4BC3A

Crystal structure of human d-xylulokinase
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
525
structure length
525
Chain Sequence
RRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLULOSE KINASE
publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 185
structure length 525
sequence length 525
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc3A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc3A01
1Y64A 5E26A 3CQXA 1RFQA 3SMSA 1ESVA 2UYTA 2W40A 5KQDA 4RWTA 3FFKB 3SLCA 4EAHD 5JLFA 3BP8A 1GLJO 3A8YA 3GE1A 5BRDA 2CH5A 2HF4A 4FWMA 2YHXA 4BRMA 1HJOA 4O5FA 2P9SB 2E88A 2PAVA 3GDQA 3I8BA 3CJBA 4B1ZA 1JCGA 4BC3A 3BUZB 3ZEUA 1ZBSA 2AP1A 1NBWA 3QDKA 3GBTA 2YJFA 3CJAA 3WXIA 5FPDA 5FPMA 1KXPA 5AQKA 2FF3B 1BU6O 2E20A 3VF6A 5B8HA 3VF4A 5AQSA 1IJJA 2D4WA 2QWOA 1QQMA 4PKHA 5KPRA 1NGFA 4WQ5C 3VERA 4CD3A 1MDUB 3HBTA 3MMVA 4EIAA 4BR9A 2HOEA 3GL1A 3HM8A 4FWKA 1U2VA 3DJCA 3FZFA 4XH1A 1QQNA 2QWMA 3LDOA 4DQ8A 1NGCA 4BQZA 2YCHA 2P9LB 4CJ7A 2A42A 1DKGD 2YHYA 1IG8A 2HF3A 3J8AA 4FOIA 3U8XA 4FL9A 2Q1NA 5E84A 2ITMA 3A5NC 4JHDA 4H0VB 4IZ9A 3L6QA 1RDWX 1TYQB 3CHWA 4IJNA 3EKSA 5KPZA 4JHDB 2A40A 2ASOA 4KBOA 3VF2A 1P8ZA 1QZ5A 1X3NA 3H3NO 4M7XA 3L4IA 4DCHA 3KVGA 5EOYA 1NGEA 4M7YA 1GLAG 3AARA 1T44A 5JMVA 2QWRA 5AQTA 4BC4A 3ZETB 2NRHA 3D2FA 4BRIA 3I33A 3CI5A 4WYBA 1C0FA 3QFUA 4H5WA 4AM6A 5KQ8A 1BUPA 1TUUA 4ISEA 5F0XA 3VEZA 5JLHA 2IVOA 3RSEA 4E1JA 3O6WA 2Q97A 3QICA 2FXUA 3EZWA 1E4GT 4BG8A 3WEEA 5KPTA 4BGAA 2NZTA 1GLEG 3D2EB 3ENOA 3H3OB 3KZBA 4MLEA 2GELA 1NGIA 1ATRA 4PKIA 5AQVA 3HZ6A 3JS6A 2YHWA 5FPEA 3D7EO 1TUYA 3AAPA 1BDGA 3MN6A 4XH5A 4BQLA 2D0PA 1ATSA 1G99A 2P9UA 3IMXA 1HKCA 3IUCA 3M6GA 4NO7A 4CZEA 3MN9A 1QQOA 1XQSC 3UKUA 2E2OA 2V7ZA 3VGKA 3MN7A 5ADXA 1HX1A 3R8EA 1U6ZA 4QS7A 4BRAA 2ZGYA 3VOVA 4BRKA 5ELZA 4F9OA 4FWPA 5AR0A 4EFHA 2Q0RA 4H0YB 1V4TA 3U9DA 2QWPA 2Q31A 4B1VA 1X9JA 3HSCA 1HKGA 1ZC6A 2IIRA 2P9SA 3SJHA 5FPNA 4BRDA 1MWKA 3FZHA 2P9KB 3TPQA 3ZX2A 4BR2A 1HKBA 4IXCA 1SZ2A 4K43A 2HMPA 2E1YA 4BRGA 3R9PA 3QMLA 3G25A 4WQ5A 3LDNA 5AQNA 5BPLA 4BRCA 3LDQA 3DXKA 2P9IB 3FR0A 4XEIA 4M63C 4GY2B 1NLVA 1WOQA 3SMPA 3BEXA 3CJ1A 3DXKB 3EKUA 3O08A 3VGMA 2KHOA 2P9LA 4IWVA 3VENA 1KAXA 3KHYA 3WXKA 2P9NB 3HI0A 3VGLA 2A41A 1T6DA 1OKJA 4CZIA 3JXUA 5AFUA 5AQOA 3FZKA 1TYQA 3WUHA 3A5LC 4CI6A 3BF3A 4H5NA 3H6EA 4CZHA 5AQLA 3LM2A 4RCHA 2J4RA 3DAWA 2BUPA 2V7YA 3H1VX 5AQQA 4BRLA 2Q2RA 4A62A 3U9ZA 4B1UB 3DWLA 3FZLA 3QFPA 1QZ6A 4BR7A 3A5OC 3M1FA 3ZETA 1NGGA 3IFRA 4O8KA 3UE5A 1DEJA 2I7PA 4DB3A 3WQTA 5EVZA 3GOIA 4FWNA 3O80A 1X3MA 3VEYA 1CZAN 3H45C 5BPNA 3VEXA 3BF1A 5I9EB 5BN9A 2OANA 1S3XA 1NGJA 4JD2A 3QBWA 1HUXA 2PBDA 1JCEA 4BRQA 3ULEB 2DPNA 1C0GA 4FWOA 3D2EA 1NGDA 4JD2B 5AQUA 2IVPA 3LDPA 4BVPA 4CZLA 4DHYA 4FWLA 3P4IA 4JN4A 1Z6RA 2CH6A 1R59O 4L3QA 2FLOA 3LL3A 5AQMA 3ENHA 4FOEA 2QWNA 3VEOA 5BRHA 4LC9B 2IVNA 4JAXA 4H0XB 3O4WA 4FWQA 4CZKA 4CBXA 3O1BA 4ISGA 1WUAA 4ISFA 1Q18A 2E8AA 2FSKA 3VEVA 4YDUA 2QWLA 2QXLA 1H1VA 1SQKA 2P9PB 4BGBA 2AA4A 1GLLO 2F9TA 4RTFD 1YAGA 5AZJB 4PL7A 3FGUA 3ZX0A 5AQJA 1XUPO 5AQGA 5EY4A 4HTLA 4A61A 3CETA 1BA0A 1V4SA 2GWKA 3FE1A 4H5RA 4H0TB 4BR0A 3WXJA 3CJ7A 1ATNA 3CIPA 4YDUC 2E2NA 5AQIA 1NM1A 4WQ4C 4EHUA 5AQRA 4B1YB 4BRPA 3SK3A 1EQYA 4BRNA 3UB5A 3M3ZA 3VESA 3VEWA 4BRFA 3LDLA 4C23A 2P9KA 4K42A 2VWBA 3F9MA 3WQUA 2FF6A 3AY9A 4H03B 4CZFA 3WT0A 1T6CA 4GNIA 3C7NA 5EXWA 2P9IA 3H46O 4B1XB 5AQPA 1XC3A 1YUWA 2NLXA 3MN5A 3C7NB 1ZXOA 2ZGZA 4JNEA 3S41A 4FWRA 5JICA 4CBUA 2Q36A 4BROA 1BA1A 1RGIA 4H0OA 5EX5A 1LOTB 5BPMA 2EWSA 1NGAA 5AQFA 1D4XA 3TU5A 3VETA 1MWMA 4PL8A 2I7NA 3QB0A 2P9NA 4BVOA 2WUSA 5F1XA 2Q0UA 4K25A 3CJ9A 2CGJA 4FPBA 4A2AA 1S22A 2FSJA 2ZF5O 5BR9A 3ZEUB 1GLCG 3MDQA 3LM9A 3GG4A 4PKGA 1BO5O 4B1WB 4CD1A 2QWQA 1NGBA 2W41A 3EO3A 3EN9A 3ZX3A 5AZIA 4FSVA 3WXLA 3CQYA 2YI1A 5AQXA 5CE3A 1NGHA 1GLFO 5AZIB 4CZGA 4BC2A 4BREA 1GLDG 1LCUA 1U2VB 4BG9A 5AFUH 4J8FA 4EHTA 2E1ZA 1BG3A 4A2BA 2BTFA 3C0BA 3ULEA 5AQHA 2A6AA 3CERA 2GUPA 3MK6A 1MA9B 3B8AX 4HWIA 4FO0A 1HLUA 2D1KA 2FSNA 5LJWA 3OHRA 3O5BA 2A5XA 2V52B 4Z94A 1QHAA 2YJEA 2E2QA 4IJAA 4BR5A 5AQWA 5F2RA 2E2PA 2H3GX 5AQYA 3AAQA 3CJCA 4FPAA 1SAZA 4IO8A 3DXMA 3ATUA 1BWFO 1Z05A 4BC5A 4I6MA 4NB4A 3W0LA 2ASMA 2P9PA 2V51B 3D2FB 1BOTO 3DXMB 3O1WA 4CZMA 5AZJA 4H0PA 3W3DA 4B9QA 4BR4A 4AM7A 4K41A 4I6MB 2VYPA 3RSEB 3O8MA 2VCPA 4WQ4A 3IDHA 4BRHA 3UKRA 2CGLA 4FWSA 2ASPA 4H5VA 2A3ZA 1YVNA 1HPMA 1JCFA 4Y0WA 3R6MA 3A5MC 5AQZA 1J6ZA 2GEMA 2ZWHA 3U4LA 3WEEB 4CBWA 4MLHA 3UKRB 4QS9A 3QBXA 1GLBG 1NWKA 4H5TA 1K8KA 2GTDA 5LJVA 1KAZA 5BREA 3L0QA 4XH4A 1K8KB 4CZJA 3HTVA 2GWJA 2P9UB 3ID8A 3MCPA 5BRFA 3ATVA 4QS8A 3FLCO 5BN8A 3VPZA 5ADXH 5TKYA 2QW9A 1YXQA 1DGKN 2CGKA 1E4FT 4MO4A 3UKUB 2D0OA 3H1QA 1KAYA 2QM1A 3A0IX 3EL2A 3FZMA 4MO5A 5LY3A 2F9WA 1NMDA
chains in the Genus database with same CATH superfamily
3SMSA 1JXEA 4M3TA 2UYTA 4CFAA 2HBKA 4RWTA 3EE9A 2YKNA 1TK5A 5JLFA 3NVKA 3OYCA 2IC3A 2HF4A 4BRMA 4KHYA 4Z4EA 2PAVA 4B3MK 4B1ZA 4BWMA 1NBWA 2O8EA 4DFJA 3GBTA 3WXIA 5HRSA 1XMQK 4FK2A 3ITHA 4NCGA 5FPMA 2NRWA 3EZ5A 4OO1J 5AQKA 2FF3B 2E20A 3C6AA 1JLFA 3VQ7A 5M1KA 3VF4A 4CJ4A 2NUBA 4FJ7A 5KPRA 1NGFA 1ASUA 4CJQA 4ELUA 3G4SN 3BGRA 3LP1A 4L8RB 4FWKA 3FZFA 4LD0A 1QQNA 2QWMA 1NGCA 3AVBA 3OYLA 4JKGB 4BQZA 1QTMA 1KFSA 2P9LB 2A42A 1DKGD 2YHYA 3DMJA 3J8AA 2Q3SA 3EY1A 3K9KA 5GINA 4B9NA 1KC8O 3D0PA 3O9SA 3LZIA 1TYQB 1YJNN 3B6PA 3T3FA 5KPZA 2A40A 2O4IA 2HBMA 3DOLA 1P8ZA 1Q82O 3L4IA 2JWKA 1YF5L 3SYZA 4U67L 3TTDA 1GLAG 3FFIA 2QWRA 2FBYA 5AQTA 2NRHA 1S5JA 4B08A 3LPUA 3I33A 3CI5A 4WYBA 4IDHA 4H5WA 4FW1A 2VQEK 1BUPA 4I7FA 1TUUA 5J2NA 5JLHA 1HQUA 1Q81O 4CIGA 1TV6A 1U4BA 1N33K 1SKWA 2FXUA 1I94K 2JGUA 2NZTA 3HO1A 2XY6A 2BGGA 3ENOA 5K14A 4HUEA 4FLYA 4MLEA 3TAGA 1NGIA 4B8AB 4PKIA 5AQVA 4OPHA 2O8CB 4FJ8A 4PY5A 1RDDA 3DI6A 2ZJRL 1ATSA 1G99A 2P9UA 1HKCA 4OVLA 4CZEA 5C2DA 1T05A 2UUBK 1DLOA 1VQPN 2O8BA 3CF5L 4DR7K 4CEBA 3R8EA 1IO2A 4HTUA 4C1NI 4HVJA 3QERA 1NK6A 4FWPA 3LAKA 4EFHA 2Q0RA 2OCEA 4IBNA 4FK0A 2Y1JA 2Q31A 1VSLA 3HSCA 3L2WA 3HL8A 5DK5A 4DTRA 4O4GA 4CF1A 3SI6A 3CPWM 3MEEA 2P9SA 3BZCA 5CR4A 1Q7YO 3QINA 5JS2A 2DFFA 4U7BA 1LV5A 3HYFA 5DM7L 1WSGA 1IKXA 2YNFA 1NK0A 4GKJK 1W9HA 2YNIA 5GAGP 1U04A 1RT1A 1YTAA 2BE2A 4GMJB 5J2PA 4CGFA 3LDQA 2QXFA 4XEIA 4DSKA 2HSTA 4M63C 3AVNA 3SMPA 3C6TA 3KKRA 3O9QA 3O3HA 4DUZK 5FRNA 4JI7K 2VWKA 4OKJA 1Z25A 2IOCA 1B9FA 1LAWA 4FM2A 4KKOA 3K59A 3M5RA 1SKRA 2O8DB 1KAXA 4OLBA 2P9NB 1HQEA 3K57A 3VGLA 3LPTA 3PY8A 3U6FA 4CI6A 1UA1A 2QI2A 3F9KA 1JLQA 2OPSA 4CHZA 4H5NA 3Q7BA 1QE1A 1UA0A 4BDZA 3DAWA 5HRPA 3K5MA 3K5LA 3DWLA 3FZLA 3ZETA 3S3OA 1NGGA 4E3SA 3Q7CA 4WE1A 4FWNA 3CCVN 3VEYA 2DY4A 3BF1A 2ITGA 3B6OA 4H8KA 4B3SK 1RBSA 4HUGA 1SKSA 1S3XA 3QBWA 3CM5A 2PBDA 3OYBA 3V9UA 5KGXA 4CVNE 5M1OA 4DQQA 4CF2A 1T7PA 3VQ5A 4CEOA 4HCCA 4JI1K 1R59O 1KFDA 1NJWA 4FOEA 3TSUA 4JKDA 3TSQA 3VQ8A 4FWQA 4CZKA 4JKCA 5D3GA 1WUAA 1BCOA 1SL0A 4ISFA 1A5XA 2E8AA 3F73A 3VEVA 4YDUA 1JLGA 3QETA 3RWUA 1S1XA 1H1VA 1SQKA 3TAFA 2ATQA 1DTQA 4RTFD 2EX3A 1KVBA 1DTTA 4CK1A 4CCHA 3VTIA 1BA0A 4H5RA 1N32K 4DFKA 3CC4N 1YT3A 3HOSA 1QS4A 4WQ4C 4IFEA 2NRRA 3CCSN 2IGIA 4B1YB 4B3TK 4HUFA 3O4NA 4BRNA 3UB5A 3NGZA 4C23A 4BRFA 4OGEA 2VWBA 3F9MA 3QEWA 4X64K 3V1QA 3H08A 2FF6A 2KFZA 3L2QA 1A5WA 2ZM6K 3THVA 1T6CA 4A59A 4BDYA 1IG9A 1WSIA 1RBUA 3VA0A 2P9IA 3HPHA 3H46O 1XHXA 5AQPA 3THWB 1YUWA 2Z1HA 5C24A 3C7NB 1RT3A 3CC2N 1VRUA 2RKIA 4JNEA 3S41A 1VQ5N 1RGIA 1NOZA 2EWSA 1NGAA 4FJIA 4DG1A 1JJ2M 1Q8IA 4PL8A 1QSSA 2HB5A 3V6DA 5T7BA 2A1SA 4O8UA 5F1XA 3DRRA 4AQYK 1JLBA 3KLIA 1RDBA 2RPIA 4KO0A 5BR9A 3SPZA 1Q86O 5LMUK 3LM9A 4PKGA 4B1WB 2YKMA 3SPYA 3EN9A 1FXXA 3WXLA 2I5JA 1XNQK 4V19S 4R79A 3CFRA 3TWHA 3DLRA 1U47A 4Z4FA 4BC2A 3SUPA 1NK4A 4RW4A 3J7AP 3TARA 3N4PA 3OS2A 1I39A 2F8TA 1U2VB 2IDOA 5EU7A 3KK3A 4CHQA 2E1ZA 1EO1A 3VA3A 4ICLA 5AQHA 1C1CA 3CERA 2NRTA 4FO0A 1IBLK 1HLUA 2FSNA 1NJXA 3S9HA 3OHRA 3KK2A 4E19A 3OYJA 4N5SA 4F2SA 5AQWA 5F2RA 3K0SA 4E89A 4FPAA 4DLGA 3S3NA 1RBVA 1Z05A 4ILHA 4NB4A 3W0LA 3I8DA 3DXMB 3L3VA 3VQ6A 1C0TA 3THXB 5AZJA 3W3DA 2XRIA 4AM7A 4K41A 1CZ9A 2WTUA 3RSEB 4AHRA 3IDHA 4BRHA 1HNIA 1R0AA 3PO4A 3C94A 3QNNA 1KSPA 4CJEA 3WEEB 1J6ZA 2GEMA 3AA5X 4CBWA 4MLHA 3UKRB 3OYMA 2P1JA 4KHNA 3P39A 1NWKA 2BH1A 1C1BA 4JEPA 2IAJA 4DTXA 1FKOA 2W6KA 5BREA 3L0QA 4CGJA 4AHCA 1WAFA 1S9GA 4DU4A 4QS8A 3QEPA 4LF5K 2QW9A 1REVA 3UKUB 2CGKA 1U49A 2OZSA 2G8HA 3E9PA 4DTMA 3V81A 1KLNA 3H1QA 4XIUA 2X6NA 1ZBUA 3MXIA 3L3UA 1NMDA 1Y64A 5E26A 4YOTA 1EXQA 3SQ2A 5KQDA 3FFKB 3SLCA 4EAHD 4JI8K 4CJWA 5BRDA 4JLHA 4DU1A 4CJRA 3DLGA 4CESA 1A5VA 4E1NA 1HJOA 4O5FA 1UWBA 1O13A 1KVAA 2E88A 3O9TA 3TABA 4BC3A 3BUZB 3ZEUA 1N36K 2OA8A 2AP1A 4DQRA 3CCJN 2BANA 3CJAA 4A57A 1NK7A 1KXPA 4CEDA 4BACA 3JSMA 3T1HK 4YOVA 2PFUA 4OPKA 2D4WA 1B9DA 3HVTA 3VERA 2Z1IA 4CD3A 1MDUB 3MMVA 1RCHA 1WNSA 4YOUA 3DJCA 3TI0A 2VG6A 2W42A 4DQ8A 4DSFA 4C8OA 4CJ7A 4B9MA 1IG8A 4FOIA 4E7HA 4F3TA 4FL9A 2HNYA 5E84A 4ZTFA 4B3RK 4H0VB 1L3UA 3L6QA 3CHWA 3V1RA 2Z1GA 2B6AA 3RMCA 3E66A 5CZ1A 4JHDB 3RR7A 1N8RO 1X3NA 2DTUA 3H3NO 4GVEA 4K8XA 4EZ9A 5GAHP 3NAEA 1M90O 3D2FA 4BRIA 3HK2A 3NDKA 1C0FA 3O3GA 1Q9XA 2IVOA 1HRHA 3O6WA 2QK9A 4CHNA 3SQ1A 1RBRA 1J9AA 2HBLA 3MWTA 3THYB 3L2VA 1E4GT 1LWFA 3ENBA 1ASWA 2B5JA 1HYSA 5GAEP 4IOAL 1ATRA 3AV9A 2YHWA 3D7EO 4CFCA 1TUYA 1I3AA 1BDGA 4XH5A 4BQLA 5C25A 4KI6A 3IMXA 4DR1K 4NO7A 2HNZA 4CIEA 2HHVA 4FVUA 1TL3A 3KLGA 3MAQA 4M3XA 4CEAA 1NK9A 4QS7A 5HL7L 3VOVA 3WNFA 1RNHA 4JI2K 4F9OA 5AR0A 4FJXA 1OH7A 4H0YB 1WSFA 3U9DA 2F7TA 3ZCMA 2QWPA 3NF6A 4M45A 3QEIA 2F4VK 1HKGA 1RT2A 3CCEN 3KK1A 3PV8A 3KD5E 5FDLA 4H4MA 1FKPA 1LW0A 3ZSVA 4NCBA 1RDCA 4K43A 3RVCA 2RF2A 4JKBA 4BRGA 3R9PA 4B9SA 3LDNA 5BPLA 1YHQN 2P5GA 3CD6N 3FR0A 4F4KA 3VQEA 4JV5K 5CYMA 4W5NA 4GY2B 4IFVA 2Y1IA 3AVGA 1NLVA 1TL1A 3HOTA 3BEXA 2QKBA 5TKWA 3DXKB 4M3YA 2G8KA 4K8ZA 3EKUA 4O5BA 4JI4K 3O08A 3VGMA 1IH7A 1OVQA 2KHOA 1EETA 1NK8A 4GV6A 4IWVA 2OPRA 3IRXA 3WXKA 3HI0A 1HJRA 1RBTA 2A41A 1T6DA 1OKJA 1OH8A 3JXUA 3I0RA 1TK8A 3A5LC 4FLUA 4DMNA 4IOXA 3CFPA 2HHUA 4RCHA 4FJLA 2BUPA 1BIUA 1KTQA 5AQQA 4BRLA 3NHGA 1F21A 5FLXO 3E1YA 1SV5A 3IFRA 3AVCA 2I7PA 4DB3A 5BR8K 4QOZB 4DV5K 3V4IA 3GOIA 4AHVA 1KLMA 2YHAA 3H45C 4FLZA 3ZSQA 3SUNA 4CJPA 3HP6A 1JCEA 4BRQA 3ULEB 4B9LA 3D2EA 5GIPA 4JD2B 3OYHA 3KKSA 3LDSA 5AQUA 2O8FB 4FWLA 3P4IA 2CH6A 4L3QA 4KB0A 3LL3A 4YNQA 2HHHK 3JAMO 2X74A 4C8NA 1BI4A 5BRHA 2IVNA 4CBXA 1X9MA 1BCMA 4ISGA 4FW2A 4O55A 3M8QA 1Q18A 4BE2A 2P9PB 4F3OA 3K5NA 4IG0A 3OBYA 3ZSYA 5AQJA 1XUPO 5AQGA 5EY4A 4WF9L 1VQMN 4KREA 3DLEA 3CETA 1K8AO 2XHBA 3FE1A 1FW6A 2OPPA 3CJ7A 1HPZA 2E2NA 1G15A 3KLEA 1NM1A 5AQRA 3MXJA 4JKFA 3T69A 1EQYA 3VESA 3M3ZA 2P9KA 4K42A 3M8PA 3WQUA 4GV9A 2FBTA 1NMNA 1NKBA 3HSTB 3P31A 1OH6A 4M3WA 3BZKA 3E9OA 4CE9A 3LP0A 4DTJA 4Z4HA 4GNIA 3C7NA 1VQ6N 5CHIA 3EEQA 1CXUA 4B1XB 1XC3A 4IO9L 3MN5A 2Z1JA 3VMFB 1ZXOA 2FBVA 2KW4A 2ZGZA 3ZSRA 4CBUA 2Q36A 1WSHA 1BA1A 4QAGA 3AGRA 3RR8A 4W5RA 1LOTB 1QHTA 5BPMA 3OW2M 1JL2A 3AVKA 1JXBA 2GBZA 3JYTA 4DU3A 3VETA 4KTZA 3VQ9A 1B92A 3PX0A 4F2RA 4JS4A 1S22A 2D0AA 4YOWA 2FSJA 4DR5K 2G8IA 2HHSA 1N34K 1D9DA 3GG4A 1BO5O 4CD1A 4LFAK 3R3LA 3EO3A 1ZBLA 4E7KA 3MCAB 4DR2K 5AQXA 3TSPA 1RT6A 1YJ9N 3ZLJA 5CY4A 5AZIB 1Z26A 3KWGA 4ILJA 5HRNA 3TTCA 1XMOK 2FC0A 3I0SA 3V9WA 3MECA 2YHBA 3M8SA 4Z4CA 4J8FA 2ETJA 1NK5A 1BG3A 4NYNA 4CK2A 5C2FA 3MX5A 2QTDA 2VG7A 4HWIA 4I9QA 2V52B 3LALA 3AO1A 4Z94A 1XI1A 1GOAA 4FVMA 5AQYA 4I9LA 1FJGK 3CJCA 4CHPA 1HYZA 4JI5K 4DWIA 3LWLA 3DXMA 4FJMA 1TVRA 2OPQA 2UXDK 2ASMA 2V51B 1BOTO 1VAZA 4DV1K 4H0PA 3LZJA 2VYPA 3WNEA 4DSEA 1L3SA 2VCPA 3UKRA 3HM9A 4WCEL 5M1FA 3R6MA 3A5MC 1S1TA 3PIOL 2E6LA 3QBXA 4KH4A 1TKDA 3QEXA 5LJVA 2DFEA 4YORA 1NJIO 3NH1A 3VQBA 4ELVA 2E5LK 3SCXA 3ULDA 1KQSM 4UQGA 2GWJA 2P9UB 5J2QA 1S1UA 3FLCO 3VPZA 5TKYA 5SZTA 2HW3A 4MO4A 4NLCA 3NH2A 4DV2K 3SQ4A 2O8BB 4DV0K 3PO5A 4A5BA 1X9SA 2NNWA 4R5PA 4DKWA 4RW7A 3QIOA 1TKXA 2XY8A 3A0IX 1NJYA 3FZMA 1HNWK 1J5EK 3WXMB 3SNNA 1YITN 4FJHA 1ESVA 1WBBA 3AGKA 3MWPA 2W40A 1LW2A 1JLCA 4HHTA 3GE1A 2CH5A 4HCBA 3NFAA 4FWMA 3PSIA 2YHXA 3G71N 3KIOA 1HNXK 2P9SB 3GDQA 1ZBSA 3CG7A 4FCYA 4YFUA 1L5UA 2YJFA 5FPDA 1YVUA 1BU6O 4KPYA 4O0JA 3VF6A 1MU2A 3AVLA 3C6HA 5AQSA 3TAQA 3V1OA 3PSFA 1QQMA 3P83D 4DTPA 5C12A 4FYDA 4AHUA 3U3YA 4YOYA 3VTHA 4BE1A 5SWMA 3HBTA 4IG3A 4CJVA 4EIAA 4BR9A 2HOEA 3HM8A 3R1XA 3LDOA 4CK3A 4M41A 4EP5A 4N47A 4CGIA 4LF9K 2ITMA 4M3RA 3KTQA 4JHDA 5CZ2A 2RHKA 3NGIA 2R7YA 1SL2A 4DTSA 4NXNK 3MXMA 3AA2A 4KHQA 3EKSA 3SUQA 4LF8K 2ASOA 3CMAN 3VF2A 2QA4N 4B8CA 3VQDA 4DCHA 2QKKA 1EWQA 2HMIA 5EOYA 1NGEA 4M7YA 3BY5A 3AARA 3DOKA 4BC4A 3ZETB 1LWCA 3QFUA 1NOYA 4J2BA 4CIFA 4AM6A 5KQ8A 4ISEA 2F8SA 3VEZA 1ILYA 4E1JA 2PYJA 4FJNA 1T8EA 5AJ3K 4QCLA 4CJ5A 3ZSWA 4MDBA 3PUFA 4CJLA 1HNZK 1RT5A 3UIQA 2KTQA 2ZE2A 3H3OB 3ZYYX 2GELA 1ZBFA 2YX6A 3HZ6A 4CJUA 3JS6A 4AF1A 3BDPA 2VWJA 5JVGL 1GOBA 2JWLA 3AAPA 4KH5A 3CMEN 3MN6A 3OBWA 5KRTA 1XQSC 4DV4K 2E2OA 3MN7A 4RW9A 1HX1A 1RT4A 4BRAA 2ZGYA 5ELZA 1VQ8N 1WN7A 3OYEA 4M42A 2ZJQL 4CF9A 4RG8A 3C6UA 3DLBA 3PLAA 3AVHA 4Y1CA 2IIRA 4Z4GA 1CZBA 3MEGA 3RTVA 1NKEA 1BQNA 3SJHA 5FPNA 4BRDA 3FZHA 3J81O 3ZX2A 4IXCA 1SZ2A 4ELTA 4PUOA 2UU9K 4DFPA 3TAEA 4LSNA 3DLLL 2ZJPL 3G25A 4WQ5A 3DLKA 3CPEA 5AQNA 4JI0K 4BRCA 3NBPA 1EKEA 3DXKA 2P9IB 5I42A 2KKZA 2PY5A 4EZ6A 1WOQA 4DTNA 3HPGA 1HR0K 4NLBA 1VSKA 1M1KO 4JKGA 3TANA 2P9LA 5C0YA 3VN5A 4LY7A 3VENA 4DSJA 2VQFK 3AO5A 3RRGA 5AQOA 3FZKA 1TYQA 3WUHA 4A5AA 2F96A 3BF3A 3D6RA 2XY5A 4CZHA 4FJJA 1T03A 1JLAA 5JS1A 2J4RA 2V7YA 2A1RA 1C6VA 1RDAA 1WSJA 4A62A 1IBKK 1OVYA 3U9ZA 4E7IA 3QFPA 1BL3A 4BR7A 3DRSA 3KWIA 4DQPA 2HHQA 1X3MA 3V9XA 2HNDA 4B3OA 4LSLA 5BPNA 1K73O 3VEXA 3ZT1A 3KK7A 1X9WA 4K0KK 3O9RA 2OANA 4JD2A 1NGJA 4FXDA 1HUXA 3LWMA 1VQNN 1JLEA 4DQSA 4DF8A 1EP4A 2DPNA 5A2QO 2O8FA 1C0GA 4M3ZA 1NGDA 3AVMA 3K58A 2ZD1A 3LDPA 4WFBL 4DHYA 4JN4A 2O8CA 4IDKA 4JK7A 4DFMA 3LP3A 1WAJA 4LC9B 4FJ9A 4G9ZA 4X65K 3O1BA 4AHSA 3OYFA 3SAFA 3E01A 3OJSA 4MFBA 4BE0A 1O1WA 2AA4A 1GLLO 1VHXA 3OYAA 5AZJB 3FGUA 4HTLA 5CYQA 3T1YK 1V4SA 3SBTA 4BR0A 3CFOA 3WXJA 4DV7K 3OVNA 4GVMA 3CIPA 4YDUC 1KRPA 2GV9A 1YIJN 3QEVA 3WNHA 1RDUA 4JKAA 3NF9A 4DSLA 5FPEA 4DR6K 3L4QA 4AHTA 4FLTA 4CW7B 1P90A 3AY9A 2WONA 1OH5A 4CZFA 3WT0A 2YNGA 4DS5A 5EXWA 2AJQA 1S72N 2KZZA 2NLXA 3C95A 4LF4K 1VK0A 3CCRN 4FJKA 4FWRA 4MDAA 3VQCA 4IEEA 4UY8O 4JI3K 1D4XA 2WFBA 2O8DA 1N6QA 2P9NA 1RTDA 2WUSA 2Q0UA 4CJTA 4K25A 2D5RA 2CGJA 4DTOA 2XO7A 1YI2N 4N41A 3ZEUB 3AVFA 1GLCG 5M1PA 2ZQBA 3MDQA 3ZT2A 2VGMA 2YNHA 4JRQA 2QWQA 3ASMA 3ZX3A 4GKKK 5AZIA 4FSVA 3SUOA 1DT9A 3HT3A 4CEEA 3D45A 5CE3A 2WC9A 1NGHA 4Y1DA 4NCAA 3TAMA 5JVHL 1VRTA 1VSMA 1LAVA 4EP4A 1KCFA 1RT7A 3VQQA 2DFHA 2FBXA 3HJFA 4FZXC 1IBMK 2B4JA 5AFUH 3SZ2A 2BTFA 4CECA 3SAGA 4FM0A 2GUPA 3MK6A 1MA9B 3B8AX 4KHWA 3ZT0A 2KQ2A 2A5XA 2HVHA 4IJAA 4NYFA 4BR5A 4N56A 4KAZA 4OKEA 4KV8A 4AILC 1S9EA 2D0BA 1SAZA 1IKWA 4TSXA 4IO8A 3ATUA 1TGOA 4O44A 4FM1A 3D2FB 3OYNA 4CZMA 1K9MO 4I6MB 4E0DA 3MX2A 4KI4A 5KI6A 4E1MA 2CGLA 4FWSA 3CXCM 2ASPA 2A3ZA 1YVNA 1HPMA 4E7JA 3OS0A 3U4LA 4B9VA 3AVIA 3C65A 4X62K 4C8MA 4BY9C 1ZBIA 4KTQA 4DR3K 3LANA 4FJ5A 2WOMA 5LL6Z 4E7LA 1KAZA 3AO2A 3M8RA 1K8KB 4F8RA 1QVFM 4CGGA 4IEIA 2GX9A 3P38A 3L8BA 3ATVA 5BN8A 1U48A 4IOCL 1DGKN 1RTIA 1TKZA 3RMDA 4DS4A 3THWA 1XNRK 1RTJA 1L3VA 4CGHA 4CFDA 1VSIA 3KJVA 3EL2A 4CEQA 1QSYA 3J80O 5LY3A 1BIZA 3HPOA 3CQXA 1RFQA 3K2PA 4G1QA 1W97L 3BP8A 1GLJO 3A8YA 4WFAL 2UUAK 3SBGA 1X1PA 4PQUA 4KB1A 3QLHA 3I8BA 3VQPA 1XC9A 4LFCK 3P5JA 3CJBA 1JCGA 2NRXA 3QDKA 4CERA 2G8WA 2O8EB 3WNGA 5B8HA 4JYAK 1VSDA 4DQIA 1IJJA 2HVIA 4PKHA 2QWOA 3F5TA 3P1GA 4ZHRA 1VQ9N 4CJFA 1C0MA 4Q0BA 4WQ5C 2LSNA 3GL1A 3IG1A 4JRPA 1U2VA 1CXQA 1WBDA 3TAPA 3NF7A 4XH1A 2YCHA 3NMUA 5H1SQ 2HF3A 3PX6A 3DLHA 3TR8A 3U8XA 4KH6A 4PHTX 2Q1NA 5HROA 3A5NC 2OZMA 4LH4A 2G8UA 3HRGA 4IZ9A 1RDWX 1WLJA 3AO3A 4IJNA 4CF8A 3KLFA 1RILA 4KBOA 5HP1A 4H4OA 1QZ5A 4M7XA 1QSLA 3KVGA 1EWRA 2HBJA 4CJ3A 4C1NK 4FZZA 1KD1O 1T44A 5JMVA 3J7YP 3VQ4A 3THXA 4Z0UA 3NH0A 3ALYA 4CHOA 5F0XA 4BWJA 1Y97A 3RSEA 3CQ8A 3MEDA 2Q97A 5HLFA 3QICA 5LMNK 3EZWA 3CCLN 2UUCK 4BG8A 3WEEA 5KPTA 4BGAA 1GLEG 3D2EB 3OYDA 1IV0A 4M3UA 3KZBA 3RMBA 3OYKA 3AA4A 2VGNA 3ZT4A 3O4QA 5MLCQ 1WB9A 4DUYK 4DSIA 4OKKA 3ISNC 4OJRA 2D0PA 2E4LA 1BI4B 3IUCA 3M6GA 4FK4A 3MN9A 1QQOA 4RW6A 2NRVA 3UKUA 3SQ0A 1XHZA 3HXMA 4CHYA 1W2BM 3CM6A 5FRMA 2V7ZA 3VGKA 1ZYQA 3L2RA 2BDPA 4JK8A 5ADXA 2E6MA 1U6ZA 3ZSOA 4ID1A 3OA9A 4BRKA 3RMAA 3AVJA 3KLHA 4DV6K 1VQLN 1NJZA 1BISA 1V4TA 3NVMA 4B1VA 4JKHA 1QQCA 3L2UA 1X9JA 3HVRA 2KFNA 5KRSA 1ZC6A 2OTLN 3HP9A 2UXBK 1MWKA 2P51A 5M1NA 5IT9O 2P9KB 3TPQA 3CCQN 4FZYA 5GIOA 5DMRA 4BR2A 1HKBA 2HMPA 1XWLA 4FLVA 4CEZA 1ZBHA 2E1YA 2RE2A 5HBMA 1C0UA 3QMLA 3EE8A 4DR4K 1YJWN 1J5OA 2X6SA 4OX9K 1ITGA 1K6YA 3CJ1A 1J54A 3T1AA 4J2DA 1HYVA 5J2MA 1TAQA 1NKCA 4OPJA 2UXCK 5J1EA 3SAHA 4FJGA 4YOXA 3K9JA 3KHYA 1TK0A 2KLAA 4CZIA 5AFUA 5KTQA 1UAXA 1VQON 2X78A 4N76A 3O9UA 3H6EA 3G10A 5AQLA 4W5OA 2HHWA 3LM2A 3H1VX 4LF6K 2HHTA 2Q2RA 4B1UB 1D9FA 1QZ6A 2VG5A 3A5OC 3M1FA 4O8KA 1S1VA 3UE5A 1DEJA 3WQTA 4OPAA 5EVZA 1SL1A 2IS3A 3O80A 2KZMA 4KHSA 4C8LA 4GV3A 1CZAN 1SS6A 2EHGA 3T7ZA 3ZT3A 4CFBA 5I9EB 3PIPL 5BN9A 3THYA 3EYZA 3NCIA 1LWEA 5M1QA 4FWOA 3LP2A 3ZSXA 1BGXT 2G8FA 2IVPA 4BVPA 4CZLA 4WFNL 4KTWA 1Z6RA 1QVGM 2FLOA 5AQMA 3IAYA 3ID6A 3ENHA 1VSFA 3A2FA 1VSEA 1J53A 2QWNA 3VEOA 3E9LA 3LAMA 4DLEA 3SV4A 3IKMA 3F2KA 4JAXA 3TTFA 4H0XB 3O4WA 1D5AA 3I55N 2FSKA 5E41A 4O0IA 2QWLA 2GUIA 2QXLA 3PX4A 4BGBA 1CLQA 2F9TA 1YAGA 4CJKA 3NGYA 4JKEA 3ZX0A 4PL7A 4I2QA 3DM2A 5C15A 5IWAK 4A61A 2GWKA 4H0TB 3O3FA 1ATNA 2YV0X 4J2EA 3QESA 5AQIA 4EHUA 5KGWA 4BRPA 4CJSA 3SK3A 4X66K 3VEWA 4C8KA 4KFBA 3OYGA 3LDLA 2OTJN 4PWDA 4FLXA 4DV3K 4RW8A 2OYQA 1HMVA 3CC7N 4H03B 4JK9A 5GADP 1TAUA 5FROA 3AVAA 4GW6A 5HOOA 1RTHA 2JLEA 1SUQA 1U45A 4B9TA 2D0CA 2NRZA 3OYIA 4OLAA 4DF4A 5JICA 4BROA 1NU0A 1FK9A 4H0OA 5EX5A 3SV3A 3KD1E 1WSEA 1TKTA 4DTUA 1IKYA 4PA1A 5HRRA 1VQ7N 5AQFA 4NXMK 3TU5A 5C10A 4Q5VA 4JI6K 1MWMA 2I7NA 1ASVA 1W7AA 2PZSA 3J7ZO 3QB0A 3T19A 4BVOA 4I2PA 3K5OA 3CJ9A 4FPBA 4A2AA 2ZF5O 5DM6L 3VQAA 2WBNA 1S1WA 3NF8A 1KVCA 4Z4IA 4IFYA 2P5OA 1NGBA 3CYMA 2W41A 1VQ4N 1D8YA 1NNEA 3CQYA 2YI1A 1C1AA 3V9SA 4LF7K 4MQ3A 1GLFO 1VQKN 4B9UA 4CZGA 4ILGB 3I56N 4BREA 2RN2A 1JL1A 1GLDG 4CGDA 1L3TA 1LCUA 4BG9A 1E3MA 4EHTA 4A2BA 4CF0A 4ZTJA 3C0BA 3ULEA 3OJUA 4KRFA 2A6AA 4FLWA 3QIPA 4LH5A 3ZSZA 3S3MA 2HHXA 1Q9YA 2W6LA 1UOCA 2D1KA 5LJWA 3SJJA 3O5BA 4BDPA 4YHHK 1QHAA 2G8VA 2YJEA 2E2QA 2E2PA 2H3GX 3AAQA 1BHLA 2O4GA 3DRPA 3IS9A 3DYAA 4IKFA 4LFBK 1S6PA 3OY9A 1BWFO 1EX4A 4BC5A 3OS1A 3AO4A 1VSHA 4I6MA 4JS5A 2P9PA 3V9ZA 1JKHA 3O1WA 1NG9A 4B9QA 4BR4A 3OTOK 3CCMN 2PYLA 4W5QA 3O8MA 4WQ4A 3G0ZA 3N4QA 1YTUA 4OGCA 4H5VA 4KHUA 1S6QA 1JCFA 4Y0WA 5C42A 1W0HA 5AQZA 2ZWHA 1BQMA 4QS9A 1T3VA 4W5TA 3RRHA 1GLBG 4H5TA 2XY7A 4ID5A 3QNOA 1K8KA 2GTDA 4J2AA 4YY3K 4CEFA 4XH4A 4KHPK 4CZJA 3HTVA 3ID8A 3MCPA 4AH9A 5BRFA 3CCUN 1HNVA 1N5YA 3G6EN 5ADXH 1YXQA 1E4FT 3QO9A 2D0OA 1IKVA 3U3GA 3AA3A 1VSJA 2QEXN 1GOCA 1KAYA 2QM1A 3NE6A 4MO5A 2F9WA 5I3UA
chains in the Genus database with same CATH topology
1Y64A 5E26A 4YOTA 1YITN 3CQXA 1RFQA 3SMSA 1ESVA 3AGKA 2UYTA 3MWPA 2W40A 5KQDA 2HBKA 3FFKB 3EE9A 3SLCA 4RWTA 4EAHD 5JLFA 1W97L 3BP8A 1GLJO 3A8YA 3NVKA 3GE1A 5BRDA 2CH5A 4WFAL 2HF4A 4FWMA 2YHXA 3SBGA 4BRMA 1HJOA 4O5FA 3G71N 2P9SB 1O13A 2E88A 2PAVA 3GDQA 3I8BA 3O9TA 3CJBA 4B1ZA 1JCGA 4BC3A 3CCSN 3BUZB 3ZEUA 1ZBSA 2NRXA 2AP1A 1NBWA 3QDKA 3GBTA 3CCJN 2YJFA 3CJAA 3WXIA 4A57A 5FPDA 5FPMA 2NRWA 4OO1J 1KXPA 5AQKA 2FF3B 1BU6O 2E20A 3C6AA 5M1KA 3VF6A 5B8HA 3C6HA 3VF4A 2PFUA 5AQSA 4YOVA 1IJJA 2D4WA 2QWOA 1QQMA 3F5TA 4PKHA 5KPRA 1VQ9N 1NGFA 5C12A 4YOYA 3VTHA 4WQ5C 3G4SN 3VERA 4CD3A 1MDUB 3HBTA 3MMVA 4EIAA 4BR9A 2HOEA 3GL1A 3HM8A 4FWKA 1U2VA 4YOUA 3DJCA 3FZFA 4XH1A 1QQNA 3R1XA 2QWMA 3LDOA 4DQ8A 1NGCA 4JKGB 2YCHA 4BQZA 2P9LB 4CJ7A 2A42A 1DKGD 2YHYA 1IG8A 2HF3A 5H1SQ 3NMUA 3J8AA 4FOIA 3U8XA 4KH6A 4FL9A 4PHTX 3K9KA 2Q1NA 5GINA 5E84A 2ITMA 3A5NC 1KC8O 4JHDA 2RHKA 4H0VB 3HRGA 4IZ9A 3L6QA 3O9SA 1RDWX 1TYQB 3CHWA 4IJNA 1YJNN 3E66A 3EKSA 5KPZA 4JHDB 2A40A 2ASOA 3CMAN 4KBOA 3VF2A 2HBMA 2QA4N 1N8RO 1P8ZA 1QZ5A 1X3NA 3H3NO 4M7XA 1Q82O 4GVEA 3L4IA 2JWKA 4DCHA 3KVGA 1YF5L 2HBJA 4U67L 5EOYA 1NGEA 4M7YA 3TTDA 4C1NK 1GLAG 3AARA 1KD1O 1T44A 5JMVA 5GAHP 2QWRA 5AQTA 4BC4A 3ZETB 2NRHA 1M90O 3D2FA 4BRIA 3I33A 3CI5A 4WYBA 1C0FA 3QFUA 4IDHA 4H5WA 4AM6A 5KQ8A 1BUPA 1TUUA 4ISEA 5F0XA 1ILYA 3VEZA 5JLHA 2IVOA 3RSEA 4E1JA 3O6WA 1Q81O 2Q97A 3QICA 2HBLA 3MWTA 2FXUA 3EZWA 3CCLN 4MDBA 1E4GT 4BG8A 3WEEA 5KPTA 4BGAA 3ENBA 2NZTA 1GLEG 3D2EB 3ENOA 3H3OB 3KZBA 4MLEA 3ZYYX 5GAEP 2GELA 1NGIA 4IOAL 1ATRA 4PKIA 2YX6A 2VGNA 3HZ6A 4OPHA 3JS6A 5AQVA 5MLCQ 4AF1A 2YHWA 5FPEA 3D7EO 5JVGL 1TUYA 3AAPA 2JWLA 4KH5A 3CMEN 1BDGA 3MN6A 4XH5A 4BQLA 2ZJRL 2D0PA 1ATSA 1G99A 2P9UA 3IMXA 3OBWA 1HKCA 3IUCA 3M6GA 4NO7A 4CZEA 5C2DA 3MN9A 1QQOA 1VQPN 2NRVA 1XQSC 3UKUA 4FVUA 3CF5L 1W2BM 2E2OA 2V7ZA 3VGKA 3MN7A 4JK8A 5ADXA 1HX1A 3R8EA 1U6ZA 4QS7A 4BRAA 2ZGYA 4C1NI 3OA9A 3VOVA 4BRKA 5ELZA 5HL7L 1VQ8N 4F9OA 4FWPA 5AR0A 4EFHA 1VQLN 2Q0RA 4H0YB 1V4TA 3U9DA 2F7TA 2ZJQL 2QWPA 2Q31A 3NVMA 4JKHA 4B1VA 1X9JA 3PLAA 3HSCA 1HKGA 3CCEN 1ZC6A 2IIRA 2OTLN 3CPWM 2P9SA 3SJHA 5FPNA 4BRDA 1MWKA 3FZHA 5M1NA 2P9KB 3TPQA 3CCQN 3ZX2A 5CR4A 5GIOA 1Q7YO 4BR2A 4U7BA 1HKBA 4IXCA 5DM7L 1SZ2A 4K43A 2HMPA 3RVCA 2E1YA 4JKBA 4BRGA 3R9PA 2RE2A 5GAGP 3DLLL 2ZJPL 3QMLA 3G25A 4WQ5A 3LDNA 3CPEA 3EE8A 5AQNA 5BPLA 1YHQN 4BRCA 3LDQA 1YJWN 3CD6N 3DXKA 2P9IB 3FR0A 4XEIA 2HSTA 2KKZA 4GY2B 4M63C 1NLVA 1WOQA 4BRPA 3SMPA 3HOTA 3BEXA 3O9QA 5TKWA 3CJ1A 3DXKB 3EKUA 4NLBA 3O08A 3VGMA 1M1KO 2KHOA 4JKGA 2P9LA 5C0YA 3M5RA 3SAHA 4GV6A 4IWVA 3K9JA 1KAXA 3VENA 4YOXA 3KHYA 3WXKA 2P9NB 3HI0A 3VGLA 2A41A 1T6DA 1OKJA 2KLAA 4CZIA 3JXUA 5AFUA 5AQOA 3FZKA 1TYQA 3WUHA 1VQON 3A5LC 4CI6A 2QI2A 3O9UA 4A5AA 3BF3A 3D6RA 4H5NA 3H6EA 3Q7BA 4IOXA 4CZHA 5AQLA 3LM2A 4RCHA 2J4RA 3DAWA 2BUPA 2V7YA 3H1VX 5AQQA 4BRLA 2Q2RA 4A62A 1OVYA 3U9ZA 4B1UB 3DWLA 3E1YA 3FZLA 3QFPA 1QZ6A 4BR7A 3A5OC 3M1FA 3ZETA 1NGGA 3IFRA 4O8KA 3UE5A 3Q7CA 1DEJA 2I7PA 4DB3A 3WQTA 4OPAA 5EVZA 3KWIA 3GOIA 4FWNA 3O80A 3CCVN 1X3MA 4GV3A 3VEYA 1CZAN 1SS6A 3H45C 3T7ZA 5BPNA 1K73O 3VEXA 3BF1A 3KK7A 3PIPL 5I9EB 3O9RA 2OANA 5BN9A 1S3XA 1NGJA 4JD2A 3QBWA 1HUXA 2PBDA 1JCEA 1VQNN 4BRQA 3ULEB 2DPNA 5M1QA 1C0GA 4FWOA 3D2EA 1NGDA 5GIPA 4JD2B 5M1OA 5AQUA 2IVPA 3LDPA 4BVPA 4CZLA 4WFNL 4WFBL 4DHYA 4FWLA 3P4IA 4JN4A 1Z6RA 2CH6A 1R59O 1QVGM 4L3QA 2FLOA 3LL3A 5AQMA 3ID6A 3ENHA 4FOEA 4JK7A 3TSUA 4JKDA 2QWNA 3VEOA 3E9LA 3TSQA 3IKMA 4LC9B 3F2KA 2IVNA 4JAXA 4H0XB 3O4WA 4FWQA 3TTFA 5BRHA 4CZKA 4CBXA 4JKCA 3O1BA 4ISGA 1WUAA 3I55N 4ISFA 1Q18A 2E8AA 2FSKA 3SAFA 3VEVA 4YDUA 2QWLA 2QXLA 1H1VA 1SQKA 2P9PB 4BGBA 2AA4A 1GLLO 2F9TA 4RTFD 1YAGA 5AZJB 4JKEA 4PL7A 3FGUA 3OBYA 3ZX0A 5AQJA 1XUPO 5AQGA 5EY4A 4HTLA 5C15A 4WF9L 1VQMN 4A61A 3CETA 3VTIA 1K8AO 1BA0A 1V4SA 2GWKA 3FE1A 4H5RA 3SBTA 4H0TB 4BR0A 3WXJA 3CJ7A 1ATNA 3CIPA 4YDUC 2E2NA 3CC4N 1YIJN 3HOSA 5AQIA 1NM1A 4IFEA 4WQ4C 2NRRA 4EHUA 5AQRA 1RDUA 4JKAA 3T69A 4JKFA 4B1YB 3SK3A 1EQYA 4BRNA 3UB5A 3M3ZA 3VESA 3VEWA 4BRFA 3LDLA 3L4QA 2P9KA 4K42A 2VWBA 4C23A 2OTJN 3F9MA 3WQUA 1P90A 4GV9A 2FF6A 3AY9A 3CC7N 4H03B 4JK9A 5GADP 3P31A 4CZFA 3WT0A 1T6CA 3E9OA 4A59A 4GNIA 3C7NA 5EXWA 1VQ6N 5CHIA 5HOOA 1S72N 2P9IA 3H46O 4B1XB 5AQPA 1XC3A 1YUWA 2NLXA 3MN5A 4IO9L 3VMFB 3C7NB 1ZXOA 2NRZA 2ZGZA 3CCRN 3CC2N 4JNEA 3S41A 1VQ5N 4FWRA 5JICA 4CBUA 2Q36A 4BROA 1BA1A 1RGIA 3AGRA 4H0OA 5EX5A 1LOTB 5BPMA 4MDAA 3OW2M 4IEEA 1VQ7N 2EWSA 4UY8O 1NGAA 5AQFA 1D4XA 3TU5A 2WFBA 3VETA 5C10A 1JJ2M 1MWMA 4PL8A 2I7NA 3J7ZO 3QB0A 2P9NA 4BVOA 4O8UA 2WUSA 5F1XA 2Q0UA 4K25A 3CJ9A 2CGJA 4FPBA 4A2AA 1S22A 4YOWA 2FSJA 2ZF5O 1YI2N 5BR9A 3ZEUB 5DM6L 2WBNA 1GLCG 5M1PA 1Q86O 3MDQA 3LM9A 3GG4A 2VGMA 1BO5O 4PKGA 4B1WB 4CD1A 2QWQA 1NGBA 3R3LA 2W41A 3EO3A 3EN9A 3ZX3A 3MCAB 1VQ4N 5AZIA 4FSVA 3WXLA 1DT9A 3CQYA 2YI1A 5AQXA 4R79A 3TSPA 5CE3A 2WC9A 1NGHA 1YJ9N 1GLFO 5AZIB 1VQKN 4CZGA 4ILGB 3KWGA 4BC2A 3I56N 4BREA 5JVHL 4ILJA 3TTCA 1GLDG 3N4PA 1LCUA 1U2VB 4BG9A 5AFUH 4J8FA 4EHTA 2E1ZA 1BG3A 5C2FA 1EO1A 4A2BA 3MX5A 2QTDA 2BTFA 3C0BA 3ULEA 5AQHA 2A6AA 3CERA 3SAGA 2GUPA 2NRTA 3MK6A 1MA9B 3B8AX 4HWIA 4FO0A 1HLUA 2D1KA 2FSNA 5LJWA 3OHRA 3O5BA 2A5XA 2V52B 4Z94A 1QHAA 2YJEA 2E2QA 4IJAA 4BR5A 5AQWA 5F2RA 2E2PA 2H3GX 5AQYA 3AAQA 3CJCA 4FPAA 1SAZA 4IO8A 3DXMA 3ATUA 1BWFO 1Z05A 4BC5A 4ILHA 4I6MA 4NB4A 3W0LA 2ASMA 2P9PA 2V51B 3D2FB 1BOTO 4G9ZA 3DXMB 1VAZA 3O1WA 4CZMA 5AZJA 1K9MO 4H0PA 3W3DA 4B9QA 4BR4A 4AM7A 3CCMN 4K41A 4I6MB 2VYPA 3RSEB 3O8MA 2VCPA 4WQ4A 3MX2A 3IDHA 4BRHA 3N4QA 3UKRA 2CGLA 4FWSA 3CXCM 2ASPA 4H5VA 2A3ZA 1YVNA 1HPMA 1JCFA 4Y0WA 4WCEL 5M1FA 3R6MA 3A5MC 5AQZA 1J6ZA 2GEMA 2ZWHA 3C65A 3U4LA 3WEEB 4MLHA 3UKRB 4CBWA 3PIOL 4BY9C 4QS9A 1T3VA 3P39A 3QBXA 1GLBG 1NWKA 4H5TA 2BH1A 4KH4A 4JEPA 1K8KA 2GTDA 5LJVA 4YORA 1NJIO 1KAZA 5BREA 3L0QA 4XH4A 1KQSM 1K8KB 4CZJA 3HTVA 2GWJA 1QVFM 2P9UB 3ID8A 3MCPA 4IEIA 2GX9A 5BRFA 3P38A 3CCUN 3ATVA 4QS8A 3G6EN 3FLCO 5BN8A 3VPZA 5ADXH 5TKYA 2QW9A 4IOCL 1YXQA 1DGKN 2CGKA 1E4FT 4MO4A 4NLCA 3UKUB 2D0OA 3E9PA 4A5BA 2NNWA 4DKWA 2QEXN 3H1QA 1KAYA 2QM1A 3A0IX 3EL2A 3FZMA 4MO5A 3WXMB 5LY3A 2F9WA 1NMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y64 A;  5E26 A;  3CQX A;  1RFQ A;  3SMS A;  1ESV A;  2UYT A;  2W40 A;  5KQD A;  4RWT A;  3FFK B;  3SLC A;  4EAH D;  5JLF A;  3BP8 A;  1GLJ O;  3A8Y A;  3GE1 A;  5BRD A;  2CH5 A;  2HF4 A;  4FWM A;  2YHX A;  4BRM A;  1HJO A;  4O5F A;  2P9S B;  2E88 A;  2PAV A;  3GDQ A;  3I8B A;  3CJB A;  4B1Z A;  1JCG A;  4BC3 A;  3BUZ B;  3ZEU A;  1ZBS A;  2AP1 A;  1NBW A;  3QDK A;  3GBT A;  2YJF A;  3CJA A;  3WXI A;  5FPD A;  5FPM A;  1KXP A;  5AQK A;  2FF3 B;  1BU6 O;  2E20 A;  3VF6 A;  5B8H A;  3VF4 A;  5AQS A;  1IJJ A;  2D4W A;  2QWO A;  1QQM A;  4PKH A;  5KPR A;  1NGF A;  4WQ5 C;  3VER A;  4CD3 A;  1MDU B;  3HBT A;  3MMV A;  4EIA A;  4BR9 A;  2HOE A;  3GL1 A;  3HM8 A;  4FWK A;  1U2V A;  3DJC A;  3FZF A;  4XH1 A;  1QQN A;  2QWM A;  3LDO A;  4DQ8 A;  1NGC A;  4BQZ A;  2YCH A;  2P9L B;  4CJ7 A;  2A42 A;  1DKG D;  2YHY A;  1IG8 A;  2HF3 A;  3J8A A;  4FOI A;  3U8X A;  4FL9 A;  2Q1N A;  5E84 A;  2ITM A;  3A5N C;  4JHD A;  4H0V B;  4IZ9 A;  3L6Q A;  1RDW X;  1TYQ B;  3CHW A;  4IJN A;  3EKS A;  5KPZ A;  4JHD B;  2A40 A;  2ASO A;  4KBO A;  3VF2 A;  1P8Z A;  1QZ5 A;  1X3N A;  3H3N O;  4M7X A;  3L4I A;  4DCH A;  3KVG A;  5EOY A;  1NGE A;  4M7Y A;  1GLA G;  3AAR A;  1T44 A;  5JMV A;  2QWR A;  5AQT A;  4BC4 A;  3ZET B;  2NRH A;  3D2F A;  4BRI A;  3I33 A;  3CI5 A;  4WYB A;  1C0F A;  3QFU A;  4H5W A;  4AM6 A;  5KQ8 A;  1BUP A;  1TUU A;  4ISE A;  5F0X A;  3VEZ A;  5JLH A;  2IVO A;  3RSE A;  4E1J A;  3O6W A;  2Q97 A;  3QIC A;  2FXU A;  3EZW A;  1E4G T;  4BG8 A;  3WEE A;  5KPT A;  4BGA A;  2NZT A;  1GLE G;  3D2E B;  3ENO A;  3H3O B;  3KZB A;  4MLE A;  2GEL A;  1NGI A;  1ATR A;  4PKI A;  5AQV A;  3HZ6 A;  3JS6 A;  2YHW A;  5FPE A;  3D7E O;  1TUY A;  3AAP A;  1BDG A;  3MN6 A;  4XH5 A;  4BQL A;  2D0P A;  1ATS A;  1G99 A;  2P9U A;  3IMX A;  1HKC A;  3IUC A;  3M6G A;  4NO7 A;  4CZE A;  3MN9 A;  1QQO A;  1XQS C;  3UKU A;  2E2O A;  2V7Z A;  3VGK A;  3MN7 A;  5ADX A;  1HX1 A;  3R8E A;  1U6Z A;  4QS7 A;  4BRA A;  2ZGY A;  3VOV A;  4BRK A;  5ELZ A;  4F9O A;  4FWP A;  5AR0 A;  4EFH A;  2Q0R A;  4H0Y B;  1V4T A;  3U9D A;  2QWP A;  2Q31 A;  4B1V A;  1X9J A;  3HSC A;  1HKG A;  1ZC6 A;  2IIR A;  2P9S A;  3SJH A;  5FPN A;  4BRD A;  1MWK A;  3FZH A;  2P9K B;  3TPQ A;  3ZX2 A;  4BR2 A;  1HKB A;  4IXC A;  1SZ2 A;  4K43 A;  2HMP A;  2E1Y A;  4BRG A;  3R9P A;  3QML A;  3G25 A;  4WQ5 A;  3LDN A;  5AQN A;  5BPL A;  4BRC A;  3LDQ A;  3DXK A;  2P9I B;  3FR0 A;  4XEI A;  4M63 C;  4GY2 B;  1NLV A;  1WOQ A;  3SMP A;  3BEX A;  3CJ1 A;  3DXK B;  3EKU A;  3O08 A;  3VGM A;  2KHO A;  2P9L A;  4IWV A;  3VEN A;  1KAX A;  3KHY A;  3WXK A;  2P9N B;  3HI0 A;  3VGL A;  2A41 A;  1T6D A;  1OKJ A;  4CZI A;  3JXU A;  5AFU A;  5AQO A;  3FZK A;  1TYQ A;  3WUH A;  3A5L C;  4CI6 A;  3BF3 A;  4H5N A;  3H6E A;  4CZH A;  5AQL A;  3LM2 A;  4RCH A;  2J4R A;  3DAW A;  2BUP A;  2V7Y A;  3H1V X;  5AQQ A;  4BRL A;  2Q2R A;  4A62 A;  3U9Z A;  4B1U B;  3DWL A;  3FZL A;  3QFP A;  1QZ6 A;  4BR7 A;  3A5O C;  3M1F A;  3ZET A;  1NGG A;  3IFR A;  4O8K A;  3UE5 A;  1DEJ A;  2I7P A;  4DB3 A;  3WQT A;  5EVZ A;  3GOI A;  4FWN A;  3O80 A;  1X3M A;  3VEY A;  1CZA N;  3H45 C;  5BPN A;  3VEX A;  3BF1 A;  5I9E B;  5BN9 A;  2OAN A;  1S3X A;  1NGJ A;  4JD2 A;  3QBW A;  1HUX A;  2PBD A;  1JCE A;  4BRQ A;  3ULE B;  2DPN A;  1C0G A;  4FWO A;  3D2E A;  1NGD A;  4JD2 B;  5AQU A;  2IVP A;  3LDP A;  4BVP A;  4CZL A;  4DHY A;  4FWL A;  3P4I A;  4JN4 A;  1Z6R A;  2CH6 A;  1R59 O;  4L3Q A;  2FLO A;  3LL3 A;  5AQM A;  3ENH A;  4FOE A;  2QWN A;  3VEO A;  5BRH A;  4LC9 B;  2IVN A;  4JAX A;  4H0X B;  3O4W A;  4FWQ A;  4CZK A;  4CBX A;  3O1B A;  4ISG A;  1WUA A;  4ISF A;  1Q18 A;  2E8A A;  2FSK A;  3VEV A;  4YDU A;  2QWL A;  2QXL A;  1H1V A;  1SQK A;  2P9P B;  4BGB A;  2AA4 A;  1GLL O;  2F9T A;  4RTF D;  1YAG A;  5AZJ B;  4PL7 A;  3FGU A;  3ZX0 A;  5AQJ A;  1XUP O;  5AQG A;  5EY4 A;  4HTL A;  4A61 A;  3CET A;  1BA0 A;  1V4S A;  2GWK A;  3FE1 A;  4H5R A;  4H0T B;  4BR0 A;  3WXJ A;  3CJ7 A;  1ATN A;  3CIP A;  4YDU C;  2E2N A;  5AQI A;  1NM1 A;  4WQ4 C;  4EHU A;  5AQR A;  4B1Y B;  4BRP A;  3SK3 A;  1EQY A;  4BRN A;  3UB5 A;  3M3Z A;  3VES A;  3VEW A;  4BRF A;  3LDL A;  4C23 A;  2P9K A;  4K42 A;  2VWB A;  3F9M A;  3WQU A;  2FF6 A;  3AY9 A;  4H03 B;  4CZF A;  3WT0 A;  1T6C A;  4GNI A;  3C7N A;  5EXW A;  2P9I A;  3H46 O;  4B1X B;  5AQP A;  1XC3 A;  1YUW A;  2NLX A;  3MN5 A;  3C7N B;  1ZXO A;  2ZGZ A;  4JNE A;  3S41 A;  4FWR A;  5JIC A;  4CBU A;  2Q36 A;  4BRO A;  1BA1 A;  1RGI A;  4H0O A;  5EX5 A;  1LOT B;  5BPM A;  2EWS A;  1NGA A;  5AQF A;  1D4X A;  3TU5 A;  3VET A;  1MWM A;  4PL8 A;  2I7N A;  3QB0 A;  2P9N A;  4BVO A;  2WUS A;  5F1X A;  2Q0U A;  4K25 A;  3CJ9 A;  2CGJ A;  4FPB A;  4A2A A;  1S22 A;  2FSJ A;  2ZF5 O;  5BR9 A;  3ZEU B;  1GLC G;  3MDQ A;  3LM9 A;  3GG4 A;  4PKG A;  1BO5 O;  4B1W B;  4CD1 A;  2QWQ A;  1NGB A;  2W41 A;  3EO3 A;  3EN9 A;  3ZX3 A;  5AZI A;  4FSV A;  3WXL A;  3CQY A;  2YI1 A;  5AQX A;  5CE3 A;  1NGH A;  1GLF O;  5AZI B;  4CZG A;  4BC2 A;  4BRE A;  1GLD G;  1LCU A;  1U2V B;  4BG9 A;  5AFU H;  4J8F A;  4EHT A;  2E1Z A;  1BG3 A;  4A2B A;  2BTF A;  3C0B A;  3ULE A;  5AQH A;  2A6A A;  3CER A;  2GUP A;  3MK6 A;  1MA9 B;  3B8A X;  4HWI A;  4FO0 A;  1HLU A;  2D1K A;  2FSN A;  5LJW A;  3OHR A;  3O5B A;  2A5X A;  2V52 B;  4Z94 A;  1QHA A;  2YJE A;  2E2Q A;  4IJA A;  4BR5 A;  5AQW A;  5F2R A;  2E2P A;  2H3G X;  5AQY A;  3AAQ A;  3CJC A;  4FPA A;  1SAZ A;  4IO8 A;  3DXM A;  3ATU A;  1BWF O;  1Z05 A;  4BC5 A;  4I6M A;  4NB4 A;  3W0L A;  2ASM A;  2P9P A;  2V51 B;  3D2F B;  1BOT O;  3DXM B;  3O1W A;  4CZM A;  5AZJ A;  4H0P A;  3W3D A;  4B9Q A;  4BR4 A;  4AM7 A;  4K41 A;  4I6M B;  2VYP A;  3RSE B;  3O8M A;  2VCP A;  4WQ4 A;  3IDH A;  4BRH A;  3UKR A;  2CGL A;  4FWS A;  2ASP A;  4H5V A;  2A3Z A;  1YVN A;  1HPM A;  1JCF A;  4Y0W A;  3R6M A;  3A5M C;  5AQZ A;  1J6Z A;  2GEM A;  2ZWH A;  3U4L A;  3WEE B;  4CBW A;  4MLH A;  3UKR B;  4QS9 A;  3QBX A;  1GLB G;  1NWK A;  4H5T A;  1K8K A;  2GTD A;  5LJV A;  1KAZ A;  5BRE A;  3L0Q A;  4XH4 A;  1K8K B;  4CZJ A;  3HTV A;  2GWJ A;  2P9U B;  3ID8 A;  3MCP A;  5BRF A;  3ATV A;  4QS8 A;  3FLC O;  5BN8 A;  3VPZ A;  5ADX H;  5TKY A;  2QW9 A;  1YXQ A;  1DGK N;  2CGK A;  1E4F T;  4MO4 A;  3UKU B;  2D0O A;  3H1Q A;  1KAY A;  2QM1 A;  3A0I X;  3EL2 A;  3FZM A;  4MO5 A;  5LY3 A;  2F9W A;  1NMD A; 
#chains in the Genus database with same CATH topology
 3SMS A;  1JXE A;  4M3T A;  2UYT A;  4CFA A;  2HBK A;  4RWT A;  3EE9 A;  2YKN A;  1TK5 A;  5JLF A;  3NVK A;  3OYC A;  2IC3 A;  2HF4 A;  4BRM A;  4KHY A;  4Z4E A;  2PAV A;  4B3M K;  4B1Z A;  4BWM A;  1NBW A;  2O8E A;  4DFJ A;  3GBT A;  3WXI A;  5HRS A;  1XMQ K;  4FK2 A;  3ITH A;  4NCG A;  5FPM A;  2NRW A;  3EZ5 A;  4OO1 J;  5AQK A;  2FF3 B;  2E20 A;  3C6A A;  1JLF A;  3VQ7 A;  5M1K A;  3VF4 A;  4CJ4 A;  2NUB A;  4FJ7 A;  5KPR A;  1NGF A;  1ASU A;  4CJQ A;  4ELU A;  3G4S N;  3BGR A;  3LP1 A;  4L8R B;  4FWK A;  3FZF A;  4LD0 A;  1QQN A;  2QWM A;  1NGC A;  3AVB A;  3OYL A;  4JKG B;  4BQZ A;  1QTM A;  1KFS A;  2P9L B;  2A42 A;  1DKG D;  2YHY A;  3DMJ A;  3J8A A;  2Q3S A;  3EY1 A;  3K9K A;  5GIN A;  4B9N A;  1KC8 O;  3D0P A;  3O9S A;  3LZI A;  1TYQ B;  1YJN N;  3B6P A;  3T3F A;  5KPZ A;  2A40 A;  2O4I A;  2HBM A;  3DOL A;  1P8Z A;  1Q82 O;  3L4I A;  2JWK A;  1YF5 L;  3SYZ A;  4U67 L;  3TTD A;  1GLA G;  3FFI A;  2QWR A;  2FBY A;  5AQT A;  2NRH A;  1S5J A;  4B08 A;  3LPU A;  3I33 A;  3CI5 A;  4WYB A;  4IDH A;  4H5W A;  4FW1 A;  2VQE K;  1BUP A;  4I7F A;  1TUU A;  5J2N A;  5JLH A;  1HQU A;  1Q81 O;  4CIG A;  1TV6 A;  1U4B A;  1N33 K;  1SKW A;  2FXU A;  1I94 K;  2JGU A;  2NZT A;  3HO1 A;  2XY6 A;  2BGG A;  3ENO A;  5K14 A;  4HUE A;  4FLY A;  4MLE A;  3TAG A;  1NGI A;  4B8A B;  4PKI A;  5AQV A;  4OPH A;  2O8C B;  4FJ8 A;  4PY5 A;  1RDD A;  3DI6 A;  2ZJR L;  1ATS A;  1G99 A;  2P9U A;  1HKC A;  4OVL A;  4CZE A;  5C2D A;  1T05 A;  2UUB K;  1DLO A;  1VQP N;  2O8B A;  3CF5 L;  4DR7 K;  4CEB A;  3R8E A;  1IO2 A;  4HTU A;  4C1N I;  4HVJ A;  3QER A;  1NK6 A;  4FWP A;  3LAK A;  4EFH A;  2Q0R A;  2OCE A;  4IBN A;  4FK0 A;  2Y1J A;  2Q31 A;  1VSL A;  3HSC A;  3L2W A;  3HL8 A;  5DK5 A;  4DTR A;  4O4G A;  4CF1 A;  3SI6 A;  3CPW M;  3MEE A;  2P9S A;  3BZC A;  5CR4 A;  1Q7Y O;  3QIN A;  5JS2 A;  2DFF A;  4U7B A;  1LV5 A;  3HYF A;  5DM7 L;  1WSG A;  1IKX A;  2YNF A;  1NK0 A;  4GKJ K;  1W9H A;  2YNI A;  5GAG P;  1U04 A;  1RT1 A;  1YTA A;  2BE2 A;  4GMJ B;  5J2P A;  4CGF A;  3LDQ A;  2QXF A;  4XEI A;  4DSK A;  2HST A;  4M63 C;  3AVN A;  3SMP A;  3C6T A;  3KKR A;  3O9Q A;  3O3H A;  4DUZ K;  5FRN A;  4JI7 K;  2VWK A;  4OKJ A;  1Z25 A;  2IOC A;  1B9F A;  1LAW A;  4FM2 A;  4KKO A;  3K59 A;  3M5R A;  1SKR A;  2O8D B;  1KAX A;  4OLB A;  2P9N B;  1HQE A;  3K57 A;  3VGL A;  3LPT A;  3PY8 A;  3U6F A;  4CI6 A;  1UA1 A;  2QI2 A;  3F9K A;  1JLQ A;  2OPS A;  4CHZ A;  4H5N A;  3Q7B A;  1QE1 A;  1UA0 A;  4BDZ A;  3DAW A;  5HRP A;  3K5M A;  3K5L A;  3DWL A;  3FZL A;  3ZET A;  3S3O A;  1NGG A;  4E3S A;  3Q7C A;  4WE1 A;  4FWN A;  3CCV N;  3VEY A;  2DY4 A;  3BF1 A;  2ITG A;  3B6O A;  4H8K A;  4B3S K;  1RBS A;  4HUG A;  1SKS A;  1S3X A;  3QBW A;  3CM5 A;  2PBD A;  3OYB A;  3V9U A;  5KGX A;  4CVN E;  5M1O A;  4DQQ A;  4CF2 A;  1T7P A;  3VQ5 A;  4CEO A;  4HCC A;  4JI1 K;  1R59 O;  1KFD A;  1NJW A;  4FOE A;  3TSU A;  4JKD A;  3TSQ A;  3VQ8 A;  4FWQ A;  4CZK A;  4JKC A;  5D3G A;  1WUA A;  1BCO A;  1SL0 A;  4ISF A;  1A5X A;  2E8A A;  3F73 A;  3VEV A;  4YDU A;  1JLG A;  3QET A;  3RWU A;  1S1X A;  1H1V A;  1SQK A;  3TAF A;  2ATQ A;  1DTQ A;  4RTF D;  2EX3 A;  1KVB A;  1DTT A;  4CK1 A;  4CCH A;  3VTI A;  1BA0 A;  4H5R A;  1N32 K;  4DFK A;  3CC4 N;  1YT3 A;  3HOS A;  1QS4 A;  4WQ4 C;  4IFE A;  2NRR A;  3CCS N;  2IGI A;  4B1Y B;  4B3T K;  4HUF A;  3O4N A;  4BRN A;  3UB5 A;  3NGZ A;  4C23 A;  4BRF A;  4OGE A;  2VWB A;  3F9M A;  3QEW A;  4X64 K;  3V1Q A;  3H08 A;  2FF6 A;  2KFZ A;  3L2Q A;  1A5W A;  2ZM6 K;  3THV A;  1T6C A;  4A59 A;  4BDY A;  1IG9 A;  1WSI A;  1RBU A;  3VA0 A;  2P9I A;  3HPH A;  3H46 O;  1XHX A;  5AQP A;  3THW B;  1YUW A;  2Z1H A;  5C24 A;  3C7N B;  1RT3 A;  3CC2 N;  1VRU A;  2RKI A;  4JNE A;  3S41 A;  1VQ5 N;  1RGI A;  1NOZ A;  2EWS A;  1NGA A;  4FJI A;  4DG1 A;  1JJ2 M;  1Q8I A;  4PL8 A;  1QSS A;  2HB5 A;  3V6D A;  5T7B A;  2A1S A;  4O8U A;  5F1X A;  3DRR A;  4AQY K;  1JLB A;  3KLI A;  1RDB A;  2RPI A;  4KO0 A;  5BR9 A;  3SPZ A;  1Q86 O;  5LMU K;  3LM9 A;  4PKG A;  4B1W B;  2YKM A;  3SPY A;  3EN9 A;  1FXX A;  3WXL A;  2I5J A;  1XNQ K;  4V19 S;  4R79 A;  3CFR A;  3TWH A;  3DLR A;  1U47 A;  4Z4F A;  4BC2 A;  3SUP A;  1NK4 A;  4RW4 A;  3J7A P;  3TAR A;  3N4P A;  3OS2 A;  1I39 A;  2F8T A;  1U2V B;  2IDO A;  5EU7 A;  3KK3 A;  4CHQ A;  2E1Z A;  1EO1 A;  3VA3 A;  4ICL A;  5AQH A;  1C1C A;  3CER A;  2NRT A;  4FO0 A;  1IBL K;  1HLU A;  2FSN A;  1NJX A;  3S9H A;  3OHR A;  3KK2 A;  4E19 A;  3OYJ A;  4N5S A;  4F2S A;  5AQW A;  5F2R A;  3K0S A;  4E89 A;  4FPA A;  4DLG A;  3S3N A;  1RBV A;  1Z05 A;  4ILH A;  4NB4 A;  3W0L A;  3I8D A;  3DXM B;  3L3V A;  3VQ6 A;  1C0T A;  3THX B;  5AZJ A;  3W3D A;  2XRI A;  4AM7 A;  4K41 A;  1CZ9 A;  2WTU A;  3RSE B;  4AHR A;  3IDH A;  4BRH A;  1HNI A;  1R0A A;  3PO4 A;  3C94 A;  3QNN A;  1KSP A;  4CJE A;  3WEE B;  1J6Z A;  2GEM A;  3AA5 X;  4CBW A;  4MLH A;  3UKR B;  3OYM A;  2P1J A;  4KHN A;  3P39 A;  1NWK A;  2BH1 A;  1C1B A;  4JEP A;  2IAJ A;  4DTX A;  1FKO A;  2W6K A;  5BRE A;  3L0Q A;  4CGJ A;  4AHC A;  1WAF A;  1S9G A;  4DU4 A;  4QS8 A;  3QEP A;  4LF5 K;  2QW9 A;  1REV A;  3UKU B;  2CGK A;  1U49 A;  2OZS A;  2G8H A;  3E9P A;  4DTM A;  3V81 A;  1KLN A;  3H1Q A;  4XIU A;  2X6N A;  1ZBU A;  3MXI A;  3L3U A;  1NMD A;  1Y64 A;  5E26 A;  4YOT A;  1EXQ A;  3SQ2 A;  5KQD A;  3FFK B;  3SLC A;  4EAH D;  4JI8 K;  4CJW A;  5BRD A;  4JLH A;  4DU1 A;  4CJR A;  3DLG A;  4CES A;  1A5V A;  4E1N A;  1HJO A;  4O5F A;  1UWB A;  1O13 A;  1KVA A;  2E88 A;  3O9T A;  3TAB A;  4BC3 A;  3BUZ B;  3ZEU A;  1N36 K;  2OA8 A;  2AP1 A;  4DQR A;  3CCJ N;  2BAN A;  3CJA A;  4A57 A;  1NK7 A;  1KXP A;  4CED A;  4BAC A;  3JSM A;  3T1H K;  4YOV A;  2PFU A;  4OPK A;  2D4W A;  1B9D A;  3HVT A;  3VER A;  2Z1I A;  4CD3 A;  1MDU B;  3MMV A;  1RCH A;  1WNS A;  4YOU A;  3DJC A;  3TI0 A;  2VG6 A;  2W42 A;  4DQ8 A;  4DSF A;  4C8O A;  4CJ7 A;  4B9M A;  1IG8 A;  4FOI A;  4E7H A;  4F3T A;  4FL9 A;  2HNY A;  5E84 A;  4ZTF A;  4B3R K;  4H0V B;  1L3U A;  3L6Q A;  3CHW A;  3V1R A;  2Z1G A;  2B6A A;  3RMC A;  3E66 A;  5CZ1 A;  4JHD B;  3RR7 A;  1N8R O;  1X3N A;  2DTU A;  3H3N O;  4GVE A;  4K8X A;  4EZ9 A;  5GAH P;  3NAE A;  1M90 O;  3D2F A;  4BRI A;  3HK2 A;  3NDK A;  1C0F A;  3O3G A;  1Q9X A;  2IVO A;  1HRH A;  3O6W A;  2QK9 A;  4CHN A;  3SQ1 A;  1RBR A;  1J9A A;  2HBL A;  3MWT A;  3THY B;  3L2V A;  1E4G T;  1LWF A;  3ENB A;  1ASW A;  2B5J A;  1HYS A;  5GAE P;  4IOA L;  1ATR A;  3AV9 A;  2YHW A;  3D7E O;  4CFC A;  1TUY A;  1I3A A;  1BDG A;  4XH5 A;  4BQL A;  5C25 A;  4KI6 A;  3IMX A;  4DR1 K;  4NO7 A;  2HNZ A;  4CIE A;  2HHV A;  4FVU A;  1TL3 A;  3KLG A;  3MAQ A;  4M3X A;  4CEA A;  1NK9 A;  4QS7 A;  5HL7 L;  3VOV A;  3WNF A;  1RNH A;  4JI2 K;  4F9O A;  5AR0 A;  4FJX A;  1OH7 A;  4H0Y B;  1WSF A;  3U9D A;  2F7T A;  3ZCM A;  2QWP A;  3NF6 A;  4M45 A;  3QEI A;  2F4V K;  1HKG A;  1RT2 A;  3CCE N;  3KK1 A;  3PV8 A;  3KD5 E;  5FDL A;  4H4M A;  1FKP A;  1LW0 A;  3ZSV A;  4NCB A;  1RDC A;  4K43 A;  3RVC A;  2RF2 A;  4JKB A;  4BRG A;  3R9P A;  4B9S A;  3LDN A;  5BPL A;  1YHQ N;  2P5G A;  3CD6 N;  3FR0 A;  4F4K A;  3VQE A;  4JV5 K;  5CYM A;  4W5N A;  4GY2 B;  4IFV A;  2Y1I A;  3AVG A;  1NLV A;  1TL1 A;  3HOT A;  3BEX A;  2QKB A;  5TKW A;  3DXK B;  4M3Y A;  2G8K A;  4K8Z A;  3EKU A;  4O5B A;  4JI4 K;  3O08 A;  3VGM A;  1IH7 A;  1OVQ A;  2KHO A;  1EET A;  1NK8 A;  4GV6 A;  4IWV A;  2OPR A;  3IRX A;  3WXK A;  3HI0 A;  1HJR A;  1RBT A;  2A41 A;  1T6D A;  1OKJ A;  1OH8 A;  3JXU A;  3I0R A;  1TK8 A;  3A5L C;  4FLU A;  4DMN A;  4IOX A;  3CFP A;  2HHU A;  4RCH A;  4FJL A;  2BUP A;  1BIU A;  1KTQ A;  5AQQ A;  4BRL A;  3NHG A;  1F21 A;  5FLX O;  3E1Y A;  1SV5 A;  3IFR A;  3AVC A;  2I7P A;  4DB3 A;  5BR8 K;  4QOZ B;  4DV5 K;  3V4I A;  3GOI A;  4AHV A;  1KLM A;  2YHA A;  3H45 C;  4FLZ A;  3ZSQ A;  3SUN A;  4CJP A;  3HP6 A;  1JCE A;  4BRQ A;  3ULE B;  4B9L A;  3D2E A;  5GIP A;  4JD2 B;  3OYH A;  3KKS A;  3LDS A;  5AQU A;  2O8F B;  4FWL A;  3P4I A;  2CH6 A;  4L3Q A;  4KB0 A;  3LL3 A;  4YNQ A;  2HHH K;  3JAM O;  2X74 A;  4C8N A;  1BI4 A;  5BRH A;  2IVN A;  4CBX A;  1X9M A;  1BCM A;  4ISG A;  4FW2 A;  4O55 A;  3M8Q A;  1Q18 A;  4BE2 A;  2P9P B;  4F3O A;  3K5N A;  4IG0 A;  3OBY A;  3ZSY A;  5AQJ A;  1XUP O;  5AQG A;  5EY4 A;  4WF9 L;  1VQM N;  4KRE A;  3DLE A;  3CET A;  1K8A O;  2XHB A;  3FE1 A;  1FW6 A;  2OPP A;  3CJ7 A;  1HPZ A;  2E2N A;  1G15 A;  3KLE A;  1NM1 A;  5AQR A;  3MXJ A;  4JKF A;  3T69 A;  1EQY A;  3VES A;  3M3Z A;  2P9K A;  4K42 A;  3M8P A;  3WQU A;  4GV9 A;  2FBT A;  1NMN A;  1NKB A;  3HST B;  3P31 A;  1OH6 A;  4M3W A;  3BZK A;  3E9O A;  4CE9 A;  3LP0 A;  4DTJ A;  4Z4H A;  4GNI A;  3C7N A;  1VQ6 N;  5CHI A;  3EEQ A;  1CXU A;  4B1X B;  1XC3 A;  4IO9 L;  3MN5 A;  2Z1J A;  3VMF B;  1ZXO A;  2FBV A;  2KW4 A;  2ZGZ A;  3ZSR A;  4CBU A;  2Q36 A;  1WSH A;  1BA1 A;  4QAG A;  3AGR A;  3RR8 A;  4W5R A;  1LOT B;  1QHT A;  5BPM A;  3OW2 M;  1JL2 A;  3AVK A;  1JXB A;  2GBZ A;  3JYT A;  4DU3 A;  3VET A;  4KTZ A;  3VQ9 A;  1B92 A;  3PX0 A;  4F2R A;  4JS4 A;  1S22 A;  2D0A A;  4YOW A;  2FSJ A;  4DR5 K;  2G8I A;  2HHS A;  1N34 K;  1D9D A;  3GG4 A;  1BO5 O;  4CD1 A;  4LFA K;  3R3L A;  3EO3 A;  1ZBL A;  4E7K A;  3MCA B;  4DR2 K;  5AQX A;  3TSP A;  1RT6 A;  1YJ9 N;  3ZLJ A;  5CY4 A;  5AZI B;  1Z26 A;  3KWG A;  4ILJ A;  5HRN A;  3TTC A;  1XMO K;  2FC0 A;  3I0S A;  3V9W A;  3MEC A;  2YHB A;  3M8S A;  4Z4C A;  4J8F A;  2ETJ A;  1NK5 A;  1BG3 A;  4NYN A;  4CK2 A;  5C2F A;  3MX5 A;  2QTD A;  2VG7 A;  4HWI A;  4I9Q A;  2V52 B;  3LAL A;  3AO1 A;  4Z94 A;  1XI1 A;  1GOA A;  4FVM A;  5AQY A;  4I9L A;  1FJG K;  3CJC A;  4CHP A;  1HYZ A;  4JI5 K;  4DWI A;  3LWL A;  3DXM A;  4FJM A;  1TVR A;  2OPQ A;  2UXD K;  2ASM A;  2V51 B;  1BOT O;  1VAZ A;  4DV1 K;  4H0P A;  3LZJ A;  2VYP A;  3WNE A;  4DSE A;  1L3S A;  2VCP A;  3UKR A;  3HM9 A;  4WCE L;  5M1F A;  3R6M A;  3A5M C;  1S1T A;  3PIO L;  2E6L A;  3QBX A;  4KH4 A;  1TKD A;  3QEX A;  5LJV A;  2DFE A;  4YOR A;  1NJI O;  3NH1 A;  3VQB A;  4ELV A;  2E5L K;  3SCX A;  3ULD A;  1KQS M;  4UQG A;  2GWJ A;  2P9U B;  5J2Q A;  1S1U A;  3FLC O;  3VPZ A;  5TKY A;  5SZT A;  2HW3 A;  4MO4 A;  4NLC A;  3NH2 A;  4DV2 K;  3SQ4 A;  2O8B B;  4DV0 K;  3PO5 A;  4A5B A;  1X9S A;  2NNW A;  4R5P A;  4DKW A;  4RW7 A;  3QIO A;  1TKX A;  2XY8 A;  3A0I X;  1NJY A;  3FZM A;  1HNW K;  1J5E K;  3WXM B;  3SNN A;  1YIT N;  4FJH A;  1ESV A;  1WBB A;  3AGK A;  3MWP A;  2W40 A;  1LW2 A;  1JLC A;  4HHT A;  3GE1 A;  2CH5 A;  4HCB A;  3NFA A;  4FWM A;  3PSI A;  2YHX A;  3G71 N;  3KIO A;  1HNX K;  2P9S B;  3GDQ A;  1ZBS A;  3CG7 A;  4FCY A;  4YFU A;  1L5U A;  2YJF A;  5FPD A;  1YVU A;  1BU6 O;  4KPY A;  4O0J A;  3VF6 A;  1MU2 A;  3AVL A;  3C6H A;  5AQS A;  3TAQ A;  3V1O A;  3PSF A;  1QQM A;  3P83 D;  4DTP A;  5C12 A;  4FYD A;  4AHU A;  3U3Y A;  4YOY A;  3VTH A;  4BE1 A;  5SWM A;  3HBT A;  4IG3 A;  4CJV A;  4EIA A;  4BR9 A;  2HOE A;  3HM8 A;  3R1X A;  3LDO A;  4CK3 A;  4M41 A;  4EP5 A;  4N47 A;  4CGI A;  4LF9 K;  2ITM A;  4M3R A;  3KTQ A;  4JHD A;  5CZ2 A;  2RHK A;  3NGI A;  2R7Y A;  1SL2 A;  4DTS A;  4NXN K;  3MXM A;  3AA2 A;  4KHQ A;  3EKS A;  3SUQ A;  4LF8 K;  2ASO A;  3CMA N;  3VF2 A;  2QA4 N;  4B8C A;  3VQD A;  4DCH A;  2QKK A;  1EWQ A;  2HMI A;  5EOY A;  1NGE A;  4M7Y A;  3BY5 A;  3AAR A;  3DOK A;  4BC4 A;  3ZET B;  1LWC A;  3QFU A;  1NOY A;  4J2B A;  4CIF A;  4AM6 A;  5KQ8 A;  4ISE A;  2F8S A;  3VEZ A;  1ILY A;  4E1J A;  2PYJ A;  4FJN A;  1T8E A;  5AJ3 K;  4QCL A;  4CJ5 A;  3ZSW A;  4MDB A;  3PUF A;  4CJL A;  1HNZ K;  1RT5 A;  3UIQ A;  2KTQ A;  2ZE2 A;  3H3O B;  3ZYY X;  2GEL A;  1ZBF A;  2YX6 A;  3HZ6 A;  4CJU A;  3JS6 A;  4AF1 A;  3BDP A;  2VWJ A;  5JVG L;  1GOB A;  2JWL A;  3AAP A;  4KH5 A;  3CME N;  3MN6 A;  3OBW A;  5KRT A;  1XQS C;  4DV4 K;  2E2O A;  3MN7 A;  4RW9 A;  1HX1 A;  1RT4 A;  4BRA A;  2ZGY A;  5ELZ A;  1VQ8 N;  1WN7 A;  3OYE A;  4M42 A;  2ZJQ L;  4CF9 A;  4RG8 A;  3C6U A;  3DLB A;  3PLA A;  3AVH A;  4Y1C A;  2IIR A;  4Z4G A;  1CZB A;  3MEG A;  3RTV A;  1NKE A;  1BQN A;  3SJH A;  5FPN A;  4BRD A;  3FZH A;  3J81 O;  3ZX2 A;  4IXC A;  1SZ2 A;  4ELT A;  4PUO A;  2UU9 K;  4DFP A;  3TAE A;  4LSN A;  3DLL L;  2ZJP L;  3G25 A;  4WQ5 A;  3DLK A;  3CPE A;  5AQN A;  4JI0 K;  4BRC A;  3NBP A;  1EKE A;  3DXK A;  2P9I B;  5I42 A;  2KKZ A;  2PY5 A;  4EZ6 A;  1WOQ A;  4DTN A;  3HPG A;  1HR0 K;  4NLB A;  1VSK A;  1M1K O;  4JKG A;  3TAN A;  2P9L A;  5C0Y A;  3VN5 A;  4LY7 A;  3VEN A;  4DSJ A;  2VQF K;  3AO5 A;  3RRG A;  5AQO A;  3FZK A;  1TYQ A;  3WUH A;  4A5A A;  2F96 A;  3BF3 A;  3D6R A;  2XY5 A;  4CZH A;  4FJJ A;  1T03 A;  1JLA A;  5JS1 A;  2J4R A;  2V7Y A;  2A1R A;  1C6V A;  1RDA A;  1WSJ A;  4A62 A;  1IBK K;  1OVY A;  3U9Z A;  4E7I A;  3QFP A;  1BL3 A;  4BR7 A;  3DRS A;  3KWI A;  4DQP A;  2HHQ A;  1X3M A;  3V9X A;  2HND A;  4B3O A;  4LSL A;  5BPN A;  1K73 O;  3VEX A;  3ZT1 A;  3KK7 A;  1X9W A;  4K0K K;  3O9R A;  2OAN A;  4JD2 A;  1NGJ A;  4FXD A;  1HUX A;  3LWM A;  1VQN N;  1JLE A;  4DQS A;  4DF8 A;  1EP4 A;  2DPN A;  5A2Q O;  2O8F A;  1C0G A;  4M3Z A;  1NGD A;  3AVM A;  3K58 A;  2ZD1 A;  3LDP A;  4WFB L;  4DHY A;  4JN4 A;  2O8C A;  4IDK A;  4JK7 A;  4DFM A;  3LP3 A;  1WAJ A;  4LC9 B;  4FJ9 A;  4G9Z A;  4X65 K;  3O1B A;  4AHS A;  3OYF A;  3SAF A;  3E01 A;  3OJS A;  4MFB A;  4BE0 A;  1O1W A;  2AA4 A;  1GLL O;  1VHX A;  3OYA A;  5AZJ B;  3FGU A;  4HTL A;  5CYQ A;  3T1Y K;  1V4S A;  3SBT A;  4BR0 A;  3CFO A;  3WXJ A;  4DV7 K;  3OVN A;  4GVM A;  3CIP A;  4YDU C;  1KRP A;  2GV9 A;  1YIJ N;  3QEV A;  3WNH A;  1RDU A;  4JKA A;  3NF9 A;  4DSL A;  5FPE A;  4DR6 K;  3L4Q A;  4AHT A;  4FLT A;  4CW7 B;  1P90 A;  3AY9 A;  2WON A;  1OH5 A;  4CZF A;  3WT0 A;  2YNG A;  4DS5 A;  5EXW A;  2AJQ A;  1S72 N;  2KZZ A;  2NLX A;  3C95 A;  4LF4 K;  1VK0 A;  3CCR N;  4FJK A;  4FWR A;  4MDA A;  3VQC A;  4IEE A;  4UY8 O;  4JI3 K;  1D4X A;  2WFB A;  2O8D A;  1N6Q A;  2P9N A;  1RTD A;  2WUS A;  2Q0U A;  4CJT A;  4K25 A;  2D5R A;  2CGJ A;  4DTO A;  2XO7 A;  1YI2 N;  4N41 A;  3ZEU B;  3AVF A;  1GLC G;  5M1P A;  2ZQB A;  3MDQ A;  3ZT2 A;  2VGM A;  2YNH A;  4JRQ A;  2QWQ A;  3ASM A;  3ZX3 A;  4GKK K;  5AZI A;  4FSV A;  3SUO A;  1DT9 A;  3HT3 A;  4CEE A;  3D45 A;  5CE3 A;  2WC9 A;  1NGH A;  4Y1D A;  4NCA A;  3TAM A;  5JVH L;  1VRT A;  1VSM A;  1LAV A;  4EP4 A;  1KCF A;  1RT7 A;  3VQQ A;  2DFH A;  2FBX A;  3HJF A;  4FZX C;  1IBM K;  2B4J A;  5AFU H;  3SZ2 A;  2BTF A;  4CEC A;  3SAG A;  4FM0 A;  2GUP A;  3MK6 A;  1MA9 B;  3B8A X;  4KHW A;  3ZT0 A;  2KQ2 A;  2A5X A;  2HVH A;  4IJA A;  4NYF A;  4BR5 A;  4N56 A;  4KAZ A;  4OKE A;  4KV8 A;  4AIL C;  1S9E A;  2D0B A;  1SAZ A;  1IKW A;  4TSX A;  4IO8 A;  3ATU A;  1TGO A;  4O44 A;  4FM1 A;  3D2F B;  3OYN A;  4CZM A;  1K9M O;  4I6M B;  4E0D A;  3MX2 A;  4KI4 A;  5KI6 A;  4E1M A;  2CGL A;  4FWS A;  3CXC M;  2ASP A;  2A3Z A;  1YVN A;  1HPM A;  4E7J A;  3OS0 A;  3U4L A;  4B9V A;  3AVI A;  3C65 A;  4X62 K;  4C8M A;  4BY9 C;  1ZBI A;  4KTQ A;  4DR3 K;  3LAN A;  4FJ5 A;  2WOM A;  5LL6 Z;  4E7L A;  1KAZ A;  3AO2 A;  3M8R A;  1K8K B;  4F8R A;  1QVF M;  4CGG A;  4IEI A;  2GX9 A;  3P38 A;  3L8B A;  3ATV A;  5BN8 A;  1U48 A;  4IOC L;  1DGK N;  1RTI A;  1TKZ A;  3RMD A;  4DS4 A;  3THW A;  1XNR K;  1RTJ A;  1L3V A;  4CGH A;  4CFD A;  1VSI A;  3KJV A;  3EL2 A;  4CEQ A;  1QSY A;  3J80 O;  5LY3 A;  1BIZ A;  3HPO A;  3CQX A;  1RFQ A;  3K2P A;  4G1Q A;  1W97 L;  3BP8 A;  1GLJ O;  3A8Y A;  4WFA L;  2UUA K;  3SBG A;  1X1P A;  4PQU A;  4KB1 A;  3QLH A;  3I8B A;  3VQP A;  1XC9 A;  4LFC K;  3P5J A;  3CJB A;  1JCG A;  2NRX A;  3QDK A;  4CER A;  2G8W A;  2O8E B;  3WNG A;  5B8H A;  4JYA K;  1VSD A;  4DQI A;  1IJJ A;  2HVI A;  4PKH A;  2QWO A;  3F5T A;  3P1G A;  4ZHR A;  1VQ9 N;  4CJF A;  1C0M A;  4Q0B A;  4WQ5 C;  2LSN A;  3GL1 A;  3IG1 A;  4JRP A;  1U2V A;  1CXQ A;  1WBD A;  3TAP A;  3NF7 A;  4XH1 A;  2YCH A;  3NMU A;  5H1S Q;  2HF3 A;  3PX6 A;  3DLH A;  3TR8 A;  3U8X A;  4KH6 A;  4PHT X;  2Q1N A;  5HRO A;  3A5N C;  2OZM A;  4LH4 A;  2G8U A;  3HRG A;  4IZ9 A;  1RDW X;  1WLJ A;  3AO3 A;  4IJN A;  4CF8 A;  3KLF A;  1RIL A;  4KBO A;  5HP1 A;  4H4O A;  1QZ5 A;  4M7X A;  1QSL A;  3KVG A;  1EWR A;  2HBJ A;  4CJ3 A;  4C1N K;  4FZZ A;  1KD1 O;  1T44 A;  5JMV A;  3J7Y P;  3VQ4 A;  3THX A;  4Z0U A;  3NH0 A;  3ALY A;  4CHO A;  5F0X A;  4BWJ A;  1Y97 A;  3RSE A;  3CQ8 A;  3MED A;  2Q97 A;  5HLF A;  3QIC A;  5LMN K;  3EZW A;  3CCL N;  2UUC K;  4BG8 A;  3WEE A;  5KPT A;  4BGA A;  1GLE G;  3D2E B;  3OYD A;  1IV0 A;  4M3U A;  3KZB A;  3RMB A;  3OYK A;  3AA4 A;  2VGN A;  3ZT4 A;  3O4Q A;  5MLC Q;  1WB9 A;  4DUY K;  4DSI A;  4OKK A;  3ISN C;  4OJR A;  2D0P A;  2E4L A;  1BI4 B;  3IUC A;  3M6G A;  4FK4 A;  3MN9 A;  1QQO A;  4RW6 A;  2NRV A;  3UKU A;  3SQ0 A;  1XHZ A;  3HXM A;  4CHY A;  1W2B M;  3CM6 A;  5FRM A;  2V7Z A;  3VGK A;  1ZYQ A;  3L2R A;  2BDP A;  4JK8 A;  5ADX A;  2E6M A;  1U6Z A;  3ZSO A;  4ID1 A;  3OA9 A;  4BRK A;  3RMA A;  3AVJ A;  3KLH A;  4DV6 K;  1VQL N;  1NJZ A;  1BIS A;  1V4T A;  3NVM A;  4B1V A;  4JKH A;  1QQC A;  3L2U A;  1X9J A;  3HVR A;  2KFN A;  5KRS A;  1ZC6 A;  2OTL N;  3HP9 A;  2UXB K;  1MWK A;  2P51 A;  5M1N A;  5IT9 O;  2P9K B;  3TPQ A;  3CCQ N;  4FZY A;  5GIO A;  5DMR A;  4BR2 A;  1HKB A;  2HMP A;  1XWL A;  4FLV A;  4CEZ A;  1ZBH A;  2E1Y A;  2RE2 A;  5HBM A;  1C0U A;  3QML A;  3EE8 A;  4DR4 K;  1YJW N;  1J5O A;  2X6S A;  4OX9 K;  1ITG A;  1K6Y A;  3CJ1 A;  1J54 A;  3T1A A;  4J2D A;  1HYV A;  5J2M A;  1TAQ A;  1NKC A;  4OPJ A;  2UXC K;  5J1E A;  3SAH A;  4FJG A;  4YOX A;  3K9J A;  3KHY A;  1TK0 A;  2KLA A;  4CZI A;  5AFU A;  5KTQ A;  1UAX A;  1VQO N;  2X78 A;  4N76 A;  3O9U A;  3H6E A;  3G10 A;  5AQL A;  4W5O A;  2HHW A;  3LM2 A;  3H1V X;  4LF6 K;  2HHT A;  2Q2R A;  4B1U B;  1D9F A;  1QZ6 A;  2VG5 A;  3A5O C;  3M1F A;  4O8K A;  1S1V A;  3UE5 A;  1DEJ A;  3WQT A;  4OPA A;  5EVZ A;  1SL1 A;  2IS3 A;  3O80 A;  2KZM A;  4KHS A;  4C8L A;  4GV3 A;  1CZA N;  1SS6 A;  2EHG A;  3T7Z A;  3ZT3 A;  4CFB A;  5I9E B;  3PIP L;  5BN9 A;  3THY A;  3EYZ A;  3NCI A;  1LWE A;  5M1Q A;  4FWO A;  3LP2 A;  3ZSX A;  1BGX T;  2G8F A;  2IVP A;  4BVP A;  4CZL A;  4WFN L;  4KTW A;  1Z6R A;  1QVG M;  2FLO A;  5AQM A;  3IAY A;  3ID6 A;  3ENH A;  1VSF A;  3A2F A;  1VSE A;  1J53 A;  2QWN A;  3VEO A;  3E9L A;  3LAM A;  4DLE A;  3SV4 A;  3IKM A;  3F2K A;  4JAX A;  3TTF A;  4H0X B;  3O4W A;  1D5A A;  3I55 N;  2FSK A;  5E41 A;  4O0I A;  2QWL A;  2GUI A;  2QXL A;  3PX4 A;  4BGB A;  1CLQ A;  2F9T A;  1YAG A;  4CJK A;  3NGY A;  4JKE A;  3ZX0 A;  4PL7 A;  4I2Q A;  3DM2 A;  5C15 A;  5IWA K;  4A61 A;  2GWK A;  4H0T B;  3O3F A;  1ATN A;  2YV0 X;  4J2E A;  3QES A;  5AQI A;  4EHU A;  5KGW A;  4BRP A;  4CJS A;  3SK3 A;  4X66 K;  3VEW A;  4C8K A;  4KFB A;  3OYG A;  3LDL A;  2OTJ N;  4PWD A;  4FLX A;  4DV3 K;  4RW8 A;  2OYQ A;  1HMV A;  3CC7 N;  4H03 B;  4JK9 A;  5GAD P;  1TAU A;  5FRO A;  3AVA A;  4GW6 A;  5HOO A;  1RTH A;  2JLE A;  1SUQ A;  1U45 A;  4B9T A;  2D0C A;  2NRZ A;  3OYI A;  4OLA A;  4DF4 A;  5JIC A;  4BRO A;  1NU0 A;  1FK9 A;  4H0O A;  5EX5 A;  3SV3 A;  3KD1 E;  1WSE A;  1TKT A;  4DTU A;  1IKY A;  4PA1 A;  5HRR A;  1VQ7 N;  5AQF A;  4NXM K;  3TU5 A;  5C10 A;  4Q5V A;  4JI6 K;  1MWM A;  2I7N A;  1ASV A;  1W7A A;  2PZS A;  3J7Z O;  3QB0 A;  3T19 A;  4BVO A;  4I2P A;  3K5O A;  3CJ9 A;  4FPB A;  4A2A A;  2ZF5 O;  5DM6 L;  3VQA A;  2WBN A;  1S1W A;  3NF8 A;  1KVC A;  4Z4I A;  4IFY A;  2P5O A;  1NGB A;  3CYM A;  2W41 A;  1VQ4 N;  1D8Y A;  1NNE A;  3CQY A;  2YI1 A;  1C1A A;  3V9S A;  4LF7 K;  4MQ3 A;  1GLF O;  1VQK N;  4B9U A;  4CZG A;  4ILG B;  3I56 N;  4BRE A;  2RN2 A;  1JL1 A;  1GLD G;  4CGD A;  1L3T A;  1LCU A;  4BG9 A;  1E3M A;  4EHT A;  4A2B A;  4CF0 A;  4ZTJ A;  3C0B A;  3ULE A;  3OJU A;  4KRF A;  2A6A A;  4FLW A;  3QIP A;  4LH5 A;  3ZSZ A;  3S3M A;  2HHX A;  1Q9Y A;  2W6L A;  1UOC A;  2D1K A;  5LJW A;  3SJJ A;  3O5B A;  4BDP A;  4YHH K;  1QHA A;  2G8V A;  2YJE A;  2E2Q A;  2E2P A;  2H3G X;  3AAQ A;  1BHL A;  2O4G A;  3DRP A;  3IS9 A;  3DYA A;  4IKF A;  4LFB K;  1S6P A;  3OY9 A;  1BWF O;  1EX4 A;  4BC5 A;  3OS1 A;  3AO4 A;  1VSH A;  4I6M A;  4JS5 A;  2P9P A;  3V9Z A;  1JKH A;  3O1W A;  1NG9 A;  4B9Q A;  4BR4 A;  3OTO K;  3CCM N;  2PYL A;  4W5Q A;  3O8M A;  4WQ4 A;  3G0Z A;  3N4Q A;  1YTU A;  4OGC A;  4H5V A;  4KHU A;  1S6Q A;  1JCF A;  4Y0W A;  5C42 A;  1W0H A;  5AQZ A;  2ZWH A;  1BQM A;  4QS9 A;  1T3V A;  4W5T A;  3RRH A;  1GLB G;  4H5T A;  2XY7 A;  4ID5 A;  3QNO A;  1K8K A;  2GTD A;  4J2A A;  4YY3 K;  4CEF A;  4XH4 A;  4KHP K;  4CZJ A;  3HTV A;  3ID8 A;  3MCP A;  4AH9 A;  5BRF A;  3CCU N;  1HNV A;  1N5Y A;  3G6E N;  5ADX H;  1YXQ A;  1E4F T;  3QO9 A;  2D0O A;  1IKV A;  3U3G A;  3AA3 A;  1VSJ A;  2QEX N;  1GOC A;  1KAY A;  2QM1 A;  3NE6 A;  4MO5 A;  2F9W A;  5I3U A; 
#chains in the Genus database with same CATH homology
 1Y64 A;  5E26 A;  4YOT A;  1YIT N;  3CQX A;  1RFQ A;  3SMS A;  1ESV A;  3AGK A;  2UYT A;  3MWP A;  2W40 A;  5KQD A;  2HBK A;  3FFK B;  3EE9 A;  3SLC A;  4RWT A;  4EAH D;  5JLF A;  1W97 L;  3BP8 A;  1GLJ O;  3A8Y A;  3NVK A;  3GE1 A;  5BRD A;  2CH5 A;  4WFA L;  2HF4 A;  4FWM A;  2YHX A;  3SBG A;  4BRM A;  1HJO A;  4O5F A;  3G71 N;  2P9S B;  1O13 A;  2E88 A;  2PAV A;  3GDQ A;  3I8B A;  3O9T A;  3CJB A;  4B1Z A;  1JCG A;  4BC3 A;  3CCS N;  3BUZ B;  3ZEU A;  1ZBS A;  2NRX A;  2AP1 A;  1NBW A;  3QDK A;  3GBT A;  3CCJ N;  2YJF A;  3CJA A;  3WXI A;  4A57 A;  5FPD A;  5FPM A;  2NRW A;  4OO1 J;  1KXP A;  5AQK A;  2FF3 B;  1BU6 O;  2E20 A;  3C6A A;  5M1K A;  3VF6 A;  5B8H A;  3C6H A;  3VF4 A;  2PFU A;  5AQS A;  4YOV A;  1IJJ A;  2D4W A;  2QWO A;  1QQM A;  3F5T A;  4PKH A;  5KPR A;  1VQ9 N;  1NGF A;  5C12 A;  4YOY A;  3VTH A;  4WQ5 C;  3G4S N;  3VER A;  4CD3 A;  1MDU B;  3HBT A;  3MMV A;  4EIA A;  4BR9 A;  2HOE A;  3GL1 A;  3HM8 A;  4FWK A;  1U2V A;  4YOU A;  3DJC A;  3FZF A;  4XH1 A;  1QQN A;  3R1X A;  2QWM A;  3LDO A;  4DQ8 A;  1NGC A;  4JKG B;  2YCH A;  4BQZ A;  2P9L B;  4CJ7 A;  2A42 A;  1DKG D;  2YHY A;  1IG8 A;  2HF3 A;  5H1S Q;  3NMU A;  3J8A A;  4FOI A;  3U8X A;  4KH6 A;  4FL9 A;  4PHT X;  3K9K A;  2Q1N A;  5GIN A;  5E84 A;  2ITM A;  3A5N C;  1KC8 O;  4JHD A;  2RHK A;  4H0V B;  3HRG A;  4IZ9 A;  3L6Q A;  3O9S A;  1RDW X;  1TYQ B;  3CHW A;  4IJN A;  1YJN N;  3E66 A;  3EKS A;  5KPZ A;  4JHD B;  2A40 A;  2ASO A;  3CMA N;  4KBO A;  3VF2 A;  2HBM A;  2QA4 N;  1N8R O;  1P8Z A;  1QZ5 A;  1X3N A;  3H3N O;  4M7X A;  1Q82 O;  4GVE A;  3L4I A;  2JWK A;  4DCH A;  3KVG A;  1YF5 L;  2HBJ A;  4U67 L;  5EOY A;  1NGE A;  4M7Y A;  3TTD A;  4C1N K;  1GLA G;  3AAR A;  1KD1 O;  1T44 A;  5JMV A;  5GAH P;  2QWR A;  5AQT A;  4BC4 A;  3ZET B;  2NRH A;  1M90 O;  3D2F A;  4BRI A;  3I33 A;  3CI5 A;  4WYB A;  1C0F A;  3QFU A;  4IDH A;  4H5W A;  4AM6 A;  5KQ8 A;  1BUP A;  1TUU A;  4ISE A;  5F0X A;  1ILY A;  3VEZ A;  5JLH A;  2IVO A;  3RSE A;  4E1J A;  3O6W A;  1Q81 O;  2Q97 A;  3QIC A;  2HBL A;  3MWT A;  2FXU A;  3EZW A;  3CCL N;  4MDB A;  1E4G T;  4BG8 A;  3WEE A;  5KPT A;  4BGA A;  3ENB A;  2NZT A;  1GLE G;  3D2E B;  3ENO A;  3H3O B;  3KZB A;  4MLE A;  3ZYY X;  5GAE P;  2GEL A;  1NGI A;  4IOA L;  1ATR A;  4PKI A;  2YX6 A;  2VGN A;  3HZ6 A;  4OPH A;  3JS6 A;  5AQV A;  5MLC Q;  4AF1 A;  2YHW A;  5FPE A;  3D7E O;  5JVG L;  1TUY A;  3AAP A;  2JWL A;  4KH5 A;  3CME N;  1BDG A;  3MN6 A;  4XH5 A;  4BQL A;  2ZJR L;  2D0P A;  1ATS A;  1G99 A;  2P9U A;  3IMX A;  3OBW A;  1HKC A;  3IUC A;  3M6G A;  4NO7 A;  4CZE A;  5C2D A;  3MN9 A;  1QQO A;  1VQP N;  2NRV A;  1XQS C;  3UKU A;  4FVU A;  3CF5 L;  1W2B M;  2E2O A;  2V7Z A;  3VGK A;  3MN7 A;  4JK8 A;  5ADX A;  1HX1 A;  3R8E A;  1U6Z A;  4QS7 A;  4BRA A;  2ZGY A;  4C1N I;  3OA9 A;  3VOV A;  4BRK A;  5ELZ A;  5HL7 L;  1VQ8 N;  4F9O A;  4FWP A;  5AR0 A;  4EFH A;  1VQL N;  2Q0R A;  4H0Y B;  1V4T A;  3U9D A;  2F7T A;  2ZJQ L;  2QWP A;  2Q31 A;  3NVM A;  4JKH A;  4B1V A;  1X9J A;  3PLA A;  3HSC A;  1HKG A;  3CCE N;  1ZC6 A;  2IIR A;  2OTL N;  3CPW M;  2P9S A;  3SJH A;  5FPN A;  4BRD A;  1MWK A;  3FZH A;  5M1N A;  2P9K B;  3TPQ A;  3CCQ N;  3ZX2 A;  5CR4 A;  5GIO A;  1Q7Y O;  4BR2 A;  4U7B A;  1HKB A;  4IXC A;  5DM7 L;  1SZ2 A;  4K43 A;  2HMP A;  3RVC A;  2E1Y A;  4JKB A;  4BRG A;  3R9P A;  2RE2 A;  5GAG P;  3DLL L;  2ZJP L;  3QML A;  3G25 A;  4WQ5 A;  3LDN A;  3CPE A;  3EE8 A;  5AQN A;  5BPL A;  1YHQ N;  4BRC A;  3LDQ A;  1YJW N;  3CD6 N;  3DXK A;  2P9I B;  3FR0 A;  4XEI A;  2HST A;  2KKZ A;  4GY2 B;  4M63 C;  1NLV A;  1WOQ A;  4BRP A;  3SMP A;  3HOT A;  3BEX A;  3O9Q A;  5TKW A;  3CJ1 A;  3DXK B;  3EKU A;  4NLB A;  3O08 A;  3VGM A;  1M1K O;  2KHO A;  4JKG A;  2P9L A;  5C0Y A;  3M5R A;  3SAH A;  4GV6 A;  4IWV A;  3K9J A;  1KAX A;  3VEN A;  4YOX A;  3KHY A;  3WXK A;  2P9N B;  3HI0 A;  3VGL A;  2A41 A;  1T6D A;  1OKJ A;  2KLA A;  4CZI A;  3JXU A;  5AFU A;  5AQO A;  3FZK A;  1TYQ A;  3WUH A;  1VQO N;  3A5L C;  4CI6 A;  2QI2 A;  3O9U A;  4A5A A;  3BF3 A;  3D6R A;  4H5N A;  3H6E A;  3Q7B A;  4IOX A;  4CZH A;  5AQL A;  3LM2 A;  4RCH A;  2J4R A;  3DAW A;  2BUP A;  2V7Y A;  3H1V X;  5AQQ A;  4BRL A;  2Q2R A;  4A62 A;  1OVY A;  3U9Z A;  4B1U B;  3DWL A;  3E1Y A;  3FZL A;  3QFP A;  1QZ6 A;  4BR7 A;  3A5O C;  3M1F A;  3ZET A;  1NGG A;  3IFR A;  4O8K A;  3UE5 A;  3Q7C A;  1DEJ A;  2I7P A;  4DB3 A;  3WQT A;  4OPA A;  5EVZ A;  3KWI A;  3GOI A;  4FWN A;  3O80 A;  3CCV N;  1X3M A;  4GV3 A;  3VEY A;  1CZA N;  1SS6 A;  3H45 C;  3T7Z A;  5BPN A;  1K73 O;  3VEX A;  3BF1 A;  3KK7 A;  3PIP L;  5I9E B;  3O9R A;  2OAN A;  5BN9 A;  1S3X A;  1NGJ A;  4JD2 A;  3QBW A;  1HUX A;  2PBD A;  1JCE A;  1VQN N;  4BRQ A;  3ULE B;  2DPN A;  5M1Q A;  1C0G A;  4FWO A;  3D2E A;  1NGD A;  5GIP A;  4JD2 B;  5M1O A;  5AQU A;  2IVP A;  3LDP A;  4BVP A;  4CZL A;  4WFN L;  4WFB L;  4DHY A;  4FWL A;  3P4I A;  4JN4 A;  1Z6R A;  2CH6 A;  1R59 O;  1QVG M;  4L3Q A;  2FLO A;  3LL3 A;  5AQM A;  3ID6 A;  3ENH A;  4FOE A;  4JK7 A;  3TSU A;  4JKD A;  2QWN A;  3VEO A;  3E9L A;  3TSQ A;  3IKM A;  4LC9 B;  3F2K A;  2IVN A;  4JAX A;  4H0X B;  3O4W A;  4FWQ A;  3TTF A;  5BRH A;  4CZK A;  4CBX A;  4JKC A;  3O1B A;  4ISG A;  1WUA A;  3I55 N;  4ISF A;  1Q18 A;  2E8A A;  2FSK A;  3SAF A;  3VEV A;  4YDU A;  2QWL A;  2QXL A;  1H1V A;  1SQK A;  2P9P B;  4BGB A;  2AA4 A;  1GLL O;  2F9T A;  4RTF D;  1YAG A;  5AZJ B;  4JKE A;  4PL7 A;  3FGU A;  3OBY A;  3ZX0 A;  5AQJ A;  1XUP O;  5AQG A;  5EY4 A;  4HTL A;  5C15 A;  4WF9 L;  1VQM N;  4A61 A;  3CET A;  3VTI A;  1K8A O;  1BA0 A;  1V4S A;  2GWK A;  3FE1 A;  4H5R A;  3SBT A;  4H0T B;  4BR0 A;  3WXJ A;  3CJ7 A;  1ATN A;  3CIP A;  4YDU C;  2E2N A;  3CC4 N;  1YIJ N;  3HOS A;  5AQI A;  1NM1 A;  4IFE A;  4WQ4 C;  2NRR A;  4EHU A;  5AQR A;  1RDU A;  4JKA A;  3T69 A;  4JKF A;  4B1Y B;  3SK3 A;  1EQY A;  4BRN A;  3UB5 A;  3M3Z A;  3VES A;  3VEW A;  4BRF A;  3LDL A;  3L4Q A;  2P9K A;  4K42 A;  2VWB A;  4C23 A;  2OTJ N;  3F9M A;  3WQU A;  1P90 A;  4GV9 A;  2FF6 A;  3AY9 A;  3CC7 N;  4H03 B;  4JK9 A;  5GAD P;  3P31 A;  4CZF A;  3WT0 A;  1T6C A;  3E9O A;  4A59 A;  4GNI A;  3C7N A;  5EXW A;  1VQ6 N;  5CHI A;  5HOO A;  1S72 N;  2P9I A;  3H46 O;  4B1X B;  5AQP A;  1XC3 A;  1YUW A;  2NLX A;  3MN5 A;  4IO9 L;  3VMF B;  3C7N B;  1ZXO A;  2NRZ A;  2ZGZ A;  3CCR N;  3CC2 N;  4JNE A;  3S41 A;  1VQ5 N;  4FWR A;  5JIC A;  4CBU A;  2Q36 A;  4BRO A;  1BA1 A;  1RGI A;  3AGR A;  4H0O A;  5EX5 A;  1LOT B;  5BPM A;  4MDA A;  3OW2 M;  4IEE A;  1VQ7 N;  2EWS A;  4UY8 O;  1NGA A;  5AQF A;  1D4X A;  3TU5 A;  2WFB A;  3VET A;  5C10 A;  1JJ2 M;  1MWM A;  4PL8 A;  2I7N A;  3J7Z O;  3QB0 A;  2P9N A;  4BVO A;  4O8U A;  2WUS A;  5F1X A;  2Q0U A;  4K25 A;  3CJ9 A;  2CGJ A;  4FPB A;  4A2A A;  1S22 A;  4YOW A;  2FSJ A;  2ZF5 O;  1YI2 N;  5BR9 A;  3ZEU B;  5DM6 L;  2WBN A;  1GLC G;  5M1P A;  1Q86 O;  3MDQ A;  3LM9 A;  3GG4 A;  2VGM A;  1BO5 O;  4PKG A;  4B1W B;  4CD1 A;  2QWQ A;  1NGB A;  3R3L A;  2W41 A;  3EO3 A;  3EN9 A;  3ZX3 A;  3MCA B;  1VQ4 N;  5AZI A;  4FSV A;  3WXL A;  1DT9 A;  3CQY A;  2YI1 A;  5AQX A;  4R79 A;  3TSP A;  5CE3 A;  2WC9 A;  1NGH A;  1YJ9 N;  1GLF O;  5AZI B;  1VQK N;  4CZG A;  4ILG B;  3KWG A;  4BC2 A;  3I56 N;  4BRE A;  5JVH L;  4ILJ A;  3TTC A;  1GLD G;  3N4P A;  1LCU A;  1U2V B;  4BG9 A;  5AFU H;  4J8F A;  4EHT A;  2E1Z A;  1BG3 A;  5C2F A;  1EO1 A;  4A2B A;  3MX5 A;  2QTD A;  2BTF A;  3C0B A;  3ULE A;  5AQH A;  2A6A A;  3CER A;  3SAG A;  2GUP A;  2NRT A;  3MK6 A;  1MA9 B;  3B8A X;  4HWI A;  4FO0 A;  1HLU A;  2D1K A;  2FSN A;  5LJW A;  3OHR A;  3O5B A;  2A5X A;  2V52 B;  4Z94 A;  1QHA A;  2YJE A;  2E2Q A;  4IJA A;  4BR5 A;  5AQW A;  5F2R A;  2E2P A;  2H3G X;  5AQY A;  3AAQ A;  3CJC A;  4FPA A;  1SAZ A;  4IO8 A;  3DXM A;  3ATU A;  1BWF O;  1Z05 A;  4BC5 A;  4ILH A;  4I6M A;  4NB4 A;  3W0L A;  2ASM A;  2P9P A;  2V51 B;  3D2F B;  1BOT O;  4G9Z A;  3DXM B;  1VAZ A;  3O1W A;  4CZM A;  5AZJ A;  1K9M O;  4H0P A;  3W3D A;  4B9Q A;  4BR4 A;  4AM7 A;  3CCM N;  4K41 A;  4I6M B;  2VYP A;  3RSE B;  3O8M A;  2VCP A;  4WQ4 A;  3MX2 A;  3IDH A;  4BRH A;  3N4Q A;  3UKR A;  2CGL A;  4FWS A;  3CXC M;  2ASP A;  4H5V A;  2A3Z A;  1YVN A;  1HPM A;  1JCF A;  4Y0W A;  4WCE L;  5M1F A;  3R6M A;  3A5M C;  5AQZ A;  1J6Z A;  2GEM A;  2ZWH A;  3C65 A;  3U4L A;  3WEE B;  4MLH A;  3UKR B;  4CBW A;  3PIO L;  4BY9 C;  4QS9 A;  1T3V A;  3P39 A;  3QBX A;  1GLB G;  1NWK A;  4H5T A;  2BH1 A;  4KH4 A;  4JEP A;  1K8K A;  2GTD A;  5LJV A;  4YOR A;  1NJI O;  1KAZ A;  5BRE A;  3L0Q A;  4XH4 A;  1KQS M;  1K8K B;  4CZJ A;  3HTV A;  2GWJ A;  1QVF M;  2P9U B;  3ID8 A;  3MCP A;  4IEI A;  2GX9 A;  5BRF A;  3P38 A;  3CCU N;  3ATV A;  4QS8 A;  3G6E N;  3FLC O;  5BN8 A;  3VPZ A;  5ADX H;  5TKY A;  2QW9 A;  4IOC L;  1YXQ A;  1DGK N;  2CGK A;  1E4F T;  4MO4 A;  4NLC A;  3UKU B;  2D0O A;  3E9P A;  4A5B A;  2NNW A;  4DKW A;  2QEX N;  3H1Q A;  1KAY A;  2QM1 A;  3A0I X;  3EL2 A;  3FZM A;  4MO5 A;  3WXM B;  5LY3 A;  2F9W A;  1NMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...