4ID5A

Hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 164
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4id5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4id5A05
3IRXB 4CCHA 4B3OB 3AO3A 2ETJA 3QGIA 5KFZA 4DL7A 1RAJA 1RDRA 4GVMA 3DLEB 1TKTA 3LP2B 5KFRA 2X6SA 3OYMA 3PW7A 1TGOA 5KFVA 3NCIA 4M3WA 5J2MB 1WSHA 4ED1A 3H5XA 3SJJA 5F8IA 2AWZA 2WOMB 1RT5A 3QETA 4FLUA 4Q8EA 5FROA 1C2PA 3FFIA 5CYMB 2UVWA 4EO8A 2VA2A 3FSIA 3IG1A 3AVJA 3G6VA 3QEWA 3D5MA 2G8UA 2IJNA 5KFOA 2RF2B 1LAWA 4FJMA 3KLFB 1BI4B 4Y1CA 2E4LA 3SI8A 2AJQA 3CDUA 4E7KA 4J2BA 1J9AA 5KT7A 3L2WA 3UDLA 2O4GA 4LD0A 3NE6A 4FLZA 3BSOA 5DG8A 3GV5B 4MH8A 2VWKA 3NF7A 2A1RA 3SUOA 3DLKB 5KFBA 3SNNA 4RU9A 4E7LA 4ED3A 1NOZA 4CJRA 2HMIA 3SFUA 3N6LA 1KTQA 1IKXA 2OPPB 1RDAA 1X1PA 4WZMA 3ITHA 3RB0A 2YHBA 4CHZA 4WXOA 4FJIA 3FQLA 3OSPA 3CJ3A 4RG8A 2X6NA 2JC1A 3V9WA 4Z4IA 3BREA 4BDYA 4FK4A 4LSNA 3KJVB 4IG0A 2W9BA 1JLEB 4U6PA 1VSDA 3H5UA 4HUEA 2D3UA 1YT3A 3LPTA 1S4FA 3TANA 1RILA 1X9SA 4CJEA 1VSKA 2R8GA 3TAFA 4RZRA 3DMJB 1OS5A 1S9GB 4IBNA 4DF8A 2XHBA 2G8KA 3AVKA 2FLPA 1CZ9A 4KREA 5F8NA 1LWFA 3VQ7A 2B6AB 3G10A 3ZSZA 1RTIA 1N56A 5KT2A 2R2SA 3VQ4A 4IR9A 3QZ7A 4JRPA 3SZ2A 2W8LA 4OGEA 1MU2A 2C22A 1QE1A 1JL1A 1BCOA 2IM2A 1EP4B 4LQ3A 1RDBA 2P1JA 4CGHA 4ZPAA 3ZSRA 1L5UA 2IAJB 1LW2A 1XC9A 1KVCA 3ZT2A 3PJXA 4KTQA 4YQWA 3KLHA 4CFDA 2KQ2A 3OYBA 3M8PA 3MXIA 1NJWA 4CJKA 2R8KA 3PW0A 1DTQA 3BSAA 3CJ2A 4CHQA 3IRXA 3L2VA 3SUNA 3AVIA 3HP9A 4B3OA 1XHZA 3NAHA 5KFIA 3MXJA 1CZBA 2ZE2B 3Q8PB 3K5LA 2GV9A 1KVBA 4OKJA 3DLEA 2BE2B 1LWCB 4GMJB 3LP2A 1XR6A 3ISND 2HWIA 4R5PA 3OS1A 3CFRA 4Q5VA 5HRNA 4FJ8A 4CEQA 3GIMA 5L1JA 3OS2A 1K6YA 5J2MA 3VA3A 3EPIA 3T1AA 4CJWA 2WOMA 2P51A 4KHRA 4GC7A 1S6QB 3DRPB 4Q45A 4FK2A 3Q8RB 4IDKA 4M94A 3JSMB 3NMAA 5CYMA 5L1LA 3L2QA 3KKRA 2C28A 1VSFA 3D0PA 4XO0A 2RF2A 4J9LA 2XI2A 1BI4A 3B6PA 4H4OB 3OVNA 4IH5A 1C1AA 4ELVA 1HNIB 1LV5A 3JYTB 1RDDA 3DLKA 3A2FA 3LAMA 4RW9B 3M8QB 5FDLB 3NF8A 4RNNA 4NRUA 2KTQA 1W9HA 3HK2A 2KFZA 2KZMA 4Z4FA 2OPPA 2C2DA 2OPQA 4F4WA 4F50A 1JXBA 3DI6B 1RTHB 3NAEA 4XPCA 4DSFA 1KLNA 2FBVA 4W5OA 5T14A 3HVTB 1RT2B 4DQSA 2IC3B 1D5AA 4EZ6A 1R0AB 2RDJA 1ZYQA 3S9HA 3KJVA 4ECZA 1JLEA 2AGOA 3NH1A 2HHSA 2FJXA 3M8RA 1S0NA 2CKWA 5F8HA 1D9DA 4KI6A 4M42A 5KG6A 2R2TA 4URGA 3RR7A 1YVFA 3DMJA 3U6FA 1S9GA 4YR2A 3NHGA 3SI6A 1I39A 1WSIA 4NLYA 4EZ9A 3SV3A 3HSTB 5KFSA 1JKHB 1IH7A 2B6AA 4DL5A 1GOAA 4DSEA 1N5YB 3NGYA 4XPEA 5F8LA 5JUMA 1WN7A 5KFWA 1EP4A 4CGDA 2IAJA 3LDSA 3Q8QB 1A5XA 3SCXA 3SYZA 4KV8A 3HXMA 3C95A 2X74A 3L2RA 2F8TA 1G15A 1L3VA 1FKOB 2WONA 2G8VA 3DLGB 2E6MA 1SKSA 2HNZB 4I2PB 4CIFA 3QYYA 1TK0A 2ZE2A 2O4IA 1S1XB 2D41A 3OL7A 4FJ5A 1TVRB 4IOBA 2BE2A 3K5MA 4NLRA 1LWCA 1RT3B 3TAQA 1TAUA 3OYHA 4W5TA 4HTUA 4ED2A 3BGRB 1J53A 4JV2A 4RUAA 4M41A 1QUVA 1JXEA 1S1TB 4K4ZA 1S6QA 3DRPA 2EC0A 1EXQA 3JSMA 4EP4A 4TQSA 2PYJA 4KTWA 4DMNA 4O5BA 3IN5A 2JEJA 3AVNA 4WYWA 1BCMA 3V9ZA 3GYNA 2F8SA 4CHNA 2HW3A 3O3HA 2C2EA 4H4OA 4CGGA 3V4IB 3G0ZA 1HNIA 1TKXA 3VQ9A 2EHGA 3JYTA 1CLQA 4YFUA 1NKEA 4RW9A 5FDLA 3RMCA 2I5JB 5KFDA 4HUGA 4NYNA 5DMRA 3UPFA 3VA0A 4O3SA 1D9FA 5I3UB 1TKZB 3BQ2A 5KG2A 3DRSB 3U3GA 4ID1A 1NK7A 4MFBB 3AA2A 2OYQA 4KSEB 3AVLA 2G8IA 3DI6A 1RTHA 4E0DA 4I2QB 3HVTA 1RT2A 3OLBA 2JLEA 2DFHA 5DQGA 1UOCA 2IC3A 1R0AA 2J6UA 3NGDA 2Y1IA 1NHUA 3THVA 1S0MA 3KHLA 5KG0A 4Q8FA 1LWEB 1U09A 4WFZA 4FJJA 5K14B 3C6UB 3EZ5A 4ED0A 4WYLA 2HHVA 4I9LA 4CEEA 2XWYA 3SQ4A 3PX4A 3CO9A 2WRMA 4NLXA 3RB4A 1JKHA 4IRKA 1JIHA 2G8WA 3M9MB 4FBTA 4MKAA 1N5YA 2XGQA 3RRHA 4FJ9A 3KLEB 3DDKA 1ZBUA 1FK9B 4EEYA 1SUQB 4CE9A 1BISA 2ASLA 5KG4A 4NLDA 1VRUB 4CJVA 4M3XA 2P5GA 3MR2A 4CGJA 3HVAA 4KHQA 2UUWA 4IKAA 4L8RB 4N41A 2QXFA 4DTUA 4M3TA 4KB1A 4R8UB 4J9KA 4FM2A 1SH0A 2DY4A 3AVCA 1SH3A 2FLLA 2GC8A 1FKOA 5DLGA 1UA0A 1JLBB 4FS1A 3DLGA 4CF2A 2HNZA 1QAJA 3HT3A 3NL0A 4I2PA 4FLVA 2UVRA 4X2BA 1BL3A 5HROB 3ALYA 2AGQA 5KT6A 1TVRA 4CEAA 2FBYA 1RT3A 1QSYA 3UIQA 3VQPA 4DLGA 3PX6A 4DTOA 3BGRA 3BSNA 3H2LA 2O5DA 1S1TA 1I6JA 4DQPA 1C6VA 2RN2A 3NKYA 1C1BB 5KFJA 5KGXA 3PO5A 3AO4A 3RAXA 3RB3A 1I3AA 4CJFA 4KB0A 2IA6A 3OYNA 2FBTA 4ICLB 4DTMA 4ZVGA 3V4IA 2PY5A 4DFMA 5KFMA 1Q9XA 4K4VA 2FLNA 2JC0A 4CJPA 5HRPA 3SV4A 4FW2A 1NK4A 2I5JA 2J6SA 1RNHA 1HPZB 3K2PA 3G6YA 2UVUA 3P83D 3CJ0A 4NZ0A 4ECYA 3M8PB 5KFHA 2XY8A 3O4QA 5FRMA 2BQ3A 4BE0A 4DL2A 4FLWA 5I3UA 1TKZA 1KFDA 2Y1JA 1S6PB 3DRSA 3CM5A 4MFBA 3KHHA 4JS5A 4RW8B 4N5SA 1XWLA 4KPYA 4FZZA 3IGVA 2YKNB 4IH7A 3VQDA 3OYIA 1NOYA 4I2QA 4N47A 4F4ZA 4Q43A 2E9RX 2XC9A 2KFNA 2BRLA 4R5PB 5EWEA 3AA4A 4DFPA 4URQU 1LWEA 4CJTA 5K14A 3C6UA 4HKQA 4IDKB 3NBPB 4NLUA 4DEZA 4CJSA 1KCFA 4RW7B 1LW0B 3V6JA 3V6HA 2Z1JA 4DTJA 1YTAA 4ZPCA 4PWDB 1RYRA 4ZTFA 2RDIA 5KFTA 1TQLA 5L9XA 3KLEA 4CK3A 4WFXA 1FK9A 4F4YA 1ITGA 1SUQA 4Z4HA 3OYDA 1CXUA 1VRUA 4UQGA 4K4SA 1IKVB 2R2RA 1ASUA 3MR6A 1VSIA 1VSJA 2CJQA 5SWMA 3IAYA 4R8UA 1KSPA 3DM2B 5DGAA 3VQBA 4HUFA 2UVVA 3IS9B 5KFCA 5KFXA 2OPQB 1VRTB 1T3NA 1JLBA 3NF6A 1GOBA 3HPGA 3OYJA 1J54A 4QW8A 1BIUA 1RA7A 5HROA 1X9WA 3KK2B 2XI3A 3QLHB 3HYFA 3HVWA 1N6QB 5SZTA 3H98A 1VK0A 2R2UA 3EZUA 3L8BA 5KG1A 3H4BA 4C8KA 3TR8A 3CG7A 4F2RA 3OSNA 3QEPA 2HHUA 3LAKA 4EBCA 1XHXA 2NUBA 4K4XA 3VQ8A 1U49A 1JLGB 5KI6A 3GV7B 2E9TA 4DTSA 5KFUA 1SKWA 4ZPBA 1HYVA 3MEDB 4ZMMA 3LPUA 1C1BA 4O44B 2XY7A 5KFPA 2HVHA 4IG3B 4ICLA 3VQEA 4KAIA 1SL1A 4CF9A 4O4RA 4O3QA 1QTMA 3QINA 3DRRB 3HP6A 3CFOA 5KG7A 2BQRA 1WNEA 1HPZA 1VSLA 4KV8B 3CDWA 3KNAA 4U7CA 2ATQA 2OZMA 4ECRA 4CGIA 2WONB 4K4TA 1S6PA 3AA3A 4NCGB 3QIPB 2UUTA 4ZVFA 1T05B 3CVKA 3AVHA 3HPOA 4RW8A 3DLBA 1KFSA 3UR0A 4FK0A 2YKNA 4IQXA 1TV6B 4ED8A 1U48A 2JEFA 4IFVA 4J9NA 4YNQA 4TQRA 1KLMB 4DQQA 1JL2A 4ZP9A 4FLYA 2Z1HA 4M3ZA 3NBPA 4BDZA 1BIZA 1HMVB 1RA6A 2IM0A 4OKEA 3ZSVA 4RW7A 1LW0A 2R8JA 4CIGA 4ECUA 4TYBA 4OPJA 4KI4A 3FQKA 4FM1A 4MIBA 4PWDA 4YP3A 3RRGA 4MKBA 4Q0BB 2D0CA 3MEGB 4B9TA 2GIQA 3ZSQA 4QPXA 1TKXB 3I8DA 1S48A 2AQ4A 5HBMB 3ZT4A 1IKVA 4OLBA 4K8ZA 1Y97A 1B9FA 3RR8A 2AX1A 3VN5A 2JGUA 3VQCA 4CEBA 3OYLA 1VSHA 2R8IA 3V81B 3DM2A 4BE1A 1RT7B 3CWJA 4O3OA 3UQSA 3IS9A 1NK6A 4OLAA 4J2DA 1VRTA 2YNFB 4ELUA 3VQSA 3RBDA 4KRFA 3NGZA 4QWAA 4DS4A 3KK2A 3QLHA 3PVXA 1HRHA 4IKFA 2WB4A 4DL3A 3EPGA 2FJWA 1Q9YA 3LP0B 1N6QA 1Z26A 2ASDA 3E01B 3C6TB 4PUOB 4CFCA 4FLTA 3PW5A 3DLRA 4CHPA 2AU0A 2DFFA 3TARA 1S0OA 5C42B 2IMWP 2BANA 2HB5A 2KZZA 3HPHA 1U4BA 4FBUA 2P5OA 4AHVA 2YNHB 4DG1B 5J1EB 4MK8A 1JLGA 2IM3A 3AA5X 3B6OA 2D7SA 1NNDA 2YKMB 5KFGA 3DYAB 4ID5B 1EKEA 4FJNA 1D8YA 1U47A 4B8CA 3MAQA 3MEDA 2HVIA 1JX4A 1C1CB 4O44A 4DWIA 4CJLA 3BQ1A 4IG3A 1FXXA 3D45A 4DQIA 1TAQA 2C2RA 2VA3A 5DG9A 3MXMA 2HNYB 3QIOA 2KW4A 3DRRA 4TY8B 1T94A 3CDEA 2ILZA 1IKWB 1NK0A 3N6MA 4JLHA 3AVBA 1SV5B 3QGHA 3ZT1A 4J9SA 1S10A 4E7JA 1DLOB 3PUFA 1T03A 3PZPA 4NCGA 4WFYA 3QESA 3QIPA 2R8HA 1T05A 3VQQA 2ATLA 4TY9A 3OYGA 3K59A 2FVQA 1RDCA 2B4JA 3ZT3A 1HQUB 1TV6A 3MFIA 3QERA 3E51A 4NLVA 1C0UB 4J9PA 4NLWA 4AILC 2QK9A 4I7FB 5JS1A 4ECVA 3T5LA 4AHUA 1KLMA 2FVCA 4C8LA 2HHWA 1VSMA 1WSGA 1T7PA 1QHTA 4E89A 4CK2A 1S1VB 5KFLA 3GQCA 3SUQA 4J2AA 1RT6B 5KFAA 1L3UA 1HMVA 1HARA 3OHAA 4O3NA 1W0HA 3KD5E 4TN2A 4ELTA 4DSIA 4DTXA 1SH2A 3NGIA 4J9MA 4K8XA 4GC6A 3ZSOA 2D5RA 3OYEA 4KHNA 4CEOA 3VQAA 1U45A 1JLFB 3KHRA 3TAPA 2V4RA 2AX0A 2EX3A 5EU7A 4Q0BA 3MEGA 3MFHA 4E1NA 4WXWA 5DQIA 3CM6A 3AVMA 3KLGB 1EX4A 5HBMA 5D3GA 3VQ6A 4FCYA 4DTRA 1NJXA 4O0JA 3V81A 1RT7A 4RNHA 1LAVA 3NH0A 2XGPA 4HYKA 4OPKA 4CFBA 2YNFA 4Z4CA 3H4DA 5EDWA 3P1GA 4J2EA 2IS3A 3KLIB 4JS4A 3AVFA 3LP0A 1QSSA 3SPYA 3TI0A 3E01A 5CYQB 3C6TA 4PUOA 3KK1B 1TL1B 4QW9A 4B08A 5C42A 4DU3A 4B8AB 4PY5A 1C0TB 2VWJA 4IRCA 1NJYA 2YNHA 4DG1A 1S1UB 5J1EA 3LANA 1ZBLA 4ZVHA 1X9MA 2YKMA 3DYAA 1KRPA 2VG5B 4ID5A 1VSEA 1ZBFA 4FJGA 3OL9A 1C1CA 5KFFA 3PO4A 2XY5A 3PR4A 2Q3SA 4DSLA 1T8EA 2PZSA 3S3MA 2ZKUA 2GUIA 4JUZA 3RAQA 1QSLA 2HHTA 4B9NA 5KFYA 2HNYA 3PHEA 3PX0A 3TAGA 1W25A 1IO2A 1A5WA 5KFQA 4TY8A 3QIDA 2PYLA 2Z1IA 2FC0A 1IKWA 3KTQA 4Y1DA 1SV5A 4ECQA 1HYSB 3AO5A 1D1UA 1DLOA 4O4GB 1RYSA 4DTPA 4G1QB 3KIOA 3GV8B 3CYMA 4PA1A 5L1IA 1HQUA 3OYAA 3OS0A 5J2QB 2XRIA 2RKIB 1C0UA 3KHGA 2FVSA 3TAEA 2VG6B 3T5KA 3RMAA 4I7FA 3H40A 4M95A 4JV1A 4FJKA 4CGFA 4YMEA 1XI1A 1NK8A 3DOKB 4KKOB 1JLCB 5DLFA 4MIAA 1ZETA 2Z1GA 3LWMA 4E7HA 1RT1B 1S1VA 5JXSA 2D0BA 1RT6A 3CIZA 4KHSA 5KT4A 3C94A 4J9QA 4CEDA 5KT3A 2WK4A 2ZQBA 4R0EA 1FKPB 1YVUA 4DL4A 1D0EA 4E3SA 1JLFA 5HRRA 4CHOA 4I9QA 5HLFB 4ECSA 3G6XA 3SPZA 3FRZA 1XR7A 3KLGA 2W9AA 5HP1B 4CFAA 1S49A 1ASWA 4CEZA 4H4MB 3NDKA 1TL3A 2BRKA 5J2PB 3S3OA 4QAGA 3FDSA 1BGXT 3LP3A 3G86A 4DU4A 4C8NA 1CXQA 5KTQA 4DSJA 4FJXA 4GW6A 3LP1B 2ITGA 4QWCA 4LH4A 3KLIA 1RBUA 4HVJA 1GX5A 2G8FA 4IFVB 3QO9B 4DSKA 2YV0X 4OJRA 5CYQA 3HO1A 3ZSYA 2W7OA 3KK1A 1U04A 5DG7A 4BWMA 1TL1A 4FYDA 4FJ7A 4Y3CA 4KAZA 2HWHA 4BWJA 3QNOA 1C0TA 4B9MA 4NYZA 4FZXC 2GBZA 1S1UA 4ED6A 5CY4A 2DPJA 3AO2A 1RTJB 5J2NB 1IKYB 3MR3A 2VG5A 4NLPA 1QQCA 3GIIA 2IBKA 3EYZA 4LQ9A 3KMQA 4HCBA 2OPSB 2W42A 3OLAA 4OL8A 4Y2AA 1SL2A 4KE5A 4N56A 4ZVEA 1A5VA 4ZHRB 2BGGA 5F8GA 1RBTA 1ZTTA 1WNSA 1REVB 4N76A 3PJWA 2FBXA 4EP5A 2HHXA 1ZBIA 2IJFA 2ALZA 3CJ4A 4WE1B 4Y34A 5I42B 1JLAB 3NF9A 2BDPA 1HQEB 1HYSA 3Q8SB 2WCXA 3TVKA 4O4GA 4J9RA 4CJUA 4FS2A 2B43A 1ZTWA 2VG7B 3H59A 3SFGA 4G1QA 1RCHA 5FRNA 3OYKA 1Q8IA 2IGIA 5J2QA 2RKIA 4K50A 5EWGA 4IRDA 2VG6A 2HNDB 3ASMA 3SQ1A 4BACA 1L3SA 2BANB 5F9NA 3AVGA 3OY9A 3ZSXA 3DOKA 4KKOA 4NRTA 1JLCA 1KVAA 3RBEA 1RT1A 4M3YA 4YR0A 1S9EB 3WNGA 1SL0A 4EYIB 3KOAA 4H8KA 5DK5A 4DFKA 1FKPA 4JRQA 3RMDA 1UA1A 1HNVB 4YR3A 4ZP7A 5F9LA 4E7IA 1GOCA 5HLFA 3K57A 4NLQA 1MMLA 3ZSWA 1RT4B 1S1WB 3SQ0A 5HP1A 5KFNA 1RBRA 2HHQA 4H4MA 2F8EX 3OJSA 5J2PA 5KRTA 3T5JA 4WZQA 2W8KA 1T03B 4CF1A 1Z4UA 5DGBA 5HRSA 3LP1A 4TSXA 3IGNA 4ECXA 4DLEA 2DFEA 1J5OB 3K58A 1UAXA 4O3RA 1TK8A 3MECB 3VQ5A 2ILYA 3ZCMA 3QO9A 5CZ1A 3DOLB 3D28A 2E9ZA 3QEIA 4O3PA 3MF5A 4FLXA 1N48A 2IOCA 3HHKA 3MR5A 4IFYB 5KG3A 2QKKA 5C25B 1RTJA 5J2NA 1IKYA 4KFBB 4CERA 1BHLA 3S3NA 2OPSA 2A1SA 3V9SA 4KHMA 4CF0A 4NYFA 4QWBA 2V4QA 4ECTA 3BR9A 4JV0A 3L3UA 3RWUA 4RUCA 4NCAA 1ZBHA 3M9NB 4B9LA 4NLOA 4ZHRA 2E6LA 4DTNA 3BDPA 1REVA 3GIKA 5D3GB 2YNIB 4DU1A 4CF8A 3WNEA 2GIRA 1UWBB 3KLFA 4WE1A 5I42A 1JLAA 2DPIA 3OHBA 4O0IA 1HQEA 4OGCA 4EBEA 4AHTA 1WLJA 3SQ2A 3MEEB 3H5SA 1WSJA 2VG7A 2BQUA 3BQ0A 4ZTJA 1XR5A 2ZD1B 4AH9A 2G8HA 5KFKA 3AVAA 4LSLB 4DQRA 4KB7A 2I1RA 3I0RB 4B9UA 3RTVA 2D0AA 3AO1A 2HNDA 3PW4A 4K4WA 4C8OA 3V1QA 1HJRA 4EBDA 1RTDB 3L3VA 1B92A 4F4KA 3KLVA 4RW6B 3QEXA 1NK5A 4ZP6A 3V9UA 5EUHA 3CFPA 4XIUA 4CJQA 1WSFA 1S9EA 2YNGB 4RNOA 4K4UA 4F2SA 4RW4B 3V6KA 3LWLA 2V9WA 3QGGA 3N6NA 3CQ8A 1O1WA 1KHVA 1HNVA 4FJLA 3TQ1A 3F9KA 3PW2A 1BQNB 4IR1A 3K5OA 2RPIA 2XY6A 1RT4A 4LH5A 2WHOA 3M9OB 1S1WA 1TKDA 3O4NA 4FXDA 1N4LA 4M3RA 5C24B 4H54A 4HHTA 3WNFA 5E41A 4FZYA 5KGWA 1NHVA 4J9OA 1GX6A 4G3IA 2JEIA 4DL6A 4QOZB 1NKCA 1J5OA 2FVRA 3V6DB 1JLQB 2F96A 2D3ZA 3MECA 2AGPA 5KG5A 2OH2A 3AV9A 3DOLA 2OPRB 4IH6A 3H08A 2XCAA 4FM0A 3HJFA 3I5AA 3KK3B 3F73A 3LZJA 4IFYA 5DQHA 4ECWA 5T7BA 5C25A 4KTZA 4KFBA 4BE2A 1EETB 4ZPDA 3CJ5A 1BQMB 3OJUA 4OVLA 4KO0B 4KHWA 1DTTB 1IG9A 4C8MA 3HM9A 4PQUB 3O3FA 3QZ8A 1RBVA 4MK9A 5KRSA 2W7PA 4ED7A 2J6TA 1Z25A 2DTUA 4CJ4A 1IM4A 2YNIA 4TLRA 3TAMB 4URSA 3TABA 1TL3B 1UWBA 2XCPA 3DLHA 3OL6A 2ASJA 3QEVA 4FJHA 2W9CB 1S97A 3ULDA 4FVMA 3MEEA 3M8QA 4Z4EA 3HKWA 5F8JA 2ZD1A 4B9SA 3I0SB 4F3OA 2B5JB 4KHYA 4KHUA 3LALA 4LSLA 3BJYA 2BR0A 3V1RA 4KBIA 4Z0UA 3I0RA 4NLGA 4AHSA 4W5RA 3GIJA 2OZSA 1TP7A 4E1MA 4M3UA 3QNNA 1RTDA 3I5BA 1WAFA 3HL8A 4RW6A 1TKTB 4MQ3A 3OYCA 4DF4A 4TXSA 1RBSA 1NK9A 4F3TA 1QS4A 4F8RA 3RB6A 2IDOA 4CK1A 2YNGA 4RW4A 1L3TA 3NH2A 4CJ3A 4QWEA 3H5YA 4NCBA 2X78A 3I5CA 3L2UA 1RT5B 4RNFA 2V0NA 2QE5A 3KD1E 4EO6A 1WSEA 5KT5A 3RMBA 2QV6A 3FFIB 4CHYA 1S5JA 3IG1B 1BQNA 2XO7A 4NLSA 4CJ5A 1QAIA 2OA8A 3K5NA 2FVPA 2JEGA 3T19A 5C5JA 4Y2CA 5C24A 4F4XA 1NJZA 2HAIA 1NKBA 4QCLA 3ICLA 4W5QA 1B9DA 1ASVA 3EY1A 3MTKA 4AHCA 1HYZA 4DS5A 3U3YA 1KHWA 3PY8A 4QWDA 3O3GA 1F21A 2HMIB 3P5JA 3V6DA 3V1OA 1JLQA 3WNHA 1IKXB 1TK5A 4M45A 4HCCA 1S9FA 3OL8A 4B9VA 2OPRA 3ITHB 3BSCA 4Z4GA 2R7YA 3OYFA 1S1XA 3KK3A 4Q44A 3GILA 4DFJA 1JXLA 3T5HA 4LSNB 1WAJA 5EWFA 1SKRA 1CSJA 3T3FA 4OKKA 5F8MA 4IG0B 1EETA 4MK7A 2W9BB 1BQMA 3LZIA 4EYHB 4CEFA 1C0MA 3ISNC 4KO0A 3PR5B 1DTTA 3NAIA 4ZP8A 4AHRA 5KFEA 4PQUA 4CIEA 3TWHA 4TYAA 3M8SA 3NFAA 4RNMA 1LWFB 5CZ2A 4NLTA 2IM1A 1RTIB 2QKBA 3SUPA 4O55A 1K1SA 3TAMA 5L1KA 5JS2A 1MU2B 3HVRA 4LY7A 4W5NA 1QE1B 3KKSA 2YHAA 2W9CA 1K1QA 2FJVA 4CECA 3PV8A 2WTFA 1LW2B 4CESA 4K4YA 3KLHB 3I0SA 2LSNA 2B5JA 3V9XA 4FW1A 3ZT0A 4E19A 4BDPA 1DTQB 3KMSA 1YTUA
chains in the Genus database with same CATH superfamily
3PYEA 3IRXB 4JI4F 3AO3A 4KJIA 2ETJA 2QL7B 3MCAB 4OMFG 4YOEA 3HSJA 4CYUB 3LP2B 5CQGA 1QDUB 3GFZA 2WW8A 4GVBA 3PW7A 1TGOA 1IVZA 3I4HX 5A8KB 1N88A 3CC7N 4GKKJ 1CLFA 1F3VA 5F8IA 3QETA 1GXUA 3FFIA 2UVWA 2CH5A 3THYA 2LECA 2E4LA 3SI8A 1RZMA 2AJQA 3UDLA 2O4GA 2V51B 1CS4A 2ZGZA 5T41A 4FLZA 2VQFJ 2VWKA 4PG7A 4PHTX 4A8WA 3DLKB 1RFQA 2UUCK 2VC0A 4JKGB 4S0MA 3J8AA 2HMIA 3SFUA 3N6LA 1KTQA 1IKXA 2DH8A 2PEHA 4CT9A 3G8TA 2FF6A 2YHBA 4JD2B 1W7AA 4WXOA 4FJIA 3MMAA 3BZKA 2ADCA 1KQGB 1FD8A 2W6KA 4X65F 2HQCA 2JC1A 3V9WA 3BREA 1IG8A 4QR2A 3BZCA 4DR2J 3I96A 4LSNA 4PRFA 4IG0A 2GWKA 2W9BA 1JLEB 4ZS6A 4HUEA 2D3UA 5CYJA 4QIWD 1FWKA 2U1AA 3TANA 3BGFA 1LFWA 2R8GA 3TAFA 1YJWN 3DMJB 1S9GB 4IBNA 4DF8A 1EJ7L 2XHBA 3AVKA 3TZXA 3G10A 3TUZC 1SBRA 1PJ7A 1R8BA 1RAEB 4IR9A 3G25A 1DARA 3SZ2A 4LFBF 2W8LA 1MU2A 1R89A 1HKCA 4DCHA 1RDBA 1HNXK 2MDAA 2A3JA 3ZSRA 1IQTA 1L5UA 2IAJB 3PYDA 1X8DA 2Q6BA 2MLXA 3PJXA 4P2FA 3KLHA 4CFDA 5AQUA 1IQZA 1NJWA 3HT0A 1MN9A 4USTA 5AQJA 4C8ZA 2DTJA 1V3RA 5EOYA 3L2VA 2Q66A 2VH7A 1J5EJ 3TX8A 5ELZA 2GV9A 3DLEA 5M2PA 2YWWA 1XR6A 2GTDA 1FVQA 4W90B 3OS1A 1SC6A 2D0PA 3CDAA 4K0KF 3EVOA 1Q5VA 3MM8A 4BC3A 4PL8A 5J2MA 1QZ6A 3T1AA 4CJWA 4FK2A 4IDKA 3NMAA 3JSMB 4E1JA 2FTRA 2AJ2A 4IFEA 3WHIA 1KDNA 4DHYA 2DR5A 3KDNA 4OZ0A 3E3XA 1GLJO 3M32A 3OVNA 2V50A 1GLEG 1T9WA 3PG9A 1C1AA 4B02A 1LV5A 3VEVA 3JYTB 1MG7A 1NRKA 3CXCM 3O8WA 3LAMA 5AZIA 2CQ2A 3O9QA 4K2JA 1W9HA 3P45B 3AHPA 5BN9A 3FRYA 2ZH9A 1RHKB 4GV9A 3GTYX 4Z4FA 1BC6A 4K42A 5KQ8A 4F4WA 1YRTA 3DI6B 1P27B 4DSFA 3G87A 5CH7B 2AT1B 2JRSA 1NZAA 4EZ6A 1D5AA 1SIWB 2RDJA 2ZHBA 5DO2A 3KJVA 1U0HB 4WKYA 4ECZA 1HWLA 1OSCA 2HHSA 3M8RA 1W2BR 1S0NA 1D9DA 2UUAF 2R9LA 1WSIA 4NLYA 4EZ9A 2JL9A 3A5MC 1M5SA 1IR2A 1KQFB 1IH7A 1IUJA 4OX9K 1GOAA 3AGRA 3HFKA 2VF3A 1A7GE 2CDQA 1XNQK 5E3PA 2YWHA 3RUBL 2BM1A 3HSGA 1IJEB 5DDQC 1KR4A 1HW9A 3C16B 2UV8A 3R5BA 4KV8A 1YJTA 1ZM3A 4M5DA 2RRNA 1PC4A 3IMQJ 3MMCA 1L3VA 1FKOB 1BO5O 3SBGA 2E6MA 1SKSA 2WC9A 2HNZB 1H73A 4GKJK 1TK0A 3M1FA 1S1XB 2D41A 4FJ5A 4LRCA 2E88A 3K5MA 4NLRA 1LWCA 3R5CA 3C6HA 5AQTA 4OYXA 1TAUA 4W5TA 3DGPB 3CCRN 4JV2A 4DPOA 3DXMA 1JXEA 4EAHD 2E5GA 2EC0A 1EXQA 1BMQB 1UP1A 1NU0A 2DO0A 3THTA 4X4PA 1F9FA 1R3NA 1BCMA 2CVIA 2PT0A 2UXCK 1YJ9S 1B4SA 3ET6B 4H4OA 3A0IX 3R97A 1OMSA 2BOPA 1XMQK 1HNIA 1CLQA 4YFUA 4BR7A 1B70B 3RMCA 2I5JB 1NMDA 3CF5Q 5DMRA 4I68A 2RHSB 3VA0A 2NRTA 4O3SA 1D9FA 4JI2K 5I3UB 1UFKA 3DRSB 1NK7A 1N54B 3AA2A 1WEXA 2Q79A 1SC1B 4KSEB 2UUCF 3ILLA 1HI8A 4OI4A 3HSDA 4X84A 3C6AA 3Q22A 1RTHA 1RWUA 4E0DA 2HRYA 4OHZA 2CJXB 3ADAC 3UDEA 2JLEA 5E3AA 2H4YB 3PKMA 1NXIA 3ZTPA 2Y1IA 2AYGA 2K2PA 1U1KA 2HBJA 4DV0K 2VC1A 4NYPA 1Q86O 4FJJA 3BKFA 3HHLA 4I6MA 1JNZB 2EWSA 5G0RB 1KS2A 4A59A 3O6WA 4DUZJ 2FJDB 4OPAA 1R6VA 3CO9A 4NLXA 1E6VA 1RAIB 4DV2K 3TUPA 2PEBA 2G0JA 1JKHA 1OY6A 4FNIA 5D0HA 4IOAQ 4FBTA 1SQFA 4I0WA 3KLEB 5A8RA 4MYTA 1FK9B 1SUQB 4NOHA 2IRYA 5KG4A 3J7A1 4M3XA 3MR2A 4A8QA 4CGJA 2FY1A 1NGCA 3NS7B 4L8RB 2CIMA 4KB1A 2W40A 1CJVA 3M05A 3SAHA 2AF6A 1SH3A 4A8OA 3R27A 1HNXF 1LOUA 2ZM6K 1F9HA 4FS1A 3DLGA 4HEA9 1HI0P 4I2PA 2CYYA 4FNHA 1R8HA 1BL3A 5HROB 3M30B 4KH1B 2FBYA 1QSYA 5CAAA 3MM7B 3M3ZA 2NRHA 4KHPJ 3O3LA 4H0OA 5LM7E 4BG8A 3H2LA 2QFJA 2O5DA 2BBEA 2ZBQA 5B09A 1S1TA 3O9UA 5CABA 2DKOB 2M9KA 1I6JA 1C6VA 2BW7A 3UNYA 2RN2A 3OR1B 3DLJA 4QIGA 1Y5IB 2CQ4A 3RBXA 4AE5A 1W97L 4USKA 3SSSA 3RAXA 4CJFA 2ZOFA 2FBTA 1Q4RA 2HRTA 4IZ9A 2J9DA 4I6YA 2PY5A 1AZSA 3I32A 2JC0A 4CJPA 5HRPA 5AXLA 5CA5A 1RNHA 2QX0A 1N33K 5FRMA 3RRKA 1TKZA 4AL7A 1FT8A 1KFDA 2DISA 4DR5J 1FJCA 2CPJA 3H20A 4RW8B 3GU0A 3IGVA 2UU9J 4IH7A 3RW7A 2GJ2A 2G4BA 4I2QA 1X5SA 1JXVA 3QSIA 2IVPA 2QW9A 5B0CA 2XC9A 2F4VJ 4WFAL 4R5PB 5EWEA 4W98A 5AQZA 4WBFA 3VAKA 3T1YJ 1R0BG 3IA0A 3AA4A 4DFPA 2OSRA 2NRVA 1LWEA 3GE9A 2MYFA 3SBTA 3CF5L 1HR0J 5K14A 3C6UA 1WOQA 4HKQA 3NBPB 3CQYA 1YWXA 3OVSA 3DGVA 3PHTA 1KCFA 4BRPA 3RJMB 5IC4B 1LW0B 3PEJA 4ES2A 4K2XA 2O1PA 1GLBG 4DV5J 4DTJA 1RWKB 5KFTA 5DDRC 1TQLA 2EFPA 4KGZB 1FFSB 2XMJA 4F4YA 4YDXA 4Z4HA 1VQYA 4V19J 4HI2A 2UUBK 4JYAK 1Q16B 4LF5J 4K4SA 4OX9F 1IKVB 3JXOA 2R2RA 1ASUA 3HF5A 1VSIA 2GV1A 5FPDA 1SJQA 1VQNN 3IM8A 3JXUA 2XMVA 1P8GA 5DGAA 3VQBA 3NCQA 5HMXA 3IS9B 3UD3P 2OPQB 1ZA1B 3NF6A 1GOBA 5J1NA 3AB4B 3MCPA 3HFVA 4QW8A 4IOAL 1X9WA 3KK2B 1HD0A 1RJJA 3TP2A 1N6QB 3G71S 2R2UA 3EZUA 4GKJF 1XTZA 1EKSA 4C8KA 4BVPA 4H4KA 3G96A 2EFQA 1S22A 1D3WA 4WIQA 4BQZA 1XHXA 1WTFA 3VQ8A 1U49A 1JLGB 3GV7B 2E9TA 2DHGA 3OXFA 5KFUA 2E1RA 4ZPBA 3KFWX 3MEDB 3LPUA 5LSLA 4NI2B 2HK2A 2XY7A 5KFPA 4QS9A 1YITS 3W62A 4IG3B 4ICLA 5BR8J 1SL1A 1BA1A 3ZNUA 3I55S 3QINA 2UXCF 1H38A 2BQRA 4RBUA 4FZVA 4DMZA 3KG4A 5LJ3Y 5IV4A 3CDWA 1XMQF 4U7CA 2ATQA 3HHLC 5ETKA 4CGIA 4K4TA 1S6PA 2CAJA 2X1AA 2HGMA 3EE8A 3EZOA 3IFRA 1T9XA 5M1NA 5AJ3J 2YKNA 2CPHA 3AAQA 4JI2F 1H98A 1TV6B 3QNWB 4J9NA 3JB9k 5KOXA 3I33A 1YI2N 2QWPA 3R7NB 4DQQA 5FPNA 3GJSB 2LMIA 1PJ5A 5LMUJ 4BDZA 1U8SA 1RA6A 4DV0F 3EM1A 2R7QA 4WK3A 4RW7A 1Q0NA 2B4OA 2CPFA 3Q24A 1OH6A 3RRGA 1TUGB 3OTOF 5B8HA 4Q0BB 3PNIA 4DV2F 3CCUN 4ID8A 3A5OC 5C2CA 4DV4J 3WQTA 2ZBIA 1NM2A 1WSRA 1B9FA 4FKYA 3D7EO 3RR8A 2JGUA 1NG9A 4M5KA 2LXFA 1YJRA 1GMVA 5GIOA 3NLCA 1RT7B 2HMPA 1GK8A 2HIYA 4OX6A 2F7VA 4OLAA 4U96A 4J2DA 3AJDA 2X3DA 3R2CJ 2VODA 2VUGA 4ELUA 2MZTA 3RBDA 4KRFA 4D3HA 4QWAA 3H46O 2LQ5A 1HRHA 2WB4A 2HF4A 1NH8A 4EU0A 2ASDA 1Z26A 2Q97A 3C6TB 2CJKA 4CFCA 1VBYA 2KN4A 4CHPA 2DFFA 1OKJA 1K8KA 5C42B 4OV1A 2BANA 1QY7A 1X5PA 2HB5A 4CLKA 2P5OA 4FO0A 1WDTA 1JJHA 2MKKA 1QQMA 1N32J 2RE1A 2D7SA 4CI6A 2YKMB 1HNWK 4ID5B 1D8YA 1JX4A 1RE1B 3HM8A 4O44A 2ZC4A 3GOIA 1TUVA 1VQ9N 4OZ2A 2CG8A 2O8BA 4CLLA 4G1IA 3DRRA 1YDLA 1RAOA 1BD6A 3TWZA 4Y6IA 1SV5B 3AVBA 3QGHA 3CJSA 3H0PA 2WTUA 1M1KT 2JFKA 1D4XA 4WFYA 5ADXA 4J9VA 5JVHL 1N33F 4JKBA 1QTNB 4F4AA 3U9DA 3RAMA 2P5VA 1LXJA 2B4JA 4OI6A 1TL4A 3A12A 3MFIA 3ZNJ1 1C0UB 3CERA 2HRUA 2ZFHA 1F6TA 3SCLE 2EBGA 1KLMA 4C8LA 1OYEA 2FVCA 5FLXY 4FYVB 1TUWA 1QHTA 1DT9A 2QLXA 5BYQA 4CK2A 2F5GA 3SUQA 2CNOB 1RT6B 1L3UA 1HMVA 1NSKL 4O3NA 3U8XA 4TN2A 2P9EA 4DTXA 2J0WA 2YX7A 3CCTA 4CEOA 2YH1A 3VQAA 4ETXA 4ETZA 3HZ6A 4C7QA 3DHWC 4ILJA 3MFHA 3ENWA 2JLFA 4GV3A 3CCQS 5FPEA 2XWXA 3LDQA 3AVMA 1ELOA 1MA9B 1NJXA 4DTRA 5ETSA 2QWOA 2V8HA 1YBTA 1A9NB 4H4KC 1SQEA 2UUBF 4JYAF 5D4PA 1EKRA 5JJBA 1S72N 2YNFA 4ER8A 4XK8C 3VZHA 3H4DA 3UVJA 4HT7A 4C3MA 3PIPQ 1UEUA 4CIOA 1WF1A 3AVFA 1S3XA 3FMBA 4OX8A 2E2PA 2YWGA 1HIYA 3TUIC 4CO4A 1IXKA 3MUMP 2XMUA 4ZJLA 3VGUA 2N7CA 2RHKA 4ZPTR 4QW9A 1NGDA 1VQSA 1C0TB 4UY8O 5IT9U 4DG1A 1ZBLA 2NLWA 4ZVHA 1X9MA 3POTB 1RWVB 2VG5B 2FSKA 3PCOB 2NXCA 4OLPA 2BKOA 4FJGA 3GSIA 1RACB 4JI7K 4FVUA 2DEIA 2XY5A 1W26A 2CPYA 3PR4A 2BX6A 2E1ZA 2Q3SA 2WSCC 3S41A 1T8EA 4USUA 3M2RB 4NASA 4JUZA 3RAQA 4A8YA 1NGBA 3T9NA 4ZCMA 2O8EA 2K1RB 2HNYA 4LFCK 1W25A 2PYLA 3H2UB 5EXWA 4Y1DA 2ZJRQ 4RX6A 2VFTA 1WHVA 1DLOA 3MK6A 4PPZA 4G1QB 3KIOA 4ISEA 1G7CB 4PA1A 4C23A 3OS0A 3FBBA 1TZ0A 2XYGB 3QQCD 3HDSA 3KHGA 2IVYA 3RMAA 5F41A 2F8MA 4JV1A 2UUAJ 1F60B 1NK8A 1Q7YT 1ZETA 3LWMA 5FJ4A 4ENOA 3C94A 3IMXA 3KUHA 4ISFA 2W2OP 3ILOA 4R0EA 1BDGA 4E3SA 1JLFA 2DITA 2JZ5A 3VHQA 3G8QA 4I9QA 5B0FA 2MQLA 3UCGA 2RUGA 3KLGA 2QO3A 4FF4A 1ATNA 4CFAA 4LF4K 3DXBA 1TL3A 4M5MA 1O51A 4QAGA 3R5JB 4CO3A 2W2QP 3SMPA 3CCVN 4DSJA 3FBEA 3H1VX 4X66J 2GGPA 3KLIA 3QO9B 3CCSS 1LQ9A 3HO1A 5DG7A 4FJ7A 3WDOA 4IDHA 1VHIA 2WVEA 4FZXC 1S1UA 3T9ZA 1RTJB 4IOCQ 1OY8A 4CZHA 1ZAWA 2ZEJA 1U1RA 2LEPA 1TYQA 4LIRA 2V69A 1QQOA 2OPSB 2HVZA 3PIPL 1YJNN 4OL8A 1HNWF 2CG4A 3PJWA 5A6WA 1FESA 3P96A 2FBXA 2WAQD 2QG9B 3BUZB 1UTAA 4FF1A 4KH5A 4DX6A 1HYSA 3LH2S 3CCZA 2FHOB 2IVMA 3TVKA 4O4GA 4FS2A 1NNEA 1REGX 2OO4A 4JI5J 3FEXB 1PCAA 2APOA 1RCHA 5FRNA 2XLKA 5LXYA 4HL9A 1F5BA 1Q95G 2DK2A 2HNDB 2C2ZB 3AOAA 3SQ1A 2ZBPA 4BACA 1UL3A 2QA4S 1NMEB 2A2DA 4KKOA 4NRTA 4IEIA 3RBEA 3M1VA 2ZJRL 3SQGA 4IOXA 1SL0A 4QS8A 3CJBA 1F5AA 2BH1A 2W2NP 5DK5A 2X7IA 1FKPA 1UA1A 3RMDA 3WT0A 2HBYB 1GOCA 3NNAA 5HLFA 3K57A 2V8PA 2NSCA 5AQNA 1N34K 2F3JA 1N5QA 5HP1A 1UFWA 1RK8A 3R8EA 4CZKA 5J2PA 4MO4A 4KR0B 1LXNA 3THXA 5IXUA 2ABYA 2QC3A 3T5JA 3US5A 4WZQA 3MPDA 1T03B 2W8KA 1Z4UA 1VQ4S 3MN6A 5DGBA 3ETOA 3LP1A 2Z2ZA 3DKDA 3WXIA 3K58A 1J5OB 3SXLA 1T3VA 3CMAS 4CD1A 3HHEA 4DN0A 1XIQA 2CQGA 2ILYA 1KD1T 1VRQC 4ZIVA 3ZFVA 4FLXA 4BC7A 1E6YB 2A5XA 2J0QD 5M1QA 3AA8A 2V34A 2H54B 3QATA 4CYUA 1APSA 3QBXA 1IJJA 1OWXA 2QKKA 4H5TA 4CERA 3OR2B 2M88A 1YVNA 3UB5A 3PACA 2MQ8A 2A1SA 1X7VA 3AJ2A 3CCWA 1WG4A 4I67A 3TTDA 3RWUA 4RUCA 2VPWB 2XYHB 3WX4A 1R8AA 1ZBHA 4B9LA 4JK8A 3R5AA 3QB0A 2CH6A 3D6MB 2LQJA 4JI7F 3HSZA 4CF8A 4YHHK 1IBKJ 3S7RA 3WQUA 4WE1A 4O0IA 2J9DE 2QA1A 1HQEA 4OGCA 1XERA 2AJFE 2XMTA 4C97A 4AHTA 1DEJA 1RHJB 4LFCF 4UUXA 3MEEB 3F56A 5IWAJ 1N0UA 3D6HB 1XR5A 2ZD1B 3CD0A 2MTLA 2W4DA 4AH9A 3CT9A 3HI0A 4JKGA 4BR9A 1HWIA 1Q5YA 2CQCA 2FZCB 2F9DA 2DR6A 2I1RA 2HFOA 2P9CA 3RTVA 1HHTP 4K4WA 4C8OA 4ZJQA 2YCHA 3BPDA 1HJRA 1WBBA 3DU6A 2B4PA 3J7ZT 4CQ1A 3L3VA 1EQ0A 1NSPA 3I56S 3V9UA 2DNMA 4XIUA 1C4CA 1S9EA 4EFHA 1R7IA 4DV1J 4WKRA 3KK7A 1GTHA 2RT3A 3LWLA 3A5NC 3CQ8A 2E1YA 5ADXH 1KHVA 1HNVA 3LDLA 4J9UE 3UDVA 4Z94A 4MMOA 4Y2MA 5THWA 1U26A 4OX9J 2RPIA 1RT4A 2A0FB 4LH5A 2MPUA 1S1WA 2P9SB 3U9ZA 2C3UA 4NWBA 4FXDA 4M3RA 5C24B 1XNQJ 1CJKB 3MPYA 4NZ6A 1I1GA 3HHNB 2NRRA 3GJTB 3TYTA 3MD1A 2G1HA 4PG8A 3A8EA 4LF4F 1AXQA 1YBUA 1JNRB 1TUUA 4OZ5A 2D3ZA 3LGHA 3OXGA 4IWVA 3H3OB 3JTOA 1OPIA 4P7TA 5L38A 1KEKA 3MURP 2OH2A 3NEKA 2MZJA 4IH6A 1TL5A 1S0VA 1VC0A 4FM0A 1VQLN 1UVJA 4LFAK 1MMNA 1FA0A 4YDUA 2ZDPA 4N8OA 5T7BA 2E5IA 3Q83A 3VENA 1EIYB 1TMJA 3K8VA 3FGVA 1C4AA 2L9DA 3F41A 2I7PA 1YQHA 3DOMB 1DTTB 2LQBA 2ZVSA 4ATNA 3CPWM 1ZAVA 3J80O 2HHHJ 3CCQN 2W4CA 5KRSA 2J6TA 2IRUA 2YNIA 3TAMB 3RVCA 3TABA 3B8AX 3DLHA 4CWBA 1B0VA 1G6BA 1NBWA 3I9V9 3QEVA 1Y3JA 2QSWA 2DGOA 1A6LA 2OKQA 2IJRA 4IO9Q 4U9RA 1MWMA 2MKJA 5ETOA 3HKWA 5F8JA 4B9SA 1JK9B 3I0SB 2B5JB 1EARA 3DXKB 4Z0UA 5AQWA 4NLGA 3H1QA 4W5RA 4ZJOA 1Z6RA 4YB6A 3PEHA 3EKSA 5LSOA 1VI7A 1TP7A 3L95X 5G4DA 4USHA 4RW6A 2NPIA 2IVOA 1QS4A 2K7KA 4DV0J 2O01C 3AJ1A 3RB6A 3CCJN 2YNGA 3W8GA 2EK6A 3FSXA 3NH2A 1HUXA 3JSRA 3H5YA 2X78A 3I5CA 3KDOA 4XDDA 5L46A 2QE5A 3KD1E 1WSEA 3FFIB 3UO0A 4CJ5A 3THYB 1QAIA 2FVPA 5C5JA 3CJCA 1RB0A 3SMZA 2HS4A 1NJZA 1HBUA 3ICLA 1FRKA 2XZDB 4X64J 1CS4B 4XH5A 3EY1A 1N34F 4AHCA 4JOUA 1U1OA 4QWDA 1ZOTA 3O3GA 1F21A 2HMIB 4OHWA 3ZZZA 2ZM6J 3IKMA 1IBMK 1IKXB 2ZBCA 4M45A 4HCCA 2KRBA 1QHAA 3KG0A 1XMOK 3CETA 1T95A 1AA1B 3MMAB 2ZDOA 1S1XA 4DFJA 4X4SA 3NS5A 3T5HA 3IAS9 4LSNB 3CJTA 1CSJA 4OKKA 4IG0B 1S4EA 2W9BB 4EYHB 3E9PA 2R4FA 1VBZA 3NAIA 4RLEA 3TSQA 2PE8A 1DZ5A 3NFAA 2H1YA 3SK3A 4RNMA 1WDDA 3SUPA 3CTRA 2AV5A 4CH1A 3ZTSA 1MU2B 3HVRA 3E66A 4W5NA 1WACA 4WIIA 3VGTA 1CQMA 4MJKA 3PV8A 4YHHF 1XNRK 2QI2A 4CESA 4JHDB 3VOVA 3KLHB 2LSNA 5C2DA 3ZT0A 2B9WA 1YTUA 2CQ3A 2HBRB 4UT4A 1K0VA 3ZEUA 1T9TA 1RAJA 2FY8A 4GVMA 3DLEB 3X3UA 2FGCA 3MM6A 1R8CA 5KOWA 5KFRA 2X6SA 2QT7A 4Q2LA 1HW8A 1CPZA 2DNKA 5KFVA 1KTVA 4DX7A 3NCIA 2PIIA 4IO9L 3MM8B 2ZC3A 5J2MB 1RT5A 4GKKK 1K73O 5GMDA 5FROA 3PSIA 3O5BA 3JSBA 5IM0A 3FZBA 2VA2A 3IG1A 2O3DA 2L08A 3QEWA 2ASMA 2G8UA 4I56A 2XM3A 2DNOA 5E5NA 4J2BA 3M32B 4JYAJ 4M63C 4CW7B 2CQIA 5BRHA 3GV5B 1R31A 2A1RA 1UFLA 4YDUC 1VCTA 5KFBA 2R7SA 3SNNA 5IC6B 2HSEB 5AZIB 4PABA 3IFEA 2GQ2A 5D15A 4DR3K 1SXLA 2NRWA 3EKUA 4YOUA 4F67A 1NM1A 4WZMA 3DHXA 1G3OA 3RB0A 2QA4G 3Q7BA 4CVNE 1B64A 3EDQB 5E7OB 1WOOA 1N8RO 2ITMA 4RG8A 3ZETA 2NUUG 2DVIA 4CLWA 3TVYA 4BDYA 3KJVB 2AYBA 2B8QA 2PBDA 4R25A 2LEBA 4DR2K 2WZ1A 1VSDA 1H2UX 1YT3A 3LPTA 2CPXA 3FZHA 1X9SA 2LQ9A 5CE3A 2F40A 3G4SN 4RZRA 1WG5A 1OS5A 1NDKA 5ETMA 1RHRB 1PJ6A 5F8NA 1LWFA 1NPRA 3ZX3A 5F0UA 1CULA 1N56A 2P9UA 2R2SA 4PPDA 2VV5A 4ZPWR 3QZ7A 5I3QA 4DV7F 4OGEA 1M5KC 1F3FA 2C3PA 1UVMA 4C4WA 1BCOA 2IM2A 3P8BB 1X4HA 2P1JA 1VGYA 2B4VA 1RABB 1OYDA 4KTQA 2FSJA 4JV5K 3OYBA 4M5DB 3MXIA 4OQJA 2IPOB 4ILGB 2R8KA 3MMCB 4BROA 1KQSR 5LJWA 4YORA 4QU6A 2ZUGA 4B3OA 1XHZA 3MXJA 4HHUA 3K89A 3Q8PB 3K5LA 1Y10A 3N5FA 3MEKA 3DXSX 1ZZFA 2OTLS 2ZWOA 1LWCB 4GMJB 3ISND 2Z57B 4USVA 4R5PA 1HQ2A 3NNHA 1YIJS 4Q5VA 5HRNA 3OBWA 4CEQA 3QFHA 5HI7A 1K6YA 4LRAA 2D1CA 3VA3A 3EPIA 4JP8A 3DXMB 2N4DA 5HATA 1FRIA 4CO2A 4Y2KA 3VEYA 2FZGB 5CYMA 3CUNA 3UNGC 3HULA 4GO5X 3NMUA 3MI7X 1M5PC 2RF2A 2PC6A 1Q81T 4J9LA 3T41A 1SJ3P 1BI4A 1T6DA 4H0XB 2VYPA 4H4OB 4JNEA 3OFGA 4IH5A 1HNIB 3IBWA 3UKRA 4WFNQ 3L7OA 5LY3A 3ATUA 5AQPA 1YX2A 1H6KX 2IA0A 4NRUA 3GCXP 2KTQA 2R42A 2KFZA 3MXHP 4DN9A 1Y3KA 2OPQA 1RTHB 3NAEA 2JOQA 1TU0B 1NJIT 3R2DJ 2FBVA 1WOSA 1IBMF 4CBWA 2V2QA 2KG0A 4P2MA 4GVLA 4F04B 4XTTA 3S01A 1XMOF 2PN6A 4KGXB 1VQ8N 3S9HA 2GW8A 2WSFC 2AJ4A 2FJXA 1WI6A 3HHLB 1ZBSA 3CMES 4PYAA 4I6MB 4M42A 3ENQA 5EX3A 2R2TA 1LK5A 3U6FA 4RWTA 4C2MA 4YR2A 5AQMA 3MCSA 4JKFA 1E6VB 3SV3A 1JKHB 2B6AA 2FUG9 4BR2A 2P9KA 4DL5A 2VONA 5EX5A 4YS2A 4RWWA 2LYVA 2KKHA 5A8RB 1F2HA 2E66A 1WN7A 5KFWA 4FWPA 1EP4A 4CGDA 4R0JA 3O1LA 1CJVB 3FGUA 2BUPA 3HXMA 4RR5A 3C95A 1GLAG 2OSQA 3L2RA 2F8TA 1EO1A 3W9IA 3HD2A 1G15A 4JKEA 1XNRF 2G8VA 3DLGB 2P6SA 4I2PB 5K8PA 2ZE2A 2R3VA 2QGFB 3H42A 3TAQA 1OQ3A 4ED2A 1J53A 4LREA 1VC6A 2VOPA 3MTJA 2VICA 4LF6J 4FWLA 1S1TB 2EKYA 3DRPA 3GZ7A 2YX6A 2CZ9A 4TQSA 2AJ1A 2EFGA 4JI8J 3TZZA 3MCOA 4DMNA 3IN5A 2JEJA 3AVNA 5H9EK 1P8ZA 4GKKF 5BPLA 5DM6Q 2ZH3A 1FNMA 2C2EA 3DWLA 2B7CB 1AZSB 4UF4A 3VQ9A 2EHGA 5M2UA 4HUGA 4HDGA 2Z58B 4I1TA 1S77D 1ZM9A 4ANEA 1TKZB 2E8AA 5BREA 4WTYA 5KG2A 3U3GA 4ID1A 3UW1A 1WEYA 2A10A 5A0YA 2DHHA 4CLTA 4DR3F 4CM2A 2P6TA 4I2QB 3HVTA 1FX2A 2GFFA 4B1VA 3VPZA 2IC3A 1U2CA 4B3SK 1ZPWX 2J6UA 4RO0A 5AR0A 3D2WA 3W9JA 4WFNL 3KHLA 1FEHA 1LWEB 4WFZA 4OZJA 5K14B 3C6UB 4WYLA 1U8WA 4DBQA 3M6WA 5EVZA 2ZZMA 3JTNA 3IM9A 4DR2F 1AUSL 3A8JA 4IRKA 2G8WA 1U2RA 1UJ4A 4CJ7A 3M9MB 1O8BA 4ED4A 3C19A 5D8HB 3EVMA 4WJBA 4W4MA 4BRLA 4CE9A 1BISA 3IO1A 2ASLA 5L39A 2GJFA 2N7YA 4X4UA 1HLWA 4CJVA 2RE2A 3D66A 1O5JA 4NL5A 2YQ3A 2P5GA 1RWPB 1M0SA 4KHQA 2XBPA 4M3TA 4N41A 2QXFA 4CLUA 3FZ2A 2KKZA 4FM2A 2YPYA 4CBXA 4PKHA 5DM7Q 2CQPA 1UA0A 3UCZP 3FBFA 1QAJA 1PSDA 2AGQA 5KT6A 1TVRA 2GMLA 4P2XA 2V2ZA 1BWFO 2V68A 4B1UB 1RT3A 3A3PB 4DLGA 3PX6A 3NVKA 3BGRA 3BSNA 2GWJA 4M5LA 2MSTA 2BJDA 3T6BA 4I69A 4KHPK 4FYXB 5K5MA 1UKUA 3ZZRA 2HIQA 4BG9A 2BZ2A 5HL7Q 1ZBTA 1GQEA 3J81O 4YOYA 2PD1A 2YTCA 4K5SA 3NKYA 2HAFA 4LBHA 3PO5A 2P8IA 1I3AA 4KB0A 4F3QA 2H65B 4ICLB 2VKRA 3CCMN 3V4IA 5K8MA 2OUGA 2XTJP 4HACA 4MTPA 2LLZA 3OW2M 4LF4J 3I4PA 2RS8A 4FWMA 3SV4A 3GG1A 2ACYA 1VQKS 4L73A 2J6SA 1KAXA 2GJIA 1KQKA 3H25A 1QAXA 2XY8A 2DGWA 2RB7A 5ETNA 2BQ3A 1DHMA 4DL2A 3HMJG 1S6PB 3KHHA 4V19X 3FJ2A 4JS5A 4X62J 2ZVIA 4FZZA 5IFMA 2XS7A 2YKNB 2X51A 2WBRA 4OZ3A 4N47A 4PXCA 5DM6L 1E3MA 4Q43A 2G13A 3HOTA 2KFNA 2UU9K 2BRLA 1SJFA 3HTVA 3DCAA 2QTDA 2F4VK 5AT1B 4NO7A 1NZ8A 3KNGA 3IR5B 4CLPA 2BE7D 1WELA 2FC9A 1X4CA 4NLUA 5H9FK 3W63A 1IR0A 1RGVA 4C11A 1HR0K 1G1XA 4CJSA 3FUYA 5HJXA 2XSFA 2NRZA 4RW7B 3LW5C 2KU7A 1X31C 3CC7S 2A1BA 3V6HA 4EMDA 2P9IA 2KXNB 4ZPCA 4C0BA 4ZTFA 4CK3A 3SDEA 4DV5K 2K06A 2K1RA 4UQGA 3ILJA 2D9PA 1VSJA 4CZFA 3B4MA 4KGVB 5SWMA 4R8UA 4LR9A 4LF5K 1VIOA 2XYPB 1NO8A 5M2RA 2KHCA 2UVVA 5KFCA 5KFXA 3MD3A 4QYZJ 2QZ8A 2O66A 2CQ0A 1S6OA 4DPTA 1BIUA 4W92B 3I8BA 3W3SA 2MEWA 2B9EA 3M2VA 2GIFA 3HVWA 3QRPA 2GZOA 1ZH5A 1OJ4A 1K8KB 2OANA 3AGKA 3OSNA 5CHCB 3QEPA 1UEKA 3X1LB 6FD1A 2VPYB 5DM7L 2QYGA 1QVFR 1HPMA 1SPBP 1WF0A 3PFEA 1SKWA 1HYVA 4OJGA 4E2FB 2G2ZA 2WVCA 1FE4A 3JAMO 4O44B 3J7YI 4HVZA 2W25A 2DGUA 1YHQS 3VQTA 1YJWS 4CF9A 4O4RA 4O3QA 2O8BB 3DRRB 5KG7A 1HPZA 1FDBA 1YJUA 5A2QO 2GS8A 2OZMA 5HL7L 5B0GA 2IY5B 4ZVFA 4U8VA 1PAEX 2RD5C 2D4WA 3ULHA 1FF2A 2VJUA 1U48A 1FJGJ 5AJ3K 1BHNA 2HSTA 3MAAA 2VFUA 3OV7A 2HWTA 4YNQA 2W01A 1KLMB 1H2VZ 1JL2A 3VF2A 4YUDA 2Z1HA 1LNQA 3AB2B 4B3SF 1HMVB 1KWMA 5C7PA 2R8JA 4CIGA 4TYBA 2ZNZA 4KI4A 3FQKA 4H0YB 4FM1A 4MIBA 4PWDA 4YP3A 2NQPA 3OQ2A 3R3TA 3IDHA 3VERA 2D0CA 1FHTA 2WBNA 3ZSQA 2Q1NA 1BE4A 2Q1LA 2H5JB 1S48A 2AQ4A 2MKSA 1M5HA 1FXLA 4OLBA 5DZ6A 4JI0K 4X4VA 4DV4K 5T7LA 3VQCA 2HLUA 5AQKA 3FR0A 4BVOA 2R8IA 3DM2A 2KG1A 2EFVA 3UQSA 4OFZA 2B0GA 1VRTA 3QWPA 1K9MT 2YNFB 2PDAA 3TRGA 4MLEA 3QJPA 3ILIA 3B6BA 4FOIA 3QLHA 3PVXA 2OEMA 3BKUA 4WCEQ 4K5RA 3EPGA 2FJWA 4DL3A 4J5OA 3ZTQA 4H5VA 3DLRA 3SLCA 3TARA 1S0OA 1NGFA 1NWKA 4DX5A 5KPRA 2GAGC 1U4BA 4ZA1A 4FBUA 4BC9A 4EUVA 3ZZUA 4AHVA 4DG1B 3Q2SC 1V5IB 3B6OA 2BM0A 5KFGA 2AW0A 4FJNA 1U47A 1N32K 3W2WA 2VD3A 4KHPF 4OYBA 3J80Y 1OH5A 4FP9A 2ZBRA 4L3NA 1H3DA 3BQ1A 4DQIA 3D45A 4TKTA 2C2RA 4YB7A 3TX0A 4Y65A 5DG9A 2NRXA 3O8MA 2O8EB 2M2BA 2HNYB 3QIOA 4JAXA 2E1CA 3N6MA 4JLHA 3ZT1A 1EWQA 1DLOB 2XS5A 4OIXA 1T03A 3PZPA 3QESA 3SBMA 4TY9A 3OYGA 2FVQA 4M8LA 1RDCA 2VBWA 1UWAA 3P49B 1GFWB 3E51A 2QEXN 4DPWA 4NLWA 3BO3A 2JHEA 4N8NA 4LFAJ 2PA3A 3K0SA 3WQPA 2FB0A 4ILMA 4CZMA 1PIEA 2UU9F 1DY3A 3UN3A 4U95A 3T69A 1RLDA 1VQ5N 4J2AA 3AD8C 2JVOA 2ASPA 3FCHA 4UOFA 2UXDJ 1J27A 2F4VF 2KLAA 3HKZD 3KD5E 3VESA 4DSIA 3CCRS 3NGIA 4K8XA 5M1OA 3ZSOA 2D5RA 4KHNA 1JLFB 3KHRA 1HR0F 4A8FA 1KBRA 5EU7A 3HLUA 3MEGA 5HO4A 4XEIA 1FDDA 4OYMA 4OHXA 4F25A 5DQIA 3CM6A 3HHLD 3TO8A 3KLGB 4EHUA 4L74A 3V5RA 4C0OC 2E20A 5F3ZA 2MKYA 3FC9A 4DV5F 3OD2A 4O8UA 4HYKA 3R3LA 3UCUP 4CFBA 2DXDA 3VMFB 4LF5F 2GGPB 3KLIB 3KVGA 3HFZB 4OJ3A 4CZIA 3HSCA 3E9OA 3SPYA 3G82A 3E01A 1FW6A 3BBFA 1HI1A 2RAQA 2BEFA 4PY5A 3F0NA 3HX9A 4IRCA 1NGEA 5CCLA 1S1UB 5ETQA 5AQGA 4KGMA 3GJRB 3WXLA 3DYAA 1KRPA 1E4GT 1TYQB 4OYIA 2V94A 1ZBFA 1C1CA 1RWOB 4DSLA 1URRA 4WCEL 4DV6K 1BWEA 4NA1A 1XK8A 5B0BA 4C6AA 2HHTA 2RDDA 3H6EA 2GMJA 3PHEA 1UPPA 3TAGA 5KFQA 3CEDA 2DNPA 2X1BA 4UY85 3EE9A 3D68A 2FC0A 1IKWA 4ECQA 1HYSB 5D0RA 5BR8F 4O4GB 1UJ5A 3S6EA 1I5OB 1B7YB 4DTPA 4OJ1A 2C1EB 2ZZTA 5IQ6A 5L1IA 1K8AO 1HQUA 1SB6A 2AJ0A 4M7YA 1Z2LA 1XMOJ 2E5JA 1J6ZA 4WWSA 1Z05A 4NPOA 2JX2A 3MOZA 3T5KA 4I7FA 3QRQA 1D09B 4M95A 3H40A 4FJKA 4CGFA 4YMEA 2AIRB 4KKOB 2VB6A 2Z1GA 4MIAA 5AJ3F 4E7HA 5HMYA 3M1VB 5JXSA 3SQGB 3CIZA 3EXYA 3CE8A 2FJAB 5A6PA 1FKPB 3N28A 5B7WA 3ENOA 1GLDG 2B3TB 3QJLA 5HLFB 4ECSA 1GLLO 3P6YC 3VGLA 1XR7A 5HP1B 3D3CJ 2NUHA 2ZJQL 1V6HA 2W7AA 2BRKA 5J2PB 3FDSA 3THXB 1KONA 1XNRJ 3LP3A 2BW2A 1UMJA 1CXQA 2QM1A 2BACA 3M8ZA 5IS2A 4JI0F 4GW6A 4UTGA 3LP1B 4DV4F 2ITGA 4QWCA 4RL1A 3BH6B 2JSXA 1GX5A 2G8FA 3NWGA 4ZVOB 4IFVB 4PXBA 4X66K 3DXKA 2KT5A 1BLUA 3KWMA 3ZSYA 4BWMA 1TL1A 1HHSA 3WX8A 2DY1A 1XQSC 4KAZA 4BWJA 5ADZA 3PFOA 2Q31A 4EK2A 4DPXA 2F63A 4ED6A 2DPJA 5E84A 1HNZK 3MR3A 1IBLK 1IWGA 1QQCA 4CDIA 3CJ9A 4LQ9A 3KMQA 1YRUA 3VWSA 4OYPA 4ILLA 2IYIA 4L3KA 5B08A 4WU3A 1MWZA 1WC1A 4QIVA 3ONQA 1SL2A 4WF9Q 5M1KA 4N56A 3CULA 2DGSA 1N32F 1UCNA 4N76A 1Z2ZA 1WBDA 4EP5A 3HOSA 4CBUA 3FZKA 1ZBIA 3CJ4A 4ZCKA 4WE1B 2EW9A 3QAEA 2BDPA 1HQEB 2F1FA 3HCXA 2C3MA 3AFGA 3CCEN 4C1NK 1ZTWA 2DNGA 4DR3J 3ZYYX 3H59A 3SFGA 1LOTB 1Q82T 2YWFA 2DNZA 1W7WA 1WUUA 2J5AA 4JI5K 2RKIA 1VQNS 4C9DA 2Q6CA 2G0IA 3C7NA 1Q53A 1T6CA 3B8HA 3RZAA 1HWKA 1XEZA 3IBFB 4MLHA 5GVQA 5F9NA 2NS1B 1XN9A 2RQMA 4GVEA 3AVGA 2QN6B 2LDIA 4YR0A 1S9EB 1G4CA 5MLCV 2NXUA 3KOAA 1CJTA 1S99A 1YGYA 1YHQN 1HNVB 2H51B 1NHKL 4LR7A 3G9CA 3O9TA 1KAYA 1RT4B 1SVDA 5BPNA 1S1WB 2QTWA 1ACMB 2HHQA 4H4MA 2F8EX 3NVMA 2GO9A 2QMUB 4GMKA 2AZ1A 2C2OB 4CF1A 3RG6A 2KT3A 2G2OA 2J0XA 5I4MA 4JV5J 4TSXA 1U0SA 3IGNA 2XZTB 4JHDA 2KB2A 1QVGM 4KC5A 4AYBD 3SIPB 4M5NA 1TK8A 3VQ5A 5CZ1A 3D28A 3M6UA 2IOCA 3NRBA 3HHKA 1RAFB 3MR5A 3A8KA 5KG3A 4JN4A 1RQ0A 1FI4A 1BHLA 1QJHA 2R7VA 2EG2A 4CF0A 4NYFA 1YI2S 1RADB 3L3UA 4USMA 4LF9K 4NLOA 4FPBA 2V8VA 4WFBQ 1REVA 3DU5A 5D3GB 2YNIB 1OIAA 4YY3K 1Y0HA 5I42A 2MKCA 2DPIA 3M6XA 3OHBA 2V63A 1H7XA 1IBKK 1HX1A 1WLJA 3CCUS 3LGMA 1WSJA 1S57A 2VG7A 2BQUA 2POKA 5FIIA 1WG1A 3G6EN 4QIFA 2O8DA 3TPQA 2Y3YA 5IWAK 3MM9B 3NCRA 2L41A 2E1MC 3N0VA 2D0AA 2ZWPA 3LDNA 1MMDA 3V1QA 4OZNA 3D3BJ 2LP4A 5GIPA 1B92A 3KLVA 4RW6B 3QEXA 3CFPA 3N4PA 4A8MP 1YJVA 2YNGB 1OSDA 4F2SA 4K4UA 2AP6A 3BYRA 2V9WA 4QR1A 3QGGA 3THPA 2IMOA 3AQPA 4CT8A 4DV1K 2Q0RA 3QAUA 1O1WA 2NZTA 4JI6J 4FJLA 2OD6A 3F9KA 1ROFA 2MJNA 4IR1A 4ZVTB 3M9OB 2JJ4D 3D1HA 3O4NA 2PFUA 2E5LJ 1HBUB 4HI1A 4H54A 3J81j 2HBKA 2VL1A 1RWMB 8RUCA 5E41A 1X5OA 4J9OA 3GLJA 1GX6A 1VQ9S 1MWYA 1KVJA 4LC9B 4CLYA 2EK1A 3EGNA 5LSRA 2F96A 3H8YA 2E1AA 2AGPA 3CPEA 3AV9A 3DOLA 3DFEA 5GAEP 2HBMA 2CZ4A 2J9CA 2XCAA 2WSEC 3HJFA 3I5AA 4X66F 3LZJA 1WKLA 1JCEA 4ECWA 1JCGA 4KFBA 4BE2A 1VHFA 2I2YA 3DRYA 2ZGYA 3CJ5A 4OVLA 3KHYA 1NDCA 1IG9A 3U1MA 2MB0B 2ROPA 1V4TA 3DRXA 3NXZA 1HNZF 5CZVA 5H9EJ 4V19S 3QZ8A 2RIJA 3VAIA 5C2GA 4ED7A 1GTEA 1KVIA 2DTUA 3E8OA 4CJ4A 2HHHK 3CO0P 4TLRA 2YJEA 4F0MA 4P7VA 2Y0SD 3Q8VA 1O0PA 1S97A 4NLBA 3ULDA 4FVMA 5HAOA 2MLZA 3OTEA 2VBXA 1F5CA 4KHYA 4KHUA 4LSLA 2PI4A 4JBCA 2E2NA 1HBNB 2BR0A 4FWNA 1K44A 2Y1RI 5DDOC 4DPYA 4CO5A 4AD6A 3NNCA 2HGNA 2OZSA 3ZEUB 1S72S 4JI5F 3EGZA 1RTDA 4B3SJ 4DF4A 3MM6B 4EIAA 4F3TA 3B82A 3LGNA 4F8RA 2IDOA 1WC5A 2QWQA 4ES1A 3UN2A 4CJ3A 3NCPA 2YKAA 3VAFA 4CO1A 3L2UA 1RT5B 4RNFA 3J81Y 3WUHA 4EO6A 3TTFA 1S5JA 3CW2C 4AL6A 5IM0B 4NXNJ 3IG1B 3GE1A 1M90O 2OA8A 3N01A 2DGVA 4Y2CA 3FK4A 1EQYA 4F4XA 1NKBA 2HAIA 3I9ZA 2D69A 3HD1A 1KC8T 3PYFA 1HYZA 4X64K 2KJWA 3U3YA 5L8RC 1ATRA 2B7BB 3OXLA 2XMMA 3V1OA 1JLQA 3WNHA 2RQKA 1C0FA 3QFPA 2DD8S 1SJ4P 4NEYA 7FD1A 3W64A 4M5IA 1S9FA 2OPRA 4X4OA 3BSCA 4P72A 3Q7CA 3O9SA 3SCIE 3U1LA 2V52B 3MAHA 3ZETB 1F9EB 3GILA 3SJHA 1T0TV 5DZ7A 3D2FA 1SKRA 3AOCA 4EHTA 5F8MA 1RKIA 2P9PA 2Z56B 2CJ9A 3LZIA 4CEFA 1C0MA 4IUFA 6AT1B 3VAGA 3IC1A 4AHRA 4TYAA 2LU2A 1LWFB 5CZ2A 2XG8A 3W61A 4QR0A 3W5XA 1CULB 2FYXA 2P9UB 1V3SA 2HKEA 3A3OB 2L48A 4LF9F 5JS2A 3BN7A 2KM8C 2VQEJ 3KKSA 2A2CA 2W9CA 1K1QA 3R9LA 2WTFA 2EFOA 3JQMA 1TELA 4K4YA 4YY3F 2KI2A 1IBKF 4JI3K 3RBZA 3RSEA 1NEEA 4E19A 2PFDA 2R7UA 3KMSA 3SAGA 1DGKN 1UZDA 3D9BA 3THWA 1VIXA 4A46A 4CCHA 4B3OB 3CCVS 1J2VA 3V4MA 3IRWP 3QGIA 4DL7A 5IWAF 4AXIA 4DR7K 5H1SV 2V7YA 1GT8A 4CTAA 1GMUA 1VQ6N 2CNLB 4M3WA 1FKAF 5C2FA 1WSHA 4ED1A 3H5XA 5H9FJ 1YZ7A 5TKWA 2AWZA 3LUYA 4FLUA 1C2PA 5M1PA 5CYMB 3WEEA 4EO8A 3JAMY 3FSIA 3VEXA 3D5MA 1Z1ZA 2YKQA 3MR7A 3FEYB 1K47A 4QIEA 4DV1F 2RF2B 4UW2A 1MWKA 4LSZB 4FJMA 3KLFB 3BYPA 1BI4B 2CADA 3UE2A 2F9TA 3CDUA 5KT7A 5C15A 4F36A 4LD0A 2DR9A 3NE6A 3CDBA 1YJNS 5DG8A 4MH8A 5KQDA 3UKRB 4FOEA 3SUOA 3C2PA 5A2QY 3D6RA 4ZKAA 2Q36A 2N3LA 3TZWA 7FDRA 2KRRA 1RDAA 1XNQF 1X1PA 3O6QA 2GHPA 3ITHA 4KQZA 3QGPA 3U27A 4TU9A 3UD4P 3FQLA 4TU8A 3CJ3A 1PYSB 2GMHA 1ZM2A 2X6NA 2GQCA 4JKHA 4NA2A 3KWGA 6FDRA 5MLCQ 1S76D 4U6PA 3H5UA 4Y0FA 2XNRA 8AT1B 3BO4A 3VF4A 3AAWB 5ITHA 1RILA 4CJEA 1VSKA 2CDRB 5HJYA 1NGIA 1H72C 2G8KA 1CZ9A 1FVSA 4A57A 4E8UA 2B6AB 1MROA 2COLA 1YAGA 3ZSZA 1RTIA 1VQMN 5GINA 5KT2A 5AQQA 2P9KB 3VQ4A 3R1XA 1WEZA 2PA8D 4P9SA 2ZKTA 3RU0A 1QE1A 1JL1A 4P73A 1EP4B 4LQ3A 4PCQA 2HHHF 4ZPAA 3M7VA 1LW2A 1KVCA 3ZT2A 1TTHB 2KQ2A 4NXMJ 2FHJA 2RQCA 4CJKA 2HVEA 3PW0A 3CJ2A 3SUNA 3AVIA 2YVSA 4H0PA 1YLXA 2ZE2B 3NOCA 2I7NA 2OAUA 4ZCIA 2KFYA 3CFRA 1RAHB 3J7Z5 4FWKA 5L1JA 3OS2A 4C3LA 1P9QC 1RUSA 1ZC6A 3TOQA 2WOMA 2P51A 4AT1B 3DRPB 4Q45A 3Q8RB 3GWCA 5L1LA 3C15A 3A4TA 2C28A 1VSFA 2E7WA 1WUAA 4XO0A 4ZIWA 3LTOA 2K8GA 3QT5A 1PO6A 3B6PA 5I3PA 4MDBA 3ZO7A 5F0XA 3B78A 2ZUAA 4ELVA 1R8PA 4JI0J 2YY3A 1T9VA 3GG0A 1RDDA 3A2FA 4DB3A 3C0BA 4GY2B 1NB7A 2AKWB 2MKHA 3A5LC 2HFSA 2OPPA 2DIVA 4X64F 3CC2N 5A0YB 1JXBA 4F50A 2O8FA 2RRAA 5F1XA 4B3RJ 4ZITA 1KLNA 5EHHA 1MN7A 1GAOA 5T14A 3HVTB 3D1OA 1S59A 3BN4A 2IC3B 2FJBB 2ZM6F 1ZYQA 2CPIA 2DHSA 2J7UA 4ZVRB 5ETPA 2B4UA 2DR7A 2AGOA 4M1KA 4HWIA 3CMQA 4KI6A 4Z37A 4URGA 3GPAA 3RR7A 2FZKB 1I39A 2ZH4A 4F9OA 2Z0GA 1V3ZA 3ZZPA 3W7BA 4AF1A 5KFSA 4HH0A 4U7UK 2NXJA 1PAUB 3NGYA 2RU3A 4C0HA 4DR4K 5JUMA 2XSJA 1KKHA 1GXLA 2FHKA 5CXTA 2C3OA 1HA1A 3LDSA 3Q8QB 1A5XA 4LF1A 2CNKB 1JJ4A 3PM9A 1GLFO 4JKDA 3SYZA 4OZLA 5JICA 2BJ1A 2OFGX 3CI5A 4FDFA 4RPFA 2RUSA 2IVNA 1GH8A 4Z7YA 3QYYA 2O4IA 3AD7C 2JNJA 4BRQA 4JI3F 1IN0A 4WU2A 1TVRB 4IOBA 2BE2A 1O6XA 1RT3B 3BF3A 2W2MP 3ID8A 4HTUA 2C2KB 3M5RA 3BGRB 2H5IB 4H03B 1LWXA 4M41A 4DR7F 4AQYK 2DO4A 1DBDA 1VQLS 1G99A 1S6QA 4QJVA 4CP5A 4LVOP 1X5TA 4LF6K 2PYJA 4KTWA 3ZX0A 3BP8A 4RTFD 4JI8K 4WYWA 2F4FA 3V9ZA 3O3HA 3V4IB 4ED5A 1UVKA 3MWTA 4HACB 2XHCA 1WOPA 3MMBA 4KT0C 4RW9A 5FDLA 4ZDNA 3K9KA 5KFDA 4NYNA 3BEGB 3UPFA 3GG4A 2NYHA 5HVGA 5A76A 1HBOA 1M1GA 1N52B 4DPUA 4CRJA 3AVLA 2MY8A 3GL1A 4TU7A 3K9JA 1RT2A 2HPUA 1X0PA 5DQGA 1UOCA 4AL5A 5FLXO 1R0AA 4CI0B 4OPHA 3NGDA 4FL9A 1NHUA 3THVA 1S0MA 2YXLA 5KG0A 1U09A 2QL5B 2FQQB 4ED0A 4BRMA 2V9KA 4I9LA 1H74A 3C65A 3PX4A 3SQ4A 4C11B 1VK8A 2WRMA 3RB4A 3BF1A 3CCJS 4DV6J 1JIHA 1RISA 2P9IB 3WIUA 2K3KA 2VPXB 3TR5A 1N5YA 2XGQA 2IVFB 3BEXA 3RRHA 3DDKA 3SDEB 2ALYB 2DY9A 2PMWA 3ULEB 4NLDA 3O08A 3HVAA 2UUWA 4IKAA 5EN1A 2M70A 2AP1A 4R8UB 3OBIA 1XUPO 2DY4A 1H2TZ 3AVCA 3CHWA 4OI2A 4PKGA 3MZIA 4IJNA 3K2YA 3MX5A 1KVKA 1CJUB 4CF2A 4CH0S 3T1HJ 3NL0A 2MQOA 4X2BA 2M0GB 3P4IA 3ALYA 3M2VB 3KXDA 5KPZA 1JJ2R 2WB1D 4J37A 3VQPA 3DN9A 4DTOA 1OH7A 3QPIA 3VGVA 2Y0BB 2RH3A 3K17A 1MWQA 3JTPA 2XLIA 3VTHA 2ZH7A 2HZVA 3CJ1A 2EEYA 1F0XA 4EGLA 4EI2A 1T44A 5KFJA 4LRDA 1F2GA 1YJ7A 1OH8A 4RUHA 1PBUA 4CO0A 1Q86T 3IWLA 2LEAA 4ZVGA 4UUWA 1PYOB 4DFMA 5KFMA 4K4VA 2FLNA 3CJQA 3VVTA 2ZJPQ 1FDAA 1NK4A 1S79A 4CZEA 1HPZB 2UVUA 2XMAA 3SCJE 4DUYJ 4ECYA 3M8PB 3O4QA 4FLWA 1U2VA 2YHWA 1NGHA 4MFBA 4O8KA 4G1PA 1RHQB 4N5SA 1Q8LA 1WSVA 1VQPN 1XWLA 4KPYA 2DH7A 3VQDA 1NOYA 2LVWA 4X62K 4F4ZA 5H1SQ 4L72B 4FWRA 4LF2A 1FRXA 3MAAB 1B3TA 4L75A 3LQVA 4K7QA 2FIUA 3K8WA 1HL6A 4CJTA 4KIAA 3MWBA 4NA3A 1HNZJ 1IBLJ 2N82B 2RU9A 1KAZA 2Z4PA 2MGZB 1VBXA 3TW0A 1S7IA 1NU4A 2Z1JA 2HYIB 2PSZA 2K7JA 3IR6B 4PWDB 3NGSA 4B3TJ 2GNKA 4U7UD 3BKTA 4OYAA 2HVDA 3OYDA 1CXUA 1VRUA 3A13A 3MR6A 2CJQA 5T7LB 1FD2A 4DR4F 2HLTA 2HHPA 1KSPA 3DM2B 2P9NA 4FVCA 3RGIA 5CHIA 1VRTB 1Y00A 1JLBA 1HBMA 5C10A 4IO8A 3HPGA 3OYJA 1J54A 1RA7A 2XI3A 3PTWA 3QLHB 3HYFA 4QYZK 5IZHA 1EQMA 5SZTA 3H98A 2Y8WA 3J80U 1YZ6A 1X3MA 3R1LA 2W1BA 3H4BA 3DAWA 1XBWA 2DCLA 4F2RA 3KJFB 3V2UC 3LAKA 2NUBA 4K4XA 3UFCX 2Z2LA 3ZZYA 3QMQA 4DTSA 4NMLA 1C1BA 3W2WB 2GVZA 4AQYF 1UAWA 2HVHA 1RU1A 3LDPA 4PAAA 1NDPA 2R7RA 4ALZA 4LF6F 3G4SS 3W2VA 3L7UA 4I6AA 3J7AN 1QTMA 4JI8F 2VWBA 3HP6A 3CFOA 1WNEA 3TVZA 1ZXOA 2KL8A 4KYZA 4ECRA 5K8OA 1YF5L 2WONB 1U1NA 2ZWHA 2VIHA 2QWMA 3GIRA 3HPOA 3AVHA 2OIHA 1KFSA 4IQXA 4UOGA 1SCJB 5AE3A 4ED8A 4JK7A 4IFVA 2CQBA 1XJWB 1FJGK 1PC5A 2M8HA 2ZJPL 4TQRA 2FSNA 3P4UB 1YXQA 2BTFA 2L3MA 4ZP9A 4FLYA 4M3ZA 3K5PA 1BIZA 2IM0A 2VFVA 4OKEA 5BJRA 3ZSVA 1VISA 4CZLA 1FJ7A 4PG6A 1MW7A 4OPJA 1Q8BA 4LF9J 3WIVA 1M1KO 2HURA 3MEGB 1VC5A 4B9TA 3N5BA 1TKXB 4FKXA 4TLQA 4YY3J 4ANDA 2JWLA 3J7YP 3ZT4A 4K8ZA 2YPZA 2MLYA 2AX1A 3QBCA 1AROP 1Q79A 2HFNA 3OYLA 1RDUA 3TA0A 4BE1A 1Y64A 2D3O1 4QZVB 1WHXA 2IYGA 4IOCL 2YHXA 4KBOA 3U1NA 1QVGR 3OA9A 4B1ZA 5GAEI 3VQSA 2OTJS 3NGZA 4DS4A 1VMBA 2EC2A 1P6TA 1NB2A 4IKFA 1Q9YA 1RCXB 1QQNA 3G82B 3E01B 1WC3A 4OYOA 3ID6A 2AU0A 4YN3B 4CH7A 2WBMA 2KZZA 5F0WA 3HPHA 3VETA 2NYIA 4ZPVR 4M7XA 2IM3A 3M2UA 5JLHA 3DYAB 3BBCA 1EKEA 2HEKA 4H0TB 4B8CA 3CIMA 1VQ8S 1UZHA 1RLCL 2P9LA 4USWA 3QFWA 1C1CB 4WQ4A 4DWIA 5E3QA 3ELHA 2M52A 3O80A 3NGKA 3IUCA 3O9RA 1TAQA 3GR1A 2VA3A 4KRWA 1FNXH 1N0VC 3MXMA 2KW4A 3AODA 4RU2A 2J7KA 4B9QA 4MT1A 1T94A 4OHYA 2ILZA 1IKWB 3IR7B 3N4WA 3NP5A 2BJ9A 1D8ZA 3BS9A 3R6MA 2FF3B 1S10A 1N36J 2OCEA 3CXCR 1NDLA 4BGBA 4DU8A 2M7SA 4NCGA 3QIPA 4USIA 1T05A 3VQQA 5AQXA 1UVLA 3RYLA 3K59A 1HQUB 2V8GA 4IXCA 2IRXA 4NLVA 3L9ZA 1WTBA 1BU6O 3QDKA 2QK9A 4I7FB 2CUYA 3O4WA 3TEHB 4X62F 1VSMA 1VK3A 1WSGA 4M63A 1T7PA 2X1GA 1SJRA 5KFLA 3UWTA 3GQCA 1RCOB 1NUEA 2ZOGA 4WP9A 3FLCO 3LDOA 3OHAA 2VCPA 1W0HA 3TSUA 4ELTA 3EUNA 1FRJA 4J9MA 2UXDK 4BC2A 3TU5A 4GC6A 3OYEA 5AQIA 3TAPA 4WFAQ 3PRVA 1PKUA 5L9NA 3U02A 2CVEA 3KWIA 1PYTA 1EX4A 2JDJA 5HBMA 5D3GA 3VQ6A 4O0JA 3VEOA 3V81A 5GAEU 4RNHA 1LAVA 2XGPA 3A8YA 1AYEA 4NMXA 4FYYB 3PDNA 3CCLS 2CXEA 1CVJA 1Q1KA 3P1GA 1Q7YO 5LJ5Y 2DYAA 1R0CB 1I94K 5MAOA 5B0AA 4OZ1A 4JS4A 2YBVA 3LP0A 1QSSA 3MM9A 3VZIA 3TI0A 2IBOA 4PUOA 2WVDA 1T9YA 1TL1B 2CRLA 1N5TA 3MPWA 1HWJA 1NJYA 2VGNA 1V4SA