3AO4A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
139
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/transferase inhibitor
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 47
structure length 139
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao4A00
1EXQA 1L5UA 3ZSYA 1W0HA 2B6AA 2G8VA 1TVRA 1ZBUA 1HPZA 1CXQA 1LAWA 1J9AA 2RN2A 3AO3A 2Q3SA 4OPKA 4RW7A 4YFUA 4HUFA 1BQNA 3V4IA 2E4LA 2KZMA 2RF2A 4CK3A 3PO4A 3HSTB 5CY4A 2F8TA 2VG5A 4DMNA 2Y1JA 3EY1A 4DSJA 1TKXA 1SL0A 1EETA 1RT2A 2G8WA 5JS1A 4BE2A 1R0AA 2XY7A 3QNNA 2OPSA 2ITGA 4I9LA 4DTUA 4N47A 4FZXC 3M8QA 1RDDA 4CJ3A 5HLFA 3BDPA 4DFMA 1DTQA 1TL3A 3QERA 1TK5A 4DTNA 2EHGA 3VQQA 3QEIA 1BIZA 2HNZA 2KW4A 1TAQA 4K8XA 1JLAA 1L3TA 5KI6A 4I7FA 3OYKA 1UWBA 2VWJA 1NJYA 1RTDA 4FXDA 4AHVA 2ETJA 3ULDA 4CIEA 5J1EA 4FLVA 4DFJA 4EZ6A 1NK6A 1HJRA 4KI6A 1LWFA 1ZBLA 3OJUA 4F3TA 4CHQA 4LSNA 2AJQA 2G8HA 1RCHA 1X1PA 3OYGA 1RT7A 4CJFA 3ITHA 4CGFA 1JLFA 3JYTA 2PYJA 3DRRA 5HROA 5HRSA 4DQIA 2EX3A 4E7LA 2OZSA 3L3UA 1SV5A 1K6YA 3HP6A 4DQQA 1IG9A 1U04A 1WSFA 2RKIA 3NF9A 4DF8A 1JXBA 1BI4A 5EU7A 3VQ5A 4CJTA 3K58A 4KREA 4CECA 3HPGA 3CFRA 4DU4A 2D0CA 4DTRA 2XRIA 4FLUA 3WNFA 4C8OA 4F8RA 4ICLA 5KGXA 3CFPA 1U45A 4HUGA 4DFKA 2QKKA 2YHBA 4CEZA 3V6DA 1UA1A 4NYFA 4E19A 1U49A 3PY8A 2Z1IA 4O5BA 4KAZA 4ELVA 2VG7A 4H4OA 2OPPA 4OJRA 4IG0A 4C8NA 1LV5A 3LP1A 3LP0A 3OYAA 3TABA 4Q0BA 4KRFA 3CM6A 3LPTA 4LSLA 5FDLA 4G1QA 1ASWA 4FLZA 4CF8A 1NJWA 3K5MA 1N6QA 3DLHA 4CHOA 4CEQA 3VQ6A 5T7BA 3MXMA 3HP9A 1NK0A 1S6QA 4OPJA 2D5RA 3HM9A 2O4GA 4BDPA 4AH9A 5HBMA 4FLWA 4NCBA 4CGJA 3T1AA 1S6PA 1QHTA 3LP3A 4CJLA 3VQDA 4B9UA 3C94A 3NF6A 2F96A 2QXFA 3EYZA 4CEBA 1HNIA 5DMRA 3PX0A 1XI1A 1U47A 5KRTA 4H4MA 4AHRA 5CZ2A 4M42A 1DLOA 1BQMA 1VSEA 2YNGA 1BCOA 1CLQA 1EKEA 1A5WA 3LPUA 1A5VA 2NUBA 1C1BA 4OGCA 3HPOA 4DLEA 4FLXA 3KLGA 4IG3A 1VSMA 1BL3A 3SUPA 1KRPA 3RTVA 3AVKA 1WLJA 3AVMA 4E89A 2HHTA 3TAFA 4I2QA 4E7IA 1SL1A 4CJEA 1NKEA 3ZT4A 1HYSA 1XC9A 1NK9A 1TAUA 1QE1A 1RBVA 4DTMA 4BDZA 4Z0UA 4B08A 3V1RA 3ZT0A 4I2PA 1L3UA 4PUOA 1KLNA 1L3VA 2B4JA 3HVTA 4IFYA 3LZIA 1B9FA 1Z26A 2Y1IA 4DF4A 4J2EA 4ZTJA 4FJKA 3NBPA 4TSXA 3ZSZA 1QSSA 4F4KA 2X74A 4KTWA 4O4GA 1DTTA 3HPHA 4OKJA 1IKWA 3CFOA 1KVCA 4B9NA 3QIOA 5FRNA 3F9KA 4BWMA 3OS1A 1Y97A 2YHAA 1NK4A 4RG8A 5SWMA 4E7KA 3CYMA 2A1SA 3M8SA 4KKOA 2X6NA 3SQ1A 4DSKA 1WSEA 1G15A 3I0SA 3OYNA 4DLGA 4JS4A 2XY6A 1NOYA 4J2DA 2HHUA 1KVBA 1RT5A 2DFFA 3SUOA 3KK1A 2PZSA 3HK2A 4LD0A 3NDKA 4QCLA 3MEGA 2DFEA 1TK0A 3QEWA 1HYVA 4BWJA 4JRQA 1TGOA 3AV9A 1FKPA 1WNSA 4LH4A 5HRNA 4Z4FA 1F21A 1SUQA 3SCXA 3SI6A 3B6PA 1WAJA 4M3ZA 4B9MA 3D0PA 4FK2A 4CEFA 1JXEA 3K59A 2XY5A 3WNGA 3K5OA 1VRTA 4CGHA 2IS3A 1QS4A 1X9SA 4DG1A 3OYEA 4BDYA 1WSHA 3T3FA 5I3UA 2PY5A 1NJXA 4OLBA 3LP2A 1I3AA 4Y1DA 1JLGA 1KCFA 1SKSA 3KK3A 4ELUA 1FKOA 1RBTA 2Z1GA 3EZ5A 3PX4A 4M3XA 4FJGA 1T7PA 1WN7A 4BE1A 3MEDA 3UIQA 1VSLA 3RR8A 3HYFA 4FK0A 2HHVA 5E41A 1RTIA 1BISA 3NF7A 2XHBA 1U4BA 4FJNA 4FYDA 1RTJA 4BACA 5CYMA 3VQ9A 4FLTA 4C8LA 2WOMA 4AILC 3TI0A 3IG1A 5C24A 1QSYA 3AVIA 5FROA 1BGXT 2P51A 3MAQA 1NKCA 4N76A 4DSEA 1W9HA 3VQCA 3NF8A 3L8BA 2OZMA 5HP1A 4B3OA 1RDCA 2B5JA 3VQ7A 3LAMA 3V9UA 1NKBA 4O0IA 2QK9A 3C95A 4Z4IA 4LY7A 1IKYA 2HW3A 3KJVA 4RW9A 1TK8A 1LW0A 3ZT1A 4FZYA 2KZZA 3P83D 4M3RA 3K5NA 1RILA 4GVMA 4CJWA 3L2UA 1TL1A 3KK2A 1U48A 3KIOA 1VSIA 3AO2A 4M3UA 1RDAA 3RMCA 3TAPA 4F2SA 3OYHA 2A1RA 3QESA 4WE1A 5SZTA 3KLFA 3O3FA 1EP4A 1ASUA 1Q9YA 4Y1CA 3CG7A 4JRPA 4C8MA 1XHXA 2YNHA 4DQSA 1GOCA 2FC0A 1C0MA 2XY8A 3WNEA 5C25A 1VRUA 3NGZA 1C1CA 3HJFA 4B9VA 3V81A 1IH7A 3I0RA 4JS5A 3HXMA 3VQPA 1JLBA 1XHZA 1S1VA 3SQ2A 4FJMA 4M3WA 4FCYA 1CZ9A 2FBYA 4CGGA 4CJPA 2D0BA 4HUEA 1SKWA 3QEPA 4C8KA 3MXJA 4E7JA 1J5OA 2DFHA 1RBSA 4E7HA 3RRHA 1C6VA 3RR7A 3VQ8A 3C6UA 2OA8A 3L2QA 2R7YA 3K57A 3VA3A 3S3MA 1YVUA 3SZ2A 3K2PA 1C1AA 3VQBA 3VN5A 4HHTA 3VA0A 3THVA 2ZD1A 3RRGA 4PY5A 3OYBA 1CXUA 3TARA 4ZTFA 4CEEA 4DWIA 3AA3A 4KB1A 3AVFA 3B6OA 3AVCA 1J53A 2JLEA 3SPZA 3ZSXA 4CJ5A 4KHYA 2YNIA 3BGRA 3DRPA 3ZSQA 4DU3A 4GW6A 2FBVA 3PUFA 2G8FA 1RT3A 1HMVA 3KLEA 2LSNA 3CQ8A 1T8EA 3ZT3A 3TAGA 4CJQA 2PYLA 2XO7A 1RT6A 4FM2A 3DI6A 3G10A 3RMDA 1RT4A 3ZCMA 4NCAA 4OLAA 1GOBA 5CZ1A 4CK2A 5KTQA 1TKZA 4CCHA 3S3OA 1TKTA 3I8DA 3KKRA 2RPIA 1ZBIA 1ZBFA 4N41A 1SKRA 3M8PA 1UA0A 3NE6A 3NAEA 4QOZB 3HL8A 4CHZA 4CFCA 5HRPA 1NK7A 1HRHA 3NGIA 3V1OA 2VG6A 3U3GA 2OPQA 3U6FA 1VSDA 3AVLA 2HB5A 2Z1JA 4FJLA 3OS2A 3LANA 4GMJB 4J2AA 5D3GA 4FJ5A 3AVGA 4CF9A 4FM1A 3V9SA 4OKEA 2BANA 4CJUA 3OJSA 2HMIA 1I39A 1RT1A 3DOLA 1WSJA 4KV8A 4FJIA 3TANA 4F3OA 1D5AA 1ZBHA 5HRRA 4MFBA 2D0AA 1KVAA 2YNFA 5JS2A 1ZYQA 3O4NA 3O4QA 4KB0A 4ZHRA 2IOCA 4FJ8A 3NH1A 4M45A 1YTUA 3AVAA 3LWLA 1FK9A 4LH5A 3OYIA 4DQRA 3IS9A 3DLBA 3HVRA 3SUNA 4DSIA 1NOZA 2HHXA 3PV8A 3AA4A 3KLIA 3L2WA 1RBRA 3CM5A 5KGWA 3LZJA 1T03A 3L2VA 3ALYA 3LAKA 3SV4A 3NH2A 2G8KA 2E6MA 3NCIA 4M3YA 1BHLA 3KD1E 4DFPA 3AVHA 4E0DA 2GV9A 1B9DA 4KTQA 1S5JA 1YTAA 2IGIA 4RW6A 4DQPA 1JLEA 3AO5A 4Z4HA 3OS0A 2BE2A 4YNQA 3DYAA 3QEXA 4CJKA 1VSHA 3ZSOA 3AO1A 4ID5A 4K8ZA 1S1TA 4FJHA 1QSLA 3ZSWA 4AHSA 1RTHA 1YT3A 3SJJA 2KFNA 2DY4A 3SUQA 4DS5A 3D45A 3TR8A 4OVLA 2X78A 4CF2A 4L8RB 1TV6A 4CFDA 4BE0A 1NK8A 3QLHA 1Q9XA 1FXXA 3M8RA 4DTOA 1IKXA 4FJJA 4B9LA 1LW2A 1LWEA 3SQ4A 1T05A 2F8SA 3QEVA 2W42A 3SYZA 1RDBA 4CE9A 1X9MA 1WAFA 4N56A 4B9TA 4M41A 2G8IA 3F73A 2IAJA 4EZ9A 3IRXA 1D8YA 4Q5VA 1KLMA 2HHQA 3ASMA 2ZQBA 4E1MA 1B92A 1S1XA 2Z1HA 5K14A 2ZE2A 3IAYA 3T19A 3AA5X 1GOAA 1IKVA 4KO0A 3LWMA 4CHNA 4CEOA 3ISNC 4E3SA 3OVNA 1HNVA 3TAQA 3AA2A 4CJRA 3K5LA 4CHPA 4FJ9A 1NJZA 3S3NA 1BIUA 4CJSA 4DU1A 3SNNA 3E01A 4Z4EA 1EX4A 3DLGA 5CYQA 4R5PA 3FFIA 1KSPA 5J2NA 3VQ4A 4M3TA 3V9WA 3OYLA 4KHNA 3NGYA 3ZSVA 3OY9A 4KHSA 3DRSA 5DK5A 5J2MA 4PWDA 4CF0A 2IC3A 3MXIA 5FRMA 4HCBA 4MQ3A 4I9QA 4PQUA 3QIPA 3LALA 4KHUA 4W5OA 3V9ZA 3DLEA 4AHCA 3V1QA 1QTMA 3NFAA 1D9FA 3AVJA 3AVNA 1JL2A 2FBTA 5KRSA 5J2PA 3RWUA 2YKNA 4EP4A 3DMJA 4XIUA 3KLHA 3A2FA 2HVHA 5J2QA 4FZZA 1HQUA 4FVMA 3LDSA 3QO9A 4CJVA 5I42A 3KTQA 4CHYA 1KTQA 3DOKA 2KFZA 4HTUA 1HQEA 1JLCA 3TAEA 4FM0A 3DLRA 1Z25A 1BI4B 2P5GA 4B9SA 4O0JA 3HT3A 4KPYA 2BDPA 1D9DA 1KFDA 1UOCA 3L3VA 1CZBA 4O55A 1VSKA 5C42A 2YV0X 3QINA 4KTZA 4RW4A 4B8CA 4W5RA 4KI4A 4FW2A 4HVJA 4CF1A 3U3YA 3TAMA 3RMAA 4W5QA 4NCGA 3OYDA 3PX6A 1S1UA 3KKSA 4FJXA 2FBXA 2QKBA 4H8KA 2G8UA 4Z4CA 2ATQA 2DTUA 4NYNA 4W5TA 4DTSA 3H08A 3L2RA 4FK4A 4F2RA 2OPRA 3S9HA 2WONA 3HO1A 1WSIA 4PA1A 3G0ZA 4N5SA 2E6LA 3MECA 3ZT2A 4CEDA 3OYJA 3VQEA 4CJ4A 4ID1A 1J54A 3MEEA 1HYZA 4ELTA 3QETA 4CK1A 4FLYA 4UQGA 1NK5A 4CIFA 4AHTA 2BGGA 4E1NA 1X9WA 1C0UA 2GUIA 3WNHA 4CEAA 4CFAA 3OYMA 1N5YA 1REVA 1KFSA 1BCMA 4AHUA 4KHQA 4CGIA 1UAXA 3JSMA 2KQ2A 3P1GA 3NHGA 1QQCA 4RW8A 4OKKA 2HNDA 4DTXA 3SV3A 2JGUA 3VQAA 4JLHA 4DSLA 1LAVA 1ITGA 4CERA 1TKDA 4FW1A 1IO2A 4CIGA 4HCCA 4IKFA 3RMBA 3QNOA 4Z4GA 3V9XA 1VSJA 4B8AB 2KTQA 1VSFA 2X6SA 4FJ7A 3P5JA 4OGEA 3AO4A 4J2BA 2VWKA 2IDOA 2P5OA 4CESA 4DTPA 1RNHA 2YKMA 3AVBA 2I5JA 4DTJA 2HHSA 4IDKA 1A5XA 1S9GA 1LWCA 3C6TA 1XWLA 4CGDA 1JKHA 4IFVA 3O3GA 3TWHA 4W5NA 3ZSRA 3DM2A 3DLKA 3PO5A 1S9EA 4IBNA 2HVIA 2HNYA 2O4IA 1MU2A 4KHWA 4CFBA 1C0TA 2P1JA 2OYQA 2HHWA 1S1WA 4QAGA 4DSFA 1ASVA 3SPYA 1VK0A 4KFBA 3NH0A 1JLQA 1WSGA 3OYFA 1SL2A 1JL1A 4EP5A 1L3SA 3OYCA 3KD5E 4DS4A 3SQ0A 1O1WA 1Q8IA 1RBUA 4O44A 2GBZA 3O3HA
chains in the Genus database with same CATH superfamily
3CXCM 3ZSYA 1W0HA 1E3MA 1LAWA 2Q3SA 3MN5A 2E4LA 2KZMA 4MLHA 1QQMA 3A5MC 4DSJA 2HF3A 2G8WA 5JS1A 1R0AA 4Y0WA 2XY7A 3VESA 2QM1A 1EWRA 2ZJPL 3KWIA 3T1YK 4K8XA 5KI6A 4I7FA 1NJYA 1U2VA 4AHVA 2ETJA 3NMUA 4OPHA 1YAGA 3OA9A 3WQTA 4PKHA 4CHQA 2AJQA 2G8HA 1X1PA 3ITHA 1JLFA 3UKRB 4E7LA 4BRIA 4ISFA 4DQQA 3BY5A 2RKIA 4BRNA 1BI4A 5EU7A 1ILYA 2NRHA 4CJTA 2NRVA 5M1OA 4B1XB 4DKWA 4DU4A 4DTRA 3BZCA 2PBDA 3Q7CA 4FLUA 1U45A 4DFKA 4JEPA 4FWNA 4B9QA 3V6DA 5AQLA 1DGKN 1LV5A 3LP1A 3SK3A 1QHAA 2A6AA 4LSLA 5FDLA 3DLHA 1NJWA 3FFKB 4DV7K 4CEQA 3MXMA 2Q36A 2D5RA 3THYB 4EHTA 1VQLN 5HBMA 4NCBA 4ISEA 2F96A 3W3DA 1HNIA 3PX0A 4H4MA 4AHRA 5CZ2A 4M42A 2F9WA 2YNGA 1A5WA 3LPUA 2NUBA 4OGCA 1C1BA 3HPOA 4WQ4A 4GV9A 3KLGA 2ASMA 1K8AO 1KRPA 2HHTA 4E89A 1S72N 3QB0A 3VEZA 4A59A 2UXBK 4Z0UA 4B08A 3E66A 3ZT0A 3O1WA 4IFYA 2ZGZA 3LZIA 1Z26A 1YUWA 2Y1IA 4BC3A 4J2EA 4ZTJA 4A57A 2D0OA 4F4KA 3H45C 3J7AP 1Y97A 3TTFA 5JVGL 3CYMA 4KKOA 1SS6A 3LDQA 2X6NA 3G4SN 3IMXA 2Q31A 4DLGA 2XY6A 1NOYA 4J2DA 3ZEUB 5GIOA 1C0FA 2AP1A 4DR7K 1RT5A 3P39A 4YOVA 4QCLA 4LD0A 5ADXA 3MEGA 4B1WB 3MMVA 4JRQA 2Q97A 1WNSA 5HRNA 4KH5A 2O8EB 2A40A 2P9LB 3SCXA 3VEXA 3H1QA 2D1KA 4WCEL 3CJAA 3W0LA 4CEFA 5BPNA 4CGHA 1QS4A 1RGIA 4JKBA 5AQMA 1NJXA 3LP2A 1I3AA 1JLGA 4ISGA 4H0XB 3VF6A 1RBTA 3EZ5A 2V52B 1M90O 5AQIA 3PSFA 4H0PA 3RR8A 1BISA 4FJNA 1U4BA 4IZ9A 4C8LA 3UE5A 1YI2N 2P51A 3R8EA 4DSEA 1J5EK 5HP1A 2B5JA 3VQ7A 3LAMA 2O8FB 4O0IA 4LY7A 1IKYA 3KJVA 4RW9A 3ZT1A 1Q82O 3G71N 3THWA 3K5NA 1RILA 3LDOA 3O8MA 4O5FA 3KK2A 1U48A 1RDAA 3RMCA 4F2SA 3FZMA 3OYHA 4JNEA 3QESA 5SZTA 4MO5A 4V19S 1EP4A 1TYQB 4Y1CA 4DQSA 2FC0A 5C25A 5AQNA 5BRDA 4B9VA 2Q0RA 3CPWM 1S1VA 4M3WA 4CJPA 3MXJA 3IDHA 4E7HA 3RRHA 3RR7A 3C6UA 4JI6K 3L2QA 4AM7A 3SZ2A 1C1AA 3DAWA 3VN5A 2ZD1A 3CCRN 4ZTFA 4DWIA 4KB1A 1J53A 2E2PA 3ZSXA 4KHYA 5AQWA 3MWTA 5KPZA 3ZSQA 3EE9A 2G8FA 4BRAA 4MDAA 2OTLN 3ZT3A 2ASPA 4CJQA 2P9SB 3RMDA 1RT4A 3CC7N 2GWKA 5M1NA 4OLAA 1P90A 3CD6N 4IO9L 5ELZA 3S3OA 5AQJA 3EN9A 4M63C 5F2RA 3KKRA 2RPIA 3VEYA 4JK7A 5H1SQ 1SKRA 4N41A 4EHUA 1LCUA 3NE6A 3MX2A 3HL8A 4BRKA 5CR4A 5HRPA 2ZJQL 1HRHA 3V1OA 2VG6A 2OPQA 3U6FA 3AAQA 2BUPA 2QWPA 2QWLA 4FJLA 4CZJA 4FJ5A 3AVGA 4CD1A 1NU0A 3OJSA 2HMIA 4YDUA 2O8CB 4FJIA 3TANA 1D5AA 3O9TA 5HRRA 4DR6K 2IVOA 3VGKA 4JKFA 5F1XA 4LH5A 3OYIA 2E2OA 4PL7A 4KH4A 3SUNA 4DSIA 3F2KA 5FPNA 4JD2B 3CJCA 1RBRA 3ENOA 5JMVA 1LOTB 1NNEA 4CD3A 3WT0A 3NCIA 4M3YA 2HBKA 3VENA 3O6WA 2F7TA 3VOVA 3D7EO 1B9DA 4KTQA 3LDNA 4RW6A 2FSNA 4YOXA 1JLEA 3AO5A 4YNQA 3R3LA 1VSHA 2GWJA 3EZWA 3BUZB 3AO1A 4ID5A 1RTHA 2YHWA 2DY4A 5EOYA 1EO1A 1MA9B 4OVLA 1TV6A 4X64K 4BE0A 3QLHA 3IFRA 1IKXA 2OANA 3SQ4A 1T05A 2F8SA 3QEVA 1RDBA 1WAFA 4B9TA 4M41A 4PKGA 3M1FA 4EZ9A 3IRXA 1D8YA 2ZQBA 4DV3K 4E1MA 3KK7A 1S1XA 3SMSA 3IAYA 3T19A 3AA5X 3TU5A 4CHNA 4E3SA 1HNVA 3E1YA 3T1HK 3S3NA 3ATUA 5AJ3K 3DLGA 5CYQA 5BR8K 3V9WA 4KHSA 5AQQA 3DRSA 4PWDA 2IC3A 5B8HA 3O9QA 3MN6A 4A62A 2IVNA 2P9PA 3LALA 3QIPA 5CHIA 4K43A 1KAYA 2HBJA 3NFAA 1E4FT 1JL2A 3KLHA 3TSPA 1NG9A 4FZZA 4FVMA 4CJVA 1JLCA 3TAEA 3DLRA 3FZFA 1M1KO 1KQSM 4KPYA 1KFDA 5EX5A 1CZBA 5JICA 4O55A 5CE3A 4KTZA 4B8CA 2J4RA 2E20A 4J8FA 3UB5A 4KI4A 4H0VB 4CF1A 3U3YA 4FJXA 4W5QA 3PX6A 2HSTA 1OH6A 5KQ8A 4H8KA 2WUSA 2DTUA 3ZX3A 2QWNA 1WSIA 4BRLA 1TUUA 3OYJA 4CJ4A 1IJJA 3MEEA 1HYZA 1Z6RA 3MWPA 4CIFA 3SAGA 2BGGA 1HNXK 1C0UA 2GUIA 4CEAA 4CFAA 5FLXO 1N5YA 1KXPA 4H5RA 4KHQA 3P1GA 1QQCA 4RW8A 2HNDA 3SV3A 4JAXA 3VQAA 4DSLA 1GLCG 1VQ9N 3VTHA 4HCCA 3QNOA 2NZTA 5M1QA 4B8AB 4B1UB 4FJ7A 2X6SA 3P4IA 3AO4A 2WFBA 4FL9A 1RDWX 2DPNA 3AVBA 3GE1A 4IDKA 1A5XA 3OHRA 1LWCA 2ZWHA 4IJNA 4IFVA 3O3GA 4YY3K 4DV5K 3DM2A 3QFPA 1S9EA 3CETA 4IBNA 4BGAA 2OYQA 2HHWA 3AGRA 3C65A 4AF1A 2QWRA 3SPYA 4X62K 1L3SA 2QTDA 4FWRA 4DS4A 3A8YA 4B3SK 2GBZA 1EXQA 3H46O 4C1NI 4A61A 4KBOA 1TVRA 5EY4A 4HUFA 2KLAA 4YFUA 3AO3A 3J81O 4RW7A 3FLCO 3V4IA 2RF2A 4CK3A 3HSTB 5AQOA 3THXA 1H1VA 2ASOA 2WC9A 1TKXA 1RT2A 4BE2A 2ITGA 4N47A 4CJ3A 3BDPA 4DFMA 1DTQA 1YF5L 1TK5A 3VQQA 5AZIA 4BC5A 1JLAA 1NJIO 1VQKN 2O8BB 3ULDA 4EZ6A 5J1EA 1HJRA 1ZBLA 1YITN 1BA1A 2F9TA 3RSEB 4CJFA 4CGFA 1VQ5N 2PYJA 3DRRA 4DQIA 3L3UA 3VGMA 1IG9A 5AZJB 4I9QA 1U04A 1JXBA 3K58A 4KREA 4CECA 3HPGA 3CFRA 2A41A 3CCMN 4F8RA 3R9PA 4LF4K 4HUGA 1YJNN 4WQ5C 3HOTA 4NYFA 1HKGA 3L6QA 1XMQK 3U8XA 2VG7A 4DV6K 3THYA 4IG0A 4LFCK 2GTDA 5AQGA 3MN7A 3K0SA 3CM6A 3VEVA 4FLZA 4UY8O 1ASWA 1N6QA 4CHOA 1NK0A 4OPJA 3HM9A 2O4GA 4AH9A 4CGJA 3BEXA 3T1AA 3ULEB 3VQDA 4B9UA 3D2EB 2QXFA 3EYZA 1XI1A 1U47A 3HBTA 5IWAK 1BQMA 1VSEA 1BCOA 1CLQA 1EKEA 4DLEA 4FLXA 4IG3A 1VSMA 1V4SA 3ZX2A 3VETA 1WLJA 3AVMA 4FOEA 3TAFA 1SL1A 3ZT4A 1YHQN 1TAUA 3G6EN 4H5WA 4DTMA 4BRHA 2VQFK 1L3UA 4PUOA 4LF8K 2B4JA 4CZFA 1QQNA 1BUPA 2BTFA 2PAVA 4O8UA 4JHDA 3ZSZA 3J80O 4XEIA 3HPHA 2E2QA 4GY2B 1KVCA 3QDKA 4GKKK 3QIOA 3F9KA 3WXJA 4RG8A 4E7KA 2A1SA 3PIPL 3OBWA 4AQYK 2O8EA 1WSEA 2P9LA 4H5VA 3CQYA 3SAFA 3SUOA 2DFFA 2PZSA 3HK2A 3U9ZA 2DFEA 2FF6A 3QEWA 1FKPA 3SI6A 3JAMO 1JCGA 3D0PA 1WOQA 3CQXA 3K59A 2P9NB 3BZKA 1X9SA 4DG1A 3T3FA 4BDYA 2PY5A 4WFBL 5I3UA 4I6MB 4WFAL 4XH5A 1SKSA 5AQVA 5A2QO 3O9SA 3PX4A 3S41A 3KHYA 3NF7A 3VQ9A 5GAGP 3SJHA 1N32K 1QSYA 3AVIA 1NKCA 1VQ4N 2HBMA 5F0XA 4Z4IA 4YOTA 1NGJA 4R79A 4CJWA 1EQYA 4CZHA 2A1RA 4WE1A 4C8MA 1U6ZA 1OH7A 3L4QA 1C0MA 2XY8A 1HNZK 3NGZA 3V81A 3HXMA 3VQPA 1QVFM 1HKCA 3VEOA 3CCSN 2FBYA 4HUEA 1SKWA 1IBKK 4C8KA 1YIJN 1T6CA 2WTUA 1Q7YO 3Q7BA 4DV2K 3S3MA 3F9MA 1YVUA 3THVA 4HHTA 1HLUA 4PY5A 1VHXA 1IBLK 4KH6A 4H0TB 3AA3A 3AVFA 3B6OA 3AVCA 3CIPA 4CJ5A 4JI3K 3BGRA 4JKGB 4DU3A 3PIOL 2FBVA 3PUFA 1RT3A 1HMVA 4BGBA 3KLEA 2LSNA 3CQ8A 2NNWA 5C12A 2XO7A 1RT6A 4NLBA 4EIAA 5AFUA 4FM2A 3G10A 3O80A 3T69A 4B1ZA 3C7NB 3H3NO 4CK2A 1ATSA 1O13A 1TKTA 4LF7K 1K73O 1NGCA 3DXMB 3NAEA 3M5RA 4CHZA 2O8CA 1VSDA 2Z1JA 4JV5K 2P9IB 4GMJB 3V9SA 4CJUA 2BANA 3CPEA 1I39A 3DOLA 5TKWA 4RTFD 4MFBA 4BC2A 5JS2A 4FWQA 3WXMB 1ZYQA 3O4NA 2OTJN 2QWQA 4ZHRA 2IOCA 1S3XA 1BDGA 5AQHA 4M45A 1YTUA 3LWLA 4LC9B 4DQRA 4LFBK 4IOCL 1I94K 2HHXA 3PV8A 3AA4A 5KGWA 1T03A 3L2VA 3RVCA 2G8KA 4FWLA 1GLLO 2YX6A 4E0DA 2GV9A 1S22A 1S5JA 3OS0A 3DYAA 3ZSOA 3ENHA 4K8ZA 3SBGA 4FJHA 1QSLA 3ZSWA 1YT3A 2KFNA 3O1BA 1D4XA 4DS5A 3SUQA 3L0QA 4CF2A 4L8RB 3WEEB 1C0GA 1FXXA 4DTOA 1KAXA 1LW2A 1LWEA 2QI2A 2GX9A 4DR3K 3SYZA 4BR7A 3E9OA 4N56A 3F73A 4WYBA 3ASMA 4FWOA 2A5XA 1B92A 4QS7A 3IUCA 5K14A 1E4GT 1WBDA 2ZE2A 2OCEA 5AQYA 3FR0A 3TAQA 3AA2A 3K5LA 3CCEN 4CJSA 4FPBA 3E01A 2CGKA 3LL3A 3FFIA 2E1ZA 3OYLA 4KHNA 3OY9A 4WQ5A 4CF0A 5FRMA 1NM1A 2A42A 3MK6A 1U2VB 3V9ZA 4A2BA 4BQZA 3BF3A 4BR5A 4AHCA 3CHWA 1QTMA 5J2PA 2FBTA 1HNWK 3DMJA 5J2QA 4MO4A 1HQUA 4DV1K 3FZHA 4HTUA 3OW2M 1HQEA 1P8ZA 1BI4B 3MCPA 1BOTO 1V4TA 2BDPA 3B8AX 3L3VA 1NBWA 2AA4A 2YV0X 3EO3A 3A0IX 3TAMA 4NCGA 5GAEP 2QKBA 4DUYK 2HOEA 3U4LA 1YJ9N 1KC8O 3E9PA 4DTSA 3L2RA 3S9HA 3FE1A 3G0ZA 4CEDA 4ILHA 3VQEA 3OTOK 3QETA 4FLYA 4UQGA 1NGDA 1HPMA 5LMNK 3WNHA 1W97L 4IOXA 2E1YA 2NRZA 4O8KA 2Q0UA 3WXLA 4DHYA 3HZ6A 2JGUA 4JLHA 1ZC6A 5AR0A 1ITGA 2YCHA 4HWIA 4FW1A 4BR4A 1TKDA 1IO2A 5BRHA 1YJWN 3RMBA 1ATNA 2FXUA 2PFUA 3O5BA 3MN9A 4OGEA 5C0YA 2VWKA 5TKYA 2HHSA 3D2FB 1XWLA 4CGDA 2UUAK 1IBMK 3DLKA 1QVGM 4B3MK 4H03B 2O4IA 3I33A 1MU2A 4AM6A 3PLAA 5C10A 5DM7L 1VQMN 4NXMK 1SL2A 1JL1A 4DV0K 3OYCA 3EL2A 3SQ0A 2YHXA 2CGLA 3CCLN 1RBUA 4BG9A 5C2DA 3O3HA 1L5UA 4OPKA 2OA8A 2RN2A 1J9AA 3A5OC 2ZJRL 3PO4A 1SL0A 2VGMA 1EETA 2GEMA 3QNNA 2O8BA 4DTUA 4JK9A 4FZXC 1TL3A 2HNZA 3DWLA 3GDQA 1IV0A 1SQKA 4L3QA 2E2NA 3OYKA 1RTDA 1FW6A 2VWJA 3DXKB 3N4QA 2Q1NA 4DFJA 4FLVA 4KI6A 2P9UA 1LWFA 3R6MA 3OJUA 4LSNA 3OYGA 1SAZA 1ZBSA 4BR9A 3HP6A 1K6YA 4OO1J 1WSFA 3NF9A 3VQ5A 3FZLA 4PHTX 3CCUN 2D0CA 2XRIA 3THWB 2I7PA 3WNFA 5KGXA 3FGUA 2F4VK 2QKKA 2YHBA 1BWFO 1UA1A 4E19A 3DJCA 1U49A 3GG4A 2OPPA 4OJRA 5I9EB 3TABA 4Q0BA 4KRFA 1HJOA 1XQSC 5AQSA 3LPTA 3ZYYX 3K5MA 3VQ6A 1S6QA 4CI6A 1EWQA 2QW9A 5C15A 4WFNL 3LP3A 3DLLL 5DMRA 5KRTA 3LM9A 2EWSA 1A5VA 5M1PA 5FPDA 3SUPA 3RTVA 3AVKA 4E7IA 4JN4A 4A5AA 4CJEA 1RDUA 2P9KB 1R59O 1HYSA 5BRFA 1XC9A 1RBVA 5FPEA 4BDZA 3SBTA 3V1RA 4I2PA 4PL8A 3HVTA 1GLFO 4DF4A 4BR0A 4FJKA 3NBPA 4TSXA 1QSSA 2X74A 4WQ4C 4O4GA 4B9NA 1NK4A 3CJBA 3M8SA 4CZEA 4DSKA 3I0SA 3OYNA 2HHUA 4YOUA 1NWKA 4CBXA 1MDUB 3WQUA 1TK0A 1HYVA 4HTLA 3AY9A 4LH4A 4Z4FA 1F21A 1SUQA 1MWMA 4C1NK 4I6MA 4IEIA 4M3ZA 4CZIA 2XY5A 2GELA 3WNGA 4CZMA 2JWLA 1WSHA 1ESVA 4OLBA 1JCFA 4Y1DA 1KCFA 1T3VA 3KK3A 4ELUA 1CZAN 1FKOA 2Z1GA 3IKMA 4LF9K 4CJ7A 3MEDA 5E41A 4NB4A 5CYMA 4FLTA 2WOMA 5BREA 3IG1A 3TI0A 5HL7L 2UUCK 1BGXT 4N76A 2OZMA 3VQCA 3NF8A 2ZGYA 3UKRA 4BRFA 1NKBA 3C95A 5DM6L 4K25A 2NLXA 3TTCA 3WXKA 1GLAG 3QFUA 5EVZA 4M3RA 3AO2A 4M3UA 1X9JA 3TAPA 1VQPN 4IFEA 1ASUA 1Q9YA 1JJ2M 1XHXA 2YNHA 3ATVA 5LJWA 2FSKA 3N4PA 3HJFA 3I0RA 3J7ZO 4JS5A 1JLBA 1XHZA 2CH5A 4FWSA 2FF3B 3SQ2A 4FCYA 4IOAL 4CGGA 4G9ZA 4YOWA 2D0BA 3QEPA 1J5OA 5GINA 2KKZA 2P9PB 3K57A 4Z94A 4JKGA 3WUHA 2YHYA 3OYBA 1CXUA 4CEEA 5GAHP 2JLEA 4X66K 1HX1A 2YNIA 4DCHA 1T8EA 2PYLA 3AGKA 5M1KA 4QS8A 4NCAA 1G99A 3ID6A 3NVMA 5CZ1A 3CJ9A 4BVOA 4JYAK 4B3TK 3KWGA 3ZX0A 1N34K 1ZBIA 1ZBFA 1SZ2A 1UA0A 4QOZB 2Q2RA 3G25A 4JKDA 4CFCA 3ZEUA 3NGIA 3L4IA 1WB9A 1JCEA 3AVLA 2HB5A 3SLCA 5IT9O 5EXWA 5D3GA 2RHKA 4FM1A 2W40A 4OKEA 4YHHK 1WSJA 4KV8A 4F3OA 4B3RK 2D0AA 1KVAA 4KB0A 4FJ8A 2CH6A 3NH1A 3C0BA 3AVAA 3WXIA 3CMEN 1FK9A 1NOZA 3I56N 5AQXA 3KLIA 3L2WA 3LAKA 4JI4K 5C2FA 3SV4A 4A2AA 5LJVA 3NH2A 2HMPA 3M3ZA 4BRMA 1BHLA 3QBXA 3KD1E 4B1YB 3AVHA 2IVPA 2IGIA 4DQPA 3CI5A 4OPAA 3EE8A 1Q86O 3ZLJA 5ADXH 3D45A 3TR8A 4BQLA 2X78A 2O8FA 4FSVA 4CFDA 4YOYA 3M8RA 3M6GA 4B9LA 5JVHL 1GLEG 2W42A 2G8IA 3HM8A 1XNQK 4FWPA 2V7ZA 1KLMA 3CJ1A 2Z1HA 3A5NC 1NGAA 2E8AA 1TYQA 3P38A 1IKVA 4KO0A 2I7NA 4FJ9A 3THXB 3CCVN 4DU1A 1NMDA 3VQ4A 4DR2K 3KZBA 3ZETB 3ZSVA 5DK5A 3HI0A 5J2MA 3J7YP 4HCBA 5AZIB 5AQRA 3HOSA 4FVUA 4IJAA 3EEQA 1K9MO 4PQUA 4W5OA 3DLEA 3QMLA 3V1QA 2W41A 3AVNA 4H5NA 4XIUA 3A2FA 3TTDA 2ZM6K 3LDSA 3QO9A 2KFZA 1KTQA 3DOKA 4CZGA 4FM0A 1BU6O 1VQ6N 4O0JA 4IO8A 1D9DA 5BN9A 1BA0A 3QINA 4RW4A 1HUXA 2P9SA 4EAHD 5LMUK 3VEWA 3RMAA 3O9RA 1S1UA 2FBXA 2G8UA 4DR5K 4JI8K 4W5TA 4FK4A 3H08A 4KHPK 2OPRA 2WONA 1YXQA 3LDLA 4PA1A 1VQON 4N5SA 2E6LA 3MECA 3ZT2A 4X65K 5AQFA 1J54A 4BROA 4MDBA 1NK5A 3AARA 4AHTA 4E1NA 3OYMA 2NRRA 3K9KA 1REVA 1BCMA 4CGIA 1UAXA 2VQEK 3JSMA 2KQ2A 1NGBA 3LDPA 4NO7A 3TSUA 3LM2A 1BG3A 4CIGA 1DEJA 2O8DB 4Z4GA 3D2FA 1VSJA 2KTQA 4JD2A 1VSFA 3P5JA 3PSIA 2IDOA 4XH4A 4CESA 1RNHA 3GOIA 4BR2A 2I5JA 4DTJA 2YJEA 4JI5K 3C6TA 1JKHA 3TWHA 4JKEA 3ZSRA 1K8KB 3PO5A 5JLFA 2HVIA 4M7XA 2HNYA 4JHDB 1C0TA 2V51B 4DSFA 3C6AA 3UKUB 3NH0A 3D6RA 4CZLA 1Z05A 4BREA 4GNIA 1N36K 1O1WA 1Q8IA 1W7AA 4M7YA 3ID8A 2B6AA 2G8VA 1ZBUA 1HPZA 1CXQA 1BQNA 5AQTA 5CY4A 2F8TA 2VG5A 4DMNA 2Y1JA 3EY1A 4E1JA 3CC4N 3VERA 3DXKA 1J6ZA 2OPSA 1VAZA 3R1XA 4I9LA 1XC3A 3M8QA 1RDDA 3HRGA 5HLFA 3QERA 4CVNE 2EHGA 4DTNA 3QEIA 1BIZA 2KW4A 1TAQA 1L3TA 1UWBA 4FXDA 1NGIA 3C6HA 4CIEA 3HTVA 1NK6A 2VYPA 5FPMA 4F3TA 4JI7K 3P31A 4DR1K 1RCHA 1RT7A 3JYTA 5HROA 5HRSA 2EX3A 2HF4A 2OZSA 4W5NA 1SV5A 4DF8A 4JKAA 4WF9L 1OKJA 3NVKA 4C8OA 4ICLA 1XUPO 3CFPA 3I8BA 4CEZA 2V7YA 2UU9K 1ATRA 5KPTA 3PY8A 2Z1IA 4O5BA 4KAZA 4ELVA 4H4OA 2GUPA 4C8NA 3LP0A 3OYAA 4G1QA 2JWKA 4CF8A 5T7BA 3HP9A 2YJFA 3GBTA 1OVYA 4BDPA 4FLWA 1S6PA 1QHTA 4BG8A 3EKUA 4CJLA 4CZKA 3C94A 3F5TA 3NF6A 4CEBA 4BVPA 4C23A 1DLOA 2P9KA 1NLVA 1ZBHA 1BO5O 4BRPA 1BL3A 3FZKA 5GIPA 2QEXN 4I2QA 1NKEA 1NK9A 1QE1A 2HHHK 3MCAB 3I55N 5E84A 2FSJA 1L3VA 1KLNA 1VQ7N 1B9FA 2UXDK 3MDQA 4FO0A 2VCPA 3BP8A 4K0KK 1NGGA 4KTWA 1DTTA 3H6EA 1IKWA 3CFOA 4OKJA 5FRNA 5AQZA 4BWMA 3OS1A 2YHAA 5SWMA 3SQ1A 2NRTA 1G15A 4JS4A 3SMPA 4DR4K 1KVBA 2BH1A 3KK1A 3NDKA 4OX9K 1X3MA 4BWJA 1TGOA 3AV9A 3VTIA 3B6PA 3EKSA 4H0YB 1WAJA 4B9MA 4FK2A 5M1FA 1JXEA 3K5OA 1VRTA 2IS3A 3OYEA 3SAHA 4GV6A 2HBLA 1OH5A 4CW7B 2UYTA 1N8RO 4M3XA 4FJGA 1T7PA 1WN7A 3QICA 4BE1A 5AQPA 3UIQA 1VSLA 3HYFA 4FK0A 2HHVA 1HR0K 3KVGA 1RTIA 2XHBA 4FYDA 1RTJA 4BACA 3TPQA 4AILC 3CC2N 2W6LA 5C24A 5FROA 1FJGK 1DKGD 3MAQA 3RSEA 4DUZK 1X3NA 4K41A 4F9OA 1W9HA 3L8BA 4B3OA 1RDCA 5E26A 5AZJA 3V9UA 2QK9A 1N33K 2HW3A 1TK8A 1LW0A 4FZYA 2KZZA 3P83D 4GVMA 4EFHA 3L2UA 1TL1A 3ENBA 3KIOA 1VSIA 4U7BA 4XH1A 4CBUA 4BC4A 3KLFA 3O3FA 4JRPA 3CG7A 1GOCA 1NGEA 3WNEA 4MLEA 1VRUA 1C1CA 3VMFB 1IH7A 1VQ8N 2H3GX 5KPRA 1NGHA 4FJMA 3E9LA 1CZ9A 3QBWA 3A5LC 4E7JA 3ULEA 2DFHA 1RBSA 3VF4A 1C6VA 3D2EA 2FLOA 5AQKA 2NRXA 3VQ8A 4GKJK 4BY9C 2R7YA 3VA3A 4DQ8A 3K2PA 3VQBA 3RRGA 3VA0A 3TARA 4ILGB 2E5LK 5BR9A 4NXNK 3SPZA 2YI1A 1VQNN 3DRPA 4BRCA 4GW6A 5GADP 1NGFA 3TAGA 3MX5A 3O08A 2W6KA 5KQDA 3H1VX 3H3OB 2RE2A 3DI6A 4JKCA 2KHOA 2QXLA 3ZCMA 4GV3A 1GOBA 2A3ZA 4A5BA 5BPLA 5KTQA 1TKZA 4CCHA 1QZ6A 3I8DA 3M8PA 3HSCA 3O9UA 2ZF5O 2CGJA 4JI2K 1NK7A 3CERA 4LF5K 3U3GA 3U9DA 1WBBA 3OS2A 3LANA 4J2AA 1XNRK 4CF9A 1RT1A 3T7ZA 1QZ5A 2YNFA 3K9JA 3O4QA 2P9NA 2UUBK 5BN8A 1W2BM 3IS9A 4FWMA 3DLBA 3HVRA 4FWKA 4NLCA 3CM5A 4IWVA 3LZJA 1NMNA 3ALYA 4H0OA 4JK8A 5LL6Z 3J8AA 2E6MA 4DFPA 4IDHA 1YTAA 1MWKA 4Z4HA 2BE2A 1ZXOA 3QEXA 4CJKA 5AQUA 3CJ7A 1S1TA 4JKHA 4AHSA 4B1VA 3SJJA 4BRQA 4K42A 4PKIA 1Y64A 1NK8A 2WBNA 1Q9XA 4BRGA 4FJJA 1IG8A 1X9MA 4CE9A 4DB3A 1XMOK 2IAJA 2D0PA 4Q5VA 2HHQA 1GOAA 3LWMA 1WUAA 4FPAA 3ZETA 4CEOA 3ISNC 4BRDA 3OVNA 4CJRA 4CHPA 3BF1A 1NJZA 1BIUA 3SNNA 4Z4EA 4RCHA 1EX4A 3CF5L 4U67L 3TSQA 4R5PA 1GLDG 1KSPA 5J2NA 4M3TA 3NGYA 5HOOA 5JLHA 3MXIA 3VPZA 4MQ3A 4CBWA 5LY3A 4RWTA 1GLBG 4KHUA 1KD1O 2P9UB 2VGNA 4H5TA 1D9FA 3AVJA 3O4WA 5KRSA 3RWUA 2YKNA 4EP4A 2HVHA 4IEEA 3CCJN 4IXCA 3CMAN 5I42A 3KTQA 4CHYA 1Z25A 3CCQN 1YVNA 2P5GA 4B9SA 3HT3A 1UOCA 5C42A 1VSKA 4W5RA 4FW2A 4HVJA 1KAZA 3OYDA 3KKSA 3C7NA 4FOIA 4Z4CA 4JI0K 2ATQA 2UXCK 4NYNA 1RFQA 4F2RA 3HO1A 4ILJA 4DV4K 3DXMA 1TUYA 4ID1A 4YORA 4ELTA 5BPMA 4CK1A 3JS6A 2P9IA 1X9WA 1T6DA 2QWOA 4LF6K 1KFSA 2O8DA 4AHUA 4LFAK 4JI1K 3NHGA 2QWMA 1Q18A 4OKKA 4DTXA 3GL1A 1LAVA 4CERA 2NRWA 4IKFA 2VWBA 2QA4N 3V9XA 1OH8A 3AAPA 1QQOA 3JXUA 5AFUH 1GLJO 2IIRA 4J2BA 1K8KA 3OBYA 2P5OA 4DTPA 2YKMA 3VGLA 2ITMA 3VF2A 1S9GA 1OVQA 3UKUA 5MLCQ 1HKBA 4KHWA 4CFBA 2P1JA 4GVEA 4YDUC 1S1WA 4QAGA 1ASVA 4QS9A 1VK0A 2E88A 4KFBA 1Q81O 3WEEA 1JLQA 1T44A 1WSGA 3OYFA 4EP5A 3KD5E 2D4WA 4O44A 1DT9A
chains in the Genus database with same CATH topology
1EXQA 1L5UA 3ZSYA 1W0HA 2B6AA 2G8VA 1TVRA 1ZBUA 1HPZA 1CXQA 1LAWA 1J9AA 2RN2A 3AO3A 2Q3SA 4OPKA 4RW7A 4YFUA 4HUFA 1BQNA 3V4IA 2E4LA 2KZMA 2RF2A 4CK3A 3PO4A 3HSTB 5CY4A 2F8TA 2VG5A 4DMNA 2Y1JA 3EY1A 4DSJA 1TKXA 1SL0A 1EETA 1RT2A 2G8WA 5JS1A 4BE2A 1R0AA 2XY7A 3QNNA 2OPSA 2ITGA 4I9LA 4DTUA 4N47A 4FZXC 3M8QA 1RDDA 4CJ3A 5HLFA 3BDPA 4DFMA 1DTQA 1TL3A 3QERA 1TK5A 4DTNA 2EHGA 3VQQA 3QEIA 1BIZA 2HNZA 2KW4A 1TAQA 4K8XA 1JLAA 1L3TA 5KI6A 4I7FA 3OYKA 1UWBA 2VWJA 1NJYA 1RTDA 4FXDA 4AHVA 2ETJA 3ULDA 4CIEA 5J1EA 4FLVA 4DFJA 4EZ6A 1NK6A 1HJRA 4KI6A 1LWFA 1ZBLA 3OJUA 4F3TA 4CHQA 4LSNA 2AJQA 2G8HA 1RCHA 1X1PA 3OYGA 1RT7A 4CJFA 3ITHA 4CGFA 1JLFA 3JYTA 2PYJA 3DRRA 5HROA 5HRSA 4DQIA 2EX3A 4E7LA 2OZSA 3L3UA 1SV5A 1K6YA 3HP6A 4DQQA 1IG9A 1U04A 1WSFA 2RKIA 3NF9A 4DF8A 1JXBA 1BI4A 5EU7A 3VQ5A 4CJTA 3K58A 4KREA 4CECA 3HPGA 3CFRA 4DU4A 2D0CA 4DTRA 2XRIA 4FLUA 3WNFA 4C8OA 4F8RA 4ICLA 5KGXA 3CFPA 1U45A 4HUGA 4DFKA 2QKKA 2YHBA 4CEZA 3V6DA 1UA1A 4NYFA 4E19A 1U49A 3PY8A 2Z1IA 4O5BA 4KAZA 4ELVA 2VG7A 4H4OA 2OPPA 4OJRA 4IG0A 4C8NA 1LV5A 3LP1A 3LP0A 3OYAA 3TABA 4Q0BA 4KRFA 3CM6A 3LPTA 4LSLA 5FDLA 4G1QA 1ASWA 4FLZA 4CF8A 1NJWA 3K5MA 1N6QA 3DLHA 4CHOA 4CEQA 3VQ6A 5T7BA 3MXMA 3HP9A 1NK0A 1S6QA 4OPJA 2D5RA 3HM9A 2O4GA 4BDPA 4AH9A 5HBMA 4FLWA 4NCBA 4CGJA 3T1AA 1S6PA 1QHTA 3LP3A 4CJLA 3VQDA 4B9UA 3C94A 3NF6A 2F96A 2QXFA 3EYZA 4CEBA 1HNIA 5DMRA 3PX0A 1XI1A 1U47A 5KRTA 4H4MA 4AHRA 5CZ2A 4M42A 1DLOA 1BQMA 1VSEA 2YNGA 1BCOA 1CLQA 1EKEA 1A5WA 3LPUA 1A5VA 2NUBA 1C1BA 4OGCA 3HPOA 4DLEA 4FLXA 3KLGA 4IG3A 1VSMA 1BL3A 3SUPA 1KRPA 3RTVA 3AVKA 1WLJA 3AVMA 4E89A 2HHTA 3TAFA 4I2QA 4E7IA 1SL1A 4CJEA 1NKEA 3ZT4A 1HYSA 1XC9A 1NK9A 1TAUA 1QE1A 1RBVA 4DTMA 4BDZA 4Z0UA 4B08A 3V1RA 3ZT0A 4I2PA 1L3UA 4PUOA 1KLNA 1L3VA 2B4JA 3HVTA 4IFYA 3LZIA 1B9FA 1Z26A 2Y1IA 4DF4A 4J2EA 4ZTJA 4FJKA 3NBPA 4TSXA 3ZSZA 1QSSA 4F4KA 2X74A 4KTWA 4O4GA 1DTTA 3HPHA 4OKJA 1IKWA 3CFOA 1KVCA 4B9NA 3QIOA 5FRNA 3F9KA 4BWMA 3OS1A 1Y97A 2YHAA 1NK4A 4RG8A 5SWMA 4E7KA 3CYMA 2A1SA 3M8SA 4KKOA 2X6NA 3SQ1A 4DSKA 1WSEA 1G15A 3I0SA 3OYNA 4DLGA 4JS4A 2XY6A 1NOYA 4J2DA 2HHUA 1KVBA 1RT5A 2DFFA 3SUOA 3KK1A 2PZSA 3HK2A 4LD0A 3NDKA 4QCLA 3MEGA 2DFEA 1TK0A 3QEWA 1HYVA 4BWJA 4JRQA 1TGOA 3AV9A 1FKPA 1WNSA 4LH4A 5HRNA 4Z4FA 1F21A 1SUQA 3SCXA 3SI6A 3B6PA 1WAJA 4M3ZA 4B9MA 3D0PA 4FK2A 4CEFA 1JXEA 3K59A 2XY5A 3WNGA 3K5OA 1VRTA 4CGHA 2IS3A 1QS4A 1X9SA 4DG1A 3OYEA 4BDYA 1WSHA 3T3FA 5I3UA 2PY5A 1NJXA 4OLBA 3LP2A 1I3AA 4Y1DA 1JLGA 1KCFA 1SKSA 3KK3A 4ELUA 1FKOA 1RBTA 2Z1GA 3EZ5A 3PX4A 4M3XA 4FJGA 1T7PA 1WN7A 4BE1A 3MEDA 3UIQA 1VSLA 3RR8A 3HYFA 4FK0A 2HHVA 5E41A 1RTIA 1BISA 3NF7A 2XHBA 1U4BA 4FJNA 4FYDA 1RTJA 4BACA 5CYMA 3VQ9A 4FLTA 4C8LA 2WOMA 4AILC 3TI0A 3IG1A 5C24A 1QSYA 3AVIA 5FROA 1BGXT 2P51A 3MAQA 1NKCA 4N76A 4DSEA 1W9HA 3VQCA 3NF8A 3L8BA 2OZMA 5HP1A 4B3OA 1RDCA 2B5JA 3VQ7A 3LAMA 3V9UA 1NKBA 4O0IA 2QK9A 3C95A 4Z4IA 4LY7A 1IKYA 2HW3A 3KJVA 4RW9A 1TK8A 1LW0A 3ZT1A 4FZYA 2KZZA 3P83D 4M3RA 3K5NA 1RILA 4GVMA 4CJWA 3L2UA 1TL1A 3KK2A 1U48A 3KIOA 1VSIA 3AO2A 4M3UA 1RDAA 3RMCA 3TAPA 4F2SA 3OYHA 2A1RA 3QESA 4WE1A 5SZTA 3KLFA 3O3FA 1EP4A 1ASUA 1Q9YA 4Y1CA 3CG7A 4JRPA 4C8MA 1XHXA 2YNHA 4DQSA 1GOCA 2FC0A 1C0MA 2XY8A 3WNEA 5C25A 1VRUA 3NGZA 1C1CA 3HJFA 4B9VA 3V81A 1IH7A 3I0RA 4JS5A 3HXMA 3VQPA 1JLBA 1XHZA 1S1VA 3SQ2A 4FJMA 4M3WA 4FCYA 1CZ9A 2FBYA 4CGGA 4CJPA 2D0BA 4HUEA 1SKWA 3QEPA 4C8KA 3MXJA 4E7JA 1J5OA 2DFHA 1RBSA 4E7HA 3RRHA 1C6VA 3RR7A 3VQ8A 3C6UA 2OA8A 3L2QA 2R7YA 3K57A 3VA3A 3S3MA 1YVUA 3SZ2A 3K2PA 1C1AA 3VQBA 3VN5A 4HHTA 3VA0A 3THVA 2ZD1A 3RRGA 4PY5A 3OYBA 1CXUA 3TARA 4ZTFA 4CEEA 4DWIA 3AA3A 4KB1A 3AVFA 3B6OA 3AVCA 1J53A 2JLEA 3SPZA 3ZSXA 4CJ5A 4KHYA 2YNIA 3BGRA 3DRPA 3ZSQA 4DU3A 4GW6A 2FBVA 3PUFA 2G8FA 1RT3A 1HMVA 3KLEA 2LSNA 3CQ8A 1T8EA 3ZT3A 3TAGA 4CJQA 2PYLA 2XO7A 1RT6A 4FM2A 3DI6A 3G10A 3RMDA 1RT4A 3ZCMA 4NCAA 4OLAA 1GOBA 5CZ1A 4CK2A 5KTQA 1TKZA 4CCHA 3S3OA 1TKTA 3I8DA 3KKRA 2RPIA 1ZBIA 1ZBFA 4N41A 1SKRA 3M8PA 1UA0A 3NE6A 3NAEA 4QOZB 3HL8A 4CHZA 4CFCA 5HRPA 1NK7A 1HRHA 3NGIA 3V1OA 2VG6A 3U3GA 2OPQA 3U6FA 1VSDA 3AVLA 2HB5A 2Z1JA 4FJLA 3OS2A 3LANA 4GMJB 4J2AA 5D3GA 4FJ5A 3AVGA 4CF9A 4FM1A 3V9SA 4OKEA 2BANA 4CJUA 3OJSA 2HMIA 1I39A 1RT1A 3DOLA 1WSJA 4KV8A 4FJIA 3TANA 4F3OA 1D5AA 1ZBHA 5HRRA 4MFBA 2D0AA 1KVAA 2YNFA 5JS2A 1ZYQA 3O4NA 3O4QA 4KB0A 4ZHRA 2IOCA 4FJ8A 3NH1A 4M45A 1YTUA 3AVAA 3LWLA 1FK9A 4LH5A 3OYIA 4DQRA 3IS9A 3DLBA 3HVRA 3SUNA 4DSIA 1NOZA 2HHXA 3PV8A 3AA4A 3KLIA 3L2WA 1RBRA 3CM5A 5KGWA 3LZJA 1T03A 3L2VA 3ALYA 3LAKA 3SV4A 3NH2A 2G8KA 2E6MA 3NCIA 4M3YA 1BHLA 3KD1E 4DFPA 3AVHA 4E0DA 2GV9A 1B9DA 4KTQA 1S5JA 1YTAA 2IGIA 4RW6A 4DQPA 1JLEA 3AO5A 4Z4HA 3OS0A 2BE2A 4YNQA 3DYAA 3QEXA 4CJKA 1VSHA 3ZSOA 3AO1A 4ID5A 4K8ZA 1S1TA 4FJHA 1QSLA 3ZSWA 4AHSA 1RTHA 1YT3A 3SJJA 2KFNA 2DY4A 3SUQA 4DS5A 3D45A 3TR8A 4OVLA 2X78A 4CF2A 4L8RB 1TV6A 4CFDA 4BE0A 1NK8A 3QLHA 1Q9XA 1FXXA 3M8RA 4DTOA 1IKXA 4FJJA 4B9LA 1LW2A 1LWEA 3SQ4A 1T05A 2F8SA 3QEVA 2W42A 3SYZA 1RDBA 4CE9A 1X9MA 1WAFA 4N56A 4B9TA 4M41A 2G8IA 3F73A 2IAJA 4EZ9A 3IRXA 1D8YA 4Q5VA 1KLMA 2HHQA 3ASMA 2ZQBA 4E1MA 1B92A 1S1XA 2Z1HA 5K14A 2ZE2A 3IAYA 3T19A 3AA5X 1GOAA 1IKVA 4KO0A 3LWMA 4CHNA 4CEOA 3ISNC 4E3SA 3OVNA 1HNVA 3TAQA 3AA2A 4CJRA 3K5LA 4CHPA 4FJ9A 1NJZA 3S3NA 1BIUA 4CJSA 4DU1A 3SNNA 3E01A 4Z4EA 1EX4A 3DLGA 5CYQA 4R5PA 3FFIA 1KSPA 5J2NA 3VQ4A 4M3TA 3V9WA 3OYLA 4KHNA 3NGYA 3ZSVA 3OY9A 4KHSA 3DRSA 5DK5A 5J2MA 4PWDA 4CF0A 2IC3A 3MXIA 5FRMA 4HCBA 4MQ3A 4I9QA 4PQUA 3QIPA 3LALA 4KHUA 4W5OA 3V9ZA 3DLEA 4AHCA 3V1QA 1QTMA 3NFAA 1D9FA 3AVJA 3AVNA 1JL2A 2FBTA 5KRSA 5J2PA 3RWUA 2YKNA 4EP4A 3DMJA 4XIUA 3KLHA 3A2FA 2HVHA 5J2QA 4FZZA 1HQUA 4FVMA 3LDSA 3QO9A 4CJVA 5I42A 3KTQA 4CHYA 1KTQA 3DOKA 2KFZA 4HTUA 1HQEA 1JLCA 3TAEA 4FM0A 3DLRA 1Z25A 1BI4B 2P5GA 4B9SA 4O0JA 3HT3A 4KPYA 2BDPA 1D9DA 1KFDA 1UOCA 3L3VA 1CZBA 4O55A 1VSKA 5C42A 2YV0X 3QINA 4KTZA 4RW4A 4B8CA 4W5RA 4KI4A 4FW2A 4HVJA 4CF1A 3U3YA 3TAMA 3RMAA 4W5QA 4NCGA 3OYDA 3PX6A 1S1UA 3KKSA 4FJXA 2FBXA 2QKBA 4H8KA 2G8UA 4Z4CA 2ATQA 2DTUA 4NYNA 4W5TA 4DTSA 3H08A 3L2RA 4FK4A 4F2RA 2OPRA 3S9HA 2WONA 3HO1A 1WSIA 4PA1A 3G0ZA 4N5SA 2E6LA 3MECA 3ZT2A 4CEDA 3OYJA 3VQEA 4CJ4A 4ID1A 1J54A 3MEEA 1HYZA 4ELTA 3QETA 4CK1A 4FLYA 4UQGA 1NK5A 4CIFA 4AHTA 2BGGA 4E1NA 1X9WA 1C0UA 2GUIA 3WNHA 4CEAA 4CFAA 3OYMA 1N5YA 1REVA 1KFSA 1BCMA 4AHUA 4KHQA 4CGIA 1UAXA 3JSMA 2KQ2A 3P1GA 3NHGA 1QQCA 4RW8A 4OKKA 2HNDA 4DTXA 3SV3A 2JGUA 3VQAA 4JLHA 4DSLA 1LAVA 1ITGA 4CERA 1TKDA 4FW1A 1IO2A 4CIGA 4HCCA 4IKFA 3RMBA 3QNOA 4Z4GA 3V9XA 1VSJA 4B8AB 2KTQA 1VSFA 2X6SA 4FJ7A 3P5JA 4OGEA 3AO4A 4J2BA 2VWKA 2IDOA 2P5OA 4CESA 4DTPA 1RNHA 2YKMA 3AVBA 2I5JA 4DTJA 2HHSA 4IDKA 1A5XA 1S9GA 1LWCA 3C6TA 1XWLA 4CGDA 1JKHA 4IFVA 3O3GA 3TWHA 4W5NA 3ZSRA 3DM2A 3DLKA 3PO5A 1S9EA 4IBNA 2HVIA 2HNYA 2O4IA 1MU2A 4KHWA 4CFBA 1C0TA 2P1JA 2OYQA 2HHWA 1S1WA 4QAGA 4DSFA 1ASVA 3SPYA 1VK0A 4KFBA 3NH0A 1JLQA 1WSGA 3OYFA 1SL2A 1JL1A 4EP5A 1L3SA 3OYCA 3KD5E 4DS4A 3SQ0A 1O1WA 1Q8IA 1RBUA 4O44A 2GBZA 3O3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EXQ A;  1L5U A;  3ZSY A;  1W0H A;  2B6A A;  2G8V A;  1TVR A;  1ZBU A;  1HPZ A;  1CXQ A;  1LAW A;  1J9A A;  2RN2 A;  3AO3 A;  2Q3S A;  4OPK A;  4RW7 A;  4YFU A;  4HUF A;  1BQN A;  3V4I A;  2E4L A;  2KZM A;  2RF2 A;  4CK3 A;  3PO4 A;  3HST B;  5CY4 A;  2F8T A;  2VG5 A;  4DMN A;  2Y1J A;  3EY1 A;  4DSJ A;  1TKX A;  1SL0 A;  1EET A;  1RT2 A;  2G8W A;  5JS1 A;  4BE2 A;  1R0A A;  2XY7 A;  3QNN A;  2OPS A;  2ITG A;  4I9L A;  4DTU A;  4N47 A;  4FZX C;  3M8Q A;  1RDD A;  4CJ3 A;  5HLF A;  3BDP A;  4DFM A;  1DTQ A;  1TL3 A;  3QER A;  1TK5 A;  4DTN A;  2EHG A;  3VQQ A;  3QEI A;  1BIZ A;  2HNZ A;  2KW4 A;  1TAQ A;  4K8X A;  1JLA A;  1L3T A;  5KI6 A;  4I7F A;  3OYK A;  1UWB A;  2VWJ A;  1NJY A;  1RTD A;  4FXD A;  4AHV A;  2ETJ A;  3ULD A;  4CIE A;  5J1E A;  4FLV A;  4DFJ A;  4EZ6 A;  1NK6 A;  1HJR A;  4KI6 A;  1LWF A;  1ZBL A;  3OJU A;  4F3T A;  4CHQ A;  4LSN A;  2AJQ A;  2G8H A;  1RCH A;  1X1P A;  3OYG A;  1RT7 A;  4CJF A;  3ITH A;  4CGF A;  1JLF A;  3JYT A;  2PYJ A;  3DRR A;  5HRO A;  5HRS A;  4DQI A;  2EX3 A;  4E7L A;  2OZS A;  3L3U A;  1SV5 A;  1K6Y A;  3HP6 A;  4DQQ A;  1IG9 A;  1U04 A;  1WSF A;  2RKI A;  3NF9 A;  4DF8 A;  1JXB A;  1BI4 A;  5EU7 A;  3VQ5 A;  4CJT A;  3K58 A;  4KRE A;  4CEC A;  3HPG A;  3CFR A;  4DU4 A;  2D0C A;  4DTR A;  2XRI A;  4FLU A;  3WNF A;  4C8O A;  4F8R A;  4ICL A;  5KGX A;  3CFP A;  1U45 A;  4HUG A;  4DFK A;  2QKK A;  2YHB A;  4CEZ A;  3V6D A;  1UA1 A;  4NYF A;  4E19 A;  1U49 A;  3PY8 A;  2Z1I A;  4O5B A;  4KAZ A;  4ELV A;  2VG7 A;  4H4O A;  2OPP A;  4OJR A;  4IG0 A;  4C8N A;  1LV5 A;  3LP1 A;  3LP0 A;  3OYA A;  3TAB A;  4Q0B A;  4KRF A;  3CM6 A;  3LPT A;  4LSL A;  5FDL A;  4G1Q A;  1ASW A;  4FLZ A;  4CF8 A;  1NJW A;  3K5M A;  1N6Q A;  3DLH A;  4CHO A;  4CEQ A;  3VQ6 A;  5T7B A;  3MXM A;  3HP9 A;  1NK0 A;  1S6Q A;  4OPJ A;  2D5R A;  3HM9 A;  2O4G A;  4BDP A;  4AH9 A;  5HBM A;  4FLW A;  4NCB A;  4CGJ A;  3T1A A;  1S6P A;  1QHT A;  3LP3 A;  4CJL A;  3VQD A;  4B9U A;  3C94 A;  3NF6 A;  2F96 A;  2QXF A;  3EYZ A;  4CEB A;  1HNI A;  5DMR A;  3PX0 A;  1XI1 A;  1U47 A;  5KRT A;  4H4M A;  4AHR A;  5CZ2 A;  4M42 A;  1DLO A;  1BQM A;  1VSE A;  2YNG A;  1BCO A;  1CLQ A;  1EKE A;  1A5W A;  3LPU A;  1A5V A;  2NUB A;  1C1B A;  4OGC A;  3HPO A;  4DLE A;  4FLX A;  3KLG A;  4IG3 A;  1VSM A;  1BL3 A;  3SUP A;  1KRP A;  3RTV A;  3AVK A;  1WLJ A;  3AVM A;  4E89 A;  2HHT A;  3TAF A;  4I2Q A;  4E7I A;  1SL1 A;  4CJE A;  1NKE A;  3ZT4 A;  1HYS A;  1XC9 A;  1NK9 A;  1TAU A;  1QE1 A;  1RBV A;  4DTM A;  4BDZ A;  4Z0U A;  4B08 A;  3V1R A;  3ZT0 A;  4I2P A;  1L3U A;  4PUO A;  1KLN A;  1L3V A;  2B4J A;  3HVT A;  4IFY A;  3LZI A;  1B9F A;  1Z26 A;  2Y1I A;  4DF4 A;  4J2E A;  4ZTJ A;  4FJK A;  3NBP A;  4TSX A;  3ZSZ A;  1QSS A;  4F4K A;  2X74 A;  4KTW A;  4O4G A;  1DTT A;  3HPH A;  4OKJ A;  1IKW A;  3CFO A;  1KVC A;  4B9N A;  3QIO A;  5FRN A;  3F9K A;  4BWM A;  3OS1 A;  1Y97 A;  2YHA A;  1NK4 A;  4RG8 A;  5SWM A;  4E7K A;  3CYM A;  2A1S A;  3M8S A;  4KKO A;  2X6N A;  3SQ1 A;  4DSK A;  1WSE A;  1G15 A;  3I0S A;  3OYN A;  4DLG A;  4JS4 A;  2XY6 A;  1NOY A;  4J2D A;  2HHU A;  1KVB A;  1RT5 A;  2DFF A;  3SUO A;  3KK1 A;  2PZS A;  3HK2 A;  4LD0 A;  3NDK A;  4QCL A;  3MEG A;  2DFE A;  1TK0 A;  3QEW A;  1HYV A;  4BWJ A;  4JRQ A;  1TGO A;  3AV9 A;  1FKP A;  1WNS A;  4LH4 A;  5HRN A;  4Z4F A;  1F21 A;  1SUQ A;  3SCX A;  3SI6 A;  3B6P A;  1WAJ A;  4M3Z A;  4B9M A;  3D0P A;  4FK2 A;  4CEF A;  1JXE A;  3K59 A;  2XY5 A;  3WNG A;  3K5O A;  1VRT A;  4CGH A;  2IS3 A;  1QS4 A;  1X9S A;  4DG1 A;  3OYE A;  4BDY A;  1WSH A;  3T3F A;  5I3U A;  2PY5 A;  1NJX A;  4OLB A;  3LP2 A;  1I3A A;  4Y1D A;  1JLG A;  1KCF A;  1SKS A;  3KK3 A;  4ELU A;  1FKO A;  1RBT A;  2Z1G A;  3EZ5 A;  3PX4 A;  4M3X A;  4FJG A;  1T7P A;  1WN7 A;  4BE1 A;  3MED A;  3UIQ A;  1VSL A;  3RR8 A;  3HYF A;  4FK0 A;  2HHV A;  5E41 A;  1RTI A;  1BIS A;  3NF7 A;  2XHB A;  1U4B A;  4FJN A;  4FYD A;  1RTJ A;  4BAC A;  5CYM A;  3VQ9 A;  4FLT A;  4C8L A;  2WOM A;  4AIL C;  3TI0 A;  3IG1 A;  5C24 A;  1QSY A;  3AVI A;  5FRO A;  1BGX T;  2P51 A;  3MAQ A;  1NKC A;  4N76 A;  4DSE A;  1W9H A;  3VQC A;  3NF8 A;  3L8B A;  2OZM A;  5HP1 A;  4B3O A;  1RDC A;  2B5J A;  3VQ7 A;  3LAM A;  3V9U A;  1NKB A;  4O0I A;  2QK9 A;  3C95 A;  4Z4I A;  4LY7 A;  1IKY A;  2HW3 A;  3KJV A;  4RW9 A;  1TK8 A;  1LW0 A;  3ZT1 A;  4FZY A;  2KZZ A;  3P83 D;  4M3R A;  3K5N A;  1RIL A;  4GVM A;  4CJW A;  3L2U A;  1TL1 A;  3KK2 A;  1U48 A;  3KIO A;  1VSI A;  3AO2 A;  4M3U A;  1RDA A;  3RMC A;  3TAP A;  4F2S A;  3OYH A;  2A1R A;  3QES A;  4WE1 A;  5SZT A;  3KLF A;  3O3F A;  1EP4 A;  1ASU A;  1Q9Y A;  4Y1C A;  3CG7 A;  4JRP A;  4C8M A;  1XHX A;  2YNH A;  4DQS A;  1GOC A;  2FC0 A;  1C0M A;  2XY8 A;  3WNE A;  5C25 A;  1VRU A;  3NGZ A;  1C1C A;  3HJF A;  4B9V A;  3V81 A;  1IH7 A;  3I0R A;  4JS5 A;  3HXM A;  3VQP A;  1JLB A;  1XHZ A;  1S1V A;  3SQ2 A;  4FJM A;  4M3W A;  4FCY A;  1CZ9 A;  2FBY A;  4CGG A;  4CJP A;  2D0B A;  4HUE A;  1SKW A;  3QEP A;  4C8K A;  3MXJ A;  4E7J A;  1J5O A;  2DFH A;  1RBS A;  4E7H A;  3RRH A;  1C6V A;  3RR7 A;  3VQ8 A;  3C6U A;  2OA8 A;  3L2Q A;  2R7Y A;  3K57 A;  3VA3 A;  3S3M A;  1YVU A;  3SZ2 A;  3K2P A;  1C1A A;  3VQB A;  3VN5 A;  4HHT A;  3VA0 A;  3THV A;  2ZD1 A;  3RRG A;  4PY5 A;  3OYB A;  1CXU A;  3TAR A;  4ZTF A;  4CEE A;  4DWI A;  3AA3 A;  4KB1 A;  3AVF A;  3B6O A;  3AVC A;  1J53 A;  2JLE A;  3SPZ A;  3ZSX A;  4CJ5 A;  4KHY A;  2YNI A;  3BGR A;  3DRP A;  3ZSQ A;  4DU3 A;  4GW6 A;  2FBV A;  3PUF A;  2G8F A;  1RT3 A;  1HMV A;  3KLE A;  2LSN A;  3CQ8 A;  1T8E A;  3ZT3 A;  3TAG A;  4CJQ A;  2PYL A;  2XO7 A;  1RT6 A;  4FM2 A;  3DI6 A;  3G10 A;  3RMD A;  1RT4 A;  3ZCM A;  4NCA A;  4OLA A;  1GOB A;  5CZ1 A;  4CK2 A;  5KTQ A;  1TKZ A;  4CCH A;  3S3O A;  1TKT A;  3I8D A;  3KKR A;  2RPI A;  1ZBI A;  1ZBF A;  4N41 A;  1SKR A;  3M8P A;  1UA0 A;  3NE6 A;  3NAE A;  4QOZ B;  3HL8 A;  4CHZ A;  4CFC A;  5HRP A;  1NK7 A;  1HRH A;  3NGI A;  3V1O A;  2VG6 A;  3U3G A;  2OPQ A;  3U6F A;  1VSD A;  3AVL A;  2HB5 A;  2Z1J A;  4FJL A;  3OS2 A;  3LAN A;  4GMJ B;  4J2A A;  5D3G A;  4FJ5 A;  3AVG A;  4CF9 A;  4FM1 A;  3V9S A;  4OKE A;  2BAN A;  4CJU A;  3OJS A;  2HMI A;  1I39 A;  1RT1 A;  3DOL A;  1WSJ A;  4KV8 A;  4FJI A;  3TAN A;  4F3O A;  1D5A A;  1ZBH A;  5HRR A;  4MFB A;  2D0A A;  1KVA A;  2YNF A;  5JS2 A;  1ZYQ A;  3O4N A;  3O4Q A;  4KB0 A;  4ZHR A;  2IOC A;  4FJ8 A;  3NH1 A;  4M45 A;  1YTU A;  3AVA A;  3LWL A;  1FK9 A;  4LH5 A;  3OYI A;  4DQR A;  3IS9 A;  3DLB A;  3HVR A;  3SUN A;  4DSI A;  1NOZ A;  2HHX A;  3PV8 A;  3AA4 A;  3KLI A;  3L2W A;  1RBR A;  3CM5 A;  5KGW A;  3LZJ A;  1T03 A;  3L2V A;  3ALY A;  3LAK A;  3SV4 A;  3NH2 A;  2G8K A;  2E6M A;  3NCI A;  4M3Y A;  1BHL A;  3KD1 E;  4DFP A;  3AVH A;  4E0D A;  2GV9 A;  1B9D A;  4KTQ A;  1S5J A;  1YTA A;  2IGI A;  4RW6 A;  4DQP A;  1JLE A;  3AO5 A;  4Z4H A;  3OS0 A;  2BE2 A;  4YNQ A;  3DYA A;  3QEX A;  4CJK A;  1VSH A;  3ZSO A;  3AO1 A;  4ID5 A;  4K8Z A;  1S1T A;  4FJH A;  1QSL A;  3ZSW A;  4AHS A;  1RTH A;  1YT3 A;  3SJJ A;  2KFN A;  2DY4 A;  3SUQ A;  4DS5 A;  3D45 A;  3TR8 A;  4OVL A;  2X78 A;  4CF2 A;  4L8R B;  1TV6 A;  4CFD A;  4BE0 A;  1NK8 A;  3QLH A;  1Q9X A;  1FXX A;  3M8R A;  4DTO A;  1IKX A;  4FJJ A;  4B9L A;  1LW2 A;  1LWE A;  3SQ4 A;  1T05 A;  2F8S A;  3QEV A;  2W42 A;  3SYZ A;  1RDB A;  4CE9 A;  1X9M A;  1WAF A;  4N56 A;  4B9T A;  4M41 A;  2G8I A;  3F73 A;  2IAJ A;  4EZ9 A;  3IRX A;  1D8Y A;  4Q5V A;  1KLM A;  2HHQ A;  3ASM A;  2ZQB A;  4E1M A;  1B92 A;  1S1X A;  2Z1H A;  5K14 A;  2ZE2 A;  3IAY A;  3T19 A;  3AA5 X;  1GOA A;  1IKV A;  4KO0 A;  3LWM A;  4CHN A;  4CEO A;  3ISN C;  4E3S A;  3OVN A;  1HNV A;  3TAQ A;  3AA2 A;  4CJR A;  3K5L A;  4CHP A;  4FJ9 A;  1NJZ A;  3S3N A;  1BIU A;  4CJS A;  4DU1 A;  3SNN A;  3E01 A;  4Z4E A;  1EX4 A;  3DLG A;  5CYQ A;  4R5P A;  3FFI A;  1KSP A;  5J2N A;  3VQ4 A;  4M3T A;  3V9W A;  3OYL A;  4KHN A;  3NGY A;  3ZSV A;  3OY9 A;  4KHS A;  3DRS A;  5DK5 A;  5J2M A;  4PWD A;  4CF0 A;  2IC3 A;  3MXI A;  5FRM A;  4HCB A;  4MQ3 A;  4I9Q A;  4PQU A;  3QIP A;  3LAL A;  4KHU A;  4W5O A;  3V9Z A;  3DLE A;  4AHC A;  3V1Q A;  1QTM A;  3NFA A;  1D9F A;  3AVJ A;  3AVN A;  1JL2 A;  2FBT A;  5KRS A;  5J2P A;  3RWU A;  2YKN A;  4EP4 A;  3DMJ A;  4XIU A;  3KLH A;  3A2F A;  2HVH A;  5J2Q A;  4FZZ A;  1HQU A;  4FVM A;  3LDS A;  3QO9 A;  4CJV A;  5I42 A;  3KTQ A;  4CHY A;  1KTQ A;  3DOK A;  2KFZ A;  4HTU A;  1HQE A;  1JLC A;  3TAE A;  4FM0 A;  3DLR A;  1Z25 A;  1BI4 B;  2P5G A;  4B9S A;  4O0J A;  3HT3 A;  4KPY A;  2BDP A;  1D9D A;  1KFD A;  1UOC A;  3L3V A;  1CZB A;  4O55 A;  1VSK A;  5C42 A;  2YV0 X;  3QIN A;  4KTZ A;  4RW4 A;  4B8C A;  4W5R A;  4KI4 A;  4FW2 A;  4HVJ A;  4CF1 A;  3U3Y A;  3TAM A;  3RMA A;  4W5Q A;  4NCG A;  3OYD A;  3PX6 A;  1S1U A;  3KKS A;  4FJX A;  2FBX A;  2QKB A;  4H8K A;  2G8U A;  4Z4C A;  2ATQ A;  2DTU A;  4NYN A;  4W5T A;  4DTS A;  3H08 A;  3L2R A;  4FK4 A;  4F2R A;  2OPR A;  3S9H A;  2WON A;  3HO1 A;  1WSI A;  4PA1 A;  3G0Z A;  4N5S A;  2E6L A;  3MEC A;  3ZT2 A;  4CED A;  3OYJ A;  3VQE A;  4CJ4 A;  4ID1 A;  1J54 A;  3MEE A;  1HYZ A;  4ELT A;  3QET A;  4CK1 A;  4FLY A;  4UQG A;  1NK5 A;  4CIF A;  4AHT A;  2BGG A;  4E1N A;  1X9W A;  1C0U A;  2GUI A;  3WNH A;  4CEA A;  4CFA A;  3OYM A;  1N5Y A;  1REV A;  1KFS A;  1BCM A;  4AHU A;  4KHQ A;  4CGI A;  1UAX A;  3JSM A;  2KQ2 A;  3P1G A;  3NHG A;  1QQC A;  4RW8 A;  4OKK A;  2HND A;  4DTX A;  3SV3 A;  2JGU A;  3VQA A;  4JLH A;  4DSL A;  1LAV A;  1ITG A;  4CER A;  1TKD A;  4FW1 A;  1IO2 A;  4CIG A;  4HCC A;  4IKF A;  3RMB A;  3QNO A;  4Z4G A;  3V9X A;  1VSJ A;  4B8A B;  2KTQ A;  1VSF A;  2X6S A;  4FJ7 A;  3P5J A;  4OGE A;  3AO4 A;  4J2B A;  2VWK A;  2IDO A;  2P5O A;  4CES A;  4DTP A;  1RNH A;  2YKM A;  3AVB A;  2I5J A;  4DTJ A;  2HHS A;  4IDK A;  1A5X A;  1S9G A;  1LWC A;  3C6T A;  1XWL A;  4CGD A;  1JKH A;  4IFV A;  3O3G A;  3TWH A;  4W5N A;  3ZSR A;  3DM2 A;  3DLK A;  3PO5 A;  1S9E A;  4IBN A;  2HVI A;  2HNY A;  2O4I A;  1MU2 A;  4KHW A;  4CFB A;  1C0T A;  2P1J A;  2OYQ A;  2HHW A;  1S1W A;  4QAG A;  4DSF A;  1ASV A;  3SPY A;  1VK0 A;  4KFB A;  3NH0 A;  1JLQ A;  1WSG A;  3OYF A;  1SL2 A;  1JL1 A;  4EP5 A;  1L3S A;  3OYC A;  3KD5 E;  4DS4 A;  3SQ0 A;  1O1W A;  1Q8I A;  1RBU A;  4O44 A;  2GBZ A;  3O3H A; 
#chains in the Genus database with same CATH topology
 3CXC M;  3ZSY A;  1W0H A;  1E3M A;  1LAW A;  2Q3S A;  3MN5 A;  2E4L A;  2KZM A;  4MLH A;  1QQM A;  3A5M C;  4DSJ A;  2HF3 A;  2G8W A;  5JS1 A;  1R0A A;  4Y0W A;  2XY7 A;  3VES A;  2QM1 A;  1EWR A;  2ZJP L;  3KWI A;  3T1Y K;  4K8X A;  5KI6 A;  4I7F A;  1NJY A;  1U2V A;  4AHV A;  2ETJ A;  3NMU A;  4OPH A;  1YAG A;  3OA9 A;  3WQT A;  4PKH A;  4CHQ A;  2AJQ A;  2G8H A;  1X1P A;  3ITH A;  1JLF A;  3UKR B;  4E7L A;  4BRI A;  4ISF A;  4DQQ A;  3BY5 A;  2RKI A;  4BRN A;  1BI4 A;  5EU7 A;  1ILY A;  2NRH A;  4CJT A;  2NRV A;  5M1O A;  4B1X B;  4DKW A;  4DU4 A;  4DTR A;  3BZC A;  2PBD A;  3Q7C A;  4FLU A;  1U45 A;  4DFK A;  4JEP A;  4FWN A;  4B9Q A;  3V6D A;  5AQL A;  1DGK N;  1LV5 A;  3LP1 A;  3SK3 A;  1QHA A;  2A6A A;  4LSL A;  5FDL A;  3DLH A;  1NJW A;  3FFK B;  4DV7 K;  4CEQ A;  3MXM A;  2Q36 A;  2D5R A;  3THY B;  4EHT A;  1VQL N;  5HBM A;  4NCB A;  4ISE A;  2F96 A;  3W3D A;  1HNI A;  3PX0 A;  4H4M A;  4AHR A;  5CZ2 A;  4M42 A;  2F9W A;  2YNG A;  1A5W A;  3LPU A;  2NUB A;  4OGC A;  1C1B A;  3HPO A;  4WQ4 A;  4GV9 A;  3KLG A;  2ASM A;  1K8A O;  1KRP A;  2HHT A;  4E89 A;  1S72 N;  3QB0 A;  3VEZ A;  4A59 A;  2UXB K;  4Z0U A;  4B08 A;  3E66 A;  3ZT0 A;  3O1W A;  4IFY A;  2ZGZ A;  3LZI A;  1Z26 A;  1YUW A;  2Y1I A;  4BC3 A;  4J2E A;  4ZTJ A;  4A57 A;  2D0O A;  4F4K A;  3H45 C;  3J7A P;  1Y97 A;  3TTF A;  5JVG L;  3CYM A;  4KKO A;  1SS6 A;  3LDQ A;  2X6N A;  3G4S N;  3IMX A;  2Q31 A;  4DLG A;  2XY6 A;  1NOY A;  4J2D A;  3ZEU B;  5GIO A;  1C0F A;  2AP1 A;  4DR7 K;  1RT5 A;  3P39 A;  4YOV A;  4QCL A;  4LD0 A;  5ADX A;  3MEG A;  4B1W B;  3MMV A;  4JRQ A;  2Q97 A;  1WNS A;  5HRN A;  4KH5 A;  2O8E B;  2A40 A;  2P9L B;  3SCX A;  3VEX A;  3H1Q A;  2D1K A;  4WCE L;  3CJA A;  3W0L A;  4CEF A;  5BPN A;  4CGH A;  1QS4 A;  1RGI A;  4JKB A;  5AQM A;  1NJX A;  3LP2 A;  1I3A A;  1JLG A;  4ISG A;  4H0X B;  3VF6 A;  1RBT A;  3EZ5 A;  2V52 B;  1M90 O;  5AQI A;  3PSF A;  4H0P A;  3RR8 A;  1BIS A;  4FJN A;  1U4B A;  4IZ9 A;  4C8L A;  3UE5 A;  1YI2 N;  2P51 A;  3R8E A;  4DSE A;  1J5E K;  5HP1 A;  2B5J A;  3VQ7 A;  3LAM A;  2O8F B;  4O0I A;  4LY7 A;  1IKY A;  3KJV A;  4RW9 A;  3ZT1 A;  1Q82 O;  3G71 N;  3THW A;  3K5N A;  1RIL A;  3LDO A;  3O8M A;  4O5F A;  3KK2 A;  1U48 A;  1RDA A;  3RMC A;  4F2S A;  3FZM A;  3OYH A;  4JNE A;  3QES A;  5SZT A;  4MO5 A;  4V19 S;  1EP4 A;  1TYQ B;  4Y1C A;  4DQS A;  2FC0 A;  5C25 A;  5AQN A;  5BRD A;  4B9V A;  2Q0R A;  3CPW M;  1S1V A;  4M3W A;  4CJP A;  3MXJ A;  3IDH A;  4E7H A;  3RRH A;  3RR7 A;  3C6U A;  4JI6 K;  3L2Q A;  4AM7 A;  3SZ2 A;  1C1A A;  3DAW A;  3VN5 A;  2ZD1 A;  3CCR N;  4ZTF A;  4DWI A;  4KB1 A;  1J53 A;  2E2P A;  3ZSX A;  4KHY A;  5AQW A;  3MWT A;  5KPZ A;  3ZSQ A;  3EE9 A;  2G8F A;  4BRA A;  4MDA A;  2OTL N;  3ZT3 A;  2ASP A;  4CJQ A;  2P9S B;  3RMD A;  1RT4 A;  3CC7 N;  2GWK A;  5M1N A;  4OLA A;  1P90 A;  3CD6 N;  4IO9 L;  5ELZ A;  3S3O A;  5AQJ A;  3EN9 A;  4M63 C;  5F2R A;  3KKR A;  2RPI A;  3VEY A;  4JK7 A;  5H1S Q;  1SKR A;  4N41 A;  4EHU A;  1LCU A;  3NE6 A;  3MX2 A;  3HL8 A;  4BRK A;  5CR4 A;  5HRP A;  2ZJQ L;  1HRH A;  3V1O A;  2VG6 A;  2OPQ A;  3U6F A;  3AAQ A;  2BUP A;  2QWP A;  2QWL A;  4FJL A;  4CZJ A;  4FJ5 A;  3AVG A;  4CD1 A;  1NU0 A;  3OJS A;  2HMI A;  4YDU A;  2O8C B;  4FJI A;  3TAN A;  1D5A A;  3O9T A;  5HRR A;  4DR6 K;  2IVO A;  3VGK A;  4JKF A;  5F1X A;  4LH5 A;  3OYI A;  2E2O A;  4PL7 A;  4KH4 A;  3SUN A;  4DSI A;  3F2K A;  5FPN A;  4JD2 B;  3CJC A;  1RBR A;  3ENO A;  5JMV A;  1LOT B;  1NNE A;  4CD3 A;  3WT0 A;  3NCI A;  4M3Y A;  2HBK A;  3VEN A;  3O6W A;  2F7T A;  3VOV A;  3D7E O;  1B9D A;  4KTQ A;  3LDN A;  4RW6 A;  2FSN A;  4YOX A;  1JLE A;  3AO5 A;  4YNQ A;  3R3L A;  1VSH A;  2GWJ A;  3EZW A;  3BUZ B;  3AO1 A;  4ID5 A;  1RTH A;  2YHW A;  2DY4 A;  5EOY A;  1EO1 A;  1MA9 B;  4OVL A;  1TV6 A;  4X64 K;  4BE0 A;  3QLH A;  3IFR A;  1IKX A;  2OAN A;  3SQ4 A;  1T05 A;  2F8S A;  3QEV A;  1RDB A;  1WAF A;  4B9T A;  4M41 A;  4PKG A;  3M1F A;  4EZ9 A;  3IRX A;  1D8Y A;  2ZQB A;  4DV3 K;  4E1M A;  3KK7 A;  1S1X A;  3SMS A;  3IAY A;  3T19 A;  3AA5 X;  3TU5 A;  4CHN A;  4E3S A;  1HNV A;  3E1Y A;  3T1H K;  3S3N A;  3ATU A;  5AJ3 K;  3DLG A;  5CYQ A;  5BR8 K;  3V9W A;  4KHS A;  5AQQ A;  3DRS A;  4PWD A;  2IC3 A;  5B8H A;  3O9Q A;  3MN6 A;  4A62 A;  2IVN A;  2P9P A;  3LAL A;  3QIP A;  5CHI A;  4K43 A;  1KAY A;  2HBJ A;  3NFA A;  1E4F T;  1JL2 A;  3KLH A;  3TSP A;  1NG9 A;  4FZZ A;  4FVM A;  4CJV A;  1JLC A;  3TAE A;  3DLR A;  3FZF A;  1M1K O;  1KQS M;  4KPY A;  1KFD A;  5EX5 A;  1CZB A;  5JIC A;  4O55 A;  5CE3 A;  4KTZ A;  4B8C A;  2J4R A;  2E20 A;  4J8F A;  3UB5 A;  4KI4 A;  4H0V B;  4CF1 A;  3U3Y A;  4FJX A;  4W5Q A;  3PX6 A;  2HST A;  1OH6 A;  5KQ8 A;  4H8K A;  2WUS A;  2DTU A;  3ZX3 A;  2QWN A;  1WSI A;  4BRL A;  1TUU A;  3OYJ A;  4CJ4 A;  1IJJ A;  3MEE A;  1HYZ A;  1Z6R A;  3MWP A;  4CIF A;  3SAG A;  2BGG A;  1HNX K;  1C0U A;  2GUI A;  4CEA A;  4CFA A;  5FLX O;  1N5Y A;  1KXP A;  4H5R A;  4KHQ A;  3P1G A;  1QQC A;  4RW8 A;  2HND A;  3SV3 A;  4JAX A;  3VQA A;  4DSL A;  1GLC G;  1VQ9 N;  3VTH A;  4HCC A;  3QNO A;  2NZT A;  5M1Q A;  4B8A B;  4B1U B;  4FJ7 A;  2X6S A;  3P4I A;  3AO4 A;  2WFB A;  4FL9 A;  1RDW X;  2DPN A;  3AVB A;  3GE1 A;  4IDK A;  1A5X A;  3OHR A;  1LWC A;  2ZWH A;  4IJN A;  4IFV A;  3O3G A;  4YY3 K;  4DV5 K;  3DM2 A;  3QFP A;  1S9E A;  3CET A;  4IBN A;  4BGA A;  2OYQ A;  2HHW A;  3AGR A;  3C65 A;  4AF1 A;  2QWR A;  3SPY A;  4X62 K;  1L3S A;  2QTD A;  4FWR A;  4DS4 A;  3A8Y A;  4B3S K;  2GBZ A;  1EXQ A;  3H46 O;  4C1N I;  4A61 A;  4KBO A;  1TVR A;  5EY4 A;  4HUF A;  2KLA A;  4YFU A;  3AO3 A;  3J81 O;  4RW7 A;  3FLC O;  3V4I A;  2RF2 A;  4CK3 A;  3HST B;  5AQO A;  3THX A;  1H1V A;  2ASO A;  2WC9 A;  1TKX A;  1RT2 A;  4BE2 A;  2ITG A;  4N47 A;  4CJ3 A;  3BDP A;  4DFM A;  1DTQ A;  1YF5 L;  1TK5 A;  3VQQ A;  5AZI A;  4BC5 A;  1JLA A;  1NJI O;  1VQK N;  2O8B B;  3ULD A;  4EZ6 A;  5J1E A;  1HJR A;  1ZBL A;  1YIT N;  1BA1 A;  2F9T A;  3RSE B;  4CJF A;  4CGF A;  1VQ5 N;  2PYJ A;  3DRR A;  4DQI A;  3L3U A;  3VGM A;  1IG9 A;  5AZJ B;  4I9Q A;  1U04 A;  1JXB A;  3K58 A;  4KRE A;  4CEC A;  3HPG A;  3CFR A;  2A41 A;  3CCM N;  4F8R A;  3R9P A;  4LF4 K;  4HUG A;  1YJN N;  4WQ5 C;  3HOT A;  4NYF A;  1HKG A;  3L6Q A;  1XMQ K;  3U8X A;  2VG7 A;  4DV6 K;  3THY A;  4IG0 A;  4LFC K;  2GTD A;  5AQG A;  3MN7 A;  3K0S A;  3CM6 A;  3VEV A;  4FLZ A;  4UY8 O;  1ASW A;  1N6Q A;  4CHO A;  1NK0 A;  4OPJ A;  3HM9 A;  2O4G A;  4AH9 A;  4CGJ A;  3BEX A;  3T1A A;  3ULE B;  3VQD A;  4B9U A;  3D2E B;  2QXF A;  3EYZ A;  1XI1 A;  1U47 A;  3HBT A;  5IWA K;  1BQM A;  1VSE A;  1BCO A;  1CLQ A;  1EKE A;  4DLE A;  4FLX A;  4IG3 A;  1VSM A;  1V4S A;  3ZX2 A;  3VET A;  1WLJ A;  3AVM A;  4FOE A;  3TAF A;  1SL1 A;  3ZT4 A;  1YHQ N;  1TAU A;  3G6E N;  4H5W A;  4DTM A;  4BRH A;  2VQF K;  1L3U A;  4PUO A;  4LF8 K;  2B4J A;  4CZF A;  1QQN A;  1BUP A;  2BTF A;  2PAV A;  4O8U A;  4JHD A;  3ZSZ A;  3J80 O;  4XEI A;  3HPH A;  2E2Q A;  4GY2 B;  1KVC A;  3QDK A;  4GKK K;  3QIO A;  3F9K A;  3WXJ A;  4RG8 A;  4E7K A;  2A1S A;  3PIP L;  3OBW A;  4AQY K;  2O8E A;  1WSE A;  2P9L A;  4H5V A;  3CQY A;  3SAF A;  3SUO A;  2DFF A;  2PZS A;  3HK2 A;  3U9Z A;  2DFE A;  2FF6 A;  3QEW A;  1FKP A;  3SI6 A;  3JAM O;  1JCG A;  3D0P A;  1WOQ A;  3CQX A;  3K59 A;  2P9N B;  3BZK A;  1X9S A;  4DG1 A;  3T3F A;  4BDY A;  2PY5 A;  4WFB L;  5I3U A;  4I6M B;  4WFA L;  4XH5 A;  1SKS A;  5AQV A;  5A2Q O;  3O9S A;  3PX4 A;  3S41 A;  3KHY A;  3NF7 A;  3VQ9 A;  5GAG P;  3SJH A;  1N32 K;  1QSY A;  3AVI A;  1NKC A;  1VQ4 N;  2HBM A;  5F0X A;  4Z4I A;  4YOT A;  1NGJ A;  4R79 A;  4CJW A;  1EQY A;  4CZH A;  2A1R A;  4WE1 A;  4C8M A;  1U6Z A;  1OH7 A;  3L4Q A;  1C0M A;  2XY8 A;  1HNZ K;  3NGZ A;  3V81 A;  3HXM A;  3VQP A;  1QVF M;  1HKC A;  3VEO A;  3CCS N;  2FBY A;  4HUE A;  1SKW A;  1IBK K;  4C8K A;  1YIJ N;  1T6C A;  2WTU A;  1Q7Y O;  3Q7B A;  4DV2 K;  3S3M A;  3F9M A;  1YVU A;  3THV A;  4HHT A;  1HLU A;  4PY5 A;  1VHX A;  1IBL K;  4KH6 A;  4H0T B;  3AA3 A;  3AVF A;  3B6O A;  3AVC A;  3CIP A;  4CJ5 A;  4JI3 K;  3BGR A;  4JKG B;  4DU3 A;  3PIO L;  2FBV A;  3PUF A;  1RT3 A;  1HMV A;  4BGB A;  3KLE A;  2LSN A;  3CQ8 A;  2NNW A;  5C12 A;  2XO7 A;  1RT6 A;  4NLB A;  4EIA A;  5AFU A;  4FM2 A;  3G10 A;  3O80 A;  3T69 A;  4B1Z A;  3C7N B;  3H3N O;  4CK2 A;  1ATS A;  1O13 A;  1TKT A;  4LF7 K;  1K73 O;  1NGC A;  3DXM B;  3NAE A;  3M5R A;  4CHZ A;  2O8C A;  1VSD A;  2Z1J A;  4JV5 K;  2P9I B;  4GMJ B;  3V9S A;  4CJU A;  2BAN A;  3CPE A;  1I39 A;  3DOL A;  5TKW A;  4RTF D;  4MFB A;  4BC2 A;  5JS2 A;  4FWQ A;  3WXM B;  1ZYQ A;  3O4N A;  2OTJ N;  2QWQ A;  4ZHR A;  2IOC A;  1S3X A;  1BDG A;  5AQH A;  4M45 A;  1YTU A;  3LWL A;  4LC9 B;  4DQR A;  4LFB K;  4IOC L;  1I94 K;  2HHX A;  3PV8 A;  3AA4 A;  5KGW A;  1T03 A;  3L2V A;  3RVC A;  2G8K A;  4FWL A;  1GLL O;  2YX6 A;  4E0D A;  2GV9 A;  1S22 A;  1S5J A;  3OS0 A;  3DYA A;  3ZSO A;  3ENH A;  4K8Z A;  3SBG A;  4FJH A;  1QSL A;  3ZSW A;  1YT3 A;  2KFN A;  3O1B A;  1D4X A;  4DS5 A;  3SUQ A;  3L0Q A;  4CF2 A;  4L8R B;  3WEE B;  1C0G A;  1FXX A;  4DTO A;  1KAX A;  1LW2 A;  1LWE A;  2QI2 A;  2GX9 A;  4DR3 K;  3SYZ A;  4BR7 A;  3E9O A;  4N56 A;  3F73 A;  4WYB A;  3ASM A;  4FWO A;  2A5X A;  1B92 A;  4QS7 A;  3IUC A;  5K14 A;  1E4G T;  1WBD A;  2ZE2 A;  2OCE A;  5AQY A;  3FR0 A;  3TAQ A;  3AA2 A;  3K5L A;  3CCE N;  4CJS A;  4FPB A;  3E01 A;  2CGK A;  3LL3 A;  3FFI A;  2E1Z A;  3OYL A;  4KHN A;  3OY9 A;  4WQ5 A;  4CF0 A;  5FRM A;  1NM1 A;  2A42 A;  3MK6 A;  1U2V B;  3V9Z A;  4A2B A;  4BQZ A;  3BF3 A;  4BR5 A;  4AHC A;  3CHW A;  1QTM A;  5J2P A;  2FBT A;  1HNW K;  3DMJ A;  5J2Q A;  4MO4 A;  1HQU A;  4DV1 K;  3FZH A;  4HTU A;  3OW2 M;  1HQE A;  1P8Z A;  1BI4 B;  3MCP A;  1BOT O;  1V4T A;  2BDP A;  3B8A X;  3L3V A;  1NBW A;  2AA4 A;  2YV0 X;  3EO3 A;  3A0I X;  3TAM A;  4NCG A;  5GAE P;  2QKB A;  4DUY K;  2HOE A;  3U4L A;  1YJ9 N;  1KC8 O;  3E9P A;  4DTS A;  3L2R A;  3S9H A;  3FE1 A;  3G0Z A;  4CED A;  4ILH A;  3VQE A;  3OTO K;  3QET A;  4FLY A;  4UQG A;  1NGD A;  1HPM A;  5LMN K;  3WNH A;  1W97 L;  4IOX A;  2E1Y A;  2NRZ A;  4O8K A;  2Q0U A;  3WXL A;  4DHY A;  3HZ6 A;  2JGU A;  4JLH A;  1ZC6 A;  5AR0 A;  1ITG A;  2YCH A;  4HWI A;  4FW1 A;  4BR4 A;  1TKD A;  1IO2 A;  5BRH A;  1YJW N;  3RMB A;  1ATN A;  2FXU A;  2PFU A;  3O5B A;  3MN9 A;  4OGE A;  5C0Y A;  2VWK A;  5TKY A;  2HHS A;  3D2F B;  1XWL A;  4CGD A;  2UUA K;  1IBM K;  3DLK A;  1QVG M;  4B3M K;  4H03 B;  2O4I A;  3I33 A;  1MU2 A;  4AM6 A;  3PLA A;  5C10 A;  5DM7 L;  1VQM N;  4NXM K;  1SL2 A;  1JL1 A;  4DV0 K;  3OYC A;  3EL2 A;  3SQ0 A;  2YHX A;  2CGL A;  3CCL N;  1RBU A;  4BG9 A;  5C2D A;  3O3H A;  1L5U A;  4OPK A;  2OA8 A;  2RN2 A;  1J9A A;  3A5O C;  2ZJR L;  3PO4 A;  1SL0 A;  2VGM A;  1EET A;  2GEM A;  3QNN A;  2O8B A;  4DTU A;  4JK9 A;  4FZX C;  1TL3 A;  2HNZ A;  3DWL A;  3GDQ A;  1IV0 A;  1SQK A;  4L3Q A;  2E2N A;  3OYK A;  1RTD A;  1FW6 A;  2VWJ A;  3DXK B;  3N4Q A;  2Q1N A;  4DFJ A;  4FLV A;  4KI6 A;  2P9U A;  1LWF A;  3R6M A;  3OJU A;  4LSN A;  3OYG A;  1SAZ A;  1ZBS A;  4BR9 A;  3HP6 A;  1K6Y A;  4OO1 J;  1WSF A;  3NF9 A;  3VQ5 A;  3FZL A;  4PHT X;  3CCU N;  2D0C A;  2XRI A;  3THW B;  2I7P A;  3WNF A;  5KGX A;  3FGU A;  2F4V K;  2QKK A;  2YHB A;  1BWF O;  1UA1 A;  4E19 A;  3DJC A;  1U49 A;  3GG4 A;  2OPP A;  4OJR A;  5I9E B;  3TAB A;  4Q0B A;  4KRF A;  1HJO A;  1XQS C;  5AQS A;  3LPT A;  3ZYY X;  3K5M A;  3VQ6 A;  1S6Q A;  4CI6 A;  1EWQ A;  2QW9 A;  5C15 A;  4WFN L;  3LP3 A;  3DLL L;  5DMR A;  5KRT A;  3LM9 A;  2EWS A;  1A5V A;  5M1P A;  5FPD A;  3SUP A;  3RTV A;  3AVK A;  4E7I A;  4JN4 A;  4A5A A;  4CJE A;  1RDU A;  2P9K B;  1R59 O;  1HYS A;  5BRF A;  1XC9 A;  1RBV A;  5FPE A;  4BDZ A;  3SBT A;  3V1R A;  4I2P A;  4PL8 A;  3HVT A;  1GLF O;  4DF4 A;  4BR0 A;  4FJK A;  3NBP A;  4TSX A;  1QSS A;  2X74 A;  4WQ4 C;  4O4G A;  4B9N A;  1NK4 A;  3CJB A;  3M8S A;  4CZE A;  4DSK A;  3I0S A;  3OYN A;  2HHU A;  4YOU A;  1NWK A;  4CBX A;  1MDU B;  3WQU A;  1TK0 A;  1HYV A;  4HTL A;  3AY9 A;  4LH4 A;  4Z4F A;  1F21 A;  1SUQ A;  1MWM A;  4C1N K;  4I6M A;  4IEI A;  4M3Z A;  4CZI A;  2XY5 A;  2GEL A;  3WNG A;  4CZM A;  2JWL A;  1WSH A;  1ESV A;  4OLB A;  1JCF A;  4Y1D A;  1KCF A;  1T3V A;  3KK3 A;  4ELU A;  1CZA N;  1FKO A;  2Z1G A;  3IKM A;  4LF9 K;  4CJ7 A;  3MED A;  5E41 A;  4NB4 A;  5CYM A;  4FLT A;  2WOM A;  5BRE A;  3IG1 A;  3TI0 A;  5HL7 L;  2UUC K;  1BGX T;  4N76 A;  2OZM A;  3VQC A;  3NF8 A;  2ZGY A;  3UKR A;  4BRF A;  1NKB A;  3C95 A;  5DM6 L;  4K25 A;  2NLX A;  3TTC A;  3WXK A;  1GLA G;  3QFU A;  5EVZ A;  4M3R A;  3AO2 A;  4M3U A;  1X9J A;  3TAP A;  1VQP N;  4IFE A;  1ASU A;  1Q9Y A;  1JJ2 M;  1XHX A;  2YNH A;  3ATV A;  5LJW A;  2FSK A;  3N4P A;  3HJF A;  3I0R A;  3J7Z O;  4JS5 A;  1JLB A;  1XHZ A;  2CH5 A;  4FWS A;  2FF3 B;  3SQ2 A;  4FCY A;  4IOA L;  4CGG A;  4G9Z A;  4YOW A;  2D0B A;  3QEP A;  1J5O A;  5GIN A;  2KKZ A;  2P9P B;  3K57 A;  4Z94 A;  4JKG A;  3WUH A;  2YHY A;  3OYB A;  1CXU A;  4CEE A;  5GAH P;  2JLE A;  4X66 K;  1HX1 A;  2YNI A;  4DCH A;  1T8E A;  2PYL A;  3AGK A;  5M1K A;  4QS8 A;  4NCA A;  1G99 A;  3ID6 A;  3NVM A;  5CZ1 A;  3CJ9 A;  4BVO A;  4JYA K;  4B3T K;  3KWG A;  3ZX0 A;  1N34 K;  1ZBI A;  1ZBF A;  1SZ2 A;  1UA0 A;  4QOZ B;  2Q2R A;  3G25 A;  4JKD A;  4CFC A;  3ZEU A;  3NGI A;  3L4I A;  1WB9 A;  1JCE A;  3AVL A;  2HB5 A;  3SLC A;  5IT9 O;  5EXW A;  5D3G A;  2RHK A;  4FM1 A;  2W40 A;  4OKE A;  4YHH K;  1WSJ A;  4KV8 A;  4F3O A;  4B3R K;  2D0A A;  1KVA A;  4KB0 A;  4FJ8 A;  2CH6 A;  3NH1 A;  3C0B A;  3AVA A;  3WXI A;  3CME N;  1FK9 A;  1NOZ A;  3I56 N;  5AQX A;  3KLI A;  3L2W A;  3LAK A;  4JI4 K;  5C2F A;  3SV4 A;  4A2A A;  5LJV A;  3NH2 A;  2HMP A;  3M3Z A;  4BRM A;  1BHL A;  3QBX A;  3KD1 E;  4B1Y B;  3AVH A;  2IVP A;  2IGI A;  4DQP A;  3CI5 A;  4OPA A;  3EE8 A;  1Q86 O;  3ZLJ A;  5ADX H;  3D45 A;  3TR8 A;  4BQL A;  2X78 A;  2O8F A;  4FSV A;  4CFD A;  4YOY A;  3M8R A;  3M6G A;  4B9L A;  5JVH L;  1GLE G;  2W42 A;  2G8I A;  3HM8 A;  1XNQ K;  4FWP A;  2V7Z A;  1KLM A;  3CJ1 A;  2Z1H A;  3A5N C;  1NGA A;  2E8A A;  1TYQ A;  3P38 A;  1IKV A;  4KO0 A;  2I7N A;  4FJ9 A;  3THX B;  3CCV N;  4DU1 A;  1NMD A;  3VQ4 A;  4DR2 K;  3KZB A;  3ZET B;  3ZSV A;  5DK5 A;  3HI0 A;  5J2M A;  3J7Y P;  4HCB A;  5AZI B;  5AQR A;  3HOS A;  4FVU A;  4IJA A;  3EEQ A;  1K9M O;  4PQU A;  4W5O A;  3DLE A;  3QML A;  3V1Q A;  2W41 A;  3AVN A;  4H5N A;  4XIU A;  3A2F A;  3TTD A;  2ZM6 K;  3LDS A;  3QO9 A;  2KFZ A;  1KTQ A;  3DOK A;  4CZG A;  4FM0 A;  1BU6 O;  1VQ6 N;  4O0J A;  4IO8 A;  1D9D A;  5BN9 A;  1BA0 A;  3QIN A;  4RW4 A;  1HUX A;  2P9S A;  4EAH D;  5LMU K;  3VEW A;  3RMA A;  3O9R A;  1S1U A;  2FBX A;  2G8U A;  4DR5 K;  4JI8 K;  4W5T A;  4FK4 A;  3H08 A;  4KHP K;  2OPR A;  2WON A;  1YXQ A;  3LDL A;  4PA1 A;  1VQO N;  4N5S A;  2E6L A;  3MEC A;  3ZT2 A;  4X65 K;  5AQF A;  1J54 A;  4BRO A;  4MDB A;  1NK5 A;  3AAR A;  4AHT A;  4E1N A;  3OYM A;  2NRR A;  3K9K A;  1REV A;  1BCM A;  4CGI A;  1UAX A;  2VQE K;  3JSM A;  2KQ2 A;  1NGB A;  3LDP A;  4NO7 A;  3TSU A;  3LM2 A;  1BG3 A;  4CIG A;  1DEJ A;  2O8D B;  4Z4G A;  3D2F A;  1VSJ A;  2KTQ A;  4JD2 A;  1VSF A;  3P5J A;  3PSI A;  2IDO A;  4XH4 A;  4CES A;  1RNH A;  3GOI A;  4BR2 A;  2I5J A;  4DTJ A;  2YJE A;  4JI5 K;  3C6T A;  1JKH A;  3TWH A;  4JKE A;  3ZSR A;  1K8K B;  3PO5 A;  5JLF A;  2HVI A;  4M7X A;  2HNY A;  4JHD B;  1C0T A;  2V51 B;  4DSF A;  3C6A A;  3UKU B;  3NH0 A;  3D6R A;  4CZL A;  1Z05 A;  4BRE A;  4GNI A;  1N36 K;  1O1W A;  1Q8I A;  1W7A A;  4M7Y A;  3ID8 A;  2B6A A;  2G8V A;  1ZBU A;  1HPZ A;  1CXQ A;  1BQN A;  5AQT A;  5CY4 A;  2F8T A;  2VG5 A;  4DMN A;  2Y1J A;  3EY1 A;  4E1J A;  3CC4 N;  3VER A;  3DXK A;  1J6Z A;  2OPS A;  1VAZ A;  3R1X A;  4I9L A;  1XC3 A;  3M8Q A;  1RDD A;  3HRG A;  5HLF A;  3QER A;  4CVN E;  2EHG A;  4DTN A;  3QEI A;  1BIZ A;  2KW4 A;  1TAQ A;  1L3T A;  1UWB A;  4FXD A;  1NGI A;  3C6H A;  4CIE A;  3HTV A;  1NK6 A;  2VYP A;  5FPM A;  4F3T A;  4JI7 K;  3P31 A;  4DR1 K;  1RCH A;  1RT7 A;  3JYT A;  5HRO A;  5HRS A;  2EX3 A;  2HF4 A;  2OZS A;  4W5N A;  1SV5 A;  4DF8 A;  4JKA A;  4WF9 L;  1OKJ A;  3NVK A;  4C8O A;  4ICL A;  1XUP O;  3CFP A;  3I8B A;  4CEZ A;  2V7Y A;  2UU9 K;  1ATR A;  5KPT A;  3PY8 A;  2Z1I A;  4O5B A;  4KAZ A;  4ELV A;  4H4O A;  2GUP A;  4C8N A;  3LP0 A;  3OYA A;  4G1Q A;  2JWK A;  4CF8 A;  5T7B A;  3HP9 A;  2YJF A;  3GBT A;  1OVY A;  4BDP A;  4FLW A;  1S6P A;  1QHT A;  4BG8 A;  3EKU A;  4CJL A;  4CZK A;  3C94 A;  3F5T A;  3NF6 A;  4CEB A;  4BVP A;  4C23 A;  1DLO A;  2P9K A;  1NLV A;  1ZBH A;  1BO5 O;  4BRP A;  1BL3 A;  3FZK A;  5GIP A;  2QEX N;  4I2Q A;  1NKE A;  1NK9 A;  1QE1 A;  2HHH K;  3MCA B;  3I55 N;  5E84 A;  2FSJ A;  1L3V A;  1KLN A;  1VQ7 N;  1B9F A;  2UXD K;  3MDQ A;  4FO0 A;  2VCP A;  3BP8 A;  4K0K K;  1NGG A;  4KTW A;  1DTT A;  3H6E A;  1IKW A;  3CFO A;  4OKJ A;  5FRN A;  5AQZ A;  4BWM A;  3OS1 A;  2YHA A;  5SWM A;  3SQ1 A;  2NRT A;  1G15 A;  4JS4 A;  3SMP A;  4DR4 K;  1KVB A;  2BH1 A;  3KK1 A;  3NDK A;  4OX9 K;  1X3M A;  4BWJ A;  1TGO A;  3AV9 A;  3VTI A;  3B6P A;  3EKS A;  4H0Y B;  1WAJ A;  4B9M A;  4FK2 A;  5M1F A;  1JXE A;  3K5O A;  1VRT A;  2IS3 A;  3OYE A;  3SAH A;  4GV6 A;  2HBL A;  1OH5 A;  4CW7 B;  2UYT A;  1N8R O;  4M3X A;  4FJG A;  1T7P A;  1WN7 A;  3QIC A;  4BE1 A;  5AQP A;  3UIQ A;  1VSL A;  3HYF A;  4FK0 A;  2HHV A;  1HR0 K;  3KVG A;  1RTI A;  2XHB A;  4FYD A;  1RTJ A;  4BAC A;  3TPQ A;  4AIL C;  3CC2 N;  2W6L A;  5C24 A;  5FRO A;  1FJG K;  1DKG D;  3MAQ A;  3RSE A;  4DUZ K;  1X3N A;  4K41 A;  4F9O A;  1W9H A;  3L8B A;  4B3O A;  1RDC A;  5E26 A;  5AZJ A;  3V9U A;  2QK9 A;  1N33 K;  2HW3 A;  1TK8 A;  1LW0 A;  4FZY A;  2KZZ A;  3P83 D;  4GVM A;  4EFH A;  3L2U A;  1TL1 A;  3ENB A;  3KIO A;  1VSI A;  4U7B A;  4XH1 A;  4CBU A;  4BC4 A;  3KLF A;  3O3F A;  4JRP A;  3CG7 A;  1GOC A;  1NGE A;  3WNE A;  4MLE A;  1VRU A;  1C1C A;  3VMF B;  1IH7 A;  1VQ8 N;  2H3G X;  5KPR A;  1NGH A;  4FJM A;  3E9L A;  1CZ9 A;  3QBW A;  3A5L C;  4E7J A;  3ULE A;  2DFH A;  1RBS A;  3VF4 A;  1C6V A;  3D2E A;  2FLO A;  5AQK A;  2NRX A;  3VQ8 A;  4GKJ K;  4BY9 C;  2R7Y A;  3VA3 A;  4DQ8 A;  3K2P A;  3VQB A;  3RRG A;  3VA0 A;  3TAR A;  4ILG B;  2E5L K;  5BR9 A;  4NXN K;  3SPZ A;  2YI1 A;  1VQN N;  3DRP A;  4BRC A;  4GW6 A;  5GAD P;  1NGF A;  3TAG A;  3MX5 A;  3O08 A;  2W6K A;  5KQD A;  3H1V X;  3H3O B;  2RE2 A;  3DI6 A;  4JKC A;  2KHO A;  2QXL A;  3ZCM A;  4GV3 A;  1GOB A;  2A3Z A;  4A5B A;  5BPL A;  5KTQ A;  1TKZ A;  4CCH A;  1QZ6 A;  3I8D A;  3M8P A;  3HSC A;  3O9U A;  2ZF5 O;  2CGJ A;  4JI2 K;  1NK7 A;  3CER A;  4LF5 K;  3U3G A;  3U9D A;  1WBB A;  3OS2 A;  3LAN A;  4J2A A;  1XNR K;  4CF9 A;  1RT1 A;  3T7Z A;  1QZ5 A;  2YNF A;  3K9J A;  3O4Q A;  2P9N A;  2UUB K;  5BN8 A;  1W2B M;  3IS9 A;  4FWM A;  3DLB A;  3HVR A;  4FWK A;  4NLC A;  3CM5 A;  4IWV A;  3LZJ A;  1NMN A;  3ALY A;  4H0O A;  4JK8 A;  5LL6 Z;  3J8A A;  2E6M A;  4DFP A;  4IDH A;  1YTA A;  1MWK A;  4Z4H A;  2BE2 A;  1ZXO A;  3QEX A;  4CJK A;  5AQU A;  3CJ7 A;  1S1T A;  4JKH A;  4AHS A;  4B1V A;  3SJJ A;  4BRQ A;  4K42 A;  4PKI A;  1Y64 A;  1NK8 A;  2WBN A;  1Q9X A;  4BRG A;  4FJJ A;  1IG8 A;  1X9M A;  4CE9 A;  4DB3 A;  1XMO K;  2IAJ A;  2D0P A;  4Q5V A;  2HHQ A;  1GOA A;  3LWM A;  1WUA A;  4FPA A;  3ZET A;  4CEO A;  3ISN C;  4BRD A;  3OVN A;  4CJR A;  4CHP A;  3BF1 A;  1NJZ A;  1BIU A;  3SNN A;  4Z4E A;  4RCH A;  1EX4 A;  3CF5 L;  4U67 L;  3TSQ A;  4R5P A;  1GLD G;  1KSP A;  5J2N A;  4M3T A;  3NGY A;  5HOO A;  5JLH A;  3MXI A;  3VPZ A;  4MQ3 A;  4CBW A;  5LY3 A;  4RWT A;  1GLB G;  4KHU A;  1KD1 O;  2P9U B;  2VGN A;  4H5T A;  1D9F A;  3AVJ A;  3O4W A;  5KRS A;  3RWU A;  2YKN A;  4EP4 A;  2HVH A;  4IEE A;  3CCJ N;  4IXC A;  3CMA N;  5I42 A;  3KTQ A;  4CHY A;  1Z25 A;  3CCQ N;  1YVN A;  2P5G A;  4B9S A;  3HT3 A;  1UOC A;  5C42 A;  1VSK A;  4W5R A;  4FW2 A;  4HVJ A;  1KAZ A;  3OYD A;  3KKS A;  3C7N A;  4FOI A;  4Z4C A;  4JI0 K;  2ATQ A;  2UXC K;  4NYN A;  1RFQ A;  4F2R A;  3HO1 A;  4ILJ A;  4DV4 K;  3DXM A;  1TUY A;  4ID1 A;  4YOR A;  4ELT A;  5BPM A;  4CK1 A;  3JS6 A;  2P9I A;  1X9W A;  1T6D A;  2QWO A;  4LF6 K;  1KFS A;  2O8D A;  4AHU A;  4LFA K;  4JI1 K;  3NHG A;  2QWM A;  1Q18 A;  4OKK A;  4DTX A;  3GL1 A;  1LAV A;  4CER A;  2NRW A;  4IKF A;  2VWB A;  2QA4 N;  3V9X A;  1OH8 A;  3AAP A;  1QQO A;  3JXU A;  5AFU H;  1GLJ O;  2IIR A;  4J2B A;  1K8K A;  3OBY A;  2P5O A;  4DTP A;  2YKM A;  3VGL A;  2ITM A;  3VF2 A;  1S9G A;  1OVQ A;  3UKU A;  5MLC Q;  1HKB A;  4KHW A;  4CFB A;  2P1J A;  4GVE A;  4YDU C;  1S1W A;  4QAG A;  1ASV A;  4QS9 A;  1VK0 A;  2E88 A;  4KFB A;  1Q81 O;  3WEE A;  1JLQ A;  1T44 A;  1WSG A;  3OYF A;  4EP5 A;  3KD5 E;  2D4W A;  4O44 A;  1DT9 A; 
#chains in the Genus database with same CATH homology
 1EXQ A;  1L5U A;  3ZSY A;  1W0H A;  2B6A A;  2G8V A;  1TVR A;  1ZBU A;  1HPZ A;  1CXQ A;  1LAW A;  1J9A A;  2RN2 A;  3AO3 A;  2Q3S A;  4OPK A;  4RW7 A;  4YFU A;  4HUF A;  1BQN A;  3V4I A;  2E4L A;  2KZM A;  2RF2 A;  4CK3 A;  3PO4 A;  3HST B;  5CY4 A;  2F8T A;  2VG5 A;  4DMN A;  2Y1J A;  3EY1 A;  4DSJ A;  1TKX A;  1SL0 A;  1EET A;  1RT2 A;  2G8W A;  5JS1 A;  4BE2 A;  1R0A A;  2XY7 A;  3QNN A;  2OPS A;  2ITG A;  4I9L A;  4DTU A;  4N47 A;  4FZX C;  3M8Q A;  1RDD A;  4CJ3 A;  5HLF A;  3BDP A;  4DFM A;  1DTQ A;  1TL3 A;  3QER A;  1TK5 A;  4DTN A;  2EHG A;  3VQQ A;  3QEI A;  1BIZ A;  2HNZ A;  2KW4 A;  1TAQ A;  4K8X A;  1JLA A;  1L3T A;  5KI6 A;  4I7F A;  3OYK A;  1UWB A;  2VWJ A;  1NJY A;  1RTD A;  4FXD A;  4AHV A;  2ETJ A;  3ULD A;  4CIE A;  5J1E A;  4FLV A;  4DFJ A;  4EZ6 A;  1NK6 A;  1HJR A;  4KI6 A;  1LWF A;  1ZBL A;  3OJU A;  4F3T A;  4CHQ A;  4LSN A;  2AJQ A;  2G8H A;  1RCH A;  1X1P A;  3OYG A;  1RT7 A;  4CJF A;  3ITH A;  4CGF A;  1JLF A;  3JYT A;  2PYJ A;  3DRR A;  5HRO A;  5HRS A;  4DQI A;  2EX3 A;  4E7L A;  2OZS A;  3L3U A;  1SV5 A;  1K6Y A;  3HP6 A;  4DQQ A;  1IG9 A;  1U04 A;  1WSF A;  2RKI A;  3NF9 A;  4DF8 A;  1JXB A;  1BI4 A;  5EU7 A;  3VQ5 A;  4CJT A;  3K58 A;  4KRE A;  4CEC A;  3HPG A;  3CFR A;  4DU4 A;  2D0C A;  4DTR A;  2XRI A;  4FLU A;  3WNF A;  4C8O A;  4F8R A;  4ICL A;  5KGX A;  3CFP A;  1U45 A;  4HUG A;  4DFK A;  2QKK A;  2YHB A;  4CEZ A;  3V6D A;  1UA1 A;  4NYF A;  4E19 A;  1U49 A;  3PY8 A;  2Z1I A;  4O5B A;  4KAZ A;  4ELV A;  2VG7 A;  4H4O A;  2OPP A;  4OJR A;  4IG0 A;  4C8N A;  1LV5 A;  3LP1 A;  3LP0 A;  3OYA A;  3TAB A;  4Q0B A;  4KRF A;  3CM6 A;  3LPT A;  4LSL A;  5FDL A;  4G1Q A;  1ASW A;  4FLZ A;  4CF8 A;  1NJW A;  3K5M A;  1N6Q A;  3DLH A;  4CHO A;  4CEQ A;  3VQ6 A;  5T7B A;  3MXM A;  3HP9 A;  1NK0 A;  1S6Q A;  4OPJ A;  2D5R A;  3HM9 A;  2O4G A;  4BDP A;  4AH9 A;  5HBM A;  4FLW A;  4NCB A;  4CGJ A;  3T1A A;  1S6P A;  1QHT A;  3LP3 A;  4CJL A;  3VQD A;  4B9U A;  3C94 A;  3NF6 A;  2F96 A;  2QXF A;  3EYZ A;  4CEB A;  1HNI A;  5DMR A;  3PX0 A;  1XI1 A;  1U47 A;  5KRT A;  4H4M A;  4AHR A;  5CZ2 A;  4M42 A;  1DLO A;  1BQM A;  1VSE A;  2YNG A;  1BCO A;  1CLQ A;  1EKE A;  1A5W A;  3LPU A;  1A5V A;  2NUB A;  1C1B A;  4OGC A;  3HPO A;  4DLE A;  4FLX A;  3KLG A;  4IG3 A;  1VSM A;  1BL3 A;  3SUP A;  1KRP A;  3RTV A;  3AVK A;  1WLJ A;  3AVM A;  4E89 A;  2HHT A;  3TAF A;  4I2Q A;  4E7I A;  1SL1 A;  4CJE A;  1NKE A;  3ZT4 A;  1HYS A;  1XC9 A;  1NK9 A;  1TAU A;  1QE1 A;  1RBV A;  4DTM A;  4BDZ A;  4Z0U A;  4B08 A;  3V1R A;  3ZT0 A;  4I2P A;  1L3U A;  4PUO A;  1KLN A;  1L3V A;  2B4J A;  3HVT A;  4IFY A;  3LZI A;  1B9F A;  1Z26 A;  2Y1I A;  4DF4 A;  4J2E A;  4ZTJ A;  4FJK A;  3NBP A;  4TSX A;  3ZSZ A;  1QSS A;  4F4K A;  2X74 A;  4KTW A;  4O4G A;  1DTT A;  3HPH A;  4OKJ A;  1IKW A;  3CFO A;  1KVC A;  4B9N A;  3QIO A;  5FRN A;  3F9K A;  4BWM A;  3OS1 A;  1Y97 A;  2YHA A;  1NK4 A;  4RG8 A;  5SWM A;  4E7K A;  3CYM A;  2A1S A;  3M8S A;  4KKO A;  2X6N A;  3SQ1 A;  4DSK A;  1WSE A;  1G15 A;  3I0S A;  3OYN A;  4DLG A;  4JS4 A;  2XY6 A;  1NOY A;  4J2D A;  2HHU A;  1KVB A;  1RT5 A;  2DFF A;  3SUO A;  3KK1 A;  2PZS A;  3HK2 A;  4LD0 A;  3NDK A;  4QCL A;  3MEG A;  2DFE A;  1TK0 A;  3QEW A;  1HYV A;  4BWJ A;  4JRQ A;  1TGO A;  3AV9 A;  1FKP A;  1WNS A;  4LH4 A;  5HRN A;  4Z4F A;  1F21 A;  1SUQ A;  3SCX A;  3SI6 A;  3B6P A;  1WAJ A;  4M3Z A;  4B9M A;  3D0P A;  4FK2 A;  4CEF A;  1JXE A;  3K59 A;  2XY5 A;  3WNG A;  3K5O A;  1VRT A;  4CGH A;  2IS3 A;  1QS4 A;  1X9S A;  4DG1 A;  3OYE A;  4BDY A;  1WSH A;  3T3F A;  5I3U A;  2PY5 A;  1NJX A;  4OLB A;  3LP2 A;  1I3A A;  4Y1D A;  1JLG A;  1KCF A;  1SKS A;  3KK3 A;  4ELU A;  1FKO A;  1RBT A;  2Z1G A;  3EZ5 A;  3PX4 A;  4M3X A;  4FJG A;  1T7P A;  1WN7 A;  4BE1 A;  3MED A;  3UIQ A;  1VSL A;  3RR8 A;  3HYF A;  4FK0 A;  2HHV A;  5E41 A;  1RTI A;  1BIS A;  3NF7 A;  2XHB A;  1U4B A;  4FJN A;  4FYD A;  1RTJ A;  4BAC A;  5CYM A;  3VQ9 A;  4FLT A;  4C8L A;  2WOM A;  4AIL C;  3TI0 A;  3IG1 A;  5C24 A;  1QSY A;  3AVI A;  5FRO A;  1BGX T;  2P51 A;  3MAQ A;  1NKC A;  4N76 A;  4DSE A;  1W9H A;  3VQC A;  3NF8 A;  3L8B A;  2OZM A;  5HP1 A;  4B3O A;  1RDC A;  2B5J A;  3VQ7 A;  3LAM A;  3V9U A;  1NKB A;  4O0I A;  2QK9 A;  3C95 A;  4Z4I A;  4LY7 A;  1IKY A;  2HW3 A;  3KJV A;  4RW9 A;  1TK8 A;  1LW0 A;  3ZT1 A;  4FZY A;  2KZZ A;  3P83 D;  4M3R A;  3K5N A;  1RIL A;  4GVM A;  4CJW A;  3L2U A;  1TL1 A;  3KK2 A;  1U48 A;  3KIO A;  1VSI A;  3AO2 A;  4M3U A;  1RDA A;  3RMC A;  3TAP A;  4F2S A;  3OYH A;  2A1R A;  3QES A;  4WE1 A;  5SZT A;  3KLF A;  3O3F A;  1EP4 A;  1ASU A;  1Q9Y A;  4Y1C A;  3CG7 A;  4JRP A;  4C8M A;  1XHX A;  2YNH A;  4DQS A;  1GOC A;  2FC0 A;  1C0M A;  2XY8 A;  3WNE A;  5C25 A;  1VRU A;  3NGZ A;  1C1C A;  3HJF A;  4B9V A;  3V81 A;  1IH7 A;  3I0R A;  4JS5 A;  3HXM A;  3VQP A;  1JLB A;  1XHZ A;  1S1V A;  3SQ2 A;  4FJM A;  4M3W A;  4FCY A;  1CZ9 A;  2FBY A;  4CGG A;  4CJP A;  2D0B A;  4HUE A;  1SKW A;  3QEP A;  4C8K A;  3MXJ A;  4E7J A;  1J5O A;  2DFH A;  1RBS A;  4E7H A;  3RRH A;  1C6V A;  3RR7 A;  3VQ8 A;  3C6U A;  2OA8 A;  3L2Q A;  2R7Y A;  3K57 A;  3VA3 A;  3S3M A;  1YVU A;  3SZ2 A;  3K2P A;  1C1A A;  3VQB A;  3VN5 A;  4HHT A;  3VA0 A;  3THV A;  2ZD1 A;  3RRG A;  4PY5 A;  3OYB A;  1CXU A;  3TAR A;  4ZTF A;  4CEE A;  4DWI A;  3AA3 A;  4KB1 A;  3AVF A;  3B6O A;  3AVC A;  1J53 A;  2JLE A;  3SPZ A;  3ZSX A;  4CJ5 A;  4KHY A;  2YNI A;  3BGR A;  3DRP A;  3ZSQ A;  4DU3 A;  4GW6 A;  2FBV A;  3PUF A;  2G8F A;  1RT3 A;  1HMV A;  3KLE A;  2LSN A;  3CQ8 A;  1T8E A;  3ZT3 A;  3TAG A;  4CJQ A;  2PYL A;  2XO7 A;  1RT6 A;  4FM2 A;  3DI6 A;  3G10 A;  3RMD A;  1RT4 A;  3ZCM A;  4NCA A;  4OLA A;  1GOB A;  5CZ1 A;  4CK2 A;  5KTQ A;  1TKZ A;  4CCH A;  3S3O A;  1TKT A;  3I8D A;  3KKR A;  2RPI A;  1ZBI A;  1ZBF A;  4N41 A;  1SKR A;  3M8P A;  1UA0 A;  3NE6 A;  3NAE A;  4QOZ B;  3HL8 A;  4CHZ A;  4CFC A;  5HRP A;  1NK7 A;  1HRH A;  3NGI A;  3V1O A;  2VG6 A;  3U3G A;  2OPQ A;  3U6F A;  1VSD A;  3AVL A;  2HB5 A;  2Z1J A;  4FJL A;  3OS2 A;  3LAN A;  4GMJ B;  4J2A A;  5D3G A;  4FJ5 A;  3AVG A;  4CF9 A;  4FM1 A;  3V9S A;  4OKE A;  2BAN A;  4CJU A;  3OJS A;  2HMI A;  1I39 A;  1RT1 A;  3DOL A;  1WSJ A;  4KV8 A;  4FJI A;  3TAN A;  4F3O A;  1D5A A;  1ZBH A;  5HRR A;  4MFB A;  2D0A A;  1KVA A;  2YNF A;  5JS2 A;  1ZYQ A;  3O4N A;  3O4Q A;  4KB0 A;  4ZHR A;  2IOC A;  4FJ8 A;  3NH1 A;  4M45 A;  1YTU A;  3AVA A;  3LWL A;  1FK9 A;  4LH5 A;  3OYI A;  4DQR A;  3IS9 A;  3DLB A;  3HVR A;  3SUN A;  4DSI A;  1NOZ A;  2HHX A;  3PV8 A;  3AA4 A;  3KLI A;  3L2W A;  1RBR A;  3CM5 A;  5KGW A;  3LZJ A;  1T03 A;  3L2V A;  3ALY A;  3LAK A;  3SV4 A;  3NH2 A;  2G8K A;  2E6M A;  3NCI A;  4M3Y A;  1BHL A;  3KD1 E;  4DFP A;  3AVH A;  4E0D A;  2GV9 A;  1B9D A;  4KTQ A;  1S5J A;  1YTA A;  2IGI A;  4RW6 A;  4DQP A;  1JLE A;  3AO5 A;  4Z4H A;  3OS0 A;  2BE2 A;  4YNQ A;  3DYA A;  3QEX A;  4CJK A;  1VSH A;  3ZSO A;  3AO1 A;  4ID5 A;  4K8Z A;  1S1T A;  4FJH A;  1QSL A;  3ZSW A;  4AHS A;  1RTH A;  1YT3 A;  3SJJ A;  2KFN A;  2DY4 A;  3SUQ A;  4DS5 A;  3D45 A;  3TR8 A;  4OVL A;  2X78 A;  4CF2 A;  4L8R B;  1TV6 A;  4CFD A;  4BE0 A;  1NK8 A;  3QLH A;  1Q9X A;  1FXX A;  3M8R A;  4DTO A;  1IKX A;  4FJJ A;  4B9L A;  1LW2 A;  1LWE A;  3SQ4 A;  1T05 A;  2F8S A;  3QEV A;  2W42 A;  3SYZ A;  1RDB A;  4CE9 A;  1X9M A;  1WAF A;  4N56 A;  4B9T A;  4M41 A;  2G8I A;  3F73 A;  2IAJ A;  4EZ9 A;  3IRX A;  1D8Y A;  4Q5V A;  1KLM A;  2HHQ A;  3ASM A;  2ZQB A;  4E1M A;  1B92 A;  1S1X A;  2Z1H A;  5K14 A;  2ZE2 A;  3IAY A;  3T19 A;  3AA5 X;  1GOA A;  1IKV A;  4KO0 A;  3LWM A;  4CHN A;  4CEO A;  3ISN C;  4E3S A;  3OVN A;  1HNV A;  3TAQ A;  3AA2 A;  4CJR A;  3K5L A;  4CHP A;  4FJ9 A;  1NJZ A;  3S3N A;  1BIU A;  4CJS A;  4DU1 A;  3SNN A;  3E01 A;  4Z4E A;  1EX4 A;  3DLG A;  5CYQ A;  4R5P A;  3FFI A;  1KSP A;  5J2N A;  3VQ4 A;  4M3T A;  3V9W A;  3OYL A;  4KHN A;  3NGY A;  3ZSV A;  3OY9 A;  4KHS A;  3DRS A;  5DK5 A;  5J2M A;  4PWD A;  4CF0 A;  2IC3 A;  3MXI A;  5FRM A;  4HCB A;  4MQ3 A;  4I9Q A;  4PQU A;  3QIP A;  3LAL A;  4KHU A;  4W5O A;  3V9Z A;  3DLE A;  4AHC A;  3V1Q A;  1QTM A;  3NFA A;  1D9F A;  3AVJ A;  3AVN A;  1JL2 A;  2FBT A;  5KRS A;  5J2P A;  3RWU A;  2YKN A;  4EP4 A;  3DMJ A;  4XIU A;  3KLH A;  3A2F A;  2HVH A;  5J2Q A;  4FZZ A;  1HQU A;  4FVM A;  3LDS A;  3QO9 A;  4CJV A;  5I42 A;  3KTQ A;  4CHY A;  1KTQ A;  3DOK A;  2KFZ A;  4HTU A;  1HQE A;  1JLC A;  3TAE A;  4FM0 A;  3DLR A;  1Z25 A;  1BI4 B;  2P5G A;  4B9S A;  4O0J A;  3HT3 A;  4KPY A;  2BDP A;  1D9D A;  1KFD A;  1UOC A;  3L3V A;  1CZB A;  4O55 A;  1VSK A;  5C42 A;  2YV0 X;  3QIN A;  4KTZ A;  4RW4 A;  4B8C A;  4W5R A;  4KI4 A;  4FW2 A;  4HVJ A;  4CF1 A;  3U3Y A;  3TAM A;  3RMA A;  4W5Q A;  4NCG A;  3OYD A;  3PX6 A;  1S1U A;  3KKS A;  4FJX A;  2FBX A;  2QKB A;  4H8K A;  2G8U A;  4Z4C A;  2ATQ A;  2DTU A;  4NYN A;  4W5T A;  4DTS A;  3H08 A;  3L2R A;  4FK4 A;  4F2R A;  2OPR A;  3S9H A;  2WON A;  3HO1 A;  1WSI A;  4PA1 A;  3G0Z A;  4N5S A;  2E6L A;  3MEC A;  3ZT2 A;  4CED A;  3OYJ A;  3VQE A;  4CJ4 A;  4ID1 A;  1J54 A;  3MEE A;  1HYZ A;  4ELT A;  3QET A;  4CK1 A;  4FLY A;  4UQG A;  1NK5 A;  4CIF A;  4AHT A;  2BGG A;  4E1N A;  1X9W A;  1C0U A;  2GUI A;  3WNH A;  4CEA A;  4CFA A;  3OYM A;  1N5Y A;  1REV A;  1KFS A;  1BCM A;  4AHU A;  4KHQ A;  4CGI A;  1UAX A;  3JSM A;  2KQ2 A;  3P1G A;  3NHG A;  1QQC A;  4RW8 A;  4OKK A;  2HND A;  4DTX A;  3SV3 A;  2JGU A;  3VQA A;  4JLH A;  4DSL A;  1LAV A;  1ITG A;  4CER A;  1TKD A;  4FW1 A;  1IO2 A;  4CIG A;  4HCC A;  4IKF A;  3RMB A;  3QNO A;  4Z4G A;  3V9X A;  1VSJ A;  4B8A B;  2KTQ A;  1VSF A;  2X6S A;  4FJ7 A;  3P5J A;  4OGE A;  3AO4 A;  4J2B A;  2VWK A;  2IDO A;  2P5O A;  4CES A;  4DTP A;  1RNH A;  2YKM A;  3AVB A;  2I5J A;  4DTJ A;  2HHS A;  4IDK A;  1A5X A;  1S9G A;  1LWC A;  3C6T A;  1XWL A;  4CGD A;  1JKH A;  4IFV A;  3O3G A;  3TWH A;  4W5N A;  3ZSR A;  3DM2 A;  3DLK A;  3PO5 A;  1S9E A;  4IBN A;  2HVI A;  2HNY A;  2O4I A;  1MU2 A;  4KHW A;  4CFB A;  1C0T A;  2P1J A;  2OYQ A;  2HHW A;  1S1W A;  4QAG A;  4DSF A;  1ASV A;  3SPY A;  1VK0 A;  4KFB A;  3NH0 A;  1JLQ A;  1WSG A;  3OYF A;  1SL2 A;  1JL1 A;  4EP5 A;  1L3S A;  3OYC A;  3KD5 E;  4DS4 A;  3SQ0 A;  1O1W A;  1Q8I A;  1RBU A;  4O44 A;  2GBZ A;  3O3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...