3KLFA

Crystal structure of wild-type hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
total genus 139
structure length 553
sequence length 553
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klfA05
3VQPA 1EXQA 3V9XA 3G86A 1QS4A 4FVMA 2B43A 4B9VA 4OKJA 4IR1A 1U09A 1S6PA 4EO8A 2E9ZA 4LY7A 4KRFA 1S1TB 5HLFB 3H4BA 4ED8A 3TANA 2D0AA 3OYBA 4NYFA 1RBSA 2OPPB 4CJKA 2RF2A 1L3TA 1L3VA 4YR2A 1SH2A 3HT3A 3VQ6A 1QE1A 4MQ3A 4ZPBA 4TY9A 4NCGB 2W7OA 3DRSB 3LALA 2V4RA 3IAYA 3QZ7A 1RT7B 3Q8RB 2HHXA 4ECZA 3V9WA 2HB5A 1HRHA 3IGVA 1FK9A 4NLYA 1W0HA 3CYMA 4DMNA 4XPEA 4W5TA 4BDZA 3NGDA 4K4ZA 4LSLA 3VQCA 4BE2A 3OVNA 3V9ZA 5KI6A 3GV8B 1HPZB 3ITHB 2E9TA 3DLKA 1LWCB 4RW4A 3KJVA 1N6QB 4CIGA 2R8GA 3ZSYA 3NAEA 4OGCA 3G6YA 3OL8A 4DF8A 4H4OA 2W9BA 2OPRB 1J53A 3RR8A 4ECSA 2HHVA 4DSEA 2RPIA 4ZPCA 2G8WA 4TY8B 2W8LA 3QESA 4EZ9A 2R8IA 2ITGA 3KMSA 3GIIA 4PWDB 5C25B 5CZ1A 3VQDA 3DMJB 4IG0B 3QZ8A 4AILC 4GVMA 1B9FA 5CZ2A 5T7BA 4DL3A 3AVHA 4DQIA 1JIHA 2KW4A 4EO6A 1N5YB 3I0SA 1SH0A 5KTQA 1S0MA 4DU4A 2VWJA 5DG8A 3PZPA 3FSIA 2W42A 4OKEA 4HUEA 2YNGA 5JUMA 3IS9B 2G8HA 1CLQA 1BIUA 3ASMA 1IKXB 5F8GA 1T3NA 1WAFA 3KKRA 1EP4B 4LQ9A 5KFRA 2FVSA 4JRQA 3H08A 2GIQA 5HROA 3H5UA 3V1RA 1YTUA 2RDJA 4KBIA 1NJXA 3DI6A 4Y2AA 5KFXA 5F8NA 3ZT1A 3HPHA 3CFOA 4HVJA 1IKVA 1N5YA 1XI1A 2IM1A 4FJNA 2W9AA 1J5OA 2V4QA 1TV6A 5D3GA 3TWHA 4EZ6A 2JLEA 4NLDA 4PWDA 2FVCA 1NOZA 3SUNA 2BGGA 3CVKA 4TLRA 4DQQA 4E7JA 5DQHA 4TYBA 1A5VA 4B3OB 2HNDA 2HNDB 2X78A 4FW1A 3CQ8A 1BQNB 4F50A 4FS1A 1D9DA 5KFUA 1W9HA 4KTZA 2D0BA 4J2AA 1WN7A 5KG3A 4J9SA 4O44A 4FZYA 1TV6B 1LWCA 4U6PA 5F8IA 5KT7A 4MK9A 5F9LA 3LP1B 3T3FA 3L2UA 1HYVA 4MK7A 3AO4A 4CCHA 4YR3A 4RG8A 4FCYA 3MR6A 2B6AA 3DOKA 4CJUA 4Q43A 2LSNA 3JSMB 2XY7A 4YQWA 2VG7B 4FJ9A 1TKXB 2YKMA 3EPGA 4PA1A 3AVKA 4KI6A 4NYNA 4FLVA 4HCBA 4ZP6A 4WXWA 3A2FA 2IM0A 5EWFA 1S0OA 5HBMB 2NUBA 3Q8QB 2XRIA 4Z4FA 4IFYB 3NMAA 4HUGA 4WXOA 2JC0A 3CM5A 3V4IB 3K58A 2OPPA 1NOYA 4QAGA 4FM1A 5JS2A 5E41A 3DRPB 2WK4A 3DLRA 3ZSWA 3E01B 2IC3A 2BANA 3PW5A 3DMJA 4IG0A 4IRCA 3QEWA 4O5BA 4EBCA 3AA5X 4HYKA 2WCXA 4XPCA 4J9MA 4IOBA 2XCAA 4KO0A 4TY8A 1NKCA 4LSNB 1D1UA 4ZTFA 1J9AA 4FLXA 4OJRA 4FZXC 3SPZA 2FBYA 4CFAA 3LDSA 5DLGA 3V6KA 3RBEA 1S97A 2YV0X 3B6OA 2E9RX 1CZBA 4N47A 1JLEA 3LANA 1T03B 2B4JA 2IDOA 4Z4GA 1IKWB 3KLIB 3NF6A 4DQSA 1WSJA 3H40A 4WZMA 2C22A 3ZSXA 3PJXA 4EP5A 2JEIA 1MU2A 1OS5A 4TQRA 1RCHA 1QSLA 4QW8A 2AX1A 1RT7A 4NRUA 4CFCA 4MH8A 3KK3B 3DOLB 3AV9A 1WNEA 1WSEA 4ECQA 4N56A 2ATLA 3GIMA 3NAHA 4K4TA 1QE1B 2FLLA 2V9WA 5JS1A 2B5JA 4Z4HA 1D0EA 1XR5A 1C0UA 3CO9A 1JXBA 2FLPA 3O4NA 2EC0A 3QEIA 3BJYA 4CEDA 3HXMA 4G3IA 1NKEA 1HARA 1S1WB 2OPQA 3V6HA 5KFAA 1GOCA 4AH9A 1FKPB 3NH1A 3HK2A 2DPIA 4E89A 5C5JA 3NL0A 3OYKA 4CEOA 1RT1A 4FK2A 3KKSA 2D5RA 4FLZA 4CERA 4KHUA 3EY1A 1TK5A 3NCIA 2XCPA 2VA2A 4K4SA 5DQGA 4OGEA 3RB4A 4GC7A 1TKTA 4DWIA 4DLGA 1U04A 4DSFA 4WFYA 2G8VA 2HVIA 4DSIA 4KHRA 3KD1E 4RNOA 2PZSA 3V81B 3BQ1A 4CHQA 4O4GA 4O4GB 3H59A 5J2MA 1DTTB 4E3SA 1FXXA 4CGFA 1HMVA 2FVRA 4IR9A 4NLOA 2Z1HA 1JL1A 4ID5B 2JEGA 2HHWA 5KFVA 3PY8A 4E1MA 1RTDA 4Q8EA 4KV8A 1SUQA 5KFCA 1JLFA 1JLCB 1HMVB 2WB4A 3GILA 1VSMA 5FROA 5DG9A 3SNNA 2JEJA 2ASJA 4O0JA 5KFMA 4CGJA 2IAJA 1JLBB 2FBVA 3BQ0A 1FKPA 3DM2B 4IDKA 2GV9A 4ECYA 3KHRA 4EBDA 4AHTA 2HNYB 1XR7A 3AVJA 3O3HA 3IRXA 2XHBA 3M9OB 4DSLA 3OSNA 1NK5A 1TGOA 4QWBA 3HYFA 4NLRA 1KHVA 2RKIA 2VG5A 3CM6A 1NK0A 4KTQA 1BCOA 1RT3A 1VSHA 4O3PA 3DOLA 4I9LA 1ZBHA 3KIOA 5J2QA 2Z1GA 3C94A 2YNIB 1MU2B 2RN2A 2WONB 3PW0A 4ID1A 4HHTA 1KFSA 3FFIB 1UA1A 5KFFA 2XGPA 3I0RA 3M8PA 1I3AA 1HYSB 3OYMA 1DTQB 1XHZA 4WZQA 2R8HA 2Y1IA 2FLNA 1GX5A 3HPOA 4MFBB 3CJ2A 3KMQA 2GBZA 1ZBFA 3NF8A 1RT2B 4K4UA 3N6NA 4C8OA 1QAJA 3QIPB 2IA6A 4LSNA 4M94A 4W5QA 5EWEA 4M3ZA 2W7PA 1L3SA 4ZP9A 2AGQA 3KLFB 1YT3A 4L8RB 2W9CB 4Y34A 1KTQA 1T03A 2J6TA 1VSLA 2IOCA 5J2PA 5I3UA 5KFKA 4TSXA 3BQ2A 4R0EA 3H98A 4M42A 5F9NA 2HMIA 3T5LA 2FBTA 4KAZA 4MIAA 4CK3A 4B9UA 1J54A 3TAPA 5HP1A 3PX6A 3OYNA 3D5MA 4ZVEA 3QO9A 4URSA 4RW8A 2KFNA 3G10A 3BREA 3SUQA 1RTIA 3T19A 3E01A 5L1JA 3MFHA 4IG3B 4BE1A 2EHGA 2C2DA 3PUFA 3PR5B 1NK7A 4CJRA 1BQMB 3KHHA 3N6MA 4QW9A 3GYNA 2D3ZA 1HQUB 1C2PA 1RNHA 2F96A 1RA6A 4F2SA 1IKYA 3AO2A 2F8SA 3VQQA 4NLQA 2XGQA 3PW7A 1QSSA 3AA2A 1LW2A 2B6AB 1RILA 2AU0A 4OVLA 4CHNA 4YFUA 4AHUA 2YNHB 4KREA 3HVAA 2HNZA 4KKOA 3K5LA 3UIQA 1JXEA 3FDSA 3KLHA 1S48A 4NYZA 3T5HA 3KOAA 1BCMA 4RW7A 2ZE2B 3VQBA 3OYIA 4ED2A 4IDKB 3QIDA 3CJ3A 2FJWA 1Q9XA 3DM2A 1RT6B 4NLVA 3OYAA 1BQNA 3GQCA 3DDKA 4AHVA 3TR8A 5HROB 4DTNA 1VSEA 4DTPA 2P1JA 4IH6A 1ZBLA 3AA3A 3L3UA 3O3GA 2WHOA 3ZSZA 2IJFA 3QGHA 1RBUA 2I1RA 2PY5A 4CF1A 1QTMA 1QUVA 3HVTB 5F8LA 2GIRA 1RTDB 4K50A 5KT5A 2VWKA 2P5GA 1IH7A 4TQSA 3I0SB 3SCXA 4CEBA 4DTSA 4CJLA 5CYQB 3KLGA 4GC6A 4KB1A 5F8HA 4J2BA 2BRLA 1TP7A 5C25A 3OLBA 2OH2A 4FJIA 1VK0A 1XC9A 4URGA 3ZSQA 1SL1A 4OKKA 1TL3A 1SH3A 3QNOA 4CFDA 4DQPA 4RW6B 1R0AB 2FVPA 4X2BA 4FLUA 4RW7B 2HWIA 4WYWA 5KG2A 1IG9A 3NGYA 1RYRA 2CJQA 1X9MA 4ZVGA 1C1AA 1Q9YA 4KKOB 4URQU 4FJMA 1RT5B 2VG6B 1Y97A 2YNHA 4B9NA 2E6MA 1YVFA 1NJZA 1K1SA 3LP0B 4Y1CA 1RT1B 3P1GA 4H4OB 1C6VA 4ZPAA 3MXIA 4FXDA 1NHUA 5L1LA 5DG7A 3TAQA 1S9GA 4RW4B 3KJVB 1N6QA 3VQSA 3PW2A 3LZIA 4F4WA 1RAJA 3SI8A 1KLMB 4C8LA 3TQ1A 4KHQA 5KFEA 5KG1A 4KTWA 4BDYA 3ULDA 3RMBA 3FQLA 4O3SA 1HNVB 2UUTA 3KK2A 3TVKA 4XO0A 2AQ4A 3VQ9A 4W5OA 2YHBA 3VQ5A 1S6PB 4O4RA 4CK2A 3QNNA 1SV5B 3KK3A 4I7FA 4CJPA 4MIBA 4ZP7A 4DL2A 4RW8B 4CJVA 2G8KA 4NCGA 3P5JA 2FBXA 5C42A 5HP1B 4JLHA 3MECA 3HHKA 1MMLA 4M45A 2R7YA 3MFIA 3LP2A 4FYDA 3DRRA 3EPIA 3KK1B 4Y1DA 1SKWA 2R2TA 1VRTA 2YKNA 5I3UB 4NZ0A 3HPGA 3QIOA 4DTOA 3UQSA 3KK1A 3U3GA 4ZP8A 3OYHA 2IGIA 2BE2A 4G1QB 2GUIA 3MECB 4O0IA 4B8CA 3QIPA 4ICLA 4ED7A 4DTXA 4CECA 3SQ1A 1SKSA 4J2DA 3ZSOA 1JLQA 3QGIA 5KFOA 4CHOA 2O4GA 4CJ4A 4MFBA 1C1CA 5KFNA 2BQRA 2BANB 4J9QA 5KFHA 3S9HA 1HYZA 1HNVA 3IGNA 4YR0A 4RZRA 3PVXA 3V4IA 3AVBA 4FJ7A 3RB0A 2WONA 3TAGA 3SJJA 3AVNA 5J2QB 4JUZA 2KTQA 4HUFA 1Z25A 4QCLA 3BDPA 3BGRA 1SV5A 1JLGB 4JV2A 4FK4A 1TL1A 4BDPA 2XC9A 5KT4A 1C0TA 2XO7A 2D3UA 4BWJA 2ALZA 3DOKB 1BGXT 2DY4A 4CIFA 3IRXB 3U3YA 2IJNA 2F8TA 4QPXA 4DFKA 2ZQBA 3D0PA 3L2RA 4M3RA 4NLXA 2HHUA 2HVHA 5KGXA 1T8EA 5SWMA 2OZSA 4Q8FA 3OS1A 4F8RA 3PX0A 3SUPA 3LP0A 3BSCA 2I5JB 1LW0A 4CGHA 2A1SA 4KE5A 1RT5A 2VG6A 1TK0A 4NLTA 4ZPDA 1RT4A 2JEFA 5FRNA 4Q0BA 4RNMA 2J6SA 1Z26A 2ASDA 4FLTA 1VSFA 3GV7B 5J2NB 3VQ7A 5J1EA 2PYLA 2ETJA 4F4XA 3LZJA 2OZMA 3RTVA 4NLGA 4M3WA 4ED6A 1TL3B 3TAMB 4JRPA 3HVTA 1LWFB 3PX4A 1REVA 3QETA 3DLGB 4YNQA 1XR6A 3NF9A 3N6LA 1B92A 4CHPA 1TQLA 2KFZA 1IKXA 3SQ2A 4FK0A 4QWEA 1C1BB 5CYQA 3IG1A 4HKQA 4U7CA 1N56A 3LPUA 4ED3A 3C6TA 4WFXA 1D8YA 2BQUA 4KSEB 4H54A 1S1VA 1RT6A 3MXJA 4FJHA 1JLAB 4KPYA 4CF9A 3AA4A 3KNAA 1TKDA 4W5NA 4JS5A 4LH5A 3NE6A 2DPJA 4DSKA 4CHZA 1KFDA 5DQIA 1UAXA 4CF0A 5HRNA 3L3VA 4E1NA 1TKZA 4Q5VA 1U48A 2UVVA 1S49A 1T05A 5KG0A 5HRRA 4ECVA 4ELTA 4DTRA 3DLEB 1JKHB 4FJKA 4FJ8A 4JV1A 1LW2B 2AWZA 4TYAA 5KFQA 3NH0A 2F8EX 4RU9A 1UWBA 2OPQB 5C24A 3KHLA 1G15A 2AGOA 4KB0A 1NK6A 2ZE2A 4ECWA 4NCAA 4R5PB 4DU1A 4RNNA 1RTJB 3CFPA 4R8UA 1HPZA 1S9FA 1FKOA 1NJYA 3ZT2A 4J9KA 2XY6A 4LSLB 3AVIA 4BACA 3S3NA 1RDAA 2P51A 3WNGA 3NFAA 1WSIA 1BQMA 4RUCA 4JS4A 4IH7A 1HQEA 1ASUA 4Z0UA 4CE9A 2R2SA 2AGPA 4LH4A 1ZTTA 1TVRA 3WNEA 3AO3A 3SI6A 1IKYB 3CFRA 4NCBA 3K2PA 1HQEB 4ZMMA 2EX3A 1HQUA 3UR0A 3OL6A 3H5XA 3OS2A 3FQKA 4FBTA 1Q8IA 4TN2A 3WNFA 2DFEA 4KI4A 1L3UA 4E7LA 4FJLA 3V9UA 1ZTWA 4C8KA 1WSFA 1JXLA 1UA0A 1SL0A 1RTIB 5L1KA 4OLAA 4CJWA 2IM2A 5KFJA 3I5AA 3THVA 2HHTA 2KQ2A 5EU7A 3H5SA 3AVCA 4I9QA 3KLVA 3OJSA 1WLJA 1ASVA 4WFZA 4B9SA 1EETB 2BQ3A 3HVWA 2HMIB 2IC3B 4Q44A 3LWLA 1RT2A 3CG7A 4FS2A 1BISA 4IQXA 5J2PB 1LV5A 1IO2A 4AHRA 4E7KA 3NGIA 4ZVFA 3RB3A 3MEDA 2QK9A 4M3YA 3I0RB 4CJEA 3TI0A 3C6TB 1S1XA 5L1IA 1C1BA 4DSJA 4N5SA 5HBMA 3HL8A 4PY5A 4PQUA 3M8QA 5KG7A 3HP9A 1NJWA 2YHAA 1TVRB 2JC1A 3T5KA 1TKXA 3NHGA 1REVB 2R8JA 4RNFA 3TAMA 2RKIB 2VG5B 3UPFA 4FLWA 1HYSA 1EKEA 5J1EB 3RB6A 1X9WA 4YP3A 3TABA 3FFIA 5F8JA 2O5DA 3M9MB 2QKBA 1KSPA 1RTHA 4DTUA 4OL8A 3RMAA 5C24B 2E6LA 2I5JA 4B3OA 1HJRA 1RBRA 4DF4A 1K6YA 4PUOA 4KFBB 1S9EA 4IRDA 3S3OA 3RMCA 5KFGA 1N48A 1Z4UA 1J5OB 5EWGA 3GIKA 1JLCA 4DQRA 3OY9A 4ZTJA 1ZBUA 3SPYA 1IKVB 3VQAA 3BSNA 1JLAA 4Y2CA 3OL9A 4M3TA 3LP3A 1ZYQA 3MTKA 4RNHA 1JLBA 4N76A 4ID5A 2RDIA 3SZ2A 3OJUA 3V6DA 4NLPA 3DLHA 1RYSA 3B6PA 4DG1A 4LD0A 2OA8A 4E7IA 3D45A 3K5MA 3G6VA 1JLGA 1VSJA 1RBTA 1K1QA 3ISND 4CEEA 3DLGA 4CESA 4DLEA 1GOAA 4DS5A 1SL2A 1JL2A 3NAIA 2ATQA 1CSJA 5HRPA 1DLOA 5EUHA 3MAQA 3SV4A 5J2NA 4GW6A 1TKTB 1D5AA 2ILZA 4QWCA 2JGUA 4J9OA 4F4KA 3ZT3A 3PR4A 2QKKA 2Y1JA 3ISNC 3M8SA 3K5OA 1X9SA 2FJXA 3KLEB 4W5RA 4B8AB 1L5UA 3RRGA 3F9KA 4HTUA 4CJFA 4K4XA 3MR2A 3OSPA 3CWJA 3MEEA 2ZD1A 3K57A 4ECTA 3GIJA 3U6FA 5SZTA 1KVBA 2HWHA 1S6QA 3ITHA 3QLHA 5F8MA 4CEZA 5KG4A 3OLAA 3L2VA 2YKNB 4Z4EA 1VRTB 4O3OA 5I42A 1C0UB 3HSTB 4CFBA 3C95A 3NGZA 3OYCA 3NKYA 3LP2B 2E4LA 4M41A 3QGGA 5KFSA 1VSIA 1A5XA 2Z1JA 2DFHA 4ZVHA 4EYHB 4J9RA 2G8IA 5C42B 1BI4B 4N41A 3AVFA 4DL5A 4DEZA 2ZKUA 1KVAA 1QHTA 3OYGA 4ELUA 4O55A 3P83D 3RMDA 3DLBA 3QEPA 4NRTA 3SQ0A 1B9DA 2RF2B 4CHYA 4CJSA 4K4WA 1VSKA 2D0CA 3G0ZA 3KLIA 5DGBA 3DYAB 2Z1IA 1TAQA 3H2LA 3PW4A 4DTJA 4QWAA 1C0MA 1KLMA 4Z4CA 3V1OA 2O4IA 1BIZA 4FZZA 3TAFA 4HCCA 4F3OA 1TAUA 4EEYA 4J9NA 3OYJA 1BI4A 1HNIA 5DK5A 2OPSA 4UQGA 3KLEA 4MKAA 2BE2B 1IKWA 2UVRA 4ZHRB 3Q8SB 3RR7A 1ASWA 4BE0A 4DFJA 3NBPA 1JX4A 1S6QB 2R8KA 3DRRB 2XY8A 2FC0A 2HAIA 4O3RA 2ZD1B 5KFIA 1WSHA 1R0AA 3LWMA 3QEVA 3KD5E 1W25A 1N4LA 4ECXA 4DS4A 4QOZB 4MKBA 2D7SA 4IFYA 3NH2A 2J6UA 3MEGA 4IBNA 2HHQA 4I2PA 4CGGA 4I7FB 4TXSA 3OYLA 3ZSRA 4B9MA 2ASLA 3CDWA 2C28A 3MF5A 1XHXA 3V6DB 3DRPA 3KK2B 3JSMA 3IN5A 4KHNA 1RDDA 4CJ3A 4XIUA 1NK4A 5KG6A 3VQ8A 3NF7A 3V6JA 4DFMA 4B08A 1S1UB 2A1RA 3LAKA 3OHBA 2D41A 5KT2A 2YNFA 4O44B 2XI2A 1S9GB 2DTUA 3L2WA 4KFBA 4PUOB 4DG1B 2YKMB 2BRKA 2VG7A 4I2QB 5KFWA 2P5OA 5KRSA 1CXQA 2CKWA 4FJ5A 4FLYA 3LP1A 4Q45A 1KRPA 2WOMA 3LAMA 5K14A 2X6NA 3T1AA 4RW9A 4CK1A 1I39A 4FM2A 2ILYA 4IKAA 5CY4A 4B9LA 1UOCA 4RW6A 4KHWA 4F4ZA 4K8ZA 3DI6B 2AX0A 2DFFA 2PYJA 1ZETA 4J2EA 5T14A 4QWDA 3RAQA 1CXUA 4C8MA 4FJGA 1RA7A 4ED0A 1NHVA 4EBEA 1EP4A 3ALYA 5D3GB 3KLGB 3SFGA 3IS9A 1GX6A 1BL3A 4ECRA 3PV8A 4H4MA 1S1UA 2HW3A 2KZZA 5KFDA 4FBUA 1ITGA 1LAVA 4DTMA 3HP6A 5DGAA 4E7HA 5CYMA 4CF2A 3OS0A 4IG3A 4C8NA 4WYLA 1RDBA 1KLNA 3G6XA 3BSAA 3AVLA 3AVMA 1YVUA 1QSYA 3CJ4A 3BR9A 4I2PB 4AHSA 4PQUB 5JXSA 3SUOA 2VA3A 2YNGB 1S1XB 2WRMA 2R2UA 3MEDB 2IBKA 2HHSA 3QEXA 2OPRA 4J9LA 2UVWA 1KHWA 5KGWA 4EP4A 3V9SA 4H8KA 2Q3SA 3KLHB 1F21A 3DLKB 4E0DA 3GV5B 5KFLA 4GMJB 2KZMA 2R2RA 3HKWA 3AVAA 3D28A 4K8XA 3ZT4A 4LQ3A 2HNZB 4ZHRA 2QE5A 4IFVA 3MXMA 3KLFA 4Z4IA 2IMWP 2OPSB 5KFYA 1FK9B 4DFPA 1RBVA 4CGDA 1NK9A 2W9BB 2AJQA 5KFBA 4DL7A 4OPJA 5DMRA 4FW2A 4IKFA 1S4FA 5L9XA 1NK8A 2XWYA 3WNHA 4CEQA 3PO4A 5KT3A 1DTQA 1D9FA 3PO5A 3S3MA 3DYAA 4DU3A 4K4YA 5KFZA 4ED1A 4B9TA 3RBDA 1RTJA 3CJ5A 3V1QA 1S1TA 5HLFA 4R5PA 1RDRA 1YTAA 2YNIA 4IH5A 2FJVA 4OPKA 3CDEA 3VA0A 1KCFA 1UWBB 3OL7A 3QINA 2IS3A 3SFUA 3AO1A 3DRSA 3QO9B 4KAIA 3K59A 4F2RA 1JKHA 3M9NB 1WSGA 4IFVB 3OYDA 3MR5A 3OHAA 1T05B 1TKZB 4CGIA 3AVGA 3OYFA 5EDWA 1VSDA 1FKOB 3H5YA 4M3UA 5I42B 5KT6A 3I5BA 4R8UB 3RWUA 4KHMA 5FRMA 1RDCA 2HNYA 1ZBIA 1I6JA 3QLHB 3KTQA 2W9CA 3ZT0A 4E19A 1U4BA 3MEEB 1KVCA 4WE1B 3EZ5A 3FRZA 3TAEA 3IG1B 2W8KA 3SQ4A 3DLEA 3I8DA 3L8BA 2XY5A 3VQ4A 3O3FA 1U49A 3EYZA 3E51A 4O3QA 2OYQA 4F4YA 4CJ5A 5KFTA 5CYMB 1S10A 1SUQB 1X1PA 1GOBA 3PHEA 1S1VB 3L2QA 3HO1A 3M8PB 4O3NA 3HM9A 4KHSA 2UUWA 3BSOA 3VQEA 4CJQA 4H4MB 3EZUA 1DLOB 2G8FA 4M3XA 3C6UA 1U47A 3O4QA 4KB7A 3K5NA 5DLFA 4M95A 1S5JA 1LW0B 4NLSA 5FDLA 2QV6A 1LWEB 1NKBA 3M8RA 1LWFA 3SV3A 2V0NA 1RT3B 3Q8PB 5KG5A 1TK8A 2IM3A 2X6SA 1NNDA 5HRSA 2C2RA 3ICLA 2FVQA 3I5CA 4F3TA 4CEFA 1O1WA 4RW9B 5K14B 4DL6A 4Q0BB 2WOMB 1VRUA 3JYTB 1RT4B 1T7PA 1T94A 3PJWA 4I2QA 3RAXA 4MK8A 2BR0A 1S9EB 2IAJB 4CJTA 1C0TB 1EX4A 4EYIB 4RUAA 1A5WA 3BGRB 5FDLB 2YNFB 3KHGA 3TARA 3ZSVA 1S1WA 3HJFA 1LAWA 1JLFB 4NLUA 1RTHB 1VRUB 3JYTA 4KV8B 3NDKA 3LPTA 3F73A 4BWMA 1S0NA 4Y3CA 3SYZA 2GC8A 4FJJA 1QAIA 3VA3A 2B5JB 1SKRA 3UDLA 4DL4A 1WNSA 4YMEA 4OLBA 2X74A 2XI3A 5KFPA 1TL1B 1WAJA 1CZ9A 4NLWA 3CDUA 1IM4A 3RRHA 1LWEA 3CIZA 1DTTA 3OYEA 5J2MB 4AHCA 2WTFA 4ELVA 3HVRA 3AO5A 1XWLA 4FJXA 3V81A 3MEGB 2C2EA 3M8QB 4KHYA 3C6UB 1QQCA 1U45A 4G1QA 4CEAA 3QYYA 4WE1A 3T5JA 3VN5A 5KRTA 4FM0A 4K4VA 2QXFA 3NBPB 4ECUA 1JLEB 3H4DA 1C1CB 4J9PA 4CIEA 4CF8A 2UVUA 1BHLA 3ZCMA 3CJ0A 1JLQB 4JV0A 4IRKA 4ICLB 1EETA 3QERA 2G8UA 3MR3A 4KO0B 2BDPA 1HNIB
chains in the Genus database with same CATH superfamily
2BJ7A 4FWSA 1EXQA 3V9XA 2P2CB 2UUCF 4FVMA 4B9VA 4PXEA 4OKJA 1VLOA 2DNPA 2HQGA 1HNXK 4BR9A 4EO8A 2E9ZA 1VQPS 3GU0A 4KRFA 3DNCA 4I6WA 4TU9A 3H4BA 1QHAA 2HGNA 3H7HB 4NYFA 4AD6A 3O80A 2RF2A 1L3TA 5A8RA 3HT3A 3V5RA 4Y0FA 2LEAA 2O8DA 3W3SA 5ELZA 4ATNA 3IAYA 4ILRA 3N0VA 4CD1A 1BWEA 2OELA 3FCWA 2ROEA 2QLWA 3UFCX 2V4JB 4W5TA 4BDZA 5AQNA 4GKJF 3SLCA 3VQCA 4BE2A 2VPXB 3NWRA 3V9ZA 3MN6A 2E2OA 4K0KF 4FSVA 1IBCB 3BEGB 2E9TA 3AH6A 5C10A 3DXSX 3W64A 3ETOA 3E66A 3G6YA 1FERA 4H4OA 4QIWD 4F9OA 2W9BA 3MWPA 1BUXA 2HG4A 2HHVA 3AOCA 3RJMB 5IT0A 4DV4F 4ZPCA 3RBXA 1UW4A 2XYPB 1Y64A 2RSQA 3EVMA 4EZ9A 2CQCA 1YJVA 2R8IA 4DPWA 2MKCA 3KMSA 3EMTA 4A5AA 1X4CA 4USWA 1OSDA 3DMJB 4GVLA 4YDUA 2CJXB 3S01A 1WDTA 2QYGA 1Q86T 1JIHA 3MMAB 4EO6A 2NR0A 1S0MA 4FWMA 1UVNA 3ZETB 2W42A 2YNGA 5JUMA 3IS9B 4CZMA 3ASMA 4DR1K 5F8GA 4ED4A 2B56A 4ZOSA 4OYXA 2YX1A 3RW6A 4JYAK 3MMBB 1Y11A 4JI6J 2XZDB 1YTUA 3G96A 4EI2A 2F7TA 2DD8S 4Y2AA 5GAHP 4LUBA 2CNKB 2HGMA 1XI1A 3WXMB 1FRXA 4RBTA 5D8HB 1TV6A 4LFBJ 4CI0B 5AQXA 3ZO7A 3JS9A 2M70A 1HUXA 2X51A 1M5VC 4E7JA 2MKJA 5I9EB 4FW1A 2FYXA 1DZ5A 3CQ8A 1OYEA 4F50A 3W2WA 1W9HA 2J4RA 4S0MA 2D0BA 3T1YK 3VAIA 4O44A 4U6PA 5F8IA 4PKGA 4M63C 2D9OA 4MK7A 2CPJA 4YR3A 1QM9A 3R9PA 1OY8A 4CQ1A 2LSNA 3U7JA 2V68A 4M5GA 3BO3A 1FNXH 5JVGL 2K1RB 4PQAA 4JNEA 3AVKA 2OTLN 1IJJA 5DZ7A 1XMBA 3RSEA 3LGNA 2YKOA 3GJQB 2Q79A 3CTRA 2FHJD 1S99A 2M7SA 5BPNA 3V4IB 3K58A 3CIPA 2BJ8A 1TFYA 2VZ9A 4XH5A 2IC3A 4EGLA 4P75A 4EBCA 3C0BA 2LKZA 3B54A 1BE4A 1VS3A 5DDQC 5LXRA 1X5PA 1FFWB 4HHUA 3LTOA 2E1CA 1IVZA 4YOUA 1YX2A 4LFAF 3CB4A 3TQEA 1QD1A 4JHDB 1V3RA 3SPZA 2C2KB 1WHYA 3RBEA 4N47A 2E1PA 1K0VA 1WTBA 2PN6A 2D1KA 2KM8B 1NGDA 1ZC6A 1IKWB 4X66K 4BRFA 2XQCA 1GT8A 3H40A 4WZMA 4CNZA 2C22A 4ZA1A 2G4BA 2VH7A 1GH8A 2OJ3A 1QSLA 3LPEA 4QW8A 3MXHP 3Q0AA 4MH8A 3KK3B 4U7UK 3LH2S 1N32K 4CW7B 3Q7CA 2EK6A 6FD1A 4N56A 5AQLA 3GIMA 1YWXA 4K4TA 1QE1B 3IWLA 2HS3A 5JLHA 4UF4A 2BM0A 4W98A 3O4NA 2ZOFA 2BKPA 2D69A 3BJYA 3P6YC 2GUPA 4CEDA 4QR0A 1NKEA 2UXBJ 3V6HA 3MGJA 3SMSA 1HR0J 4OI3A 4ES2A 1PYTA 1OH8A 4FWOA 4PYAA 5C5JA 5GADI 4Y65A 2L41A 3KKSA 5F3ZA 3DDIA 4FLZA 1CJVA 3VALA 2BJEA 2V51B 2N4CA 3G8SA 1T6CA 5E7OB 4F26A 3NCIA 1G4CA 3OFHA 5DQGA 3CD6S 1HNWF 2HVZA 2MZJA 4L3KA 5AXMA 4DWIA 1NPRA 1JMTA 4C8ZA 4L3QA 4JD2B 3D68A 1S22A 4KHRA 5I3PA 3KD1E 3DGVA 1IJEB 2PZSA 4KH0B 4CHQA 3NOGA 5AXLA 1AT1B 3FJ2A 1HMVA 4CGFA 1U1MA 4IR9A 3JQJA 1VCTA 2GJIA 4ZVUB 4QS8A 4BG8A 3CCLN 5KPTA 2MDAA 3G87A 2P9NA 1EJ7L 4ID5B 3FRYA 1VIXA 2JEGA 1Y3JA 1VYAA 3R27A 3R5BA 4MTPA 4N8NA 3QWUA 3PY8A 3VCDA 3W2VB 3W8GA 1G1XA 5L8RC 4JAXA 2GX8A 2MY8A 4IO1A 4M5IA 1ACMB 3MPUB 4X64F 1X4EA 2JEJA 2WFBA 2XMTA 2ASJA 4PYDA 2KG1A 2IAJA 2FBVA 1FKPA 1SCJB 2UP1A 4RWWA 2C42A 4ECYA 1QDUB 3KHRA 4JKGB 1XR7A 4QIEA 1K8KB 2VQEJ 2NXEA 2H65B 3FCHA 5LSLA 4IOCL 1NK5A 1VQ4N 3ZZUA 5EVZA 3W7BA 4KTQA 5IXUA 1RT3A 3JXOA 1VSHA 5B0AA 4NE9C 3ULEA 2MQPA 2IYGA 2AJ2A 3SQGA 2HSTA 4HHTA 3FFIB 3JTPA 1X9JA 2XGPA 3I0RA 3GJRB 4BR5A 3CC2N 1NG9A 4WBFA 2R8HA 4E2FB 3OFGA 4M5NA 2RS8A 3T6JA 3CJ2A 5AQRA 1YLXA 3BBBA 4XK8C 5AE3A 3CNQP 1QAJA 4AQYF 2IA6A 5AQIA 4O23A 2R7SA 3POTB 2EKYA 2ZITA 1L3SA 5ETRA 4PWWA 3QT6A 4L8RB 3HSJA 3DAWA 3TUPA 2KHCA 2CADA 2IOCA 3AQPA 2W4CA 5CHIA 3H98A 4M42A 1JNRB 3VEWA 3T5LA 2ZVSA 2GMJA 2PAVA 1WHVA 2BVZA 1J54A 5A2QO 1HL6A 5HP1A 2J7KA 4MKYA 2RHQB 3W5ZA 1HBUA 2O1PA 2ZH9A 1KDNA 1SC4B 3SUQA 3VMFB 2CJYB 2XBPA 2DJWA 3T19A 2V7YA 3MM8A 5AXKA 3ZX0A 2RH3A 1ZZFA 4IG3B 2DR8A 4A8FA 1OH6A 4CJRA 2ACMA 3QT5A 2HLTA 3KHHA 2VQFF 2CZ9A 4O5FA 2D3ZA 3VAKA 1HQUB 3HD2A 1RNHA 2F96A 2PD1A 3GE9A 3ZTQA 4KH6A 4LF6K 3QNWB 2DH9A 1QSSA 1HNZF 2DNRA 3BV8A 3BZQA 1LW2A 4H5VA 2UUCJ 4LRCA 4ZPTR 1NB7A 1VBXA 3UE5A 3FDSA 4OZ1A 1UVMA 5LY3A 1HWUA 3THWA 1RT6B 3OYAA 1NJIO 2GQ2A 2GAHC 3CXCM 3HI9A 4MT1A 3PIPL 3GFHA 2FTRA 4QJVA 1ZBLA 4AL6A 3L3UA 2WHOA 2RQCA 3OQ2A 1WBBA 4JI8K 3HVTB 5F8LA 3KKFA 3DXBA 3CJ7A 4CD3A 2VWKA 1IH7A 4WKRA 1N33J 4DTSA 2VQFK 3R2CJ 3KLGA 3VF6A 4KB1A 2HBRB 4DV7J 5C25A 5B0EA 3TRGA 4FJIA 5KPZA 3MPDA 2VQEK 1Q7YT 2X3DA 1NGFA 3U9DA 1FDDA 3QBWA 4F25A 1SH3A 2VB6A 2HAFA 1WUAA 3QNOA 1Y9OA 3LO3A 1HWIA 4Y28C 4LVOP 2J8SA 2FVPA 1HI8A 4X2BA 4FLUA 4RW7B 4WYWA 3C6AA 2H1YA 2HFSA 2CJQA 3I8BA 4ZVGA 4KKOB 3JSYA 2VGNA 2I0XA 2VG6B 1S77D 1YJNN 4B9NA 4KRWA 2E6MA 1YVFA 1NJZA 2O8BB 2CZVC 1XJWB 4FZVA 4PZVA 2DY9A 1OPIA 4LF7J 3TAQA 4OYOA 1LXJA 2Q66A 3AT1B 1FTCA 2WW4A 3FGVA 5KG1A 1BA0A 3RMBA 2CQ1A 4O3SA 2UUTA 3KK2A 4L3NA 2OMLA 5D4NA 3HD1A 3GLJA 3PKMA 4IYQA 1P1TA 2HHPA 1SJ3P 2GVZA 3ZZYA 5BR8K 4O4RA 4CK2A 3KDOA 1SV5B 4TLQA 4I7FA 2G8KA 1Q8KA 3I4HX 2UXDJ 3P5JA 1PAEX 3THPA 5C42A 5HP1B 3MECA 1G3OA 3N28A 1FRKA 2E5LJ 3J7AP 4E1JA 3EPIA 3D2FB 2H3EB 4U96A 3VGSA 4DTOA 1VQ5S 1PJ5A 3A3OB 1DEJA 2G1HA 4Y0WA 2E5LF 4G1QB 1PG5B 3EX7B 3MECB 2GS8A 3SK3A 3QIPA 4ICLA 5IC4B 4ED7A 4DTXA 4M7YA 3J8AA 2Q1NA 3C14B 1JLQA 5ETTA 2J9CA 2QW9A 4LF4F 4WCEQ 4MFBA 2QL7B 4J8FA 2M2BA 5KFNA 3BO2A 2QSFA 3OVBA 3CJBA 1PIEA 3OR2A 1HYZA 1HNVA 2OO4A 2V2VA 3EVWA 4YR0A 4CYUB 3UN3A 3G6ES 1UKUA 2YI1A 3PVXA 3TSPA 3V4IA 3GR0A 4TKTA 4B3MJ 4NXNF 2FLOA 3JAMU 5G4DA 2DNQA 2FY8A 5J2QB 4LF9F 4JUZA 3CCJS 1GEHA 4BCAA 3IUCA 3HTVA 1ZH5A 2ZEJA 5A76A 2XLKA 2J8AA 2GVZB 2HS4A 2H5EA 2VODA 3GONA 4BRPA 3CIMA 2D3UA 1XC3A 2RE2A 4M5MA 2DY4A 3MPVA 4CIFA 4NEYA 2XB2D 2F8TA 3PTWA 4DFKA 1JJCB 4JI0F 3WQPA 4M3RA 3D54A 4NLXA 4WQ4A 3NGKA 3CDAA 2HS0A 3QMQA 2H4YB 4H0XB 4ZLJA 4F8RA 3GP9A 2OTLS 3SUPA 4UQTA 4RUHA 4CO1A 1BO5O 1N5QA 1NHKL 3ENAA 2A1SA 3DWLA 2VG6A 3H45C 3HM8A 1T11A 4G65A 4FWQA 4RU2A 4FLTA 4LFCK 2K3KA 3VQ7A 1KEKA 2ZOMA 2P9NB 1R8AA 1UZDA 4NLGA 4ED6A 3HVTA 1ZZNA 3JS6A 4C97A 1FNMA 2MJUA 2HFUA 2YWFA 3NF9A 3N6LA 1B92A 2NYIA 3VESA 4Q2MA 3UVJB 3SCJE 5AZIB 2AHOB 3LPUA 4G1PA 1F1BB 4KSEB 3NGUA 4H54A 1RT6A 4XTTA 3MXJA 3CC7S 1TKDA 3CMAS 1ESVA 1HKAA 3NG8A 2PI5A 4CHZA 2G2OA 3QAUA 3L3VA 5T7LB 5L46A 5K8NA 2WVDA 2UVVA 1WC5A 3W8PA 2KYZA 3O5BA 3KHLA 2AJFE 1Q7YO 2ZE2A 4R5PB 4DCHA 3BEXA 5LMNF 3J7Z5 1IR0A 2Q3PA 4JKAA 1NJYA 1FJCA 2W40A 1AROP 3AVIA 2UXCJ 3WNGA 2E1ZA 2H54B 4CLSA 2DB1A 4YB7A 3AD9C 4CE9A 1NGHA 1FX4A 4DR4J 2JX2A 3UCZP 1RKJA 4OZ0A 3CJ9A 1DURA 4RO0A 4LF9K 2QMUB 2E2NA 5T41A 2EX3A 1HQUA 3DGPB 3FQKA 1F9EB 4NA2A 4TN2A 4KI4A 3R7SB 4FJLA 1CJTB 3V9UA 4K2XA 1PBAA 1HA1A 5LL6Z 1WSFA 3CETA 1JXLA 1SL0A 3O2IA 4FVUA 1ZA2B 2ZNZA 1X4HA 3I5AA 5KFJA 4QYZK 4OHZA 5E26A 1YTYA 3HVWA 5F0XA 2IC3B 1A9NB 3VAJA 3CG7A 5B0CA 2ZH5A 4FS2A 1TUYA 2A3ZA 4LRAA 2GAGC 2EC2A 2JSXA 2ZBCA 3RB3A 1YI2S 4OX9K 3MEDA 3U9ZA 4M3YA 3I0RB 3ET6A 3TI0A 3C6TB 3GE1A 1IBMJ 1F2HA 1C1BA 4KHPK 4DSJA 4N5SA 4JI2F 1I5OB 3H0PA 2VKZG 1BLUA 4QR1A 3UN2A 2ZZNA 3POTA 1U6FA 4DV6F 4A4JA 1XN9A 2YHAA 2YWEA 3NVKA 1JJ2M 2JC1A 3CQYA 1M5PC 3DN9A 4H4KA 5AQVA 3TAMA 4ZK7M 2OEMA 3BF4A 4FLWA 1HYSA 3KHYA 2GQCA 4UOCA 4U67L 3C19A 5HO4A 2G0JA 1GLLO 3TABA 4USKA 2DXEA 3M1FA 3SQGB 1KSPA 4JKGA 3NP5A 2UXCK 1U1PA 3ULEB 1VQNS 5DJBA 3PG9A 2X1BA 2C2NA 5GMEA 4P52A 4Z7YA 1RCOB 3THTA 3CCSS 4IRDA 4YDUC 5KFGA 3HSCA 1I94K 2KYXA 3C65A 3VVUA 3CC2S 2U2FA 5F41A 4HH0A 2IVYA 1ZBUA 3BSNA 2Y3YA 2NPIA 3DU6A 4Y2CA 1VDHA 3RAMA 1ZYQA 1VR6A 3OVAA 4MAKA 4ID5A 2BEFA 2RDIA 4ITSA 4LR9A 3C46A 3R8YA 4F02A 4DG1A 5MAOA 2KVIA 1JLGA 1Q4RA 2FDNA 3IFRA 2FUG9 2DEIA 4DS5A 1V3ZA 3NAIA 2JNJA 2ATQA 2CPFA 5HRPA 3R1LA 3MAQA 1YG0A 3DOMB 2OKQA 2P9UB 4CM0A 3P45B 2UUBK 1DARA 4AFFA 1AA1B 2O3DA 3VHQA 3QDKA 2ZDOA 4C8YA 4B1VA 1SQKA 3ZT3A 3PR4A 2QKKA 2RQMA 4LF2A 2Y1JA 1Q16B 3CMES 2L9NA 5HVFA 1Q8BA 4DV4J 2L48A 2DEJA 3CDBA 4CJFA 3FZBA 2F3JA 3U6FA 3G8TA 2QWLA 1RWXB 1RADB 3QLHA 4ILMA 4IFEA 5I42A 4CLPA 2EFOA 2E4LA 3K89A 4F0HA 2V4JA 5KFSA 2Z1JA 1ZPVA 2DFHA 4J9RA 2IMOA 1BI4B 3AVFA 2CQIA 3EKSA 4A8OA 4FN5A 4DEZA 2CG8A 1Z1ZA 1KVAA 4UOGA 4CZFA 3FNNA 4ELUA 4UT4A 1WTFA 4O55A 3MN7A 3SQ0A 1CQNA 3I87A 2VYPA 5HSPA 4CHYA 3FBFA 4R25A 4CJSA 4K4WA 4DPOA 4BQZA 3G0ZA 2QXLA 3KLIA 5DGBA 1YGYA 1TAQA 4J91A 3CCRN 1XIQA 3H2LA 5AFUH 4DTJA 4OPHA 4Z4CA 3V1OA 4FZZA 4F3OA 4UY8T 2ZVIA 4CLKA 4JHDA 1RGVA 4EEYA 3IAS9 3IBFB 1S57A 4J9NA 3OYJA 3P8BB 2YPYA 1VC0A 5DK5A 2OPSA 2V8VA 4DHYA 3MN9A 1IKWA 1UTAA 3AD8C 3G4SS 2F4VF 3RR7A 4A46A 4USMA 3CJ1A 1S6QB 3U1MA 3NY0A 3UWTA 4CLFA 2ZD1B 4C6AA 2M52A 1N4LA 4DS4A 4C11B 4QOZB 1AUDA 3NH2A 3N4QA 3TWZA 4WWSA 2HHQA 2CGJA 4I2PA 5BR9A 3CCES 1YSJA 4OV6A 2DGVA 3T1HK 4NI2B 3LM9A 3CDWA 1EAYC 4KPCA 1XHXA 1IBMK 3KK2B 5GMKa 4JI7J 1FRMA 4FXVA 2WBRA 1P8GA 3TO8A 3ELHA 5A8WA 3SDEA 5KG6A 4JI1J 4V19S 4CIOA 2HWTA 4BQLA 4R79A 4ZVPB 3M2UA 5EY4A 3OHBA 2YNFA 4O44B 1HI1A 1S9GB 1HD0A 2BACA 2ZH3A 5ETQA 1BA1A 2OI2A 2V2QA 3EE8A 4HHJA 3P5BP 2P9SA 2VG7A 4QYZJ 4BHQA 1VQOS 5EHHA 3J81U 2YWWA 1CXQA 4FJ5A 4FLYA 3BPDA 3I32A 1CULA 2OP5A 5K8OA 2FB0A 4RW9A 4JV5F 2GZOA 2DGTA 3FC9A 5CY4A 1B3TA 1NAQA 2B4UA 4EIAA 4KHWA 4F4ZA 3TX8A 4BRHA 1XNQJ 3A8YA 2IY5B 1NWKA 4JI4J 3U1LA 4N8OA 2XSJB 1HWJA 2NSCA 4ED0A 1NHVA 5CHCB 4I1TA 4G9ZA 3W0LA 2I8EA 4WFNQ 4ETXA 3DRXA 4PR6A 3D7EO 2Y8YA 3TPQA 3EWGA 1FDBA 3IS9A 1M90O 5HANA 4H4MA 1S1UA 4CZIA 2MKIA 3TU5A 1U24A 2BW2A 3R5CA 4CF2A 3OS0A 4QR2A 2ZC3A 3WIVA 1FFSB 3BDEA 2LU2A 3DHWC 5JLFA 4AHSA 4PQUB 3MCPA 3ONQA 3SUOA 2YNGB 1UJ5A 1S1XB 1RHRB 4XH4A 2R2UA 2RRAA 1OH5A 1TYQA 2AW0A 3QEXA 3VVTA 2CPEA 4J9LA 1KHWA 1IWGA 3TUJC 4EP4A 1KS2A 1YIJN 2Q3SA 3VGMA 2KZMA 3HKWA 3D28A 1NPKA 4OFZA 4KBOA 3ZT4A 3PYGA 2JLGA 3IFEA 3FR0A 5BRFA 1NK9A 2QFIA 4DV1K 3EGNA 2W9BB 2ZJQL 1UAWA 2VICA 4OPJA 5DMRA 4FW2A 3T9ZA 7FDRA 5AXNA 2XWYA 2DHGA 5M1QA 3KNGA 5KT3A 4CZEA 5A8RB 2C3UA 2VC0A 2DY1A 1IQTA 2J0XA 4K4YA 4DV0K 2D4WA 4ED1A 2FHKA 3ENBA 3CJ5A 3V1QA 1S1TA 1N0UA 4IH5A 4OPKA 3O1LA 2IS3A 3AO1A 4CM2A 3JQMA 2AJ0A 1NDLA 4KAIA 2UUBF 2W24A 3IRWP 3M9NB 1WSGA 4IFVB 3OYDA 1T05B 2ROGA 4PHTX 1FKOB 3H5YA 4M3UA 1RDCA 2HNYA 1OY6A 2QSWA 3KTQA 3MEEB 2V8PA 3WBZA 5D4OA 3GYXB 2Z8QA 2XY5A 3VQ4A 4F3QA 3O3FA 1U49A 1P9QC 4IXCA 3D67A 3E51A 3GSIA 4O3QA 4OX9F 4CO2A 1X0PA 1YITN 2XMVA 4NX9A 1YIJS 1S1VB 3L2QA 3MAAB 2G9OA 4LF8F 3HO1A 4MYTA 3HM9A 4CJQA 2BW7A 2W25A 3RVCA 4OV1A 2X1GA 1V3SA 1D3WA 2B9WA 3H90A 2CJ9A 4DUZJ 3H1VX 2OTJS 3KJFB 2XYGB 1R6YA 5ETOA 4WYBA 3M8RA 3SV3A 1LWFA 1TK8A 4X62J 3MX2A 3OPKA 5HRSA 4Q2LA 2C2RA 4X4VA 5DRKA 2FVQA 2KN4A 3TW0A 3DCAA 1K8KA 4O8UA 5K14B 4DL6A 3F2KA 4Q0BB 1VRUA 4QU7A 1FXDA 2JVOA 4QU6A 5EN1A 4K2JA 4WK3A 2BV3A 4I2QA 2DGQA 4MK8A 4LR8A 4CJTA 3GIRA 4X65J 4OJ3A 4NXMJ 4RUAA 3M1VB 4A61A 4NLBA 1AZSB 2PSZA 4CI6A 2ZH1A 1S1WA 3AXMA 3D2EB 3JYTA 3NDKA 3RBZA 1T0TV 2HRTA 2JZ5A 2B5JB 1ZBTA 4DL4A 2BJ3A 3QJJA 4YMEA 4OLBA 3WIUA 3OBWA 2VWBA 4HEA9 4PL7A 4NLWA 1ZM9A 1BQXA 3LGHA 4F7VA 4AHCA 2B9EA 1RK8A 2DO0A 2L3MA 1X8DA 3M8QB 4KHYA 3G2XA 3KXDA 3QYYA 3T5JA 3VN5A 4PKDB 4GVEA 3DU5A 5IT9Y 3VGKA 2QXFA 3D0IE 4ZJOA 3ZEUA 1UMJA 4FPIA 3IM8A 1LQ9A 3ZCMA 5AQGA 5CZXA 3CQXA 2DIVA 3W5YA 2CH5A 3QERA 2G8UA 3MR3A 2YTCA 2R7OA 3H6EA 3THXB 4UOHA 1J6ZA 3OXFA 4H0YB 3OR1B 1U09A 4W4MA 4LY7A 4DBQA 5HLFB 4ED8A 2D0AA 3OYBA 3MM5A 3PFEA 3A4TA 2KVQE 4CJKA 1FA0A 1F3VA 2CQBA 1WEYA 3VQ6A 4JI1F 1QE1A 4MQ3A 4ZPBA 5LOQA 4MO5A 3DRSB 3LALA 1M5HA 2NRRA 1NJIT 4EHUA 2HB5A 1HRHA 4DUZK 1U2CA 2HYIB 3CYMA 4G1IA 4BC4A 3FVYA 4LSLA 2UXCF 4HTIA 2CGLA 2O01C 5KI6A 2DH7A 1RHKB 3GV8B 4CH7A 1HPZB 3ITHB 1WC6A 3VR1A 2GWKA 2I7PA 2QZ8A 3M2VB 3J80O 2J7UA 1W2IA 4DV3K 4ECSA 4DSEA 3HKZD 2RPIA 3E9PA 4TY8B 2W8LA 5D77A 2GHPA 2EG2A 3M4XA 1WKLA 2ITGA 4UW2A 4I67A 3GIIA 1SJ4P 5B09A 5CZ1A 3VQDA 4IG0B 5CD4H 4I6MA 1B9FA 3MR7A 1ULRA 4LFAJ 4MKVA 2W2NP 1VFJA 4DL3A 3I9V9 1N5YB 3SEOA 4DU4A 5IT9O 2YQ0A 1NGBA 3PZPA 4CLZA 3FSIA 3DXMA 1RWUA 4HDHA 4HUEA 3OXGA 4NYPA 1NGEA 1VQYA 2HHHF 1C4AA 5C7PA 3OTBA 2C1EB 3LPYA 3QGPA 2LP4A 5HROA 1N8RT 2MQQA 3H5UA 3V1RA 3DI6A 4LRFA 5F8NA 1SVDA 3HPHA 3H2VE 4H4KC 1IKVA 3L6QA 3BPSP 3VF4A 1J5OA 2V4QA 2GELA 2V69A 5D3GA 3TWHA 4NLDA 2CDRB 2LQ8A 2QA2A 5IQQA 3SSSA 5CZVA 2KU7A 3CVKA 4JI2K 4DV3F 5KQDA 3PRDA 5ETLA 2HNDB 2X78A 1KQSM 4FS1A 1D9DA 2VPYB 5KFUA 1YF5L 1HR0K 3ZZTA 4J2AA 4DZDA 4FZYA 3HSGA 4LF4K 1TV6B 1RLCL 4LF5K 4MK9A 3A5NC 1U1RA 1X5TA 4OZ3A 1HYVA 2D3OR 1XMOK 4BROA 5DDRC 3MR6A 1JNZB 3QJLA 3DOKA 2YQ1A 3LF0A 4Q43A 3JSMB 2XY7A 3PM9A 3D6MB 5CR4A 1UW9A 3UKUA 4OI4A 3MMBA 4FPRA 1LK7A 2AKWB 4PA1A 4KI6A 3DHXA 2XMAA 4USIA 5EWFA 4ISEA 3C6HA 1TUVA 1NOYA 3MMAA 1N54B 5E41A 3DRPB 4I6YA 3DLRA 4BR7A 3ZSWA 3E01B 2VASA 2QIFA 2BANA 3PW5A 3DMJA 4C98A 1VQLN 4IRCA 1HX1A 4QIGA 1GMUA 3E8OA 4HYKA 2XCAA 1S5ZA 2COLA 4LSNB 1UETA 3KJNB 1D1UA 2LXIA 4JI3F 4FLXA 4OLPA 3ENOA 4OJRA 4UZCA 5B0DA 4FZXC 4DU8A 1S79A 4ANDA 5FIIA 3LDSA 5DLGA 1NUEA 3B6OA 2V2KA 2Q43A 1KAXA 2Y8WA 1T03B 2B4JA 4PPDA 4Z4GA 1XMOF 1VQ7S 2XNRA 3HT0A 1M1KT 2A3JA 1WSJA 3VEXA 4GY2B 3WDOA 2CJKA 1MU2A 4TQRA 1RT7A 4CFCA 3OBYA 5HATA 3DOLB 2BYCA 1WNEA 1YBTA 4USTA 2HHHK 2ZZMA 2ATLA 3NAHA 3CEDA 1YI2N 2B5JA 2XLIA 1YJUA 4Z4HA 1XR5A 1C0UA 3CO9A 2MGZB 3EGWB 1JXBA 2FLPA 4ZIVA 4FF3A 3QEIA 4ERDA 3HXMA 4G3IA 1ZBSA 4M5JA 1S1WB 3THYA 3OTDA 1I51B 4WFAL 1H1VA 1RAAB 2ZWHA 1RKIA 1CG2A 3OYKA 1RT1A 2Q2RA 2ACYA 2HVDA 2VUGA 4KHUA 1N36K 2UYTA 4DV6K 2OAUA 1TK5A 2HBMA 1T9YA 1KR4A 3CJ8A 1XMQK 4FPAA 4WP3A 1E4GT 1TKTA 1APSA 4DSFA 2HVIA 3ZFVA 2G8VA 4DSIA 5B0GA 1PC4A 3CCZA 2ASOA 1V4TA 3BQ1A 5BN8A 1MLAA 5FLXU 5J2MA 1DTTB 1G7CB 3KUEA 1UPPA 2LQ9A 2EBGA 2N7CA 1U0HA 1WKKA 3R7NB 2O8CA 4JI7F 3CE8A 4ZLPA 3ZX2A 2QM1A 1UEVA 4E1MA 1RTDA 5GVQA 3O08A 1SUQA 4BC7A 2QL9B 2K8GA 2WB4A 1DQ9A 5I4MA 5LXYA 3O8WA 2D0OA 3SNNA 3M6GA 2EEYA 4JI4K 4CGJA 3NS5A 2HZVA 1K47A 4DDFA 2VJVA 1UEUA 2MLYA 4EBDA 1VQ4S 3TZZA 4AHTA 2HNYB 4WQ5C 3D1HA 1FJ7A 3K0SA 2XHBA 3M9OB 5LJVA 2QTWA 5GIOA 4QWBA 3WXLA 1KHVA 1NGIA 3MCAB 1EQMA 2IVNA 3I55S 4RKUC 2HGLA 1Y5IB 3HFVA 4BC9A 1TL5A 3C94A 2KHDA 2YNIB 2HQFA 1MU2B 2WONB 2DHHA 4CZLA 3M8PA 1H7XA 4FYWB 1SC1B 3JTOA 1TTHB 1DTQB 4WZQA 2DXFA 2Y1IA 2FLNA 1GX5A 1HFEL 2QWPA 1IR1A 4C4WA 3KMQA 4U67Q 1C4CA 2KT3A 1G2EA 1WOPA 1RT2B 2VFVA 3N6NA 2EFNA 4C8OA 1JCFA 5H9EK 4P2MA 5HQ8A 3VZIA 3MMCB 4M94A 4W5QA 2W7PA 2QTDA 4X4QA 2VL1A 1HBNA 1HHSA 1DAXA 5K8MA 4Y34A 4CLUA 1T03A 2CQ0A 4GKKF 1H2VZ 3WXJA 3O9RA 5J2PA 5I3UA 2H3GX 2FJEB 5FD1A 1BOTO 5F9NA 2V5HG 1SPBP 3D6HB 5U47A 2FBTA 4YDXA 3HI0A 3PX6A 4ID8A 4HLBA 4ZVEA 3VGLA 3F41A 3CXCR 3G10A 1EKSA 4KY3A 3BREA 3EKUA 4LVNP 1RTIA 1YJ9S 4WP9A 5BR8J 4HT7A 3MM6B 2ADCA 4TNOA 1BQMB 3MMVA 2VBXA 4OJHA 3GYNA 2VKRA 1C2PA 3CHWA 1ILYA 2ZJRL 3CC4S 1WHWA 4DV2J 3W9HA 3VQQA 2VU5A 2XSJA 3MM9A 4KR0B 3PW7A 2RJZA 1UVJA 3AOAA 2BKNA 4CHNA 3M5RA 3O44A 4KREA 3HVAA 2HNZA 1WORA 3GWCA 3K5LA 3UIQA 3KLHA 2YQ3A 2HSEB 1S48A 4NYZA 3CCVN 1CULB 3C7NA 3VQBA 3RU0A 3WX8A 1IBMF 2FJWA 3DM2A 4C7QA 2YH0A 4DR7K 2NYHA 3TR8A 1CS4B 3K17A 4DTNA 4FWNA 3CMAN 2DNYA 5GAEP 4I56A 2M4MA 3ZSZA 2IJFA 4PG7A 4CF1A 2HHHJ 1QUVA 3ZZZA 3MUVP 4DUYK 2DO4A 1RTDB 4M63A 4K50A 3EO3A 3SDEB 2P5GA 4TQSA 4CEBA 3OBIA 3AJDA 5IWAF 4JI6K 4J2BA 3UKRA 2OH2A 3A8EA 1VK0A 1WEXA 4L75A 1NMEB 3VOVA 2NNWA 4OKKA 1TL3A 3L7PA 1HHTP 5IS2A 3OFFA 2ZWOA 2CVIA 1YJNS 2A42A 5M1FA 1CC8A 2E1RA 2A6AA 2MQLA 4C48A 1RT5B 4OJ1A 2YNHA 2GJFA 5GINA 2EFVA 3VAHA 4DV5F 1ATSA 2YWKA 1K1SA 1EZZB 2EWHA 1BXNA 1T9TA 2QA4S 2W6LA 3R9LA 1NHUA 5DG7A 3BP8A 4RW4B 3KJVB 1N6QA 3LZIA 4KGXB 4FNHA 2CQ4A 2JFKA 4U8YA 4C8LA 2C2MB 4KHQA 5KFEA 4IOCQ 1RAHB 1HBMA 4KTWA 2HRYA 3O6WA 2VGMA 2BA9A 4CO5A 2GW8A 3TVKA 2HZCA 2AQ4A 4D3HA 3VQ5A 4K7QA 2HIYA 3ILOA 3W62A 3IBWA 4DL2A 4BC2A 3GFXA 3W65A 2FBXA 1V9OA 1AB8A 2QYCA 1MMLA 3DFEA 4ILGB 4M45A 1O5JA 3MFIA 2O8FB 4OPAA 3O6QA 3MM5B 3DRRA 3KK1B 1VRTA 1G99A 2YKNA 2LQJA 2W2PP 5I3UB 2F9JA 3AGKA 3HPGA 4JK7A 1PKUA 4A47A 2NRZA 3AD7C 1HBNB 2QWRA 4NPOA 2YX6A 1DQ8A 4CECA 3SQ1A 2HKEA 2XZWA 5EOYA 2CQHA 3UW1A 4TU7A 5HOOA 2NS1B 4I68A 1K0TA 2SXLA 1RISA 5A0YB 3RB0A 2WONA 3LDQA 4CBWA 2J0QD 3SJJA 3AVNA 1S7IA 3BDPA 1KWMA 1VIOA 2K3IA 4AF1A 3M1VA 4M5HA 4JV2A 4K25A 4LFAK 3GSDA 1TL1A 4NXMF 3CPWM 5KT4A 4FXWA 5E3AA 1Y5LB 5EGYA 3ZZ0A 1Q82T 1FDNA 2DPNA 1BGXT 3UDEA 3IRXB 3TEGA 3CERA 3U3YA 2A6OA 1U1LA 4QPXA 4RLEA 3M30B 3L2RA 1L3KA 3R5JB 4BLGA 1XQSC 4Q8FA 4CH1A 3OS1A 1KOHA 3QJPA 3AGRA 1NSAA 3R6MA 3LP0A 2VPZB 1OQ3A 1Q78A 3H1QA 4FVCA 1GLJO 1RT5A 3N9UC 4ZKAA 1RT4A 4LFBK 5FRNA 4Q0BA 1VQNN 4B3SF 1IBKK 4DR6F 1X5SA 4RJVA 2PYLA 2ETJA 3LZJA 2YX4A 4R0JA 2OZMA 3O9TA 1IXKA 3RTVA 2IIHA 2VDHA 3QETA 3PACA 4C3MA 3GFZA 2MZSA 3TJ8A 4V1Ak 3JTNA 2KO1A 2KFZA 4DR1J 3WZ0A 1X4BA 1WWHA 3SQ2A 4QWEA 1C1BB 2QMXA 3IG1A 2B4OA 1N56A 2Y0SD 1AW0A 3MCOA 2BQUA 1NZ8A 3Q22A 2UXDF 4IZ9A 4FJHA 1JLAB 3KNAA 1UWAA 3NE6A 2DPJA 2ITMA 2CQ3A 3CT9A 1F6TA 3O1BA 5HRRA 3R3TA 5JJBA 2OD6A 1UCNA 5HK4A 1JKHB 3LGMA 1QQOA 4FJKA 5CXTA 4JV1A 4OQJA 3JQKA 2PMHA 4K42A 2KB2A 3THYB 1RZMA 1K8AO 2AGOA 4KB0A 2APOA 3FBEA 4ECWA 2IIRA 3W3DA 1CJTA 1RTJB 4LC9B 1HPZA 1S9FA 2AV5A 1FKOA 3BGUA 1ROFA 2AJ1A 4J9KA 4BACA 3CPEA 3CI5A 1E3MA 3NFAA 1BQMA 5ADXH 3NCPA 2QO3A 2R2SA 2Q0UA 2BOPA 3IR5B 4BRDA 2I7NA 2AGPA 1VC6A 3F9MA 4LH4A 1H2UX 1F0XA 1TVRA 2CPYA 3N01A 3LQVA 3CFRA 3K2PA 2HPUA 5ETKA 3HOTA 5A2QY 3KDNA 4IEEA 4FYVB 4XH1A 4PRFA 3UR0A 4X66J 4JK8A 1A0OB 4H0OA 4C0BA 3WNFA 2PT0A 2RNEA 2MSTA 1Q53A 4OX6A 3NNHA 1ZTWA 2AP1A 5KOXA 1GAOA 4OLAA 1EQYA 4CJWA 3FEYB 2MEWA 1PYSB 1QVGM 3W9IA 3THXA 1D09B 3AVCA 1XMQJ 4Q7AA 1WLJA 4BC5A 1MWYA 2MQNA 2V52B 3FZHA 3AODA 4CO3A 4A62A 4RX6A 5T7LA 3A5MC 4DPXA 3SQOP 1RT2A 2LFVA 3OUYB 4IQXA 5J2PB 2MKSA 1IO2A 4JI2J 1M5KC 4AHRA 3HLUA 3G82B 1DGKN 3NGIA 2NQPA 5GAGU 4ZVFA 4GKJK 1S1XA 1MROA 5HBMA 3HL8A 3GTYX 4DN9A 1NZAA 3MWTA 3U1NA 4QZVB 2AEFA 1TVRB 3UKUB 4USUA 1Y00A 1REVB 3CJKB 3C2PA 4L6V3 5HMZA 2R8JA 1KQKA 1K9MO 3EEQA 2H9ZA 3UPFA 1TUUA 1UL3A 3G71S 5J1EB 1SIZA 3TP2A 3GCXP 2Z4PA 1FXRA 1NSQA 3VEYA 1NM1A 2G1DA 3OTOF 3MPYA 4X62F 5F8JA 3NS7B 2O5DA 3M9MB 2QKBA 3CCEN 4JKBA 4NMXA 1RBAA 1R31A 4DTUA 1WG4A 4OO1J 3CW2C 5C24B 3CO0P 1SJRA 2I5JA 1RB0A 2UU9K 2PIIA 3ZNUA 1LEOA 2DT9A 3NNCA 2F40A 3K9KA 2LQ5A 1RBRA 3ATVA 4FWLA 3PHTA 1K6YA 4WU2A 3IDHA 2A1BA 2Q97A 5AFUA 2FSJA 1R27B 1N48A 1Z4UA 5EWGA 3ILJA 3AHPA 1PGZA 5FLXY 4ZTJA 3CCSN 3VQAA 3MCMA 1JLBA 4N76A 5FJ4A 3SZ2A 4JK9A 1U0HB 1OWXA 3V6DA 3DLHA 5CQGA 2ZBRA 4IOXA 3TZYA 2R7XA 4LD0A 3D45A 3K5MA 1GMWA 1MSWD 1MWMA 2QL5B 4DR4K 2QI2A 4IQMA 1SL2A 2RD5C 4DR7F 1VQSA 4GW6A 4PKIA 2ILZA 3ZZOA 4F4KA 1SXLA 3T1YJ 1TZ0A 2PFDA 3O4WA 5GIPA 3A5LC 1WOQA 3ISNC 3J7YP 3TR5A 3EICA 2FZKB 3M8SA 4KHPF 3K5OA 2FJXA 4FKXA 1FRHA 4PL8A 1PJ7A 4B8AB 3RRGA 3F9KA 2DNLA 3MR2A 1R3NA 3OSPA 3MEEA 2ZD1A 5LM7E 3K57A 4ECTA 3GIJA 5IM0B 2HWHA 2JWLA 1NGGA 1X31C 4NEZA 5F8MA 5ITHA 3GYGA 2UXDK 3NCRA 4CFBA 3NGZA 3C16B 3NKYA 3LP2B 1LK5A 4M41A 3QGGA 3R8EA 1VSIA 1A5XA 5GADU 1XBWA 1BC6A 4BRKA 2WZ1A 2YKQA 2ZKUA 2XS2A 4MIWA 2WW8A 3PFOA 2HRUA 3QFWA 3TVZA 3Q7BA 3P49B 2HFZA 5CCMA 3GDQA 5CE3A 1WF1A 4L73A 3PW4A 5HL7Q 3UI3A 1DQAA 3L0QA 3TAFA 2DGWA 2XMKA 4HCCA 2DVIA 3P4UB 4CLLA 5BN9A 3IBCB 3ENQA 3E1YA 1BI4A 1MDUB 4UQGA 4ZCMA 3LM2A 1YJWS 4OI2A 2D1CA 1U1QA 4LREA 4ZHRB 5BYQA 1XNRK 3SBMA 3D6TB 4B3TF 2HMPA 3NS6A 1JX4A 2H48B 3DRRB 2XY8A 2FC0A 1CEZA 2HAIA 2DGSA 2VOOA 5MLCV 2ZHBA 4FNIA 3IA0A 3SCLE 1J5EJ 2H5JB 5D0HA 4ECXA 2D7SA 4IFYA 2E7XA 3BB5A 3M32B 1T02A 4YEAA 2IVOA 4CGGA 5G0RB 2QX0A 1P6TA 2ASLA 4DJBA 2Q0RA 4NL5A 2H5IB 3E9LA 3IN5A 3T1HJ 2G2YA 1Q95G 3GB0A 1HBMB 5M1KA 3ZTOA 1S12A 2MKHA 3V6JA 3OT9A 4B08A 2C3YA 1S1UB 2A1RA 5KT2A 1EWQA 3OD2A 3SMZA 4F4AA 1FCAA 2DTUA 4DCPB 4L72B 2A18A 4M5DB 2AZ1A 2XEXA 4A8MP 1FJGJ 3VF0B 4I2QB 5KFWA 4KT0C 1N36J 2KL8A 3HX9A 2CKWA 4J5OA 3AAQA 2U1AA 4AXJA 3QBXA 2WOMA 1Q7LB 5K14A 3T1AA 3MTJA 4FF1A 3ZTRA 3IMQJ 4B9LA 1GTHA 2MJNA 4RW6A 1TELA 3AOBA 2E1YA 2NXUA 1K73T 1VBYA 1ZETA 4J2EA 3RAQA 4QWDA 1CXUA 2P5VA 1RA7A 3BYPA 1OY9A 3B78A 1GXLA 3VERA 2LECA 1N34K 3PIPQ 4OZJA 4LRBA 1LAVA 4DTMA 3HP6A 1RTZA 2EK1A 3KVGA 4E7HA 3I56N 3S1TA 3SAGA 4IG3A 3EGZA 4LFBF 2XZTB 2XLJA 3G6XA 3TOQA 1QSYA 3AVMA 1UFLA 2PFUA 4I2PB 2B4PA 5JXSA 1NSPA 3MEDB 4DX5A 2HHSA 3R1XA 2M3DA 1F5CA 3V9SA 3AJ2A 3V4MA 3P96A 4GMJB 3HHEA 4K8XA 4JI0J 2F4VJ 1ATNA 3MXMA 3W1YC 4W90B 2C3MA 2HZAA 4CH0S 1CVJA 1R6VA 2OPSB 5F1XA 5KFYA 1FK9B 2G13A 2VQEF 2AJQA 5EXWA 3SIPB 5B0BA 2AJ4A 1NK8A 3CJAA 3WNHA 3PO4A 5IZHA 2AA4A 3N4PA 2P6SA 3S3MA 2ZUGA 1KC8O 1RBOB 3FZMA 4P2SA 3LDNA 4RL1A 3PRVA 2E88A 3H8YA 4GNIA 5B8HA 1MWQA 3VEVA 2RQ4A 1HWLA 5CA5A 2FJVA 2G0CA 2ZUAA 3VA0A 1KCFA 3CCWA 3QINA 3SFUA 5ADZA 3DRSA 1VQ6N 4OHVA 3OVSA 1ZS6A 3K59A 4GKJJ 2OEJA 2KXNB 1CLFA 1H38A 3AVGA 1VSDA 2QFJA 1MMDA 4X4NA 4M5KA 3FLCO 3ZZRA 2DNKA 1Q18A 4YOVA 3HHDA 3EGVA 1RABB 1KVCA 3B8HA 3EZ5A 2MSSA 2EKNA 3DLLQ 5CD4A 1RAIB 4LJMA 5LJWA 1YKWA 2B8PA 3EYZA 3EE3A 3JSRA 5C2CA 5KFTA 4YHHJ 4UZBA 5CYMB 1RWWB 2VFRA 4JI5F 2AYBA 1S10A 2P9KB 3QT8A 2XO6A 3BSOA 3VQEA 2LVWA 3K0JA 2F8MA 3QATA 1U47A 4BRNA 1RLDA 3ZX3A 4YB1P 3HHLB 2JVRA 2ZM6K 4XAKA 1LW0B 1BUPA 1FT8A 4NLSA 1LWEB 1NKBA 4N7TA 5LJ5Y 4X4PA 3X1LB 4CLWA 5KG5A 3G9CA 4A8YA 3PSIA 2X6SA 2GX9A 3TA1A 3BKFA 4CEFA 4GV6A 2R7UA 3VEZA 1EARA 2NRVA 3JYTB 4FKYA 1KD1T 2OANA 1C0FA 1T7PA 5AQUA 3QT7A 2DHAA 3SMPA 9RUBA 2WBMA 1P9YA 1KAYA 3BUZB 1Z6RA 1A5WA 5FDLB 2DR6A 1UVLA 2VC1A 3L4BC 3HJFA 1JLFB 4LF9J 4NLUA 3OW2M 3K5PA 2NPFA 1ZM4A 1S0NA 2VQFJ 4Y3CA 3SYZA 2V94A 4FJJA 1OMSA 1AYEA 3BKTA 3MAAA 1FVSA 5LMUK 5THWA 5KFPA 2YJEA 1WAJA 3CDUA 4NI2A 4X4TA 3OYEA 1DTTA 5J2MB 3R5DA 3HVRA 2ZJPQ 3V81A 1NRKA 1HD1A 2C2EA 2BJ9A 1U45A 1FJEB 3H42A 1X4GA 4C9DA 3ET6B 4CYUA 5AQQA 3NBPB 2FZGB 4CWBA 2H51B 4JBCA 4LF4J 3OA9A 3SSRA 3Q23A 2M8DB 4CF8A 2LYVA 2UVUA 1JLQB 1HW9A 1N34F 2B7BB 3FZLA 4OJGA 2W4PA 1N36F 4KO0B 4FJGA 3VQPA 4LT6A 1QS4A 5RUBA 2YJFA 4DMZA 1S6PA 2GFFA 1S1TB 3R1HA 3ZLJA 2MGZA 2OPPB 4ZVSB 1U6BA 4YR2A 1S6UA 1Y10A 2QT7A 4TY9A 4NCGB 2N3LA 3PIOL 1RP5A 2V4RA 1MN7A 2HF4A 4FF4A 4LFCJ 1RT7B 3SCKE 2HHXA 2B9XA 4ECZA 2EW9A 3V9WA 3IGVA 2ZJPL 4NLYA 1W0HA 5HL7L 2LCWA 4DMNA 4XPEA 3CCVS 4C3KA 3NGDA 1W26A 1AFIA 3OVNA 3LW5C 5FPMA 2DRAA 1MWKA 3DLKA 4DI6A 4X65K 3BZCA 3NAEA 2R8GA 3TNVA 4OGCA 5DM6Q 2XWXA 3OL8A 4DF8A 5JVHL 2RS2A 2L9DA 1J53A 1E6VB 3RR8A 5LMUF 4DV5J 3QESA 2O8BA 2CNNB 4GVBB 4HWIA 5DZ6A 4DV3J 4QS9A 5C25B 4K5RA 3QZ8A 1NH8A 4AILC 4EFAC 4X62K 2CYYA 5CZ2A 5T7BA 3OTOK 4DQIA 2KW4A 4QPTA 3I0SA 1SH0A 2VWJA 1QAXA 1NNEA 3BZKA 5DG8A 1V5IB 3C8YA 4B1XB 1IN0A 3KG4A 4OKEA 3D3CJ 4CZHA 1PILA 4KGKA 2G8HA 3WEEA 2YWHA 1BIUA 1TU0B 1IKXB 1T3NA 4PXBA 1WAFA 3KKRA 1FD2A 4LQ9A 1TFWA 2XMMA 1HJOA 4JRQA 1YAGA 3H08A 2CPIA 1N33F 1NJXA 4KBIA 3U4LA 5KFXA 3ZT1A 4BS2A 3H3NO 4AT1B 5JVHQ 3CFOA 3HOSA 5E5NA 2IM1A 3B8AX 4FJNA 1GLBG 3KWIA 2W9AA 2N7YA 2ROPA 1U2VB 4EZ6A 1RFQA 2JLEA 1MN9A 2KH9A 4YN3B 2BGGA 4TLRA 4DQQA 4TYBA 3GBTA 4B3OB 4GV9A 2HNDA 1UJ4A 2P9SB 1B4SA 2OFHX 2P9CA 4KTZA 1D4XA 4B3TK 4J9SA 1RACB 4ZCIA 5BYRA 1SJFA 1RI7A 3T3FA 2Z30B 2GCFA 2MQ8A 3CSKA 2Y9HA 3AO4A 4OI6A 5A8WB 4CTAA 1YZ6A 4CJUA 4YQWA 2VG7B 4L74A 4PCQA 4FJ9A 1TKXB 2YKMA 1BD6A 4NYNA 4FLVA 1MNEA 4HCBA 4ZP6A 4FWKA 1HBUB 3NMRA 2NUBA 3Q8QB 4KH1B 3NMAA 4DQ8A 1U25A 4WXOA 3W66A 3CM5A 2FGOA 2ZJRQ 2OPPA 2ZFHA 4JV5K 3BF1A 2RU3A 4FM1A 1V4SA 2WK4A 3I55N 3LDOA 2Z2MA 4IG0A 2I6WA 3QEWA 2B9YA 4IOBA 2HBJA 3M6WA 4HACB 2OSQA 4KO0A 4TY8A 1NKCA 3QBCA 5JICA 3I9ZA 1J9AA 4DR5K 4YORA 2YH1A 2HK3A 1BMQB 1JJ4A 4MLHA 3V6KA 2RHSB 1S97A 2E9RX 1CZBA 1WF0A 3NEKA 2IDOA 4Y00A 3KLIB 1W97L 4ZJLA 3PJXA 1IV0A 1OS5A 2NREA 4IOAL 1RCHA 3R5AA 5F0UA 1YRXA 4DX8H 1DT9A 1YVNA 2Z2LA 3BH6B 1FO1A 1KQGB 1N5TA 5JS1A 3BH7B 3NCQA 1D0EA 2YBVA 1MWZA 2RQKA 4M5LA 3QQCD 2BH1A 2EC0A 2IYIA 4D3GA 2ZKTA 4JI5K 2OPQA 3R2DJ 1GOCA 1FKPB 2BJ1A 4UOFA 3FZFA 2F9WA 3J7YI 4FK2A 2W6KA 2D5RA 4OIXA 1DHMA 3AB2B 3US5A 3EY1A 3GCWP 4OYPA 2XCPA 4B1ZA 2J0SD 3I56S 4OGEA 3RB4A 3CF5Q 1TMJA 4GC7A 4QOTA 4A8QA 4B1WB 4DLGA 1YBUA 1U04A 3KFWX 3VGVA 4WFYA 2IPOB 4LMZA 2BXJA 3CCQN 1CBKA 4O4GA 3C66A 4O4GB 2MQMA 2BE7D 4E3SA 1FXXA 3GG0A 1QQMA 2Z1HA 5EX0A 4YHHK 1JL1A 1NSKL 1WC0A 3HCXA 3M8YA 3D2WA 2P9UA 1T95A 2XSFA 1OPZA 2P9KA 1K73O 4KV8A 4QBUA 5BRHA 5KFCA 1HMVB 3D2EA 4YY3K 2JOQA 1GFWB 4H5WA 3DJCA 3A8KA 1ZM2A 1IQZA 4O0JA 4DR7J 4AL5A 2OTJN 2P9IA 1FX2A 3A1YG 1QZ6A 5DDOC 1TR0A 5D78A 5AQFA 2CNLB 4IDKA 1ZAVA 1JQGA 3AVJA 2XNQA 2RILA 1UFKA 3GPAA 3OSNA 3R5GA 3WX4A 3D4JA 3HYFA 3GZ7A 2RKIA 2VG5A 3KWMA 4PAAA 4LF6F 3CM6A 4I9LA 1ZBHA 3QPIA 3KIOA 5J2QA 1FHTA 2Z1GA 4K0KK 3OW2R 4ID1A 2FJDB 5AR0A 2KHOA 2A40A 2XULA 1Q86O 1HYSB 3GFYA 2CJBA 3OYMA 1XHZA 2VF3A 4ZJQA 1H2TZ 2A2DA 3HPOA 4MFBB 2GBZA 3NF8A 3TSUA 1SI9A 3DXKB 1KNZA 2JL9A 3QIPB 4BRGA 3AY9A 2W2MP 3O9SA 4YOXA 4ZP9A 2AGQA 4BBYA 1VQKS 4I6AA 2VPWB 2QLXA 2E7VA 2HFVA 1FESA 2W9CB 1KTQA 2QMWA 2AD9A 4JI6F 3QFUA 3ILIA 1FTRA 5KFKA 3MOJB 1EKRA 2MTLA 3SAFA 2HMIA 1RUSA 1VISA 4HR2A 4B9UA 3VAFA 1VBKA 3FMWA 4HT5A 4BVOA 3QO9A 4URSA 2O66A 4RW8A 2BZ2A 1K44A 4AQYJ 1NLKL 3DXKA 2RU9A 1RBLA 1KC8T 3MFHA 2EHGA 2Z58B 1NXIA 3AA8A 3PUFA 1NK7A 2F63A 3N6MA 4QW9A 3MCSA 3KYLA 4X4SA 1BDGA 2LEPA 1TL7A 1RA6A 4DV0J 2A0FB 1HNXJ 3VWSA 2F8SA 3WHIA 4NLQA 3MMJA 4NA1A 2Q6BA 4NXMK 4ILJA 4X4OA 1RILA 3FZKA 4H5TA 4YFUA 4OVLA 2JLFA 2Y1LB 4AHUA 4KKOA 1WI6A 1JXEA 1U2VA 3GOIA 2NRHA 3PRBA 5B0FA 2O67A 3T5HA 3KOAA 1BCMA 4RW7A 2ZE2B 3OYIA 2R42A 4IDKB 2E66A 4PG5A 3CJ3A 2OGUA 1Q9XA 4MMOA 3DDKA 4IO9Q 4LBHA 3UD4P 4BRLA 2GJ2A 3FBCA 4F0MA 1IWAA 2P1JA 1RBUA 1QTMA 2JWNA 3QSIA 1JK9B 4NWBA 5KT5A 1YJTA 2CPHA 4P72A 3I0SB 3SCXA 1Y5NB 4DV7K 4CJLA 1RU1A 5F8HA 2QN6B 4DCOB 1N33K 2BRLA 2KT2A 2IFXA 4Z7CA 3FSYA 4ZS6A 4RCHA 2ASPA 4URGA 2C2ZB 5DM7Q 1M5SA 1KQSR 3VV2B 2B51A 3PSFA 4A8WA 4DL0C 3N79A 4DQPA 3MOZA 4H0TB 5IT4A 2GA7A 2HWIA 2GTDA 1IG9A 3NGYA 1UJ6A 5FPEA 1B7YB 4N77A 4URQU 4FJMA 3EDQB 1Y97A 1O6XA 3VAGA 2HVEA 4LF5F 1B99A 3NOCA 1LWXA 4WFNL 4Y1CA 1WJ9A 3I33A 1GMVA 3P1GA 4JV5J 4H4OB 5AE2A 2RRBA 3ZYYX 3MXIA 5L1LA 2QG9B 1S9GA 3NVMA 3MEKA 5AJ3K 1U0SA 3PW2A 2O8DB 2ZBQA 1RAJA 2KT5A 3TQ1A 2OIHA 2HQDA 5SUHA 3Q2SC 4BDYA 1JCEA 3FQLA 1S6OA 1HNVB 3GJTB 4XO0A 3VQ9A 4WTOB 4UTGA 5ADXA 2HFNA 2YHYA 1S6PB 3MPWA 2DNOA 2ASYA 3KK3A 4CJPA 4MIBA 4ZP7A 4RW8B 3LA0A 4NCGA 2BBEA 4TVAB 3CMEN 1RHUB 2GO9A 1FXLA 1FKAF 2WC9A 4ILHA 2IRYA 4C11A 1JB0C 3HHKA 4A8XA 3TZXA 2R7YA 3LP2A 4JKFA 4UUWA 4OHXA 2F9DA 2R2TA 2PI4A 4CZGA 3D2FA 1E6YB 3VTHA 3J7ZT 1LOTB 2M8HA 1Y7PA 2AIRB 2BE2A 2F8HA 2GUIA 3HZEA 5FLXO 4O0IA 3F44A 4B8CA 2JFDA 1HKBA 2RRNA 4HACA 4J2DA 3ZSOA 4DV2K 4A57A 2FHOB 4CHOA 4C0HA 2O4GA 4CJ4A 3MUTP 3VTIA 1GK8A 5E2QA 4LIWA 4J9QA 5J1PA 3S9HA 4CBXA 4V19J 3IGNA 5TKYA 4RZRA 4B3SK 3AVBA 4FJ7A 4JI4F 1OQ6A 2ZJQQ 3R6LB 2KTQA 2UU9F 4DPUA 4HUFA 1R89A 4J9VA 3BGRA 1SV5A 2DRBA 2E7WA 4USVA 3LOUA 4ZLLA 4BDPA 4ZCLA 2XO7A 2EI5A 3CJSA 2VBYA 4CTAB 2ZQBA 2CGKA 3AB4B 5M1OA 1BWVA 5AE1A 1R0BG 2FJBB 1U1KA 3EUNA 2EXUA 5LMNJ 2HVHA 2KJWA 2V63A 5KGXA 2DYAA 4P73A 4I4BA 4PXCA 4BY9C 3MM7A 3BSCA 5IOLA 2GV1A 2I5JB 5C2GA 5HI7A 4BRMA 1YHQS 1LW0A 4CGHA 2KDOA 2MPUA 2QC3A 4FYXB 4NLTA 4ZPDA 2JEFA 4RNMA 3UB5A 3L4QA 3P4IA 2M9KA 3Q89A 2ASDA 3NNAA 1VSFA 1VHFA 3B6BA 5J2NB 2B3TB 5IFMA 5J1EA 2RB7A 3HULA 5CABA 3PX4A 4JYAF 1REVA 3CJKA 4YHHF 2VFSA 3DLGB 4YNQA 4IUFA 4DHVA 1XR6A 4OYMA 4FOIA 1IKXA 3LL3A 1OO0B 4FK0A 4ED3A 4HKQA 2UZAA 1SB6A 3KJQB 2VHGA 1D8YA 1YJRA 4BRQA 2MY7A 3W9JA 2QA4N 3G82A 4KPYA 5HJXA 4CF9A 4W5NA 1IBLK 4DSKA 4JKHA 3OUYA 1LCUA 2X7IA 1O0PA 3HJVA 4CF0A 5HRNA 4E1NA 3ATUA 1TKZA 2XHCA 1U48A 1KP6A 1S49A 5KG0A 4ECVA 4DR2J 2GGPA 1FRJA 1VQKN 4FJ8A 1NM2A 1LW2B 2AWZA 3NH0A 2F8EX 5D0GA 1H3DA 1UWBA 2OPQB 1G15A 3PEHA 2ALYB 4OZLA 4OYBA 1S72N 2DGUA 4DU1A 2XTJP 3CJRA 4R8UA 3R97A 1FE4A 1I1GA 2YX7A 1NMDA 2XY6A 3EVOA 2EWSA 2BTFA 2P51A 2DKOB 2MKKA 1WSIA 4JS4A 1HQEA 3QB0A 4Z0UA 5IV4A 3A3NB 3ISZA 4F67A 4OX8A 3AO3A 3PXGa 1YHQN 4NCBA 1KONA 4OLOA 3S8SA 1QLNA 4NB4A 3H5XA 3OS2A 3NRBA 2DHSA 2DFEA 1R8BA 4EAHD 4DU7A 3CJQA 1J5EK 4DV6J 5K20B 1UA0A 5GAHU 2W1BA 3THVA 4IEIA 2HHTA 3H5SA 5AQSA 3KLVA 2E2QA 5GAGI 1ASVA 1EETB 4WIQA 3M6XA 2QLBB 5GAGP 2HMIB 3LWLA 3GL1A 3UNGC 3BKUA 1Q5VA 5IT9U 2ZOGA 3EM1A 2ZH4A 2MZRA 2KJVA 5C12A 1VC5A 1RAOA 1FNOA 2QK9A 1S7HA 5L1IA 3QAEA 3C15B 5KG7A 4B3MK 1TKXA 4RBVA 3CJTA 3IC1A 3FMBA 4RNFA 1RAGB 3J80U 3M6UA 1F9HA 1R59O 2RKIB 2VG5B 3L4IA 1S72S 1XMQF 3FKBA 2FY1A 1QQNA 1YJ9N 1EKEA 1DJ0A 1SBRA 1GLEG 4YP3A 1FRLA 4QYRA 3FFIA 2O8EB 1UVKA 3CJCA 1PO6A 1H72C 5L39A 2GMLA 4OL8A 3EN9A 4K8RA 3W2WB 2E6LA 3Q86A 2P9IB