3KLFA

Crystal structure of wild-type hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
total genus 139
structure length 553
sequence length 553
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klfA05
4OKEA 2XY8A 3QYYA 5CZ2A 5KRTA 1JLBB 4DF4A 2P5GA 2BANA 1YTUA 4DSJA 1JKHB 1U47A 3C6TB 5HP1B 2IAJB 3I5BA 3AA5X 4DQPA 3K5LA 3TQ1A 3NCIA 3NAHA 2C2EA 4CGHA 3HPGA 1KRPA 2QK9A 1KLMB 1RDDA 3NFAA 3FSIA 1JKHA 3HO1A 4ED2A 3RWUA 1JX4A 3KK2A 2ZE2B 3NBPB 3SFUA 4NLXA 4O3RA 3CFPA 4DTUA 3QLHB 3MR6A 1U45A 4BE2A 3ZT1A 5KFIA 4KE5A 4G3IA 3K2PA 1S1TB 4TXSA 4HUGA 1A5XA 1RBTA 1BHLA 1VK0A 3AVGA 2OH2A 4CF9A 3QIOA 2ZD1B 3DLKA 3O4NA 1HMVB 3ZT2A 1NK8A 3PVXA 2IM1A 4CJ3A 1JLCB 4HYKA 4I7FB 3IAYA 1BI4B 3DRPB 4DTMA 2HHWA 1SH0A 1QE1A 1L3UA 2V9WA 4O44A 5C25A 4OPJA 3RR7A 2ALZA 4EZ9A 3P5JA 1JXBA 1JLAA 5EWGA 4OVLA 5L1JA 1HNVA 5KFLA 4RNMA 3RAQA 4C8KA 4J9SA 4TSXA 1QS4A 3ZT3A 1XR6A 2F8TA 4CF2A 4FLUA 2IAJA 2VG7B 4CEAA 4CECA 2WONA 2EX3A 4DL2A 2GBZA 2BR0A 4AHVA 2UVUA 4FLWA 4DSFA 4NZ0A 3RBEA 4IRKA 1NJWA 5KTQA 1S9GA 3ICLA 4EYIB 1YT3A 4KB0A 1T7PA 3PW7A 3HVAA 1KFDA 3IG1A 2HHQA 3HP6A 4I2PA 4OGCA 3TAGA 1QSLA 3PV8A 2HNYB 3NF6A 4FZXC 5KT3A 4WYWA 5KFDA 4KO0B 2OPSA 3OLBA 4PY5A 1KTQA 5CZ1A 4ECQA 2QE5A 2ATLA 2O4IA 1S1VA 3LP2A 2W8KA 4CEQA 1R0AA 1HPZB 4NLYA 2XI2A 4EYHB 3AO4A 1LAVA 1VSKA 5J2PB 5F8MA 4FM1A 4QW9A 4Q44A 4CGIA 1NHUA 4KAZA 1ZTWA 4NCAA 4ZPDA 4QWEA 3RMCA 1L3VA 2ZQBA 5K14A 4FK4A 4GC6A 1NK6A 3DMJB 3L2UA 4M3TA 1NKCA 2VWJA 3H2LA 4NCGA 4WE1A 4CF8A 2OZMA 1TVRB 4QWBA 2DPIA 3H5SA 3NMAA 2YNFB 3DYAA 1K1QA 3DOKB 4XO0A 2HB5A 3NDKA 4FYDA 1S6PA 3H5UA 2YNGA 4RW9B 1BL3A 2RN2A 4Z4CA 1IG9A 4ICLB 3SPYA 1T94A 3QEIA 4KHQA 2XGQA 4Y2AA 1SV5B 5CY4A 2XY6A 4IKAA 4DQSA 1TV6A 2IS3A 3M9MB 3AVFA 3E01A 2J6TA 1BIZA 3ITHA 5HBMB 4YQWA 3DOLB 4CEDA 4FJNA 1SKWA 2XCPA 3HJFA 5EWFA 4J2BA 3QO9B 4O0JA 4YP3A 4F8RA 2OPQB 4Y2CA 2QV6A 2HNDA 3IGVA 4J2DA 5KI6A 5DGBA 4DTOA 4LSNB 3NE6A 4O3QA 1Z4UA 4Q43A 4CJKA 3LANA 4KI6A 4EBCA 2XGPA 4ZTFA 1WSEA 3CDWA 3QEPA 1JLFB 2UVVA 3HK2A 4KHUA 4G1QA 1FKPA 4K4XA 1T8EA 2FBXA 4ZMMA 3P1GA 4AILC 4FJJA 3RAXA 2Q3SA 4FXDA 1HNIA 1Y97A 3V1OA 4FK2A 4ECRA 3SYZA 1RNHA 3BSCA 3QINA 4PWDA 3BGRB 4H8KA 4NYZA 1QAIA 4O4GA 3MR3A 2UVRA 3TANA 3JSMB 3DLRA 1N4LA 5KT7A 2HNDB 3GV5B 3V1QA 2OPQA 1K6YA 2OYQA 3CM5A 1C0TA 4DTJA 2Y1JA 4QPXA 3MXJA 5DQGA 3DOLA 4FJ8A 3AO5A 4B08A 4CJPA 5FRMA 3KK3A 3M8PA 2J6SA 2W42A 2HHTA 4EO6A 3SPZA 3PW5A 5KFFA 3PX6A 4FJMA 4I2QA 1EETA 1C1CA 1CSJA 3IN5A 3C6UA 4CFAA 4CGJA 5F9NA 4BDPA 2B6AB 3LALA 5EWEA 4RW4A 1KLNA 2IDOA 4RW9A 1W9HA 1S6PB 1LWFA 2ITGA 4FM0A 1D1UA 1JLFA 3DOKA 3CYMA 4CF1A 2A1RA 4RUAA 5KT5A 2GV9A 1DTTB 3K5NA 1UA0A 3BR9A 4NCGB 3M8RA 3CJ3A 3LPTA 4BDYA 3KNAA 1S1XB 4WYLA 1GOCA 2P51A 3UPFA 4KHSA 2R2SA 2FBTA 2HHSA 2CKWA 4WZMA 3AVNA 3T1AA 4FBUA 3F73A 2R2UA 4J9QA 1BQMB 3LP0B 4J2AA 3HSTB 4K8ZA 1L3SA 2R2TA 3F9KA 1HPZA 1VRUA 2D0AA 4ECZA 2OA8A 3OYJA 3CJ0A 1T05B 5L1KA 4CJSA 2ASLA 4PQUB 4DL5A 4KO0A 2C2DA 3V9XA 4FLXA 1JLGB 1WSIA 4FM2A 3L3UA 3E01B 1VSHA 3G6VA 2O4GA 4DTPA 1ASUA 4FS1A 3B6PA 4JUZA 2IA6A 3WNGA 4KB7A 1GOAA 2AX0A 4URQU 3U3GA 3RTVA 3RBDA 3V9ZA 4R5PA 1REVA 1F21A 4ZVFA 4E3SA 1C1BA 3ULDA 5KG7A 3TVKA 2Z1IA 2YNIA 4FJIA 3MFIA 4B3OB 2RF2A 1JLEA 1NJYA 3KLGA 1RT2B 1RDAA 1ZTTA 1NJXA 3FFIB 2VG5B 5C25B 4CFDA 2D3ZA 3HPOA 2WHOA 4BACA 1RT7B 4E7HA 3HP9A 3NL0A 1VSJA 4I9LA 4QWDA 3G10A 3MTKA 2W8LA 3LAKA 5DG8A 4MIAA 1QAJA 4F4XA 3LWMA 1I39A 1KHWA 1JLGA 4ZPCA 5FDLA 4CEOA 4PQUA 4M95A 3K5MA 4KI4A 1I3AA 5KFWA 2P1JA 4NYFA 1VRUB 2ZKUA 1MU2B 1GOBA 1BQNB 1NK0A 2W9CA 3V6DB 4DTXA 3SQ2A 3V6KA 5J1EA 1FXXA 2EC0A 4U7CA 1WSFA 3KJVA 3AO2A 1W25A 1S0NA 4W5RA 4JRPA 1RT1B 2AGQA 4E7IA 1D9DA 1YTAA 2BANB 5KT2A 4O44B 1U49A 1LWFB 4M3RA 1RT6B 5KFEA 4Y1CA 1S6QA 3T5HA 4FS2A 4DSKA 3QGIA 3MEEA 1C0UA 1RYRA 3K58A 4GVMA 1LWCB 2KFNA 4TQSA 5KG0A 1B9FA 4DG1A 5KFRA 2E9RX 3FQKA 1ZBUA 4QCLA 1SKSA 3SZ2A 2ZE2A 1U4BA 2WOMA 4DU1A 3NF7A 4FW1A 2X6SA 1RBSA 3ISNC 2HHUA 3MXMA 2KQ2A 1JXLA 4O4GB 3OLAA 3CFOA 4B9VA 3AVBA 4F3OA 4TLRA 3QGGA 2HMIA 4HHTA 4DTNA 2HHXA 4GMJB 3Q8QB 2Z1JA 1QHTA 2G8UA 4H4MA 2VA3A 4QW8A 4BE1A 1FKPB 4G1QB 3MEDA 1D0EA 1HJRA 3DLEB 3AVMA 1RTIB 4CEFA 1S1UB 4AHTA 3UQSA 2B4JA 3DRRB 2IJFA 1WAJA 1ZBHA 2UUWA 4E0DA 2XC9A 2AGPA 1D5AA 4B9NA 3NHGA 1VSEA 4M41A 3TI0A 3VQ7A 2ILZA 1YVFA 3MR5A 1HQEB 1NNDA 4IFVB 4ECSA 4K4UA 1RILA 2BQ3A 4ED6A 4IG0B 3AA4A 1J5OA 4C8OA 1VSFA 5F9LA 4CJLA 3OL9A 3PUFA 1S97A 4E7LA 1NK9A 4OJRA 1RBUA 3CQ8A 4CJFA 2YKMA 4FK0A 2HAIA 2VG6A 3V4IA 1S48A 4RW7B 2YHAA 1TKTB 1LWEA 2BE2A 3O3HA 2EHGA 3KK1B 3MXIA 4Q8EA 4CHQA 4IR1A 3QZ7A 5KFCA 4DF8A 2ATQA 2YHBA 4Z4GA 4DL4A 4ED8A 4CESA 4JV0A 5E41A 4FLTA 5I42B 2VG6B 1LV5A 2YKMB 3IRXA 5HROB 5HRRA 3OYGA 2X78A 4K50A 3BSOA 3U6FA 4ECWA 3UR0A 3RB6A 5C42A 4QWAA 1RT5B 2XY7A 2IC3B 3MEGB 5KG4A 1R0AB 3PR4A 4FJ5A 3VA0A 3SI8A 4RW8A 1IKVA 1HQUA 3CFRA 4IBNA 2HNYA 3WNEA 3LP1A 4CGDA 5C24B 5J1EB 4DFKA 4I2PB 2AJQA 3ZCMA 3V6DA 3KLIA 2W9CB 5I3UB 1MMLA 4N76A 4IFYA 1EXQA 3S3OA 4DLEA 1B92A 3QEXA 4MQ3A 1SL0A 1MU2A 4ZP9A 2QKBA 3SI6A 5KG2A 2G8WA 4F2RA 3L2RA 3HT3A 3CO9A 1RTHA 4IH6A 3OJUA 1ZBFA 1UWBB 4NLRA 3MF5A 2BRLA 2HMIB 2GIQA 2BQRA 3G6YA 3K5OA 4ED7A 3N6MA 4J9MA 4MIBA 3CM6A 4DSIA 4MKAA 4JS4A 2B5JA 2G8VA 4Z4IA 1JL2A 3QIPB 3ZSWA 3THVA 1NOYA 3IGNA 1XWLA 4Z0UA 3OS0A 1RDCA 3BQ0A 4HKQA 4QAGA 2HWHA 1QUVA 1CZBA 1UAXA 2E6LA 4PUOB 4H54A 3BREA 3TAFA 4DFPA 1JLEB 3MECA 1U04A 3KLVA 4CGGA 3DM2B 4B3OA 5DK5A 2C28A 5KG5A 2D5RA 4FJ9A 3H4DA 4KKOA 1CZ9A 4MK8A 1HMVA 1LWCA 1C1AA 4YR3A 1C1BB 1JLQB 1BGXT 4WZQA 1XHZA 4ZP6A 4DTRA 2AX1A 4ED0A 1LW2B 3BDPA 3NKYA 4KHNA 3AVHA 3OYEA 1GX5A 4F4YA 3EYZA 1SUQB 2YKNA 4J9LA 1IKYA 3VQ5A 2FJXA 4ZP8A 1SL2A 5JS1A 1S9EB 1WSJA 5KFYA 3V81A 3OY9A 1KLMA 2E9ZA 4CF0A 1RT1A 4ECVA 1WN7A 1Q9YA 3D0PA 2XY5A 3K59A 3RR8A 2W7PA 3SJJA 1RYSA 3PO5A 4KSEB 2FJVA 4O55A 4CK3A 3EPIA 2C2RA 4TYAA 4RNFA 4WFYA 5KFOA 4RNHA 3C95A 4E89A 3C6TA 5HP1A 1RBVA 4FJHA 2D41A 3TWHA 3Q8SB 3KMSA 1RDBA 2E4LA 1WSHA 4OPKA 2RKIA 4L8RB 4J2EA 1BQNA 4K4YA 2R8HA 3MFHA 3SQ1A 1JLBA 4J9RA 1TL1B 4DEZA 4LSLB 1FK9A 4ZVHA 1XHXA 2D7SA 1ZBLA 1TK8A 1S1XA 1KVBA 4OL8A 1JXEA 1DTTA 1IKXB 1L3TA 4CGFA 2D0CA 1S1WA 4DFMA 3TAPA 2YKNB 5KFBA 2CJQA 4TY9A 3OYAA 1C6VA 3C6UB 2NUBA 3FFIA 3DI6A 2QXFA 4TY8A 2WCXA 1BCOA 4AH9A 3OYNA 4FLVA 3KLGB 4I2QB 2FVQA 2OPPB 3NH0A 5T14A 4NLWA 3KK3B 4MFBB 1D8YA 2WB4A 2IOCA 3ZT0A 4LQ3A 5FRNA 5DLGA 4ECUA 3PW4A 2JEIA 3VQ6A 3B6OA 5J2MB 1LW0A 3CVKA 3V9SA 3N6NA 4O3OA 3L3VA 1W0HA 4CJEA 2G8FA 5KT4A 4U6PA 2W9BA 4XPEA 1VSDA 3JSMA 3QEWA 4LD0A 1X1PA 4PWDB 5KG3A 3L8BA 2DFEA 2F8SA 4CJVA 3QNOA 4C8LA 3H98A 4YFUA 4DLGA 5JS2A 3KHGA 3CDUA 1O1WA 3LDSA 4M3ZA 1KFSA 4IRDA 4O0IA 3P83D 1RTJB 2Z1HA 3SCXA 4FJGA 4Z4HA 4KBIA 2RPIA 1KVCA 3SUQA 1U09A 1BQMA 1TKZB 3LP0A 4DFJA 3KLIB 3PJXA 5DGAA 4FBTA 2F8EX 3CG7A 4DSLA 1RA6A 1RT4A 3LP1B 1OS5A 5DLFA 2FC0A 2FBYA 2HWIA 3G0ZA 4RW8B 3TAMB 3QNNA 3CDEA 4MKBA 1TL3A 4Q5VA 1N5YA 1QSSA 1CXQA 3S3NA 4NLTA 5DMRA 2XWYA 4KPYA 4B9UA 5C42B 4NLUA 2G8HA 3EPGA 4CJUA 1X9WA 4K4WA 4K4SA 3EY1A 4K8XA 4EBEA 4IRCA 5HBMA 3VQBA 3HM9A 1TKXA 5J2NA 3C94A 1TKXB 4ED1A 3M8PB 1N48A 4B9LA 1I6JA 4IH5A 1SL1A 2W9BB 2KW4A 5HRSA 4DMNA 4KFBB 3TAEA 1C0TB 3ZSXA 3AO1A 4ECYA 1ITGA 4RW7A 5C5JA 2HHVA 3SQ0A 3SQ4A 2D0BA 4DL3A 3NF8A 4FJLA 2JC0A 1GX6A 4EBDA 4CFCA 1FKOB 3TAMA 2DY4A 1EKEA 3NGDA 3VQ9A 4PA1A 3I0RA 3SV3A 1WNEA 4WXOA 4DQRA 3DI6B 4IKFA 2X6NA 4KTQA 3I0SB 4EO8A 4DL6A 2XCAA 3Q8RB 4ELVA 4B9SA 5SWMA 1CXUA 1SH3A 4FLYA 2KZZA 2DFFA 3K57A 3BQ2A 4FCYA 3E51A 4URSA 1RAJA 1S1UA 1RTIA 3DLEA 4WFXA 3RMAA 3MEDB 4RZRA 4KTWA 1S9GB 4N5SA 4R8UA 4H4MB 3HVTB 2R8JA 3QO9A 3OYHA 1IM4A 2W9AA 3JYTB 2AQ4A 3WNFA 3BSNA 4E1NA 3M8QB 4J9NA 2R2RA 4MFBA 2FVRA 4KHYA 4TQRA 4MH8A 4I9QA 4OKKA 1BISA 4NLGA 4CJ5A 3QGHA 3KMQA 1TV6B 4HVJA 4ICLA 5KFUA 4YNQA 2FLNA 4CEBA 5EU7A 4KTZA 5EUHA 1IO2A 1BI4A 3RB4A 3LWLA 1S9FA 2JEJA 4CHZA 1JLQA 1TVRA 3AVLA 4E1MA 5D3GA 1ZYQA 2ETJA 3D5MA 3KKSA 4CEZA 3V9UA 3DRSA 3MEEB 3FQLA 4WXWA 1RA7A 1S1TA 3DM2A 4EZ6A 4GW6A 1J54A 3T3FA 4LH5A 1TGOA 3KIOA 3MECB 3OYIA 1TL1A 3NF9A 4Q0BA 3QESA 2FJWA 3NBPA 4HUEA 2RKIB 5J2PA 4Z4FA 1DTQA 3NGYA 3CWJA 3NH2A 3AVIA 1VSMA 1S1VB 4CHOA 1LAWA 1VRTB 4GC7A 3GV7B 3TAQA 4ZTJA 3D45A 3QIPA 4NRUA 5CYQA 4R0EA 3OYFA 2WTFA 4K4VA 3KHLA 3BJYA 3ZSRA 2R8IA 1HYSA 4EP5A 1EP4B 3O3GA 3RMBA 2E6MA 5KFXA 4NLOA 2JGUA 4JV2A 1IKYB 1NJZA 3NAEA 4RU9A 4JV1A 4DQQA 5J2QA 2DPJA 3UDLA 5I3UA 3D28A 4W5QA 1QQCA 1EP4A 3OSNA 4H4OA 1S5JA 3CIZA 2V4RA 4KKOB 3KLEA 3V1RA 2GUIA 4DU4A 4KHMA 3PX0A 1VRTA 1Z25A 4PUOA 3OL6A 1HNVB 3WNHA 3ALYA 2IC3A 3MEGA 4KB1A 1DTQB 3HVWA 4IDKA 3CJ4A 5DQIA 4O3NA 3LZIA 3QZ8A 1ASVA 4URGA 4Q0BB 4CIEA 4E7KA 1RT2A 4DS5A 4ECXA 4AHUA 2RF2B 3KLEB 3GIIA 2YNIB 2W7OA 2ZD1A 3DLKB 3IRXB 3T5KA 5HROA 4AHSA 2XHBA 5D3GB 5KFVA 1KHVA 5KFJA 1REVB 2AWZA 2F96A 3OS2A 4CCHA 2WK4A 4OGEA 3QLHA 4J9OA 3L2WA 1J9AA 1WSGA 3NGIA 5CYMA 3KK2B 4W5TA 4CERA 4UQGA 1HYSB 3OHAA 2G8KA 3QIDA 4F50A 4ZHRA 5CYQB 1IKVB 1HQUB 2QKKA 2I5JB 3H59A 4ED3A 5KFHA 4IR9A 2GC8A 3OL7A 1J5OB 4DL7A 1IH7A 3AA3A 3VQSA 3HL8A 4ELTA 1HQEA 5T7BA 3HXMA 4WFZA 4QWCA 1A5WA 5KFQA 2VWKA 4XIUA 2ILYA 1RTDB 4JRQA 5F8LA 3QETA 5L1IA 1S10A 2KTQA 4CJRA 5I42A 3DDKA 4JLHA 3U3YA 4CIFA 3UIQA 5F8NA 4DWIA 4KREA 1L5UA 3I8DA 5F8IA 4M3YA 3PZPA 4N47A 3ZSVA 2C22A 2HNZA 4MK9A 1IKWB 3L2VA 3TR8A 2BDPA 2FVSA 5KGXA 4RW4B 1NOZA 3KLFB 2B6AA 3SFGA 3HPHA 2WRMA 1KSPA 4C8NA 3VQAA 1C1CB 3GIKA 2JLEA 1NKBA 3KLHA 4DSEA 1XI1A 5KFSA 1S49A 4LQ9A 2FBVA 1FKOA 2PY5A 4ELUA 3I5AA 3H4BA 4Z4EA 4IH7A 4K4TA 3LZJA 4BWMA 3HVTA 4R8UB 3T5LA 4HCCA 3KLFA 3RRGA 4M42A 4M3UA 2OPRB 4RNNA 3AV9A 3TABA 3AVJA 5KFAA 4QOZB 3I5CA 2HNZB 3VQPA 2UVWA 3BGRA 3DLGA 3ZSQA 5L9XA 1WAFA 4FLZA 1XC9A 1RTDA 3CJ5A 2PYJA 1N6QA 3HKWA 3PJWA 4MK7A 2Z1GA 2ASJA 2LSNA 1C2PA 4KHWA 5KG1A 2DFHA 4KV8A 4FJ7A 1N5YB 3GV8B 1TL3B 2JC1A 5JUMA 3AVKA 4EEYA 5FROA 4N41A 3AO3A 5F8HA 2I5JA 2FLPA 3SUPA 5KFGA 4FZYA 4F2SA 3KJVB 5F8JA 2KZMA 4ZHRB 1RT4B 3ZT4A 1HARA 4B9TA 3OSPA 4AHCA 4RUCA 4YR0A 2YV0X 3ZSYA 3KKRA 1A5VA 5KRSA 3PHEA 4DG1B 1Q8IA 1HYZA 4ZPBA 2HVIA 3SUOA 3ITHB 4E19A 3FRZA 4IG3B 4CHYA 4CK2A 2R8KA 1T03A 1C0UB 4OLAA 4NLVA 2J6UA 5KFZA 4F4ZA 4CK1A 1SV5A 3V6HA 3RMDA 3S9HA 4ZPAA 1ZETA 1RT6A 4ZVGA 2I1RA 1T3NA 4F4WA 3IS9A 4ZVEA 4K4ZA 3L2QA 4BDZA 3G6XA 4CHNA 1LW0B 3GIJA 3DYAB 1HYVA 4IDKB 2YNFA 3GIMA 3GILA 5KFNA 1NHVA 1JIHA 4RW6A 4CJQA 1DLOB 2PYLA 4KAIA 2V0NA 3H08A 2OPPA 2HVHA 2JEFA 4DTSA 4TY8B 1TKZA 1EX4A 1X9MA 4X2BA 5DG9A 5HRPA 1TAQA 2V4QA 1X9SA 3VQDA 3LAMA 3VQQA 3V9WA 1RTJA 3LP2B 4ID5A 1S1WB 5SZTA 3ISND 2OPSB 5FDLB 3RRHA 3O3FA 4M94A 2YNHB 2AGOA 3TARA 4IQXA 2IM2A 2HW3A 1T05A 3RB3A 2Y1IA 3OJSA 1RT7A 4FW2A 4LSLA 2VG5A 3HYFA 3PY8A 1TKDA 4E7JA 3VQ8A 1WLJA 3V6JA 4F4KA 1D9FA 3M9OB 1K1SA 2VG7A 4NLSA 4OLBA 2OZSA 4CJTA 1ASWA 3DRSB 1DLOA 2BGGA 4RW6B 4NLPA 1HRHA 4AHRA 1NK7A 1RDRA 3BSAA 3OYLA 4YR2A 5HRNA 3M8SA 3OS1A 3PO4A 1S9EA 4R5PB 3S3MA 1XR5A 5L1LA 3IS9B 1XR7A 1QE1B 1SUQA 1UOCA 2IJNA 5DG7A 4I7FA 3AVCA 4FJKA 2JEGA 1IKXA 3AVAA 1JL1A 1NK5A 4B8CA 3OYBA 3OYKA 2D3UA 3OL8A 3M8QA 3A2FA 1FK9B 4F3TA 3DLBA 1VSIA 3JYTA 5DQHA 3RB0A 2IGIA 1TAUA 4TN2A 3M9NB 1BIUA 1SKRA 3OYMA 2YNHA 5KFTA 1VSLA 3H40A 4O3PA 2R8GA 3V81B 3PW2A 1HNIB 5KFKA 1RTHB 4CHPA 4ID5B 4M3WA 5F8GA 2IMWP 4CFBA 3OYCA 1LW2A 3VA3A 2RDJA 3I0SA 4HTUA 4FVMA 2FLLA 4O5BA 2X74A 1EETB 2GIRA 3I0RB 4DS4A 1ZBIA 3SUNA 4CEEA 1KVAA 3OVNA 2DTUA 3NH1A 4FJXA 3NAIA 4ID1A 3DLGB 4DU3A 4YMEA 1J53A 2UUTA 4EP4A 4KHRA 4HUFA 4JS5A 1TK5A 5EDWA 1NKEA 2PZSA 3Q8PB 2ASDA 1Q9XA 4NLDA 5HLFB 3OYDA 1NK4A 4B8AB 2IM3A 2AU0A 1KCFA 4KFBA 1TP7A 4Q45A 1RT3B 4XPCA 1RBRA 3PX4A 3T19A 4KRFA 3FDSA 4Q8FA 5KFPA 4LY7A 4FZZA 3NGZA 2B5JB 3VQEA 3KLHB 3G86A 4OKJA 1T03B 3BQ1A 3KTQA 4IG3A 1UWBA 2IM0A 4W5OA 5J2NB 1BCMA 3H5YA 3PW0A 4C8MA 4ECTA 4IOBA 1CLQA 1C0MA 2R7YA 4RG8A 4IFYB 4J9KA 3KD1E 4M3XA 1S0OA 3KK1A 3DLHA 4LH4A 5C24A 4W5NA 3V4IB 3AA2A 1TQLA 4O3SA 3VQ4A 4B9MA 3DMJA 4LSNA 3QERA 2FVCA 5K14B 4KV8B 4NYNA 1RT5A 3EZUA 4RNOA 4IG0A 3HVRA 2B43A 4ZP7A 3H5XA 4IFVA 2FVPA 2BRKA 4DQIA 3ASMA 1B9DA 3KOAA 1N6QB 3HHKA 3EZ5A 3KHRA 4HCBA 3OHBA 3O4QA 3GYNA 4CE9A 3ZSOA 5KFMA 3SV4A 1Z26A 3DRRA 1SH2A 2XRIA 2IBKA 4Y3CA 2XI3A 4Y1DA 4O4RA 4TYBA 5CYMB 3LP3A 4BWJA 3T5JA 2YNGB 2OPRA 3VN5A 3MAQA 5J2MA 1LWEB 2BE2B 1YVUA 1TKTA 1WNSA 5KGWA 5KT6A 3SNNA 4WE1B 1QTMA 2WONB 1G15A 3QEVA 5KG6A 4CJWA 3GQCA 4NLQA 4CIGA 1RT3A 2A1SA 4Y34A 2O5DA 1JLAB 3KHHA 5HLFA 1TK0A 2WOMB 1S4FA 2RDIA 4M45A 2XO7A 5JXSA 1QSYA 2E9TA 3LPUA 3DRPA 2BQUA 1IKWA 3KD5E 3VQCA 1JLCA 2VA2A 3CJ2A 3MR2A 4NCBA 2KFZA 3N6LA 1N56A 4CJ4A 1U48A 2G8IA 1UA1A 4H4OB 3ZSZA 1RCHA 4NRTA 1S0MA 3IG1B 3PR5B 4N56A 4BE0A 4J9PA 1S6QB 2P5OA 5J2QB
chains in the Genus database with same CATH superfamily
5HJXA 1X0FA 3HSGA 1FW6A 3DKDA 3FFKB 2BANA 1WOQA 2MZRA 2QEXN 3I5BA 4RPFA 1N34F 3D2WA 1NPKA 4ZLNA 1GLDG 4CGHA 3O2IA 1RDDA 3I56N 3G71N 3FSIA 1JKHA 1YRXA 4C0OC 3Q83A 4ED2A 3RWUA 5IFMA 2KT5A 2ZE2B 5B8HA 1U8SA 1G99A 3ZT1A 4L74A 1NHKL 2HIQA 1UJ5A 2UUBF 4G3IA 4TXSA 4GMKA 1BHLA 1VK0A 3MMAA 4YY3F 3QIOA 1RLDA 2ZD1B 1HMVB 4WCEL 1NK8A 3PVXA 2IM1A 4CJ3A 1JLCB 4HYKA 4P9SA 4UY85 4OI6A 5AQJA 5B0EA 7AT1B 2UV8G 4ZVQB 2GHPA 3RR7A 4EZ9A 4OVLA 5EWGA 5L1JA 4M5DA 3RAQA 4J9SA 4C11B 5HVGA 3ZT3A 1XR6A 2F8TA 1URNA 1X4HA 1E4GT 4IO1A 2IAJA 2WC9A 4CEAA 3CF5L 5KPRA 4H0XB 4DL2A 4CO4A 5AQTA 3RU0A 1YI2S 3OFEA 1NJWA 1F5BA 5KTQA 2H4YB 4EYIB 1EB0A 1T7PA 3HVAA 3PYEA 4BRAA 2LCWA 3BBCA 4OGCA 3MM8B 4DI6A 4I4BA 3PV8A 2R7TA 5CYJA 4L6V3 5HO4A 2WBNA 3OLBA 2OPSA 1VQNS 1RCXB 2H1YA 5CZ1A 2ZFHA 1AFIA 1F5AA 2XI2A 1WC5A 1VSKA 5J2PB 1LAVA 4QW9A 2J4RA 4NXMJ 4UQTA 1ZTWA 4NCAA 1L3VA 2OO4A 4FK4A 1U2VB 1U7LA 5E33A 5A6WA 2OZMA 1TVRB 4QWBA 4OYMA 3WBZA 2DPIA 3B4DA 3BGOP 4JV5J 3DYAA 4TNOA 2AMCB 1P27B 3QBXA 3VGMA 2RN2A 4RW9B 1KAZA 4ICLB 1T94A 4XH1A 2EFOA 2CNLB 4YOYA 2YKAA 4IZ9A 1TV6A 3M9MB 3AVFA 4OPAA 2YVSA 2MZ1A 2KVQE 2XYGB 2J6TA 1YRUA 4BRKA 3EE3A 4CEDA 4ATNA 4BLGA 5EWFA 4O0JA 4DPUA 1JXVA 3EJMA 2OPQB 4Y2CA 1HWJA 2HNDA 3S6EA 4W90B 4ZLLA 4PG4A 2GQ2A 1SJFA 5ETRA 3NE6A 4O3QA 1IVZA 4RBUA 3BUZB 2G0CA 3MPVA 4EBCA 5GADI 3PACA 2HHPA 4ZTFA 1WSEA 2ROPA 3CDWA 3QEPA 3M8YA 3HK2A 1FKPA 3C16A 3P1GA 1JJCB 1YJ7A 2Q3SA 4OJGA 4CLPA 1Y97A 5AQZA 1FNOA 4NWBA 1HNWF 3VZIA 2E20A 4HHHA 2GVZA 1BG3A 1RNHA 3UR3C 3R5JB 4O4GA 1N4LA 4OJ1A 4FF2A 4BR7A 1NDCA 4M1KA 3GV5B 3DCAA 5B0BA 3OTEA 1C0TA 2LDIA 2IYGA 3HJVA 1GTHA 4Y00A 3W9JA 2K7KA 1BA1A 3AO5A 3VZHA 3DHXA 3CJKA 1AZSA 4FJMA 1URRA 3C6UA 3AFGA 2Y3YA 2MLYA 1MROB 1PILA 4WYBA 3C6HA 1W9HA 1S6PB 5HQ8A 1LWFA 4FM0A 1SQFA 4ZVUB 4CF1A 3J80U 4LFAK 1MG7A 1NPRA 2FJEB 3K5NA 1UA0A 2P9SA 2R42A 2K3IA 3LPTA 1OH5A 4WYLA 5D0GA 1GOCA 4WQ4A 3TZYA 4KHSA 1NRKA 3GG1A 1V6HA 5D77A 2DGVA 3AVNA 2H51B 1FT8A 1HBUA 2R2UA 2YXLA 5KPZA 3QJJA 2J7WA 3LP0B 3NGSA 2KJWA 1Y00A 2R2TA 3F9KA 1TFYA 3JSYA 3U8XA 4DCPB 1K8AO 4IO8A 3H0PA 4ECZA 4WP8A 3OYJA 3CJ0A 1T05B 5L1KA 3ZX0A 3VHQA 4DL5A 3AGKA 4FLXA 3W60A 3L3UA 3E01B 3G6VA 1MN7A 1KQSR 4DTPA 2MMYA 3WNGA 2IIRA 4KB7A 2K3KA 4NZ6A 4CWBA 4K25A 1OPZA 2LU1A 3G4SS 2RU9A 4WBFA 2MKHA 2E1ZA 4ZVFA 4CLUA 3D2FA 3ULDA 3TVKA 2UXBJ 1A9NB 3D7EO 3MFIA 3TZXA 4HACA 5CXTA 1JLEA 1X7VA 3KLGA 2DTJA 2NZ4A 1OQ3A 3J80Y 4IOAL 2DNHA 2D3ZA 2CJBA 1VHXA 2OTLS 3PNIA 4BACA 2GVDB 4E7HA 3EN9A 3HFZB 1ATRA 7FD1A 3CMEN 1VSJA 1IBKK 4QWDA 3LDPA 3MTKA 3W0LA 5DG8A 3M2VA 1P8GA 1ZM3A 1RAAB 3W66A 3KG0A 4ZPCA 3JXUA 3C66A 2JVOA 2QXLA 3TR5A 1H6KX 2XMMA 2EFVA 4NYFA 3BF1A 3AD8C 1U0HA 3FGUA 4JNEA 1GOBA 2W9CA 2OFGX 2MQNA 3V6KA 2LECA 5J1EA 4OYXA 1FXXA 1N88A 2E1YA 4WFAL 4U7CA 4FNHA 1R6YA 3AO2A 2JSXA 2AGQA 4ILJA 3GBTA 2LKZA 1VQMS 1DAXA 4I6MA 1U49A 2M0GB 3P38A 3K0JA 4JI7K 3TJ8A 3AA9A 4KC5A 1WEZA 2R7SA 3ILIA 1R0BG 5BR9A 3U7JA 3K89A 4BHQA 1TFWA 4USWA 4BR5A 4OX7A 3NEKA 4JD2B 1FNXH 1B9FA 5A76A 4DG1A 2LFVA 1GLLO 3VEWA 1ZBUA 3SZ2A 4BCAA 1HWLA 4PXCA 1X4BA 3ZZUA 2X6SA 2F40A 1ZBSA 1UJ4A 3ISNC 3OQ2A 5LXYA 1XUPO 3H2VE 2B4UA 1CULA 4F3OA 1VAZA 4AQYK 2CPYA 2HMIA 5LMUJ 3Q8QB 2ASYA 1M5SA 4WF9L 3NOCA 3QPIA 1KOHA 4G1QB 1D0EA 1OYDA 2ZVIA 5E3PA 1FJGF 1RTIB 2BKPA 1S1UB 1YQHA 5GAEU 2IJFA 1IJFB 5AFUA 3MCOA 4E0DA 2ZZMA 3EL2A 3TI0A 2O3DA 1QDUB 3MR5A 1HQEB 1NNDA 2QRRA 3UKUB 2FF3B 4A8OA 4U67Q 2XM3A 3AA4A 4LRCA 3R7BB 3CCTA 4B3SF 4R0JA 4J9VA 3W65A 3OL9A 3CD0A 1NK9A 1YITN 4OI3A 5D4LA 3NGTA 2DGXA 4FK0A 2HAIA 1FJEB 5DZ7A 4QS8A 4DHYA 1LWEA 2FC9A 3MXIA 1JNRB 2P9EA 4CHQA 4CD1A 1HKCA 1HD0A 2UXCK 2WZ1A 2ATQA 4B1ZA 5JVHL 3QATA 3CD6N 5DETA 1DEJA 5HROB 4QYRA 3VGTA 4A48A 3N5FA 2KM8B 4DV4J 4CH1A 2LQ5A 1VQ4S 4LFCK 3V2UC 3LPEA 3RB6A 2RE1A 2PFFB 1ZH5A 1Y5IB 4GY2B 2VOPA 3QMLA 2NR0A 2IC3B 2RUSA 4DV2F 1R0AB 3O6WA 1HR0K 4MLHA 2DNLA 5GIPA 1CQNA 4BR2A 3BKTA 3SI8A 4UT4A 2CQGA 1QJHA 3CFRA 2EG2A 2HNYA 1KDNA 4M5KA 4PKGA 4DFKA 2DHXA 3ZCMA 1NDLA 2LVWA 2IVMA 3V6DA 3KLIA 1D3WA 3T7ZA 1MMLA 4IFYA 1KKHA 5KOWA 3CCJS 4DV0J 4I64A 2V8VA 2QKBA 4OHYA 2ZEJA 1UZDA 2LLZA 5KG2A 2G8WA 3KJQB 3CO9A 1RTHA 4IH6A 4PPDA 2JEIA 2HMIB 1YZ7A 3GCWP 1SPBP 4E2FB 3RVCA 4MKAA 2B5JA 4Z4IA 3UCGA 2L48A 3L4IA 4BRHA 3CGIA 4F9OA 5G0RA 3CUNA 4Z0UA 4O8UA 3THWB 3TPQA 5B0GA 4QAGA 4JI7F 4F26A 1UAXA 4H54A 1O8BA 3Q8VA 3C7NA 2A2CA 2DNYA 4B3OA 2LEPA 2C28A 1WBDA 2D5RA 4MK8A 3VVTA 4PYAA 1BGXT 3EGWB 3NGRA 2BABA 6FDRA 4WZQA 1AB8A 4DTRA 3NKYA 4KHNA 4DR3J 3PM9A 1TMMA 2FJXA 1YAGA 5JS1A 1S9EB 1ROFA 1N33K 1VCTA 3V81A 4ANDA 3OY9A 1Q9YA 2E1RA 4NLCA 2XY5A 3K59A 2UP1A 3CJ1A 5EN1A 3EKUA 3PO5A 5D0HA 4CK3A 1I5OB 3EPIA 5KFOA 4E89A 3OTOF 3EVMA 4K43A 1RGIA 3Q8SB 4YOTA 2RKIA 1UL3A 2MGZA 5JMVA 5LSLA 2MHNA 4LSLB 2IMOA 2XHCA 1U0HB 3CMQA 3W63A 2CNOB 2RQMA 3G2XA 1RAIB 2GZOA 5FPDA 1YJNS 4P75A 2V50A 2GCFA 4OZ3A 4UOFA 4OL8A 1TU0B 2XMVA 1DTTA 3SAFA 3M2VB 1L3TA 1S1WA 2H3GX 2EW9A 3HCXA 1ZOTA 2V6AA 2KRBA 3QT6A 4RWXA 4IUFA 4USVA 2X3DA 2XSJA 3LGNA 3A8EA 3OYNA 2ZVSA 4FLVA 3KLGB 3M7VA 2HHHJ 4ZLJA 2FVQA 2OPPB 3RYLA 4BRQA 3NH0A 4MFBB 2QW9A 4ZDNA 5IWAF 1KD1T 4I68A 4EFAC 1IXKA 4B02A 1LW0A 3CVKA 4NEZA 3N6NA 4O3OA 1W0HA 5E3CA 3PRVA 1R8BA 4DBQA 1VSDA 3I32A 3QB0A 4LD0A 2IJRA 1S99A 3L8BA 5JJBA 3QNOA 4DR3F 4C8LA 3CDUA 3VAMA 4ER8A 4JK7A 3FCHA 4IYQA 3GDQA 1VRQC 2LP4A 2AZ3A 3MD1A 1KQSM 1HR0F 3LP0A 2ZWPA 2ZGYA 1YJUA 3DGPB 3CG7A 1FTCA 5DLFA 2FBYA 2KXFA 3G0ZA 4RW8B 2EPIA 4PG6A 2VZ9A 1TL3A 1N5YA 4IDHA 3CCQN 2XWYA 4DB3A 3LPYA 1VI7A 4B9UA 4P10A 3C46A 2V7ZA 4CJUA 4K4WA 2VV5A 4JI5K 4DR1F 1RAOA 4K4SA 1GEHA 4HR2A 4IRCA 5E0OA 3HT0A 2OUGA 2P6SA 3QMQA 1VS3A 2BKOA 4DR6K 1N48A 3GR1A 4A57A 5A8RB 4MLEA 3MURP 1C0TB 2ZHAA 3ZSXA 2V2KA 3T9NA 4BGAA 2E5LK 2PEHA 3NF8A 3P39A 1YI2N 1PG5B 2CDRB 3TAMA 4DKWA 1IBKJ 4CLKA 2MQQA 3L7PA 4LBIA 2HQIA 4ANEA 2MTLA 1NU4A 2QLFB 2WAQD 4JI6F 1CC7A 4KTQA 2F4FA 2CH5A 3Q8RB 5U47A 1VQ9N 4LF1A 1R31A 3B8HA 1X5TA 3ZNJ1 3HHDA 4FCYA 2OD6A 1WOSA 1Z2LA 3E51A 2GTDA 3ET6A 3UDEA 1RAJA 2GO8A 3EXCX 4RZRA 1NAQA 4N5SA 4B1VA 3D68A 2FY8A 4DUYK 2W9AA 3JYTB 1NLVA 4E1NA 3MPDA 1OSDA 2JH3A 4KHYA 2DBBA 1S72S 4OKKA 1BISA 4F67A 3FLCO 3OUYB 1OQ6A 4KH1B 1TV6B 4LVNP 1R27B 2ASPA 2I0XA 4HVJA 3C14B 2B56A 4JKGB 1AA1B 2Z2LA 1S6OA 5EVZA 2J0WA 4ICLA 4IEIA 2PI5A 2CPHA 3AY0A 4CO5A 1IO2A 4KTZA 3MM5A 2DR8A 3AGRA 3N9UC 2FHJD 4Y28C 1TVRA 3AVLA 3G25A 5IT0A 4PRFA 1M90T 3DRSA 2XEXA 3MEEB 5F0XA 2KDOA 4GW6A 4DV5K 4LH5A 1NH8A 1GXLA 2RILA 1TL1A 3NF9A 4Q0BA 2FJWA 3ETMA 4FNIA 1Q82T 5J2PA 1DTQA 3CWJA 3NH2A 2KYXA 2P8IA 2Y1RI 1RU1A 2ZUAA 3FBEA 1KTVA 4CHOA 4WQ5A 2R7WA 4UZBA 4ZTJA 3I4HX 2K8GA 1X31C 4I6AA 4R0EA 3RBXA 2GJIA 3MM8A 2E6MA 4QZVB 2JGUA 3JAMU 1NJZA 2QWNA 3R6MA 3C3LA 5J2QA 4EAHD 1JWWA 1RU2A 1S5ZA 3QT8A 2E1PA 4ANCA 3OSNA 1VQ6S 4C0HA 3CIZA 3L95X 1NDKA 2QLXA 2BXJA 1OY6A 3H8YA 3IAS9 2F1FA 3J7AP 3NGKA 3J7AN 4PUOA 3OL6A 4TU8A 1KQFB 4I69A 3ALYA 4KB1A 1DTQB 2FSKA 4IDKA 5DQIA 3LDLA 3LZIA 4K59A 1ASVA 3MM9B 4Q0BB 4CIEA 1JJ2M 2F4VK 2G13A 2QLBB 1X8DA 4ECXA 4DR3K 1FJ7A 5EOYA 3R1HA 4JAXA 5MAOA 2YNIB 1VJWA 2W7OA 2CPXA 2ZD1A 3MMAB 4HH1A 4AHSA 4LF8K 4CZLA 1DZ5A 5KFJA 4WF9Q 2V8DA 1RZMA 2WK4A 4OGEA 2VBYA 3BO3A 4J9OA 1WF0A 3CMAS 4IXCA 2HFNA 1TYQB 4DV2J 2RHSB 4ED5A 3G9CA 2R3VA 2RQKA 3QIDA 4F50A 2VD3A 1K8KB 3AB4B 1IKVB 4OI2A 3H59A 3L7OA 5I3QA 2YWGA 3BGFA 2VB6A 4YDDB 1G3OA 1QY7A 5AQGA 1RCOB 1J5OB 4DL7A 2YWWA 2NRWA 2GWJA 2RIJA 4ELTA 1KAYA 1ESVA 2Q43A 3HXMA 4WFZA 2DR5A 3MDFA 5KFQA 5BYQA 3CPWR 2ILYA 1RTDB 4BRLA 3M30B 3QETA 3US5A 3DDKA 1VQ5N 5F8NA 4KREA 4FXVA 4PXBA 3PZPA 4N47A 3ZSVA 1BLUA 3NMUA 2P9PB 5D4OA 1CVJA 1XERA 2VOOA 4YY3J 1S22A 3PYDA 5CHCB 2O8FB 3CCWA 1NOZA 4OZNA 3SFGA 2WRMA 4BREA 1KSPA 4C8NA 1H1VA 3MPYA 1NB2A 4F02A 3OUYA 1CG2A 3KLHA 5ETOA 5KFSA 5HL7Q 4LQ9A 2FBVA 3CB4A 1EAYC 3CCUN 2PY5A 4ELUA 3I5AA 4CZHA 4IH7A 4MAKA 4K4TA 4QIEA 3LZJA 2F9JA 3KWMA 2DGTA 3GMGA 4X4PA 3T5LA 2POKA 4OMFG 4JI0K 1EQMA 2OPRB 3DXBA 1F3VA 5BR8K 4QOZB 3M6VA 4ZVRB 2AD9A 3NVKA 3WIVA 1NGAA 3ZSQA 3ZTOA 1VHIA 3R5CA 1A6LA 1B70B 4FLZA 2W2MP 1RTDA 3CJ5A 1N6QA 1LKZA 1KAXA 2C2NA 5CABA 3NRBA 5D0EA 3HKWA 3PJWA 1TELA 2LQ9A 4MK7A 3DXMB 2R7UA 3HBTA 4KHWA 1RWUA 2B8QA 1M5PC 4KV8A 2CQ3A 4DR7K 4D3HA 1N5YB 1TL3B 2P2CB 3VALA 4DV3F 2YWHA 3AVKA 5FROA 4N41A 5FLXO 3VGLA 3GLJA 4H5TA 4JYAJ 3KJVB 4FYYB 4OZ2A 4B9TA 1OH7A 1VBKA 3KKRA 5KRSA 4K8RA 1Q8IA 1FVQA 5JLFA 4JN4A 2HVIA 3E3XA 2CGKA 4NYPA 1V5VA 1O51A 4USIA 3ZZOA 4CK2A 3CJSA 1C0UB 1FF2A 4NLVA 1FFWB 3D6FB 2ZH8A 3H90A 3IS9A 1GLFO 3GJQB 2M8HA 3K5PA 1LW0B 4IDKB 2YNFA 5F0WA 3GIMA 2CJ9A 1QVFM 2OFHX 1WKKA 4CJQA 4FPIA 2VASA 2PYLA 4KAIA 1AFJA 2QWQA 2V0NA 3H08A 2OPPA 3L4QA 4DTSA 2AEFA 1UTAA 4LF8J 3S41A 1EX4A 2D3O1 3FBFA 4U8YA 4X2BA 3TA1A 1PJ7A 4HVZA 2V4QA 1XC3A 3VQQA 3LP2B 1PJ5A 1S1WB 3OXFA 3ISND 4X4TA 2XZDB 1YKWA 4M94A 3AOBA 3ZX2A 3WHIA 2CQIA 2B9WA 3TARA 4IQXA 2NRRA 4RCHA 4KGZB 5B0FA 4P71A 4QJVA 3H2UB 4LSLA 4ISFA 5THWA 4E7JA 1WLJA 3JSRA 4F4KA 5F3TA 1D9FA 2HS3A 3ZZZA 2VG7A 4NLSA 4DCHA 3U1NA 2DNNA 3DRSB 5J1NA 4OIXA 3BSAA 5AQOA 1XIQA 1S9EA 4R5PB 4NASA 2FDNA 5L1LA 1UOCA 2FD2A 5DG7A 4MYTA 2NRHA 2A41A 4JKGA 1BDGA 2WVEA 3OBYA 3PYFA 3TUIC 2BJ9A 3TX0A 5ELZA 1PAEX 3R9LA 3C7NB 4LF9J 1TZ0A 1BOTO 3JYTA 4JI0F 3FZKA 1TAUA 4C3MA 4AM7A 1Q1KA 3PRDA 1X4EA 5J1PA 2QYCA 2BTFA 1N33F 3IA0A 1Q86T 2XS5A 4JYAK 5AQMA 3F0NA 1SXLA 3ID8A 3ET6B 5KFTA 1VSLA 1H2VZ 2MJNA 4O3PA 3V81B 4DV6J 4H5NA 1VLOA 1RTHB 1U2RA 2U2FA 2PO4A 2HFZA 2GUPA 4N77A 4O5BA 3GYGA 1EETB 4RJVA 2GIRA 4C7QA 3EVWA 1GLJO 5AXLA 4CEEA 4DR7J 2DTUA 4FJXA 3CDAA 4DU3A 4OX9K 4IWVA 4HUFA 1TK5A 4QU6A 1RWWB 1NNEA 4C97A 3JAMY 4KRFA 3GJRB 2B5JB 2ZBRA 1T03B 3BQ1A 2BW2A 2IVNA 4W5OA 4DX8H 4KHPF 2R7QA 4IOBA 1CLQA 2BBEA 1HHTP 3NWGA 2XULA 4IFYB 4J9KA 2QMUB 4AQYJ 3KD1E 1FXRA 4Y2IA 2MY8A 2VFVA 1SQKA 1LOUA 4JI8K 2R7OA 4JI8J 3CXCM 4W5NA 3AA2A 1RXOB 4LIWA 5L9NA 1Y64A 2HBJA 4FYXB 3DMJA 1TUVA 2EK1A 3BKFA 4LSNA 3R8YA 2FVCA 2VQEK 5EGYA 2CZVC 2EBGA 3EZUA 3NXZA 3LL3A 3AT1B 2DPNA 4ZP7A 2F8MA 4KH5A 2FVPA 4DQIA 1WUAA 3ASMA 1HIYA 4DR5J 3HHKA 1VQMN 2C2MB 3M1VB 3ISZA 3ZSOA 3WIUA 1VGYA 1Z26A 2N4CA 4ZCIA 2HRTA 2FC8A 2XI3A 1FRXA 4O4RA 4TYBA 1FWLA 3LP3A 2QLJB 4DUZJ 1T9XA 3MAQA 2ZJPQ 1FFSB 4K42A 1LWEB 5KT6A 1K73T 3SNNA 3O9UA 1G15A 2WVDA 1RHJB 3EEQA 1T3VA 3GQCA 4CLFA 1YITS 4NLQA 4RR5A 2PEBA 1T9UA 2XSJB 4Y34A 2M8DB 3RGIA 2A40A 5SUHA 3BDEA 3LPUA 3CCMN 2HZCA 3OW2R 4LMZA 4JD2A 3CD6S 5BYRA 2VA2A 5DM7Q 3N6LA 2G8IA 4QR1A 1UFWA 4CVNE 2OD4A 3WEEA 4J9PA 1F60B 4BG9A 2MQOA 1LK7A 3QYYA 5KRTA 3TTDA 5IXUA 4NXMK 1JB0C 3G87A 4FWRA 1YTUA 2CWKA 4M8LA 5I3PA 4DSJA 5AQNA 1C0FA 3AA5X 4DQPA 3K5LA 3NCIA 2ZJQL 2OTJS 4JI3J 2QK9A 3AB2B 1FTRA 3H1VX 3NFAA 3VETA 3HO1A 3R97A 1MMNA 1JX4A 3SFUA 2RQ4A 1QVGM 4IFEA 3CFPA 4DTUA 3CCJN 2DH7A 3K2YA 1U45A 3X1LB 4DV7K 3Q2SC 2KKHA 3WEEB 1HLWA 5HATA 1DHMA 4UW2A 2YCHA 1RBTA 3TUZC 3DLKA 2HQGA 5LMUF 3BZCA 3ZT2A 5KPTA 1FI4A 1BI4B 2EXUA 4L3NA 4DTMA 1SH0A 4DR2F 4DPWA 2UXBF 4I6MB 3PRBA 2VKRA 4GV3A 1JXBA 3MZIA 2EKNA 1NGDA 4FWLA 4WFAQ 5KFLA 3THWA 2R7VA 4TSXA 3FBBA 3UDVA 1BO5O 1XNRF 4CF2A 2HWTA 2CZ4A 4FLUA 2VG7B 2CIMA 2UZAA 1HLUA 4CECA 4YS2A 1RSCA 2W7AA 4M5HA 1RISA 2UVUA 2B7BB 5EXWA 2X1AA 4NZ0A 3RBEA 1NMNA 2B7CB 2N7YA 1FWPA 4A8KA 1VC5A 1YT3A 3PW7A 2GV1A 1KFDA 3EDQB 3CEDA 1S79A 2OP5A 2HNYB 1SC4B 2KKZA 3NF6A 4YB5A 3P31A 3ENQA 4DV4F 5H1SQ 1M5HA 2VBXA 3O3LA 4LFCF 3M1VA 2ATLA 1S1VA 3LP2A 3ONQA 2W8KA 4CEQA 1R0AA 4NLYA 4EYHB 4BRPA 2E1MC 4FM1A 1DFDA 1DQAA 1ZXOA 4Q44A 4CGIA 2QG9B 2V52B 5BRDA 4WJBA 3GZ7A 5C2DA 1QUPA 2NXNA 1YJNN 3DMJB 4KHPK 3L2UA 2QMXA 3ILLA 1KVIA 2IVPA 2HFSA 4CF8A 5F3ZA 5E84A 2YNFB 2CH6A 2KLAA 4DU8A 1K1QA 3M05A 2C3MA 2ZNZA 3SMPA 3A5OC 3NDKA 1OY8A 4FYDA 1S6PA 2PMZD 3SPYA 1X4DA 3QEIA 4OHWA 5BJRA 3F41A 4Y2AA 5CY4A 1T3OA 5DS7A 1FESA 2UYTA 4DQSA 4LR8A 5AQPA 1H2UX 1XN9A 3E01A 2OEKA 5IT9O 1UETA 2M5YA 5HBMB 4CD3A 4EIAA 3BKUA 4BG8A 2KM8C 3AOCA 1LXJA 2ZM6F 2EG1A 1H7WA 3PCOB 1NG9A 1GTEA 2GELA 4YP3A 1N33J 1HBUB 4GVBB 1WG1A 4DTOA 4LSNB 3IR6B 4UY8O 4Q43A 4DDFA 2BOPA 4CJKA 3LANA 1VC0A 2Q97A 2UUBK 4KRWA 4DOZA 2K2PA 2UVVA 4KHUA 4G1QA 4LF5F 4DUYF 2P9NA 4K4XA 4JKCA 4FPAA 1MROA 4CZMA 5KQ8A 3HFVA 1AT1B 3KUEA 3UDCA 1N36K 3FC9A 2E29A 1VBZA 1IBLF 1NSQA 3V1OA 4FK2A 4ZN3A 1V3SA 2Q3PA 3QINA 4PWDA 3D1HA 3MR3A 2UVRA 4N8OA 3DLRA 3GWCA 3ILJA 2HNDB 1B0TA 4ILHA 2OPQA 1UVMA 1K6YA 3CM5A 3VTIA 4JI4K 3JTNA 4GNIA 4DTJA 4W92B 1ZA1B 5DQGA 2GO9A 2MQPA 4LIRA 2KL8A 1BWFO 4ED4A 3KK3A 1K47A 3Q7BA 2HHTA 3SPZA 2OKQA 1EETA 4F3QA 1VYAA 2UXBK 3LALA 3SEOA 4RW9A 1TL7A 1FERA 4ILGB 1D1UA 1YXQA 3TP2A 4XH4A 3O9QA 3BGUA 2WFBA 2RSQA 3AOAA 3CJ3A 4BDYA 2P51A 3M30A 2ZM6J 2FBTA 4CLLA 2WBRA 4WZMA 3PFOA 3NY0A 2QMWA 2QT7A 4DV7F 5E3AA 2ZH6A 1VQ9S 3ZETA 3GSIA 3SCIE 3WZ0A 2OA8A 4CJSA 2ASLA 5HQMA 2C2DA 1XNQF 3V9XA 1WSIA 1FA0A 2LQBA 4DL0C 2O4GA 4FS1A 4DV0F 2EC2A 4JUZA 1HNXF 4KH0B 5D78A 4URQU 4ES2A 3U3GA 4K2XA 3RBDA 3N4WA 2RHKA 3GYXB 3UN3A 4R5PA 1FRIA 4PR6A 1J5EJ 1KC8T 1F21A 3CJRA 4NI2B 4E3SA 3W2WA 3Q89A 1B7YB 3HHEA 5KG7A 2Z1IA 2YNIA 4FJIA 4WWSA 1S72N 5AJ3K 4MO4A 4C0BA 3SBMA 2RDDA 1ZTTA 2OMLA 1APSA 2Z56B 5LMNK 3CQXA 3MI7X 2FGOA 3NL0A 5ADXH 4G65A 4BY9C 3G10A 2W8LA 1N32K 4DR6F 4MIAA 3T69A 1KHWA 3SLCA 2ERRA 1JNZB 4GKJJ 3P4IA 3K5MA 4KI4A 4WIIA 5GAHI 4DXLA 2P1JA 2CQCA 1BE4A 1MU2B 2Z8QA 2Z2YB 2G1DA 1BQNB 3B54A 3FCWA 4DTXA 5AFUH 2XS2A 2EC0A 1WSFA 2DHAA 3TZWA 4KGXB 3KJVA 2I6WA 4H4KC 4ILLA 1S0NA 4W5RA 4C11A 1D4XA 4E7IA 2P9SB 4I56A 2QFIA 4QR2A 1YTAA 2BANB 4B3TJ 3DXMA 1LWFB 4KPCA 4M3RA 1NUEA 4Y1CA 2MKCA 5KOXA 3T5HA 2HFUA 2MJUA 4FS2A 4Z37A 3QGIA 3MEEA 1C0UA 5C7PA 3I33A 2FYXA 4TQSA 3I8BA 2CNNB 2EKYA 5B0CA 5DDPC 4H0VB 5KFRA 3R2DJ 4LRAA 2KG0A 3FSXA 2W41A 1HNZJ 2ZE2A 4CZCA 2E5LF 4DU1A 5BR8F 2DY9A 2H5IB 3OXLA 4FW1A 3ZLJA 2RNEA 4Q2LA 2ZH5A 2NZCA 2HHUA 4FXWA 4O4GB 4NPOA 3T1HF 4B9VA 1U1NA 4JBCA 3AVBA 2HPUA 1SBRA 4DTNA 3NP5A 1HI8A 2Z1JA 4QIWD 2O8FA 3CMAN 2DIVA 1FKPB 3C16B 1Q79A 3PEHA 2UV8A 2P9PA 3K0SA 1QLNA 2B4JA 3DRRB 2RUGA 1X0PA 2XC9A 2AGPA 1D5AA 3O4WA 4B9NA 1VSEA 4M41A 3VQ7A 2PDAA 3P96A 2AP1A 2ILZA 3WXKA 1YVFA 1UP1A 1BQXA 1SQEA 4ECSA 2Q1NA 1WB9A 1YG0A 2WSFC 1RILA 1K9MO 1EJ7L 2HAFA 1J5OA 4USMA 2PT0A 5F9LA 2ZJRQ 1P1LA 4BBYA 5K9FA 3ULEA 3PUFA 1RBUA 3O5BA 4ISGA 3UCZP 3ENBA 3AD9C 4JHDA 1VQ5S 2VG6A 3V4IA 1S48A 3J81Y 1ITPA 2QA4S 4GO7X 3KK1B 4FF3A 3A13A 1NU0A 5A8RA 1WC0A 2VFUA 2DGUA 2YHBA 3G8TA 4Z4GA 4DL4A 3RSEA 4ED8A 4JV0A 4PL8A 1MN9A 4FLTA 1SVDA 2V4JA 2HOEA 4HEA9 1NB7A 1NGEA 4MKVA 3NGUA 4P2SA 1RT5B 4LSZB 3R3LA 3MCNA 4BRMA 2CJAA 3P5TL 4FJ5A 1UWAA 2EI5A 5FPNA 4JI8F 4RW8A 1IKVA 1VC6A 3TSPA 4U95A 1VQ7S 4LF5J 4KY3A 4B9QA 1A0OB 4HWIA 5B09A 4N76A 1EXQA 4BC2A 4USHA 1MU2A 3SI6A 3MUTP 1NSKL 9RUBA 2WTUA 3OJUA 4DR5F 1ZBFA 4NLRA 4CBWA 3MF5A 2GIQA 3K5OA 3N6MA 4J9MA 4DSIA 5ADXA 3CC4S 4M63C 1PYOB 2G8VA 2V8PA 1JL2A 3AH6A 2EEYA 2E2NA 3EWGA 4ILMA 3OS0A 2MEWA 3QFUA 3BQ0A 1L3KA 1NPPA 2XZWA 3OR2B 4O23A 4PUOB 4LT6A 3KLVA 5BPNA 3DJCA 1RQ0A 1RWPB 1HMVA 2OEMA 4M5NA 1C1AA 1Q7YT 2MKSA 2N3OA 6FD1A 4A5AA 1FRMA 1P6TA 3MOZA 4NI2A 3A8IA 1BY9A 4ZP6A 3QRRA 2AX1A 3MWTA 3BDPA 2HBRB 1K0VA 3OYEA 1RWOB 1GX5A 3JQMA 3EYZA 3J7Z5 5GAGU 3VQ5A 4H0PA 3MAAA 3D0GE 2VU5A 3C14A 3VEXA 3I9V9 3TO8A 1RT1A 2W4PA 1WN7A 4W4MA 2W7PA 3OW2M 3SJJA 1RYSA 3VEOA 2FJVA 3SCLE 4TYAA 4RNFA 4WFYA 3C95A 4IOCQ 1NLKL 2NPIA 5GAGI 2VQEJ 3UE5A 4J2EA 4L8RB 2MGZB 3MFHA 2JWLA 3J7YU 1TL1B 2MKKA 4ZVHA 5FIIA 3QT5A 3VEZA 1ZBLA 2YH1A 1VK8A 4G6VB 1YJ9S 3CD5A 1GLBG 2A2DA 2V69A 4PXEA 2WVFA 1DT9A 2OANA 4EFHA 1NM2A 4U9RA 4CGFA 4EU0A 3FZFA 1I51B 2C1EB 2LU2A 4G1PA 3NMRA 3MCMA 1N5TA 2AJ1A 1BCOA 2N4DA 4AH9A 4GV9A 4YDXA 4FWKA 2CZ9A 4IO9L 2Y1LB 1R7IA 2QA4G 3PTWA 2X51A 4NLWA 3KK3B 2DR9A 1D8YA 1RWVB 2IOCA 1B0VA 4WP9A 1RHUB 4LQ3A 1H98A 2Q6BA 4B1XB 3ADAC 2DXDA 1Q16B 5DLGA 3DC2A 5HVHA 3AXMA 1IQZA 3B6OA 5J2MB 4PKIA 2RS8A 2I9SA 3UCUP 4A47A 3NWRA 5KT4A 5AQVA 2GFFA 4XPEA 1YJVA 1M5KC 5M1OA 5DRKA 4PWDB 5KG3A 4FP9A 2DFEA 2R9LA 4WP3A 2F8SA 3ENVA 4CJVA 3D3BJ 3CT9A 1U1KA 4DLGA 4YFUA 5JS2A 1SQGA 2V2ZA 2MKJA 3KHGA 1JCGA 4H5VA 1O1WA 4M3ZA 2XQCA 4O0IA 2VF3A 2JWKA 5GAHU 1KVCA 2RPIA 2DITA 2P9NB 3I82A 1U09A 4DV2K 3LGMA 4DFJA 3KLIB 2UUBJ 2Q66A 3EX7B 1NH7A 2JX2A 2VICA 3CCRS 3E9PA 1PC4A 1E3MA 1OS5A 2HWIA 4JI5J 3TAMB 4HDHA 2WW4A 5A8WB 4DV1F 4CLSA 4Q5VA 1FDBA 3CJ7A 2G2ZA 5DMRA 2QWPA 3GSDA 3IAM9 4B3TK 2E1AA 4K5RA 4NLUA 3IR5B 3P45B 1OO0B 4OX6A 1ZM4A 5HBMA 3VQBA 3QFWA 2E2OA 3BBFA 2NYHA 2OI2A 5LSRA 4QOTA 3M8PB 4B9LA 1I6JA 4IH5A 2KW4A 3TAEA 5LJVA 3AO1A 3OTOJ 4CM2A 4FO0A 4RWWA 4ECYA 4DPXA 4BRDA 5C5JA 2VPZB 3SQ0A 2JC0A 1FKOB 2UUCF 2A10A 1WDTA 4LF9K 1FRLA 3NGDA 3DGPA 3AXKA 3DU5A 4KH6A 4C9DA 1E6YA 4PA1A 3I0RA 5IT9Y 3DAWA 2O66A 4WXOA 1DBDA 4DQRA 1FCAA 3EO3A 2XMAA 4EO8A 3BO2A 2XCAA 5SWMA 1CXUA 2ZNYA 5AQWA 1ATNA 2KZZA 3F5TA 1FEEA 4ZVTB 2HLUA 1S1UA 5AXMA 1RTIA 3FRYA 1XK8A 2HBYB 5M1KA 2K1RA 4KTWA 2HGLA 3I6PA 4R8UA 1BWEA 3HVTB 2XG8A 3OYHA 1RLCL 1Z05A 3WNFA 3BSNA 3SK3A 3M8QB 4J9NA 2R2RA 2HBQB 3LH2S 1RHRB 4MFBA 2FVRA 3W7BA 5A8KA 2F5GA 2BM1A 3T9ZA 2QL5B 4CLTA 1CBKA 4CJ5A 3QGHA 2GMHA 3G6EN 4AL7A 1V3ZA 3CHWA 1AROP 1RFQA 1X5SA 1GMUA 4YNQA 3MHYA 3C19A 5AT1B 5EUHA 1BI4A 3LWLA 3RB4A 1S9FA 2V94A 1X60A 4CO1A 2JEJA 4F0MA 5HANA 2J8SA 5I9EB 1Y11A 2AHOB 1MSWD 1O0PA 1Q81O 2X1FA 3KKSA 4CEZA 1NBWA 1WF2A 4WXWA 1RA7A 4EZ6A 3L3CA 1HJOA 3KIOA 4FWPA 3OYIA 1R8PA 2RKIB 2PC6A 3NGYA 5M1NA 4P6QA 2XMJA 3SQOP 1NO8A 5G0RB 1LAWA 4GC7A 4DR1K 2HIYA 2BE7D 2XSFA 2WTFA 4K4VA 1VQ8N 2WVBA 3ZSRA 2O8DB 3E9LA 1HYSA 1RAHB 8RUCA 2B4VA 3RMBA 3SMZA 1ACMB 5KFXA 3GG0A 4HT5A 1M1HA 3CXCR 3HX9A 3QSYB 3GFHA 1RHMB 4FSVA 1WF1A 2KFYA 2AYGA 1EP4A 2CPEA 4P2FA 3MN6A 1S5JA 2V4RA 3V1RA 5ETQA 3PHTA 4DU4A 3PX0A 1VRTA 2CJKA 2UXCJ 4HI2A 2YQ1A 4JI1F 1HNVB 3T1HJ 2IC3A 3HVWA 2W4CA 2KN4A 3QZ8A 2DGQA 4URGA 4E7KA 1X9JA 4DS5A 3RAMA 2IBOA 2VYPA 1FE4A 4DX7A 4OZLA 1VQYA 2DY1A 3KLEB 3D1OA 2A6AA 2CGLA 4CLWA 2GJFA 5HROA 3T5KA 4ZJQA 4P7VA 2DCLA 4NXNJ 1N52B 5HI7A 1KHVA 4J91A 3CCMS 2V8GA 2UXCF 3W1YC 3OS2A 1BA0A 3GB0A 3MM6B 3NGIA 1N0UA 3CIMA 3KK2B 2W2OP 5GAEI 1AXQA 2JJ4D 2G8KA 2PA3A 2E5HA 5IZHA 2VHGA 2H4WB 2XS7A 4UUWA 2VQEF 3U1MA 3C6AA 1W2IA 4ED3A 1CEZA 1PBUA 3VERA 4UY8T 2CRLA 4IR9A 1P1TA 3FZHA 2CAJA 3KVGA 1D09B 2H5JB 1HW9A 5M2PA 2BJ3A 4JK8A 4BGBA 3UKUA 3AA3A 2AIRB 4CO2A 3HL8A 1Y3JA 1HQEA 1OJ4A 2C3PA 5ITHA 2Q36A 4QWCA 3JB9k 4A61A 4CBUA 1A5WA 1VQ6N 3MGJA 4IQMA 3MMBA 1SJRA 4JRQA 3CCSN 1M5VC 2LXUA 1S10A 3PJ9A 1Q5YA 4CJRA 2QFJA 3SCJE 1Y9OA 2ITMA 1FNMA 4QS9A 4OYZA 1I1GA 4WQ5C 3L2VA 1VDHA 3SXLA 2YWEA 3R5DA 3W5YA 3VQAA 1REGX 5F41A 3GIKA 2D0PA 3EGNA 4DSEA 3CJKB 2BACA 3ZTQA 3HMJG 5IS2A 2Z0GA 2VGNA 1ZPWX 4M42A 4RNNA 2NXCA 4MT1A 3TYTA 1HKGA 2HNZB 3VQPA 1T44A 2N82B 4CZEA 2GVZB 1FRKA 2MQ8A 2QA2A 1WSVA 1XC9A 1WG5A 1FX4A 2PYJA 2XTJP 4OYIA 2YX7A 5G4DA 4HTJA 4OI4A 4A8FA 3LF0A 2BZ2A 4CM0A 3F56A 4KH4A 1C2PA 4BRIA 1DKGD 1CULB 2XMUA 4A8XA 4DV0K 1HNXK 5F8HA 5DDOC 4FZYA 3O1LA 1AUSL 4HI1A 2KZMA 4ZHRB 1RT4B 3OSPA 4WPAA 4AHCA 1LOTB 2HS4A 4RUCA 2EFGA 2W2NP 2IVOA 2AJFE 7FDRA 4JI2K 4DG1B 3HHLC 1HKBA 4YY3K 1HYZA 2I8EA 3UE2A 2WW8A 4ZPBA 2LYVA 3SUOA 2G0IA 2A6OA 2XMKA 4IG3B 2VWBA 3UN2A 4H5WA 1QAXA 4D3GA 4OLAA 2J6UA 4TU9A 4CK1A 1WC3A 3PG9A 3JQKA 3S9HA 2APOA 3TOQA 4CNZA 2I1RA 1T3NA 4F4WA 4BDZA 2GS8A 3DYAB 1HYVA 4K0KK 2DNPA 4Q7AA 2OHDA 4B3SJ 3CCES 5A2QO 4ZCKA 1VMBA 2G0JA 2FF6A 1JIHA 1V5IB 2G1HA 4E8UA 1B4SA 3IWXA 5GVQA 4LF8F 4DV5J 1YBAA 4TVAB 2KXHA 3HOSA 1AW0A 3H7HB 4Z94A 1F9FA 1IBMF 1LQ9A 5DG9A 3EGVA 1X9SA 3BF4A 1RTJA 2YPYA 3O9TA 4ID5A 3NCQA 2NPFA 3B78A 2OPSB 4BC4A 1OYEA 3RRHA 2XHWA 3UD5A 2XWXA 3UI3A 2OLWA 3N0VA 1T05A 1YSJA 2Y1IA 3DRXA 2JLGA 3Q2TC 2GVDA 4AXJA 2ACMA 4X62J 1VJQA 3HYFA 4JOUA 1VK3A 4PL7A 4PHTX 3ZEUB 2RVJA 2BKNA 1YX2A 4P7TA 4QBUA 4HACB 5CHIA 1ASWA 3PXGa 5AE1A 4AHRA 3KG4A 2VDHA 3OYLA 3EICA 4C4WA 4JI5F 3IR7B 3IS9B 1SUQA 3GPAA 1N36F 4JKAA 5IQ6A 3AVCA 4M5JA 3AVAA 1JL1A 3AA8A 1NK5A 1RE1B 1RK8A 3OYBA 4PYDA 3FZ2A 2F9WA 5AQSA 2D3UA 3MDQA 4NX9A 4YDUA 2XNQA 4F3TA 4ZITA 1Q53A 3OHRA 5DQHA 3IFEA 3RB0A 2IGIA 3HI9A 3SCKE 5M1QA 1VQ7N 2C3YA 1WTBA 3C2PA 2DB1A 2MB0B 2HSEB 4LF7F 1ZPVA 4LF4K 1S7IA 1H2TZ 3OYMA 9ATCB 5IT9U 2F63A 4YOXA 2YNHA 4AE5A 4DPOA 2VIHA 3PW2A 4LF5K 3AJDA 1PIEA 1GLCG 3CC7S 1U1QA 1UEVA 4CHPA 5F8GA 4I6WA 4AUKA 3R7NB 2IMWP 4CFBA 4BQLA 3D54A 1LW2A 3VA3A 3DXKB 4DR7F 1H7XA 2MPUA 5HMZA 3CERA 2X74A 2J7UA 4IJAA 3IXQA 4DS4A 2NUUG 1ZBIA 3AAPA 4F4AA 3NAIA 3EGZA 2XMWA 4NMLA 2NXJA 4JS5A 5B08A 4WFBQ 2PZSA 3Q8PB 1IWGA 4USJC 5GAGP 5HLFB 2GEMA 2IM3A 1R6VA 3WT0A 2J76E 2P5VA 1KQGB 4PKHA 3PX4A 4OJHA 3T19A 1XNQJ 5KFPA 3IBWA 3NGZA 3R5BA 5CA5A 2CPIA 4PZVA 2CGJA 3KLHB 4OKJA 1NMEB 3TZZA 3M2RA 3PIPL 1BCMA 3VWSA 2QWMA 2R7XA 3HI0A 1C0MA 2R7YA 5K5MA 1S0OA 2N7CA 2YJFA 3UW1A 3JSBA 4F36A 3LM2A 3ZTRA 4O3SA 4V19J 3A5LC 2VQFK 4BRFA 4RWTA 4J9UE 2DHHA 4NA2A 2LA6A 1TUUA 2QWRA 4RNOA 4ZA1A 1RHQB 2B43A 4FKXA 4IFVA 1IBKF 2DH9A 2W24A 2XLIA 3GYNA 1ZM9A 5KFMA 1LXNA 1K8KA 3WQUA 3QFPA 1VQKS 4OI1A 2Q31A 4MJKA 3R5AA 1AUDA 5CQGA 1VQPS 4DQ8A 3HSDA 4DUZK 1TYQA 3F9MA 3VF6A 3T5JA 2ZJRL 4ISEA 5AR0A 2UUCJ 1HA1A 1YVUA 1EWQA 3GE1A 1WNSA 5KGWA 1QTMA 2MYFA 5LL6d 1J6ZA 3QEVA 4CJWA 1DY3A 3RBZA 1U2VA 4IOXA 2ZITA 5IC4B 4EK2A 4CIGA 1RT3A 2YWKA 2V9KA 1G4CA 3MM9A 2O5DA 3M1FA 1WTFA 3M6XA 2WOMB 3GFYA 2RDIA 2QO3A 3MCSA 2XO7A 5JXSA 1GK8A 2BJ7A 2Q0RA 3VVUA 2E9TA 1IKWA 1RKJA 3SAHA 2QN6B 2L9DA 3K17A 3VQCA 4GKKF 1JLCA 4OZJA 3QQCD 3CJ2A 3MR2A 1GLEG 4HTIA 1FDAA 4CJ4A 2QIFA 1PYTA 1U48A 3I4PA 1GNKA 1RCHA 1S0MA 2VGMA 3CCRN 1SJ4P 2HVZA 4N56A 1YJRA 2XBPA 4E98A 1S6QB 5J2QB 4OKEA 4DZDA 1JLBB 2P5GA 1UVLA 2WVCA 1JKHB 5HP1B 4YOVA 2IAJB 1S4EA 1HR0J 3TQ1A 5F2RA 2X1GA 4AQYF 3WXJA 4OV6A 4RUBA 3CCLN 2C2EA 3R8EA 1Q78A 3O6QA 5DZ6A 3HPGA 1KLMB 3OFHA 4M5DB 3VGSA 3Q8UA 1BUPA 3R6GB 1U1PA 3X3UA 4NLXA 4QPTA 3QLHB 5AQIA 4YOWA 2LXFA 3MR6A 4BE2A 2QA4N 4UOCA 3K2PA 3CE8A 1A5XA 4ZJOA 1JMTA 3G4SN 3AVGA 2OH2A 4CF9A 3P4UB 4MDBA 3O4NA 2RS2A 3IWNC 3KK7A 2I7NA 2DNMA 3IAYA 5KAKA 2XO6A 3MM5B 3U02A 1S76D 3HHLA 4C1NK 2V9WA 3IMXA 3CC2N 1BHNA 3VAHA 2YX6A 2ALZA 2KB2A 3P5JA 2FGCA 4F3MA 1JLAA 2D69A 1EQ0A 2EBEA 3OFFA 4NXNK 1RI7A 4DMZA 3WQTA 5BXIA 2Y0SD 4C8KA 2V63A 1WC6A 1QS4A 5A0YB 2GIFA 4ZLPA 2D1KA 5AQQA 2VJVA 2WONA 2EX3A 3O8MA 2UUAF 3D6HB 1YJWN 2GBZA 2BR0A 2CA9A 4RLEA 3OVBA 2O8BB 4PG5A 4IRKA 3BN7A 5BPMA 4YN3B 4KB0A 3DRYA 1NGIA 2HHQA 3IG1A 1M1KO 3SDEB 1RTZA 1U26A 4FZXC 5KT3A 4WYWA 5EX0A 4KO0B 3JQJA 5KFDA 4ECQA 4F7VA 2PE8A 5TKWA 1TL4A 4RX6A 1Y5LB 3AO4A 2KHOA 4X4VA 3WUHA 5D0RA 4KAZA 1X5PA 4ZPDA 3G6ES 5GIOA 4GC6A 4CYUB 4M3TA 5AZIB 2HQ3A 2NSCA 2YY3A 2E2PA 3DOKB 4IJNA 5LJ5Y 2HB5A 5LMNJ 3R1XA 2VBZA 3H5UA 2B8PA 1H3DA 1IUJA 1IN0A 2J0QD 2XY6A 4IKAA 3UVJA 4YUDA 2IS3A 3CD7A 2RMLA 1FJGJ 2P9KB 4LJMA 1U0SA 3ITHA 2ZBCA 5MLCQ 5BR8J 4B1YB 2XZTB 4A8QA 1J2VA 3B6BA 5EHHA 1SKWA 4CBXA 4JI3F 3HJFA 3QO9B 2RHQB 2VL1A 1N8RO 3OPKA 2LQJA 1RBOB 3IGVA 4X64J 5DGBA 3A8KA 1Z4UA 3W2VB 2V7YA 4ZIWA 3FEXB 3EZOA 1T9YA 2L9NA 4KI6A 3DN9A 3LW5C 3U9DA 5E3RA 1HKAA 3DOMA 1JLFB 5AZJA 2RRBA 1HBOB 3UNGC 1NCLA 1T8EA 3UD4P 3R9PA 4ZMMA 4DR5K 3DU6A 2JFKA 4HH0A 1KD1O 4AILC 3BZKA 4FJJA 3KG1A 3RAXA 4FXDA 1F3FA 2ZZNA 3RUBL 1HNIA 4DCOB 2BVZA 3SYZA 5DDRC 3BSCA 2O8CB 4NYZA 1QAIA 5IC6B 3AQOA 3TANA 4FWNA 4V19S 1G6BA 4FOIA 2ZDPA 3OTOK 3V1QA 4W98A 2OYQA 2Y1JA 3MXJA 1J27A 3O44A 2QL9B 3DOLA 1UMJA 3PSIA 4B1UB 3ZTPA 4K7QA 3VCDA 3TUJC 3H46O 2W42A 2VONA 2COLA 5HN0A 4DHVA 3PW5A 3PX6A 3CCUS 3CO0P 2L41A 1CJTA 3HSJA 3IN5A 4CFAA 4CGJA 3HDSA 3J7YI 2VQFJ 3CW2C 4RW4A 2B9YA 8ATCB 1KLNA 5EX3A 3H3NO 2ITGA 2LA4A 3DGVA 3CIPA 2DO0A 3K9JA 2FSNA 2F8HA 3CYMA 4RUAA 1O6XA 5KT5A 2GV9A 4BRNA 1VIOA 1DTTB 2HRUA 4NCGB 3TEGA 3KNAA 1W2BM 3D9BA 3UPFA 1ZBTA 2E44A 2R2SA 2HHSA 5K8OA 3N01A 3F73A 4FBUA 3T1AA 3ETOA 4X4QA 1LNQA 5T41A 2IYIA 3PIOQ 3NNHA 2OMOA 2GX8A 1XMQF 4Y0WA 4GVLA 4WK1A 4PWWA 1BQMB 2FZCB 3HSTB 4DV1J 2PMWA 1HPZA 1VRUA 3MPWA 4JKEA 2D0AA 2B9XA 1OPIA 2QLWA 2BOAA 2F3JA 5AQHA 1SC1B 4PQUB 5F0UA 4FM2A 2VH7A 4L3KA 5AE3A 2VBWA 4X62K 1ASUA 1SIWB 2GAGC 4B3RF 2I7PA 4CTAB 3TRGA 2ADCA 4ZCMA 2HF4A 2FUG9 2LEBA 3V9ZA 3FBCA 1FWKA 5BPLA 3OV7A 3J81j 3GR0A 4C1NI 4KIAA 3FSYA 1HBMB 2HKEA 4LBPA 3IM8A 4B3OB 2DGSA 4PPZA 1SCJB 2B9EA 1RT2B 3N79A 4CT9A 3FFIB 2DJWA 2VG5B 5C25B 5LJWA 4CFDA 3NCRA 4H5RA 3ENHA 2DNQA 3R5GA 5AE2A 2P9LB 5DJBA 2YI1A 1JCEA 3HP9A 4K0KF 4DV3J 4KGMA 4LF6F 5H1SV 4JV5F 1T95A 3OR1B 1PGZA 3E1YA 2HQFA 1JLGA 5FDLA 4M95A 2HG4A 1I3AA 5KFWA 2X3GA 5AQKA 3SJHA 1ZM2A 3VESA 4A59A 1ZZNA 4BRCA 3UB5A 4J5OA 1NK0A 3V6DB 1WHVA 1FVSA 4BVPA 3BEGB 3GG4A 1CJUA 2HURA 3JXOA 4DV1K 4X64K 3CC4N 2A6MA 1YIJN 1HHQA 4JRPA 2AZ1A 2A5XA 1N36J 3GONA 4DUYJ 4EMDA 2PD1A 4EWTA 5KT2A 4N7TA 4O44B 1HL6A 1E4FT 3N4PA 1KBRA 1RT6B 2V2QA 1IBLJ 2CFXA 3R6LB 4U7UD 2AW0A 4DSKA 3MM7A 1RYRA 4CQ1A 3K58A 1LWCB 2Y8YA 1Q7YO 3ZXWA 2EVZA 4Z2XA 1Q18A 2DNZA 4JI7J 2PAVA 1M1GA 4KHPJ 4QCLA 1U4BA 3O9SA 2VFTA 4M5IA 1XEZA 3C15B 2CQPA 3MXMA 2MXYA 2ZH1A 3UKRB 1JXLA 2KI2A 3OLAA 3CFOA 1EO1A 4OYPA 1TUYA 3UN5A 1N34K 4TLRA 3QGGA 4HHTA 2HHXA 3A8YA 3KYLA 2IRYA 2G8UA 3T6JA 1VBYA 2ZGZA 2BJDA 1XMBA 4QW8A 3KUHA 4BE1A 4RU2A 4Y2KA 4WIQA 2DHGA 5CR4A 4CEFA 4AHTA 4C8ZA 3O08A 3UQSA 1X4GA 2RD5C 4M7XA 2UUWA 1P9YA 3GJTB 3SQGA 1LFPA 2SXLA 1Y4ZB 1QD1A 4AM6A 1RAGB 2L08A 4GV6A 4F04B 1S6UA 4K4UA 2E7VA 5CD4H 3N28A 3LA0A 2VJUA 2BQ3A 4ED6A 4HHUA 2NZTA 4IG0B 2DR7A 1VSFA 5D6GA 4OJRA 2VFSA 3CQ8A 4CJFA 2YKMA 4CIOA 3CJBA 5HOOA 4RW7B 1TKTB 3BY5A 2BE2A 2EHGA 1EZZB 4O8KA 3TX8A 4X65F 5FPMA 3G82B 4BC7A 4IR1A 2MSSA 3QZ7A 3DFEA 4DF8A 4RUHA 2HHHF 5E41A 4CESA 2FZGB 5T7LB 2B3TB 1H72C 2YKMB 1X3NA 4F0HA 4OI0A 5I4MA 1B3TA 3J7ZO 3BSOA 4LR7A 3A0IX 4ECWA 1F6TA 4USUA 2J8AA 2QL7B 2XY7A 3MEGB 5ETSA 1WHXA 3PR4A 1R8CA 2HF3A 4LF4J 3OXGA 3QWUA 3THPA 4DR1J 5B0AA 4FVCA 4CZKA 3WNEA 2YWFA 5C24B 5J1EB 5L38A 3CJAA 4I2PB 2MSTA 3RRKA 4DJBA 2KT3A 1XMOJ 1Y0HA 4V19X 4ZVOB 4ERDA 2W9CB 5D4PA 3RG6A 3LGHA 4DLEA 4MQ3A 2BJ1A 3OTDA 4ZP9A 1CPZA 5H9EJ 2RU3A 1RB0A 2ZBIA 3L2RA 3RW6A 1UWBB 2U1AA 2BRLA 2BQRA 2HHVA 4FL9A 4ED7A 4JS4A 2H9ZA 4K2JA 3D1QA 3ZSWA 1YLXA 1FXDA 1CJVB 3THVA 1NOYA 3IGNA 3KFWX 1IWAA 1P9QC 4B1WB 4CDIA 1N8RT 3H20A 4DN9A 2L9WA 4TKTA 2E6LA 1N32F 2ASMA 3TAFA 2ZF5O 4DFPA 1JLEB 1KR4A 3MECA 1U04A 4CGGA 3QJLA 3H45C 3H4DA 2VUGA 1LWCA 1U1OA 4OHVA 3P3DA 3D2FB 3I96A 1IQTA 3KZBA 1JLQB 5D15A 2HK3A 3AVHA 2YKNA 1MNEA 1IKYA 4ZP8A 1SL2A 4X64F 2BE9B 2MZQA 1UVKA 1WSJA 5KFYA 2FHKA 1SC6A 2E9ZA 5DM6Q 1JJ4A 4CF0A 4ECVA 2JVRA 3D0PA 4JI0J 4KSEB 3IKMA 4RNHA 3IC1A 2H48B 3C6TA 1RBVA 4FJHA 2D41A 3SBGA 2CQ4A 3KMSA 4OYBA 1IJJA 2PFUA 4OPKA 2CQ1A 2CPDA 4K4YA 4OZ5A 3SQ1A 4J9RA 4MKYA 5C0YA 1FK9A 2DXEA 4CNYA 3M3ZA 2C3UA 3BF3A 2FJDB 2YQ3A 2RB7A 3VAJA 1TK8A 4NZ7A 3FEZA 5ETNA 3MMJA 3VTHA 2A42A 4WTYA 4LFBJ 1KVBA 5M2UA 2X7IA 1IKXB 2NUHA 2D0CA 3BPDA 1RACB 1H73A 1WSRA 3FMBA 4DFMA 4ZN1A 3FUYA 4OX8A 3HZGA 2AEMA 4TY9A 3OYAA 1C6VA 3C6UB 2NUBA 3FFIA 3OA9A 3DI6A 4TY8A 1YUWA 2ZHBA 3GJSB 2VODA 1AZSB 3HLUA 1DQ8A 4B3MJ 3VF0B 5IOLA 4OQJA 1YF5L 2BA9A 3UWTA 4LFBF 3PDNA 3ZYYX 3PW4A 3SSSA 3IBFB 4GKJK 4JI4J 2HHHK 3BP8A 3ULHA 3L3VA 2AV5A 2G8FA 5D8HB 4U6PA 3A5NC 2YKPA 3QEWA 3QJPA 2XLKA 4OYWA 2W40A 4ZJLA 2Z58B 4OHXA 1VQ8S 3DHWC 1Z6RA 3AY9A 3LDSA 4IRDA 3P83D 2Z1HA 4ALZA 1XMQJ 4FJGA 4LFAF 3SUQA 1KNZA 1BQMA 1TKZB 5GAHP 5DGAA 2QZ8A 5IT4A 3LP1B 1YJ9N 3F44A 3HSZA 4DUTA 2W6KA 3O1WA 1CXQA 1JQGA 4FVUA 4NB4A 1PJ6A 4KPYA 1O5JA 1HI0P 5C42B 1YK9A 2G8HA 1X9WA 1DURA 2M4MA 3PYGA 2NNWA 4YOEA 4WK3A 4YDUC 3VPZA 3POTA 1G1XA 4L75A 1TKXA 5J2NA 2B4PA 1CJTB 4WFBL 4LF2A 3C94A 2MZJA 3VV2B 4ED1A 1Y7PA 2IVFB 1R8AA 2HMPA 1SL1A 3QNWB 3JS6A 1CJKB 2W9BB 3H25A 5HRSA 3SMSA 4KFBB 2QTWA 2Z2MA 2FPHX 2RRAA 1VR6A 5C2GA 1ITGA 1NJIT 2EFQA 1R89A 3SQ4A 2D0BA 4DL3A 2A1BA 5CD4A 4EBDA 1QQMA 3I55N 4CFCA 1JJ2R 5LM7E 1FFGB 4AT1B 4H4KA 2V34A 4CLYA 3CCVN 1WACA 4JYAF 3SV3A 5A2QU 1X3MA 2XNRA 4IKFA 1QAYA 3W5ZA 1AYEA 2F4VF 3I0SB 1Q4RA 3VQTA 3BZQA 4ELVA 4FLYA 3D67A 4URSA 4IOAQ 2DGOA 3DLEA 2DYAA 3W2VA 4WFXA 2CUYA 1E6VB 3MEDB 1ULRA 2K7JA 4H4MB 2ZC3A 3QO9A 4L72B 1V4TA 2VC1A 1IG8A