4ID5A

Hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 164
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4id5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4id5A05
5F9NA 2BRKA 4ECZA 4R8UA 4CJSA 4DQIA 1RYRA 4FM0A 1RDAA 2EX3A 2IS3A 3TI0A 4KO0A 5DMRA 4CESA 5J2MB 3Q8SB 5L1LA 4NLVA 3VQAA 3NE6A 4LSNA 2W8KA 2Q3SA 1LW2A 3BJYA 1RT3B 1S9FA 1JLEB 5KFIA 1J9AA 2V4RA 1RT5B 5JS2A 1DTTB 4NZ0A 2FVQA 3KLVA 4FLYA 3L2UA 2JEFA 4DS4A 2DPIA 4PQUA 5KFRA 1S1XB 1SH2A 3HL8A 3BDPA 1NKBA 2ZE2A 4IG0A 3K5LA 5KFWA 4M95A 3PO5A 1TQLA 3LDSA 4DS5A 4JV0A 5JXSA 3V6DB 2RDJA 1HYSB 1TAUA 2ATQA 3DLEA 4YR3A 4F4ZA 4CJUA 4CHOA 4E7JA 1D0EA 2X78A 1I39A 4Q0BA 3N6LA 3TAPA 5KFZA 4KHYA 3VQPA 4DTPA 2HVHA 1LWCB 4DFKA 1D8YA 3NBPA 3AO3A 5C5JA 2YHAA 5J1EA 3KOAA 4LSLB 3C95A 1UWBA 1BCOA 4FJIA 2ZD1A 3DYAB 2E4LA 3DMJB 1S1VB 1TKTA 2VG6B 2CKWA 2XWYA 1JLFA 4ZVEA 1RBVA 1KLMB 2YNFA 4KKOA 2Z1HA 3PJXA 4ID5B 4NLTA 4ZPAA 3OJUA 2X6NA 3CM5A 1SUQA 4F50A 2HVIA 4RNOA 3CWJA 4Q43A 2CJQA 4QW8A 4CGJA 3SPYA 1XC9A 4KB7A 4WE1A 2RDIA 1TKDA 1X9WA 4KRFA 1FKOB 4KFBB 1IKYB 2G8UA 3QO9B 1D5AA 3T5HA 5KFDA 3KK1B 4ELVA 4E89A 2YNGB 3HVRA 4WXWA 3KLFA 4TXSA 4F2SA 3I5CA 4CGGA 3NMAA 2F96A 1NK4A 1O1WA 4FLUA 4IKAA 1WAFA 1HQUA 4F3TA 1EETA 3G10A 2BANA 1KTQA 2PY5A 3ZSXA 1RDCA 2D41A 4DFPA 4I2PB 3IG1B 4OJRA 3PR4A 4FK2A 3NGZA 4IH7A 4J9RA 1NJWA 1LAVA 3V9WA 3T3FA 4F4WA 3DLRA 3E01B 3MFHA 3P5JA 2HWHA 2E9TA 2P5OA 3MECA 4RW9B 1S49A 3QNOA 4FLVA 4DSIA 3MTKA 3ZSWA 4IDKA 3V1RA 4W5OA 4AHSA 3DOKB 2YNIB 1QSLA 4RNNA 2WRMA 1ASWA 3V6JA 4HUGA 4HHTA 3QLHA 1JLGA 3HPHA 1C0TA 4I2QA 4BE0A 4Q8EA 4FJ9A 4M3YA 3SZ2A 3ZT0A 3A2FA 1XWLA 1GX6A 4RW7A 3H08A 5CY4A 2FLLA 3ZT1A 4K4SA 4ED7A 3VN5A 1Q9XA 3KHRA 4ZHRB 5KGXA 4M94A 4KB0A 1TKXA 1IH7A 1C0UB 2D3ZA 4RW6A 2R8KA 1YTUA 2XY8A 4DLEA 3B6PA 4ZHRA 3K57A 3VQQA 4DG1B 3KLGB 1UA0A 4PA1A 2GBZA 1TV6A 1VRUB 2VA2A 1TL3B 4IRDA 4DMNA 4RNHA 4XPEA 1S97A 4IFYB 1NOZA 3FRZA 2OH2A 2QKKA 3OSPA 4URSA 3UQSA 3C6UB 4EBEA 4NYFA 2RKIB 3ZSOA 1QSYA 3HVAA 1L3VA 3QLHB 5HRSA 1RT2B 4K4UA 1XHZA 4ECTA 5KG3A 2RF2A 1UAXA 3LP2A 4PUOA 2BE2A 4NYNA 4CIEA 2E9ZA 3MECB 3ZSRA 1FXXA 2W9CB 3TARA 3CJ3A 2G8KA 4H54A 3RAXA 3SQ2A 1D1UA 1T3NA 3T5LA 3SFUA 1W25A 4DU1A 5HLFA 1A5VA 2FJXA 2C2RA 4EEYA 4KTZA 4Y2CA 3M8QA 3TQ1A 4RNFA 1XR6A 4RUCA 4KV8A 3OL7A 4YNQA 4OGCA 2R2TA 1UA1A 1C2PA 4CEEA 1BL3A 2EHGA 3RRGA 5J2NA 3FDSA 4CJTA 2VWKA 1NKEA 1JL1A 2AX1A 3C6TB 3LPTA 5T7BA 4ELUA 1TKZB 3G6VA 5J2NB 2O4GA 3PJWA 2RPIA 1S5JA 3MR3A 1YTAA 3C94A 1ZBFA 3MXIA 4YQWA 3OLAA 2KW4A 2B43A 4DL7A 4URGA 3OL8A 2VG5B 4OVLA 3KLEA 1RDRA 4O5BA 1JLCA 1EETB 4DFJA 1FK9A 3PW7A 4FJXA 3ITHA 3LALA 4RU9A 3V9XA 4CJQA 4Q5VA 3TAEA 4N56A 4KTQA 3G6YA 3G6XA 3BQ0A 3RMCA 3MR5A 2B6AA 1SKSA 4HUEA 1RILA 2VG5A 2AX0A 3VQ6A 2ZD1B 3DYAA 1MU2B 2HHSA 4J2DA 3O3HA 1HQEB 4CEQA 1EP4A 2XGPA 3ZCMA 4URQU 3TAFA 1U45A 1BI4B 5F8GA 2XY7A 4QCLA 3D5MA 3CFPA 2OA8A 3CFRA 1N4LA 1BQMB 4ECVA 3MR6A 2Y1JA 4TY8A 4FXDA 4LD0A 5T14A 2IDOA 1IKWA 1QAJA 4C8LA 5EDWA 4CHYA 3AVLA 1BIUA 3NH0A 3RWUA 4FZXC 2D5RA 4CF1A 2FJVA 4FJJA 3Q8RB 2R8IA 3CDWA 3PW4A 3JYTB 3FQLA 4Z4IA 3PX6A 3D28A 2P1JA 2OPPA 4DQPA 5HROA 3BR9A 1KSPA 3H4BA 1DLOB 1UWBB 2JEJA 1HQUB 1TL1A 4B8AB 1IO2A 3VQ8A 3ZSVA 4NLSA 4RG8A 5KRTA 4I2QB 3LP0A 1HJRA 1B92A 5KTQA 3AO2A 3IRXB 5CYMA 3DLKB 2XI2A 2IJFA 2J6UA 4U6PA 3JSMA 1TK0A 4WXOA 1VRTB 3O4NA 4ZPCA 1TL1B 1IM4A 4ZTFA 3OYGA 3H5UA 5KFCA 4FJ5A 3BREA 5FRMA 3LWMA 3RB0A 5HROB 2BQRA 1T7PA 4ZPDA 3K5NA 4B3OA 1RT1A 5KG5A 3OVNA 3VA3A 3DMJA 3S3NA 4O44A 2X74A 1RT6B 5KI6A 2PZSA 4JV1A 2LSNA 4CK3A 4BWJA 4MIAA 4MQ3A 1QQCA 2J6SA 3OYDA 1S6QB 2I5JB 4ECQA 3SUQA 4CJVA 4KSEB 4ECRA 3K5MA 1HNVA 1S6QA 2VG7B 3GIMA 3DLBA 4NCAA 1TL3A 3JSMB 4EP4A 4CGDA 2HHUA 2DTUA 1WAJA 5CYMB 4RW8A 5DQGA 1B9DA 3M8PA 4IG3B 4Y34A 5FDLA 1RA7A 3KLIA 5KFFA 3HPGA 3SPZA 4QWCA 1IKWB 2BQUA 3H4DA 3KIOA 3IN5A 2YNHB 5HRPA 3ALYA 3VQEA 3V4IA 4YP3A 4Q8FA 4ZVHA 1WNSA 1REVA 3M9OB 3L2VA 4CF0A 3AO5A 1NJYA 2ZQBA 1X9MA 1U09A 4DQQA 4HCCA 4R5PA 1RA6A 4EO8A 1IG9A 5HBMB 4U7CA 3M9MB 3QIOA 1GOBA 4ED0A 1JLQA 5KFLA 1UOCA 1VSLA 4C8NA 4GVMA 4FZZA 2YKMB 4KAIA 4ECUA 4CGFA 1TKZA 5KFHA 2FVRA 3ICLA 4MK7A 3AVKA 4CK2A 3GQCA 1T94A 4ID1A 4J9KA 4CEZA 3OYAA 2OZMA 4QWAA 2HHWA 4CJKA 1RTDB 3QEPA 3OHAA 5DLFA 4B9VA 3HXMA 4C8MA 3LAMA 3CYMA 1DLOA 3GYNA 3KKRA 4XIUA 3H5SA 3IAYA 4EP5A 1NK0A 4TQSA 1JLAA 3PVXA 3PW0A 2JC0A 3IGVA 1LWEB 2YNHA 1RTDA 2UUWA 3UIQA 3RMDA 2IA6A 4B08A 4K4ZA 1BISA 5EWFA 4ZVFA 3SUOA 3KLIB 2W8LA 1BQMA 1TKTB 4M45A 2YNGA 1VSJA 1KHWA 3LANA 4LQ3A 4FJLA 3ISND 3QNNA 3RAQA 1J54A 4NLDA 4CJWA 4BACA 4IRKA 3VQ9A 1U47A 4M3XA 4ZP6A 4QWEA 4KREA 3SV3A 2IC3A 2JGUA 2IOCA 4DL4A 4Y2AA 4E0DA 3HO1A 5KFXA 3L2WA 3I0RB 3VQCA 4G1QA 3VQ5A 4J9OA 5I3UA 3FQKA 2OYQA 2BE2B 3MEDA 1S6PB 3WNFA 1S1WB 1K1SA 4FLXA 2DFEA 1RT7A 3V81A 1HNIB 4ED2A 2OPQA 4H4OA 4DLGA 4PQUB 4WZQA 2KZZA 1LW0B 3AA3A 3AVFA 4LSLA 4QOZB 3M8RA 1N56A 4CEFA 3H5XA 4E7IA 1JX4A 4JRPA 4ZTJA 2GIQA 4YFUA 4CEDA 3NGDA 3OJSA 1Q9YA 3QEWA 4CJEA 4G3IA 2KFNA 5C25B 2WONA 2D7SA 3V6DA 5CZ1A 2BRLA 2W7OA 3NH1A 1NK7A 3HP9A 1NKCA 5KFUA 4BE1A 1MMLA 3KJVB 4MK8A 1VSMA 3LPUA 3HYFA 4K8ZA 1TKXB 4J9PA 1NK9A 2HHXA 4K4VA 3ULDA 4HCBA 1RT4A 3QIDA 4CHZA 1N6QB 1SKWA 4E7LA 1WLJA 4DQRA 2OPSA 4FK0A 5KFQA 5SWMA 1NHVA 4J2BA 1RDDA 1GOCA 4CF8A 4WZMA 5KFTA 3HKWA 2UVVA 3K2PA 3G86A 1ZTTA 4F4KA 1W9HA 4Z4CA 5CZ2A 1HARA 4WYWA 4CF2A 3SQ0A 1ITGA 1ZBLA 3EY1A 1HYVA 2E6MA 3DRRB 2ATLA 4HYKA 1F21A 2XY5A 3G0ZA 1S1UB 3T5KA 2HW3A 3SI8A 4CFCA 1T03B 4JS4A 5DG8A 4FJ8A 2W9BB 4M42A 3OS1A 3KHGA 4FVMA 4O4RA 2B4JA 4Z4GA 4M3UA 1NK6A 1KVCA 3SUPA 2IM2A 2W9CA 3V6KA 4CEBA 3SFGA 3AV9A 3BSAA 3KLFB 1Z25A 2XCPA 4DQSA 3KK2A 4F4XA 3AVCA 2HNDB 4WFYA 3KK1A 3RRHA 4CGIA 4W5RA 4C8KA 4EBDA 2ILYA 4AHRA 3KD5E 4KFBA 3F9KA 4J9NA 4TN2A 2ASJA 1RAJA 2JC1A 4AHTA 3MXMA 2IM3A 1BIZA 3MXJA 2R2UA 1BQNA 1TAQA 3MEEB 4CFDA 1C6VA 3DLHA 3LZJA 3AVJA 4AH9A 1HNIA 3NAHA 4B3OB 5KFOA 1FKOA 3ZSZA 2RF2B 1JLAB 3KNAA 4CHPA 4CEAA 4DSFA 1NK5A 4FBTA 4IFVA 2RKIA 3OS0A 3S3OA 3RR8A 2FC0A 4N47A 3NF9A 3RB4A 4FM1A 4OPKA 5EWGA 3LP2B 1C0TB 2XGQA 4CJFA 4KI6A 3SCXA 3ZT4A 4DL2A 5KFEA 3PX0A 1S9EB 3AVBA 3O4QA 3PR5B 1R0AA 3KTQA 1TVRB 5KT2A 4OL8A 3EYZA 4OKEA 1ZETA 1U4BA 4NLPA 1S6PA 3MEDB 4E3SA 3LAKA 3E01A 2I5JA 3PX4A 3SI6A 2A1RA 2V4QA 5C42B 2WK4A 1ZBHA 2E9RX 2JEGA 3NF6A 3RMAA 1YT3A 4MKBA 4M3RA 4MFBA 1QAIA 5KG1A 4IQXA 1T05A 3V81B 4DSKA 1KFSA 2UVWA 3HVTB 4ZP9A 4AHUA 4HTUA 2FBYA 3IRXA 1VSIA 3U3GA 3IS9A 3ASMA 4CJ5A 2HNZA 4M3WA 3BGRB 1WNEA 4R8UB 4GC6A 4B9TA 1LWEA 4Y3CA 4O3NA 4DL5A 4Z0UA 4LSNB 5HBMA 3THVA 3DLKA 3QGIA 1J5OA 3LZIA 1QSSA 5L1JA 4N41A 3MFIA 4KB1A 4M3TA 1IKVB 1SL1A 2IJNA 3CJ4A 4CFAA 1NK8A 5KFKA 1ZTWA 1S9GB 4DL3A 4FJHA 3OL6A 3QZ7A 2FBVA 3ITHB 1CSJA 4FJKA 4OKKA 3FSIA 3IGNA 3QZ8A 3EZ5A 4K4TA 3L2RA 3HP6A 3T19A 1FKPB 2C2EA 4CFBA 3DI6B 1LV5A 4ECWA 5EWEA 2WCXA 2QXFA 3OSNA 3QYYA 4R5PB 1RBRA 3MAQA 1XI1A 2XCAA 3SNNA 1K6YA 4CK1A 4AHCA 1CXQA 4OGEA 4GC7A 5DK5A 4O44B 1CZ9A 4IR9A 5HP1A 1U04A 3KLHB 2UVUA 2ALZA 2GUIA 1HQEA 2HB5A 2YHBA 3WNEA 3O3GA 3SQ4A 2QV6A 4NCBA 3TABA 3RR7A 3KK3B 3CJ2A 1S1UA 5DG9A 2VG7A 4NLWA 1NNDA 3ZT2A 1KVBA 4NLUA 1JLEA 3AVHA 3QEVA 2AQ4A 1KFDA 3C6TA 2R8JA 4MKAA 4ZVGA 4J9LA 2HMIA 4IBNA 4W5NA 3HM9A 3BSCA 4IG0B 3LP1A 2V9WA 4IFVB 4YMEA 3V4IB 3DLGB 4FW1A 5F8MA 5DQHA 4J2EA 2E6LA 2IM0A 3M8QB 4H4MB 4J9MA 4NLQA 3K58A 1OS5A 4KHWA 4B9LA 5C25A 5C24B 1JXBA 1WN7A 2HNYA 3KMSA 4CIGA 3LP0B 2XI3A 5KFSA 3RBEA 3T1AA 4ZMMA 3HJFA 4E7HA 2V0NA 4O3RA 4ELTA 2VA3A 4W5TA 5E41A 1RT3A 4CEOA 1SL0A 2KZMA 4FLZA 3MEGA 1JLGB 4EYIB 4CJ3A 3PHEA 3OHBA 4LH5A 4ZP7A 3HSTB 3QERA 3H2LA 3KK2B 4KHSA 4RW4A 3QGHA 1RBUA 1KRPA 2AGQA 2AGOA 4N76A 3PY8A 3AVAA 1GX5A 1XR5A 4DF4A 5EU7A 2Z1GA 3NHGA 5C42A 1HPZA 1BQNB 3AVMA 3AO4A 2FBTA 2GC8A 1VSHA 4M3ZA 1NOYA 3ZSQA 2I1RA 5F8NA 1HYZA 4DTUA 4I2PA 1WSFA 2R8GA 4O0JA 4H8KA 4F4YA 1I6JA 3HK2A 1RBTA 4PUOB 4DFMA 3H59A 2W9AA 3E51A 1N5YA 3OS2A 5HP1B 3MF5A 1EP4B 2GIRA 5DLGA 2ASDA 5KT5A 3DRSB 3NFAA 2ILZA 4KHMA 4CGHA 2EC0A 2YNIA 5JUMA 4KHNA 1TP7A 4B9NA 4QWDA 5KT7A 3OYMA 3EPGA 4UQGA 3GV5B 3SYZA 1JLQB 2W42A 4ED1A 2NUBA 2XO7A 1LW0A 4PWDA 3GV8B 3QESA 3BQ2A 5FROA 3TAMB 1T03A 1MU2A 3CFOA 3NAIA 3KHHA 3F73A 4ECYA 4IDKB 3TANA 4IRCA 4FBUA 1C1AA 2DPJA 5FRNA 2UUTA 5KFAA 2IM1A 2XC9A 4FYDA 4MIBA 3EPIA 4NRUA 1C1BB 3NL0A 3ZT3A 5I42B 1X9SA 1A5XA 4CJLA 4DEZA 2ZKUA 1KCFA 4DU4A 1J5OB 1CLQA 4NYZA 2R2SA 5L9XA 4O55A 1S1TA 2OPRB 1VK0A 2F8EX 1WSHA 2F8SA 4O3QA 4FS1A 1XHXA 4Q0BB 3CO9A 1S0OA 2UVRA 4JLHA 4I7FA 4JS5A 5I42A 2XRIA 2OPSB 1NJZA 4R0EA 3PZPA 4EZ9A 4H4OB 1NJXA 4BDPA 3UR0A 2HHTA 2YNFB 2FVPA 2FLNA 5KG2A 4RW4B 3CM6A 1JLCB 2HHVA 4LH4A 4NRTA 4O3PA 3V9ZA 3DLGA 4DU3A 3HT3A 3OYCA 2Y1IA 3GIKA 2BQ3A 4NLGA 2P51A 4PWDB 1JKHA 1GOAA 4FJNA 3UPFA 4DL6A 4O3OA 4ID5A 3Q8QB 3OYEA 5KG6A 2HNZB 3CIZA 4J9SA 3GILA 1A5WA 5D3GB 3AO1A 4ZPBA 2HWIA 1JLBA 1S1TB 4FM2A 4IH6A 4TYAA 1LWFA 3K5OA 5HRRA 4LQ9A 1R0AB 4NCGB 3L3UA 4DG1A 3QINA 1RT7B 3OYKA 4ZP8A 1RTHB 4O4GA 2KFZA 1KVAA 4MFBB 1S1XA 4RW9A 3VQSA 5K14B 4K4YA 5KG7A 3TAQA 5JS1A 2G8FA 2PYLA 4CJPA 2HNYB 1TV6B 1VRUA 2JLEA 3M9NB 1SL2A 2FVCA 2IAJB 4E1NA 4KHUA 1U49A 4L8RB 3LP1B 2C2DA 4F2RA 2BANB 5KG0A 4FCYA 3KLHA 5FDLB 5KFVA 3HPOA 3H98A 1S1WA 3OLBA 3OYLA 2Z1IA 1TVRA 4CERA 3OYBA 4GW6A 4DTJA 1WSJA 4WFZA 1JLBB 5KG4A 5KFNA 3PW5A 3P83D 4IOBA 4EYHB 4IFYA 4Y1CA 3D45A 3I0SA 3OYFA 1FKPA 1HMVB 3IG1A 2HHQA 3RB3A 1SUQB 5J2MA 4NLOA 1VSEA 4FJ7A 4NLYA 5KGWA 1QTMA 3SJJA 4QWBA 2Z1JA 1G15A 1EX4A 1RBSA 4K50A 3DRPA 1L3UA 1FK9B 3NGIA 1S0NA 4KI4A 2DY4A 1BGXT 4I7FB 3OY9A 3ISNC 1RT5A 1S0MA 3KKSA 3NGYA 3TAMA 1BHLA 2OPRA 1CXUA 4NLRA 4LY7A 5L1IA 4ED8A 3NBPB 5J2QB 4FJGA 4FZYA 4OLAA 4DF8A 5KT4A 2F8TA 3QGGA 2C22A 1REVB 2B6AB 1S48A 1S10A 2O5DA 5F9LA 1C1BA 4DSLA 1Z4UA 4HKQA 5HRNA 3DOLA 1KLMA 1BCMA 1DTQA 4QAGA 5KFPA 3L8BA 1RCHA 4O0IA 4TY9A 2ZE2B 3B6OA 3PV8A 1C1CA 4DTNA 4CHNA 3ZSYA 3O3FA 3GIIA 3CDUA 3RB6A 2IMWP 3I0SB 2ASLA 3U3YA 4YR0A 4JUZA 2D0AA 4FLWA 3WNHA 3NAEA 1IKXA 1L3TA 1D9DA 3AA4A 1QS4A 1YVUA 1B9FA 3VQ7A 3I8DA 1IKVA 1TK8A 2WOMA 4NLXA 1KHVA 1N48A 4DTRA 1BI4A 3HVTA 4I9QA 1TGOA 1RT1B 4W5QA 4DTMA 4Z4EA 4KO0B 1SH3A 1LWCA 4F8RA 1HRHA 5DQIA 4WE1B 5DGBA 4B9MA 4WYLA 3VQ4A 2IAJA 5EUHA 3DLEB 5KFGA 2ETJA 3KK3A 3K59A 5J2PB 1N6QA 1W0HA 2FJWA 3V9SA 1Q8IA 4OKJA 3FFIA 4BDZA 2WHOA 1L3SA 2C28A 5F8JA 1RTJB 4RNMA 2HAIA 1S1VA 2QK9A 3KLEB 3CQ8A 1QUVA 2P5GA 4FK4A 3QIPA 4X2BA 5CYQB 4F3OA 1VSFA 3DDKA 3DM2A 4CJ4A 2QE5A 3KD1E 4KPYA 3P1GA 2G8HA 4N5SA 5DG7A 3VQBA 5K14A 4E1MA 1WSGA 1ASUA 2D0BA 4MK9A 5KT6A 2AJQA 1HYSA 3NH2A 4OPJA 1TK5A 2OPQB 4YR2A 4KBIA 1S9EA 1RT6A 4H4MA 4IH5A 4J9QA 3I5BA 4DWIA 3PW2A 2AU0A 4KV8B 3V1OA 3BSNA 3PUFA 3NCIA 3I0RA 4FJMA 5F8IA 5J2PA 2AWZA 2J6TA 4M41A 4BWMA 4Z4FA 3AA5X 2WB4A 1JXEA 5F8LA 1VRTA 2WTFA 2OPPB 1HMVA 1WSIA 5J2QA 3JYTA 2ITGA 3TAGA 1SV5A 4TSXA 4RUAA 2BGGA 4HUFA 2B5JA 4ICLA 2YV0X 2WOMB 1D9FA 1WSEA 4J2AA 3MEEA 4DTOA 4Q44A 4B9UA 3DRPB 5D3GA 4AHVA 1C0MA 2FLPA 3BQ1A 2YKMA 5DGAA 4JV2A 4ED3A 3TR8A 1L5UA 3CJ5A 1QE1B 1T05B 3PO4A 1JL2A 4EBCA 3KLGA 1ZBIA 3HHKA 3U6FA 1QE1A 4Q45A 2W7PA 3RTVA 3QEIA 4RW6B 4KAZA 1VSKA 3CG7A 3N6MA 4C8OA 1RTIA 1S9GA 4DSJA 2D0CA 2BR0A 1ZBUA 4RW7B 4IG3A 1SKRA 2W9BA 4NCGA 5KFJA 2WONB 1T8EA 1N5YB 3C6UA 3V6HA 2G8IA 1EKEA 1ZYQA 3SQ1A 3BGRA 3I5AA 1EXQA 2OZSA 2IGIA 1HPZB 1LAWA 1XR7A 4QPXA 4KKOB 1RT4B 4DTSA 3VA0A 1RTIB 2KTQA 4DSEA 4Z4HA 3D0PA 1RTHA 4O4GB 3UDLA 4K4XA 1JLFB 3CJ0A 4FW2A 3T5JA 2RN2A 3LWLA 3KJVA 2YKNB 1SH0A 1C0UA 4RW8B 3OYNA 2G8VA 3FFIB 5I3UB 3KHLA 2FVSA 4KE5A 1JIHA 5HLFB 1Z26A 3EZUA 1LWFB 4E7KA 4WFXA 4CHQA 5J1EB 5L1KA 2O4IA 1DTTA 4ED6A 3CDEA 4B8CA 3DM2B 4EZ6A 5KFYA 5C24A 3H40A 3NDKA 3DRSA 1CZBA 1RT2A 2DFHA 2D3UA 3SV4A 2YKNA 4CE9A 3Q8PB 4XPCA 3OL9A 3NF8A 5KFBA 4IKFA 1S4FA 4KHRA 3N6NA 3AVNA 1K1QA 5KT3A 4TLRA 4OLBA 2PYJA 3BSOA 4BE2A 1J53A 2FBXA 5CYQA 2IC3B 4E19A 3OYHA 1X1PA 3AVGA 4K8XA 4O3SA 3V1QA 2AGPA 3AVIA 1Y97A 3S3MA 4DTXA 4HVJA 2DFFA 1U48A 4QW9A 1ASVA 3DRRA 3OYIA 4I9LA 4TYBA 4FLTA 3LP3A 1QHTA 3M8SA 4CF9A 3V9UA 2XHBA 3WNGA 4IR1A 4CCHA 1I3AA 3QO9A 3CVKA 4MH8A 1JKHB 3AA2A 3QEXA 4XO0A 1VSDA 3L3VA 4BDYA 2HNDA 2X6SA 3H5YA 3S9HA 1KLNA 5KFMA 3DOKA 4TQRA 2BDPA 1DTQB 3RBDA 5KRSA 3QETA 4GMJB 4ECSA 1IKXB 4G1QB 3MR2A 2GV9A 1NHUA 4PY5A 4TY8B 4KHQA 3M8PB 2G8WA 3SUNA 4K4WA 4RZRA 1JXLA 2R7YA 4KTWA 2IBKA 1LW2B 1C1CB 3VQDA 2B5JB 4ICLB 5F8HA 3MEGB 1RNHA 1IKYA 2R2RA 3DI6A 1RYSA 1HNVB 3OYJA 2HMIB 3DOLB 4FS2A 4JRQA 1YVFA 4CECA 3IS9B 3GV7B 2VWJA 2KQ2A 2XY6A 1RDBA 4AILC 3QIPB 3GIJA 4CJRA 3KMQA 3TVKA 5SZTA 3RMBA 2VG6A 3NF7A 4Y1DA 1SV5B 3L2QA 2A1SA 1RTJA 3HVWA 4ECXA 4EO6A 4B9SA 4CIFA 2QKBA 2R8HA 3TWHA 3NKYA 2JEIA
chains in the Genus database with same CATH superfamily
2CUYA 1UKUA 5F9NA 1HNWK 2BRKA 1WHXA 2OD4A 4DQIA 3J80U 2ZJQQ 4WIIA 2CH6A 5F2RA 2ASYA 3ISZA 3MMAA 4GRSA 1MMNA 2PFDA 1A7GE 2ZZNA 2AYGA 4LF8K 3VQAA 4TU9A 2UU9F 3T7ZA 2R42A 4CI6A 2OSQA 2VPXB 3U27A 1JLEB 3A5MC 1J9AA 3VTIA 3BEGB 4DV7K 3L2UA 1XMOJ 4QOTA 2HBMA 3P5TL 2OGUA 2EBGA 3QWPA 2HGNA 2OLWA 3VVUA 1NKBA 2ZE2A 4B1UB 5KFWA 4M95A 3PO5A 3LDSA 3J81j 4UQTA 3V6DB 4OX9K 1DT9A 3S7RA 4CJUA 3CPEA 4E7JA 3I82A 4DR3K 2FJBB 4JI4J 1D8YA 4OZ2A 4ZS6A 4LF4J 3CCUN 2YWFA 1TR0A 1RSCA 3HHDA 3DYAB 5D4PA 2AD9A 2HHHK 5IOLA 3DMJB 1S1VB 4CO4A 3G87A 1TKTA 1HWIA 3D3CJ 3DHWC 1KLMB 3TX8A 3VEOA 3ZTOA 2LXIA 4KHPK 4KKOA 2Z1HA 4NLTA 4ID5B 1OY8A 4IWVA 4F50A 2HVIA 2Y0BB 3CWJA 2RD5C 1ESVA 3O6WA 4DMZA 1X9WA 3TU5A 2QWQA 1WC0A 4KFBB 1IKYB 2G8UA 2CWXA 4DR7F 5DDRC 3NNHA 3WDOA 3T5HA 3W66A 4ELVA 4DR5F 3CDBA 5DM7Q 5D6GA 3KLFA 4TXSA 4F2SA 1TTHB 3I5CA 3CCUS 2YXLA 3DU5A 2E88A 2E5JA 1NK4A 1AXQA 4OYPA 4IKAA 4F3TA 4YS2A 1RDCA 1VHFA 4LF4K 4OJRA 1JK9B 3T3FA 2PI4A 2ABYA 2HWHA 1AFIA 3MECA 4DSIA 1HKGA 3UFCX 2BJ3A 5RUBA 2YNIB 4RNNA 2B4VA 2EKYA 2WRMA 1ASWA 4DHYA 2P9GA 2G1HA 2CNKB 4JB8B 2HWTA 3FUYA 2FXUA 1C0TA 2DGUA 5AFUA 4Q8EA 1M1HA 2H5EA 2VPWB 1XMOK 2QA4N 1J5EF 4C98A 1FRJA 3SZ2A 3ATVA 2E66A 2UXBJ 3VWSA 3EO3A 2BZ2A 2NRVA 4JKHA 2FDNA 5GAHP 1X8DA 1YJUA 4GKKK 1IH7A 3W61A 1FERA 3WQTA 3CC4N 1Y64A 3DKDA 5U47A 3D2FA 1ZZNA 2ZC4A 2F4FA 4MMOA 1QZ5A 4IRDA 1S97A 4IFYB 4BG9A 1NH7A 1EX8A 5E5NA 1DARA 3GU0A 4EBEA 4DR3F 3OTEA 3FR0A 2V51B 3HVAA 2MQOA 3ZTRA 2CH5A 3FVYA 3H20A 1RT2B 4K4UA 2HFNA 4TU7A 1PO6A 3CCVS 5GADP 1S72N 4CIEA 5GAEP 3MECB 3CJ3A 4PQAA 2G8KA 2Q66A 3T5LA 1QAYA 4NMXA 1HD1A 2E2QA 5HAOA 2B7BB 3GPAA 2MY7A 4EEYA 3J81O 1A6LA 3CHWA 4Y2CA 4YNQA 1FJGJ 3FJ2A 1UA1A 1C2PA 1C0FA 3IAM9 2KM8C 4CJTA 1NKEA 2AX1A 1UJ5A 3C6TB 3TWZA 4BVPA 2RPIA 1NBWA 2PA3A 1SC1B 4Y28C 4DUZJ 4BRAA 2D9PA 1QUPA 2YTCA 1FDDA 1RZMA 4YQWA 2P9PB 3D2FB 2ZJRQ 3M6XA 4URGA 3E8OA 2VG5B 4OVLA 5HMYA 2HQ3A 3MWTA 4NLBA 2ZEJA 1FK9A 3PW7A 2VH7A 3KG0A 3LALA 4RU9A 3TW0A 3V9XA 3TAEA 2EG2A 1ICEB 3RMCA 3RBZA 3MR5A 2NR0A 1K73T 2H4WB 2QFIA 1R59O 2BX6A 3DYAA 4DV4F 2HHSA 3AQOA 5M1QA 3O3HA 3MCOA 1EP4A 1KVKA 3FK4A 1TUUA 2XGPA 1PYTA 3ENQA 1CJUB 1XBWA 4QCLA 2RQKA 4A47A 3D5MA 2EK1A 3CFRA 4QPTA 2Y1JA 3NS6A 4FXDA 4YB1P 4UY85 5B0CA 2IDOA 4BRPA 4C8LA 4A4JA 4CHYA 3RWUA 4FZXC 2UUAF 1T44A 4FJJA 4OZNA 5IV4A 5LXYA 3P8BB 4Z4IA 3D28A 2P1JA 2OPPA 2W2OP 3THWB 3GE9A 3H4BA 1DLOB 2WBRA 3ET6B 3SAGA 2QO3A 4LRAA 4MDBA 3C6AA 1IO2A 3POTA 1O5JA 1KR4A 3ZSVA 4NLSA 3EXYA 4NEYA 4OFZA 4RG8A 3CC2N 3CC7N 3J81Y 5KRTA 3CCSN 3LP0A 1RGIA 1G3OA 4RX6A 3MPWA 2O66A 2XI2A 3Q83A 4CT8A 2OTJN 4MTPA 1VC6A 3MCNA 3CJAA 3MD1A 3NG8A 3DGVA 1TL1B 1VQKN 2VQFJ 5AQMA 3W8PA 3DNCA 1Q7YT 4F7VA 3LWMA 3RB0A 2BQRA 2UXCF 3C14B 3DDNA 3F0NA 4QIWD 4LR8A 4JKFA 3TNVA 1KWMA 2PZSA 3CT9A 4LRBA 2LSNA 4DR2J 3CQYA 4P2FA 4ILHA 2Q0RA 1QQCA 4EFHA 5AZJB 1WB9A 2E1ZA 4CJVA 3HULA 3MN6A 3O9TA 1WKLA 2OAUA 4NCAA 3GFXA 4EWTA 4FF2A 1WAJA 2UUAK 2MKJA 3M8PA 5C12A 1TMJA 3RRKA 4IG3B 4BCAA 3KLIA 1Q82O 4QWCA 2IHR1 3HFVA 3V4IA 4YP3A 1REVA 1F2HA 3M9OB 1FO1A 2IVPA 3AO5A 1HNWJ 4R5PA 2FYXA 2HOEA 1RA6A 5EX0A 3VF6A 1KC8O 4DHVA 4U7CA 1GOBA 4JI8J 2Z2LA 3AA8A 4KAIA 1TKZA 1NPKA 3U8XA 4CK2A 3GQCA 1T94A 2ROPA 4CJKA 4RO0A 2B4UA 1U1OA 4WFAQ 4B9VA 3US5A 3VF2A 2P6SA 1DLOA 2DBBA 4XIUA 1GLBG 1YJTA 1JLAA 3JTNA 3N5FA 1LWEB 2YNHA 1NG9A 3P4IA 1RTDA 3RMDA 3BDEA 3W7BA 5CHIA 3TA1A 1UP1A 1WF2A 1D3WA 2VQFK 2ZH9A 2LDYA 4CJWA 4UUXA 4IRKA 3VQ9A 2BVZA 3OVBA 2YI1A 4BC7A 2POKA 1P6TA 2DNHA 1NU0A 1X4DA 1JQGA 1Q4RA 5CAAA 1IWGA 3QFWA 5KFXA 6FD1A 2RHSB 1Q86O 3MEDA 3UDEA 3EVMA 1K1SA 5HL7L 2DFEA 3V81A 2CZVC 1HNIB 3CCES 2XG8A 1YXQA 3ZXWA 4Z7YA 3AVFA 4CEFA 4E7IA 2HF3A 1JX4A 1ZAXA 1D4XA 1R6VA 4YFUA 2DTJA 3AD7C 4QS9A 5HK4A 3FZFA 5IQQA 2DCLA 2ZFHA 1FD8A 4C11A 1UAWA 3THWA 2W7OA 3NH1A 5E3QA 2B9YA 1BU6O 1VSMA 3IMXA 2JWLA 4J9PA 2LEAA 2LCWA 1YHQN 1RT4A 1SKWA 4B3TJ 4NYPA 1SAZA 2CPZA 3D3BJ 1U6FA 2P9LA 1U1MA 4HTLA 4RR5A 4X66F 3A3PB 1YITN 3HTVA 1GOCA 3UKUB 4I67A 4CF8A 2JFDA 3IFEA 1R8CA 1S79A 1RB0A 1W9HA 5FPEA 3SQ0A 2RS8A 1DAXA 1F21A 2J9EA 3EWGA 4H4KA 2PEBA 3KFWX 3C3LA 4FJ8A 3MHYA 3KHGA 3PG9A 1FWLA 4HH0A 4M3UA 3G8TA 1KVCA 3I31A 2IM2A 3NWRA 3MM9A 1SPBP 3V6KA 3SFGA 3VOVA 3KLFB 4OHZA 3J81U 4J37A 3AVCA 4WFYA 3KK1A 4CGIA 4JNEA 3ZETB 2LMIA 1WEYA 2DNGA 3F9KA 4QR0A 1T0TV 4O8KA 2ASJA 3DU6A 3ATUA 3R5JB 4GNIA 5B8HA 2JC1A 2BA9A 4AHTA 2W2NP 1JJ2R 2MQLA 1BIZA 2R2UA 1GEHA 4OHYA 2KN4A 1NGDA 3AVJA 1HNIA 5GAEU 1VQ8S 2W1BA 4Z7CA 1LOTB 1FESA 4ES1A 2RF2B 3GB0A 4QJVA 3MX2A 4FBTA 3OS0A 1N8RT 3S3OA 4JOUA 3TZXA 2PT0A 3NF9A 4Y2MA 3M5RA 4OPKA 5MAOA 3UCZP 2Y9HA 5EWGA 1VHXA 4TLQA 2IYGA 2XGQA 2V8HA 3WC0A 4CJFA 3SCXA 2FHMA 3E3XA 5KFEA 4ZLNA 4OHXA 1C4CA 1P9YA 2F8MA 3EYZA 2IYIA 1U1RA 4OKEA 2GZOA 1U4BA 2FTRA 1J6ZA 1UPPA 3CCQN 2O01C 2M2BA 4BBYA 1DJ0A 2I5JA 1HHSA 3CC2S 1WHYA 5DDPC 2W41A 5C42B 2WK4A 4PR6A 1YT3A 2VOOA 2BEFA 2J9DE 1QAIA 1OH5A 5AR0A 1CC8A 2UVWA 3HVTB 2IJRA 2ROGA 4FF3A 3QBXA 3J7AP 2FBYA 1NPRA 3IDHA 3U3GA 4YOXA 1HNXJ 2HSTA 2FGCA 4NWBA 2IVOA 2QXLA 4R8UB 1IJJA 3QJLA 1LWEA 4LFCF 4Z0UA 3CJ1A 2F5GA 3VEYA 5C15A 3DLKA 3LZIA 3MN5A 3TJ8A 5HMZA 1HW9A 4X64J 4M3TA 3EGZA 2DNLA 5KFKA 4E8UA 3DCAA 1ZTWA 4L6V3 4FJHA 3HI0A 4DUZF 4ZJOA 3ITHB 1CJKB 4JBCA 3FSIA 1MLAA 4UY8T 2DJWA 2FSJA 4UZCA 3T19A 4QU7A 3BBBA 1Q7YO 2L41A 1NWKA 3OBYA 3OSNA 3QYYA 4X62K 4R5PB 2VFSA 4K0KF 1B0PA 2HHHF 1XI1A 2IDLA 1NLVA 1ZC6A 1K6YA 4C8ZA 2BH1A 3FNNA 4AHCA 1CXQA 4OGEA 4FYVB 1J2VA 2ZDPA 4QIGA 2QI2A 4IR9A 3OV7A 3WXIA 2VQEK 2VC0A 3UI3A 4NL5A 2ALZA 2YHBA 3WNEA 1M5HA 1VJQA 2RNEA 2P2CB 5GMKa 3CF5Q 1XEZA 3H0PA 5DG9A 2VG7A 1MROB 3VENA 4NLWA 2ZH1A 4MAKA 1YITS 1T9WA 1ZOTA 1QM9A 2AQ4A 2PFFB 5K8PA 4Y2IA 1CQMA 2KU7A 2JNJA 4MKAA 1NO8A 3AOBA 2QA1A 4YOVA 2QL7B 4LF2A 4DV2J 2XM3A 2B7CB 3WXJA 2OI2A 4IG0B 4WP8A 4OYBA 2RQMA 2AJ1A 3P3DA 1GXTA 3VALA 3LP1A 2V9WA 1S5ZA 3VZHA 3VAJA 4DB3A 2R4FA 2HHHJ 3EGWB 3PXGa 1IN0A 5BXIA 1KC8T 2QSWA 2OIHA 3DLGB 4FW1A 4USUA 1VIOA 2X1FA 4J2EA 2UUCJ 1K73O 2UXCJ 3A8YA 4H4MB 2X7IA 5HVHA 4J9MA 1OS5A 2P9PA 3SCKE 1JXBA 1WN7A 1Y11A 3DXMA 1VISA 3GSDA 3HJFA 2QT7A 3W9IA 3IR5B 4C3LA 2VA3A 1OH8A 2CQBA 4FVUA 4WP9A 1SL0A 3MEGA 4H5WA 3SQGA 3ID8A 4ERDA 4ZP7A 1NGHA 1VC0A 2ZGYA 3NCQA 1KRPA 3PY8A 4ANDA 4ZN3A 2D4WA 2V63A 2XZDB 5EU7A 1N5QA 2P9KA 4KGZB 4M3ZA 1HYZA 4PG4A 3CD6N 4O0JA 4KH6A 2MZQA 4IOCL 3H59A 5TKWA 3MURP 4CW7B 3OS2A 3MF5A 1E6YB 1XERA 5DLGA 2CFXA 3DC2A 5KT5A 3DRSB 3QWUA 2UP1A 4CGHA 2YNIA 1JJCB 3VAHA 2AP6A 4KHNA 1Q8KA 3IC1A 4B9NA 1H98A 4QWDA 5KT7A 3IWNC 4UQGA 1AB8A 4BS2A 1VLOA 3SYZA 4ILRA 4LF6K 3C19A 2NUBA 1RI7A 2XO7A 4PWDA 1GXUA 5FROA 3TAMB 1G6BA 4JI2F 1R0CB 1H2TZ 2E1CA 3UN2A 2U2FA 4AXIA 2KG0A 3O5TB 4OX6A 2DPJA 5AQQA 3LGMA 3EPIA 4NRUA 3RAMA 4CH1A 3CDAA 1KCFA 4AYBD 4OI3A 2HZCA 1CLQA 2R2SA 2C3PA 2H9ZA 5L9XA 2RU3A 1NGCA 4CTAA 1S1TA 1VK0A 2WBNA 1U0HB 3HMJG 2LQBA 1WSHA 1XHXA 4WIQA 3CD0A 3CO9A 4NXMK 4JS5A 4USWA 2V8DA 4DX6A 3V4MA 1XMOF 1LOUA 2OPSB 4NXMJ 5GIPA 1NJZA 3PZPA 4LC9B 4H4OB 4HDGA 3CC7S 3UR0A 3ZZPA 2YNFB 2BBEA 1VC5A 4RW4B 3CM6A 2UU9J 4NRTA 1PBAA 4GKJK 3BH7B 1SBRA 2RUSA 5HL7Q 5DS7A 4NLGA 3J80Y 2CA9A 1JKHA 5FPDA 1IUJA 4O3OA 4B3RK 3CIZA 3M32A 4ZPBA 2HWIA 3W0LA 4TYAA 3GYGA 1R0AB 4NCGB 4WQ4C 4DPYA 2UXBK 4WQ4A 2OCEA 2OTJS 1RTHB 4MFBB 1S1XA 5K14B 2MJNA 4YHHF 5BREA 2G8FA 2KVQE 3T1YF 2MZJA 3R27A 2JLEA 2V2QA 4I4BA 3X3UA 3WEEA 3K0SA 3LP1B 2JSXA 3KLHA 4CLFA 3G96A 4Y00A 2XS5A 5IT9U 4PYAA 3OYBA 4GW6A 2UXBF 4WFZA 1RHRB 3GWCA 3UD5A 4AQYK 3PW5A 2DIUA 4EYHB 2R7OA 1UPMB 3AAQA 4Y1CA 1VDHA 3D45A 3HZGA 3N0VA 2OANA 3NS5A 3OW2M 1YDLA 4P2XA 3M2RB 1SUQB 4M7YA 4KPCA 2PC6A 1OQ6A 1GXLA 3VHQA 3MR7A 4PXBA 1HUXA 3NGIA 1S0NA 2ZBPA 3ISNC 1PIEA 1RDUA 1S0MA 4HI2A 2PE8A 3NGYA 3TAMA 4B3SJ 1HLWA 2ZVSA 3UNYA 3SSQA 1TL7B 4NLRA 1CZAN 5L1IA 4LY7A 4ED8A 2DNKA 2WVEA 5F3TA 2ZWPA 1RGVA 1HBUB 3VPZA 3ZFVA 4XAKA 3QGGA 2C22A 1AUSL 3ILJA 3J7A1 4HKQA 2CIMA 4IEIA 5HRNA 2KYXA 1T6CA 2PAVA 1RCHA 4O0IA 1FRLA 2GWKA 5L46A 5LMUK 1RAHB 3ZSYA 2WW8A 3OTBA 5EOYA 3FMBA 4ZVOB 3ZC4A 3O3FA 1MSWD 3RB6A 1HHTP 3I0SB 2EW9A 2O8DB 4FLWA 2C2MB 3AARA 3HDSA 4RBTA 2PIIA 3W5YA 1D9DA 4M5LA 1CULA 4CYUA 3VAFA 2MSTA 2V2KA 3VQ7A 2QN6B 1TK8A 3FCHA 2WOMA 5K9FA 1N48A 1WEXA 3U1MA 4DTRA 1RWKB 1GLLO 3G25A 1OVQA 4W5QA 1S99A 1F5CA 4KO0B 2IIHA 2V68A 4I6WA 1KQKA 4JI4F 1SH3A 3AY0A 1HRHA 4USJC 2G2ZA 3WXLA 1Y9OA 2CWKA 3VQ4A 4DR6F 5A6WA 5A8RA 3KK3A 1N6QA 1W0HA 2FJWA 1Q5YA 1GH8A 2GNKA 4OKJA 3FFIA 2Q43A 1FTCA 1X9JA 2C28A 3H46O 2DK2A 2FUG9 1RTJB 3UWTA 2OKQA 3C16A 3D1OA 5FPMA 3ENAA 1S1VA 3CQ8A 3U9DA 1VQMN 1IXKA 3AT1B 1VSFA 3DDKA 3DM2A 3OUYA 4CJ4A 2DIVA 3VQBA 2H4YB 2GVDA 5GVQA 5E3CA 1P1LA 4DV1J 4CLSA 4G1IA 2AJQA 3C15A 2H48B 5ADXA 3VGTA 4X4OA 3NH2A 4OPJA 1TK5A 2OPQB 4YR2A 4XEIA 4KBIA 3KWMA 4DWIA 3CNQP 3PW2A 1U2RA 2P5VA 1PG5B 5ETOA 3T69A 3Q2SC 2LA4A 4FJMA 3EICA 3RUBL 1BA0A 5J2PA 4DR2F 3HOSA 4Z4FA 3AA5X 4MO4A 1YJNN 2WTFA 4LF6F 2SXLA 3ILOA 4MKYA 2BGGA 2KT3A 1SS6A 1WSEA 3LH2S 4J2AA 1PYOB 3MEEA 2VQFF 3GONA 1H2UX 5D3GA 1XC3A 1C0MA 2GX9A 1GMUA 4JV2A 2CGKA 4RL1A 3TR8A 5HMXA 5LSOA 2NNWA 2EFQA 4X62J 1QE1B 3PIPQ 3U6FA 2F3JA 2W7PA 4IOCQ 5K20B 3QEIA 1D8ZA 3N6MA 4X4SA 2YQ1A 1S9GA 3OD2A 4DSJA 2D0CA 5F0UA 4RW7B 4IG3A 1SKRA 1SZ2A 3ADAC 2RIJA 5E26A 5CQGA 4PXCA 5D15A 2WONB 4C1NK 3C6UA 3W60A 2G8IA 1EKEA 1ZYQA 3SQ1A 2NRZA 2CDRB 4Q2LA 5AXNA 3P45B 4J5OA 4FF4A 3BF3A 3H2UB 1Q79A 1SCJB 1RLDA 2DY9A 2ZOFA 2DR9A 1LAWA 1HPZB 1EO1A 4QPXA 2QA2A 4DTSA 3DAWA 1RTIB 2KTQA 4DR6K 1RTHA 2GMLA 2YH0A 4F67A 4FW2A 1JLFB 2DXFA 2RN2A 1VBZA 3LWLA 2OMOA 1RWOB 4W4MA 4RW8B 4GVBB 3OTOF 3BGUA 5K8MA 3KHLA 2FVSA 1ROFA 5CD4A 4OYIA 1LWFB 1RTZA 3ENWA 4NOHA 5B0FA 1I3OB 5AE3A 3DN9A 3I55N 2JH3A 4KY3A 3P49B 4EZ6A 3RU0A 5KFYA 3H40A 1FVQA 2NS1B 1RT2A 5CYJA 3ENVA 2DFHA 1E6VB 4LF9J 2D3UA 3SV4A 2HQDA 2YKNA 3GSIA 3NF8A 5KFBA 4IKFA 1L3KA 1S4FA 5KT3A 1RWXB 1F6TA 1BQXA 3WX4A 2MKCA 5IC4B 3KUEA 1QHAA 4I6MA 4LIRA 3AVIA 1Y97A 3S3MA 4DTXA 2DVIA 3FZKA 3QT7A 3O1BA 1ASVA 2VONA 2AV5A 4XH4A 5AJ3K 3EDQB 4FLTA 3V9UA 5EXWA 2DNZA 4LBIA 4JI0J 4IR1A 1I3AA 3ZZYA 2JFKA 3PJ9A 1VQNN 1URNA 4XO0A 3OA9A 4K25A 4BDYA 2X6SA 3I56S 3S9HA 4LF8F 5BR8J 4FWNA 1XNQK 3A8KA 2BDPA 3RBDA 2E1RA 3OTOK 3QETA 4LRDA 3OXFA 1E3MA 1IKXB 4G1QB 3MD3A 1YSJA 2RJZA 1EAYC 1NHUA 3OFFA 1NMNA 3M8PB 2G8WA 3IBFB 2LYVA 1JXLA 2IBKA 2B5JB 1JXVA 1RNHA 2R2RA 3DI6A 4I6AA 2NPFA 4FS2A 1YJVA 2MGZA 4CECA 5LJWA 4J90A 2VWJA 4WBFA 2QFJA 5DZ6A 4KHPJ 1VQPS 3D2EA 3VMFB 3PRBA 3BM7A 4AILC 2L3MA 4X4RA 2A6OA 2J7KA 3TX0A 4FPRA 2NUHA 5A8WB 4O5FA 2UXDF 2VG6A 3NF7A 4Y1DA 3HVWA 4EO6A 2QKBA 4YUDA 3P31A 3O3LA 2QGFB 4G65A 4H5NA 1RYRA 4BRIA 4CLYA 1NSPA 1W2BR 4FKYA 3BH6B 4DV3F 3Q8SB 5L1LA 4GVLA 1GMWA 3U4LA 5AQZA 3UKRA 5EVZA 3NE6A 1XMQK 2UUCF 4E1JA 1W7AA 2CPFA 2Q3SA 1UZHA 5E3PA 3BEXA 1LW2A 5KAKA 3BJYA 1K8AO 4OJGA 3J8AA 4X4UA 4UTGA 3KLVA 4G1PA 1H72C 4A48A 4CBWA 3CCJS 3O1LA 3JSBA 4DS4A 1NH8A 3R6MA 2KM8B 3HL8A 3OQ2A 5H9FK 5HI7A 3BDPA 5CZVA 3MCMA 2DYAA 3Q24A 4DV2F 4LFBF 5GAHI 4BC4A 1HYSB 1DQ9A 4YR3A 4F4ZA 3ZX3A 3ZO7A 2NZTA 4DBQA 2HBZB 4CHOA 1W2IA 4PRFA 1I39A 3TAPA 2Q1LA 2D1KA 2CJBA 3MWPA 2HVHA 3M6VA 1LWCB 3GOIA 4DFKA 4LF5F 3AO3A 2YHAA 5B0BA 2VFRA 3C95A 4NX9A 1UWBA 2YH1A 2OEJA 1BCOA 4FJIA 4AQYF 1NRKA 3R7NB 2CGLA 1M0SA 5A2QY 4L74A 1VQLS 2IVMA 3PYDA 3M6WA 1RBVA 3MCSA 3W3DA 3ZLJA 4N7TA 1YBUA 2HRYA 4FNHA 2MHNA 4WPAA 4ZPAA 2DNRA 2ZM6K 2CJQA 3VV2B 1RWWB 4WE1A 2RDIA 2WFBA 3GJTB 3PFEA 4PAAA 1MWYA 2Z2ZA 2V4JB 3QO9B 1D5AA 4HT7A 4OQJA 5KFDA 3TUPA 1LQ9A 5CH7B 2L9NA 3HVRA 2DD8S 3KG1A 1QJHA 5AXMA 4CGGA 3AY9A 1GMWD 3T1HK 4WKRA 2KHOA 2KHDA 3O8WA 2MLZA 1WAFA 1HQUA 3MN9A 1E4GT 2D41A 4DFPA 1HKBA 1SC6A 3PR4A 4FK2A 2JZ5A 3NGZA 4LUBA 2HK3A 1NJWA 1LAVA 3CD7A 4WYBA 3TTFA 1PAEX 3VGMA 2E9TA 1RBLA 4DX7A 3VAMA 4W5OA 4WF9Q 1QSLA 2W2PP 1QD1A 1XNRK 2HS3A 4A5BA 3CQXA 4HUGA 4CP5A 5JVGQ 3G6EN 3QLHA 5HQLA 4HHTA 4CBUA 3HD2A 1N8RO 4LREA 1IR1A 5LMNJ 2G4BA 2HQCA 4B1XB 3MM8B 3UDVA 2B4PA 2KDOA 4H4KC 1XWLA 1TYQB 3I9V9 1GX6A 5CY4A 4HHUA 3BBFA 4ED7A 3VN5A 1Q9XA 5GMDA 4WFBQ 3KHRA 3OW2R 3HSCA 4M94A 3FRYA 4KT0C 4DR1F 1P90A 1TKXA 1C0UB 4RW6A 3SMSA 2HFVA 4DLEA 2HKEA 4BREA 4DCOB 3K57A 3VEXA 3KLGB 4HDHA 2VA2A 1IBCB 1NDKA 2OH2A 3OSPA 4JV5F 2Z0GA 1WI6A 4QS8A 2Z56B 3ZSOA 1QSYA 3MM6A 2FHKA 4BC5A 1X5OA 1X7VA 1R8PA 4C11B 3R7SB 3CD5A 1FKAF 2R7RA 3W2WA 1AROP 4ZIVA 3ZSRA 1FXXA 2B8PA 4OZ3A 1T3NA 2OP5A 2CRLA 4DU1A 5HLFA 2C2RA 1Q5VA 4KTZA 1XR6A 4KV8A 4JYAF 3E66A 3NVMA 4IO9L 4F02A 4CEEA 2R7UA 1BL3A 2EHGA 3G71S 3RRGA 5J2NA 3FDSA 5F41A 2V8VA 4ELUA 1YI2N 2O4GA 3TSPA 2RE1A 2MKKA 2ZOGA 1FFWB 3OFGA 4I6YA 1S5JA 2D1CA 1YTAA 3GJQB 3DXMB 4LFAK 5AQGA 3ZX0A 4C1NI 1ZBFA 2DRDA 2B43A 3EE8A 3KJFB 4O5BA 1NJIO 4J9VA 4OV6A 2R7SA 2DCUB 4XTTA 3IFRA 3IO1A 1SKSA 4W98A 2VG5A 1RILA 1RQ0A 4CEQA 3GCWP 1HL6A 1HJOA 2QMUB 2FF3B 1BC6A 3OT9A 2XMJA 2I6WA 2N3OA 3PYFA 4RPFA 3F2KA 3UVJA 3A3NB 3S41A 4ECVA 3H7HB 3Q89A 3MR6A 5KPRA 4TY8A 1KN6A 4LD0A 4JI7J 1IKWA 1QAJA 1E6YA 2IIRA 3AVLA 2Z30B 2N82B 4P72A 2ZJRL 3PX6A 2Y1RI 4N8NA 3ZZOA 4JD2B 4ZPVR 1KSPA 3T6BA 1UWBB 3SQGB 1VQKS 1RWUA 1ZM2A 1HQUB 1TL1A 4GKJF 2F7TA 1AT1B 3CCWA 1HWJA 2WBMA 4IJAA 1UEVA 1N33F 4I2QB 3TZYA 2D9OA 3GL1A 1CJVB 5KTQA 5CYMA 4F0KA 1SJFA 2L48A 4CO5A 2RAQA 3WXKA 4MO5A 2QC3A 5IFMA 1VQMS 2GVDB 1VCTA 3M2UA 2E8AA 5AQJA 2GQQA 1FE4A 4ZTFA 3OYGA 5KFCA 1NEEA 4AXJA 2APOA 1WBDA 1T7PA 1EKSA 2M9KA 4HACA 5IWAK 1RT1A 3GFYA 4IOXA 3DMJA 2CQ4A 5KI6A 3WHIA 4ISGA 4MQ3A 2XHCA 4RJVA 4USKA 3WBZA 4ZN1A 4ECQA 1N33J 4LF7J 3K5MA 4AT1B 1F1BB 4G9ZA 1HNVA 5AZJA 2VG7B 3GIMA 2FZCB 1RBOB 4DR4K 4EP4A 3GTYX 2NQPA 4ZLLA 2BM1A 2HHUA 5A0YA 3DJCA 2MQNA 4RW8A 4GVBA 1OY9A 5DQGA 1B9DA 2VB6A 4A8OA 4Y34A 3MUVP 5FDLA 1AZSB 4CIOA 3HPGA 2BQUA 5HRPA 1Q81O 3VQEA 3BB5A 3CJSA 4CF0A 4NA1A 2ZQBA 3MM8A 1X9MA 2CPYA 1U09A 2O3DA 5HO4A 1BO5O 2BJDA 1VQ4N 5AE1A 2NXNA 5HBMB 4JI8F 1AUDA 2YHWA 1VSLA 5H9EJ 2RDDA 3ENBA 4GVMA 5A8KB 2EFOA 1PJ6A 1N54B 4CEZA 4QWAA 3LOUA 2HHWA 3QEPA 3OHAA 4X4NA 2NRTA 2XB2D 5DLFA 2E5IA 1PKUA 3LAMA 1NB7A 5GAEI 3KKRA 1B0VA 2NXUA 2DXDA 2HQIA 3PVXA 3PW0A 3IGVA 4K43A 1OKJA 2I0XA 1RDWX 3UIQA 5D0EA 2IA6A 4B08A 1YRUA 4A8KA 1BISA 4ZVFA 1FNXH 3SUOA 5HANA 2XZTB 2MXYA 3FGUA 1SIZA 4M45A 3Q7CA 2YNGA 4K2XA 1KHWA 3LANA 5LT5A 3SCLE 3QNNA 3H8YA 1T9XA 3D7SB 2NUUG 2HZAA 3ILIA 1EHWA 1U47A 3CMQA 4JYAJ 4M3XA 3BO3A 4QWEA 1MA9B 4KREA 2BABA 1NM1A 2P8IA 1X4EA 2IC3A 2JGUA 1BWEA 3S8SA 4DL4A 4E0DA 4MT1A 4PL7A 2NCKL 5I3UA 3FQKA 1YUWA 4IYQA 2OYQA 1S6PB 1RKIA 1V4SA 2WAQD 1S1WB 3ZZTA 2OELA 1YTYA 3MK6A 1NZ8A 2MB0B 2LU1A 4H4OA 2ZH3A 3R8YA 4X66J 2KZZA 4FWLA 1VFJA 1W26A 2DGVA 2Q1NA 4QOZB 2P9EA 1N56A 2GIQA 2AA4A 3OJSA 3FFKB 3QEWA 2ZZMA 2WONA 2D7SA 2MZSA 2GEMA 5CZ1A 1H3DA 2LVWA 3AJ2A 1GLCG 2EPIA 4BE1A 3KJVB 4QIVA 2MQQA 4K8ZA 1NK9A 8AT1B 2UUAJ 3O8MA 4K4VA 3BYPA 3ZZZA 4HCBA 4E7LA 1WLJA 2OPSA 2F9DA 5KFQA 4J2BA 1NHVA 3TZZA 1DQ8A 1RDDA 1OWXA 5LMNF 1HNZF 3WT0A 1U8WA 2UXDJ 3TJAA 3W5XA 3EGVA 1HHQA 2KB2A 3LTOA 4CF2A 2V67A 4FKXA 1M5OC 1ITGA 4CZFA 1VQ5N 2W4PA 2B3TB 2WSFC 3DRRB 2ATLA 2N7YA 4WK3A 2JLFA 3S6EA 3G0ZA 4MKVA 1S1UB 3T5KA 4FWRA 2XLKA 3MXHP 2P9IA 1NZAA 3SI8A 4HHJA 4AFFA 3LM2A 4JS4A 4OHWA 3KYLA 4USTA 5LXRA 3TRGA 3MEKA 3OS1A 4FVMA 3ZZRA 3I87A 3JAMY 1VQ8N 2LKZA 1FNOA 2B4JA 4Z4GA 1NK6A 3H1QA 2HURA 2WW4A 3J7YI 4IUFA 5FPNA 2AEFA 3DFEA 5BR8F 3VZIA 5MLCV 2OO4A 2HNDB 2FY1A 5EX5A 2QLFB 2K06A 3TSQA 2ILYA 1MG7A 4AHRA 5IT9O 5EGYA 2N4DA 4HH1A 4TN2A 3ZETA 1RAJA 4DPTA 1S3XA 4FNIA 1QY7A 2YWKA 1BQNA 2HLUA 1TAQA 4RWXA 4CFDA 3DLHA 1C6VA 3LZJA 2CNOB 2QWPA 2JRSA 4AH9A 4DXLA 3P4UB 1TL5A 2H51B 4FOIA 3L4BC 2DGWA 1X5SA 2A6AA 2G13A 3KNAA 3TUIC 2WSEC 4DSFA 1NK5A 4CEAA 5LMNK 2FC0A 3OVSA 2AHOB 3J7AN 4RBVA 1B99A 3LP2B 3SAHA 3G71N 1C0TB 2O67A 4KI6A 1IBMK 3AVBA 1O0PA 3PR5B 1R0AA 4PPDA 1PCAA 4DL0C 1LK5A 4OL8A 1ZETA 2UYTA 4UOGA 5L8RC 3N28A 4A5AA 2LEBA 4E3SA 1QQOA 5G0RB 3MM5A 2QLXA 5C2GA 3QMLA 5KG1A 3HCXA 1VQNS 4GV6A 4DSKA 3TUJC 1KFSA 4P75A 5AQYA 4KGMA 1GFWB 1VYAA 4HTUA 1Q82T 3A3OB 3IRXA 4IO9Q 1VSIA 2UUBK 3JQKA 4AL6A 3NXZA 1R8HA 3NGRA 4YOEA 3ASMA 4I64A 2K7JA 1PAUB 4EU0A 3O08A 3BGRB 4GO5X 4B9TA 4BC2A 3U02A 4Y3CA 4O3NA 3QGPA 1ZM9A 4PPZA 1J5OA 5L1JA 4KB1A 3W9HA 1VQ6S 2ADCA 4ATNA 2IJNA 4L3NA 3CJ4A 4CWBA 4LFAF 3DLLQ 3EUNA 2DHXA 1CSJA 1NB2A 1G2EA 1JJ2M 3L9ZA 3WXMB 4RUHA 4LVOP 4U7BA 5E2QA 1H38A 1DKGD 4ISEA 2G1DA 3EZWA 3JQMA 2QWNA 1FKPB 2NRXA 1JB0C 5EWEA 2WCXA 4BVOA 2G0JA 1UJ4A 2KVIA 3K89A 1RBRA 2MDAA 4DZ6A 2E29A 3WIVA 5B09A 3LDPA 4CYUB 2V7ZA 1RHUB 1LK7A 4HT5A 4O44B 1Z1ZA 3MMCA 3VESA 2HEKA 3BY5A 4LF7K 3MAHA 3O3GA 3SQ4A 2QV6A 4ED5A 1UWAA 5C2DA 2C3OA 3TABA 3MDQA 1S1UA 1CLFA 3R5GA 4WFNQ 1NNDA 2RB7A 2HYIB 4UW2A 1JLEA 4KQZA 4TU8A 3O4WA 5D4OA 3BF1A 1UVJA 1KFDA 2CGJA 1KVJA 3EM1A 3GP9A 4PG7A 3PIPL 1WBBA 1LNQA 4HR2A 3OVAA 4ZVGA 4J9LA 2HMIA 3CXCM 3PTWA 3BSCA 5AT1B 1XNQJ 2ZDOA 3W8GA 1Y5IB 4IFVB 3VEZA 1GMVA 3JXOA 2CJYB 3W1YC 4FSVA 3GJRB 5DQHA 4YDXA 2OFGX 1D9AA 3M8QB 1T02A 5GAHU 2DHSA 4NLQA 2F4VF 4H0TB 2Y8WA 5C25A 5C24B 3EMTA 4OI1A 4CIGA 4CZIA 3LP0B 4LFBK 3Q22A 4ZMMA 4E7HA 1VQSA 3M2UB 1TUVA 1RT3A 3UD4P 4LFCK 5LJVA 2H5IB 4FLZA 5H9FJ 2YPZA 2DR5A 2A42A 3OHBA 2VHGA 3E9PA 2CPDA 4DKWA 3HSTB 1Q7LB 1XK8A 5C2CA 4JI2J 1U1QA 1WORA 2G2OA 3G82B 1ZA1B 3P96A 3AVAA 1XR5A 5K8NA 4UT4A 1HPZA 3AO4A 2IVNA 2GC8A 2OD6A 4X4PA 1UL3A 3TVZA 4H8KA 4F4YA 3OHRA 1I6JA 4DFMA 1DZ5A 2W9AA 3SCJE 2UXCK 3NWGA 1N5YA 4N77A 1SIWB 2IRUA 5HP1B 1HBOA 2GAHC 5AQFA 2ZVIA 3LO3A 5LJ5Y 2ASDA 4K0KK 5AQWA 2EC0A 3BYRA 2NPIA 1J5EJ 4JK8A 4DUYK 3EPGA 1N36F 2AJ0A 4DZDA 4UOCA 3D6FB 2W42A 2HVDA 1B4SA 3GCXP 4NASA 2JOQA 1FJCA 1MWMA 3BQ2A 1NDLA 4BQLA 4KH1B 3M6UA 4GV9A 3WQPA 3KHHA 3F73A 1SQFA 2P9LB 5A76A 4IDKB 1GAOA 3TANA 2HAFA 1C1AA 2UUTA 4WKYA 5KFAA 2IM1A 2XC9A 3CE8A 3H6EA 1C1BB 4DV4K 4ALZA 3NL0A 3AXKA 4BRMA 5I42B 2EK6A 1A5XA 1Q16B 3K8WA 4DEZA 4DU4A 1J5OB 1N36K 2IMOA 3D1HA 4ZVUB 3FEZA 3QQCD 1YLXA 2PMHA 2BJ1A 3NGSA 4FXWA 2A41A 1KQSM 3R3TA 3MOJB 2HGMA 3AB2B 4OV1A 3RVCA 4LH4A 1YRXA 4O3PA 3DLGA 3NMUA 3GIKA 3R1XA 2P51A 1PJ5A 1IG8A 2AJ2A 4DL6A 2YWGA 1FXLA 1WC6A 2HNZB 1CJTB 5A6PA 4ZOSA 1UVIA 1UJ6A 4QR2A 4UOHA 4FM2A 4LQ9A 4A8WA 2B0GA 2GUPA 1KKHA 4USMA 1QQNA 4JK9A 5AQOA 2ZH8A 3QINA 5D77A 1CULB 2KFZA 3VQSA 4RW9A 1WG4A 3IWLA 3TSUA 2VPYB 3TAQA 5JS1A 5BJRA 3G9CA 2H65B 2X51A 1Q1KA 3M9NB 1TV6B 3LA0A 3O44A 1SL2A 3HBTA 4AM6A 4K0KJ 3QSYB 2F4VJ 3FEYB 2RVJA 3AH6A 3B54A 4CT9A 2C2DA 5KG0A 2E2PA 4FCYA 5FDLB 3OLBA 4MJKA 4B3MK 1KS2A 4QYZJ 4AF1A 2HF4A 2GO8A 4FWOA 1P8ZA 1U2CA 4ILMA 1YWXA 4DTJA 4NXMF 2CQIA 5KG4A 4ZCIA 3IA0A 3C6HA 1NXIA 2Y0SD 4WFBL 1OY6A 8RUCA 4IOBA 1ZBTA 4DR1K 4IFYA 1E4FT 4DUZK 1Y7PA 3I0SA 4JI2K 3OYFA 1H7XA 1T9YA 3O1WA 1VS3A 2RQ4A 4M7XA 4HEA9 3RB3A 1OJ4A 2XNQA 4NLOA 1VSEA 4NLYA 5KGWA 4LFCJ 3SJJA 1ULRA 3R5AA 3WUHA 9RUBA 4K50A 3DRPA 1L3UA 2DNNA 4PG8A 1FK9B 1HNXF 2O8DA 5L38A 3A13A 4KI4A 2DY4A 4I7FB 3OY9A 3H2VE 3KKSA 2XSFA 5AQHA 2BOPA 3KXDA 3CJKB 1CJUA 5L9NA 2OPRA 1CXUA 1U1LA 3NBPB 3VAGA 2Z2MA 4FJGA 2B6AB 1S10A 1S48A 1C1BA 4M8LA 1Z4UA 1UVMA 3MWBA 3DOLA 3AJ1A 4H0YB 1NUEA 5KFPA 3L8BA 4DDFA 2MQPA 5HJYA 3P6YC 2F9TA 5FD1A 4DV1K 3CPWR 1KAXA 2BTFA 5HSPA 3U3YA 2KKZA 2ZUGA 4JUZA 3D54A 1IKXA 1N5VA 1L3TA 4I69A 2DNMA 3ONQA 1H73A 2ZBQA 3TJ9A 1QS4A 1YVUA 1Q95G 1B9FA 3I8DA 4XH5A 1M1KO 3D9BA 4ZVRB 3FLCO 1RLCL 2KXFA 1WOSA 4K8RA 3HVTA 1U2VA 4BR7A 5KPZA 3VR1A 1HR0J 2WZ1A 1WG1A 4P74A 5DQIA 4WE1B 4Z94A 4JEPA 2V2VA 4ZIWA 4LMZA 1ILYA 3DLEB 4Z2XA 2LXUA 3FSYA 1IM6A 3D2WA 2VFVA 3K59A 4BHQA 2M88A 4JYAK 4KBOA 4RNMA 2J7UA 5KOXA 2WVDA 1SC3B 2CJXB 5GADU 4X2BA 4F3OA 3MTJA 2CNNB 3KD1E 1W7WA 4KPYA 2G8HA 1VHIA 4Q7AA 4N5SA 1RAAB 4E1MA 1CEZA 2D0BA 3PEJA 1CS4A 1VK8A 3UN3A 1V3ZA 5LL6d 3MAAA 4CBXA 4OPAA 2YQ3A 1S9EA 1RT6A 4H4MA 4IH5A 1U2FA 1V4TA 5ADZA 2M4MA 5F1XA 4KV8B 4DV1F 3C2PA 3BSNA 3SK3A 2WC9A 1VLYA 3NCIA 4KH5A 1N33K 3R7BB 4E2FB 1KNZA 4BC3A 2V52B 3N5BA 5T41A 2WB4A 1JXEA 5F8LA 2OPPB 2ITGA 4USHA 1RABB 2VOPA 4ICLA 1HBNA 3WIUA 5ETQA 2WOMB 1D9FA 4EHTA 2ZJQL 1T95A 4Q44A 3ULHA 4WJBA 2RRAA 1VQYA 1X5TA 3DRPB 3BQ1A 1QAXA 4DV6J 4B3TF 2GV1A 5DGAA 2GTDA 4JI3K 4I56A 1UETA 2NZCA 2FSKA 1DFDA 2RHQB 3OR2A 4U95A 1ZBIA 3HHKA 2IDEA 1QE1A 3CCMN 3BKUA 3LUYA 3AODA 4RU2A 4KAZA 3ULEB 2W4CA 3RW6A 1RTIA 2X3GA 4R0JA 1IWAA 4FYXB 3S1TA 2AP1A 2QWOA 1ZBUA 1OYDA 4CZJA 3UVJB 5CABA 3KUHA 5AE2A 3RYLA 2E44A 3W62A 2GGPA 5CE3A 2R7XA 3DRXA 3FBEA 1T8EA 4MLEA 1RU2A 5BR9A 3I5AA 2V9KA 2C2ZB 2EEYA 1EXQA 2XYPB 4DPWA 1Z2ZA 1RAFB 2F1FA 4KKOB 3M6GA 4FPBA 2CG4A 3VA0A 4JKBA 1SB6A 2GIFA 2BMBA 4Z4HA 2GW8A 3D0PA 4K4XA 2FJAB 5D0GA 3KJVA 2YKNB 5ETLA 1C0UA 3OBIA 1MNEA 4WK1A 3FFIB 3VF4A 4KE5A 5IC6B 1V3SA 3D6MB 1Z26A 3EZUA 3T1HF 4CHQA 5J1EB 2W7AA 1R8AA 2N4CA 4WP3A 3GMGA 2O8CA 5JVHL 3AXMA 4ED6A 3QT8A 4FYWB 1F9FA 1TUWA 3GG0A 3CDEA 4MLHA 2BJ9A 3DM2B 2A0FB 3DRSA 3A8IA 5TKYA 3R97A 3HJVA 3LL3A 4CD1A 3HSZA 3PRVA 4NB4A 2FD2A 5HQ8A 1VQLN 2FGOA 4CE9A 1NGEA 4LR7A 1Q18A 4KHRA 2XYGB 3AVNA 2CYYA 3VGSA 4JI7F 5D0HA 2FBXA 5CYQA 4ZCLA 3KG4A 4ZCKA 4DV5F 2AT1B 2DEJA 1X1PA 3OYHA 3AVGA 3V1QA 2LLZA 3L7UA 2L9WA 5ITHA 3U9ZA 2DFFA 1U1NA 4JKGB 4QYZK 4CO0A 3EKSA 1X4AA 3V5RA 4A8FA 3VVTA 1QHTA 3EVOA 3K2YA 4P10A 1I94F 3KDOA 1IBKF 3QO9A 3BKFA 2Z2YB 3UNGC 4H5VA 3QEXA 4FWSA 2HRUA 3VAKA 1HI8A 4M5DA 4JI3F 2HVZA 3D1QA 3VGUA 4DV0K 1H74A 2BUPA 2MPUA 2K2PA 3DOKA 2D0OA 5KRSA 3K7RA 3IXQA 1MW7A 4ECSA 3M1VA 2GS8A 2VJVA 2GV9A 5A8RB 4PY5A 1G99A 4KHQA 3GR1A 3MCPA 1KP6A 4RZRA 5DRKA 1LW2B 4CLKA 4OYAA 2HQGA 5F8HA 1FW6A 1IKYA 4FXVA 4NI2B 2Q6CA 2E1YA 1YVFA 3M1FA 3EDRB 3R5DA 3I4HX 3OUYB 2KQ2A 1RDBA 3NCPA 1X0PA 3UDCA 4QIEA 3KMQA 4FOEA 2M70A 5SZTA 3RMBA 5BN9A 3CO0P 4ZVSB 4ECXA 1NGGA 3GIRA 4X64F 4B9SA 4FWQA 4CIFA 3SLCA 2JEIA 4ECZA 4CJSA 5A8WA 2ZHOA 2GQ2A 3AB4B 3K17A 2FJEB 3F9MA 5DMRA 2MKSA 4CESA 5J2MB 1R31A 4ANEA 4L75A 3CERA 4NLVA 3UO0A 1WKKA 4P7VA 5F0XA 4LSNA 2K8GA 2WUSA 3CD6S 3LM9A 1HNZJ 4LF7F 3I56N 3DOMA 1RT3B 5JS2A 2V4RA 1RT5B 5CCLA 4F25A 4YEAA 1YHQS 4NZ0A 2FVQA 4FLYA 2EBEA 1EB0A 1VRQC 2DPIA 3CCRS 4PQUA 1WHVA 3PHTA 1ZBSA 4JKCA 1S1XB 3AJDA 2NRRA 3HHEA 3K5LA 3Q23A 4DV5K 3O80A 4NO7A 1TQLA 4DS5A 4CO2A 2CZ4A 4ZKAA 2RDJA 1TAUA 2ATQA 2P9SB 3MPUB 1QDUB 4PXEA 1D0EA 4Q0BA 3N6LA 5KFZA 4KHYA 2QL9B 3VQPA 4DTPA 2Y1LB 2ZH6A 4AM7A 4LSZB 5C5JA 5J1EA 4UY8O 3R5BA 1MWZA 2YX4A 5B0DA 1I1GA 3U1NA 2ZD1A 3UW1A 2CVEA 5AQSA 4BRKA 4EGLA 2VG6B 2J0XA 2XWYA 4X64K 1BA1A 2YNFA 1NU4A 2AZ1A 3BR8A 3PJXA 1YJ9N 5E84A 3E1YA 3I55S 2X6NA 1SUQA 2KI2A 3CM5A 3FMWA 4CGJA 3SPYA 1XC9A 1TKDA 1FKOB 3V2UC 4ILJA 3HHNB 4LIWA 2ZNYA 4JI6F 4YB6A 3ETMA 3M7VA 2CQHA 2HFUA 4E89A 2UU9K 1WC4A 4LR9A 2O8EB 2XULA 3MUMP 2MGZB 1V9OA 2PSZA 4JV5K 5KPTA 3MDFA 3JSYA 1EETA 2WVCA 3EGNA 3ZSXA 1VBXA 4I2PB 3IG1B 3JXUA 4JI3J 4AQYJ 1MN7A 1WDTA 5C2FA 3R9PA 4J9RA 1GTHA 4F4WA 2WB1D 3DLRA 3E01B 3P5JA 1VGYA 1RE1B 1GT8A 4RW9B 1S49A 4FLVA 2LXFA 4A59A 3MTKA 3ZSWA 2O8BB 2PDAA 3DOKB 2KO1A 2QJ3A 4EK2A 3J7YU 2HLTA 3AA9A 4Q2MA 4M5DB 3V6JA 4YORA 4EHUA 1JLGA 2VV5A 2DITA 2DY1A 4BE0A 1HLUA 1KOOA 4CJ7A 1CJTA 4M3YA 5DJBA 2QZ8A 4RW7A 1HPMA 2DPNA 2JWKA 4KGKA 2FLLA 3ZT1A 4K4SA 2QW9A 4ZHRB 4KB0A 2D3ZA 2VPZB 2R8KA 2F40A 2VD3A 3B6PA 1BDGA 1YZ7A 2ACMA 3TTDA 1RHMB 4P73A 2GBZA 3QPIA 1TV6A 1C0GA 3EVWA 4DMNA 4XPEA 4A61A 1NOZA 4RLEA 4ZJQA 3NOCA 5IT0A 4URSA 3C6UB 4B1WB 4NYFA 2EKNA 4DX8H 5HRSA 3NS7B 4ECTA 5KG3A 2GWJA 5FJ4A 4HTIA 1UAXA 3LP2A 4PUOA 3BN7A 2E9ZA 1U8SA 4CZMA 2W9CB 3MZIA 4BROA 4K59A 4H54A 3RAXA 3QJPA 5AQLA 3SFUA 1W25A 5AJ3J 1A5VA 2FJXA 4CZEA 3OTCA 3J7YP 3TQ1A 4RNFA 4RUCA 2QMWA 3B8AX 4OGCA 2A5XA 2R2TA 2RUGA 4OMFG 2L08A 1YJWN 4JI6K 1TKZB 4PWWA 1FA0A 5J2NB 1WC3A 1REGX 1C4AA 3QAEA 3IR6B 2CDQA 2IRYA 1IQTA 4DUYF 3I96A 3OLAA 3BN4A 3CCJN 2Z8QA 3OL8A 4GKKF 2CQGA 1RDRA 2DH9A 2AEJA 4H0OA 1JLCA 1S6UA 4DFJA 4LF4F 5JVGL 4FJXA 3ITHA 3TVYA 4Q5VA 4ZLPA 4N56A 1QZ6A 3G6YA 1VQ9S 3G6XA 3BQ0A 1FVSA 3FC9A 4DV6F 2B6AA 2DR8A 4B1ZA 1MMDA 5K5MA 2ZD1B 1MU2B 1IQZA 1HQEB 3UB5A 2E5GA 3ZCMA 4CO3A 3TAFA 1KBRA 3OTDA 2FHJD 1U45A 1BI4B 3H42A 5F8GA 2XY7A 2YX6A 2E5HA 1FFSB 3CFPA 2AJ4A 2DT9A 1XJWB 3QBCA 5T14A 4DV2K 1S57A 2ZJPL 1Y5LB 3OFHA 5EDWA 5AQTA 1BIUA 3FBBA 5GAGP 2D5RA 2FJVA 2DGOA 3Q8RB 4BRGA 3FZHA 2AF6A 3C14A 2XMMA 3BR9A 4BR5A 2K3KA 3A1YG 1O13A 4B8AB 4DU7A 2ZWOA 3QT6A 2UUCK 3BPSP 3SDEA 3LF0A 4UZBA 1TMMA 2L9DA 1HJRA 2DEIA 3FZ2A 3AO2A 1WOPA 2QYGA 3HT0A 4U6PA 3OXGA 4LF5J 3D0GE 4M5NA 1YBAA 4ZPCA 1S72S 1U1KA 3CEDA 5G0RA 3GR0A 4GV3A 2UZAA 3CCLN 2PI5A 5HROB 4ZPDA 1DBDA 1H7WA 4U7UK 1VIXA 1CG2A 3VA3A 2KT2A 3M4XA 4YOTA 3S3NA 4J9UE 4O44A 4G6VB 2X74A 1RT6B 4DV5J 4JV1A 4CK3A 4BWJA 2E1MC 3MM7B 3HSGA 4OLOA 4MIAA 3OYDA 4AL7A 1S6QB 4NA2A 3M30A 3SUQA 4W92B 3FZBA 3ZTQA 3DLBA 1PJ7A 3JSMB 3CC4S 5BPMA 5ETSA 2DTUA 4EUVA 5CYMB 1NMDA 4PG5A 3MGJA 2KT5A 2Z58B 4X62F 4K42A 1RA7A 3CETA 3FEXB 4DR1J 3SPZA 1OPIA 2RHKA 3H4DA 2J4RA 4A57A 3WEEB 2YNHB 1R8BA 1MN9A 1WNSA 3TZWA 4P52A 3L2VA 2W2QP 2K3IA 2PN6A 1NJYA 3ZZUA 4EFAC 1JNRB 5ETKA 1K0TA 4EO8A 4FP9A 3L95X 1IG9A 3HSDA 1GLJO 4C7QA 1TL7A 3M9MB 2VDIA 4K41A 5KFLA 4JK7A 2MZTA 3PCOB 3TR5A 2YKMB 1NBEB 2VZ9A 1X4CA 4P71A 5KFHA 1HI0P 3AVKA 2IA0A 2QYCA 5SUHA 1HBUA 2OZMA 5DM6L 4GMKA 2R7TA 1HBNB 4AD6A 3JS6A 4F26A 2P9UA 1M90O 3X1LB 3HXMA 3GYNA 1O8BA 4FYYB 5LY3A 5I4MA 3H5SA 1HX1A 4EP5A 4TQSA 5D8HB 2FHOB 2NRWA 2NXJA 1YX2A 3PSIA 3RW7A 4GVEA 1KXPA 4C2MA 4DR5K 3NVKA 5HOOA 2UUWA 3AOCA 2W8LA 2XSJB 1BQMA 1B7YB 4BLGA 4H5TA 1VSJA 5BR8K 4FZVA 4LQ3A 3ISND 1OSDA 2W25A 3RAQA 1J54A 1HKAA 5LMUJ 2V4JA 4BACA 3CMEN 2ERRA 4OYZA 1WOOA 4ZP6A 4W90B 3SV3A 3AGRA 3CJCA 1WC5A 1XQIA 2K7KA 3GYXB 2IOCA 1CPZA 3HO1A 4Y2AA 3ID6A 4QYRA 4KGXB 2G2YA 4LRCA 2HRTA 3I0RB 3VQCA 5LJ3Y 4PWUA 3VQ5A 1X3NA 1VI7A 2E5LF 1HD0A 2UV8G 2VBYA 2RS2A 1N88A 3JSRA 1BG3A 1QQMA 1RT7A 2HSEB 3QATA 2OPQA 2RMLA 4DLGA 1HBMA 4WZQA 4X84A 3AA3A 4LSLA 4B3RJ 1TYQA 3R8EA 4FPIA 3D7EO 2VASA 3NGDA 1R7IA 4CJEA 1LFPA 2KH9A 3C66A 1MWQA 2CXEA 2KXNB 1IBMF 2BRLA 1WSVA 1NKCA 3HP9A 2DRAA 1HBOB 2JDJA 3D4JA 2JHEA 5KFUA 1MMLA 3LPUA 3HYFA 4FDFA 5GAGU 3ULDA 1YI2S 3ZTPA 5DDOC 3QIDA 3MPDA 1N6QB 3H45C 4DQRA 1EIYB 1T9VA 1FRKA 2PMWA 5SWMA 2I9SA 2FC9A 5I9EB 3DGPA 1BLUA 4FL9A 4WZMA 4CLLA 5KFTA 1LWXA 4IFEA 2ZJPQ 1HWLA 1WEZA 1JWWA 5BRDA 3HKWA 4B3SK 1LXNA 3AFGA 3VGVA 3N9UC 3K2PA 1ZTTA 2A10A 4Z4CA 4OJ1A 2DGTA 5CZ2A 4WYWA 4JHDA 1M5PC 1ZBLA 4KH0B 3FGVA 4L3KA 3HM8A 4L72B 4I68A 5K8OA 4KH4A 5E7OB 2GMHA 4HYKA 3PYGA 5H1SQ 4RKUC 4TKTA 2HW3A 2ZITA 1HWKA 4CFCA 3HHLD 2CQDA 2B9WA 2W9BB 4B17A 2V5HG 3SBGA 2P9IB 4F36A 2HPUA 2OTLS 4NXNK 2ZC3A 1I5OB 3CULA 4F04B 2ADBA 4M5JA 2NSCA 5DM7L 1Z25A 1O51A 2HBLA 5DM6Q 3RRHA 3ZTSA 4W5RA 1WTBA 4LF1A 5KQDA 4KFBA 4DR7J 4YY3F 3BUZB 5L39A 1WUAA 3GG1A 3MXJA 3LDLA 1TELA 3MEEB 3MM7A 2Q0UA 4JAXA 2FLOA 4JI7K 4OYMA 3W2WB 4CZLA 2BXJA 1SJRA 1P9QC 3C16B 5GAGI 1SJQA 4B3OB 5KFOA 1FKOA 1JLAB 3EZOA 3W63A 2FF6A 1UVNA 3Q2TC 4ISFA 2MHEA 5M1KA 1ZS6A 4IFVA 2RKIA 3RR8A 5B0GA 4N47A 3GG4A 2GVZB 4C48A 4OJ3A 4ILLA 5IT4A 3K0JA 1X0FA 3R3LA 3ZT4A 2MMYA 3PX0A 3O4QA 2MY8A 4Z37A 3F5TA 1NHKL 5KT2A 2XSJA 4EAHD 3M32B 4U7UD 3CIMA 3I4PA 3MEDB 3R6LB 2FSNA 4KRWA 2A1BA 2NRHA 2EFPA 1F60B 3LAKA 3E01A 1CVJA 4A8XA 1DRZA 2QX0A 4FO0A 4B3RF 3IMQJ 1GNKA 1UW9A 1ZBHA 4JKDA 2E9RX 3QAUA 2JEGA 2MJUA 1FT8A 4MKBA 2MKIA 2IY5B 4M3RA 4MFBA 2G0IA 4IQXA 5LM7E 1T05A 5ETPA 3V81B 2QG9B 5AQUA 4RWWA 2D3O1 1JMTA 4ZP9A 4AHUA 2VBXA 3MAAB 1CJVA 1UTAA 1T6DA 1X4BA 4ETZA 3IS9A 1WELA 4CJ5A 2HNZA 4ZVPB 1YVNA 4XH1A 3EN9A 1WNEA 3WC2A 2XYHB 1WUUA 3TTCA 4LSNB 3CJKA 5HBMA 1RU1A 3GFZA 3CCQS 1AFJA 4N41A 1OVYA 3W64A 1K8KA 1SL1A 3RJMB 1NK8A 4CFAA 3G8SA 2J8SA 1S9GB 3MM9B 4LRFA 4JI8K 2HG4A 2KL8A 3QZ7A 2UXDK 3B4MA 2QIFA 2YJFA 1J27A 3CJ8A 4FJKA 2M5YA 3M2RA 4K4TA 4PG6A 4YY3J 3HP6A 5A0YB 2HBKA 4B3MJ 4CFBA 3DI6B 1LV5A 1HFEL 4ECWA 5IV3A 5BN8A 3F41A 1JJHA 4X4TA 4ZVTB 5B7WA 1RACB 3M8WA 4B9QA 4LT6A 1CZ9A 4LFAJ 2XZWA 4OIXA 5HP1A 4DU8A 3ZX2A 3L4QA 4WTYA 3I9ZA 3TP2A 4EMDA 1IVZA 2UVUA 1HQEA 3DDIA 2E2NA 4NCBA 1NM2A 2ZF5O 3RR7A 3KK3B 4DCHA 3Q8VA 1NAQA 2VC1A 3BKTA 3FZMA 3MMCB 1KVBA 7FDRA 1AA1B 4NLUA 3D68A 5IM0B 3K8VA 2CAJA 4WTOB 3C6TA 1U1PA 1QVFR 4IO1A 4ANCA 1S76D 4BR0A 2YKAA 1SVDA