4BC3A

Crystal structure of human d-xylulokinase
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
525
structure length
525
Chain Sequence
RRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLULOSE KINASE
publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 185
structure length 525
sequence length 525
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc3A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc3A01
4IJAA 4CJ7A 3AAQA 1X3MA 3C7NB 2ASOA 4BRCA 5JICA 3H6EA 3VESA 5B8HA 3CETA 2F9WA 4EHUA 2P9IB 5AZJA 2FXUA 3H3OB 4C23A 4DB3A 5CE3A 1GLCG 4IO8A 2P9KB 2AP1A 2P9SA 5FPNA 1NWKA 4MO5A 4F9OA 3CERA 1BDGA 1NBWA 4YDUA 3FE1A 4A61A 3QBWA 4BVOA 4XH1A 3D7EO 3R6MA 3UKRB 3O5BA 3ULEA 4BRKA 4QS8A 2P9LB 1ATNA 2P9UB 2Q0UA 1TUUA 4JD2B 3KZBA 4NB4A 4EIAA 2HF3A 3DXMB 3BF1A 1YVNA 5AQFA 3UKUB 3HZ6A 4BRPA 4BRMA 2ASMA 3EN9A 4A2AA 2GTDA 5AQHA 5BPMA 2IVOA 4B1VA 4BQLA 5BREA 3O8MA 3MN6A 1DGKN 1ESVA 3ZEUB 3DJCA 2AA4A 4M63C 3FR0A 4JHDB 4FWOA 1HKCA 2Q0RA 1S22A 1YUWA 1GLFO 3VEOA 4B1UB 2BTFA 2HF4A 3U8XA 3A5OC 3CHWA 3VF2A 4BROA 5AQMA 5LJWA 4HWIA 5AQJA 1XC3A 2E2OA 1K8KB 3FZFA 2E1ZA 4BVPA 1NM1A 4K25A 3O6WA 3L4IA 2PBDA 2EWSA 1CZAN 5E26A 3RSEA 4CZKA 1HKGA 1U2VA 3J8AA 3CQXA 5ADXA 1WOQA 3CIPA 1BO5O 1KAYA 4AM6A 1V4SA 3IUCA 5TKYA 1TUYA 2ZGYA 5BN9A 1ZC6A 5AQVA 3QMLA 4H0TB 4PL7A 2NLXA 4BRAA 2QWNA 5KPRA 2P9PA 3GL1A 2V7YA 3OHRA 2HOEA 1GLJO 4CBWA 4EFHA 3VERA 5AQQA 1HX1A 1BOTO 4AM7A 4BGAA 3FZHA 3A5LC 2NRHA 5ELZA 1U6ZA 4H03B 2YHWA 4BREA 4M7XA 4BRDA 4DQ8A 2YHXA 3VF6A 2FSNA 3QICA 1GLDG 2FF6A 1BG3A 4MLHA 4BG9A 4A62A 4BRGA 1QQOA 3SJHA 2D4WA 3VEWA 1NGJA 1RDWX 4BRIA 5I9EB 4H5WA 4ISGA 1GLAG 5AQLA 1LCUA 3DXKB 4CBUA 3HM8A 3FZKA 3GE1A 3QB0A 5AQWA 3VENA 1BUPA 1LOTB 5AQPA 3SMPA 3U9DA 3F9MA 3VGMA 3ID8A 3WXJA 3VEXA 3UB5A 5AFUH 4FWSA 3G25A 2W41A 1H1VA 5KPZA 1HUXA 3IDHA 2BUPA 3BP8A 4H5VA 4BC3A 4BR2A 4BR4A 4JNEA 4B1WB 3H46O 3ATVA 3DWLA 2CGKA 3IMXA 4FOEA 3D2EA 3I33A 3ZETB 3VOVA 3IFRA 3H1QA 1TYQB 3FZLA 2E8AA 2YJFA 1T6DA 2IIRA 5AQZA 1X9JA 5AZIA 2ZF5O 2ASPA 3BEXA 3U4LA 5BPLA 1E4FT 4H0YB 4CZHA 1WUAA 3EKSA 1IG8A 4JAXA 4FWLA 1QQMA 4FPBA 3C7NA 4GNIA 1ATSA 4XH5A 2A6AA 2P9IA 3HBTA 4EAHD 4XH4A 1JCGA 2P9NB 3FGUA 5EOYA 2P9KA 3C0BA 1NGDA 3SLCA 3MCPA 4MO4A 3DAWA 4H0OA 4J8FA 2GUPA 5F1XA 2DPNA 2QW9A 2GEMA 3FZMA 3GG4A 3O80A 2F9TA 4FO0A 3WXLA 4PKHA 1NGFA 3W3DA 2P9UA 5AQTA 5AQXA 3MN7A 4I6MB 1HLUA 1NGBA 3DXMA 3VETA 3UKUA 1NLVA 4FWRA 2I7PA 3CQYA 3VF4A 2NZTA 4CBXA 4BRHA 2V52B 3JS6A 3R9PA 3WT0A 4BC4A 2VYPA 5AR0A 5EX5A 3EO3A 3LDOA 1NGEA 5AQNA 2FF3B 4H0VB 1IJJA 2VWBA 2YI1A 3ZEUA 1SZ2A 1RGIA 3LDLA 4PKGA 4JHDA 2ZWHA 1Z05A 3CJ7A 3O1WA 1RFQA 1R59O 1KAXA 1HKBA 2YHYA 2FSKA 4MLEA 2V7ZA 1U2VB 3H1VX 4E1JA 2A41A 4NO7A 4LC9B 2IVNA 1QZ6A 2D0PA 4WQ4C 4QS9A 3D2FB 2E2PA 2D0OA 5LJVA 2E2QA 1K8KA 3QBXA 1QHAA 3GBTA 2HMPA 2GWJA 1JCFA 1C0GA 2WUSA 3SK3A 4Z94A 4IZ9A 2IVPA 1ZXOA 2E2NA 4B1ZA 4CD3A 5JLFA 3HTVA 4WYBA 1NGIA 4CZIA 3ATUA 3A8YA 4BC5A 3L0QA 5FPDA 2I7NA 5AQUA 3ENHA 4FWQA 4FWPA 4BR0A 4CZFA 4CI6A 4BRQA 4CD1A 3QFPA 3FFKB 2QWRA 2A3ZA 1C0FA 3S41A 4IXCA 1NGCA 2KHOA 2ITMA 2CH6A 2CH5A 3M1FA 5AQKA 5AQRA 4ISFA 4CZLA 5ADXH 4WQ5C 3QFUA 3A5MC 4B1XB 5KQDA 1NGGA 3FLCO 2V51B 4H0PA 3WEEA 5EVZA 3I8BA 2QWLA 4JN4A 3A0IX 2A42A 3TU5A 3MDQA 1MDUB 1XUPO 3VGKA 1XQSC 2CGLA 1QZ5A 4H5NA 4ISEA 4DHYA 3DXKA 4PL8A 4PKIA 3CJAA 1J6ZA 1HPMA 1Z6RA 5FPMA 5EXWA 4CZEA 5BRHA 5AQIA 2Q97A 5AZJB 4K43A 1YXQA 3CJ9A 4DCHA 3EKUA 3ENOA 2P9SB 4IJNA 3LDNA 4B1YB 4RWTA 3H3NO 5AZIB 1BU6O 2QWPA 3R8EA 4BRFA 5KQ8A 5AQYA 2Q36A 1T44A 4BR5A 3WXKA 3ULEB 2Q1NA 3BF3A 2E88A 4BRLA 3ZETA 4BG8A 3O08A 3B8AX 2QM1A 2H3GX 4BR7A 1DKGD 1TYQA 1MWMA 1G99A 4BR9A 1E4GT 2YCHA 4H5TA 2E20A 3LDQA 3L6QA 2J4RA 4GY2B 4FWNA 3M3ZA 1BA1A 3UKRA 3VEZA 3A5NC 5JLHA 1YAGA 2P9LA 2UYTA 4JD2A 2FSJA 3VEVA 1S3XA 3U9ZA 1D4XA 1SQKA 1GLBG 1GLEG 2CGJA 4CZJA 3W0LA 3HI0A 3QDKA 3UE5A 3EZWA 2P9NA 1NMDA 1EQYA 3ZX0A 1BWFO 1BA0A 4O8KA 4Y0WA 2A40A 1GLLO 4K41A 4WQ5A 2QWMA 1Y64A 3AAPA 3KHYA 1QQNA 3KVGA 2QXLA 3CJCA 5FPEA 1Q18A 3RSEB 4I6MA 4CZMA 4BGBA 5BR9A 3JXUA 3O1BA 2ZGZA 4KBOA 4EHTA 3GOIA 3WQTA 1X3NA 5JMVA 5KPTA 2YJEA 2QWQA 3LDPA 3VPZA 1NGAA 4K42A 2A5XA 3WXIA 4BQZA 2P9PB 3LM9A 3HSCA 5AQSA 3LM2A 5BPNA 4A2BA 3CI5A 3WUHA 2FLOA 4YDUC 5BRDA 1SAZA 2E1YA 3O4WA 3EL2A 3D2FA 1T6CA 4O5FA 3MMVA 5AFUA 4FSVA 2Q2RA 1HJOA 2OANA 5AQOA 2D1KA 2Q31A 3AY9A 3M6GA 2VCPA 4H5RA 2W40A 3WQUA 2QWOA 3AARA 4H0XB 4RCHA 4BC2A 3TPQA 3GDQA 1MWKA 3P4IA 4CZGA 4RTFD 1P8ZA 3MK6A 3MN5A 3BUZB 5BN8A 3WEEB 3H45C 4HTLA 3ZX2A 4FPAA 5AQGA 5F0XA 2GWKA 1ATRA 3CJBA 5LY3A 1KXPA 3CJ1A 3LL3A 4FL9A 5BRFA 4FOIA 3VEYA 4FWKA 4M7YA 5E84A 3VGLA 1DEJA 3D2EB 4FWMA 1MA9B 1ZBSA 4IWVA 4BRNA 1NGHA 3SMSA 2PAVA 1KAZA 3ZX3A 5F2RA 4XEIA 4B9QA 1JCEA 5EY4A 2GELA 4L3QA 4QS7A 1OKJA 1V4TA 4WQ4A 3MN9A
chains in the Genus database with same CATH superfamily
4IJAA 1EX4A 4DFMA 4DTUA 3AA4A 2LSNA 4DSIA 3C7NB 4BRCA 3N4QA 3CCSN 3VESA 4CCHA 3RTVA 1HMVA 2P9IB 3H3OB 2HNDA 2QTDA 4YOUA 2HMIA 5CE3A 4FW1A 5FPNA 2P9SA 2O4IA 4F9OA 2VWKA 3L4QA 1JLEA 4WF9L 4XH1A 3OS1A 3UKRB 3HM9A 1KLMA 3ULEA 3SAHA 2HBJA 2Q0UA 4DR2K 4EIAA 1C0MA 3UKUB 1CZ9A 4BRPA 1RTIA 3EN9A 3K5OA 4DV6K 4NXMK 2HW3A 3I0SA 2F4VK 4BQLA 3RR7A 4FJIA 4FZZA 3G4SN 4CECA 4X66K 3MN6A 4A59A 1DGKN 1ESVA 3DJCA 2AA4A 4M63C 4M41A 3ZYYX 3O3GA 3FR0A 1RBSA 4JHDB 3KK3A 4FWOA 1HKCA 1S22A 4BWJA 1NK4A 2ZE2A 1RT5A 4A5BA 3ZLJA 2A1SA 4LF5K 1YTUA 4Z4CA 5AQJA 1RCHA 1K8KB 2E1ZA 2D5RA 1RT6A 5CHIA 4BVPA 3TTCA 3O6WA 3PX0A 3L4IA 1TL3A 4IKFA 3V4IA 3BZCA 4CZKA 2F7TA 1U2VA 4CEEA 3CIPA 4LF8K 5CY4A 3OYEA 5TKYA 2P5GA 3R3LA 3NH1A 2ZGYA 5BN9A 1ZC6A 1KVAA 1S6QA 4PL7A 5J2NA 4BRAA 5HRRA 2V7YA 2HOEA 4EFHA 2HHUA 3DLLL 1HX1A 1D9FA 3BDPA 5H1SQ 2XY6A 3HPGA 3TAQA 1N6QA 2BGGA 2NRTA 3J7AP 4H03B 2Z1JA 4JKHA 4DQ8A 2YHXA 2FSNA 3L2UA 1N33K 5FRMA 1GLDG 3D6RA 4LFCK 4BRGA 3VEWA 3VQAA 1NGJA 2GBZA 1RBTA 4DV1K 4BRIA 3NF7A 1GLAG 4ISGA 4B9NA 4CEBA 3DOKA 4GV6A 2RF2A 3GE1A 1KLNA 5AQWA 1LOTB 2QA4N 3SV3A 3WXJA 2OTLN 4JI3K 4M3TA 3OYDA 5HRPA 4DLGA 5HP1A 4JK8A 4KAZA 1H1VA 5KPZA 2Y1IA 4E1NA 4QOZB 1HQUA 4DG1A 1KFSA 4EZ6A 4BR4A 3H46O 1EWRA 4OGEA 3DWLA 4OKJA 5DM6L 3ZETB 5J2QA 3THWB 3DLGA 3N4PA 1C6VA 2NRXA 2YV0X 2DFFA 3PLAA 1TKXA 5AQZA 3WNGA 3U4LA 3JYTA 4JI5K 1N36K 4CHYA 2HBKA 5KRTA 4X64K 1ZBFA 2HBMA 3I55N 1QQMA 4AHCA 3NHGA 2HNZA 4DTPA 2VWJA 4GMJB 3RWUA 1BQMA 2NUBA 1G15A 3HT3A 4FJ8A 4CFBA 3MCPA 4E19A 3DAWA 4KB0A 4AQYK 4F8RA 3WNEA 1JLAA 2QW9A 4DUZK 3H08A 3MXIA 3RMAA 4PKHA 4KHSA 3W3DA 4CHQA 3SPYA 3MN7A 4DU4A 1NGBA 1ZYQA 1NK5A 4FLWA 1K6YA 5C2FA 3THVA 3R9PA 3C94A 2HNYA 4M3RA 3TAGA 1GOBA 5EX5A 3V9XA 5AQNA 2FF3B 3CFPA 2XHBA 4NCBA 2YI1A 1RGIA 1VSIA 3V9UA 3AVMA 4J2EA 1VQPN 2ZWHA 3O9UA 2YHYA 2FSKA 4MLEA 2A41A 4NO7A 4GV9A 3B6OA 4BE0A 2QEXN 2FBVA 4KH4A 2VQFK 2E2PA 2G8UA 3EE8A 3TABA 1XHZA 1KC8O 4LH5A 1DT9A 1QHAA 3MECA 4M42A 2OTJN 4PQUA 2W6KA 4CJEA 3OYCA 4W5TA 4R5PA 1C0GA 1S5JA 2WUSA 3OTOK 1RBUA 4M3UA 3K2PA 3O4NA 1NK7A 3I0RA 1VK0A 4FK0A 4CZIA 4ICLA 1TGOA 4FVUA 5FDLA 1HJRA 3F5TA 1GOCA 3NGYA 1VQON 1J53A 4JI4K 2UXDK 4CZFA 4AF1A 3QETA 1KSPA 2B6AA 4FJLA 4HHTA 3FFKB 2QWRA 1N5YA 3PX4A 1C0FA 3SBTA 2ATQA 2ITMA 3M1FA 3CPEA 4B1XB 5KQDA 3TSQA 3PSFA 1L3VA 4QAGA 4ZTJA 4FJGA 2Z1GA 3ASMA 2BANA 1YI2N 4GW6A 1KVBA 3MDQA 1VRUA 1XQSC 1WAJA 4YHHK 3AO4A 3DXKA 3PSIA 4PKIA 3CJAA 1L5UA 4OKKA 3LP2A 1JL1A 4OO1J 4LSNA 2X74A 5AQIA 2IC3A 3CJ9A 3EKUA 3ENOA 3CCEN 4B3SK 3E66A 4B1YB 4RWTA 2G8WA 4CHOA 3T69A 1HNIA 3O9QA 4BRFA 2QKKA 1QSSA 2Q36A 4BR5A 3MEEA 1M90O 4BG8A 4DQSA 3B8AX 1DKGD 1TYQA 5D3GA 4FVMA 4HCBA 1Z26A 3J7ZO 4CF8A 1VQKN 3L3VA 3M3ZA 5HLFA 1BA1A 2HHHK 3VEZA 4PWDA 3QEVA 3SQ0A 1YAGA 3QLHA 1S3XA 5MLCQ 3U9ZA 5JS1A 2CGJA 1CZBA 4DR4K 3HXMA 4O4GA 1XI1A 3K59A 2KZZA 2E6MA 4DFPA 3WXMB 4DV2K 2KLAA 2IAJA 1BWFO 2A40A 1HQEA 4K41A 2G8IA 4WQ5A 4FJNA 3KHYA 1KVCA 3MX2A 5FPEA 3DLEA 1VQ6N 1VSJA 2WFBA 3SUOA 2UXCK 3OS2A 2ZGZA 5JMVA 2PY5A 4GVMA 5KPTA 2QWQA 1WB9A 3VPZA 3EYZA 3AVBA 2A5XA 3OW2M 4BQZA 2P9PB 4X65K 3LM9A 4OPKA 3RMCA 4C8NA 4Q0BA 1NU0A 4RW7A 1O1WA 1YJWN 2KTQA 2A1RA 1WSFA 1TAQA 2FLOA 1RDBA 5BRDA 4DQIA 2E1YA 3O4WA 4CF9A 4B3MK 4QCLA 1BQNA 1W7AA 1JLGA 4O5FA 3M8RA 4FSVA 3P31A 3SAFA 1N32K 2UXBK 4OLAA 1K9MO 3DRRA 4CEOA 1VQ4N 4WFBL 2JGUA 1RBVA 3KWIA 4CK1A 3I8DA 3O3FA 3LWLA 5BN8A 3WEEB 3QIPA 3CCMN 4YY3K 2DTUA 4NCGA 3OYMA 1S1VA 4CJLA 3AVLA 3V1RA 3CJBA 5LY3A 5KGXA 1FKOA 1IBMK 3ZSVA 3VEYA 2OPQA 1N8RO 4FWKA 3NDKA 5E84A 5LMUK 3D2EB 1U4BA 1NGHA 4YOTA 3R1XA 3SMSA 5M1NA 4XEIA 2JWLA 2G8FA 1NKCA 2D0BA 3FFIA 2GELA 1NOZA 3SZ2A 3WNFA 3DOLA 4WQ4A 1RDCA 2E5LK 1FXXA 4CJ7A 4J2DA 4G9ZA 3D0PA 1KFDA 4YFUA 4N41A 1A5WA 3TSPA 3VQDA 3H6EA 5B8HA 3THYA 4BDZA 5AZJA 3Q7BA 1VQ5N 3CCJN 3ZSXA 4C23A 3HVRA 1UOCA 1IH7A 4I2QA 3DRPA 4C1NK 3MEDA 4IO8A 1T8EA 1NBWA 3LPTA 4YDUA 3SYZA 4OPHA 1NK0A 1X9WA 3V81A 4BRKA 2P9LB 4FCYA 4JD2B 3L3UA 3DXMB 1JLFA 5AQFA 1FK9A 4BRMA 1WLJA 3AV9A 2Z1HA 4FYDA 4MQ3A 5KRSA 4IG0A 2RE2A 1S1XA 4DUYK 5CYMA 1SL2A 4C8OA 4YORA 3ZEUB 1L3TA 4HUGA 4GV3A 1EKEA 4DQPA 2YHAA 4B1UB 2BTFA 1LAVA 3U8XA 3A5OC 4KPYA 2AJQA 3DRSA 4IDKA 4OPJA 1XC3A 1ASVA 2VG6A 4FJMA 1NM1A 3HYFA 5HOOA 3SUPA 1RT7A 4DR6K 2EWSA 1CZAN 3VN5A 3RSEA 3T19A 3S3MA 1WOQA 1BO5O 1KAYA 3VQ8A 1JXEA 1ASUA 4B8AB 4KHQA 3C95A 3VMFB 5AQVA 1NKEA 3KD5E 2NLXA 1TKTA 5KPRA 5J1EA 3OHRA 3KK7A 3BZKA 3L8BA 1U49A 1U04A 3EE9A 1BOTO 5ELZA 3CD6N 1XNRK 4IEIA 2O8DB 1QSLA 4W5QA 1YF5L 1VSFA 1TK0A 3HJFA 2YHWA 4N56A 4E7KA 1BG3A 4BG9A 3THXB 3SJHA 2D4WA 4B3RK 5I9EB 1Q7YO 4JI7K 3NGZA 4LY7A 1XC9A 3AO2A 2O8BB 1ZBLA 3FZKA 2HB5A 2O8FA 3VENA 1BUPA 5AQPA 4FM1A 3U9DA 2DY4A 1T7PA 3SV4A 3VEXA 4M3XA 3UB5A 4FK2A 5AFUH 1VHXA 4FWSA 3DLHA 4FJHA 1RT1A 2O8EB 3G25A 3SBGA 2W41A 3NVKA 3K9JA 3AGKA 4NLBA 4JS5A 4IOAL 3AVGA 3BP8A 4H5VA 4W5NA 4JNEA 2XRIA 3TAEA 4FOEA 4Z0UA 3I33A 4AH9A 3H1QA 4CFCA 3RRHA 2Y1JA 1BL3A 5SZTA 2ZF5O 3BEXA 3CXCM 3EKSA 4JAXA 4V19S 3VA0A 3MEGA 1VSLA 3C7NA 4GNIA 4WE1A 3CPWM 2A6AA 2P9IA 3HBTA 1RDAA 4XH4A 3OYBA 1JCGA 5C25A 2HHSA 3FGUA 1S1UA 1X1PA 1QE1A 4UY8O 3LAKA 1NGDA 2OZSA 4MO4A 4KV8A 4J8FA 3E1YA 5M1FA 1YVUA 3O80A 1C1AA 2RHKA 1NGFA 3AA3A 1UA0A 1IKWA 2G8HA 1IBLK 3U3YA 3VETA 3UKUA 1NLVA 1X9MA 1OH7A 3O4QA 3CQYA 3VF4A 2NZTA 1NJWA 4AHRA 4BC4A 4DR5K 1C1CA 3EO3A 3LDOA 2KZMA 3RMDA 1IJJA 4N5SA 3LDLA 4PKGA 4O5BA 4JHDA 1VQMN 3O1WA 3CJ7A 4CEQA 3D45A 1KAXA 1U2VB 1RNHA 4LC9B 5J2MA 2F96A 3P83D 1QZ6A 3DYAA 4B9VA 4WQ4C 3CCUN 3D2FB 4LFBK 2E2QA 1K8KA 4WFAL 1UWBA 3CCVN 1YITN 4CJQA 1W97L 4DFJA 4HCCA 1VQ9N 2YHBA 3AVFA 2GWJA 1JCFA 5T7BA 4AHSA 3SK3A 4KFBA 4CJPA 1J54A 4IZ9A 2E2NA 5JLFA 3I56N 3HTVA 4PA1A 1BIZA 3EY1A 3A8YA 4BC5A 2WBNA 5FPDA 4FWQA 4CI6A 3AVIA 4BRQA 4IOCL 4CD1A 3QERA 4LH4A 4IXCA 2KHOA 4UQGA 2CH6A 3OJUA 5M1PA 5AQRA 4CZLA 1IO2A 3LANA 3OS0A 3QFUA 1XMOK 5C0YA 2V51B 4H0PA 3I8BA 2VG5A 3MCAB 3O9RA 2PYLA 3TANA 3TU5A 1MDUB 1XUPO 3VQBA 3VGKA 2CGLA 4ZTFA 4CJRA 4PL8A 2OPRA 1DTTA 3F73A 4YNQA 1D8YA 3RMBA 4CZEA 2Q97A 1QS4A 4DCHA 3PV8A 1WSJA 1U48A 1BCMA 4DSKA 4CEFA 4ILHA 3LDNA 1HPZA 1NJZA 2QWPA 5K14A 3R8EA 5KQ8A 3AO1A 1SL1A 1QHTA 3HP9A 2YNHA 4FLVA 2Q1NA 3BF3A 4CEAA 5HRNA 4BRLA 3ZETA 4NLCA 2QM1A 4DWIA 3THWA 1G99A 5JVGL 1IBKK 4AHVA 4H5TA 4DV0K 1ITGA 4IOXA 1D9DA 1EWQA 4DR1K 3ENBA 1EETA 5JLHA 4CHPA 4A5AA 3VEVA 1D4XA 1SQKA 4CZJA 3M8QA 1LV5A 4I9LA 4ILGB 3HPHA 5CR4A 1RDUA 4DV5K 3NF6A 2DFHA 4FZYA 4YOXA 1JKHA 5GAEP 2YNFA 1GLLO 3LZIA 1Y64A 4C1NI 4KRFA 4Z4FA 4ID5A 4W5OA 2QXLA 3CJCA 3P38A 3S3OA 3J81O 4JKAA 2NRRA 2PYJA 4BGBA 3CC2N 1CLQA 3WQTA 3KLGA 4YOYA 4CJ5A 2WTUA 1TK5A 3OYHA 3WXIA 3PO5A 2G8VA 4O55A 1JLQA 3QIOA 3LZJA 4A2BA 4F2RA 1QTMA 4E7HA 3WUHA 4O8UA 3ZT2A 3OBYA 1SAZA 3EL2A 3SI6A 4CGJA 1SKWA 4K0KK 3P1GA 3V1OA 2XO7A 1ZBHA 1LWCA 3VTIA 1Q8IA 1HJOA 2OANA 2Q2RA 5AQOA 2D1KA 4BE2A 4DF8A 4FJ7A 3K0SA 3ZT4A 3DMJA 1VAZA 3HSTB 4BDYA 2HHXA 4H5RA 3WQUA 4FLXA 2QWOA 4H0XB 2KKZA 1MWKA 4CZGA 1HNZK 3BUZB 2BDPA 4FK4A 3H45C 4LD0A 4I9QA 3ZT3A 2XY8A 5F0XA 3QEIA 3NVMA 4DS4A 4M3ZA 1ATRA 3KK1A 1CXUA 3KTQA 4CJVA 2HSTA 3DI6A 3VGLA 4FWMA 1MA9B 1ZBSA 3L2RA 1TAUA 5F2RA 1P90A 2VGNA 3ZT1A 1X9SA 2OA8A 3T7ZA 4CJTA 1OKJA 4DTMA 3HPOA 1HNVA 1VSEA 3A2FA 3MWPA 5KTQA 1IKYA 2F9WA 2EHGA 4DR3K 2FXUA 5HBMA 1I94K 3C6HA 4DB3A 1JXBA 3ISNC 3ZSWA 2P9KB 1NK8A 4MO5A 3LAMA 1FW6A 1VRTA 3FE1A 3RVCA 4A61A 4BVOA 3CFOA 2UUBK 3R6MA 1KQSM 4QS8A 2P9UB 5HROA 3KZBA 1BI4B 3NBPA 2HF3A 5BR8K 3HZ6A 4JKGB 1SUQA 3KKSA 3TAMA 2GTDA 5AQHA 5BPMA 3C6AA 4DV7K 3QEWA 4FW2A 2IVOA 3C6TA 4B1VA 5BREA 2O8CB 4DU1A 3VQPA 5GAGP 3AO3A 3KIOA 2HBLA 3VEOA 4YOVA 3DM2A 5M1OA 3CHWA 3VF2A 4BROA 5AQMA 1SL0A 5GINA 5EU7A 4CHNA 3BGRA 3E9LA 3JAMO 5LJWA 2E2OA 3C6UA 3FZFA 3ALYA 5CZ2A 4K25A 3SCXA 2PBDA 5E26A 3TARA 2ETJA 4JEPA 2FBXA 1BHLA 4JI8K 2BE2A 3J8AA 5TKWA 3CQXA 5ADXA 1HNXK 4CF1A 1V4SA 3IUCA 2ITGA 4E7JA 1TUYA 4AHTA 4IO9L 3CC7N 3Q7CA 3SPZA 2UUAK 2JLEA 2P9PA 3GL1A 1RBRA 1KD1O 4CBWA 4KREA 1WSGA 3SQ2A 4GVEA 4AM7A 1Q9YA 3A5LC 4JV5K 1U6ZA 1TK8A 4Z4EA 4B8CA 2ZJRL 1SKSA 3VF6A 1JLBA 3QICA 4MLHA 1T03A 4F2SA 1DLOA 2QI2A 5GADP 2ZM6K 1YJNN 2KQ2A 5AQLA 2ZD1A 4CBUA 1S6PA 4JKEA 4KB1A 4HTUA 3KJVA 4OLBA 3VGMA 3ZSRA 4CW7B 4OJRA 4DU3A 1MU2A 4DTOA 1QQCA 2UUCK 4BE1A 2EX3A 3CFRA 3TAPA 3K5NA 4J2BA 5IT9O 3IDHA 2BUPA 4KHUA 4BC3A 4B1WB 1HRHA 4WFNL 1NG9A 3OVNA 5LMNK 2CGKA 3D2EA 3K9KA 3IS9A 3NGIA 3IFRA 2E8AA 4K8XA 3AVKA 3HK2A 3IRXA 4IFYA 5AZIA 1LW0A 2IIRA 1E4FT 4H0YB 5LL6Z 4DQRA 4E7IA 4FWLA 1ATSA 3ZSQA 3VQ7A 4XH5A 1UA1A 3PY8A 3BY5A 2HVIA 1R0AA 2P9NB 3NH0A 1EO1A 1RDDA 5EOYA 3F9KA 3C0BA 4U7BA 3HOSA 4DSFA 5F1XA 2DPNA 1WNSA 2WC9A 3DLBA 1WSIA 2GEMA 3FZMA 3GG4A 2VG7A 1RILA 2F9TA 3WXLA 4PUOA 4XIUA 3MXMA 1S1TA 5AQTA 5AQXA 4I6MB 3DXMA 3OYAA 5AJ3K 3O9TA 4FWRA 2I7PA 2F8SA 1N34K 1TL1A 4FJXA 4CBXA 2V52B 1OH6A 3MWTA 3WT0A 2VYPA 4YOWA 5AR0A 1NGEA 4LF6K 4FZXC 3U3GA 3ZEUA 1Z25A 4DV3K 3K5LA 1J5EK 1RFQA 1R59O 1HKBA 2R7YA 2V7ZA 4CVNE 3ZCMA 1NJYA 2YKMA 4N76A 2D0PA 4EP4A 1VSHA 1XMQK 4KKOA 4JK7A 1HYSA 2D0OA 5LJVA 5CZ1A 4IBNA 3OBWA 1QVFM 5FROA 2E6LA 2D0CA 3G71N 3SQ1A 4BACA 3DLRA 4HUEA 3AO5A 4CD3A 3VQ4A 3KD1E 3CCRN 4DV4K 4KHWA 4FXDA 3ATUA 3U6FA 4LF4K 3L0QA 3C65A 3VQCA 3E9OA 3HL8A 2RN2A 3L2QA 3IG1A 4OX9K 2A3ZA 3SJJA 3S41A 1NGCA 2O8DA 4DF4A 3NMUA 1ILYA 2CH5A 4ISFA 3QESA 4WQ5C 1WBDA 3G6EN 4FM2A 3RR8A 2IGIA 2B4JA 3TSUA 3VQ6A 3THXA 3A0IX 2YX6A 4I2PA 4ISEA 4DHYA 1LAWA 2O8BA 1I39A 5FPMA 1XNQK 2WOMA 1LWFA 5EXWA 4OKEA 4DMNA 5BRHA 1J9AA 4K43A 1YXQA 2F8TA 5JVHL 3OJSA 3QNNA 2P9SB 4IJNA 3H3NO 1TVRA 1BU6O 1S9GA 5AQYA 2O8EA 1T44A 3OY9A 2WONA 3G10A 3WXKA 4CEZA 3ULEB 1NK6A 1NJIO 1S72N 3IAYA 4IEEA 3MAQA 1W9HA 3LDQA 2IOCA 3EEQA 1Y97A 3L6QA 4GY2B 4FWNA 3UKRA 4CGHA 3HO1A 4KI6A 3A5NC 1WSEA 2UYTA 4PHTX 2FSJA 3PIPL 1QVGM 3WNHA 4B9SA 1NMNA 3KK2A 1C0TA 3HI0A 3QDKA 1SV5A 3EZWA 1VQ7N 3NFAA 3HOTA 1KTQA 1NMDA 1EQYA 3ZX0A 1VSKA 4Y0WA 3O9SA 2VGMA 3CF5L 1QQNA 3KVGA 4DTJA 1S1WA 4ELUA 1Q18A 1EXQA 2UU9K 2HVHA 4DLEA 4TSXA 4RG8A 3JXUA 3O1BA 3GOIA 4ELVA 1X3NA 4FJJA 3K57A 4LF7K 2IDOA 4BDPA 2Q3SA 4JYAK 1NGAA 5DK5A 4CJ3A 3CG7A 4CJUA 4RW8A 2W6LA 5DM7L 1L3UA 3K5MA 3V9SA 1VSMA 4YDUC 4ELTA 3TAFA 4CGDA 2QK9A 1BGXT 3D2FA 1T6CA 1YHQN 3MMVA 1YT3A 1RT2A 1KRPA 4MFBA 3AY9A 2P51A 1TKDA 3QINA 2KFNA 3S3NA 1K73O 3TTDA 1TV6A 4LFAK 4RCHA 4BC2A 2Z1IA 3GDQA 3P4IA 1RT4A 1FJGK 4RTFD 1U47A 3HP6A 4ILJA 4Y1DA 4F4KA 2HHVA 3ZX2A 5E41A 3ITHA 3L2WA 3CCLN 2PFUA 3UIQA 3CJ1A 3LL3A 4FL9A 2P5OA 4LSLA 5C24A 1K8AO 1DEJA 3HRGA 2XY5A 2PAVA 1KAZA 3AA5X 3PUFA 1JCEA 3LP1A 4CESA 5EY4A 4QS7A 1V4TA 3CCQN 5SWMA 4FLYA 3MN9A 5JS2A 3VQQA 2BH1A 3AAQA 1X3MA 3P5JA 4EZ9A 4DSJA 2ASOA 1ZBIA 5JICA 4IDHA 3VA3A 3CETA 4EHUA 2GV9A 5KI6A 1GLCG 4CK2A 2AP1A 2RPIA 3T1HK 1NWKA 3CERA 1BDGA 4B9MA 4CIGA 3QBWA 1HNWK 3F2KA 2YKNA 4RW4A 3D7EO 3O5BA 3M8SA 1HYVA 1ATNA 1NOYA 1TUUA 4NB4A 3BF1A 1YVNA 1Q86O 1RT3A 2ASMA 4A2AA 4Y1CA 2ZJPL 3PO4A 4W5RA 3QEXA 3O8MA 4DTNA 3LPUA 3CQ8A 4ID1A 2RKIA 3OYIA 1VQ8N 1NKBA 2Q0RA 4KH5A 4ZHRA 1YUWA 5C12A 1GLFO 1RTJA 4JI0K 2HF4A 3ID6A 5M1KA 1W2BM 1A5XA 1IV0A 1OH8A 4GKJK 3QO9A 2PZSA 2D0AA 4JRQA 4HWIA 4FJ9A 5C15A 2I5JA 4EP5A 4DSEA 3VTHA 1JLCA 4JS4A 1YTAA 4AILC 4JI1K 1HKGA 3PX6A 4E7LA 4AM6A 3QNOA 3KLFA 5HL7L 1J5OA 4M45A 5FLXO 4DKWA 3QMLA 4KTWA 4H0TB 1HR0K 1BISA 4KH6A 2QWNA 3LALA 3VQ9A 5IWAK 3KLHA 1GLJO 1NK9A 1E3MA 3VERA 5AQQA 4FLUA 4DFKA 1M1KO 3AVCA 4BGAA 3FZHA 4HUFA 4JRPA 2NRHA 3CM6A 3SNNA 4M3YA 4C8KA 1WSHA 5I3UA 4BREA 2JWKA 4M7XA 4BRDA 1QSYA 2E4LA 2FF6A 4JI6K 4A62A 4L8RB 1IG9A 1QQOA 4KHYA 1RDWX 4CGGA 3PIOL 4B3TK 4H5WA 4JK9A 3TWHA 1DTQA 1LCUA 1C1BA 3DXKB 3O3HA 3HM8A 4DQQA 4HVJA 3QB0A 3E9PA 3SMPA 3F9MA 1JJ2M 3ID8A 3IKMA 5C2DA 2G8KA 4C8LA 1WN7A 3RRGA 4DR7K 3KKRA 3ZSOA 2FC0A 5C10A 4NXNK 4E1MA 4A57A 3AVNA 1ZBUA 1Q82O 1HUXA 3NH2A 4BR2A 1L3SA 4CJWA 4CFAA 1F21A 3ATVA 4BWMA 3IMXA 3VOVA 1TYQB 3FZLA 3NAEA 3ULDA 5FRNA 2P1JA 2YJFA 3ZSZA 1T6DA 5BPLA 1X9JA 2ASPA 3AVHA 4G1QA 2QKBA 4CZHA 4DSLA 1WUAA 4BY9C 1IG8A 3SAGA 3KLIA 4MDBA 2O4GA 4FPBA 1VSDA 2X78A 1LWEA 2VQEK 2YNGA 1OVYA 3OYGA 4JKCA 2OPPA 4EAHD 1T3VA 3JSMA 1WAFA 2P9KA 3SLCA 4CHZA 4H0OA 2GUPA 2FBYA 3ZSYA 3LP3A 5KGWA 4FO0A 3VQEA 1C0UA 3AA2A 4JKBA 4J2AA 1ASWA 2P9UA 4FLZA 5GIOA 1BI4A 1HLUA 4JKGA 4CF0A 1B92A 4BRHA 3JS6A 1CXQA 3OA9A 3NF8A 4CJ4A 4B3OA 2HHWA 2O8CA 1GOAA 4H0VB 1XHXA 2VWBA 2OPSA 1SZ2A 4KHPK 1S9EA 4KHNA 2KW4A 1Z05A 4I7FA 1A5VA 4JKFA 3H1VX 4E1JA 2GUIA 2NNWA 5J2PA 4CGIA 2IVNA 4U67L 1HYZA 4QS9A 3AVAA 4RW9A 4CIFA 3QBXA 1REVA 3GBTA 4WCEL 1UAXA 2HMPA 3OYLA 4DTRA 4Z94A 1BCOA 1ZXOA 2IVPA 4B1ZA 3J80O 4WYBA 1NGIA 4CJFA 4CE9A 4DTXA 3E01A 2I7NA 5AQUA 3ENHA 4H8KA 4FWPA 4BR0A 3ZT0A 3V9ZA 3LWMA 3QFPA 4KTZA 3T1YK 4Z4IA 3CMEN 3LP0A 3OYNA 4OGCA 2HHQA 4KI4A 5AQKA 1OVQA 4CJSA 5ADXH 3A5MC 2XY7A 1NGGA 3FLCO 4C8MA 3CM5A 1O13A 3WEEA 5EVZA 2QWLA 4JN4A 4CJKA 2A42A 4FM0A 4OVLA 1T05A 3T3FA 3MXJA 3CC4N 1QZ5A 4H5NA 5C42A 3SQ4A 1J6ZA 1HPMA 1Z6RA 3V9WA 2NRWA 4JI2K 3THYB 4CFDA 3T1AA 5HRSA 5AZJB 2QXFA 2OYQA 1VQNN 3AGRA 1W0HA 4CK3A 5AZIB 3DLKA 1WBBA 4DS5A 4B9TA 3M8PA 5GIPA 1Q9XA 4N47A 2HHTA 1D5AA 4CEDA 2E88A 4B9UA 4O44A 3O08A 2OZMA 2H3GX 4BR7A 4CERA 1MWMA 4BR9A 3P39A 1E4GT 2YCHA 4NCAA 2E20A 3NF9A 2J4RA 3V1QA 2FBTA 3QEPA 1KCFA 5M1QA 3L2VA 3TTFA 2P9LA 4RW6A 4JD2A 4CF2A 2NRZA 4JKDA 3NE6A 2X6NA 1GLBG 1GLEG 4O0JA 4NYFA 3W0LA 1B9FA 3UE5A 1NJXA 1YJ9N 2P9NA 3SUQA 4IFEA 5DMRA 4B9LA 2KFZA 1BA0A 4O8KA 2IS3A 4OPAA 4F3OA 3NCIA 2QWMA 3AAPA 4FJ5A 1EP4A 2ZJQL 4Q5VA 3RSEB 3OYFA 3CMAN 4FJKA 4NYNA 3MX5A 1TKZA 4I6MA 4MDAA 2YNIA 4CZMA 3LDSA 2OCEA 5I42A 5BR9A 3SUNA 4KBOA 4EHTA 4IFVA 3EZ5A 3TI0A 4E0DA 2YJEA 3S9HA 4B08A 2B5JA 2GX9A 3LDPA 4K42A 4Z4GA 3M5RA 3HSCA 4JLHA 5AQSA 1I3AA 3LM2A 3VQ5A 4R79A 4E3SA 1SS6A 5BPNA 1LW2A 2W42A 3CI5A 1IKVA 4H4MA 1JL2A 4O0IA 1OH5A 1RTHA 3V6DA 4KO0A 2DFEA 1BIUA 5AFUA 3G0ZA 4M3WA 4F3TA 1VQLN 1RTDA 1IKXA 2Q31A 4KTQA 3M6GA 4GKKK 2NRVA 5A2QO 2VCPA 5GAHP 2W40A 4CIEA 4CGFA 3AARA 2O8FB 2X6SA 1U45A 3TPQA 3K58A 2ZQBA 1YIJN 4FLTA 1B9DA 4X62K 1P8ZA 5CYQA 3KLEA 3MK6A 4LF9K 3MN5A 4DTSA 3CYMA 3TR8A 4HTLA 4FPAA 5AQGA 2GWKA 1NNEA 3OYKA 1KXPA 1FKPA 4AHUA 1SKRA 4K8ZA 4E89A 5BRFA 4IG3A 4FOIA 3AVJA 4M7YA 4PY5A 3HVTA 3OYJA 4BRNA 4IWVA 1XWLA 3ZX3A 4B9QA 1Q81O 3KWGA 4Z4HA 4H4OA 4L3QA 3B6PA 3J7YP
chains in the Genus database with same CATH topology
4IJAA 4CJ7A 2BH1A 4G9ZA 3AAQA 1X3MA 3C7NB 2ASOA 3MWPA 3N4QA 3TSPA 4BRCA 5JICA 3CCSN 3H6EA 4IDHA 3VESA 5B8HA 3CETA 2F9WA 4EHUA 2P9IB 5AZJA 3Q7BA 1VQ5N 2FXUA 3H3OB 3CCJN 2QTDA 4C23A 4YOUA 3C6HA 4DB3A 5CE3A 1GLCG 4C1NK 4IO8A 2P9KB 2AP1A 2P9SA 5FPNA 1NWKA 4MO5A 4F9OA 3CERA 1BDGA 1NBWA 4YDUA 3L4QA 3FE1A 3RVCA 4A61A 3QBWA 4BVOA 4WF9L 3F2KA 4XH1A 4OPHA 3D7EO 3R6MA 3UKRB 3O5BA 1KQSM 3ULEA 3SAHA 4BRKA 4QS8A 2P9LB 1ATNA 2HBJA 2P9UB 2Q0UA 1TUUA 4JD2B 3KZBA 4NB4A 4EIAA 2HF3A 3DXMB 3BF1A 1YVNA 5AQFA 3UKUB 1Q86O 3HZ6A 4JKGB 4BRPA 4BRMA 2ASMA 3EN9A 4A2AA 2GTDA 5AQHA 5BPMA 2ZJPL 3C6AA 2RE2A 2IVOA 4B1VA 4BQLA 5BREA 3O8MA 4YORA 3G4SN 3MN6A 4A59A 1DGKN 1ESVA 3ZEUB 3DJCA 2AA4A 4M63C 3ZYYX 3FR0A 4JHDB 5GAGP 1VQ8N 4FWOA 1HKCA 2Q0RA 1S22A 4KH5A 4GV3A 1YUWA 2HBLA 1GLFO 4A5BA 3VEOA 4B1UB 2BTFA 5C12A 2HF4A 4YOVA 3U8XA 3ID6A 3A5OC 5M1OA 5M1KA 3CHWA 3VF2A 1W2BM 4BROA 5AQMA 5GINA 3E9LA 5LJWA 4HWIA 5AQJA 1XC3A 2E2OA 5C15A 1K8KB 3FZFA 2E1ZA 5CHIA 4BVPA 3TTCA 1NM1A 5HOOA 4K25A 3O6WA 3VTHA 3L4IA 2PBDA 2EWSA 1CZAN 5E26A 3RSEA 4JEPA 4CZKA 2F7TA 1HKGA 1U2VA 3J8AA 5TKWA 3CQXA 5ADXA 1WOQA 3CIPA 1BO5O 1KAYA 4AM6A 1V4SA 3IUCA 5TKYA 3R3LA 5HL7L 1TUYA 2ZGYA 5BN9A 1ZC6A 5AQVA 3VMFB 4DKWA 3QMLA 4IO9L 3CC7N 4H0TB 4PL7A 3Q7CA 2NLXA 4KH6A 4BRAA 2QWNA 5KPRA 2P9PA 3GL1A 2V7YA 3OHRA 1KD1O 3KK7A 2HOEA 1GLJO 4CBWA 4EFHA 3VERA 5AQQA 3DLLL 1HX1A 4GVEA 3EE9A 1BOTO 4AM7A 1M1KO 4BGAA 3FZHA 3A5LC 2NRHA 5ELZA 5H1SQ 3CD6N 2NRTA 4IEIA 1U6ZA 2ZJRL 1YF5L 4H03B 2YHWA 4BREA 2JWKA 4JKHA 4M7XA 4BRDA 4DQ8A 2YHXA 3VF6A 2FSNA 3QICA 1GLDG 2FF6A 1BG3A 3D6RA 4MLHA 4A62A 4BG9A 4BRGA 1QQOA 2QI2A 2D4WA 3SJHA 1NGJA 3VEWA 5GADP 1RDWX 4BRIA 5I9EB 3PIOL 1YJNN 1Q7YO 4H5WA 4JK9A 4ISGA 1GLAG 5AQLA 1LCUA 3DXKB 4CBUA 3HM8A 4GV6A 3FZKA 4JKEA 3GE1A 3QB0A 5AQWA 3VENA 3E9PA 1BUPA 1LOTB 5AQPA 3SMPA 2QA4N 3U9DA 3F9MA 1JJ2M 3VGMA 3ID8A 3IKMA 5C2DA 3WXJA 3VEXA 2OTLN 3UB5A 5C10A 5AFUH 4FWSA 4A57A 3G25A 4JK8A 3SBGA 2W41A 3NVKA 1H1VA 3AGKA 3K9JA 1HUXA 3IDHA 2BUPA 4NLBA 5KPZA 3BP8A 1Q82O 4IOAL 4H5VA 4BC3A 4BR2A 4BR4A 4JNEA 4B1WB 3H46O 4WFNL 3ATVA 3DWLA 2CGKA 3IMXA 4FOEA 5DM6L 3D2EA 3K9KA 3I33A 3ZETB 3VOVA 3IFRA 3H1QA 1TYQB 3FZLA 2E8AA 3N4PA 2YJFA 2NRXA 1T6DA 2IIRA 5AQZA 1X9JA 5AZIA 2ZF5O 2ASPA 3BEXA 3U4LA 5BPLA 1E4FT 4H0YB 3CXCM 4CZHA 1WUAA 3EKSA 4BY9C 1IG8A 4JAXA 2HBKA 4FWLA 3SAGA 2HBMA 3I55N 4MDBA 1QQMA 4FPBA 3C7NA 4GNIA 1ATSA 1OVYA 4XH5A 3CPWM 2A6AA 2P9IA 4JKCA 3HBTA 1T3VA 4XH4A 4EAHD 1JCGA 1EO1A 2P9NB 3FGUA 5EOYA 2P9KA 4UY8O 3C0BA 1NGDA 3SLCA 3MCPA 4MO4A 4U7BA 3DAWA 3HOSA 4H0OA 4J8FA 2GUPA 3E1YA 5M1FA 5F1XA 2DPNA 2WC9A 2QW9A 2GEMA 3FZMA 3GG4A 3O80A 2F9TA 4FO0A 3WXLA 2RHKA 4JKBA 4PKHA 1NGFA 3W3DA 2P9UA 5GIOA 5AQTA 5AQXA 3MN7A 4I6MB 1HLUA 1NGBA 3DXMA 3VETA 3UKUA 1NLVA 3O9TA 2I7PA 4FWRA 4JKGA 3CQYA 3VF4A 2NZTA 4CBXA 4BRHA 2V52B 5C2FA 3MWTA 3JS6A 3R9PA 3WT0A 4BC4A 2VYPA 3OA9A 4YOWA 5AR0A 5EX5A 3EO3A 3LDOA 1NGEA 5AQNA 2FF3B 4H0VB 1IJJA 2VWBA 2YI1A 3ZEUA 1SZ2A 1RGIA 3LDLA 4PKGA 1VQMN 4JHDA 1VQPN 2ZWHA 1Z05A 3CJ7A 3O1WA 1RFQA 1R59O 3O9UA 1KAXA 1HKBA 2YHYA 2FSKA 4MLEA 2V7ZA 1U2VB 4JKFA 3H1VX 4E1JA 2A41A 4NO7A 4GV9A 4LC9B 2NNWA 2IVNA 1QZ6A 2D0PA 4U67L 4WQ4C 2QEXN 4KH4A 4QS9A 4JK7A 3CCUN 3D2FB 2E2PA 2D0OA 5LJVA 2E2QA 3EE8A 1K8KA 4WFAL 1KC8O 1DT9A 3QBXA 1QHAA 3OBWA 3GBTA 4WCEL 1QVFM 3CCVN 1YITN 1W97L 1VQ9N 2OTJN 2HMPA 2GWJA 1JCFA 3G71N 1C0GA 2WUSA 3SK3A 4Z94A 4IZ9A 2IVPA 1ZXOA 2E2NA 4B1ZA 4CD3A 5JLFA 3I56N 3HTVA 3CCRN 4WYBA 1NGIA 4CZIA 4FVUA 3ATUA 3A8YA 4BC5A 2WBNA 3F5TA 3L0QA 3C65A 3E9OA 5FPDA 2I7NA 5AQUA 3ENHA 4FWQA 4FWPA 4BR0A 1VQON 4CZFA 4AF1A 4CI6A 4BRQA 4IOCL 4CD1A 3QFPA 3FFKB 2QWRA 2A3ZA 1C0FA 3SBTA 3S41A 4IXCA 3CMEN 1NGCA 2KHOA 2ITMA 3NMUA 2CH6A 1ILYA 2CH5A 3M1FA 5AQKA 5AQRA 5M1PA 4ISFA 4CZLA 5ADXH 4WQ5C 3QFUA 3CPEA 3A5MC 4B1XB 5KQDA 5C0YA 3TSQA 1NGGA 3FLCO 3G6EN 2V51B 4H0PA 1O13A 3WEEA 5EVZA 3I8BA 2QWLA 4JN4A 3MCAB 3O9RA 1YI2N 3TSUA 3A0IX 2A42A 3TU5A 3MDQA 1MDUB 1XUPO 2YX6A 1XQSC 3VGKA 2CGLA 3CC4N 1QZ5A 4H5NA 4ISEA 4DHYA 3DXKA 4PL8A 4PKIA 3CJAA 1J6ZA 1HPMA 1Z6RA 4OO1J 2NRWA 5FPMA 5EXWA 4CZEA 5BRHA 5AQIA 2Q97A 5AZJB 4K43A 1YXQA 3CJ9A 4DCHA 3EKUA 5JVHL 3ENOA 1VQNN 3CCEN 3AGRA 2P9SB 4IJNA 4ILHA 3E66A 3LDNA 4B1YB 4RWTA 3H3NO 3T69A 5AZIB 1BU6O 2QWPA 3O9QA 3R8EA 4BRFA 3PLAA 5KQ8A 5AQYA 5GIPA 2Q36A 1T44A 4BR5A 3WXKA 3ULEB 2Q1NA 1NJIO 1M90O 3BF3A 1S72N 2E88A 4BRLA 3ZETA 4BG8A 4IEEA 3O08A 3B8AX 2QM1A 4NLCA 2H3GX 4BR7A 1DKGD 1TYQA 1MWMA 1G99A 3P39A 4BR9A 5JVGL 1E4GT 2YCHA 4H5TA 2E20A 3LDQA 3L6QA 3J7ZO 2J4RA 4GY2B 4IOXA 4FWNA 1VQKN 3M3ZA 1BA1A 3ENBA 3UKRA 3VEZA 5M1QA 3A5NC 5JLHA 1YAGA 3TTFA 2P9LA 4A5AA 2UYTA 4PHTX 4JD2A 2FSJA 3VEVA 3PIPL 1QVGM 1S3XA 5MLCQ 2NRZA 4JKDA 3U9ZA 1D4XA 1SQKA 1GLBG 1GLEG 2CGJA 4CZJA 3W0LA 3HI0A 3QDKA 3UE5A 1YJ9N 3EZWA 1VQ7N 2P9NA 4ILGB 5CR4A 4IFEA 3HOTA 1RDUA 1NMDA 3WXMB 1EQYA 2KLAA 3ZX0A 1BWFO 4YOXA 1BA0A 4O8KA 5GAEP 4Y0WA 2A40A 4OPAA 1GLLO 3O9SA 4K41A 2VGMA 4WQ5A 3CF5L 2QWMA 1Y64A 3AAPA 3KHYA 4C1NI 1QQNA 3KVGA 2ZJQL 2QXLA 3CJCA 3MX2A 3P38A 5FPEA 1Q18A 3RSEB 3CMAN 1VQ6N 4JKAA 2NRRA 2WFBA 3MX5A 4I6MA 4MDAA 4CZMA 4BGBA 5BR9A 3JXUA 3O1BA 3CC2N 2ZGZA 4KBOA 4EHTA 3GOIA 3WQTA 1X3NA 5JMVA 4YOYA 5KPTA 2YJEA 2GX9A 2QWQA 3LDPA 3VPZA 1NGAA 4K42A 2A5XA 3WXIA 3OW2M 4BQZA 2P9PB 3LM9A 3M5RA 3HSCA 5AQSA 3LM2A 4R79A 1SS6A 5BPNA 5DM7L 4A2BA 3CI5A 1YJWN 3WUHA 2FLOA 4YDUC 5BRDA 4O8UA 3OBYA 1SAZA 2E1YA 3O4WA 3EL2A 3D2FA 1T6CA 4O5FA 1YHQN 3MMVA 5AFUA 4FSVA 3VTIA 2Q2RA 1HJOA 2OANA 3P31A 3SAFA 5AQOA 2D1KA 1VQLN 2Q31A 3AY9A 1VAZA 3M6GA 2NRVA 1K73O 2VCPA 1K9MO 4H5RA 3TTDA 5GAHP 2W40A 3WQUA 2QWOA 3AARA 4H0XB 4RCHA 4BC2A 2KKZA 3GDQA 3TPQA 1VQ4N 1MWKA 3P4IA 4WFBL 4CZGA 1YIJN 3KWIA 4RTFD 1P8ZA 3MK6A 3MN5A 3BUZB 4ILJA 5BN8A 3WEEB 3CCMN 3H45C 4HTLA 3ZX2A 4FPAA 5AQGA 5F0XA 2GWKA 3NVMA 3CCLN 1ATRA 2PFUA 3CJBA 5LY3A 1KXPA 3CJ1A 3LL3A 4FL9A 5BRFA 4FOIA 3VEYA 1N8RO 4FWKA 2HSTA 4M7YA 5E84A 3VGLA 1K8AO 1DEJA 3D2EB 3HRGA 4FWMA 1MA9B 1ZBSA 4IWVA 4BRNA 1NGHA 4YOTA 3R1XA 2PAVA 1KAZA 3SMSA 3ZX3A 5M1NA 5F2RA 4XEIA 1P90A 1JCEA 2JWLA 4B9QA 1Q81O 2VGNA 3KWGA 5EY4A 2GELA 4L3QA 4QS7A 3T7ZA 1OKJA 1V4TA 3CCQN 4WQ4A 3MN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJA A;  4CJ7 A;  3AAQ A;  1X3M A;  3C7N B;  2ASO A;  4BRC A;  5JIC A;  3H6E A;  3VES A;  5B8H A;  3CET A;  2F9W A;  4EHU A;  2P9I B;  5AZJ A;  2FXU A;  3H3O B;  4C23 A;  4DB3 A;  5CE3 A;  1GLC G;  4IO8 A;  2P9K B;  2AP1 A;  2P9S A;  5FPN A;  1NWK A;  4MO5 A;  4F9O A;  3CER A;  1BDG A;  1NBW A;  4YDU A;  3FE1 A;  4A61 A;  3QBW A;  4BVO A;  4XH1 A;  3D7E O;  3R6M A;  3UKR B;  3O5B A;  3ULE A;  4BRK A;  4QS8 A;  2P9L B;  1ATN A;  2P9U B;  2Q0U A;  1TUU A;  4JD2 B;  3KZB A;  4NB4 A;  4EIA A;  2HF3 A;  3DXM B;  3BF1 A;  1YVN A;  5AQF A;  3UKU B;  3HZ6 A;  4BRP A;  4BRM A;  2ASM A;  3EN9 A;  4A2A A;  2GTD A;  5AQH A;  5BPM A;  2IVO A;  4B1V A;  4BQL A;  5BRE A;  3O8M A;  3MN6 A;  1DGK N;  1ESV A;  3ZEU B;  3DJC A;  2AA4 A;  4M63 C;  3FR0 A;  4JHD B;  4FWO A;  1HKC A;  2Q0R A;  1S22 A;  1YUW A;  1GLF O;  3VEO A;  4B1U B;  2BTF A;  2HF4 A;  3U8X A;  3A5O C;  3CHW A;  3VF2 A;  4BRO A;  5AQM A;  5LJW A;  4HWI A;  5AQJ A;  1XC3 A;  2E2O A;  1K8K B;  3FZF A;  2E1Z A;  4BVP A;  1NM1 A;  4K25 A;  3O6W A;  3L4I A;  2PBD A;  2EWS A;  1CZA N;  5E26 A;  3RSE A;  4CZK A;  1HKG A;  1U2V A;  3J8A A;  3CQX A;  5ADX A;  1WOQ A;  3CIP A;  1BO5 O;  1KAY A;  4AM6 A;  1V4S A;  3IUC A;  5TKY A;  1TUY A;  2ZGY A;  5BN9 A;  1ZC6 A;  5AQV A;  3QML A;  4H0T B;  4PL7 A;  2NLX A;  4BRA A;  2QWN A;  5KPR A;  2P9P A;  3GL1 A;  2V7Y A;  3OHR A;  2HOE A;  1GLJ O;  4CBW A;  4EFH A;  3VER A;  5AQQ A;  1HX1 A;  1BOT O;  4AM7 A;  4BGA A;  3FZH A;  3A5L C;  2NRH A;  5ELZ A;  1U6Z A;  4H03 B;  2YHW A;  4BRE A;  4M7X A;  4BRD A;  4DQ8 A;  2YHX A;  3VF6 A;  2FSN A;  3QIC A;  1GLD G;  2FF6 A;  1BG3 A;  4MLH A;  4BG9 A;  4A62 A;  4BRG A;  1QQO A;  3SJH A;  2D4W A;  3VEW A;  1NGJ A;  1RDW X;  4BRI A;  5I9E B;  4H5W A;  4ISG A;  1GLA G;  5AQL A;  1LCU A;  3DXK B;  4CBU A;  3HM8 A;  3FZK A;  3GE1 A;  3QB0 A;  5AQW A;  3VEN A;  1BUP A;  1LOT B;  5AQP A;  3SMP A;  3U9D A;  3F9M A;  3VGM A;  3ID8 A;  3WXJ A;  3VEX A;  3UB5 A;  5AFU H;  4FWS A;  3G25 A;  2W41 A;  1H1V A;  5KPZ A;  1HUX A;  3IDH A;  2BUP A;  3BP8 A;  4H5V A;  4BC3 A;  4BR2 A;  4BR4 A;  4JNE A;  4B1W B;  3H46 O;  3ATV A;  3DWL A;  2CGK A;  3IMX A;  4FOE A;  3D2E A;  3I33 A;  3ZET B;  3VOV A;  3IFR A;  3H1Q A;  1TYQ B;  3FZL A;  2E8A A;  2YJF A;  1T6D A;  2IIR A;  5AQZ A;  1X9J A;  5AZI A;  2ZF5 O;  2ASP A;  3BEX A;  3U4L A;  5BPL A;  1E4F T;  4H0Y B;  4CZH A;  1WUA A;  3EKS A;  1IG8 A;  4JAX A;  4FWL A;  1QQM A;  4FPB A;  3C7N A;  4GNI A;  1ATS A;  4XH5 A;  2A6A A;  2P9I A;  3HBT A;  4EAH D;  4XH4 A;  1JCG A;  2P9N B;  3FGU A;  5EOY A;  2P9K A;  3C0B A;  1NGD A;  3SLC A;  3MCP A;  4MO4 A;  3DAW A;  4H0O A;  4J8F A;  2GUP A;  5F1X A;  2DPN A;  2QW9 A;  2GEM A;  3FZM A;  3GG4 A;  3O80 A;  2F9T A;  4FO0 A;  3WXL A;  4PKH A;  1NGF A;  3W3D A;  2P9U A;  5AQT A;  5AQX A;  3MN7 A;  4I6M B;  1HLU A;  1NGB A;  3DXM A;  3VET A;  3UKU A;  1NLV A;  4FWR A;  2I7P A;  3CQY A;  3VF4 A;  2NZT A;  4CBX A;  4BRH A;  2V52 B;  3JS6 A;  3R9P A;  3WT0 A;  4BC4 A;  2VYP A;  5AR0 A;  5EX5 A;  3EO3 A;  3LDO A;  1NGE A;  5AQN A;  2FF3 B;  4H0V B;  1IJJ A;  2VWB A;  2YI1 A;  3ZEU A;  1SZ2 A;  1RGI A;  3LDL A;  4PKG A;  4JHD A;  2ZWH A;  1Z05 A;  3CJ7 A;  3O1W A;  1RFQ A;  1R59 O;  1KAX A;  1HKB A;  2YHY A;  2FSK A;  4MLE A;  2V7Z A;  1U2V B;  3H1V X;  4E1J A;  2A41 A;  4NO7 A;  4LC9 B;  2IVN A;  1QZ6 A;  2D0P A;  4WQ4 C;  4QS9 A;  3D2F B;  2E2P A;  2D0O A;  5LJV A;  2E2Q A;  1K8K A;  3QBX A;  1QHA A;  3GBT A;  2HMP A;  2GWJ A;  1JCF A;  1C0G A;  2WUS A;  3SK3 A;  4Z94 A;  4IZ9 A;  2IVP A;  1ZXO A;  2E2N A;  4B1Z A;  4CD3 A;  5JLF A;  3HTV A;  4WYB A;  1NGI A;  4CZI A;  3ATU A;  3A8Y A;  4BC5 A;  3L0Q A;  5FPD A;  2I7N A;  5AQU A;  3ENH A;  4FWQ A;  4FWP A;  4BR0 A;  4CZF A;  4CI6 A;  4BRQ A;  4CD1 A;  3QFP A;  3FFK B;  2QWR A;  2A3Z A;  1C0F A;  3S41 A;  4IXC A;  1NGC A;  2KHO A;  2ITM A;  2CH6 A;  2CH5 A;  3M1F A;  5AQK A;  5AQR A;  4ISF A;  4CZL A;  5ADX H;  4WQ5 C;  3QFU A;  3A5M C;  4B1X B;  5KQD A;  1NGG A;  3FLC O;  2V51 B;  4H0P A;  3WEE A;  5EVZ A;  3I8B A;  2QWL A;  4JN4 A;  3A0I X;  2A42 A;  3TU5 A;  3MDQ A;  1MDU B;  1XUP O;  3VGK A;  1XQS C;  2CGL A;  1QZ5 A;  4H5N A;  4ISE A;  4DHY A;  3DXK A;  4PL8 A;  4PKI A;  3CJA A;  1J6Z A;  1HPM A;  1Z6R A;  5FPM A;  5EXW A;  4CZE A;  5BRH A;  5AQI A;  2Q97 A;  5AZJ B;  4K43 A;  1YXQ A;  3CJ9 A;  4DCH A;  3EKU A;  3ENO A;  2P9S B;  4IJN A;  3LDN A;  4B1Y B;  4RWT A;  3H3N O;  5AZI B;  1BU6 O;  2QWP A;  3R8E A;  4BRF A;  5KQ8 A;  5AQY A;  2Q36 A;  1T44 A;  4BR5 A;  3WXK A;  3ULE B;  2Q1N A;  3BF3 A;  2E88 A;  4BRL A;  3ZET A;  4BG8 A;  3O08 A;  3B8A X;  2QM1 A;  2H3G X;  4BR7 A;  1DKG D;  1TYQ A;  1MWM A;  1G99 A;  4BR9 A;  1E4G T;  2YCH A;  4H5T A;  2E20 A;  3LDQ A;  3L6Q A;  2J4R A;  4GY2 B;  4FWN A;  3M3Z A;  1BA1 A;  3UKR A;  3VEZ A;  3A5N C;  5JLH A;  1YAG A;  2P9L A;  2UYT A;  4JD2 A;  2FSJ A;  3VEV A;  1S3X A;  3U9Z A;  1D4X A;  1SQK A;  1GLB G;  1GLE G;  2CGJ A;  4CZJ A;  3W0L A;  3HI0 A;  3QDK A;  3UE5 A;  3EZW A;  2P9N A;  1NMD A;  1EQY A;  3ZX0 A;  1BWF O;  1BA0 A;  4O8K A;  4Y0W A;  2A40 A;  1GLL O;  4K41 A;  4WQ5 A;  2QWM A;  1Y64 A;  3AAP A;  3KHY A;  1QQN A;  3KVG A;  2QXL A;  3CJC A;  5FPE A;  1Q18 A;  3RSE B;  4I6M A;  4CZM A;  4BGB A;  5BR9 A;  3JXU A;  3O1B A;  2ZGZ A;  4KBO A;  4EHT A;  3GOI A;  3WQT A;  1X3N A;  5JMV A;  5KPT A;  2YJE A;  2QWQ A;  3LDP A;  3VPZ A;  1NGA A;  4K42 A;  2A5X A;  3WXI A;  4BQZ A;  2P9P B;  3LM9 A;  3HSC A;  5AQS A;  3LM2 A;  5BPN A;  4A2B A;  3CI5 A;  3WUH A;  2FLO A;  4YDU C;  5BRD A;  1SAZ A;  2E1Y A;  3O4W A;  3EL2 A;  3D2F A;  1T6C A;  4O5F A;  3MMV A;  5AFU A;  4FSV A;  2Q2R A;  1HJO A;  2OAN A;  5AQO A;  2D1K A;  2Q31 A;  3AY9 A;  3M6G A;  2VCP A;  4H5R A;  2W40 A;  3WQU A;  2QWO A;  3AAR A;  4H0X B;  4RCH A;  4BC2 A;  3TPQ A;  3GDQ A;  1MWK A;  3P4I A;  4CZG A;  4RTF D;  1P8Z A;  3MK6 A;  3MN5 A;  3BUZ B;  5BN8 A;  3WEE B;  3H45 C;  4HTL A;  3ZX2 A;  4FPA A;  5AQG A;  5F0X A;  2GWK A;  1ATR A;  3CJB A;  5LY3 A;  1KXP A;  3CJ1 A;  3LL3 A;  4FL9 A;  5BRF A;  4FOI A;  3VEY A;  4FWK A;  4M7Y A;  5E84 A;  3VGL A;  1DEJ A;  3D2E B;  4FWM A;  1MA9 B;  1ZBS A;  4IWV A;  4BRN A;  1NGH A;  3SMS A;  2PAV A;  1KAZ A;  3ZX3 A;  5F2R A;  4XEI A;  4B9Q A;  1JCE A;  5EY4 A;  2GEL A;  4L3Q A;  4QS7 A;  1OKJ A;  1V4T A;  4WQ4 A;  3MN9 A; 
#chains in the Genus database with same CATH topology
 4IJA A;  1EX4 A;  4DFM A;  4DTU A;  3AA4 A;  2LSN A;  4DSI A;  3C7N B;  4BRC A;  3N4Q A;  3CCS N;  3VES A;  4CCH A;  3RTV A;  1HMV A;  2P9I B;  3H3O B;  2HND A;  2QTD A;  4YOU A;  2HMI A;  5CE3 A;  4FW1 A;  5FPN A;  2P9S A;  2O4I A;  4F9O A;  2VWK A;  3L4Q A;  1JLE A;  4WF9 L;  4XH1 A;  3OS1 A;  3UKR B;  3HM9 A;  1KLM A;  3ULE A;  3SAH A;  2HBJ A;  2Q0U A;  4DR2 K;  4EIA A;  1C0M A;  3UKU B;  1CZ9 A;  4BRP A;  1RTI A;  3EN9 A;  3K5O A;  4DV6 K;  4NXM K;  2HW3 A;  3I0S A;  2F4V K;  4BQL A;  3RR7 A;  4FJI A;  4FZZ A;  3G4S N;  4CEC A;  4X66 K;  3MN6 A;  4A59 A;  1DGK N;  1ESV A;  3DJC A;  2AA4 A;  4M63 C;  4M41 A;  3ZYY X;  3O3G A;  3FR0 A;  1RBS A;  4JHD B;  3KK3 A;  4FWO A;  1HKC A;  1S22 A;  4BWJ A;  1NK4 A;  2ZE2 A;  1RT5 A;  4A5B A;  3ZLJ A;  2A1S A;  4LF5 K;  1YTU A;  4Z4C A;  5AQJ A;  1RCH A;  1K8K B;  2E1Z A;  2D5R A;  1RT6 A;  5CHI A;  4BVP A;  3TTC A;  3O6W A;  3PX0 A;  3L4I A;  1TL3 A;  4IKF A;  3V4I A;  3BZC A;  4CZK A;  2F7T A;  1U2V A;  4CEE A;  3CIP A;  4LF8 K;  5CY4 A;  3OYE A;  5TKY A;  2P5G A;  3R3L A;  3NH1 A;  2ZGY A;  5BN9 A;  1ZC6 A;  1KVA A;  1S6Q A;  4PL7 A;  5J2N A;  4BRA A;  5HRR A;  2V7Y A;  2HOE A;  4EFH A;  2HHU A;  3DLL L;  1HX1 A;  1D9F A;  3BDP A;  5H1S Q;  2XY6 A;  3HPG A;  3TAQ A;  1N6Q A;  2BGG A;  2NRT A;  3J7A P;  4H03 B;  2Z1J A;  4JKH A;  4DQ8 A;  2YHX A;  2FSN A;  3L2U A;  1N33 K;  5FRM A;  1GLD G;  3D6R A;  4LFC K;  4BRG A;  3VEW A;  3VQA A;  1NGJ A;  2GBZ A;  1RBT A;  4DV1 K;  4BRI A;  3NF7 A;  1GLA G;  4ISG A;  4B9N A;  4CEB A;  3DOK A;  4GV6 A;  2RF2 A;  3GE1 A;  1KLN A;  5AQW A;  1LOT B;  2QA4 N;  3SV3 A;  3WXJ A;  2OTL N;  4JI3 K;  4M3T A;  3OYD A;  5HRP A;  4DLG A;  5HP1 A;  4JK8 A;  4KAZ A;  1H1V A;  5KPZ A;  2Y1I A;  4E1N A;  4QOZ B;  1HQU A;  4DG1 A;  1KFS A;  4EZ6 A;  4BR4 A;  3H46 O;  1EWR A;  4OGE A;  3DWL A;  4OKJ A;  5DM6 L;  3ZET B;  5J2Q A;  3THW B;  3DLG A;  3N4P A;  1C6V A;  2NRX A;  2YV0 X;  2DFF A;  3PLA A;  1TKX A;  5AQZ A;  3WNG A;  3U4L A;  3JYT A;  4JI5 K;  1N36 K;  4CHY A;  2HBK A;  5KRT A;  4X64 K;  1ZBF A;  2HBM A;  3I55 N;  1QQM A;  4AHC A;  3NHG A;  2HNZ A;  4DTP A;  2VWJ A;  4GMJ B;  3RWU A;  1BQM A;  2NUB A;  1G15 A;  3HT3 A;  4FJ8 A;  4CFB A;  3MCP A;  4E19 A;  3DAW A;  4KB0 A;  4AQY K;  4F8R A;  3WNE A;  1JLA A;  2QW9 A;  4DUZ K;  3H08 A;  3MXI A;  3RMA A;  4PKH A;  4KHS A;  3W3D A;  4CHQ A;  3SPY A;  3MN7 A;  4DU4 A;  1NGB A;  1ZYQ A;  1NK5 A;  4FLW A;  1K6Y A;  5C2F A;  3THV A;  3R9P A;  3C94 A;  2HNY A;  4M3R A;  3TAG A;  1GOB A;  5EX5 A;  3V9X A;  5AQN A;  2FF3 B;  3CFP A;  2XHB A;  4NCB A;  2YI1 A;  1RGI A;  1VSI A;  3V9U A;  3AVM A;  4J2E A;  1VQP N;  2ZWH A;  3O9U A;  2YHY A;  2FSK A;  4MLE A;  2A41 A;  4NO7 A;  4GV9 A;  3B6O A;  4BE0 A;  2QEX N;  2FBV A;  4KH4 A;  2VQF K;  2E2P A;  2G8U A;  3EE8 A;  3TAB A;  1XHZ A;  1KC8 O;  4LH5 A;  1DT9 A;  1QHA A;  3MEC A;  4M42 A;  2OTJ N;  4PQU A;  2W6K A;  4CJE A;  3OYC A;  4W5T A;  4R5P A;  1C0G A;  1S5J A;  2WUS A;  3OTO K;  1RBU A;  4M3U A;  3K2P A;  3O4N A;  1NK7 A;  3I0R A;  1VK0 A;  4FK0 A;  4CZI A;  4ICL A;  1TGO A;  4FVU A;  5FDL A;  1HJR A;  3F5T A;  1GOC A;  3NGY A;  1VQO N;  1J53 A;  4JI4 K;  2UXD K;  4CZF A;  4AF1 A;  3QET A;  1KSP A;  2B6A A;  4FJL A;  4HHT A;  3FFK B;  2QWR A;  1N5Y A;  3PX4 A;  1C0F A;  3SBT A;  2ATQ A;  2ITM A;  3M1F A;  3CPE A;  4B1X B;  5KQD A;  3TSQ A;  3PSF A;  1L3V A;  4QAG A;  4ZTJ A;  4FJG A;  2Z1G A;  3ASM A;  2BAN A;  1YI2 N;  4GW6 A;  1KVB A;  3MDQ A;  1VRU A;  1XQS C;  1WAJ A;  4YHH K;  3AO4 A;  3DXK A;  3PSI A;  4PKI A;  3CJA A;  1L5U A;  4OKK A;  3LP2 A;  1JL1 A;  4OO1 J;  4LSN A;  2X74 A;  5AQI A;  2IC3 A;  3CJ9 A;  3EKU A;  3ENO A;  3CCE N;  4B3S K;  3E66 A;  4B1Y B;  4RWT A;  2G8W A;  4CHO A;  3T69 A;  1HNI A;  3O9Q A;  4BRF A;  2QKK A;  1QSS A;  2Q36 A;  4BR5 A;  3MEE A;  1M90 O;  4BG8 A;  4DQS A;  3B8A X;  1DKG D;  1TYQ A;  5D3G A;  4FVM A;  4HCB A;  1Z26 A;  3J7Z O;  4CF8 A;  1VQK N;  3L3V A;  3M3Z A;  5HLF A;  1BA1 A;  2HHH K;  3VEZ A;  4PWD A;  3QEV A;  3SQ0 A;  1YAG A;  3QLH A;  1S3X A;  5MLC Q;  3U9Z A;  5JS1 A;  2CGJ A;  1CZB A;  4DR4 K;  3HXM A;  4O4G A;  1XI1 A;  3K59 A;  2KZZ A;  2E6M A;  4DFP A;  3WXM B;  4DV2 K;  2KLA A;  2IAJ A;  1BWF O;  2A40 A;  1HQE A;  4K41 A;  2G8I A;  4WQ5 A;  4FJN A;  3KHY A;  1KVC A;  3MX2 A;  5FPE A;  3DLE A;  1VQ6 N;  1VSJ A;  2WFB A;  3SUO A;  2UXC K;  3OS2 A;  2ZGZ A;  5JMV A;  2PY5 A;  4GVM A;  5KPT A;  2QWQ A;  1WB9 A;  3VPZ A;  3EYZ A;  3AVB A;  2A5X A;  3OW2 M;  4BQZ A;  2P9P B;  4X65 K;  3LM9 A;  4OPK A;  3RMC A;  4C8N A;  4Q0B A;  1NU0 A;  4RW7 A;  1O1W A;  1YJW N;  2KTQ A;  2A1R A;  1WSF A;  1TAQ A;  2FLO A;  1RDB A;  5BRD A;  4DQI A;  2E1Y A;  3O4W A;  4CF9 A;  4B3M K;  4QCL A;  1BQN A;  1W7A A;  1JLG A;  4O5F A;  3M8R A;  4FSV A;  3P31 A;  3SAF A;  1N32 K;  2UXB K;  4OLA A;  1K9M O;  3DRR A;  4CEO A;  1VQ4 N;  4WFB L;  2JGU A;  1RBV A;  3KWI A;  4CK1 A;  3I8D A;  3O3F A;  3LWL A;  5BN8 A;  3WEE B;  3QIP A;  3CCM N;  4YY3 K;  2DTU A;  4NCG A;  3OYM A;  1S1V A;  4CJL A;  3AVL A;  3V1R A;  3CJB A;  5LY3 A;  5KGX A;  1FKO A;  1IBM K;  3ZSV A;  3VEY A;  2OPQ A;  1N8R O;  4FWK A;  3NDK A;  5E84 A;  5LMU K;  3D2E B;  1U4B A;  1NGH A;  4YOT A;  3R1X A;  3SMS A;  5M1N A;  4XEI A;  2JWL A;  2G8F A;  1NKC A;  2D0B A;  3FFI A;  2GEL A;  1NOZ A;  3SZ2 A;  3WNF A;  3DOL A;  4WQ4 A;  1RDC A;  2E5L K;  1FXX A;  4CJ7 A;  4J2D A;  4G9Z A;  3D0P A;  1KFD A;  4YFU A;  4N41 A;  1A5W A;  3TSP A;  3VQD A;  3H6E A;  5B8H A;  3THY A;  4BDZ A;  5AZJ A;  3Q7B A;  1VQ5 N;  3CCJ N;  3ZSX A;  4C23 A;  3HVR A;  1UOC A;  1IH7 A;  4I2Q A;  3DRP A;  4C1N K;  3MED A;  4IO8 A;  1T8E A;  1NBW A;  3LPT A;  4YDU A;  3SYZ A;  4OPH A;  1NK0 A;  1X9W A;  3V81 A;  4BRK A;  2P9L B;  4FCY A;  4JD2 B;  3L3U A;  3DXM B;  1JLF A;  5AQF A;  1FK9 A;  4BRM A;  1WLJ A;  3AV9 A;  2Z1H A;  4FYD A;  4MQ3 A;  5KRS A;  4IG0 A;  2RE2 A;  1S1X A;  4DUY K;  5CYM A;  1SL2 A;  4C8O A;  4YOR A;  3ZEU B;  1L3T A;  4HUG A;  4GV3 A;  1EKE A;  4DQP A;  2YHA A;  4B1U B;  2BTF A;  1LAV A;  3U8X A;  3A5O C;  4KPY A;  2AJQ A;  3DRS A;  4IDK A;  4OPJ A;  1XC3 A;  1ASV A;  2VG6 A;  4FJM A;  1NM1 A;  3HYF A;  5HOO A;  3SUP A;  1RT7 A;  4DR6 K;  2EWS A;  1CZA N;  3VN5 A;  3RSE A;  3T19 A;  3S3M A;  1WOQ A;  1BO5 O;  1KAY A;  3VQ8 A;  1JXE A;  1ASU A;  4B8A B;  4KHQ A;  3C95 A;  3VMF B;  5AQV A;  1NKE A;  3KD5 E;  2NLX A;  1TKT A;  5KPR A;  5J1E A;  3OHR A;  3KK7 A;  3BZK A;  3L8B A;  1U49 A;  1U04 A;  3EE9 A;  1BOT O;  5ELZ A;  3CD6 N;  1XNR K;  4IEI A;  2O8D B;  1QSL A;  4W5Q A;  1YF5 L;  1VSF A;  1TK0 A;  3HJF A;  2YHW A;  4N56 A;  4E7K A;  1BG3 A;  4BG9 A;  3THX B;  3SJH A;  2D4W A;  4B3R K;  5I9E B;  1Q7Y O;  4JI7 K;  3NGZ A;  4LY7 A;  1XC9 A;  3AO2 A;  2O8B B;  1ZBL A;  3FZK A;  2HB5 A;  2O8F A;  3VEN A;  1BUP A;  5AQP A;  4FM1 A;  3U9D A;  2DY4 A;  1T7P A;  3SV4 A;  3VEX A;  4M3X A;  3UB5 A;  4FK2 A;  5AFU H;  1VHX A;  4FWS A;  3DLH A;  4FJH A;  1RT1 A;  2O8E B;  3G25 A;  3SBG A;  2W41 A;  3NVK A;  3K9J A;  3AGK A;  4NLB A;  4JS5 A;  4IOA L;  3AVG A;  3BP8 A;  4H5V A;  4W5N A;  4JNE A;  2XRI A;  3TAE A;  4FOE A;  4Z0U A;  3I33 A;  4AH9 A;  3H1Q A;  4CFC A;  3RRH A;  2Y1J A;  1BL3 A;  5SZT A;  2ZF5 O;  3BEX A;  3CXC M;  3EKS A;  4JAX A;  4V19 S;  3VA0 A;  3MEG A;  1VSL A;  3C7N A;  4GNI A;  4WE1 A;  3CPW M;  2A6A A;  2P9I A;  3HBT A;  1RDA A;  4XH4 A;  3OYB A;  1JCG A;  5C25 A;  2HHS A;  3FGU A;  1S1U A;  1X1P A;  1QE1 A;  4UY8 O;  3LAK A;  1NGD A;  2OZS A;  4MO4 A;  4KV8 A;  4J8F A;  3E1Y A;  5M1F A;  1YVU A;  3O80 A;  1C1A A;  2RHK A;  1NGF A;  3AA3 A;  1UA0 A;  1IKW A;  2G8H A;  1IBL K;  3U3Y A;  3VET A;  3UKU A;  1NLV A;  1X9M A;  1OH7 A;  3O4Q A;  3CQY A;  3VF4 A;  2NZT A;  1NJW A;  4AHR A;  4BC4 A;  4DR5 K;  1C1C A;  3EO3 A;  3LDO A;  2KZM A;  3RMD A;  1IJJ A;  4N5S A;  3LDL A;  4PKG A;  4O5B A;  4JHD A;  1VQM N;  3O1W A;  3CJ7 A;  4CEQ A;  3D45 A;  1KAX A;  1U2V B;  1RNH A;  4LC9 B;  5J2M A;  2F96 A;  3P83 D;  1QZ6 A;  3DYA A;  4B9V A;  4WQ4 C;  3CCU N;  3D2F B;  4LFB K;  2E2Q A;  1K8K A;  4WFA L;  1UWB A;  3CCV N;  1YIT N;  4CJQ A;  1W97 L;  4DFJ A;  4HCC A;  1VQ9 N;  2YHB A;  3AVF A;  2GWJ A;  1JCF A;  5T7B A;  4AHS A;  3SK3 A;  4KFB A;  4CJP A;  1J54 A;  4IZ9 A;  2E2N A;  5JLF A;  3I56 N;  3HTV A;  4PA1 A;  1BIZ A;  3EY1 A;  3A8Y A;  4BC5 A;  2WBN A;  5FPD A;  4FWQ A;  4CI6 A;  3AVI A;  4BRQ A;  4IOC L;  4CD1 A;  3QER A;  4LH4 A;  4IXC A;  2KHO A;  4UQG A;  2CH6 A;  3OJU A;  5M1P A;  5AQR A;  4CZL A;  1IO2 A;  3LAN A;  3OS0 A;  3QFU A;  1XMO K;  5C0Y A;  2V51 B;  4H0P A;  3I8B A;  2VG5 A;  3MCA B;  3O9R A;  2PYL A;  3TAN A;  3TU5 A;  1MDU B;  1XUP O;  3VQB A;  3VGK A;  2CGL A;  4ZTF A;  4CJR A;  4PL8 A;  2OPR A;  1DTT A;  3F73 A;  4YNQ A;  1D8Y A;  3RMB A;  4CZE A;  2Q97 A;  1QS4 A;  4DCH A;  3PV8 A;  1WSJ A;  1U48 A;  1BCM A;  4DSK A;  4CEF A;  4ILH A;  3LDN A;  1HPZ A;  1NJZ A;  2QWP A;  5K14 A;  3R8E A;  5KQ8 A;  3AO1 A;  1SL1 A;  1QHT A;  3HP9 A;  2YNH A;  4FLV A;  2Q1N A;  3BF3 A;  4CEA A;  5HRN A;  4BRL A;  3ZET A;  4NLC A;  2QM1 A;  4DWI A;  3THW A;  1G99 A;  5JVG L;  1IBK K;  4AHV A;  4H5T A;  4DV0 K;  1ITG A;  4IOX A;  1D9D A;  1EWQ A;  4DR1 K;  3ENB A;  1EET A;  5JLH A;  4CHP A;  4A5A A;  3VEV A;  1D4X A;  1SQK A;  4CZJ A;  3M8Q A;  1LV5 A;  4I9L A;  4ILG B;  3HPH A;  5CR4 A;  1RDU A;  4DV5 K;  3NF6 A;  2DFH A;  4FZY A;  4YOX A;  1JKH A;  5GAE P;  2YNF A;  1GLL O;  3LZI A;  1Y64 A;  4C1N I;  4KRF A;  4Z4F A;  4ID5 A;  4W5O A;  2QXL A;  3CJC A;  3P38 A;  3S3O A;  3J81 O;  4JKA A;  2NRR A;  2PYJ A;  4BGB A;  3CC2 N;  1CLQ A;  3WQT A;  3KLG A;  4YOY A;  4CJ5 A;  2WTU A;  1TK5 A;  3OYH A;  3WXI A;  3PO5 A;  2G8V A;  4O55 A;  1JLQ A;  3QIO A;  3LZJ A;  4A2B A;  4F2R A;  1QTM A;  4E7H A;  3WUH A;  4O8U A;  3ZT2 A;  3OBY A;  1SAZ A;  3EL2 A;  3SI6 A;  4CGJ A;  1SKW A;  4K0K K;  3P1G A;  3V1O A;  2XO7 A;  1ZBH A;  1LWC A;  3VTI A;  1Q8I A;  1HJO A;  2OAN A;  2Q2R A;  5AQO A;  2D1K A;  4BE2 A;  4DF8 A;  4FJ7 A;  3K0S A;  3ZT4 A;  3DMJ A;  1VAZ A;  3HST B;  4BDY A;  2HHX A;  4H5R A;  3WQU A;  4FLX A;  2QWO A;  4H0X B;  2KKZ A;  1MWK A;  4CZG A;  1HNZ K;  3BUZ B;  2BDP A;  4FK4 A;  3H45 C;  4LD0 A;  4I9Q A;  3ZT3 A;  2XY8 A;  5F0X A;  3QEI A;  3NVM A;  4DS4 A;  4M3Z A;  1ATR A;  3KK1 A;  1CXU A;  3KTQ A;  4CJV A;  2HST A;  3DI6 A;  3VGL A;  4FWM A;  1MA9 B;  1ZBS A;  3L2R A;  1TAU A;  5F2R A;  1P90 A;  2VGN A;  3ZT1 A;  1X9S A;  2OA8 A;  3T7Z A;  4CJT A;  1OKJ A;  4DTM A;  3HPO A;  1HNV A;  1VSE A;  3A2F A;  3MWP A;  5KTQ A;  1IKY A;  2F9W A;  2EHG A;  4DR3 K;  2FXU A;  5HBM A;  1I94 K;  3C6H A;  4DB3 A;  1JXB A;  3ISN C;  3ZSW A;  2P9K B;  1NK8 A;  4MO5 A;  3LAM A;  1FW6 A;  1VRT A;  3FE1 A;  3RVC A;  4A61 A;  4BVO A;  3CFO A;  2UUB K;  3R6M A;  1KQS M;  4QS8 A;  2P9U B;  5HRO A;  3KZB A;  1BI4 B;  3NBP A;  2HF3 A;  5BR8 K;  3HZ6 A;  4JKG B;  1SUQ A;  3KKS A;  3TAM A;  2GTD A;  5AQH A;  5BPM A;  3C6A A;  4DV7 K;  3QEW A;  4FW2 A;  2IVO A;  3C6T A;  4B1V A;  5BRE A;  2O8C B;  4DU1 A;  3VQP A;  5GAG P;  3AO3 A;  3KIO A;  2HBL A;  3VEO A;  4YOV A;  3DM2 A;  5M1O A;  3CHW A;  3VF2 A;  4BRO A;  5AQM A;  1SL0 A;  5GIN A;  5EU7 A;  4CHN A;  3BGR A;  3E9L A;  3JAM O;  5LJW A;  2E2O A;  3C6U A;  3FZF A;  3ALY A;  5CZ2 A;  4K25 A;  3SCX A;  2PBD A;  5E26 A;  3TAR A;  2ETJ A;  4JEP A;  2FBX A;  1BHL A;  4JI8 K;  2BE2 A;  3J8A A;  5TKW A;  3CQX A;  5ADX A;  1HNX K;  4CF1 A;  1V4S A;  3IUC A;  2ITG A;  4E7J A;  1TUY A;  4AHT A;  4IO9 L;  3CC7 N;  3Q7C A;  3SPZ A;  2UUA K;  2JLE A;  2P9P A;  3GL1 A;  1RBR A;  1KD1 O;  4CBW A;  4KRE A;  1WSG A;  3SQ2 A;  4GVE A;  4AM7 A;  1Q9Y A;  3A5L C;  4JV5 K;  1U6Z A;  1TK8 A;  4Z4E A;  4B8C A;  2ZJR L;  1SKS A;  3VF6 A;  1JLB A;  3QIC A;  4MLH A;  1T03 A;  4F2S A;  1DLO A;  2QI2 A;  5GAD P;  2ZM6 K;  1YJN N;  2KQ2 A;  5AQL A;  2ZD1 A;  4CBU A;  1S6P A;  4JKE A;  4KB1 A;  4HTU A;  3KJV A;  4OLB A;  3VGM A;  3ZSR A;  4CW7 B;  4OJR A;  4DU3 A;  1MU2 A;  4DTO A;  1QQC A;  2UUC K;  4BE1 A;  2EX3 A;  3CFR A;  3TAP A;  3K5N A;  4J2B A;  5IT9 O;  3IDH A;  2BUP A;  4KHU A;  4BC3 A;  4B1W B;  1HRH A;  4WFN L;  1NG9 A;  3OVN A;  5LMN K;  2CGK A;  3D2E A;  3K9K A;  3IS9 A;  3NGI A;  3IFR A;  2E8A A;  4K8X A;  3AVK A;  3HK2 A;  3IRX A;  4IFY A;  5AZI A;  1LW0 A;  2IIR A;  1E4F T;  4H0Y B;  5LL6 Z;  4DQR A;  4E7I A;  4FWL A;  1ATS A;  3ZSQ A;  3VQ7 A;  4XH5 A;  1UA1 A;  3PY8 A;  3BY5 A;  2HVI A;  1R0A A;  2P9N B;  3NH0 A;  1EO1 A;  1RDD A;  5EOY A;  3F9K A;  3C0B A;  4U7B A;  3HOS A;  4DSF A;  5F1X A;  2DPN A;  1WNS A;  2WC9 A;  3DLB A;  1WSI A;  2GEM A;  3FZM A;  3GG4 A;  2VG7 A;  1RIL A;  2F9T A;  3WXL A;  4PUO A;  4XIU A;  3MXM A;  1S1T A;  5AQT A;  5AQX A;  4I6M B;  3DXM A;  3OYA A;  5AJ3 K;  3O9T A;  4FWR A;  2I7P A;  2F8S A;  1N34 K;  1TL1 A;  4FJX A;  4CBX A;  2V52 B;  1OH6 A;  3MWT A;  3WT0 A;  2VYP A;  4YOW A;  5AR0 A;  1NGE A;  4LF6 K;  4FZX C;  3U3G A;  3ZEU A;  1Z25 A;  4DV3 K;  3K5L A;  1J5E K;  1RFQ A;  1R59 O;  1HKB A;  2R7Y A;  2V7Z A;  4CVN E;  3ZCM A;  1NJY A;  2YKM A;  4N76 A;  2D0P A;  4EP4 A;  1VSH A;  1XMQ K;  4KKO A;  4JK7 A;  1HYS A;  2D0O A;  5LJV A;  5CZ1 A;  4IBN A;  3OBW A;  1QVF M;  5FRO A;  2E6L A;  2D0C A;  3G71 N;  3SQ1 A;  4BAC A;  3DLR A;  4HUE A;  3AO5 A;  4CD3 A;  3VQ4 A;  3KD1 E;  3CCR N;  4DV4 K;  4KHW A;  4FXD A;  3ATU A;  3U6F A;  4LF4 K;  3L0Q A;  3C65 A;  3VQC A;  3E9O A;  3HL8 A;  2RN2 A;  3L2Q A;  3IG1 A;  4OX9 K;  2A3Z A;  3SJJ A;  3S41 A;  1NGC A;  2O8D A;  4DF4 A;  3NMU A;  1ILY A;  2CH5 A;  4ISF A;  3QES A;  4WQ5 C;  1WBD A;  3G6E N;  4FM2 A;  3RR8 A;  2IGI A;  2B4J A;  3TSU A;  3VQ6 A;  3THX A;  3A0I X;  2YX6 A;  4I2P A;  4ISE A;  4DHY A;  1LAW A;  2O8B A;  1I39 A;  5FPM A;  1XNQ K;  2WOM A;  1LWF A;  5EXW A;  4OKE A;  4DMN A;  5BRH A;  1J9A A;  4K43 A;  1YXQ A;  2F8T A;  5JVH L;  3OJS A;  3QNN A;  2P9S B;  4IJN A;  3H3N O;  1TVR A;  1BU6 O;  1S9G A;  5AQY A;  2O8E A;  1T44 A;  3OY9 A;  2WON A;  3G10 A;  3WXK A;  4CEZ A;  3ULE B;  1NK6 A;  1NJI O;  1S72 N;  3IAY A;  4IEE A;  3MAQ A;  1W9H A;  3LDQ A;  2IOC A;  3EEQ A;  1Y97 A;  3L6Q A;  4GY2 B;  4FWN A;  3UKR A;  4CGH A;  3HO1 A;  4KI6 A;  3A5N C;  1WSE A;  2UYT A;  4PHT X;  2FSJ A;  3PIP L;  1QVG M;  3WNH A;  4B9S A;  1NMN A;  3KK2 A;  1C0T A;  3HI0 A;  3QDK A;  1SV5 A;  3EZW A;  1VQ7 N;  3NFA A;  3HOT A;  1KTQ A;  1NMD A;  1EQY A;  3ZX0 A;  1VSK A;  4Y0W A;  3O9S A;  2VGM A;  3CF5 L;  1QQN A;  3KVG A;  4DTJ A;  1S1W A;  4ELU A;  1Q18 A;  1EXQ A;  2UU9 K;  2HVH A;  4DLE A;  4TSX A;  4RG8 A;  3JXU A;  3O1B A;  3GOI A;  4ELV A;  1X3N A;  4FJJ A;  3K57 A;  4LF7 K;  2IDO A;  4BDP A;  2Q3S A;  4JYA K;  1NGA A;  5DK5 A;  4CJ3 A;  3CG7 A;  4CJU A;  4RW8 A;  2W6L A;  5DM7 L;  1L3U A;  3K5M A;  3V9S A;  1VSM A;  4YDU C;  4ELT A;  3TAF A;  4CGD A;  2QK9 A;  1BGX T;  3D2F A;  1T6C A;  1YHQ N;  3MMV A;  1YT3 A;  1RT2 A;  1KRP A;  4MFB A;  3AY9 A;  2P51 A;  1TKD A;  3QIN A;  2KFN A;  3S3N A;  1K73 O;  3TTD A;  1TV6 A;  4LFA K;  4RCH A;  4BC2 A;  2Z1I A;  3GDQ A;  3P4I A;  1RT4 A;  1FJG K;  4RTF D;  1U47 A;  3HP6 A;  4ILJ A;  4Y1D A;  4F4K A;  2HHV A;  3ZX2 A;  5E41 A;  3ITH A;  3L2W A;  3CCL N;  2PFU A;  3UIQ A;  3CJ1 A;  3LL3 A;  4FL9 A;  2P5O A;  4LSL A;  5C24 A;  1K8A O;  1DEJ A;  3HRG A;  2XY5 A;  2PAV A;  1KAZ A;  3AA5 X;  3PUF A;  1JCE A;  3LP1 A;  4CES A;  5EY4 A;  4QS7 A;  1V4T A;  3CCQ N;  5SWM A;  4FLY A;  3MN9 A;  5JS2 A;  3VQQ A;  2BH1 A;  3AAQ A;  1X3M A;  3P5J A;  4EZ9 A;  4DSJ A;  2ASO A;  1ZBI A;  5JIC A;  4IDH A;  3VA3 A;  3CET A;  4EHU A;  2GV9 A;  5KI6 A;  1GLC G;  4CK2 A;  2AP1 A;  2RPI A;  3T1H K;  1NWK A;  3CER A;  1BDG A;  4B9M A;  4CIG A;  3QBW A;  1HNW K;  3F2K A;  2YKN A;  4RW4 A;  3D7E O;  3O5B A;  3M8S A;  1HYV A;  1ATN A;  1NOY A;  1TUU A;  4NB4 A;  3BF1 A;  1YVN A;  1Q86 O;  1RT3 A;  2ASM A;  4A2A A;  4Y1C A;  2ZJP L;  3PO4 A;  4W5R A;  3QEX A;  3O8M A;  4DTN A;  3LPU A;  3CQ8 A;  4ID1 A;  2RKI A;  3OYI A;  1VQ8 N;  1NKB A;  2Q0R A;  4KH5 A;  4ZHR A;  1YUW A;  5C12 A;  1GLF O;  1RTJ A;  4JI0 K;  2HF4 A;  3ID6 A;  5M1K A;  1W2B M;  1A5X A;  1IV0 A;  1OH8 A;  4GKJ K;  3QO9 A;  2PZS A;  2D0A A;  4JRQ A;  4HWI A;  4FJ9 A;  5C15 A;  2I5J A;  4EP5 A;  4DSE A;  3VTH A;  1JLC A;  4JS4 A;  1YTA A;  4AIL C;  4JI1 K;  1HKG A;  3PX6 A;  4E7L A;  4AM6 A;  3QNO A;  3KLF A;  5HL7 L;  1J5O A;  4M45 A;  5FLX O;  4DKW A;  3QML A;  4KTW A;  4H0T B;  1HR0 K;  1BIS A;  4KH6 A;  2QWN A;  3LAL A;  3VQ9 A;  5IWA K;  3KLH A;  1GLJ O;  1NK9 A;  1E3M A;  3VER A;  5AQQ A;  4FLU A;  4DFK A;  1M1K O;  3AVC A;  4BGA A;  3FZH A;  4HUF A;  4JRP A;  2NRH A;  3CM6 A;  3SNN A;  4M3Y A;  4C8K A;  1WSH A;  5I3U A;  4BRE A;  2JWK A;  4M7X A;  4BRD A;  1QSY A;  2E4L A;  2FF6 A;  4JI6 K;  4A62 A;  4L8R B;  1IG9 A;  1QQO A;  4KHY A;  1RDW X;  4CGG A;  3PIO L;  4B3T K;  4H5W A;  4JK9 A;  3TWH A;  1DTQ A;  1LCU A;  1C1B A;  3DXK B;  3O3H A;  3HM8 A;  4DQQ A;  4HVJ A;  3QB0 A;  3E9P A;  3SMP A;  3F9M A;  1JJ2 M;  3ID8 A;  3IKM A;  5C2D A;  2G8K A;  4C8L A;  1WN7 A;  3RRG A;  4DR7 K;  3KKR A;  3ZSO A;  2FC0 A;  5C10 A;  4NXN K;  4E1M A;  4A57 A;  3AVN A;  1ZBU A;  1Q82 O;  1HUX A;  3NH2 A;  4BR2 A;  1L3S A;  4CJW A;  4CFA A;  1F21 A;  3ATV A;  4BWM A;  3IMX A;  3VOV A;  1TYQ B;  3FZL A;  3NAE A;  3ULD A;  5FRN A;  2P1J A;  2YJF A;  3ZSZ A;  1T6D A;  5BPL A;  1X9J A;  2ASP A;  3AVH A;  4G1Q A;  2QKB A;  4CZH A;  4DSL A;  1WUA A;  4BY9 C;  1IG8 A;  3SAG A;  3KLI A;  4MDB A;  2O4G A;  4FPB A;  1VSD A;  2X78 A;  1LWE A;  2VQE K;  2YNG A;  1OVY A;  3OYG A;  4JKC A;  2OPP A;  4EAH D;  1T3V A;  3JSM A;  1WAF A;  2P9K A;  3SLC A;  4CHZ A;  4H0O A;  2GUP A;  2FBY A;  3ZSY A;  3LP3 A;  5KGW A;  4FO0 A;  3VQE A;  1C0U A;  3AA2 A;  4JKB A;  4J2A A;  1ASW A;  2P9U A;  4FLZ A;  5GIO A;  1BI4 A;  1HLU A;  4JKG A;  4CF0 A;  1B92 A;  4BRH A;  3JS6 A;  1CXQ A;  3OA9 A;  3NF8 A;  4CJ4 A;  4B3O A;  2HHW A;  2O8C A;  1GOA A;  4H0V B;  1XHX A;  2VWB A;  2OPS A;  1SZ2 A;  4KHP K;  1S9E A;  4KHN A;  2KW4 A;  1Z05 A;  4I7F A;  1A5V A;  4JKF A;  3H1V X;  4E1J A;  2GUI A;  2NNW A;  5J2P A;  4CGI A;  2IVN A;  4U67 L;  1HYZ A;  4QS9 A;  3AVA A;  4RW9 A;  4CIF A;  3QBX A;  1REV A;  3GBT A;  4WCE L;  1UAX A;  2HMP A;  3OYL A;  4DTR A;  4Z94 A;  1BCO A;  1ZXO A;  2IVP A;  4B1Z A;  3J80 O;  4WYB A;  1NGI A;  4CJF A;  4CE9 A;  4DTX A;  3E01 A;  2I7N A;  5AQU A;  3ENH A;  4H8K A;  4FWP A;  4BR0 A;  3ZT0 A;  3V9Z A;  3LWM A;  3QFP A;  4KTZ A;  3T1Y K;  4Z4I A;  3CME N;  3LP0 A;  3OYN A;  4OGC A;  2HHQ A;  4KI4 A;  5AQK A;  1OVQ A;  4CJS A;  5ADX H;  3A5M C;  2XY7 A;  1NGG A;  3FLC O;  4C8M A;  3CM5 A;  1O13 A;  3WEE A;  5EVZ A;  2QWL A;  4JN4 A;  4CJK A;  2A42 A;  4FM0 A;  4OVL A;  1T05 A;  3T3F A;  3MXJ A;  3CC4 N;  1QZ5 A;  4H5N A;  5C42 A;  3SQ4 A;  1J6Z A;  1HPM A;  1Z6R A;  3V9W A;  2NRW A;  4JI2 K;  3THY B;  4CFD A;  3T1A A;  5HRS A;  5AZJ B;  2QXF A;  2OYQ A;  1VQN N;  3AGR A;  1W0H A;  4CK3 A;  5AZI B;  3DLK A;  1WBB A;  4DS5 A;  4B9T A;  3M8P A;  5GIP A;  1Q9X A;  4N47 A;  2HHT A;  1D5A A;  4CED A;  2E88 A;  4B9U A;  4O44 A;  3O08 A;  2OZM A;  2H3G X;  4BR7 A;  4CER A;  1MWM A;  4BR9 A;  3P39 A;  1E4G T;  2YCH A;  4NCA A;  2E20 A;  3NF9 A;  2J4R A;  3V1Q A;  2FBT A;  3QEP A;  1KCF A;  5M1Q A;  3L2V A;  3TTF A;  2P9L A;  4RW6 A;  4JD2 A;  4CF2 A;  2NRZ A;  4JKD A;  3NE6 A;  2X6N A;  1GLB G;  1GLE G;  4O0J A;  4NYF A;  3W0L A;  1B9F A;  3UE5 A;  1NJX A;  1YJ9 N;  2P9N A;  3SUQ A;  4IFE A;  5DMR A;  4B9L A;  2KFZ A;  1BA0 A;  4O8K A;  2IS3 A;  4OPA A;  4F3O A;  3NCI A;  2QWM A;  3AAP A;  4FJ5 A;  1EP4 A;  2ZJQ L;  4Q5V A;  3RSE B;  3OYF A;  3CMA N;  4FJK A;  4NYN A;  3MX5 A;  1TKZ A;  4I6M A;  4MDA A;  2YNI A;  4CZM A;  3LDS A;  2OCE A;  5I42 A;  5BR9 A;  3SUN A;  4KBO A;  4EHT A;  4IFV A;  3EZ5 A;  3TI0 A;  4E0D A;  2YJE A;  3S9H A;  4B08 A;  2B5J A;  2GX9 A;  3LDP A;  4K42 A;  4Z4G A;  3M5R A;  3HSC A;  4JLH A;  5AQS A;  1I3A A;  3LM2 A;  3VQ5 A;  4R79 A;  4E3S A;  1SS6 A;  5BPN A;  1LW2 A;  2W42 A;  3CI5 A;  1IKV A;  4H4M A;  1JL2 A;  4O0I A;  1OH5 A;  1RTH A;  3V6D A;  4KO0 A;  2DFE A;  1BIU A;  5AFU A;  3G0Z A;  4M3W A;  4F3T A;  1VQL N;  1RTD A;  1IKX A;  2Q31 A;  4KTQ A;  3M6G A;  4GKK K;  2NRV A;  5A2Q O;  2VCP A;  5GAH P;  2W40 A;  4CIE A;  4CGF A;  3AAR A;  2O8F B;  2X6S A;  1U45 A;  3TPQ A;  3K58 A;  2ZQB A;  1YIJ N;  4FLT A;  1B9D A;  4X62 K;  1P8Z A;  5CYQ A;  3KLE A;  3MK6 A;  4LF9 K;  3MN5 A;  4DTS A;  3CYM A;  3TR8 A;  4HTL A;  4FPA A;  5AQG A;  2GWK A;  1NNE A;  3OYK A;  1KXP A;  1FKP A;  4AHU A;  1SKR A;  4K8Z A;  4E89 A;  5BRF A;  4IG3 A;  4FOI A;  3AVJ A;  4M7Y A;  4PY5 A;  3HVT A;  3OYJ A;  4BRN A;  4IWV A;  1XWL A;  3ZX3 A;  4B9Q A;  1Q81 O;  3KWG A;  4Z4H A;  4H4O A;  4L3Q A;  3B6P A;  3J7Y P; 
#chains in the Genus database with same CATH homology
 4IJA A;  4CJ7 A;  2BH1 A;  4G9Z A;  3AAQ A;  1X3M A;  3C7N B;  2ASO A;  3MWP A;  3N4Q A;  3TSP A;  4BRC A;  5JIC A;  3CCS N;  3H6E A;  4IDH A;  3VES A;  5B8H A;  3CET A;  2F9W A;  4EHU A;  2P9I B;  5AZJ A;  3Q7B A;  1VQ5 N;  2FXU A;  3H3O B;  3CCJ N;  2QTD A;  4C23 A;  4YOU A;  3C6H A;  4DB3 A;  5CE3 A;  1GLC G;  4C1N K;  4IO8 A;  2P9K B;  2AP1 A;  2P9S A;  5FPN A;  1NWK A;  4MO5 A;  4F9O A;  3CER A;  1BDG A;  1NBW A;  4YDU A;  3L4Q A;  3FE1 A;  3RVC A;  4A61 A;  3QBW A;  4BVO A;  4WF9 L;  3F2K A;  4XH1 A;  4OPH A;  3D7E O;  3R6M A;  3UKR B;  3O5B A;  1KQS M;  3ULE A;  3SAH A;  4BRK A;  4QS8 A;  2P9L B;  1ATN A;  2HBJ A;  2P9U B;  2Q0U A;  1TUU A;  4JD2 B;  3KZB A;  4NB4 A;  4EIA A;  2HF3 A;  3DXM B;  3BF1 A;  1YVN A;  5AQF A;  3UKU B;  1Q86 O;  3HZ6 A;  4JKG B;  4BRP A;  4BRM A;  2ASM A;  3EN9 A;  4A2A A;  2GTD A;  5AQH A;  5BPM A;  2ZJP L;  3C6A A;  2RE2 A;  2IVO A;  4B1V A;  4BQL A;  5BRE A;  3O8M A;  4YOR A;  3G4S N;  3MN6 A;  4A59 A;  1DGK N;  1ESV A;  3ZEU B;  3DJC A;  2AA4 A;  4M63 C;  3ZYY X;  3FR0 A;  4JHD B;  5GAG P;  1VQ8 N;  4FWO A;  1HKC A;  2Q0R A;  1S22 A;  4KH5 A;  4GV3 A;  1YUW A;  2HBL A;  1GLF O;  4A5B A;  3VEO A;  4B1U B;  2BTF A;  5C12 A;  2HF4 A;  4YOV A;  3U8X A;  3ID6 A;  3A5O C;  5M1O A;  5M1K A;  3CHW A;  3VF2 A;  1W2B M;  4BRO A;  5AQM A;  5GIN A;  3E9L A;  5LJW A;  4HWI A;  5AQJ A;  1XC3 A;  2E2O A;  5C15 A;  1K8K B;  3FZF A;  2E1Z A;  5CHI A;  4BVP A;  3TTC A;  1NM1 A;  5HOO A;  4K25 A;  3O6W A;  3VTH A;  3L4I A;  2PBD A;  2EWS A;  1CZA N;  5E26 A;  3RSE A;  4JEP A;  4CZK A;  2F7T A;  1HKG A;  1U2V A;  3J8A A;  5TKW A;  3CQX A;  5ADX A;  1WOQ A;  3CIP A;  1BO5 O;  1KAY A;  4AM6 A;  1V4S A;  3IUC A;  5TKY A;  3R3L A;  5HL7 L;  1TUY A;  2ZGY A;  5BN9 A;  1ZC6 A;  5AQV A;  3VMF B;  4DKW A;  3QML A;  4IO9 L;  3CC7 N;  4H0T B;  4PL7 A;  3Q7C A;  2NLX A;  4KH6 A;  4BRA A;  2QWN A;  5KPR A;  2P9P A;  3GL1 A;  2V7Y A;  3OHR A;  1KD1 O;  3KK7 A;  2HOE A;  1GLJ O;  4CBW A;  4EFH A;  3VER A;  5AQQ A;  3DLL L;  1HX1 A;  4GVE A;  3EE9 A;  1BOT O;  4AM7 A;  1M1K O;  4BGA A;  3FZH A;  3A5L C;  2NRH A;  5ELZ A;  5H1S Q;  3CD6 N;  2NRT A;  4IEI A;  1U6Z A;  2ZJR L;  1YF5 L;  4H03 B;  2YHW A;  4BRE A;  2JWK A;  4JKH A;  4M7X A;  4BRD A;  4DQ8 A;  2YHX A;  3VF6 A;  2FSN A;  3QIC A;  1GLD G;  2FF6 A;  1BG3 A;  3D6R A;  4MLH A;  4A62 A;  4BG9 A;  4BRG A;  1QQO A;  2QI2 A;  2D4W A;  3SJH A;  1NGJ A;  3VEW A;  5GAD P;  1RDW X;  4BRI A;  5I9E B;  3PIO L;  1YJN N;  1Q7Y O;  4H5W A;  4JK9 A;  4ISG A;  1GLA G;  5AQL A;  1LCU A;  3DXK B;  4CBU A;  3HM8 A;  4GV6 A;  3FZK A;  4JKE A;  3GE1 A;  3QB0 A;  5AQW A;  3VEN A;  3E9P A;  1BUP A;  1LOT B;  5AQP A;  3SMP A;  2QA4 N;  3U9D A;  3F9M A;  1JJ2 M;  3VGM A;  3ID8 A;  3IKM A;  5C2D A;  3WXJ A;  3VEX A;  2OTL N;  3UB5 A;  5C10 A;  5AFU H;  4FWS A;  4A57 A;  3G25 A;  4JK8 A;  3SBG A;  2W41 A;  3NVK A;  1H1V A;  3AGK A;  3K9J A;  1HUX A;  3IDH A;  2BUP A;  4NLB A;  5KPZ A;  3BP8 A;  1Q82 O;  4IOA L;  4H5V A;  4BC3 A;  4BR2 A;  4BR4 A;  4JNE A;  4B1W B;  3H46 O;  4WFN L;  3ATV A;  3DWL A;  2CGK A;  3IMX A;  4FOE A;  5DM6 L;  3D2E A;  3K9K A;  3I33 A;  3ZET B;  3VOV A;  3IFR A;  3H1Q A;  1TYQ B;  3FZL A;  2E8A A;  3N4P A;  2YJF A;  2NRX A;  1T6D A;  2IIR A;  5AQZ A;  1X9J A;  5AZI A;  2ZF5 O;  2ASP A;  3BEX A;  3U4L A;  5BPL A;  1E4F T;  4H0Y B;  3CXC M;  4CZH A;  1WUA A;  3EKS A;  4BY9 C;  1IG8 A;  4JAX A;  2HBK A;  4FWL A;  3SAG A;  2HBM A;  3I55 N;  4MDB A;  1QQM A;  4FPB A;  3C7N A;  4GNI A;  1ATS A;  1OVY A;  4XH5 A;  3CPW M;  2A6A A;  2P9I A;  4JKC A;  3HBT A;  1T3V A;  4XH4 A;  4EAH D;  1JCG A;  1EO1 A;  2P9N B;  3FGU A;  5EOY A;  2P9K A;  4UY8 O;  3C0B A;  1NGD A;  3SLC A;  3MCP A;  4MO4 A;  4U7B A;  3DAW A;  3HOS A;  4H0O A;  4J8F A;  2GUP A;  3E1Y A;  5M1F A;  5F1X A;  2DPN A;  2WC9 A;  2QW9 A;  2GEM A;  3FZM A;  3GG4 A;  3O80 A;  2F9T A;  4FO0 A;  3WXL A;  2RHK A;  4JKB A;  4PKH A;  1NGF A;  3W3D A;  2P9U A;  5GIO A;  5AQT A;  5AQX A;  3MN7 A;  4I6M B;  1HLU A;  1NGB A;  3DXM A;  3VET A;  3UKU A;  1NLV A;  3O9T A;  2I7P A;  4FWR A;  4JKG A;  3CQY A;  3VF4 A;  2NZT A;  4CBX A;  4BRH A;  2V52 B;  5C2F A;  3MWT A;  3JS6 A;  3R9P A;  3WT0 A;  4BC4 A;  2VYP A;  3OA9 A;  4YOW A;  5AR0 A;  5EX5 A;  3EO3 A;  3LDO A;  1NGE A;  5AQN A;  2FF3 B;  4H0V B;  1IJJ A;  2VWB A;  2YI1 A;  3ZEU A;  1SZ2 A;  1RGI A;  3LDL A;  4PKG A;  1VQM N;  4JHD A;  1VQP N;  2ZWH A;  1Z05 A;  3CJ7 A;  3O1W A;  1RFQ A;  1R59 O;  3O9U A;  1KAX A;  1HKB A;  2YHY A;  2FSK A;  4MLE A;  2V7Z A;  1U2V B;  4JKF A;  3H1V X;  4E1J A;  2A41 A;  4NO7 A;  4GV9 A;  4LC9 B;  2NNW A;  2IVN A;  1QZ6 A;  2D0P A;  4U67 L;  4WQ4 C;  2QEX N;  4KH4 A;  4QS9 A;  4JK7 A;  3CCU N;  3D2F B;  2E2P A;  2D0O A;  5LJV A;  2E2Q A;  3EE8 A;  1K8K A;  4WFA L;  1KC8 O;  1DT9 A;  3QBX A;  1QHA A;  3OBW A;  3GBT A;  4WCE L;  1QVF M;  3CCV N;  1YIT N;  1W97 L;  1VQ9 N;  2OTJ N;  2HMP A;  2GWJ A;  1JCF A;  3G71 N;  1C0G A;  2WUS A;  3SK3 A;  4Z94 A;  4IZ9 A;  2IVP A;  1ZXO A;  2E2N A;  4B1Z A;  4CD3 A;  5JLF A;  3I56 N;  3HTV A;  3CCR N;  4WYB A;  1NGI A;  4CZI A;  4FVU A;  3ATU A;  3A8Y A;  4BC5 A;  2WBN A;  3F5T A;  3L0Q A;  3C65 A;  3E9O A;  5FPD A;  2I7N A;  5AQU A;  3ENH A;  4FWQ A;  4FWP A;  4BR0 A;  1VQO N;  4CZF A;  4AF1 A;  4CI6 A;  4BRQ A;  4IOC L;  4CD1 A;  3QFP A;  3FFK B;  2QWR A;  2A3Z A;  1C0F A;  3SBT A;  3S41 A;  4IXC A;  3CME N;  1NGC A;  2KHO A;  2ITM A;  3NMU A;  2CH6 A;  1ILY A;  2CH5 A;  3M1F A;  5AQK A;  5AQR A;  5M1P A;  4ISF A;  4CZL A;  5ADX H;  4WQ5 C;  3QFU A;  3CPE A;  3A5M C;  4B1X B;  5KQD A;  5C0Y A;  3TSQ A;  1NGG A;  3FLC O;  3G6E N;  2V51 B;  4H0P A;  1O13 A;  3WEE A;  5EVZ A;  3I8B A;  2QWL A;  4JN4 A;  3MCA B;  3O9R A;  1YI2 N;  3TSU A;  3A0I X;  2A42 A;  3TU5 A;  3MDQ A;  1MDU B;  1XUP O;  2YX6 A;  1XQS C;  3VGK A;  2CGL A;  3CC4 N;  1QZ5 A;  4H5N A;  4ISE A;  4DHY A;  3DXK A;  4PL8 A;  4PKI A;  3CJA A;  1J6Z A;  1HPM A;  1Z6R A;  4OO1 J;  2NRW A;  5FPM A;  5EXW A;  4CZE A;  5BRH A;  5AQI A;  2Q97 A;  5AZJ B;  4K43 A;  1YXQ A;  3CJ9 A;  4DCH A;  3EKU A;  5JVH L;  3ENO A;  1VQN N;  3CCE N;  3AGR A;  2P9S B;  4IJN A;  4ILH A;  3E66 A;  3LDN A;  4B1Y B;  4RWT A;  3H3N O;  3T69 A;  5AZI B;  1BU6 O;  2QWP A;  3O9Q A;  3R8E A;  4BRF A;  3PLA A;  5KQ8 A;  5AQY A;  5GIP A;  2Q36 A;  1T44 A;  4BR5 A;  3WXK A;  3ULE B;  2Q1N A;  1NJI O;  1M90 O;  3BF3 A;  1S72 N;  2E88 A;  4BRL A;  3ZET A;  4BG8 A;  4IEE A;  3O08 A;  3B8A X;  2QM1 A;  4NLC A;  2H3G X;  4BR7 A;  1DKG D;  1TYQ A;  1MWM A;  1G99 A;  3P39 A;  4BR9 A;  5JVG L;  1E4G T;  2YCH A;  4H5T A;  2E20 A;  3LDQ A;  3L6Q A;  3J7Z O;  2J4R A;  4GY2 B;  4IOX A;  4FWN A;  1VQK N;  3M3Z A;  1BA1 A;  3ENB A;  3UKR A;  3VEZ A;  5M1Q A;  3A5N C;  5JLH A;  1YAG A;  3TTF A;  2P9L A;  4A5A A;  2UYT A;  4PHT X;  4JD2 A;  2FSJ A;  3VEV A;  3PIP L;  1QVG M;  1S3X A;  5MLC Q;  2NRZ A;  4JKD A;  3U9Z A;  1D4X A;  1SQK A;  1GLB G;  1GLE G;  2CGJ A;  4CZJ A;  3W0L A;  3HI0 A;  3QDK A;  3UE5 A;  1YJ9 N;  3EZW A;  1VQ7 N;  2P9N A;  4ILG B;  5CR4 A;  4IFE A;  3HOT A;  1RDU A;  1NMD A;  3WXM B;  1EQY A;  2KLA A;  3ZX0 A;  1BWF O;  4YOX A;  1BA0 A;  4O8K A;  5GAE P;  4Y0W A;  2A40 A;  4OPA A;  1GLL O;  3O9S A;  4K41 A;  2VGM A;  4WQ5 A;  3CF5 L;  2QWM A;  1Y64 A;  3AAP A;  3KHY A;  4C1N I;  1QQN A;  3KVG A;  2ZJQ L;  2QXL A;  3CJC A;  3MX2 A;  3P38 A;  5FPE A;  1Q18 A;  3RSE B;  3CMA N;  1VQ6 N;  4JKA A;  2NRR A;  2WFB A;  3MX5 A;  4I6M A;  4MDA A;  4CZM A;  4BGB A;  5BR9 A;  3JXU A;  3O1B A;  3CC2 N;  2ZGZ A;  4KBO A;  4EHT A;  3GOI A;  3WQT A;  1X3N A;  5JMV A;  4YOY A;  5KPT A;  2YJE A;  2GX9 A;  2QWQ A;  3LDP A;  3VPZ A;  1NGA A;  4K42 A;  2A5X A;  3WXI A;  3OW2 M;  4BQZ A;  2P9P B;  3LM9 A;  3M5R A;  3HSC A;  5AQS A;  3LM2 A;  4R79 A;  1SS6 A;  5BPN A;  5DM7 L;  4A2B A;  3CI5 A;  1YJW N;  3WUH A;  2FLO A;  4YDU C;  5BRD A;  4O8U A;  3OBY A;  1SAZ A;  2E1Y A;  3O4W A;  3EL2 A;  3D2F A;  1T6C A;  4O5F A;  1YHQ N;  3MMV A;  5AFU A;  4FSV A;  3VTI A;  2Q2R A;  1HJO A;  2OAN A;  3P31 A;  3SAF A;  5AQO A;  2D1K A;  1VQL N;  2Q31 A;  3AY9 A;  1VAZ A;  3M6G A;  2NRV A;  1K73 O;  2VCP A;  1K9M O;  4H5R A;  3TTD A;  5GAH P;  2W40 A;  3WQU A;  2QWO A;  3AAR A;  4H0X B;  4RCH A;  4BC2 A;  2KKZ A;  3GDQ A;  3TPQ A;  1VQ4 N;  1MWK A;  3P4I A;  4WFB L;  4CZG A;  1YIJ N;  3KWI A;  4RTF D;  1P8Z A;  3MK6 A;  3MN5 A;  3BUZ B;  4ILJ A;  5BN8 A;  3WEE B;  3CCM N;  3H45 C;  4HTL A;  3ZX2 A;  4FPA A;  5AQG A;  5F0X A;  2GWK A;  3NVM A;  3CCL N;  1ATR A;  2PFU A;  3CJB A;  5LY3 A;  1KXP A;  3CJ1 A;  3LL3 A;  4FL9 A;  5BRF A;  4FOI A;  3VEY A;  1N8R O;  4FWK A;  2HST A;  4M7Y A;  5E84 A;  3VGL A;  1K8A O;  1DEJ A;  3D2E B;  3HRG A;  4FWM A;  1MA9 B;  1ZBS A;  4IWV A;  4BRN A;  1NGH A;  4YOT A;  3R1X A;  2PAV A;  1KAZ A;  3SMS A;  3ZX3 A;  5M1N A;  5F2R A;  4XEI A;  1P90 A;  1JCE A;  2JWL A;  4B9Q A;  1Q81 O;  2VGN A;  3KWG A;  5EY4 A;  2GEL A;  4L3Q A;  4QS7 A;  3T7Z A;  1OKJ A;  1V4T A;  3CCQ N;  4WQ4 A;  3MN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...