1TL3A

Crystal structure of hiv-1 reverse transcriptase in complex with gw450557
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 147
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tl3A05
1RDDA 4Y3CA 4C8OA 2IA6A 3KNAA 4DG1A 4ICLA 1BIZA 2RKIA 4OVLA 4DF8A 4N56A 5CYMB 4GMJB 4B9MA 1FKOB 2D7SA 3ZT0A 1T03B 2G8FA 1ZBUA 3SV4A 4M3TA 3GIIA 3KIOA 3V6KA 4JV1A 5KFVA 2V0NA 1FK9B 5KTQA 4PQUB 3V9SA 3SI8A 4ED7A 3VA3A 2KFZA 3SZ2A 4DSJA 1WNEA 4I9LA 1T8EA 5EDWA 1LAVA 3V1QA 2FBXA 1NJXA 4F2RA 4J9KA 3MF5A 4DTRA 4DL4A 3OJUA 3KLFA 4RNHA 3RAQA 3K57A 2KW4A 3SCXA 5KFNA 1W0HA 4TSXA 5CZ1A 2RF2A 2R8KA 3DRPA 3DOLA 3SQ4A 1YVUA 5L9XA 4LY7A 4DTXA 5EWGA 1U48A 3AVNA 2WOMB 3PW0A 3GIJA 4O3NA 1T94A 3NF8A 4J2DA 1ZBIA 4AHTA 2WK4A 5C25B 1DTTB 4OKEA 1D8YA 5C24B 1ZTWA 5HRRA 4BDZA 1Z4UA 3GV7B 3NGZA 4IFVA 4CJTA 5F8LA 2Z1GA 1XR6A 3VQSA 5JS2A 3ALYA 4ZVFA 3QGIA 3MXIA 2XC9A 3N6MA 4DSEA 4ED2A 2P5GA 2FVSA 4ELVA 3F73A 4IR9A 4ID1A 1SL2A 1VSLA 3CWJA 1N6QB 5J2MA 4AHRA 3H5SA 3PY8A 4ED6A 3TQ1A 3KD1E 1SH0A 2WOMA 3SUNA 3RMDA 4R8UA 5DGBA 2IS3A 4CECA 5FRNA 4CK2A 1SKWA 4J9RA 3HVTA 1ZBHA 3DOKA 4IRDA 3PZPA 1XR5A 3V9ZA 2XWYA 3HP6A 3ZSZA 3EYZA 3RB6A 5KFJA 1IKVB 4EBCA 3V6JA 4RNMA 2Z1HA 1KLMA 2OPSB 4QOZB 2C2EA 1X9MA 3RB4A 4CEBA 4E19A 3WNHA 1JKHA 4KRFA 4EEYA 1RTHA 3QZ8A 1RT4A 3Q8QB 3L2UA 4TY8A 1EETA 4CEDA 2EX3A 4NLSA 1BI4A 3H5YA 4FVMA 3LZIA 3EZ5A 3NAHA 5J1EA 1EXQA 3CG7A 4CHYA 4YP3A 2VWJA 1QS4A 1RDAA 1HNIA 3RRHA 1NJZA 1TKXA 5F8NA 3HSTB 5KFKA 4Z4FA 4FYDA 2RKIB 5J1EB 4LQ3A 5E41A 1BI4B 3AA2A 3ZT2A 2AGPA 3DLEA 4KKOA 4O4GA 3HJFA 4C8MA 4FCYA 1C0UA 1OS5A 1MMLA 2Y1IA 4RZRA 5F9LA 4HCCA 2WCXA 1GX6A 3HVAA 4CHQA 2F96A 5KFPA 2ZD1B 2WONB 4QW8A 3V6DB 1I6JA 2AQ4A 4LSLA 5CYQA 3BSCA 2E6LA 4HUEA 3AA4A 5HROA 4M94A 4GC7A 1S0OA 4HVJA 5HRNA 3PX6A 2XI3A 4M45A 4DTMA 3ZSXA 2UVWA 4CGFA 2VWKA 4CFAA 3QERA 3Q8SB 4AH9A 2HHSA 3QIOA 2PZSA 3KMQA 1ZTTA 3HP9A 4DLGA 1RDRA 3VQDA 4B9LA 2O4GA 2OPPB 3WNFA 1TKTB 4IRKA 5T7BA 4PUOB 3NDKA 4I2QA 4HCBA 3AVBA 4EP4A 2GC8A 2FVQA 4CJQA 4CEEA 2KTQA 3HVRA 1HYSB 1EX4A 4FBTA 3PO4A 4TQRA 2AGOA 2ZQBA 2Z1IA 4K4SA 1HQEA 1ASUA 4CJSA 4E89A 1GOBA 1KHWA 1JLFB 1SH3A 4IH5A 3K2PA 3DMJA 3QLHB 4LSNB 2HB5A 1VSFA 2VG6B 1RBSA 1C0TB 5K14B 4J9SA 2AGQA 4XO0A 3EZUA 4GW6A 2GV9A 1RT7B 4ECUA 1TAQA 4E0DA 4IQXA 3PW7A 4J9QA 3Q8PB 3HPOA 3DRSA 4WXOA 4CJFA 1BHLA 2R7YA 1QQCA 3ZSRA 4DQSA 4XPEA 4URGA 1F21A 3QO9B 1T05B 1WAFA 1YTAA 2UVUA 1JX4A 2HWIA 2IM2A 4ED3A 3QO9A 1SKSA 1HPZB 4FJ9A 1TKZB 1T3NA 4B9NA 3BDPA 3P5JA 3DRSB 4NZ0A 1NHUA 4NLXA 1W25A 4TYAA 2FBTA 3OYHA 4Z4EA 3SPYA 2ILZA 3GIMA 3VN5A 3MEEB 1N5YA 3NGIA 1FKPB 1FK9A 4KAIA 3I8DA 2HHXA 2F8TA 2ZKUA 1NKCA 3NAEA 3AVJA 4KHYA 4CHOA 5KRTA 3SNNA 4KB7A 4LSNA 4FK0A 1CZ9A 5KFYA 1JLFA 4M3WA 2W8LA 3ICLA 1L3VA 5CYMA 1TK5A 3SJJA 2IJFA 5KFLA 1BIUA 3BSNA 1J5OB 3H2LA 4Q45A 1X1PA 1S49A 3B6OA 4ZTFA 2BANA 3HL8A 4I2QB 3V1OA 2QKKA 1VSHA 5EWFA 1TKDA 2GUIA 3H5XA 3B6PA 1R0AA 4NCGB 2XO7A 5HLFB 5KFGA 1YVFA 5C42B 4CJKA 4RW9A 4OGCA 5F8HA 3BSAA 1XHXA 4Z4CA 1VRTB 5KFFA 4ZPAA 4ECZA 3TWHA 1S1UA 4W5RA 3V9WA 4B8CA 1TP7A 2HVHA 2ASDA 2G8IA 4N47A 4BDPA 4LD0A 5KT7A 4I7FA 3PV8A 5HROB 4KHNA 4Q44A 3IGNA 1HYVA 3MXMA 2JEJA 3RTVA 2YKNA 4MIBA 4Q43A 4LSLB 1Q9XA 4BWJA 2JGUA 3IG1A 4MIAA 3BQ1A 4M3RA 2WONA 2ZD1A 1IH7A 4F8RA 3TI0A 2IJNA 4MFBB 4IFYB 4NLPA 3T19A 1C0UB 3AVGA 1WSEA 2DPIA 2C2RA 3DLEB 1BQMB 2J6SA 3HXMA 3NHGA 2YNHB 4JRQA 2W7PA 4CHZA 5DLGA 4FZZA 5L1IA 3AO5A 4B9UA 1RTDA 3OYJA 1TKXB 4Y1CA 3KK2B 4ECSA 1HNIB 3THVA 2F8SA 3VQEA 4DTUA 3BR9A 3AVIA 2G8KA 4FBUA 1KVCA 1UWBA 1L3UA 1ZETA 4EP5A 4TY8B 4PWDA 2IC3A 1RT4B 1QTMA 5L1LA 1W9HA 1RT1A 3H08A 2YKMA 1RTHB 1JKHB 1MU2B 2W9AA 4DTNA 4FJ5A 3EPIA 5CZ2A 1L3TA 5FDLB 4KI6A 1KLMB 2OPSA 3CJ4A 4R5PB 4WYWA 1IKXB 4RW4B 3VQ9A 3VA0A 1S6QA 4ECTA 3FQLA 4ZMMA 2I5JA 3DOKB 3NL0A 1C6VA 3JSMB 4B9TA 2JC1A 4O3SA 1CXQA 2F8EX 4EYHB 3RMAA 2UVRA 1J9AA 4IRCA 1VSMA 1N6QA 1DTQA 4FJLA 4F4KA 4KFBA 4CJUA 4LH5A 4FM0A 1RT5A 3HPGA 4FJHA 3CVKA 3LP1B 3H4BA 3ISNC 3TAFA 4FZYA 4K50A 4IFVB 4QWCA 3RR7A 1C2PA 2P1JA 2IBKA 4ZP8A 4FLZA 1I3AA 1DTTA 4MKAA 2FLPA 4HTUA 5KFUA 4KB1A 1KCFA 3DI6A 5KFWA 1JL1A 4QW9A 3EPGA 4R0EA 2B43A 4E7KA 3QEWA 4C8NA 4CESA 2HW3A 3ZSOA 3PJWA 4B8AB 4YNQA 3TAMB 3AA5X 2B6AA 2XCAA 3DRPB 1D0EA 1ZBLA 4OKKA 2RF2B 1SV5A 2G8HA 3RRGA 3NFAA 4CJ5A 2BDPA 4AHSA 3KLIB 3V9XA 1NOYA 3KLFB 1BQNB 3FSIA 4IG3B 2FVPA 4KREA 3H98A 4DLEA 3H59A 4XPCA 4CFDA 3OYBA 4K4TA 2GBZA 1C1CA 1ASWA 1IG9A 1VRUB 1C1BB 4JV0A 3KHHA 2KFNA 3AV9A 1J53A 4CF9A 3OS0A 1RBVA 3QZ7A 4QWEA 4YFUA 4L8RB 1IKWB 5DQGA 3SV3A 2GIQA 3FDSA 3ASMA 1ASVA 3MEGA 3BGRA 5SWMA 1S9GB 1L5UA 4FM1A 4U6PA 2HHTA 3FFIB 1RYSA 4O3PA 3DLGB 4ED0A 5EWEA 2BRLA 4FZXC 4QCLA 4ICLB 3N6LA 4DG1B 4MK9A 2OA8A 5J2PA 3O3HA 1SUQA 3S3MA 2W9BB 2D41A 3PW2A 4NLYA 1NJYA 3RB0A 3D5MA 1LWCA 4M3UA 1JLGA 3V4IB 1LWEB 4CJEA 3T3FA 3NF7A 1NK5A 1JLBB 4ECXA 2E4LA 4IG0B 2D3UA 1A5XA 4B9VA 1JLEA 2WTFA 3KLGB 1HQUA 2YNGB 4AILC 3ITHA 4NLDA 2DPJA 3MAQA 3CFRA 4TYBA 5KG1A 2JEIA 3LDSA 4CGHA 2D0BA 1GOAA 1JLQB 2W9CB 4WYLA 2HHWA 1WSGA 1VSKA 3CIZA 3RAXA 2BE2B 1RT2A 5T14A 3QGHA 4B08A 4G1QB 1RTIA 1J54A 4DFMA 3OVNA 2BQUA 1L3SA 3EY1A 3AO2A 2D0CA 1B9DA 2A1RA 4FLWA 3TR8A 2XGPA 2JC0A 3GV5B 3TAEA 3M8QB 4IH6A 4KO0B 4F4ZA 3BQ2A 4ZVEA 1CZBA 4AHUA 4FJJA 5KFXA 5KG6A 1RT6A 2DFHA 3LP2B 1A5VA 3L2VA 4Z4IA 4Y2CA 3O4QA 1N48A 3MECB 1VK0A 2XRIA 2I1RA 4OGEA 3AO4A 1TK0A 4O44A 4OLBA 3T5HA 1SL1A 4YR0A 1LV5A 3ZCMA 2X74A 4FJGA 3I0SA 3KK1A 3K59A 2JEGA 4TQSA 2ZE2A 3G10A 1TL3A 2KQ2A 2OPRA 4CK1A 4CGDA 5HBMB 3PR4A 5D3GA 4JV2A 3MR2A 4F4XA 1IM4A 5KG4A 4FLVA 4I2PA 4W5QA 3CFOA 3RBEA 5F8GA 3BJYA 4IOBA 3CJ0A 4DTOA 4YQWA 1BCMA 3CJ2A 4CJ3A 3FQKA 3QNNA 2DFFA 2UUWA 3MEDB 1RILA 3KKRA 4O3RA 3CYMA 2FJVA 2IM3A 2EHGA 4ZHRA 3L3UA 1S1TB 3PR5B 3OS2A 2RN2A 3KTQA 3H4DA 3K5MA 3SI6A 2HNYB 4JS5A 4KAZA 3D28A 1KLNA 4J9LA 1D9FA 5I3UB 3DRRA 2R8HA 5KFTA 4DL7A 3OYFA 2FVRA 3LP3A 5KG2A 3NBPB 3KMSA 4Q5VA 5FRMA 1JLCA 1Z25A 4LH4A 3C6TA 4ID5B 4UQGA 3O3GA 1RCHA 4IDKB 4BACA 4NLOA 1HMVA 4FJNA 3RBDA 4K4VA 1XC9A 1U49A 3G86A 2O5DA 3VQ6A 1BCOA 3NMAA 4CCHA 1QSLA 4U7CA 3PX4A 1RA7A 2ETJA 5J2NA 2OPQA 3UPFA 4NLUA 5KG0A 3D45A 4B9SA 4HYKA 2VG5B 1LW2B 3LPTA 3QINA 2AU0A 5I42B 4DU1A 3S9HA 3PW4A 3OYEA 3M9NB 4O0IA 2HNDA 4CGJA 3M8PB 2ALZA 2HMIB 4FLUA 3NGYA 2HHVA 1TVRA 4FK4A 4O55A 3BSOA 5KG3A 2YNIB 1HNVA 2FLNA 4FM2A 3K58A 5HP1B 1JLCB 3VQAA 1LW0A 4CGGA 5KFRA 3L2RA 4M3YA 1TAUA 3DRRB 2LSNA 3QGGA 4ZP9A 3NH1A 3KJVA 2HNYA 4BWMA 3C6UA 1IKYB 3CJ5A 2J6TA 2VG7B 3NF9A 1QE1B 2QV6A 4ELUA 3G0ZA 3F9KA 1JLAA 4H4MA 3MEDA 3SQ1A 2ITGA 5KT2A 3KD5E 4J2BA 5CY4A 4OL8A 4HKQA 1LWFB 3AVCA 1CSJA 1S1WB 2FJXA 3GIKA 4WE1A 4DS5A 4KV8B 4CHPA 3HKWA 2RDIA 4WFZA 2X6NA 4K4WA 3SUPA 3DLKA 2R8IA 4CF1A 5DG8A 3DYAA 4KTQA 4JUZA 2YV0X 1TL3B 1EP4A 3G6VA 4CEQA 4H4OA 2ZE2B 3L2WA 4FLYA 3KK1B 4B3OB 3JYTA 4RW7A 4H54A 2IMWP 2XY5A 2FBVA 1S9EA 3I0RA 4EBEA 1VSJA 1TK8A 4NLQA 4FS2A 4Q0BA 3PW5A 4FJIA 2XI2A 4FS1A 1DLOA 2PYLA 4DWIA 4ZVGA 1WSFA 4DQQA 3V81B 1RT6B 3IRXA 4EO8A 3D0PA 1BGXT 2IAJB 4DFPA 2YHAA 3LALA 4RNOA 2E6MA 1HJRA 3DM2B 2IM1A 3OLAA 2QE5A 5J2QA 1U4BA 4J2EA 3V81A 3RMCA 4NLRA 4IKAA 4EZ6A 2ILYA 5KFMA 2YHBA 1RTIB 5DQIA 1S9EB 5KRSA 3SQ2A 3JYTB 3OL7A 3E01A 5SZTA 4KHWA 3L8BA 5HRSA 3QEIA 1XHZA 2W42A 1X9WA 5KG7A 4CF2A 1GX5A 2HHQA 3QETA 2A1SA 4O5BA 4TY9A 2JLEA 5F9NA 4KTZA 2IGIA 2B5JA 3OSPA 3SFUA 1UA1A 1JLBA 1LWCB 2W8KA 3U3YA 1S1WA 3KHGA 4M42A 3CQ8A 2RDJA 3KHLA 3DLHA 1QSYA 1S1VB 4H4MB 3CM5A 4CF0A 3SYZA 1JLAB 4OKJA 4NRUA 3KK3B 1RTJA 3OYIA 3IAYA 3ZT4A 5KT5A 4CEOA 3NF6A 5KFBA 1S9GA 4NLVA 3VQBA 3BGRB 3MEGB 5KT3A 3BREA 1RDBA 3OYNA 2QXFA 1IKWA 3PJXA 5KT6A 3SFGA 1U09A 1RTJB 2OZSA 4DQIA 3KK3A 4F4WA 3DLBA 1TV6B 2OH2A 3O4NA 4IBNA 3KLHA 5KFDA 2C28A 4OPKA 2X6SA 3UR0A 3VQCA 1VRUA 3HYFA 3CM6A 2YNIA 4M95A 3AVKA 1GOCA 3HPHA 4YMEA 1TVRB 1REVA 2HMIA 2YNFA 3QIPB 2KZZA 3LP0A 5I42A 3KLIA 2ASJA 2FLLA 4DL5A 1VSDA 3TAQA 1SV5B 1S6PB 1RT3B 4CGIA 4WZQA 3SPZA 1S48A 1B9FA 1Y97A 3AO3A 4IKFA 3E01B 3AO1A 4OJRA 3SUQA 3IS9B 4FJKA 2HNZB 2P51A 4E7LA 4MK8A 1K6YA 3ISND 4J9PA 5DGAA 2DFEA 3OY9A 1NK9A 4NLGA 4IDKA 1S4FA 4J9NA 1RNHA 3HVWA 4F4YA 4FW2A 1TL1B 1SL0A 3LP1A 3IGVA 2R2UA 4DS4A 2HAIA 3MR3A 3RR8A 4TN2A 4KBIA 2CJQA 2BGGA 5KFEA 3QEPA 4KHSA 4ZVHA 4DMNA 4MH8A 2R2TA 4E1NA 1DLOB 3U6FA 2V4QA 4WFXA 2VA2A 3NKYA 1NJWA 3I0RB 4F50A 3OLBA 1ZBFA 4RW7B 4B3OA 3KLEA 2BR0A 2AX0A 2E9TA 5EUHA 3OS1A 2P5OA 3WNGA 1K1SA 2IM0A 3ZSVA 4RUCA 4RW6A 3DLKB 4TXSA 4K8XA 5DMRA 4KV8A 1Q8IA 3S3NA 4CEZA 2XGQA 4CJ4A 1MU2A 3SUOA 4I2PB 4RG8A 4FJ8A 3NCIA 3RMBA 3CDWA 5FROA 4CE9A 5DG7A 4DSIA 4RW6B 4JS4A 4PWDB 5HBMA 1Q9YA 2OPRB 5JUMA 4J9MA 1NK0A 4E7JA 1U45A 3PO5A 3T5LA 3KLEB 1UWBB 2G8WA 4BE0A 4WZMA 1IKYA 3C6UB 4O3QA 4YR3A 1RA6A 2KZMA 2XCPA 3KJVB 3M8RA 4M41A 3QYYA 5DG9A 3ZSYA 4FLTA 5HP1A 1BQMA 4KO0A 1TL1A 4KI4A 3M8QA 1HNVB 2IDOA 4DTJA 4EZ9A 1G15A 4ZPDA 3TAGA 3M8PA 2HNDB 4NLWA 3KHRA 2HNZA 1X9SA 1C1AA 4W5OA 3IS9A 4ZPBA 2BE2A 3P83D 4Q8EA 3I5AA 4FW1A 1LW2A 2AWZA 1TQLA 3L3VA 3WNEA 2GIRA 4I7FB 1JLQA 4XIUA 3T1AA 3V9UA 1TGOA 5KFQA 5J2NB 1I39A 1RT3A 2YNGA 4JLHA 1S6PA 4KE5A 1JLEB 3NH0A 2XHBA 1WSHA 4IG0A 4NCBA 2HWHA 3H5UA 3V4IA 1S10A 4BE2A 3LP0B 2JEFA 5EU7A 2YNFB 3QIPA 4NCGA 1REVB 4ZTJA 1HMVB 4FJ7A 3VQ5A 3K5LA 3VQQA 5J2PB 4O3OA 3H40A 3RWUA 1S5JA 3DLRA 2BANB 3OYAA 4DTSA 1J5OA 4NYFA 3KLHB 3NBPA 2VA3A 1NKBA 3S3OA 3DLGA 1TV6A 4ZPCA 4ECYA 4K4ZA 3AA3A 1SH2A 3FRZA 3MTKA 4HUFA 4N5SA 4RU9A 2FBYA 1NNDA 4FXDA 1NHVA 1SKRA 2ATLA 1NOZA 3UIQA 1S1TA 2UVVA 3UQSA 4AHCA 2B4JA 1WLJA 4CFBA 4E7IA 4WFYA 2D0AA 2V9WA 3MEEA 2BRKA 4ECWA 3CDEA 3LWMA 4BE1A 4Q8FA 4LQ9A 1C1BA 4FK2A 1S1VA 1C1CB 1XR7A 1VSIA 4WXWA 4MK7A 4DL2A 1WSIA 4GVMA 4DU4A 5KFZA 1UA0A 2ATQA 1HPZA 3OSNA 2FVCA 4N41A 1BISA 3V6HA 4W5NA 4KHQA 1KHVA 3LZJA 4Y1DA 2B5JB 3ULDA 4URQU 4QWBA 3QEXA 3DDKA 3HO1A 4DU3A 1Z26A 3ZSWA 1RBTA 3ZT3A 4ED8A 1RT7A 3T5KA 1RYRA 1QUVA 3DI6B 2WRMA 5KG5A 1U47A 4CJVA 3OYCA 3MFHA 2R8GA 2VG6A 5KI6A 3QLHA 3DMJB 4O44B 4CJPA 3C95A 3AVLA 3OJSA 3MR6A 4CIFA 4H8KA 3LP2A 4F3OA 4ECQA 1HQEB 5J2QB 5KFOA 4M3XA 3DM2A 5KFIA 1WSJA 3CFPA 2IAJA 1D5AA 1RT5B 3IRXB 4CK3A 1KSPA 4PUOA 1TKTA 4NYNA 2J6UA 3OL8A 2OPPA 4C8KA 1KTQA 3O3FA 4Q0BB 2G8VA 4G1QA 1XI1A 5KFHA 5L1JA 1RT2B 4FLXA 1QAJA 4URSA 2QKBA 4ED1A 1D1UA 3T5JA 3LWLA 4H4OB 1EP4B 3JSMA 2R2RA 4CERA 4DF4A 3DYAB 3ITHB 3UDLA 3OYMA 2D5RA 3NE6A 3IN5A 1FXXA 1NK4A 1HQUB 1IKXA 4RW4A 3KLGA 2HVIA 4R5PA 3BQ0A 5JXSA 3NH2A 2AJQA 3NAIA 4KHUA 4WE1B 4KPYA 1LWEA 1JLGB 5CYQB 2CKWA 3U3GA 3NGDA 3M8SA 3V6DA 1D9DA 2WHOA 1S0MA 2E9ZA 4Z4HA 1LWFA 2YKMB 2Z1JA 1KVBA 4CF8A 3RB3A 4K4UA 4NRTA 1SUQB 2Q3SA 3ZT1A 3LAKA 4I9QA 4KKOB 4O4GB 4FJMA 3AVMA 3TANA 1S0NA 1QE1A 4J2AA 3PHEA 2IOCA 3P1GA 4F3TA 4ELTA 2VG7A 3Q8RB 3K5OA 4KHRA 3FFIA 4DSLA 2Y1JA 2WB4A 4NLTA 3KK2A 1RBUA 1HRHA 4CIGA 5JS1A 3OL9A 5KGWA 1N56A 2PYJA 1LW0B 3CO9A 4EYIB 4KTWA 2XY6A 2YNHA 4G3IA 1EETB 4TLRA 3TAPA 2DY4A 4QAGA 1K1QA 1KFDA 1RBRA 4MFBA 4HUGA 4DL6A 4IG3A 1BQNA 2C22A 4HHTA 2D3ZA 2YKNB 5KGXA 4YR2A 4GC6A 4J9OA 1T7PA 3LANA 1IKVA 2O4IA 5F8JA 2VG5A 4K4XA 2B6AB 5C5JA 3VQ4A 3TAMA 2OPQB 3G6YA 4Y2AA 4O4RA 1NKEA 4C8LA 3HVTB 5DQHA 1S1UB 5L1KA 4CHNA 4R8UB 3QIDA 4QWAA 4O0JA 4RNNA 4E3SA 1VRTA 3AVFA 3K5NA 1KVAA 4DFKA 2BQ3A 3OYDA 5J2MB 1RDCA 5HLFA 4RNFA 1JL2A 4NCAA 2FC0A 3VQ8A 3AVHA 3I5BA 2EC0A 3HK2A 3QEVA 1CXUA 4ECRA 3L2QA 4EO6A 2E9RX 1XWLA 2R2SA 3C6TB 4ID5A 3KLVA 3OHBA 4IR1A 3HT3A 1JXLA 4W5TA 2FJWA 4N76A 4OPJA 4RUAA 4DSFA 5KT4A 3GILA 5DLFA 4KFBB 5F8MA 5I3UA 2QK9A 1NK6A 4DSKA 5C24A 3E51A 5DK5A 5C25A 4ECVA 4IH7A 1DTQB 1YTUA 1B92A 3QNOA 2G8UA 3VQ7A 2W7OA 2OZMA 3TARA 3HM9A 1EKEA 4CEAA 1QHTA 1FKPA 4ZHRB 3LAMA 4CFCA 4DQRA 1N5YB 5KFCA 4DTPA 4Z0UA 3M9OB 4QPXA 3GV8B 4PY5A 1UOCA 1UAXA 1VSEA 4PA1A 2I5JB 2HHUA 1A5WA 1S6QB 2RPIA 3DOLB 1TKZA 1ZYQA 1NK8A 1JXBA 4JRPA 5FDLA 4CJRA 1S9FA 1JIHA 3OYGA 4Y34A 2XY7A 1T05A 1HARA 2NUBA 2R8JA 1U04A 4DFJA 2AX1A 1RT1B 5D3GB 2IC3B 3KOAA 1KFSA 2PY5A 4E1MA 5KFAA 4ZP6A 4MQ3A 2UUTA 4QWDA 4CJWA 3I0SB 4PQUA 3OHAA 1IO2A 1JXEA 3PVXA 3SQ0A 2X78A 1C0TA 5K14A 1N4LA 2OYQA 3V1RA 1T03A 3MFIA 1FKOA 3MECA 5KFSA 4M3ZA 1S97A 4KHMA 4KSEB 1WAJA 3TVKA 1RTDB 5F8IA 3OYKA 2ASLA 1C0MA 4CIEA 1NK7A 1HYSA 4E7HA 3CJ3A 2C2DA 1ITGA 1QSSA 1RAJA 2XY8A 3TABA 4DL3A 4IFYA 1HYZA 1KRPA 3MR5A 1S1XA 4F2SA 3IG1B 4K8ZA 5HRPA 3G6XA 1CLQA 3OYLA 4BDYA 3GYNA 4EBDA 3LPUA 4KB0A 1QAIA 3CDUA 4FJXA 2W9CA 4DEZA 3VQPA 3QESA 4CJLA 3KKSA 3PUFA 3OL6A 4X2BA 4OLAA 4RW8B 4RW8A 3HHKA 1LAWA 4Z4GA 3GQCA 2BQRA 3A2FA 4NYZA 3C94A 4MKBA 3AVAA 4RW9B 2DTUA 1YT3A 3I5CA 3ZSQA 1WNSA 2V4RA 5C42A 1BL3A 4CEFA 3MXJA 4DQPA 4ZP7A 4K4YA 3PX0A 1S1XB 1R0AB 3N6NA 3M9MB 4AHVA 2W9BA 1O1WA 1WN7A
chains in the Genus database with same CATH superfamily
1RDDA 5CCLA 4Y3CA 2IA6A 1EKSA 2JWKA 3KNAA 1VQKS 4LRFA 2LA4A 2G0JA 4OVLA 4AD6A 2HQCA 1B4SA 2DBBA 3O2IA 4B3MK 2Z30B 4KBOA 3X3UA 1VHIA 2AJ0A 1T03B 2MKIA 3KIOA 5KFVA 1FK9B 1D4XA 3LL3A 3VA3A 3FCWA 2E1YA 2KFZA 3AAPA 3VPZA 3OW2M 1X4BA 4NPOA 3J7YU 1LAVA 3BBCA 3FEXB 2H5IB 3OXFA 3CCMN 2IDLA 1NJXA 5KOXA 3U9DA 3QATA 3C14B 5L9NA 2PI4A 4J9KA 3MF5A 3T7ZA 1HWUA 1VQKN 2CA9A 2KW4A 3VEXA 3DDIA 2W2QP 5MAOA 2KO1A 2RF2A 2CPHA 3DOLA 1Y10A 1S99A 3NVMA 4ZIWA 4DOZA 2Q66A 1NB7A 3DXKA 3JAMY 1HWIA 2WVEA 1CJUB 1SZ2A 1SI9A 1U48A 3AXKA 4O3NA 1T94A 4HTJA 2PEBA 3P49B 1PKUA 1ZBIA 4AHTA 2WK4A 3O9UA 1DTTB 1T6CA 4OKEA 1D8YA 5C24B 1QAYA 3MMCA 5HRRA 2YX6A 4RKUC 2HVEA 1QTNB 2DH7A 1YITN 4OZ1A 4RWXA 2MMYA 2Z1GA 4JI1F 4DUZK 2E20A 4MDBA 2RQKA 1HNWJ 1LOTB 1S0VA 2QLJB 4DSEA 4ELVA 4BRHA 4IR9A 1HL6A 3L4BC 3P4UB 5J2MA 1P9YA 2XTJP 3KD1E 4U8VA 1N34J 1I94J 1X4DA 5DGBA 2IS3A 4JI8J 4DR1K 3CMQA 3RUBL 4YB1P 3SIPB 3PZPA 3HP6A 3EYZA 1RUSA 2KJVA 3ZEUB 5JVHQ 2C2EA 3NXZA 2LCWA 4BLGA 2YY3A 3RB4A 4CEBA 5GADP 4GO5X 4JNEA 5IQ6A 3MCMA 3W8PA 1JKHA 5CHIA 1RTHA 4BR7A 3BPDA 4B1VA 2B51A 3IWLA 3QZ8A 3MN7A 1RT4A 1RZMA 4J90A 4M5HA 2QWLA 2OO4A 2EX3A 4X66K 1ITPA 3FZBA 1Q1KA 3EZ5A 5JMNA 1EXQA 2BJ9A 5T41A 5ETQA 3GLJA 4HVZA 4PL8A 3Q23A 4ZLNA 1HNIA 3RRHA 1NJZA 2PEHA 3HSTB 4Z4FA 4ZLJA 3PM9A 5D8HB 2AMCB 2VODA 4PZVA 2P9GA 3TA0A 3ZT2A 2CWKA 1U2FA 4O4GA 3FCVA 2ZHBA 2VONA 3HJFA 4WTYA 4C8MA 1OS5A 2Y1IA 3TSPA 3I87A 1RWNB 1XMOF 3TO8A 4WFNQ 5KFPA 2ZD1B 4HL9A 1DGKN 4LSLA 4L75A 3BSCA 1XQIA 5A8RB 4JI0F 5HOOA 2EKYA 2FXUA 4B1XB 3CPWR 3T6JA 4M94A 5E2QA 3GSDA 3PX6A 3OD2A 3PYEA 2XI3A 4LRCA 1P6TA 4DTMA 1KNZA 2VFTA 1OYDA 2KH9A 2HQ3A 3CCES 3CC7S 2H54B 1Y11A 3L7OA 3HP9A 2M88A 5M1PA 1RDRA 3PKMA 1NGDA 3L09A 4LF6F 1K8KA 4IRKA 4K7QA 4DV0J 3O1BA 3AVBA 3EICA 1K47A 4CJQA 4Z94A 3HVRA 1HYSB 1EX4A 3TJAA 2CDRB 3FSYA 3A3OB 4QYZK 2Z1IA 4JHDB 1HQEA 4ZCIA 2ZBRA 1GOBA 1KHWA 3LDLA 2P6SA 3GCXP 4C7QA 1K44A 1RAOA 1C0TB 1FJGK 4LUBA 4J9SA 2AGQA 3D0GE 1V3SA 5CXTA 2QTDA 2DGXA 2GV9A 1R8AA 1BWVA 1TAQA 4DV3F 4JBCA 3M2VA 4J9QA 4DR1J 4IEEA 4NLCA 1CQNA 3R1HA 3DRSA 4WXOA 1BHLA 4Y0WA 1QQCA 3ZSRA 1F21A 4USTA 2ZBQA 2UVUA 2WBNA 5D4LA 3QO9A 1EQ0A 5HSPA 3E9PA 3DRSB 4DHVA 4NZ0A 4BRNA 3O9QA 1JNZB 4BC2A 3M1VA 2VC0A 5GMKa 1U02A 3ENOA 5DZ7A 1FKPB 1FK9A 4KAIA 1HI1A 1DKGD 3NAEA 2JOQA 3H2UB 5AQJA 4USHA 4LSNA 4B3MF 1IBCB 1H3DA 1U0HA 2KHDA 3C8YA 2ZZNA 5GMDA 1VJQA 3SJJA 2CZ4A 2FZGB 4A2AA 3B6BA 1YJVA 4IUFA 1SPBP 4ZTFA 2MQPA 3Q83A 1RLDA 1ZAVA 4I2QB 3AD8C 1VSHA 5IT9U 4OJ3A 4UW2A 2E44A 2XO7A 3W9HA 2GX9A 4CJKA 2LKZA 1XHXA 4Z4CA 1VRTB 1N32F 1VQ6S 1S1UA 3MM5A 1NGEA 4B8CA 1ICEB 1S6OA 4UTGA 4CWBA 3C7NB 4LRDA 4PXBA 2BYCA 4FXWA 4RR5A 2FJBB 4N47A 3WXMB 1FJGF 3PV8A 2DRBA 2GO9A 4OYOA 3IGNA 4CLTA 2VUGA 1HYVA 4A46A 4LFBJ 4JKGB 4BWJA 4LF7F 2NRXA 3G6EN 4MIAA 2ZWHA 3BQ1A 1ATNA 2D0PA 2WONA 2IJNA 4IFYB 3Q24A 3KWGA 3T19A 2CQHA 2QL7B 1YG0A 1HKBA 3AVGA 1HWJA 2C2RA 2VPZB 3MD3A 4OYXA 3HXMA 2RB7A 2GAHC 1YXQA 3UDVA 1HR0F 1ZC6A 2ZH6A 4BVPA 3THVA 3T1HK 3HM8A 1KVCA 4Q2MA 5AQSA 2DO4A 4CLKA 2MY7A 1W7AA 2PDAA 2R7WA 4Z2XA 2A1BA 2HRUA 3J7YI 5L1LA 1ESVA 4C9DA 1W9HA 3H08A 3MN6A 3Q8YA 2YKMA 4ETXA 3P6YC 2GQQA 4FJ5A 2CXEA 3EPIA 1VQ5S 4KHPJ 1IJJA 2UUCF 3QWUA 5FDLB 1CJKB 2F9WA 1KLMB 4FZVA 2ROPA 3KJFB 4WYWA 3SMZA 1CULB 4RW4B 1YDLA 1U1OA 1FJGJ 3RGIA 1GH8A 3CW2C 5F0XA 1C6VA 4B9TA 4WK3A 1XTZA 3W5YA 2HSTA 1NDLA 5K8OA 2F8EX 3M2UB 3UD5A 4EYHB 3RMAA 3VOVA 2L3MA 1MROB 3CTRA 2GVDA 4FJLA 3JTNA 4F4KA 2NXUA 2JVOA 5GIPA 4KFBA 4I6YA 2DNHA 2CG4A 4L3KA 1RT5A 1NGGA 2ZC3A 3HPGA 4FJHA 1WWHA 1MN9A 3H4BA 5D0EA 2OIHA 4FZYA 4K50A 3ZZUA 4QWCA 2IBKA 1I3AA 4MKAA 4D3GA 2F4VF 4OV1A 1HHTP 1CVJA 3MI7X 4ZJLA 2OANA 4EWTA 4OZ5A 4IOCL 3EDRB 3DI6A 5KFWA 3MR7A 4QW9A 3ZNJ1 4NXMJ 1F2HA 3VGTA 4L73A 4E7KA 3QEWA 3PJWA 4CLPA 5K8PA 2Z2LA 1OH7A 4KGZB 3BO4A 4EIAA 5LXYA 3OUYA 2CUYA 3VAJA 3LW5C 4LIWA 3NFAA 3CJ8A 3A5LC 2VFRA 2GW8A 1BQNB 4YOVA 5ETLA 4USMA 4IG3B 2DXEA 2FVPA 4WYBA 1NDPA 5LSRA 4CZKA 5HN0A 4DV4K 1C1CA 3CF5Q 1IG9A 2E2OA 3KHHA 2IVFB 1UEVA 2CZ9A 4QWEA 4L8RB 3DRXA 1EZZB 2P9IB 1W26A 1RWOB 3SV3A 2IIRA 3FDSA 2QWNA 3MEGA 1R0BG 4U6PA 2HHTA 3EE9A 3FFIB 1RYSA 5JMVA 4NX9A 3W2WA 4YOTA 3DLGB 4XH4A 1M5KC 3I96A 3N6LA 1EQYA 3JQMA 4MK9A 3KUHA 2CJBA 4YB5A 3ET6B 3M6UA 3RB0A 3D5MA 1CLFA 4AL5A 2UXCK 2C3PA 2J9CA 4B1WB 3V4IB 3T3FA 1C0FA 2E7WA 2E4LA 4IG0B 4B3SK 3OW2R 4AILC 2V8PA 1QZ5A 4DX7A 2H4WB 3ZXWA 2AF6A 2BTFA 2DPJA 3S1TA 2WVCA 4UUXA 5KG1A 1GAOA 3LDSA 5CD4A 1GLBG 1JLQB 4CZJA 2E8AA 1WSGA 4NO7A 3C6HA 1RT2A 1FWKA 1HW9A 5T14A 3OVSA 1RU1A 1HI0P 1RTIA 2EWSA 5C12A 3W64A 1BOTO 1JJ4A 1B9DA 1KWMA 4I0WA 1FESA 2JC0A 3GV5B 4Y0FA 3M8QB 1VIXA 1GNKA 3G71N 5B0BA 5KFXA 2DFHA 3PIPL 3LP2B 3OR1B 2I7PA 2GVZA 1AB8A 1YGYA 3MECB 3JXUA 4AL6A 3CERA 3VEVA 3T5HA 3D3CJ 1ZBSA 2UUAF 3US5A 3HZEA 1WDTA 3JSRA 2YQ1A 3I0SA 1RKJA 1KQGB 2JHEA 1RAGB 4IZ9A 1YJTA 3CJBA 4AM6A 5AQGA 1NSPA 2OPRA 2Z0GA 1U1QA 2NRHA 4M63A 5HBMB 3PR4A 3MR2A 4F4XA 1IM4A 4JK7A 3W8GA 4WQ4C 4W5QA 3DRYA 2QG9B 4LBIA 1SJ1A 3CFOA 3RBEA 2MHNA 1CPZA 3PFEA 1TL4A 3FRYA 1HJOA 1B99A 2XS7A 2V8HA 1Z2LA 3D4JA 2B8QA 1XMOJ 3CYMA 2FJVA 2HBQB 2QX0A 5IM0A 4C4WA 3PJ9A 3OS2A 4LF4K 3E2EA 2V94A 3MK6A 2YCHA 3H6EA 4J9LA 2IVNA 2ADCA 5KFTA 3ISZA 4CLYA 4IO9L 5KG2A 1IUJA 4Q5VA 3ULEB 4UQGA 5DDRC 1RCHA 1KR4A 1G6BA 4IDKB 2CQ2A 3EN9A 4JI7J 2OGUA 2OMOA 1XC9A 3G86A 1KDNA 3VQ6A 2E5GA 3TPQA 4X4SA 3RAMA 4DX5A 2ERRA 2P6TA 1VQPS 2F3JA 4ISGA 3ADAC 3W66A 1NUEA 1MG7A 3UPFA 4NLUA 4X64J 3NNHA 3FGUA 3ILIA 2RH3A 2IY5B 3ZTOA 1RP5A 3EWGA 3PW4A 3M9NB 4O0IA 3M8PB 2ALZA 2HMIB 5LMNK 5JLHA 4ZPTR 2X51A 3RG6A 3ZETA 2YNIB 1HNVA 3THXA 1Y5LB 4WFBL 4FM2A 1KAZA 2EFNA 4C11B 1JLCB 1U26A 1IG8A 3WXIA 1LW0A 4CGGA 1XNQK 5G0RA 3L2RA 4M3YA 4JP8A 5E3QA 5B8HA 1AA1B 1P8GA 2FD2A 4ZP9A 1IJEB 4AL7A 4P10A 2EI5A 5BR8F 3CJ5A 2J6TA 1YZ6A 5ETMA 2VGNA 4L74A 2DR5A 3MM7B 3NF9A 4KHPK 3D54A 5IM0B 1YJNS 3G0ZA 1YJUA 1JLAA 4H4MA 4X66F 4LFCF 2MZQA 1E6VB 7FDRA 4QOTA 1FERA 2EK1A 4UZBA 3GIKA 3AQPA 3C66A 4KV8B 4QS9A 4PQAA 3AA9A 2X6NA 2C3YA 1YAGA 4NLBA 3MM9B 4TVAB 4MYUA 4OYMA 4DR7J 5DG8A 2B4VA 2YV0X 3CIMA 4ZITA 3SBGA 2UU9K 4H4OA 1O51A 4FLYA 3EZOA 4RW7A 4H54A 4FO0A 1PSDA 3FC9A 3I0RA 4EBEA 1TK8A 5A6PA 3TW0A 4FS2A 1MWMA 3IUCA 2ABYA 2KL8A 4Q0BA 3QPIA 4UOFA 4KGVB 2IIHA 1ZM2A 4DQQA 5KPZA 1CJVA 2H3GX 3V81B 4OX8A 3CCSS 4EO8A 3VTHA 3Q8VA 3LALA 3UD4P 5HMWA 4RPFA 2MYFA 1X0FA 3RMCA 4GVBB 5CZVA 3GJTB 2R7SA 4CT9A 2CGKA 4HDHA 5DQIA 5EOYA 3CHWA 5KRSA 2LU1A 4EGLA 4P73A 3SQ2A 3OXLA 2B0GA 3PIOL 3TRGA 1TL7B 2R7OA 3NNCA 3QEIA 1FVSA 1X9WA 3KVGA 2HHQA 1GX5A 4CF2A 3QETA 3WEEA 4NXNF 4X64K 2AYMA 4XTTA 1ZPWX 2Y8YA 4CTAA 3MMVA 2KYXA 3KHGA 1EWQA 4M42A 3KHLA 4WK1A 1UW9A 3DLHA 3E9OA 1OPIA 4OJHA 1S1VB 2QMXA 2DNPA 2FJEB 5AR0A 2QEXN 2H5JB 4NRUA 3BZKA 4RCHA 4DX8H 3ZT4A 3UW1A 3M05A 4NLVA 3DLLQ 2HGNA 3MEGB 3G82A 3BREA 2NYIA 2GFFA 1FXLA 4G1IA 3P3DA 4WQ5C 3KLHA 2C28A 2X6SA 3UR0A 4KY3A 3PKYA 1R8CA 1VRUA 2X3GA 3HYFA 3G8SA 2V8VA 2G1HA 1WC4A 2YNFA 3HKZD 4F25A 4OYWA 2YH1A 3VAHA 4DL5A 5F1XA 3TAQA 4FOIA 4P52A 3NCQA 2XSFA 1GXTA 1RT3B 2OTJN 4CGIA 4HT7A 4WZQA 3SPZA 3AA8A 2ZJPQ 4ER8A 4LFAJ 1Y97A 3JTPA 4IKFA 3CCQN 3VHQA 4OZLA 2VQFK 2POKA 5ADXA 3W62A 5K20B 3IS9B 2YXLA 2YKAA 4E7LA 2YWGA 3SXLA 2K2PA 4ED4A 4ILGB 4J9PA 2OHDA 3QFHA 1WKKA 3J80O 4IDKA 4PL7A 1S4FA 4J9NA 5IV4A 1Y9OA 2CPFA 3HVWA 3I31A 5EGYA 1SL0A 3LP1A 2HFSA 2E5LJ 3IGVA 4EFHA 2HAIA 3MR3A 4KBIA 5KFEA 4DR7K 3QEPA 1YSJA 4KHSA 1VBXA 1QVGR 3BO2A 2ZDOA 2E88A 1R31A 4HACB 2GVDB 1WI8A 3NKYA 2CJAA 1XMQK 1UZDA 2M52A 1X4CA 1OIAA 1NSKL 2BR0A 2AX0A 4U7UK 2AW0A 5EUHA 3OS1A 2P5OA 1PYTA 4PCQA 3CMEN 2CPZA 2QM1A 2MQQA 4F67A 1CS4B 3PXGa 2C2OB 1TL5A 2KG0A 1Q8IA 3UFCX 4OZJA 4CJ4A 4KIAA 2H9ZA 1Y4ZB 4LFAF 4I2PB 4RG8A 4RLEA 4HHUA 3CCVN 4JS4A 4PWDB 5JUMA 4EHTA 1FRIA 1YWXA 1U45A 4E7JA 5HMYA 3N0VA 3KLEB 3C6UB 4C1NK 5CR4A 4FSVA 1WELA 1VJWA 3GIRA 1MLAA 2ZBIA 4BVOA 3GYXB 2PAVA 2LLZA 3R7SB 2R7QA 3ZSYA 5HQ8A 4FLTA 3MMBB 1QY7A 2ZM6K 4W90B 3CPWM 2P2CB 1YF5L 4ZPDA 4OZ0A 5AQRA 3TAGA 1NXIA 1QZ6A 1S59A 4NOHA 3W3SA 4A8SA 4NLWA 2NRZA 1JQGA 1X9SA 3CCEN 3THWB 4JKGA 3IS9A 2IVYA 1NMDA 3R8YA 1DFDA 3WNEA 3M30A 2GIRA 3CC4N 3V9UA 4A4JA 1I39A 3VAGA 2YNGA 1ZS6A 4DR3J 4B3SF 2YKOA 3R5AA 3L6QA 3ILLA 5B0DA 2HWHA 1OH6A 3V4IA 1S10A 3U8XA 5A8WA 5RUBA 2WTUA 4ZTJA 3OFFA 3MCPA 1NLKL 3VEYA 1S7HA 3K5LA 3PDNA 3MDQA 3SCIE 1N34F 1I94F 3H45C 1N33J 4NYFA 3KLHB 3NBPA 1NKBA 2VOPA 1FFSB 3DLGA 4ZPCA 2B7BB 4ECYA 1OH5A 1CG2A 3M3ZA 3HFZB 1NNDA 2OELA 4H5NA 1NWKA 1SKRA 4DUYJ 2F9JA 3PCOB 5F3TA 3WC2A 2B4JA 4J5OA 3LWMA 2YI1A 2ZKTA 2PFUA 1PJ6A 3VF6A 3I56N 3NMRA 5ETOA 4DL2A 4GVMA 2GTDA 1UEUA 2CQCA 4RO0A 4DU4A 5KFZA 1HPZA 4PKGA 4N41A 3V6HA 4W5NA 3O44A 5BXIA 2MLYA 4GKKK 1WF2A 4OJ1A 4GY2B 2VJVA 1KOOA 1UZHA 1Z26A 3CC2N 1X3MA 5SUHA 1WSRA 2HFUA 2CWXA 4ED8A 1RT7A 3ATVA 1GLEG 4LF7J 4WWSA 4WCEQ 2CAJA 4CJVA 4JI5F 3MFHA 1N5TA 3QLHA 3DMJB 2VPXB 3AVLA 1O8BA 4CIFA 4CO3A 1XNQF 4H8KA 5FLXU 2M8DB 3MM8B 1HR0J 2M5YA 2IAJA 2MZJA 1RDWX 2G4BA 2YTCA 2DNRA 5AQVA 1M5OC 3ENQA 5BPNA 1KSPA 1XMBA 2J6UA 4C8KA 5AQWA 4NA3A 3HD1A 1YRXA 2MQOA 2G8VA 4G1QA 1U25A 3TR5A 4URSA 4M8LA 3CF5L 4QS8A 2N82B 1NAQA 3DYAB 4DF4A 3UDLA 1KXPA 1FXXA 3RVCA 3KLGA 1CULA 1BWFO 5JXSA 2OKQA 1Z6RA 5D4NA 1RWPB 5LJWA 2V2QA 1JLGB 4J91A 3WQPA 4HHHA 4LF8K 5A8KB 5AZIA 4CZCA 1KVBA 5AXKA 4CF8A 2PC6A 3IDHA 4B3RF 1TZ0A 5IFMA 3J81O 2G13A 3QB0A 4FJMA 1TUWA 4KGKA 1S0NA 3BBBA 1YJ9S 3P1GA 2UP1A 1P1TA 1VI7A 1XIQA 3CCSN 1IM6A 3Q8RB 4WP3A 2YX1A 4GKJK 4DSLA 1BXNA 1K0VA 3LDNA 2HGLA 3KK2A 1RBUA 2DRAA 1HR0K 3IXQA 5JS1A 3SCLE 1N56A 4LR8A 2PYJA 3CCQS 4G3IA 2OFHX 3R5DA 4ZKAA 1HKCA 4OI4A 3T6BA 2DCUB 4TLRA 4W98A 3GTYX 2A10A 4G65A 3LTOA 1R27B 4MFBA 5A0YB 1NZAA 5E5NA 3HHDA 4CO2A 4E8UA 1SJRA 1MA9B 1MMNA 2YVSA 4NEZA 4ENOA 2R7UA 2KXFA 4J9OA 1S6UA 1VHFA 2HFNA 2E1CA 3LANA 4H0PA 2O4IA 2VG5A 3A13A 4C0OC 1Q8KA 3TAMA 1OJ4A 3C7NA 1NKEA 4C8LA 2NXCA 3MX2A 4R8UB 3EXYA 4E3SA 3AVFA 4DFKA 1OY6A 4X4TA 3L9ZA 3AJ1A 5J2MB 4FL9A 4H5WA 3MXHP 4JK9A 2DY9A 2EC0A 1WHWA 2RE1A 4DV2F 1CXUA 4ECRA 1XMQJ 3W9IA 4JEPA 1NLVA 3HT3A 4L6V3 3M7VA 1G99A 2FJWA 4FVCA 4N76A 3ZTRA 2FQQB 4RUAA 4HI2A 1Q86O 3ID6A 1NK6A 4DSKA 5DK5A 1DTQB 5BR8K 4K0KF 3EJMA 1YJ9N 3P5TL 3HM9A 4O5FA 5DDQC 1NU0A 2F5GA 4CFCA 4DTPA 4Q2LA 4Z0UA 4M5KA 5GAGU 1VQLS 1N33F 1HBMA 1GLLO 1TKZA 1ZYQA 1JXBA 1X7VA 2DNOA 3DGPA 3KWMA 4B1YB 1JIHA 4YOXA 2R9LA 3DU5A 2NUBA 2R8JA 1U04A 1VQ9N 2YHWA 3TZYA 3BGFA 1N36F 1KTVA 3TZZA 1IBKF 4QWDA 1WEZA 3MAAA 1RKIA 3OHAA 2W6KA 3PVXA 1ZOTA 1C0TA 2OYQA 5GAGI 5AQXA 5I9EB 1XERA 3MN5A 3MECA 3JQKA 4P72A 5F8IA 3OYKA 1FT8A 1NK7A 1HYSA 4E7HA 2K1RB 1RAJA 4DL3A 3KUEA 3MR5A 3W60A 4M5DA 1DT9A 1UFLA 2M2BA 1S1XA 3AY9A 4LIRA 1JB0C 4K8ZA 2E5HA 3I4HX 1X60A 4OI3A 3JS6A 3LPUA 5HANA 3ELHA 2WB1D 2Y3YA 2W9CA 2ZBPA 1HNWK 5GAEU 2EFPA 1Q7YT 4ZN3A 3X1LB 1F5CA 4RW8A 3HX9A 5HL7Q 3NS5A 5AQYA 3A2FA 3AVAA 1N8RO 2P9PB 2YJEA 3GSIA 4RW9B 3ZSQA 4CEFA 3CD0A 2F4VJ 4DQPA 3PX0A 1S1XB 3FE1A 4AHVA 2W9BA 2P9NA 1O1WA 1WN7A 4PPZA 4YOYA 4OO1J 4X4UA 4NXMF 4A8YA 5LSLA 4C8OA 4DG1A 2BE7D 5DDOC 2ZF5O 2O8FA 2J0QD 2ASOA 5CA5A 2Y8WA 2VHGA 5CYMB 3MTJA 1BLUA 3BUZB 3SCKE 3ZT0A 3ZTPA 2IJRA 3SV4A 1WOOA 3BZQA 3GIIA 2KJWA 2P9LB 4JV1A 4JKAA 2BJ3A 3JB9k 4X84A 3SI8A 4ED7A 2P9SA 1PIEA 2R7XA 1SQFA 1T8EA 3TTFA 3HOTA 3ENAA 4BR0A 4HI1A 4JI4J 4BC4A 4LFBK 2MB0B 4ILJA 4DTRA 4DL4A 5ADZA 3KLFA 2VU5A 5T7LA 3RAQA 2BE9B 3DXSX 1KC8T 5F3ZA 5CZ1A 3N5BA 3A8YA 4DUYK 2ZNYA 3HMJG 5DRKA 3W5ZA 3U27A 3MPDA 3CT9A 4BC9A 3ENWA 1BMQB 2PGCA 5EWGA 1CC8A 3PW0A 4A61A 2R7RA 1BUXA 4CLFA 3PSFA 4J2DA 4CVNE 3CMAN 1QQNA 4K43A 2Q1NA 3D6MB 3EGVA 3FGVA 4UT4A 4JHDA 1J5EJ 2WSCC 4NA1A 2CGLA 4JI1K 4CLWA 1XR6A 3VQSA 3ALYA 1M0SA 2XMJA 4ZVFA 3QGIA 3O9RA 4V19S 2XC9A 1YBTA 3MMCB 2XZDB 4ID1A 4I1TA 1SL2A 5E3PA 1N6QB 2G2ZA 1WF0A 3M8YA 2WOMA 3SUNA 2Q79A 4CK2A 2SXLA 2E1PA 3OTBA 4IRDA 3FEZA 1XR5A 3C15A 2G9OA 2XWYA 3GG0A 2ZH7A 4EBCA 1B70B 4DV4F 4RBVA 1KLMA 2QA1A 4QOZB 3FBCA 1X8DA 4E19A 1KBRA 1YLXA 2EFQA 2VICA 4K0KJ 3C14A 3VGSA 3G9CA 4NA2A 1JCEA 3Q8QB 3L2UA 4TY8A 4IWVA 1EETA 1BI4A 5HQMA 3H5YA 4FVMA 3H46O 3NAHA 5J1EA 2HVDA 5FJ4A 1QS4A 1HD1A 1WG1A 4X4VA 3GP9A 2KKZA 3J80U 3VGKA 5LL6d 2RKIB 5J1EB 4DUZJ 5JJBA 2P9CA 1BI4B 3DLEA 1N36J 4FCYA 4HCCA 4KT0C 1RACB 2F96A 2KDOA 2D9PA 2MKCA 1WF1A 3V6DB 2AQ4A 3SEOA 3W2VA 3QRQA 4BRIA 1R89A 3CXCM 1KEKA 2CPXA 3PYGA 1RAEB 1S0OA 5HRNA 2D69A 2HK3A 4DMZA 3ZSXA 1MSWD 2UVWA 1JNRB 4CFAA 5K8NA 4AH9A 3QIOA 1VFJA 1VR6A 3KMQA 2ADBA 5MLCQ 2ZJQL 3EVMA 4YHHF 4B9LA 2O4GA 2H1YA 4CZEA 4B3TF 4ZDNA 1OVYA 2OPPB 4QR2A 3WNFA 3NDKA 4JI8K 4HCBA 4OLOA 4PWWA 1KQKA 2KTQA 3D2WA 3ZC4A 4L72B 2VQFJ 2DNLA 2DR7A 4K4SA 3DGVA 2DR6A 4KH5A 4IO1A 3T1HF 3K2PA 2HB5A 1RBSA 4XO0A 2E1AA 2ROGA 3EZUA 3IBWA 3VGMA 4UOHA 2ZDPA 4DV6K 1CJUA 4IQXA 2QWPA 1AT1B 2UUBK 1PYSB 3NGKA 5K5MA 1YJ7A 2AYGA 2VF3A 1X4EA 4DQSA 4XPEA 4URGA 1T05B 2QMWA 1YTAA 2DIUA 1LKZA 5T7LB 5EXWA 2I38A 1HPZB 4XEIA 1TKZB 3IRWP 1WKJA 5FPNA 4LFBF 4KRWA 4NLXA 2CQ0A 2FBTA 4RTFD 3MDFA 2YWKA 1N5YA 4ZA1A 2COLA 1KD1O 2NRVA 2HBYB 2HHXA 2F8TA 2ZKUA 3T9NA 2P9LA 1N32K 4CHOA 4KB7A 4FK0A 1CZ9A 2FYXA 1YHQS 3IWXA 2W8LA 1L3VA 5D15A 1LXJA 3KXDA 4CT8A 3UN3A 1TK5A 2IJFA 3H2LA 4Q45A 1X1PA 1S49A 3B6OA 2BANA 1YJWS 1J2VA 4ZCLA 3HL8A 1UETA 3JS9A 2RNEA 2P9NB 2J7WA 3V1OA 2UU9J 3H5XA 3B6PA 2HBJA 4NCGB 1S4EA 4H0VB 5HLFB 5KFGA 1YVFA 3UI3A 5C42B 1VOMA 4FVUA 3SBTA 4U7UD 2J4RA 1NPPA 1AXQA 4JYAF 4W5RA 2X1FA 4XK8C 3HHLA 1NBWA 2KI2A 3TEHB 3NS7B 4KHNA 2HBLA 4PR6A 4WFNL 2JEJA 2YKNA 4MIBA 2A6AA 4LSLB 1Q9XA 3MGJA 2JGUA 3V2UC 3ZZYA 3SSQA 4NLPA 3SDEB 1SCJB 4FNIA 3DLEB 1ULRA 2W01A 2ZVSA 2OEKA 4ZLLA 3MMBA 1BHNA 5JLFA 1X4GA 4DR2K 1HX1A 5L1IA 1RTDA 8AT1B 3J7Z5 3IA0A 5AFUH 1TKXB 4DTUA 2CQIA 3BR9A 4B17A 2LDIA 1LCUA 3LQVA 3IR7B 1L3UA 1RHMB 3D0IE 3HHEA 5KAKA 3CJ7A 1AUSL 4ZOSA 4DV7F 3G4SN 3UO0A 3O9SA 1N34K 1I94K 4TY8B 1LEOA 1RT4B 2FGOA 1C4CA 3E3XA 5AZIB 3J7ZO 5JVGQ 1X4FA 3TJ8A 1MU2B 2W9AA 3WQTA 3CQYA 5CZ2A 5AZJA 1L3TA 2AD9A 1IJFB 4KI6A 1GLDG 3CJ4A 4W92B 4R5PB 3VQ9A 3VA0A 1JK9B 4ZMMA 3MUVP 3NL0A 3CD5A 5A6WA 3DU6A 3GU0A 1CXQA 3ETMA 4B3RJ 5BYQA 2UVRA 1VSMA 4GVLA 4LREA 2H3EB 1VIOA 1SAZA 4ES3A 5HK4A 2AHOB 3LP1B 1FEHA 2VDIA 1DEJA 3ISNC 3TAFA 4IFVB 2IRYA 4IJNA 2P1JA 3F5TA 4ZP8A 4FLZA 3DWLA 2ASYA 1DTTA 4RL1A 4DR2J 3TWZA 4HTUA 5KFUA 4AT1B 1KCFA 2PI5A 4A62A 4R0EA 1KVIA 2O8CA 3SAGA 3ULHA 2E7VA 4UY8T 1FRJA 3ZSOA 3AA5X 1PC5A 2XCAA 5M1OA 3DRPB 1A0OB 3QAUA 4OKKA 4DR5K 4UOGA 4OZ3A 3V9XA 3KLFB 1SVDA 5G4DA 2IDEA 1TYQA 3W5XA 3R5JB 2OD6A 4XPCA 4CFDA 3OYBA 1IV0A 1V9OA 4DZ6A 3R2CJ 3B4MA 3GDQA 1N5SA 2KFNA 2P9SB 1J53A 4CF9A 3WT0A 3G6ES 4BRCA 1G3OA 3CJAA 3CD6N 3BGRA 1Q5VA 4FWMA 1H72C 4U9RA 1W7WA 1QQMA 2GJFA 1EB0A 4O3PA 4DR7F 3SLCA 4IDHA 4FZXC 1UVMA 4QCLA 2N7CA 5BN9A 1GMVA 5AJ3J 2BKNA 3E8OA 2OA8A 2YPZA 3TA1A 3O3HA 3NCPA 4BQLA 2V67A 3MMAB 4LF8F 1NJYA 2FY8A 1LWCA 4M3UA 2VBYA 5E7OB 4MKYA 2LQJA 2CJYB 1U24A 1UFKA 1RLCL 3ZZOA 3R97A 4S0MA 1A5XA 4B9VA 3DHWC 4K2XA 4KH1B 4PXCA 3KLGB 2QA4G 2CIMA 2AIRB 1PCAA 1R8HA 1GOAA 4NZ7A 1BG3A 2HHWA 1RWKB 2GV1A 3CIZA 2BE2B 3QGHA 3EUNA 2RRAA 2A5XA 5DM6L 4DFMA 3OVNA 4FF4A 1L3SA 1S12A 4DV6J 4LJMA 2A1RA 2DGQA 1RWXB 1T02A 1NEEA 3WZ0A 1PYOB 4OV6A 1RWVB 2FHMA 4ZVEA 4YY3F 1CZBA 3L4IA 4FJJA 2X1AA 4CI0B 3MCNA 1A5VA 4Z4IA 4Y2CA 1TMJA 2FHJA 4OGEA 3AO4A 2NUHA 4O44A 1NCLA 4YR0A 5H9EJ 3ZCMA 4JI5K 2HLUA 4CQ1A 2CQ1A 2X74A 2DITA 4FJGA 2V69A 2I2YA 3D2FB 4TQSA 3KK7A 5BR9A 2JX2A 3G10A 3UN5A 1TL3A 2Q6BA 4LF8J 2FB0A 3GCWP 1UKUA 2KQ2A 4CK1A 3CO0P 4I56A 5KG4A 4FLVA 2WVFA 4IOAL 1YITS 4H5TA 3F0NA 5F8GA 2CH5A 3BJYA 1K8AO 3H20A 3KG1A 2ACYA 4DTOA 3SK3A 2A42A 4L3NA 4CJ3A 4K59A 1YKWA 4DN9A 1QHAA 1FDAA 3GE9A 2ZH3A 2D4WA 1M90T 5HVFA 3KKRA 2ZM6J 4ZHRA 3R2DJ 2MY8A 1S1TB 3KTQA 2RN2A 3A8EA 4WFAL 1F60B 3SI6A 4JS5A 1KLNA 3IMXA 3DRRA 3OYFA 2FVRA 3LP3A 1ZPVA 3OTCA 2DY1A 4MKVA 1Z25A 3C6TA 3O3GA 4BACA 4NLOA 2NRTA 1DBDA 3ZX2A 3RBDA 1XNRJ 1RXOB 4LF6J 2RJZA 3UCZP 4A8KA 1FTRA 4ZVUB 3W7BA 3BM7A 2PD1A 4M5LA 2UXCJ 2NZTA 2CDQA 2W4DA 4P9SA 1U1NA 3SSSA 3G96A 3OTEA 4ZIVA 4ZJQA 2MGZA 2OCEA 4N77A 2MDAA 3KZBA 5H1SV 2XYGB 3A3NB 4HYKA 5ETPA 4IYQA 4O0NA 1XK8A 3D0HE 2HHHF 3LPTA 1VAZA 3QINA 3TSQA 4WCEL 5I42B 4DPYA 3R6LB 1R8BA 2HNDA 4FLUA 4FK4A 2P9UB 3BSOA 3NOGA 2O3DA 3OR2A 4BGBA 1LQ9A 2C3MA 1DZ5A 3AT1B 1VRQC 2ZOMA 2VBXA 2DHGA 3DRRB 2HQIA 3QGGA 2VV5A 3KJVA 1N8RT 2HNYA 3C6UA 5LOQA 3KDOA 3GFHA 1WC0A 3G71S 1QE1B 4ELUA 4EK2A 3J7AN 1VQOS 3F9KA 1RWWB 4ZVQB 7AT1B 2ITGA 5LL6Z 3A5NC 3KD5E 4J2BA 5CY4A 4OL8A 4HKQA 1LWFB 1RQ0A 1NMEB 3AVCA 2B3TB 1VDHA 2UXCF 3PEJA 1R43A 3GG1A 2DIVA 4NXNJ 4BROA 3J7AP 1QLNA 1Y5IB 4DS5A 1FFWB 3N79A 3HKWA 4K4WA 2BJEA 3DLKA 3DYAA 4KTQA 4JUZA 1APSA 1VGYA 2NSBA 3RYLA 2FHOB 4CEQA 1U2VA 2ZE2B 4DB3A 3JYTA 2IMWP 2FBVA 1S9EA 4JI4K 4LC9B 3PW5A 3D9BA 3BKFA 3OV7A 3RW7A 4FS1A 3NWRA 1RT6B 1GEHA 5ETVA 4F7VA 1CC7A 2YHAA 1S77D 2RHSB 4RNOA 1WC1A 2E6MA 2FDNA 5J2QA 1U4BA 3V81A 1VQYA 4PG7A 1S72S 5KFMA 2YHBA 2CQBA 4X65F 3M6XA 2IVOA 3TSUA 4XDCA 2R4FA 1RTIB 1X5PA 4WFBQ 5M1NA 1S9EB 5BJRA 3JYTB 3OL7A 4CI6A 1RTZA 2VOOA 5HRSA 2DO0A 3GFYA 3MM9A 4J8FA 2A1SA 4TY9A 5F9NA 4OYBA 1NG9A 2IGIA 3S6EA 4JV5F 2LQ5A 1B0VA 5D4OA 3SFUA 4QIEA 4QU6A 3DC2A 1JLBA 3IAM9 3BV8A 4CP5A 2W8KA 1IXKA 1S1WA 1Q78A 1WG5A 1HBNB 3FBEA 1VK3A 1VQ4S 2V4JB 3S7RA 2GMJA 4DPWA 2VASA 4X4OA 4CF0A 3SYZA 2WSEC 1C0GA 1NM1A 2O8EA 4K41A 4DKWA 1K9MT 1RTJA 2GCFA 4G9ZA 1NNEA 4CEOA 3NF6A 2UUAK 5KFBA 2HOEA 3IMQJ 4NI2A 3VQBA 4WU3A 3C6AA 1YUWA 2QXFA 1IKWA 3PJXA 2FJDB 2ZH2A 3AODA 1VK8A 4F4WA 3DLBA 2KXHA 2AA4A 4UZCA 3H1QA 4IBNA 3NGSA 5KFDA 2Q0RA 4OPKA 3FR0A 2J9EA 4Y2MA 3EX7B 1IBKJ 2YNIA 2YKPA 3HPHA 2ZJQQ 3B8HA 5GAHP 1T3VA 2HMIA 4BBYA 1PGZA 5I42A 3FZ2A 4FNHA 2KRBA 3KLIA 2ASJA 2B9XA 1O0PA 4ZPVR 2W40A 1S6PB 2RIJA 2A0FB 2ZOGA 3U4LA 1VLYA 4DR5J 3O6QA 3QJPA 3AO3A 1IWAA 3E01B 3M30B 3ZNUA 3SUQA 4FJKA 1FXRA 2P51A 4QIWD 2D9OA 1DQ8A 4LR7A 2W4PA 4NLGA 4OI0A 4PG4A 2VWBA 4F4YA 2W41A 4FW2A 3BY5A 3HD2A 2VFVA 1R59O 2R2UA 1I5OB 3RR8A 3NNAA 2BGGA 2H5EA 2M7SA 4DMNA 4E1NA 2WVBA 3BO3A 3AGRA 3D67A 4FPIA 3DXBA 2GHWA 5AE1A 3OLBA 3O5TB 1RB0A 3KLEA 5E0OA 1ATSA 3ZFVA 3HHLC 1Y3JA 3ZSVA 5C0YA 3DLKB 5KPRA 3SMSA 1N32J 1E4FT 1Q0NA 2LQ9A 4BGAA 3LF0A 3S3NA 2F63A 5F0WA 2O67A 2PE8A 5I4MA 3R6MA 3FLCO 4P74A 1YBAA 4FJ8A 1WACA 3NCIA 1QJHA 4DSIA 2LEPA 1Q18A 3PYDA 1Y64A 3EL2A 4XH1A 4J9MA 1FWLA 2HBZB 2LXFA 1H7WA 4H0YB 1BA0A 1UWBB 2FC9A 1NDCA 2UXDJ 4P6QA 2F8MA 2RQ4A 3KJVB 1V5VA 3R1LA 3VMFB 2ZJPL 4JI2J 3GB0A 4P2FA 5DG9A 3AGKA 5HP1A 3OR2B 2A6MA 1IBLK 1O5JA 2HNDB 5ETSA 5ETRA 4MMOA 1C1AA 3CJCA 4ZPBA 5IXUA 2BE2A 3K5PA 5HL7L 3I5AA 2CNKB 1LW2A 2AWZA 1TQLA 2DXDA 3IC1A 2HFZA 4XIUA 1VBZA 2CJ9A 1FJCA 2OUGA 1QQOA 4BRMA 1K0TA 5J2NB 4CRJA 1RT3A 4JLHA 1Y0HA 1S6PA 3NH0A 1JLEB 1FNMA 1YIJN 2RRNA 4GV6A 3H5UA 3A1YG 4BE2A 7FD1A 3LP0B 3L0QA 2OTJS 2DNMA 4X65J 3QIPA 3W9JA 1WUUA 2EEYA 4JI6F 1RAAB 2WBMA 1HMVB 3FJ2A 1KQSR 3VQQA 5J2PB 1ELOA 2UXDF 4O3OA 3RWUA 1TFYA 1S5JA 3MEKA 3DLRA 2BANB 2J0SD 1T0TV 5A76A 1ILYA 3T69A 1VQMN 3S3OA 2H48B 5AQTA 5AQMA 4O8UA 3NGRA 1IQTA 1SH2A 3PFOA 3FRZA 3MTKA 2MZTA 1DY3A 1HD0A 1YI2S 5C2GA 1NOZA 4FF1A 2MZRA 3ID8A 3FKBA 2YPYA 2HBKA 3QT7A 4RX6A 4ES1A 1NSAA 2HKEA 2E29A 3OBIA 4YDUC 2CRLA 3MEEA 2BRKA 4F9OA 4PKDB 4Q8FA 5FD1A 4B02A 1GT8A 2JWLA 1S1VA 2V52B 5IC6B 1XR7A 1VSIA 3FBBA 3CCTA 4JI0K 2PT0A 1WOQA 4DV5K 1OVQA 1WOPA 3UVJB 1BISA 1JJCB 5DETA 3GJQB 4Y1DA 3M2RA 2MKHA 2B5JB 3AOBA 4QWBA 3K17A 4PWUA 5AE2A 3DDKA 1YTYA 3HO1A 3QEXA 2DNZA 4C8YA 2QLWA 2E2QA 1XJWB 1SC1B 3AOAA 3VVTA 4QBUA 1RBLA 3WIUA 3D2FA 3DI6B 2WRMA 3CNQP 5AFUA 1U47A 3Q7CA 3ONQA 3LDPA 3D6TB 2R8GA 2VG6A 3TUPA 4CJPA 3RBXA 4N8OA 2J0XA 4FWQA 1RE1B 2PMWA 2RRBA 3K0JA 3MOZA 4F3OA 3CGIA 4ECQA 5J2QB 5AQPA 4M3XA 3LO3A 2CPEA 5KFIA 2HZCA 2VQEJ 4NXMK 4DHYA 1D5AA 4WQ5A 3FFKB 2UYTA 4M7XA 3VALA 3HDSA 4PUOA 4NYNA 2VL1A 1KTQA 1WD6A 4Q0BB 3D68A 3G8TA 2DJWA 1Q81O 5L1JA 1KQSM 4ED1A 3I56S 1D1UA 3T5JA 2ASMA 4H4OB 2MPUA 2R2RA 4JI2K 1PBUA 1PJ7A 2KT2A 3AB2B 5FLXY 2D5RA 1N5VA 1F9FA 5GVQA 1Z05A 1IKXA 4QIFA 2HS3A 2HVIA 1VMBA 3NAIA 4DZDA 2GMLA 4KPYA 3U3GA 3W2VB 4ID8A 4TKTA 1UEKA 3V6DA 1S0MA 4Z4HA 2XZTB 2YKMB 2Z1JA 4LRAA 1NGHA 4NRTA 3THTA 3ZT1A 4KKOB 5GINA 2IOCA 4ELTA 2HG4A 3K5OA 4Z7YA 1VQSA 4OHZA 3RSEB 1X5OA 2YHXA 3WBZA 1HIYA 3RU0A 2XS2A 4GKJF 1PJ5A 2AJ2A 2VQEF 2VYPA 1V3ZA 4C3MA 4LMZA 4DCHA 3NS6A 4M5GA 1LW0B 4WF9Q 5D0RA 2XY6A 2YNHA 4UUWA 3DN9A 2ZHAA 2BA9A 3QNWB 4C97A 4CO0A 1LK7A 4QAGA 3SDEA 1RBRA 1K1QA 1KFDA 2P9UA 4EUVA 3TEGA 2CQPA 4DL6A 3UDEA 2RAQA 5KPTA 4PKHA 1RBOB 3R7BB 3N4QA 4QR0A 1LOUA 3K7RA 4FPBA 2ATCB 3EM1A 1F3VA 5F8JA 5B0CA 4CBWA 2B6AB 3VQ4A 2OPQB 3VF2A 3G6YA 4JD2B 3HVTB 9ATCB 5DQHA 4EAHD 1S1UB 4O0JA 3PEHA 2HIYA 4DU7A 4K0KK 2BKPA 1AFJA 2BQ3A 2HF3A 2BUNA 4FPRA 2DH9A 5HLFA 4RNFA 5E33A 3MUMP 4AQYJ 1HLUA 3I5BA 3AVHA 1A6LA 3HK2A 1T9XA 3L2QA 4I68A 1XWLA 3BS9A 4O23A 2R2SA 3AB4B 3KLVA 1E6YA 3GWCA 4JKEA 3HSGA 1Q4RA 4GKJJ 3O5BA 1VQ5N 2VPWB 2LDYA 5F8MA 2E5JA 5I3UA 2QK9A 2DGVA 3E51A 2DGOA 4ECVA 3ZZZA 3VQ7A 1XNRK 5LJ5Y 2OZMA 1OY8A 1U2RA 4C8ZA 1N5YB 1NGJA 1RCXB 5IS2A 5K9FA 3QICA 2MQNA 2K3IA 1VSEA 2I5JB 1A5WA 4OI1A 1S6QB 4CH0S 5AXNA 2BOPA 5E3CA 3HTVA 1S9FA 3W0LA 3U1MA 5AZJB 3OYGA 2OJ3A 4Y34A 5AQHA 2MKYA 1HARA 3D6FB 4PYDA 2CPJA 1D9AA 4DFJA 2AX1A 4DV5F 2VGMA 2QWQA 3KOAA 1KFSA 3DNCA 4E1MA 3M2VB 3EE8A 4ZP6A 4MQ3A 2A2DA 1KC8O 3I0SB 2GGPB 4DV6F 1RFQA 2X78A 1N4LA 3EGWB 3KKFA 5GAEI 1T03A 2IRXA 3MPVA 2E7XA 4N8NA 3I82A 5KFSA 2DR8A 1WAJA 3PIOQ 3TVKA 1FXDA 2ASLA 4LT6A 4ANEA 3GG4A 1HHQA 2DCLA 2C2DA 5KQ8A 4BHQA 4CBXA 2QYGA 3SQGA 3OYLA 4OX9J 1MWZA 4HH1A 2F40A 2Z57B 1QAIA 3CDUA 4LR9A 4CIOA 4FJXA 4L76A 4WQ4A 4DEZA 3F2KA 3VQPA 3MURP 3K9KA 4F0MA 2R7VA 3T1YJ 3KKSA 4M63C 3OL6A 4KR0B 4X2BA 2NLWA 4OLAA 1P9QC 2VKRA 2QFJA 1LAWA 4Z4GA 3GQCA 3NVKA 1CQMA 3MM6B 1ATRA 3O1LA 1UCNA 1N36K 2AZ1A 1FCAA 4Y2IA 3UE2A 4MLEA 5GAHU 1HNZF 4ZN1A 1BL3A 1NJIT 4OZ2A 1M5PC 1RSCA 2MJUA 3MMAA 1UPMB 2C2KB 2ZM6F 2E1MC 3OT9A 2D3O1 1M1HA 2OAUA 4A8XA 1HBUA 2A2CA 4DF8A 4N56A 1T9WA 4F3QA 5A2QY 3NOCA 4NWBA 4B9MA 1FKOB 2D7SA 3BEGB 4AXIA 1HQ2A 2P9IA 3SAHA 1JCFA 5DM7Q 3DAWA 2QRRA 4LVNP 2G0IA 2V0NA 4NMXA 4PQUB 3J81j 5GAEP 1KAYA 3SZ2A 2KHCA 4DSJA 1WNEA 1HWLA 5EDWA 3V1QA 2FBXA 4CLLA 1QVGM 2AEMA 4CZMA 5JICA 4I69A 1EO1A 3CCJN 4RNHA 3W1YC 3K57A 3SCXA 2V7YA 3UNYA 4ISFA 4A47A 2R8KA 3DRPA 3R5GA 4H5RA 4FPAA 5L9XA 4U8YA 1SBRA 5AJ3F 3ATUA 4DTXA 2EPIA 3AVNA 2WOMB 2IFXA 3NF8A 4USUA 2BV3A 1MMDA 4BDZA 4DV1F 2LXUA 1Z4UA 1Y00A 3GV7B 3UKRA 4AUKA 4IFVA 4CJTA 5F8LA 1H0HB 5JS2A 4TU9A 2OSQA 4BCAA 1NBEB 1YJNN 3MXIA 3E1YA 1CEZA 3N6MA 2P5GA 2FVSA 4E1JA 1VHXA 5D78A 1VQ4N 3DXMB 4AXJA 2HQFA 1K8AT 3CWJA 3PY8A 2HQDA 2Z8QA 3TP2A 3JTOA 3IM9A 4NE9C 1SH0A 4X66J 3RMDA 4R8UA 2ASPA 4CECA 5FRNA 1YHQN 4HR2A 1ZBHA 4V19X 4JD2A 3TA2A 3V9ZA 5C10A 5BPLA 2P9KB 3ZSZA 4JAXA 5JVGL 4BY9C 3M6GA 1IKVB 2K3KA 3G2XA 3V6JA 4RNMA 5EHHA 2Z1HA 1NRKA 1X9MA 4DUYF 4HT5A 3EVWA 1WC6A 3D1OA 1M1KO 4KRFA 1Q86T 3O8WA 4EEYA 2JL9A 2LQBA 4YHHJ 3BF3A 4CEDA 3BYRA 3LZIA 4OMFG 3W63A 1U2CA 3CC4S 1T6DA 2VWJA 5E84A 1PAUB 2Z2ZA 1FRLA 5F8NA 1KD1T 5I3PA 1AFIA 2HSEB 2R3VA 2KT3A 3BGLA 4LQ3A 3AA2A 3U02A 4LF5J 1D3WA 1C0UA 1MMLA 4RZRA 5F9LA 2WCXA 1GX6A 3P38A 4CO1A 4LFAK 5M1KA 1LWXA 2ALYB 1I6JA 5CYQA 1ZBTA 4KPCA 2KKHA 1D09B 4HUEA 3AA4A 4Y00A 2ZGZA 1VCTA 2GHVC 3HHLB 4M45A 3C15B 1I51B 2LECA 2VWKA 4EMDA 3QERA 3H42A 3Q8SB 3CCVS 2ZVIA 2HHSA 2E2PA 2PZSA 3VAMA 3P96A 4QPTA 3FZLA 3AY0A 3N9UC 3LUYA 3QGPA 1FO1A 2AZ3A 4I2QA 2YJFA 2YKQA 3U9ZA 4BC7A 4C1NI 4M7YA 3CXCR 2V8DA 1GLFO 2Q3PA 2AGOA 2OTLN 3C2PA 1H98A 1ASUA 4CJSA 1WJ9A 4E89A 3TQEA 4GKKJ 5LSOA 2EVZA 2N4CA 2MXYA 4C3LA 3DMJA 3QLHB 2VG6B 3FSXA 2DXFA 3HCXA 2EFGA 1OYEA 5AJ3K 2QI2A 4LF5F 4GW6A 2GGPA 4CZGA 3D6RA 4AE5A 1RT7B 4E0DA 2BJDA 3TZXA 3AFGA 2ZZTA 3HPOA 3FZFA 4CJFA 1IBKK 2R7YA 5CQGA 3EKSA 1WAFA 4I6MB 3OFHA 2HRTA 2HWIA 4MO5A 2IM2A 4ED3A 1SKSA 2DHHA 2KB2A 3BH6B 4FJ9A 1T3NA 4B9NA 4CD3A 3BDPA 5BR8J 4GO7X 1G4CA 5HAOA 4HLBA 4TYAA 3SPYA 1FI4A 2ILZA 3MEEB 4BG9A 3JXOA 3NP5A 3IBCB 3I8DA 3ZZPA 4P75A 1RI7A 3G4SS 4F3MA 3R5BA 3AVJA 4NEYA 5KRTA 3M5RA 3SNNA 1B7YB 3EKUA 1WBBA 5KFYA 3ICLA 4J37A 2W2MP 5CYMA 1FTCA 2H4YB 1P90A 5KFLA 1BIUA 4CW7B 3BSNA 4DR4F 2BKOA 2Q97A 1VBYA 3R3LA 1E6YB 2EKNA 2F7TA 4F0KA 2GUIA 1R0AA 2B9YA 3BP8A 4F26A 4QIVA 3KG0A 2YX4A 5F8HA 3BSAA 2HHHK 4NXNK 4ECZA 4RWTA 3TWHA 4A8WA 3IFEA 4NYPA 2ASDA 2G8IA 4BDPA 5KT7A 3R6GB 3OTOF 3KFWX 4FYYB 3MXMA 4Q43A 4U7BA 1FRKA 4M3RA 4CYUB 2L08A 1C0UB 4BRLA 1WSEA 5HJYA 2K7KA 3GZ7A 4FKXA 2J6SA 3PACA 2YNHB 4OQJA 4CHZA 2DPNA 5DLGA 2YHYA 4FZZA 3RBZA 1VLOA 4JV5J 4FXVA 5H9FK 1CJTB 1DURA 4Y1CA 4LF1A 3VQEA 2BBEA 2ZJRQ 4NZ6A 2G8KA 4FBUA 1UWBA 2U2FA 2UU9F 3LDQA 3NGTA 1ZAWA 1ZETA 3DOMA 4PWDA 1QTMA 1RT1A 3AHPA 2J9DA 1RTHB 2ZFHA 4DCPB 3BBFA 4DTNA 1NGAA 2WSFC 5KOWA 5CHCB 1OSCA 2OPSA 4IOXA 5GMEA 2XLJA 4DR6F 2NS1B 3J7ZT 4DI6A 2DNNA 2HPUA 1Q16B 1IKXB 1S6QA 2I5JA 3DOKB 3OTOJ 2JC1A 1BA1A 4O3SA 2FPHX 1XNRF 1KKHA 4J9UE 2YWWA 2DEJA 2ZH4A 3C46A 1Q81T 3CJ1A 2FC8A 2CQGA 1DTQA 3VESA 4DCJB 4HACA 1NB2A 4PKIA 4CJUA 3CJSA 3D1QA 4FM0A 2LP4A 3CI5A 2HK2A 3CCZA 3CVKA 5B09A 3VV2B 5D0HA 1J6ZA 6FDRA 4FF2A 3MM8A 2KVQE 5H9FJ 3RR7A 2KT5A 1TMMA 2P9EA 2FF6A 3Q22A 4GMKA 3ENHA 4MTPA 4KB1A 3PLAA 3FZHA 2QEXS 1C4AA 2XYPB 2B43A 1EARA 2I6WA 2NREA 4C8NA 4PRFA 3TAMB 2HQGA 3GJRB 2B6AA 3JQJA 1UJ6A 1D0EA 2OI2A 1ZBLA 2RF2B 1FEEA 1IBMK 1SV5A 1RABB 2G8HA 3M2RB 3O08A 4CJ5A 5CZXA 2BDPA 3D2EA 2F4FA 3KLIB 2CVIA 3L4QA 4GKKF 5F41A 1UMJA 2HBMA 4A8FA 4YN3B 4DPOA 3H59A 2OTLS 1ASWA 1VRUB 4DV7K 4LFCJ 2D74B 2QLFB 3GYGA 5B0AA 4MLHA 3AV9A 1AZSA 2J76E 3QZ7A 1RBVA 2B9WA 2W4CA 4HTLA 2V2KA 3Q86A 1IKWB 1B3TA 2GIQA 3ASMA 5SWMA 1S9GB 1L5UA 1RHUB 3VAIA 4FM1A 2LMIA 1NJIO 3FBFA 3ILOA 3RSEA 3IWNC 1SC6A 4ED0A 3SJHA 3G8QA 1FKAF 1TUUA 2LVWA 4ICLB 3EE3A 5AE3A 1X31C 1SUQA 2BZ2A 1SKUB 3S3MA 2DB1A 2V4JA 2D41A 3VF0B 4H0TB 3PW2A 1Q82T 3SAFA 1JLGA 3IR6B 3A12A 4CJEA 3NF7A 1NK5A 2FHJD 1RU2A 2D3UA 4M5JA 2V7ZA 4JI2F 2RU9A 1HQUA 2YNGB 4CLUA 2CJKA 3R9LA 2D0OA 5C2CA 1GMWD 4TYBA 2BM0A 2BOAA 2Y1RI 3CDBA 2BJ7A 2W9CB 4WYLA 1U1MA 3QQCD 3RAXA 5M2RA 2F4VK 1EKRA 3QSIA 4WIQA 3CDAA 4B08A 4TU8A 4ZCKA 1J54A 2ZH8A 2BQUA 3WC0A 3EY1A 4GVBA 2HIQA 4MT1A 4ANDA 3AO2A 4LBPA 3AAWB 3TR8A 1T9VA 2XGPA 2G2YA 3TAEA 3ZX0A 2NPFA 4ES2A 4IH6A 4KO0B 4F4ZA 4HDGA 4HWIA 4JYAJ 3ZYYX 2HMPA 1U7LA 1DQ9A 1RT6A 4CO4A 4ILHA 3L2VA 4DR4K 1UPPA 1HNZK 2I1RA 1TK0A 4OLBA 2MLZA 1SL1A 1ZM9A 1LV5A 1AUDA 4DPUA 2VD3A 3K59A 4JI6J 3S41A 4P2XA 2GNKA 3CMAS 4CGDA 1R8PA 5D3GA 1K73O 2B4OA 2E1ZA 4I2PA 5AQFA 1T11A 3GL1A 2FGCA 5LMNF 5D0GA 3IBFB 2A3JA 3GPAA 4IO9Q 4AFFA 3DGPB 2RS2A 3PNIA 5A2QO 4Q7AA 3BPSP 1WBDA 3QNNA 2DFFA 3BGOP 2FZCB 2UUWA 2JJ4D 1RILA 1ZM4A 4O3RA 1CZAN 5AQOA 1X4AA 3QFUA 3WIVA 2CH6A 2IM3A 1WTFA 3CEDA 3F9MA 4OYAA 4R0JA 3H4DA 3K5MA 4JI0J 1VYAA 2HNYB 4KAZA 2ZNZA 2QZ8A 3UCGA 4LVOP 2IMOA 1U8WA 1IQZA 4DL7A 4G6VB 3WX4A 5B0FA 2Q6CA 2CGJA 3KMSA 5FRMA 4LH4A 4UOCA 3O1WA 4ID5B 2VB6A 1UAWA 3CSKA 4OZNA 4CH1A 3OVAA 1HNXF 1HMVA 4FJNA 4K4VA 2BUPA 3FCHA 1U49A 2DR9A 3AQOA 2O5DA 2BVZA 2VFSA 4JI5J 1SQEA 4DV0F 1LFWA 1BCOA 4CCHA 4U7CA 4LF4F 3OPKA 3CCMS 3PX4A 1RA7A 2AJ4A 4YB6A 1URNA 1H2VZ 2VQFF 2NSCA 5J2NA 3SBMA 1WHYA 2OPQA 2WVDA 3IM8A 3P39A 2GO8A 1NMNA 2XMWA 1GXUA 1LW2B 2BABA 4BRPA 8RUCA 3V5RA 4CBUA 3OYEA 3NGYA 2HHVA 1TVRA 1FE4A 5BPMA 5GADI 2DYAA 5KG3A 3K9JA 1Q95G 4H0OA 1URRA 1PC4A 2DGUA 5HP1B 1FDBA 4A59A 3VQAA 3GMGA 4WIIA 5EX5A 1VQ6N 4QYZJ 5FPMA 3VQTA 3NH1A 4BWMA 3ZTQA 1IKYB 3UWTA 2CJXB 4R25A 1F1BB 2VG7B 4NB4A 2P8IA 2R42A 2FIUA 3PYFA 1FNXH 3MHYA 3MEDA 3PG9A 3CIPA 3SQ1A 1HKGA 4OX9F 5KT2A 3I9ZA 2LYVA 1CSJA 2C42A 4AYBD 1HFEL 5J1NA 2KN4A 6AT1B 3SQOP 1FNOA 4CHPA 2MZSA 4WFZA 1EHWA 1GTHA 2R8IA 4CF1A 4QIGA 2RU3A 2CNLB 3QMLA 1EP4A 3TZWA 3G6VA 3GR0A 3L2WA 2ZUAA 3KK1B 4OLPA 3BZCA 3U1LA 4OPHA 4FJIA 3W65A 4OX7A 2EWHA 3H3NO 2PYLA 4DWIA 4ZVGA 1WSFA 5H9EK 4FYWB 3IRXA 3OXGA 1MWKA 2XULA 2AV5A 1BGXT 3DM2B 2IM1A 3OLAA 2QE5A 4X4RA 3FEYB 3KWIA 2C2NA 4LF7K 1T44A 1N5QA 5IT0A 3EEQA 4YHHK 4C98A 5DS7A 2NRWA 2J8SA 2F65A 1U2VB