4JI3K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji3K00
4DR7K 4B3MK 5IWAK 4X65K 4DV4K 4LF9K 2UXDK 1I94K 4LF5K 3OTOK 4NXNK 4NXMK 1XMQK 4X66K 1XMOK 2UUBK 4JI8K 2UXBK 4B3TK 1N33K 1HNZK 4LFCK 3J7AP 4LFBK 2UU9K 2VQEK 4DR4K 1HR0K 5LMUK 1IBLK 4LF4K 1XNQK 4GKJK 4JI1K 5LMNK 4AQYK 1N36K 4JI2K 1N34K 4YY3K 4DR6K 4JI7K 1IBKK 4DR1K 4JI6K 2UXCK 3J7YP 4JYAK 4JI4K 2UUAK 4DV6K 4K0KK 4JI3K 4V19S 4DR5K 1HNWK 1IBMK 3T1YK 4KHPK 3J80O 4X62K 4DR2K 4DV1K 1HNXK 5A2QO 2E5LK 4JI5K 4JI0K 4LF6K 1XNRK 3JAMO 4DV3K 4DV2K 4B3SK 1N32K 4DUYK 5AJ3K 4CVNE 4LF7K 2UUCK 4X64K 4DV0K 3T1HK 4B3RK 2ZM6K 4DV7K 4DR3K 5BR8K 4DUZK 3J81O 4JV5K 2VQFK 4YHHK 4DV5K 2F4VK 5LL6Z 4CW7B 5FLXO 2HHHK 4GKKK 4LF8K 4LFAK 5IT9O 4OX9K 1FJGK 1J5EK
chains in the Genus database with same CATH superfamily
3WXIA 3V9UA 3AVBA 4LD0A 2FBVA 3M6GA 3QEXA 5AZJA 2RN2A 1KLNA 4RW8A 2ASOA 2GUIA 4CGIA 4IXCA 2G8FA 1T3VA 2A6AA 1S1VA 4FPBA 3N4QA 4NXNK 5C2DA 4DS5A 4FPAA 1VSDA 1RT4A 4KFBA 1VQ4N 1GLFO 2UU9K 3O9UA 2HHUA 1Q18A 5C15A 2E4LA 2ZD1A 3U3GA 3O08A 4H4OA 3QLHA 2A42A 5JVHL 2B6AA 4CD3A 1CZAN 3OHRA 2P9KA 4WYBA 1W9HA 1S9EA 4JK9A 3AVHA 2Q3SA 1U04A 3R6MA 1Q86O 1YITN 3AGRA 1BISA 5GIPA 5GIOA 4JKEA 2KZZA 4CF8A 2P9IA 1E3MA 4FO0A 4MLEA 4FJNA 4K42A 2VGMA 2ASMA 1IKYA 1C0MA 3LDNA 3D45A 1GOCA 4YDUC 5C10A 1LWFA 3KJVA 4F8RA 3QEIA 4FYDA 1JLEA 4CBXA 1NOZA 4IOCL 1YTAA 1NK6A 4CK3A 4DV3K 1LW2A 1S9GA 5KGWA 4RCHA 1HPMA 4FW2A 1I39A 5M1PA 4ELTA 4AHUA 4FZXC 3ZSXA 5AFUA 3D0PA 5DMRA 1KLMA 3U8XA 3THVA 3KK7A 1HYZA 1HQEA 1RT1A 2ATQA 1QS4A 4KTZA 5AQJA 4DV5K 1V4TA 3RWUA 1ZBSA 1EXQA 1YAGA 3C95A 4FSVA 4O5BA 4BRDA 4FJHA 4GKKK 1SUQA 1SKWA 4CEOA 1JXEA 1M1KO 1NG9A 1WBDA 4FLUA 3V6DA 4E0DA 2W40A 3AAPA 1WSEA 4KRFA 1K8KA 4LF9K 1HQUA 4H03B 4FW1A 1QVFM 1ASUA 3QICA 2H3GX 1NGBA 3L3VA 3IUCA 4BVPA 1QVGM 2O8EB 3GDQA 1VSMA 4FJLA 2JLEA 4CEQA 4IFYA 1EETA 3OYEA 2HW3A 4F4KA 3A5OC 4H5NA 5JLFA 1XHXA 2KFZA 5KRTA 4B9VA 2W41A 1QQMA 4J2AA 5C25A 1TKZA 2IIRA 3WNEA 4Q0BA 2P9SB 4OPAA 2QWRA 1EQYA 2YX6A 4IJNA 1YJNN 3C6HA 5AQGA 4C8MA 2ITGA 1TAQA 3J8AA 2E1ZA 2KLAA 3NBPA 3VPZA 3BF3A 1XHZA 2O4GA 3BUZB 4B9SA 4O5FA 1VQ7N 4H5WA 2BUPA 2YHBA 4NCBA 2WBNA 4CERA 2OPQA 2RPIA 3THWA 2E2PA 3EL2A 1S6QA 3AA4A 5D3GA 1WSJA 4CBUA 3V9XA 4DWIA 2PY5A 4KHUA 3M8SA 5E41A 5AQYA 4BRNA 2QEXN 3NE6A 3CHWA 3CJBA 1SV5A 4MLHA 4FK0A 1HLUA 3SCXA 4JNEA 4HHTA 4QS7A 2OYQA 3HSCA 4KHSA 1IH7A 3DLRA 3CQYA 4ZHRA 1YTUA 1VQ6N 5DK5A 3T1HK 1KVAA 1QSLA 1FK9A 2NRXA 3NVMA 3O9TA 4BVOA 3KLHA 2OTLN 2NUBA 1K8AO 2DFHA 2F4VK 5ELZA 1OVQA 2OANA 5I42A 1L3SA 3ZT3A 5LY3A 2QM1A 3HPOA 1BIZA 3SV4A 5AQFA 5IT9O 4OX9K 2QWNA 1NMNA 1IG8A 4KHYA 4Z4HA 4M3TA 4IJAA 4DV4K 2V51B 2QXFA 3CCRN 4OKKA 4DTXA 3DJCA 3LM2A 1Z05A 4HTLA 3HI0A 3KLEA 3P5JA 4AF1A 4BE0A 3AVFA 2XY5A 4FLXA 3NH1A 2O8DB 1LOTB 3I0SA 4X66K 3V81A 3V9SA 1YVNA 4LFBK 4CECA 5DM6L 1HR0K 4BDYA 1IBLK 4ELUA 2O8CB 1NOYA 4CEAA 4Y1CA 5FROA 5AQKA 4CJFA 1D9DA 1KQSM 4JI2K 2E2NA 3HL8A 3L2WA 1CXQA 4HUGA 3E66A 5GAHP 3OYAA 1A5WA 3T19A 3L4QA 3DOLA 3M8QA 1MU2A 3QFPA 1BQNA 1DEJA 4YOVA 4Z4FA 4W5RA 4WFBL 3FZKA 3SMPA 4CGJA 3QETA 5GINA 3K9KA 1Q9YA 4KHWA 4H0TB 3OBWA 2F7TA 4FWRA 1X3MA 3LZIA 4HTUA 4KHPK 1T7PA 4BC5A 3MAQA 2HHQA 2E5LK 2P9UB 3GBTA 3HXMA 4IOAL 1WSFA 4DFJA 1CZBA 5FPDA 1XNRK 3HM9A 2FSJA 4BC3A 3MXJA 1L5UA 3LZJA 2EX3A 4DV2K 3AVGA 1UA0A 4I6MA 3Q7CA 2FSNA 4DSFA 4K8ZA 4BQZA 1DTQA 3GG4A 4I9LA 4CFBA 4CZGA 3IFRA 1GLBG 5KPZA 2NNWA 3ZT2A 3AARA 4CJPA 1NK4A 5SZTA 2Q31A 4JKGB 4WQ5C 2VQFK 1RCHA 1NJWA 1YF5L 4WFNL 2P1JA 2O8EA 3CXCM 3QNNA 2OA8A 3K2PA 1KSPA 3MN6A 3CC2N 1Z6RA 3CJAA 3F9MA 5J1EA 1B9DA 5EX5A 1NGFA 1XWLA 3TSQA 2VGNA 1FKPA 1IJJA 2P9SA 3E1YA 3CJ9A 2D5RA 3ENBA 3ULDA 2Q0UA 1M90O 3EZ5A 1XMOK 1N33K 3DLEA 1YUWA 4I2QA 2JGUA 4AILC 4KPYA 4CIGA 4E1JA 2VQEK 1Q7YO 2HMIA 3CF5L 4E19A 3G4SN 3WNFA 1CXUA 5KPTA 4DCHA 4OJRA 1BWFO 2OCEA 2P9NB 2VWJA 3K5NA 1KD1O 3CCJN 3TAGA 2GTDA 2A1RA 2HF3A 2F96A 4JHDA 3C7NA 3H6EA 3K5MA 4BC2A 3M8PA 4WCEL 2YJFA 2QKKA 3F9KA 3ATUA 1IBMK 3QESA 2BE2A 4DSEA 1BIUA 1U2VB 4CFCA 4FOIA 4CFDA 4DMNA 2R7YA 5AZJB 3HJFA 1IKWA 1N6QA 1Y97A 4FLTA 3DOKA 3JAMO 3KK2A 2GV9A 2DY4A 2W6LA 1KAXA 1SL1A 4A59A 4BRQA 1NMDA 3DLHA 4LF7K 3VGMA 3F5TA 4CK1A 4X64K 1CZ9A 3MEDA 3O4WA 4B08A 1GLEG 1TK8A 1MA9B 4DTSA 4B9TA 4RWTA 3LALA 3OYIA 3KKSA 3VN5A 1BQMA 4BR4A 3MX2A 4PKGA 5EOYA 4F2RA 2FC0A 2A1SA 3V4IA 3AVJA 1GOBA 4DG1A 3TARA 3PSIA 4CZHA 3VA3A 2P9KB 2IGIA 3OJSA 3PUFA 2O8CA 3NH0A 4IO8A 3J7ZO 4KTQA 4LFAK 4A5AA 3OA9A 5AQXA 4FZZA 5J2PA 4FWMA 5GAEP 3FR0A 5AR0A 1RT5A 4FJ7A 3AVCA 3VEWA 1HRHA 5BRDA 4XEIA 4O8KA 4NCGA 5C2FA 2P9IB 3LL3A 2O8FA 4N41A 3ZYYX 3CCLN 3DRPA 4IEEA 1W97L 4CHNA 3O3FA 1L3TA 2ZJPL 3DLBA 3FZLA 2NLXA 3ID6A 3MN7A 4CF9A 3SNNA 4BWJA 4CI6A 3OYGA 3HVTA 1KXPA 1P90A 4B8CA 4CEZA 4DQPA 3ULEA 4DF4A 1HMVA 5AQTA 4U67L 1Y64A 5I9EB 3LP3A 1ASWA 3PO5A 3IMXA 1Z25A 4IWVA 4CHQA 3MCAB 4JI7K 3TPQA 2F9TA 4E3SA 3AV9A 1LWCA 4EIAA 1K73O 1VK0A 1B92A 3LDLA 1U49A 2AJQA 3WXMB 3UKRA 4F2SA 3SPYA 4BE2A 4CHPA 3CFOA 1VQON 1NK7A 3HBTA 4WQ5A 3ZSOA 3O8MA 3AAQA 5FDLA 1NGHA 4DU4A 4XH4A 3QINA 3GOIA 4BWMA 4J8FA 3OYJA 1XC9A 5BPNA 4QS8A 1XUPO 2E1YA 3CFRA 4N76A 4YOWA 4W5NA 3OS1A 2KQ2A 2YV0X 3W0LA 4GV6A 3KLFA 3AA5X 3PIPL 4HUEA 4B3RK 4B3OA 2ZQBA 2KTQA 4DV7K 4DUZK 4Y1DA 2YKNA 2QTDA 5AQQA 2CGKA 1OH6A 5EXWA 4JKCA 4B1ZA 1X9JA 4WQ4A 4BR5A 3BZCA 3P83D 1YVUA 4GY2B 3O3GA 4IEIA 4IZ9A 3K9JA 4FWSA 3SUPA 2YI1A 2EHGA 4DQ8A 4XH1A 4CF0A 4BRAA 2P5OA 3OBYA 1FJGK 1BDGA 1L3VA 2HBLA 3U9DA 3THXB 1YIJN 4BR0A 1LWEA 3I8DA 3AVKA 3SUNA 4NO7A 4Z94A 4MFBA 3TR8A 4YOXA 1WBBA 2AP1A 3THWB 4LSLA 2J4RA 3O9RA 4IFEA 5BR9A 4ILHA 4A5BA 4JI8K 3CJ7A 2O4IA 3M3ZA 1HNZK 1NNEA 3VEOA 4OVLA 4CGFA 1NGDA 5B8HA 1JLQA 3KD5E 3DMJA 3K0SA 2YHAA 2ZJQL 4RW7A 4ELVA 4CJVA 4H5VA 5JS1A 3A0IX 1FW6A 3MXIA 3AVNA 3FGUA 4DR1K 2FLOA 1GLAG 2AA4A 4U7BA 3VGKA 3FLCO 4PKIA 2DFFA 4J2BA 3K58A 1WOQA 3LDOA 3O4QA 1Q8IA 4H0OA 4JAXA 2UUAK 5C24A 4O0IA 4LH4A 4F9OA 2HHTA 2G8HA 1XQSC 5AQMA 3OYFA 2F9WA 2VCPA 3HZ6A 1O1WA 2BTFA 2RF2A 1F21A 3TTDA 1JL1A 4N56A 4IOXA 4FLVA 4FK4A 2Z1JA 1GLJO 3ZLJA 3QB0A 2P5GA 2EWSA 3QIPA 1VQ5N 1X9SA 1VSFA 1QQCA 4BREA 2D1KA 5AQRA 2UUCK 1QQOA 3CETA 1P8ZA 1NJYA 3VGLA 4CZFA 3RR8A 4BACA 5HOOA 3SYZA 5CHIA 4PY5A 3E9PA 1RT3A 4A61A 5FRNA 2X78A 4YHHK 3UB5A 1S6PA 3MN5A 1ATNA 2F8TA 2IDOA 3ZEUA 1B9FA 3W3DA 3CM5A 1ZXOA 2VWBA 4IDHA 2XY7A 3AA3A 4BGAA 5JS2A 4E1NA 1ZYQA 1E4GT 2FBTA 3S3NA 4AHTA 2XY8A 1I3AA 1CLQA 1C1BA 1WSHA 4CGHA 4C1NI 2IAJA 2BANA 3G10A 5LJVA 3T1AA 4BRPA 1NJIO 3SQ4A 4UQGA 4DR4K 5FPNA 4I6MB 4CIFA 2WTUA 1OH5A 3HVRA 5BN9A 3TI0A 4O4GA 2ETJA 4JI1K 5F1XA 4C23A 2GWJA 2QXLA 1N34K 3GE1A 3CPWM 4ISGA 3SQ1A 4B9NA 2Y1IA 3THYA 4JYAK 1RILA 2ZJRL 3C0BA 3PY8A 1JXBA 1BO5O 5AQOA 1RBUA 1QSSA 4J2DA 1SQKA 3P4IA 4ZTFA 4EZ6A 4L8RB 5HLFA 2YNHA 3EKUA 1UWBA 1VAZA 4DFPA 1NJXA 3KTQA 1JLAA 4JI0K 2IVNA 4YOUA 3K57A 3SJHA 4C1NK 4PHTX 4ICLA 3AVLA 1RTJA 2RE2A 3OYLA 3VERA 3THXA 1A5XA 4DB3A 4K8XA 4KTWA 2A5XA 3HK2A 4CE9A 3TWHA 4HUFA 3HOSA 4DQIA 4QAGA 1Z26A 2QI2A 3KLGA 2IVPA 2YCHA 1BU6O 2PBDA 1T6DA 4FK2A 5J2QA 4EP4A 3E01A 2YHXA 1IV0A 4CHOA 4FM0A 1NGGA 2NRZA 3NVKA 5AQIA 1WSGA 2X74A 4BDPA 1JL2A 4J2EA 1ILYA 4CFAA 1X1PA 4DU1A 4JHDB 4A62A 3OYKA 3C7NB 2DTUA 1HYVA 3JYTA 4BRFA 4CJSA 4CZEA 1RDUA 4YOYA 3SMSA 4Z0UA 4AHRA 5M1KA 3CCVN 1VSEA 3AVAA 3LM9A 4E7JA 3QEWA 4F3TA 1BOTO 3V9WA 1IG9A 3OS2A 4LFCK 2QKBA 3FFKB 3ZSRA 2FBXA 3DAWA 2YNGA 2ZWHA 3DXKB 3SUOA 4ZTJA 5LMUK 3TTCA 4TSXA 4EHUA 2WC9A 1VQ8N 3DXMB 1D9FA 3UKUA 4BDZA 3CYMA 3VQ7A 4CK2A 3SAFA 1RDCA 4JLHA 1MWKA 2FF6A 4DLGA 1HJOA 4CJKA 1UA1A 3VQEA 1IKXA 4M3YA 5AQLA 1RBRA 4XH5A 3C6UA 3PX6A 1WNSA 4QS9A 4JN4A 4FJXA 4EHTA 4M3RA 3RSEB 4FOEA 1TK5A 1U45A 4E89A 4PL7A 4OPJA 3EE9A 3TAFA 5AQNA 1ZC6A 4LF6K 3MXMA 1TK0A 3OYCA 4FJIA 3FZMA 3ISNC 4M7YA 2O8FB 1KRPA 2BDPA 4CESA 3HSTB 2KHOA 2YJEA 4DHYA 3TABA 4CEBA 2OZMA 4M42A 5BRFA 3H46O 2ZM6K 2VYPA 1ATRA 3A2FA 2V7ZA 4CBWA 3ULEB 3NGZA 1VQKN 2HNZA 4KHQA 4DKWA 1KC8O 3D2FB 5CZ2A 5AQSA 4B1VA 3CMAN 4FWQA 4UY8O 3C94A 3CI5A 4LF8K 3TAPA 4FWOA 2F8SA 4O55A 3LPUA 5K14A 4CF1A 3KZBA 3UKRB 3L3UA 4RG8A 3QEVA 1SKSA 4CJUA 2A3ZA 4IFVA 4DSJA 4BY9C 2QK9A 4GVMA 2IVOA 2X6SA 4KI6A 3QNOA 1BGXT 2A41A 2Z1HA 1IO2A 3S3MA 1Q9XA 3WXKA 4KO0A 5CR4A 3E9LA 3Q7BA 3RRGA 3KK3A 4CCHA 5HBMA 3L6QA 3V1QA 3VETA 1BA0A 2YNIA 3K59A 3QDKA 3EY1A 5GAGP 4KKOA 4M7XA 4BC4A 1D5AA 4CZKA 2HHWA 2PZSA 2HHVA 5C12A 4AH9A 3OYHA 5BPLA 2IOCA 1BI4A 4CEEA 4W5TA 1VHXA 4DTPA 5E26A 3J7YP 1D8YA 4LSNA 4WQ4C 3RTVA 3VA0A 1RT2A 3SLCA 4B8AB 2I7NA 1NKCA 4CF2A 3FZHA 1JJ2M 1HKGA 4KHNA 4H0XB 5CYQA 4AHSA 1VSLA 1KFDA 3MCPA 2P9LA 1T05A 3KVGA 4FJMA 2Q2RA 3KIOA 1T6CA 1NK8A 4A57A 3ATVA 4DU3A 4CGDA 4DS4A 1MWMA 2RHKA 4FLWA 2VG5A 4RW9A 3V1RA 3O9QA 4H5TA 4FVMA 5EVZA 3RMAA 1RDDA 1DKGD 4FWPA 2W6KA 3VQQA 4BR9A 3R9PA 2JWLA 4NLBA 4IG3A 2OPPA 3J81O 1RFQA 2IC3A 5AQZA 2BH1A 1ZBIA 4KB1A 2ZF5O 1X9MA 4B1WB 4YFUA 4KB0A 3DXKA 3NGIA 1FXXA 1RDBA 1C0UA 3T7ZA 3DXMA 4WF9L 4DQSA 4XIUA 4GV3A 2XHBA 1T03A 4C8KA 4DTRA 3MN9A 3TSUA 5IWAK 3PIOL 1NGAA 4Q5VA 2ZE2A 3LDQA 3HPHA 4CGGA 2G8IA 4Z4GA 3T69A 1XC3A 1KAZA 1XMQK 3AVIA 3NDKA 4B3TK 3VEYA 4BRHA 3HP6A 2WFBA 4C8OA 1K6YA 3AO2A 3CPEA 1YXQA 3S41A 3RSEA 5M1NA 1TUYA 1EKEA 2YNFA 3HPGA 3JS6A 3VQ6A 4HWIA 3S3OA 3WEEA 1DTTA 2HMPA 3ENOA 1GLLO 4FJ8A 4N5SA 2Q0RA 4M41A 4JI6K 1K9MO 3CCUN 3P31A 4ISEA 4MDBA 4LH5A 1S22A 4KI4A 1J54A 5C0YA 3TSPA 4OLBA 4DSIA 3ZEUB 4JI3K 4FJ9A 2O8BB 1QQNA 3AO1A 3D2FA 2XRIA 1HUXA 4FL9A 1XI1A 1HPZA 2BGGA 3VQAA 1YJWN 3IDHA 4FXDA 1S3XA 3ENHA 4YOTA 4CZMA 3G0ZA 3OYMA 4DUYK 3CC4N 5AJ3K 2Q1NA 3QERA 5JVGL 3WQUA 3EYZA 3H45C 4CJWA 1TV6A 4OKJA 1VSJA 1ZBLA 4FJ5A 1L3UA 5CYMA 4CZJA 1SL0A 3U3YA 4KH5A 3P1GA 1BCMA 1TL1A 4DQRA 5TKWA 1FKOA 5AZIA 3VQ5A 3IKMA 3D2EA 4B9QA 1WB9A 5ADXA 3VQ8A 3AO5A 1S1TA 3U9ZA 3ZX3A 4GV9A 4IBNA 3THYB 3L0QA 5I3UA 3HYFA 3I33A 3KLIA 1QHAA 3NFAA 4GVEA 1C1AA 2KZMA 1QZ5A 2CH6A 3L2UA 1BCOA 4I2PA 1I94K 4BR7A 3BGRA 5GADP 2ZGYA 1JCGA 3MEEA 5EY4A 1W0HA 3HRGA 5AQVA 3CJCA 2XO7A 3BY5A 4OLAA 2Y1JA 4LC9B 2ITMA 4PA1A 2YKMA 3G25A 3VTHA 3NCIA 1EP4A 1WAJA 3TTFA 3ZETA 4EFHA 5C42A 3MK6A 3CG7A 5TKYA 3OVNA 4ILGB 1XNQK 4GKJK 2KKZA 1VSIA 2IS3A 3HP9A 1HNIA 2QWLA 2P9PB 1U6ZA 4ISFA 3P38A 4DLEA 3TAEA 1JLFA 2NRWA 5H1SQ 4FWKA 1JCFA 4Z4IA 1ASVA 4JI4K 2D0AA 4HCCA 3M8RA 4BRGA 1G99A 4K0KK 3CC7N 5HRPA 1GLDG 4CD1A 3RMCA 1D4XA 3HT3A 3FFIA 3F2KA 2XY6A 5AQPA 4ID1A 3KWIA 4M3UA 3VEZA 4DTNA 3HO1A 2GUPA 3VQCA 1N32K 1VQ9N 5FPEA 1SZ2A 4LY7A 3P39A 3O5BA 3WXLA 4KH6A 4K43A 4K41A 1ZBHA 3JSMA 3TAMA 4FM1A 1IKVA 1JCEA 1VRTA 4DTOA 4E1MA 4JKDA 3A8YA 5AFUH 1N5YA 3IG1A 3LAKA 3UKUB 3SQ2A 4KAZA 3HM8A 2QWQA 1E4FT 4OGEA 3LP0A 2B4JA 4R79A 3L2VA 4FWNA 4CJTA 1ATSA 3OYNA 1YHQN 4NLCA 1RDAA 3O9SA 3VQ9A 4OO1J 3V9ZA 2FBYA 1R59O 3NGYA 2FSKA 3G6EN 3GL1A 4EP5A 3DLLL 2NZTA 2A40A 1YJ9N 1KTQA 2HVIA 4KH4A 3WNGA 3ZSWA 3ZCMA 4PWDA 1EO1A 4AHCA 1W7AA 1X9WA 5KI6A 4B1UB 3J7AP 2G8VA 3RR7A 2O8BA 4LF4K 5F2RA 3UIQA 3EEQA 3MECA 3ZT0A 4CHZA 4RW6A 1QHTA 4JD2A 2QW9A 2I7PA 3KWGA 4AM7A 1DT9A 1KVCA 3CD6N 3H3NO 4BRCA 3NMUA 4K25A 3K5OA 1HJRA 2UXCK 3EO3A 3D6RA 1NU0A 4BRMA 3I56N 3SZ2A 4C8LA 1S1UA 1RT6A 2ZGZA 4DV6K 3VQPA 1O13A 3DWLA 3ZT4A 2RKIA 4GMJB 2E88A 4E7HA 2D4WA 3ZSVA 4AM6A 1OH8A 4DR2K 1BA1A 1A5VA 1VSKA 3SK3A 3NF6A 1NLVA 2NRTA 4PL8A 2VG6A 2PYLA 2E6LA 2X6NA 4FCYA 3L4IA 3LWLA 3CJ1A 3NH2A 3SI6A 1VRUA 3F73A 4M45A 2B5JA 4YORA 2DFEA 3ZT1A 2WUSA 3LDSA 2GELA 1RTDA 5FRMA 2E20A 4JS4A 3AA2A 3VQ4A 3EE8A 4CJ7A 2GBZA 2QWPA 3NF9A 4HVJA 3AVMA 5HP1A 1QTMA 1J5OA 4MDAA 3HTVA 1DLOA 1JLGA 3QMLA 3VF4A 4QCLA 4DFMA 3BEXA 3SBTA 3ASMA 3I8BA 5LL6Z 4JRQA 1BI4B 1X3NA 2CGJA 1JKHA 4IO9L 3DLKA 3SJJA 2NRVA 4HCBA 4DR7K 3WT0A 2P9PA 3RVCA 4KBOA 2Q97A 3A5MC 1YT3A 2E8AA 4H8KA 2P9LB 2Q36A 1BG3A 3IAYA 4E7LA 4CEFA 4NXMK 3SAHA 1LAVA 3H3OB 4OGCA 3O6WA 3PV8A 1C6VA 2HNDA 3LPTA 3CIPA 4IG0A 3VOVA 4CJ3A 3WXJA 1WN7A 4ID5A 4JKHA 1NGCA 3DYAA 3LANA 3VMFB 3CQXA 1N36K 4H0PA 4JKBA 4CJLA 3H1VX 5AQUA 4JK8A 2OPSA 2NRHA 4ILJA 1KFSA 4QOZB 4Z4CA 1NGIA 3R3LA 4GNIA 5HRRA 4CEDA 3K5LA 3B6PA 4BQLA 4V19S 2KW4A 3MMVA 2HVHA 3T1YK 3TU5A 1U4BA 3B6OA 3OY9A 1TYQB 4R5PA 1NK9A 2HBJA 3M1FA 3CCQN 3JXUA 2HHSA 1RT7A 1ZBFA 3BZKA 4JI5K 3OJUA 1TKDA 2DPNA 2G8KA 5HROA 1RBVA 1JLBA 4B3SK 4G1QA 3PSFA 4JRPA 5JICA 1C0GA 1KCFA 4DFKA 1NK5A 1U48A 4WFAL 3SPZA 1GOAA 2HNYA 4C8NA 4MO5A 4DV0K 1ITGA 1GLCG 2V52B 5CE3A 3CQ8A 4DR3K 4GW6A 4IDKA 2JWKA 3O1BA 1UOCA 4M3WA 1VQMN 2PAVA 5BPMA 4CHYA 2GWKA 3LP2A 3M5RA 1S1WA 3LWMA 5CY4A 3WEEB 1RTIA 4H0YB 3VEXA 5FLXO 4NYFA 4DSKA 1HYSA 2FF3B 2FXUA 4Y0WA 1RBSA 3ALYA 3B8AX 3DRSA 3H08A 4B3MK 4YDUA 3ITHA 3CCSN 5KTQA 1SS6A 5KQ8A 2KFNA 3DLGA 4A2AA 1BHLA 4NCAA 1VQLN 1OVYA 1ZBUA 4CJEA 3CCMN 1RGIA 5EU7A 2UUBK 2UXBK 1DGKN 3AO3A 3QBWA 2Z1GA 4PKHA 2Z1IA 3QO9A 3MX5A 2HF4A 3VF2A 3OYBA 4EZ9A 3KK1A 4FLZA 3TANA 3NF8A 1EWQA 5AQWA 1TVRA 4F3OA 5KGXA 3SAGA 3SQ0A 5BRHA 4YY3K 1J6ZA 2QWMA 4NYNA 4BRLA 3RMDA 4H5RA 1HX1A 1REVA 4E7IA 4PQUA 5FPMA 4OPKA 1QZ6A 5M1QA 2OZSA 1SAZA 4JEPA 5KQDA 4DTUA 5AZIB 3D2EB 2E6MA 2E2QA 1LCUA 1HNWK 2HHXA 1TAUA 3J80O 4O8UA 3VQBA 1RNHA 4DV1K 4O0JA 3MDQA 4KV8A 5AQHA 1J53A 3U6FA 1S72N 3CMEN 2D0BA 3C6TA 3ZSQA 3KKRA 2HSTA 4M3XA 2YHYA 1J9AA 3FZFA 1N8RO 4B9LA 1NKBA 3R8EA 3ZETB 1LW0A 3TAQA 4DTJA 4FJJA 1MDUB 3CM6A 5J2MA 1VQPN 3CFPA 3E9OA 3RRHA 3WNHA 3IRXA 1EX4A 2G8UA 3MWPA 1J5EK 5BN8A 3NAEA 4X65K 4M63C 3LP1A 1Q82O 4M3ZA 5M1OA 4N47A 1H1VA 1RDWX 1C0TA 4DSLA 1NGEA 1C0FA 3A5NC 2HB5A 4CJQA 4B1XB 5HRSA 1NKEA 5LJWA 1WLJA 4MO4A 3ZX2A 1NWKA 3S9HA 5F0XA 1TYQA 5HRNA 4BG9A 3QBXA 4I7FA 1VSHA 5JMVA 4JKFA 5LMNK 1TL3A 5BREA 4OKEA 2HBKA 1LV5A 2YHWA 1HNVA 1R0AA 1V4SA 4RW4A 1SKRA 3EZWA 3O4NA 2PFUA 3UE5A 4CJRA 3RMBA 2CH5A 3I0RA 4FZYA 4H4MA 3EKSA 3LDPA 4RTFD 1YI2N 3VEVA 4A2BA 3OS0A 4JKAA 3VQDA 1NJZA 4PUOA 4CIEA 4JK7A 4DR5K 3ZX0A 3C6AA 2O8DA 4CZLA 3D7EO 3IS9A 1HNXK 3MEGA 5A2QO 2OPRA 2WOMA 4MQ3A 5SWMA 5T7BA 5DM7L 3BF1A 4E7KA 4EAHD 2G8WA 4B9UA 4DTMA 4NB4A 4CVNE 3DRRA 3I55N 4DQQA 5KPRA 3WQTA 4FWLA 5ADXH 4FM2A 1BUPA 2ASPA 5CZ1A 4L3QA 3H1QA 1NGJA 4B1YB 4JD2B 4CW7B 1T44A 4DF8A 3CERA 4AHVA 3SUQA 2LSNA 3CCEN 1QE1A 3DM2A 4BRIA 3NF7A 1JLCA 1W2BM 2P9UA 3L2QA 3VTIA 1U47A 3A5LC 2CGLA 4IKFA 3OYDA 3O80A 2UXDK 2VWKA 4LF5K 3OTOK 3KHYA 5J2NA 4BG8A 3PX0A 5E84A 3HOTA 2QA4N 4FJKA 1UAXA 3BDPA 3LAMA 1NBWA 5JLHA 3T3FA 1SL2A 2I5JA 3QEPA 3ID8A 4WE1A 3QFUA 1BL3A 2WONA 5MLCQ 1WAFA 4JKGA 5KRSA 4FVUA 1NM1A 4CJ5A 2D0PA 1ESVA 3KD1E 2GEMA 3U4LA 3SBGA 4AQYK 3AO4A 1S5JA 3L8BA 1WSIA 3AY9A 3R1XA 3SV3A 3DI6A 4Z4EA 2GX9A 4DR6K 1RTHA 1IBKK 2VG7A 1QSYA 1K8KB 2D0OA 1KVBA 1WUAA 3EN9A 4OPHA 3WUHA 2NRRA 2HBMA 1HKCA 1KAYA 4BRKA 2D0CA 3C65A 4CJ4A 1OKJA 1S1XA 3VENA 1Q81O 3ZSZA 2OTJN 4I9QA 4B9MA 4X62K 4BE1A 1VQNN 1OH7A 1TKTA 3FE1A 2W42A 4FJGA 1TKXA 3MWTA 1EWRA 2QWOA 1RBTA 1NK0A 3BP8A 3O1WA 1TUUA 3NHGA 2P9NA 2PYJA 5M1FA 3V1OA 5BR8K 4CZIA 4BROA 3PO4A 4JV5K 3ZSYA 1LAWA 5HL7L 4JS5A 1HKBA 3OW2M 2P51A 4W5QA 4BGBA 2UYTA 3PX4A 4FLYA 3L2RA 4G9ZA 3PLAA 3VESA 1TGOA 3QIOA 4YNQA 2E2OA 4W5OA 4O44A 3AGKA 4H0VB 3O3HA 3N4PA 2HHHK 1T8EA 4KREA 1G15A 3G71N 4BR2A 2HOEA 3VF6A 1U2VA 2V7YA 1C1CA
chains in the Genus database with same CATH topology
4DR7K 4B3MK 5IWAK 4X65K 4DV4K 4LF9K 2UXDK 1I94K 4LF5K 3OTOK 4NXNK 4NXMK 1XMQK 4X66K 1XMOK 2UUBK 4JI8K 2UXBK 4B3TK 1N33K 1HNZK 4LFCK 3J7AP 4LFBK 2UU9K 2VQEK 4DR4K 1HR0K 5LMUK 1IBLK 4LF4K 1XNQK 4GKJK 4JI1K 5LMNK 4AQYK 1N36K 4JI2K 1N34K 4YY3K 4DR6K 4JI7K 1IBKK 4DR1K 4JI6K 2UXCK 3J7YP 4JYAK 4JI4K 2UUAK 4DV6K 4K0KK 4JI3K 4V19S 4DR5K 1HNWK 1IBMK 3T1YK 4KHPK 3J80O 4X62K 4DR2K 4DV1K 1HNXK 5A2QO 2E5LK 4JI5K 4JI0K 4LF6K 1XNRK 3JAMO 4DV3K 4DV2K 4B3SK 1N32K 4DUYK 5AJ3K 4CVNE 4LF7K 2UUCK 4X64K 4DV0K 3T1HK 4B3RK 2ZM6K 4DV7K 4DR3K 5BR8K 4DUZK 3J81O 4JV5K 2VQFK 4YHHK 4DV5K 2F4VK 5LL6Z 4CW7B 5FLXO 2HHHK 4GKKK 4LF8K 4LFAK 5IT9O 4OX9K 1FJGK 1J5EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 K;  4B3M K;  5IWA K;  4X65 K;  4DV4 K;  4LF9 K;  2UXD K;  1I94 K;  4LF5 K;  3OTO K;  4NXN K;  4NXM K;  1XMQ K;  4X66 K;  1XMO K;  2UUB K;  4JI8 K;  2UXB K;  4B3T K;  1N33 K;  1HNZ K;  4LFC K;  3J7A P;  4LFB K;  2UU9 K;  2VQE K;  4DR4 K;  1HR0 K;  5LMU K;  1IBL K;  4LF4 K;  1XNQ K;  4GKJ K;  4JI1 K;  5LMN K;  4AQY K;  1N36 K;  4JI2 K;  1N34 K;  4YY3 K;  4DR6 K;  4JI7 K;  1IBK K;  4DR1 K;  4JI6 K;  2UXC K;  3J7Y P;  4JYA K;  4JI4 K;  2UUA K;  4DV6 K;  4K0K K;  4JI3 K;  4V19 S;  4DR5 K;  1HNW K;  1IBM K;  3T1Y K;  4KHP K;  3J80 O;  4X62 K;  4DR2 K;  4DV1 K;  1HNX K;  5A2Q O;  2E5L K;  4JI5 K;  4JI0 K;  4LF6 K;  1XNR K;  3JAM O;  4DV3 K;  4DV2 K;  4B3S K;  1N32 K;  4DUY K;  5AJ3 K;  4CVN E;  4LF7 K;  2UUC K;  4X64 K;  4DV0 K;  3T1H K;  4B3R K;  2ZM6 K;  4DV7 K;  4DR3 K;  5BR8 K;  4DUZ K;  3J81 O;  4JV5 K;  2VQF K;  4YHH K;  4DV5 K;  2F4V K;  5LL6 Z;  4CW7 B;  5FLX O;  2HHH K;  4GKK K;  4LF8 K;  4LFA K;  5IT9 O;  4OX9 K;  1FJG K;  1J5E K; 
#chains in the Genus database with same CATH topology
 3WXI A;  3V9U A;  3AVB A;  4LD0 A;  2FBV A;  3M6G A;  3QEX A;  5AZJ A;  2RN2 A;  1KLN A;  4RW8 A;  2ASO A;  2GUI A;  4CGI A;  4IXC A;  2G8F A;  1T3V A;  2A6A A;  1S1V A;  4FPB A;  3N4Q A;  4NXN K;  5C2D A;  4DS5 A;  4FPA A;  1VSD A;  1RT4 A;  4KFB A;  1VQ4 N;  1GLF O;  2UU9 K;  3O9U A;  2HHU A;  1Q18 A;  5C15 A;  2E4L A;  2ZD1 A;  3U3G A;  3O08 A;  4H4O A;  3QLH A;  2A42 A;  5JVH L;  2B6A A;  4CD3 A;  1CZA N;  3OHR A;  2P9K A;  4WYB A;  1W9H A;  1S9E A;  4JK9 A;  3AVH A;  2Q3S A;  1U04 A;  3R6M A;  1Q86 O;  1YIT N;  3AGR A;  1BIS A;  5GIP A;  5GIO A;  4JKE A;  2KZZ A;  4CF8 A;  2P9I A;  1E3M A;  4FO0 A;  4MLE A;  4FJN A;  4K42 A;  2VGM A;  2ASM A;  1IKY A;  1C0M A;  3LDN A;  3D45 A;  1GOC A;  4YDU C;  5C10 A;  1LWF A;  3KJV A;  4F8R A;  3QEI A;  4FYD A;  1JLE A;  4CBX A;  1NOZ A;  4IOC L;  1YTA A;  1NK6 A;  4CK3 A;  4DV3 K;  1LW2 A;  1S9G A;  5KGW A;  4RCH A;  1HPM A;  4FW2 A;  1I39 A;  5M1P A;  4ELT A;  4AHU A;  4FZX C;  3ZSX A;  5AFU A;  3D0P A;  5DMR A;  1KLM A;  3U8X A;  3THV A;  3KK7 A;  1HYZ A;  1HQE A;  1RT1 A;  2ATQ A;  1QS4 A;  4KTZ A;  5AQJ A;  4DV5 K;  1V4T A;  3RWU A;  1ZBS A;  1EXQ A;  1YAG A;  3C95 A;  4FSV A;  4O5B A;  4BRD A;  4FJH A;  4GKK K;  1SUQ A;  1SKW A;  4CEO A;  1JXE A;  1M1K O;  1NG9 A;  1WBD A;  4FLU A;  3V6D A;  4E0D A;  2W40 A;  3AAP A;  1WSE A;  4KRF A;  1K8K A;  4LF9 K;  1HQU A;  4H03 B;  4FW1 A;  1QVF M;  1ASU A;  3QIC A;  2H3G X;  1NGB A;  3L3V A;  3IUC A;  4BVP A;  1QVG M;  2O8E B;  3GDQ A;  1VSM A;  4FJL A;  2JLE A;  4CEQ A;  4IFY A;  1EET A;  3OYE A;  2HW3 A;  4F4K A;  3A5O C;  4H5N A;  5JLF A;  1XHX A;  2KFZ A;  5KRT A;  4B9V A;  2W41 A;  1QQM A;  4J2A A;  5C25 A;  1TKZ A;  2IIR A;  3WNE A;  4Q0B A;  2P9S B;  4OPA A;  2QWR A;  1EQY A;  2YX6 A;  4IJN A;  1YJN N;  3C6H A;  5AQG A;  4C8M A;  2ITG A;  1TAQ A;  3J8A A;  2E1Z A;  2KLA A;  3NBP A;  3VPZ A;  3BF3 A;  1XHZ A;  2O4G A;  3BUZ B;  4B9S A;  4O5F A;  1VQ7 N;  4H5W A;  2BUP A;  2YHB A;  4NCB A;  2WBN A;  4CER A;  2OPQ A;  2RPI A;  3THW A;  2E2P A;  3EL2 A;  1S6Q A;  3AA4 A;  5D3G A;  1WSJ A;  4CBU A;  3V9X A;  4DWI A;  2PY5 A;  4KHU A;  3M8S A;  5E41 A;  5AQY A;  4BRN A;  2QEX N;  3NE6 A;  3CHW A;  3CJB A;  1SV5 A;  4MLH A;  4FK0 A;  1HLU A;  3SCX A;  4JNE A;  4HHT A;  4QS7 A;  2OYQ A;  3HSC A;  4KHS A;  1IH7 A;  3DLR A;  3CQY A;  4ZHR A;  1YTU A;  1VQ6 N;  5DK5 A;  3T1H K;  1KVA A;  1QSL A;  1FK9 A;  2NRX A;  3NVM A;  3O9T A;  4BVO A;  3KLH A;  2OTL N;  2NUB A;  1K8A O;  2DFH A;  2F4V K;  5ELZ A;  1OVQ A;  2OAN A;  5I42 A;  1L3S A;  3ZT3 A;  5LY3 A;  2QM1 A;  3HPO A;  1BIZ A;  3SV4 A;  5AQF A;  5IT9 O;  4OX9 K;  2QWN A;  1NMN A;  1IG8 A;  4KHY A;  4Z4H A;  4M3T A;  4IJA A;  4DV4 K;  2V51 B;  2QXF A;  3CCR N;  4OKK A;  4DTX A;  3DJC A;  3LM2 A;  1Z05 A;  4HTL A;  3HI0 A;  3KLE A;  3P5J A;  4AF1 A;  4BE0 A;  3AVF A;  2XY5 A;  4FLX A;  3NH1 A;  2O8D B;  1LOT B;  3I0S A;  4X66 K;  3V81 A;  3V9S A;  1YVN A;  4LFB K;  4CEC A;  5DM6 L;  1HR0 K;  4BDY A;  1IBL K;  4ELU A;  2O8C B;  1NOY A;  4CEA A;  4Y1C A;  5FRO A;  5AQK A;  4CJF A;  1D9D A;  1KQS M;  4JI2 K;  2E2N A;  3HL8 A;  3L2W A;  1CXQ A;  4HUG A;  3E66 A;  5GAH P;  3OYA A;  1A5W A;  3T19 A;  3L4Q A;  3DOL A;  3M8Q A;  1MU2 A;  3QFP A;  1BQN A;  1DEJ A;  4YOV A;  4Z4F A;  4W5R A;  4WFB L;  3FZK A;  3SMP A;  4CGJ A;  3QET A;  5GIN A;  3K9K A;  1Q9Y A;  4KHW A;  4H0T B;  3OBW A;  2F7T A;  4FWR A;  1X3M A;  3LZI A;  4HTU A;  4KHP K;  1T7P A;  4BC5 A;  3MAQ A;  2HHQ A;  2E5L K;  2P9U B;  3GBT A;  3HXM A;  4IOA L;  1WSF A;  4DFJ A;  1CZB A;  5FPD A;  1XNR K;  3HM9 A;  2FSJ A;  4BC3 A;  3MXJ A;  1L5U A;  3LZJ A;  2EX3 A;  4DV2 K;  3AVG A;  1UA0 A;  4I6M A;  3Q7C A;  2FSN A;  4DSF A;  4K8Z A;  4BQZ A;  1DTQ A;  3GG4 A;  4I9L A;  4CFB A;  4CZG A;  3IFR A;  1GLB G;  5KPZ A;  2NNW A;  3ZT2 A;  3AAR A;  4CJP A;  1NK4 A;  5SZT A;  2Q31 A;  4JKG B;  4WQ5 C;  2VQF K;  1RCH A;  1NJW A;  1YF5 L;  4WFN L;  2P1J A;  2O8E A;  3CXC M;  3QNN A;  2OA8 A;  3K2P A;  1KSP A;  3MN6 A;  3CC2 N;  1Z6R A;  3CJA A;  3F9M A;  5J1E A;  1B9D A;  5EX5 A;  1NGF A;  1XWL A;  3TSQ A;  2VGN A;  1FKP A;  1IJJ A;  2P9S A;  3E1Y A;  3CJ9 A;  2D5R A;  3ENB A;  3ULD A;  2Q0U A;  1M90 O;  3EZ5 A;  1XMO K;  1N33 K;  3DLE A;  1YUW A;  4I2Q A;  2JGU A;  4AIL C;  4KPY A;  4CIG A;  4E1J A;  2VQE K;  1Q7Y O;  2HMI A;  3CF5 L;  4E19 A;  3G4S N;  3WNF A;  1CXU A;  5KPT A;  4DCH A;  4OJR A;  1BWF O;  2OCE A;  2P9N B;  2VWJ A;  3K5N A;  1KD1 O;  3CCJ N;  3TAG A;  2GTD A;  2A1R A;  2HF3 A;  2F96 A;  4JHD A;  3C7N A;  3H6E A;  3K5M A;  4BC2 A;  3M8P A;  4WCE L;  2YJF A;  2QKK A;  3F9K A;  3ATU A;  1IBM K;  3QES A;  2BE2 A;  4DSE A;  1BIU A;  1U2V B;  4CFC A;  4FOI A;  4CFD A;  4DMN A;  2R7Y A;  5AZJ B;  3HJF A;  1IKW A;  1N6Q A;  1Y97 A;  4FLT A;  3DOK A;  3JAM O;  3KK2 A;  2GV9 A;  2DY4 A;  2W6L A;  1KAX A;  1SL1 A;  4A59 A;  4BRQ A;  1NMD A;  3DLH A;  4LF7 K;  3VGM A;  3F5T A;  4CK1 A;  4X64 K;  1CZ9 A;  3MED A;  3O4W A;  4B08 A;  1GLE G;  1TK8 A;  1MA9 B;  4DTS A;  4B9T A;  4RWT A;  3LAL A;  3OYI A;  3KKS A;  3VN5 A;  1BQM A;  4BR4 A;  3MX2 A;  4PKG A;  5EOY A;  4F2R A;  2FC0 A;  2A1S A;  3V4I A;  3AVJ A;  1GOB A;  4DG1 A;  3TAR A;  3PSI A;  4CZH A;  3VA3 A;  2P9K B;  2IGI A;  3OJS A;  3PUF A;  2O8C A;  3NH0 A;  4IO8 A;  3J7Z O;  4KTQ A;  4LFA K;  4A5A A;  3OA9 A;  5AQX A;  4FZZ A;  5J2P A;  4FWM A;  5GAE P;  3FR0 A;  5AR0 A;  1RT5 A;  4FJ7 A;  3AVC A;  3VEW A;  1HRH A;  5BRD A;  4XEI A;  4O8K A;  4NCG A;  5C2F A;  2P9I B;  3LL3 A;  2O8F A;  4N41 A;  3ZYY X;  3CCL N;  3DRP A;  4IEE A;  1W97 L;  4CHN A;  3O3F A;  1L3T A;  2ZJP L;  3DLB A;  3FZL A;  2NLX A;  3ID6 A;  3MN7 A;  4CF9 A;  3SNN A;  4BWJ A;  4CI6 A;  3OYG A;  3HVT A;  1KXP A;  1P90 A;  4B8C A;  4CEZ A;  4DQP A;  3ULE A;  4DF4 A;  1HMV A;  5AQT A;  4U67 L;  1Y64 A;  5I9E B;  3LP3 A;  1ASW A;  3PO5 A;  3IMX A;  1Z25 A;  4IWV A;  4CHQ A;  3MCA B;  4JI7 K;  3TPQ A;  2F9T A;  4E3S A;  3AV9 A;  1LWC A;  4EIA A;  1K73 O;  1VK0 A;  1B92 A;  3LDL A;  1U49 A;  2AJQ A;  3WXM B;  3UKR A;  4F2S A;  3SPY A;  4BE2 A;  4CHP A;  3CFO A;  1VQO N;  1NK7 A;  3HBT A;  4WQ5 A;  3ZSO A;  3O8M A;  3AAQ A;  5FDL A;  1NGH A;  4DU4 A;  4XH4 A;  3QIN A;  3GOI A;  4BWM A;  4J8F A;  3OYJ A;  1XC9 A;  5BPN A;  4QS8 A;  1XUP O;  2E1Y A;  3CFR A;  4N76 A;  4YOW A;  4W5N A;  3OS1 A;  2KQ2 A;  2YV0 X;  3W0L A;  4GV6 A;  3KLF A;  3AA5 X;  3PIP L;  4HUE A;  4B3R K;  4B3O A;  2ZQB A;  2KTQ A;  4DV7 K;  4DUZ K;  4Y1D A;  2YKN A;  2QTD A;  5AQQ A;  2CGK A;  1OH6 A;  5EXW A;  4JKC A;  4B1Z A;  1X9J A;  4WQ4 A;  4BR5 A;  3BZC A;  3P83 D;  1YVU A;  4GY2 B;  3O3G A;  4IEI A;  4IZ9 A;  3K9J A;  4FWS A;  3SUP A;  2YI1 A;  2EHG A;  4DQ8 A;  4XH1 A;  4CF0 A;  4BRA A;  2P5O A;  3OBY A;  1FJG K;  1BDG A;  1L3V A;  2HBL A;  3U9D A;  3THX B;  1YIJ N;  4BR0 A;  1LWE A;  3I8D A;  3AVK A;  3SUN A;  4NO7 A;  4Z94 A;  4MFB A;  3TR8 A;  4YOX A;  1WBB A;  2AP1 A;  3THW B;  4LSL A;  2J4R A;  3O9R A;  4IFE A;  5BR9 A;  4ILH A;  4A5B A;  4JI8 K;  3CJ7 A;  2O4I A;  3M3Z A;  1HNZ K;  1NNE A;  3VEO A;  4OVL A;  4CGF A;  1NGD A;  5B8H A;  1JLQ A;  3KD5 E;  3DMJ A;  3K0S A;  2YHA A;  2ZJQ L;  4RW7 A;  4ELV A;  4CJV A;  4H5V A;  5JS1 A;  3A0I X;  1FW6 A;  3MXI A;  3AVN A;  3FGU A;  4DR1 K;  2FLO A;  1GLA G;  2AA4 A;  4U7B A;  3VGK A;  3FLC O;  4PKI A;  2DFF A;  4J2B A;  3K58 A;  1WOQ A;  3LDO A;  3O4Q A;  1Q8I A;  4H0O A;  4JAX A;  2UUA K;  5C24 A;  4O0I A;  4LH4 A;  4F9O A;  2HHT A;  2G8H A;  1XQS C;  5AQM A;  3OYF A;  2F9W A;  2VCP A;  3HZ6 A;  1O1W A;  2BTF A;  2RF2 A;  1F21 A;  3TTD A;  1JL1 A;  4N56 A;  4IOX A;  4FLV A;  4FK4 A;  2Z1J A;  1GLJ O;  3ZLJ A;  3QB0 A;  2P5G A;  2EWS A;  3QIP A;  1VQ5 N;  1X9S A;  1VSF A;  1QQC A;  4BRE A;  2D1K A;  5AQR A;  2UUC K;  1QQO A;  3CET A;  1P8Z A;  1NJY A;  3VGL A;  4CZF A;  3RR8 A;  4BAC A;  5HOO A;  3SYZ A;  5CHI A;  4PY5 A;  3E9P A;  1RT3 A;  4A61 A;  5FRN A;  2X78 A;  4YHH K;  3UB5 A;  1S6P A;  3MN5 A;  1ATN A;  2F8T A;  2IDO A;  3ZEU A;  1B9F A;  3W3D A;  3CM5 A;  1ZXO A;  2VWB A;  4IDH A;  2XY7 A;  3AA3 A;  4BGA A;  5JS2 A;  4E1N A;  1ZYQ A;  1E4G T;  2FBT A;  3S3N A;  4AHT A;  2XY8 A;  1I3A A;  1CLQ A;  1C1B A;  1WSH A;  4CGH A;  4C1N I;  2IAJ A;  2BAN A;  3G10 A;  5LJV A;  3T1A A;  4BRP A;  1NJI O;  3SQ4 A;  4UQG A;  4DR4 K;  5FPN A;  4I6M B;  4CIF A;  2WTU A;  1OH5 A;  3HVR A;  5BN9 A;  3TI0 A;  4O4G A;  2ETJ A;  4JI1 K;  5F1X A;  4C23 A;  2GWJ A;  2QXL A;  1N34 K;  3GE1 A;  3CPW M;  4ISG A;  3SQ1 A;  4B9N A;  2Y1I A;  3THY A;  4JYA K;  1RIL A;  2ZJR L;  3C0B A;  3PY8 A;  1JXB A;  1BO5 O;  5AQO A;  1RBU A;  1QSS A;  4J2D A;  1SQK A;  3P4I A;  4ZTF A;  4EZ6 A;  4L8R B;  5HLF A;  2YNH A;  3EKU A;  1UWB A;  1VAZ A;  4DFP A;  1NJX A;  3KTQ A;  1JLA A;  4JI0 K;  2IVN A;  4YOU A;  3K57 A;  3SJH A;  4C1N K;  4PHT X;  4ICL A;  3AVL A;  1RTJ A;  2RE2 A;  3OYL A;  3VER A;  3THX A;  1A5X A;  4DB3 A;  4K8X A;  4KTW A;  2A5X A;  3HK2 A;  4CE9 A;  3TWH A;  4HUF A;  3HOS A;  4DQI A;  4QAG A;  1Z26 A;  2QI2 A;  3KLG A;  2IVP A;  2YCH A;  1BU6 O;  2PBD A;  1T6D A;  4FK2 A;  5J2Q A;  4EP4 A;  3E01 A;  2YHX A;  1IV0 A;  4CHO A;  4FM0 A;  1NGG A;  2NRZ A;  3NVK A;  5AQI A;  1WSG A;  2X74 A;  4BDP A;  1JL2 A;  4J2E A;  1ILY A;  4CFA A;  1X1P A;  4DU1 A;  4JHD B;  4A62 A;  3OYK A;  3C7N B;  2DTU A;  1HYV A;  3JYT A;  4BRF A;  4CJS A;  4CZE A;  1RDU A;  4YOY A;  3SMS A;  4Z0U A;  4AHR A;  5M1K A;  3CCV N;  1VSE A;  3AVA A;  3LM9 A;  4E7J A;  3QEW A;  4F3T A;  1BOT O;  3V9W A;  1IG9 A;  3OS2 A;  4LFC K;  2QKB A;  3FFK B;  3ZSR A;  2FBX A;  3DAW A;  2YNG A;  2ZWH A;  3DXK B;  3SUO A;  4ZTJ A;  5LMU K;  3TTC A;  4TSX A;  4EHU A;  2WC9 A;  1VQ8 N;  3DXM B;  1D9F A;  3UKU A;  4BDZ A;  3CYM A;  3VQ7 A;  4CK2 A;  3SAF A;  1RDC A;  4JLH A;  1MWK A;  2FF6 A;  4DLG A;  1HJO A;  4CJK A;  1UA1 A;  3VQE A;  1IKX A;  4M3Y A;  5AQL A;  1RBR A;  4XH5 A;  3C6U A;  3PX6 A;  1WNS A;  4QS9 A;  4JN4 A;  4FJX A;  4EHT A;  4M3R A;  3RSE B;  4FOE A;  1TK5 A;  1U45 A;  4E89 A;  4PL7 A;  4OPJ A;  3EE9 A;  3TAF A;  5AQN A;  1ZC6 A;  4LF6 K;  3MXM A;  1TK0 A;  3OYC A;  4FJI A;  3FZM A;  3ISN C;  4M7Y A;  2O8F B;  1KRP A;  2BDP A;  4CES A;  3HST B;  2KHO A;  2YJE A;  4DHY A;  3TAB A;  4CEB A;  2OZM A;  4M42 A;  5BRF A;  3H46 O;  2ZM6 K;  2VYP A;  1ATR A;  3A2F A;  2V7Z A;  4CBW A;  3ULE B;  3NGZ A;  1VQK N;  2HNZ A;  4KHQ A;  4DKW A;  1KC8 O;  3D2F B;  5CZ2 A;  5AQS A;  4B1V A;  3CMA N;  4FWQ A;  4UY8 O;  3C94 A;  3CI5 A;  4LF8 K;  3TAP A;  4FWO A;  2F8S A;  4O55 A;  3LPU A;  5K14 A;  4CF1 A;  3KZB A;  3UKR B;  3L3U A;  4RG8 A;  3QEV A;  1SKS A;  4CJU A;  2A3Z A;  4IFV A;  4DSJ A;  4BY9 C;  2QK9 A;  4GVM A;  2IVO A;  2X6S A;  4KI6 A;  3QNO A;  1BGX T;  2A41 A;  2Z1H A;  1IO2 A;  3S3M A;  1Q9X A;  3WXK A;  4KO0 A;  5CR4 A;  3E9L A;  3Q7B A;  3RRG A;  3KK3 A;  4CCH A;  5HBM A;  3L6Q A;  3V1Q A;  3VET A;  1BA0 A;  2YNI A;  3K59 A;  3QDK A;  3EY1 A;  5GAG P;  4KKO A;  4M7X A;  4BC4 A;  1D5A A;  4CZK A;  2HHW A;  2PZS A;  2HHV A;  5C12 A;  4AH9 A;  3OYH A;  5BPL A;  2IOC A;  1BI4 A;  4CEE A;  4W5T A;  1VHX A;  4DTP A;  5E26 A;  3J7Y P;  1D8Y A;  4LSN A;  4WQ4 C;  3RTV A;  3VA0 A;  1RT2 A;  3SLC A;  4B8A B;  2I7N A;  1NKC A;  4CF2 A;  3FZH A;  1JJ2 M;  1HKG A;  4KHN A;  4H0X B;  5CYQ A;  4AHS A;  1VSL A;  1KFD A;  3MCP A;  2P9L A;  1T05 A;  3KVG A;  4FJM A;  2Q2R A;  3KIO A;  1T6C A;  1NK8 A;  4A57 A;  3ATV A;  4DU3 A;  4CGD A;  4DS4 A;  1MWM A;  2RHK A;  4FLW A;  2VG5 A;  4RW9 A;  3V1R A;  3O9Q A;  4H5T A;  4FVM A;  5EVZ A;  3RMA A;  1RDD A;  1DKG D;  4FWP A;  2W6K A;  3VQQ A;  4BR9 A;  3R9P A;  2JWL A;  4NLB A;  4IG3 A;  2OPP A;  3J81 O;  1RFQ A;  2IC3 A;  5AQZ A;  2BH1 A;  1ZBI A;  4KB1 A;  2ZF5 O;  1X9M A;  4B1W B;  4YFU A;  4KB0 A;  3DXK A;  3NGI A;  1FXX A;  1RDB A;  1C0U A;  3T7Z A;  3DXM A;  4WF9 L;  4DQS A;  4XIU A;  4GV3 A;  2XHB A;  1T03 A;  4C8K A;  4DTR A;  3MN9 A;  3TSU A;  5IWA K;  3PIO L;  1NGA A;  4Q5V A;  2ZE2 A;  3LDQ A;  3HPH A;  4CGG A;  2G8I A;  4Z4G A;  3T69 A;  1XC3 A;  1KAZ A;  1XMQ K;  3AVI A;  3NDK A;  4B3T K;  3VEY A;  4BRH A;  3HP6 A;  2WFB A;  4C8O A;  1K6Y A;  3AO2 A;  3CPE A;  1YXQ A;  3S41 A;  3RSE A;  5M1N A;  1TUY A;  1EKE A;  2YNF A;  3HPG A;  3JS6 A;  3VQ6 A;  4HWI A;  3S3O A;  3WEE A;  1DTT A;  2HMP A;  3ENO A;  1GLL O;  4FJ8 A;  4N5S A;  2Q0R A;  4M41 A;  4JI6 K;  1K9M O;  3CCU N;  3P31 A;  4ISE A;  4MDB A;  4LH5 A;  1S22 A;  4KI4 A;  1J54 A;  5C0Y A;  3TSP A;  4OLB A;  4DSI A;  3ZEU B;  4JI3 K;  4FJ9 A;  2O8B B;  1QQN A;  3AO1 A;  3D2F A;  2XRI A;  1HUX A;  4FL9 A;  1XI1 A;  1HPZ A;  2BGG A;  3VQA A;  1YJW N;  3IDH A;  4FXD A;  1S3X A;  3ENH A;  4YOT A;  4CZM A;  3G0Z A;  3OYM A;  4DUY K;  3CC4 N;  5AJ3 K;  2Q1N A;  3QER A;  5JVG L;  3WQU A;  3EYZ A;  3H45 C;  4CJW A;  1TV6 A;  4OKJ A;  1VSJ A;  1ZBL A;  4FJ5 A;  1L3U A;  5CYM A;  4CZJ A;  1SL0 A;  3U3Y A;  4KH5 A;  3P1G A;  1BCM A;  1TL1 A;  4DQR A;  5TKW A;  1FKO A;  5AZI A;  3VQ5 A;  3IKM A;  3D2E A;  4B9Q A;  1WB9 A;  5ADX A;  3VQ8 A;  3AO5 A;  1S1T A;  3U9Z A;  3ZX3 A;  4GV9 A;  4IBN A;  3THY B;  3L0Q A;  5I3U A;  3HYF A;  3I33 A;  3KLI A;  1QHA A;  3NFA A;  4GVE A;  1C1A A;  2KZM A;  1QZ5 A;  2CH6 A;  3L2U A;  1BCO A;  4I2P A;  1I94 K;  4BR7 A;  3BGR A;  5GAD P;  2ZGY A;  1JCG A;  3MEE A;  5EY4 A;  1W0H A;  3HRG A;  5AQV A;  3CJC A;  2XO7 A;  3BY5 A;  4OLA A;  2Y1J A;  4LC9 B;  2ITM A;  4PA1 A;  2YKM A;  3G25 A;  3VTH A;  3NCI A;  1EP4 A;  1WAJ A;  3TTF A;  3ZET A;  4EFH A;  5C42 A;  3MK6 A;  3CG7 A;  5TKY A;  3OVN A;  4ILG B;  1XNQ K;  4GKJ K;  2KKZ A;  1VSI A;  2IS3 A;  3HP9 A;  1HNI A;  2QWL A;  2P9P B;  1U6Z A;  4ISF A;  3P38 A;  4DLE A;  3TAE A;  1JLF A;  2NRW A;  5H1S Q;  4FWK A;  1JCF A;  4Z4I A;  1ASV A;  4JI4 K;  2D0A A;  4HCC A;  3M8R A;  4BRG A;  1G99 A;  4K0K K;  3CC7 N;  5HRP A;  1GLD G;  4CD1 A;  3RMC A;  1D4X A;  3HT3 A;  3FFI A;  3F2K A;  2XY6 A;  5AQP A;  4ID1 A;  3KWI A;  4M3U A;  3VEZ A;  4DTN A;  3HO1 A;  2GUP A;  3VQC A;  1N32 K;  1VQ9 N;  5FPE A;  1SZ2 A;  4LY7 A;  3P39 A;  3O5B A;  3WXL A;  4KH6 A;  4K43 A;  4K41 A;  1ZBH A;  3JSM A;  3TAM A;  4FM1 A;  1IKV A;  1JCE A;  1VRT A;  4DTO A;  4E1M A;  4JKD A;  3A8Y A;  5AFU H;  1N5Y A;  3IG1 A;  3LAK A;  3UKU B;  3SQ2 A;  4KAZ A;  3HM8 A;  2QWQ A;  1E4F T;  4OGE A;  3LP0 A;  2B4J A;  4R79 A;  3L2V A;  4FWN A;  4CJT A;  1ATS A;  3OYN A;  1YHQ N;  4NLC A;  1RDA A;  3O9S A;  3VQ9 A;  4OO1 J;  3V9Z A;  2FBY A;  1R59 O;  3NGY A;  2FSK A;  3G6E N;  3GL1 A;  4EP5 A;  3DLL L;  2NZT A;  2A40 A;  1YJ9 N;  1KTQ A;  2HVI A;  4KH4 A;  3WNG A;  3ZSW A;  3ZCM A;  4PWD A;  1EO1 A;  4AHC A;  1W7A A;  1X9W A;  5KI6 A;  4B1U B;  3J7A P;  2G8V A;  3RR7 A;  2O8B A;  4LF4 K;  5F2R A;  3UIQ A;  3EEQ A;  3MEC A;  3ZT0 A;  4CHZ A;  4RW6 A;  1QHT A;  4JD2 A;  2QW9 A;  2I7P A;  3KWG A;  4AM7 A;  1DT9 A;  1KVC A;  3CD6 N;  3H3N O;  4BRC A;  3NMU A;  4K25 A;  3K5O A;  1HJR A;  2UXC K;  3EO3 A;  3D6R A;  1NU0 A;  4BRM A;  3I56 N;  3SZ2 A;  4C8L A;  1S1U A;  1RT6 A;  2ZGZ A;  4DV6 K;  3VQP A;  1O13 A;  3DWL A;  3ZT4 A;  2RKI A;  4GMJ B;  2E88 A;  4E7H A;  2D4W A;  3ZSV A;  4AM6 A;  1OH8 A;  4DR2 K;  1BA1 A;  1A5V A;  1VSK A;  3SK3 A;  3NF6 A;  1NLV A;  2NRT A;  4PL8 A;  2VG6 A;  2PYL A;  2E6L A;  2X6N A;  4FCY A;  3L4I A;  3LWL A;  3CJ1 A;  3NH2 A;  3SI6 A;  1VRU A;  3F73 A;  4M45 A;  2B5J A;  4YOR A;  2DFE A;  3ZT1 A;  2WUS A;  3LDS A;  2GEL A;  1RTD A;  5FRM A;  2E20 A;  4JS4 A;  3AA2 A;  3VQ4 A;  3EE8 A;  4CJ7 A;  2GBZ A;  2QWP A;  3NF9 A;  4HVJ A;  3AVM A;  5HP1 A;  1QTM A;  1J5O A;  4MDA A;  3HTV A;  1DLO A;  1JLG A;  3QML A;  3VF4 A;  4QCL A;  4DFM A;  3BEX A;  3SBT A;  3ASM A;  3I8B A;  5LL6 Z;  4JRQ A;  1BI4 B;  1X3N A;  2CGJ A;  1JKH A;  4IO9 L;  3DLK A;  3SJJ A;  2NRV A;  4HCB A;  4DR7 K;  3WT0 A;  2P9P A;  3RVC A;  4KBO A;  2Q97 A;  3A5M C;  1YT3 A;  2E8A A;  4H8K A;  2P9L B;  2Q36 A;  1BG3 A;  3IAY A;  4E7L A;  4CEF A;  4NXM K;  3SAH A;  1LAV A;  3H3O B;  4OGC A;  3O6W A;  3PV8 A;  1C6V A;  2HND A;  3LPT A;  3CIP A;  4IG0 A;  3VOV A;  4CJ3 A;  3WXJ A;  1WN7 A;  4ID5 A;  4JKH A;  1NGC A;  3DYA A;  3LAN A;  3VMF B;  3CQX A;  1N36 K;  4H0P A;  4JKB A;  4CJL A;  3H1V X;  5AQU A;  4JK8 A;  2OPS A;  2NRH A;  4ILJ A;  1KFS A;  4QOZ B;  4Z4C A;  1NGI A;  3R3L A;  4GNI A;  5HRR A;  4CED A;  3K5L A;  3B6P A;  4BQL A;  4V19 S;  2KW4 A;  3MMV A;  2HVH A;  3T1Y K;  3TU5 A;  1U4B A;  3B6O A;  3OY9 A;  1TYQ B;  4R5P A;  1NK9 A;  2HBJ A;  3M1F A;  3CCQ N;  3JXU A;  2HHS A;  1RT7 A;  1ZBF A;  3BZK A;  4JI5 K;  3OJU A;  1TKD A;  2DPN A;  2G8K A;  5HRO A;  1RBV A;  1JLB A;  4B3S K;  4G1Q A;  3PSF A;  4JRP A;  5JIC A;  1C0G A;  1KCF A;  4DFK A;  1NK5 A;  1U48 A;  4WFA L;  3SPZ A;  1GOA A;  2HNY A;  4C8N A;  4MO5 A;  4DV0 K;  1ITG A;  1GLC G;  2V52 B;  5CE3 A;  3CQ8 A;  4DR3 K;  4GW6 A;  4IDK A;  2JWK A;  3O1B A;  1UOC A;  4M3W A;  1VQM N;  2PAV A;  5BPM A;  4CHY A;  2GWK A;  3LP2 A;  3M5R A;  1S1W A;  3LWM A;  5CY4 A;  3WEE B;  1RTI A;  4H0Y B;  3VEX A;  5FLX O;  4NYF A;  4DSK A;  1HYS A;  2FF3 B;  2FXU A;  4Y0W A;  1RBS A;  3ALY A;  3B8A X;  3DRS A;  3H08 A;  4B3M K;  4YDU A;  3ITH A;  3CCS N;  5KTQ A;  1SS6 A;  5KQ8 A;  2KFN A;  3DLG A;  4A2A A;  1BHL A;  4NCA A;  1VQL N;  1OVY A;  1ZBU A;  4CJE A;  3CCM N;  1RGI A;  5EU7 A;  2UUB K;  2UXB K;  1DGK N;  3AO3 A;  3QBW A;  2Z1G A;  4PKH A;  2Z1I A;  3QO9 A;  3MX5 A;  2HF4 A;  3VF2 A;  3OYB A;  4EZ9 A;  3KK1 A;  4FLZ A;  3TAN A;  3NF8 A;  1EWQ A;  5AQW A;  1TVR A;  4F3O A;  5KGX A;  3SAG A;  3SQ0 A;  5BRH A;  4YY3 K;  1J6Z A;  2QWM A;  4NYN A;  4BRL A;  3RMD A;  4H5R A;  1HX1 A;  1REV A;  4E7I A;  4PQU A;  5FPM A;  4OPK A;  1QZ6 A;  5M1Q A;  2OZS A;  1SAZ A;  4JEP A;  5KQD A;  4DTU A;  5AZI B;  3D2E B;  2E6M A;  2E2Q A;  1LCU A;  1HNW K;  2HHX A;  1TAU A;  3J80 O;  4O8U A;  3VQB A;  1RNH A;  4DV1 K;  4O0J A;  3MDQ A;  4KV8 A;  5AQH A;  1J53 A;  3U6F A;  1S72 N;  3CME N;  2D0B A;  3C6T A;  3ZSQ A;  3KKR A;  2HST A;  4M3X A;  2YHY A;  1J9A A;  3FZF A;  1N8R O;  4B9L A;  1NKB A;  3R8E A;  3ZET B;  1LW0 A;  3TAQ A;  4DTJ A;  4FJJ A;  1MDU B;  3CM6 A;  5J2M A;  1VQP N;  3CFP A;  3E9O A;  3RRH A;  3WNH A;  3IRX A;  1EX4 A;  2G8U A;  3MWP A;  1J5E K;  5BN8 A;  3NAE A;  4X65 K;  4M63 C;  3LP1 A;  1Q82 O;  4M3Z A;  5M1O A;  4N47 A;  1H1V A;  1RDW X;  1C0T A;  4DSL A;  1NGE A;  1C0F A;  3A5N C;  2HB5 A;  4CJQ A;  4B1X B;  5HRS A;  1NKE A;  5LJW A;  1WLJ A;  4MO4 A;  3ZX2 A;  1NWK A;  3S9H A;  5F0X A;  1TYQ A;  5HRN A;  4BG9 A;  3QBX A;  4I7F A;  1VSH A;  5JMV A;  4JKF A;  5LMN K;  1TL3 A;  5BRE A;  4OKE A;  2HBK A;  1LV5 A;  2YHW A;  1HNV A;  1R0A A;  1V4S A;  4RW4 A;  1SKR A;  3EZW A;  3O4N A;  2PFU A;  3UE5 A;  4CJR A;  3RMB A;  2CH5 A;  3I0R A;  4FZY A;  4H4M A;  3EKS A;  3LDP A;  4RTF D;  1YI2 N;  3VEV A;  4A2B A;  3OS0 A;  4JKA A;  3VQD A;  1NJZ A;  4PUO A;  4CIE A;  4JK7 A;  4DR5 K;  3ZX0 A;  3C6A A;  2O8D A;  4CZL A;  3D7E O;  3IS9 A;  1HNX K;  3MEG A;  5A2Q O;  2OPR A;  2WOM A;  4MQ3 A;  5SWM A;  5T7B A;  5DM7 L;  3BF1 A;  4E7K A;  4EAH D;  2G8W A;  4B9U A;  4DTM A;  4NB4 A;  4CVN E;  3DRR A;  3I55 N;  4DQQ A;  5KPR A;  3WQT A;  4FWL A;  5ADX H;  4FM2 A;  1BUP A;  2ASP A;  5CZ1 A;  4L3Q A;  3H1Q A;  1NGJ A;  4B1Y B;  4JD2 B;  4CW7 B;  1T44 A;  4DF8 A;  3CER A;  4AHV A;  3SUQ A;  2LSN A;  3CCE N;  1QE1 A;  3DM2 A;  4BRI A;  3NF7 A;  1JLC A;  1W2B M;  2P9U A;  3L2Q A;  3VTI A;  1U47 A;  3A5L C;  2CGL A;  4IKF A;  3OYD A;  3O80 A;  2UXD K;  2VWK A;  4LF5 K;  3OTO K;  3KHY A;  5J2N A;  4BG8 A;  3PX0 A;  5E84 A;  3HOT A;  2QA4 N;  4FJK A;  1UAX A;  3BDP A;  3LAM A;  1NBW A;  5JLH A;  3T3F A;  1SL2 A;  2I5J A;  3QEP A;  3ID8 A;  4WE1 A;  3QFU A;  1BL3 A;  2WON A;  5MLC Q;  1WAF A;  4JKG A;  5KRS A;  4FVU A;  1NM1 A;  4CJ5 A;  2D0P A;  1ESV A;  3KD1 E;  2GEM A;  3U4L A;  3SBG A;  4AQY K;  3AO4 A;  1S5J A;  3L8B A;  1WSI A;  3AY9 A;  3R1X A;  3SV3 A;  3DI6 A;  4Z4E A;  2GX9 A;  4DR6 K;  1RTH A;  1IBK K;  2VG7 A;  1QSY A;  1K8K B;  2D0O A;  1KVB A;  1WUA A;  3EN9 A;  4OPH A;  3WUH A;  2NRR A;  2HBM A;  1HKC A;  1KAY A;  4BRK A;  2D0C A;  3C65 A;  4CJ4 A;  1OKJ A;  1S1X A;  3VEN A;  1Q81 O;  3ZSZ A;  2OTJ N;  4I9Q A;  4B9M A;  4X62 K;  4BE1 A;  1VQN N;  1OH7 A;  1TKT A;  3FE1 A;  2W42 A;  4FJG A;  1TKX A;  3MWT A;  1EWR A;  2QWO A;  1RBT A;  1NK0 A;  3BP8 A;  3O1W A;  1TUU A;  3NHG A;  2P9N A;  2PYJ A;  5M1F A;  3V1O A;  5BR8 K;  4CZI A;  4BRO A;  3PO4 A;  4JV5 K;  3ZSY A;  1LAW A;  5HL7 L;  4JS5 A;  1HKB A;  3OW2 M;  2P51 A;  4W5Q A;  4BGB A;  2UYT A;  3PX4 A;  4FLY A;  3L2R A;  4G9Z A;  3PLA A;  3VES A;  1TGO A;  3QIO A;  4YNQ A;  2E2O A;  4W5O A;  4O44 A;  3AGK A;  4H0V B;  3O3H A;  3N4P A;  2HHH K;  1T8E A;  4KRE A;  1G15 A;  3G71 N;  4BR2 A;  2HOE A;  3VF6 A;  1U2V A;  2V7Y A;  1C1C A; 
#chains in the Genus database with same CATH homology
 4DR7 K;  4B3M K;  5IWA K;  4X65 K;  4DV4 K;  4LF9 K;  2UXD K;  1I94 K;  4LF5 K;  3OTO K;  4NXN K;  4NXM K;  1XMQ K;  4X66 K;  1XMO K;  2UUB K;  4JI8 K;  2UXB K;  4B3T K;  1N33 K;  1HNZ K;  4LFC K;  3J7A P;  4LFB K;  2UU9 K;  2VQE K;  4DR4 K;  1HR0 K;  5LMU K;  1IBL K;  4LF4 K;  1XNQ K;  4GKJ K;  4JI1 K;  5LMN K;  4AQY K;  1N36 K;  4JI2 K;  1N34 K;  4YY3 K;  4DR6 K;  4JI7 K;  1IBK K;  4DR1 K;  4JI6 K;  2UXC K;  3J7Y P;  4JYA K;  4JI4 K;  2UUA K;  4DV6 K;  4K0K K;  4JI3 K;  4V19 S;  4DR5 K;  1HNW K;  1IBM K;  3T1Y K;  4KHP K;  3J80 O;  4X62 K;  4DR2 K;  4DV1 K;  1HNX K;  5A2Q O;  2E5L K;  4JI5 K;  4JI0 K;  4LF6 K;  1XNR K;  3JAM O;  4DV3 K;  4DV2 K;  4B3S K;  1N32 K;  4DUY K;  5AJ3 K;  4CVN E;  4LF7 K;  2UUC K;  4X64 K;  4DV0 K;  3T1H K;  4B3R K;  2ZM6 K;  4DV7 K;  4DR3 K;  5BR8 K;  4DUZ K;  3J81 O;  4JV5 K;  2VQF K;  4YHH K;  4DV5 K;  2F4V K;  5LL6 Z;  4CW7 B;  5FLX O;  2HHH K;  4GKK K;  4LF8 K;  4LFA K;  5IT9 O;  4OX9 K;  1FJG K;  1J5E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...