1JLEA

Crystal structure of y188c mutant hiv-1 reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
549
structure length
524
Chain Sequence
b'PISPIETVPVKLKPGMDGPQWPLTEEKIKALVEICTEMEKEGKISKINPYNTPVFKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGANRLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 133
structure length 524
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jleA05
4I2PB 4FXDA 4M42A 3E01B 3V1QA 5DQGA 4Q8FA 1RT7B 3HPOA 3V4IB 3VQEA 1BQNB 3M8RA 3KLGB 3MR5A 3TAFA 2RN2A 4NYZA 4N41A 1IKWA 4IRKA 1CSJA 2B5JB 2X78A 4G3IA 4OKJA 5KFVA 2R7YA 5KRSA 1TKTB 2D41A 2RKIA 4IG3B 4J9LA 3AVNA 4HKQA 1KRPA 1D1UA 3DLBA 2FJXA 3O4QA 3TR8A 1S6QA 2VG6A 4FJKA 3T3FA 3KKRA 1U09A 3L2QA 1QE1A 2F96A 3S9HA 4ED6A 4YNQA 3I5BA 3KLEA 1UWBB 5EU7A 4LSNA 5KFLA 2DPJA 3M9OB 2OH2A 4RNFA 4RNMA 3MFIA 1A5XA 3A2FA 3ZT0A 4YR3A 1VSLA 5KFBA 4DL2A 1RBUA 3QETA 5HP1B 3GV7B 3OYDA 3M8SA 4RNNA 3CDWA 3TARA 4RU9A 3KLVA 1KLNA 1VSJA 4C8OA 4ICLB 2B4JA 3PX0A 4IRDA 2KFZA 4Q0BA 5C42A 1SKRA 3QLHB 3ZSYA 1TKZA 3V81B 5C24A 4M3YA 5J2PA 1KCFA 4B9UA 4K4VA 5JXSA 3BSOA 2XO7A 1A5VA 1HNIA 4B3OA 4PQUA 5KFMA 5F8NA 1NJWA 4W5TA 3OYJA 4O4RA 3O3HA 4DSIA 2UVRA 4KO0A 5J2QA 2WOMA 4L8RB 3WNEA 3AVIA 2XY5A 3CM6A 2C28A 4CECA 3NBPB 1T3NA 4DU3A 5KFZA 4NLPA 3T5JA 3RR8A 3V1OA 1XI1A 4Y34A 2E9ZA 5KI6A 4Q45A 4IG0B 1IO2A 1D9FA 3UDLA 4CF0A 2WB4A 2UUTA 1YVFA 2KZMA 4DG1A 3RRGA 1LAWA 4CESA 3DDKA 5L1JA 1KHVA 1EETA 2HHTA 3IAYA 3HHKA 1JIHA 3DRRA 1FXXA 1T03A 4R5PA 2YNIB 2QKBA 1LW2A 4EO6A 4DF8A 1J5OB 4FBTA 1S0MA 4DQIA 4J2EA 4NLGA 1NHUA 5KFGA 5EWGA 3I0SB 2FC0A 4N5SA 2AX0A 5KFEA 4CGFA 3VQCA 4DFJA 3NE6A 1SKWA 2X6SA 1U48A 2IM1A 4KHSA 2G8IA 2BRLA 4PY5A 4DSKA 3LP2B 3OS1A 1NJXA 3PW7A 2YKNB 1RT5A 1WAJA 3L3UA 4OLAA 3ZSRA 3ZSOA 1WSFA 4KHUA 3KKSA 3LP0B 4M94A 5J1EB 4ED0A 1S1TA 2RPIA 3QGHA 4K4SA 2FBTA 3K59A 4RW8B 2BR0A 2F8EX 1IKYB 2IGIA 4I2PA 1N48A 4Y1DA 3E01A 3SQ4A 4IR9A 3JYTB 3KLFA 4ZPDA 1RT7A 4O44B 5KFIA 4CK1A 3IGVA 1J53A 1BQNA 1KTQA 3KLGA 2W7PA 4ID1A 3G10A 4F50A 2B5JA 2V9WA 3ALYA 3FDSA 4EP4A 1S9GB 4ZP6A 1TKTA 4IG3A 4DL4A 2OA8A 1KVAA 3L2RA 5KFKA 3H08A 2YNHB 2X6NA 4RW7B 4K4WA 3MXIA 2WHOA 1JLCB 4Z4EA 4MFBB 2P5GA 1RTIB 1WNSA 3HXMA 4ZHRB 4IR1A 1UWBA 4N56A 4MK9A 1S1UB 3O3GA 2ASLA 5F9NA 5F8GA 4CJTA 1ZBHA 3QEIA 3CJ4A 2R2UA 4KHWA 5HP1A 2Z1HA 3BSNA 1XHXA 2IM3A 4CK2A 4OLBA 4ELVA 3GYNA 4CEEA 1WN7A 4DS4A 3OY9A 3OYIA 4ICLA 3K58A 3CJ3A 4WFZA 3SJJA 3CJ5A 4AH9A 3QLHA 2D0AA 3V81A 3NHGA 3QIOA 3NCIA 5FROA 3PX4A 4LSLA 2E6LA 4ZP7A 3PW2A 2GC8A 1QSSA 3SNNA 4FZYA 4YR0A 3N6MA 3OYFA 3NAIA 4FW2A 4WFXA 1HQUB 1B9DA 5F8IA 3QGGA 1G15A 2ALZA 1KSPA 2XY6A 4DFPA 1RNHA 4E1MA 1U45A 5K14B 4BACA 3NBPA 3LZJA 1Z4UA 3OVNA 1VK0A 3HPGA 4Z0UA 1RTDB 1LWFB 2AX1A 2OPPB 4J9MA 3TABA 4J2BA 4U7CA 4ZVEA 1EP4B 4TY8B 3GIKA 2IM2A 4KB1A 4KAZA 3V9WA 3RTVA 3MR6A 2QE5A 4NLVA 1LWCB 3LZIA 2AGPA 1SKSA 4ID5B 4CJKA 3VQ5A 2V4RA 4R0EA 2ASDA 2EX3A 2YNIA 4DSFA 3PVXA 3AO5A 3I5CA 2KW4A 5FDLB 1ZTTA 1J5OA 2O4GA 4CJ3A 1S6PB 4MQ3A 4KRFA 1FKPB 2P5OA 4FK4A 1S9EB 2GIRA 2AU0A 4OPKA 4TYAA 2OZMA 2YKMB 3B6PA 3PJWA 2W9CA 1XR5A 4RW9B 4DTRA 4FCYA 3PW5A 4X2BA 3QZ8A 4IFVB 4KHMA 1JX4A 2R2SA 2R8IA 3LP2A 4FM0A 4FLUA 2YKNA 5DMRA 3ZSZA 4QPXA 5FRNA 3WNFA 2VG6B 1C0UB 1NHVA 2YNFB 3MECB 4KREA 1S0NA 3NGYA 3LP0A 2Q3SA 1XR7A 2FLPA 5J1EA 5T14A 3KMSA 4FW1A 2UVUA 3OYMA 5L1KA 4RW8A 4FLTA 1IKYA 4DS5A 5I42B 3V9UA 5KT2A 3SV3A 3HO1A 3JYTA 3HT3A 4O44A 1S49A 3DLHA 3MXJA 1RILA 4EEYA 4FK2A 4CIGA 3RWUA 1JLBB 3AO1A 3GIJA 3EPIA 3OYNA 2HHWA 4DL5A 4HVJA 1TV6B 1S9GA 1S9FA 1NOZA 3ZSWA 2OPSB 1S4FA 1RT3B 2V4QA 4FZZA 4GMJB 1FK9B 3GV8B 2YNHA 4W5NA 4RW7A 5F8JA 3K5NA 4FLVA 4DTNA 5L1LA 1D9DA 1JLCA 4RNHA 4MFBA 4WZMA 5KFAA 2FBXA 1C1BB 1BI4A 1RTIA 4ZHRA 3V6KA 2ATQA 2FVRA 1S1UA 3DLEB 1C0TB 2WTFA 3QERA 2JC0A 1S0OA 3SQ0A 3TVKA 5KRTA 2ZKUA 3CDUA 4U6PA 4YR2A 4AHSA 4AHTA 1LWEB 2OZSA 1JLQB 1TVRB 4BDPA 1B9FA 3ICLA 4NCGB 1S1XB 3MEGB 4DQPA 1OS5A 3LAMA 4TY9A 1RCHA 2QKKA 4RUCA 5CYMB 4M3UA 3OJUA 4CJUA 4EZ9A 5EDWA 3DMJB 5KFUA 1BIZA 1QTMA 3VQPA 3OL7A 2P1JA 4XO0A 4E7IA 3IS9B 4O3QA 4IH7A 4AHVA 4FJ8A 3OL6A 1HQUA 2AJQA 2ILYA 3OYEA 3T19A 3CG7A 4E19A 5K14A 3THVA 4FJXA 3KIOA 2BQUA 1NK0A 3MAQA 1HJRA 1RT1B 4LH4A 3OHAA 4M3XA 2BQRA 1NKEA 1RTDA 1LWFA 2OPPA 3G6VA 4B9TA 4NRUA 3SUOA 3SUPA 1TAUA 4CGGA 5EWEA 4DL3A 1EP4A 3LP3A 4TY8A 3KHHA 4EBCA 3G86A 3CJ0A 3CJ2A 1LWCA 3NDKA 3DLKA 1SH3A 2HB5A 4ID5A 3D45A 1F21A 3KMQA 3HM9A 3JSMB 2DFHA 2OPQB 4JS4A 4HHTA 5F8MA 5FDLA 1KHWA 1S6PA 4CEAA 4RW6B 1FKPA 3KLFB 4DWIA 4IRCA 2IBKA 1S9EA 3QZ7A 4Y3CA 3ISNC 3PO5A 2YKMA 4DEZA 2UVWA 4RW9A 1S1VA 4DMNA 4Y2CA 3SFUA 4IFVA 3AA3A 4HUEA 2GBZA 4CIEA 4N76A 4ECRA 1ZBUA 1D8YA 1CXQA 3RAQA 4KB7A 1WSEA 3SYZA 1C0UA 2YNFA 3MECA 4XPCA 4ZP9A 4F4YA 5KG5A 3KK1A 2AQ4A 5JS1A 3MEEB 3TAQA 4Q43A 2BDPA 1TP7A 4BDZA 4K8ZA 1GX5A 4HYKA 3LALA 5I42A 3ZSQA 3TAPA 3H40A 1JLAB 3OJSA 4PUOB 3NF7A 4C8LA 3PUFA 1JLGB 4CJVA 3ZSVA 4HCBA 3KJVB 3FQKA 3NGDA 2YHBA 1QSLA 4TLRA 4CF9A 3Q8PB 1JLBA 3ZT3A 3CWJA 1NK7A 1BHLA 1EXQA 5SZTA 1TV6A 4ELTA 2UVVA 4CJ4A 2BANB 2OPSA 5C5JA 4DTJA 1RT3A 4O0JA 1FK9A 3OYBA 3DYAB 4EYIB 1RTHB 4E7LA 3OHBA 4J9RA 4TQSA 4LSLB 2KFNA 3LWMA 3OSPA 3C6TB 2HWIA 2O4IA 1WSIA 1C1BA 4CJPA 1GOAA 4QW9A 1BL3A 4XPEA 2W8KA 3ZT4A 3BSAA 4ZP8A 4KTWA 3AV9A 3DLEA 1C0TA 4IKFA 1Q8IA 4ED3A 1U4BA 1VSKA 1XR6A 3VA3A 5D3GB 3BSCA 3MF5A 2DTUA 3H5SA 3RB0A 1RYSA 2XGPA 3VA0A 2PY5A 3QNNA 3OYGA 4E3SA 3PW0A 1LWEA 4K4YA 4TXSA 1JLQA 1TVRA 1SUQB 3TAGA 4NCGA 1S1XA 3MEGA 1S48A 4ELUA 1UAXA 3WNGA 5E41A 1NK4A 1TAQA 5CYMA 4NRTA 3TAMA 2FJWA 2HHQA 1RBVA 3I0RB 1CXUA 4HUFA 3DMJA 3LPUA 3PHEA 5KTQA 4QOZB 3T1AA 4FS2A 3PR5B 3IS9A 3S3MA 5DG8A 2G8WA 3UR0A 4CHNA 4KHNA 4WXWA 2AGOA 3IGNA 1N6QB 1GOCA 1CLQA 4NCBA 3BGRB 1J9AA 3L2UA 1B92A 5KFRA 2IS3A 3NF9A 1RT1A 2W9CB 4I2QA 3LANA 3QIDA 3M9NB 3K57A 3HVAA 3E51A 2HNZB 1TQLA 5CYQB 4J9PA 4IH6A 1C2PA 4ECQA 1VSHA 4CF2A 4GC7A 2EC0A 4DTXA 2A1RA 2B43A 3FFIB 4K4UA 2GV9A 3UIQA 2E9TA 3RB3A 2OPRB 4MIBA 3MEDB 1ASVA 4DU4A 3HPHA 3MFHA 4EBDA 4F2SA 3LPTA 1RT6B 1O1WA 4CHQA 3CQ8A 2DY4A 4F3OA 3JSMA 4O3RA 3DOKB 2R2TA 2OPQA 4JUZA 3KHGA 4HCCA 3VQQA 5KFJA 4RW6A 2UUWA 3NAEA 4CHPA 1N56A 4DLEA 1K6YA 2G8FA 3PZPA 4FZXC 4I9QA 3FSIA 4CERA 4NLSA 4ZTFA 1XHZA 3HL8A 3D0PA 4FJIA 3PW4A 1BISA 1RAJA 1UA1A 4EP5A 3K5OA 2ETJA 2AGQA 2VA2A 4NZ0A 4O3PA 3T5HA 4ZTJA 2E9RX 5KT6A 3H5XA 5EUHA 4AHCA 3MEEA 5HBMB 4KAIA 2WCXA 1Q9YA 1BI4B 3V9SA 4KV8B 3ITHB 5KFSA 4O3NA 4IFYB 4Z4HA 3OS2A 4DQSA 1TK8A 1L3SA 3HVWA 4FVMA 4DFKA 1JLAA 2R8JA 4FK0A 4PUOA 2XWYA 1JLGA 3NKYA 3KJVA 3I5AA 4H8KA 3OLBA 2FVPA 3OYAA 1WSGA 2VG7B 4KKOB 1T94A 2YV0X 5KFTA 2G8HA 4Q44A 4QWCA 2RDJA 2BANA 4FLWA 4ZPBA 3BQ1A 3KD1E 4NLUA 3DYAA 3RMBA 1EKEA 1IKXB 5J2MB 4CJLA 2HMIB 1RTHA 2IA6A 3L2VA 2WRMA 3HJFA 4M45A 3C6TA 2B6AB 5I3UB 4I7FB 4MK8A 4ECZA 1S5JA 1Z25A 2RDIA 4QW8A 5L9XA 3H59A 3BR9A 3PX6A 4M3WA 5KG6A 3QINA 2JEJA 1HPZB 5D3GA 4B9LA 3LP1B 4PWDB 4XIUA 3KTQA 1HYSB 5DLFA 1BIUA 4IDKB 4DTMA 1SUQA 4E0DA 5C25B 4DSLA 3GIMA 2A1SA 3KHRA 1VSMA 4CF1A 4AHUA 1YVUA 4EBEA 3OYHA 1KFDA 3RBDA 4Z4GA 1BGXT 1Q9XA 4FBUA 3DLKB 1TK0A 3CVKA 3QEXA 2BE2B 2I5JA 3I0RA 5F8LA 3QEWA 4CEDA 2IAJB 4IH5A 1NOYA 4GC6A 3SZ2A 3OYKA 1R0AB 4CEFA 1A5WA 2OYQA 1N6QA 4OL8A 3AA5X 5KG1A 4QWAA 4B08A 4TYBA 2J6UA 1RA7A 1VRTB 2XCPA 4FJNA 3BGRA 5KFDA 2D5RA 1NK8A 4MK7A 2J6SA 1HQEB 3ASMA 4DF4A 1S1VB 1CZ9A 4FLZA 2XY8A 2HNZA 5CYQA 2DFEA 1RDRA 4DL6A 2R8GA 1I39A 4B8AB 2BQ3A 1W0HA 4WXOA 4FJGA 4DTUA 2C22A 1BCMA 3FFIA 4FJ5A 3DRSB 3GV5B 2OPRA 3KOAA 1C1CB 2I1RA 4O3OA 1GX6A 3MEDA 1XC9A 4URQU 4QWEA 4K4XA 1WSJA 3KK1B 4NYNA 4FM2A 4H4MA 1RT6A 3KLHB 1RTJB 3KHLA 1HYVA 3DOKA 1DLOB 4F4WA 2VG5B 1WSHA 4QAGA 2D7SA 2HVHA 3KNAA 5KG2A 2E4LA 3PR4A 3SI6A 3U3GA 4AHRA 4FM1A 4ED1A 4JRPA 3P83D 3QEVA 4J2AA 2JC1A 3QIPB 1SH0A 4BE2A 3BDPA 1C6VA 1IKVB 3RRHA 5T7BA 5CZ2A 3KK3B 4FLYA 3AVJA 4F4ZA 4PA1A 3VQ4A 1KVCA 3HP9A 1VSFA 3AVBA 1BQMB 2D3UA 4IOBA 1RT2A 5KFNA 3RB6A 2JEGA 3RMAA 1W9HA 1MMLA 5HBMA 4JRQA 3K2PA 4UQGA 4KV8A 3ITHA 1YTAA 4IFYA 4NLWA 4C8NA 2FVSA 3O3FA 4H54A 4YP3A 3C95A 3C94A 3BJYA 1RDBA 1HMVB 1MU2B 3NGZA 5F9LA 3SCXA 2FLNA 3VQBA 3HVRA 4FYDA 3HK2A 4O0IA 3CIZA 3ULDA 3NF6A 4FJHA 2HNYB 1TL3B 2VG7A 4KKOA 1ZBFA 2WK4A 3AVGA 3NF8A 2PYJA 1RBRA 5DQHA 3P1GA 3VQ9A 4O3SA 3OL9A 1U47A 3MTKA 3NH0A 1IKXA 3TAMB 5J2MA 2HMIA 4N47A 5KG3A 3SV4A 4ECUA 4FJ9A 4NLRA 2B6AA 4NYFA 5I3UA 2GIQA 4I7FA 3VQ7A 2HHXA 1ZTWA 2DFFA 3G6YA 4KHRA 2W8LA 4OPJA 3DOLB 1LV5A 2WONB 4WYWA 1WLJA 3PO4A 1K1QA 4CGHA 1NJZA 1HPZA 1S1WA 4KHQA 4LD0A 3M8QB 2W9AA 5DLGA 3U6FA 1KFSA 3LP1A 4NLDA 1RT4B 4I2QB 4E89A 4PWDA 1HYSA 5HLFB 2JEIA 4IDKA 1YT3A 3DI6B 5C25A 1JXBA 2XRIA 3SQ1A 2HWHA 2JEFA 3D28A 1D5AA 3SUNA 3V6JA 1NNDA 4E1NA 1JXEA 2D3ZA 2R2RA 1JLFB 1NK5A 2BE2A 3QO9B 4KBIA 3RMDA 4JLHA 2IMWP 4TQRA 5JS2A 2IAJA 1KVBA 4JV2A 4NCAA 1R0AA 1S10A 3AVHA 1HYZA 4K50A 1VRTA 4ZPAA 4K4TA 3KD5E 3Q8SB 4ZMMA 3I8DA 1JKHB 3GILA 4M3TA 4Z4FA 1VSIA 4FJJA 1HQEA 3TI0A 4ED2A 3SUQA 2IM0A 4K4ZA 3HKWA 2G8UA 1ASUA 2C2DA 4OJRA 4ED7A 3IG1B 1SL1A 4KB0A 3VQSA 4YMEA 3DRSA 1C1CA 3M8PB 3KLIB 4ED8A 2NUBA 2IC3B 3KLHA 1RTJA 4ECXA 3V9XA 4HUGA 3L3VA 1LAVA 2Y1IA 1DLOA 1HARA 3D5MA 2VG5A 4FJ7A 2W7OA 4CGIA 3UQSA 3WNHA 2VWKA 3RMCA 3H98A 5KG7A 3HVTB 2J6TA 4Q8EA 4JV1A 2ITGA 2IJFA 4E7HA 2C2RA 4DTOA 3QIPA 2D0BA 3AO4A 3PJXA 2YHAA 1IKVA 4M95A 5KFWA 1GOBA 4CJWA 3CFRA 3SQ2A 3EZUA 3KK3A 2CKWA 4OGEA 3MR2A 1X1PA 4M3RA 1BQMA 4WE1B 3VQDA 4Z4CA 1XWLA 2HNDA 4CE9A 4YFUA 1L5UA 4H4OB 3CDEA 4KE5A 1QS4A 3SI8A 4J9OA 1J54A 5KFPA 4C8MA 5HROB 2E6MA 2RF2B 4IBNA 4CJ5A 4LY7A 1TKDA 3VQ8A 1HMVA 3NFAA 1X9MA 2V0NA 1MU2A 1N5YB 2ZE2B 3G0ZA 4G1QB 4WYLA 4CJRA 2O5DA 3L2WA 3FRZA 1I3AA 5HRNA 2HNYA 1TL3A 3ZT2A 2HHVA 4MIAA 4ZPCA 3P5JA 1DTQB 4HTUA 4R8UB 3S3OA 4GW6A 3C6UB 2I5JB 4CJQA 4CHZA 4CJFA 1REVB 1FKOB 1N4LA 1TKXB 1T05B 3N6LA 2ATLA 1SV5B 3DOLA 1D0EA 1ZBLA 1TK5A 2WONA 3SPZA 4MH8A 4M41A 3F73A 2YNGB 1VRUB 3AVCA 3M8QA 1RDDA 3TWHA 3AVFA 1SL0A 1RT4A 3OS0A 3V6DA 2XHBA 1KLMB 3NMAA 5HLFA 3T5LA 2W42A 3DI6A 4DU1A 4CGJA 4RNOA 3H2LA 3KK2B 3AA4A 4CEZA 1QSYA 4IKAA 3IRXB 4IQXA 2VWJA 3HP6A 2KQ2A 4K8XA 5SWMA 3MXMA 1JLFA 3G6XA 1RYRA 4H4MB 3QO9A 4WZQA 3NL0A 4NLTA 3SFGA 4JS5A 2AWZA 5JUMA 1L3VA 2KTQA 3Q8RB 2IOCA 2HVIA 3V1RA 1YTUA 3V6HA 1JKHA 5FRMA 4E7JA 4TSXA 2JLEA 4J9SA 4MKAA 5HRSA 2HW3A 3IG1A 4RW4B 4F4KA 3V4IA 4OGCA 3VN5A 1QAIA 1QAJA 3M8PA 2Z1IA 3KLIA 1RT2B 4DTSA 1SL2A 2QV6A 2IC3A 2EHGA 4KTQA 4KI6A 2XCAA 4NLOA 2HHSA 3RAXA 3NGIA 5KG0A 1VSEA 5HRPA 5J2NB 3CO9A 4F4XA 1IH7A 5DG9A 3M9MB 3QYYA 3QNOA 1LW0B 1Z26A 5KFXA 4BWJA 4JV0A 5KFHA 3SPYA 2R8HA 4DQRA 3HVTA 4O4GB 3H4BA 3DM2B 3LAKA 1T8EA 2FBYA 4CFCA 4AILC 4DSJA 1HRHA 3ZSXA 3H5UA 4KI4A 3BQ2A 5KT5A 1JLEB 4B8CA 1VSDA 2XI3A 3F9KA 5CY4A 1RDAA 4ECWA 1ZBIA 2XC9A 3NH1A 4DTPA 4URSA 4WE1A 4J2DA 2CJQA 1TL1B 2BRKA 1C0MA 4C8KA 4ZVFA 3DRPB 4RZRA 4H4OA 2HAIA 2ZD1B 4YQWA 5HRRA 4CEBA 3H4DA 5HROA 2RF2A 1HNVB 1S1WB 3OL8A 1EX4A 4J9QA 4B9MA 1Y97A 1N5YA 2ZE2A 4KHYA 3Q8QB 4G1QA 2W9BB 3O4NA 2FVQA 2GUIA 1IG9A 2ASJA 2FBVA 4CFBA 4KTZA 3L8BA 2F8TA 4CHYA 3AO2A 4BWMA 1DTQA 5DG7A 4BE0A 3TAEA 4R8UA 4Q5VA 1NJYA 4QWBA 1WNEA 1DTTB 4F2RA 3C6UA 1BCOA 1RBTA 4IG0A 2D0CA 5DQIA 3DLGB 4KFBB 4CHOA 1REVA 1FKOA 3UPFA 1TKXA 4DL7A 4URGA 1T05A 2VA3A 1NK9A 4F3TA 4ECVA 5DK5A 4OKEA 1SV5A 3ISND 1C1AA 2YNGA 1TGOA 3TANA 1ASWA 1VRUA 3EZ5A 4BDYA 3MR3A 3CYMA 1KLMA 4ZVHA 1WAFA 3DLRA 5KT3A 1UOCA 5KGWA 3KK2A 3I0SA 2XGQA 1X9SA 2QXFA 1IKWB 4NLQA 4EYHB 3IRXA 4NLXA 1QUVA 2PYLA 2QK9A 3IN5A 1I6JA 3ZCMA 2C2EA 1CZBA 4J9KA 2R8KA 3RR7A 2FVCA 4W5QA 2IJNA 4O5BA 4CF8A 2RKIB 3QEPA 4LQ9A 4KPYA 4M3ZA 1S6QB 4Y2AA 3T5KA 3EPGA 4OKKA 4CIFA 4FLXA 5KFOA 5KFYA 1QE1B 4FS1A 5KT4A 4EO8A 4CK3A 2F8SA 5KFCA 4CCHA 3KLEB 4LSNB 1NKBA 4BE1A 1ZETA 4DSEA 1JL1A 1U49A 4RW4A 4I9LA 5EWFA 4GVMA 2PZSA 3HSTB 4CJSA 4Z4IA 4CGDA 4FJLA 1ITGA 2HNDB 2BGGA 4ECTA 3AO3A 3NH2A 4DFMA 4LH5A 3V9ZA 4B9SA 4WFYA 1IM4A 4Q0BB 5C42B 5J2NA 2LSNA 1TKZB 5C24B 3NAHA 3S3NA 3RBEA 4E7KA 4MKBA 5KFFA 1X9WA 5J2PB 1LW0A 3EY1A 1HNIB 4B3OB 4CEOA 1NKCA 4PQUB 4O4GA 3GIIA 3DM2A 1K1SA 2IDOA 2KZZA 4KO0B 4TN2A 4ZVGA 5J2QB 2DPIA 2WOMB 3RB4A 2X74A 1UA0A 1T7PA 2XY7A 1JLEA 4Y1CA 3N6NA 4W5OA 2G8KA 2G8VA 4RUAA 3TQ1A 4LQ3A 1QQCA 4DQQA 2HHUA 5CZ1A 4O55A 1TL1A 1ZYQA 2FJVA 3PV8A 3HYFA 4F8RA 4DG1B 1QHTA 3DRPA 3ZT1A 5KT7A 3OYLA 5KFQA 2ZD1A 3OLAA 4FJMA 1EETB 3QGIA 3K5LA 3CM5A 3U3YA 1HNVA 3VQ6A 2Z1JA 2ZQBA 2P51A 3DRRB 2Z1GA 3PY8A 1T03B 1JL2A 3BQ0A 4R5PB 4B9VA 2W9BA 3B6OA 4RG8A 1LW2B 3AA2A 4OVLA 3V6DB 1NK6A 4KSEB 3OYCA 3CFPA 2FLLA 1JXLA 3AVKA 4W5RA 4NLYA 3OSNA 3QESA 4QWDA 1U04A 3H5YA 3LWLA 5DGBA 5L1IA 3BREA 5DGAA 1DTTA 4QCLA 3AVMA 3DLGA 2JGUA 4KFBA 1S97A 3AVAA 2Y1JA 4ECYA 3GQCA 1SH2A 1RT5B 3FQLA 3LDSA 2ILZA 5KGXA 1RA6A 4CJEA 1RDCA 2XI2A 3CFOA 1RBSA 4EZ6A 4CEQA 4CFDA 4DLGA 1S1TB 4J9NA 3K5MA 4ECSA 3EYZA 3VQAA 1L3UA 5F8HA 1L3TA 5KG4A 1W25A 4B9NA 4CFAA 3AVLA
chains in the Genus database with same CATH superfamily
3E01B 4QS9A 4LF6J 2RHQB 2RUSA 1IKWA 4M5MA 4L76A 2O8BA 2B5JB 2PT0A 1BUXA 3AJDA 2VC1A 1P27B 4OYMA 5KFVA 3CPWR 1VQON 4OHVA 1T44A 3TZWA 2DR6A 4LBIA 1TKTB 3EWGA 4JI7K 1ZM2A 4IG3B 1VQ4N 1HWLA 1B99A 3DLBA 3O4QA 2VG6A 4FJKA 3T3FA 1WHXA 4I4BA 3JSYA 4JHDB 3KKRA 4NI2B 1QE1A 2J7KA 1VQKN 1WHWA 5AZIB 1HW8A 1DHMA 4YNQA 1PILA 2EWSA 4A8SA 2OH2A 4GO5X 1N8RO 2YY3A 1OKJA 1FJGK 5KFBA 1VC0A 4DL2A 2YX4A 3A3PB 3OYDA 3CGIA 1U1NA 4OHXA 5EOYA 3AB2B 3H42A 3MHYA 3A0IX 2BACA 3BEGB 1LFPA 2DNZA 5C24A 3X3UA 1NO8A 1QQNA 4K4VA 2VDHA 3CCLS 4AF1A 1HNIA 4B3OA 2F8MA 3CEDA 3WXKA 3HOTA 2HYIB 3P4IA 1KKHA 3VAMA 4FOEA 4W5TA 3OYJA 4O4RA 2EKNA 2UVRA 4KO0A 3FFKB 2RQMA 5F0WA 4P9SA 2F4VK 2R7WA 3C0BA 4LRCA 3NBPB 2NXNA 3D68A 5KFZA 4NLPA 2GWJA 3T5JA 1XI1A 4IG0B 1IO2A 3UDLA 1GLEG 1VDHA 2KZMA 4A8XA 5KQ8A 3NNAA 3C65A 2MKIA 3DDKA 1EETA 3ZNJ1 3UDEA 3TNVA 1FHTA 3M2VA 5HL7Q 4QU6A 4ZPVR 1J5OB 4NLGA 4LF9K 5LL6Z 3LW5C 3MN5A 5EWGA 2ZVSA 2V8PA 4K7QA 3I0SB 3J81O 3S1TA 2FC0A 4N5SA 5KFEA 1SKWA 1OO0B 2DITA 1Z05A 2X6SA 3CD0A 3MX5A 3T1HK 4KHSA 1BD6A 2BRLA 5AQWA 4PY5A 4TLQA 1VQ9N 3F2KA 1H2VZ 3AAQA 3O1WA 4ZJOA 4X4SA 3FMWA 5JMVA 2CDRB 1WAJA 2JZ5A 3L3UA 4UY8T 4DV1J 4ILGB 3ZSOA 3PEHA 3KKSA 2E8AA 3MM8A 4GVEA 1AROP 3J7AN 1S1TA 2RPIA 2F63A 4K4SA 2FBTA 1UVLA 1YBUA 2ADCA 1MSWD 4CI6A 3ZYYX 3K5PA 2IGIA 5HANA 3E01A 2YQ3A 2QTDA 2W4DA 1RDUA 3JYTB 1BU6O 1YRTA 4ZPDA 1ZA1B 4LFAJ 4BC7A 4WJBA 3RRKA 3Q23A 2B5JA 2KT5A 2QTWA 3EVWA 5F41A 4ZP6A 1TKTA 4IG3A 3G87A 4DL4A 2YJFA 4DX6A 1NMEB 2X6NA 1Y3JA 4W92B 3A8JA 4BRAA 3W8PA 2VFRA 2CPEA 2UXCF 1S5ZA 1DBDA 4JHDA 1PC4A 1JLCB 4OYBA 3J7YP 4MFBB 1X5SA 4V19S 1RTIB 5AZIA 3HXMA 4MT1A 4IR1A 4EIAA 1UPPA 2CADA 5M2UA 4CJTA 2FHJA 5LOQA 4FL9A 1XMOK 1UEKA 4HHUA 1UKUA 2BTFA 2Z1HA 3NOGA 2YKQA 3BSNA 1WC0A 3U1LA 2IM3A 4CD3A 4CEEA 2EFVA 1NGFA 2ERRA 3CJ3A 5C2GA 4WFZA 3CJ5A 4IDHA 4DV6K 1YWXA 3NCIA 4JOUA 6FD1A 5TKYA 3CDAA 3PX4A 2JX2A 4DR1K 3NAIA 3Q24A 1RFQA 4WFXA 1HQUB 5F8IA 3QGGA 3IBWA 4CLTA 1YHQS 5MAOA 4DFPA 1RNHA 1QY7A 2RRNA 3NBPA 1WG5A 5AQSA 1FRLA 3D54A 1VYAA 1RTDB 2AX1A 4UY8O 3BO2A 1OH5A 4RKUC 1CULB 2KFYA 2BW2A 4U7CA 4ZVEA 1BWEA 2IM2A 2P5VA 1O0PA 2FQQB 4B1VA 4ID5B 4ZVPB 4QPTA 4YB6A 2PFUA 1MWZA 1NH8A 3AO5A 5FDLB 2AZ3A 1J5OA 4NA3A 4MQ3A 2H3EB 2M88A 4DR7K 2P5OA 4FK4A 3L9ZA 4M8LA 1KEKA 1YUWA 1ATNA 2HQFA 4TYAA 2OZMA 3NCPA 3FGUA 4PYDA 1XR5A 4RW9B 4LF5J 4DTRA 4Z37A 2UUBK 1H2UX 1E6VB 2R8IA 3FBCA 4FM0A 3ZSZA 1Q53A 4OMFG 5FRNA 4DPTA 4OQJA 4V19J 3MECB 3NGYA 5BR8J 2NR0A 5A2QY 4JI8F 4DV2J 1NGGA 5T14A 1V9OA 4F25A 3OYMA 5AQXA 5L1KA 4A8QA 2R7SA 4JI2K 3V9UA 3L4QA 1IBMJ 3SV3A 3JYTA 3OXGA 3GMGA 1GH8A 2OEJA 1S49A 1VIOA 1FNOA 2FHMA 1RILA 3D2WA 1H98A 1MDUB 2V2VA 3MCOA 3VQTA 5ADXA 4HVJA 2ASPA 3FVYA 1S9FA 4FWSA 4UOCA 2YWFA 4FZZA 2CQ4A 3EDQB 5AQGA 4FSVA 1LKZA 5FLXU 1JLCA 3P3DA 4MFBA 2W2QP 2SXLA 4ZCLA 1NGCA 2NQPA 1RTIA 3H45C 3PYEA 4OI4A 2FVRA 2WAQD 3CCRN 1C0TB 1WEXA 2YWHA 4X4QA 3VGKA 4B9QA 2A3ZA 1HKCA 3GB0A 1N36J 5KRTA 1N34K 1OIAA 1SIWB 3CDUA 3GU0A 4AHSA 3A13A 3TZZA 1TVRB 1CBKA 1KQSR 5TKWA 1B9FA 2M7SA 3ICLA 4P2SA 1JQGA 2XZWA 3C8YA 1NMDA 1RCHA 4BRLA 5CYMB 1SPBP 3ENWA 5EDWA 3EUNA 1P90A 3OL7A 4LF8K 2DEJA 4XO0A 2ZH5A 1BOTO 1I94J 1K8AO 1HQUA 2AJQA 1G99A 2ILYA 4LFCF 1TZ0A 3O80A 3VOVA 3NWRA 4UW2A 3THVA 4FJXA 3NWGA 2BQUA 3JAMO 3MAQA 1HJRA 4M3XA 1U6ZA 1RTDA 1P9YA 4WFAL 3VGTA 4B9TA 4I6AA 4NX9A 1CULA 1TAUA 3UNGC 5EWEA 1S0VA 1AW0A 2HS3A 2QEXN 3KHHA 1VC5A 1HWUA 3CJ0A 1XQIA 1JNRB 3DLKA 1KBRA 1R8CA 4ID5A 2BVZA 1O51A 1AB8A 5AQHA 2EW9A 1B7YB 3HM9A 3MUVP 4JS4A 2ZH1A 5E84A 5FDLA 1PAEX 1Q8BA 1RUSA 4IRCA 3I87A 4NXMJ 3TZXA 3ETOA 3OFHA 1IR1A 4RW9A 3GTYX 4Y2CA 3P8BB 4RWWA 1E6VA 3DKDA 2AHOB 4QYZK 3LPYA 2Q36A 2GNKA 3MECA 1G3OA 4GVBA 1S99A 4UT4A 1RGVA 1T9TA 3UI3A 5GAHI 4GO7X 1TP7A 4K8ZA 2ZWHA 2H4YB 4JI6K 1HHQA 2CPIA 2YX6A 3I6PA 3VGVA 2AJ1A 4PUOB 4GKKJ 8RUCA 3BN4A 3EGWB 3PUFA 3SAGA 3KJVB 2ZBCA 3FQKA 2K1RB 2XLJA 1FVQA 1QSLA 3BDEA 4CF9A 1Q78A 4JI0J 3O5TB 3MWBA 1KAXA 1BHLA 5SZTA 1EXQA 1N5TA 5IQQA 2UVVA 2FY1A 5C5JA 2G0JA 1MA9B 3OYBA 3DYAB 5LXYA 4EYIB 1RTHB 4LSLB 1F2HA 2KFNA 3LWMA 4ED5A 3OSPA 3M30B 3C6TB 2O4IA 4LF4K 5AE2A 4OHYA 2L48A 2PDAA 2DJWA 1GOAA 2R7QA 4QW9A 3RW7A 1GXTA 2XS5A 4XPEA 1ZM9A 5AQMA 2W8KA 3ZT4A 1BE4A 5E2QA 3BSAA 3W62A 1U8SA 1C0TA 4ED3A 3NGUA 3VA3A 5E3AA 5D3GB 2NS1B 1RYSA 3C7NB 5HI7A 4C1NK 1X4BA 3MPUB 5ETNA 3N79A 2PY5A 3QNNA 3OYGA 3PW0A 4K4YA 1TVRA 1SUQB 2F5GA 4K0KF 2ADBA 4P10A 4BVOA 5LMNJ 1T6CA 3WNGA 3O6QA 1X4EA 1NK4A 5CYMA 1OSDA 3DLLL 2E1AA 3TAMA 1HA1A 1KC8T 1CXUA 5M1FA 3CF5L 2M3DA 2D74B 2BJ8A 1QVFR 3S3MA 4E2FB 4ZJLA 3UR0A 4WXWA 2AGOA 3EGZA 1N6QB 2VQFF 2R7XA 1QJHA 4HLBA 1IJEB 2H5IB 1OY6A 2JLFA 4IWVA 1EQ0A 4FPBA 7FDRA 4LMZA 2DH7A 4IXCA 3WUHA 5CR4A 1KOHA 3AAPA 1C2PA 1GMUA 3FFIB 3UIQA 3RB3A 5MLCV 3WEEA 4DU4A 5IC6B 3MFHA 1RT6B 2HFOA 4FWMA 2V63A 2VH7A 1QZ5A 4O3RA 1M5VC 2B9YA 4UQTA 3O9QA 3EZWA 2B7BB 3R6LB 1ZBSA 1M5PC 2UUWA 3Q83A 4YDUA 2DHXA 3PZPA 3U8XA 4JI3K 1YKWA 2HHHJ 1NH7A 5FPDA 3D0PA 5BR9A 4LVOP 3W2VB 4C98A 4DJBA 4HVZA 2ETJA 4RTFD 2V2KA 1AFJA 1FJCA 4YOXA 3LQVA 4ATNA 2E5GA 4ZTJA 4KGKA 1X8DA 2WCXA 1TL5A 2Q6CA 4PXDA 5KFSA 4O3NA 1TK8A 1FA0A 4FVMA 2GJ2A 2EFPA 4FK0A 4J7CA 4PUOA 4DN9A 1SJFA 3KJVA 3I5AA 2K1RA 4RWXA 3ZXWA 2HGMA 3OYAA 3I8BA 4RU2A 3QT6A 1SJQA 1VAZA 2YV0X 3MDFA 1N5VA 2RDJA 4A61A 1HNXJ 1Q86T 4FLWA 1WEZA 1L3KA 2YH0A 1IJJA 4NLUA 3DYAA 2DIUA 1NBEB 3IWLA 5J2MB 4CJLA 2HMIB 1RTHA 2CZ4A 2IA6A 5HMWA 2OLWA 3L0QA 3M30A 4M45A 3C6TA 2B6AB 2HBRB 4ZN1A 1Z25A 3AD7C 2RDIA 1N32J 2VL1A 4P2MA 3O1BA 2Q1NA 2B9WA 3QINA 2JEJA 4OYZA 4ANDA 1J2VA 4X62J 5D3GA 4B9LA 3LP1B 2OJ3A 3C7NA 4ZVTB 3ID8A 4Y00A 1BIUA 2YKOA 1YF5L 1KWMA 1SUQA 4E0DA 3GIMA 1YVUA 5FD1A 1Q9XA 4EGLA 4DUYJ 2RIJA 5F8LA 4CEDA 4NLBA 3CCQN 4IH5A 2VHGA 4GC6A 3OYKA 2MEWA 4M5LA 1A5WA 1N6QA 4OL8A 2V5HG 4M63C 5KG1A 2J6UA 2GO8A 1VRTB 2D5RA 1KXPA 4ZVRB 3M1VB 3GLJA 3L09A 5L46A 5I4MA 3G25A 2J6SA 3H6EA 3ASMA 1S59A 4DF4A 5IM0B 1CZ9A 3MCAB 3BP8A 2OTLN 4DL6A 1I39A 1U2CA 2BQ3A 1W0HA 1LK5A 3G8TA 5ETVA 2VDIA 1U1KA 3FFIA 4FYWB 4Y6IA 2M4MA 2F1FA 3KOAA 1D3WA 4PWWA 2HGNA 1XC9A 3KK1B 4K41A 4NYNA 1Q79A 1RT6A 2DYAA 2HF3A 3ATUA 3KHLA 2DXDA 2YQ1A 1DLOB 1S7HA 3N4WA 2JVRA 1RXOB 1WSHA 2E5LK 4ZVSB 4CBUA 4DPUA 3CD6N 4LFBF 4USJC 1VCTA 1ITPA 1YZ6A 3SI6A 3IM9A 2FC9A 1WF1A 2GHPA 4ED1A 1Q86O 3P83D 3NGKA 3RAMA 1WELA 2VU5A 3U27A 4JV5F 2BA9A 1SH0A 3BDPA 4JKDA 2D9OA 3K8WA 3OVAA 1GLFO 4JNEA 3MX2A 1VBZA 1A6LA 3W2VA 4U7UK 2V4JA 4FLYA 1O5JA 3MTJA 4DV7K 1PYOB 3TOQA 1BQMB 4LT6A 2D3UA 1T3VA 2QL9B 5B8HA 1WF0A 2WBNA 2DISA 4JYAF 1BDGA 2ZZTA 4WFNL 2J0WA 5ETRA 1HBNB 4C8NA 3O3FA 4OYXA 1AA1B 4H54A 4YP3A 3KJQB 1J6ZA 5LMUJ 3K0SA 2HS0A 2IPOB 1Q8LA 1MU2B 2IRYA 3NGZA 2FLNA 2HK2A 2OEKA 3I56N 1C4CA 3CJ7A 3PRBA 4YB1P 1YSJA 3OBIA 1M0SA 1TL3B 2WK4A 2PYJA 1FWPA 2VUGA 1RBLA 2A10A 2BKPA 1WD6A 5DQHA 1Y9OA 2A2DA 3MTKA 2I0XA 4ZCMA 5J2MA 2HMIA 1WOQA 2BOPA 2BE7D 3SV4A 2UXBK 4NLRA 2B6AA 2ZBIA 2HHXA 1VK8A 1IBKK 3PLAA 1LV5A 3VESA 3SDEB 4WYWA 1WLJA 1ZM4A 2ZWPA 1K1QA 4DR5J 1B0TA 4KHQA 3M8QB 2Q97A 4MAKA 3LP1A 4I2QB 2ZNYA 4IZ9A 5HLFB 5GAEI 2OGUA 3SAHA 3DI6B 3CCVS 2XRIA 1APSA 3Q7BA 1HNZF 1B64A 1D5AA 3CPWM 1NNDA 4E1NA 3A8EA 1KOOA 3PRDA 4CH7A 1NK5A 5HATA 3QO9B 2CG4A 4KBIA 3RMDA 5JS2A 1KVBA 3CJQA 3KWIA 5AQYA 3AVHA 1FD8A 2W40A 2P9IB 3FZFA 1SQEA 2FPHX 1VRTA 3LGHA 4DHVA 3M1VA 3PJ9A 2W2PP 1VSIA 3ZX0A 1RHJB 4NXNF 5IM0A 1TMJA 3ET6B 4M7YA 1FKAF 2G8UA 4FPAA 5M1QA 2FJBB 4OJRA 4ED7A 4EK2A 2AV5A 4LF6K 3M8PB 3KLIB 1VQMN 1KQKA 4H5TA 4P71A 4USHA 2DXFA 2ZJQQ 2M5YA 1DLOA 4FJ7A 2W7OA 4Y0FA 2UXCJ 3F0NA 4BR9A 4C0OC 4JV1A 4KC5A 3D4JA 2RE2A 3PYGA 4L74A 9RUBA 3M6UA 3AO4A 1UW4A 4C11B 2AJ0A 3OTOF 3CFRA 4MTPA 3CCZA 2P8IA 2ZH7A 3MR2A 2J5AA 1BQMA 3VQDA 1XWLA 3CJSA 3THPA 3OV7A 1X4HA 4V1Ak 4YOYA 2LQJA 3M2RB 4ES1A 1RABB 3TZYA 3CDEA 1HBNA 1XC3A 1J54A 3CT9A 4C8MA 2E6MA 5HL7L 3NVMA 4IBNA 2DNHA 4RBTA 4TKTA 1H73A 4ZLLA 1MU2A 3KJNB 1RHUB 2ACYA 2RQCA 4KBOA 3VEOA 2ZE2B 2QA4G 3MEKA 5JMNA 3G0ZA 4G1QB 3PXGa 3FRZA 2GAHC 3WBZA 1TL3A 3ZT2A 2ZM6K 3KFWX 5AQZA 4MIAA 2FHKA 1QAXA 5LJWA 4BR0A 4AUKA 4RWTA 3KJFB 4NA2A 3C6UB 4DKWA 1U24A 1HR0J 1WC5A 1REVB 4C0HA 1N4LA 5AFUA 1TKXB 1T05B 3RBZA 1TUGB 3N6LA 4DR4F 1SV5B 5C7PA 4JEPA 2YHWA 3SDEA 3PACA 1UJ6A 3F73A 2X1BA 4ZVUB 4K25A 4OI3A 3M8QA 1WHYA 2HAFA 1XNRJ 3CCLN 4H5NA 3MK6A 1KLMB 5GADP 5HLFA 2W42A 3DI6A 4N7TA 4RNOA 2VONA 4CGJA 1CJVB 3E1YA 4C48A 1RWVB 1M1KT 4PG8A 4OZ2A 4IQXA 5HQLA 4K8XA 2J8AA 3QO9A 4WZQA 1NSAA 4RX6A 4PG4A 2VYPA 1ROFA 1SJ1A 2AWZA 2F8HA 1L3VA 2P9IA 4BBYA 3S7RA 1LNQA 4DV1K 3FUYA 1C0GA 3CD7A 3LM9A 3NGSA 1YTUA 3V6HA 2NRHA 4ETZA 2XB2D 5FRMA 2B4UA 3ET6A 1FRJA 4AM7A 2ZVIA 2MLYA 2Y0SD 3V4IA 3IRWP 1YJ9S 3M6WA 1RI7A 2QWNA 1HPMA 3M8PA 2Z1IA 2B8PA 3KLIA 2X1AA 1RT2B 4F3QA 2QV6A 1MWYA 4KI6A 2ZH2A 5A2QO 3NGIA 5KG0A 1VSEA 3QWUA 4AYBD 1YJUA 4JK9A 2LU2A 2M70A 1D4XA 4CIOA 4O4GB 4IO1A 2HFNA 2FBYA 2V8DA 4CFCA 5D15A 2DBBA 3UD3P 4KI4A 1IBLK 4C11A 2ROEA 3NNCA 4B8CA 1YAGA 1VSDA 2C2OB 9ATCB 4QOTA 2KHCA 5EGYA 4DTPA 3GDQA 1YRXA 3H3NO 4J2DA 1SJRA 2GZOA 1C0MA 4QR0A 4C8KA 2ZFHA 2KHDA 4RZRA 3M2RA 2HAIA 2PE8A 2KXNB 4F02A 3DXKB 4NEZA 4WBFA 1P1TA 5IWAF 2DHAA 2ZE2A 3LA0A 4B3MK 4G1QA 5BJRA 1M1KO 3FCVA 4F67A 2LQ8A 4JI4F 1RKIA 4H03B 1HNWF 3L8BA 1R6VA 3E2EA 1S12A 5DG7A 4Y65A 3TAEA 1NJYA 1A0OB 4X64K 1WNEA 4ISGA 1DTTB 3C6UA 1RHMB 5GMDA 2PSZA 3OT9A 2D0CA 2XWXA 4H0VB 3NRBA 5B09A 1REVA 4E1JA 2MJNA 3UPFA 1TKXA 1D9AA 3Q89A 3VAJA 2F9WA 1B3TA 4DV0F 1T05A 1NK9A 2Y1RI 1CZAN 1SV5A 4EWTA 3ISND 3JQJA 1DGKN 2DNLA 4UZBA 3TANA 1CG2A 1IBCB 4KGVB 3J81j 4DX5A 2QFJA 3MR3A 4XEIA 1KLMA 2Q3PA 4EFAC 2ZJRQ 1CJVA 5BPNA 1YHQN 1X9SA 4NLQA 4NLXA 4HWIA 1QUVA 3PKYA 3U7JA 3IN5A 5IT9U 1CZBA 4J9KA 3E3XA 4IEIA 4AL5A 1T95A 2AYBA 3QDKA 5DS7A 4CF8A 3OA9A 2MMYA 3NNHA 2PIIA 5L8RC 2ZUGA 4KPYA 3C46A 3QGPA 4YN3B 3NOCA 2CH5A 4Q7AA 4OKKA 1SIZA 4FLXA 1O6XA 5KFYA 4DV2K 4EO8A 5LXRA 3A8IA 3VAGA 2KXHA 5ADZA 3HX9A 2NUHA 3THXB 2E2OA 3D7SB 1Y4ZB 1DY3A 3FCWA 5HVHA 5EWFA 3T1YF 1RDWX 3K7RA 4CGDA 4DV3F 4X65J 4A59A 1BHNA 2M8DB 3IXQA 3ISZA 1KQSM 2IRUA 2UXDJ 1HL6A 2PC6A 1WDDA 1QVGR 4B9SA 4LH5A 4WFYA 3CCJS 5C42B 1R8PA 1TKZB 1F5AA 3NAHA 3RBEA 4QR1A 1Y64A 2J7WA 2DGTA 1S77D 1V6HA 4BRMA 3ULHA 4WQ5C 4O4GA 1F0XA 2LP4A 4NOHA 4MYTA 3MMBB 1VQ5S 3FBFA 4ZVGA 3M1FA 1SC6A 2X74A 3A8KA 1N33K 2XY7A 2C3PA 4W5OA 2HK3A 3HHLD 4LQ3A 2OSRA 3MN6A 1Y5IB 2IVPA 1N36K 4DQQA 2HHUA 1E6YB 3LM2A 4CZEA 1VC6A 4DZ6A 2LFVA 1VHXA 3CJ9A 3TEHB 3N01A 5EY4A 4BROA 1VFJA 3MUMP 3DXKA 3UDVA 4PG7A 3VQ6A 1JCGA 1BMQB 2Z1GA 1T03B 2L9WA 5AXLA 2ZC4A 4B9VA 4OVLA 3EE9A 1RAEB 2VQFJ 2RRBA 3AVKA 4NLYA 2OHDA 2OKQA 2I8EA 3K9JA 5DGBA 1FRHA 5L1IA 1DTTA 2A2CA 4M5KA 1FX4A 3DCAA 1S97A 1IQTA 1MG7A 2W01A 4ECYA 3GQCA 1DQ9A 2ZEJA 4OYIA 1SH2A 3J7ZT 1RT5B 2W6KA 2ILZA 4N77A 2GVDB 1RBSA 4CEQA 4CFDA 1SJ3P 4DLGA 2H3GX 4OHZA 1XMQJ 4LJMA 3ENBA 3D3CJ 1UCNA 2MZJA 1W25A 1XN9A 5DQGA 2BZ2A 2MZTA 3HPOA 4AQYF 1PO6A 3M8RA 3MR5A 3TAFA 1M1HA 2RN2A 4OX9F 1CSJA 4NXMK 1FNXH 5AJ3F 2DR7A 5IT4A 2R7YA 5KRSA 3FKBA 2D41A 4J9LA 4NA1A 2FZKB 4UY85 1VQPS 1KRPA 1FRMA 4U7BA 2KRBA 3PIPQ 3J80Y 2QMXA 2F96A 1PSDA 1UVKA 5GAGP 3S9HA 4CLYA 3AD8C 1UWBB 3THXA 2DPJA 3M9OB 4PKDB 5A6PA 4RNMA 1A5XA 3ZT0A 2BJ9A 1UTAA 2E7WA 1R8AA 3MM9B 3GV7B 4EAHD 5JVGL 2BM1A 4CBXA 2J9EA 3M8SA 4G1PA 1VSJA 3MXHP 2B4JA 3HSGA 3MAHA 2KFZA 4CI0B 5C42A 1TUUA 1H7XA 3QLHB 3IM8A 1TKZA 3BN7A 4M3YA 1S22A 1M90O 1KCFA 3BSOA 4HTLA 1QVFM 5KFMA 5F8NA 1U1RA 1R0CB 3VEYA 4A5BA 3O3HA 4DSIA 3MMBA 1NSPA 1R89A 1NLKL 4L8RB 3TQEA 2XY5A 2HVDA 2CZ9A 3CM6A 3IP0A 4CECA 3KWGA 2IVNA 4CZHA 3OUYB 3R7SB 3J7ZO 4Y34A 2HLTA 5KI6A 4PXBA 4Q45A 2ZOFA 2R7TA 3D6TB 4CZFA 1E6YA 5B0DA 3W66A 2D1KA 1KHVA 3IAM9 4ZIVA 4J91A 1WTBA 2G0IA 3HHKA 1OPIA 4Z7YA 2RVJA 1T03A 3SCKE 2NLXA 3QMLA 4DF8A 3GOIA 2XULA 3AOBA 4DQIA 4XH1A 1WKLA 2QM1A 1EHWA 1D8ZA 1T6DA 4B17A 4DUZK 2E5HA 1TL7B 2EG2A 4DFJA 3VQCA 3NE6A 2BXJA 1RGIA 2IM1A 5CAAA 3TSPA 2VC0A 4C1NI 5FLXY 1TR0A 3OS1A 3PW7A 1RT5A 5LY3A 2WB1D 4F4AA 2XEXA 1U0SA 4OLAA 3S41A 2CQ1A 2V50A 4KHUA 3CXCR 1GLDG 2XM3A 2AEMA 2GVDA 4M1KA 5J1EB 5EX5A 3QGHA 1UFLA 4RW8B 1V3SA 2BR0A 1N48A 4LF7K 4JI7F 1P6TA 2VKZG 3SQ4A 2H54B 3KLFA 2XTJP 4O44B 5KFIA 1J53A 4F04B 4OYPA 4ID1A 3G10A 4F50A 2ZBQA 4A48A 4ETXA 3E9LA 2HHHK 4NPOA 3HZEA 3FDSA 4DPXA 3H46O 2F4FA 3I55S 2XMKA 4BREA 1HLWA 3L2RA 2V9KA 3W5XA 1YX2A 2ZH8A 1ATSA 3I31A 1MNEA 5J1PA 3ZTRA 3HZ6A 2QWPA 2ABYA 1YGYA 2P9SB 4CO3A 4Z4EA 4OHWA 2J9DA 3HHNB 2FY8A 4CNZA 5K20B 4YORA 2JL9A 4N56A 1UWBA 3W3SA 1S1UB 2ZHBA 4CYUB 3L6QA 1ZBHA 2UV8A 5HSPA 4KHWA 2FIUA 3MM9A 3ZETB 3ZEUB 3W9HA 2O66A 4YOUA 1WN7A 4DS4A 3OYIA 3QATA 4AH9A 3QLHA 2D0AA 1R43A 1NM1A 1JXVA 3QNWB 2HG4A 4X4OA 1F5BA 5FROA 5CHIA 3PW2A 3R3TA 3TTDA 4FZYA 2ATCB 2DY9A 4UZCA 1VHFA 4XDDA 1SKUB 2ZC3A 1B9DA 1G15A 1N32K 3OVBA 4E1MA 5K14B 2DTJA 4BACA 3AH6A 3LDNA 3OUYA 4X62K 4C4WA 3HPGA 1OWXA 3UVJB 2G1HA 2UU9K 2MQNA 1LEOA 4JI1J 3K89A 2R7OA 2MKKA 4BC5A 1N54B 3AGKA 5DDRC 3V9WA 2Q0RA 1X0FA 5F0XA 1FJ7A 2QZ8A 3UN2A 1QUPA 5JVHL 2ASDA 2EX3A 2UUCF 3Q2TC 3PVXA 2BABA 1ZTTA 4CJ3A 1J27A 4NXNJ 2YKMB 3B6PA 4LIRA 1TL7A 4FCYA 4X2BA 3OQ2A 3QZ8A 5AE3A 1GXUA 4XDCA 1HHTP 1NDPA 2V68A 2WVEA 5DMRA 5DZ6A 4G65A 3KWMA 2XHCA 2Q3SA 5J1EA 4FW1A 4PL8A 1Z6RA 5LJVA 2UVUA 2IVMA 4RW8A 4DS5A 3UCUP 1H38A 3MCMA 3F9MA 1Q18A 4X66J 3FEZA 2X7IA 4O44A 3MXJA 3BR8A 4LFAF 1FRXA 5IZHA 4EEYA 4FK2A 1JLBB 3AO1A 3GIJA 3EPIA 4CD1A 4U67Q 4JN4A 5IQ6A 2AEFA 3W8GA 2X3DA 3ILLA 1Q4RA 3QB0A 1BLUA 2ASYA 2A6MA 1XMOF 5F8JA 2P9SA 4DTNA 5L1LA 5D0GA 1VHIA 4ILLA 4LIWA 1C1BB 1HD0A 2ATQA 1NAQA 3M6VA 2QSWA 1S1UA 3DLEB 3FRYA 1PIEA 2HFVA 4CYUA 2YJEA 3GCXP 1KVJA 3O6WA 3EXCX 3MAAB 4U6PA 1Q16B 3ZEUA 5ETKA 1JMTA 4BC3A 4YB7A 3I33A 3JS6A 1JLQB 2DNRA 2D0PA 4U8VA 3MEGB 4BR5A 1OS5A 4TY9A 4CLFA 2QKKA 3SSQA 5C0YA 4CJUA 4FN5A 1BIZA 3VQPA 5M2PA 4IH7A 4DR4J 4GV9A 4FJ8A 3OL6A 2WSCC 4B1WB 4ZPTR 2KT2A 5ETSA 2QI2A 4KH1B 1HKAA 5K14A 4BC9A 2PA3A 3KIOA 4FPRA 2ZGZA 4PWUA 1WJ9A 1NK0A 3OHAA 1NKEA 1X3MA 3UVJA 3SUOA 4GY2B 2PMZD 3SUPA 4DL3A 1W97L 4HH0A 1DURA 4ISFA 3P31A 3OFFA 3PFOA 1NU0A 4DR3F 3NG8A 3CJ2A 4RUHA 2EWHA 4IQMA 4PKGA 3IBFB 3KMQA 5M1NA 2DFHA 4HHTA 1FESA 2MJUA 1NWKA 4BR7A 1KHWA 2JVOA 2IRXA 3CCSS 2ALYB 3D6FB 2OP5A 1RWOB 2UZAA 4OI6A 4F0MA 2YWKA 4RO0A 1OH7A 3QZ7A 4Y3CA 3UR3C 4E8UA 3ISNC 2CDQA 3PO5A 2YKMA 2JSXA 4CO1A 1VOMA 2UVWA 5FIIA 4USVA 5SUHA 4LF5F 2DR5A 2QFIA 1Y00A 5DZ7A 3FGVA 4HUEA 2U1AA 2GBZA 2Y1LB 3HHLB 1D8YA 1CXQA 2V6AA 4ED4A 4KB7A 3RAQA 3CCVN 1NGEA 3SYZA 3A5MC 3FBEA 1XERA 3MD3A 4ZP9A 4F4YA 1KDNA 3ENVA 4WWSA 2AQ4A 5BR8F 2Q2RA 2Z2MA 3MEEB 4DI6A 1WUUA 4Q43A 1UEUA 2HQ3A 4QS7A 4K59A 4A8FA 3ZSQA 5CH7B 3HTVA 2MKCA 2CWKA 3E66A 1IBMF 4C8LA 3DRYA 2OD6A 3JQKA 3NGDA 1FO1A 4TLRA 4RL1A 2HKEA 1JLBA 3ZT3A 3KYLA 2GQCA 2GQ2A 3BGLA 3VGLA 1NK7A 5H9EJ 1F9HA 2BANB 5EX0A 2W1BA 5ETQA 1KONA 3OHBA 3FEXB 1YDLA 4KRWA 1WSIA 2R7UA 4CO4A 1C1BA 2AJ4A 2QX0A 3L95X 1BL3A 4TU7A 3DLEA 4BG9A 3KXDA 4FWNA 2BJ7A 1F2GA 1Q8IA 1XR6A 2NLWA 3H5SA 3KNGA 1MWMA 1GAOA 3MAAA 4JI4J 2DT9A 2K7JA 3QMQA 1HNWJ 2YI1A 1JLQA 4B3SK 3MEGA 1FDDA 1TU0B 1UAXA 2UV8G 1TAQA 4NRTA 3HHLC 2FJWA 2FD2A 3O1LA 1X4CA 4KH4A 4IOXA 3PHEA 1WBBA 5KTQA 3HBTA 1M1GA 4ZOSA 5D0RA 4DV0J 3T9NA 2V52B 5DG8A 2MKJA 3MD1A 2FSJA 1JJ2R 2KN4A 3IGNA 1V3ZA 3SQOP 1I94F 3I96A 3MPVA 3BGRB 1B92A 1RLCL 3NMUA 1P9QC 5G4DA 2W9CB 1OPZA 2VPXB 3LANA 3K57A 3HVAA 3E51A 4CH1A 3BZCA 1MWQA 4J9PA 1X3NA 1EKRA 2XBPA 4ECQA 2F65A 2E9TA 2CNKB 4M5GA 2KT3A 3MEDB 4OZJA 4A46A 4OZ0A 1SQKA 3LPTA 1O1WA 3CSKA 3CCTA 4CHQA 1N5QA 4F3OA 1DQAA 2F3JA 3B78A 3ENHA 5KFJA 3FZHA 2IYIA 3NAEA 4PR6A 4CHPA 4DLEA 1N88A 5AE1A 3DJCA 1EQMA 4M5DB 4FZXC 4I9QA 2DKOB 3BBCA 4NZ7A 4JI8K 3G6ES 1XHZA 4WQ4C 4ID8A 5IOLA 3B8AX 3TA2A 3PW4A 2QIFA 2YHXA 1OH6A 4CO0A 1HHSA 3ZTPA 3TSQA 4EP5A 3HHLA 3K5OA 4O3PA 3T5HA 3IDHA 3D0HE 2E9RX 4JKBA 5EUHA 4KHPJ 3MEEA 3R5DA 1BI4B 4BGBA 5CE3A 2GX9A 3OS2A 2WW4A 3HVWA 2AT1B 2QWOA 4GKKF 4BRKA 1IXKA 4OI0A 5AXKA 5AQVA 1A9NB 2F9TA 2NPFA 4YOVA 1G4CA 4JI0F 1ZOTA 2G8HA 4QWCA 3WT0A 5CZXA 2BANA 2QW9A 4ZPBA 3R1LA 3KD1E 4QIVA 4DV5K 1CC7A 2HSTA 4P6QA 4OPAA 1YJ9N 1Q81T 2WRMA 3HJFA 1EQYA 1Y0HA 2ZBRA 5AR0A 5I3UB 4I7FB 4ECZA 3NP5A 3AOAA 1RU2A 4BHQA 1HKBA 4YDXA 3QBXA 3BR9A 3PX6A 1V5IB 2V51B 3OTEA 1TYQB 3QAUA 4WQ4A 5D4NA 1H74A 2ZJRL 4I56A 2VB6A 4PWDB 1RHRB 1HYSB 4IDKB 4LFCK 2DB1A 5A6WA 4OJHA 3WQTA 1KFDA 5LMNF 3RBDA 4Z4GA 2LLZA 1TTHB 3RGIA 1TK0A 3CVKA 2I5JA 2B56A 3GIRA 4AL6A 1NOYA 3QICA 2OYQA 2CXEA 5HMYA 3AA5X 1WI8A 1RAIB 1RA7A 2XCPA 3BGRA 3A5OC 1NK8A 2RH3A 3IUCA 4G6VB 4FKYA 3MM7B 1S1VB 2MQOA 2XY8A 3QWPA 3EDRB 4HR2A 1FCAA 3U02A 2G2ZA 5BYSA 4OJ3A 4B8AB 4FJGA 3TWZA 4AQYJ 2NRRA 4DTUA 2C22A 1BCMA 4FJ5A 1FD2A 2CPJA 4W98A 5BREA 2LA4A 5IV4A 2I1RA 4O3OA 1EAYC 3MEDA 2P9NB 3O44A 1QVGM 1GK8A 2DRDA 4QWEA 4K4XA 5JLFA 3CMAS 1WSJA 3IR6B 1SVDA 4ZITA 4H4MA 2ASOA 3ENAA 3MWTA 3T9ZA 3L3CA 1YJNS 2VG5B 2VBYA 3VTHA 2Z8QA 4ALZA 3AARA 5KG2A 2MKHA 2FGOA 3TX0A 4DB3A 4M5DA 4X4RA 3U3GA 4AHRA 4C3KA 4JRPA 3ZZOA 4J2AA 3QIPB 4LVNP 2WFBA 3W61A 4IYQA 4M5NA 5T7BA 5CZ2A 4FWOA 5BN9A 3AVJA 2ZHAA 4PA1A 3VQ4A 5CQGA 3HP9A 3AVBA 3ZZYA 4IOBA 5KPZA 2QO3A 4MIWA 2MQLA 2Q43A 2JEGA 1RQ0A 1W9HA 4JRQA 2VPZB 3K2PA 3J80O 5IS2A 3RU0A 1XQSC 1JCFA 5F3ZA 3DOMB 4BS2A 4UUWA 3EL2A 1H3DA 3BJYA 1FFSB 1WSRA 2XYPB 3SCXA 2GQQA 4PG6A 1UW9A 3W9JA 3HK2A 4FYDA 3KDOA 3WHIA 4O0IA 2JWNA 1UVMA 1RWPB 2MHNA 3MURP 1VQNS 2H9ZA 4UF4A 3SBTA 3MMCB 3SEOA 1HNXF 3P1GA 3VQ9A 3OL9A 3NH0A 1YIJS 2JFDA 3UCGA 2YQ0A 4I0WA 4ECUA 4FJ9A 1KN6A 5I3UA 4I7FA 4OZ3A 3VQ7A 4K0KK 3WQPA 3ILJA 1ZTWA 5GMKa 4KHRA 1K9MT 1KAYA 2E20A 3CCJN 3PO4A 5AT1B 1TYQA 2OELA 2RU9A 4CGHA 4C8ZA 1NJZA 1S1WA 2HZAA 2W9AA 4A2BA 4NLDA 2CNNB 1PCAA 3RSEB 4PABA 4PWDA 4UUXA 1HYSA 4YHHF 1Y10A 2JEIA 4IDKA 1T3OA 2L3MA 2VQFK 1JXBA 3SQ1A 2JDJA 1VQ5N 3AQOA 1Q82T 4B3TJ 4P75A 5C2FA 3SUNA 3V6JA 3HSJA 3KG0A 2D3ZA 2QXLA 1JLFB 4DUYF 5B0EA 3IFEA 1W7WA 4JLHA 2IMWP 3IFRA 1IV0A 3EVMA 3G9CA 3PIPL 1FJEB 5F1XA 1XMBA 4ZPAA 4K4TA 3KD5E 2KL8A 4KH6A 3I8DA 4M3TA 2ZZNA 4FJJA 4EMDA 4IOCQ 4ED2A 4PXEA 3MM7A 2IM0A 2V69A 2PBDA 1WI6A 4JI7J 2C2DA 4KB0A 2GUPA 3ZZUA 3BUZB 3G8QA 4EU0A 5FLXO 2QLWA 5E0OA 1K47A 2P9NA 4ED8A 1C4AA 4LC9B 3FZ2A 2NZCA 1LAVA 2J4RA 2LEPA 2CJAA 1HWJA 2VG5A 3AXKA 4CGIA 3R8EA 1AYEA 3LDLA 3KG4A 2DHHA 2VWKA 5KG7A 2L08A 4Q8EA 3ZZ0A 1WORA 3BH7B 4AFFA 2E29A 3F5TA 2C2RA 3QIPA 2D0BA 2YHAA 3R6MA 5KFWA 1GOBA 3SQ2A 3EZUA 1GTHA 5D0HA 2CKWA 1NSQA 2RMLA 3PEJA 5CD4A 1K9MO 2B4VA 2JFKA 2IY5B 4J8FA 1ZA2B 2ZDOA 3EN9A 1ICEB 2W2MP 2F4VJ 3ATVA 4H4OB 2DNKA 1QS4A 4KE5A 2OANA 3R1XA 2FB0A 4LRBA 1YK9A 3DOMA 5AQQA 1RKJA 1TKDA 3NFAA 1X9MA 2V0NA 5LMUF 1VQPN 3HHDA 2X51A 4P72A 3CD5A 1Q82O 4CJRA 3L2WA 3X1LB 1I3AA 1GT8A 3P4UB 2RJZA 5IT9Y 4USWA 2HHVA 3HDSA 4DUTA 3AJ2A 3AAWB 1IBKF 4PEOA 5ETTA 1DTQB 3MMCA 1ZZFA 2J0SD 3GPAA 3CC7S 4R8UB 4PAAA 3P5TL 2V8HA 4CHZA 3FSYA 1FKOB 2F9DA 4RUBA 3HFKA 2ATLA 3CXCM 2C2MB 1CS4A 3JQMA 1ZBLA 4MDAA 3J7YU 2O8EB 3CC4S 3VVTA 2YNGB 1VRUB 4DQ8A 3AVCA 4DR5F 3Q2SC 2UUCJ 2HQGA 5B0CA 1SL0A 4N8NA 3RSEA 4P52A 4BRGA 4IO8A 3V6DA 5DDPC 3NMAA 2LQ9A 3RBXA 4ZS6A 4DU1A 3KK2B 1QTNB 2HBJA 1C0FA 2NRZA 1YJVA 1IM6A 4NLCA 5GAEU 1YJWS 2VWJA 2APOA 3IMXA 3HP6A 2KQ2A 1JLFA 3G6XA 2I7NA 1LXNA 4I68A 7AT1B 3NL0A 1FNMA 4NLTA 3SFGA 3QPIA 3UO0A 2I7PA 3IO1A 2DGSA 3JXOA 2W24A 4ZLJA 3V1RA 3SK3A 4H5RA 4P73A 3NS6A 3MI7X 2FJDB 4E7JA 5B08A 2PI5A 3KZBA 5HRSA 3K2YA 4LFBK 2YH1A 3H8YA 2CJ9A 2BJDA 4LBPA 1QAIA 1QAJA 2FYXA 1JJCB 2FLOA 1SL2A 5L9NA 2QJ3A 3GBTA 4KTQA 2XCAA 4JV5K 3BKUA 1WG4A 2HGLA 3V2UC 1GTEA 2P9UB 5J2NB 3CTRA 3CO9A 2XZDB 2KKHA 3QYYA 4OI1A 1XMOJ 1LW0B 1K44A 2V94A 1QQOA 2C3YA 2R8HA 1E4GT 4DQRA 4DR2F 3MOZA 1X0PA 2KYZA 4NI2A 4JYAK 1J5EF 1IWAA 3LAKA 1RSCA 1EKSA 4USKA 3FZKA 1YITS 1O8BA 3ZSXA 3H5UA 2XMAA 2PEBA 2QSFA 2FTRA 4ENOA 2GGPB 4KPCA 3HSZA 3I9V9 2K06A 4DV6J 1S76D 3IMQJ 2XC9A 4MO4A 3NH1A 2RDDA 2Z0GA 1U25A 4URSA 2O1PA 2IJRA 3R5GA 1TL1B 5C2DA 2BRKA 1RP5A 4DR1J 4JD2B 3MCNA 4ZVFA 4BR2A 1GMWD 1S72S 4H4OA 2ZH9A 4YQWA 5HRRA 4CEBA 3I55N 1KVKA 3PM9A 2IHR1 3T7ZA 1EZZB 1HNVB 3QJPA 1Y97A 2W9BB 3R5BA 4NE9C 3VVUA 1NGHA 2X1FA 2GMJA 1R6YA 4BWMA 1DTQA 4BE0A 2J8SA 4PPDA 4R8UA 5KQDA 1FE0A 4QWBA 4DL0C 1BCOA 4IG0A 5DQIA 2KH9A 4KFBB 1ZAVA 1HR0F 1FKOA 1EWQA 3EKUA 2HFSA 4URGA 1HNZK 4ECVA 4DR3J 3N4PA 5DK5A 1K8KB 1TUWA 3MCPA 2O8EA 2DCLA 1C1AA 2YNGA 2GCFA 1VRUA 3VEXA 3M8ZA 4OO1J 1NXIA 3TUZC 3EZ5A 4K5RA 4PQAA 3AY9A 1FERA 2AD9A 1XNRF 4BDYA 2XMJA 4ZVHA 3RUBL 3KK2A 2XG8A 4NYPA 3TEGA 3D2FB 1ZS6A 5RUBA 3I0SA 2XGQA 3U9ZA 2HPUA 2A18A 4NXNK 3ZCMA 2C2EA 1SQFA 2R8KA 2FVCA 2YPZA 3J7Z5 2HZCA 2RKIB 3QEPA 4LQ9A 1RK8A 1S6QB 2IDEA 2JRSA 4KY3A 4B1XB 5KFCA 2HOEA 4CCHA 1SBRA 1PKUA 4I9LA 1U6FA 2C2ZB 2AF6A 4CJSA 4Z4IA 1CJTB 2Q6BA 3FJ2A 3QRQA 2HNDB 4ECTA 1ZC6A 1IM4A 4Q0BB 4CZIA 2DR9A 3OTOK 2P9UA 5J2NA 3F44A 3S3NA 4A2AA 1OYDA 4MKBA 1LW0A 4ISEA 1NDCA 4RLEA 4CEOA 4PQUB 3DN9A 1N34J 3CHWA 5AQKA 3GIIA 1K1SA 2KZZA 4C2MA 1R59O 3O9RA 5J2QB 2DPIA 2WOMB 2Y3YA 3W63A 1T7PA 1WOSA 4QQBA 4Y1CA 4CZJA 2GGPA 3JTNA 2G8KA 4AT1B 3KHYA 4RUAA 2G8VA 3TQ1A 2YX1A 5LM7E 4PCQA 1IVZA 3EVOA 5CZ1A 5AQRA 5H1SV 1TL1A 1ZYQA 4JD2A 1UPMB 3PV8A 4P74A 3HYFA 2QMWA 3G82B 4DG1B 1QHTA 1H72C 5KFQA 2LVWA 1TUYA 3CM5A 5JLHA 3LDOA 1HNVA 2BEFA 3H90A 2P51A 4CZKA 2E88A 3F41A 3D9BA 3SMPA 4R5PB 2W9BA 4OYAA 3CI5A 3NS7B 1LW2B 2VFSA 3VHQA 3AA2A 3M3ZA 3OYCA 2KHOA 2E2NA 4WFBL 3W2WB 4DR4K 5DM6Q 3QESA 1IG8A 4JBCA 4QCLA 2HBLA 4CH0S 4KFBA 3RW6A 3AVAA 1URRA 4CZCA 2HZVA 1G1XA 3LDSA 1K8KA 1VLOA 1U1MA 1RA6A 3UD4P 3DAWA 5DETA 3Q22A 1R0BG 2NXJA 1S79A 1FEHA 4J9NA 2P2CB 3C15B 3EYZA 5F8HA 4ANEA 5KG4A 2G0CA 4CFAA 4QYZJ 3V1QA 4Q8FA 1FXLA 1RT7B 4A62A 3D2FA 3VQEA 1GQEA 1BQNB 3KLGB 3VV2B 4NYZA 1B70B 2X78A 4OKJA 3PG9A 1PJ7A 3R7BB 2UP1A 3FZMA 3V5RA 1U6BA 2RKIA 2DXEA 3GZ7A 3AVNA 4HKQA 1S6OA 5F0UA 4RBUA 1S6QA 4QR2A 4MDBA 1BQXA 3QJLA 3EZOA 3UE2A 2PMWA 2DGQA 1UVJA 2O3DA 2CIMA 1X4FA 4ED6A 2CGLA 3I5BA 1V5VA 4OX7A 1QHAA 2DNPA 3GONA 4YR3A 3AGRA 1H6KX 3HSDA 3CCSN 4E98A 1RBUA 2MXYA 5HP1B 1LOUA 2VPYB 4MLEA 2AA4A 4X65F 4KH0B 1RWKB 1B7FA 3CDWA 4LF4J 2UXDF 3KLVA 4ICLB 3PX0A 4IRDA 4ITSA 4Q0BA 1H2TZ 2OEMA 5EN1A 1N33F 2KU7A 4HHJA 1KAZA 5JXSA 1Q1KA 4Y2KA 4PQUA 2AZ1A 2ZNZA 1JJ2M 2RU3A 1OJ4A 4HT7A 4X4UA 2P9PB 5J2QA 2WOMA 3MUTP 3WNEA 1IN0A 1HBOB 5IWAK 1T3NA 2Y8YA 3RR8A 5AQOA 3V1OA 4KJIA 2Q79A 2JNJA 4YDUC 3VEZA 4DX8H 1TL4A 5CXTA 3NMRA 4JI4K 2FC8A 3EE8A 3G82A 4QZVB 4DG1A 1HNWK 3RRGA 4IUFA 2G4BA 2ACMA 1HBUB 3UD5A 3VEWA 1V3RA 1PGZA 2KDOA 4FWKA 4QIGA 2HHTA 3IAYA 2KG0A 2B3TB 1BUPA 5E26A 2DHSA 1FXXA 3HM8A 4R5PA 2QKBA 1LW2A 4EO6A 1KR4A 4FBTA 3W2WA 3WIVA 4XTTA 3D66A 3AJ1A 1NGJA 1B4SA 2AX0A 1X5OA 4CLZA 1U8WA 3W3DA 1U48A 2G8IA 4BQZA 2JJ4D 5T7LB 2RHSB 3ZSRA 3D1QA 3GFZA 1WSFA 3KUGA 2QT7A 2CQGA 2E1PA 5C12A 4H0TB 3Q8UA 4CZGA 2LECA 3C15A 1XMQF 1RWNB 2H48B 1IKYB 5GINA 1RT7A 2XO6A 4F0KA 3IGVA 4JKFA 1BQNA 3KLGA 2W7PA 3NY0A 1NDKA 2HURA 1NPRA 2V9WA 3JTOA 4P2FA 3US5A 4EP4A 2NRTA 1RE1B 3W9IA 4J90A 4FF4A 1YTYA 3T1YK 3NS5A 5KFKA 3EEQA 3H08A 4DV3K 2YNHB 3H3OB 4RW7B 1FWLA 4K4WA 3MXIA 1FFGB 5H9FJ 3JTPA 2WHOA 1WOPA 1I5OB 2P5GA 5HVGA 2E1RA 1RB0A 2E2PA 2VBZA 4MK9A 5U47A 3O3GA 2ASLA 5F9NA 5F8GA 4LSZB 1HQ2A 4JKCA 4EUVA 5HP1A 3UDCA 2VBXA 2R3VA 4OLOA 4OZ5A 3ILOA 4CK2A 3VF2A 4ELVA 3GYNA 3P6YC 3MDQA 3G6EN 3C3LA 4ICLA 4DU8A 1KC8O 3TVYA 3SJJA 5AQFA 3QT8A 2NNWA 1OY9A 3NHGA 1VQ8S 5IT0A 4H0OA 3PYDA 2GJIA 4WK3A 2XNRA 4LSLA 2E6LA 4ZP7A 2V67A 2GC8A 4FVCA 3SNNA 4YR0A 3N6MA 2GV1A 1N0UA 2P9PA 4CT9A 1KSPA 1HBOA 1CJKB 1F3VA 3G71S 1TMMA 2LQBA 3LZJA 2KG1A 3ENOA 3OVNA 2EFQA 1NDLA 3EXYA 1OYEA 4JI5F 4Z0UA 1NB7A 4YHHJ 4J9MA 2R4FA 3U1MA 2ZWOA 3TABA 1U0HB 5A0YB 4J2BA 4HTJA 4TY8B 3GIKA 4PKHA 2GVZB 2ITMA 1HBUA 4KAZA 3RTVA 2QE5A 2AGPA 4FP9A 3VQ5A 3TJAA 2WSEC 5GAHP 1KTVA 1XTZA 2O4GA 4WKRA 1S4EA 4KRFA 3ZZTA 3TR5A 3R1HA 4OPKA 3M2UB 3P45B 3W1YC 4WKYA 4FYXB 3MN7A 3PJWA 2XS2A 1NPKA 3PW5A 2ZBPA 1FFWB 2NZ4A 4X84A 2NCKL 2R2SA 2WBRA 3TUIC 5T7LA 4FLUA 3GG4A 4FVUA 3CETA 3WNFA 4LF7F 2VG6B 1NHVA 4OX9K 2EK6A 4KREA 1S0NA 5AJ3K 4USMA 1XR7A 2FLPA 4Y2IA 3KMSA 3CMQA 2CGJA 2O8FB 3R27A 3POTB 3L4BC 2LMIA 2QA4S 1IKYA 5I42B 4R79A 5KT2A 5BXIA 2X1GA 3BS9A 3HO1A 1NNEA 1URNA 3DLHA 3O8WA 2VIHA 2FUG9 4ZIWA 5AXMA 1T9YA 4CIGA 3VETA 1RBAA 2HHWA 3CCES 1TV6B 2YPYA 1NOZA 3G8SA 4ES3A 2V4QA 4YOEA 1P8ZA 2YNHA 4W5NA 2RQKA 2OAUA 3Q7CA 5B0BA 4RW7A 4PKIA 4DV4F 3H2UB 2DEIA 4LBHA 1D9DA 4WZMA 5ELZA 4BC4A 3CMAN 3PDNA 3H1VX 4Z2XA 3V6KA 2RS2A 3B6BA 4LRAA 1VQ6S 5F2RA 4J9UE 1U1PA 1YJNN 5EHHA 3QERA 2DH8A 1S0OA 3SQ0A 3TVKA 2YHYA 2ZKUA 2UXBJ 2V2QA 4U95A 2LQ5A 2LXIA 2MHEA 1Q0NA 3MM5B 4YR2A 4AHTA 1LWEB 3PIOQ 4BDPA 1IBKJ 2NRXA 5C15A 1S57A 4NCGB 1S1XB 1T9VA 4DQPA 4ER8A 2FJEB 2HBKA 5K9FA 3LAMA 1VBKA 4RUCA 4M3UA 4EZ9A 4L3QA 3ZLJA 1DT9A 5KFUA 2HWTA 3JSRA 1JB0C 2P1JA 2V34A 3J7YI 4B3RF 2LDIA 4E7IA 3IS9B 4O3QA 4BRHA 3AQPA 2IBOA 4WTOB 3OYEA 2CG8A 3CG7A 1CJKA 5IT9O 4K2XA 5LSRA 2ROPA 4I67A 4LH4A 2BQRA 2ZH3A 1U0HA 5A0YA 2DNGA 3CIMA 4DR6F 1ILYA 2BW7A 1UVNA 4JI1F 3MCSA 4TY8A 2YCHA 2GVZA 3QRPA 3CCMN 2OUGA 4KYZA 4NL5A 4EBCA 4I6WA 3S01A 2OMOA 1VQNN 3NDKA 4GKJK 1SH3A 3OBYA 2HB5A 3HMJG 3D45A 1GMVA 2DGUA 4WF9Q 1YIJN 2OPQB 1X60A 5F8MA 1JJHA 3CCWA 2IVOA 3PCOB 4CEAA 1SQGA 3RYLA 2CFXA 3M2UA 4F3MA 3GR0A 3FC9A 4DMNA 4UOGA 3SFUA 3F56A 3AA3A 2UUAF 1U2FA 2J9DE 4WPAA 4L73A 1H0HB 2KB2A 3D6HB 5E3PA 2CNLB 3P38A 1ZBUA 1WSEA 1A7GE 1UP1A 1GLJO 3R5AA 3VENA 5IC4B 5KG5A 3KK1A 1GMWA 3TAQA 2O8FA 4BDZA 5GIOA 3POTA 4HYKA 2BKNA 3VEVA 5I42A 2FXUA 4IEEA 1JLAB 2DY1A 4MKYA 3DFEA 4DR2J 3FE1A 1JLGB 3ZSVA 4HCBA 4X66F 2W41A 2YXLA 1RHKB 5GADU 1J5EJ 2AEJA 2I38A 2YHBA 1UZHA 3D0GE 3Q8PB 3JXUA 1ESVA 5BRFA 1TV6A 3FR0A 2G13A 1NJIT 4KH5A 3LPEA 2QA1A 4O0JA 4BG8A 1FXDA 2QWQA 4C8YA 4BGAA 3TA0A 1FTCA 3CULA 4M5JA 3GJTB 1NHKL 3M6GA 2A40A 4CJPA 2ZM6J 3OBWA 3UFCX 4WU2A 3LDPA 4H5WA 4ZP8A 4KTWA 3AV9A 2F7VA 3DXSX 1U4BA 3MF5A 2PFDA 1WEYA 1FXRA 3RB0A 3TSUA 3VA0A 2XZTB 2E5IA 2MY7A 3A3OB 3MM5A 5D4LA 4E3SA 2J9CA 1LWEA 3BEXA 4TXSA 1JJ4A 2WVBA 2DVIA 1ZAWA 5BN8A 3TAGA 2AJFE 2FF6A 4NCGA 1S1XA 1S48A 2Q0UA 1WKKA 4RBVA 5E41A 1S6UA 4IJAA 2HHQA 1RBVA 3LPUA 1FRIA 2KJVA 1QQMA 4FS2A 3T1AA 4P2XA 3IS9A 4YS2A 2G8WA 1GEHA 4B1UB 3BB5A 1CLQA 3G4SS 4R25A 2IYGA 3D7EO 1NGAA 4NB4A 1J9AA 3ETMA 2ZOGA 4X4NA 4ZVQB 5KFRA 2IS3A 4LRFA 2FHOB 4I2QA 2UUCK 2CJKA 3PSFA 1LWXA 2HNZB 1TQLA 3R9PA 2AW0A 4IH6A 3MPYA 2KO1A 1VSHA 4CF2A 2VGMA 4GC7A 2A1RA 2VF3A 2B43A 1HFEL 2Q1LA 2W2NP 2GV9A 2POKA 2DNQA 4MIBA 1ASVA 1EIYB 3HPHA 3NEKA 3BGOP 2VQEF 4EBDA 4F2SA 3CC7N 3HI0A 5CA5A 3R2CJ 2KVIA 2R2TA 1OQ3A 2VCPA 2OPQA 3CNQP 4C6AA 3QAEA 3KHGA 4BR4A 4HCCA 1HI8A 3VQQA 5AQLA 1Z1ZA 4G9ZA 4C23A 2BX6A 1UZDA 1N56A 2AYEA 1K6YA 2G8FA 4IFEA 2A0FB 1LOTB 1NJIO 2IIRA 2B4OA 3EGVA 4CERA 3CC4N 4NLSA 1YJRA 3OTDA 4ZTFA 1VBXA 3HL8A 4HI1A 2GEMA 3M7VA 1BISA 4YY3F 1UA1A 2GHVC 3VAHA 3I82A 3BM7A 1UFWA 4LFAK 1SXLA 1EWRA 4UOFA 4C7QA 3H5XA 3THWB 1Q8KA 2IVYA 4AHCA 3SSSA 5GIPA 1YJWN 5HBMB 2CGKA 3FK4A 3V9SA 1IBLJ 3ITHB 5F3TA 4IFYB 4Z4HA 1NMNA 4DQSA 1L3SA 4DFKA 1RTZA 1JLAA 3SAFA 2XWYA 1JLGA 4LR8A 3BH6B 1YVNA 2FZGB 5A76A 4KGXB 1WSGA 2DRBA 3EMTA 3OXLA 5GAEP 4WP9A 5KFTA 3KUHA 4Q44A 1RADB 1FRKA 1Q7LB 2JWLA 1T0TV 2EEYA 2CQHA 2E7XA 3L2VA 2W7AA 4B3MJ 5ITHA 2Z58B 1FDNA 3MPDA 1S5JA 4FXWA 3H59A 4QJVA 4B3SF 3I4HX 3J80U 1HW9A 2DGOA 4X64J 4XH5A 4FNIA 1FWKA 4CO2A 4GRSA 2JOQA 1GLLO 3CC2S 4XIUA 4ANCA 5C25B 2MZQA 1VSMA 1YITN 3CIPA 4WIQA 3OYHA 4EHUA 1U2VB 2BOAA 3DLKB 2DNNA 3FBBA 1WB9A 2IAJB 3GE1A 3SZ2A 3BO3A 1R0AB 1JK9B 4WIIA 3C6HA 1FEEA 4C97A 4DR3K 1S72N 4FJNA 3O2IA 2BE9B 2MKYA 5KFDA 1P1LA 4ILMA 2WVCA 4MK7A 1K8AT 1HQEB 3BBBA 2NREA 2HNZA 2DFEA 1RDRA 2R8GA 4WXOA 1D09B 3WQUA 3GV5B 5H1SQ 1H1VA 2BV3A 3ZZPA 4GVBB 4FM2A 4LF5K 2WVDA 3KLHB 1RTJB 3Q86A 2MLXA 4F4WA 1QD1A 4WK1A 4QAGA 3N0VA 3ENQA 2O8CB 2M52A 2HVHA 2V7ZA 3B54A 2E4LA 3LUYA 1EARA 5BR8K 5M1PA 1YLXA 1BA1A 2V7YA 3QEVA 4ZKAA 4BE2A 1C6VA 2F7TA 4CDIA 3KK3B 2HLUA 1IBMK 2A3JA 4ILJA 1KVCA 1VSFA 3QT7A 4JK7A 1RT2A 5KFNA 3THWA 2Z30B 2MQMA 4KHPF 4IO9Q 5HBMA 3PHTA 3OFEA 3PYFA 1N33J 4IJNA 3ITHA 4IFYA