4BC3A

Crystal structure of human d-xylulokinase
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
525
structure length
525
Chain Sequence
RRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords XYLULOSE KINASE
publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
total genus 185
structure length 525
sequence length 525
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc3A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc3A01
4YDUC 2P9LA 1J6ZA 3O4WA 4IJAA 4BR4A 1DEJA 3VENA 3IDHA 1YUWA 4BR7A 5F1XA 4HTLA 1NGJA 3MCPA 1RGIA 4A2BA 4PL8A 3FLCO 2FXUA 3QICA 4A2AA 4J8FA 3EKUA 1QQOA 2CGJA 5AZIA 2HF4A 4BR0A 3GE1A 2QWOA 4B1UB 3A0IX 2NZTA 2BTFA 3A5OC 1NM1A 4BC5A 1OKJA 3KHYA 3WUHA 1YVNA 4H0OA 1JCEA 2NLXA 5BPMA 3RSEA 3IMXA 1BU6O 3VEOA 5FPEA 1ATSA 4QS8A 5AQVA 5AZJA 4EFHA 4BRHA 3MDQA 3CI5A 1T6DA 1TYQA 2Q0UA 2P9SA 3D7EO 1GLAG 1ZC6A 2A41A 4AM7A 4FWOA 3DXKB 1ESVA 3QFPA 2CH5A 1CZAN 4MO5A 2CH6A 1Z6RA 2P9IB 1SAZA 3C7NB 3ENHA 3WT0A 1U6ZA 1MWMA 4BR9A 4O5FA 3ID8A 4FSVA 3FGUA 4CJ7A 2ASMA 4FPAA 3DAWA 2V7ZA 2Q31A 3LDLA 1NGIA 1QHAA 5AQKA 4EIAA 3QB0A 2VWBA 3CJBA 4Z94A 1T6CA 2HMPA 2AP1A 3CIPA 3IFRA 4PKIA 3VEWA 1BG3A 1IJJA 1QZ5A 5AQGA 1E4GT 3ATVA 5AQQA 5EX5A 3KVGA 3UKUB 1JCFA 2IIRA 4ISEA 2VYPA 1GLCG 1V4TA 3HTVA 3FZKA 1NBWA 4B1ZA 3QMLA 5ADXH 3AAPA 4BRPA 3A5LC 3J8AA 1X3NA 4H0YB 1QQNA 1P8ZA 3BF1A 2YHXA 1WOQA 2A40A 4XH1A 5AQJA 1NGAA 5EVZA 3ZETA 2P9NB 4RWTA 5AQWA 2CGKA 1RFQA 5AQZA 1DGKN 2P9UB 3U9DA 3VEYA 2D0PA 3W0LA 1XUPO 4BG9A 4MLEA 3ZEUA 4BRDA 4H5VA 1HUXA 4BRAA 4DHYA 4H0TB 4O8KA 3R6MA 4M7YA 3D2EA 4BRLA 2D0OA 4CZJA 5AQRA 1LOTB 3A8YA 3EZWA 4WQ5C 4BRKA 1KAZA 1NGCA 3BUZB 3VF4A 4JD2A 4GNIA 1K8KB 5TKYA 2P9PA 1NGEA 3UKRB 5KPTA 4BRQA 5BRDA 4BR2A 3EN9A 2NRHA 3A5MC 4GY2B 3P4IA 3MK6A 4L3QA 5B8HA 3M1FA 2ZF5O 2P9KB 3F9MA 1GLEG 4BGAA 3LDNA 3EL2A 2E20A 2HF3A 2IVNA 2Q97A 4F9OA 3I33A 3MN9A 5E84A 3CJ1A 3GL1A 4FWKA 4ISGA 4FWMA 1NGFA 4H5TA 3FZFA 1KXPA 3VETA 3MMVA 5LJVA 4IXCA 5AZIB 4E1JA 3FE1A 2V52B 2FSKA 3H6EA 5KQ8A 1RDWX 4FL9A 5F2RA 1T44A 3DXMA 2E88A 2ZGZA 3U8XA 3B8AX 3C0BA 3SMSA 2E8AA 4ISFA 5I9EB 1SZ2A 1C0FA 4K41A 1GLFO 1NMDA 5JLFA 2DPNA 1TYQB 3H3OB 1S3XA 4RTFD 4CBUA 2OANA 4CZEA 2J4RA 5LJWA 4A62A 5AQHA 3O1BA 1DKGD 4CZKA 4IWVA 5E26A 1NLVA 3MN7A 5AQIA 1GLLO 1Q18A 3EKSA 1E4FT 4WYBA 3QBXA 3VERA 5FPMA 5BR9A 2W40A 4CD3A 3EO3A 2YCHA 3ATUA 4JN4A 5KPRA 3GOIA 3D2FB 3CJCA 3CQYA 2ITMA 5AQTA 2QWMA 2P9IA 4BRMA 4KBOA 2A3ZA 3C7NA 4FWLA 4IJNA 1HKBA 2I7NA 3BF3A 4CBWA 1HLUA 5KPZA 1BDGA 1GLDG 3AAQA 4WQ4C 5AR0A 4B1VA 4H03B 2D1KA 3CJ7A 4Y0WA 4NB4A 1SQKA 3DJCA 4H5WA 4EHUA 4FWSA 2QWLA 2QWQA 4CZIA 3A5NC 2E2NA 4FO0A 3VPZA 5AFUH 3VEXA 4BROA 3UB5A 3MN5A 1BA0A 4BGBA 3H3NO 4FWNA 4MLHA 3QDKA 5LY3A 1HKCA 3WXLA 5BPLA 2QWRA 1S22A 2F9WA 3ULEB 2KHOA 3FFKB 1NGBA 4FOIA 2QM1A 4C23A 4CZGA 2WUSA 3WEEB 3KZBA 3VGMA 2E2OA 4JHDB 3ZETB 1YXQA 3ENOA 4FWPA 4BR5A 4FWQA 3QFUA 3MN6A 3HSCA 2QWPA 5EY4A 3U9ZA 5AQLA 1U2VB 3O6WA 4K25A 2ZGYA 4K43A 1BA1A 1BUPA 1GLBG 4JAXA 2P9NA 3D2EB 4CZFA 5KQDA 1IG8A 3SJHA 2YHYA 4NO7A 5BRHA 2P9UA 1TUYA 3VOVA 1V4SA 4M63C 3I8BA 4BQZA 4BRFA 3VF6A 2FSJA 3O8MA 2W41A 2QWNA 4H0XB 5AQUA 2YJEA 3CQXA 3VEVA 2V51B 1MWKA 4B1XB 4PL7A 2P9LB 4BC4A 3DWLA 1R59O 3JS6A 2FSNA 4I6MA 4QS9A 3WXKA 3UKRA 4BRIA 2VCPA 2BUPA 4FPBA 3FZLA 3VGLA 1X3MA 2A6AA 1MDUB 3ZX2A 4FWRA 1GLJO 2E1YA 3BEXA 2FF6A 4LC9B 3VGKA 2P9KA 4WQ5A 3O5BA 5EOYA 4CBXA 3GBTA 1ATNA 1XC3A 4A61A 4BC2A 4DQ8A 2IVOA 3CJ9A 1KAXA 4QS7A 5ADXA 2GUPA 3ZX3A 4XH5A 4B1YB 4BG8A 4CZLA 3H46O 4H5NA 5AQFA 3R8EA 1ZBSA 4CI6A 2GTDA 2D4WA 4YDUA 4XH4A 3DXMB 4JNEA 3RSEB 3TU5A 1G99A 5AZJB 5AQMA 1NGGA 2E1ZA 2AA4A 2ASOA 1KAYA 2P9SB 2IVPA 2CGLA 5AQOA 3U4LA 4PKGA 4CD1A 3AARA 2UYTA 3S41A 5F0XA 3VEZA 1QZ6A 4BC3A 1X9JA 2GWJA 3WXIA 2E2QA 2Q1NA 4EHTA 3CJAA 1EQYA 3VF2A 1HKGA 4BVPA 3L4IA 2A42A 3VESA 3HI0A 4BRCA 4IO8A 4BREA 3SLCA 3DXKA 3CETA 3HZ6A 5AQPA 5JICA 2Q2RA 2HOEA 2Q36A 3O08A 1BO5O 5JLHA 3CHWA 3WQTA 4FOEA 4BQLA 4HWIA 2QW9A 3O80A 3AY9A 2I7PA 1NGDA 2GWKA 4H5RA 5CE3A 2ASPA 3HBTA 1C0GA 3SMPA 3D2FA 5JMVA 3WXJA 4DCHA 1BWFO 2FF3B 3G25A 3GG4A 4H0PA 3FZHA 4CZHA 4PKHA 3FZMA 3UKUA 3LM9A 5AQYA 5FPDA 4XEIA 3L0QA 3LL3A 3LM2A 2FLOA 2GEMA 3QBWA 3L6QA 3UE5A 2ZWHA 3H45C 3IUCA 4BRGA 3LDOA 4B1WB 4DB3A 5ELZA 1ZXOA 4WQ4A 5AQXA 1ATRA 2EWSA 3H1VX 2YHWA 3SK3A 3TPQA 3O1WA 3ZEUB 3ULEA 2V7YA 2A5XA 4EAHD 4B9QA 2GELA 3CERA 5BREA 1QQMA 2YI1A 4H0VB 5AQNA 3WEEA 5BN9A 4CZMA 2Q0RA 5EXWA 1HPMA 4JHDA 1BOTO 2E2PA 1MA9B 4JD2B 5AQSA 1TUUA 1NGHA 2P9PB 2F9TA 3ZX0A 3BP8A 1U2VA 4BVOA 3OHRA 5BRFA 2H3GX 3FR0A 4MO4A 4AM6A 3M3ZA 1D4XA 3H1QA 2PAVA 5FPNA 1HX1A 2QXLA 4K42A 1K8KA 1LCUA 1Z05A 1XQSC 1JCGA 2PBDA 3W3DA 3GDQA 1YAGA 4I6MB 1H1VA 4RCHA 3HM8A 4IZ9A 3JXUA 3R9PA 5BPNA 1NWKA 1HJOA 3WQUA 4M7XA 5BN8A 3LDPA 1WUAA 1Y64A 3LDQA 5AFUA 3M6GA 2YJFA 4BRNA
chains in the Genus database with same CATH superfamily
5JVHL 1J6ZA 4IJAA 1VQ6N 1DEJA 3HP9A 3K9KA 3O4QA 1W0HA 5F1XA 1HNVA 4HTLA 2IGIA 3CXCM 3TTDA 3ISNC 1QQOA 1M1KO 5AZIA 2HNDA 2HF4A 1HYZA 1Q81O 4BR0A 4M3RA 3GE1A 1RILA 2BTFA 3A5OC 3OYMA 1NM1A 2RPIA 1TKXA 1VQKN 1YVNA 4H0OA 2NLXA 1WSGA 3G71N 4WFAL 2ZJQL 1LW0A 5FPEA 5AQVA 3QESA 3AVHA 4Z4GA 4YY3K 1TYQA 4CK1A 2G8WA 2D0BA 5AJ3K 1MU2A 3U3GA 1GLAG 3LAKA 4FLYA 1ESVA 2G8VA 1CZAN 4MO5A 2CH6A 4AHCA 1QS4A 4DSJA 3ID8A 5I42A 3FGUA 4CJ7A 4FPAA 3DAWA 1NGIA 2NRTA 4B8CA 4JI0K 3SBTA 4E1MA 3QINA 1HNIA 3CIPA 4O55A 2QK9A 1QZ5A 4KTQA 1S9GA 3OYDA 3ATVA 5AQQA 4MQ3A 4FVUA 3UKUB 3CCUN 2IIRA 4M3ZA 4KFBA 1GLCG 3LWLA 1V4TA 3HTVA 2O8BA 3FZKA 3ZT4A 2WFBA 4DV2K 3QMLA 4BRPA 3A5LC 1S1TA 3V81A 3OYFA 4JK7A 1P8ZA 3K9JA 1WOQA 4XH1A 4CEDA 1TKTA 5EVZA 3DLHA 4IEIA 3ZETA 3EZ5A 2YNIA 3DLEA 4DQRA 3VEYA 4YNQA 1VSKA 4GKJK 2O8CA 3VTHA 3OTOK 4E7JA 4FVMA 4BG9A 1Q7YO 4MLEA 3ZEUA 3ZSVA 2Y1IA 1L5UA 2GX9A 1C6VA 3D2EA 4BRLA 4CZJA 2Q3SA 1LOTB 5AQRA 3EZWA 4WQ5C 3ID6A 3I8DA 3TTCA 4FM2A 2VWKA 1Q8IA 2HBLA 4PHTX 4FJGA 2ZJPL 4GNIA 1K8KB 3THWA 3TAQA 3NF6A 1KLNA 3UKRB 4BRQA 4BR2A 3HOTA 5FDLA 2NRHA 4CJTA 3P4IA 4L3QA 4CJ3A 5GADP 3RTVA 3QNOA 3U6FA 1WSIA 3C6AA 4LD0A 3D6RA 3OW2M 4LFAK 1WLJA 5E84A 3CJ1A 4FWKA 3HXMA 3SPYA 3LAMA 4FWMA 4MFBA 2RF2A 3C94A 4EP4A 3TANA 2IS3A 2OZSA 3OYJA 4FLXA 4FJNA 3V1OA 2AJQA 1T44A 1X9MA 3DXMA 4DTRA 3SJJA 2HHUA 3DYAA 3C0BA 1VSIA 2E8AA 1BIUA 3V9XA 1TL1A 2QEXN 3QO9A 1C0FA 1TK5A 1NMDA 1Z26A 4CJEA 3AA4A 1M90O 4E89A 3H3OB 3CCSN 4RTFD 5LJWA 2J4RA 5AQHA 4O44A 3O1BA 1QSLA 4IWVA 1NLVA 5JS1A 1E4FT 3DLGA 3QBXA 4N41A 2PY5A 2W40A 2YKNA 3K57A 4KB0A 3VQBA 3GOIA 4CJVA 4N76A 1W2BM 4BRMA 2E6LA 2A3ZA 1TL3A 3ZSZA 4LSNA 1HLUA 5KPZA 4CEOA 4WQ4C 4DQQA 3QEPA 3RRGA 4B9LA 4HTUA 1XMOK 4EHUA 4KHYA 4C1NI 3A5NC 4FLWA 1JXEA 1CXQA 3TTFA 1HYVA 3VEXA 4M3XA 3T19A 1KLMA 5HOOA 3DOKA 3MN5A 4FWNA 1O1WA 4K0KK 3OY9A 3WXLA 5DK5A 3FFKB 4FOIA 4W5OA 2QM1A 2YNGA 4C23A 1VSMA 5DM6L 3EE8A 4CEEA 5CYMA 1KCFA 2E2OA 3QERA 1K9MO 3RMBA 4CFDA 1TV6A 3QFUA 1RTIA 1IH7A 3U9ZA 3O3GA 3NH1A 3OS0A 4NLCA 4K43A 1NK5A 4Z4HA 3NGZA 1U49A 1BQMA 4NO7A 5BRHA 1TUYA 3VOVA 1V4SA 2YNHA 1ILYA 1WSFA 3L2QA 1KSPA 5DMRA 4CW7B 2DFFA 5AQUA 4CK2A 3VEVA 3HPOA 3CF5L 1RBTA 3RMCA 4AQYK 4B1XB 4BC4A 1C0UA 3UKRA 1X3MA 3THYA 5IT9O 4F3OA 3ZX2A 5GIOA 1GLJO 1FKOA 2E1YA 4A5BA 2VGMA 3A2FA 4WQ5A 4F2SA 2F4VK 4GKKK 5LL6Z 4DQ8A 1KAXA 2G8IA 4F2RA 2F8SA 4CF1A 3AGKA 3VQCA 1ZBSA 4Z4FA 3AO1A 1FKPA 2B4JA 4JNEA 3L3UA 5AZJB 1RCHA 5AQMA 3TWHA 3LP2A 5T7BA 4ILJA 3NH0A 1KAYA 1S1UA 3HP6A 3AARA 1L3UA 2UYTA 3S41A 1QZ6A 4BC3A 2GWJA 4CECA 3WXIA 2Q1NA 3G4SN 1IKVA 4PQUA 2A42A 4LF4K 4BRCA 1W7AA 4IOXA 4BREA 3V9UA 4YHHK 4CGDA 4G1QA 3NF7A 5MLCQ 4BWMA 3HZ6A 4DQIA 5JICA 2Q2RA 3O08A 4JYAK 4AILC 1ASUA 3LPUA 4BQLA 1BHLA 4E7LA 3SAGA 3UIQA 4H5RA 5CE3A 1U47A 4WF9L 1A5VA 4JS4A 4CGFA 4DCHA 4I7FA 4LF8K 3HPGA 3GG4A 4H0PA 1RT6A 3FZHA 5DM7L 4DTXA 1I94K 3J81O 4E7KA 5FRMA 3IRXA 4CHNA 3L8BA 1WAJA 3L0QA 3LL3A 1OH5A 2FLOA 4DR3K 3Q7CA 1RTHA 2ZWHA 3ENBA 4CJFA 5GAHP 4F4KA 4Z0UA 4DB3A 3LDOA 3CG7A 4WQ4A 4KH4A 1ATRA 2EWSA 1TK0A 4ILHA 3TPQA 3MXMA 3HL8A 3LALA 4QOZB 2A5XA 1ASVA 2NRXA 4FJ9A 3CERA 4RW4A 5AQNA 4CZMA 2BDPA 2Q0RA 3CC7N 4PY5A 4DV1K 1BOTO 1SL1A 4JD2B 1NGHA 2ZJRL 3ZX0A 4BVOA 4OPHA 3MX5A 3M8RA 1D4XA 1DLOA 5FPNA 1EP4A 4NCGA 2FC0A 1KFDA 4CCHA 2WOMA 4ELTA 5C24A 2HMIA 2O8FB 1JCGA 3KK1A 1XMQK 4I6MB 1SL0A 4IZ9A 1VK0A 1NWKA 3KKRA 4EZ6A 2EX3A 4B9SA 1DT9A 3LDQA 4OJRA 4YDUC 1G15A 3O4WA 4BR4A 2HVHA 1RDUA 4JK9A 1NK0A 3ZCMA 1NG9A 3SNNA 1J9AA 2NRRA 1D8YA 3JAMO 3HRGA 4A2BA 3FLCO 2FXUA 4I2PA 2CGJA 2XRIA 1HRHA 2W6KA 4CJSA 3P39A 4C8OA 3A0IX 2NZTA 4IBNA 3KHYA 3AV9A 1JCEA 2R7YA 3IMXA 2RHKA 1ATSA 1Q9YA 3PSIA 5AZJA 4BRHA 3MWPA 1RNHA 1T6DA 1J53A 2Q0UA 1S6QA 4GV9A 1ZC6A 1UA1A 1X1PA 4CF2A 3DXKB 2BGGA 5GAGP 1TKDA 4CHPA 2CH5A 3H08A 2P5GA 2O8EA 1Z6RA 3RRHA 3CCVN 3O3FA 3KLFA 1L3TA 1U6ZA 3CCEN 1MWMA 3LZIA 1L3VA 4FSVA 2PYJA 2RKIA 4DR6K 2HHHK 4KHSA 3VQ4A 3WNEA 3AO3A 1VQ8N 2HBMA 2VWBA 2HMPA 3IFRA 5EX5A 3KVGA 4LH4A 4YORA 5M1PA 3HK2A 4O0JA 2VYPA 5J2NA 1RTJA 4E1NA 4H4OA 4DTOA 3KWGA 1NBWA 4DTMA 4DV3K 5ADXH 2XY6A 3AAPA 4CJQA 3F73A 3J8AA 3LANA 1X3NA 3WNHA 1YITN 3U3YA 1QQNA 1YJNN 1VSEA 2A1RA 3BF1A 4WFBL 4E7HA 3K2PA 1JLFA 3VQPA 4PWDA 3AA3A 5GIPA 5KGWA 1KFSA 5AQWA 2CGKA 1RFQA 3ZYYX 2OTJN 3NGIA 2D0PA 4JKCA 3THXB 1XUPO 3C6UA 4M3UA 4M3YA 2KLAA 4FW2A 3TARA 4DHYA 3QEWA 5JVGL 3A8YA 3DRPA 4W5QA 1KAZA 5D3GA 4DQPA 4JD2A 4IG0A 3N4QA 1NGEA 2BE2A 3BY5A 3A5MC 4JKHA 4IO9L 1WN7A 5B8HA 4KTWA 5HBMA 1Q82O 3MWTA 3G6EN 2G8HA 3C95A 4JI3K 4CJWA 5TKWA 2O8FA 1B92A 2QI2A 2IVNA 4F9OA 2D5RA 3DI6A 4JRQA 3I33A 3MN9A 1SKRA 3C6HA 4DSEA 2YX6A 1NGFA 4H5TA 3FZFA 3CFRA 4BDYA 4FCYA 3VETA 3BZKA 3J7AP 5GAEP 3QETA 4CFCA 5HL7L 1OVYA 2XY8A 4CFBA 1QVGM 2FSKA 1RDWX 4FL9A 2IAJA 1GOBA 2ZGZA 3I0RA 3JYTA 4YFUA 4FXDA 2F8TA 3ZT0A 3SMSA 5I9EB 5HROA 1NK9A 4ICLA 1RT7A 3NVKA 4JI1K 1S72N 1VQNN 3B6PA 3MEDA 1QTMA 4CZEA 1HR0K 4IOAL 3CPEA 4CZKA 2F96A 1IBLK 1EXQA 1T7PA 5E26A 4CHYA 2JLEA 3AVFA 4JV5K 4U67L 2PFUA 3VERA 2UXDK 4LFCK 1J5OA 2XY5A 4GV3A 3TSPA 1YF5L 3ATUA 4FZZA 1FXXA 3CJCA 4OKKA 2ITMA 1VQLN 4CFAA 1RT1A 4FWLA 3CQ8A 1HKBA 1WNSA 4B9NA 4IDKA 3OJUA 3AAQA 2FBYA 4OKEA 4CF0A 4CVNE 5HLFA 1HNZK 4UQGA 4H03B 4Y0WA 2E5LK 1F21A 2VQFK 4DR1K 4H5WA 3NHGA 4FWSA 4NCAA 4FO0A 4FJLA 4Z4CA 5SWMA 3DLBA 5HRRA 3T3FA 3PX4A 3OYAA 2KTQA 1BA0A 3SAHA 5LY3A 3NCIA 2QWRA 4CGJA 2F9WA 4FJXA 1EO1A 2KHOA 1NGBA 5LMNK 4V19S 3RWUA 2DTUA 3KZBA 2KZZA 4EP5A 4B9UA 1HJRA 3ZSOA 4DUZK 4DSLA 3MN6A 2FBVA 4DSIA 4M42A 5EY4A 5HRNA 1N6QA 3O6WA 5J2PA 2HHSA 2ZGYA 3ZT3A 2NRVA 1BA1A 1GLBG 4JAXA 4ZTJA 1IG8A 3SJHA 3LWMA 4NCBA 4FZYA 1HNXK 2LSNA 4DU1A 3AA5X 1X9SA 3S9HA 3VF6A 3VQQA 4JKBA 2X6SA 1VQ7N 4MDAA 3LDSA 4JI8K 2OPSA 3PX6A 1KVCA 1BQNA 2OZMA 2X6NA 3WXKA 4X64K 2VCPA 3I55N 4FPBA 3FZLA 4C8MA 4JEPA 2XO7A 1W9HA 4C8NA 3E9LA 1W97L 3P83D 4CJPA 2UU9K 5EOYA 4BC2A 3QIPA 1VSLA 4QS7A 4CK3A 5ADXA 2GUPA 4CESA 4JKFA 4BG8A 4CZLA 3H46O 3R8EA 2O8DB 2VG6A 1VQ9N 2VWJA 4XH4A 4B8AB 3NFAA 1XI1A 4CGGA 5FRNA 2IOCA 1NJXA 4DR7K 2AA4A 1XC9A 2P9SB 2CGLA 2W42A 1Q86O 4JKGB 4CD1A 4J2AA 4DF8A 5C42A 2E2QA 3CJAA 4X66K 3QEXA 4JI7K 1RT5A 1C1CA 4IO8A 3SLCA 4CEBA 3SPZA 3CETA 1Q9XA 4LF9K 4JS5A 3KTQA 3CHWA 3WQTA 1YI2N 3AY9A 4KH5A 4E3SA 2HHXA 1NU0A 1YHQN 2ASPA 3SQ1A 3SUQA 1NKEA 5KGXA 1NKBA 2UUAK 3G0ZA 4JK8A 4I2QA 5JMVA 4LSLA 3G25A 5H1SQ 2XHBA 4DU4A 1SKWA 3NF9A 4CZHA 4AF1A 3CC4N 3AO2A 3UKUA 2KKZA 3DLLL 3NAEA 2Z1HA 4KB1A 4B08A 4OPAA 4XEIA 3LM2A 2GEMA 3QBWA 1WSEA 2WC9A 3RR7A 1BI4B 4CIGA 4GVMA 4BRGA 4B1WB 1N34K 2KW4A 5ELZA 1ZXOA 1CZ9A 4DMNA 4DTJA 1RBSA 4N5SA 4DR4K 3AVKA 4R5PA 1VQ4N 3HYFA 4LFBK 3P38A 1JLCA 3SK3A 4FJ8A 2GV9A 2V7YA 2GELA 3I56N 2EHGA 1QQMA 4H0VB 2YHAA 4FJMA 3CCQN 5BN9A 5EXWA 1HPMA 3HPHA 4B3RK 2D0AA 1VQ5N 1EWRA 1MA9B 3HVTA 2P9PB 3IAYA 2F9TA 2PZSA 3BP8A 4M45A 1YJ9N 3OHRA 5BRFA 1K6YA 4Y1DA 4AM6A 3DOLA 3TAPA 4K8XA 2QXLA 3EEQA 3MECA 3CFPA 1K8KA 3PLAA 1RBRA 1XQSC 2GBZA 4DV5K 3MEEA 1H1VA 3R9PA 3TAGA 3P1GA 3NBPA 3KLEA 4OPKA 1JLBA 5BN8A 1WUAA 1Y64A 3M6GA 4U7BA 1RDBA 4LF7K 1TAQA 4FM1A 2B5JA 3IDHA 1YUWA 3L4QA 4DV0K 1D9DA 4BR7A 3MCPA 2KZMA 1RGIA 1JLQA 3V4IA 4PL8A 4A2AA 4DS5A 4CJKA 4J8FA 3K5NA 2ITGA 4CJRA 4OKJA 2QWOA 4B1UB 4CHQA 4KH6A 4Q5VA 1XNRK 2O8DA 2RN2A 4Z4EA 2Z1GA 1OKJA 3HSTB 1ZBFA 3WUHA 4IFYA 5BPMA 1ZBUA 3ASMA 2B6AA 5M1KA 4IFEA 4QS8A 1DTQA 5SZTA 4ELVA 1KVBA 4LH5A 2UXBK 2P9SA 4FK2A 3SQ0A 2A41A 4JKGA 2WONA 4AM7A 1QSSA 3SQ2A 2DFEA 4CIFA 1U45A 2O4IA 3OYHA 3TSUA 4I9LA 1SAZA 3C7NB 4TSXA 3OBWA 4KO0A 4YOYA 3WT0A 1BCMA 4YOXA 4O5FA 3QLHA 3CC2N 2V7ZA 4DFKA 3LDLA 2I5JA 3DMJA 5C2FA 1QHAA 3L3VA 5AQKA 3MXJA 2NUBA 3QB0A 4X65K 1KQSM 2QKBA 1SL2A 3CJBA 4CEFA 1ZBIA 2AP1A 1LAVA 1YTAA 5AQGA 1E4GT 2HBKA 3C6TA 3LZJA 1X9WA 4ISEA 3TAMA 3ZSRA 3OS1A 1D9FA 4DF4A 4B1ZA 2OPQA 4JI2K 1JL2A 1A5XA 1B9FA 4H0YB 2ZM6K 3T1YK 2YHXA 2A40A 3KLGA 5AQJA 1BI4A 1NGAA 4KHWA 2P9NB 4RWTA 4HCBA 4RW8A 2HB5A 4KI4A 4OLBA 1DGKN 2P9UB 4CGHA 3F5TA 4O0IA 3HM9A 3W0LA 2A1SA 4IFVA 4BRAA 4M7YA 3AGRA 2D0OA 3KIOA 1VQMN 3T69A 4L8RB 3RMDA 2OTLN 5J2QA 3IKMA 1S6PA 3VF4A 4OO1J 4FLUA 3OJSA 2P9PA 3VQ8A 5KPTA 2QA4N 4ID1A 5BRDA 4H8KA 3ZT1A 4GY2B 3LP1A 1TK8A 2ZF5O 2P9KB 4NXMK 5M1QA 2KFNA 3PUFA 3D0PA 3LDNA 2HNZA 5HRPA 5KTQA 2HHVA 1N33K 3PV8A 4YOWA 3JSMA 4B9TA 1VAZA 1NJIO 1IBMK 1KXPA 4RW6A 1VSHA 3N4PA 2X74A 5CHIA 1OH7A 3AVBA 5AZIB 1S9EA 4OPJA 4CJUA 4E1JA 3O3HA 3FE1A 4J2BA 3KLIA 3HT3A 2OA8A 1XWLA 4DLGA 3OYKA 2E88A 1RDAA 3K0SA 3KK2A 4DG1A 3U8XA 3B8AX 1FJGK 1UOCA 4GV6A 4AHTA 4ISFA 4K41A 3ZLJA 5JLFA 4DSFA 3NF8A 3CCJN 3M8QA 1TYQB 3VQ5A 1S3XA 4H4MA 4CBUA 2OANA 3B6OA 2OPPA 2X78A 3KK3A 4A62A 1IBKK 1ZBHA 1DKGD 1LAWA 3TABA 1IV0A 2DY4A 4MDBA 3MN7A 5AQIA 2UUBK 1HNWK 3EKSA 4WYBA 4M3TA 5BR9A 5J2MA 1JLEA 3EO3A 2IC3A 1VQPN 3SUPA 5LMUK 4JN4A 3PIPL 3K5LA 3K5MA 4FJJA 1RBVA 1SUQA 4DU3A 4FK4A 1JL1A 3C7NA 4IJNA 3THVA 4ELUA 3BF3A 1GLDG 4CHOA 2NRZA 3F2KA 4B1VA 3P5JA 2D1KA 3CJ7A 1EWQA 4NB4A 4IG3A 4FJHA 4W5RA 3V9SA 2OYQA 1FW6A 4EZ9A 1J54A 1RTDA 3UB5A 4NXNK 5FROA 3H3NO 4BGBA 4MLHA 3QDKA 2RE2A 1HKCA 4GW6A 3KD5E 4M3WA 3BZCA 3AA2A 2WBNA 1SV5A 4O8UA 1OVQA 2G8UA 4CZGA 1WB9A 3DM2A 3HVRA 3WEEB 1NMNA 4AHVA 3VGMA 4JHDB 3ZETB 3OYLA 4B3SK 3CD6N 2Z1JA 4FWQA 4BR5A 4LY7A 2G8KA 5C10A 3OYGA 1KTQA 4NYNA 4CE9A 4B3MK 4K25A 1TAUA 2Z1IA 4CJ4A 1BUPA 1RDCA 4N47A 4JI4K 2P9NA 3D2EB 1QHTA 1XNQK 1P90A 2YHYA 2P9UA 4BQZA 4M63C 3I8BA 3R1XA 3TI0A 3THWB 3OA9A 1QQCA 1GOCA 2QWNA 3CQXA 3CMEN 2V51B 3AVGA 1BGXT 2P9LB 1K8AO 3JS6A 4I6MA 4QS9A 4E19A 3VGLA 1YTUA 3VQAA 4N56A 1SS6A 1MDUB 4KHUA 4FWRA 3ZT2A 3VGKA 3O9TA 1TKZA 2P9KA 1C1AA 3WNFA 4DS4A 3O5BA 1KVAA 3GBTA 4DFMA 2QKKA 1XC3A 1VSFA 1IG9A 4ZTFA 3KKSA 3S3NA 3S3MA 1B9DA 4XH5A 4LF6K 3AVMA 5AQFA 4BDZA 1S1WA 4C8LA 1HYSA 1NNEA 4CI6A 3HO1A 4YDUA 3RMAA 3AO4A 3DXMB 3MEGA 3RSEB 3LP0A 3TU5A 3E1YA 1NGGA 3PIOL 3K58A 3M5RA 4CHZA 4CEAA 4J2DA 1ZBLA 4B3TK 3E01A 3LP3A 4JI5K 2D0CA 3PY8A 1NK4A 3MX2A 2W6LA 1X9JA 5M1FA 2ATQA 3E9OA 2ZE2A 2HNYA 1EQYA 3AVJA 3VF2A 4FJ7A 1HKGA 3V6DA 3VESA 3TR8A 1VSDA 3MCAB 3DXKA 4ID5A 3HOSA 5AQPA 5GINA 2Q36A 5JLHA 2QW9A 3O80A 4C8KA 4KHPK 3ZSQA 1C0GA 2P1JA 4FLZA 3CMAN 1VSJA 3WXJA 2BH1A 4HCCA 1NKCA 4KV8A 4PKHA 5C12A 3NGYA 1YJWN 5AQYA 1WBBA 4BE1A 4JKDA 2OCEA 3UE5A 3L6QA 4WE1A 3H45C 2DFHA 2E4LA 3V1RA 3J7YP 2OPRA 5M1NA 4BE2A 3IUCA 4FM0A 3WNGA 1Z25A 3QEIA 4OLAA 2YHWA 1LV5A 4Z4IA 3O1WA 5IWAK 2HHTA 4EAHD 1U48A 3CFOA 3WEEA 1YVUA 2BANA 4JHDA 2E2PA 4IOCL 2KFZA 3AO5A 3THXA 2G8FA 3PO5A 1WSHA 5M1OA 5FLXO 1RDDA 2H3GX 3FR0A 3M3ZA 3SZ2A 3O9SA 3NH2A 2FBTA 2PAVA 3H1QA 1U04A 4I9QA 3SCXA 3PSFA 1JLAA 3W3DA 1S1XA 4KPYA 1YAGA 3HM8A 3JXUA 4CGIA 1BISA 5BPNA 2XY7A 3THYB 1YIJN 1IKXA 4M7XA 3LDPA 3J80O 4DR2K 4DSKA 4BRNA 4KRFA 2P9LA 1YT3A 5C25A 3OBYA 3VENA 1BCOA 3NDKA 4G9ZA 1NGJA 4A59A 2NNWA 4Q0BA 3WXMB 3QICA 3T7ZA 1LWCA 3EKUA 3L2RA 4OGCA 3CCLN 4KTZA 1UA0A 4KKOA 4DTPA 3AVCA 4YOUA 3NE6A 4BC5A 3LPTA 4ILGB 3SV3A 2FBXA 3RSEA 1N8RO 4BDPA 4F3TA 1BU6O 5CY4A 3VEOA 1VHXA 4EFHA 3TAEA 3CPWM 1I3AA 3MDQA 5CZ1A 4BWJA 3CI5A 4FK0A 3D7EO 4FW1A 5KI6A 4YOTA 4KHQA 4CJLA 4FWOA 1N32K 3QFPA 4AHSA 2P5OA 4FZXC 2P9IB 4BY9C 3ENHA 2NRWA 3V1QA 4BR9A 2ASMA 2Q31A 2O4GA 1NK6A 4CERA 2QTDA 4EIAA 1CZBA 4Z94A 1T6CA 3V9ZA 4PKIA 3VEWA 1BG3A 1IJJA 1JKHA 1HMVA 4O5BA 4A5AA 1HPZA 2Y1JA 4DFJA 4HUGA 1CLQA 4KI6A 1UWBA 3OYBA 3L2VA 2E6MA 3SUNA 2WTUA 1T3VA 3T1HK 1JCFA 5CR4A 4E7IA 3HJFA 4NLBA 1VRUA 3S3OA 4NYFA 1JJ2M 4JLHA 3DRRA 3DLRA 4JRPA 3VMFB 5I3UA 2HW3A 4DKWA 1S5JA 1RT4A 4W5NA 1OH8A 3L2WA 1WAFA 1K73O 3E9PA 3CM5A 1L3SA 5AQZA 3U9DA 2KQ2A 4XIUA 3ULDA 3T1AA 4BRDA 3RVCA 4H5VA 1HUXA 3NMUA 4IEEA 4H0TB 2VG7A 3R6MA 4O8KA 1N5YA 4DFPA 4BRKA 3P31A 1NGCA 3BUZB 5TKYA 1VRTA 2YKMA 4IKFA 3CM6A 2JWLA 1C1BA 3KJVA 3DRSA 3EN9A 1GOAA 1J5EK 3SI6A 3MK6A 4YOVA 1QVFM 3M1FA 5J1EA 3D45A 1O13A 3F9MA 1GLEG 4DV7K 4BGAA 1QE1A 3EL2A 2E20A 4M41A 2HHWA 3ITHA 2HF3A 2Q97A 4DLEA 3VA0A 3GL1A 4ISGA 3F9KA 1T8EA 3MMVA 1CXUA 5LJVA 2VGNA 4IDHA 4IXCA 3M8PA 1BIZA 2ETJA 4KHNA 2P51A 2V52B 3H6EA 5KQ8A 5F2RA 3VQ9A 1TGOA 1Y97A 3K5OA 2HVIA 4A57A 1SZ2A 5CZ2A 1GLFO 5KRSA 1T05A 3AVAA 1NK8A 4QCLA 2DPNA 1EX4A 1D5AA 3VQDA 1C0TA 1HQUA 3QNNA 3VQ6A 4UY8O 4WFNL 1FK9A 4OVLA 3AVLA 4PA1A 1GLLO 1Q18A 4CEQA 3I0SA 2O8EB 5FPMA 1NJWA 5BR8K 3VQEA 4AHRA 1BL3A 4RW9A 4CD3A 2YCHA 4B9VA 3O9UA 5KPRA 3D2FB 3L2UA 4FJ5A 3CQYA 4BE0A 5AQTA 2QWMA 2P9IA 4KBOA 5C0YA 3OYEA 2I7NA 4CBWA 1BDGA 5C15A 5AR0A 4KREA 4HUEA 1SQKA 3DJCA 1NK7A 1S1VA 4CZIA 2QWLA 2QWQA 3ZSYA 2E2NA 1XHZA 3VPZA 5AFUH 1IO2A 1E3MA 4B3OA 5EU7A 4DV6K 4BROA 1TVRA 1KC8O 3Q7BA 1T03A 3RR8A 1ITGA 5BPLA 1S22A 2YHBA 3ZSWA 3TAFA 4FJIA 3ULEB 5K14A 1VQON 4KAZA 2WUSA 1LWFA 4HVJA 3EE9A 3E66A 1YXQA 3ENOA 4FWPA 3OVNA 2VQEK 1ZYQA 3HSCA 2QWPA 1A5WA 2HSTA 3PO4A 5AQLA 3VN5A 1U2VB 3MXIA 5A2QO 3SUOA 4CF9A 4CZFA 4RW7A 5KQDA 2JWKA 3KD1E 4FYDA 3EY1A 4BRFA 3IS9A 4GMJB 2FSJA 3O8MA 4DV4K 4C1NK 3NVMA 2W41A 4H0XB 2YJEA 3DLKA 3OYIA 3K59A 1KD1O 3AVIA 1MWKA 4F8RA 4PL7A 3BGRA 3DWLA 1R59O 2FSNA 4BRIA 2BUPA 3QIOA 2YV0X 5HP1A 2ZQBA 1RT3A 3G10A 2A6AA 4O4GA 5HRSA 3VTIA 5JS2A 3BEXA 2FF6A 2QXFA 4LC9B 4DQSA 3SYZA 2F7TA 2UUCK 4CBXA 1ATNA 4A61A 2IVOA 3CJ9A 1U4BA 1KRPA 4CF8A 4CJ5A 3ZX3A 3SQ4A 1R0AA 4B1YB 1C0MA 2ZD1A 1WBDA 4H5NA 1N36K 4AH9A 2GTDA 2D4WA 3AVNA 3KK7A 4AHUA 1RT2A 1G99A 4Y1CA 4JKAA 1SKSA 2IDOA 2E1ZA 4E0DA 4DTSA 3V9WA 2ASOA 5CYQA 2PYLA 2IVPA 5AQOA 1LW2A 3O9QA 1ASWA 3CYMA 4OGEA 3U4LA 4PKGA 1OH6A 4FLVA 5F0XA 3VEZA 1XHXA 1NJZA 4FJKA 3IG1A 4DTUA 5KRTA 4EHTA 1I39A 4CEZA 3R3LA 4BVPA 3L4IA 4OX9K 3HI0A 1HQEA 1EETA 4RG8A 4W5TA 3OYNA 4DR5K 4PUOA 4ZHRA 4DTNA 3SAFA 4WCEL 2HOEA 1BO5O 3O9RA 4FOEA 4HWIA 2JGUA 3FFIA 2I7PA 4JKEA 5C2DA 3VA3A 1IKYA 1NGDA 2GWKA 2HBJA 1UAXA 3HBTA 3SMPA 1EKEA 3D2FA 4R79A 1WSJA 1BWFO 2FF3B 4B9MA 2O8BB 4BACA 1QSYA 3FZMA 3TSQA 3LM9A 5FPDA 4HUFA 4FLTA 3ZSXA 3SBGA 2YNFA 5E41A 3BDPA 2UXCK 3ALYA 3J7ZO 4K8ZA 5AQXA 1RBUA 1NJYA 3OS2A 4LF5K 3C65A 3H1VX 2O8CB 3ZEUB 3ULEA 4X62K 4QAGA 4DUYK 4B9QA 3CCMN 4HHTA 3M8SA 5BREA 2YI1A 2GUIA 1DTTA 1NOZA 1IKWA 3PX0A 3KWIA 3O4NA 5AQSA 1TUUA 1JLGA 4JI6K 3CCRN 1NOYA 1REVA 1U2VA 1LWEA 3SV4A 4MO4A 4CIEA 3QEVA 3VQ7A 1HX1A 4DWIA 4K42A 3EYZA 1LCUA 1Z05A 3MAQA 4J2EA 3OYCA 2PBDA 2HHQA 1JXBA 3GDQA 4RCHA 1HJOA 2VG5A 3WQUA 3KLHA 4GVEA 5AFUA 2YJFA
chains in the Genus database with same CATH topology
4YDUC 5JVHL 2P9LA 1J6ZA 3O4WA 4IJAA 3OBYA 4BR4A 1DEJA 1VQ6N 3VENA 3IDHA 1RDUA 3K9KA 1YUWA 4JK9A 3L4QA 2NRRA 4BR7A 4G9ZA 5F1XA 3HRGA 4HTLA 1NGJA 3MCPA 4A59A 1RGIA 2NNWA 4A2BA 3CXCM 4PL8A 3TTDA 3FLCO 2FXUA 3QICA 3T7ZA 3WXMB 4J8FA 4A2AA 3EKUA 1QQOA 1M1KO 2CGJA 5AZIA 2HF4A 3CCLN 3P39A 4BR0A 1Q81O 3GE1A 2QWOA 4B1UB 3A0IX 2NZTA 4YOUA 4KH6A 2BTFA 3A5OC 1NM1A 4BC5A 1OKJA 3KHYA 4ILGB 3WUHA 1YVNA 1VQKN 4H0OA 1JCEA 2NLXA 5BPMA 3RSEA 3IMXA 4WFAL 3G71N 1BU6O 2RHKA 3VEOA 4IFEA 1ATSA 4QS8A 5AQVA 5FPEA 5M1KA 5AZJA 4EFHA 4BRHA 3CPWM 3MDQA 3CI5A 3MWPA 1T6DA 1TYQA 2Q0UA 2P9SA 3D7EO 4GV9A 4YOTA 1GLAG 1ZC6A 2A41A 4JKGA 4AM7A 4FWOA 3DXKB 5GAGP 1ESVA 3QFPA 2CH5A 1CZAN 4MO5A 2CH6A 1Z6RA 2ZJQL 3TSUA 2P9IB 4BY9C 1SAZA 3C7NB 3CCVN 3OBWA 3ENHA 4YOYA 2NRWA 1U6ZA 3WT0A 1MWMA 4BR9A 4YOXA 4O5FA 3CCEN 3ID8A 4FSVA 3CC2N 3FGUA 4CJ7A 2ASMA 4FPAA 3DAWA 2V7ZA 2Q31A 3LDLA 1NGIA 5C2FA 1QHAA 2QTDA 2NRTA 5AQKA 4EIAA 3QB0A 1KQSM 2HBMA 2VWBA 3SBTA 1VQ8N 3CJBA 4Z94A 1T6CA 2HMPA 2AP1A 3CIPA 3IFRA 4PKIA 3VEWA 1BG3A 1IJJA 1QZ5A 5AQGA 1E4GT 4A5AA 3ATVA 2HBKA 5AQQA 5EX5A 3KVGA 4FVUA 4YORA 1T3VA 5M1PA 3UKUB 3CCUN 1JCFA 5CR4A 2IIRA 4ISEA 2VYPA 4NLBA 1GLCG 1V4TA 3HTVA 3FZKA 1JJ2M 2WFBA 3KWGA 1NBWA 4B1ZA 3QMLA 5ADXH 3AAPA 3VMFB 4BRPA 3A5LC 3J8AA 1X3NA 4DKWA 4H0YB 1YITN 1QQNA 1YJNN 4JK7A 1P8ZA 3BF1A 5GIOA 2YHXA 3K9JA 1WOQA 2A40A 4XH1A 4WFBL 5AQJA 1NGAA 5EVZA 4IEIA 3ZETA 2P9NB 4RWTA 5GIPA 1K73O 3E9PA 5AQWA 2CGKA 1RFQA 5AQZA 3ZYYX 1DGKN 2P9UB 3U9DA 3F5TA 3VEYA 2OTJN 3VTHA 2D0PA 4JKCA 3W0LA 1XUPO 4BG9A 1Q7YO 4MLEA 3ZEUA 4BRDA 3RVCA 2KLAA 2GX9A 1HUXA 4H5VA 4BRAA 4IEEA 4H0TB 4O8KA 3R6MA 4DHYA 4M7YA 3NMUA 3D2EA 4BRLA 3AGRA 2D0OA 1VQMN 4CZJA 3T69A 5JVGL 5AQRA 1LOTB 3A8YA 3EZWA 4WQ5C 3ID6A 4BRKA 3P31A 3TTCA 1KAZA 2OTLN 1NGCA 3BUZB 2HBLA 3IKMA 3VF4A 4PHTX 4JD2A 2ZJPL 4GNIA 1K8KB 4OO1J 3N4QA 5TKYA 2P9PA 1NGEA 3UKRB 5KPTA 4BRQA 2JWLA 5BRDA 4BR2A 3HOTA 2QA4N 3EN9A 2NRHA 3A5MC 4JKHA 4IO9L 4GY2B 3P4IA 3MK6A 4L3QA 4YOVA 5GADP 5B8HA 1QVFM 3M1FA 1Q82O 3MWTA 2ZF5O 2P9KB 1O13A 3G6EN 3F9MA 1GLEG 5M1QA 3C6AA 5TKWA 4BGAA 3D6RA 3EL2A 3LDNA 3OW2M 2E20A 2QI2A 2HF3A 2IVNA 2Q97A 4F9OA 3I33A 3MN9A 5E84A 3C6HA 3CJ1A 3GL1A 2YX6A 4FWKA 4ISGA 4YOWA 4FWMA 1NGFA 1VAZA 3FZFA 4H5TA 1NJIO 1KXPA 3N4PA 3VETA 3MMVA 5GAEP 5CHIA 5LJVA 2VGNA 4IDHA 4IXCA 1OVYA 5AZIB 5HL7L 4E1JA 3FE1A 2V52B 1QVGM 2FSKA 3H6EA 5KQ8A 1RDWX 4FL9A 5F2RA 1T44A 3DXMA 2E88A 2ZGZA 3U8XA 3B8AX 4A57A 3C0BA 3SMSA 2E8AA 4GV6A 4ISFA 5I9EB 2QEXN 1SZ2A 1C0FA 4K41A 1GLFO 1NMDA 5JLFA 3NVKA 1S72N 3CCJN 1VQNN 2DPNA 1TYQB 1M90O 3H3OB 3CCSN 1S3XA 4RTFD 4CBUA 2OANA 4CZEA 2J4RA 5LJWA 4WFNL 4A62A 4UY8O 4IOAL 5AQHA 3CPEA 3O1BA 1DKGD 4CZKA 4IWVA 5E26A 1NLVA 4MDBA 3MN7A 5AQIA 1GLLO 1Q18A 3EKSA 4U67L 1E4FT 2PFUA 4WYBA 3QBXA 3VERA 5FPMA 5BR9A 2W40A 4CD3A 3EO3A 2YCHA 4GV3A 1VQPN 3TSPA 3O9UA 1YF5L 3ATUA 4JN4A 5KPRA 3GOIA 3PIPL 3D2FB 3CJCA 3CQYA 2ITMA 1VQLN 5AQTA 2QWMA 2P9IA 1W2BM 4BRMA 4KBOA 2A3ZA 3C7NA 4FWLA 4IJNA 1HKBA 5C0YA 2I7NA 3BF3A 4CBWA 1HLUA 5KPZA 1BDGA 1GLDG 3AAQA 5C15A 4WQ4C 2NRZA 3F2KA 5AR0A 4B1VA 4H03B 2D1KA 3CJ7A 4Y0WA 4NB4A 1SQKA 3DJCA 4H5WA 4EHUA 4FWSA 2QWLA 2QWQA 4C1NI 3A5NC 2E2NA 4FO0A 4CZIA 3VPZA 5AFUH 3TTFA 3VEXA 4BROA 5HOOA 3UB5A 3MN5A 1KC8O 1BA0A 4BGBA 3H3NO 4FWNA 3SAHA 3Q7BA 4MLHA 3QDKA 5LY3A 2RE2A 1HKCA 3WXLA 5BPLA 2QWRA 1S22A 2F9WA 1EO1A 4U7BA 3ULEB 2KHOA 2WBNA 1NGBA 3FFKB 4FOIA 2QM1A 4C23A 1VQON 4O8UA 5DM6L 4CZGA 2WUSA 3EE8A 3WEEB 3EE9A 3KZBA 3VGMA 3E66A 2E2OA 4JHDB 3ZETB 1YXQA 1K9MO 3ENOA 4FWPA 3CD6N 4BR5A 4FWQA 3QFUA 3MN6A 5C10A 3HSCA 2QWPA 5EY4A 2HSTA 3U9ZA 5AQLA 1U2VB 3O6WA 4K25A 2ZGYA 4NLCA 2NRVA 1BA1A 1BUPA 1GLBG 4JAXA 2P9NA 3D2EB 4K43A 4CZFA 5KQDA 1IG8A 3SJHA 1P90A 2YHYA 2JWKA 4NO7A 5BRHA 2P9UA 1TUYA 3VOVA 1V4SA 4M63C 3I8BA 3R1XA 4BRFA 4BQZA 1ILYA 3VF6A 2FSJA 3OA9A 3O8MA 4JKBA 4C1NK 3NVMA 1VQ7N 4MDAA 2W41A 2QWNA 4H0XB 5AQUA 2YJEA 3CQXA 3VEVA 3CMEN 3CF5L 1KD1O 2V51B 1MWKA 4B1XB 4PL7A 2P9LB 4BC4A 3DWLA 1R59O 1K8AO 3JS6A 2FSNA 4I6MA 4QS9A 3WXKA 3UKRA 4BRIA 2VCPA 2BUPA 3I55N 4FPBA 3FZLA 3VGLA 1X3MA 4JEPA 2A6AA 1SS6A 1MDUB 3ZX2A 4FWRA 1GLJO 3E9LA 3VTIA 2E1YA 3BEXA 2FF6A 3O9TA 1W97L 2VGMA 4LC9B 3VGKA 2P9KA 4WQ5A 4A5BA 2F7TA 3O5BA 5EOYA 4CBXA 3GBTA 1ATNA 1XC3A 4A61A 4BC2A 4DQ8A 2IVOA 3CJ9A 1KAXA 4QS7A 5ADXA 2GUPA 3ZX3A 4JKFA 4XH5A 4B1YB 4BG8A 4CZLA 3H46O 4H5NA 5AQFA 3R8EA 3AGKA 1ZBSA 4CI6A 2GTDA 2D4WA 4YDUA 3KK7A 1N8RO 1VQ9N 4XH4A 3DXMB 4JNEA 3RSEB 3TU5A 1G99A 3E1YA 5AZJB 5AQMA 1NGGA 4JKAA 3PIOL 3M5RA 2E1ZA 2AA4A 2ASOA 4ILJA 1KAYA 2P9SB 2IVPA 2CGLA 5AQOA 1Q86O 3O9QA 4JKGB 3U4LA 4PKGA 4CD1A 3AARA 2UYTA 3S41A 5F0XA 3VEZA 1QZ6A 3MX2A 1X9JA 2GWJA 3WXIA 4BC3A 5M1FA 2E2QA 2Q1NA 3E9OA 3CJAA 4EHTA 3G4SN 1EQYA 3VF2A 1HKGA 3R3LA 4BVPA 3L4IA 2A42A 3VESA 3HI0A 4BRCA 4IO8A 4IOXA 4BREA 3MCAB 3SLCA 3DXKA 3CETA 5MLCQ 3HZ6A 3HOSA 5AQPA 3SAFA 4WCEL 5JICA 5GINA 2Q2RA 2HOEA 2Q36A 3O08A 1BO5O 5JLHA 3CHWA 3WQTA 3O9RA 1YI2N 4FOEA 4BQLA 4HWIA 2QW9A 3O80A 3AY9A 2I7PA 4KH5A 3SAGA 4JKEA 5C2DA 1NGDA 2GWKA 2HBJA 4H5RA 5CE3A 1YHQN 2ASPA 3HBTA 1C0GA 4WF9L 3SMPA 3CMAN 3D2FA 4R79A 4JK8A 5JMVA 3WXJA 4DCHA 2BH1A 1BWFO 2FF3B 3G25A 3GG4A 5H1SQ 4H0PA 3FZHA 5DM7L 4CZHA 4PKHA 5C12A 4AF1A 3CC4N 1YJWN 3FZMA 3UKUA 3TSQA 2KKZA 3DLLL 3LM9A 5AQYA 5FPDA 4OPAA 4XEIA 3L0QA 3LL3A 3LM2A 4JKDA 2FLOA 2GEMA 3Q7CA 3QBWA 3L6QA 3SBGA 3UE5A 2ZWHA 2WC9A 3ENBA 3H45C 5GAHP 5M1NA 3IUCA 4BRGA 3LDOA 4B1WB 4DB3A 3J7ZO 5ELZA 1ZXOA 4WQ4A 5AQXA 4KH4A 1ATRA 2EWSA 3C65A 1VQ4N 3H1VX 4ILHA 2YHWA 3P38A 3SK3A 3TPQA 3O1WA 3ZEUB 3ULEA 2V7YA 2A5XA 4EAHD 4B9QA 2GELA 2NRXA 3I56N 3CERA 3CCMN 5BREA 1QQMA 2YI1A 4H0VB 3CCQN 5AQNA 3WEEA 5BN9A 4CZMA 2Q0RA 5EXWA 3CC7N 1HPMA 4JHDA 1BOTO 2E2PA 3KWIA 4IOCL 1VQ5N 1MA9B 4JD2B 5AQSA 1TUUA 1NGHA 2P9PB 2F9TA 3ZX0A 2ZJRL 3CCRN 3BP8A 5M1OA 1U2VA 4BVOA 1YJ9N 3OHRA 5BRFA 4OPHA 2H3GX 3MX5A 3FR0A 4MO4A 4AM6A 3M3ZA 1D4XA 3O9SA 3H1QA 2PAVA 5FPNA 1HX1A 2QXLA 4K42A 1K8KA 1LCUA 1Z05A 3PLAA 1XQSC 1JCGA 2PBDA 3W3DA 3GDQA 1YAGA 4I6MB 1H1VA 4RCHA 3HM8A 4IZ9A 3JXUA 3R9PA 5BPNA 1NWKA 1HJOA 3WQUA 1YIJN 4M7XA 5BN8A 1DT9A 3LDPA 1WUAA 1Y64A 3LDQA 4GVEA 5AFUA 3M6GA 2YJFA 4BRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDU C;  2P9L A;  1J6Z A;  3O4W A;  4IJA A;  4BR4 A;  1DEJ A;  3VEN A;  3IDH A;  1YUW A;  4BR7 A;  5F1X A;  4HTL A;  1NGJ A;  3MCP A;  1RGI A;  4A2B A;  4PL8 A;  3FLC O;  2FXU A;  3QIC A;  4A2A A;  4J8F A;  3EKU A;  1QQO A;  2CGJ A;  5AZI A;  2HF4 A;  4BR0 A;  3GE1 A;  2QWO A;  4B1U B;  3A0I X;  2NZT A;  2BTF A;  3A5O C;  1NM1 A;  4BC5 A;  1OKJ A;  3KHY A;  3WUH A;  1YVN A;  4H0O A;  1JCE A;  2NLX A;  5BPM A;  3RSE A;  3IMX A;  1BU6 O;  3VEO A;  5FPE A;  1ATS A;  4QS8 A;  5AQV A;  5AZJ A;  4EFH A;  4BRH A;  3MDQ A;  3CI5 A;  1T6D A;  1TYQ A;  2Q0U A;  2P9S A;  3D7E O;  1GLA G;  1ZC6 A;  2A41 A;  4AM7 A;  4FWO A;  3DXK B;  1ESV A;  3QFP A;  2CH5 A;  1CZA N;  4MO5 A;  2CH6 A;  1Z6R A;  2P9I B;  1SAZ A;  3C7N B;  3ENH A;  3WT0 A;  1U6Z A;  1MWM A;  4BR9 A;  4O5F A;  3ID8 A;  4FSV A;  3FGU A;  4CJ7 A;  2ASM A;  4FPA A;  3DAW A;  2V7Z A;  2Q31 A;  3LDL A;  1NGI A;  1QHA A;  5AQK A;  4EIA A;  3QB0 A;  2VWB A;  3CJB A;  4Z94 A;  1T6C A;  2HMP A;  2AP1 A;  3CIP A;  3IFR A;  4PKI A;  3VEW A;  1BG3 A;  1IJJ A;  1QZ5 A;  5AQG A;  1E4G T;  3ATV A;  5AQQ A;  5EX5 A;  3KVG A;  3UKU B;  1JCF A;  2IIR A;  4ISE A;  2VYP A;  1GLC G;  1V4T A;  3HTV A;  3FZK A;  1NBW A;  4B1Z A;  3QML A;  5ADX H;  3AAP A;  4BRP A;  3A5L C;  3J8A A;  1X3N A;  4H0Y B;  1QQN A;  1P8Z A;  3BF1 A;  2YHX A;  1WOQ A;  2A40 A;  4XH1 A;  5AQJ A;  1NGA A;  5EVZ A;  3ZET A;  2P9N B;  4RWT A;  5AQW A;  2CGK A;  1RFQ A;  5AQZ A;  1DGK N;  2P9U B;  3U9D A;  3VEY A;  2D0P A;  3W0L A;  1XUP O;  4BG9 A;  4MLE A;  3ZEU A;  4BRD A;  4H5V A;  1HUX A;  4BRA A;  4DHY A;  4H0T B;  4O8K A;  3R6M A;  4M7Y A;  3D2E A;  4BRL A;  2D0O A;  4CZJ A;  5AQR A;  1LOT B;  3A8Y A;  3EZW A;  4WQ5 C;  4BRK A;  1KAZ A;  1NGC A;  3BUZ B;  3VF4 A;  4JD2 A;  4GNI A;  1K8K B;  5TKY A;  2P9P A;  1NGE A;  3UKR B;  5KPT A;  4BRQ A;  5BRD A;  4BR2 A;  3EN9 A;  2NRH A;  3A5M C;  4GY2 B;  3P4I A;  3MK6 A;  4L3Q A;  5B8H A;  3M1F A;  2ZF5 O;  2P9K B;  3F9M A;  1GLE G;  4BGA A;  3LDN A;  3EL2 A;  2E20 A;  2HF3 A;  2IVN A;  2Q97 A;  4F9O A;  3I33 A;  3MN9 A;  5E84 A;  3CJ1 A;  3GL1 A;  4FWK A;  4ISG A;  4FWM A;  1NGF A;  4H5T A;  3FZF A;  1KXP A;  3VET A;  3MMV A;  5LJV A;  4IXC A;  5AZI B;  4E1J A;  3FE1 A;  2V52 B;  2FSK A;  3H6E A;  5KQ8 A;  1RDW X;  4FL9 A;  5F2R A;  1T44 A;  3DXM A;  2E88 A;  2ZGZ A;  3U8X A;  3B8A X;  3C0B A;  3SMS A;  2E8A A;  4ISF A;  5I9E B;  1SZ2 A;  1C0F A;  4K41 A;  1GLF O;  1NMD A;  5JLF A;  2DPN A;  1TYQ B;  3H3O B;  1S3X A;  4RTF D;  4CBU A;  2OAN A;  4CZE A;  2J4R A;  5LJW A;  4A62 A;  5AQH A;  3O1B A;  1DKG D;  4CZK A;  4IWV A;  5E26 A;  1NLV A;  3MN7 A;  5AQI A;  1GLL O;  1Q18 A;  3EKS A;  1E4F T;  4WYB A;  3QBX A;  3VER A;  5FPM A;  5BR9 A;  2W40 A;  4CD3 A;  3EO3 A;  2YCH A;  3ATU A;  4JN4 A;  5KPR A;  3GOI A;  3D2F B;  3CJC A;  3CQY A;  2ITM A;  5AQT A;  2QWM A;  2P9I A;  4BRM A;  4KBO A;  2A3Z A;  3C7N A;  4FWL A;  4IJN A;  1HKB A;  2I7N A;  3BF3 A;  4CBW A;  1HLU A;  5KPZ A;  1BDG A;  1GLD G;  3AAQ A;  4WQ4 C;  5AR0 A;  4B1V A;  4H03 B;  2D1K A;  3CJ7 A;  4Y0W A;  4NB4 A;  1SQK A;  3DJC A;  4H5W A;  4EHU A;  4FWS A;  2QWL A;  2QWQ A;  4CZI A;  3A5N C;  2E2N A;  4FO0 A;  3VPZ A;  5AFU H;  3VEX A;  4BRO A;  3UB5 A;  3MN5 A;  1BA0 A;  4BGB A;  3H3N O;  4FWN A;  4MLH A;  3QDK A;  5LY3 A;  1HKC A;  3WXL A;  5BPL A;  2QWR A;  1S22 A;  2F9W A;  3ULE B;  2KHO A;  3FFK B;  1NGB A;  4FOI A;  2QM1 A;  4C23 A;  4CZG A;  2WUS A;  3WEE B;  3KZB A;  3VGM A;  2E2O A;  4JHD B;  3ZET B;  1YXQ A;  3ENO A;  4FWP A;  4BR5 A;  4FWQ A;  3QFU A;  3MN6 A;  3HSC A;  2QWP A;  5EY4 A;  3U9Z A;  5AQL A;  1U2V B;  3O6W A;  4K25 A;  2ZGY A;  4K43 A;  1BA1 A;  1BUP A;  1GLB G;  4JAX A;  2P9N A;  3D2E B;  4CZF A;  5KQD A;  1IG8 A;  3SJH A;  2YHY A;  4NO7 A;  5BRH A;  2P9U A;  1TUY A;  3VOV A;  1V4S A;  4M63 C;  3I8B A;  4BQZ A;  4BRF A;  3VF6 A;  2FSJ A;  3O8M A;  2W41 A;  2QWN A;  4H0X B;  5AQU A;  2YJE A;  3CQX A;  3VEV A;  2V51 B;  1MWK A;  4B1X B;  4PL7 A;  2P9L B;  4BC4 A;  3DWL A;  1R59 O;  3JS6 A;  2FSN A;  4I6M A;  4QS9 A;  3WXK A;  3UKR A;  4BRI A;  2VCP A;  2BUP A;  4FPB A;  3FZL A;  3VGL A;  1X3M A;  2A6A A;  1MDU B;  3ZX2 A;  4FWR A;  1GLJ O;  2E1Y A;  3BEX A;  2FF6 A;  4LC9 B;  3VGK A;  2P9K A;  4WQ5 A;  3O5B A;  5EOY A;  4CBX A;  3GBT A;  1ATN A;  1XC3 A;  4A61 A;  4BC2 A;  4DQ8 A;  2IVO A;  3CJ9 A;  1KAX A;  4QS7 A;  5ADX A;  2GUP A;  3ZX3 A;  4XH5 A;  4B1Y B;  4BG8 A;  4CZL A;  3H46 O;  4H5N A;  5AQF A;  3R8E A;  1ZBS A;  4CI6 A;  2GTD A;  2D4W A;  4YDU A;  4XH4 A;  3DXM B;  4JNE A;  3RSE B;  3TU5 A;  1G99 A;  5AZJ B;  5AQM A;  1NGG A;  2E1Z A;  2AA4 A;  2ASO A;  1KAY A;  2P9S B;  2IVP A;  2CGL A;  5AQO A;  3U4L A;  4PKG A;  4CD1 A;  3AAR A;  2UYT A;  3S41 A;  5F0X A;  3VEZ A;  1QZ6 A;  4BC3 A;  1X9J A;  2GWJ A;  3WXI A;  2E2Q A;  2Q1N A;  4EHT A;  3CJA A;  1EQY A;  3VF2 A;  1HKG A;  4BVP A;  3L4I A;  2A42 A;  3VES A;  3HI0 A;  4BRC A;  4IO8 A;  4BRE A;  3SLC A;  3DXK A;  3CET A;  3HZ6 A;  5AQP A;  5JIC A;  2Q2R A;  2HOE A;  2Q36 A;  3O08 A;  1BO5 O;  5JLH A;  3CHW A;  3WQT A;  4FOE A;  4BQL A;  4HWI A;  2QW9 A;  3O80 A;  3AY9 A;  2I7P A;  1NGD A;  2GWK A;  4H5R A;  5CE3 A;  2ASP A;  3HBT A;  1C0G A;  3SMP A;  3D2F A;  5JMV A;  3WXJ A;  4DCH A;  1BWF O;  2FF3 B;  3G25 A;  3GG4 A;  4H0P A;  3FZH A;  4CZH A;  4PKH A;  3FZM A;  3UKU A;  3LM9 A;  5AQY A;  5FPD A;  4XEI A;  3L0Q A;  3LL3 A;  3LM2 A;  2FLO A;  2GEM A;  3QBW A;  3L6Q A;  3UE5 A;  2ZWH A;  3H45 C;  3IUC A;  4BRG A;  3LDO A;  4B1W B;  4DB3 A;  5ELZ A;  1ZXO A;  4WQ4 A;  5AQX A;  1ATR A;  2EWS A;  3H1V X;  2YHW A;  3SK3 A;  3TPQ A;  3O1W A;  3ZEU B;  3ULE A;  2V7Y A;  2A5X A;  4EAH D;  4B9Q A;  2GEL A;  3CER A;  5BRE A;  1QQM A;  2YI1 A;  4H0V B;  5AQN A;  3WEE A;  5BN9 A;  4CZM A;  2Q0R A;  5EXW A;  1HPM A;  4JHD A;  1BOT O;  2E2P A;  1MA9 B;  4JD2 B;  5AQS A;  1TUU A;  1NGH A;  2P9P B;  2F9T A;  3ZX0 A;  3BP8 A;  1U2V A;  4BVO A;  3OHR A;  5BRF A;  2H3G X;  3FR0 A;  4MO4 A;  4AM6 A;  3M3Z A;  1D4X A;  3H1Q A;  2PAV A;  5FPN A;  1HX1 A;  2QXL A;  4K42 A;  1K8K A;  1LCU A;  1Z05 A;  1XQS C;  1JCG A;  2PBD A;  3W3D A;  3GDQ A;  1YAG A;  4I6M B;  1H1V A;  4RCH A;  3HM8 A;  4IZ9 A;  3JXU A;  3R9P A;  5BPN A;  1NWK A;  1HJO A;  3WQU A;  4M7X A;  5BN8 A;  3LDP A;  1WUA A;  1Y64 A;  3LDQ A;  5AFU A;  3M6G A;  2YJF A;  4BRN A; 
#chains in the Genus database with same CATH topology
 5JVH L;  1J6Z A;  4IJA A;  1VQ6 N;  1DEJ A;  3HP9 A;  3K9K A;  3O4Q A;  1W0H A;  5F1X A;  1HNV A;  4HTL A;  2IGI A;  3CXC M;  3TTD A;  3ISN C;  1QQO A;  1M1K O;  5AZI A;  2HND A;  2HF4 A;  1HYZ A;  1Q81 O;  4BR0 A;  4M3R A;  3GE1 A;  1RIL A;  2BTF A;  3A5O C;  3OYM A;  1NM1 A;  2RPI A;  1TKX A;  1VQK N;  1YVN A;  4H0O A;  2NLX A;  1WSG A;  3G71 N;  4WFA L;  2ZJQ L;  1LW0 A;  5FPE A;  5AQV A;  3QES A;  3AVH A;  4Z4G A;  4YY3 K;  1TYQ A;  4CK1 A;  2G8W A;  2D0B A;  5AJ3 K;  1MU2 A;  3U3G A;  1GLA G;  3LAK A;  4FLY A;  1ESV A;  2G8V A;  1CZA N;  4MO5 A;  2CH6 A;  4AHC A;  1QS4 A;  4DSJ A;  3ID8 A;  5I42 A;  3FGU A;  4CJ7 A;  4FPA A;  3DAW A;  1NGI A;  2NRT A;  4B8C A;  4JI0 K;  3SBT A;  4E1M A;  3QIN A;  1HNI A;  3CIP A;  4O55 A;  2QK9 A;  1QZ5 A;  4KTQ A;  1S9G A;  3OYD A;  3ATV A;  5AQQ A;  4MQ3 A;  4FVU A;  3UKU B;  3CCU N;  2IIR A;  4M3Z A;  4KFB A;  1GLC G;  3LWL A;  1V4T A;  3HTV A;  2O8B A;  3FZK A;  3ZT4 A;  2WFB A;  4DV2 K;  3QML A;  4BRP A;  3A5L C;  1S1T A;  3V81 A;  3OYF A;  4JK7 A;  1P8Z A;  3K9J A;  1WOQ A;  4XH1 A;  4CED A;  1TKT A;  5EVZ A;  3DLH A;  4IEI A;  3ZET A;  3EZ5 A;  2YNI A;  3DLE A;  4DQR A;  3VEY A;  4YNQ A;  1VSK A;  4GKJ K;  2O8C A;  3VTH A;  3OTO K;  4E7J A;  4FVM A;  4BG9 A;  1Q7Y O;  4MLE A;  3ZEU A;  3ZSV A;  2Y1I A;  1L5U A;  2GX9 A;  1C6V A;  3D2E A;  4BRL A;  4CZJ A;  2Q3S A;  1LOT B;  5AQR A;  3EZW A;  4WQ5 C;  3ID6 A;  3I8D A;  3TTC A;  4FM2 A;  2VWK A;  1Q8I A;  2HBL A;  4PHT X;  4FJG A;  2ZJP L;  4GNI A;  1K8K B;  3THW A;  3TAQ A;  3NF6 A;  1KLN A;  3UKR B;  4BRQ A;  4BR2 A;  3HOT A;  5FDL A;  2NRH A;  4CJT A;  3P4I A;  4L3Q A;  4CJ3 A;  5GAD P;  3RTV A;  3QNO A;  3U6F A;  1WSI A;  3C6A A;  4LD0 A;  3D6R A;  3OW2 M;  4LFA K;  1WLJ A;  5E84 A;  3CJ1 A;  4FWK A;  3HXM A;  3SPY A;  3LAM A;  4FWM A;  4MFB A;  2RF2 A;  3C94 A;  4EP4 A;  3TAN A;  2IS3 A;  2OZS A;  3OYJ A;  4FLX A;  4FJN A;  3V1O A;  2AJQ A;  1T44 A;  1X9M A;  3DXM A;  4DTR A;  3SJJ A;  2HHU A;  3DYA A;  3C0B A;  1VSI A;  2E8A A;  1BIU A;  3V9X A;  1TL1 A;  2QEX N;  3QO9 A;  1C0F A;  1TK5 A;  1NMD A;  1Z26 A;  4CJE A;  3AA4 A;  1M90 O;  4E89 A;  3H3O B;  3CCS N;  4RTF D;  5LJW A;  2J4R A;  5AQH A;  4O44 A;  3O1B A;  1QSL A;  4IWV A;  1NLV A;  5JS1 A;  1E4F T;  3DLG A;  3QBX A;  4N41 A;  2PY5 A;  2W40 A;  2YKN A;  3K57 A;  4KB0 A;  3VQB A;  3GOI A;  4CJV A;  4N76 A;  1W2B M;  4BRM A;  2E6L A;  2A3Z A;  1TL3 A;  3ZSZ A;  4LSN A;  1HLU A;  5KPZ A;  4CEO A;  4WQ4 C;  4DQQ A;  3QEP A;  3RRG A;  4B9L A;  4HTU A;  1XMO K;  4EHU A;  4KHY A;  4C1N I;  3A5N C;  4FLW A;  1JXE A;  1CXQ A;  3TTF A;  1HYV A;  3VEX A;  4M3X A;  3T19 A;  1KLM A;  5HOO A;  3DOK A;  3MN5 A;  4FWN A;  1O1W A;  4K0K K;  3OY9 A;  3WXL A;  5DK5 A;  3FFK B;  4FOI A;  4W5O A;  2QM1 A;  2YNG A;  4C23 A;  1VSM A;  5DM6 L;  3EE8 A;  4CEE A;  5CYM A;  1KCF A;  2E2O A;  3QER A;  1K9M O;  3RMB A;  4CFD A;  1TV6 A;  3QFU A;  1RTI A;  1IH7 A;  3U9Z A;  3O3G A;  3NH1 A;  3OS0 A;  4NLC A;  4K43 A;  1NK5 A;  4Z4H A;  3NGZ A;  1U49 A;  1BQM A;  4NO7 A;  5BRH A;  1TUY A;  3VOV A;  1V4S A;  2YNH A;  1ILY A;  1WSF A;  3L2Q A;  1KSP A;  5DMR A;  4CW7 B;  2DFF A;  5AQU A;  4CK2 A;  3VEV A;  3HPO A;  3CF5 L;  1RBT A;  3RMC A;  4AQY K;  4B1X B;  4BC4 A;  1C0U A;  3UKR A;  1X3M A;  3THY A;  5IT9 O;  4F3O A;  3ZX2 A;  5GIO A;  1GLJ O;  1FKO A;  2E1Y A;  4A5B A;  2VGM A;  3A2F A;  4WQ5 A;  4F2S A;  2F4V K;  4GKK K;  5LL6 Z;  4DQ8 A;  1KAX A;  2G8I A;  4F2R A;  2F8S A;  4CF1 A;  3AGK A;  3VQC A;  1ZBS A;  4Z4F A;  3AO1 A;  1FKP A;  2B4J A;  4JNE A;  3L3U A;  5AZJ B;  1RCH A;  5AQM A;  3TWH A;  3LP2 A;  5T7B A;  4ILJ A;  3NH0 A;  1KAY A;  1S1U A;  3HP6 A;  3AAR A;  1L3U A;  2UYT A;  3S41 A;  1QZ6 A;  4BC3 A;  2GWJ A;  4CEC A;  3WXI A;  2Q1N A;  3G4S N;  1IKV A;  4PQU A;  2A42 A;  4LF4 K;  4BRC A;  1W7A A;  4IOX A;  4BRE A;  3V9U A;  4YHH K;  4CGD A;  4G1Q A;  3NF7 A;  5MLC Q;  4BWM A;  3HZ6 A;  4DQI A;  5JIC A;  2Q2R A;  3O08 A;  4JYA K;  4AIL C;  1ASU A;  3LPU A;  4BQL A;  1BHL A;  4E7L A;  3SAG A;  3UIQ A;  4H5R A;  5CE3 A;  1U47 A;  4WF9 L;  1A5V A;  4JS4 A;  4CGF A;  4DCH A;  4I7F A;  4LF8 K;  3HPG A;  3GG4 A;  4H0P A;  1RT6 A;  3FZH A;  5DM7 L;  4DTX A;  1I94 K;  3J81 O;  4E7K A;  5FRM A;  3IRX A;  4CHN A;  3L8B A;  1WAJ A;  3L0Q A;  3LL3 A;  1OH5 A;  2FLO A;  4DR3 K;  3Q7C A;  1RTH A;  2ZWH A;  3ENB A;  4CJF A;  5GAH P;  4F4K A;  4Z0U A;  4DB3 A;  3LDO A;  3CG7 A;  4WQ4 A;  4KH4 A;  1ATR A;  2EWS A;  1TK0 A;  4ILH A;  3TPQ A;  3MXM A;  3HL8 A;  3LAL A;  4QOZ B;  2A5X A;  1ASV A;  2NRX A;  4FJ9 A;  3CER A;  4RW4 A;  5AQN A;  4CZM A;  2BDP A;  2Q0R A;  3CC7 N;  4PY5 A;  4DV1 K;  1BOT O;  1SL1 A;  4JD2 B;  1NGH A;  2ZJR L;  3ZX0 A;  4BVO A;  4OPH A;  3MX5 A;  3M8R A;  1D4X A;  1DLO A;  5FPN A;  1EP4 A;  4NCG A;  2FC0 A;  1KFD A;  4CCH A;  2WOM A;  4ELT A;  5C24 A;  2HMI A;  2O8F B;  1JCG A;  3KK1 A;  1XMQ K;  4I6M B;  1SL0 A;  4IZ9 A;  1VK0 A;  1NWK A;  3KKR A;  4EZ6 A;  2EX3 A;  4B9S A;  1DT9 A;  3LDQ A;  4OJR A;  4YDU C;  1G15 A;  3O4W A;  4BR4 A;  2HVH A;  1RDU A;  4JK9 A;  1NK0 A;  3ZCM A;  1NG9 A;  3SNN A;  1J9A A;  2NRR A;  1D8Y A;  3JAM O;  3HRG A;  4A2B A;  3FLC O;  2FXU A;  4I2P A;  2CGJ A;  2XRI A;  1HRH A;  2W6K A;  4CJS A;  3P39 A;  4C8O A;  3A0I X;  2NZT A;  4IBN A;  3KHY A;  3AV9 A;  1JCE A;  2R7Y A;  3IMX A;  2RHK A;  1ATS A;  1Q9Y A;  3PSI A;  5AZJ A;  4BRH A;  3MWP A;  1RNH A;  1T6D A;  1J53 A;  2Q0U A;  1S6Q A;  4GV9 A;  1ZC6 A;  1UA1 A;  1X1P A;  4CF2 A;  3DXK B;  2BGG A;  5GAG P;  1TKD A;  4CHP A;  2CH5 A;  3H08 A;  2P5G A;  2O8E A;  1Z6R A;  3RRH A;  3CCV N;  3O3F A;  3KLF A;  1L3T A;  1U6Z A;  3CCE N;  1MWM A;  3LZI A;  1L3V A;  4FSV A;  2PYJ A;  2RKI A;  4DR6 K;  2HHH K;  4KHS A;  3VQ4 A;  3WNE A;  3AO3 A;  1VQ8 N;  2HBM A;  2VWB A;  2HMP A;  3IFR A;  5EX5 A;  3KVG A;  4LH4 A;  4YOR A;  5M1P A;  3HK2 A;  4O0J A;  2VYP A;  5J2N A;  1RTJ A;  4E1N A;  4H4O A;  4DTO A;  3KWG A;  1NBW A;  4DTM A;  4DV3 K;  5ADX H;  2XY6 A;  3AAP A;  4CJQ A;  3F73 A;  3J8A A;  3LAN A;  1X3N A;  3WNH A;  1YIT N;  3U3Y A;  1QQN A;  1YJN N;  1VSE A;  2A1R A;  3BF1 A;  4WFB L;  4E7H A;  3K2P A;  1JLF A;  3VQP A;  4PWD A;  3AA3 A;  5GIP A;  5KGW A;  1KFS A;  5AQW A;  2CGK A;  1RFQ A;  3ZYY X;  2OTJ N;  3NGI A;  2D0P A;  4JKC A;  3THX B;  1XUP O;  3C6U A;  4M3U A;  4M3Y A;  2KLA A;  4FW2 A;  3TAR A;  4DHY A;  3QEW A;  5JVG L;  3A8Y A;  3DRP A;  4W5Q A;  1KAZ A;  5D3G A;  4DQP A;  4JD2 A;  4IG0 A;  3N4Q A;  1NGE A;  2BE2 A;  3BY5 A;  3A5M C;  4JKH A;  4IO9 L;  1WN7 A;  5B8H A;  4KTW A;  5HBM A;  1Q82 O;  3MWT A;  3G6E N;  2G8H A;  3C95 A;  4JI3 K;  4CJW A;  5TKW A;  2O8F A;  1B92 A;  2QI2 A;  2IVN A;  4F9O A;  2D5R A;  3DI6 A;  4JRQ A;  3I33 A;  3MN9 A;  1SKR A;  3C6H A;  4DSE A;  2YX6 A;  1NGF A;  4H5T A;  3FZF A;  3CFR A;  4BDY A;  4FCY A;  3VET A;  3BZK A;  3J7A P;  5GAE P;  3QET A;  4CFC A;  5HL7 L;  1OVY A;  2XY8 A;  4CFB A;  1QVG M;  2FSK A;  1RDW X;  4FL9 A;  2IAJ A;  1GOB A;  2ZGZ A;  3I0R A;  3JYT A;  4YFU A;  4FXD A;  2F8T A;  3ZT0 A;  3SMS A;  5I9E B;  5HRO A;  1NK9 A;  4ICL A;  1RT7 A;  3NVK A;  4JI1 K;  1S72 N;  1VQN N;  3B6P A;  3MED A;  1QTM A;  4CZE A;  1HR0 K;  4IOA L;  3CPE A;  4CZK A;  2F96 A;  1IBL K;  1EXQ A;  1T7P A;  5E26 A;  4CHY A;  2JLE A;  3AVF A;  4JV5 K;  4U67 L;  2PFU A;  3VER A;  2UXD K;  4LFC K;  1J5O A;  2XY5 A;  4GV3 A;  3TSP A;  1YF5 L;  3ATU A;  4FZZ A;  1FXX A;  3CJC A;  4OKK A;  2ITM A;  1VQL N;  4CFA A;  1RT1 A;  4FWL A;  3CQ8 A;  1HKB A;  1WNS A;  4B9N A;  4IDK A;  3OJU A;  3AAQ A;  2FBY A;  4OKE A;  4CF0 A;  4CVN E;  5HLF A;  1HNZ K;  4UQG A;  4H03 B;  4Y0W A;  2E5L K;  1F21 A;  2VQF K;  4DR1 K;  4H5W A;  3NHG A;  4FWS A;  4NCA A;  4FO0 A;  4FJL A;  4Z4C A;  5SWM A;  3DLB A;  5HRR A;  3T3F A;  3PX4 A;  3OYA A;  2KTQ A;  1BA0 A;  3SAH A;  5LY3 A;  3NCI A;  2QWR A;  4CGJ A;  2F9W A;  4FJX A;  1EO1 A;  2KHO A;  1NGB A;  5LMN K;  4V19 S;  3RWU A;  2DTU A;  3KZB A;  2KZZ A;  4EP5 A;  4B9U A;  1HJR A;  3ZSO A;  4DUZ K;  4DSL A;  3MN6 A;  2FBV A;  4DSI A;  4M42 A;  5EY4 A;  5HRN A;  1N6Q A;  3O6W A;  5J2P A;  2HHS A;  2ZGY A;  3ZT3 A;  2NRV A;  1BA1 A;  1GLB G;  4JAX A;  4ZTJ A;  1IG8 A;  3SJH A;  3LWM A;  4NCB A;  4FZY A;  1HNX K;  2LSN A;  4DU1 A;  3AA5 X;  1X9S A;  3S9H A;  3VF6 A;  3VQQ A;  4JKB A;  2X6S A;  1VQ7 N;  4MDA A;  3LDS A;  4JI8 K;  2OPS A;  3PX6 A;  1KVC A;  1BQN A;  2OZM A;  2X6N A;  3WXK A;  4X64 K;  2VCP A;  3I55 N;  4FPB A;  3FZL A;  4C8M A;  4JEP A;  2XO7 A;  1W9H A;  4C8N A;  3E9L A;  1W97 L;  3P83 D;  4CJP A;  2UU9 K;  5EOY A;  4BC2 A;  3QIP A;  1VSL A;  4QS7 A;  4CK3 A;  5ADX A;  2GUP A;  4CES A;  4JKF A;  4BG8 A;  4CZL A;  3H46 O;  3R8E A;  2O8D B;  2VG6 A;  1VQ9 N;  2VWJ A;  4XH4 A;  4B8A B;  3NFA A;  1XI1 A;  4CGG A;  5FRN A;  2IOC A;  1NJX A;  4DR7 K;  2AA4 A;  1XC9 A;  2P9S B;  2CGL A;  2W42 A;  1Q86 O;  4JKG B;  4CD1 A;  4J2A A;  4DF8 A;  5C42 A;  2E2Q A;  3CJA A;  4X66 K;  3QEX A;  4JI7 K;  1RT5 A;  1C1C A;  4IO8 A;  3SLC A;  4CEB A;  3SPZ A;  3CET A;  1Q9X A;  4LF9 K;  4JS5 A;  3KTQ A;  3CHW A;  3WQT A;  1YI2 N;  3AY9 A;  4KH5 A;  4E3S A;  2HHX A;  1NU0 A;  1YHQ N;  2ASP A;  3SQ1 A;  3SUQ A;  1NKE A;  5KGX A;  1NKB A;  2UUA K;  3G0Z A;  4JK8 A;  4I2Q A;  5JMV A;  4LSL A;  3G25 A;  5H1S Q;  2XHB A;  4DU4 A;  1SKW A;  3NF9 A;  4CZH A;  4AF1 A;  3CC4 N;  3AO2 A;  3UKU A;  2KKZ A;  3DLL L;  3NAE A;  2Z1H A;  4KB1 A;  4B08 A;  4OPA A;  4XEI A;  3LM2 A;  2GEM A;  3QBW A;  1WSE A;  2WC9 A;  3RR7 A;  1BI4 B;  4CIG A;  4GVM A;  4BRG A;  4B1W B;  1N34 K;  2KW4 A;  5ELZ A;  1ZXO A;  1CZ9 A;  4DMN A;  4DTJ A;  1RBS A;  4N5S A;  4DR4 K;  3AVK A;  4R5P A;  1VQ4 N;  3HYF A;  4LFB K;  3P38 A;  1JLC A;  3SK3 A;  4FJ8 A;  2GV9 A;  2V7Y A;  2GEL A;  3I56 N;  2EHG A;  1QQM A;  4H0V B;  2YHA A;  4FJM A;  3CCQ N;  5BN9 A;  5EXW A;  1HPM A;  3HPH A;  4B3R K;  2D0A A;  1VQ5 N;  1EWR A;  1MA9 B;  3HVT A;  2P9P B;  3IAY A;  2F9T A;  2PZS A;  3BP8 A;  4M45 A;  1YJ9 N;  3OHR A;  5BRF A;  1K6Y A;  4Y1D A;  4AM6 A;  3DOL A;  3TAP A;  4K8X A;  2QXL A;  3EEQ A;  3MEC A;  3CFP A;  1K8K A;  3PLA A;  1RBR A;  1XQS C;  2GBZ A;  4DV5 K;  3MEE A;  1H1V A;  3R9P A;  3TAG A;  3P1G A;  3NBP A;  3KLE A;  4OPK A;  1JLB A;  5BN8 A;  1WUA A;  1Y64 A;  3M6G A;  4U7B A;  1RDB A;  4LF7 K;  1TAQ A;  4FM1 A;  2B5J A;  3IDH A;  1YUW A;  3L4Q A;  4DV0 K;  1D9D A;  4BR7 A;  3MCP A;  2KZM A;  1RGI A;  1JLQ A;  3V4I A;  4PL8 A;  4A2A A;  4DS5 A;  4CJK A;  4J8F A;  3K5N A;  2ITG A;  4CJR A;  4OKJ A;  2QWO A;  4B1U B;  4CHQ A;  4KH6 A;  4Q5V A;  1XNR K;  2O8D A;  2RN2 A;  4Z4E A;  2Z1G A;  1OKJ A;  3HST B;  1ZBF A;  3WUH A;  4IFY A;  5BPM A;  1ZBU A;  3ASM A;  2B6A A;  5M1K A;  4IFE A;  4QS8 A;  1DTQ A;  5SZT A;  4ELV A;  1KVB A;  4LH5 A;  2UXB K;  2P9S A;  4FK2 A;  3SQ0 A;  2A41 A;  4JKG A;  2WON A;  4AM7 A;  1QSS A;  3SQ2 A;  2DFE A;  4CIF A;  1U45 A;  2O4I A;  3OYH A;  3TSU A;  4I9L A;  1SAZ A;  3C7N B;  4TSX A;  3OBW A;  4KO0 A;  4YOY A;  3WT0 A;  1BCM A;  4YOX A;  4O5F A;  3QLH A;  3CC2 N;  2V7Z A;  4DFK A;  3LDL A;  2I5J A;  3DMJ A;  5C2F A;  1QHA A;  3L3V A;  5AQK A;  3MXJ A;  2NUB A;  3QB0 A;  4X65 K;  1KQS M;  2QKB A;  1SL2 A;  3CJB A;  4CEF A;  1ZBI A;  2AP1 A;  1LAV A;  1YTA A;  5AQG A;  1E4G T;  2HBK A;  3C6T A;  3LZJ A;  1X9W A;  4ISE A;  3TAM A;  3ZSR A;  3OS1 A;  1D9F A;  4DF4 A;  4B1Z A;  2OPQ A;  4JI2 K;  1JL2 A;  1A5X A;  1B9F A;  4H0Y B;  2ZM6 K;  3T1Y K;  2YHX A;  2A40 A;  3KLG A;  5AQJ A;  1BI4 A;  1NGA A;  4KHW A;  2P9N B;  4RWT A;  4HCB A;  4RW8 A;  2HB5 A;  4KI4 A;  4OLB A;  1DGK N;  2P9U B;  4CGH A;  3F5T A;  4O0I A;  3HM9 A;  3W0L A;  2A1S A;  4IFV A;  4BRA A;  4M7Y A;  3AGR A;  2D0O A;  3KIO A;  1VQM N;  3T69 A;  4L8R B;  3RMD A;  2OTL N;  5J2Q A;  3IKM A;  1S6P A;  3VF4 A;  4OO1 J;  4FLU A;  3OJS A;  2P9P A;  3VQ8 A;  5KPT A;  2QA4 N;  4ID1 A;  5BRD A;  4H8K A;  3ZT1 A;  4GY2 B;  3LP1 A;  1TK8 A;  2ZF5 O;  2P9K B;  4NXM K;  5M1Q A;  2KFN A;  3PUF A;  3D0P A;  3LDN A;  2HNZ A;  5HRP A;  5KTQ A;  2HHV A;  1N33 K;  3PV8 A;  4YOW A;  3JSM A;  4B9T A;  1VAZ A;  1NJI O;  1IBM K;  1KXP A;  4RW6 A;  1VSH A;  3N4P A;  2X74 A;  5CHI A;  1OH7 A;  3AVB A;  5AZI B;  1S9E A;  4OPJ A;  4CJU A;  4E1J A;  3O3H A;  3FE1 A;  4J2B A;  3KLI A;  3HT3 A;  2OA8 A;  1XWL A;  4DLG A;  3OYK A;  2E88 A;  1RDA A;  3K0S A;  3KK2 A;  4DG1 A;  3U8X A;  3B8A X;  1FJG K;  1UOC A;  4GV6 A;  4AHT A;  4ISF A;  4K41 A;  3ZLJ A;  5JLF A;  4DSF A;  3NF8 A;  3CCJ N;  3M8Q A;  1TYQ B;  3VQ5 A;  1S3X A;  4H4M A;  4CBU A;  2OAN A;  3B6O A;  2OPP A;  2X78 A;  3KK3 A;  4A62 A;  1IBK K;  1ZBH A;  1DKG D;  1LAW A;  3TAB A;  1IV0 A;  2DY4 A;  4MDB A;  3MN7 A;  5AQI A;  2UUB K;  1HNW K;  3EKS A;  4WYB A;  4M3T A;  5BR9 A;  5J2M A;  1JLE A;  3EO3 A;  2IC3 A;  1VQP N;  3SUP A;  5LMU K;  4JN4 A;  3PIP L;  3K5L A;  3K5M A;  4FJJ A;  1RBV A;  1SUQ A;  4DU3 A;  4FK4 A;  1JL1 A;  3C7N A;  4IJN A;  3THV A;  4ELU A;  3BF3 A;  1GLD G;  4CHO A;  2NRZ A;  3F2K A;  4B1V A;  3P5J A;  2D1K A;  3CJ7 A;  1EWQ A;  4NB4 A;  4IG3 A;  4FJH A;  4W5R A;  3V9S A;  2OYQ A;  1FW6 A;  4EZ9 A;  1J54 A;  1RTD A;  3UB5 A;  4NXN K;  5FRO A;  3H3N O;  4BGB A;  4MLH A;  3QDK A;  2RE2 A;  1HKC A;  4GW6 A;  3KD5 E;  4M3W A;  3BZC A;  3AA2 A;  2WBN A;  1SV5 A;  4O8U A;  1OVQ A;  2G8U A;  4CZG A;  1WB9 A;  3DM2 A;  3HVR A;  3WEE B;  1NMN A;  4AHV A;  3VGM A;  4JHD B;  3ZET B;  3OYL A;  4B3S K;  3CD6 N;  2Z1J A;  4FWQ A;  4BR5 A;  4LY7 A;  2G8K A;  5C10 A;  3OYG A;  1KTQ A;  4NYN A;  4CE9 A;  4B3M K;  4K25 A;  1TAU A;  2Z1I A;  4CJ4 A;  1BUP A;  1RDC A;  4N47 A;  4JI4 K;  2P9N A;  3D2E B;  1QHT A;  1XNQ K;  1P90 A;  2YHY A;  2P9U A;  4BQZ A;  4M63 C;  3I8B A;  3R1X A;  3TI0 A;  3THW B;  3OA9 A;  1QQC A;  1GOC A;  2QWN A;  3CQX A;  3CME N;  2V51 B;  3AVG A;  1BGX T;  2P9L B;  1K8A O;  3JS6 A;  4I6M A;  4QS9 A;  4E19 A;  3VGL A;  1YTU A;  3VQA A;  4N56 A;  1SS6 A;  1MDU B;  4KHU A;  4FWR A;  3ZT2 A;  3VGK A;  3O9T A;  1TKZ A;  2P9K A;  1C1A A;  3WNF A;  4DS4 A;  3O5B A;  1KVA A;  3GBT A;  4DFM A;  2QKK A;  1XC3 A;  1VSF A;  1IG9 A;  4ZTF A;  3KKS A;  3S3N A;  3S3M A;  1B9D A;  4XH5 A;  4LF6 K;  3AVM A;  5AQF A;  4BDZ A;  1S1W A;  4C8L A;  1HYS A;  1NNE A;  4CI6 A;  3HO1 A;  4YDU A;  3RMA A;  3AO4 A;  3DXM B;  3MEG A;  3RSE B;  3LP0 A;  3TU5 A;  3E1Y A;  1NGG A;  3PIO L;  3K58 A;  3M5R A;  4CHZ A;  4CEA A;  4J2D A;  1ZBL A;  4B3T K;  3E01 A;  3LP3 A;  4JI5 K;  2D0C A;  3PY8 A;  1NK4 A;  3MX2 A;  2W6L A;  1X9J A;  5M1F A;  2ATQ A;  3E9O A;  2ZE2 A;  2HNY A;  1EQY A;  3AVJ A;  3VF2 A;  4FJ7 A;  1HKG A;  3V6D A;  3VES A;  3TR8 A;  1VSD A;  3MCA B;  3DXK A;  4ID5 A;  3HOS A;  5AQP A;  5GIN A;  2Q36 A;  5JLH A;  2QW9 A;  3O80 A;  4C8K A;  4KHP K;  3ZSQ A;  1C0G A;  2P1J A;  4FLZ A;  3CMA N;  1VSJ A;  3WXJ A;  2BH1 A;  4HCC A;  1NKC A;  4KV8 A;  4PKH A;  5C12 A;  3NGY A;  1YJW N;  5AQY A;  1WBB A;  4BE1 A;  4JKD A;  2OCE A;  3UE5 A;  3L6Q A;  4WE1 A;  3H45 C;  2DFH A;  2E4L A;  3V1R A;  3J7Y P;  2OPR A;  5M1N A;  4BE2 A;  3IUC A;  4FM0 A;  3WNG A;  1Z25 A;  3QEI A;  4OLA A;  2YHW A;  1LV5 A;  4Z4I A;  3O1W A;  5IWA K;  2HHT A;  4EAH D;  1U48 A;  3CFO A;  3WEE A;  1YVU A;  2BAN A;  4JHD A;  2E2P A;  4IOC L;  2KFZ A;  3AO5 A;  3THX A;  2G8F A;  3PO5 A;  1WSH A;  5M1O A;  5FLX O;  1RDD A;  2H3G X;  3FR0 A;  3M3Z A;  3SZ2 A;  3O9S A;  3NH2 A;  2FBT A;  2PAV A;  3H1Q A;  1U04 A;  4I9Q A;  3SCX A;  3PSF A;  1JLA A;  3W3D A;  1S1X A;  4KPY A;  1YAG A;  3HM8 A;  3JXU A;  4CGI A;  1BIS A;  5BPN A;  2XY7 A;  3THY B;  1YIJ N;  1IKX A;  4M7X A;  3LDP A;  3J80 O;  4DR2 K;  4DSK A;  4BRN A;  4KRF A;  2P9L A;  1YT3 A;  5C25 A;  3OBY A;  3VEN A;  1BCO A;  3NDK A;  4G9Z A;  1NGJ A;  4A59 A;  2NNW A;  4Q0B A;  3WXM B;  3QIC A;  3T7Z A;  1LWC A;  3EKU A;  3L2R A;  4OGC A;  3CCL N;  4KTZ A;  1UA0 A;  4KKO A;  4DTP A;  3AVC A;  4YOU A;  3NE6 A;  4BC5 A;  3LPT A;  4ILG B;  3SV3 A;  2FBX A;  3RSE A;  1N8R O;  4BDP A;  4F3T A;  1BU6 O;  5CY4 A;  3VEO A;  1VHX A;  4EFH A;  3TAE A;  3CPW M;  1I3A A;  3MDQ A;  5CZ1 A;  4BWJ A;  3CI5 A;  4FK0 A;  3D7E O;  4FW1 A;  5KI6 A;  4YOT A;  4KHQ A;  4CJL A;  4FWO A;  1N32 K;  3QFP A;  4AHS A;  2P5O A;  4FZX C;  2P9I B;  4BY9 C;  3ENH A;  2NRW A;  3V1Q A;  4BR9 A;  2ASM A;  2Q31 A;  2O4G A;  1NK6 A;  4CER A;  2QTD A;  4EIA A;  1CZB A;  4Z94 A;  1T6C A;  3V9Z A;  4PKI A;  3VEW A;  1BG3 A;  1IJJ A;  1JKH A;  1HMV A;  4O5B A;  4A5A A;  1HPZ A;  2Y1J A;  4DFJ A;  4HUG A;  1CLQ A;  4KI6 A;  1UWB A;  3OYB A;  3L2V A;  2E6M A;  3SUN A;  2WTU A;  1T3V A;  3T1H K;  1JCF A;  5CR4 A;  4E7I A;  3HJF A;  4NLB A;  1VRU A;  3S3O A;  4NYF A;  1JJ2 M;  4JLH A;  3DRR A;  3DLR A;  4JRP A;  3VMF B;  5I3U A;  2HW3 A;  4DKW A;  1S5J A;  1RT4 A;  4W5N A;  1OH8 A;  3L2W A;  1WAF A;  1K73 O;  3E9P A;  3CM5 A;  1L3S A;  5AQZ A;  3U9D A;  2KQ2 A;  4XIU A;  3ULD A;  3T1A A;  4BRD A;  3RVC A;  4H5V A;  1HUX A;  3NMU A;  4IEE A;  4H0T B;  2VG7 A;  3R6M A;  4O8K A;  1N5Y A;  4DFP A;  4BRK A;  3P31 A;  1NGC A;  3BUZ B;  5TKY A;  1VRT A;  2YKM A;  4IKF A;  3CM6 A;  2JWL A;  1C1B A;  3KJV A;  3DRS A;  3EN9 A;  1GOA A;  1J5E K;  3SI6 A;  3MK6 A;  4YOV A;  1QVF M;  3M1F A;  5J1E A;  3D45 A;  1O13 A;  3F9M A;  1GLE G;  4DV7 K;  4BGA A;  1QE1 A;  3EL2 A;  2E20 A;  4M41 A;  2HHW A;  3ITH A;  2HF3 A;  2Q97 A;  4DLE A;  3VA0 A;  3GL1 A;  4ISG A;  3F9K A;  1T8E A;  3MMV A;  1CXU A;  5LJV A;  2VGN A;  4IDH A;  4IXC A;  3M8P A;  1BIZ A;  2ETJ A;  4KHN A;  2P51 A;  2V52 B;  3H6E A;  5KQ8 A;  5F2R A;  3VQ9 A;  1TGO A;  1Y97 A;  3K5O A;  2HVI A;  4A57 A;  1SZ2 A;  5CZ2 A;  1GLF O;  5KRS A;  1T05 A;  3AVA A;  1NK8 A;  4QCL A;  2DPN A;  1EX4 A;  1D5A A;  3VQD A;  1C0T A;  1HQU A;  3QNN A;  3VQ6 A;  4UY8 O;  4WFN L;  1FK9 A;  4OVL A;  3AVL A;  4PA1 A;  1GLL O;  1Q18 A;  4CEQ A;  3I0S A;  2O8E B;  5FPM A;  1NJW A;  5BR8 K;  3VQE A;  4AHR A;  1BL3 A;  4RW9 A;  4CD3 A;  2YCH A;  4B9V A;  3O9U A;  5KPR A;  3D2F B;  3L2U A;  4FJ5 A;  3CQY A;  4BE0 A;  5AQT A;  2QWM A;  2P9I A;  4KBO A;  5C0Y A;  3OYE A;  2I7N A;  4CBW A;  1BDG A;  5C15 A;  5AR0 A;  4KRE A;  4HUE A;  1SQK A;  3DJC A;  1NK7 A;  1S1V A;  4CZI A;  2QWL A;  2QWQ A;  3ZSY A;  2E2N A;  1XHZ A;  3VPZ A;  5AFU H;  1IO2 A;  1E3M A;  4B3O A;  5EU7 A;  4DV6 K;  4BRO A;  1TVR A;  1KC8 O;  3Q7B A;  1T03 A;  3RR8 A;  1ITG A;  5BPL A;  1S22 A;  2YHB A;  3ZSW A;  3TAF A;  4FJI A;  3ULE B;  5K14 A;  1VQO N;  4KAZ A;  2WUS A;  1LWF A;  4HVJ A;  3EE9 A;  3E66 A;  1YXQ A;  3ENO A;  4FWP A;  3OVN A;  2VQE K;  1ZYQ A;  3HSC A;  2QWP A;  1A5W A;  2HST A;  3PO4 A;  5AQL A;  3VN5 A;  1U2V B;  3MXI A;  5A2Q O;  3SUO A;  4CF9 A;  4CZF A;  4RW7 A;  5KQD A;  2JWK A;  3KD1 E;  4FYD A;  3EY1 A;  4BRF A;  3IS9 A;  4GMJ B;  2FSJ A;  3O8M A;  4DV4 K;  4C1N K;  3NVM A;  2W41 A;  4H0X B;  2YJE A;  3DLK A;  3OYI A;  3K59 A;  1KD1 O;  3AVI A;  1MWK A;  4F8R A;  4PL7 A;  3BGR A;  3DWL A;  1R59 O;  2FSN A;  4BRI A;  2BUP A;  3QIO A;  2YV0 X;  5HP1 A;  2ZQB A;  1RT3 A;  3G10 A;  2A6A A;  4O4G A;  5HRS A;  3VTI A;  5JS2 A;  3BEX A;  2FF6 A;  2QXF A;  4LC9 B;  4DQS A;  3SYZ A;  2F7T A;  2UUC K;  4CBX A;  1ATN A;  4A61 A;  2IVO A;  3CJ9 A;  1U4B A;  1KRP A;  4CF8 A;  4CJ5 A;  3ZX3 A;  3SQ4 A;  1R0A A;  4B1Y B;  1C0M A;  2ZD1 A;  1WBD A;  4H5N A;  1N36 K;  4AH9 A;  2GTD A;  2D4W A;  3AVN A;  3KK7 A;  4AHU A;  1RT2 A;  1G99 A;  4Y1C A;  4JKA A;  1SKS A;  2IDO A;  2E1Z A;  4E0D A;  4DTS A;  3V9W A;  2ASO A;  5CYQ A;  2PYL A;  2IVP A;  5AQO A;  1LW2 A;  3O9Q A;  1ASW A;  3CYM A;  4OGE A;  3U4L A;  4PKG A;  1OH6 A;  4FLV A;  5F0X A;  3VEZ A;  1XHX A;  1NJZ A;  4FJK A;  3IG1 A;  4DTU A;  5KRT A;  4EHT A;  1I39 A;  4CEZ A;  3R3L A;  4BVP A;  3L4I A;  4OX9 K;  3HI0 A;  1HQE A;  1EET A;  4RG8 A;  4W5T A;  3OYN A;  4DR5 K;  4PUO A;  4ZHR A;  4DTN A;  3SAF A;  4WCE L;  2HOE A;  1BO5 O;  3O9R A;  4FOE A;  4HWI A;  2JGU A;  3FFI A;  2I7P A;  4JKE A;  5C2D A;  3VA3 A;  1IKY A;  1NGD A;  2GWK A;  2HBJ A;  1UAX A;  3HBT A;  3SMP A;  1EKE A;  3D2F A;  4R79 A;  1WSJ A;  1BWF O;  2FF3 B;  4B9M A;  2O8B B;  4BAC A;  1QSY A;  3FZM A;  3TSQ A;  3LM9 A;  5FPD A;  4HUF A;  4FLT A;  3ZSX A;  3SBG A;  2YNF A;  5E41 A;  3BDP A;  2UXC K;  3ALY A;  3J7Z O;  4K8Z A;  5AQX A;  1RBU A;  1NJY A;  3OS2 A;  4LF5 K;  3C65 A;  3H1V X;  2O8C B;  3ZEU B;  3ULE A;  4X62 K;  4QAG A;  4DUY K;  4B9Q A;  3CCM N;  4HHT A;  3M8S A;  5BRE A;  2YI1 A;  2GUI A;  1DTT A;  1NOZ A;  1IKW A;  3PX0 A;  3KWI A;  3O4N A;  5AQS A;  1TUU A;  1JLG A;  4JI6 K;  3CCR N;  1NOY A;  1REV A;  1U2V A;  1LWE A;  3SV4 A;  4MO4 A;  4CIE A;  3QEV A;  3VQ7 A;  1HX1 A;  4DWI A;  4K42 A;  3EYZ A;  1LCU A;  1Z05 A;  3MAQ A;  4J2E A;  3OYC A;  2PBD A;  2HHQ A;  1JXB A;  3GDQ A;  4RCH A;  1HJO A;  2VG5 A;  3WQU A;  3KLH A;  4GVE A;  5AFU A;  2YJF A; 
#chains in the Genus database with same CATH homology
 4YDU C;  5JVH L;  2P9L A;  1J6Z A;  3O4W A;  4IJA A;  3OBY A;  4BR4 A;  1DEJ A;  1VQ6 N;  3VEN A;  3IDH A;  1RDU A;  3K9K A;  1YUW A;  4JK9 A;  3L4Q A;  2NRR A;  4BR7 A;  4G9Z A;  5F1X A;  3HRG A;  4HTL A;  1NGJ A;  3MCP A;  4A59 A;  1RGI A;  2NNW A;  4A2B A;  3CXC M;  4PL8 A;  3TTD A;  3FLC O;  2FXU A;  3QIC A;  3T7Z A;  3WXM B;  4J8F A;  4A2A A;  3EKU A;  1QQO A;  1M1K O;  2CGJ A;  5AZI A;  2HF4 A;  3CCL N;  3P39 A;  4BR0 A;  1Q81 O;  3GE1 A;  2QWO A;  4B1U B;  3A0I X;  2NZT A;  4YOU A;  4KH6 A;  2BTF A;  3A5O C;  1NM1 A;  4BC5 A;  1OKJ A;  3KHY A;  4ILG B;  3WUH A;  1YVN A;  1VQK N;  4H0O A;  1JCE A;  2NLX A;  5BPM A;  3RSE A;  3IMX A;  4WFA L;  3G71 N;  1BU6 O;  2RHK A;  3VEO A;  4IFE A;  1ATS A;  4QS8 A;  5AQV A;  5FPE A;  5M1K A;  5AZJ A;  4EFH A;  4BRH A;  3CPW M;  3MDQ A;  3CI5 A;  3MWP A;  1T6D A;  1TYQ A;  2Q0U A;  2P9S A;  3D7E O;  4GV9 A;  4YOT A;  1GLA G;  1ZC6 A;  2A41 A;  4JKG A;  4AM7 A;  4FWO A;  3DXK B;  5GAG P;  1ESV A;  3QFP A;  2CH5 A;  1CZA N;  4MO5 A;  2CH6 A;  1Z6R A;  2ZJQ L;  3TSU A;  2P9I B;  4BY9 C;  1SAZ A;  3C7N B;  3CCV N;  3OBW A;  3ENH A;  4YOY A;  2NRW A;  1U6Z A;  3WT0 A;  1MWM A;  4BR9 A;  4YOX A;  4O5F A;  3CCE N;  3ID8 A;  4FSV A;  3CC2 N;  3FGU A;  4CJ7 A;  2ASM A;  4FPA A;  3DAW A;  2V7Z A;  2Q31 A;  3LDL A;  1NGI A;  5C2F A;  1QHA A;  2QTD A;  2NRT A;  5AQK A;  4EIA A;  3QB0 A;  1KQS M;  2HBM A;  2VWB A;  3SBT A;  1VQ8 N;  3CJB A;  4Z94 A;  1T6C A;  2HMP A;  2AP1 A;  3CIP A;  3IFR A;  4PKI A;  3VEW A;  1BG3 A;  1IJJ A;  1QZ5 A;  5AQG A;  1E4G T;  4A5A A;  3ATV A;  2HBK A;  5AQQ A;  5EX5 A;  3KVG A;  4FVU A;  4YOR A;  1T3V A;  5M1P A;  3UKU B;  3CCU N;  1JCF A;  5CR4 A;  2IIR A;  4ISE A;  2VYP A;  4NLB A;  1GLC G;  1V4T A;  3HTV A;  3FZK A;  1JJ2 M;  2WFB A;  3KWG A;  1NBW A;  4B1Z A;  3QML A;  5ADX H;  3AAP A;  3VMF B;  4BRP A;  3A5L C;  3J8A A;  1X3N A;  4DKW A;  4H0Y B;  1YIT N;  1QQN A;  1YJN N;  4JK7 A;  1P8Z A;  3BF1 A;  5GIO A;  2YHX A;  3K9J A;  1WOQ A;  2A40 A;  4XH1 A;  4WFB L;  5AQJ A;  1NGA A;  5EVZ A;  4IEI A;  3ZET A;  2P9N B;  4RWT A;  5GIP A;  1K73 O;  3E9P A;  5AQW A;  2CGK A;  1RFQ A;  5AQZ A;  3ZYY X;  1DGK N;  2P9U B;  3U9D A;  3F5T A;  3VEY A;  2OTJ N;  3VTH A;  2D0P A;  4JKC A;  3W0L A;  1XUP O;  4BG9 A;  1Q7Y O;  4MLE A;  3ZEU A;  4BRD A;  3RVC A;  2KLA A;  2GX9 A;  1HUX A;  4H5V A;  4BRA A;  4IEE A;  4H0T B;  4O8K A;  3R6M A;  4DHY A;  4M7Y A;  3NMU A;  3D2E A;  4BRL A;  3AGR A;  2D0O A;  1VQM N;  4CZJ A;  3T69 A;  5JVG L;  5AQR A;  1LOT B;  3A8Y A;  3EZW A;  4WQ5 C;  3ID6 A;  4BRK A;  3P31 A;  3TTC A;  1KAZ A;  2OTL N;  1NGC A;  3BUZ B;  2HBL A;  3IKM A;  3VF4 A;  4PHT X;  4JD2 A;  2ZJP L;  4GNI A;  1K8K B;  4OO1 J;  3N4Q A;  5TKY A;  2P9P A;  1NGE A;  3UKR B;  5KPT A;  4BRQ A;  2JWL A;  5BRD A;  4BR2 A;  3HOT A;  2QA4 N;  3EN9 A;  2NRH A;  3A5M C;  4JKH A;  4IO9 L;  4GY2 B;  3P4I A;  3MK6 A;  4L3Q A;  4YOV A;  5GAD P;  5B8H A;  1QVF M;  3M1F A;  1Q82 O;  3MWT A;  2ZF5 O;  2P9K B;  1O13 A;  3G6E N;  3F9M A;  1GLE G;  5M1Q A;  3C6A A;  5TKW A;  4BGA A;  3D6R A;  3EL2 A;  3LDN A;  3OW2 M;  2E20 A;  2QI2 A;  2HF3 A;  2IVN A;  2Q97 A;  4F9O A;  3I33 A;  3MN9 A;  5E84 A;  3C6H A;  3CJ1 A;  3GL1 A;  2YX6 A;  4FWK A;  4ISG A;  4YOW A;  4FWM A;  1NGF A;  1VAZ A;  3FZF A;  4H5T A;  1NJI O;  1KXP A;  3N4P A;  3VET A;  3MMV A;  5GAE P;  5CHI A;  5LJV A;  2VGN A;  4IDH A;  4IXC A;  1OVY A;  5AZI B;  5HL7 L;  4E1J A;  3FE1 A;  2V52 B;  1QVG M;  2FSK A;  3H6E A;  5KQ8 A;  1RDW X;  4FL9 A;  5F2R A;  1T44 A;  3DXM A;  2E88 A;  2ZGZ A;  3U8X A;  3B8A X;  4A57 A;  3C0B A;  3SMS A;  2E8A A;  4GV6 A;  4ISF A;  5I9E B;  2QEX N;  1SZ2 A;  1C0F A;  4K41 A;  1GLF O;  1NMD A;  5JLF A;  3NVK A;  1S72 N;  3CCJ N;  1VQN N;  2DPN A;  1TYQ B;  1M90 O;  3H3O B;  3CCS N;  1S3X A;  4RTF D;  4CBU A;  2OAN A;  4CZE A;  2J4R A;  5LJW A;  4WFN L;  4A62 A;  4UY8 O;  4IOA L;  5AQH A;  3CPE A;  3O1B A;  1DKG D;  4CZK A;  4IWV A;  5E26 A;  1NLV A;  4MDB A;  3MN7 A;  5AQI A;  1GLL O;  1Q18 A;  3EKS A;  4U67 L;  1E4F T;  2PFU A;  4WYB A;  3QBX A;  3VER A;  5FPM A;  5BR9 A;  2W40 A;  4CD3 A;  3EO3 A;  2YCH A;  4GV3 A;  1VQP N;  3TSP A;  3O9U A;  1YF5 L;  3ATU A;  4JN4 A;  5KPR A;  3GOI A;  3PIP L;  3D2F B;  3CJC A;  3CQY A;  2ITM A;  1VQL N;  5AQT A;  2QWM A;  2P9I A;  1W2B M;  4BRM A;  4KBO A;  2A3Z A;  3C7N A;  4FWL A;  4IJN A;  1HKB A;  5C0Y A;  2I7N A;  3BF3 A;  4CBW A;  1HLU A;  5KPZ A;  1BDG A;  1GLD G;  3AAQ A;  5C15 A;  4WQ4 C;  2NRZ A;  3F2K A;  5AR0 A;  4B1V A;  4H03 B;  2D1K A;  3CJ7 A;  4Y0W A;  4NB4 A;  1SQK A;  3DJC A;  4H5W A;  4EHU A;  4FWS A;  2QWL A;  2QWQ A;  4C1N I;  3A5N C;  2E2N A;  4FO0 A;  4CZI A;  3VPZ A;  5AFU H;  3TTF A;  3VEX A;  4BRO A;  5HOO A;  3UB5 A;  3MN5 A;  1KC8 O;  1BA0 A;  4BGB A;  3H3N O;  4FWN A;  3SAH A;  3Q7B A;  4MLH A;  3QDK A;  5LY3 A;  2RE2 A;  1HKC A;  3WXL A;  5BPL A;  2QWR A;  1S22 A;  2F9W A;  1EO1 A;  4U7B A;  3ULE B;  2KHO A;  2WBN A;  1NGB A;  3FFK B;  4FOI A;  2QM1 A;  4C23 A;  1VQO N;  4O8U A;  5DM6 L;  4CZG A;  2WUS A;  3EE8 A;  3WEE B;  3EE9 A;  3KZB A;  3VGM A;  3E66 A;  2E2O A;  4JHD B;  3ZET B;  1YXQ A;  1K9M O;  3ENO A;  4FWP A;  3CD6 N;  4BR5 A;  4FWQ A;  3QFU A;  3MN6 A;  5C10 A;  3HSC A;  2QWP A;  5EY4 A;  2HST A;  3U9Z A;  5AQL A;  1U2V B;  3O6W A;  4K25 A;  2ZGY A;  4NLC A;  2NRV A;  1BA1 A;  1BUP A;  1GLB G;  4JAX A;  2P9N A;  3D2E B;  4K43 A;  4CZF A;  5KQD A;  1IG8 A;  3SJH A;  1P90 A;  2YHY A;  2JWK A;  4NO7 A;  5BRH A;  2P9U A;  1TUY A;  3VOV A;  1V4S A;  4M63 C;  3I8B A;  3R1X A;  4BRF A;  4BQZ A;  1ILY A;  3VF6 A;  2FSJ A;  3OA9 A;  3O8M A;  4JKB A;  4C1N K;  3NVM A;  1VQ7 N;  4MDA A;  2W41 A;  2QWN A;  4H0X B;  5AQU A;  2YJE A;  3CQX A;  3VEV A;  3CME N;  3CF5 L;  1KD1 O;  2V51 B;  1MWK A;  4B1X B;  4PL7 A;  2P9L B;  4BC4 A;  3DWL A;  1R59 O;  1K8A O;  3JS6 A;  2FSN A;  4I6M A;  4QS9 A;  3WXK A;  3UKR A;  4BRI A;  2VCP A;  2BUP A;  3I55 N;  4FPB A;  3FZL A;  3VGL A;  1X3M A;  4JEP A;  2A6A A;  1SS6 A;  1MDU B;  3ZX2 A;  4FWR A;  1GLJ O;  3E9L A;  3VTI A;  2E1Y A;  3BEX A;  2FF6 A;  3O9T A;  1W97 L;  2VGM A;  4LC9 B;  3VGK A;  2P9K A;  4WQ5 A;  4A5B A;  2F7T A;  3O5B A;  5EOY A;  4CBX A;  3GBT A;  1ATN A;  1XC3 A;  4A61 A;  4BC2 A;  4DQ8 A;  2IVO A;  3CJ9 A;  1KAX A;  4QS7 A;  5ADX A;  2GUP A;  3ZX3 A;  4JKF A;  4XH5 A;  4B1Y B;  4BG8 A;  4CZL A;  3H46 O;  4H5N A;  5AQF A;  3R8E A;  3AGK A;  1ZBS A;  4CI6 A;  2GTD A;  2D4W A;  4YDU A;  3KK7 A;  1N8R O;  1VQ9 N;  4XH4 A;  3DXM B;  4JNE A;  3RSE B;  3TU5 A;  1G99 A;  3E1Y A;  5AZJ B;  5AQM A;  1NGG A;  4JKA A;  3PIO L;  3M5R A;  2E1Z A;  2AA4 A;  2ASO A;  4ILJ A;  1KAY A;  2P9S B;  2IVP A;  2CGL A;  5AQO A;  1Q86 O;  3O9Q A;  4JKG B;  3U4L A;  4PKG A;  4CD1 A;  3AAR A;  2UYT A;  3S41 A;  5F0X A;  3VEZ A;  1QZ6 A;  3MX2 A;  1X9J A;  2GWJ A;  3WXI A;  4BC3 A;  5M1F A;  2E2Q A;  2Q1N A;  3E9O A;  3CJA A;  4EHT A;  3G4S N;  1EQY A;  3VF2 A;  1HKG A;  3R3L A;  4BVP A;  3L4I A;  2A42 A;  3VES A;  3HI0 A;  4BRC A;  4IO8 A;  4IOX A;  4BRE A;  3MCA B;  3SLC A;  3DXK A;  3CET A;  5MLC Q;  3HZ6 A;  3HOS A;  5AQP A;  3SAF A;  4WCE L;  5JIC A;  5GIN A;  2Q2R A;  2HOE A;  2Q36 A;  3O08 A;  1BO5 O;  5JLH A;  3CHW A;  3WQT A;  3O9R A;  1YI2 N;  4FOE A;  4BQL A;  4HWI A;  2QW9 A;  3O80 A;  3AY9 A;  2I7P A;  4KH5 A;  3SAG A;  4JKE A;  5C2D A;  1NGD A;  2GWK A;  2HBJ A;  4H5R A;  5CE3 A;  1YHQ N;  2ASP A;  3HBT A;  1C0G A;  4WF9 L;  3SMP A;  3CMA N;  3D2F A;  4R79 A;  4JK8 A;  5JMV A;  3WXJ A;  4DCH A;  2BH1 A;  1BWF O;  2FF3 B;  3G25 A;  3GG4 A;  5H1S Q;  4H0P A;  3FZH A;  5DM7 L;  4CZH A;  4PKH A;  5C12 A;  4AF1 A;  3CC4 N;  1YJW N;  3FZM A;  3UKU A;  3TSQ A;  2KKZ A;  3DLL L;  3LM9 A;  5AQY A;  5FPD A;  4OPA A;  4XEI A;  3L0Q A;  3LL3 A;  3LM2 A;  4JKD A;  2FLO A;  2GEM A;  3Q7C A;  3QBW A;  3L6Q A;  3SBG A;  3UE5 A;  2ZWH A;  2WC9 A;  3ENB A;  3H45 C;  5GAH P;  5M1N A;  3IUC A;  4BRG A;  3LDO A;  4B1W B;  4DB3 A;  3J7Z O;  5ELZ A;  1ZXO A;  4WQ4 A;  5AQX A;  4KH4 A;  1ATR A;  2EWS A;  3C65 A;  1VQ4 N;  3H1V X;  4ILH A;  2YHW A;  3P38 A;  3SK3 A;  3TPQ A;  3O1W A;  3ZEU B;  3ULE A;  2V7Y A;  2A5X A;  4EAH D;  4B9Q A;  2GEL A;  2NRX A;  3I56 N;  3CER A;  3CCM N;  5BRE A;  1QQM A;  2YI1 A;  4H0V B;  3CCQ N;  5AQN A;  3WEE A;  5BN9 A;  4CZM A;  2Q0R A;  5EXW A;  3CC7 N;  1HPM A;  4JHD A;  1BOT O;  2E2P A;  3KWI A;  4IOC L;  1VQ5 N;  1MA9 B;  4JD2 B;  5AQS A;  1TUU A;  1NGH A;  2P9P B;  2F9T A;  3ZX0 A;  2ZJR L;  3CCR N;  3BP8 A;  5M1O A;  1U2V A;  4BVO A;  1YJ9 N;  3OHR A;  5BRF A;  4OPH A;  2H3G X;  3MX5 A;  3FR0 A;  4MO4 A;  4AM6 A;  3M3Z A;  1D4X A;  3O9S A;  3H1Q A;  2PAV A;  5FPN A;  1HX1 A;  2QXL A;  4K42 A;  1K8K A;  1LCU A;  1Z05 A;  3PLA A;  1XQS C;  1JCG A;  2PBD A;  3W3D A;  3GDQ A;  1YAG A;  4I6M B;  1H1V A;  4RCH A;  3HM8 A;  4IZ9 A;  3JXU A;  3R9P A;  5BPN A;  1NWK A;  1HJO A;  3WQU A;  1YIJ N;  4M7X A;  5BN8 A;  1DT9 A;  3LDP A;  1WUA A;  1Y64 A;  3LDQ A;  4GVE A;  5AFU A;  3M6G A;  2YJF A;  4BRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...