4JYAK

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4jyaK00
4DR4K 4DV6K 1HNWK 1N33K 1FJGK 4JI1K 1HNXK 3JAMO 2UXBK 1J5EK 4NXMK 4JI7K 4LFCK 1N32K 4X65K 4LF7K 4JV5K 4JYAK 1N36K 1XMOK 4JI4K 4YHHK 4LF5K 5IWAK 2UUAK 5LMNK 1HNZK 4GKKK 3T1YK 1IBKK 1IBLK 4DUYK 4X66K 4YY3K 2UXCK 4CVNE 5LL6Z 4DR7K 4AQYK 4NXNK 4DR5K 4OX9K 4GKJK 4DR3K 4X64K 5BR8K 1I94K 4DV5K 4B3RK 5A2QO 4LF8K 4JI3K 4DR6K 3J80O 4CW7B 4DR2K 4B3TK 4DR1K 3J7YP 4DV0K 2UXDK 2UUCK 4DV3K 1XMQK 4JI5K 1N34K 2E5LK 3J7AP 2VQEK 4JI0K 2VQFK 4JI8K 4V19S 4DV1K 1XNRK 4LF9K 4JI6K 3OTOK 1IBMK 2HHHK 4LF6K 4LF4K 5FLXO 1HR0K 2F4VK 4DUZK 3J81O 4DV2K 2UUBK 5LMUK 2UU9K 5IT9O 4X62K 4DV4K 4B3MK 4B3SK 4KHPK 3T1HK 4K0KK 4LFBK 4DV7K 4JI2K 2ZM6K 1XNQK 4LFAK 5AJ3K
chains in the Genus database with same CATH superfamily
5E26A 3PO4A 1KAZA 4CJFA 3LDSA 4O0JA 3GDQA 3PY8A 1W97L 4PL7A 3SJHA 2DPNA 4WQ4A 3PO5A 2O8BA 2FSKA 4B8CA 4BQLA 3CCSN 1N32K 3OY9A 1WSGA 3IUCA 3S3MA 1I3AA 3NGYA 4FWNA 3CFPA 2P9NB 3DWLA 4H4MA 3SAHA 4F2SA 3SJJA 3V1QA 4BRKA 2VWKA 1KLNA 4BG9A 3ENBA 2PFUA 3HVRA 4ILGB 1RDCA 1VSMA 3VQ6A 4DTXA 3QINA 1JXEA 4FYDA 5TKWA 1NK9A 2E88A 3ZCMA 3V9UA 1RGIA 5ADXH 4JEPA 1D4XA 3DRPA 4LF8K 1JJ2M 4JS4A 3LDNA 2WOMA 1KLMA 4B9LA 1K8KB 4JI3K 4CF0A 4BRLA 5AQFA 3G0ZA 4CFCA 3ZT1A 3EZWA 1CZ9A 1BWFO 1E4FT 4B3OA 1SKRA 3IDHA 5D3GA 4J2BA 1HNVA 4KI4A 4IFYA 4DSEA 3RSEA 2UUCK 1IKWA 1XMQK 2ASMA 1C1CA 2A6AA 3IMXA 1O13A 3SQ4A 1S1XA 3VEYA 1RBRA 1XNRK 1G15A 4IZ9A 1IBMK 5FLXO 4FPBA 4IDHA 4B1YB 1Z05A 4CHQA 5HBMA 2P9UA 4X62K 4CZFA 1T03A 2F9WA 4B3MK 1H1VA 4N47A 3ZT4A 1VQMN 1B9DA 1BHLA 1OH8A 4E7LA 4QCLA 2RF2A 1GLDG 4CZKA 4R79A 4M3RA 4ILJA 5AQKA 1FJGK 4YOXA 2P9UB 4BRCA 3HM9A 3K59A 1HNIA 4PUOA 2VWBA 2UXBK 4FZZA 1BUPA 3RMCA 1VQON 1NK4A 1OVQA 4JV5K 4JYAK 1JCEA 3SPZA 3NH0A 3AO5A 1SL2A 2NRXA 2YKMA 3VTHA 5AFUA 4YHHK 1JLQA 5GAHP 4Z4IA 5M1PA 3WNGA 3AAQA 2W6LA 4KH4A 4W5QA 3NGZA 3OJSA 3U9ZA 3LP1A 1ZBIA 1EETA 2GWKA 2I7PA 5AZJB 3C7NA 2ZJRL 4DTMA 4H8KA 2DFFA 3HOSA 4DS4A 2A1SA 4DR5K 2G8FA 1RCHA 3VQEA 4E19A 1FKOA 4CJLA 4O0IA 1X9SA 4CJRA 3EY1A 3LWMA 2HHXA 2YX6A 5C25A 4Z4CA 4FLWA 3M8PA 2DTUA 3TARA 4ZTJA 1KVAA 5AQVA 1S72N 1TYQA 2ZWHA 4E7HA 1S3XA 3K5OA 4JKEA 2YCHA 4CJ7A 1XWLA 1JCFA 1E3MA 4B9VA 1DGKN 4LF9K 3ZSWA 2GUIA 4DG1A 4B9MA 2GEMA 3WUHA 3MN9A 3EKUA 1RDUA 4AHVA 3R9PA 1BL3A 3AA5X 4CJTA 1SZ2A 3CCEN 3HK2A 4KHPK 5GIPA 4JKAA 2FBXA 5KTQA 2ZM6K 1XNQK 4H5WA 3L2WA 2V52B 4L8RB 4CHOA 4DR4K 3LM2A 4OO1J 1KAYA 4FJ9A 3ZX3A 1EQYA 3OYJA 3ZETB 4RW7A 3JAMO 1UAXA 4KB0A 4M7YA 3PIOL 2AJQA 3BZCA 3VQDA 1WSIA 4YDUA 4KTQA 1LWCA 3BDPA 1WUAA 1N36K 3KK7A 2F96A 1N8RO 5BRFA 3THVA 1KSPA 4EP5A 1TUYA 1HJRA 4KHNA 5HRRA 4AHTA 4ELUA 3SQ1A 3LDPA 4CVNE 2VCPA 3SCXA 5LL6Z 1DLOA 1VSKA 2QWNA 2Y1JA 3RMAA 4DTRA 5AQXA 3VOVA 2J4RA 2P9KB 2Z1IA 2P9PB 2CH6A 4F3OA 2X6SA 4LC9B 5BR8K 3QNNA 1I94K 2VG7A 3VMFB 4J2EA 4WCEL 4ID1A 2OZMA 1REVA 2DFEA 1X3NA 4E3SA 2I7NA 5FROA 3JXUA 5HRPA 3TI0A 1WSFA 1VRTA 1RTDA 3WNEA 4DR6K 5T7BA 3LWLA 5AZIB 4CEBA 3LDOA 3OS1A 1WSEA 3GOIA 4CZHA 3K57A 1SL0A 4Y0WA 4LH4A 2D0OA 2HNYA 2VQFK 4FCYA 2G8KA 1HYSA 4W5RA 2QTDA 3EL2A 5FPEA 3HBTA 1NBWA 3AVIA 5HL7L 4BGBA 3OTOK 5M1FA 1K8KA 4I7FA 4OJRA 3ATUA 5CE3A 3B6PA 1KRPA 5CZ1A 1VK0A 3BUZB 3CCRN 4RW9A 4N41A 3ATVA 4BC5A 4K0KK 3DLGA 3ENOA 1TKXA 4DV7K 4Z0UA 5J2MA 3CM6A 2ATQA 3ZT0A 5CHIA 1T05A 3KTQA 2ZQBA 2Z1HA 3DI6A 4HCCA 2HHSA 2E1ZA 2CGJA 1NKCA 4H5RA 1U49A 3CI5A 4FJXA 4DU3A 3NFAA 4E1NA 2IVPA 2OANA 5AQLA 5F1XA 2P9LA 1J5EK 1QQOA 3HJFA 1XUPO 1SV5A 1U2VA 1DTQA 5C24A 4I2PA 1JLAA 3NAEA 5FDLA 5EX5A 4HHTA 2ITGA 3MXIA 3U8XA 2E8AA 1ATSA 2BTFA 5JMVA 4E7JA 4BR5A 5EVZA 3VGLA 3D7EO 4JD2B 3BEXA 4CZMA 5I9EB 1NGFA 1Q8IA 3M8RA 1NM1A 1NWKA 3VGMA 1U48A 1NMDA 4MLEA 4AQYK 4XH4A 3OYFA 4BC4A 2HMPA 4BRMA 2NRRA 2QA4N 1NKEA 3IRXA 4NCGA 3HP9A 3ZEUA 3M1FA 2Q97A 3THWA 4OPHA 2VWJA 1NG9A 2OTLN 4GVMA 1XC9A 2A41A 1G99A 3CXCM 3QEWA 4DTOA 3G25A 3SMPA 2E4LA 3DOKA 4RW4A 1YVNA 2FXUA 1N5YA 1T3VA 3I33A 4DQSA 1BDGA 3HOTA 3VEOA 3SYZA 2NUBA 3OVNA 3MK6A 4G1QA 4JI0K 3E9PA 3O9UA 4YOVA 2DY4A 5I42A 4CD1A 3CMEN 3TTCA 4IBNA 1J6ZA 3ZEUB 3ZSZA 4M3UA 2YNIA 2EHGA 1NJZA 4DTNA 4KO0A 1BCMA 3OYCA 1V4TA 4LSNA 4CGGA 3NH1A 4FLTA 1KVBA 4F3TA 2JWLA 2D5RA 2ZJPL 3DLKA 5C2DA 3SZ2A 3FFKB 1S9EA 4XH5A 4GVEA 4F8RA 2QK9A 4IEIA 3DLRA 4IOAL 2UYTA 3MN7A 3FLCO 4C23A 5JICA 4E7KA 3A0IX 3FZMA 3RR8A 3BF1A 2W41A 2QXFA 4DQQA 4FWQA 3JSMA 4A2AA 2W40A 1FKPA 4H03B 2VGMA 3SMSA 2E2OA 1Q9YA 4WF9L 4EIAA 1U2VB 3HM8A 2BUPA 3L6QA 4FWLA 5IWAK 3JYTA 1RFQA 1VSIA 1MA9B 5FPMA 4DSLA 4C1NK 4ID5A 1IBLK 3J7ZO 3T3FA 1VSFA 4FW1A 4DF8A 5SZTA 3PX4A 2KZMA 1SKSA 1TKDA 4CEOA 5TKYA 3Q7CA 3TTFA 4DLEA 4OX9K 3OYMA 4LD0A 3BZKA 4MO5A 4CEAA 4QAGA 3O1WA 1TKZA 2W6KA 3CYMA 5EY4A 4O8UA 2D0CA 3D0PA 5HRNA 2E2QA 3CF5L 2Q0RA 2GWJA 1LW2A 1HX1A 4AH9A 4FXDA 2QM1A 1X9JA 4LH5A 4BWJA 4CFBA 4FM1A 3J80O 2JLEA 3MX5A 3O08A 3H46O 4B3TK 4PKGA 3EO3A 2QW9A 3EN9A 3O3HA 2QWPA 2OTJN 1D9DA 3V4IA 3VQ7A 1GLFO 2QWMA 5CYMA 4DV3K 4JKGA 4A59A 1EWRA 2E5LK 2E2NA 1SAZA 3LP2A 1P90A 2RE2A 2Q0UA 5AZIA 2HBJA 4V19S 3QO9A 4AM7A 1T7PA 3KKSA 3AVFA 3I8DA 5AQSA 1EP4A 1S6PA 4AILC 1B92A 4CHYA 3DXMA 2YHAA 3LPUA 1B9FA 4IWVA 1NGBA 3V9XA 2UU9K 5KPRA 4CEQA 4RWTA 1VHXA 4BVOA 4CECA 3AVNA 1K9MO 4U67L 1HYZA 2O8FA 3O9SA 4K8ZA 4FJLA 3O3FA 5AJ3K 1IKVA 1CXQA 1C0MA 4CGJA 1HNWK 4N56A 4KFBA 5AQJA 3HP6A 1RBVA 1A5VA 3AVGA 1TV6A 3TAFA 1OH6A 3C65A 1S9GA 4JI7K 2HOEA 3MCAB 4DU4A 1ZC6A 1JXBA 5AQNA 1SUQA 4WYBA 4CEZA 3LM9A 3BP8A 4KHUA 1YVUA 4F9OA 3JS6A 3TU5A 3LP3A 2RN2A 3QEXA 3OS2A 3TWHA 2HF3A 1F21A 3VQAA 4BC2A 1NGIA 4K43A 4GY2B 2IIRA 5MLCQ 3U3GA 4BRQA 3AARA 1YTUA 3GE1A 3SUNA 2KFNA 1T6CA 4IEEA 4JRQA 1X3MA 2A1RA 5AQUA 4GKJK 3ID6A 4FO0A 3IS9A 1KFDA 3AA2A 5KPTA 4IO8A 3TPQA 4GW6A 3C6AA 5A2QO 3VPZA 2FBTA 3MECA 3THXB 5ELZA 4WQ5C 3AV9A 3K5LA 3FZLA 1L3TA 4UQGA 3AGKA 3I8BA 1HUXA 2PY5A 5BR9A 1TAQA 4C1NI 1WSHA 1GLLO 2LSNA 4BROA 1X9MA 4H5VA 1KC8O 4WQ4C 5FRNA 3UKRB 1XHZA 3O4NA 1J9AA 1S1TA 1TUUA 4KHYA 3O6WA 3PLAA 4GV9A 4DUZK 2VGNA 1U45A 4BGAA 4WQ5A 4OKEA 1RT5A 3U4LA 1NGGA 2HNDA 1TKTA 3RMBA 3ULEB 4DHYA 4BC3A 2A42A 5DM6L 5C42A 1QSLA 2ZJQL 3VEVA 1TVRA 1LAWA 2GV9A 3SUOA 3CG7A 5AQPA 3PSFA 1C0TA 4FSVA 1YIJN 4BRNA 3V9SA 1NU0A 1E4GT 1WB9A 4C8MA 4CK2A 1HJOA 4BQZA 2PYLA 1YJNN 1GLEG 4CJ5A 5CZ2A 4HUEA 3DLHA 1BISA 3TSQA 5HP1A 3CJ9A 1DTTA 3MAQA 5LMNK 3P31A 1BQNA 3H45C 3OA9A 4FJMA 5GAGP 1C0UA 5C0YA 1HKBA 5DK5A 4CJWA 4FWOA 2O8DB 4CHZA 4DKWA 3UKRA 5BPNA 1LOTB 5AQMA 1KAXA 4WFNL 2WC9A 5GINA 4DTPA 4BR0A 1D5AA 1NGAA 2CGKA 3S3OA 1JCGA 3CC2N 3L2UA 4BR4A 3DRRA 3VQCA 4LY7A 3CJCA 4CEDA 2P5GA 1JLCA 1WOQA 3CC7N 2XY8A 3PX6A 5KRSA 1TL3A 4ZTFA 3AO3A 4OKKA 4W5OA 2OA8A 4EZ6A 2PZSA 3VERA 3VQ9A 1BA1A 4KB1A 3RSEB 2FBVA 1MWMA 3QEIA 2UXDK 1W0HA 1HMVA 4FJGA 4KHSA 2BGGA 3IFRA 3DRSA 3C94A 3RRHA 3C7NB 4YFUA 3HPOA 1D9FA 3A2FA 4GV3A 3EZ5A 3ISNC 3LDLA 2F9TA 3HSTB 4G9ZA 1HR0K 4RCHA 4A61A 3O9QA 3PUFA 3L4IA 1BCOA 1LWFA 1ZXOA 1YTAA 3NE6A 4CCHA 3QLHA 4IOXA 1BI4A 3DLEA 1ASVA 2HF4A 3TSPA 1W2BM 4LSLA 5CYQA 5JLHA 1GOBA 1IJJA 4K41A 1VSLA 1OVYA 4EHTA 4HCBA 4FPAA 3MXJA 2JGUA 3C6TA 2WONA 2B5JA 2GX9A 3VQQA 5J1EA 1N33K 3PIPL 3NF8A 1Y97A 3V6DA 4GV6A 3OYEA 3RR7A 3MMVA 3VETA 1WAJA 5E84A 4KBOA 4N5SA 2BDPA 2GBZA 1FK9A 3LDQA 2QKBA 5J2NA 4DU1A 4AHCA 2Q31A 1GLAG 4FJ5A 3LAMA 2P5OA 1HQEA 3OYAA 4OVLA 2R7YA 2NZTA 4DSKA 1KXPA 4MO4A 4FOIA 4DQIA 2UXCK 1W7AA 2KHOA 1C1BA 4U7BA 3ZLJA 3R8EA 3QMLA 4DFKA 2A3ZA 4CF1A 3WXMB 4NYFA 1ATNA 4PA1A 3CPWM 3VQ8A 1JKHA 3DJCA 3LZJA 1QQMA 5BRDA 2P9KA 5FPDA 3MWPA 3T19A 2FF3B 3DYAA 4CJVA 1VQ4N 4DV5K 5BPLA 4FLYA 4FLZA 1LV5A 3TTDA 3BGRA 3TAPA 5LJVA 1X1PA 1JLEA 3FZHA 3SNNA 5HLFA 2CGLA 3J8AA 1HRHA 4IG3A 1IO2A 3CM5A 4J2AA 3J7YP 4BRHA 4QS7A 2QKKA 5JVGL 3J7AP 3D2EB 4CZJA 3NHGA 3AO1A 3CCJN 4B9UA 5KGWA 1VQ6N 3AA3A 3ZSRA 5AR0A 3SLCA 3V81A 1NOYA 2UUBK 4JK9A 3VEZA 4MQ3A 4O8KA 1SS6A 3D45A 4NLCA 4KKOA 3W3DA 5AQQA 4YORA 4FLUA 1NK8A 3BY5A 4W5NA 2D0PA 3M6GA 1ZBSA 1RDDA 4E1MA 2NRVA 2VYPA 3QEVA 3FFIA 3MXMA 4YNQA 1KTQA 2X6NA 3AVAA 3V1RA 5C10A 3TABA 2D0AA 2ZF5O 4LF5K 3VF2A 2UUAK 1R0AA 4NB4A 1RT6A 5LJWA 3K9KA 4FJNA 4H0YB 1XHXA 1VQKN 2X74A 4CFAA 1DKGD 1GOCA 1K8AO 4NCAA 3AGRA 4DSIA 3DXMB 2F8SA 3QB0A 3AVKA 2E6MA 1ESVA 3F5TA 1T8EA 1C6VA 3V9WA 4NXNK 1T44A 2IOCA 4H0PA 3RVCA 4ZHRA 2KQ2A 4E89A 3SK3A 1BGXT 4DQRA 2YNFA 1NJWA 3VESA 3QIOA 2Q36A 2YNHA 4IO9L 3AVMA 3THWB 4NCBA 1Z25A 1Q18A 3WEEB 4CJ3A 3IAYA 5HRSA 4CK1A 2PYJA 4FZYA 3DOLA 4DR2K 1TAUA 3WT0A 4DS5A 5JS2A 4OGEA 3HO1A 3K2PA 1ZBFA 5KI6A 1VQ8N 4DTJA 2P1JA 1VRUA 3ZSQA 1U04A 4O55A 3E66A 3QBWA 4M3XA 1GLJO 3DLBA 1NMNA 1YJ9N 4CJKA 4EZ9A 1K73O 4KHWA 1NGJA 4CF9A 3ZSYA 4GNIA 5AQYA 3EE9A 1EKEA 4CE9A 3N4PA 3O4QA 1WNSA 2HHWA 3L4QA 2IGIA 3O3GA 4FWRA 4ISEA 3NF6A 4CJPA 3SBGA 3A8YA 3E1YA 3CJBA 4DB3A 4Z4GA 2OPQA 4JN4A 4CJ4A 3HRGA 3F73A 3SQ2A 3VGKA 4FJKA 3WNHA 1EWQA 3C0BA 3CCQN 4NO7A 1RILA 3GG4A 4JK8A 3CHWA 2KTQA 4IKFA 4BVPA 3V9ZA 3KK2A 2Z1JA 1S6QA 4CHNA 3CCUN 1QZ6A 1S22A 2V7ZA 3DXKB 1QZ5A 3ZX2A 5AQGA 4JKGB 3L2RA 3O9TA 1D8YA 1UA1A 4FWMA 3OYBA 1L3VA 5AQIA 4I6MB 4CGFA 4DUYK 1MDUB 2E1YA 4X66K 3OYGA 2QWRA 2Z1GA 1QVGM 3OYHA 3H08A 1CZAN 4CHPA 3A5NC 3FZKA 3ULEA 3AVCA 2PAVA 3O8MA 1WAFA 2I5JA 3K9JA 4DCHA 5H1SQ 2GUPA 4JKFA 3HVTA 1WN7A 1L3SA 3M8QA 3OYIA 3DM2A 3I0SA 3MWTA 4BRIA 4CEFA 3M5RA 2HHUA 4ELVA 3O4WA 3UB5A 4Y1DA 4K42A 2ASOA 2YHXA 4H0VB 4CGIA 2P9SB 2HBLA 4KH6A 4IJAA 3NF9A 3HXMA 4H4OA 3T7ZA 2IC3A 3LZIA 3FZFA 4DR1K 4DFPA 4DV0K 4FJ8A 1U47A 1U4BA 2OZSA 5I3UA 4BDPA 4JI5K 1QE1A 4OLBA 3HI0A 2XRIA 3KLFA 4B8AB 1NGEA 3CC4N 3LP0A 3AVBA 1C0FA 4I9LA 4FM2A 1DEJA 1VSHA 4H0OA 4LF6K 1TGOA 3THXA 3I56N 4B1VA 2HHTA 3M8SA 4K8XA 2QWQA 1UWBA 4HVJA 3MCPA 4DWIA 5IT9O 1ZBLA 1TL1A 3CFRA 1ITGA 3KLHA 2KW4A 3CCLN 3O5BA 2YKNA 3KIOA 2X78A 4WE1A 4JHDB 3F9KA 2QWOA 3G4SN 4HTLA 1EX4A 4DV6K 1U6ZA 4A57A 3CIPA 4CBWA 1T6DA 3H1QA 3FE1A 3A5LC 1YJWN 4E7IA 1Q86O 4O5BA 2Q3SA 3VA3A 4HUFA 1BIZA 2P9IA 3C6HA 2QWLA 4BR7A 2NRZA 4OPAA 2IAJA 5LY3A 3A5MC 2NRTA 1IH7A 3U9DA 5SWMA 3MDQA 1NLVA 3O1BA 1RT1A 4WFBL 1K6YA 3T69A 4DMNA 2D4WA 3T1YK 3L2QA 4TSXA 3CFOA 5GAEP 4UY8O 3AO2A 3THYA 1CXUA 4A2BA 4AHUA 3P39A 4M41A 3T1AA 2CH5A 2RHKA 3ZSVA 1YUWA 4JNEA 2ZGZA 3KWIA 1WLJA 2WBNA 3WQUA 2VG5A 1TK8A 4OPJA 3NGIA 4C8LA 1GLCG 2HHVA 3ZT2A 1Y64A 3WXKA 5KQ8A 1QSYA 4FZXC 2H3GX 2YHYA 1M90O 5BN8A 2RPIA 5CR4A 3TAQA 3QETA 2ASPA 1BO5O 3VQ4A 5DM7L 1MU2A 4RW8A 4AF1A 3FGUA 2VQEK 1Q7YO 1WBBA 4B1WB 5AQTA 4E0DA 1NJYA 3AA4A 4QS8A 3TANA 1J53A 1ATRA 4I6MA 2F4VK 3O9RA 3S3NA 4CZGA 2O8DA 3NVKA 3J81O 3KLGA 4KRFA 2ZE2A 3P5JA 3QESA 4XIUA 3GBTA 2KFZA 4CJQA 3ID8A 5FPNA 3C6UA 3CCMN 1BG3A 4LFBK 3H1VX 1VAZA 4AM6A 1QHTA 4LFAK 3OS0A 2IS3A 2OPPA 4BE0A 2RKIA 1HQUA 1Z26A 3KKRA 4L3QA 3KJVA 1HNXK 4NYNA 4Z4EA 4CIGA 4CJSA 2HSTA 4IOCL 2G8HA 3L3UA 4RW6A 3D6RA 4LFCK 4X65K 1HLUA 4M45A 3L3VA 2D1KA 3SUQA 4C8OA 2HVHA 3HT3A 3I0RA 1NK7A 3IG1A 1SKWA 3VN5A 4QS9A 1S1UA 1A5XA 3A5OC 3CQYA 2OYQA 3QNOA 5J2PA 1N6QA 4M63C 2HMIA 4JS5A 1IBKK 4BRFA 4B1XB 3HL8A 5KRTA 1ZYQA 3UKUA 3E9OA 4FLXA 1M1KO 4HWIA 1YITN 2GELA 4KH5A 1X9WA 4YOYA 1XQSC 4CD3A 4HUGA 1YT3A 3MEDA 1RTHA 3OYKA 2FSNA 3QFUA 5GADP 1V4SA 1S5JA 1TK0A 1IG9A 3VEXA 4RTFD 5FRMA 3QERA 2ZGYA 5F2RA 1QTMA 1CLQA 5M1OA 3UE5A 1UOCA 1ASUA 2KKZA 1RTJA 3CMAN 2XO7A 4ILHA 2P9SA 4CW7B 1QQCA 1VSEA 5E41A 4YOUA 1LAVA 3HPHA 2O8CB 1XI1A 1J54A 1YF5L 2YHWA 5EU7A 1XC3A 1YI2N 3S41A 1RDBA 4DV1K 3RRGA 3TAGA 2P9IB 2XHBA 4MLHA 1RT3A 3QICA 2WFBA 1WBDA 3ALYA 3L8BA 1YHQN 4BE2A 2NNWA 2BH1A 3DLLL 3B6OA 4OPKA 4KTWA 1QQNA 2E20A 1VQ5N 1NGHA 1UA0A 3E9LA 3KHYA 1MWKA 5M1KA 1QSSA 3VQBA 4DLGA 3TAEA 4JI1K 3PV8A 3D2FB 1FW6A 4FWSA 4KAZA 3EKSA 4EAHD 1NKBA 4FLVA 2G8IA 2B4JA 4DSJA 1SQKA 5CY4A 4LF7K 1C1AA 5EXWA 2O4IA 3P1GA 2AA4A 2OPSA 3U6FA 1JL1A 1NGCA 4GMJB 4GKKK 3S9HA 4YDUC 4FJ7A 3ZSXA 4BACA 3HYFA 3HSCA 4H5NA 3CCVN 4YY3K 2XY5A 2IDOA 3CD6N 5BPMA 3QEPA 4O44A 1QS4A 3O80A 4N76A 1HKCA 3P4IA 4FVMA 2O8CA 4DQPA 1BI4B 4DR3K 3SV4A 5AQZA 2EX3A 3NDKA 1W9HA 1P8ZA 5AQHA 3RWUA 1J5OA 4BE1A 4XEIA 2W42A 5K14A 1IG8A 3VA0A 3VF4A 1KVCA 3KLIA 5AZJA 4DFMA 2P51A 4I9QA 2F8TA 2YV0X 1NGDA 4KHQA 2JWKA 1EXQA 2E6LA 4B9QA 4JK7A 4B08A 1ZBHA 5HROA 4Z4HA 3NVMA 3G71N 4DSFA 3KD5E 4IDKA 3VENA 4B9SA 4C8NA 4A62A 4LF4K 4KREA 2ITMA 1DT9A 3AY9A 3K5MA 3OYLA 4DV4K 3PSIA 4B3SK 3NBPA 3H3OB 4BDZA 4CIFA 3SV3A 4JI2K 3KD1E 4MDAA 3AO4A 3P38A 2P9LB 3ZYYX 4KV8A 4O5FA 4CZEA 3IKMA 4CERA 4YOWA 2QI2A 4JKBA 4IFVA 5JVHL 4M3TA 1VQPN 5BN9A 3MEEA 2KLAA 3W0LA 4PQUA 4CZLA 1RT4A 2XY7A 1XMOK 3LALA 1R59O 3MN6A 4Y1CA 5M1QA 4BRDA 4M3WA 1LCUA 5KPZA 3N4QA 5AQRA 1KFSA 3K5NA 4PKIA 3ITHA 3EEQA 4DR7K 2YHBA 3WXJA 4JAXA 2V7YA 3MEGA 5JLFA 2KZZA 3D2EA 4BRGA 4K25A 4IJNA 1Q9XA 1BQMA 4KPYA 2YJFA 1RBUA 4J2DA 2IVNA 2O8EB 1OH5A 4B9TA 1ILYA 1NNEA 1JLGA 2G8VA 3M3ZA 3CJ7A 3F9MA 3ZX0A 4B1UB 4M3YA 1EO1A 3E01A 2O4GA 3GL1A 1VSJA 2FLOA 4CIEA 5BREA 1S1VA 4JKCA 4BDYA 4ISGA 1RT2A 2FBYA 4FOEA 1CZBA 3WQTA 3L0QA 3TSUA 3EYZA 4JI8K 3FR0A 4FJHA 3LAKA 2BANA 4FWKA 3THYB 1HPZA 3SAGA 3LL3A 2GTDA 3WXIA 4JI6K 1VQ7N 2HHHK 4Q5VA 3SQ0A 1VQLN 4QOZB 4YOTA 3VTIA 3CERA 1OKJA 3G10A 3TR8A 4DV2K 1IKYA 5AQOA 3SBTA 4PL8A 1VQNN 1A5WA 2ETJA 4OKJA 4EHUA 1GOAA 3T1HK 4EP4A 4FJIA 5C15A 5AQWA 3K0SA 3AAPA 2Y1IA 3KWGA 5B8HA 2WUSA 4AHSA 4BRAA 2NRHA 3C95A 2YJEA 4PWDA 4A5AA 3V1OA 1QVFM 4CK3A 2E2PA 3L2VA 4J8FA 4NLBA 1BA0A 4ICLA 3ZT3A 2V51B 3VQ5A 4R5PA 2ZD1A 4NXMK 1O1WA 2G8WA 2FSJA 4JHDA 4CI6A 4CFDA 1I39A 4CGDA 4FM0A 2HBMA 2FF6A 4RG8A 1SL1A 3RTVA 4Z94A 4C8KA 4CEEA 1HYVA 3OYDA 1HNZK 1NOZA 4B1ZA 4CBUA 4FWPA 3HPGA 3WNFA 4M42A 5F0XA 1RT7A 1L3UA 1KQSM 4OLAA 3U3YA 3R1XA 3NCIA 1LW0A 5EOYA 1Q82O 3TAMA 3KK1A 3I55N 3NF7A 4CBXA 4HTUA 4CJEA 4DFJA 5M1NA 4BR2A 4DTUA 2F7TA 1YAGA 2HNZA 3F2KA 2QEXN 4B3RK 1BIUA 4BY9C 1VSDA 1BOTO 2XY6A 4CF8A 1KD1O 1VQ9N 1HPMA 3H3NO 3UKUB 4KI6A 4JD2A 3QIPA 1QHAA 3UIQA 4XH1A 3BF3A 4DQ8A 1NK0A 1ZBUA 4FK0A 2EWSA 2BE2A 4KTZA 3ZSOA 3P83D 3CQ8A 1Q81O 4PKHA 3VEWA 1IV0A 5KQDA 1N34K 1RNHA 4FW2A 2G8UA 3KK3A 4BR9A 4ISFA 3LPTA 4OGCA 1FXXA 1RBTA 5DMRA 1OH7A 1JL2A 4H0XB 4CJUA 1NK5A 3OBWA 4H0TB 4FK2A 3PX0A 3HTVA 4M7XA 3ULDA 4IXCA 5LMUK 3AVLA 1C0GA 3OHRA 4PY5A 5AFUH 4F4KA 2HW3A 3OJUA 2A5XA 3HZ6A 1TK5A 2NRWA 4WFAL 4BWMA 5J2QA 1KCFA 4I2QA 2Q2RA 2Q1NA 4DTSA 4CF2A 1ASWA 1GLBG 3SUPA 2B6AA 4M3ZA 2O8FB 3CJAA 4BRPA 3K58A 2AP1A 4JLHA 4E1JA 3H6EA 4JI4K 3RMDA 3G6EN 4FL9A 4FJJA 3DMJA 4IG0A 3KVGA 2O8BB 4PHTX 1JLFA 3D2FA 3LANA 3NH2A 1JLBA 4ELTA 3B8AX 4MDBA 3AVHA 3OW2M 2OCEA 4H5TA 3SAFA 3CJ1A 1RTIA 5KGXA 3OYNA 2A40A 5BRHA 2YI1A 4CESA 4Q0BA 3ASMA 3EE8A 1RDWX 4JKHA 2FC0A 4BREA 1S1WA 2P9PA 4X64K 1HKGA 3SI6A 3WEEA 3QBXA 1TYQB 1IKXA 4W5TA 1WSJA 3MN5A 2IVOA 4Z4FA 2HVIA 4JRPA 5JS1A 4A5BA 4AHRA 4FK4A 4F2RA 3ENHA 1NJXA 3R6MA 2HB5A 2DFHA 1RBSA 3R3LA 3VQPA 4BG8A 3CQXA 2NLXA 4JKDA 4IFEA 5HOOA 3WXLA 3CETA 2O8EA 5GIOA 1LWEA 3VF6A 4B9NA 1NK6A 5ADXA 3OBYA 2HBKA 2OPRA 1L5UA 4MFBA 4CGHA 3SPYA 2WTUA 4FVUA 2D0BA 1YXQA 2QXLA 1BU6O 1RDAA 4DF4A 2PBDA 2YNGA 1NJIO 3KZBA 3MX2A 4EFHA 4O4GA 3QFPA 3ZETA 5C12A 3Q7BA 2P9NA 1Z6RA 4CZIA 2HHQA 3KLEA 3QDKA 3AVJA 3NMUA 3DAWA 3CPEA 2VG6A 5C2FA 3DXKA
chains in the Genus database with same CATH topology
4DR4K 4DV6K 1HNWK 1N33K 1FJGK 4JI1K 1HNXK 3JAMO 2UXBK 1J5EK 4NXMK 4JI7K 4LFCK 1N32K 4X65K 4LF7K 4JV5K 4JYAK 1N36K 1XMOK 4JI4K 4YHHK 4LF5K 5IWAK 2UUAK 5LMNK 1HNZK 4GKKK 3T1YK 1IBKK 1IBLK 4DUYK 4X66K 4YY3K 2UXCK 4CVNE 5LL6Z 4DR7K 4AQYK 4NXNK 4DR5K 4OX9K 4GKJK 4DR3K 4X64K 5BR8K 1I94K 4DV5K 4B3RK 5A2QO 4LF8K 4JI3K 4DR6K 3J80O 4CW7B 4DR2K 4B3TK 4DR1K 3J7YP 4DV0K 2UXDK 2UUCK 4DV3K 1XMQK 4JI5K 1N34K 2E5LK 3J7AP 2VQEK 4JI0K 2VQFK 4JI8K 4V19S 4DV1K 1XNRK 4LF9K 4JI6K 3OTOK 1IBMK 2HHHK 4LF6K 4LF4K 5FLXO 1HR0K 2F4VK 4DUZK 3J81O 4DV2K 2UUBK 5LMUK 2UU9K 5IT9O 4X62K 4DV4K 4B3MK 4B3SK 4KHPK 3T1HK 4K0KK 4LFBK 4DV7K 4JI2K 2ZM6K 1XNQK 4LFAK 5AJ3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 K;  4DV6 K;  1HNW K;  1N33 K;  1FJG K;  4JI1 K;  1HNX K;  3JAM O;  2UXB K;  1J5E K;  4NXM K;  4JI7 K;  4LFC K;  1N32 K;  4X65 K;  4LF7 K;  4JV5 K;  4JYA K;  1N36 K;  1XMO K;  4JI4 K;  4YHH K;  4LF5 K;  5IWA K;  2UUA K;  5LMN K;  1HNZ K;  4GKK K;  3T1Y K;  1IBK K;  1IBL K;  4DUY K;  4X66 K;  4YY3 K;  2UXC K;  4CVN E;  5LL6 Z;  4DR7 K;  4AQY K;  4NXN K;  4DR5 K;  4OX9 K;  4GKJ K;  4DR3 K;  4X64 K;  5BR8 K;  1I94 K;  4DV5 K;  4B3R K;  5A2Q O;  4LF8 K;  4JI3 K;  4DR6 K;  3J80 O;  4CW7 B;  4DR2 K;  4B3T K;  4DR1 K;  3J7Y P;  4DV0 K;  2UXD K;  2UUC K;  4DV3 K;  1XMQ K;  4JI5 K;  1N34 K;  2E5L K;  3J7A P;  2VQE K;  4JI0 K;  2VQF K;  4JI8 K;  4V19 S;  4DV1 K;  1XNR K;  4LF9 K;  4JI6 K;  3OTO K;  1IBM K;  2HHH K;  4LF6 K;  4LF4 K;  5FLX O;  1HR0 K;  2F4V K;  4DUZ K;  3J81 O;  4DV2 K;  2UUB K;  5LMU K;  2UU9 K;  5IT9 O;  4X62 K;  4DV4 K;  4B3M K;  4B3S K;  4KHP K;  3T1H K;  4K0K K;  4LFB K;  4DV7 K;  4JI2 K;  2ZM6 K;  1XNQ K;  4LFA K;  5AJ3 K; 
#chains in the Genus database with same CATH topology
 5E26 A;  3PO4 A;  1KAZ A;  4CJF A;  3LDS A;  4O0J A;  3GDQ A;  3PY8 A;  1W97 L;  4PL7 A;  3SJH A;  2DPN A;  4WQ4 A;  3PO5 A;  2O8B A;  2FSK A;  4B8C A;  4BQL A;  3CCS N;  1N32 K;  3OY9 A;  1WSG A;  3IUC A;  3S3M A;  1I3A A;  3NGY A;  4FWN A;  3CFP A;  2P9N B;  3DWL A;  4H4M A;  3SAH A;  4F2S A;  3SJJ A;  3V1Q A;  4BRK A;  2VWK A;  1KLN A;  4BG9 A;  3ENB A;  2PFU A;  3HVR A;  4ILG B;  1RDC A;  1VSM A;  3VQ6 A;  4DTX A;  3QIN A;  1JXE A;  4FYD A;  5TKW A;  1NK9 A;  2E88 A;  3ZCM A;  3V9U A;  1RGI A;  5ADX H;  4JEP A;  1D4X A;  3DRP A;  4LF8 K;  1JJ2 M;  4JS4 A;  3LDN A;  2WOM A;  1KLM A;  4B9L A;  1K8K B;  4JI3 K;  4CF0 A;  4BRL A;  5AQF A;  3G0Z A;  4CFC A;  3ZT1 A;  3EZW A;  1CZ9 A;  1BWF O;  1E4F T;  4B3O A;  1SKR A;  3IDH A;  5D3G A;  4J2B A;  1HNV A;  4KI4 A;  4IFY A;  4DSE A;  3RSE A;  2UUC K;  1IKW A;  1XMQ K;  2ASM A;  1C1C A;  2A6A A;  3IMX A;  1O13 A;  3SQ4 A;  1S1X A;  3VEY A;  1RBR A;  1XNR K;  1G15 A;  4IZ9 A;  1IBM K;  5FLX O;  4FPB A;  4IDH A;  4B1Y B;  1Z05 A;  4CHQ A;  5HBM A;  2P9U A;  4X62 K;  4CZF A;  1T03 A;  2F9W A;  4B3M K;  1H1V A;  4N47 A;  3ZT4 A;  1VQM N;  1B9D A;  1BHL A;  1OH8 A;  4E7L A;  4QCL A;  2RF2 A;  1GLD G;  4CZK A;  4R79 A;  4M3R A;  4ILJ A;  5AQK A;  1FJG K;  4YOX A;  2P9U B;  4BRC A;  3HM9 A;  3K59 A;  1HNI A;  4PUO A;  2VWB A;  2UXB K;  4FZZ A;  1BUP A;  3RMC A;  1VQO N;  1NK4 A;  1OVQ A;  4JV5 K;  4JYA K;  1JCE A;  3SPZ A;  3NH0 A;  3AO5 A;  1SL2 A;  2NRX A;  2YKM A;  3VTH A;  5AFU A;  4YHH K;  1JLQ A;  5GAH P;  4Z4I A;  5M1P A;  3WNG A;  3AAQ A;  2W6L A;  4KH4 A;  4W5Q A;  3NGZ A;  3OJS A;  3U9Z A;  3LP1 A;  1ZBI A;  1EET A;  2GWK A;  2I7P A;  5AZJ B;  3C7N A;  2ZJR L;  4DTM A;  4H8K A;  2DFF A;  3HOS A;  4DS4 A;  2A1S A;  4DR5 K;  2G8F A;  1RCH A;  3VQE A;  4E19 A;  1FKO A;  4CJL A;  4O0I A;  1X9S A;  4CJR A;  3EY1 A;  3LWM A;  2HHX A;  2YX6 A;  5C25 A;  4Z4C A;  4FLW A;  3M8P A;  2DTU A;  3TAR A;  4ZTJ A;  1KVA A;  5AQV A;  1S72 N;  1TYQ A;  2ZWH A;  4E7H A;  1S3X A;  3K5O A;  4JKE A;  2YCH A;  4CJ7 A;  1XWL A;  1JCF A;  1E3M A;  4B9V A;  1DGK N;  4LF9 K;  3ZSW A;  2GUI A;  4DG1 A;  4B9M A;  2GEM A;  3WUH A;  3MN9 A;  3EKU A;  1RDU A;  4AHV A;  3R9P A;  1BL3 A;  3AA5 X;  4CJT A;  1SZ2 A;  3CCE N;  3HK2 A;  4KHP K;  5GIP A;  4JKA A;  2FBX A;  5KTQ A;  2ZM6 K;  1XNQ K;  4H5W A;  3L2W A;  2V52 B;  4L8R B;  4CHO A;  4DR4 K;  3LM2 A;  4OO1 J;  1KAY A;  4FJ9 A;  3ZX3 A;  1EQY A;  3OYJ A;  3ZET B;  4RW7 A;  3JAM O;  1UAX A;  4KB0 A;  4M7Y A;  3PIO L;  2AJQ A;  3BZC A;  3VQD A;  1WSI A;  4YDU A;  4KTQ A;  1LWC A;  3BDP A;  1WUA A;  1N36 K;  3KK7 A;  2F96 A;  1N8R O;  5BRF A;  3THV A;  1KSP A;  4EP5 A;  1TUY A;  1HJR A;  4KHN A;  5HRR A;  4AHT A;  4ELU A;  3SQ1 A;  3LDP A;  4CVN E;  2VCP A;  3SCX A;  5LL6 Z;  1DLO A;  1VSK A;  2QWN A;  2Y1J A;  3RMA A;  4DTR A;  5AQX A;  3VOV A;  2J4R A;  2P9K B;  2Z1I A;  2P9P B;  2CH6 A;  4F3O A;  2X6S A;  4LC9 B;  5BR8 K;  3QNN A;  1I94 K;  2VG7 A;  3VMF B;  4J2E A;  4WCE L;  4ID1 A;  2OZM A;  1REV A;  2DFE A;  1X3N A;  4E3S A;  2I7N A;  5FRO A;  3JXU A;  5HRP A;  3TI0 A;  1WSF A;  1VRT A;  1RTD A;  3WNE A;  4DR6 K;  5T7B A;  3LWL A;  5AZI B;  4CEB A;  3LDO A;  3OS1 A;  1WSE A;  3GOI A;  4CZH A;  3K57 A;  1SL0 A;  4Y0W A;  4LH4 A;  2D0O A;  2HNY A;  2VQF K;  4FCY A;  2G8K A;  1HYS A;  4W5R A;  2QTD A;  3EL2 A;  5FPE A;  3HBT A;  1NBW A;  3AVI A;  5HL7 L;  4BGB A;  3OTO K;  5M1F A;  1K8K A;  4I7F A;  4OJR A;  3ATU A;  5CE3 A;  3B6P A;  1KRP A;  5CZ1 A;  1VK0 A;  3BUZ B;  3CCR N;  4RW9 A;  4N41 A;  3ATV A;  4BC5 A;  4K0K K;  3DLG A;  3ENO A;  1TKX A;  4DV7 K;  4Z0U A;  5J2M A;  3CM6 A;  2ATQ A;  3ZT0 A;  5CHI A;  1T05 A;  3KTQ A;  2ZQB A;  2Z1H A;  3DI6 A;  4HCC A;  2HHS A;  2E1Z A;  2CGJ A;  1NKC A;  4H5R A;  1U49 A;  3CI5 A;  4FJX A;  4DU3 A;  3NFA A;  4E1N A;  2IVP A;  2OAN A;  5AQL A;  5F1X A;  2P9L A;  1J5E K;  1QQO A;  3HJF A;  1XUP O;  1SV5 A;  1U2V A;  1DTQ A;  5C24 A;  4I2P A;  1JLA A;  3NAE A;  5FDL A;  5EX5 A;  4HHT A;  2ITG A;  3MXI A;  3U8X A;  2E8A A;  1ATS A;  2BTF A;  5JMV A;  4E7J A;  4BR5 A;  5EVZ A;  3VGL A;  3D7E O;  4JD2 B;  3BEX A;  4CZM A;  5I9E B;  1NGF A;  1Q8I A;  3M8R A;  1NM1 A;  1NWK A;  3VGM A;  1U48 A;  1NMD A;  4MLE A;  4AQY K;  4XH4 A;  3OYF A;  4BC4 A;  2HMP A;  4BRM A;  2NRR A;  2QA4 N;  1NKE A;  3IRX A;  4NCG A;  3HP9 A;  3ZEU A;  3M1F A;  2Q97 A;  3THW A;  4OPH A;  2VWJ A;  1NG9 A;  2OTL N;  4GVM A;  1XC9 A;  2A41 A;  1G99 A;  3CXC M;  3QEW A;  4DTO A;  3G25 A;  3SMP A;  2E4L A;  3DOK A;  4RW4 A;  1YVN A;  2FXU A;  1N5Y A;  1T3V A;  3I33 A;  4DQS A;  1BDG A;  3HOT A;  3VEO A;  3SYZ A;  2NUB A;  3OVN A;  3MK6 A;  4G1Q A;  4JI0 K;  3E9P A;  3O9U A;  4YOV A;  2DY4 A;  5I42 A;  4CD1 A;  3CME N;  3TTC A;  4IBN A;  1J6Z A;  3ZEU B;  3ZSZ A;  4M3U A;  2YNI A;  2EHG A;  1NJZ A;  4DTN A;  4KO0 A;  1BCM A;  3OYC A;  1V4T A;  4LSN A;  4CGG A;  3NH1 A;  4FLT A;  1KVB A;  4F3T A;  2JWL A;  2D5R A;  2ZJP L;  3DLK A;  5C2D A;  3SZ2 A;  3FFK B;  1S9E A;  4XH5 A;  4GVE A;  4F8R A;  2QK9 A;  4IEI A;  3DLR A;  4IOA L;  2UYT A;  3MN7 A;  3FLC O;  4C23 A;  5JIC A;  4E7K A;  3A0I X;  3FZM A;  3RR8 A;  3BF1 A;  2W41 A;  2QXF A;  4DQQ A;  4FWQ A;  3JSM A;  4A2A A;  2W40 A;  1FKP A;  4H03 B;  2VGM A;  3SMS A;  2E2O A;  1Q9Y A;  4WF9 L;  4EIA A;  1U2V B;  3HM8 A;  2BUP A;  3L6Q A;  4FWL A;  5IWA K;  3JYT A;  1RFQ A;  1VSI A;  1MA9 B;  5FPM A;  4DSL A;  4C1N K;  4ID5 A;  1IBL K;  3J7Z O;  3T3F A;  1VSF A;  4FW1 A;  4DF8 A;  5SZT A;  3PX4 A;  2KZM A;  1SKS A;  1TKD A;  4CEO A;  5TKY A;  3Q7C A;  3TTF A;  4DLE A;  4OX9 K;  3OYM A;  4LD0 A;  3BZK A;  4MO5 A;  4CEA A;  4QAG A;  3O1W A;  1TKZ A;  2W6K A;  3CYM A;  5EY4 A;  4O8U A;  2D0C A;  3D0P A;  5HRN A;  2E2Q A;  3CF5 L;  2Q0R A;  2GWJ A;  1LW2 A;  1HX1 A;  4AH9 A;  4FXD A;  2QM1 A;  1X9J A;  4LH5 A;  4BWJ A;  4CFB A;  4FM1 A;  3J80 O;  2JLE A;  3MX5 A;  3O08 A;  3H46 O;  4B3T K;  4PKG A;  3EO3 A;  2QW9 A;  3EN9 A;  3O3H A;  2QWP A;  2OTJ N;  1D9D A;  3V4I A;  3VQ7 A;  1GLF O;  2QWM A;  5CYM A;  4DV3 K;  4JKG A;  4A59 A;  1EWR A;  2E5L K;  2E2N A;  1SAZ A;  3LP2 A;  1P90 A;  2RE2 A;  2Q0U A;  5AZI A;  2HBJ A;  4V19 S;  3QO9 A;  4AM7 A;  1T7P A;  3KKS A;  3AVF A;  3I8D A;  5AQS A;  1EP4 A;  1S6P A;  4AIL C;  1B92 A;  4CHY A;  3DXM A;  2YHA A;  3LPU A;  1B9F A;  4IWV A;  1NGB A;  3V9X A;  2UU9 K;  5KPR A;  4CEQ A;  4RWT A;  1VHX A;  4BVO A;  4CEC A;  3AVN A;  1K9M O;  4U67 L;  1HYZ A;  2O8F A;  3O9S A;  4K8Z A;  4FJL A;  3O3F A;  5AJ3 K;  1IKV A;  1CXQ A;  1C0M A;  4CGJ A;  1HNW K;  4N56 A;  4KFB A;  5AQJ A;  3HP6 A;  1RBV A;  1A5V A;  3AVG A;  1TV6 A;  3TAF A;  1OH6 A;  3C65 A;  1S9G A;  4JI7 K;  2HOE A;  3MCA B;  4DU4 A;  1ZC6 A;  1JXB A;  5AQN A;  1SUQ A;  4WYB A;  4CEZ A;  3LM9 A;  3BP8 A;  4KHU A;  1YVU A;  4F9O A;  3JS6 A;  3TU5 A;  3LP3 A;  2RN2 A;  3QEX A;  3OS2 A;  3TWH A;  2HF3 A;  1F21 A;  3VQA A;  4BC2 A;  1NGI A;  4K43 A;  4GY2 B;  2IIR A;  5MLC Q;  3U3G A;  4BRQ A;  3AAR A;  1YTU A;  3GE1 A;  3SUN A;  2KFN A;  1T6C A;  4IEE A;  4JRQ A;  1X3M A;  2A1R A;  5AQU A;  4GKJ K;  3ID6 A;  4FO0 A;  3IS9 A;  1KFD A;  3AA2 A;  5KPT A;  4IO8 A;  3TPQ A;  4GW6 A;  3C6A A;  5A2Q O;  3VPZ A;  2FBT A;  3MEC A;  3THX B;  5ELZ A;  4WQ5 C;  3AV9 A;  3K5L A;  3FZL A;  1L3T A;  4UQG A;  3AGK A;  3I8B A;  1HUX A;  2PY5 A;  5BR9 A;  1TAQ A;  4C1N I;  1WSH A;  1GLL O;  2LSN A;  4BRO A;  1X9M A;  4H5V A;  1KC8 O;  4WQ4 C;  5FRN A;  3UKR B;  1XHZ A;  3O4N A;  1J9A A;  1S1T A;  1TUU A;  4KHY A;  3O6W A;  3PLA A;  4GV9 A;  4DUZ K;  2VGN A;  1U45 A;  4BGA A;  4WQ5 A;  4OKE A;  1RT5 A;  3U4L A;  1NGG A;  2HND A;  1TKT A;  3RMB A;  3ULE B;  4DHY A;  4BC3 A;  2A42 A;  5DM6 L;  5C42 A;  1QSL A;  2ZJQ L;  3VEV A;  1TVR A;  1LAW A;  2GV9 A;  3SUO A;  3CG7 A;  5AQP A;  3PSF A;  1C0T A;  4FSV A;  1YIJ N;  4BRN A;  3V9S A;  1NU0 A;  1E4G T;  1WB9 A;  4C8M A;  4CK2 A;  1HJO A;  4BQZ A;  2PYL A;  1YJN N;  1GLE G;  4CJ5 A;  5CZ2 A;  4HUE A;  3DLH A;  1BIS A;  3TSQ A;  5HP1 A;  3CJ9 A;  1DTT A;  3MAQ A;  5LMN K;  3P31 A;  1BQN A;  3H45 C;  3OA9 A;  4FJM A;  5GAG P;  1C0U A;  5C0Y A;  1HKB A;  5DK5 A;  4CJW A;  4FWO A;  2O8D B;  4CHZ A;  4DKW A;  3UKR A;  5BPN A;  1LOT B;  5AQM A;  1KAX A;  4WFN L;  2WC9 A;  5GIN A;  4DTP A;  4BR0 A;  1D5A A;  1NGA A;  2CGK A;  3S3O A;  1JCG A;  3CC2 N;  3L2U A;  4BR4 A;  3DRR A;  3VQC A;  4LY7 A;  3CJC A;  4CED A;  2P5G A;  1JLC A;  1WOQ A;  3CC7 N;  2XY8 A;  3PX6 A;  5KRS A;  1TL3 A;  4ZTF A;  3AO3 A;  4OKK A;  4W5O A;  2OA8 A;  4EZ6 A;  2PZS A;  3VER A;  3VQ9 A;  1BA1 A;  4KB1 A;  3RSE B;  2FBV A;  1MWM A;  3QEI A;  2UXD K;  1W0H A;  1HMV A;  4FJG A;  4KHS A;  2BGG A;  3IFR A;  3DRS A;  3C94 A;  3RRH A;  3C7N B;  4YFU A;  3HPO A;  1D9F A;  3A2F A;  4GV3 A;  3EZ5 A;  3ISN C;  3LDL A;  2F9T A;  3HST B;  4G9Z A;  1HR0 K;  4RCH A;  4A61 A;  3O9Q A;  3PUF A;  3L4I A;  1BCO A;  1LWF A;  1ZXO A;  1YTA A;  3NE6 A;  4CCH A;  3QLH A;  4IOX A;  1BI4 A;  3DLE A;  1ASV A;  2HF4 A;  3TSP A;  1W2B M;  4LSL A;  5CYQ A;  5JLH A;  1GOB A;  1IJJ A;  4K41 A;  1VSL A;  1OVY A;  4EHT A;  4HCB A;  4FPA A;  3MXJ A;  2JGU A;  3C6T A;  2WON A;  2B5J A;  2GX9 A;  3VQQ A;  5J1E A;  1N33 K;  3PIP L;  3NF8 A;  1Y97 A;  3V6D A;  4GV6 A;  3OYE A;  3RR7 A;  3MMV A;  3VET A;  1WAJ A;  5E84 A;  4KBO A;  4N5S A;  2BDP A;  2GBZ A;  1FK9 A;  3LDQ A;  2QKB A;  5J2N A;  4DU1 A;  4AHC A;  2Q31 A;  1GLA G;  4FJ5 A;  3LAM A;  2P5O A;  1HQE A;  3OYA A;  4OVL A;  2R7Y A;  2NZT A;  4DSK A;  1KXP A;  4MO4 A;  4FOI A;  4DQI A;  2UXC K;  1W7A A;  2KHO A;  1C1B A;  4U7B A;  3ZLJ A;  3R8E A;  3QML A;  4DFK A;  2A3Z A;  4CF1 A;  3WXM B;  4NYF A;  1ATN A;  4PA1 A;  3CPW M;  3VQ8 A;  1JKH A;  3DJC A;  3LZJ A;  1QQM A;  5BRD A;  2P9K A;  5FPD A;  3MWP A;  3T19 A;  2FF3 B;  3DYA A;  4CJV A;  1VQ4 N;  4DV5 K;  5BPL A;  4FLY A;  4FLZ A;  1LV5 A;  3TTD A;  3BGR A;  3TAP A;  5LJV A;  1X1P A;  1JLE A;  3FZH A;  3SNN A;  5HLF A;  2CGL A;  3J8A A;  1HRH A;  4IG3 A;  1IO2 A;  3CM5 A;  4J2A A;  3J7Y P;  4BRH A;  4QS7 A;  2QKK A;  5JVG L;  3J7A P;  3D2E B;  4CZJ A;  3NHG A;  3AO1 A;  3CCJ N;  4B9U A;  5KGW A;  1VQ6 N;  3AA3 A;  3ZSR A;  5AR0 A;  3SLC A;  3V81 A;  1NOY A;  2UUB K;  4JK9 A;  3VEZ A;  4MQ3 A;  4O8K A;  1SS6 A;  3D45 A;  4NLC A;  4KKO A;  3W3D A;  5AQQ A;  4YOR A;  4FLU A;  1NK8 A;  3BY5 A;  4W5N A;  2D0P A;  3M6G A;  1ZBS A;  1RDD A;  4E1M A;  2NRV A;  2VYP A;  3QEV A;  3FFI A;  3MXM A;  4YNQ A;  1KTQ A;  2X6N A;  3AVA A;  3V1R A;  5C10 A;  3TAB A;  2D0A A;  2ZF5 O;  4LF5 K;  3VF2 A;  2UUA K;  1R0A A;  4NB4 A;  1RT6 A;  5LJW A;  3K9K A;  4FJN A;  4H0Y B;  1XHX A;  1VQK N;  2X74 A;  4CFA A;  1DKG D;  1GOC A;  1K8A O;  4NCA A;  3AGR A;  4DSI A;  3DXM B;  2F8S A;  3QB0 A;  3AVK A;  2E6M A;  1ESV A;  3F5T A;  1T8E A;  1C6V A;  3V9W A;  4NXN K;  1T44 A;  2IOC A;  4H0P A;  3RVC A;  4ZHR A;  2KQ2 A;  4E89 A;  3SK3 A;  1BGX T;  4DQR A;  2YNF A;  1NJW A;  3VES A;  3QIO A;  2Q36 A;  2YNH A;  4IO9 L;  3AVM A;  3THW B;  4NCB A;  1Z25 A;  1Q18 A;  3WEE B;  4CJ3 A;  3IAY A;  5HRS A;  4CK1 A;  2PYJ A;  4FZY A;  3DOL A;  4DR2 K;  1TAU A;  3WT0 A;  4DS5 A;  5JS2 A;  4OGE A;  3HO1 A;  3K2P A;  1ZBF A;  5KI6 A;  1VQ8 N;  4DTJ A;  2P1J A;  1VRU A;  3ZSQ A;  1U04 A;  4O55 A;  3E66 A;  3QBW A;  4M3X A;  1GLJ O;  3DLB A;  1NMN A;  1YJ9 N;  4CJK A;  4EZ9 A;  1K73 O;  4KHW A;  1NGJ A;  4CF9 A;  3ZSY A;  4GNI A;  5AQY A;  3EE9 A;  1EKE A;  4CE9 A;  3N4P A;  3O4Q A;  1WNS A;  2HHW A;  3L4Q A;  2IGI A;  3O3G A;  4FWR A;  4ISE A;  3NF6 A;  4CJP A;  3SBG A;  3A8Y A;  3E1Y A;  3CJB A;  4DB3 A;  4Z4G A;  2OPQ A;  4JN4 A;  4CJ4 A;  3HRG A;  3F73 A;  3SQ2 A;  3VGK A;  4FJK A;  3WNH A;  1EWQ A;  3C0B A;  3CCQ N;  4NO7 A;  1RIL A;  3GG4 A;  4JK8 A;  3CHW A;  2KTQ A;  4IKF A;  4BVP A;  3V9Z A;  3KK2 A;  2Z1J A;  1S6Q A;  4CHN A;  3CCU N;  1QZ6 A;  1S22 A;  2V7Z A;  3DXK B;  1QZ5 A;  3ZX2 A;  5AQG A;  4JKG B;  3L2R A;  3O9T A;  1D8Y A;  1UA1 A;  4FWM A;  3OYB A;  1L3V A;  5AQI A;  4I6M B;  4CGF A;  4DUY K;  1MDU B;  2E1Y A;  4X66 K;  3OYG A;  2QWR A;  2Z1G A;  1QVG M;  3OYH A;  3H08 A;  1CZA N;  4CHP A;  3A5N C;  3FZK A;  3ULE A;  3AVC A;  2PAV A;  3O8M A;  1WAF A;  2I5J A;  3K9J A;  4DCH A;  5H1S Q;  2GUP A;  4JKF A;  3HVT A;  1WN7 A;  1L3S A;  3M8Q A;  3OYI A;  3DM2 A;  3I0S A;  3MWT A;  4BRI A;  4CEF A;  3M5R A;  2HHU A;  4ELV A;  3O4W A;  3UB5 A;  4Y1D A;  4K42 A;  2ASO A;  2YHX A;  4H0V B;  4CGI A;  2P9S B;  2HBL A;  4KH6 A;  4IJA A;  3NF9 A;  3HXM A;  4H4O A;  3T7Z A;  2IC3 A;  3LZI A;  3FZF A;  4DR1 K;  4DFP A;  4DV0 K;  4FJ8 A;  1U47 A;  1U4B A;  2OZS A;  5I3U A;  4BDP A;  4JI5 K;  1QE1 A;  4OLB A;  3HI0 A;  2XRI A;  3KLF A;  4B8A B;  1NGE A;  3CC4 N;  3LP0 A;  3AVB A;  1C0F A;  4I9L A;  4FM2 A;  1DEJ A;  1VSH A;  4H0O A;  4LF6 K;  1TGO A;  3THX A;  3I56 N;  4B1V A;  2HHT A;  3M8S A;  4K8X A;  2QWQ A;  1UWB A;  4HVJ A;  3MCP A;  4DWI A;  5IT9 O;  1ZBL A;  1TL1 A;  3CFR A;  1ITG A;  3KLH A;  2KW4 A;  3CCL N;  3O5B A;  2YKN A;  3KIO A;  2X78 A;  4WE1 A;  4JHD B;  3F9K A;  2QWO A;  3G4S N;  4HTL A;  1EX4 A;  4DV6 K;  1U6Z A;  4A57 A;  3CIP A;  4CBW A;  1T6D A;  3H1Q A;  3FE1 A;  3A5L C;  1YJW N;  4E7I A;  1Q86 O;  4O5B A;  2Q3S A;  3VA3 A;  4HUF A;  1BIZ A;  2P9I A;  3C6H A;  2QWL A;  4BR7 A;  2NRZ A;  4OPA A;  2IAJ A;  5LY3 A;  3A5M C;  2NRT A;  1IH7 A;  3U9D A;  5SWM A;  3MDQ A;  1NLV A;  3O1B A;  1RT1 A;  4WFB L;  1K6Y A;  3T69 A;  4DMN A;  2D4W A;  3T1Y K;  3L2Q A;  4TSX A;  3CFO A;  5GAE P;  4UY8 O;  3AO2 A;  3THY A;  1CXU A;  4A2B A;  4AHU A;  3P39 A;  4M41 A;  3T1A A;  2CH5 A;  2RHK A;  3ZSV A;  1YUW A;  4JNE A;  2ZGZ A;  3KWI A;  1WLJ A;  2WBN A;  3WQU A;  2VG5 A;  1TK8 A;  4OPJ A;  3NGI A;  4C8L A;  1GLC G;  2HHV A;  3ZT2 A;  1Y64 A;  3WXK A;  5KQ8 A;  1QSY A;  4FZX C;  2H3G X;  2YHY A;  1M90 O;  5BN8 A;  2RPI A;  5CR4 A;  3TAQ A;  3QET A;  2ASP A;  1BO5 O;  3VQ4 A;  5DM7 L;  1MU2 A;  4RW8 A;  4AF1 A;  3FGU A;  2VQE K;  1Q7Y O;  1WBB A;  4B1W B;  5AQT A;  4E0D A;  1NJY A;  3AA4 A;  4QS8 A;  3TAN A;  1J53 A;  1ATR A;  4I6M A;  2F4V K;  3O9R A;  3S3N A;  4CZG A;  2O8D A;  3NVK A;  3J81 O;  3KLG A;  4KRF A;  2ZE2 A;  3P5J A;  3QES A;  4XIU A;  3GBT A;  2KFZ A;  4CJQ A;  3ID8 A;  5FPN A;  3C6U A;  3CCM N;  1BG3 A;  4LFB K;  3H1V X;  1VAZ A;  4AM6 A;  1QHT A;  4LFA K;  3OS0 A;  2IS3 A;  2OPP A;  4BE0 A;  2RKI A;  1HQU A;  1Z26 A;  3KKR A;  4L3Q A;  3KJV A;  1HNX K;  4NYN A;  4Z4E A;  4CIG A;  4CJS A;  2HST A;  4IOC L;  2G8H A;  3L3U A;  4RW6 A;  3D6R A;  4LFC K;  4X65 K;  1HLU A;  4M45 A;  3L3V A;  2D1K A;  3SUQ A;  4C8O A;  2HVH A;  3HT3 A;  3I0R A;  1NK7 A;  3IG1 A;  1SKW A;  3VN5 A;  4QS9 A;  1S1U A;  1A5X A;  3A5O C;  3CQY A;  2OYQ A;  3QNO A;  5J2P A;  1N6Q A;  4M63 C;  2HMI A;  4JS5 A;  1IBK K;  4BRF A;  4B1X B;  3HL8 A;  5KRT A;  1ZYQ A;  3UKU A;  3E9O A;  4FLX A;  1M1K O;  4HWI A;  1YIT N;  2GEL A;  4KH5 A;  1X9W A;  4YOY A;  1XQS C;  4CD3 A;  4HUG A;  1YT3 A;  3MED A;  1RTH A;  3OYK A;  2FSN A;  3QFU A;  5GAD P;  1V4S A;  1S5J A;  1TK0 A;  1IG9 A;  3VEX A;  4RTF D;  5FRM A;  3QER A;  2ZGY A;  5F2R A;  1QTM A;  1CLQ A;  5M1O A;  3UE5 A;  1UOC A;  1ASU A;  2KKZ A;  1RTJ A;  3CMA N;  2XO7 A;  4ILH A;  2P9S A;  4CW7 B;  1QQC A;  1VSE A;  5E41 A;  4YOU A;  1LAV A;  3HPH A;  2O8C B;  1XI1 A;  1J54 A;  1YF5 L;  2YHW A;  5EU7 A;  1XC3 A;  1YI2 N;  3S41 A;  1RDB A;  4DV1 K;  3RRG A;  3TAG A;  2P9I B;  2XHB A;  4MLH A;  1RT3 A;  3QIC A;  2WFB A;  1WBD A;  3ALY A;  3L8B A;  1YHQ N;  4BE2 A;  2NNW A;  2BH1 A;  3DLL L;  3B6O A;  4OPK A;  4KTW A;  1QQN A;  2E20 A;  1VQ5 N;  1NGH A;  1UA0 A;  3E9L A;  3KHY A;  1MWK A;  5M1K A;  1QSS A;  3VQB A;  4DLG A;  3TAE A;  4JI1 K;  3PV8 A;  3D2F B;  1FW6 A;  4FWS A;  4KAZ A;  3EKS A;  4EAH D;  1NKB A;  4FLV A;  2G8I A;  2B4J A;  4DSJ A;  1SQK A;  5CY4 A;  4LF7 K;  1C1A A;  5EXW A;  2O4I A;  3P1G A;  2AA4 A;  2OPS A;  3U6F A;  1JL1 A;  1NGC A;  4GMJ B;  4GKK K;  3S9H A;  4YDU C;  4FJ7 A;  3ZSX A;  4BAC A;  3HYF A;  3HSC A;  4H5N A;  3CCV N;  4YY3 K;  2XY5 A;  2IDO A;  3CD6 N;  5BPM A;  3QEP A;  4O44 A;  1QS4 A;  3O80 A;  4N76 A;  1HKC A;  3P4I A;  4FVM A;  2O8C A;  4DQP A;  1BI4 B;  4DR3 K;  3SV4 A;  5AQZ A;  2EX3 A;  3NDK A;  1W9H A;  1P8Z A;  5AQH A;  3RWU A;  1J5O A;  4BE1 A;  4XEI A;  2W42 A;  5K14 A;  1IG8 A;  3VA0 A;  3VF4 A;  1KVC A;  3KLI A;  5AZJ A;  4DFM A;  2P51 A;  4I9Q A;  2F8T A;  2YV0 X;  1NGD A;  4KHQ A;  2JWK A;  1EXQ A;  2E6L A;  4B9Q A;  4JK7 A;  4B08 A;  1ZBH A;  5HRO A;  4Z4H A;  3NVM A;  3G71 N;  4DSF A;  3KD5 E;  4IDK A;  3VEN A;  4B9S A;  4C8N A;  4A62 A;  4LF4 K;  4KRE A;  2ITM A;  1DT9 A;  3AY9 A;  3K5M A;  3OYL A;  4DV4 K;  3PSI A;  4B3S K;  3NBP A;  3H3O B;  4BDZ A;  4CIF A;  3SV3 A;  4JI2 K;  3KD1 E;  4MDA A;  3AO4 A;  3P38 A;  2P9L B;  3ZYY X;  4KV8 A;  4O5F A;  4CZE A;  3IKM A;  4CER A;  4YOW A;  2QI2 A;  4JKB A;  4IFV A;  5JVH L;  4M3T A;  1VQP N;  5BN9 A;  3MEE A;  2KLA A;  3W0L A;  4PQU A;  4CZL A;  1RT4 A;  2XY7 A;  1XMO K;  3LAL A;  1R59 O;  3MN6 A;  4Y1C A;  5M1Q A;  4BRD A;  4M3W A;  1LCU A;  5KPZ A;  3N4Q A;  5AQR A;  1KFS A;  3K5N A;  4PKI A;  3ITH A;  3EEQ A;  4DR7 K;  2YHB A;  3WXJ A;  4JAX A;  2V7Y A;  3MEG A;  5JLF A;  2KZZ A;  3D2E A;  4BRG A;  4K25 A;  4IJN A;  1Q9X A;  1BQM A;  4KPY A;  2YJF A;  1RBU A;  4J2D A;  2IVN A;  2O8E B;  1OH5 A;  4B9T A;  1ILY A;  1NNE A;  1JLG A;  2G8V A;  3M3Z A;  3CJ7 A;  3F9M A;  3ZX0 A;  4B1U B;  4M3Y A;  1EO1 A;  3E01 A;  2O4G A;  3GL1 A;  1VSJ A;  2FLO A;  4CIE A;  5BRE A;  1S1V A;  4JKC A;  4BDY A;  4ISG A;  1RT2 A;  2FBY A;  4FOE A;  1CZB A;  3WQT A;  3L0Q A;  3TSU A;  3EYZ A;  4JI8 K;  3FR0 A;  4FJH A;  3LAK A;  2BAN A;  4FWK A;  3THY B;  1HPZ A;  3SAG A;  3LL3 A;  2GTD A;  3WXI A;  4JI6 K;  1VQ7 N;  2HHH K;  4Q5V A;  3SQ0 A;  1VQL N;  4QOZ B;  4YOT A;  3VTI A;  3CER A;  1OKJ A;  3G10 A;  3TR8 A;  4DV2 K;  1IKY A;  5AQO A;  3SBT A;  4PL8 A;  1VQN N;  1A5W A;  2ETJ A;  4OKJ A;  4EHU A;  1GOA A;  3T1H K;  4EP4 A;  4FJI A;  5C15 A;  5AQW A;  3K0S A;  3AAP A;  2Y1I A;  3KWG A;  5B8H A;  2WUS A;  4AHS A;  4BRA A;  2NRH A;  3C95 A;  2YJE A;  4PWD A;  4A5A A;  3V1O A;  1QVF M;  4CK3 A;  2E2P A;  3L2V A;  4J8F A;  4NLB A;  1BA0 A;  4ICL A;  3ZT3 A;  2V51 B;  3VQ5 A;  4R5P A;  2ZD1 A;  4NXM K;  1O1W A;  2G8W A;  2FSJ A;  4JHD A;  4CI6 A;  4CFD A;  1I39 A;  4CGD A;  4FM0 A;  2HBM A;  2FF6 A;  4RG8 A;  1SL1 A;  3RTV A;  4Z94 A;  4C8K A;  4CEE A;  1HYV A;  3OYD A;  1HNZ K;  1NOZ A;  4B1Z A;  4CBU A;  4FWP A;  3HPG A;  3WNF A;  4M42 A;  5F0X A;  1RT7 A;  1L3U A;  1KQS M;  4OLA A;  3U3Y A;  3R1X A;  3NCI A;  1LW0 A;  5EOY A;  1Q82 O;  3TAM A;  3KK1 A;  3I55 N;  3NF7 A;  4CBX A;  4HTU A;  4CJE A;  4DFJ A;  5M1N A;  4BR2 A;  4DTU A;  2F7T A;  1YAG A;  2HNZ A;  3F2K A;  2QEX N;  4B3R K;  1BIU A;  4BY9 C;  1VSD A;  1BOT O;  2XY6 A;  4CF8 A;  1KD1 O;  1VQ9 N;  1HPM A;  3H3N O;  3UKU B;  4KI6 A;  4JD2 A;  3QIP A;  1QHA A;  3UIQ A;  4XH1 A;  3BF3 A;  4DQ8 A;  1NK0 A;  1ZBU A;  4FK0 A;  2EWS A;  2BE2 A;  4KTZ A;  3ZSO A;  3P83 D;  3CQ8 A;  1Q81 O;  4PKH A;  3VEW A;  1IV0 A;  5KQD A;  1N34 K;  1RNH A;  4FW2 A;  2G8U A;  3KK3 A;  4BR9 A;  4ISF A;  3LPT A;  4OGC A;  1FXX A;  1RBT A;  5DMR A;  1OH7 A;  1JL2 A;  4H0X B;  4CJU A;  1NK5 A;  3OBW A;  4H0T B;  4FK2 A;  3PX0 A;  3HTV A;  4M7X A;  3ULD A;  4IXC A;  5LMU K;  3AVL A;  1C0G A;  3OHR A;  4PY5 A;  5AFU H;  4F4K A;  2HW3 A;  3OJU A;  2A5X A;  3HZ6 A;  1TK5 A;  2NRW A;  4WFA L;  4BWM A;  5J2Q A;  1KCF A;  4I2Q A;  2Q2R A;  2Q1N A;  4DTS A;  4CF2 A;  1ASW A;  1GLB G;  3SUP A;  2B6A A;  4M3Z A;  2O8F B;  3CJA A;  4BRP A;  3K58 A;  2AP1 A;  4JLH A;  4E1J A;  3H6E A;  4JI4 K;  3RMD A;  3G6E N;  4FL9 A;  4FJJ A;  3DMJ A;  4IG0 A;  3KVG A;  2O8B B;  4PHT X;  1JLF A;  3D2F A;  3LAN A;  3NH2 A;  1JLB A;  4ELT A;  3B8A X;  4MDB A;  3AVH A;  3OW2 M;  2OCE A;  4H5T A;  3SAF A;  3CJ1 A;  1RTI A;  5KGX A;  3OYN A;  2A40 A;  5BRH A;  2YI1 A;  4CES A;  4Q0B A;  3ASM A;  3EE8 A;  1RDW X;  4JKH A;  2FC0 A;  4BRE A;  1S1W A;  2P9P A;  4X64 K;  1HKG A;  3SI6 A;  3WEE A;  3QBX A;  1TYQ B;  1IKX A;  4W5T A;  1WSJ A;  3MN5 A;  2IVO A;  4Z4F A;  2HVI A;  4JRP A;  5JS1 A;  4A5B A;  4AHR A;  4FK4 A;  4F2R A;  3ENH A;  1NJX A;  3R6M A;  2HB5 A;  2DFH A;  1RBS A;  3R3L A;  3VQP A;  4BG8 A;  3CQX A;  2NLX A;  4JKD A;  4IFE A;  5HOO A;  3WXL A;  3CET A;  2O8E A;  5GIO A;  1LWE A;  3VF6 A;  4B9N A;  1NK6 A;  5ADX A;  3OBY A;  2HBK A;  2OPR A;  1L5U A;  4MFB A;  4CGH A;  3SPY A;  2WTU A;  4FVU A;  2D0B A;  1YXQ A;  2QXL A;  1BU6 O;  1RDA A;  4DF4 A;  2PBD A;  2YNG A;  1NJI O;  3KZB A;  3MX2 A;  4EFH A;  4O4G A;  3QFP A;  3ZET A;  5C12 A;  3Q7B A;  2P9N A;  1Z6R A;  4CZI A;  2HHQ A;  3KLE A;  3QDK A;  3AVJ A;  3NMU A;  3DAW A;  3CPE A;  2VG6 A;  5C2F A;  3DXK A; 
#chains in the Genus database with same CATH homology
 4DR4 K;  4DV6 K;  1HNW K;  1N33 K;  1FJG K;  4JI1 K;  1HNX K;  3JAM O;  2UXB K;  1J5E K;  4NXM K;  4JI7 K;  4LFC K;  1N32 K;  4X65 K;  4LF7 K;  4JV5 K;  4JYA K;  1N36 K;  1XMO K;  4JI4 K;  4YHH K;  4LF5 K;  5IWA K;  2UUA K;  5LMN K;  1HNZ K;  4GKK K;  3T1Y K;  1IBK K;  1IBL K;  4DUY K;  4X66 K;  4YY3 K;  2UXC K;  4CVN E;  5LL6 Z;  4DR7 K;  4AQY K;  4NXN K;  4DR5 K;  4OX9 K;  4GKJ K;  4DR3 K;  4X64 K;  5BR8 K;  1I94 K;  4DV5 K;  4B3R K;  5A2Q O;  4LF8 K;  4JI3 K;  4DR6 K;  3J80 O;  4CW7 B;  4DR2 K;  4B3T K;  4DR1 K;  3J7Y P;  4DV0 K;  2UXD K;  2UUC K;  4DV3 K;  1XMQ K;  4JI5 K;  1N34 K;  2E5L K;  3J7A P;  2VQE K;  4JI0 K;  2VQF K;  4JI8 K;  4V19 S;  4DV1 K;  1XNR K;  4LF9 K;  4JI6 K;  3OTO K;  1IBM K;  2HHH K;  4LF6 K;  4LF4 K;  5FLX O;  1HR0 K;  2F4V K;  4DUZ K;  3J81 O;  4DV2 K;  2UUB K;  5LMU K;  2UU9 K;  5IT9 O;  4X62 K;  4DV4 K;  4B3M K;  4B3S K;  4KHP K;  3T1H K;  4K0K K;  4LFB K;  4DV7 K;  4JI2 K;  2ZM6 K;  1XNQ K;  4LFA K;  5AJ3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...