1JLEA

Crystal structure of y188c mutant hiv-1 reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
549
structure length
524
Chain Sequence
PISPIETVPVKLKPGMDGPQWPLTEEKIKALVEICTEMEKEGKISKINPYNTPVFKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGANRLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 133
structure length 524
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jleA05
2KQ2A 2IOCA 1U48A 4MKBA 4KKOB 4Y3CA 2VA3A 3KK1B 1RT4B 4GC7A 4FLZA 4NCBA 4IBNA 2EC0A 1NK5A 1DTTA 3QLHA 1LWEB 4MIAA 2JEJA 4FYDA 3VQCA 1YVUA 4FLYA 3CFOA 2BQ3A 2JC0A 5HRPA 3L2VA 4BWMA 4AHUA 4QWEA 1S48A 1C0UA 1ZBUA 2O4GA 3Q8RB 3QNOA 4YNQA 2R8GA 3H98A 4ZVGA 3L2WA 4FZYA 4ZPBA 4CJRA 4FJJA 3ZT1A 1SKSA 1RDCA 4BE2A 4CJPA 2UVUA 1EKEA 3FSIA 4F4ZA 1ZETA 4Q45A 4O44A 1JLGB 2R8IA 4QCLA 3KNAA 4LH4A 5DGAA 2IM0A 4G1QA 3QERA 2RF2A 1N6QB 1T05A 1UA1A 1S4FA 1IKWA 1KLMB 3D5MA 3QYYA 3IGVA 3PX6A 1SL1A 1TL3B 4WZQA 2W7OA 3RMBA 2W42A 4TN2A 4HUGA 4BDPA 2F8EX 2D0CA 3K5NA 1QSSA 1ITGA 3T5KA 2G8WA 4CK1A 3EPGA 4U6PA 4IFVB 3IAYA 2O4IA 4CERA 3NGIA 1S1WB 3TI0A 4CJWA 2G8FA 1TVRB 1TL1B 1JX4A 1REVA 2V9WA 3V9SA 2Q3SA 4AHRA 3MEDB 3I0RA 4OKJA 1IO2A 4KO0A 5KFIA 1ZYQA 3NAHA 3KHRA 2DFHA 1LW0B 3L3VA 3I5AA 4QW8A 4DU4A 4DLEA 4KFBA 3VQEA 5C25B 4CIEA 1TAUA 4B9TA 4NLWA 2UUTA 1VSDA 2IM2A 1RT6B 3L3UA 5C42B 2PY5A 4DFPA 4Z4FA 2AU0A 1J53A 1NHVA 1UOCA 3DOLB 4RW6A 4HCBA 3CDEA 3JYTB 3KLGB 1X9MA 3QO9A 2XGQA 1RDDA 2BRKA 3MTKA 3K2PA 1HQUA 3G6YA 1TV6B 3MAQA 4RW6B 2DPIA 4O3RA 3I0SA 2G8HA 4FJKA 4CFAA 5HP1A 2A1SA 1U09A 5KFQA 4O5BA 1BCMA 2D41A 3NL0A 3NHGA 1LWEA 1WNSA 2UVWA 3E01A 1OS5A 1BL3A 2QKKA 4I2PA 3KK3B 4ZMMA 4OJRA 5F9LA 3ICLA 5EWEA 3ULDA 3I0RB 4DQIA 4TYBA 4MK8A 4CGJA 1J9AA 3MR2A 4LD0A 4F8RA 2OPQA 4J9PA 1QAJA 3NKYA 3HPGA 4DTSA 4C8LA 3CFPA 4IOBA 4PUOA 3OS0A 3MFHA 5DGBA 3BR9A 3UQSA 1X1PA 1TK5A 4LQ9A 3GIMA 4DQPA 1TKDA 4WFXA 4RNOA 4BDZA 3EZ5A 3PJXA 3NAEA 4KV8B 5HROA 5CYQB 1IKWB 4DTPA 3KLIA 1S1UB 3QEWA 4RUCA 5KG4A 1DTTB 4HKQA 2WK4A 2W8KA 3O3HA 3V81A 3V1QA 3OL9A 4I7FB 1U47A 4NYNA 3L8BA 1RDRA 1Y97A 4C8NA 2ALZA 1HPZA 4KBIA 3NF7A 1TVRA 5CYMA 2YKMA 3KLHB 2JEGA 3GV7B 4OLAA 1VSHA 1T03B 2BANB 4CGGA 5JXSA 5KGWA 2RKIA 1Q9YA 3KLFB 1LWFB 3LZJA 5KFKA 5EUHA 2GBZA 1S9EB 1RAJA 1C2PA 3MEGB 2HVHA 2NUBA 4FM2A 3ZT2A 3H4DA 4FLWA 3RMDA 4H4MA 3B6OA 4FLUA 4CIGA 4EBCA 4IDKA 4EBEA 1KTQA 3PY8A 3SQ4A 1SH2A 4O55A 3MF5A 3V9ZA 1TKZA 1S9EA 3QIDA 5KFLA 2XCPA 1A5VA 3VQBA 1D9DA 1RT4A 1JLBA 3P5JA 4F4WA 1VSMA 4FBUA 2RDJA 3OVNA 4NYFA 1LAVA 1S1UA 5DQGA 2ZD1B 1C1BA 1XHZA 3CWJA 2CJQA 4RW7A 1JL1A 1ASVA 4N76A 3HVAA 4C8KA 3NH0A 4QOZB 3Q8SB 1SKRA 4RW9A 1F21A 5J2QB 5J2PA 5DLGA 4IRKA 4YR3A 3M9MB 2AWZA 1VSJA 2ITGA 4DQRA 1HNIA 1T8EA 4RNHA 3TAQA 3DLKB 2XY6A 3DYAB 5K14B 4DU1A 2RKIB 3MEGA 2D5RA 4CF2A 2JEIA 1GOBA 1JXLA 4ZPAA 4CEQA 1K1SA 4IG0A 3BQ2A 2ASJA 2UVVA 2HAIA 3AO2A 1CZ9A 5KFYA 1KVAA 3AA2A 1XR7A 3VA0A 3ZSOA 1SUQB 3AO1A 4R8UA 3L2RA 4JS5A 4CJTA 3CG7A 3HK2A 3SI6A 1W25A 3LDSA 3I0SB 3ZT3A 5F8JA 4C8MA 5KFHA 3RBDA 1L3VA 1I3AA 3DM2B 3RRGA 4KHNA 2IBKA 2HHVA 3RMAA 4IFYB 3SZ2A 4XPCA 4EZ6A 4F3TA 3V6JA 4KHMA 3RB0A 1BHLA 1TK0A 3IS9A 2BQRA 3DDKA 5KG2A 1L3UA 3LWMA 3LP1A 1SV5B 4J9RA 4WZMA 4H4OA 2W8LA 4FLXA 4RUAA 4DSLA 2X6NA 4DLGA 4FJ9A 4CJVA 1BI4A 3BSOA 4NZ0A 3CDWA 4O3OA 1R0AA 3PUFA 4CGIA 5C24A 4KO0B 4ECRA 4DSFA 1XWLA 3U3YA 3CJ2A 2YV0X 4FJ7A 1KHWA 4C8OA 3IN5A 3ZSQA 1D0EA 4EZ9A 1RT7A 1LWCA 4J9OA 3V4IA 2G8IA 1TKZB 1MU2B 3H5SA 2HWHA 1S6QB 4DF8A 4ZPDA 2C2RA 3BGRB 3LALA 5KFOA 1O1WA 4DQSA 3ZSRA 3HYFA 3E01B 4ZHRA 1X9SA 4IH5A 1KVBA 2V4RA 4CEAA 1L3TA 3DLGB 4I9LA 3KKRA 2YNGB 3DMJA 2EHGA 4RG8A 2YKNA 4EP5A 4KAIA 1TKXB 3BREA 4ECQA 4B8AB 1BQMB 2C2EA 5KTQA 1HNVB 2XCAA 4WE1B 2OYQA 1B9FA 5L1KA 3OL7A 5L9XA 3Q8PB 1N4LA 2W9CA 4E89A 1D8YA 3UR0A 4IG0B 4FBTA 3PR4A 3WNGA 3G86A 2BGGA 4G1QB 2XY8A 2RN2A 4E19A 1NJXA 3OYAA 1KSPA 2FC0A 4FLTA 4IDKB 1FXXA 2KFNA 2C2DA 4OKKA 4TY8A 4DMNA 1KFDA 3S3MA 4TY9A 5DK5A 1SH0A 4RW7B 1NK8A 3KLGA 2DTUA 2BDPA 4J9MA 3AO4A 1GOAA 1TKTB 3AV9A 4CEEA 4GVMA 5T14A 3VQ6A 1ZBLA 4EO6A 1TP7A 4Y2CA 2R2TA 4NCGB 2X74A 3D28A 3SCXA 4BE0A 2VG7A 1EX4A 3HPHA 2OPPA 2FLNA 5FRMA 3O4QA 2Z1GA 1QAIA 4J9KA 4B08A 3IG1B 4MKAA 4W5TA 1ZBFA 4ECSA 1RBSA 2HNZA 4DG1A 3SFUA 3TQ1A 4DFMA 5D3GB 2XY7A 3EY1A 2VG5A 2YNIA 4OGCA 4R5PA 3OYCA 3F9KA 3NH1A 4PUOB 1FKPA 4CHZA 4MH8A 2GIRA 3RBEA 2KW4A 3HO1A 4UQGA 4J2BA 1SH3A 3BSCA 4KB0A 3QEPA 1GX6A 1HMVA 3T5LA 4HCCA 3N6LA 1ASWA 3V9XA 3NBPB 3C6TA 3SV4A 5KG6A 2YNGA 3DMJB 4KTWA 3CYMA 4YP3A 4E0DA 4JV1A 2XI2A 3SUNA 4NLOA 4OPKA 2HVIA 1JLEA 3VQDA 4H8KA 3HT3A 4N41A 3MXIA 5DMRA 1ZTWA 1WNEA 4XO0A 3PJWA 1RT1B 2BRLA 5F8GA 2I1RA 1W0HA 1BIUA 5KFNA 3V9WA 5FROA 4M3ZA 4N47A 4B9NA 1T94A 4B9VA 1SUQA 3FFIB 4ECXA 4CHOA 5DG9A 4MFBB 3BGRA 1RA7A 4NLPA 5KFSA 3SQ2A 1T05B 3QIPB 1C1AA 2FBTA 3QZ8A 3VQ5A 1EETB 2ATQA 3CJ3A 4M3RA 4AILC 3M9NB 3QGGA 2AJQA 2E4LA 3PR5B 4NCGA 3VQPA 3OYLA 3MECA 1JLQB 4FZZA 2VWJA 1WSIA 3UDLA 3RAXA 2YKNB 1RTJA 4QWDA 1S0OA 2OPRA 1QHTA 3C94A 2JC1A 3AA3A 4JRQA 2ZE2B 3H5YA 1J54A 4O3SA 4RNNA 2E9ZA 1XR5A 2FLPA 3TAGA 4TQSA 1IH7A 1RCHA 4PWDA 4N56A 2P5GA 4ECUA 4O4GB 3HP6A 1NNDA 4R5PB 4RU9A 1RBVA 1RT7B 4Y1CA 3RMCA 3N6NA 5JS1A 5F9NA 1RBRA 4F50A 4EO8A 3HP9A 2D3ZA 4HTUA 4OLBA 1L5UA 2W9AA 3DI6A 3T5HA 4CE9A 3IRXA 2KFZA 3QGHA 2HWIA 1XC9A 4EP4A 4Q8EA 2XWYA 2W9BA 2B5JA 4DTXA 4Z4GA 5KFCA 5J2MA 2HMIA 3CDUA 1RILA 5J2NA 3KJVB 3Q8QB 1T7PA 1T03A 1JLCB 3AVJA 4URQU 4KHYA 4CEDA 3HM9A 5T7BA 3OS2A 1JLEB 2F8SA 2YHBA 4DEZA 3OYHA 3M8SA 5KRSA 3SYZA 3AO3A 3RB3A 4ED8A 5DQIA 1RT3A 3DRRB 1TAQA 2E9RX 3V6KA 2ATLA 4KFBB 2PZSA 2JLEA 3LP0A 2HW3A 4PWDB 3DLBA 1N6QA 4DTUA 1Z25A 2HHTA 2WTFA 4YQWA 1CXQA 1TQLA 3PZPA 3TAFA 3TAMB 4L8RB 3GIIA 4CJLA 5I3UB 4M3YA 3CO9A 3IRXB 4M3WA 1N56A 4M3UA 4FJGA 4NCAA 5HROB 1CZBA 4F3OA 3OHAA 4CEOA 4IR9A 1D9FA 4QAGA 3H5XA 1YVFA 4WXOA 4X2BA 4XPEA 5DQHA 2P5OA 4FW2A 3EPIA 5KFTA 4IH7A 3KTQA 4M41A 3KK2A 4E1NA 4CHQA 4M42A 1S1XB 3ZSZA 3ITHA 2IJNA 4NLXA 1KVCA 4DSIA 1HNVA 5KT3A 3SUOA 3CVKA 1C1CA 2W7PA 5C5JA 5DG7A 3CM6A 4Y34A 3BDPA 1RYSA 1T3NA 1UWBB 1XI1A 2F96A 4N5SA 1DLOB 2J6SA 4M3XA 2WONA 4DSKA 4ECWA 1NJWA 4URSA 4LY7A 1U45A 3O4NA 5FDLA 3B6PA 3HL8A 4QWBA 1D1UA 1QS4A 4ZP8A 4I9QA 3K5MA 4GMJB 3C6TB 2JGUA 3MR3A 3V6HA 3H5UA 3K59A 4KKOA 4PQUA 1WSHA 3HXMA 3RAQA 1JLQA 2C22A 3M8QB 1KLNA 3FDSA 3D45A 1RTHB 2HHSA 4KPYA 1UA0A 4TLRA 2R2RA 1BCOA 1LV5A 4AH9A 4CESA 3VQAA 1K6YA 3DRSA 1WN7A 3OYDA 4ED6A 1ZBHA 3JSMB 4FJ8A 3TR8A 1RDBA 5KFRA 4K4YA 1QTMA 3DLKA 2V4QA 5KGXA 5J1EA 4E1MA 4HUEA 2VG6B 1S97A 5KT6A 1REVB 4ICLA 3PW2A 3OJSA 4KTQA 1FKPB 5KFGA 4KI6A 4CHPA 1C0TA 1FK9B 1HQUB 2IJFA 2YNIB 3M9OB 2Z1HA 4ZP6A 3T1AA 3RB6A 2AGQA 4Z4CA 1TKTA 2D7SA 2HHQA 3MFIA 4FVMA 4E7HA 1YTAA 4ED3A 4ECTA 4K4TA 4K4ZA 5CZ1A 5J2NB 4W5QA 3U6FA 5JS2A 4JRPA 3KK2B 4B9SA 4ED2A 4CGFA 2FBVA 4FJLA 3SNNA 4KHWA 5JUMA 1D5AA 4OPJA 3EZUA 4CFDA 4IFVA 4E7IA 2R7YA 3CM5A 3K57A 1NOZA 3NAIA 2BANA 3VQ7A 1U4BA 5KFPA 3NH2A 1MMLA 3DYAA 4F2SA 2V0NA 4ZVHA 1IG9A 3UPFA 3GV5B 1HNIB 4LSNA 4WFYA 3S3OA 3D0PA 3QEVA 1VRTB 3KHHA 2HNDB 2OPQB 5KI6A 2IC3A 4E7KA 4ZTFA 1RBUA 3DLEB 4F4YA 5C25A 3E51A 5F8LA 4ZPCA 4IQXA 3QGIA 1HMVB 1X9WA 2J6TA 2IAJA 3V81B 5KFMA 4MFBA 2FJVA 3OHBA 4CF9A 3FQLA 4IG3B 2B43A 3ZSVA 4E3SA 1IM4A 4KB7A 4NLVA 4ZHRB 4RNFA 3CJ4A 3OL8A 5KT4A 3CQ8A 3C95A 2AGOA 5KG7A 4ZVEA 3MECB 1RYRA 4O3PA 2OPSA 5I42B 3KLFA 5J2PB 5J2QA 3JSMA 1N5YA 2BE2A 4NLUA 2VG6A 3LP2B 1RNHA 3AVHA 3L2UA 3AVBA 2I5JB 3G6VA 3KK3A 4KHSA 1BI4B 1BQMA 1IKVA 1QUVA 4BE1A 1HQEB 2IDOA 1JLGA 1S10A 1JLBB 4CIFA 4DS4A 2F8TA 1QSLA 2FVPA 3FQKA 3GILA 4TSXA 2GV9A 4CHYA 2GC8A 2C28A 2YNHA 3VA3A 3QINA 5KG3A 3MEEA 3JYTA 1VSIA 3V4IB 4BDYA 4CJQA 5KFWA 4F2RA 3ZT0A 3SQ1A 1Z26A 3OSNA 1L3SA 4DS5A 3DM2A 3PW4A 3NF9A 2XI3A 4DF4A 1GOCA 3MXJA 3VQQA 3DLHA 1S1VA 2AGPA 5F8NA 4ED7A 3KOAA 4MK9A 5KT7A 3KKSA 3GV8B 4CCHA 1HPZB 2A1RA 1ZBIA 1CSJA 4EYHB 1N5YB 2VWKA 3HKWA 4DTRA 4Y2AA 4K8ZA 2FVRA 3TWHA 4O0JA 3CJ5A 1NK4A 1SL0A 3L2QA 2B6AA 1S9GA 3HVTB 1VK0A 2Z1JA 1RTDA 3PVXA 4FM0A 3MR5A 2YHAA 5HBMA 2YNFA 3LAMA 3MXMA 5L1IA 1Q8IA 3NGDA 5KT5A 3BQ0A 4ELTA 4Z4IA 2DFEA 1RTDB 5KFUA 2GUIA 3OL6A 3DOKA 4KSEB 4IR1A 2R8HA 1QE1A 4R8UB 5CY4A 4YMEA 4QWAA 3OSPA 2YKMB 3T19A 4KREA 4B8CA 2HHXA 3QEXA 3BSAA 3KMSA 2BE2B 1EXQA 4CJEA 1LW0A 4WYWA 1WAFA 4ED1A 4DL4A 1CXUA 1LAWA 5KRTA 3NE6A 2X6SA 1WSGA 2QV6A 4CJ4A 5K14A 3M8PB 2KTQA 4RW8B 1N48A 4DG1B 1NKEA 3MEDA 3PW5A 4FJ5A 1HJRA 4RZRA 1NOYA 3U3GA 4CJ5A 1NK7A 3PO4A 3TAMA 4CF8A 4FK2A 4DTJA 2RF2B 1JLAA 3LPUA 2QK9A 1VSKA 4AHTA 4TY8B 3O3GA 4QWCA 4CECA 1KLMA 2IAJB 5KFBA 4LQ3A 4JLHA 2ZD1A 5KFAA 2D3UA 1JLAB 4HHTA 1KRPA 3OYJA 4FK4A 3TVKA 2UUWA 4RW4B 4B3OA 1S5JA 1Z4UA 3GQCA 3OLBA 3DRPB 4ID5B 1S1VB 3LP3A 2KZMA 2BQUA 4KAZA 4KI4A 3V9UA 3ZT4A 4FJXA 1VSEA 1DTQB 3LAKA 4DL7A 1XHXA 4FS2A 1RTIA 3OYNA 4FS1A 1LWFA 1RTJB 1QSYA 2DFFA 3TAPA 4FCYA 1C0UB 4PY5A 4K4VA 4K4WA 3NF8A 2FVSA 4NYZA 3MR6A 5DLFA 2JEFA 3KMQA 1KCFA 4DFKA 3H2LA 2R8JA 2R8KA 1NK9A 3SQ0A 4CEFA 3G10A 4FJIA 4IKAA 3HHKA 4W5OA 1RT6A 2P1JA 4NLSA 4JS4A 4CJUA 1BQNA 1JLFB 3OLAA 4KE5A 2FVCA 4ECYA 4J9QA 5KFFA 5F8HA 3AA5X 3RTVA 3SPYA 3OYKA 2R2SA 3SUPA 5HP1B 4FJNA 2D0BA 1TKXA 3DRSB 5J2MB 2HMIB 4IFYA 3LZIA 3M8RA 1YT3A 1SV5A 1G15A 3OY9A 4IRCA 4J2EA 3KHLA 5EWFA 1DLOA 4OGEA 4DQQA 1FKOA 3VQ8A 5EDWA 4CFCA 5C24B 1RT2B 3HPOA 1EP4B 1S6PA 1S0MA 4NLDA 2WB4A 2B6AB 5KFXA 5DG8A 3DOLA 1FKOB 4AHVA 3RB4A 4W5NA 3I5CA 1NKCA 4NLGA 4Q8FA 1EP4A 1S6PB 3OYIA 4MIBA 4YFUA 3AVNA 5HRRA 4DFJA 1NKBA 1YTUA 2ZQBA 1S49A 1TV6A 2QXFA 1HYVA 3QIPA 4I2QA 3SJJA 3RWUA 2IM1A 3RRHA 2B4JA 1KFSA 2ILZA 3KLVA 5KFDA 1JXBA 1LW2B 4Z4HA 4J9NA 1JL2A 4IG3A 4IH6A 3PW0A 4PA1A 3H08A 3NCIA 4CHNA 5KG5A 4RW4A 2HNYA 4B3OB 4U7CA 4KHRA 4J9LA 4KHUA 4E7JA 3G0ZA 4MK7A 4O3QA 1WSFA 4IRDA 4NRTA 1IKXA 3HVWA 4W5RA 1C1CB 4NRUA 3KLEB 2IA6A 2AX1A 4NLQA 2HNZB 3BJYA 4LSNB 3DLRA 3LANA 1NJZA 3BQ1A 4HYKA 1RT3B 3DRRA 3KIOA 3N6MA 5KFEA 2I5JA 3PW7A 3H59A 4O0IA 4EYIB 5HLFA 4G3IA 3VQ9A 4CF1A 4RNMA 5SZTA 5D3GA 4JV0A 5CYQA 2GIQA 1RT5B 5KG1A 4CGDA 3I5BA 2P51A 5I3UA 4B9UA 2HHWA 3NMAA 2VA2A 2G8VA 3AVIA 2XY5A 3AVLA 1BIZA 2OPRB 3OYFA 4GC6A 4TYAA 4BACA 4ELUA 3TABA 5L1LA 3AVKA 2AX0A 4E7LA 4NLYA 4FK0A 4ID5A 3DRPA 2G8UA 3VN5A 3AO5A 3OYBA 1K1QA 1U49A 4TXSA 2OH2A 2OPPB 2WCXA 5HRSA 3NF6A 1KHVA 1CLQA 1R0AB 3ISNC 2ETJA 4B9MA 4J2DA 1SKWA 3LP2A 4Q0BB 2QKBA 3C6UA 4ECVA 3KLEA 5J1EB 3SV3A 4CF0A 4M95A 1IKXB 3LP1B 2WOMA 1J5OA 4OL8A 2KZZA 1MU2A 4LSLB 2E6LA 1TK8A 2E6MA 2XGPA 3KLIB 4Q5VA 2YNHB 3LWLA 2W9BB 4FM1A 5KG0A 3S3NA 3NFAA 3F73A 1RT5A 4B9LA 3P1GA 4FXDA 3KK1A 1VSFA 4ZVFA 4URGA 5F8MA 1BISA 1C1BB 3QLHB 4DL2A 3T3FA 3DOKB 5L1JA 4I7FA 3IGNA 2ZKUA 3KD5E 2ASDA 1S0NA 4PQUB 4O4RA 4CK3A 3TANA 1RTHA 1WAJA 3IS9B 4WYLA 4HVJA 5KFJA 2ZE2A 1B9DA 4FLVA 1IKYA 4F4KA 2HHUA 4HUFA 3H4BA 2D0AA 2R2UA 3VQSA 5HRNA 4DSEA 4CJFA 1UWBA 2IS3A 1S9GB 3HVTA 4O4GA 4H4OB 1GX5A 4KHQA 4DL3A 1J5OB 3K58A 4CFBA 3VQ4A 4OVLA 4K50A 4Q44A 3KD1E 1C0MA 3CJ0A 3GIJA 5HBMB 3QEIA 2XC9A 4ELVA 3SPZA 3QO9B 1JIHA 3AVMA 4FW1A 2G8KA 1BGXT 1WSEA 1XR6A 3OJUA 1SL2A 3CIZA 3KHGA 3QZ7A 4Z0UA 3DLEA 1LWCB 2IMWP 2VG7B 2X78A 2HB5A 3WNHA 4K4SA 1TGOA 3HSTB 4FJMA 1S1XA 2IM3A 1W9HA 3P83D 4JUZA 4DWIA 2HNYB 1S1WA 4OKEA 2OPSB 3T5JA 4KB1A 5EU7A 3OS1A 5E41A 3A2FA 4RW8A 1RTIB 2WONB 4Q43A 2EX3A 1DTQA 1Q9XA 1JKHA 2OZSA 3SFGA 5HLFB 2Y1JA 5FDLB 3C6UB 4TQRA 3PX0A 1RBTA 1VRTA 3H40A 2XHBA 4EEYA 4DL6A 1VSLA 4GW6A 2WRMA 1ZTTA 1TL3A 4QW9A 1A5XA 3ALYA 2IC3B 4NLRA 1UAXA 4J2AA 1HARA 3ASMA 1HQEA 4R0EA 2FBYA 3ZCMA 1BQNB 4MQ3A 4ZP7A 4DU3A 4CK2A 3CFRA 3PO5A 2Z1IA 1WSJA 1VRUB 2OA8A 4AHSA 2Y1IA 3ISND 1HYZA 4NLTA 3DLGA 4YR2A 4DTNA 4K8XA 3KJVA 4CJKA 3ZSXA 2QE5A 4KRFA 3QIOA 3K5LA 5I42A 4AHCA 1JLCA 3KLHA 2J6UA 2OZMA 3V6DA 3K5OA 5F8IA 4WE1A 3S9HA 4M3TA 4K4XA 2XO7A 3QNNA 1WLJA 4Y1DA 2W9CB 4RW9B 1I39A 4CJSA 5SWMA 3AVCA 3RR8A 1C0TB 4BWJA 4ZTJA 2HNDA 3AA4A 1RT2A 3LP0B 4CEZA 1S1TA 4CJ3A 2ASLA 2O5DA 2FJWA 2DPJA 4O44B 2DY4A 2B5JB 4ICLB 3AVFA 3LPTA 3GYNA 4QPXA 5KFVA 4IKFA 4CGHA 4DTMA 1HYSB 4Z4EA 2CKWA 3RR7A 1S9FA 5EWGA 3UIQA 3IG1A 3QESA 2FLLA 2PYLA 2WHOA 1QE1B 3OYEA 4DL5A 2LSNA 1QQCA 2IGIA 3V1OA 4M94A 4K4UA 4XIUA 3PX4A 2FBXA 3TARA 1B92A 1JKHB 3TAEA 5KFZA 4O3NA 4WFZA 3V1RA 1NK6A 1NK0A 1RT1A 2RPIA 3AVAA 4H4MB 4KV8A 4LH5A 4ECZA 4EBDA 5CZ2A 3NGYA 4YR0A 1FK9A 3FFIA 3O3FA 1ASUA 2YNFB 4DSJA 5FRNA 3ZSWA 3SUQA 3AVGA 1VRUA 1NHUA 4KTZA 1LW2A 3QETA 4F4XA 4WXWA 3WNEA 3FRZA 1RDAA 3MEEB 2UVRA 3WNFA 3DI6B 4ED0A 3GIKA 5CYMB 1S6QA 1IKYB 3PV8A 3HJFA 3SI8A 3THVA 4DTOA 3NBPA 1A5WA 1I6JA 3ITHB 2FJXA 3OYGA 3PHEA 3I8DA 3EYZA 2E9TA 1JXEA 4I2PB 3NDKA 4M45A 3V6DB 3ZSYA 4ZP9A 1U04A 1TL1A 1HRHA 2FVQA 3NGZA 1C6VA 3BSNA 1S1TB 4FZXC 4ID1A 2AQ4A 4Q0BA 2VG5B 3HVRA 4FJHA 3M8PA 2WOMB 2RDIA 4I2QB 1RA6A 4LSLA 1IKVB 3G6XA 4JV2A 5C42A 1NJYA 3OYMA 1JLFA 2BR0A 4J9SA 2PYJA 1EETA 2ILYA 4CEBA 3M8QA 5KT2A 4H54A 2XRIA 1HYSA
chains in the Genus database with same CATH superfamily
1U48A 1K0VA 4F9OA 2VFSA 1RT4B 3GB0A 1NU4A 1DTTA 4GV3A 4ZCIA 5ETKA 1YVUA 4FLYA 4CP5A 3H1VX 3CFOA 2ZZTA 2D4WA 1BY9A 3L2VA 4LFCJ 2LU1A 1ZBUA 5K5MA 1S7IA 3QNOA 2R8GA 2J76E 3H98A 4CJRA 3EJMA 2FD2A 5HAOA 1YRUA 3TUZC 1K9MO 3MCNA 1VQNS 2LEAA 1FDBA 3Q2SC 4LH4A 1H72C 2J0WA 3LA0A 3UDVA 2IM0A 2VZ9A 4G1QA 2RF2A 4QIVA 3AJ2A 4A59A 1FNOA 1SL1A 1N5SA 4J9UE 1F5CA 4TN2A 1WJ9A 3FGUA 5D0GA 4FKYA 2E44A 3T5KA 2G8WA 4NA2A 5ETSA 4CNZA 3EPGA 4CK1A 1N34J 3EZWA 3IAYA 1HWIA 4LFBF 2W4CA 4PABA 2O4IA 3F5TA 1ZPWX 1TVRB 4DR2J 2Q3SA 4AHRA 1HI0P 4FWKA 1AFIA 1HBNB 1ZYQA 2P9NA 4NWBA 3VTIA 1FDNA 1ZA2B 3JSBA 3OTBA 3H6EA 4W98A 1X8DA 1FHTA 3NCQA 1TAUA 2O8EA 2UU9F 3D2FB 1U1QA 3L3UA 3UDEA 4WFNL 5C42B 4Z4FA 3W2WA 3DOLB 2DRBA 3VGUA 2XGQA 2V7ZA 1RDDA 4RBVA 4CO3A 3K2PA 4B3RK 4J8FA 4O3RA 4IO9Q 1U2FA 4FJKA 4CFAA 2A1SA 4BQZA 3A3NB 3NHGA 2W24A 1S7HA 1WNSA 2E7XA 3M4XA 5AQWA 3E01A 3CIPA 1A0OB 2QKKA 5LMNF 3OR1B 4ZVQB 4ZMMA 1YRTA 2FSNA 1BG3A 5M2RA 3DGVA 2ZEJA 4C8LA 1SJ1A 5DGBA 4FWOA 1TK5A 1B4SA 1ZAVA 4DQPA 1BOTO 2G2YA 4RNOA 2PDAA 3EZ5A 1XTZA 1WKJA 4D3GA 3G25A 5HROA 1WDTA 4H0PA 4Y6IA 1VQON 2HMPA 2W41A 3QEWA 1U7LA 1DTTB 1MSWD 4N8NA 2CPFA 1BLUA 3ENOA 1AROP 3OL9A 3LF0A 3C0BA 2HQGA 5GMEA 4KBIA 1H1VA 3WT0A 1PJ6A 1TVRA 1WKLA 3DFEA 2JEGA 4JI6J 1T03B 2KM8B 1D3WA 2BANB 3A5OC 2CQPA 2RKIA 3B8AX 3L7UA 1RWOB 1LWFB 1I3OB 3JQKA 4LF2A 2LCWA 2FLOA 5KFKA 4LIWA 1XNQK 4AD6A 3I9ZA 3P6YC 3M05A 4CWBA 5A0YA 2NUBA 1NO8A 4JI0J 2K2PA 1WTBA 4FLWA 1RAAB 3M32B 4CIGA 4P9SA 4Z2XA 4EBEA 2RIJA 1SVDA 5GAEI 4WP9A 3TZYA 2E5GA 2HURA 1IBMF 1A5VA 1RT4A 3DCAA 1M1GA 1GLDG 3CB4A 4X62F 4F4WA 2IVFB 2CGKA 2RDJA 4NYFA 5LY3A 1T9WA 2UXBF 2RMLA 3CWJA 1ASVA 2HWTA 2YQ1A 3HVAA 3W3DA 3OPKA 3G8SA 4JKGA 4QOZB 2F8MA 2AZ1A 5BPMA 5J2QB 4IRKA 4YR3A 3M9MB 4F25A 3IUCA 4P71A 1R8PA 3H20A 4ED5A 2LDIA 3JAMU 3DLKB 1VBZA 5K14B 3GPAA 3L4IA 2RKIB 3MEGA 1U6ZA 4CEQA 3BQ2A 2ASJA 2QW9A 2V9KA 2LDYA 2LQ5A 3T69A 1LOUA 2EFQA 3GSIA 3GR0A 4LF7K 3HT0A 3GFXA 4C4WA 2UV8A 3MR7A 4X66J 3L2RA 4BC2A 4JS5A 3SIPB 1YJNN 3I0SB 2O01C 1F0XA 3IM9A 3ZT3A 1HNZF 1SKUB 1L3VA 1C4CA 1UVMA 3DM2B 3SSRA 1I3AA 1QVGM 4X66F 1LOTB 4FNIA 1X4HA 4DV5F 4NZ7A 3R5AA 4XPCA 4B3TF 4F3TA 1VQMN 7FDRA 2BMBA 2DH7A 3CD5A 3I4PA 5BN9A 5GADU 2JLFA 3R2CJ 1UFKA 5GIPA 1VIXA 1VQ4S 3EXYA 4DSLA 2X6NA 3GZ7A 4DLGA 2ZGZA 4FJ9A 1BI4A 3BSOA 1SIWB 4NZ0A 1DY3A 4O3OA 5FLXU 3Q83A 2C3OA 2O66A 4KO0B 2E1AA 5ETRA 4DSFA 1LQ9A 5IC6B 2YV0X 4YOEA 2CQHA 2FY1A 2FZGB 3UW1A 3BO4A 4EZ9A 2K3KA 1WOOA 2X1FA 1TKZB 1MU2B 2RU3A 2HWHA 3E9PA 2HZVA 4DF8A 3BGRB 3LALA 4ZDNA 5KFOA 4A2BA 3D1HA 3T9ZA 4ZHRA 4P74A 1UWAA 5AFUH 2NLWA 4CEAA 2GA7A 3DLGB 3DMJA 5LMUK 5EXWA 4EP5A 3NCPA 1KD1O 2MZTA 2CJAA 1DRZA 2C2EA 2V63A 3CC4S 3TEHB 4KH4A 1R31A 5L9XA 3Q8PB 3DAWA 2CJYB 3PR4A 2PEHA 3G86A 2BGGA 2FJBB 2DY1A 1SI9A 3OYAA 4LF7J 6FD1A 3PLAA 2CPZA 1RWUA 3X1LB 1YJTA 3KWGA 3U9ZA 4KY3A 3CIMA 2DB1A 1M5SA 3EE8A 4UOGA 2BE9B 1NK8A 3AARA 3IXQA 4TNOA 1ZM9A 1NGIA 3AO4A 4C1NK 3UKUB 3CD0A 3SDEB 3TOQA 4GVMA 3BKTA 4EO6A 5GAGU 1UVLA 4CH7A 2W1BA 3UKRA 4CTAB 1QAIA 5F0UA 2QTWA 4B08A 5TKYA 1ZBFA 2QSWA 4K42A 5E3CA 5HMZA 3T1HK 3FR0A 3ZZUA 3KDNA 3G4SS 4DFMA 1YJVA 1HNZK 5D3GB 3MUMP 2XY7A 2YNIA 4R5PA 4GO5X 1VBKA 1FJGK 1FKPA 3TTFA 4CHZA 2K06A 2AKWB 4YDXA 2KW4A 3HO1A 5I3QA 4UQGA 4J2BA 7FD1A 4KB0A 1U2VB 1FD8A 1HMVA 1M90T 4BRAA 1VMBA 4BRKA 3KWMA 4OI4A 4UF4A 3NBPB 3C6TA 1UW9A 3SV4A 3QRRA 2I7NA 1T6DA 3L0QA 4I6YA 1RWPB 3CYMA 4E0DA 4JV1A 4NLOA 2MJUA 3HT3A 3MXIA 1FFSB 4XO0A 1RT1B 5GAEU 2BRLA 4ZLPA 4NXNJ 2VQFK 4R25A 2P9SB 5ETPA 2PA8D 4DBQA 4DDFA 1KBRA 4M3ZA 4DR1F 5CZVA 3VEZA 3G8TA 2AIRB 2DHHA 3ZXWA 4OYBA 3FFIB 4KGKA 4ECXA 4CHOA 4CYUA 3WC2A 4NXNK 4C3MA 3NVMA 3BGRA 2OHDA 5CA5A 3TJAA 1Z2ZA 2DIVA 3VHQA 2ZH3A 1F3FA 3DOMB 1S6UA 1NHKL 3ZNJ1 4M3RA 5EHHA 4KT0C 3AD9C 2VYPA 3QGGA 3AB4B 2E4LA 4NCGA 3P5BP 4IOCL 4LFBJ 4FZZA 2VWJA 2XHCA 1WSIA 3UDLA 1CC7A 2IVOA 5M1FA 5A8WB 3C94A 2GIFA 1MWZA 3AA3A 4ISGA 4DL0C 2ZE2B 4O3SA 2NZCA 4U9RA 4D3HA 2P9KA 1XR5A 3TAGA 3MWBA 4TQSA 1ZA1B 4BRFA 1JMTA 3O9QA 1KVIA 3MM6A 3FC9A 2JOQA 3PDNA 4RU9A 1RBVA 4Y1CA 3N6NA 1YITS 2CH5A 5JS1A 5HMXA 5F9NA 2BVZA 3M5RA 4EO8A 2D3ZA 2NS1B 2CNKB 3D6FB 4HTUA 2FHMA 4DZ6A 3WIUA 5D4NA 3OA9A 3T5HA 4EU0A 3MM5B 1YIJN 3UKUA 2RHSB 3MN9A 2XWYA 2E5IA 5J2MA 1IWAA 4Z7YA 3SCIE 5J2NA 1XQIA 4WK3A 1PC5A 3AVJA 3ULHA 5TKWA 5T7BA 3OS2A 2YHBA 3M8SA 4CVNE 5KRSA 4CLPA 2A41A 3AD8C 2VFTA 5DQIA 1TAQA 3VWSA 5GAHP 4QIWD 2ATLA 2ZOGA 4JHDA 3MTJA 4BC4A 1N6QA 3CCSN 1Z25A 1YKWA 3CJTA 4QU6A 3DRYA 2NPFA 2BV3A 5BN8A 1U6FA 4LR9A 1HBMB 1H3DA 3IRXB 1OYEA 4M3UA 3BYPA 1PAUB 3OHAA 1N5QA 4OO1J 2ASOA 4DR7J 2D1KA 2XSJA 4OZNA 3EPIA 3HD1A 4X4RA 5KFTA 3GR1A 2CQBA 3A3PB 2CJBA 2LXUA 4L6V3 5EX5A 5M1OA 4E1NA 4CHQA 2MKHA 1S1XB 1UETA 2HBYB 1EQMA 5KT3A 2KYXA 4DR4K 2W7PA 3FRYA 2Y9HA 5C5JA 4MYUA 4USHA 3CJ8A 3ULEA 1UJ4A 4RTFD 1T11A 3VAHA 1Y0HA 2B8PA 1WD6A 1JJHA 2IVMA 3O4NA 4EHTA 5FDLA 1P8ZA 5JVHQ 4EGLA 4ZLJA 3D2EA 1GMVA 2PFUA 3SSQA 3T1YJ 2CRLA 2V67A 1R89A 1RGIA 2L9WA 3C6TB 2KB2A 4MT1A 3UN3A 2WBNA 3F44A 3HXMA 2PD1A 3M8QB 6FDRA 5HSPA 3Q24A 4KPYA 2XZDB 3AOBA 2R2RA 1RWVB 3VQAA 3R5GA 4JI3J 2NREA 1WN7A 4FF3A 1RDBA 1QTMA 3DHXA 5J1EA 4E1MA 2VG6B 3GWCA 5F0WA 5KT6A 3GE9A 2VBYA 3RU0A 1DJ0A 4KTQA 1FKPB 1OVYA 2HF3A 1HQUB 3TTCA 4CLFA 3T1AA 3RB6A 1TKTA 4DV2J 4U7UD 1YWXA 1YTAA 4ED3A 2CPHA 4K4ZA 2Q43A 1S99A 4BVOA 3HHLB 3MCMA 3W2VB 2H5EA 5C2GA 3IAS9 4JRPA 2IRUA 2NUUG 2XLKA 2JH3A 4DR6F 2XMAA 2DNLA 4M8LA 2R7YA 3CM5A 1Y3KA 1NOZA 3NAIA 2DXDA 4TKTA 5E84A 2PMWA 2MY7A 1GNKA 2V4JA 4I56A 3GV5B 4AM6A 4M5IA 4LF6K 3S3OA 4HHJA 3QEVA 2AMCB 2C3MA 2HNDB 2OPQB 4ZTFA 1XIQA 2HHHF 4YDUC 3E51A 5F8LA 4JI1J 4WFBL 2B9EA 4IQXA 2F4VF 1TUVA 3V81B 5KFMA 2FJVA 3ZSVA 2B43A 4DV0K 2BOPA 1IM4A 2X1BA 4JD2B 4OZ0A 1X5TA 4NLVA 4ZS6A 4H4KA 4WYBA 4YB1P 1FF2A 3J80Y 2P6TA 2AGOA 3P5TL 4NOHA 1VCTA 3MECB 4IQMA 4O3PA 2OPSA 1HI8A 2LQ9A 3VEWA 2L3MA 1V5IB 1N5YA 3CETA 1Y7PA 3FZ2A 3MCSA 3AVHA 4KHSA 1BXNA 2DH8A 3LUYA 5D4PA 4NL5A 1Q82T 4FPIA 2FF3B 2UU9K 2HS0A 3UR3C 1C0FA 2GAHC 4BE1A 2CPJA 4CNYA 2EKYA 1CVJA 1FVQA 1U8WA 1YJNS 1VQ4N 2FC9A 2RRBA 1IV0A 2FVPA 1YDLA 2EWSA 1S4EA 3QFWA 2GV9A 4CHYA 2GC8A 4DR2K 4RBUA 3LDNA 5HATA 3JB9k 4ILHA 3CDBA 3JYTA 1X9JA 3V4IB 4OI6A 4BDYA 1QAYA 2DNKA 4JI5J 4CJQA 4HVZA 1G99A 3ZT0A 1Z26A 4FVUA 1TUGB 3BKFA 5LSOA 4DF4A 1ZZNA 2RHKA 3MXJA 2DGTA 5HQMA 4ZVPB 5F8NA 3KOAA 3FEYB 4CO5A 2WFBA 5KT7A 1UFLA 2EPIA 3GV8B 4CCHA 4MO4A 1D8ZA 1ZBIA 4EYHB 3Q7BA 4B1YB 2UXDJ 1R8BA 5CH7B 3TWHA 4WCEL 2HBKA 3P39A 2YJEA 1SL0A 2DRAA 3PXGa 3FVYA 4M5KA 2G1DA 2KU7A 3HFVA 2Z1JA 3R6LB 1RTDA 1Y4ZB 4BCAA 3PVXA 3PM9A 3MXMA 2XEXA 1Q8IA 3CCES 3EZOA 3ISZA 1X5SA 2KT2A 2GQ2A 4ELTA 1RTDB 3O2IA 3RBZA 4A8YA 4X84A 1S3XA 4A8MP 4YMEA 2M5YA 2HFNA 4DUZJ 3QEXA 1Q53A 2BE2B 2I6WA 1EXQA 2WB1D 1VHIA 5HMWA 9RUBA 1SIZA 3FBCA 1H73A 4EHUA 2QV6A 2H54B 2P9PA 4FYXB 2IFXA 4LF4K 2DR6A 3VZIA 4FJ5A 4ANCA 4RZRA 4DV1F 4CJ5A 3D4JA 4RWXA 3NNHA 3OR2B 4FK2A 4DTJA 2BJDA 3CW2C 3MAAA 2E1MC 1VSKA 1G6BA 2IAJB 1QAXA 4I6WA 5E3RA 3CE8A 1KRPA 4JKEA 3OYJA 4FK4A 1FESA 4BRIA 4RW4B 3OLBA 1EQYA 2I8EA 1N54B 1V3RA 1B64A 2BJ1A 1XEZA 4P75A 1GMWD 1BD6A 4LJMA 1ZPVA 4FS2A 4ID8A 3W0LA 4YHHK 2FHKA 5ETOA 5FPMA 1C0UB 1HR0J 4LRAA 2VASA 4NYZA 3MMBA 2CVIA 3FFKB 2FSKA 4FPAA 4FJIA 2VFRA 3HHKA 3O9UA 2QGFB 5AJ3F 4JS4A 4JK9A 4CJUA 2M7SA 2OMOA 1U1OA 1GLLO 1ACMB 2MXYA 1TL7B 4KE5A 3R3LA 2JFDA 3HRGA 1UMJA 1G2EA 5KFFA 1HPMA 1NZAA 2V2QA 3TUIC 3MX2A 1OJ4A 3OYKA 1X5PA 5AT1B 2R2SA 2DY9A 1MW7A 1RBLA 3NLCA 4QU7A 4WFNQ 3OW2M 4FJNA 2K1RA 2H1YA 2HMIB 3M8RA 1R8AA 4OGEA 1GTEA 2B9YA 3AA9A 4DPTA 5EDWA 1N36F 3VGVA 2Z30B 5DG8A 3DOLA 4PG8A 3I5CA 4NLGA 2R7VA 3ETMA 1EP4A 3AVNA 2H48B 4DFJA 3QQCD 2VDIA 2E66A 1WUAA 5EX0A 1WHXA 2IM1A 3ILOA 4K7QA 1KFSA 3KLVA 5KFDA 1LW2B 4J9NA 1F5BA 4B3OB 5C15A 4KHRA 5EOYA 3MMAA 1K44A 1VBXA 1OWXA 2VPYB 3CPEA 2VICA 4O3QA 5FLXY 4XEIA 4UW2A 3M6GA 1WSFA 3TSQA 1YG0A 4P7TA 4K8RA 4W5RA 4OZ5A 1C1CB 2CXEA 3KLEB 4TLQA 3LANA 1NJZA 4AM7A 3CPWM 2JX2A 1RT3B 4GKJF 2VJUA 1FDAA 2C2OB 2I5JA 4LT6A 5AQOA 2ZC3A 4G3IA 3WXKA 2R7XA 2DXEA 2AEFA 3LTOA 5HO4A 1Z6RA 3LPEA 5D3GA 4JV0A 4GVEA 3EXCX 3I5BA 5ETNA 2P51A 3EO3A 5I3UA 2VJVA 5B08A 3WHIA 1CJVA 2BJ3A 3P8BB 2W2OP 5ELZA 4ENOA 3TABA 3AVKA 2BYCA 3FCWA 4FK0A 2QLJB 3VN5A 3CCJS 4CTAA 3NXZA 1K1QA 3FMBA 3CJ9A 2QX0A 5H9FK 1SPBP 4IO1A 5HRSA 3CD6S 3NF6A 1KHVA 2CJ9A 4J2DA 3T1YK 4Q0BB 2QKBA 1XMBA 4WBFA 4OI3A 2QXLA 3UE5A 4CF0A 2BKPA 4J37A 1J5OA 4OL8A 2O8BA 2F9DA 4LF9J 3R1HA 3HSZA 3O4WA 2XGPA 3LWLA 1K73T 2CQCA 3S3NA 1UFWA 4JKFA 4KH1B 3NGTA 3F73A 4FXDA 3NS5A 3KK1A 4B3SJ 4ZVFA 1E4FT 5F8MA 2BUPA 2KVIA 4DOZA 1C1BB 2QLBB 5C0YA 4F0HA 3K9JA 2OD4A 4DL2A 5BR9A 2Q79A 5L1JA 3G82B 1OY8A 4I7FA 3CMAN 4PXCA 1RK8A 1CZAN 2L9NA 2RRAA 2ASDA 1S0NA 4JNEA 3TANA 4RBTA 2ZBCA 3CCVS 2J7KA 3QGPA 4YB6A 2Q1NA 4F4KA 2EK1A 2MQNA 1NH7A 1XBWA 2D3OR 3VQSA 4DSEA 2VQEF 2F9TA 3HHDA 2KXNB 4H4OB 4NXMJ 4DL3A 3U1LA 1J5OB 4OHWA 2CG8A 3K58A 1RDUA 4OVLA 1WOPA 1YGYA 3NS6A 1F6TA 5I4MA 1C0MA 3CJ0A 2NSBA 5K8PA 2P8IA 2QN6B 4OV6A 3QO9B 2DRDA 4JV5K 4CZFA 4C98A 4FW1A 4A8QA 2J9DE 2H65B 2Z57B 3QZ7A 3DLEA 3MUTP 1LWCB 2JWLA 2MQOA 1LNQA 1IJEB 2VG7B 2BTFA 4MO5A 2M8HA 3EVWA 4OZ3A 2MLZA 4DWIA 2HNYB 4O23A 4PEOA 2J9DA 2ZNZA 4MJKA 2UXDF 2MKJA 3KWIA 4PKHA 5A8WA 2GX9A 3RSEB 4RW8A 3FJ2A 5EGYA 3BPSP 2W6KA 2GV1A 4LREA 1Q9XA 4X64J 2OZSA 3CGIA 2Y1JA 3PX0A 2PBDA 4TU8A 2JDJA 2RUGA 3UNYA 2EBGA 1WUUA 2XHBA 1NGBA 4HWIA 2QIFA 1TL3A 3ALYA 4DU8A 1MMNA 2CDRB 1WBDA 1HQEA 5LJ5Y 2NSCA 1BQNB 3PO5A 2Y1IA 3M1FA 3QNWB 3ISND 1HYZA 2G0CA 2OEMA 4NLTA 3HMJG 2WC9A 4NYPA 1AB8A 5IT0A 3TNVA 4B3MJ 2RH3A 1VC0A 1EHWA 3TW0A 1N34F 3E2EA 4CBXA 2E7WA 1PIEA 4WE1A 2LVWA 5F8IA 2O8CB 3CQYA 2ZBRA 3TRGA 3GJRB 4Y1DA 2W9CB 4RW9B 3AVCA 3ZYYX 3N0VA 1DQ9A 1F9FA 2D9OA 4IO9L 3ZZTA 3G87A 4YB5A 3FEZA 4ETZA 3JXUA 2GZOA 2G9OA 1S1TA 4ZVUB 1E6VB 1I94J 1JNZB 4FVCA 4O44B 2DR7A 3DHWC 2AJ2A 1QUPA 1V9OA 2RJZA 3BZQA 3LPTA 5CR4A 3NS7B 2KHOA 3D2EB 4OI1A 1HUXA 1U1RA 2QA1A 2IDEA 2N7YA 3D7SB 5L39A 4HTLA 3SK3A 4M5HA 1NGAA 4DUTA 3VTHA 2XG8A 2CKWA 2QLWA 4Z4EA 3RR7A 1JWWA 5GAHU 1KC8O 3OFEA 5BPLA 4P2MA 2JWNA 2FLLA 2ZVSA 1F5AA 4RWWA 4LRDA 5JVGL 1F2GA 1X0FA 1CQNA 4NX9A 4K4UA 1B92A 4O5FA 3TAEA 1R6VA 4A4JA 3UVJA 3VETA 2MHEA 1QY7A 4CZIA 1DFDA 1RT1A 4ER8A 2P9IA 1HKCA 2DTJA 1HNXK 2PMHA 1FK9A 3WQPA 3MMVA 4CZHA 1ASUA 3AA8A 4DSJA 5FRNA 3ZSWA 4P52A 3VZHA 4K2XA 4WKRA 3FRZA 1RDAA 2UVRA 3WNFA 1XNQF 3MD1A 4ED0A 5FPDA 2OTLS 1O13A 5AE3A 1IKYB 3PV8A 3HJFA 3SI8A 3BDEA 1A5WA 3CMEN 1ICEB 3M6UA 3OYGA 3EYZA 5M2UA 2IYIA 3PYEA 4M45A 3UI3A 3HHLC 1WSRA 1VDHA 2FVQA 1XJWB 3GCWP 1C6VA 3BSNA 2RQ4A 4FPRA 3TVZA 1NDKA 4FF4A 1LXJA 3M8PA 2NRHA 3D1OA 4ALZA 3TP2A 3HOSA 4CLWA 2CPDA 3FSYA 1BO5O 3G6XA 3EKUA 3SQGA 2AJ4A 1KD1T 4JV2A 3TVYA 4NA3A 1EO1A 2VOOA 4ZPWR 2BR0A 2RU9A 4OYXA 3D7EO 2ILYA 2DNRA 4ZCLA 2QA4S 1C4AA 5GAGP 2F1FA 4MKBA 4BY9C 3A8IA 1VI7A 1QVFR 2V2VA 4NCBA 1NK5A 2ZDPA 3PACA 1YF5L 1YJRA 4IFEA 4BR4A 2NRRA 3GFYA 2CPXA 2BQ3A 2JC0A 2KJVA 5HRPA 4BWMA 2HBRB 4QS8A 1FA0A 1N88A 1S48A 3DKDA 5GVQA 3MOJB 3Q8RB 3M8ZA 4YNQA 4ZVGA 3J7A1 1RXOB 4C2MA 1RDCA 3EICA 4BE2A 1KQGB 2GHPA 1RWXB 1ZETA 2R8IA 2DGQA 3RJMB 4EIAA 4ISEA 1M5PC 3QERA 3OD2A 1IKWA 4K25A 3KJNB 2M4MA 3D5MA 3PX6A 4AT1B 3DLLQ 1RISA 2F8EX 4ZVSB 3M2UA 2ZBPA 1RKJA 1QSSA 4JKHA 1ITGA 1KQKA 4CZJA 4CI6A 3M2RA 3FLCO 4U6PA 4DB3A 3GE1A 3A4TA 4AXIA 1K73O 1NDLA 3ZFVA 1HNWF 4OYMA 3EL2A 2KRBA 2GMLA 1S1WB 4ZPTR 4RO0A 2G8FA 2LFVA 3NCRA 3W9HA 3NNCA 3V9SA 3AB2B 3MEDB 3I0RA 4OJ1A 3NAHA 2KH9A 3KHRA 1Y5NB 2YHXA 3L3VA 3OXFA 3I5AA 3ZZRA 1BC6A 1SJRA 2DKOB 4DU4A 2V8PA 2NNWA 3OVBA 3VQEA 4CIEA 3NWRA 4B9TA 4X64K 5ETMA 5IT4A 1EWQA 4QS9A 3SQOP 1DARA 1CBKA 1RT6B 2VC1A 4JI2F 2ZGYA 4DFPA 2AU0A 4F7VA 5AQXA 3SAHA 2QL9B 3JYTB 3MMCA 2NCKL 2HIYA 1I5OB 1DEJA 1TMMA 3MTKA 1OH8A 1V6HA 1TV6B 3ENBA 2DPIA 3DLJA 4HTIA 1BCMA 3NL0A 2M52A 4EFHA 1CULB 3DXSX 1S76D 2UVWA 4QQBA 1BL3A 4BROA 4CZEA 4JEPA 5M1QA 1LXNA 2ZJRQ 3ICLA 5EWEA 3I0RB 3DDIA 4HHHA 1DURA 4L73A 4MK8A 4FXWA 3MR2A 3AXKA 2OPQA 4JI0K 4IOBA 4PUOA 3BGLA 5A8KB 3MFHA 5F0XA 4BLGA 3DGPA 1X1PA 4CW7B 4UOHA 3W61A 1RWNB 4J91A 4DN9A 4BDZA 3V2UC 2C2NA 3BN7A 3PJXA 2N4DA 4DQ8A 4JI8F 4KV8B 1X3NA 2R42A 1VQ6N 1S1UB 3ID6A 5KG4A 4HKQA 5KQDA 1FE0A 3BH7B 2KT5A 5DDPC 3N4PA 4F26A 4NYNA 4Y00A 3N79A 4PL7A 1LFPA 4B3TJ 3KLHB 4C9DA 3HD2A 1VSHA 4OLAA 3E1YA 1J5EJ 4PPZA 4CGGA 5JXSA 1S77D 1NB7A 1KN6A 5KGWA 4Z94A 1FNMA 3D0GE 1Q9YA 5D8HB 3KLFB 5DZ6A 4JOUA 4KH6A 3TZWA 5LJVA 1S9EB 3MEGB 3LOUA 1IBLF 1SQKA 2O8BB 2LA4A 3ZT2A 3RMDA 2ATCB 2N3LA 3B6OA 4IDKA 4C0OC 1KTQA 3PY8A 3CCLS 3MF5A 1S9EA 5KFLA 1PBUA 3W2WB 3ILJA 1BMQB 1HNXJ 2CZ9A 1FRIA 2Z2ZA 1Q95G 1FWPA 4LF8K 1XC3A 3E66A 3MN5A 4FBUA 5HVFA 3OVNA 2H51B 2QWRA 1LAVA 5DQGA 1C1BA 1LCUA 1RGVA 1W26A 1JL1A 3OR1A 3CC4N 1G3OA 4LR8A 5B0DA 3TSUA 4KRWA 3FCVA 3W5YA 4L74A 4BC3A 4OI0A 2AYEA 1CLFA 2AWZA 4AQYF 3F41A 4JKBA 2MYFA 4DQRA 4RNHA 1KAZA 1J2VA 3TAQA 3CHWA 4IOAQ 1OQ6A 2HQCA 1SC6A 2BOAA 2DXFA 1KAYA 2DD8S 4CQ1A 1IBLJ 3P4IA 4CF2A 4NLBA 3R7BB 2VBXA 4ZPAA 5BR8J 1SCJB 1Z1ZA 4ES1A 1CZ9A 3QMLA 1KVAA 2RT3A 2KO1A 3VA0A 3ZSOA 4R8UA 5AXMA 2R7UA 2J7WA 3CMAS 1ULRA 3SI6A 5B7WA 5LM7E 5IXUA 5F2RA 3IMQJ 3ENHA 2PN6A 4GKKK 3MPYA 3DU5A 3LDPA 2IBKA 3MM8B 4JB8B 3V6JA 1LEOA 4KHMA 1BHLA 2BQRA 4W90B 3GL1A 3R8EA 2PAVA 2E5LF 2WSCC 4J9RA 2NRXA 4FLXA 1NU0A 2HF4A 3PFEA 2QFIA 3VERA 4CJVA 3CDWA 5DZ7A 4ECRA 1XWLA 3CJ2A 2MZSA 4CH1A 3PG9A 1D0EA 1RT7A 3S8SA 2JL9A 2Q66A 4YUDA 3V4IA 3CCWA 2G8IA 1WF0A 3H5SA 4ZPDA 2C2RA 2VGNA 3G71S 4UY85 3E01B 4IH5A 2GCFA 1KVBA 2K1RB 1GLCG 1NZ8A 1L3TA 3A3OB 2R4FA 3DJCA 4E98A 5GAEP 2B56A 2ZVIA 2YKNA 1TUUA 3ZEUB 1TKXB 2WZ1A 3BREA 2CWKA 3ENQA 2KHDA 1OPIA 2MKIA 3KZBA 2WBRA 4WE1B 3AGKA 4KJIA 5L1KA 3R5CA 2W9CA 4E89A 5IM0B 3P45B 3UR0A 4FBTA 2MGZA 3EVMA 1M1KT 4DHVA 5A76A 1FXXA 3VEYA 2C2DA 2MZQA 4OKKA 5JVGQ 4C1NI 2XMUA 2RE1A 1QTNB 3MN7A 3IWNC 2K7KA 1SH0A 3TUPA 4Y28C 5MLCQ 2LKZA 4H03B 4J9MA 1MWKA 1AUSL 3WZ0A 3AV9A 4FWPA 4CEEA 2AD9A 5T14A 3VQ6A 3OVSA 4G1IA 1YHQN 5DDQC 2VG7A 1HLWA 1EX4A 5AQUA 3HPHA 2OPPA 1RZMA 3GYGA 1D09B 2M8DB 2Z1GA 3PKYA 3IG1B 2KG0A 4W5TA 3A5NC 4OV1A 5CE3A 4ILMA 1RBSA 4IZ9A 4NXNF 3W5XA 4DG1A 3SFUA 3QJPA 5ITHA 1BDGA 1XMOF 4E8UA 4B3SK 2VG5A 3D6TB 3DGPB 1Q5VA 4AF1A 3CC2N 1FT8A 2VOPA 4MH8A 3IBCB 2E5JA 2GIRA 4AL7A 1HWLA 2A6AA 2HS4A 3DOMA 2B51A 1SH3A 3T5LA 4HCCA 4DN0A 1FEEA 2GVZB 2YNGA 1G1XA 3CC7S 4KTWA 4YP3A 3VVUA 4FPBA 3BV8A 2XI2A 4MLHA 3DU6A 1JLEA 3VQDA 4N41A 4RUBA 2G4BA 5HI7A 4BG9A 4CBUA 4FZVA 5F8GA 1W0HA 3DN9A 2PT0A 1NJIT 1F3VA 3ZZPA 1HLUA 4PKIA 1VR6A 5FROA 4V1Ak 4B9NA 4N47A 1T94A 4NEZA 5LXRA 3SBGA 2KVQE 4MKYA 5MAOA 4MFBB 4KGZB 2OANA 4L72B 1RA7A 4NLPA 5KFSA 4WF9Q 1DT9A 3OXLA 1GEHA 3MCAB 4AXJA 4BRCA 4DV3F 1BA0A 4WP3A 1AT1B 5HQLA 3CMES 4I0WA 2AJQA 2YX1A 5DM6Q 3VQPA 2ZWPA 1JLQB 1CJUA 4MTPA 1TYQA 1CC8A 3VAKA 1QHTA 3I33A 3THYB 4PWUA 2DT9A 4DPUA 1IN0A 4JRQA 3CCEN 1Q16B 2DGVA 1WF2A 2FLPA 2EFVA 1IH7A 4CD1A 2P5GA 5GMDA 4ECUA 2DNMA 1NNDA 4HEA9 4R5PB 4JI2J 5M1NA 4A8OA 4H0XB 3LGNA 4WU2A 2BJEA 3PCOB 4CDIA 4M7YA 1RBRA 2DNYA 5AQSA 1Y10A 5ADXH 4Q2LA 4AYBD 4GKJJ 4OPAA 5HL7Q 2Q3PA 2QZ8A 4P73A 2X1GA 4CE9A 1FCAA 1JJ2M 2B4OA 2W9BA 2AW0A 4JI5K 2B5JA 5KFCA 3W64A 2KL8A 1RDWX 2HMIA 4X62J 5K20B 3Q8QB 4CEDA 4BRHA 4A47A 2CVEA 3TPQA 2F8SA 2DPNA 1NMDA 5JLFA 1GLEG 2ROEA 1OQ3A 3RB3A 2RHQB 1RT3A 4AFFA 1Y3JA 5D78A 3H42A 2LP4A 4NXMF 3V6KA 3HHLD 4KFBB 1ILYA 2KN4A 3DLBA 4BR0A 2HLUA 3VEXA 2VCPA 1IBMJ 3TJ8A 1IJJA 2HHTA 2W2PP 2CFXA 5AQJA 1CXQA 3DNCA 3TAMB 3HULA 2CZ4A 1SQEA 3HJVA 2ZH7A 4M3WA 3V5RA 1CZBA 4BREA 2RDDA 1E6YA 1D9FA 3MPDA 3THXA 2F7VA 2HOEA 2KYZA 1SS6A 4NI2A 5DQHA 3FZFA 1M0SA 2AHOB 4M41A 2MKKA 3KK2A 3L7OA 1HHSA 2QWQA 1KVJA 2BUNA 1S12A 1KVKA 3CCLN 3ZSZA 3ITHA 1KVCA 2OMLA 1WSVA 3CVKA 4JI7K 4ANEA 4USTA 1Q8LA 5DG7A 2AJ1A 3EE9A 4Y34A 2L08A 3IFRA 4X4PA 1T3NA 2DHGA 4WJBA 2APOA 2V4JB 4N5SA 1DLOB 4M3XA 4DSKA 1RABB 4ECWA 2YPYA 4LY7A 5HN0A 1QHAA 4MDAA 1YRXA 3B6PA 2RVJA 1DZ5A 3HSJA 2IJRA 1MWQA 5I3PA 3K5MA 4G9ZA 3C6HA 5H1SQ 3V6HA 3H5UA 5D15A 4KKOA 1NBEB 1UW4A 1RHMB 4FO0A 3R1LA 2YWGA 4OJ3A 3RAQA 3B8HA 3IDHA 5JLHA 1TFWA 1YTYA 1WHVA 3NG8A 5CHIA 4AH9A 3DXMA 3OYDA 3BKUA 3TR8A 1SAZA 4K4YA 3C15B 4HUEA 1HA1A 3EGWB 4C0BA 1NDCA 2ZHBA 1S97A 1XMOK 3SMPA 4QR2A 5K9FA 3PW2A 1W2BR 4KI6A 1RCOB 2CQ4A 4CHPA 1FK9B 3M9OB 2Z1HA 4CLTA 3IFEA 4FF1A 2A40A 5AQFA 2W25A 1U1LA 3TA0A 3GFZA 1E6YB 3MFIA 3M6XA 4FVMA 4E7HA 3ZX0A 3GCXP 3KK2B 3ZTOA 1B0PA 4ED2A 2FBVA 1K8KA 5JUMA 2W4DA 4OPJA 1NSPA 1VQLS 2DCUB 4M7XA 3FZHA 1GXUA 3W2VA 2XYPB 3K57A 4GKKJ 3VQ7A 4F02A 5AQQA 1BWEA 1GFWB 4F2SA 2V0NA 1IG9A 4L76A 3A8YA 4WFYA 3D0PA 1VRTB 3KHHA 2P9GA 5KI6A 1M5VC 2LLZA 4F4YA 4H5NA 3K5PA 1WC0A 1VRQC 2OD6A 4CZMA 4BBYA 3QB0A 4OYAA 2VB6A 2NYIA 3BBFA 5A2QO 3R9LA 5GMKa 3UN2A 3OHBA 4IG3B 3J7ZT 2YWWA 3T6JA 3GG1A 5KT4A 3CQ8A 4DR2F 3VAGA 2XMVA 2AYBA 4LF5F 4AUKA 4ZVEA 1VQSA 5K8MA 1RYRA 3ZETA 2QMUB 3GTYX 1NMNA 5J2PB 4DR4J 1U1PA 2VG6A 1OMSA 1RNHA 3L2UA 1BU6O 5CHCB 4K43A 3UVJB 3B54A 1BQMA 1T9UA 2W2QP 3E9OA 4OX7A 3MDQA 1QUVA 4DV0J 1HQEB 2IDOA 1JLBB 3O9SA 1ZBSA 4CIFA 2B9XA 3CF5L 4USKA 2J9CA 3F0NA 3A5LC 3FQKA 5K8NA 3LH2S 4XAKA 1N0VC 2GGPA 2YNHA 3FZLA 3QINA 3W9IA 5KG3A 4DV7K 2NUHA 2VDHA 1ATNA 5KFWA 4NB4A 3I31A 4DV3J 4IUFA 3VGLA 3RUBL 1WACA 2XULA 3NRBA 3NF9A 4F04B 3QDKA 1GOCA 1ELOA 3TZXA 1NGCA 4WKYA 1XMQJ 3I6PA 2AGPA 1N36J 5CYJA 4C3LA 3RW7A 1VBYA 4BRQA 3OW2R 1HPZB 3Q23A 4NA1A 1CSJA 3N4WA 1N5YB 1IBKF 2EC2A 2VWKA 2A10A 3S41A 5LL6Z 4Y2AA 3O5TB 2OTLN 1XMQF 2FVRA 3VR1A 1YQHA 3W65A 4UOCA 5D77A 3L2QA 2B6AA 2GWJA 3MMBB 3SXLA 3MR5A 3CMQA 4F0KA 1AA1B 3GLJA 4MLEA 5L38A 3RGIA 4QBUA 1YK9A 5DJBA 4JD2A 1BQXA 3TEGA 4RR5A 2DFEA 4LFBK 4BG8A 4JKAA 1T9YA 3FKBA 4XK8C 3OL6A 3DOKA 3CJ7A 3VAMA 4ZVOB 1X4DA 2ADCA 1MLAA 2F40A 4R8UB 4QWAA 2W4PA 4NI2B 4KREA 2IHR1 3KMSA 4PXDA 2PIIA 2DNZA 4ED1A 5KRTA 2X6SA 2GWKA 2L48A 1NM1A 4RUHA 3A8EA 4DG1B 1NKEA 3R5JB 4JI7J 1NOYA 3ZO7A 1NK7A 1O6XA 1HIYA 3TAMA 4HDGA 3Q2TC 2LXIA 1HBMA 4K5SA 2QK9A 2V8DA 1UL3A 3NGUA 3EM1A 1AXQA 5DO2A 5KFAA 4CO4A 4A5BA 2VONA 4HHTA 3CI5A 1Q18A 3PNIA 1S79A 4DZDA 1S5JA 2Z2YB 4ID5B 4PRFA 2CQDA 4KYZA 3LP3A 1RHRB 2BQUA 4FOIA 3MDFA 3V9UA 1N36K 3BZKA 1OPZA 1VSEA 2OKQA 3ATVA 3CCQS 4FS1A 4USWA 1QSYA 4K4VA 4N77A 1UEUA 3GYXB 3R97A 3MR6A 3O5BA 4YORA 4H5VA 5F3ZA 4M1KA 4UT4A 2R8JA 1NK9A 3SQ0A 3G10A 5AZIB 3PYDA 3N5BA 4ATNA 4NLSA 1S0VA 1WC5A 5DRKA 3P38A 1EX8A 1VQ9N 4J9QA 4HLBA 3D67A 5F8HA 4YEAA 1YI2S 4NO7A 3HSGA 1CJUB 4JI4J 3HFZB 4Z37A 1UEVA 2E1RA 4IO8A 1SV5A 4BRPA 2NRTA 4IRCA 5E3QA 3C8YA 2W6LA 2CQGA 1FKOA 4ERDA 5ETVA 3MHYA 3BGOP 4CFCA 5C7PA 1RT2B 3R7SB 1N32J 3HPOA 4NLDA 2WB4A 2HQDA 1FKOB 4PXBA 1NKCA 2ZH5A 4Q8FA 2XM3A 3D6HB 3T9NA 3UCZP 2DH9A 4Y2IA 5HRRA 2P9LB 3AT1B 2ZQBA 1VFJA 1S49A 1YTUA 1Y5LB 1HYVA 4I2QA 2RB7A 4H4KC 3SJJA 3RRHA 1HBOB 4JK7A 3LDQA 2ILZA 5E3AA 2GNKA 1JXBA 4UOFA 4H5RA 4Z4HA 3AHPA 3CJQA 4WQ5C 5A8RB 4IH6A 3HZGA 3PW0A 3N5FA 4DCJB 4RW4A 4U7CA 2AJ0A 4J9LA 4E7JA 3VOVA 3G0ZA 4M5NA 1L3KA 4NRTA 1IKXA 2D74B 1WEYA 1HBNA 2IA6A 4DR6J 4RWTA 3ZC4A 3TZZA 3KIOA 4DV5K 1HWJA 2ZFHA 3MCPA 5DM6L 4LVNP 4O0IA 4EYIB 3VQ9A 3BGFA 4W4MA 1RQ0A 1HBUB 5KPRA 3U02A 3PSFA 1EIYB 5LJWA 2CWXA 3HM8A 1BUXA 2ZOMA 3CSKA 5HJXA 1VIOA 1RT5B 5KG1A 1YX2A 2B4UA 5A6WA 2M3DA 4B9UA 3NMAA 2VA2A 3PIOL 2ADBA 4ZIWA 1XK8A 4TYAA 4ELUA 5IFMA 1WBBA 3C7NB 1RAEB 2DISA 4NLYA 3VCDA 1PGZA 2FJEB 2G8UA 3JTPA 2ZH1A 1QLNA 3AO5A 3CCVN 3EKSA 4TXSA 2OH2A 2OPPB 2WCXA 1FXLA 5LSLA 4UY8O 3MMAB 1R0AB 5D0HA 3B78A 3D6RA 1SKWA 3LP2A 2V68A 3KVGA 4FNHA 3OR2A 1IKXB 1MWMA 2WOMA 3VGKA 1NJIO 3CT9A 2OJ3A 4DPWA 3MWPA 2KZZA 4FYWB 2HGMA 4HTJA 3QSIA 2E6MA 3CCTA 1N8RO 5ADXA 2RUSA 2YKPA 2XS5A 1Q0NA 1YJWN 3CD6N 1B99A 5KG0A 2Y1LB 3J7Z5 2CPIA 4KGMA 4GV6A 4QOTA 2V2ZA 3TUJC 3QLHB 3T3FA 5AQZA 3GJQB 4HR2A 3KD5E 3S01A 4LFCF 5BYQA 4R79A 1B9DA 1U6BA 1UZDA 4P6QA 4MDBA 2D0AA 1M90O 2OCEA 2E1PA 1K9MT 1ZM4A 1UWBA 1S9GB 3HVTA 4O4GA 3KJFB 4KH0B 4KHQA 4Q2MA 1FXRA 4PWWA 3VQ4A 4I6AA 4K50A 4BRGA 4Q44A 4CRJA 3GIJA 3CXCR 2UXCJ 5HBMB 3CCQN 3QEIA 2GVDB 2DGXA 3FUYA 1JIHA 2UUCJ 3CIZA 3KHGA 1X0PA 2IMWP 4YS2A 3W63A 3BGUA 4K4SA 1KOHA 4I69A 4H5TA 3T7ZA 4Y2KA 2QYCA 3BY5A 5AE1A 1S1WA 2QA2A 4CO2A 4OKEA 1VK3A 4EK2A 5ETQA 3QWPA 2DHXA 3C2PA 5FPNA 4X4OA 5LSRA 1CS4A 3A2FA 2BJ9A 2AF6A 2WONB 4U8VA 3H2VE 4Q43A 2EX3A 2CGJA 1SBRA 1WG4A 4J90A 1KKHA 1VK8A 1FRKA 1RBTA 2QC3A 4X65F 2JSXA 1Q1KA 1W7AA 4DV0F 4DL6A 1Q7YT 1VSLA 3H3NO 2WRMA 2XYHB 4QW9A 1A5XA 2DIUA 4NLRA 1HARA 3ASMA 1WEZA 4MQ3A 4ZP7A 3R5DA 4CK2A 1YHQS 4HH0A 1WSJA 2C3YA 5M2PA 2QT7A 3K0JA 1X4FA 5CD4H 4NMLA 4CJKA 3ZSXA 5AQGA 2KM8C 3AAPA 3EWGA 4F67A 2GMJA 3MEKA 3V6DA 2DR9A 1RLDA 2OFHX 5IQQA 4I4BA 5SWMA 3RR8A 1IBKJ 1FO1A 3A0IX 1C0TB 3OTEA 1Q79A 2V34A 2MGZB 4BWJA 4ZTJA 2HNDA 5I9EB 2Z58B 2EG2A 1J27A 4CEZA 2ROGA 3I87A 5BYRA 3ZTRA 4AE5A 4G1PA 1H74A 4JI8K 2B5JB 3HZEA 1WC6A 3H7HB 2C1EB 5KFVA 4IKFA 2QSFA 4WK1A 5AJ3J 3T41A 3ZEUA 3H3OB 4G6VB 2J7UA 1PJ5A 2LYVA 1S9FA 2YWKA 5EWGA 5BYSA 4MIWA 4WTYA 3IG1A 2PYLA 1QE1B 1IUJA 5D4OA 2ZBQA 2LSNA 5IWAK 2IGIA 4KHUA 3V1OA 3GP9A 5KFZA 3ZNUA 4O3NA 1N0UA 3IR7B 4RJVA 4ANDA 1NK6A 4CZGA 1RU2A 1NLVA 4K5RA 3FBBA 1U24A 4LH5A 3NGYA 2ZITA 2GTDA 4YR0A 3FFIA 3TX8A 3AVGA 2R3VA 1VRUA 2CDQA 2XS2A 1RFQA 4F4XA 1T9XA 3UB5A 2I0XA 4LF8F 5C10A 1U26A 4ZVTB 4CLYA 1K8AO 2R7OA 2AYGA 2EG1A 1S6QA 3DC2A 2FZKB 5HANA 3BEXA 3NBPA 5L8RC 1I6JA 3ITHB 3MWTA 3CO0P 2FJXA 1HFEL 3PHEA 5C12A 4ZKAA 1OIAA 4I2PB 4DPOA 3G82A 5HL7L 2L41A 3PIOQ 3ZSYA 4ZP9A 1HRHA 1EKSA 1RLCL 2OO4A 4ZOSA 1VHFA 4LF5K 5C2FA 1U2RA 2VF3A 2GO9A 1S1TB 4FZXC 4Q0BA 3R9PA 5BRFA 2HS3A 1QQMA 1XMOJ 4EMDA 4LSLA 1FI4A 1IKVB 2NYHA 1NB2A 4CT9A 5M1PA 3OYMA 4U7BA 2HHPA 4J9SA 2F7TA 4PYDA 1EETA 5K8OA 2E7VA 3TQEA 3FZMA 5AZJB 1RADB 1QZ6A 2IOCA 4HT7A 3CCRN 2VA3A 3KK1B 3OTOF 2NXNA 4FLZA 4IBNA 2EC0A 3HF5A 4A57A 2CYYA 2QTDA 1CJTA 1HJOA 1OH6A 2V69A 4B1UB 2HRTA 2UUBJ 1UVNA 4QWEA 1C0UA 4QYZJ 2O4GA 2GO8A 3KK7A 4DHYA 2Z56B 3L2WA 5DDRC 4ZPBA 4FZYA 1SKSA 3TA1A 3O08A 2UVUA 4YN3B 2BACA 3FSIA 5AQKA 5B8HA 4Q45A 4S0MA 4O44A 1JLGB 1K47A 3I32A 2CQ3A 2NRWA 4QCLA 1TUYA 1MWYA 3HLUA 5DGAA 2E5LK 4KR0B 3W3SA 4OX9F 3OUYA 1N6QB 1T05A 2VKRA 1KLMB 3IR6B 3QYYA 3DXKB 4OI2A 2W7OA 3D54A 2M88A 1TFYA 2W42A 4HUGA 1UTAA 1RKIA 2D0CA 3O80A 2HLTA 1K8AT 1JJ2R 3NNAA 2DR5A 1IM6A 2XYGB 2ZJQQ 3OVAA 5T41A 3NGIA 3VENA 1CEZA 4CJWA 3KUEA 2DO4A 2VL1A 1Y11A 3UWTA 5IZHA 1P8GA 5CCLA 2E5LJ 1BA1A 3KUGA 1LW0B 1M5OC 5F1XA 3ENWA 4QW8A 4DLEA 4XTTA 2HZCA 2ALYB 4NLWA 1VSDA 4JI3K 4M63C 1P9YA 1U02A 5EX3A 1VLOA 1FFWB 3H0PA 4DV3K 2HBJA 1NHVA 2MZ1A 1XNRK 4HCBA 3G2XA 4X4VA 3KLGB 1X9MA 1A9NB 1WC4A 1HQUA 3G6YA 2Q97A 4DV5J 2CUYA 3JTNA 4YB7A 4CO0A 5HP1A 2RILA 4O5BA 2E2PA 3CULA 3ZLJA 2ERRA 3U4LA 1OS5A 1Q86T 1FRMA 4OJRA 3Q8UA 5AQLA 1QDUB 4KHPF 4TYBA 2IRXA 3BH6B 4CGJA 3Q86A 1J9AA 5IT9O 5E3PA 4FF2A 1QAJA 2GJIA 3U27A 3HPGA 1NLKL 3CFPA 1W7WA 4ZITA 2ZNYA 3UQSA 1FRLA 3CJ1A 1I94F 4WFXA 1RWMB 5ETLA 3RBXA 4FWLA 3O9RA 4WIIA 1EAYC 2HBMA 3KLIA 2GAGC 4RUCA 5F3TA 4AL6A 2WK4A 3M2RB 4B3SF 2U2FA 2W8KA 4QIFA 3O3HA 3SSSA 2J0SD 3V81A 3V1QA 3U1NA 3ET6B 2G0IA 3SCJE 3L8BA 3UD4P 1Y97A 4C8NA 5F41A 1HPZA 4CLZA 4LFAF 1VQKS 3S1TA 3NF7A 1U8SA 5CYMA 2D69A 3I96A 4JYAF 1SC1B 4I6MA 4NYOA 4DV1J 1B0VA 2WVBA 1S72N 4RCHA 3MUVP 5EN1A 1KXPA 4LRBA 1PBAA 3K9KA 3LZJA 3JQMA 1O8BA 4ILJA 2GBZA 3ID8A 5T7LB 1C2PA 1NPKA 1JXVA 5H9EK 2GGPB 4F0MA 3H4DA 4H4MA 4FLUA 4EBCA 1SH2A 1DGKN 2VHGA 3MK6A 4O55A 3V9ZA 2KKHA 2EI5A 1D9DA 4KC5A 1VC6A 5IWAJ 2U1AA 1GLJO 1JLBA 4FYYB 1YLXA 3KFWX 3AODA 2X1AA 1S1UA 3I82A 3ET6A 3PJ9A 2XMWA 2CJQA 4RW7A 2O8CA 2NPIA 2VU5A 5BPNA 3NH0A 1WKKA 1F21A 5J2PA 1GXLA 4FYVB 5DLGA 3C15A 3KJQB 3MMJA 2YQ3A 3BO3A 3J7YP 3AXMA 4HI2A 3DYAB 4X64F 4EAHD 1IQTA 2D5RA 1TL4A 2XNQA 1H2TZ 3CJSA 1VQ6S 2ZH4A 3AO2A 2NRVA 1P1TA 4OYOA 4JBCA 5KFYA 3AA2A 4NMXA 1RHUB 1WHYA 2EFOA 4LBIA 1SUQB 3AO1A 2C42A 4B3MK 4CJTA 3CG7A 5FD1A 3HK2A 1W25A 3LDSA 3MZIA 3ZZZA 1BWFO 2E2NA 2Q2RA 5F8JA 5KFHA 5SUHA 3RMAA 4CZLA 4LBHA 1UCNA 4IFYB 4EZ6A 3R27A 3O1WA 1TK0A 3S6EA 3DDKA 5KG2A 2EK6A 3LWMA 4NLCA 3LP1A 1SV5B 2E29A 4DV6K 1OYDA 4RUAA 4L3NA 2XS7A 1R0AA 5C24A 2A2CA 3NGRA 2FHOB 2M70A 4YHHF 3U3YA 4IDHA 1KHWA 4C8OA 4TU9A 1F2HA 3Q22A 2PO4A 4J9OA 4EWTA 4J9VA 2YX7A 1O1WA 1VQPS 3CNQP 1FX4A 1H2UX 1X9SA 3UO0A 2V4RA 2HQIA 3PEHA 4C11B 1V5VA 4DV6J 3R6MA 4OIXA 4I9LA 2EHGA 4RG8A 4KAIA 2QMXA 3L09A 2KFYA 1UEKA 3KG0A 4LF5J 3PIPL 1BQMB 2OUGA 5KTQA 2OYQA 1U1MA 3TA2A 1B9FA 3HKZD 3OL7A 3NOCA 1R59O 4IOCQ 3N4QA 2O8DB 2P9NB 3IRWP 3C16B 3WNGA 4G1QB 5A0YB 2RN2A 1WC3A 3D0IE 4LF4J 1KSPA 2FC0A 1ROFA 3ILIA 4FLTA 4IDKB 2UZAA 2KFNA 2FTRA 4JI7F 4DMNA 2I9SA 2ASMA 2QWOA 1R3NA 1KFDA 4LFAK 1DQAA 3AAWB 5IV3A 3S3MA 3T6BA 2DTUA 2BDPA 1GOAA 1TKTB 1YAGA 1IVZA 1TP7A 1N52B 2R2TA 2QA4G 2N3OA 1HD0A 1WHWA 3K8WA 5LMNK 3O4QA 2JRSA 3QFPA 3PRBA 1WEXA 2IYGA 4ECSA 3CCUN 1ZAXA 5DETA 3O8WA 2Q0UA 2POKA 3TQ1A 4B1ZA 1VQPN 4M5DA 4JI0F 3EY1A 2MMYA 1O51A 3OYCA 3F9KA 3NH1A 3RRKA 3C16A 4QIEA 3MMCB 1YIJS 3Q8YA 3RBEA 2VH7A 2DNOA 4LF9F 1ATSA 2CPEA 1RAHB 3WXIA 1GX6A 3BN4A 5IT9U 4UZCA 3AOCA 2C2MB 4PG5A 4DV7F 3J81U 5AQHA 2O8FA 2KJWA 3DMJB 1FWLA 1SC3B 2EBEA 1AFJA 5IV4A 2F5GA 3SUNA 3EEQA 5D0RA 1NGDA 2DNPA 1AW0A 4HDHA 1P9QC 3K8VA 5DMRA 4JI2K 3PJWA 4JP8A 4QPTA 1VISA 2RQMA 1BIUA 2OELA 5KFNA 1HWUA 2A6MA 3V9WA 2MY8A 2MB0B 4CT8A 2QEXN 1SUQA 4L3QA 5DG9A 2YH1A 2NXUA 2XSFA 4CI0B 2J4RA 1PILA 4AL5A 1C1AA 3GG0A 3QZ8A 2YI1A 3VQ5A 4J5OA 2F4VJ 4GVBB 5LOQA 1UVIA 3M9NB 1R0BG 3OYLA 3MECA 3SAFA 2BXJA 2YKNB 1S0OA 3UDCA 1E4GT 1LK5A 3WXMB 3WX8A 3EMTA 8RUCA 1KAXA 3LW5C 4JKGB 3K89A 2V8HA 4ZN1A 4N56A 4PWDA 1RCHA 2QLFB 2VUGA 1RJJA 3PRDA 3CTRA 1APSA 3W8GA 4HH1A 1RT7B 4LRFA 2EFGA 2CPYA 2IPOB 1GAOA 4ZIVA 2I7PA 5ETTA 2Z8QA 3VEOA 4CZCA 1WI8A 4WIQA 2H4YB 2QM1A 1L5UA 3DI6A 4H0VB 3D2FA 4FSVA 3QGHA 2HWIA 1XC9A 2H4WB 4EI2A 4Q8EA 2ACMA 4DTXA 4Z4GA 5BRDA 4ZJLA 1S59A 2HEKA 1RILA 3HHLA 1T03A 1QQNA 1JLCB 4URQU 4KHYA 3O6QA 2J0XA 1JLEB 4ZCKA 1TYQB 3AQPA 4DEZA 5ADZA 3OYHA 3SYZA 5E7OB 2OP5A 1OVQA 1ZH5A 1VS3A 4ZK7M 3QBCA 2XMJA 3M7VA 2EXUA 3E8OA 1VJWA 2PZSA 2JLEA 4BC5A 3MM6B 4XH1A 3TYTA 4PWDB 4RX6A 2ZZMA 2HYIB 4DTUA 3A1YG 2XTJP 2HVDA 3PFOA 2WTFA 3MURP 3PZPA 1BUPA 2YHWA 1YZ7A 3TAFA 4L8RB 4U95A 4USJC 3GIIA 2UUCK 4CJLA 4ZCMA 1WOQA 5I3UB 3CO9A 1BWVA 5G4DA 1MMDA 1WF1A 1GLFO 1W2BM 3MM8A 1H2VZ 1SJFA 1N56A 1I1GA 2DO0A 1PG5B 1R7IA 4PPDA 4F3OA 3H5XA 2LMIA 1YVFA 2YJFA 4X2BA 5AQIA 4FW2A 4O8KA 5AFUA 4P10A 2HGNA 1JJCB 4H0OA 4M42A 1IBCB 1TMJA 2IJNA 4NLXA 2OI2A 4DSIA 3SUOA 1C1CA 3MPVA 3J7ZO 3UFCX 1RYSA 5M1KA 1F9EB 1GMUA 1NDPA 3VF0B 4OX8A 4FWSA 4EFAC 2WONA 1NJWA 4URSA 5D0EA 4DUYF 1WB9A 5JMVA 4QWBA 4I67A 1QS4A 3FK4A 4GMJB 5L9NA 3QATA 2CNLB 1Y00A 1NCLA 3DXBA 1WSHA 1VQ5N 1MDUB 2J5AA 1OO0B 1KLNA 4YOVA 3FDSA 2HHSA 1UA0A 3B4MA 2UP1A 3J81Y 3SAGA 2MZRA 1LV5A 2XSJB 3UD3P 3DRSA 4RU2A 2ZHAA 2DEJA 3JSMB 1ZBHA 1UPMB 4FJ8A 1RAFB 3RSEA 3CCSS 5KFRA 4QJVA 3DLKA 3R5BA 4KGXB 3IO1A 1REVB 3ULEB 1TTHB 3OJSA 5KFGA 1C0TA 2KHCA 3IA0A 2YNIB 3LPYA 1KNZA 2OIHA 2GUPA 4I68A 3EE3A 4EUVA 2HK3A 4X65J 1JCGA 3LGMA 2AGQA 1Z2LA 3SDEA 2D7SA 2V6AA 3OT9A 4JI5F 4A62A 5E2QA 3HTVA 5CZ1A 3UKRB 5J2NB 4I1TA 4WCEQ 1ZZFA 3U6FA 5JS2A 3VV2B 4CGFA 3SNNA 1CJTB 2ZUAA 1D5AA 1FDDA 2OFGX 4CFDA 3L4QA 1VC5A 4IFVA 2VGMA 1QVFM 3CJBA 4E7IA 4P2FA 2ZZNA 1ZBTA 1U4BA 5KFPA 3NH2A 4YOTA 2VKZG 1OH7A 1HNIB 3P49B 4DR5K 3MOZA 1X60A 2YCHA 2AEMA 1D4XA 4ZLLA 3E9LA 2I38A 1HBUA 5IOLA 2DGOA 4NPOA 2IC3A 3OFFA 1RBUA 3DLEB 1X7VA 5C25A 4PL8A 3R3TA 1X9WA 1HMVB 1VQNN 2IAJA 4CF9A 4USIA 3HZ6A 2OSRA 2EWHA 1H7XA 4KB7A 4LF8J 4ZHRB 4RNFA 3CJ4A 2CIMA 3C95A 3AJ1A 4PXEA 2IVYA 2KDOA 4Y65A 5KG7A 2NXEA 1MN9A 1IG8A 2RQCA 4CD3A 5I42B 1ZAWA 2KRRA 3JSMA 3ELHA 4NLUA 2RQKA 1LFWA 2IBOA 1N33K 1RB0A 3ETOA 4K0KK 3G6VA 4P7VA 3KK3A 1BI4B 3ENAA 2MKCA 1RI7A 1HD1A 4L3KA 5AXNA 1IKVA 4BR2A 5JMNA 2IVNA 3FEXB 4OZLA 4F3MA 4V19J 4OMFG 3QRQA 1VQOS 3L95X 2BJ7A 3N01A 4TSXA 4C8ZA 2C28A 2PSZA 4GMKA 2VWBA 3MEEA 1URNA 1VSIA 2YKAA 2LQBA 4GNIA 4B1XB 4F2RA 2V52B 3NGKA 3OSNA 3THYA 1L3SA 3GONA 4DS5A 2QJ3A 4C11A 2XI3A 2Q0RA