4JYAK

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4jyaK00
1XNRK 5IWAK 4JYAK 2UUAK 4DV3K 1HNXK 4DUYK 4DR1K 4LFBK 5LMNK 4LF6K 4JI7K 4DUZK 1HR0K 1J5EK 4X65K 4CVNE 1XMQK 4DR6K 1HNZK 4DR4K 4B3TK 5A2QO 4DV4K 2E5LK 4B3SK 2VQFK 5LL6Z 3J7AP 4NXNK 2UUCK 4X64K 4LF5K 4OX9K 4V19S 2UU9K 4JI8K 3J80O 4JI1K 2UUBK 5BR8K 1N33K 4JI2K 4CW7B 4JV5K 1XMOK 1HNWK 4JI6K 4LF7K 4LF9K 4LFCK 1N36K 4DV0K 1I94K 5LMUK 3JAMO 1IBMK 4LF8K 4JI0K 4DR3K 1FJGK 4KHPK 4B3RK 4DR2K 4DV5K 2UXBK 4DV7K 4AQYK 2UXCK 3T1YK 4JI5K 1N32K 4NXMK 1IBLK 2F4VK 4YHHK 4GKJK 1XNQK 4JI3K 5FLXO 2ZM6K 4JI4K 4GKKK 4X66K 3J81O 5IT9O 3J7YP 3T1HK 4YY3K 5AJ3K 4DV2K 4DV6K 1N34K 4LF4K 1IBKK 4K0KK 2UXDK 4X62K 3OTOK 2HHHK 2VQEK 4DR7K 4DR5K 4B3MK 4LFAK 4DV1K
chains in the Genus database with same CATH superfamily
3L0QA 1OKJA 4AM7A 2B6AA 4DU4A 2QWLA 5HBMA 4O5FA 4K8XA 4Y1CA 4DV3K 4QS7A 3V81A 3H46O 4GV3A 4I2PA 4E0DA 4YFUA 1JCFA 1KVBA 3GBTA 4F3TA 1OVQA 3O3GA 4M3WA 3OJUA 4IFVA 1NKCA 2XO7A 5DM7L 1SL1A 1DKGD 3TAMA 1L3TA 5E26A 1SS6A 4AHRA 3V9ZA 4IJAA 3A0IX 2UUCK 1GLCG 4CZJA 2KFNA 3D2EB 3U9DA 1N8RO 4IZ9A 5HROA 3D2FB 4FWKA 4JI1K 1ESVA 2NLXA 4Z4HA 2V7YA 3CCQN 2GELA 3OBYA 5M1FA 1JCGA 3TTCA 1NK0A 3THYB 2KZZA 3NH2A 5KRSA 5CY4A 3AA4A 3NGIA 5EVZA 1YI2N 4A2AA 4XH4A 4BR2A 5GAGP 4IDKA 4BRFA 2OANA 2ITGA 5M1QA 3C6AA 4BR0A 5C10A 2IGIA 2E4LA 1C0MA 3OS1A 3C0BA 1O13A 3LDNA 4E7KA 1U47A 3TSUA 5BRHA 5FPEA 4NXMK 2G8UA 4CJVA 3SBGA 2HOEA 4JK8A 5CYMA 3PX4A 4E19A 4JI3K 1JLBA 5AQVA 1T6CA 1XHXA 3D7EO 3VERA 2V51B 3J81O 4F2SA 1QSLA 5FDLA 1Q82O 2P9NA 4CJEA 2XY6A 4KTZA 3TTDA 4U67L 1JKHA 4B9NA 3CC7N 1GOAA 3QBXA 2UXDK 3SQ0A 5BREA 2HHHK 4A5BA 4H0XB 1HYVA 5CR4A 4DSFA 5E84A 3CCMN 3RMBA 2OTLN 3G25A 3B8AX 4OPHA 4ID5A 1XNRK 1GLLO 2Q97A 4CF1A 1XQSC 5J1EA 3BY5A 1S1VA 4XIUA 1YVUA 4CGHA 2HSTA 3IRXA 3RSEA 1NMNA 1WSJA 4CZIA 2XHBA 4JKGA 4OKJA 1QTMA 1U6ZA 4F8RA 3C7NB 5GADP 4CD3A 1L3UA 4NXNK 3SPZA 4GVEA 3R3LA 4JK9A 3QB0A 4R79A 3V9SA 3RR7A 4OX9K 4V19S 4FM1A 2BE2A 4PA1A 1LV5A 1I3AA 1ZBHA 2O4IA 1SL2A 2GTDA 5KGWA 4LY7A 1U2VA 5HRNA 1HKCA 3IMXA 2JLEA 4FK2A 2EX3A 3ENOA 3IKMA 3MX2A 3NF6A 1K9MO 3OS0A 2P9PA 3HM9A 3FZKA 4DLGA 2HF3A 4CEFA 3T1AA 5AQRA 4CJ3A 2P9SA 1NGFA 2Y1JA 4N5SA 2PBDA 4FL9A 3LM9A 4B3RK 2KZMA 2DPNA 2FC0A 1NK5A 3VQBA 3IUCA 4DFMA 4C8NA 4BC5A 1JLCA 3K5LA 2UXCK 5AQNA 1NJIO 2ZJPL 1EO1A 3P1GA 3GG4A 1UA1A 3J7ZO 3R6MA 3AVKA 3ZSYA 3ZT4A 1HPMA 4BWMA 2H3GX 3P5JA 1TAQA 4CIFA 1QQOA 3A5OC 3VQ8A 1N5YA 3L2WA 4DG1A 4EP4A 3OYDA 2FSJA 3MEGA 4BRGA 2P9NB 4BWJA 4FWMA 1D9DA 4E1NA 1G99A 1T05A 3EL2A 4CZMA 4JKHA 2W42A 4DQRA 1C0FA 4L3QA 3RRHA 3SUPA 4FWPA 5TKWA 4W5QA 5MLCQ 4H5NA 5GIPA 1HKGA 4LFAK 4UY8O 4KH4A 3M8SA 4GMJB 4KH6A 1NK9A 1NGAA 1RBUA 3I55N 1NOYA 2A1SA 1NK4A 4ELVA 3A2FA 3RTVA 4DR1K 4BROA 3HRGA 1HMVA 4FLXA 3UIQA 1XMQK 1NGEA 2BUPA 3QFUA 4JK7A 1VAZA 4E1MA 4CJRA 4YDUA 3A5MC 3K58A 4RTFD 1K8KB 1YJ9N 4H5VA 4CHOA 2VWJA 3VEZA 4JI8K 4H0YB 2GWKA 4FJ7A 4B1WB 1T44A 4UQGA 3DRPA 3WXMB 4W5OA 4FJJA 3U9ZA 4CHZA 3I8DA 3HTVA 1YAGA 4M3UA 5HL7L 3ASMA 3ID6A 3B6OA 3H6EA 3NE6A 4M41A 3O08A 1W9HA 3VGLA 3VGMA 3W0LA 3PX0A 4BC3A 3SI6A 1SUQA 3HSTB 3R8EA 2QXLA 3PLAA 4DV5K 4Z4EA 3QESA 3SUQA 4C23A 4FZZA 2GX9A 4BREA 4AHSA 3AA5X 4LC9B 3MAQA 4M7XA 3VEWA 2JWKA 3QO9A 3LDQA 2EHGA 2NUBA 2OPSA 3CQXA 4KHQA 4DQPA 5K14A 1RFQA 3G6EN 1RTDA 3EKUA 3V9XA 1ZXOA 4IG0A 4BRCA 4KI6A 4BRAA 3T1HK 1HLUA 4YOWA 4IO8A 4I7FA 3OYLA 3S3MA 1MU2A 3T69A 3THVA 1QQMA 3OYJA 1RT1A 1VQNN 1WN7A 1NGDA 4CBXA 3F73A 1MWMA 3OYNA 4IFYA 5IWAK 4A61A 3WXLA 4PL8A 5BN8A 3O4NA 1EQYA 1Q86O 3LAKA 5M1KA 3O4WA 5LMNK 3OW2M 1WLJA 3ZX0A 4BE1A 3CJBA 3B6PA 1JLQA 1MDUB 4M63C 3IAYA 1SZ2A 1CZ9A 3QEXA 3TARA 5FROA 3UKRA 4CHYA 2RN2A 4H0OA 3ZT0A 1VSMA 1WSIA 1ASVA 3J80O 3L2QA 3WQUA 4RW7A 4J8FA 4NLCA 4WCEL 4DWIA 1SQKA 2Q0UA 4CJWA 4JI2K 4ZTFA 3DLLL 4NCGA 3QIOA 3I0SA 3SMSA 1RNHA 1U49A 1RTJA 4M3RA 2IVPA 4DHYA 3K59A 2HHQA 1BL3A 1RGIA 4O4GA 2R7YA 4K25A 5FPNA 4FM0A 3MMVA 1UOCA 2F96A 3AVHA 3CERA 3OYHA 1RTIA 4H5TA 4IEEA 4JHDB 4FWRA 5BPMA 3LDPA 1DT9A 1BA1A 4KREA 1DGKN 3E9LA 2DFEA 4FJGA 1HYZA 5JS2A 1N32K 1ASUA 3CXCM 3HJFA 1S1UA 4OKEA 5GIOA 4C8LA 4H5WA 3M1FA 3CMEN 5CHIA 3V4IA 2E1ZA 3ZSXA 2Z1GA 3CF5L 3ENBA 3WXIA 1X9WA 1JLEA 3J7YP 4FOEA 3D45A 3NMUA 3EN9A 4JKDA 1ATRA 2CGJA 4CFBA 3OA9A 4CD1A 1VQMN 3PIPL 2GUPA 2W40A 3TAEA 2IDOA 2Q1NA 4PKGA 1QS4A 2RF2A 1HJOA 3SUOA 1U4BA 2QXFA 3CM5A 3MCAB 4YOYA 4BQLA 4C1NI 2YHYA 1GLDG 1HNVA 2VG5A 2E2OA 4C8MA 3HPGA 4B1YB 4F2RA 1B9FA 2P5GA 1RDUA 1S5JA 4GY2B 1Q18A 3VF6A 3A8YA 1I39A 1QQCA 1IG9A 2PYLA 3DMJA 4E3SA 2Z1HA 5DMRA 2HNZA 1YJWN 3U6FA 1ZBUA 4B1ZA 1VQ6N 4DFJA 4B3OA 3CCRN 3DRSA 4ISGA 3KLGA 4NCBA 4CHNA 2Z1JA 1Q9YA 4XH1A 1SKWA 3T7ZA 4CEBA 4DTSA 1VSEA 3LANA 4CF2A 1BI4B 4B1XB 1BCMA 1QQNA 2ZF5O 3TR8A 4YNQA 3E9PA 1DTTA 4O0JA 4C1NK 3P38A 1JL2A 4LF7K 1LCUA 1N36K 4FW1A 2O8EB 1NGJA 2GEMA 4DR2K 5KPRA 1XWLA 4FSVA 1VSDA 4PQUA 1OH7A 2V7ZA 1IJJA 2FBXA 2FBVA 4A57A 2BGGA 3E66A 2P1JA 1EETA 1IKVA 2DFFA 3HL8A 4YORA 4KI4A 1BDGA 1SV5A 3F2KA 1X1PA 3DI6A 3FE1A 4CFAA 4GKJK 3UB5A 1SKSA 4CJKA 1YTUA 1S1TA 2E88A 3KVGA 1ZBSA 3PSIA 4EIAA 2OPQA 2Z1IA 4X66K 3K9KA 3SAGA 5BRFA 1OH6A 1YXQA 4YY3K 5AJ3K 3KLHA 1R59O 2NRWA 4FWSA 1X3NA 3OTOK 3BP8A 4MLHA 3C65A 4B3MK 3OYEA 1WAFA 4IFEA 4BG9A 3AO3A 1IG8A 1QVGM 1O1WA 3KKSA 3FZFA 3M8RA 3LP2A 2O8DA 2RE2A 2QM1A 1HNXK 3IFRA 1Q7YO 1B92A 1KFSA 1KCFA 3AARA 3BEXA 3N4PA 3G71N 5AQMA 3MECA 2IAJA 1D9FA 2YCHA 3AV9A 4L8RB 4FVMA 5AQKA 4FLTA 4CGJA 4FJKA 4CEOA 4RWTA 3OYMA 3C95A 3H08A 3UKRB 1T8EA 4FCYA 4BC4A 5DM6L 3L3UA 3BF1A 2P5OA 4CFDA 2D5RA 3F9KA 3VQCA 4O8KA 3DOKA 1N33K 4JV5K 3JS6A 5BPLA 3DXKA 5BPNA 2X6NA 4WFAL 2P9UB 3VQ6A 4HUFA 4GV6A 3DAWA 3JXUA 4WFNL 3PY8A 3WNFA 3OYAA 2OA8A 4M42A 1TUYA 1S22A 2ZD1A 4DLEA 4A62A 3SV4A 4OGCA 3AAPA 4FXDA 2NRZA 4JKCA 3OYGA 2O8CA 2FXUA 4FYDA 1M90O 4FOIA 1VQ4N 4CJUA 2F8TA 2HVIA 2D0BA 4CBUA 1JL1A 2HHWA 2D0CA 5LY3A 4JEPA 4EFHA 4WQ4C 4FJ8A 4BVPA 3AVCA 3ZSQA 3SUNA 5SWMA 2OZMA 4CK1A 4CF0A 4FJHA 3O9TA 1VK0A 1RBRA 3K2PA 4KHNA 3G0ZA 4KRFA 1G15A 1WNSA 2QWNA 2O8DB 4YOXA 1TAUA 4FWOA 1A5VA 4M3YA 4MFBA 1TL3A 1YIJN 3KZBA 4QCLA 3HP6A 5AQGA 4IBNA 5J2NA 1HX1A 4PY5A 3C6HA 4N47A 4JKEA 3O80A 1NGIA 4A5AA 3QINA 1D8YA 3HK2A 3VPZA 2HNDA 3WT0A 1KFDA 3FFIA 1MWKA 3VN5A 4G9ZA 3K5MA 2AP1A 2A41A 5BR8K 1HRHA 2QI2A 2NNWA 5KQ8A 1BOTO 1RTHA 2PAVA 2CGKA 3RMDA 3LP3A 3PX6A 4FZXC 5HLFA 3J8AA 4BE2A 4LFCK 1T7PA 3QLHA 3NVMA 4NYFA 4Z4CA 1IBMK 1BGXT 2QWQA 4AHTA 2P9SB 3K57A 1QHTA 1TUUA 3VESA 5AZJA 3CG7A 1VQON 4M7YA 4MDBA 3LPTA 5H1SQ 1N6QA 4M3TA 2UXBK 1TK0A 3FR0A 3QEVA 1KLMA 3R1XA 2QK9A 3VQ7A 2A40A 3AGKA 2VGMA 4DU1A 2IOCA 1BO5O 3HYFA 2D1KA 4KKOA 3RMAA 4IKFA 4K8ZA 4DF4A 3I0RA 4G1QA 3MWPA 1DLOA 1LAWA 3LDOA 2O8FA 5AQQA 4DS4A 4E7IA 5IT9O 2FSKA 3CETA 1GLJO 3VQ4A 4DB3A 4DSJA 1S6PA 3C94A 4BACA 4OPKA 3DOLA 1N34K 2F9TA 4ILJA 5HRSA 4KB1A 3M6GA 1TGOA 3HZ6A 4KFBA 3L3VA 4EAHD 4J2AA 2Q0RA 2FF3B 4HCBA 4MO5A 4DV1K 3NHGA 2E1YA 4WF9L 1WBBA 3Q7CA 3PV8A 2UUAK 5C2DA 4CJLA 1VQ7N 2A5XA 4C8OA 1IO2A 2RKIA 4MDAA 4I9QA 3CJ9A 4CVNE 4CJ7A 1P8ZA 1REVA 2E5LK 4JKFA 2NRVA 1FW6A 2DY4A 4JNEA 2A1RA 5AQWA 1BQMA 4CJPA 2DFHA 1IKYA 2NRRA 3SPYA 4JS5A 4FJ5A 3O9UA 4KTQA 4CECA 3VTHA 3P83D 4K43A 3NF9A 4OLBA 3GOIA 4GNIA 3SCXA 4N76A 3LZJA 3MN7A 3WUHA 1KQSM 2DTUA 3HOSA 3VQEA 3CD6N 4JRPA 2B4JA 2VCPA 3MDQA 3PSFA 5BR9A 1NLVA 1I94K 4FWLA 2WOMA 3JAMO 4O0IA 3MN5A 3V1OA 2ASPA 4RG8A 3ZSRA 2P9KA 5E41A 4JN4A 3HXMA 1U04A 3ZSVA 1YHQN 1RBSA 4CGDA 3VEVA 3HVTA 1VSKA 2G8KA 3O9SA 3NH1A 2VG6A 5AZIA 4BRQA 1HPZA 1OH5A 4BVOA 3HT3A 2O8CB 1S1XA 4O55A 4RW4A 1RDBA 2P9IA 1QE1A 3OJSA 3RWUA 4ELUA 3KK3A 2ZWHA 4CEEA 4KV8A 3T19A 4KBOA 4ILGB 4DV2K 3OYCA 4ZHRA 4A2BA 4K0KK 3HI0A 3VQPA 4RW6A 4DTXA 2G8FA 1GOBA 2VG7A 3VENA 3NDKA 1C1CA 3CJAA 1VSIA 4CZKA 4ISFA 1CXQA 1RDAA 3OYBA 4PHTX 2CH5A 3OYIA 4KHYA 3ZX2A 5TKYA 1RT4A 1X9MA 4BRDA 5AQYA 3ZYYX 5KPZA 3TI0A 2QWRA 4XH5A 3AVBA 1EKEA 3VTIA 4DV4K 3V9UA 3CJ1A 1DTQA 2FLOA 4JD2A 2WUSA 4FJXA 4Z0UA 4MQ3A 4E7JA 4B8CA 3PIOL 4FJLA 2HHTA 3D2EA 4FVUA 4X64K 4QOZB 1JLFA 2KHOA 3KD5E 1RBTA 3THXB 3DJCA 3UKUA 2QTDA 2IC3A 1E4GT 1WBDA 4WE1A 3E1YA 1TKDA 1J9AA 2FSNA 3L8BA 2G8VA 4KB0A 4LF9K 5AQFA 2ZGYA 4B9VA 5JVGL 4KTWA 3ZSOA 3CCLN 2OZSA 2BH1A 3LALA 5EU7A 2YX6A 1XI1A 3ID8A 3L4IA 3CCSN 2HBLA 2WTUA 3SAHA 4I2QA 1L5UA 3HP9A 4FWNA 1HQUA 2ZE2A 3U3GA 3V6DA 4IEIA 3TAGA 3V1RA 2HHXA 3AVJA 2HBJA 4BGAA 4PUOA 2VGNA 4OKKA 1QHAA 1RBVA 2EWSA 3AVLA 4AF1A 2WC9A 5AQOA 3VQAA 4LSNA 2YHBA 2BTFA 1JLAA 3H45C 2HVHA 4GKKK 5EOYA 3SJHA 5KGXA 1YF5L 4BR4A 4CZEA 1FXXA 5T7BA 1T6DA 2P9LA 5JLHA 1IBKK 1TK5A 3ZETB 2CH6A 5HRPA 4DR7K 1QZ5A 4O8UA 3CPWM 3EZWA 3S9HA 1NMDA 3CJCA 5JICA 4FJMA 1X9JA 1KVCA 4NB4A 3LWMA 1X3MA 3TTFA 4DQQA 3MXJA 4CERA 1NJZA 3TAPA 1NJXA 3AGRA 2HF4A 3L2VA 1C0GA 1Q9XA 4OJRA 4RCHA 1HR0K 1GLEG 5KRTA 1WAJA 3KLEA 3RSEB 3QEIA 4F9OA 2GBZA 3O3HA 3NF8A 1VRUA 2VQFK 1GOCA 2GUIA 1SL0A 4WYBA 3H1QA 1Z26A 4QS8A 3ZT3A 3M5RA 3ZT1A 1WSHA 3KHYA 5AQHA 3FLCO 1VQ9N 5C15A 4HHTA 1XUPO 4CJFA 2Y1IA 3ZX3A 1U2VB 3N4QA 4JLHA 4Z4FA 4DKWA 4IOAL 1KSPA 4CEZA 2ETJA 4EZ6A 3CFPA 4FJIA 3OYKA 4DTJA 1FKOA 3KJVA 2E8AA 3VQQA 3RVCA 4CIEA 1K73O 3VQ9A 4H0VB 4DV0K 4DS5A 3OY9A 4CZFA 4I6MA 3QMLA 4IOXA 4JI0K 5JS1A 2I7NA 4DR3K 1FJGK 4Z4GA 2W41A 1NGCA 3F9MA 3GE1A 3GDQA 1TVRA 3S41A 3O9QA 1GLAG 1ZYQA 2OCEA 5ADXH 4IG3A 2YHAA 3A5NC 2PFUA 4DTUA 3T1YK 4NYNA 4NCAA 3NGZA 4JI5K 4N41A 1JLGA 3ITHA 3DLGA 4YHHK 3KD1E 4H0PA 3CJ7A 1S9EA 2CGLA 3LZIA 2HW3A 1YJNN 2IS3A 3TU5A 2RHKA 1NBWA 4WQ4A 4CK2A 2ASMA 2XY8A 4H4MA 3AVAA 2BANA 4B9TA 4CF8A 1A5XA 4YOUA 3HVRA 4EP5A 3AO4A 1VQ5N 2HBKA 4I6MB 3AA2A 4WQ5C 4RW9A 3WNEA 3DXMA 4CBWA 2YJFA 3C6UA 4JYAK 2AA4A 3ZT2A 5AQZA 4KHSA 4IOCL 2QW9A 4CFCA 2KKZA 1QZ6A 1YTAA 1EXQA 4DF8A 2HHSA 4LF6K 4CJ4A 2YHXA 1OH8A 2B5JA 1F21A 3KKRA 2F9WA 4Y0WA 4B3TK 4DR4K 5GAHP 1WOQA 3SMPA 4R5PA 5AFUA 3DYAA 4J2DA 2KFZA 2AJQA 4ZTJA 3ULEA 1S72N 1C0TA 5AZIB 1ITGA 3PUFA 5HRRA 4ISEA 1NGGA 5AQLA 3M8QA 4DSLA 3CQYA 2E2PA 4O44A 2G8HA 3KTQA 4DTNA 3A5LC 3CC2N 3MCPA 4FLVA 1Z25A 2QKBA 2P9IB 5I42A 5CZ1A 1KLNA 2YNHA 4JRQA 3ALYA 3WNGA 3K0SA 1XMOK 3E9OA 3OS2A 4DTRA 3D6RA 3T3FA 4YOVA 4DQSA 2PYJA 4FPAA 3G4SN 3AVNA 3FZLA 5ADXA 5GINA 4FJ9A 3NCIA 4LF8K 1YT3A 4BRMA 5KTQA 1LWEA 1D4XA 1RT7A 4U7BA 2PZSA 4DV7K 4BE0A 4BRIA 3THWA 5I3UA 4OO1J 2VYPA 3SAFA 3UE5A 4Z4IA 4AQYK 3C6TA 4PKIA 4FK0A 2O8BA 4N56A 3HO1A 2YNGA 5FLXO 4GV9A 1L3SA 1WUAA 2HNYA 4JI4K 3EKSA 3HOTA 3KWIA 1KVAA 1RT2A 4W5TA 5FPMA 4OVLA 4OPJA 4B8AB 5C2FA 1T3VA 1V4SA 3NH0A 1YITN 2J4RA 4E89A 1S9GA 3AO5A 2ZJRL 1E3MA 1Z6RA 1S6QA 1KC8O 3SQ4A 3DXMB 4E7HA 4DTPA 3PO5A 4TSXA 2W6LA 2HMIA 5AQUA 4FWQA 1NJYA 2WBNA 3SYZA 3CI5A 4I9LA 4BC2A 1CLQA 1ZBFA 5BN9A 2ITMA 3LP0A 2YKNA 2ZJQL 3O1WA 1SKRA 2YHWA 4LH5A 3ZEUA 1TKXA 3SBTA 5GAEP 2QA4N 2OYQA 1HJRA 1K6YA 4EHUA 1NKBA 4B9QA 5AQJA 5HOOA 3AO1A 3ULEB 3AVIA 3WEEA 3J7AP 3DWLA 1FK9A 1VQKN 4HCCA 3SQ1A 4CJ5A 4HTUA 1JXEA 5J2MA 4CZGA 1NK7A 3AY9A 2HHVA 3VA3A 4MLEA 2Q31A 4CEDA 1VQ8N 4BRNA 3TANA 1IKXA 4A59A 3GL1A 4FZYA 3LP1A 3EE8A 4H03B 1W7AA 3THYA 1HNIA 1IH7A 3I8BA 3QEPA 3MWTA 3U3YA 3L2RA 4DFKA 3SZ2A 4ID1A 2QWPA 2V52B 3EE9A 2D0PA 1QSYA 4BY9C 1HYSA 4CEAA 3TWHA 1YVNA 1B9DA 2X6SA 5AQTA 3CCVN 5C25A 2FF6A 2KLAA 4FO0A 1XC9A 1J54A 2IVNA 3VQDA 4WFBL 1J53A 4XEIA 1EWQA 1RT3A 2A3ZA 3LM2A 3MN9A 4EHTA 5F0XA 3DLEA 4FPBA 2E6MA 5AQSA 4FK4A 3KK1A 4CGFA 2Q36A 1LW2A 1HUXA 1NM1A 1Q81O 3ZCMA 2F7TA 5EXWA 3WXJA 4CGGA 3IG1A 1RILA 2OPPA 4LD0A 4CESA 3MEDA 1Y97A 4CE9A 3P31A 2P9PB 1GLFO 1BU6O 4LF4K 5C0YA 2XRIA 3D0PA 4EZ9A 3L2UA 1BQNA 4OPAA 3CFRA 2OTJN 3L6QA 4DFPA 4Z94A 3HBTA 2JWLA 3IS9A 1BISA 4DMNA 3BUZB 4DCHA 1A5WA 3VEYA 4B3SK 3C7NA 3LL3A 4M3XA 3MK6A 3SV3A 1NK6A 1C0UA 5J2PA 3LDSA 4LH4A 4M3ZA 3G10A 1YUWA 3MXMA 4F4KA 5CE3A 3OBWA 1WSGA 5F1XA 1W0HA 2P9LB 3FGUA 2UU9K 1V4TA 4RW8A 3ZETA 5LJVA 1BI4A 5C42A 2FBTA 4FLUA 1C1AA 2YNIA 3CHWA 5FRMA 1XC3A 4YDUC 2NRTA 1R0AA 2E20A 1UWBA 3KLIA 1BHLA 3JYTA 1Y64A 2D0AA 2QWMA 3K5OA 1TK8A 3SK3A 5AQXA 5AR0A 4K42A 3KWGA 3CIPA 5KQDA 3AO2A 2P9KB 4PWDA 3ZSZA 1ILYA 4CJSA 1D5AA 3HPOA 5KI6A 4C8KA 1RDWX 1S1WA 2KW4A 3P4IA 1BIZA 2Q2RA 3DM2A 3SLCA 4DSEA 4AH9A 2X74A 4H8KA 1VSHA 3W3DA 1UAXA 4CK3A 2ZM6K 1E4FT 4ILHA 4W5NA 5BRDA 1JJ2M 2XY7A 3QBWA 5ELZA 3QFPA 4O5BA 5I9EB 2KQ2A 1W2BM 4X62K 4Y1DA 4CCHA 3M3ZA 4AHUA 3QNOA 2YNFA 4DR5K 3O5BA 3L4QA 4QS9A 2YKMA 1EP4A 4BDZA 4KO0A 2W6KA 2QEXN 4DSIA 2I7PA 3V9WA 3K9JA 3EYZA 2NZTA 4DQIA 3MXIA 3ZSWA 3WNHA 4CHPA 3VA0A 1FKPA 4CZHA 3TAFA 2QKKA 4LFBK 4CIGA 3LPUA 3VQ5A 5JVHL 1TKZA 3BDPA 4HWIA 1HNZK 3HSCA 4KH5A 4BR5A 2IVOA 5JMVA 1WB9A 4PL7A 1BG3A 5M1OA 4DTMA 1QSSA 3SQ2A 3BF3A 1XHZA 4JD2B 2VWKA 1ZBLA 5AQIA 3IDHA 3DLRA 2F8SA 2HB5A 3CMAN 4LF5K 3CFOA 4BR7A 3FZHA 1ZC6A 4B1VA 3K5NA 4H4OA 2UUBK 5HP1A 4J2EA 1WSEA 4J2BA 4DTOA 3I33A 3THXA 1NKEA 4CW7B 3DXKB 1P90A 1HNWK 5EX5A 1TYQA 2IIRA 2P9UA 3WXKA 4JI6K 4FLYA 1J5OA 2A6AA 1KXPA 3S3NA 1LW0A 3PO4A 3CCUN 2D4WA 1KAYA 2D0OA 3FFKB 1NGHA 1L3VA 1RT5A 3MN6A 5F2RA 4MO4A 4JS4A 1CXUA 4CJQA 4CGIA 3QETA 3LWLA 4KHWA 1RT6A 1VRTA 1Q8IA 3NFAA 3NBPA 3R9PA 2NRHA 5FRNA 3ZEUB 3AA3A 3HM8A 1T03A 4JKBA 4CF9A 2F4VK 2HMPA 3F5TA 4FJNA 1XNQK 1U45A 1JCEA 4E1JA 5AFUH 3WEEB 4B9LA 1VSFA 3TAQA 2UYTA 1UA0A 1TYQB 4FM2A 3EEQA 3NGYA 3I56N 3LDLA 4BG8A 1BIUA 5LJWA 4GW6A 3TPQA 1CZAN 1HKBA 2PY5A 2YV0X 3VF2A 3UKUB 1JXBA 1BA0A 1Z05A 5M1NA 3NF7A 3H3OB 3ZLJA 2QWOA 3BZKA 4JHDA 3OYFA 4ICLA 4IDHA 4BRLA 1VQLN 3QNNA 4YOTA 3SNNA 5EY4A 2YI1A 4DUYK 1VSLA 4JI7K 4DUZK 5C24A 4BGBA 4DU3A 1KRPA 4IJNA 5A2QO 2E2QA 2O8BB 4QAGA 1K8AO 2WONA 1IV0A 4BRHA 5LL6Z 2NRXA 4CHQA 3VOVA 4IO9L 2YJEA 3D2FA 3TSPA 1C6VA 3QIPA 4CI6A 3M8PA 3S3OA 3VGKA 3OVNA 3U4LA 1U48A 4K41A 3AAQA 1DEJA 4B08A 5JLFA 3ISNC 4FLWA 1BCOA 2HBMA 1VQPN 3QERA 1C1BA 2O4GA 3WQTA 3H1VX 3U8XA 3MEEA 4KHUA 2JGUA 1TKTA 4CEQA 4HVJA 3VEXA 1NGBA 5LMUK 5M1PA 4BRPA 4IWVA 1VSJA 3LAMA 4BQZA 1W97L 5AZJB 3O3FA 1NK8A 3TABA 5D3GA 1ASWA 1NWKA 3CM6A 4IXCA 3Q7BA 2GWJA 1ZBIA 4OGEA 3ATVA 4JKGB 1KD1O 3SJJA 5CZ2A 4BR9A 3O8MA 3QDKA 4H5RA 2FBYA 4BRKA 4E7LA 3O6WA 4WQ5A 3VEOA 1RDCA 3CCJN 5SZTA 3JSMA 1S3XA 3BGRA 1X9SA 2WFBA 4Q0BA 3MX5A 1KAXA 4M45A 2ZQBA 3EO3A 2KTQA 3BZCA 3KLFA 2O8FB 5J2QA 5FPDA 1CZBA 1BWFO 2XY5A 3EZ5A 5C12A 3TSQA 5AQPA 3EY1A 3AVFA 1M1KO 3NVKA 1NU0A 1KAZA 3KK7A 2BDPA 2RPIA 5CYQA 1HQEA 4CZLA 2A42A 1KTQA 3V1QA 4B9MA 1NOZA 4DSKA 1J5EK 4X65K 5KPTA 4CJTA 1NNEA 4DR6K 4NLBA 3FZMA 3VMFB 1J6ZA 3RMCA 3O9RA 3VETA 4W5RA 2X78A 4PKHA 4KPYA 1LWFA 4LSLA 3QEWA 3CQ8A 2OPRA 2G8WA 3HPHA 4AILC 4JAXA 4AHVA 4HUEA 2LSNA 4FLZA 3ENHA 3RRGA 4H0TB 4JKAA 2E2NA 3E01A 1EX4A 4HTLA 3CYMA 1SAZA 1ATSA 3DRRA 1WSFA 4HUGA 2HHUA 4NO7A 4BDPA 2O8EA 2ZGZA 4OLAA 1QVFM 3NAEA 3CC4N 3AVGA 1NG9A 3VF4A 2GV9A 2VWBA 1IKWA 2ATQA 4KHPK 3ULDA 1EWRA 1MA9B 3DLBA 1RDDA 2I5JA 3DLHA 1H1VA 3THWB 1K8KA 2E6LA 4FW2A 2Q3SA 2G8IA 4AHCA 3KK2A 3ATUA 4BDYA 4B9UA 1LAVA 1LWCA 2P51A 1IBLK 3OHRA 4ELTA 3O4QA 1NJWA 1TV6A 3CCEN 4B1UB 1LOTB 1RCHA 3QICA 4Q5VA 3KIOA 4GVMA 4AM6A 3AVMA 4DQ8A 3CPEA 1ATNA 3O1BA 1TL1A 3H3NO 4DV6K 1BUPA 1GLBG 4KAZA 5B8HA 2VQEK 5DK5A 1VHXA 3DLKA 4B9SA 1OVYA 2ASOA 3RR8A 4F3OA 3P39A
chains in the Genus database with same CATH topology
1XNRK 5IWAK 4JYAK 2UUAK 4DV3K 1HNXK 4DUYK 4DR1K 4LFBK 5LMNK 4LF6K 4JI7K 4DUZK 1HR0K 1J5EK 4X65K 4CVNE 1XMQK 4DR6K 1HNZK 4DR4K 4B3TK 5A2QO 4DV4K 2E5LK 4B3SK 2VQFK 5LL6Z 3J7AP 4NXNK 2UUCK 4X64K 4LF5K 4OX9K 4V19S 2UU9K 4JI8K 3J80O 4JI1K 2UUBK 5BR8K 1N33K 4JI2K 4CW7B 4JV5K 1XMOK 1HNWK 4JI6K 4LF7K 4LF9K 4LFCK 1N36K 4DV0K 1I94K 5LMUK 3JAMO 1IBMK 4LF8K 4JI0K 4DR3K 1FJGK 4KHPK 4B3RK 4DR2K 4DV5K 2UXBK 4DV7K 4AQYK 2UXCK 3T1YK 4JI5K 1N32K 4NXMK 1IBLK 2F4VK 4YHHK 4GKJK 1XNQK 4JI3K 5FLXO 2ZM6K 4JI4K 4GKKK 4X66K 3J81O 5IT9O 3J7YP 3T1HK 4YY3K 5AJ3K 4DV2K 4DV6K 1N34K 4LF4K 1IBKK 4K0KK 2UXDK 4X62K 3OTOK 2HHHK 2VQEK 4DR7K 4DR5K 4B3MK 4LFAK 4DV1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR K;  5IWA K;  4JYA K;  2UUA K;  4DV3 K;  1HNX K;  4DUY K;  4DR1 K;  4LFB K;  5LMN K;  4LF6 K;  4JI7 K;  4DUZ K;  1HR0 K;  1J5E K;  4X65 K;  4CVN E;  1XMQ K;  4DR6 K;  1HNZ K;  4DR4 K;  4B3T K;  5A2Q O;  4DV4 K;  2E5L K;  4B3S K;  2VQF K;  5LL6 Z;  3J7A P;  4NXN K;  2UUC K;  4X64 K;  4LF5 K;  4OX9 K;  4V19 S;  2UU9 K;  4JI8 K;  3J80 O;  4JI1 K;  2UUB K;  5BR8 K;  1N33 K;  4JI2 K;  4CW7 B;  4JV5 K;  1XMO K;  1HNW K;  4JI6 K;  4LF7 K;  4LF9 K;  4LFC K;  1N36 K;  4DV0 K;  1I94 K;  5LMU K;  3JAM O;  1IBM K;  4LF8 K;  4JI0 K;  4DR3 K;  1FJG K;  4KHP K;  4B3R K;  4DR2 K;  4DV5 K;  2UXB K;  4DV7 K;  4AQY K;  2UXC K;  3T1Y K;  4JI5 K;  1N32 K;  4NXM K;  1IBL K;  2F4V K;  4YHH K;  4GKJ K;  1XNQ K;  4JI3 K;  5FLX O;  2ZM6 K;  4JI4 K;  4GKK K;  4X66 K;  3J81 O;  5IT9 O;  3J7Y P;  3T1H K;  4YY3 K;  5AJ3 K;  4DV2 K;  4DV6 K;  1N34 K;  4LF4 K;  1IBK K;  4K0K K;  2UXD K;  4X62 K;  3OTO K;  2HHH K;  2VQE K;  4DR7 K;  4DR5 K;  4B3M K;  4LFA K;  4DV1 K; 
#chains in the Genus database with same CATH topology
 3L0Q A;  1OKJ A;  4AM7 A;  2B6A A;  4DU4 A;  2QWL A;  5HBM A;  4O5F A;  4K8X A;  4Y1C A;  4DV3 K;  4QS7 A;  3V81 A;  3H46 O;  4GV3 A;  4I2P A;  4E0D A;  4YFU A;  1JCF A;  1KVB A;  3GBT A;  4F3T A;  1OVQ A;  3O3G A;  4M3W A;  3OJU A;  4IFV A;  1NKC A;  2XO7 A;  5DM7 L;  1SL1 A;  1DKG D;  3TAM A;  1L3T A;  5E26 A;  1SS6 A;  4AHR A;  3V9Z A;  4IJA A;  3A0I X;  2UUC K;  1GLC G;  4CZJ A;  2KFN A;  3D2E B;  3U9D A;  1N8R O;  4IZ9 A;  5HRO A;  3D2F B;  4FWK A;  4JI1 K;  1ESV A;  2NLX A;  4Z4H A;  2V7Y A;  3CCQ N;  2GEL A;  3OBY A;  5M1F A;  1JCG A;  3TTC A;  1NK0 A;  3THY B;  2KZZ A;  3NH2 A;  5KRS A;  5CY4 A;  3AA4 A;  3NGI A;  5EVZ A;  1YI2 N;  4A2A A;  4XH4 A;  4BR2 A;  5GAG P;  4IDK A;  4BRF A;  2OAN A;  2ITG A;  5M1Q A;  3C6A A;  4BR0 A;  5C10 A;  2IGI A;  2E4L A;  1C0M A;  3OS1 A;  3C0B A;  1O13 A;  3LDN A;  4E7K A;  1U47 A;  3TSU A;  5BRH A;  5FPE A;  4NXM K;  2G8U A;  4CJV A;  3SBG A;  2HOE A;  4JK8 A;  5CYM A;  3PX4 A;  4E19 A;  4JI3 K;  1JLB A;  5AQV A;  1T6C A;  1XHX A;  3D7E O;  3VER A;  2V51 B;  3J81 O;  4F2S A;  1QSL A;  5FDL A;  1Q82 O;  2P9N A;  4CJE A;  2XY6 A;  4KTZ A;  3TTD A;  4U67 L;  1JKH A;  4B9N A;  3CC7 N;  1GOA A;  3QBX A;  2UXD K;  3SQ0 A;  5BRE A;  2HHH K;  4A5B A;  4H0X B;  1HYV A;  5CR4 A;  4DSF A;  5E84 A;  3CCM N;  3RMB A;  2OTL N;  3G25 A;  3B8A X;  4OPH A;  4ID5 A;  1XNR K;  1GLL O;  2Q97 A;  4CF1 A;  1XQS C;  5J1E A;  3BY5 A;  1S1V A;  4XIU A;  1YVU A;  4CGH A;  2HST A;  3IRX A;  3RSE A;  1NMN A;  1WSJ A;  4CZI A;  2XHB A;  4JKG A;  4OKJ A;  1QTM A;  1U6Z A;  4F8R A;  3C7N B;  5GAD P;  4CD3 A;  1L3U A;  4NXN K;  3SPZ A;  4GVE A;  3R3L A;  4JK9 A;  3QB0 A;  4R79 A;  3V9S A;  3RR7 A;  4OX9 K;  4V19 S;  4FM1 A;  2BE2 A;  4PA1 A;  1LV5 A;  1I3A A;  1ZBH A;  2O4I A;  1SL2 A;  2GTD A;  5KGW A;  4LY7 A;  1U2V A;  5HRN A;  1HKC A;  3IMX A;  2JLE A;  4FK2 A;  2EX3 A;  3ENO A;  3IKM A;  3MX2 A;  3NF6 A;  1K9M O;  3OS0 A;  2P9P A;  3HM9 A;  3FZK A;  4DLG A;  2HF3 A;  4CEF A;  3T1A A;  5AQR A;  4CJ3 A;  2P9S A;  1NGF A;  2Y1J A;  4N5S A;  2PBD A;  4FL9 A;  3LM9 A;  4B3R K;  2KZM A;  2DPN A;  2FC0 A;  1NK5 A;  3VQB A;  3IUC A;  4DFM A;  4C8N A;  4BC5 A;  1JLC A;  3K5L A;  2UXC K;  5AQN A;  1NJI O;  2ZJP L;  1EO1 A;  3P1G A;  3GG4 A;  1UA1 A;  3J7Z O;  3R6M A;  3AVK A;  3ZSY A;  3ZT4 A;  1HPM A;  4BWM A;  2H3G X;  3P5J A;  1TAQ A;  4CIF A;  1QQO A;  3A5O C;  3VQ8 A;  1N5Y A;  3L2W A;  4DG1 A;  4EP4 A;  3OYD A;  2FSJ A;  3MEG A;  4BRG A;  2P9N B;  4BWJ A;  4FWM A;  1D9D A;  4E1N A;  1G99 A;  1T05 A;  3EL2 A;  4CZM A;  4JKH A;  2W42 A;  4DQR A;  1C0F A;  4L3Q A;  3RRH A;  3SUP A;  4FWP A;  5TKW A;  4W5Q A;  5MLC Q;  4H5N A;  5GIP A;  1HKG A;  4LFA K;  4UY8 O;  4KH4 A;  3M8S A;  4GMJ B;  4KH6 A;  1NK9 A;  1NGA A;  1RBU A;  3I55 N;  1NOY A;  2A1S A;  1NK4 A;  4ELV A;  3A2F A;  3RTV A;  4DR1 K;  4BRO A;  3HRG A;  1HMV A;  4FLX A;  3UIQ A;  1XMQ K;  1NGE A;  2BUP A;  3QFU A;  4JK7 A;  1VAZ A;  4E1M A;  4CJR A;  4YDU A;  3A5M C;  3K58 A;  4RTF D;  1K8K B;  1YJ9 N;  4H5V A;  4CHO A;  2VWJ A;  3VEZ A;  4JI8 K;  4H0Y B;  2GWK A;  4FJ7 A;  4B1W B;  1T44 A;  4UQG A;  3DRP A;  3WXM B;  4W5O A;  4FJJ A;  3U9Z A;  4CHZ A;  3I8D A;  3HTV A;  1YAG A;  4M3U A;  5HL7 L;  3ASM A;  3ID6 A;  3B6O A;  3H6E A;  3NE6 A;  4M41 A;  3O08 A;  1W9H A;  3VGL A;  3VGM A;  3W0L A;  3PX0 A;  4BC3 A;  3SI6 A;  1SUQ A;  3HST B;  3R8E A;  2QXL A;  3PLA A;  4DV5 K;  4Z4E A;  3QES A;  3SUQ A;  4C23 A;  4FZZ A;  2GX9 A;  4BRE A;  4AHS A;  3AA5 X;  4LC9 B;  3MAQ A;  4M7X A;  3VEW A;  2JWK A;  3QO9 A;  3LDQ A;  2EHG A;  2NUB A;  2OPS A;  3CQX A;  4KHQ A;  4DQP A;  5K14 A;  1RFQ A;  3G6E N;  1RTD A;  3EKU A;  3V9X A;  1ZXO A;  4IG0 A;  4BRC A;  4KI6 A;  4BRA A;  3T1H K;  1HLU A;  4YOW A;  4IO8 A;  4I7F A;  3OYL A;  3S3M A;  1MU2 A;  3T69 A;  3THV A;  1QQM A;  3OYJ A;  1RT1 A;  1VQN N;  1WN7 A;  1NGD A;  4CBX A;  3F73 A;  1MWM A;  3OYN A;  4IFY A;  5IWA K;  4A61 A;  3WXL A;  4PL8 A;  5BN8 A;  3O4N A;  1EQY A;  1Q86 O;  3LAK A;  5M1K A;  3O4W A;  5LMN K;  3OW2 M;  1WLJ A;  3ZX0 A;  4BE1 A;  3CJB A;  3B6P A;  1JLQ A;  1MDU B;  4M63 C;  3IAY A;  1SZ2 A;  1CZ9 A;  3QEX A;  3TAR A;  5FRO A;  3UKR A;  4CHY A;  2RN2 A;  4H0O A;  3ZT0 A;  1VSM A;  1WSI A;  1ASV A;  3J80 O;  3L2Q A;  3WQU A;  4RW7 A;  4J8F A;  4NLC A;  4WCE L;  4DWI A;  1SQK A;  2Q0U A;  4CJW A;  4JI2 K;  4ZTF A;  3DLL L;  4NCG A;  3QIO A;  3I0S A;  3SMS A;  1RNH A;  1U49 A;  1RTJ A;  4M3R A;  2IVP A;  4DHY A;  3K59 A;  2HHQ A;  1BL3 A;  1RGI A;  4O4G A;  2R7Y A;  4K25 A;  5FPN A;  4FM0 A;  3MMV A;  1UOC A;  2F96 A;  3AVH A;  3CER A;  3OYH A;  1RTI A;  4H5T A;  4IEE A;  4JHD B;  4FWR A;  5BPM A;  3LDP A;  1DT9 A;  1BA1 A;  4KRE A;  1DGK N;  3E9L A;  2DFE A;  4FJG A;  1HYZ A;  5JS2 A;  1N32 K;  1ASU A;  3CXC M;  3HJF A;  1S1U A;  4OKE A;  5GIO A;  4C8L A;  4H5W A;  3M1F A;  3CME N;  5CHI A;  3V4I A;  2E1Z A;  3ZSX A;  2Z1G A;  3CF5 L;  3ENB A;  3WXI A;  1X9W A;  1JLE A;  3J7Y P;  4FOE A;  3D45 A;  3NMU A;  3EN9 A;  4JKD A;  1ATR A;  2CGJ A;  4CFB A;  3OA9 A;  4CD1 A;  1VQM N;  3PIP L;  2GUP A;  2W40 A;  3TAE A;  2IDO A;  2Q1N A;  4PKG A;  1QS4 A;  2RF2 A;  1HJO A;  3SUO A;  1U4B A;  2QXF A;  3CM5 A;  3MCA B;  4YOY A;  4BQL A;  4C1N I;  2YHY A;  1GLD G;  1HNV A;  2VG5 A;  2E2O A;  4C8M A;  3HPG A;  4B1Y B;  4F2R A;  1B9F A;  2P5G A;  1RDU A;  1S5J A;  4GY2 B;  1Q18 A;  3VF6 A;  3A8Y A;  1I39 A;  1QQC A;  1IG9 A;  2PYL A;  3DMJ A;  4E3S A;  2Z1H A;  5DMR A;  2HNZ A;  1YJW N;  3U6F A;  1ZBU A;  4B1Z A;  1VQ6 N;  4DFJ A;  4B3O A;  3CCR N;  3DRS A;  4ISG A;  3KLG A;  4NCB A;  4CHN A;  2Z1J A;  1Q9Y A;  4XH1 A;  1SKW A;  3T7Z A;  4CEB A;  4DTS A;  1VSE A;  3LAN A;  4CF2 A;  1BI4 B;  4B1X B;  1BCM A;  1QQN A;  2ZF5 O;  3TR8 A;  4YNQ A;  3E9P A;  1DTT A;  4O0J A;  4C1N K;  3P38 A;  1JL2 A;  4LF7 K;  1LCU A;  1N36 K;  4FW1 A;  2O8E B;  1NGJ A;  2GEM A;  4DR2 K;  5KPR A;  1XWL A;  4FSV A;  1VSD A;  4PQU A;  1OH7 A;  2V7Z A;  1IJJ A;  2FBX A;  2FBV A;  4A57 A;  2BGG A;  3E66 A;  2P1J A;  1EET A;  1IKV A;  2DFF A;  3HL8 A;  4YOR A;  4KI4 A;  1BDG A;  1SV5 A;  3F2K A;  1X1P A;  3DI6 A;  3FE1 A;  4CFA A;  4GKJ K;  3UB5 A;  1SKS A;  4CJK A;  1YTU A;  1S1T A;  2E88 A;  3KVG A;  1ZBS A;  3PSI A;  4EIA A;  2OPQ A;  2Z1I A;  4X66 K;  3K9K A;  3SAG A;  5BRF A;  1OH6 A;  1YXQ A;  4YY3 K;  5AJ3 K;  3KLH A;  1R59 O;  2NRW A;  4FWS A;  1X3N A;  3OTO K;  3BP8 A;  4MLH A;  3C65 A;  4B3M K;  3OYE A;  1WAF A;  4IFE A;  4BG9 A;  3AO3 A;  1IG8 A;  1QVG M;  1O1W A;  3KKS A;  3FZF A;  3M8R A;  3LP2 A;  2O8D A;  2RE2 A;  2QM1 A;  1HNX K;  3IFR A;  1Q7Y O;  1B92 A;  1KFS A;  1KCF A;  3AAR A;  3BEX A;  3N4P A;  3G71 N;  5AQM A;  3MEC A;  2IAJ A;  1D9F A;  2YCH A;  3AV9 A;  4L8R B;  4FVM A;  5AQK A;  4FLT A;  4CGJ A;  4FJK A;  4CEO A;  4RWT A;  3OYM A;  3C95 A;  3H08 A;  3UKR B;  1T8E A;  4FCY A;  4BC4 A;  5DM6 L;  3L3U A;  3BF1 A;  2P5O A;  4CFD A;  2D5R A;  3F9K A;  3VQC A;  4O8K A;  3DOK A;  1N33 K;  4JV5 K;  3JS6 A;  5BPL A;  3DXK A;  5BPN A;  2X6N A;  4WFA L;  2P9U B;  3VQ6 A;  4HUF A;  4GV6 A;  3DAW A;  3JXU A;  4WFN L;  3PY8 A;  3WNF A;  3OYA A;  2OA8 A;  4M42 A;  1TUY A;  1S22 A;  2ZD1 A;  4DLE A;  4A62 A;  3SV4 A;  4OGC A;  3AAP A;  4FXD A;  2NRZ A;  4JKC A;  3OYG A;  2O8C A;  2FXU A;  4FYD A;  1M90 O;  4FOI A;  1VQ4 N;  4CJU A;  2F8T A;  2HVI A;  2D0B A;  4CBU A;  1JL1 A;  2HHW A;  2D0C A;  5LY3 A;  4JEP A;  4EFH A;  4WQ4 C;  4FJ8 A;  4BVP A;  3AVC A;  3ZSQ A;  3SUN A;  5SWM A;  2OZM A;  4CK1 A;  4CF0 A;  4FJH A;  3O9T A;  1VK0 A;  1RBR A;  3K2P A;  4KHN A;  3G0Z A;  4KRF A;  1G15 A;  1WNS A;  2QWN A;  2O8D B;  4YOX A;  1TAU A;  4FWO A;  1A5V A;  4M3Y A;  4MFB A;  1TL3 A;  1YIJ N;  3KZB A;  4QCL A;  3HP6 A;  5AQG A;  4IBN A;  5J2N A;  1HX1 A;  4PY5 A;  3C6H A;  4N47 A;  4JKE A;  3O80 A;  1NGI A;  4A5A A;  3QIN A;  1D8Y A;  3HK2 A;  3VPZ A;  2HND A;  3WT0 A;  1KFD A;  3FFI A;  1MWK A;  3VN5 A;  4G9Z A;  3K5M A;  2AP1 A;  2A41 A;  5BR8 K;  1HRH A;  2QI2 A;  2NNW A;  5KQ8 A;  1BOT O;  1RTH A;  2PAV A;  2CGK A;  3RMD A;  3LP3 A;  3PX6 A;  4FZX C;  5HLF A;  3J8A A;  4BE2 A;  4LFC K;  1T7P A;  3QLH A;  3NVM A;  4NYF A;  4Z4C A;  1IBM K;  1BGX T;  2QWQ A;  4AHT A;  2P9S B;  3K57 A;  1QHT A;  1TUU A;  3VES A;  5AZJ A;  3CG7 A;  1VQO N;  4M7Y A;  4MDB A;  3LPT A;  5H1S Q;  1N6Q A;  4M3T A;  2UXB K;  1TK0 A;  3FR0 A;  3QEV A;  1KLM A;  3R1X A;  2QK9 A;  3VQ7 A;  2A40 A;  3AGK A;  2VGM A;  4DU1 A;  2IOC A;  1BO5 O;  3HYF A;  2D1K A;  4KKO A;  3RMA A;  4IKF A;  4K8Z A;  4DF4 A;  3I0R A;  4G1Q A;  3MWP A;  1DLO A;  1LAW A;  3LDO A;  2O8F A;  5AQQ A;  4DS4 A;  4E7I A;  5IT9 O;  2FSK A;  3CET A;  1GLJ O;  3VQ4 A;  4DB3 A;  4DSJ A;  1S6P A;  3C94 A;  4BAC A;  4OPK A;  3DOL A;  1N34 K;  2F9T A;  4ILJ A;  5HRS A;  4KB1 A;  3M6G A;  1TGO A;  3HZ6 A;  4KFB A;  3L3V A;  4EAH D;  4J2A A;  2Q0R A;  2FF3 B;  4HCB A;  4MO5 A;  4DV1 K;  3NHG A;  2E1Y A;  4WF9 L;  1WBB A;  3Q7C A;  3PV8 A;  2UUA K;  5C2D A;  4CJL A;  1VQ7 N;  2A5X A;  4C8O A;  1IO2 A;  2RKI A;  4MDA A;  4I9Q A;  3CJ9 A;  4CVN E;  4CJ7 A;  1P8Z A;  1REV A;  2E5L K;  4JKF A;  2NRV A;  1FW6 A;  2DY4 A;  4JNE A;  2A1R A;  5AQW A;  1BQM A;  4CJP A;  2DFH A;  1IKY A;  2NRR A;  3SPY A;  4JS5 A;  4FJ5 A;  3O9U A;  4KTQ A;  4CEC A;  3VTH A;  3P83 D;  4K43 A;  3NF9 A;  4OLB A;  3GOI A;  4GNI A;  3SCX A;  4N76 A;  3LZJ A;  3MN7 A;  3WUH A;  1KQS M;  2DTU A;  3HOS A;  3VQE A;  3CD6 N;  4JRP A;  2B4J A;  2VCP A;  3MDQ A;  3PSF A;  5BR9 A;  1NLV A;  1I94 K;  4FWL A;  2WOM A;  3JAM O;  4O0I A;  3MN5 A;  3V1O A;  2ASP A;  4RG8 A;  3ZSR A;  2P9K A;  5E41 A;  4JN4 A;  3HXM A;  1U04 A;  3ZSV A;  1YHQ N;  1RBS A;  4CGD A;  3VEV A;  3HVT A;  1VSK A;  2G8K A;  3O9S A;  3NH1 A;  2VG6 A;  5AZI A;  4BRQ A;  1HPZ A;  1OH5 A;  4BVO A;  3HT3 A;  2O8C B;  1S1X A;  4O55 A;  4RW4 A;  1RDB A;  2P9I A;  1QE1 A;  3OJS A;  3RWU A;  4ELU A;  3KK3 A;  2ZWH A;  4CEE A;  4KV8 A;  3T19 A;  4KBO A;  4ILG B;  4DV2 K;  3OYC A;  4ZHR A;  4A2B A;  4K0K K;  3HI0 A;  3VQP A;  4RW6 A;  4DTX A;  2G8F A;  1GOB A;  2VG7 A;  3VEN A;  3NDK A;  1C1C A;  3CJA A;  1VSI A;  4CZK A;  4ISF A;  1CXQ A;  1RDA A;  3OYB A;  4PHT X;  2CH5 A;  3OYI A;  4KHY A;  3ZX2 A;  5TKY A;  1RT4 A;  1X9M A;  4BRD A;  5AQY A;  3ZYY X;  5KPZ A;  3TI0 A;  2QWR A;  4XH5 A;  3AVB A;  1EKE A;  3VTI A;  4DV4 K;  3V9U A;  3CJ1 A;  1DTQ A;  2FLO A;  4JD2 A;  2WUS A;  4FJX A;  4Z0U A;  4MQ3 A;  4E7J A;  4B8C A;  3PIO L;  4FJL A;  2HHT A;  3D2E A;  4FVU A;  4X64 K;  4QOZ B;  1JLF A;  2KHO A;  3KD5 E;  1RBT A;  3THX B;  3DJC A;  3UKU A;  2QTD A;  2IC3 A;  1E4G T;  1WBD A;  4WE1 A;  3E1Y A;  1TKD A;  1J9A A;  2FSN A;  3L8B A;  2G8V A;  4KB0 A;  4LF9 K;  5AQF A;  2ZGY A;  4B9V A;  5JVG L;  4KTW A;  3ZSO A;  3CCL N;  2OZS A;  2BH1 A;  3LAL A;  5EU7 A;  2YX6 A;  1XI1 A;  3ID8 A;  3L4I A;  3CCS N;  2HBL A;  2WTU A;  3SAH A;  4I2Q A;  1L5U A;  3HP9 A;  4FWN A;  1HQU A;  2ZE2 A;  3U3G A;  3V6D A;  4IEI A;  3TAG A;  3V1R A;  2HHX A;  3AVJ A;  2HBJ A;  4BGA A;  4PUO A;  2VGN A;  4OKK A;  1QHA A;  1RBV A;  2EWS A;  3AVL A;  4AF1 A;  2WC9 A;  5AQO A;  3VQA A;  4LSN A;  2YHB A;  2BTF A;  1JLA A;  3H45 C;  2HVH A;  4GKK K;  5EOY A;  3SJH A;  5KGX A;  1YF5 L;  4BR4 A;  4CZE A;  1FXX A;  5T7B A;  1T6D A;  2P9L A;  5JLH A;  1IBK K;  1TK5 A;  3ZET B;  2CH6 A;  5HRP A;  4DR7 K;  1QZ5 A;  4O8U A;  3CPW M;  3EZW A;  3S9H A;  1NMD A;  3CJC A;  5JIC A;  4FJM A;  1X9J A;  1KVC A;  4NB4 A;  3LWM A;  1X3M A;  3TTF A;  4DQQ A;  3MXJ A;  4CER A;  1NJZ A;  3TAP A;  1NJX A;  3AGR A;  2HF4 A;  3L2V A;  1C0G A;  1Q9X A;  4OJR A;  4RCH A;  1HR0 K;  1GLE G;  5KRT A;  1WAJ A;  3KLE A;  3RSE B;  3QEI A;  4F9O A;  2GBZ A;  3O3H A;  3NF8 A;  1VRU A;  2VQF K;  1GOC A;  2GUI A;  1SL0 A;  4WYB A;  3H1Q A;  1Z26 A;  4QS8 A;  3ZT3 A;  3M5R A;  3ZT1 A;  1WSH A;  3KHY A;  5AQH A;  3FLC O;  1VQ9 N;  5C15 A;  4HHT A;  1XUP O;  4CJF A;  2Y1I A;  3ZX3 A;  1U2V B;  3N4Q A;  4JLH A;  4Z4F A;  4DKW A;  4IOA L;  1KSP A;  4CEZ A;  2ETJ A;  4EZ6 A;  3CFP A;  4FJI A;  3OYK A;  4DTJ A;  1FKO A;  3KJV A;  2E8A A;  3VQQ A;  3RVC A;  4CIE A;  1K73 O;  3VQ9 A;  4H0V B;  4DV0 K;  4DS5 A;  3OY9 A;  4CZF A;  4I6M A;  3QML A;  4IOX A;  4JI0 K;  5JS1 A;  2I7N A;  4DR3 K;  1FJG K;  4Z4G A;  2W41 A;  1NGC A;  3F9M A;  3GE1 A;  3GDQ A;  1TVR A;  3S41 A;  3O9Q A;  1GLA G;  1ZYQ A;  2OCE A;  5ADX H;  4IG3 A;  2YHA A;  3A5N C;  2PFU A;  4DTU A;  3T1Y K;  4NYN A;  4NCA A;  3NGZ A;  4JI5 K;  4N41 A;  1JLG A;  3ITH A;  3DLG A;  4YHH K;  3KD1 E;  4H0P A;  3CJ7 A;  1S9E A;  2CGL A;  3LZI A;  2HW3 A;  1YJN N;  2IS3 A;  3TU5 A;  2RHK A;  1NBW A;  4WQ4 A;  4CK2 A;  2ASM A;  2XY8 A;  4H4M A;  3AVA A;  2BAN A;  4B9T A;  4CF8 A;  1A5X A;  4YOU A;  3HVR A;  4EP5 A;  3AO4 A;  1VQ5 N;  2HBK A;  4I6M B;  3AA2 A;  4WQ5 C;  4RW9 A;  3WNE A;  3DXM A;  4CBW A;  2YJF A;  3C6U A;  4JYA K;  2AA4 A;  3ZT2 A;  5AQZ A;  4KHS A;  4IOC L;  2QW9 A;  4CFC A;  2KKZ A;  1QZ6 A;  1YTA A;  1EXQ A;  4DF8 A;  2HHS A;  4LF6 K;  4CJ4 A;  2YHX A;  1OH8 A;  2B5J A;  1F21 A;  3KKR A;  2F9W A;  4Y0W A;  4B3T K;  4DR4 K;  5GAH P;  1WOQ A;  3SMP A;  4R5P A;  5AFU A;  3DYA A;  4J2D A;  2KFZ A;  2AJQ A;  4ZTJ A;  3ULE A;  1S72 N;  1C0T A;  5AZI B;  1ITG A;  3PUF A;  5HRR A;  4ISE A;  1NGG A;  5AQL A;  3M8Q A;  4DSL A;  3CQY A;  2E2P A;  4O44 A;  2G8H A;  3KTQ A;  4DTN A;  3A5L C;  3CC2 N;  3MCP A;  4FLV A;  1Z25 A;  2QKB A;  2P9I B;  5I42 A;  5CZ1 A;  1KLN A;  2YNH A;  4JRQ A;  3ALY A;  3WNG A;  3K0S A;  1XMO K;  3E9O A;  3OS2 A;  4DTR A;  3D6R A;  3T3F A;  4YOV A;  4DQS A;  2PYJ A;  4FPA A;  3G4S N;  3AVN A;  3FZL A;  5ADX A;  5GIN A;  4FJ9 A;  3NCI A;  4LF8 K;  1YT3 A;  4BRM A;  5KTQ A;  1LWE A;  1D4X A;  1RT7 A;  4U7B A;  2PZS A;  4DV7 K;  4BE0 A;  4BRI A;  3THW A;  5I3U A;  4OO1 J;  2VYP A;  3SAF A;  3UE5 A;  4Z4I A;  4AQY K;  3C6T A;  4PKI A;  4FK0 A;  2O8B A;  4N56 A;  3HO1 A;  2YNG A;  5FLX O;  4GV9 A;  1L3S A;  1WUA A;  2HNY A;  4JI4 K;  3EKS A;  3HOT A;  3KWI A;  1KVA A;  1RT2 A;  4W5T A;  5FPM A;  4OVL A;  4OPJ A;  4B8A B;  5C2F A;  1T3V A;  1V4S A;  3NH0 A;  1YIT N;  2J4R A;  4E89 A;  1S9G A;  3AO5 A;  2ZJR L;  1E3M A;  1Z6R A;  1S6Q A;  1KC8 O;  3SQ4 A;  3DXM B;  4E7H A;  4DTP A;  3PO5 A;  4TSX A;  2W6L A;  2HMI A;  5AQU A;  4FWQ A;  1NJY A;  2WBN A;  3SYZ A;  3CI5 A;  4I9L A;  4BC2 A;  1CLQ A;  1ZBF A;  5BN9 A;  2ITM A;  3LP0 A;  2YKN A;  2ZJQ L;  3O1W A;  1SKR A;  2YHW A;  4LH5 A;  3ZEU A;  1TKX A;  3SBT A;  5GAE P;  2QA4 N;  2OYQ A;  1HJR A;  1K6Y A;  4EHU A;  1NKB A;  4B9Q A;  5AQJ A;  5HOO A;  3AO1 A;  3ULE B;  3AVI A;  3WEE A;  3J7A P;  3DWL A;  1FK9 A;  1VQK N;  4HCC A;  3SQ1 A;  4CJ5 A;  4HTU A;  1JXE A;  5J2M A;  4CZG A;  1NK7 A;  3AY9 A;  2HHV A;  3VA3 A;  4MLE A;  2Q31 A;  4CED A;  1VQ8 N;  4BRN A;  3TAN A;  1IKX A;  4A59 A;  3GL1 A;  4FZY A;  3LP1 A;  3EE8 A;  4H03 B;  1W7A A;  3THY A;  1HNI A;  1IH7 A;  3I8B A;  3QEP A;  3MWT A;  3U3Y A;  3L2R A;  4DFK A;  3SZ2 A;  4ID1 A;  2QWP A;  2V52 B;  3EE9 A;  2D0P A;  1QSY A;  4BY9 C;  1HYS A;  4CEA A;  3TWH A;  1YVN A;  1B9D A;  2X6S A;  5AQT A;  3CCV N;  5C25 A;  2FF6 A;  2KLA A;  4FO0 A;  1XC9 A;  1J54 A;  2IVN A;  3VQD A;  4WFB L;  1J53 A;  4XEI A;  1EWQ A;  1RT3 A;  2A3Z A;  3LM2 A;  3MN9 A;  4EHT A;  5F0X A;  3DLE A;  4FPB A;  2E6M A;  5AQS A;  4FK4 A;  3KK1 A;  4CGF A;  2Q36 A;  1LW2 A;  1HUX A;  1NM1 A;  1Q81 O;  3ZCM A;  2F7T A;  5EXW A;  3WXJ A;  4CGG A;  3IG1 A;  1RIL A;  2OPP A;  4LD0 A;  4CES A;  3MED A;  1Y97 A;  4CE9 A;  3P31 A;  2P9P B;  1GLF O;  1BU6 O;  4LF4 K;  5C0Y A;  2XRI A;  3D0P A;  4EZ9 A;  3L2U A;  1BQN A;  4OPA A;  3CFR A;  2OTJ N;  3L6Q A;  4DFP A;  4Z94 A;  3HBT A;  2JWL A;  3IS9 A;  1BIS A;  4DMN A;  3BUZ B;  4DCH A;  1A5W A;  3VEY A;  4B3S K;  3C7N A;  3LL3 A;  4M3X A;  3MK6 A;  3SV3 A;  1NK6 A;  1C0U A;  5J2P A;  3LDS A;  4LH4 A;  4M3Z A;  3G10 A;  1YUW A;  3MXM A;  4F4K A;  5CE3 A;  3OBW A;  1WSG A;  5F1X A;  1W0H A;  2P9L B;  3FGU A;  2UU9 K;  1V4T A;  4RW8 A;  3ZET A;  5LJV A;  1BI4 A;  5C42 A;  2FBT A;  4FLU A;  1C1A A;  2YNI A;  3CHW A;  5FRM A;  1XC3 A;  4YDU C;  2NRT A;  1R0A A;  2E20 A;  1UWB A;  3KLI A;  1BHL A;  3JYT A;  1Y64 A;  2D0A A;  2QWM A;  3K5O A;  1TK8 A;  3SK3 A;  5AQX A;  5AR0 A;  4K42 A;  3KWG A;  3CIP A;  5KQD A;  3AO2 A;  2P9K B;  4PWD A;  3ZSZ A;  1ILY A;  4CJS A;  1D5A A;  3HPO A;  5KI6 A;  4C8K A;  1RDW X;  1S1W A;  2KW4 A;  3P4I A;  1BIZ A;  2Q2R A;  3DM2 A;  3SLC A;  4DSE A;  4AH9 A;  2X74 A;  4H8K A;  1VSH A;  3W3D A;  1UAX A;  4CK3 A;  2ZM6 K;  1E4F T;  4ILH A;  4W5N A;  5BRD A;  1JJ2 M;  2XY7 A;  3QBW A;  5ELZ A;  3QFP A;  4O5B A;  5I9E B;  2KQ2 A;  1W2B M;  4X62 K;  4Y1D A;  4CCH A;  3M3Z A;  4AHU A;  3QNO A;  2YNF A;  4DR5 K;  3O5B A;  3L4Q A;  4QS9 A;  2YKM A;  1EP4 A;  4BDZ A;  4KO0 A;  2W6K A;  2QEX N;  4DSI A;  2I7P A;  3V9W A;  3K9J A;  3EYZ A;  2NZT A;  4DQI A;  3MXI A;  3ZSW A;  3WNH A;  4CHP A;  3VA0 A;  1FKP A;  4CZH A;  3TAF A;  2QKK A;  4LFB K;  4CIG A;  3LPU A;  3VQ5 A;  5JVH L;  1TKZ A;  3BDP A;  4HWI A;  1HNZ K;  3HSC A;  4KH5 A;  4BR5 A;  2IVO A;  5JMV A;  1WB9 A;  4PL7 A;  1BG3 A;  5M1O A;  4DTM A;  1QSS A;  3SQ2 A;  3BF3 A;  1XHZ A;  4JD2 B;  2VWK A;  1ZBL A;  5AQI A;  3IDH A;  3DLR A;  2F8S A;  2HB5 A;  3CMA N;  4LF5 K;  3CFO A;  4BR7 A;  3FZH A;  1ZC6 A;  4B1V A;  3K5N A;  4H4O A;  2UUB K;  5HP1 A;  4J2E A;  1WSE A;  4J2B A;  4DTO A;  3I33 A;  3THX A;  1NKE A;  4CW7 B;  3DXK B;  1P90 A;  1HNW K;  5EX5 A;  1TYQ A;  2IIR A;  2P9U A;  3WXK A;  4JI6 K;  4FLY A;  1J5O A;  2A6A A;  1KXP A;  3S3N A;  1LW0 A;  3PO4 A;  3CCU N;  2D4W A;  1KAY A;  2D0O A;  3FFK B;  1NGH A;  1L3V A;  1RT5 A;  3MN6 A;  5F2R A;  4MO4 A;  4JS4 A;  1CXU A;  4CJQ A;  4CGI A;  3QET A;  3LWL A;  4KHW A;  1RT6 A;  1VRT A;  1Q8I A;  3NFA A;  3NBP A;  3R9P A;  2NRH A;  5FRN A;  3ZEU B;  3AA3 A;  3HM8 A;  1T03 A;  4JKB A;  4CF9 A;  2F4V K;  2HMP A;  3F5T A;  4FJN A;  1XNQ K;  1U45 A;  1JCE A;  4E1J A;  5AFU H;  3WEE B;  4B9L A;  1VSF A;  3TAQ A;  2UYT A;  1UA0 A;  1TYQ B;  4FM2 A;  3EEQ A;  3NGY A;  3I56 N;  3LDL A;  4BG8 A;  1BIU A;  5LJW A;  4GW6 A;  3TPQ A;  1CZA N;  1HKB A;  2PY5 A;  2YV0 X;  3VF2 A;  3UKU B;  1JXB A;  1BA0 A;  1Z05 A;  5M1N A;  3NF7 A;  3H3O B;  3ZLJ A;  2QWO A;  3BZK A;  4JHD A;  3OYF A;  4ICL A;  4IDH A;  4BRL A;  1VQL N;  3QNN A;  4YOT A;  3SNN A;  5EY4 A;  2YI1 A;  4DUY K;  1VSL A;  4JI7 K;  4DUZ K;  5C24 A;  4BGB A;  4DU3 A;  1KRP A;  4IJN A;  5A2Q O;  2E2Q A;  2O8B B;  4QAG A;  1K8A O;  2WON A;  1IV0 A;  4BRH A;  5LL6 Z;  2NRX A;  4CHQ A;  3VOV A;  4IO9 L;  2YJE A;  3D2F A;  3TSP A;  1C6V A;  3QIP A;  4CI6 A;  3M8P A;  3S3O A;  3VGK A;  3OVN A;  3U4L A;  1U48 A;  4K41 A;  3AAQ A;  1DEJ A;  4B08 A;  5JLF A;  3ISN C;  4FLW A;  1BCO A;  2HBM A;  1VQP N;  3QER A;  1C1B A;  2O4G A;  3WQT A;  3H1V X;  3U8X A;  3MEE A;  4KHU A;  2JGU A;  1TKT A;  4CEQ A;  4HVJ A;  3VEX A;  1NGB A;  5LMU K;  5M1P A;  4BRP A;  4IWV A;  1VSJ A;  3LAM A;  4BQZ A;  1W97 L;  5AZJ B;  3O3F A;  1NK8 A;  3TAB A;  5D3G A;  1ASW A;  1NWK A;  3CM6 A;  4IXC A;  3Q7B A;  2GWJ A;  1ZBI A;  4OGE A;  3ATV A;  4JKG B;  1KD1 O;  3SJJ A;  5CZ2 A;  4BR9 A;  3O8M A;  3QDK A;  4H5R A;  2FBY A;  4BRK A;  4E7L A;  3O6W A;  4WQ5 A;  3VEO A;  1RDC A;  3CCJ N;  5SZT A;  3JSM A;  1S3X A;  3BGR A;  1X9S A;  2WFB A;  4Q0B A;  3MX5 A;  1KAX A;  4M45 A;  2ZQB A;  3EO3 A;  2KTQ A;  3BZC A;  3KLF A;  2O8F B;  5J2Q A;  5FPD A;  1CZB A;  1BWF O;  2XY5 A;  3EZ5 A;  5C12 A;  3TSQ A;  5AQP A;  3EY1 A;  3AVF A;  1M1K O;  3NVK A;  1NU0 A;  1KAZ A;  3KK7 A;  2BDP A;  2RPI A;  5CYQ A;  1HQE A;  4CZL A;  2A42 A;  1KTQ A;  3V1Q A;  4B9M A;  1NOZ A;  4DSK A;  1J5E K;  4X65 K;  5KPT A;  4CJT A;  1NNE A;  4DR6 K;  4NLB A;  3FZM A;  3VMF B;  1J6Z A;  3RMC A;  3O9R A;  3VET A;  4W5R A;  2X78 A;  4PKH A;  4KPY A;  1LWF A;  4LSL A;  3QEW A;  3CQ8 A;  2OPR A;  2G8W A;  3HPH A;  4AIL C;  4JAX A;  4AHV A;  4HUE A;  2LSN A;  4FLZ A;  3ENH A;  3RRG A;  4H0T B;  4JKA A;  2E2N A;  3E01 A;  1EX4 A;  4HTL A;  3CYM A;  1SAZ A;  1ATS A;  3DRR A;  1WSF A;  4HUG A;  2HHU A;  4NO7 A;  4BDP A;  2O8E A;  2ZGZ A;  4OLA A;  1QVF M;  3NAE A;  3CC4 N;  3AVG A;  1NG9 A;  3VF4 A;  2GV9 A;  2VWB A;  1IKW A;  2ATQ A;  4KHP K;  3ULD A;  1EWR A;  1MA9 B;  3DLB A;  1RDD A;  2I5J A;  3DLH A;  1H1V A;  3THW B;  1K8K A;  2E6L A;  4FW2 A;  2Q3S A;  2G8I A;  4AHC A;  3KK2 A;  3ATU A;  4BDY A;  4B9U A;  1LAV A;  1LWC A;  2P51 A;  1IBL K;  3OHR A;  4ELT A;  3O4Q A;  1NJW A;  1TV6 A;  3CCE N;  4B1U B;  1LOT B;  1RCH A;  3QIC A;  4Q5V A;  3KIO A;  4GVM A;  4AM6 A;  3AVM A;  4DQ8 A;  3CPE A;  1ATN A;  3O1B A;  1TL1 A;  3H3N O;  4DV6 K;  1BUP A;  1GLB G;  4KAZ A;  5B8H A;  2VQE K;  5DK5 A;  1VHX A;  3DLK A;  4B9S A;  1OVY A;  2ASO A;  3RR8 A;  4F3O A;  3P39 A; 
#chains in the Genus database with same CATH homology
 1XNR K;  5IWA K;  4JYA K;  2UUA K;  4DV3 K;  1HNX K;  4DUY K;  4DR1 K;  4LFB K;  5LMN K;  4LF6 K;  4JI7 K;  4DUZ K;  1HR0 K;  1J5E K;  4X65 K;  4CVN E;  1XMQ K;  4DR6 K;  1HNZ K;  4DR4 K;  4B3T K;  5A2Q O;  4DV4 K;  2E5L K;  4B3S K;  2VQF K;  5LL6 Z;  3J7A P;  4NXN K;  2UUC K;  4X64 K;  4LF5 K;  4OX9 K;  4V19 S;  2UU9 K;  4JI8 K;  3J80 O;  4JI1 K;  2UUB K;  5BR8 K;  1N33 K;  4JI2 K;  4CW7 B;  4JV5 K;  1XMO K;  1HNW K;  4JI6 K;  4LF7 K;  4LF9 K;  4LFC K;  1N36 K;  4DV0 K;  1I94 K;  5LMU K;  3JAM O;  1IBM K;  4LF8 K;  4JI0 K;  4DR3 K;  1FJG K;  4KHP K;  4B3R K;  4DR2 K;  4DV5 K;  2UXB K;  4DV7 K;  4AQY K;  2UXC K;  3T1Y K;  4JI5 K;  1N32 K;  4NXM K;  1IBL K;  2F4V K;  4YHH K;  4GKJ K;  1XNQ K;  4JI3 K;  5FLX O;  2ZM6 K;  4JI4 K;  4GKK K;  4X66 K;  3J81 O;  5IT9 O;  3J7Y P;  3T1H K;  4YY3 K;  5AJ3 K;  4DV2 K;  4DV6 K;  1N34 K;  4LF4 K;  1IBK K;  4K0K K;  2UXD K;  4X62 K;  3OTO K;  2HHH K;  2VQE K;  4DR7 K;  4DR5 K;  4B3M K;  4LFA K;  4DV1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...