3AO4A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
139
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
molecule keywords POL polyprotein
total genus 47
structure length 139
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao4A00
1VSFA 3LP2A 3NF6A 4JRQA 4LSNA 2IOCA 3IS9A 4KKOA 3NH2A 1D5AA 1UWBA 2QKKA 3K5MA 2FBVA 3LZJA 4B9NA 4N76A 1QQCA 3LANA 3KK3A 4N41A 3V4IA 4FJNA 3MXMA 3AVBA 4CJTA 4DQQA 3TAGA 3O3HA 3L2QA 4J2AA 4QOZB 2BE2A 1QE1A 1U04A 4M3TA 4DF4A 4E3SA 3DLHA 4CERA 4BDPA 1BL3A 3HP9A 4NYNA 4J2BA 3NE6A 3CFPA 2XY7A 3HXMA 3PX4A 1VSIA 3RRHA 4E19A 1U49A 2G8VA 4Q0BA 4PY5A 3H08A 3LAMA 3TR8A 1VSEA 3ZT4A 1RNHA 4RW7A 4CEFA 3SZ2A 3T1AA 1ITGA 5J2PA 4W5QA 3QEWA 3PO5A 1NOZA 4QAGA 1HRHA 1HMVA 3VA0A 2QXFA 3OJUA 1LWEA 1W9HA 2Z1GA 4CK1A 3CM5A 1JLCA 4FJJA 4KAZA 2EHGA 3KKSA 2HVHA 1S1TA 2RPIA 4GW6A 1B92A 4E7IA 4CJVA 3V9SA 1XC9A 4OLAA 3V1RA 3S9HA 1NOYA 3KD5E 4O55A 3LPTA 3OVNA 1RCHA 3CFOA 2FBXA 1RDDA 3M8QA 4CJQA 4JRPA 3V9ZA 4EZ6A 4M3UA 3D45A 1TK8A 1NJZA 4M3YA 1JLFA 1S9EA 4HUGA 1RTDA 4OKJA 3NGZA 1BQMA 3KLHA 4CJ3A 3SQ4A 1U48A 1KRPA 4EZ9A 4M41A 4CFDA 4HCCA 4CGDA 3VQ9A 3OYBA 4O44A 3HSTB 3AVGA 1JKHA 3OYAA 4FM2A 1KVBA 3QNOA 3SJJA 5CYQA 3VQBA 4OPJA 2X6SA 3MXIA 2G8FA 3RWUA 4ZTJA 4B9SA 3ZSXA 1S1XA 3WNHA 4ELUA 3DYAA 4G1QA 3O4QA 4FW1A 4LSLA 4CFAA 4Z4CA 1KLNA 1HYZA 2PZSA 4C8LA 5I3UA 3KD1E 4FJ8A 3WNGA 3THVA 4CF8A 2OZMA 1L3VA 4Z4FA 3OYEA 3OYHA 3CYMA 3EZ5A 3K5LA 4F2RA 4CEDA 2ZE2A 4DTSA 4Y1CA 3HL8A 4E7JA 4DQSA 4BDZA 1T7PA 1NKBA 4M3XA 3QINA 1QSSA 4F8RA 3NF9A 1JXEA 1KCFA 4TSXA 2DFFA 4CJWA 4E7KA 4B3OA 3A2FA 3VQDA 3MAQA 2YKNA 4O4GA 4DSFA 3OYLA 3DLBA 4E7LA 2G8HA 4J2DA 4RW9A 4Y1DA 4E0DA 4L8RB 1HYVA 1RT3A 2DFEA 1TKXA 1YTAA 2IGIA 3IRXA 4CJKA 3EYZA 5HRSA 1ZBLA 2PYJA 2B6AA 3BGRA 1NJYA 4DFPA 2XO7A 3DI6A 1WSGA 3HM9A 5KRSA 1RTJA 5FDLA 4CJEA 3FFIA 3NH0A 1WNSA 3MEDA 3RTVA 1J53A 3NCIA 4CJ4A 4FJKA 3VQ8A 4LY7A 4CHZA 4CJRA 2P5GA 1IKWA 2NUBA 3V9WA 2Y1JA 3QO9A 3KLIA 3KLEA 4JS4A 1JL1A 2FC0A 1EETA 2GV9A 5DK5A 5KI6A 2OYQA 3AV9A 1L3TA 1ASUA 3QEXA 2A1SA 4OGEA 5KTQA 4AILC 4O0IA 5C24A 1KVCA 4CGFA 3S3MA 1NJXA 4J2EA 1TGOA 1YVUA 1RBRA 2B5JA 3D0PA 4CF9A 4B9UA 3KK1A 3S3OA 2HHQA 3NGYA 5KGWA 2KZZA 3ZSOA 2VWJA 4DU4A 4DFKA 3ASMA 3V9UA 3TABA 3VQEA 1BQNA 3KK2A 1L3UA 2RKIA 1XWLA 4PQUA 1X1PA 1IO2A 4CGJA 4AHUA 3BDPA 1KSPA 2Z1JA 1W0HA 2YKMA 5EU7A 4CIFA 4CJ5A 4FLWA 4DSEA 1VSDA 1LV5A 2O4IA 3SV3A 1LAWA 2Q3SA 4DSKA 1C6VA 3ZSYA 3CM6A 3V9XA 1JLGA 4FYDA 2P1JA 4AHSA 4N5SA 1QS4A 1QSYA 3ISNC 1O1WA 4FCYA 4W5TA 1KFSA 2E6MA 3B6OA 1HPZA 4FLVA 1JLBA 1RT4A 2OPQA 3QIPA 4CHQA 3I8DA 4DTJA 4DFMA 3UIQA 3TAEA 1GOAA 3K5OA 4CGGA 4CCHA 1J54A 3NHGA 1A5XA 3L2WA 3L8BA 2HVIA 2HHSA 1Q9YA 3VQAA 4Z0UA 4CEOA 3I0SA 4YFUA 4W5NA 4M3WA 3ZT1A 3DRSA 1S1UA 3VQ7A 4CEZA 3O3FA 4B9TA 4LD0A 3ZT0A 3AO4A 4M45A 4ICLA 3OS2A 3C95A 3KKRA 4KO0A 3F9KA 5I42A 4CFBA 4FK4A 4DU1A 1CXUA 4DU3A 3M8PA 2LSNA 4NYFA 4BWMA 3VQQA 4CIGA 4IG0A 3RMAA 4R5PA 3O3GA 3OYMA 4AHRA 1XI1A 3WNEA 3C94A 4JLHA 1QHTA 3KIOA 4CE9A 3RR8A 4HUEA 4FJMA 3DLEA 4I7FA 1RBSA 1T05A 4CHOA 4F3OA 2W42A 3RMDA 1ASVA 4FLYA 1D9DA 2E4LA 4Q5VA 1WLJA 2XY6A 1WAJA 1EKEA 1TV6A 4F4KA 3TAQA 1GOCA 3AA4A 4EP5A 3TARA 4K8ZA 2FBYA 3OS0A 4KHNA 1FK9A 5DMRA 4F3TA 3C6TA 4IFYA 1WN7A 4RW6A 3ULDA 4FJ5A 2KQ2A 1NK7A 1CLQA 1BIUA 4FLUA 3K5NA 3QLHA 3VQ6A 3QERA 3SQ2A 4FW2A 4KTZA 5KRTA 2D0CA 2VG6A 4DTNA 1VRUA 2D0AA 3DLRA 1CZBA 4NCGA 3ZSVA 3F73A 1I39A 1SL1A 5HP1A 3SNNA 1C0TA 5HROA 4DSLA 4M42A 1JLQA 1J5OA 4CIEA 2X6NA 2OZSA 4CEEA 3SI6A 1DLOA 2KW4A 3NH1A 2OPRA 3OYKA 4FJHA 4KHQA 4DTMA 4FJLA 3OS1A 4FLTA 3ITHA 4CHNA 4OPKA 4KPYA 1WSFA 1F21A 3L2RA 1Q9XA 4RW4A 4KRFA 2ITGA 1HYSA 1G15A 3AVJA 3LALA 4C8KA 3AVHA 2OPSA 3NF8A 1LW2A 1TL1A 1KFDA 1NK9A 3SV4A 1UAXA 1NK6A 5JS2A 3AO2A 5SWMA 3OJSA 4DSIA 3TANA 4I9QA 4CJLA 4FJXA 2VWKA 4FK0A 1SL2A 1BISA 3PO4A 1Z26A 4BACA 4BE0A 1QTMA 3RMBA 4ELTA 5CYMA 4CEQA 4DMNA 1SKSA 2HHVA 4KTWA 4ZTFA 1T03A 3TWHA 4CFCA 3RMCA 2RF2A 4Z4HA 1RT2A 2EX3A 1IG9A 3SQ1A 4M3ZA 4FZXC 3IG1A 3ZSWA 1C1CA 1A5VA 1SV5A 1VSKA 2XY5A 3DOLA 2QK9A 1FKOA 4FXDA 2KFNA 5J2MA 1ZYQA 3QIOA 1BI4A 3M8SA 4DQPA 4CJFA 2WONA 2BDPA 1IH7A 4EP4A 1NJWA 1EXQA 2XRIA 3AVIA 4BWJA 3HJFA 1IKVA 4IBNA 3OYCA 2O4GA 5J1EA 4FVMA 3AA2A 4B9LA 3U3GA 1VRTA 3TAMA 4CJSA 1X9MA 2BGGA 3TAFA 4OKKA 3RR7A 5CY4A 3WNFA 4N56A 3SUPA 5HRNA 1NKEA 5HRRA 4CHPA 1TKTA 3HPGA 1ZBIA 3EY1A 3LWMA 3HO1A 1RTHA 2DFHA 4B9MA 3PV8A 2YHBA 1C0UA 5HLFA 1VSHA 3DRRA 3VQ4A 4ID1A 5C25A 4H4MA 3SUQA 3QNNA 1C1AA 4B9VA 4CHYA 4WE1A 2I5JA 4HUFA 3LAKA 4CF0A 1NKCA 1X9WA 4GMJB 1LWFA 3LZIA 4K8XA 3PX6A 2YNHA 3K57A 3LP0A 1WSHA 1LW0A 4B8AB 4HHTA 3DLKA 4Z4EA 4FZYA 4C8NA 4NCBA 4PA1A 3VA3A 3SPZA 1SKRA 5FRMA 1IKYA 1N5YA 2WOMA 1HQUA 1L3SA 2IAJA 1NK0A 3HP6A 1JL2A 1D9FA 3HPOA 4KHUA 1IKXA 4OVLA 3OYNA 4KV8A 5HBMA 1TAQA 3AVNA 3HPHA 3QEPA 1N6QA 2IC3A 1S1WA 4RG8A 4CK2A 4HCBA 3AVAA 2HHUA 4GVMA 2YHAA 1Q8IA 4W5OA 4KI4A 4DTRA 3K2PA 3SQ0A 1UA0A 4BE1A 4IG3A 3NAEA 3ALYA 4MQ3A 1RTIA 4BDYA 2GUIA 3L3UA 4OGCA 4FLZA 3G10A 1UOCA 3AO3A 1ZBHA 3SYZA 3AVLA 3LP3A 2VG7A 4CGIA 4DTPA 1RT1A 1LAVA 1BI4B 3OYDA 2BANA 2YNGA 4DLEA 3KTQA 2KFZA 1S6PA 4H4OA 5CZ1A 3SCXA 2D5RA 4ELVA 4XIUA 4PUOA 1JLAA 2YV0X 1U47A 4Z4GA 2KZMA 1TKZA 4HVJA 3I0RA 4CESA 4KTQA 2Z1HA 2F96A 4FJ7A 2G8IA 2YNIA 4I2PA 3HT3A 2F8TA 3SPYA 1L5UA 3AVMA 3AVCA 3ZCMA 1RT5A 3L2UA 3L3VA 4O0JA 4OLBA 3AO5A 4ID5A 4DSJA 1S5JA 1GOBA 1VK0A 3JYTA 4DWIA 4B8CA 2R7YA 4KHWA 4CECA 3QESA 4KHSA 4B08A 1BCMA 1WSEA 4FJGA 4CEAA 3U3YA 4AHTA 1WAFA 3AA5X 1NK5A 1UA1A 1C0MA 3PUFA 4CJUA 1KTQA 4I2QA 4AH9A 2JGUA 1HJRA 3NFAA 3OYJA 4DS5A 1RDAA 2HNDA 4DG1A 2HW3A 5KGXA 3NDKA 4DFJA 4E7HA 1RT6A 3NBPA 1HNIA 2Y1IA 3AVFA 4PWDA 4YNQA 2HNZA 4CK3A 2G8WA 4C8OA 3B6PA 1BGXT 3DLGA 4BE2A 4CGHA 1RT7A 1EX4A 2Z1IA 1T8EA 3ZSRA 2ZD1A 1KVAA 4M3RA 3KJVA 4DS4A 4FM1A 1MU2A 1TAUA 3QEIA 2XY8A 1XHXA 3TI0A 1S9GA 1QSLA 4OJRA 5HRPA 3VQ5A 2XHBA 1RILA 3T3FA 4KHYA 3AVKA 1TK0A 3DRPA 4E1NA 2AJQA 1S6QA 4W5RA 2FBTA 4ZHRA 2PYLA 4NCAA 2HHTA 1B9FA 1I3AA 1ZBUA 3P1GA 3JSMA 1NK4A 1SUQA 4KFBA 1WSJA 4H8KA 1RDBA 4E1MA 1JXBA 2IDOA 2A1RA 4LH4A 4FJIA 3V6DA 2QKBA 5JS1A 2ZQBA 1CXQA 3AO1A 1U4BA 2G8KA 5FROA 2G8UA 3MXJA 1Y97A 2P51A 3PX0A 2HHWA 4DQRA 5J2QA 1NK8A 3M8RA 1CZ9A 2DY4A 2RN2A 1FXXA 2D0BA 2HHXA 4RW8A 4Z4IA 1DTTA 3SUOA 3CFRA 1ASWA 4IDKA 4CF2A 3KLGA 3ZT3A 3TAPA 3CQ8A 3G0ZA 4AHCA 2OA8A 4O5BA 1REVA 2F8SA 1BCOA 3PY8A 4LH5A 1VSLA 4DTOA 1SKWA 4FK2A 4IKFA 3LP1A 3NF7A 3K59A 5J2NA 4HTUA 2DTUA 1XHZA 3K58A 3E01A 3T19A 2X78A 3O4NA 3SUNA 5D3GA 1VSMA 4MFBA 1C1BA 4FJ9A 1SL0A 3RRGA 2IS3A 1YTUA 2E6LA 5C42A 3U6FA 4DQIA 3V1OA 4AHVA 4DTUA 5FRNA 1K6YA 4OKEA 3S3NA 3IAYA 2OPPA 1FKPA 3MECA 5T7BA 4E89A 1LWCA 4CF1A 1BIZA 5E41A 1KLMA 3P83D 4N47A 2B4JA 2HNYA 3DMJA 3MEGA 1BHLA 2PY5A 1J9AA 4FM0A 4CJPA 3LPUA 1TK5A 3HVRA 4UQGA 4DF8A 1S1VA 2ETJA 3VQPA 1HNVA 3VN5A 3ZT2A 3OY9A 2KTQA 3C6UA 1VSJA 2HB5A 3HVTA 3MEEA 3QEVA 3OYIA 4JS5A 3ZSZA 5CZ2A 3LDSA 4CEBA 3V81A 4KI6A 1JLEA 3ZSQA 4DTXA 3OYGA 1U45A 4KB0A 1TKDA 2X74A 3VQCA 4DLGA 4FLXA 1ZBFA 2P5OA 4KREA 1RBVA 1EP4A 2JLEA 2VG5A 4QCLA 3HK2A 3L2VA 4KB1A 1X9SA 2GBZA 2HMIA 3V1QA 4C8MA 3LWLA 1RBUA 3CG7A 1WSIA 1TVRA 5K14A 3OYFA 3QETA 1B9DA 1YT3A 1Z25A 4IFVA 3DOKA 1RBTA 1HQEA 4F2SA 1D8YA 2YNFA 2ATQA 1TL3A 5SZTA 3KLFA 1R0AA 3AA3A 3DM2A 4I9LA 3NGIA 1DTQA 4FZZA 1RDCA 3P5JA 1A5WA 3HYFA
chains in the Genus database with same CATH superfamily
3VEOA 4LFCK 2IOCA 3IS9A 1D5AA 1Q82O 2UYTA 4ISFA 2P9UB 2P9LA 4DQQA 3O3HA 1VQKN 4GV9A 1U04A 3DLHA 4JKCA 5BR9A 5AZIA 1W2BM 2XY7A 1DEJA 3HXMA 1NJIO 3RRHA 1U49A 3MMVA 3H08A 3TR8A 2YHXA 4RW7A 5J2PA 1NMDA 3T1AA 1VQ7N 1NOZA 1HRHA 4YOXA 3OJUA 3A5OC 4EHUA 1RFQA 4CK1A 3CM5A 1JLCA 4E1JA 2HMPA 4KAZA 1HX1A 4CJVA 3BZKA 1NOYA 3CJ7A 2FBXA 1RDDA 2A41A 1S9EA 4HUGA 4OKJA 3NGZA 4JK8A 3L4IA 2QEXN 3OYAA 4JI1K 3VQBA 4OPJA 3WXMB 5BPLA 3MCPA 2G8FA 3RWUA 4FWKA 4JHDA 1XMQK 3ZSXA 1S1XA 3WNHA 3ZX3A 2QWPA 1HYZA 4BROA 5I3UA 3O6WA 2YHWA 5C2FA 3O9QA 3K5LA 4CEDA 2UU9K 3DXMA 4Y1CA 3T1YK 3ZX2A 2D0OA 1QSSA 3NF9A 4E7KA 2DFFA 3DLBA 3VQDA 4O4GA 3WT0A 4RW9A 1RT3A 2F9TA 2DFEA 1YTAA 1YJ9N 4H5TA 3GOIA 1RTJA 2P9IB 3R1XA 3NH0A 1HKBA 3MEDA 3NCIA 4CJ4A 5LMNK 4FJKA 2DPNA 4X66K 4MLHA 3V9WA 5LMUK 2FC0A 2GV9A 5DK5A 3QEXA 2A1SA 4OGEA 4AILC 1NJXA 4DR4K 3ID6A 3D0PA 2B5JA 2P9NB 3IKMA 2W6LA 1NGGA 3NGYA 5KGWA 2KHOA 3ZSOA 4DFKA 3ASMA 5M1PA 2UXDK 1XWLA 3VF6A 4CGJA 1J6ZA 5GINA 4FVUA 1Y64A 2Z1JA 5ADXH 4CIFA 3NVMA 1YXQA 2Q3SA 3O9SA 1MWKA 3ZSYA 3CM6A 3V9XA 5FLXO 4FYDA 2P1JA 4N5SA 1QSYA 4W5TA 2E6MA 1LOTB 1HPZA 2NRZA 4X62K 4CHQA 1WBDA 3I8DA 2Q31A 3TAEA 3NHGA 2HHSA 3O9UA 3EO3A 5AQPA 3VQAA 4CEOA 3I0SA 1S1UA 3ZT0A 1M90O 2YCHA 4ICLA 1NU0A 1U2VB 3J8AA 3KKRA 4CZHA 3N4PA 5HOOA 1CXUA 3M8PA 2LSNA 4NYFA 1WBBA 3O9TA 4AHRA 3O9RA 3GG4A 3KIOA 3I56N 3RR8A 4BRIA 4HUEA 2QWRA 3G71N 3CJBA 4MO5A 1T05A 3H3OB 4JHDB 3RMDA 1ASVA 1D9DA 3VEVA 1GOCA 4H0TB 3TARA 4K8ZA 4KHNA 4LC9B 3C6TA 4FJ5A 3MN6A 3OHRA 2KQ2A 1CLQA 4FLUA 3HSCA 4JEPA 2QXLA 3ATVA 1VRUA 4NCGA 1SQKA 1NWKA 1DKGD 1GLFO 1J5OA 3H3NO 3SI6A 3NH1A 2OPRA 4DTMA 2IVPA 2VCPA 5TKYA 2H3GX 4CHNA 4KPYA 1VAZA 3H46O 3L2RA 3CXCM 1Q86O 4KRFA 5EVZA 1HYSA 4YOWA 5EX5A 3QBWA 3AVJA 3MDQA 4C8KA 3AVHA 3NF8A 1LW2A 1KFDA 3OJSA 2F4VK 1YUWA 1NGAA 3PO4A 4BE0A 5BRDA 4NLCA 4DMNA 3CI5A 2HBJA 2UUCK 3RMCA 4MDAA 5DM7L 2RF2A 4BRHA 2VGMA 3ULEA 4MO4A 3ZSWA 2QK9A 4FXDA 5M1NA 3O80A 3QIOA 5M1KA 1ESVA 3M8SA 4CZEA 5GIPA 4CJFA 2WONA 4DV0K 2O8FB 1NJWA 5TKWA 3HJFA 2O8DA 5AQTA 4IBNA 4C23A 4JI0K 3OYCA 2O4GA 3TAMA 4CJSA 2BGGA 4OKKA 4N56A 5HRRA 3HPGA 3HTVA 1W7AA 3PV8A 4WFBL 3CQXA 1VSHA 3R6MA 5C25A 1IBMK 3THWA 1IBKK 5EOYA 4BR5A 4B9VA 1E3MA 2NZTA 4K0KK 1X9WA 1OVQA 4QS9A 3FZHA 1VQON 1LW0A 4DV3K 4HHTA 1KAZA 3DLKA 4R79A 4FZYA 1J5EK 3K0SA 2PFUA 1HQUA 1L3SA 1MDUB 3HZ6A 3HP6A 3BF3A 4OVLA 4KHUA 3HPHA 3A0IX 4H5RA 2HHUA 5F0XA 3K2PA 3HOSA 4BE1A 3U8XA 2Q97A 4BGBA 1BDGA 4FLZA 3AO3A 1TUYA 3OYDA 3TU5A 1NNEA 2Q0UA 4JI3K 1S6PA 5LJVA 4ELVA 3JXUA 1JLAA 3QMLA 1S3XA 4CBXA 4YORA 4H5VA 3SBTA 2F9WA 4LF7K 2ZJPL 3SPYA 1GOBA 1VK0A 4BRNA 3JYTA 1T6DA 2R7YA 4DWIA 4DKWA 5AQNA 3EE8A 1WAFA 1NK5A 3OBYA 3PUFA 4FWNA 1KTQA 1Z05A 4I2QA 3NFAA 3OYJA 5KGXA 1RT6A 2Y1IA 4PWDA 1OH8A 4CK3A 3F2KA 4O8KA 1VQMN 2P9KB 1RT7A 3ZSRA 1O13A 2ZD1A 3KJVA 3EKSA 4JN4A 4FM1A 3VESA 4OJRA 2D4WA 4E1NA 4W5RA 2FBTA 1NGIA 2HHTA 1I3AA 3P1GA 2A1RA 4BRLA 2ZQBA 1GLDG 1CXQA 5AQSA 3PIPL 1Y97A 3AAPA 4B9QA 3FE1A 2D0BA 3UKUA 2ZF5O 2A6AA 2QI2A 2UUBK 4IDKA 2NLXA 4CF2A 3KVGA 2OA8A 4O5BA 2QTDA 3FLCO 3PY8A 3UE5A 4LH5A 1VSLA 2E2PA 1SKWA 3NF7A 1GLCG 3JS6A 4HTUA 1VQ9N 3SUNA 3CHWA 2IS3A 4BR0A 4AHVA 5M1QA 4BRKA 4MLEA 3P38A 5T7BA 4V19S 1BIZA 5E41A 1KLMA 2B4JA 3MEGA 3LDLA 3O1BA 1XMOK 4K41A 4JKHA 1DGKN 4EHTA 3LPUA 3HVRA 4B1ZA 4DF8A 1HNVA 5AQWA 3MEEA 3QEVA 4GV3A 4JS5A 3V81A 2A42A 4WFAL 2HBLA 5GAEP 2X74A 4DLGA 2OANA 1RBVA 4QCLA 2VG5A 2HSTA 2CH5A 2V7YA 1NMNA 2E2OA 3OYFA 5C15A 1Z25A 1K8AO 3ZLJA 1RBTA 1ATRA 2ATQA 1TL3A 3VEWA 2P9PB 1RDCA 3P5JA 3HYFA 3P4IA 1VSFA 3CCJN 4JRQA 4LSNA 1WB9A 2YX6A 4WQ5C 2FXUA 3V4IA 4FPBA 4CJTA 4J2AA 2NNWA 3D2FA 5KQ8A 4DF4A 4XEIA 1TYQA 4NYNA 5CHIA 3J80O 1KAXA 1VSIA 4PKIA 4E19A 4PY5A 3N4QA 1RNHA 1ITGA 1EWRA 1C0FA 3PO5A 3E9PA 3SK3A 3O5BA 1W9HA 2ASMA 1S22A 4O5FA 3S41A 4DUYK 4B1VA 5AZJA 4GW6A 4E7IA 5CE3A 1HPMA 2I7PA 3EE9A 3KD5E 1OH6A 3D6RA 3MWTA 1K73O 3H6EA 3M8QA 4CJQA 4JRPA 4EZ6A 4M3UA 3VTIA 1NJZA 1TK8A 1JLFA 2W41A 1RTDA 4JI7K 1Q81O 5A2QO 3KLHA 3CCVN 1U48A 4EZ9A 4EAHD 4JI4K 3VQ9A 2AA4A 4IZ9A 4O44A 3R3LA 3QNOA 1ZC6A 1QQMA 3VPZA 1P8ZA 1K9MO 4RCHA 4ELUA 3DYAA 4LSLA 4FW1A 1IBLK 3WNGA 3THVA 1OVYA 3TTFA 4DUZK 5GAGP 3EZ5A 4DQSA 1HKCA 4M3XA 3T7ZA 4F8RA 4ISEA 4TSXA 4BVOA 3A2FA 4DSFA 3BUZB 3CJ1A 3THYB 3EEQA 4WF9L 1HYVA 1TKXA 2IGIA 3CCRN 3BGRA 4XH5A 1NJYA 3WUHA 2ZGZA 3HM9A 5KRSA 4FO0A 3RTVA 3FFIA 4JYAK 1VQPN 4CJRA 1WUAA 4CHZA 4DQ8A 2P5GA 4DR2K 4G9ZA 3QO9A 5AQKA 1EETA 4JD2A 4IOCL 3AAQA 3CCSN 4O0IA 3UB5A 4H5WA 1TGOA 2PBDA 3A5LC 3KK1A 2QM1A 2KZZA 5LJWA 3CD6N 3VQEA 1IO2A 1JCFA 2OTLN 1C0GA 1S72N 3BY5A 1W0HA 5AQLA 1LV5A 2O4IA 2JWKA 4X65K 4DSKA 1C6VA 4X64K 3SMSA 3HBTA 4AHSA 2NRTA 4FCYA 1KFSA 1U2VA 3B6OA 4A5BA 4DHYA 4FLVA 1JLBA 3THXA 2ZJRL 3HOTA 1GOAA 3C7NA 4CCHA 4PL8A 3L8BA 2O8EB 2EWSA 1Q9YA 4Z0UA 4YFUA 3ZT1A 3DRSA 2E8AA 4B9TA 3G6EN 4M7XA 4LD0A 1NGHA 3O4WA 3F9KA 1XNQK 5I42A 4I6MB 3WXLA 4M3ZA 3RMAA 4BWMA 4CIGA 1GLJO 4KBOA 4BC3A 4M7YA 5JLFA 4FJMA 4WYBA 1RBSA 1YITN 4CHOA 4YOYA 1P90A 4ISGA 4Q5VA 3WQUA 4CZIA 3AA4A 1XUPO 1WN7A 1NK7A 5JVGL 4OPHA 3QERA 4JD2B 4NO7A 4BG9A 2YHYA 3VMFB 2D0AA 3DLRA 1I39A 3O1WA 1SL1A 5HROA 4B1XB 4M42A 4KHSA 4CIEA 1NGEA 4CEEA 1DLOA 3OYKA 2BH1A 4FJHA 2FSNA 4DR3K 3IFRA 3M3ZA 4IJAA 3WXIA 4BVPA 4OPKA 3U9ZA 1WSFA 1F21A 4IFEA 2UXBK 2ITGA 3LALA 2NRVA 2NRXA 2OPSA 1NK9A 3SV4A 1UAXA 4I9QA 2V51B 5AQFA 5AQUA 4JI6K 1BISA 3ULEB 2P9UA 4BACA 5C2DA 1QTMA 4KTWA 2HBKA 1T03A 2QWMA 4CFCA 5AQZA 4BRDA 5AQIA 1N32K 4WQ5A 4FZXC 3CCQN 1C1CA 1A5VA 1SV5A 1VSKA 5AJ3K 2XY5A 5J2MA 2QW9A 4DQPA 1BU6O 1H1VA 5BPMA 3FZKA 1KXPA 3AA2A 3U3GA 1VQNN 1X9MA 3SUPA 5HRNA 1NKEA 5AQHA 1GLEG 3EY1A 4JKBA 3LWMA 1IG8A 3AARA 5HLFA 3VQ4A 4H4MA 1E4FT 3EKUA 3DAWA 3DJCA 4K8XA 1LWFA 1GLAG 2YNHA 3L0QA 4C8NA 3ID8A 3SPZA 3CJCA 5FRMA 1IKYA 2NRHA 4FWRA 1JL2A 1SS6A 3H1VX 3QICA 4KV8A 1WOQA 4RG8A 3I33A 4W5OA 1Q8IA 4CBUA 1UA0A 4IG3A 3NAEA 3M1FA 4OGCA 3AY9A 2ITMA 3SYZA 2O8FA 5FPNA 4CGIA 3DXMB 1RT1A 1LAVA 2BANA 2YNGA 3AGKA 2D5RA 1BUPA 4XIUA 4RTFD 1YF5L 4CESA 4KTQA 4FJ7A 2G8IA 4I2PA 3HT3A 2FLOA 3AVMA 3AVCA 4JV5K 3KK7A 3THXB 4ID5A 5M1OA 2E5LK 4KHWA 2WBNA 3C6AA 4B08A 4CEAA 3U3YA 1IV0A 1KD1O 1UA1A 3E1YA 1RDAA 3A8YA 5ADXA 3VF2A 3L4QA 4H0PA 3AVFA 3PIOL 4C8OA 2HOEA 2FSJA 3CETA 3DLGA 4JI2K 1T8EA 2IIRA 1KVAA 3TSPA 2PAVA 1MU2A 1X3NA 1TAUA 5HRPA 1RILA 1JCEA 3AVKA 1TK0A 2AJQA 2QA4N 3BEXA 3LL3A 1ZBUA 1BO5O 5H1SQ 3JSMA 3CERA 1SUQA 4H8KA 4E1MA 1QQOA 1M1KO 2IDOA 3AO1A 2G8KA 2YI1A 1QHAA 2A3ZA 4FSVA 5FROA 3PX0A 5J2QA 3D2EB 1CZ9A 2RN2A 3QBXA 4CZKA 3E9LA 1FXXA 1GLBG 4MDBA 2D1KA 5FPDA 3CPWM 4Z4IA 4CD3A 3CFRA 1ASWA 3K9KA 3KZBA 4DR5K 4DTOA 4IKFA 2GWJA 5J2NA 2GX9A 1XHZA 3E01A 2X78A 4QS8A 3O4NA 5BR8K 1SL0A 1KQSM 3CPEA 4ILHA 3O08A 3S3NA 1FKPA 4H0VB 4CF1A 3CMEN 4N47A 3DMJA 3CMAN 4H5NA 4K43A 3BZCA 4CJPA 1NBWA 1R59O 2ASOA 3VQPA 3VN5A 4B1YB 3SBGA 4K42A 3HVTA 4YY3K 2VQEK 3ZSZA 5CZ2A 3LDSA 4CEBA 4KI6A 1N33K 4DR7K 1U45A 4KB0A 4PKHA 4KREA 4FLXA 1RDUA 2JLEA 3VGKA 3HK2A 2QWLA 4IEEA 3M5RA 1N8RO 1RGIA 4C8MA 3LWLA 3ZEUB 3QETA 1B9DA 4KH5A 4CD1A 1HQEA 4F2SA 4FWOA 3KLFA 5SZTA 3AA3A 4NXNK 4FZZA 3VETA 3GL1A 4GKJK 1A5WA 2P9IA 3LP2A 3D2EA 3NF6A 1BA1A 1UWBA 2QKKA 2O8BB 2FBVA 4N41A 4N76A 3KK3A 3LANA 3MN9A 4FJNA 3TAGA 4QOZB 2BE2A 4FOEA 1QE1A 2WFBA 1YJWN 4CERA 4BDPA 3FGUA 3HP9A 5BN8A 3NE6A 2BTFA 4GV6A 3PX4A 2JWLA 3AGRA 1VSEA 3ZT4A 4JKEA 3QEWA 3R8EA 1IJJA 4W5QA 1VQ6N 1QZ6A 4QAGA 2Z1GA 4FJJA 4KH4A 2HVHA 1S1TA 1VQ5N 3V9SA 2E1ZA 1XC9A 3V1RA 3S9HA 3LPTA 3OVNA 1RCHA 4DR6K 5AQGA 3LDQA 4M3YA 3LDNA 2Q0RA 4Z94A 1BQMA 2QWOA 4CJ3A 5CR4A 4HCCA 3ENBA 2GUPA 4DV7K 3AVGA 3SJJA 4FM2A 5CYQA 4NB4A 2HHHK 4ZTJA 3BF1A 4G1QA 4O8UA 4CFAA 5KPZA 4FJ8A 3KD1E 3ENHA 3THYA 4CF8A 2A40A 3OYHA 1NLVA 4DTSA 3HL8A 4BDZA 1KCFA 3U4LA 4OX9K 3MAQA 2YKNA 2G8HA 3SMPA 4E0DA 2RE2A 5HRSA 2XO7A 4CJEA 5FDLA 4B3RK 4DR1K 3VQ8A 5BRHA 3GDQA 3D7EO 3M6GA 4JS4A 3PSFA 4JAXA 3CJ9A 1ASUA 2E2QA 3S3MA 5C24A 4CGFA 4J2EA 1YVUA 3CC7N 4B9UA 2HHQA 3SAHA 2VQFK 2VWJA 3TABA 4JK9A 3KK2A 1BQNA 1L3UA 3IUCA 2HBMA 1X1PA 4H0OA 4AHUA 3VOVA 4YOVA 4DSEA 1HLUA 3SV3A 4BQLA 2BUPA 4CZJA 1TYQB 5BPNA 3A5NC 3ISNC 2YJFA 1O1WA 5KPTA 2HF3A 1D4XA 1YVNA 3MCAB 3CJAA 3QIPA 2OPQA 3UIQA 5JLHA 4FL9A 4CGGA 1J54A 1VQ4N 2NRRA 2HVIA 3TTDA 4M3WA 4IJNA 3VQ7A 3MX2A 3O3FA 1E4GT 3AO4A 4CZMA 3CF5L 4WQ4C 4FK4A 5M1FA 3C6HA 3O3GA 5AR0A 1XI1A 4JLHA 3MWPA 5IWAK 3DLEA 3P31A 4I7FA 2FF3B 4BY9C 1HNWK 4F3OA 4AQYK 5AFUA 3WEEA 1KAYA 1WLJA 1TV6A 3TAQA 4EP5A 4FPAA 2FBYA 1QVFM 4IDHA 5MLCQ 5DMRA 3ULDA 4RW6A 3OBWA 3K5NA 3VQ6A 4FW2A 4KTZA 5KRTA 5I9EB 3VEYA 3ZSVA 3F73A 3ZX0A 4RWTA 1C0TA 3TTCA 3ZYYX 3E9OA 1ILYA 1QQNA 2FF6A 1BWFO 3OS1A 4FLTA 1Z6RA 3ITHA 3VF4A 4CJ7A 4RW4A 1YJNN 3TSQA 2I7NA 2Q2RA 4CVNE 4JK7A 4A5AA 3SLCA 1TL1A 1XC3A 1NK6A 4PKGA 5SWMA 4CJLA 4FJXA 5AQMA 4A2AA 3H45C 4ELTA 2GWKA 5E26A 4NXMK 2HHVA 4FWSA 4K25A 1RT2A 2EX3A 1IG9A 3L6QA 4BR9A 2KFNA 3EN9A 5LY3A 3VEZA 4EP4A 4BWJA 3NMUA 1IKVA 4JKGA 3O8MA 5J1EA 4B9LA 5C12A 1OH5A 3E66A 3H1QA 5CY4A 3WNFA 5C10A 2D0PA 1TKTA 1ZBIA 3HO1A 1RTHA 5F2RA 4JKDA 4B9MA 3DRRA 3DXKB 3QNNA 1C1AA 2KKZA 2Q1NA 2P9NA 2I5JA 4HUFA 3QFUA 4CF0A 1NKCA 4GMJB 4BRQA 4CZFA 3K57A 3LP0A 1WSHA 4H0XB 5AQYA 4B8AB 4C1NK 5F1XA 4NCBA 4PA1A 2VWBA 4BR7A 1N5YA 2WOMA 5AQXA 5AQQA 2IAJA 1NK0A 2ASPA 5E84A 2IVNA 3IDHA 3HPOA 3OYNA 3AVNA 4CZGA 3QEPA 1N6QA 2IC3A 1S1WA 2A5XA 4CK2A 4HCBA 2CH6A 4A57A 4GVMA 4KI4A 4WFNL 5AQJA 3ALYA 1RTIA 2E2NA 2QWQA 1ZBHA 4CBWA 2O8DB 1T6CA 3AVLA 4DTPA 4PHTX 1BI4B 4DLEA 3KTQA 2KFZA 4H4OA 5CZ1A 3SCXA 4KHPK 2P9LB 2AP1A 4Z4GA 1TKZA 4HVJA 3FFKB 5AFUH 3HM8A 1EO1A 2Z1HA 2F96A 2YNIA 1L5UA 3KWGA 5GIOA 1RT5A 3L2UA 1VHXA 3L3VA 4DV4K 3AO5A 3EL2A 3QESA 1BCMA 4FJGA 4AHTA 3AA5X 5FPEA 4AH9A 4DS5A 1HJRA 3CCUN 2HW3A 4DG1A 2HNDA 2W6KA 4DFJA 4IEIA 3NBPA 2G8WA 3B6PA 4YOUA 4BC2A 4A59A 2Z1IA 4XH1A 1EWQA 4M3RA 3QEIA 2XY8A 3TI0A 1QSLA 3B8AX 3SJHA 3T3FA 4KHYA 1S6QA 3LM2A 4NCAA 4ZHRA 2PYLA 1NK4A 4KFBA 1WSJA 4JKAA 1RDBA 3FZMA 5JVHL 1U4BA 4LF8K 2G8UA 3I8BA 2O8EA 1X3MA 1NGCA 1NK8A 3C7NB 3U9DA 3M8RA 1N36K 3IMXA 1MA9B 4DV5K 2HHXA 3VENA 1DTTA 1V4SA 3SUOA 1QVGM 3TAPA 4IWVA 3ZT3A 3KLGA 3G0ZA 2F8SA 4I6MA 4FK2A 5EXWA 4BRMA 3I55N 3K59A 1NG9A 4FOIA 3K58A 3OA9A 3PSIA 5EY4A 5D3GA 4MFBA 1C1BA 4FJ9A 3RRGA 2W40A 3K9JA 2E6LA 1ATNA 5C42A 3V1OA 4DTUA 1K6YA 2OPPA 3FZLA 3MECA 3MN5A 1BHLA 2PY5A 1J9AA 4CI6A 4FM0A 4B1UB 3OTOK 1TK5A 1DT9A 4HTLA 4BG8A 3DLLL 2ETJA 3THWB 2KTQA 1VSJA 2HB5A 3LM9A 4PL7A 3BP8A 5JICA 1YI2N 4YOTA 3ZSQA 2UXCK 4DTXA 3OYGA 3VQCA 3CIPA 2P5OA 2GBZA 3CCMN 3VGMA 5GADP 1OKJA 4AF1A 4DV6K 1WSIA 1TVRA 1HNZK 3HI0A 4IFVA 3LDOA 3DM2A 1NGDA 2KLAA 4KKOA 3NH2A 3K5MA 3LZJA 4B9NA 1QQCA 3MXMA 3AVBA 3QB0A 3PLAA 3L2QA 1Q7YO 4M3TA 4E3SA 1BL3A 4FWMA 4J2BA 3CFPA 2V52B 2G8VA 3ATUA 4Q0BA 2ZJQL 3LAMA 4CEFA 3SZ2A 2GELA 1HMVA 3VA0A 2QXFA 1LWEA 3F9MA 4AM7A 2NRWA 3GE1A 5DM6L 4GY2B 2EHGA 1Q18A 3KKSA 2RPIA 1B92A 4OLAA 3J7AP 1YHQN 4O55A 4IOAL 1FJGK 3CFOA 3V9ZA 3D45A 3WQTA 1KRPA 3SQ4A 4M41A 4CFDA 1TUUA 3G4SN 4CGDA 3OYBA 3HSTB 1JKHA 3D2FB 1KVBA 4BRPA 5BREA 2X6SA 3MXIA 4B9SA 4GKKK 1YIJN 3T1HK 3O4QA 2PZSA 4Z4CA 1KLNA 4C8LA 2OZMA 1L3VA 4Z4FA 3OYEA 3CYMA 2J4RA 5IT9O 1EQYA 4F2RA 4NLBA 2ZE2A 4E7JA 1T7PA 1NKBA 3QINA 2P9SB 4B3OA 1JXEA 4CJWA 1HR0K 3OYLA 4E7LA 4J2DA 4Y1DA 4OPAA 4IO8A 4L8RB 2VYPA 3IRXA 3EYZA 1ZBLA 4CJKA 2PYJA 4B3TK 2B6AA 1MWMA 4DFPA 3DI6A 1WSGA 1I94K 1WNSA 1J53A 4EIAA 4LY7A 4Y0WA 1IKWA 4B1WB 2NUBA 1K8KA 2Y1JA 3KLIA 3KLEA 3VTHA 1JL1A 4BC4A 2E20A 5KI6A 3F5TA 3AV9A 2OYQA 1L3TA 5KTQA 1KVCA 1RBRA 4CF9A 3RSEA 3J7YP 3S3OA 4XH4A 4DU4A 1V4TA 1BOTO 3WEEB 3MX5A 3V9UA 4LF9K 3CC2N 2RKIA 4LF4K 4PQUA 4BRCA 3BDPA 4BRFA 1KSPA 2YKMA 5EU7A 1HJOA 4CJ5A 4FLWA 5C0YA 1VSDA 4CW7B 1LAWA 4A61A 1JLGA 3KHYA 1QS4A 3FR0A 4YDUC 1YAGA 4H03B 5KQDA 1RT4A 4DTJA 4DFMA 2WUSA 4DB3A 3K5OA 4M63C 1A5XA 3L2WA 2E88A 1SAZA 4H0YB 4B3SK 4W5NA 1G99A 1JCGA 1NGBA 4CEZA 3G25A 4M45A 3SAFA 4JI5K 3OS2A 3C95A 4KO0A 4DCHA 4CFBA 4DU1A 5FPMA 4DU3A 3ZEUA 3VQQA 4IG0A 4R5PA 3OYMA 3WNEA 3C94A 3VGLA 1QHTA 4CE9A 4AM6A 3MK6A 4LFBK 1ZXOA 3FZFA 2ZM6K 4GNIA 2WC9A 4FWLA 1T3VA 2WTUA 2W42A 4BC5A 4FLYA 5BN9A 2E4LA 4QS7A 4BRGA 2XY6A 1WAJA 1EKEA 4YDUA 3UKRA 4F4KA 4FWQA 2HF4A 2QWNA 3OS0A 1FK9A 1NGJA 4F3TA 4IFYA 4WQ4A 3R9PA 3J81O 1BIUA 3ZETA 3QLHA 3SQ2A 3SAGA 3J7ZO 2D0CA 2VG6A 4JKFA 4BGAA 4DTNA 2CGKA 1CZBA 3C0BA 3C65A 5HP1A 3W0LA 3SNNA 1JJ2M 4LF5K 4DSLA 1JLQA 2OZSA 2X6NA 4KHQA 2KW4A 2F7TA 2V7ZA 3TSUA 5HL7L 3RVCA 4FJLA 4BR2A 1Q9XA 3DWLA 3QFPA 1G15A 4BR4A 4DSJA 4U7BA 5JS2A 3AO2A 4DSIA 4ILJA 3TANA 1LCUA 2VWKA 4FK0A 1SL2A 2OTJN 4BREA 1BG3A 4IXCA 1Z26A 3RMBA 5CYMA 4CEQA 1SKSA 4ZTFA 3TWHA 2O8CB 3JAMO 3GBTA 2FSKA 4Z4HA 4LFAK 4L3QA 2P9PA 3SQ1A 3IG1A 3QDKA 3DOLA 1FKOA 1XNRK 1ZYQA 1BI4A 2BDPA 1IH7A 1EXQA 2XRIA 3AVIA 4LF6K 2OCEA 5AQOA 4FVMA 1VRTA 4BQZA 3VERA 3TAFA 3RR7A 4CHPA 3MN7A 1RDWX 2DFHA 3P39A 1BA0A 1C0UA 1SZ2A 2YHBA 3Q7BA 4GVEA 4ID1A 3WXKA 3SUQA 4CHYA 4WE1A 1W97L 3LAKA 4JKGB 3LZIA 3KWIA 3PX6A 4HWIA 5AZIB 4Z4EA 3VA3A 1SKRA 1K8KB 4FWPA 1N34K 3DXKA 4KH6A 1X9JA 1D9FA 2E1YA 1T44A 5BRFA 1IKXA 5AZJB 5HBMA 1TAQA 3AVAA 1KC8O 2YHAA 1GLLO 4DTRA 4JNEA 3SQ0A 4MQ3A 4BDYA 2GUIA 3L3UA 3G10A 1UOCA 1QZ5A 3LP3A 2VG7A 5KPRA 3W3DA 3HRGA 4PUOA 3VEXA 2YV0X 3CQYA 1U47A 2KZMA 3I0RA 2F8TA 2O8CA 3ZCMA 4O0JA 3CCLN 4OLBA 1S5JA 4B8CA 1XQSC 4CECA 1WSEA 5AQRA 3TPQA 4JI8K 3ZETB 3OW2M 1OH7A 1C0MA 2RHKA 4CJUA 4DV1K 2JGUA 4CZLA 3UKRB 3NDKA 4E7HA 4C1NI 2CGLA 1HNIA 1VQ8N 2VGNA 4YNQA 2HNZA 3WXJA 3CCEN 1BGXT 5LL6Z 4A62A 4BE2A 4CGHA 4A2BA 1EX4A 3LDPA 4IOXA 4DS4A 4ILGB 3A5MC 1XHXA 1S9GA 3VQ5A 2XHBA 3NVKA 3DRPA 2YJEA 3UKUB 1B9FA 2GEMA 3CC4N 4FJIA 1JXBA 2Q36A 5AQVA 4LH4A 2QKBA 3V6DA 5JS1A 2O8BA 3MXJA 2P51A 1HKGA 4OO1J 2HHWA 4DQRA 4DV2K 4UY8O 2DY4A 1NGFA 4YHHK 4RW8A 3CQ8A 4AHCA 3Q7CA 1REVA 5JMVA 1BCOA 1HNXK 5GAHP 3LP1A 2DTUA 3T19A 4U67L 2UUAK 1VSMA 1YTUA 3U6FA 4DQIA 5FRNA 1U6ZA 3RSEB 1ATSA 4OKEA 3IAYA 5B8HA 4E89A 1LWCA 3P83D 2HNYA 4F9OA 1ZBSA 2ZWHA 3EZWA 4UQGA 1S1VA 1VQLN 3ZT2A 4BRAA 2ZGYA 3OY9A 3C6UA 4B3MK 3OYIA 1HUXA 2P9KA 5ELZA 1FW6A 4IO9L 1JLEA 4WCEL 1TKDA 3T69A 1ZBFA 1EP4A 3L2VA 4KB1A 2IVOA 1X9SA 2HMIA 3V1QA 2P9SA 1RBUA 4J8FA 3CG7A 2GTDA 5K14A 1CZAN 2CGJA 1YT3A 3DOKA 1D8YA 1NM1A 2YNFA 4EFHA 1R0AA 4I9LA 3NGIA 3ENOA 1DTQA
chains in the Genus database with same CATH topology
1VSFA 3LP2A 3NF6A 4JRQA 4LSNA 2IOCA 3IS9A 4KKOA 3NH2A 1D5AA 1UWBA 2QKKA 3K5MA 2FBVA 3LZJA 4B9NA 4N76A 1QQCA 3LANA 3KK3A 4N41A 3V4IA 4FJNA 3MXMA 3AVBA 4CJTA 4DQQA 3TAGA 3O3HA 3L2QA 4J2AA 4QOZB 2BE2A 1QE1A 1U04A 4M3TA 4DF4A 4E3SA 3DLHA 4CERA 4BDPA 1BL3A 3HP9A 4NYNA 4J2BA 3NE6A 3CFPA 2XY7A 3HXMA 3PX4A 1VSIA 3RRHA 4E19A 1U49A 2G8VA 4Q0BA 4PY5A 3H08A 3LAMA 3TR8A 1VSEA 3ZT4A 1RNHA 4RW7A 4CEFA 3SZ2A 3T1AA 1ITGA 5J2PA 4W5QA 3QEWA 3PO5A 1NOZA 4QAGA 1HRHA 1HMVA 3VA0A 2QXFA 3OJUA 1LWEA 1W9HA 2Z1GA 4CK1A 3CM5A 1JLCA 4FJJA 4KAZA 2EHGA 3KKSA 2HVHA 1S1TA 2RPIA 4GW6A 1B92A 4E7IA 4CJVA 3V9SA 1XC9A 4OLAA 3V1RA 3S9HA 1NOYA 3KD5E 4O55A 3LPTA 3OVNA 1RCHA 3CFOA 2FBXA 1RDDA 3M8QA 4CJQA 4JRPA 3V9ZA 4EZ6A 4M3UA 3D45A 1TK8A 1NJZA 4M3YA 1JLFA 1S9EA 4HUGA 1RTDA 4OKJA 3NGZA 1BQMA 3KLHA 4CJ3A 3SQ4A 1U48A 1KRPA 4EZ9A 4M41A 4CFDA 4HCCA 4CGDA 3VQ9A 3OYBA 4O44A 3HSTB 3AVGA 1JKHA 3OYAA 4FM2A 1KVBA 3QNOA 3SJJA 5CYQA 3VQBA 4OPJA 2X6SA 3MXIA 2G8FA 3RWUA 4ZTJA 4B9SA 3ZSXA 1S1XA 3WNHA 4ELUA 3DYAA 4G1QA 3O4QA 4FW1A 4LSLA 4CFAA 4Z4CA 1KLNA 1HYZA 2PZSA 4C8LA 5I3UA 3KD1E 4FJ8A 3WNGA 3THVA 4CF8A 2OZMA 1L3VA 4Z4FA 3OYEA 3OYHA 3CYMA 3EZ5A 3K5LA 4F2RA 4CEDA 2ZE2A 4DTSA 4Y1CA 3HL8A 4E7JA 4DQSA 4BDZA 1T7PA 1NKBA 4M3XA 3QINA 1QSSA 4F8RA 3NF9A 1JXEA 1KCFA 4TSXA 2DFFA 4CJWA 4E7KA 4B3OA 3A2FA 3VQDA 3MAQA 2YKNA 4O4GA 4DSFA 3OYLA 3DLBA 4E7LA 2G8HA 4J2DA 4RW9A 4Y1DA 4E0DA 4L8RB 1HYVA 1RT3A 2DFEA 1TKXA 1YTAA 2IGIA 3IRXA 4CJKA 3EYZA 5HRSA 1ZBLA 2PYJA 2B6AA 3BGRA 1NJYA 4DFPA 2XO7A 3DI6A 1WSGA 3HM9A 5KRSA 1RTJA 5FDLA 4CJEA 3FFIA 3NH0A 1WNSA 3MEDA 3RTVA 1J53A 3NCIA 4CJ4A 4FJKA 3VQ8A 4LY7A 4CHZA 4CJRA 2P5GA 1IKWA 2NUBA 3V9WA 2Y1JA 3QO9A 3KLIA 3KLEA 4JS4A 1JL1A 2FC0A 1EETA 2GV9A 5DK5A 5KI6A 2OYQA 3AV9A 1L3TA 1ASUA 3QEXA 2A1SA 4OGEA 5KTQA 4AILC 4O0IA 5C24A 1KVCA 4CGFA 3S3MA 1NJXA 4J2EA 1TGOA 1YVUA 1RBRA 2B5JA 3D0PA 4CF9A 4B9UA 3KK1A 3S3OA 2HHQA 3NGYA 5KGWA 2KZZA 3ZSOA 2VWJA 4DU4A 4DFKA 3ASMA 3V9UA 3TABA 3VQEA 1BQNA 3KK2A 1L3UA 2RKIA 1XWLA 4PQUA 1X1PA 1IO2A 4CGJA 4AHUA 3BDPA 1KSPA 2Z1JA 1W0HA 2YKMA 5EU7A 4CIFA 4CJ5A 4FLWA 4DSEA 1VSDA 1LV5A 2O4IA 3SV3A 1LAWA 2Q3SA 4DSKA 1C6VA 3ZSYA 3CM6A 3V9XA 1JLGA 4FYDA 2P1JA 4AHSA 4N5SA 1QS4A 1QSYA 3ISNC 1O1WA 4FCYA 4W5TA 1KFSA 2E6MA 3B6OA 1HPZA 4FLVA 1JLBA 1RT4A 2OPQA 3QIPA 4CHQA 3I8DA 4DTJA 4DFMA 3UIQA 3TAEA 1GOAA 3K5OA 4CGGA 4CCHA 1J54A 3NHGA 1A5XA 3L2WA 3L8BA 2HVIA 2HHSA 1Q9YA 3VQAA 4Z0UA 4CEOA 3I0SA 4YFUA 4W5NA 4M3WA 3ZT1A 3DRSA 1S1UA 3VQ7A 4CEZA 3O3FA 4B9TA 4LD0A 3ZT0A 3AO4A 4M45A 4ICLA 3OS2A 3C95A 3KKRA 4KO0A 3F9KA 5I42A 4CFBA 4FK4A 4DU1A 1CXUA 4DU3A 3M8PA 2LSNA 4NYFA 4BWMA 3VQQA 4CIGA 4IG0A 3RMAA 4R5PA 3O3GA 3OYMA 4AHRA 1XI1A 3WNEA 3C94A 4JLHA 1QHTA 3KIOA 4CE9A 3RR8A 4HUEA 4FJMA 3DLEA 4I7FA 1RBSA 1T05A 4CHOA 4F3OA 2W42A 3RMDA 1ASVA 4FLYA 1D9DA 2E4LA 4Q5VA 1WLJA 2XY6A 1WAJA 1EKEA 1TV6A 4F4KA 3TAQA 1GOCA 3AA4A 4EP5A 3TARA 4K8ZA 2FBYA 3OS0A 4KHNA 1FK9A 5DMRA 4F3TA 3C6TA 4IFYA 1WN7A 4RW6A 3ULDA 4FJ5A 2KQ2A 1NK7A 1CLQA 1BIUA 4FLUA 3K5NA 3QLHA 3VQ6A 3QERA 3SQ2A 4FW2A 4KTZA 5KRTA 2D0CA 2VG6A 4DTNA 1VRUA 2D0AA 3DLRA 1CZBA 4NCGA 3ZSVA 3F73A 1I39A 1SL1A 5HP1A 3SNNA 1C0TA 5HROA 4DSLA 4M42A 1JLQA 1J5OA 4CIEA 2X6NA 2OZSA 4CEEA 3SI6A 1DLOA 2KW4A 3NH1A 2OPRA 3OYKA 4FJHA 4KHQA 4DTMA 4FJLA 3OS1A 4FLTA 3ITHA 4CHNA 4OPKA 4KPYA 1WSFA 1F21A 3L2RA 1Q9XA 4RW4A 4KRFA 2ITGA 1HYSA 1G15A 3AVJA 3LALA 4C8KA 3AVHA 2OPSA 3NF8A 1LW2A 1TL1A 1KFDA 1NK9A 3SV4A 1UAXA 1NK6A 5JS2A 3AO2A 5SWMA 3OJSA 4DSIA 3TANA 4I9QA 4CJLA 4FJXA 2VWKA 4FK0A 1SL2A 1BISA 3PO4A 1Z26A 4BACA 4BE0A 1QTMA 3RMBA 4ELTA 5CYMA 4CEQA 4DMNA 1SKSA 2HHVA 4KTWA 4ZTFA 1T03A 3TWHA 4CFCA 3RMCA 2RF2A 4Z4HA 1RT2A 2EX3A 1IG9A 3SQ1A 4M3ZA 4FZXC 3IG1A 3ZSWA 1C1CA 1A5VA 1SV5A 1VSKA 2XY5A 3DOLA 2QK9A 1FKOA 4FXDA 2KFNA 5J2MA 1ZYQA 3QIOA 1BI4A 3M8SA 4DQPA 4CJFA 2WONA 2BDPA 1IH7A 4EP4A 1NJWA 1EXQA 2XRIA 3AVIA 4BWJA 3HJFA 1IKVA 4IBNA 3OYCA 2O4GA 5J1EA 4FVMA 3AA2A 4B9LA 3U3GA 1VRTA 3TAMA 4CJSA 1X9MA 2BGGA 3TAFA 4OKKA 3RR7A 5CY4A 3WNFA 4N56A 3SUPA 5HRNA 1NKEA 5HRRA 4CHPA 1TKTA 3HPGA 1ZBIA 3EY1A 3LWMA 3HO1A 1RTHA 2DFHA 4B9MA 3PV8A 2YHBA 1C0UA 5HLFA 1VSHA 3DRRA 3VQ4A 4ID1A 5C25A 4H4MA 3SUQA 3QNNA 1C1AA 4B9VA 4CHYA 4WE1A 2I5JA 4HUFA 3LAKA 4CF0A 1NKCA 1X9WA 4GMJB 1LWFA 3LZIA 4K8XA 3PX6A 2YNHA 3K57A 3LP0A 1WSHA 1LW0A 4B8AB 4HHTA 3DLKA 4Z4EA 4FZYA 4C8NA 4NCBA 4PA1A 3VA3A 3SPZA 1SKRA 5FRMA 1IKYA 1N5YA 2WOMA 1HQUA 1L3SA 2IAJA 1NK0A 3HP6A 1JL2A 1D9FA 3HPOA 4KHUA 1IKXA 4OVLA 3OYNA 4KV8A 5HBMA 1TAQA 3AVNA 3HPHA 3QEPA 1N6QA 2IC3A 1S1WA 4RG8A 4CK2A 4HCBA 3AVAA 2HHUA 4GVMA 2YHAA 1Q8IA 4W5OA 4KI4A 4DTRA 3K2PA 3SQ0A 1UA0A 4BE1A 4IG3A 3NAEA 3ALYA 4MQ3A 1RTIA 4BDYA 2GUIA 3L3UA 4OGCA 4FLZA 3G10A 1UOCA 3AO3A 1ZBHA 3SYZA 3AVLA 3LP3A 2VG7A 4CGIA 4DTPA 1RT1A 1LAVA 1BI4B 3OYDA 2BANA 2YNGA 4DLEA 3KTQA 2KFZA 1S6PA 4H4OA 5CZ1A 3SCXA 2D5RA 4ELVA 4XIUA 4PUOA 1JLAA 2YV0X 1U47A 4Z4GA 2KZMA 1TKZA 4HVJA 3I0RA 4CESA 4KTQA 2Z1HA 2F96A 4FJ7A 2G8IA 2YNIA 4I2PA 3HT3A 2F8TA 3SPYA 1L5UA 3AVMA 3AVCA 3ZCMA 1RT5A 3L2UA 3L3VA 4O0JA 4OLBA 3AO5A 4ID5A 4DSJA 1S5JA 1GOBA 1VK0A 3JYTA 4DWIA 4B8CA 2R7YA 4KHWA 4CECA 3QESA 4KHSA 4B08A 1BCMA 1WSEA 4FJGA 4CEAA 3U3YA 4AHTA 1WAFA 3AA5X 1NK5A 1UA1A 1C0MA 3PUFA 4CJUA 1KTQA 4I2QA 4AH9A 2JGUA 1HJRA 3NFAA 3OYJA 4DS5A 1RDAA 2HNDA 4DG1A 2HW3A 5KGXA 3NDKA 4DFJA 4E7HA 1RT6A 3NBPA 1HNIA 2Y1IA 3AVFA 4PWDA 4YNQA 2HNZA 4CK3A 2G8WA 4C8OA 3B6PA 1BGXT 3DLGA 4BE2A 4CGHA 1RT7A 1EX4A 2Z1IA 1T8EA 3ZSRA 2ZD1A 1KVAA 4M3RA 3KJVA 4DS4A 4FM1A 1MU2A 1TAUA 3QEIA 2XY8A 1XHXA 3TI0A 1S9GA 1QSLA 4OJRA 5HRPA 3VQ5A 2XHBA 1RILA 3T3FA 4KHYA 3AVKA 1TK0A 3DRPA 4E1NA 2AJQA 1S6QA 4W5RA 2FBTA 4ZHRA 2PYLA 4NCAA 2HHTA 1B9FA 1I3AA 1ZBUA 3P1GA 3JSMA 1NK4A 1SUQA 4KFBA 1WSJA 4H8KA 1RDBA 4E1MA 1JXBA 2IDOA 2A1RA 4LH4A 4FJIA 3V6DA 2QKBA 5JS1A 2ZQBA 1CXQA 3AO1A 1U4BA 2G8KA 5FROA 2G8UA 3MXJA 1Y97A 2P51A 3PX0A 2HHWA 4DQRA 5J2QA 1NK8A 3M8RA 1CZ9A 2DY4A 2RN2A 1FXXA 2D0BA 2HHXA 4RW8A 4Z4IA 1DTTA 3SUOA 3CFRA 1ASWA 4IDKA 4CF2A 3KLGA 3ZT3A 3TAPA 3CQ8A 3G0ZA 4AHCA 2OA8A 4O5BA 1REVA 2F8SA 1BCOA 3PY8A 4LH5A 1VSLA 4DTOA 1SKWA 4FK2A 4IKFA 3LP1A 3NF7A 3K59A 5J2NA 4HTUA 2DTUA 1XHZA 3K58A 3E01A 3T19A 2X78A 3O4NA 3SUNA 5D3GA 1VSMA 4MFBA 1C1BA 4FJ9A 1SL0A 3RRGA 2IS3A 1YTUA 2E6LA 5C42A 3U6FA 4DQIA 3V1OA 4AHVA 4DTUA 5FRNA 1K6YA 4OKEA 3S3NA 3IAYA 2OPPA 1FKPA 3MECA 5T7BA 4E89A 1LWCA 4CF1A 1BIZA 5E41A 1KLMA 3P83D 4N47A 2B4JA 2HNYA 3DMJA 3MEGA 1BHLA 2PY5A 1J9AA 4FM0A 4CJPA 3LPUA 1TK5A 3HVRA 4UQGA 4DF8A 1S1VA 2ETJA 3VQPA 1HNVA 3VN5A 3ZT2A 3OY9A 2KTQA 3C6UA 1VSJA 2HB5A 3HVTA 3MEEA 3QEVA 3OYIA 4JS5A 3ZSZA 5CZ2A 3LDSA 4CEBA 3V81A 4KI6A 1JLEA 3ZSQA 4DTXA 3OYGA 1U45A 4KB0A 1TKDA 2X74A 3VQCA 4DLGA 4FLXA 1ZBFA 2P5OA 4KREA 1RBVA 1EP4A 2JLEA 2VG5A 4QCLA 3HK2A 3L2VA 4KB1A 1X9SA 2GBZA 2HMIA 3V1QA 4C8MA 3LWLA 1RBUA 3CG7A 1WSIA 1TVRA 5K14A 3OYFA 3QETA 1B9DA 1YT3A 1Z25A 4IFVA 3DOKA 1RBTA 1HQEA 4F2SA 1D8YA 2YNFA 2ATQA 1TL3A 5SZTA 3KLFA 1R0AA 3AA3A 3DM2A 4I9LA 3NGIA 1DTQA 4FZZA 1RDCA 3P5JA 1A5WA 3HYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSF A;  3LP2 A;  3NF6 A;  4JRQ A;  4LSN A;  2IOC A;  3IS9 A;  4KKO A;  3NH2 A;  1D5A A;  1UWB A;  2QKK A;  3K5M A;  2FBV A;  3LZJ A;  4B9N A;  4N76 A;  1QQC A;  3LAN A;  3KK3 A;  4N41 A;  3V4I A;  4FJN A;  3MXM A;  3AVB A;  4CJT A;  4DQQ A;  3TAG A;  3O3H A;  3L2Q A;  4J2A A;  4QOZ B;  2BE2 A;  1QE1 A;  1U04 A;  4M3T A;  4DF4 A;  4E3S A;  3DLH A;  4CER A;  4BDP A;  1BL3 A;  3HP9 A;  4NYN A;  4J2B A;  3NE6 A;  3CFP A;  2XY7 A;  3HXM A;  3PX4 A;  1VSI A;  3RRH A;  4E19 A;  1U49 A;  2G8V A;  4Q0B A;  4PY5 A;  3H08 A;  3LAM A;  3TR8 A;  1VSE A;  3ZT4 A;  1RNH A;  4RW7 A;  4CEF A;  3SZ2 A;  3T1A A;  1ITG A;  5J2P A;  4W5Q A;  3QEW A;  3PO5 A;  1NOZ A;  4QAG A;  1HRH A;  1HMV A;  3VA0 A;  2QXF A;  3OJU A;  1LWE A;  1W9H A;  2Z1G A;  4CK1 A;  3CM5 A;  1JLC A;  4FJJ A;  4KAZ A;  2EHG A;  3KKS A;  2HVH A;  1S1T A;  2RPI A;  4GW6 A;  1B92 A;  4E7I A;  4CJV A;  3V9S A;  1XC9 A;  4OLA A;  3V1R A;  3S9H A;  1NOY A;  3KD5 E;  4O55 A;  3LPT A;  3OVN A;  1RCH A;  3CFO A;  2FBX A;  1RDD A;  3M8Q A;  4CJQ A;  4JRP A;  3V9Z A;  4EZ6 A;  4M3U A;  3D45 A;  1TK8 A;  1NJZ A;  4M3Y A;  1JLF A;  1S9E A;  4HUG A;  1RTD A;  4OKJ A;  3NGZ A;  1BQM A;  3KLH A;  4CJ3 A;  3SQ4 A;  1U48 A;  1KRP A;  4EZ9 A;  4M41 A;  4CFD A;  4HCC A;  4CGD A;  3VQ9 A;  3OYB A;  4O44 A;  3HST B;  3AVG A;  1JKH A;  3OYA A;  4FM2 A;  1KVB A;  3QNO A;  3SJJ A;  5CYQ A;  3VQB A;  4OPJ A;  2X6S A;  3MXI A;  2G8F A;  3RWU A;  4ZTJ A;  4B9S A;  3ZSX A;  1S1X A;  3WNH A;  4ELU A;  3DYA A;  4G1Q A;  3O4Q A;  4FW1 A;  4LSL A;  4CFA A;  4Z4C A;  1KLN A;  1HYZ A;  2PZS A;  4C8L A;  5I3U A;  3KD1 E;  4FJ8 A;  3WNG A;  3THV A;  4CF8 A;  2OZM A;  1L3V A;  4Z4F A;  3OYE A;  3OYH A;  3CYM A;  3EZ5 A;  3K5L A;  4F2R A;  4CED A;  2ZE2 A;  4DTS A;  4Y1C A;  3HL8 A;  4E7J A;  4DQS A;  4BDZ A;  1T7P A;  1NKB A;  4M3X A;  3QIN A;  1QSS A;  4F8R A;  3NF9 A;  1JXE A;  1KCF A;  4TSX A;  2DFF A;  4CJW A;  4E7K A;  4B3O A;  3A2F A;  3VQD A;  3MAQ A;  2YKN A;  4O4G A;  4DSF A;  3OYL A;  3DLB A;  4E7L A;  2G8H A;  4J2D A;  4RW9 A;  4Y1D A;  4E0D A;  4L8R B;  1HYV A;  1RT3 A;  2DFE A;  1TKX A;  1YTA A;  2IGI A;  3IRX A;  4CJK A;  3EYZ A;  5HRS A;  1ZBL A;  2PYJ A;  2B6A A;  3BGR A;  1NJY A;  4DFP A;  2XO7 A;  3DI6 A;  1WSG A;  3HM9 A;  5KRS A;  1RTJ A;  5FDL A;  4CJE A;  3FFI A;  3NH0 A;  1WNS A;  3MED A;  3RTV A;  1J53 A;  3NCI A;  4CJ4 A;  4FJK A;  3VQ8 A;  4LY7 A;  4CHZ A;  4CJR A;  2P5G A;  1IKW A;  2NUB A;  3V9W A;  2Y1J A;  3QO9 A;  3KLI A;  3KLE A;  4JS4 A;  1JL1 A;  2FC0 A;  1EET A;  2GV9 A;  5DK5 A;  5KI6 A;  2OYQ A;  3AV9 A;  1L3T A;  1ASU A;  3QEX A;  2A1S A;  4OGE A;  5KTQ A;  4AIL C;  4O0I A;  5C24 A;  1KVC A;  4CGF A;  3S3M A;  1NJX A;  4J2E A;  1TGO A;  1YVU A;  1RBR A;  2B5J A;  3D0P A;  4CF9 A;  4B9U A;  3KK1 A;  3S3O A;  2HHQ A;  3NGY A;  5KGW A;  2KZZ A;  3ZSO A;  2VWJ A;  4DU4 A;  4DFK A;  3ASM A;  3V9U A;  3TAB A;  3VQE A;  1BQN A;  3KK2 A;  1L3U A;  2RKI A;  1XWL A;  4PQU A;  1X1P A;  1IO2 A;  4CGJ A;  4AHU A;  3BDP A;  1KSP A;  2Z1J A;  1W0H A;  2YKM A;  5EU7 A;  4CIF A;  4CJ5 A;  4FLW A;  4DSE A;  1VSD A;  1LV5 A;  2O4I A;  3SV3 A;  1LAW A;  2Q3S A;  4DSK A;  1C6V A;  3ZSY A;  3CM6 A;  3V9X A;  1JLG A;  4FYD A;  2P1J A;  4AHS A;  4N5S A;  1QS4 A;  1QSY A;  3ISN C;  1O1W A;  4FCY A;  4W5T A;  1KFS A;  2E6M A;  3B6O A;  1HPZ A;  4FLV A;  1JLB A;  1RT4 A;  2OPQ A;  3QIP A;  4CHQ A;  3I8D A;  4DTJ A;  4DFM A;  3UIQ A;  3TAE A;  1GOA A;  3K5O A;  4CGG A;  4CCH A;  1J54 A;  3NHG A;  1A5X A;  3L2W A;  3L8B A;  2HVI A;  2HHS A;  1Q9Y A;  3VQA A;  4Z0U A;  4CEO A;  3I0S A;  4YFU A;  4W5N A;  4M3W A;  3ZT1 A;  3DRS A;  1S1U A;  3VQ7 A;  4CEZ A;  3O3F A;  4B9T A;  4LD0 A;  3ZT0 A;  3AO4 A;  4M45 A;  4ICL A;  3OS2 A;  3C95 A;  3KKR A;  4KO0 A;  3F9K A;  5I42 A;  4CFB A;  4FK4 A;  4DU1 A;  1CXU A;  4DU3 A;  3M8P A;  2LSN A;  4NYF A;  4BWM A;  3VQQ A;  4CIG A;  4IG0 A;  3RMA A;  4R5P A;  3O3G A;  3OYM A;  4AHR A;  1XI1 A;  3WNE A;  3C94 A;  4JLH A;  1QHT A;  3KIO A;  4CE9 A;  3RR8 A;  4HUE A;  4FJM A;  3DLE A;  4I7F A;  1RBS A;  1T05 A;  4CHO A;  4F3O A;  2W42 A;  3RMD A;  1ASV A;  4FLY A;  1D9D A;  2E4L A;  4Q5V A;  1WLJ A;  2XY6 A;  1WAJ A;  1EKE A;  1TV6 A;  4F4K A;  3TAQ A;  1GOC A;  3AA4 A;  4EP5 A;  3TAR A;  4K8Z A;  2FBY A;  3OS0 A;  4KHN A;  1FK9 A;  5DMR A;  4F3T A;  3C6T A;  4IFY A;  1WN7 A;  4RW6 A;  3ULD A;  4FJ5 A;  2KQ2 A;  1NK7 A;  1CLQ A;  1BIU A;  4FLU A;  3K5N A;  3QLH A;  3VQ6 A;  3QER A;  3SQ2 A;  4FW2 A;  4KTZ A;  5KRT A;  2D0C A;  2VG6 A;  4DTN A;  1VRU A;  2D0A A;  3DLR A;  1CZB A;  4NCG A;  3ZSV A;  3F73 A;  1I39 A;  1SL1 A;  5HP1 A;  3SNN A;  1C0T A;  5HRO A;  4DSL A;  4M42 A;  1JLQ A;  1J5O A;  4CIE A;  2X6N A;  2OZS A;  4CEE A;  3SI6 A;  1DLO A;  2KW4 A;  3NH1 A;  2OPR A;  3OYK A;  4FJH A;  4KHQ A;  4DTM A;  4FJL A;  3OS1 A;  4FLT A;  3ITH A;  4CHN A;  4OPK A;  4KPY A;  1WSF A;  1F21 A;  3L2R A;  1Q9X A;  4RW4 A;  4KRF A;  2ITG A;  1HYS A;  1G15 A;  3AVJ A;  3LAL A;  4C8K A;  3AVH A;  2OPS A;  3NF8 A;  1LW2 A;  1TL1 A;  1KFD A;  1NK9 A;  3SV4 A;  1UAX A;  1NK6 A;  5JS2 A;  3AO2 A;  5SWM A;  3OJS A;  4DSI A;  3TAN A;  4I9Q A;  4CJL A;  4FJX A;  2VWK A;  4FK0 A;  1SL2 A;  1BIS A;  3PO4 A;  1Z26 A;  4BAC A;  4BE0 A;  1QTM A;  3RMB A;  4ELT A;  5CYM A;  4CEQ A;  4DMN A;  1SKS A;  2HHV A;  4KTW A;  4ZTF A;  1T03 A;  3TWH A;  4CFC A;  3RMC A;  2RF2 A;  4Z4H A;  1RT2 A;  2EX3 A;  1IG9 A;  3SQ1 A;  4M3Z A;  4FZX C;  3IG1 A;  3ZSW A;  1C1C A;  1A5V A;  1SV5 A;  1VSK A;  2XY5 A;  3DOL A;  2QK9 A;  1FKO A;  4FXD A;  2KFN A;  5J2M A;  1ZYQ A;  3QIO A;  1BI4 A;  3M8S A;  4DQP A;  4CJF A;  2WON A;  2BDP A;  1IH7 A;  4EP4 A;  1NJW A;  1EXQ A;  2XRI A;  3AVI A;  4BWJ A;  3HJF A;  1IKV A;  4IBN A;  3OYC A;  2O4G A;  5J1E A;  4FVM A;  3AA2 A;  4B9L A;  3U3G A;  1VRT A;  3TAM A;  4CJS A;  1X9M A;  2BGG A;  3TAF A;  4OKK A;  3RR7 A;  5CY4 A;  3WNF A;  4N56 A;  3SUP A;  5HRN A;  1NKE A;  5HRR A;  4CHP A;  1TKT A;  3HPG A;  1ZBI A;  3EY1 A;  3LWM A;  3HO1 A;  1RTH A;  2DFH A;  4B9M A;  3PV8 A;  2YHB A;  1C0U A;  5HLF A;  1VSH A;  3DRR A;  3VQ4 A;  4ID1 A;  5C25 A;  4H4M A;  3SUQ A;  3QNN A;  1C1A A;  4B9V A;  4CHY A;  4WE1 A;  2I5J A;  4HUF A;  3LAK A;  4CF0 A;  1NKC A;  1X9W A;  4GMJ B;  1LWF A;  3LZI A;  4K8X A;  3PX6 A;  2YNH A;  3K57 A;  3LP0 A;  1WSH A;  1LW0 A;  4B8A B;  4HHT A;  3DLK A;  4Z4E A;  4FZY A;  4C8N A;  4NCB A;  4PA1 A;  3VA3 A;  3SPZ A;  1SKR A;  5FRM A;  1IKY A;  1N5Y A;  2WOM A;  1HQU A;  1L3S A;  2IAJ A;  1NK0 A;  3HP6 A;  1JL2 A;  1D9F A;  3HPO A;  4KHU A;  1IKX A;  4OVL A;  3OYN A;  4KV8 A;  5HBM A;  1TAQ A;  3AVN A;  3HPH A;  3QEP A;  1N6Q A;  2IC3 A;  1S1W A;  4RG8 A;  4CK2 A;  4HCB A;  3AVA A;  2HHU A;  4GVM A;  2YHA A;  1Q8I A;  4W5O A;  4KI4 A;  4DTR A;  3K2P A;  3SQ0 A;  1UA0 A;  4BE1 A;  4IG3 A;  3NAE A;  3ALY A;  4MQ3 A;  1RTI A;  4BDY A;  2GUI A;  3L3U A;  4OGC A;  4FLZ A;  3G10 A;  1UOC A;  3AO3 A;  1ZBH A;  3SYZ A;  3AVL A;  3LP3 A;  2VG7 A;  4CGI A;  4DTP A;  1RT1 A;  1LAV A;  1BI4 B;  3OYD A;  2BAN A;  2YNG A;  4DLE A;  3KTQ A;  2KFZ A;  1S6P A;  4H4O A;  5CZ1 A;  3SCX A;  2D5R A;  4ELV A;  4XIU A;  4PUO A;  1JLA A;  2YV0 X;  1U47 A;  4Z4G A;  2KZM A;  1TKZ A;  4HVJ A;  3I0R A;  4CES A;  4KTQ A;  2Z1H A;  2F96 A;  4FJ7 A;  2G8I A;  2YNI A;  4I2P A;  3HT3 A;  2F8T A;  3SPY A;  1L5U A;  3AVM A;  3AVC A;  3ZCM A;  1RT5 A;  3L2U A;  3L3V A;  4O0J A;  4OLB A;  3AO5 A;  4ID5 A;  4DSJ A;  1S5J A;  1GOB A;  1VK0 A;  3JYT A;  4DWI A;  4B8C A;  2R7Y A;  4KHW A;  4CEC A;  3QES A;  4KHS A;  4B08 A;  1BCM A;  1WSE A;  4FJG A;  4CEA A;  3U3Y A;  4AHT A;  1WAF A;  3AA5 X;  1NK5 A;  1UA1 A;  1C0M A;  3PUF A;  4CJU A;  1KTQ A;  4I2Q A;  4AH9 A;  2JGU A;  1HJR A;  3NFA A;  3OYJ A;  4DS5 A;  1RDA A;  2HND A;  4DG1 A;  2HW3 A;  5KGX A;  3NDK A;  4DFJ A;  4E7H A;  1RT6 A;  3NBP A;  1HNI A;  2Y1I A;  3AVF A;  4PWD A;  4YNQ A;  2HNZ A;  4CK3 A;  2G8W A;  4C8O A;  3B6P A;  1BGX T;  3DLG A;  4BE2 A;  4CGH A;  1RT7 A;  1EX4 A;  2Z1I A;  1T8E A;  3ZSR A;  2ZD1 A;  1KVA A;  4M3R A;  3KJV A;  4DS4 A;  4FM1 A;  1MU2 A;  1TAU A;  3QEI A;  2XY8 A;  1XHX A;  3TI0 A;  1S9G A;  1QSL A;  4OJR A;  5HRP A;  3VQ5 A;  2XHB A;  1RIL A;  3T3F A;  4KHY A;  3AVK A;  1TK0 A;  3DRP A;  4E1N A;  2AJQ A;  1S6Q A;  4W5R A;  2FBT A;  4ZHR A;  2PYL A;  4NCA A;  2HHT A;  1B9F A;  1I3A A;  1ZBU A;  3P1G A;  3JSM A;  1NK4 A;  1SUQ A;  4KFB A;  1WSJ A;  4H8K A;  1RDB A;  4E1M A;  1JXB A;  2IDO A;  2A1R A;  4LH4 A;  4FJI A;  3V6D A;  2QKB A;  5JS1 A;  2ZQB A;  1CXQ A;  3AO1 A;  1U4B A;  2G8K A;  5FRO A;  2G8U A;  3MXJ A;  1Y97 A;  2P51 A;  3PX0 A;  2HHW A;  4DQR A;  5J2Q A;  1NK8 A;  3M8R A;  1CZ9 A;  2DY4 A;  2RN2 A;  1FXX A;  2D0B A;  2HHX A;  4RW8 A;  4Z4I A;  1DTT A;  3SUO A;  3CFR A;  1ASW A;  4IDK A;  4CF2 A;  3KLG A;  3ZT3 A;  3TAP A;  3CQ8 A;  3G0Z A;  4AHC A;  2OA8 A;  4O5B A;  1REV A;  2F8S A;  1BCO A;  3PY8 A;  4LH5 A;  1VSL A;  4DTO A;  1SKW A;  4FK2 A;  4IKF A;  3LP1 A;  3NF7 A;  3K59 A;  5J2N A;  4HTU A;  2DTU A;  1XHZ A;  3K58 A;  3E01 A;  3T19 A;  2X78 A;  3O4N A;  3SUN A;  5D3G A;  1VSM A;  4MFB A;  1C1B A;  4FJ9 A;  1SL0 A;  3RRG A;  2IS3 A;  1YTU A;  2E6L A;  5C42 A;  3U6F A;  4DQI A;  3V1O A;  4AHV A;  4DTU A;  5FRN A;  1K6Y A;  4OKE A;  3S3N A;  3IAY A;  2OPP A;  1FKP A;  3MEC A;  5T7B A;  4E89 A;  1LWC A;  4CF1 A;  1BIZ A;  5E41 A;  1KLM A;  3P83 D;  4N47 A;  2B4J A;  2HNY A;  3DMJ A;  3MEG A;  1BHL A;  2PY5 A;  1J9A A;  4FM0 A;  4CJP A;  3LPU A;  1TK5 A;  3HVR A;  4UQG A;  4DF8 A;  1S1V A;  2ETJ A;  3VQP A;  1HNV A;  3VN5 A;  3ZT2 A;  3OY9 A;  2KTQ A;  3C6U A;  1VSJ A;  2HB5 A;  3HVT A;  3MEE A;  3QEV A;  3OYI A;  4JS5 A;  3ZSZ A;  5CZ2 A;  3LDS A;  4CEB A;  3V81 A;  4KI6 A;  1JLE A;  3ZSQ A;  4DTX A;  3OYG A;  1U45 A;  4KB0 A;  1TKD A;  2X74 A;  3VQC A;  4DLG A;  4FLX A;  1ZBF A;  2P5O A;  4KRE A;  1RBV A;  1EP4 A;  2JLE A;  2VG5 A;  4QCL A;  3HK2 A;  3L2V A;  4KB1 A;  1X9S A;  2GBZ A;  2HMI A;  3V1Q A;  4C8M A;  3LWL A;  1RBU A;  3CG7 A;  1WSI A;  1TVR A;  5K14 A;  3OYF A;  3QET A;  1B9D A;  1YT3 A;  1Z25 A;  4IFV A;  3DOK A;  1RBT A;  1HQE A;  4F2S A;  1D8Y A;  2YNF A;  2ATQ A;  1TL3 A;  5SZT A;  3KLF A;  1R0A A;  3AA3 A;  3DM2 A;  4I9L A;  3NGI A;  1DTQ A;  4FZZ A;  1RDC A;  3P5J A;  1A5W A;  3HYF A; 
#chains in the Genus database with same CATH topology
 3VEO A;  4LFC K;  2IOC A;  3IS9 A;  1D5A A;  1Q82 O;  2UYT A;  4ISF A;  2P9U B;  2P9L A;  4DQQ A;  3O3H A;  1VQK N;  4GV9 A;  1U04 A;  3DLH A;  4JKC A;  5BR9 A;  5AZI A;  1W2B M;  2XY7 A;  1DEJ A;  3HXM A;  1NJI O;  3RRH A;  1U49 A;  3MMV A;  3H08 A;  3TR8 A;  2YHX A;  4RW7 A;  5J2P A;  1NMD A;  3T1A A;  1VQ7 N;  1NOZ A;  1HRH A;  4YOX A;  3OJU A;  3A5O C;  4EHU A;  1RFQ A;  4CK1 A;  3CM5 A;  1JLC A;  4E1J A;  2HMP A;  4KAZ A;  1HX1 A;  4CJV A;  3BZK A;  1NOY A;  3CJ7 A;  2FBX A;  1RDD A;  2A41 A;  1S9E A;  4HUG A;  4OKJ A;  3NGZ A;  4JK8 A;  3L4I A;  2QEX N;  3OYA A;  4JI1 K;  3VQB A;  4OPJ A;  3WXM B;  5BPL A;  3MCP A;  2G8F A;  3RWU A;  4FWK A;  4JHD A;  1XMQ K;  3ZSX A;  1S1X A;  3WNH A;  3ZX3 A;  2QWP A;  1HYZ A;  4BRO A;  5I3U A;  3O6W A;  2YHW A;  5C2F A;  3O9Q A;  3K5L A;  4CED A;  2UU9 K;  3DXM A;  4Y1C A;  3T1Y K;  3ZX2 A;  2D0O A;  1QSS A;  3NF9 A;  4E7K A;  2DFF A;  3DLB A;  3VQD A;  4O4G A;  3WT0 A;  4RW9 A;  1RT3 A;  2F9T A;  2DFE A;  1YTA A;  1YJ9 N;  4H5T A;  3GOI A;  1RTJ A;  2P9I B;  3R1X A;  3NH0 A;  1HKB A;  3MED A;  3NCI A;  4CJ4 A;  5LMN K;  4FJK A;  2DPN A;  4X66 K;  4MLH A;  3V9W A;  5LMU K;  2FC0 A;  2GV9 A;  5DK5 A;  3QEX A;  2A1S A;  4OGE A;  4AIL C;  1NJX A;  4DR4 K;  3ID6 A;  3D0P A;  2B5J A;  2P9N B;  3IKM A;  2W6L A;  1NGG A;  3NGY A;  5KGW A;  2KHO A;  3ZSO A;  4DFK A;  3ASM A;  5M1P A;  2UXD K;  1XWL A;  3VF6 A;  4CGJ A;  1J6Z A;  5GIN A;  4FVU A;  1Y64 A;  2Z1J A;  5ADX H;  4CIF A;  3NVM A;  1YXQ A;  2Q3S A;  3O9S A;  1MWK A;  3ZSY A;  3CM6 A;  3V9X A;  5FLX O;  4FYD A;  2P1J A;  4N5S A;  1QSY A;  4W5T A;  2E6M A;  1LOT B;  1HPZ A;  2NRZ A;  4X62 K;  4CHQ A;  1WBD A;  3I8D A;  2Q31 A;  3TAE A;  3NHG A;  2HHS A;  3O9U A;  3EO3 A;  5AQP A;  3VQA A;  4CEO A;  3I0S A;  1S1U A;  3ZT0 A;  1M90 O;  2YCH A;  4ICL A;  1NU0 A;  1U2V B;  3J8A A;  3KKR A;  4CZH A;  3N4P A;  5HOO A;  1CXU A;  3M8P A;  2LSN A;  4NYF A;  1WBB A;  3O9T A;  4AHR A;  3O9R A;  3GG4 A;  3KIO A;  3I56 N;  3RR8 A;  4BRI A;  4HUE A;  2QWR A;  3G71 N;  3CJB A;  4MO5 A;  1T05 A;  3H3O B;  4JHD B;  3RMD A;  1ASV A;  1D9D A;  3VEV A;  1GOC A;  4H0T B;  3TAR A;  4K8Z A;  4KHN A;  4LC9 B;  3C6T A;  4FJ5 A;  3MN6 A;  3OHR A;  2KQ2 A;  1CLQ A;  4FLU A;  3HSC A;  4JEP A;  2QXL A;  3ATV A;  1VRU A;  4NCG A;  1SQK A;  1NWK A;  1DKG D;  1GLF O;  1J5O A;  3H3N O;  3SI6 A;  3NH1 A;  2OPR A;  4DTM A;  2IVP A;  2VCP A;  5TKY A;  2H3G X;  4CHN A;  4KPY A;  1VAZ A;  3H46 O;  3L2R A;  3CXC M;  1Q86 O;  4KRF A;  5EVZ A;  1HYS A;  4YOW A;  5EX5 A;  3QBW A;  3AVJ A;  3MDQ A;  4C8K A;  3AVH A;  3NF8 A;  1LW2 A;  1KFD A;  3OJS A;  2F4V K;  1YUW A;  1NGA A;  3PO4 A;  4BE0 A;  5BRD A;  4NLC A;  4DMN A;  3CI5 A;  2HBJ A;  2UUC K;  3RMC A;  4MDA A;  5DM7 L;  2RF2 A;  4BRH A;  2VGM A;  3ULE A;  4MO4 A;  3ZSW A;  2QK9 A;  4FXD A;  5M1N A;  3O80 A;  3QIO A;  5M1K A;  1ESV A;  3M8S A;  4CZE A;  5GIP A;  4CJF A;  2WON A;  4DV0 K;  2O8F B;  1NJW A;  5TKW A;  3HJF A;  2O8D A;  5AQT A;  4IBN A;  4C23 A;  4JI0 K;  3OYC A;  2O4G A;  3TAM A;  4CJS A;  2BGG A;  4OKK A;  4N56 A;  5HRR A;  3HPG A;  3HTV A;  1W7A A;  3PV8 A;  4WFB L;  3CQX A;  1VSH A;  3R6M A;  5C25 A;  1IBM K;  3THW A;  1IBK K;  5EOY A;  4BR5 A;  4B9V A;  1E3M A;  2NZT A;  4K0K K;  1X9W A;  1OVQ A;  4QS9 A;  3FZH A;  1VQO N;  1LW0 A;  4DV3 K;  4HHT A;  1KAZ A;  3DLK A;  4R79 A;  4FZY A;  1J5E K;  3K0S A;  2PFU A;  1HQU A;  1L3S A;  1MDU B;  3HZ6 A;  3HP6 A;  3BF3 A;  4OVL A;  4KHU A;  3HPH A;  3A0I X;  4H5R A;  2HHU A;  5F0X A;  3K2P A;  3HOS A;  4BE1 A;  3U8X A;  2Q97 A;  4BGB A;  1BDG A;  4FLZ A;  3AO3 A;  1TUY A;  3OYD A;  3TU5 A;  1NNE A;  2Q0U A;  4JI3 K;  1S6P A;  5LJV A;  4ELV A;  3JXU A;  1JLA A;  3QML A;  1S3X A;  4CBX A;  4YOR A;  4H5V A;  3SBT A;  2F9W A;  4LF7 K;  2ZJP L;  3SPY A;  1GOB A;  1VK0 A;  4BRN A;  3JYT A;  1T6D A;  2R7Y A;  4DWI A;  4DKW A;  5AQN A;  3EE8 A;  1WAF A;  1NK5 A;  3OBY A;  3PUF A;  4FWN A;  1KTQ A;  1Z05 A;  4I2Q A;  3NFA A;  3OYJ A;  5KGX A;  1RT6 A;  2Y1I A;  4PWD A;  1OH8 A;  4CK3 A;  3F2K A;  4O8K A;  1VQM N;  2P9K B;  1RT7 A;  3ZSR A;  1O13 A;  2ZD1 A;  3KJV A;  3EKS A;  4JN4 A;  4FM1 A;  3VES A;  4OJR A;  2D4W A;  4E1N A;  4W5R A;  2FBT A;  1NGI A;  2HHT A;  1I3A A;  3P1G A;  2A1R A;  4BRL A;  2ZQB A;  1GLD G;  1CXQ A;  5AQS A;  3PIP L;  1Y97 A;  3AAP A;  4B9Q A;  3FE1 A;  2D0B A;  3UKU A;  2ZF5 O;  2A6A A;  2QI2 A;  2UUB K;  4IDK A;  2NLX A;  4CF2 A;  3KVG A;  2OA8 A;  4O5B A;  2QTD A;  3FLC O;  3PY8 A;  3UE5 A;  4LH5 A;  1VSL A;  2E2P A;  1SKW A;  3NF7 A;  1GLC G;  3JS6 A;  4HTU A;  1VQ9 N;  3SUN A;  3CHW A;  2IS3 A;  4BR0 A;  4AHV A;  5M1Q A;  4BRK A;  4MLE A;  3P38 A;  5T7B A;  4V19 S;  1BIZ A;  5E41 A;  1KLM A;  2B4J A;  3MEG A;  3LDL A;  3O1B A;  1XMO K;  4K41 A;  4JKH A;  1DGK N;  4EHT A;  3LPU A;  3HVR A;  4B1Z A;  4DF8 A;  1HNV A;  5AQW A;  3MEE A;  3QEV A;  4GV3 A;  4JS5 A;  3V81 A;  2A42 A;  4WFA L;  2HBL A;  5GAE P;  2X74 A;  4DLG A;  2OAN A;  1RBV A;  4QCL A;  2VG5 A;  2HST A;  2CH5 A;  2V7Y A;  1NMN A;  2E2O A;  3OYF A;  5C15 A;  1Z25 A;  1K8A O;  3ZLJ A;  1RBT A;  1ATR A;  2ATQ A;  1TL3 A;  3VEW A;  2P9P B;  1RDC A;  3P5J A;  3HYF A;  3P4I A;  1VSF A;  3CCJ N;  4JRQ A;  4LSN A;  1WB9 A;  2YX6 A;  4WQ5 C;  2FXU A;  3V4I A;  4FPB A;  4CJT A;  4J2A A;  2NNW A;  3D2F A;  5KQ8 A;  4DF4 A;  4XEI A;  1TYQ A;  4NYN A;  5CHI A;  3J80 O;  1KAX A;  1VSI A;  4PKI A;  4E19 A;  4PY5 A;  3N4Q A;  1RNH A;  1ITG A;  1EWR A;  1C0F A;  3PO5 A;  3E9P A;  3SK3 A;  3O5B A;  1W9H A;  2ASM A;  1S22 A;  4O5F A;  3S41 A;  4DUY K;  4B1V A;  5AZJ A;  4GW6 A;  4E7I A;  5CE3 A;  1HPM A;  2I7P A;  3EE9 A;  3KD5 E;  1OH6 A;  3D6R A;  3MWT A;  1K73 O;  3H6E A;  3M8Q A;  4CJQ A;  4JRP A;  4EZ6 A;  4M3U A;  3VTI A;  1NJZ A;  1TK8 A;  1JLF A;  2W41 A;  1RTD A;  4JI7 K;  1Q81 O;  5A2Q O;  3KLH A;  3CCV N;  1U48 A;  4EZ9 A;  4EAH D;  4JI4 K;  3VQ9 A;  2AA4 A;  4IZ9 A;  4O44 A;  3R3L A;  3QNO A;  1ZC6 A;  1QQM A;  3VPZ A;  1P8Z A;  1K9M O;  4RCH A;  4ELU A;  3DYA A;  4LSL A;  4FW1 A;  1IBL K;  3WNG A;  3THV A;  1OVY A;  3TTF A;  4DUZ K;  5GAG P;  3EZ5 A;  4DQS A;  1HKC A;  4M3X A;  3T7Z A;  4F8R A;  4ISE A;  4TSX A;  4BVO A;  3A2F A;  4DSF A;  3BUZ B;  3CJ1 A;  3THY B;  3EEQ A;  4WF9 L;  1HYV A;  1TKX A;  2IGI A;  3CCR N;  3BGR A;  4XH5 A;  1NJY A;  3WUH A;  2ZGZ A;  3HM9 A;  5KRS A;  4FO0 A;  3RTV A;  3FFI A;  4JYA K;  1VQP N;  4CJR A;  1WUA A;  4CHZ A;  4DQ8 A;  2P5G A;  4DR2 K;  4G9Z A;  3QO9 A;  5AQK A;  1EET A;  4JD2 A;  4IOC L;  3AAQ A;  3CCS N;  4O0I A;  3UB5 A;  4H5W A;  1TGO A;  2PBD A;  3A5L C;  3KK1 A;  2QM1 A;  2KZZ A;  5LJW A;  3CD6 N;  3VQE A;  1IO2 A;  1JCF A;  2OTL N;  1C0G A;  1S72 N;  3BY5 A;  1W0H A;  5AQL A;  1LV5 A;  2O4I A;  2JWK A;  4X65 K;  4DSK A;  1C6V A;  4X64 K;  3SMS A;  3HBT A;  4AHS A;  2NRT A;  4FCY A;  1KFS A;  1U2V A;  3B6O A;  4A5B A;  4DHY A;  4FLV A;  1JLB A;  3THX A;  2ZJR L;  3HOT A;  1GOA A;  3C7N A;  4CCH A;  4PL8 A;  3L8B A;  2O8E B;  2EWS A;  1Q9Y A;  4Z0U A;  4YFU A;  3ZT1 A;  3DRS A;  2E8A A;  4B9T A;  3G6E N;  4M7X A;  4LD0 A;  1NGH A;  3O4W A;  3F9K A;  1XNQ K;  5I42 A;  4I6M B;  3WXL A;  4M3Z A;  3RMA A;  4BWM A;  4CIG A;  1GLJ O;  4KBO A;  4BC3 A;  4M7Y A;  5JLF A;  4FJM A;  4WYB A;  1RBS A;  1YIT N;  4CHO A;  4YOY A;  1P90 A;  4ISG A;  4Q5V A;  3WQU A;  4CZI A;  3AA4 A;  1XUP O;  1WN7 A;  1NK7 A;  5JVG L;  4OPH A;  3QER A;  4JD2 B;  4NO7 A;  4BG9 A;  2YHY A;  3VMF B;  2D0A A;  3DLR A;  1I39 A;  3O1W A;  1SL1 A;  5HRO A;  4B1X B;  4M42 A;  4KHS A;  4CIE A;  1NGE A;  4CEE A;  1DLO A;  3OYK A;  2BH1 A;  4FJH A;  2FSN A;  4DR3 K;  3IFR A;  3M3Z A;  4IJA A;  3WXI A;  4BVP A;  4OPK A;  3U9Z A;  1WSF A;  1F21 A;  4IFE A;  2UXB K;  2ITG A;  3LAL A;  2NRV A;  2NRX A;  2OPS A;  1NK9 A;  3SV4 A;  1UAX A;  4I9Q A;  2V51 B;  5AQF A;  5AQU A;  4JI6 K;  1BIS A;  3ULE B;  2P9U A;  4BAC A;  5C2D A;  1QTM A;  4KTW A;  2HBK A;  1T03 A;  2QWM A;  4CFC A;  5AQZ A;  4BRD A;  5AQI A;  1N32 K;  4WQ5 A;  4FZX C;  3CCQ N;  1C1C A;  1A5V A;  1SV5 A;  1VSK A;  5AJ3 K;  2XY5 A;  5J2M A;  2QW9 A;  4DQP A;  1BU6 O;  1H1V A;  5BPM A;  3FZK A;  1KXP A;  3AA2 A;  3U3G A;  1VQN N;  1X9M A;  3SUP A;  5HRN A;  1NKE A;  5AQH A;  1GLE G;  3EY1 A;  4JKB A;  3LWM A;  1IG8 A;  3AAR A;  5HLF A;  3VQ4 A;  4H4M A;  1E4F T;  3EKU A;  3DAW A;  3DJC A;  4K8X A;  1LWF A;  1GLA G;  2YNH A;  3L0Q A;  4C8N A;  3ID8 A;  3SPZ A;  3CJC A;  5FRM A;  1IKY A;  2NRH A;  4FWR A;  1JL2 A;  1SS6 A;  3H1V X;  3QIC A;  4KV8 A;  1WOQ A;  4RG8 A;  3I33 A;  4W5O A;  1Q8I A;  4CBU A;  1UA0 A;  4IG3 A;  3NAE A;  3M1F A;  4OGC A;  3AY9 A;  2ITM A;  3SYZ A;  2O8F A;  5FPN A;  4CGI A;  3DXM B;  1RT1 A;  1LAV A;  2BAN A;  2YNG A;  3AGK A;  2D5R A;  1BUP A;  4XIU A;  4RTF D;  1YF5 L;  4CES A;  4KTQ A;  4FJ7 A;  2G8I A;  4I2P A;  3HT3 A;  2FLO A;  3AVM A;  3AVC A;  4JV5 K;  3KK7 A;  3THX B;  4ID5 A;  5M1O A;  2E5L K;  4KHW A;  2WBN A;  3C6A A;  4B08 A;  4CEA A;  3U3Y A;  1IV0 A;  1KD1 O;  1UA1 A;  3E1Y A;  1RDA A;  3A8Y A;  5ADX A;  3VF2 A;  3L4Q A;  4H0P A;  3AVF A;  3PIO L;  4C8O A;  2HOE A;  2FSJ A;  3CET A;  3DLG A;  4JI2 K;  1T8E A;  2IIR A;  1KVA A;  3TSP A;  2PAV A;  1MU2 A;  1X3N A;  1TAU A;  5HRP A;  1RIL A;  1JCE A;  3AVK A;  1TK0 A;  2AJQ A;  2QA4 N;  3BEX A;  3LL3 A;  1ZBU A;  1BO5 O;  5H1S Q;  3JSM A;  3CER A;  1SUQ A;  4H8K A;  4E1M A;  1QQO A;  1M1K O;  2IDO A;  3AO1 A;  2G8K A;  2YI1 A;  1QHA A;  2A3Z A;  4FSV A;  5FRO A;  3PX0 A;  5J2Q A;  3D2E B;  1CZ9 A;  2RN2 A;  3QBX A;  4CZK A;  3E9L A;  1FXX A;  1GLB G;  4MDB A;  2D1K A;  5FPD A;  3CPW M;  4Z4I A;  4CD3 A;  3CFR A;  1ASW A;  3K9K A;  3KZB A;  4DR5 K;  4DTO A;  4IKF A;  2GWJ A;  5J2N A;  2GX9 A;  1XHZ A;  3E01 A;  2X78 A;  4QS8 A;  3O4N A;  5BR8 K;  1SL0 A;  1KQS M;  3CPE A;  4ILH A;  3O08 A;  3S3N A;  1FKP A;  4H0V B;  4CF1 A;  3CME N;  4N47 A;  3DMJ A;  3CMA N;  4H5N A;  4K43 A;  3BZC A;  4CJP A;  1NBW A;  1R59 O;  2ASO A;  3VQP A;  3VN5 A;  4B1Y B;  3SBG A;  4K42 A;  3HVT A;  4YY3 K;  2VQE K;  3ZSZ A;  5CZ2 A;  3LDS A;  4CEB A;  4KI6 A;  1N33 K;  4DR7 K;  1U45 A;  4KB0 A;  4PKH A;  4KRE A;  4FLX A;  1RDU A;  2JLE A;  3VGK A;  3HK2 A;  2QWL A;  4IEE A;  3M5R A;  1N8R O;  1RGI A;  4C8M A;  3LWL A;  3ZEU B;  3QET A;  1B9D A;  4KH5 A;  4CD1 A;  1HQE A;  4F2S A;  4FWO A;  3KLF A;  5SZT A;  3AA3 A;  4NXN K;  4FZZ A;  3VET A;  3GL1 A;  4GKJ K;  1A5W A;  2P9I A;  3LP2 A;  3D2E A;  3NF6 A;  1BA1 A;  1UWB A;  2QKK A;  2O8B B;  2FBV A;  4N41 A;  4N76 A;  3KK3 A;  3LAN A;  3MN9 A;  4FJN A;  3TAG A;  4QOZ B;  2BE2 A;  4FOE A;  1QE1 A;  2WFB A;  1YJW N;  4CER A;  4BDP A;  3FGU A;  3HP9 A;  5BN8 A;  3NE6 A;  2BTF A;  4GV6 A;  3PX4 A;  2JWL A;  3AGR A;  1VSE A;  3ZT4 A;  4JKE A;  3QEW A;  3R8E A;  1IJJ A;  4W5Q A;  1VQ6 N;  1QZ6 A;  4QAG A;  2Z1G A;  4FJJ A;  4KH4 A;  2HVH A;  1S1T A;  1VQ5 N;  3V9S A;  2E1Z A;  1XC9 A;  3V1R A;  3S9H A;  3LPT A;  3OVN A;  1RCH A;  4DR6 K;  5AQG A;  3LDQ A;  4M3Y A;  3LDN A;  2Q0R A;  4Z94 A;  1BQM A;  2QWO A;  4CJ3 A;  5CR4 A;  4HCC A;  3ENB A;  2GUP A;  4DV7 K;  3AVG A;  3SJJ A;  4FM2 A;  5CYQ A;  4NB4 A;  2HHH K;  4ZTJ A;  3BF1 A;  4G1Q A;  4O8U A;  4CFA A;  5KPZ A;  4FJ8 A;  3KD1 E;  3ENH A;  3THY A;  4CF8 A;  2A40 A;  3OYH A;  1NLV A;  4DTS A;  3HL8 A;  4BDZ A;  1KCF A;  3U4L A;  4OX9 K;  3MAQ A;  2YKN A;  2G8H A;  3SMP A;  4E0D A;  2RE2 A;  5HRS A;  2XO7 A;  4CJE A;  5FDL A;  4B3R K;  4DR1 K;  3VQ8 A;  5BRH A;  3GDQ A;  3D7E O;  3M6G A;  4JS4 A;  3PSF A;  4JAX A;  3CJ9 A;  1ASU A;  2E2Q A;  3S3M A;  5C24 A;  4CGF A;  4J2E A;  1YVU A;  3CC7 N;  4B9U A;  2HHQ A;  3SAH A;  2VQF K;  2VWJ A;  3TAB A;  4JK9 A;  3KK2 A;  1BQN A;  1L3U A;  3IUC A;  2HBM A;  1X1P A;  4H0O A;  4AHU A;  3VOV A;  4YOV A;  4DSE A;  1HLU A;  3SV3 A;  4BQL A;  2BUP A;  4CZJ A;  1TYQ B;  5BPN A;  3A5N C;  3ISN C;  2YJF A;  1O1W A;  5KPT A;  2HF3 A;  1D4X A;  1YVN A;  3MCA B;  3CJA A;  3QIP A;  2OPQ A;  3UIQ A;  5JLH A;  4FL9 A;  4CGG A;  1J54 A;  1VQ4 N;  2NRR A;  2HVI A;  3TTD A;  4M3W A;  4IJN A;  3VQ7 A;  3MX2 A;  3O3F A;  1E4G T;  3AO4 A;  4CZM A;  3CF5 L;  4WQ4 C;  4FK4 A;  5M1F A;  3C6H A;  3O3G A;  5AR0 A;  1XI1 A;  4JLH A;  3MWP A;  5IWA K;  3DLE A;  3P31 A;  4I7F A;  2FF3 B;  4BY9 C;  1HNW K;  4F3O A;  4AQY K;  5AFU A;  3WEE A;  1KAY A;  1WLJ A;  1TV6 A;  3TAQ A;  4EP5 A;  4FPA A;  2FBY A;  1QVF M;  4IDH A;  5MLC Q;  5DMR A;  3ULD A;  4RW6 A;  3OBW A;  3K5N A;  3VQ6 A;  4FW2 A;  4KTZ A;  5KRT A;  5I9E B;  3VEY A;  3ZSV A;  3F73 A;  3ZX0 A;  4RWT A;  1C0T A;  3TTC A;  3ZYY X;  3E9O A;  1ILY A;  1QQN A;  2FF6 A;  1BWF O;  3OS1 A;  4FLT A;  1Z6R A;  3ITH A;  3VF4 A;  4CJ7 A;  4RW4 A;  1YJN N;  3TSQ A;  2I7N A;  2Q2R A;  4CVN E;  4JK7 A;  4A5A A;  3SLC A;  1TL1 A;  1XC3 A;  1NK6 A;  4PKG A;  5SWM A;  4CJL A;  4FJX A;  5AQM A;  4A2A A;  3H45 C;  4ELT A;  2GWK A;  5E26 A;  4NXM K;  2HHV A;  4FWS A;  4K25 A;  1RT2 A;  2EX3 A;  1IG9 A;  3L6Q A;  4BR9 A;  2KFN A;  3EN9 A;  5LY3 A;  3VEZ A;  4EP4 A;  4BWJ A;  3NMU A;  1IKV A;  4JKG A;  3O8M A;  5J1E A;  4B9L A;  5C12 A;  1OH5 A;  3E66 A;  3H1Q A;  5CY4 A;  3WNF A;  5C10 A;  2D0P A;  1TKT A;  1ZBI A;  3HO1 A;  1RTH A;  5F2R A;  4JKD A;  4B9M A;  3DRR A;  3DXK B;  3QNN A;  1C1A A;  2KKZ A;  2Q1N A;  2P9N A;  2I5J A;  4HUF A;  3QFU A;  4CF0 A;  1NKC A;  4GMJ B;  4BRQ A;  4CZF A;  3K57 A;  3LP0 A;  1WSH A;  4H0X B;  5AQY A;  4B8A B;  4C1N K;  5F1X A;  4NCB A;  4PA1 A;  2VWB A;  4BR7 A;  1N5Y A;  2WOM A;  5AQX A;  5AQQ A;  2IAJ A;  1NK0 A;  2ASP A;  5E84 A;  2IVN A;  3IDH A;  3HPO A;  3OYN A;  3AVN A;  4CZG A;  3QEP A;  1N6Q A;  2IC3 A;  1S1W A;  2A5X A;  4CK2 A;  4HCB A;  2CH6 A;  4A57 A;  4GVM A;  4KI4 A;  4WFN L;  5AQJ A;  3ALY A;  1RTI A;  2E2N A;  2QWQ A;  1ZBH A;  4CBW A;  2O8D B;  1T6C A;  3AVL A;  4DTP A;  4PHT X;  1BI4 B;  4DLE A;  3KTQ A;  2KFZ A;  4H4O A;  5CZ1 A;  3SCX A;  4KHP K;  2P9L B;  2AP1 A;  4Z4G A;  1TKZ A;  4HVJ A;  3FFK B;  5AFU H;  3HM8 A;  1EO1 A;  2Z1H A;  2F96 A;  2YNI A;  1L5U A;  3KWG A;  5GIO A;  1RT5 A;  3L2U A;  1VHX A;  3L3V A;  4DV4 K;  3AO5 A;  3EL2 A;  3QES A;  1BCM A;  4FJG A;  4AHT A;  3AA5 X;  5FPE A;  4AH9 A;  4DS5 A;  1HJR A;  3CCU N;  2HW3 A;  4DG1 A;  2HND A;  2W6K A;  4DFJ A;  4IEI A;  3NBP A;  2G8W A;  3B6P A;  4YOU A;  4BC2 A;  4A59 A;  2Z1I A;  4XH1 A;  1EWQ A;  4M3R A;  3QEI A;  2XY8 A;  3TI0 A;  1QSL A;  3B8A X;  3SJH A;  3T3F A;  4KHY A;  1S6Q A;  3LM2 A;  4NCA A;  4ZHR A;  2PYL A;  1NK4 A;  4KFB A;  1WSJ A;  4JKA A;  1RDB A;  3FZM A;  5JVH L;  1U4B A;  4LF8 K;  2G8U A;  3I8B A;  2O8E A;  1X3M A;  1NGC A;  1NK8 A;  3C7N B;  3U9D A;  3M8R A;  1N36 K;  3IMX A;  1MA9 B;  4DV5 K;  2HHX A;  3VEN A;  1DTT A;  1V4S A;  3SUO A;  1QVG M;  3TAP A;  4IWV A;  3ZT3 A;  3KLG A;  3G0Z A;  2F8S A;  4I6M A;  4FK2 A;  5EXW A;  4BRM A;  3I55 N;  3K59 A;  1NG9 A;  4FOI A;  3K58 A;  3OA9 A;  3PSI A;  5EY4 A;  5D3G A;  4MFB A;  1C1B A;  4FJ9 A;  3RRG A;  2W40 A;  3K9J A;  2E6L A;  1ATN A;  5C42 A;  3V1O A;  4DTU A;  1K6Y A;  2OPP A;  3FZL A;  3MEC A;  3MN5 A;  1BHL A;  2PY5 A;  1J9A A;  4CI6 A;  4FM0 A;  4B1U B;  3OTO K;  1TK5 A;  1DT9 A;  4HTL A;  4BG8 A;  3DLL L;  2ETJ A;  3THW B;  2KTQ A;  1VSJ A;  2HB5 A;  3LM9 A;  4PL7 A;  3BP8 A;  5JIC A;  1YI2 N;  4YOT A;  3ZSQ A;  2UXC K;  4DTX A;  3OYG A;  3VQC A;  3CIP A;  2P5O A;  2GBZ A;  3CCM N;  3VGM A;  5GAD P;  1OKJ A;  4AF1 A;  4DV6 K;  1WSI A;  1TVR A;  1HNZ K;  3HI0 A;  4IFV A;  3LDO A;  3DM2 A;  1NGD A;  2KLA A;  4KKO A;  3NH2 A;  3K5M A;  3LZJ A;  4B9N A;  1QQC A;  3MXM A;  3AVB A;  3QB0 A;  3PLA A;  3L2Q A;  1Q7Y O;  4M3T A;  4E3S A;  1BL3 A;  4FWM A;  4J2B A;  3CFP A;  2V52 B;  2G8V A;  3ATU A;  4Q0B A;  2ZJQ L;  3LAM A;  4CEF A;  3SZ2 A;  2GEL A;  1HMV A;  3VA0 A;  2QXF A;  1LWE A;  3F9M A;  4AM7 A;  2NRW A;  3GE1 A;  5DM6 L;  4GY2 B;  2EHG A;  1Q18 A;  3KKS A;  2RPI A;  1B92 A;  4OLA A;  3J7A P;  1YHQ N;  4O55 A;  4IOA L;  1FJG K;  3CFO A;  3V9Z A;  3D45 A;  3WQT A;  1KRP A;  3SQ4 A;  4M41 A;  4CFD A;  1TUU A;  3G4S N;  4CGD A;  3OYB A;  3HST B;  1JKH A;  3D2F B;  1KVB A;  4BRP A;  5BRE A;  2X6S A;  3MXI A;  4B9S A;  4GKK K;  1YIJ N;  3T1H K;  3O4Q A;  2PZS A;  4Z4C A;  1KLN A;  4C8L A;  2OZM A;  1L3V A;  4Z4F A;  3OYE A;  3CYM A;  2J4R A;  5IT9 O;  1EQY A;  4F2R A;  4NLB A;  2ZE2 A;  4E7J A;  1T7P A;  1NKB A;  3QIN A;  2P9S B;  4B3O A;  1JXE A;  4CJW A;  1HR0 K;  3OYL A;  4E7L A;  4J2D A;  4Y1D A;  4OPA A;  4IO8 A;  4L8R B;  2VYP A;  3IRX A;  3EYZ A;  1ZBL A;  4CJK A;  2PYJ A;  4B3T K;  2B6A A;  1MWM A;  4DFP A;  3DI6 A;  1WSG A;  1I94 K;  1WNS A;  1J53 A;  4EIA A;  4LY7 A;  4Y0W A;  1IKW A;  4B1W B;  2NUB A;  1K8K A;  2Y1J A;  3KLI A;  3KLE A;  3VTH A;  1JL1 A;  4BC4 A;  2E20 A;  5KI6 A;  3F5T A;  3AV9 A;  2OYQ A;  1L3T A;  5KTQ A;  1KVC A;  1RBR A;  4CF9 A;  3RSE A;  3J7Y P;  3S3O A;  4XH4 A;  4DU4 A;  1V4T A;  1BOT O;  3WEE B;  3MX5 A;  3V9U A;  4LF9 K;  3CC2 N;  2RKI A;  4LF4 K;  4PQU A;  4BRC A;  3BDP A;  4BRF A;  1KSP A;  2YKM A;  5EU7 A;  1HJO A;  4CJ5 A;  4FLW A;  5C0Y A;  1VSD A;  4CW7 B;  1LAW A;  4A61 A;  1JLG A;  3KHY A;  1QS4 A;  3FR0 A;  4YDU C;  1YAG A;  4H03 B;  5KQD A;  1RT4 A;  4DTJ A;  4DFM A;  2WUS A;  4DB3 A;  3K5O A;  4M63 C;  1A5X A;  3L2W A;  2E88 A;  1SAZ A;  4H0Y B;  4B3S K;  4W5N A;  1G99 A;  1JCG A;  1NGB A;  4CEZ A;  3G25 A;  4M45 A;  3SAF A;  4JI5 K;  3OS2 A;  3C95 A;  4KO0 A;  4DCH A;  4CFB A;  4DU1 A;  5FPM A;  4DU3 A;  3ZEU A;  3VQQ A;  4IG0 A;  4R5P A;  3OYM A;  3WNE A;  3C94 A;  3VGL A;  1QHT A;  4CE9 A;  4AM6 A;  3MK6 A;  4LFB K;  1ZXO A;  3FZF A;  2ZM6 K;  4GNI A;  2WC9 A;  4FWL A;  1T3V A;  2WTU A;  2W42 A;  4BC5 A;  4FLY A;  5BN9 A;  2E4L A;  4QS7 A;  4BRG A;  2XY6 A;  1WAJ A;  1EKE A;  4YDU A;  3UKR A;  4F4K A;  4FWQ A;  2HF4 A;  2QWN A;  3OS0 A;  1FK9 A;  1NGJ A;  4F3T A;  4IFY A;  4WQ4 A;  3R9P A;  3J81 O;  1BIU A;  3ZET A;  3QLH A;  3SQ2 A;  3SAG A;  3J7Z O;  2D0C A;  2VG6 A;  4JKF A;  4BGA A;  4DTN A;  2CGK A;  1CZB A;  3C0B A;  3C65 A;  5HP1 A;  3W0L A;  3SNN A;  1JJ2 M;  4LF5 K;  4DSL A;  1JLQ A;  2OZS A;  2X6N A;  4KHQ A;  2KW4 A;  2F7T A;  2V7Z A;  3TSU A;  5HL7 L;  3RVC A;  4FJL A;  4BR2 A;  1Q9X A;  3DWL A;  3QFP A;  1G15 A;  4BR4 A;  4DSJ A;  4U7B A;  5JS2 A;  3AO2 A;  4DSI A;  4ILJ A;  3TAN A;  1LCU A;  2VWK A;  4FK0 A;  1SL2 A;  2OTJ N;  4BRE A;  1BG3 A;  4IXC A;  1Z26 A;  3RMB A;  5CYM A;  4CEQ A;  1SKS A;  4ZTF A;  3TWH A;  2O8C B;  3JAM O;  3GBT A;  2FSK A;  4Z4H A;  4LFA K;  4L3Q A;  2P9P A;  3SQ1 A;  3IG1 A;  3QDK A;  3DOL A;  1FKO A;  1XNR K;  1ZYQ A;  1BI4 A;  2BDP A;  1IH7 A;  1EXQ A;  2XRI A;  3AVI A;  4LF6 K;  2OCE A;  5AQO A;  4FVM A;  1VRT A;  4BQZ A;  3VER A;  3TAF A;  3RR7 A;  4CHP A;  3MN7 A;  1RDW X;  2DFH A;  3P39 A;  1BA0 A;  1C0U A;  1SZ2 A;  2YHB A;  3Q7B A;  4GVE A;  4ID1 A;  3WXK A;  3SUQ A;  4CHY A;  4WE1 A;  1W97 L;  3LAK A;  4JKG B;  3LZI A;  3KWI A;  3PX6 A;  4HWI A;  5AZI B;  4Z4E A;  3VA3 A;  1SKR A;  1K8K B;  4FWP A;  1N34 K;  3DXK A;  4KH6 A;  1X9J A;  1D9F A;  2E1Y A;  1T44 A;  5BRF A;  1IKX A;  5AZJ B;  5HBM A;  1TAQ A;  3AVA A;  1KC8 O;  2YHA A;  1GLL O;  4DTR A;  4JNE A;  3SQ0 A;  4MQ3 A;  4BDY A;  2GUI A;  3L3U A;  3G10 A;  1UOC A;  1QZ5 A;  3LP3 A;  2VG7 A;  5KPR A;  3W3D A;  3HRG A;  4PUO A;  3VEX A;  2YV0 X;  3CQY A;  1U47 A;  2KZM A;  3I0R A;  2F8T A;  2O8C A;  3ZCM A;  4O0J A;  3CCL N;  4OLB A;  1S5J A;  4B8C A;  1XQS C;  4CEC A;  1WSE A;  5AQR A;  3TPQ A;  4JI8 K;  3ZET B;  3OW2 M;  1OH7 A;  1C0M A;  2RHK A;  4CJU A;  4DV1 K;  2JGU A;  4CZL A;  3UKR B;  3NDK A;  4E7H A;  4C1N I;  2CGL A;  1HNI A;  1VQ8 N;  2VGN A;  4YNQ A;  2HNZ A;  3WXJ A;  3CCE N;  1BGX T;  5LL6 Z;  4A62 A;  4BE2 A;  4CGH A;  4A2B A;  1EX4 A;  3LDP A;  4IOX A;  4DS4 A;  4ILG B;  3A5M C;  1XHX A;  1S9G A;  3VQ5 A;  2XHB A;  3NVK A;  3DRP A;  2YJE A;  3UKU B;  1B9F A;  2GEM A;  3CC4 N;  4FJI A;  1JXB A;  2Q36 A;  5AQV A;  4LH4 A;  2QKB A;  3V6D A;  5JS1 A;  2O8B A;  3MXJ A;  2P51 A;  1HKG A;  4OO1 J;  2HHW A;  4DQR A;  4DV2 K;  4UY8 O;  2DY4 A;  1NGF A;  4YHH K;  4RW8 A;  3CQ8 A;  4AHC A;  3Q7C A;  1REV A;  5JMV A;  1BCO A;  1HNX K;  5GAH P;  3LP1 A;  2DTU A;  3T19 A;  4U67 L;  2UUA K;  1VSM A;  1YTU A;  3U6F A;  4DQI A;  5FRN A;  1U6Z A;  3RSE B;  1ATS A;  4OKE A;  3IAY A;  5B8H A;  4E89 A;  1LWC A;  3P83 D;  2HNY A;  4F9O A;  1ZBS A;  2ZWH A;  3EZW A;  4UQG A;  1S1V A;  1VQL N;  3ZT2 A;  4BRA A;  2ZGY A;  3OY9 A;  3C6U A;  4B3M K;  3OYI A;  1HUX A;  2P9K A;  5ELZ A;  1FW6 A;  4IO9 L;  1JLE A;  4WCE L;  1TKD A;  3T69 A;  1ZBF A;  1EP4 A;  3L2V A;  4KB1 A;  2IVO A;  1X9S A;  2HMI A;  3V1Q A;  2P9S A;  1RBU A;  4J8F A;  3CG7 A;  2GTD A;  5K14 A;  1CZA N;  2CGJ A;  1YT3 A;  3DOK A;  1D8Y A;  1NM1 A;  2YNF A;  4EFH A;  1R0A A;  4I9L A;  3NGI A;  3ENO A;  1DTQ A; 
#chains in the Genus database with same CATH homology
 1VSF A;  3LP2 A;  3NF6 A;  4JRQ A;  4LSN A;  2IOC A;  3IS9 A;  4KKO A;  3NH2 A;  1D5A A;  1UWB A;  2QKK A;  3K5M A;  2FBV A;  3LZJ A;  4B9N A;  4N76 A;  1QQC A;  3LAN A;  3KK3 A;  4N41 A;  3V4I A;  4FJN A;  3MXM A;  3AVB A;  4CJT A;  4DQQ A;  3TAG A;  3O3H A;  3L2Q A;  4J2A A;  4QOZ B;  2BE2 A;  1QE1 A;  1U04 A;  4M3T A;  4DF4 A;  4E3S A;  3DLH A;  4CER A;  4BDP A;  1BL3 A;  3HP9 A;  4NYN A;  4J2B A;  3NE6 A;  3CFP A;  2XY7 A;  3HXM A;  3PX4 A;  1VSI A;  3RRH A;  4E19 A;  1U49 A;  2G8V A;  4Q0B A;  4PY5 A;  3H08 A;  3LAM A;  3TR8 A;  1VSE A;  3ZT4 A;  1RNH A;  4RW7 A;  4CEF A;  3SZ2 A;  3T1A A;  1ITG A;  5J2P A;  4W5Q A;  3QEW A;  3PO5 A;  1NOZ A;  4QAG A;  1HRH A;  1HMV A;  3VA0 A;  2QXF A;  3OJU A;  1LWE A;  1W9H A;  2Z1G A;  4CK1 A;  3CM5 A;  1JLC A;  4FJJ A;  4KAZ A;  2EHG A;  3KKS A;  2HVH A;  1S1T A;  2RPI A;  4GW6 A;  1B92 A;  4E7I A;  4CJV A;  3V9S A;  1XC9 A;  4OLA A;  3V1R A;  3S9H A;  1NOY A;  3KD5 E;  4O55 A;  3LPT A;  3OVN A;  1RCH A;  3CFO A;  2FBX A;  1RDD A;  3M8Q A;  4CJQ A;  4JRP A;  3V9Z A;  4EZ6 A;  4M3U A;  3D45 A;  1TK8 A;  1NJZ A;  4M3Y A;  1JLF A;  1S9E A;  4HUG A;  1RTD A;  4OKJ A;  3NGZ A;  1BQM A;  3KLH A;  4CJ3 A;  3SQ4 A;  1U48 A;  1KRP A;  4EZ9 A;  4M41 A;  4CFD A;  4HCC A;  4CGD A;  3VQ9 A;  3OYB A;  4O44 A;  3HST B;  3AVG A;  1JKH A;  3OYA A;  4FM2 A;  1KVB A;  3QNO A;  3SJJ A;  5CYQ A;  3VQB A;  4OPJ A;  2X6S A;  3MXI A;  2G8F A;  3RWU A;  4ZTJ A;  4B9S A;  3ZSX A;  1S1X A;  3WNH A;  4ELU A;  3DYA A;  4G1Q A;  3O4Q A;  4FW1 A;  4LSL A;  4CFA A;  4Z4C A;  1KLN A;  1HYZ A;  2PZS A;  4C8L A;  5I3U A;  3KD1 E;  4FJ8 A;  3WNG A;  3THV A;  4CF8 A;  2OZM A;  1L3V A;  4Z4F A;  3OYE A;  3OYH A;  3CYM A;  3EZ5 A;  3K5L A;  4F2R A;  4CED A;  2ZE2 A;  4DTS A;  4Y1C A;  3HL8 A;  4E7J A;  4DQS A;  4BDZ A;  1T7P A;  1NKB A;  4M3X A;  3QIN A;  1QSS A;  4F8R A;  3NF9 A;  1JXE A;  1KCF A;  4TSX A;  2DFF A;  4CJW A;  4E7K A;  4B3O A;  3A2F A;  3VQD A;  3MAQ A;  2YKN A;  4O4G A;  4DSF A;  3OYL A;  3DLB A;  4E7L A;  2G8H A;  4J2D A;  4RW9 A;  4Y1D A;  4E0D A;  4L8R B;  1HYV A;  1RT3 A;  2DFE A;  1TKX A;  1YTA A;  2IGI A;  3IRX A;  4CJK A;  3EYZ A;  5HRS A;  1ZBL A;  2PYJ A;  2B6A A;  3BGR A;  1NJY A;  4DFP A;  2XO7 A;  3DI6 A;  1WSG A;  3HM9 A;  5KRS A;  1RTJ A;  5FDL A;  4CJE A;  3FFI A;  3NH0 A;  1WNS A;  3MED A;  3RTV A;  1J53 A;  3NCI A;  4CJ4 A;  4FJK A;  3VQ8 A;  4LY7 A;  4CHZ A;  4CJR A;  2P5G A;  1IKW A;  2NUB A;  3V9W A;  2Y1J A;  3QO9 A;  3KLI A;  3KLE A;  4JS4 A;  1JL1 A;  2FC0 A;  1EET A;  2GV9 A;  5DK5 A;  5KI6 A;  2OYQ A;  3AV9 A;  1L3T A;  1ASU A;  3QEX A;  2A1S A;  4OGE A;  5KTQ A;  4AIL C;  4O0I A;  5C24 A;  1KVC A;  4CGF A;  3S3M A;  1NJX A;  4J2E A;  1TGO A;  1YVU A;  1RBR A;  2B5J A;  3D0P A;  4CF9 A;  4B9U A;  3KK1 A;  3S3O A;  2HHQ A;  3NGY A;  5KGW A;  2KZZ A;  3ZSO A;  2VWJ A;  4DU4 A;  4DFK A;  3ASM A;  3V9U A;  3TAB A;  3VQE A;  1BQN A;  3KK2 A;  1L3U A;  2RKI A;  1XWL A;  4PQU A;  1X1P A;  1IO2 A;  4CGJ A;  4AHU A;  3BDP A;  1KSP A;  2Z1J A;  1W0H A;  2YKM A;  5EU7 A;  4CIF A;  4CJ5 A;  4FLW A;  4DSE A;  1VSD A;  1LV5 A;  2O4I A;  3SV3 A;  1LAW A;  2Q3S A;  4DSK A;  1C6V A;  3ZSY A;  3CM6 A;  3V9X A;  1JLG A;  4FYD A;  2P1J A;  4AHS A;  4N5S A;  1QS4 A;  1QSY A;  3ISN C;  1O1W A;  4FCY A;  4W5T A;  1KFS A;  2E6M A;  3B6O A;  1HPZ A;  4FLV A;  1JLB A;  1RT4 A;  2OPQ A;  3QIP A;  4CHQ A;  3I8D A;  4DTJ A;  4DFM A;  3UIQ A;  3TAE A;  1GOA A;  3K5O A;  4CGG A;  4CCH A;  1J54 A;  3NHG A;  1A5X A;  3L2W A;  3L8B A;  2HVI A;  2HHS A;  1Q9Y A;  3VQA A;  4Z0U A;  4CEO A;  3I0S A;  4YFU A;  4W5N A;  4M3W A;  3ZT1 A;  3DRS A;  1S1U A;  3VQ7 A;  4CEZ A;  3O3F A;  4B9T A;  4LD0 A;  3ZT0 A;  3AO4 A;  4M45 A;  4ICL A;  3OS2 A;  3C95 A;  3KKR A;  4KO0 A;  3F9K A;  5I42 A;  4CFB A;  4FK4 A;  4DU1 A;  1CXU A;  4DU3 A;  3M8P A;  2LSN A;  4NYF A;  4BWM A;  3VQQ A;  4CIG A;  4IG0 A;  3RMA A;  4R5P A;  3O3G A;  3OYM A;  4AHR A;  1XI1 A;  3WNE A;  3C94 A;  4JLH A;  1QHT A;  3KIO A;  4CE9 A;  3RR8 A;  4HUE A;  4FJM A;  3DLE A;  4I7F A;  1RBS A;  1T05 A;  4CHO A;  4F3O A;  2W42 A;  3RMD A;  1ASV A;  4FLY A;  1D9D A;  2E4L A;  4Q5V A;  1WLJ A;  2XY6 A;  1WAJ A;  1EKE A;  1TV6 A;  4F4K A;  3TAQ A;  1GOC A;  3AA4 A;  4EP5 A;  3TAR A;  4K8Z A;  2FBY A;  3OS0 A;  4KHN A;  1FK9 A;  5DMR A;  4F3T A;  3C6T A;  4IFY A;  1WN7 A;  4RW6 A;  3ULD A;  4FJ5 A;  2KQ2 A;  1NK7 A;  1CLQ A;  1BIU A;  4FLU A;  3K5N A;  3QLH A;  3VQ6 A;  3QER A;  3SQ2 A;  4FW2 A;  4KTZ A;  5KRT A;  2D0C A;  2VG6 A;  4DTN A;  1VRU A;  2D0A A;  3DLR A;  1CZB A;  4NCG A;  3ZSV A;  3F73 A;  1I39 A;  1SL1 A;  5HP1 A;  3SNN A;  1C0T A;  5HRO A;  4DSL A;  4M42 A;  1JLQ A;  1J5O A;  4CIE A;  2X6N A;  2OZS A;  4CEE A;  3SI6 A;  1DLO A;  2KW4 A;  3NH1 A;  2OPR A;  3OYK A;  4FJH A;  4KHQ A;  4DTM A;  4FJL A;  3OS1 A;  4FLT A;  3ITH A;  4CHN A;  4OPK A;  4KPY A;  1WSF A;  1F21 A;  3L2R A;  1Q9X A;  4RW4 A;  4KRF A;  2ITG A;  1HYS A;  1G15 A;  3AVJ A;  3LAL A;  4C8K A;  3AVH A;  2OPS A;  3NF8 A;  1LW2 A;  1TL1 A;  1KFD A;  1NK9 A;  3SV4 A;  1UAX A;  1NK6 A;  5JS2 A;  3AO2 A;  5SWM A;  3OJS A;  4DSI A;  3TAN A;  4I9Q A;  4CJL A;  4FJX A;  2VWK A;  4FK0 A;  1SL2 A;  1BIS A;  3PO4 A;  1Z26 A;  4BAC A;  4BE0 A;  1QTM A;  3RMB A;  4ELT A;  5CYM A;  4CEQ A;  4DMN A;  1SKS A;  2HHV A;  4KTW A;  4ZTF A;  1T03 A;  3TWH A;  4CFC A;  3RMC A;  2RF2 A;  4Z4H A;  1RT2 A;  2EX3 A;  1IG9 A;  3SQ1 A;  4M3Z A;  4FZX C;  3IG1 A;  3ZSW A;  1C1C A;  1A5V A;  1SV5 A;  1VSK A;  2XY5 A;  3DOL A;  2QK9 A;  1FKO A;  4FXD A;  2KFN A;  5J2M A;  1ZYQ A;  3QIO A;  1BI4 A;  3M8S A;  4DQP A;  4CJF A;  2WON A;  2BDP A;  1IH7 A;  4EP4 A;  1NJW A;  1EXQ A;  2XRI A;  3AVI A;  4BWJ A;  3HJF A;  1IKV A;  4IBN A;  3OYC A;  2O4G A;  5J1E A;  4FVM A;  3AA2 A;  4B9L A;  3U3G A;  1VRT A;  3TAM A;  4CJS A;  1X9M A;  2BGG A;  3TAF A;  4OKK A;  3RR7 A;  5CY4 A;  3WNF A;  4N56 A;  3SUP A;  5HRN A;  1NKE A;  5HRR A;  4CHP A;  1TKT A;  3HPG A;  1ZBI A;  3EY1 A;  3LWM A;  3HO1 A;  1RTH A;  2DFH A;  4B9M A;  3PV8 A;  2YHB A;  1C0U A;  5HLF A;  1VSH A;  3DRR A;  3VQ4 A;  4ID1 A;  5C25 A;  4H4M A;  3SUQ A;  3QNN A;  1C1A A;  4B9V A;  4CHY A;  4WE1 A;  2I5J A;  4HUF A;  3LAK A;  4CF0 A;  1NKC A;  1X9W A;  4GMJ B;  1LWF A;  3LZI A;  4K8X A;  3PX6 A;  2YNH A;  3K57 A;  3LP0 A;  1WSH A;  1LW0 A;  4B8A B;  4HHT A;  3DLK A;  4Z4E A;  4FZY A;  4C8N A;  4NCB A;  4PA1 A;  3VA3 A;  3SPZ A;  1SKR A;  5FRM A;  1IKY A;  1N5Y A;  2WOM A;  1HQU A;  1L3S A;  2IAJ A;  1NK0 A;  3HP6 A;  1JL2 A;  1D9F A;  3HPO A;  4KHU A;  1IKX A;  4OVL A;  3OYN A;  4KV8 A;  5HBM A;  1TAQ A;  3AVN A;  3HPH A;  3QEP A;  1N6Q A;  2IC3 A;  1S1W A;  4RG8 A;  4CK2 A;  4HCB A;  3AVA A;  2HHU A;  4GVM A;  2YHA A;  1Q8I A;  4W5O A;  4KI4 A;  4DTR A;  3K2P A;  3SQ0 A;  1UA0 A;  4BE1 A;  4IG3 A;  3NAE A;  3ALY A;  4MQ3 A;  1RTI A;  4BDY A;  2GUI A;  3L3U A;  4OGC A;  4FLZ A;  3G10 A;  1UOC A;  3AO3 A;  1ZBH A;  3SYZ A;  3AVL A;  3LP3 A;  2VG7 A;  4CGI A;  4DTP A;  1RT1 A;  1LAV A;  1BI4 B;  3OYD A;  2BAN A;  2YNG A;  4DLE A;  3KTQ A;  2KFZ A;  1S6P A;  4H4O A;  5CZ1 A;  3SCX A;  2D5R A;  4ELV A;  4XIU A;  4PUO A;  1JLA A;  2YV0 X;  1U47 A;  4Z4G A;  2KZM A;  1TKZ A;  4HVJ A;  3I0R A;  4CES A;  4KTQ A;  2Z1H A;  2F96 A;  4FJ7 A;  2G8I A;  2YNI A;  4I2P A;  3HT3 A;  2F8T A;  3SPY A;  1L5U A;  3AVM A;  3AVC A;  3ZCM A;  1RT5 A;  3L2U A;  3L3V A;  4O0J A;  4OLB A;  3AO5 A;  4ID5 A;  4DSJ A;  1S5J A;  1GOB A;  1VK0 A;  3JYT A;  4DWI A;  4B8C A;  2R7Y A;  4KHW A;  4CEC A;  3QES A;  4KHS A;  4B08 A;  1BCM A;  1WSE A;  4FJG A;  4CEA A;  3U3Y A;  4AHT A;  1WAF A;  3AA5 X;  1NK5 A;  1UA1 A;  1C0M A;  3PUF A;  4CJU A;  1KTQ A;  4I2Q A;  4AH9 A;  2JGU A;  1HJR A;  3NFA A;  3OYJ A;  4DS5 A;  1RDA A;  2HND A;  4DG1 A;  2HW3 A;  5KGX A;  3NDK A;  4DFJ A;  4E7H A;  1RT6 A;  3NBP A;  1HNI A;  2Y1I A;  3AVF A;  4PWD A;  4YNQ A;  2HNZ A;  4CK3 A;  2G8W A;  4C8O A;  3B6P A;  1BGX T;  3DLG A;  4BE2 A;  4CGH A;  1RT7 A;  1EX4 A;  2Z1I A;  1T8E A;  3ZSR A;  2ZD1 A;  1KVA A;  4M3R A;  3KJV A;  4DS4 A;  4FM1 A;  1MU2 A;  1TAU A;  3QEI A;  2XY8 A;  1XHX A;  3TI0 A;  1S9G A;  1QSL A;  4OJR A;  5HRP A;  3VQ5 A;  2XHB A;  1RIL A;  3T3F A;  4KHY A;  3AVK A;  1TK0 A;  3DRP A;  4E1N A;  2AJQ A;  1S6Q A;  4W5R A;  2FBT A;  4ZHR A;  2PYL A;  4NCA A;  2HHT A;  1B9F A;  1I3A A;  1ZBU A;  3P1G A;  3JSM A;  1NK4 A;  1SUQ A;  4KFB A;  1WSJ A;  4H8K A;  1RDB A;  4E1M A;  1JXB A;  2IDO A;  2A1R A;  4LH4 A;  4FJI A;  3V6D A;  2QKB A;  5JS1 A;  2ZQB A;  1CXQ A;  3AO1 A;  1U4B A;  2G8K A;  5FRO A;  2G8U A;  3MXJ A;  1Y97 A;  2P51 A;  3PX0 A;  2HHW A;  4DQR A;  5J2Q A;  1NK8 A;  3M8R A;  1CZ9 A;  2DY4 A;  2RN2 A;  1FXX A;  2D0B A;  2HHX A;  4RW8 A;  4Z4I A;  1DTT A;  3SUO A;  3CFR A;  1ASW A;  4IDK A;  4CF2 A;  3KLG A;  3ZT3 A;  3TAP A;  3CQ8 A;  3G0Z A;  4AHC A;  2OA8 A;  4O5B A;  1REV A;  2F8S A;  1BCO A;  3PY8 A;  4LH5 A;  1VSL A;  4DTO A;  1SKW A;  4FK2 A;  4IKF A;  3LP1 A;  3NF7 A;  3K59 A;  5J2N A;  4HTU A;  2DTU A;  1XHZ A;  3K58 A;  3E01 A;  3T19 A;  2X78 A;  3O4N A;  3SUN A;  5D3G A;  1VSM A;  4MFB A;  1C1B A;  4FJ9 A;  1SL0 A;  3RRG A;  2IS3 A;  1YTU A;  2E6L A;  5C42 A;  3U6F A;  4DQI A;  3V1O A;  4AHV A;  4DTU A;  5FRN A;  1K6Y A;  4OKE A;  3S3N A;  3IAY A;  2OPP A;  1FKP A;  3MEC A;  5T7B A;  4E89 A;  1LWC A;  4CF1 A;  1BIZ A;  5E41 A;  1KLM A;  3P83 D;  4N47 A;  2B4J A;  2HNY A;  3DMJ A;  3MEG A;  1BHL A;  2PY5 A;  1J9A A;  4FM0 A;  4CJP A;  3LPU A;  1TK5 A;  3HVR A;  4UQG A;  4DF8 A;  1S1V A;  2ETJ A;  3VQP A;  1HNV A;  3VN5 A;  3ZT2 A;  3OY9 A;  2KTQ A;  3C6U A;  1VSJ A;  2HB5 A;  3HVT A;  3MEE A;  3QEV A;  3OYI A;  4JS5 A;  3ZSZ A;  5CZ2 A;  3LDS A;  4CEB A;  3V81 A;  4KI6 A;  1JLE A;  3ZSQ A;  4DTX A;  3OYG A;  1U45 A;  4KB0 A;  1TKD A;  2X74 A;  3VQC A;  4DLG A;  4FLX A;  1ZBF A;  2P5O A;  4KRE A;  1RBV A;  1EP4 A;  2JLE A;  2VG5 A;  4QCL A;  3HK2 A;  3L2V A;  4KB1 A;  1X9S A;  2GBZ A;  2HMI A;  3V1Q A;  4C8M A;  3LWL A;  1RBU A;  3CG7 A;  1WSI A;  1TVR A;  5K14 A;  3OYF A;  3QET A;  1B9D A;  1YT3 A;  1Z25 A;  4IFV A;  3DOK A;  1RBT A;  1HQE A;  4F2S A;  1D8Y A;  2YNF A;  2ATQ A;  1TL3 A;  5SZT A;  3KLF A;  1R0A A;  3AA3 A;  3DM2 A;  4I9L A;  3NGI A;  1DTQ A;  4FZZ A;  1RDC A;  3P5J A;  1A5W A;  3HYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...