4ID5A

Hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 164
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4id5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4id5A05
1LW2B 1S1WB 3MR6A 2FVCA 3GV5B 2IDOA 2G8IA 4NLXA 1CXUA 1FKPB 4CJTA 2W9CB 2W8LA 3SI8A 4K4VA 2E9RX 1GOCA 2ZD1B 4CHNA 4KI6A 1NK6A 5JUMA 2FVQA 1N6QA 3V9SA 2FJXA 4ZP8A 3CVKA 4HUGA 2Q3SA 4C8NA 4DQIA 1NJXA 1LW2A 4M3TA 4Z0UA 4KHYA 3OYIA 1WSJA 4M42A 4OJRA 2QE5A 3PW0A 4ECVA 3BSOA 1WN7A 1NOYA 3SUOA 2VG7B 4DF8A 3H40A 1IG9A 4J9SA 1X9WA 3IN5A 3KLVA 4JV1A 3DLRA 4XIUA 5F9LA 1JIHA 4PQUB 3TANA 3N6MA 1I39A 4CGJA 2FLPA 3MTKA 4CGIA 5KT7A 3V9WA 1T8EA 3MAQA 3PVXA 3NAHA 1S1VA 2DFEA 4CESA 2VA3A 3C94A 1BI4B 4HVJA 4CEAA 5KRTA 1JLQB 1L5UA 3AVLA 3QLHA 4Q43A 3KNAA 5F8HA 3OYMA 2IM3A 3LP1B 2V9WA 1S9FA 4M94A 3FQLA 3D0PA 4N5SA 5KFJA 3T19A 4Q45A 3OHAA 4NCAA 2ITGA 3PHEA 4RW4B 3VQ9A 3BR9A 4IRCA 4ZVEA 2W7PA 4Y2CA 5L9XA 1BI4A 3IRXB 4K8ZA 2KZZA 1U47A 1TVRA 1DTTA 4KHWA 1NK7A 3MXJA 1XI1A 1TV6B 3TWHA 3LAMA 1C0UB 1U48A 1NK0A 4ZVGA 1D8YA 2HB5A 3V9XA 4CJWA 1RDAA 4J9LA 2KFNA 3FDSA 4RW4A 3EPGA 3S3NA 4OPKA 3JYTB 1ZETA 2HNZB 3DMJA 2CJQA 2B43A 4BE0A 4F3OA 4FBUA 4FJGA 2YHBA 1HARA 4OKEA 1QQCA 3CDUA 1C0UA 3ZT3A 2G8VA 4EP5A 2D0CA 1NJYA 5F8IA 2C22A 4CJQA 4IH5A 3I8DA 2I5JB 1WSEA 1IO2A 3EZ5A 4K50A 5HRNA 3TABA 1ZBIA 3RRHA 2KFZA 3IGNA 5KFAA 4FJNA 3O4NA 3JYTA 1A5XA 4FZZA 2HNZA 4LH4A 2R8KA 3BGRB 1LW0B 2R2SA 2ETJA 4MIBA 3KMSA 4M41A 4JUZA 4CGFA 4HCBA 4ZMMA 1ZBFA 5CYMA 5HBMB 2AGQA 2HNDB 3EZUA 3FRZA 2OPQB 4RNFA 4IDKA 5DQIA 4C8KA 2HVHA 4F4ZA 1WSHA 3L2UA 3AVGA 3B6OA 4Q8EA 1RDBA 1QSLA 3RRGA 4DMNA 1TKZB 3NGZA 4O3RA 4DF4A 2FBXA 1LW0A 3M8QB 2WTFA 1RTHA 4J9OA 4O3QA 2XRIA 3PW5A 3CJ2A 2KTQA 1XR6A 3H98A 1RT2A 1RA7A 4CEEA 4URQU 4CIGA 4RW9B 5KG5A 4WXOA 3CDEA 2VWKA 2R8IA 1JKHB 2OPQA 1K1SA 1BQMB 4URSA 1EXQA 3AA5X 3NAEA 4AHCA 4M3UA 3OYNA 4MK7A 3DRRB 3QNNA 3TAQA 3PX0A 2GV9A 4LQ3A 2G8WA 1REVA 1KLNA 4CHPA 4K4TA 1SUQB 4F2RA 4RW7B 3SNNA 4O4GB 3VQQA 4M3WA 4HKQA 1MU2B 2E6MA 4KAZA 1UWBA 3KLIB 3KD1E 1BQMA 1Q9XA 1HPZA 3C6TA 3RB0A 3LWMA 3QZ7A 4J9MA 2HHQA 2OPSB 3SFUA 4BDPA 3T1AA 4B3OA 3GIIA 1U45A 1QSYA 1SL0A 1BIZA 1RYSA 3AVMA 4IBNA 2R8JA 3Q8QB 3LZIA 1QSSA 1SUQA 5J1EB 1MU2A 1S0NA 1SH3A 3RR7A 2YNIB 3KLIA 5EWGA 1K6YA 4LY7A 4OVLA 3RAQA 4N47A 2OPSA 4DG1B 3TAEA 3VQDA 2OA8A 2P1JA 2X6NA 3CM5A 2GUIA 1HRHA 1CZBA 4JV0A 4FJ5A 1RBUA 3IS9B 5J1EA 3LDSA 1NJWA 1SKSA 5HLFB 2YKNB 1ZTTA 3HYFA 5KG3A 2YNIA 2JEFA 3WNFA 1ASVA 4ED7A 3UPFA 4IRDA 3BSCA 5KFRA 3KIOA 2XGQA 1L3TA 4KHUA 1S49A 1ASWA 2ASDA 1RTIB 4J2BA 4IH7A 4CFCA 3OL8A 4DG1A 2YNHA 4QCLA 5L1KA 1IKXA 4ECXA 3HM9A 3AA3A 3KKRA 4CERA 3IS9A 3L3VA 1QUVA 4CE9A 2PZSA 2XCAA 4RZRA 2WCXA 2Z1IA 3L2VA 3SZ2A 1BCOA 4FJ9A 3LP3A 3GV8B 2FJVA 1S1UB 4KB0A 1RTIA 5KFPA 4ZP7A 2XGPA 3TI0A 5DG8A 1S6QB 4QWAA 2QKBA 3T5LA 1LWFB 2D0BA 1KVCA 4EZ9A 4ECUA 4DSLA 4AHTA 5C5JA 1ZTWA 3RBEA 5KG0A 1Q9YA 4M3XA 5KFTA 3OYDA 1TL3A 1R0AA 3LZJA 4B9NA 1SKWA 2BDPA 2WOMA 5DG9A 3AVJA 4DFKA 2G8UA 4M3RA 1S1UA 2QV6A 4K4XA 1VRTA 1S48A 1RT6A 4TN2A 4C8OA 5KG4A 3VQ6A 3QO9B 4YFUA 4ID5B 3RB6A 2B6AA 4NLQA 4E3SA 4ZTJA 3RMAA 3DYAB 5KGXA 1YTUA 1LWCA 3TQ1A 4NLOA 3KK3A 4CHZA 2BGGA 1F21A 4IFYB 4R0EA 4NLUA 3QO9A 2DPIA 4TLRA 3VQAA 4CEBA 1EP4B 3NMAA 2DFFA 2EC0A 3VQ4A 2IA6A 2ILYA 3DRSB 4CJPA 3HXMA 2XHBA 4KPYA 4KAIA 5KTQA 2JC0A 1D9FA 4O3PA 1C0TB 4CGHA 2IM0A 4IKFA 2HAIA 3DRPA 4AHVA 5KFLA 3MXIA 2FBYA 3ZT0A 4IFYA 2KZMA 5K14B 4B9TA 5I42B 4F8RA 4KRFA 4CEDA 4IFVB 1DTQA 1NHUA 3TARA 4FW2A 3OYLA 1RT5B 1S5JA 4IQXA 3QGGA 3H5SA 4ZPDA 4CK3A 1TP7A 2VG6B 3TAPA 3I5BA 2ATQA 3UDLA 3SQ0A 3KJVB 3V6HA 2FVSA 4RG8A 3AVCA 2UUWA 4E7HA 1RBSA 2HHTA 3NBPB 1WAFA 3I5CA 2YV0X 4Q0BB 1W0HA 4O44B 4M3YA 1HYVA 1TAUA 3RAXA 3RTVA 2RN2A 2PY5A 3T5JA 4TQSA 1LAWA 5FDLB 3KJVA 5JS1A 3KK1B 4NCGB 4R5PA 2AWZA 4KFBB 1DLOB 4Z4IA 1A5WA 2GC8A 3NBPA 3WNGA 2KW4A 4DSFA 5J2NA 4Q0BA 1SH2A 1J5OB 5KFBA 1C0MA 1JLEA 1BL3A 3VQBA 4DS5A 4ZHRB 3AO3A 3NAIA 1JLCB 1QS4A 3QINA 2IMWP 3CFPA 5FDLA 3ALYA 3KK1A 4NCGA 4OL8A 3MR3A 4B9UA 4DTJA 1XHXA 2V4RA 3LP2A 3ZSYA 3NF8A 2JC1A 3MR5A 3O4QA 4ICLB 3QEIA 4FM2A 1J5OA 4WYLA 1RTJB 5J2PB 1X1PA 4YQWA 3O3HA 3DLHA 4ZHRA 4DTUA 1NOZA 5F8LA 2W9BB 3QIPB 1VK0A 3LP0A 1RTDA 5C25B 3U3GA 2OPPA 4FZYA 5T7BA 3DM2A 5JS2A 1FK9B 2XY5A 4ICLA 3EPIA 3CQ8A 4YR2A 4KHQA 5KFWA 1RBRA 1VSKA 1RTJA 3C6UB 4ELVA 3GILA 1O1WA 3ISNC 4KKOA 3MEEA 1N6QB 3QIPA 5L1JA 2W9AA 5C25A 1HYSB 1QHTA 4J2EA 4DTMA 4MIAA 2HHSA 1FK9A 4J9NA 1SL1A 1GX5A 1VRUA 3OYKA 4E1NA 4Y2AA 5KFUA 3HVAA 2ZKUA 2W7OA 3C6UA 4C8LA 4PUOA 4XPCA 4DL3A 4ZP9A 4AH9A 2I1RA 5DMRA 4CF9A 4RUAA 4ED0A 2C2RA 1HYSA 1TAQA 2FVPA 3ZT2A 4DU1A 4KREA 3SQ2A 4MK8A 3NF6A 4BWMA 2DY4A 4TY8A 1ZBLA 3DLKB 3PY8A 1RCHA 4FM1A 1ZBUA 1U04A 4EO8A 1B9FA 1JL2A 2X78A 4ELUA 2AGPA 5DK5A 3KHLA 2FC0A 3P5JA 2HHUA 5KGWA 1S1VB 3NGIA 3NKYA 4DFPA 4IKAA 4PY5A 3JSMB 4DQQA 4EBEA 3TAGA 1TL1B 2HWIA 3QLHB 1SKRA 1G15A 4ZPAA 3DLKA 3TAMA 4RW6B 4OLBA 3ZSWA 2WONA 4AILC 1UOCA 4N56A 1NK5A 2E9TA 2O5DA 4TSXA 1RT7B 2ALZA 2IM2A 4NLRA 2O4GA 1HNIA 3HP9A 3JSMA 1TL1A 2JEJA 1TVRB 3BJYA 3L2WA 1DTTB 4QWBA 4EEYA 3NL0A 1KFDA 4LD0A 4BACA 2XI2A 2OH2A 3H5UA 2YNGA 1HYZA 3NE6A 4RW6A 1Y97A 4FS1A 3M8RA 2BR0A 5CZ2A 5KT5A 1IKWB 3SCXA 1NKEA 3G10A 1U09A 2OPRB 2QKKA 1RT7A 3AVKA 3HVTA 3RMBA 4ZTFA 4EBDA 3SV4A 2V0NA 3OYHA 1KHWA 4WYWA 4FJIA 1N56A 2RDJA 3DMJB 4KSEB 1BQNB 4B9LA 4HHTA 5DQHA 4N76A 3HVRA 4JS4A 4WFXA 2P5OA 2F8SA 4WXWA 1IKWA 2IC3B 4CIFA 2OPRA 3M8PB 2F8EX 1JLGA 2F8TA 5KRSA 3ZSOA 4DFMA 3CJ4A 4G3IA 1JXBA 1BQNA 3TAFA 3EY1A 4J9KA 1TKTA 5CYMB 4J9PA 3QZ8A 3S3OA 5KFOA 3QEVA 2IC3A 2HHXA 3QEPA 3M8PA 4E7KA 4IDKB 1UAXA 4DL6A 1JLFB 4ECYA 3PR4A 1RYRA 1UA1A 4NYNA 3HO1A 3AO2A 4FLTA 1RTHB 4NLVA 4FBTA 3SV3A 4I2QB 2ZE2B 3Q8RB 4CECA 4LSLB 1RT2B 4OLAA 3DOLB 1YTAA 1HMVA 4CHQA 3V1OA 2XI3A 2XY8A 2XY7A 1ZYQA 1ITGA 2UUTA 1WNSA 3CDWA 3HKWA 3K5OA 2ILZA 1QE1A 4MH8A 2UVUA 1JLFA 4CF2A 1RBVA 1HQEB 3SPZA 3SI6A 5J2QA 2QXFA 4Z4EA 1WAJA 1SH0A 4JRPA 2HWHA 4FJXA 4I2QA 2ZE2A 1REVB 4LSLA 4Q5VA 1VSDA 3DOLA 4B9MA 3K59A 3UR0A 5KI6A 4ED2A 1UWBB 4X2BA 3NGYA 3K5NA 3OY9A 1HPZB 3C6TB 2IM1A 4MKBA 4CFAA 1HQEA 4DS4A 3Q8SB 5DQGA 4B3OB 4RNNA 4B08A 3OYGA 3OYCA 1C6VA 3U3YA 2B5JA 2JEIA 4TXSA 2R7YA 3SUNA 4Y3CA 2OZSA 1JX4A 3HPGA 3QIDA 3T3FA 3S9HA 3ZSVA 3O3GA 3G6VA 3P1GA 3SUPA 2RF2A 2GBZA 4YR3A 5EWEA 3OSPA 2HHWA 4ELTA 5C42B 4AHSA 3SFGA 4TQRA 4O4RA 3CWJA 3E51A 4NLGA 2UVVA 3FFIB 4MFBB 1RBTA 2IGIA 4DSIA 4QWCA 3OS2A 4FLUA 4NZ0A 4KO0A 3RMDA 4FS2A 5F8MA 3AO1A 3MFHA 1NJZA 3D45A 3V6DA 2YNHB 1IKXB 4M3ZA 1EETA 1EX4A 4W5NA 5C42A 2YKMB 1WNEA 3QGIA 4ECSA 3FFIA 4MFBA 2Z1GA 3OL9A 3L2QA 4KBIA 3K2PA 4CEQA 1ZBHA 3CG7A 4CEZA 1JLAA 3QEXA 2AX0A 3ZT4A 1JL1A 2R2TA 3VQCA 5KFSA 4NCBA 2D0AA 2VG5A 2PYLA 2YKMA 3V1RA 2XY6A 4CJVA 3EYZA 3ZSXA 1FKOA 1YVFA 3HVWA 5KFIA 2DPJA 1TL3B 1R0AB 4H8KA 2WOMB 1NK9A 3MEDA 4JV2A 1VRTB 3HPOA 1RT6B 5EDWA 4MKAA 1VSLA 3LPTA 1SL2A 2F96A 2ZQBA 4O3SA 4RNHA 4HTUA 3HL8A 2B6AB 1S10A 3NDKA 4KI4A 3LALA 2R2RA 2W8KA 3NH0A 1KTQA 3OYEA 4OKJA 4F4XA 1S1TB 4NYFA 3HP6A 1LWCB 3KLHB 3KK3B 2YNFB 4C8MA 3CFOA 4BE1A 2IS3A 4DLGA 5F8JA 3PZPA 2RPIA 4IOBA 2HMIA 5D3GA 4KTWA 1N4LA 1TGOA 5KFVA 4ECRA 3P83D 4JS5A 3NH2A 4WZQA 4KE5A 4TYBA 1S1TA 2BQ3A 3H08A 1OS5A 3AA4A 4NLWA 3DRPB 4LQ9A 3AA2A 1VSMA 3DLGA 5L1LA 3K5LA 3KLHA 4AHRA 2YNFA 4DQSA 3CJ5A 3LWLA 2JEGA 2IBKA 3K58A 4Z4CA 1YVUA 2XWYA 4FLXA 4F2SA 3MFIA 4CJFA 3ASMA 1DTQB 2XO7A 1QTMA 4Y1DA 1L3UA 4H54A 3RB3A 1Q8IA 5T14A 3HPHA 4E7JA 1KSPA 3I0RB 3ISND 4DEZA 3SYZA 3OYJA 4O55A 3DOKA 4QWEA 3BQ1A 1T7PA 1T03A 5KFZA 3HJFA 3PW4A 3ZSRA 2R8GA 5FRNA 1T94A 3QETA 4WZMA 4QW9A 1Z25A 3OL6A 2HHVA 3H59A 4KHNA 3V81A 4OPJA 3OJUA 3GYNA 3OSNA 4DU3A 3I0RA 1KHVA 1UA0A 5HRPA 3ITHB 4K4SA 4R5PB 1VSEA 1JLBB 4URGA 3OVNA 1RDCA 4CJEA 3CJ0A 4NLYA 5KFGA 3GIKA 1D1UA 1S4FA 5J2NB 4DTPA 4CEOA 4Y34A 1J53A 3SJJA 3G6XA 2B4JA 3A2FA 1JLEB 4O0JA 2WHOA 4EP4A 4F4KA 4BDYA 4I2PB 2JLEA 1C1BA 3ITHA 4DTNA 2ASJA 4FW1A 4H4MA 1JLBA 3CIZA 3LP2B 2BE2A 2D5RA 4CJUA 1C2PA 3E01B 2G8KA 1KRPA 4I7FB 4B8AB 3PX6A 3OYAA 3BREA 4I2PA 1TK8A 1W25A 5KG2A 3LP0B 4DSJA 3PW7A 4ZPBA 1RTDB 1S97A 3NCIA 4W5RA 4CJLA 1K1QA 2OPPB 3DI6B 3DM2B 3E01A 4BWJA 1RAJA 3KHHA 4I7FA 4CJKA 2R8HA 3THVA 4FLZA 3H5XA 2OYQA 1D0EA 1L3VA 4MK9A 4TY9A 2C2EA 3U6FA 4J2AA 3QEWA 2UVWA 4KKOB 1CSJA 2FLNA 3MEEB 3WNHA 4K4UA 2DTUA 4HYKA 3KHGA 5F8NA 3CJ3A 3M9NB 3D28A 1EKEA 3DI6A 1IM4A 4CFBA 2J6UA 1VRUB 4WFYA 4ZVHA 3NHGA 4PUOB 3BQ2A 3QIOA 4DSKA 4FJ8A 3OJSA 1RT3A 4W5QA 1RT1A 3DLEA 1S1XA 4Q8FA 3T5HA 1J54A 4E7IA 4OKKA 1TKXA 4GMJB 1JXLA 3VQ7A 4H4OB 3M9MB 3KK2A 3GQCA 3N6NA 2E9ZA 3VQ8A 1GOAA 3M9OB 4CF8A 2A1SA 4CGGA 3MF5A 4TY8B 4CK1A 4FCYA 3D5MA 3QERA 2HW3A 3MEGB 1NNDA 1N5YA 3TVKA 5KT6A 3GV7B 4E89A 3F73A 4FJMA 3MR2A 1W9HA 5I3UB 4ID1A 3G6YA 4CK2A 4JLHA 1B92A 4DWIA 4H4OA 5J2MB 1LWEB 3H4BA 1VSIA 4NYZA 4KHMA 3K5MA 2J6TA 1WSGA 3AVHA 3QNOA 4U7CA 4I9LA 4ECZA 4DQRA 2IJNA 3MEGA 1RDRA 3TAMB 4Z4FA 3OYBA 4DTRA 2XCPA 5JXSA 2WONB 4B9SA 4K4YA 2VA2A 4BDZA 4FZXC 4F4YA 5EU7A 4Q44A 3NH1A 1LV5A 5KFEA 5I3UA 1T05B 2FLLA 4E7LA 1HNIB 4NRTA 4DTOA 3SQ1A 3DDKA 1S1WA 1LWEA 5J2MA 1IH7A 2IAJB 3AVAA 4HUFA 1FKPA 4NLPA 4EZ6A 5DGBA 2W9CA 1ASUA 4O0IA 4E19A 2YNGB 2ZD1A 4HCCA 2AX1A 5KG1A 3BQ0A 4YNQA 2HNYB 3ZT1A 3KLEB 2EHGA 3HVTB 1T05A 2X74A 4DTSA 4J9RA 2D41A 2P51A 2IAJA 4QW8A 2AGOA 1XHZA 5KFYA 2Z1JA 2G8HA 3KHRA 4CF1A 1U49A 4ECWA 5C24B 5KFNA 2VG7A 2HNYA 3KOAA 4CJSA 1WSIA 2GIRA 3KMQA 3KLEA 4Y1CA 1JLGB 2W42A 1VSHA 4FK4A 4FVMA 4KV8B 3H2LA 4PQUA 4N41A 4EO6A 4F50A 2NUBA 3AVIA 4K4WA 5CY4A 1TKTB 4FK0A 3NGDA 3QYYA 1LAVA 3KLFB 2RDIA 4B8CA 5C24A 4DFJA 3RWUA 2DFHA 3T5KA 4FYDA 1C1AA 4GW6A 1D9DA 1JLQA 3NF9A 4RNMA 3KD5E 4KV8A 5EWFA 3LP1A 4WE1B 4GC6A 1XWLA 4F3TA 3MECB 3OLBA 5KFXA 2R2UA 4FJ7A 2FJWA 3SUQA 3KLFA 1HMVB 5KG6A 2WB4A 2KQ2A 4NRUA 1B9DA 5DGAA 2RKIB 2J6SA 5SWMA 1QE1B 2BANB 4J9QA 3IRXA 1IKVB 4NLTA 5J2QB 2VWJA 3PR5B 4WE1A 1TV6A 5CZ1A 4EYHB 1JXEA 5HRRA 3MECA 1S6PB 2WK4A 3VQ5A 2AQ4A 1MMLA 4M45A 3OL7A 2RKIA 3ZSQA 4J2DA 2BANA 3KTQA 3G86A 1IKVA 4TYAA 3QGHA 4IH6A 1TQLA 2C28A 1TK5A 1WSFA 1VSJA 2B5JB 3CFRA 3OLAA 2I5JA 1S6PA 1FXXA 2EX3A 4Z4HA 5E41A 1RILA 2PYJA 2O4IA 3BGRA 4W5OA 3IG1B 3DLBA 5HP1B 4EBCA 2RF2B 4NLSA 1D5AA 4ED3A 1KVAA 3ZCMA 1CLQA 3L3UA 1X9MA 4ED8A 3WNEA 4CF0A 3SPYA 5HBMA 3OHBA 2HNDA 4ZVFA 4DL7A 1BIUA 1S9GB 3IGVA 4CJ4A 3GIMA 4FJLA 4DTXA 1TKZA 4KO0B 3IG1A 3AVFA 3M8QA 3V1QA 5HP1A 2QK9A 5KT2A 4CFDA 2Y1JA 3V6DB 1TKDA 4XO0A 4OGEA 4GC7A 2GIQA 4ECTA 1EETB 4KB7A 1BCMA 5DLGA 4CJ5A 5HRSA 4RW9A 5KFFA 3C95A 4IG0B 1JKHA 1S9GA 2BRKA 4KTZA 4GVMA 2BRLA 1RA6A 1RT4B 5KG7A 4CJRA 3PO5A 1JLAB 3DRRA 1HNVB 1KFSA 2ATLA 1RDDA 1HJRA 4FLYA 3PJWA 4IR1A 5DG7A 4RW7A 2VG5B 4O4GA 2G8FA 1CZ9A 4DL2A 5KT4A 4IG0A 4UQGA 4ZPCA 4ED6A 4DSEA 1RT4A 1FKOB 3OYFA 5KFHA 3H4DA 5KFQA 3N6LA 3MEDB 4FJJA 1XR5A 5L1IA 1HNVA 3QESA 4R8UB 4QPXA 3K57A 3ICLA 4YMEA 4CEFA 4E1MA 4AHUA 3G0ZA 2D7SA 4XPEA 4U6PA 2XC9A 4PA1A 3MXMA 1YT3A 1HQUB 4ECQA 3VQSA 1TK0A 1IKYB 3I5AA 1GOBA 4FLWA 2C2DA 3HSTB 4LSNB 4R8UA 4CGDA 2A1RA 5HLFA 3RB4A 2YKNA 2HMIB 5D3GB 4MQ3A 3ULDA 5CYQB 4Z4GA 4DL4A 3GIJA 5EUHA 4O3NA 4WFZA 1S0MA 1HQUA 1IKYA 3UQSA 2IJFA 3DLGB 3HK2A 3OS0A 4K4ZA 4LSNA 3LANA 3Q8PB 4FJKA 4QWDA 2X6SA 4DL5A 5CYQA 4PWDB 3AVNA 1XC9A 2FVRA 4RUCA 2BQUA 4F4WA 5KFKA 1KLMB 4FK2A 1NHVA 1S9EB 3TR8A 4ED1A 3BDPA 1S6QA 1BHLA 4OGCA 1LWFA 2E6LA 1WLJA 3RBDA 4IRKA 3VA0A 3DOKB 2UVRA 1NK4A 3AV9A 4PWDA 2V4QA 3PJXA 3S3MA 1T03B 1J9AA 1KVBA 3AVBA 5KFMA 1KLMA 3H5YA 1S9EA 4O5BA 4QOZB 3V81B 2OZMA 3VQPA 4ID5A 1X9SA 3L8BA 3CYMA 3V4IB 4QAGA 4DLEA 3OS1A 2Y1IA 5DLFA 4B9VA 4JRQA 2AU0A 4KB1A 3AO5A 4M95A 3NF7A 3B6PA 1SV5B 1I3AA 3DYAA 3V9ZA 1GX6A 3F9KA 1QAIA 1QAJA 5F8GA 4KTQA 3VQEA 3V6JA 1BGXT 2IOCA 4CHOA 1L3SA 3UIQA 1EP4A 1VSFA 4CCHA 1C1BB 2CKWA 3V4IA 3DRSA 4H4MB 2E4LA 3PO4A 4EYIB 4IG3B 2AJQA 4K8XA 2BE2B 1C0TA 1C1CB 1SV5A 4RNOA 3VA3A 2JGUA 3LAKA 3RMCA 5K14A 2LSNA 2YHAA 4G1QB 5I42A 1CXQA 1T3NA 4IFVA 3HHKA 3V6KA 1KCFA 2FBTA 4IG3A 3AO4A 5KFDA 3M8SA 1RT5A 1C1CA 3NFAA 5FRMA 4E0DA 2BQRA 3LPUA 4KHRA 2D3ZA 1NKBA 2VG6A 4FLVA 1RNHA 3FSIA 3I0SB 4G1QA 3O3FA 3BSAA 4DQPA 4CHYA 4CIEA 3PX4A 5SZTA 3KKSA 4DU4A 1U4BA 4LH5A 1XR7A 4NLDA 4O44A 4I9QA 4RU9A 3PUFA 4BE2A 4HUEA 3IAYA 3SQ4A 4W5TA 1NKCA 4RW8B 4CJ3A 3L2RA 1NK8A 3I0SA 1RT3B 4KFBA 1RT1B 1DLOA 3DLEB 1S1XB 1S0OA 4IR9A 2D3UA 2Z1HA 4ZP6A 1TKXB 3KLGB 2HVIA 3KK2B 3FQKA 4L8RB 2ASLA 4YP3A 4RW8A 1I6JA 1JLCA 1N5YB 5FROA 4FM0A 4O3OA 5HROB 1N48A 3VN5A 3HT3A 4YR0A 4KHSA 5KFCA 3KLGA 4FJHA 2P5GA 3PW2A 4FXDA 3CM6A 3PV8A 1Z4UA 5F9NA 3RR8A 5J2PA 3V9UA 3CO9A 1BISA 2WRMA 3BSNA 2W9BA 1Z26A 1A5VA 2FBVA 5HROA 3ZSZA 5KT3A
chains in the Genus database with same CATH superfamily
1CPZA 3UKRA 3EICA 1BG3A 2ZM6K 2G8IA 4C3MA 3BGFA 2PD1A 1VDHA 2Y8YA 3SI8A 4FP9A 1GOCA 4CHNA 4WCEQ 3TOQA 5JUMA 2FVQA 4ZP8A 4CD1A 3BKFA 4BRKA 3CVKA 4HUGA 4OO1J 2HS0A 4C8NA 1GMWD 4Y0FA 4Z0UA 3OYIA 1R8PA 1WSJA 2QE5A 1WOSA 4DOZA 5IS2A 3ZNUA 3BSOA 4DR4F 3A3PB 4JV5J 5I3QA 1UAWA 4M5DB 3CDAA 4EWTA 3MM7A 2KG0A 5A8KB 2CPDA 1MWKA 3DDIA 4XIUA 4HDGA 1UEVA 3VAIA 3N6MA 3PYEA 3WQTA 3EMTA 2HVEA 1CJKA 4B3MK 2DNMA 4CGIA 1SC4B 3PVXA 3W2WA 4BQZA 5IFMA 3W9IA 1L5UA 5IQQA 3HZGA 3AVLA 3QLHA 2CGJA 2V2KA 2V9WA 3ZTQA 1CULA 1DQAA 2V67A 4Q45A 5IWAK 3OHAA 4NCAA 4G9ZA 2FJBB 3N0VA 2O8FA 2C2NA 4USHA 5HQMA 4WFBL 3POTB 5L9XA 1BI4A 2YKAA 3NCQA 5LMNF 4KHWA 5JJBA 2V50A 1NK7A 1FWKA 3MXJA 4OX9J 1RQ0A 3TWHA 3LAMA 3DJCA 1U48A 2Z2MA 4BBYA 1XNQJ 1W2IA 2HB5A 3BB5A 3V9XA 4DX8H 1FRMA 1OSDA 4RW4A 4MO5A 3EPGA 1EKRA 2B4OA 1HW8A 2R3VA 2DGQA 3GR0A 4AQYJ 4BS2A 4F3OA 3MCOA 2PAVA 5ETKA 1QQCA 3EDRB 2G8VA 4RO0A 2QYCA 2BABA 3SAHA 3BH7B 3T1HF 3HHNB 1IO2A 4H5WA 2ZZNA 3C65A 3TABA 1ZBIA 2YWGA 3IGNA 4FJNA 4DV2F 1FNMA 1EQMA 1A5XA 4FZZA 3I32A 3BGRB 2YPYA 1I1GA 2QZ8A 3VWSA 4NI2B 4GVLA 4M41A 1VMBA 1NDKA 3KG0A 4JNEA 2HS4A 1HBNA 5IT0A 2R7XA 1HLUA 5HBMB 2UP1A 2A1BA 2AGQA 3CC4N 1NDPA 3R9PA 2B9XA 3FRZA 2PA8D 4RNFA 4IDKA 3TVZA 3M6VA 2HVHA 3FEXB 1PYSB 3L2UA 3P5TL 4Q8EA 1QSLA 4O3RA 3QFWA 1JQGA 1G3OA 3J7A1 3RZAA 2KTQA 3MUVP 1RA7A 3J81j 5C2CA 1FFWB 3UDVA 4CIGA 4LFAK 5KG5A 4WXOA 3C0BA 3CDEA 4PYDA 3AJDA 2R8IA 4QIFA 1JKHB 2OPQA 3RVCA 2ASPA 3FSXA 4URSA 4P2SA 1X5TA 3QPIA 1WBDA 5A8RB 5HN0A 5LMNK 4I6YA 3TAQA 2XYHB 3FCVA 3K8VA 2G8WA 4JYAJ 2I2YA 4CHPA 4K4TA 1SUQB 4ZIVA 4F2RA 4O4GB 4M3WA 2MKJA 3CMEN 1MWQA 6AT1B 2O8EA 3VAGA 3C6TA 1AA1B 2G0JA 4P52A 3FGVA 2HHQA 3CCUN 3OFHA 5D78A 5GAGU 1U45A 1RYSA 2R8JA 2ZBQA 5D0HA 3Q8QB 1GLJO 1M5PC 4ZCIA 3MAAA 2VICA 3T1HK 1MU2A 3KLIA 5EWGA 4DV2K 4LRFA 3CJTA 3KWMA 4AE5A 4N47A 2OA8A 3J8AA 2P1JA 2X6NA 4RWWA 1HNXF 1RBUA 3LDSA 2BA9A 2YKNB 3PRDA 3H46O 1NZ8A 3VR1A 2JEFA 2E88A 3BSCA 4JKFA 4LVNP 1L3TA 1TR0A 4F67A 4QR2A 1WEZA 2ASDA 4OX6A 3PACA 3OL8A 4DG1A 4QCLA 1P1LA 5AXKA 5CHIA 3SXLA 1S5ZA 3MUTP 1FEEA 3IS9A 4X4SA 1QUVA 5C10A 1BY9A 1A0OB 3LO3A 3SZ2A 4B1ZA 4FL9A 1H2VZ 1MROB 2FJVA 3PFOA 1S1UB 2LCWA 4JOUA 1IBMJ 5DG8A 3PRBA 4M63A 2UUBJ 5LXRA 3T5LA 1LWFB 1Q86O 4DV6F 4EZ9A 2Q79A 3W7BA 1ZTWA 3RBEA 1T44A 4M3XA 4RUBA 5KFTA 2P9KA 1HL6A 5D4NA 2G8UA 2G2OA 2ZJQL 3E9LA 1S48A 3FBEA 4TN2A 4FO0A 2M88A 1XQIA 3QO9B 4YFUA 1SJ3P 2MQQA 5EVZA 3RB6A 1FEHA 1NZAA 1O6XA 2D1KA 4E8UA 4E3SA 2A42A 2HBMA 3LA0A 2VZ9A 4DN9A 3CCLN 2GZOA 1RU2A 3FZLA 2X3GA 1M5SA 3DYAB 1NGHA 1IG8A 1LWCA 3TQ1A 4HACB 3VEWA 1I94K 4A8MP 1F21A 5LM7E 1PG5B 4L6V3 1HNXK 4NLUA 2XG8A 3VQAA 4CEBA 1EP4B 2DFFA 3VQ4A 5E3PA 3QFUA 5F0XA 4H0OA 2LXFA 3QSIA 1C0TB 5HQLA 1X7VA 3BYPA 4GO5X 4ZPVR 2DISA 4YHHJ 1NEEA 4IFYA 3QBCA 2GO8A 4AUKA 1VRQC 5BXIA 4ZLJA 4FF2A 1WI8A 3P6YC 3TARA 3DOMA 1DAXA 1M1HA 3GU0A 4PYAA 5U47A 4IQXA 3H5SA 3BN4A 4YOVA 1TP7A 1VQ4S 3TAPA 5CCMA 2ZH8A 3GE1A 1IJEB 2Z8QA 2NSCA 1BUPA 3UCGA 5A6PA 4DR6F 1F3FA 3O08A 2C3PA 4RBUA 3DU5A 4UTGA 2EWSA 3J7ZT 3IR6B 2MGZA 3I55N 3I5CA 3I33A 4Q0BB 3VGVA 4LRCA 1HYVA 1A9NB 3W65A 4GRSA 2YQ1A 3GMGA 3C14A 3MTJA 1WC1A 1LAWA 2DHHA 3ENAA 4AXJA 3MMAB 4OI1A 3GJSB 4LSZB 2YWEA 1MN7A 1ZM4A 2VQFF 5AJ3J 5A8WB 1A5WA 4CO0A 1PIEA 2KW4A 4U96A 5J2NA 1F9HA 3K7RA 2CGLA 1J5OB 1NGEA 1WWHA 1BL3A 1RWKB 2ZOFA 2IMWP 3CFPA 2E5JA 5AQOA 4C11A 3KK1A 3IO1A 5GMKa 4OL8A 4JI4K 3MR3A 2QWNA 2A6OA 4DTJA 1YUWA 4OYOA 3UI3A 2V4RA 5IXUA 4DPWA 2DHXA 3IUCA 2J76E 1X31C 1TUUA 4FVUA 1CBKA 1PAEX 1RU1A 1RTJB 1AB8A 1SJRA 4JI8J 1ZPWX 5F8LA 4C6AA 3LP0A 3LW5C 1S72S 4BC3A 1RK8A 2P9SB 3BZCA 5GAEP 3OTDA 3QT6A 3IR5B 3ZX3A 1VJQA 3DM2A 2M4MA 1YKWA 4ICLA 3VGLA 5H9EJ 4BRNA 4O23A 4F36A 4WFNL 3MM5A 4KKOA 3MEEA 1N6QB 3Q83A 5L1JA 4L3QA 5C25A 1SIZA 1QHTA 4OZ3A 3SMZA 4CT9A 3W61A 3W0LA 4J9NA 1SL1A 1P90A 2GO9A 1GX5A 4E1NA 4OPHA 3HVAA 2W7OA 2MHNA 4C8LA 1AUSL 4PUOA 3G25A 5AQZA 3SSSA 4AH9A 2E44A 2RHQB 4CF9A 4YDUA 3L4QA 4QYZJ 3H6EA 2XS5A 2VQFK 1V3SA 4KREA 5ETTA 2HSEB 1VS3A 4LF5J 3ZZRA 2HBQB 1ZBLA 3DLKB 4RPFA 1U0HB 4BREA 4M1KA 1HKBA 3QQCD 4QS9A 1RI7A 2AYGA 3A5MC 2B4UA 1B9FA 4ELUA 3KHLA 2P6SA 4CBUA 2HHUA 1S1VB 3NKYA 5G0RB 4DQQA 1D9AA 2BACA 4MAKA 4H0TB 2OSRA 3OVSA 2PGCA 3I9ZA 1J5EF 4K0KF 3AJ1A 2E9TA 3IBCB 4J8FA 1TELA 2D74B 6FD1A 5ADZA 2R7QA 4DU7A 1F2GA 5TKWA 1TVRB 4QWBA 3NL0A 2XI2A 2OH2A 4DV0F 2POKA 2YNGA 1HYZA 3R7BB 1WACA 4FS1A 4ZVUB 3CPWM 4Z37A 3G10A 1SBRA 1RT7A 3PLAA 2PE8A 2QWRA 3SV4A 4HTLA 3OYHA 4WYWA 4Q2LA 1HIYA 2EW9A 1N56A 5AXMA 4CDIA 1BQNB 4B9LA 2VBWA 1S22A 2N4CA 5IZHA 4U7UD 2C3YA 1DEJA 1HD0A 1JJ2M 4WFXA 2P5OA 1HNZF 1IKWA 2OPRA 4FPAA 4FOEA 3BN7A 1UPPA 2XBPA 2ADCA 4RCHA 1OQ3A 3M8ZA 2L41A 2QMWA 4G3IA 4ID8A 2ASMA 5GAHP 3M6WA 2B7BB 2CZVC 4DR3F 1TKTA 4L3KA 4OX7A 1XMQK 1BO5O 5CYMB 4J9PA 1F6TA 3TQEA 4JD2A 2IC3A 1YJNN 3UFCX 3M8PA 3JAMU 3CCMN 1XJWB 2W2MP 2UUCJ 1RYRA 4NYNA 3HO1A 2WW8A 1ITPA 1RTHB 4NLVA 3SV3A 3Q8RB 4CLPA 5BPMA 3A8KA 3DOLB 5AQYA 1Q95G 1J5EK 3V1OA 4K0KK 2ZBCA 3JXOA 2XY8A 3P4IA 5JMNA 1JJ2R 2HRTA 2DNGA 2ILZA 4LF8J 1WBBA 2UVUA 2EFOA 2OTLS 5J2QA 2QXFA 4Z4EA 3S41A 4DV0K 3KWGA 4I2QA 3BBBA 1REVB 4LSLA 4I1TA 3CPEA 1DRZA 3K59A 3UR0A 5KI6A 1UWBB 1YF5L 4DS4A 2B8PA 4FXVA 5AFUH 4ITSA 3OYGA 1M5VC 3RYLA 3T1YK 2B5JA 2JEIA 4Y3CA 2OZSA 1JX4A 3QIDA 3T3FA 3VENA 5G4DA 3S9HA 3BO3A 3ZSVA 3P1GA 4CZGA 1QTNB 2BOAA 2LXUA 2XO6A 3NWGA 3BV8A 3UN5A 1N88A 4DR3K 4LRDA 3BF1A 4ZDNA 1KVKA 2HHWA 4ELTA 2VGMA 4OHYA 4TQRA 3CWJA 3E51A 4Y65A 1IBKF 3NOCA 1PILA 1FE4A 4MFBB 2IGIA 1FRHA 3VVTA 1KQKA 3OS2A 3MHYA 4FLUA 3AB2B 5CE3A 3VOVA 2VFVA 3MFHA 5DETA 1SQFA 4M5KA 2FSJA 1NSAA 3AOBA 2YNHB 3OR1A 4A2BA 1S6UA 2YY3A 1IKXB 1EETA 1RWMB 2VBZA 3HSJA 3WXMB 1WNEA 2CWXA 1HW9A 5JVHQ 1T95A 3QAUA 2QFIA 3SQGB 1JLAA 5AQUA 3CCTA 3NCPA 3H0PA 1G6BA 4NCBA 2GGPB 1GXLA 2I7PA 2EKYA 2YKMA 3PIOL 2E7WA 4F7VA 1E4GT 3T41A 2NRZA 1GLEG 3ZSXA 4KHPF 1YVFA 5KFIA 1R0AB 2FQQB 1NWKA 1FX2A 1FDBA 3HT0A 5B0FA 1H72C 3F2KA 1VRTB 3R97A 2RH3A 4MT1A 4FWRA 1RAHB 1EZZB 5AT1B 2PO4A 1SS6A 1SL2A 3LPTA 1UVLA 3BO4A 2OTJS 2DHGA 4KY3A 3HL8A 2B6AB 1S10A 4U7BA 2ZWHA 4KI4A 4P10A 4CH7A 1GXTA 2NUHA 3KLHB 3QJPA 3CF5L 5BREA 4LC9B 4BE1A 4DLGA 5F8JA 4IOBA 3WUHA 2HMIA 5D3GA 1IBKK 2VV5A 2F9JA 5KFVA 4ECRA 3C16B 3P83D 3CD6N 2J0QD 2H3GX 2LP4A 4WZQA 4KE5A 4TYBA 3C8YA 4NLWA 3DRPB 1CG2A 4LQ9A 3PYFA 4JKAA 3SQOP 2NYHA 2F3JA 3G6ES 4Z4CA 3QDKA 2P9UB 2KVIA 4JI3F 4F2SA 3A8YA 4CJFA 2ZUGA 2YPZA 4OJ1A 1DY3A 3ASMA 2XO7A 1S57A 4I69A 2QTDA 4Y1DA 2Q31A 5KPRA 1FVQA 3ULEB 1L3UA 4H54A 3RB3A 3EKUA 4FWOA 1WKKA 3ZZUA 4FYWB 1AYEA 2DNNA 1HWUA 3J7YI 4DEZA 3ZZYA 2ABYA 2DGXA 4BRGA 3OYJA 3DOKA 3CJ9A 2DGVA 1T7PA 1S59A 3MM9B 1ZS6A 3HJFA 2WSEC 2RRAA 1G4CA 4F3QA 2DGWA 1T94A 3ZX0A 4QW9A 1Z25A 3OL6A 2HHVA 4CO2A 3THXB 4QBUA 3C3LA 4OPJA 3GYNA 2EFNA 4J37A 2KFYA 2BOPA 1UA0A 3ITHB 4K4SA 2V5HG 4S0MA 3TSUA 4X4TA 1QJHA 1TL5A 1VI7A 2PFFB 3TZYA 1RDCA 4CJEA 3CJ0A 2PFUA 2Q0UA 2WVDA 4NLYA 3KWIA 2OANA 4IOCQ 4O0JA 4BDYA 1C1BA 3O9RA 4HHJA 4WQ5A 2P9IA 1HWLA 2BE2A 1M90T 4Y2KA 2KI2A 2HQ3A 5JLHA 3OTOJ 4KYZA 4WCEL 1W25A 3N79A 1KBRA 4LBIA 4JI3K 2KYZA 2VKZG 4WTYA 4W5RA 4GV6A 4UW2A 4FOIA 2RD5C 3E01A 4BWJA 4F0KA 1OMSA 3LTOA 4I7FA 3THVA 3P45B 2M52A 1D0EA 3L09A 4MK9A 3SCJE 1HNWF 3D2EA 1CSJA 2Q6BA 2KL8A 1SQEA 4DJBA 2A2CA 1U2RA 1SB6A 3CJ3A 4PHTX 1HBUA 4CLWA 3DI6A 4WFYA 1WTFA 4DKWA 3W2VB 3BQ2A 4DSKA 3THPA 1AT1B 3OJSA 1S1XA 3OHRA 1TKXA 4GMJB 3UNYA 1JXLA 3UVJB 2JNJA 3GLJA 1GOAA 2A1SA 4CGGA 2JRSA 2FHOB 3CB4A 3C66A 4FCYA 3I56N 4EAHD 3MEGB 1NNDA 1N5YA 2J7KA 2JZ5A 1R31A 3M2RA 2RT3A 3THWA 5I3UB 5KAKA 3G6YA 2E66A 4H4KA 2Q0RA 1JK9B 3M2VB 4H4OA 5J2MB 3H4BA 2HKEA 4AL7A 2CQCA 2C3OA 2QMUB 4I9LA 2CJYB 3A1YG 2EFPA 5GMEA 4NXMK 3US5A 1N0UA 5JXSA 1S7IA 4F4YA 2CAJA 5EU7A 3BKTA 2QWQA 1Z05A 4E7LA 1HNIB 4DTOA 3DDKA 1X4BA 2Q3PA 3WHIA 4HUFA 4CZHA 4EZ6A 5DGBA 2IY5B 2HHHF 3FJ2A 4O0IA 4OYAA 5DDRC 2DNOA 1T3OA 1U0SA 2MZ1A 1DARA 2XSFA 2AW0A 5KG1A 5E0OA 2HNYB 2CQ4A 1ZAVA 2D3OR 2EHGA 2ZJPQ 2X74A 4DTSA 2XNQA 1H7XA 2BJ1A 2D41A 5BR8J 3ZLJA 3EN9A 3VEVA 1X3NA 1OH8A 3KOAA 1WSIA 2GIRA 3KMQA 3DN9A 3VF0B 2E1ZA 1JLGB 3V2UC 2XEXA 1G99A 1NH8A 3MCMA 5A2QY 4LFCJ 4IJAA 3H2LA 3SBTA 4F50A 1FTRA 3K8WA 3P39A 2M70A 4X4UA 4O8KA 2GWJA 2RHKA 2NQPA 2RDIA 1C0FA 4X65K 3RWUA 2D9OA 2X7IA 3UD4P 3H1VX 2LYVA 3R6LB 1FTCA 2HVDA 3MMCA 5EWFA 4OFZA 1PCAA 1XWLA 4Y2IA 3A3NB 4X62J 3HOTA 2FJWA 1Y10A 5T7LB 3KLFA 1HI8A 4AXIA 3SSRA 1B9DA 1JNZB 3POTA 5SWMA 2ZH2A 1K0VA 2P9PB 3WEEA 2ZDPA 1LXNA 1V6HA 4AQYF 4WE1A 1WC0A 3I96A 1W7AA 1JXEA 3D2WA 5HRRA 2EK6A 1XN9A 1XERA 4JI1J 4YB6A 3VQ5A 1MMLA 4M45A 1U2VB 3GFYA 4NPOA 3KTQA 2F40A 2Y0SD 4P7VA 3IBWA 2V2VA 4OHZA 1F1BB 3QGHA 4IH6A 4O0NA 1KVJA 4Z7YA 2ALYB 3HHEA 1WOQA 4FWPA 1FXXA 5E41A 2W24A 2Z2LA 3NXZA 1LEOA 1SC6A 2BUNA 2R7RA 3LGMA 3H45C 3BGRA 2AD9A 2CDRB 5HP1B 3WXLA 2RF2B 4NI2A 3DXKB 3MPUB 1RJJA 2QLXA 5HBMA 3OHBA 1BIUA 4F02A 2ZBIA 1U25A 3B54A 2FJEB 1GLAG 3OBIA 2LEBA 3SDEB 5GMDA 2WVBA 4KH0B 2QK9A 3OFFA 1EIYB 1F0XA 4GC7A 2IVMA 2UXDF 2YQ0A 1NUEA 5DLGA 1CJUB 1UCNA 4FWMA 1JKHA 4MLHA 4PPZA 2BRKA 3G9CA 4KTZA 2BRLA 1RA6A 3NS6A 4JKCA 5KG7A 1VK3A 4JI0J 3HI9A 4I6MA 2V2ZA 5A8RA 4AQYK 1JMTA 2ACYA 3HF5A 2HBLA 3CJ7A 2VG5B 4O4GA 4CTAA 1YXQA 2QA4N 2E1RA 5CD4A 4IG0A 4LIRA 1UJ4A 1SC3B 9ATCB 1HR0F 4DPOA 4CZFA 4ED6A 1FKOB 3AARA 4C2MA 5KFHA 2UUAF 4LMZA 1VC0A 2HF3A 4WBFA 1RAEB 3N6LA 4GNIA 1OY9A 2AMCB 1L3KA 2MJNA 3T9ZA 4R8UB 1U1NA 3D1OA 1P9QC 2O8DB 3K57A 2JFDA 4CEFA 2FD2A 4NB4A 4GV3A 4E1MA 4AHUA 4LVOP 4XPEA 3CW2C 4LUBA 4PA1A 3MXMA 1YT3A 1WSRA 2H3EB 1IKYB 4FLWA 3B8AX 2VPYB 3AJ2A 1SCJB 4CGDA 3CI5A 2YKNA 4F9OA 5K8PA 4DZDA 1KVIA 2HGLA 2DH7A 4FDFA 1YJVA 2R9LA 3ZZZA 1HQUA 1KAYA 4P73A 3MOZA 1KD1T 2UXDK 2L3MA 3OS0A 1G1XA 1YJ9N 1J6ZA 1V5VA 3IWLA 5CYQA 4PWDB 3AVNA 2MEWA 5E3QA 1MROA 1QQMA 1TMMA 2AIRB 2E5GA 2K3IA 4PAAA 4F4WA 2VONA 1KLMB 4FK2A 2GWKA 5T41A 3TR8A 2H65B 2F65A 3BDPA 3AGKA 3F9MA 4YY3J 1LWFA 3GJTB 1BQXA 4RX6A 2VFUA 4QS7A 4JKGA 1NK4A 3AV9A 2V4QA 1HR0K 5C12A 1J9AA 1FKAF 1KVBA 2MQLA 2VQEJ 3KFWX 3JAMO 4YUDA 1IBLJ 3H5YA 2PN6A 3U1LA 1S9EA 4O5BA 4CNYA 8AT1B 1IQTA 4UF4A 1U8SA 4IYQA 3DKDA 1XNRJ 3VQPA 2QYGA 3L8BA 3HULA 1GLDG 4QAGA 4XK8C 2Q97A 2M8DB 1CJVA 1E4FT 4TKTA 3NF7A 3B6PA 3AODA 2XZTB 2OD6A 4DPTA 2PMZD 3DYAA 4TU8A 3GIRA 4BLGA 3M05A 4WQ4A 5LJ5Y 3V6JA 3FRYA 4B3TF 5EY4A 1EP4A 5DZ7A 1EB0A 2DY9A 3J81Y 3AAPA 4IG3B 2O3DA 3DXMB 2E1YA 2IRXA 2XMAA 1C0TA 2Q2RA 2YJFA 2H54B 3VA3A 2MKIA 2Z58B 1UEKA 1N36J 2VFRA 3LAKA 3I55S 3O2IA 2DO0A 2BE7D 1B0PA 4U7UK 1RAGB 4RJVA 1VCTA 5A0YA 4USWA 4YORA 3LPUA 4KHRA 1NGBA 1NKBA 4FLVA 1LXJA 1R8CA 2B9EA 2DR9A 5SZTA 3KKSA 2OJ3A 3MURP 2G2ZA 4HLBA 3AAWB 2VASA 1WG4A 4LH5A 3W3DA 4RU9A 4BE2A 2QFJA 4HUEA 1KKHA 4CW7B 2BJDA 1UL3A 4RW8B 3VTIA 3I0SA 3NMRA 4CLUA 1U02A 3MMAA 4PWUA 2FF3B 1RT3B 2NREA 1S0OA 2MLYA 4V19S 1YSJA 1T9VA 5AE2A 3E9OA 3PYGA 3FQKA 2E5LF 3TX0A 4L8RB 1H0HB 3FLCO 5C2DA 2AT1B 1I6JA 1VHFA 1JWWA 4U95A 4B3MJ 2DEJA 2X1BA 1N48A 5H1SV 3UR3C 1YK9A 4DR5J 3RAMA 3KLGA 5GAEU 3UKRB 2R42A 3PV8A 5F9NA 3DDNA 4OI3A 2QI2A 2W2PP 1KDNA 3OPKA 1BISA 4B9QA 3BSNA 4IFEA 5CH7B 1BA1A 3UKUB 1H38A 4FNHA 1M90O 5IC4B 3MR6A 2X1GA 3GV5B 2M2BA 1URNA 4CJTA 2W9CB 2C3MA 1Q7YT 1RP5A 4K4VA 2ZD1B 3W8PA 3ZZTA 2J7WA 1BXNA 1N6QA 1RHMB 4WFAQ 3DNCA 3R5BA 4DQIA 4PXCA 4MMOA 2FXUA 5LMUF 4I6AA 5B0CA 1FW6A 4M42A 2AYBA 1U26A 2WBMA 3FNNA 3KDOA 1UZDA 4DR4J 3JSBA 1WN7A 1NOYA 1RGIA 3SUOA 1NDLA 3H40A 3W2WB 4J9SA 1X9WA 2CPHA 1GEHA 1UEUA 2XHCA 1TZ0A 4H5RA 4JV1A 4PQUB 3TANA 1U0HA 5HMYA 4NASA 1CULB 1Y3KA 3AD7C 5MLCV 1X5PA 4C48A 3D0GE 2ZBPA 3FZKA 3KUHA 3M6UA 2NXJA 1T8EA 3MAQA 3A0IX 3NAHA 1S1VA 5IT9Y 1ZM3A 5G0RA 2AJ0A 3P49B 3C94A 1BI4B 1HHTP 1GTHA 5H9EK 4J5OA 3K0SA 5F8HA 2Y1LB 2IM3A 5AQLA 2G2YA 4U67L 3D0PA 4N5SA 3GPAA 3GP9A 1PJ5A 3R27A 2ZH4A 5EHHA 4A8QA 2KN4A 4PKGA 4RW4B 1JJCB 1NGDA 3FE1A 3VQ9A 4O5FA 4Y00A 3IRXB 3QBXA 4K8ZA 2NXCA 1U47A 1TVRA 5LMNJ 1RAOA 1ZA1B 3O1BA 4A62A 5ETPA 3L3CA 1XI1A 1TV6B 4BG9A 2YI1A 2KDOA 3O1WA 2ZOGA 3L7OA 5H1SQ 3TTFA 1VQSA 4CJWA 3M2UB 2KFNA 3A12A 2B4VA 1QD1A 2OKQA 1ZETA 2M0GB 2B43A 5LMUK 4LF5K 3D68A 4FJGA 1NCLA 3CCMS 1HARA 4OKEA 1C0UA 1HBNB 2IVOA 1ULRA 1NJYA 5F1XA 3R5AA 5AQPA 3TEGA 3T1HJ 2C22A 4CJQA 1QZ6A 3M1FA 2RB7A 1WSEA 4CM0A 3EZ5A 2QIFA 5HRNA 4DV2J 3JYTA 1S76D 4LH4A 5DJBA 2R2SA 3G82B 4MIBA 4DV4F 3ZNJ1 5CYMA 1QZ5A 3HJVA 3D0IE 3EZUA 5GAGI 2OPQB 3M3ZA 5JVHL 5HQ8A 1YI2S 4LF8F 3GG0A 4F4ZA 1QVGM 3RRGA 4DMNA 3NGZA 4ZJLA 4BC2A 1LW0A 3M8QB 3BR8A 2WTFA 1RTHA 3HBTA 1K47A 4O3QA 3PW5A 1WDDA 4CEEA 4LF4F 4M7XA 3DFEA 4M5JA 2CPJA 4URQU 4RW9B 3DC2A 2VWKA 4LFBF 3P3DA 2O8EB 4OYIA 1ZC6A 4DR7F 1YJ7A 3SSQA 3AA5X 2J8SA 3NAEA 3DWLA 4M3UA 5AQXA 3WX4A 4JHDB 4MK7A 1RWXB 3DRRB 2J0SD 4A8OA 5CZXA 1REVA 2V7YA 4CZJA 1KLNA 4XH5A 4RW7B 3SNNA 3CCWA 3MAAB 3VQQA 1MU2B 1P8ZA 3WZ0A 1X4CA 2R4FA 1UWBA 3KLIB 1CLFA 1BQMA 5HSPA 1Q9XA 5L46A 3QZ7A 5IT4A 4C8ZA 4DN0A 3T1AA 4FPBA 1SL0A 1WD6A 4IBNA 2FHJD 1QVGR 4ANDA 4NXNF 4BG8A 2W41A 3VEZA 1MW7A 1ZOTA 2HFOA 2GX8A 2YX1A 3CDBA 1Q82O 4LY7A 3BYRA 1GLFO 5HAOA 1FWLA 4OVLA 1F2HA 4DG1B 3HSCA 1MWZA 4DV4K 3CM5A 2GUIA 1HNXJ 1M1KT 3QT7A 3LDOA 1TUWA 3IS9B 5J1EA 5HLFB 4B1WB 1ZTTA 3HYFA 2DRAA 4H0VB 2YNIA 3WNFA 1ASVA 4ED7A 4LF8K 3UPFA 1APSA 3R8EA 2OO4A 1ASWA 2XLJA 1HFEL 2YNHA 3VGMA 3MCPA 3CCZA 3TX8A 1IKXA 4KC5A 5C2GA 3HM9A 3MZIA 4LF4K 5M1FA 3HKZD 4CE9A 4C9DA 4LFBK 4RZRA 4Z94A 3UD3P 1JJ4A 4KB0A 4DU8A 5FLXY 3RSEB 2ZH3A 1URRA 4HEA9 2QKBA 2GGPA 2OLWA 4QWAA 4C1NI 2MMYA 5ETRA 4DV6J 4DSLA 4JI7F 5C5JA 1R0AA 4B9NA 3TSPA 3LZJA 1SKWA 5DG9A 4DFKA 4M3RA 2GVZB 1VRTA 2FB0A 5LJWA 4WU2A 4C8OA 4IOCL 4OIXA 3O5TB 4IOAQ 1N52B 3R1HA 1FXRA 2B6AA 4NLQA 4ZKAA 5HANA 4B3SF 5D0RA 5KGXA 1WF2A 1NHKL 3IFRA 4NLOA 2BGGA 1YRTA 2VB6A 4IFYB 3FBBA 5IC6B 1UVJA 3SK3A 1T02A 2VD3A 3R6GB 3NMAA 4ZCMA 2ILYA 3HXMA 3O6WA 1FRIA 3C16A 2XHBA 1WC6A 2JC0A 1KAXA 3DOMB 4CGHA 3AD8C 3DRPA 1NDCA 4KGXB 4BC4A 5DM6L 4B9TA 5I42B 1Y3JA 4KRFA 1VQ9N 3E66A 3I9V9 4CEDA 1UFLA 1YRUA 3NLCA 1S6OA 1NHUA 1KQSM 1RSCA 4FW2A 2KKZA 2CH5A 1KD1O 4ZPDA 1QQNA 2VG6B 1N5SA 4ER8A 2FVSA 2HFNA 3AVCA 4DR6J 3R8YA 4E7HA 2V6AA 1Y5IB 3DRXA 2W6KA 2HHTA 2QWPA 3MM9A 1VQ4N 3J7YP 1HLWA 1WAFA 1W0HA 4DXLA 5D8HB 3UDEA 4M3YA 4DMZA 3THXA 4OYMA 3RTVA 5E33A 2RN2A 3W1YC 3D7EO 1T9UA 2DRDA 3MMVA 4C11B 3KK1B 2MDAA 2AWZA 4KFBB 5AQWA 2E2NA 5I3PA 1UW9A 2VQFJ 4B3SK 2HQDA 3WNGA 1CEZA 4DSFA 4U9RA 1RLDA 1U2CA 3AO3A 3QINA 3ALYA 3P8BB 4NCGA 2XNRA 4B9UA 3NF8A 4ICLB 9RUBA 3B8HA 3QEIA 3Q86A 4FM2A 3IA0A 2Q36A 4ZHRA 3JTOA 3MM5B 4X4VA 3WDOA 2W9BB 4BRDA 1OPIA 4DUZF 5C25B 2VCPA 4QOTA 1NGAA 2ZJPL 2M8HA 1RBOB 2GCFA 2QWLA 1UPMB 2P8IA 3MM8B 1XK8A 4OZJA 2V8HA 1S72N 1VSKA 3HRGA 1JCEA 3G2XA 2JFKA 5BYSA 3ISNC 2H5IB 3I56S 2W9AA 4I4BA 4M5LA 4NX9A 4J2EA 3MI7X 4DTMA 4MIAA 1YJTA 1SJFA 2HHSA 4NYPA 2VYPA 3OA9A 2BJEA 3OYKA 5KFUA 3PCOB 4D3GA 2AJ1A 2D0PA 2GJ2A 4XPCA 1PSDA 3NG8A 4YN3B 2OFGX 4DL3A 4ED0A 1M0SA 1HYSA 1OH6A 2NCKL 3A5NC 2ATCB 4E98A 4IO9Q 2HZAA 4BWMA 3C6HA 5AFUA 2DY4A 2CQPA 2I0XA 1RCHA 4FM1A 1ZBUA 3CCRN 1U04A 1DBDA 3J7AN 1JL2A 2QXLA 2X78A 2AGPA 2FC0A 2F4FA 5ETOA 3JQKA 3M2VA 4IKAA 4PY5A 5GADI 2JH3A 3TAGA 4MKVA 4UT4A 1B4SA 1RGVA 1SKRA 2GHWA 2ASOA 3ZSWA 2RMLA 3AOAA 5B0BA 2DB1A 4AILC 3VAMA 4N56A 1J5EJ 4K0KJ 2FF6A 1NK5A 1RT7B 4OYBA 3S1TA 4NLRA 2O4GA 1FA0A 1HNIA 2F5GA 1WHVA 1EO1A 2I7NA 2YX6A 2VOOA 4YDUC 3L2WA 2IYIA 3PDNA 1KFDA 3T6BA 4BACA 4DV0J 1ZPVA 3H5UA 4RW6A 3CTRA 3FSYA 2BR0A 3ID6A 1IKWB 1NKEA 3FC9A 2OPRB 4UY8O 1FVSA 2V68A 3AVKA 2DNPA 4IO8A 2YHWA 1N33F 1Q8LA 3ATUA 4FJIA 4H0XB 4P2MA 2G1DA 4HHTA 5DQHA 3NS7B 3EGZA 5BR9A 2F8SA 4WXWA 1HNZJ 2IC3B 1YRXA 3M8PB 2F8EX 3THYA 4RWXA 1JLGA 1NGCA 4LRBA 3VAFA 4K42A 4EHTA 3EY1A 2OUGA 4J9KA 4DR3J 1VQLS 1AUDA 2BH1A 4LF9F 3TVYA 3QZ8A 5KFOA 3QEVA 2HHXA 3CMAN 2N4DA 2K1RB 3E8OA 1IN0A 1HPMA 3IM9A 4PG4A 2HGMA 4WP3A 3SBGA 1UA1A 2GQQA 3LM9A 2NR0A 1IJFB 2PMWA 4FBTA 4ZPWR 4I2QB 4LSLB 1RT2B 4OLAA 3LPYA 1ITGA 2UUTA 1WNSA 3CDWA 1XIQA 2EK1A 1JLFA 4CF2A 2P9PA 2D3O1 3W5YA 1WAJA 2ZVIA 3WC0A 3AFGA 2LU2A 2OCEA 4B9MA 2MZQA 1MDUB 2ZGZA 5AQSA 5BPLA 1HPZB 4MKBA 4F0MA 3CCEN 1HQEA 3FUYA 4LFCK 3H42A 1OH5A 2W4DA 3G71S 4B3RF 4B08A 4R25A 2DNLA 2VBYA 1ZM9A 3HX9A 2UXCF 4QZVB 2GJFA 3HLUA 4C0BA 4BRCA 3O9QA 3HPGA 3AGRA 4HVZA 5ETLA 4CBXA 4WK3A 3QRPA 2RF2A 2HZVA 3OR1B 4YR3A 3BKUA 3DXKA 3OSPA 3AD9C 1WC4A 3TZXA 4LF9K 4JN4A 4X62K 4NLGA 1IBKJ 1OWXA 3FCWA 1HA1A 4QIWD 1RBTA 1VGYA 4CP5A 3IXQA 3TUIC 3SDEA 2HRYA 1ATSA 3IAM9 4FS2A 2HQFA 1Y5NB 3EE9A 2AEMA 5C42A 4DCJB 4DQ8A 4JI1K 2YKMB 1JJHA 3QGIA 2QWMA 5HVFA 3DGVA 1U6ZA 2CFXA 2Z1GA 3OL9A 4OZ2A 3L2QA 5EXWA 3W9HA 2ZF5O 4CEQA 1ZBHA 5K8MA 3CG7A 4GV9A 3K5PA 2AX0A 2W2NP 3VQCA 5KFSA 4IZ9A 5AQTA 2VG5A 3N4QA 4X4PA 2DGTA 3EYZA 2CQBA 2K3KA 4KHPJ 4NA2A 1FKOA 3HVWA 1TL3B 4H8KA 3NGRA 1BUXA 4FSVA 3GCXP 1RT6B 4IEEA 2DR6A 4KH5A 3QMLA 4X4NA 4O3SA 4RNHA 4RR5A 4HTUA 2UXCK 5DRKA 3NDKA 2R2RA 1YJ9S 3NH0A 3OYEA 3U7JA 2BE9B 4NYFA 3HP6A 3W3SA 2VUGA 4FVCA 1FJGF 1JCGA 2LA4A 2OTJN 1WF1A 2DEIA 2CQ1A 2O66A 1NPRA 2RPIA 2CPIA 3I8BA 4PL8A 3K2YA 3NH2A 4JI0K 2H4WB 2BQ3A 1M1KO 2CQ3A 1VSMA 5L1LA 1ZZFA 1PJ6A 4DQSA 4L73A 2HFVA 2JEGA 2WW4A 2Y0BB 4JI3J 2RHSB 3ELHA 2KT3A 1DTQB 2ZOMA 3OT9A 4GVBB 1C4AA 4ERDA 2KM8B 4JI6F 1Q8IA 4UUXA 3NVKA 1UZHA 5TKYA 1V3RA 4ZJOA 3LM2A 2J4RA 3MX2A 3D9BA 3FMWA 3CJ1A 2MLXA 1VQKN 4G1PA 2R8GA 3ZTRA 3H59A 4KHNA 5ETMA 5F0WA 3I0RA 4R5PB 2P9IB 4DZ6A 5FD1A 4C7QA 1VJWA 1S4FA 3ISZA 2WSCC 4CEOA 3MDFA 2B4JA 4JI2F 1JLEB 3HHLC 4EP4A 3DLJA 2JLEA 4DCPB 1R59O 1D4XA 4A8KA 1NNEA 2P9GA 1A6LA 1OY8A 5HI7A 4V19J 3DXMA 1VQ5N 5EX5A 1Y5LB 4CI6A 2PA3A 2L9DA 4CJUA 2J9CA 3E01B 4I7FB 4B8AB 3PX6A 3MCNA 3CC2S 3VF6A 5KPZA 1F5AA 3OYAA 3BREA 1FT8A 4I2PA 3B4DA 2R7SA 2O01C 2DR7A 4OV1A 3PW7A 1RTDB 2NZ4A 1X9JA 5J1NA 1HBUB 4JI5F 2RRBA 3DI6B 4JI6K 2CZ4A 4CJKA 2R8HA 3H5XA 2OYQA 1NLKL 2HBKA 1HNWJ 4J2AA 3HMJG 2W25A 4DUYF 2H51B 2DTUA 4HYKA 4WYBA 1Q1KA 4K5RA 5F8NA 1X8DA 5D4OA 2CWKA 1EKEA 4WQ5C 1IM4A 4CFBA 2YJEA 3TRGA 1RTZA 4ZVHA 1RADB 2Z30B 4PKDB 3M2RB 4KRWA 1RT3A 3MXHP 3CD7A 3JTPA 3R5JB 3PXGa 2LXIA 3JTNA 4H4OB 3GOIA 2J9DE 1YG0A 3N6NA 2HZCA 2GMJA 2ZVSA 3M9OB 3D3CJ 1YDLA 4YDXA 1GQEA 3D5MA 4JI2K 3QERA 4BR2A 5F41A 1N5VA 4E89A 3F73A 4CZMA 2QLWA 4CK2A 4JLHA 2WUSA 4NYZA 4ZJQA 4DHYA 4KHMA 2XB2D 2Z0GA 4FN5A 2BVZA 1HWIA 8RUCA 1Q79A 4A2AA 4EFHA 2WONB 3D0HE 2K2PA 4PWWA 4Q44A 1LV5A 3NH1A 1OQ6A 1SQKA 3UKUA 3MOJB 2FLLA 3CXCM 4M8LA 2DRBA 4NRTA 3LOUA 3SMSA 2HHHJ 2W9CA 4E19A 2ZD1A 3ENWA 2AX1A 4DUYK 4G6VB 3R2DJ 2NUUG 3G4SN 1Q4RA 3BM7A 1UJ6A 3LGNA 4CLSA 4K2JA 1Y11A 4CRJA 1Q18A 4KBOA 2IAJA 3QJLA 1SIWB 4H4KC 2KU7A 4QW8A 2Z1JA 2G8HA 2Z2ZA 2BJ9A 4OYXA 2GMLA 1IR1A 4BROA 3KLEA 3DRYA 2M5YA 4Y1CA 4DR5K 5BJRA 1VSHA 4FK4A 1NH7A 4OJHA 4ZOSA 3MMCB 2WC9A 3CXCR 4PQUA 3MPDA 5ETVA 4FK0A 1LAVA 3KLFB 3TJAA 5C24A 4DFJA 5AQFA 3RBZA 5CR4A 3WEEB 4KV8A 3PHTA 4WE1B 4PCQA 4X66F 4GC6A 1RWPB 2HBRB 2B56A 3OLBA 1ZAWA 5KFXA 2R2UA 5KQDA 4FJ7A 4NEZA 2GFFA 1HMVB 2WB4A 3TA2A 2KQ2A 1QM9A 1QE1B 4RLEA 4J9QA 3IRXA 1FXLA 2QTWA 4NLTA 3WIVA 3VESA 3PR5B 1TV6A 1NGFA 4EYHB 4NZ6A 2MZRA 4DR4K 4OPAA 1K8KA 5E7OB 2WK4A 3M2UA 4PEOA 2O67A 3EUNA 3ILOA 3TP2A 4NO7A 3OL7A 2RKIA 3C7NA 5LJ3Y 3ZSQA 4YOYA 4J2DA 1O0PA 1RKJA 3F56A 3G86A 2GUPA 2BKOA 4YOTA 1XMOF 2AP6A 3UCZP 3ZZPA 2YTCA 4JAXA 1TK5A 3OLAA 2FHMA 3TJ8A 3LDPA 4Z4HA 5DS7A 3JSRA 2AHOB 4ZVPB 2PFDA 3M8WA 3DLBA 3G82A 4J9VA 4NLSA 1VYAA 1KVAA 1CLQA 1X9MA 4ED8A 1NM1A 5LSOA 1WEXA 3Q8YA 2ZUAA 4CF0A 2O8BB 1MWYA 3N28A 3CCSN 3CD0A 4ZIWA 3IM8A 3GBTA 4I6MB 1TL4A 5M1PA 5M1KA 4FJLA 4CH0S 4DR1F 5GAGP 3V1QA 3IG1A 1LK5A 3M8QA 3EM1A 2VH7A 1XBWA 3EE3A 2ACMA 4QPTA 4X66K 3V6DB 2UXDJ 1NSKL 2GIQA 4ECTA 4CTAB 5HRSA 3MUMP 4RW9A 3BP8A 4CNZA 4P2XA 4IG0B 2MY8A 4LT6A 4GVMA 4PG7A 1U6FA 2VODA 1WDTA 4JHDA 3DRRA 2VBXA 1KFSA 2RU9A 2QL7B 3PJWA 5DG7A 4RW7A 4ENOA 2YX7A 2G8FA 1CZ9A 4DL2A 5KT4A 2X1FA 4UQGA 4IOAL 1HR0J 4DPXA 1RB0A 1DJ0A 2A6MA 1DFDA 4DCHA 1RT4A 3OYFA 2UUAJ 2KXHA 3H4DA 3M30A 5KFQA 4P72A 1Y00A 4AFFA 1XR5A 2MLZA 5A2QU 3NNAA 1CS4B 5AQNA 3QESA 1ZZNA 4BC9A 4BHQA 4OZ1A 3VTHA 4O8UA 1YLXA 1HQUB 3A5OC 4ECQA 3VQSA 3ENBA 2C2DA 3HSTB 1VQ6S 2FC8A 1N5QA 1FERA 4WIQA 4MJKA 5HLFA 3R7SB 4EK2A 4PL7A 3JQMA 4MQ3A 5CYQB 2ZJRL 2FHJA 3DLLQ 1BOTO 5JVGL 4DR1K 4N7TA 4A8SA 3Q89A 2KKHA 3DLGB 3J80Y 3HK2A 1U7LA 3EO3A 4LSNA 5IM0A 3O9UA 3Q8PB 4FJKA 2R7UA 4ILMA 3BF4A 4QWDA 4JKGB 2X6SA 3VERA 1VC5A 1FJCA 1IUJA 5DZ6A 3O5BA 1KTVA 2BQUA 5KFKA 1NHVA 1S9EB 3RSEA 3BBFA 5CA5A 3AT1B 2GW8A 2XMUA 2XLIA 4IRKA 3VA0A 2UVRA 3E2EA 1CJVB 2FYXA 1T03B 4CBWA 3AVBA 1FD8A 2I9SA 5M1NA 3I31A 2GVZA 2MKHA 3V81B 1BA0A 2RUSA 1KXPA 3CYMA 4DLEA 3OS1A 2BW2A 2YVSA 4B9VA 3RW6A 4JRQA 4KB1A 3AXMA 4M95A 5FPMA 3OTBA 1VQ9S 1GH8A 4LR9A 1S4EA 3IFEA 2DGUA 4B3TJ 1BGXT 2IOCA 1L3SA 3PO4A 4H4MB 4EYIB 3IR7B 4K8XA 5A0YB 2ZJQQ 4BGBA 5LOQA 1BWEA 1PC4A 2QWOA 2RQCA 4CI0B 5I42A 3CQYA 4DV6K 2CQHA 1CXQA 2XSJA 1KCFA 2FBTA 5BN8A 3KZBA 2Y9HA 2WBNA 3PIPL 4YB1P 3NFAA 3J7YU 2A3ZA 2HMPA 3KG4A 4MDBA 4CZEA 3TR5A 4ES2A 2HK3A 2VG6A 4JK7A 2YWFA 3NY0A 5K20B 4K41A 3FSIA 3I0SB 2DGOA 3O3FA 3BSAA 5I9EB 4CHYA 3PX4A 2NRTA 3Q2SC 2B7CB 4WQ4C 1O8BA 4DU4A 4FWNA 1B7YB 1VBXA 4NLDA 4IO9L 1VHXA 3QFHA 2DNZA 3C19A 4QIEA 3IAYA 1TTHB 1O51A 4W5TA 4CJ3A 2CPXA 1OVYA 4N8NA 3ZYYX 4KFBA 3R1LA 1RT1B 4IR9A 2Z1HA 2D3UA 3GG4A 1EARA 3KLGB 4CZIA 3GONA 5M2UA 2E5LJ 4BR0A 3KK2B 1VLOA 5K8OA 2ASLA 4QU7A 2BEFA 3H3OB 5FROA 1ATNA 3NGUA 4CLZA 4B17A 3VN5A 5KFCA 5AE3A 3PW2A 1WOOA 4AD6A 3CM6A 3RR8A 2L9WA 1QQOA 3V9UA 2ZH7A 1GLLO 2UYTA 2W9BA 4DR6K 1MMDA 1P1TA 4U8YA 5LSRA 1A5VA 5HROA 2BV3A 2QT7A 5K5MA 1B64A 5CCLA 2A2DA 3MM8A 1CXUA 2W8LA 2E9RX 2D4WA 1RUSA 3ID8A 3VCDA 4KI6A 4A5AA 1NK6A 3HD1A 1Y0HA 2FJXA 1YWXA 4KR0B 4HT7A 2OEKA 4WP9A 3CCRS 1LW2A 1GAOA 5LMUJ 2G1HA 1H73A 3LDLA 5FPDA 3P38A 1Q8KA 1B0TA 4ECVA 4BVPA 5LY3A 2JL9A 3PJ9A 2EG2A 3IP0A 3J81U 4FYVB 3OVAA 4QIVA 3OUYB 1HBOB 3BGUA 2DCUB 3I87A 3GYXB 4B1VA 3GJRB 3WXKA 2P9NA 1HWKA 1LCUA 4CGJA 3DGPA 2FLPA 3MTKA 1W26A 1HKGA 5KT7A 3ENVA 1R43A 3J7AP 2VA3A 3VVUA 3GJQB 4CZKA 5KRTA 4CEAA 1P9YA 3GL1A 3GWCA 2W40A 3LP1B 3C46A 2PBDA 5GADP 5A6WA 1S9FA 4YOEA 1PKUA 4CD3A 5KFJA 3T19A 2ITGA 4I68A 4DDFA 3BR9A 5EX0A 2W7PA 1OO0B 3SCLE 3LL3A 3F0NA 4OJ3A 2KZZA 3OQ2A 1TUVA 3K0JA 2E2OA 4BRPA 1C0UB 1NK0A 2B9WA 1T9XA 2MQMA 4ZVGA 4CIOA 1RZMA 1D8YA 2DYAA 3U9ZA 2LKZA 1RDAA 4H03B 4J9LA 2N7CA 1VQMS 1N32J 4ILJA 4MLEA 4USKA 1VC6A 3JYTB 4DV1J 2B4PA 2CJQA 3TYTA 3CMAS 4CO1A 1JNRB 3CE8A 4DV3F 4FBUA 4JKHA 2YHBA 3HZ6A 3CDUA 3CCVS 3ZT3A 2YBVA 4PPDA 4EP5A 2D0CA 5F8IA 3TUJC 4FYYB 4IH5A 4USTA 3I8DA 2I5JB 2VIHA 5E26A 4DUTA 1YBUA 4LR8A 3CPWR 3RRHA 5KFAA 3O4NA 2IVFB 2HNZA 4BR4A 1LW0B 2ETJA 4DV4J 3FZMA 3FFKB 2CVEA 2AJFE 2HEKA 4JUZA 4M5IA 4CGFA 1F60B 1PO6A 1X4AA 3SBMA 3NP5A 1WHXA 2LU1A 4C97A 2EFGA 2ZHAA 2K1RA 2HNDB 3VETA 2LEPA 2E1CA 4K5SA 2LQ9A 1WSHA 1RDBA 1TKZB 4HH0A 2FBXA 2U2FA 2XRIA 1YI2N 3H98A 1RT2A 3CCES 4LF4J 5LL6d 2DD8S 1RHJB 4LFBJ 2V94A 3MR7A 2FZGB 3CQXA 5JLFA 1BQMB 3VF2A 4DR7J 2BJ7A 1EXQA 1H6KX 2FY8A 3D7SB 4AHCA 3VEYA 1WEYA 3QNNA 3PX0A 3G87A 4FPRA 2GV9A 3PKMA 1VQ7N 1K73T 1HNZK 4DR2F 1W2BM 2FGOA 4OZNA 3KD1E 1WHWA 1HPZA 3Q7BA 1H2UX 2F8HA 4J9MA 1YJWS 4DV3K 2YKPA 4BDPA 1GNKA 2VF3A 3GIIA 2APOA 2V7ZA 1BIZA 5AQQA 1J2VA 3AVMA 4OMFG 1QSSA 2PT0A 3LZIA 2FDNA 3NGKA 4NXNJ 5J1EB 2IVNA 2ZH1A 2IIRA 4FWKA 4P2FA 4W90B 1SQGA 4ZLPA 2YNIB 3M8YA 3VHQA 2MPUA 3I82A 5IT9U 4GKJF 3RAQA 2OPSA 3VQDA 1UKUA 2RE2A 3L95X 1SPBP 1HRHA 2W2QP 1CZBA 3LDNA 1NJWA 2DNKA 1W2BR 4K8RA 3TZWA 3KIOA 1S49A 1V5IB 3MN6A 3BH6B 5A76A 4ANCA 4CFCA 2IIHA 4BC5A 1NGIA 3TU5A 3EGNA 3ONQA 2E8AA 3AA3A 4CERA 2XYPB 3L3VA 2PZSA 3VAKA 3L2VA 3HFKA 3CC7S 4LBPA 3QFPA 1F5CA 1RTIA 2XGPA 1TUYA 3BEXA 3W9JA 3TI0A 1R8HA 2CH6A 4DR2K 2D0BA 1KVCA 4JI7J 4ED5A 1Q9YA 1EAYC 4FF1A 5M1QA 1T6CA 1TL3A 3MM6A 4A8YA 4WKYA 4WJBA 2K8GA 2QV6A 4K4XA 4AM7A 1OY6A 4P74A 1RT6A 4A4JA 3M1VB 2DNRA 3QSYB 3RBXA 1BC6A 3VMFB 2OI2A 4ID5B 3UW1A 3KVGA 3UN3A 1LNQA 4ZTJA 3BDEA 4B3SJ 2GJIA 3KJFB 4GKJK 1RLCL 3EL2A 2K7KA 3RMAA 4YEAA 3U1MA 4CHZA 3TUZC 3HI0A 2V2QA 2P9LB 2DPIA 2QA1A 4IWVA 2EC0A 4B02A 3DRSB 4CJPA 5I4MA 1NB7A 1RCXB 2E29A 1FI4A 4PG6A 4O3PA 4CQ1A 1EQYA 2HAIA 1OJ4A 4AHVA 5F3TA 5KFLA 2DIVA 1VQKS 3R7NB 3ZT0A 3ZETB 2NZTA 3HFVA 3UCUP 4PR6A 2UV8A 3PSFA 2QSWA 5CQGA 4WKRA 3PRVA 1DTQA 4KHPK 2OEJA 2HURA 4GVBA 2GAGC 1RT5B 1S5JA 3QGGA 5LSLA 1ELOA 3W63A 2XYGB 3CF5Q 3I5BA 3SQ0A 3NCRA 2CPZA 4A61A 1FFSB 1X0PA 2GMHA 3K89A 3DXBA 2HOEA 2ITMA 2IFXA 1GMUA 3ETOA 3O4WA 4U8VA 3VZIA 2ZM6F 3E3XA 2F9WA 1TAUA 3RAXA 1VQ5S 2CNNB 2UU9F 1FRLA 2E1PA 3T5JA 4TQSA 3G8TA 3AY0A 3KJVA 3Q2TC 4NCGB 4R5PA 1FX4A 3UE2A 1ICEB 2JLGA 1DLOB 4Z4IA 5RUBA 2AKWB 1H98A 3NBPA 1I51B 1U2FA 2ZGYA 1SH2A 1C0MA 1K0TA 4HDHA 1JLEA 4RWTA 4DS5A 4ZHRB 3NAIA 1JLCB 5E3RA 3EJMA 1LOUA 5FDLA 4QJVA 2YWHA 2GVDB 3N5FA 3IRWP 3FKBA 1EX8A 5AXNA 3R3TA 2JC1A 5B09A 3O4QA 1NSPA 7FD1A 4JBCA 4WYLA 1X1PA 5FLXU 3O3HA 3DLHA 4BRAA 4CWBA 1NOZA 5A2QO 3PFEA 4USIA 2VJVA 4DUZJ 1RTDA 3U8XA 4FF3A 2C3UA 3U3GA 3LQVA 5T7BA 3GFZA 2KHOA 3CQ8A 4YR2A 5KFWA 1RBRA 2C2MB 1AZSB 1OIAA 3P31A 1O1WA 2DHSA 5IWAF 1E6YB 1SVDA 3QIPA 4QS8A 3JB9k 3J7ZO 4EI2A 1QDUB 4WF9Q 2JVOA 3FCHA 1HYSB 2HBYB 2MXYA 1TL7A 3AXKA 1E6VA 2NNWA 4IDHA 3A4TA 4OYWA 2CJKA 1FK9A 3ADAC 2GQ2A 4Y2AA 3P4UB 2ZKUA 2UU9K 3C6UA 2EXUA 1HWJA 4N8OA 4NWBA 3AY9A 2I1RA 4JKDA 4DX7A 2HHPA 2C2RA 1TAQA 3VGUA 3GR1A 2FVPA 2JWLA 3SQ2A 1R3NA 4MK8A 3NF6A 5F0UA 4RBTA 3OXLA 3EX7B 1B0VA 1YIJN 5ETQA 2AYMA 2IDEA 5DK5A 2P9EA 4LJMA 3VEXA 3P5JA 4DFPA 5KGWA 3NGIA 3FEYB 3M6GA 4EBEA 3OXGA 2QL9B 1IXKA 3G4SS 1TYQB 2I8EA 3UE5A 6FDRA 1UVIA 1G15A 4ZPAA 1HNWK 4RW6B 5K9FA 2WONA 4MYUA 2O5DA 4TSXA 2ALZA 5M2RA 3MK6A 4Y2MA 2IM2A 3D2FB 3MN9A 3HP9A 3JSMA 2JWNA 1TL1A 1BE4A 4E1JA 2JEJA 2IVPA 1DTTB 4EEYA 4LD0A 4WU3A 1VIXA 1OSCA 3U9DA 2KT2A 4KPCA 1Y97A 1DURA 3O9SA 1ESVA 5CZ2A 4ZN1A 5KT5A 4C0HA 1U09A 4LFAF 2QKKA 4OLOA 1DGKN 3THYB 4KQZA 4ZVOB 3CJRA 3RMBA 3OBWA 4ZTFA 2PEBA 2V0NA 5D77A 1N33J 4C4WA 2FJDB 4NMXA 2RDJA 3DMJB 4KSEB 3O80A 5K8NA 1R0BG 3HVRA 5KOXA 4UZCA 3LUYA 4CIFA 3HHDA 2V8GA 3R5DA 5KRSA 3ZSOA 4DFMA 3CJ4A 1JXBA 3ATVA 4HH1A 4CO5A 5EN1A 4LF9J 3IKMA 2XWXA 3S3OA 4XDCA 3QEPA 2I38A 1VQLN 4M5HA 3MGJA 1UAXA 4DL6A 1JLFB 1YITS 1NG9A 5HJYA 3PR4A 4DV7F 3N4PA 1RE1B 1FCAA 2HHHK 4BRQA 5ADXH 4USVA 2NPIA 3UO0A 4Q2MA 1YTAA 1HMVA 3QJJA 3OTEA 4CHQA 2XI3A 5THWA 1ZYQA 2CPFA 2YX4A 5BN9A 3HKWA 1QE1A 3D1HA 1ZH5A 1RHUB 1KC8T 4GKKF 1RBVA 1HQEB 5AQRA 3SPZA 3SI6A 2DXFA 4JRPA 2HWHA 4FJXA 4ZVRB 2ZE2A 1T9TA 4Q5VA 2K7JA 4DCOB 5KOWA 1V4TA 4A46A 3A5LC 4X2BA 4ALZA 3K5NA 3NGYA 3OY9A 2BJ8A 2IM1A 3CCSS 2KHCA 3SLCA 4B3RJ 1PGZA 2CYYA 4B3OB 5GINA 1X5SA 3R5GA 2B3TB 4FKYA 3BO2A 1P8GA 5B0AA 1H3DA 2R7YA 3SUNA 1Q7LB 2UXCJ 3G71N 3L4IA 3QICA 5AQJA 2LQ8A 1NMDA 3NNCA 3DLLL 5BRHA 1NPPA 5EWEA 1RDUA 3QT8A 5C42B 3D6RA 1DQ9A 2ZNYA 4AHSA 4O4RA 3DHWC 2O8BA 3PKYA 2DVIA 2MSSA 4HHHA 2J0WA 4DSIA 4QWCA 1S3XA 2CQ0A 4DV7K 2OMLA 4NZ0A 3RMDA 1Q81T 3AO1A 1NJZA 3V6DA 2QO3A 1N8RT 1WF0A 1I94F 4M3ZA 1EX4A 3O9TA 2FUG9 4CLFA 4G65A 1TUGB 4OV6A 3EZOA 4ECSA 3FFIA 4CZCA 4GKKK 4P71A 4A5BA 3J81O 3QEXA 3G8QA 3QAEA 3ZT4A 2R2TA 1JXVA 3QGPA 2RSQA 2QGFB 4Y6IA 2PYLA 3V1RA 4OLPA 3JSYA 4M5NA 5LL6Z 1Q5YA 3W66A 3TWZA 2WOMB 1NK9A 1VQPS 1YZ7A 2CIMA 1CS4A 1K73O 2YWKA 3MDQA 1AXQA 5EDWA 5HK4A 3S6EA 4MKAA 1X4GA 4ATNA 1NM2A 2F96A 2ZQBA 4NA1A 1QAYA 5IQ6A 1S0VA 4YDDB 2H48B 3LALA 1CVJA 1FHTA 4ZPTR 1KTQA 2V52B 4OKJA 4F4XA 1FJGJ 4EHUA 3KK3B 2KRBA 3RW7A 3CFOA 1WG1A 1RAAB 4YB5A 1UVKA 1FXDA 3A3OB 2NS1B 4KTWA 1TGOA 3VGSA 5AE1A 2Q6CA 1S1TA 3H08A 1D3WA 3AA4A 1ZAXA 2DTJA 3AA2A 3DLGA 2FC9A 3K5LA 4AHRA 2YNFA 2CJXB 2EFQA 3CJ5A 5CHCB 3RGIA 3BZQA 4BRLA 3K58A 2J7UA 1YVUA 2J0XA 3WX8A 2XWYA 3W62A 4JI4F 3MFIA 2AEFA 2UUAK 2U1AA 3FR0A 2KXNB 4JI6J 5T14A 1B3TA 3HPHA 2HK2A 2VPXB 4CLKA 4E7JA 2VFSA 1KSPA 3AA8A 3I0RB 2RUGA 1NSQA 4O55A 3ENHA 3BQ1A 2XS2A 3GCWP 1T03A 2L9NA 3ZSRA 2P2CB 1KNZA 5ETSA 2MQOA 2AZ1A 2HPUA 2PEHA 4UOGA 3F44A 3V81A 2VC1A 4DU3A 1KHVA 2MQNA 3MCAB 2HIYA 4URGA 1FDNA 4BRIA 5AZJA 5KFGA 3P5BP 4IEIA 2LQ5A 3CJKB 4DTPA 4Y34A 2A5XA 5C15A 1J53A</