4JYAK

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4jyaK00
3T1YK 4JI3K 4NXMK 4LFAK 4LF4K 4JI2K 4DUZK 4B3MK 4X66K 5LMUK 1XMOK 4JI6K 4JI8K 4DV4K 4DR6K 5AJ3K 3OTOK 3J7AP 4CW7B 2E5LK 1N34K 5LMNK 5A2QO 1HNXK 4V19S 1HNZK 4DV6K 4YY3K 5IT9O 1XNQK 4DV5K 4GKKK 1I94K 5BR8K 2HHHK 4K0KK 4JI5K 4DR3K 4OX9K 4B3TK 1IBMK 4JV5K 4DR2K 5FLXO 4DV1K 1XNRK 4JYAK 1IBLK 2UUCK 2VQEK 4B3RK 4X62K 2ZM6K 4LF9K 2UXCK 1IBKK 4JI1K 2F4VK 2UU9K 4LF5K 4KHPK 4LFBK 4AQYK 4X65K 1N36K 4GKJK 3J81O 1XMQK 2VQFK 4DR1K 1J5EK 2UXDK 4DUYK 4LF6K 2UXBK 4DR7K 4B3SK 1N33K 5LL6Z 2UUAK 4LFCK 4JI7K 4JI0K 1HR0K 4X64K 4DR5K 4YHHK 3JAMO 3T1HK 4DV2K 4DR4K 1HNWK 4NXNK 4LF8K 1FJGK 4LF7K 4DV7K 5IWAK 3J7YP 4DV3K 3J80O 4JI4K 4CVNE 4DV0K 2UUBK 1N32K
chains in the Genus database with same CATH superfamily
4DSEA 4IZ9A 3DLEA 1T7PA 4YOTA 3NH0A 4C1NK 3VQ9A 1R0AA 3CFOA 4EHUA 1XWLA 4N56A 1WSGA 2ZJQL 3QIOA 2P9NA 4JS4A 4B3MK 4EP5A 3VOVA 3THXB 3SMPA 3CCRN 4YORA 5ELZA 1QZ6A 2GX9A 3THVA 4H8KA 1DT9A 5KRTA 2P9KB 3IFRA 1N34K 3WQTA 1HNXK 1BI4A 5AQYA 1TKXA 3ULEB 4YY3K 2DTUA 2IDOA 2WTUA 4DTJA 4WFNL 2YNHA 1D5AA 4IG0A 4CJ5A 2G8HA 1S9EA 5AQUA 3TTFA 4IWVA 4GV6A 2VQEK 4Z4IA 5AQNA 5JICA 1Q86O 3AARA 1CZ9A 4HTUA 3VQ7A 3MK6A 4I9QA 4DMNA 2D4WA 3OYMA 1HYZA 1EETA 4KV8A 2UXDK 3VGLA 3WQUA 2OZSA 3QLHA 4B1UB 4CIGA 4CHQA 3HOSA 1I39A 4O0IA 3KLFA 2UUAK 1W7AA 3I8DA 4JI7K 3BF1A 1A5WA 4B1VA 3LDPA 1KC8O 4FJ9A 1N6QA 3THWA 3CHWA 3QEPA 1EWQA 2NNWA 2P9PB 3HL8A 2R7YA 3S41A 4DR4K 3G25A 4NCBA 2HBLA 2HHUA 3V1OA 4JD2A 3MX2A 3WNFA 4H03B 3A2FA 3OBWA 4HCBA 4DV0K 5JS2A 4CJ3A 3VEOA 1TAQA 3NBPA 5HP1A 2KTQA 4CBXA 4CEBA 3WNEA 2VG7A 2XY8A 1GOAA 1L5UA 2CH6A 3DJCA 5BRHA 3AA3A 4DB3A 2NRWA 4LFAK 4FJHA 4BRPA 3DM2A 2YHXA 4JI2K 3G6EN 1Q9XA 3KLEA 1J53A 2OA8A 1DLOA 4AHRA 3ENOA 3SBTA 3HVTA 2FXUA 5AFUH 4J2DA 3U9ZA 3NVMA 4H5RA 3CPEA 4O0JA 4DFPA 4B1ZA 5CZ1A 1GLBG 4FJJA 1LOTB 3DLGA 5JLFA 1QQOA 1SKWA 1VQ4N 1HNZK 3KLHA 1K9MO 2O8CA 3A5LC 3LPUA 1ZBFA 1U45A 4CHPA 3KLIA 3M8QA 4I2QA 3L3UA 3WEEA 2P1JA 5BRFA 1Q81O 5FPDA 2HMIA 2P9IB 2BH1A 5AQVA 2Z1GA 4HTLA 1RT4A 3HBTA 2F4VK 2KZZA 3I0RA 3Q7CA 4Y0WA 4A61A 2E2PA 5LJWA 4O4GA 2VCPA 4FK0A 4ID5A 1SQKA 2X74A 1TL3A 1BI4B 4E7KA 2YCHA 4N41A 2ITGA 1GLAG 1NGAA 3D45A 3QEWA 1VSLA 1NJXA 5C2DA 4PL7A 2ZJPL 3CJ9A 3A8YA 2KKZA 4YHHK 4ELUA 3HVRA 3NF9A 5GAHP 4FSVA 1ITGA 1E4FT 1JL1A 1VQ8N 3OYEA 1HRHA 1TL1A 4AHSA 1HYSA 1X9MA 4BGAA 4YOUA 3QMLA 4JI4K 2BTFA 1NGCA 4QS9A 3WXKA 1LAWA 4N5SA 3BGRA 3L2QA 4FWQA 4A2BA 1W0HA 1SKRA 3L6QA 1H1VA 4RW4A 3H3OB 3EZ5A 3K57A 3O9QA 1SV5A 4QS7A 4HUFA 4E3SA 5KPTA 4DQRA 3M5RA 3FZLA 1NLVA 5HRNA 3G0ZA 1K8AO 3QIPA 3QFPA 1B9DA 3ZEUA 1BCMA 4BY9C 4CJ7A 4DTPA 3RMCA 4WF9L 1ATRA 4DR6K 1DTQA 4Q5VA 2W42A 3U8XA 3FZFA 4DTMA 3NVKA 3THYB 1S72N 4JKGA 4NYNA 1IKWA 2Y1IA 2FSNA 2BUPA 1UOCA 3VEYA 4DWIA 1NOYA 3NGYA 3CD6N 3MWTA 2HF3A 1ZYQA 5JS1A 4JK7A 4DV6K 4ZHRA 4JK9A 5HROA 4K0KK 5ADXH 2O4IA 4DTUA 2F8SA 1G15A 4RW6A 4ZTFA 1IO2A 1JKHA 1NK0A 3QFUA 3CCEN 5FLXO 1XNRK 4N47A 4H0TB 1HKCA 4M63C 1IBLK 3O8MA 4FYDA 2HNDA 5LY3A 2NUBA 5FDLA 5I9EB 1U48A 3T7ZA 4ILHA 3O9UA 3KZBA 4H0YB 1NK8A 5J2NA 5AQQA 3CJ1A 2WFBA 3ITHA 4M3RA 3NF7A 1LWFA 1NKBA 4EIAA 1K8KB 3B6PA 3HTVA 3CC7N 2W40A 4CE9A 1HX1A 2QK9A 2VQFK 1TKZA 1J5EK 2A3ZA 3IUCA 1BA0A 2QWLA 3L4QA 1GOCA 3F73A 1VAZA 3R1XA 2O8CB 4JRQA 4QCLA 4BC4A 1OKJA 1C0GA 5JLHA 2ASOA 4HVJA 4FM1A 3MXJA 4E1MA 4M3XA 2O8FA 4JI0K 1HLUA 4PHTX 5BREA 4BRCA 4Z0UA 3L4IA 2HHQA 2H3GX 1U6ZA 4LF8K 4C8KA 3J7YP 4IG3A 2E6LA 1RBVA 2HBJA 3PSIA 1RDDA 4I9LA 1RNHA 2OPSA 2B5JA 2PYJA 3CJ7A 3LWLA 5DM7L 5J2PA 3EY1A 2CGKA 4CJVA 4E19A 3CERA 3KHYA 4FJ7A 3EO3A 4B9VA 3AGRA 1P90A 3PX4A 3N4PA 5D3GA 2IS3A 4DUZK 5I42A 3AO2A 4WE1A 2JGUA 5AQFA 1HKBA 4PUOA 3QINA 1XHZA 2A1SA 2KFNA 1SL0A 3V9SA 5C0YA 1A5XA 3HPOA 1QQNA 4KHYA 4OJRA 3QEVA 1NJYA 4GV9A 4E7LA 4CFBA 4O8KA 1TVRA 3K58A 2ZWHA 2NRRA 4H0VB 4CZEA 4JI5K 3OYGA 2D1KA 3AVFA 3EEQA 4FJIA 4AHTA 4IDHA 1KFSA 3LM9A 4F4KA 5GAEP 4J8FA 2W6KA 3KTQA 3AVAA 4I6MB 5CYMA 2Z1IA 3P5JA 4DSFA 4B9TA 4CEFA 3TTCA 3NFAA 4JKGB 1LWCA 4GW6A 2B6AA 4BG8A 4W5RA 4AQYK 1WB9A 4KAZA 1KLNA 4A2AA 4PWDA 2AP1A 2KHOA 1L3UA 4J2EA 3WXJA 3ASMA 5CYQA 4DSIA 4F2SA 3O4QA 1KTQA 2FSJA 1RBRA 2UYTA 3HM9A 3TTDA 3G71N 4B9MA 5C10A 1HR0K 5TKWA 5AQTA 4FOEA 3T1HK 1Y97A 3VQ4A 2IVOA 2O8BA 2HHTA 4LH5A 4CD3A 1TGOA 1HPMA 4CVNE 3KWGA 1NGEA 1U49A 2HW3A 2HBKA 1HMVA 2IVNA 5H1SQ 4DFJA 4PL8A 3ID6A 4IFVA 4LD0A 1QQCA 1RILA 5BPNA 2Q36A 4IKFA 4B9LA 1RT6A 3U3GA 1HQEA 4WYBA 4JKBA 3HM8A 4KBOA 1XMOK 3NMUA 4DG1A 1IH7A 2ATQA 1C1CA 4YOXA 5EXWA 4BVPA 2YI1A 3E9LA 3BY5A 3GG4A 4KH6A 2PBDA 1VQ6N 2GUIA 2IGIA 3H1VX 4CJEA 5DM6L 3PIPL 4BWMA 1KAYA 3CETA 3LDNA 3UE5A 2P9LA 4BQLA 4FVUA 4FPBA 2E8AA 4CZHA 4KTQA 1TK5A 5FRNA 4M3WA 1VQPN 1EKEA 5AQWA 4CFDA 4CZGA 4DCHA 4M45A 2P9UB 4CGDA 3ZT4A 2X78A 1OH5A 2YNFA 1QHAA 1E4GT 4FW1A 3M8SA 4DTXA 1IG9A 4GV3A 1NG9A 3CQ8A 2QXFA 3ZETA 4KO0A 1NKCA 4RW7A 4FJXA 1VQNN 5KGWA 5FROA 3MN9A 1E3MA 5AZJA 3ZT2A 3CYMA 1N36K 3GBTA 4A57A 2F96A 4CHYA 1JLCA 3AA2A 3RMDA 1Z05A 4DU4A 2ZJRL 3S9HA 1RT1A 2Q97A 5DK5A 1ASUA 1HQUA 3PLAA 2KQ2A 3SAHA 2ZE2A 1VSIA 1CXUA 2A41A 4OVLA 4K42A 4DHYA 5J2QA 4CBUA 1S1WA 1W9HA 3C65A 1BQNA 3NAEA 3TSUA 1T05A 3V6DA 3MWPA 3SNNA 4OO1J 1U4BA 2XRIA 2Q1NA 1KAZA 4CK1A 1L3SA 4BR5A 1C0MA 3HSCA 2E2NA 3OJUA 4F8RA 4E1JA 5E26A 3TWHA 3MCAB 3C7NB 1KVAA 4ILJA 4BGBA 4KH5A 4FXDA 4WQ4C 3SV4A 3TARA 4FWLA 5LMUK 1NGDA 1QS4A 4JI8K 3RSEA 3G4SN 2BE2A 1M1KO 5AQPA 5DMRA 4CGFA 1M90O 5FRMA 3ZSZA 2E2OA 5LMNK 2Q0UA 4C8OA 3CIPA 5EY4A 1EWRA 2QA4N 1JL2A 4EFHA 1T03A 4WFBL 3DOKA 4JKHA 3U9DA 5HRPA 1DEJA 3DXKB 4CJLA 4HHTA 1J5OA 1CZAN 3CM5A 2WOMA 1YXQA 3LZJA 3A0IX 3MDQA 4Z4CA 4CJRA 1V4SA 5SWMA 5AQSA 3DRPA 2UXCK 2YV0X 5TKYA 4FWKA 1F21A 1KAXA 3LDQA 3HI0A 3K5MA 3M8RA 3LZIA 3HT3A 3DRRA 4O8UA 3VGMA 4CERA 2FC0A 4BRAA 2P9LB 4RW8A 4EP4A 3U3YA 5LL6Z 1FW6A 4CF9A 1TAUA 4DS4A 1U04A 3CG7A 4BVOA 2P9SB 2BDPA 1MDUB 1BWFO 3VQDA 2GTDA 4FLWA 1MA9B 4EAHD 4A62A 4DFKA 1NBWA 1T6CA 5FPMA 3FFIA 4YDUC 2G8KA 3QBWA 3ZETB 4LF7K 3RMBA 1VSKA 4A5AA 5EVZA 3SUOA 1QVFM 1LW2A 4JLHA 4YNQA 5AZJB 1HKGA 1WBDA 1WUAA 3NCIA 3UKUB 3ZCMA 1HNVA 3CQXA 3D2EB 2E20A 3F5TA 1RT2A 4JI3K 3S3OA 3NGIA 1Q9YA 5KQDA 5M1OA 2E88A 2Q3SA 3O9RA 4ID1A 3CF5L 3A5NC 3H46O 5AQLA 3T19A 4FWOA 2E2QA 1LAVA 5AJ3K 4FL9A 1SKSA 3ZSOA 3CCSN 3J7AP 2OTLN 4CW7B 1YIJN 1N5YA 1BIUA 3CPWM 2FBXA 5EOYA 1JLQA 3CI5A 4IO9L 3AAPA 1ZBLA 3VEWA 3OYLA 1K6YA 1HPZA 4NB4A 1TUUA 2QWMA 3PIOL 1VQ5N 4GKKK 5J1EA 3EKSA 1BDGA 4DR3K 4NCGA 3N4QA 4BR0A 3KKRA 3W3DA 3GE1A 4FWPA 4DR2K 2ZGZA 4BRGA 4FOIA 1ATNA 3FR0A 2A40A 1J54A 5CY4A 3RWUA 3RVCA 2ZGYA 1KD1O 2O8DB 3QO9A 3CCLN 3TABA 1BCOA 5CR4A 1C1BA 2JWKA 3VTIA 3RR8A 4LF6K 2UXBK 1BA1A 1SZ2A 1N33K 2DFEA 2WONA 1D4XA 2DFFA 2P9NB 3LALA 2I7PA 5CE3A 3LP2A 3O4NA 2QWNA 4CGGA 4FWMA 4KB1A 2NZTA 3AVJA 4KH4A 2YHYA 3CFRA 1IKYA 2E6MA 4OPJA 3O08A 1SS6A 4KI6A 1KVCA 3MXIA 4DV7K 4DV3K 4Y1DA 1NGHA 3TANA 1D9DA 1JLEA 4CJQA 1OVYA 3AVCA 2UUBK 4Z4GA 4FM2A 4AF1A 4AHVA 1VSEA 4B9QA 1YT3A 3DWLA 4YFUA 4M3UA 3SV3A 1J6ZA 4NXMK 3O3HA 3OYCA 2QXLA 2KZMA 4JKDA 3VQQA 1S6PA 2HMPA 4JI6K 4CGHA 1P8ZA 4DF4A 4C8NA 3CC4N 3ZX3A 4DKWA 3ZSXA 2E5LK 3SZ2A 3JYTA 1WLJA 2HSTA 3H3NO 4IJAA 4NYFA 2FBTA 4IEIA 5BR9A 2YHWA 4BRFA 3O6WA 1ILYA 3SQ4A 3O4WA 3THWB 3ZSRA 3O1BA 4CEOA 2VYPA 4B1WB 4CEZA 1IG8A 2VG5A 1BG3A 3OW2M 3OVNA 4M7XA 3MEDA 4C8MA 1RTIA 3QETA 5GIOA 4JD2B 4LF9K 1NJWA 1UWBA 3AAQA 3A5MC 4FLZA 3OHRA 5AZIA 1S3XA 4PY5A 3ZT3A 3LANA 1YVUA 4BE2A 2HHSA 3AO3A 3KKSA 4H0PA 4DR7K 4UY8O 3SYZA 3PV8A 3VERA 4M41A 4BE0A 3Q7BA 3C6HA 3QBXA 2RF2A 2IC3A 1NK9A 1W97L 3BUZB 3WNHA 4FM0A 1X9WA 3OYJA 5EX5A 3OYFA 4KHUA 2NRXA 3DRSA 3KK2A 3L8BA 3VQ8A 3CCJN 3QNNA 1NGFA 1FJGK 4AHCA 1X3MA 1U2VA 3O3GA 4BRLA 4CJ4A 3IS9A 1VRTA 3K5LA 5AQZA 3T69A 4BRDA 2YHBA 2F9TA 3WEEB 4CK2A 3SJJA 4CHZA 4BDZA 1B9FA 3LPTA 4BC3A 4GVEA 1L3VA 3EYZA 1DKGD 3KD5E 3SQ0A 4WQ5C 5M1NA 3C0BA 1KRPA 3OA9A 2PYLA 2GWJA 1RDCA 3U6FA 2HHWA 4JKFA 4KHQA 3KLGA 4K25A 3VF4A 2GV9A 3SPZA 4C8LA 1DGKN 1JLFA 4CF0A 4A5BA 1C0TA 4DV5K 3TAQA 1I94K 3PO4A 1NK5A 1RBTA 4KTWA 3M8PA 3DXMA 2BGGA 3ID8A 3I56N 1HYVA 3TAGA 3EE8A 1C0UA 3K9JA 4W5OA 2P5OA 1OH7A 4M3YA 3SUPA 2IOCA 4B3RK 1GLDG 1TYQA 3P39A 1IBKK 4JI1K 3HK2A 4JHDA 2QEXN 3AA4A 1VSMA 3CCMN 3L3VA 4LFBK 1QTMA 5C12A 1T8EA 1RFQA 4FJGA 1WOQA 4X65K 3H1QA 5HBMA 1XMQK 4R79A 4CEEA 4CJFA 3QNOA 1X9JA 1NGJA 4BDYA 1FKOA 3DAWA 1NK4A 1HUXA 2D0CA 4FCYA 1GLEG 4E7IA 3ZEUB 4LFCK 4BWJA 5AQRA 2XO7A 2CGLA 4H5NA 4AILC 2HHVA 4B8AB 3QEIA 3VEXA 3HO1A 4DR5K 4FZXC 4ELTA 3FE1A 4WQ4A 3E9OA 3HZ6A 1WSIA 2FF3B 1KFDA 2RHKA 4BR9A 5AZIB 1LV5A 3OYNA 1VQLN 4NLCA 3VMFB 3LL3A 1QSLA 2ETJA 2AA4A 2ZD1A 3C6UA 3VQ5A 3VENA 1N32K 2QWOA 4E0DA 1YITN 4CEQA 4DSJA 4BRIA 4Z94A 3T1YK 3E01A 5J2MA 3SK3A 4MLEA 4ISFA 4FLYA 4B1YB 1TUYA 3L2VA 3V1RA 3DMJA 4NLBA 5AQIA 1RCHA 3ULDA 5JVGL 3CC2N 2OTJN 4NO7A 3F9KA 4DU3A 2QTDA 2IAJA 2YKMA 4PKGA 3A5OC 3VF6A 1QQMA 4F3OA 3CFPA 1IKVA 1IV0A 1WSFA 3VEVA 3VQEA 3VF2A 2HHHK 2O8FB 3AA5X 1BIZA 1JCEA 4FWNA 4O5FA 5HRRA 2W41A 4CESA 4HWIA 3OYHA 3MX5A 2ASMA 1REVA 2HOEA 4RTFD 4CZLA 5E41A 3D2FA 3DI6A 3ZX2A 1WSJA 2RKIA 4O5BA 2YNIA 1XUPO 3S3NA 3THXA 3V9XA 4BROA 1V4TA 4YOWA 4K41A 4CF2A 1UAXA 2VG6A 3LDOA 5FPNA 3FGUA 4FJLA 4OGEA 3FLCO 2P9KA 3HSTB 5M1KA 5JVHL 2NRTA 4ILGB 3UIQA 2J4RA 2D0BA 3BZKA 1QSYA 1S1XA 4IO8A 5AQMA 3TPQA 3ULEA 4BDPA 2D0OA 3PSFA 3ZSWA 1QE1A 3CXCM 3KK1A 4AHUA 2V52B 2D0AA 4FPAA 3J8AA 3JAMO 2QW9A 3SAFA 5KRSA 3RMAA 3QICA 2DY4A 4NXNK 4HUEA 2ZQBA 1TKDA 1UA0A 4JHDB 1ESVA 2WBNA 2E1YA 5F0XA 1JLAA 4CJUA 2HHXA 4FO0A 2XY7A 1VSJA 5F2RA 2B4JA 4H4OA 3R3LA 5HOOA 3EKUA 3VQBA 3LDSA 5KPZA 1RDUA 2YX6A 4B8CA 3K59A 4C1NI 1HNIA 2OANA 1WAFA 3M3ZA 1BISA 1VQ9N 2PZSA 1S1VA 1VHXA 4CZFA 4EHTA 1GLJO 1TK8A 3AVNA 4KFBA 4CJPA 4JRPA 4IJNA 1KQSM 3G10A 3CMEN 2BANA 1EP4A 4ISEA 3JS6A 1Q18A 3P1GA 4YOVA 3TAEA 1R59O 4IOAL 4CZIA 2P51A 3VQ6A 1RGIA 4DTNA 3I33A 1NGBA 4I7FA 4CEAA 4JAXA 4OX9K 2E4LA 1BHLA 4B3TK 4MO4A 3KWIA 4CFAA 4CF8A 4E89A 1X3NA 2Q2RA 1NKEA 3WXLA 1SAZA 3SBGA 2O8BB 3PX0A 1FK9A 4I2PA 2XY6A 1NOZA 1D8YA 3L0QA 2EWSA 1QVGM 4LF5K 2CH5A 5KI6A 2G8UA 2YHAA 3O5BA 3VTHA 3K2PA 1NNEA 1JJ2M 4JEPA 2YJEA 2YJFA 4CGIA 4DUYK 3VEZA 3PX6A 1BU6O 2A42A 4B9SA 2OZMA 2VWBA 4CZKA 1WSEA 2O4GA 2OPRA 2QI2A 4IBNA 4JK8A 4BACA 3OBYA 5GAGP 3UB5A 3LDLA 4IOXA 3DLBA 3OS1A 3D2FB 3QESA 3B6OA 1NGIA 1JLGA 2CGJA 3RR7A 1LWEA 1S1TA 1WSHA 1NU0A 2EX3A 4RWTA 3MXMA 4BG9A 5IWAK 4KTZA 2P9IA 4GMJB 3H45C 3ZLJA 3K5NA 4CFCA 1QZ5A 4R5PA 1NWKA 4K8XA 3V9WA 1KLMA 3T3FA 4B1XB 3HPGA 2GUPA 4L3QA 4FWSA 4GVMA 2HB5A 2VGNA 4J2AA 3BZCA 4LSLA 3SMSA 5AQHA 4FLTA 4KHSA 3DLRA 3ATUA 1RBUA 3LP1A 1BGXT 4X66K 1RT7A 4MDAA 5AQKA 3O9TA 3VPZA 1XC9A 1NK7A 2OPQA 4HUGA 1ZC6A 4DLGA 3OS2A 3SJHA 4LC9B 3EL2A 4YOYA 1HJRA 3QERA 4FJMA 5IT9O 3BDPA 4WFAL 5BR8K 4JNEA 4PA1A 1EX4A 4BC5A 1Q7YO 3LAKA 3TU5A 4JV5K 4CGJA 1SUQA 3P4IA 1C1AA 1RT5A 2QKKA 1N8RO 1EXQA 4AM7A 4OPHA 3MEGA 4IFEA 4BRKA 3CJCA 1MWMA 3PUFA 5C2FA 3ATVA 2G8FA 1YF5L 4FLXA 4FLUA 4DLEA 3KVGA 4OPKA 4FK2A 3O80A 4JKCA 3GOIA 2FF6A 4BQZA 1RTDA 3SI6A 3THYA 1SL2A 3J81O 3ZSYA 4DF8A 1Q82O 4KKOA 5M1QA 4PKHA 4B3SK 4DTSA 3C6AA 3PY8A 2WUSA 2QWRA 4JN4A 1JLBA 4OKJA 4E1NA 4BREA 4F3TA 3RSEB 2OPPA 3V9UA 2O8EA 3BF3A 1QHTA 4BR4A 4WQ5A 1GLCG 1IJJA 2QWPA 2HBMA 4FJ8A 3CCVN 4JKAA 1DTTA 1S6QA 3D0PA 1YI2N 2KLAA 5F1XA 5C42A 3V4IA 1ASWA 1KVBA 3DYAA 3HXMA 1YTAA 3TAPA 3ZYYX 5C15A 3VETA 5GADP 4FLVA 1T6DA 1GOBA 3OY9A 5HL7L 5AQGA 1K8KA 5GIPA 4Q0BA 4OLAA 5BRDA 4KHNA 3I55N 4FWRA 1EO1A 1OVQA 4LF4K 3H6EA 4IOCL 1C0FA 5K14A 3GDQA 3HOTA 1NM1A 3ISNC 3BP8A 4CD1A 3DLHA 3KK3A 3OJSA 2JWLA 3T1AA 1XHXA 4M42A 4KB0A 1XQSC 5T7BA 4KRFA 4CBWA 5KPRA 3WUHA 1W2BM 4CIFA 2G8WA 2FSKA 5CHIA 4E7JA 2ASPA 4Z4FA 1NK6A 4DTRA 2F8TA 3K0SA 4JKEA 3ALYA 4BC2A 3AO1A 4GNIA 4PQUA 1VQKN 1YTUA 3AVHA 3LM2A 4RCHA 1WBBA 4EZ9A 1LW0A 3AY9A 1BO5O 4H5VA 3SCXA 4JYAK 3R8EA 4JS5A 1YAGA 3JXUA 4NCAA 1D9FA 3KD1E 3WT0A 4FZYA 4MQ3A 5JMVA 1QSSA 3AVLA 1VQMN 1YHQN 3HP6A 2PFUA 1YJWN 4M3ZA 1VSDA 3CJAA 3SQ1A 3ZSQA 4B9NA 2YNGA 4MO5A 4GKJK 4DR1K 4CK3A 3LP0A 1GLFO 4ICLA 2W6LA 1YJNN 3DOLA 4H0OA 2HVHA 5LJVA 2XY5A 3QEXA 1WAJA 4E7HA 2KW4A 4FJNA 3D6RA 3K5OA 3GL1A 5EU7A 1Z26A 1VQON 4DV2K 1OH8A 4ELVA 2D0PA 2WC9A 2NRVA 3OS0A 4MDBA 4I6MA 1TK0A 3R6MA 1JXBA 4BE1A 4CEDA 4DTOA 1ZBHA 3FFKB 3L2WA 3CJBA 5BPLA 2FBYA 2F9WA 5HLFA 2G8VA 1BQMA 3AO5A 4GY2B 4DFMA 3D7EO 3OYAA 3HYFA 4O55A 2F7TA 1HJOA 5AQXA 4BRHA 4HCCA 5B8HA 1T3VA 2O8EB 4OLBA 2NLXA 2RN2A 3OYKA 1RDAA 1X1PA 1A5VA 4W5NA 4Z4HA 2Q31A 3F2KA 3I8BA 1S22A 3OTOK 4XEIA 3MN6A 2GWKA 3L2RA 1ZXOA 5SZTA 1S5JA 1I3AA 4TSXA 1RDBA 5BN8A 3MCPA 3HP9A 2FBVA 4BRNA 3FZMA 4MLHA 1RBSA 4U7BA 4G9ZA 1XC3A 4CJKA 4CI6A 4DQSA 1NJIO 3VA3A 1OH6A 5BPMA 4CJSA 1VRUA 3W0LA 4K8ZA 3NDKA 1IBMK 1YUWA 4QOZB 3AVMA 4DV1K 4DSLA 3LAMA 2QWQA 4Y1CA 4W5TA 4CIEA 4FZZA 5C25A 2X6NA 2I7NA 3AVKA 2HNZA 3E66A 2V7ZA 4KHPK 3VESA 3MMVA 2A5XA 3EN9A 1KSPA 5AFUA 3H08A 4LH4A 3PO5A 3O3FA 3CCQN 3OYBA 5AQJA 3NH2A 3ENBA 4A59A 3I0SA 3VGKA 1VQ7N 1VSHA 3VN5A 3E1YA 3NF6A 3SUQA 4DS5A 3F9MA 3HPHA 3TR8A 5KTQA 4X64K 5GINA 1MWKA 1X9SA 5E84A 3O1WA 2P5GA 4BRMA 2QKBA 1J9AA 2P9UA 3LP3A 4OGCA 3OYDA 1Z25A 3ZT1A 3V9ZA 3K9KA 1UA1A 5AQOA 1NJZA 3NGZA 3E9PA 3NF8A 4EZ6A 3TAMA 4FJKA 3AVGA 2Y1JA 1S9GA 3ZT0A 3O9SA 1Q8IA 1T44A 3ZX0A 4RW9A 4H0XB 5CZ2A 4DQPA 3DLLL 4Z4EA 4XH1A 3IKMA 3TSQA 1RTJA 4DV4K 3QDKA 3CMAN 2QM1A 2A6AA 1O1WA 4BR2A 1TKTA 4DSKA 1ZBUA 3RRGA 4FK4A 4C23A 2IIRA 4V19S 2V51B 3UKRA 1U47A 1YJ9N 1VSFA 4CJWA 2PY5A 2D5RA 3TI0A 4BRQA 3IG1A 2EHGA 4DQQA 1B92A 2HVIA 3HRGA 2RE2A 4W5QA 3MN7A 1XI1A 4IEEA 5C24A 1G99A 3R9PA 2UUCK 4O44A 2AJQA 1U2VB 3C7NA 5I3UA 3L2UA 1BUPA 2ZM6K 4H5WA 4F2RA 3EZWA 2UU9K 1JCGA 3P83D 3FZHA 1FKPA 2Q0RA 3C94A 4XH5A 4OPAA 3NHGA 4IFYA 1ZBIA 4F9OA 3SUNA 4AM6A 1CLQA 5BN9A 4KI4A 5FPEA 2KFZA 3VQCA 4KHWA 5M1FA 4M7YA 2VWKA 4L8RB 3AO4A 5MLCQ 2JLEA 3IAYA 4J2BA 4ZTJA 3B8AX 4XH4A 3FZKA 4RG8A 1MU2A 4YDUA 3TSPA 3WXIA 4CF1A 5ADXA 3SAGA 4OKEA 3IRXA 4BR7A 5M1PA 3SPYA 2A1RA 3DXKA 1NMNA 1C6VA 4KREA 3MN5A 1S1UA 4IXCA 4H4MA 3RRHA 2OCEA 4B08A 1TV6A 4IDKA 3J80O 3IMXA 1YVNA 1JCFA 3U4LA 2E1ZA 2ZF5O 4CHOA 3LWMA 3J7ZO 3AVBA 5HRSA 3DXMB 2ITMA 2GEMA 2HNYA 2GBZA 4DQIA 4B3OA 1ATSA 4MFBA 3QB0A 4ISGA 4XIUA 1JXEA 2YKNA 4CCHA 2Z1HA 1TYQB 2HF4A 4CZJA 2P9SA 3CCUN 4H5TA 3DLKA 2VGMA 4K43A 1KCFA 3VA0A 1ASVA 3HJFA 4FW2A 3AV9A 2IVPA 3VQAA 1RT3A 2LSNA 5A2QO 1XNQK 4M3TA 2RPIA 2PAVA 3MEEA 3MAQA 3KIOA 1EQYA 3SQ2A 1FXXA 4FJ5A 3C6TA 3NH1A 4DQ8A 4DU1A 1RTHA 2X6SA 3UKUA 1WN7A 3AGKA 4UQGA 1LCUA 3D2EA 3ZSVA 3MECA 4U67L 3C95A 1BOTO 1Y64A 3SLCA 2Z1JA 2P9PA 3KJVA 3EE9A 3V81A 3M1FA 4X62K 3AVIA 4FVMA 3CM6A 1L3TA 3P31A 3S3MA 3WXMB 2NRHA 4PKIA 5AR0A 3WNGA 2DFHA 1ZBSA 4CJTA 3UKRB 1BL3A 2DPNA 3ENHA 3P38A 5KQ8A 1SL1A 3NE6A 1KXPA 1CXQA 2V7YA 4G1QA 3RTVA 1WNSA 1K73O 4QS8A 2GELA 1RDWX 1GLLO 4LSNA 1NMDA 4OKKA 4AH9A 4B9UA 4WCEL 3BEXA 3JSMA 2VWJA 4LY7A 1CZBA 1O13A 3CQYA 1NGGA 1HNWK 1VK0A 2OYQA 3TAFA 3IDHA 4CZMA 4N76A 4KPYA 2I5JA 3OYIA 1Z6RA 3VQPA 3V1QA 2FLOA 3M6GA 4QAGA 1IKXA 4CECA 2G8IA 2O8DA 2XHBA 4CHNA 5KGXA 2NRZA 3KK7A
chains in the Genus database with same CATH topology
3T1YK 4JI3K 4NXMK 4LFAK 4LF4K 4JI2K 4DUZK 4B3MK 4X66K 5LMUK 1XMOK 4JI6K 4JI8K 4DV4K 4DR6K 5AJ3K 3OTOK 3J7AP 4CW7B 2E5LK 1N34K 5LMNK 5A2QO 1HNXK 4V19S 1HNZK 4DV6K 4YY3K 5IT9O 1XNQK 4DV5K 4GKKK 1I94K 5BR8K 2HHHK 4K0KK 4JI5K 4DR3K 4OX9K 4B3TK 1IBMK 4JV5K 4DR2K 5FLXO 4DV1K 1XNRK 4JYAK 1IBLK 2UUCK 2VQEK 4B3RK 4X62K 2ZM6K 4LF9K 2UXCK 1IBKK 4JI1K 2F4VK 2UU9K 4LF5K 4KHPK 4LFBK 4AQYK 4X65K 1N36K 4GKJK 3J81O 1XMQK 2VQFK 4DR1K 1J5EK 2UXDK 4DUYK 4LF6K 2UXBK 4DR7K 4B3SK 1N33K 5LL6Z 2UUAK 4LFCK 4JI7K 4JI0K 1HR0K 4X64K 4DR5K 4YHHK 3JAMO 3T1HK 4DV2K 4DR4K 1HNWK 4NXNK 4LF8K 1FJGK 4LF7K 4DV7K 5IWAK 3J7YP 4DV3K 3J80O 4JI4K 4CVNE 4DV0K 2UUBK 1N32K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y K;  4JI3 K;  4NXM K;  4LFA K;  4LF4 K;  4JI2 K;  4DUZ K;  4B3M K;  4X66 K;  5LMU K;  1XMO K;  4JI6 K;  4JI8 K;  4DV4 K;  4DR6 K;  5AJ3 K;  3OTO K;  3J7A P;  4CW7 B;  2E5L K;  1N34 K;  5LMN K;  5A2Q O;  1HNX K;  4V19 S;  1HNZ K;  4DV6 K;  4YY3 K;  5IT9 O;  1XNQ K;  4DV5 K;  4GKK K;  1I94 K;  5BR8 K;  2HHH K;  4K0K K;  4JI5 K;  4DR3 K;  4OX9 K;  4B3T K;  1IBM K;  4JV5 K;  4DR2 K;  5FLX O;  4DV1 K;  1XNR K;  4JYA K;  1IBL K;  2UUC K;  2VQE K;  4B3R K;  4X62 K;  2ZM6 K;  4LF9 K;  2UXC K;  1IBK K;  4JI1 K;  2F4V K;  2UU9 K;  4LF5 K;  4KHP K;  4LFB K;  4AQY K;  4X65 K;  1N36 K;  4GKJ K;  3J81 O;  1XMQ K;  2VQF K;  4DR1 K;  1J5E K;  2UXD K;  4DUY K;  4LF6 K;  2UXB K;  4DR7 K;  4B3S K;  1N33 K;  5LL6 Z;  2UUA K;  4LFC K;  4JI7 K;  4JI0 K;  1HR0 K;  4X64 K;  4DR5 K;  4YHH K;  3JAM O;  3T1H K;  4DV2 K;  4DR4 K;  1HNW K;  4NXN K;  4LF8 K;  1FJG K;  4LF7 K;  4DV7 K;  5IWA K;  3J7Y P;  4DV3 K;  3J80 O;  4JI4 K;  4CVN E;  4DV0 K;  2UUB K;  1N32 K; 
#chains in the Genus database with same CATH topology
 4DSE A;  4IZ9 A;  3DLE A;  1T7P A;  4YOT A;  3NH0 A;  4C1N K;  3VQ9 A;  1R0A A;  3CFO A;  4EHU A;  1XWL A;  4N56 A;  1WSG A;  2ZJQ L;  3QIO A;  2P9N A;  4JS4 A;  4B3M K;  4EP5 A;  3VOV A;  3THX B;  3SMP A;  3CCR N;  4YOR A;  5ELZ A;  1QZ6 A;  2GX9 A;  3THV A;  4H8K A;  1DT9 A;  5KRT A;  2P9K B;  3IFR A;  1N34 K;  3WQT A;  1HNX K;  1BI4 A;  5AQY A;  1TKX A;  3ULE B;  4YY3 K;  2DTU A;  2IDO A;  2WTU A;  4DTJ A;  4WFN L;  2YNH A;  1D5A A;  4IG0 A;  4CJ5 A;  2G8H A;  1S9E A;  5AQU A;  3TTF A;  4IWV A;  4GV6 A;  2VQE K;  4Z4I A;  5AQN A;  5JIC A;  1Q86 O;  3AAR A;  1CZ9 A;  4HTU A;  3VQ7 A;  3MK6 A;  4I9Q A;  4DMN A;  2D4W A;  3OYM A;  1HYZ A;  1EET A;  4KV8 A;  2UXD K;  3VGL A;  3WQU A;  2OZS A;  3QLH A;  4B1U B;  4CIG A;  4CHQ A;  3HOS A;  1I39 A;  4O0I A;  3KLF A;  2UUA K;  1W7A A;  3I8D A;  4JI7 K;  3BF1 A;  1A5W A;  4B1V A;  3LDP A;  1KC8 O;  4FJ9 A;  1N6Q A;  3THW A;  3CHW A;  3QEP A;  1EWQ A;  2NNW A;  2P9P B;  3HL8 A;  2R7Y A;  3S41 A;  4DR4 K;  3G25 A;  4NCB A;  2HBL A;  2HHU A;  3V1O A;  4JD2 A;  3MX2 A;  3WNF A;  4H03 B;  3A2F A;  3OBW A;  4HCB A;  4DV0 K;  5JS2 A;  4CJ3 A;  3VEO A;  1TAQ A;  3NBP A;  5HP1 A;  2KTQ A;  4CBX A;  4CEB A;  3WNE A;  2VG7 A;  2XY8 A;  1GOA A;  1L5U A;  2CH6 A;  3DJC A;  5BRH A;  3AA3 A;  4DB3 A;  2NRW A;  4LFA K;  4FJH A;  4BRP A;  3DM2 A;  2YHX A;  4JI2 K;  3G6E N;  1Q9X A;  3KLE A;  1J53 A;  2OA8 A;  1DLO A;  4AHR A;  3ENO A;  3SBT A;  3HVT A;  2FXU A;  5AFU H;  4J2D A;  3U9Z A;  3NVM A;  4H5R A;  3CPE A;  4O0J A;  4DFP A;  4B1Z A;  5CZ1 A;  1GLB G;  4FJJ A;  1LOT B;  3DLG A;  5JLF A;  1QQO A;  1SKW A;  1VQ4 N;  1HNZ K;  3KLH A;  1K9M O;  2O8C A;  3A5L C;  3LPU A;  1ZBF A;  1U45 A;  4CHP A;  3KLI A;  3M8Q A;  4I2Q A;  3L3U A;  3WEE A;  2P1J A;  5BRF A;  1Q81 O;  5FPD A;  2HMI A;  2P9I B;  2BH1 A;  5AQV A;  2Z1G A;  4HTL A;  1RT4 A;  3HBT A;  2F4V K;  2KZZ A;  3I0R A;  3Q7C A;  4Y0W A;  4A61 A;  2E2P A;  5LJW A;  4O4G A;  2VCP A;  4FK0 A;  4ID5 A;  1SQK A;  2X74 A;  1TL3 A;  1BI4 B;  4E7K A;  2YCH A;  4N41 A;  2ITG A;  1GLA G;  1NGA A;  3D45 A;  3QEW A;  1VSL A;  1NJX A;  5C2D A;  4PL7 A;  2ZJP L;  3CJ9 A;  3A8Y A;  2KKZ A;  4YHH K;  4ELU A;  3HVR A;  3NF9 A;  5GAH P;  4FSV A;  1ITG A;  1E4F T;  1JL1 A;  1VQ8 N;  3OYE A;  1HRH A;  1TL1 A;  4AHS A;  1HYS A;  1X9M A;  4BGA A;  4YOU A;  3QML A;  4JI4 K;  2BTF A;  1NGC A;  4QS9 A;  3WXK A;  1LAW A;  4N5S A;  3BGR A;  3L2Q A;  4FWQ A;  4A2B A;  1W0H A;  1SKR A;  3L6Q A;  1H1V A;  4RW4 A;  3H3O B;  3EZ5 A;  3K57 A;  3O9Q A;  1SV5 A;  4QS7 A;  4HUF A;  4E3S A;  5KPT A;  4DQR A;  3M5R A;  3FZL A;  1NLV A;  5HRN A;  3G0Z A;  1K8A O;  3QIP A;  3QFP A;  1B9D A;  3ZEU A;  1BCM A;  4BY9 C;  4CJ7 A;  4DTP A;  3RMC A;  4WF9 L;  1ATR A;  4DR6 K;  1DTQ A;  4Q5V A;  2W42 A;  3U8X A;  3FZF A;  4DTM A;  3NVK A;  3THY B;  1S72 N;  4JKG A;  4NYN A;  1IKW A;  2Y1I A;  2FSN A;  2BUP A;  1UOC A;  3VEY A;  4DWI A;  1NOY A;  3NGY A;  3CD6 N;  3MWT A;  2HF3 A;  1ZYQ A;  5JS1 A;  4JK7 A;  4DV6 K;  4ZHR A;  4JK9 A;  5HRO A;  4K0K K;  5ADX H;  2O4I A;  4DTU A;  2F8S A;  1G15 A;  4RW6 A;  4ZTF A;  1IO2 A;  1JKH A;  1NK0 A;  3QFU A;  3CCE N;  5FLX O;  1XNR K;  4N47 A;  4H0T B;  1HKC A;  4M63 C;  1IBL K;  3O8M A;  4FYD A;  2HND A;  5LY3 A;  2NUB A;  5FDL A;  5I9E B;  1U48 A;  3T7Z A;  4ILH A;  3O9U A;  3KZB A;  4H0Y B;  1NK8 A;  5J2N A;  5AQQ A;  3CJ1 A;  2WFB A;  3ITH A;  4M3R A;  3NF7 A;  1LWF A;  1NKB A;  4EIA A;  1K8K B;  3B6P A;  3HTV A;  3CC7 N;  2W40 A;  4CE9 A;  1HX1 A;  2QK9 A;  2VQF K;  1TKZ A;  1J5E K;  2A3Z A;  3IUC A;  1BA0 A;  2QWL A;  3L4Q A;  1GOC A;  3F73 A;  1VAZ A;  3R1X A;  2O8C B;  4JRQ A;  4QCL A;  4BC4 A;  1OKJ A;  1C0G A;  5JLH A;  2ASO A;  4HVJ A;  4FM1 A;  3MXJ A;  4E1M A;  4M3X A;  2O8F A;  4JI0 K;  1HLU A;  4PHT X;  5BRE A;  4BRC A;  4Z0U A;  3L4I A;  2HHQ A;  2H3G X;  1U6Z A;  4LF8 K;  4C8K A;  3J7Y P;  4IG3 A;  2E6L A;  1RBV A;  2HBJ A;  3PSI A;  1RDD A;  4I9L A;  1RNH A;  2OPS A;  2B5J A;  2PYJ A;  3CJ7 A;  3LWL A;  5DM7 L;  5J2P A;  3EY1 A;  2CGK A;  4CJV A;  4E19 A;  3CER A;  3KHY A;  4FJ7 A;  3EO3 A;  4B9V A;  3AGR A;  1P90 A;  3PX4 A;  3N4P A;  5D3G A;  2IS3 A;  4DUZ K;  5I42 A;  3AO2 A;  4WE1 A;  2JGU A;  5AQF A;  1HKB A;  4PUO A;  3QIN A;  1XHZ A;  2A1S A;  2KFN A;  1SL0 A;  3V9S A;  5C0Y A;  1A5X A;  3HPO A;  1QQN A;  4KHY A;  4OJR A;  3QEV A;  1NJY A;  4GV9 A;  4E7L A;  4CFB A;  4O8K A;  1TVR A;  3K58 A;  2ZWH A;  2NRR A;  4H0V B;  4CZE A;  4JI5 K;  3OYG A;  2D1K A;  3AVF A;  3EEQ A;  4FJI A;  4AHT A;  4IDH A;  1KFS A;  3LM9 A;  4F4K A;  5GAE P;  4J8F A;  2W6K A;  3KTQ A;  3AVA A;  4I6M B;  5CYM A;  2Z1I A;  3P5J A;  4DSF A;  4B9T A;  4CEF A;  3TTC A;  3NFA A;  4JKG B;  1LWC A;  4GW6 A;  2B6A A;  4BG8 A;  4W5R A;  4AQY K;  1WB9 A;  4KAZ A;  1KLN A;  4A2A A;  4PWD A;  2AP1 A;  2KHO A;  1L3U A;  4J2E A;  3WXJ A;  3ASM A;  5CYQ A;  4DSI A;  4F2S A;  3O4Q A;  1KTQ A;  2FSJ A;  1RBR A;  2UYT A;  3HM9 A;  3TTD A;  3G71 N;  4B9M A;  5C10 A;  1HR0 K;  5TKW A;  5AQT A;  4FOE A;  3T1H K;  1Y97 A;  3VQ4 A;  2IVO A;  2O8B A;  2HHT A;  4LH5 A;  4CD3 A;  1TGO A;  1HPM A;  4CVN E;  3KWG A;  1NGE A;  1U49 A;  2HW3 A;  2HBK A;  1HMV A;  2IVN A;  5H1S Q;  4DFJ A;  4PL8 A;  3ID6 A;  4IFV A;  4LD0 A;  1QQC A;  1RIL A;  5BPN A;  2Q36 A;  4IKF A;  4B9L A;  1RT6 A;  3U3G A;  1HQE A;  4WYB A;  4JKB A;  3HM8 A;  4KBO A;  1XMO K;  3NMU A;  4DG1 A;  1IH7 A;  2ATQ A;  1C1C A;  4YOX A;  5EXW A;  4BVP A;  2YI1 A;  3E9L A;  3BY5 A;  3GG4 A;  4KH6 A;  2PBD A;  1VQ6 N;  2GUI A;  2IGI A;  3H1V X;  4CJE A;  5DM6 L;  3PIP L;  4BWM A;  1KAY A;  3CET A;  3LDN A;  3UE5 A;  2P9L A;  4BQL A;  4FVU A;  4FPB A;  2E8A A;  4CZH A;  4KTQ A;  1TK5 A;  5FRN A;  4M3W A;  1VQP N;  1EKE A;  5AQW A;  4CFD A;  4CZG A;  4DCH A;  4M45 A;  2P9U B;  4CGD A;  3ZT4 A;  2X78 A;  1OH5 A;  2YNF A;  1QHA A;  1E4G T;  4FW1 A;  3M8S A;  4DTX A;  1IG9 A;  4GV3 A;  1NG9 A;  3CQ8 A;  2QXF A;  3ZET A;  4KO0 A;  1NKC A;  4RW7 A;  4FJX A;  1VQN N;  5KGW A;  5FRO A;  3MN9 A;  1E3M A;  5AZJ A;  3ZT2 A;  3CYM A;  1N36 K;  3GBT A;  4A57 A;  2F96 A;  4CHY A;  1JLC A;  3AA2 A;  3RMD A;  1Z05 A;  4DU4 A;  2ZJR L;  3S9H A;  1RT1 A;  2Q97 A;  5DK5 A;  1ASU A;  1HQU A;  3PLA A;  2KQ2 A;  3SAH A;  2ZE2 A;  1VSI A;  1CXU A;  2A41 A;  4OVL A;  4K42 A;  4DHY A;  5J2Q A;  4CBU A;  1S1W A;  1W9H A;  3C65 A;  1BQN A;  3NAE A;  3TSU A;  1T05 A;  3V6D A;  3MWP A;  3SNN A;  4OO1 J;  1U4B A;  2XRI A;  2Q1N A;  1KAZ A;  4CK1 A;  1L3S A;  4BR5 A;  1C0M A;  3HSC A;  2E2N A;  3OJU A;  4F8R A;  4E1J A;  5E26 A;  3TWH A;  3MCA B;  3C7N B;  1KVA A;  4ILJ A;  4BGB A;  4KH5 A;  4FXD A;  4WQ4 C;  3SV4 A;  3TAR A;  4FWL A;  5LMU K;  1NGD A;  1QS4 A;  4JI8 K;  3RSE A;  3G4S N;  2BE2 A;  1M1K O;  5AQP A;  5DMR A;  4CGF A;  1M90 O;  5FRM A;  3ZSZ A;  2E2O A;  5LMN K;  2Q0U A;  4C8O A;  3CIP A;  5EY4 A;  1EWR A;  2QA4 N;  1JL2 A;  4EFH A;  1T03 A;  4WFB L;  3DOK A;  4JKH A;  3U9D A;  5HRP A;  1DEJ A;  3DXK B;  4CJL A;  4HHT A;  1J5O A;  1CZA N;  3CM5 A;  2WOM A;  1YXQ A;  3LZJ A;  3A0I X;  3MDQ A;  4Z4C A;  4CJR A;  1V4S A;  5SWM A;  5AQS A;  3DRP A;  2UXC K;  2YV0 X;  5TKY A;  4FWK A;  1F21 A;  1KAX A;  3LDQ A;  3HI0 A;  3K5M A;  3M8R A;  3LZI A;  3HT3 A;  3DRR A;  4O8U A;  3VGM A;  4CER A;  2FC0 A;  4BRA A;  2P9L B;  4RW8 A;  4EP4 A;  3U3Y A;  5LL6 Z;  1FW6 A;  4CF9 A;  1TAU A;  4DS4 A;  1U04 A;  3CG7 A;  4BVO A;  2P9S B;  2BDP A;  1MDU B;  1BWF O;  3VQD A;  2GTD A;  4FLW A;  1MA9 B;  4EAH D;  4A62 A;  4DFK A;  1NBW A;  1T6C A;  5FPM A;  3FFI A;  4YDU C;  2G8K A;  3QBW A;  3ZET B;  4LF7 K;  3RMB A;  1VSK A;  4A5A A;  5EVZ A;  3SUO A;  1QVF M;  1LW2 A;  4JLH A;  4YNQ A;  5AZJ B;  1HKG A;  1WBD A;  1WUA A;  3NCI A;  3UKU B;  3ZCM A;  1HNV A;  3CQX A;  3D2E B;  2E20 A;  3F5T A;  1RT2 A;  4JI3 K;  3S3O A;  3NGI A;  1Q9Y A;  5KQD A;  5M1O A;  2E88 A;  2Q3S A;  3O9R A;  4ID1 A;  3CF5 L;  3A5N C;  3H46 O;  5AQL A;  3T19 A;  4FWO A;  2E2Q A;  1LAV A;  5AJ3 K;  4FL9 A;  1SKS A;  3ZSO A;  3CCS N;  3J7A P;  2OTL N;  4CW7 B;  1YIJ N;  1N5Y A;  1BIU A;  3CPW M;  2FBX A;  5EOY A;  1JLQ A;  3CI5 A;  4IO9 L;  3AAP A;  1ZBL A;  3VEW A;  3OYL A;  1K6Y A;  1HPZ A;  4NB4 A;  1TUU A;  2QWM A;  3PIO L;  1VQ5 N;  4GKK K;  5J1E A;  3EKS A;  1BDG A;  4DR3 K;  4NCG A;  3N4Q A;  4BR0 A;  3KKR A;  3W3D A;  3GE1 A;  4FWP A;  4DR2 K;  2ZGZ A;  4BRG A;  4FOI A;  1ATN A;  3FR0 A;  2A40 A;  1J54 A;  5CY4 A;  3RWU A;  3RVC A;  2ZGY A;  1KD1 O;  2O8D B;  3QO9 A;  3CCL N;  3TAB A;  1BCO A;  5CR4 A;  1C1B A;  2JWK A;  3VTI A;  3RR8 A;  4LF6 K;  2UXB K;  1BA1 A;  1SZ2 A;  1N33 K;  2DFE A;  2WON A;  1D4X A;  2DFF A;  2P9N B;  3LAL A;  2I7P A;  5CE3 A;  3LP2 A;  3O4N A;  2QWN A;  4CGG A;  4FWM A;  4KB1 A;  2NZT A;  3AVJ A;  4KH4 A;  2YHY A;  3CFR A;  1IKY A;  2E6M A;  4OPJ A;  3O08 A;  1SS6 A;  4KI6 A;  1KVC A;  3MXI A;  4DV7 K;  4DV3 K;  4Y1D A;  1NGH A;  3TAN A;  1D9D A;  1JLE A;  4CJQ A;  1OVY A;  3AVC A;  2UUB K;  4Z4G A;  4FM2 A;  4AF1 A;  4AHV A;  1VSE A;  4B9Q A;  1YT3 A;  3DWL A;  4YFU A;  4M3U A;  3SV3 A;  1J6Z A;  4NXM K;  3O3H A;  3OYC A;  2QXL A;  2KZM A;  4JKD A;  3VQQ A;  1S6P A;  2HMP A;  4JI6 K;  4CGH A;  1P8Z A;  4DF4 A;  4C8N A;  3CC4 N;  3ZX3 A;  4DKW A;  3ZSX A;  2E5L K;  3SZ2 A;  3JYT A;  1WLJ A;  2HST A;  3H3N O;  4IJA A;  4NYF A;  2FBT A;  4IEI A;  5BR9 A;  2YHW A;  4BRF A;  3O6W A;  1ILY A;  3SQ4 A;  3O4W A;  3THW B;  3ZSR A;  3O1B A;  4CEO A;  2VYP A;  4B1W B;  4CEZ A;  1IG8 A;  2VG5 A;  1BG3 A;  3OW2 M;  3OVN A;  4M7X A;  3MED A;  4C8M A;  1RTI A;  3QET A;  5GIO A;  4JD2 B;  4LF9 K;  1NJW A;  1UWB A;  3AAQ A;  3A5M C;  4FLZ A;  3OHR A;  5AZI A;  1S3X A;  4PY5 A;  3ZT3 A;  3LAN A;  1YVU A;  4BE2 A;  2HHS A;  3AO3 A;  3KKS A;  4H0P A;  4DR7 K;  4UY8 O;  3SYZ A;  3PV8 A;  3VER A;  4M41 A;  4BE0 A;  3Q7B A;  3C6H A;  3QBX A;  2RF2 A;  2IC3 A;  1NK9 A;  1W97 L;  3BUZ B;  3WNH A;  4FM0 A;  1X9W A;  3OYJ A;  5EX5 A;  3OYF A;  4KHU A;  2NRX A;  3DRS A;  3KK2 A;  3L8B A;  3VQ8 A;  3CCJ N;  3QNN A;  1NGF A;  1FJG K;  4AHC A;  1X3M A;  1U2V A;  3O3G A;  4BRL A;  4CJ4 A;  3IS9 A;  1VRT A;  3K5L A;  5AQZ A;  3T69 A;  4BRD A;  2YHB A;  2F9T A;  3WEE B;  4CK2 A;  3SJJ A;  4CHZ A;  4BDZ A;  1B9F A;  3LPT A;  4BC3 A;  4GVE A;  1L3V A;  3EYZ A;  1DKG D;  3KD5 E;  3SQ0 A;  4WQ5 C;  5M1N A;  3C0B A;  1KRP A;  3OA9 A;  2PYL A;  2GWJ A;  1RDC A;  3U6F A;  2HHW A;  4JKF A;  4KHQ A;  3KLG A;  4K25 A;  3VF4 A;  2GV9 A;  3SPZ A;  4C8L A;  1DGK N;  1JLF A;  4CF0 A;  4A5B A;  1C0T A;  4DV5 K;  3TAQ A;  1I94 K;  3PO4 A;  1NK5 A;  1RBT A;  4KTW A;  3M8P A;  3DXM A;  2BGG A;  3ID8 A;  3I56 N;  1HYV A;  3TAG A;  3EE8 A;  1C0U A;  3K9J A;  4W5O A;  2P5O A;  1OH7 A;  4M3Y A;  3SUP A;  2IOC A;  4B3R K;  1GLD G;  1TYQ A;  3P39 A;  1IBK K;  4JI1 K;  3HK2 A;  4JHD A;  2QEX N;  3AA4 A;  1VSM A;  3CCM N;  3L3V A;  4LFB K;  1QTM A;  5C12 A;  1T8E A;  1RFQ A;  4FJG A;  1WOQ A;  4X65 K;  3H1Q A;  5HBM A;  1XMQ K;  4R79 A;  4CEE A;  4CJF A;  3QNO A;  1X9J A;  1NGJ A;  4BDY A;  1FKO A;  3DAW A;  1NK4 A;  1HUX A;  2D0C A;  4FCY A;  1GLE G;  4E7I A;  3ZEU B;  4LFC K;  4BWJ A;  5AQR A;  2XO7 A;  2CGL A;  4H5N A;  4AIL C;  2HHV A;  4B8A B;  3QEI A;  3VEX A;  3HO1 A;  4DR5 K;  4FZX C;  4ELT A;  3FE1 A;  4WQ4 A;  3E9O A;  3HZ6 A;  1WSI A;  2FF3 B;  1KFD A;  2RHK A;  4BR9 A;  5AZI B;  1LV5 A;  3OYN A;  1VQL N;  4NLC A;  3VMF B;  3LL3 A;  1QSL A;  2ETJ A;  2AA4 A;  2ZD1 A;  3C6U A;  3VQ5 A;  3VEN A;  1N32 K;  2QWO A;  4E0D A;  1YIT N;  4CEQ A;  4DSJ A;  4BRI A;  4Z94 A;  3T1Y K;  3E01 A;  5J2M A;  3SK3 A;  4MLE A;  4ISF A;  4FLY A;  4B1Y B;  1TUY A;  3L2V A;  3V1R A;  3DMJ A;  4NLB A;  5AQI A;  1RCH A;  3ULD A;  5JVG L;  3CC2 N;  2OTJ N;  4NO7 A;  3F9K A;  4DU3 A;  2QTD A;  2IAJ A;  2YKM A;  4PKG A;  3A5O C;  3VF6 A;  1QQM A;  4F3O A;  3CFP A;  1IKV A;  1IV0 A;  1WSF A;  3VEV A;  3VQE A;  3VF2 A;  2HHH K;  2O8F B;  3AA5 X;  1BIZ A;  1JCE A;  4FWN A;  4O5F A;  5HRR A;  2W41 A;  4CES A;  4HWI A;  3OYH A;  3MX5 A;  2ASM A;  1REV A;  2HOE A;  4RTF D;  4CZL A;  5E41 A;  3D2F A;  3DI6 A;  3ZX2 A;  1WSJ A;  2RKI A;  4O5B A;  2YNI A;  1XUP O;  3S3N A;  3THX A;  3V9X A;  4BRO A;  1V4T A;  4YOW A;  4K41 A;  4CF2 A;  1UAX A;  2VG6 A;  3LDO A;  5FPN A;  3FGU A;  4FJL A;  4OGE A;  3FLC O;  2P9K A;  3HST B;  5M1K A;  5JVH L;  2NRT A;  4ILG B;  3UIQ A;  2J4R A;  2D0B A;  3BZK A;  1QSY A;  1S1X A;  4IO8 A;  5AQM A;  3TPQ A;  3ULE A;  4BDP A;  2D0O A;  3PSF A;  3ZSW A;  1QE1 A;  3CXC M;  3KK1 A;  4AHU A;  2V52 B;  2D0A A;  4FPA A;  3J8A A;  3JAM O;  2QW9 A;  3SAF A;  5KRS A;  3RMA A;  3QIC A;  2DY4 A;  4NXN K;  4HUE A;  2ZQB A;  1TKD A;  1UA0 A;  4JHD B;  1ESV A;  2WBN A;  2E1Y A;  5F0X A;  1JLA A;  4CJU A;  2HHX A;  4FO0 A;  2XY7 A;  1VSJ A;  5F2R A;  2B4J A;  4H4O A;  3R3L A;  5HOO A;  3EKU A;  3VQB A;  3LDS A;  5KPZ A;  1RDU A;  2YX6 A;  4B8C A;  3K59 A;  4C1N I;  1HNI A;  2OAN A;  1WAF A;  3M3Z A;  1BIS A;  1VQ9 N;  2PZS A;  1S1V A;  1VHX A;  4CZF A;  4EHT A;  1GLJ O;  1TK8 A;  3AVN A;  4KFB A;  4CJP A;  4JRP A;  4IJN A;  1KQS M;  3G10 A;  3CME N;  2BAN A;  1EP4 A;  4ISE A;  3JS6 A;  1Q18 A;  3P1G A;  4YOV A;  3TAE A;  1R59 O;  4IOA L;  4CZI A;  2P51 A;  3VQ6 A;  1RGI A;  4DTN A;  3I33 A;  1NGB A;  4I7F A;  4CEA A;  4JAX A;  4OX9 K;  2E4L A;  1BHL A;  4B3T K;  4MO4 A;  3KWI A;  4CFA A;  4CF8 A;  4E89 A;  1X3N A;  2Q2R A;  1NKE A;  3WXL A;  1SAZ A;  3SBG A;  2O8B B;  3PX0 A;  1FK9 A;  4I2P A;  2XY6 A;  1NOZ A;  1D8Y A;  3L0Q A;  2EWS A;  1QVG M;  4LF5 K;  2CH5 A;  5KI6 A;  2G8U A;  2YHA A;  3O5B A;  3VTH A;  3K2P A;  1NNE A;  1JJ2 M;  4JEP A;  2YJE A;  2YJF A;  4CGI A;  4DUY K;  3VEZ A;  3PX6 A;  1BU6 O;  2A42 A;  4B9S A;  2OZM A;  2VWB A;  4CZK A;  1WSE A;  2O4G A;  2OPR A;  2QI2 A;  4IBN A;  4JK8 A;  4BAC A;  3OBY A;  5GAG P;  3UB5 A;  3LDL A;  4IOX A;  3DLB A;  3OS1 A;  3D2F B;  3QES A;  3B6O A;  1NGI A;  1JLG A;  2CGJ A;  3RR7 A;  1LWE A;  1S1T A;  1WSH A;  1NU0 A;  2EX3 A;  4RWT A;  3MXM A;  4BG9 A;  5IWA K;  4KTZ A;  2P9I A;  4GMJ B;  3H45 C;  3ZLJ A;  3K5N A;  4CFC A;  1QZ5 A;  4R5P A;  1NWK A;  4K8X A;  3V9W A;  1KLM A;  3T3F A;  4B1X B;  3HPG A;  2GUP A;  4L3Q A;  4FWS A;  4GVM A;  2HB5 A;  2VGN A;  4J2A A;  3BZC A;  4LSL A;  3SMS A;  5AQH A;  4FLT A;  4KHS A;  3DLR A;  3ATU A;  1RBU A;  3LP1 A;  1BGX T;  4X66 K;  1RT7 A;  4MDA A;  5AQK A;  3O9T A;  3VPZ A;  1XC9 A;  1NK7 A;  2OPQ A;  4HUG A;  1ZC6 A;  4DLG A;  3OS2 A;  3SJH A;  4LC9 B;  3EL2 A;  4YOY A;  1HJR A;  3QER A;  4FJM A;  5IT9 O;  3BDP A;  4WFA L;  5BR8 K;  4JNE A;  4PA1 A;  1EX4 A;  4BC5 A;  1Q7Y O;  3LAK A;  3TU5 A;  4JV5 K;  4CGJ A;  1SUQ A;  3P4I A;  1C1A A;  1RT5 A;  2QKK A;  1N8R O;  1EXQ A;  4AM7 A;  4OPH A;  3MEG A;  4IFE A;  4BRK A;  3CJC A;  1MWM A;  3PUF A;  5C2F A;  3ATV A;  2G8F A;  1YF5 L;  4FLX A;  4FLU A;  4DLE A;  3KVG A;  4OPK A;  4FK2 A;  3O80 A;  4JKC A;  3GOI A;  2FF6 A;  4BQZ A;  1RTD A;  3SI6 A;  3THY A;  1SL2 A;  3J81 O;  3ZSY A;  4DF8 A;  1Q82 O;  4KKO A;  5M1Q A;  4PKH A;  4B3S K;  4DTS A;  3C6A A;  3PY8 A;  2WUS A;  2QWR A;  4JN4 A;  1JLB A;  4OKJ A;  4E1N A;  4BRE A;  4F3T A;  3RSE B;  2OPP A;  3V9U A;  2O8E A;  3BF3 A;  1QHT A;  4BR4 A;  4WQ5 A;  1GLC G;  1IJJ A;  2QWP A;  2HBM A;  4FJ8 A;  3CCV N;  4JKA A;  1DTT A;  1S6Q A;  3D0P A;  1YI2 N;  2KLA A;  5F1X A;  5C42 A;  3V4I A;  1ASW A;  1KVB A;  3DYA A;  3HXM A;  1YTA A;  3TAP A;  3ZYY X;  5C15 A;  3VET A;  5GAD P;  4FLV A;  1T6D A;  1GOB A;  3OY9 A;  5HL7 L;  5AQG A;  1K8K A;  5GIP A;  4Q0B A;  4OLA A;  5BRD A;  4KHN A;  3I55 N;  4FWR A;  1EO1 A;  1OVQ A;  4LF4 K;  3H6E A;  4IOC L;  1C0F A;  5K14 A;  3GDQ A;  3HOT A;  1NM1 A;  3ISN C;  3BP8 A;  4CD1 A;  3DLH A;  3KK3 A;  3OJS A;  2JWL A;  3T1A A;  1XHX A;  4M42 A;  4KB0 A;  1XQS C;  5T7B A;  4KRF A;  4CBW A;  5KPR A;  3WUH A;  1W2B M;  4CIF A;  2G8W A;  2FSK A;  5CHI A;  4E7J A;  2ASP A;  4Z4F A;  1NK6 A;  4DTR A;  2F8T A;  3K0S A;  4JKE A;  3ALY A;  4BC2 A;  3AO1 A;  4GNI A;  4PQU A;  1VQK N;  1YTU A;  3AVH A;  3LM2 A;  4RCH A;  1WBB A;  4EZ9 A;  1LW0 A;  3AY9 A;  1BO5 O;  4H5V A;  3SCX A;  4JYA K;  3R8E A;  4JS5 A;  1YAG A;  3JXU A;  4NCA A;  1D9F A;  3KD1 E;  3WT0 A;  4FZY A;  4MQ3 A;  5JMV A;  1QSS A;  3AVL A;  1VQM N;  1YHQ N;  3HP6 A;  2PFU A;  1YJW N;  4M3Z A;  1VSD A;  3CJA A;  3SQ1 A;  3ZSQ A;  4B9N A;  2YNG A;  4MO5 A;  4GKJ K;  4DR1 K;  4CK3 A;  3LP0 A;  1GLF O;  4ICL A;  2W6L A;  1YJN N;  3DOL A;  4H0O A;  2HVH A;  5LJV A;  2XY5 A;  3QEX A;  1WAJ A;  4E7H A;  2KW4 A;  4FJN A;  3D6R A;  3K5O A;  3GL1 A;  5EU7 A;  1Z26 A;  1VQO N;  4DV2 K;  1OH8 A;  4ELV A;  2D0P A;  2WC9 A;  2NRV A;  3OS0 A;  4MDB A;  4I6M A;  1TK0 A;  3R6M A;  1JXB A;  4BE1 A;  4CED A;  4DTO A;  1ZBH A;  3FFK B;  3L2W A;  3CJB A;  5BPL A;  2FBY A;  2F9W A;  5HLF A;  2G8V A;  1BQM A;  3AO5 A;  4GY2 B;  4DFM A;  3D7E O;  3OYA A;  3HYF A;  4O55 A;  2F7T A;  1HJO A;  5AQX A;  4BRH A;  4HCC A;  5B8H A;  1T3V A;  2O8E B;  4OLB A;  2NLX A;  2RN2 A;  3OYK A;  1RDA A;  1X1P A;  1A5V A;  4W5N A;  4Z4H A;  2Q31 A;  3F2K A;  3I8B A;  1S22 A;  3OTO K;  4XEI A;  3MN6 A;  2GWK A;  3L2R A;  1ZXO A;  5SZT A;  1S5J A;  1I3A A;  4TSX A;  1RDB A;  5BN8 A;  3MCP A;  3HP9 A;  2FBV A;  4BRN A;  3FZM A;  4MLH A;  1RBS A;  4U7B A;  4G9Z A;  1XC3 A;  4CJK A;  4CI6 A;  4DQS A;  1NJI O;  3VA3 A;  1OH6 A;  5BPM A;  4CJS A;  1VRU A;  3W0L A;  4K8Z A;  3NDK A;  1IBM K;  1YUW A;  4QOZ B;  3AVM A;  4DV1 K;  4DSL A;  3LAM A;  2QWQ A;  4Y1C A;  4W5T A;  4CIE A;  4FZZ A;  5C25 A;  2X6N A;  2I7N A;  3AVK A;  2HNZ A;  3E66 A;  2V7Z A;  4KHP K;  3VES A;  3MMV A;  2A5X A;  3EN9 A;  1KSP A;  5AFU A;  3H08 A;  4LH4 A;  3PO5 A;  3O3F A;  3CCQ N;  3OYB A;  5AQJ A;  3NH2 A;  3ENB A;  4A59 A;  3I0S A;  3VGK A;  1VQ7 N;  1VSH A;  3VN5 A;  3E1Y A;  3NF6 A;  3SUQ A;  4DS5 A;  3F9M A;  3HPH A;  3TR8 A;  5KTQ A;  4X64 K;  5GIN A;  1MWK A;  1X9S A;  5E84 A;  3O1W A;  2P5G A;  4BRM A;  2QKB A;  1J9A A;  2P9U A;  3LP3 A;  4OGC A;  3OYD A;  1Z25 A;  3ZT1 A;  3V9Z A;  3K9K A;  1UA1 A;  5AQO A;  1NJZ A;  3NGZ A;  3E9P A;  3NF8 A;  4EZ6 A;  3TAM A;  4FJK A;  3AVG A;  2Y1J A;  1S9G A;  3ZT0 A;  3O9S A;  1Q8I A;  1T44 A;  3ZX0 A;  4RW9 A;  4H0X B;  5CZ2 A;  4DQP A;  3DLL L;  4Z4E A;  4XH1 A;  3IKM A;  3TSQ A;  1RTJ A;  4DV4 K;  3QDK A;  3CMA N;  2QM1 A;  2A6A A;  1O1W A;  4BR2 A;  1TKT A;  4DSK A;  1ZBU A;  3RRG A;  4FK4 A;  4C23 A;  2IIR A;  4V19 S;  2V51 B;  3UKR A;  1U47 A;  1YJ9 N;  1VSF A;  4CJW A;  2PY5 A;  2D5R A;  3TI0 A;  4BRQ A;  3IG1 A;  2EHG A;  4DQQ A;  1B92 A;  2HVI A;  3HRG A;  2RE2 A;  4W5Q A;  3MN7 A;  1XI1 A;  4IEE A;  5C24 A;  1G99 A;  3R9P A;  2UUC K;  4O44 A;  2AJQ A;  1U2V B;  3C7N A;  5I3U A;  3L2U A;  1BUP A;  2ZM6 K;  4H5W A;  4F2R A;  3EZW A;  2UU9 K;  1JCG A;  3P83 D;  3FZH A;  1FKP A;  2Q0R A;  3C94 A;  4XH5 A;  4OPA A;  3NHG A;  4IFY A;  1ZBI A;  4F9O A;  3SUN A;  4AM6 A;  1CLQ A;  5BN9 A;  4KI4 A;  5FPE A;  2KFZ A;  3VQC A;  4KHW A;  5M1F A;  4M7Y A;  2VWK A;  4L8R B;  3AO4 A;  5MLC Q;  2JLE A;  3IAY A;  4J2B A;  4ZTJ A;  3B8A X;  4XH4 A;  3FZK A;  4RG8 A;  1MU2 A;  4YDU A;  3TSP A;  3WXI A;  4CF1 A;  5ADX A;  3SAG A;  4OKE A;  3IRX A;  4BR7 A;  5M1P A;  3SPY A;  2A1R A;  3DXK A;  1NMN A;  1C6V A;  4KRE A;  3MN5 A;  1S1U A;  4IXC A;  4H4M A;  3RRH A;  2OCE A;  4B08 A;  1TV6 A;  4IDK A;  3J80 O;  3IMX A;  1YVN A;  1JCF A;  3U4L A;  2E1Z A;  2ZF5 O;  4CHO A;  3LWM A;  3J7Z O;  3AVB A;  5HRS A;  3DXM B;  2ITM A;  2GEM A;  2HNY A;  2GBZ A;  4DQI A;  4B3O A;  1ATS A;  4MFB A;  3QB0 A;  4ISG A;  4XIU A;  1JXE A;  2YKN A;  4CCH A;  2Z1H A;  1TYQ B;  2HF4 A;  4CZJ A;  2P9S A;  3CCU N;  4H5T A;  3DLK A;  2VGM A;  4K43 A;  1KCF A;  3VA0 A;  1ASV A;  3HJF A;  4FW2 A;  3AV9 A;  2IVP A;  3VQA A;  1RT3 A;  2LSN A;  5A2Q O;  1XNQ K;  4M3T A;  2RPI A;  2PAV A;  3MEE A;  3MAQ A;  3KIO A;  1EQY A;  3SQ2 A;  1FXX A;  4FJ5 A;  3C6T A;  3NH1 A;  4DQ8 A;  4DU1 A;  1RTH A;  2X6S A;  3UKU A;  1WN7 A;  3AGK A;  4UQG A;  1LCU A;  3D2E A;  3ZSV A;  3MEC A;  4U67 L;  3C95 A;  1BOT O;  1Y64 A;  3SLC A;  2Z1J A;  2P9P A;  3KJV A;  3EE9 A;  3V81 A;  3M1F A;  4X62 K;  3AVI A;  4FVM A;  3CM6 A;  1L3T A;  3P31 A;  3S3M A;  3WXM B;  2NRH A;  4PKI A;  5AR0 A;  3WNG A;  2DFH A;  1ZBS A;  4CJT A;  3UKR B;  1BL3 A;  2DPN A;  3ENH A;  3P38 A;  5KQ8 A;  1SL1 A;  3NE6 A;  1KXP A;  1CXQ A;  2V7Y A;  4G1Q A;  3RTV A;  1WNS A;  1K73 O;  4QS8 A;  2GEL A;  1RDW X;  1GLL O;  4LSN A;  1NMD A;  4OKK A;  4AH9 A;  4B9U A;  4WCE L;  3BEX A;  3JSM A;  2VWJ A;  4LY7 A;  1CZB A;  1O13 A;  3CQY A;  1NGG A;  1HNW K;  1VK0 A;  2OYQ A;  3TAF A;  3IDH A;  4CZM A;  4N76 A;  4KPY A;  2I5J A;  3OYI A;  1Z6R A;  3VQP A;  3V1Q A;  2FLO A;  3M6G A;  4QAG A;  1IKX A;  4CEC A;  2G8I A;  2O8D A;  2XHB A;  4CHN A;  5KGX A;  2NRZ A;  3KK7 A; 
#chains in the Genus database with same CATH homology
 3T1Y K;  4JI3 K;  4NXM K;  4LFA K;  4LF4 K;  4JI2 K;  4DUZ K;  4B3M K;  4X66 K;  5LMU K;  1XMO K;  4JI6 K;  4JI8 K;  4DV4 K;  4DR6 K;  5AJ3 K;  3OTO K;  3J7A P;  4CW7 B;  2E5L K;  1N34 K;  5LMN K;  5A2Q O;  1HNX K;  4V19 S;  1HNZ K;  4DV6 K;  4YY3 K;  5IT9 O;  1XNQ K;  4DV5 K;  4GKK K;  1I94 K;  5BR8 K;  2HHH K;  4K0K K;  4JI5 K;  4DR3 K;  4OX9 K;  4B3T K;  1IBM K;  4JV5 K;  4DR2 K;  5FLX O;  4DV1 K;  1XNR K;  4JYA K;  1IBL K;  2UUC K;  2VQE K;  4B3R K;  4X62 K;  2ZM6 K;  4LF9 K;  2UXC K;  1IBK K;  4JI1 K;  2F4V K;  2UU9 K;  4LF5 K;  4KHP K;  4LFB K;  4AQY K;  4X65 K;  1N36 K;  4GKJ K;  3J81 O;  1XMQ K;  2VQF K;  4DR1 K;  1J5E K;  2UXD K;  4DUY K;  4LF6 K;  2UXB K;  4DR7 K;  4B3S K;  1N33 K;  5LL6 Z;  2UUA K;  4LFC K;  4JI7 K;  4JI0 K;  1HR0 K;  4X64 K;  4DR5 K;  4YHH K;  3JAM O;  3T1H K;  4DV2 K;  4DR4 K;  1HNW K;  4NXN K;  4LF8 K;  1FJG K;  4LF7 K;  4DV7 K;  5IWA K;  3J7Y P;  4DV3 K;  3J80 O;  4JI4 K;  4CVN E;  4DV0 K;  2UUB K;  1N32 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...