3AO4A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
139
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
total genus 47
structure length 139
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao4A00
3ZSZA 3RRHA 1YVUA 1S9GA 3F73A 3K5MA 3ZSXA 4EP4A 3TI0A 4M3XA 3M8SA 4QCLA 1JLQA 5SZTA 5FROA 3AV9A 3AVFA 5JS2A 3M8RA 3CFOA 3RMCA 4DU4A 4FJIA 2D0CA 1VSFA 3O4QA 4DQRA 4F3OA 5CYQA 4CJWA 3QNNA 1HJRA 4CHPA 1QSYA 4B9LA 4B8AB 3AO5A 4KI6A 3G0ZA 4RW4A 4DF8A 4M3ZA 3MEGA 1K6YA 3LP0A 1D5AA 1KVCA 3OYJA 3PX0A 4K8ZA 1TKZA 3VQAA 3A2FA 3TR8A 3CFPA 2A1RA 4BDPA 3VQ8A 4CCHA 4CHOA 3NE6A 2FBVA 4F2SA 3TABA 1REVA 4LD0A 4DLEA 4HUGA 2HB5A 3AO3A 2Z1HA 4M41A 1SKSA 3P1GA 1XC9A 4N47A 2XY8A 1FK9A 3DOKA 4Y1CA 2Y1JA 4E0DA 3QETA 4B9SA 3VQDA 4CK1A 4DSFA 4E1MA 1QS4A 4BACA 4DQQA 1NOZA 3AVGA 3K5LA 1JLEA 3HO1A 1RDCA 1ZBIA 5DK5A 1S1UA 2P5GA 1RT2A 5J2QA 1W0HA 3LP2A 3OYCA 1JLCA 3TAFA 1NK5A 2B6AA 4CF2A 1J9AA 1BCOA 1KFDA 3B6PA 1KLNA 4PUOA 4FW2A 4CJFA 2HVIA 3ZT0A 1HPZA 2JGUA 1IKVA 1KCFA 5HRSA 3OJUA 4HTUA 4E7IA 1TKDA 3ZT3A 4B9UA 3OYBA 1WSHA 5EU7A 3KK2A 3I8DA 3SQ2A 4FK4A 4KAZA 3VQPA 1TK5A 1BI4A 3MEEA 3V9WA 1BIZA 3C6TA 2Z1JA 5FDLA 1RTIA 1CXQA 2YNGA 3HPHA 3VQ7A 3WNFA 4DLGA 4Z4EA 4CEEA 3SQ4A 2P51A 5C42A 4DFMA 3RMDA 3P5JA 3L2QA 1RT7A 2RF2A 3MXMA 1RTHA 2HNDA 2O4IA 4CJLA 3VQCA 1RT3A 2OA8A 1IKWA 2WONA 4O4GA 3NHGA 3WNHA 3SUNA 1EP4A 5DMRA 3ZSWA 2ETJA 3T3FA 3SV4A 4DTMA 2D5RA 1D9DA 4J2EA 3SUQA 1WLJA 3SUPA 3NH1A 5CY4A 1NKBA 4ELTA 3DLKA 4B9VA 1S1WA 3I0SA 1JL1A 3ZSQA 3QEIA 4DSJA 2HHVA 1S1TA 2EHGA 1LWCA 2ITGA 3WNGA 3VA3A 4CJ5A 4BWMA 4DU1A 3LZIA 1KVBA 1TAQA 4KHUA 4AILC 2AJQA 2GUIA 3CG7A 3RR8A 1TV6A 4EP5A 3DMJA 4OLAA 4ZTJA 3SQ0A 1S6QA 3V1RA 1FKOA 4OVLA 2FBTA 3IAYA 1WN7A 5SWMA 1QHTA 3V9SA 4EZ6A 1RBSA 3SUOA 4DS5A 4GVMA 5I3UA 3DLRA 4CGGA 2OPRA 4AH9A 1LAWA 1S6PA 1BQMA 2B5JA 5KI6A 1UWBA 4DQIA 1VSJA 3DLHA 4H8KA 3QINA 3AVNA 1VSLA 1VSDA 2KTQA 1C0TA 3ZT2A 2IOCA 4FZZA 1N6QA 4CIFA 5T7BA 4FLWA 2DFEA 1XHXA 2HW3A 2VG7A 2F8SA 3NGIA 3IRXA 1TK0A 1GOAA 1ZBLA 1X9WA 4CEAA 5HP1A 4NYFA 3ZT1A 3HXMA 2NUBA 4AHVA 1EKEA 1Q8IA 1U45A 2KFNA 4DSLA 4Y1DA 5E41A 4I9LA 3O3GA 1TL3A 3OS0A 3ZCMA 1L3SA 1KLMA 3CM6A 1JXBA 1FKPA 4AHRA 3D45A 2OYQA 2E6LA 2ZQBA 3OS1A 3V9ZA 3AA2A 4J2AA 3ZSOA 4DTJA 3P83D 3SPZA 4Z0UA 2Z1IA 1EX4A 4GW6A 4M45A 3K5NA 1HNIA 4DTNA 1KFSA 2OZSA 2F8TA 4DG1A 4CJQA 1RTDA 1U49A 1QE1A 1XWLA 2F96A 4TSXA 3CQ8A 1W9HA 1QTMA 3M8PA 4AHTA 3KLFA 3FFIA 3QIOA 1SKWA 4DTRA 1ASVA 2XY7A 1IKYA 3WNEA 4DFKA 4CJVA 3V4IA 2YNIA 4N56A 2R7YA 3DRPA 4M3TA 4CHYA 5J2NA 3VQBA 3OY9A 5KGXA 1C0MA 4W5QA 4M42A 3DRRA 4HHTA 3LWMA 3RMAA 4FZYA 1ZBFA 4H4MA 1TKXA 3KD1E 3MAQA 3LDSA 4Z4FA 4FJNA 4FJ8A 4CF9A 1ITGA 3LALA 3DLBA 4M3YA 3M8QA 1NJXA 4EZ9A 2G8VA 3ULDA 3TANA 3DLEA 1WNSA 1SUQA 4CJ3A 4KTZA 4CEFA 2YV0X 5J2MA 2ATQA 1ZBUA 3AVCA 5CYMA 1QQCA 3VQ6A 3S3OA 3LZJA 1D8YA 4JS5A 4OPJA 1QSSA 1BGXT 3U3GA 3SJJA 2IAJA 1UAXA 1DLOA 3NF9A 4AHSA 1T05A 4PA1A 4FZXC 1NJWA 4I2PA 3DLGA 3UIQA 3L2UA 3HP6A 4JS4A 4FM2A 1NJYA 4IBNA 4M3RA 1BI4B 1GOCA 3AA4A 3QERA 1YTUA 3ZSYA 3SPYA 1NK8A 3V1OA 3IG1A 1J53A 4FK0A 4Z4HA 2XY6A 4DU3A 3OVNA 4OKJA 1CXUA 3DOLA 4CJTA 3CYMA 1TVRA 3HT3A 3KLGA 4FLYA 3THVA 4IFVA 4F3TA 3S3MA 1NK7A 4F8RA 4CF8A 1SL2A 1J54A 1FXXA 1C0UA 1NK6A 3KLHA 2G8WA 1VK0A 3OYKA 5C24A 4CJ4A 2RPIA 2DFFA 2QXFA 3H08A 1U48A 3K57A 2VG6A 1LV5A 4FLTA 4DQPA 4KHYA 3MECA 4FJJA 1I3AA 2BGGA 1L5UA 4K8XA 3RMBA 2GV9A 4IG0A 2RN2A 3VQ9A 4AHUA 3L8BA 2QK9A 2IS3A 4QAGA 3EZ5A 4BDYA 3O4NA 4FYDA 4FW1A 4DSKA 3LAMA 2XHBA 5KGWA 4ICLA 3V9XA 3SNNA 3CFRA 3KTQA 1B9DA 2RKIA 4ELUA 4N41A 3F9KA 5HRRA 4CJRA 4FJLA 4CGHA 4RW9A 2IDOA 2HHTA 3T19A 3MEDA 4C8OA 3TAEA 1KRPA 1XI1A 3C94A 3PY8A 4HCCA 3AO4A 2Y1IA 1HRHA 4CJUA 2DY4A 1Z26A 1LWFA 1Y97A 5J1EA 2YKNA 1RBVA 3EY1A 3KKSA 2G8UA 4CEBA 1SL0A 4FJ7A 4YNQA 3KKRA 4NCGA 1CZ9A 1BISA 4CFBA 1TGOA 1ASWA 2IGIA 2G8IA 4I7FA 1F21A 1S1XA 3TAPA 2KFZA 2HNZA 4J2BA 5FRMA 1ZBHA 2G8HA 4CE9A 4W5OA 4CGDA 4KRFA 5JS1A 3OYEA 1IO2A 3U6FA 2P5OA 1U47A 2I5JA 4BWJA 4CFDA 4HUEA 1RDDA 4IFYA 4O44A 1B92A 4LSNA 3V9UA 1BQNA 3C95A 4E1NA 4E7JA 4FJHA 1LWEA 2ZD1A 3NBPA 3AVKA 4DTXA 1HQEA 4LSLA 4KKOA 3VQ5A 4CIEA 4IDKA 2GBZA 3JSMA 1IH7A 3HK2A 1HMVA 1RT1A 3ZSRA 1NK4A 3KLIA 4OLBA 4Z4GA 1RILA 4CEOA 4YFUA 4FM1A 3TARA 2Z1GA 1WAJA 1YT3A 3O3FA 1EETA 4E7LA 4NCBA 1TKTA 5D3GA 2B4JA 3SZ2A 1TAUA 1D9FA 4FCYA 3RWUA 1BL3A 4JLHA 3OJSA 3QO9A 1JLBA 4BE2A 2YHAA 1LW2A 4CF1A 4E7KA 4F4KA 3AO1A 1WSEA 2X78A 3HPOA 2HHXA 3LP3A 2D0BA 3PO5A 3C6UA 4FK2A 3AVBA 4CEQA 3OYIA 2VWJA 5KRTA 4HVJA 1VRTA 3SI6A 2VWKA 4BDZA 3SQ1A 4CGFA 1N5YA 4N5SA 1LAVA 3BDPA 3TAGA 4DFJA 3HYFA 1EXQA 1Z25A 4M3WA 3NF7A 5KRSA 1S1VA 1C1CA 3NF8A 3L2WA 4KV8A 3D0PA 3G10A 4QOZB 4KREA 1DTQA 4CJEA 2PYLA 1HYSA 4CEDA 2YNHA 3L3UA 3V81A 3HPGA 1C1AA 1UA0A 2HVHA 2WOMA 3LPTA 3LAKA 1RT4A 2W42A 2QKKA 1RBTA 4KI4A 2OPPA 2HHSA 4OPKA 4UQGA 2DTUA 4KB0A 2HHUA 1R0AA 1B9FA 4O5BA 1HQUA 5FRNA 4KTWA 1CLQA 1S9EA 1IKXA 5CZ1A 4OGEA 3V1QA 2OPQA 4DTPA 4C8LA 4CESA 3QEPA 1NOYA 4CECA 4W5RA 1O1WA 5HBMA 4Z4IA 4FLUA 3NFAA 3PV8A 3OYFA 4LY7A 4CF0A 4C8KA 4FJMA 3O3HA 2LSNA 1RCHA 1JL2A 4DQSA 1G15A 4ELVA 1RNHA 4DTOA 4BE0A 4MQ3A 2PYJA 3LPUA 4L8RB 4ID1A 3TAMA 1C6VA 3I0RA 1VSMA 1UOCA 3VQEA 4ZHRA 3RTVA 1T7PA 2QKBA 2KZZA 3AVLA 1A5VA 4FLXA 2XY5A 1X1PA 1HYZA 3HVTA 3B6OA 3MXJA 4ZTFA 3OYHA 4RW8A 4NCAA 1C1BA 3OYGA 3JYTA 4HUFA 1RDAA 4CHZA 1WSFA 2BDPA 4KHSA 4O0JA 4PQUA 4CIGA 2OZMA 1BHLA 5HRPA 4Q0BA 3NF6A 3HJFA 1VSKA 4GMJB 4F2RA 1GOBA 3DRSA 3TAQA 3QIPA 3NCIA 1UA1A 3AVHA 3AO2A 4RW6A 3BGRA 3CM5A 1X9SA 1L3VA 2HHQA 2HHWA 1YTAA 4IG3A 4DSEA 3ALYA 3OYDA 5J2PA 3U3YA 4M3UA 4FM0A 4AHCA 3QNOA 2EX3A 2E4LA 3OS2A 3KLEA 2FBXA 4E7HA 4J2DA 1S5JA 4OKEA 4CEZA 3TWHA 3PUFA 4DFPA 1DTTA 2P1JA 3DM2A 2HMIA 1HNVA 2E6MA 5CZ2A 4E19A 3HVRA 1L3UA 4KHNA 1XHZA 2KW4A 3VQ4A 4CK2A 1T8EA 4FJKA 1MU2A 2KQ2A 2KZMA 3EYZA 3MXIA 3AVMA 3QEXA 1SKRA 5HLFA 1JLFA 1IG9A 1WSJA 2X74A 3KIOA 4CFCA 3KD5E 2BE2A 2O4GA 5HRNA 3OYNA 1KTQA 4CGJA 4FJ9A 4I9QA 3SV3A 4KO0A 3K2PA 1KVAA 4RW7A 4CJSA 3OYAA 1JLGA 5HROA 1RTJA 2OPSA 3KJVA 1A5WA 3LWLA 4OGCA 4DS4A 1Q9YA 3ISNC 3L2VA 5I42A 2VG5A 1NJZA 4CK3A 3K59A 3PX6A 2FBYA 4CJKA 1J5OA 3NH2A 4CHNA 3KK1A 4FJGA 4OJRA 4H4OA 1X9MA 4KHWA 1RBRA 4FLVA 1VSEA 3RR7A 3SYZA 1RBUA 4E89A 2PZSA 4PWDA 3HM9A 4E3SA 1RT6A 4B9TA 1NKCA 3T1AA 3QEVA 4IKFA 2A1SA 1KSPA 4KHQA 3AA3A 4DWIA 3L3VA 3V6DA 1VSHA 3QEWA 1NKEA 4KB1A 3HL8A 1JXEA 3NAEA 4B9NA 4N76A 4CHQA 1ASUA 1BIUA 2YNFA 1A5XA 4KFBA 1VRUA 4PY5A 1LW0A 2FC0A 3NH0A 4FJXA 4OKKA 1WSIA 4FVMA 3VQQA 2JLEA 4O55A 4MFBA 3K58A 1HYVA 1RT5A 1T03A 2YHBA 1Q9XA 4XIUA 4KTQA 4FXDA 1NK0A 2BANA 4DSIA 4RG8A 3OYMA 4B8CA 2PY5A 4DTUA 3SCXA 4BE1A 1QSLA 2XO7A 1TK8A 3OYLA 3QESA 2X6SA 1SV5A 3RRGA 3S9HA 3HP9A 2DFHA 3ZSVA 1U04A 4C8MA 4W5TA 4LH4A 4NYNA 4HCBA 4LH5A 3S3NA 4B3OA 3ZT4A 3HSTB 3K5OA 4CFAA 2Q3SA 3VN5A 5K14A 1BCMA 1WSGA 3LANA 2YKMA 4DF4A 2G8FA 3QLHA 4G1QA 5KTQA 2D0AA 1TL1A 4Q5VA 3NGZA 4FJ5A 4CJPA 4R5PA 4WE1A 4B08A 3ITHA 3AA5X 1U4BA 4KPYA 4JRQA 4Z4CA 3LP1A 4JRPA 4CGIA 3DYAA 3AVJA 3ASMA 3L2RA 3DI6A 1CZBA 5C25A 3PX4A 3AVIA 4DMNA 3AVAA 1ZYQA 4ID5A 4O0IA 3VA0A 1I39A 1VSIA 4W5NA 2X6NA 4CERA 4FLZA 1L3TA 1WAFA 3PO4A 1SL1A 1JLAA 3NGYA 3KK3A 3NDKA 2HNYA 2G8KA 1RDBA 2XRIA 4I2QA 4DTSA 4C8NA 1JKHA 3IS9A 3E01A 2ZE2A 2IC3A 4B9MA 1NK9A
chains in the Genus database with same CATH superfamily
3ZSZA 1NGAA 1N33K 1Q82O 3LDLA 1VQNN 5AQNA 3TI0A 3E9PA 4M3XA 2VGNA 4QCLA 1JLQA 5JS2A 3M8RA 3O4WA 3GG4A 3LDQA 4DU4A 1T3VA 3ZETA 3QNNA 1HJRA 2QA4N 3OHRA 4ILJA 4KI6A 4B3SK 4DF8A 4BREA 3LP0A 1KVCA 3OYJA 3A2FA 2V52B 4BRCA 2P9UB 2NRVA 4PHTX 4DLEA 1NGBA 3ZEUA 2HB5A 4HUGA 4BRNA 4BRHA 4IDHA 1W7AA 3CCMN 4BR2A 3DOKA 2WUSA 4Y1CA 2Y1JA 2P5GA 3WUHA 1NOZA 3AVGA 2HBJA 4FSVA 3VOVA 1VQPN 4FWQA 1W0HA 4CF2A 1QZ6A 4CJFA 2HVIA 1TKDA 3ZT3A 4B9UA 3S41A 2D4WA 4LF4K 4BVOA 4KAZA 1O13A 1TK5A 3SBTA 3V9WA 5FDLA 3WNFA 5LJVA 4DLGA 5GADP 4DFMA 1RT7A 2O4IA 3O9TA 4NLCA 4O4GA 2WONA 3SUNA 1EP4A 1TYQB 2D0OA 4DTMA 2D5RA 4IEIA 5BPLA 1HNXK 1NKBA 1ATSA 3HOTA 2F7TA 1LWCA 2ITGA 3EE9A 3WNGA 3LZIA 3R9PA 3IDHA 4AILC 2GUIA 3RR8A 1TV6A 4OLAA 2P9LA 1FKOA 4OVLA 3ZYYX 3QB0A 1WN7A 5SWMA 3V9SA 4GVMA 3DLRA 5E26A 3B8AX 4AH9A 1VSJA 4X64K 3H6EA 1IBKK 1VSLA 3HSCA 3KHYA 5C10A 2IOCA 3WEEB 3ZX3A 2FSNA 3LDOA 4CEAA 5JVGL 4YHHK 1EKEA 1Q8IA 2KFNA 1YJNN 4I9LA 4H0OA 4B1WB 4JKEA 3H45C 2E2QA 3ZCMA 3CCVN 1JXBA 3C0BA 1C0GA 4AHRA 3BY5A 4K0KK 3V9ZA 3ZSOA 4DTJA 5M1KA 1KFSA 2UXCK 2ZGZA 1EX4A 1RTDA 1U49A 1XWLA 4TSXA 2O8EA 3I55N 3KLFA 1SKWA 4DTRA 1ASVA 3WNEA 3SMSA 3C65A 1YIJN 3GE1A 1BDGA 3OY9A 5KGXA 1I94K 4M42A 1E4GT 1TKXA 3MAQA 1S3XA 4CF9A 4E1JA 3LALA 3N4QA 2UU9K 1T6CA 4EZ9A 3QICA 4M7XA 3VEOA 2P9NA 3DLEA 4BQZA 3C7NA 4YDUC 1ZBUA 3CCUN 2RHKA 3S3OA 3VQ6A 4DUZK 3LZJA 2YI1A 4A2AA 3K0SA 2PFUA 3U3GA 1Z05A 2IAJA 3NF9A 1DLOA 4AHSA 1XNRK 4FZXC 1KAXA 1NJWA 4I2PA 5AQIA 4MLEA 4BGBA 3QFPA 1VQ4N 2V7YA 5AZJB 5AFUA 3SPYA 1NK8A 5AQKA 1OVYA 1J53A 3WT0A 3W3DA 4H5WA 3OVNA 3DAWA 4OKJA 1QQMA 1TVRA 4H0TB 3CF5L 1DEJA 1HPMA 3KK7A 4CF8A 1HKCA 3KLHA 1VK0A 3OYKA 2DFFA 1U48A 1LV5A 3IKMA 4FJJA 2BGGA 1L5UA 2O8DB 4CD3A 3L4IA 2QK9A 3EZ5A 3O4NA 4QS9A 2NRWA 5KGWA 3GDQA 1HUXA 3CFRA 2RKIA 3CJAA 4ELUA 4H5VA 3F9KA 2IDOA 3ZX2A 3MEDA 3TAEA 2ZJRL 1KRPA 4NXMK 1XI1A 3C94A 4HCCA 1IG8A 2OTJN 3AO4A 4IO8A 2YJFA 5BPNA 1Q81O 4BR0A 5J1EA 1DKGD 3ID6A 4M63C 4U67L 1SL0A 2QWRA 3UKUA 3O9RA 2BH1A 3KKRA 3THWB 1ASWA 4FVUA 2OANA 2A5XA 2HNZA 4J2BA 4W5OA 2V51B 3U6FA 3D2FA 2UUBK 3V9UA 4E7JA 3VQ5A 1RT1A 3ZSRA 4CEOA 3J8AA 4FM1A 3O3FA 5AQUA 1EETA 4GV6A 1TKTA 3CJ7A 2B4JA 4XH4A 4FWOA 4FCYA 2UXBK 2YHAA 3AO1A 2X78A 2HHXA 3PO5A 3J7AP 1VQON 4JI3K 2WFBA 1W97L 5KRTA 1VRTA 3SQ1A 1JJ2M 2IVNA 4X65K 4DQ8A 4DFJA 3NMUA 3WXLA 3D2EA 3NF7A 3M5RA 3NF8A 4KV8A 1MDUB 4CJEA 4B3TK 4NLBA 1YAGA 3T1HK 1VAZA 2FSJA 1RT4A 2W42A 3VEYA 4H0PA 4DV6K 4GV3A 2HHSA 4UQGA 5BRHA 4UY8O 3W0LA 4O5BA 4KH4A 3TSQA 1S9EA 3RSEB 3IFRA 1DGKN 4C8LA 5I9EB 5HBMA 3SJHA 4Z4IA 3I56N 4FLUA 3R8EA 4JKGB 3OYFA 1ATRA 1JL2A 3LM2A 1CZAN 5AQVA 3VGKA 4MQ3A 2PYJA 3L6QA 4ID1A 4ZHRA 1T7PA 3ZX0A 1UOCA 5TKWA 3RTVA 3A5MC 4FLXA 1X1PA 4RCHA 4RW8A 4X66K 1C1BA 3JYTA 4HUFA 4KHSA 4CHZA 2OZMA 4GY2B 1GLFO 4KHPK 4Q0BA 2KKZA 5AQWA 3VPZA 5DM7L 3DRSA 3QIPA 1S72N 1UA1A 1L3VA 4OPAA 4CZEA 1WB9A 4LFAK 2HHQA 5IT9O 3ALYA 1LCUA 3LL3A 5J2PA 3PLAA 5ELZA 4FM0A 2GTDA 3QNOA 2W40A 3KLEA 1Q7YO 4BGAA 4J2DA 4CEZA 3CCRN 3PUFA 3SK3A 3P31A 2P1JA 5ADXA 2E6MA 3HVRA 1XHZA 3VQ4A 1C0FA 2KQ2A 4J8FA 3QEXA 1VQKN 1WSJA 2X74A 1YITN 4FPAA 4CGJA 4I9QA 5FLXO 2QWNA 3OYAA 2OPSA 4DS4A 1Q9YA 2YCHA 3BZCA 3TU5A 3OBYA 3DLLL 5I42A 4CK3A 2FBYA 3H46O 4H4OA 4C23A 4FLVA 4OO1J 1RT6A 3CQYA 3HBTA 3H3NO 4ISGA 4JKAA 3UE5A 3NVMA 3CC4N 3QEWA 4MDBA 4A57A 1ASUA 3BF1A 5HL7L 2YNFA 4FO0A 4KFBA 4KH6A 5KQ8A 3NH0A 3VF2A 3VMFB 4OKKA 3VQQA 4KREA 4BRMA 3BF3A 1RT5A 2BTFA 4FXDA 3BP8A 4QS8A 3OYMA 4B8CA 4DTUA 1YF5L 2P9KA 3OYLA 2ZJPL 3CETA 3CHWA 3ZSVA 4C8MA 3O80A 4HCBA 4XH5A 3FZLA 4B3OA 2O8CA 3AGRA 5K14A 3LANA 2G8FA 4PL8A 1TL1A 4R5PA 4DCHA 4WE1A 1V4TA 4KPYA 1JCEA 4JRQA 1VQ5N 3LP1A 3BZKA 4CGIA 2IIRA 3CJ1A 4BG8A 5C25A 4FWNA 1ZYQA 4DV0K 3CJCA 1EWRA 1JLAA 3KK3A 1RDBA 3CD6N 1JKHA 4A61A 2ZE2A 1VHXA 4PL7A 2HOEA 4DB3A 3ZSXA 4EP4A 5BRFA 2GEMA 4YORA 5SZTA 3AV9A 3MMVA 5AQMA 3CFOA 1EQYA 1VSFA 4DQRA 4CJWA 4JN4A 3G0ZA 4DR5K 1K6YA 3SAFA 5C12A 1M1KO 2E2PA 1ATNA 3ULEA 3VQAA 1FW6A 3T7ZA 4BDPA 3O5BA 3NE6A 4BC3A 4LD0A 2NLXA 4ILGB 5CR4A 1Q18A 3FGUA 4JNEA 4M41A 3G71N 3F9MA 1XC9A 4JD2A 4N47A 1FK9A 5AR0A 3CCSN 3IUCA 4DSFA 4HTLA 1QS4A 4E1MA 4DQQA 1JLEA 1VQLN 1ZBIA 1RT2A 2PAVA 3OYCA 1J9AA 1BCOA 4PUOA 3ZT0A 4JI8K 4HTUA 3OYBA 1OH8A 3I8DA 3VQPA 1EWQA 1BI4A 3MEEA 3CMAN 3RVCA 3HPHA 2YNGA 4IEEA 5M1QA 3SQ4A 2P51A 5C42A 3L2QA 2RF2A 4A5BA 1RTHA 3OTOK 2HNDA 4CJLA 1RT3A 2FLOA 2OA8A 5AQRA 1IKWA 2UXDK 4LF7K 2QXLA 5DMRA 2ETJA 5M1FA 4O8UA 1WLJA 4ELTA 5CY4A 3DLKA 4B9VA 2D0PA 3QEIA 2HHVA 2GELA 4CJ5A 2O8FA 3M1FA 4KHUA 2AJQA 3CPWM 4EP5A 3DMJA 2F9WA 4JEPA 3SQ0A 4LC9B 4CZKA 4EZ6A 5CHIA 5I3UA 4CGGA 2OPRA 5KI6A 2J4RA 3Q7CA 1VQ6N 5JLHA 3AVNA 2KTQA 1C0TA 1R59O 5AZIB 1XHXA 3L4QA 3QFUA 3G4SN 1GOAA 1X9WA 5HP1A 4NYFA 3ZT1A 4JHDA 4AHVA 4Y1DA 5E41A 3T1YK 1NGGA 4BC2A 1NGDA 3ZETB 1KLMA 3D45A 2E6LA 3K5NA 2F8TA 1HNIA 1D4XA 2A3ZA 1QE1A 2AA4A 3ID8A 4CZFA 4B9QA 2QWLA 3CQ8A 1OVQA 4BRKA 2XY7A 3V4IA 4DFKA 5B8HA 3ENHA 2R7YA 1ESVA 3ZEUB 5J2NA 5MLCQ 1C0MA 3OBWA 2DPNA 2JWKA 5JICA 2YHWA 4H4MA 5F2RA 3KD1E 1N32K 4H5NA 4CBUA 3EE8A 3AAPA 4WFAL 2FF3B 3AGKA 3M8QA 4M3YA 4B1ZA 5TKYA 4KTZA 4CEFA 1D9FA 4JS5A 1BGXT 1UAXA 4B1UB 1BU6O 4PA1A 3L2UA 5LY3A 1GLEG 3HP6A 4IBNA 3HI0A 1GOCA 3AA4A 4C1NK 1YTUA 3VTHA 2PBDA 2GWJA 4FK0A 2XY6A 4DU3A 3HT3A 3CYMA 1U2VA 2WBNA 3TTDA 4HWIA 3FR0A 3S3MA 1NK7A 5BN9A 1FXXA 2VG6A 4CBWA 1KAZA 4K8XA 3RMBA 4IG0A 2IS3A 4BDYA 5BN8A 2EWSA 4QS7A 2XHBA 3V9XA 2HHHK 3SNNA 1JCGA 3KTQA 5HRRA 5AQSA 2P9LB 2HHTA 4U7BA 2Y1IA 1WBBA 2DY4A 3CC7N 3K9JA 1LWFA 1Y97A 4JI0K 3EY1A 4A59A 4FJ7A 2HBKA 2HF4A 4JI2K 5AQLA 4FOIA 4BRAA 3CCEN 4O8KA 2QI2A 1BISA 3MWTA 4JI7K 1X9JA 1NMDA 2IGIA 1K9MO 1F21A 2WC9A 1NNEA 5KQDA 4I6MA 4CE9A 2P5OA 1IO2A 4K43A 4BWJA 1BQNA 2ZD1A 3NBPA 4DTXA 5AQGA 1VQ7N 2QEXN 4MDAA 4CIEA 3ENOA 1NK4A 4DR4K 3AAQA 3EO3A 4E7LA 4YOWA 3G6EN 5D3GA 3CC2N 1TUYA 2O8EB 1BL3A 4JLHA 3OJSA 4CF1A 3HPOA 3LP3A 2D0BA 3C6UA 3ATUA 4FK2A 2NNWA 4CEQA 3SI6A 4HVJA 3FLCO 1DT9A 2ZF5O 4LF8K 3BDPA 4M3WA 3HYFA 1S1VA 5AQJA 2P9NB 4QOZB 3C7NB 2YNHA 5FPEA 3HPGA 4MLHA 3VEWA 5AJ3K 3LAKA 4CVNE 1RBTA 4DV3K 2OPPA 4LFBK 4OPKA 2P9IA 4BY9C 2HHUA 2E20A 3BUZB 1CLQA 3V1QA 2OPQA 3QEPA 1KAYA 4DKWA 4CECA 5BREA 5IWAK 1O1WA 1N36K 5C0YA 2LSNA 1YI2N 4ILHA 2VQFK 4ELVA 1RNHA 4DTOA 3O08A 4IXCA 3TAMA 4WQ4A 4DV2K 1VSMA 2KZZA 2XY5A 1HYZA 3B6OA 3MXJA 1WSFA 2BDPA 2Q31A 4CIGA 4EHUA 1KD1O 5HRPA 4IFEA 3NF6A 4JKFA 4H0XB 2YHYA 1XUPO 1X9SA 4RW6A 2CGLA 1NU0A 1MWKA 3H3OB 2EX3A 2E4LA 2FBXA 3UKRA 1S5JA 3IMXA 4OKEA 5LL6Z 4E19A 3UKUB 3D7EO 1SZ2A 4FJKA 4EHTA 1MU2A 3MXIA 3AVMA 1SKRA 1YXQA 3MX2A 4PKGA 1NM1A 3KIOA 4BRDA 1SS6A 2P9SA 3D2FB 3OYNA 1KTQA 1GLLO 4LF9K 4KO0A 5AQYA 5HROA 3KJVA 5AQHA 4B1XB 3J7YP 4FPBA 3L2VA 1X3NA 2VG5A 1NJZA 3PX6A 3TSUA 4CJKA 4DUYK 1J5OA 3LDNA 3KK1A 4BROA 4JI6K 3SYZA 4E89A 3HM9A 4E3SA 2GWKA 4B9TA 4A62A 3T1AA 1YVNA 2A1SA 1KSPA 1KC8O 3AA3A 4WQ5C 1QZ5A 4JI1K 3V6DA 1VSHA 3P4IA 1HX1A 2OCEA 4B9NA 1JXEA 3CCQN 3CMEN 4IJNA 1A5XA 3M3ZA 4PY5A 1LW0A 2JLEA 4MFBA 1T03A 1Q9XA 4KTQA 2BUPA 2CGJA 1NK0A 4DSIA 2PY5A 1M90O 3SCXA 4BE1A 1QSLA 3D2EB 4JI4K 3TTCA 4W5TA 4LH4A 2QTDA 4NYNA 4GKJK 3DXKA 5BPMA 2CH5A 3K5OA 4NB4A 1WSGA 4DV1K 3NGZA 3L0QA 3ITHA 3AA5X 1NLVA 1MA9B 4Z4CA 3THXA 4IJAA 3AVJA 3DI6A 1CZBA 3P39A 3AVIA 4B3RK 3VA0A 1I39A 4W5NA 3CQXA 2X6NA 4B1VA 3EEQA 3PO4A 3NGYA 2NZTA 2HNYA 4DTSA 4C8NA 1WBDA 1T6DA 5GAEP 5GIPA 2IC3A 4B9MA 1ZXOA 4X62K 3RRHA 1YVUA 2E1YA 5AQOA 2E1ZA 3A0IX 3M8SA 3U9ZA 2UUCK 3WXJA 5FROA 3AVFA 3SAHA 1VQ8N 4IOAL 3O4QA 2W6KA 4B9LA 2CH6A 1QSYA 3AO5A 4GV9A 4K8ZA 1HLUA 2A1RA 1OKJA 3VQ8A 4CHOA 1LOTB 2FBVA 4F2SA 1REVA 3AO3A 5EVZA 1SKSA 3P1GA 3VF4A 3QETA 4B9SA 3VQDA 4BACA 3K5LA 3QDKA 3HO1A 3TSPA 1RDCA 1S1UA 3WQTA 5J2QA 3LP2A 3TTFA 4R79A 1NK5A 2B6AA 1KLNA 4FW2A 3PSIA 3GBTA 4JK9A 1KCFA 3OJUA 4E7IA 1WSHA 3KK2A 3EKUA 3SQ2A 3CERA 4FL9A 5CE3A 3MN5A 2Z1JA 3EKSA 4CZIA 3CCJN 4DR7K 4Z4EA 2W41A 4CEEA 3RMDA 3P5JA 4IO9L 1BOTO 2VWBA 3VQCA 3J81O 5A2QO 3DJCA 3WNHA 2ZGYA 1NGJA 3SV4A 1D9DA 3QMLA 1GLCG 4J2EA 3SUQA 2P9KB 3I0SA 1JL1A 3ZSQA 3D6RA 2EHGA 3VA3A 4YOTA 1NJIO 1OH7A 4DU1A 2O8CB 1Z6RA 1RDUA 3VESA 4YOXA 4ZTJA 3V1RA 1NG9A 2FBTA 3IAYA 5LMNK 1QHTA 3E9OA 1RBSA 3SUOA 2ZM6K 2A42A 3DWLA 4DS5A 4JAXA 3HZ6A 1UWBA 3THYA 4H8KA 3ATVA 4BVPA 3QINA 1VSDA 4JI5K 3MN9A 4CIFA 2IVPA 5T7BA 1BA1A 2DFEA 4FLWA 2VG7A 3OW2M 2F8SA 2HW3A 3IRXA 1KXPA 5AQQA 5EY4A 3HXMA 2CGKA 5C2FA 3R1XA 4OX9K 2KHOA 4DSLA 4IZ9A 3O3GA 1TL3A 4DR3K 3OS0A 1NGHA 2OYQA 1BA0A 3SPZA 4FZZA 4GW6A 4DTNA 3I8BA 3ULEB 2F96A 1K8KA 4B3MK 1W9HA 1QTMA 4AHTA 4CJVA 2YNIA 3O9QA 1ZBSA 3DRPA 3VQBA 5GAGP 4LF5K 3DRRA 4JD2B 3LWMA 3RMAA 1YJWN 1ZBFA 3LDSA 4Z4FA 4FJNA 3CXCM 4FJ8A 1ITGA 4BQLA 3DLBA 1NJXA 3ULDA 1WNSA 1SUQA 2ATQA 2P9PA 3AVCA 1D8YA 2FF6A 4BRGA 4OPJA 3UIQA 4FM2A 4M3RA 1BI4B 3QERA 3ZSYA 3V1OA 3IG1A 3PIOL 1CXUA 3DOLA 4AF1A 1NWKA 5F1XA 4H0YB 4IFVA 4F3TA 1SL2A 4YDUA 5C24A 4CJ4A 2RPIA 2QXFA 3H08A 4KH5A 4XEIA 3C6HA 2VCPA 3VQ9A 4GKKK 4FW1A 5AQFA 3SMPA 2O8FB 3LAMA 1B9DA 4N41A 4CJRA 3DXMA 2E88A 3MN7A 4RW9A 4C8OA 3CPEA 1RGIA 3PY8A 1HRHA 3PSFA 3TPQA 1RBVA 2ASOA 3KKSA 2G8UA 4CEBA 1NGEA 2F9TA 4CFBA 2G8IA 1S1XA 3TAPA 2KFZA 5FRMA 1ZBHA 1WUAA 2G8HA 4KRFA 5JS1A 1U47A 2I5JA 2E5LK 4CFDA 4CZGA 4HUEA 1RDDA 5AFUH 2W6LA 4JHDB 4O44A 5FPDA 3VENA 4FJHA 3C95A 4DV7K 2O8BA 3AVKA 1IBLK 4LSLA 4KKOA 4DV5K 3U8XA 4GVEA 2GBZA 3JSMA 1IH7A 3HK2A 1HMVA 3KLIA 2HMPA 4OLBA 1NMNA 4Z4GA 4YFUA 2Z1GA 1WAJA 4NCBA 4FWRA 1TAUA 3HTVA 3RWUA 3M6GA 4JKDA 2ZWHA 3QO9A 4BC4A 4JYAK 1JLBA 1LW2A 4F4KA 2H3GX 3OYIA 1YJ9N 3O9UA 2VWJA 3FE1A 1SAZA 2GX9A 3EL2A 3L2WA 3G10A 2NRRA 3L3UA 1UA0A 3MDQA 4CZHA 1IBMK 4KB0A 1B9FA 2Q0UA 1HQUA 1IKXA 5CZ1A 4OGEA 5GINA 3VEXA 3N4PA 1U2VB 3K9KA 3EZWA 3PV8A 2HSTA 4LY7A 4C8KA 4FJMA 1YUWA 1RCHA 1G15A 5HOOA 2NRTA 5EXWA 1N34K 3LPUA 4L8RB 2QKBA 1E3MA 3AVLA 1A5VA 4NCAA 3HVTA 4K25A 4PKIA 4JKCA 3OYGA 4FWLA 2VYPA 1XC3A 2F4VK 3HJFA 4WFBL 4GMJB 1IJJA 1GOBA 3A5OC 3NCIA 3AO2A 1YTAA 4IG3A 4DSEA 4AHCA 3E1YA 2P9UA 3DM2A 1HNVA 2KW4A 4CK2A 1T8EA 1Q86O 2KZMA 3EYZA 3FZMA 4I6MB 3R6MA 1ILYA 2BE2A 2O4GA 5HRNA 2OTLN 3SV3A 3K2PA 1KVAA 4RW7A 4CJSA 4DR1K 4FYDA 3SAGA 3JXUA 3LWLA 1TUUA 3ISNC 1Y64A 4DR2K 2D1KA 4BC5A 3K59A 4BRLA 1ZC6A 1J5EK 4BRQA 4CHNA 4FJGA 2QW9A 4KHWA 1BO5O 4IWVA 3VERA 4DR6K 4YOYA 3SLCA 1NKCA 1SQKA 2I7NA 4H5RA 4DWIA 1NKEA 1NGFA 1GLJO 4KB1A 3NAEA 4CHQA 4G9ZA 2Q36A 1VRUA 1RFQA 4BR4A 3CJ9A 2FC0A 2E2NA 3K58A 1K73O 3C6AA 1TYQA 2YJEA 1FJGK 2BANA 2JWLA 2QWQA 1N8RO 3QESA 3FZHA 3O9SA 3S9HA 3HP9A 3MWPA 2DFHA 3KZBA 5ADXH 4LH5A 3Q7BA 3S3NA 3ZT4A 2QWOA 3HOSA 2FSKA 1BCMA 4DF4A 3VETA 3QLHA 1HNZK 1GLBG 2P9IB 2D0AA 4MO5A 4CJPA 5KPZA 1U4BA 3L2RA 3ASMA 4Z94A 3MN6A 3PX4A 4ID5A 3F2KA 3MX5A 1VQMN 3R3LA 3VGLA 3HM8A 3OA9A 5FPMA 1L3TA 1SL1A 4FWMA 5JVHL 4I2QA 4BR7A 4BRFA 3WEEA 3MCPA 4DQPA 1NK9A 4LF6K 3E66A 1S9GA 3F73A 3K5MA 5EX5A 3WXKA 1EO1A 4ISEA 2NRXA 2UYTA 3LDPA 3RMCA 2D0CA 5BR9A 4F3OA 5CYQA 4CHPA 4B8AB 1MWMA 4H5TA 4BG9A 1QHAA 4EAHD 4RW4A 4M3ZA 4DV4K 3MEGA 1D5AA 3PX0A 2ITMA 1TKZA 3CFPA 3TR8A 3CJBA 3UKRB 4CCHA 3GOIA 4Y0WA 2VQEK 3TABA 2QM1A 4XH1A 1RDWX 2Z1HA 3LM9A 2P9SB 2XY8A 5DM6L 4E0DA 4CK1A 2ASPA 5KPRA 5DK5A 1JCFA 4WYBA 1W2BM 4K42A 4A2BA 1JLCA 3TAFA 4L3QA 1KFDA 3B6PA 1HPZA 2JGUA 1IKVA 5HRSA 4BRPA 1XQSC 5EU7A 4YY3K 5F0XA 4FK4A 4CBXA 4BR5A 5AZJA 1BIZA 3C6TA 3VQ7A 1RTIA 1CXQA 4FWPA 3WQUA 3MXMA 1OH6A 3NHGA 3ZSWA 3T3FA 1X3MA 2AP1A 3SUPA 2QWMA 3NH1A 1S1WA 4DSJA 2O8DA 1S1TA 3DXKB 4BWMA 1KVBA 1TAQA 3CG7A 1S6QA 5LMUK 3T69A 3PIPL 4JK7A 1E4FT 5M1NA 3THXB 3U9DA 4WCEL 1LAWA 1S6PA 1BQMA 2B5JA 4DQIA 2Q1NA 3WXIA 3VGMA 1BWFO 3THWA 1G99A 2I7PA 3ZT2A 1P8ZA 1N6QA 4JKHA 3O1BA 3O1WA 4KBOA 3NGIA 1TK0A 1ZBLA 2KLAA 2NUBA 1U45A 4K41A 2A40A 4JK8A 1T44A 1L3SA 3CM6A 1FKPA 2ZQBA 3OS1A 3HRGA 3AA2A 4J2AA 3P83D 4Z0UA 2Z1IA 4M45A 2OZSA 4DG1A 4CJQA 3U4LA 3QBWA 4DHYA 4NXNK 2IVOA 3M8PA 4BRIA 2E8AA 3FFIA 3QIOA 3FZKA 1IKYA 1KQSM 3O6WA 4N56A 2ZJQL 4GNIA 1QQOA 4M3TA 4CHYA 4JV5K 2NRHA 4B1YB 1XMQK 4W5QA 4HHTA 4FZYA 2VGMA 2Q97A 4EIAA 2A41A 2G8VA 2HF3A 4CJ3A 5J2MA 2YV0X 4FJIA 5CYMA 1QQCA 4CW7B 5LJWA 3UB5A 1QSSA 3SJJA 1T05A 3GL1A 4ISFA 3DLGA 2HBLA 4JS4A 4LFCK 1GLDG 1NJYA 3RSEA 4F9OA 4Z4HA 3DLHA 4CJTA 3THVA 3KLGA 4FLYA 4A5AA 4JKGA 4F8RA 1VQ9N 1J54A 1C0UA 4CJ7A 1NK6A 1BG3A 2G8WA 3ZLJA 2FXUA 3E9LA 5C2DA 3K57A 4FLTA 4CZLA 4KHYA 1HKGA 3MECA 1I3AA 5AQXA 4CD1A 2GV9A 4AHUA 2RN2A 3L8BA 3KWGA 4QAGA 4RTFD 4DSKA 4ICLA 5AQPA 4FJLA 3A5NC 4CGHA 3T19A 4WF9L 3VEZA 1P90A 1XMOK 4CJUA 1Z26A 2YKNA 1NGCA 5GIOA 2HBMA 3WXMB 1H1VA 3THYB 1HKBA 4H03B 4YNQA 4NCGA 1CZ9A 1TGOA 4I7FA 5H1SQ 3P38A 1S22A 3VEVA 4CGDA 3OYEA 3JAMO 3CI5A 3NVKA 4AQYK 5AQZA 5BR8K 4IFYA 1B92A 1J6ZA 2RE2A 4LSNA 3I33A 4E1NA 1LWEA 3G25A 1HQEA 4AM7A 4IDKA 2A6AA 3A8YA 5JLFA 1U6ZA 2YHXA 1RILA 3TARA 1YT3A 5AQTA 2WTUA 3SZ2A 3BEXA 1K8KB 5EOYA 1YHQN 4NO7A 4CZMA 4BE2A 2Q2RA 4E7KA 4WFNL 1WSEA 5E84A 3AVBA 3AARA 2VWKA 4BDZA 4CGFA 1N5YA 4N5SA 1LAVA 3TAGA 1V4SA 1EXQA 1Z25A 2Q0RA 5KRSA 1C1CA 3D0PA 1DTQA 1GLAG 4YOVA 2PYLA 1HYSA 4CEDA 2P9PB 3KVGA 3V81A 1C1AA 2HVHA 1IV0A 2WOMA 3LPTA 4WQ4C 2QKKA 4KI4A 3QBXA 2DTUA 1R0AA 5FRNA 4KTWA 1HJOA 1WOQA 4DTPA 5KPTA 3CCLN 4CESA 5BRDA 2UUAK 1NOYA 4C1NI 3ENBA 4W5RA 4YOUA 4EFHA 3NFAA 4RWTA 4CF0A 3O3HA 4PKHA 3H1QA 4DQSA 4BE0A 3VQEA 1C6VA 3I0RA 4ZTFA 3F5TA 3OYHA 1QVFM 3J80O 1RDAA 4PQUA 3VF6A 4O0JA 1BHLA 1XNQK 4M7YA 3FZFA 3DXMB 1VSKA 4F2RA 4JKBA 4IOXA 3TAQA 3VTIA 1QQNA 3AVHA 3BGRA 3CM5A 4CI6A 2HHWA 3MK6A 3OYDA 5GAHP 3U3YA 4M3UA 1HNWK 4E7HA 3OS2A 4DFPA 3TWHA 1DTTA 2HMIA 5CZ2A 1L3UA 4KHNA 5FPNA 5M1OA 4OPHA 5HLFA 1JLFA 1IG9A 3KD5E 3EN9A 4CFCA 4FJ9A 3TANA 1JLGA 1RTJA 2O8BB 1A5WA 4OGCA 1NGIA 1OH5A 3NH2A 4OJRA 4AM6A 1X9MA 1RBRA 3MCAB 1VSEA 3RR7A 3E01A 1RBUA 2PZSA 4V19S 4PWDA 2QWPA 3QEVA 4IKFA 4KHQA 3SBGA 3A5LC 3KWIA 3L3VA 3HL8A 4N76A 3CIPA 1BIUA 5C15A 2NRZA 4O5FA 2YX6A 4FJXA 1WSIA 3O8MA 4FVMA 4O55A 1HYVA 3JS6A 2YHBA 4FWKA 4XIUA 5M1PA 4RG8A 2GUPA 2XO7A 1TK8A 2X6SA 4FWSA 1SV5A 3RRGA 2ASMA 1U04A 4WQ5A 3HSTB 4H0VB 4CFAA 3FFKB 3VN5A 2Q3SA 3H1VX 3AY9A 2YKMA 4G1QA 5KTQA 4Q5VA 4FJ5A 2V7ZA 4B08A 1QVGM 1K8AO 4JRPA 3DYAA 3J7ZO 4BR9A 4DMNA 3AVAA 4MO4A 4O0IA 4IOCL 1VSIA 4CERA 4CZJA 4FLZA 1WAFA 5JMVA 3NDKA 2G8KA 2XRIA 2E2OA 1NBWA 4FOEA 1BUPA 3IS9A 5AZIA 1HR0K
chains in the Genus database with same CATH topology
3ZSZA 3RRHA 1YVUA 1S9GA 3F73A 3K5MA 3ZSXA 4EP4A 3TI0A 4M3XA 3M8SA 4QCLA 1JLQA 5SZTA 5FROA 3AV9A 3AVFA 5JS2A 3M8RA 3CFOA 3RMCA 4DU4A 4FJIA 2D0CA 1VSFA 3O4QA 4DQRA 4F3OA 5CYQA 4CJWA 3QNNA 1HJRA 4CHPA 1QSYA 4B9LA 4B8AB 3AO5A 4KI6A 3G0ZA 4RW4A 4DF8A 4M3ZA 3MEGA 1K6YA 3LP0A 1D5AA 1KVCA 3OYJA 3PX0A 4K8ZA 1TKZA 3VQAA 3A2FA 3TR8A 3CFPA 2A1RA 4BDPA 3VQ8A 4CCHA 4CHOA 3NE6A 2FBVA 4F2SA 3TABA 1REVA 4LD0A 4DLEA 4HUGA 2HB5A 3AO3A 2Z1HA 4M41A 1SKSA 3P1GA 1XC9A 4N47A 2XY8A 1FK9A 3DOKA 4Y1CA 2Y1JA 4E0DA 3QETA 4B9SA 3VQDA 4CK1A 4DSFA 4E1MA 1QS4A 4BACA 4DQQA 1NOZA 3AVGA 3K5LA 1JLEA 3HO1A 1RDCA 1ZBIA 5DK5A 1S1UA 2P5GA 1RT2A 5J2QA 1W0HA 3LP2A 3OYCA 1JLCA 3TAFA 1NK5A 2B6AA 4CF2A 1J9AA 1BCOA 1KFDA 3B6PA 1KLNA 4PUOA 4FW2A 4CJFA 2HVIA 3ZT0A 1HPZA 2JGUA 1IKVA 1KCFA 5HRSA 3OJUA 4HTUA 4E7IA 1TKDA 3ZT3A 4B9UA 3OYBA 1WSHA 5EU7A 3KK2A 3I8DA 3SQ2A 4FK4A 4KAZA 3VQPA 1TK5A 1BI4A 3MEEA 3V9WA 1BIZA 3C6TA 2Z1JA 5FDLA 1RTIA 1CXQA 2YNGA 3HPHA 3VQ7A 3WNFA 4DLGA 4Z4EA 4CEEA 3SQ4A 2P51A 5C42A 4DFMA 3RMDA 3P5JA 3L2QA 1RT7A 2RF2A 3MXMA 1RTHA 2HNDA 2O4IA 4CJLA 3VQCA 1RT3A 2OA8A 1IKWA 2WONA 4O4GA 3NHGA 3WNHA 3SUNA 1EP4A 5DMRA 3ZSWA 2ETJA 3T3FA 3SV4A 4DTMA 2D5RA 1D9DA 4J2EA 3SUQA 1WLJA 3SUPA 3NH1A 5CY4A 1NKBA 4ELTA 3DLKA 4B9VA 1S1WA 3I0SA 1JL1A 3ZSQA 3QEIA 4DSJA 2HHVA 1S1TA 2EHGA 1LWCA 2ITGA 3WNGA 3VA3A 4CJ5A 4BWMA 4DU1A 3LZIA 1KVBA 1TAQA 4KHUA 4AILC 2AJQA 2GUIA 3CG7A 3RR8A 1TV6A 4EP5A 3DMJA 4OLAA 4ZTJA 3SQ0A 1S6QA 3V1RA 1FKOA 4OVLA 2FBTA 3IAYA 1WN7A 5SWMA 1QHTA 3V9SA 4EZ6A 1RBSA 3SUOA 4DS5A 4GVMA 5I3UA 3DLRA 4CGGA 2OPRA 4AH9A 1LAWA 1S6PA 1BQMA 2B5JA 5KI6A 1UWBA 4DQIA 1VSJA 3DLHA 4H8KA 3QINA 3AVNA 1VSLA 1VSDA 2KTQA 1C0TA 3ZT2A 2IOCA 4FZZA 1N6QA 4CIFA 5T7BA 4FLWA 2DFEA 1XHXA 2HW3A 2VG7A 2F8SA 3NGIA 3IRXA 1TK0A 1GOAA 1ZBLA 1X9WA 4CEAA 5HP1A 4NYFA 3ZT1A 3HXMA 2NUBA 4AHVA 1EKEA 1Q8IA 1U45A 2KFNA 4DSLA 4Y1DA 5E41A 4I9LA 3O3GA 1TL3A 3OS0A 3ZCMA 1L3SA 1KLMA 3CM6A 1JXBA 1FKPA 4AHRA 3D45A 2OYQA 2E6LA 2ZQBA 3OS1A 3V9ZA 3AA2A 4J2AA 3ZSOA 4DTJA 3P83D 3SPZA 4Z0UA 2Z1IA 1EX4A 4GW6A 4M45A 3K5NA 1HNIA 4DTNA 1KFSA 2OZSA 2F8TA 4DG1A 4CJQA 1RTDA 1U49A 1QE1A 1XWLA 2F96A 4TSXA 3CQ8A 1W9HA 1QTMA 3M8PA 4AHTA 3KLFA 3FFIA 3QIOA 1SKWA 4DTRA 1ASVA 2XY7A 1IKYA 3WNEA 4DFKA 4CJVA 3V4IA 2YNIA 4N56A 2R7YA 3DRPA 4M3TA 4CHYA 5J2NA 3VQBA 3OY9A 5KGXA 1C0MA 4W5QA 4M42A 3DRRA 4HHTA 3LWMA 3RMAA 4FZYA 1ZBFA 4H4MA 1TKXA 3KD1E 3MAQA 3LDSA 4Z4FA 4FJNA 4FJ8A 4CF9A 1ITGA 3LALA 3DLBA 4M3YA 3M8QA 1NJXA 4EZ9A 2G8VA 3ULDA 3TANA 3DLEA 1WNSA 1SUQA 4CJ3A 4KTZA 4CEFA 2YV0X 5J2MA 2ATQA 1ZBUA 3AVCA 5CYMA 1QQCA 3VQ6A 3S3OA 3LZJA 1D8YA 4JS5A 4OPJA 1QSSA 1BGXT 3U3GA 3SJJA 2IAJA 1UAXA 1DLOA 3NF9A 4AHSA 1T05A 4PA1A 4FZXC 1NJWA 4I2PA 3DLGA 3UIQA 3L2UA 3HP6A 4JS4A 4FM2A 1NJYA 4IBNA 4M3RA 1BI4B 1GOCA 3AA4A 3QERA 1YTUA 3ZSYA 3SPYA 1NK8A 3V1OA 3IG1A 1J53A 4FK0A 4Z4HA 2XY6A 4DU3A 3OVNA 4OKJA 1CXUA 3DOLA 4CJTA 3CYMA 1TVRA 3HT3A 3KLGA 4FLYA 3THVA 4IFVA 4F3TA 3S3MA 1NK7A 4F8RA 4CF8A 1SL2A 1J54A 1FXXA 1C0UA 1NK6A 3KLHA 2G8WA 1VK0A 3OYKA 5C24A 4CJ4A 2RPIA 2DFFA 2QXFA 3H08A 1U48A 3K57A 2VG6A 1LV5A 4FLTA 4DQPA 4KHYA 3MECA 4FJJA 1I3AA 2BGGA 1L5UA 4K8XA 3RMBA 2GV9A 4IG0A 2RN2A 3VQ9A 4AHUA 3L8BA 2QK9A 2IS3A 4QAGA 3EZ5A 4BDYA 3O4NA 4FYDA 4FW1A 4DSKA 3LAMA 2XHBA 5KGWA 4ICLA 3V9XA 3SNNA 3CFRA 3KTQA 1B9DA 2RKIA 4ELUA 4N41A 3F9KA 5HRRA 4CJRA 4FJLA 4CGHA 4RW9A 2IDOA 2HHTA 3T19A 3MEDA 4C8OA 3TAEA 1KRPA 1XI1A 3C94A 3PY8A 4HCCA 3AO4A 2Y1IA 1HRHA 4CJUA 2DY4A 1Z26A 1LWFA 1Y97A 5J1EA 2YKNA 1RBVA 3EY1A 3KKSA 2G8UA 4CEBA 1SL0A 4FJ7A 4YNQA 3KKRA 4NCGA 1CZ9A 1BISA 4CFBA 1TGOA 1ASWA 2IGIA 2G8IA 4I7FA 1F21A 1S1XA 3TAPA 2KFZA 2HNZA 4J2BA 5FRMA 1ZBHA 2G8HA 4CE9A 4W5OA 4CGDA 4KRFA 5JS1A 3OYEA 1IO2A 3U6FA 2P5OA 1U47A 2I5JA 4BWJA 4CFDA 4HUEA 1RDDA 4IFYA 4O44A 1B92A 4LSNA 3V9UA 1BQNA 3C95A 4E1NA 4E7JA 4FJHA 1LWEA 2ZD1A 3NBPA 3AVKA 4DTXA 1HQEA 4LSLA 4KKOA 3VQ5A 4CIEA 4IDKA 2GBZA 3JSMA 1IH7A 3HK2A 1HMVA 1RT1A 3ZSRA 1NK4A 3KLIA 4OLBA 4Z4GA 1RILA 4CEOA 4YFUA 4FM1A 3TARA 2Z1GA 1WAJA 1YT3A 3O3FA 1EETA 4E7LA 4NCBA 1TKTA 5D3GA 2B4JA 3SZ2A 1TAUA 1D9FA 4FCYA 3RWUA 1BL3A 4JLHA 3OJSA 3QO9A 1JLBA 4BE2A 2YHAA 1LW2A 4CF1A 4E7KA 4F4KA 3AO1A 1WSEA 2X78A 3HPOA 2HHXA 3LP3A 2D0BA 3PO5A 3C6UA 4FK2A 3AVBA 4CEQA 3OYIA 2VWJA 5KRTA 4HVJA 1VRTA 3SI6A 2VWKA 4BDZA 3SQ1A 4CGFA 1N5YA 4N5SA 1LAVA 3BDPA 3TAGA 4DFJA 3HYFA 1EXQA 1Z25A 4M3WA 3NF7A 5KRSA 1S1VA 1C1CA 3NF8A 3L2WA 4KV8A 3D0PA 3G10A 4QOZB 4KREA 1DTQA 4CJEA 2PYLA 1HYSA 4CEDA 2YNHA 3L3UA 3V81A 3HPGA 1C1AA 1UA0A 2HVHA 2WOMA 3LPTA 3LAKA 1RT4A 2W42A 2QKKA 1RBTA 4KI4A 2OPPA 2HHSA 4OPKA 4UQGA 2DTUA 4KB0A 2HHUA 1R0AA 1B9FA 4O5BA 1HQUA 5FRNA 4KTWA 1CLQA 1S9EA 1IKXA 5CZ1A 4OGEA 3V1QA 2OPQA 4DTPA 4C8LA 4CESA 3QEPA 1NOYA 4CECA 4W5RA 1O1WA 5HBMA 4Z4IA 4FLUA 3NFAA 3PV8A 3OYFA 4LY7A 4CF0A 4C8KA 4FJMA 3O3HA 2LSNA 1RCHA 1JL2A 4DQSA 1G15A 4ELVA 1RNHA 4DTOA 4BE0A 4MQ3A 2PYJA 3LPUA 4L8RB 4ID1A 3TAMA 1C6VA 3I0RA 1VSMA 1UOCA 3VQEA 4ZHRA 3RTVA 1T7PA 2QKBA 2KZZA 3AVLA 1A5VA 4FLXA 2XY5A 1X1PA 1HYZA 3HVTA 3B6OA 3MXJA 4ZTFA 3OYHA 4RW8A 4NCAA 1C1BA 3OYGA 3JYTA 4HUFA 1RDAA 4CHZA 1WSFA 2BDPA 4KHSA 4O0JA 4PQUA 4CIGA 2OZMA 1BHLA 5HRPA 4Q0BA 3NF6A 3HJFA 1VSKA 4GMJB 4F2RA 1GOBA 3DRSA 3TAQA 3QIPA 3NCIA 1UA1A 3AVHA 3AO2A 4RW6A 3BGRA 3CM5A 1X9SA 1L3VA 2HHQA 2HHWA 1YTAA 4IG3A 4DSEA 3ALYA 3OYDA 5J2PA 3U3YA 4M3UA 4FM0A 4AHCA 3QNOA 2EX3A 2E4LA 3OS2A 3KLEA 2FBXA 4E7HA 4J2DA 1S5JA 4OKEA 4CEZA 3TWHA 3PUFA 4DFPA 1DTTA 2P1JA 3DM2A 2HMIA 1HNVA 2E6MA 5CZ2A 4E19A 3HVRA 1L3UA 4KHNA 1XHZA 2KW4A 3VQ4A 4CK2A 1T8EA 4FJKA 1MU2A 2KQ2A 2KZMA 3EYZA 3MXIA 3AVMA 3QEXA 1SKRA 5HLFA 1JLFA 1IG9A 1WSJA 2X74A 3KIOA 4CFCA 3KD5E 2BE2A 2O4GA 5HRNA 3OYNA 1KTQA 4CGJA 4FJ9A 4I9QA 3SV3A 4KO0A 3K2PA 1KVAA 4RW7A 4CJSA 3OYAA 1JLGA 5HROA 1RTJA 2OPSA 3KJVA 1A5WA 3LWLA 4OGCA 4DS4A 1Q9YA 3ISNC 3L2VA 5I42A 2VG5A 1NJZA 4CK3A 3K59A 3PX6A 2FBYA 4CJKA 1J5OA 3NH2A 4CHNA 3KK1A 4FJGA 4OJRA 4H4OA 1X9MA 4KHWA 1RBRA 4FLVA 1VSEA 3RR7A 3SYZA 1RBUA 4E89A 2PZSA 4PWDA 3HM9A 4E3SA 1RT6A 4B9TA 1NKCA 3T1AA 3QEVA 4IKFA 2A1SA 1KSPA 4KHQA 3AA3A 4DWIA 3L3VA 3V6DA 1VSHA 3QEWA 1NKEA 4KB1A 3HL8A 1JXEA 3NAEA 4B9NA 4N76A 4CHQA 1ASUA 1BIUA 2YNFA 1A5XA 4KFBA 1VRUA 4PY5A 1LW0A 2FC0A 3NH0A 4FJXA 4OKKA 1WSIA 4FVMA 3VQQA 2JLEA 4O55A 4MFBA 3K58A 1HYVA 1RT5A 1T03A 2YHBA 1Q9XA 4XIUA 4KTQA 4FXDA 1NK0A 2BANA 4DSIA 4RG8A 3OYMA 4B8CA 2PY5A 4DTUA 3SCXA 4BE1A 1QSLA 2XO7A 1TK8A 3OYLA 3QESA 2X6SA 1SV5A 3RRGA 3S9HA 3HP9A 2DFHA 3ZSVA 1U04A 4C8MA 4W5TA 4LH4A 4NYNA 4HCBA 4LH5A 3S3NA 4B3OA 3ZT4A 3HSTB 3K5OA 4CFAA 2Q3SA 3VN5A 5K14A 1BCMA 1WSGA 3LANA 2YKMA 4DF4A 2G8FA 3QLHA 4G1QA 5KTQA 2D0AA 1TL1A 4Q5VA 3NGZA 4FJ5A 4CJPA 4R5PA 4WE1A 4B08A 3ITHA 3AA5X 1U4BA 4KPYA 4JRQA 4Z4CA 3LP1A 4JRPA 4CGIA 3DYAA 3AVJA 3ASMA 3L2RA 3DI6A 1CZBA 5C25A 3PX4A 3AVIA 4DMNA 3AVAA 1ZYQA 4ID5A 4O0IA 3VA0A 1I39A 1VSIA 4W5NA 2X6NA 4CERA 4FLZA 1L3TA 1WAFA 3PO4A 1SL1A 1JLAA 3NGYA 3KK3A 3NDKA 2HNYA 2G8KA 1RDBA 2XRIA 4I2QA 4DTSA 4C8NA 1JKHA 3IS9A 3E01A 2ZE2A 2IC3A 4B9MA 1NK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSZ A;  3RRH A;  1YVU A;  1S9G A;  3F73 A;  3K5M A;  3ZSX A;  4EP4 A;  3TI0 A;  4M3X A;  3M8S A;  4QCL A;  1JLQ A;  5SZT A;  5FRO A;  3AV9 A;  3AVF A;  5JS2 A;  3M8R A;  3CFO A;  3RMC A;  4DU4 A;  4FJI A;  2D0C A;  1VSF A;  3O4Q A;  4DQR A;  4F3O A;  5CYQ A;  4CJW A;  3QNN A;  1HJR A;  4CHP A;  1QSY A;  4B9L A;  4B8A B;  3AO5 A;  4KI6 A;  3G0Z A;  4RW4 A;  4DF8 A;  4M3Z A;  3MEG A;  1K6Y A;  3LP0 A;  1D5A A;  1KVC A;  3OYJ A;  3PX0 A;  4K8Z A;  1TKZ A;  3VQA A;  3A2F A;  3TR8 A;  3CFP A;  2A1R A;  4BDP A;  3VQ8 A;  4CCH A;  4CHO A;  3NE6 A;  2FBV A;  4F2S A;  3TAB A;  1REV A;  4LD0 A;  4DLE A;  4HUG A;  2HB5 A;  3AO3 A;  2Z1H A;  4M41 A;  1SKS A;  3P1G A;  1XC9 A;  4N47 A;  2XY8 A;  1FK9 A;  3DOK A;  4Y1C A;  2Y1J A;  4E0D A;  3QET A;  4B9S A;  3VQD A;  4CK1 A;  4DSF A;  4E1M A;  1QS4 A;  4BAC A;  4DQQ A;  1NOZ A;  3AVG A;  3K5L A;  1JLE A;  3HO1 A;  1RDC A;  1ZBI A;  5DK5 A;  1S1U A;  2P5G A;  1RT2 A;  5J2Q A;  1W0H A;  3LP2 A;  3OYC A;  1JLC A;  3TAF A;  1NK5 A;  2B6A A;  4CF2 A;  1J9A A;  1BCO A;  1KFD A;  3B6P A;  1KLN A;  4PUO A;  4FW2 A;  4CJF A;  2HVI A;  3ZT0 A;  1HPZ A;  2JGU A;  1IKV A;  1KCF A;  5HRS A;  3OJU A;  4HTU A;  4E7I A;  1TKD A;  3ZT3 A;  4B9U A;  3OYB A;  1WSH A;  5EU7 A;  3KK2 A;  3I8D A;  3SQ2 A;  4FK4 A;  4KAZ A;  3VQP A;  1TK5 A;  1BI4 A;  3MEE A;  3V9W A;  1BIZ A;  3C6T A;  2Z1J A;  5FDL A;  1RTI A;  1CXQ A;  2YNG A;  3HPH A;  3VQ7 A;  3WNF A;  4DLG A;  4Z4E A;  4CEE A;  3SQ4 A;  2P51 A;  5C42 A;  4DFM A;  3RMD A;  3P5J A;  3L2Q A;  1RT7 A;  2RF2 A;  3MXM A;  1RTH A;  2HND A;  2O4I A;  4CJL A;  3VQC A;  1RT3 A;  2OA8 A;  1IKW A;  2WON A;  4O4G A;  3NHG A;  3WNH A;  3SUN A;  1EP4 A;  5DMR A;  3ZSW A;  2ETJ A;  3T3F A;  3SV4 A;  4DTM A;  2D5R A;  1D9D A;  4J2E A;  3SUQ A;  1WLJ A;  3SUP A;  3NH1 A;  5CY4 A;  1NKB A;  4ELT A;  3DLK A;  4B9V A;  1S1W A;  3I0S A;  1JL1 A;  3ZSQ A;  3QEI A;  4DSJ A;  2HHV A;  1S1T A;  2EHG A;  1LWC A;  2ITG A;  3WNG A;  3VA3 A;  4CJ5 A;  4BWM A;  4DU1 A;  3LZI A;  1KVB A;  1TAQ A;  4KHU A;  4AIL C;  2AJQ A;  2GUI A;  3CG7 A;  3RR8 A;  1TV6 A;  4EP5 A;  3DMJ A;  4OLA A;  4ZTJ A;  3SQ0 A;  1S6Q A;  3V1R A;  1FKO A;  4OVL A;  2FBT A;  3IAY A;  1WN7 A;  5SWM A;  1QHT A;  3V9S A;  4EZ6 A;  1RBS A;  3SUO A;  4DS5 A;  4GVM A;  5I3U A;  3DLR A;  4CGG A;  2OPR A;  4AH9 A;  1LAW A;  1S6P A;  1BQM A;  2B5J A;  5KI6 A;  1UWB A;  4DQI A;  1VSJ A;  3DLH A;  4H8K A;  3QIN A;  3AVN A;  1VSL A;  1VSD A;  2KTQ A;  1C0T A;  3ZT2 A;  2IOC A;  4FZZ A;  1N6Q A;  4CIF A;  5T7B A;  4FLW A;  2DFE A;  1XHX A;  2HW3 A;  2VG7 A;  2F8S A;  3NGI A;  3IRX A;  1TK0 A;  1GOA A;  1ZBL A;  1X9W A;  4CEA A;  5HP1 A;  4NYF A;  3ZT1 A;  3HXM A;  2NUB A;  4AHV A;  1EKE A;  1Q8I A;  1U45 A;  2KFN A;  4DSL A;  4Y1D A;  5E41 A;  4I9L A;  3O3G A;  1TL3 A;  3OS0 A;  3ZCM A;  1L3S A;  1KLM A;  3CM6 A;  1JXB A;  1FKP A;  4AHR A;  3D45 A;  2OYQ A;  2E6L A;  2ZQB A;  3OS1 A;  3V9Z A;  3AA2 A;  4J2A A;  3ZSO A;  4DTJ A;  3P83 D;  3SPZ A;  4Z0U A;  2Z1I A;  1EX4 A;  4GW6 A;  4M45 A;  3K5N A;  1HNI A;  4DTN A;  1KFS A;  2OZS A;  2F8T A;  4DG1 A;  4CJQ A;  1RTD A;  1U49 A;  1QE1 A;  1XWL A;  2F96 A;  4TSX A;  3CQ8 A;  1W9H A;  1QTM A;  3M8P A;  4AHT A;  3KLF A;  3FFI A;  3QIO A;  1SKW A;  4DTR A;  1ASV A;  2XY7 A;  1IKY A;  3WNE A;  4DFK A;  4CJV A;  3V4I A;  2YNI A;  4N56 A;  2R7Y A;  3DRP A;  4M3T A;  4CHY A;  5J2N A;  3VQB A;  3OY9 A;  5KGX A;  1C0M A;  4W5Q A;  4M42 A;  3DRR A;  4HHT A;  3LWM A;  3RMA A;  4FZY A;  1ZBF A;  4H4M A;  1TKX A;  3KD1 E;  3MAQ A;  3LDS A;  4Z4F A;  4FJN A;  4FJ8 A;  4CF9 A;  1ITG A;  3LAL A;  3DLB A;  4M3Y A;  3M8Q A;  1NJX A;  4EZ9 A;  2G8V A;  3ULD A;  3TAN A;  3DLE A;  1WNS A;  1SUQ A;  4CJ3 A;  4KTZ A;  4CEF A;  2YV0 X;  5J2M A;  2ATQ A;  1ZBU A;  3AVC A;  5CYM A;  1QQC A;  3VQ6 A;  3S3O A;  3LZJ A;  1D8Y A;  4JS5 A;  4OPJ A;  1QSS A;  1BGX T;  3U3G A;  3SJJ A;  2IAJ A;  1UAX A;  1DLO A;  3NF9 A;  4AHS A;  1T05 A;  4PA1 A;  4FZX C;  1NJW A;  4I2P A;  3DLG A;  3UIQ A;  3L2U A;  3HP6 A;  4JS4 A;  4FM2 A;  1NJY A;  4IBN A;  4M3R A;  1BI4 B;  1GOC A;  3AA4 A;  3QER A;  1YTU A;  3ZSY A;  3SPY A;  1NK8 A;  3V1O A;  3IG1 A;  1J53 A;  4FK0 A;  4Z4H A;  2XY6 A;  4DU3 A;  3OVN A;  4OKJ A;  1CXU A;  3DOL A;  4CJT A;  3CYM A;  1TVR A;  3HT3 A;  3KLG A;  4FLY A;  3THV A;  4IFV A;  4F3T A;  3S3M A;  1NK7 A;  4F8R A;  4CF8 A;  1SL2 A;  1J54 A;  1FXX A;  1C0U A;  1NK6 A;  3KLH A;  2G8W A;  1VK0 A;  3OYK A;  5C24 A;  4CJ4 A;  2RPI A;  2DFF A;  2QXF A;  3H08 A;  1U48 A;  3K57 A;  2VG6 A;  1LV5 A;  4FLT A;  4DQP A;  4KHY A;  3MEC A;  4FJJ A;  1I3A A;  2BGG A;  1L5U A;  4K8X A;  3RMB A;  2GV9 A;  4IG0 A;  2RN2 A;  3VQ9 A;  4AHU A;  3L8B A;  2QK9 A;  2IS3 A;  4QAG A;  3EZ5 A;  4BDY A;  3O4N A;  4FYD A;  4FW1 A;  4DSK A;  3LAM A;  2XHB A;  5KGW A;  4ICL A;  3V9X A;  3SNN A;  3CFR A;  3KTQ A;  1B9D A;  2RKI A;  4ELU A;  4N41 A;  3F9K A;  5HRR A;  4CJR A;  4FJL A;  4CGH A;  4RW9 A;  2IDO A;  2HHT A;  3T19 A;  3MED A;  4C8O A;  3TAE A;  1KRP A;  1XI1 A;  3C94 A;  3PY8 A;  4HCC A;  3AO4 A;  2Y1I A;  1HRH A;  4CJU A;  2DY4 A;  1Z26 A;  1LWF A;  1Y97 A;  5J1E A;  2YKN A;  1RBV A;  3EY1 A;  3KKS A;  2G8U A;  4CEB A;  1SL0 A;  4FJ7 A;  4YNQ A;  3KKR A;  4NCG A;  1CZ9 A;  1BIS A;  4CFB A;  1TGO A;  1ASW A;  2IGI A;  2G8I A;  4I7F A;  1F21 A;  1S1X A;  3TAP A;  2KFZ A;  2HNZ A;  4J2B A;  5FRM A;  1ZBH A;  2G8H A;  4CE9 A;  4W5O A;  4CGD A;  4KRF A;  5JS1 A;  3OYE A;  1IO2 A;  3U6F A;  2P5O A;  1U47 A;  2I5J A;  4BWJ A;  4CFD A;  4HUE A;  1RDD A;  4IFY A;  4O44 A;  1B92 A;  4LSN A;  3V9U A;  1BQN A;  3C95 A;  4E1N A;  4E7J A;  4FJH A;  1LWE A;  2ZD1 A;  3NBP A;  3AVK A;  4DTX A;  1HQE A;  4LSL A;  4KKO A;  3VQ5 A;  4CIE A;  4IDK A;  2GBZ A;  3JSM A;  1IH7 A;  3HK2 A;  1HMV A;  1RT1 A;  3ZSR A;  1NK4 A;  3KLI A;  4OLB A;  4Z4G A;  1RIL A;  4CEO A;  4YFU A;  4FM1 A;  3TAR A;  2Z1G A;  1WAJ A;  1YT3 A;  3O3F A;  1EET A;  4E7L A;  4NCB A;  1TKT A;  5D3G A;  2B4J A;  3SZ2 A;  1TAU A;  1D9F A;  4FCY A;  3RWU A;  1BL3 A;  4JLH A;  3OJS A;  3QO9 A;  1JLB A;  4BE2 A;  2YHA A;  1LW2 A;  4CF1 A;  4E7K A;  4F4K A;  3AO1 A;  1WSE A;  2X78 A;  3HPO A;  2HHX A;  3LP3 A;  2D0B A;  3PO5 A;  3C6U A;  4FK2 A;  3AVB A;  4CEQ A;  3OYI A;  2VWJ A;  5KRT A;  4HVJ A;  1VRT A;  3SI6 A;  2VWK A;  4BDZ A;  3SQ1 A;  4CGF A;  1N5Y A;  4N5S A;  1LAV A;  3BDP A;  3TAG A;  4DFJ A;  3HYF A;  1EXQ A;  1Z25 A;  4M3W A;  3NF7 A;  5KRS A;  1S1V A;  1C1C A;  3NF8 A;  3L2W A;  4KV8 A;  3D0P A;  3G10 A;  4QOZ B;  4KRE A;  1DTQ A;  4CJE A;  2PYL A;  1HYS A;  4CED A;  2YNH A;  3L3U A;  3V81 A;  3HPG A;  1C1A A;  1UA0 A;  2HVH A;  2WOM A;  3LPT A;  3LAK A;  1RT4 A;  2W42 A;  2QKK A;  1RBT A;  4KI4 A;  2OPP A;  2HHS A;  4OPK A;  4UQG A;  2DTU A;  4KB0 A;  2HHU A;  1R0A A;  1B9F A;  4O5B A;  1HQU A;  5FRN A;  4KTW A;  1CLQ A;  1S9E A;  1IKX A;  5CZ1 A;  4OGE A;  3V1Q A;  2OPQ A;  4DTP A;  4C8L A;  4CES A;  3QEP A;  1NOY A;  4CEC A;  4W5R A;  1O1W A;  5HBM A;  4Z4I A;  4FLU A;  3NFA A;  3PV8 A;  3OYF A;  4LY7 A;  4CF0 A;  4C8K A;  4FJM A;  3O3H A;  2LSN A;  1RCH A;  1JL2 A;  4DQS A;  1G15 A;  4ELV A;  1RNH A;  4DTO A;  4BE0 A;  4MQ3 A;  2PYJ A;  3LPU A;  4L8R B;  4ID1 A;  3TAM A;  1C6V A;  3I0R A;  1VSM A;  1UOC A;  3VQE A;  4ZHR A;  3RTV A;  1T7P A;  2QKB A;  2KZZ A;  3AVL A;  1A5V A;  4FLX A;  2XY5 A;  1X1P A;  1HYZ A;  3HVT A;  3B6O A;  3MXJ A;  4ZTF A;  3OYH A;  4RW8 A;  4NCA A;  1C1B A;  3OYG A;  3JYT A;  4HUF A;  1RDA A;  4CHZ A;  1WSF A;  2BDP A;  4KHS A;  4O0J A;  4PQU A;  4CIG A;  2OZM A;  1BHL A;  5HRP A;  4Q0B A;  3NF6 A;  3HJF A;  1VSK A;  4GMJ B;  4F2R A;  1GOB A;  3DRS A;  3TAQ A;  3QIP A;  3NCI A;  1UA1 A;  3AVH A;  3AO2 A;  4RW6 A;  3BGR A;  3CM5 A;  1X9S A;  1L3V A;  2HHQ A;  2HHW A;  1YTA A;  4IG3 A;  4DSE A;  3ALY A;  3OYD A;  5J2P A;  3U3Y A;  4M3U A;  4FM0 A;  4AHC A;  3QNO A;  2EX3 A;  2E4L A;  3OS2 A;  3KLE A;  2FBX A;  4E7H A;  4J2D A;  1S5J A;  4OKE A;  4CEZ A;  3TWH A;  3PUF A;  4DFP A;  1DTT A;  2P1J A;  3DM2 A;  2HMI A;  1HNV A;  2E6M A;  5CZ2 A;  4E19 A;  3HVR A;  1L3U A;  4KHN A;  1XHZ A;  2KW4 A;  3VQ4 A;  4CK2 A;  1T8E A;  4FJK A;  1MU2 A;  2KQ2 A;  2KZM A;  3EYZ A;  3MXI A;  3AVM A;  3QEX A;  1SKR A;  5HLF A;  1JLF A;  1IG9 A;  1WSJ A;  2X74 A;  3KIO A;  4CFC A;  3KD5 E;  2BE2 A;  2O4G A;  5HRN A;  3OYN A;  1KTQ A;  4CGJ A;  4FJ9 A;  4I9Q A;  3SV3 A;  4KO0 A;  3K2P A;  1KVA A;  4RW7 A;  4CJS A;  3OYA A;  1JLG A;  5HRO A;  1RTJ A;  2OPS A;  3KJV A;  1A5W A;  3LWL A;  4OGC A;  4DS4 A;  1Q9Y A;  3ISN C;  3L2V A;  5I42 A;  2VG5 A;  1NJZ A;  4CK3 A;  3K59 A;  3PX6 A;  2FBY A;  4CJK A;  1J5O A;  3NH2 A;  4CHN A;  3KK1 A;  4FJG A;  4OJR A;  4H4O A;  1X9M A;  4KHW A;  1RBR A;  4FLV A;  1VSE A;  3RR7 A;  3SYZ A;  1RBU A;  4E89 A;  2PZS A;  4PWD A;  3HM9 A;  4E3S A;  1RT6 A;  4B9T A;  1NKC A;  3T1A A;  3QEV A;  4IKF A;  2A1S A;  1KSP A;  4KHQ A;  3AA3 A;  4DWI A;  3L3V A;  3V6D A;  1VSH A;  3QEW A;  1NKE A;  4KB1 A;  3HL8 A;  1JXE A;  3NAE A;  4B9N A;  4N76 A;  4CHQ A;  1ASU A;  1BIU A;  2YNF A;  1A5X A;  4KFB A;  1VRU A;  4PY5 A;  1LW0 A;  2FC0 A;  3NH0 A;  4FJX A;  4OKK A;  1WSI A;  4FVM A;  3VQQ A;  2JLE A;  4O55 A;  4MFB A;  3K58 A;  1HYV A;  1RT5 A;  1T03 A;  2YHB A;  1Q9X A;  4XIU A;  4KTQ A;  4FXD A;  1NK0 A;  2BAN A;  4DSI A;  4RG8 A;  3OYM A;  4B8C A;  2PY5 A;  4DTU A;  3SCX A;  4BE1 A;  1QSL A;  2XO7 A;  1TK8 A;  3OYL A;  3QES A;  2X6S A;  1SV5 A;  3RRG A;  3S9H A;  3HP9 A;  2DFH A;  3ZSV A;  1U04 A;  4C8M A;  4W5T A;  4LH4 A;  4NYN A;  4HCB A;  4LH5 A;  3S3N A;  4B3O A;  3ZT4 A;  3HST B;  3K5O A;  4CFA A;  2Q3S A;  3VN5 A;  5K14 A;  1BCM A;  1WSG A;  3LAN A;  2YKM A;  4DF4 A;  2G8F A;  3QLH A;  4G1Q A;  5KTQ A;  2D0A A;  1TL1 A;  4Q5V A;  3NGZ A;  4FJ5 A;  4CJP A;  4R5P A;  4WE1 A;  4B08 A;  3ITH A;  3AA5 X;  1U4B A;  4KPY A;  4JRQ A;  4Z4C A;  3LP1 A;  4JRP A;  4CGI A;  3DYA A;  3AVJ A;  3ASM A;  3L2R A;  3DI6 A;  1CZB A;  5C25 A;  3PX4 A;  3AVI A;  4DMN A;  3AVA A;  1ZYQ A;  4ID5 A;  4O0I A;  3VA0 A;  1I39 A;  1VSI A;  4W5N A;  2X6N A;  4CER A;  4FLZ A;  1L3T A;  1WAF A;  3PO4 A;  1SL1 A;  1JLA A;  3NGY A;  3KK3 A;  3NDK A;  2HNY A;  2G8K A;  1RDB A;  2XRI A;  4I2Q A;  4DTS A;  4C8N A;  1JKH A;  3IS9 A;  3E01 A;  2ZE2 A;  2IC3 A;  4B9M A;  1NK9 A; 
#chains in the Genus database with same CATH topology
 3ZSZ A;  1NGA A;  1N33 K;  1Q82 O;  3LDL A;  1VQN N;  5AQN A;  3TI0 A;  3E9P A;  4M3X A;  2VGN A;  4QCL A;  1JLQ A;  5JS2 A;  3M8R A;  3O4W A;  3GG4 A;  3LDQ A;  4DU4 A;  1T3V A;  3ZET A;  3QNN A;  1HJR A;  2QA4 N;  3OHR A;  4ILJ A;  4KI6 A;  4B3S K;  4DF8 A;  4BRE A;  3LP0 A;  1KVC A;  3OYJ A;  3A2F A;  2V52 B;  4BRC A;  2P9U B;  2NRV A;  4PHT X;  4DLE A;  1NGB A;  3ZEU A;  2HB5 A;  4HUG A;  4BRN A;  4BRH A;  4IDH A;  1W7A A;  3CCM N;  4BR2 A;  3DOK A;  2WUS A;  4Y1C A;  2Y1J A;  2P5G A;  3WUH A;  1NOZ A;  3AVG A;  2HBJ A;  4FSV A;  3VOV A;  1VQP N;  4FWQ A;  1W0H A;  4CF2 A;  1QZ6 A;  4CJF A;  2HVI A;  1TKD A;  3ZT3 A;  4B9U A;  3S41 A;  2D4W A;  4LF4 K;  4BVO A;  4KAZ A;  1O13 A;  1TK5 A;  3SBT A;  3V9W A;  5FDL A;  3WNF A;  5LJV A;  4DLG A;  5GAD P;  4DFM A;  1RT7 A;  2O4I A;  3O9T A;  4NLC A;  4O4G A;  2WON A;  3SUN A;  1EP4 A;  1TYQ B;  2D0O A;  4DTM A;  2D5R A;  4IEI A;  5BPL A;  1HNX K;  1NKB A;  1ATS A;  3HOT A;  2F7T A;  1LWC A;  2ITG A;  3EE9 A;  3WNG A;  3LZI A;  3R9P A;  3IDH A;  4AIL C;  2GUI A;  3RR8 A;  1TV6 A;  4OLA A;  2P9L A;  1FKO A;  4OVL A;  3ZYY X;  3QB0 A;  1WN7 A;  5SWM A;  3V9S A;  4GVM A;  3DLR A;  5E26 A;  3B8A X;  4AH9 A;  1VSJ A;  4X64 K;  3H6E A;  1IBK K;  1VSL A;  3HSC A;  3KHY A;  5C10 A;  2IOC A;  3WEE B;  3ZX3 A;  2FSN A;  3LDO A;  4CEA A;  5JVG L;  4YHH K;  1EKE A;  1Q8I A;  2KFN A;  1YJN N;  4I9L A;  4H0O A;  4B1W B;  4JKE A;  3H45 C;  2E2Q A;  3ZCM A;  3CCV N;  1JXB A;  3C0B A;  1C0G A;  4AHR A;  3BY5 A;  4K0K K;  3V9Z A;  3ZSO A;  4DTJ A;  5M1K A;  1KFS A;  2UXC K;  2ZGZ A;  1EX4 A;  1RTD A;  1U49 A;  1XWL A;  4TSX A;  2O8E A;  3I55 N;  3KLF A;  1SKW A;  4DTR A;  1ASV A;  3WNE A;  3SMS A;  3C65 A;  1YIJ N;  3GE1 A;  1BDG A;  3OY9 A;  5KGX A;  1I94 K;  4M42 A;  1E4G T;  1TKX A;  3MAQ A;  1S3X A;  4CF9 A;  4E1J A;  3LAL A;  3N4Q A;  2UU9 K;  1T6C A;  4EZ9 A;  3QIC A;  4M7X A;  3VEO A;  2P9N A;  3DLE A;  4BQZ A;  3C7N A;  4YDU C;  1ZBU A;  3CCU N;  2RHK A;  3S3O A;  3VQ6 A;  4DUZ K;  3LZJ A;  2YI1 A;  4A2A A;  3K0S A;  2PFU A;  3U3G A;  1Z05 A;  2IAJ A;  3NF9 A;  1DLO A;  4AHS A;  1XNR K;  4FZX C;  1KAX A;  1NJW A;  4I2P A;  5AQI A;  4MLE A;  4BGB A;  3QFP A;  1VQ4 N;  2V7Y A;  5AZJ B;  5AFU A;  3SPY A;  1NK8 A;  5AQK A;  1OVY A;  1J53 A;  3WT0 A;  3W3D A;  4H5W A;  3OVN A;  3DAW A;  4OKJ A;  1QQM A;  1TVR A;  4H0T B;  3CF5 L;  1DEJ A;  1HPM A;  3KK7 A;  4CF8 A;  1HKC A;  3KLH A;  1VK0 A;  3OYK A;  2DFF A;  1U48 A;  1LV5 A;  3IKM A;  4FJJ A;  2BGG A;  1L5U A;  2O8D B;  4CD3 A;  3L4I A;  2QK9 A;  3EZ5 A;  3O4N A;  4QS9 A;  2NRW A;  5KGW A;  3GDQ A;  1HUX A;  3CFR A;  2RKI A;  3CJA A;  4ELU A;  4H5V A;  3F9K A;  2IDO A;  3ZX2 A;  3MED A;  3TAE A;  2ZJR L;  1KRP A;  4NXM K;  1XI1 A;  3C94 A;  4HCC A;  1IG8 A;  2OTJ N;  3AO4 A;  4IO8 A;  2YJF A;  5BPN A;  1Q81 O;  4BR0 A;  5J1E A;  1DKG D;  3ID6 A;  4M63 C;  4U67 L;  1SL0 A;  2QWR A;  3UKU A;  3O9R A;  2BH1 A;  3KKR A;  3THW B;  1ASW A;  4FVU A;  2OAN A;  2A5X A;  2HNZ A;  4J2B A;  4W5O A;  2V51 B;  3U6F A;  3D2F A;  2UUB K;  3V9U A;  4E7J A;  3VQ5 A;  1RT1 A;  3ZSR A;  4CEO A;  3J8A A;  4FM1 A;  3O3F A;  5AQU A;  1EET A;  4GV6 A;  1TKT A;  3CJ7 A;  2B4J A;  4XH4 A;  4FWO A;  4FCY A;  2UXB K;  2YHA A;  3AO1 A;  2X78 A;  2HHX A;  3PO5 A;  3J7A P;  1VQO N;  4JI3 K;  2WFB A;  1W97 L;  5KRT A;  1VRT A;  3SQ1 A;  1JJ2 M;  2IVN A;  4X65 K;  4DQ8 A;  4DFJ A;  3NMU A;  3WXL A;  3D2E A;  3NF7 A;  3M5R A;  3NF8 A;  4KV8 A;  1MDU B;  4CJE A;  4B3T K;  4NLB A;  1YAG A;  3T1H K;  1VAZ A;  2FSJ A;  1RT4 A;  2W42 A;  3VEY A;  4H0P A;  4DV6 K;  4GV3 A;  2HHS A;  4UQG A;  5BRH A;  4UY8 O;  3W0L A;  4O5B A;  4KH4 A;  3TSQ A;  1S9E A;  3RSE B;  3IFR A;  1DGK N;  4C8L A;  5I9E B;  5HBM A;  3SJH A;  4Z4I A;  3I56 N;  4FLU A;  3R8E A;  4JKG B;  3OYF A;  1ATR A;  1JL2 A;  3LM2 A;  1CZA N;  5AQV A;  3VGK A;  4MQ3 A;  2PYJ A;  3L6Q A;  4ID1 A;  4ZHR A;  1T7P A;  3ZX0 A;  1UOC A;  5TKW A;  3RTV A;  3A5M C;  4FLX A;  1X1P A;  4RCH A;  4RW8 A;  4X66 K;  1C1B A;  3JYT A;  4HUF A;  4KHS A;  4CHZ A;  2OZM A;  4GY2 B;  1GLF O;  4KHP K;  4Q0B A;  2KKZ A;  5AQW A;  3VPZ A;  5DM7 L;  3DRS A;  3QIP A;  1S72 N;  1UA1 A;  1L3V A;  4OPA A;  4CZE A;  1WB9 A;  4LFA K;  2HHQ A;  5IT9 O;  3ALY A;  1LCU A;  3LL3 A;  5J2P A;  3PLA A;  5ELZ A;  4FM0 A;  2GTD A;  3QNO A;  2W40 A;  3KLE A;  1Q7Y O;  4BGA A;  4J2D A;  4CEZ A;  3CCR N;  3PUF A;  3SK3 A;  3P31 A;  2P1J A;  5ADX A;  2E6M A;  3HVR A;  1XHZ A;  3VQ4 A;  1C0F A;  2KQ2 A;  4J8F A;  3QEX A;  1VQK N;  1WSJ A;  2X74 A;  1YIT N;  4FPA A;  4CGJ A;  4I9Q A;  5FLX O;  2QWN A;  3OYA A;  2OPS A;  4DS4 A;  1Q9Y A;  2YCH A;  3BZC A;  3TU5 A;  3OBY A;  3DLL L;  5I42 A;  4CK3 A;  2FBY A;  3H46 O;  4H4O A;  4C23 A;  4FLV A;  4OO1 J;  1RT6 A;  3CQY A;  3HBT A;  3H3N O;  4ISG A;  4JKA A;  3UE5 A;  3NVM A;  3CC4 N;  3QEW A;  4MDB A;  4A57 A;  1ASU A;  3BF1 A;  5HL7 L;  2YNF A;  4FO0 A;  4KFB A;  4KH6 A;  5KQ8 A;  3NH0 A;  3VF2 A;  3VMF B;  4OKK A;  3VQQ A;  4KRE A;  4BRM A;  3BF3 A;  1RT5 A;  2BTF A;  4FXD A;  3BP8 A;  4QS8 A;  3OYM A;  4B8C A;  4DTU A;  1YF5 L;  2P9K A;  3OYL A;  2ZJP L;  3CET A;  3CHW A;  3ZSV A;  4C8M A;  3O80 A;  4HCB A;  4XH5 A;  3FZL A;  4B3O A;  2O8C A;  3AGR A;  5K14 A;  3LAN A;  2G8F A;  4PL8 A;  1TL1 A;  4R5P A;  4DCH A;  4WE1 A;  1V4T A;  4KPY A;  1JCE A;  4JRQ A;  1VQ5 N;  3LP1 A;  3BZK A;  4CGI A;  2IIR A;  3CJ1 A;  4BG8 A;  5C25 A;  4FWN A;  1ZYQ A;  4DV0 K;  3CJC A;  1EWR A;  1JLA A;  3KK3 A;  1RDB A;  3CD6 N;  1JKH A;  4A61 A;  2ZE2 A;  1VHX A;  4PL7 A;  2HOE A;  4DB3 A;  3ZSX A;  4EP4 A;  5BRF A;  2GEM A;  4YOR A;  5SZT A;  3AV9 A;  3MMV A;  5AQM A;  3CFO A;  1EQY A;  1VSF A;  4DQR A;  4CJW A;  4JN4 A;  3G0Z A;  4DR5 K;  1K6Y A;  3SAF A;  5C12 A;  1M1K O;  2E2P A;  1ATN A;  3ULE A;  3VQA A;  1FW6 A;  3T7Z A;  4BDP A;  3O5B A;  3NE6 A;  4BC3 A;  4LD0 A;  2NLX A;  4ILG B;  5CR4 A;  1Q18 A;  3FGU A;  4JNE A;  4M41 A;  3G71 N;  3F9M A;  1XC9 A;  4JD2 A;  4N47 A;  1FK9 A;  5AR0 A;  3CCS N;  3IUC A;  4DSF A;  4HTL A;  1QS4 A;  4E1M A;  4DQQ A;  1JLE A;  1VQL N;  1ZBI A;  1RT2 A;  2PAV A;  3OYC A;  1J9A A;  1BCO A;  4PUO A;  3ZT0 A;  4JI8 K;  4HTU A;  3OYB A;  1OH8 A;  3I8D A;  3VQP A;  1EWQ A;  1BI4 A;  3MEE A;  3CMA N;  3RVC A;  3HPH A;  2YNG A;  4IEE A;  5M1Q A;  3SQ4 A;  2P51 A;  5C42 A;  3L2Q A;  2RF2 A;  4A5B A;  1RTH A;  3OTO K;  2HND A;  4CJL A;  1RT3 A;  2FLO A;  2OA8 A;  5AQR A;  1IKW A;  2UXD K;  4LF7 K;  2QXL A;  5DMR A;  2ETJ A;  5M1F A;  4O8U A;  1WLJ A;  4ELT A;  5CY4 A;  3DLK A;  4B9V A;  2D0P A;  3QEI A;  2HHV A;  2GEL A;  4CJ5 A;  2O8F A;  3M1F A;  4KHU A;  2AJQ A;  3CPW M;  4EP5 A;  3DMJ A;  2F9W A;  4JEP A;  3SQ0 A;  4LC9 B;  4CZK A;  4EZ6 A;  5CHI A;  5I3U A;  4CGG A;  2OPR A;  5KI6 A;  2J4R A;  3Q7C A;  1VQ6 N;  5JLH A;  3AVN A;  2KTQ A;  1C0T A;  1R59 O;  5AZI B;  1XHX A;  3L4Q A;  3QFU A;  3G4S N;  1GOA A;  1X9W A;  5HP1 A;  4NYF A;  3ZT1 A;  4JHD A;  4AHV A;  4Y1D A;  5E41 A;  3T1Y K;  1NGG A;  4BC2 A;  1NGD A;  3ZET B;  1KLM A;  3D45 A;  2E6L A;  3K5N A;  2F8T A;  1HNI A;  1D4X A;  2A3Z A;  1QE1 A;  2AA4 A;  3ID8 A;  4CZF A;  4B9Q A;  2QWL A;  3CQ8 A;  1OVQ A;  4BRK A;  2XY7 A;  3V4I A;  4DFK A;  5B8H A;  3ENH A;  2R7Y A;  1ESV A;  3ZEU B;  5J2N A;  5MLC Q;  1C0M A;  3OBW A;  2DPN A;  2JWK A;  5JIC A;  2YHW A;  4H4M A;  5F2R A;  3KD1 E;  1N32 K;  4H5N A;  4CBU A;  3EE8 A;  3AAP A;  4WFA L;  2FF3 B;  3AGK A;  3M8Q A;  4M3Y A;  4B1Z A;  5TKY A;  4KTZ A;  4CEF A;  1D9F A;  4JS5 A;  1BGX T;  1UAX A;  4B1U B;  1BU6 O;  4PA1 A;  3L2U A;  5LY3 A;  1GLE G;  3HP6 A;  4IBN A;  3HI0 A;  1GOC A;  3AA4 A;  4C1N K;  1YTU A;  3VTH A;  2PBD A;  2GWJ A;  4FK0 A;  2XY6 A;  4DU3 A;  3HT3 A;  3CYM A;  1U2V A;  2WBN A;  3TTD A;  4HWI A;  3FR0 A;  3S3M A;  1NK7 A;  5BN9 A;  1FXX A;  2VG6 A;  4CBW A;  1KAZ A;  4K8X A;  3RMB A;  4IG0 A;  2IS3 A;  4BDY A;  5BN8 A;  2EWS A;  4QS7 A;  2XHB A;  3V9X A;  2HHH K;  3SNN A;  1JCG A;  3KTQ A;  5HRR A;  5AQS A;  2P9L B;  2HHT A;  4U7B A;  2Y1I A;  1WBB A;  2DY4 A;  3CC7 N;  3K9J A;  1LWF A;  1Y97 A;  4JI0 K;  3EY1 A;  4A59 A;  4FJ7 A;  2HBK A;  2HF4 A;  4JI2 K;  5AQL A;  4FOI A;  4BRA A;  3CCE N;  4O8K A;  2QI2 A;  1BIS A;  3MWT A;  4JI7 K;  1X9J A;  1NMD A;  2IGI A;  1K9M O;  1F21 A;  2WC9 A;  1NNE A;  5KQD A;  4I6M A;  4CE9 A;  2P5O A;  1IO2 A;  4K43 A;  4BWJ A;  1BQN A;  2ZD1 A;  3NBP A;  4DTX A;  5AQG A;  1VQ7 N;  2QEX N;  4MDA A;  4CIE A;  3ENO A;  1NK4 A;  4DR4 K;  3AAQ A;  3EO3 A;  4E7L A;  4YOW A;  3G6E N;  5D3G A;  3CC2 N;  1TUY A;  2O8E B;  1BL3 A;  4JLH A;  3OJS A;  4CF1 A;  3HPO A;  3LP3 A;  2D0B A;  3C6U A;  3ATU A;  4FK2 A;  2NNW A;  4CEQ A;  3SI6 A;  4HVJ A;  3FLC O;  1DT9 A;  2ZF5 O;  4LF8 K;  3BDP A;  4M3W A;  3HYF A;  1S1V A;  5AQJ A;  2P9N B;  4QOZ B;  3C7N B;  2YNH A;  5FPE A;  3HPG A;  4MLH A;  3VEW A;  5AJ3 K;  3LAK A;  4CVN E;  1RBT A;  4DV3 K;  2OPP A;  4LFB K;  4OPK A;  2P9I A;  4BY9 C;  2HHU A;  2E20 A;  3BUZ B;  1CLQ A;  3V1Q A;  2OPQ A;  3QEP A;  1KAY A;  4DKW A;  4CEC A;  5BRE A;  5IWA K;  1O1W A;  1N36 K;  5C0Y A;  2LSN A;  1YI2 N;  4ILH A;  2VQF K;  4ELV A;  1RNH A;  4DTO A;  3O08 A;  4IXC A;  3TAM A;  4WQ4 A;  4DV2 K;  1VSM A;  2KZZ A;  2XY5 A;  1HYZ A;  3B6O A;  3MXJ A;  1WSF A;  2BDP A;  2Q31 A;  4CIG A;  4EHU A;  1KD1 O;  5HRP A;  4IFE A;  3NF6 A;  4JKF A;  4H0X B;  2YHY A;  1XUP O;  1X9S A;  4RW6 A;  2CGL A;  1NU0 A;  1MWK A;  3H3O B;  2EX3 A;  2E4L A;  2FBX A;  3UKR A;  1S5J A;  3IMX A;  4OKE A;  5LL6 Z;  4E19 A;  3UKU B;  3D7E O;  1SZ2 A;  4FJK A;  4EHT A;  1MU2 A;  3MXI A;  3AVM A;  1SKR A;  1YXQ A;  3MX2 A;  4PKG A;  1NM1 A;  3KIO A;  4BRD A;  1SS6 A;  2P9S A;  3D2F B;  3OYN A;  1KTQ A;  1GLL O;  4LF9 K;  4KO0 A;  5AQY A;  5HRO A;  3KJV A;  5AQH A;  4B1X B;  3J7Y P;  4FPB A;  3L2V A;  1X3N A;  2VG5 A;  1NJZ A;  3PX6 A;  3TSU A;  4CJK A;  4DUY K;  1J5O A;  3LDN A;  3KK1 A;  4BRO A;  4JI6 K;  3SYZ A;  4E89 A;  3HM9 A;  4E3S A;  2GWK A;  4B9T A;  4A62 A;  3T1A A;  1YVN A;  2A1S A;  1KSP A;  1KC8 O;  3AA3 A;  4WQ5 C;  1QZ5 A;  4JI1 K;  3V6D A;  1VSH A;  3P4I A;  1HX1 A;  2OCE A;  4B9N A;  1JXE A;  3CCQ N;  3CME N;  4IJN A;  1A5X A;  3M3Z A;  4PY5 A;  1LW0 A;  2JLE A;  4MFB A;  1T03 A;  1Q9X A;  4KTQ A;  2BUP A;  2CGJ A;  1NK0 A;  4DSI A;  2PY5 A;  1M90 O;  3SCX A;  4BE1 A;  1QSL A;  3D2E B;  4JI4 K;  3TTC A;  4W5T A;  4LH4 A;  2QTD A;  4NYN A;  4GKJ K;  3DXK A;  5BPM A;  2CH5 A;  3K5O A;  4NB4 A;  1WSG A;  4DV1 K;  3NGZ A;  3L0Q A;  3ITH A;  3AA5 X;  1NLV A;  1MA9 B;  4Z4C A;  3THX A;  4IJA A;  3AVJ A;  3DI6 A;  1CZB A;  3P39 A;  3AVI A;  4B3R K;  3VA0 A;  1I39 A;  4W5N A;  3CQX A;  2X6N A;  4B1V A;  3EEQ A;  3PO4 A;  3NGY A;  2NZT A;  2HNY A;  4DTS A;  4C8N A;  1WBD A;  1T6D A;  5GAE P;  5GIP A;  2IC3 A;  4B9M A;  1ZXO A;  4X62 K;  3RRH A;  1YVU A;  2E1Y A;  5AQO A;  2E1Z A;  3A0I X;  3M8S A;  3U9Z A;  2UUC K;  3WXJ A;  5FRO A;  3AVF A;  3SAH A;  1VQ8 N;  4IOA L;  3O4Q A;  2W6K A;  4B9L A;  2CH6 A;  1QSY A;  3AO5 A;  4GV9 A;  4K8Z A;  1HLU A;  2A1R A;  1OKJ A;  3VQ8 A;  4CHO A;  1LOT B;  2FBV A;  4F2S A;  1REV A;  3AO3 A;  5EVZ A;  1SKS A;  3P1G A;  3VF4 A;  3QET A;  4B9S A;  3VQD A;  4BAC A;  3K5L A;  3QDK A;  3HO1 A;  3TSP A;  1RDC A;  1S1U A;  3WQT A;  5J2Q A;  3LP2 A;  3TTF A;  4R79 A;  1NK5 A;  2B6A A;  1KLN A;  4FW2 A;  3PSI A;  3GBT A;  4JK9 A;  1KCF A;  3OJU A;  4E7I A;  1WSH A;  3KK2 A;  3EKU A;  3SQ2 A;  3CER A;  4FL9 A;  5CE3 A;  3MN5 A;  2Z1J A;  3EKS A;  4CZI A;  3CCJ N;  4DR7 K;  4Z4E A;  2W41 A;  4CEE A;  3RMD A;  3P5J A;  4IO9 L;  1BOT O;  2VWB A;  3VQC A;  3J81 O;  5A2Q O;  3DJC A;  3WNH A;  2ZGY A;  1NGJ A;  3SV4 A;  1D9D A;  3QML A;  1GLC G;  4J2E A;  3SUQ A;  2P9K B;  3I0S A;  1JL1 A;  3ZSQ A;  3D6R A;  2EHG A;  3VA3 A;  4YOT A;  1NJI O;  1OH7 A;  4DU1 A;  2O8C B;  1Z6R A;  1RDU A;  3VES A;  4YOX A;  4ZTJ A;  3V1R A;  1NG9 A;  2FBT A;  3IAY A;  5LMN K;  1QHT A;  3E9O A;  1RBS A;  3SUO A;  2ZM6 K;  2A42 A;  3DWL A;  4DS5 A;  4JAX A;  3HZ6 A;  1UWB A;  3THY A;  4H8K A;  3ATV A;  4BVP A;  3QIN A;  1VSD A;  4JI5 K;  3MN9 A;  4CIF A;  2IVP A;  5T7B A;  1BA1 A;  2DFE A;  4FLW A;  2VG7 A;  3OW2 M;  2F8S A;  2HW3 A;  3IRX A;  1KXP A;  5AQQ A;  5EY4 A;  3HXM A;  2CGK A;  5C2F A;  3R1X A;  4OX9 K;  2KHO A;  4DSL A;  4IZ9 A;  3O3G A;  1TL3 A;  4DR3 K;  3OS0 A;  1NGH A;  2OYQ A;  1BA0 A;  3SPZ A;  4FZZ A;  4GW6 A;  4DTN A;  3I8B A;  3ULE B;  2F96 A;  1K8K A;  4B3M K;  1W9H A;  1QTM A;  4AHT A;  4CJV A;  2YNI A;  3O9Q A;  1ZBS A;  3DRP A;  3VQB A;  5GAG P;  4LF5 K;  3DRR A;  4JD2 B;  3LWM A;  3RMA A;  1YJW N;  1ZBF A;  3LDS A;  4Z4F A;  4FJN A;  3CXC M;  4FJ8 A;  1ITG A;  4BQL A;  3DLB A;  1NJX A;  3ULD A;  1WNS A;  1SUQ A;  2ATQ A;  2P9P A;  3AVC A;  1D8Y A;  2FF6 A;  4BRG A;  4OPJ A;  3UIQ A;  4FM2 A;  4M3R A;  1BI4 B;  3QER A;  3ZSY A;  3V1O A;  3IG1 A;  3PIO L;  1CXU A;  3DOL A;  4AF1 A;  1NWK A;  5F1X A;  4H0Y B;  4IFV A;  4F3T A;  1SL2 A;  4YDU A;  5C24 A;  4CJ4 A;  2RPI A;  2QXF A;  3H08 A;  4KH5 A;  4XEI A;  3C6H A;  2VCP A;  3VQ9 A;  4GKK K;  4FW1 A;  5AQF A;  3SMP A;  2O8F B;  3LAM A;  1B9D A;  4N41 A;  4CJR A;  3DXM A;  2E88 A;  3MN7 A;  4RW9 A;  4C8O A;  3CPE A;  1RGI A;  3PY8 A;  1HRH A;  3PSF A;  3TPQ A;  1RBV A;  2ASO A;  3KKS A;  2G8U A;  4CEB A;  1NGE A;  2F9T A;  4CFB A;  2G8I A;  1S1X A;  3TAP A;  2KFZ A;  5FRM A;  1ZBH A;  1WUA A;  2G8H A;  4KRF A;  5JS1 A;  1U47 A;  2I5J A;  2E5L K;  4CFD A;  4CZG A;  4HUE A;  1RDD A;  5AFU H;  2W6L A;  4JHD B;  4O44 A;  5FPD A;  3VEN A;  4FJH A;  3C95 A;  4DV7 K;  2O8B A;  3AVK A;  1IBL K;  4LSL A;  4KKO A;  4DV5 K;  3U8X A;  4GVE A;  2GBZ A;  3JSM A;  1IH7 A;  3HK2 A;  1HMV A;  3KLI A;  2HMP A;  4OLB A;  1NMN A;  4Z4G A;  4YFU A;  2Z1G A;  1WAJ A;  4NCB A;  4FWR A;  1TAU A;  3HTV A;  3RWU A;  3M6G A;  4JKD A;  2ZWH A;  3QO9 A;  4BC4 A;  4JYA K;  1JLB A;  1LW2 A;  4F4K A;  2H3G X;  3OYI A;  1YJ9 N;  3O9U A;  2VWJ A;  3FE1 A;  1SAZ A;  2GX9 A;  3EL2 A;  3L2W A;  3G10 A;  2NRR A;  3L3U A;  1UA0 A;  3MDQ A;  4CZH A;  1IBM K;  4KB0 A;  1B9F A;  2Q0U A;  1HQU A;  1IKX A;  5CZ1 A;  4OGE A;  5GIN A;  3VEX A;  3N4P A;  1U2V B;  3K9K A;  3EZW A;  3PV8 A;  2HST A;  4LY7 A;  4C8K A;  4FJM A;  1YUW A;  1RCH A;  1G15 A;  5HOO A;  2NRT A;  5EXW A;  1N34 K;  3LPU A;  4L8R B;  2QKB A;  1E3M A;  3AVL A;  1A5V A;  4NCA A;  3HVT A;  4K25 A;  4PKI A;  4JKC A;  3OYG A;  4FWL A;  2VYP A;  1XC3 A;  2F4V K;  3HJF A;  4WFB L;  4GMJ B;  1IJJ A;  1GOB A;  3A5O C;  3NCI A;  3AO2 A;  1YTA A;  4IG3 A;  4DSE A;  4AHC A;  3E1Y A;  2P9U A;  3DM2 A;  1HNV A;  2KW4 A;  4CK2 A;  1T8E A;  1Q86 O;  2KZM A;  3EYZ A;  3FZM A;  4I6M B;  3R6M A;  1ILY A;  2BE2 A;  2O4G A;  5HRN A;  2OTL N;  3SV3 A;  3K2P A;  1KVA A;  4RW7 A;  4CJS A;  4DR1 K;  4FYD A;  3SAG A;  3JXU A;  3LWL A;  1TUU A;  3ISN C;  1Y64 A;  4DR2 K;  2D1K A;  4BC5 A;  3K59 A;  4BRL A;  1ZC6 A;  1J5E K;  4BRQ A;  4CHN A;  4FJG A;  2QW9 A;  4KHW A;  1BO5 O;  4IWV A;  3VER A;  4DR6 K;  4YOY A;  3SLC A;  1NKC A;  1SQK A;  2I7N A;  4H5R A;  4DWI A;  1NKE A;  1NGF A;  1GLJ O;  4KB1 A;  3NAE A;  4CHQ A;  4G9Z A;  2Q36 A;  1VRU A;  1RFQ A;  4BR4 A;  3CJ9 A;  2FC0 A;  2E2N A;  3K58 A;  1K73 O;  3C6A A;  1TYQ A;  2YJE A;  1FJG K;  2BAN A;  2JWL A;  2QWQ A;  1N8R O;  3QES A;  3FZH A;  3O9S A;  3S9H A;  3HP9 A;  3MWP A;  2DFH A;  3KZB A;  5ADX H;  4LH5 A;  3Q7B A;  3S3N A;  3ZT4 A;  2QWO A;  3HOS A;  2FSK A;  1BCM A;  4DF4 A;  3VET A;  3QLH A;  1HNZ K;  1GLB G;  2P9I B;  2D0A A;  4MO5 A;  4CJP A;  5KPZ A;  1U4B A;  3L2R A;  3ASM A;  4Z94 A;  3MN6 A;  3PX4 A;  4ID5 A;  3F2K A;  3MX5 A;  1VQM N;  3R3L A;  3VGL A;  3HM8 A;  3OA9 A;  5FPM A;  1L3T A;  1SL1 A;  4FWM A;  5JVH L;  4I2Q A;  4BR7 A;  4BRF A;  3WEE A;  3MCP A;  4DQP A;  1NK9 A;  4LF6 K;  3E66 A;  1S9G A;  3F73 A;  3K5M A;  5EX5 A;  3WXK A;  1EO1 A;  4ISE A;  2NRX A;  2UYT A;  3LDP A;  3RMC A;  2D0C A;  5BR9 A;  4F3O A;  5CYQ A;  4CHP A;  4B8A B;  1MWM A;  4H5T A;  4BG9 A;  1QHA A;  4EAH D;  4RW4 A;  4M3Z A;  4DV4 K;  3MEG A;  1D5A A;  3PX0 A;  2ITM A;  1TKZ A;  3CFP A;  3TR8 A;  3CJB A;  3UKR B;  4CCH A;  3GOI A;  4Y0W A;  2VQE K;  3TAB A;  2QM1 A;  4XH1 A;  1RDW X;  2Z1H A;  3LM9 A;  2P9S B;  2XY8 A;  5DM6 L;  4E0D A;  4CK1 A;  2ASP A;  5KPR A;  5DK5 A;  1JCF A;  4WYB A;  1W2B M;  4K42 A;  4A2B A;  1JLC A;  3TAF A;  4L3Q A;  1KFD A;  3B6P A;  1HPZ A;  2JGU A;  1IKV A;  5HRS A;  4BRP A;  1XQS C;  5EU7 A;  4YY3 K;  5F0X A;  4FK4 A;  4CBX A;  4BR5 A;  5AZJ A;  1BIZ A;  3C6T A;  3VQ7 A;  1RTI A;  1CXQ A;  4FWP A;  3WQU A;  3MXM A;  1OH6 A;  3NHG A;  3ZSW A;  3T3F A;  1X3M A;  2AP1 A;  3SUP A;  2QWM A;  3NH1 A;  1S1W A;  4DSJ A;  2O8D A;  1S1T A;  3DXK B;  4BWM A;  1KVB A;  1TAQ A;  3CG7 A;  1S6Q A;  5LMU K;  3T69 A;  3PIP L;  4JK7 A;  1E4F T;  5M1N A;  3THX B;  3U9D A;  4WCE L;  1LAW A;  1S6P A;  1BQM A;  2B5J A;  4DQI A;  2Q1N A;  3WXI A;  3VGM A;  1BWF O;  3THW A;  1G99 A;  2I7P A;  3ZT2 A;  1P8Z A;  1N6Q A;  4JKH A;  3O1B A;  3O1W A;  4KBO A;  3NGI A;  1TK0 A;  1ZBL A;  2KLA A;  2NUB A;  1U45 A;  4K41 A;  2A40 A;  4JK8 A;  1T44 A;  1L3S A;  3CM6 A;  1FKP A;  2ZQB A;  3OS1 A;  3HRG A;  3AA2 A;  4J2A A;  3P83 D;  4Z0U A;  2Z1I A;  4M45 A;  2OZS A;  4DG1 A;  4CJQ A;  3U4L A;  3QBW A;  4DHY A;  4NXN K;  2IVO A;  3M8P A;  4BRI A;  2E8A A;  3FFI A;  3QIO A;  3FZK A;  1IKY A;  1KQS M;  3O6W A;  4N56 A;  2ZJQ L;  4GNI A;  1QQO A;  4M3T A;  4CHY A;  4JV5 K;  2NRH A;  4B1Y B;  1XMQ K;  4W5Q A;  4HHT A;  4FZY A;  2VGM A;  2Q97 A;  4EIA A;  2A41 A;  2G8V A;  2HF3 A;  4CJ3 A;  5J2M A;  2YV0 X;  4FJI A;  5CYM A;  1QQC A;  4CW7 B;  5LJW A;  3UB5 A;  1QSS A;  3SJJ A;  1T05 A;  3GL1 A;  4ISF A;  3DLG A;  2HBL A;  4JS4 A;  4LFC K;  1GLD G;  1NJY A;  3RSE A;  4F9O A;  4Z4H A;  3DLH A;  4CJT A;  3THV A;  3KLG A;  4FLY A;  4A5A A;  4JKG A;  4F8R A;  1VQ9 N;  1J54 A;  1C0U A;  4CJ7 A;  1NK6 A;  1BG3 A;  2G8W A;  3ZLJ A;  2FXU A;  3E9L A;  5C2D A;  3K57 A;  4FLT A;  4CZL A;  4KHY A;  1HKG A;  3MEC A;  1I3A A;  5AQX A;  4CD1 A;  2GV9 A;  4AHU A;  2RN2 A;  3L8B A;  3KWG A;  4QAG A;  4RTF D;  4DSK A;  4ICL A;  5AQP A;  4FJL A;  3A5N C;  4CGH A;  3T19 A;  4WF9 L;  3VEZ A;  1P90 A;  1XMO K;  4CJU A;  1Z26 A;  2YKN A;  1NGC A;  5GIO A;  2HBM A;  3WXM B;  1H1V A;  3THY B;  1HKB A;  4H03 B;  4YNQ A;  4NCG A;  1CZ9 A;  1TGO A;  4I7F A;  5H1S Q;  3P38 A;  1S22 A;  3VEV A;  4CGD A;  3OYE A;  3JAM O;  3CI5 A;  3NVK A;  4AQY K;  5AQZ A;  5BR8 K;  4IFY A;  1B92 A;  1J6Z A;  2RE2 A;  4LSN A;  3I33 A;  4E1N A;  1LWE A;  3G25 A;  1HQE A;  4AM7 A;  4IDK A;  2A6A A;  3A8Y A;  5JLF A;  1U6Z A;  2YHX A;  1RIL A;  3TAR A;  1YT3 A;  5AQT A;  2WTU A;  3SZ2 A;  3BEX A;  1K8K B;  5EOY A;  1YHQ N;  4NO7 A;  4CZM A;  4BE2 A;  2Q2R A;  4E7K A;  4WFN L;  1WSE A;  5E84 A;  3AVB A;  3AAR A;  2VWK A;  4BDZ A;  4CGF A;  1N5Y A;  4N5S A;  1LAV A;  3TAG A;  1V4S A;  1EXQ A;  1Z25 A;  2Q0R A;  5KRS A;  1C1C A;  3D0P A;  1DTQ A;  1GLA G;  4YOV A;  2PYL A;  1HYS A;  4CED A;  2P9P B;  3KVG A;  3V81 A;  1C1A A;  2HVH A;  1IV0 A;  2WOM A;  3LPT A;  4WQ4 C;  2QKK A;  4KI4 A;  3QBX A;  2DTU A;  1R0A A;  5FRN A;  4KTW A;  1HJO A;  1WOQ A;  4DTP A;  5KPT A;  3CCL N;  4CES A;  5BRD A;  2UUA K;  1NOY A;  4C1N I;  3ENB A;  4W5R A;  4YOU A;  4EFH A;  3NFA A;  4RWT A;  4CF0 A;  3O3H A;  4PKH A;  3H1Q A;  4DQS A;  4BE0 A;  3VQE A;  1C6V A;  3I0R A;  4ZTF A;  3F5T A;  3OYH A;  1QVF M;  3J80 O;  1RDA A;  4PQU A;  3VF6 A;  4O0J A;  1BHL A;  1XNQ K;  4M7Y A;  3FZF A;  3DXM B;  1VSK A;  4F2R A;  4JKB A;  4IOX A;  3TAQ A;  3VTI A;  1QQN A;  3AVH A;  3BGR A;  3CM5 A;  4CI6 A;  2HHW A;  3MK6 A;  3OYD A;  5GAH P;  3U3Y A;  4M3U A;  1HNW K;  4E7H A;  3OS2 A;  4DFP A;  3TWH A;  1DTT A;  2HMI A;  5CZ2 A;  1L3U A;  4KHN A;  5FPN A;  5M1O A;  4OPH A;  5HLF A;  1JLF A;  1IG9 A;  3KD5 E;  3EN9 A;  4CFC A;  4FJ9 A;  3TAN A;  1JLG A;  1RTJ A;  2O8B B;  1A5W A;  4OGC A;  1NGI A;  1OH5 A;  3NH2 A;  4OJR A;  4AM6 A;  1X9M A;  1RBR A;  3MCA B;  1VSE A;  3RR7 A;  3E01 A;  1RBU A;  2PZS A;  4V19 S;  4PWD A;  2QWP A;  3QEV A;  4IKF A;  4KHQ A;  3SBG A;  3A5L C;  3KWI A;  3L3V A;  3HL8 A;  4N76 A;  3CIP A;  1BIU A;  5C15 A;  2NRZ A;  4O5F A;  2YX6 A;  4FJX A;  1WSI A;  3O8M A;  4FVM A;  4O55 A;  1HYV A;  3JS6 A;  2YHB A;  4FWK A;  4XIU A;  5M1P A;  4RG8 A;  2GUP A;  2XO7 A;  1TK8 A;  2X6S A;  4FWS A;  1SV5 A;  3RRG A;  2ASM A;  1U04 A;  4WQ5 A;  3HST B;  4H0V B;  4CFA A;  3FFK B;  3VN5 A;  2Q3S A;  3H1V X;  3AY9 A;  2YKM A;  4G1Q A;  5KTQ A;  4Q5V A;  4FJ5 A;  2V7Z A;  4B08 A;  1QVG M;  1K8A O;  4JRP A;  3DYA A;  3J7Z O;  4BR9 A;  4DMN A;  3AVA A;  4MO4 A;  4O0I A;  4IOC L;  1VSI A;  4CER A;  4CZJ A;  4FLZ A;  1WAF A;  5JMV A;  3NDK A;  2G8K A;  2XRI A;  2E2O A;  1NBW A;  4FOE A;  1BUP A;  3IS9 A;  5AZI A;  1HR0 K; 
#chains in the Genus database with same CATH homology
 3ZSZ A;  3RRH A;  1YVU A;  1S9G A;  3F73 A;  3K5M A;  3ZSX A;  4EP4 A;  3TI0 A;  4M3X A;  3M8S A;  4QCL A;  1JLQ A;  5SZT A;  5FRO A;  3AV9 A;  3AVF A;  5JS2 A;  3M8R A;  3CFO A;  3RMC A;  4DU4 A;  4FJI A;  2D0C A;  1VSF A;  3O4Q A;  4DQR A;  4F3O A;  5CYQ A;  4CJW A;  3QNN A;  1HJR A;  4CHP A;  1QSY A;  4B9L A;  4B8A B;  3AO5 A;  4KI6 A;  3G0Z A;  4RW4 A;  4DF8 A;  4M3Z A;  3MEG A;  1K6Y A;  3LP0 A;  1D5A A;  1KVC A;  3OYJ A;  3PX0 A;  4K8Z A;  1TKZ A;  3VQA A;  3A2F A;  3TR8 A;  3CFP A;  2A1R A;  4BDP A;  3VQ8 A;  4CCH A;  4CHO A;  3NE6 A;  2FBV A;  4F2S A;  3TAB A;  1REV A;  4LD0 A;  4DLE A;  4HUG A;  2HB5 A;  3AO3 A;  2Z1H A;  4M41 A;  1SKS A;  3P1G A;  1XC9 A;  4N47 A;  2XY8 A;  1FK9 A;  3DOK A;  4Y1C A;  2Y1J A;  4E0D A;  3QET A;  4B9S A;  3VQD A;  4CK1 A;  4DSF A;  4E1M A;  1QS4 A;  4BAC A;  4DQQ A;  1NOZ A;  3AVG A;  3K5L A;  1JLE A;  3HO1 A;  1RDC A;  1ZBI A;  5DK5 A;  1S1U A;  2P5G A;  1RT2 A;  5J2Q A;  1W0H A;  3LP2 A;  3OYC A;  1JLC A;  3TAF A;  1NK5 A;  2B6A A;  4CF2 A;  1J9A A;  1BCO A;  1KFD A;  3B6P A;  1KLN A;  4PUO A;  4FW2 A;  4CJF A;  2HVI A;  3ZT0 A;  1HPZ A;  2JGU A;  1IKV A;  1KCF A;  5HRS A;  3OJU A;  4HTU A;  4E7I A;  1TKD A;  3ZT3 A;  4B9U A;  3OYB A;  1WSH A;  5EU7 A;  3KK2 A;  3I8D A;  3SQ2 A;  4FK4 A;  4KAZ A;  3VQP A;  1TK5 A;  1BI4 A;  3MEE A;  3V9W A;  1BIZ A;  3C6T A;  2Z1J A;  5FDL A;  1RTI A;  1CXQ A;  2YNG A;  3HPH A;  3VQ7 A;  3WNF A;  4DLG A;  4Z4E A;  4CEE A;  3SQ4 A;  2P51 A;  5C42 A;  4DFM A;  3RMD A;  3P5J A;  3L2Q A;  1RT7 A;  2RF2 A;  3MXM A;  1RTH A;  2HND A;  2O4I A;  4CJL A;  3VQC A;  1RT3 A;  2OA8 A;  1IKW A;  2WON A;  4O4G A;  3NHG A;  3WNH A;  3SUN A;  1EP4 A;  5DMR A;  3ZSW A;  2ETJ A;  3T3F A;  3SV4 A;  4DTM A;  2D5R A;  1D9D A;  4J2E A;  3SUQ A;  1WLJ A;  3SUP A;  3NH1 A;  5CY4 A;  1NKB A;  4ELT A;  3DLK A;  4B9V A;  1S1W A;  3I0S A;  1JL1 A;  3ZSQ A;  3QEI A;  4DSJ A;  2HHV A;  1S1T A;  2EHG A;  1LWC A;  2ITG A;  3WNG A;  3VA3 A;  4CJ5 A;  4BWM A;  4DU1 A;  3LZI A;  1KVB A;  1TAQ A;  4KHU A;  4AIL C;  2AJQ A;  2GUI A;  3CG7 A;  3RR8 A;  1TV6 A;  4EP5 A;  3DMJ A;  4OLA A;  4ZTJ A;  3SQ0 A;  1S6Q A;  3V1R A;  1FKO A;  4OVL A;  2FBT A;  3IAY A;  1WN7 A;  5SWM A;  1QHT A;  3V9S A;  4EZ6 A;  1RBS A;  3SUO A;  4DS5 A;  4GVM A;  5I3U A;  3DLR A;  4CGG A;  2OPR A;  4AH9 A;  1LAW A;  1S6P A;  1BQM A;  2B5J A;  5KI6 A;  1UWB A;  4DQI A;  1VSJ A;  3DLH A;  4H8K A;  3QIN A;  3AVN A;  1VSL A;  1VSD A;  2KTQ A;  1C0T A;  3ZT2 A;  2IOC A;  4FZZ A;  1N6Q A;  4CIF A;  5T7B A;  4FLW A;  2DFE A;  1XHX A;  2HW3 A;  2VG7 A;  2F8S A;  3NGI A;  3IRX A;  1TK0 A;  1GOA A;  1ZBL A;  1X9W A;  4CEA A;  5HP1 A;  4NYF A;  3ZT1 A;  3HXM A;  2NUB A;  4AHV A;  1EKE A;  1Q8I A;  1U45 A;  2KFN A;  4DSL A;  4Y1D A;  5E41 A;  4I9L A;  3O3G A;  1TL3 A;  3OS0 A;  3ZCM A;  1L3S A;  1KLM A;  3CM6 A;  1JXB A;  1FKP A;  4AHR A;  3D45 A;  2OYQ A;  2E6L A;  2ZQB A;  3OS1 A;  3V9Z A;  3AA2 A;  4J2A A;  3ZSO A;  4DTJ A;  3P83 D;  3SPZ A;  4Z0U A;  2Z1I A;  1EX4 A;  4GW6 A;  4M45 A;  3K5N A;  1HNI A;  4DTN A;  1KFS A;  2OZS A;  2F8T A;  4DG1 A;  4CJQ A;  1RTD A;  1U49 A;  1QE1 A;  1XWL A;  2F96 A;  4TSX A;  3CQ8 A;  1W9H A;  1QTM A;  3M8P A;  4AHT A;  3KLF A;  3FFI A;  3QIO A;  1SKW A;  4DTR A;  1ASV A;  2XY7 A;  1IKY A;  3WNE A;  4DFK A;  4CJV A;  3V4I A;  2YNI A;  4N56 A;  2R7Y A;  3DRP A;  4M3T A;  4CHY A;  5J2N A;  3VQB A;  3OY9 A;  5KGX A;  1C0M A;  4W5Q A;  4M42 A;  3DRR A;  4HHT A;  3LWM A;  3RMA A;  4FZY A;  1ZBF A;  4H4M A;  1TKX A;  3KD1 E;  3MAQ A;  3LDS A;  4Z4F A;  4FJN A;  4FJ8 A;  4CF9 A;  1ITG A;  3LAL A;  3DLB A;  4M3Y A;  3M8Q A;  1NJX A;  4EZ9 A;  2G8V A;  3ULD A;  3TAN A;  3DLE A;  1WNS A;  1SUQ A;  4CJ3 A;  4KTZ A;  4CEF A;  2YV0 X;  5J2M A;  2ATQ A;  1ZBU A;  3AVC A;  5CYM A;  1QQC A;  3VQ6 A;  3S3O A;  3LZJ A;  1D8Y A;  4JS5 A;  4OPJ A;  1QSS A;  1BGX T;  3U3G A;  3SJJ A;  2IAJ A;  1UAX A;  1DLO A;  3NF9 A;  4AHS A;  1T05 A;  4PA1 A;  4FZX C;  1NJW A;  4I2P A;  3DLG A;  3UIQ A;  3L2U A;  3HP6 A;  4JS4 A;  4FM2 A;  1NJY A;  4IBN A;  4M3R A;  1BI4 B;  1GOC A;  3AA4 A;  3QER A;  1YTU A;  3ZSY A;  3SPY A;  1NK8 A;  3V1O A;  3IG1 A;  1J53 A;  4FK0 A;  4Z4H A;  2XY6 A;  4DU3 A;  3OVN A;  4OKJ A;  1CXU A;  3DOL A;  4CJT A;  3CYM A;  1TVR A;  3HT3 A;  3KLG A;  4FLY A;  3THV A;  4IFV A;  4F3T A;  3S3M A;  1NK7 A;  4F8R A;  4CF8 A;  1SL2 A;  1J54 A;  1FXX A;  1C0U A;  1NK6 A;  3KLH A;  2G8W A;  1VK0 A;  3OYK A;  5C24 A;  4CJ4 A;  2RPI A;  2DFF A;  2QXF A;  3H08 A;  1U48 A;  3K57 A;  2VG6 A;  1LV5 A;  4FLT A;  4DQP A;  4KHY A;  3MEC A;  4FJJ A;  1I3A A;  2BGG A;  1L5U A;  4K8X A;  3RMB A;  2GV9 A;  4IG0 A;  2RN2 A;  3VQ9 A;  4AHU A;  3L8B A;  2QK9 A;  2IS3 A;  4QAG A;  3EZ5 A;  4BDY A;  3O4N A;  4FYD A;  4FW1 A;  4DSK A;  3LAM A;  2XHB A;  5KGW A;  4ICL A;  3V9X A;  3SNN A;  3CFR A;  3KTQ A;  1B9D A;  2RKI A;  4ELU A;  4N41 A;  3F9K A;  5HRR A;  4CJR A;  4FJL A;  4CGH A;  4RW9 A;  2IDO A;  2HHT A;  3T19 A;  3MED A;  4C8O A;  3TAE A;  1KRP A;  1XI1 A;  3C94 A;  3PY8 A;  4HCC A;  3AO4 A;  2Y1I A;  1HRH A;  4CJU A;  2DY4 A;  1Z26 A;  1LWF A;  1Y97 A;  5J1E A;  2YKN A;  1RBV A;  3EY1 A;  3KKS A;  2G8U A;  4CEB A;  1SL0 A;  4FJ7 A;  4YNQ A;  3KKR A;  4NCG A;  1CZ9 A;  1BIS A;  4CFB A;  1TGO A;  1ASW A;  2IGI A;  2G8I A;  4I7F A;  1F21 A;  1S1X A;  3TAP A;  2KFZ A;  2HNZ A;  4J2B A;  5FRM A;  1ZBH A;  2G8H A;  4CE9 A;  4W5O A;  4CGD A;  4KRF A;  5JS1 A;  3OYE A;  1IO2 A;  3U6F A;  2P5O A;  1U47 A;  2I5J A;  4BWJ A;  4CFD A;  4HUE A;  1RDD A;  4IFY A;  4O44 A;  1B92 A;  4LSN A;  3V9U A;  1BQN A;  3C95 A;  4E1N A;  4E7J A;  4FJH A;  1LWE A;  2ZD1 A;  3NBP A;  3AVK A;  4DTX A;  1HQE A;  4LSL A;  4KKO A;  3VQ5 A;  4CIE A;  4IDK A;  2GBZ A;  3JSM A;  1IH7 A;  3HK2 A;  1HMV A;  1RT1 A;  3ZSR A;  1NK4 A;  3KLI A;  4OLB A;  4Z4G A;  1RIL A;  4CEO A;  4YFU A;  4FM1 A;  3TAR A;  2Z1G A;  1WAJ A;  1YT3 A;  3O3F A;  1EET A;  4E7L A;  4NCB A;  1TKT A;  5D3G A;  2B4J A;  3SZ2 A;  1TAU A;  1D9F A;  4FCY A;  3RWU A;  1BL3 A;  4JLH A;  3OJS A;  3QO9 A;  1JLB A;  4BE2 A;  2YHA A;  1LW2 A;  4CF1 A;  4E7K A;  4F4K A;  3AO1 A;  1WSE A;  2X78 A;  3HPO A;  2HHX A;  3LP3 A;  2D0B A;  3PO5 A;  3C6U A;  4FK2 A;  3AVB A;  4CEQ A;  3OYI A;  2VWJ A;  5KRT A;  4HVJ A;  1VRT A;  3SI6 A;  2VWK A;  4BDZ A;  3SQ1 A;  4CGF A;  1N5Y A;  4N5S A;  1LAV A;  3BDP A;  3TAG A;  4DFJ A;  3HYF A;  1EXQ A;  1Z25 A;  4M3W A;  3NF7 A;  5KRS A;  1S1V A;  1C1C A;  3NF8 A;  3L2W A;  4KV8 A;  3D0P A;  3G10 A;  4QOZ B;  4KRE A;  1DTQ A;  4CJE A;  2PYL A;  1HYS A;  4CED A;  2YNH A;  3L3U A;  3V81 A;  3HPG A;  1C1A A;  1UA0 A;  2HVH A;  2WOM A;  3LPT A;  3LAK A;  1RT4 A;  2W42 A;  2QKK A;  1RBT A;  4KI4 A;  2OPP A;  2HHS A;  4OPK A;  4UQG A;  2DTU A;  4KB0 A;  2HHU A;  1R0A A;  1B9F A;  4O5B A;  1HQU A;  5FRN A;  4KTW A;  1CLQ A;  1S9E A;  1IKX A;  5CZ1 A;  4OGE A;  3V1Q A;  2OPQ A;  4DTP A;  4C8L A;  4CES A;  3QEP A;  1NOY A;  4CEC A;  4W5R A;  1O1W A;  5HBM A;  4Z4I A;  4FLU A;  3NFA A;  3PV8 A;  3OYF A;  4LY7 A;  4CF0 A;  4C8K A;  4FJM A;  3O3H A;  2LSN A;  1RCH A;  1JL2 A;  4DQS A;  1G15 A;  4ELV A;  1RNH A;  4DTO A;  4BE0 A;  4MQ3 A;  2PYJ A;  3LPU A;  4L8R B;  4ID1 A;  3TAM A;  1C6V A;  3I0R A;  1VSM A;  1UOC A;  3VQE A;  4ZHR A;  3RTV A;  1T7P A;  2QKB A;  2KZZ A;  3AVL A;  1A5V A;  4FLX A;  2XY5 A;  1X1P A;  1HYZ A;  3HVT A;  3B6O A;  3MXJ A;  4ZTF A;  3OYH A;  4RW8 A;  4NCA A;  1C1B A;  3OYG A;  3JYT A;  4HUF A;  1RDA A;  4CHZ A;  1WSF A;  2BDP A;  4KHS A;  4O0J A;  4PQU A;  4CIG A;  2OZM A;  1BHL A;  5HRP A;  4Q0B A;  3NF6 A;  3HJF A;  1VSK A;  4GMJ B;  4F2R A;  1GOB A;  3DRS A;  3TAQ A;  3QIP A;  3NCI A;  1UA1 A;  3AVH A;  3AO2 A;  4RW6 A;  3BGR A;  3CM5 A;  1X9S A;  1L3V A;  2HHQ A;  2HHW A;  1YTA A;  4IG3 A;  4DSE A;  3ALY A;  3OYD A;  5J2P A;  3U3Y A;  4M3U A;  4FM0 A;  4AHC A;  3QNO A;  2EX3 A;  2E4L A;  3OS2 A;  3KLE A;  2FBX A;  4E7H A;  4J2D A;  1S5J A;  4OKE A;  4CEZ A;  3TWH A;  3PUF A;  4DFP A;  1DTT A;  2P1J A;  3DM2 A;  2HMI A;  1HNV A;  2E6M A;  5CZ2 A;  4E19 A;  3HVR A;  1L3U A;  4KHN A;  1XHZ A;  2KW4 A;  3VQ4 A;  4CK2 A;  1T8E A;  4FJK A;  1MU2 A;  2KQ2 A;  2KZM A;  3EYZ A;  3MXI A;  3AVM A;  3QEX A;  1SKR A;  5HLF A;  1JLF A;  1IG9 A;  1WSJ A;  2X74 A;  3KIO A;  4CFC A;  3KD5 E;  2BE2 A;  2O4G A;  5HRN A;  3OYN A;  1KTQ A;  4CGJ A;  4FJ9 A;  4I9Q A;  3SV3 A;  4KO0 A;  3K2P A;  1KVA A;  4RW7 A;  4CJS A;  3OYA A;  1JLG A;  5HRO A;  1RTJ A;  2OPS A;  3KJV A;  1A5W A;  3LWL A;  4OGC A;  4DS4 A;  1Q9Y A;  3ISN C;  3L2V A;  5I42 A;  2VG5 A;  1NJZ A;  4CK3 A;  3K59 A;  3PX6 A;  2FBY A;  4CJK A;  1J5O A;  3NH2 A;  4CHN A;  3KK1 A;  4FJG A;  4OJR A;  4H4O A;  1X9M A;  4KHW A;  1RBR A;  4FLV A;  1VSE A;  3RR7 A;  3SYZ A;  1RBU A;  4E89 A;  2PZS A;  4PWD A;  3HM9 A;  4E3S A;  1RT6 A;  4B9T A;  1NKC A;  3T1A A;  3QEV A;  4IKF A;  2A1S A;  1KSP A;  4KHQ A;  3AA3 A;  4DWI A;  3L3V A;  3V6D A;  1VSH A;  3QEW A;  1NKE A;  4KB1 A;  3HL8 A;  1JXE A;  3NAE A;  4B9N A;  4N76 A;  4CHQ A;  1ASU A;  1BIU A;  2YNF A;  1A5X A;  4KFB A;  1VRU A;  4PY5 A;  1LW0 A;  2FC0 A;  3NH0 A;  4FJX A;  4OKK A;  1WSI A;  4FVM A;  3VQQ A;  2JLE A;  4O55 A;  4MFB A;  3K58 A;  1HYV A;  1RT5 A;  1T03 A;  2YHB A;  1Q9X A;  4XIU A;  4KTQ A;  4FXD A;  1NK0 A;  2BAN A;  4DSI A;  4RG8 A;  3OYM A;  4B8C A;  2PY5 A;  4DTU A;  3SCX A;  4BE1 A;  1QSL A;  2XO7 A;  1TK8 A;  3OYL A;  3QES A;  2X6S A;  1SV5 A;  3RRG A;  3S9H A;  3HP9 A;  2DFH A;  3ZSV A;  1U04 A;  4C8M A;  4W5T A;  4LH4 A;  4NYN A;  4HCB A;  4LH5 A;  3S3N A;  4B3O A;  3ZT4 A;  3HST B;  3K5O A;  4CFA A;  2Q3S A;  3VN5 A;  5K14 A;  1BCM A;  1WSG A;  3LAN A;  2YKM A;  4DF4 A;  2G8F A;  3QLH A;  4G1Q A;  5KTQ A;  2D0A A;  1TL1 A;  4Q5V A;  3NGZ A;  4FJ5 A;  4CJP A;  4R5P A;  4WE1 A;  4B08 A;  3ITH A;  3AA5 X;  1U4B A;  4KPY A;  4JRQ A;  4Z4C A;  3LP1 A;  4JRP A;  4CGI A;  3DYA A;  3AVJ A;  3ASM A;  3L2R A;  3DI6 A;  1CZB A;  5C25 A;  3PX4 A;  3AVI A;  4DMN A;  3AVA A;  1ZYQ A;  4ID5 A;  4O0I A;  3VA0 A;  1I39 A;  1VSI A;  4W5N A;  2X6N A;  4CER A;  4FLZ A;  1L3T A;  1WAF A;  3PO4 A;  1SL1 A;  1JLA A;  3NGY A;  3KK3 A;  3NDK A;  2HNY A;  2G8K A;  1RDB A;  2XRI A;  4I2Q A;  4DTS A;  4C8N A;  1JKH A;  3IS9 A;  3E01 A;  2ZE2 A;  2IC3 A;  4B9M A;  1NK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...