1JLEA

Crystal structure of y188c mutant hiv-1 reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
549
structure length
524
Chain Sequence
PISPIETVPVKLKPGMDGPQWPLTEEKIKALVEICTEMEKEGKISKINPYNTPVFKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGANRLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 133
structure length 524
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jleA05
4BE0A 5HP1A 5DG8A 1VSEA 3ULDA 3DLGA 2A1SA 1JXEA 4CHOA 2ILZA 3LP0A 3AVGA 4E7JA 3TAGA 4B9UA 1S1TA 3NBPB 4PA1A 3GIKA 3ZSXA 4MFBA 4FLZA 2C28A 1GX6A 4CF0A 3N6LA 4NLVA 4C8NA 2JEIA 1IKVB 3OYCA 1W25A 4DTPA 4DTNA 1C0TA 2WONA 1T8EA 3MEDA 4I9QA 1W0HA 3I0SA 1LW2B 2ILYA 1WNSA 4FM0A 4FJ7A 3KLIB 5C5JA 1RBVA 3PO4A 1UWBA 4E3SA 4DTSA 1TVRB 3O4QA 5DQHA 4IG3B 1GX5A 3G6YA 5HRRA 1ZBLA 3RR8A 1S97A 5DK5A 3RRHA 4NRTA 2EHGA 1QAJA 4N41A 2R2UA 4CJKA 4ZPDA 4QWDA 1S6PA 3NFAA 4FS2A 3CDEA 4FW2A 1SL1A 4B8AB 1NJXA 3KD5E 1SV5B 4OKKA 3WNFA 2B5JB 4AHRA 1XWLA 4E7IA 2IOCA 4CIGA 3V81B 4MK8A 1NK6A 4KHUA 1K1SA 3KLVA 3IG1A 4TXSA 1R0AB 2OPQA 4K4ZA 4NYNA 1T05A 4O4GB 2R8JA 1N5YB 4I7FB 3MXMA 4KFBA 4KV8B 2E6LA 3KLFA 4K4TA 1VSLA 4I2PA 1HQUA 3U3GA 2HHTA 3BQ0A 1S0OA 3PJWA 4OKEA 1D1UA 4LQ3A 2DTUA 5EUHA 5C25A 5KT2A 4TYAA 4AILC 4QWEA 4CEQA 2FJVA 4KPYA 4CEZA 4Y2AA 4URQU 2GBZA 4M3WA 4PUOA 3K58A 4WFYA 4M95A 2PZSA 2D0BA 4E0DA 3H5XA 1ZBFA 2FC0A 2PY5A 1J53A 5SWMA 1QTMA 4C8KA 1N6QA 2HHQA 4PQUA 1S9FA 1GOAA 1C6VA 3OL9A 3NF7A 4MKAA 4YNQA 1JKHA 1Z25A 4NYFA 1QSSA 2A1RA 2ZE2A 4FJMA 1Z4UA 4FJIA 2QKBA 4NZ0A 1IKXA 1XI1A 3NGZA 2HNYA 3AO2A 1VRTA 2HNZA 3MEEA 5HBMA 4ECXA 2ATQA 3EZUA 1HNIB 2W8LA 5C42B 3RB3A 3AV9A 4CERA 2Z1IA 1L3SA 3KJVB 4EBDA 4WE1B 3CJ0A 5DQGA 3PW4A 4ED7A 3TAFA 4Y34A 3IN5A 1BL3A 4M3TA 4DFJA 2YKNA 1NKCA 5I42A 1DTQA 3S3OA 4GC6A 4GMJB 4O44A 5CYQB 3RWUA 4JS5A 4B9SA 2JLEA 3CQ8A 3QEVA 3F9KA 3LAKA 1TKXA 3IGVA 3OSPA 1NOZA 2F8TA 4URGA 1BQNB 2JGUA 4EZ9A 1X1PA 3OL8A 1U48A 2EX3A 3OHAA 1X9WA 4KHWA 5KG2A 3I5CA 3L2WA 3S3NA 3H59A 2KTQA 1SL2A 3HT3A 4Q43A 3OL6A 1JIHA 3I5BA 2R8KA 3RB0A 4FZZA 1G15A 3ZSYA 4QW8A 3H5YA 1C1AA 4N56A 3C6TB 2D3UA 1C0UA 3DI6B 3AVJA 5L1LA 2KFNA 3AO1A 1JXLA 3EYZA 4CJPA 3TWHA 4JV1A 4CFAA 1WSEA 2AGPA 1MU2A 4KE5A 3KHLA 1FK9B 1HNVA 5L1IA 1NK8A 3PUFA 4YR2A 3RR7A 4FXDA 1RT4A 1VRUA 1S1VA 3SI6A 3LWLA 2G8UA 1JLGA 3P83D 3HPGA 1XR6A 3QIDA 5D3GA 1JLBA 4AHSA 4WXOA 3PHEA 1EP4B 4IH5A 4ED6A 4KAZA 2OZSA 2BANA 1SKWA 5FRNA 3V6HA 2W8KA 1C2PA 2YNIB 3ZSZA 1TL1A 4ID5B 4RW8B 4CEBA 3EPGA 3NGIA 3QETA 4M45A 4RG8A 2WK4A 1NKEA 1FKOA 4WFZA 3VQ5A 3HKWA 3KLGA 5J2MA 3OYHA 3QEIA 1X9SA 4I2QA 3TAEA 4ZVHA 1F21A 3KLEB 3DRPA 3D28A 3NH2A 3QEWA 3BGRB 1KTQA 4MQ3A 4DTXA 3MF5A 2WOMB 3AA4A 1N4LA 4FK4A 3CWJA 1LWCB 3VQDA 1HRHA 1YVUA 1WSGA 2IA6A 2LSNA 4DSLA 5KFYA 2FBTA 5DLGA 1BI4A 4BWMA 4K4WA 3AVMA 4JS4A 1MMLA 4RNNA 3M9NB 4FLWA 1SKSA 2VWJA 4DMNA 4BDZA 1RDRA 2UVUA 4B3OA 1VSHA 4QCLA 3CG7A 5DMRA 5KG0A 1Q9XA 2JC1A 4ZP9A 3D45A 4H8KA 4HUEA 3CVKA 3DLGB 3KOAA 2X6SA 3OS2A 3LP0B 3ZSVA 2XCAA 1FKPA 5HLFA 3SZ2A 3PW5A 1TK8A 3T5JA 5JS2A 1S1TB 4Q45A 3AVCA 4F50A 3DMJB 2HVIA 2C2DA 3NF9A 1IKYB 3DRRA 3OJUA 2YHBA 2KZZA 3ALYA 1I3AA 3CFPA 3TANA 3KK3A 1RT3A 5L9XA 1YTAA 1C0TB 3K5MA 2WONB 2JEJA 4WYWA 3BQ2A 1LWFA 4CJ3A 3EPIA 3MEDB 3I0SB 3NHGA 2FVSA 3H08A 2F96A 3SQ4A 1UA0A 3K5NA 3NGYA 2ZD1A 4Z4CA 4LD0A 3UDLA 4CIFA 4RW9A 3M8PA 5EU7A 1JLCA 5CY4A 1UAXA 4NLTA 5KFFA 5EWEA 4LSLA 3MR2A 3OYGA 3LPTA 4ECQA 4F4ZA 3SQ0A 3SI8A 4LH5A 3CM6A 4NYZA 4IFYA 2IGIA 3NAEA 1CZ9A 2DFFA 3JSMA 1NNDA 5KFZA 3SV4A 4DL6A 1D8YA 1T05B 4TN2A 4ZHRA 1LW0B 4KFBB 3I8DA 1LV5A 3KLFB 2C22A 4KHMA 4O0IA 3V4IA 5KG7A 4NCBA 1NJWA 2I5JA 4NLDA 2FVPA 2FJXA 3B6PA 1T03B 1XR7A 1D5AA 2YNGA 5J1EA 5C25B 1RT5A 4M94A 2HNDB 4Y2CA 3AVIA 4IG0A 3HK2A 3CJ5A 5F8JA 4DQRA 5DQIA 4CFDA 3IRXA 1VSDA 2Z1JA 4CGIA 1S1WB 4HCCA 3Q8SB 4DSKA 4CECA 3T3FA 4J9KA 4ZVEA 2YNHA 2FVQA 2G8WA 4TQRA 3KKSA 4J9LA 4H4OA 3ISNC 4ZPBA 1N6QB 2W9BA 4PQUB 4FZYA 3NF6A 1YT3A 2XGQA 3KTQA 4CK2A 4F4KA 4K4UA 1B92A 3QNNA 1RTDA 4FJJA 4AHVA 4B9MA 2C2EA 4IDKA 2O4GA 2R8GA 3P5JA 2JEGA 3VQ8A 3AA5X 1IKXB 4KKOB 4FBUA 1S5JA 5KGWA 2HNYB 1VRTB 3MEEB 5HBMB 3LP1B 1TK5A 4JV0A 3TAMA 3NH0A 3FFIA 4FM2A 1TAQA 1DLOA 4TYBA 5F8MA 2OPRB 3VQPA 4Y3CA 3OYAA 1A5XA 1RDCA 1QE1A 3ITHB 4KHRA 1KHWA 4MK9A 1O1WA 5I42B 2AU0A 5F8IA 1DTQB 3TABA 3ICLA 1IO2A 3BJYA 4KI6A 4O44B 4W5TA 1B9FA 3OLAA 3C95A 3ZT3A 3UR0A 4CFCA 4DSJA 4QWAA 1UOCA 3LZJA 4BDYA 1TKXB 3KHRA 5E41A 2QKKA 4FW1A 3CFRA 4HUGA 3QNOA 4F3TA 3DM2A 4Q8EA 4H4MB 3HO1A 1S48A 1S6QA 3ZCMA 1WAFA 3I0RA 5J2PA 2OA8A 4NCGA 3LP3A 4J9PA 5F8NA 4DQSA 4DFPA 2BDPA 3LAMA 1XHXA 2D7SA 4EP4A 3IS9B 1SH2A 3VQEA 4KI4A 3KLHA 3AO5A 3CO9A 3DOKB 1NOYA 5JS1A 4CHPA 4Z4FA 4R0EA 1C0UB 2NUBA 1KLMA 3QGHA 5KTQA 1BCOA 4KRFA 2AGOA 4DL7A 1MU2B 2FBVA 4CJ5A 3PR5B 3PO5A 5KFDA 1IM4A 4EO8A 4LQ9A 1WAJA 3QLHB 1RT4B 2YV0X 1VRUB 1RYSA 3VQ6A 3NDKA 3QGGA 1S1VB 4LSNA 4DQIA 2VG7B 2CKWA 4KHSA 4OLBA 2GUIA 3FRZA 4W5OA 1ASWA 4N5SA 3CDUA 2BR0A 3ZSWA 5CYMB 5JUMA 5KRTA 3OYNA 2BANB 1IKWA 3H2LA 3O3HA 3Q8QB 2AQ4A 3M8SA 1SUQB 2UVWA 4KTQA 4YMEA 3L8BA 3V9XA 2IC3A 2IDOA 4UQGA 4KB0A 4Q8FA 4IRCA 1TL3A 2W9AA 3MEGA 4DLGA 3KLGB 5J2MB 2FBYA 3SUQA 3BQ1A 4DL3A 3SQ2A 4I2QB 4HVJA 5FDLA 1WN7A 1HPZA 1QUVA 4DSEA 2XY8A 3DRPB 3SFGA 4Q0BB 1DTTB 4IRKA 5KFTA 2XY5A 4IFVB 2FVCA 4E19A 5DLFA 1XR5A 5C24B 4JUZA 4CHQA 1HQEA 2HMIA 4ECTA 5I3UA 5F9NA 4CGDA 5F8HA 2BRKA 1BISA 4CF1A 1ZTTA 1HYZA 4DFMA 3RRGA 3TARA 4FLVA 2HWHA 4CHZA 4MKBA 2HVHA 3L2UA 2QXFA 1I39A 2X78A 4RW7B 4B3OB 4ED2A 5FRMA 2V4QA 4ICLA 4HKQA 3FSIA 4HUFA 3RAQA 3OS0A 4G1QB 3S3MA 3JYTB 2J6TA 4U7CA 1NJZA 3NL0A 3H4DA 1S0NA 4CJRA 5HLFB 2C2RA 3VQ7A 4JV2A 5HROA 3C6UB 1BQMB 4CIEA 3OYIA 2HW3A 5KFAA 3OS1A 1TAUA 2AWZA 3HP9A 3D5MA 4ZVGA 3QZ7A 3DRSA 4PWDA 4ECRA 2BQUA 3ZT0A 1KFSA 3KK3B 2XRIA 1RT3B 3E01B 3CFOA 2B4JA 2PYLA 2DFHA 4FLXA 3CJ2A 4RZRA 4RW6A 3BR9A 3RTVA 1S1XA 4NLSA 4FS1A 4E7HA 3HSTB 1S1UA 4DF4A 2RKIA 1LWEB 4FZXC 4R5PA 3OL7A 2ZD1B 2R2TA 4FBTA 3TI0A 3RAXA 3OYMA 5KFCA 4KHYA 3MFIA 4CJQA 3C94A 3KNAA 4AH9A 3QEPA 4KSEB 4F2RA 4FJLA 4J9MA 4CJUA 4YQWA 4HTUA 3HM9A 3SNNA 3QZ8A 4HYKA 4JLHA 4OPKA 1A5WA 1RTIA 3V9SA 3NAHA 4Q5VA 2HB5A 4WXWA 3L2RA 4ZTFA 2W9CA 4IFYB 1HYSA 3GILA 4FK2A 2E9TA 4C8LA 3LP2A 4L8RB 3GV8B 3PR4A 2QK9A 2VA3A 2E9RX 2G8VA 3MXIA 3HPOA 1CSJA 1NJYA 2RF2A 4ZHRB 3EZ5A 1SH0A 3V4IB 3M9OB 3PW2A 4F2SA 2ATLA 3RMCA 1RBRA 4R8UA 3OYBA 4J2BA 5KFJA 3NCIA 2YNGB 1TKZB 3CDWA 5F8GA 3OY9A 4KAIA 3AO4A 3AVNA 1K1QA 4IG0B 4M3XA 2YKMB 1BIZA 1IKVA 3CM5A 3QIOA 4E7LA 1S9EA 4DTOA 3AVFA 1LW2A 3DLEA 3M8RA 4IBNA 1RILA 1EX4A 4KTZA 2YNHB 4E1MA 4GC7A 1TVRA 1B9DA 4IG3A 3OYDA 4H4OB 2W9BB 3PV8A 4IQXA 1VSIA 3OYKA 2XC9A 2FLPA 3SYZA 3T5KA 2WRMA 1RA6A 4IDKB 5HRSA 5T14A 3F73A 3LDSA 1W9HA 5J2NA 3MR6A 4Z0UA 4EEYA 1ZETA 1RNHA 3ZSOA 3M8QA 1J5OA 3KIOA 4KREA 3FFIB 4O5BA 4CF8A 3DLKA 4O3OA 3MXJA 1KVBA 1R0AA 3CJ4A 2VG6B 2HHWA 3RMDA 4I7FA 1KRPA 2OZMA 1D9FA 4CHNA 2F8SA 1U09A 5L1JA 1D0EA 4RNMA 4DG1A 2WCXA 2AX1A 4DSFA 4ZMMA 1TQLA 5KFQA 1C1CA 1TGOA 4CJEA 1NK4A 3LWMA 1JLFA 1WLJA 2ZQBA 4KO0B 1RBUA 5K14A 3QIPA 4FVMA 3K5OA 1TV6B 1Y97A 2W42A 3K59A 1RT1A 4EBCA 1T94A 3V9WA 3GIIA 3QO9B 2HHUA 4CF2A 3DM2B 1EXQA 1C1BA 4YFUA 5HP1B 3QERA 3TQ1A 1NK9A 2XI3A 1NK7A 3QGIA 3PX0A 1ITGA 4NLRA 3I0RB 5J2PB 1QSLA 4DSIA 2XWYA 2I1RA 4J9NA 2VA2A 1RT6A 3AA3A 3TAQA 4MFBB 4NLPA 2X6NA 3P1GA 3PY8A 3E51A 3RB4A 2FVRA 3UQSA 2IS3A 2FBXA 2IM2A 3BDPA 1J9AA 4DL2A 3V6JA 1HNIA 4W5NA 1KCFA 1KLMB 4OPJA 3DYAA 1XC9A 4BE1A 4WE1A 4CK1A 1UWBB 3K57A 5HRPA 3I5AA 3V1RA 4RW4A 2VG5A 3DOLA 4XO0A 2BRLA 4C8MA 1OS5A 2R2RA 5J2QA 1NK0A 3SV3A 1N56A 1QAIA 3FQLA 5KFPA 3QINA 4EBEA 3DLHA 3H5SA 4M41A 3T5HA 2WTFA 1HYVA 1S6PB 3SCXA 4QWBA 3VQBA 2XY6A 4CJVA 3S9HA 3SUPA 3KKRA 3KMQA 1NHUA 4WZQA 1TKTA 3PX4A 1BQNA 3MFHA 3IG1B 2B6AA 2OPQB 3BREA 3OYLA 4J9RA 4J2AA 3OHBA 4I2PB 1HQUB 3MR3A 4E7KA 2IC3B 3MECA 3OJSA 2Z1HA 3TVKA 4J9SA 3H98A 4ECVA 4EP5A 5CZ1A 5KFLA 3KK2A 4NLWA 3RMBA 2G8IA 3HHKA 4O3PA 4K4VA 3LANA 4PY5A 4B9TA 3MAQA 4J9QA 3PJXA 3DI6A 4PUOB 2OPPA 4M42A 3G6XA 1RTHA 3G0ZA 4CEOA 2P51A 3IAYA 2OH2A 4B9NA 4OGCA 5KG5A 1JKHB 4EYIB 2ZE2B 3KK1A 4TSXA 5KG3A 5KT5A 3GV5B 4N47A 4HHTA 2B43A 4FK0A 3HPHA 4K50A 3O4NA 1K6YA 1GOBA 4OVLA 1Q8IA 2BQ3A 2HNZB 3LPUA 3QYYA 3AO3A 1EP4A 5HROB 1REVA 3G10A 1LAWA 4PWDB 3HVTA 2Y1JA 4QW9A 2D41A 2YKNB 5HRNA 2R7YA 2YNIA 1L3VA 1RT7A 1RDBA 1VK0A 4RW6B 1S1XB 2V9WA 4FLTA 2W7PA 4Q44A 1EETA 4IKFA 1S1UB 3T19A 5DG7A 4ECSA 2RKIB 3QESA 4NLOA 2G8FA 2IM3A 1HARA 1JLQA 3VQSA 1U49A 5KT6A 1KFDA 1TP7A 2OYQA 1LWCA 2XO7A 2Q3SA 3V9UA 1TK0A 4ID1A 1RBTA 4MIAA 3LALA 3SPYA 5KT3A 4CJFA 1ZYQA 4K4YA 1QS4A 4NLXA 1HYSB 2HHSA 1S0MA 4B9LA 3LP2B 4CEFA 3BSCA 3T5LA 2UVVA 4C8OA 4WYLA 3KD1E 4EZ6A 3L3VA 2RF2B 2BE2A 2DFEA 2G8KA 2HHXA 2Z1GA 4ZTJA 2GIRA 5EDWA 4XPCA 3VQ9A 1U4BA 4DF8A 2O4IA 1JLAA 4R8UB 1CLQA 4J2DA 1KHVA 4Y1DA 4FJHA 3DMJA 1IKYA 2YNFA 3GIJA 4IOBA 1L3TA 3H4BA 4E1NA 4Y1CA 4DQQA 4RUAA 1RAJA 4KHNA 1S9EB 1HNVB 2ASLA 3DLEB 1SL0A 4IRDA 4CCHA 4FCYA 4DS5A 1UA1A 2ITGA 1JLGB 1U45A 2D0AA 1HMVA 5D3GB 1JLBB 4DS4A 3VQAA 2XI2A 4TY8A 4CJSA 3OYJA 4BWJA 4GVMA 3RMAA 5KRSA 4CFBA 4KB7A 2JEFA 4Z4HA 1JLEA 4O3NA 3H40A 1S49A 2DPJA 2KW4A 3A2FA 4IH6A 5J2NB 3RBDA 1TL1B 4AHTA 2WHOA 4NLQA 4BDPA 3M8QB 4ECZA 2KZMA 1J5OB 3GV7B 1VSMA 1RT2A 3GIMA 1FKOB 4GW6A 4MH8A 3DLKB 4ZP6A 4ZP7A 1J54A 2KQ2A 2QV6A 4DWIA 3U6FA 2XHBA 4NLGA 3NF8A 1LW0A 3V6DA 4G3IA 2KFZA 4CGJA 1JL2A 4KTWA 1FXXA 5KI6A 1KLNA 2IM0A 4DQPA 3HXMA 1JX4A 1RCHA 3UPFA 1ZTWA 4DG1B 1T03A 1C1CB 4DTMA 2RDJA 1KVCA 3TR8A 4CE9A 1U47A 4X2BA 3V6KA 4B8CA 3BSAA 4FJKA 2HNDA 5KFWA 4EYHB 1BI4B 1JLFB 2FLNA 4JRQA 2J6SA 1KSPA 5K14B 4YP3A 3QIPB 1S10A 3MTKA 4ZPAA 3PW0A 1RT1B 5F9LA 2GV9A 3HL8A 1L5UA 4RNOA 1IH7A 1S1WA 3NH1A 2R2SA 5KFMA 3ASMA 1C1BB 2IAJA 1CZBA 2UUWA 4ED1A 4DL5A 4DU1A 2RPIA 4K4XA 2ETJA 4AHUA 5KFKA 2Y1IA 4URSA 2BGGA 1FKPB 2P1JA 1S9GA 4ECWA 4CEAA 3ISND 4O3QA 1WSIA 1RT6B 4TQSA 4F4XA 4ELVA 3FDSA 3DDKA 3NKYA 3IGNA 3DRRB 2OPSA 4DFKA 4CGHA 4KKOA 4H54A 4KBIA 3HJFA 4OL8A 1RBSA 3LP1A 4FLUA 1LWFB 2YHAA 4IKAA 3AVKA 1RYRA 3PX6A 4XPEA 2G8HA 2GC8A 3DYAB 5KGXA 4CJTA 2OPRA 3HYFA 4OLAA 3NAIA 4RW4B 4O55A 2VG5B 2P5OA 1RTJA 3DOLB 3ITHA 4DEZA 2UUTA 4RW9B 4LY7A 3M8PB 5J2QB 5DGAA 3RB6A 1JLCB 3Q8PB 3ZT1A 3U3YA 3K2PA 3NGDA 4B08A 4ED8A 5KFSA 4CEEA 4LSLB 2D3ZA 3KMSA 1WSHA 4K4SA 5KFNA 1I6JA 5L1KA 1ASVA 4DTUA 1YTUA 4M3YA 1TKTB 3JSMB 3V1QA 3D0PA 2V0NA 3V9ZA 4H4MA 2B6AB 2F8EX 3TAPA 4F4WA 4ED3A 1VSKA 2AJQA 2IJFA 3GYNA 5KFEA 5EWFA 3MECB 3L2QA 4ZP8A 4WZMA 2I5JB 3NBPA 4QPXA 1KVAA 4FM1A 3CYMA 3WNEA 3VQQA 4QOZB 5J1EB 3IS9A 3KK2B 4KHQA 3VN5A 1RT5B 1VSFA 1YVFA 4CF9A 4F8RA 4M3RA 4KB1A 3K5LA 3DOKA 3PVXA 4F3OA 4K8ZA 3IRXB 3ZT4A 1NK5A 4ELUA 1LAVA 1JL1A 3V1OA 3AVLA 4CJWA 2OPPB 3KLIA 2P5GA 4RU9A 1RTHB 3G86A 4XIUA 4CESA 5KFHA 4J9OA 2UVRA 4FJ5A 3CIZA 4QWCA 4J2EA 1Z26A 1EKEA 2XY7A 1NKBA 1RTDB 1L3UA 4O3SA 3KK1B 1BCMA 4M3UA 3QLHA 4OKJA 2QE5A 5KG4A 4CK3A 4B9VA 4RNFA 2VG7A 1SV5A 2FLLA 3PW7A 3AVAA 4O3RA 2B5JA 1REVB 2FJWA 3TAMB 1QQCA 3RBEA 5CYMA 5KFVA 1DLOB 3V81A 3O3FA 4FJNA 2RN2A 4O4GA 3HVTB 2WB4A 5CZ2A 1QE1B 1N5YA 4KV8A 1SUQA 5SZTA 4NCAA 4RNHA 1RT7B 5KT4A 5T7BA 3SPZA 1EETB 2HAIA 3WNHA 3LZIA 5EWGA 3Q8RB 3QEXA 4FLYA 4OGEA 4CJLA 1CXUA 4Q0BA 1DTTA 4DL4A 4U6PA 1SH3A 5DGBA 2E4LA 3ZSRA 3THVA 5KG1A 1JLQB 4IFVA 1BGXT 1S4FA 5C24A 3SUNA 2CJQA 3N6NA 3M9MB 3DLRA 2PYJA 2HHVA 3HVWA 1X9MA 1S6QB 2ASDA 5KFXA 3HP6A 1IG9A 1U04A 1ZBHA 4NCGB 3L2VA 4RW7A 4BACA 2R8IA 4FJXA 4E89A 3AA2A 2AGQA 3SUOA 2V4RA 5KG6A 4G1QA 4YR0A 3KLHB 3JYTA 5FROA 4CGFA 4DTRA 2BE2B 3ZSQA 4CEDA 1ZBUA 3C6UA 1BQMA 3DLBA 5C42A 3B6OA 2DPIA 2VWKA 1JLAB 3KJVA 2ASJA 2DY4A 2YNFB 3OYEA 4FJGA 1WNEA 1C0MA 4DTJA 4DLEA 3SJJA 3E01A 4M3ZA 1T7PA 4WFXA 1QHTA 3CJ3A 4AHCA 5DG9A 3HVAA 4LSNB 5CYQA 1LWEA 3FQKA 1HMVB 1HJRA 3UIQA 1D9DA 2X74A 4W5QA 2ZKUA 1ASUA 4NLUA 4TY8B 4O4RA 4MIBA 2AX0A 2XGPA 1TKDA 3BSNA 1ZBIA 4IR1A 4K8XA 3AVHA 1IKWB 2J6UA 1JLEB 2BQRA 2E9ZA 3OLBA 2IBKA 3KHHA 1WSFA 4TY9A 1CXQA 3H5UA 4ELTA 1TL3B 3G6VA 2JC0A 1RT2B 3MEGB 4FJ9A 3GQCA 5JXSA 5FDLB 4RUCA 1HPZB 3SQ1A 1XHZA 3O3GA 3V6DB 3C6TA 2D5RA 2IJNA 5KFRA 3NMAA 4TLRA 1T3NA 2ALZA 4W5RA 1HQEB 2HMIB 1TKZA 2O5DA 4ECUA 5I3UB 5KFBA 2D0CA 3EY1A 5KFIA 4Z4EA 2YKMA 5KT7A 2EC0A 1BHLA 3VA0A 3N6MA 3VA3A 4I9LA 5KFGA 4ZVFA 1FK9A 1NHVA 3MR5A 2RDIA 3OVNA 2IM1A 4FYDA 4ICLB 2XCPA 4Z4IA 3BSOA 2R8HA 2IAJB 1VSJA 3OYFA 1RDDA 5F8LA 1S9GB 4O0JA 2W7OA 4NLYA 2IMWP 4DU4A 4YR3A 3DRSB 1SKRA 3HVRA 1QSYA 4DU3A 2OPSB 3SFUA 5KFOA 4IH7A 3WNGA 4ECYA 4ID5A 4F4YA 4RW8A 2GIQA 4IR9A 4FJ8A 1JXBA 1RDAA 3VQCA 4CJ4A 3AVBA 1GOCA 4HCBA 4QAGA 4OJRA 4NRUA 3OSNA 3PZPA 2VG6A 3NE6A 4R5PB 3KLEA 4CHYA 2HWIA 1RTJB 3ZT2A 1A5VA 3T1AA 3BGRA 4JRPA 3KHGA 4MK7A 2WOMA 4CGGA 3L3UA 2E6MA 4Z4GA 1Q9YA 4KO0A 4ZPCA 1RTIB 4BE2A 1BIUA 1RA7A 1TV6A 4N76A 2W9CB 4LH4A 1N48A 5KFUA 4EO6A 3QO9A 1WSJA 3VQ4A 4ED0A
chains in the Genus database with same CATH superfamily
1KR4A 4DQ8A 5HP1A 5DG8A 1VSEA 4CHOA 3R2CJ 2L48A 5HK4A 3D3CJ 3AVGA 3LPYA 2DR6A 3GCWP 1KQFB 4C2MA 2HBJA 5HVFA 4MFBA 2VQFJ 2NUHA 4CF0A 3HHLA 4NLVA 3O08A 3P96A 3WBZA 1MWYA 5DRKA 4DMZA 4ZKAA 5A8KB 3OYCA 3CCRN 4RBVA 1NM2A 1C0TA 1ZA2B 3GP9A 3P6YC 1V5IB 4USIA 1LW2B 4FM0A 5CXTA 4FJ7A 3KLIB 1RBVA 2G13A 2KJWA 3BYPA 3IR6B 4EAHD 2DNMA 2QWLA 2MLYA 1ZBLA 3RR8A 3BPDA 5DK5A 1UEVA 3H25A 3KDOA 3RRHA 5LXRA 2EHGA 4ZPDA 3VAMA 2WW4A 3ZETB 5GIOA 1S6PA 3NFAA 2OI2A 3UNGC 3W0LA 5D77A 1SV5B 4LT6A 2FF6A 4E7IA 4CIGA 4LF1A 2P9LB 4DR5K 1LFPA 3ILOA 4KFBA 4C8YA 3PIOQ 3KLFA 2IJRA 1XMOJ 1XNQJ 3U3GA 3BGFA 2R4FA 4HI1A 2F4VK 3VERA 3AQOA 3LGHA 4ETZA 4DR2K 4I6AA 5KT2A 4KY3A 4P2MA 1VQ4N 4NYPA 3QT5A 3GYXB 4JYAJ 4P75A 2FJVA 1VMBA 3ZZPA 4UT4A 4HTLA 4Y2AA 2GBZA 2UUAK 1FVQA 1VK8A 3OBIA 1VHXA 3JQMA 4IO1A 2DCLA 2UUBJ 5SWMA 2FJBB 1GOAA 1C6VA 2V4JA 2ZFHA 1QSSA 1Y5NB 4FJMA 1Z4UA 2QKBA 3AOAA 1WDDA 3AAQA 1HHQA 2X1FA 4B3SF 3UFCX 1XI1A 5GADU 3EZUA 1HNIB 4JV5F 2VQEF 1L3SA 3ZZOA 4OI0A 2I38A 5DQGA 4KGXB 4ED7A 3TAFA 4RR5A 1X3NA 3IN5A 1RHUB 3BY5A 3J7Z5 4DV1F 4CZHA 5A2QO 1JB0C 1HFEL 2N3LA 5FLXU 3D6TB 4KBOA 2C2KB 4GMJB 3H90A 5CYQB 2E1PA 3RWUA 3G8QA 4B9SA 5ADXH 3F9KA 3IGVA 2FJAB 2RRNA 4CBXA 3GJSB 3AD8C 2RS2A 2V7ZA 4DR5J 1X1PA 3OL8A 4K7QA 3DCAA 2EX3A 3OHAA 2A42A 3EVOA 3DWLA 4K0KF 3KUGA 2OUGA 3I5CA 3L2WA 2GAHC 2DISA 3VAGA 4Q43A 1JIHA 2RD5C 4K43A 1ZA1B 3R1LA 2BE7D 3GSIA 5C2CA 2D1KA 2YJEA 3TTFA 4FWPA 5THWA 1C0UA 2DTJA 3TJ8A 5L1LA 2MGZB 5BN9A 2BUPA 2KFNA 2FY8A 1JXLA 3CMAN 3TWHA 4V19X 1WSEA 3SK3A 1MDUB 2OP5A 5CD4H 3POTB 2GWKA 3G2XA 3LM2A 3NMRA 1REGX 1HNVA 3I33A 2CPHA 2I7PA 2QSWA 1S1VA 3SI6A 3TA0A 3LWLA 2NZ4A 1JLGA 2ASPA 1K9MO 3HPGA 4X64F 3QFWA 1JLBA 4AHSA 3EVWA 4DV6K 2B7BB 2V51B 1YWXA 4KAZA 1WSVA 5CCLA 3R6GB 4WF9L 4X62F 1SJQA 2W8KA 1C2PA 3NNCA 3MM7A 4CEBA 3QETA 4WWSA 3CCQN 1FFGB 5HI7A 4IWVA 1YK9A 4W92B 3QEIA 4YOXA 2GEMA 2AIRB 4I2QA 1R8AA 3IMXA 3KLEB 4YOWA 3D28A 1GXUA 3MD3A 2LDIA 1F6TA 3EICA 4CLFA 3TRGA 2ZJPL 1YVNA 3MXHP 2A3JA 2IA6A 3J7AN 1TL4A 3B4DA 3MCMA 4BWMA 4MO5A 4JS4A 1SKSA 2ZOGA 2VWJA 1B7FA 5GMKa 3I56N 1HPMA 1VSHA 3DGVA 1XJWB 2FSKA 1Q9XA 1CJKA 4DPWA 4N77A 2X6SA 3OS2A 4HI2A 2KRBA 1FKPA 3JSRA 4CZFA 4H0YB 4NZ7A 1U0SA 4C3KA 3SLCA 3AVCA 3MDQA 1RLCL 3O2IA 3KWGA 2Z2ZA 4ID8A 4FZVA 2HVIA 2VWBA 3HHLB 3OJUA 2BKOA 2KZZA 3TANA 2IVFB 3ALYA 5E3RA 1Y3JA 4NI2B 1RT3A 5L9XA 1C0TB 4JI2F 4C0BA 5EVZA 4WYWA 3BQ2A 3EPIA 2YKOA 1XUPO 2IY5B 3CUNA 2FVSA 4RL1A 5EX0A 2F96A 4OZJA 3K5NA 3NGYA 4LR8A 3HHLD 3THWA 2A2CA 1AUSL 4DV6J 4ENOA 1JLCA 2L9NA 5CY4A 5KPTA 3KKFA 2CZ9A 4CW7B 3NS6A 5EWEA 4G9ZA 3OYGA 3LPTA 3R8EA 4ECQA 4F4ZA 3SQ0A 4LH5A 2RE1A 3CM6A 3PXGa 1RP5A 3KVGA 1NH7A 1E6VA 3F2KA 1AW0A 1NNDA 4F0MA 2FGCA 1YJRA 3SV4A 5HN0A 1MMNA 1HX1A 1S72N 4ZHRA 1FJ7A 2FDNA 4KFBB 3I8DA 3KLFB 4KHMA 4CLYA 1TMJA 2B9EA 2H5EA 3TA1A 4NCBA 4OYOA 4QIWD 1KBRA 3B6PA 1XR7A 4PRFA 2YNGA 2YHXA 2FLOA 2J8SA 1RAGB 2HNDB 4HHHA 4Y2CA 3AVIA 4OX6A 2J9CA 4NB4A 5DQIA 3QSYB 4CFDA 1M5PC 4LBPA 2VPYB 4ER8A 1E6YA 3PRVA 2W2OP 3NOGA 4MYUA 4AL7A 3KHYA 2FVQA 2G8WA 4H4OA 4H5RA 1Y9OA 2V4JB 4MLHA 3KUEA 1YT3A 4CK2A 3T6BA 1B92A 4FJJA 1AROP 5BYRA 3P5JA 4OI6A 1OQ6A 3AA5X 3CETA 1R59O 1N5QA 2F65A 3C6HA 1U2FA 5AJ3J 4ANDA 1TK5A 4ZVPB 4JV0A 3L7UA 4BREA 4DV4J 3TAMA 1F5BA 4FM2A 5GAGI 2MZ1A 3CD5A 1RWUA 3VQPA 4LC9B 4E8UA 1T6DA 2QIFA 1XNRF 3AJ2A 4NO7A 2GA7A 3QBXA 3BJYA 3BPSP 1RWPB 3ZT3A 1K73O 2R7OA 2A40A 1Q7YO 2DRBA 2HBKA 4FW1A 3W2VA 4DV3F 3CFRA 4HUGA 4F3TA 1B0PA 3PIOL 1FXLA 1M5HA 3IWLA 4J9PA 2WUSA 1PKUA 2O8BA 2VKRA 4QU6A 1VJQA 1S0VA 4P52A 2RJZA 2MKJA 4JI6F 1C0UB 1EX8A 3P3DA 1U0HA 3QGHA 4GVBB 1XIQA 2FB0A 4KRFA 2B8PA 4X65F 1KAZA 4JI3K 1KONA 4DL7A 3WQTA 1UETA 3LDLA 2GMLA 2FBVA 2ZHOA 3PO5A 8ATCB 3VAJA 1WF1A 2GX8A 3AGRA 2A6OA 3DGPB 1WAJA 1HNXK 1S1VB 4HTIA 4UOGA 3EXYA 3KXDA 4W5OA 1HWLA 3FCWA 1UTAA 5ETPA 2HBLA 5AR0A 5JUMA 5KRTA 4DOZA 3H42A 3BH7B 3RVCA 1TMMA 4J7CA 1X4EA 3R5CA 1SUQB 3K2YA 1BWEA 2P9KA 2C3OA 5ETMA 3MM7B 1NMNA 2J9DE 3V9XA 5GAHU 4NLCA 4UQGA 4KB0A 4Q8FA 4HDGA 1TL3A 2L41A 3AJ1A 4DN0A 4IO8A 1HHSA 1IJJA 3MMCA 4Z94A 4I2QB 1WC0A 4HVJA 5FDLA 2HG4A 1QUVA 1CJUB 1DTTB 2Q79A 5KQ8A 1MWQA 3H46O 5C24B 4JUZA 4CHQA 2DXEA 4ECTA 3MHYA 1FDNA 1ZTTA 4DFMA 2DKOB 1ZXOA 3D7SB 2HBQB 3GIRA 4MKBA 1XERA 4MDBA 3L2UA 2QXFA 4FPBA 3OPKA 4OLPA 1I39A 3VEZA 4HKQA 3FSIA 3OBWA 4BRPA 1CJKB 3IAM9 3OS0A 4G1QB 3UD5A 4CZIA 4U7CA 2HIYA 3O8MA 2PI5A 4PKDB 3GOIA 1ATNA 3ZEUB 2V5HG 3NNAA 2PN6A 1IBLF 4WFBQ 3WC2A 4JI3J 3ZT0A 1KFSA 2XRIA 1RT3B 2B4JA 2VV5A 2PYLA 4RZRA 4J37A 3RTVA 4FS1A 1Z05A 3O1WA 1HA1A 3CCSS 4RLEA 4DF4A 3TTDA 1FJGK 3CCVN 3THWB 2HPUA 1U24A 4M5MA 3MFIA 5AQJA 2HZVA 3HI9A 3M32A 3MI7X 3C94A 3KNAA 2MY8A 4I64A 3RRKA 5LJ5Y 3QZ8A 1TUUA 4OPKA 1ATRA 1A5WA 2RHQB 3D4JA 4Q5VA 2HB5A 5DO2A 2Z4PA 3CCWA 4P2SA 2W9CA 4ZCLA 1EQYA 1E6VB 4FK2A 2KHCA 3L9ZA 4DXLA 4C11B 3LP2A 3GV8B 2NXUA 2E9RX 3FGUA 5CCMA 4ZHRB 4HL9A 3DLLQ 1SH0A 1U1RA 2WVFA 1M0SA 1IM6A 3RMCA 2XMAA 1U6BA 4J2BA 5KFJA 3NCIA 2YNGB 3ZX2A 1TKZB 3CDWA 3O5TB 1VISA 3AO4A 5A6WA 1NGIA 1IKVA 2XMUA 2UU9F 3CM5A 3QIOA 1VDHA 4DTOA 4IO9L 2PEHA 3CJAA 3M8RA 2BJ7A 2COLA 2P9PB 4IBNA 1PJ6A 5D4LA 1EX4A 3JTPA 4BLGA 3CD7A 2I9SA 1Y3KA 3FGVA 1EARA 4JI8F 1B9DA 4H4OB 3PV8A 2P9SA 1X0FA 2MKIA 3FLCO 4TU9A 2DY9A 4P10A 2XYPB 5ELZA 3OYKA 2FLPA 3M6UA 4JAXA 5M1OA 5BJRA 3G6ES 4EEYA 2BKPA 1F60B 3HHDA 3M8QA 2ZWPA 1BUXA 3WQPA 4CF8A 1WTBA 3QICA 2VG6B 1FRHA 2XMWA 3JB9k 3IC1A 2OZMA 1D9FA 3BKFA 1YDLA 4Y6IA 4FKXA 1QQNA 1EB0A 1QZ6A 2AX1A 5KFQA 1C1CA 1NK4A 1RUSA 5D0EA 2F40A 1JLFA 4AE5A 3OTDA 1Q86O 1TV6B 3K59A 1RT1A 4ZOSA 2OLWA 5AQNA 1X7VA 1AB8A 5BYSA 2HHUA 4CF2A 4X4VA 3PHTA 2CZVC 1HR0K 5IQQA 3VVTA 1FFWB 1HW8A 3CDBA 3QERA 4P73A 1D9AA 3PX0A 1ITGA 2OJ3A 2V8GA 1QSLA 4DSIA 1Z2LA 1HNZK 1B70B 3RAMA 4J9NA 1RT6A 3TAQA 2O8BB 4NLPA 3PY8A 2FVRA 3CMQA 3UQSA 2IS3A 2Q6BA 1YGYA 2XMTA 1HBNA 4ZJQA 4DN9A 1O51A 1VQ7N 3DYAA 5GADP 2HBRB 1YJ7A 1UWBB 3ZNUA 1IBMF 4JK8A 3I5AA 3V1RA 5AQQA 2W01A 1RABB 3DOLA 3SAGA 2YWHA 2R2RA 3SV3A 1N56A 1Y11A 1OH8A 4U9RA 4GKJF 3QINA 3H5SA 4LRCA 2BJ1A 5BRHA 2XY6A 2CQGA 3W8GA 3UI3A 2O8DA 1P6TA 4H03B 3KKRA 2D69A 3D0IE 3KMQA 1BQNA 2VFRA 2OPQB 1CVJA 4A8FA 3JS9A 4J2AA 3OHBA 2V52B 2K1RA 2P9KB 4FWQA 2Q31A 4E7KA 2RQCA 5GINA 5BPMA 3RG6A 4RWWA 5LSLA 4BRAA 2P9EA 2CGLA 2G8IA 2D0OA 4O3PA 3P8BB 4PY5A 3W5YA 1G99A 2CA9A 3HZ6A 3DI6A 4PUOB 1UPMB 3ILJA 5CQGA 2GHPA 3C8YA 1BOTO 1EHWA 4CEOA 2X1AA 3IAYA 3DDNA 2HHHF 5HMXA 1HNZJ 5KG5A 1JKHB 4C23A 4E2FB 2ZE2B 5KT5A 1FRLA 1WUUA 3D6HB 3T41A 3A12A 3CCMN 3QT7A 3HPHA 1NDKA 1CEZA 4DKWA 1SQEA 4K50A 4OVLA 1Q8IA 2GQ2A 4I67A 4HT7A 1EP4A 1REVA 3UB5A 2DJWA 3SBGA 5ETNA 4Y28C 5AZIA 2Y1JA 3EUNA 5B0CA 2R7YA 2YNIA 4GV9A 5DDQC 1L3VA 1UWAA 2X7IA 1NB7A 3N9UC 4QYRA 4B3SK 4IKFA 3LDOA 3T19A 5DG7A 3QRRA 3K5PA 2VYPA 3O9TA 2G8FA 2VBWA 4OI4A 4H0VB 4JV5K 4JKFA 5AXNA 1HARA 1JLQA 2VQEK 3M32B 1FX4A 3PYDA 3V5RA 3B8AX 2IBOA 1OO0B 1Y00A 3V9UA 4DV1K 3RJMB 3J7A1 4ES2A 5ETSA 3LL3A 2MSSA 1PIEA 4CZKA 3VESA 5KOXA 3CC4S 3WXJA 1SJ4P 3LP2B 3KG4A 1UFLA 3T5LA 3ENVA 3KD1E 2HHXA 4ZTJA 2O4IA 2KT5A 3ZZZA 1KC8T 4KC5A 2KL8A 4Y1DA 3DMJA 3MGJA 5B0BA 5C2DA 1OPZA 3R27A 4K0KK 4V19S 4Y1CA 4A8KA 4OX9F 2XMKA 3GWCA 2PMHA 3DN9A 1AT1B 4P7VA 1W2IA 2EFQA 4U7UK 1BD6A 5L9NA 3IA0A 4FCYA 1K8AT 1U45A 1VAZA 2D0AA 1UZDA 4FF4A 3VQAA 2P9SB 3KJFB 4TY8A 5EXWA 3SCJE 4ZVUB 3NVKA 4GVMA 2PSZA 2CNOB 4Q2LA 4WFBL 4OI2A 3OFEA 4PKIA 3FBCA 3THTA 1H3DA 1S49A 3MOZA 2HRTA 1FWKA 1CS4A 2LU1A 1TL1B 2WHOA 5B0DA 3Q24A 3GMGA 2CH6A 3M8QB 4BC5A 2KZMA 1RT2A 3GIMA 1FKOB 4B3SJ 1O0PA 3S01A 4X64K 3CC7S 2QV6A 4DWIA 5GVQA 4CI6A 1X60A 4G3IA 4JV5J 5AQYA 1KNZA 2VQEJ 2NZCA 4ZLLA 4ZA1A 2ZH6A 3HXMA 4BC4A 5IS2A 1T03A 1C1CB 2NXJA 4CE9A 4DV1J 3TR8A 1U47A 4C9DA 1JLFB 5IQ6A 4YOYA 1B7YB 3CIMA 3CCJN 4NA2A 3PW0A 1RT1B 3E3XA 5F9LA 3HL8A 5LL6d 1S1WA 1UVKA 3NH1A 2R2SA 5KFMA 3DLLL 1GLJO 4DU1A 3TSQA 2Y1IA 4FYYB 3FE1A 4IEIA 2ZM6J 2P1JA 2CQPA 3IMQJ 4ECWA 4EK2A 1RT6B 5HAOA 3NKYA 3IGNA 3PIPL 2X1BA 2NR0A 2PT0A 4K0KJ 4QS8A 3I8BA 4DPOA 3AA8A 1G4CA 1RBSA 2NRZA 4BRIA 4K5SA 4DR3F 2EWHA 1HBNB 4FLUA 1RBAA 1RYRA 2GC8A 3DYAB 5KGXA 3HSCA 2L9DA 3L6QA 4OLAA 1RTJA 3DOLB 1VQPS 3ITHA 2EFPA 2XHCA 2UUTA 3C65A 2IRXA 3RB6A 1L3KA 1NSAA 4RU2A 3ZT1A 5CH7B 3U3YA 4B08A 3LDNA 3S1TA 4CVNE 1NLVA 4DDFA 3KMSA 1HQ2A 4JI2K 4JI7F 4DR6J 2OKQA 3QJPA 1VBKA 5AQMA 1WKLA 2C1EB 1WC4A 4HACA 3CT9A 2HRYA 2GS8A 3D0PA 1EQ0A 3L7PA 2E5HA 1F5CA 2F8EX 3NWRA 2AJQA 3FEYB 2K1RB 1JJ4A 3CJKA 5KFEA 3HOSA 4QYZK 2QRRA 4QPXA 3NBPA 4X62J 3WNEA 1Q18A 2G4BA 5F0UA 4DB3A 2ITMA 1V4TA 2FHKA 4KB1A 3E1YA 1LXNA 3K5LA 4USHA 3OTOF 2VGMA 3ZT4A 3RW6A 1JL1A 3AVLA 3SAHA 2BJEA 1W7WA 2C3PA 1U02A 4BY9C 3QFHA 4CESA 2VUGA 5IT9O 2DNRA 4FJ5A 4QWCA 3FMBA 1Z26A 4HH1A 1NG9A 3K8WA 3FZHA 2O1PA 4WK1A 4M3UA 3QLHA 5KAKA 4OKJA 2QE5A 5AE2A 5BPLA 5KG4A 4B9VA 1ZAVA 1HNWF 1QVGM 2B5JA 1REVB 2FJWA 4ILJA 3RBEA 5CYMA 2IA0A 1DLOB 4NYOA 3V81A 2ZVSA 5AZIB 3AODA 2JOQA 1SPBP 2WTUA 1Q78A 3VAFA 3MCPA 2KYXA 4M5JA 4KRWA 3LZIA 3IBWA 2OD4A 5GAHP 4JI2J 2LEBA 2E2PA 4CJLA 3WXKA 1UFWA 5BREA 4RWXA 3THVA 5KG1A 1JLQB 5KPZA 4IFVA 3SUNA 2CJQA 1TUGB 2EKYA 3Q89A 4ALZA 2HHVA 2KT2A 1Q79A 4PQAA 1XNRK 3I9ZA 3MMAB 3WXLA 1MWKA 5AZJB 3FZLA 1RHQB 1ZBHA 4NCGB 4JKHA 1T9TA 4A8SA 1XMBA 2V4RA 4UUWA 3BDEA 3KLHB 1H38A 4KH4A 4DV3K 1ZBUA 4OHZA 1BQMA 3DLBA 3ID8A 1KTVA 3KFWX 2DY4A 3WQUA 2XWXA 1PYOB 1GLCG 3OYEA 1TUWA 2X1GA 3KWIA 1C0MA 2A10A 2C3MA 3PYGA 1OY9A 3MURP 2CQBA 4L74A 2OANA 1DKGD 3BN7A 4LSNB 4H5WA 2NPFA 4X4QA 1U1KA 1HJRA 2W6LA 3UIQA 4BG9A 2UXBK 1ASUA 4JI6K 4AM6A 4TY8B 4O4RA 4QS7A 1QVFM 4MIBA 1NCLA 4A46A 4YB1P 3W65A 4X65K 4WTYA 1Y4ZB 1IKWB 2J6UA 2CQCA 1LEOA 3KHHA 1WSFA 2J9EA 1YKWA 1HWUA 4A5BA 2JSXA 4ELTA 2M4MA 3G6VA 1RT2B 4ZK7M 4TVAB 3CPEA 3MM5A 1BA0A 2LU2A 4J8FA 1GK8A 3GQCA 1PYTA 1U8SA 1ILYA 4IYQA 3DXSX 2OD6A 2D5RA 2NNWA 2B4OA 2IJNA 3QAEA 1T3NA 4W5RA 2H4YB 2LDYA 2HMIB 4C3LA 5I3UB 1OWXA 5KFIA 4Z4EA 2WVEA 3LGNA 3NEKA 1SIWB 5KT7A 2EC0A 4CP5A 9RUBA 3VA3A 1VC6A 4L3KA 3MUVP 1FK9A 3VF2A 2JZ5A 3MR5A 3W62A 2XCPA 3JAMU 4IQMA 3CMEN 4JD2A 2GCFA 2UXCF 2DHGA 1YJ9S 3OYFA 3MTJA 1RDDA 4DV3J 3FZMA 4O0JA 2ZH7A 5RUBA 1F9EB 2IMWP 4DU4A 4YR3A 1N32F 3SFUA 1QM9A 4JKCA 1NXIA 4RW8A 4UY8O 1R3NA 2BTFA 3VHQA 3NY0A 4N7TA 2CJYB 1P8GA 1GOCA 2OEJA 2ADCA 3R1XA 2R7TA 5ADXA 4QAGA 1OIAA 3FKBA 1IR0A 3VQTA 2KG0A 4R5PB 2Q2RA 1RTJB 4JHDA 4CM2A 3UCGA 1T11A 4JI6J 3JTOA 4JRPA 2DH8A 2WOMA 2BM1A 3UO0A 1IBLK 4X65J 2E6MA 4I6MA 4LBIA 2F7VA 4LJMA 3CJCA 4ILHA 4O23A 4BE2A 1BIUA 3VF4A 4C4WA 1UMJA 3G4SS 2K3IA 2V8VA 2QI2A 1Q81T 3DLGA 2A1SA 1OSDA 5B7WA 3CJKB 2PC6A 3TNVA 4B9UA 3NGTA 1Q8KA 4UOFA 3CPWM 3NBPB 5CD4A 4PA1A 2C28A 4MLEA 1WHYA 2E66A 4CT9A 2JEIA 1IWAA 2KFYA 5IWAK 1T8EA 3MEDA 4I9QA 3I0SA 2W24A 1WNSA 4LVNP 3BS9A 2MHEA 5I4MA 5M2PA 4DTSA 1LOTB 4IG3B 4DBQA 5HRRA 3Q7BA 1S97A 1FWLA 2Q6CA 1QVFR 1JCGA 4N41A 2R2UA 3SCIE 4ZIVA 2UU9K 2Z58B 3A8KA 2AV5A 2N3OA 4FW2A 3KD5E 3OR1B 3WNFA 3FEXB 2B5JB 1HBOA 5LJVA 1XWLA 3V81B 3EXCX 1NK6A 4JI8K 4KHUA 1K1SA 3IG1A 1R0AB 4K4ZA 4NYNA 1T05A 3SSRA 3Q22A 3MXMA 2E6LA 3E8OA 4K4TA 1VSLA 2HHTA 1HQUA 4OKEA 3PJWA 1IBLJ 4BVOA 4FWKA 3OTBA 5HJYA 2YWEA 1VJWA 2DTUA 2P6SA 2XM3A 4TYAA 4H0PA 4X4OA 3M1VA 1WUAA 3J7YU 4QWEA 4KPYA 4CEZA 1B3TA 4WKYA 2DK2A 4M3WA 3C7NA 4WFYA 4ILMA 5G0RB 1UEKA 4LF5F 5DJBA 1ZBFA 1BHNA 3PSIA 4RTFD 1B64A 4EWTA 4ZPTR 1N6QA 4PQUA 1S9FA 3OL9A 3NF7A 4MKAA 4OJ3A 1Z25A 3A13A 4L73A 2QWRA 5B0FA 5IT9Y 3ZX3A 3RBXA 3CCLS 4V1Ak 2BABA 1VQ9S 4F3QA 1IKXA 5ETLA 1YBUA 2XLJA 3AO2A 1VRTA 2DHAA 5HBMA 4ECXA 2HMPA 4EHTA 2W8LA 1F1BB 2QMUB 3AV9A 2Z1IA 4QBUA 1RHRB 3CJ0A 2GW8A 2E8AA 5LY3A 4Y34A 4M3TA 2V2KA 4DFJA 4WU2A 3CW2C 4E98A 3H3NO 4JYAF 7FDRA 1DTQA 1YX2A 4V19J 3MAHA 3PFEA 3VAHA 2XSJB 3HSDA 2P9UB 2MYFA 4O44A 2UU9J 3J81U 4JS5A 3EWGA 1CJTA 4CLKA 3CQ8A 3KZBA 2UUBF 3EGZA 3N01A 1IBMK 3RBZA 4URGA 5DDPC 2O01C 4BROA 2JGUA 4JI8J 4EZ9A 4LF6K 4OZ0A 1IJEB 2GVDA 3QFUA 4X4UA 4DR7J 1X9WA 4NOHA 5EX5A 4GKJK 2YI1A 3S3NA 2M5YA 2OTLS 3ZTQA 1FXRA 3A8YA 3OD2A 3I5BA 3ATVA 2R8KA 3MM5B 3CPWR 2L08A 1G15A 1UEUA 4QW8A 3H5YA 1ZZNA 1C1AA 1ZC6A 1GT8A 4CRJA 1X3MA 1BWFO 4EIAA 5AQZA 4YDDB 3DHWC 4KHPF 2DCUB 3AVJA 5LSOA 3TO8A 1X9JA 1V5VA 1UVIA 4TU7A 2FY1A 4F25A 1U2CA 4KE5A 5F41A 2KU7A 3HFVA 1FK9B 3ZZTA 3ULEA 3PUFA 1OQ3A 4FXDA 1EIYB 2G0CA 1VRUA 2CH5A 1GXTA 4K59A 2CQDA 4JD2B 3P83D 5MLCQ 3LPEA 2GMJA 2E2QA 3PHEA 4OPAA 2I6WA 2HHHK 1X4DA 1GXLA 2P8IA 2ZH1A 3V6HA 3HI0A 1NUEA 1XMQK 4CWBA 4RW8B 4USUA 2ZBQA 2AJFE 4NA1A 3H8YA 3HKWA 2DGUA 2BW2A 4K41A 3VZIA 2ZH8A 1X9SA 2HF3A 1YBTA 3TAEA 3CD0A 2B4UA 2IFXA 1N8RT 4CJ7A 1XQIA 1KTQA 4GKKJ 4MQ3A 2HZAA 2WOMB 1IBMJ 3AQPA 1N4LA 2KHDA 1LWCB 3VQDA 2E5IA 4I6MB 1WSGA 3OUYB 5AQTA 3GR0A 1BI4A 3M9NB 2BVZA 5BR8J 2NZTA 4YOUA 4DMNA 1H0HB 4GKJJ 1RDRA 3TQEA 2UVUA 4QCLA 3O9RA 1ZH5A 5DMRA 3AOBA 4MMOA 4H8KA 4HUEA 3DLGB 3CJTA 3AARA 4B3TF 5HLFA 3SZ2A 2DO0A 4FSVA 2EWSA 5JS2A 4B1XB 2V34A 4F50A 2VZ9A 2VGNA 2R7UA 3CFPA 4WP8A 3QMLA 1KQKA 1B0TA 1VBXA 1YTAA 2JEJA 4DR4K 3MEDB 3I0SB 3H08A 2Z0GA 3VALA 2WVDA 3J80O 2B7CB 2YPYA 2B9YA 2ZD1A 2Q66A 2Z2MA 4Z4CA 2XB2D 1R6YA 4RW9A 3M8PA 2FIUA 2CIMA 4CTAB 4FOEA 4I68A 1UAXA 1RLDA 2HHHJ 4LSLA 3MR2A 3OW2M 1K0VA 3SI8A 2R7SA 4NYZA 3OVBA 4IFYA 1HBOB 2ZWHA 1CZ9A 4F3MA 5HQLA 1R27B 2DYAA 4ZN1A 4M5DB 1T05B 2AZ1A 2E88A 3VGLA 2WBMA 1IQZA 1U8WA 1LW0B 3R9PA 2V7YA 3I31A 4O0IA 2CDRB 2P2CB 3DXBA 1RHKB 2ZWOA 4NLDA 4JKEA 2B9XA 3ZTOA 3S8SA 3M1VB 3VEWA 3CJ5A 1DAXA 2E1MC 3RGIA 3T1HJ 1R8BA 3IRXA 4HCCA 3C7NB 2PIIA 1IBCB 1SI9A 4DSKA 7AT1B 1HKBA 2WB1D 4ZVEA 1BG3A 1DGKN 2K8GA 3ISNC 2ZH2A 1N6QB 4PQUB 3NF6A 2H9ZA 3T1YF 4QR0A 3KTQA 4BQZA 3GJQB 2J8AA 3SIPB 4K4UA 1F9FA 1RTDA 5BXIA 2GAGC 3D6MB 4AHVA 1EO1A 1DJ0A 3BV8A 1PJ7A 1KQSM 1W26A 4IDKA 2FJEB 2C2EA 2R8GA 2QG9B 1UW4A 3BO4A 1IKXB 4FBUA 2QMXA 1S5JA 5H1SQ 5KGWA 4PPZA 1VRTB 5HBMB 2YXLA 3LP1B 1VLYA 2JFKA 1TTHB 4P74A 4DPXA 5ETVA 4TYBA 2GHVC 4Y3CA 1U6ZA 2Q1LA 1RDCA 1QE1A 2DGQA 1B4SA 1WKKA 4ZVOB 5H9EK 1KHWA 5EX3A 3ZYYX 1DTQB 5AQOA 1RWXB 2U2FA 2BXJA 1S79A 4JBCA 4O44B 4OX9J 2KDOA 2MQ8A 2E2NA 4DR3K 5CHIA 1CJTB 3LZJA 4DV2K 3MCAB 4LR7A 2QKKA 1NGFA 1WC1A 3MM8A 1ZM2A 3QPIA 1W7AA 4H4MB 1S48A 3NGUA 3ZCMA 2A3ZA 1Q95G 1VBZA 5F8NA 2P9IA 2IDLA 5AJ3F 1J5EJ 4DQSA 1XHXA 1SH2A 4DV4F 1QHAA 2K2PA 3CO9A 3DOKB 1MN7A 3IWNC 1Y64A 4DUZF 3UKRB 3MWPA 2DNHA 5GMDA 4Z4FA 1KLMA 2LCWA 3A5OC 3A8EA 1KDNA 1SBRA 1BCOA 5AQUA 2K7KA 5B09A 1IQTA 4AL6A 4EFHA 4OHYA 2OIHA 1C4AA 3PEJA 3ZO7A 1PBAA 3ULEB 5KFDA 2CVEA 4LQ9A 2MZRA 1VRUB 3VQ6A 2E29A 3NDKA 4DQIA 1PYSB 3OTOK 1O6XA 2GUIA 1GEHA 1TL5A 1D4XA 1JMTA 3OW2R 4OFZA 4ZCIA 5C2GA 2DNNA 4QIEA 3H20A 3MM9A 1T0TV 4PXCA 3WXMB 2FJDB 4OYBA 5E0OA 4PG4A 2ZUAA 4CI0B 3M8SA 1CZAN 2O8FA 2UVWA 1RWWB 4W4MA 4KTQA 3MMVA 4YMEA 2RSQA 2IC3A 1XQSC 2G1DA 2EI5A 1WOQA 3MEGA 1HNWK 4LFAF 3BQ1A 2AEFA 4DL3A 3SQ2A 3D1QA 1WN7A 3ID6A 2Q36A 2XY8A 3PG9A 1M1KT 2C42A 2FVCA 5GMEA 3HM8A 3HSJA 4L72B 2V69A 2M88A 4BHQA 1HYZA 4BRKA 4ISFA 4JP8A 3TARA 4RKUC 5DZ7A 3S41A 1QY7A 3P31A 3AAPA 5JVHQ 4RW7B 5FRMA 4ICLA 3M8YA 4JI7J 1JCEA 4BRCA 3RAQA 1WG5A 1KQSR 3JYTB 1RZMA 2CNKB 3H4DA 1S0NA 2VD3A 4CJRA 1Y10A 5HLFB 2C2RA 2Z57B 3W61A 5EHHA 5HROA 3G8SA 1TAUA 2AWZA 2V8PA 1UVNA 1KN6A 3D5MA 3WDOA 3QZ7A 3TVYA 3DRSA 4JI0F 4ANCA 2FD2A 1YIJS 2B0GA 2O8CB 3ENHA 2BQUA 3VEVA 3ETOA 4DX8H 1U1MA 3E01B 1LCUA 3CFOA 2RMLA 5HMWA 1WHXA 1S22A 5ETQA 1S1XA 1K8KA 2OTJS 4OHVA 3H0PA 2RKIA 1LWEB 4FZXC 2ADBA 1R89A 5GAEU 2ZD1B 2R2TA 3OTOJ 2EFGA 1YI2S 4ES1A 5KFCA 5GADI 4OYZA 4CJQA 4AH9A 1UKUA 1CC8A 2Q1NA 4HTUA 3SNNA 4YOVA 4HYKA 4JLHA 4UOHA 1P8ZA 3V9SA 4DCPB 1VQMS 1MMDA 2K3KA 3I32A 4IFYB 2AF6A 4JKDA 2NSBA 1DFDA 1HNWJ 3AA9A 2E9TA 4C8LA 2QK9A 3SBTA 2VA3A 2Y0BB 3MXIA 4FOIA 3AY9A 1NJYA 4KGMA 3UW1A 5AQKA 4I0WA 3THPA 1GFWB 3VTHA 3M9OB 2R7QA 2ZUGA 3AD9C 2QA4S 2OMOA 2NRXA 5F8GA 4KAIA 2HOEA 3AVNA 4M3XA 4ZPVR 3OXFA 3TTCA 3FZ2A 2XULA 1LW2A 3DLEA 5ITHA 2DVIA 2GQCA 5G4DA 1P9QC 3G71S 5HMYA 1RILA 2LQBA 1N34J 2ASOA 4HR2A 1YG0A 2YKQA 2LMIA 3KYLA 2HYIB 4UZBA 2XC9A 3C16A 5JICA 4FWOA 4IDKB 2KLAA 3U27A 4GV6A 1YZ6A 5C10A 4Z0UA 3QT8A 1ZETA 1DURA 3NCRA 2PGCA 3ZZRA 5SUHA 4WIIA 4DU7A 2MQMA 4USJC 4O5BA 2UXCK 4KGKA 2VFTA 1IN0A 4DX7A 3MXJA 1KVBA 2P9LA 1UPPA 1WEXA 2IVYA 3M30A 5AQRA 1YZ7A 1RKIA 3OR2B 4PL8A 2RIJA 1D0EA 2W4CA 2OELA 4F0KA 4RNMA 1N32K 4RWTA 1TQLA 1TGOA 2GHWA 4CJEA 3CI5A 3LWMA 4JN4A 1SZ2A 1GLEG 1I3OB 3K5OA 1Y97A 1FNOA 3FC9A 4A59A 4Y00A 4BS2A 1CJVA 3J7YP 4ZVSB 3TX8A 3GIIA 3QO9B 1C1BA 1NK9A 3GCXP 4NLRA 2XWYA 3FSXA 2AHOB 2P9IB 3AA3A 4FL9A 2X6NA 3TR5A 4FWRA 5AQVA 3AAWB 2FBXA 3DXKA 1JJHA 1J9AA 1CULB 2BZ2A 1HNIA 1KLMB 2MB0B 4KH5A 2GGPA 3I6PA 3CHWA 2J5AA 2CNLB 5AQSA 3CCEN 3BBFA 4C8MA 4B3MF 4IJAA 1NK0A 2EFVA 3FQLA 5KFPA 4NMLA 1FFSB 3R3LA 1VQ6N 3DOMA 3T5HA 1FRJA 4ZN3A 1HYVA 3SCXA 2DGWA 1NMDA 1WB9A 1U1QA 1S7IA 4CJVA 3BZKA 5D6GA 4A8OA 3D67A 5FIIA 3M8ZA 2UXCJ 2LQ5A 3EKUA 2H3GX 3ONQA 3HFKA 2B6AA 3WXIA 4I2PB 1OKJA 2W25A 2IC3B 3MECA 3MR7A 1N32J 2IVPA 4CZGA 2ASYA 2HLTA 4J9SA 4DHVA 3H98A 4ECVA 3CJQA 3KK2A 3HSGA 1TU0B 4NLWA 1R0BG 2EXUA 3GSDA 2ASMA 3RMBA 5DM6Q 5H9FK 2ZITA 3MMJA 4M5NA 4OYIA 5C7PA 1ELOA 3ENOA 3LANA 1UL3A 2CADA 4B9TA 2LXUA 1JNZB 2XTJP 1NGBA 1YJNS 2OPPA 2MGZA 3OFFA 3C66A 2H48B 2L3MA 2D9OA 4B9NA 1NJIO 3P38A 4WTOB 3ISZA 2UXDF 2QLXA 2E2OA 4EYIB 5E7OB 5I3PA 4TSXA 4F36A 2ZHBA 4HHTA 1X0PA 2M8HA 4HH0A 2H5IB 3O4NA 1K6YA 1GOBA 4PG8A 2BQ3A 2HNZB 4YDXA 3LPUA 3CCUS 4NXNF 4AXIA 3AO3A 3QB0A 5HROB 4LF5K 3EJMA 2ZJRQ 4UTGA 1KOHA 3HVTA 3AT1B 2YKNB 5T7LA 2RE2A 1VK0A 3TZZA 1S1XB 4FLTA 1ZZFA 1EETA 3ZLJA 2RKIB 1SCJB 3CJSA 2ZKTA 4C0OC 5C12A 2IM3A 4USWA 3QDKA 2MZTA 1KFDA 1K44A 2IYIA 4ANEA 1X4GA 5M1KA 3SPYA 2QLFB 4L6V3 3EL2A 3CD6N 4JYAK 1Y0HA 1ZYQA 2NUUG 3PACA 4K4YA 2KH9A 4BR0A 1CPZA 2HHSA 2BJ3A 4CEFA 3N4PA 5H9FJ 2YY3A 2I0XA 3L3VA 2DFEA 1WOSA 2Z1GA 2E7VA 2GIRA 5EDWA 2UUBK 1U4BA 3C6AA 4DF8A 2J0XA 1URNA 2WAQD 3MPWA 4FJHA 2YNFA 1O5JA 4IOBA 2MQQA 3H4BA 2Q97A 3MPUB 4CLUA 1RFQA 4NI2A 4WQ4C 1IR2A 5JVHL 3J8AA 4AD6A 2W2MP 3DLEB 2A18A 3CGIA 3N28A 1VCTA 3BP8A 1CLFA 4ZLNA 5D3GB 4KHPK 1M90O 3RMAA 1LXJA 3TJ9A 4FNHA 4LF5J 4CFBA 3C16B 2Z56B 4Z4HA 1VQ5S 3SMSA 1JLEA 4U7UD 1KVJA 2KW4A 2VIHA 4GV3A 5D4PA 4XAKA 4IH6A 2DNQA 1YHQS 4FF1A 2CAJA 1KD1O 2KXHA 3LM9A 3GV7B 2JNJA 3H45C 5JVGQ 3C15A 4GW6A 1R31A 2NRVA 1NGEA 4LRFA 3U6FA 1NPPA 4DUTA 1RQ0A 3HSZA 3M30B 3GBTA 1JL2A 4CH0S 5KI6A 3MK6A 2Y3YA 2VCPA 1JX4A 1ZTWA 1XEZA 1EQMA 2XO6A 3BZQA 3V6KA 4X2BA 3BSAA 2HNDA 1VQKS 1QUPA 4JRQA 2CWXA 1KSPA 4NPOA 3MWBA 3BGLA 2R7RA 3B54A 3TZYA 5GAHI 4RNOA 4TLQA 1CJVB 4CLPA 3IDHA 1C1BB 2FTRA 3QT6A 2UUWA 4ED1A 3EZWA 1NGCA 2RPIA 4MTPA 4K4XA 2ETJA 1U2RA 4FO0A 1WI8A 1A9NB 1S9GA 3PCOB 4N8OA 3ISND 4O3QA 2HQDA 2DNPA 3DRRB 2OPSA 3X3UA 4CGHA 4RX6A 1YSJA 2AYMA 3CC2N 3HJFA 1SC1B 1WJ9A 3DXKB 1LWFB 3AVKA 4OMFG 3PX6A 4XPEA 5DETA 3OTEA 2GGPB 4CJTA 3F44A 2RQKA 3NAIA 3SDEB 1VQ8N 4B3TK 1FW6A 1EJ7L 3VTIA 3BM7A 3LW5C 4KHPJ 3CCTA 2BBEA 3FZKA 4F9OA 2DXFA 3CCRS 4H5NA 4DL0C 1VOMA 1WEZA 4OYWA 5HMZA 3DOMB 4ES3A 3A8IA 1WSHA 4K4SA 1N33F 2ALYB 3W7BA 4WBFA 2GTDA 4DTUA 1YXQA 3TX0A 2LXIA 1CC7A 1T9YA 4LIWA 1N8RO 2VOPA 1S4EA 2XNQA 1TUVA 2ZM6F 4AT1B 3JSMB 3N79A 3OVSA 3OTCA 2AZ3A 4WP9A 2B6AB 2P5VA 1OVYA 1N0VC 1DQAA 2WFBA 5EWFA 3F41A 3MECB 3L2QA 3VF6A 4WZMA 1V3ZA 2I5JB 2H3EB 1KVAA 3KWMA 3FJ2A 4QOZB 5J1EB 3KK2B 3VN5A 1RT5B 2GVZA 3MPYA 1C0GA 1P1TA 2HFVA 2RT3A 3PVXA 1OMSA 1RJJA 4I6YA 1NK5A 3MPVA 3NMUA 1RXOB 3ZNJ1 2OPPB 2K7JA 4GVBA 2CJBA 4BC2A 2XYHB 2ZZTA 5AQPA 3G86A 3R1HA 4CH1A 5KFHA 3VGTA 4J9OA 4YN3B 4BQLA 5A8RB 2QL5B 1O8BA 2DHXA 1VQ4S 1NKBA 1WOPA 4DR6F 3HDSA 2M9KA 2E1AA 2A2DA 2ZBIA 3DGPA 1MNEA 4JKAA 2CQ3A 5L46A 3B6BA 2FZGB 4DR2F 4EHUA 4RNFA 2VKZG 5CA5A 2HURA 3M2UA 4YY3F 3T6JA 5E33A 1FHTA 4O3RA 3PJ9A 5IV3A 1R8CA 3S6EA 4UUXA 1DRZA 3M1FA 3GFYA 1NEEA 5MAOA 4B3TJ 2RN2A 3HVTB 2WB4A 5CZ2A 1N5YA 4KV8A 3T1YK 1SUQA 1WSRA 4JI5F 4RNHA 5T7LB 4DHYA 3M3ZA 5M2RA 1PCAA 3GE9A 4K2XA 1EETB 4KJIA 1QLNA 5EWGA 3Q8RB 4Z37A 3SXLA 4A61A 1WACA 5ETRA 1CJUA 1DTTA 4DL4A 5DGBA 2I2YA 4IUFA 4QPTA 3NS7B 5C24A 3L4BC 3N6NA 3M9MB 1S6QB 1SVDA 3CQXA 2OFHX 1ULRA 2YWGA 3HP6A 2V8HA 2MDAA 4YORA 3EM1A 4H4KA 3CJ8A 2AGQA 5DM6L 3SUOA 4G1QA 3HULA 2MKCA 4FPAA 4WCEQ 4LF7J 4B9QA 4PYDA 1PO6A 3TSUA 5C42A 3B6OA 1K9MT 3ZEUA 3CJBA 3QATA 2YH0A 4CLZA 3I4PA 4ED5A 1KVKA 2YNFB 3UD3P 2DO4A 5AJ3K 2DGVA 4JNEA 1T7PA 4WFXA 2B56A 3CJ3A 4OQJA 6FDRA 4DV4K 4OZ3A 2EKNA 4K5RA 5DG9A 1VRQC 4M5LA 4XH4A 1VK3A 3FQKA 2DNZA 4W5QA 4DUZK 2ZKUA 3CMAS 4NLUA 4F0HA 2AX0A 5U47A 1ZBIA 2ZJRL 2U1AA 4DV5F 4P2FA 5GAEP 1FE0A 1JLEB 2AJ4A 1UVMA 3D54A 2XZWA 1FNXH 3T1YJ 1NDLA 1LWXA 2DGTA 2MKYA 2MLXA 3LGMA 2NRHA 4WJBA 1WD6A 1WF0A 1G6BA 3C15B 4FJ9A 4C11A 2IDEA 4CO3A 3UN2A 5JXSA 3CB4A 1HPZB 4OLOA 3PKMA 4Q7AA 3SMZA 3Q2TC 2KHOA 1RAHB 2PFUA 4WQ4A 2ALZA 3O3LA 5LMNF 1HQEB 3IUCA 3CCQS 1TKZA 2O5DA 5AXKA 3A1YG 1FNMA 4IOCQ 3UE5A 3TWZA 3MCOA 4ZVFA 3P5TL 2R7WA 1AA1B 4LFAK 1Q82O 2RDIA 3OVNA 1R8HA 2P9PA 4WFNQ 3BSOA 5ETKA 4OX8A 2XQCA 3G25A 1V3SA 4OJHA 1E3MA 3FVYA 2HZCA 2NRWA 1S9GB 2W7OA 2DNGA 4NLYA 4J5OA 5JLHA 4ZIWA 2GZOA 5HVHA 1LK7A 3BF4A 2OSRA 1SKRA 3I56S 2OPSB 1MSWD 1SJ3P 5KFOA 4IH7A 3WNGA 3RW7A 3S7RA 4ID5A 2YWKA 1XK8A 2GJIA 4OZNA 4C8ZA 2YX7A 3VPZA 3GFXA 2DGSA 3AVBA 2QWPA 4NWBA 4IOAQ 2C2OB 3OSNA 3PZPA 2VG6A 3JS6A 4DUZJ 1F3FA 2HWIA 3C46A 3W1YC 3UDVA 3D9BA 3T1AA 4FF3A 4MK7A 2D4WA 1X8DA 2BEFA 4ATNA 2HQCA 3PRBA 4CNYA 4AFFA 4Z4GA 3O5BA 2ZJQQ 2G0JA 4ZPCA 1RTIB 3O9SA 2YQ3A 2YJFA 5KOWA 1TV6A 2QWMA 3WIVA 4D3GA 4LFCJ 5ETTA 3R3TA 1WSJA 4ED0A 4PCQA 3ULDA 1JXEA 4FPIA 3LP0A 2ZH3A 1ITPA 2X51A 3TAGA 5HJXA 1TR0A 2LECA 1MWMA 1S1TA 1DBDA 2JLFA 3FUYA 4FLZA 1UVLA 1VHFA 3CJ1A 1GX6A 3N6LA 1VC0A 3JQKA 5IT4A 4P72A 4C8NA 2GVZB 1YJWN 4YHHF 1GLFO 2MLZA 2WONA 3NOCA 4LFAJ 1S72S 3QFPA 1RAIB 1RWMB 1ESVA 3JSBA 1KXPA 3PO4A 1FERA 1UWBA 2EPIA 2GUPA 4E3SA 2GIFA 1TVRB 3GJRB 1BU6O 1N88A 5DQHA 3SCLE 1GX5A 2P6TA 1X5OA 1FRMA 1H2TZ 5JMNA 3E9LA 5A2QY 1QAJA 2BJDA 2QGFB 2QFJA 5B08A 3MX5A 4FS2A 3CULA 3F9MA 3M2UB 4OKKA 4C6AA 2IYGA 1F2HA 1VYAA 4AHRA 1V6HA 2IOCA 3N4QA 1K73T 1Q7YT 2F63A 3KLVA 4TXSA 2OPQA 1NDCA 4W90B 2R8JA 1N5YB 4I7FB 4KV8B 1DEJA 4AM7A 3BQ0A 1S0OA 4HEA9 1NSKL 4JI0J 1W97L 2DIUA 1SXLA 4A2BA 4LQ3A 4B17A 3G8TA 4QOTA 3K7RA 2LFVA 2E44A 3ULHA 4LF8J 4UY85 2DITA 4URQU 1JXVA 3D68A 4O0NA 4PUOA 4G6VB 3K58A 4QIVA 4M95A 3Q0AA 2PZSA 2D0BA 1Q0NA 1NMEB 2FC0A 5K20B 2H65B 4A57A 4U95A 4YNQA 1JKHA 2ZE2A 4KR0B 2HBMA 4FJIA 1NBEB 2AKWB 4YEAA 2W2QP 2HQGA 3W8PA 4WPAA 3QAUA 3GE1A 3MN5A 3NGZA 3O9UA 5C42B 3RB3A 3DRYA 4EBDA 4WE1B 1YJTA 2BE9B 4WYBA 1BL3A 4CO4A 1OY6A 2CG4A 5C2FA 3Q23A 5I42A 2VONA 2EFOA 2HS4A 2E1RA 4OZ2A 2CQ4A 3S3OA 1FRIA 4GC6A 3FFKB 4X66F 3LAKA 1TKXA 1ZPWX 4LR9A 1HKAA 7FD1A 2RS8A 4B3MK 4OV1A 4BVPA 2WBNA 4NEYA 4FF2A 1WEYA 5KG2A 4JI1F 4KHWA 2Y8YA 3H59A 4NXMF 2KTQA 3HT3A 2V63A 2FPHX 1NBWA 4HHJA 3RB0A 3WX8A 3C2PA 5LT5A 1HNXF 4FZZA 2DEIA 3HOTA 3ZSYA 4OJGA 3BF1A 4JK7A 1AZSB 4N56A 2CPIA 3FMWA 4J91A 1RWNB 2QWNA 2QYGA 2VC0A 4F26A 4FWLA 3OXGA 3AO1A 4CJPA 8RUCA 2ZHAA 3HBTA 4OYPA 4OIXA 2AGPA 1MU2A 5LMUJ 4XTTA 2DRDA 6FD1A 2ROGA 5L1IA 1FTCA 3EZOA 4OZ1A 3U1NA 4YR2A 2NRTA 1RT4A 2HQFA 4FNIA 3C19A 2G8UA 4WCEL 5GIPA 3QIDA 2XLIA 1X4FA 4WXOA 5HVGA 2Q0UA 2DH9A 4IH5A 4HWIA 3VEYA 1M1HA 4DR7F 2OZSA 3U7JA 1SKWA 4FDFA 3TOQA 1SB6A 3UVJA 2Q43A 3ZSZA 1TL1A 4ID5B 3GONA 2FSJA 3ET6B 3J81j 2KVQE 5D15A 3O9QA 1NKEA 1FKOA 4WFZA 1F9HA 5J2MA 3OYHA 4OZLA 3PEHA 4ZVHA 1M5KC 1F21A 4NXNK 1Q16B 1NSQA 2QC3A 3DRPA 1DQ9A 3NH2A 3HHNB 4DTXA 3MF5A 2VB6A 3AA4A 4FK4A 3CWJA 3TZWA 4TKTA 3FRYA 4NX9A 1YVUA 4BR7A 4DSLA 5KFYA 2FBTA 4B3MJ 5DLGA 4FLWA 4B1ZA 3CCVS 3MMBB 4OYMA 4DCOB 3B8HA 3CG7A 3A3PB 2A6MA 2DHHA 2XBPA 1Y5LB 4ZP9A 3VEXA 1NZ8A 4ZLJA 3CVKA 3KOAA 4A48A 3LP0B 3R2DJ 1SJRA 1QQOA 1TK8A 3T5JA 3A8JA 5K8PA 1S1TB 5F3ZA 3W9JA 3ILIA 2C2DA 1IKYB 5CR4A 3I55N 3ZX0A 2KB2A 4WF9Q 1XTZA 4ETXA 4BRNA 3MX2A 2QWOA 3W3DA 4DPTA 2WONB 1MA9B 2ZH5A 5BN8A 4GKKF 4WFNL 2G2YA 2NS1B 2M2BA 2HEKA 3SQ4A 2EVZA 5IT0A 1UA0A 2F9TA 1TYQA 3R97A 3UDLA 1NGAA 3IWXA 5CHCB 1RHJB 2MSTA 5BR8F 3O1LA 2YX6A 5KFFA 2UXDJ 3EDRB 3A5MC 2KXFA 1SQKA 2M0GB 4NL5A 3NAEA 2DFFA 4IOAL 1NPRA 1Q86T 2JH3A 4MKYA 1D8YA 4NXNJ 1VFJA 2C22A 2CZ4A 2HWTA 2P9NA 2QN6B 2YVSA 3SBMA 3EVMA 2D3OR 2FVPA 3EO3A 1BWVA 2ZJQL 3RSEB 5HOOA 4M94A 4IEEA 5B0GA 3HK2A 1S3XA 1QQMA 1JQGA 1X4AA 1VSDA 3DU5A 4NEZA 3AH6A 4IFEA 1WHWA 4X4RA 2PEBA 3Q8SB 4OZ5A 3T3FA 4J9KA 1PJ5A 2YNHA 2QZ8A 4TQRA 3KUHA 4J9LA 4ZPBA 4AF1A 5K8NA 4CBWA 4WK3A 4XK8C 4F4KA 3O1BA 5AQWA 4B9MA 2EK6A 3D7EO 2VODA 2BH1A 2JEGA 3VQ8A 1S5ZA 4KKOB 3I9V9 4WU3A 2ABYA 1NPKA 2Y0SD 3IP0A 3NH0A 1IV0A 1DLOA 2OPRB 4KIAA 1G2EA 1LQ9A 1A7GE 2L9WA 3OYAA 2A41A 2HHPA 2NYHA 3TUJC 4KHRA 3KG0A 4MK9A 5I42B 2AU0A 4ZVRB 2DR7A 3TABA 2FF3B 3ICLA 2NSCA 2V2VA 3T1HF 4KI6A 1VQ7S 3ADAC 2D0PA 3PTWA 3OLAA 1J6ZA 3UCZP 4DSJA 3MN7A 2J76E 2VICA 3TP2A 1SS6A 4BDYA 1TKXB 1SC3B 5E41A 4M7XA 3U8XA 5D0RA 2V6AA 1P90A 4Q8EA 3HO1A 1ZM4A 2V2QA 1WTFA 3MMAA 5AZJA 2RH3A 5JMVA 1NU4A 5J2PA 2OA8A 4NCGA 2BDPA 3LAMA 2D7SA 3IS9B 1N33K 3VQEA 2HRUA 4KI4A 3KLHA 2QL9B 1S6OA 3D66A 4LF4F 5A2QU 4PG5A 3WC0A 3AO5A 1ICEB 2G2ZA 1NOYA 5JS1A 2ZM6K 4R0EA 2NUBA 1RK8A 3A3OB 5KTQA 3K89A 2RDDA 4YDUC 2JJ4D 3ILLA 2EK1A 1MU2B 4DV0F 3PRDA 2VASA 2AA4A 4CDIA 3PR5B 5CAAA 1JWWA 5LJ3Y 1RT4B 3KG1A 1DZ5A 4FN5A 1RYSA 1ROFA 1Y5IB 3QBCA 4LSNA 2VG7B 2ACMA 2CKWA 4OLBA 2A5XA 3FRZA 3WEEB 5D4NA 3ZSWA 2VJVA 1U6FA 1IKWA 3H2LA 5LM7E 3O3HA 1J5EF 5M1QA 4CZLA 3UVJB 1SJFA 3CCMS 3L8BA 4DR6K 5IV4A 2IDOA 1IUJA 2Z8QA 5J2MB 2FBYA 5IOLA 3GG0A 4YY3K 3KNGA 4MAKA 3DRPB 3SFGA 4Q0BB 1T02A 4NMXA 1RWKB 5KFTA 3MZIA 2XY5A 2LLZA 5DLFA 2G9OA 1PC4A 2KT3A 3J7ZT 2HMIA 4X62K 4JKGA 5A8WB 5I3UA 4QJVA 5F8HA 2BRKA 1FT8A 2V67A 1BISA 4CF1A 4JI5K 3AXMA 3RRGA 2E5GA 2HWHA 1W2BR 2E1ZA 2MHNA 2HVHA 4CHZA 1G7CB 4C7QA 1I5OB 4K42A 1FDBA 2V4QA 2VBYA 2E5LF 1N33J 5CE3A 5JJBA 4KGZB 3ZZUA 2N4CA 3TSPA 1NJZA 3J7YI 3D0GE 5BPNA 1YRUA 4JV2A 3VQ7A 2C3YA 3C6UB 1J2VA 3HP9A 1FD2A 3THYB 4ECRA 2YKPA 3ATUA 2CPDA 2AD9A 4LSZB 2DFHA 3CJ2A 3BKTA 3BR9A 1BA1A 1H72C 3GTYX 1XC3A 3HSTB 3BO2A 4R5PA 1HI1A 4C3MA 4FYVB 1TYQB 3CQYA 4PYAA 4FBTA 6AT1B 4CLLA 3TI0A 4PHTX 3RAXA 2VH7A 1V9OA 1HHTP 4KHYA 1RWVB 2NXEA 4KSEB 1CQNA 2WSEC 1VQYA 4YQWA 3WHIA 1RHMB 4ZTFA 1X4HA 2F4VJ 4MT1A 1HYSA 4DR2J 3H1QA 3MAAB 3MCSA 3W60A 2RAQA 4L8RB 3EX7B 4YY3J 4CO2A 4B1VA 2FHJA 1CSJA 1GMVA 2HBZB 3L7OA 3R5BA 2P9NB 4DV5K 4F2SA 2UUAJ 2ATLA 1H7XA 1RBRA 4R8UA 2GX9A 4WFAQ 5DM7Q 3GLJA 3OYBA 1FEEA 3OY9A 3QSIA 4JI5J 2KKZA 1LFWA 5FPDA 2CJXB 1KKHA 2YKMB 3GU0A 4E7LA 3VMFB 1RI7A 1S9EA 3BGOP 3I4HX 2MKSA 2OSQA 2QJ3A 4XH1A 1R43A 2J0SD 4KTZA 2YNHB 2OHDA 3TVZA 4RJVA 4IG3A 3OYDA 3UE2A 1JJCB 1CQMA 4IQXA 1VSIA 2CJKA 1NU0A 3CCJS 2BX6A 5LMNK 1VQLN 3SYZA 3P4IA 1BY9A 5HRSA 3F73A 5J1PA 1F3VA 2W41A 4LMZA 3OFHA 1W9HA 3M6VA 3VEOA 4DX6A 3K17A 3OR1A 2B9WA 1IXKA 3M6GA 4MIWA 3ZSOA 2AP6A 4DUYF 3SAFA 3X1LB 5A0YB 2JL9A 1R0AA 3GR1A 1BC6A 3M05A 3LTOA 2HBYB 4F4AA 3D6RA 4DPUA 2KYZA 3HCXA 5L1JA 4HDHA 2WCXA 4DSFA 1OJ4A 3PSFA 4PXBA 4CYUA 1WLJA 4KO0B 2I8EA 3QIPA 2UP1A 1N34F 2ACYA 1N54B 4EBCA 3DRXA 4IO9Q 2DGXA 2KVIA 1T94A 3V9WA 5IXUA 2QFIA 5G0RA 4U67Q 1Q53A 2HFUA 2EEYA 4Z7YA 5HP1B 1JK9B 3GL1A 2HLUA 1ZS6A 3TQ1A 2WSCC 2XI3A 3OFGA 1NK7A 3QGIA 1EZZB 4DV5J 1NHKL 5J2PB 3EMTA 2I1RA 2VPXB 2Y8WA 3DHXA 3FBFA 3R7SB 4MFBB 4ERDA 2BACA 3NGRA 3P1GA 3E51A 4H0XB 3C3LA 2RB7A 1H74A 2IM2A 3K9JA 5AXMA 4CLWA 3BDPA 2QA4G 3IRWP 3V6JA 4DL2A 4W5NA 1HLWA 2VJUA 2Y9HA 4OPJA 2N7YA 4KGVB 4BE1A 2Y1LB 3P5BP 2F3JA 5HRPA 3DDIA 4RW4A 2AT1B 1OS5A 2C2ZB 2JWNA 2X3GA 2NQPA 1T44A 3NGSA 1QAIA 4F04B 5LMNJ 2QLBB 2XSJA 2P9UA 1JNRB 3UDEA 3VGKA 5T41A 4YHHK 1WELA 2BA9A 2WTFA 3NNHA 1S6PB 3B78A 2PDAA 1FRKA 1M5SA 4P9SA 3SUPA 3TYTA 4ILRA 1TKTA 3PX4A 4OJ1A 1KAYA 5K9FA 1VQLS 3OYLA 1FE4A 3Q83A 3AY0A 2LA6A 3BBBA 3MR3A 2CG8A 3OJSA 4E1JA 2Z1HA 4Y2KA 2CGKA 4AL5A 2GJ2A 5CZ1A 5KFLA 4XH5A 4YB6A 1FX2A 3D2FA 3V2UC 2ZDPA 3DFEA 4YDUA 4K4VA 2EG1A 5FPMA 3R6LB 1QTNB 1RGVA 4J9QA 3PJXA 3MM6A 1KWMA 5CZXA 4M42A 2EBGA 2V94A 4JKGB 1N52B 5E3QA 4A4JA 2UUCF 2ZF5O 1GLBG 2P51A