4JYAK

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4jyaK00
5BR8K 4JI7K 1XMQK 1HNXK 3J7AP 4DR1K 4LF5K 4LFCK 4LFAK 4JI5K 1I94K 4OX9K 4LF9K 1IBMK 4B3MK 4DR7K 4JI1K 4CW7B 3J7YP 4DV5K 4DV7K 4X62K 1N36K 4JI3K 4DV1K 1N33K 4DUZK 3T1YK 5FLXO 5LMNK 1J5EK 1N34K 2E5LK 3J80O 2UU9K 2UXBK 2VQEK 1HNZK 1XMOK 4JI8K 3JAMO 4JYAK 4JI4K 4DV6K 5A2QO 2UUCK 4B3TK 4LF7K 2UUBK 4JV5K 1IBKK 4GKJK 2F4VK 4AQYK 5AJ3K 5IWAK 2VQFK 4DR2K 4JI6K 4DV4K 3OTOK 4X66K 4DR3K 4X64K 4DR5K 4LF4K 1HNWK 4JI2K 4LFBK 1FJGK 3J81O 4JI0K 4DR4K 2UXDK 4YY3K 1XNQK 2UUAK 4NXNK 4DUYK 4DV3K 4YHHK 4B3RK 5LL6Z 4NXMK 4LF6K 1IBLK 4DV0K 4LF8K 1N32K 4DV2K 4CVNE 5LMUK 3T1HK 1XNRK 4KHPK 5IT9O 4X65K 2HHHK 4V19S 2UXCK 4B3SK 1HR0K 4DR6K 2ZM6K 4GKKK 4K0KK
chains in the Genus database with same CATH superfamily
1NJYA 3OYDA 1NGGA 2W42A 3VOVA 4CEAA 2P9PA 3LP0A 4LFCK 4BR7A 1C0TA 3HVTA 2GWKA 1S1WA 3LDNA 3G71N 3VEOA 4FLVA 3ZETA 1JLFA 2VWKA 1N36K 3V9XA 4JNEA 1WBDA 4N41A 5AQPA 1HKGA 3IS9A 4LH4A 1IJJA 2HOEA 2GV9A 2UYTA 4E3SA 1C1CA 3QNOA 4DTRA 1D9DA 4BR2A 2W6KA 3LPUA 4DLEA 4B1WB 4JKDA 3VETA 4BC2A 4MLHA 3SV4A 4WQ4C 1SKWA 1RBUA 3LWMA 2J4RA 5AZJA 2V7YA 3CM5A 3MN6A 3ZT3A 2F4VK 1I3AA 4UY8O 3RMCA 1YF5L 3THXA 4CF2A 3CJ7A 4JI2K 3U6FA 5BPLA 1TKXA 4FZYA 3O4NA 1VSDA 1MWKA 1D5AA 1J54A 1KFSA 3BY5A 1EXQA 4FLXA 1TL1A 1XNQK 4HUEA 1BCOA 2YKNA 3U9ZA 5CHIA 2CH6A 4PY5A 3O3HA 1SV5A 2PY5A 2A3ZA 4XEIA 1XI1A 3UE5A 2BDPA 2FF6A 3DJCA 4A5BA 1RDAA 2QM1A 4DV2K 3KJVA 4FW2A 3VGMA 2JLEA 4KHSA 3KD5E 1JXEA 2RE2A 3O9UA 3QDKA 1NK9A 3VQPA 3V1OA 3KK3A 4M3RA 4CF0A 1BL3A 3SZ2A 1G15A 1W0HA 5JICA 4JI7K 4BRFA 1DTQA 5ADXA 4DR1K 4H0XB 5FPDA 1SKSA 1HQUA 1L3VA 3CXCM 2QKBA 5HP1A 2Y1IA 4BRLA 3FE1A 1P8ZA 4EFHA 4NCBA 4E1JA 1TK0A 3Q7CA 4OPHA 3ITHA 3AY9A 3H45C 1GLAG 3RRHA 5AQNA 2RN2A 3UIQA 1BU6O 1FKOA 3BUZB 3RR8A 3C65A 4DUZK 4FK2A 3UKRA 5AQWA 1C1BA 4CJ7A 1ZC6A 2ZJRL 3V9WA 5LMNK 3CF5L 1C1AA 3T7ZA 3R9PA 1VK0A 3A0IX 1ZBUA 3FZHA 2UXBK 4YOXA 5LY3A 3LDQA 4MFBA 3R3LA 2NRVA 3I0RA 3DXKA 3WXMB 4CZHA 3DLBA 5CYMA 4CCHA 5CR4A 1ZBFA 4DV6K 1C0GA 4JV5K 3T3FA 4ILJA 1X9WA 4EAHD 4JI6K 4OKJA 3I8DA 4GW6A 4CZJA 3R1XA 1X1PA 5BR9A 2F96A 3HO1A 2PAVA 4KI6A 4JKHA 4E19A 3MX5A 2X78A 4OPJA 4BDYA 4DWIA 4NLBA 4RG8A 1NK0A 4NXNK 2CH5A 1RTJA 2IGIA 3DRSA 4IO8A 4CJRA 5DM7L 1LW0A 1ZBLA 1RT6A 2E2OA 4DTPA 5LL6Z 3KLEA 3W0LA 2D5RA 5D3GA 4KFBA 5AQVA 1EQYA 5C10A 4CD1A 2QEXN 4NO7A 4CEZA 4B9LA 3D45A 1RBSA 1W2BM 3KIOA 3OA9A 4JEPA 3OVNA 3DXMB 1QQCA 4FWPA 2HBKA 3OHRA 4M3YA 4U7BA 2HBMA 1IG9A 1HNXK 2ATQA 1ILYA 3CCEN 4J2AA 2ZD1A 1TVRA 4B9TA 1X9JA 1S9GA 3VGLA 2HMIA 3HVRA 3CPWM 1TYQB 4B3MK 1GLDG 4JHDA 3BDPA 4LF9K 5KPRA 3KLFA 3J7YP 4E7IA 2QWOA 4FXDA 2KFNA 3F2KA 3TSQA 3VEVA 4FK0A 4BRCA 3KVGA 2ZE2A 1ATSA 2FXUA 3QB0A 3VEXA 2GUPA 2GWJA 5KQ8A 4BVPA 1YUWA 4AM7A 1VHXA 4BRGA 5AQGA 3DLKA 3VMFB 4DQPA 3SYZA 3AAPA 5C12A 3MXIA 4RW9A 4BVOA 1K73O 4BGBA 2F9TA 3JAMO 2FBXA 5FROA 4DQQA 4DCHA 3T69A 3SV3A 4CJEA 1G99A 2IC3A 3ZSYA 1C0MA 4DV4K 3WUHA 4CIFA 5F2RA 3WQTA 2Q36A 4DR5K 3LDSA 3SK3A 3SUOA 2E8AA 3CJ9A 1SKRA 2D0BA 1BUPA 4JKGA 1VRTA 4H0YB 3LANA 1NKCA 1QHTA 3DYAA 2IVNA 3VQ7A 3LP1A 1RDCA 3THVA 3L2WA 1NG9A 3IFRA 4F3TA 4DUYK 5EY4A 3D7EO 1CZBA 1EP4A 4FO0A 3CCJN 3CCLN 1FW6A 4KHQA 3RRGA 3GG4A 3VEZA 2FBYA 3THWA 1IBLK 3QEVA 2RKIA 1Q8IA 1N32K 5GIPA 4BRAA 4Q0BA 5HRSA 1VQ8N 3PIOL 1BIZA 5AQRA 3C6UA 4CHOA 1RT3A 2AJQA 4A57A 1S1XA 3DLGA 1NKBA 1YT3A 1NMDA 1HPZA 3C7NA 4KTWA 3TAPA 1M90O 2ZM6K 3EKSA 3TAQA 3A5LC 3LP3A 1J53A 2GBZA 3WNEA 1VSKA 1T03A 4F9OA 4IFYA 4CGIA 3L8BA 4LF5K 3WNFA 3H3OB 1T7PA 4B9NA 4PL7A 1U45A 2HHUA 2QWPA 2VGNA 2A5XA 4CBXA 3V9SA 4HWIA 4CGDA 4IJAA 1FK9A 4N56A 1T8EA 3LP2A 4DFPA 3AVIA 1U04A 4O5FA 5B8HA 4H5VA 5JLFA 3D2EB 4JD2A 1HNIA 3LAKA 4CHYA 1EWQA 4OPKA 3AVBA 5BPNA 5KPTA 4E7KA 3NAEA 4JLHA 4CJQA 4JRPA 4Z0UA 3KWIA 4XH1A 5AQIA 3OYKA 3NGIA 1NGIA 3AGKA 1NGFA 4JS4A 1NOYA 4KAZA 2VWBA 4O5BA 1QQMA 3LZIA 5KTQA 4IZ9A 1IKWA 4AHUA 3BP8A 4CJ4A 2G8WA 3OYIA 4DU3A 4DR2K 2RHKA 1UAXA 2HVHA 4ILHA 3AVKA 1ITGA 4OVLA 3JS6A 4FJKA 3ATVA 3QICA 1U6ZA 4FWOA 3QEPA 2Q2RA 5KRTA 4C8LA 4B9VA 1NGHA 3AO2A 4KBOA 4AHSA 3PO4A 1VSJA 2HNZA 3GDQA 4O55A 3HSCA 4I9QA 2XY8A 3M5RA 4CJKA 1JLGA 2P9NB 1TKTA 4FWLA 1RDWX 3ATUA 3E9LA 3LAMA 4F2RA 3E01A 3MWPA 4M7YA 5HOOA 3M8SA 3B6OA 4YDUC 5EXWA 3V9UA 3LM9A 3VGKA 1BQNA 1A5XA 2F8SA 1QHAA 2NRRA 2O8EA 4IJNA 3SQ0A 4KHUA 4H03B 1OVQA 1GLBG 3QO9A 5KQDA 2P51A 4ZHRA 4QCLA 1L3UA 2P9LA 3DWLA 1QZ5A 3CQXA 3L0QA 3MCAB 4OX9K 2V51B 2P9KB 3AV9A 4DV5K 4CJ5A 4CFDA 1GLFO 3S9HA 3CM6A 3H1QA 4IDKA 4JKEA 5SZTA 4CZKA 4WF9L 5FPEA 3RSEB 2P9SA 4CGFA 4RW4A 4M3ZA 5AQQA 3B8AX 1YTAA 4CEFA 4ISFA 4WQ4A 4PHTX 4WFAL 1HYVA 5CZ2A 3THYA 2E2PA 2A41A 3E1YA 1WLJA 3P31A 4CD3A 4H5WA 3QETA 4LF7K 1D4XA 1JCGA 2VQFK 5AQMA 3ULEA 3FLCO 2HBJA 1HNWK 1LWFA 3WNHA 3QLHA 3L6QA 5CZ1A 1HLUA 4B3OA 1T6DA 5AQSA 4BDPA 2G8IA 3BZKA 2NLXA 2IDOA 5AQUA 5TKYA 3WXJA 1NJWA 5C42A 3CMEN 4FJMA 1U49A 1X9MA 1JLQA 4FWMA 2NRXA 3GL1A 4CEBA 3VQ5A 4K8ZA 4YHHK 1KLNA 5J2MA 3UB5A 1TUYA 3AO1A 4MLEA 1TK8A 1BOTO 1ZBIA 3TABA 3OS2A 5C25A 3SUNA 4A2BA 4YFUA 4GVMA 4CVNE 1XNRK 2B6AA 4AILC 4CEDA 3OS1A 4IKFA 4IWVA 3OYFA 1KRPA 4X65K 3IDHA 4CJSA 1TAUA 1JLEA 4U67L 4Z94A 2OZMA 4KREA 3RMBA 4OPAA 2UXCK 3SUPA 3QINA 3SQ1A 3GOIA 3VF4A 1XC3A 2VCPA 3EN9A 3DLHA 5JVGL 4M45A 4BC4A 4OLAA 3MEEA 3CQYA 4W5RA 1I94K 1HKBA 4IDHA 2V52B 5JS1A 3CIPA 1K6YA 1BI4A 5C15A 3MXMA 3P38A 3H6EA 2P9UA 5FPNA 1L3SA 3HM8A 4AHCA 4IEEA 1NLVA 5AQHA 1JLCA 1Q81O 2EX3A 4H5RA 1Z6RA 1DT9A 2OZSA 3J80O 4W5QA 4TSXA 1NK6A 2KQ2A 3J8AA 3DM2A 1HNZK 1RDDA 3OJUA 2IAJA 3A5MC 3VTIA 4CBWA 4YOVA 4DS4A 4XH5A 3KK7A 2RF2A 3PX4A 3WXLA 1W7AA 1IBKK 5AQZA 5GAEP 1RT1A 3CJBA 3SAGA 1WB9A 1KLMA 3O6WA 2P9IB 1W97L 3L2RA 4DU4A 2DFHA 1JL2A 2KKZA 4BY9C 4QS8A 1RBRA 3P4IA 1CXQA 2KHOA 4BWJA 5J2PA 1O1WA 4WCEL 2HNDA 4CHPA 1REVA 2ZWHA 3S3NA 4Z4HA 3WEEB 3UKUB 4DF8A 4KHWA 4RW6A 3AA4A 3DI6A 4FWSA 2YNHA 5JMVA 3SBTA 3T19A 3DRRA 2HHQA 3C95A 2FSJA 1W9HA 1DKGD 4CECA 4FWRA 2O8CB 4H0OA 4LD0A 3L2QA 2QXFA 3VQQA 3A5NC 1HJOA 2JWKA 3C94A 3K9KA 2D0OA 1M1KO 2OYQA 3DLRA 3PX0A 2A42A 5EX5A 1BG3A 4FJLA 3CCRN 2DFEA 1K8AO 3NF9A 3AA2A 4C8MA 1WSGA 3ASMA 5E84A 4JI5K 3ENHA 2YJFA 1HMVA 3TPQA 4CJTA 2HSTA 2E2NA 3D2FB 1RBTA 1NGAA 3LDOA 5FDLA 5KPZA 4KB1A 4IG3A 5FPMA 3EL2A 4DQSA 3ZYYX 1KFDA 3K2PA 3MEGA 3OBYA 4BACA 1U2VB 3ZEUB 5F0XA 5GIOA 3M8QA 3NDKA 3CQ8A 4BE2A 4FM0A 2XRIA 4FK4A 3C0BA 3CCVN 2Z1IA 3VA0A 4BREA 4BRHA 4O8KA 4CBUA 3BF1A 3AVFA 4JI4K 2O8FB 2UUBK 3ZSVA 3WQUA 2IOCA 3C6HA 4DR3K 4I6MA 3CC4N 2YNFA 3IKMA 1S72N 4RTFD 2PYLA 1WSFA 3K9JA 2HVIA 3ENOA 3I8BA 3VPZA 5AQFA 2QI2A 4CGHA 1YXQA 1VQ7N 1OH6A 1RFQA 3SUQA 2UXDK 1QE1A 3D6RA 2OPPA 4FOIA 4BE1A 3CYMA 5DMRA 1VRUA 1BCMA 3KZBA 2OA8A 2XY7A 4PQUA 1MA9B 3ZSRA 2QKKA 3O9TA 3CD6N 1XUPO 4FWQA 4NYFA 4FWNA 5F1XA 5AZIA 2KFZA 1L5UA 1IG8A 4NYNA 4BGAA 2JGUA 4K43A 1B9FA 3BEXA 2WTUA 5I42A 4BWMA 5BN9A 1GOCA 3CMAN 2HHHK 3VQ4A 4E1MA 3EYZA 4FLZA 3KHYA 4DSEA 3EY1A 5BRHA 4BRMA 3MAQA 2WONA 4BR5A 1ZYQA 5BR8K 4IO9L 4ELTA 4W5TA 3OYEA 1QVGM 4O0JA 1Z25A 4CJLA 4CZGA 3HP6A 4NCAA 1SL0A 5HRRA 1YJ9N 3HP9A 4KH6A 4C8OA 1GLLO 3HYFA 3EZ5A 2V7ZA 3I56N 2WC9A 4IOCL 4JN4A 3O5BA 4DV7K 1YI2N 5EU7A 3TTDA 2Q1NA 2ASMA 4MQ3A 4BRKA 4EZ9A 3TWHA 2FF3B 3PV8A 2IVPA 4DTUA 1TAQA 2NUBA 1N34K 2GEMA 5J2QA 2F7TA 3VA3A 4CZIA 3FFKB 5CE3A 2VQEK 3AVAA 2P9PB 5BPMA 3VENA 3H1VX 3KK1A 4DTMA 5EVZA 3QERA 2QWRA 3QNNA 3L4QA 4J2BA 3EZWA 3MMVA 1C6VA 2EWSA 4B3TK 2CGLA 3LALA 3O9RA 3KWGA 2Z1JA 3CETA 3ZETB 4AQYK 4JRQA 3JXUA 1QQNA 2FSKA 3KLHA 1WBBA 3KKRA 1VQLN 4JI0K 4FL9A 4DQ8A 4BRDA 3L3UA 4G1QA 5I9EB 4HUFA 1X9SA 4I9LA 3OYNA 2O4IA 2YHAA 4CK2A 1X3MA 2D0PA 4BE0A 5AZJB 4I7FA 2PZSA 4LF6K 4QOZB 3O9QA 4EIAA 5M1QA 4QS7A 4DV0K 3HPOA 1ESVA 3THXB 4CF1A 4CJUA 4YDUA 3P1GA 4FLYA 3O3GA 5BRDA 2ASPA 3HBTA 3HI0A 1I39A 3U3GA 3MEDA 4CEOA 2W40A 4ELUA 3A8YA 3A5OC 3L3VA 4JS5A 5KRSA 4K0KK 3TR8A 2PFUA 4DTOA 2A6AA 4JKCA 3OS0A 4FW1A 4RCHA 1R59O 3ZX0A 4KTQA 1HYSA 2BUPA 4IOXA 2O4GA 2QK9A 1VQKN 2OCEA 1IBMK 3MN5A 4CZFA 5E26A 3IAYA 3AA3A 4B9UA 5HRPA 4HVJA 1NK4A 2F8TA 3NE6A 3SCXA 1S22A 1JKHA 1JLAA 4C1NI 1HX1A 3RWUA 1VQ4N 3H08A 3K0SA 2QXLA 1K8KA 3VQDA 4B1XB 2OANA 1NGDA 3HZ6A 3CG7A 1N6QA 1KTQA 3ZSXA 3OYAA 1RILA 2GX9A 1MWMA 3BF3A 4GV9A 1KAZA 3ID6A 3SMSA 2O8DA 4YOYA 1LAVA 2FBVA 1KAYA 4BRNA 4JYAK 4M42A 3K59A 4M3WA 2XY6A 1CXUA 3O4WA 1DEJA 4X64K 3K5MA 1JCEA 4FJ7A 3UKRB 4FJIA 4KPYA 3O1BA 1FJGK 2F9WA 4Z4FA 4LSNA 2HF4A 5BRFA 3E9OA 2YI1A 1Q86O 4E7JA 1FXXA 3PIPL 3HSTB 2QTDA 4BR9A 4RW7A 5AQTA 3RMDA 2O8BA 2BGGA 3NF8A 3CCUN 3DXKB 3LL3A 3L2UA 3KKSA 3NGZA 4FJXA 4LH5A 5M1PA 1YVUA 2I5JA 4B3RK 2GELA 4FJNA 3AA5X 4W5OA 3EKUA 1EETA 1SS6A 4B1ZA 2BE2A 2I7PA 5C2FA 4FLUA 1XHXA 1TGOA 4CI6A 4CHQA 2G8VA 1V4SA 5EOYA 5AFUH 3TU5A 5M1KA 1J5OA 1S5JA 1JCFA 5HL7L 4B08A 2VG5A 1GLJO 4RW8A 2GTDA 2P5GA 4B9QA 4CZMA 4ZTJA 5KGWA 4BG9A 4H5TA 4B9SA 2CGJA 1RTDA 4KHYA 4CZEA 3ZSQA 2KW4A 4A59A 1ASUA 3SJJA 1XHZA 4AH9A 3FZKA 1T05A 4HCCA 2YX6A 2ETJA 2NRTA 4DG1A 5GADP 1BDGA 3TANA 4AHRA 2X6NA 4E7LA 1VSHA 1NBWA 2FSNA 4DU1A 2VWJA 3L4IA 2HHVA 5GAHP 2E6MA 3NVMA 2ZJQL 5AQOA 1Q9YA 1WAFA 1E4GT 3V9ZA 2KTQA 4JI8K 1D9FA 4PKGA 4BRIA 1RDBA 1IO2A 4JHDB 3JSMA 1WOQA 4A5AA 4DTSA 1C0FA 3ALYA 3HRGA 2ZQBA 4IFVA 1WAJA 1X3NA 2ZF5O 4BR4A 2Q97A 3V4IA 4LFBK 2PBDA 3ZLJA 3GBTA 2Q0RA 1BISA 2VG7A 1KVBA 2LSNA 3M8PA 1S3XA 4CJPA 2E2QA 3HK2A 1HUXA 3MCPA 3AVHA 5K14A 2VG6A 4FLWA 4E89A 4H0PA 1U48A 3FGUA 4W5NA 4FJGA 2YHBA 1YIJN 3IRXA 4B9MA 4K41A 1XC9A 1Q7YO 5H1SQ 4GV3A 1JL1A 3FFIA 3VF2A 3SQ2A 3OYJA 3QIPA 3N4QA 4BQLA 3TARA 3SAHA 3CC2N 1IH7A 1S1TA 3V1QA 2Z1GA 1Z26A 4NCGA 4DB3A 2IS3A 4JKGB 1LOTB 4F2SA 5GINA 4V19S 3AGRA 1BHLA 1QQOA 4K42A 1MU2A 3EE9A 5LJWA 4H4MA 3ISNC 2BTFA 3NFAA 3EEQA 4PWDA 4B1YB 4AHTA 1VQ9N 3W3DA 3J7AP 4F8RA 1Y64A 4CHZA 3P39A 3E66A 1VQ6N 3HPHA 2HB5A 3THWB 2YV0X 1V4TA 4LFAK 1LWCA 4DSKA 3HXMA 4DMNA 1SQKA 4OKKA 4DFJA 3CFRA 1RGIA 1NU0A 4WE1A 3O9SA 1YTUA 1NGJA 4F4KA 3MWTA 5HBMA 4DSJA 2AA4A 4WYBA 5MLCQ 4HTUA 5KI6A 2E4LA 4HUGA 3C7NB 4CJWA 3I55N 4M3TA 3LM2A 4AHVA 3VN5A 2QWLA 3RMAA 3DLEA 1DTTA 3O3FA 4PKIA 1Q82O 5AQXA 4FJ9A 1HYZA 1OVYA 5CY4A 1E4FT 5A2QO 1B92A 3C6AA 1DLOA 3N4PA 3CERA 3VQ6A 5FRNA 2W41A 3SAFA 2AP1A 4X66K 1TKDA 1K9MO 2JWLA 2ZGYA 3OYBA 4DKWA 4Y1DA 1SUQA 3J81O 4JD2B 4C8NA 4KHNA 1S1VA 4CIEA 3DXMA 4CGJA 4FJ5A 3U9DA 3QESA 1EKEA 3AAQA 4OLBA 1T44A 2UUAK 4CE9A 3CJ1A 4R79A 3O80A 4C8KA 1VQON 2IVOA 2YKMA 1TV6A 3NH1A 3D0PA 4UQGA 3PX6A 1NGBA 1VSLA 3TSUA 3EE8A 1QSLA 4YORA 1SZ2A 3KK2A 5JLHA 3CCMN 1TYQA 4J8FA 3SJHA 2Q3SA 4JAXA 3ZT1A 1SL1A 4BRPA 3HT3A 3OW2M 4DTXA 3OYCA 4GKKK 2QW9A 4J2DA 3VEWA 1OH5A 4K8XA 4WQ5A 1WSEA 1H1VA 1JLBA 4FVMA 4RWTA 4BDZA 1EWRA 4QS9A 3MX2A 4KTZA 5KGXA 3QFUA 4I2QA 4M7XA 3VF6A 4WFBL 2A1RA 2B5JA 1WSHA 3QEXA 1KQSM 4JI1K 4KI4A 1FKPA 3CCSN 4FZXC 4X62K 3M3ZA 1HJRA 4DV1K 2XY5A 1U47A 4FJHA 2CGKA 3P83D 5FLXO 4EHUA 1J5EK 2X6SA 4CERA 3QBWA 2O8EB 2E5LK 1CZ9A 1KCFA 1JXBA 3ZSOA 3RR7A 2BH1A 2E1YA 3PSFA 4ELVA 2HF3A 3CCQN 2P9LB 4GVEA 2FBTA 3MK6A 4GNIA 2QWNA 4Y0WA 3SLCA 4YNQA 1NWKA 4N5SA 1XMOK 4XH4A 3S3MA 4FJJA 3FZFA 4FM2A 2G8FA 3FR0A 1S6QA 1BQMA 3TSPA 2HHXA 1S6PA 1BIUA 3KTQA 1SAZA 3ZT2A 1ATRA 1OKJA 1NGEA 4M3XA 4FWKA 4LF4K 4OKEA 1RDUA 2OPSA 4FZZA 2P1JA 3TI0A 1VQ5N 3SMPA 2P9SB 1VQPN 3TTCA 4Z4IA 4DQRA 1LV5A 2BANA 2GUIA 3TAMA 4FYDA 4DSIA 2DPNA 3G10A 4YY3K 2HHTA 4DFMA 1RNHA 4HHTA 2HHWA 4A2AA 3PO5A 3H3NO 3NF6A 5LJVA 3NVKA 3THYB 3OY9A 2NRHA 3BZCA 2NRWA 1Q18A 1D8YA 3ULEB 1YITN 5JVHL 3NBPA 4A62A 5ADXH 1N5YA 4I2PA 5J2NA 4CESA 4H0TB 2H3GX 3VQAA 4NB4A 1IV0A 4DTNA 5M1NA 1ASVA 3DOKA 2KLAA 1BO5O 4B8CA 4Z4EA 2XHBA 4BQZA 3DMJA 4EP4A 1HR0K 4A61A 3AARA 4FM1A 3D2EA 4JKBA 3SNNA 4JKAA 1OH8A 1ZBSA 4KO0A 4J2EA 4H8KA 4CK1A 3K5LA 3AO3A 3O4QA 2D0AA 4ZTFA 1TK5A 3AVCA 1CLQA 3VQ8A 4OGEA 4DS5A 1GOAA 3VEYA 2I7NA 3BGRA 5CYQA 4ISGA 1KC8O 4OGCA 3WXIA 3NF7A 3AVLA 2DTUA 3T1YK 3C6TA 1WUAA 4JK8A 3A2FA 3P5JA 4PUOA 2D4WA 1OH7A 5AQJA 1U4BA 3IG1A 3TAGA 3CC7N 4WQ5C 2WFBA 4M3UA 3L2VA 4FPBA 4QAGA 1NKEA 3WNGA 4CK3A 4FVUA 1BI4B 4L8RB 4Y1CA 5AJ3K 3WXKA 1YJWN 4PL8A 2P9UB 2WUSA 3DAWA 4ISEA 5ELZA 2P9NA 4BR0A 2A40A 3MDQA 2OTJN 4BC3A 4B8AB 1NNEA 1LAWA 5C0YA 3QEIA 3GE1A 4GV6A 3G0ZA 3CJAA 4H4OA 4Z4GA 3M1FA 3ULDA 1VQNN 3O8MA 4IXCA 3ZX2A 3NHGA 3PY8A 3SQ4A 3K57A 1RT7A 4MDBA 4KRFA 1QS4A 2YNIA 4DV3K 3SPZA 4LF8K 3ENBA 4E7HA 3CI5A 4K25A 1KXPA 2P9KA 4KHPK 3K5NA 4LSLA 1RTHA 1RT2A 1A5WA 1KVAA 4E1NA 4FCYA 2HW3A 2YHYA 2NRZA 4YOUA 3RSEA 4DR6K 1S9EA 5BN8A 4E0DA 5HRNA 2E88A 5TKWA 3HPGA 1NMNA 4LY7A 2D0CA 4O4GA 5AQLA 3MN7A 1NJZA 1VAZA 4JK9A 3NCIA 3QFPA 1LCUA 4CJFA 4GY2B 4CHNA 2B4JA 1KD1O 2A1SA 4CW7B 2YCHA 3CHWA 3M6GA 4KB0A 2QWMA 4Q5VA 1TKZA 3VESA 3NGYA 1N33K 3T1AA 3V1RA 3OBWA 4FJ8A 4ILGB 2OPRA 4DSLA 3V81A 5DK5A 5FRMA 4DSFA 1VSMA 1GLEG 3DOLA 2YHWA 3AVNA 1HNVA 2YJEA 3U3YA 2YNGA 1NK7A 2R7YA 1S1UA 2QWQA 4JK7A 1QSYA 1QSSA 1L3TA 1YVNA 3KLIA 3NH2A 4CF8A 4DHYA 2UUCK 1KAXA 2HBLA 1J9AA 3AVGA 5C24A 1ASWA 3IUCA 3K58A 3V6DA 4CFAA 1UA1A 1CZAN 4HTLA 4N76A 1UWBA 2IIRA 1QZ6A 1QTMA 4AF1A 3LDLA 1T3VA 2E1ZA 4CF9A 4KH4A 4GMJB 1Q9XA 4WFNL 4CIGA 1O13A 3ZT4A 1GOBA 1TL3A 5AQYA 3QBXA 3ZSZA 2E20A 4JKFA 1N8RO 3OYMA 3QMLA 4BC5A 3TTFA 4O0IA 3KD1E 3F9MA 1NGCA 2DY4A 5M1FA 1GLCG 3LPTA 4I6MB 4KKOA 1T6CA 4BRQA 3T1HK 4ID5A 3AVJA 1Y97A 1EX4A 3VQCA 1J6ZA 3VTHA 1NJXA 2XO7A 1NK5A 1XQSC 1HRHA 3B6PA 4IG0A 1RTIA 3VERA 5M1OA 1KVCA 4OJRA 3HOTA 2YHXA 2Y1JA 1A5VA 4XIUA 1HPMA 4IOAL 5AFUA 1DGKN 4IEIA 5AZIB 3MECA 4KH5A 2NZTA 3VQ9A 3H46O 1LWEA 1BA1A 3AVMA 4G9ZA 2FLOA 4DLGA 1HQEA 3R8EA 3NMUA 3LDPA 3PUFA 3WT0A 3ZT0A 2P9IA 1RT4A 4CFCA 3G6EN 1KSPA 3DRPA 1RBVA 4YOWA 4O8UA 5E41A 2G8UA 4M63C 4HCBA 3QIOA 3K5OA 2KZMA 1R0AA 1BA0A 3ZSWA 4B1UB 2WBNA 3WEEA 3UKUA 4CEEA 3ID8A 4KV8A 4ICLA 4DTJA 3AO5A 4GKJK 5IWAK 4ID1A 4H5NA 1MDUB 3MXJA 3G25A 1WSIA 2ZJPL 3TAEA 4EP5A 3OYGA 2DFFA 3ZX3A 3E9PA 4MO5A 4BG8A 1LW2A 5AQKA 2KZZA 3VQEA 4AM6A 3VQBA 2O8CA 3IMXA 1ATNA 1NK8A 1UA0A 1NM1A 3EO3A 1VSFA 4IBNA 3U8XA 2P5OA 4OO1J 2VGMA 3RTVA 4M41A 3G4SN 4MO4A 1UOCA 5GAGP 5SWMA 1WSJA 4CEQA 4DF4A 4EHTA 1IKYA 2E6LA 4N47A 4CFBA 4DFKA 4B1VA 5LMUK 3CFOA 4H0VB 1TUUA 3Q7BA 3D2FA 2ASOA 2OTLN 4FOEA 2D1KA 4NLCA 3HTVA 2X74A 4Z4CA 5HLFA 1RT5A 4B3SK 3U4LA 3FZLA 2NNWA 1BWFO 1U2VA 3DLLL 2HHSA 1B9DA 3ZEUA 1XMQK 3F73A 4CJVA 1IKXA 2PYJA 3PSIA 2Z1HA 2G8HA 2ITGA 4FSVA 3I33A 1NOZA 2HMPA 2HNYA 1WN7A 4DR7K 3FZMA 3RVCA 3OYLA 2O8FA 4O44A 1YAGA 5HROA 4JI3K 2RPIA 1IKVA 1YHQN 5J1EA 1F21A 1XWLA 5T7BA 3CFPA 4YOTA 1Z05A 3MN9A 3LWLA 2ITMA 3O1WA 2UU9K 4F3OA 5I3UA 3KLGA 3HJFA 1SL2A 3HM9A 3SI6A 1JJ2M 3SPYA 5BREA 3J7ZO 3OYHA 1WNSA 1HKCA 1RCHA 4C1NK 3HL8A 3SBGA 3R6MA 4EZ6A 4R5PA 3ZCMA 3OJSA 3QEWA 3OTOK 5AR0A 2W6LA 3LZJA 1VQMN 2G8KA 4MDAA 4BROA 1K8KB 3F5TA 2FC0A 2WOMA 3O08A 2OPQA 4DQIA 4DR4K 4L3QA 1ZBHA 1C0UA 3I0SA 1ZXOA 2Q0UA 2Q31A 3CJCA 4FLTA 2O8DB 2EHGA 4LC9B 3PLAA 3NH0A 4PKHA 1P90A 2ZGZA 4NXMK 1E3MA 1NJIO 3M8RA 2QA4N 3JYTA 1VSIA 1VSEA 4IFEA 4PA1A 5IT9O 4CGGA 3S3OA 3HOSA 3S41A 1EO1A 3CPEA 5JS2A 3TAFA 4CZLA 5DM6L 4C23A 5C2DA 4FPAA 3AO4A 2VYPA 3F9KA 1YJNN 1BGXT 2O8BB 4CJ3A 1QVFM
chains in the Genus database with same CATH topology
5BR8K 4JI7K 1XMQK 1HNXK 3J7AP 4DR1K 4LF5K 4LFCK 4LFAK 4JI5K 1I94K 4OX9K 4LF9K 1IBMK 4B3MK 4DR7K 4JI1K 4CW7B 3J7YP 4DV5K 4DV7K 4X62K 1N36K 4JI3K 4DV1K 1N33K 4DUZK 3T1YK 5FLXO 5LMNK 1J5EK 1N34K 2E5LK 3J80O 2UU9K 2UXBK 2VQEK 1HNZK 1XMOK 4JI8K 3JAMO 4JYAK 4JI4K 4DV6K 5A2QO 2UUCK 4B3TK 4LF7K 2UUBK 4JV5K 1IBKK 4GKJK 2F4VK 4AQYK 5AJ3K 5IWAK 2VQFK 4DR2K 4JI6K 4DV4K 3OTOK 4X66K 4DR3K 4X64K 4DR5K 4LF4K 1HNWK 4JI2K 4LFBK 1FJGK 3J81O 4JI0K 4DR4K 2UXDK 4YY3K 1XNQK 2UUAK 4NXNK 4DUYK 4DV3K 4YHHK 4B3RK 5LL6Z 4NXMK 4LF6K 1IBLK 4DV0K 4LF8K 1N32K 4DV2K 4CVNE 5LMUK 3T1HK 1XNRK 4KHPK 5IT9O 4X65K 2HHHK 4V19S 2UXCK 4B3SK 1HR0K 4DR6K 2ZM6K 4GKKK 4K0KK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 K;  4JI7 K;  1XMQ K;  1HNX K;  3J7A P;  4DR1 K;  4LF5 K;  4LFC K;  4LFA K;  4JI5 K;  1I94 K;  4OX9 K;  4LF9 K;  1IBM K;  4B3M K;  4DR7 K;  4JI1 K;  4CW7 B;  3J7Y P;  4DV5 K;  4DV7 K;  4X62 K;  1N36 K;  4JI3 K;  4DV1 K;  1N33 K;  4DUZ K;  3T1Y K;  5FLX O;  5LMN K;  1J5E K;  1N34 K;  2E5L K;  3J80 O;  2UU9 K;  2UXB K;  2VQE K;  1HNZ K;  1XMO K;  4JI8 K;  3JAM O;  4JYA K;  4JI4 K;  4DV6 K;  5A2Q O;  2UUC K;  4B3T K;  4LF7 K;  2UUB K;  4JV5 K;  1IBK K;  4GKJ K;  2F4V K;  4AQY K;  5AJ3 K;  5IWA K;  2VQF K;  4DR2 K;  4JI6 K;  4DV4 K;  3OTO K;  4X66 K;  4DR3 K;  4X64 K;  4DR5 K;  4LF4 K;  1HNW K;  4JI2 K;  4LFB K;  1FJG K;  3J81 O;  4JI0 K;  4DR4 K;  2UXD K;  4YY3 K;  1XNQ K;  2UUA K;  4NXN K;  4DUY K;  4DV3 K;  4YHH K;  4B3R K;  5LL6 Z;  4NXM K;  4LF6 K;  1IBL K;  4DV0 K;  4LF8 K;  1N32 K;  4DV2 K;  4CVN E;  5LMU K;  3T1H K;  1XNR K;  4KHP K;  5IT9 O;  4X65 K;  2HHH K;  4V19 S;  2UXC K;  4B3S K;  1HR0 K;  4DR6 K;  2ZM6 K;  4GKK K;  4K0K K; 
#chains in the Genus database with same CATH topology
 1NJY A;  3OYD A;  1NGG A;  2W42 A;  3VOV A;  4CEA A;  2P9P A;  3LP0 A;  4LFC K;  4BR7 A;  1C0T A;  3HVT A;  2GWK A;  1S1W A;  3LDN A;  3G71 N;  3VEO A;  4FLV A;  3ZET A;  1JLF A;  2VWK A;  1N36 K;  3V9X A;  4JNE A;  1WBD A;  4N41 A;  5AQP A;  1HKG A;  3IS9 A;  4LH4 A;  1IJJ A;  2HOE A;  2GV9 A;  2UYT A;  4E3S A;  1C1C A;  3QNO A;  4DTR A;  1D9D A;  4BR2 A;  2W6K A;  3LPU A;  4DLE A;  4B1W B;  4JKD A;  3VET A;  4BC2 A;  4MLH A;  3SV4 A;  4WQ4 C;  1SKW A;  1RBU A;  3LWM A;  2J4R A;  5AZJ A;  2V7Y A;  3CM5 A;  3MN6 A;  3ZT3 A;  2F4V K;  1I3A A;  4UY8 O;  3RMC A;  1YF5 L;  3THX A;  4CF2 A;  3CJ7 A;  4JI2 K;  3U6F A;  5BPL A;  1TKX A;  4FZY A;  3O4N A;  1VSD A;  1MWK A;  1D5A A;  1J54 A;  1KFS A;  3BY5 A;  1EXQ A;  4FLX A;  1TL1 A;  1XNQ K;  4HUE A;  1BCO A;  2YKN A;  3U9Z A;  5CHI A;  2CH6 A;  4PY5 A;  3O3H A;  1SV5 A;  2PY5 A;  2A3Z A;  4XEI A;  1XI1 A;  3UE5 A;  2BDP A;  2FF6 A;  3DJC A;  4A5B A;  1RDA A;  2QM1 A;  4DV2 K;  3KJV A;  4FW2 A;  3VGM A;  2JLE A;  4KHS A;  3KD5 E;  1JXE A;  2RE2 A;  3O9U A;  3QDK A;  1NK9 A;  3VQP A;  3V1O A;  3KK3 A;  4M3R A;  4CF0 A;  1BL3 A;  3SZ2 A;  1G15 A;  1W0H A;  5JIC A;  4JI7 K;  4BRF A;  1DTQ A;  5ADX A;  4DR1 K;  4H0X B;  5FPD A;  1SKS A;  1HQU A;  1L3V A;  3CXC M;  2QKB A;  5HP1 A;  2Y1I A;  4BRL A;  3FE1 A;  1P8Z A;  4EFH A;  4NCB A;  4E1J A;  1TK0 A;  3Q7C A;  4OPH A;  3ITH A;  3AY9 A;  3H45 C;  1GLA G;  3RRH A;  5AQN A;  2RN2 A;  3UIQ A;  1BU6 O;  1FKO A;  3BUZ B;  3RR8 A;  3C65 A;  4DUZ K;  4FK2 A;  3UKR A;  5AQW A;  1C1B A;  4CJ7 A;  1ZC6 A;  2ZJR L;  3V9W A;  5LMN K;  3CF5 L;  1C1A A;  3T7Z A;  3R9P A;  1VK0 A;  3A0I X;  1ZBU A;  3FZH A;  2UXB K;  4YOX A;  5LY3 A;  3LDQ A;  4MFB A;  3R3L A;  2NRV A;  3I0R A;  3DXK A;  3WXM B;  4CZH A;  3DLB A;  5CYM A;  4CCH A;  5CR4 A;  1ZBF A;  4DV6 K;  1C0G A;  4JV5 K;  3T3F A;  4ILJ A;  1X9W A;  4EAH D;  4JI6 K;  4OKJ A;  3I8D A;  4GW6 A;  4CZJ A;  3R1X A;  1X1P A;  5BR9 A;  2F96 A;  3HO1 A;  2PAV A;  4KI6 A;  4JKH A;  4E19 A;  3MX5 A;  2X78 A;  4OPJ A;  4BDY A;  4DWI A;  4NLB A;  4RG8 A;  1NK0 A;  4NXN K;  2CH5 A;  1RTJ A;  2IGI A;  3DRS A;  4IO8 A;  4CJR A;  5DM7 L;  1LW0 A;  1ZBL A;  1RT6 A;  2E2O A;  4DTP A;  5LL6 Z;  3KLE A;  3W0L A;  2D5R A;  5D3G A;  4KFB A;  5AQV A;  1EQY A;  5C10 A;  4CD1 A;  2QEX N;  4NO7 A;  4CEZ A;  4B9L A;  3D45 A;  1RBS A;  1W2B M;  3KIO A;  3OA9 A;  4JEP A;  3OVN A;  3DXM B;  1QQC A;  4FWP A;  2HBK A;  3OHR A;  4M3Y A;  4U7B A;  2HBM A;  1IG9 A;  1HNX K;  2ATQ A;  1ILY A;  3CCE N;  4J2A A;  2ZD1 A;  1TVR A;  4B9T A;  1X9J A;  1S9G A;  3VGL A;  2HMI A;  3HVR A;  3CPW M;  1TYQ B;  4B3M K;  1GLD G;  4JHD A;  3BDP A;  4LF9 K;  5KPR A;  3KLF A;  3J7Y P;  4E7I A;  2QWO A;  4FXD A;  2KFN A;  3F2K A;  3TSQ A;  3VEV A;  4FK0 A;  4BRC A;  3KVG A;  2ZE2 A;  1ATS A;  2FXU A;  3QB0 A;  3VEX A;  2GUP A;  2GWJ A;  5KQ8 A;  4BVP A;  1YUW A;  4AM7 A;  1VHX A;  4BRG A;  5AQG A;  3DLK A;  3VMF B;  4DQP A;  3SYZ A;  3AAP A;  5C12 A;  3MXI A;  4RW9 A;  4BVO A;  1K73 O;  4BGB A;  2F9T A;  3JAM O;  2FBX A;  5FRO A;  4DQQ A;  4DCH A;  3T69 A;  3SV3 A;  4CJE A;  1G99 A;  2IC3 A;  3ZSY A;  1C0M A;  4DV4 K;  3WUH A;  4CIF A;  5F2R A;  3WQT A;  2Q36 A;  4DR5 K;  3LDS A;  3SK3 A;  3SUO A;  2E8A A;  3CJ9 A;  1SKR A;  2D0B A;  1BUP A;  4JKG A;  1VRT A;  4H0Y B;  3LAN A;  1NKC A;  1QHT A;  3DYA A;  2IVN A;  3VQ7 A;  3LP1 A;  1RDC A;  3THV A;  3L2W A;  1NG9 A;  3IFR A;  4F3T A;  4DUY K;  5EY4 A;  3D7E O;  1CZB A;  1EP4 A;  4FO0 A;  3CCJ N;  3CCL N;  1FW6 A;  4KHQ A;  3RRG A;  3GG4 A;  3VEZ A;  2FBY A;  3THW A;  1IBL K;  3QEV A;  2RKI A;  1Q8I A;  1N32 K;  5GIP A;  4BRA A;  4Q0B A;  5HRS A;  1VQ8 N;  3PIO L;  1BIZ A;  5AQR A;  3C6U A;  4CHO A;  1RT3 A;  2AJQ A;  4A57 A;  1S1X A;  3DLG A;  1NKB A;  1YT3 A;  1NMD A;  1HPZ A;  3C7N A;  4KTW A;  3TAP A;  1M90 O;  2ZM6 K;  3EKS A;  3TAQ A;  3A5L C;  3LP3 A;  1J53 A;  2GBZ A;  3WNE A;  1VSK A;  1T03 A;  4F9O A;  4IFY A;  4CGI A;  3L8B A;  4LF5 K;  3WNF A;  3H3O B;  1T7P A;  4B9N A;  4PL7 A;  1U45 A;  2HHU A;  2QWP A;  2VGN A;  2A5X A;  4CBX A;  3V9S A;  4HWI A;  4CGD A;  4IJA A;  1FK9 A;  4N56 A;  1T8E A;  3LP2 A;  4DFP A;  3AVI A;  1U04 A;  4O5F A;  5B8H A;  4H5V A;  5JLF A;  3D2E B;  4JD2 A;  1HNI A;  3LAK A;  4CHY A;  1EWQ A;  4OPK A;  3AVB A;  5BPN A;  5KPT A;  4E7K A;  3NAE A;  4JLH A;  4CJQ A;  4JRP A;  4Z0U A;  3KWI A;  4XH1 A;  5AQI A;  3OYK A;  3NGI A;  1NGI A;  3AGK A;  1NGF A;  4JS4 A;  1NOY A;  4KAZ A;  2VWB A;  4O5B A;  1QQM A;  3LZI A;  5KTQ A;  4IZ9 A;  1IKW A;  4AHU A;  3BP8 A;  4CJ4 A;  2G8W A;  3OYI A;  4DU3 A;  4DR2 K;  2RHK A;  1UAX A;  2HVH A;  4ILH A;  3AVK A;  1ITG A;  4OVL A;  3JS6 A;  4FJK A;  3ATV A;  3QIC A;  1U6Z A;  4FWO A;  3QEP A;  2Q2R A;  5KRT A;  4C8L A;  4B9V A;  1NGH A;  3AO2 A;  4KBO A;  4AHS A;  3PO4 A;  1VSJ A;  2HNZ A;  3GDQ A;  4O55 A;  3HSC A;  4I9Q A;  2XY8 A;  3M5R A;  4CJK A;  1JLG A;  2P9N B;  1TKT A;  4FWL A;  1RDW X;  3ATU A;  3E9L A;  3LAM A;  4F2R A;  3E01 A;  3MWP A;  4M7Y A;  5HOO A;  3M8S A;  3B6O A;  4YDU C;  5EXW A;  3V9U A;  3LM9 A;  3VGK A;  1BQN A;  1A5X A;  2F8S A;  1QHA A;  2NRR A;  2O8E A;  4IJN A;  3SQ0 A;  4KHU A;  4H03 B;  1OVQ A;  1GLB G;  3QO9 A;  5KQD A;  2P51 A;  4ZHR A;  4QCL A;  1L3U A;  2P9L A;  3DWL A;  1QZ5 A;  3CQX A;  3L0Q A;  3MCA B;  4OX9 K;  2V51 B;  2P9K B;  3AV9 A;  4DV5 K;  4CJ5 A;  4CFD A;  1GLF O;  3S9H A;  3CM6 A;  3H1Q A;  4IDK A;  4JKE A;  5SZT A;  4CZK A;  4WF9 L;  5FPE A;  3RSE B;  2P9S A;  4CGF A;  4RW4 A;  4M3Z A;  5AQQ A;  3B8A X;  1YTA A;  4CEF A;  4ISF A;  4WQ4 A;  4PHT X;  4WFA L;  1HYV A;  5CZ2 A;  3THY A;  2E2P A;  2A41 A;  3E1Y A;  1WLJ A;  3P31 A;  4CD3 A;  4H5W A;  3QET A;  4LF7 K;  1D4X A;  1JCG A;  2VQF K;  5AQM A;  3ULE A;  3FLC O;  2HBJ A;  1HNW K;  1LWF A;  3WNH A;  3QLH A;  3L6Q A;  5CZ1 A;  1HLU A;  4B3O A;  1T6D A;  5AQS A;  4BDP A;  2G8I A;  3BZK A;  2NLX A;  2IDO A;  5AQU A;  5TKY A;  3WXJ A;  1NJW A;  5C42 A;  3CME N;  4FJM A;  1U49 A;  1X9M A;  1JLQ A;  4FWM A;  2NRX A;  3GL1 A;  4CEB A;  3VQ5 A;  4K8Z A;  4YHH K;  1KLN A;  5J2M A;  3UB5 A;  1TUY A;  3AO1 A;  4MLE A;  1TK8 A;  1BOT O;  1ZBI A;  3TAB A;  3OS2 A;  5C25 A;  3SUN A;  4A2B A;  4YFU A;  4GVM A;  4CVN E;  1XNR K;  2B6A A;  4AIL C;  4CED A;  3OS1 A;  4IKF A;  4IWV A;  3OYF A;  1KRP A;  4X65 K;  3IDH A;  4CJS A;  1TAU A;  1JLE A;  4U67 L;  4Z94 A;  2OZM A;  4KRE A;  3RMB A;  4OPA A;  2UXC K;  3SUP A;  3QIN A;  3SQ1 A;  3GOI A;  3VF4 A;  1XC3 A;  2VCP A;  3EN9 A;  3DLH A;  5JVG L;  4M45 A;  4BC4 A;  4OLA A;  3MEE A;  3CQY A;  4W5R A;  1I94 K;  1HKB A;  4IDH A;  2V52 B;  5JS1 A;  3CIP A;  1K6Y A;  1BI4 A;  5C15 A;  3MXM A;  3P38 A;  3H6E A;  2P9U A;  5FPN A;  1L3S A;  3HM8 A;  4AHC A;  4IEE A;  1NLV A;  5AQH A;  1JLC A;  1Q81 O;  2EX3 A;  4H5R A;  1Z6R A;  1DT9 A;  2OZS A;  3J80 O;  4W5Q A;  4TSX A;  1NK6 A;  2KQ2 A;  3J8A A;  3DM2 A;  1HNZ K;  1RDD A;  3OJU A;  2IAJ A;  3A5M C;  3VTI A;  4CBW A;  4YOV A;  4DS4 A;  4XH5 A;  3KK7 A;  2RF2 A;  3PX4 A;  3WXL A;  1W7A A;  1IBK K;  5AQZ A;  5GAE P;  1RT1 A;  3CJB A;  3SAG A;  1WB9 A;  1KLM A;  3O6W A;  2P9I B;  1W97 L;  3L2R A;  4DU4 A;  2DFH A;  1JL2 A;  2KKZ A;  4BY9 C;  4QS8 A;  1RBR A;  3P4I A;  1CXQ A;  2KHO A;  4BWJ A;  5J2P A;  1O1W A;  4WCE L;  2HND A;  4CHP A;  1REV A;  2ZWH A;  3S3N A;  4Z4H A;  3WEE B;  3UKU B;  4DF8 A;  4KHW A;  4RW6 A;  3AA4 A;  3DI6 A;  4FWS A;  2YNH A;  5JMV A;  3SBT A;  3T19 A;  3DRR A;  2HHQ A;  3C95 A;  2FSJ A;  1W9H A;  1DKG D;  4CEC A;  4FWR A;  2O8C B;  4H0O A;  4LD0 A;  3L2Q A;  2QXF A;  3VQQ A;  3A5N C;  1HJO A;  2JWK A;  3C94 A;  3K9K A;  2D0O A;  1M1K O;  2OYQ A;  3DLR A;  3PX0 A;  2A42 A;  5EX5 A;  1BG3 A;  4FJL A;  3CCR N;  2DFE A;  1K8A O;  3NF9 A;  3AA2 A;  4C8M A;  1WSG A;  3ASM A;  5E84 A;  4JI5 K;  3ENH A;  2YJF A;  1HMV A;  3TPQ A;  4CJT A;  2HST A;  2E2N A;  3D2F B;  1RBT A;  1NGA A;  3LDO A;  5FDL A;  5KPZ A;  4KB1 A;  4IG3 A;  5FPM A;  3EL2 A;  4DQS A;  3ZYY X;  1KFD A;  3K2P A;  3MEG A;  3OBY A;  4BAC A;  1U2V B;  3ZEU B;  5F0X A;  5GIO A;  3M8Q A;  3NDK A;  3CQ8 A;  4BE2 A;  4FM0 A;  2XRI A;  4FK4 A;  3C0B A;  3CCV N;  2Z1I A;  3VA0 A;  4BRE A;  4BRH A;  4O8K A;  4CBU A;  3BF1 A;  3AVF A;  4JI4 K;  2O8F B;  2UUB K;  3ZSV A;  3WQU A;  2IOC A;  3C6H A;  4DR3 K;  4I6M A;  3CC4 N;  2YNF A;  3IKM A;  1S72 N;  4RTF D;  2PYL A;  1WSF A;  3K9J A;  2HVI A;  3ENO A;  3I8B A;  3VPZ A;  5AQF A;  2QI2 A;  4CGH A;  1YXQ A;  1VQ7 N;  1OH6 A;  1RFQ A;  3SUQ A;  2UXD K;  1QE1 A;  3D6R A;  2OPP A;  4FOI A;  4BE1 A;  3CYM A;  5DMR A;  1VRU A;  1BCM A;  3KZB A;  2OA8 A;  2XY7 A;  4PQU A;  1MA9 B;  3ZSR A;  2QKK A;  3O9T A;  3CD6 N;  1XUP O;  4FWQ A;  4NYF A;  4FWN A;  5F1X A;  5AZI A;  2KFZ A;  1L5U A;  1IG8 A;  4NYN A;  4BGA A;  2JGU A;  4K43 A;  1B9F A;  3BEX A;  2WTU A;  5I42 A;  4BWM A;  5BN9 A;  1GOC A;  3CMA N;  2HHH K;  3VQ4 A;  4E1M A;  3EYZ A;  4FLZ A;  3KHY A;  4DSE A;  3EY1 A;  5BRH A;  4BRM A;  3MAQ A;  2WON A;  4BR5 A;  1ZYQ A;  5BR8 K;  4IO9 L;  4ELT A;  4W5T A;  3OYE A;  1QVG M;  4O0J A;  1Z25 A;  4CJL A;  4CZG A;  3HP6 A;  4NCA A;  1SL0 A;  5HRR A;  1YJ9 N;  3HP9 A;  4KH6 A;  4C8O A;  1GLL O;  3HYF A;  3EZ5 A;  2V7Z A;  3I56 N;  2WC9 A;  4IOC L;  4JN4 A;  3O5B A;  4DV7 K;  1YI2 N;  5EU7 A;  3TTD A;  2Q1N A;  2ASM A;  4MQ3 A;  4BRK A;  4EZ9 A;  3TWH A;  2FF3 B;  3PV8 A;  2IVP A;  4DTU A;  1TAQ A;  2NUB A;  1N34 K;  2GEM A;  5J2Q A;  2F7T A;  3VA3 A;  4CZI A;  3FFK B;  5CE3 A;  2VQE K;  3AVA A;  2P9P B;  5BPM A;  3VEN A;  3H1V X;  3KK1 A;  4DTM A;  5EVZ A;  3QER A;  2QWR A;  3QNN A;  3L4Q A;  4J2B A;  3EZW A;  3MMV A;  1C6V A;  2EWS A;  4B3T K;  2CGL A;  3LAL A;  3O9R A;  3KWG A;  2Z1J A;  3CET A;  3ZET B;  4AQY K;  4JRQ A;  3JXU A;  1QQN A;  2FSK A;  3KLH A;  1WBB A;  3KKR A;  1VQL N;  4JI0 K;  4FL9 A;  4DQ8 A;  4BRD A;  3L3U A;  4G1Q A;  5I9E B;  4HUF A;  1X9S A;  4I9L A;  3OYN A;  2O4I A;  2YHA A;  4CK2 A;  1X3M A;  2D0P A;  4BE0 A;  5AZJ B;  4I7F A;  2PZS A;  4LF6 K;  4QOZ B;  3O9Q A;  4EIA A;  5M1Q A;  4QS7 A;  4DV0 K;  3HPO A;  1ESV A;  3THX B;  4CF1 A;  4CJU A;  4YDU A;  3P1G A;  4FLY A;  3O3G A;  5BRD A;  2ASP A;  3HBT A;  3HI0 A;  1I39 A;  3U3G A;  3MED A;  4CEO A;  2W40 A;  4ELU A;  3A8Y A;  3A5O C;  3L3V A;  4JS5 A;  5KRS A;  4K0K K;  3TR8 A;  2PFU A;  4DTO A;  2A6A A;  4JKC A;  3OS0 A;  4FW1 A;  4RCH A;  1R59 O;  3ZX0 A;  4KTQ A;  1HYS A;  2BUP A;  4IOX A;  2O4G A;  2QK9 A;  1VQK N;  2OCE A;  1IBM K;  3MN5 A;  4CZF A;  5E26 A;  3IAY A;  3AA3 A;  4B9U A;  5HRP A;  4HVJ A;  1NK4 A;  2F8T A;  3NE6 A;  3SCX A;  1S22 A;  1JKH A;  1JLA A;  4C1N I;  1HX1 A;  3RWU A;  1VQ4 N;  3H08 A;  3K0S A;  2QXL A;  1K8K A;  3VQD A;  4B1X B;  2OAN A;  1NGD A;  3HZ6 A;  3CG7 A;  1N6Q A;  1KTQ A;  3ZSX A;  3OYA A;  1RIL A;  2GX9 A;  1MWM A;  3BF3 A;  4GV9 A;  1KAZ A;  3ID6 A;  3SMS A;  2O8D A;  4YOY A;  1LAV A;  2FBV A;  1KAY A;  4BRN A;  4JYA K;  4M42 A;  3K59 A;  4M3W A;  2XY6 A;  1CXU A;  3O4W A;  1DEJ A;  4X64 K;  3K5M A;  1JCE A;  4FJ7 A;  3UKR B;  4FJI A;  4KPY A;  3O1B A;  1FJG K;  2F9W A;  4Z4F A;  4LSN A;  2HF4 A;  5BRF A;  3E9O A;  2YI1 A;  1Q86 O;  4E7J A;  1FXX A;  3PIP L;  3HST B;  2QTD A;  4BR9 A;  4RW7 A;  5AQT A;  3RMD A;  2O8B A;  2BGG A;  3NF8 A;  3CCU N;  3DXK B;  3LL3 A;  3L2U A;  3KKS A;  3NGZ A;  4FJX A;  4LH5 A;  5M1P A;  1YVU A;  2I5J A;  4B3R K;  2GEL A;  4FJN A;  3AA5 X;  4W5O A;  3EKU A;  1EET A;  1SS6 A;  4B1Z A;  2BE2 A;  2I7P A;  5C2F A;  4FLU A;  1XHX A;  1TGO A;  4CI6 A;  4CHQ A;  2G8V A;  1V4S A;  5EOY A;  5AFU H;  3TU5 A;  5M1K A;  1J5O A;  1S5J A;  1JCF A;  5HL7 L;  4B08 A;  2VG5 A;  1GLJ O;  4RW8 A;  2GTD A;  2P5G A;  4B9Q A;  4CZM A;  4ZTJ A;  5KGW A;  4BG9 A;  4H5T A;  4B9S A;  2CGJ A;  1RTD A;  4KHY A;  4CZE A;  3ZSQ A;  2KW4 A;  4A59 A;  1ASU A;  3SJJ A;  1XHZ A;  4AH9 A;  3FZK A;  1T05 A;  4HCC A;  2YX6 A;  2ETJ A;  2NRT A;  4DG1 A;  5GAD P;  1BDG A;  3TAN A;  4AHR A;  2X6N A;  4E7L A;  1VSH A;  1NBW A;  2FSN A;  4DU1 A;  2VWJ A;  3L4I A;  2HHV A;  5GAH P;  2E6M A;  3NVM A;  2ZJQ L;  5AQO A;  1Q9Y A;  1WAF A;  1E4G T;  3V9Z A;  2KTQ A;  4JI8 K;  1D9F A;  4PKG A;  4BRI A;  1RDB A;  1IO2 A;  4JHD B;  3JSM A;  1WOQ A;  4A5A A;  4DTS A;  1C0F A;  3ALY A;  3HRG A;  2ZQB A;  4IFV A;  1WAJ A;  1X3N A;  2ZF5 O;  4BR4 A;  2Q97 A;  3V4I A;  4LFB K;  2PBD A;  3ZLJ A;  3GBT A;  2Q0R A;  1BIS A;  2VG7 A;  1KVB A;  2LSN A;  3M8P A;  1S3X A;  4CJP A;  2E2Q A;  3HK2 A;  1HUX A;  3MCP A;  3AVH A;  5K14 A;  2VG6 A;  4FLW A;  4E89 A;  4H0P A;  1U48 A;  3FGU A;  4W5N A;  4FJG A;  2YHB A;  1YIJ N;  3IRX A;  4B9M A;  4K41 A;  1XC9 A;  1Q7Y O;  5H1S Q;  4GV3 A;  1JL1 A;  3FFI A;  3VF2 A;  3SQ2 A;  3OYJ A;  3QIP A;  3N4Q A;  4BQL A;  3TAR A;  3SAH A;  3CC2 N;  1IH7 A;  1S1T A;  3V1Q A;  2Z1G A;  1Z26 A;  4NCG A;  4DB3 A;  2IS3 A;  4JKG B;  1LOT B;  4F2S A;  5GIN A;  4V19 S;  3AGR A;  1BHL A;  1QQO A;  4K42 A;  1MU2 A;  3EE9 A;  5LJW A;  4H4M A;  3ISN C;  2BTF A;  3NFA A;  3EEQ A;  4PWD A;  4B1Y B;  4AHT A;  1VQ9 N;  3W3D A;  3J7A P;  4F8R A;  1Y64 A;  4CHZ A;  3P39 A;  3E66 A;  1VQ6 N;  3HPH A;  2HB5 A;  3THW B;  2YV0 X;  1V4T A;  4LFA K;  1LWC A;  4DSK A;  3HXM A;  4DMN A;  1SQK A;  4OKK A;  4DFJ A;  3CFR A;  1RGI A;  1NU0 A;  4WE1 A;  3O9S A;  1YTU A;  1NGJ A;  4F4K A;  3MWT A;  5HBM A;  4DSJ A;  2AA4 A;  4WYB A;  5MLC Q;  4HTU A;  5KI6 A;  2E4L A;  4HUG A;  3C7N B;  4CJW A;  3I55 N;  4M3T A;  3LM2 A;  4AHV A;  3VN5 A;  2QWL A;  3RMA A;  3DLE A;  1DTT A;  3O3F A;  4PKI A;  1Q82 O;  5AQX A;  4FJ9 A;  1HYZ A;  1OVY A;  5CY4 A;  1E4F T;  5A2Q O;  1B92 A;  3C6A A;  1DLO A;  3N4P A;  3CER A;  3VQ6 A;  5FRN A;  2W41 A;  3SAF A;  2AP1 A;  4X66 K;  1TKD A;  1K9M O;  2JWL A;  2ZGY A;  3OYB A;  4DKW A;  4Y1D A;  1SUQ A;  3J81 O;  4JD2 B;  4C8N A;  4KHN A;  1S1V A;  4CIE A;  3DXM A;  4CGJ A;  4FJ5 A;  3U9D A;  3QES A;  1EKE A;  3AAQ A;  4OLB A;  1T44 A;  2UUA K;  4CE9 A;  3CJ1 A;  4R79 A;  3O80 A;  4C8K A;  1VQO N;  2IVO A;  2YKM A;  1TV6 A;  3NH1 A;  3D0P A;  4UQG A;  3PX6 A;  1NGB A;  1VSL A;  3TSU A;  3EE8 A;  1QSL A;  4YOR A;  1SZ2 A;  3KK2 A;  5JLH A;  3CCM N;  1TYQ A;  4J8F A;  3SJH A;  2Q3S A;  4JAX A;  3ZT1 A;  1SL1 A;  4BRP A;  3HT3 A;  3OW2 M;  4DTX A;  3OYC A;  4GKK K;  2QW9 A;  4J2D A;  3VEW A;  1OH5 A;  4K8X A;  4WQ5 A;  1WSE A;  1H1V A;  1JLB A;  4FVM A;  4RWT A;  4BDZ A;  1EWR A;  4QS9 A;  3MX2 A;  4KTZ A;  5KGX A;  3QFU A;  4I2Q A;  4M7X A;  3VF6 A;  4WFB L;  2A1R A;  2B5J A;  1WSH A;  3QEX A;  1KQS M;  4JI1 K;  4KI4 A;  1FKP A;  3CCS N;  4FZX C;  4X62 K;  3M3Z A;  1HJR A;  4DV1 K;  2XY5 A;  1U47 A;  4FJH A;  2CGK A;  3P83 D;  5FLX O;  4EHU A;  1J5E K;  2X6S A;  4CER A;  3QBW A;  2O8E B;  2E5L K;  1CZ9 A;  1KCF A;  1JXB A;  3ZSO A;  3RR7 A;  2BH1 A;  2E1Y A;  3PSF A;  4ELV A;  2HF3 A;  3CCQ N;  2P9L B;  4GVE A;  2FBT A;  3MK6 A;  4GNI A;  2QWN A;  4Y0W A;  3SLC A;  4YNQ A;  1NWK A;  4N5S A;  1XMO K;  4XH4 A;  3S3M A;  4FJJ A;  3FZF A;  4FM2 A;  2G8F A;  3FR0 A;  1S6Q A;  1BQM A;  3TSP A;  2HHX A;  1S6P A;  1BIU A;  3KTQ A;  1SAZ A;  3ZT2 A;  1ATR A;  1OKJ A;  1NGE A;  4M3X A;  4FWK A;  4LF4 K;  4OKE A;  1RDU A;  2OPS A;  4FZZ A;  2P1J A;  3TI0 A;  1VQ5 N;  3SMP A;  2P9S B;  1VQP N;  3TTC A;  4Z4I A;  4DQR A;  1LV5 A;  2BAN A;  2GUI A;  3TAM A;  4FYD A;  4DSI A;  2DPN A;  3G10 A;  4YY3 K;  2HHT A;  4DFM A;  1RNH A;  4HHT A;  2HHW A;  4A2A A;  3PO5 A;  3H3N O;  3NF6 A;  5LJV A;  3NVK A;  3THY B;  3OY9 A;  2NRH A;  3BZC A;  2NRW A;  1Q18 A;  1D8Y A;  3ULE B;  1YIT N;  5JVH L;  3NBP A;  4A62 A;  5ADX H;  1N5Y A;  4I2P A;  5J2N A;  4CES A;  4H0T B;  2H3G X;  3VQA A;  4NB4 A;  1IV0 A;  4DTN A;  5M1N A;  1ASV A;  3DOK A;  2KLA A;  1BO5 O;  4B8C A;  4Z4E A;  2XHB A;  4BQZ A;  3DMJ A;  4EP4 A;  1HR0 K;  4A61 A;  3AAR A;  4FM1 A;  3D2E A;  4JKB A;  3SNN A;  4JKA A;  1OH8 A;  1ZBS A;  4KO0 A;  4J2E A;  4H8K A;  4CK1 A;  3K5L A;  3AO3 A;  3O4Q A;  2D0A A;  4ZTF A;  1TK5 A;  3AVC A;  1CLQ A;  3VQ8 A;  4OGE A;  4DS5 A;  1GOA A;  3VEY A;  2I7N A;  3BGR A;  5CYQ A;  4ISG A;  1KC8 O;  4OGC A;  3WXI A;  3NF7 A;  3AVL A;  2DTU A;  3T1Y K;  3C6T A;  1WUA A;  4JK8 A;  3A2F A;  3P5J A;  4PUO A;  2D4W A;  1OH7 A;  5AQJ A;  1U4B A;  3IG1 A;  3TAG A;  3CC7 N;  4WQ5 C;  2WFB A;  4M3U A;  3L2V A;  4FPB A;  4QAG A;  1NKE A;  3WNG A;  4CK3 A;  4FVU A;  1BI4 B;  4L8R B;  4Y1C A;  5AJ3 K;  3WXK A;  1YJW N;  4PL8 A;  2P9U B;  2WUS A;  3DAW A;  4ISE A;  5ELZ A;  2P9N A;  4BR0 A;  2A40 A;  3MDQ A;  2OTJ N;  4BC3 A;  4B8A B;  1NNE A;  1LAW A;  5C0Y A;  3QEI A;  3GE1 A;  4GV6 A;  3G0Z A;  3CJA A;  4H4O A;  4Z4G A;  3M1F A;  3ULD A;  1VQN N;  3O8M A;  4IXC A;  3ZX2 A;  3NHG A;  3PY8 A;  3SQ4 A;  3K57 A;  1RT7 A;  4MDB A;  4KRF A;  1QS4 A;  2YNI A;  4DV3 K;  3SPZ A;  4LF8 K;  3ENB A;  4E7H A;  3CI5 A;  4K25 A;  1KXP A;  2P9K A;  4KHP K;  3K5N A;  4LSL A;  1RTH A;  1RT2 A;  1A5W A;  1KVA A;  4E1N A;  4FCY A;  2HW3 A;  2YHY A;  2NRZ A;  4YOU A;  3RSE A;  4DR6 K;  1S9E A;  5BN8 A;  4E0D A;  5HRN A;  2E88 A;  5TKW A;  3HPG A;  1NMN A;  4LY7 A;  2D0C A;  4O4G A;  5AQL A;  3MN7 A;  1NJZ A;  1VAZ A;  4JK9 A;  3NCI A;  3QFP A;  1LCU A;  4CJF A;  4GY2 B;  4CHN A;  2B4J A;  1KD1 O;  2A1S A;  4CW7 B;  2YCH A;  3CHW A;  3M6G A;  4KB0 A;  2QWM A;  4Q5V A;  1TKZ A;  3VES A;  3NGY A;  1N33 K;  3T1A A;  3V1R A;  3OBW A;  4FJ8 A;  4ILG B;  2OPR A;  4DSL A;  3V81 A;  5DK5 A;  5FRM A;  4DSF A;  1VSM A;  1GLE G;  3DOL A;  2YHW A;  3AVN A;  1HNV A;  2YJE A;  3U3Y A;  2YNG A;  1NK7 A;  2R7Y A;  1S1U A;  2QWQ A;  4JK7 A;  1QSY A;  1QSS A;  1L3T A;  1YVN A;  3KLI A;  3NH2 A;  4CF8 A;  4DHY A;  2UUC K;  1KAX A;  2HBL A;  1J9A A;  3AVG A;  5C24 A;  1ASW A;  3IUC A;  3K58 A;  3V6D A;  4CFA A;  1UA1 A;  1CZA N;  4HTL A;  4N76 A;  1UWB A;  2IIR A;  1QZ6 A;  1QTM A;  4AF1 A;  3LDL A;  1T3V A;  2E1Z A;  4CF9 A;  4KH4 A;  4GMJ B;  1Q9X A;  4WFN L;  4CIG A;  1O13 A;  3ZT4 A;  1GOB A;  1TL3 A;  5AQY A;  3QBX A;  3ZSZ A;  2E20 A;  4JKF A;  1N8R O;  3OYM A;  3QML A;  4BC5 A;  3TTF A;  4O0I A;  3KD1 E;  3F9M A;  1NGC A;  2DY4 A;  5M1F A;  1GLC G;  3LPT A;  4I6M B;  4KKO A;  1T6C A;  4BRQ A;  3T1H K;  4ID5 A;  3AVJ A;  1Y97 A;  1EX4 A;  3VQC A;  1J6Z A;  3VTH A;  1NJX A;  2XO7 A;  1NK5 A;  1XQS C;  1HRH A;  3B6P A;  4IG0 A;  1RTI A;  3VER A;  5M1O A;  1KVC A;  4OJR A;  3HOT A;  2YHX A;  2Y1J A;  1A5V A;  4XIU A;  1HPM A;  4IOA L;  5AFU A;  1DGK N;  4IEI A;  5AZI B;  3MEC A;  4KH5 A;  2NZT A;  3VQ9 A;  3H46 O;  1LWE A;  1BA1 A;  3AVM A;  4G9Z A;  2FLO A;  4DLG A;  1HQE A;  3R8E A;  3NMU A;  3LDP A;  3PUF A;  3WT0 A;  3ZT0 A;  2P9I A;  1RT4 A;  4CFC A;  3G6E N;  1KSP A;  3DRP A;  1RBV A;  4YOW A;  4O8U A;  5E41 A;  2G8U A;  4M63 C;  4HCB A;  3QIO A;  3K5O A;  2KZM A;  1R0A A;  1BA0 A;  3ZSW A;  4B1U B;  2WBN A;  3WEE A;  3UKU A;  4CEE A;  3ID8 A;  4KV8 A;  4ICL A;  4DTJ A;  3AO5 A;  4GKJ K;  5IWA K;  4ID1 A;  4H5N A;  1MDU B;  3MXJ A;  3G25 A;  1WSI A;  2ZJP L;  3TAE A;  4EP5 A;  3OYG A;  2DFF A;  3ZX3 A;  3E9P A;  4MO5 A;  4BG8 A;  1LW2 A;  5AQK A;  2KZZ A;  3VQE A;  4AM6 A;  3VQB A;  2O8C A;  3IMX A;  1ATN A;  1NK8 A;  1UA0 A;  1NM1 A;  3EO3 A;  1VSF A;  4IBN A;  3U8X A;  2P5O A;  4OO1 J;  2VGM A;  3RTV A;  4M41 A;  3G4S N;  4MO4 A;  1UOC A;  5GAG P;  5SWM A;  1WSJ A;  4CEQ A;  4DF4 A;  4EHT A;  1IKY A;  2E6L A;  4N47 A;  4CFB A;  4DFK A;  4B1V A;  5LMU K;  3CFO A;  4H0V B;  1TUU A;  3Q7B A;  3D2F A;  2ASO A;  2OTL N;  4FOE A;  2D1K A;  4NLC A;  3HTV A;  2X74 A;  4Z4C A;  5HLF A;  1RT5 A;  4B3S K;  3U4L A;  3FZL A;  2NNW A;  1BWF O;  1U2V A;  3DLL L;  2HHS A;  1B9D A;  3ZEU A;  1XMQ K;  3F73 A;  4CJV A;  1IKX A;  2PYJ A;  3PSI A;  2Z1H A;  2G8H A;  2ITG A;  4FSV A;  3I33 A;  1NOZ A;  2HMP A;  2HNY A;  1WN7 A;  4DR7 K;  3FZM A;  3RVC A;  3OYL A;  2O8F A;  4O44 A;  1YAG A;  5HRO A;  4JI3 K;  2RPI A;  1IKV A;  1YHQ N;  5J1E A;  1F21 A;  1XWL A;  5T7B A;  3CFP A;  4YOT A;  1Z05 A;  3MN9 A;  3LWL A;  2ITM A;  3O1W A;  2UU9 K;  4F3O A;  5I3U A;  3KLG A;  3HJF A;  1SL2 A;  3HM9 A;  3SI6 A;  1JJ2 M;  3SPY A;  5BRE A;  3J7Z O;  3OYH A;  1WNS A;  1HKC A;  1RCH A;  4C1N K;  3HL8 A;  3SBG A;  3R6M A;  4EZ6 A;  4R5P A;  3ZCM A;  3OJS A;  3QEW A;  3OTO K;  5AR0 A;  2W6L A;  3LZJ A;  1VQM N;  2G8K A;  4MDA A;  4BRO A;  1K8K B;  3F5T A;  2FC0 A;  2WOM A;  3O08 A;  2OPQ A;  4DQI A;  4DR4 K;  4L3Q A;  1ZBH A;  1C0U A;  3I0S A;  1ZXO A;  2Q0U A;  2Q31 A;  3CJC A;  4FLT A;  2O8D B;  2EHG A;  4LC9 B;  3PLA A;  3NH0 A;  4PKH A;  1P90 A;  2ZGZ A;  4NXM K;  1E3M A;  1NJI O;  3M8R A;  2QA4 N;  3JYT A;  1VSI A;  1VSE A;  4IFE A;  4PA1 A;  5IT9 O;  4CGG A;  3S3O A;  3HOS A;  3S41 A;  1EO1 A;  3CPE A;  5JS2 A;  3TAF A;  4CZL A;  5DM6 L;  4C23 A;  5C2D A;  4FPA A;  3AO4 A;  2VYP A;  3F9K A;  1YJN N;  1BGX T;  2O8B B;  4CJ3 A;  1QVF M; 
#chains in the Genus database with same CATH homology
 5BR8 K;  4JI7 K;  1XMQ K;  1HNX K;  3J7A P;  4DR1 K;  4LF5 K;  4LFC K;  4LFA K;  4JI5 K;  1I94 K;  4OX9 K;  4LF9 K;  1IBM K;  4B3M K;  4DR7 K;  4JI1 K;  4CW7 B;  3J7Y P;  4DV5 K;  4DV7 K;  4X62 K;  1N36 K;  4JI3 K;  4DV1 K;  1N33 K;  4DUZ K;  3T1Y K;  5FLX O;  5LMN K;  1J5E K;  1N34 K;  2E5L K;  3J80 O;  2UU9 K;  2UXB K;  2VQE K;  1HNZ K;  1XMO K;  4JI8 K;  3JAM O;  4JYA K;  4JI4 K;  4DV6 K;  5A2Q O;  2UUC K;  4B3T K;  4LF7 K;  2UUB K;  4JV5 K;  1IBK K;  4GKJ K;  2F4V K;  4AQY K;  5AJ3 K;  5IWA K;  2VQF K;  4DR2 K;  4JI6 K;  4DV4 K;  3OTO K;  4X66 K;  4DR3 K;  4X64 K;  4DR5 K;  4LF4 K;  1HNW K;  4JI2 K;  4LFB K;  1FJG K;  3J81 O;  4JI0 K;  4DR4 K;  2UXD K;  4YY3 K;  1XNQ K;  2UUA K;  4NXN K;  4DUY K;  4DV3 K;  4YHH K;  4B3R K;  5LL6 Z;  4NXM K;  4LF6 K;  1IBL K;  4DV0 K;  4LF8 K;  1N32 K;  4DV2 K;  4CVN E;  5LMU K;  3T1H K;  1XNR K;  4KHP K;  5IT9 O;  4X65 K;  2HHH K;  4V19 S;  2UXC K;  4B3S K;  1HR0 K;  4DR6 K;  2ZM6 K;  4GKK K;  4K0K K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...