1TL3A

Crystal structure of hiv-1 reverse transcriptase in complex with gw450557
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 147
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tl3A05
1A5XA 4KHWA 3DOLB 3HHKA 3H08A 1S1UB 4J2BA 2D3UA 3SFGA 2ITGA 3T5JA 2XHBA 5K14B 1T05A 5KG4A 4CGDA 1QUVA 5L1IA 3PUFA 4Z4IA 3GIIA 1FKPA 2AX1A 5JUMA 1CXUA 1XR5A 1WSGA 4K50A 3CQ8A 2OPQB 4BACA 4EZ6A 4MIAA 2HMIA 3TAQA 4IG3B 3RAXA 4DTPA 4NZ0A 1ZYQA 1U4BA 4E7KA 4F2SA 4Z4EA 4ECTA 5HLFA 3V9UA 2OPPB 2G8KA 2IM3A 3HO1A 4AH9A 5F9LA 4BDZA 4LSLA 3NGZA 2R8GA 3UIQA 3PW4A 1X9MA 1JLGA 2W9BA 4FBTA 1JL2A 1HYVA 4ZTFA 4M3TA 4WE1B 5DLFA 4YR2A 3I0SA 4KB7A 4DS5A 2OPSA 3OL8A 1BQNA 2YNIA 2D41A 4FK0A 3AO1A 4IKAA 1LW2A 4KV8A 3L2RA 3BGRA 1CSJA 1KHWA 3DOKA 4HUGA 4TYBA 1DLOB 4I9LA 3RMAA 1J5OB 1ZETA 4Q45A 2XY5A 4DTOA 3H2LA 3IS9A 3RAQA 1W9HA 1W25A 4JV1A 4EZ9A 1NK9A 5J1EA 2G8WA 2WRMA 5HRNA 1JLAA 4BDYA 4GC6A 4KHUA 1O1WA 1A5WA 4JS4A 1SKRA 3KKRA 2FVPA 4NLSA 4NRUA 4Y34A 4OGCA 2KTQA 4DU4A 3M8PA 3NGYA 5FRMA 1HYSB 4E7IA 2BR0A 4QW9A 2G8UA 4EBDA 3EZ5A 3OHAA 3VQPA 4HKQA 1HQUB 1VSKA 3G0ZA 3ZSXA 2XI2A 4EYIB 3OS2A 3OYCA 1NK5A 1FK9A 1UAXA 3ZSYA 4QWDA 4FCYA 4DFMA 3N6MA 3KHLA 1VSMA 5KFZA 3HKWA 3RB4A 3QEXA 4IDKB 4B9SA 3MEDB 3CWJA 2W9CA 4G1QB 5J2MB 5DG7A 4E3SA 1YVFA 3SQ1A 5HROB 4DSKA 4ZHRB 3LP3A 1SL0A 3AO5A 4MK8A 2YNFA 4CK2A 1WSJA 4CGFA 4IOBA 4DTSA 1RTJA 4QW8A 4O3OA 5KFNA 4FLZA 3DLEB 2AX0A 2EHGA 2DFEA 4ZPAA 2VA3A 4ZP7A 2FLLA 1HYZA 3G6VA 4J2EA 5KT2A 4IQXA 2YHBA 4DQIA 1FKPB 4W5QA 4CIEA 4Z4GA 5KFUA 2R2SA 1WSEA 2HMIB 3HL8A 3LAKA 3LWLA 1SL2A 4M95A 4URQU 1QSSA 2VG5A 3SYZA 2A1RA 4CF9A 3RR8A 3Q8PB 4IR9A 3OY9A 4FJJA 5EWEA 1RBUA 4KFBA 2IAJA 1RTIA 1HQEA 5HLFB 2IM0A 4RNMA 3CFRA 1I39A 4DL4A 2GIRA 4F3TA 1Z4UA 4KRFA 1JLGB 3QO9A 2W9BB 4QAGA 3QIOA 3QEIA 3HP6A 3I0SB 2OPSB 5KT4A 1BQNB 4RW9A 4Y3CA 2YNIB 3L3VA 1KLMA 1LW2B 3DYAA 3NH0A 4KV8B 3GIKA 3BGRB 4I7FA 3RB6A 4BE1A 3AA3A 1XWLA 4B9TA 3QZ8A 3IS9B 1TGOA 3P1GA 3S9HA 3NF9A 4GVMA 1UA1A 5KFHA 4J9LA 3VQ6A 1SH3A 5J1EB 4DSJA 1JLAB 3QGHA 4U7CA 3ZT0A 1NK8A 4F4YA 3I5AA 1KFSA 2FVRA 5CZ2A 3H40A 4Y1CA 3O3HA 4PQUA 1KVAA 3LZIA 2Q3SA 3EYZA 3CJ0A 2ATQA 4CHZA 1FK9B 1K1QA 1JLQA 1RT6A 3VN5A 3F9KA 3CJ4A 2BQRA 4JV2A 3OL7A 5KGXA 1S9GA 4F4XA 4DG1A 2R2TA 2PZSA 4Q0BA 1SH2A 3BSAA 4M42A 3SUQA 4AHSA 5F8NA 4N56A 3AO2A 3SPYA 5T7BA 2P1JA 1JL1A 5F8LA 4GC7A 2IDOA 1IM4A 4N41A 4NYNA 2VWJA 1RTJB 5KFYA 4ED0A 3AVJA 2OA8A 4W5NA 2YNHA 2E9ZA 3KK3A 5KFPA 4FXDA 5KFRA 2LSNA 5DK5A 1JLBB 4FM1A 3KLHA 3T5LA 2C2EA 2IA6A 4H8KA 5KTQA 2R8KA 4O5BA 4K4UA 5DG8A 3O3FA 4JRQA 5J2QA 2JEJA 4DQRA 3V1RA 2VG5B 4Y2CA 4CJVA 1BQMA 3KD1E 4NYZA 3OL9A 4KFBB 2IAJB 4OLAA 1RTIB 1BI4A 4ED1A 1NJZA 3QGIA 1RDCA 3SI8A 5HRSA 1RCHA 5HP1A 1LWFA 4O0IA 3QO9B 2BGGA 4CHQA 4RW4A 4M3UA 4RW7A 4H4OA 4RW9B 2RF2A 1QSLA 1RILA 3O4NA 1KLMB 1LAVA 3KIOA 2Y1IA 2WONA 3DYAB 1BL3A 5J2PA 3BQ1A 4I7FB 1HMVA 4IFVA 3TAGA 4DL5A 3MFIA 4N47A 3VQBA 3NAIA 3NKYA 4WFXA 3M8SA 4EP4A 2IC3B 5KT7A 3ICLA 4PY5A 1K6YA 3MECA 3K5LA 4DSFA 3K59A 3CDWA 2HAIA 4YQWA 4CGJA 3HVRA 4FM0A 4EBCA 4PQUB 4QWEA 3NHGA 2HHVA 3RR7A 3KLIA 2PYLA 3FRZA 4WZQA 1RT6B 2ZD1A 4W5RA 3P5JA 4MH8A 4K8ZA 4CJ5A 1S9GB 4J9MA 4ZP8A 3M8QA 3H5UA 4DG1B 3NF8A 1VSIA 4Q0BB 4MIBA 1FXXA 4HCBA 1LW0A 4CE9A 1JX4A 2WOMA 4ED3A 4K4VA 5CYQA 4HHTA 2F96A 2ALZA 1Z25A 1D9FA 2YNHB 1NHUA 3KK3B 2OPRA 4TYAA 4KPYA 1C0TA 1SV5A 4DLEA 4K4SA 3U6FA 1JLCA 1SKWA 1XC9A 1NK4A 2F8EX 4O3NA 4WFZA 5J2QB 3CJ5A 2FJVA 4GW6A 2CJQA 4HYKA 1BCOA 3H5YA 4QOZB 4DSLA 1S1TA 2D3ZA 3B6OA 3DM2A 1BQMB 3HM9A 1WNEA 5DQHA 4RNOA 4Q44A 4QWCA 1BI4B 3QZ7A 4KTWA 5HP1B 2IM1A 3D28A 1LWFB 4FJNA 3NGIA 4NLXA 4FZYA 5CYMA 1JLEA 4R8UA 1G15A 3G10A 2RDJA 4F4WA 3OJSA 4RW4B 3KHRA 1L3UA 2D7SA 2OZMA 4RW7B 4H4OB 2RF2B 1WN7A 3ZSVA 2WONB 4WYLA 5J2PB 1RT1A 1I6JA 1HMVB 4IFVB 1WSFA 1TL1A 3T1AA 2FJXA 3K5NA 4CEBA 4DTUA 3KJVA 4DQPA 2XCAA 3IRXA 3G6XA 2XY7A 1VSHA 3OYHA 3GIJA 2ETJA 4BE0A 3RTVA 3OLAA 3ASMA 3MECB 2FVCA 3ZSZA 1LWCA 1DTQA 3KHHA 1GOCA 3BJYA 3SPZA 1N48A 4OL8A 3TANA 3NMAA 1JIHA 4ID1A 5EWGA 2C2DA 2JEIA 4QWBA 1L3SA 2I5JB 4BDPA 3KLIB 1NJYA 3LWMA 1TL3A 1B9FA 3V6DA 4FLUA 3TAMA 3KK1A 4NLUA 2ZD1B 3SUNA 3BREA 3JSMA 4CJKA 3M8QB 3OYKA 1Q9XA 2D0BA 3TR8A 4AHCA 4H54A 5KI6A 1KRPA 2NUBA 4CF1A 4N76A 1GOBA 4DTXA 4URGA 1T3NA 4FVMA 4KB1A 1LW0B 4WXOA 4O3RA 1S4FA 1U48A 3LAMA 2WOMB 5CYQB 3TVKA 4J9NA 3MTKA 4WXWA 1RT7A 3RMDA 1BGXT 4CFCA 1KLNA 2XY6A 1GOAA 1RT4A 2P5GA 2OPRB 3KHGA 2Z1HA 3H98A 1C0TB 1SV5B 1JLCB 4DL7A 3I5BA 4KI6A 1IO2A 5KG1A 1CXQA 4I2PA 2IOCA 3Q8RB 2XCPA 5KFMA 3L2UA 2BE2A 2J6SA 2P5OA 3BQ0A 4URSA 3RRGA 4QPXA 1S5JA 2HHSA 1D0EA 1SUQA 2UUTA 3VQQA 4FLYA 3V6HA 5EUHA 4DTMA 2W7PA 3V9WA 4ECSA 3NH1A 3PJWA 3OSNA 3KK2A 4E1NA 3SQ0A 1TVRA 5CYMB 1KVBA 1JLEB 3HPGA 4R8UB 1WAJA 3KTQA 3FDSA 1UWBA 2JEGA 4O0JA 5KT3A 2AGOA 4FLTA 1UA0A 1BIUA 3MFHA 4CF0A 1QS4A 2BRLA 1YVUA 5I42A 2BDPA 4NRTA 1RT1B 4ECZA 2WTFA 1TL1B 1S9EA 2QE5A 1J9AA 3V1QA 3D5MA 3K57A 4C8LA 1TP7A 3KJVB 3TARA 3IRXB 1N6QA 4ED8A 2YHAA 3OYMA 2R8JA 2PY5A 4DSIA 3PJXA 4J9QA 3N6LA 1EX4A 4FJLA 4CEOA 1S1WA 1LWCB 3UQSA 1DTQB 3H5XA 2FBVA 4UQGA 1TKZA 4QCLA 2HVHA 2HNYA 3SFUA 3DLGA 4EYHB 1BISA 3AVGA 4JUZA 5L1LA 3OYBA 4C8KA 1TL3B 3PO4A 3V6DB 2HWIA 4E7JA 3TAMB 3KK1B 2R7YA 1QTMA 1R0AA 4J9KA 3JSMB 2ASDA 3DRPA 1T05B 1Q9YA 3PW0A 4KHNA 2UVRA 1WLJA 1TQLA 2GC8A 3NBPA 1RTHA 5T14A 1TKXA 3L2WA 4E7HA 2B5JA 1ZBUA 3CJ3A 1EXQA 4DTJA 5DGAA 3SJJA 4IH6A 4CIFA 3EY1A 4CEAA 3A2FA 4FJ5A 5C42A 1NKBA 4YNQA 4F4KA 1IH7A 5KFGA 1RT7B 3V4IA 3HSTB 3OJUA 1U09A 3V9ZA 4J2AA 3ZSWA 1EP4A 4K4XA 3NGDA 1VSEA 1RT4B 1VK0A 4OJRA 4CJUA 4LSLB 3TQ1A 4RW6A 5KG3A 1I3AA 3ZT4A 1ASVA 3T5HA 3LANA 2R8HA 2DPIA 4I2PB 3E51A 3V9SA 3IAYA 1YTUA 4CJTA 4WZMA 4Z4CA 2BE2B 2E6LA 1RBRA 1YT3A 3MXMA 4RUCA 3DOKB 3P83D 5KFAA 4ED6A 2FBXA 4NLRA 5FRNA 3QLHA 3BQ2A 3G6YA 5HRPA 1RA6A 4XPCA 3EPIA 5EWFA 4K4YA 3KK2B 3HVAA 1TVRB 3PX6A 5KFDA 2JC1A 4Q8EA 3RB0A 1FKOA 1UWBB 3M8PB 3L8BA 3K58A 1KFDA 3VQ7A 1KVCA 5I42B 3FFIA 4DF4A 1Y97A 3PX0A 3NF7A 5EDWA 1S9EB 2HNZA 4IFYA 3OYLA 2XGPA 4CJSA 4CEFA 1RDBA 3PR5B 2Z1IA 4QWAA 5FDLA 2B4JA 4FS1A 4DMNA 3PO5A 4L8RB 5KFOA 1ZBLA 1CLQA 3V6JA 3AVNA 4CEDA 1DTTA 2IJNA 2W9CB 4B9VA 3C94A 3ZSRA 1SKSA 5L1JA 2ASLA 2R2RA 4LH4A 1TKZB 4O4GA 2HNYB 3DLGB 2YNFB 2WB4A 4O44A 4FLWA 1ITGA 1VRTA 4TY9A 3QERA 3IGVA 4FYDA 3AVFA 4OKEA 2BRKA 3NDKA 1IKYA 2ASJA 3CVKA 4AHTA 4KO0A 1NHVA 1RT2A 2CKWA 3H5SA 1ASUA 4AHRA 4K8XA 4ZP9A 1R0AB 1QAJA 2C2RA 3DRPB 3DRRA 3JYTA 3G86A 3KD5E 2G8VA 1W0HA 1S48A 3NBPB 1J53A 1RTHB 1IKVA 1TKXB 4KHSA 2E9TA 2B5JB 3UPFA 4O4RA 2IS3A 5KT5A 4FLVA 5JS1A 1JLFA 5C42B 3OYDA 1J54A 4HUEA 2A1SA 4K4WA 3V4IB 4CJLA 2KW4A 2B43A 3I0RA 1EP4B 4KAIA 4MQ3A 3LP1A 3CFPA 1T7PA 1HQEB 5FROA 1L5UA 3L2VA 2AWZA 2YKMA 3VQ5A 3CM5A 3LPUA 4OGEA 4RW6B 1ZBFA 4DQSA 4DSEA 4FS2A 2V0NA 1VRUA 1RA7A 4KHMA 2G8HA 2RKIA 3QYYA 4IKFA 3OLBA 3ISND 4DWIA 1CZ9A 1S1XA 1NNDA 4NCAA 3SUOA 4K4ZA 1XHXA 4XIUA 1NK0A 2JC0A 3CDEA 2R8IA 3QLHB 1JXLA 4IG0A 4FJIA 4R5PA 3HVWA 5L1KA 3BSOA 4YFUA 3DLRA 2FVQA 3LP0A 1S6PA 4ELUA 3OYEA 3TAPA 1UOCA 1HRHA 3UDLA 2YNGA 1FKOB 1T03A 2OH2A 1D9DA 5JS2A 2QKKA 3Q8QB 3FFIB 3N6NA 2P51A 3ISNC 4KTQA 3MR3A 3KMQA 2E4LA 4IFYB 3H4DA 2W7OA 4OLBA 1JLQB 5KFVA 4JLHA 1D5AA 3AVCA 1WSIA 1U04A 1WSHA 1D8YA 1TK0A 4IRCA 3I8DA 2ILZA 1TAQA 2FVSA 4FW1A 1VSLA 5KG6A 3F73A 4FJ7A 2UVVA 4O4GB 1NJXA 2EC0A 3KKSA 4H4MA 4F2RA 1S1UA 4DFJA 1VSJA 4O44B 1C0MA 2J6UA 1VRTB 4J9PA 2FJWA 4J9SA 1TV6A 3OS0A 2IGIA 2O4IA 2RDIA 4KO0B 3LP2A 1REVA 2OPQA 4ELTA 3KLHB 1K1SA 1S9FA 3CG7A 4C8OA 3DRRB 3JYTB 3NAEA 3PV8A 2HHQA 3ZT1A 3QIPA 3L2QA 4ED7A 3SUPA 2DFFA 1IKVB 4DEZA 3QESA 3U3GA 1TKTA 2GBZA 4AHUA 1JLFB 5C24A 4J9OA 3VA3A 4CJRA 2ZE2A 4RW8A 1RYSA 2AJQA 4WFYA 2W9AA 3BSCA 2ZKUA 3DMJA 2ATLA 5DMRA 2JEFA 1RBSA 3LP1B 1TKDA 3WNHA 5KFQA 4LY7A 1RDDA 2W42A 2DFHA 5E41A 3M8RA 3FQLA 3DI6A 3EZUA 2KQ2A 4NLPA 3QETA 1VRUB 4W5TA 4DFPA 1TK5A 2RKIB 4TQSA 4CK1A 3ZT3A 1U47A 1S1XB 3PZPA 1J5OA 1X9SA 4XPEA 2QV6A 4NCGA 1BHLA 4CEQA 1L3VA 3QEWA 3GV8B 1RT5A 2W8KA 4I9QA 3V81A 5C25A 2D5RA 2HHWA 1GX6A 4E1MA 4IG0B 4O3PA 5DG9A 4R5PB 1HYSA 1KCFA 3PHEA 2D0CA 3MEGA 3SZ2A 4FZZA 4E89A 4FBUA 3MXJA 4O55A 1NJWA 3LP0B 1S6PB 4M41A 3HP9A 4RUAA 3HXMA 2V4RA 2YNGB 4MK9A 1T03B 4B9LA 1S1VA 4OKJA 4CFAA 5F8HA 4EO8A 2E6MA 3V1OA 4TSXA 5KFLA 4DFKA 4ECWA 3RBDA 4CEEA 1XR6A 4Z4HA 1S10A 4RNHA 2VG7A 3OS1A 3DLHA 4C8MA 4PUOA 4YP3A 3S3MA 4BWJA 5KFTA 1C1BA 1NOZA 4HVJA 4J2DA 4DTRA 2IM2A 1VSFA 4Q5VA 1HNVA 3PW5A 3L3UA 4H4MB 5SWMA 2AGQA 2J6TA 3D0PA 2EX3A 3PW2A 2XY8A 4LD0A 4W5OA 3K2PA 1C6VA 4M3XA 1TV6B 4DU1A 4PWDA 4NLGA 4CESA 3LP2B 3M9OB 1REVB 5F8MA 1MU2A 3ZSOA 1RYRA 4TQRA 3QGGA 1QSYA 3QIPB 3MXIA 4KE5A 3HVTA 4M3YA 1RBVA 3VQ4A 1S97A 3RWUA 1IG9A 2GUIA 3RMCA 4DL2A 1TKTB 4MKAA 2D0AA 5F8JA 2BQ3A 3ITHA 4KTZA 5C24B 4FJGA 1S1TB 2ZE2B 4M3WA 4RW8B 4FLXA 5J2NA 3DM2B 2X6SA 1N4LA 4R0EA 4O3QA 1U49A 3DMJB 4FJ9A 1ASWA 4F4ZA 1QHTA 2VWKA 4B8AB 5CY4A 2W8LA 5EU7A 2XO7A 3C6UA 3DI6B 4G3IA 4HCCA 3HPOA 4LQ3A 3CJ2A 1VSDA 1C1AA 4CGGA 3QIDA 4ED2A 3HK2A 1KSPA 4EP5A 4DF8A 4KREA 5SZTA 1HJRA 5KT6A 3FSIA 4NCGB 3OYGA 1RT5B 2XI3A 4MFBA 3M9MB 2JGUA 3V81B 5KFFA 5C25B 3OSPA 3S3OA 3OVNA 2E9RX 1TAUA 2HHUA 4LSNA 3LZJA 3DLKA 3MEGB 2G8IA 4JS5A 1S6QA 3GV5B 3KLFA 4DU3A 3AA2A 3VQ9A 4FM2A 4ZVHA 5KFEA 2C28A 3AV9A 4OVLA 1C0UA 1S1VB 3KLVA 4EEYA 2RPIA 4CJ3A 4B9NA 3AO4A 4XO0A 3ZSQA 4E7LA 1BCMA 4ICLA 4YMEA 3NE6A 4C8NA 3KOAA 1X9WA 3M9NB 4NLDA 3PY8A 1OS5A 4Y1DA 2VG7B 3V6KA 3DRSA 4PUOB 3ALYA 4U6PA 3OHBA 2Z1JA 5HRRA 4E19A 3MR2A 1Q8IA 1C1BB 5F8GA 2ZQBA 1QQCA 3K5OA 4KB0A 3WNFA 3QNNA 3GYNA 3NL0A 3SV3A 1HNVB 4J9RA 3H4BA 3LDSA 3O4QA 4NLTA 1JLBA 4LH5A 1HPZA 2WK4A 3CYMA 5KGWA 4JRPA 1WAFA 2FBTA 3E01A 4ECVA 4F3OA 3HJFA 2JLEA 1YTAA 2BANA 5L9XA 3AVBA 4RG8A 1NKCA 2KZMA 4Y2AA 4PWDB 2V4QA 2HWHA 1XHZA 1MU2B 4KHRA 2RN2A 2O4GA 4KHYA 4CFDA 2QXFA 3MF5A 3RB3A 3CM6A 3OYIA 2XWYA 5KG0A 3HVTB 3EPGA 2HNDA 1KTQA 1S0OA 1WNSA 2HW3A 1CZBA 4Z4FA 4CJWA 4N5SA 4OPKA 3ITHB 3ZT2A 4FJHA 3GQCA 5KG7A 5J2NB 2XC9A 1SUQB 4YR3A 4NLQA 3OYNA 3O3GA 4B9MA 1HNIA 2UUWA 4RNFA 4CJQA 4GMJB 2KFZA 3GILA 3VQCA 4HTUA 4ID5A 5CZ1A 3C6UB 3BR9A 3TAEA 2GIQA 1JKHA 3NCIA 3H59A 2YV0X 1LV5A 2OZSA 4EO6A 2HHTA 4KHQA 4ZP6A 5KFSA 5KRTA 3SCXA 2X74A 2IC3A 2V9WA 4MFBB 4CJPA 3V9XA 1TK8A 3CFOA 3AVMA 4DLGA 4LSNB 3RRHA 2G8FA 4ZPDA 1RTDA 1N6QB 5HBMA 4ELVA 3LPTA 3DLKB 5KFKA 5KG2A 4B08A 4CK3A 5F9NA 3MEEA 5KRSA 1S6QB 3KLFB 3BSNA 3AVAA 4ECQA 4F8RA 4B8CA 1S1WB 1RNHA 3VQ8A 3AVIA 3TABA 3T5KA 2BQUA 1C0UB 2XGQA 4CERA 5C5JA 1SH0A 3QEPA 3TWHA 4E0DA 4ZMMA 4ICLB 1RDRA 4OPJA 3VQSA 1T8EA 1LWEA 4YR0A 3RMBA 4BWMA 3GIMA 2HHXA 1JXBA 3RBEA 2UVWA 2F8SA 4CF2A 3OYJA 1ZTTA 3DRSB 3PVXA 3D45A 4FJMA 1B9DA 1IKWA 4I2QA 2X78A 4NLYA 5KFIA 4O3SA 3U3YA 3WNEA 2IBKA 2C22A 3ZCMA 1RBTA 1S0MA 2O5DA 4IR1A 4KSEB 2YKNA 4EBEA 1D1UA 2OYQA 4NLWA 1NK6A 1HPZB 3VQDA 3KLEA 2VA2A 3NF6A 4FW2A 4RU9A 1MMLA 3T3FA 3E01B 4KKOA 4F50A 2BANB 4B3OA 3KLGA 3AO3A 3BDPA 3QNOA 1N56A 2XRIA 4KI4A 4M3ZA 1LAWA 4NLVA 3IG1A 4RNNA 4IRKA 4DQQA 2AQ4A 4ZPBA 4FK2A 1RDAA 3FQKA 4TY8A 1N5YA 2HNDB 2FBYA 1RAJA 3IGNA 3UR0A 1EETA 4ECXA 2IJFA 3LALA 3NAHA 5D3GA 2B6AA 3SNNA 4PA1A 5I3UA 4IH7A 1ZBIA 3NH2A 1HNIB 3NFAA 1XR7A 3I5CA 1C1CA 1QAIA 4BE2A 4ID5B 3AA4A 1ZBHA 4ZVEA 2DPJA 4X2BA 1JKHB 4Q8FA 4B9UA 3KNAA 1NKEA 4TLRA 1RT3A 4CGIA 4IH5A 1HARA 4Q43A 4DL6A 4CHOA 1T94A 4DTNA 3SI6A 5DLGA 1ZTWA 1IKXA 3AA5X 2HNZB 4M94A 2IMWP 4DS4A 2VG6A 4TXSA 4M45A 5KFBA 2Z1GA 1RTDB 5FDLB 3IN5A 5HBMB 2GV9A 1QE1A 1B92A 4NLOA 1JXEA 3MEEB 2WHOA 3C6TA 3CO9A 1DTTB 2I5JA 4FK4A 3MAQA 3HT3A 3PW7A 4CF8A 4MKBA 1U45A 2R2UA 4IBNA 3DOLA 3MR5A 3WNGA 4LQ9A 3HYFA 1F21A 3SQ2A 4WYWA 3CIZA 3VQEA 4CGHA 3TAFA 3HPHA 2KZZA 5K14A 1X1PA 1Z26A 4RZRA 3AVKA 4CECA 1LWEB 2AGPA 4FZXC 3ULDA 1IKYB 3SV4A 4NCBA 1RT2B 3PR4A 3OYAA 2X6NA 1IKWB 2UVUA 4I2QB 4IG3A 4CJ4A 2DTUA 1XI1A 3KMSA 3QEVA 3CDUA 2YKNB 1NOYA 4FJ8A 2QKBA 3SQ4A 2OPPA 1GX5A 4CJFA 3Q8SB 4ZVGA 5DQGA 3VQAA 3KLEB 2ILYA 2PYJA 3THVA 4KKOB 4CCHA 4ZPCA 4WE1A 4B3OB 4M3RA 3KLGB 1L3TA 3I0RB 1S49A 4MK7A 3PX4A 2HVIA 3IG1B 2YKMB 5KG5A 5DQIA 4FJXA 4OKKA 5JXSA 1SL1A 2F8TA 2AU0A 1BIZA 3OYFA 2I1RA 4TY8B 5KFWA 1N5YB 1DLOA 3MR6A 3B6PA 4CFBA 2FLPA 3OL6A 1EETB 3K5MA 3DLBA 3AVHA 4ECYA 2FC0A 2HB5A 1S0NA 2DY4A 5D3GB 2QK9A 2FLNA 2B6AB 5I3UB 4ZTJA 1C1CB 3AVLA 2KFNA 4ECUA 1A5VA 3GV7B 5DGBA 4IRDA 5F8IA 4CHPA 3T19A 4ECRA 1HQUA 3DDKA 3TI0A 4K4TA 1EKEA 4JV0A 1RT3B 4DL3A 5KFXA 4FJKA 4KBIA 4NYFA 4CIGA 4TN2A 3QINA 3S3NA 4IDKA 4Z0UA 5KFCA 3MEDA 1NK7A 3VA0A 1IKXB 5KFJA 4G1QA 5J2MA 3C95A 5HROA 2VG6B 4AILC 4CEZA 1KHVA 2WCXA 4ZHRA 4AHVA 1C2PA 4ZVFA 4CHNA 1QE1B 4CHYA 3C6TB 4KAZA 4CJEA 4HUFA 2Y1JA 3DLEA
chains in the Genus database with same CATH superfamily
3GBTA 5CCLA 2PMHA 5BPLA 2D3UA 1QQMA 1U6FA 2XHBA 3D6MB 3JQMA 1T05A 1QUVA 4ED5A 4Z4IA 5AQUA 4BACA 3O8MA 1HNWJ 2NREA 2NNWA 5KAKA 1ZM3A 4F2SA 4OHXA 2IM3A 3HO1A 4BR5A 3QJLA 5F9LA 5K8MA 1RACB 4KGXB 3OVBA 3UIQA 1X9MA 4ZTFA 4M3TA 3IA0A 5DLFA 2M8HA 3HULA 1BUPA 4FKXA 2XS7A 3DXKA 4PPDA 3AO1A 3GYGA 1SVDA 1I94J 3BY5A 5AXNA 3M2RB 1NSPA 1RWKB 5AQYA 4I9LA 2W2QP 1R8HA 1ZETA 2NUUG 3IS9A 1W9HA 3W9IA 4EZ9A 4HWIA 3MUTP 2H65B 5AXMA 5HRNA 2FIUA 4JN4A 4Z7YA 4DPUA 2U1AA 4Y34A 4NLSA 1SJRA 2KVIA 3Q24A 2BJEA 5ETPA 3EZ5A 1ZA1B 2CQHA 3TZWA 3W5XA 4HKQA 3PSIA 3OS2A 1NK5A 2HRTA 3ZSYA 3UDVA 5AQZA 5E33A 3KHLA 2UXCK 4IDKB 3ZX0A 3CWJA 5J2MB 5DG7A 1CJUA 1AA1B 1M5VC 1S12A 2CADA 2J7KA 4RR5A 3LP3A 2N4CA 2O8DB 2YNFA 1KQGB 3GL1A 4UQTA 5M1NA 2DNGA 2AYGA 4EWTA 1NG9A 1IG8A 4FLZA 3DLEB 1QAXA 2FZKB 3Q22A 4IO1A 4OZJA 1IBKF 3CCEN 5A8WA 4NE9C 2Q36A 2YHBA 3EEQA 4Z4GA 1WC1A 2VFRA 2QFJA 2R2SA 3U9ZA 2XYHB 4PL7A 2KRBA 1VJWA 1SJ1A 2QC3A 3W60A 3TPQA 2HQCA 4EHUA 3KVGA 1KOOA 3PIOQ 2IHR1 4IR9A 1IQTA 1Z6RA 4FJJA 3MAHA 5U47A 1RTIA 5C15A 3THWA 4RNMA 2P9IA 3HBTA 3CFRA 1BY9A 4DL4A 3NY0A 4JYAF 4O0NA 2RVJA 2M5YA 3O6QA 4ES2A 5M1QA 2J0QD 4QAGA 2NRVA 1U1PA 4Y3CA 3DXKB 3BB5A 2DO0A 2P6TA 5IXUA 3NH0A 4OJHA 4FWKA 3RB6A 4DR7F 2CNNB 1XWLA 2QWPA 1KAYA 2RRNA 3IS9B 1M5PC 3S9HA 1XK8A 4DV0J 4DPYA 3VQ6A 3MPVA 3KG0A 1SXLA 4FF1A 1NK8A 4DR1F 4CZGA 1YQHA 2VGMA 2KL8A 1UAWA 5HANA 2B56A 3UB5A 3QT5A 4P52A 3EYZA 2DNKA 2Q3SA 2X1GA 3N4PA 4GKJJ 2NRWA 5E3RA 5G4DA 3AQOA 4DCPB 2NXJA 2NYIA 1K1QA 3VN5A 3ZFVA 3F9KA 1RFQA 3OL7A 1S9GA 5L39A 3A3OB 2IDEA 1CJUB 3AJ2A 4IYQA 3SPYA 2M4MA 2JSXA 2DEIA 2OO4A 2HF4A 5F8LA 4H0OA 3MHYA 4BRHA 4OI1A 3OHRA 1G2EA 2ALYB 2XQCA 1QVGR 5KFYA 4DV4K 4ED0A 2BTFA 3VAKA 3VCDA 1Q95G 2E9ZA 5KFRA 5DK5A 1TL4A 1XMOJ 1XNQK 3A5LC 3U4LA 5CZVA 5IWAJ 1VQLN 5A8WB 4H8KA 4NLCA 1WB9A 4B3TK 1X60A 1MSWD 4DQRA 4C3KA 3V1RA 1PBUA 4LBHA 4GV6A 4KGKA 4BR9A 2Q6BA 4NYZA 4UOCA 3C8YA 2B8QA 1YF5L 1RTIB 5E3QA 4ED1A 1ELOA 3QGIA 1RDCA 4CZLA 3THWB 2Q1LA 2P9IB 3O9UA 3WEEA 2XSJA 4C7QA 3QWPA 2BGGA 4K43A 4CHQA 1IJJA 1QQOA 3K17A 1N36J 2F63A 3L7UA 1X7VA 2KVQE 2B4UA 1QSLA 1RILA 3O4NA 3U1LA 2VPYB 5FJ4A 3BO2A 2HMPA 4IFVA 3MFIA 3OFFA 2CVIA 4CLLA 5GIPA 4KR0B 3M8SA 2HEKA 2HFNA 1B0PA 4ID8A 4DPWA 4PY5A 3VTHA 3PYGA 1Q53A 3K59A 1WOOA 3WX4A 2VICA 4EBCA 3TX0A 2XMJA 4ZJOA 2RQ4A 1Y7PA 2IJRA 2HHVA 4GO7X 3CCMN 1OH8A 3QRQA 1YJVA 4WZQA 5JVHL 4CLKA 2QWQA 3S6EA 4W5RA 1AW0A 3CJKA 4K8ZA 4CJ5A 1S9GB 4J9MA 4F67A 4MO4A 4PG4A 3M8QA 1NDLA 5BREA 3ZZYA 1VSIA 1FRHA 2WBMA 2K2PA 4NI2A 1FXXA 5H1SV 1X4FA 3V5RA 2CZ9A 4AM6A 1N5TA 2FJDB 5AQSA 2AYMA 2DT9A 4FPBA 2XZWA 1WTBA 1GEHA 2ALZA 1VQKS 3EN9A 3CIPA 3EM1A 3M8YA 4WFNQ 2FPHX 3J7Z5 2OPRA 4JHDA 5CHCB 2W6KA 1C0TA 5ELZA 3JS6A 3SDEA 4A5AA 3IR6B 5A6WA 2OMOA 2VFTA 4WQ5C 3N9UC 3VQTA 1FEEA 2JFKA 4O3NA 2HSTA 2KO1A 2JDJA 4GW6A 1P8ZA 2QA4S 2V7YA 2P9KA 3B6OA 3DM2A 1U2CA 1N0UA 1K8KA 4PABA 1YBUA 1GMVA 3IM9A 4UOHA 5B8HA 4F04B 4QWCA 3QT7A 6FDRA 2E5HA 5HVHA 2IM1A 3SQGA 3WEEB 2XSJB 1X4EA 4B17A 4R8UA 1ATRA 1L3UA 3VETA 1S59A 2B0GA 4LF4K 2CQGA 3CCQN 2ZWPA 2ZJRQ 3ZSVA 4CBWA 4WYLA 4A59A 5KQDA 2CJXB 2ASOA 4IFVB 3T1AA 5E84A 3K5NA 3W62A 3ZZ0A 4C6AA 4K25A 5ETRA 2Q6CA 2DRBA 1WD6A 1XJWB 4BE0A 2IVYA 3ASMA 3NWGA 3BZQA 2FZGB 1GOCA 3BJYA 5F0XA 3SPZA 1N48A 3FSXA 2YTCA 1Q8BA 4XH1A 4ID1A 4PRFA 1HQ2A 4IDHA 2JEIA 1RISA 5DO2A 1L3SA 2GV1A 3W5YA 4X4QA 1RAEB 4DUYF 5B09A 1X3MA 2LEBA 5B0CA 3CJKB 4BC3A 2A5XA 4CJKA 3M8QB 4YS2A 2RRBA 4AHCA 1X4DA 4H54A 5KI6A 4NI2B 4BRMA 1GOBA 2F4FA 4ZOSA 2CNLB 2COLA 1S4FA 3LAMA 4I0WA 5FD1A 2YQ3A 4CFCA 1KLNA 1P1TA 1RT4A 2OPRB 4JHDB 2Z1HA 3KDOA 5SUHA 1C0TB 3SDEB 1SC6A 1NRKA 1SJ3P 4HH0A 4KI6A 5KG1A 1FRKA 5KQ8A 5KFMA 1EQ0A 4USTA 1HD0A 2V34A 2V4JA 2P9KB 3RRGA 2WB1D 1N88A 4ZN1A 2OELA 4FLYA 1M1HA 1K8KB 1SC4B 1U24A 5EUHA 1R31A 1VK8A 4B3SK 5HMWA 2W7PA 4YOTA 3NS6A 4AM7A 3OTOK 1TVRA 2UXCJ 2C3YA 1KVBA 2E2OA 4R8UB 1UPMB 3FDSA 3FFKB 4O0JA 3VF6A 2EFOA 1OKJA 3MFHA 4PR6A 4DKWA 5M1PA 3VOVA 3D1HA 4NZ6A 3AY0A 2XMTA 5A2QY 1RAOA 2DRAA 3K57A 1TP7A 2PMZD 1R43A 3EWGA 1CPZA 2YHAA 2AYEA 5DZ6A 5IV3A 4DSIA 5GAHU 1VDHA 3H1VX 1VYAA 5H9EK 3J80O 2XMWA 1CZAN 1JCGA 3DLGA 4HDGA 3TA1A 4IUFA 3CCWA 3FMBA 5AJ3F 3CJQA 1ZPWX 3OYBA 1WTFA 4P74A 3C14A 1YJWS 2WTUA 1FJCA 4XAKA 2OI2A 1NGFA 5ETVA 1Q9YA 3PACA 3FR0A 3OW2R 1MN9A 5T14A 1ZBUA 3CJ3A 2UUCJ 1EXQA 2NLWA 3SJJA 4BR0A 3EY1A 1OYDA 1YHQN 4YNQA 1WHXA 1Q18A 2M3DA 3GCWP 3L09A 1TUVA 3HZEA 3OV7A 1KWMA 5AQOA 4X66K 2KG0A 2NQPA 1RT4B 2UUBF 1CC7A 2HIQA 4C3LA 3A8YA 5BYRA 5ITHA 2UU9F 1QVGM 2CAJA 1PJ7A 1NZAA 4CH0S 2E6LA 2V4JB 1YT3A 3MXMA 3DOKB 4TLQA 4CLWA 1EKRA 3Q8YA 5KFAA 3P83D 4WQ5A 2FBXA 1UL3A 4NEZA 3TYTA 4GVBB 3BQ2A 1MW7A 1WBDA 5CR4A 4DQ8A 4DPXA 1RTZA 4GY2B 3M32A 1TVRB 1CJVA 4A2AA 1XN9A 4QIWD 2M0GB 7AT1B 5D6GA 5D77A 3R6MA 4UY8T 2AJ1A 2C2NA 3K58A 2QM1A 3F9MA 3HZGA 3BPSP 4ZLNA 1P90A 4B3RJ 4ERDA 2G2ZA 4MIWA 4DV4J 2IYGA 5IT9U 2B4JA 3D1QA 3K8VA 1X5SA 4DMNA 3NGTA 4L8RB 4WFBL 3Q7BA 3V6JA 4B9VA 1XNQJ 5LL6d 2CQ0A 4Y28C 4OYMA 2R2RA 2DR8A 4LH4A 3CMAN 3PEHA 1KQSR 3DLGB 4EK2A 4B3TJ 1M1KT 4DBQA 3MPDA 3NGRA 4CZCA 1DQ8A 3IGVA 2SXLA 2ZGZA 1JWWA 5GAHI 3C14B 2QZ8A 3FZHA 1ASUA 2J5AA 2VGNA 2ADCA 1QAJA 4CLSA 2P8IA 2GJ2A 2YWWA 5AQXA 2YCHA 3LDNA 2IDLA 3F56A 3GP9A 2IBOA 4KHSA 3OT9A 1Y9OA 3MPYA 1N33K 1JMTA 3HOSA 4NX9A 1KC8O 2K1RA 1JNZB 2G1DA 2KW4A 2B43A 4ZKAA 3MMAA 4KAIA 4MQ3A 3CFPA 1H3DA 3LPUA 1R8PA 1BDGA 1BWVA 3CETA 1M1KO 2MLYA 3OLBA 1UVKA 1CZ9A 2ROEA 1NNDA 3I82A 1GNKA 2HGMA 4NCAA 3OTBA 4E8UA 2LXIA 2O66A 3UVJA 4I6YA 3HI0A 3TZZA 2R8IA 1V3ZA 4IEIA 3A0IX 1YITN 1FD2A 2CJ9A 5L1KA 2HVZA 3M32B 3RBZA 2FLOA 2FVQA 1Q86T 4K0KK 3DNCA 4CLPA 1WF2A 1UOCA 5ETMA 1CJVB 1HRHA 1B64A 2NZCA 2QGFB 1YAGA 1J5EK 4CLZA 3QPIA 4FWRA 2BOPA 4X62F 1YZ7A 2E4LA 2W7OA 2D9PA 2QXLA 4KPCA 5D8HB 4MTPA 4JLHA 1D5AA 4OHYA 1D8YA 2PEHA 2OEKA 3LDLA 1TAQA 2EK6A 4NA2A 2FVSA 4FW1A 2H1YA 3NVKA 4JI6F 1VSLA 4F9OA 5FPEA 1ZM4A 1S72S 2EC0A 4HTJA 4H4MA 2Z2YB 1IVZA 4U95A 3M3ZA 1NSAA 5I3PA 4WFAL 3K0JA 3OS0A 1VQ5N 2P6SA 2O4IA 1IQZA 1ULRA 5E5NA 4KQZA 1LQ9A 4JI4K 2BMBA 1Z05A 3KLHB 3JTNA 4C8OA 1RCOB 3NAEA 3QIPA 3L2QA 3JQJA 1ZPVA 1CG2A 4ED7A 3GR1A 5HN0A 3F2KA 2GBZA 2WSCC 2A2DA 3C46A 1WF0A 2DB1A 2LQ9A 4AHUA 2C2OB 2K1RB 4YDDB 1IR1A 2AJQA 4WFYA 3BSCA 1QVFM 2DNZA 5IM0A 1HNWF 1RBSA 3MMAB 2EXUA 5EOYA 2OD4A 5HL7L 1RDDA 2W42A 2DGOA 4U7UK 4PG8A 2W40A 3EZUA 2KQ2A 4NLPA 5IS2A 1PAUB 4W5TA 4DFPA 3CC4N 3BYPA 4YDUC 4H4KA 4OJ1A 2VPXB 1WF1A 3RSEA 4NCGA 3QATA 3UVJB 1BHLA 2CIMA 4CEQA 1L3VA 2OEJA 1S6UA 4OPHA 1I94F 2PD1A 2ZC3A 4E1MA 3PHEA 1KCFA 3J81U 4QS7A 4E89A 4O55A 1RDUA 2QLFB 3EJMA 1RDWX 3ZTPA 4ZPVR 1N5QA 1HBNA 3EZWA 3CDAA 3AAQA 1UETA 3GFHA 4RLEA 3BUZB 4U67L 1F1BB 4FKYA 4DOZA 1R8AA 4OKJA 2JH3A 3ILLA 4EO8A 1SB6A 4I6MA 4OHWA 1Q82O 3KUEA 5KFLA 1PGZA 3AT1B 4DFKA 3HDSA 2DNOA 2VQEK 4QJVA 4ECWA 1WOPA 1GLDG 4LF5K 3R9LA 1U1RA 2ASYA 1RGIA 1C1BA 1WC0A 2XHCA 4XDDA 4PXBA 4HVJA 1YRTA 4LFAK 4DTRA 3D3BJ 3ID6A 4NLBA 2AMCB 2Z4PA 2IM2A 2OCEA 3PW5A 2VPWB 4H4MB 2AGQA 4USJC 4JBCA 1Z2LA 5E0OA 3PW2A 2XY8A 4LD0A 5LMNK 1GLCG 4M3XA 3QT8A 2DGTA 2ZJQQ 4WU2A 4DU1A 4NLGA 3Q89A 1MU2A 2QLWA 1PC4A 4B3SJ 1OQ6A 3VAHA 1QSYA 3I56S 3QIPB 1E4FT 4OYOA 2HHHK 3RWUA 1IG9A 2GUIA 1JCEA 4L76A 2XEXA 2YHYA 2BQ3A 4ILMA 4K2JA 5JJBA 3ITHA 1UCNA 3BH7B 1S1TB 5J2NA 3QDKA 2X6SA 2MB0B 4LVOP 2ZH3A 5IM0B 1HI8A 2R7TA 3DLLQ 4FJ9A 1FRMA 2Z56B 2L41A 1BQXA 3NMUA 1FNXH 4B8AB 5CY4A 1GT8A 3QMQA 2XO7A 4G3IA 4UZBA 4HDHA 3I55S 3W2WA 2EBGA 1C1AA 4GMKA 2MDAA 4ED2A 5H9EJ 4H5NA 3CCSN 4EP5A 1UVMA 4KREA 3P49B 3FSIA 4BRAA 4NCGB 1U2VA 3CJBA 2OP5A 5KFFA 1HBUA 3OSPA 1BA0A 3BEGB 3A5OC 3CCRN 3LZJA 4I68A 2YI1A 1JJHA 4OI2A 1S6QA 2HRUA 4M5MA 3VQ9A 1M5SA 4ZVTB 4ZVHA 1U2FA 1HBNB 2AD9A 3I8BA 5KFEA 3ENOA 4DV0F 4BRFA 4FVCA 2RPIA 4MYTA 4EU0A 3AO4A 3ZSQA 1YUWA 4ICLA 4I6MB 2E5IA 2I0XA 3GYXB 1VBZA 4OYBA 3KOAA 2FHJA 2P9PA 1OS5A 4GKJF 3ALYA 4U6PA 4ZJLA 3ZZPA 4X66J 1A7GE 4OX7A 1HPMA 1C1BB 5AXKA 1E6VA 1S6OA 3VGMA 3H7HB 2AA4A 4X4UA 1DY3A 5AFUH 2VC1A 3BS9A 1GXLA 2BJ7A 3LDSA 4LH5A 3P4IA 1HPZA 5KGWA 9ATCB 3LQVA 3E01A 1N52B 3TWZA 1YTAA 2BANA 5L9XA 3TSQA 2VBXA 2KZMA 3G71N 1T02A 3C65A 3CJRA 3N28A 3KWGA 1MU2B 2RN2A 2O4GA 1UW4A 3RB3A 4FOIA 3OYIA 1VQOS 1XMOF 1TELA 2M7SA 1X4CA 3CJ7A 5IWAF 4P73A 3UFCX 4Z4FA 4CJWA 2ZUAA 2QL7B 2EFQA 4N5SA 4OPKA 1QD1A 3ITHB 3D3CJ 4LIRA 4C0BA 4LFBF 2QX0A 3GQCA 1HLWA 4I64A 4AF1A 5J2NB 4DR3K 5AQJA 2LU2A 4I4BA 5IC4B 4FZVA 3VV2B 4GV9A 1WSVA 1HNIA 2UUWA 2KFZA 2DCUB 3QNWB 1A6LA 3BR9A 1JKHA 4ITSA 3W2WB 3N5FA 3PIPQ 4JKHA 1LV5A 5EX5A 4B1YB 2VKRA 2ZFHA 4OIXA 2HHTA 4CD1A 3G8TA 1GLLO 2IC3A 1RQ0A 1UFLA 3VGSA 1U2VB 5ETNA 4CJPA 1HBUB 3CCTA 4DCOB 4YDUA 1TK8A 2D69A 2UXBK 3SCIE 2H3GX 4ELVA 3LPTA 1WOSA 5KFKA 1WDTA 4CK3A 4A47A 1PKUA 1S6QB 3OBIA 1OVQA 3AVAA 3M30A 3AVIA 5AQPA 5KPTA 2DITA 2YPYA 1IM6A 4LF7F 2XGQA 1PG5B 5C5JA 3FBCA 4KGZB 3QEPA 4M5LA 3TWHA 4ICLB 1E4GT 4KH6A 1NDCA 3VQSA 5HAOA 3GTYX 1T8EA 3RMBA 2P9PB 1NGHA 3BZCA 4CF2A 2YH0A 1X4HA 4DV1K 3DWLA 4L3QA 1HNXF 1FNMA 5EXWA 1EQYA 2X78A 2F1FA 4P2MA 4QBUA 4NLYA 5KFIA 3I4PA 4NMLA 1EAYC 2RIJA 4IXCA 1YIJN 2O5DA 4KJIA 3US5A 4KSEB 2YKNA 3J7ZO 1LXNA 1D1UA 1NH7A 2A2CA 3ZLJA 1ZA2B 3MAAA 2RILA 1HPZB 3VQDA 2VA2A 4V19S 1MMLA 2DKOB 3E01B 3QMLA 2BANB 3PTWA 3N5BA 1U7LA 3JQKA 1N56A 3C66A 4IRKA 5CZXA 2W01A 4ZCKA 1XTZA 1OSDA 4YB7A 3THXA 4K0KJ 4FYXB 2DH7A 4TY8A 3CCZA 2FBYA 2RE2A 1RAJA 2CQ1A 3KXDA 1N8RO 1J5EJ 3LALA 3C2PA 4PYAA 5D3GA 3RW6A 4PAAA 5D78A 1RUSA 1YBTA 4NOHA 1ZBIA 2V52B 1HNIB 1XR7A 3I5CA 1QAIA 4A8XA 3T1YF 1JJ2R 3PSFA 5C7PA 3O9TA 2UUAK 2CPEA 1JKHB 3EKSA 5A8RA 5A2QO 3DDNA 4Q8FA 1Y3JA 5HJXA 1NKEA 2NLXA 1B0TA 3EDQB 4EAHD 4B1VA 3CJTA 4QIFA 3ADAC 4OX8A 1S22A 3EUNA 3CQYA 4JKDA 3RW7A 4CO5A 2HNZB 2IMWP 2VG6A 5KFBA 2MHNA 5GINA 5FDLB 3IN5A 2Z2MA 3BBBA 4JI4J 4X65K 4CZMA 3M30B 3PW7A 3BH6B 2OGUA 4MKBA 4B1WB 2R2UA 3DOLA 4LQ9A 2GAHC 3HYFA 3SQ2A 3CIZA 2WBNA 3VQEA 3MMJA 2PC6A 1SS6A 4GO5X 1P9YA 4FZXC 2PE8A 4M63C 3ENVA 3OYAA 3MI7X 1F3FA 2JVOA 4IG3A 4P75A 2DTUA 3M2UA 2R9LA 1UZDA 5MAOA 4ILGB 4NEYA 3I6PA 3IWNC 2YKNB 1VLOA 4HT7A 3SQ4A 2KHCA 4OI6A 4PXDA 3MAAB 4ZVGA 4LF6K 3ULHA 1MROA 4YHHK 5MLCQ 5BRDA 1U2RA 3I0RB 3A3PB 3AY9A 4RU2A 3ZEUA 5I9EB 4WIQA 5KG5A 3I31A 4F3QA 3THXB 4L72B 4A2BA 3OYFA 4TY8B 5KFWA 3D6TB 2FDNA 3M6WA 4CFBA 2DNNA 3AVHA 3SIPB 3R8EA 1LXJA 3CC2N 5D3GB 4GKKK 3VF2A 4LRFA 4NZ7A 3ZX3A 4OZ3A 2FLNA 4OZ0A 2VQEJ 4LF5J 4Y6IA 3AVLA 3O1WA 2E5GA 1D4XA 1K73T 1SJQA 4ILHA 3S8SA 2PAVA 4CHPA 2O8BA 3O4WA 1V5IB 2X7IA 1S76D 5A8RB 5AQMA 1NZ8A 4K4TA 4LFAJ 2UXCF 3MDQA 4CIGA 4PCQA 1I3OB 3BBFA 1UZHA 2CJBA 5KFCA 4Z0UA 1RWXB 4G1QA 2AV5A 3BKTA 2VODA 5LMNJ 4Y2KA 2P9NA 2VG6B 2D9OA 2V2QA 2F4VK 4ER8A 4YB1P 4ILRA 1S7HA 4DU8A 3CCES 1VQ8N 3DOMA 4ZDNA 1MNEA 1BG3A 3DOLB 2HHHJ 2L48A 3H08A 4J2BA 4O5FA 1AUSL 4NB4A 5F2RA 1T44A 3MMCA 3T5JA 2ITGA 2OJ3A 3U8XA 1CJKA 3PUFA 3B6BA 5JUMA 1CXUA 1YI2N 1XR5A 1WSGA 3D6RA 3U1NA 3SMSA 2ZM6J 2OPQB 4EZ6A 3AXMA 3NLCA 4BCAA 3CCVS 4IG3B 4FPIA 4NZ0A 3MCSA 2DH9A 2ZUGA 1U4BA 3D0GE 4DUTA 2ZJPQ 4ECTA 2N3LA 5HLFA 3V9UA 1NGJA 4BC5A 2G8KA 2GX9A 1CULA 4D3GA 2NRXA 2IVNA 4LSLA 4P2XA 4JI2K 3NGZA 3EGNA 1MROB 5HI7A 1JL2A 1HYVA 4CTAA 4EI2A 3EGVA 3R5AA 2OPSA 2PEBA 1RWNB 2B7BB 2HLUA 2M52A 1LW2A 3QAEA 3BGRA 1KHWA 3FJ2A 4TYBA 2F8MA 3G87A 1FO1A 3RMAA 1J5OB 2KG1A 4ZJQA 4DTOA 4RL1A 2H5EA 4JV1A 3HI9A 1GLAG 1TUUA 1BO5O 5J1EA 2WRMA 2LQBA 3SSSA 4GC6A 4OYZA 1O1WA 1RHKB 2CQCA 1A5WA 1R6YA 4NRUA 1NO8A 3MX5A 2OANA 3M8PA 2HBLA 3F5TA 4E7IA 4QW9A 2G8UA 4EBDA 1NNEA 4DI6A 4IQMA 1HWJA 2EI5A 3VHQA 2KB2A 3G6EN 2O8BB 2LKZA 3ZSXA 2XI2A 5C2DA 1U1KA 2QIFA 2CDQA 2ZBRA 4QWDA 4A8FA 2OD6A 2N4DA 4FCYA 3N6MA 1GLFO 1IUJA 1VSMA 4NWBA 5KFZA 3QEXA 2FD2A 4G1QB 1YVFA 3HSZA 4JB8B 1VQPN 2V8VA 2P9NB 1RBLA 1UFKA 4DSKA 4CT8A 2PA8D 2MMYA 4DV4F 2A0FB 1VQLS 4IOBA 3DOMB 1H2TZ 3IBCB 3KUGA 4O3OA 1XNQF 1DGKN 1T0TV 1RHMB 3BGOP 2VA3A 3MMCB 4J2EA 3G6VA 2H4YB 4NA3A 4IQXA 4B3TF 4C0HA 1CJKB 2LQJA 3A8IA 2DNRA 3MZIA 4W5QA 4CIEA 4G1PA 3A5NC 2M2BA 1H7XA 3HL8A 1NDPA 4FDFA 3LAKA 3QSYB 3N4QA 3GR0A 3IWXA 4CF9A 1Q5YA 1V6HA 4M63A 4X64J 4FNIA 3ULEA 3J7AN 3DRYA 4Q7AA 4WTYA 3AOAA 3ENWA 3VEZA 5HLFB 1T9VA 3NOGA 2WVBA 2IM0A 1CULB 2YPZA 4AT1B 2QSWA 5HATA 1Z4UA 1OY8A 3W9HA 4KRFA 2GFFA 4OZ1A 4Z37A 3QIOA 3QEIA 2E7XA 2OPSB 5KT4A 2DK2A 4BVOA 4DV6K 4MKYA 3PYFA 1LW2B 1LFPA 4U7BA 3BGRB 3HSCA 4NXMK 4OI3A 3ZC4A 2RMLA 3ZZZA 4BE1A 1YJNN 1PIEA 5DM6Q 4B9TA 3QZ8A 1NMEB 5HMYA 1UA1A 5JLFA 4QIEA 5IT4A 4L74A 2RE1A 5J1EB 3TUPA 1YJTA 2AEFA 3ZT0A 4F4YA 4FXWA 2FVRA 1K8AT 4Y1CA 3FK4A 4PXCA 5HL7Q 1AROP 1YDLA 4M1KA 3MCPA 4DV1J 4A61A 1PJ6A 5IT9O 2AJ4A 4FWMA 4CHZA 2Q2RA 1WKLA 1RT6A 4FYVB 4LF2A 2BQRA 4USVA 4F4XA 2R2TA 2QI2A 1SH2A 2ZWOA 2P9SB 4M42A 4AHSA 2BJ1A 1KOHA 2F9WA 2P1JA 1JL1A 1U8WA 2QYGA 2C1EB 3GCXP 4XK8C 2LXUA 4LBPA 2KKHA 5LY3A 1NGIA 4ZIVA 3L7OA 4U67Q 2BXJA 2NPIA 2V8HA 1WG5A 3CCLN 2OA8A 2YNHA 5KFPA 2DH8A 2LSNA 4FM1A 3DGVA 3T5LA 2C2EA 1K8AO 1T9XA 1FJ7A 3G8SA 2DY9A 2R8KA 1SCJB 4M5KA 3TZYA 4NPOA 3TZXA 3BP8A 2EKYA 4XH4A 5LMUK 2FJAB 3L4IA 4A62A 3SCLE 2MZRA 2X1AA 2OTLS 4Y2CA 5KPZA 1BQMA 2UUAJ 3ULEB 3OL9A 4H5VA 3SI8A 3P39A 3J7AP 4DUZK 5HP1A 1LWFA 2H3EB 2DD8S 5AR0A 4DV5K 4O0IA 3W8GA 2QA2A 4LF4F 1KTVA 2EFPA 4DR2K 2BW7A 4DV2K 2J7WA 2M8DB 4H4OA 2RF2A 5DRKA 4RBVA 5J2PA 3BQ1A 2WBRA 1W26A 3TAGA 4X65J 3B4MA 4N47A 2ZOMA 3NKYA 4WFXA 3VMFB 1SIZA 3DDIA 1PYSB 2M88A 2CWXA 5KT7A 1VISA 3ICLA 4QS8A 1K6YA 2OLWA 5E7OB 3MECA 3GWCA 4DSFA 4CLUA 2J0XA 1YZ6A 2B8PA 2HAIA 4YQWA 4CGJA 4WP9A 2H5JB 2CQ2A 3RR7A 2A42A 3FRZA 3GFXA 4OFZA 1RT6B 2MXYA 3NNCA 1NJIT 1CLFA 4ZP8A 2JWLA 2PIIA 3PIOL 4P6QA 1MWMA 2Q97A 5M2UA 4YHHJ 3K0SA 3P31A 3G9CA 1NM2A 3POTA 2I8EA 1UKUA 3DN9A 2KH9A 3IAM9 2FGCA 5CYQA 2F96A 1GTEA 1FDAA 5DETA 1D9FA 2IVFB 5IT0A 2YNHB 2Z57B 3H2VE 4DLEA 2HQGA 4K4SA 3VENA 4DR6K 3U6FA 1JLCA 1VFJA 2CPYA 1VQ9N 2JLFA 1N34K 2FY1A 1WEZA 1XC9A 4GKKJ 4JI8K 3OUYA 1NWKA 3EICA 2B9EA 4Y2MA 5GADP 2JOQA 2CJQA 3JB9k 3CT9A 3A8JA 2DISA 3W0LA 2YKPA 4BBYA 1BQMB 1VHXA 3HM9A 1WNEA 3BGUA 4RNOA 4B3SF 1REGX 2W6LA 3OTOF 1UEVA 5HP1B 1LWFB 1O6XA 4YOWA 2EFGA 3U27A 4NLXA 4W98A 4Z2XA 1B7FA 1JLEA 3NP5A 3G10A 2RDJA 3OJSA 1CQNA 3THTA 2PFDA 3N01A 2VOOA 4H4OB 3EZOA 2RF2B 2F4VJ 1PYOB 2EPIA 1S4EA 2DNMA 2QMUB 1WN7A 5C10A 2VUGA 1Y0HA 5J2PB 3AOCA 1RT1A 3AGKA 5A76A 4CLFA 3D0HE 1RBOB 3DHXA 4DTUA 4G1IA 3IRXA 1RXOB 1Z1ZA 4EHTA 2H51B 1VSHA 3OYHA 3GIJA 3OLAA 4X4SA 3MECB 4W90B 1G7CB 4IWVA 4A57A 2VD3A 3KHHA 2IVMA 4OL8A 1VQ6N 4GRSA 2WC9A 2C2MB 3TU5A 1JIHA 3CTRA 5EWGA 1TZ0A 5I4MA 2I5JB 4BDPA 3R2CJ 2ZH2A 1RWVB 3KJFB 4P2SA 3CB4A 3GZ7A 3TAMA 2QTDA 5BRFA 2YVSA 3OD2A 3BREA 3AARA 2ZH9A 4USUA 5F3TA 1KRPA 4JI2J 2NUBA 4URGA 1T3NA 3M6XA 1UVNA 5E3PA 2O3DA 3POTB 4WXOA 4O3RA 1ZAWA 1U48A 5D15A 2Q31A 3VERA 5HVFA 5CYQB 4NA1A 1T6CA 3TVKA 4J9NA 5HMZA 4X66F 2D0OA 2CVEA 3KG1A 3D4JA 1KBRA 1BGXT 4NYPA 3OBYA 2P5GA 3RAMA 4AYBD 2WSEC 2X1BA 1JLCB 3R6GB 5HJYA 4X4VA 4DL7A 3MUVP 3I5BA 5M2RA 5LJ5Y 1IO2A 1HWKA 3KJNB 3P6YC 3OUYB 3Q8RB 1JJCB 4ZCLA 3GSDA 1W2IA 3L2UA 2BE2A 3BQ0A 4OZNA 2KXNB 4URSA 3NEKA 1D0EA 1PAEX 1SUQA 2DHXA 2AF6A 2GCFA 1WELA 2RHSB 3J7YU 3OXGA 2ZH7A 3NH1A 3PJWA 3T6BA 3WQTA 1JLEB 1U26A 5KT3A 1GTHA 2AGOA 2QJ3A 1UA0A 4PWWA 3G4SS 1BIUA 1QS4A 2BDPA 2IFXA 1RT1B 3MD1A 5HK4A 4FO0A 1B99A 1TUYA 2WTFA 1DEJA 3GIRA 3V1QA 3D5MA 4CM0A 1JNRB 3IRXB 2FHOB 4JV5K 3OYMA 4LF8K 3PJXA 3N6LA 1RWUA 4FJLA 4CEOA 4UQGA 2P9EA 1TKZA 3A13A 4XTTA 4WFNL 2GQQA 1HHQA 3J80U 4R0JA 3AVGA 2HRYA 4JUZA 4LF9K 4UOGA 1RADB 1KNZA 1R0CB 2AP6A 3TAMB 2W4PA 1QTMA 1FJGF 1RHJB 4AL7A 4UUXA 2Z8QA 1AT1B 3DRPA 2QMWA 3H0PA 1WLJA 4X4RA 3GJTB 3TA2A 4CQ1A 1N33F 1TKXA 3L2WA 2LCWA 3M1FA 3W5ZA 5DGAA 2Q66A 4IH6A 4O8UA 3EXCX 1NKBA 1WOQA 5KFGA 4ZVOB 2XULA 1Y64A 3HSTB 4KBOA 3O1LA 3VGVA 2K06A 3K2YA 3V9ZA 3MX2A 3ZSWA 1EP4A 4NXMJ 2OTJS 4OJRA 4CJUA 2ZJRL 4RW6A 1SJFA 3ZT4A 4WU3A 1ASVA 3LANA 4JD2A 5B0DA 4MT1A 1UMJA 1Y5IB 3V9SA 1YTUA 4LR8A 3CO0P 5FLXY 4K8RA 2BE2B 4Z4CA 1RBRA 3UN2A 5AQKA 3UNYA 3MM6A 4ED6A 2B4PA 3BKFA 4G9ZA 2BE7D 5HSPA 2ACYA 3ID8A 1AUDA 4V19X 2F7TA 1NAQA 1PCAA 1Q7YT 4K0KF 1RA6A 2V69A 3IMXA 3BBCA 2EFNA 3J81Y 2DHHA 3AD8C 1J5EF 4Q8EA 3RB0A 4YOEA 3WIUA 4GNIA 3HRGA 1FKOA 4NL5A 5HMXA 1K47A 3D9BA 1KFDA 3UKRA 3FFIA 4DF4A 3GFYA 3PX0A 3GFZA 2E7WA 2VASA 3J7YI 5F3ZA 5EDWA 5H9FJ 3HLUA 4CEFA 3MEKA 4ALZA 3NG8A 3OXLA 4QWAA 4W4MA 4FS1A 3Q2TC 1T3OA 3UCGA 1KVKA 2IJNA 2W9CB 3C94A 2NXNA 2F9DA 1SKSA 1RBAA 1VQ5S 1R0BG 5L1JA 2ASLA 2F8HA 3MM8A 1TKZB 4O4GA 2GQ2A 4MAKA 2XB2D 2C3UA 1ITGA 4S0MA 4TY9A 3JAMY 1WEYA 4A46A 2JVRA 3CPEA 4C11A 1NHVA 2CKWA 1RT2A 3H5SA 4OZLA 2PA3A 4ZP9A 3TA0A 7FD1A 2DO4A 5JMVA 3DRPB 3DRRA 3KD5E 4DUZJ 3WQUA 4DV5J 4KYZA 1TKXB 2E9TA 4DR2J 2KDOA 2IS3A 1UEKA 4DV2J 3AOBA 4PL8A 1ZBSA 1BU6O 5JS1A 1JLFA 2FJEB 4JK8A 3CC4S 4K4WA 3G8QA 5D0GA 1EP4B 1T7PA 2DVIA 1HQEB 2Y9HA 3D67A 1L5UA 1HR0K 3CI5A 4RW6B 4DSEA 1RA7A 3LW5C 3E9OA 4KHMA 4JD2B 2RKIA 1EIYB 4IEEA 4IKFA 1P6TA 1HBOA 3TW0A 4QIVA 2FZCB 2GX8A 4B1UB 3SUOA 2MQOA 4CZHA 4J5OA 3QAUA 4OHVA 1XHXA 4XIUA 3K9JA 3MM6B 3L6QA 3AD9C 1WHVA 4KC5A 3CDEA 3T1HK 4FJIA 4R5PA 1VGYA 1NGCA 1DFDA 1S7IA 3LM9A 3LP0A 3MCMA 3R5GA 4ELUA 3OYEA 3GE1A 1NHKL 1FKOB 2V2ZA 1FTCA 2OH2A 1ZXOA 3VAJA 3UKRB 3FZBA 2J4RA 3Q8QB 3FFIB 3CULA 2OMLA 2VQEF 2P51A 4CO1A 3MR3A 4BS2A 1K9MO 2MY7A 3H4DA 1HNZK 4I69A 1JLQB 4KGVB 2B9WA 1BLUA 1U04A 4CZJA 1WSHA 4LFAF 5GVQA 1NBEB 1X9JA 2ILZA 3MPUB 2O1PA 4DR6J 2CQ4A 1ZH5A 5KG6A 3F73A 2JHEA 1N34J 4FJ7A 3VALA 3MM8B 4O4GB 3AD7C 4WF9L 4JI8J 4F2RA 5T41A 4DFJA 1D9AA 1C0MA 2J6UA 1D3WA 4J9SA 1TV6A 2Q3PA 2ABYA 1JQGA 2IGIA 2CJAA 3VZIA 2OEMA 2RDIA 4C11B 4I67A 1X3NA 3O1BA 4ELTA 3CG7A 3QGPA 3DRRB 2HHHF 4C1NI 2DFFA 3A4TA 4PKDB 1TKTA 1NU4A 2Q79A 3TVZA 2BM0A 4BC4A 1JLFB 4KH1B 3VGLA 3TUZC 2FF6A 1UWAA 1BC6A 5B7WA 3DMJA 2ATLA 2DNHA 2ZNYA 1NPPA 3X1LB 5E41A 2QEXS 3FQLA 2LEAA 3W63A 5THWA 5G0RA 2E66A 2BX6A 2RKIB 1V4TA 4TQSA 1HBOB 3UDEA 1Y10A 3CF5Q 3V2UC 3MCOA 2HQ3A 3QEWA 4H0TB 4I9QA 1UJ5A 3V81A 3IFRA 1KVIA 2HHWA 2NPFA 3R3LA 2W4DA 5EX0A 2HFZA 4O3PA 2YQ0A 4R5PB 1RWOB 2D0CA 1FFGB 3LP0B 4M41A 4HTIA 4RUAA 3FZKA 3WXMB 4MK9A 4YOYA 4B9LA 2QL9B 3IC1A 5F8HA 4Y0WA 1BE4A 4OYXA 3MDFA 3V1OA 1KKHA 4TSXA 4BRGA 3SCJE 4Z4HA 1S10A 4C8MA 4PUOA 4B02A 4YP3A 3CMEN 4LF1A 5KFTA 2J0SD 3HD2A 1QAYA 1HL6A 1NOZA 1WUAA 2IA0A 2HZVA 1FXDA 3G71S 1VSFA 1HNVA 1OY9A 1FA0A 3L3UA 4IJAA 5SWMA 5CH7B 2FUG9 2NS1B 4ZN3A 2EX3A 1VI7A 4YB5A 3K2PA 5C0YA 3C6HA 3DAWA 1C6VA 2BV3A 1TV6B 3MM9A 1VOMA 3EGZA 3M9OB 5IC6B 5F8MA 1HHTP 3ZSOA 2BACA 3Q23A 3QGGA 4UF4A 5GADU 2NSBA 3EMTA 1ITPA 3FBEA 4J7CA 4TU9A 3RMCA 1TKTB 1LFWA 4RWWA 2D0AA 5F8JA 1SC1B 2F5GA 5LXYA 4LSZB 2XBPA 3MPWA 4DR3F 4M3WA 4FLXA 3MCNA 2EW9A 4O3QA 1U49A 3DMJB 5LSRA 1AFIA 3R6LB 4F4ZA 2VWKA 2QA4N 4JV5J 3SMPA 4LF8J 5G0RB 2YH1A 3QIDA 4WQ4C 4CZEA 1KSPA 4M8LA 3U1MA 1HJRA 5KT6A 1FJEB 1VBYA 5D4OA 4ZIWA 4YEAA 4CZFA 2PBDA 2XI3A 3V81B 2UXBF 2CFXA 3OVNA 4LF9J 3DU6A 4LSNA 3VGUA 2EG1A 2GJFA 4FVUA 4ZPTR 2JRSA 3R7SB 4JS5A 2VL1A 2HFUA 2GMHA 3GV5B 2VBWA 3KLFA 2HFVA 2CZVC 3PLAA 2WW4A 2C28A 2H48B 2QWRA 4DDFA 4OVLA 3ZZTA 4EEYA 4GVLA 4CJ3A 2VJUA 4XO0A 1BCMA 3NE6A 4KH0B 4OI0A 4C8NA 1YIJS 2KXFA 1QZ5A 4I1TA 3M9NB 3R8YA 4DV1F 4KT0C 3FCWA 4OZ2A 2EFVA 3V6KA 3DRSA 4PUOB 2HSEB 3OHBA 2Z1JA 3MR2A 2V94A 4CDIA 3WUHA 5F8GA 3K5OA 1QQCA 4NYOA 2C3MA 1T9YA 3HM8A 3GYNA 2RH3A 1R27B 1NEEA 2LYVA 3SV3A 3NL0A 4LC9B 1HNVB 4N7TA 1H6KX 2HS3A 3CYMA 3FRYA 3HJFA 3W7BA 2JLEA 3TEGA 4P7VA 3W9JA 1F2HA 2VYPA 3MM9B 1NKCA 1V4SA 4RG8A 1NB7A 3M8WA 4ZK7M 4R25A 4KIAA 1VQ7N 2X3DA 4KHYA 2GHPA 3P96A 1S99A 2QXFA 3MF5A 1Q1KA 2VBZA 3UD3P 2XWYA 3EPGA 2HNDA 2XS5A 1XNRK 1HLUA 2W24A 2EBEA 3ZT2A 4FJHA 4CLYA 2V7ZA 2XC9A 1M90O 1FI4A 2UUCK 2GIFA 2CZ4A 2DNYA 2NZ4A 4CJQA 4GMJB 4ES3A 1C0GA 3GILA 3RJMB 2D74B 3NCIA 4CZKA 4IOAQ 2LLZA 4L3NA 3PRBA 4ZLPA 1XMQK 1TYQA 2RQMA 2OZSA 1CS4A 1UFWA 4KHQA 2E1MC 4ZP6A 2DR7A 1B70B 4BY9C 3DFEA 1AFJA 3V9XA 3CFOA 4LSNB 2J9EA 2G1HA 2G8FA 1N6QB 5BPNA 1DHMA 4X65F 1HIYA 4B08A 3KLFB 2OFGX 3BSNA 3JSYA 4F8RA 1SQGA 4B8CA 1S1WB 2BQUA 2ZJQL 5IOLA 3OFHA 3UD5A 4CERA 3B82A 2VFVA 1SH0A 3E9LA 5CABA 2I2YA 2KKZA 2RUSA 2HHXA 1JXBA 3O2IA 3RBEA 2UVWA 2F8SA 3OR2A 1ZTTA 3DRSB 2A6MA 2JFDA 4FJMA 2QSFA 2WZ1A 3QQCD 3H6EA 1IKWA 2KU7A 4B3RK 1S57A 1HR0J 1VMBA 4O3SA 3WNEA 3S7RA 2WUSA 2C22A 1HD1A 2W2OP 4YORA 1F5AA 3T6JA 4OQJA 3DLLL 2OYQA 2BM1A 1YJWN 4F3MA 4YHHF 3QICA 4RU9A 4KKOA 4B3OA 2VIHA 3BDPA 2RJZA 4NLVA 3ISZA 3P3DA 4DR7J 3T1HJ 1GLBG 4LRCA 4JKBA 7FDRA 5F0WA 4LVNP 4ZPBA 2ZH1A 1RDAA 2PT0A 3SXLA 1N5YA 2HNDB 4DPOA 2G2YA 4A8YA 4ECXA 5K20B 2XZDB 4GKKF 4FPAA 5C2FA 4M5DB 3Q8VA 5CXTA 1G3OA 4LIWA 3SNNA 1UTAA 5I3UA 4HI2A 2DRDA 2LFVA 1U6BA 4JI5K 1HNZJ 2VJVA 3AA4A 1ZBHA 4ZVEA 2DPJA 4P10A 4X2BA 2R7WA 1SQKA 3OFGA 1V9OA 4DN0A 4CGIA 1TYQB 2MJUA 1CS4B 4DXLA 1I1GA 3UWTA 4BRDA 4LBIA 4CHOA 5A2QU 2NUHA 2UZAA 3AA5X 2F4VF 2J9DA 4WQ4A 2BEFA 4UW2A 3AFGA 4M45A 1ZZNA 2Z1GA 1NUEA 2GV9A 5HQMA 4AQYK 4HTLA 1EX8A 1JXEA 4QS9A 3C6TA 1DTTB 3CD5A 3FBBA 3MAQA 2IVOA 3HT3A 1YI2S 4CBUA 1SPBP 3GG0A 3ZTSA 1U45A 3MR5A 3TOQA 1F21A 4YOVA 3IBWA 2NYHA 1NGAA 4CGHA 3HPHA 2W25A 1RAAB 2KRRA 3GPAA 2RQKA 3AVKA 4CECA 1IKYB 3OR2B 3SV4A 4NCBA 2HBMA 2X6NA 2L08A 1IKWB 2HK3A 1BMQB 4CJ4A 2LP4A 5BN9A 3A3NB 3QEVA 3CDUA 3PRDA 2OPPA 4JI2F 2ZHBA 1LEOA 4CJFA 3EXYA 2ILYA 3QFWA 2E1YA 1T9UA 2E2PA 4Z7CA 4KKOB 2FSNA 4WE1A 4B3OB 1H2UX 1IJFB 3PIPL 1L3TA 5AQGA 4MK7A 2WVFA 2HVIA 1OY6A 1ESVA 2YKMB 1IR0A 5FLXO 3IBFB 3VR1A 4ZLJA 4OKKA 1WJ9A 3QBXA 4J8FA 1BIZA 2I1RA 1N5YB 1DLOA 3MR6A 3ONQA 2FLPA 1F9HA 4FP9A 3DLBA 3HKZD 1UW9A 1IV0A 3G6ES 2HB5A 1Y5NB 1KD1O 2DY4A 1RCXB 4JKAA 2DHSA 5I3UB 3DCAA 2KFNA 4K59A 5F8IA 1TTHB 4PKHA 5ETSA 1FTRA 4DR4K 5JVGL 3JXOA 3TI0A 1EKEA 3NRBA 4DV3K 2DIUA 5KFXA 4FJKA 3MR7A 5JMNA 1ZC6A 2E5JA 2R4FA 2KT2A 2BOAA 3S3NA 2LU1A 1NK7A 5J1NA 4X4PA 3FCVA 3C95A 4LFCK 4KY3A 2XMMA 4CEZA 1Q81O 4HHHA 4BC2A 1RP5A 1C2PA 1H98A 4CHNA 4DV7K 1VAZA 4CHYA 3C6TB 4KAZA 2DPNA 3JAMO 3KNGA 4WTOB 1VJQA 4EGLA 2Y1JA 2C3OA 2L9WA 1WKKA 3UW1A 1S1UB 3O9QA 1QVFR 4QR0A 4CGDA 1R3NA 5L1IA 2JJ4D 3GIIA 2AX1A 1QLNA 1U0HA 2ZHOA 3SSRA 4K50A 3CQ8A 2VWBA 4RUHA 5AQNA 3NWRA 2HMIA 2NRTA 2GVDA 3RAXA 5EY4A 4DTPA 4CH1A 2ZHAA 3BV8A 3O6WA 1ZYQA 2ASPA 2IRXA 4WKRA 4Z4EA 3KWIA 1OSCA 2OPPB 2GHWA 1VQMS 4AH9A 4BDZA 1URNA 1NCLA 4DX8H 4CH7A 5AE2A 1JLGA 4FBTA 4WE1B 3SAHA 3ILJA 4DV6F 4YR2A 4KB7A 3CUNA 1BQNA 2P9UA 2XMKA 2YNIA 4FK0A 1N54B 4MJKA 1U6ZA 4A4JA 4C9DA 4KV8A 3L2RA 4NXMF 3DOKA 2Y8YA 4HUGA 2BYCA 1YK9A 1IWGA 2X51A 1DLOB 2HBKA 4GVBA 1X31C 4QR2A 1VHFA 4V1Ak 2XY5A 3I96A 3H2LA 3HOTA 4ZVRB 1NK9A 3JTPA 2YKOA 1VRQC 4CO2A 1NGBA 2YX1A 4OGCA 4UT4A 2EG2A 3NGYA 1Q7LB 2NRZA 1HYSB 3VESA 5C12A 2HK2A 3O9RA 2G0CA 3WDOA 4RPFA 1VSKA 3G0ZA 1FDBA 5DJBA 3MWBA 2W7AA 5ADZA 2L9NA 3HKWA 2KJVA 1FVSA 4E3SA 5K8NA 1H72C 1SL0A 3AO5A 1B4SA 4CGFA 3NNAA 4DTSA 1RTJA 4QW8A 3RGIA 3FEXB 3CW2C 3R5JB 1OH6A 1CQMA 2AX0A 2YWFA 2JLGA 2MZJA 3WQPA 2EHGA 1DURA 4DZDA 4ZP7A 2FLLA 1XNRJ 3MGJA 1U0HB 3HHDA 1W97L 3MURP 5LMUF 4IJNA 4BG9A 2F65A 2HMIB 1AXQA 2BA9A 2GVDB 1SL2A 4M95A 2VG5A 2CQ3A 3SYZA 2A1RA 3RR8A 3Q8PB 1PBAA 2LXFA 3OY9A 1TFWA 3K89A 2YJEA 5EWEA 1RBUA 4KFBA 1B7YB 4DUZF 5K8PA 5LT5A 3DGPA 1XMQJ 4WF9Q 3BYRA 1AZSA 4H4KC 4CO0A 4DV5F 1I39A 4DR2F 4F3TA 3KKFA 3OPKA 2ZITA 4WJBA 1JLGB 4DV2F 2CJYB 3HP6A 3NVMA 3L95X 1BQNB 4RW9A 2P9UB 3L4QA 1LOTB 2YNIB 2K3KA 4QPTA 3L3VA 1KLMA 4H0XB 3DYAA 5DZ7A 4KV8B 3GIKA 3CJ8A 4I7FA 2CPDA 1RLCL 2OKQA 2Y3YA 3AXKA 2HF3A 3D2WA 2D4WA 4GVMA 5KFHA 1YJRA 4J9LA 2W41A 1SH3A 4DSJA 3FMWA 4U7CA 4Z94A 3CD0A 1ZBTA 5BR8F 2BE9B 3I5AA 1KFSA 4CW7B 3I55N 5CZ2A 5FPMA 3H40A 3GG1A 3O3HA 1KVAA 1YSJA 3LZIA 2DGVA 2VONA 5LXRA 1Q79A 3LF0A 2JNJA 1RLDA 4OJGA 2MTLA 2IY5B 1VQYA 1IBLK 1KC8T 2A41A 2HS0A 2EK1A 3VWSA 4H5WA 2KT5A 4DG1A 2PZSA 4Q0BA 3BSAA 1ZAVA 4LUBA 2P5VA 3SUQA 2XHWA 2YY3A 5F8NA 4FPRA 3AO2A 2ZJPL 2DTJA 2QT7A 5T7BA 4H0PA 1GMWA 4GC7A 2K3IA 2IDOA 1IM4A 1FWLA 1J6ZA 4NYNA 1H73A 1VQ9S 1RTJB 3U7JA 4BRPA 5JLHA 4DR6F 1KDNA 3KK3A 3CD6S 2UU9J 2HBRB 4FXDA 1JLBB 3CNQP 1N34F 3KLHA 1GXTA 1VC6A 4ZS6A 4A48A 4JI8F 3L9ZA 2E8AA 1VIOA 4K4UA 1O5JA 2KLAA 3O3FA 3R5CA 4OYWA 4BRNA 2CPXA 2JEJA 2NRRA 4JI5J 3QFPA 3ET6A 5M1KA 2DGQA 2VG5B 2V8DA 4IZ9A 1TMMA 1WC4A 2RHKA 4KFBB 3KYLA 1BI4A 3DGPB 4BC7A 5HRSA 1AZSB 1RCHA 5CHIA 1H38A 2ZVIA 2PFFB 4MO5A 1VQON 3PFOA 3EDRB 4M3UA 4CIOA 2ASMA 3QJPA 4RW7A 4RW9B 3OTDA 2HKEA 5D0RA 4QQBA 1KLMB 1LAVA 3KIOA 2Y1IA 2WONA 3DYAB 4AQYJ 1BL3A 4B3MK 4I7FB 3SEOA 3TUJC 2GGPA 1ACMB 2CPZA 1C0FA 1PSDA 1KS2A 3NAIA 1HWIA 2FC8A 4UOFA 3QRRA 4EMDA 3TRGA 4EP4A 3PEJA 3I9ZA 2GAGC 1W7AA 2AP1A 2MKSA 2I7NA 2Y8WA 1Q8KA 5AQHA 4F0HA 4QWEA 4JKCA 1GLJO 3CCJN 6AT1B 1NPKA 2BJDA 4M5IA 3MWPA 2PYLA 5AFUA 1YG0A 2AKWB 2O8FA 2A10A 5BR9A 1KQKA 3CCUS 3B4DA 3P5JA 1RE1B 1K44A 5K5MA 3H5UA 4DG1B 2HS4A 4C1NK 1ZAXA 4Q0BB 2A1BA 4TVAB 1VQSA 4HCBA 1RSCA 2W2MP 3TSUA 1VIXA 4ANCA 1LW0A 4CE9A 4FYYB 2KHOA 3TP2A 2WOMA 1GFWB 1EKSA 4N8OA 4K4VA 5HQ8A 4HHTA 2NRHA 2EWSA 4USMA 1H1VA 2GMLA 4UY85 3R1XA 2AJ2A 1Z25A 2CNKB 1NHUA 3KK3B 2MYFA 3IWLA 4TYAA 1D09B 5GAEP 3AA8A 2MKIA 2KFYA 1LCUA 2E5LK 2MHEA 2F8EX 2HBJA 4WFZA 3TVYA 5DM6L 3WX8A 2FJVA 3ET6B 3H5YA 4DSLA 1S1TA 3D2FA 1Q82T 4DR4J 3RG6A 4Q44A 1BI4B 4DV3J 5BYSA 5EHHA 4FJNA 3T9ZA 4FZYA 5CYMA 1G15A 4PXEA 2D7SA 4LFCJ 4RW7B 2K8GA 1SC3B 2E29A 2WONB 3T1YK 5AQVA 4DV7J 1WSFA 1TL1A 2FJXA 2GGPB 4CNYA 4CEBA 4FWQA 3Q86A 4JV5F 3KJVA 4LF8F 4BG8A 1ZM9A 1U02A 3G6XA 2V8PA 2XY7A 2ETJA 4D3HA 4P2FA 3RTVA 4NO7A 3AJ1A 1IWAA 2FVCA 3ZSZA 1LWCA 1DTQA 2DYAA 5GAHP 2N82B 4JI0K 2VB6A 2H5IB 2IRYA 4EUVA 3CHWA 1U1OA 3NMAA 4LF9F 1YJ9N 4Y65A 1RAIB 1JK9B 3LWMA 1TL3A 2O8FB 3V6DA 4FLUA 4B1XB 3AODA 2V50A 4ILLA 3JSBA 3EX7B 2D0BA 1YLXA 1YXQA 1HUXA 4CF1A 4N76A 4AFFA 4DTXA 2RNEA 4FVMA 1LW0B 2J76E 3WHIA 4A8SA 2WOMB 3LPEA 2GVZA 4M7YA 3RMDA 4HACB 1GOAA 5FPDA 4ZVPB 3KHGA 1CJTA 3H98A 3RRKA 1CXQA 2KN4A 4I2PA 2JX2A 1Y5LB 2IOCA 2XCPA 5EVZA 4DR5K 4L73A 4BC9A 1BUXA 3MCAB 3W3SA 5GMKa 3LOUA 1S5JA 1RI7A 4MMOA 4CD3A 3D2FB 2ZM6K 1HFEL 3GONA 2VV5A 3UCZP 4DTMA 3V9WA 4ECSA 2QWOA 1JCFA 3OSNA 3SQ0A 3KK2A 4E1NA 2RQCA 3ZX2A 5CYMB 3HPGA 3KTQA 2JEGA 3PM9A 3UO0A 4P72A 4RCHA 3O44A 4ETZA 3TJ9A 5I42A 1PC5A 4PG7A 4HI1A 5AQTA 3LA0A 2GJIA 1BOTO 4FF2A 1TL1B 1S9EA 1LK5A 4JP8A 3J81j 4E2FB 2DNPA 3KJVB 1RGVA 4ED8A 2PY5A 2R8JA 4BLGA 4J9QA 2AYBA 3BM7A 4HHJA 1EX4A 3CJAA 5KPRA 4FF3A 1LWCB 1DTQB 3H5XA 3CC7N 2HVHA 4HH1A 3SFUA 1WSRA 1BISA 3TTFA 3KK7A 4BHQA 2B4OA 2QWMA 5L1LA 3HHLC 1XEZA 1U1QA 1TL3B 3PO4A 3V6DB 3QBCA 3M1VA 2HWIA 2R7YA 3MN5A 2K7JA 3R1LA 2BKPA 1YJ7A 2ASDA 3BF1A 1T05B 3PW0A 1TQLA 4PG5A 2GC8A 2ZBIA 2ZDPA 1P1LA 4ISFA 4E7HA 1M0SA 3HX9A 3GDQA 3NCQA 4DTJA 4EFAC 2MZTA 4CIFA 3EE8A 3PYDA 1R7IA 2K7KA 3A2FA 4BRKA 4C98A 1QUPA 4F4KA 1IH7A 2YQ1A 1UVIA 3V4IA 3OJUA 2GVZB 3O08A 1X5OA 2Z0GA 1HR0F 1VSEA 1VK0A 2QO3A 1CJTB 1NMDA 3CJCA 3TQ1A 3CCVN 5KG3A 1I3AA 4IOCQ 3T5HA 3CPWR 1VCTA 3IAYA 4I2PB 1O0PA 4CJTA 3W64A 1TL5A 1N5SA 3DXBA 3PKMA 3AB4B 1PO6A 4WZMA 4C8YA 2AZ3A 2JL9A 2PDAA 2KYXA 1W2BM 4RUCA 3T1HF 3MXHP 5B0AA 4QU7A 4FYWB 3QLHA 2G2OA 2I7PA 4L6V3 5HRPA 3CDBA 5IFMA 1IBLJ 4JI3K 4ES1A 3I33A 3FZ2A 4K4YA 2YWKA 3KK2B 4X64K 3PX6A 4ANEA 1P27B 5KFDA 1R8CA 2JC1A 5B0BA 3PDNA 4OX9K 3AGRA 1F3VA 5I42B 1N36F 3J7ZT 3NF7A 4H0VB 1HNZF 1M1GA 2N7CA 2KM8B 1S9EB 2HNZA 4IFYA 3OYLA 2XGPA 1R6VA 1RDBA 5AE3A 2D0PA 2DGSA 3PR5B 5FDLA 1GXUA 3GJSB 1OH7A 4BVPA 5KFOA 1ZBLA 1CLQA 4CEDA 2VHGA 1WC5A 3VZHA 4ZVQB 1SI9A 1HBMA 2YNFB 3MOJB 9RUBA 4PQAA 1N8RT 1VRTA 3BDEA 3MK6A 2RS2A 5JVGQ 3ILIA 4FYDA 3K7RA 4WK3A 3AVFA 4OKEA 1E3MA 2BRKA 3M1VB 3L4BC 2ROPA 2MKYA 2ASJA 4AHTA 3PCOB 3A8EA 4DZ6A 4NASA 2C2RA 1TL7A 3JYTA 2CYYA 1DKGD 1S48A 4LFBJ 1J53A 8AT1B 1IKVA 2YXLA 2M9KA 3UPFA 4O4RA 4J91A 5KT5A 2AZ1A 2KXHA 3BGFA 3S01A 1J54A 3R27A 3QFUA 2CRLA 5DDOC 3V4IB 4B3MJ 3FEYB 3I0RA 3LP1A 2QG9B 2QYCA 4J9VA 3CM5A 4OGEA 1ZBFA 4E1JA 3ATVA 5ETQA 2XLJA 3EE3A 3M6VA 1VRUA 1TUGB 2G8HA 3VAIA 3C16A 3QYYA 4W92B 4WYBA 1S1XA 4QOTA 1UVLA 4K4ZA 4AXJA 1VQNS 2JC0A 3QLHB 1JXLA 2JWKA 4DB3A 3ZXWA 3HVWA 3CSKA 3BSOA 3DLRA 2H54B 4LF7J 2XM3A 1QZ6A