1JLEA

Crystal structure of y188c mutant hiv-1 reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
549
structure length
524
Chain Sequence
PISPIETVPVKLKPGMDGPQWPLTEEKIKALVEICTEMEKEGKISKINPYNTPVFKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGANRLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 133
structure length 524
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jleA05
3HPHA 3EY1A 5CZ1A 4NRTA 2DTUA 1EETB 3MEGB 1KRPA 3SFUA 3DRPA 2XI3A 1TK5A 1BCOA 5KFXA 5CY4A 5KFDA 1NKEA 4ICLB 3IAYA 4ELTA 4WZMA 3HSTB 4B9UA 1RT5B 3NGDA 3KHGA 3OYKA 4PA1A 3MEEB 3F9KA 4YQWA 1WSFA 3BGRB 4CEEA 3V6HA 3HVWA 3QEIA 2JEFA 4F4ZA 4LQ9A 3Q8RB 4ZP6A 4AHVA 4N41A 4OKKA 4CGHA 2Z1JA 4AHRA 4K50A 1FXXA 3BSCA 1K1QA 3P83D 1KFSA 4ECRA 5EDWA 3RMBA 4HUFA 1EX4A 5KFYA 1YVFA 1SH3A 2ATQA 4B9VA 4CJ5A 3LZJA 1RBRA 5KI6A 3TAMB 4PUOB 4TY8A 2HHSA 3N6NA 3SFGA 4RNMA 4DFMA 2OPPA 3NDKA 2G8IA 5E41A 4W5RA 5I42A 4ZP8A 2HNZA 3I5CA 1T3NA 3AA3A 4NLSA 1K1SA 4K4UA 1WAFA 3U3GA 2AX1A 1S6QA 2KZMA 4F4XA 3FQLA 1TAQA 2XGPA 3KHRA 1L5UA 5T14A 3ULDA 2VA2A 3IGNA 4M3RA 3KK2A 3BR9A 4ELVA 3QGGA 5KFQA 3OL6A 1NKCA 5C25A 2QXFA 3QIPB 3V6KA 4DU1A 2OPSB 3CDEA 3QZ8A 3PX4A 1D5AA 2HNDA 3QLHB 2FJVA 1RBVA 3KD1E 2BRKA 5F8JA 4RU9A 4YP3A 1RDDA 3VQDA 4PUOA 3C6UA 3I0SA 3RTVA 4ID1A 3BJYA 1LWCA 3HVAA 1VSMA 2ILYA 4M41A 3A2FA 3OJUA 3V9WA 3G6YA 5JS1A 3AVMA 2R2RA 1ZETA 4X2BA 4CFBA 1GOCA 4CJUA 1JLAB 1RT1A 4KB7A 4MIBA 3OYDA 3GIMA 4IR1A 5FRNA 2B5JA 4FLWA 4CHOA 1J5OB 3ICLA 3PHEA 4YR0A 3Q8SB 2XY8A 5EWEA 3I5BA 3QIPA 3HHKA 2C2RA 3V4IB 4FJKA 4Q5VA 3QESA 4M3TA 5FDLA 1RBSA 3L8BA 2IM2A 1C1CA 4FYDA 1HYSA 3NAHA 3M9OB 3C6UB 3OHBA 2R2UA 3K58A 1RCHA 4FCYA 2ITGA 4OLAA 4KSEB 3H4DA 4YMEA 1C6VA 2D5RA 1S9EA 4NLPA 2RF2B 3JSMB 3PV8A 3FFIA 4FJMA 3KLEB 1ZTWA 3M8QA 3AVJA 1ZBFA 3KK1B 1HPZA 1VSDA 3TQ1A 4CHQA 2GV9A 2RDIA 4ZVHA 3KD5E 1TVRA 1L3SA 4TYAA 1NHVA 5KFSA 2YHBA 2RDJA 3MXJA 1L3UA 4QAGA 3N6LA 4NLUA 1LAWA 1VSFA 4MKAA 3GIJA 2W8LA 3O3GA 4NCGA 1C1CB 1UA1A 4ZTFA 5JXSA 5KFRA 3PR4A 3QO9A 3ZSVA 3NF6A 3V9UA 5F8LA 4H54A 1B9FA 3DLGA 1VSJA 1LW2A 3JSMA 1UA0A 3IRXB 3WNFA 2FBYA 1K6YA 3NFAA 3P5JA 2E9TA 4H4MB 4DTUA 4TXSA 4CF8A 3OVNA 1QSLA 2YNHB 5F9NA 5F9LA 3L2UA 3DRRA 1HQUB 3WNEA 1JKHB 2R8GA 4DTJA 1DTQA 2CKWA 5KFIA 1WNEA 4PY5A 5C5JA 5J2MA 4W5TA 4RW9B 4RW7B 3DLEB 4FS1A 4E7JA 1ASVA 4E1MA 1MU2A 2O4IA 4O0JA 4XPEA 4IG0A 2V0NA 1ZBIA 2R8JA 4Z4EA 4ZHRB 1N5YA 1JXEA 2J6UA 2VG5A 3MFHA 1LW2B 3BDPA 2W9BA 5HRRA 4NYNA 3RRHA 4OKJA 1UWBB 4I2PA 4NLGA 3L3VA 3KLHB 2ALZA 3RAXA 5KFZA 1VSEA 3QEVA 4CEOA 3BSAA 4DQRA 3IG1A 1IKXA 1TL1B 2UUWA 1S1TB 3HKWA 2IBKA 4ZPBA 4LSNA 2YNIB 3HT3A 1U48A 2RPIA 2RKIA 3RB3A 3QNNA 2F8TA 2KZZA 1RYSA 4CF2A 4G1QB 3NAEA 4DSKA 4BDYA 1IO2A 2HNYA 2X6SA 3FQKA 4CJTA 1S97A 4CHNA 4I2QB 1SUQB 5HP1A 4FXDA 2KW4A 4FJJA 3G0ZA 2IOCA 3PX0A 4YFUA 3PR5B 3PY8A 2VG6B 1KHWA 1IKVB 4DFJA 3OS2A 3NGYA 2FVCA 1SH0A 4KBIA 3BSOA 3OHAA 1VSHA 4XPCA 4O55A 4F4WA 2X6NA 4R8UA 1S1TA 2O5DA 2HHUA 3LAKA 3DRSB 2YNIA 4RNOA 1S49A 1HYZA 1NK9A 4IOBA 4AHSA 4CEZA 1QSYA 2ASLA 1X1PA 1RT6B 2IS3A 4DSLA 4NZ0A 4IH6A 1RA6A 1QQCA 3KOAA 1XHXA 4IFYB 3OYGA 4FM0A 2R2SA 5C42A 1B92A 4CESA 4J9NA 3KHLA 3JYTA 3H5SA 5HLFA 4J2AA 4PWDA 1BQMB 1J9AA 2BE2A 4RW8B 5EWFA 3MXMA 3NBPA 4Q0BA 3V6JA 4LQ3A 1JLGB 3LZIA 4IDKB 3O3FA 3PO4A 2FBXA 3EYZA 1S0NA 4TQSA 5FROA 3DRSA 4JS5A 1SL2A 1BGXT 1WSHA 4F4KA 3ZSZA 3HM9A 4O3RA 4FS2A 1IKYB 2KTQA 3DMJB 3HJFA 3HVRA 4FLZA 2ZD1B 1JLQB 4B8CA 4WFZA 3OS0A 4IQXA 4MIAA 2HHTA 4LSLB 4CGDA 2IJFA 3HVTB 3DM2A 5KFTA 3OYJA 1S6PB 5KG5A 4G3IA 5SZTA 4J9LA 5J2PB 4W5NA 3T19A 4FLVA 3OYAA 4KHNA 4QWCA 3AV9A 5KFEA 4CGGA 4RUCA 4DQIA 1S1UA 1NHUA 4HHTA 1C1BA 4O3SA 4FJHA 2OZMA 4DSEA 4KO0B 1BQNA 4WXOA 3V6DB 4Y1DA 4IG3B 5CYMB 4K4ZA 4K4YA 4NLDA 4IBNA 2JGUA 2VG7A 3RR7A 2C2DA 1S48A 3LWMA 4KHMA 3SUPA 1SV5A 2E9ZA 3H2LA 3QIDA 2D41A 2FVSA 4KREA 1HNIA 1S1VB 4N56A 4JV2A 1U4BA 3LPUA 4DQPA 1S6PA 3DDKA 2XC9A 2GC8A 4ECVA 4J9OA 4KV8A 1BISA 2XHBA 3FDSA 2J6SA 1CXQA 3SV4A 3UPFA 4KKOB 3CJ5A 4JRPA 4KPYA 3H5XA 3K5OA 3AO1A 4B3OB 2JEGA 3KLFA 3L2RA 1WSJA 3T3FA 3AO4A 3IGVA 3B6OA 1BQNB 4C8NA 3MEGA 1C0MA 3MXIA 3DYAA 3V6DA 3HP9A 1BI4B 1JLFB 1HNVA 4ICLA 1S9FA 2VG7B 1JXBA 3ZT4A 3RWUA 2DPJA 3HK2A 4Q45A 1N6QA 4RW4A 4CEFA 1FK9B 4O44A 4WFXA 3VQQA 3QERA 4FW2A 3T5JA 1X9MA 1HMVB 3AVFA 4CEAA 4ELUA 4DQQA 1J54A 4Z0UA 2IC3A 5DG8A 2FVPA 3ISNC 2J6TA 3UR0A 3LP3A 3PW2A 3U3YA 3V9SA 1XR6A 4M3XA 4ZP9A 2OPPB 2R8IA 3GYNA 1KLMB 1S1WB 5HRPA 3TI0A 3FRZA 4FLYA 1VRTB 4ECTA 4EYHB 4MK8A 4CJSA 1OS5A 3L3UA 1TL3A 4W5OA 5DQHA 3CM6A 2VA3A 1RBTA 1JLEA 1RT7B 2ZKUA 3KJVA 2V4RA 2WOMB 2JC1A 5KT7A 4WYLA 4CIGA 3KTQA 4DWIA 1DLOB 4K4WA 2HNDB 4Q8FA 3RBDA 1IG9A 4DSJA 1QSSA 4KFBB 5J2NB 4PQUA 2WTFA 3S9HA 5HBMA 3C94A 4M3UA 4DL2A 4Z4IA 4U6PA 4ECYA 1ZYQA 4BDPA 3CG7A 1TL3B 4FLXA 1C2PA 1BIUA 4BWJA 3MFIA 1I6JA 3RR8A 4ED6A 4FM1A 4I7FB 4ED3A 1X9WA 1NK4A 4FJ8A 3H5YA 2DY4A 4F2SA 1RBUA 1TK0A 1MMLA 3KK3A 1TQLA 5DGAA 2W9CB 3DI6B 4B9TA 1TP7A 1B9DA 3CVKA 4ID5B 3AA4A 1DLOA 3K59A 1SL1A 3AVGA 4CHZA 1X9SA 1ZTTA 3VQ4A 4QW9A 2IGIA 3KIOA 4IRCA 3UQSA 2HB5A 1WNSA 1KSPA 4M94A 4ZVFA 3V9XA 4CFCA 3MR5A 3H59A 4AHCA 1N4LA 1DTTA 1Q8IA 4Z4GA 3DLKB 2HNZB 4EYIB 3KLEA 5KFJA 5KFKA 3NE6A 4KHSA 4ED2A 4EZ9A 4AH9A 1NJZA 3AVAA 1A5XA 4DTMA 3MR3A 4FJGA 3CJ0A 2W8KA 3PX6A 4K4TA 3RB0A 4TN2A 2IM1A 2V4QA 3DI6A 2HAIA 4FVMA 3V1QA 3L2QA 4DS5A 1U45A 2PYJA 3SPYA 3P1GA 1RDBA 3NL0A 3S3MA 2BDPA 2IAJB 5L1KA 3LALA 1RTDB 4CFDA 3QLHA 3ZT1A 2XWYA 1KHVA 4M3YA 5KFNA 1QTMA 2FLLA 1RT3B 1A5WA 2FC0A 2G8VA 4W5QA 3H40A 3NH2A 4WZQA 1TKZB 1KCFA 1ASUA 4UQGA 1S1XA 4CJLA 1RT4A 1YTAA 4DS4A 4IFVA 5KG6A 1XI1A 4KI4A 2OPRA 3BQ2A 3QEWA 2G8UA 1HQUA 5KT6A 3SI8A 4FBTA 5CYQB 2XY6A 3E01B 3VN5A 4ED7A 3V4IA 2Z1GA 4FJLA 1JIHA 2BQ3A 4DTPA 4FBUA 4J9KA 3NGZA 4C8MA 3WNGA 1HARA 4ECXA 1RAJA 3AO2A 1BCMA 4K8XA 3SUNA 3PO5A 4EEYA 4ED0A 4ZHRA 4KHRA 2PZSA 3NH0A 3ALYA 3FFIB 1CZ9A 1RT5A 1S1XB 1NK8A 2HHXA 2F8SA 1FKPB 3K2PA 4M3ZA 1C0TA 4LH5A 4KAIA 1SKSA 4DF8A 5DK5A 2XGQA 2NUBA 1IKXB 1RNHA 1BHLA 4ECZA 4O3PA 1HRHA 5JS2A 3LP1B 4E7IA 5KGWA 4NCGB 3U6FA 3OL7A 2YNGA 2YKMB 3NHGA 3TR8A 4DMNA 1IKWA 2WB4A 5I42B 3CDUA 1JLCB 4EO6A 1RTIA 4DG1A 4KTWA 1HJRA 2AJQA 1TV6B 5L1LA 1D9DA 4NYZA 1RTHA 4C8KA 2D0BA 4O4RA 3NF8A 2ASJA 3D28A 3CDWA 3IS9A 4JLHA 4CJVA 3CFOA 2YNFA 4F2RA 2W42A 2DFHA 1Z25A 3QGIA 4NLQA 5KFPA 2JEJA 4JS4A 4NLWA 2DFFA 4QW8A 5KFWA 3KKRA 3VQEA 4R5PA 3DLEA 2AWZA 2FLNA 3I0RA 5KFMA 2XCAA 1RT6A 2AU0A 5KT5A 1REVB 4OPKA 3UIQA 4XIUA 4AILC 1N5YB 3GQCA 1JLAA 3TAPA 1TK8A 1U47A 2B5JB 2ETJA 4QCLA 2HVHA 1W9HA 1F21A 4DTSA 3C6TA 3KHHA 1QE1A 2R8HA 3CQ8A 3T5HA 1KVAA 4IDKA 4F8RA 1N56A 3OYHA 1TL1A 5FDLB 3SYZA 1BL3A 1UAXA 3NAIA 3D0PA 3HO1A 4LSNB 2V9WA 4KHQA 4DSFA 3CFRA 4DL7A 1C0UA 4ZP7A 3QIOA 5T7BA 2W7OA 2RF2A 2F8EX 2BQRA 2YV0X 3DMJA 3VQ5A 4DF4A 4FW1A 3THVA 2D0AA 3KLGB 4E7KA 4N5SA 4FJ7A 1JLQA 4E89A 4CIFA 2D0CA 3V1RA 4TY9A 4FJNA 3HVTA 3M9NB 4HUEA 3NKYA 3O4NA 3ISND 4K4XA 3CJ3A 4FZXC 1RDCA 3UDLA 3ASMA 2HMIA 5DG7A 1L3TA 5KT2A 4B9LA 4LH4A 4EBEA 4IKAA 4FK4A 1IH7A 1KTQA 1TKTA 3NF7A 4DFKA 2EX3A 3B6PA 1RDAA 3QO9B 4IH7A 3DLGB 4MH8A 4O0IA 3IRXA 4IG3A 5CYMA 3CWJA 1GOAA 2OPQB 3K57A 3KLGA 2E6MA 3QETA 4O4GA 2FVRA 3LP2B 2YNHA 4CECA 4DTRA 1SV5B 3JYTB 4HTUA 1HNIB 1S1VA 3KLIA 3SNNA 1JKHA 1WSIA 4CEQA 1RTJA 2BE2B 4DLEA 5L9XA 3HXMA 1SKRA 1VSLA 1JLGA 4O3NA 4OGEA 4DEZA 1LV5A 4FK0A 3CJ4A 4URQU 4RW9A 4RW7A 5KG0A 4DL6A 2WCXA 5J2QA 4URGA 1T05B 4F50A 2F96A 1EP4A 3CFPA 3HPOA 1TAUA 2ASDA 5DQIA 3AVKA 4BACA 2G8KA 4F4YA 3QEXA 2W9BB 2A1SA 2KFZA 1VRUB 3MEDB 1N6QB 4MK7A 4E7HA 2XO7A 1R0AB 2BQUA 3KLHA 1LWFB 1NNDA 5DLFA 3KLIB 4Y2AA 4M95A 4ZPDA 2XI2A 4HCCA 4CGFA 3EZ5A 2QKBA 4CJWA 1JLBA 3TAQA 4OLBA 3SJJA 5F8IA 2G8HA 5J2QB 3VQ8A 1NK6A 1T05A 1QHTA 3SI6A 4HCBA 3G6XA 4O3OA 1KVBA 1L3VA 2YHAA 2WONB 4Z4CA 3SUQA 4ZTJA 1XWLA 3NF9A 2AQ4A 4B08A 4F3TA 2ZE2A 2Y1JA 5F8GA 2BANB 4ED1A 4CK2A 2P51A 4EBDA 3KLVA 4DL3A 1EXQA 2XY7A 1LWFA 5KFBA 1RT7A 1W25A 2PYLA 5HROB 1ITGA 2WOMA 3PUFA 3AA2A 4CJFA 2FLPA 1TKXB 1JLBB 4CEBA 3H08A 1CZBA 4O3QA 3NMAA 4DTXA 4IKFA 2LSNA 4KFBA 1CLQA 5J2NA 2I1RA 2JEIA 5C24B 4ZVGA 1KVCA 1XC9A 4WYWA 2WONA 4IFYA 5C42B 3VA0A 3ITHA 4CCHA 1YTUA 3DYAB 2UUTA 2FJWA 1BI4A 2ZE2B 4BE1A 4NCBA 2E6LA 4I9LA 4J2EA 3LAMA 5JUMA 3SV3A 4RW4B 4Y2CA 4JV1A 4I7FA 2ZQBA 4NLTA 1YVUA 3KK3B 3QNOA 4GC7A 5KT4A 3NGIA 5HROA 4BE2A 3K5MA 3PJXA 2OPSA 4BWMA 4DL5A 1S0MA 1U49A 3VQBA 3S3OA 3RB6A 3M8PB 4KAZA 1HYVA 2Z1IA 5C24A 3Q8PB 5DLGA 3CYMA 3VQSA 3K5LA 4LD0A 2B6AA 4FK2A 4TLRA 2X74A 4NRUA 5KFUA 3D45A 3ITHB 4TQRA 4GMJB 2GBZA 4DTNA 3O4QA 3RB4A 4J9PA 3PW0A 4DSIA 1RT1B 1JXLA 5K14B 5J1EB 4RNNA 1LAVA 1WLJA 4CERA 4AHUA 2AX0A 3QINA 5KG2A 3AO5A 5CZ2A 4HUGA 4BE0A 2FJXA 4J2DA 4NLOA 3KJVB 3E51A 4RNHA 4H4OA 5EWGA 3SCXA 2ILZA 1RTDA 1JL1A 1C1BB 3M8PA 3I8DA 1HYSB 3MAQA 1EETA 4J9SA 4CJKA 3ZSYA 3DRPB 1D0EA 1O1WA 4URSA 4QPXA 4DQSA 5KFVA 1TGOA 5L1IA 1GX6A 1RT2B 2BRLA 4KHUA 3OYCA 5KFGA 2X78A 3KKSA 5KFCA 1T8EA 1ZBHA 4IRKA 2AGQA 3TAEA 5EUHA 3ZSQA 3KK1A 4Y3CA 5I3UA 2UVWA 4HKQA 2KFNA 5J1EA 2OPRB 2UVUA 2D3ZA 4WE1B 3DOLA 4MFBA 3H5UA 4DLGA 3TAGA 5D3GA 3ZSWA 4CJ3A 4CJQA 1XHZA 2UVRA 4CJ4A 1RDRA 2GIQA 4RW6A 2WHOA 3VQ9A 4K4SA 3T1AA 3KLFB 5KRSA 4KRFA 1SL0A 4CF0A 3T5KA 3KMSA 4WFYA 4KHWA 3BQ0A 3DOKB 1DTTB 1S6QB 3DLKA 2HW3A 2DFEA 3M8SA 3KMQA 3H98A 3DLBA 3BQ1A 2CJQA 3IN5A 5I3UB 3N6MA 4N76A 5C25B 4M3WA 4B9SA 4ECSA 4U7CA 2IA6A 4WE1A 4MFBB 2IC3B 3ZCMA 4N47A 5KFHA 4HYKA 1DTQB 2FBVA 4RW6B 5KFFA 4CJRA 3RBEA 3I0SB 4Y1CA 3LP0B 1LWCB 4FZYA 3I5AA 2DPIA 2YKMA 1T94A 1ZBLA 1VRTA 3PW7A 1RTIB 3G10A 1Q9XA 1S10A 1S4FA 2VG5B 1TV6A 1RTHB 5F8NA 3MEEA 4Q44A 1UWBA 3QZ7A 3IS9B 2D7SA 3OY9A 3HP6A 2A1RA 1NK0A 1NJWA 4OL8A 3E01A 4ZVEA 4ZMMA 4NCAA 3IG1B 4QWAA 4OVLA 3QGHA 4ZPAA 4QOZB 3SZ2A 3TAMA 4TY8B 3PZPA 3LP0A 4YR3A 2QKKA 2RKIB 4H8KA 2P5OA 2WK4A 3M9MB 4HVJA 3L2WA 1REVA 4G1QA 3M8QB 1T7PA 1HPZB 3AVNA 1D8YA 3TWHA 2QE5A 2HNYB 4EO8A 4E19A 2KQ2A 3VQCA 3KK2B 1TVRB 1FKPA 4FJIA 3V1OA 5KFOA 3C6TB 2HWIA 1QE1B 1IKVA 2C2EA 4O5BA 1NJYA 4ID5A 3OL8A 4E1NA 5KG4A 4Z4HA 3RAQA 2BGGA 1RA7A 3MF5A 3OSNA 4DTOA 3OYLA 3LP1A 4FJ9A 4EP4A 3SQ1A 5SWMA 4EBCA 3OLBA 3AVCA 4EP5A 3RRGA 2YNGB 2BR0A 3OYMA 2W7PA 1IKWB 1JLCA 2R8KA 1N48A 2OH2A 4H4MA 5L1JA 3S3NA 5KTQA 4L8RB 4DU3A 4MQ3A 4YNQA 3VQ6A 5HLFB 4FM2A 1J5OA 3MTKA 2IDOA 1Z26A 1BQMA 1RILA 1YT3A 3K5NA 4FZZA 4OPJA 4OJRA 1NK5A 4KTZA 2HMIB 4YR2A 1UOCA 3Q8QB 1WSEA 2E4LA 1LWEA 2I5JA 3QYYA 3OYEA 5KRTA 4ECUA 4IRDA 3NCIA 2OA8A 2Q3SA 4NYFA 3GV5B 1JX4A 1WSGA 1MU2B 3VA3A 4R5PB 5KG1A 1RT3A 3GV7B 3QEPA 4RNFA 1S9EB 1IKYA 3HYFA 3EZUA 4K8ZA 2ZD1A 1QAIA 2E9RX 3OYBA 1RT4B 4IFVB 5KGXA 3LP2A 1Q9YA 3GV8B 4CJPA 1VSKA 4CK1A 3KNAA 4Y34A 3V81B 5CYQA 2D3UA 1D1UA 4TYBA 4CGJA 3ZSRA 3G6VA 4EZ6A 5J2PA 1LWEB 2I5JB 4KB1A 3HL8A 1QUVA 3AO3A 4QWDA 4J9RA 4CHYA 4I9QA 5F8HA 4J9QA 5HRNA 3AVLA 4ECQA 3ZSXA 3LWLA 1U09A 5KFAA 1SUQA 2XRIA 3TAFA 1FKOB 2HHVA 2OZSA 1CSJA 4MKBA 3MR2A 3MEDA 1C0TB 3OS1A 2IMWP 1GOBA 3VQ7A 3DRRB 4KE5A 4M42A 3BREA 4CF1A 3VQAA 3V81A 3ZT2A 4KV8B 2IM0A 3OJSA 3TARA 4C8OA 5J2MB 3C95A 4Z4FA 4B9NA 5FRMA 3AVBA 1LW0B 3CIZA 4BDZA 4IR9A 4KKOA 3O3HA 3SQ4A 4CF9A 4FLUA 2GIRA 3OL9A 4IG0B 4DG1B 3D5MA 4CEDA 3TABA 4C8LA 3OYIA 1VK0A 4KTQA 1XR7A 4CFAA 3HPGA 3ZT3A 2OPQA 4QWEA 1JLFA 5DGBA 1HNVB 1FKOA 3LANA 4I2PB 2FBTA 1XR5A 4TSXA 4FLTA 3L2VA 3V9ZA 2YNFB 1C1AA 3WNHA 3SPZA 2PY5A 1FK9A 4NLRA 4KHYA 4O44B 3SUOA 2WRMA 1U04A 3ZSOA 1RTJB 5F8MA 1I3AA 5HRSA 2FVQA 3AVIA 4J9MA 4GVMA 1TKXA 4GC6A 3SQ0A 1LW0A 2VWKA 4B8AB 3I0RB 4ED8A 1HQEB 3OSPA 1EP4B 1WN7A 1EKEA 3GILA 2AGPA 4CK3A 1ASWA 2B4JA 3NH1A 4I2QA 4LSLA 2EC0A 5HP1B 3RMAA 3OYNA 4E0DA 2HWHA 3RMDA 1D9FA 1G15A 3DM2B 3ZT0A 3OYFA 5DG9A 1VRUA 2P1JA 4R0EA 2VG6A 4OKEA 1JLEB 4XO0A 1SH2A 2IJNA 2O4GA 4CGIA 1T03A 1Y97A 4R8UB 1W0HA 3F73A 4AHTA 3MR6A 3PW4A 3M8RA 3PJWA 1WAJA 3SQ2A 3GIKA 1C0UB 1RYRA 4KO0A 4PQUB 1TKDA 2RN2A 1NOZA 4DU4A 1HQEA 5HBMB 4MK9A 4Q43A 2JC0A 1GX5A 2B6AB 4DFPA 3T5LA 1KLNA 1Z4UA 2BANA 4FJXA 2UVVA 4JUZA 2C28A 4PWDB 4ECWA 2R2TA 4RW8A 1NK7A 4CJEA 3NBPB 4Q0BB 5KT3A 4JRQA 5KFLA 4NLYA 2HVIA 2HHWA 1T03B 1IM4A 1VSIA 2W9CA 1NKBA 1CXUA 2W9AA 1TKTB 2XY5A 2OYQA 4B9MA 4J2BA 4NLVA 4E3SA 1ZBUA 2QV6A 3MECB 3CO9A 3GIIA 3OLAA 2QK9A 2ATLA 3BSNA 1S9GB 4GW6A 1SKWA 1BIZA 1RT2A 1S5JA 2EHGA 2JLEA 5KG7A 2G8FA 4O4GB 1JL2A 2XCPA 1A5VA 3TANA 1NOYA 4CIEA 3PW5A 3TVKA 3LDSA 1HMVA 4WXWA 4K4VA 1NJXA 4CHPA 2YKNA 4F3OA 3DOLB 3CJ2A 1I39A 2Z1HA 4LY7A 5D3GB 5EU7A 3DLHA 4JV0A 1S1UB 2B43A 2VWJA 3CM5A 2HHQA 5DMRA 3LPTA 2IAJA 4ZPCA 4RG8A 3MECA 4KB0A 4OGCA 4M45A 1J53A 4NLXA 4IH5A 1S9GA 1KLMA 1S1WA 3EPGA 3AVHA 3G86A 3DOKA 4E7LA 2P5GA 2GUIA 2IM3A 4CE9A 3VQPA 4Q8EA 4RUAA 4DL4A 1QS4A 1TKZA 2C22A 4FJ5A 1R0AA 3AA5X 3FSIA 3DLRA 3BGRA 3PVXA 5KG3A 1S0OA 5K14A 4RZRA 5DQGA 4QWBA 1QAJA 1KFDA 2YKNB 3EPIA 2Y1IA 3RMCA 2G8WA 2AGOA 4H4OB 4KI6A 4B3OA 3H4BA 2R7YA
chains in the Genus database with same CATH superfamily
3HPHA 4NXNF 1R43A 1KRPA 4KBOA 2UU9J 3MMBA 5KFDA 2ZH3A 4OZ5A 1RLDA 4WZMA 1YI2N 1AB8A 3FZLA 3KHGA 3BYRA 4PA1A 4H0TB 4H5TA 4CEEA 2QA4N 2LQJA 1HW8A 5L39A 3QEIA 4L76A 2JEFA 3EXYA 4LQ9A 1TL7B 1ZM3A 5HVFA 4CGHA 4AHRA 2NNWA 3RMBA 3ET6A 1HUXA 2V7ZA 4MKVA 1YVFA 5HK4A 2ATQA 3MM5B 1RBRA 5KI6A 2M0GB 1BA0A 3SFGA 3JTNA 4DFMA 2PDAA 1T9TA 4ZP8A 3O5BA 1WAFA 3I96A 1TUGB 5T14A 2DEIA 3CD7A 3IGNA 3FZFA 2I9SA 3OL6A 1NKCA 1U2RA 5JVGQ 1WTBA 1VMBA 3TEHB 3KDNA 3VR1A 3UDCA 1PAUB 4M5NA 3P4UB 4CDIA 4DU1A 5MAOA 2V8PA 3QLHB 5DJBA 3GFZA 1SJ4P 3C8YA 2DYAA 1ESVA 2XMKA 5LSOA 3VQDA 3C6UA 2I6WA 3ID8A 2E1CA 1VSMA 1HBOA 3GJQB 2BACA 2R2RA 4Y6IA 4P52A 4X2BA 1PBAA 2V4JA 4ZK7M 4ZCLA 4WTOB 5U47A 4OYXA 3QAEA 5D0RA 2B5JA 5RUBA 1J5OB 3ENVA 3AXKA 4BC4A 5K8PA 4MLHA 1F9HA 2HEKA 3TZZA 4HTIA 1T9YA 2UUAK 1RBSA 3L8BA 2IM2A 2RRAA 3NAHA 2UUCF 4P2SA 2CH6A 3U1NA 1WC6A 2NPFA 4LVOP 2D5RA 2WC9A 1S9EA 4M5MA 4ILMA 4FJMA 1ZTWA 2N82B 3AVJA 1ZBFA 1ICEB 3D7SB 4DV4K 2ZHOA 4CO1A 2DB1A 4DV3K 2B0GA 4MYUA 1RAOA 3UDVA 1FESA 2P9NB 3M8WA 1NHVA 1UFKA 2R7VA 1LAWA 1RGVA 4Q2LA 1RWVB 1VSFA 4X4SA 1UA1A 5HJXA 2RHKA 4DV7F 2QWOA 5B8HA 2NSCA 2AJ4A 3WNFA 3NFAA 3P5JA 1S7HA 4H4MB 4CF8A 3ZETA 1M1HA 4M8LA 5F9LA 3L2UA 2CXEA 3ZZZA 4BRKA 3WNEA 3ULHA 4OI3A 1JKHB 2BJ9A 1MMDA 2R7RA 3N5BA 3R7SB 4PY5A 2OEJA 5C5JA 4RW9B 4RW7B 1ZZNA 4E7JA 4P7VA 2G2ZA 1MU2A 5KQDA 3DRXA 1R0BG 3VALA 2V0NA 4X62J 1ZBIA 2FGOA 4ZHRB 2EXUA 4GO5X 1LW2B 2GUPA 4KGXB 3FEYB 4DR5K 2QZ8A 5HRRA 3RRHA 1VHXA 2FSNA 1UWBB 3J7ZO 2GQQA 2NXNA 2ADCA 3A8YA 3L3VA 3KLHB 2LFVA 5KFZA 2FC9A 3J81U 2C2ZB 1R89A 4CEOA 2QLWA 3AT1B 4B1UB 3CC4N 3HKWA 2JL9A 3AGKA 3HRGA 3W2WA 4L3NA 4PAAA 2MMYA 1WKJA 2RPIA 4NOHA 2F8TA 4DUTA 4CF2A 1VI7A 4ZLJA 1S79A 4M1KA 1FTRA 1IO2A 1WDDA 2HNYA 1EARA 1CLFA 2X6SA 1FFSB 4CHNA 5E7OB 4GKKK 2KW4A 4C9DA 1HWUA 2F3JA 2NUUG 3GWCA 3PR5B 2UUAF 3PY8A 2VG6B 1SI9A 4UQTA 4JI1J 3IBWA 3W5YA 2FVCA 2F9WA 4C3LA 3R8YA 4F4WA 4JI8K 4H0YB 4UUWA 1ATNA 3FE1A 1CJTB 1N52B 3L7UA 1XNQK 1NNEA 3LAKA 4L73A 1WEYA 4RNOA 1S49A 1HYZA 1NK9A 4AHSA 1QD1A 2EPIA 4H0PA 2O3DA 2OTJS 4B3RF 3HSGA 2I38A 2NQPA 2LDYA 4C11B 4X4OA 4FM0A 1BU6O 2MY7A 2KH9A 1HW9A 2QIFA 2FIUA 3CCUS 3H5SA 4LF4F 2L9NA 3M8YA 3ILOA 2VFTA 1OH6A 1FX4A 1UP1A 1NGHA 3MXMA 2Q2RA 4Q0BA 2Z30B 1JLGB 1CC7A 4PYDA 3O3FA 3PO4A 2ZHAA 1SVDA 2HFSA 2C3OA 1F5AA 4FO0A 1VBXA 4TQSA 4W4MA 3SQOP 1VQ5S 3ID6A 1SL2A 1WSHA 3I9V9 3HM9A 2B4UA 1VQKN 2KXHA 2KTQA 2BYCA 3DMJB 2V5HG 3HVRA 5AXNA 2ZD1B 4FWSA 4OYMA 3OVAA 4IQXA 2H9ZA 2DR6A 4CGDA 3HVTB 5LOQA 5KFTA 4MKYA 3CJ9A 3T1HF 2FJEB 4DV0K 3A5OC 4J9LA 4OHZA 4TU9A 4W5NA 3MCAB 2L9DA 1R59O 1XIQA 4QWCA 1Q79A 4DQIA 2P6TA 1U25A 3IWNC 1H7WA 2RQKA 3DXSX 4O3SA 2YQ0A 4GVEA 3OV7A 2OZMA 4DSEA 1SIZA 1T44A 4X4QA 4CO5A 1CS4A 1BQNA 1T0TV 3V6DB 4DV5F 3MI7X 4IBNA 1WB9A 4PL8A 2M4MA 1PBUA 2RS8A 2VG7A 3PJ9A 5ETKA 3GONA 2XEXA 1SV5A 4ZPWR 2DITA 3OTOF 1S6PA 2HQIA 2XC9A 4KV8A 1XN9A 5KPZA 1ZC6A 5B0GA 4CBXA 3M32B 3FDSA 1VQ4S 1X7VA 3SCLE 3CJ5A 2K8GA 4N77A 4IO9L 3UW1A 1NJIO 3KLFA 1NSAA 3L2RA 3O5TB 3WT0A 3AO4A 2CG8A 3MPDA 2UZAA 1C0MA 3MXIA 3CXCR 1HNVA 3LQVA 1HX1A 1YVNA 1JXBA 2JNJA 3R3LA 2DPJA 3PG9A 3AD9C 4JI5F 4ZLPA 1I51B 3C14A 3R5AA 2HOEA 3VQQA 3QERA 4FW2A 3AVFA 4CEAA 5AJ3F 3BF1A 1YJ9N 1I94J 2DXFA 1WI8A 1HL6A 3NNAA 2HS0A 3EWGA 1IBKJ 1DKGD 3ILLA 1SQKA 1ZXOA 3U3YA 1S1WB 5HRPA 4ECTA 3U9DA 4CJSA 3L3UA 1TL3A 1RHMB 2QWRA 1LQ9A 4GVBB 4ANDA 2F63A 2VA3A 1RT7B 1Z6RA 3KJVA 2O01C 2WOMB 4ISFA 1X5SA 4OO1J 4DWIA 1DLOB 4KJIA 4FN5A 4X4PA 1KKHA 1IG9A 1P1TA 1Y9OA 3DLJA 2WTFA 4U9RA 3S9HA 3N0VA 1WHVA 3C94A 4OHVA 5GAHP 4Z4IA 3DLLQ 2Z2MA 4BDPA 4CZJA 1C2PA 4BWJA 2GAHC 3RR8A 4ED6A 3D66A 4ED3A 3H5YA 2RE2A 1RBUA 2CDQA 3KK3A 2LMIA 2ZOMA 5K8MA 3M30A 1MNEA 2ZC4A 1FD8A 3CVKA 3CCES 1RDUA 4DCPB 2VH7A 1DLOA 3K59A 3U4LA 4C6AA 2IGIA 4C0BA 2DIVA 4NYPA 2HB5A 3ZZPA 4ZVFA 3V9XA 4CFCA 3MR5A 1S6UA 2Z2YB 1NWKA 4DR7F 2A41A 5CCMA 1DTTA 1MWZA 1Q8IA 3TWZA 3OTOK 1VC5A 1Q8LA 2A10A 2DIUA 1MN9A 4EZ9A 4ER8A 3AVAA 4A59A 4DB3A 3BO4A 1NM2A 5BRDA 5LMUJ 4FVMA 2BJEA 3L2QA 1KQSR 4F0KA 5AQXA 3SPYA 3P1GA 1IBLJ 1RDBA 3NL0A 3S3MA 3CQYA 2JWNA 2BDPA 4PRFA 2G0CA 2HRTA 3HZGA 1Q8KA 3LPEA 5E3AA 4ZPTR 5CYJA 3JSRA 4B3TF 3VAIA 3TSPA 4KHPF 3H25A 1U1PA 2FLLA 4E8UA 4LF8K 3LW5C 3F9MA 2VQFK 3CMES 2EFPA 4H5WA 1T9UA 5E84A 1KQGB 2FY1A 4DV0F 4OFZA 4IFVA 3OBWA 2MKCA 3NCQA 4OYOA 3UN2A 3BQ2A 4OV1A 1X4CA 1U6ZA 1YJRA 1YSJA 3SMSA 2Z1GA 1UWAA 4CJ7A 1JIHA 2XSFA 3VPZA 4J9KA 1BQXA 3NGZA 4C8MA 3WNGA 3CIMA 3S8SA 1RAJA 4K8XA 2NRRA 4ED0A 1NCLA 2PEHA 2BEFA 4LUBA 3W2VA 2KJWA 3R1HA 1S72N 3FFIB 1OY9A 1M5HA 3KHYA 1N36K 2HHXA 4NLBA 4DJBA 3IR5B 2PMWA 2POKA 1VQMS 3IWLA 1C0TA 1DRZA 4JYAK 4LH5A 4DF8A 2BJDA 4FZVA 5DK5A 3VVUA 2NUBA 2IRYA 4JKAA 3H90A 1YJVA 1IKXB 3JQKA 3UCZP 1BHLA 4ECZA 4K43A 5ELZA 5JS2A 1K73T 3MM5A 4O5FA 2BKOA 3JTPA 3U6FA 4FXVA 4A8FA 4HTJA 3TR8A 1ACMB 2YPYA 4I68A 3W5XA 3AJDA 2HBRB 4AT1B 1NLKL 1R8HA 4A57A 4WFAQ 4C8KA 3H45C 2D0BA 2EBGA 5JLHA 1KBRA 5GADI 3IS9A 4JI1K 3CFOA 4F2RA 2FDNA 4DXLA 4NMXA 1KDNA 4NLQA 2U2FA 2F7TA 2ERRA 1G6BA 2WSEC 1PKUA 3R8EA 1XTZA 2Z57B 4I69A 1SJFA 2AWZA 5JVHL 2X3GA 3GZ7A 4EMDA 4DPTA 3I0RA 4PL7A 5KFMA 4PG7A 3WEEB 1RCOB 2IVOA 5KT5A 3Q24A 4PG5A 3ZX2A 5IM0A 4DBQA 2WFBA 3UIQA 1JLAA 3PRDA 1T95A 4AYBD 4JEPA 4QCLA 3UB5A 4A4JA 1WBBA 2RMLA 1W9HA 1F21A 1EIYB 4WBFA 3NGSA 1SC6A 2R8HA 3DHWC 3T5HA 3B4MA 4F8RA 4FPRA 1N56A 2B7CB 1XNRF 1WOOA 3O80A 2EK1A 3GBTA 4X65F 2H54B 1C0UA 4ZP7A 2RRNA 3DFEA 2F8EX 3NCPA 1IG8A 2BQRA 2VDIA 3VTIA 4DF4A 2XS5A 4FW1A 3THVA 1TZ0A 1NBWA 4E7KA 4FJ7A 4X65K 1YF5L 1NGIA 3M6GA 2ZFHA 1UL3A 3ZX3A 3V1RA 3M2VB 4OJ1A 3OTCA 3M9NB 2YCHA 4HUEA 3O4NA 4CTAA 1RDCA 4PXBA 4JI0F 3R6LB 1XMQK 3I87A 4EBEA 5D4PA 4JI5J 1IH7A 4DFKA 3B6PA 1NMDA 1NDCA 3AOAA 1RQ0A 4ZJOA 4BRLA 2KHDA 1R3NA 4DCOB 2CQ1A 1KOOA 1AA1B 2YJEA 5TKYA 2CNOB 3CWJA 1MW7A 3GYXB 2E6MA 1HPMA 3QETA 4O4GA 2FHKA 2YNHA 4CECA 4KY3A 1SV5B 4B3SF 2BE7D 1HNIB 1HHTP 4BQZA 4DPUA 1JKHA 4CEQA 4B3MK 1NUEA 5L9XA 3HXMA 1FRLA 4DV2K 1A0OB 1JLGA 1H6KX 2V51B 4DEZA 1VQ7N 2LA6A 2Y1RI 2C3MA 4URQU 5KG0A 3IC1A 2CZ4A 3CCJN 2ACMA 3WDOA 4A61A 3CFPA 4I0WA 2WW4A 4BRNA 2JH3A 3H3OB 1YITN 3EGZA 3G87A 5K9FA 3QEXA 4DUYK 1FX2A 2Q31A 5G0RB 1VRUB 4ID8A 3CPWR 1CJVA 4BVPA 2YJFA 3KLHA 5I4MA 5DLFA 4M95A 1WACA 2XI2A 3JAMY 4HCCA 1HWKA 1N33K 1RI7A 4CJWA 2D1CA 3M2UA 1JLBA 4OLBA 5EY4A 3DOMA 5J2QB 1BLUA 1T05A 4XH1A 2ZM6F 4HCBA 4O3OA 3MCSA 1KD1T 2G1HA 3SUQA 1XWLA 5BPLA 3AODA 2W41A 1VQON 3CJKB 2ZE2A 2BANB 4ED1A 3ATVA 4CK2A 1GT8A 4EBDA 2KYXA 1N54B 1ATRA 2XMTA 3PSIA 2PYLA 2RUGA 4KH6A 2GNKA 5GVQA 5HROB 4J37A 4NI2A 5AZIB 3L0QA 3AA2A 5IWAF 3H08A 2O1PA 2QX0A 2ASYA 2VC1A 5J2NA 1J27A 3G25A 3MWPA 3CCRN 3IR7B 2AZ1A 1KVCA 3V5RA 4CCHA 1V3SA 5AJ3K 1EKSA 3I56N 2ZE2B 2ZBQA 3ZNJ1 4BE1A 4DR2K 1M90T 2E6LA 4I9LA 1DY3A 3SV3A 1BDGA 5IT0A 2ZQBA 3T69A 1Y00A 4PWUA 1CULA 3M1VA 2LQ9A 3KK3B 4DV1F 4IO1A 5AQVA 5KT4A 1NSPA 4UY8T 2HS3A 2ZBIA 3WXKA 3S3OA 3RB6A 1NGAA 3O08A 4KAZA 3LDOA 5C24A 4USTA 2B6AA 4YOWA 4FK2A 4TLRA 2X74A 3NGKA 2GBZA 1CPZA 2FHMA 3RB4A 2EG1A 3IXQA 1H38A 4K2XA 4DSIA 2KKZA 1GAOA 1LAVA 1NLVA 2CZ9A 3QRRA 5K8NA 3I8BA 1OVYA 4BE0A 3TU5A 3PYDA 3WQPA 3E51A 4H4OA 3D1OA 3JSBA 5AQYA 4I67A 1RGIA 3RSEA 1NBEB 3O9UA 1QM9A 4RWWA 1HBUA 5AFUA 5A2QY 3KG4A 4QYZJ 4C23A 3MAQA 4J9SA 2IBOA 3AJ1A 1VQPN 4QPXA 4DQSA 5L1IA 1GX6A 4DI6A 5KFGA 3KKSA 1RU2A 4OX9J 2AGQA 2IVFB 1U8SA 3UN5A 3ZZYA 2ITMA 1VS3A 1VBZA 2A6OA 2UVUA 4EHUA 4MMOA 4C7QA 4DLGA 3TAGA 3A5MC 3ZSWA 4CJ3A 2QEXN 3C6HA 2UVRA 2GIQA 2E5LF 4RW6A 2WHOA 3VHQA 5AQJA 1RHUB 4KRFA 1U6BA 2HBYB 2XLIA 4KHWA 2AV5A 3CMEN 1DTTB 3A13A 3BBFA 4NXMF 2HW3A 1YJWN 2RIJA 3A8KA 2MLXA 3IN5A 3RJMB 1UKUA 4H5VA 4M3WA 2Q97A 3ONQA 4JI8J 2CADA 1OQ3A 1NSKL 5KFHA 2WVBA 2EFVA 2VKZG 3CCVS 1DTQB 3TVZA 2VHGA 3TUZC 3MOJB 4ES2A 2MYFA 3I0SB 3LP0B 3BF4A 2XYGB 3P5TL 5F41A 2DR8A 2DO0A 1QQNA 4UOHA 3HFVA 2F1FA 4BG9A 2RS2A 1RBAA 3F0NA 5F8NA 4Q44A 1PYSB 2D7SA 2R42A 3CD0A 2A1RA 2H4YB 1NJWA 4AQYF 2ZZTA 1B70B 4ILRA 2HIYA 3E01A 4ZVEA 4WF9Q 1WKKA 4NCAA 2E2NA 3QGHA 1W2BM 2ZJPL 4FOIA 3QATA 5GMDA 1QUPA 4L6V3 1XNRK 1N34J 2QKKA 3CGIA 4KGVB 4OYAA 2VD3A 1KS2A 3PKYA 4HVJA 5KOXA 4GV3A 3M8QB 2A0FB 2HAFA 1HPZB 4CLTA 1Y10A 4DUZF 3TWHA 4EO8A 4FPBA 3VQCA 3AXMA 3KK2B 1TVRB 2QL5B 1FKPA 3MTJA 1B4SA 3M7VA 1DHMA 2C2NA 2LQ8A 1IKVA 4O5BA 2M8HA 3H6EA 1RACB 2B9YA 2BGGA 1RA7A 3C2PA 1LNQA 4DTOA 2VU5A 3OYLA 4YS2A 2E29A 5DDRC 1WOPA 3FSXA 3AVCA 3KWGA 4EP5A 1HLUA 2B4OA 2KVQE 3KWIA 1IKWB 4FYXB 1R27B 1NAQA 1JLCA 1WOQA 1HR0K 3S3NA 5KTQA 1VRQC 4MQ3A 1HJOA 5F3TA 1PC4A 1AW0A 4ZN3A 3MTKA 2IDOA 5EVZA 2Q36A 4PCQA 2DNQA 3DCAA 3M05A 4B3TJ 5AJ3J 4WJBA 4OJRA 5A8WB 4KTZA 3Q8QB 1UOCA 5M2UA 1LWEA 4ECUA 3UNYA 3NCIA 4PQAA 5ETPA 1JX4A 2AYMA 2CJAA 1GEHA 5J1NA 4X84A 4L74A 1AFIA 4Y2KA 1S9EB 3CJSA 1KTVA 2N7CA 4JKDA 4EAHD 3W3DA 1R6YA 1RT4B 1FE4A 3MR7A 4WU3A 5DDQC 2HMPA 3US5A 5BR8F 1FEHA 3L3CA 3OTDA 2RNEA 3VERA 4WPAA 3ULEA 2ZNZA 2D3UA 4TYBA 3GSIA 3CJAA 2CWXA 3THXB 4KB1A 4ZJQA 1QUVA 4U95A 4J9RA 3OFFA 4I9QA 2KDOA 4J9QA 1PGZA 3GYGA 1UJ6A 3AVLA 3A5LC 3FVYA 1U09A 4HI2A 3R5DA 1NPKA 4XEIA 3MAAB 3BZCA 1S3XA 1IJEB 5CHIA 4M42A 1YLXA 2Q6CA 3BREA 2F65A 2ZJQL 3VQAA 3V81A 2IM0A 4FF2A 4DX8H 3A3PB 4CI6A 4Z4FA 5FRMA 3AVBA 3TX8A 1LW0B 4BDZA 4KKOA 3BY5A 1XMQF 3SQ4A 1DGKN 4CF9A 4EU0A 3MX2A 4FLUA 2GIRA 4RO0A 3CC4S 4R25A 2IY5B 2PA3A 3OYIA 1VK0A 1TUWA 4DV4J 2XQCA 2OPQA 2PGCA 1YRTA 1IQZA 1RBOB 1I1GA 4FF3A 2MKKA 4FVCA 1TFWA 1A9NB 1X4GA 4I2PB 2HZVA 1PYOB 1XR5A 2DGTA 4FLTA 3RYLA 3ZZRA 1LFPA 3PFOA 4KHYA 4BHQA 4D3HA 3LGMA 4M5IA 2PEBA 3HHNB 1I3AA 2QWQA 4J9MA 3SCIE 4FDFA 3SQ0A 5THWA 1RWUA 2KM8B 4WQ5C 1FJGK 1JK9B 2UXCF 4ZCMA 1REGX 2CPJA 4CZGA 2NZ4A 3GILA 2AGPA 4B1XB 1YRUA 1SZ2A 5CXTA 1XEZA 3RMAA 2KM8C 1SJ1A 1HNXJ 1WEXA 5IQQA 5E26A 2O8FA 3I6PA 3KNGA 1CJTA 1FWLA 2Q1LA 2DNOA 2ASOA 1WAJA 3EX7B 1HBNA 2RN2A 1NOZA 4WP9A 3OR2A 5ETSA 1WF1A 1RB0A 5JLFA 3KK7A 4B1ZA 4DQ8A 1IUJA 1S57A 2ZM6J 4PHTX 1OJ4A 1RP5A 1FDBA 3M2VA 2UVVA 2YPZA 2ZGYA 4NWBA 3SCJE 2MGZB 3NBPB 4E98A 1U1LA 4NLYA 2HVIA 3DXKA 1T03B 4J91A 4DV6J 1LFWA 3IWXA 1CXUA 3ZEUA 1TKTB 4CH7A 3CJ7A 3N5FA 5IC6B 3O1LA 1HBUB 2OYQA 1SAZA 3TQEA 2QK9A 2ASMA 3CI5A 3SBMA 1M5KC 4GW6A 2OMOA 2YTCA 3GSDA 4LFAK 2L9WA 2JLEA 1BIZA 4JI5K 3CNQP 1VC0A 3UE2A 3BP8A 4IWVA 5FPMA 2Z8QA 2CNKB 4FYYB 1YDLA 3GCWP 3NS5A 4FP9A 1NJXA 5DRKA 4OHYA 5EU7A 3W5ZA 2B43A 1NM1A 1P90A 3ZX0A 3WC2A 3UKRA 4EK2A 2ZH2A 1N0UA 2X3DA 1OY6A 1J53A 3IA0A 4BBYA 1S9GA 1MDUB 3G86A 1OSDA 4OV6A 5F0XA 1BG3A 1VHIA 3LGHA 3OFGA 1QS4A 2XMWA 2Z4PA 4FJ5A 1RAAB 3TP2A 3C3LA 4YHHJ 2DVIA 1ZM2A 3ISZA 3FK4A 3DLRA 3BGRA 3QT8A 2R7OA 4OJGA 1T02A 4WYBA 4XH5A 1LK5A 3JSYA 3MXHP 1KFDA 2YHXA 1YJTA 1FDDA 2VFSA 2LEBA 2Y1IA 3QDKA 2V2QA 4YEAA 2G8WA 4KHPK 3WQTA 1GTHA 3ET6B 3Q0AA 2FSKA 3FBCA 4CO2A 4FWKA 2CQ0A 2R7YA 5D6GA 4ZA1A 1CJKA 4H0XB 1QAYA 5E2QA 2FF6A 4NRTA 4YOEA 4P75A 4RX6A 2ZJQQ 5AQFA 1S59A 1TK5A 2Y9HA 2DTJA 2CQCA 2CA9A 5CY4A 1NKEA 2AF6A 4QPTA 5L46A 2VODA 3MEEB 3F9KA 3H2VE 4JK9A 3G9CA 2QO3A 1U1QA 5KQ8A 4K50A 3BGOP 1V5VA 1KFSA 3P83D 1EX4A 2E5IA 4X4UA 3FLCO 2JVOA 3O3LA 3PYGA 1Q81O 3TAMB 3MCOA 4TY8A 3THTA 3N6NA 5E3QA 1DQAA 5E41A 5I42A 2VICA 2HNZA 4NLSA 1K1SA 5GAEU 2GHPA 5DDPC 4ISGA 2M70A 1V3ZA 4IOAL 2KZMA 1TAQA 1EB0A 2XSJA 2VA2A 3KK2A 3FKBA 5A2QO 3QGGA 5D4LA 5C25A 2QXFA 2Z56B 3V6KA 5LSLA 3QZ8A 3M5RA 1RBVA 5AQRA 5F8JA 4RU9A 1RDDA 4R79A 4ID1A 3BJYA 2MY8A 3Q23A 3MM6A 4M41A 4X64J 2VPZB 4LFBF 3G6YA 4JK7A 1DFDA 1UVKA 3OPKA 4OI6A 4CJUA 3VVTA 4MIBA 4CZIA 1CZAN 3O1WA 3VESA 2A1BA 3GIMA 2QWLA 4WQ5A 4CHOA 2IDEA 4X62K 3OUYB 4YR0A 1IN0A 2E1MC 3Q8SB 3GDQA 3HHKA 3BDEA 3O6WA 3V4IB 3W9HA 1AXQA 1S77D 3QESA 4M3TA 1P27B 4M63C 4PPDA 1C1CA 1H72C 4DKWA 5LM7E 4FWLA 1PYTA 1FNXH 3C6UB 3UO0A 2ZDOA 1RCHA 4FCYA 5AQNA 3ATUA 3H4DA 1C6VA 3ENOA 2RF2B 3CHWA 5EGYA 3K9KA 1H7XA 3KK1B 5BREA 2XS7A 4CHQA 1FRIA 2GV9A 3ZC4A 4ZDNA 3ZTRA 3TJAA 4JKHA 5KFSA 4DV4F 3CQXA 2RDJA 2BTFA 4QAGA 4EFAC 3UVJB 2VOPA 2O66A 4MKAA 3GIJA 2W8LA 3O3GA 4NCGA 4USKA 4BY9C 3MMAB 1OY8A 3ELHA 4ZTFA 5JXSA 3PR4A 3CF5L 4CZLA 2A42A 4YDUA 2O67A 3C15A 3IFEA 3D0IE 4BC9A 3DGPB 3P31A 4L75A 3IRXB 2FBYA 4DTUA 4HACB 4ZOSA 1VK8A 1BWVA 1OMSA 1OVQA 2VQEJ 3OVNA 5F9NA 4I6YA 3P45B 1GTEA 3J7Z5 4P6QA 2NXEA 4YY3F 1W97L 4DTJA 4NEYA 4JI7J 1PG5B 1NGCA 4FS1A 4E1MA 3IKMA 2VBXA 3L4IA 5CAAA 2DHGA 3A8IA 4XPEA 3EJMA 1N5YA 1JXEA 2EFNA 2VG5A 2HLUA 3MFHA 2DNRA 2VKRA 3BH6B 5CD4H 3IAM9 5EOYA 2O8DB 4DU7A 4I2PA 4QIVA 4NLGA 2HRUA 2HVDA 4F7VA 4DR5F 2ZBCA 2ALZA 1XMOJ 1VSEA 3BSAA 4DQRA 2IYGA 3DDIA 1FHTA 1IKXA 1TL1B 4HTLA 5HAOA 3J81j 5E0OA 3CCMN 4ZPBA 4QIWD 4LSNA 1O5JA 3D6FB 1VDHA 3HT3A 1HWLA 1NHKL 1HHQA 4P2XA 9ATCB 3QNNA 3W7BA 3MDFA 1RYSA 1UVJA 5K8OA 2E88A 4OYIA 3GOIA 4WCEL 4PXDA 2ASPA 2MKYA 3FQKA 4CT8A 3L6QA 1YKWA 4I2QB 4P71A 5HP1A 4FXDA 3MAAA 3IBCB 3PX0A 1Y3KA 2DH7A 2AKWB 1KHWA 3OS2A 2F5GA 3AOBA 1VR6A 1HKAA 4XPCA 1VJQA 2J7WA 2X6NA 4R8UA 3LDQA 5HJYA 1S1TA 2YXLA 3KJNB 2E5LJ 3UKUB 1ULRA 1GLFO 4CD1A 1BMQB 4JI0J 2MKIA 1H2UX 2ASLA 3DU6A 2M3DA 2IS3A 5IM0B 1V4TA 1H0HB 4HT5A 4IFYB 3KOAA 3OYGA 5C42A 5AQUA 3HT0A 4C3MA 2BA9A 4DR1J 1BQMB 1J9AA 2E5HA 3CIPA 4RW8B 1X4EA 3LUYA 2OHDA 1D4XA 2H5JB 4UOFA 3BEXA 3L9ZA 2CYYA 4KGKA 5FROA 3DRSA 5FIIA 4JS5A 2GX9A 1BGXT 4F02A 1X5TA 2UUCJ 2XM3A 4O3RA 2CVIA 2Y1LB 3GU0A 4YOTA 4FLZA 2CJ9A 2QSWA 1OQ6A 2BX6A 4LF9J 2Y8WA 5H1SQ 3MMCB 1JLQB 2DD8S 3NP5A 3MCMA 2QLBB 2HHTA 1OYDA 1BE4A 1HQ2A 5A0YB 4Z37A 4C48A 3DM2A 2O8BB 5JMNA 4CTAB 1TMMA 4YB6A 4NO7A 4FLVA 4TU8A 3OYAA 4CGGA 4RUCA 4BR2A 2AW0A 1C1BA 1JMTA 4ENOA 2FXUA 1UEKA 1VQPS 1EO1A 3PFEA 9RUBA 3ZTOA 3CD6S 1FXDA 4K4YA 1IJJA 3RR7A 2VV5A 1UZDA 2DR7A 1VAZA 4U67L 3SDEA 1Q82O 4Y28C 2YWFA 3QIDA 2QLJB 1JNRB 4N56A 2OEMA 2NRWA 3E3XA 2C1EB 3O2IA 4BS2A 5GAGU 4ECVA 4YB1P 2BXJA 2XHBA 3GG1A 4WK1A 3B6BA 3VGSA 4AXJA 4RKUC 4K0KJ 3QBCA 3B54A 3FCVA 2X7IA 5IQ6A 3UPFA 2DGWA 4JRPA 1HBMB 4KPYA 4YN3B 3AO1A 2JEGA 1CJKB 3TYTA 4HWIA 1F5BA 1WSJA 5ADXH 1GMWA 5HN0A 3B6OA 1I94F 2YHYA 4FF4A 1EQMA 3J81Y 3J7AN 3MMBB 3SQGB 4LFCK 3A8JA 5LMNK 4JHDB 3HK2A 1U26A 4Q45A 4XH4A 1N6QA 4CEFA 1FK9B 1XNQF 2OLWA 4EWTA 4DR7K 3Q89A 4DQQA 4Z0UA 2XMAA 5DG8A 5K5MA 1FJCA 4DV1J 2J6TA 3UR0A 1FE0A 3TEGA 5MLCV 2B4VA 1QZ6A 2C3PA 3LDPA 5A8KA 4FLYA 2RB7A 1QJHA 1NXIA 4QIFA 4MK8A 1IBMK 4OI0A 2Q1NA 2G2YA 2QTWA 3I82A 5CH7B 1U0HB 4QIGA 5JMVA 2P9KA 5DQHA 3F41A 3CM6A 3ZZOA 4JI6J 4CLUA 2VB6A 4QR0A 4DV3J 3VF6A 2VQFJ 2QL7B 3WZ0A 3CCWA 1RAIB 1R0CB 1WSRA 1KC8O 2QMUB 1X0FA 2V7YA 2HNDB 1Y4ZB 3RBDA 4DSJA 1FXRA 3JXUA 2ZUAA 3K8VA 4DL2A 3I4PA 4OPAA 1NGBA 4OHXA 3R1LA 3TZWA 4LF5J 5BN8A 1WG1A 2HQ3A 4ZS6A 1K47A 1S99A 3FEZA 2PO4A 5AQTA 4J5OA 4FJ8A 3DXMA 1XUPO 1IBCB 1TK0A 2LXIA 1TQLA 1IVZA 1YJNN 2GVZB 3DI6B 4B9TA 1FWKA 1B9DA 3FZMA 4UOGA 5GADU 3AA4A 1SL1A 3AVGA 2DRAA 3D6RA 1X9SA 1UW4A 4QW9A 3KIOA 4IRCA 5GINA 2ZF5O 5HO4A 4M94A 4LRDA 5LMUF 4LIRA 3H59A 4AHCA 1PJ5A 4LF5K 4ITSA 3KLEA 5KFKA 4AH9A 1ZAVA 2F4VK 3HMJG 1SC3B 1Y11A 2YQ3A 1K9MO 2LEAA 4RBVA 5G4DA 4K4TA 3G6EN 1OSCA 3KZBA 3V1QA 4X4RA 1U45A 2HSTA 1YQHA 3CJ8A 4JI2J 2RU3A 2IAJB 3GJTB 3LALA 1RTDB 4ZIWA 5L1KA 3QLHA 2XWYA 3UKRB 3CCUN 2MJUA 4M3YA 1Q7YT 4G1PA 1UFLA 3KUEA 2UXCJ 2FC0A 5TKWA 4W5QA 3MUTP 1OKJA 1ASUA 4UQGA 2E1YA 5KPRA 1S1XA 4ZVUB 2W01A 4HACA 1NDPA 3NGTA 1RT4A 4DS4A 1DARA 4WFAL 2V68A 5KG6A 4WFNL 1BHNA 3QEWA 2G8UA 1U8WA 1YJ9S 2PBDA 4AM6A 4W90B 5CYQB 1D09B 3E01B 3KVGA 3VN5A 4ED7A 5GAGI 4WU2A 1JJ4A 4AQYJ 3EVOA 3POTB 1TR0A 2BQ3A 1N32J 4DTPA 3HFZB 1Q86O 1MWMA 4FBUA 1Y64A 3VV2B 3MOZA 5IFMA 4HDGA 2P9LA 3PO5A 3GPAA 4ZHRA 4KHRA 2PZSA 2B9EA 1MN7A 3ALYA 2XNQA 5A8RB 5KAKA 1S1XB 3WBZA 1M1KT 2EKYA 4M63A 2Z0GA 2VJVA 4M3ZA 2OMLA 2YWKA 4M5DB 2AD9A 1DEJA 4KH1B 4CVNE 1PO6A 1H1VA 5KGWA 4NCGB 1FT8A 3VGVA 2YKMB 3NHGA 4RUHA 4B1VA 1IKWA 5B0FA 2WB4A 2DJWA 3CDUA 3D4JA 5IT4A 3VCDA 1RTIA 3E2EA 1RTHA 1QLNA 4BCAA 1XMBA 3GTYX 1CJUA 1D8ZA 1QZ5A 5A8WA 3QFUA 4IXCA 1BUXA 1F9EB 1U6FA 1T11A 4PR6A 1GFWB 3VQEA 1HD0A 1HBOB 4IOXA 3QICA 1REVB 4OZLA 3QB0A 2FTRA 8RUCA 3OTEA 5MLCQ 1N5YB 4QU6A 2LCWA 2ADBA 1RKJA 2YKOA 3P6YC 4RBUA 1IR0A 1T3OA 4YHHF 4EFHA 2XWXA 3ZNUA 1B99A 2U1AA 2GO8A 3KHHA 1QE1A 5HMYA 3RZAA 3CQ8A 1X4BA 2DNMA 1FERA 1KVAA 3R9PA 1Q0NA 2DHXA 2EFGA 4JI4J 4PABA 5D78A 1NU4A 1TL1A 1URRA 4CIOA 1BL3A 3NAIA 3D0PA 2QWMA 1XMOF 4KHQA 2N4DA 3EMTA 4DL7A 4KGMA 3QIOA 5AE2A 1YHQN 2W7OA 2RF2A 2I8EA 3DMJA 4IQMA 4K0KF 1UJ5A 3KLGB 2J7KA 1YJWS 2QG9B 2J76E 2KB2A 1KNZA 1RSCA 4TY9A 3HVTA 3D3CJ 5F1XA 4CZMA 1K8KA 3ISND 3CJ3A 4FZXC 1EZZB 3K17A 2ZUGA 1GLAG 3FEXB 2WVCA 3DXBA 3NOGA 4B9LA 1NGGA 3K2YA 4IKAA 4FK4A 1KTQA 1FA0A 2VF3A 2BH1A 3CPWM 2EX3A 1RDAA 4P72A 2KL8A 2PFFB 2OJ3A 3VF4A 4IG3A 5CYMA 4QYRA 1ZZFA 4PG4A 2OTLS 2K2PA 2W2QP 4AD6A 4DTRA 1WG5A 4NXMK 3IM8A 5IT9U 5K20B 3SAFA 1S1VA 3PIOQ 2MQNA 4FYVB 4LR7A 2BE2B 2AZ3A 3MK6A 5IOLA 2G13A 4OGEA 2EG2A 3THXA 3MEKA 4P9SA 2WCXA 3BPDA 2QYCA 4X66F 1EP4A 2VQFF 1IXKA 3NLCA 4NYOA 1N88A 2ASDA 5DQIA 4BACA 1MWYA 2G8KA 4F4YA 4JI7K 4QS8A 3A3OB 1N33F 1N6QB 4MK7A 2HFVA 3FMWA 1R0AB 4CLWA 1IWGA 1LWFB 3FRYA 5DO2A 5GAHI 2E7WA 3KLIB 3V2UC 4CGFA 1WKLA 5FPDA 1VC6A 2HHHF 5IWAK 5F8IA 3CSKA 1YJUA 4OYZA 2IFXA 1XMOK 2APOA 1WBDA 3G6ES 3SI6A 1E6YB 4ATNA 4UY8O 2WONB 3LPYA 4ZTJA 3LO3A 2EW9A 3EGNA 2CQDA 4Q2MA 1JJCB 2Y1JA 4I4BA 2P51A 4USHA 1EXQA 2XY7A 1LWFA 1H3DA 4IO9Q 2GWKA 3E9OA 4CWBA 1TL4A 3BEGB 4CJFA 2FLPA 1FXLA 2IHR1 1LOTB 1JLBB 4LC9B 3QT7A 2CJYB 1UETA 1RDWX 3MUMP 1O8BA 4UW2A 3GP9A 5C24B 2MZ1A 4WKYA 4ZVGA 1E6YA 2YHWA 2K7JA 4CZFA 4A2AA 1VOMA 2FJWA 5M1KA 3CCRS 2OP5A 1DAXA 4FWRA 4J2EA 4RW4B 3BN7A 4P2MA 4DR4J 1RWXB 3GFXA 2HF3A 4F3QA 4GC7A 1FNOA 3M30B 3M2RA 3QT5A 2LQ5A 4ZCIA 5H1SV 4BWMA 1S0MA 5DM6Q 3R6MA 1PC5A 3TZXA 3M8PB 3QPIA 3LOUA 1HNWF 4HHUA 5ITHA 3Q8PB 5DLGA 3VQSA 1N5QA 5ETOA 5GAEI 3K5LA 3FGUA 4LD0A 3SK3A 2WW8A 5DZ6A 4P73A 4TQRA 3TZYA 2VQEK 1G1XA 1RAGB 3M6UA 3PW0A 3AOCA 2EVZA 4I64A 4AHUA 2W24A 3QJJA 1KWMA 3QINA 3AO5A 3IDHA 4L3KA 2ILZA 2I0XA 1T9XA 3JB9k 4I6MB 3M8PA 3I8DA 2XLKA 2D0OA 3QAUA 4CJKA 4WP8A 4OI4A 5DS7A 3DRPB 1RHJB 1TGOA 3OYCA 2X78A 1NZ8A 5KFCA 3QMLA 2VCPA 1ZBHA 2W2MP 3TAEA 2EEYA 4J9UE 1Q1KA 5I3UA 1VLOA 2UVWA 5M2PA 3PLAA 2D3ZA 4WE1B 5DDOC 2HS4A 3VEWA 4MFBA 1X5PA 2RU9A 3U1MA 3D2EA 4YDDB 4CJ4A 1TYQA 3W1YC 2QFJA 3CCLN 1YGYA 3T1AA 3KLFB 3MPYA 1SL0A 2UYTA 3T5KA 2YBVA 3KMSA 2W4DA 3BQ0A 3ENQA 3TOQA 4OX9K 3JAMU 1S6QB 5D0EA 2YKAA 5KPTA 2IVYA 4IYQA 3H98A 3DLBA 2QRRA 2ATCB 4AL7A 4AF1A 2YWGA 3BQ1A 2GGPA 3GJSB 3N6MA 2MZSA 2F4VF 3CCVN 3NCRA 2D74B 4U7CA 2IA6A 4DV0J 2CGKA 3M6VA 2NPIA 2UXCK 2UV8G 4HYKA 3MPVA 4NX9A 2FBVA 4DR5J 3CJ1A 2QSFA 2RHSB 3CCTA 3CERA 1PILA 2DPIA 1T94A 2FSJA 4USMA 2MQLA 4LF7K 2CRLA 3MM7A 1RTIB 3HSZA 1Q9XA 1S4FA 4OZJA 2WVDA 3GFHA 2O8DA 1RTHB 3HOTA 2FQQB 1UWBA 3M1FA 3HP6A 1NK0A 3ZFVA 4OL8A 1TL7A 2BM0A 4ZIVA 4ZMMA 4QWAA 4B3SJ 3AJ2A 1M0SA 1VQMN 2B8QA 3W2WB 2PE8A 3PZPA 2NCKL 4GKJJ 1KN6A 4H8KA 2PD1A 2WK4A 1MLAA 2F7VA 3L2WA 1REVA 1T7PA 2RJZA 1WOSA 2A18A 1TU0B 2QE5A 4FWNA 2KQ2A 3D2FA 5D0GA 3FZKA 2QW9A 2VPXB 4M5DA 4ILJA 1RWWB 3Q8YA 1XBWA 2C2EA 1W2IA 2XULA 3NNCA 4ID5A 3MF5A 1UVMA 4FJ9A 4EP4A 3SQ1A 1N34K 4EBCA 1FFWB 5ETVA 4GKKF 5HSPA 2YNGB 3IUCA 4TU7A 2BR0A 2W7PA 2YKPA 3THYA 2A5XA 4IOCQ 2MEWA 3MCPA 4BRDA 4FM2A 2H1YA 1J5OA 2B8PA 1Z26A 3HI9A 3PEJA 1YT3A 2HGNA 1RILA 1SB6A 4YR2A 3T9NA 3MD1A 3J7A1 2BMBA 1G99A 1N33J 2Q3SA 4JV5J 3GV5B 2FZKB 4NYFA 4TNOA 2RH3A 1HI0P 2JRSA 5L38A 4JI7F 5KG1A 3GV7B 3ZZUA 2QFIA 3QEPA 3QRQA 1SC1B 1G2EA 1HWJA 3OXGA 4K8ZA 1QAIA 3BBCA 4QR2A 1FRHA 1NDKA 2QL9B 1Q9YA 1VSKA 1PCAA 4CK1A 3A8EA 5CYQA 2DXEA 2FHJD 1D1UA 3NNHA 5J2PA 3C6AA 2A6MA 2W6KA 4PYAA 1LWEB 4UZBA 2VASA 1BXNA 1RU1A 2DGXA 2KFYA 3AO3A 4RR5A 3O4WA 3AAQA 3AGRA 2ZVIA 4CLLA 4CHYA 5F8HA 2NYIA 1HWIA 3MD3A 5A8RA 5KFAA 2RE1A 2CPZA 1SUQA 3UWTA 1FKOB 2HHVA 2GIFA 4DL0C 4ILGB 1CSJA 1S72S 3MR2A 3MEDA 1C0TB 2Q3PA 3OS1A 2IMWP 3D6TB 3VQ7A 3PNIA 2V6AA 4CF1A 2Q0UA 3ZT2A 1KAXA 3OJSA 5IWAJ 4C8OA 2NXUA 1ZA2B 2DCLA 1BA1A 3FBBA 3C95A 2BJ7A 2D4WA 2N7YA 3BYPA 3SXLA 3OL9A 1NPRA 4C8LA 1ZA1B 5E33A 4KTQA 1XR7A 4JI3J 4CFAA 3O44A 2CPHA 4BGBA 4QWEA 1R7IA 1FKOA 4WQ4A 3LANA 2IMOA 4RBTA 3V9ZA 3OBYA 1C1AA 3R97A 2PY5A 1FK9A 4O44B 4JKGA 3SUOA 2WRMA 4KT0C 2GQ2A 1FF2A 3ETOA 2HFUA 2KYZA 2W6LA 5HRSA 3AVIA 4GVMA 4GC6A 2J7UA 3I4HX 5DETA 4BG8A 4NLCA 4B8AB 1EP4B 1Z2ZA 3KXDA 2H3EB 3EE8A 1EKEA 1V9OA 4YB7A 2KRRA 4BRQA 3NH1A 4E0DA 4DR4K 3DM2B 2AA4A 3BZQA 2O8BA 3VGUA 2MQPA 1UJ4A 3ENBA 2V94A 3HSCA 3QWPA 2K06A 1JLEB 4JN4A 5LSRA 3HSDA 3EKUA 1SH2A 4JKEA 3FC9A 2DR9A 4CGIA 3E1YA 1W0HA 5AZJB 3B82A 4AHTA 2CGLA 2JFKA 1UEVA 3SQ2A 4H0VB 3HI0A 1RYRA 3O1BA 4KO0A 1HNZF 4DU4A 2Z2ZA 3CMAS 1R8BA 4NA1A 1YAGA 3BB5A 4DFPA 3T5LA 4C0HA 3VOVA 3DHXA 4YB5A 1Z4UA 1KLNA 5HQ8A 3I32A 4JBCA 4K41A 4JUZA 2C28A 4PWDB 2ZJRQ 4ECWA 4WIIA 1C0FA 4PXCA 2B3TB 4OZ1A 4NZ6A 2BW7A 2HHWA 4OJHA 1V3RA 3K0SA 4RTFD 2DPNA 5DZ7A 2W9AA 2ZZMA 1NJIT 5ETLA 4FXWA 1NB7A 1HBMA 2DGQA 2F4VJ 2ZZNA 3DJCA 5LT5A 3GIIA 3OLAA 1UVNA 2Y8YA 1S9GB 1SKWA 4A8OA 2MLYA 2PI4A 1WG4A 4ES1A 3T41A 2BBEA 4KRWA 4PG6A 1M1GA 1NOYA 2D0PA 4K59A 2MQ8A 3TVKA 1QVFM 3LDSA 1YIJN 1YX2A 2MGZA 4CHPA 2PAVA 2ROPA 1FCAA 2E2PA 5D3GB 3LM9A 5CCLA 1XNQJ 4JK8A 2DRBA 3VWSA 5E5NA 2FZGB 4ZPCA 3I31A 4USIA 4NLXA 4IH5A 4Z7CA 5A6PA 1S1WA 3AVHA 4IUFA 3DOKA 2CPEA 4E7LA 2EKNA 2IM3A 1MROA 5E3CA 3VQPA 4Q8EA 4ILHA 4DL4A 3G96A 4K2JA 5LY3A 2CQ3A 1X8DA 1R0AA 3FSIA 2ZWOA 2EK6A 1S0OA 3MWTA 1WC3A 5DQGA 1QAJA 1M5PC 3W64A 1D3WA 3LGNA 1C4CA 2J8SA 2DY9A 3WX4A 2ZH8A 4JI6F 3U7JA 2L48A 4C0OC 4DV3F 1HNZJ 4H4OB 2CDRB 1F9FA 3J7AP 4K0KK 4KI6A 1SQEA 2DR5A 5GADP 4B3OA 3H4BA 2RUSA 3HCXA 3SFUA 1BCOA 5KFXA 3VTHA 3UD4P 3R27A 3D7EO 2E5LK 1RT5B 5M2RA 3PRVA 2XZTB 3C14B 1WSFA 3BGRB 5BPMA 3MPUB 4NXMJ 3BPSP 3T1HJ 5M1OA 3Q8RB 1WUAA 4AHVA 4N41A 2LU1A 4B3MF 1HNZK 2P9PB 2X1AA 2Z1JA 1H73A 1RZMA 4J90A 2VJUA 1FXXA 3PIPL 1U2VB 3BSCA 1K1QA 5EDWA 1UFWA 5KFYA 1SH3A 4PUOB 4DR3F 2HHSA 5B0EA 2CG4A 2DGSA 4RNMA 1NGEA 4MLEA 7FD1A 1K44A 1QQOA 3NDKA 3UD3P 4W5RA 4G6VB 3AA3A 4K4UA 2AX1A 1U1KA 1U0HA 3CCZA 4F4XA 1K8AO 1BY9A 2FY8A 1CG2A 3OA9A 3D2WA 3ULDA 3D2FB 3BR9A 1CULB 5KFQA 2QA1A 1HI1A 3PACA 1X0PA 1VQYA 4KH0B 3QIPB 1N5SA 2VOOA 2BW2A 2OPSB 3CDEA 3VAHA 4ZVPB 2FJVA 1FVQA 1DJ0A 2BRKA 1GLBG 4OJ3A 4XK8C 1GH8A 4YP3A 4PUOA 3RTVA 1LWCA 3KFWX 2GJIA 2ILYA 3BGFA 3V9WA 3WEEA 3CC7N 4KQZA 3CCJS 3O8MA 2GMLA 2J0SD 3THYB 1GOCA 1JLAB 3M6WA 1FD2A 3DLLL 3EDRB 4B3SK 2FJDB 5FRNA 2DKOB 2ZH9A 2WZ1A 3PHEA 5AQSA 4V19S 5EWEA 1N5TA 3I5BA 4FNIA 4Q5VA 1IBKK 3HD2A 4R0JA 5FDLA 3KDOA 1IR2A 1VYAA 2GZOA 5JICA 3G71N 2RD5C 5HVGA 2ZWHA 2GVDA 4KSEB 4DUYF 3P96A 3M8QA 1RAEB 5B7WA 1SIWB 2A3JA 1FEEA 2RDIA 3KD5E 1TVRA 3EGWB 2QXLA 4BGAA 2HFZA 3MXJA 4X4TA 4NLUA 2A6AA 1OH5A 1XC3A 1B7FA 1C1CB 3B78A 3V4MA 5KFRA 3J80U 3V9UA 4H54A 5CQGA 1B9FA 1SJQA 2GVDB 3GMGA 3OQ2A 1MMNA 1VSJA 1LW2A 4DR6K 4DZ6A 1K6YA 1I94K 4A47A 2E9TA 1UAWA 4IEIA 3C65A 1VJWA 5B0CA 2YNHB 1N5VA 3O6QA 3CMQA 2ROGA 2HFNA 2E1RA 3E9LA 5D77A 1TMJA 1HQUB 2Q6BA 2J9EA 4B3RK 2BABA 2P9NA 2R8GA 5FJ4A 1OH7A 1DTQA 2CKWA 5KFIA 1WNEA 4K5SA 3HSJA 2BJ8A 4CNZA 3M3ZA 4W5TA 4CO0A 3S6EA 3DLEB 3POTA 2XLJA 3W63A 4DR1K 3SEOA 3MX5A 1VISA 2P9LB 4IG0A 3FCHA 3OW2M 4Z4EA 2J6UA 3BKFA 1H2VZ 4M5GA 1M1KO 3S1TA 3BDPA 2CUYA 3CJBA 2AP6A 4OKJA 2J9CA 3SAGA 2HQCA 1JWWA 4LF6F 4ZVQB 2WBNA 4JYAJ 2PFDA 1CEZA 2E1PA 4GKJF 4WIQA 3G2XA 1UEUA 2UUWA 4LF4J 2IBKA 2MXYA 2WUSA 3CEDA 4WFBL 1I5OB 1YIJS 3WIUA 5ETTA 2RKIA 3RB3A 1TELA 4KIAA 5EX3A 4QBUA 2KZZA 1X9JA 3NAEA 4DSKA 1GQEA 2HKEA 3VAGA 1X4HA 4CJTA 1SUQB 4FJJA 5A2QU 3EICA 3RG6A 2JLFA 2JDJA 4UY85 1IKVB 1HFEL 1SH0A 2R7SA 3BSOA 4O55A 2ZC3A 3B8HA 2ZJPQ 4JI3K 2O5DA 4DPYA 2HHUA 5GMKa 1Y3JA 2DNZA 2YNIA 5C12A 1C0GA 2J9DE 2PN6A 1LWXA 1QSYA 3TNVA 1X1PA 3JQJA 3QFHA 2BJ1A 3TTDA 1YUWA 5I3QA 1BC6A 4IH6A 1RA6A 1QQCA 1XHXA 2DGUA 1XJWB 4CESA 2GELA 2O8CA 3AB4B 3JYTA 3J8AA 4Y0WA 2GTDA 5HLFA 4J2AA 4AFFA 1KD1O 3AA8A 3VMFB 2LEPA 1RISA 3CCLS 4PWDA 4A8XA 3C16A 3CDAA 4KH4A 4DHYA 4EHTA 4LF9F 4U8YA 4LQ3A 4OI1A 3LZIA 4IDKB 2H65B 3TA2A 1HNXF 2FBXA 2H51B 4LFCF 3X3UA 2WSCC 1O51A 4Q7AA 4F25A 2HBQB 3FGVA 2JJ4D 1SS6A 4F4KA 2NS1B 3AY9A 4FS2A 3Q2SC 3IAS9 1IKYB 2UXBK 4LR8A 3QBWA 2E5JA 3DNCA 1R31A 4IO8A 4B8CA 3OS0A 4MIAA 3CPEA 4LSLB 2K1RB 1V5IB 2IJFA 5FLXU 4DUZK 1VLYA 4X66K 2C2KB 3ILJA 4IJNA 5C15A 1TL5A 2M9KA 1S6PB 5SZTA 4LBIA 3CCQN 3T19A 1AYEA 3CD5A 4HLBA 4KHNA 3AV9A 5C10A 1KC8T 4C1NK 3QFPA 3F56A 3RSEB 3VZIA 1R8PA 4DV6F 2J0WA 1AUDA 1HBNB 4KO0B 2A3ZA 4WXOA 4K4ZA 1S22A 4NLDA 2AJFE 1MWQA 2BUNA 1APSA 4S0MA 3W9IA 2C2DA 3K7RA 4KHMA 3ADAC 2DHHA 3SUPA 2E9ZA 4KREA 2WAQD 3H8YA 2K3KA 3BH7B 1S1VB 4E2FB 1U4BA 2GWJA 4JV2A 3DDKA 2GC8A 4J9OA 3NGRA 1BISA 5HMZA 2ZNYA 1YJNS 4CH0S 2V2ZA 2J6SA 4O0NA 1CXQA 3GIRA 2XMJA 3NVMA 2HBZB 4BC7A 5C7PA 4NASA 1PSDA 2RQMA 4KKOB 4ERDA 3LF0A 2R7QA 4M5HA 1S6OA 3BR8A 5L9NA 3T3FA 5IT9O 1QVGM 4BC2A 4C8NA 4I1TA 3OFHA 1VQLN 3MMJA 2CJBA 2E5GA 1S9FA 2VG7B 3RWUA 2DXDA 3SSRA 5GIPA 3J80O 4RW4A 5F0WA 5CHCB 4O44A 4WFXA 4JKGB 2UUBK 4USWA 2C2MB 3R2DJ 4OPHA 1G3OA 1RCXB 3T5JA 2P9SA 2MHNA 4ELUA 2UXBJ 3GR0A 1J54A 2IC3A 2FVPA 3T1YJ 2PMHA 5H9EJ 1VFJA 1J5EJ 5GIOA 5IV3A 2ZOGA 4H0OA 1XR6A 3V9SA 3Q83A 3QSYB 2XTJP 3GYNA 3PHTA 1VRTB 2QLXA 5BYRA 2B7BB 5FD1A 5LXRA 1KR4A 5J1PA 4W5OA 4ZPVR 2E7VA 3CB4A 1RBTA 1JLEA 4C4WA 4B3TK 2CH5A 4DPXA 2V4RA 2JC1A 4F04B 5KT7A 4WYLA 5JVHQ 4DHVA 4K4WA 5LJVA 7AT1B 4AL6A 2HYIB 1Y5LB 1QSSA 3Q7BA 5J2NB 6AT1B 3QSIA 4F0HA 3DU5A 1B7YB 1ZYQA 3IP0A 1UW9A 2DISA 1TL3B 4ZVRB 2L08A 2HPUA 2KXNB 2QM1A 3CG7A 4FLXA 3C7NB 3VGKA 2GV1A 1I6JA 4HHHA 1S12A 4I7FB 1X9WA 2DY4A 1IQTA 4F2SA 3AAPA 5DGAA 2BOPA 4UTGA 1K73O 3GCXP 4ID5B 3BKUA 3EE3A 4USVA 2HVZA 1ZTTA 1NRKA 2HF4A 3UQSA 1WNSA 1N4LA 4Z4GA 3DLKB 2VGNA 2HNZB 4EYIB 3WUHA 3ETMA 2DEJA 3NE6A 4KHSA 4M7YA 3C7NA 2H3GX 3W9JA 2LECA 3WIVA 1A5XA 4DTMA 3MR3A 1Q7YO 4FJGA 1YK9A 2W8KA 1BO5O 3PX6A 2HSEB 3FR0A 3RB0A 1DQ9A 4YY3J 4DS5A 2IM1A 2HAIA 2HVEA 2PYJA 5KOWA 3MN9A 4FWMA 1N8RT 1HR0F 4JKCA 2UV8A 4RWXA 1KHVA 3MM8B 3BO2A 1A5WA 3VEVA 2BOAA 3PCOB 4USUA 2UUBF 4P2FA 4WZQA 1TKZB 1KCFA 4CJLA 3SSQA 2UUAJ 4TKTA 3IM9A 1XI1A 2OPRA 4IZ9A 2KT5A 2OTLN 3SI8A 2XY6A 4NA2A 5IS2A 3V4IA 3C66A 3FSYA 1VQ8S 1Q8BA 3A0IX 3UCUP 1QVFR 4ECXA 3AO2A 4JI0K 2YVSA 1BCMA 3FZ2A 4MTPA 1KOHA 3PDNA 3VGMA 4UUXA 2KXFA 2HWTA 3NMRA 1CZ9A 3AARA 3JS6A 4BR7A 1NK8A 3TX0A 1TTHB 2E1ZA 2MZJA 3A4TA 4BR9A 2RSQA 4GO7X 3QJLA 4DMZA 3NMUA 1SKSA 2UU9K 1ZM9A 1EWQA 1RNHA 1UPPA 4C98A 1HRHA 3ILIA 2OFHX 2V63A 5CD4A 4QYZK 3L7OA 1WUUA 3ZLJA 1ATSA 2YNGA 5I42B 2PFUA 1JLCB 3C15B 2R7TA 4DG1A 1FDNA 4KTWA 1FTCA 1HJRA 2JWKA 1UZHA 2IYIA 3NF8A 2F40A 3D28A 1WDTA 4DDFA 5AQZA 3CDWA 2CQ2A 4JLHA 3MUVP 4PEOA 3MGJA 1VQNN 4ZN1A 1U2FA 3R5BA 2HBKA 2W42A 3VEYA 4NZ7A 2R7UA 2DFHA 4C8ZA 1QTNB 1Z25A 3KJFB 3QGIA 5KFPA 2JEJA 4NLWA 3JS9A 1MSWD 3K0JA 2FPHX 3SJHA 1YBUA 4A8YA 2LA4A 1YG0A 4R5PA 2FD2A 4ZLLA 2ZWPA 2XBPA 3ENWA 2XCAA 1RT6A 2AU0A 3J80Y 4AILC 1P8GA 4MO4A 2H4WB 3EZOA 3HHLB 4OYPA 4CO3A 4XTTA 3TAPA 1Z05A 4BQLA 3SMZA 1U47A 2LU2A 3O9RA 2D1KA 2NLXA 2CNLB 4IDKA 2XB2D 2O8FB 2LVWA 3SYZA 1UAXA 2V9WA 4OZ2A 4PKDB 5BN9A 1FRJA 5B0AA 3THWA 2QMXA 3AY0A 3LH2S 5T7BA 1R8CA 2CPIA 3BKTA 2YV0X 3JQMA 3VQ5A 2RILA 2RHQB 4H5NA 1K8AT 3EDQB 4N5SA 2GW8A 4E89A 2M52A 3TJ8A 3P38A 4CIFA 2D0CA 2B56A 3TJ9A 4FJNA 3AA9A 2CQBA 4A46A 3NKYA 4K4XA 1RKIA 3UNGC 5HI7A 3UDLA 2HMIA 3DXKB 3G8SA 5KT2A 4LH4A 1TKTA 3BBBA 2QWPA 3KUGA 3NF7A 3QO9B 4RL1A 4IH7A 4OMFG 3VGTA 2VFUA 1F6TA 3THWB 3DLGB 3HHLC 4O0IA 5AQIA 2HZCA 1F0XA 2V8GA 3OFEA 5ADXA 4ZKAA 3QRPA 4V19J 2FC8A 3LP2B 3PXGa 1EQ0A 4DV2F 3G8TA 3JYTB 3FCWA 5EX5A 4K25A 1F3FA 3KLIA 3SNNA 3FJ2A 1WSIA 3C16B 4DLEA 2WVFA 1SKRA 1VSLA 2NZTA 4BRIA 3NS6A 4O3NA 3CJ4A 2PA8D 4RW9A 4RW7A 4KPCA 3J7YU 4A5BA 5J2QA 2JLGA 2BM1A 1TUUA 4F50A 3P5BP 2Y3YA 2X1GA 2G2OA 3HM8A 3OHRA 2SXLA 1TAUA 4LFCJ 3AVKA 1IBLK 4PKIA 1OH8A 3SQGA 2A1SA 5C2DA 2KFZA 1JQGA 3BGUA 2E66A 3R5CA 3R5GA 2DCUB 3MEDB 4E7HA 2W40A 3T6BA 2NRVA 1NNDA 5JJBA 4CLZA 4ZPDA 2KN4A 4NI2B 4Y2IA 2OI2A 3KUHA 4K42A 4RCHA 2E7XA 1PIEA 4ZITA 3TAQA 3GLJA 4N8OA 2EC2A 2G8HA 2CQPA 1QHTA 4X64K 4DPWA 1KVBA 1L3VA 2YHAA