1JLEA

Crystal structure of y188c mutant hiv-1 reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
549
structure length
524
Chain Sequence
PISPIETVPVKLKPGMDGPQWPLTEEKIKALVEICTEMEKEGKISKINPYNTPVFKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGANRLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 133
structure length 524
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jleA05
4FZYA 5CZ2A 4E89A 2XGQA 4I2QB 3QEWA 3M8PB 3IS9B 4I2PB 4J9LA 4CJVA 1N5YA 1JL2A 4HHTA 3OYFA 4DEZA 4KHRA 4G3IA 3RR8A 2IOCA 4I7FA 4ZP9A 2GC8A 4IFVA 3H2LA 1U04A 3KLEA 1WSHA 3AVBA 3CYMA 4JRPA 3OVNA 3PZPA 2GBZA 2Q3SA 3UDLA 4K4YA 3K2PA 1W0HA 3O3FA 4NCGB 3MEGB 1S1UB 4ZHRA 3QYYA 4TY8A 1BI4B 4FK2A 3GV5B 4GMJB 1FKOB 3ISNC 1VSFA 2JC1A 3SUNA 4KAZA 1RTHB 3KKSA 4GW6A 1RTIA 2VG7B 4CJWA 4DS5A 2PZSA 4J9QA 4FJGA 3TANA 1TL3B 4KBIA 3H59A 1FKPB 3C6TB 3V6HA 2DFEA 2IGIA 3H4DA 3FDSA 3I5CA 3S3MA 2XY6A 4N76A 4IRCA 1Z4UA 3NDKA 1SUQB 3N6LA 4IQXA 5KGWA 1C1AA 1NOZA 1N56A 3KK2A 4F4XA 4HTUA 3K5LA 4CEAA 2YKMA 3IRXB 4IRDA 3S3OA 3PVXA 4DWIA 3K57A 2HNZA 3HPGA 2VA3A 1YTUA 4QW9A 2D5RA 1I3AA 1D1UA 3PUFA 4QPXA 3MAQA 4RW8B 4ECVA 3JSMA 4CHOA 1JLBB 2D0AA 3AVHA 4Q8EA 4Y2CA 4FLWA 4RW7A 3CDEA 3V4IA 1S6PB 4ID5A 5C24A 4B9SA 4QWAA 3NGIA 4J2DA 4F4ZA 4PY5A 5CYMA 3NGZA 4PQUB 2FJWA 2EHGA 4F4KA 3QIOA 3SUPA 5C25A 1ZBUA 4LSLA 4KHUA 3FFIB 1NK9A 4O44B 2AJQA 2F8EX 1JLEB 3QO9B 3MXIA 3AA3A 3UIQA 5EWFA 2XCPA 4OGEA 2HWHA 3V6DA 1X9SA 5KFDA 3NMAA 4XPCA 1U47A 3KLFA 4Q8FA 3DI6A 2RF2B 3KLHA 4O3RA 4CIEA 4KAIA 4OKEA 2W9CA 4NCBA 1ZBIA 3RRHA 4OVLA 3BR9A 2G8VA 1KLMA 2IBKA 4DSKA 4JRQA 2HNYB 1FK9A 2OPPB 4H4MB 1KFSA 2B5JB 4KO0A 4W5RA 1RT7A 1LWFA 1NJWA 3Q8PB 1IKVB 3PHEA 4NLWA 2DY4A 3E51A 5KFAA 3PW2A 4WFXA 1WNEA 3SPZA 2HB5A 3CDWA 4OPKA 4M41A 2ILYA 1TVRA 2KW4A 2DPIA 5KTQA 2R2UA 2DPJA 3ZSQA 4FJJA 1D5AA 5FRNA 3OYIA 4DQSA 3DOLB 5HRPA 4Z4HA 1XR7A 3SNNA 3G86A 1TQLA 2V4QA 3BQ1A 3HVTB 4ICLA 3LAKA 4N41A 2FLPA 1X1PA 4DQPA 3QEXA 3OYHA 3IAYA 1RT6A 3NAHA 2G8HA 3HYFA 2IA6A 2O4GA 4YR3A 2FBYA 1WSFA 4NLOA 2WONB 1VSKA 2HNDA 2OPQB 2D3UA 3L3VA 4FLYA 3ZSZA 4FK4A 4DF8A 2G8UA 4KRFA 1TKZA 3C6UA 3D0PA 1S48A 4TQRA 3AO4A 1VK0A 4FJKA 3DOKA 3HP6A 4DLEA 1IM4A 2CJQA 1TAUA 4FJ7A 3LZIA 5JXSA 3KLEB 4K50A 3OYMA 3T19A 5KFVA 3CFRA 1OS5A 2BDPA 3AVAA 3NF9A 3HVWA 1L3VA 4KHSA 5I42B 1S1XA 2B6AB 3NE6A 1WSIA 4ZHRB 5KG3A 5KT6A 3CQ8A 4TY8B 4KB7A 1S9EB 4RNMA 2JEJA 3AA2A 3RMCA 5F8GA 3VQ6A 2EC0A 3U3GA 3TQ1A 2G8WA 2BRLA 2WHOA 4TN2A 1TGOA 3VQCA 3LANA 4NLTA 4OJRA 3NL0A 1Y97A 1NJZA 3GILA 5KFBA 3I0RB 2YKNB 3K58A 5JS2A 3EZUA 4DU4A 4ED1A 1S9FA 3OY9A 3KK2B 4KHMA 4ECRA 1L5UA 3OYDA 3BDPA 4JV0A 1T3NA 1SH2A 1A5XA 2C2DA 4I9QA 2R8GA 3NBPB 5KGXA 5KFFA 3HVRA 1ZBFA 4ID1A 2D0BA 3KHRA 1FXXA 4CEDA 4ZPAA 5KFMA 5F8MA 4Y34A 4Q0BA 3ZT2A 1WSGA 3VQ5A 1ZYQA 4MKBA 3AVLA 3ITHA 3V9WA 2QK9A 4ID5B 5C24B 3SI8A 5FDLB 4ZP7A 2I5JA 3TAMA 4ZVFA 5KRSA 3M8QA 4FCYA 5KFQA 4DSJA 1HQUB 1RBUA 3T5HA 1NK0A 4R5PA 4LSLB 3L2VA 3AA5X 2HHQA 4NYZA 4AH9A 4DTPA 4NLPA 4IH7A 5KG5A 3TAEA 3AA4A 4ZVGA 3EPIA 3I8DA 3M8PA 3CJ0A 1SL0A 1G15A 3IS9A 4I2PA 5D3GA 3PR5B 4J9RA 4ED6A 3HPHA 3NAEA 3HT3A 1ZBHA 4F50A 3IN5A 4IRKA 4HUFA 4KTQA 3DI6B 3ZSWA 3KLHB 1QSYA 5DQIA 3VQQA 2XCAA 2W9CB 3HKWA 3HL8A 5EU7A 1T05B 4DFMA 1L3TA 1KHVA 4QOZB 3OYCA 3QESA 1EX4A 4W5QA 4KO0B 1XI1A 1XHZA 1RT7B 3G0ZA 1LW2B 3DDKA 3MEGA 3F9KA 3MF5A 2ASLA 4URQU 4C8MA 1TL1A 1FKOA 3L2RA 3RTVA 1YVFA 4MK7A 4IH6A 3ZT1A 4FW2A 3DM2A 4B3OB 1GX6A 4NLGA 1CXUA 3ZSOA 2HVIA 2VG7A 3O4QA 4CK1A 1NKEA 1TVRB 4OKKA 3GIKA 2OH2A 4O3QA 4CEOA 3C6TA 2V0NA 2ATQA 2UVVA 4HUGA 2KQ2A 4EEYA 1BL3A 3KK3B 1Z25A 4WYLA 3DYAB 3MEDB 4QWBA 1RT4A 1GOAA 2BQRA 3SI6A 3U3YA 3ASMA 4K4ZA 4E7JA 4CEZA 2AQ4A 1TKTB 3PV8A 1NOYA 3T5JA 3NCIA 3VQBA 3DLGB 2V4RA 4KHWA 1RT1B 1RTJB 3VA0A 1RBVA 3IGNA 4CJKA 4E7IA 4YP3A 4DFJA 2FVPA 3OLBA 3BJYA 5KG7A 1K1QA 2XGPA 2G8IA 1QE1B 2G8KA 3WNEA 3AVNA 3QGHA 4FJLA 1MMLA 1JKHB 4PQUA 1U45A 4CF1A 3HVAA 3FFIA 1UOCA 3I5BA 4O44A 3NF7A 1JLEA 1S1XB 1KSPA 3QO9A 4WFZA 1BGXT 3P1GA 4DLGA 5J1EA 1WSEA 5KT2A 3PO4A 3LDSA 4IDKA 4ZMMA 4JV2A 1QTMA 2CKWA 2R8HA 4R8UB 4FJHA 2UVWA 1T8EA 3NH1A 5KT3A 4ED7A 1C0UB 1N48A 2OZSA 4F4WA 1D0EA 2QKKA 2HNYA 5DLGA 3U6FA 3O3GA 4M3XA 3V9XA 4DL5A 3MXMA 4H4MA 3UQSA 4GC7A 4ED2A 4ECUA 3P83D 4Z0UA 4Q43A 4RNNA 3RB0A 4KREA 2HMIB 1GX5A 5KT4A 1CXQA 3I5AA 3MR2A 1S49A 5KFEA 3KK1A 2I1RA 1CLQA 5KFLA 4FLTA 4HYKA 4EZ9A 1XR6A 4O3SA 2R2RA 2ZKUA 3NF6A 4DTNA 4DF4A 3ZSYA 4FM2A 1SKRA 1D9DA 3GV7B 5DQGA 3VQ4A 1S1WB 3Q8SB 4FLVA 1J5OA 4HKQA 1IH7A 4YMEA 2O4IA 4AILC 1S1VA 3OHAA 4O0JA 4F4YA 4R5PB 2WONA 4QWDA 3SFGA 3AVCA 5J2QA 4CERA 2OPQA 2P1JA 4KB0A 4EO6A 3L2WA 5L1IA 3SQ4A 5D3GB 4Q45A 3B6OA 2XY5A 1QSLA 3SCXA 1XHXA 5HLFB 1JL1A 5EWGA 5DG9A 1HRHA 3CWJA 2J6UA 4CGDA 4DMNA 1VRTA 2IM1A 2VWJA 1KHWA 2R2TA 1CSJA 2BE2B 3MXJA 3HXMA 3BQ0A 2YNFB 4FJXA 3TAGA 2PYJA 1CZ9A 3FSIA 5I42A 4AHUA 2W7PA 2B6AA 1RAJA 4K4VA 4J9SA 3T5KA 3CVKA 2BQUA 1TL1B 3KJVB 3SQ0A 1YVUA 1S9EA 2FC0A 4CJ3A 4Z4GA 4DFPA 3DM2B 3S3NA 4J9OA 4NZ0A 3HPOA 4DSIA 3BSCA 5KFXA 4CHPA 4RZRA 1Q8IA 3VQEA 2IM3A 3QGIA 4MH8A 2HAIA 4OKJA 4IH5A 1J54A 3I0RA 2YKNA 3DRSA 2BANB 5HROB 1RT4B 2X6NA 2GIQA 4XIUA 2IC3B 5KT5A 1D9FA 3M8RA 2XRIA 4WXWA 4ED8A 4E7HA 3MEEA 3CFPA 3M9NB 3SQ1A 3RMAA 1XC9A 3VN5A 1BQNA 4F2RA 3KIOA 2X74A 5KFNA 3ISND 1S10A 4FLXA 3NBPA 3I0SB 2Z1IA 5DMRA 2Z1HA 1IKXA 3BSNA 3RB4A 2IS3A 4E7KA 4J9MA 4BACA 4NLRA 4KI4A 5FDLA 3ZT4A 4IR9A 5KG4A 3LAMA 2YHAA 4CJUA 1RNHA 2HW3A 1HQUA 2OZMA 3BREA 3WNFA 1UWBA 1NNDA 4NLVA 1S1TB 5J1EB 4KHQA 1RILA 1L3SA 4FJ5A 4IDKB 4C8KA 2FLLA 5EUHA 2HWIA 3OYLA 3V9ZA 4G1QB 2P5GA 4DTXA 1HMVB 1T05A 3AV9A 2OPRB 4NLDA 1JLQA 4CESA 3FRZA 5JUMA 1I6JA 1LW2A 1LWCA 4ZP6A 1WAJA 1ASWA 1J9AA 5J2NA 3LP3A 3OL8A 3KK1B 1S4FA 4UQGA 4B3OA 3VQSA 3DLRA 3TR8A 3LPTA 2E6MA 3QZ8A 2HHWA 1U48A 4C8LA 3AVKA 4MIAA 4K4TA 4CFBA 2JEFA 4N5SA 2WRMA 2KZZA 2OPSB 3KK3A 3V6KA 3DYAA 3MEDA 4NLUA 3S9HA 4CK3A 5L9XA 3OSPA 3DLEB 4ZP8A 1J5OB 1N4LA 3T5LA 4DL7A 3PX4A 5I3UB 4OL8A 2ASDA 1S1VB 2DTUA 1TKTA 3OSNA 4LQ3A 4ECWA 2WTFA 3V6JA 5KG1A 4U7CA 3GIMA 1KVCA 3O4NA 3DLGA 1RT1A 1RTJA 5J2QB 1ASUA 4RNFA 4I9LA 4M95A 2JEIA 4TSXA 1LW0A 4AHVA 1ZETA 4YNQA 4BDZA 5EWEA 4KTWA 4J9KA 2E9RX 1JLGB 3RMDA 4FJMA 2UVUA 3OL9A 3GYNA 3ZSRA 4QWCA 1QE1A 3FQLA 4O5BA 1VRTB 1JKHA 3UPFA 1HQEA 2B43A 1SH0A 3PJWA 4EO8A 1NK4A 1RT2B 2FBTA 3SZ2A 3H08A 1XR5A 1IO2A 2P5OA 5CY4A 4FM0A 1S5JA 3KMQA 1B9FA 4Y1DA 2YNIA 4EYHB 4WYWA 4BWMA 2PY5A 2X6SA 1ITGA 4R8UA 3C94A 4O3PA 1X9WA 1C0UA 5KFHA 3F73A 4CF8A 2GUIA 2W7OA 3LP0B 3SYZA 3TI0A 2W8LA 4Z4CA 2E9ZA 1UAXA 4IFYA 5HP1B 4CIFA 4IKFA 2RDIA 3OL6A 4O0IA 3DRSB 1RTDB 1TV6A 2WCXA 2KZMA 2HMIA 3OYEA 4CE9A 3V1QA 4WFYA 4RW6A 3MEEB 4M3YA 3TWHA 1BQNB 3KD5E 3NGYA 1UA1A 4HCCA 4DTRA 2YNHA 1IKXB 2NUBA 2FBXA 4U6PA 3BSOA 3T3FA 1IKWB 2W42A 4R0EA 2YNGA 4F8RA 1S1WA 5L1JA 4RUAA 3AVGA 3KLGA 2JLEA 2BR0A 4JLHA 4MFBB 3PR4A 3B6PA 3ZSVA 4RU9A 3CJ2A 1NJYA 4MQ3A 2BRKA 5DLFA 1UWBB 1ZTWA 3K59A 1WNSA 5CZ1A 1EXQA 3RRGA 2FVSA 2HHTA 5HLFA 1C1CA 1HNIB 1K6YA 5KFGA 4OPJA 3JYTB 1R0AA 4IKAA 4ELVA 1JLQB 2BE2A 4KKOB 1A5WA 2YNFA 1WAFA 2AWZA 4XO0A 1S0MA 1JXEA 1LWCB 5KFSA 4DSEA 4ZTJA 2KTQA 4GVMA 3PW4A 3KJVA 3PX0A 1KVAA 5J2NB 1HYVA 4ZVHA 3TABA 1X9MA 4IG3B 4AHTA 4M3TA 4AHCA 2IM2A 1TK0A 3D5MA 1SV5B 3DMJB 5J2PB 2ZD1B 3L3UA 2R8IA 3HP9A 2O5DA 3SUQA 1Z26A 1HNVB 2BANA 5HROA 1JIHA 2W8KA 2UUWA 4CHYA 3VA3A 5KFUA 1XWLA 1B92A 2VG6A 2IC3A 3CG7A 4O55A 4DTMA 4DL6A 4FYDA 3H40A 3KOAA 2PYLA 2XY8A 4FS1A 4RUCA 2FVQA 1WSJA 4K4WA 4EP4A 2FBVA 2OYQA 3I0SA 4DQIA 4M3UA 4ZPDA 2WOMB 4WXOA 1LW0B 1K1SA 4CF0A 4WZMA 4ZPCA 1T7PA 1C1BA 3LP1B 4YQWA 2JGUA 5KT7A 3G10A 2C2RA 2FVCA 3H5YA 3PW0A 4B8AB 5FRMA 3Q8RB 3PX6A 1HQEB 3A2FA 1S9GB 3BGRB 1VRUA 4RW4B 4MK8A 4CFDA 4F3OA 5T14A 4FJ9A 2C2EA 4EZ6A 1S1TA 1ZBLA 4AHRA 4BDPA 1VSJA 4KI6A 2YNIB 4WE1B 3O3HA 3NAIA 4MK9A 2ILZA 4LSNB 3OYKA 4CHQA 1RT3B 4G1QA 2HHUA 1HMVA 2F96A 4GC6A 5F8JA 2VA2A 2OPRA 1QUVA 2XI3A 1SL2A 2EX3A 2XHBA 1L3UA 4M42A 1TKXA 1CZBA 3MFHA 4IFYB 1RYSA 3TAPA 4NCAA 1TV6B 4EBDA 4DL3A 4TYAA 4K4XA 4BWJA 3MR3A 3DRPB 1C0TB 4N56A 1BCMA 5L1KA 4RG8A 4K8ZA 1EP4A 3TVKA 2J6SA 4RW6B 3C95A 4C8OA 1YT3A 1ZTTA 1KFDA 2FLNA 1S6QA 3GV8B 3M9MB 4QW8A 5HBMA 2FVRA 4DTOA 2YNHB 3QIPA 2XO7A 1S97A 2B4JA 4DG1B 1SL1A 3G6XA 2OPSA 3IG1A 5KG2A 3THVA 2YHBA 4DU3A 2YNGB 5DGBA 4DSLA 3DLEA 1JXBA 4KE5A 2W9BB 1RBTA 4ED0A 3DLKB 5I3UA 3KLGB 2BQ3A 4CGJA 3RBEA 4AHSA 1JLAA 2QE5A 3GQCA 3H98A 5KFOA 4W5NA 4CGIA 5SZTA 2AGPA 4ELTA 4ECQA 4W5TA 4RNHA 4FLUA 1N6QA 5JS1A 4W5OA 3OLAA 2RDJA 5HRSA 4FJIA 1VSHA 1JLGA 2XI2A 3MECB 2XC9A 3HHKA 3CO9A 2ASJA 4RW9B 1GOCA 1C1CB 1R0AB 4Y1CA 1F21A 1RT2A 3QLHB 4Q44A 1DLOB 2R2SA 2ZE2A 1TK5A 4FZXC 3G6YA 1T03A 4TXSA 1S0OA 5CYQA 5T7BA 1U49A 2QV6A 4ZPBA 3H5SA 3PY8A 1NJXA 1KTQA 3TAQA 4ECTA 4YFUA 3N6MA 1NK7A 2R8JA 3TAFA 4NYFA 3LP0A 1JLCA 3LWLA 2FJVA 2JC0A 3SFUA 1C2PA 3KHLA 4CJRA 3QERA 3N6NA 4CK2A 4IOBA 3KHGA 3EPGA 4DU1A 1HJRA 5HP1A 2AX1A 4B8CA 3GIJA 4LH4A 2IJFA 1RTDA 3NGDA 1BIUA 3Q8QB 3L2QA 4KV8B 3PW5A 3ZSXA 2VG6B 3QEPA 1O1WA 1VSIA 4HUEA 3QEVA 4B9UA 5KI6A 1RDCA 4O4GB 1RA6A 3OJSA 3L2UA 2D0CA 4F3TA 4L8RB 4CIGA 3K5NA 4FM1A 3EYZA 3KMSA 3RBDA 2VG5B 3LP2B 3T1AA 4KPYA 1WN7A 4O4RA 4CEEA 4CECA 1IKWA 3RWUA 3OL7A 1REVB 1C1BB 3PJXA 4FZZA 5F8HA 4KFBB 3NFAA 4CFAA 4OGCA 3SV3A 5FROA 4MFBA 1DTTB 4URSA 2QKBA 2RPIA 4E1MA 1DTQB 1VRUB 3NF8A 1SKWA 1RA7A 1BQMB 4C8NA 2QXFA 1QAJA 2C28A 4K8XA 4KB1A 5KFKA 1JLFA 1Q9XA 3KKRA 4NRUA 1QHTA 1NK6A 1KVBA 2RN2A 3E01A 3RAQA 3QETA 3VQAA 1RCHA 3RR7A 3VQ8A 5KFZA 1RDDA 1HPZA 1HNIA 4QAGA 1KLNA 5K14B 5SWMA 2A1RA 3JYTA 4ELUA 4E19A 1NK5A 2AGQA 4BE0A 1LV5A 3QZ7A 2W9AA 4KKOA 3CM5A 2BGGA 2ITGA 4FS2A 4DQQA 1TKXB 4Q5VA 1Q9YA 4M94A 3OYAA 4M3WA 2ETJA 3RB6A 4IG0B 2AX0A 3G6VA 2FJXA 1VSLA 1EETB 2VWKA 2GV9A 1EP4B 2WK4A 3AVJA 4IG3A 4PWDB 1S6QB 4E1NA 4KHYA 3V81A 1SV5A 3DMJA 5J2PA 2Z1JA 1KCFA 4QCLA 5HBMB 3QIPB 2ZD1A 3VQ7A 1BCOA 3IG1B 3KHHA 3LWMA 3M9OB 1HNVA 1S0NA 3CIZA 3L8BA 4H4OA 3LPUA 4CGHA 1UA0A 3AVMA 5KG0A 3OS0A 4ZVEA 5KFPA 2UVRA 5KFRA 1JLAB 1W25A 4CHZA 4Z4FA 1RT5A 4TY9A 4TYBA 4M45A 1N6QB 3SUOA 2WOMA 4URGA 4CGGA 3H4BA 4YR0A 1C0MA 3CJ3A 4DL2A 4N47A 3KLIB 1NHVA 3QNOA 4M3RA 4CEQA 3LP1A 1QQCA 4CJLA 5F9LA 3MTKA 5KFTA 1QAIA 4YR2A 4B9VA 4EP5A 1T94A 1S9GA 3BGRA 4RW4A 3ICLA 1I39A 1HYSA 3AO1A 2ZE2B 1B9DA 3D45A 1T03B 1N5YB 3KNAA 4I7FB 3DRRA 4CGFA 4EYIB 4JS4A 4WE1A 5CYQB 4IFVB 2YV0X 4HCBA 3LALA 4LSNA 1RT3A 4FJNA 2HHVA 1VSDA 5E41A 2C22A 1SKSA 1HYZA 1VSEA 5HRNA 1JLCB 4DL4A 2F8SA 4DQRA 4NYNA 3NHGA 2ALZA 5C42A 3LZJA 1RTIB 3HK2A 3DRPA 1C0TA 1MU2A 3HSTB 4B9MA 3AVIA 1YTAA 1D8YA 4Z4IA 5L1LA 4RNOA 4LQ9A 1BISA 2IAJA 1RDRA 2HHXA 3WNHA 2Y1JA 4NRTA 1LWEA 2E6LA 3CJ5A 4J9NA 4QWEA 4ECYA 4E3SA 4CCHA 2GIRA 4CJEA 3SPYA 1EKEA 4DG1A 4IBNA 1LAWA 5J2MA 4CHNA 2YKMB 1TP7A 4EBEA 2HHSA 3SJJA 4Y3CA 4LY7A 4WZQA 2W9BA 2OA8A 3DLKA 5DGAA 2HNZB 2LSNA 2RKIA 3OYNA 3K5OA 2XWYA 4FXDA 4PUOA 2AU0A 3JSMB 2D41A 4MKAA 1J53A 1NKCA 1IKYA 4FJ8A 4RW7B 3OS2A 3V4IB 1JLFB 5EDWA 4H54A 3D28A 3OYJA 5CYMB 3E01B 3MECA 3CJ4A 4BE1A 3V9SA 4Y2AA 3AO5A 4LH5A 4RW9A 4J9PA 3QIDA 1HPZB 2UUTA 5C25B 4IR1A 2P51A 3VQ9A 5KFCA 4DTUA 2DFFA 3FQKA 3QLHA 3ALYA 4CFCA 4I2QA 3V9UA 3CDUA 4O3OA 1DLOA 2DFHA 3V6DB 5F8NA 1RYRA 1NKBA 3KLFB 3NH2A 1BIZA 4CJ4A 2AGOA 4DFKA 1VSMA 4O3NA 5KFWA 1KLMB 2J6TA 5DG8A 4ECXA 4EBCA 1FK9B 3DLHA 4XPEA 3EY1A 3MFIA 1LWFB 4NCGA 1S1UA 3V81B 3SV4A 2IDOA 4E7LA 4X2BA 1BI4A 1NK8A 2XY7A 1QS4A 4TLRA 1RTHA 4CEFA 4CF9A 4KV8A 4H4OB 3GIIA 4KHNA 4PA1A 3AO3A 2A1SA 2HVHA 4ECZA 4ECSA 1TL3A 4O4GA 1FKPA 3MR6A 2IMWP 3V1RA 1JXLA 2WB4A 1WLJA 4K4SA 1RDAA 4FVMA 5KRTA 4M3ZA 5KFJA 4Z4EA 1SUQA 1RT5B 2VG5A 3LP2A 2D7SA 4JV1A 3OJUA 4B08A 1BHLA 4ICLB 1A5VA 3ZCMA 2KFZA 2V9WA 3SQ2A 4B9NA 4NLXA 3IRXA 1RT6B 3PO5A 4H8KA 1REVA 3NH0A 4FLZA 4KFBA 3TARA 1RBRA 4JS5A 4CJ5A 2Y1IA 4E0DA 3QNNA 3CFOA 3OS1A 2HNDB 2IJNA 2E9TA 3ZT3A 1IG9A 1DTTA 4JUZA 1DTQA 2R8KA 1RBSA 4BE2A 3HM9A 3QGGA 3EZ5A 4NLSA 1BQMA 1TKZB 4RW8A 3PW7A 4CJFA 3C6UB 1JLBA 1HYSB 3H5UA 1NHUA 3AVFA 1S6PA 3KD1E 3DOKB 3OHBA 3DRRB 4MIBA 3QINA 1RDBA 3OYBA 1ASVA 4CJSA 4DSFA 5F9NA 4B9TA 5KFYA 4B9LA 5K14A 5KFIA 2IM0A 2X78A 4LD0A 3RB3A 4FBTA 1GOBA 4OLAA 3NKYA 4DS4A 3K5MA 3M8SA 4FK0A 5DQHA 3WNGA 4J2EA 4IG0A 2ZQBA 5C42B 5HRRA 3VQDA 3VQPA 2RF2A 1MU2B 1C6VA 1EETA 4K4UA 3V1OA 1U09A 5F8IA 2G8FA 3RAXA 3P5JA 2IAJB 3BSAA 1KRPA 3UR0A 3QEIA 1QSSA 3HO1A 1W9HA 3MR5A 2OPPA 4PWDA 3AO2A 4KSEB 2D3ZA 2B5JA 4J2BA 4BDYA 3IGVA 4NLYA 5KG6A 1LWEB 4ZTFA 1IKVA 4CJPA 4TQSA 4FBUA 3CM6A 4CJTA 5J2MB 1TAQA 5DK5A 1U4BA 1TK8A 3ULDA 2RKIB 1SH3A 3RMBA 3H5XA 3DOLA 4DTSA 4FW1A 3KTQA 4PUOB 5C5JA 4ED3A 4Q0BB 3KLVA 1IKYB 2F8TA 1HARA 3HVTA 3ITHB 1TKDA 4NLQA 4OLBA 1LAVA 4KTZA 4CEBA 2R7YA 3KLIA 5DG7A 4CF2A 3OYGA 1JX4A 2JEGA 2KFNA 2I5JB 5F8LA 3TAMB 4HVJA 3M8QB 2Z1GA 4DTJA 4CJQA 4J2AA 3HJFA 2E4LA 3DLBA 3ZT0A 4F2SA 3BQ2A 2ATLA
chains in the Genus database with same CATH superfamily
4FZYA 3T1YJ 1TL5A 5CZ2A 1GLCG 2R42A 1TYQA 3QEWA 3M8PB 4WTOB 2E5LK 4YY3K 3WXKA 1GXUA 4I7FA 4JKCA 5EHHA 1RK8A 1P1TA 1KQKA 3OVNA 2G2ZA 4HL9A 1XMOK 4V19J 3PYEA 3K2PA 1KVIA 4Z37A 5K20B 1S1UB 3QYYA 1NGIA 4AD6A 2Q97A 2EC2A 2BJ3A 4RWXA 1VSFA 2E1MC 4I1TA 5DDRC 4GW6A 3MN5A 2R7OA 3EDRB 1RP5A 3ENOA 4FJGA 2X51A 3NCRA 3TANA 2R7TA 5JICA 3K8VA 2H1YA 2VDIA 2ZM6J 3OTBA 1SJ4P 3EKUA 2V5HG 4H5RA 3WC0A 1SUQB 2JLFA 3N6LA 3GZ7A 4IQXA 5KGWA 4DOZA 1UFLA 1NOZA 3G82B 5LSLA 2YKMA 2NNWA 5DM7L 3S3OA 3CC4S 2DEIA 4FWRA 2GJ2A 1NWKA 1U0SA 2VA3A 4QW9A 2WBMA 2IBOA 4FPIA 5KQDA 3JSMA 4PG6A 4JKEA 1VFJA 4Y2CA 2PMWA 3MWBA 3UCUP 1S6PB 5C24A 4B9SA 2WUSA 1T9YA 1Z05A 2FD2A 5IQQA 2V50A 1GXTA 1BG3A 2E2QA 2QJ3A 5E3RA 1B4SA 5F3ZA 3QIOA 2VBXA 3BP8A 1SIWB 4LRBA 1M1GA 4LSLA 2HFVA 4IQMA 5GAEI 1NK9A 2EBGA 2F8EX 4DPWA 3MXIA 1IBLK 1K73O 4OGEA 2XCPA 2MHEA 2ZOFA 3MUVP 2XS5A 2VFUA 2B4VA 1X9SA 5KFDA 4A8XA 4LRFA 3MAHA 4O3RA 2RE1A 4KAIA 2W9CA 3RRHA 4DSKA 1UJ4A 3M4XA 1FK9A 1KFSA 1S99A 2WVEA 4IUFA 1NJWA 1IKVB 4DV7J 2M52A 4KHPJ 2CPYA 1N36F 4ISGA 1GMWA 5C12A 2DXFA 1FWPA 2CJ9A 4UY8T 1B7FA 3QRRA 2R2UA 3JTPA 2DPJA 3ZSQA 5FRNA 1HPMA 3OYIA 3CSKA 3DOLB 1WC5A 4Z4HA 1XR7A 5DM6L 1CJTA 4BC2A 2ZWOA 1NMEB 3W5XA 4B3RF 1DY3A 2IYIA 4N41A 1U6BA 4DUYJ 3OYHA 4DR5F 5GADP 3C65A 2FBYA 4WU2A 1Q7LB 1WSFA 3WXMB 2WONB 5AQXA 2HNDA 3CC4N 3VETA 4FLYA 5IXUA 2PMZD 3UE5A 2G8UA 1EKRA 3C6UA 4RCHA 1FDDA 4WFBQ 5IT9Y 2YX4A 2H3EB 2OFHX 1IN0A 3AO4A 1VK0A 3DOKA 4FJ7A 4RBVA 1SB6A 5D4OA 4K50A 2HQCA 1X8DA 2BDPA 2DHAA 1RQ0A 2UZAA 3NF9A 1SAZA 5TKWA 3E66A 2D74B 5GADI 2NYHA 4H0YB 1VIOA 2ZH4A 2QA1A 2JVOA 4KB7A 2KYXA 3RMCA 3P31A 2MQMA 3WZ0A 2ZH9A 2EC0A 2OEMA 3ID8A 2G8WA 2BRLA 4LF6F 1G99A 3ILIA 2ZC3A 1HJOA 4DZDA 5BYQA 1NJZA 3GILA 3LM9A 3K58A 4OZ1A 1S9FA 3KXDA 1HWKA 4ZIWA 2BABA 4ECRA 1Q0NA 3K5PA 1YG0A 2JWLA 4JV0A 2M2BA 1SH2A 4LFCJ 2R8GA 3VVTA 5KGXA 3HVRA 4ID1A 2UV8A 3U1MA 3UFCX 4YDDB 3KHRA 4YUDA 2KXFA 5A8WA 5C7PA 4RUBA 2ZH1A 1EAYC 2XSJA 3UNYA 2QK9A 1KEKA 3V9WA 3C7NA 1HHSA 2N4DA 2GTDA 5C24B 3H2VE 3R1LA 1I94J 4B3TK 1K9MO 1ZBTA 2B8PA 3NVKA 4LSLB 2HHQA 2GEMA 4NLPA 4IH7A 1CEZA 5BYRA 2R3VA 3IS9A 4I2PA 3PR5B 3NAEA 1GLJO 4BRCA 1UPMB 2ROGA 3IN5A 4M5IA 1IBKF 4KTQA 3ZZOA 1U2CA 4ZVRB 2E5JA 2XCAA 2W9CB 3HL8A 5EU7A 3HM8A 4XK8C 1KHVA 4QOZB 3OYCA 4A47A 2QL5B 5KPZA 4OHYA 4PG8A 2QFJA 1T9XA 3QWPA 1XI1A 1NB2A 4PXCA 4RUHA 2V2KA 1KAZA 5IQ6A 3F9KA 4XH4A 4U8VA 1TL1A 1OY8A 2Y8YA 2Q1NA 3PIPQ 3BZCA 3IRWP 2G1HA 4CJ7A 3SK3A 3A3NB 4FW2A 1GX6A 5DJBA 2HVIA 4CK1A 2JLGA 3AH6A 1NKEA 2FSKA 4OKKA 1T9TA 4EGLA 4X62K 4O3QA 3FZLA 2JZ5A 1Z2ZA 4DCOB 3DXBA 4LT6A 4HUGA 1MSWD 4BRDA 1WC0A 1CJTB 2D4WA 4C0OC 2DNKA 3UDVA 4HEA9 4UF4A 1TKTB 3G71S 2RHQB 1SXLA 1X60A 3NCIA 2N3OA 2QYGA 3VQBA 3ZLJA 1YJWS 4ZPWR 3IGNA 3K8WA 4K43A 1VHIA 1WI8A 1SC4B 2OP5A 3ZYYX 2FVPA 3N9UC 3OR1B 5AQHA 2XGPA 2LKZA 2DY1A 2Z2MA 3BGLA 4CO1A 2LEBA 3B78A 2IPOB 2KG0A 3HVAA 2XO6A 2H5JB 4Z7CA 3FFIA 1UOCA 4O44A 4QZVB 3NF7A 3QO9A 2UV8G 1GMUA 1BUPA 2H54B 3GONA 1WSEA 3PO4A 3P4UB 2CJXB 1X7VA 3OFFA 3QMQA 1T3VA 3K7RA 3IAS9 2CKWA 2R8HA 5AXMA 3LDPA 2YQ0A 3NH1A 3CCSN 4IOXA 3EKSA 4PXDA 5AQZA 4M3XA 1R3NA 2BYCA 2YI1A 5HOOA 4Q43A 4X4OA 4RNNA 3EL2A 2KU7A 4KREA 5EX0A 5M2RA 3I5AA 4X4TA 4CO2A 3CJQA 2GX8A 4ILHA 2E2OA 2W6KA 5KFLA 4GNIA 1WC4A 1RBOB 2YWKA 4HYKA 2R2RA 3NF6A 4V19S 3O9SA 2LQ9A 2NRRA 4RLEA 1V5IB 5A8WB 3VGUA 3GV7B 3R6GB 3UD5A 4BY9C 4DV3F 3IR6B 3H6EA 4K7QA 4B3SJ 5ETOA 2O4IA 1S1VA 2QIFA 2HGLA 2RU3A 4M7XA 2LVWA 2VH7A 1ZA1B 3MM7B 3NGKA 3G71N 5J2QA 1EB0A 1DHMA 3R3TA 1X31C 3LDOA 3THPA 5AFUA 3THWB 1YJWN 1VQLS 3J81U 1QSLA 3SCXA 3GR0A 5HLFB 5EWGA 3VPZA 2BKPA 3CWJA 3VGSA 4CGDA 2Q66A 1VRTA 4FVCA 4HDHA 1KHWA 2UXCF 3ZX0A 4WBFA 5F2RA 2LQ5A 1CSJA 3L7UA 1OJ4A 1XNRK 4FJXA 3RUBL 3CGIA 4K4VA 2NCKL 1TL1B 4CJ3A 4WFNQ 2G4BA 1K44A 3J7AN 3KFWX 4DSIA 4DR7K 4I6MB 3MM9A 1Q8IA 3QGIA 3NWGA 3G4SS 2RS8A 4MH8A 2HAIA 4UTGA 3J7YI 3M1VA 3ISZA 1T11A 4FWPA 5HROB 2Z58B 1F2HA 2IC3B 2XRIA 4K2JA 3M2UA 1XC9A 4JYAF 4FOEA 1BQNA 2X74A 3AQOA 2GJIA 3QAEA 3FBEA 4YOVA 3NBPA 1HI8A 4AT1B 3EGZA 4CZGA 2GIFA 3ET6A 2V2ZA 3CC7N 2BUPA 3BSNA 4E8UA 4E7KA 4ZVOB 1YJRA 2FF6A 3LL3A 5FDLA 1IM6A 4X4RA 1UETA 2DKOB 3ZT4A 4IR9A 2R7XA 4ALZA 1VQMS 2ZF5O 1QQNA 3WT0A 4KHQA 1M5OC 2CJBA 1TUGB 4IJAA 3TZXA 2CQHA 5EUHA 3V9ZA 1RZMA 3TTDA 4NLDA 4NOHA 1JLQA 1S57A 3D54A 3QJLA 2IVFB 2AJ2A 2O66A 2HFZA 2RB7A 3JXOA 2O8BB 3SXLA 2YWGA 1HI0P 2AJFE 3CTRA 4ZP6A 2V69A 4F67A 1J9AA 5J2NA 1HBNB 2HGNA 1S4FA 5ETKA 4B3OA 2FY1A 2AD9A 2Q79A 3J7ZO 3LPTA 4C8LA 1RHRB 3TRGA 3OW2R 4DV2K 4MIAA 5HK4A 3RU0A 3NMRA 3KK3A 3V6KA 3G4SN 1K8AO 3FGVA 1X4BA 3OSPA 2H48B 1J5EJ 1N4LA 3T5LA 3VF4A 2PDAA 4OL8A 5FLXY 4DI6A 1EWRA 1S1VB 3OSNA 1KVJA 2QLBB 2WTFA 3V6JA 5KG1A 1KVCA 3QQCD 3DLGA 3R5BA 1RTJA 5J2QB 1ASUA 2DISA 3IBCB 3FNNA 2NRTA 3T1HK 4M95A 4USKA 2A10A 3AARA 3SBMA 4JI2F 4J9KA 1RDWX 1PBUA 1JLGB 4K41A 3SSSA 2GAGC 1VRTB 4CO5A 2ASOA 4JB8B 3A5OC 3UPFA 2M70A 4EO8A 5LM7E 1NK4A 2XZWA 4YDUA 1PBAA 1VQMN 1WWHA 4X66K 4F3MA 1F6TA 1IJFB 1S72S 1B9FA 2IDEA 4EYHB 2O1PA 4FF4A 3MM9B 1C0UA 1KDNA 2FJAB 2W7OA 3LP0B 4LF6J 2YTCA 4DHYA 4Z4CA 2E9ZA 4HHUA 5HP1B 4IKFA 3OL6A 4FXWA 3M1VB 3TSUA 2HMIA 1EIYB 1VS3A 1SC6A 3OYEA 4CE9A 1M5KC 4WIIA 1WBBA 2NXJA 3PG9A 1BQNB 3KJQB 2COLA 3WX8A 3KD5E 3NGYA 1KD1T 1PJ6A 3C14A 4LF4F 4AXJA 3S01A 4AM6A 2YNHA 1OYDA 3CJBA 3ET6B 1NGBA 4U6PA 3BSOA 4ZJQA 2R4FA 3FSYA 1VBKA 4R0EA 4WFBL 3ZETB 5A8KA 4C97A 3TX8A 2CZ9A 5IT9U 4G6VB 3AVGA 2CYYA 3UI3A 2BR0A 3MCSA 4GO5X 4ED5A 3V2UC 1NJYA 2BRKA 4OMFG 1D4XA 2QWQA 2JX2A 4CZLA 5HMXA 3GG0A 1EXQA 4G1PA 4A2BA 5AQVA 1HHTP 3GCWP 2QA4G 1IBKJ 3LGMA 3MCNA 1C1CA 2EK6A 3IR7B 1RAGB 3OXGA 2M88A 5JLHA 1NLVA 4IKAA 1F5CA 1JLQB 2DGWA 2Q43A 3OBWA 3GE1A 2BE2A 4DCHA 2K1RA 5FJ4A 3HHLC 4DV4K 2OAUA 2GW8A 2KYZA 5D0GA 3BN7A 3QJJA 4I67A 5KFSA 4ZTJA 1TTHB 4I6AA 5J2NB 2AYBA 4RJVA 3CCQN 3TU5A 1X9MA 4IG3B 4H5VA 3WEEB 3EXYA 1SV5B 5J2PB 3VGVA 5LSOA 1VHXA 2ZJQQ 3HP9A 3Q22A 1HNVB 1KQFB 1B92A 1U1OA 4IXCA 3H40A 3KOAA 2PYLA 2OELA 2FVQA 5C2GA 1AUSL 4WJBA 4DPYA 2YWFA 3MM6A 2MQNA 2DIUA 4H4KC 5C10A 4D3GA 4M3UA 1JJ2R 2NUUG 4LUBA 2E2NA 1H74A 4JKBA 3J7YU 3JB9k 3KUHA 1O13A 1XNQF 4IDHA 1C1BA 3GYGA 3D7EO 3VWSA 1RWUA 4MJKA 2HFOA 3PW0A 4A5AA 1GXLA 2DGTA 3Q8RB 3I55N 3A2FA 2KRBA 1N54B 2B0GA 4OX7A 3RRKA 4X65K 3BGRB 1UVMA 1RE1B 4F3OA 5T14A 1VQ7S 4LVNP 8ATCB 3MZIA 4LBHA 4EZ6A 1JNZB 4AHRA 4OYAA 4X4PA 5MAOA 3O3HA 2ILZA 2HK2A 3OYKA 4JHDB 4DV5K 1K0VA 2QXLA 2HZCA 2W25A 3BGUA 3LDQA 3AQPA 1CZBA 3MFHA 3M7VA 4I64A 2VQEF 3TAPA 4R0JA 1FWKA 4MKVA 2CNOB 1YVNA 2P9KA 4BWJA 3DRPB 1SJ3P 1NPKA 4N56A 1YZ7A 4B1XB 5L1KA 2ZHAA 4OZ3A 1EP4A 1LFWA 4C8OA 1VAZA 4NXMF 1YT3A 3KG0A 1ZTTA 5I9EB 1KFDA 2KM8C 5HQMA 2FC8A 2OTLS 3M9MB 1WC6A 2H3GX 1LWXA 4DTOA 2YNHB 2XO7A 4UW2A 3T6BA 4U67Q 2RVJA 3THVA 3D6MB 2KVIA 4DSLA 3DLEA 5LT5A 2W9BB 4RBUA 4DV3J 2VFSA 2BQ3A 1MNEA 1S0VA 4CGJA 1M1HA 2GA7A 4AHSA 2CH5A 5KFOA 2AGPA 4ELTA 2CPJA 1UCNA 5A0YA 3D0IE 3TP2A 5JS1A 4W5OA 3OLAA 3VAJA 1K0TA 5HRSA 3A4TA 1VK8A 4DU8A 3CO9A 4BBYA 1GOCA 2A6AA 1C1CB 3CCJS 1FRXA 4JI6K 1F21A 3MGJA 2K1RB 1PKUA 1RU2A 3NNCA 1RWOB 4I6WA 2M5YA 3ZZPA 2DR5A 3EVOA 1VQ7N 5CYQA 1U49A 2DO0A 2QV6A 1O8BA 1RAAB 1Q82O 2GVDA 3TW0A 2LEPA 4YFUA 1BY9A 3N6MA 2R8JA 7FD1A 4DV0K 4NYFA 2CPFA 2JC0A 3SFUA 3L09A 1HBMA 4DPXA 3N6NA 4IOBA 4DU1A 3EPGA 1I1GA 2QSFA 4PZVA 1N5QA 1N0VC 4I56A 3OT9A 3L2QA 4OI2A 3QEPA 2HHHJ 5GAHI 3HFKA 1VSIA 2OKQA 4B9UA 4HUEA 3QEVA 5KI6A 4JI7K 3H7HB 1QQOA 1TU0B 1R27B 3OJSA 4JD2A 3L2UA 3BH7B 2FB0A 3CJAA 2XZTB 3OHRA 3CIPA 5H1SV 1K9MT 3KMSA 3RBDA 2VG5B 1N34F 3LP2B 2CWKA 3HHDA 2PD1A 3KG1A 4C3KA 2OTLN 1E6YA 4O4RA 4CEEA 4B9QA 3X3UA 2KVQE 5JVGQ 2JWNA 3TVZA 3PJXA 1C1BB 5F8HA 4KFBB 5E7OB 3MPVA 1XEZA 4NA3A 1T95A 1G7CB 4EI2A 2MJNA 1HNZK 1VQ6S 4DV1K 1IR2A 2NLWA 3I33A 3K0SA 4KB1A 3RW7A 5KFKA 2E66A 1CULA 2A0FB 4LF8K 3MM5A 3DCAA 4MDBA 1QHTA 3E01A 4LRDA 4WFNL 3VQ8A 1URNA 5KFZA 2Z0GA 3FFKB 5K14B 2HRTA 2A1RA 1JMTA 4UQTA 2AGQA 4BE0A 1P8GA 4KKOA 1BWEA 1RXOB 1RBLA 1WD6A 4Q5VA 4M94A 1N32J 3OYAA 5TKYA 5F0UA 1RLDA 2P9KB 2P9UA 3TA2A 1VSLA 2A2DA 4CNZA 1EP4B 3DXSX 3UN3A 3ATUA 2CGLA 2FXUA 4PWDB 1SJFA 2ACMA 2LQ8A 2L9WA 3D68A 3GPAA 2Z1JA 1NDLA 1KCFA 3OTOF 3IXQA 4J9VA 3ZTSA 3QICA 1BCOA 4TU7A 3E8OA 3LWMA 2HVDA 1S0NA 4MLEA 3QSYB 5D8HB 3GE9A 1UA0A 5T41A 3Q7CA 3AVMA 3OS0A 4ZVEA 2F4VK 1XQSC 3LUYA 1X4FA 4A8SA 1RGVA 1VLOA 4CT8A 4Z4FA 1U02A 4B3MJ 1F3FA 4WP9A 5A0YB 3SUOA 2WOMA 3H4BA 3CDAA 4BRLA 1CJVA 5AFUH 3CJ3A 4DL2A 5BREA 4JI2J 1NHVA 4M3RA 5LXRA 5F9LA 2POKA 1WUUA 3NGRA 3KJFB 1LQ9A 1IBMF 1FRKA 3GL1A 2C2KB 2QTDA 1DURA 1B9DA 4WQ5A 2ADBA 2HF3A 3IDHA 3W1YC 2ZZMA 3N5BA 1VQ6N 3D6TB 4WE1A 5CYQB 3MMAB 5HO4A 3JAMO 4LSNA 4K5RA 3LO3A 3VEVA 2UXBF 4JV5J 3LGHA 4E2FB 1SKSA 5IC4B 3KDOA 1WEYA 4M1KA 1CG2A 1E3MA 5KAKA 4DQRA 5CCMA 1AA1B 5AQOA 3TVYA 3NHGA 2J7KA 3LZJA 1ZA2B 1RTIB 2C3MA 2XULA 4EIAA 1C0TA 1MU2A 1VQ9S 4FWKA 3HSTB 4CM2A 2LA4A 4KH4A 2BACA 5L1LA 3EDQB 4JD2B 1BISA 2P9IA 2HHXA 3CETA 2M8DB 2ERRA 3BY5A 4LF9K 5ADXH 4J9NA 4E3SA 4CCHA 2KN4A 2GIRA 4OJHA 4LBIA 2QWMA 4JK7A 5J2MA 2MQ8A 4CHNA 3CCZA 2HF4A 2DRDA 4EBEA 3VR1A 4Y3CA 3IWNC 5CR4A 1P90A 2J0WA 3DLKA 5DGAA 1SIZA 1V4TA 4LFBK 3K2YA 2Q6BA 3K5OA 1VR6A 3C15A 3SCKE 3L3CA 3TUPA 3DOMA 1X3NA 1J53A 3D6HB 2CDQA 1OSCA 2JJ4D 5AZIB 1CULB 2DNMA 3MM5B 5CYMB 2OO4A 3E01B 3MECA 3CJ4A 4Y2AA 5KOXA 1JQGA 1M1KT 2RU9A 1OKJA 5A2QU 3B8AX 3QFPA 1HUXA 2Q1LA 5KFCA 3VQTA 1M5VC 3I82A 4CFCA 3V9UA 3CDUA 1DLOA 4ZN3A 4QYRA 1NKBA 3KLFB 2DNLA 4LRAA 2F1FA 2P9UB 3RVCA 1Q7YT 3P4IA 3K9KA 1VSMA 1R43A 4O3NA 2J4RA 3D4JA 1KLMB 2J6TA 2HBMA 4ECXA 1S6UA 2OTJS 1OPIA 4ILRA 2CPEA 4CZEA 2IDOA 5HQ8A 2MB0B 1VI7A 6FD1A 4X2BA 1SI9A 2MKHA 3CHWA 2QWNA 1TUYA 3T6JA 4CNYA 3F0NA 1ZM2A 1RTHA 1MROA 3I4PA 5AE1A 2RE2A 4A8QA 1RWWB 2V2QA 4CEFA 4KV8A 1RWNB 4KHNA 3HHLD 3AO3A 4JI3F 2FGCA 3QRPA 1TL3A 3VTHA 2V4JA 1VQ9N 3V1RA 3V4MA 1JXLA 2DNNA 3CB4A 3H46O 5B8HA 2NRXA 1NSQA 2MKCA 2KFZA 2V9WA 1CJVB 3BF4A 4NLXA 2QFIA 4H8KA 1XNQJ 2HFSA 3CFOA 5GAGP 5GAHU 1ZZNA 1T0TV 3ZZTA 5B0CA 4OX9F 4JUZA 1DTQA 2R8KA 2QWLA 2NXNA 3H5UA 1NHUA 2VPWB 2ZUGA 3ELHA 3L0QA 3KG4A 4CD3A 1ASVA 1G1XA 2JWKA 3QATA 4C4WA 4DSFA 4DPTA 1GTEA 5KFIA 4Y00A 4HTJA 2F9WA 3D2EB 1UL3A 1SJ1A 4N8OA 4O0NA 4DR4J 2C2OB 2CQDA 5GAGI 4FK0A 5DQHA 2ZJQL 2VQEJ 1UZDA 2K3IA 5HRRA 3VQDA 4KH5A 1MU2B 1C6VA 4K4UA 1K8AT 3VEZA 2HAFA 4JNEA 3V1OA 5L9NA 1ACMB 1YZ6A 1HD0A 3BSAA 3UR0A 1W9HA 2OPPA 2A18A 4NXMJ 4KSEB 2P9IB 5JJBA 4DR1F 5KG6A 3HI0A 4TKTA 3MDFA 5LMUJ 3KVGA 1VBXA 3CM6A 3H3OB 5J2MB 4BRMA 2I7NA 3HCXA 1UMJA 4ILLA 1U4BA 2GO9A 1DFDA 3ULDA 4ZLPA 2QG9B 3MURP 2QMWA 3H5XA 1Q81O 1FDBA 1RJJA 2BOAA 2NRHA 2IRYA 3DOMB 5C5JA 3O9UA 2CJKA 4UUWA 3H90A 1D3WA 3PNIA 3M8ZA 4NMXA 3HVTA 3HSZA 1FJGK 4QJVA 4JI0F 3T41A 4HVZA 5DG7A 2DR6A 3S7RA 2V6AA 3TAMB 3HZ6A 3TUIC 4J2AA 5C2FA 1WC3A 1EX8A 3DLBA 2V7ZA 3L6QA 4F2SA 2E5LF 4YY3F 4JI5K 1BUXA 2XGQA 2DH7A 2DCLA 2GELA 4J9LA 2XMWA 3T1YK 2A3ZA 3S8SA 2LDYA 4OYZA 1N5YA 3OYFA 3BBCA 2IOCA 2AV5A 1XMOF 2BM0A 4X64J 4IFVA 3MPWA 3D6RA 3IP0A 3CYMA 4JRPA 2HQIA 1CJKA 3PZPA 4USVA 2GBZA 3UDLA 3Q2TC 3QT6A 3CJ7A 2CQBA 3O3FA 1RAFB 2ZKTA 2A6OA 2XLIA 4WK3A 2CH6A 3JSRA 3GV5B 4LF7K 4OJ3A 1FKOB 5E3PA 3ISNC 4HI2A 2UXDK 1RTHB 1O51A 4ZPVR 3KKSA 2E88A 2VG7B 3S1TA 3ZXWA 3OUYB 1CC8A 2YKPA 4CJWA 1VQOS 3EVMA 4J9QA 4L3NA 1TL3B 5GIPA 4KBIA 1VQPS 2V4JB 4USWA 3C6TB 1YJNS 5AQWA 2DFEA 3QT7A 3I5CA 4N76A 2D9OA 1ATSA 1Z4UA 2ZM6K 3NDKA 3ENQA 1C1AA 2O67A 5LY3A 3PSFA 1HW8A 3RZAA 3E2EA 2HQFA 4QS9A 3CCLN 2PGCA 4BGBA 4DWIA 2ADCA 1WELA 3Q2SC 3D0HE 2ZJPQ 4JEPA 2HNZA 2C3YA 1YTUA 2QL7B 1I3AA 3HSGA 1NJIO 4Q8EA 3QBXA 4ID5A 2ZBRA 2J9CA 1FJCA 4J2DA 3TZYA 4IOAQ 1HIYA 1YLXA 3ENAA 2WZ1A 4PQUB 2FJWA 2J8SA 4OZ0A 1RDUA 1IBLF 4KPCA 3VEYA 2HWTA 3TZZA 1ZBUA 3R5AA 1WACA 4OYXA 3UWTA 4W92B 2RS2A 4I69A 3AAQA 2HS0A 1JLEB 1U6ZA 1S22A 3V6DA 4XPCA 3QB0A 3QFUA 2DYAA 2YH0A 2WW4A 1OYEA 4Q8FA 3DI6A 1ZM3A 4CIEA 1N88A 1MN9A 2IBKA 3MN9A 2HNYB 4XEIA 2CVEA 2OPPB 3T9ZA 4H4MB 5EX3A 4KO0A 1RT7A 3Q8PB 3PHEA 4NLWA 2DY4A 1GLDG 1RISA 3I56S 5IZHA 4WFXA 1WHVA 1HD1A 4QOTA 4DR2J 5JVGL 3GJTB 3NMUA 1U26A 1D5AA 3D2WA 3T9NA 1VQON 4PXBA 2KHDA 3ATVA 1VQPN 1YJNN 4BRAA 1Q1KA 1TQLA 5F0XA 5E0OA 2V4QA 3HVTB 4ICLA 2H4YB 4UY85 2R7WA 4NI2A 1T6DA 3L7PA 3CIMA 3E9LA 3V5RA 4XH1A 3MTJA 3UO0A 3UVJA 4WQ4C 2XBPA 2NR0A 4KGXB 3R27A 4NLOA 5CYJA 2D3UA 3NNHA 2V68A 2QI2A 1IBMJ 3DLLQ 1TKZA 1TELA 3D0PA 2HGMA 4TQRA 3C3LA 4FJKA 3HP6A 4F0KA 3HOSA 1DQ8A 2LA6A 4DN9A 2M3DA 3GG1A 3CEDA 2VOPA 1GH8A 4BVOA 5KFVA 1CJKB 1WF1A 3CFRA 1OS5A 1H2UX 5LJWA 2N4CA 2V8VA 5I42B 2B6AB 2VFVA 5KT6A 1KS2A 2OMOA 2RAQA 2WSEC 1S9EB 3AA2A 1MN7A 5F8GA 1X5SA 2BEFA 2RT3A 3CJKA 3L9ZA 2P9NA 4ANEA 2I7PA 2WHOA 1TZ0A 3VQCA 4J9UE 1NLKL 2ZH7A 3MWTA 2QC3A 1RHKB 4DR3K 2DR8A 5AQIA 3I0RB 2YKNB 2A41A 3TA1A 3EZUA 2P6TA 1LK5A 4W98A 1U8WA 2FJBB 3I56N 4MTPA 1T3NA 1A5XA 2KKHA 2CADA 3H45C 2CPZA 4YOEA 3LPYA 3THTA 3UB5A 1H72C 4HT5A 5KFFA 4LFCK 2D0BA 1DBDA 2G1DA 1IR1A 4Y34A 1HNXF 3VQ5A 5ADZA 4B3TF 3KDNA 2PN6A 4ID5B 1NEEA 2DNYA 4U96A 4ZP7A 2I5JA 4CLUA 4ZVFA 3M8QA 4FCYA 1RBUA 5AQPA 4EU0A 1NK0A 1RGIA 3L2VA 3M30A 1BQXA 5KG5A 3AA4A 4BR9A 4ZVGA 3I8DA 2MZJA 5FIIA 3CJ0A 1SL0A 3HPHA 1IJEB 1ZBHA 4F50A 1FTCA 3DI6B 3ZSWA 1F9EB 4NLCA 3ENWA 4YB5A 4CM0A 4OPHA 1XMQJ 3CF5L 3I4HX 3NGUA 5IWAK 5D4NA 4GKJF 4KO0B 3MD1A 2LU2A 2BZ2A 1RT7B 3G0ZA 2OD6A 3MEGA 2LXIA 1HHQA 3A5MC 3L2RA 3U8XA 5LL6d 4MK7A 4C23A 4X62F 4IH6A 1CXUA 2DBBA 4PPDA 3VEOA 4DR6J 2YXLA 2N82B 1RAEB 2VIHA 4WFAL 5CH7B 3AXKA 4CEOA 2VFRA 2UVVA 2KQ2A 4EEYA 2XB2D 3MEDB 1UVIA 4QWBA 1ZPWX 3CUNA 1NZAA 5B08A 3RG6A 1Q86T 3SI6A 4NASA 3DXMA 3U3YA 3ASMA 4NI2B 2AQ4A 3CD7A 3VF0B 3UVJB 3PV8A 3T5JA 3TQEA 2A6MA 2V4RA 4KHWA 2QEXS 4JKGA 4OX9J 2I8EA 5HI7A 1JCGA 2PFFB 4MMOA 4E7IA 1R0CB 3WIUA 3CDBA 1K1QA 2EWHA 3AD9C 3SLCA 4DV6J 2G8KA 4CRJA 3WNEA 3AVNA 4FJLA 1JKHB 1X4GA 4CF1A 3W65A 3DNCA 4ID8A 4P71A 2F9JA 3I5BA 2X3GA 1UVLA 4WFZA 3UDCA 1BGXT 2GHVC 3LDSA 1PAEX 4IDKA 2ASPA 2RNEA 4KGZB 4FJHA 2UVWA 3FR0A 3O9QA 1AW0A 2J0QD 3RBXA 1FE0A 5KT3A 4ED7A 1N48A 2OZSA 4F4WA 5DLGA 3O3GA 5MLCQ 2MQLA 3MXMA 1XMBA 4P2MA 3D66A 3VHQA 2Q2RA 3RB0A 3HX9A 1GX5A 1WJ9A 4WTYA 3KK1A 2K7KA 2VV5A 4OHWA 3PEJA 3NVMA 2I1RA 1EQ0A 2HBQB 1CLQA 3J7Z5 3BBFA 2RQMA 4O3SA 2ZKUA 4EMDA 1WOPA 4BG8A 4NYOA 4Y6IA 3WQPA 4OFZA 2A40A 3ZSYA 1OSDA 5LMNK 3VQ4A 4OIXA 1HBUA 2ZZNA 1S1WB 4FLVA 4Q7AA 1N8RT 3W66A 4FF2A 3VAIA 1WHYA 4LJMA 1IH7A 3P49B 2LLZA 4JI0J 1AUDA 2WVBA 4B3SK 3VAKA 3GJSB 3O5TB 3ZX3A 1YRXA 5L46A 1B99A 4LC9B 3U02A 2OPQA 1GMWD 4EK2A 2E5LJ 1NUEA 4X4SA 4C3LA 5IV4A 3DN9A 3P39A 3B6OA 3AOCA 1JL1A 5DG9A 3WQTA 3CJ8A 4DX7A 3SDEA 1XNRF 2IM1A 1XMOJ 4K25A 4ZA1A 3PEHA 4CD1A 3GMGA 2O8EB 2HEKA 2MPUA 5E5NA 1YVUA 4DR7F 1P1LA 3FGUA 4DCPB 3IO1A 4DFPA 2K06A 3BSCA 2B9EA 4OX8A 1YJ9S 2WSFC 3MI7X 3MUTP 2CWXA 3U4LA 4GV3A 1FA0A 1PCAA 4NZ7A 3VENA 1X4AA 2BANB 4XIUA 4OYOA 4MLHA 3DAWA 4CO4A 3TSPA 5F41A 3W2WA 4NWBA 4JKFA 3A0IX 4PQAA 1HKAA 2RIJA 3ISND 3W2VA 4CQ1A 3R8EA 4FLXA 2HBJA 4JI1K 3I0SB 2LU1A 2Z1IA 5DMRA 4BRPA 2Z1HA 3Q86A 1IKXA 4M5GA 2LDIA 3AB4B 3R5DA 3TJ8A 3HKZD 4CIOA 2D9PA 3RB4A 2WBRA 4QIEA 1H6KX 2AJ4A 4J9MA 4QQBA 4XDCA 4NLRA 3U9ZA 4KI4A 2ZDOA 2J0SD 2AYEA 4J5OA 2XZDB 2YX1A 2OANA 3LM2A 3LAMA 4CJUA 2ZUAA 3MPYA 3I87A 1NO8A 1HQUA 1RNHA 2OZMA 2HURA 4K59A 4JI8K 3BEXA 4RPFA 4NLVA 2BV3A 1S1TB 5D78A 1AXQA 1L3SA 1BWFO 4CI6A 4IDKB 1SC3B 3FZFA 1RLCL 2HWIA 1QQMA 4G1QB 3TPQA 4DTXA 1HMVB 1T05A 2QN6B 2OPRB 4Y65A 4CESA 3FRZA 1WI6A 3H3NO 3E9OA 3FBFA 4N77A 1I6JA 4E98A 1LW2A 1IR0A 1GLLO 3EZOA 2F4FA 2R7SA 3KK1B 4UQGA 4RX6A 3TOQA 4DV2F 2ZH5A 5B0GA 2E6MA 1UJ5A 3D7SB 2XHWA 3QZ8A 1BMQB 2ZJPL 2IRXA 3NWRA 2OCEA 1YJ9N 5CHIA 2BH1A 2DRAA 2WRMA 4P73A 1AZSA 1EARA 3DYAA 3CMQA 5H9EK 4NLUA 4CK3A 1HBUB 2FHJA 4WYBA 4ZP8A 5I3UB 2B9WA 1KAXA 1J5EK 2DTUA 3O9RA 2CUYA 2Y8WA 3T1HF 2RRAA 4IO9L 2VC1A 3N5FA 4JKDA 1RT1A 3RAMA 4I9LA 2JEIA 4TSXA 3AY9A 4AHVA 2SXLA 2K2PA 2E9RX 2UVUA 2ZZTA 1JK9B 1QE1A 1JB0C 3FQLA 3K89A 2P9SA 1SBRA 1HLUA 1YITS 1U8SA 1HQEA 4GVLA 1SH0A 3NGTA 3PJWA 1RT2B 4X66F 4FP9A 3SZ2A 3H08A 3THXB 4ZIVA 2YKOA 4A2AA 5D4PA 2YHXA 3OPKA 1X4CA 4Y1DA 3ONQA 2YNIA 4BLGA 2PT0A 3DU6A 4WYWA 4BWMA 2X6SA 1ITGA 1KOHA 3UCGA 4R8UA 1OVYA 1U1RA 5BRFA 3C94A 1GT8A 1ICEB 3D1OA 3DXKA 2GUIA 2G2YA 3TI0A 4UT4A 2UXBK 3HDSA 3WBZA 1UAXA 1Q16B 4IFYA 2ZBQA 4JP8A 3VALA 5K9FA 2V51B 1RTDB 3O9TA 2JSXA 5M1KA 4CBWA 4G65A 4XTTA 5IS2A 3AD7C 3CD5A 4IJNA 3BBBA 2F65A 4RW6A 2NXCA 3W2WB 1JJHA 4LFAK 2W24A 3TWHA 3O8MA 4GVEA 1Q79A 1UA1A 3W2VB 2DXEA 3H0PA 4C0HA 1YBUA 3PDNA 1J6ZA 2ZWPA 1EQMA 4HHHA 4H0VB 2WVDA 2CQ4A 1IKXB 2FBXA 3M32B 5I3PA 2YWHA 3BO3A 3MX2A 1JCEA 4KH0B 4B3TJ 4ZS6A 2CNKB 1W7WA 1VQSA 2BTFA 2GHPA 5BR9A 1LXNA 1C0FA 4NXNJ 3G87A 4MQ3A 4YHHK 2WTUA 5DLFA 3P6YC 5BR8F 1KC8T 1ZTWA 4NEZA 1WNSA 3AB2B 1FNMA 1M90O 5DO2A 5E26A 1K6YA 5KFGA 4KGKA 4DV4F 2MDAA 3JYTB 4P52A 3BGOP 4BR5A 3ZEUA 1RKIA 3MAAA 3NNAA 3KWMA 2AIRB 1A5WA 2YNFA 1DARA 3JAMY 3M1FA 1YITN 2AWZA 4XO0A 1QVGM 5AQSA 4AFFA 4H5TA 4DSEA 2KTQA 3PW4A 3KJVA 1KVAA 3G6EN 4ZVHA 5GMKa 4X62J 4FN5A 2VQFK 2UUAK 4MO5A 4AHTA 1H38A 4BC5A 4KC5A 3C2PA 1TK0A 1SJRA 3D5MA 2WVFA 1YDLA 2ZD1B 4BRQA 2O5DA 1F5BA 3J7A1 1RHQB 1JIHA 2EXUA 2UUWA 4CHYA 3SBGA 1XWLA 3VA3A 2VG6A 1FRHA 5EN1A 3HRGA 4O55A 4DL6A 2JVRA 2DGSA 4ANDA 3IA0A 3MN6A 2LMIA 2XY8A 3IMXA 4AQYJ 4K4WA 4F02A 2OYQA 5AQYA 4F4AA 5G0RB 4BRFA 3EWGA 3ZTPA 2DK2A 1HBOA 4PKGA 2P9CA 1K1SA 4WZMA 1NSAA 4ZPCA 4YQWA 4OZJA 2VFTA 3G10A 2G9OA 4X65F 2C2RA 2P9SB 5AR0A 4B8AB 5FRMA 1BC6A 3PX6A 1HQEB 1S9GB 4RW4B 1VRUA 4LSZB 4MK8A 3R1HA 1LNQA 4CFDA 4QR1A 2PEBA 4WPAA 1ZBLA 2L9DA 4DV5F 4MDAA 3RGIA 2WAQD 2YNIB 4KI6A 4MK9A 3R9LA 4CHQA 1RT3B 4RKUC 1P27B 4FKYA 2M4MA 2HHUA 1XERA 4PAAA 3UDEA 2VA2A 4I68A 1RHMB 4QU6A 2U2FA 1BHNA 4USHA 4XDDA 5KPTA 4M42A 4IFYB 5BN8A 2HBZB 4TYAA 4OV6A 1ZAXA 1BCMA 3D9BA 3QJPA 4RW6B 4GY2B 2KRRA 3TZWA 1KXPA 4Y0FA 1PG5B 5HBMA 3FEXB 3BF1A 4TU9A 5JLFA 3GCXP 4DG1B 1SL1A 2OPSA 3IG1A 5KG2A 1W7AA 3EE3A 1WKKA 1JXBA 2UU9J 4HHJA 3BZKA 2PFUA 5CZVA 2ZGZA 3ZNUA 4IFEA 3UN5A 5EVZA 2AZ3A 4ECQA 3OA9A 2H5EA 4RNHA 4W5TA 4GRSA 1GNKA 4ZITA 2AZ1A 3C8YA 1VSHA 2DNQA 2XI2A 3GSIA 2XC9A 3HHKA 4OO1J 4JI6F 4RW9B 2ZWHA 1IQZA 3M8WA 3VGLA 2FSJA 4ER8A 2Y0SD 4Y1CA 2KT2A 3TNVA 3ZEUB 3MAAB 2R2SA 1TK5A 3EMTA 2RH3A 1BDGA 3R2DJ 3G6YA 1T03A 1DZ5A 4ZKAA 1RB0A 1ZAVA 4TXSA 4DR7J 4WQ5C 3H5SA 2MZ1A 4DV0F 3NCPA 2NRVA 3DRXA 1SZ2A 5A6WA 2AW0A 4KT0C 3PIOQ 4CZCA 3BV8A 2GNKA 3QERA 4CK2A 3KHGA 1HJRA 3MD3A 2AX1A 3QSIA 3GIJA 2IJFA 3NGDA 1GFWB 5JVHQ 1VQKS 4JI7F 2VJUA 2VG6B 1O1WA 5GVQA 2W2PP 2RD5C 1RDCA 3FRYA 1OWXA 4M7YA 2HHHK 4F3TA 3MM8B 4U8YA 3K5NA 4BRNA 5E2QA 4FM1A 3EYZA 2ASMA 4YOYA 2W2OP 3SCIE 1YBAA 4CZFA 1W2IA 1UEUA 3EE8A 4CECA 2IVOA 4P2XA 3W8PA 2NSCA 1IKWA 3RWUA 1H98A 2JH3A 3VF2A 1RCOB 2CPHA 5BPNA 5ETSA 2NLXA 4A62A 1HNZF 4OGCA 4MFBA 4UOGA 4DV1F 2QKBA 3HZGA 5IT9O 2H5IB 4E1MA 2D0OA 1VRUB 5RUBA 2ZC4A 1RA7A 4C8NA 4LF8F 2KJWA 4DPOA 3KKRA 4NRUA 2CXEA 1NK6A 2RN2A 3NOGA 4P9SA 2P5VA 4J91A 1RWVB 4K5SA 1HNWJ 4QAGA 1HNIA 2AMCB 1KLNA 3CQXA 4ELUA 1WOSA 3W7BA 1NK5A 4E19A 2B4PA 5C2CA 2CJYB 2ITGA 2MHNA 4FS2A 1Q9YA 5E33A 4YOTA 4K0KJ 3JTNA 3ILOA 4QIWD 1N32K 1EETB 2FHOB 3SAGA 2ROPA 2V9KA 4KQZA 3K0JA 1H0HB 2KB2A 3P45B 4DV2J 1MMDA 1NMDA 3A8YA 4E1NA 3DMJA 1WOQA 2UUBK 1YF5L 1FE4A 5HBMB 3C0BA 5G4DA 3IG1B 3KHHA 3CIZA 2QZ8A 2F4VF 4CGHA 3R5JB 4M8LA 1Y3JA 3OFHA 5KG0A 1Q78A 2G0CA 4CTAB 1VQKN 4AF1A 2IVMA 2EEYA 1VRQC 2JRSA 5DZ7A 3GIRA 2DR7A 3T1HJ 1RT5A 4TYBA 2CPDA 2EPIA 3PLAA 3CJSA 2CPIA 4B3MK 1C0MA 4N47A 2CQGA 4CEQA 3LP1A 1ILYA 3VOVA 3D3CJ 2CQ3A 2GHWA 4YR2A 4B9VA 1T94A 2H51B 4DPUA 4FKXA 4DQ8A 3ICLA 5A8RA 5BPLA 1TYQB 1NDPA 2PC6A 3ZZZA 5I3QA 4CYUA 2AYMA 1T03B 1SVDA 3TUZC 3KNAA 4I7FB 3W62A 4EYIB 4QIFA 2VWBA 1EO1A 4JS4A 2CA9A 5B0FA 4A48A 5CAAA 4L73A 1BA1A 4FJNA 2HHVA 1VSDA 2P9LA 2NZ4A 4DCJB 3ZTRA 1HYZA 5HRNA 4JV5K 1SJQA 3PACA 4ZLNA 2ALZA 5JMNA 4HR2A 3IBWA 1NMNA 3MMCA 3AVIA 1YTAA 2B4OA 1CQNA 4LF9F 3W64A 2DGQA 2DGUA 4ZOSA 2Y1JA 1PYOB 3CJ5A 4ECYA 4QWEA 1LAWA 3C6HA 3P3DA 5F1XA 2YKMB 1U1NA 5D0RA 4LFBF 3SJJA 1SKUB 2DHHA 1DQ9A 3ULHA 1U7LA 3I9ZA 2OA8A 4H0XB 2Z2LA 1WEZA 2XWYA 5B0AA 2ZJRQ 1WKLA 3JSMB 2HQ3A 1AYEA 4A8MP 3VZHA 1HNXK 4H54A 3D28A 3OYJA 3DDIA 4TVAB 5ETNA 4BE1A 1WHXA 1H1VA 3FLCO 3PRDA 4BRHA 4KR0B 1YWXA 3VQ9A 3FQKA 3QLHA 1TUVA 4I2QA 3UD3P 4DB3A 2DFHA 2W01A 2VICA 1CS4A 4M5KA 1RYRA 1N0UA 2XG8A 4R25A 1P9YA 3LGNA 5KFWA 2ROEA 3WC2A 5DG8A 1FK9B 5CA5A 3TR5A 4BR7A 1XUPO 4XPEA 2Y9HA 1TL7A 3EN9A 3EZWA 4NCGA 1UVNA 2VL1A 4C1NK 2HVZA 1NGHA 1FFSB 1NK8A 4GKJK 1QS4A 3O4WA 4TLRA 2A2CA 3PTWA 1AROP 3CPWR 3J81j 4CF9A 4BCAA 2FHKA 4O4GA 1EKSA 1FKPA 3I96A 1XTZA 2WB4A 3A8KA 1ZOTA 2X1AA 5KRTA 5C2DA 2CVIA 3MMJA 1WTFA 5KFJA 2DRBA 1RT5B 1RHJB 2CGJA 2HSTA 1U0HA 3ZCMA 2WSCC 3EGVA 4UY8O 2ALYB 3PO5A 5BXIA 1REVA 2LP4A 4CVNE 4FLZA 4FDFA 1RBRA 4JS5A 4E0DA 4CJ5A 4WIQA 2MY8A 3QNNA 4GKKK 2HNDB 1DTTA 2CPXA 1RBSA 3OD2A 4NLSA 1BQMA 3ZTOA 2VGMA 3C6UB 4FOIA 1DJ0A 4R79A 1SPBP 3KD1E 3DOKB 2EI5A 3OHBA 2HBKA 3QINA 4DV5J 5DDPC 5D77A 1AT1B 4CJSA 1EJ7L 5F9NA 4B9TA 4B9LA 3PYFA 5CZXA 2L41A 2IM0A 2P9LB 3QNWB 2BW7A 4FBTA 2DEJA 4DBQA 2OD4A 3EX7B 3W61A 1VIXA 4DR4K 1OH8A 1WEXA 4IG0A 2VDHA 4J2EA 2RDDA 2KT5A 2RF2A 3IWLA 2EFOA 2B51A 2DNHA 1VQYA 1U09A 2G8FA 3RAXA 2MTLA 2AKWB 3R6MA 4FYXB 3MR5A 3ZZYA 1E4GT 2D3ZA 2B5JA 3IGVA 2R9LA 5LXYA 2ZH6A 5GAEU 4ZTFA 2PI5A 4CJPA 4FBUA 2OEKA 4QYZJ 4YEAA 3UKRA 3FZMA 2BXJA 5LMUK 4C9DA 1Y3KA 1FTRA 1U1QA 3AT1B 5DK5A 2P6SA 1TK8A 2KXNB 3U7JA 1SH3A 4HWIA 3RMBA 2O3DA 1WC1A 2MEWA 3FJ2A 1FJGF 1APSA 1A6LA 3KTQA 3KLVA 2XSJB 3QMLA 2JHEA 3C7NB 2M9KA 1NU4A 1F1BB 1TKDA 3RSEA 3CCRS 4HDGA 4YDXA 1HKBA 3KLIA 3OYGA 4HVJA 5F8LA 2E5GA 4JI5F 4JI6J 4OPAA 3HHLA 3T1YF 4P2FA 4I2QB 2GQQA 3IS9B 4I2PB 3CJRA 3DGPA 3ZTQA 3RR8A 4HHTA 4DEZA 4KHRA 3G96A 4ZP9A 3H2LA 1U04A 3KLEA 1WSHA 4UZCA 4LIWA 2LFVA 1ZH5A 1E6VA 4K4YA 4LF7F 1JWWA 4NCGB 4OYIA 4ZHRA 2UXDF 4U7BA 2GWKA 3HJVA 4GMJB 1KN6A 3GG4A 3SUNA 2JC1A 2F7VA 4JI7J 2XLJA 3MEKA 4P7VA 3W60A 4Y2KA 2ZM6F 1FKPB 2E1ZA 2IGIA 4FYYB 2QTWA 4IRCA 3FVYA 5GADU 1N56A 4F4XA 1RWKB 3K5LA 4CEAA 2KXHA 4KH6A 1Y5LB 2QGFB 4IRDA 1YQHA 2V52B 3PCOB 3SAHA 3HPGA 1HNZJ 3N4QA 1FRLA 2D5RA 5ADXA 2RILA 4MT1A 4DX8H 1S5ZA 4DV1J 2FY8A 3VAGA 1D1UA 4CHOA 3OFGA 2D0AA 3DJCA 3AVHA 2W2MP 1FFGB 4FLWA 4RW7A 2B56A 3V4IA 4HTLA 2V63A 4QWAA 3NGIA 3UKUA 3SCJE 4OI0A 3KWIA 4PY5A 5HAOA 5M2UA 3SUPA 5C25A 4KHUA 3FFIB 1V5VA 4O44B 1NBEB 2XS7A 5A2QO 3QO9B 3AA3A 3PIOL 1T6CA 2HWHA 2MZQA 3NMAA 1QD1A 2JDJA 1U47A 4J8FA 3Q8VA 5JVHL 2RF2B 1ATNA 1VQLN 2G8VA 1B3TA 2B5JB 1LWFA 3UNGC 5CD4H 1WTBA 2F9TA 2XS2A 1PYTA 3E51A 3PW2A 4B1YB 2Z8QA 2CQPA 1N36J 1NSKL 2YWEA 2GAHC 4OPKA 1NSPA 3CDWA 5CABA 3HTVA 4M41A 4ZVSB 2ILYA 4CI0B 4CLTA 2KW4A 2PO4A 2JL9A 5KTQA 2MSTA 1HFEL 4DR2K 3THYA 2ZEJA 4AUKA 2ZBPA 3BGFA 4K8RA 2M0GB 3SNNA 1UPPA 1Y7PA 2FIUA 3BQ1A 3OVSA 4B3RJ 2JFDA 4DUYF 1QDUB 2O8CA 3QEXA 3IAYA 1RT6A 2G8HA 1YRUA 4DR5J 3HYFA 1B64A 3VESA 1H73A 3MPUB 5D0HA 5K8NA 3M5RA 2NPFA 4IEEA 3M2RA 3L3VA 1MWMA 3ZSZA 2X1GA 2HRYA 4FK4A 4BC3A 1IG8A 3KJNB 4KRFA 4AXIA 4ZLLA 2O8DA 2WC9A 3JTOA 3DGPB 1S48A 4IYQA 1Y11A 4M5DA 4B1UB 1QLNA 2KJVA 3KLEB 2CIMA 4C48A 1RAHB 4P75A 4RU2A 3OYMA 3OFEA 2DPNA 2YQ1A 2E8AA 1E6VB 2YCHA 1FESA 2Z57B 3HVWA 1RI7A 4KHSA 2PSZA 3NE6A 4ZHRB 2ZDPA 3CQ8A 3H42A 4RNMA 1DEJA 1YRTA 2PIIA 3NY0A 3W0LA 3U3GA 4H0PA 4RR5A 3HFZB 4OHZA 1OPZA 1TGOA 4DR3F 3LANA 1V3ZA 1XIQA 4CBXA 4YB6A 3FZBA 3NL0A 1Y97A 2IVYA 1S77D 1NU0A 3EVWA 1M5HA 2PEHA 4DU4A 4ED1A 3OY9A 4L76A 5BRDA 3TEGA 1L5UA 2A42A 3C6AA 3WX4A 3M2UB 3CCES 4ZN1A 3BDPA 4LFCF 5K8PA 3IFRA 1NXIA 4M5LA 1FJEB 4I9QA 5CCLA 3NBPB 4CZIA 1WDTA 3L4QA 3BB5A 2O8FA 1FXXA 4CEDA 1YSJA 4ZPAA 5KFMA 5F8MA 1CLFA 4Q0BA 2DITA 2CAJA 1WORA 5FD1A 1ZYQA 1VISA 3ITHA 1UTAA 4FWSA 2APOA 1WB9A 3K17A 3SI8A 5FDLB 3UKUB 5GMDA 2DXDA 4BHQA 1VQ4S 1GTHA 4DSJA 2YX6A 3T5HA 4PYDA 2ATCB 3AA5X 5A76A 4AH9A 4CO3A 5CXTA 1FVSA 3D6FB 3A1YG 3EPIA 3M8PA 1UEVA 2Z4PA 1KONA 5D3GA 3BYRA 5BR8K 3HT3A 4P74A 4IRKA 4A5BA 7FDRA 2GV1A 3CC2S 1LFPA 5IV3A 1QSYA 2B7BB 3VQQA 3PYGA 3HKWA 5IWAF 1ROFA 3AJ1A 2VPYB 4IO1A 1EX4A 4YB1P 4W5QA 4AL7A 1TR0A 1XMQK 1KVKA 3PFOA 3MXHP 3A5NC 1OIAA 1B70B 2J7WA 4URQU 3RTVA 2DH8A 4OYBA 3FCHA 4B3OB 4NLGA 3ZSOA 2WW8A 3O4QA 1S72N 3U9DA 3GIKA 2OH2A 1B0VA 2NZTA 4DR6K 2OGUA 3OXFA 2ATQA 3VERA 2RUSA 3DLJA 1VQ5S 1C4AA 3KK3B 1Z25A 2ZJRL 5C0YA 2RUGA 2KL8A 4QBUA 1RSCA 3U1LA 1GOAA 4M63A 2BQRA 1OY6A 2O8CB 3O08A 4E7JA 2NZCA 4CEZA 4IZ9A 1EWQA 1HKGA 2ZHBA 3CCEN 3DLGB 1RTJB 4MKYA 3VA0A 2HG4A 4YB7A 6AT1B 4AYBD 2O8DB 4DUZK 1K73T 3P8BB 5KG7A 5ETRA 4M5DB 2XMJA 2Z2YB 3QGHA 4M5HA 3GR1A 4DV6K 3CT9A 3PRVA 1IWAA 4UOCA 3D2FA 2GQCA 2Y0BB 3VEWA 4JKAA 1VQ4N 1KSPA 3TJAA 2LECA 1FCAA 3IM9A 5KT2A 1BXNA 1V4SA 4ZMMA 4WK1A 4JV2A 2V94A 4GVBA 2V8DA 1JJCB 4CLPA 3AGRA 1C0UB 4YOUA 2QKKA 3CC2N 3U6FA 3V9XA 5DZ6A 3UQSA 4GC7A 4ED2A 3GWCA 4ECUA 3P83D 3VVUA 4Z0UA 2F40A 2GZOA 3QFHA 1OH5A 2Y3YA 4DZ6A 2HMIB 3MR2A 3QBCA 1S49A 3CXCR 4OX6A 4FWMA 1HR0K 2AJ0A 3RJMB 2C2NA 4BR0A 3IMQJ 1FKAF 1Q5VA 3D1QA 2FZKB 4EZ9A 3C14B 3VGKA 5HL7Q 4USUA 5LMNF 3B6BA 2I6WA 2BE7D 4DTNA 1FO1A 4DF4A 2CFXA 1SKRA 4FM2A 4D3HA 4ZVTB 5A8KB 3O6QA 1J5OA 1VQ5N 2CG4A 4B3SF 4HKQA 3GSDA 2RQCA 4FNHA 1KD1O 4YMEA 4AILC 2QA2A 3OHAA 4O0JA 5M1OA 5ETQA 1NAQA 1ZM9A 4F4YA 3AOBA 3D3BJ 2WONA 3SFGA 1BU6O 3BEGB 3LPEA 4EO6A 5L1IA 2ZBCA 1VC0A 5D3GB 2MKJA 4BR4A 2G2OA 2W4CA 3ZFVA 2J6UA 4DMNA 2X3DA 3G8QA 2UXCJ 2L08A 3ZC4A 1Q8KA 3TX0A 2BE2B 4OJ1A 2HQDA 1IBCB 3TAGA 3EJMA 4LF7J 4AHUA 2W7PA 1RAJA 2XMUA 3LOUA 3CVKA 4WKYA 2UXDJ 5ETVA 4KIAA 3SQ0A 2FC0A 4BROA 3F41A 4I6YA 4Z4GA 3S3NA 4NZ0A 3R6LB 1V3RA 3HPOA 4FF3A 5AQJA 3HSCA 4CHPA 4RZRA 1RKJA 4E1JA 2IM3A 1D9AA 3CCWA 3CCTA 4FYVB 8RUCA 2EFGA 1T9UA 1R89A 3IC1A 4ZCLA 4IH5A 2I38A 2GIQA 2X6NA 4DX5A 1D9FA 3M8RA 4G1IA 4WXWA 3SIPB 4PKHA 2D69A 1Y64A 3MEEA 4PABA 3CFPA 5GAEP 2BJDA 3RMAA 4JI1F 4JYAJ 2J9DE 3KIOA 4RL1A 4OZ5A 3MM6B 1S10A 3DC2A 1I5OB 1FWLA 3M6WA 2VCPA 2NXUA 3ZNJ1 5KQ8A 2IS3A 3PRBA 2YVSA 2DHGA 4BACA 2F5GA 5KG4A 1HW9A 4JI8F 2YHAA 3IM8A 2HW3A 4OYMA 1T9VA 1FW6A 3D2FB 4C3MA 5GMEA 4DUTA 3DFEA 1UWBA 1NNDA 5K8OA 4J37A 4PG7A 2E1PA 2GMLA 1RILA 1DQAA 4FJ5A 5KOWA 2FLLA 4GVBB 2MGZA 4USTA 3OYLA 5CHCB 2FTRA 2DNGA 4S0MA 5JUMA 5AQNA 4A61A 3CCJN 1RWPB 2IA0A 2EVZA 4Y2MA 5AQGA 2OMLA 3GFZA 1ASWA 1NDKA 1G6BA 3HF5A 5AJ3K 3SMPA 3TR8A 1U48A 1S6OA 3HFVA 2GUPA 1J2VA 4K4TA 4A57A 4CFBA 2AA4A 4N5SA 4JI4K 5C15A 2PE8A 3WUHA 1J5EF 3B4MA 1Q4RA 4KJIA 3DLEB 1J5OB 5AXNA 2KI2A 2K7JA 2OUGA 2ASDA 4ES2A 1TKTA 2QLWA 1YKWA 1GEHA 1VC6A 4NYPA 3O4NA 3S41A 4RNFA 3BZQA 3CO0P 4BR2A 4OZ2A 1ZETA 4CZMA 2P9EA 3O2IA 3OR1A 3RMDA 2PI4A 3ZSRA 3BN4A 4QWCA 2BBEA 3BPSP 3GB0A 4O5BA 4KGVB 3O44A 2MLXA 2JFKA 2C2MB 2FBTA 2OSRA 2HIQA 1RTZA 1XR5A 1IO2A 2P5OA 4FVUA 5CY4A 2NYIA 1S5JA 3KMQA 2FDNA 3PHTA 2I2YA 2GMHA 1VLYA 4OHVA 2QLXA 3ID6A 3BH6B 2E1RA 2GVDB 4O3PA 5AT1B 5KFHA 3F73A 1WDDA 4DR3J 3NOCA 4CF8A 3SYZA 1S7HA 2W8LA 3GTYX 2ITMA 1HBMB 2C3PA 1R8CA 1H3DA 4LF5K 1PC5A 4NMLA 3D67A 4O0IA 1TV6A 1TFYA 4B17A 4JK9A 2KZMA 4OI4A 4LFAF 1F3VA 2VBYA 2KG1A 3BS9A 3H1VX 4WFYA 3MEEB 3CF5Q 1NCLA 2L48A 5FLXU 1YIJS 1H7XA 2B3TB 4KH1B 2BJ8A 4HCCA 2YWWA 4DTRA 4LF4J 3NLCA 2YBVA 2L3MA 2XMAA 1E6YB 1CZAN 5EX5A 2MLZA 2A3JA 4WFAQ 3DHXA 5MLCV 5L1JA 4RWWA 1MMNA 3KLGA 2L9NA 4JLHA 1IUJA 4A8OA 2MZTA 4YHHF 4FL9A 3PR4A 1C4CA 3NXZA 3ZSVA 2B4UA 3AY0A 3MM7A 1QZ5A 3CJ2A 2AJ1A 1UWBB 3KK7A 4NXNK 2DY9A 1XK8A 3N28A 5H9FJ 3THWA 2EBEA 1YHQS 3ZZUA 3CCSS 5SUHA 5HLFA 2MGZB 2W4DA 5IWAJ 3KNGA 4OPJA 3M05A 4KKOB 1A7GE 4X4QA 3CCUS 3AJ2A 1S0MA 1JXEA 4Z2XA 2LYVA 2VQFF 2UUAF 3MCMA 1CVJA 2MMYA 1G3OA 3PX0A 1Q8BA 3CE8A 2P8IA 3TABA 5LJVA 3VCDA 3MCOA 1PAUB 5ETPA 4I6MA 4AHCA 5HMYA 2IM2A 4EHUA 1F9HA 2DB1A 4NB4A 3RW6A 4NE9C 4CLZA 2R8IA 3SUQA 3VAHA 1NBWA 5HROA 1R8HA 2W1BA 1YI2S 5KFUA 1VYAA 1N33K 2IC3A 1UW4A 2Q31A 2FJDB 1U2VA 4WQ4A 4FYDA 5FPDA 1RAOA 4FS1A 4H5WA 1RAIB 1VMBA 1WSJA 1U2FA 4EP4A 1LXJA 2HS3A 3LQVA 3Q0AA 4AQYK 1YIJN 4ZPDA 2WOMB 1P9QC 1KQSM 2DT9A 2XWXA 4CF0A 4KYZA 2F63A 1JCFA 1Z1ZA 2G0IA 2BOPA 4JBCA