAJA 4FF1A 1KFSA 4OZ1A 2C2DA 2VV5A 4BR4A 3TR5A 4LQ9A 1GEHA 3CFRA 4RW9B 2YKMB 2A41A 4Z4IA 3CJ7A 5DM7L 2QEXN 2J5AA 1N34K 3NAHA 4WQ4A 2HVDA 5AQIA 5I9EB 1JLCB 1JJ2R 3UPFA 2WTFA 2BX6A 2I8EA 4DV7J 1NK7A 4DSKA 3W1YC 1RWXB 1H2UX 1U2RA 2D0BA 2CPHA 3GSIA 2WUSA 3SEOA 1XC3A 3EPGA 1RCHA 1PAUB 4O3NA 1RT2A 1Z4UA 4FYXB 2IHR1 3IR6B 2GUIA 2FC9A 4B1XB 3AV9A 1X3NA 1ZA1B 4QWCA 2DR9A 4QR2A 2Q0UA 2OIHA 4DU1A 1XQIA 2GAGC 3LGNA 1JXBA 2FBXA 4BR0A 4F50A 4YOTA 4DCPB 4BGAA 3DI6B 2VFVA 1HKGA 3NF8A 2QWMA 3M8RA 4K8XA 2WOMA 2ALZA 3I56N 3N6NA 1RBRA 1FRXA 5EWGA 4KI4A 2E7XA 4CF1A 2QKBA 2DPJA 1WLJA 2YX4A 4H4KC 3MUTP 1X60A 3KG4A 4PKDB 3SPZA 1R8AA 2BJ9A 2YWEA 5KPZA 4W4MA 3VOVA 3LP2A 2OMLA 3NS6A 1X5OA 3L2RA 4IOXA 3NY0A 1IR2A 2V51B 1VC0A 3OV7A 4ILRA 1RWWB 1IWGA 3UE5A 2XHBA 2V50A 4JI1K 4OPJA 3EKUA 1PG5B 2HBMA 1W9HA 3VA0A 2HMPA 1ZTWA 4WQ4C 3C8YA 4WQ5A 2J8SA 2W6LA 2KTQA 3E9PA 2E5HA 2DXEA 4PY5A 2IC3A 5JICA 2AJ1A 2O01C 1KAYA 4YHHK 1S0OA 1U2VB 3CHWA 4GW6A 2VG6A 1UCNA 3S6EA 3FRYA 4C2MA 2R2UA 3LDLA 5AXLA 1MWKA 1NGGA 4HH0A 4EBDA 4FXDA 5KT3A 4O3RA 2RRBA 3CJ4A 1GLAG 3A13A 1ZBLA 1RTJA 3SYZA 3A12A 3EVWA 3MTJA 5FPDA 2G8HA 4OQJA 5CYMA 3CMAS 4N5SA 5F8IA 3NGTA 1HPMA 3VGLA 3SAFA 3DNCA 1ZS6A 1RWOB 4JKHA 1WKLA 1S9EA 2BUNA 3O5TB 2XMUA 4WP3A 4NO7A 4CYUA 4FKYA 4S0MA 3IN5A 4H5NA 4CZFA 2M9KA 4DHYA 5F2RA 5CZ2A 1NMEB 3IUCA 1EQ0A 1Q82T 4C8KA 4DPUA 4AD6A 3CCMN 2QA4N 3JQKA 1HD1A 4FW2A 3UWTA 2IJRA 1VQ5S 2W2NP 3GB0A 4BCAA 5A2QO 3PO4A 1WSEA 2F4VJ 1RWPB 3T9ZA 1NH7A 1FNXH 3K5NA 3FFKB 4MTPA 4AQYJ 5LM7E 3GU0A 2A3ZA 1HKBA 4E2FB 3UE2A 1FK9A 2YQ0A 4C97A 3WEEA 4R8UA 5LJWA 4WQ5C 4DWIA 1RGIA 2G4BA 4BRNA 1B4SA 2LKZA 2M3DA 1X8DA 4DTJA 4A8FA 5EX0A 2ROPA 2XI3A 5JVHQ 4WFZA 1QD1A 2Q79A 2YNHB 3OBIA 2NS1B 2E2NA 2UU9K 1PILA 2FQQB 4QWEA 2FJXA 2HFSA 4FK0A 2PI4A 4CHNA 3MM5A 5A76A 3G6XA 5U47A 5A8WA 4O55A 3BQ2A 4OZNA 5KFKA 2NPIA 4OPKA 5C25A 4J91A 2OLWA 3C6TA 1T9UA 5ELZA 2E1ZA 4X4TA 3ETOA 4NA1A 3FGUA 2MDAA 4IFVA 1VHIA 3EM1A 2FHOB 4GV9A 2IYGA 4WTOB 3NS7B 3ISNC 3IBWA 3NCPA 5IXUA 3D6FB 4YFUA 1KQGB 3R5DA 2FY1A 3L2QA 1L3UA 4QZVB 3EGZA 3HHNB 1FE4A 4LVNP 4CZLA 2CZ9A 2CZ4A 4C48A 2ZJRL 5DM7Q 3OR1A 1GOCA 1S9FA 1TR0A 2E1MC 1Z05A 4HHUA 4B3SJ 4DV0K 1HBUA 4NLBA 5HP1A 3NH0A 2ZGZA 1U1MA 4O8KA 4H0OA 3C3LA 4JI0F 1HYZA 3MM6A 4DN0A 1VC5A 5K14B 2RRNA 2F8MA 3RVCA 2VODA 2XRIA 2FDNA 4FLXA 2MSSA 1IBKK 1V5IB 4DPTA 4ZIWA 2X1BA 2MMYA 1EP4A 3KLFB 4FYWB 2UXDK 5KFWA 4M5JA 4O4GB 2KFYA 3TUZC 4YN3B 2HBRB 2FBTA 2UP1A 2B6AA 3NVMA 5GADP 5BYQA 5DQGA 2X6SA 1DQ8A 4TY9A 1N33K 2DY1A 3ET6B 5AZJB 2AW0A 4FVUA 3MMBB 3Q86A 3HHEA 2RH3A 3R5GA 2VWKA 3M2UB 3W2WB 5C10A 1NDKA 2CVIA 4RNOA 5IV4A 1HNZJ 3AT1B 1YJRA 2N3LA 4IH5A 1N36J 1UWBB 4JS5A 2ZUGA 1HNVA 1KOHA 4OYMA 1IWAA 3ZTOA 1FVQA 1MROA 2V69A 3I0RB 1D5AA 4PEOA 3D67A 1S6QB 2G9OA 2XSJB 2QEXS 2AX0A 2HQFA 1FDAA 1U1LA 4LSNA 2HIQA 5AR0A 3IP0A 1FKPB 4CJVA 2QWOA 3PW5A 3DOMB 3FCWA 4PG7A 4B9QA 4DB3A 4KYZA 2ZHBA 4MK8A 4DV4J 1D9FA 2B56A 1T11A 3VV2B 3GIKA 5KT7A 3OY9A 4FWOA 3C15A 5AQKA 1UAWA 2BACA 2M2BA 4E7JA 1RYRA 2JDJA 3W9HA 1I94K 3DRPB 3M8YA 3MEKA 4DR6J 2ZBQA 4ELTA 3BBBA 2IRUA 3TOQA 5CYQB 1WC4A 1M5KC 4EIAA 7FD1A 4NLDA 3DJCA 3CWJA 1K73T 4ZVTB 2FVCA 3RW7A 2NRHA 1BQMA 1I5OB 2EW9A 2VKZG 3NBPA 3UFCX 4C11A 3L6QA 2MHEA 5KG3A 4DR3F 3CB4A 2DITA 2AT1B 3BQ0A 3VAIA 3MAQA 2IA6A 4HHTA 3AVKA 2CJKA 4F3MA 2NREA 1IBLK 3W62A 2VPZB 4N77A 4PKIA 4RUCA 4ZOSA 2XY8A 3PTWA 5A8KB 1NJXA 2VFTA 2HAIA 5C15A 1VSFA 1ZC6A 2F7VA 2GC8A 2DO4A 1VRTB 1P6TA 3D28A 3EEQA 5HROA 4IOAL 4MLEA 3QT8A 4FN5A 3AJDA 2FLPA 4FWKA 3A4TA 4FS1A 5DGBA 4ZVOB 2Y8WA 3W66A 1TK8A 3IWLA 3HPHA 5CYJA 3HVWA 3M8PA 1FRMA 1S99A 1CQNA 3NG8A 3BZQA 1VSMA 1HNXK 3RRGA 3OBWA 4Y1DA 4FSVA 2EI5A 1D4XA 1P27B 4RLEA 3A3OB 4QPXA 1XNRJ 1S5JA 4CO3A 2NUBA 1AA1B 2HSEB 2PEHA 3MUMP 4YDDB 4IRDA 1MG7A 5M1PA 2FF3B 2NZTA 1U7LA 2HK3A 3TAPA 4E3SA 4W98A 3DXKA 1GNKA 1WC5A 3IRWP 3U02A 1RTDA 3L09A 4FBTA 2BM0A 3LAMA 3RU0A 3U3YA 4EYIB 1RKIA 2ZBIA 4FPAA 1R8PA 2IIHA 4A8QA 1GT8A 1BD6A 4FP9A 3ZYYX 2QA4S 3TU5A 3M6UA 3ENAA 4IRKA 4AILC 5BRDA 4BRAA 1K8AT 3CQXA 1GXUA 4OLPA 3FQKA 3QFPA 1D8YA 3H8YA 5FPEA 2KXNB 3RR8A 4CH1A 1SJ4P 2ZJRQ 4WU2A 2UXBF 4OJHA 2RIJA 3SQ0A 2M8HA 3F44A 1G15A 4RTFD 2W9BB 3MM7B 4BLGA 3TTCA 3V1RA 1S6PB 1CS4B 4DSIA 3DHXA 2RF2A 1J54A 5L1JA 2JZ5A 4WFBL 3QO9B 1BUXA 1JJCB 3MAAB 2OD4A 2KG1A 4B02A 3QRPA 4O5FA 1IBMF 2RKIA 5DETA 2XC9A 2R8IA 1GMWD 2ZBPA 2FJAB 3DHWC 1ZBUA 2I7PA 4RPFA 3NOCA 3E3XA 5AFUA 2JEJA 1LW0A 2EFNA 4ECXA 2QLWA 1C0TB 3S3OA 2NYIA 3OYDA 4NLTA 1WEZA 3IG1A 4FLWA 3MTKA 3VF2A 4CD1A 3UDLA 1JB0C 1XMQJ 5CHCB 1RILA 1MWYA 3VQSA 3VAFA 1IO2A 1U6BA 4CHQA 4CZGA 2LU1A 4DUZF 2HSTA 4I6YA 2A2DA 2ASJA 1F60B 3W9JA 4DR7J 4QYZK 1YQHA 1NKCA 1G7CB 4CBXA 5LXYA 3KK3B 4OYXA 2LQ9A 3JS6A 4ZCMA 2QM1A 1E6VB 1WELA 2XHWA 4BRPA 3GZ7A 3T1YF 1R6YA 3V6KA 1S59A 2JLEA 2FBVA 5AQLA 1V4TA 1BWFO 1NHKL 3U1LA 3AVNA 3JTNA 3HKZD 2V2ZA 1Y11A 3OPKA 5L39A 1Q9XA 2OPSB 2W7AA 4X62F 3N6LA 5L46A 2ZH9A 3UO0A 4RW8A 2BE7D 4DQSA 1LK5A 2KB2A 4F04B 1DT9A 4X66F 1EKRA 4QR0A 4ANDA 4JI7F 4GKJJ 2CQCA 1S9GB 3OYJA 1K8AO 4E7IA 1HQUA 3DLGA 3K5OA 4XIUA 2CPDA 5L1IA 5J2QA 4GVLA 2A6OA 4DPOA 1RTHB 1SL0A 1CPZA 3GTYX 3HJFA 2AP6A 5JUMA 3KVGA 4BC4A 1QLNA 2IDLA 4JI4J 3R7NB 2B9YA 2EEYA 4Q43A 1J5EJ 1C4AA 3M6GA 1KONA 4X4QA 4RL1A 4B1YB 5KFHA 4IH7A 2OSRA 2QZ8A 4CLTA 2GBZA 4JAXA 4XTTA 3NH2A 3DLBA 3HDSA 3MPWA 3HFVA 1Z25A 1ZBTA 3B6BA 1D1UA 2J0WA 1CC7A 1ZBSA 4UT4A 1GXLA 1GQEA 3TUIC 3VQPA 4J7CA 3FBBA 2QG9B 4RNNA 1YITS 4J8FA 4IOAQ 3E01B 3KKSA 2CADA 4PL7A 1FXDA 3RTVA 1TKDA 3AVFA 4CVNE 3LPUA 2DBBA 3UKUB 3M9OB 1MU2A 2W1BA 3C46A 1NK4A 3ISZA 4HH1A 1BCOA 3NDKA 2IDEA 2V8DA 1YXQA 3ITHA 2OD6A 4I9QA 1GX5A 2W9CA 4USMA 1CJVA 1UZDA 4ZP7A 2AQ4A 2EG1A 3MOZA 3FQLA 4PABA 2YHWA 1SKUB 3TJ9A 1FDBA 1H73A 3DKDA 3D2EA 3LDPA 3F9MA 1X9SA 2WBRA 1SAZA 3ALYA 3PW0A 1A6LA 2BJ3A 4GVMA 5IT9U 2E44A 4F36A 3R5AA 2IVNA 3QBCA 5J1NA 2RD5C 1RAAB 2LEPA 1A9NB 1HWJA 4DQPA 3LL3A 3CM6A 3J7YI 2JNJA 4NCBA 4H0TB 4HR2A 2C3PA 3OTOF 2QWPA 1ZOTA 4CESA 3CPEA 3RG6A 4CLWA 2MZSA 4ZVSB 2V9WA 3HJVA 3CNQP 2DHXA 4CEZA 4EP4A 1XTZA 1WSFA 3Q8UA 3QMLA 1JLEA 2HHWA 2RAQA 4ED8A 4ECVA 3QLHA 1BGXT 2W2MP 2YKQA 3ASMA 1FNMA 1WOPA 3UKRB 2CH5A 3KUHA 3B82A 3CJ5A 3NGRA 1EO1A 3V6DA 2G0CA 2UUBJ 4DTRA 4J37A 4WFBQ 3C6UA 4NA2A 3BQ1A 2EC2A 4DQRA 2OPPA 4PYDA 2HHVA 1BUPA 2R7VA 4DUYJ 4JI0K 4DU4A 4H4OA 2M0GB 2GJFA 4OPHA 2P9SA 2Y1JA 2GVZA 1UW4A 2XMAA 2IS3A 3GV5B 2CJQA 4KHQA 3SUNA 4W92B 4M5IA 4KE5A 4U96A 3TUPA 3N4QA 3KJNB 2YNIB 2IVMA 2E9RX 1FNOA 2XGQA 2DKOB 2WTUA 1R43A 4LR7A 4P6QA 3BO2A 3RMDA 2YNGB 4WYLA 2VDHA 2GUPA 2ILYA 1Q7LB 4ZCKA 3C19A 4OHYA 2BQ3A 4FF3A 1N5SA 3JYTB 5BYRA 2DNYA 3OUYB 3ENOA 2FZCB 3VTIA 1HBNA 2UUAJ 1MSWD 1VFJA 2CNNB 3J7YU 4DSEA 3EO3A 1BHLA 4CIOA 3SLCA 4ZVHA 1UZHA 4UQTA 4QWAA 5LXRA 1H2VZ 4CM2A 2HBYB 3CJRA 1GTHA 2B4JA 3T6BA 4B8CA 4XDDA 3QT5A 1I6JA 2F40A 1V5VA 3CDUA 4NL5A 1NGCA 1NBWA 3U4LA 4N76A 1SIZA 3AO2A 3G9CA 1UL3A 1AYEA 4RU2A 1CBKA 3LP1B 2XO6A 3DU6A 3CCLN 3ETMA 4TN2A 3I9V9 4Y0WA 2C2EA 1DY3A 3HBTA 3GIJA 3UD5A 3BF3A 2A18A 4K25A 2NXJA 2ZWPA 3MN6A 5BN8A 2NNWA 4JNEA 3NCRA 1PSDA 5HQMA 1Q8KA 4JI2F 1C1CB 2PMZD 1EWRA 3OTDA 2POKA 4P7TA 1YZ6A 5DZ7A 1Q86T 2Y1RI 2HF3A 1JLBB 1FJCA 3AD8C 1SL2A 1G1XA 3SJHA 5EY4A 4DL6A 1HI0P 3M30A 2L9WA 2B9XA 4JV2A 3SCIE 2NR0A 3KLVA 4X4PA 4U67L 1LWEB 3O9UA 3FZKA 3CCZA 4KC5A 3JB9k 4DR3K 2P9KB 5KRSA 5C7PA 3D0PA 4JYAJ 2DNKA 1ZM4A 1OY6A 4KHWA 4KHSA 1HQEB 3WNHA 3CCWA 2VG7B 1NSKL 1Q4RA 3CCRS 2DHSA 1S1TB 4O4RA 5A8RA 3V4MA 3SV4A 5TKYA 3CW2C 3THVA 3O6QA 4M3YA 3WQUA 3ZTPA 1QE1B 2FHJD 1FJGF 1SUQB 4OX9J 5DZ6A 1FXXA 4PG5A 5DMRA 1VRQC 3L7PA 1YJ7A 1HMVA 3QZ7A 2LECA 4MDAA 1PKUA 3SV3A 4KBIA 5HMZA 3MXJA 4DMNA 2P9UA 2FD2A 1KVAA 1OYDA 4F2RA 5L1LA 1H2TZ 4Z0UA 3F41A 5DG7A 4C0BA 4LQ3A 4LRAA 2MTLA 3AVLA 3VEVA 4DPYA 1EJ7L 1RWVB 2HZVA 3R8EA 1FT8A 2KFZA 1ILYA 4J9RA 3GE1A 3U6FA 5AQPA 4HT5A 4DBQA 5C24B 2DH8A 4XH1A 3MDFA 2XEXA 3RSEB 3CCSN 4K4UA 4K42A 3VGTA 2QSFA 3OBYA 2BUPA 1H6KX 2WBMA 3SCLE 2ATCB 4LF5F 1OS5A 3H2VE 1HIYA 5BR8F 4MO4A 4A8XA 3DLJA 3PJ9A 2ZE2B 4DPXA 4DTMA 4XO0A 3TI0A 4EBEA 2D3ZA 2V34A 2RPIA 4NYNA 4DR5J 4DUZJ 4QR1A 4UOFA 5IS2A 4LFBJ 3Q0AA 2ZF5O 4H5WA 2C3OA 2O8FA 1SC4B 4NLYA 1U48A 2XS5A 3NWGA 5KFOA 1YF5L 4TYAA 1S5ZA 2ZZTA 3CCQS 3NMRA 3DXMB 2BANA 4D3HA 4BDYA 1IR0A 3QIPA 3UVJA 2UXBK 3MMCA 5SZTA 1VQOS 5KFIA 5F8HA 5LT5A 3OS1A 9ATCB 1BE4A 2RRAA 1QVGR 4IG3B 3T5HA 2R42A 1SV5A 4HCBA 1VR6A 4JI3F 2DFHA 3U9DA 2GVDB 3KJQB 2QL7B 5B0DA 1VCTA 1FKAF 4X4VA 4JI8F 2E7WA 2K7JA 5M2UA 4EEYA 3HSGA 2R3VA 5KGXA 3HI9A 2E1AA 1OYEA 3QAUA 2B6AB 1HBMA 3IMXA 1ATSA 5F0UA 5G4DA 4QBUA 1RWUA 4N7TA 4FJ8A 2RQMA 1GH8A 4H5TA 3PKMA 4CW7B 4NI2A 2VFRA 2H5IB 3D7EO 1R0BG 5AQYA 1OVYA 4FJKA 3TA0A 3HM8A 4Y00A 2KJWA 2GTDA 4PAAA 1PGZA 2OTLN 3UD4P 2D41A 4G1QB 4KPYA 4DS4A 2M52A 4QU7A 4ZITA 1T05B 4K8ZA 4ELVA 4ECUA 1TVRB 4UUWA 2A3JA 4YEAA 2LXFA 3T1YK 3P8BB 2CQ2A 5LOQA 4ILLA 3TA2A 3UW1A 1F6TA 3ULEB 4Q0BA 1VRUB 1A5XA 4CJWA 2WB4A 2H65B 1FWLA 4BRIA 3P4UB 4LF9F 5DLFA 1M0SA 2E2PA 4X62K 3FZFA 2ZBRA 3KMQA 3NMAA 3PVXA 1YTAA 1JX4A 1CZBA 2C22A 2DXFA 4FL9A 3O9TA 1TKXB 1MN7A 1WI6A 1NB7A 2RQKA 1D09B 4OV6A 3A8IA 3R7SB 4X66K 1KLMA 4JI7K 3RWUA 4DX8H 4OZLA 1RLCL 4U67Q 3ZT0A 4EZ6A 2QT7A 4IFYA 2YI1A 1HNWJ 3QEVA 1RBVA 4BC3A 3WNGA 5H1SV 4M45A 2V7ZA 2G8VA 1VHXA 4IR1A 1V3RA 2V8VA 2FJWA 4ZPTR 2ZDPA 4KV8B 5LMUJ 2DHHA 3MMAA 2WVBA 2J0SD 2JLGA 1WOSA 2YKNB 4MYUA 3OYEA 3K9JA 4Z4CA 3CCLS 3MCSA 3MN9A 3OTOJ 4XEIA 2O8EB 1FWKA 3SCJE 5CZVA 1SJFA 3UN3A 4IXCA 5KQ8A 1N48A 1S12A 3GJRB 1T03B 2VF3A 3V9ZA 3N01A 1NRKA 3SMSA 1RQ0A 5LSOA 3I8DA 4WBFA 3RBDA 4FJGA 2VB6A 2HFVA 4NLWA 4N56A 4IKFA 2F9TA 2J9EA 5L8RC 4R5PA 2H5JB 4K4SA 2R8KA 2D0AA 3GSDA 3MWTA 4QW8A 2AHOB 3PYGA 1VLOA 1FHTA 3QYYA 2EFGA 4JI5F 5B0CA 2Z30B 4KO0B 1N6QB 3CJSA 4QIWD 3M2VB 4GO7X 3KLEB 1NSQA 1MMDA 3BSAA 3N0VA 5HVFA 4EHTA 4K0KF 1HR0J 3H5UA 4WIQA 1TL7A 2GMJA 4TLQA 3IA0A 2E5LK 2CPFA 3DOLA 3M1VB 4A5BA 1KLNA 2NRTA 2HLUA 1ZBHA 4CEDA 4PYAA 1QZ5A 2HYIB 1NCLA 1TL3B 1R6VA 3R8YA 1A0OB 5AJ3J 3G6VA 1RKJA 2H48B 3R5BA 2NRWA 2GMHA 4DSJA 5IFMA 3D2WA 3HD2A 3IRXA 4H5RA 2IIRA 2AV5A 1TL1B 3NS5A 2OSQA 1GAOA 3IFEA 3CCEN 4YB6A 4G6VB 2QMUB 2ZM6J 3PZPA 3CUNA 3HFKA 1MWZA 3AO4A 5ETNA 2HVHA 1FCAA 3X3UA 4C4WA 3V1OA 4W5RA 2QRRA 1R0AA 4J9SA 1U09A 3SUPA 4JI6F 4F0HA 2KM8C 1KQSM 2R7QA 3BKFA 3ZLJA 2XCPA 1D3WA 2IM2A 3J80Y 3CGIA 1S7HA 5CZXA 3NVKA 3GWCA 1Q5VA 1WG1A 3TZXA 2JVRA 1R27B 2VWJA 5AQVA 4CD3A 1DEJA 1HRHA 5BPNA 4PQUB 1EX8A 1VSHA 2L3MA 3GR0A 3C7NB 2E1RA 4UQGA 3VAMA 1Q7YT 5HJYA 4O0IA 3MOJB 1ASWA 4PUOA 1HW8A 1SC1B 3EGWB 4BWMA 5GAGI 4YOWA 2GFFA 4CP5A 1D9AA 3CC7N 4XK8C 3R6GB 1GLCG 4AL7A 3V81B 4ZIVA 3R6MA 4IRCA 2VPWB 3DM2B 1WBBA 3R9PA 1EX4A 3OVBA 3UDEA 4LF7J 3ZETA 3JTOA 1QSYA 1NK0A 1VQLN 2JVOA 1YGYA 4ZP6A 1VQNS 3DDIA 2AYBA 5IM0A 5AQNA 2YJFA 4Y65A 4Y2CA 5KFUA 4LSZB 2BE9B 3IAM9 5CXTA 2ATLA 5B7WA 1S49A 3VQ8A 4KTWA 5J2MA 3VETA 4KGZB 3WXLA 6FDRA 1TP7A 1S1UB 1IBCB 1RT7B 4P2XA 1HA1A 1RT6A 4OI1A 1X4BA 4BR2A 1NLVA 2NPFA 3D1QA 3FBFA 5HATA 5ETRA 3KJVA 4FNIA 3P5TL 5IT9Y 4BRFA 4CECA 5GMEA 2D0CA 4WK3A 4JI2K 1URRA 2IVFB 4V19X 4Z7YA 3LH2S 4CLUA 3WNEA 4OI6A 5CD4H 4FJXA 2B9WA 4Z4GA 3G87A 1MMNA 1C4CA 3ZSOA 3BY5A 2E5JA 2HRUA 3UR3C 1B9DA 3HP9A 1DTTB 1HQUB 3KUEA 5KFSA 3WZ0A 4DX6A 4KH5A 5THWA 1DFDA 4DTUA 5TKWA 5GAGU 1SJ3P 3H5YA 2W4PA 2MZ1A 3T3FA 2VBZA 3GE9A 1IKVB 1Y5LB 3WX8A 3GJSB 4RW7A 1XR5A 3VQ5A 2V4QA 3DC2A 2FSJA 1VJWA 2Z0GA 4UW2A 3CJAA 4JEPA 3MN7A 2H5EA 2YX1A 4RU9A 5BR8J 4BY9C 1E6YB 5GAHI 4DR4F 4CTAB 2DNLA 2WVEA 1Y00A 3JTPA 2KT5A 4B3RK 1UA1A 3FR0A 5E3RA 5LL6d 3RB4A 1SQGA 3JXUA 4ES3A 1HJOA 1SIWB 2BJ8A 3ZXWA 1N32J 1S57A 1LOTB 3WUHA 1FJGK 3BR9A 3DMJA 4M7XA 1Q7YO 5AQWA 1FRLA 2CA9A 4IR9A 2DGWA 2GMLA 3VAGA 2D1CA 1SH2A 4K8RA 1OIAA 2UV8A 3I55N 4LF4K 2Q1NA 4ED6A 1IM6A 3BSCA 4M63A 4C98A 2I5JB 4L74A 5KFDA 1QQNA 3UNGC 1NGAA 3J7Z5 2JWNA 2P9LA 2F4FA 1QY7A 3ENBA 1VQ4S 1CJUA 3FZMA 1APSA 3AAQA 4JI3J 2Y0SD 3D6TB 4CO5A 2IA0A 4DSFA 2YX6A 2PFDA 1F9EB 1Q5YA 3N4WA 1YRUA 2K2PA 2DH7A 3R3LA 2A5XA 1S79A 5F3ZA 4DV3J 4LF5K 4RW9A 2YKMA 1IG8A 1YJVA 3MM9B 3D1HA 1HHQA 3D0IE 2XMMA 1X1PA 3EN9A 1BDGA 2KJVA 3GL1A 1VQKN 2ZGYA 3QETA 1JLCA 2V0NA 1QQCA 2AEJA 5EGYA 2KHDA 5AQQA 2ZH7A 4E1NA 2L08A 5DGAA 4UZBA 1ESVA 5GAHU 3AD7C 3OSPA 3CT9A 2KKHA 4M5NA 3HXMA 3M8SA 2ETJA 3W5ZA 2X3GA 3SBGA 4D3GA 3LM2A 4IOCL 4NYPA 4F3TA 4BC5A 4AT1B 2DK2A 4FJ7A 2YVSA 1G6BA 5B8HA 5C5JA 2A6MA 4A59A 5GMDA 1XMOF 1UP1A 4ZDNA 3DI6A 4OYZA 3AA5X 3CERA 3OR2B 2AJ4A 1KQSR 3I31A 3OL8A 2VYPA 4RNFA 3H5SA 3I4HX 3K59A 1YT3A 4M63C 1I51B 2HFOA 2Q6CA 3BGUA 3NGYA 2G13A 3SK3A 2G8IA 4WXOA 4CJUA 1GLDG 3U8XA 4HEA9 3G6ES 3C65A 1TU0B 4JKDA 4JI8K 1SKRA 3H3NO 1T9XA 2ZVIA 1WSJA 2Y1IA 3CD6N 5MLCV 3CCES 4OZJA 4J2DA 2UUWA 2YWFA 3PW4A 5IQQA 2IMOA 1J53A 5B0FA 3E9LA 3U1NA 2GGPB 4CGJA 2N82B 3LP0B 4BRMA 3C2PA 3D6RA 3MK6A 4BC2A 3CJ1A 4C9DA 1TYQB 4ILMA 1BY9A 3MX5A 4AH9A 3VQ9A 1U2VA 2JH3A 2QFJA 2IRXA 1KN6A 4OI2A 4GMJB 1XWLA 1U4BA 3R1XA 4EYHB 2HQGA 3D9BA 1UFWA 3OFEA 4J90A 3FZHA 2CQ0A 1WKKA 3KLIB 4NLRA 4J9PA 2DGSA 1R3NA 3R2DJ 1L3SA 5L9XA 3NF6A 4LBHA 1QQMA 4AHSA 5DK5A 4LF9K 2RS2A 2GO9A 2FUG9 1RGVA 2PGCA 4PR6A 1BMQB 3J7AN 1A5VA 1B9FA 3THWB 3LZIA 3QESA 5DDQC 1NGHA 2FF6A 5ADXH 3T69A 4RCHA 1UVNA 2HWHA 4DDFA 1EB0A 4DV6J 3NGDA 4KGVB 1SXLA 1X3MA 3FCVA 2HLTA 4NXMF 2E8AA 4FK2A 5IZHA 4LIWA 3MCPA 4H5VA 1BLUA 4UY8T 2V68A 2VJUA 4DR2J 1SJQA 4FWPA 3DRXA 4AF1A 2VQEJ 3C0BA 2ATQA 3LDNA 4DMZA 3MFHA 2YKPA 3QJPA 3GIIA 1JLFB 5D0RA 1RBOB 5C0YA 2PIIA 2I1RA 4ZLJA 1XNQF 1RUSA 1MDUB 2ZUAA 4MIBA 3SQ1A 5H9EK 4C3LA 2IFXA 1BOTO 5DLGA 4R79A 3PJXA 4ERDA 4GKKF 1EQYA 1DQ9A 2YNHA 3HI0A 1VQ8S 4ALZA 3VEWA 3LAKA 3KDOA 4HUFA 2HFZA 4NXNF 3FCHA 3MAHA 1Y97A 2D9OA 2H1YA 3ZSZA 3UDVA 2MKIA 2A1SA 2BVZA 3EX7B 1VBZA 1RAGB 4MKAA 5D78A 2ROEA 4X64F 4JI5K 1AZSB 2HBQB 1O51A 2HW3A 4CHZA 3TZYA 4FZZA 4LF6F 3O80A 4YOEA 3BBFA 3EZOA 4K0KK 1U2CA 5T7LB 2Y0BB 5KI6A 1WEYA 2HQ3A 2PMWA 3H46O 3HLUA 2KW4A 3P39A 5KFZA 1YJNS 2KXFA 5HN0A 4A5AA 2HMIB 1LV5A 4DL7A 3ZEUB 4ID1A 3K5MA 3SDEB 4OPAA 2CGLA 5K14A 1YHQN 4FXWA 4PPDA 2V94A 2IJNA 4F4ZA 3OA9A 4B1UB 1D0EA 4J9NA 4ES2A 4IOCQ 5AQXA 3I55S 3HM9A 3NHGA 3KLFA 4O4GA 1FTRA 4O3PA 2Q0RA 4PWWA 1UMJA 4B3TF 1BA0A 4BREA 3AVMA 4OX8A 3FMBA 4LY7A 2HF4A 3ET6A 1Z26A 2O8BB 4U7UD 4JI6K 5AZJA 2LU2A 1LW2B 3M4XA 3MMBA 5ETSA 4M41A 3M2UA 3W2WA 2YHYA 3CC2N 2PEBA 3MUVP 5AZIB 5LJ3Y 3DXBA 4FM1A 4Q5VA 3IWNC 1UWBA 1NM2A 4CBUA 1GTEA 2AGPA 5I3QA 2UUCF 1VS3A 3I0RA 3IMQJ 4K2XA 1S6QA 3GFYA 2XSJA 3TTFA 3O08A 2VASA 1HLUA 2VPXB 4CLLA 4DCJB 4LC9B 1XR7A 3LGMA 2GZOA 4CJ5A 1OWXA 2MQMA 3BPDA 3OLBA 1U49A 4CEQA 1GXTA 4KPCA 1FKPA 2HHUA 5KT6A 3ZT1A 3BPSP 3DOMA 2JEFA 4F4WA 4ISGA 4NCAA 1RHJB 3QNNA 3GV8B 2ASYA 3D3CJ 2QL5B 3UI3A 2VCPA 2Z1JA 4DV7F 3DLEB 2RHKA 1R89A 3E9OA 3DRPA 1WTFA 2EHGA 3SUQA 2RDDA 1FDNA 3VF0B 5CYQA 3N6MA 3J7YP 3KHGA 2C2KB 4A47A 3AJ1A 2DEIA 3DFEA 4FDFA 3M9NB 4RX6A 1YI2S 1J27A 2E9TA 2PN6A 1PIEA 4IG0B 3EGNA 3ZTSA 4B1VA 4JKGB 4O3OA 2VKRA 1B7YB 2NUHA 3FUYA 2CPIA 4FOEA 4P74A 1ZAWA 1RT4B 4F4YA 3Q89A 1HKAA 2HZAA 1S4FA 3OJSA 3CD6S 4PXEA 4JRPA 2CJ9A 5A8KA 1P8ZA 3PCOB 4DZ6A 3GYGA 3CI5A 3VQDA 2OI2A 1ZM3A 3DRYA 1U0HB 4OJ3A 3KK1B 2N3OA 4A8OA 2J6TA 1HWKA 1VRTA 1HNIB 2VQFJ 2Z2LA 4OHXA 3RZAA 3KK2B 1IJFB 3QGPA 2W42A 1TKTB 1WC0A 5BPLA 2CUYA 1RBSA 4QOTA 3OYBA 5EHHA 3SSQA 4DQIA 4N41A 2GJIA 5F8NA 1PJ5A 1U47A 1VQPS 3RUBL 2U2FA 5GAEI 4L3KA 1HQ2A 3BZKA 4DR4K 1FRHA 5HL7L 2LXUA 3PIOL 3VQTA 1J9AA 1RWMB 2JWLA 4CCHA 3ZZPA 4BRDA 3L95X 2ASOA 5KFEA 4YY3J 1LWCB 2LEBA 4BRQA 2D3OR 2BMBA 3G0ZA 4ZVPB 4Q44A 4DU8A 4HTUA 4CZHA 3TAFA 3DXSX 2MGZB 4DFKA 3MM8B 4CJFA 5BRFA 3CJCA 5IOLA 4JKFA 2ALYB 3RB3A 2JJ4D 3T9NA 2VD3A 5KPTA 3OHBA 2ZWHA 1REVB 3M1FA 3UDCA 3VWSA 5B0BA 2WB1D 5JS1A 5HMWA 2LP4A 1C0MA 1FTCA 3L9ZA 1KFDA 3H25A 4QWBA 3BEGB 2HGNA 3QICA 4OLOA 3O44A 3KIOA 1PC5A 4LIRA 4YB5A 1GMWA 4I68A 3KLHB 4CFDA 5KFMA 3FEXB 2V8PA 3H4BA 3G4SS 3PJWA 4CJ3A 5AQFA 3DRSB 1F9FA 2O66A 5GVQA 2W9BA 5M1QA 3MM7A 4ILHA 1S6PA 1CS4A 3F0NA 4YR0A 3I8BA 4AQYF 2LCWA 3QO9A 1RB0A 5A2QU 2NRVA 1RT5B 2KYZA 4ILJA 1FRIA 3MAAA 3TP2A 5GAEU 3D0GE 3EUNA 2YTCA 4BR7A 4CJSA 1X9MA 2YKOA 2CXEA 1DARA 3ZT4A 2K3IA 2P5OA 2GS8A 5JXSA 1QZ6A 1C0TA 3NCIA 2X6NA 3M8WA 3W63A 3VGSA 1WDDA 1U25A 2Q43A 1NU0A 5FLXU 1WC1A 1VQ7N 1X31C 1XMOK 1HBOB 3AODA 4Q45A 1NJYA 1WF0A 2W7PA 3HSTB