1JLEA

Crystal structure of y188c mutant hiv-1 reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
549
structure length
524
Chain Sequence
PISPIETVPVKLKPGMDGPQWPLTEEKIKALVEICTEMEKEGKISKINPYNTPVFKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGANRLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 133
structure length 524
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jleA05
2HVIA 1NK9A 4E7LA 1UAXA 3OVNA 3AA2A 5DK5A 3OYJA 1R0AB 4ZVEA 3V6DA 1J5OB 3SCXA 2XY8A 3ZT2A 1YVUA 3QERA 1UA1A 3MECA 1T8EA 1CXQA 4BDZA 3KLGB 2BGGA 5DQIA 4KI4A 1RDRA 3BQ0A 3C6TB 2FJVA 3I0SA 5KT4A 4KO0B 3NMAA 4EBCA 1TL1A 3QEXA 4IFVA 2IM3A 1KFDA 4KV8B 4E1NA 5DQGA 2BDPA 3DRPB 3KHGA 4CEEA 4QW8A 5KT5A 2B6AB 5KFZA 2ZQBA 2XRIA 5CY4A 4J9OA 1S6PA 2B5JB 2C28A 1XHXA 2WTFA 5T14A 3PR4A 4ZPAA 3AVHA 3BSOA 2QKKA 1MMLA 2W8KA 4QWCA 3B6OA 1LWEA 3JYTA 4DLGA 4DFPA 3RB0A 4AHRA 2P5OA 3HVRA 3G0ZA 2JEIA 2YNHB 3FQKA 1WAFA 2LSNA 1HMVB 3PUFA 3AVKA 3KK1B 3OYHA 4Q43A 3G6YA 3ASMA 5KFPA 4K4WA 3V6HA 3CFPA 1KFSA 4FJMA 4I7FB 2HMIB 3NBPB 1JXBA 3OJUA 4J9LA 2JC0A 2VG5B 4O5BA 1S1UA 1W9HA 1RT6B 3VQAA 4FYDA 3SYZA 1SKWA 3VQ5A 3UR0A 1BI4B 2XY7A 1LAVA 2KW4A 2P51A 3KJVB 1JKHA 5J2MB 1TL3B 4J9MA 1SUQB 1RT7A 4LQ9A 2YKNA 4H4OB 1CXUA 1ITGA 4TY9A 4I2PA 5F9NA 3MR3A 1VSHA 5F8IA 3LP1A 2R2SA 3DLKB 3ISND 4CESA 4CJLA 2A1RA 3OL8A 1JLEB 2YNFB 4NCGA 2RDJA 4JS5A 2XO7A 2KTQA 3L3UA 5KG2A 4CEFA 4KKOB 5KFOA 4CHQA 2Y1IA 3CJ2A 4IR1A 3G6VA 4NLSA 4URQU 3P1GA 2R2TA 1JLQA 1S49A 3CM5A 3H4DA 4QOZB 2UVVA 1C0UB 4Z4CA 5L1LA 1KVCA 3HPOA 2FLLA 2HB5A 3NGDA 4B9NA 1JIHA 5KFRA 4CHYA 2UUTA 2X6SA 4HCCA 5C42A 4M3TA 3KHHA 4LQ3A 3M8SA 1WSIA 3NAIA 3H59A 4CHPA 4LSNB 3OYDA 1QS4A 1EETB 2O4IA 5C24A 3AO4A 4Y1DA 1JLAB 5KFFA 1RT4B 4O55A 3BREA 4MK9A 5KGWA 3THVA 3UQSA 2HNYA 2EC0A 2WOMA 4FJ9A 4Z4HA 1X9MA 2FVCA 5CYQA 4OGCA 2G8UA 2WONB 4PA1A 4CJRA 4CGDA 3OYKA 3K59A 4Y2AA 1CLQA 3KLFA 3MEEA 4R8UB 1LWFA 2IS3A 4CJSA 4ED2A 1C2PA 1B9FA 3DOLB 1WSEA 3F9KA 3TAGA 3M9NB 4O4RA 2YNIA 4M94A 4EZ9A 5KFTA 3UDLA 5KFHA 4LSLB 4JV1A 1NK6A 2R2RA 3H2LA 3TAMB 1RDAA 1KLMB 1S9FA 5KFCA 5J2NB 2DPIA 3OYFA 5I3UB 1LW0B 4C8OA 1FKOB 5KFVA 4FJGA 1S1VB 3KMQA 4DG1A 1HYSA 2R8KA 2W9AA 4IH7A 3S3MA 1QAJA 5KG6A 3SPYA 3BR9A 2E9TA 4ZHRA 3RR7A 1S1TA 3L2RA 4URGA 1EXQA 4C8MA 4IG0A 1RTDB 1S9GA 1I39A 1JLBB 4AHUA 3T5HA 3KMSA 4ECUA 4TSXA 3VA3A 3QYYA 3DLBA 4Z4EA 1TAUA 5K14A 3V4IB 4BE1A 4FJ7A 4RW8A 3CDWA 1LW2A 2B43A 3GIKA 3SUNA 1RT3B 3IS9A 1YTAA 2OH2A 3QLHB 4M3YA 3I5AA 1U09A 5KFIA 4NLRA 3DLHA 3OSNA 2ILZA 3M8PA 4RG8A 4B8AB 4JV2A 3MXIA 3BSAA 1BCMA 4PY5A 1FK9B 1RBTA 1QSLA 1C0MA 3MEGB 3PY8A 3I0RB 3U3GA 4RW7B 3RB6A 2IAJB 4Z0UA 5D3GB 5T7BA 2W9CB 1BIUA 1RBVA 3SQ2A 3QEPA 1NK5A 4DTXA 4ZP8A 3VQ6A 1GOCA 4Y3CA 3HP9A 4CK2A 3Q8RB 2BR0A 1S0NA 4R5PA 4DSFA 1XR7A 1HJRA 2GC8A 3FRZA 1VRUB 2Q3SA 3QIOA 1TVRA 4TYBA 1SV5B 2VG7B 2UVWA 4YP3A 1IKXB 3MR6A 4OVLA 4CK1A 3G10A 1JLFB 4FLVA 4R0EA 2AX0A 4GC6A 4HHTA 3H40A 5SWMA 1EP4A 4Z4FA 3OYGA 4KI6A 1NNDA 4GVMA 2E6MA 5DGBA 3AVMA 2DFFA 4CJVA 4FJ8A 3NH1A 1VSKA 4O4GA 3KK2A 2O4GA 5C5JA 2G8WA 1T05A 4LH5A 3KLEA 1JLGA 4DL5A 4F8RA 1NKCA 4Q0BB 4CF0A 3NDKA 1HPZA 5C25B 2GUIA 3L2WA 2R7YA 2X78A 1K6YA 1WSGA 2ZD1B 2FBVA 5CZ1A 1HQEB 2FC0A 3BQ2A 1N6QA 4FK2A 3FQLA 3OYAA 3RBDA 5J2QB 3RRGA 5DLFA 4CECA 4AHTA 4CJQA 4B9VA 4Z4IA 2G8FA 1KHWA 3TARA 4M3UA 1NHVA 5EWGA 1RT2A 1FXXA 1RTIB 4TY8B 3QINA 3MEDA 1C1AA 4G1QA 1TKZA 2EHGA 4WXOA 3GV5B 3DM2B 4YQWA 1XWLA 4QWDA 1YT3A 5KT3A 3S3NA 4ECZA 5FDLB 1VK0A 4M3XA 3NF6A 4MIAA 4XO0A 3ZCMA 3NGZA 4RNNA 1D5AA 3D28A 4B3OA 4ZP9A 4CEOA 5F8NA 4ED6A 1RAJA 4J9QA 3DRRA 3KK3B 5KFJA 4M95A 4PUOA 5KG1A 3V81A 2C2EA 4CJ5A 4CJUA 1C1BA 1L3TA 1Y97A 3N6MA 4MK8A 3I8DA 3SPZA 3PW5A 1ZBHA 4KHNA 5HBMA 5KRSA 3RTVA 4F4YA 4FK4A 4ECTA 4OKEA 5HLFA 4C8KA 3CO9A 1Z25A 3H4BA 2BANB 3VQSA 4DQIA 1Z4UA 2OPPB 4HCBA 4WE1B 3PJXA 1WNSA 3NE6A 2W8LA 2V0NA 4UQGA 4OKJA 2V4QA 1S9EA 2HHWA 4DF8A 4NLVA 1ZBLA 1NOYA 3KKRA 4KFBA 1LWCA 4FLYA 2I5JA 4IR9A 1D0EA 4FM1A 3KD1E 1S1XB 4EO8A 1IKWB 2G8IA 4FLUA 3ITHB 4DMNA 1T3NA 4O3QA 4NLTA 3M8QB 3C6TA 3QIPA 4FBUA 4IKFA 3PW2A 3DLRA 1GOBA 4KO0A 4CEAA 3U6FA 5KFXA 1EX4A 3E51A 4QWAA 3GV7B 1O1WA 3K5MA 1CSJA 4IOBA 4TXSA 3HM9A 1RDBA 3ZSZA 3QNNA 5L9XA 4NLOA 4KV8A 3RRHA 1NJYA 3DRPA 1I3AA 2B6AA 1S5JA 3TAPA 3JSMB 4EO6A 4DU1A 3H5UA 3HSTB 4K50A 1NOZA 4DFMA 3QEVA 2RKIA 4MK7A 3L2VA 3CFRA 2PYJA 4DSEA 1T03B 2HHUA 4QWEA 3CM6A 3MR2A 1REVB 1WSHA 4CJ4A 3DMJB 4ZP7A 4KE5A 2VG6B 1XR5A 2YNHA 2RF2A 4OJRA 4WFYA 4ED1A 3KLIB 4I9LA 3DRSA 3SQ4A 4BDYA 2J6UA 4GW6A 3SV4A 4DTJA 1KHVA 4DTMA 2FVRA 2QV6A 3NFAA 1HARA 4J2AA 2QK9A 4IRKA 1VSMA 1L3UA 3RR8A 2GV9A 1FKPA 4I7FA 2HMIA 4NLYA 3LZJA 2XHBA 3PX4A 4ZTJA 4F50A 4ID5B 3OYCA 3V9XA 2FVQA 5DGAA 1KVBA 3HL8A 4LH4A 4FJNA 3EYZA 3GIMA 4O44B 2AWZA 3D45A 1HRHA 4KTWA 2BQ3A 4LD0A 3GYNA 1SUQA 3DOKB 3U3YA 4W5NA 5HP1A 2DTUA 2WRMA 4Q45A 3MR5A 3IG1B 1RYSA 4ECXA 4B8CA 2C22A 3CDEA 3KNAA 1UA0A 3TR8A 1MU2A 3B6PA 4AHVA 4NLXA 3H98A 4KB0A 4OPJA 1LAWA 3WNHA 4MFBB 4PQUA 4H4MB 4ZVFA 1HQUB 2D0BA 2XI2A 5DMRA 1BGXT 5DLGA 1X9SA 4E0DA 1QUVA 4NLUA 2WK4A 4Q44A 4J9NA 4FJKA 2OPSB 4KSEB 2UUWA 4FM0A 3CJ5A 2BQUA 1C0TA 1RILA 1K1SA 2JGUA 2YNGA 1RT5A 2B4JA 2IA6A 3LDSA 1TP7A 3V6DB 2PZSA 1JL2A 4NRUA 3TWHA 3K5OA 3H5XA 1U4BA 1EETA 3GV8B 3RMCA 3BJYA 5I42B 5DG8A 4F4ZA 1DTTA 4CFDA 3TANA 3RB3A 2W9BA 3I0SB 1JLCB 2AGPA 3NHGA 1KSPA 2HHTA 4RW4B 1W0HA 4QCLA 3SUOA 1J53A 1XC9A 3QZ7A 3Q8QB 4B9MA 2FVSA 3IGVA 3EPGA 4MQ3A 3ZSRA 3BGRA 3NCIA 4O3SA 4CEDA 4CE9A 3CG7A 3LP2A 1N56A 3AA3A 3ZSOA 3MXMA 1DTQA 3RAXA 3LPUA 3L2UA 1A5VA 3O3GA 4R8UA 4OLAA 3ZSYA 4B9LA 4WZMA 1SH2A 4KPYA 4CHZA 2HHXA 3DOLA 5F8HA 1WAJA 3HJFA 3IRXA 4J2BA 3I5BA 1IH7A 4NLDA 4U6PA 1Q9XA 4O3OA 4ECVA 3S3OA 4PWDA 3K2PA 3L2QA 5J2NA 1SL1A 2P5GA 1LW0A 2IJFA 3CFOA 4K4XA 1FKOA 1U04A 3SV3A 4O3RA 4FK0A 4FLWA 1WLJA 2IM2A 4EP5A 3V6JA 2OPRB 1RTDA 2FLPA 4IFYA 4F3OA 1S1UB 4ECYA 4QPXA 4F2SA 2HHVA 2HNZA 2IBKA 5F8GA 3V4IA 1OS5A 3EZUA 1UWBA 4DQQA 2X74A 1A5WA 2C2DA 1JKHB 4OGEA 4CF1A 1RT7B 3AA5X 3QLHA 4I2PB 1HYVA 3VQQA 1ZYQA 1HNIA 4Y34A 2WB4A 4KB7A 3LP1B 4M3ZA 2R8HA 5DG9A 4FW1A 3V9WA 3V6KA 3SUPA 3DI6A 1U47A 1X9WA 4O3PA 5EWFA 3VQ4A 1SKSA 4YMEA 3D0PA 1FK9A 3MEGA 1XR6A 2UVUA 3I0RA 2V9WA 4RW7A 3AV9A 1JLQB 5D3GA 4DL3A 4M3RA 1CZ9A 4KBIA 1WNEA 4RNHA 3PJWA 4FVMA 5EUHA 3FSIA 4KHRA 3AO5A 3Q8SB 4FJIA 3ULDA 4E7HA 2AGQA 4IG3A 4CFCA 4CJFA 3ZSQA 2XCAA 3ALYA 3DLEB 4H54A 5J1EA 3VQPA 4QWBA 2IOCA 4TN2A 4Z4GA 5C42B 4IDKA 4ZVGA 2D7SA 5KFWA 4J9KA 1JL1A 4CJPA 5C24B 4RNFA 3AVCA 1DLOA 4HVJA 2BRKA 2Z1IA 3RMDA 4ZPCA 1JLFA 5KFMA 2FVPA 3T5JA 3H5SA 4W5OA 4KHSA 2D0AA 1X1PA 1U45A 4CJTA 2R8IA 4BWJA 2HNYB 2WCXA 2WOMB 4FLTA 1TKXB 3LWMA 2W7PA 3GIIA 5CYQB 4ECSA 1NK4A 4O0JA 4NZ0A 5DG7A 3QEWA 3V9UA 2ATQA 5JS2A 4CGGA 1HNVA 4W5TA 3KLFB 3MEEB 4B08A 4HYKA 1LWFB 3D5MA 3DLGA 1VSLA 1KVAA 3SI8A 3PV8A 5C25A 4KAZA 2XCPA 2E4LA 2CKWA 3NF9A 1BQNA 2YNIB 3AVIA 5SZTA 4EYIB 2J6SA 3OL6A 3Q8PB 1RBSA 4CGIA 3K5LA 1RTHA 2HNDA 4DL7A 3C95A 1RA6A 4CHNA 4RW6A 3NL0A 4HTUA 4B9SA 4MKAA 4RUCA 3V9SA 4CF2A 3LP0A 4DFKA 1S1WA 4G3IA 4ED8A 2X6NA 4E7IA 3KHRA 4ZHRB 1UOCA 1S1TB 1NJXA 2JEFA 4CIEA 2E9RX 3HVAA 4FW2A 5FDLA 4YR0A 3KLHA 2Z1JA 4WFZA 5HRNA 5K14B 4RW8B 1IKYA 3IAYA 3KD5E 5KFGA 2HVHA 1LW2B 2ASJA 3FFIB 1QE1A 1IKVA 4RW9A 2FBXA 4J9RA 3K57A 3PHEA 3TAQA 1BQMB 2AGOA 3O3HA 4FLXA 3MFIA 4DF4A 2D5RA 4NCBA 2KFNA 2XGQA 3C6UA 3M8PB 4CFAA 2OPQA 5KT6A 3O4NA 4I2QA 4ZTFA 3HVTB 1BL3A 5HRSA 5FROA 3G6XA 4N5SA 4CEBA 1TKTA 3QGHA 5J2PB 4ELTA 1VRTB 2XWYA 3BDPA 4WYWA 1TV6B 4TLRA 4ZP6A 3ZSWA 4FCYA 1KLNA 3PX0A 4WE1A 4OKKA 4AH9A 5F8MA 4CIFA 3HPHA 1XHZA 3RWUA 5JS1A 1KRPA 4FJXA 1RNHA 2OZSA 4JRQA 1N5YA 1WN7A 4ECRA 2QKBA 2AX1A 4BE2A 3QNOA 4ECWA 4XIUA 2JEGA 5KG4A 2D0CA 3NAHA 3AVAA 1S1XA 4DS5A 3LZIA 1IG9A 4URSA 4KHUA 3OYLA 1C1CB 3ITHA 4GC7A 4CJ3A 4EP4A 2YHBA 3HKWA 1EP4B 3H5YA 1S6QB 1NK7A 2Z1HA 3QO9A 4O4GB 3QEIA 1T05B 4CJKA 2RN2A 3KLEB 1J54A 1JLGB 1VSDA 2BRLA 1RCHA 5HROA 4B9TA 1Q8IA 1NK0A 3FDSA 4MH8A 5CYMA 1HPZB 4JLHA 4H8KA 3SQ0A 2IC3A 4JV0A 5KRTA 2IJNA 4E89A 3OYNA 4CIGA 2IGIA 1Q9YA 2ETJA 5KTQA 4DL4A 4IH6A 1ZBFA 4F4KA 1TQLA 3OS1A 3SUQA 3V9ZA 4KRFA 3OYBA 3E01B 3CWJA 1R0AA 1RT2B 1J5OA 3MEDB 2F8TA 4KHYA 4RNOA 2XGPA 3KLGA 3F73A 2GBZA 4ECQA 3OSPA 1K1QA 4B3OB 1S4FA 2XI3A 1VSIA 4ICLB 5KT2A 4FXDA 3PZPA 5KGXA 3OJSA 3QETA 1RT1B 4RZRA 4PUOB 4BACA 4J9PA 3M8RA 4GMJB 2B5JA 2O5DA 5KFQA 4DSLA 2J6TA 1C1BB 4M3WA 4K4SA 4RU9A 4ED7A 4DL6A 4KB1A 5HRPA 2HHQA 5HBMB 4BWMA 5F9LA 2YKMB 4H4MA 3BSNA 5HLFB 3LAKA 1HMVA 3ZT3A 4KHWA 2VA2A 1RBUA 1RTJB 1S10A 4WZQA 2ZKUA 3GILA 3KK1A 3OYEA 3NGIA 4F4XA 3RAQA 4B9UA 4WXWA 4ELUA 1TAQA 3AO1A 2HHSA 5EWEA 3GQCA 4NYFA 4ELVA 3NBPA 3M9MB 1NJZA 4DSIA 1EKEA 3OL7A 4MIBA 1NKBA 4K8XA 4KFBB 1LWCB 2VG5A 2I5JB 1BIZA 2ITGA 3S9HA 2FBYA 2FLNA 4M45A 2R8JA 4KAIA 3OYIA 1TK5A 1B92A 3CYMA 1RT6A 4O3NA 1BI4A 5I42A 3KJVA 3RMBA 5J2MA 1TL3A 3QIPB 4E1MA 2ASLA 4H4OA 1JLCA 4ZMMA 4MKBA 2RDIA 3AVBA 4RW4A 1HYZA 5EDWA 2AQ4A 2RPIA 1NKEA 3O3FA 4N47A 3DLKA 1SKRA 5FRNA 4X2BA 4FBTA 3WNFA 1JLEA 2YNFA 3HPGA 3AVGA 3CJ4A 4K4TA 1G15A 4W5RA 3OYMA 4KKOA 3RBEA 3H08A 2RKIB 3AVJA 4FJHA 3CIZA 1JXEA 1C0UA 2ZE2B 3V1RA 5E41A 2BE2B 3L8BA 4K8ZA 4NLQA 4CFBA 2IDOA 4XPEA 5EU7A 3DYAB 3IN5A 1A5XA 5HRRA 1S0MA 2RF2B 2YV0X 2NUBA 3DRSB 4DQSA 4DTNA 4F4WA 4K4VA 3N6NA 1RA7A 2KZMA 3MECB 3EY1A 4LSNA 2QE5A 1ZTWA 3L3VA 3CQ8A 1D9FA 3NH2A 4CGHA 1FKPB 1JLAA 1T7PA 1NK8A 2BQRA 4IBNA 1RT4A 1ASWA 4U7CA 3SI6A 5CZ2A 2WHOA 4KHMA 1QHTA 2OPRA 2A1SA 3PR5B 1TL1B 4M41A 4CJEA 4IFVB 4YR2A 1CZBA 1IO2A 3T3FA 4ZPDA 1D9DA 3VA0A 2WONA 3CJ3A 3VN5A 2VWJA 2OYQA 2XC9A 3VQ8A 3MXJA 2D41A 5KG0A 2FBTA 1S6PB 5F8JA 5HP1B 1VSEA 3ZT0A 4RUAA 2F8SA 1MU2B 4TQRA 1LWEB 4Y1CA 3JYTB 2R2UA 4CEQA 2XY6A 3TQ1A 3HK2A 2DPJA 1ZTTA 4DS4A 2DFHA 3CDUA 4E7JA 4PQUB 3AVLA 3VQCA 3BSCA 3A2FA 4LSLA 3OS0A 5KG5A 3N6LA 4JUZA 3TAMA 2VA3A 1RBRA 1KLMA 4QW9A 1ZETA 5I3UA 1W25A 4F2RA 2ALZA 4KTZA 4N56A 4DLEA 5KFBA 1S1VA 2W7OA 3SZ2A 4FM2A 3TI0A 3PO5A 4N76A 1C0TB 3TAEA 4OL8A 4FJ5A 2AU0A 2YNGB 2ILYA 2VWKA 3DLEA 1RT5B 1YTUA 3MAQA 1JLBA 1QSYA 1VSFA 3AVNA 4FZYA 4CCHA 5JXSA 4YNQA 1WSFA 2Y1JA 4HUEA 4FJJA 3HHKA 3SNNA 1GOAA 2F96A 3LPTA 1DTTB 1RT3A 3KOAA 4CF8A 2W9BB 2YKNB 4DEZA 4EYHB 4NRTA 4ZVHA 4J2EA 2HWIA 4ED3A 1J9AA 3VQBA 4WFXA 4CK3A 1NJWA 5KFAA 3I5CA 2EX3A 1TKXA 3OY9A 1BISA 1LV5A 4NCGB 3OS2A 3O4QA 3QGIA 3BGRB 4M42A 5L1IA 4DTUA 3LP2B 1QSSA 4E7KA 4DL2A 1DTQB 4K4ZA 3NGYA 4EEYA 1GX6A 3TABA 1KTQA 3SFUA 3OLAA 1YVFA 3VQEA 2D3UA 3PO4A 3QESA 2IAJA 2W9CA 3HYFA 5KI6A 1XI1A 4FS2A 1BCOA 3RMAA 3IRXB 1C6VA 3OL9A 3HT3A 2XY5A 2DY4A 2KFZA 3WNGA 4DU3A 4PWDB 4IQXA 3PVXA 2G8VA 4W5QA 1VRUA 1GX5A 1TK0A 2V4RA 1U48A 4K4UA 5KG7A 5KFNA 1SV5A 2ASDA 2VG7A 4CGJA 4N41A 3NF8A 4E19A 1RYRA 1IKXA 5KFLA 1QQCA 1ZBUA 4IH5A 1B9DA 4NLWA 3KKSA 3HP6A 4BE0A 2IM0A 3SJJA 4CERA 1IM4A 4IFYB 4WYLA 3RB4A 5L1JA 2HNZB 1TGOA 2QXFA 1KCFA 1T94A 1UWBB 3EPIA 2DFEA 3FFIA 4DTRA 4FZZA 4KREA 2Z1GA 3QZ8A 2R8GA 3G86A 3C94A 3AA4A 1HNIB 3IGNA 1L3SA 1BQMA 3P5JA 4Q0BA 2FJXA 2AJQA 3DI6B 2ZD1A 4NCAA 4HUFA 4I9QA 1HQEA 4CEZA 4FJLA 4TQSA 4DQRA 2C2RA 3HVTA 1S97A 2HW3A 1RDCA 5J2PA 5J2QA 1VRTA 1D8YA 3T5LA 3V1OA 1S48A 1TV6A 4ZPBA 3AO3A 2JC1A 4DG1B 1HYSB 4AILC 3KLVA 2G8KA 4IG3B 1RTIA 4TY8A 2E9ZA 1VSJA 4HKQA 1BHLA 1SL2A 3LWLA 3DM2A 4IG0B 5J1EB 4NYZA 1S9GB 4TYAA 3GIJA 4IRCA 4IDKB 1SL0A 1Z26A 4Q8EA 4Y2CA 3MFHA 1DLOB 2D3ZA 3IS9B 4QAGA 4IKAA 4JRPA 5KFEA 3KK3A 4DWIA 1C1CA 1JXLA 1L3VA 3LP3A 4Q5VA 1S6QA 4AHCA 4DTOA 5F8LA 3HO1A 4LY7A 1NHUA 2G8HA 1HNVB 2F8EX 4JS4A 3DLGB 4J9SA 4DU4A 1TKDA 1F21A 1JX4A 3WNEA 2KQ2A 3AO2A 4EBDA 4KHQA 1BQNB 2BANA 4OPKA 3HXMA 5FRMA 3SQ1A 3LANA 4E3SA 1RTHB 2HNDB 2OPPA 4R5PB 4O0IA 3PW0A 4ED0A 4RW6B 3ISNC 3KHLA 4OLBA 1TVRB 4CHOA 1SH0A 3OHAA 3P83D 2ATLA 3E01A 3V1QA 1TK8A 3LP0B 4Q8FA 1S1WB 3ZT4A 4CJWA 4YFUA 4FLZA 4C8LA 1IKWA 4F3TA 3KTQA 3ZT1A 4DTSA 4IRDA 4CGFA 3KLHB 3VQ9A 3M8QA 2JLEA 1IKYB 3KK2B 1QTMA 3LAMA 1N48A 2FJWA 2JEJA 4ID1A 3KIOA 3PX6A 1QE1B 4ICLA 1IKVB 4RW9B 1D1UA 1I6JA 1RT1A 4DFJA 3BQ1A 3UPFA 3JSMA 2OA8A 1U49A 2I1RA 4C8NA 5JUMA 3T19A 5KFDA 4RNMA 3AVFA 3C6UB 1S0OA 1SH3A 4AHSA 2PYLA 2OPQB 4I2QB 1T03A 1N6QB 5KT7A 3K5NA 1WSJA 1N4LA 1REVA 4EZ6A 1TKTB 3MF5A 3DMJA 5KFUA 4J2DA 3T1AA 2YKMA 2VG6A 1RDDA 3HVWA 2P1JA 3KLIA 3NKYA 3TVKA 4FS1A 1ZBIA 1RTJA 4NLPA 4KTQA 3VQDA 3SFGA 2E6LA 4G1QB 1TKZB 2GIRA 5DQHA 2OZMA 3PW4A 4NLGA 4K4YA 3LALA 4FZXC 1N5YB 3DDKA 2W42A 3K58A 5KFYA 3CJ0A 2CJQA 4ID5A 3OHBA 3EZ5A 1QAIA 3QIDA 2UVRA 1L5UA 3DRRB 3PW7A 4BDPA 3CVKA 4O44A 3TAFA 1ASVA 3NAEA 3DOKA 3V81B 2YHAA 5KG3A 5L1KA 3ICLA 2PY5A 4NYNA 3QO9B 3NF7A 3IG1A 2HWHA 2HAIA 3OLBA 3NH0A 4DSKA 5KFKA 3T5KA 2IM1A 5HROB 4DQPA 3QGGA 3ZSVA 4L8RB 2KZZA 5CYMB 4XPCA 4MFBA 2IC3B 1HQUA 4EBEA 4DSJA 3UIQA 3MTKA 2IMWP 4DTPA 3VQ7A 4CF9A 2ZE2A 4HUGA 2BE2A 2GIQA 4YR3A 5KFSA 3M9OB 2OPSA 1S9EB 1ASUA 3DYAA 3ZSXA
chains in the Genus database with same CATH superfamily
3BF3A 1Y10A 1X31C 2KFYA 4DR2J 3KWGA 1NM2A 3H2UB 5CZVA 5GMKa 1YVUA 2MZRA 3THWA 3QERA 1UA1A 3U1MA 4R25A 2VWBA 2ZH9A 4BDZA 3GSDA 1VAZA 1OVQA 3KLGB 4KI4A 1RDRA 3VPZA 3BS9A 1MWMA 5KT4A 4KO0B 1RTZA 1X5SA 4PWWA 5E3PA 1TL1A 3QEXA 4IFVA 2K06A 1RAAB 2CG8A 2IM3A 4N8OA 2UXCJ 2CPJA 3KHGA 2XSJB 1V4TA 5HANA 4KGZB 4J9OA 1YJWN 2C28A 1XHXA 5T14A 5DS7A 3PR4A 4ZPAA 4DU8A 4HT5A 2LEBA 1UP1A 3B6OA 4FWPA 4CDIA 4DLGA 3HTVA 1HHTP 3OHRA 4AHRA 3HVRA 2H54B 3CJAA 4FPAA 2LSNA 1O0PA 4NE9C 2W2PP 3MM9A 3SDEB 4CNZA 1B7YB 2Z56B 4X62J 1R0BG 4EFHA 1KFSA 5DM7L 4I7FB 3OJUA 2VFTA 3FBCA 4J9LA 2HBKA 5A2QO 2G0IA 2VQFJ 2VG5B 2XG8A 1B99A 3J8AA 3D2FA 1RT6B 3SYZA 1TYQB 2MY7A 3A0IX 3R9PA 4ID8A 3KJVB 1TL3B 1MROB 1SUQB 1OYDA 4LQ9A 4Q2LA 3MR3A 4DR5J 2VDIA 5E3CA 2QW9A 3A5LC 5M1NA 3J7AN 5FPEA 3ISND 3VAFA 5GMDA 2DGSA 3OL8A 4NCGA 2E5LF 3A5NC 3L3UA 4ANCA 1IBLK 4OPHA 3LPYA 3R5AA 4CEFA 5T7LB 4KKOB 2Y1IA 3CJ2A 2IRXA 4IR1A 3HCXA 1JLQA 3H4DA 3JTPA 3GFZA 1UFKA 3EE9A 4H5NA 4B9NA 1UAWA 5CABA 1XC3A 4CHYA 4OYXA 1PGZA 1X4CA 2DO0A 2GJIA 3CMAN 2BYCA 4M3TA 3QFHA 2VUGA 3NAIA 3H59A 4PG7A 4BG8A 1VHFA 4B17A 3OYDA 4YHHJ 2O4IA 5C24A 4NB4A 3AO4A 4Y1DA 3W2VA 2DPNA 5BPLA 2VHGA 1JLAB 1PJ7A 5AXMA 5MAOA 2HBJA 2YHWA 5LY3A 3THVA 3UQSA 4JN4A 1SQEA 3VGLA 2WOMA 1I1GA 4HHJA 2G8UA 2WONB 3O1BA 3LOUA 4CJRA 1JJ4A 2ZVSA 2A18A 3K59A 2AYEA 3KLFA 3M05A 2UXDK 2HS3A 5H1SV 4ED2A 5IT9U 1B9FA 3DOLB 1TMJA 1NAQA 3TAGA 4O4RA 1Q5VA 4WTYA 1RU2A 1HBNA 1NH7A 1RXOB 3UDLA 4DB3A 1NK6A 3BYPA 2IBOA 1SCJB 2DPIA 2ZH5A 5I3UB 1LW0B 1FKOB 4OI3A 1F9FA 3CDAA 1F0XA 3ATUA 1S1VB 4UUWA 4DG1A 1QAJA 1QQNA 3D54A 2E9TA 4X65K 4URGA 1EXQA 4C8MA 3LF0A 2KJWA 1S9GA 3T5HA 3O1WA 2XULA 1OH5A 5BRHA 1JCEA 1TAUA 2HRUA 2HOEA 3DDNA 2DGUA 3OXLA 3GIKA 3SUNA 1RT3B 3IS9A 1UEVA 1YTAA 4M3YA 2WVFA 3I5AA 1YBUA 2HZVA 2GO8A 1KOHA 2BXJA 3CJCA 1RJJA 3U1NA 3K5PA 4UZBA 2ILZA 3W9HA 2WC9A 4JV2A 3MXIA 3BSAA 3FZLA 1FK9B 3PY8A 1FXRA 3ENBA 4RW7B 2IAJB 4Z0UA 5D3GB 5T7BA 2V4JB 3SQ2A 4C0HA 2BA9A 1DURA 4ZP8A 3E9PA 5M1QA 4Y3CA 5AQSA 2QWLA 2H1YA 3MPVA 4DSFA 3SMSA 4JV5K 2Q3SA 3MZIA 2VV5A 3JB9k 3CMQA 2E1RA 2RHKA 2KHOA 3BKUA 3G10A 2NS1B 2ZBIA 2RAQA 3DC2A 3PNIA 3H40A 5SWMA 1WWHA 4Z4FA 1WBDA 4GVMA 2E6MA 2DFFA 3KK2A 3RAMA 3BBFA 5C5JA 1YUWA 1EAYC 1N88A 4LH5A 2ASYA 1VK8A 2M3DA 1U0HA 4DL5A 1BA1A 3C8YA 4CF0A 1X5OA 4DPOA 2KL8A 3NDKA 3MPUB 2X78A 1K6YA 3W60A 4LFBK 4HTLA 1WSGA 4N77A 4LF9J 2FBVA 1OY8A 1UW4A 1N6QA 3OYAA 3M6UA 1YI2S 1U2RA 3RBDA 4YOTA 4G1IA 2VU5A 1Q4RA 4B9VA 4CJQA 2C3YA 1KHWA 3TARA 1I94F 3QINA 3N79A 2YH1A 5LXYA 4WFBQ 5HQMA 1HI1A 1M90T 1TKZA 1MN7A 4WXOA 4NZ7A 1Z2ZA 2J9DE 4YQWA 5KT3A 3PYDA 4M3XA 4DUTA 3ZCMA 2VCPA 4RNNA 1EIYB 3D28A 2V5HG 4P7VA 4J9QA 2VPZB 2HFZA 3M1VB 3DRRA 5DDOC 4X64F 3SXLA 3G96A 3M30A 4QYZJ 2E5JA 3WEEB 4OI1A 2AJ0A 2DHSA 1Y64A 4PUOA 3WXMB 3V81A 1IBMF 3PXGa 4CJUA 1XQIA 1RHJB 1C1BA 1NDKA 4LBPA 4MK8A 3I8DA 4J91A 4JI8F 3PW5A 2YVSA 2VFUA 4PG5A 1HW8A 1X4GA 3M2UB 5HLFA 4C8KA 2Y9HA 1Z25A 4ZPTR 1OPIA 1N36F 4PXEA 2D0OA 4OFZA 3HHLB 3CD6N 3B4DA 4WE1B 2V8VA 3PJXA 1WNSA 2XS2A 3NE6A 4A48A 2IDLA 2V0NA 4UQGA 4BRPA 4OKJA 1LFWA 1PYSB 4B1VA 1HKGA 4NLVA 3IAM9 3KKRA 2Y0BB 2I5JA 3TEGA 3BF1A 5C2CA 4FM1A 3EVMA 3F9MA 1ZAVA 4FLUA 3J7A1 3ITHB 4WQ5A 2B4UA 4JHDA 3AOBA 4FBUA 3PW2A 3DLRA 1GOBA 4HDHA 4KO0A 1VQON 3E51A 2DNKA 1CSJA 1H6KX 4LF2A 3QNNA 1H1VA 3HRGA 1S5JA 3N0VA 4OHZA 2OFHX 1Y5LB 2P6TA 3H5UA 4ETZA 4DFMA 3DGVA 5K8OA 3QEVA 4DR2K 2PYJA 1T03B 1FRXA 3OVBA 2HHUA 1RHRB 2G9OA 3MR2A 1WSHA 1B3TA 1V6HA 3UD3P 5HJYA 4X4NA 1YRUA 4RLEA 1LK5A 4WF9Q 4FL9A 4JI1F 4BDYA 3WDOA 4DTJA 1X9JA 4KY3A 1RWKB 2FVRA 3NFAA 3X3UA 2QK9A 2KT3A 3RR8A 1G1XA 4I7FA 2UXCK 2PT0A 2KLAA 2P9IA 2D9OA 2A42A 1G2EA 4WQ4C 2KM8C 4P10A 2XYGB 3M8WA 5DGAA 1GLAG 2QA2A 1EQMA 1YJ7A 3EYZA 2R7WA 4O44B 2AWZA 3THTA 4X66J 5AQMA 3D45A 1KC8T 4RWWA 1HRHA 1SUQA 3GG0A 3KJQB 3IG1B 4YY3F 2C22A 3CDEA 1URNA 3B6PA 3PG9A 5C0YA 3MPDA 2EWHA 2BX6A 4MFBB 5EX3A 3SIPB 4X62K 3UCZP 4H4MB 1JJHA 2D0BA 5T7LA 5DLGA 1FHTA 2RU9A 3A5OC 2VQFK 3HLUA 1VCTA 3CTRA 3G82B 5KPTA 3GTYX 1X0PA 2ZBPA 2GO9A 1NUEA 1O6XA 3QSIA 1K1SA 2QA4N 2YNGA 3MN9A 4BQZA 1M0SA 2O8DB 4CZJA 5HN0A 4NXNJ 2P9GA 3TW0A 4LT6A 3AHPA 1YITN 2VPYB 5DG8A 2JRSA 3L9ZA 2YX4A 2JWKA 2AEFA 4QCLA 3B6BA 5CCMA 2DVIA 1VQ7N 3J80O 1VDHA 3Q8QB 4CZKA 3ZZOA 3IGVA 3EPGA 5CQGA 3LGNA 3PFOA 3ZSRA 3NCIA 4O3SA 3CG7A 3AA3A 1DTQA 3RAXA 2MMYA 3O3GA 1P9QC 4CO1A 2M52A 3FEXB 2FHKA 4B9LA 4WZMA 3J81O 3QAEA 1S6OA 2HHXA 3MOZA 3DOLA 5F8HA 1IJJA 4BQLA 4NMXA 1WC6A 4WCEL 3NMUA 3MM7B 4M8LA 4PWDA 3K2PA 2HZAA 2P5GA 1T9XA 1LW0A 1FKOA 3AH6A 3QJPA 4O3RA 1K8KA 3Q23A 5IV3A 4FLWA 4DPTA 2GUPA 4CYUB 2FLPA 3CCLN 4F3OA 1EKRA 4JI5F 2IBKA 5F8GA 5IT4A 2F3JA 2XQCA 4OZ2A 2X74A 1A5WA 2C2DA 1JKHB 3CDBA 3HSCA 4OGEA 4CF1A 3D1OA 5HO4A 1FWLA 1WKJA 1O51A 1HYVA 4LFAJ 2B0GA 3LGMA 4KB7A 4L73A 5B8HA 5C2FA 3PCOB 4CD3A 4FW1A 5EVZA 3T41A 1WJ9A 1JXVA 3LM9A 1X9WA 4O3PA 5EWFA 4K8RA 1SKSA 1S6UA 1FK9A 2GHWA 4RW7A 5D3GA 3GG1A 1GXTA 4XTTA 4KBIA 3PJWA 4DV5F 3OR1B 5EUHA 3FSIA 3Q8SB 4GV3A 4E7HA 4LBIA 2QWQA 2XMVA 3EEQA 2QTDA 3ZSQA 4FPRA 3P5TL 2XCAA 1RHKB 3ALYA 5ETSA 1TL4A 4H54A 5HQ8A 3VQPA 4M1KA 3A4TA 4Z4GA 1XJWB 2D7SA 1J5EF 4J5OA 5KFWA 2PFUA 4J9KA 4HVJA 2QX0A 4GNIA 4UUXA 2Q0UA 4H0VB 3RMDA 2E1YA 3OBWA 5KFMA 2FVPA 2ZF5O 2GVZB 2R8IA 4BWJA 2MLXA 3RUBL 4FLTA 3LWMA 4OLPA 2R7UA 2AW0A 2VKRA 2RUSA 5DG7A 4CNYA 3QEWA 4NMLA 1R8HA 3W8PA 1LWFB 3SCLE 3SI8A 5HQLA 4BVPA 2BW7A 2RQMA 2OSRA 3KG4A 2KRBA 2E4LA 5IOLA 5SZTA 1BQNA 1R8PA 1ROFA 2C3OA 2CGJA 5GAGI 4EYIB 3WIVA 3OL6A 2N7YA 1RBSA 4HDGA 3ZTRA 2JVOA 1RA6A 4A5AA 2NPFA 3U02A 1YJ9N 1HWIA 4B9SA 2FZKB 1VQ5S 4RUCA 5ITHA 1F5CA 2ZOMA 4ZHRB 2E7VA 5D4NA 5AR0A 1FRMA 2JEFA 4I56A 3BBBA 3I33A 3HVAA 2QO3A 4YR0A 4ILMA 4DQ8A 4WFZA 5HRNA 1U8SA 1IKYA 3IAYA 5KFGA 3ISZA 4LF9K 2YKQA 1GMVA 5KPZA 4Z7CA 3M1VA 1W2BR 1HR0K 3TAQA 3WEEA 4IO9L 2AGOA 4OYOA 3MFIA 5E7OB 2D5RA 4NCBA 3EDRB 2YX6A 3TVZA 2XGQA 4XH4A 2E1AA 2MKKA 4BC2A 2OPQA 1UL3A 4PKGA 3K8WA 1ATNA 2FF6A 2E2PA 3MDFA 4YDXA 4V1Ak 2XWYA 4ZVTB 4WYWA 2O8EB 2HIQA 1LWXA 4LRDA 2CWXA 3IWLA 1H7WA 2JSXA 3HHLA 2G1HA 4WE1A 3FZBA 4AH9A 4HACA 5F8MA 1ZH5A 4DKWA 4CIFA 1FCAA 4YEAA 4JYAJ 4QYZK 1RNHA 2AP1A 3D9BA 4BE2A 5B08A 3I4HX 1Y5IB 1N32K 4I4BA 2RRNA 4URSA 1HX1A 3ITHA 4GC7A 2ZH6A 1FRIA 1GXUA 3D3CJ 3H5YA 1S6QB 2F1FA 2P9SA 1VRQC 1BWFO 3DXKA 4PL8A 4GKJJ 4C8YA 5JVGL 2FQQB 4ER8A 1J54A 2EFVA 1D9AA 2PA3A 1VSDA 4B9TA 5HROA 1Q8IA 3FDSA 4MH8A 5CYMA 1URRA 1HPZB 4JI2K 2ROGA 2D1CA 3M3ZA 4BRCA 1RCOB 4F36A 2I7NA 3O5TB 5F3TA 1NGHA 2IGIA 1DAXA 1Q9YA 2OANA 5I3QA 5KTQA 2HSEB 4IH6A 1XK8A 5AQNA 1NZAA 4KRFA 2MQQA 5ETMA 3OYBA 3E01B 4FOIA 2YHXA 1PCAA 3N4PA 4CLWA 4YOUA 4OZ0A 3H1VX 1WTFA 4RNOA 2E1MC 1UJ6A 1VQ4S 2YTCA 3RJMB 2GBZA 5F41A 3D1HA 4BVOA 2CDQA 4B3OB 5A8KB 1UTAA 4LF4F 5KT2A 4BR5A 3PZPA 5KGXA 2QWNA 2X1FA 2VZ9A 4J9PA 2NLWA 3M8RA 2B5JA 4DSLA 3MN6A 4M3WA 4K4SA 4RU9A 4Y0WA 3W62A 5GAEI 4J90A 4XDCA 1FA0A 4KB1A 3LDLA 2HHQA 2YKMB 1CS4B 4H4MA 3DFEA 5HL7Q 4B1XB 1HMVA 4BC3A 1RBUA 1RTJB 4WZQA 3CCEN 1QVGR 3KK1A 4ES1A 1S5ZA 2GNKA 3TX0A 4CLUA 3AGRA 2B9WA 1TAQA 1PILA 3CJ9A 4DJBA 3GQCA 2I0XA 4X66K 4DSIA 4A62A 3EL2A 4YOXA 4K8XA 2O8DA 4R0JA 3MM5A 2XZTB 3H2VE 2ITGA 3S9HA 2VC0A 4I67A 3I4PA 2N4DA 4O3NA 1DARA 3A8KA 3GB0A 2OO4A 3RMBA 5J2MA 3BZQA 2QEXS 2V34A 3W2WB 2IVPA 3R8EA 3H6EA 5KPRA 4MKBA 4OHWA 1HYZA 5EDWA 2AQ4A 2R42A 1NKEA 4F0HA 4N47A 3Q89A 3G8QA 3GP9A 1TU0B 2Z2YB 4X2BA 4FBTA 1BMQB 1JLEA 2YNFA 4JI8J 4M5MA 3AVGA 1UJ4A 5GAHI 4JD2B 3ENAA 4USVA 1NPPA 2YKPA 3H08A 4DX5A 2RKIB 1FFWB 1ZM4A 4LF5J 3V1RA 2IRYA 3CC7S 4NLQA 2IDOA 4XPEA 5A8WB 5EU7A 3C14B 3IN5A 1A5XA 1KD1O 3VF6A 3AJ2A 3DRSB 3BF4A 3UD4P 3CCJN 3MM7A 2HBYB 4YB1P 5J1PA 4DTNA 4K4VA 3N6NA 2KZMA 2Z2LA 2QE5A 2R7OA 1ZTWA 3QFPA 1Q86O 4EUVA 1FKPB 5AXLA 4X4SA 1FKAF 2BQRA 1EHWA 3CC2S 2IIRA 4RKUC 4X4QA 2WHOA 1QHTA 3QWPA 4CYUA 2FIUA 4M41A 2CNNB 4RL1A 3WHIA 3NNAA 2CFXA 3CCWA 4MO5A 3P8BB 3CMES 3S1TA 3CJ3A 3K9JA 3J7YI 3VN5A 3EE8A 4H0PA 2MZ1A 3H7HB 3VQ8A 2CJ9A 2E2QA 1VSEA 1WORA 4A46A 3WXLA 1MU2B 4A8WA 3VGUA 1LWEB 1R0CB 3JYTB 2R2UA 4CEQA 3HK2A 2DPJA 2F40A 4YB5A 2DY1A 5K8PA 3D6RA 3VEOA 3MWTA 4C4WA 4LSLA 2PMZD 2DR7A 1RBRA 1KLMA 4QW9A 1ZETA 4DLEA 3OR1A 5KFBA 4JI6J 2GMJA 1TUYA 2MEWA 4N76A 3TAEA 1SJ4P 5A6PA 4FJ5A 2AU0A 2VWKA 1RT5B 3MAQA 4DV4F 1JLBA 4IYQA 5JXSA 4LFAK 1WSFA 1EO1A 4HUEA 4FJJA 1GOAA 2HIYA 3KDNA 1HNWF 2W9BB 2YKNB 4ZVHA 4ES3A 4HHUA 2GVZA 4PXCA 5KFAA 3I5CA 1LV5A 4NA2A 1JNRB 1BE4A 3QGIA 4W4MA 2FC9A 4C6AA 4A8QA 3TABA 2DR6A 1YVFA 1WG4A 4UY8T 2W9CA 3EGVA 3GE1A 3IR7B 3HYFA 2VD3A 4USJC 5MLCQ 3OL9A 4CBXA 3HT3A 2B8PA 2RD5C 4DV1F 4ZJOA 2O8BA 3WNGA 4IQXA 2OTLS 4W5QA 2V4RA 5KFNA 2VG7A 3NF8A 4IH5A 2V52B 5JVHL 1XTZA 4BE0A 3N5BA 4CT8A 2E7WA 3KXDA 5C15A 4LFCJ 4OI4A 2NXJA 1HHSA 1QTNB 3QZ8A 4MLHA 4DV2F 3AA4A 1HNIB 4I6AA 1L3SA 5BR8F 4Q0BA 4FYVB 1FRKA 4U7UD 5HVHA 1K73T 2M8DB 2DTJA 2F9DA 2FGCA 3M2RB 3W65A 1N5TA 3DI6B 3AXMA 3EXYA 1MWKA 1ZS6A 1YZ6A 4TQSA 2UUCF 1S97A 4NYPA 1CPZA 3TZWA 3ONQA 4BR4A 1S48A 4ZPBA 2O8EA 2JWLA 1HYSB 2C42A 4AILC 4CBUA 1ZM3A 1RGVA 2XHWA 2YKAA 2P5VA 5CH7B 1FJ7A 3LWLA 5J1EB 1KQFB 3T1HJ 2PSZA 4L3NA 2AP6A 4IRCA 4M5DA 3L4BC 4CRJA 4Q8EA 4M63A 1DLOB 1VQKS 1Q7YT 1Q0NA 4JRPA 4DWIA 3CB4A 2YPYA 1NRKA 1S6QA 3UNGC 1Y0HA 1Q7LB 4ISEA 4AHCA 5GIOA 2W4PA 1NDLA 1JJ2M 4DTOA 2G8HA 1HNVB 3H42A 3W0LA 3M5RA 3DLGB 2L48A 1NM1A 1TKDA 2VOPA 4JYAK 3AO2A 2HBZB 4EBDA 2ROEA 3R7SB 4LR7A 3MUMP 4WJBA 3LANA 4MYUA 8AT1B 2HNDB 3PW0A 1GEHA 2QMUB 1VLOA 3BDEA 3ISNC 2JWNA 4I68A 3KHLA 2CVEA 1TVRB 3ULEB 4CHOA 1SH0A 3MR7A 3JXUA 3LQVA 3P83D 1RAIB 2ATLA 3E01A 1TK8A 3LP0B 1XMOF 2AJFE 1VK3A 3HHEA 3CCMS 4YFUA 4GKJK 2XLKA 4FLZA 4C8LA 2EFQA 4F3TA 1TL7A 2BABA 2CPEA 1X5TA 4F0KA 3M8ZA 1PYTA 1KONA 3M8QA 3VQ9A 2WW8A 3VENA 1QTMA 3LAMA 2GELA 1X4DA 4CZEA 1YTYA 3KIOA 1QE1B 4IJAA 4ITSA 1D1UA 1CJTB 1VQ9S 1I6JA 1T11A 4PEOA 4RX6A 3M32A 4CLPA 1HNXJ 1U49A 4CO2A 4C8NA 1N5VA 5KFDA 1RGIA 2IYGA 3AVFA 3C6UB 2HF3A 4UZCA 3GG4A 3K5NA 2P9KA 3G8TA 1REVA 4DV3F 1TKTB 3GL1A 2YKMA 1YVNA 1PIEA 4MLEA 3MHYA 2P1JA 1OWXA 3NKYA 4BLGA 3TVKA 5KOWA 3R5DA 5TKWA 1RTJA 4OYWA 4ISGA 2BJDA 2Q43A 1P6TA 4USHA 4FVCA 1Q82T 4WKYA 4QS9A 4K4YA 3MWBA 3K58A 1EB0A 5J1NA 3N28A 2G2OA 3CJ0A 4HI2A 1VJQA 4ID5A 2RRAA 3LDNA 3OHBA 3QATA 2CQGA 2LFVA 1GMWA 2UVRA 2BM1A 4B3SK 3MI7X 1TZ0A 1M5VC 3CCTA 2JX2A 3GR0A 4PG4A 3NAEA 3AY0A 3W2WA 3ICLA 3VV2B 3B8AX 1QHAA 1K44A 4TU9A 2HWHA 2HAIA 2CRLA 1U25A 3WX4A 2NCKL 3NH0A 4X4VA 4DCJB 1AFJA 4L8RB 2KZZA 2EFGA 1ESVA 4ETXA 3S6EA 1HQUA 4LF7F 4CZHA 3OW2M 5IT0A 2IMWP 4DTPA 4CF9A 1S99A 4EU0A 3KNGA 5C12A 2GX8A 5A8WA 5GADU 4ZITA 1UAXA 1QAXA 2Z4PA 3OYJA 1R0AB 1J5OB 1NU0A 2XY8A 4B3RF 1UEUA 2WBRA 3NS6A 4DUYJ 1WELA 1CXQA 5HSPA 2V2QA 4IXCA 2BGGA 5DQIA 3BQ0A 2FJVA 1HWLA 1YJUA 2OIHA 2JZ5A 1KFDA 4JBCA 4KV8B 2O66A 4LF5K 4WPAA 4QW8A 2B7BB 5L9NA 1YJWS 2XRIA 5CY4A 3GR1A 4C7QA 4DX6A 3R1XA 1IJEB 1U8WA 2NLXA 1UPMB 2QSWA 5CYJA 2KI2A 3AVHA 2GW8A 4QWCA 1LWEA 3JYTA 1YIJN 4FNIA 4HR2A 4DFPA 4JKFA 2P5OA 2DYAA 2ZEJA 2YNHB 1X4EA 3VZHA 2PDAA 5BPNA 3B78A 3TJ8A 4JI0F 4F7VA 1CJKA 4RO0A 2W41A 3H46O 3OYHA 2NYIA 4Q43A 3H0PA 3G6YA 5KFPA 2CUYA 3H1QA 5EXWA 4HH1A 1T0TV 2HMIB 1O8BA 2Z57B 3MCMA 4DI6A 2ZHAA 2JC0A 5ADXA 4DV6J 1NZ8A 3MOJB 1VQ8N 4C97A 1MN9A 4FWNA 1NBEB 4I6MB 3VQAA 5JLFA 1SKWA 3MPYA 2XY7A 2KW4A 1HI0P 4J9MA 3HHLD 4LF8F 2YKNA 2DNGA 2HFSA 4TVAB 5ELZA 2FHMA 3IA0A 3DLKB 1FE0A 3CCUN 2EG1A 4OZLA 1S72N 2XO7A 3THXB 4K25A 1Q5YA 4JI6K 1KTVA 3PHTA 1PG5B 1S57A 4OYPA 4NYOA 1EZZB 4DDFA 2YWGA 4PHTX 5KFOA 4CHQA 3D67A 4E98A 1CQMA 4NLSA 3PLAA 2R2TA 1S49A 4N8NA 1C0UB 5L1LA 2FLLA 4J9VA 4JI7F 1VI7A 2FXUA 1NB7A 5JICA 3NGDA 4A8XA 2MZQA 4WFNQ 1JIHA 4J37A 3TUJC 1RWWB 4CD1A 2J9EA 3TYTA 1N54B 3OD2A 1JJCB 4NA3A 2X6SA 3TA2A 5C42A 3KHHA 2DNZA 3R6GB 2DISA 2P9LB 1HLWA 3C7NB 2IVOA 3IFRA 3ZLJA 1RBOB 4CHPA 1M90O 4LSNB 4FKXA 1QS4A 3US5A 2P9NA 2PO4A 1Q53A 1I5OB 1RWNB 3TWZA 2UP1A 3BREA 5KGWA 5EGYA 3ENOA 4Y0FA 5CYQA 5GAGP 4OYBA 3FBEA 4PA1A 1F2GA 4EIAA 3I8BA 1NGCA 4Y2AA 3MEEA 4R8UB 2ZNYA 4ZOSA 3GONA 3W1YC 2M8HA 3MN5A 2RMLA 2EVZA 2D69A 1WSEA 3F9KA 3M2RA 2YQ0A 3M9NB 4EZ9A 2YNIA 2MB0B 2FJDB 1FESA 4UOCA 4JI3J 4DR7J 3CJQA 4JV1A 3ZZTA 1UVNA 3R97A 2R2RA 3H2LA 4H0OA 3C6AA 1S9FA 3N4QA 4C8OA 3HSGA 2CJYB 3LA0A 3KMQA 2CYYA 2UUAF 1HYSA 4IH7A 5KG6A 3CC4N 1KAXA 1S1TA 2MZJA 4LC9B 1RTDB 5FPMA 4AHUA 5FLXY 4XH5A 3QYYA 5K14A 2HG4A 4RW8A 5LXRA 1SVDA 4NXMJ 2B43A 4WYBA 3ZX3A 4IOAL 2OH2A 2COLA 1D8ZA 1NLKL 2DO4A 4DR6J 2H4WB 3DXMB 4WTOB 3MMCB 5KFIA 3UI3A 1VC5A 2GWJA 3OR2B 3OSNA 1V3SA 4BCAA 2BTFA 1MNEA 1IXKA 2OJ3A 2EEYA 2GHVC 1TUVA 4BG9A 3U3GA 2O1PA 3IXQA 3T1HK 3FLCO 4P73A 2L9WA 1RBVA 2O01C 3QEPA 5F0WA 3CHWA 1NK5A 4Y28C 5A0YB 2LA6A 1KBRA 3BBCA 3Q8RB 3O2IA 2IPOB 2KYZA 1FNMA 2GC8A 2JFDA 3FRZA 1VRUB 1UZDA 1TVRA 3ULEA 2N7CA 4O8KA 3ZTPA 2FUG9 4Q2MA 1T6CA 2MYFA 4ANEA 3MR6A 3AJDA 4OVLA 1B7FA 4LUBA 4DX8H 3G9CA 4HHTA 2LQJA 4PYAA 3VGSA 3BY5A 2F5GA 3VGTA 5T41A 1WG5A 2WZ1A 2CQHA 4K7QA 3OTOF 4FSVA 1BU6O 5E3AA 1KC8O 2O8FA 1S59A 3TSQA 5LT5A 3KLEA 1JLGA 2GMHA 1CJTA 4F8RA 1VISA 3ZNJ1 2HPUA 5C25B 2GUIA 2B9YA 2RHSB 1NXIA 1UEKA 2XMMA 3D6MB 1PKUA 4AQYF 3BGFA 3BZKA 1N8RO 4JKDA 1HQEB 1PSDA 4FK2A 3FQLA 2V2ZA 4AYBD 3IMQJ 3BN7A 5CA5A 3CIPA 2AZ3A 2C1EB 2VQEF 4DV1J 2XMAA 3DU6A 1XERA 2DNQA 1G4CA 2UU9F 1RT2A 1RTIB 4TY8B 3MEDA 4OZ1A 3NCQA 2HS4A 1E4FT 4WP8A 3GV5B 3DM2B 1B64A 3RBZA 3MCPA 1UFLA 4ECZA 1PBUA 3SAHA 3NF6A 3FGVA 3NGZA 1HNXK 2B9XA 3EGNA 4AFFA 2BV3A 4BRGA 5GAEP 5E2QA 1X5PA 5F8NA 4F04B 2VOOA 3KK3B 5KFJA 2F65A 4Y00A 2ADBA 5DM6Q 1F2HA 5KG1A 4CJ5A 5HVGA 2AMCB 2ZDOA 3G2XA 3IM8A 3AD9C 2B3TB 2MY8A 4JP8A 1P90A 4ALZA 5HBMA 4ECTA 4OKEA 2ZUGA 2EK6A 2BANB 3EGWB 3DLLQ 4JK8A 3CT9A 1Z4UA 3ZETA 1FWKA 3BM7A 3HI0A 1RBAA 2VFVA 2V4QA 3JS6A 4GO7X 3KJFB 1YHQN 4CZLA 4F3MA 3IP0A 5BYQA 4IR9A 1D0EA 3MTJA 5B09A 3HSDA 5M1FA 3KD1E 1S1XB 4EO8A 3G71N 2RS2A 1IKWB 2GGPB 2ZGYA 2G8IA 5BYRA 4NLTA 5GAHP 3QIPA 4G6VB 1VQOS 1EJ7L 1NGIA 3NCRA 4IOBA 4TXSA 4V19J 5L9XA 3HT0A 4F9OA 4KV8A 1MLAA 3D0IE 1GXLA 4P75A 3TAPA 1S7IA 4DU1A 1A7GE 3H90A 5HMXA 4K50A 3TJ9A 4KHPJ 2DIUA 4U8YA 1KN6A 4MK7A 3L2VA 4GKKF 4DSEA 3WT0A 3ZXWA 3ZZZA 4QWEA 2DGXA 1U1QA 4W92B 2QXLA 4DUYK 2HBRB 1ZBTA 2P6SA 2VG6B 1XR5A 2YNHA 2RF2A 4ED1A 3KLIB 4I9LA 2R9LA 4AM7A 2EWSA 4K2JA 3NOGA 3M7VA 3SV4A 5EY4A 1XMOJ 4AXIA 4DTMA 2F63A 4AE5A 1VC0A 2DCUB 5M1KA 4C0OC 4J2AA 4IRKA 3J7YP 2GV9A 2HMIA 4NLYA 2WSEC 2W6LA 1WSRA 4F50A 1SJFA 4EI2A 2FVQA 3A8YA 5IQQA 2HF4A 4WQ4A 2FY8A 2OEMA 4LH4A 1U1RA 4DR3J 4I6MA 2LEPA 4KC5A 2HGMA 2KT2A 3GYNA 5B0BA 3BYRA 1DQ9A 5I3PA 1S76D 2DTUA 1P8ZA 4ECXA 3KNAA 3TUPA 2LCWA 3E1YA 2EI5A 3H98A 4LIRA 4OPJA 1K8AT 4CO3A 3FC9A 5HJXA 3MURP 3WNHA 1NEEA 4ZVFA 3EICA 1E6YB 1AB8A 3NVKA 3EE3A 3UE5A 5AZIB 1N34F 2NREA 4DV6K 4E0DA 5DDQC 4NLUA 4CH7A 2WK4A 4J9NA 4TLQA 5LSRA 3N9UC 5LMUF 4WP3A 4FJKA 3QNWB 4FXWA 2QA4S 4FM0A 2BQUA 1C0TA 4Q7AA 4OJHA 2O3DA 5AQJA 2B4JA 2XEXA 2IA6A 3LDSA 3OTDA 3O44A 2PZSA 3P38A 3C7NA 2J8SA 3K5OA 1F9HA 1YITS 1S12A 1P8GA 5FPDA 2ZJRL 2B7CB 3RMCA 4MKYA 4OX6A 1WF1A 3TO8A 5I42B 4F4ZA 1DTTA 4BR7A 4C98A 2VH7A 2D0PA 2PI5A 1DZ5A 1EX8A 4U7BA 1VQ7S 3SUOA 3U27A 3K2YA 3R5JB 3E66A 2VFRA 2NXCA 1WBBA 1YJTA 4ZKAA 2WTUA 1KQGB 3OBIA 2DNLA 5AQVA 3BGRA 2KYXA 3ILIA 3LP2A 3CCSN 3ZSOA 3W5ZA 2DEIA 2E1CA 1VMBA 4ENOA 1GLBG 4R8UA 2L9NA 2XNQA 5MLCV 4QZVB 4OX9K 5F1XA 3HJFA 2RVJA 3IRXA 4J2BA 2ZJQQ 4LBHA 4NLDA 1HBOA 1Q9XA 4O3OA 1VQMN 5A2QU 3N01A 5BREA 4K0KJ 3S3OA 3AARA 1SL1A 6FD1A 1V5IB 2E7XA 3PSIA 3C16B 3POTB 4B3RJ 1F60B 4NWBA 3FCVA 1KWMA 3CCLS 2LECA 3V6JA 1RTDA 3T1YF 3U7JA 4DV7K 2XMKA 3T7ZA 4ECYA 1IVZA 4QPXA 3HMJG 3D2FB 2DGWA 2RT3A 5DZ7A 3GIRA 2N4CA 2BJ7A 1UWBA 4DQQA 1X0FA 3W5XA 4JI3K 4P6QA 4DR7K 3VQQA 2L08A 2CH6A 2R8HA 4BBYA 5DG9A 3V9WA 3V6KA 3SUPA 2ZM6J 4L3QA 1KS2A 2AYGA 5FPNA 4BC7A 1GMWD 3VQ4A 4BGBA 1XR6A 3LM2A 2V9WA 2CAJA 1JLQB 4DL3A 4CP5A 4M3RA 4Z7YA 1CZ9A 3C46A 4RNHA 4FVMA 2PAVA 3AO5A 4FJIA 1HD0A 5A0YA 4NXMK 2A5XA 4KGVB 1NWKA 2HHHJ 4BRNA 1CEZA 4IOCL 4C3LA 1N5SA 4QWBA 4DR6K 4ZVGA 2JJ4D 5C24B 3HZ6A 3AVCA 3W2VB 1RQ0A 1FJCA 4DR4J 2I7PA 2B4VA 4LF8J 1H0HB 4W5OA 2D0AA 4PWUA 2RH3A 5AJ3J 4AXJA 2MDAA 2WOMB 5HK4A 4OYZA 2HWTA 2W7PA 1FJGF 4ECSA 1IR0A 1LXNA 3GSIA 1NK4A 2C2MB 2CGKA 4O0JA 3RZAA 5JS2A 4CGGA 1WSVA 1WF2A 1K0VA 3KLFB 1GK8A 1OO0B 4K2XA 3QT7A 3G87A 1IBKJ 1KVAA 1VQNS 3SCKE 5C25A 3Q7CA 1HFEL 3R5CA 2GEMA 2CKWA 4UOHA 3Q8PB 4OO1J 1RTHA 3C95A 1NGEA 2KKZA 1XIQA 2ZDPA 5IWAJ 1YJ9S 3VR1A 3CPWR 2D74B 2IVMA 5A6WA 1H2VZ 1S22A 5LJWA 2C3PA 3V9SA 4CF2A 2OEJA 2JOQA 3AQOA 1S1WA 4YDUC 3J80Y 1U6BA 1YJNS 1UOCA 4Z2XA 3WQPA 1DQAA 4C8ZA 1NJXA 4OYAA 2ZZTA 1JCFA 5H9EJ 2ASJA 3J81Y 1BWEA 2J5AA 2A10A 2XMJA 2J4RA 4P2FA 1OQ6A 4RW9A 3O3LA 1RZMA 4J9RA 1NG9A 3O80A 1GLEG 2MJNA 5IC4B 1R27B 2NXNA 5IT9Y 4CFAA 3O4NA 3NMRA 4ZTFA 3HVTB 2F8HA 2B4PA 5HRSA 3G6XA 4N5SA 2EBEA 3QGHA 5J2PB 4ELTA 3C15A 1VRTB 3EN9A 1DY3A 4TLRA 1KLNA 1CC8A 2HQ3A 2HBQB 2UUAJ 3PX0A 4OKKA 3IMXA 1N33F 4AL7A 1FEHA 1KRPA 5JS1A 4JRQA 1N5YA 1X4AA 1M5OC 4ECRA 4FNHA 2ZH1A 4B02A 4OHYA 2J0XA 3EJMA 1QDUB 2VBYA 3NNCA 1H72C 2AT1B 1H98A 5KG4A 1S1XA 3UCUP 3CGIA 1HNZJ 1W2IA 4OMFG 4GO5X 4FYYB 2MPUA 3VAJA 2CZVC 4YOWA 3WXKA 3QO9A 2ZH7A 4I6YA 4ERDA 1XMQJ 1QZ6A 1MWZA 1VQSA 1U0HB 2BRLA 2ERRA 2UUBJ 2FZCB 1RU1A 1YRTA 2IC3A 2IJNA 1WEYA 2ZBQA 4HWIA 3TOQA 3OYNA 4NLCA 4USIA 3VGMA 3VF0B 2ETJA 2LQBA 2RIJA 2CPZA 1ZBFA 3E2EA 1TQLA 3D6TB 2ASMA 4ILGB 3NY0A 5K20B 4XH1A 4MDBA 4RR5A 2U1AA 3L0QA 1YK9A 2E20A 3JAMO 3CJ8A 4KHYA 2R7RA 4RPFA 4DCOB 1RACB 3O6WA 3F73A 2AD9A 4KHPK 1WHXA 1B70B 2H5IB 1SC3B 2XI3A 3G4SS 2DNNA 3MX5A 3MPWA 1GAOA 3H20A 1FNXH 4H5WA 3M30B 2NUHA 4HVZA 4PUOB 4P2MA 1GH8A 1NJIO 1RABB 4GMJB 5KFQA 2ZC3A 1C1BB 5L38A 1OIAA 3W7BA 5HRPA 4O0NA 1PJ6A 2P9PB 2Q36A 4UY8O 1JQGA 2V69A 5HLFB 3TSPA 1VHIA 5LMNJ 2EPIA 1VYAA 2VQEJ 2VA2A 3CCES 3VGKA 5D0GA 3O1LA 5KOXA 3GILA 4F4AA 3BGLA 2Q2RA 2MKSA 3DJCA 3A8EA 4B9UA 1IBLF 1DGKN 4DR3K 3AB4B 1VQPN 4WU3A 3C65A 4NYFA 3MGJA 4ELVA 3NBPA 1NJZA 4M7XA 3PEJA 1NDCA 2V8PA 3TEHB 1TL5A 2I5JB 1BIZA 3GMGA 2ZHOA 2R8JA 3OYIA 4IO1A 6AT1B 1W26A 1B92A 1KQKA 2HQDA 2EC2A 3SSSA 1BI4A 1X3NA 2CQCA 5I42A 4JHDB 1UPPA 3OUYA 1S4EA 2ASLA 2B8QA 4H4OA 3PRVA 4ZMMA 4KGMA 1J2VA 1VBKA 2RS8A 2JFKA 2RPIA 1T9TA 1Q78A 1SKRA 4K5RA 4QU7A 2CZ9A 3UO0A 3GOIA 1AT1B 2GTDA 3WXIA 3CJ4A 1K73O 1KP6A 3OYMA 4FJHA 3CIZA 3NGSA 3W5YA 4CFBA 3AOAA 3QBWA 2UXDF 5HRRA 1SC6A 3CCJS 4IUFA 2MZSA 1KDNA 2V2VA 1ZA2B 2LXFA 3L4QA 3MECB 3C16A 3EY1A 5A76A 4LF6K 3WIUA 3POTA 3L3VA 3DNCA 4CGHA 2MJUA 1NK8A 1NPKA 2ZWHA 2P9IB 4IBNA 1RT4A 1PAEX 2M4MA 2R7XA 4U7CA 3MM8A 2DJWA 4HL9A 4I69A 3C6HA 3PR5B 1E4GT 1BXNA 1Q7YO 4ZPDA 4X65F 1FDNA 1D9DA 2NRRA 3ZTQA 3VA0A 1KNZA 5AQYA 2Z0GA 4CLKA 3EUNA 2OYQA 2LVWA 5KG0A 1WD6A 5F8JA 1U0SA 2DXFA 4K0KK 4ZCMA 2A3JA 1C4CA 3TQ1A 4LRBA 1T3OA 3FVYA 4MIWA 3ET6A 1ZTTA 1TUGB 3AVLA 3BSCA 3DWLA 3E8OA 3IR6B 2DIVA 1ZZFA 3TAMA 3LDOA 3DU5A 3Q7BA 1P27B 3P5BP 4TNOA 4F2RA 4KTZA 4M5NA 4N7TA 3PO5A 3Q83A 2RE2A 2YNGB 4B3TK 4RBUA 1WF0A 4OZNA 3ZNUA 2FSJA 2HFUA 1QSYA 4DUZK 1VSFA 2JL9A 3J7ZT 3AVNA 3J80U 5AQFA 1UMJA 2ZM6K 1SPBP 4JV5F 2H5JB 4CF8A 2YPZA 2Q97A 2HWIA 5E0OA 3VGVA 3VQBA 3J81U 2R4FA 4AD6A 3EKUA 1R59O 3OY9A 3CJ1A 2RDDA 4LVOP 5L1IA 5D0HA 3HOTA 4E7KA 1DTQB 3NGYA 1GX6A 1SJRA 3SFUA 2GWKA 2HHHK 4USMA 2HZCA 2FY1A 4Y6IA 3WC0A 1XI1A 4FS2A 2X1BA 2J76E 5BJRA 4DV0J 4QBUA 2P2CB 5LMUJ 5EOYA 2CVIA 4DR4K 3S01A 4LFBF 1EKSA 4DU3A 4PWDB 3O9UA 1U48A 5F2RA 5AJ3K 1SV5A 2K2PA 4OHXA 2BKNA 1Q82O 1Y5NB 1K8KB 1IKXA 5KFLA 1RWXB 1UKUA 3HZGA 2R3VA 4NLWA 3QAUA 2CQBA 1O13A 4CERA 1Y3KA 1IM4A 4BREA 3RB4A 3GDQA 5L1JA 4E8UA 1ZPWX 1IBKK 5ETNA 1KCFA 1Q8LA 4FWQA 3S7RA 3EPIA 1RHUB 2DFEA 3WQUA 3CW2C 4FZZA 1CJVB 2Z1GA 4KREA 1FD2A 1AROP 4W90B 3HI9A 2D9PA 2XO6A 4DR1J 3IGNA 5IWAK 4A8SA 3SCJE 1BDGA 2K7JA 2ZD1A 3CJKA 2CGLA 4HUFA 4CEZA 3B8HA 3HVTA 5LSOA 2E29A 2ZC4A 5J2PA 5J2QA 1VRTA 3V1OA 3JSBA 2EBGA 4PKIA 2HQCA 3A8JA 2G8KA 4CWBA 1SZ2A 3KZBA 4IG0B 4YS2A 4TYAA 1XNRJ 4PYDA 3SQGB 3DDIA 3T1YJ 3Q24A 3I9V9 3U4LA 1Z26A 4CO0A 2GVDA 4Y2CA 3MFHA 2F4VJ 1P9YA 1C4AA 3ENVA 2M0GB 1L3VA 2DGQA 3GBTA 2I9SA 1QQMA 1FFGB 1YLXA 4QR0A 2LEAA 3NS7B 3T9NA 1VR6A 1NHUA 2F8EX 3I56N 2DY9A 3FBFA 3H45C 2I2YA 2RRBA 3L95X 3D66A 4WFBL 1BQNB 3HHLC 4OPKA 3HXMA 2LXIA 2W25A 1GLCG 3VEVA 5FRMA 3TNVA 4NZ6A 2OPPA 1HNZK 1PJ5A 1UCNA 4OLBA 4DR2F 1IQTA 3V1QA 1M5SA 1MWQA 2Q3PA 4CTAA 1KAYA 3ILLA 3ETMA 5CXTA 4B3MJ 3CNQP 2W40A 3V5RA 4H5TA 2YH0A 2OFGX 2Q66A 3TRGA 1XMQK 2PBDA 4PZVA 2UUBK 3GJQB 1R7IA 4EHTA 3K8VA 1SIWB 1IKYB 4Y2MA 3TR5A 1U7LA 1BUXA 5A8RA 4DXLA 3R5BA 4DOZA 2E5GA 1N48A 1WKKA 2JEJA 3AY9A 4ID1A 4X4TA 2UXCF 5M1OA 2BUPA 3W63A 1EARA 1VJWA 2NRZA 3JSMA 3CULA 2UV8G 2VKZG 2N3LA 3M8YA 3T19A 1S0OA 1SH3A 3D6FB 2N82B 3TU5A 4AHSA 2OPQB 4ZLLA 2P9PA 1AYEA 3DMJA 4J2DA 4P9SA 5DRKA 2W7AA 4IEEA 3HVWA 3VHQA 1LXJA 4KTQA 5M1PA 4X62F 3VCDA 4IDHA 2VGMA 2CNLB 4FDFA 4HACB 2G0JA 2HQIA 1B4SA 2KXHA 2HURA 3PW4A 2BOAA 3ZZ0A 3AOCA 2VQFF 2V67A 3FMBA 4GMKA 4MKVA 3N4WA 1PYOB 1VQ4N 5E3QA 3UKRA 4K42A 2QMWA 1L5UA 3PW7A 5THWA 3WQTA 2FLOA 5F3ZA 3EVOA 2POKA 1XNQJ 3DOKA 2YHAA 5KG3A 4DR5F 2P9SB 2QN6B 2PY5A 3MCNA 2G4BA 3DXKB 5LMNK 2W2MP 3P39A 3K0JA 1WC0A 3FE1A 2RE1A 4BRHA 2Z58B 5KFKA 2RU3A 5HROB 4BRKA 4WF9L 5CYMB 2KRRA 4HEA9 2NSBA 4DSJA 3VMFB 2C3UA 3VQTA 1NHKL 2DH9A 5FIIA 4HUGA 2B51A 3O8MA 4GY2B 5ETLA 4WFAQ 2OPSA 1S9EB 4GVBB 2UXBJ 2MQPA 1NK9A 2YQ3A 4E7LA 1T6DA 2ZKTA 5GIPA 1RP5A 5DK5A 3MCAB 2DNOA 1REGX 3V6DA 5B0CA 3GJRB 3ZT2A 4ILHA 3MECA 2DGTA 4TKTA 3TQEA 3HOSA 3C6TB 1AUSL 2V51B 3I0SA 2QEXN 2VJVA 1RLCL 3NMAA 2B4OA 2D3OR 2BE7D 3GJTB 4P71A 1NSQA 4E1NA 3AQPA 5KFZA 3JXOA 3U1LA 2ZQBA 4AF1A 3ZTSA 2B5JB 1HI8A 2XMWA 3DKDA 3O6QA 3M2VA 4FOEA 2DNRA 3BSOA 2QLXA 3TVYA 3P4IA 1C0FA 2W8KA 1VOMA 5D8HB 3VALA 3PIPQ 3L3CA 1K47A 1H3DA 1N8RT 2G0CA 3CJTA 3G0ZA 3FQKA 1HMVB 3HULA 3MD1A 3PUFA 4KH0B 3BEXA 2FD2A 3HSJA 4M5IA 2IRUA 3KK1B 3DOMA 3MM6A 1E6VB 1RLDA 3V6HA 3CFPA 4MYTA 4W98A 2ZGZA 2IFXA 3IO1A 3TUIC 3QDKA 2VC1A 1PBAA 3MM5B 3RRKA 1Z6RA 3VWSA 3OVAA 2R7QA 4DR5K 2KJVA 1S1UA 4FYDA 4IOXA 4BR0A 3VQ5A 4JI4J 3BR8A 2A40A 2OLWA 5J2MB 1RT7A 1CXUA 1ITGA 4I2PA 5F9NA 1NSKL 1VSHA 3QT5A 5F8IA 3LP1A 1A0OB 3PYGA 1S72S 4CJLA 2A1RA 5CD4A 1JLEB 4QU6A 2YNFB 3K7RA 1FO1A 5KG2A 3R2DJ 2HVEA 4FZVA 2DEJA 3F2KA 1R8BA 2DT9A 4PXDA 5D0EA 4HLBA 2Z30B 2MKYA 2ZJPQ 2UVVA 4A8MP 1KVCA 1VBXA 1YX2A 4JKGA 2HB5A 1WTBA 4YHHK 4LIWA 2KG1A 1R6YA 4A8YA 2WSFC 4JKBA 3TZYA 4KH5A 1OSDA 2KN4A 4LQ3A 1K0TA 3A1YG 2C2ZB 1EETB 2XYPB 2N3OA 5LJVA 1TFYA 3M6GA 5KFFA 2DHAA 2XHCA 1QVFR 5EX0A 3RSEA 5B0DA 3NRBA 2Z2MA 1FVSA 4A2BA 4RUBA 2QM1A 2HNYA 4FP9A 3DLJA 1X4FA 4WIQA 2BE9B 3Q8VA 4DV0K 4CGDA 3OYKA 1CJVA 1T9VA 3I9ZA 4OLOA 3IRWP 1VIXA 5CR4A 4CJSA 4LF9F 4M94A 3IM9A 1HR0F 3T9ZA 3UB5A 5KFHA 2NZCA 4PPZA 3KWMA 3VAKA 2UXDJ 4LSLB 4CZGA 2IY5B 1KLMB 2E2NA 4P7TA 1BG3A 5KFVA 2OTLN 4FJGA 3CC4S 2CNOB 4MDAA 4MT1A 4JB8B 3BR9A 5CHIA 3Q2TC 4IG0A 1JLBB 4G1PA 3IR5B 4WBFA 5AFUA 3I6PA 1ZC6A 3KMSA 3SQGA 4DR1K 4ECUA 3ENQA 3DLBA 3G6EN 4Z4EA 2FSNA 4FJ7A 1D09B 1LW2A 1VQLN 4X65J 3AAWB 4M5HA 4ZN1A 4ED4A 3CCVN 3R5GA 3ZX2A 2M7SA 1NDPA 3FRYA 1IM6A 4NLRA 2F7VA 4G65A 4DU7A 1N32F 3QRPA 2OELA 1KQSR 3M8PA 4RG8A 2E5LJ 1QSLA 1RBTA 4RUHA 3AA8A 3O9QA 3I0RB 1CBKA 2ZWPA 3RB6A 2BMBA 2W9CB 1BIUA 3LGHA 1XNRK 6FDRA 3H3NO 4DTXA 4USWA 5CE3A 3HP9A 4CK2A 2HEKA 2BR0A 4JI2F 3ILOA 1S0NA 1XR7A 4FN5A 1X60A 2O8BB 2F4VK 2EK1A 1QZ5A 4K59A 5K5MA 2AHOB 1KAZA 3TA0A 3ZTOA 1FDBA 1IBCB 2VG7B 4M5GA 4YP3A 3JQJA 4DL0C 3FBBA 4CK1A 4R79A 4R0EA 3D0HE 3NOCA 4U67Q 1WACA 1S3XA 1EP4A 3ID6A 3OYGA 3EXCX 1WOQA 1KQSM 3GLJA 3AVMA 3UNYA 4CJVA 4FJ8A 1RKJA 3NH1A 4DBQA 4YOVA 1VSKA 4O4GA 3J81j 2O4GA 2EXUA 4J8FA 2G8WA 1T05A 1WDTA 2HLTA 1MW7A 1KOOA 4H0YB 5JMNA 4Q0BB 3NLCA 2R7YA 2BEFA 4E2FB 1ZPVA 4C0BA 1K8AO 3WXJA 2FC0A 1NNEA 2HGLA 3BQ2A 4B3MK 1F3FA 3GYGA 1BOTO 3SMZA 1HPMA 1SAZA 2QLJB 5EHHA 4CECA 3ZZYA 2VPXB 3ZX0A 1CG2A 4M3UA 5EWGA 1FXXA 3CXCR 2MKIA 1U24A 2EHGA 3CCMN 3IC1A 4RU2A 5FJ4A 1YT3A 3S3NA 4M5DB 1VK0A 4M5KA 4MIAA 2VL1A 2HQFA 4F3QA 3FSXA 1D5AA 2CQ4A 2A6MA 4C23A 4CEOA 1W2BM 5SUHA 1RAJA 4X66F 4A8OA 3S8SA 4M95A 1XUPO 2MQLA 1N0UA 3JQKA 4BGAA 1F1BB 2V2KA 1L3TA 1Y97A 1NGGA 3N6MA 3R7BB 3SPZA 2ZH3A 3SEOA 4USUA 5RUBA 1BWVA 5IS2A 5KRSA 2FPHX 1YBAA 3AGKA 2QFJA 3H4BA 3CXCM 1V3ZA 4X4UA 2RNEA 3VQSA 4DQIA 3I87A 5IM0A 4FWKA 4NL5A 4HCBA 3AFGA 4UY85 2W8LA 2K1RA 1KXPA 1S9EA 1IUJA 2HHWA 4GVBA 2W2QP 4FO0A 4FPBA 1XNQK 4CH0S 2Q1LA 1ZBLA 4KFBA 4NXNF 1LWCA 4FLYA 1NGBA 3G71S 4H0XB 2M9KA 1HWUA 3FZFA 1TL7B 5AQHA 1T3NA 3T6BA 4O3QA 3M8QB 3C6TA 4QIGA 1SB6A 3OT9A 1F6TA 5HATA 4CEAA 4DN0A 3ADAC 4QWAA 1O1WA 1WI6A 2BJ3A 3ZSZA 5LL6d 4NLOA 3PACA 5HL7L 3RRHA 4LF1A 1LFPA 1I3AA 3QICA 4PCQA 4CO5A 4EO6A 3M32B 3VEYA 2FYXA 3HSTB 2UXBK 1LKZA 2AJ1A 4OX8A 3CQYA 3PIOQ 1U2CA 2MQNA 1WC3A 2P9KB 1EWQA 4LJMA 3EMTA 1REVB 3HM8A 2YCHA 4ZP7A 1H38A 4KE5A 3E3XA 1B0VA 5IC6B 4WFYA 4LRCA 4YORA 3IKMA 1HD1A 2CQ1A 4GW6A 1KHVA 5JJBA 3M6XA 3MMAA 1DRZA 2I38A 1I94J 1E6VA 4KRWA 1HARA 3C3LA 3P6YC 2F9TA 2R7VA 1VSMA 2KVQE 1S7HA 3SSRA 4K41A 1HWKA 3PX4A 4ZCIA 2JDJA 4ID5B 2GV1A 3OYCA 3V9XA 2DH8A 4AT1B 2RHQB 3F41A 3BB5A 4ZS6A 5GADI 2MHEA 4X64J 4KTWA 3SK3A 4QIFA 4LD0A 4DHYA 5FLXO 3U3YA 2SXLA 4KH4A 3FNNA 4W5NA 2YKOA 5AQGA 2QWPA 4LFAF 1FXLA 5HP1A 2KXNB 4Q45A 3MR5A 1RYSA 1IBMJ 3W8GA 3CCQS 2QG9B 3TR8A 3A3NB 4KB0A 2KXFA 4PQUA 5HMWA 2O8CA 1HQUB 2XI2A 1WUUA 5DMRA 1BGXT 4A47A 2YWFA 1QVGM 4O23A 1X9SA 2I6WA 2ATCB 1N36J 1Q1KA 2VONA 1NGJA 1QUVA 4ZPWR 1YAGA 4BY9C 2U2FA 4Q44A 5B0FA 2ZFHA 2YJEA 4NXNK 4X84A 2AYBA 4KSEB 2AEJA 1JNZB 2UUWA 4JI4K 3CJ5A 3MAAA 1UJ5A 2OTJN 1TP7A 1FXDA 1SI9A 1JL2A 3TWHA 2MTLA 2XMTA 1U4BA 2H3GX 1EETA 3IBCB 3BJYA 2P9CA 3Q22A 4CFDA 4A8KA 2BJ8A 2AGPA 1KSPA 2HHTA 5DM7Q 4RW4B 3KKFA 1W0HA 2FVSA 3H8YA 3CCSS 4X4RA 2DXDA 2QC3A 3MXMA 3LPUA 3L2UA 2MZTA 1A5VA 4IQMA 3ZSYA 4ZIWA 3OFEA 2W2OP 4PL7A 1SH2A 4MTPA 2DK2A 3S41A 1VC6A 4CHZA 3L7OA 1WAJA 1VQMS 3M1FA 3W9IA 2H4YB 1CJKB 5LJ5Y 4JI1J 3CFOA 3VF4A 4K4XA 3FJ2A 2QL5B 1U04A 4DCHA 2QZ8A 1LK7A 3KUHA 1TUUA 4WK3A 3CPEA 4IFEA 4EP5A 4FF2A 4DCPB 3VVTA 4IFYA 1X4BA 4CH1A 5U47A 2HHVA 2HNZA 2R7SA 3HKZD 4IEIA 3QSYB 3EZUA 3W3SA 4F02A 3L7PA 4ED5A 2MKHA 2GFFA 3TTDA 3BPDA 4FWLA 4ILRA 8RUCA 2FTRA 4Y34A 4KBOA 2WB4A 4M3ZA 2A1BA 2FB0A 3TP2A 4YY3J 1NJIT 2OP5A 5M2PA 1HLUA 5BXIA 7AT1B 3NVMA 4IWVA 1U47A 1X8DA 4LRAA 5AQXA 2KB2A 3BV8A 3I0RA 1J27A 3VTIA 4KHRA 1YQHA 4IG3A 2DRBA 4CFCA 3Q0AA 4CJFA 4JYAF 3DLEB 2IOCA 4TN2A 5C42B 4IDKA 3O9RA 1JL1A 4CJPA 2P9NB 3MXHP 1T95A 4JAXA 4KQZA 3UVJB 2BKOA 2JHEA 4A57A 1HQ2A 3H5SA 4WU2A 2E5LK 4KHSA 1X1PA 4CJTA 1QM9A 2QGFB 2WCXA 3L6QA 3GPAA 4GKJF 3GIIA 4ILLA 5CYQB 3QFWA 2VGNA 4NZ0A 3X1LB 2OD4A 3RGIA 1IG8A 4B08A 3MEEB 2GX9A 2QYGA 2PIIA 3AB2B 3PV8A 3EM1A 3R3TA 4NI2B 3HSZA 3NF9A 2YNIB 2J6SA 1NGDA 3HD2A 3K5LA 2DH7A 3I55S 4Z37A 4RW6A 3OXFA 1HJOA 3NL0A 2VYPA 4HTUA 2F9JA 3TX8A 4DZ6A 2J0WA 2H51B 1DT9A 1S0VA 5I4MA 3FFKB 4LVNP 2X6NA 5ETVA 1Q95G 1S1TB 4YDUA 3FUYA 2HBLA 3HDSA 1VQ6S 3KYLA 1BO5O 3Q2SC 4CIEA 1DFDA 2A41A 3THYA 2E9RX 1TFWA 3P31A 4B1UB 4FW2A 3SAGA 3KLHA 1WHYA 5K14B 4JI5J 4RW8B 3PFEA 3OTCA 3CCRS 1YSJA 4FYXB 3IBWA 2Y8WA 1U6ZA 1S79A 2FJEB 2K7KA 1DQ8A 2V6AA 1IKVA 1FTCA 4J7CA 3CETA 2FBXA 2OEKA 2YX1A 2DKOB 1BQMB 3TA1A 5AXNA 2P9UB 1IWAA 4FLXA 4DF4A 1P1LA 1WC1A 2MGZB 5HVFA 4L75A 2KFNA 2BUNA 4B3SF 3H3OB 5KT6A 3O4WA 4I2QA 3QQCD 2E88A 3CI5A 2V68A 3D7SB 1HR0J 1BL3A 4CI0B 3LW5C 2LDIA 5LSLA 2DNMA 1TV6B 3K89A 2CDRB 2CQ3A 5AQLA 4DV5J 3JS9A 1WC5A 5JMVA 4UOGA 1XHZA 2H5EA 4FJXA 1WN7A 2J8AA 2QKBA 3AA9A 2AX1A 3D0GE 3LH2S 4OPAA 3I32A 3OTBA 1J5EJ 3QNOA 4ECWA 2DRDA 2JEGA 2W6KA 3VEXA 2D0CA 3NAHA 3VEWA 3AVAA 4BC5A 1EQ0A 5ADXH 2B56A 2ZH8A 4KHUA 2HGNA 2C3MA 1C1CB 4CJ3A 1HBMB 2B9EA 4EP4A 3A8IA 3P4UB 1NK7A 3CE8A 8ATCB 2ZOFA 3QEIA 2O8FB 3BEGB 5C2GA 1N32J 4EK2A 2PMHA 2RN2A 1G6BA 3KLEB 3FEZA 1JLGB 2DGVA 1RCHA 2NR0A 1BC6A 3SQ0A 4JLHA 4CIOA 4JV0A 2CQIA 3KUGA 3FCHA 4E89A 5KRTA 2Z8QA 3AAPA 1GLDG 4LF5F 4OI0A 1DEJA 4CIGA 1O5JA 2CZ4A 1NH8A 2E44A 2QYCA 4DL4A 3AT1B 3HFZB 4KH6A 4F4KA 3V4MA 3OS1A