4ID5A

Hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 164
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4id5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4id5A05
3DOKB 3KLFA 3H2LA 4DG1B 1GOAA 4FJJA 3RAQA 5DK5A 5KG0A 2HMIA 1KRPA 4IRKA 4CGGA 5I3UA 1JXLA 5KFNA 2EX3A 2IM3A 4DTXA 1JLBB 4NLQA 3TAMA 3KLEA 2BRLA 4CGJA 5F8HA 3L2WA 4OLAA 4OLBA 1FK9B 4HUEA 3M8SA 4CJTA 4W5OA 4RW8A 4O44B 1U09A 4H4OB 4DTJA 1G15A 4F3TA 1Q9XA 1QQCA 4FVMA 1S6QA 2J6TA 3HL8A 2FVQA 1RBTA 2G8VA 1UOCA 1NHUA 2C2EA 4H4MB 5DG9A 1WN7A 4C8OA 3AO5A 4CJVA 5KGXA 1REVB 4KO0B 5DG8A 3PV8A 3P5JA 1QAJA 3V6KA 4Q0BA 5L1IA 2AX0A 1MU2A 4EP4A 3NE6A 3PW2A 3ASMA 5HRRA 4CGIA 4CECA 3JSMA 4WXOA 3U6FA 3TARA 4L8RB 4E19A 1RYSA 2J6SA 1DTTA 2FJWA 1RT2B 3ZT0A 3O3FA 2P51A 1C1CA 4F4ZA 1C1BB 2YNFB 3IGNA 3TI0A 4FLZA 2Q3SA 1TKXB 3ZT4A 3QGIA 4N47A 3QIDA 4DFPA 3IG1A 4M42A 3FRZA 1YTAA 4DF8A 3KHRA 3AV9A 3U3GA 1A5WA 1S1UA 5KG6A 5JUMA 2JEIA 1VSLA 4O4RA 5KFQA 1VSKA 1LWCA 3MEGB 4K4XA 4EZ6A 3D0PA 2WHOA 1IO2A 3CO9A 3GV7B 4RU9A 2YKNB 4F2RA 3I0SB 4DSIA 4Y2AA 1NJXA 5HP1B 1JLCB 4DTNA 5KFWA 4RW8B 4DTSA 4OGEA 1LWEA 4FYDA 4BACA 3VQ5A 4KTWA 3VQ4A 3L2UA 2E6LA 4CEFA 4XIUA 1X9WA 4W5NA 3LZIA 4QW8A 4WFXA 3ZSOA 3TAPA 4RNHA 2VWJA 3DLHA 3C6UB 3DYAB 4OPKA 1UA0A 3V6HA 2XGPA 3KJVB 3CJ0A 4EYIB 3HPGA 3HPOA 4R5PA 3VQDA 4B8CA 3KK1A 2Z1GA 4DG1A 4FJ8A 3NHGA 4F4WA 3JSMB 1NKBA 4RNMA 1L3SA 1D0EA 4DTUA 1NK0A 3NF7A 1ASUA 4Z4EA 3V9SA 2IOCA 2VWKA 3V81A 2XY8A 4ZP9A 3AVNA 1JLEA 5KFKA 3AA4A 2HW3A 1JKHB 1N6QA 3KLIB 4IFVA 4J9LA 2GBZA 1CZBA 3K5MA 2XGQA 5KG2A 2O4IA 4J9KA 1TAUA 3VN5A 3HO1A 1HQEA 4Q5VA 1HNVA 3NAIA 4M3TA 4CJ3A 1S1UB 4KHSA 1FK9A 3C6TB 3LP2A 1DTQA 5C42B 4NLDA 1T05A 4H4OA 3AA3A 4CJEA 4O4GB 4NCGA 3MR6A 2QKBA 3NH2A 2PZSA 1TL3B 4F4XA 1JLGA 1N5YA 3NFAA 5KFYA 3UIQA 4KKOA 1LWEB 4K4TA 4DSEA 4O3RA 5KFTA 2YNGB 5SZTA 1RT6A 2KZMA 3OYAA 2ZQBA 2WRMA 2D3ZA 3AVBA 4DSFA 1RT2A 3SYZA 4RW4B 2VG6A 4JRQA 2XO7A 3HHKA 4DU4A 1LW0B 2B5JA 2YNFA 2FVSA 2HHTA 4JV1A 1TKXA 3C6UA 4K8ZA 2VG5B 3BSOA 3ZSYA 2ITGA 3ISND 3Q8QB 1EX4A 3LDSA 4M94A 4ZVHA 4DQQA 5KFSA 4EZ9A 4YMEA 2A1RA 4OVLA 2W9BA 1TVRB 5CYMB 3VQ6A 2KFZA 3MECA 2HNYA 3ICLA 2YHBA 1RNHA 5KFDA 2BE2B 1S1XA 1SH3A 2QV6A 2YKNA 4YNQA 4ED8A 1BGXT 4M3XA 1JLCA 4LSNB 2OZMA 4NLWA 3OYHA 4ZTFA 1WAJA 2HHVA 3LZJA 4C8NA 4ID5A 5FDLA 1A5XA 4CFAA 4HUFA 1HQEB 1BCOA 2W8LA 4CESA 4CJWA 4QWBA 1FKOB 3I5CA 4ZHRA 2E9ZA 1JLAB 5HP1A 4CIGA 3HP9A 3HVRA 3AO1A 4K50A 4IDKA 4FW1A 2Z1JA 4MIAA 1S1WA 1XC9A 2RN2A 2BR0A 4IKFA 1I3AA 4FLWA 1NK4A 1ZYQA 2R2RA 3E51A 4O3PA 4E7IA 2ILYA 4KFBA 4RW7B 1HYSB 1X9SA 3NMAA 1RAJA 3KOAA 2G8IA 2PYLA 3AVLA 4GMJB 5D3GA 3QNOA 1I6JA 4RUAA 4K4YA 1K6YA 3HK2A 1N4LA 4HVJA 3HPHA 1SKRA 1LW0A 2B5JB 1S6PA 5KGWA 2JLEA 4ECXA 5F8IA 1I39A 1ZBLA 1IKYA 4TQRA 2GIQA 4H54A 3V6JA 1YVUA 2OYQA 4FJ9A 3MAQA 2R8JA 2FBXA 2DTUA 5FRNA 1U4BA 4ED1A 4CGFA 4AHCA 3D5MA 4X2BA 3PUFA 4CIEA 5L9XA 3EY1A 4E7JA 1C6VA 1IH7A 2HNYB 5KI6A 1SV5A 4PUOB 2HHUA 4O4GA 4CJLA 5KT3A 4EP5A 2Y1JA 2HB5A 4URGA 4LH5A 2OPPB 2E9RX 3KD1E 4BDPA 4KHRA 3QLHB 1LWFB 3KK2A 4MIBA 4LY7A 2KFNA 4ECSA 3H4DA 1RTJB 1DTQB 3VQQA 4Z4CA 4EBDA 5KFHA 1T05B 4LH4A 3RBDA 3H40A 4I7FB 1Z4UA 1JLAA 4CGDA 3QZ7A 4DU3A 3GV5B 2XC9A 3VQAA 1TV6A 4NRTA 3VQ8A 3V4IA 4CEOA 3LPUA 2G8FA 5HBMB 3ZSQA 4ICLB 2D0CA 2OPRA 1NOYA 2RPIA 5L1LA 3KTQA 1SL0A 1LW2A 2G8KA 1L3TA 5KFJA 2AJQA 2PYJA 4NLOA 1S9FA 2YV0X 3Q8SB 4HKQA 3PW0A 4ED0A 3O4QA 2XY7A 1SUQA 3RB0A 5F9LA 5T7BA 1QSLA 3SNNA 1VSDA 2AWZA 4C8MA 3L3UA 1RDBA 4DFJA 2YNIA 5CZ1A 1HPZB 4LQ9A 3QIPA 1HQUA 2E4LA 1ASWA 4Y34A 4LQ3A 2BQRA 1KTQA 3DRRA 5EWGA 1CLQA 4JV2A 1NHVA 1RBSA 3RR7A 2D0AA 5J2PB 2HHXA 1FKOA 4IH5A 2AU0A 3DI6B 2R2TA 4DWIA 4XPCA 1JIHA 4Q8EA 1K1SA 4MQ3A 2HHWA 2O5DA 1T8EA 3V6DA 3T5JA 1NKEA 1QUVA 1JLQB 1Z25A 3H59A 3M9OB 2W8KA 4ECUA 3M8QA 4B9NA 4QWEA 3TQ1A 4IOBA 4O5BA 3DLRA 4G1QB 1RBRA 3KKSA 1KCFA 4BWJA 1U48A 1WLJA 5F9NA 2RF2B 2ZD1A 2IM1A 4E0DA 1S6PB 5DQIA 4FZYA 4HCCA 1JLBA 4KFBB 3CDEA 1BL3A 2HHQA 4BE2A 1TL1B 5D3GB 2F96A 3DRSA 3NGZA 4IFYB 4OJRA 1S1VA 3CQ8A 4Q45A 4YR3A 2FBYA 4TSXA 2R8GA 3ZSVA 3SZ2A 5KFCA 5KT5A 3T19A 4I9QA 4FW2A 3JYTA 4GVMA 4E7HA 1DLOB 4ID1A 3QLHA 3KK2B 4NLVA 3RAXA 4FLTA 1NJZA 3P1GA 4CJQA 3WNFA 1VSHA 2XHBA 1RTDA 4EBEA 5J2MA 1KHVA 1NK5A 3IS9A 4FJXA 4ZPCA 2IJNA 1BI4A 3PR5B 3M9NB 3L2QA 3KLFB 2EC0A 3MXJA 2PY5A 5KG7A 1RT3B 1R0AB 3OJUA 4KAZA 3KNAA 2W9AA 2V9WA 3QZ8A 3V4IB 2CKWA 3EZUA 4GW6A 3TAMB 4K4VA 4FK2A 3ZSRA 4M3RA 3V9ZA 3OY9A 2XY6A 3VQ7A 4IRCA 4Y1CA 4C8LA 1X1PA 1SL2A 2YKMB 3O3HA 4OKKA 5C24B 4CJFA 3KK3A 5J2QB 4E3SA 3OS1A 1HRHA 3HM9A 3MF5A 3SPZA 1N56A 4F2SA 2X6SA 4AILC 4CIFA 5KFFA 3ZSZA 4KRFA 3CIZA 1DTTB 4WYLA 4EO8A 2IA6A 1KVCA 5E41A 3HP6A 1XR6A 3HVTB 4PQUB 4ZPDA 4CFDA 3PJXA 5C25A 3BQ0A 3OJSA 3QEIA 3MR2A 2GV9A 4ECVA 1WSJA 4ZPBA 1D5AA 2RDIA 2LSNA 4ZP8A 2HNZA 4DSJA 1RTDB 2R8IA 4RW9A 1CSJA 2DPIA 2Z1IA 3D45A 2FBTA 3K59A 3HSTB 2OH2A 2XY5A 1EP4A 4IR1A 5HLFB 1GX5A 3CG7A 1T3NA 1A5VA 4B3OA 2BRKA 4TY9A 3IAYA 2QK9A 3V81B 3L2VA 1NK6A 3T3FA 4TXSA 2X78A 1RILA 2RKIA 2DFEA 4O0IA 5C42A 2P5OA 2O4GA 1S97A 3I0RA 4CF8A 2BANB 2CJQA 3SI8A 1QSYA 3KMSA 4O55A 1TL3A 4ECRA 2VA2A 3CDUA 1KFDA 3I8DA 1J53A 3JYTB 1KVBA 1SH2A 1T94A 4KB7A 3BSNA 3TABA 3KLHB 4CF1A 1KLMA 4MFBB 4IR9A 3ITHA 3KJVA 4Y3CA 1RA6A 1JLGB 1N5YB 4KB0A 4MK8A 3HVTA 4PQUA 2BQUA 4KI6A 3G10A 5KT2A 4EYHB 3VQSA 1WNSA 3K2PA 1RT6B 1XHZA 1WSGA 4FJIA 4IFVB 1BISA 4DSKA 3OHBA 4Y1DA 1IM4A 1S1TA 1RDDA 1NOZA 1C0UA 3PX6A 4N56A 1BQNA 3LP2B 3EYZA 4NLTA 4BDYA 3MECB 4M3YA 4RNFA 1JKHA 2HVHA 1FKPB 3NGDA 3HVWA 1BCMA 4FLUA 4KHQA 4DS4A 3KK3B 1QTMA 1IKXA 3QESA 1RTHB 1LAVA 3OSPA 4YQWA 4FJLA 3WNEA 2OPQA 4R0EA 1JLFA 1EETB 1UWBA 4KBIA 3DLEB 4DTRA 2RKIB 3SUPA 2W9CB 4JV0A 4FS2A 5HROA 5KG1A 2R8HA 4ID5B 3VQPA 1VRTA 2FBVA 3QEWA 5C25B 1RA7A 3S3MA 2YNGA 3KLVA 3ISNC 3EPGA 4J9PA 3BSCA 3L3VA 4KPYA 3L2RA 1GOBA 4ECZA 2HNZB 4GC6A 3F73A 2AX1A 4FM2A 3AVFA 4RW4A 1NK8A 3SUQA 3NKYA 4FJNA 1S4FA 4KREA 1VSFA 4IKAA 3VA3A 1Z26A 2FLNA 1XR5A 1KLMB 3T1AA 2XCAA 3QEXA 5HRPA 3PJWA 1C0MA 3GV8B 1SL1A 4CF9A 1S10A 1ZTWA 1RCHA 3HYFA 1S1XB 3PHEA 4O3SA 1ZBIA 2HMIB 4DLEA 1TKTA 3FFIA 2XCPA 4HYKA 4C8KA 1TVRA 3B6OA 4CJ5A 2ATQA 4KE5A 3SV3A 3KLEB 5F8GA 3NH1A 3TAQA 4IH7A 3OL7A 5KFEA 5DMRA 3FSIA 3RTVA 4ECTA 3LAKA 3NGYA 4FJKA 2E9TA 3ZT3A 4NCAA 3LAMA 3PR4A 2IC3A 1WSFA 3BJYA 3LALA 4B3OB 3AVIA 3GIMA 2B43A 1J5OB 2I5JB 2AGQA 1IKXB 4EEYA 5I42B 1VSEA 4DQIA 4ZHRB 2IS3A 4W5QA 5CYQA 3IRXA 3EPIA 1S1WB 5DQGA 1D9DA 3THVA 4HUGA 4RUCA 1C1AA 3ITHB 1QHTA 4J9SA 4DQRA 3CVKA 1MU2B 4IG0B 4AHUA 2W7OA 1LWFA 1T7PA 1U04A 3S9HA 1RTJA 4QPXA 2VA3A 4Z4IA 1HARA 4Q43A 3MEDB 4N76A 1BIUA 4MFBA 4ZP6A 3V9UA 3BQ2A 3LWLA 4Y2CA 3VA0A 5EWEA 3PO4A 2WTFA 2D0BA 4ECYA 4M3WA 2UUTA 4E7KA 4CCHA 1UA1A 3NCIA 4QWCA 1RT1B 5EUHA 3MTKA 3SI6A 3PW5A 2HNDB 4TN2A 4BE1A 4J9NA 4NLSA 2IAJB 3QIPB 1NKCA 3P83D 3G6XA 5F8JA 4CEQA 4E7LA 1BQNB 4FJ5A 2W42A 4F50A 3H5XA 3RB6A 1FKPA 5J2PA 3DLEA 4DTOA 3OSNA 3DOLB 2DPJA 4JS5A 1TK0A 3T5HA 3CJ3A 3SFUA 2ASJA 3M8RA 3OYIA 4LD0A 4QW9A 1JLQA 4DL3A 2WCXA 3OL9A 5KFIA 1ASVA 3NAEA 1TAQA 1NJYA 4Q44A 2FC0A 5KFUA 1LW2B 3OHAA 5J1EA 3B6PA 4I7FA 4DQPA 4QWAA 4F8RA 5CYQB 5KFVA 1TGOA 3DYAA 4WE1B 3M8PA 3RMAA 1RDAA 4CEDA 4B9MA 3AVHA 3M8QB 4IG0A 1TK5A 2JEJA 4U7CA 3G6YA 3V1RA 2RDJA 2P5GA 3PW4A 1HMVB 3NAHA 1KFSA 3C95A 4DSLA 4I2QB 5L1JA 2GIRA 4NCBA 4QCLA 3PX4A 2FVCA 4IFYA 3CFRA 1L3UA 3CJ4A 2XRIA 1S1VB 4LSLA 5T14A 4GC7A 1BIZA 4F3OA 1WNEA 1KSPA 5KFZA 4JLHA 4Z4HA 3KHLA 4OKEA 5K14A 1S9GB 4CFCA 1TKTB 4J9OA 2ILZA 3AVKA 1TL1A 4WFZA 1J5OA 3KIOA 3PO5A 4Z0UA 4ZTJA 4PWDA 5SWMA 2BGGA 4NLUA 5C5JA 3BGRA 4IBNA 4IH6A 5DLFA 2HHSA 3H08A 4OKJA 5KFMA 4EO6A 1JXEA 2IC3B 1C0TA 1VK0A 5KRSA 4ED3A 4U6PA 3GQCA 3KHGA 3CFPA 4OGCA 4FJGA 2WOMB 1TQLA 1S0OA 3H5YA 3K57A 5L1KA 4DU1A 1WSHA 5HRSA 4TY8B 4XPEA 3UQSA 4K4ZA 2DY4A 1U45A 5J2MB 4CHOA 4ZPAA 3IS9B 4JS4A 4ZVGA 2B4JA 2OPSA 4YR2A 2JC1A 5KFOA 3V1QA 5DQHA 4DLGA 1BI4B 4FS1A 3QNNA 3SUOA 3DDKA 3CJ2A 4WE1A 1RT7B 4NLYA 3MEDA 3CJ5A 1S9EB 1IG9A 1WSIA 1IKWB 2R2SA 3DRSB 3NF6A 2B6AA 2C2RA 4MK7A 3H98A 1RBUA 4XO0A 4DL6A 3K5LA 2YKMA 3OVNA 4DMNA 5C24A 3MR3A 2R7YA 4B9TA 1S0NA 3DLKA 1WSEA 1F21A 5DG7A 3C94A 1B9DA 3BDPA 2DFHA 3Q8PB 3DOLA 3RMBA 3KLGA 4F4YA 2XWYA 3T5KA 1ZBHA 3HXMA 4J2BA 2IGIA 4FCYA 4ZVEA 4W5TA 4HTUA 4J2EA 3NL0A 4J9MA 5J2QA 4PWDB 3O4NA 4O3QA 4DL5A 3PZPA 3G0ZA 4ZP7A 1RBVA 3LP3A 3HVAA 1CZ9A 2IDOA 1S48A 4CJPA 4B9UA 1C2PA 3K5OA 2F8TA 3OYEA 3E01B 4RG8A 3UDLA 1BHLA 3F9KA 3EZ5A 5J1EB 2ZKUA 3PW7A 1R0AA 5J2NB 4J2DA 1HYSA 1VRUB 4OL8A 4I2QA 4Z4FA 4AHTA 1KVAA 1LV5A 1MMLA 4NZ0A 3M8PB 1T03A 3AVCA 4K4SA 3NDKA 4FXDA 3TANA 3OYDA 4FJHA 2W7PA 2P1JA 3V9XA 5CYMA 3KD5E 2UVRA 1IKYB 1RT5A 2BE2A 1LAWA 3LP0B 1XR7A 2C22A 4CK1A 2Z1HA 2A1SA 2J6UA 3OYNA 5KG5A 4CE9A 3V9WA 2BANA 4M3UA 2D41A 3HKWA 4HCBA 5KFRA 3AO2A 4ECQA 3DLKB 4CJKA 2D5RA 4FLXA 2C28A 3TAGA 4NYFA 3BQ1A 3TR8A 3DLBA 3FQKA 4ED2A 1RTIA 3NF9A 1BQMA 2QXFA 2YNHB 3OYKA 4J9QA 4OPJA 3AO3A 5KFAA 1S6QB 4CHZA 1JXBA 2OA8A 4J9RA 4M45A 5DGBA 4RW9B 4H4MA 4M3ZA 1EXQA 4ED7A 2KTQA 4AHSA 4DL2A 2AQ4A 2NUBA 4FJMA 1XHXA 5HBMA 4Q0BB 3E01A 3GILA 3DM2B 3QO9B 1S9EA 4RW6A 2WONA 4Q8FA 1IKWA 4EBCA 5I3UB 4I9LA 3SQ4A 4CEEA 2FJXA 1NK7A 3N6MA 3VQEA 3RBEA 3N6NA 1SH0A 3NH0A 2HWHA 1WAFA 4DFKA 4O44A 4PUOA 2FVRA 1EETA 1UWBB 1HQUB 3I0RB 1Q8IA 3KLHA 4CJUA 2QE5A 3AA5X 4K4UA 4K8XA 3DRRB 3S3NA 4CK3A 2IMWP 4R8UA 4CHNA 4KTZA 1JX4A 3MEGA 4KTQA 2OPQB 2OZSA 1REVA 4KO0A 3ZCMA 3OYFA 3WNHA 5F8LA 4PY5A 1TP7A 2BDPA 5JS2A 1C1CB 1TKZA 3OYJA 3NF8A 3L8BA 2WK4A 4ELTA 2W9CA 1S1TB 5KFGA 3RWUA 4RNOA 3FQLA 2FVPA 4RNNA 3I5BA 3OLAA 4Z4GA 4FM1A 3RMDA 4ECWA 1ZETA 2UVUA 4CHQA 4IQXA 3MFHA 2FLPA 2ASDA 3QGGA 3PVXA 1K1QA 1C0UB 2YHAA 2IM0A 1TK8A 3ZT1A 2R8KA 3CFOA 5J2NA 1GX6A 1VRUA 2AGOA 5KG4A 1QE1A 3DM2A 3QO9A 3LP1A 4KAIA 3ZT2A 4I2PB 1T03B 4KHWA 1RTHA 3KLIA 4NLGA 4ELUA 4FJ7A 3M9MB 4JUZA 1JLFB 3ULDA 1RT5B 1RDCA 3Q8RB 3OL8A 3NGIA 4BE0A 3TVKA 4AH9A 3I0SA 1NNDA 1JLEB 3GIKA 2AGPA 4B08A 1N6QB 4FZZA 4YP3A 3RB4A 4HHTA 4CJ4A 5F8MA 3UPFA 1XI1A 4ZMMA 1J54A 5KRTA 3MXMA 2F8EX 2VG7A 2V4QA 1W0HA 4R8UB 2F8SA 2G8HA 1S0MA 3DMJB 3QETA 2G8WA 1SKSA 4FK4A 4QWDA 1B9FA 5DGAA 4CERA 3U3YA 2ETJA 3FFIB 3H5UA 2FLLA 4TLRA 3UR0A 4PA1A 4E1MA 3WNGA 1HJRA 3KKRA 2UVVA 3D28A 1RDRA 1VSIA 3KK1B 3VQ9A 4G3IA 4BDZA 1GOCA 4FK0A 2WONB 3QYYA 2G8UA 3SUNA 1TKDA 3VQBA 3AVMA 3KHHA 5KT7A 3OYMA 4KI4A 2HNDA 3QIOA 3PY8A 2V4RA 4TYAA 3ALYA 1NJWA 3MXIA 3FDSA 4TYBA 3TAFA 4URSA 1OS5A 5JXSA 1S5JA 1VSJA 1HNIB 4CF2A 4CGHA 1QSSA 4RW6B 4M41A 4NLRA 3OL6A 3RR8A 3GYNA 2ATLA 3O3GA 4NCGB 3SV4A 2WB4A 2I5JA 4AHVA 3LP1B 1HNVB 2GUIA 4QOZB 3GIJA 2JC0A 2DFFA 3AVAA 4CEBA 3BREA 3C6TA 3HJFA 2W9BB 4CJSA 3RRGA 4B9LA 4DQSA 4DF4A 3PX0A 3IRXB 3LPTA 4WYWA 1SKWA 1RT4B 5KTQA 3RRHA 3OYGA 1RYRA 2JGUA 1TKZB 2HAIA 2R2UA 2HWIA 2KW4A 4KKOB 2ALZA 4IG3B 1U49A 3RMCA 4FBTA 3SPYA 3H4BA 3TWHA 2VG5A 4O0JA 3OS0A 1RT3A 3IGVA 2VG6B 5KT6A 2IAJA 3MEEA 1QS4A 4IDKB 3NBPB 1S49A 2BQ3A 3DRPB 1RT1A 2JEGA 4FM0A 1X9MA 1EP4B 5KT4A 4LSLB 4NLPA 3MR5A 4B9VA 1IKVB 4MKBA 1W25A 2IM2A 4YR0A 1QE1B 1HMVA 4KHYA 2ASLA 5KFLA 4LSNA 4WFYA 4DS5A 4O3NA 5F8NA 2D7SA 3QINA 4O3OA 4RZRA 2X6NA 5FDLB 3I5AA 1ZBUA 4ELVA 3BSAA 3AVJA 1Q9YA 4I2PA 4CK2A 4YFUA 3SCXA 4CEZA 3ZSWA 4DL7A 4F4KA 4W5RA 3IN5A 4ZVFA 1D1UA 3KMQA 2VG7B 3SQ0A 3DLGB 4KV8A 3BR9A 1YT3A 4URQU 4CF0A 4WXWA 4IRDA 4RW7A 3DOKA 4TQSA 1VSMA 4DEZA 2HVIA 5KFXA 1XWLA 4CHPA 2OPPA 4FLVA 3CWJA 4WZQA 1TV6B 3DMJA 3LANA 3AVGA 1S9GA 2ZE2B 1EKEA 2KZZA 4B9SA 5FROA 5FRMA 3LWMA 3CM5A 5HLFA 2D3UA 3VQCA 4DTPA 4JRPA 2B6AB 2XI3A 4MKAA 1NK9A 1JL2A 1ITGA 3NBPA 1JL1A 4UQGA 5CY4A 5EU7A 5K14B 4FLYA 4ICLA 4DFMA 3OYBA 1RT7A 3K58A 1SV5B 2IBKA 1W9HA 1IKVA 3MFIA 4CEAA 3OYCA 3K5NA 2UVWA 2V0NA 3BGRB 1HNIA 2E6MA 3ZSXA 4TY8A 3V1OA 4E89A 1C0TB 4KSEB 3HT3A 4N5SA 1HPZA 2WOMA 3KLGB 2OPSB 4N41A 5HROB 1CXQA 4CHYA 2IJFA 1U47A 1O1WA 2GC8A 1VRTB 1D8YA 2OPRB 4CJRA 2JEFA 1ZBFA 1RT4A 5EDWA 3SJJA 3IG1B 4MH8A 3DI6A 5DLGA 3SQ1A 3N6LA 3MEEB 4WZMA 3AA2A 4KB1A 4KHMA 3OS2A 4IG3A 3QEPA 1KLNA 4B8AB 3QGHA 1B92A 4ED6A 1SUQB 4BWMA 5CZ2A 2RF2A 2ZD1B 4DTMA 3G6VA 5HRNA 1N48A 5KG3A 2KQ2A 4M95A 3QERA 2EHGA 1LWCB 1QAIA 3AO4A 3CYMA 1KHWA 1D9FA 1UAXA 4NYZA 4FZXC 2ZE2A 4MK9A 3G86A 3S3OA 4G1QA 5KFBA 3OLBA 4K4WA 3DRPA 2Y1IA 3CM6A 1L3VA 5KFPA 4FBUA 2YNIB 3RB3A 3SFGA 3QEVA 1FXXA 4NRUA 4J2AA 3LP0A 3V6DB 3GIIA 2FJVA 1HYVA 1RTIB 4AHRA 1BQMB 1DLOA 3TAEA 3OYLA 2QKKA 4QAGA 5I42A 1L5UA 4KHNA 2I1RA 1HYZA 2X74A 4H8KA 4R5PB 4KHUA 1YTUA 1YVFA 4NLXA 4NYNA 3CDWA 3A2FA 1C1BA 1CXUA 3SQ2A 5EWFA 3H5SA 1J9AA 1Y97A 2YNHA 3DLGA 4KV8B 2XI2A 5JS1A 2UUWA 2C2DA 4E1NA 4CFBA 1ZTTA 3T5LA 4DL4A
chains in the Genus database with same CATH superfamily
3DOKB 3GG0A 2BUNA 3H2LA 4HT5A 1OPZA 3THYB 3J80O 3MI7X 4IRKA 5KFNA 5A8WB 4B3SJ 2EWSA 3TEHB 3VMFB 2BRLA 4OYWA 3QPIA 5F8HA 2MGZA 3EEQA 4ER8A 4OLAA 1OSDA 4GKJK 2HGLA 3M8SA 1VJWA 4DR4K 4W5OA 3UCZP 3H7HB 2MKHA 1ZXOA 4P71A 3CJAA 4H4OB 5ETSA 1G15A 2HS4A 4RL1A 4DR1F 1QQCA 2J6TA 2E1AA 3QMQA 2G8VA 1GQEA 1YJTA 4H5RA 3F0NA 3AO5A 4PR6A 2PMHA 2FHJD 4CTAB 4DHYA 1NDLA 3WXIA 3V6KA 5L1IA 4IFEA 5E3RA 2Q66A 3PW2A 3ULHA 5HRRA 2R9LA 2G9OA 1RWXB 2ZDOA 3M2VA 3SQOP 5F0WA 2E1ZA 1QQMA 2EK1A 4A8WA 2YNFB 2J4RA 2Q3SA 3EXYA 3QGIA 2QL7B 1NPKA 3IG1A 1HL6A 3S1TA 1IBLJ 2XYHB 1NM2A 3TUJC 2L3MA 2K8GA 3VEZA 3BM7A 4JK8A 1GEHA 2E29A 1J2VA 2Z8QA 3CPWM 3IWXA 4M5HA 1A5WA 3IA0A 5KPRA 3MMJA 3V5RA 5KG6A 5JLHA 4Y00A 3CPWR 1CJTB 1SXLA 1EAYC 4EZ6A 4DV6K 1S7IA 4C11B 4F2RA 2R7VA 2K06A 2NRVA 3I0SB 1RBOB 2X1FA 1UFWA 5KFWA 4DTSA 5LSRA 1LWEA 4QIFA 2KI2A 2LXFA 4KTWA 3L2UA 1NJIT 2UP1A 1NNEA 2E6LA 5K8NA 2YHXA 1BU6O 2B51A 1Q8KA 4YHHJ 4LREA 1X9WA 3UVJA 1YSJA 1YZ6A 4ILLA 1TL4A 1YUWA 4W5NA 3CT9A 3ZSOA 4OPKA 3JAMU 2LEBA 4LIRA 3CJ0A 5DO2A 3HPGA 2QWLA 4R5PA 3THPA 3TX0A 2P9NA 4YOTA 3KK1A 3FZ2A 1JCFA 3KDOA 3MUTP 2GO9A 4USVA 1IM6A 4F4WA 3DXSX 5GAHU 3ENBA 1D0EA 4DTUA 1HW9A 2IVNA 1WOQA 1NK0A 1V3SA 1Z6RA 3NF7A 4Z4EA 2IOCA 4KGKA 2ZHAA 5ETOA 2ZC3A 3MN5A 4FN5A 4PL8A 3KNGA 1BXNA 1X0FA 4OYPA 2YX6A 1XIQA 1XN9A 1N6QA 3TW0A 4J9LA 2A42A 3K5MA 2GBZA 3R8EA 2BV3A 1BC6A 5AXLA 3HO1A 2B0GA 2IBOA 4ANCA 4M3TA 1ZOTA 2ASYA 4KHSA 3MWBA 3LP2A 1DTQA 2VC0A 4M63C 5A2QO 4NLDA 4A48A 2A5XA 1RB0A 4PYAA 2QKBA 3NH2A 2PZSA 4M5IA 4DSEA 3E2EA 4C0OC 4C2MA 2YNGB 5SZTA 1RT6A 1X9JA 2WRMA 4Q2LA 3AVBA 1RK8A 4RW4B 3HHKA 1FRHA 1LW0B 2B5JA 2YNFA 1HWLA 3AXKA 4K8ZA 2RUSA 4LF9K 3BSOA 2MZSA 3W7BA 3OBIA 2ZJPL 1WB9A 4DV5J 2ITGA 2O8DB 4O8KA 4ZCKA 3I32A 2MPUA 3F41A 3WX8A 2BXJA 2IPOB 2W9BA 1BUPA 5LMNF 3MECA 3MPVA 2H4WB 1RAEB 4D3HA 2W6KA 5B09A 3H45C 1S59A 1OYDA 4K42A 4M3XA 1M5OC 1JLCA 4LSNB 3R27A 1QVFR 1Q16B 4ZTFA 2HHVA 1A5XA 2XZTB 1U8WA 4WJBA 3VGMA 4DV1F 4ZHRA 4IO9Q 2PC6A 4JKDA 3ZEUA 2VPZB 4K50A 4FW1A 4MIAA 1YIJS 2NUHA 4Y0FA 1I3AA 4J37A 3ENVA 3A8KA 4LSZB 3ZZRA 3PNIA 3GDQA 4NI2B 1ZYQA 2UUCK 4O3PA 3JS6A 4E7IA 2I38A 4KFBA 1HYSB 2HQ3A 3KOAA 2PYLA 1I94K 4X4OA 2ZC4A 3AVLA 2VD3A 3W1YC 4GMJB 2PT0A 3HK2A 1H2TZ 1LW0A 2B5JB 3LM9A 3F56A 1I39A 1ZBLA 1TMMA 4I6YA 3CC2S 3AOAA 2P9UB 3ILLA 5DZ7A 4RBTA 1VJQA 3MAQA 3W62A 4AM7A 3NNCA 1VI7A 4LRDA 3D5MA 4F0HA 1JJCB 3EY1A 2ZHBA 1M5PC 3EGZA 5F2RA 1C6VA 2HNYB 4D3GA 5KI6A 5K8PA 4LVOP 4ZJQA 3BP8A 5AQFA 5LMNJ 2E5LJ 4PZVA 3CGIA 7AT1B 2VHGA 3D2FA 4LY7A 1VK3A 2KFNA 5BR8J 5LL6d 3KG4A 1RTJB 4GVBA 4W90B 3VQQA 1UVJA 2DXDA 3DOMB 4EBDA 3RGIA 2NRRA 1T9UA 1R8CA 2J76E 2GWKA 2H54B 5I3QA 2Z0GA 4X62F 2P9IA 4DR1J 3QZ7A 2XC9A 2HBQB 1TV6A 1WEXA 2V8DA 1TUGB 3V4IA 4CEOA 3LPUA 5HBMB 4ICLB 4JB8B 2HGMA 4MO5A 3VZIA 1IR2A 4W92B 2R7UA 3SIPB 5L1LA 2Q31A 2NZCA 4ZVRB 2CIMA 1L3TA 1RHQB 2YX7A 2PYJA 4NLOA 5G0RA 1VC6A 4HKQA 4ZCLA 1CLFA 3UKUA 3PW0A 2XY7A 5ETMA 3FNNA 5CZXA 2AWZA 2DNZA 2M88A 5D77A 1OO0B 4UUWA 4LQ9A 4WQ5A 1AROP 3M8ZA 4C48A 5ETLA 2DY1A 5C10A 1NHVA 2VQFK 3RR7A 4KR0B 2D0AA 3ZLJA 3TP2A 2VODA 4IH5A 2AU0A 1XMQK 4IQMA 4Q8EA 3VTIA 1K1SA 3DC2A 4G9ZA 2HHWA 1T8EA 2NNWA 3V6DA 1NKEA 1QUVA 4LFBK 3K17A 3THXB 3M9OB 4BQZA 4ECUA 3M8QA 3MN9A 2HZCA 4PXCA 1CG2A 2YQ3A 3TQ1A 2FY8A 2DNGA 4LRCA 4O5BA 2ZWHA 3T7ZA 1WACA 1RBRA 4ZS6A 1GXLA 2K3IA 4OHWA 1NH8A 1WOPA 1A0OB 4CBWA 2IM1A 2QMXA 4P73A 1IR0A 1YITS 1OPIA 3CDEA 5LOQA 3OV7A 1HIYA 5EOYA 4I68A 2DGTA 4NASA 2HHQA 4BRQA 4BE2A 4X66J 2YPZA 4HR2A 5K8OA 2F96A 3DRSA 4NXMJ 3O6WA 4CRJA 3CMEN 4OJRA 3ZZPA 1S1VA 2E7XA 3U4LA 3CQ8A 1E6YA 1OY6A 2ADCA 4LF5F 3SZ2A 2RB7A 3P39A 2GUPA 5THWA 3RJMB 3I8BA 1FEEA 3OT9A 4A8QA 3EKUA 3OTCA 3TA0A 4EMDA 1NJZA 4UUXA 3DGVA 1WJ9A 4BVPA 4EBEA 4JKGA 1KHVA 4DV6F 4CTAA 1FDAA 4ZPCA 4I4BA 3LTOA 4NX9A 8AT1B 2V2ZA 3OR1A 1BI4A 3PR5B 2UXBF 4WFAL 2PY5A 4B3SK 1RT3B 3U1LA 2CYYA 3QZ8A 2CKWA 4GW6A 4GV9A 4K4VA 3GJTB 1Q8LA 1LK5A 3GFYA 3O1LA 2XY6A 4BRPA 4A8KA 4CWBA 2CGLA 4Y1CA 2P5VA 1SL2A 3E3XA 1PO6A 3WEEA 4ILHA 1A9NB 2GV1A 3O3HA 4FVUA 4IO8A 3IP0A 5C24B 1IBKJ 4CM0A 2EW9A 1N56A 1WORA 1TUUA 4OYOA 2UUBF 1FT8A 2X1BA 1NAQA 3Q2SC 2D1CA 1F6TA 1WEZA 3M6UA 3OJSA 3MR2A 2ZH7A 1WSJA 4ZPBA 2ROPA 2LSNA 4DSJA 4IOAQ 3UDEA 4P52A 4RW9A 4BR9A 4JKGB 2YWEA 5IWAK 4DXLA 5LSOA 3D45A 1YRXA 3TTDA 1XNRJ 1KQKA 1V6HA 1FDDA 3BN4A 5JMNA 1VIXA 1LFPA 3ENWA 4KQZA 1A5VA 3QT8A 5FLXU 2FJBB 2E7VA 3IAYA 4BRCA 2WSEC 3SAGA 1NK6A 3CCUS 1P9QC 3CQXA 2NSCA 5KQ8A 3ETOA 1WC3A 1RILA 3FEZA 1NMNA 3MWTA 4NEYA 1VQ6S 3ZZUA 2W4DA 3RBXA 3QMLA 2Q1LA 4ANEA 3CIMA 4LBIA 1RADB 3KMSA 4J5OA 3AAWB 1KS2A 4MKYA 3CCMS 5HL7Q 3EJMA 4ECRA 2R7SA 4ES3A 1Z2LA 2ZOFA 5BN9A 2EVZA 1X4AA 3I8DA 1J53A 5AQXA 2HQGA 3RSEA 1ZZNA 3KJVA 4Y3CA 1RA6A 1YTYA 4KB0A 2GCFA 1G3OA 4MK8A 5KT2A 4DPOA 3HJVA 1YRTA 3K2PA 1GXUA 1RT6B 3L09A 4DV7K 1UETA 4FJIA 2BM0A 1WF0A 3CMQA 4HVZA 3VAMA 4DSKA 2O8DA 3M5RA 3DLLQ 1C0UA 4N56A 3EYZA 3WC0A 4BDYA 3MECB 3PSIA 5AE3A 5CH7B 4X4TA 1BCMA 4KHQA 1IV0A 3MMCB 4DR4F 1R31A 1YI2N 2DISA 4YQWA 1YJWS 1SAZA 4ZDNA 2CA9A 4R0EA 3P8BB 4KBIA 2W6LA 3O9SA 2HWTA 3DLEB 4RJVA 4RX6A 3AY0A 5D8HB 3SUPA 4B3RF 4FZVA 3M32B 2W9CB 1T9TA 2CJKA 3S3MA 3PXGa 1NLKL 2YNGA 2E44A 4KPYA 3GB0A 3L2RA 3O8MA 3C19A 3F73A 4EIAA 5AQYA 2B4PA 3AJ2A 4GV6A 3IMQJ 1VSFA 4NMXA 1N32F 1Z26A 4FKYA 3FSYA 5TKWA 2ZBIA 2XCAA 5HRPA 3PJWA 1T95A 1YHQS 2LU1A 3PHEA 2IVFB 3HZEA 2HMIB 2P9KB 4BHQA 3C15A 2XCPA 3B6OA 4CJ5A 1ZAXA 3TAQA 4AQYF 1UEKA 4DX6A 3OL7A 2E1PA 4BR2A 2YH1A 4ECTA 1H3DA 3UNGC 1QAXA 4CO5A 4DDFA 3NGYA 4FJKA 1WDTA 3ZT3A 1U6FA 4CDIA 3PR4A 2M2BA 3BJYA 4HDGA 2N82B 3O9TA 1EHWA 3ILIA 2UXCK 1VSEA 4DQIA 4Z94A 5ETVA 2UUBJ 5CYQA 1NPPA 3RSEB 3WXJA 2P9IB 1Y0HA 4DQRA 2GFFA 1MU2B 1Q5YA 2W7OA 2X1AA 3NY0A 4WP8A 3S9HA 1RSCA 1RTJA 4OX9K 1WTFA 3KDNA 3IR5B 4Z4IA 1PGZA 2Y1RI 4N76A 1VBXA 1BIUA 2BA9A 1PBAA 3G4SN 1R27B 5L38A 5ETRA 4M3WA 2UUTA 2YCHA 4DR5K 4CCHA 1UA1A 3EO3A 2MQLA 2ZJRL 3G82A 3NCIA 1RT1B 5EUHA 4PXEA 2UUAK 3SI6A 4WCEQ 3IWNC 2A18A 4TN2A 4J9NA 4PKIA 2IFXA 1T0TV 4CEQA 4K41A 2VQFJ 5FPNA 4MDBA 4F50A 3U1NA 3D6MB 2ACYA 3VVTA 3HOSA 4DTOA 2DPJA 4DV0F 4JI1K 3CJ3A 3K9JA 3IR7B 3FBBA 4DR3F 3QSYB 2AHOB 1MWZA 4MIWA 3M8RA 3FEXB 1UEUA 2KRBA 2E5LF 3OL9A 4DHVA 4LF6F 1DARA 2FC0A 2IA0A 3A3OB 1KEKA 4DQPA 3HSDA 3J7AP 5B0FA 4QWAA 2AYGA 4F8RA 4YDUC 4FKXA 4MLEA 4WE1B 4QS7A 2VFVA 3PIOQ 4BLGA 4B9MA 3AVHA 3M8QB 2CQCA 4U7CA 3G6YA 2QW9A 2E2PA 2CH5A 1RGVA 1C0GA 2P5GA 4DSLA 2BOPA 1EARA 1RUSA 2KO1A 4QCLA 3PX4A 2Q2RA 2FVCA 3WIUA 3G87A 4I1TA 1T11A 2KT3A 1KSPA 4KHPJ 5KFZA 2YWHA 1B0VA 1RABB 3AVKA 2E66A 1J5OA 2IVYA 3DFEA 4PWDA 4CLZA 1NJIO 3T9ZA 5KFMA 1C0TA 4ZJOA 3BO2A 4DBQA 2DNKA 3AY9A 1WHXA 3W8GA 3W2VB 3GQCA 3CIPA 3KHGA 3CFPA 2WOMB 2A6MA 2J7KA 2LDYA 3K57A 4JI8F 1WSHA 1XC3A 5M2RA 1NO8A 3DHWC 3Q7BA 3IS9B 2VPYB 1OY9A 4M7XA 1RWOB 3KWIA 1D09B 3CUNA 2PO4A 4DLGA 3QNNA 1X4FA 4WE1A 2W2PP 3O9UA 4I6MB 4RTFD 4NLYA 3MEDA 1WOSA 1IG9A 5CD4H 1IKWB 2DNYA 2R2SA 4OZ5A 3NF6A 3OXFA 3CD7A 3R9PA 3H98A 4OYMA 4ZPTR 1I1GA 3HHLD 4FWPA 4DMNA 4DZ6A 5C24A 4DX7A 1WSEA 1F21A 3CC2N 4UOGA 5C7PA 1B9DA 3UW1A 2DFHA 2V8HA 3DOLA 3RMBA 3K8WA 2CDRB 2NXCA 4CZHA 5BR9A 1CBKA 4J2BA 1FNXH 2IGIA 4ZVEA 3NL0A 4PHTX 4PWDB 4O3QA 4DL5A 3G0ZA 3PJ9A 3L7PA 3HVAA 1ZM3A 2KXNB 1UVIA 1S48A 4PG7A 4CJPA 3D2EB 1W26A 4UQTA 3J7ZO 3K5OA 2PFFB 1XMQF 2XSJA 5LMUF 1HKCA 1SC6A 4RG8A 2ZWOA 7FDRA 1BHLA 1NSAA 3EZ5A 2KM8C 2DD8S 1RDUA 1HNXJ 3QATA 1NGDA 1KVAA 4M5DA 3ZXWA 2XLKA 4NZ0A 1S72N 3AVCA 4ZCIA 3NDKA 2P1JA 4CI6A 3O1BA 1KDNA 1FW6A 5A6WA 1VAZA 4FOIA 3G71N 3WEEB 2J6UA 3IR6B 5AQQA 1PG5B 1YJ7A 2EG2A 2AEFA 2A0FB 3NWGA 5KPTA 5MLCV 5FIIA 4Y65A 1U0SA 1DJ0A 2IIHA 5KFRA 2IDLA 2XS7A 5T7LB 2DHAA 2OEKA 1BWEA 3DLBA 1QVGR 3HBTA 4NYFA 3UNYA 3FQKA 1RTIA 2KH9A 1BQMA 3K89A 2YNHB 4UY8T 4X4PA 1FD2A 4PPDA 1K8KB 2EPIA 3BYPA 3I4PA 4J9RA 5IT9U 2E2QA 2WB1D 3QFHA 2PFDA 4K43A 4RW9B 1OH7A 4NL5A 4ED7A 4LF7K 3W5XA 5AQIA 4PKHA 4HDHA 3H2UB 2NUBA 1XHXA 4OLPA 1SVDA 3DM2B 3QO9B 2WONA 3TZWA 1UTAA 3J7YU 2D0PA 2ZBCA 3TTCA 4BGAA 3SQ4A 3JTNA 4HH1A 1NK7A 2Q3PA 3N6MA 3VQEA 5B08A 2E1MC 4IEEA 2LQJA 5HMZA 2FF3B 2FVRA 1EETA 2OO4A 2RRBA 1HQUB 4LUBA 3MX2A 1K0VA 3PM9A 3DRRB 3S3NA 4CK3A 2IMWP 4BRMA 1KOOA 2DBBA 3GG4A 4FPBA 3MEGA 2BJ9A 4KTQA 5H9EK 3OYFA 1YBTA 3M2VB 3WNHA 4PY5A 1TP7A 3OYJA 2K1RA 3NF8A 2P6SA 4ILRA 2W9CA 1VQ7S 3CXCM 3RWUA 3A0IX 2QWMA 4RNNA 5CR4A 2B4OA 3OLAA 4FM1A 3RMDA 1ZETA 2UVUA 3R6MA 4IQXA 4JI3K 3PVXA 1S0VA 5DM7L 2D1KA 1QHAA 2ZH8A 1CVJA 1C0UB 1CJTA 4S0MA 2YHAA 2ROGA 2IM0A 3ZT1A 2R8KA 2LEAA 4C1NI 3PEJA 3HFZB 4FPAA 3LP1A 4KAIA 3W2WB 5LT5A 1SZ2A 4UW2A 3EDQB 4KHWA 1NSKL 2HFOA 3KLIA 2POKA 3AGKA 1D3WA 4JUZA 4X84A 4ALZA 1WUAA 4DV2K 1AW0A 4BE0A 4AH9A 1JLEB 3GU0A 4MMOA 4B08A 3FBEA 2CQ2A 2Z58B 4CJ4A 3UPFA 1J54A 1OVYA 5KRTA 2F8HA 2IJRA 1UJ5A 1S0MA 1GLBG 3DMJB 3FZHA 3BZKA 3QETA 4QWDA 1FA0A 4CERA 1VQ5S 1T9YA 1U0HA 1X5TA 4E1MA 4O8UA 1HJRA 2AJFE 2HEKA 4O23A 3D28A 2B9WA 4RPFA 5AE1A 4HEA9 2CWKA 3GIRA 4F7VA 2B56A 4G3IA 2NPFA 2WONB 3QYYA 3AVMA 1FERA 3KHHA 4LF6K 2P9KA 3OYMA 2X51A 3QIOA 3QFWA 2CDQA 3NG8A 3MXIA 3FDSA 4TYBA 2A3ZA 1FX4A 2I7PA 4URSA 4LF4F 1OS5A 5JXSA 1S5JA 3OTOJ 4M41A 3OL6A 3RR8A 1NGHA 3MM6A 2ATLA 3MN6A 5K8MA 2I5JA 2FSNA 3LP1B 2BE9B 5M1NA 1GMWD 3HJFA 1CZAN 3C6TA 2NXNA 1QLNA 1QM9A 2CFXA 4DF4A 2MJNA 3LPTA 1FXRA 2CQBA 1E6VB 2CPDA 4UT4A 1Y5LB 1RHRB 3PIPL 3NXZA 4JHDB 2HAIA 2R2UA 4KKOB 2ALZA 4IG3B 5EX5A 1C4CA 2ZZNA 4FBTA 3C46A 3SPYA 4DR7J 3JAMY 4J7CA 3QT6A 4HTJA 2ZH4A 3GPAA 1RT3A 4LF5K 4RUBA 2OAUA 1QS4A 5EXWA 3MMBA 3NBPB 3CMES 2UXDJ 4BC9A 3L4BC 5KT4A 4NLPA 4PG6A 4DKWA 1IKVB 2IM2A 2H51B 3VPZA 1QE1B 5KOXA 4O0NA 3W2WA 4GKKK 3GJQB 2ZH5A 4LSNA 3GSDA 2AW0A 5F8NA 2FGCA 1RE1B 4GVEA 1FRIA 4A57A 5FDLB 2ZM6F 2VBWA 4JYAJ 2UU9J 1GTHA 1LK7A 3I5AA 2UXCJ 1N5TA 3NGKA 1ZBUA 3BSAA 2KKHA 4FPRA 1Q9YA 1YG0A 5A0YB 4C7QA 2ZFHA 2I7NA 1DT9A 2XG8A 4DL7A 4F4KA 3S41A 3MPDA 1D1UA 5CYJA 3KMQA 2PFUA 2B7CB 2P9LA 3UCUP 4DV1J 3M6GA 4WF9Q 5IOLA 4HI1A 2C2ZB 2ZH1A 4ZKAA 1P9YA 2HVIA 4FLVA 4WZQA 3SBMA 3LDLA 1TV6B 3AVGA 2BE7D 4CLKA 1YK9A 2EKNA 1KXPA 3VGUA 1S6UA 1JB0C 3EVMA 1WUUA 3HSZA 1NK9A 1JL2A 2MDAA 1ITGA 1U25A 3KJNB 3NBPA 2HOEA 4DFMA 4USKA 5EU7A 4FLYA 2HBYB 2UXBK 1RT7A 2FIUA 2QL5B 1S57A 1SV5B 2IBKA 3V2UC 5JVGQ 2PEHA 3SCKE 3OYCA 1X4BA 3U02A 2UVWA 3G25A 1HBUB 1PJ5A 2WVFA 2V0NA 3BGRB 1HNIA 1U1LA 1XMOF 3ZSXA 4GVBB 1X0PA 4TY8A 4XAKA 2NREA 3OFEA 4E89A 1C0TB 1RKJA 3HT3A 1N33F 1YZ7A 2EFQA 2MZJA 4L75A 2QFJA 2AZ1A 4LR9A 4CHYA 2IJFA 1KBRA 2C3PA 4HHJA 4ZVPB 5ETPA 1D8YA 4CJRA 3LA0A 1CPZA 3IG1B 3DI6A 4Q2MA 3N6LA 4JI8J 1YBUA 3U1MA 4KB1A 4KHMA 2CZVC 2NZTA 5AZJB 1WF2A 4B3MF 4BWMA 3MZIA 1V4TA 3LQVA 1HW8A 3G6VA 5HRNA 1VLOA 1N48A 2HPUA 1UAXA 4NYZA 5JVHL 2ZE2A 4FZXC 3G86A 3S3OA 5KFBA 4M5DB 3BBBA 5G4DA 4K8RA 2OFGX 4K4WA 2IDEA 2Y1IA 4NA1A 2CPXA 3CM6A 2VFTA 2AT1B 1T9XA 2CNLB 3CO0P 2L48A 2W24A 4J2AA 5BRFA 5BYSA 5DDPC 4JI2J 3GIIA 3UO0A 3WXMB 2RQ4A 1RTIB 3PRVA 1IG8A 1BQMB 1X5SA 3K0SA 5IV3A 2QKKA 1L5UA 2XWXA 3I96A 3EKSA 1K8KA 3WUHA 2X74A 3R6LB 2FHMA 3HDSA 3MPUB 5F3TA 4R5PB 4NZ6A 4EUVA 1RAHB 4NYNA 1DFDA 2VF3A 3BV8A 4PABA 2FSKA 4KV8B 5JS1A 2RU9A 4CFBA 1WC6A 5EVZA 3OA9A 2V5HG 2DEJA 1Q7YT 3O1WA 4DL4A 2BJDA 5DK5A 4ETXA 4JI8K 4OI0A 3QNWB 3MEKA 4NLCA 2EX3A 4TKTA 2AD9A 2QWPA 4NLQA 4IOAL 2KL8A 4CGJA 3J8AA 1Y5IB 4QR2A 4OLBA 1FK9B 1X31C 3IBCB 3CCTA 1VQOS 1ATRA 3JQJA 4CJTA 1AB8A 4O44B 2VGNA 3G4SS 1NPRA 1VQMN 3S01A 3SSSA 4N77A 1CJKA 4OJHA 2ZDPA 3P5JA 3BZCA 3PKYA 3AQOA 2BTFA 4Q0BA 2AX0A 4WTOB 3KZBA 2L9WA 2P6TA 3GYGA 2C3UA 3JSMA 3MM9B 3U6FA 3B4MA 3TARA 5AQLA 3L3CA 2XB2D 2V2QA 1DTTA 1IBMJ 5EX0A 4ATNA 2IRYA 4FLZA 4RR5A 4N47A 2P9EA 2A1BA 3QIDA 4YS2A 5B0BA 4DFPA 4M42A 2BKOA 2DGSA 4WFAQ 4P9SA 2XZDB 2M4MA 3KHRA 1FRKA 1DURA 4PKDB 5FPDA 2F4FA 5JUMA 3AT1B 4H0YB 4EU0A 1VSKA 4K4XA 2PDAA 2CNKB 5JLFA 3CO9A 4QR1A 2YKNB 5LL6Z 5A8RA 1NJXA 3IRWP 5HP1B 1JLCB 4DTNA 4OGEA 4PKGA 2U2FA 3HOTA 2J0XA 5IC4B 5BYQA 3VQ4A 2JDJA 4YHHF 2QMWA 3FC9A 3W8PA 2LEPA 4XIUA 4B3TF 3T1YJ 2DYAA 2GMLA 2KHOA 4LF4K 1MWMA 3LZIA 4QW8A 4WFXA 4DJBA 3TAPA 2SXLA 3C6UB 3CCWA 3PYDA 2VC1A 3R2DJ 1N32J 3KJVB 2MLYA 4EYIB 2V94A 1MSWD 5FLXY 4DG1A 4FJ8A 3J81U 2YQ0A 3NHGA 1Y9OA 4QJVA 1MMNA 3JSMB 3MM9A 4RNMA 4PEOA 5AQRA 3V9SA 3V81A 1XK8A 3B6BA 4DOZA 3PIOL 2XY8A 1FJGF 4RUHA 1JLEA 4LFBJ 4LR8A 3EGWB 4OFZA 1R3NA 2JWNA 3KLIB 4IFVA 1UPPA 1OYEA 2BM1A 4WPAA 3MOJB 2XGQA 4OI4A 1H0HB 1XMQJ 5KG2A 2O4IA 4J9KA 1TAUA 2AEMA 2P9SA 4Q5VA 2DHGA 1HNVA 3D67A 2HBZB 1S1UB 4LFCJ 1VS3A 3AOBA 2WUSA 4JEPA 5C42B 2F4VJ 3DOMA 2CQGA 3CB4A 3OFGA 3D0IE 1X5PA 4LFCK 3MR6A 1N36J 4CBUA 4CZIA 4NI2A 1F60B 1VHIA 3WC2A 5KFTA 5D4OA 2ZBQA 3ZO7A 3OYAA 2GA7A 4LFAK 1RT2A 2VG6A 4OV6A 2XO7A 5G0RB 4CYUA 2ZNYA 4WF9L 3DCAA 3MMBB 3C6UA 1N0VC 3Q7CA 4HTLA 1NBEB 4ILJA 4TU9A 3Q8QB 1EX4A 4DQQA 2F40A 5KFSA 4EZ9A 1XNQK 3M6WA 1HNZJ 5D78A 3VQ6A 2HNYA 2C1EB 2YX1A 3F9MA 4B1YB 1RNHA 2ZZMA 2CVIA 1SH3A 1E6VA 1VQ9N 4A61A 2QV6A 2YKNA 5EN1A 2E5LK 4ED8A 1RHKB 5LMNK 3OPKA 3BBFA 3OYHA 4C8NA 5GAEP 5FDLA 2Q43A 3BB5A 3GG1A 4P6QA 3UN5A 3ZTOA 1BCOA 4ISGA 1RAFB 4CJWA 3I56S 3I5CA 2IMOA 2NRXA 2DJWA 2E9ZA 2DCLA 3HVRA 3EZWA 4IDKA 3D2EA 2EK6A 4HWIA 2BR0A 5B8HA 4IKFA 3CJ9A 1S6OA 3GBTA 5CHIA 4JI0K 1GAOA 1R6VA 4Z7CA 3AARA 3U9DA 1RAJA 2G8IA 1HNZF 1I6JA 2D9OA 3LGMA 3R8YA 2QA2A 1TUYA 3OFHA 3AD8C 2E5JA 5KGWA 4ECXA 4LMZA 3W3DA 2MLXA 4C0HA 4F67A 3GZ7A 4JI3F 3MDFA 5F8IA 2KM8B 3BY5A 3CC4N 4TQRA 4EWTA 1B4SA 2ZITA 5GAGI 2BABA 3OQ2A 3OTBA 4FJ9A 1HBMA 5AZIA 2DR8A 5H9EJ 3E1YA 5ETNA 1HBUA 4CGFA 4AHCA 1KC8T 4IWVA 4X2BA 1RFQA 1Y5NB 2N3OA 4USTA 3LPYA 1IH7A 1SV5A 3GSIA 2HHUA 1IBLF 2ASOA 1NLVA 4CJLA 4B02A 2OKQA 1YKWA 4EP5A 2HB5A 4XDCA 4LH5A 3FZFA 2E9RX 4BDPA 3HSCA 3KK2A 1LWFB 1YRUA 3H4DA 3DWLA 2P9PB 4Z4CA 4GKKF 2XNQA 1T05B 1GLCG 3RBDA 3H40A 2V63A 1HD1A 4I7FB 2HS3A 3ATUA 3TPQA 4DU3A 3GV5B 1RBLA 2GZOA 5E3AA 2OGUA 2OUGA 4JBCA 4NRTA 3ZTQA 4GKJF 3ZZYA 1NEEA 3DGPA 4QYZJ 3ZSQA 2D0CA 3P6YC 3NNHA 2RPIA 4HL9A 1Q81O 1PSDA 4FF1A 2VGMA 1LW2A 2QLFB 3UKRB 1SQKA 2AJQA 4K5SA 2Z4PA 3Q8SB 5A2QY 1VQNN 2RU3A 3O4QA 3FZMA 5JICA 1R0CB 1SUQA 2FSJA 4C8MA 4MYTA 1OQ6A 3OFFA 2YNIA 4CZEA 3QIPA 1HQUA 2L41A 4C3MA 3QWUA 2BZ2A 1H7WA 5CCLA 1KTQA 3DRRA 3QGPA 1U6BA 5J2PB 1NZ8A 2HHXA 3HCXA 2R2TA 1FI4A 4A8SA 2ASPA 1QQNA 4OLOA 4DR3K 2C3MA 2YWFA 1JLQB 3HHLC 1EB0A 1GXTA 2VCPA 2W8KA 2P9CA 3TZZA 1W7WA 4X62K 2HURA 4U9RA 1UL3A 4IOBA 2HS0A 1U24A 3VQTA 4BWJA 4LBPA 1WLJA 2ZD1A 1PC4A 4E0DA 2LDIA 2LCWA 5DQIA 4HCCA 2H65B 3UD3P 3IUCA 3BN7A 1HBMB 5AZIB 4LF7F 4IFYB 3MM7A 3ZETB 4Q45A 4TSXA 3SCJE 2HBMA 3J7YI 2OCEA 4AFFA 5KFCA 3CCES 1TTHB 2XNRA 4FW2A 2MSSA 5A6PA 4M5JA 2W2MP 5GAHP 3DNCA 3KK2B 1LQ9A 3R5JB 3RAXA 3P1GA 4CJQA 2Q1NA 1VSHA 1O6XA 1U02A 2KJWA 3Q24A 3R5DA 3CJ1A 5MLCQ 1NK5A 3IS9A 4OX7A 2DTJA 4DN9A 1W97L 2IJNA 4C8ZA 1U1PA 3M9NB 4K25A 2HFNA 4OIXA 2EC0A 3MXJA 3RUBL 4N7TA 1FXLA 2W9AA 2V9WA 5E33A 4DPYA 2VQEK 1W2BR 2MQQA 3V9ZA 5GIOA 1JXVA 3OY9A 3K2YA 1FNMA 4B1ZA 4IRCA 2NLWA 1H1VA 3O3LA 3WXKA 1X1PA 3Q0AA 2YKMB 4OKKA 3M1VA 3MMCA 2HFUA 2E20A 2RHSB 5J2QB 1ZPVA 4HTIA 3OS1A 4QZVB 3BO3A 3SPZA 3TSPA 5C2FA 2UV8A 1KQSR 1R59O 2YJFA 5KFFA 2OTLS 2DY9A 3PHTA 1KQSM 1XERA 1SJQA 2C42A 1KVCA 3HP6A 4JI0F 2Y0BB 3HVTB 5D0EA 1VBYA 3D66A 1FJGK 5HI7A 5LJ5Y 4CZKA 3BQ0A 4K0KK 4U67L 2GV9A 1VQSA 4FYVB 4U7BA 1ZM9A 2DNMA 4QIWD 2V4JA 2RDIA 4ZP8A 4A62A 2V51B 3UI3A 1CSJA 1FESA 1QAYA 4GY2B 1ZA2B 2Z1IA 1ZBSA 4ILGB 4V19X 2E1YA 4DQ8A 3UN2A 1PKUA 4KGVB 2M5YA 1TYQB 1QVFM 2CJXB 4A2AA 2D3O1 3MCPA 2AEJA 2HHHF 2BRKA 2RS8A 3I9V9 3V81B 3ID6A 2D74B 3R1HA 3NGRA 2RKIA 1NU0A 2P8IA 3VTHA 5C42A 4JV5K 2ZH3A 1FE4A 4DI6A 4CF8A 2BANB 1UCNA 2CJQA 4O55A 4DX8H 3L95X 3ID8A 2HK3A 5ITHA 2P2CB 3L7UA 4F26A 1GH8A 1EJ7L 3JYTB 1KVBA 1T94A 4KB7A 3OTOK 2CQ4A 4CF1A 3S7RA 3VZHA 1JLGB 1N5YB 4L3NA 2ZBPA 4DR5J 3HVTA 4KI6A 4X62J 2HSEB 4TLQA 2F65A 3CJBA 4IFVB 5BR8F 3TOQA 2XMMA 1JJHA 4CYUB 4Y1DA 3QICA 2O66A 3PX6A 1TL5A 2HZVA 3LP2B 1LKZA 3G6ES 2XYPB 2HVHA 3HVWA 3OTOF 1TYQA 3M1VB 3LL3A 4LF4J 4HACA 5FLXO 1QTMA 1RTHB 2L9NA 3OSPA 2Y9HA 5FPMA 4LR7A 4FJLA 3WNEA 4CZFA 1YHQN 1T44A 1BA0A 5D15A 3FGVA 2GHVC 3HMJG 1SJ4P 2RKIB 2WVCA 3I9ZA 3ZEUB 1GT8A 5H9FK 4JV0A 5AQUA 5HROA 3G8QA 5KG1A 2FBVA 2FLOA 1D9AA 1U2VB 3L3VA 3BSCA 1GOBA 4GC6A 2AX1A 3AVFA 3IAS9 3SUQA 4PAAA 4ILMA 3NKYA 4FJNA 2WFBA 3BKTA 2FLNA 1XR5A 5HN0A 1PYTA 5AZJA 1RU2A 1SL1A 1S10A 1ZTWA 1Q7LB 1RCHA 2IYGA 4OYBA 1ZBIA 3ENQA 4DLEA 4KH1B 2DRAA 5MAOA 2YY3A 4C8KA 4YOYA 2ATQA 4KE5A 1CC7A 3C2PA 3NH1A 1MW7A 2FHKA 3LAKA 4ZLPA 2J9CA 3HHLB 2CNNB 2KJVA 4B3OB 3AVIA 3NGTA 2Y8YA 3GIMA 3WZ0A 1J5OB 2I5JB 3OBWA 4ISEA 1GMVA 4QIEA 2AGQA 2Q6CA 1FDBA 1RWNB 2K7KA 1IKXB 4EEYA 3H3OB 2ZVIA 3A8JA 2VV5A 1HNXF 1U7LA 1TZ0A 3BZQA 4DCPB 3EPIA 3T1HF 3POTA 1TELA 3R7BB 3VF0B 1UW4A 1OQ3A 5FPEA 1D9DA 4KRWA 4B3TK 5IXUA 1QHTA 4J9SA 5M2PA 3QJPA 4AHUA 4CVNE 1LWFA 1T7PA 3T6JA 4QPXA 4FP9A 2VA3A 4BGBA 2JSXA 5IC6B 2HBKA 4YB5A 4RKUC 2VB6A 3PACA 1HKBA 4MFBA 4ZP6A 3SMZA 3V9UA 1HNWJ 1VQMS 4Y2CA 3TYTA 3AB2B 5BREA 2WTFA 3HSJA 2V9KA 2D0BA 3C7NA 3Q22A 4RO0A 2NS1B 4Y2KA 4QWCA 3VGLA 3PW5A 2MY8A 2HNDB 4M1KA 4BE1A 2IAJB 1BA1A 3P83D 5F8JA 4E7LA 1BQNB 3VEWA 3O6QA 3UE5A 3G96A 3H5XA 2B9YA 1FKPA 5CAAA 5J2PA 1R8AA 1HNZK 1HX1A 3DOLB 1SJ1A 1TK0A 4PXBA 3SFUA 1M5SA 4X64J 1Q82T 2OMOA 3OYIA 1NWKA 3VALA 1JLQA 3R7SB 3B78A 1TAQA 4Q44A 3UD5A 5KFUA 2MXYA 1CJVB 2V8GA 2QGFB 3B6PA 4I7FA 1DHMA 5DJBA 2KFYA 1TGOA 3DYAA 3CD5A 4DUYJ 4OX9F 3M8PA 3VCDA 4PL7A 2KKZA 4IEIA 3RZAA 1TK5A 4OYIA 3V1RA 4P2SA 2V2VA 2R3VA 5IWAJ 1HMVB 1URNA 4BBYA 4WTYA 1X8DA 4AQYJ 2GIRA 4NCBA 3HD2A 1NB7A 1M5KC 4IFYA 3MM7B 4YDUA 4AE5A 2XRIA 1S1VB 4F3OA 1BIZA 1BLUA 4JI2F 4JI4K 4Z4HA 5IT9O 3AA8A 3KHLA 2VOPA 5AQVA 2GX8A 2IVMA 2ILZA 1TL1A 2UXCF 4JNEA 1CULA 4WFZA 3PO5A 3QT5A 2DGWA 4DUZK 2BKPA 1UZDA 5C5JA 3BGRA 4OZ2A 1MA9B 2HHSA 4U7UK 4BC2A 1O8BA 5KRSA 5FD1A 4CO0A 4DR6K 1EWRA 2W41A 3KFWX 4AL5A 2H48B 4USJC 1VLYA 4XH5A 4OGCA 2O01C 2W40A 1S99A 5L1KA 4A8FA 3ENHA 1EKSA 3CJ7A 1N32K 2DY4A 1MDUB 3SEOA 4CHOA 4YDDB 4ZVGA 5EX3A 3CCEN 3EMTA 4C8YA 1UW9A 4YR2A 2JC1A 1Q53A 1RZMA 1NGFA 3E8OA 1RT7B 2DR6A 1S9EB 4TU8A 3CC7S 4MK7A 3QSIA 1RBUA 4PPZA 2YKMA 4NB4A 1X5OA 2KDOA 2R7YA 1S0NA 2BJ7A 2QA4G 3BDPA 3C94A 2I8EA 3VAFA 1S3XA 4FWMA 4F4YA 2GJFA 1HWUA 2IYIA 4F9OA 1PYOB 4JP8A 2MMYA 4HTUA 4J2EA 5J2QA 1X60A 3PCOB 1M90T 3O4NA 1U8SA 2QM1A 1RBVA 2UU9K 2HHHK 2AJ2A 1N33K 4LF1A 2LECA 4ZOSA 2R7WA 1BUXA 4BRDA 2IRXA 4B1XB 3UDLA 4KIAA 3FRYA 1FWPA 1NGCA 5J1EB 3P31A 2N7YA 1R0AA 2HVZA 2UXDK 4CW7B 5CA5A 3K9KA 3HF5A 5A8KA 4C4WA 1LV5A 3VF4A 1T03A 4FXDA 1YWXA 2ASMA 2W7PA 1U1RA 3U9ZA 1ZBTA 1VQ4N 3KD5E 2UVRA 1IKYB 3JQMA 2FJDB 1HD0A 3W5ZA 2C22A 1IJFB 1WG5A 4MYUA 3O8WA 3MR7A 3MCNA 3MM5B 4DL0C 4AXIA 2QT7A 1AUDA 3V9WA 5BPNA 3AA9A 2BANA 2H3EB 1N8RT 4HCBA 3AO2A 4Y28C 3DLKB 4CJKA 2C28A 3TAGA 1EQYA 3BQ1A 4WFNQ 4XH1A 4A8YA 4YORA 1FTRA 2JHEA 1WG4A 1GLFO 4J9QA 2HRTA 4QU6A 5KFAA 2VWBA 3MMVA 3WXLA 5F3ZA 1FJ7A 2AKWB 1ACMB 5DGBA 4H4MA 4M3ZA 1A6LA 1N8RO 1EXQA 2ZHOA 5ETQA 4AHSA 2F3JA 1D4XA 1BWFO 4FVCA 4DL2A 2ZKTA 3R5AA 4B3RK 2GW8A 2LYVA 1VQ6N 5F0UA 3EUNA 4QS8A 3UWTA 3GILA 2CUYA 1S9EA 3QJLA 1NMEB 4NLBA 4EBCA 5I3UB 4I9LA 4CEEA 2FJXA 1YJWN 5IM0A 2GX9A 1IBCB 1KC8O 2GEMA 3NH0A 2XMTA 2HWHA 2CGJA 1WAFA 5BR8K 5CD4A 2DO0A 1KKHA 3T1YK 2J0WA 1Q5VA 3K5PA 5A8RB 4JK7A 4F0KA 1J6ZA 4JHDA 4K8XA 2COLA 4BRNA 3KUEA 4EGLA 4CHNA 2H5IB 4KTZA 1JX4A 1RACB 2OPQB 4YN3B 3VR1A 2OZSA 1U1KA 3ZCMA 2V7ZA 1UVKA 4CIOA 3A5MC 4J9VA 1LEOA 3L8BA 1C1CB 3FMWA 5D0GA 2QXLA 3GCWP 1FEHA 4M5LA 3FQLA 5E3PA 2RILA 3MMAB 4F02A 4Z4GA 5J1NA 3THTA 3MCAB 4GMKA 1TUWA 3B4DA 3ZTSA 3QGGA 1K8AT 1BHNA 4USIA 2W2QP 2BMBA 1RAIB 5J2NA 2DITA 5KG4A 3D1HA 2H5JB 5DZ6A 1QE1A 3VAKA 3DXBA 4ZVOB 4I2PB 4DUZF 2DXEA 5F1XA 3M32A 1RTHA 2GQCA 1OY8A 4FJ7A 3M9MB 2QC3A 3K7RA 3NGIA 1Q86T 1NNDA 2F7VA 4ZLLA 2AGPA 3UDCA 3EXCX 3L7OA 4YP3A 4U7UD 1XI1A 3C0BA 4ZMMA 4DMZA 2IRUA 2F8EX 5CCMA 3LDNA 2V4QA 1W0HA 2F8SA 2G8HA 2HQFA 2G8WA 3D9BA 1W7AA 5AQWA 2V68A 2R42A 5DGAA 3IO1A 4P7TA 4DV5K 1VISA 3H5UA 2FLLA 2ZM6J 3A3PB 1Q86O 4IXCA 4PA1A 3WNGA 3KKRA 2UVVA 4OYZA 1RDRA 2H9ZA 1VSIA 1RGIA 3MCOA 4FF2A 4BDZA 1GOCA 4FK0A 1KP6A 3SUNA 2R7RA 2CG4A 3HHLA 2A6AA 4ZVSB 2V2KA 2I9SA 5KT7A 2AA4A 2GVDB 4KI4A 1I94F 4DB3A 2V8VA 5GIPA 4TYAA 1B64A 2Y0SD 2V69A 2M7SA 4YUDA 1HNIB 2YQ1A 5HAOA 1GNKA 3KVGA 5DS7A 1T9WA 3GYNA 3I82A 2GMHA 4DR5F 3SBGA 3LDQA 3HSGA 2GUIA 5L8RC 2BW7A 3OUYB 3NCRA 4H5NA 4NXNJ 3IRXB 1QD1A 4WYWA 1SKWA 3RRHA 3ZTPA 1IQZA 3F44A 2JGUA 5DRKA 2MKJA 1HJOA 2HWIA 4YY3K 2KW4A 4UTGA 2CNOB 2D3OR 1HWKA 2V6AA 3NGUA 1I51B 3MAAB 1RCOB 2DXFA 3O4WA 1H98A 2C2OB 5HATA 3T1HJ 1AFIA 2E5GA 3M2RB 4FM0A 4CZJA 1EP4B 2MHNA 3VF6A 3MR5A 4B9VA 3HFKA 3MX5A 1HMVA 4KHYA 2ASLA 4HLBA 2QA4S 4DPUA 1NBWA 4DS5A 3WIVA 1ZM4A 4I69A 4O3OA 5GADP 3ONQA 1RLDA 3RAMA 4ZCMA 3IBWA 2XTJP 3T1YF 1H74A 4PG4A 5D4LA 2CWXA 1G7CB 4W5RA 4QPTA 3SQ0A 1YT3A 2CZ4A 2X7IA 2PA3A 1U2FA 3BF3A 4CF0A 3P96A 4WXWA 1JJ4A 1WHYA 4RW7A 2GJIA 4IRDA 1RHUB 1MWKA 3DOKA 1VSMA 2YVSA 4DEZA 3H42A 3R3LA 4U8VA 4CHPA 1IBLK 3CWJA 2XS2A 2PD1A 2J8SA 5RUBA 1JQGA 4ZA1A 2ZE2B 2EFVA 3G8TA 2KZZA 5FROA 4CO4A 2DKOB 4K0KJ 2OANA 2J0QD 3TZXA 1CULB 3W5YA 3DXMB 3NWRA 3LM2A 5ETKA 1N88A 2EC2A 4BC3A 4DV0J 4RU2A 4YY3J 2PSZA 4DX5A 1W9HA 3J7AN 1WC0A 1LOUA 1IJJA 3W9JA 2B8PA 2QZ8A 2WC9A 3CC4S 3DRYA 3P4UB 2E6MA 2GNKA 1Q1KA 2VONA 3V1OA 2ACMA 3BKUA 4N5SA 4F4AA 4BC4A 3A1YG 1HPZA 4H0VB 5B7WA 4E98A 2BKNA 4P2FA 1U47A 1VRTB 2OPRB 4GRSA 2W4PA 2NXJA 4E8UA 2O8BB 1RT4A 4BRLA 3SJJA 5DLGA 1CQNA 5AQPA 1HPMA 4BR0A 3MEEB 1FD8A 3QWPA 5KQDA 2GAHC 4P72A 4CP5A 3OS2A 4IYQA 1E4FT 1KN6A 4CLTA 5GAEU 4BY9C 2CJ9A 3VGKA 5GADI 2V34A 1SUQB 4ZPWR 2ZD1B 2HLTA 1ZAWA 2NYIA 3C65A 1Y00A 2KQ2A 1F5AA 3QERA 1HHQA 3CCQS 5ADXA 4LF5J 2EG1A 4MK9A 3CMAS 4KY3A 3GWCA 1X4DA 4A59A 3DRPA 3GP9A 4WU2A 3DAWA 5CZVA 4FBUA 3GFXA 3SFGA 2JX2A 1F9HA 4ZVQB 3QEVA 1VQKS 4NRUA 3CTRA 3ZYYX 1HYVA 4DV7F 3S6EA 3QRQA 2MZTA 1DLOA 3US5A 3TAEA 2W1BA 4QAGA 1ATSA 5I42A 4ID8A 2IIRA 2WVDA 1A7GE 6FDRA 2HKEA 4KHUA 4KGZB 2G0CA 1WBDA 1NUEA 1UJ6A 3SQ2A 5EWFA 3Q8UA 3OR2B 2BACA 3DLGA 2UUWA 2C2DA 3A5NC 3IAM9 5M2UA 2YWKA 2JZ5A 1GTEA 1YJVA 4DG1B 1GOAA 4FJJA 1KVKA 1WKJA 2HMIA 5CHCB 1KRPA 1QY7A 5I3UA 1TL7B 3IM8A 3FFKB 3GR1A 3A5OC 1S76D 3P5BP 2J5AA 3AD9C 2MKSA 1JLBB 1HR0J 2EFGA 4KPCA 1YGYA 3EVWA 3M8WA 2ZVSA 1S4EA 3BUZB 3SDEA 2CJYB 1HHSA 2AMCB 3SXLA 2OP5A 2DR5A 3M30A 4WFBQ 2VYPA 4DTJA 1HKGA 1Q9XA 3HHNB 3FE1A 4FVMA 4JD2A 3P38A 2HGNA 1UOCA 2C2EA 4H4MB 2RDDA 4CJVA 1X4GA 5KGXA 1TUVA 1V5IB 3PV8A 2KXHA 4DV2J 1GK8A 1M1KO 1MU2A 1VQNS 4LT6A 1U1MA 2JVOA 4F04B 1JWWA 2QWRA 4L8RB 2JRSA 4E19A 5ADZA 2J6SA 2FJWA 1RT2B 1ITPA 1FNOA 2B7BB 1C1CA 3TRGA 4F4ZA 1C1BB 3SCIE 2FF6A 1B70B 1I94J 3ZT4A 4X66F 4FDFA 4IUFA 4JI3J 5E26A 3JAMO 5I4MA 5EGYA 1IWAA 3WDOA 3AV9A 5AQOA 3TVZA 2MYFA 1VRQC 2XM3A 1WWHA 3PDNA 3DU6A 1S1UA 3PFEA 3CJTA 2JEIA 3VGSA 1VSLA 1P8GA 1LWCA 2DNLA 3FZKA 1S77D 3MEGB 4A8MP 2WHOA 1IO2A 2E5IA 3GV7B 4BG9A 4RU9A 3H0PA 4Y2AA 3AAQA 2AV5A 2A40A 3J81O 1QZ6A 4WWSA 4BACA 3VQ5A 1VQ5N 4FWOA 4CEFA 1FF2A 2N3LA 1LWXA 3L9ZA 4P10A 3CCLN 1KAYA 2QEXS 4YDXA 5ADXH 3R2CJ 3R97A 4RNHA 1WTBA 3FZLA 2VWJA 3GJSB 3DYAB 4IJNA 2E1CA 2QWNA 5AQGA 1UA0A 1KQGB 1W2IA 4GO7X 3CC7N 3HPOA 3EICA 3QB0A 4CD3A 2FD2A 2H3GX 4USHA 2MKKA 1L3SA 5E84A 1WC1A 2XBPA 3JSYA 5DM6L 2ZF5O 8ATCB 3EDRB 2AIRB 4F3QA 4ZP9A 3U27A 2OI2A 3AVNA 3W60A 5DETA 3AA4A 4C98A 5AFUA 1JKHB 1TFWA 3MM6B 2Z2YB 1NDPA 2QYGA 3OVAA 1HQEA 4JD2B 3NAIA 5I3PA 4CJ3A 3OD2A 2WVBA 3JXOA 3AD7C 3D2FB 3C6TB 3CE8A 2VICA 2GELA 4ZIVA 1HI0P 4AD6A 1T05A 3W63A 3AA3A 4CJEA 4O4GB 2KLAA 4MAKA 4NCGA 2QSFA 1DAXA 1JLGA 1N5YA 1Y64A 3RW7A 3R9LA 4KH4A 4KKOA 3AJ1A 4Y6IA 4K4TA 4O3RA 1DY3A 4OHZA 2RHQB 2KZMA 2ZQBA 1RTZA 2CG8A 4LF9F 3I55N 4USWA 4DSFA 4JRQA 5HOOA 4DU4A 1HUXA 1X4HA 4A8XA 4V19S 4QS9A 2A3JA 3R7NB 2XSFA 4WIIA 3ZZTA 1VQ8N 4AT1B 3L0QA 4EHTA 3D0GE 5HO4A 3UKRA 3CCRS 3LH2S 5L46A 3MUMP 3M05A 3LDSA 4M94A 4LVNP 4YMEA 5CYMB 2KFZA 3ICLA 2YHBA 2FC9A 1S1XA 3I55S 4YNQA 3I4HX 2G2YA 4DR6J 1BGXT 3AFGA 3J80U 1E4GT 1WAJA 2OTJN 1RISA 2EI5A 4CFAA 4HUFA 3PYGA 1HQEB 1MLAA 1DBDA 1FFSB 3DHXA 4CESA 4QWBA 1OKJA 4IO1A 3NOGA 1LXJA 4FLWA 2R2RA 2PAVA 2IVPA 2Q0RA 5E3QA 2ILYA 1SC3B 4RW7B 4ED5A 1X9SA 2QN6B 1R89A 3T1HK 2QLXA 5AJ3J 4RUAA 4K4YA 1ZPWX 1K6YA 4EI2A 5HL7L 1N4LA 1SKRA 1VQYA 4HVJA 2A2DA 2P9NB 3A8IA 2N4DA 1REGX 4ED4A 3O9QA 3WQTA 4YOXA 3V6JA 2OYQA 1ILYA 2FBXA 5FRNA 1RHJB 3M8YA 3RU0A 1APSA 1R6YA 1IR1A 4ED1A 1IBKF 1WBBA 1SQFA 2AP1A 3ZETA 4WU3A 3PUFA 5LMUK 5E2QA 4PUOB 1ESVA 4O4GA 3I33A 5KT3A 2Y1JA 2P9GA 3VAGA 9ATCB 2BJ8A 5IT0A 1Y3JA 3PYFA 4ECSA 5M1PA 2LLZA 1DTQB 1H72C 4UF4A 4ZVTB 2CQ1A 4DR7F 2AZ3A 7FD1A 1Z4UA 2HAFA 1JLAA 3VQAA 4M5MA 5AFUH 4X66K 4Z37A 2M9KA 2OPRA 2VFRA 1K9MO 4XEIA 1UFKA 1P90A 1P6TA 3O80A 1SL0A 2YX4A 1N52B 1T6CA 1S9FA 1J27A 3DU5A 1WEYA 5LXRA 2MQNA 1NGAA 3RB0A 2G1HA 3MCMA 5F9LA 5T7BA 3SNNA 1K44A 1XMBA 5JVGL 3L3UA 1RDBA 4DFJA 4KH0B 5CZ1A 3J7YP 3EX7B 2E4LA 3RG6A 1EQMA 4Y34A 4LQ3A 3GE1A 2BQRA 5EWGA 4JI7K 1G1XA 2H4YB 3CD6N 1CLQA 1EX8A 4GV3A 4I6AA 1EWQA 2MQPA 3DI6B 4FO0A 3CCJN 4X65F 2BEFA 4JI1J 4GO5X 2MKYA 4L74A 3AGRA 3CNQP 4LF8J 3QAEA 3T5JA 3W64A 5M1QA 2Z57B 4DV7J 1Z25A 4DPTA 4B9NA 4QWEA 1SIWB 1S12A 1RXOB 2KVQE 1YF5L 3SJHA 3DLRA 3H2VE 1F5BA 3KKSA 1U48A 2UUAJ 2CQIA 2A2CA 2RH3A 2RF2B 1TR0A 5EY4A 1JLBA 5AT1B 4DV3F 4G6VB 1BL3A 2KT2A 3C14A 1TL1B 5D3GB 4OI6A 2L08A 4OX9J 4JN4A 1DRZA 4OI2A 4JI2K 3BYRA 5H9FJ 3VEXA 5KT5A 4C1NK 3JB9k 3T19A 2OEMA 2BOAA 3R5CA 3JYTA 2E2NA 4E7HA 1DLOB 3NVKA 1KOHA 4NLVA 4FLTA 2VKZG 1PAEX 2DNRA 4X4NA 2OEJA 2XHBA 5CE3A 5E5NA 5J2MA 3BS9A 4C6AA 4FJXA 1T9VA 3CJ8A 2CJAA 2MZ1A 2PMZD 1ZH5A 3KLFB 5D0HA 3NRBA 2EXUA 5KG7A 4LIWA 1HR0K 1R0AB 3FMBA 3OJUA 4KAZA 3V4IB 5AQMA 5A8KB 3GFZA 3O5TB 2UUCJ 3VQ7A 2RS2A 2VOOA 2D0OA 4CLPA 2WVEA 5HMWA 3EM1A 4C8LA 3C14B 5HMYA 2DR9A 2YPYA 4L3QA 4HACB 3RYLA 4CJFA 1H73A 2NRTA 3CERA 3LDOA 3HM9A 1GMWA 4F2SA 2X6SA 3DJCA 3ZX0A 1VDHA 2YI1A 2IVOA 1M1KT 4KRFA 1VQLN 4XH4A 2EWHA 4JV5J 1DTTB 4EO8A 2ZWPA 3L6QA 5E41A 2FZCB 1XR6A 4MKVA 4CM2A 3FSXA 1PAUB 4JI7J 4CFDA 3PJXA 4L73A 2RIJA 1U2VA 4ECVA 3B8HA 4UY8O 1RTDB 3O2IA 4EFAC 2PN6A 4Z7YA 4CT9A 3K59A 2XY5A 1FDNA 4M5GA 2F8MA 5HLFB 3N79A 3GCXP 1YJNN 1VHFA 4EHUA 4B3OA 2F9WA 2DCUB 2VFUA 2Q36A 1UJ4A 1UVLA 2QK9A 1VC5A 4TXSA 1FVQA 1S72S 2X78A 3CJCA 2FGOA 2QIFA 2E8AA 1SBRA 3CCZA 3M3ZA 4NXMK 1S97A 2XLIA 3CULA 4JK9A 4HH0A 3SI8A 1QSYA 1VK8A 4K5RA 1IUJA 3CJKB 3RVCA 3CDUA 3LUYA 2DK2A 3GMGA 2FHJA 1XNQJ 1KFDA 3C8YA 3KLHB 1VC0A 4MFBB 3VVUA 5LMUJ 1XMOJ 2JFKA 2X3GA 2R4FA 4USMA 4IO9L 3P5TL 5IQ6A 2BQUA 4DV0K 4FWKA 4A5AA 2VKRA 3MURP 2LQ5A 1XHZA 3BH7B 4RWTA 1FRMA 1WSGA 1BISA 3BGOP 3OR1B 1NB2A 4MTPA 3OHBA 2P9SB 1YVNA 4X64F 1S1TA 1NOZA 4NLTA 4M3YA 1JKHA 1F9FA 5AQHA 1FKPB 4FLUA 2VZ9A 1V5VA 2DVIA 4DS4A 3KK3B 1IKXA 4DPWA 3QESA 1R7IA 4M63A 5C2CA 2OPQA 1GLAG 1JLFA 1UWBA 4W4MA 1ATNA 3MM8A 2YWWA 4X4VA 3AXMA 3D68A 4QYRA 3H20A 1DQAA 4FS2A 1M0SA 2R8HA 4ID5B 1VRTA 1RA7A 3ISNC 1NU4A 4J9PA 4ECZA 3ET6A 2HNZB 4FM2A 2KHCA 2QTWA 5JJBA 1S4FA 2ZJQL 4IKAA 2B8QA 2CXEA 1KLMB 2ZZTA 1C0MA 5U47A 2OD4A 1KQFB 2BJ1A 2RRNA 3IDHA 1UKUA 4FWSA 1C4AA 4LRAA 2RQCA 1BY9A 3FFIA 4R25A 2N4CA 4HYKA 4M7YA 4B1UB 3BGLA 5L9NA 3KLEB 5F8GA 5KFEA 1S5ZA 3NGSA 2B9EA 3IFRA 1KR4A 1KD1T 1VQPS 3LAMA 4IJAA 4OZ3A 1WSFA 1N5QA 3KG1A 3TJ8A 2B43A 1XQIA 1O51A 5AQZA 2KU7A 1FCAA 2GO8A 2M0GB 3CW2C 2IS3A 4W5QA 3OUYA 2XMAA 3KKFA 4PQAA 3IRXA 1S1WB 2APOA 1C1AA 3ITHB 5GAHI 4DR4J 4H5VA 3DGPB 1QVGM 1VQPN 4Q43A 3MEDB 5GAEI 3EGVA 2GVDA 3VEYA 1URRA 3EWGA 3TA2A 3SMSA 5EWEA 4CLYA 4CLWA 5LSLA 2V67A 3VWSA 4QYZK 3CF5Q 2FY1A 2O1PA 2QSWA 4LF8K 3MTKA 5E3CA 2A41A 1MN9A 3MHYA 2LXIA 4NLSA 1SJRA 3QIPB 2WW8A 1SKUB 4OJGA 3IKMA 5HQLA 1T3VA 4OO1J 4LRFA 2YKAA 2XMJA 2ZH6A 3D7SB 2WZ1A 2BBEA 4JS5A 3R1LA 2ASJA 3KG0A 2NPIA 3TSUA 1Y7PA 4DL3A 2HRUA 2QA4N 3U8XA 4IOCQ 1NJYA 1LW2B 4OPAA 3GONA 2MQ8A 3NEKA 1JCGA 3D54A 3K8VA 2ZEJA 2G2ZA 5KFVA 1W2BM 2XYGB 1OH5A 1F3VA 1QZ5A 1GFWB 4LF7J 1NH7A 1FVSA 4IOXA 3VOVA 1X3NA 3PW4A 3NAHA 1KFSA 1OH6A 4I2QB 1MROA