4JYAK

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4jyaK00
4X64K 4DR5K 2UUAK 4LF4K 4B3RK 4JI0K 2F4VK 4JI5K 4LF7K 4DR4K 5LL6Z 4K0KK 4NXNK 3JAMO 4JYAK 1N32K 3J7YP 1N36K 2UXBK 5IT9O 1XMQK 4DV2K 5IWAK 2VQEK 4LFCK 4LF8K 1XNQK 1HNXK 4LF6K 5FLXO 4DR1K 2HHHK 1XMOK 3J80O 4GKJK 3J81O 2E5LK 4JI7K 4AQYK 5LMUK 4DV1K 1HR0K 1XNRK 4GKKK 4DR6K 4NXMK 4DV4K 4YY3K 4CVNE 4V19S 1N34K 4CW7B 1IBKK 4B3MK 4DV0K 5A2QO 4DV5K 3T1YK 1I94K 2UXCK 4JI4K 4X62K 2UXDK 4JI8K 4X65K 2UUBK 4LF9K 4JI6K 1HNWK 4JI1K 4JI2K 4DV3K 4LF5K 2UUCK 4DUYK 1IBLK 4LFAK 4B3TK 1FJGK 3T1HK 3OTOK 1IBMK 4LFBK 5BR8K 4DUZK 1N33K 3J7AP 2ZM6K 4YHHK 5AJ3K 5LMNK 4DV7K 4B3SK 4DR2K 4OX9K 1HNZK 2UU9K 4DR7K 4JV5K 2VQFK 4DR3K 1J5EK 4JI3K 4KHPK 4X66K 4DV6K
chains in the Genus database with same CATH superfamily
1Q8IA 1Y97A 4OPKA 4DR5K 4LF4K 3TSPA 1A5WA 3C6TA 2KZMA 1XQSC 4CK2A 1KLNA 4FJHA 2F4VK 4ID5A 2O4GA 1VQLN 3EKUA 4O44A 4XH1A 3CHWA 3OYJA 4C8OA 1RT4A 4XH5A 5FROA 4Z4EA 4H0OA 3IS9A 3V81A 2V52B 4W5NA 1KFDA 1HUXA 2E2QA 4IJNA 4KB0A 1D5AA 5BPLA 4HVJA 3AO4A 1N8RO 4ELTA 3ID6A 3FR0A 3SAHA 2HHSA 3VERA 3KLFA 4JI7K 2Y1IA 4M3WA 1TUUA 1D8YA 3ULEA 3VESA 1X1PA 2GUPA 3CCEN 2ZF5O 2QWRA 3C65A 2P51A 2NZTA 2GUIA 2JGUA 1RGIA 3E01A 3V6DA 2NRRA 1C0UA 1HNWK 1BI4A 3SBTA 1NU0A 3NF8A 3VQDA 4BC4A 4DUYK 3ATUA 1L3VA 3ENOA 3UKRB 3DLGA 4E89A 1L3UA 4F2RA 3K5LA 2ZQBA 4IKFA 3P83D 1DKGD 1NGDA 2E1YA 3IMXA 1NMDA 3O3HA 4FJKA 2E2OA 2D0CA 1Y64A 3O4WA 4A5BA 2V7ZA 3CCJN 4DTXA 1GOBA 1U47A 1ZBSA 4O4GA 3AO1A 3I56N 1U4BA 4L3QA 4FOEA 3LL3A 4ZTJA 3MXMA 1NGBA 3HSTB 4CIEA 4DF8A 1NWKA 4E3SA 4FVUA 3G10A 3FFIA 4AHVA 1TAQA 3P38A 2X6SA 2R7YA 4CZFA 4Z0UA 2W6KA 3VOVA 4M63C 2KZZA 4AHTA 2XY7A 3HSCA 2G8HA 4H0PA 4LF7K 1M1KO 4M42A 1VQON 3M1FA 1VSFA 3ZSYA 1SKWA 3VQEA 5HBMA 5AQZA 3VMFB 1J6ZA 4FJNA 3DOKA 1VRUA 2I7PA 3MXIA 3MWTA 5GINA 2P9LA 2OPQA 5GAGP 5J2MA 5AZJB 4CEBA 4CZKA 4OPJA 3ZT4A 5M1QA 3L4QA 4A2AA 1MA9B 4HUEA 2V51B 3S41A 5FPDA 3CCRN 4FZYA 4M3ZA 1VK0A 4PWDA 2NNWA 3QICA 2E6LA 4BE2A 1JLQA 3U3GA 1VSEA 2OA8A 4WFBL 4FK2A 4FPAA 3RR7A 1TKTA 2O8FB 1DEJA 3DYAA 3BZKA 3SQ1A 2Q3SA 3NF9A 3JYTA 3GOIA 3SUQA 3K5NA 2ZGYA 1NGJA 3TAFA 3NCIA 1BHLA 2PZSA 3V9WA 4FWOA 3O1WA 4N47A 4F3OA 4BQLA 2ZJRL 2A1SA 1GOCA 4N5SA 1LAVA 4K42A 2P9UB 3OYAA 2KTQA 2ASMA 3NGZA 3T1HK 1TV6A 1LW0A 3OTOK 2ZGZA 2HW3A 2F7TA 3D7EO 4BRMA 1N33K 4CK3A 4CF8A 4Z4HA 4WF9L 2ZM6K 4YHHK 3QMLA 4H0XB 4CZIA 2J4RA 4K43A 3OJUA 4I2PA 3TAPA 1ASUA 2PYLA 5JLFA 1C1AA 3SPZA 3RR8A 4O0IA 5AQYA 1KC8O 3ENBA 1KXPA 1BA0A 1RFQA 2KHOA 4I7FA 1D9FA 1BIUA 2A1RA 3D2EA 1IKXA 1MU2A 4BC2A 4X64K 3E9OA 4Z4FA 4OO1J 4JI0K 1RDBA 1JLAA 3ZSRA 4H8KA 1WB9A 1ZBHA 4CF9A 1WBBA 1VRTA 4CGDA 2BGGA 3O4NA 3O8MA 1GLAG 4H5TA 4DLEA 1YJWN 4BR9A 1VQ5N 1WN7A 2NRHA 5C12A 3QEWA 3RMAA 4M3YA 3O6WA 3QIOA 3SI6A 3AGKA 4IEIA 1FW6A 3I8BA 2Z1IA 2QWPA 3L2UA 1SUQA 1T7PA 5KRTA 2Q1NA 2YNFA 1C6VA 2HHQA 4CHNA 1S1VA 1IO2A 3W0LA 4FLTA 4BRCA 4RCHA 4BR2A 3P5JA 4FWSA 4B9QA 3VA3A 3Q7CA 4YOXA 4CF1A 4CFAA 2YKMA 1NK5A 4BG9A 4CEZA 4CW7B 3OYMA 4IZ9A 1XUPO 3RTVA 2PBDA 5AQPA 4B3MK 2P9KB 2FXUA 4LF9K 3AVNA 3AAQA 3L4IA 1CZAN 3ITHA 1RDUA 3OYLA 3P39A 3LANA 4JEPA 4LFAK 4YOUA 1DT9A 3ENHA 4CEQA 3IFRA 1S1WA 3F73A 3SUPA 3H45C 3LDLA 4YDUC 5DMRA 2BANA 2E2PA 4DU3A 2KW4A 4DUZK 4DSJA 1UWBA 2FF6A 2D4WA 2HF4A 4FCYA 4DSLA 4IJAA 4OPAA 3VQ9A 1M90O 3FZFA 3AV9A 5AJ3K 4J2EA 5LMNK 3HJFA 1TK5A 1TKDA 1HJOA 1GOAA 4CGJA 1GLDG 5HRPA 1IJJA 2D0BA 4PA1A 2NRTA 3L8BA 3UKRA 1YVUA 5E41A 4CZMA 3UE5A 4X66K 4H4OA 3SAGA 4FZZA 1GLJO 1RT3A 4C1NK 5AZIA 5AQWA 3K2PA 4CBWA 1NBWA 4W5RA 3CCUN 2QK9A 2E20A 1JCFA 2ZE2A 5BN9A 3CQYA 4DFPA 1VSDA 4NXNK 4BRDA 2YHYA 4CD3A 4O5BA 4CK1A 3QNNA 4FWKA 3AVJA 2D0AA 1HNXK 4WQ4C 3VQCA 3GL1A 1SAZA 4F3TA 5AQQA 3TI0A 3FFKB 1S3XA 3VQAA 1XHZA 3KKSA 4NO7A 1OH8A 5GAHP 2GBZA 2OZMA 5LY3A 4PQUA 3ULEB 4BRQA 4O5FA 4DU4A 4CJEA 1RNHA 4R79A 4FZXC 1N34K 1EP4A 4BRNA 4DG1A 3MN6A 2WC9A 4DV5K 1H1VA 3AA4A 2O4IA 1S9GA 2F96A 3KK7A 1KVCA 3HZ6A 3NF7A 3EZWA 4CJRA 5C25A 4AF1A 1BI4B 3NH1A 4FOIA 3LZJA 4FLVA 5HOOA 4ELUA 1FXXA 2VCPA 3QO9A 3CMEN 4I6MA 2X78A 4WFAL 2WBNA 1U49A 2D0PA 1REVA 1SZ2A 5KPRA 1JXEA 4M45A 4KHSA 1WNSA 1A5XA 4BDYA 5AQNA 4DFMA 4ISEA 4UQGA 3FZKA 3AVMA 3CERA 3B6OA 5BN8A 1QHAA 1XWLA 1LWCA 4BQZA 1WLJA 1CXQA 2YHWA 4FK0A 1J5EK 3AVIA 3DXKA 3VTHA 4CJ7A 2ATQA 1RDAA 3TPQA 4EP5A 3DRRA 4DTOA 3LPTA 1WSEA 1A5VA 4B1VA 5EOYA 1NGHA 1XHXA 1QTMA 4BC5A 4B1XB 4O55A 2FSNA 1SV5A 3LP3A 3WQUA 3EE9A 1YVNA 2Q31A 4K0KK 2VGNA 2EX3A 1KAYA 4AHCA 1C0GA 3JAMO 1U48A 4BVPA 1ZBIA 4J8FA 5JS2A 3VEWA 1X3NA 4BRFA 4CZGA 1ZBUA 3PIPL 2P9LB 2XY5A 2A6AA 3OYHA 1MWKA 1K8AO 3J80O 4GKJK 1VQNN 1K8KA 1EKEA 1HX1A 3H1VX 1KVAA 3K5OA 3OYBA 3MDQA 4A5AA 2BDPA 3HVRA 1P90A 4K8ZA 1Q86O 2QA4N 3SK3A 4CHQA 4U7BA 5A2QO 4RWTA 1RBUA 1MWMA 2EHGA 4X62K 3C6UA 3DLKA 2QM1A 3EY1A 5DK5A 2UUCK 2WONA 3O9RA 3PO5A 3CXCM 3O9TA 1TGOA 1WSFA 4DFKA 1Z26A 2GX9A 2VWBA 1EWRA 3I55N 2QKKA 1JL2A 2YKNA 5BR8K 1VQ8N 2YJFA 3H6EA 5ADXH 2VG6A 3H08A 3QB0A 3PSIA 4JKCA 3T7ZA 5EVZA 2DFEA 2HNZA 2RHKA 4JAXA 4Y0WA 3M5RA 2HB5A 4B9LA 2JWKA 4MO5A 4DR2K 4NLBA 3SPYA 1E3MA 1HMVA 1S1UA 1JLCA 3UKUA 3ZEUA 2Z1GA 3CCSN 1Q18A 4FXDA 3DWLA 4OKJA 4DR3K 4KHPK 1VQPN 4KAZA 3D6RA 3L2QA 4B9UA 5KRSA 2HHWA 3KLEA 2B5JA 1ILYA 4OPHA 2WFBA 2P9NA 4EFHA 3WQTA 3D45A 1YT3A 4B1WB 3A5MC 4PKHA 5AQTA 1S6PA 5DM7L 2O8CA 2O8EA 4NB4A 1TAUA 4FLWA 1YXQA 5CZ2A 4MDAA 3ULDA 4FJ7A 1UA0A 3UIQA 4E1MA 1HPMA 3W3DA 1QZ5A 3P4IA 3T1AA 3EO3A 2QWMA 4HHTA 4L8RB 1QZ6A 2GWJA 4H5WA 4LY7A 1ZBLA 4KB1A 1QE1A 3OHRA 4JKAA 1NLVA 1IKVA 4LSNA 4B9TA 4E7IA 4KREA 4GVMA 3T3FA 3CJCA 2DTUA 4TSXA 3QLHA 4BE0A 1TUYA 3CPEA 4KHUA 4FO0A 5I3UA 3OJSA 3OYKA 2DFHA 2QXLA 1QSYA 1IH7A 4M3RA 1W2BM 4CJQA 3P31A 3PX0A 4FWMA 1BA1A 4N76A 4K25A 3PY8A 4C8NA 3V1RA 4DTPA 3IUCA 1MDUB 3F5TA 4MQ3A 4FWRA 4GW6A 2PY5A 3KWGA 3I0SA 1T3VA 3G6EN 1JLGA 4HTLA 2LSNA 4QS8A 4DF4A 1HYSA 4OGEA 2YNIA 4IBNA 4M41A 3THVA 4DV6K 4C23A 5E26A 1JLFA 3WXJA 1YI2N 4DSKA 4FYDA 5JVGL 4FLXA 4KPYA 5AQLA 2O8BA 4LC9B 1C1BA 1NG9A 3JSMA 5AZIB 1G15A 2YX6A 2PAVA 3TU5A 4DS4A 4IFYA 4M7XA 1Q9XA 3MCAB 4H0TB 4BREA 3J7ZO 2KFNA 4FL9A 3H46O 4ISGA 3HO1A 4YDUA 2KLAA 4DLGA 3MAQA 3RRHA 3QBWA 3PIOL 1N36K 3LDNA 2HMIA 4LSLA 3JS6A 2B4JA 3THWA 1NOZA 3BF1A 3J8AA 1BQMA 4FJXA 2G8IA 4JS4A 3HI0A 3WEEA 1RILA 5B8HA 4DR1K 5KPTA 1R59O 1YTAA 3I8DA 2RF2A 3OBWA 2P5OA 1XC9A 3K9KA 1O13A 1VAZA 4IOAL 1TK0A 4JLHA 4J2DA 3LDSA 4DV4K 4YY3K 1NJXA 3CCMN 4F8RA 1N6QA 4Z4GA 1S72N 3ISNC 2YHAA 3CCLN 1BG3A 3CJ1A 3G0ZA 2ZJPL 1VSMA 4X65K 3OYEA 3N4QA 5CR4A 4G1QA 3I0RA 3K9JA 3MN7A 1RDCA 5CYQA 3ZT0A 4CEFA 4YOWA 3A5NC 4WQ4A 5EXWA 2HF3A 3UB5A 3NMUA 3BEXA 4I6MB 3BGRA 2CH6A 4CE9A 3ZSXA 1DTQA 2IIRA 2JWLA 3IKMA 3KIOA 4H5RA 3M8PA 1NKBA 1HNZK 3SUOA 4FJLA 1K9MO 4GV9A 1IKWA 4KH4A 1QQNA 1VSKA 2EWSA 5SWMA 3O3FA 2HBKA 3HM9A 2NLXA 3DXKB 2QTDA 2UUAK 5FPEA 4EZ9A 3FE1A 5KPZA 3HM8A 1RTIA 3NF6A 1W0HA 1HKGA 3MN5A 3MEDA 3O08A 1NKCA 1NGEA 3R8EA 1NJWA 3IG1A 4BC3A 3CFOA 1VSJA 2CGJA 3ZX0A 5C2FA 2E2NA 2FBTA 2JLEA 3EEQA 4Z94A 3WXIA 1QSLA 4FJ8A 3QERA 4OLAA 3A2FA 4DU1A 1Z25A 3LP1A 1BU6O 4E7JA 3BDPA 4B9MA 4BR0A 5JLHA 1S6QA 4O0JA 1XMOK 3J81O 1HQUA 4PL8A 1LWEA 3AO5A 4A2BA 4BRLA 1K8KB 3VQ7A 4WE1A 2IVOA 4XIUA 3AGRA 4IO8A 3G25A 4AHSA 3A0IX 3C7NA 1JLEA 3QEVA 4ICLA 1SL1A 3VEXA 2NUBA 3LAKA 4AHRA 3FGUA 3RSEA 4WYBA 1EQYA 4FM0A 2G8FA 3KZBA 1WOQA 4JKDA 4JS5A 2UXCK 3PO4A 3VF6A 4IFEA 2WOMA 4DTMA 2P9SA 4Z4IA 4JI2K 3BZCA 3ZSVA 3AA3A 4QS9A 1T6DA 1B9DA 2OANA 4FVMA 1JL1A 4CJFA 1WUAA 4CJSA 3VPZA 3H1QA 5JS1A 4KTZA 5KGXA 3PLAA 4E7HA 1V4SA 1VHXA 4MLHA 4J2BA 3IAYA 3TAQA 3AARA 1YITN 1NOYA 4M3XA 3NFAA 3H3NO 4IWVA 3HP6A 3VQ4A 4DQQA 3C6HA 4JKGA 4CZJA 4B08A 3SAFA 5HROA 4KH6A 3DRPA 4IOCL 3D2FA 3KLHA 4B3SK 1D9DA 4KTQA 4ZHRA 2Q36A 1NK8A 5TKYA 1HLUA 3UKUB 3ZEUB 3S9HA 3V4IA 1C0FA 1RT6A 3VEVA 2E4LA 4MFBA 1JJ2M 3S3OA 4LH4A 2ZWHA 3ZSOA 4BR5A 1HKBA 1RT7A 1RCHA 3V9ZA 2P9NB 3E9PA 1KCFA 3DJCA 1YAGA 2O8CB 1KQSM 1SKSA 5IT9O 2O8EB 4DV2K 4HCCA 4KI4A 3V9XA 3QDKA 4RTFD 1EX4A 5M1KA 4JRQA 5HRRA 4NYNA 4LF6K 4E0DA 5FLXO 4JK8A 2IVPA 4ZTFA 2GEMA 2Q97A 2G8WA 5C10A 4CGHA 1RT1A 4JHDA 1FK9A 3CFRA 3CM5A 2DPNA 4RW8A 1JXBA 5GADP 2IVNA 4FM2A 2RE2A 1TVRA 2YCHA 1XNRK 3I33A 4GKKK 3SMPA 3BUZB 5AQHA 1RT2A 3A5LC 4CZLA 1BGXT 4FWLA 3SZ2A 4OGCA 1NJIO 5LJWA 4BRAA 4H0VB 5C0YA 4DV0K 3QBXA 3WXMB 3CM6A 5AQRA 2X6NA 1HNVA 1RBTA 3OS1A 4K41A 1NGCA 4J2AA 1DLOA 3FZLA 2GWKA 1BUPA 4NYFA 3DRSA 3NDKA 4DQIA 1YTUA 4LH5A 1RDDA 4BRPA 2QW9A 4DTSA 3WNHA 3U4LA 3CQXA 3CJ7A 3CFPA 2ASOA 4HWIA 2GV9A 4CJVA 5M1OA 2FLOA 4CGGA 4IXCA 3AA5X 4FLZA 3TABA 1BDGA 4N41A 1ASVA 2ZD1A 3O9UA 1WSJA 3OS0A 3TANA 1KRPA 1JCEA 3LP2A 3MK6A 3EE8A 4M3TA 3SJJA 2BH1A 2OPPA 3QINA 2HHVA 3MXJA 4CJUA 4C8KA 3DAWA 4CCHA 3L6QA 3LWLA 1I39A 3WNGA 3AVFA 1SKRA 2IGIA 1QVGM 1KD1O 4OVLA 1NK6A 3EYZA 3TAMA 1HPZA 3C0BA 3OVNA 4A59A 2O8BB 2RN2A 1ZXOA 1SL2A 3KKRA 4EP4A 2ITMA 4IFVA 2A3ZA 3R3LA 2QKBA 1RBVA 5M1FA 4DR4K 4H0YB 5LL6Z 4BROA 3OS2A 1QQCA 1SS6A 1X9JA 2HHXA 4W5QA 1BCMA 2YJEA 3WXLA 5I9EB 3HRGA 2ASPA 2UXBK 4CJLA 1K73O 5JMVA 1E4GT 3LM9A 3L2VA 4CD1A 4HTUA 2VYPA 3THWB 3A5OC 4DB3A 4FJIA 3PX6A 3WEEB 1G99A 1BO5O 2YNHA 1ZC6A 2Q0RA 3O1BA 5C42A 1KFSA 4NCAA 2E88A 3VN5A 4JKFA 4MDBA 3CC4N 2HNDA 2FBVA 4EAHD 4I9LA 3MMVA 4F9OA 2PYJA 2D5RA 4DQRA 1NK4A 3THYA 3SCXA 5BREA 2BE2A 1SQKA 3L3UA 1ASWA 4M7YA 1BISA 3FZHA 2DFFA 2A42A 4JI4K 4JI8K 3S3MA 3R6MA 5AQMA 2OPRA 4JD2A 4FJGA 3AVBA 3HTVA 2FBYA 4RW4A 4KHQA 2NRXA 2XY6A 1BCOA 2HSTA 5AQSA 4BG8A 1YIJN 3O9SA 3SBGA 5SZTA 2P9PA 1WSHA 3IRXA 3MEGA 1YJNN 3SJHA 4DWIA 4CF0A 3VGMA 1TK8A 1N5YA 4BRIA 5EU7A 5M1PA 3OYFA 1GLFO 3KHYA 4CIFA 3PUFA 1LAWA 4OX9K 2O8DA 4GVEA 1NKEA 3LDPA 2UU9K 4OKKA 4FJJA 4RG8A 4KKOA 2AA4A 5KGWA 4Q0BA 4YOYA 3LDOA 2OZSA 5AQIA 3M3ZA 1FKPA 3HPOA 1TKXA 4C8LA 5BRHA 2KQ2A 5F0XA 5KQ8A 2IC3A 4AM7A 2NRVA 4IDKA 4B8CA 3TR8A 3LZIA 3MX5A 3ATVA 3RWUA 4O8KA 2HVHA 4HUGA 1BL3A 3KK2A 3SV4A 1Q81O 4ILJA 5GIOA 3ZYYX 5DM6L 4KV8A 3BP8A 1WSGA 4MO4A 3KLGA 4FJ5A 4BE1A 2P5GA 1GLLO 1JLBA 3L3VA 4CFBA 3QEPA 3ZETA 4IDHA 4CGFA 1S5JA 2E5LK 4B1ZA 4CBUA 4ISFA 4EHUA 3ID8A 1HR0K 1Q82O 4RW6A 3O3GA 2F9TA 3KJVA 5AQUA 1CZBA 4FW2A 5C2DA 1W97L 1C0MA 1GLBG 4Y1CA 3DLHA 1FKOA 2Y1JA 4UY8O 4JNEA 4Z4CA 1HYVA 4K8XA 3C7NB 3SQ2A 3T1YK 1I94K 3RSEB 2XRIA 4CZEA 4YORA 5FRMA 2UXDK 1LWFA 4AHUA 4JI1K 5AQKA 3TTCA 3DI6A 2CGKA 1NGFA 2P9SB 3NH2A 3LWMA 3DLBA 3HP9A 4LF5K 5EX5A 1BOTO 1IG9A 4B3TK 5EY4A 1ZBFA 3L2WA 5TKWA 4OJRA 3TWHA 1IBMK 3G71N 3T19A 4WQ5C 1J9AA 3U8XA 5JVHL 2IOCA 2NRZA 1HQEA 1Z05A 2OTLN 4DTJA 1KSPA 3V9SA 4DV7K 3AA2A 4JKGB 4PL7A 4AH9A 1X9MA 2A5XA 3K0SA 3D2FB 3QFUA 4QOZB 3KD5E 3ZCMA 4CHZA 4A57A 3LALA 3HBTA 1Z6RA 1V4TA 1TYQA 2P1JA 3EZ5A 1GLEG 3SUNA 1L3SA 2F8TA 2FC0A 5JICA 2WUSA 4RW9A 5F1XA 1ATSA 1EXQA 3O9QA 2AJQA 2VWKA 3QNOA 1TL1A 4E7LA 5KQDA 4CECA 1HRHA 2OPSA 3VEZA 1N32K 1RBSA 4EIAA 4KH5A 3SMSA 3U3YA 5IWAK 1ZYQA 3VA0A 3K59A 1IG8A 4PHTX 4LF8K 1EO1A 4EHTA 3O4QA 1QHTA 2X74A 4U67L 1YHQN 2QWQA 4DQPA 3ZT2A 1F21A 2VG7A 4XH4A 3PSFA 4NLCA 1LW2A 4DQSA 3E66A 3G4SN 1S9EA 4DV1K 4ILGB 1KTQA 4JHDB 3O5BA 4IO9L 2QEXN 2VG5A 3FLCO 4DKWA 1RTDA 4DR6K 2QI2A 3CJ9A 5CE3A 5BPNA 1J5OA 1B92A 4V19S 3ZSQA 4CJTA 1IBKK 5F2RA 5CYMA 1VSLA 4CJPA 4O8UA 1U2VB 5CZ1A 2UUBK 2G8UA 2G8KA 1ATRA 2I7NA 3CD6N 3GBTA 1X9SA 1U45A 1YUWA 2W41A 2HBJA 4JKEA 1IBLK 2CGLA 4CF2A 3DXMA 3KVGA 3WNEA 4BRGA 1HJRA 3Q7BA 2XY8A 3KWIA 3ZLJA 1T03A 3KTQA 2XHBA 4IOXA 4DSIA 5AFUH 3RMDA 4DHYA 4FPBA 3V1QA 3DLEA 3OW2M 3THXA 5AR0A 2ZJQL 3OYGA 1EWQA 1B9FA 4DTNA 3VEOA 2E8AA 3V9UA 2FF3B 1OVYA 3ZSWA 4JI3K 2UYTA 3CJAA 4H4MA 4YOVA 1UAXA 4QS7A 4E19A 3OBYA 4NCBA 1U04A 1EETA 2F8SA 2E1ZA 4B3RK 3VEYA 1OVQA 4R5PA 4DTRA 3AVKA 3AVAA 2PFUA 3LP0A 4CJKA 4DQ8A 4DSFA 3H3OB 1T05A 4FLYA 4CHPA 3D0PA 3HOTA 3OY9A 3CIPA 1X9WA 3VF4A 2VQEK 4DMNA 4BACA 4B8AB 3P1GA 1HKCA 4WCEL 3E9LA 3A8YA 3OYDA 1JKHA 4BVOA 4A61A 1BIZA 2HHHK 1LOTB 2Q2RA 2QWLA 4QAGA 4I9QA 3SV3A 1SL0A 3CF5L 4AQYK 5AQJA 5LMUK 2W40A 3R9PA 3ZT3A 4E7KA 5J2PA 1VQ9N 4DFJA 2HOEA 1VQ6N 3ZX3A 4CEDA 4C1NI 4C8MA 3THYB 4MLEA 4OLBA 4YNQA 3DOLA 1OH5A 3CJBA 1C0TA 1NK7A 4HUFA 3RMBA 3HK2A 4DV3K 4JD2B 4CZHA 3HT3A 3HYFA 1TL3A 5AQFA 2GTDA 1IV0A 1C1CA 3RVCA 1VQ7N 5T7BA 3MWPA 3SNNA 1W7AA 3NH0A 3ZX2A 3NBPA 3F2KA 2P9PB 2F9WA 1OH6A 4B9SA 3RMCA 3OA9A 1S1TA 1NGGA 3LPUA 4Y1DA 1Q7YO 3PX4A 4BY9C 4PUOA 4BWJA 3RRGA 1BQNA 1KAXA 3FZMA 1GLCG 2QWNA 2P9IA 4JV5K 2O8DB 2VQFK 3SQ0A 2A41A 4A62A 1ATNA 4BWMA 3EN9A 4M3UA 3EL2A 1L5UA 3KD1E 3C94A 3MCPA 2QWOA 1TKZA 4LD0A 2FSJA 1KLMA 3KK1A 4I2QA 4CEAA 4H03B 3MX2A 2FBXA 4CEOA 4PKIA 4CHOA 3AVLA 3ALYA 3AO2A 4CFDA 4CGIA 4DTUA 1Q9YA 2HHUA 4AM6A 3VQ8A 4B3OA 3J7YP 5HRSA 2D1KA 4JKHA 2D0OA 4CJ3A 3U9ZA 2A40A 4NCGA 1XMQK 1QVFM 3T69A 2RPIA 1VQKN 1XNQK 3R1XA 5AQGA 4BDPA 4IG0A 4GY2B 4KRFA 4KHWA 2Q0UA 3B8AX 4E1NA 3VQ5A 2BUPA 3CMAN 4KHYA 2GELA 4B1YB 5J2NA 3ZETB 4PKGA 2HNYA 1NGAA 3K57A 3NAEA 5ADXA 1ITGA 2ITGA 4CVNE 4FWNA 2HHTA 5HRNA 4CIGA 3TARA 4BRHA 3B6PA 1J54A 3VF2A 3K5MA 3QFPA 5HP1A 4FK4A 5FRNA 2H3GX 5MLCQ 1NNEA 2V7YA 4OKEA 4DSEA 1P8ZA 1LV5A 3BY5A 1UA1A 2OTJN 5J1EA 4CESA 1HNIA 3M6GA 2WTUA 4B1UB 4BRKA 5FPNA 1S22A 1RT5A 5CY4A 1D4XA 3WUHA 1U2VA 2BTFA 1I3AA 5BRFA 4XEIA 1WAFA 1CXUA 4H5VA 3WXKA 1QQOA 4JN4A 3CCQN 3AAPA 4GV6A 4DCHA 2XO7A 2AP1A 4W5OA 4KHNA 4DR7K 3CETA 2CH5A 3WNFA 4KBOA 3CCVN 2YNGA 3ASMA 5H1SQ 1KVBA 3DM2A 2KKZA 2QXFA 5GIPA 2OCEA 3KK3A 2DY4A 1CZ9A 1RTHA 1TYQB 4CI6A 4B9VA 4DS5A 4BGAA 1NJYA 3MEEA 4RW7A 4ILHA 3KLIA 1CLQA 1R0AA 4JI5K 1OKJA 3M8SA 5GAEP 4JYAK 2Z1HA 3VQPA 4WQ5A 3CG7A 1T44A 5AQXA 2FSKA 4QCLA 5KI6A 3WT0A 5AZJA 3JXUA 4YFUA 5AQOA 3VGLA 3F9MA 1XI1A 1WBDA 1QS4A 4CEEA 3QESA 3HVTA 4E1JA 1VQ4N 3PV8A 4KI6A 2O8FA 4WFNL 4CJ5A 4CBXA 2RKIA 5CHIA 1OH7A 5HL7L 3TAEA 4NXMK 3K58A 3OYNA 4G9ZA 5BR9A 2IS3A 1T6CA 3BF3A 3HPGA 2HBMA 2OYQA 4BR4A 4CJ4A 3GDQA 2YHXA 3VETA 1YJ9N 1NMNA 3AO3A 3C95A 3LM2A 1RTJA 1W9HA 3VGKA 1NJZA 5AQVA 4GV3A 4CERA 4JI6K 1WAJA 2P9UA 2YV0X 5E84A 5J2QA 5FDLA 4ID1A 3AY9A 1X3MA 3F9KA 3SLCA 3L2RA 3CC2N 1FJGK 1ESVA 4JRPA 1KAZA 1DTTA 3DXMB 3CYMA 5C24A 2I5JA 4LFBK 2W42A 4Q5VA 1NGIA 2IDOA 4KFBA 1QSSA 1U6ZA 3VTIA 3GG4A 1QQMA 5HLFA 4FWQA 4FM1A 3CQ8A 3OYCA 1VSHA 4GNIA 3DMJA 3N4PA 5D3GA 4IG3A 2ETJA 3THXB 3LDQA 4FSVA 2VGMA 1T8EA 3QIPA 3HXMA 2IAJA 3QETA 1YF5L 1L3TA 3U6FA 4CHYA 2HMPA 3TSUA 3LAMA 3TSQA 5BRDA 2YI1A 3NGYA 1HYZA 3V1OA 4AILC 3NE6A 3VQQA 3DLLL 3M8RA 3AVCA 4CFCA 4KTWA 1LCUA 3VQ6A 1JCGA 4HCBA 2HBLA 3S3NA 1VSIA 4YOTA 3NVKA 3NGIA 2W6LA 1IKYA 3AVHA 3O80A 4IEEA 3OYIA 5AFUA 4FW1A 4LFCK 1S1XA 1NK0A 3EKSA 1K6YA 2E6MA 4FLUA 5I42A 1NK9A 4JK7A 4BDZA 3QEIA 3DLRA 4FWPA 3MECA 4PY5A 2NRWA 2B6AA 4CJWA 3SYZA 1E4FT 4JKBA 4FJMA 3QEXA 2YHBA 3ZT1A 4N56A 2P9KA 1NM1A 5M1NA 3IDHA 1O1WA 2VWJA 3ZSZA 5LJVA 3NVMA 1RDWX 1DGKN 4BGBA 3HPHA 3NHGA 3CC7N 2KFZA 5ELZA 3TTFA 3U9DA 3C6AA 3MN9A 3L0QA 2G8VA 1J53A 4ELVA 4F2SA 1WSIA 3SQ4A 2HVIA 4KO0A 3D2EB 5BPMA 4F4KA 1RBRA 5KTQA 4B9NA 3J7AP 4GMJB 5FPMA 3CI5A 4JK9A 3HL8A 3VENA 3E1YA 2Z1JA 1XC3A 3GE1A 3TTDA 4BR7A 5C15A 3M8QA 4EZ6A 1VQMN 5K14A 3CPWM 1UOCA 3TAGA 4W5TA 4FJ9A 2P9IB 3VQBA 1BWFO 4H5NA 3HOSA 3AVGA
chains in the Genus database with same CATH topology
4X64K 4DR5K 2UUAK 4LF4K 4B3RK 4JI0K 2F4VK 4JI5K 4LF7K 4DR4K 5LL6Z 4K0KK 4NXNK 3JAMO 4JYAK 1N32K 3J7YP 1N36K 2UXBK 5IT9O 1XMQK 4DV2K 5IWAK 2VQEK 4LFCK 4LF8K 1XNQK 1HNXK 4LF6K 5FLXO 4DR1K 2HHHK 1XMOK 3J80O 4GKJK 3J81O 2E5LK 4JI7K 4AQYK 5LMUK 4DV1K 1HR0K 1XNRK 4GKKK 4DR6K 4NXMK 4DV4K 4YY3K 4CVNE 4V19S 1N34K 4CW7B 1IBKK 4B3MK 4DV0K 5A2QO 4DV5K 3T1YK 1I94K 2UXCK 4JI4K 4X62K 2UXDK 4JI8K 4X65K 2UUBK 4LF9K 4JI6K 1HNWK 4JI1K 4JI2K 4DV3K 4LF5K 2UUCK 4DUYK 1IBLK 4LFAK 4B3TK 1FJGK 3T1HK 3OTOK 1IBMK 4LFBK 5BR8K 4DUZK 1N33K 3J7AP 2ZM6K 4YHHK 5AJ3K 5LMNK 4DV7K 4B3SK 4DR2K 4OX9K 1HNZK 2UU9K 4DR7K 4JV5K 2VQFK 4DR3K 1J5EK 4JI3K 4KHPK 4X66K 4DV6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 K;  4DR5 K;  2UUA K;  4LF4 K;  4B3R K;  4JI0 K;  2F4V K;  4JI5 K;  4LF7 K;  4DR4 K;  5LL6 Z;  4K0K K;  4NXN K;  3JAM O;  4JYA K;  1N32 K;  3J7Y P;  1N36 K;  2UXB K;  5IT9 O;  1XMQ K;  4DV2 K;  5IWA K;  2VQE K;  4LFC K;  4LF8 K;  1XNQ K;  1HNX K;  4LF6 K;  5FLX O;  4DR1 K;  2HHH K;  1XMO K;  3J80 O;  4GKJ K;  3J81 O;  2E5L K;  4JI7 K;  4AQY K;  5LMU K;  4DV1 K;  1HR0 K;  1XNR K;  4GKK K;  4DR6 K;  4NXM K;  4DV4 K;  4YY3 K;  4CVN E;  4V19 S;  1N34 K;  4CW7 B;  1IBK K;  4B3M K;  4DV0 K;  5A2Q O;  4DV5 K;  3T1Y K;  1I94 K;  2UXC K;  4JI4 K;  4X62 K;  2UXD K;  4JI8 K;  4X65 K;  2UUB K;  4LF9 K;  4JI6 K;  1HNW K;  4JI1 K;  4JI2 K;  4DV3 K;  4LF5 K;  2UUC K;  4DUY K;  1IBL K;  4LFA K;  4B3T K;  1FJG K;  3T1H K;  3OTO K;  1IBM K;  4LFB K;  5BR8 K;  4DUZ K;  1N33 K;  3J7A P;  2ZM6 K;  4YHH K;  5AJ3 K;  5LMN K;  4DV7 K;  4B3S K;  4DR2 K;  4OX9 K;  1HNZ K;  2UU9 K;  4DR7 K;  4JV5 K;  2VQF K;  4DR3 K;  1J5E K;  4JI3 K;  4KHP K;  4X66 K;  4DV6 K; 
#chains in the Genus database with same CATH topology
 1Q8I A;  1Y97 A;  4OPK A;  4DR5 K;  4LF4 K;  3TSP A;  1A5W A;  3C6T A;  2KZM A;  1XQS C;  4CK2 A;  1KLN A;  4FJH A;  2F4V K;  4ID5 A;  2O4G A;  1VQL N;  3EKU A;  4O44 A;  4XH1 A;  3CHW A;  3OYJ A;  4C8O A;  1RT4 A;  4XH5 A;  5FRO A;  4Z4E A;  4H0O A;  3IS9 A;  3V81 A;  2V52 B;  4W5N A;  1KFD A;  1HUX A;  2E2Q A;  4IJN A;  4KB0 A;  1D5A A;  5BPL A;  4HVJ A;  3AO4 A;  1N8R O;  4ELT A;  3ID6 A;  3FR0 A;  3SAH A;  2HHS A;  3VER A;  3KLF A;  4JI7 K;  2Y1I A;  4M3W A;  1TUU A;  1D8Y A;  3ULE A;  3VES A;  1X1P A;  2GUP A;  3CCE N;  2ZF5 O;  2QWR A;  3C65 A;  2P51 A;  2NZT A;  2GUI A;  2JGU A;  1RGI A;  3E01 A;  3V6D A;  2NRR A;  1C0U A;  1HNW K;  1BI4 A;  3SBT A;  1NU0 A;  3NF8 A;  3VQD A;  4BC4 A;  4DUY K;  3ATU A;  1L3V A;  3ENO A;  3UKR B;  3DLG A;  4E89 A;  1L3U A;  4F2R A;  3K5L A;  2ZQB A;  4IKF A;  3P83 D;  1DKG D;  1NGD A;  2E1Y A;  3IMX A;  1NMD A;  3O3H A;  4FJK A;  2E2O A;  2D0C A;  1Y64 A;  3O4W A;  4A5B A;  2V7Z A;  3CCJ N;  4DTX A;  1GOB A;  1U47 A;  1ZBS A;  4O4G A;  3AO1 A;  3I56 N;  1U4B A;  4L3Q A;  4FOE A;  3LL3 A;  4ZTJ A;  3MXM A;  1NGB A;  3HST B;  4CIE A;  4DF8 A;  1NWK A;  4E3S A;  4FVU A;  3G10 A;  3FFI A;  4AHV A;  1TAQ A;  3P38 A;  2X6S A;  2R7Y A;  4CZF A;  4Z0U A;  2W6K A;  3VOV A;  4M63 C;  2KZZ A;  4AHT A;  2XY7 A;  3HSC A;  2G8H A;  4H0P A;  4LF7 K;  1M1K O;  4M42 A;  1VQO N;  3M1F A;  1VSF A;  3ZSY A;  1SKW A;  3VQE A;  5HBM A;  5AQZ A;  3VMF B;  1J6Z A;  4FJN A;  3DOK A;  1VRU A;  2I7P A;  3MXI A;  3MWT A;  5GIN A;  2P9L A;  2OPQ A;  5GAG P;  5J2M A;  5AZJ B;  4CEB A;  4CZK A;  4OPJ A;  3ZT4 A;  5M1Q A;  3L4Q A;  4A2A A;  1MA9 B;  4HUE A;  2V51 B;  3S41 A;  5FPD A;  3CCR N;  4FZY A;  4M3Z A;  1VK0 A;  4PWD A;  2NNW A;  3QIC A;  2E6L A;  4BE2 A;  1JLQ A;  3U3G A;  1VSE A;  2OA8 A;  4WFB L;  4FK2 A;  4FPA A;  3RR7 A;  1TKT A;  2O8F B;  1DEJ A;  3DYA A;  3BZK A;  3SQ1 A;  2Q3S A;  3NF9 A;  3JYT A;  3GOI A;  3SUQ A;  3K5N A;  2ZGY A;  1NGJ A;  3TAF A;  3NCI A;  1BHL A;  2PZS A;  3V9W A;  4FWO A;  3O1W A;  4N47 A;  4F3O A;  4BQL A;  2ZJR L;  2A1S A;  1GOC A;  4N5S A;  1LAV A;  4K42 A;  2P9U B;  3OYA A;  2KTQ A;  2ASM A;  3NGZ A;  3T1H K;  1TV6 A;  1LW0 A;  3OTO K;  2ZGZ A;  2HW3 A;  2F7T A;  3D7E O;  4BRM A;  1N33 K;  4CK3 A;  4CF8 A;  4Z4H A;  4WF9 L;  2ZM6 K;  4YHH K;  3QML A;  4H0X B;  4CZI A;  2J4R A;  4K43 A;  3OJU A;  4I2P A;  3TAP A;  1ASU A;  2PYL A;  5JLF A;  1C1A A;  3SPZ A;  3RR8 A;  4O0I A;  5AQY A;  1KC8 O;  3ENB A;  1KXP A;  1BA0 A;  1RFQ A;  2KHO A;  4I7F A;  1D9F A;  1BIU A;  2A1R A;  3D2E A;  1IKX A;  1MU2 A;  4BC2 A;  4X64 K;  3E9O A;  4Z4F A;  4OO1 J;  4JI0 K;  1RDB A;  1JLA A;  3ZSR A;  4H8K A;  1WB9 A;  1ZBH A;  4CF9 A;  1WBB A;  1VRT A;  4CGD A;  2BGG A;  3O4N A;  3O8M A;  1GLA G;  4H5T A;  4DLE A;  1YJW N;  4BR9 A;  1VQ5 N;  1WN7 A;  2NRH A;  5C12 A;  3QEW A;  3RMA A;  4M3Y A;  3O6W A;  3QIO A;  3SI6 A;  3AGK A;  4IEI A;  1FW6 A;  3I8B A;  2Z1I A;  2QWP A;  3L2U A;  1SUQ A;  1T7P A;  5KRT A;  2Q1N A;  2YNF A;  1C6V A;  2HHQ A;  4CHN A;  1S1V A;  1IO2 A;  3W0L A;  4FLT A;  4BRC A;  4RCH A;  4BR2 A;  3P5J A;  4FWS A;  4B9Q A;  3VA3 A;  3Q7C A;  4YOX A;  4CF1 A;  4CFA A;  2YKM A;  1NK5 A;  4BG9 A;  4CEZ A;  4CW7 B;  3OYM A;  4IZ9 A;  1XUP O;  3RTV A;  2PBD A;  5AQP A;  4B3M K;  2P9K B;  2FXU A;  4LF9 K;  3AVN A;  3AAQ A;  3L4I A;  1CZA N;  3ITH A;  1RDU A;  3OYL A;  3P39 A;  3LAN A;  4JEP A;  4LFA K;  4YOU A;  1DT9 A;  3ENH A;  4CEQ A;  3IFR A;  1S1W A;  3F73 A;  3SUP A;  3H45 C;  3LDL A;  4YDU C;  5DMR A;  2BAN A;  2E2P A;  4DU3 A;  2KW4 A;  4DUZ K;  4DSJ A;  1UWB A;  2FF6 A;  2D4W A;  2HF4 A;  4FCY A;  4DSL A;  4IJA A;  4OPA A;  3VQ9 A;  1M90 O;  3FZF A;  3AV9 A;  5AJ3 K;  4J2E A;  5LMN K;  3HJF A;  1TK5 A;  1TKD A;  1HJO A;  1GOA A;  4CGJ A;  1GLD G;  5HRP A;  1IJJ A;  2D0B A;  4PA1 A;  2NRT A;  3L8B A;  3UKR A;  1YVU A;  5E41 A;  4CZM A;  3UE5 A;  4X66 K;  4H4O A;  3SAG A;  4FZZ A;  1GLJ O;  1RT3 A;  4C1N K;  5AZI A;  5AQW A;  3K2P A;  4CBW A;  1NBW A;  4W5R A;  3CCU N;  2QK9 A;  2E20 A;  1JCF A;  2ZE2 A;  5BN9 A;  3CQY A;  4DFP A;  1VSD A;  4NXN K;  4BRD A;  2YHY A;  4CD3 A;  4O5B A;  4CK1 A;  3QNN A;  4FWK A;  3AVJ A;  2D0A A;  1HNX K;  4WQ4 C;  3VQC A;  3GL1 A;  1SAZ A;  4F3T A;  5AQQ A;  3TI0 A;  3FFK B;  1S3X A;  3VQA A;  1XHZ A;  3KKS A;  4NO7 A;  1OH8 A;  5GAH P;  2GBZ A;  2OZM A;  5LY3 A;  4PQU A;  3ULE B;  4BRQ A;  4O5F A;  4DU4 A;  4CJE A;  1RNH A;  4R79 A;  4FZX C;  1N34 K;  1EP4 A;  4BRN A;  4DG1 A;  3MN6 A;  2WC9 A;  4DV5 K;  1H1V A;  3AA4 A;  2O4I A;  1S9G A;  2F96 A;  3KK7 A;  1KVC A;  3HZ6 A;  3NF7 A;  3EZW A;  4CJR A;  5C25 A;  4AF1 A;  1BI4 B;  3NH1 A;  4FOI A;  3LZJ A;  4FLV A;  5HOO A;  4ELU A;  1FXX A;  2VCP A;  3QO9 A;  3CME N;  4I6M A;  2X78 A;  4WFA L;  2WBN A;  1U49 A;  2D0P A;  1REV A;  1SZ2 A;  5KPR A;  1JXE A;  4M45 A;  4KHS A;  1WNS A;  1A5X A;  4BDY A;  5AQN A;  4DFM A;  4ISE A;  4UQG A;  3FZK A;  3AVM A;  3CER A;  3B6O A;  5BN8 A;  1QHA A;  1XWL A;  1LWC A;  4BQZ A;  1WLJ A;  1CXQ A;  2YHW A;  4FK0 A;  1J5E K;  3AVI A;  3DXK A;  3VTH A;  4CJ7 A;  2ATQ A;  1RDA A;  3TPQ A;  4EP5 A;  3DRR A;  4DTO A;  3LPT A;  1WSE A;  1A5V A;  4B1V A;  5EOY A;  1NGH A;  1XHX A;  1QTM A;  4BC5 A;  4B1X B;  4O55 A;  2FSN A;  1SV5 A;  3LP3 A;  3WQU A;  3EE9 A;  1YVN A;  2Q31 A;  4K0K K;  2VGN A;  2EX3 A;  1KAY A;  4AHC A;  1C0G A;  3JAM O;  1U48 A;  4BVP A;  1ZBI A;  4J8F A;  5JS2 A;  3VEW A;  1X3N A;  4BRF A;  4CZG A;  1ZBU A;  3PIP L;  2P9L B;  2XY5 A;  2A6A A;  3OYH A;  1MWK A;  1K8A O;  3J80 O;  4GKJ K;  1VQN N;  1K8K A;  1EKE A;  1HX1 A;  3H1V X;  1KVA A;  3K5O A;  3OYB A;  3MDQ A;  4A5A A;  2BDP A;  3HVR A;  1P90 A;  4K8Z A;  1Q86 O;  2QA4 N;  3SK3 A;  4CHQ A;  4U7B A;  5A2Q O;  4RWT A;  1RBU A;  1MWM A;  2EHG A;  4X62 K;  3C6U A;  3DLK A;  2QM1 A;  3EY1 A;  5DK5 A;  2UUC K;  2WON A;  3O9R A;  3PO5 A;  3CXC M;  3O9T A;  1TGO A;  1WSF A;  4DFK A;  1Z26 A;  2GX9 A;  2VWB A;  1EWR A;  3I55 N;  2QKK A;  1JL2 A;  2YKN A;  5BR8 K;  1VQ8 N;  2YJF A;  3H6E A;  5ADX H;  2VG6 A;  3H08 A;  3QB0 A;  3PSI A;  4JKC A;  3T7Z A;  5EVZ A;  2DFE A;  2HNZ A;  2RHK A;  4JAX A;  4Y0W A;  3M5R A;  2HB5 A;  4B9L A;  2JWK A;  4MO5 A;  4DR2 K;  4NLB A;  3SPY A;  1E3M A;  1HMV A;  1S1U A;  1JLC A;  3UKU A;  3ZEU A;  2Z1G A;  3CCS N;  1Q18 A;  4FXD A;  3DWL A;  4OKJ A;  4DR3 K;  4KHP K;  1VQP N;  4KAZ A;  3D6R A;  3L2Q A;  4B9U A;  5KRS A;  2HHW A;  3KLE A;  2B5J A;  1ILY A;  4OPH A;  2WFB A;  2P9N A;  4EFH A;  3WQT A;  3D45 A;  1YT3 A;  4B1W B;  3A5M C;  4PKH A;  5AQT A;  1S6P A;  5DM7 L;  2O8C A;  2O8E A;  4NB4 A;  1TAU A;  4FLW A;  1YXQ A;  5CZ2 A;  4MDA A;  3ULD A;  4FJ7 A;  1UA0 A;  3UIQ A;  4E1M A;  1HPM A;  3W3D A;  1QZ5 A;  3P4I A;  3T1A A;  3EO3 A;  2QWM A;  4HHT A;  4L8R B;  1QZ6 A;  2GWJ A;  4H5W A;  4LY7 A;  1ZBL A;  4KB1 A;  1QE1 A;  3OHR A;  4JKA A;  1NLV A;  1IKV A;  4LSN A;  4B9T A;  4E7I A;  4KRE A;  4GVM A;  3T3F A;  3CJC A;  2DTU A;  4TSX A;  3QLH A;  4BE0 A;  1TUY A;  3CPE A;  4KHU A;  4FO0 A;  5I3U A;  3OJS A;  3OYK A;  2DFH A;  2QXL A;  1QSY A;  1IH7 A;  4M3R A;  1W2B M;  4CJQ A;  3P31 A;  3PX0 A;  4FWM A;  1BA1 A;  4N76 A;  4K25 A;  3PY8 A;  4C8N A;  3V1R A;  4DTP A;  3IUC A;  1MDU B;  3F5T A;  4MQ3 A;  4FWR A;  4GW6 A;  2PY5 A;  3KWG A;  3I0S A;  1T3V A;  3G6E N;  1JLG A;  4HTL A;  2LSN A;  4QS8 A;  4DF4 A;  1HYS A;  4OGE A;  2YNI A;  4IBN A;  4M41 A;  3THV A;  4DV6 K;  4C23 A;  5E26 A;  1JLF A;  3WXJ A;  1YI2 N;  4DSK A;  4FYD A;  5JVG L;  4FLX A;  4KPY A;  5AQL A;  2O8B A;  4LC9 B;  1C1B A;  1NG9 A;  3JSM A;  5AZI B;  1G15 A;  2YX6 A;  2PAV A;  3TU5 A;  4DS4 A;  4IFY A;  4M7X A;  1Q9X A;  3MCA B;  4H0T B;  4BRE A;  3J7Z O;  2KFN A;  4FL9 A;  3H46 O;  4ISG A;  3HO1 A;  4YDU A;  2KLA A;  4DLG A;  3MAQ A;  3RRH A;  3QBW A;  3PIO L;  1N36 K;  3LDN A;  2HMI A;  4LSL A;  3JS6 A;  2B4J A;  3THW A;  1NOZ A;  3BF1 A;  3J8A A;  1BQM A;  4FJX A;  2G8I A;  4JS4 A;  3HI0 A;  3WEE A;  1RIL A;  5B8H A;  4DR1 K;  5KPT A;  1R59 O;  1YTA A;  3I8D A;  2RF2 A;  3OBW A;  2P5O A;  1XC9 A;  3K9K A;  1O13 A;  1VAZ A;  4IOA L;  1TK0 A;  4JLH A;  4J2D A;  3LDS A;  4DV4 K;  4YY3 K;  1NJX A;  3CCM N;  4F8R A;  1N6Q A;  4Z4G A;  1S72 N;  3ISN C;  2YHA A;  3CCL N;  1BG3 A;  3CJ1 A;  3G0Z A;  2ZJP L;  1VSM A;  4X65 K;  3OYE A;  3N4Q A;  5CR4 A;  4G1Q A;  3I0R A;  3K9J A;  3MN7 A;  1RDC A;  5CYQ A;  3ZT0 A;  4CEF A;  4YOW A;  3A5N C;  4WQ4 A;  5EXW A;  2HF3 A;  3UB5 A;  3NMU A;  3BEX A;  4I6M B;  3BGR A;  2CH6 A;  4CE9 A;  3ZSX A;  1DTQ A;  2IIR A;  2JWL A;  3IKM A;  3KIO A;  4H5R A;  3M8P A;  1NKB A;  1HNZ K;  3SUO A;  4FJL A;  1K9M O;  4GV9 A;  1IKW A;  4KH4 A;  1QQN A;  1VSK A;  2EWS A;  5SWM A;  3O3F A;  2HBK A;  3HM9 A;  2NLX A;  3DXK B;  2QTD A;  2UUA K;  5FPE A;  4EZ9 A;  3FE1 A;  5KPZ A;  3HM8 A;  1RTI A;  3NF6 A;  1W0H A;  1HKG A;  3MN5 A;  3MED A;  3O08 A;  1NKC A;  1NGE A;  3R8E A;  1NJW A;  3IG1 A;  4BC3 A;  3CFO A;  1VSJ A;  2CGJ A;  3ZX0 A;  5C2F A;  2E2N A;  2FBT A;  2JLE A;  3EEQ A;  4Z94 A;  3WXI A;  1QSL A;  4FJ8 A;  3QER A;  4OLA A;  3A2F A;  4DU1 A;  1Z25 A;  3LP1 A;  1BU6 O;  4E7J A;  3BDP A;  4B9M A;  4BR0 A;  5JLH A;  1S6Q A;  4O0J A;  1XMO K;  3J81 O;  1HQU A;  4PL8 A;  1LWE A;  3AO5 A;  4A2B A;  4BRL A;  1K8K B;  3VQ7 A;  4WE1 A;  2IVO A;  4XIU A;  3AGR A;  4IO8 A;  3G25 A;  4AHS A;  3A0I X;  3C7N A;  1JLE A;  3QEV A;  4ICL A;  1SL1 A;  3VEX A;  2NUB A;  3LAK A;  4AHR A;  3FGU A;  3RSE A;  4WYB A;  1EQY A;  4FM0 A;  2G8F A;  3KZB A;  1WOQ A;  4JKD A;  4JS5 A;  2UXC K;  3PO4 A;  3VF6 A;  4IFE A;  2WOM A;  4DTM A;  2P9S A;  4Z4I A;  4JI2 K;  3BZC A;  3ZSV A;  3AA3 A;  4QS9 A;  1T6D A;  1B9D A;  2OAN A;  4FVM A;  1JL1 A;  4CJF A;  1WUA A;  4CJS A;  3VPZ A;  3H1Q A;  5JS1 A;  4KTZ A;  5KGX A;  3PLA A;  4E7H A;  1V4S A;  1VHX A;  4MLH A;  4J2B A;  3IAY A;  3TAQ A;  3AAR A;  1YIT N;  1NOY A;  4M3X A;  3NFA A;  3H3N O;  4IWV A;  3HP6 A;  3VQ4 A;  4DQQ A;  3C6H A;  4JKG A;  4CZJ A;  4B08 A;  3SAF A;  5HRO A;  4KH6 A;  3DRP A;  4IOC L;  3D2F A;  3KLH A;  4B3S K;  1D9D A;  4KTQ A;  4ZHR A;  2Q36 A;  1NK8 A;  5TKY A;  1HLU A;  3UKU B;  3ZEU B;  3S9H A;  3V4I A;  1C0F A;  1RT6 A;  3VEV A;  2E4L A;  4MFB A;  1JJ2 M;  3S3O A;  4LH4 A;  2ZWH A;  3ZSO A;  4BR5 A;  1HKB A;  1RT7 A;  1RCH A;  3V9Z A;  2P9N B;  3E9P A;  1KCF A;  3DJC A;  1YAG A;  2O8C B;  1KQS M;  1SKS A;  5IT9 O;  2O8E B;  4DV2 K;  4HCC A;  4KI4 A;  3V9X A;  3QDK A;  4RTF D;  1EX4 A;  5M1K A;  4JRQ A;  5HRR A;  4NYN A;  4LF6 K;  4E0D A;  5FLX O;  4JK8 A;  2IVP A;  4ZTF A;  2GEM A;  2Q97 A;  2G8W A;  5C10 A;  4CGH A;  1RT1 A;  4JHD A;  1FK9 A;  3CFR A;  3CM5 A;  2DPN A;  4RW8 A;  1JXB A;  5GAD P;  2IVN A;  4FM2 A;  2RE2 A;  1TVR A;  2YCH A;  1XNR K;  3I33 A;  4GKK K;  3SMP A;  3BUZ B;  5AQH A;  1RT2 A;  3A5L C;  4CZL A;  1BGX T;  4FWL A;  3SZ2 A;  4OGC A;  1NJI O;  5LJW A;  4BRA A;  4H0V B;  5C0Y A;  4DV0 K;  3QBX A;  3WXM B;  3CM6 A;  5AQR A;  2X6N A;  1HNV A;  1RBT A;  3OS1 A;  4K41 A;  1NGC A;  4J2A A;  1DLO A;  3FZL A;  2GWK A;  1BUP A;  4NYF A;  3DRS A;  3NDK A;  4DQI A;  1YTU A;  4LH5 A;  1RDD A;  4BRP A;  2QW9 A;  4DTS A;  3WNH A;  3U4L A;  3CQX A;  3CJ7 A;  3CFP A;  2ASO A;  4HWI A;  2GV9 A;  4CJV A;  5M1O A;  2FLO A;  4CGG A;  4IXC A;  3AA5 X;  4FLZ A;  3TAB A;  1BDG A;  4N41 A;  1ASV A;  2ZD1 A;  3O9U A;  1WSJ A;  3OS0 A;  3TAN A;  1KRP A;  1JCE A;  3LP2 A;  3MK6 A;  3EE8 A;  4M3T A;  3SJJ A;  2BH1 A;  2OPP A;  3QIN A;  2HHV A;  3MXJ A;  4CJU A;  4C8K A;  3DAW A;  4CCH A;  3L6Q A;  3LWL A;  1I39 A;  3WNG A;  3AVF A;  1SKR A;  2IGI A;  1QVG M;  1KD1 O;  4OVL A;  1NK6 A;  3EYZ A;  3TAM A;  1HPZ A;  3C0B A;  3OVN A;  4A59 A;  2O8B B;  2RN2 A;  1ZXO A;  1SL2 A;  3KKR A;  4EP4 A;  2ITM A;  4IFV A;  2A3Z A;  3R3L A;  2QKB A;  1RBV A;  5M1F A;  4DR4 K;  4H0Y B;  5LL6 Z;  4BRO A;  3OS2 A;  1QQC A;  1SS6 A;  1X9J A;  2HHX A;  4W5Q A;  1BCM A;  2YJE A;  3WXL A;  5I9E B;  3HRG A;  2ASP A;  2UXB K;  4CJL A;  1K73 O;  5JMV A;  1E4G T;  3LM9 A;  3L2V A;  4CD1 A;  4HTU A;  2VYP A;  3THW B;  3A5O C;  4DB3 A;  4FJI A;  3PX6 A;  3WEE B;  1G99 A;  1BO5 O;  2YNH A;  1ZC6 A;  2Q0R A;  3O1B A;  5C42 A;  1KFS A;  4NCA A;  2E88 A;  3VN5 A;  4JKF A;  4MDB A;  3CC4 N;  2HND A;  2FBV A;  4EAH D;  4I9L A;  3MMV A;  4F9O A;  2PYJ A;  2D5R A;  4DQR A;  1NK4 A;  3THY A;  3SCX A;  5BRE A;  2BE2 A;  1SQK A;  3L3U A;  1ASW A;  4M7Y A;  1BIS A;  3FZH A;  2DFF A;  2A42 A;  4JI4 K;  4JI8 K;  3S3M A;  3R6M A;  5AQM A;  2OPR A;  4JD2 A;  4FJG A;  3AVB A;  3HTV A;  2FBY A;  4RW4 A;  4KHQ A;  2NRX A;  2XY6 A;  1BCO A;  2HST A;  5AQS A;  4BG8 A;  1YIJ N;  3O9S A;  3SBG A;  5SZT A;  2P9P A;  1WSH A;  3IRX A;  3MEG A;  1YJN N;  3SJH A;  4DWI A;  4CF0 A;  3VGM A;  1TK8 A;  1N5Y A;  4BRI A;  5EU7 A;  5M1P A;  3OYF A;  1GLF O;  3KHY A;  4CIF A;  3PUF A;  1LAW A;  4OX9 K;  2O8D A;  4GVE A;  1NKE A;  3LDP A;  2UU9 K;  4OKK A;  4FJJ A;  4RG8 A;  4KKO A;  2AA4 A;  5KGW A;  4Q0B A;  4YOY A;  3LDO A;  2OZS A;  5AQI A;  3M3Z A;  1FKP A;  3HPO A;  1TKX A;  4C8L A;  5BRH A;  2KQ2 A;  5F0X A;  5KQ8 A;  2IC3 A;  4AM7 A;  2NRV A;  4IDK A;  4B8C A;  3TR8 A;  3LZI A;  3MX5 A;  3ATV A;  3RWU A;  4O8K A;  2HVH A;  4HUG A;  1BL3 A;  3KK2 A;  3SV4 A;  1Q81 O;  4ILJ A;  5GIO A;  3ZYY X;  5DM6 L;  4KV8 A;  3BP8 A;  1WSG A;  4MO4 A;  3KLG A;  4FJ5 A;  4BE1 A;  2P5G A;  1GLL O;  1JLB A;  3L3V A;  4CFB A;  3QEP A;  3ZET A;  4IDH A;  4CGF A;  1S5J A;  2E5L K;  4B1Z A;  4CBU A;  4ISF A;  4EHU A;  3ID8 A;  1HR0 K;  1Q82 O;  4RW6 A;  3O3G A;  2F9T A;  3KJV A;  5AQU A;  1CZB A;  4FW2 A;  5C2D A;  1W97 L;  1C0M A;  1GLB G;  4Y1C A;  3DLH A;  1FKO A;  2Y1J A;  4UY8 O;  4JNE A;  4Z4C A;  1HYV A;  4K8X A;  3C7N B;  3SQ2 A;  3T1Y K;  1I94 K;  3RSE B;  2XRI A;  4CZE A;  4YOR A;  5FRM A;  2UXD K;  1LWF A;  4AHU A;  4JI1 K;  5AQK A;  3TTC A;  3DI6 A;  2CGK A;  1NGF A;  2P9S B;  3NH2 A;  3LWM A;  3DLB A;  3HP9 A;  4LF5 K;  5EX5 A;  1BOT O;  1IG9 A;  4B3T K;  5EY4 A;  1ZBF A;  3L2W A;  5TKW A;  4OJR A;  3TWH A;  1IBM K;  3G71 N;  3T19 A;  4WQ5 C;  1J9A A;  3U8X A;  5JVH L;  2IOC A;  2NRZ A;  1HQE A;  1Z05 A;  2OTL N;  4DTJ A;  1KSP A;  3V9S A;  4DV7 K;  3AA2 A;  4JKG B;  4PL7 A;  4AH9 A;  1X9M A;  2A5X A;  3K0S A;  3D2F B;  3QFU A;  4QOZ B;  3KD5 E;  3ZCM A;  4CHZ A;  4A57 A;  3LAL A;  3HBT A;  1Z6R A;  1V4T A;  1TYQ A;  2P1J A;  3EZ5 A;  1GLE G;  3SUN A;  1L3S A;  2F8T A;  2FC0 A;  5JIC A;  2WUS A;  4RW9 A;  5F1X A;  1ATS A;  1EXQ A;  3O9Q A;  2AJQ A;  2VWK A;  3QNO A;  1TL1 A;  4E7L A;  5KQD A;  4CEC A;  1HRH A;  2OPS A;  3VEZ A;  1N32 K;  1RBS A;  4EIA A;  4KH5 A;  3SMS A;  3U3Y A;  5IWA K;  1ZYQ A;  3VA0 A;  3K59 A;  1IG8 A;  4PHT X;  4LF8 K;  1EO1 A;  4EHT A;  3O4Q A;  1QHT A;  2X74 A;  4U67 L;  1YHQ N;  2QWQ A;  4DQP A;  3ZT2 A;  1F21 A;  2VG7 A;  4XH4 A;  3PSF A;  4NLC A;  1LW2 A;  4DQS A;  3E66 A;  3G4S N;  1S9E A;  4DV1 K;  4ILG B;  1KTQ A;  4JHD B;  3O5B A;  4IO9 L;  2QEX N;  2VG5 A;  3FLC O;  4DKW A;  1RTD A;  4DR6 K;  2QI2 A;  3CJ9 A;  5CE3 A;  5BPN A;  1J5O A;  1B92 A;  4V19 S;  3ZSQ A;  4CJT A;  1IBK K;  5F2R A;  5CYM A;  1VSL A;  4CJP A;  4O8U A;  1U2V B;  5CZ1 A;  2UUB K;  2G8U A;  2G8K A;  1ATR A;  2I7N A;  3CD6 N;  3GBT A;  1X9S A;  1U45 A;  1YUW A;  2W41 A;  2HBJ A;  4JKE A;  1IBL K;  2CGL A;  4CF2 A;  3DXM A;  3KVG A;  3WNE A;  4BRG A;  1HJR A;  3Q7B A;  2XY8 A;  3KWI A;  3ZLJ A;  1T03 A;  3KTQ A;  2XHB A;  4IOX A;  4DSI A;  5AFU H;  3RMD A;  4DHY A;  4FPB A;  3V1Q A;  3DLE A;  3OW2 M;  3THX A;  5AR0 A;  2ZJQ L;  3OYG A;  1EWQ A;  1B9F A;  4DTN A;  3VEO A;  2E8A A;  3V9U A;  2FF3 B;  1OVY A;  3ZSW A;  4JI3 K;  2UYT A;  3CJA A;  4H4M A;  4YOV A;  1UAX A;  4QS7 A;  4E19 A;  3OBY A;  4NCB A;  1U04 A;  1EET A;  2F8S A;  2E1Z A;  4B3R K;  3VEY A;  1OVQ A;  4R5P A;  4DTR A;  3AVK A;  3AVA A;  2PFU A;  3LP0 A;  4CJK A;  4DQ8 A;  4DSF A;  3H3O B;  1T05 A;  4FLY A;  4CHP A;  3D0P A;  3HOT A;  3OY9 A;  3CIP A;  1X9W A;  3VF4 A;  2VQE K;  4DMN A;  4BAC A;  4B8A B;  3P1G A;  1HKC A;  4WCE L;  3E9L A;  3A8Y A;  3OYD A;  1JKH A;  4BVO A;  4A61 A;  1BIZ A;  2HHH K;  1LOT B;  2Q2R A;  2QWL A;  4QAG A;  4I9Q A;  3SV3 A;  1SL0 A;  3CF5 L;  4AQY K;  5AQJ A;  5LMU K;  2W40 A;  3R9P A;  3ZT3 A;  4E7K A;  5J2P A;  1VQ9 N;  4DFJ A;  2HOE A;  1VQ6 N;  3ZX3 A;  4CED A;  4C1N I;  4C8M A;  3THY B;  4MLE A;  4OLB A;  4YNQ A;  3DOL A;  1OH5 A;  3CJB A;  1C0T A;  1NK7 A;  4HUF A;  3RMB A;  3HK2 A;  4DV3 K;  4JD2 B;  4CZH A;  3HT3 A;  3HYF A;  1TL3 A;  5AQF A;  2GTD A;  1IV0 A;  1C1C A;  3RVC A;  1VQ7 N;  5T7B A;  3MWP A;  3SNN A;  1W7A A;  3NH0 A;  3ZX2 A;  3NBP A;  3F2K A;  2P9P B;  2F9W A;  1OH6 A;  4B9S A;  3RMC A;  3OA9 A;  1S1T A;  1NGG A;  3LPU A;  4Y1D A;  1Q7Y O;  3PX4 A;  4BY9 C;  4PUO A;  4BWJ A;  3RRG A;  1BQN A;  1KAX A;  3FZM A;  1GLC G;  2QWN A;  2P9I A;  4JV5 K;  2O8D B;  2VQF K;  3SQ0 A;  2A41 A;  4A62 A;  1ATN A;  4BWM A;  3EN9 A;  4M3U A;  3EL2 A;  1L5U A;  3KD1 E;  3C94 A;  3MCP A;  2QWO A;  1TKZ A;  4LD0 A;  2FSJ A;  1KLM A;  3KK1 A;  4I2Q A;  4CEA A;  4H03 B;  3MX2 A;  2FBX A;  4CEO A;  4PKI A;  4CHO A;  3AVL A;  3ALY A;  3AO2 A;  4CFD A;  4CGI A;  4DTU A;  1Q9Y A;  2HHU A;  4AM6 A;  3VQ8 A;  4B3O A;  3J7Y P;  5HRS A;  2D1K A;  4JKH A;  2D0O A;  4CJ3 A;  3U9Z A;  2A40 A;  4NCG A;  1XMQ K;  1QVF M;  3T69 A;  2RPI A;  1VQK N;  1XNQ K;  3R1X A;  5AQG A;  4BDP A;  4IG0 A;  4GY2 B;  4KRF A;  4KHW A;  2Q0U A;  3B8A X;  4E1N A;  3VQ5 A;  2BUP A;  3CMA N;  4KHY A;  2GEL A;  4B1Y B;  5J2N A;  3ZET B;  4PKG A;  2HNY A;  1NGA A;  3K57 A;  3NAE A;  5ADX A;  1ITG A;  2ITG A;  4CVN E;  4FWN A;  2HHT A;  5HRN A;  4CIG A;  3TAR A;  4BRH A;  3B6P A;  1J54 A;  3VF2 A;  3K5M A;  3QFP A;  5HP1 A;  4FK4 A;  5FRN A;  2H3G X;  5MLC Q;  1NNE A;  2V7Y A;  4OKE A;  4DSE A;  1P8Z A;  1LV5 A;  3BY5 A;  1UA1 A;  2OTJ N;  5J1E A;  4CES A;  1HNI A;  3M6G A;  2WTU A;  4B1U B;  4BRK A;  5FPN A;  1S22 A;  1RT5 A;  5CY4 A;  1D4X A;  3WUH A;  1U2V A;  2BTF A;  1I3A A;  5BRF A;  4XEI A;  1WAF A;  1CXU A;  4H5V A;  3WXK A;  1QQO A;  4JN4 A;  3CCQ N;  3AAP A;  4GV6 A;  4DCH A;  2XO7 A;  2AP1 A;  4W5O A;  4KHN A;  4DR7 K;  3CET A;  2CH5 A;  3WNF A;  4KBO A;  3CCV N;  2YNG A;  3ASM A;  5H1S Q;  1KVB A;  3DM2 A;  2KKZ A;  2QXF A;  5GIP A;  2OCE A;  3KK3 A;  2DY4 A;  1CZ9 A;  1RTH A;  1TYQ B;  4CI6 A;  4B9V A;  4DS5 A;  4BGA A;  1NJY A;  3MEE A;  4RW7 A;  4ILH A;  3KLI A;  1CLQ A;  1R0A A;  4JI5 K;  1OKJ A;  3M8S A;  5GAE P;  4JYA K;  2Z1H A;  3VQP A;  4WQ5 A;  3CG7 A;  1T44 A;  5AQX A;  2FSK A;  4QCL A;  5KI6 A;  3WT0 A;  5AZJ A;  3JXU A;  4YFU A;  5AQO A;  3VGL A;  3F9M A;  1XI1 A;  1WBD A;  1QS4 A;  4CEE A;  3QES A;  3HVT A;  4E1J A;  1VQ4 N;  3PV8 A;  4KI6 A;  2O8F A;  4WFN L;  4CJ5 A;  4CBX A;  2RKI A;  5CHI A;  1OH7 A;  5HL7 L;  3TAE A;  4NXM K;  3K58 A;  3OYN A;  4G9Z A;  5BR9 A;  2IS3 A;  1T6C A;  3BF3 A;  3HPG A;  2HBM A;  2OYQ A;  4BR4 A;  4CJ4 A;  3GDQ A;  2YHX A;  3VET A;  1YJ9 N;  1NMN A;  3AO3 A;  3C95 A;  3LM2 A;  1RTJ A;  1W9H A;  3VGK A;  1NJZ A;  5AQV A;  4GV3 A;  4CER A;  4JI6 K;  1WAJ A;  2P9U A;  2YV0 X;  5E84 A;  5J2Q A;  5FDL A;  4ID1 A;  3AY9 A;  1X3M A;  3F9K A;  3SLC A;  3L2R A;  3CC2 N;  1FJG K;  1ESV A;  4JRP A;  1KAZ A;  1DTT A;  3DXM B;  3CYM A;  5C24 A;  2I5J A;  4LFB K;  2W42 A;  4Q5V A;  1NGI A;  2IDO A;  4KFB A;  1QSS A;  1U6Z A;  3VTI A;  3GG4 A;  1QQM A;  5HLF A;  4FWQ A;  4FM1 A;  3CQ8 A;  3OYC A;  1VSH A;  4GNI A;  3DMJ A;  3N4P A;  5D3G A;  4IG3 A;  2ETJ A;  3THX B;  3LDQ A;  4FSV A;  2VGM A;  1T8E A;  3QIP A;  3HXM A;  2IAJ A;  3QET A;  1YF5 L;  1L3T A;  3U6F A;  4CHY A;  2HMP A;  3TSU A;  3LAM A;  3TSQ A;  5BRD A;  2YI1 A;  3NGY A;  1HYZ A;  3V1O A;  4AIL C;  3NE6 A;  3VQQ A;  3DLL L;  3M8R A;  3AVC A;  4CFC A;  4KTW A;  1LCU A;  3VQ6 A;  1JCG A;  4HCB A;  2HBL A;  3S3N A;  1VSI A;  4YOT A;  3NVK A;  3NGI A;  2W6L A;  1IKY A;  3AVH A;  3O80 A;  4IEE A;  3OYI A;  5AFU A;  4FW1 A;  4LFC K;  1S1X A;  1NK0 A;  3EKS A;  1K6Y A;  2E6M A;  4FLU A;  5I42 A;  1NK9 A;  4JK7 A;  4BDZ A;  3QEI A;  3DLR A;  4FWP A;  3MEC A;  4PY5 A;  2NRW A;  2B6A A;  4CJW A;  3SYZ A;  1E4F T;  4JKB A;  4FJM A;  3QEX A;  2YHB A;  3ZT1 A;  4N56 A;  2P9K A;  1NM1 A;  5M1N A;  3IDH A;  1O1W A;  2VWJ A;  3ZSZ A;  5LJV A;  3NVM A;  1RDW X;  1DGK N;  4BGB A;  3HPH A;  3NHG A;  3CC7 N;  2KFZ A;  5ELZ A;  3TTF A;  3U9D A;  3C6A A;  3MN9 A;  3L0Q A;  2G8V A;  1J53 A;  4ELV A;  4F2S A;  1WSI A;  3SQ4 A;  2HVI A;  4KO0 A;  3D2E B;  5BPM A;  4F4K A;  1RBR A;  5KTQ A;  4B9N A;  3J7A P;  4GMJ B;  5FPM A;  3CI5 A;  4JK9 A;  3HL8 A;  3VEN A;  3E1Y A;  2Z1J A;  1XC3 A;  3GE1 A;  3TTD A;  4BR7 A;  5C15 A;  3M8Q A;  4EZ6 A;  1VQM N;  5K14 A;  3CPW M;  1UOC A;  3TAG A;  4W5T A;  4FJ9 A;  2P9I B;  3VQB A;  1BWF O;  4H5N A;  3HOS A;  3AVG A; 
#chains in the Genus database with same CATH homology
 4X64 K;  4DR5 K;  2UUA K;  4LF4 K;  4B3R K;  4JI0 K;  2F4V K;  4JI5 K;  4LF7 K;  4DR4 K;  5LL6 Z;  4K0K K;  4NXN K;  3JAM O;  4JYA K;  1N32 K;  3J7Y P;  1N36 K;  2UXB K;  5IT9 O;  1XMQ K;  4DV2 K;  5IWA K;  2VQE K;  4LFC K;  4LF8 K;  1XNQ K;  1HNX K;  4LF6 K;  5FLX O;  4DR1 K;  2HHH K;  1XMO K;  3J80 O;  4GKJ K;  3J81 O;  2E5L K;  4JI7 K;  4AQY K;  5LMU K;  4DV1 K;  1HR0 K;  1XNR K;  4GKK K;  4DR6 K;  4NXM K;  4DV4 K;  4YY3 K;  4CVN E;  4V19 S;  1N34 K;  4CW7 B;  1IBK K;  4B3M K;  4DV0 K;  5A2Q O;  4DV5 K;  3T1Y K;  1I94 K;  2UXC K;  4JI4 K;  4X62 K;  2UXD K;  4JI8 K;  4X65 K;  2UUB K;  4LF9 K;  4JI6 K;  1HNW K;  4JI1 K;  4JI2 K;  4DV3 K;  4LF5 K;  2UUC K;  4DUY K;  1IBL K;  4LFA K;  4B3T K;  1FJG K;  3T1H K;  3OTO K;  1IBM K;  4LFB K;  5BR8 K;  4DUZ K;  1N33 K;  3J7A P;  2ZM6 K;  4YHH K;  5AJ3 K;  5LMN K;  4DV7 K;  4B3S K;  4DR2 K;  4OX9 K;  1HNZ K;  2UU9 K;  4DR7 K;  4JV5 K;  2VQF K;  4DR3 K;  1J5E K;  4JI3 K;  4KHP K;  4X66 K;  4DV6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...