4JI3K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji3K00
4YY3K 1J5EK 4JI1K 4V19S 1HNZK 4DR7K 4NXNK 5AJ3K 5LMNK 3J81O 4DV0K 4LFBK 4K0KK 4JI6K 4LF7K 2VQEK 2UXDK 3T1HK 4DR4K 4DV4K 4OX9K 4NXMK 4JI2K 4LF6K 4CW7B 2E5LK 1HNXK 5IWAK 5LMUK 2VQFK 4X62K 3T1YK 4DV6K 4LF4K 2UUCK 1IBKK 4LF8K 3J7AP 1IBLK 1I94K 3OTOK 4DR3K 1HNWK 4DUZK 4DR6K 1FJGK 4B3MK 4LF5K 4JI4K 5A2QO 4LF9K 4B3SK 2UUBK 4B3TK 1XMQK 5FLXO 4DV3K 4JI5K 4JI3K 2UXBK 2UXCK 4DV2K 4X66K 4AQYK 4JV5K 3JAMO 2ZM6K 4DV7K 1N34K 1IBMK 2UUAK 4LFAK 4JI0K 4JI8K 4CVNE 1XMOK 4GKJK 2UU9K 4DV5K 4KHPK 2F4VK 4DR2K 4X64K 1N32K 5BR8K 4B3RK 3J80O 2HHHK 4LFCK 4JYAK 4DUYK 1HR0K 1XNRK 4X65K 5IT9O 4YHHK 4JI7K 1N36K 4GKKK 4DR5K 5LL6Z 4DV1K 1N33K 1XNQK 4DR1K 3J7YP
chains in the Genus database with same CATH superfamily
4YY3K 1J5EK 4YOTA 4B9UA 4HUEA 1C0FA 3CCUN 5BRFA 3U3GA 4JI6K 4LF7K 4OJRA 5CR4A 2UXDK 2AJQA 1NGDA 3V9ZA 4JK8A 4CK3A 4DTOA 4NXMK 3S41A 1HNXK 1NGHA 4YOWA 2QWOA 3C65A 3BF3A 1WSHA 4CZJA 4O5BA 1CZAN 3OS1A 3ZSQA 4U7BA 4DR3K 4FJLA 4A5BA 3LM9A 2XY6A 3NFAA 1IG8A 1SZ2A 1P90A 3AA4A 5C24A 4FWLA 4CHZA 3NGZA 1XHZA 3NH2A 4CJ7A 2AA4A 4OLAA 1RILA 1Q18A 4KH5A 2XO7A 3S3NA 2QKBA 1ZBFA 5AQGA 1JL2A 2FBXA 3ASMA 5C25A 3RMCA 1O13A 2OTJN 4LH5A 2F96A 3WEEB 3VA0A 2GX9A 5HRSA 2P5GA 4CCHA 3WNHA 3L4QA 1A5VA 1QHTA 3M8SA 4ILGB 1JLFA 1A5XA 3DRRA 1VSIA 1YXQA 4DV7K 1RDBA 1GLEG 4E7IA 1LAWA 4N41A 4JKEA 1H1VA 4KRFA 4E19A 4H8KA 5TKWA 3K9KA 3G0ZA 3AVCA 2KTQA 3D45A 3QETA 3AVFA 1BQMA 1S1XA 2HHHK 3QBXA 1VSLA 3Q7BA 4K41A 1S6PA 3SUNA 1L3VA 1VQ5N 1YT3A 2VG7A 5BPNA 4YHHK 3JYTA 3ID6A 2VGMA 5AQSA 1N36K 4BRKA 3WXIA 1T05A 5AQTA 1KD1O 1XUPO 4XH4A 3QFPA 4IO9L 4NYFA 3VQDA 3BUZB 4CFCA 4DCHA 1Q82O 2Z1GA 3PUFA 4JI1K 4GY2B 4CJLA 1RDUA 4ICLA 4JAXA 4NXNK 2Q1NA 2VQEK 4FK0A 1LWEA 1KXPA 1L3UA 3NAEA 2HBJA 3KLHA 5KGWA 4W5OA 4LF6K 4CZLA 4E0DA 1LW2A 3IRXA 1KVCA 5CZ2A 3HOTA 3CJ9A 5IWAK 3NGYA 4CZEA 1QZ6A 3RRHA 1WBDA 3PO5A 3VESA 4AM6A 1A5WA 1WN7A 4JK7A 4BC3A 1IBKK 3T69A 1IBLK 3KIOA 1IG9A 3U8XA 2A41A 3ZT1A 4YOXA 1BI4A 2EX3A 4DS4A 4PHTX 4DS5A 1BCOA 1RBTA 3K5NA 3EYZA 1HKGA 4FM0A 4DQIA 3DLKA 4HTLA 4B3TK 4OPKA 2A1SA 2WC9A 4QS8A 1QQNA 4JI5K 1TK5A 4O0IA 2HHVA 3AVBA 4CBUA 1J54A 4F4KA 2OPPA 4LD0A 1C1AA 1LWFA 1KAYA 3IFRA 4CFAA 3F5TA 1IBMK 4GV9A 3R3LA 3HPHA 4JI0K 3KLEA 4CVNE 1XMOK 3D2EB 5CYQA 4KAZA 4W5TA 4PQUA 2BUPA 2O4IA 3HT3A 4BWJA 2QM1A 3UB5A 3NH0A 4CJFA 4FWQA 4CF1A 1TYQB 3IG1A 3C0BA 4O4GA 4ELVA 3VQ8A 2P9UA 5JVHL 3THXA 2VWKA 1QZ5A 3JS6A 3NBPA 4I6MA 4CEZA 2YX6A 4N56A 1YJNN 3HJFA 4EFHA 3SUQA 1JXBA 2HHTA 1NMNA 4FZYA 5M1NA 3SJJA 1BGXT 3NVKA 4CEDA 3G10A 4DFJA 1SV5A 1BG3A 2HHQA 3OYLA 2F9TA 1XI1A 3O8MA 5LMNK 5BREA 2WTUA 3V9SA 2YKNA 4IFVA 1JCFA 1FKPA 1S9GA 4BDYA 1YJ9N 3PLAA 4ISGA 3OJUA 4FXDA 3RMDA 2FF6A 2B6AA 3HO1A 5AQXA 3VMFB 4NYNA 5SWMA 5AQYA 3L4IA 3WNGA 2A1RA 4FLTA 4DQPA 2YNHA 1QSLA 3NF7A 4H0OA 2F9WA 3EE9A 5LJWA 3QEIA 1I94K 3LAKA 4DSIA 4M3RA 1W7AA 2RKIA 3RMAA 2IGIA 1RTJA 3TTFA 3QINA 2ASOA 3TAQA 1KC8O 2RHKA 3OYIA 3ID8A 4JHDA 1VQON 1NJIO 2IC3A 2OPQA 1OVYA 3BP8A 2PYJA 1S72N 2YJFA 5J2NA 4XEIA 3BZCA 2P9PB 3TAFA 5FRMA 1EXQA 5T7BA 3H1QA 4J2DA 3V1OA 2QXFA 1ZBLA 1IKYA 4FW2A 3KKSA 5TKYA 1DEJA 1YF5L 2BGGA 3PIOL 2G8WA 3QLHA 2HVHA 4DV5K 3DWLA 4IDHA 3DRPA 1SL0A 1KRPA 4A61A 4Z4GA 4RCHA 4BG8A 3J80O 4IOAL 3NH1A 1QSSA 3D2FB 1W97L 4CIFA 2O8EA 3BZKA 1BUPA 4BRGA 2ZE2A 2RPIA 3ZT4A 2XY7A 3O9UA 1JKHA 1RT7A 3FLCO 2KZZA 4IWVA 1XQSC 2YI1A 3MN6A 2E4LA 3H08A 5ADXA 4KH6A 1N33K 1VQ7N 4BRQA 3VEXA 1WAFA 3L2RA 1KLNA 4IG3A 2HF3A 1HPMA 2WFBA 4C8NA 4CZIA 4AHTA 3LP3A 1WUAA 1YITN 4JLHA 2JGUA 2DFEA 4CHPA 3P39A 1LV5A 3TPQA 2QWRA 2HBLA 4BR0A 4Z4FA 1VQ9N 5EOYA 1HNIA 3TI0A 3MEEA 4YDUC 4YNQA 4FOIA 5AQFA 1ATRA 3OTOK 1EO1A 3P31A 4DTPA 2E2NA 3MN5A 5MLCQ 3OYDA 4BR4A 1SS6A 4FWRA 4LF5K 1QQOA 1C6VA 1YJWN 4B9SA 3JXUA 3EO3A 4BVPA 4KTQA 3G6EN 1D9FA 1DLOA 4KHWA 3MCPA 4FSVA 3VGLA 4FW1A 1WBBA 3F2KA 4Z94A 4FWMA 4UQGA 4JKFA 3LALA 5KQ8A 4X66K 1R59O 2E1ZA 4DG1A 4ELUA 3ZSRA 2KFZA 3DLEA 3U9DA 2A6AA 2Q36A 5KRTA 5KPRA 4KKOA 4PL7A 4IXCA 5C2FA 3MAQA 4DF8A 3EZ5A 1X3MA 1WB9A 4JKGA 1GLLO 4PKIA 3P5JA 4GVEA 2GUPA 4X64K 2HHWA 5JS1A 3FZKA 3AA3A 1ZYQA 1KQSM 4DUYK 3SQ0A 3WUHA 1CXUA 3THWB 3MN7A 1XNRK 1VRTA 1RNHA 4OLBA 5GAGP 3KLGA 2GUIA 4HUGA 4NB4A 5GINA 3K5OA 5AZJB 5HRNA 3GG4A 2PY5A 1W2BM 3I8DA 4I9QA 3HRGA 2PYLA 3E66A 3IKMA 4FK2A 4ILJA 2IAJA 1B9DA 3CCSN 1EWRA 4I9LA 3PSIA 2WBNA 2O8CA 3ZSXA 4LFBK 3LL3A 2YNGA 4WE1A 1M1KO 3TAEA 5C0YA 3KK7A 2ASPA 3MWPA 4CIGA 5AQVA 1JL1A 3LPTA 2DY4A 1IV0A 3DYAA 2X6SA 2X74A 3UE5A 1N5YA 1Q9XA 4LF4K 4CGHA 2I5JA 1KAZA 4CEAA 3CC7N 1DTQA 1GOAA 4E7LA 2KQ2A 4J8FA 4M7XA 2PZSA 4E7HA 4M7YA 2V51B 3O5BA 3TANA 4DR6K 3FZLA 4BRAA 3M8PA 4FJMA 3V9UA 1RBRA 4KI4A 2NRTA 4ZHRA 3PV8A 5C12A 1YHQN 2JWLA 3NF8A 3ISNC 5K14A 1NGEA 2CH6A 3VQ7A 3WXLA 4CESA 2FBTA 2ZF5O 2YKMA 3K58A 2F8SA 3OS0A 1J53A 1RT5A 1ZBSA 2A42A 4E7KA 1L5UA 3U9ZA 4CHQA 1GLCG 1VQMN 4B1WB 3UKUB 4FZXC 1T44A 3K57A 2Z1JA 3ATUA 1UWBA 1JJ2M 1VSEA 4H0XB 4LFCK 1EP4A 1NG9A 2GBZA 4BR7A 5GAHP 4PKHA 1BA0A 3AO2A 4X65K 4BRMA 4CK2A 4ID1A 4KTZA 1HJRA 4B1VA 5GIPA 3CQYA 3ZT2A 4EZ9A 1TGOA 1WNSA 3O3FA 4H5RA 3OYFA 3FR0A 3DXMB 1JLQA 4FPAA 4C8OA 3KLIA 3V81A 4O5FA 3L8BA 3BDPA 3VQQA 1VQKN 3WXKA 4KO0A 1L3SA 1ZC6A 1LAVA 3VERA 4OPJA 3EN9A 2WONA 1NJXA 2XY8A 3MX2A 3SLCA 1DKGD 3L2VA 3TWHA 5C2DA 4CHYA 5AZIA 3NMUA 4OPAA 1ESVA 1HPZA 4YFUA 3A5MC 2VG6A 3N4PA 1WLJA 2P9SB 4CF2A 3U6FA 1WSFA 3R9PA 4YOVA 4CJ5A 1NGBA 4FJJA 3D0PA 1BHLA 3H3OB 1XC3A 4CJ3A 3L3UA 5CHIA 3SJHA 3ITHA 4A57A 4MLEA 3PY8A 4I2QA 2ZGYA 1RBSA 4IJAA 3QDKA 4CJWA 4OKEA 1KVAA 4C1NI 3V9WA 3RTVA 4BR5A 3HP9A 3KVGA 3SYZA 4JD2B 2E8AA 2YHAA 2P1JA 1SL2A 4LH4A 3AV9A 4CZHA 3IUCA 5DM7L 3VTIA 3ZX0A 2UUAK 2O8BA 5F0XA 3LWMA 4OVLA 3LDLA 1NNEA 1VAZA 4YDUA 2ETJA 4F2RA 5EVZA 4B3RK 3K5LA 5ELZA 1IKXA 4CZMA 3CCLN 4CZGA 3ZT3A 4AHCA 1BQNA 2Y1JA 4BR2A 4IKFA 1P8ZA 2P5OA 1K8AO 1VSFA 5C15A 4M3WA 3OYAA 1BU6O 1RFQA 3ZETB 5EX5A 2DPNA 1HQUA 4BROA 4B9NA 1VK0A 4B1XB 1NGFA 1E4GT 5J2QA 4RW7A 2XRIA 4JNEA 1YVUA 2E20A 1HYVA 4KTWA 4B9VA 3CJAA 5HRPA 2HVIA 1RDWX 3IMXA 4FOEA 3SUOA 5DK5A 3S3MA 1RTIA 3OYGA 2FSKA 5JICA 3ZCMA 3AVHA 4BG9A 4DV4K 4DR4K 3MXMA 3ZEUB 4KV8A 3NE6A 3WXMB 3SAGA 2E5LK 3M6GA 4EHTA 4DTMA 4BQLA 3SQ2A 1SKRA 1BISA 2O4GA 2W40A 3LP2A 2IVPA 3QNNA 1NM1A 3MK6A 4HUFA 2XY5A 4BRLA 1KCFA 1BDGA 1VSDA 3DLLL 3V1RA 3HSCA 2G8IA 1S1WA 4CK1A 1QQMA 2H3GX 3E01A 4J2BA 5GIOA 3KK1A 3G4SN 1C0GA 4FJHA 4M45A 4F3OA 4KI6A 3OBYA 4B3SK 3QICA 3L2WA 5FLXO 1TKTA 5JS2A 3BF1A 1SL1A 3C7NB 2B5JA 3LDQA 1IO2A 2EHGA 4CGGA 3LZIA 1REVA 2BDPA 2Z1HA 4H0TB 3JAMO 2XHBA 3CCEN 2X78A 3V1QA 1NOYA 3HSTB 4JS4A 2RF2A 3D7EO 1FKOA 5KPTA 1YUWA 3RSEA 5FROA 1TVRA 4JI8K 1IH7A 2O8DA 2P9PA 4CZFA 4ID5A 4IG0A 1SUQA 2ASMA 5HRRA 1U2VB 1NJYA 1NK8A 3AVIA 3DI6A 4DTNA 2GEMA 4BR9A 5ADXH 4JYAK 4FLWA 4EIAA 4L8RB 1T3VA 4K25A 3UKRA 3O3GA 5BR9A 2VYPA 1VSJA 4DTRA 2FSJA 4E1NA 2IDOA 3HZ6A 3QBWA 5HP1A 3J7YP 5KQDA 2HHUA 1QE1A 4RG8A 3KK2A 4LC9B 4CIEA 5D3GA 3ZSWA 4Z4CA 1UA0A 2IOCA 3HK2A 3TSQA 1X3NA 1VQNN 4KREA 2VGNA 4FO0A 4QS7A 4K0KK 3SPYA 2OZMA 5C10A 2E6LA 4FVMA 4BRCA 2O8FB 5KI6A 3ULDA 5JLFA 2EWSA 4PY5A 1NLVA 1V4SA 3SQ1A 5BRHA 4DSFA 3A0IX 3CJCA 1X9JA 3DMJA 3F9MA 3O08A 1BCMA 4CJRA 3E9OA 2P9LA 5I3UA 1T03A 1HNWK 1UAXA 1LWCA 3I0RA 3KZBA 3HPGA 5FPDA 2HOEA 3KWIA 3DAWA 1I3AA 4LF9K 4QAGA 5AQZA 3QEPA 4YOYA 1U04A 3HOSA 1J5OA 1IKWA 2P9NB 4FK4A 4FLXA 2UXBK 4DV2K 4DFKA 3MWTA 3QEWA 1GLDG 3LANA 4BRDA 4H5NA 2OZSA 3PO4A 4W5NA 2RE2A 3L0QA 4FM1A 1CXQA 3CCJN 1E3MA 1Z26A 4BC2A 3RMBA 4O8UA 3QEVA 3RVCA 3O6WA 4O8KA 4FWOA 5BRDA 4CF0A 2ZQBA 2NRWA 3O3HA 2HBKA 2CGJA 3I0SA 5CE3A 5DM6L 4IEIA 4E3SA 1NKBA 4JI7K 1RBUA 3AA2A 3SV3A 2FLOA 3W0LA 4MO5A 4C1NK 4NCBA 3THYA 4TSXA 3TR8A 1D4XA 4GVMA 3VQAA 3M8QA 2P9IB 1X9SA 2D0PA 3LAMA 3CPWM 4DU3A 3VQPA 1LW0A 3TSPA 2J4RA 3I8BA 4DV0K 4CJPA 2QKKA 1MU2A 2QW9A 3LP0A 3AVKA 4CGJA 4DQSA 3VENA 3ZT0A 3B8AX 5AQLA 3O1BA 1BA1A 4BE0A 4M3TA 4QCLA 4KPYA 4CJ4A 3OYJA 3J7ZO 2QA4N 3H3NO 4BVOA 1SKWA 4B9MA 3TAGA 4JRQA 1WSJA 3SAFA 5HL7L 3T19A 2NRRA 3VN5A 4AH9A 4JKBA 3DXKA 3C6TA 4HWIA 5KPZA 1RT1A 3E9LA 2KHOA 2HBMA 3B6PA 4JI4K 3S3OA 4CI6A 5FPEA 3V9XA 3SV4A 2YHXA 2B4JA 4CFDA 3FFKB 2HMPA 4I6MB 5HROA 1NMDA 4M63C 4DQ8A 4IFEA 3N4QA 2NRVA 2WUSA 4DHYA 2QI2A 3LP1A 2E6MA 3V6DA 4AHRA 3IAYA 4E89A 1KFSA 3K9JA 1W0HA 3PSFA 3OJSA 1D9DA 4BRIA 3V4IA 2UU9K 2YCHA 3WQUA 3M1FA 1OH5A 3VEZA 4JRPA 4FJKA 4M42A 3TSUA 3LDOA 2W42A 3K5MA 3OYMA 4DR2K 3A2FA 4ILHA 1OH7A 4ISFA 2ZJRL 2Q3SA 3OS2A 1HKCA 3R6MA 3MCAB 3MEDA 2ITGA 3A5LC 3TU5A 1QHAA 1WAJA 3M8RA 2V7YA 5AQIA 3CCRN 4PUOA 3VF4A 1BO5O 1KAXA 4CF9A 3G25A 3FZFA 4IJNA 4FWPA 4DR1K 4H0VB 3H46O 4A5AA 1N8RO 2I7NA 4ELTA 3EKUA 1N6QA 4DFMA 3S9HA 3QEXA 4JHDB 1HNZK 1NBWA 3O4NA 3J81O 3K59A 3AA5X 3OYKA 4C8KA 4Z4IA 1VSMA 2D0AA 3CFOA 3MN9A 3T1HK 3ENHA 2QWMA 3DXMA 4JI2K 5GAEP 5E84A 4G9ZA 1C1CA 1G15A 2PBDA 4B1UB 1GOCA 3EKSA 4I7FA 4X62K 1SAZA 1GLJO 2W41A 2NRXA 1YAGA 3LDNA 1NK9A 4M3YA 3CF5L 4BGAA 1J9AA 3LPUA 3ULEB 4DUZK 2P9KA 4FJGA 3G71N 4FJXA 3MDQA 1C0TA 1RT2A 3ZLJA 4B1YB 4RW9A 3IS9A 3CM5A 3CG7A 3SCXA 2OCEA 2Q2RA 2P9SA 4Q5VA 5AQPA 3CJ1A 4WYBA 4XH1A 3KKRA 4DV3K 2QEXN 4E7JA 4C8LA 1RGIA 3C95A 3FZMA 4FCYA 4E1MA 2A5XA 2GTDA 2Q0RA 1JLAA 1WSEA 3WQTA 1DT9A 1S1UA 1S5JA 4AQYK 4K8XA 2D4WA 3A8YA 3M5RA 3J8AA 3CJBA 3CXCM 4LFAK 3HI0A 1ILYA 4HVJA 5F2RA 1OKJA 3MX5A 4JD2A 2I7PA 4WQ5C 3AVMA 3ZSVA 3FGUA 3AVLA 1OH6A 4UY8O 3AO5A 4R5PA 1T7PA 1K8KB 5I9EB 3U4LA 3HPOA 4A59A 3GOIA 5EXWA 4DU4A 3T3FA 4CE9A 1BL3A 1JLBA 2RN2A 5AFUA 3CCVN 5C42A 3SI6A 3AVNA 4AM7A 3VA3A 4J2EA 5JMVA 3SUPA 3WEEA 4JEPA 1KFDA 1B9FA 1VQ8N 4KHYA 4H03B 4H0PA 3QERA 1NGAA 4KB0A 3TAPA 5AQOA 1QQCA 4IO8A 5E26A 1C0MA 2WOMA 4OX9K 1J6ZA 4H5WA 1NJWA 4DSKA 3SAHA 3OY9A 1IKVA 2X6NA 2IVOA 4IFYA 1MWMA 1JCGA 3MECA 1XWLA 3VQ5A 4K8ZA 1VHXA 3AGKA 2IVNA 2P51A 3HXMA 1WOQA 1EX4A 4NLBA 3AGRA 3L6QA 3L2UA 3CQXA 4BACA 4KHQA 4JKGB 1ATNA 1NGGA 4N47A 3ZEUA 3AO1A 2Y1IA 4LF8K 4FJ8A 3J7AP 4BQZA 5BPLA 1MDUB 3MXIA 1Y97A 1YTUA 3CETA 3NCIA 3QNOA 4CZKA 5M1KA 4RTFD 4I2PA 1S1VA 2YNIA 3SMPA 1NGCA 3PIPL 2OYQA 3VEOA 1XMQK 3O1WA 5DMRA 4WFBL 1HQEA 1NK0A 4R79A 3HM8A 4CEQA 4IOCL 5B8HA 3LDSA 1FW6A 4M3XA 3H1VX 1S1TA 3EL2A 4MDBA 2O8CB 3IDHA 4G1QA 4BC4A 1OH8A 1RT3A 4CF8A 5BR8K 1RCHA 1O1WA 4CBWA 1QSYA 3KJVA 3HTVA 4DSJA 2NRZA 2BANA 4IOXA 4M3UA 3DLGA 1GLFO 4U67L 3F73A 1DTTA 1HR0K 3O9QA 4B9QA 1Q86O 3O9TA 1U2VA 4LY7A 1UA1A 4FJ9A 5AQRA 4Z4EA 1R0AA 1FK9A 1MWKA 1K6YA 3FFIA 1W9HA 1GLBG 1Q8IA 4M41A 3O4WA 2Q31A 1HJOA 4DMNA 1Q9YA 3CHWA 5AQJA 3K0SA 4WFAL 3SZ2A 1NU0A 3ZSYA 4DR7K 4OKKA 1XHXA 1Q7YO 2HNDA 1VQLN 3D2EA 3P38A 4FYDA 5HOOA 3KTQA 4AF1A 4HCBA 3GDQA 3PX4A 4XIUA 4CW7B 3SNNA 1RBVA 2ZWHA 4BGBA 3CC4N 3VQ4A 4CERA 2V7ZA 1HRHA 1TYQA 3VGMA 3LWLA 4HCCA 4GV3A 2HHSA 2ATQA 1YVNA 3ATVA 3PX6A 4F9OA 3F9KA 2QWLA 3NF9A 4KFBA 2O8FA 3H6EA 3WNEA 3L2QA 2QWNA 3HL8A 1FJGK 3EE8A 1Q81O 3QIPA 1JLGA 3VGKA 3WT0A 1BIUA 1NOZA 2HSTA 4FWKA 3DLBA 2V52B 4DTUA 1NWKA 4N76A 1S9EA 4DTSA 5EU7A 4CGDA 4FPBA 3CIPA 4WF9L 4JV5K 2DFHA 5M1OA 4B8AB 1SKSA 4J2AA 4EZ6A 2OPRA 1TK8A 2P9NA 4B3OA 4JKAA 4PKGA 4CHNA 3CMAN 3CQ8A 1EWQA 4FLUA 5J2PA 1ASWA 4KHPK 1JLCA 1V4TA 3VQ6A 4CEFA 1HYZA 3TTCA 1VSKA 3NHGA 4CJSA 3CC2N 4QS9A 4WQ4A 4RW8A 5AQQA 5AZIB 3THVA 1M90O 4IBNA 1S6QA 1T6DA 3WNFA 2ZD1A 4BRHA 1RTDA 5FPMA 2D1KA 5E41A 5J2MA 1NK6A 2GV9A 5AR0A 3KD5E 1K73O 2FF3B 3WXJA 2GELA 2NLXA 3AVGA 3C6AA 3C6UA 4GW6A 1CZBA 1HYSA 3GBTA 4GNIA 3O80A 4JKCA 5AQHA 2UYTA 4PA1A 4DTJA 4B1ZA 2KKZA 3O9RA 4AHUA 4DQQA 3EEQA 3LDPA 4CFBA 3CMEN 4H5TA 1I39A 3ENOA 4DFPA 1U6ZA 1TL3A 1RDCA 3C94A 2P9IA 4WQ5A 3NVMA 2E88A 3T7ZA 3D2FA 3OYBA 3NDKA 4FJ7A 3AVAA 2O8BB 3CI5A 4DSLA 3AO4A 1NJZA 3OVNA 2PAVA 3ZYYX 1NK4A 4NCAA 2YNFA 3DLRA 4KB1A 4W5RA 3VEVA 4DSEA 4FM2A 1U4BA 3AAPA 4FLVA 3KHYA 3QESA 2AP1A 2YHYA 4JKDA 4JI3K 4H0YB 3DRSA 1VQ6N 1TUYA 2KLAA 3HM9A 4RW6A 1LOTB 3ZX3A 3KD1E 1C0UA 2ZM6K 3HVRA 3P1GA 4O55A 3FZHA 3HBTA 3W3DA 3E1YA 3VETA 4A62A 2GWKA 2VWBA 4BWMA 2IS3A 3QIOA 4OPHA 4GKJK 1BOTO 2HMIA 3AARA 3QB0A 4MO4A 3Q7CA 5CYMA 4OKJA 1X9MA 2F4VK 4O44A 3I56N 3MXJA 2OPSA 1RDDA 2D0OA 3VEWA 2Q0UA 4Z4HA 4GMJB 2IIRA 3TAMA 3VOVA 4CBXA 1VQ4N 5FDLA 1ZBUA 2G8KA 4B9LA 4HHTA 1U45A 3DM2A 4EHUA 4CJTA 3EZWA 1C1BA 3CFPA 4DF4A 3VQBA 4HTUA 2OANA 1ASUA 1KSPA 5J1EA 2CH5A 4F2SA 3CD6N 5AQWA 1XNQK 3DJCA 3NGIA 2HB5A 3GE1A 4OO1J 1X1PA 2OTLN 5AQKA 1KVBA 4Y1DA 2DTUA 1CZ9A 1Z25A 3DLHA 4B9TA 1NGIA 5AJ3K 3OYCA 3I55N 1T6CA 1TAQA 3OA9A 4WCEL 2ITMA 2FC0A 3ENBA 4PL8A 1VRUA 1WSIA 3ZX2A 3KWGA 1VSHA 1BI4B 5LMUK 3THWA 4K42A 5KTQA 3A5NC 2VQFK 3RSEB 4ZTJA 4ISEA 1HUXA 4DV6K 3T1YK 1ZBHA 3CPEA 1ATSA 1TKXA 2O8DB 3SMSA 2UUCK 3K2PA 4DLGA 4C23A 1TUUA 5AZJA 3OYHA 3SK3A 1TAUA 4FVUA 2BE2A 3O9SA 1TL1A 2LSNA 3AO3A 4BRFA 4B3MK 1QTMA 4A2BA 1GOBA 4EP5A 1HX1A 1HNVA 4PWDA 3UKRB 1U49A 4DKWA 4Y0WA 4FL9A 4BRPA 4K43A 2HNZA 3ULEA 4NCGA 2G8HA 1NKEA 5AQMA 1F21A 1ZXOA 1MA9B 4B8CA 3E9PA 4FWNA 3SBGA 3ZSOA 4YOUA 2D0BA 3VQ9A 1T8EA 4FJ5A 2NUBA 2BTFA 3P83D 4Q0BA 2P9UB 3THXB 2PFUA 3OYEA 1HLUA 2QK9A 4KHSA 1D5AA 4CEEA 1N32K 3HP6A 1Z6RA 5AFUH 4EP4A 1CLQA 2ZJPL 1S22A 2ZJQL 1RDAA 2CGLA 3AAQA 3B6OA 1YI2N 4CJKA 5IT9O 1SQKA 1ITGA 4DR5K 2VCPA 3CJ7A 3CERA 2P9LB 3HVTA 5M1QA 1VQPN 3O4QA 1K8KA 2BH1A 2NZTA 1EQYA 2OA8A 1U48A 5HBMA 3VQCA 3KLFA 1QVFM 1E4FT 4MFBA 4CECA 4WFNL 4E1JA 2E2PA 2D0CA 5CZ1A 4LSLA 5M1PA 4BREA 4OGEA 2ZGZA 4N5SA 3UKUA 4F8RA 4DQRA 1TK0A 3VTHA 4LSNA 3RR7A 1FXXA 5SZTA 5HLFA 3FE1A 4KBOA 4FJNA 2QWPA 3TABA 2G8FA 3CCQN 3RR8A 1Y64A 5CY4A 1EETA 3D6RA 4CGIA 1NK7A 2HHXA 5JVGL 4Z0UA 3AY9A 2KW4A 3KK3A 3EY1A 1Z05A 4CJVA 1XC9A 3DOLA 1U47A 4CHOA 1BIZA 1TKZA 3GL1A 2JLEA 4DU1A 1WSGA 4RW4A 3UIQA 1D8YA 1GLAG 5A2QO 4B08A 1KTQA 3MMVA 3H45C 2HF4A 4AILC 2UUBK 5KRSA 2CGKA 5AQNA 3OW2M 4JKHA 4ZTFA 1EKEA 3TARA 2FBVA 2UXCK 2HW3A 2YHWA 4CJQA 3THYB 1HMVA 2GWJA 2HNYA 4NO7A 3VF2A 1RTHA 3A5OC 5BN8A 3R8EA 1TV6A 1YIJN 3VQEA 4WQ4C 4MQ3A 4OGCA 3QO9A 4DLEA 2O8EB 2FXUA 4CJUA 1JXEA 1UOCA 3RRGA 2E2OA 3JSMA 4GV6A 3OHRA 1G99A 3I33A 3VEYA 4CD1A 2FSNA 3MEGA 5AQUA 2Z1IA 5FRNA 4Y1CA 1RT6A 2NRHA 2QWQA 2G8UA 4DWIA 4XH5A 2W6KA 4GKKK 3AVJA 5F1XA 1JLEA 4MDAA 2YJEA 4IZ9A 4CD3A 4DV1K 5JLHA 1HKBA 4AHVA 4RWTA 1NK5A 4EAHD 1YTAA 3DXKB 1ZBIA 4BE1A 2YV0X 2KFNA 4H4MA 1S3XA 4V19S 3R1XA 3QMLA 4KHUA 3CFRA 3LZJA 3SBTA 1NGJA 2D5RA 4FLZA 3TTDA 2E2QA 4L3QA 1NKCA 4FLYA 4BE2A 1QS4A 5FPNA 5GADP 3CYMA 2R7YA 1BWFO 3NF6A 4DB3A 1ASVA 3OYNA 3PX0A 2NNWA 2F7TA 4H5VA 2A40A 1JCEA 3P4IA 4BY9C 2FBYA 3M3ZA 3ZETA 5LY3A 3RWUA 5KGXA 4JK9A 1L3TA 4KH4A 4YORA 2DFFA 3SQ4A 3ZSZA 1X9WA 3QFUA 4DTXA 5LJVA 2Q97A 2F8TA 2YHBA 4AHSA 2A3ZA 4JN4A 4W5QA 4NLCA 4O0JA 1QVGM 2VG5A 2G8VA 3HYFA 1DGKN 4BDZA 3LM2A 3OBWA 3BEXA 1IJJA 3ALYA 3C6HA 1TKDA 1OVQA 2QTDA 5BN9A 5M1FA 4F3TA 1RT4A 1N34K 1KLMA 4CEBA 4IEEA 4CEOA 1K9MO 5EY4A 5BPMA 4FWSA 3CM6A 1LCUA 4IDKA 4CJEA 3L3VA 2VWJA 4JS5A 5I42A 3DOKA 4MLHA 4KHNA 5H1SQ 3T1AA 2W6LA 4C8MA 1B92A 3BGRA 3VPZA 4BC5A 4FJIA 4H4OA 4BDPA 2JWKA 3U3YA 3CCMN 2QXLA 3C7NA 5LL6Z 3BY5A 3VF6A 4M3ZA 4QOZB 4BRNA 2KZMA 3SPZA 4A2AA 4CGFA 2E1YA 4FZZA 2P9KB
chains in the Genus database with same CATH topology
4YY3K 1J5EK 4JI1K 4V19S 1HNZK 4DR7K 4NXNK 5AJ3K 5LMNK 3J81O 4DV0K 4LFBK 4K0KK 4JI6K 4LF7K 2VQEK 2UXDK 3T1HK 4DR4K 4DV4K 4OX9K 4NXMK 4JI2K 4LF6K 4CW7B 2E5LK 1HNXK 5IWAK 5LMUK 2VQFK 4X62K 3T1YK 4DV6K 4LF4K 2UUCK 1IBKK 4LF8K 3J7AP 1IBLK 1I94K 3OTOK 4DR3K 1HNWK 4DUZK 4DR6K 1FJGK 4B3MK 4LF5K 4JI4K 5A2QO 4LF9K 4B3SK 2UUBK 4B3TK 1XMQK 5FLXO 4DV3K 4JI5K 4JI3K 2UXBK 2UXCK 4DV2K 4X66K 4AQYK 4JV5K 3JAMO 2ZM6K 4DV7K 1N34K 1IBMK 2UUAK 4LFAK 4JI0K 4JI8K 4CVNE 1XMOK 4GKJK 2UU9K 4DV5K 4KHPK 2F4VK 4DR2K 4X64K 1N32K 5BR8K 4B3RK 3J80O 2HHHK 4LFCK 4JYAK 4DUYK 1HR0K 1XNRK 4X65K 5IT9O 4YHHK 4JI7K 1N36K 4GKKK 4DR5K 5LL6Z 4DV1K 1N33K 1XNQK 4DR1K 3J7YP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 K;  1J5E K;  4JI1 K;  4V19 S;  1HNZ K;  4DR7 K;  4NXN K;  5AJ3 K;  5LMN K;  3J81 O;  4DV0 K;  4LFB K;  4K0K K;  4JI6 K;  4LF7 K;  2VQE K;  2UXD K;  3T1H K;  4DR4 K;  4DV4 K;  4OX9 K;  4NXM K;  4JI2 K;  4LF6 K;  4CW7 B;  2E5L K;  1HNX K;  5IWA K;  5LMU K;  2VQF K;  4X62 K;  3T1Y K;  4DV6 K;  4LF4 K;  2UUC K;  1IBK K;  4LF8 K;  3J7A P;  1IBL K;  1I94 K;  3OTO K;  4DR3 K;  1HNW K;  4DUZ K;  4DR6 K;  1FJG K;  4B3M K;  4LF5 K;  4JI4 K;  5A2Q O;  4LF9 K;  4B3S K;  2UUB K;  4B3T K;  1XMQ K;  5FLX O;  4DV3 K;  4JI5 K;  4JI3 K;  2UXB K;  2UXC K;  4DV2 K;  4X66 K;  4AQY K;  4JV5 K;  3JAM O;  2ZM6 K;  4DV7 K;  1N34 K;  1IBM K;  2UUA K;  4LFA K;  4JI0 K;  4JI8 K;  4CVN E;  1XMO K;  4GKJ K;  2UU9 K;  4DV5 K;  4KHP K;  2F4V K;  4DR2 K;  4X64 K;  1N32 K;  5BR8 K;  4B3R K;  3J80 O;  2HHH K;  4LFC K;  4JYA K;  4DUY K;  1HR0 K;  1XNR K;  4X65 K;  5IT9 O;  4YHH K;  4JI7 K;  1N36 K;  4GKK K;  4DR5 K;  5LL6 Z;  4DV1 K;  1N33 K;  1XNQ K;  4DR1 K;  3J7Y P; 
#chains in the Genus database with same CATH topology
 4YY3 K;  1J5E K;  4YOT A;  4B9U A;  4HUE A;  1C0F A;  3CCU N;  5BRF A;  3U3G A;  4JI6 K;  4LF7 K;  4OJR A;  5CR4 A;  2UXD K;  2AJQ A;  1NGD A;  3V9Z A;  4JK8 A;  4CK3 A;  4DTO A;  4NXM K;  3S41 A;  1HNX K;  1NGH A;  4YOW A;  2QWO A;  3C65 A;  3BF3 A;  1WSH A;  4CZJ A;  4O5B A;  1CZA N;  3OS1 A;  3ZSQ A;  4U7B A;  4DR3 K;  4FJL A;  4A5B A;  3LM9 A;  2XY6 A;  3NFA A;  1IG8 A;  1SZ2 A;  1P90 A;  3AA4 A;  5C24 A;  4FWL A;  4CHZ A;  3NGZ A;  1XHZ A;  3NH2 A;  4CJ7 A;  2AA4 A;  4OLA A;  1RIL A;  1Q18 A;  4KH5 A;  2XO7 A;  3S3N A;  2QKB A;  1ZBF A;  5AQG A;  1JL2 A;  2FBX A;  3ASM A;  5C25 A;  3RMC A;  1O13 A;  2OTJ N;  4LH5 A;  2F96 A;  3WEE B;  3VA0 A;  2GX9 A;  5HRS A;  2P5G A;  4CCH A;  3WNH A;  3L4Q A;  1A5V A;  1QHT A;  3M8S A;  4ILG B;  1JLF A;  1A5X A;  3DRR A;  1VSI A;  1YXQ A;  4DV7 K;  1RDB A;  1GLE G;  4E7I A;  1LAW A;  4N41 A;  4JKE A;  1H1V A;  4KRF A;  4E19 A;  4H8K A;  5TKW A;  3K9K A;  3G0Z A;  3AVC A;  2KTQ A;  3D45 A;  3QET A;  3AVF A;  1BQM A;  1S1X A;  2HHH K;  3QBX A;  1VSL A;  3Q7B A;  4K41 A;  1S6P A;  3SUN A;  1L3V A;  1VQ5 N;  1YT3 A;  2VG7 A;  5BPN A;  4YHH K;  3JYT A;  3ID6 A;  2VGM A;  5AQS A;  1N36 K;  4BRK A;  3WXI A;  1T05 A;  5AQT A;  1KD1 O;  1XUP O;  4XH4 A;  3QFP A;  4IO9 L;  4NYF A;  3VQD A;  3BUZ B;  4CFC A;  4DCH A;  1Q82 O;  2Z1G A;  3PUF A;  4JI1 K;  4GY2 B;  4CJL A;  1RDU A;  4ICL A;  4JAX A;  4NXN K;  2Q1N A;  2VQE K;  4FK0 A;  1LWE A;  1KXP A;  1L3U A;  3NAE A;  2HBJ A;  3KLH A;  5KGW A;  4W5O A;  4LF6 K;  4CZL A;  4E0D A;  1LW2 A;  3IRX A;  1KVC A;  5CZ2 A;  3HOT A;  3CJ9 A;  5IWA K;  3NGY A;  4CZE A;  1QZ6 A;  3RRH A;  1WBD A;  3PO5 A;  3VES A;  4AM6 A;  1A5W A;  1WN7 A;  4JK7 A;  4BC3 A;  1IBK K;  3T69 A;  1IBL K;  3KIO A;  1IG9 A;  3U8X A;  2A41 A;  3ZT1 A;  4YOX A;  1BI4 A;  2EX3 A;  4DS4 A;  4PHT X;  4DS5 A;  1BCO A;  1RBT A;  3K5N A;  3EYZ A;  1HKG A;  4FM0 A;  4DQI A;  3DLK A;  4HTL A;  4B3T K;  4OPK A;  2A1S A;  2WC9 A;  4QS8 A;  1QQN A;  4JI5 K;  1TK5 A;  4O0I A;  2HHV A;  3AVB A;  4CBU A;  1J54 A;  4F4K A;  2OPP A;  4LD0 A;  1C1A A;  1LWF A;  1KAY A;  3IFR A;  4CFA A;  3F5T A;  1IBM K;  4GV9 A;  3R3L A;  3HPH A;  4JI0 K;  3KLE A;  4CVN E;  1XMO K;  3D2E B;  5CYQ A;  4KAZ A;  4W5T A;  4PQU A;  2BUP A;  2O4I A;  3HT3 A;  4BWJ A;  2QM1 A;  3UB5 A;  3NH0 A;  4CJF A;  4FWQ A;  4CF1 A;  1TYQ B;  3IG1 A;  3C0B A;  4O4G A;  4ELV A;  3VQ8 A;  2P9U A;  5JVH L;  3THX A;  2VWK A;  1QZ5 A;  3JS6 A;  3NBP A;  4I6M A;  4CEZ A;  2YX6 A;  4N56 A;  1YJN N;  3HJF A;  4EFH A;  3SUQ A;  1JXB A;  2HHT A;  1NMN A;  4FZY A;  5M1N A;  3SJJ A;  1BGX T;  3NVK A;  4CED A;  3G10 A;  4DFJ A;  1SV5 A;  1BG3 A;  2HHQ A;  3OYL A;  2F9T A;  1XI1 A;  3O8M A;  5LMN K;  5BRE A;  2WTU A;  3V9S A;  2YKN A;  4IFV A;  1JCF A;  1FKP A;  1S9G A;  4BDY A;  1YJ9 N;  3PLA A;  4ISG A;  3OJU A;  4FXD A;  3RMD A;  2FF6 A;  2B6A A;  3HO1 A;  5AQX A;  3VMF B;  4NYN A;  5SWM A;  5AQY A;  3L4I A;  3WNG A;  2A1R A;  4FLT A;  4DQP A;  2YNH A;  1QSL A;  3NF7 A;  4H0O A;  2F9W A;  3EE9 A;  5LJW A;  3QEI A;  1I94 K;  3LAK A;  4DSI A;  4M3R A;  1W7A A;  2RKI A;  3RMA A;  2IGI A;  1RTJ A;  3TTF A;  3QIN A;  2ASO A;  3TAQ A;  1KC8 O;  2RHK A;  3OYI A;  3ID8 A;  4JHD A;  1VQO N;  1NJI O;  2IC3 A;  2OPQ A;  1OVY A;  3BP8 A;  2PYJ A;  1S72 N;  2YJF A;  5J2N A;  4XEI A;  3BZC A;  2P9P B;  3TAF A;  5FRM A;  1EXQ A;  5T7B A;  3H1Q A;  4J2D A;  3V1O A;  2QXF A;  1ZBL A;  1IKY A;  4FW2 A;  3KKS A;  5TKY A;  1DEJ A;  1YF5 L;  2BGG A;  3PIO L;  2G8W A;  3QLH A;  2HVH A;  4DV5 K;  3DWL A;  4IDH A;  3DRP A;  1SL0 A;  1KRP A;  4A61 A;  4Z4G A;  4RCH A;  4BG8 A;  3J80 O;  4IOA L;  3NH1 A;  1QSS A;  3D2F B;  1W97 L;  4CIF A;  2O8E A;  3BZK A;  1BUP A;  4BRG A;  2ZE2 A;  2RPI A;  3ZT4 A;  2XY7 A;  3O9U A;  1JKH A;  1RT7 A;  3FLC O;  2KZZ A;  4IWV A;  1XQS C;  2YI1 A;  3MN6 A;  2E4L A;  3H08 A;  5ADX A;  4KH6 A;  1N33 K;  1VQ7 N;  4BRQ A;  3VEX A;  1WAF A;  3L2R A;  1KLN A;  4IG3 A;  2HF3 A;  1HPM A;  2WFB A;  4C8N A;  4CZI A;  4AHT A;  3LP3 A;  1WUA A;  1YIT N;  4JLH A;  2JGU A;  2DFE A;  4CHP A;  3P39 A;  1LV5 A;  3TPQ A;  2QWR A;  2HBL A;  4BR0 A;  4Z4F A;  1VQ9 N;  5EOY A;  1HNI A;  3TI0 A;  3MEE A;  4YDU C;  4YNQ A;  4FOI A;  5AQF A;  1ATR A;  3OTO K;  1EO1 A;  3P31 A;  4DTP A;  2E2N A;  3MN5 A;  5MLC Q;  3OYD A;  4BR4 A;  1SS6 A;  4FWR A;  4LF5 K;  1QQO A;  1C6V A;  1YJW N;  4B9S A;  3JXU A;  3EO3 A;  4BVP A;  4KTQ A;  3G6E N;  1D9F A;  1DLO A;  4KHW A;  3MCP A;  4FSV A;  3VGL A;  4FW1 A;  1WBB A;  3F2K A;  4Z94 A;  4FWM A;  4UQG A;  4JKF A;  3LAL A;  5KQ8 A;  4X66 K;  1R59 O;  2E1Z A;  4DG1 A;  4ELU A;  3ZSR A;  2KFZ A;  3DLE A;  3U9D A;  2A6A A;  2Q36 A;  5KRT A;  5KPR A;  4KKO A;  4PL7 A;  4IXC A;  5C2F A;  3MAQ A;  4DF8 A;  3EZ5 A;  1X3M A;  1WB9 A;  4JKG A;  1GLL O;  4PKI A;  3P5J A;  4GVE A;  2GUP A;  4X64 K;  2HHW A;  5JS1 A;  3FZK A;  3AA3 A;  1ZYQ A;  1KQS M;  4DUY K;  3SQ0 A;  3WUH A;  1CXU A;  3THW B;  3MN7 A;  1XNR K;  1VRT A;  1RNH A;  4OLB A;  5GAG P;  3KLG A;  2GUI A;  4HUG A;  4NB4 A;  5GIN A;  3K5O A;  5AZJ B;  5HRN A;  3GG4 A;  2PY5 A;  1W2B M;  3I8D A;  4I9Q A;  3HRG A;  2PYL A;  3E66 A;  3IKM A;  4FK2 A;  4ILJ A;  2IAJ A;  1B9D A;  3CCS N;  1EWR A;  4I9L A;  3PSI A;  2WBN A;  2O8C A;  3ZSX A;  4LFB K;  3LL3 A;  2YNG A;  4WE1 A;  1M1K O;  3TAE A;  5C0Y A;  3KK7 A;  2ASP A;  3MWP A;  4CIG A;  5AQV A;  1JL1 A;  3LPT A;  2DY4 A;  1IV0 A;  3DYA A;  2X6S A;  2X74 A;  3UE5 A;  1N5Y A;  1Q9X A;  4LF4 K;  4CGH A;  2I5J A;  1KAZ A;  4CEA A;  3CC7 N;  1DTQ A;  1GOA A;  4E7L A;  2KQ2 A;  4J8F A;  4M7X A;  2PZS A;  4E7H A;  4M7Y A;  2V51 B;  3O5B A;  3TAN A;  4DR6 K;  3FZL A;  4BRA A;  3M8P A;  4FJM A;  3V9U A;  1RBR A;  4KI4 A;  2NRT A;  4ZHR A;  3PV8 A;  5C12 A;  1YHQ N;  2JWL A;  3NF8 A;  3ISN C;  5K14 A;  1NGE A;  2CH6 A;  3VQ7 A;  3WXL A;  4CES A;  2FBT A;  2ZF5 O;  2YKM A;  3K58 A;  2F8S A;  3OS0 A;  1J53 A;  1RT5 A;  1ZBS A;  2A42 A;  4E7K A;  1L5U A;  3U9Z A;  4CHQ A;  1GLC G;  1VQM N;  4B1W B;  3UKU B;  4FZX C;  1T44 A;  3K57 A;  2Z1J A;  3ATU A;  1UWB A;  1JJ2 M;  1VSE A;  4H0X B;  4LFC K;  1EP4 A;  1NG9 A;  2GBZ A;  4BR7 A;  5GAH P;  4PKH A;  1BA0 A;  3AO2 A;  4X65 K;  4BRM A;  4CK2 A;  4ID1 A;  4KTZ A;  1HJR A;  4B1V A;  5GIP A;  3CQY A;  3ZT2 A;  4EZ9 A;  1TGO A;  1WNS A;  3O3F A;  4H5R A;  3OYF A;  3FR0 A;  3DXM B;  1JLQ A;  4FPA A;  4C8O A;  3KLI A;  3V81 A;  4O5F A;  3L8B A;  3BDP A;  3VQQ A;  1VQK N;  3WXK A;  4KO0 A;  1L3S A;  1ZC6 A;  1LAV A;  3VER A;  4OPJ A;  3EN9 A;  2WON A;  1NJX A;  2XY8 A;  3MX2 A;  3SLC A;  1DKG D;  3L2V A;  3TWH A;  5C2D A;  4CHY A;  5AZI A;  3NMU A;  4OPA A;  1ESV A;  1HPZ A;  4YFU A;  3A5M C;  2VG6 A;  3N4P A;  1WLJ A;  2P9S B;  4CF2 A;  3U6F A;  1WSF A;  3R9P A;  4YOV A;  4CJ5 A;  1NGB A;  4FJJ A;  3D0P A;  1BHL A;  3H3O B;  1XC3 A;  4CJ3 A;  3L3U A;  5CHI A;  3SJH A;  3ITH A;  4A57 A;  4MLE A;  3PY8 A;  4I2Q A;  2ZGY A;  1RBS A;  4IJA A;  3QDK A;  4CJW A;  4OKE A;  1KVA A;  4C1N I;  3V9W A;  3RTV A;  4BR5 A;  3HP9 A;  3KVG A;  3SYZ A;  4JD2 B;  2E8A A;  2YHA A;  2P1J A;  1SL2 A;  4LH4 A;  3AV9 A;  4CZH A;  3IUC A;  5DM7 L;  3VTI A;  3ZX0 A;  2UUA K;  2O8B A;  5F0X A;  3LWM A;  4OVL A;  3LDL A;  1NNE A;  1VAZ A;  4YDU A;  2ETJ A;  4F2R A;  5EVZ A;  4B3R K;  3K5L A;  5ELZ A;  1IKX A;  4CZM A;  3CCL N;  4CZG A;  3ZT3 A;  4AHC A;  1BQN A;  2Y1J A;  4BR2 A;  4IKF A;  1P8Z A;  2P5O A;  1K8A O;  1VSF A;  5C15 A;  4M3W A;  3OYA A;  1BU6 O;  1RFQ A;  3ZET B;  5EX5 A;  2DPN A;  1HQU A;  4BRO A;  4B9N A;  1VK0 A;  4B1X B;  1NGF A;  1E4G T;  5J2Q A;  4RW7 A;  2XRI A;  4JNE A;  1YVU A;  2E20 A;  1HYV A;  4KTW A;  4B9V A;  3CJA A;  5HRP A;  2HVI A;  1RDW X;  3IMX A;  4FOE A;  3SUO A;  5DK5 A;  3S3M A;  1RTI A;  3OYG A;  2FSK A;  5JIC A;  3ZCM A;  3AVH A;  4BG9 A;  4DV4 K;  4DR4 K;  3MXM A;  3ZEU B;  4KV8 A;  3NE6 A;  3WXM B;  3SAG A;  2E5L K;  3M6G A;  4EHT A;  4DTM A;  4BQL A;  3SQ2 A;  1SKR A;  1BIS A;  2O4G A;  2W40 A;  3LP2 A;  2IVP A;  3QNN A;  1NM1 A;  3MK6 A;  4HUF A;  2XY5 A;  4BRL A;  1KCF A;  1BDG A;  1VSD A;  3DLL L;  3V1R A;  3HSC A;  2G8I A;  1S1W A;  4CK1 A;  1QQM A;  2H3G X;  3E01 A;  4J2B A;  5GIO A;  3KK1 A;  3G4S N;  1C0G A;  4FJH A;  4M45 A;  4F3O A;  4KI6 A;  3OBY A;  4B3S K;  3QIC A;  3L2W A;  5FLX O;  1TKT A;  5JS2 A;  3BF1 A;  1SL1 A;  3C7N B;  2B5J A;  3LDQ A;  1IO2 A;  2EHG A;  4CGG A;  3LZI A;  1REV A;  2BDP A;  2Z1H A;  4H0T B;  3JAM O;  2XHB A;  3CCE N;  2X78 A;  3V1Q A;  1NOY A;  3HST B;  4JS4 A;  2RF2 A;  3D7E O;  1FKO A;  5KPT A;  1YUW A;  3RSE A;  5FRO A;  1TVR A;  4JI8 K;  1IH7 A;  2O8D A;  2P9P A;  4CZF A;  4ID5 A;  4IG0 A;  1SUQ A;  2ASM A;  5HRR A;  1U2V B;  1NJY A;  1NK8 A;  3AVI A;  3DI6 A;  4DTN A;  2GEM A;  4BR9 A;  5ADX H;  4JYA K;  4FLW A;  4EIA A;  4L8R B;  1T3V A;  4K25 A;  3UKR A;  3O3G A;  5BR9 A;  2VYP A;  1VSJ A;  4DTR A;  2FSJ A;  4E1N A;  2IDO A;  3HZ6 A;  3QBW A;  5HP1 A;  3J7Y P;  5KQD A;  2HHU A;  1QE1 A;  4RG8 A;  3KK2 A;  4LC9 B;  4CIE A;  5D3G A;  3ZSW A;  4Z4C A;  1UA0 A;  2IOC A;  3HK2 A;  3TSQ A;  1X3N A;  1VQN N;  4KRE A;  2VGN A;  4FO0 A;  4QS7 A;  4K0K K;  3SPY A;  2OZM A;  5C10 A;  2E6L A;  4FVM A;  4BRC A;  2O8F B;  5KI6 A;  3ULD A;  5JLF A;  2EWS A;  4PY5 A;  1NLV A;  1V4S A;  3SQ1 A;  5BRH A;  4DSF A;  3A0I X;  3CJC A;  1X9J A;  3DMJ A;  3F9M A;  3O08 A;  1BCM A;  4CJR A;  3E9O A;  2P9L A;  5I3U A;  1T03 A;  1HNW K;  1UAX A;  1LWC A;  3I0R A;  3KZB A;  3HPG A;  5FPD A;  2HOE A;  3KWI A;  3DAW A;  1I3A A;  4LF9 K;  4QAG A;  5AQZ A;  3QEP A;  4YOY A;  1U04 A;  3HOS A;  1J5O A;  1IKW A;  2P9N B;  4FK4 A;  4FLX A;  2UXB K;  4DV2 K;  4DFK A;  3MWT A;  3QEW A;  1GLD G;  3LAN A;  4BRD A;  4H5N A;  2OZS A;  3PO4 A;  4W5N A;  2RE2 A;  3L0Q A;  4FM1 A;  1CXQ A;  3CCJ N;  1E3M A;  1Z26 A;  4BC2 A;  3RMB A;  4O8U A;  3QEV A;  3RVC A;  3O6W A;  4O8K A;  4FWO A;  5BRD A;  4CF0 A;  2ZQB A;  2NRW A;  3O3H A;  2HBK A;  2CGJ A;  3I0S A;  5CE3 A;  5DM6 L;  4IEI A;  4E3S A;  1NKB A;  4JI7 K;  1RBU A;  3AA2 A;  3SV3 A;  2FLO A;  3W0L A;  4MO5 A;  4C1N K;  4NCB A;  3THY A;  4TSX A;  3TR8 A;  1D4X A;  4GVM A;  3VQA A;  3M8Q A;  2P9I B;  1X9S A;  2D0P A;  3LAM A;  3CPW M;  4DU3 A;  3VQP A;  1LW0 A;  3TSP A;  2J4R A;  3I8B A;  4DV0 K;  4CJP A;  2QKK A;  1MU2 A;  2QW9 A;  3LP0 A;  3AVK A;  4CGJ A;  4DQS A;  3VEN A;  3ZT0 A;  3B8A X;  5AQL A;  3O1B A;  1BA1 A;  4BE0 A;  4M3T A;  4QCL A;  4KPY A;  4CJ4 A;  3OYJ A;  3J7Z O;  2QA4 N;  3H3N O;  4BVO A;  1SKW A;  4B9M A;  3TAG A;  4JRQ A;  1WSJ A;  3SAF A;  5HL7 L;  3T19 A;  2NRR A;  3VN5 A;  4AH9 A;  4JKB A;  3DXK A;  3C6T A;  4HWI A;  5KPZ A;  1RT1 A;  3E9L A;  2KHO A;  2HBM A;  3B6P A;  4JI4 K;  3S3O A;  4CI6 A;  5FPE A;  3V9X A;  3SV4 A;  2YHX A;  2B4J A;  4CFD A;  3FFK B;  2HMP A;  4I6M B;  5HRO A;  1NMD A;  4M63 C;  4DQ8 A;  4IFE A;  3N4Q A;  2NRV A;  2WUS A;  4DHY A;  2QI2 A;  3LP1 A;  2E6M A;  3V6D A;  4AHR A;  3IAY A;  4E89 A;  1KFS A;  3K9J A;  1W0H A;  3PSF A;  3OJS A;  1D9D A;  4BRI A;  3V4I A;  2UU9 K;  2YCH A;  3WQU A;  3M1F A;  1OH5 A;  3VEZ A;  4JRP A;  4FJK A;  4M42 A;  3TSU A;  3LDO A;  2W42 A;  3K5M A;  3OYM A;  4DR2 K;  3A2F A;  4ILH A;  1OH7 A;  4ISF A;  2ZJR L;  2Q3S A;  3OS2 A;  1HKC A;  3R6M A;  3MCA B;  3MED A;  2ITG A;  3A5L C;  3TU5 A;  1QHA A;  1WAJ A;  3M8R A;  2V7Y A;  5AQI A;  3CCR N;  4PUO A;  3VF4 A;  1BO5 O;  1KAX A;  4CF9 A;  3G25 A;  3FZF A;  4IJN A;  4FWP A;  4DR1 K;  4H0V B;  3H46 O;  4A5A A;  1N8R O;  2I7N A;  4ELT A;  3EKU A;  1N6Q A;  4DFM A;  3S9H A;  3QEX A;  4JHD B;  1HNZ K;  1NBW A;  3O4N A;  3J81 O;  3K59 A;  3AA5 X;  3OYK A;  4C8K A;  4Z4I A;  1VSM A;  2D0A A;  3CFO A;  3MN9 A;  3T1H K;  3ENH A;  2QWM A;  3DXM A;  4JI2 K;  5GAE P;  5E84 A;  4G9Z A;  1C1C A;  1G15 A;  2PBD A;  4B1U B;  1GOC A;  3EKS A;  4I7F A;  4X62 K;  1SAZ A;  1GLJ O;  2W41 A;  2NRX A;  1YAG A;  3LDN A;  1NK9 A;  4M3Y A;  3CF5 L;  4BGA A;  1J9A A;  3LPU A;  3ULE B;  4DUZ K;  2P9K A;  4FJG A;  3G71 N;  4FJX A;  3MDQ A;  1C0T A;  1RT2 A;  3ZLJ A;  4B1Y B;  4RW9 A;  3IS9 A;  3CM5 A;  3CG7 A;  3SCX A;  2OCE A;  2Q2R A;  2P9S A;  4Q5V A;  5AQP A;  3CJ1 A;  4WYB A;  4XH1 A;  3KKR A;  4DV3 K;  2QEX N;  4E7J A;  4C8L A;  1RGI A;  3C95 A;  3FZM A;  4FCY A;  4E1M A;  2A5X A;  2GTD A;  2Q0R A;  1JLA A;  1WSE A;  3WQT A;  1DT9 A;  1S1U A;  1S5J A;  4AQY K;  4K8X A;  2D4W A;  3A8Y A;  3M5R A;  3J8A A;  3CJB A;  3CXC M;  4LFA K;  3HI0 A;  1ILY A;  4HVJ A;  5F2R A;  1OKJ A;  3MX5 A;  4JD2 A;  2I7P A;  4WQ5 C;  3AVM A;  3ZSV A;  3FGU A;  3AVL A;  1OH6 A;  4UY8 O;  3AO5 A;  4R5P A;  1T7P A;  1K8K B;  5I9E B;  3U4L A;  3HPO A;  4A59 A;  3GOI A;  5EXW A;  4DU4 A;  3T3F A;  4CE9 A;  1BL3 A;  1JLB A;  2RN2 A;  5AFU A;  3CCV N;  5C42 A;  3SI6 A;  3AVN A;  4AM7 A;  3VA3 A;  4J2E A;  5JMV A;  3SUP A;  3WEE A;  4JEP A;  1KFD A;  1B9F A;  1VQ8 N;  4KHY A;  4H03 B;  4H0P A;  3QER A;  1NGA A;  4KB0 A;  3TAP A;  5AQO A;  1QQC A;  4IO8 A;  5E26 A;  1C0M A;  2WOM A;  4OX9 K;  1J6Z A;  4H5W A;  1NJW A;  4DSK A;  3SAH A;  3OY9 A;  1IKV A;  2X6N A;  2IVO A;  4IFY A;  1MWM A;  1JCG A;  3MEC A;  1XWL A;  3VQ5 A;  4K8Z A;  1VHX A;  3AGK A;  2IVN A;  2P51 A;  3HXM A;  1WOQ A;  1EX4 A;  4NLB A;  3AGR A;  3L6Q A;  3L2U A;  3CQX A;  4BAC A;  4KHQ A;  4JKG B;  1ATN A;  1NGG A;  4N47 A;  3ZEU A;  3AO1 A;  2Y1I A;  4LF8 K;  4FJ8 A;  3J7A P;  4BQZ A;  5BPL A;  1MDU B;  3MXI A;  1Y97 A;  1YTU A;  3CET A;  3NCI A;  3QNO A;  4CZK A;  5M1K A;  4RTF D;  4I2P A;  1S1V A;  2YNI A;  3SMP A;  1NGC A;  3PIP L;  2OYQ A;  3VEO A;  1XMQ K;  3O1W A;  5DMR A;  4WFB L;  1HQE A;  1NK0 A;  4R79 A;  3HM8 A;  4CEQ A;  4IOC L;  5B8H A;  3LDS A;  1FW6 A;  4M3X A;  3H1V X;  1S1T A;  3EL2 A;  4MDB A;  2O8C B;  3IDH A;  4G1Q A;  4BC4 A;  1OH8 A;  1RT3 A;  4CF8 A;  5BR8 K;  1RCH A;  1O1W A;  4CBW A;  1QSY A;  3KJV A;  3HTV A;  4DSJ A;  2NRZ A;  2BAN A;  4IOX A;  4M3U A;  3DLG A;  1GLF O;  4U67 L;  3F73 A;  1DTT A;  1HR0 K;  3O9Q A;  4B9Q A;  1Q86 O;  3O9T A;  1U2V A;  4LY7 A;  1UA1 A;  4FJ9 A;  5AQR A;  4Z4E A;  1R0A A;  1FK9 A;  1MWK A;  1K6Y A;  3FFI A;  1W9H A;  1GLB G;  1Q8I A;  4M41 A;  3O4W A;  2Q31 A;  1HJO A;  4DMN A;  1Q9Y A;  3CHW A;  5AQJ A;  3K0S A;  4WFA L;  3SZ2 A;  1NU0 A;  3ZSY A;  4DR7 K;  4OKK A;  1XHX A;  1Q7Y O;  2HND A;  1VQL N;  3D2E A;  3P38 A;  4FYD A;  5HOO A;  3KTQ A;  4AF1 A;  4HCB A;  3GDQ A;  3PX4 A;  4XIU A;  4CW7 B;  3SNN A;  1RBV A;  2ZWH A;  4BGB A;  3CC4 N;  3VQ4 A;  4CER A;  2V7Z A;  1HRH A;  1TYQ A;  3VGM A;  3LWL A;  4HCC A;  4GV3 A;  2HHS A;  2ATQ A;  1YVN A;  3ATV A;  3PX6 A;  4F9O A;  3F9K A;  2QWL A;  3NF9 A;  4KFB A;  2O8F A;  3H6E A;  3WNE A;  3L2Q A;  2QWN A;  3HL8 A;  1FJG K;  3EE8 A;  1Q81 O;  3QIP A;  1JLG A;  3VGK A;  3WT0 A;  1BIU A;  1NOZ A;  2HST A;  4FWK A;  3DLB A;  2V52 B;  4DTU A;  1NWK A;  4N76 A;  1S9E A;  4DTS A;  5EU7 A;  4CGD A;  4FPB A;  3CIP A;  4WF9 L;  4JV5 K;  2DFH A;  5M1O A;  4B8A B;  1SKS A;  4J2A A;  4EZ6 A;  2OPR A;  1TK8 A;  2P9N A;  4B3O A;  4JKA A;  4PKG A;  4CHN A;  3CMA N;  3CQ8 A;  1EWQ A;  4FLU A;  5J2P A;  1ASW A;  4KHP K;  1JLC A;  1V4T A;  3VQ6 A;  4CEF A;  1HYZ A;  3TTC A;  1VSK A;  3NHG A;  4CJS A;  3CC2 N;  4QS9 A;  4WQ4 A;  4RW8 A;  5AQQ A;  5AZI B;  3THV A;  1M90 O;  4IBN A;  1S6Q A;  1T6D A;  3WNF A;  2ZD1 A;  4BRH A;  1RTD A;  5FPM A;  2D1K A;  5E41 A;  5J2M A;  1NK6 A;  2GV9 A;  5AR0 A;  3KD5 E;  1K73 O;  2FF3 B;  3WXJ A;  2GEL A;  2NLX A;  3AVG A;  3C6A A;  3C6U A;  4GW6 A;  1CZB A;  1HYS A;  3GBT A;  4GNI A;  3O80 A;  4JKC A;  5AQH A;  2UYT A;  4PA1 A;  4DTJ A;  4B1Z A;  2KKZ A;  3O9R A;  4AHU A;  4DQQ A;  3EEQ A;  3LDP A;  4CFB A;  3CME N;  4H5T A;  1I39 A;  3ENO A;  4DFP A;  1U6Z A;  1TL3 A;  1RDC A;  3C94 A;  2P9I A;  4WQ5 A;  3NVM A;  2E88 A;  3T7Z A;  3D2F A;  3OYB A;  3NDK A;  4FJ7 A;  3AVA A;  2O8B B;  3CI5 A;  4DSL A;  3AO4 A;  1NJZ A;  3OVN A;  2PAV A;  3ZYY X;  1NK4 A;  4NCA A;  2YNF A;  3DLR A;  4KB1 A;  4W5R A;  3VEV A;  4DSE A;  4FM2 A;  1U4B A;  3AAP A;  4FLV A;  3KHY A;  3QES A;  2AP1 A;  2YHY A;  4JKD A;  4JI3 K;  4H0Y B;  3DRS A;  1VQ6 N;  1TUY A;  2KLA A;  3HM9 A;  4RW6 A;  1LOT B;  3ZX3 A;  3KD1 E;  1C0U A;  2ZM6 K;  3HVR A;  3P1G A;  4O55 A;  3FZH A;  3HBT A;  3W3D A;  3E1Y A;  3VET A;  4A62 A;  2GWK A;  2VWB A;  4BWM A;  2IS3 A;  3QIO A;  4OPH A;  4GKJ K;  1BOT O;  2HMI A;  3AAR A;  3QB0 A;  4MO4 A;  3Q7C A;  5CYM A;  4OKJ A;  1X9M A;  2F4V K;  4O44 A;  3I56 N;  3MXJ A;  2OPS A;  1RDD A;  2D0O A;  3VEW A;  2Q0U A;  4Z4H A;  4GMJ B;  2IIR A;  3TAM A;  3VOV A;  4CBX A;  1VQ4 N;  5FDL A;  1ZBU A;  2G8K A;  4B9L A;  4HHT A;  1U45 A;  3DM2 A;  4EHU A;  4CJT A;  3EZW A;  1C1B A;  3CFP A;  4DF4 A;  3VQB A;  4HTU A;  2OAN A;  1ASU A;  1KSP A;  5J1E A;  2CH5 A;  4F2S A;  3CD6 N;  5AQW A;  1XNQ K;  3DJC A;  3NGI A;  2HB5 A;  3GE1 A;  4OO1 J;  1X1P A;  2OTL N;  5AQK A;  1KVB A;  4Y1D A;  2DTU A;  1CZ9 A;  1Z25 A;  3DLH A;  4B9T A;  1NGI A;  5AJ3 K;  3OYC A;  3I55 N;  1T6C A;  1TAQ A;  3OA9 A;  4WCE L;  2ITM A;  2FC0 A;  3ENB A;  4PL8 A;  1VRU A;  1WSI A;  3ZX2 A;  3KWG A;  1VSH A;  1BI4 B;  5LMU K;  3THW A;  4K42 A;  5KTQ A;  3A5N C;  2VQF K;  3RSE B;  4ZTJ A;  4ISE A;  1HUX A;  4DV6 K;  3T1Y K;  1ZBH A;  3CPE A;  1ATS A;  1TKX A;  2O8D B;  3SMS A;  2UUC K;  3K2P A;  4DLG A;  4C23 A;  1TUU A;  5AZJ A;  3OYH A;  3SK3 A;  1TAU A;  4FVU A;  2BE2 A;  3O9S A;  1TL1 A;  2LSN A;  3AO3 A;  4BRF A;  4B3M K;  1QTM A;  4A2B A;  1GOB A;  4EP5 A;  1HX1 A;  1HNV A;  4PWD A;  3UKR B;  1U49 A;  4DKW A;  4Y0W A;  4FL9 A;  4BRP A;  4K43 A;  2HNZ A;  3ULE A;  4NCG A;  2G8H A;  1NKE A;  5AQM A;  1F21 A;  1ZXO A;  1MA9 B;  4B8C A;  3E9P A;  4FWN A;  3SBG A;  3ZSO A;  4YOU A;  2D0B A;  3VQ9 A;  1T8E A;  4FJ5 A;  2NUB A;  2BTF A;  3P83 D;  4Q0B A;  2P9U B;  3THX B;  2PFU A;  3OYE A;  1HLU A;  2QK9 A;  4KHS A;  1D5A A;  4CEE A;  1N32 K;  3HP6 A;  1Z6R A;  5AFU H;  4EP4 A;  1CLQ A;  2ZJP L;  1S22 A;  2ZJQ L;  1RDA A;  2CGL A;  3AAQ A;  3B6O A;  1YI2 N;  4CJK A;  5IT9 O;  1SQK A;  1ITG A;  4DR5 K;  2VCP A;  3CJ7 A;  3CER A;  2P9L B;  3HVT A;  5M1Q A;  1VQP N;  3O4Q A;  1K8K A;  2BH1 A;  2NZT A;  1EQY A;  2OA8 A;  1U48 A;  5HBM A;  3VQC A;  3KLF A;  1QVF M;  1E4F T;  4MFB A;  4CEC A;  4WFN L;  4E1J A;  2E2P A;  2D0C A;  5CZ1 A;  4LSL A;  5M1P A;  4BRE A;  4OGE A;  2ZGZ A;  4N5S A;  3UKU A;  4F8R A;  4DQR A;  1TK0 A;  3VTH A;  4LSN A;  3RR7 A;  1FXX A;  5SZT A;  5HLF A;  3FE1 A;  4KBO A;  4FJN A;  2QWP A;  3TAB A;  2G8F A;  3CCQ N;  3RR8 A;  1Y64 A;  5CY4 A;  1EET A;  3D6R A;  4CGI A;  1NK7 A;  2HHX A;  5JVG L;  4Z0U A;  3AY9 A;  2KW4 A;  3KK3 A;  3EY1 A;  1Z05 A;  4CJV A;  1XC9 A;  3DOL A;  1U47 A;  4CHO A;  1BIZ A;  1TKZ A;  3GL1 A;  2JLE A;  4DU1 A;  1WSG A;  4RW4 A;  3UIQ A;  1D8Y A;  1GLA G;  5A2Q O;  4B08 A;  1KTQ A;  3MMV A;  3H45 C;  2HF4 A;  4AIL C;  2UUB K;  5KRS A;  2CGK A;  5AQN A;  3OW2 M;  4JKH A;  4ZTF A;  1EKE A;  3TAR A;  2FBV A;  2UXC K;  2HW3 A;  2YHW A;  4CJQ A;  3THY B;  1HMV A;  2GWJ A;  2HNY A;  4NO7 A;  3VF2 A;  1RTH A;  3A5O C;  5BN8 A;  3R8E A;  1TV6 A;  1YIJ N;  3VQE A;  4WQ4 C;  4MQ3 A;  4OGC A;  3QO9 A;  4DLE A;  2O8E B;  2FXU A;  4CJU A;  1JXE A;  1UOC A;  3RRG A;  2E2O A;  3JSM A;  4GV6 A;  3OHR A;  1G99 A;  3I33 A;  3VEY A;  4CD1 A;  2FSN A;  3MEG A;  5AQU A;  2Z1I A;  5FRN A;  4Y1C A;  1RT6 A;  2NRH A;  2QWQ A;  2G8U A;  4DWI A;  4XH5 A;  2W6K A;  4GKK K;  3AVJ A;  5F1X A;  1JLE A;  4MDA A;  2YJE A;  4IZ9 A;  4CD3 A;  4DV1 K;  5JLH A;  1HKB A;  4AHV A;  4RWT A;  1NK5 A;  4EAH D;  1YTA A;  3DXK B;  1ZBI A;  4BE1 A;  2YV0 X;  2KFN A;  4H4M A;  1S3X A;  4V19 S;  3R1X A;  3QML A;  4KHU A;  3CFR A;  3LZJ A;  3SBT A;  1NGJ A;  2D5R A;  4FLZ A;  3TTD A;  2E2Q A;  4L3Q A;  1NKC A;  4FLY A;  4BE2 A;  1QS4 A;  5FPN A;  5GAD P;  3CYM A;  2R7Y A;  1BWF O;  3NF6 A;  4DB3 A;  1ASV A;  3OYN A;  3PX0 A;  2NNW A;  2F7T A;  4H5V A;  2A40 A;  1JCE A;  3P4I A;  4BY9 C;  2FBY A;  3M3Z A;  3ZET A;  5LY3 A;  3RWU A;  5KGX A;  4JK9 A;  1L3T A;  4KH4 A;  4YOR A;  2DFF A;  3SQ4 A;  3ZSZ A;  1X9W A;  3QFU A;  4DTX A;  5LJV A;  2Q97 A;  2F8T A;  2YHB A;  4AHS A;  2A3Z A;  4JN4 A;  4W5Q A;  4NLC A;  4O0J A;  1QVG M;  2VG5 A;  2G8V A;  3HYF A;  1DGK N;  4BDZ A;  3LM2 A;  3OBW A;  3BEX A;  1IJJ A;  3ALY A;  3C6H A;  1TKD A;  1OVQ A;  2QTD A;  5BN9 A;  5M1F A;  4F3T A;  1RT4 A;  1N34 K;  1KLM A;  4CEB A;  4IEE A;  4CEO A;  1K9M O;  5EY4 A;  5BPM A;  4FWS A;  3CM6 A;  1LCU A;  4IDK A;  4CJE A;  3L3V A;  2VWJ A;  4JS5 A;  5I42 A;  3DOK A;  4MLH A;  4KHN A;  5H1S Q;  3T1A A;  2W6L A;  4C8M A;  1B92 A;  3BGR A;  3VPZ A;  4BC5 A;  4FJI A;  4H4O A;  4BDP A;  2JWK A;  3U3Y A;  3CCM N;  2QXL A;  3C7N A;  5LL6 Z;  3BY5 A;  3VF6 A;  4M3Z A;  4QOZ B;  4BRN A;  2KZM A;  3SPZ A;  4A2A A;  4CGF A;  2E1Y A;  4FZZ A;  2P9K B; 
#chains in the Genus database with same CATH homology
 4YY3 K;  1J5E K;  4JI1 K;  4V19 S;  1HNZ K;  4DR7 K;  4NXN K;  5AJ3 K;  5LMN K;  3J81 O;  4DV0 K;  4LFB K;  4K0K K;  4JI6 K;  4LF7 K;  2VQE K;  2UXD K;  3T1H K;  4DR4 K;  4DV4 K;  4OX9 K;  4NXM K;  4JI2 K;  4LF6 K;  4CW7 B;  2E5L K;  1HNX K;  5IWA K;  5LMU K;  2VQF K;  4X62 K;  3T1Y K;  4DV6 K;  4LF4 K;  2UUC K;  1IBK K;  4LF8 K;  3J7A P;  1IBL K;  1I94 K;  3OTO K;  4DR3 K;  1HNW K;  4DUZ K;  4DR6 K;  1FJG K;  4B3M K;  4LF5 K;  4JI4 K;  5A2Q O;  4LF9 K;  4B3S K;  2UUB K;  4B3T K;  1XMQ K;  5FLX O;  4DV3 K;  4JI5 K;  4JI3 K;  2UXB K;  2UXC K;  4DV2 K;  4X66 K;  4AQY K;  4JV5 K;  3JAM O;  2ZM6 K;  4DV7 K;  1N34 K;  1IBM K;  2UUA K;  4LFA K;  4JI0 K;  4JI8 K;  4CVN E;  1XMO K;  4GKJ K;  2UU9 K;  4DV5 K;  4KHP K;  2F4V K;  4DR2 K;  4X64 K;  1N32 K;  5BR8 K;  4B3R K;  3J80 O;  2HHH K;  4LFC K;  4JYA K;  4DUY K;  1HR0 K;  1XNR K;  4X65 K;  5IT9 O;  4YHH K;  4JI7 K;  1N36 K;  4GKK K;  4DR5 K;  5LL6 Z;  4DV1 K;  1N33 K;  1XNQ K;  4DR1 K;  3J7Y P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...