4JI3K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji3K00
4JI5K 2UXBK 4CW7B 5LMUK 4DUZK 5IWAK 5FLXO 1IBLK 1XNRK 4JI4K 4LF8K 4NXMK 1N36K 5AJ3K 2UUAK 4JI8K 4JI1K 4LFCK 1IBMK 1HR0K 3J7YP 4V19S 1FJGK 2VQEK 4X64K 4LF9K 1HNXK 4LF5K 2HHHK 3T1HK 4DV3K 4DR5K 5LL6Z 4JI7K 4JI0K 1HNZK 4DUYK 5IT9O 4DR1K 4DR7K 4KHPK 4YHHK 4LF6K 2ZM6K 5A2QO 1XMQK 5BR8K 4DR3K 4B3MK 3JAMO 4DR4K 2UUCK 4AQYK 4DR6K 4GKJK 4X65K 5LMNK 2UXDK 1N32K 1XNQK 3T1YK 4X66K 1XMOK 4K0KK 3J7AP 4X62K 4DV0K 4OX9K 4GKKK 4DV2K 4DV6K 4B3SK 1J5EK 4LFBK 4LF7K 4DR2K 4CVNE 4JI6K 4LF4K 1I94K 2UU9K 2UXCK 3J80O 4DV5K 4DV4K 2E5LK 4DV1K 4JYAK 4B3RK 1IBKK 1HNWK 4B3TK 2F4VK 4LFAK 1N33K 2UUBK 4JI3K 4JI2K 4NXNK 1N34K 4YY3K 3OTOK 3J81O 4JV5K 4DV7K 2VQFK
chains in the Genus database with same CATH superfamily
3CJBA 3LP0A 2HF4A 5BN9A 1J54A 4DQSA 2HBMA 3P38A 3K59A 1K6YA 3MN6A 1BU6O 3WEEB 2P9UA 4N76A 2VCPA 1ZXOA 4WFBL 2OZMA 3BF1A 5AZJA 4BDZA 4O0IA 1N36K 3O9SA 3PY8A 4E0DA 1YJ9N 4R5PA 4DQQA 1WSGA 3QEVA 3ID8A 2NNWA 3AVHA 4CJ7A 2DFEA 4PWDA 1RCHA 1GLFO 4X64K 4IO8A 3CFPA 4RW4A 4CZIA 3AAQA 2QM1A 1S1VA 3DAWA 1BIZA 3T1HK 2GX9A 4CERA 4HTUA 2ITGA 2P9KA 3OBWA 3CXCM 3H3NO 5AQMA 5IT9O 1T3VA 3ZT2A 1LAVA 4DSKA 2NZTA 1ATSA 2QKKA 1G15A 3ALYA 4BRMA 1U4BA 4DSIA 3EKSA 4DB3A 5EX5A 3MCAB 2IVNA 3SV4A 3T3FA 3T1YK 1ILYA 4JKHA 3DLEA 5C2FA 1QSLA 4CF2A 3IDHA 2VG6A 1FKOA 1U45A 4FWMA 3A5OC 3O9UA 2E88A 5JS2A 3KK2A 3SUPA 3UKRA 4CFAA 4H4OA 1EQYA 2PYJA 5BPMA 3DM2A 1JXEA 1I3AA 1S9EA 4PKGA 3TI0A 3ZT1A 3KWIA 3D0PA 3CPEA 2QXLA 3CC4N 3PX6A 4B3RK 1IKYA 3IMXA 4IG0A 2P51A 3VERA 3K5NA 3RRGA 1SUQA 4FJXA 3DLHA 2QK9A 5ADXH 1NGFA 1VSMA 2OTLN 4FLVA 4M3RA 4DMNA 3C65A 2IC3A 1RNHA 1RTDA 1C0FA 3N4PA 3NGZA 4FZYA 5HBMA 4WFAL 1RBUA 1ATNA 4CHNA 3AA4A 4GW6A 2I5JA 1XNRK 5ELZA 1GLEG 2X6NA 4AHSA 4FJ7A 4ISFA 3THWB 1HYZA 1JLCA 3MN9A 3VQ8A 1LWFA 2GEMA 5FPEA 4FJ9A 5BRFA 2Z1GA 3WEEA 3CD6N 1VRUA 5M1KA 1OH8A 2NRVA 2KW4A 1S22A 2G8IA 4E7IA 5C24A 1SQKA 3HVTA 4K25A 4JKGB 1HQEA 4ISGA 2O8FB 2Q0RA 4DR1K 4CZMA 4DTMA 5HRNA 2HHTA 1SAZA 3WXIA 4TSXA 4AQYK 1T44A 4AHVA 3FFKB 3FFIA 3ZT0A 3OYMA 3KWGA 4EP5A 3AVCA 2P9LB 3KHYA 1NK9A 4OGCA 3MEDA 4IKFA 3HTVA 3WXJA 1W7AA 4PKIA 4WQ4C 1S1TA 3MX5A 1QE1A 1TK8A 2F8SA 4DKWA 4OLBA 1VQ9N 1GOCA 4QAGA 3ULDA 2W41A 3K5LA 3GDQA 3LDQA 2UXCK 4C8NA 3D7EO 3V9WA 2ZGZA 4F3OA 2X78A 3OYAA 1C1BA 3P83D 2FSKA 2F4VK 4ILGB 3QDKA 2R7YA 4JAXA 1RILA 1BDGA 4MLEA 3RVCA 1RDUA 1FW6A 1ATRA 3KLIA 1IO2A 4GNIA 1GLBG 1NBWA 3TPQA 3AV9A 4O5BA 4B9VA 4C1NI 3NCIA 3KKSA 1S1UA 1IBLK 3DLGA 4B1XB 3HP9A 4JKFA 1UWBA 1Z05A 5AJ3K 3AGRA 1HKCA 1QQNA 3J7YP 3G6EN 4MDAA 3LWMA 1KXPA 5BN8A 3I56N 1Q86O 3RSEB 4CD3A 1JLFA 1SZ2A 2YNIA 4JKEA 3AO3A 4Z4EA 3L8BA 3AO5A 5LL6Z 4GV6A 3RMCA 1FXXA 3WQUA 1SL0A 2G8FA 3LP3A 1BWFO 5HP1A 5AQXA 3THWA 4BDYA 2CGLA 4JKBA 4FWLA 1NJIO 3OYHA 1XMQK 4CIFA 2Z1JA 2QWPA 3QBXA 4CJEA 1BUPA 2E6MA 1E4FT 3OYKA 1BIUA 2UXDK 4JS4A 2JWKA 4BRCA 4FCYA 4FVUA 1ZBLA 4MFBA 3EE9A 2IAJA 4X66K 1TKZA 1Q82O 5AZIB 3HM9A 3CC7N 3IRXA 3ITHA 4IOXA 1SKRA 3VQ4A 4BG9A 3TWHA 2Y1IA 5JS1A 2KQ2A 3MXJA 1ASWA 1KFDA 2J4RA 5JLHA 1DGKN 4JKGA 2O8FA 3EZWA 5CYQA 3THYA 3DLRA 4LH4A 2CH5A 4M3YA 4CZJA 1QZ6A 2XHBA 3VQAA 3OYCA 2O8EB 2WONA 4B1YB 1V4TA 4K42A 3HK2A 2NRHA 1K73O 2P9LA 3MAQA 4CBWA 4AM7A 1NJXA 3NBPA 3FZHA 4B3TK 2BANA 1XQSC 3HPGA 1QQCA 4CHZA 5KQ8A 3ZETB 3O3HA 3AA3A 2CH6A 1GLCG 4NCAA 4DHYA 5KPRA 4CBXA 4IZ9A 3AO4A 4LC9B 1D9FA 1T05A 1H1VA 1K8KB 2FF3B 2ZF5O 2W42A 3U6FA 3ZX2A 1GLJO 3NVMA 1IBMK 1NK4A 4JKDA 4FXDA 3NAEA 2Q2RA 3VEWA 5M1QA 1Z26A 4YOXA 1L3SA 5BRHA 3OYIA 2E2PA 3EEQA 3CMAN 1DLOA 1OVQA 2GV9A 4CI6A 4DWIA 4LF9K 4B9QA 3G10A 3LP2A 1C0TA 4B9TA 2VYPA 1NNEA 3CJCA 3K9JA 1QVGM 1TVRA 5AFUH 4BE0A 3FZFA 4Z4GA 4A2AA 4KHPK 1QHAA 3SUNA 3RSEA 5A2QO 4DR3K 4KV8A 1YTUA 2E1YA 4XH1A 2RPIA 1O1WA 1VQ8N 1S3XA 3WNGA 4G1QA 4H4MA 4Z0UA 1W0HA 1IKXA 1VQKN 1TAUA 1HUXA 2YHYA 4KHYA 3CCLN 4FLZA 1XHXA 2FSNA 3F5TA 4BVPA 3O4QA 2QA4N 2PY5A 5FRMA 3CCMN 2D0CA 2ZJRL 3KLEA 3HZ6A 1RTJA 3DLKA 4JI6K 3I55N 1NK6A 1C1AA 1RFQA 3U9ZA 1B9DA 1YXQA 1CZ9A 5AZIA 5KQDA 4DV5K 5F2RA 3SJJA 3M1FA 2BTFA 5KI6A 3MECA 4E19A 3DYAA 3AGKA 3NGYA 4ZTFA 4IDKA 4F3TA 4FJ8A 3BZCA 2YNFA 4EZ6A 2WBNA 3A0IX 4CF0A 5LY3A 2OCEA 4RW6A 3M8SA 4FPAA 5FDLA 2HBJA 2O8EA 3ZYYX 3MWPA 2RE2A 4DTSA 1N6QA 2D4WA 3G0ZA 4DS5A 2GBZA 1NK0A 2HNYA 2OZSA 1T6DA 4H0YB 1QSSA 3CJ7A 4FWPA 5IWAK 1IV0A 3R3LA 2OYQA 4FWNA 1BA1A 1NJYA 3ZSWA 4NXMK 5KTQA 4JI1K 3ZETA 5C25A 5HRSA 1ESVA 2O8CB 3F9MA 5C12A 2E6LA 2DFHA 4CGFA 5B8HA 4KH5A 1FK9A 1IKWA 3LM9A 1HNXK 3O6WA 3HI0A 3VGMA 2IGIA 1K8KA 1C0MA 4DV3K 3S3OA 2V51B 5KGXA 3LAKA 4YOWA 2Q97A 4E7JA 4BR0A 3M8RA 3SMPA 4BRNA 1BI4A 1X9JA 1WUAA 1C0UA 4DUYK 1QVFM 3M6GA 2ZM6K 4ICLA 1XHZA 1TK5A 2RF2A 4W5NA 3LDSA 3C7NB 4FJMA 2XY6A 4LSLA 4DU4A 1VQ4N 3VF4A 3BEXA 4FOIA 2HF3A 4AM6A 2KFNA 1TKXA 4BRQA 4CZKA 1NMDA 2OA8A 4GVEA 4X62K 2D0OA 2O4GA 3HYFA 4W5QA 3O3GA 3CQ8A 2P5GA 4DU1A 4DV6K 2IVPA 2WFBA 2Y1JA 1GOBA 1ZBHA 1J6ZA 3SBGA 4N5SA 4BGBA 1HYVA 3PUFA 3ZT4A 4CZEA 4I2QA 3ZSQA 2UU9K 4KO0A 3SCXA 3LDLA 2ATQA 5GIPA 5LJWA 4YOVA 5EVZA 4JKAA 1VAZA 3OYEA 2A5XA 4FK0A 1R59O 3QMLA 3CCJN 1HNIA 2H3GX 2YJFA 3ZSVA 4PUOA 3LDPA 4CEBA 3SPZA 4Y0WA 2BE2A 3I0SA 3V1RA 2HHSA 4DV7K 3CQYA 1S72N 1RT5A 3AVJA 4E7KA 1LW0A 2NRZA 3LZIA 2UXBK 3HBTA 1IKVA 1LWCA 3R1XA 1RT2A 4LF8K 4Q0BA 4BQLA 1YJWN 3QIPA 4JI8K 3ATUA 1HQUA 1RT4A 4DTJA 2JLEA 1NOYA 3D2EB 4HUFA 2KTQA 4HWIA 2KHOA 4FWQA 1EETA 4CGJA 2IS3A 1FJGK 5KPTA 2A1RA 2YNGA 3L3VA 3KJVA 1BQMA 4BC2A 4BC4A 2HNDA 1VSHA 1LCUA 2B4JA 5KRTA 1NGIA 4KHSA 3SMSA 1WB9A 4F2SA 4DU3A 3QBWA 4DSEA 1VSKA 4GY2B 2O8BA 4CZGA 3CM6A 3SQ4A 1VQ7N 1N32K 5I9EB 3LPTA 3TANA 4OPHA 4OPAA 4NLCA 5JICA 3KTQA 4MDBA 4E89A 1BGXT 2I7NA 2DY4A 4BREA 1WBBA 4XH5A 2W6LA 1D9DA 3RR8A 3SAHA 1BL3A 3WNEA 1HKBA 1KTQA 4M3WA 4YDUA 2VG7A 4KH4A 4BRAA 3VGKA 3FE1A 3QEPA 3C7NA 4F4KA 4DS4A 2OPSA 4B8AB 1YAGA 2FBVA 2NRWA 4WQ5A 4O55A 1M90O 4NCGA 4CEFA 1TAQA 4CEOA 4Y1CA 4FK4A 3OS1A 3HM8A 3THVA 1WSEA 2QEXN 3ID6A 4M45A 3RMAA 3IKMA 5AQRA 3VMFB 4UQGA 1N5YA 2UUBK 2QKBA 1TYQB 3TABA 4JI2K 3CERA 1TGOA 2WTUA 1DT9A 4KFBA 5AQSA 3K9KA 4PL8A 3BZKA 4MO5A 4CK1A 2NLXA 4M3XA 4F2RA 4JI4K 1Z25A 3PO5A 4LFCK 3P39A 2BUPA 4ELTA 1P8ZA 4FZZA 4K8ZA 4CF8A 3RMBA 1EP4A 5DM6L 2EX3A 2HVHA 4JK8A 5AR0A 3SUOA 1BHLA 4HUEA 4DQ8A 1XUPO 4CK3A 3NDKA 3WUHA 1C1CA 2D5RA 3L2UA 4FM0A 2ASOA 4JI7K 5EXWA 3OY9A 2LSNA 2RKIA 1KAZA 2FXUA 1UOCA 4HCBA 3IS9A 1NM1A 3AVNA 4FW1A 5H1SQ 4CCHA 4KPYA 3D2EA 1G99A 2Q31A 4CBUA 4YHHK 5SWMA 5GAHP 1NK8A 4N41A 3VQ9A 4B3MK 4FYDA 1A5WA 2VGNA 3QERA 3TSQA 5BR9A 5LMNK 4AILC 3AVAA 2ZWHA 2E2OA 3DRRA 3AVBA 3ZSYA 5CY4A 2A1SA 1J9AA 3CCEN 4QS9A 3WXMB 2JGUA 4JEPA 1TUYA 1JCEA 1GLLO 1NGHA 3Q7BA 3SAGA 3NFAA 1WBDA 1LV5A 4IOAL 2ZQBA 3VEVA 3PSIA 1NOZA 4LD0A 4J8FA 4FM1A 2Q36A 2DFFA 5AQQA 4KB1A 4ILHA 1RDWX 4LSNA 2HBKA 3B8AX 2P9IB 3J80O 1LOTB 3L2VA 1RTIA 4CJRA 4FZXC 3MK6A 1E3MA 3OYFA 3WNHA 2G8WA 4FJJA 3OYLA 2W6KA 3AO1A 3OYBA 2Q3SA 2PFUA 4DFKA 3C6TA 3V1OA 4EIAA 1QQOA 1Y97A 4NXNK 1YJNN 3AARA 1JXBA 2VG5A 4A5BA 2P1JA 1RBSA 3H46O 3ZSZA 3ZT3A 2KZZA 4OPJA 4WF9L 4I9LA 4A5AA 4JI5K 1S6PA 4RG8A 3OJSA 2WUSA 3GG4A 3ZSXA 4FJIA 1ZBIA 4L3QA 5EY4A 3QLHA 1KVCA 4FLWA 3ZLJA 3SQ1A 2E2NA 2QWRA 3NMUA 3LALA 1W9HA 3VQQA 1TYQA 3U4LA 1TL1A 3ENBA 3TAFA 5C15A 4FJHA 1JLGA 3ULEB 5J2QA 3R8EA 4CK2A 4FJKA 5ADXA 2FSJA 5BPNA 4CJFA 3OVNA 1HJRA 1NGEA 3NHGA 3SLCA 2BDPA 3VTHA 4DTXA 2OANA 1KCFA 5KPZA 4N47A 2YV0X 2ASPA 2YHWA 3CFRA 3V81A 1U2VB 1RT1A 4M3TA 4CEAA 4DR4K 3C0BA 3SZ2A 1L3UA 4QS8A 5FROA 1CZAN 3SBTA 3VQBA 3H08A 4W5OA 4O8UA 2RHKA 3TTDA 1N8RO 4C23A 1VSEA 3V6DA 4A62A 4GKKK 4DV2K 2ASMA 4PHTX 1IG8A 1K8AO 4FJLA 4WFNL 4Z4FA 1TUUA 4KI6A 4CEZA 3K58A 2PAVA 3RRHA 2Q1NA 4DTUA 4JNEA 5M1NA 2AJQA 3LWLA 1UA0A 4IFYA 1IBKK 3DXKB 5GIOA 3CJ9A 3AY9A 4DSFA 3CG7A 3JSMA 4ELUA 3FGUA 1RDBA 4B1VA 1L5UA 3OS2A 1YVNA 4ELVA 4B3OA 4CW7B 4EHTA 4KHWA 4OKEA 1S6QA 5DK5A 2P9IA 4KTZA 1C6VA 5FLXO 2G8VA 3WNFA 2DTUA 4FM2A 4RW8A 4K43A 3QEWA 1SV5A 1HX1A 1Q8IA 4FLUA 4JK9A 2ZE2A 4DF4A 3ZSOA 2D0AA 4H8KA 1Z6RA 3Q7CA 1MWMA 5I3UA 4QCLA 1WNSA 3O9TA 4Z94A 4Q5VA 1KLMA 4LF5K 2P9NB 2HHHK 5KRSA 1YVUA 4DFJA 1NGAA 4CJWA 4YORA 2YX6A 4OLAA 2HSTA 5HRRA 2OPQA 1SKSA 4OO1J 5CR4A 4BACA 3QO9A 4KB0A 1EXQA 4EFHA 4BR2A 4AH9A 4OVLA 4Y1DA 1TL3A 1LWEA 4BWMA 3PSFA 2HBLA 4E3SA 3NH1A 1NU0A 1WSIA 1ASUA 3NH0A 2FBXA 3ULEA 3G71N 4PY5A 4GKJK 4H0VB 3M3ZA 3TAPA 2QWMA 2F9TA 3VQCA 4CFCA 2G8HA 4IFVA 3TSUA 2EWSA 2YNHA 4L8RB 3NF8A 3AVLA 3T69A 2V7ZA 3WT0A 2A6AA 2BH1A 3NVKA 4CHOA 3KK3A 4A59A 4B9NA 3MXMA 1KQSM 1YT3A 1LAWA 2G8UA 2ETJA 5HROA 2YHBA 1EWRA 3O9QA 3M5RA 3G25A 4RTFD 3S3NA 1QQMA 4RW7A 3L2WA 4BR4A 4LF4K 1K9MO 1XC3A 1ZBSA 2E5LK 3KK7A 3TU5A 3CM5A 1F21A 4Z4HA 3E01A 4M7XA 3CMEN 3VETA 3IFRA 1X3NA 3CCVN 4Z4CA 3QIOA 1GLDG 3D6RA 4JI3K 2CGKA 2QI2A 3L4QA 1LW2A 1MU2A 3U3GA 1NKCA 3BF3A 4YY3K 2GELA 3TTCA 4J2DA 3V9UA 4JD2B 2D0PA 2YKMA 3ZX0A 4M7YA 3LANA 5E26A 5LMUK 4DUZK 4DFPA 1OKJA 3QB0A 5E41A 2GWKA 3NF7A 3V9SA 1HPMA 3AA2A 1WOQA 5AQZA 5AQKA 4C8OA 3CF5L 4IJNA 3DXKA 4JHDB 3L2RA 4HHTA 3SQ0A 4KBOA 3E66A 3BDPA 3KD1E 3KIOA 3QINA 3TAQA 4CJTA 3I8DA 4BRDA 2NRXA 2HMIA 1T8EA 4R79A 1HYSA 3ZCMA 4H5NA 5EOYA 4BR9A 2A41A 4GVMA 4CGDA 3CIPA 3K0SA 1VQMN 3P5JA 2A3ZA 3ZSRA 4OGEA 3P1GA 3FLCO 3SAFA 3RWUA 3U8XA 4CJKA 4ZHRA 3M8QA 4XEIA 1OH5A 3K57A 2ZD1A 3EL2A 4H5RA 5AQJA 5J1EA 2AP1A 5CZ2A 2F96A 5I42A 1S1WA 1TKDA 3DLBA 4GV9A 1VSLA 1YUWA 3C95A 3D2FB 5BREA 3MDQA 2P9NA 4YOYA 4AF1A 1OH6A 1Q18A 4BVOA 2P9UB 1VQON 3NF9A 1MA9B 4E7LA 4CJ3A 2E2QA 4KAZA 3DRPA 1VSFA 4CEEA 2A40A 4FL9A 4FJGA 3FZLA 5J2NA 1J53A 4BRKA 3HVRA 2OTJN 3CHWA 2HHXA 1MDUB 3T19A 1RT7A 1L3VA 3VN5A 3CETA 5AFUA 2FF6A 5CYMA 2HW3A 1M1KO 3O1BA 2KKZA 2NRRA 4BR5A 1X1PA 4CGHA 3S9HA 3PIPL 3UB5A 3CQXA 4OJRA 4AHCA 3OS0A 4FLXA 1R0AA 3I33A 4IDHA 4BRPA 2YI1A 4PKHA 3E9LA 4H0TB 4A57A 3KKRA 1KLNA 3O5BA 1NKBA 4BROA 1RT6A 3T7ZA 4JN4A 3H3OB 3GL1A 3H45C 4CZLA 4RWTA 4KHQA 4NYFA 5F0XA 2QW9A 4KH6A 2GTDA 2HNZA 2GUIA 3ATVA 3QFUA 3TAMA 1WN7A 2QWLA 1NJWA 4M3ZA 4IEEA 4CD1A 1JCFA 3SYZA 5D3GA 4F9OA 4YFUA 3NH2A 4KRFA 2VWJA 1Y64A 4CGIA 5AQYA 3CC2N 3O80A 4KTWA 3S3MA 3TR8A 4CJPA 1C0GA 1Q9YA 4KI4A 3EY1A 2HHQA 2PYLA 1KD1O 4JD2A 2D1KA 3KVGA 2JWLA 3DJCA 4C8MA 1CLQA 4FOEA 4YOTA 2VWKA 5FPDA 2O8DB 3V4IA 4CZFA 4JI0K 4E1NA 1NJZA 3DMJA 1UAXA 2I7PA 3O08A 1D5AA 4FVMA 4JHDA 5AQHA 4JKCA 4K8XA 4A61A 1VSJA 1RBTA 1FKPA 2IDOA 3DRSA 4WQ4A 4E1MA 1RBRA 3P4IA 3O1WA 3CJAA 2AA4A 5CHIA 2P9SB 3CCRN 4B08A 4DCHA 2P5OA 1VQ6N 3W3DA 1B9FA 1KRPA 1BCMA 3HPHA 3KLGA 1NGJA 3J7AP 4DFMA 5CE3A 1NGCA 1OVYA 3MMVA 4CHQA 3O4WA 4OX9K 4W5RA 4M41A 1NWKA 1RDCA 1ZYQA 5AQFA 4EAHD 1ITGA 4O44A 4LFBK 1EKEA 2O8CA 4B1UB 3D2FA 4CECA 3VTIA 4JK7A 3UE5A 4BR7A 5BRDA 1A5XA 1I94K 3QICA 4ISEA 4CESA 1Q9XA 2XRIA 3DLLL 4JYAK 3FZKA 2GWJA 3HPOA 1HNWK 4BY9C 3SPYA 1KAYA 3SNNA 3MEGA 1N33K 4LY7A 3EKUA 2FLOA 3AVMA 1HPZA 3MX2A 3HO1A 2Q0UA 1JLAA 1N34K 4CF9A 4JRQA 4M63C 3V9ZA 3OTOK 2B5JA 2YCHA 3THXB 4CJUA 3UKUB 3ENHA 4IFEA 3J8AA 2O4IA 2ZJPL 4H5WA 1NGBA 2NUBA 3GOIA 3L2QA 2IOCA 4IJAA 3VQ5A 3HT3A 3V9XA 2G8KA 1V4SA 4E7HA 3H1VX 3ZEUB 4F8RA 4G9ZA 4RCHA 4CZHA 2X6SA 2CGJA 1SL2A 2IIRA 1RDDA 1RT3A 5AQGA 4UY8O 1HMVA 4BC3A 4KHUA 1DTTA 1ZC6A 3MN5A 3A5LC 2YHXA 4EP4A 4EZ9A 1EO1A 4FWSA 5M1PA 4BE1A 2YHAA 4WYBA 1HNZK 3A5MC 3VA3A 2HMPA 3HJFA 4GV3A 4ID5A 2IVOA 1QHTA 3HSTB 1S5JA 4U7BA 4CFBA 3QETA 4M3UA 2EHGA 4JLHA 3SUQA 4DR6K 5TKWA 4MLHA 3C6UA 1QZ5A 3LP1A 4CIEA 3PIOL 2O8DA 4PL7A 3WXKA 1XMOK 5C10A 2VGMA 3LM2A 4ZTJA 4BRFA 4I6MB 3CJ1A 3MEEA 3RTVA 5F1XA 4BRGA 1J5EK 3LZJA 4C1NK 3LPUA 3OA9A 4BRHA 4CEDA 1IG9A 5HRPA 2VWBA 4C8LA 5AQNA 2P9SA 1KSPA 3UIQA 4CJVA 1YI2N 1GLAG 2F7TA 3B6OA 2QWQA 5KGWA 3VQDA 1BCOA 1JKHA 4FW2A 4DQIA 3R9PA 2ZGYA 1U47A 1T7PA 3L3UA 2X74A 3JS6A 4DQPA 4CF1A 1O13A 5AQPA 4BWJA 1BG3A 1IH7A 3M8PA 5C2DA 3SI6A 3IAYA 3SQ2A 4KTQA 4IOCL 1T03A 2YJEA 3MCPA 5CZ1A 3HP6A 1XI1A 1VQ5N 5J2PA 1S9GA 3THYB 1QSYA 3VEZA 3TTFA 3W0LA 3QNOA 3TAGA 1WLJA 3SK3A 3VESA 4V19S 4ID1A 2HHUA 3K5MA 3PX0A 4BDPA 2FBYA 5GAGP 3THXA 3OW2M 3EE8A 4I2PA 3UKUA 3A2FA 1JJ2M 1NK7A 4I9QA 3FR0A 5HLFA 4HCCA 3A8YA 3TARA 4B1WB 3TAEA 3AAPA 4IG3A 2BGGA 4FWOA 4FK2A 3C6HA 3EO3A 1A5VA 1VQPN 4KKOA 3VPZA 3ZEUA 3ZX3A 1KVBA 1WSJA 4FLYA 3EN9A 3O4NA 3QEXA 5BR8K 3VEOA 4CIGA 3JAMO 3L4IA 2XY8A 1EWQA 4DLGA 4I7FA 3ENOA 4X65K 3VA0A 5AQOA 2WOMA 1CXQA 3GBTA 1XNQK 4XIUA 3DOKA 1L3TA 3AVIA 5AQTA 3QESA 1X9WA 1UA1A 1XC9A 1U6ZA 4KREA 1W97L 3J7ZO 3DXMB 1VQLN 1JL1A 2KZMA 3A5NC 3E9PA 3EYZA 3IG1A 1J5OA 3U9DA 4MO4A 1REVA 1KFSA 1S1XA 1RTHA 4NLBA 4BRIA 4LF7K 3I8BA 4KHNA 3VF6A 2B6AA 3OYDA 1X3MA 3BY5A 1BISA 2A42A 2OPPA 3QFPA 2E4LA 3VQPA 4OKJA 4DV4K 3CCSN 1VK0A 4I6MA 4LH5A 4DTPA 3AVGA 1Q81O 3VQEA 1X9MA 4JS5A 4LFAK 4FJNA 4Z4IA 1W2BM 4H0OA 4YDUC 2QWOA 1JCGA 3OHRA 1DEJA 3J81O 4JV5K 3IUCA 1NKEA 3PV8A 2QTDA 2HOEA 3MN7A 2V7YA 1D4XA 2YKNA 4CFDA 4WQ5C 1U04A 1XWLA 1OH7A 4FSVA 1YTAA 4CJQA 3HXMA 5EU7A 4CGGA 1CZBA 4B9UA 4NO7A 4O5FA 2PZSA 4H5TA 1CXUA 1NGDA 2FC0A 2RN2A 4FWKA 1HR0K 3ISNC 1B92A 3KZBA 3CCQN 4J2AA 1JL2A 4DSLA 5HOOA 2PBDA 3L0QA 3VF2A 2E8AA 5FRNA 4QS7A 3LDNA 5BPLA 4DTOA 3BP8A 1YIJN 3ASMA 5C0YA 4DR5K 4K41A 3O3FA 1X9SA 3O8MA 2XO7A 3CYMA 3HOSA 1MWKA 4J2BA 3OYGA 5DM7L 1HKGA 4YOUA 1GOAA 4AHRA 3V1QA 1KC8O 3BGRA 3GE1A 1WSFA 1JLBA 3CCUN 4DSJA 2E20A 4B8CA 1JLQA 3OBYA 1DKGD 3SV3A 5GADP 4DV0K 3QEIA 3NGIA 1BOTO 2FBTA 4IO9L 5E84A 1TK0A 2HVIA 3HRGA 1NK5A 4FLTA 5FPMA 4N56A 3D45A 5T7BA 2UYTA 4CHPA 3MXIA 4H0PA 3F2KA 3DI6A 2XY5A 2HHVA 1BA0A 4ILJA 4EHUA 5M1OA 1SKWA 4WE1A 4E1JA 4MQ3A 4DV1K 4XH4A 1BI4B 5AQVA 3QNNA 1KVAA 3DXMA 3VQ7A 1YHQN 1HNVA 4O0JA 1NMNA 3HOTA 4GMJB 4W5TA 1U2VA 2HHWA 4NB4A 3U3YA 2VQFK 4IWVA 4CJSA 1TV6A 3H6EA 1T6CA 4O8KA 1JLEA 3KLFA 4CEQA 4FO0A 1RDAA 3VENA 5JVHL 3K5OA 2KLAA 3E9OA 3G4SN 1HRHA 2WC9A 3AO2A 3PO4A 2Z1HA 3VEYA 3RR7A 2KFZA 2QWNA 3LDOA 2VQEK 4BE2A 1VRTA 1RGIA 4H5VA 1I39A 2XY7A 3MWTA 4NYNA 2E1ZA 3AA5X 1QTMA 4B9SA 3AVKA 2P9PB 1ASVA 2QXFA 5HL7L 5TKYA 3KD5E 4BRLA 3E1YA 1ZBUA 4DR7K 3CFOA 4DG1A 5JMVA 4DF8A 1VHXA 3C94A 1E4GT 5AQUA 1YF5L 2UUCK 2OPRA 4OPKA 3CPWM 1RBVA 2F8TA 3TSPA 1HLUA 5M1FA 1DTQA 3SJHA 3PLAA 4YNQA 2DPNA 1ZBFA 2NRTA 3EZ5A 2HB5A 4B3SK 2F9WA 4RW9A 4NCBA 4DQRA 1D8YA 2D0BA 4CHYA 4DLEA 4CJLA 4BG8A 3LAMA 3KLHA 4CE9A 5J2MA 5SZTA 5AZJB 5AQIA 1P90A 4PA1A 3NF6A 4HTLA 4U67L 3CI5A 3FZMA 3C6AA 4BC5A 3R6MA 4A2BA 2O8BB 3WXLA 3VOVA 3OJUA 4B9LA 1WSHA 1SL1A 2P9KB 3VGLA 3L6QA 5C42A 4FWRA 5JVGL 2UUAK 3JXUA 4DTNA 3B6PA 4H03B 2V52B 5GAEP 4OKKA 3I0RA 4O4GA 4J2EA 4AHTA 3HSCA 1KAXA 2W40A 4BGAA 4CJ5A 2ITMA 4FPBA 5JLFA 3OYJA 2ZJQL 4C8KA 4DTRA 1QS4A 1IJJA 4IBNA 1VQNN 3S41A 4M42A 3LL3A 3HL8A 3NE6A 4IEIA 5DMRA 5AQWA 3UKRB 1U48A 4LF6K 1WAJA 2Z1IA 3VQ6A 3OYNA 3AVFA 3RMDA 4BQZA 1NG9A 4AHUA 1BQNA 5K14A 4K0KK 2GUPA 3H1QA 2P9PA 3KK1A 1WAFA 5AQLA 3BUZB 1NGGA 4CJ4A 4PQUA 4HVJA 3JYTA 4IXCA 3T1AA 4B1ZA 4QOZB 3VEXA 3O9RA 1HJOA 3F9KA 1VSIA 4DR2K 1TKTA 4CVNE 4FJ5A 1EX4A 5GINA 1NLVA 4JRPA 3DOLA 1BO5O 1Q7YO 3WQTA 5MLCQ 5LJVA 3P31A 4WCEL 3K2PA 1YITN 3PX4A 3N4QA 1VSDA 4HUGA 3F73A 3DWLA 1U49A 5FPNA 4H0XB 4B9MA 1SS6A
chains in the Genus database with same CATH topology
4JI5K 2UXBK 4CW7B 5LMUK 4DUZK 5IWAK 5FLXO 1IBLK 1XNRK 4JI4K 4LF8K 4NXMK 1N36K 5AJ3K 2UUAK 4JI8K 4JI1K 4LFCK 1IBMK 1HR0K 3J7YP 4V19S 1FJGK 2VQEK 4X64K 4LF9K 1HNXK 4LF5K 2HHHK 3T1HK 4DV3K 4DR5K 5LL6Z 4JI7K 4JI0K 1HNZK 4DUYK 5IT9O 4DR1K 4DR7K 4KHPK 4YHHK 4LF6K 2ZM6K 5A2QO 1XMQK 5BR8K 4DR3K 4B3MK 3JAMO 4DR4K 2UUCK 4AQYK 4DR6K 4GKJK 4X65K 5LMNK 2UXDK 1N32K 1XNQK 3T1YK 4X66K 1XMOK 4K0KK 3J7AP 4X62K 4DV0K 4OX9K 4GKKK 4DV2K 4DV6K 4B3SK 1J5EK 4LFBK 4LF7K 4DR2K 4CVNE 4JI6K 4LF4K 1I94K 2UU9K 2UXCK 3J80O 4DV5K 4DV4K 2E5LK 4DV1K 4JYAK 4B3RK 1IBKK 1HNWK 4B3TK 2F4VK 4LFAK 1N33K 2UUBK 4JI3K 4JI2K 4NXNK 1N34K 4YY3K 3OTOK 3J81O 4JV5K 4DV7K 2VQFK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 K;  2UXB K;  4CW7 B;  5LMU K;  4DUZ K;  5IWA K;  5FLX O;  1IBL K;  1XNR K;  4JI4 K;  4LF8 K;  4NXM K;  1N36 K;  5AJ3 K;  2UUA K;  4JI8 K;  4JI1 K;  4LFC K;  1IBM K;  1HR0 K;  3J7Y P;  4V19 S;  1FJG K;  2VQE K;  4X64 K;  4LF9 K;  1HNX K;  4LF5 K;  2HHH K;  3T1H K;  4DV3 K;  4DR5 K;  5LL6 Z;  4JI7 K;  4JI0 K;  1HNZ K;  4DUY K;  5IT9 O;  4DR1 K;  4DR7 K;  4KHP K;  4YHH K;  4LF6 K;  2ZM6 K;  5A2Q O;  1XMQ K;  5BR8 K;  4DR3 K;  4B3M K;  3JAM O;  4DR4 K;  2UUC K;  4AQY K;  4DR6 K;  4GKJ K;  4X65 K;  5LMN K;  2UXD K;  1N32 K;  1XNQ K;  3T1Y K;  4X66 K;  1XMO K;  4K0K K;  3J7A P;  4X62 K;  4DV0 K;  4OX9 K;  4GKK K;  4DV2 K;  4DV6 K;  4B3S K;  1J5E K;  4LFB K;  4LF7 K;  4DR2 K;  4CVN E;  4JI6 K;  4LF4 K;  1I94 K;  2UU9 K;  2UXC K;  3J80 O;  4DV5 K;  4DV4 K;  2E5L K;  4DV1 K;  4JYA K;  4B3R K;  1IBK K;  1HNW K;  4B3T K;  2F4V K;  4LFA K;  1N33 K;  2UUB K;  4JI3 K;  4JI2 K;  4NXN K;  1N34 K;  4YY3 K;  3OTO K;  3J81 O;  4JV5 K;  4DV7 K;  2VQF K; 
#chains in the Genus database with same CATH topology
 3CJB A;  3LP0 A;  2HF4 A;  5BN9 A;  1J54 A;  4DQS A;  2HBM A;  3P38 A;  3K59 A;  1K6Y A;  3MN6 A;  1BU6 O;  3WEE B;  2P9U A;  4N76 A;  2VCP A;  1ZXO A;  4WFB L;  2OZM A;  3BF1 A;  5AZJ A;  4BDZ A;  4O0I A;  1N36 K;  3O9S A;  3PY8 A;  4E0D A;  1YJ9 N;  4R5P A;  4DQQ A;  1WSG A;  3QEV A;  3ID8 A;  2NNW A;  3AVH A;  4CJ7 A;  2DFE A;  4PWD A;  1RCH A;  1GLF O;  4X64 K;  4IO8 A;  3CFP A;  4RW4 A;  4CZI A;  3AAQ A;  2QM1 A;  1S1V A;  3DAW A;  1BIZ A;  3T1H K;  2GX9 A;  4CER A;  4HTU A;  2ITG A;  2P9K A;  3OBW A;  3CXC M;  3H3N O;  5AQM A;  5IT9 O;  1T3V A;  3ZT2 A;  1LAV A;  4DSK A;  2NZT A;  1ATS A;  2QKK A;  1G15 A;  3ALY A;  4BRM A;  1U4B A;  4DSI A;  3EKS A;  4DB3 A;  5EX5 A;  3MCA B;  2IVN A;  3SV4 A;  3T3F A;  3T1Y K;  1ILY A;  4JKH A;  3DLE A;  5C2F A;  1QSL A;  4CF2 A;  3IDH A;  2VG6 A;  1FKO A;  1U45 A;  4FWM A;  3A5O C;  3O9U A;  2E88 A;  5JS2 A;  3KK2 A;  3SUP A;  3UKR A;  4CFA A;  4H4O A;  1EQY A;  2PYJ A;  5BPM A;  3DM2 A;  1JXE A;  1I3A A;  1S9E A;  4PKG A;  3TI0 A;  3ZT1 A;  3KWI A;  3D0P A;  3CPE A;  2QXL A;  3CC4 N;  3PX6 A;  4B3R K;  1IKY A;  3IMX A;  4IG0 A;  2P51 A;  3VER A;  3K5N A;  3RRG A;  1SUQ A;  4FJX A;  3DLH A;  2QK9 A;  5ADX H;  1NGF A;  1VSM A;  2OTL N;  4FLV A;  4M3R A;  4DMN A;  3C65 A;  2IC3 A;  1RNH A;  1RTD A;  1C0F A;  3N4P A;  3NGZ A;  4FZY A;  5HBM A;  4WFA L;  1RBU A;  1ATN A;  4CHN A;  3AA4 A;  4GW6 A;  2I5J A;  1XNR K;  5ELZ A;  1GLE G;  2X6N A;  4AHS A;  4FJ7 A;  4ISF A;  3THW B;  1HYZ A;  1JLC A;  3MN9 A;  3VQ8 A;  1LWF A;  2GEM A;  5FPE A;  4FJ9 A;  5BRF A;  2Z1G A;  3WEE A;  3CD6 N;  1VRU A;  5M1K A;  1OH8 A;  2NRV A;  2KW4 A;  1S22 A;  2G8I A;  4E7I A;  5C24 A;  1SQK A;  3HVT A;  4K25 A;  4JKG B;  1HQE A;  4ISG A;  2O8F B;  2Q0R A;  4DR1 K;  4CZM A;  4DTM A;  5HRN A;  2HHT A;  1SAZ A;  3WXI A;  4TSX A;  4AQY K;  1T44 A;  4AHV A;  3FFK B;  3FFI A;  3ZT0 A;  3OYM A;  3KWG A;  4EP5 A;  3AVC A;  2P9L B;  3KHY A;  1NK9 A;  4OGC A;  3MED A;  4IKF A;  3HTV A;  3WXJ A;  1W7A A;  4PKI A;  4WQ4 C;  1S1T A;  3MX5 A;  1QE1 A;  1TK8 A;  2F8S A;  4DKW A;  4OLB A;  1VQ9 N;  1GOC A;  4QAG A;  3ULD A;  2W41 A;  3K5L A;  3GDQ A;  3LDQ A;  2UXC K;  4C8N A;  3D7E O;  3V9W A;  2ZGZ A;  4F3O A;  2X78 A;  3OYA A;  1C1B A;  3P83 D;  2FSK A;  2F4V K;  4ILG B;  3QDK A;  2R7Y A;  4JAX A;  1RIL A;  1BDG A;  4MLE A;  3RVC A;  1RDU A;  1FW6 A;  1ATR A;  3KLI A;  1IO2 A;  4GNI A;  1GLB G;  1NBW A;  3TPQ A;  3AV9 A;  4O5B A;  4B9V A;  4C1N I;  3NCI A;  3KKS A;  1S1U A;  1IBL K;  3DLG A;  4B1X B;  3HP9 A;  4JKF A;  1UWB A;  1Z05 A;  5AJ3 K;  3AGR A;  1HKC A;  1QQN A;  3J7Y P;  3G6E N;  4MDA A;  3LWM A;  1KXP A;  5BN8 A;  3I56 N;  1Q86 O;  3RSE B;  4CD3 A;  1JLF A;  1SZ2 A;  2YNI A;  4JKE A;  3AO3 A;  4Z4E A;  3L8B A;  3AO5 A;  5LL6 Z;  4GV6 A;  3RMC A;  1FXX A;  3WQU A;  1SL0 A;  2G8F A;  3LP3 A;  1BWF O;  5HP1 A;  5AQX A;  3THW A;  4BDY A;  2CGL A;  4JKB A;  4FWL A;  1NJI O;  3OYH A;  1XMQ K;  4CIF A;  2Z1J A;  2QWP A;  3QBX A;  4CJE A;  1BUP A;  2E6M A;  1E4F T;  3OYK A;  1BIU A;  2UXD K;  4JS4 A;  2JWK A;  4BRC A;  4FCY A;  4FVU A;  1ZBL A;  4MFB A;  3EE9 A;  2IAJ A;  4X66 K;  1TKZ A;  1Q82 O;  5AZI B;  3HM9 A;  3CC7 N;  3IRX A;  3ITH A;  4IOX A;  1SKR A;  3VQ4 A;  4BG9 A;  3TWH A;  2Y1I A;  5JS1 A;  2KQ2 A;  3MXJ A;  1ASW A;  1KFD A;  2J4R A;  5JLH A;  1DGK N;  4JKG A;  2O8F A;  3EZW A;  5CYQ A;  3THY A;  3DLR A;  4LH4 A;  2CH5 A;  4M3Y A;  4CZJ A;  1QZ6 A;  2XHB A;  3VQA A;  3OYC A;  2O8E B;  2WON A;  4B1Y B;  1V4T A;  4K42 A;  3HK2 A;  2NRH A;  1K73 O;  2P9L A;  3MAQ A;  4CBW A;  4AM7 A;  1NJX A;  3NBP A;  3FZH A;  4B3T K;  2BAN A;  1XQS C;  3HPG A;  1QQC A;  4CHZ A;  5KQ8 A;  3ZET B;  3O3H A;  3AA3 A;  2CH6 A;  1GLC G;  4NCA A;  4DHY A;  5KPR A;  4CBX A;  4IZ9 A;  3AO4 A;  4LC9 B;  1D9F A;  1T05 A;  1H1V A;  1K8K B;  2FF3 B;  2ZF5 O;  2W42 A;  3U6F A;  3ZX2 A;  1GLJ O;  3NVM A;  1IBM K;  1NK4 A;  4JKD A;  4FXD A;  3NAE A;  2Q2R A;  3VEW A;  5M1Q A;  1Z26 A;  4YOX A;  1L3S A;  5BRH A;  3OYI A;  2E2P A;  3EEQ A;  3CMA N;  1DLO A;  1OVQ A;  2GV9 A;  4CI6 A;  4DWI A;  4LF9 K;  4B9Q A;  3G10 A;  3LP2 A;  1C0T A;  4B9T A;  2VYP A;  1NNE A;  3CJC A;  3K9J A;  1QVG M;  1TVR A;  5AFU H;  4BE0 A;  3FZF A;  4Z4G A;  4A2A A;  4KHP K;  1QHA A;  3SUN A;  3RSE A;  5A2Q O;  4DR3 K;  4KV8 A;  1YTU A;  2E1Y A;  4XH1 A;  2RPI A;  1O1W A;  1VQ8 N;  1S3X A;  3WNG A;  4G1Q A;  4H4M A;  4Z0U A;  1W0H A;  1IKX A;  1VQK N;  1TAU A;  1HUX A;  2YHY A;  4KHY A;  3CCL N;  4FLZ A;  1XHX A;  2FSN A;  3F5T A;  4BVP A;  3O4Q A;  2QA4 N;  2PY5 A;  5FRM A;  3CCM N;  2D0C A;  2ZJR L;  3KLE A;  3HZ6 A;  1RTJ A;  3DLK A;  4JI6 K;  3I55 N;  1NK6 A;  1C1A A;  1RFQ A;  3U9Z A;  1B9D A;  1YXQ A;  1CZ9 A;  5AZI A;  5KQD A;  4DV5 K;  5F2R A;  3SJJ A;  3M1F A;  2BTF A;  5KI6 A;  3MEC A;  4E19 A;  3DYA A;  3AGK A;  3NGY A;  4ZTF A;  4IDK A;  4F3T A;  4FJ8 A;  3BZC A;  2YNF A;  4EZ6 A;  2WBN A;  3A0I X;  4CF0 A;  5LY3 A;  2OCE A;  4RW6 A;  3M8S A;  4FPA A;  5FDL A;  2HBJ A;  2O8E A;  3ZYY X;  3MWP A;  2RE2 A;  4DTS A;  1N6Q A;  2D4W A;  3G0Z A;  4DS5 A;  2GBZ A;  1NK0 A;  2HNY A;  2OZS A;  1T6D A;  4H0Y B;  1QSS A;  3CJ7 A;  4FWP A;  5IWA K;  1IV0 A;  3R3L A;  2OYQ A;  4FWN A;  1BA1 A;  1NJY A;  3ZSW A;  4NXM K;  5KTQ A;  4JI1 K;  3ZET A;  5C25 A;  5HRS A;  1ESV A;  2O8C B;  3F9M A;  5C12 A;  2E6L A;  2DFH A;  4CGF A;  5B8H A;  4KH5 A;  1FK9 A;  1IKW A;  3LM9 A;  1HNX K;  3O6W A;  3HI0 A;  3VGM A;  2IGI A;  1K8K A;  1C0M A;  4DV3 K;  3S3O A;  2V51 B;  5KGX A;  3LAK A;  4YOW A;  2Q97 A;  4E7J A;  4BR0 A;  3M8R A;  3SMP A;  4BRN A;  1BI4 A;  1X9J A;  1WUA A;  1C0U A;  4DUY K;  1QVF M;  3M6G A;  2ZM6 K;  4ICL A;  1XHZ A;  1TK5 A;  2RF2 A;  4W5N A;  3LDS A;  3C7N B;  4FJM A;  2XY6 A;  4LSL A;  4DU4 A;  1VQ4 N;  3VF4 A;  3BEX A;  4FOI A;  2HF3 A;  4AM6 A;  2KFN A;  1TKX A;  4BRQ A;  4CZK A;  1NMD A;  2OA8 A;  4GVE A;  4X62 K;  2D0O A;  2O4G A;  3HYF A;  4W5Q A;  3O3G A;  3CQ8 A;  2P5G A;  4DU1 A;  4DV6 K;  2IVP A;  2WFB A;  2Y1J A;  1GOB A;  1ZBH A;  1J6Z A;  3SBG A;  4N5S A;  4BGB A;  1HYV A;  3PUF A;  3ZT4 A;  4CZE A;  4I2Q A;  3ZSQ A;  2UU9 K;  4KO0 A;  3SCX A;  3LDL A;  2ATQ A;  5GIP A;  5LJW A;  4YOV A;  5EVZ A;  4JKA A;  1VAZ A;  3OYE A;  2A5X A;  4FK0 A;  1R59 O;  3QML A;  3CCJ N;  1HNI A;  2H3G X;  2YJF A;  3ZSV A;  4PUO A;  3LDP A;  4CEB A;  3SPZ A;  4Y0W A;  2BE2 A;  3I0S A;  3V1R A;  2HHS A;  4DV7 K;  3CQY A;  1S72 N;  1RT5 A;  3AVJ A;  4E7K A;  1LW0 A;  2NRZ A;  3LZI A;  2UXB K;  3HBT A;  1IKV A;  1LWC A;  3R1X A;  1RT2 A;  4LF8 K;  4Q0B A;  4BQL A;  1YJW N;  3QIP A;  4JI8 K;  3ATU A;  1HQU A;  1RT4 A;  4DTJ A;  2JLE A;  1NOY A;  3D2E B;  4HUF A;  2KTQ A;  4HWI A;  2KHO A;  4FWQ A;  1EET A;  4CGJ A;  2IS3 A;  1FJG K;  5KPT A;  2A1R A;  2YNG A;  3L3V A;  3KJV A;  1BQM A;  4BC2 A;  4BC4 A;  2HND A;  1VSH A;  1LCU A;  2B4J A;  5KRT A;  1NGI A;  4KHS A;  3SMS A;  1WB9 A;  4F2S A;  4DU3 A;  3QBW A;  4DSE A;  1VSK A;  4GY2 B;  2O8B A;  4CZG A;  3CM6 A;  3SQ4 A;  1VQ7 N;  1N32 K;  5I9E B;  3LPT A;  3TAN A;  4OPH A;  4OPA A;  4NLC A;  5JIC A;  3KTQ A;  4MDB A;  4E89 A;  1BGX T;  2I7N A;  2DY4 A;  4BRE A;  1WBB A;  4XH5 A;  2W6L A;  1D9D A;  3RR8 A;  3SAH A;  1BL3 A;  3WNE A;  1HKB A;  1KTQ A;  4M3W A;  4YDU A;  2VG7 A;  4KH4 A;  4BRA A;  3VGK A;  3FE1 A;  3QEP A;  3C7N A;  4F4K A;  4DS4 A;  2OPS A;  4B8A B;  1YAG A;  2FBV A;  2NRW A;  4WQ5 A;  4O55 A;  1M90 O;  4NCG A;  4CEF A;  1TAQ A;  4CEO A;  4Y1C A;  4FK4 A;  3OS1 A;  3HM8 A;  3THV A;  1WSE A;  2QEX N;  3ID6 A;  4M45 A;  3RMA A;  3IKM A;  5AQR A;  3VMF B;  4UQG A;  1N5Y A;  2UUB K;  2QKB A;  1TYQ B;  3TAB A;  4JI2 K;  3CER A;  1TGO A;  2WTU A;  1DT9 A;  4KFB A;  5AQS A;  3K9K A;  4PL8 A;  3BZK A;  4MO5 A;  4CK1 A;  2NLX A;  4M3X A;  4F2R A;  4JI4 K;  1Z25 A;  3PO5 A;  4LFC K;  3P39 A;  2BUP A;  4ELT A;  1P8Z A;  4FZZ A;  4K8Z A;  4CF8 A;  3RMB A;  1EP4 A;  5DM6 L;  2EX3 A;  2HVH A;  4JK8 A;  5AR0 A;  3SUO A;  1BHL A;  4HUE A;  4DQ8 A;  1XUP O;  4CK3 A;  3NDK A;  3WUH A;  1C1C A;  2D5R A;  3L2U A;  4FM0 A;  2ASO A;  4JI7 K;  5EXW A;  3OY9 A;  2LSN A;  2RKI A;  1KAZ A;  2FXU A;  1UOC A;  4HCB A;  3IS9 A;  1NM1 A;  3AVN A;  4FW1 A;  5H1S Q;  4CCH A;  4KPY A;  3D2E A;  1G99 A;  2Q31 A;  4CBU A;  4YHH K;  5SWM A;  5GAH P;  1NK8 A;  4N41 A;  3VQ9 A;  4B3M K;  4FYD A;  1A5W A;  2VGN A;  3QER A;  3TSQ A;  5BR9 A;  5LMN K;  4AIL C;  3AVA A;  2ZWH A;  2E2O A;  3DRR A;  3AVB A;  3ZSY A;  5CY4 A;  2A1S A;  1J9A A;  3CCE N;  4QS9 A;  3WXM B;  2JGU A;  4JEP A;  1TUY A;  1JCE A;  1GLL O;  1NGH A;  3Q7B A;  3SAG A;  3NFA A;  1WBD A;  1LV5 A;  4IOA L;  2ZQB A;  3VEV A;  3PSI A;  1NOZ A;  4LD0 A;  4J8F A;  4FM1 A;  2Q36 A;  2DFF A;  5AQQ A;  4KB1 A;  4ILH A;  1RDW X;  4LSN A;  2HBK A;  3B8A X;  2P9I B;  3J80 O;  1LOT B;  3L2V A;  1RTI A;  4CJR A;  4FZX C;  3MK6 A;  1E3M A;  3OYF A;  3WNH A;  2G8W A;  4FJJ A;  3OYL A;  2W6K A;  3AO1 A;  3OYB A;  2Q3S A;  2PFU A;  4DFK A;  3C6T A;  3V1O A;  4EIA A;  1QQO A;  1Y97 A;  4NXN K;  1YJN N;  3AAR A;  1JXB A;  2VG5 A;  4A5B A;  2P1J A;  1RBS A;  3H46 O;  3ZSZ A;  3ZT3 A;  2KZZ A;  4OPJ A;  4WF9 L;  4I9L A;  4A5A A;  4JI5 K;  1S6P A;  4RG8 A;  3OJS A;  2WUS A;  3GG4 A;  3ZSX A;  4FJI A;  1ZBI A;  4L3Q A;  5EY4 A;  3QLH A;  1KVC A;  4FLW A;  3ZLJ A;  3SQ1 A;  2E2N A;  2QWR A;  3NMU A;  3LAL A;  1W9H A;  3VQQ A;  1TYQ A;  3U4L A;  1TL1 A;  3ENB A;  3TAF A;  5C15 A;  4FJH A;  1JLG A;  3ULE B;  5J2Q A;  3R8E A;  4CK2 A;  4FJK A;  5ADX A;  2FSJ A;  5BPN A;  4CJF A;  3OVN A;  1HJR A;  1NGE A;  3NHG A;  3SLC A;  2BDP A;  3VTH A;  4DTX A;  2OAN A;  1KCF A;  5KPZ A;  4N47 A;  2YV0 X;  2ASP A;  2YHW A;  3CFR A;  3V81 A;  1U2V B;  1RT1 A;  4M3T A;  4CEA A;  4DR4 K;  3C0B A;  3SZ2 A;  1L3U A;  4QS8 A;  5FRO A;  1CZA N;  3SBT A;  3VQB A;  3H08 A;  4W5O A;  4O8U A;  2RHK A;  3TTD A;  1N8R O;  4C23 A;  1VSE A;  3V6D A;  4A62 A;  4GKK K;  4DV2 K;  2ASM A;  4PHT X;  1IG8 A;  1K8A O;  4FJL A;  4WFN L;  4Z4F A;  1TUU A;  4KI6 A;  4CEZ A;  3K58 A;  2PAV A;  3RRH A;  2Q1N A;  4DTU A;  4JNE A;  5M1N A;  2AJQ A;  3LWL A;  1UA0 A;  4IFY A;  1IBK K;  3DXK B;  5GIO A;  3CJ9 A;  3AY9 A;  4DSF A;  3CG7 A;  3JSM A;  4ELU A;  3FGU A;  1RDB A;  4B1V A;  1L5U A;  3OS2 A;  1YVN A;  4ELV A;  4B3O A;  4CW7 B;  4EHT A;  4KHW A;  4OKE A;  1S6Q A;  5DK5 A;  2P9I A;  4KTZ A;  1C6V A;  5FLX O;  2G8V A;  3WNF A;  2DTU A;  4FM2 A;  4RW8 A;  4K43 A;  3QEW A;  1SV5 A;  1HX1 A;  1Q8I A;  4FLU A;  4JK9 A;  2ZE2 A;  4DF4 A;  3ZSO A;  2D0A A;  4H8K A;  1Z6R A;  3Q7C A;  1MWM A;  5I3U A;  4QCL A;  1WNS A;  3O9T A;  4Z94 A;  4Q5V A;  1KLM A;  4LF5 K;  2P9N B;  2HHH K;  5KRS A;  1YVU A;  4DFJ A;  1NGA A;  4CJW A;  4YOR A;  2YX6 A;  4OLA A;  2HST A;  5HRR A;  2OPQ A;  1SKS A;  4OO1 J;  5CR4 A;  4BAC A;  3QO9 A;  4KB0 A;  1EXQ A;  4EFH A;  4BR2 A;  4AH9 A;  4OVL A;  4Y1D A;  1TL3 A;  1LWE A;  4BWM A;  3PSF A;  2HBL A;  4E3S A;  3NH1 A;  1NU0 A;  1WSI A;  1ASU A;  3NH0 A;  2FBX A;  3ULE A;  3G71 N;  4PY5 A;  4GKJ K;  4H0V B;  3M3Z A;  3TAP A;  2QWM A;  2F9T A;  3VQC A;  4CFC A;  2G8H A;  4IFV A;  3TSU A;  2EWS A;  2YNH A;  4L8R B;  3NF8 A;  3AVL A;  3T69 A;  2V7Z A;  3WT0 A;  2A6A A;  2BH1 A;  3NVK A;  4CHO A;  3KK3 A;  4A59 A;  4B9N A;  3MXM A;  1KQS M;  1YT3 A;  1LAW A;  2G8U A;  2ETJ A;  5HRO A;  2YHB A;  1EWR A;  3O9Q A;  3M5R A;  3G25 A;  4RTF D;  3S3N A;  1QQM A;  4RW7 A;  3L2W A;  4BR4 A;  4LF4 K;  1K9M O;  1XC3 A;  1ZBS A;  2E5L K;  3KK7 A;  3TU5 A;  3CM5 A;  1F21 A;  4Z4H A;  3E01 A;  4M7X A;  3CME N;  3VET A;  3IFR A;  1X3N A;  3CCV N;  4Z4C A;  3QIO A;  1GLD G;  3D6R A;  4JI3 K;  2CGK A;  2QI2 A;  3L4Q A;  1LW2 A;  1MU2 A;  3U3G A;  1NKC A;  3BF3 A;  4YY3 K;  2GEL A;  3TTC A;  4J2D A;  3V9U A;  4JD2 B;  2D0P A;  2YKM A;  3ZX0 A;  4M7Y A;  3LAN A;  5E26 A;  5LMU K;  4DUZ K;  4DFP A;  1OKJ A;  3QB0 A;  5E41 A;  2GWK A;  3NF7 A;  3V9S A;  1HPM A;  3AA2 A;  1WOQ A;  5AQZ A;  5AQK A;  4C8O A;  3CF5 L;  4IJN A;  3DXK A;  4JHD B;  3L2R A;  4HHT A;  3SQ0 A;  4KBO A;  3E66 A;  3BDP A;  3KD1 E;  3KIO A;  3QIN A;  3TAQ A;  4CJT A;  3I8D A;  4BRD A;  2NRX A;  2HMI A;  1T8E A;  4R79 A;  1HYS A;  3ZCM A;  4H5N A;  5EOY A;  4BR9 A;  2A41 A;  4GVM A;  4CGD A;  3CIP A;  3K0S A;  1VQM N;  3P5J A;  2A3Z A;  3ZSR A;  4OGE A;  3P1G A;  3FLC O;  3SAF A;  3RWU A;  3U8X A;  4CJK A;  4ZHR A;  3M8Q A;  4XEI A;  1OH5 A;  3K57 A;  2ZD1 A;  3EL2 A;  4H5R A;  5AQJ A;  5J1E A;  2AP1 A;  5CZ2 A;  2F96 A;  5I42 A;  1S1W A;  1TKD A;  3DLB A;  4GV9 A;  1VSL A;  1YUW A;  3C95 A;  3D2F B;  5BRE A;  3MDQ A;  2P9N A;  4YOY A;  4AF1 A;  1OH6 A;  1Q18 A;  4BVO A;  2P9U B;  1VQO N;  3NF9 A;  1MA9 B;  4E7L A;  4CJ3 A;  2E2Q A;  4KAZ A;  3DRP A;  1VSF A;  4CEE A;  2A40 A;  4FL9 A;  4FJG A;  3FZL A;  5J2N A;  1J53 A;  4BRK A;  3HVR A;  2OTJ N;  3CHW A;  2HHX A;  1MDU B;  3T19 A;  1RT7 A;  1L3V A;  3VN5 A;  3CET A;  5AFU A;  2FF6 A;  5CYM A;  2HW3 A;  1M1K O;  3O1B A;  2KKZ A;  2NRR A;  4BR5 A;  1X1P A;  4CGH A;  3S9H A;  3PIP L;  3UB5 A;  3CQX A;  4OJR A;  4AHC A;  3OS0 A;  4FLX A;  1R0A A;  3I33 A;  4IDH A;  4BRP A;  2YI1 A;  4PKH A;  3E9L A;  4H0T B;  4A57 A;  3KKR A;  1KLN A;  3O5B A;  1NKB A;  4BRO A;  1RT6 A;  3T7Z A;  4JN4 A;  3H3O B;  3GL1 A;  3H45 C;  4CZL A;  4RWT A;  4KHQ A;  4NYF A;  5F0X A;  2QW9 A;  4KH6 A;  2GTD A;  2HNZ A;  2GUI A;  3ATV A;  3QFU A;  3TAM A;  1WN7 A;  2QWL A;  1NJW A;  4M3Z A;  4IEE A;  4CD1 A;  1JCF A;  3SYZ A;  5D3G A;  4F9O A;  4YFU A;  3NH2 A;  4KRF A;  2VWJ A;  1Y64 A;  4CGI A;  5AQY A;  3CC2 N;  3O80 A;  4KTW A;  3S3M A;  3TR8 A;  4CJP A;  1C0G A;  1Q9Y A;  4KI4 A;  3EY1 A;  2HHQ A;  2PYL A;  1KD1 O;  4JD2 A;  2D1K A;  3KVG A;  2JWL A;  3DJC A;  4C8M A;  1CLQ A;  4FOE A;  4YOT A;  2VWK A;  5FPD A;  2O8D B;  3V4I A;  4CZF A;  4JI0 K;  4E1N A;  1NJZ A;  3DMJ A;  1UAX A;  2I7P A;  3O08 A;  1D5A A;  4FVM A;  4JHD A;  5AQH A;  4JKC A;  4K8X A;  4A61 A;  1VSJ A;  1RBT A;  1FKP A;  2IDO A;  3DRS A;  4WQ4 A;  4E1M A;  1RBR A;  3P4I A;  3O1W A;  3CJA A;  2AA4 A;  5CHI A;  2P9S B;  3CCR N;  4B08 A;  4DCH A;  2P5O A;  1VQ6 N;  3W3D A;  1B9F A;  1KRP A;  1BCM A;  3HPH A;  3KLG A;  1NGJ A;  3J7A P;  4DFM A;  5CE3 A;  1NGC A;  1OVY A;  3MMV A;  4CHQ A;  3O4W A;  4OX9 K;  4W5R A;  4M41 A;  1NWK A;  1RDC A;  1ZYQ A;  5AQF A;  4EAH D;  1ITG A;  4O44 A;  4LFB K;  1EKE A;  2O8C A;  4B1U B;  3D2F A;  4CEC A;  3VTI A;  4JK7 A;  3UE5 A;  4BR7 A;  5BRD A;  1A5X A;  1I94 K;  3QIC A;  4ISE A;  4CES A;  1Q9X A;  2XRI A;  3DLL L;  4JYA K;  3FZK A;  2GWJ A;  3HPO A;  1HNW K;  4BY9 C;  3SPY A;  1KAY A;  3SNN A;  3MEG A;  1N33 K;  4LY7 A;  3EKU A;  2FLO A;  3AVM A;  1HPZ A;  3MX2 A;  3HO1 A;  2Q0U A;  1JLA A;  1N34 K;  4CF9 A;  4JRQ A;  4M63 C;  3V9Z A;  3OTO K;  2B5J A;  2YCH A;  3THX B;  4CJU A;  3UKU B;  3ENH A;  4IFE A;  3J8A A;  2O4I A;  2ZJP L;  4H5W A;  1NGB A;  2NUB A;  3GOI A;  3L2Q A;  2IOC A;  4IJA A;  3VQ5 A;  3HT3 A;  3V9X A;  2G8K A;  1V4S A;  4E7H A;  3H1V X;  3ZEU B;  4F8R A;  4G9Z A;  4RCH A;  4CZH A;  2X6S A;  2CGJ A;  1SL2 A;  2IIR A;  1RDD A;  1RT3 A;  5AQG A;  4UY8 O;  1HMV A;  4BC3 A;  4KHU A;  1DTT A;  1ZC6 A;  3MN5 A;  3A5L C;  2YHX A;  4EP4 A;  4EZ9 A;  1EO1 A;  4FWS A;  5M1P A;  4BE1 A;  2YHA A;  4WYB A;  1HNZ K;  3A5M C;  3VA3 A;  2HMP A;  3HJF A;  4GV3 A;  4ID5 A;  2IVO A;  1QHT A;  3HST B;  1S5J A;  4U7B A;  4CFB A;  3QET A;  4M3U A;  2EHG A;  4JLH A;  3SUQ A;  4DR6 K;  5TKW A;  4MLH A;  3C6U A;  1QZ5 A;  3LP1 A;  4CIE A;  3PIO L;  2O8D A;  4PL7 A;  3WXK A;  1XMO K;  5C10 A;  2VGM A;  3LM2 A;  4ZTJ A;  4BRF A;  4I6M B;  3CJ1 A;  3MEE A;  3RTV A;  5F1X A;  4BRG A;  1J5E K;  3LZJ A;  4C1N K;  3LPU A;  3OA9 A;  4BRH A;  4CED A;  1IG9 A;  5HRP A;  2VWB A;  4C8L A;  5AQN A;  2P9S A;  1KSP A;  3UIQ A;  4CJV A;  1YI2 N;  1GLA G;  2F7T A;  3B6O A;  2QWQ A;  5KGW A;  3VQD A;  1BCO A;  1JKH A;  4FW2 A;  4DQI A;  3R9P A;  2ZGY A;  1U47 A;  1T7P A;  3L3U A;  2X74 A;  3JS6 A;  4DQP A;  4CF1 A;  1O13 A;  5AQP A;  4BWJ A;  1BG3 A;  1IH7 A;  3M8P A;  5C2D A;  3SI6 A;  3IAY A;  3SQ2 A;  4KTQ A;  4IOC L;  1T03 A;  2YJE A;  3MCP A;  5CZ1 A;  3HP6 A;  1XI1 A;  1VQ5 N;  5J2P A;  1S9G A;  3THY B;  1QSY A;  3VEZ A;  3TTF A;  3W0L A;  3QNO A;  3TAG A;  1WLJ A;  3SK3 A;  3VES A;  4V19 S;  4ID1 A;  2HHU A;  3K5M A;  3PX0 A;  4BDP A;  2FBY A;  5GAG P;  3THX A;  3OW2 M;  3EE8 A;  4I2P A;  3UKU A;  3A2F A;  1JJ2 M;  1NK7 A;  4I9Q A;  3FR0 A;  5HLF A;  4HCC A;  3A8Y A;  3TAR A;  4B1W B;  3TAE A;  3AAP A;  4IG3 A;  2BGG A;  4FWO A;  4FK2 A;  3C6H A;  3EO3 A;  1A5V A;  1VQP N;  4KKO A;  3VPZ A;  3ZEU A;  3ZX3 A;  1KVB A;  1WSJ A;  4FLY A;  3EN9 A;  3O4N A;  3QEX A;  5BR8 K;  3VEO A;  4CIG A;  3JAM O;  3L4I A;  2XY8 A;  1EWQ A;  4DLG A;  4I7F A;  3ENO A;  4X65 K;  3VA0 A;  5AQO A;  2WOM A;  1CXQ A;  3GBT A;  1XNQ K;  4XIU A;  3DOK A;  1L3T A;  3AVI A;  5AQT A;  3QES A;  1X9W A;  1UA1 A;  1XC9 A;  1U6Z A;  4KRE A;  1W97 L;  3J7Z O;  3DXM B;  1VQL N;  1JL1 A;  2KZM A;  3A5N C;  3E9P A;  3EYZ A;  3IG1 A;  1J5O A;  3U9D A;  4MO4 A;  1REV A;  1KFS A;  1S1X A;  1RTH A;  4NLB A;  4BRI A;  4LF7 K;  3I8B A;  4KHN A;  3VF6 A;  2B6A A;  3OYD A;  1X3M A;  3BY5 A;  1BIS A;  2A42 A;  2OPP A;  3QFP A;  2E4L A;  3VQP A;  4OKJ A;  4DV4 K;  3CCS N;  1VK0 A;  4I6M A;  4LH5 A;  4DTP A;  3AVG A;  1Q81 O;  3VQE A;  1X9M A;  4JS5 A;  4LFA K;  4FJN A;  4Z4I A;  1W2B M;  4H0O A;  4YDU C;  2QWO A;  1JCG A;  3OHR A;  1DEJ A;  3J81 O;  4JV5 K;  3IUC A;  1NKE A;  3PV8 A;  2QTD A;  2HOE A;  3MN7 A;  2V7Y A;  1D4X A;  2YKN A;  4CFD A;  4WQ5 C;  1U04 A;  1XWL A;  1OH7 A;  4FSV A;  1YTA A;  4CJQ A;  3HXM A;  5EU7 A;  4CGG A;  1CZB A;  4B9U A;  4NO7 A;  4O5F A;  2PZS A;  4H5T A;  1CXU A;  1NGD A;  2FC0 A;  2RN2 A;  4FWK A;  1HR0 K;  3ISN C;  1B92 A;  3KZB A;  3CCQ N;  4J2A A;  1JL2 A;  4DSL A;  5HOO A;  2PBD A;  3L0Q A;  3VF2 A;  2E8A A;  5FRN A;  4QS7 A;  3LDN A;  5BPL A;  4DTO A;  3BP8 A;  1YIJ N;  3ASM A;  5C0Y A;  4DR5 K;  4K41 A;  3O3F A;  1X9S A;  3O8M A;  2XO7 A;  3CYM A;  3HOS A;  1MWK A;  4J2B A;  3OYG A;  5DM7 L;  1HKG A;  4YOU A;  1GOA A;  4AHR A;  3V1Q A;  1KC8 O;  3BGR A;  3GE1 A;  1WSF A;  1JLB A;  3CCU N;  4DSJ A;  2E20 A;  4B8C A;  1JLQ A;  3OBY A;  1DKG D;  3SV3 A;  5GAD P;  4DV0 K;  3QEI A;  3NGI A;  1BOT O;  2FBT A;  4IO9 L;  5E84 A;  1TK0 A;  2HVI A;  3HRG A;  1NK5 A;  4FLT A;  5FPM A;  4N56 A;  3D45 A;  5T7B A;  2UYT A;  4CHP A;  3MXI A;  4H0P A;  3F2K A;  3DI6 A;  2XY5 A;  2HHV A;  1BA0 A;  4ILJ A;  4EHU A;  5M1O A;  1SKW A;  4WE1 A;  4E1J A;  4MQ3 A;  4DV1 K;  4XH4 A;  1BI4 B;  5AQV A;  3QNN A;  1KVA A;  3DXM A;  3VQ7 A;  1YHQ N;  1HNV A;  4O0J A;  1NMN A;  3HOT A;  4GMJ B;  4W5T A;  1U2V A;  2HHW A;  4NB4 A;  3U3Y A;  2VQF K;  4IWV A;  4CJS A;  1TV6 A;  3H6E A;  1T6C A;  4O8K A;  1JLE A;  3KLF A;  4CEQ A;  4FO0 A;  1RDA A;  3VEN A;  5JVH L;  3K5O A;  2KLA A;  3E9O A;  3G4S N;  1HRH A;  2WC9 A;  3AO2 A;  3PO4 A;  2Z1H A;  3VEY A;  3RR7 A;  2KFZ A;  2QWN A;  3LDO A;  2VQE K;  4BE2 A;  1VRT A;  1RGI A;  4H5V A;  1I39 A;  2XY7 A;  3MWT A;  4NYN A;  2E1Z A;  3AA5 X;  1QTM A;  4B9S A;  3AVK A;  2P9P B;  1ASV A;  2QXF A;  5HL7 L;  5TKY A;  3KD5 E;  4BRL A;  3E1Y A;  1ZBU A;  4DR7 K;  3CFO A;  4DG1 A;  5JMV A;  4DF8 A;  1VHX A;  3C94 A;  1E4G T;  5AQU A;  1YF5 L;  2UUC K;  2OPR A;  4OPK A;  3CPW M;  1RBV A;  2F8T A;  3TSP A;  1HLU A;  5M1F A;  1DTQ A;  3SJH A;  3PLA A;  4YNQ A;  2DPN A;  1ZBF A;  2NRT A;  3EZ5 A;  2HB5 A;  4B3S K;  2F9W A;  4RW9 A;  4NCB A;  4DQR A;  1D8Y A;  2D0B A;  4CHY A;  4DLE A;  4CJL A;  4BG8 A;  3LAM A;  3KLH A;  4CE9 A;  5J2M A;  5SZT A;  5AZJ B;  5AQI A;  1P90 A;  4PA1 A;  3NF6 A;  4HTL A;  4U67 L;  3CI5 A;  3FZM A;  3C6A A;  4BC5 A;  3R6M A;  4A2B A;  2O8B B;  3WXL A;  3VOV A;  3OJU A;  4B9L A;  1WSH A;  1SL1 A;  2P9K B;  3VGL A;  3L6Q A;  5C42 A;  4FWR A;  5JVG L;  2UUA K;  3JXU A;  4DTN A;  3B6P A;  4H03 B;  2V52 B;  5GAE P;  4OKK A;  3I0R A;  4O4G A;  4J2E A;  4AHT A;  3HSC A;  1KAX A;  2W40 A;  4BGA A;  4CJ5 A;  2ITM A;  4FPB A;  5JLF A;  3OYJ A;  2ZJQ L;  4C8K A;  4DTR A;  1QS4 A;  1IJJ A;  4IBN A;  1VQN N;  3S41 A;  4M42 A;  3LL3 A;  3HL8 A;  3NE6 A;  4IEI A;  5DMR A;  5AQW A;  3UKR B;  1U48 A;  4LF6 K;  1WAJ A;  2Z1I A;  3VQ6 A;  3OYN A;  3AVF A;  3RMD A;  4BQZ A;  1NG9 A;  4AHU A;  1BQN A;  5K14 A;  4K0K K;  2GUP A;  3H1Q A;  2P9P A;  3KK1 A;  1WAF A;  5AQL A;  3BUZ B;  1NGG A;  4CJ4 A;  4PQU A;  4HVJ A;  3JYT A;  4IXC A;  3T1A A;  4B1Z A;  4QOZ B;  3VEX A;  3O9R A;  1HJO A;  3F9K A;  1VSI A;  4DR2 K;  1TKT A;  4CVN E;  4FJ5 A;  1EX4 A;  5GIN A;  1NLV A;  4JRP A;  3DOL A;  1BO5 O;  1Q7Y O;  3WQT A;  5MLC Q;  5LJV A;  3P31 A;  4WCE L;  3K2P A;  1YIT N;  3PX4 A;  3N4Q A;  1VSD A;  4HUG A;  3F73 A;  3DWL A;  1U49 A;  5FPN A;  4H0X B;  4B9M A;  1SS6 A; 
#chains in the Genus database with same CATH homology
 4JI5 K;  2UXB K;  4CW7 B;  5LMU K;  4DUZ K;  5IWA K;  5FLX O;  1IBL K;  1XNR K;  4JI4 K;  4LF8 K;  4NXM K;  1N36 K;  5AJ3 K;  2UUA K;  4JI8 K;  4JI1 K;  4LFC K;  1IBM K;  1HR0 K;  3J7Y P;  4V19 S;  1FJG K;  2VQE K;  4X64 K;  4LF9 K;  1HNX K;  4LF5 K;  2HHH K;  3T1H K;  4DV3 K;  4DR5 K;  5LL6 Z;  4JI7 K;  4JI0 K;  1HNZ K;  4DUY K;  5IT9 O;  4DR1 K;  4DR7 K;  4KHP K;  4YHH K;  4LF6 K;  2ZM6 K;  5A2Q O;  1XMQ K;  5BR8 K;  4DR3 K;  4B3M K;  3JAM O;  4DR4 K;  2UUC K;  4AQY K;  4DR6 K;  4GKJ K;  4X65 K;  5LMN K;  2UXD K;  1N32 K;  1XNQ K;  3T1Y K;  4X66 K;  1XMO K;  4K0K K;  3J7A P;  4X62 K;  4DV0 K;  4OX9 K;  4GKK K;  4DV2 K;  4DV6 K;  4B3S K;  1J5E K;  4LFB K;  4LF7 K;  4DR2 K;  4CVN E;  4JI6 K;  4LF4 K;  1I94 K;  2UU9 K;  2UXC K;  3J80 O;  4DV5 K;  4DV4 K;  2E5L K;  4DV1 K;  4JYA K;  4B3R K;  1IBK K;  1HNW K;  4B3T K;  2F4V K;  4LFA K;  1N33 K;  2UUB K;  4JI3 K;  4JI2 K;  4NXN K;  1N34 K;  4YY3 K;  3OTO K;  3J81 O;  4JV5 K;  4DV7 K;  2VQF K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...