3KLFA

Crystal structure of wild-type hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 139
structure length 553
sequence length 553
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klfA05
2AGOA 3VQQA 4NRTA 4GC6A 3D5MA 3CFRA 4Q0BB 3CJ2A 3ZSOA 2CJQA 4KKOB 1BHLA 2GIQA 4BWMA 3BQ0A 3EZ5A 4DTSA 1SKWA 4ID5B 1VSDA 3KK1A 5KT4A 1NOZA 1ZBLA 5F9LA 3H4DA 1RT1B 1T05A 3K2PA 5KG7A 3OHBA 4Y2AA 3IRXB 1LW2B 3KKSA 3M9NB 4YQWA 2GBZA 2PY5A 2XGQA 3HKWA 3V1QA 3QO9B 3U6FA 3K59A 1JLBA 3NGIA 4UQGA 4NLGA 4O3NA 3AVFA 1T03A 5JS2A 4ZTFA 4GVMA 4B9VA 1S5JA 4NRUA 3KJVB 4FJ5A 4M94A 3P83D 3SV3A 4Z4EA 1UA1A 1RTJA 5KT5A 4IQXA 5EUHA 5KFIA 2DY4A 5HRPA 4OPJA 2J6UA 4RW9B 2AX0A 5L1IA 3MEDA 3ZSZA 2IA6A 3ZT0A 3I5AA 3LDSA 1RYRA 4HUGA 3OYLA 2BANB 1S1UB 4Q8FA 2JEIA 4AH9A 3I5BA 3HVWA 3TAQA 5KFKA 3PW4A 3WNEA 4CJSA 1IKXA 3FFIA 2FC0A 1DLOB 1LWFB 4FK0A 4CFDA 1R0AB 3QETA 4J9NA 1QSLA 3CJ5A 4Z4FA 4KE5A 3NH1A 4KI6A 3HP6A 3L3VA 3THVA 3LP1B 4QW9A 3OSPA 4I7FA 1IKWA 1C0UB 3SQ0A 3M9MB 1LWCA 1RAJA 1MU2B 4FJGA 1TL1A 3DYAB 4O4RA 1RCHA 4KAZA 1VSMA 3KLGB 3NF9A 4CJFA 2W7OA 4EO8A 1HARA 4Z4HA 3H98A 4DLGA 2R2TA 1TVRB 3V6JA 4AILC 3ISND 4KKOA 3T19A 1C1BB 2W9CB 3MEEB 4O5BA 4FLZA 1JLCB 3VQ7A 3OYHA 3IN5A 3KK2B 2R2UA 3H5UA 2BE2B 2Z1GA 4QPXA 2FJXA 3KKRA 5KFPA 4CJTA 4KSEB 2YNFB 3IRXA 3AO5A 4JRQA 3TANA 4TY8A 1KLNA 4CJ4A 4OJRA 1NKBA 1N5YB 4CEZA 5KG6A 4DTPA 2XY7A 4RUAA 3T5KA 3NBPB 2DPIA 3QO9A 2AX1A 2RPIA 4E7LA 4DG1A 3TARA 3KK3A 3NAEA 4PA1A 3KLEB 1FKPB 3GIIA 3M8QB 4IRKA 4TLRA 4KI4A 3KJVA 2WTFA 4E7IA 1QS4A 3NHGA 2FVCA 2ILYA 4QWDA 2EHGA 4ICLB 3VQ8A 4RW9A 3KLHA 4B08A 3IS9B 2WONA 1GX6A 4R8UB 2IM2A 4M95A 3NGYA 1UA0A 4KRFA 1U49A 1S1UA 1XWLA 4NCBA 1HYSB 2WRMA 2PYLA 4CF2A 3H40A 2FJVA 1C0TB 3KD5E 4ELUA 3OYAA 1ZTTA 2DFEA 1DLOA 3HHKA 1LWFA 1C1CB 5HLFB 1FK9B 5DG8A 2RF2B 3NF8A 1SUQB 2G8VA 1QE1B 3PX6A 4N47A 1S9EB 2GV9A 4RUCA 1NJZA 1BISA 2IOCA 5KFHA 4DFPA 3PZPA 4PWDB 2FLNA 1T94A 3DYAA 4HHTA 3UIQA 1S97A 4Q44A 4HCBA 3MFHA 1TVRA 2WK4A 4ED1A 2XWYA 3ZSVA 5F8GA 2FBTA 3PUFA 2Y1IA 3MEEA 2BDPA 4KB7A 4FJMA 3NF6A 5J2MB 1J53A 2FBXA 3KK2A 3HM9A 4WZMA 2A1RA 3NL0A 5FRNA 2YNFA 3CO9A 2O5DA 3NH2A 3K5OA 1LV5A 4URSA 2RDIA 2IM0A 4LH4A 1REVB 2E9TA 1TKTB 1TK5A 3LAKA 2E6MA 1DTQB 3NBPA 3SFGA 4C8LA 4AHVA 4RW4B 2UVRA 2ZKUA 2XCAA 4KHNA 4O3SA 5KFOA 5KFXA 3M8QA 1A5XA 5F8IA 4JUZA 2HHTA 1S10A 1S1TA 2X6NA 2UVUA 3DOKA 3LZIA 4NLOA 4IFVB 4HCCA 2G8FA 3V6DB 4B9SA 4DSJA 4RNNA 4QWEA 3EY1A 3NE6A 1SH0A 1BQNA 2G8UA 4KB1A 4TYBA 5HROA 3L2VA 1IO2A 3HVRA 1HNIB 3JSMB 4CIFA 3QIPA 3SV4A 4CIGA 3IS9A 1S9FA 1JLAB 4OGCA 2C28A 4R8UA 2IM3A 3HPOA 4DU3A 2D3UA 2UVVA 2D5RA 5J2QB 4E3SA 4F4XA 3NMAA 1JKHA 3PVXA 2V4QA 3V6HA 2BRLA 2XGPA 3TQ1A 3F9KA 3RR7A 4E7HA 4B8AB 3MXMA 1FK9A 2WHOA 5CYQB 1QAIA 2IMWP 3OS1A 4DFJA 3GIKA 4DL2A 1QE1A 5C25A 2GC8A 4FK2A 4NLVA 4C8NA 4ECSA 2BQ3A 4C8MA 4F2SA 3DOLB 3HVAA 4DQQA 4E89A 3MTKA 4O44A 5KTQA 5I42A 2XO7A 1YTUA 3V6KA 2HAIA 3N6LA 1HYVA 1VRUB 3PW5A 4EZ9A 4LSNB 2AJQA 1QHTA 4NCGA 4K4ZA 5KFWA 3KLVA 3Q8QB 2FVRA 1RDCA 1X1PA 5FRMA 3RB3A 1U04A 3HPGA 3VA3A 1Y97A 5J2MA 4GMJB 2YNIA 2EC0A 4KHYA 3I0SB 4DTMA 2VA2A 5KFGA 4TQSA 4YNQA 3U3YA 4I2QB 4DFMA 1EETB 4DQSA 2UVWA 3HVTA 1REVA 1SV5B 4CJ5A 4R5PB 3PJWA 4CJQA 4FJJA 2V4RA 5HRSA 3ULDA 3QNOA 3DMJB 2ATQA 4I9QA 1TKXB 5KFVA 4OGEA 3ICLA 3CDUA 3HSTB 4FLTA 3RB6A 3ZT3A 4OVLA 2R7YA 5SZTA 1BIUA 4CJWA 4Q43A 5C24B 4IFVA 4IR9A 5EU7A 4Z4CA 2IAJB 4FS1A 1X9SA 3CIZA 5KRSA 4F4ZA 1ITGA 3AVLA 4KB0A 3D28A 2PYJA 3V9WA 2HHVA 3WNFA 3SPYA 4OKJA 3SI6A 4DU1A 2I5JB 1NK9A 4QWAA 1VRTB 1WSEA 5J2QA 4TN2A 1B9FA 2I1RA 2B5JB 2ASLA 3OJUA 4YMEA 4O55A 3OYIA 4G1QB 1VSHA 4IG3B 4ZVEA 3TAPA 4KREA 3QGHA 1XC9A 3KTQA 3HYFA 4IFYB 4W5OA 2D0BA 2IDOA 4FJXA 4URQU 4IKAA 2VA3A 2R8KA 3KMQA 4TSXA 2HNYA 2BGGA 2HWHA 3CJ3A 1RT4B 3NGDA 3DLKB 4XPCA 1SKSA 4PQUA 1CZBA 1VRUA 1IKVB 4LSNA 3NFAA 2HB5A 3WNGA 3Q8RB 4LY7A 1EP4B 4WFXA 3HO1A 3GV8B 3CYMA 1KHVA 4J2AA 1RT5A 4BDZA 2B4JA 3I0SA 3ITHA 4N41A 4CJLA 4LQ9A 4N5SA 3SUQA 1KSPA 3CFPA 4I2QA 4M42A 5K14A 3UDLA 3QZ7A 1SV5A 4R5PA 1UOCA 5KFQA 2F8SA 4MK7A 5KT2A 4B9MA 4CHNA 2ZE2A 3DMJA 1JXEA 1TKXA 4F8RA 4J2BA 1JXBA 4CHOA 4U6PA 3GV7B 3VQPA 4N76A 3TAMB 1ZBIA 4KFBB 1KFSA 3KLIB 3HXMA 5KG4A 3PR4A 2DFHA 5C24A 5F8LA 4DTUA 4DL3A 2X74A 1I6JA 5KFCA 3SUPA 2AU0A 4FZXC 4MKAA 4NLTA 1C2PA 3FQLA 2VG7A 2FLPA 4ELTA 4FK4A 3NAHA 1KVBA 3LANA 3DI6B 1U09A 4CGHA 3RMAA 3OS2A 2OPPB 3BGRB 1T3NA 2VWJA 4CF0A 4O3OA 2KW4A 4FM2A 4EYIB 4K4VA 4QWBA 3AA3A 2XY8A 2B5JA 5J2PA 2OPRB 4FJ7A 3LZJA 3DDKA 5T14A 4ED0A 4K4WA 1KCFA 5CYMB 4IG3A 4E7JA 2P1JA 3T5HA 4QAGA 4DL6A 1RTDB 2KZZA 3QEPA 4WYLA 3C6UB 4FM0A 5EWFA 4M3ZA 4WYWA 5KFNA 2FJWA 1S1XA 1S4FA 4RNHA 2ALZA 2OPSA 1TV6A 3OHAA 1ZYQA 1NKCA 4BWJA 1KLMB 3MXIA 3OYFA 3QNNA 1RT3B 1IKVA 3ZSYA 3TAGA 4J9SA 3DLEB 3O4QA 4EBEA 1EP4A 1NHVA 4Y3CA 3N6MA 4B9NA 1HQUB 2UUWA 4CGIA 4B8CA 3AVCA 4AHRA 4Z0UA 4MK8A 5J1EB 4F3TA 4O3RA 3O3FA 3D0PA 1VK0A 5L1KA 4E7KA 1HQEB 3EZUA 2E4LA 3FSIA 4PUOB 2O4GA 4CF1A 1GOCA 2UUTA 2YHAA 4B3OB 1JX4A 4OLBA 5FDLB 4DQIA 1QQCA 4EBDA 4RZRA 1A5VA 3O3GA 2VG5A 3O3HA 2X6SA 3RAQA 1S0OA 4CJEA 1Z26A 1RT6B 3NH0A 2ZD1A 3L2WA 2KQ2A 4ZP8A 4M3XA 1NK4A 5KGXA 4KFBA 4F3OA 1QTMA 4ZVGA 3GQCA 2W8LA 3JYTB 4CIEA 4KHSA 3SUNA 3G6XA 1VSLA 5JXSA 3KMSA 3RMBA 4CJKA 1C1AA 2WOMB 3ZSQA 3HP9A 4H4MB 4EO6A 3DI6A 2HHWA 4CGGA 2FVPA 3NAIA 3IG1B 4J2EA 4Q0BA 3OL7A 4LSLB 5J2NB 2OPRA 4ID5A 4MIAA 3M8SA 5CYMA 4ZPCA 3PW7A 1RT1A 4QW8A 1SL0A 2HHXA 1LW2A 1RTDA 4QWCA 4ED8A 4CFAA 4K4TA 3PX0A 1TK0A 1EKEA 2IC3B 3V4IB 5KFZA 5DLFA 3OYJA 2XHBA 2JLEA 1LW0B 4CEFA 2R8GA 4CEAA 1FXXA 1JLFB 2BR0A 3K57A 1KLMA 4DQPA 3QEIA 1SL2A 4JS4A 4CEOA 3GIJA 2W9BB 3AVHA 3MXJA 4FJ9A 3DLRA 4IBNA 3T5LA 3HK2A 1WSGA 3DLEA 3VQBA 3BQ1A 4ED6A 3SNNA 4MFBB 1Z4UA 1BQMB 3CQ8A 3QERA 5J1EA 1RBTA 2OZSA 1TL3B 2DPJA 1VSKA 4PUOA 4G3IA 1IG9A 2F8EX 5KFSA 4RNOA 3AO4A 1RNHA 1SH2A 2BANA 4B3OA 5FDLA 4EYHB 4CESA 3IGNA 2IJNA 1TK8A 5KFRA 3VQSA 3RRHA 2DTUA 5DQHA 4I2PB 4EP4A 3LWMA 4FYDA 3MF5A 1RT6A 4DL5A 2XC9A 1IM4A 3KHHA 4FXDA 4B9LA 2XRIA 1UWBB 1R0AA 1XR7A 3SQ2A 3OYBA 3QINA 3S3OA 4WFZA 4ECVA 3Q8PB 4ECWA 4AHTA 3LP1A 5T7BA 1C0UA 3G86A 1MU2A 3OL9A 3V9XA 3D45A 4LQ3A 4J9RA 3TWHA 1JLQB 3KLGA 4H4MA 3CWJA 3AA4A 4Y1CA 1GOAA 4FLUA 1RTIB 3NDKA 4Z4GA 4WXWA 1RDDA 4LSLA 1C1BA 2Y1JA 3I5CA 2W9CA 5J2NA 2FLLA 1DTTB 1JLCA 1RDBA 3A2FA 4YR3A 2PZSA 2B43A 2BE2A 1S48A 4EP5A 3DM2B 1S6PB 3L2QA 4URGA 1ZBHA 1N56A 3F73A 1O1WA 3T1AA 1HJRA 1S6QB 4DTNA 3QEXA 3HL8A 1LW0A 4ZP7A 1N5YA 1YT3A 4DWIA 5SWMA 1JLFA 3PO5A 3E01B 2VWKA 4DF4A 4ZP6A 2R2SA 5DLGA 3VQCA 2W9BA 1D9DA 4K50A 3KLEA 4Y34A 4CE9A 1KRPA 1FKPA 1RT7B 3G6VA 4RW8B 4F2RA 5JUMA 1NK7A 3ZT1A 4KV8B 5HBMB 4ICLA 4ZPDA 5C5JA 2C2RA 1RILA 4DLEA 3RMCA 1NJXA 4DTXA 3GIMA 1TL3A 3LPTA 4JRPA 1TAUA 3OYNA 1J5OB 3CM5A 3TAEA 1HYZA 4FJIA 5F8NA 3BSAA 3AO2A 1WSIA 3EPIA 1HYSA 5KFBA 1IKYB 1TQLA 4K8ZA 4IR1A 2W42A 4ED2A 4YP3A 4DSKA 1C0TA 2HWIA 2BRKA 1ZTWA 4BE0A 1L3UA 1C1CA 5HLFA 2RF2A 1RBVA 1UWBA 1SUQA 2R8IA 4CK3A 4U7CA 3MEGB 1S9EA 3QEWA 2G8WA 3RTVA 4PWDA 3OY9A 2D41A 3CDEA 1C0MA 1JLQA 3CVKA 3BSOA 3LPUA 3OL6A 2YHBA 4M3RA 1KVAA 3AVIA 3AA2A 3RB0A 1RT2B 4FLYA 1DTTA 3G0ZA 4H4OB 4CGJA 3CM6A 4J9MA 1BI4B 4Q45A 4BACA 3DM2A 4E0DA 1RBUA 4C8KA 4I9LA 1RDAA 4CJRA 1RDRA 1IH7A 3H59A 5HRRA 1Q9YA 3MECB 2KTQA 4RW7B 3VQDA 1XHZA 3CJ0A 1TKTA 2QE5A 4KBIA 4CK2A 2Z1IA 1SL1A 1DTQA 3SQ4A 4RW4A 3E01A 4IKFA 1N6QB 3PR5B 2RN2A 3OS0A 2KFZA 4CFBA 3ZT4A 3HJFA 2Z1JA 4DS4A 5KI6A 1LWEB 2RKIB 1RT7A 4RW8A 5EDWA 4IDKB 3S3NA 3G6YA 3SYZA 1UAXA 2ILZA 4FLXA 4L8RB 4ID1A 5HBMA 3V6DA 4ZVHA 4KTWA 4CHPA 2HHSA 3SFUA 2ASDA 1BL3A 3C6TB 5KFUA 3QIOA 1HNIA 3JSMA 5CZ1A 2ATLA 4HYKA 1X9MA 3KNAA 5E41A 1JLAA 3KD1E 4B9UA 2J6SA 4TY9A 3SJJA 4FBUA 1QAJA 2QV6A 4CHYA 3BJYA 4W5NA 4TYAA 4TQRA 4CJ3A 4CEBA 4DEZA 1IKYA 2YNGB 2VG6B 4GC7A 4FS2A 5HP1B 3AO1A 3DRPB 3MFIA 3SI8A 4NCAA 4E1MA 1KTQA 5CYQA 1KFDA 3AVBA 4DTRA 5CY4A 4F4WA 2AWZA 4M3TA 4NLPA 2Q3SA 1RA6A 4DMNA 4BE2A 4NLRA 2GIRA 3DOLA 2DFFA 4FVMA 3FQKA 4FM1A 3LAMA 3AA5X 5KG1A 4RNFA 3OL8A 3DLGB 4DL4A 2J6TA 3KHGA 4R0EA 1ASWA 4DQRA 3G10A 5L9XA 1TKDA 1RT2A 1I3AA 1NK5A 2OPQB 1BI4A 1JLBB 2XY6A 3ZSWA 1T03B 1S0MA 1EETA 4QCLA 1TP7A 4FZZA 5KT3A 3EPGA 4RW7A 1CZ9A 1Q9XA 3QYYA 1EXQA 3PV8A 2HNDB 4CGDA 2D3ZA 2P51A 1K1SA 4K8XA 1CLQA 3KIOA 4ECRA 4M41A 4CJUA 2IS3A 1N6QA 5CZ2A 1W25A 5KFEA 2R8JA 1ASVA 2RKIA 2FBVA 5DMRA 4AHSA 3DRRB 3OYDA 4F4KA 1I39A 4DSLA 1NHUA 3L3UA 2BQUA 4ZMMA 2IAJA 1XHXA 1QSYA 2XI2A 3VQ5A 2IM1A 4OL8A 4ECXA 4DSFA 2I5JA 1RYSA 1VRTA 2LSNA 3MR2A 1WNSA 4Z4IA 3K5NA 4J2DA 1IKWB 1Z25A 3E51A 2ZQBA 3H2LA 1LWCB 1VSJA 1TL1B 1MMLA 4Y2CA 2VG6A 2IGIA 4X2BA 3OYGA 4G1QA 3RR8A 5HP1A 1GX5A 3OYCA 3DRPA 4CECA 4FBTA 3H5YA 4EBCA 4IFYA 4JV1A 4DFKA 4XO0A 1TAQA 3U3GA 2F8TA 3BSCA 4JV0A 4NYNA 4DL7A 2R8HA 1L3VA 1T8EA 1GOBA 2QXFA 3CFOA 4KTQA 1A5WA 1JLGB 3QESA 1RT4A 4NLWA 2P5GA 4XIUA 3DLKA 2OH2A 2E6LA 4J9QA 4TY8B 4KO0B 1RBSA 4KHQA 3DLGA 4Q5VA 3OJSA 5F8MA 3QIDA 2HMIB 3OYMA 3T5JA 4DU4A 4NLXA 1WSJA 3Q8SB 3AV9A 2RDJA 3V81B 4OPKA 2GUIA 2OPQA 3DLHA 4MH8A 1EX4A 3B6OA 3WNHA 1CXQA 4DF8A 4DG1B 1WNEA 3KK3B 4WXOA 5KFLA 3M8PB 4HKQA 3BSNA 5D3GB 4FJ8A 1TGOA 4ZPAA 3IAYA 4EEYA 3S9HA 3L2RA 4HUEA 2HNDA 3GYNA 5DQIA 1RTHB 1U45A 4NZ0A 3RBEA 3V9ZA 5JS1A 3KLHB 3MR6A 4JLHA 1T7PA 4KAIA 3TAMA 4BDPA 2WONB 3L2UA 3KLIA 4FJLA 3DRRA 2OZMA 3BR9A 4CEQA 5DG7A 3SCXA 5KG0A 2KFNA 2HVIA 4F4YA 3GILA 4W5QA 3M8RA 3ASMA 3V9UA 4JS5A 3H4BA 3TABA 3TI0A 3P1GA 1S1WB 5F8HA 3UQSA 4RG8A 4KHWA 2OPPA 3BGRA 3LP3A 4IH5A 4E19A 2WCXA 1S0NA 3AVNA 1CSJA 1B92A 3AVMA 3O4NA 4CF8A 4B9TA 1WAJA 4O4GB 5KFTA 1U47A 3C6UA 1JL1A 2JC1A 3QZ8A 4K4YA 4K4UA 2W7PA 4ZVFA 3HPHA 3KHRA 2HHQA 1RBRA 4IH7A 3DRSB 3CG7A 1NOYA 1K6YA 1JLGA 1NNDA 4ZPBA 2EX3A 3BQ2A 1VSIA 1SKRA 3QGIA 4KO0A 1RT3A 5I3UB 4JV2A 2C2DA 4YFUA 1J9AA 4DSIA 3OYKA 2HMIA 1WSHA 4EZ6A 4IOBA 1YVFA 1NJWA 1HQUA 2JGUA 2R2RA 1S9GB 3V81A 3V1OA 5DGBA 3V1RA 4IH6A 3PY8A 3M8PA 2E9RX 5KGWA 1HQEA 3OYEA 4ECTA 3V9SA 5D3GA 3EYZA 3VQEA 3RBDA 1S1TB 1SH3A 2JEGA 4K4XA 3L8BA 4QOZB 3DOKB 3H08A 4FJKA 1RTHA 5C42B 4KTZA 2ASJA 1BQNB 5KFFA 2YKNB 5KG5A 5HROB 1LAVA 1WLJA 3C94A 3QIPB 3TVKA 4KPYA 5KFMA 4ZHRB 1N48A 4RW6B 4WZQA 2WB4A 3S3MA 4KHRA 1OS5A 3JYTA 2JEJA 4FLVA 1JKHB 1VSFA 4HTUA 3LP0B 2D0CA 3OLBA 5FROA 4WE1B 1NK6A 2WOMA 2E9ZA 4IRDA 1YVUA 5KFJA 3H5XA 1N4LA 4FW2A 4AHCA 1S1WA 5DGAA 1KVCA 3VQAA 3IG1A 4O0IA 5C25B 1S1VB 2XCPA 3ISNC 3K58A 1W9HA 4HVJA 1K1QA 3VN5A 4M3UA 4CHQA 4O44B 2C2EA 4CK1A 5I42B 4J9KA 4O4GA 2NUBA 4AHUA 4RU9A 1VSEA 1JLEB 4NCGB 4CEEA 4IG0B 2HHUA 3OSNA 2YV0X 1NK8A 2IC3A 2HVHA 3V4IA 1HMVB 4J9PA 4DTJA 3DRSA 3IGVA 3LP2B 4K4SA 2YNIB 4ECZA 1HNVB 3TR8A 2JEFA 4IRCA 4MK9A 2V0NA 4J9OA 4HUFA 4CGFA 5I3UA 1NK0A 3NGZA 3HVTB 4ECUA 2QK9A 3KHLA 3SPZA 5KFYA 5L1JA 3DLBA 4GW6A 3I0RB 1B9DA 3OLAA 1QSSA 5L1LA 5KG3A 4PY5A 1YTAA 1S9GA 4ZTJA 2JC0A 1BCMA 4MFBA 3N6NA 4DSEA 1BQMA 3ALYA 3MR3A 2FVQA 3PHEA 4NYZA 3GV5B 3LALA 1D9FA 5KRTA 1JL2A 5HRNA 1TKZB 5KFAA 5C42A 2AGQA 4XPEA 4CF9A 2P5OA 4O0JA 3MR5A 2YKNA 4I2PA 2X78A 3SZ2A 1RA7A 3RB4A 2G8KA 3C95A 3AVJA 4ZHRA 4O3QA 1NJYA 3CJ4A 3QLHB 3NKYA 4RW6A 3AVAA 3ZSXA 3QEVA 3ZT2A 4W5RA 1HPZB 2C22A 3LP0A 1ZBUA 2AQ4A 4WE1A 1NKEA 3FDSA 3SQ1A 3QGGA 5DK5A 4KHUA 4CJPA 4J9LA 1L5UA 2QKKA 1RTIA 3RRGA 1WAFA 1S1VA 4C8OA 2G8IA 2B6AB 3ZCMA 4NYFA 3RAXA 3K5MA 2HNYB 2YNHB 5EWGA 3UPFA 1S6PA 4LD0A 4PQUB 4BE1A 1JLEA 4IG0A 3AVKA 3LWLA 3RWUA 1S6QA 3BDPA 4ELVA 5KG2A 2OA8A 1HMVA 3KLFB 4YR2A 1FKOB 4M3YA 4TXSA 4DTOA 1XR5A 4Q8EA 3LP2A 3T3FA 1LAWA 1U48A 1XR6A 1XI1A 1F21A 1HNVA 2HW3A 1RT5B 4ZP9A 2F96A 4RNMA 3ITHB 3M9OB 1BIZA 2YKMB 1J54A 1L3SA 4MKBA 1JIHA 2OYQA 5K14B 3VQ6A 1WSFA 3VA0A 4F50A 3UR0A 3AVGA 1D0EA 3TAFA 4NLUA 3I0RA 2A1SA 1L3TA 4LH5A 4Y1DA 4KV8A 3PX4A 2ZE2B 4ECQA 5F8JA 4NLDA 3AO3A 4M3WA 1J5OA 4CERA 1TKZA 4H54A 2XY5A 4NLQA 2HNZB 5F9NA 1Q8IA 1C6VA 4MQ3A 2FVSA 2VG7B 2W8KA 3PO4A 3PJXA 2V9WA 4O3PA 1BCOA 1ZETA 3QLHA 3VQ9A 4FLWA 1ASUA 4E1NA 2G8HA 3MEGA 4NLYA 1HPZA 3P5JA 5J2PB 2W9AA 2O4IA 3KOAA 3KK1B 3FRZA 2QKBA 1T05B 3PW0A 1WN7A 1D5AA 4N56A 3OVNA 1X9WA 3CDWA 4FCYA 5DG9A 1ZBFA 2XI3A 1S1XB 4FW1A 2B6AA 1JXLA 4OLAA 1KHWA 1S49A 5KFDA 2OPSB 2AGPA 1TV6B 4H4OA 5DQGA 2IBKA 1HRHA 2KZMA 2IJFA 3K5LA 2YNHA 4ED7A 3HT3A 4MIBA 4NLSA 4DS5A 1U4BA 1D8YA 4WFYA 4CFCA 3MECA 4CHZA 3KLFA 1FKOA 4OKKA 5EWEA 3BREA 4FZYA 4FJHA 1RTJB 1D1UA 1G15A 4M45A 3VQ4A 2BQRA 4FJNA 4KHMA 2YKMA 4YR0A 4ED3A 3MEDB 3SUOA 3B6PA 2FBYA 1LWEA 3PW2A 3NF7A 4IDKA 1BGXT 2D0AA 4BDYA 3ZSRA 2VG5B 1CXUA 2ETJA 3MAQA 4ECYA 4OKEA 4CEDA 4CCHA 4W5TA 5KT6A 2Z1HA 3I8DA 1IKXB 1QUVA 3FFIB 2ZD1B 3C6TA 2D7SA 4H8KA 4CJVA 3NCIA 3H5SA 5KT7A 2HNZA 4I7FB 2ITGA 2YNGA 2CKWA 3RMDA 1W0HA
chains in the Genus database with same CATH superfamily
1ZZFA 2P2CB 1JJ4A 4ZKAA 1R43A 4BWMA 2QO3A 1SKWA 5T41A 2JLFA 2UV8A 3BKTA 1VSDA 3LDOA 4L3QA 3HZ6A 1T05A 5IOLA 4Y2AA 4B1WB 2GVZB 3KKSA 1PILA 3D66A 4CZCA 2UXBJ 5ETVA 3HMJG 2FYXA 3H20A 5HVFA 2W41A 2P9GA 2FHOB 1VBZA 2V63A 1M5OC 5E84A 1HKCA 2YQ1A 4I0WA 3U6FA 1ELOA 1JLBA 2MGZA 2NXNA 3BR8A 4UQGA 4NLGA 1CJKA 3BO3A 1RBAA 4JI2K 3MOJB 5AQRA 2ZM6F 1S5JA 2D74B 4DCHA 3KJVB 4LF5F 3P83D 3DOMB 3BN4A 3KUHA 3C66A 4OYIA 5HRPA 3R7NB 4ZLPA 2DT9A 2J6UA 4HI1A 1EQMA 4RW9B 2GJFA 3DGPB 5L1IA 4ZS6A 2IA6A 2B3TB 3ZT0A 3UDVA 2R7QA 2M70A 3CMAS 1RWXB 4D3GA 2UU9F 5HJYA 2RNEA 2D3OR 1FXDA 4H0YB 3VZIA 3VESA 3M1FA 2FC0A 2WAQD 1YI2S 2Q6BA 2OEKA 2J9EA 1FJCA 4JN4A 2DH8A 1QSLA 2FY8A 3NH1A 3HP6A 4JEPA 3THVA 2L3MA 3FMWA 1UVKA 1U6FA 4OI3A 3B8HA 2RH3A 5AQSA 3ZTSA 2Y9HA 2FLOA 3NF9A 1HARA 3H98A 4PXBA 4DLGA 2OD6A 1PG5B 2N7CA 1C1BB 3UFCX 3R5GA 1JLCB 3EGNA 3C16B 3IN5A 3KK2B 1OH6A 1MWYA 2HS4A 5ETPA 3M30A 5KFPA 5AE2A 4JRQA 3DLJA 4CVNE 2P9PA 4B02A 3DFEA 5BPNA 5KG6A 2XY7A 4TU8A 2FC9A 2A6OA 4OIXA 2AX1A 4I6AA 3FFKB 3FZKA 2DGTA 4E7LA 1HI1A 3ZZUA 3NAEA 1YWXA 2CA9A 5A0YB 4F02A 3M8QB 1RISA 2CAJA 2ZNYA 2XS5A 4E98A 4JD2A 4C3KA 3NHGA 1XMBA 3RJMB 3M3ZA 1ZA2B 2IDEA 3C14A 2G2OA 1NBWA 1EARA 4DR7F 4R8UB 3QMQA 2D0PA 4P74A 4M95A 4KRFA 3W2WA 3FR0A 3CERA 4V19J 3CCRN 4NCBA 4GVLA 1VMBA 2OELA 4ELUA 3OYAA 2OEMA 4PG7A 2PGCA 5DG8A 2J76E 2MKJA 4Y0FA 4EFAC 2EBEA 3BDEA 5ETKA 2BE7D 5I3PA 2OSQA 1F1BB 1NJZA 1PAEX 4DFPA 3PZPA 2I7PA 1T94A 4HHTA 5E33A 5HANA 1JQGA 2F8MA 3MCOA 1X0FA 2Q79A 2CQIA 4Q44A 5GAGP 2ZH2A 3O5TB 4FJMA 5J2MB 4OYBA 3HM9A 4WZMA 3OHRA 1QZ5A 2GHVC 5AQFA 2A1RA 4KH0B 5CD4H 3MAHA 3K9KA 2YNFA 3JTOA 3NGTA 1F60B 1LV5A 5IT9Y 5LMNK 2BJ9A 1DZ5A 4BRLA 3BF4A 3O8MA 5M1QA 1K73O 1CULB 2E6MA 2C2MB 3NBPA 2Q36A 3J7A1 2UVRA 1NPKA 4MDBA 3CEDA 5GADP 2CGJA 4A57A 2FJBB 5GIPA 1Q78A 3CJKA 2ASMA 3Q8UA 2DRBA 2NR0A 4BC7A 1U1LA 3GG4A 3LZIA 3DOKA 4NLOA 3V6DB 4DV3F 1CS4A 4RNNA 2IRUA 1HWIA 4F3MA 2F9DA 4TYBA 2HK2A 5A8WB 4LF1A 3SV4A 3IS9A 3LL3A 1G99A 2ZEJA 1JLAB 4E3SA 3UD5A 3D1QA 5CQGA 2IVNA 3WBZA 4DQ8A 2QC3A 3NEKA 2CXEA 4FNHA 3TQ1A 3RR7A 4E7HA 3AOCA 1F3FA 5CYQB 5B0GA 5JMVA 3CDBA 1QE1A 2AYMA 3ZETA 1N33J 2CQHA 4NLVA 2YCHA 3HTVA 3MK6A 4Y2KA 3TJ9A 4F2SA 3BN7A 1M1KO 4PRFA 4AQYK 3OXFA 4DV4J 1RSCA 3W2VB 3WIUA 2HAIA 5BPLA 2DYAA 5LXRA 2K8GA 3Q8QB 1YJUA 3E1YA 1X1PA 5AJ3J 3FGVA 1U04A 1ZPWX 1Y97A 3ZZRA 2YNIA 3I0SB 2VA2A 4YOYA 2KT2A 5IQ6A 4I2QB 1EETB 2UVWA 3T1HK 4ZCMA 3CCMS 1IJFB 4CJQA 2OLWA 1FWLA 1GMVA 1QAXA 5LJ5Y 3QJPA 3CJ7A 5HRSA 3LGMA 3GSIA 3THWB 3H2UB 1F9FA 3P3DA 1W7WA 3HSTB 2XYPB 2P6SA 5SZTA 3CT9A 2AYEA 1BIUA 4PHTX 1WSRA 4JKAA 3EVWA 4IFVA 1SVDA 4IR9A 5EU7A 2DGSA 1X9SA 1WEXA 3CJTA 4FWQA 1FDNA 4OKJA 2AW0A 4PWUA 1QUPA 3RVCA 4AYBD 1M0SA 2AP1A 2XLJA 2VFVA 3A8EA 4H03B 1WSEA 1P9QC 2VASA 3PACA 4YMEA 3OYIA 4G1QB 1VSHA 3N01A 3A4TA 3CCMN 3KTQA 2B9WA 3UN5A 4JKHA 2DPNA 2QFIA 3D1OA 2D0BA 2A6AA 3GU0A 2R7RA 4FJXA 2GZOA 2WC9A 1IWAA 3JB9k 2HGNA 2HNYA 3THYA 4C1NK 5D8HB 4HTLA 4G9ZA 1J5EK 3FZBA 3TEGA 1CZBA 5KQDA 2ZC3A 2EFVA 2P9EA 3OTEA 1S4EA 3TR5A 3SAHA 2J7UA 3Q8RB 1LEOA 3CYMA 3UKUA 5AQTA 3DCAA 1KHVA 3D2EA 3JXUA 5BN8A 1RUSA 4C3MA 1KP6A 2XMUA 3MAAB 3CFPA 7AT1B 4M42A 3DXSX 1T9XA 3OR2A 3UDLA 2O8DA 4LF6J 3BGOP 3Q86A 3PFEA 5JLHA 1UOCA 4HDGA 4ETXA 1PCAA 1NAQA 1JXEA 4U6PA 1WB9A 4RU2A 1OYDA 1OH8A 2AEJA 3VGMA 1IBMF 4KFBB 3KLIB 3EEQA 3PR4A 4CLZA 5F8LA 4DTUA 4DL3A 1YJNN 2OTLN 4DU7A 1UFKA 1I51B 2V51B 1TYQA 1XERA 4A2AA 2VG7A 1CJUB 3TYTA 3QRQA 4ELTA 3BKUA 3KG4A 2YHYA 3LANA 2G9OA 4CGHA 3RMAA 3BGRB 5BJRA 4HH0A 2NCKL 2QMXA 2KW4A 4FM2A 4EYIB 5J2PA 4FJ7A 3R5AA 3DDKA 2RQMA 3IR5B 5CYMB 4IG3A 3PKYA 3O44A 4QAGA 4DL6A 2H3GX 1RTDB 2KZZA 2J8AA 1F0XA 2Y1RI 2OO4A 3I4PA 1A7GE 5D0EA 1TV6A 9RUBA 3IKMA 1KLMB 3MDQA 4WYBA 1YGYA 5AZIB 1IKVA 3HZEA 2A5XA 4I67A 4YOVA 2KM8B 3O4QA 4QU6A 2N7YA 1EP4A 3GFYA 3NNAA 3HCXA 1I3OB 1HQUB 2UUWA 1P8GA 5H9FJ 4B8CA 4P7TA 4AHRA 5E2QA 5BYQA 3O3FA 1CJVA 4ZVQB 1VK0A 1RXOB 3W8GA 3FLCO 1NGAA 2O4GA 4CF1A 1ZPVA 1VCTA 1GOCA 2YHAA 1JX4A 4OLBA 4DQIA 4RZRA 5GAGI 3R5DA 3MM5A 2QWQA 3A8IA 3CCZA 4CJEA 5G0RA 3L6QA 2ZD1A 2KJWA 2O8FB 2ALYB 2P9SB 1NK4A 5KGXA 4F3OA 4RBUA 2M52A 1YBAA 2GIFA 4FWNA 4C0HA 3SCLE 3KMSA 3NMUA 1C1AA 2WOMB 3ZSQA 3CIMA 2XMVA 1YG0A 3H3OB 4DHYA 3OTOJ 2VFSA 4BBYA 2KFYA 2VODA 4OX6A 2FVPA 3OL7A 2KRRA 3VGTA 3J7YU 4ID5A 4MT1A 4MIAA 4GO5X 3M8SA 1XMQJ 3OTOF 1S72N 1RHJB 3PW7A 1RT1A 3I6PA 4ZITA 3CCJS 4BC2A 4QWCA 4K4TA 4X64K 2C2OB 3DXMA 4DR3F 2IC3B 1OQ3A 5KFZA 2J5AA 2XHBA 1LW0B 1GMWA 1XMQF 1B0PA 1O0PA 1ZBSA 1I5OB 4C11A 4X62K 2HPUA 1RAGB 4LFBK 4A46A 1SL2A 3HI0A 5F1XA 3GIJA 4H4KA 3UKRB 4HT5A 1HJOA 3CXCM 2CPDA 3VQBA 4G65A 2FF3B 2F4VJ 3LPYA 4J8FA 1KVJA 2VH7A 4MFBB 1MMNA 1JXVA 1QTNB 2IBOA 1M5HA 2OZSA 4RKUC 2F8EX 5L38A 2UZAA 2BANA 4B3OA 4EYHB 1TK8A 2OD4A 2GELA 3RRHA 5AQXA 4F0HA 4OLOA 3U1MA 3FZLA 1RT6A 2BX6A 3ZZ0A 5HQMA 1IM4A 3KHHA 1WTFA 1KBRA 4FXDA 2ZHOA 2XRIA 2EI5A 3OYBA 1YQHA 1MROB 3QINA 4ES2A 3DXKB 2DXFA 1MWMA 2W6LA 2VQEF 3NLCA 3LP1A 4U96A 1R6YA 5DETA 3ENVA 5F41A 1JLQB 3VVTA 5HMWA 4H4MA 3CWJA 5AQPA 3BS9A 1C4AA 3I4HX 3KUEA 4FLUA 1B64A 2V8VA 4L6V3 2VPWB 1VQON 3UWTA 4LSLA 2L08A 4USHA 1DHMA 2Y1JA 4Q7AA 5AQUA 4IEIA 5AZJB 4YR3A 2BE2A 2E1ZA 1TL7A 2ZOGA 3DM2B 2CQ2A 3L2QA 4LR9A 3H2VE 3HULA 4G1PA 2DHHA 2M9KA 4WIIA 1S6QB 3HOSA 3UE2A 2QRRA 4C23A 2W4PA 2F7VA 1F2GA 3PLAA 2Y8WA 1N5YA 3FGUA 1IBLK 1YT3A 1I94K 4DWIA 4PWWA 4DV0F 2HOEA 4X4OA 4JI0K 4OYZA 2R2SA 4MLEA 3KLEA 2NPFA 4JV5F 3VAKA 1KRPA 1FKPA 4F2RA 2X51A 5JUMA 3W9HA 3ILIA 5A8RB 2OCEA 2HURA 4CQ1A 1NK7A 2A10A 1VBYA 2CH6A 2NS1B 1VQYA 4C97A 5C5JA 4DPYA 5M2PA 1VQ6N 3GIMA 1TL3A 4JRPA 1AW0A 1J5OB 4X4TA 3TAEA 1VBXA 3WHIA 4FJIA 3UD3P 5F8NA 3AO2A 1X4EA 1TQLA 4I1TA 3PYFA 4UY8O 1C0TA 3M1VB 4J9UE 3U4LA 1K8KA 2ACMA 3MM6A 5C10A 3CD6S 1YHQS 4FZVA 2I2YA 2C1EB 3EXYA 3DHXA 1PBAA 1OPZA 5BRHA 3UI3A 2CUYA 3QEWA 1IV0A 3W1YC 3BBBA 4CTAB 4PWDA 3OY9A 3BUZB 2H48B 4NXNK 2RS2A 4FWRA 1KVAA 3AVIA 3AA2A 1X5TA 3RB0A 1RT2B 4FLYA 1S6OA 3CM6A 1HI8A 4Q45A 4E0DA 5FIIA 1QQMA 3PSFA 1MW7A 2JSXA 3TTFA 4RBVA 2VFTA 2KTQA 1Y5LB 2VFRA 2AHOB 3CJ0A 4DPOA 3O6QA 4JI1F 4IKFA 2KHDA 4CD3A 2UV8G 3ZT4A 1PC5A 2ZH8A 1YRTA 4ZDNA 2RKIB 2JDJA 2VZ9A 2Z2LA 3J7YP 5K5MA 4ID1A 5HBMA 3DN9A 4ZVHA 2CG8A 1X3NA 2HHSA 3R5BA 2A18A 3NOCA 5D0GA 1Z2LA 1FVSA 2ATLA 1VHIA 1X9MA 3W63A 3EMTA 2F4FA 4B9UA 1TMJA 4TY9A 4U7UK 4CHYA 2D1CA 4CJ3A 1VR6A 2YNGB 4DPXA 2XULA 2CGKA 1HBUB 4A8XA 5A8KA 5HP1B 3AO1A 3DRPB 4LF4K 1NGCA 3MFIA 3ET6B 4IXCA 5B0BA 1SJ1A 1DFDA 4U95A 4F4WA 2AWZA 4MAKA 1N32J 4M3TA 3VAGA 2C2NA 1QVGR 2GIRA 3VCDA 3AJ1A 3M6VA 3CTRA 4RNFA 4FYXB 1WUAA 3TSUA 1YJ9S 1N32F 3PRBA 1FJGK 4R0EA 1GEHA 3A3NB 3W7BA 3G10A 5L9XA 1NK5A 4EGLA 2Q6CA 2OPQB 2W24A 5A2QY 1BI4A 1JLBB 2MGZB 4LBIA 4JI5J 3ZSWA 1CJKB 1FNXH 4NE9C 2GEMA 1VDHA 1Q9XA 2YPZA 4RW7A 1CZ9A 4LREA 2RJZA 2UXCJ 2D3ZA 2DGUA 3HHLA 1UVJA 4K25A 2QLJB 2DNOA 4K8XA 1PJ5A 1CLQA 3R3TA 4ECRA 2EFOA 1WTBA 5CZ2A 1W25A 3POTA 4JAXA 2P9KA 3IFEA 2VV5A 4OZ0A 3OYDA 2OANA 3CJQA 4RJVA 3R2DJ 2RE1A 3MMJA 1KS2A 2QYGA 1T44A 4USUA 4ES3A 4CZMA 2IM1A 4OL8A 2KDOA 1VRTA 2LSNA 2LDYA 2VQFJ 1WNSA 3NG8A 4J2DA 2JWKA 1VSJA 4B3TJ 3M6XA 2LXIA 2NUHA 3OYCA 1U6BA 3H5YA 4IFYA 2YX7A 4DFKA 1B3TA 1FDBA 2WVFA 3W61A 2VQFF 3BSCA 3CD5A 1HKBA 3CI5A 1L3VA 2J9CA 4U7BA 1T95A 3CFOA 5IC4B 4I6YA 4HDHA 4NLWA 3MX2A 3CC4S 3DLKA 1FE4A 2OH2A 2ZBIA 4KO0B 1RBSA 4NZ7A 2OP5A 2NQPA 4QIEA 4DU4A 1RWVB 2QMWA 2L9WA 3BZCA 3Q8SB 2JWNA 2RDJA 4OPKA 3B78A 1EX4A 3WNHA 1HNXK 1CXQA 1WNEA 4X66K 5LOQA 3WQUA 4JI3J 3M8PB 2APOA 3Q0AA 1VQSA 4CJ7A 4M5KA 3A5NC 1FF2A 4FJ8A 4QYRA 1HFEL 2KYZA 4JD2B 4EEYA 2E5IA 2O8EB 2HNDA 2IVYA 2HGMA 1NZ8A 4NZ0A 1B99A 4JI3F 5JS1A 2KXFA 2GX8A 3FMBA 3QWUA 5HOOA 2CQ1A 1U2VA 2CPZA 4EAHD 3WXMB 3DRRA 1YX2A 1S77D 2ERRA 1RTZA 1WG4A 4F3QA 3VETA 3NXZA 2YI1A 4N8OA 4OHYA 2KFNA 1N5TA 2Y1LB 4WTYA 4F4YA 4W5QA 3AJ2A 3M8RA 3ASMA 3M8ZA 3ID8A 4DL0C 4I68A 3VQTA 2QM1A 5D6GA 4RG8A 4MYTA 4L3KA 1IR1A 3C6HA 2CQ0A 4IH5A 3UCGA 1CSJA 5E26A 3NCQA 1VC0A 3O4NA 4CZIA 2E66A 3O1LA 4O4GB 2FF6A 5AXLA 5B8HA 2JC1A 3QZ8A 2BH1A 4DZDA 3HPHA 4JI8J 1QD1A 3ZX0A 3CG7A 2ZWHA 1K6YA 1UVNA 1HWJA 2QLXA 2UXDF 1JLGA 2Y8YA 2P9UA 1PYSB 2C2DA 3QFPA 1J9AA 1LK7A 4F0MA 2MLXA 2AD9A 1U02A 4EZ6A 5D78A 1O13A 4YHHF 2R2RA 1S9GB 4LF9K 2MZ1A 3VAMA 3V1OA 2WW8A 1PAUB 3DGVA 3V1RA 3J80Y 4C3LA 3CJKB 4ECTA 3GJQB 3VQEA 1FNMA 3RSEA 3DOKB 3CPWR 3H08A 1RTHA 1RHUB 2ASJA 2ZDOA 1Q18A 2K7JA 1LAVA 3WC2A 2I7NA 2BJEA 1GH8A 1W2BR 4M5IA 3ZZYA 5IS2A 3BF1A 2BJDA 5KFMA 1NMNA 4ZHRB 2C3MA 2OIHA 3DRXA 4LRBA 4WZQA 4UY85 5FLXO 3S3MA 4KHRA 3GCWP 3K7RA 1V3RA 4I6WA 1HBMB 4HTUA 3FJ2A 2R7TA 3VGVA 3TTDA 3IC1A 2E9ZA 1YVUA 4IZ9A 1G2EA 4AHCA 5AQZA 4JKCA 3B4DA 3HJVA 1JMTA 3ZETB 4B3SJ 2J9DE 5IWAF 3ISNC 2GQQA 5IM0B 4ZCIA 3D6TB 3QAUA 4RCHA 3QT8A 3J7YI 4IQMA 3L9ZA 1X4HA 2B51A 2NUBA 3JXOA 4UQTA 4B3SF 4CEEA 2YV0X 1W2IA 4J9PA 4DTJA 3JAMO 1KC8T 2YNIB 4EFHA 3MCPA 4M5NA 4KR0B 2JEFA 4IRCA 4MK9A 2V0NA 1P8ZA 2ZWPA 4CDIA 2HQCA 3SMSA 1V5IB 4CO0A 2LFVA 3SPZA 1Q8BA 4GW6A 4ZK7M 4YOUA 1QSSA 2DR7A 3MM9B 1YTAA 2M8DB 2JC0A 1DKGD 2P9LA 1BQMA 3ALYA 1F2HA 4P10A 2DR8A 4JI2J 3K9JA 4A59A 4CH1A 2FVQA 5C7PA 1SJRA 4NYZA 3C0BA 1O5JA 1LFPA 5HRNA 5KFAA 1PYTA 5C42A 1SC4B 4RWWA 4C1NI 2YKNA 4I2PA 1XNRJ 2QJ3A 3SZ2A 3WZ0A 5F0UA 1RWUA 3C95A 3AVJA 3QJJA 3CJ4A 3QLHB 3NKYA 4RW6A 3PIPL 2H5JB 3PIPQ 4W5RA 1HPZB 2HMPA 1CEZA 2DGXA 3KJQB 5EX0A 2AQ4A 3EX7B 3VF2A 1RFQA 2EW9A 4P75A 1HWUA 3GPAA 3M32B 4J9LA 1VQ8S 1WC6A 1WDDA 1S1VA 2G8IA 2P9NA 4BR2A 3RAXA 2LQJA 2HNYB 1SI9A 3THYB 2QL9B 1V9OA 2FJEB 2YWFA 5FJ4A 4OJGA 5EWGA 2ZM6K 1UETA 3GLJA 1S6PA 4LD0A 4LF5K 1YUWA 1I1GA 2PN6A 1JLEA 3AVKA 4N77A 3BDPA 4YR2A 5AQQA 4BR0A 3NWGA 3M7VA 3UKUB 4KGMA 5B0FA 2WVCA 1UVMA 2HFNA 2HW3A 3D2EB 5IV3A 3L7OA 4RNMA 4J37A 2ZHAA 4MO5A 5LSLA 4MKBA 3MGJA 1TZ0A 3MCNA 2O8DB 3VR1A 3I0RA 3IR6B 4LH5A 3K8VA 3CCQS 2GUPA 5CZVA 2JX2A 4ECQA 3J81Y 3AO3A 1UJ5A 4M3WA 4J9VA 2V94A 4GO7X 1S57A 4RL1A 3MWTA 2DHGA 2VJVA 3CGIA 1TYQB 3FE1A 3RZAA 2QWLA 2VG7B 1VQNS 2E5HA 2CZVC 2X3GA 3PJXA 4CZFA 5K8PA 1BCOA 4ILGB 2HG4A 4OQJA 1R0CB 2G8HA 3TU5A 2CQPA 3BH7B 4NLYA 4LBPA 2E44A 3P5JA 2CIMA 5J2PB 1JK9B 2P6TA 5H9EJ 2YHWA 3KK1B 3FRZA 2QKBA 1VIXA 1WN7A 6FD1A 2VPYB 4N56A 1Q53A 3CCQN 3R1LA 1X9WA 5DG9A 1V3ZA 1JXLA 3QATA 2IVFB 2O3DA 1X4FA 2C3OA 3O9UA 1TV6B 5DQGA 4WWSA 2KZMA 4K43A 2IJFA 3K5LA 1P27B 1QM9A 4UOGA 2O66A 4CHZA 1HWKA 1FKOA 4OKKA 4DV1K 3MHYA 4DR7K 1KXPA 1D1UA 4PYAA 2BQRA 2OEJA 1GLCG 1MDUB 2YKMA 1CJVB 5LMNJ 1GT8A 3MXHP 3TP2A 4YR0A 5EGYA 1SC6A 2FBYA 1QVGM 3BO4A 2M4MA 1AUSL 4IDKA 1Y5IB 3OTBA 4OYWA 4LRAA 1HR0F 4BDYA 2H4WB 3ZTPA 2EC2A 2ETJA 3MM5B 4CEDA 4XK8C 2Z1HA 2MSTA 2ZD1B 1FD8A 1X0PA 4LRDA 1TELA 4L72B 3MN6A 1WC1A 3RW7A 4CO1A 3MM7B 1YAGA 2HS3A 4K5RA 4ANCA 1XBWA 3OBYA 4I7FB 2Q43A 2PO4A 2CKWA 5H1SQ 1W0HA 5GIOA 1KQKA 3T7ZA 4EI2A 3VQQA 4GC6A 3CFRA 3D0HE 3ZSOA 2CJQA 4KKOB 1UZDA 4DXLA 3BQ0A 4DR5K 3SK3A 5BYRA 4I6MB 3CCUS 1U0HA 4ID5B 4BRIA 1R8BA 2AZ1A 4BCAA 5KT4A 1NOZA 1HLUA 4ISGA 3LA0A 3PRVA 1ZBLA 3T41A 1RT1B 1EKSA 2QLBB 3IRXB 2GBZA 3DXMB 4RPFA 3P39A 1DQ8A 1NGIA 4AQYJ 3W66A 2PY5A 2ZBPA 1YJWS 1RKIA 4C11B 3BV8A 1NGHA 2L41A 4P52A 3NGIA 4WFAL 1RJJA 4O3NA 4DV3K 4U8YA 2Z58B 3TUPA 4WK1A 4ZTFA 4JKGA 4GVMA 2F9WA 4M94A 2W4DA 4K2JA 4FWLA 3SV3A 3CPEA 1UA1A 2OMLA 1KVKA 2XMWA 2DY4A 1B4SA 2GGPA 3LH2S 3T1HJ 3M05A 1FRMA 3VTIA 3A3PB 1X3MA 2W2NP 3CCUN 3OFHA 2BANB 1S1UB 4Q8FA 1U1OA 3HVWA 3OR1A 5AQVA 2MJUA 3TAQA 5KFKA 1FFGB 1LWXA 3L7UA 1VK8A 4CJSA 1IKXA 4FWSA 3FFIA 2DIUA 1LWFB 4F0KA 4CFDA 3K2YA 2KL8A 3CJ5A 2E2QA 4KI6A 3LP1B 1RACB 1IKWA 1LWCA 3D0IE 4FJGA 4XEIA 4O5FA 2YY3A 3DYAB 4CJFA 4EO8A 1DARA 3G71S 2QA2A 2R2TA 1TVRB 4AILC 3P4IA 2VDHA 3N5FA 4LBHA 2L48A 3CJ8A 4JI6F 4IOXA 3U02A 2BE2B 2Z1GA 3KJFB 3T6BA 3HT0A 4TY8A 2G2ZA 4AE5A 5EY4A 3VWSA 1D9AA 1N5YB 1N54B 4DTPA 3ADAC 3P96A 3EDQB 2IYGA 1J5EJ 3QAEA 5L9NA 1VAZA 1NSQA 4M5JA 5ITHA 3KLEB 2VDIA 1V4SA 1FKPB 2MZJA 2I0XA 2XMTA 4KI4A 1J5EF 3KJVA 5L39A 5AQLA 2ILYA 4M8LA 2WVDA 4RW9A 4B08A 2AJ0A 3DGPA 2UUCF 2WONA 4LUBA 1R31A 3C15B 1EAYC 2WRMA 1SC1B 2OGUA 2PYLA 1JJHA 2WBNA 3H40A 2FJVA 1C0TB 4V1Ak 1AYEA 1ZTTA 2DFEA 3QT5A 8AT1B 3HSGA 3AB4B 1FK9B 3MM6B 4ZIVA 1UW4A 2W2OP 2DH9A 3FBFA 4DCJB 5KFHA 4PWDB 4A4JA 2JH3A 2FLNA 1OPIA 4CP5A 3W9JA 1CJTA 2V2KA 4BRPA 4UUXA 2WK4A 4OHVA 2XWYA 4U8VA 3ZSVA 4LRFA 5F8GA 2FBTA 1HQ2A 2MHNA 2BDPA 4KB7A 4M63C 3NF6A 5E3CA 2DNGA 1J53A 3C16A 3KK2A 3BGFA 3FCWA 2J0WA 5FRNA 3F9MA 4YN3B 1RAIB 2NRVA 3MN7A 4LH4A 4PPZA 2YH1A 1HNZK 5LL6Z 2WTUA 3AQPA 5HSPA 1K9MT 1A9NB 4LFAF 4HHJA 4E2FB 2YWGA 4C8LA 4AHVA 3M2UB 1IBMK 1QVFR 1CVJA 1X4AA 1O6XA 2ZJRL 2ZJRQ 3CF5Q 3P4UB 1D8ZA 5A0YA 5KFOA 3M8QA 5F8IA 2HHTA 1S10A 1GLBG 4KGXB 2UVUA 1YTYA 2EFGA 4B9SA 4DSJA 2G8UA 1SH0A 2V34A 5LSRA 4IO1A 5M1PA 5HQ8A 1IUJA 2EXUA 2Y0BB 5FPDA 3QIPA 2HGLA 2RQCA 2PA8D 2KN4A 4OGCA 4R8UA 1FFWB 3HKZD 2D5RA 5J2QB 2KB2A 3NMAA 1SJQA 2JOQA 4N7TA 2V4QA 2BRLA 3NP5A 3F9KA 2IMWP 3IWNC 2J0XA 3ZO7A 3GIKA 2R7SA 2LDIA 2GC8A 4RUHA 4FK2A 3F44A 5C2DA 4M5DA 1R8CA 4DQQA 1YZ7A 1ZH5A 4E89A 4IO8A 2KKHA 3MTKA 3M2RB 1RU2A 4TU9A 3D2FB 3IWLA 2DY9A 3N6LA 4OX8A 2YH0A 3PW5A 5E0OA 4MJKA 3TVYA 3N0VA 3W0LA 4FWPA 2FVRA 3AAWB 1RDCA 5FRMA 3VA3A 1RWPB 2CPJA 5J2MA 2Q0UA 5BRFA 4X64J 2GCFA 4TQSA 4ZCKA 4YNQA 3U3YA 4HR2A 1GXUA 1U8WA 1NUEA 2MQOA 4CLFA 3HVTA 1NHKL 3A0IX 3PJWA 4X62J 4LFBJ 2H65B 4QOTA 3Q89A 3VGUA 3KG1A 1T3VA 4I9QA 1TKXB 1Q5YA 4Z2XA 3POTB 3RB6A 2XHCA 2P9KB 4OVLA 2NXJA 2R7YA 4HL9A 4KC5A 2IY5B 2MB0B 4FWMA 4ANEA 2J7KA 3U1NA 3W64A 2K7KA 5C24B 3D6RA 5ADZA 3KHYA 2HQDA 5BR8K 2Z2YB 4FS1A 5KRSA 4F4ZA 2E2NA 3AVLA 4KB0A 3WNFA 4DU1A 2WUSA 1VRTB 2CNLB 5M2RA 2D1KA 2ZJQL 1SQGA 1BWEA 2ZJQQ 4LT6A 4TN2A 3GDQA 2I1RA 2B5JB 3I31A 2FD2A 1WHXA 4DR3K 2PD1A 4YDUC 4ZVEA 1XC9A 3JQJA 2VCPA 1VQ5S 4IFYB 1Z05A 4W5OA 1BWFO 2BJ1A 2IDOA 4EUVA 4URQU 4IKAA 5D4NA 2R8KA 4TSXA 5KPTA 4ANDA 1VJWA 2CYYA 2HWHA 1RDUA 2G0CA 3CJ3A 3DLKB 2UUBK 4PQUA 3ZNJ1 5B7WA 1K0VA 3E3XA 2HB5A 4LY7A 3WX4A 2C3YA 3HDSA 1S99A 1GAOA 3GV8B 3ZTRA 2RE2A 2QZ8A 1RT5A 3FSYA 2CJBA 4BRQA 2B4JA 3I0SA 1YIJS 2ZZMA 5AQHA 2DVIA 4N41A 4N5SA 2E5JA 3ENAA 2DK2A 4I2QA 2DXEA 1IBLJ 4X4UA 1I94J 4ALZA 4H0VB 3VPZA 5KFQA 2F8SA 4FP9A 3KG0A 4JI0J 5KT2A 2KLAA 2LA6A 4OX9F 3GV7B 2VQEK 2FQQB 4N76A 1ZBIA 1KFSA 4AL6A 1D3WA 4JI0F 4B9QA 1I6JA 2D9OA 1K8AT 1DT9A 4IWVA 4D3HA 2CPFA 1YJRA 1RCXB 3FQLA 1RZMA 2FLPA 1WOPA 1MWZA 3O3LA 4NASA 4L3NA 2ASYA 1ICEB 1T3NA 2VWJA 5IV4A 4JI4F 2E7WA 1YIJN 2FJAB 3AA3A 5BRDA 2OPRB 3LZJA 3T9NA 4FOEA 2V4JA 3CCSS 4E7JA 4USWA 2HVDA 1NB2A 3W65A 1OY8A 1URRA 4I4BA 2R7VA 4DUZF 4M3ZA 5KFNA 3OTDA 4DV0K 2FJWA 2CG4A 2E1MC 5DDRC 3THPA 4Y00A 1T6DA 3NRBA 2B4PA 2F1FA 3RG6A 4JV5K 2OPSA 4NXNJ 2EG2A 1ZYQA 1NXIA 4YB5A 1NKCA 3FRYA 3OYFA 1T3OA 3RBXA 3O80A 2NLXA 3LM2A 1KAXA 3KDNA 3TSQA 2X3DA 3TPQA 4RWTA 2ZDPA 2HIYA 3N6MA 1OY6A 3MMCA 1R8HA 4ITSA 2QX0A 3R7SB 2W1BA 1FRLA 4CM0A 4MK8A 4Z0UA 2QGFB 5J1EB 4O3RA 3MAAA 5L1KA 2LKZA 1BD6A 2F9JA 4FPBA 3EZUA 3FSIA 5CHCB 3RSEB 5HK4A 5FDLB 4LJMA 2VG5A 3O3HA 2BW2A 1Z26A 3PNIA 2NRWA 3BBFA 4CLPA 4MKYA 1GLAG 2KQ2A 4ZP8A 4M3XA 1EHWA 2CPXA 2DTJA 4KFBA 4ZA1A 1QTMA 1LNQA 4ZVGA 3GQCA 3Q22A 3PDNA 1H38A 3HD2A 2JVOA 3G6XA 3ENHA 3UR3C 2DBBA 4F26A 2CPEA 4CJKA 1AT1B 3GP9A 4A8FA 1S6UA 3EVOA 2IMOA 5D4LA 3OFFA 3S8SA 2RQ4A 1VQLN 4EO6A 2IRYA 2HHWA 4LF8F 3NAIA 4Q0BA 2G0IA 3JSBA 4Y28C 4LF4J 5CYMA 3E66A 4ZPCA 3ENQA 1LW2A 3NOGA 1RTDA 3ZZTA 5L8RC 1TK0A 3D4JA 3L3CA 4JI1K 4CW7B 1AZSA 2JLEA 3JS9A 1FRKA 5LY3A 2OTJS 1NZAA 4FF2A 4C8ZA 4CEFA 4CEAA 1FXXA 1JLFB 2BR0A 3K57A 4M7YA 1KLMA 4DQPA 2RT3A 4NO7A 1FJGJ 4GMKA 2W9BB 3BYRA 3AVHA 4FJ9A 3HK2A 3IP0A 4CYUB 1LXJA 5AXKA 3WXLA 3CJ9A 1YK9A 3BQ1A 1VHFA 3G6EN 5HAOA 2H1YA 2F3JA 3CCWA 3IXQA 3PYGA 1FJGF 2P9LB 4Q2LA 1BQMB 4WFNL 1X8DA 3Q8YA 3QERA 4WFNQ 3KNGA 5CXTA 4Z7YA 1IG9A 5CZXA 4QIFA 3VGKA 1RNHA 3R3LA 3R5CA 1VQ7S 4UTGA 1NU4A 1CPZA 4X65F 3IGNA 2B8QA 2H54B 1UL3A 5KFRA 3AD9C 2DTUA 3D68A 1QZ6A 5DQHA 2BMBA 4I2PB 3LWMA 3E2EA 4Z37A 4BRGA 2O8FA 2XC9A 2BUPA 3EICA 1KC8O 1UWBB 4FKXA 4P2SA 3ZTOA 5M1NA 1IBCB 4ECVA 1WSVA 1ULRA 5D0HA 1MU2A 3OL9A 1EIYB 3AA4A 4JHDA 4R25A 3VGLA 4KH1B 4Z4GA 4WXWA 1RDDA 2W9CA 2KU7A 1GLLO 2WFBA 1S7IA 2FLLA 1DTTB 1B0TA 4EWTA 1XTZA 1WORA 2C3PA 4P2XA 4EP5A 3QFWA 1S6PB 3F73A 1VQ7N 1U1MA 3CQYA 4WU2A 2F65A 2D9PA 1LW0A 1KQSM 1AROP 3IMQJ 5SWMA 2BUNA 3HHDA 4ZJLA 3IDHA 1EWQA 4A8MP 1HHQA 2R7WA 2V2ZA 1VQ9N 4RW8B 5ETLA 1RLCL 1VQPN 3MMAB 3UN3A 1HNXJ 1NM1A 3ILOA 4X66J 4IJNA 4CBXA 3FNNA 4UZCA 3MDFA 4ICLA 3ILLA 2XNRA 2QL5B 1N5VA 3EWGA 3GG0A 3RMCA 3BH6B 4LRCA 3D0GE 5AQKA 1HNXF 3OYNA 2LU1A 1FE0A 1B70B 3BSAA 1IKYB 3HD1A 2PMHA 4IR1A 2W42A 1H73A 1N5QA 1FFSB 2BJ3A 4YP3A 4DSKA 1SIWB 1F5BA 1UJ6A 2V8DA 1R7IA 3TNVA 1C1CA 5HLFA 2DH7A 1RK8A 3QBCA 2R8IA 3HOTA 2QTDA 3EGZA 2CNKB 4U7CA 2UXBK 1TUWA 2GAHC 4CM2A 3CDEA 4YOWA 1JLQA 4IOCL 4OFZA 4IOCQ 3CCTA 4FPIA 1NO8A 4M3RA 5GAHU 2CWKA 1U2FA 3GJSB 4J9MA 5AZJA 2DKOB 2CQBA 3JQMA 1WACA 2VONA 4KH4A 3DM2A 1RBUA 4I9LA 1RDAA 1IH7A 5HRRA 1VK3A 1F5AA 4OPHA 1TKTA 2QE5A 1ITPA 2Z1IA 3LQVA 4DJBA 4JKDA 2CZ4A 3ETOA 3D6FB 4PKHA 1YJVA 2RN2A 3OS0A 3VEVA 3HM8A 4LF9J 4IDKB 3J7ZT 1T9YA 3SYZA 3QT7A 2ILZA 4DPTA 4FLXA 4L8RB 2MHEA 1Q95G 4KTWA 1SQEA 3O08A 2DB1A 4A2BA 1ZAXA 2QG9B 3K89A 3AHPA 3GFZA 1BL3A 3QIOA 2Z56B 2ROPA 1HNIA 3JSMA 1TUYA 5CZ1A 3IM8A 4USTA 3N79A 4WP9A 3RYLA 5E41A 4RBTA 5ETNA 2J6SA 3SJJA 2M5YA 4FBUA 1JJCB 2YKAA 4TYAA 2P8IA 2AT1B 2Q66A 3GFXA 1NDCA 2VG6B 3I56S 1U1QA 3GE1A 3QJLA 4F7VA 3SI8A 1OVYA 4NCAA 4E1MA 2J8SA 2CJAA 4DTRA 3EE3A 4WKRA 2UXDK 1RA6A 4DMNA 2XLIA 1HNWF 1U0HB 4O0NA 2DFFA 4DI6A 2YWWA 4FYVB 3LTOA 2DNZA 3OL8A 4YHHK 3DLGB 2B7BB 5FLXY 5CA5A 1DQAA 2J6TA 3KHGA 1JNRB 4DQRA 2PBDA 3QNWB 5C2CA 1RT2A 2V7ZA 1Y64A 4LFCF 2O8CB 1FNOA 3M5RA 3CSKA 4BG8A 2IA0A 3W5XA 2E1AA 2OFGX 4FZZA 1H7WA 5KT3A 1NMDA 3PV8A 3KKFA 2GGPB 4CJUA 4M41A 5KOXA 2ZZNA 1WOQA 2DEIA 1IQZA 4V19S 2R8JA 1HUXA 1ASVA 4ED5A 2RKIA 2R4FA 4ENOA 1ATNA 4DR1F 4ES1A 4AT1B 4DSLA 4BR9A 4CO5A 3OR1B 2AIRB 3TWZA 5IQQA 4WPAA 5M2UA 4NEZA 2HQFA 4KT0C 5IWAK 4C7QA 3VQ5A 4BRAA 4ECXA 4I64A 2I5JA 1NH7A 5IT9O 1Q8KA 3MR2A 2Y3YA 1IKWB 2ZQBA 3H2LA 1LWCB 1MMLA 5HP1A 1GXLA 3DRPA 3UNGC 3MM8B 3U7JA 3ET6A 5GADU 2XYGB 2ZWOA 4OV1A 3OPKA 1ZS6A 1NEEA 5ADXA 2F8TA 4YUDA 4NYNA 4DL7A 4UOCA 1T8EA 2M2BA 4KTQA 3CHWA 2VU5A 3QESA 4XIUA 1ROFA 4J9QA 4TY8B 4KHQA 1ZM4A 4Q5VA 3GONA 1OKJA 1NDPA 2MYFA 2HMIB 1SPBP 4NLXA 2KI2A 3AY0A 2PMZD 4L74A 3H25A 2E5LF 1WSJA 4AL5A 2ZM6J 3AJDA 3AV9A 3V81B 4LF5J 2OPQA 5DJBA 2LQ8A 2W4CA 4NYOA 2FPHX 3M6UA 4R79A 3BSNA 5AQGA 1K47A 3GBTA 2B56A 1TGOA 2IPOB 2IFXA 4IFEA 3S9HA 3JQKA 5DQIA 2KT5A 3LDNA 3QRPA 1FHTA 2B7CB 3IO1A 5I4MA 2UU9J 1PC4A 1KQFB 2CQ4A 4JLHA 2AA4A 4M5GA 1T7PA 4KAIA 5GAHP 2RIJA 3TAMA 2BM1A 2WONB 4GV3A 5FPNA 3BR9A 4CEQA 5DG7A 1P1LA 3SCXA 5CABA 1IJEB 2FGCA 2MEWA 2H3EB 4OZLA 4HVZA 5CHIA 3UQSA 4XAKA 2ZOMA 2OPPA 4KHWA 5C0YA 3LP3A 4B3MF 1RWMB 1RBOB 3E9LA 3CXCR 2ADBA 3SEOA 4CF8A 1SS6A 1Y0HA 4LIWA 1WAJA 4BR7A 3HHNB 2Q97A 5BR9A 2HBJA 1CJTB 1U47A 5C12A 4JYAK 2H5IB 2W7PA 4ZVFA 3KHRA 3Q7BA 3DRSB 3RRKA 2G1HA 3G8SA 2AEMA 3BQ2A 1VSIA 3CMAN 2A3ZA 2ASOA 4P2MA 4KO0A 2V8GA 1SZ2A 5I3UB 1YKWA 2FGOA 2HFUA 3OQ2A 5L46A 4DSIA 4KH5A 1OY9A 4GRSA 4WKYA 1YVFA 3Q24A 5EXWA 2BJ7A 1YI2N 2RVJA 2GTDA 2MQNA 1Z2ZA 3G25A 1YBTA 3M8PA 1F6TA 1BOTO 4ILJA 3SSSA 3EYZA 4DR7J 3NGUA 4HI2A 3L8BA 4K4XA 2O8EA 4FJKA 4KTZA 2GWJA 1YJTA 2HBRB 4NWBA 4DV1F 3QIPB 3G8QA 4KPYA 3N28A 1K44A 3SDEA 3JYTA 2JEJA 2QA4S 2VBZA 3LP0B 3OLBA 4WCEL 1HHSA 2DNQA 5AE3A 4WCEQ 2GWKA 1N4LA 4OI6A 1K9MO 5DGAA 3IG1A 4O0IA 3ZC4A 4M5DB 3K58A 2AYGA 2UP1A 4OX7A 1HKAA 2OMOA 2C2EA 3NGRA 4O4GA 4ZJOA 4DR5J 4OYOA 1WI8A 2GMLA 4CD1A 3V4IA 2ZH4A 1HMVB 1C0FA 3AD7C 2PEBA 1BO5O 2AF6A 1WEZA 4ECZA 1HNVB 2NSCA 4DR5F 5BN9A 4HUFA 1RHQB 4CGFA 2PE8A 1HR0K 4H5WA 3HSJA 3HVTB 1UFWA 4OI4A 4ECUA 2QK9A 1MG7A 5KQ8A 3U9ZA 2NXCA 2ADCA 1TUGB 4PY5A 1S9GA 4ZTJA 2DO4A 4BREA 1BCMA 3N6NA 4DV3J 4CI6A 3P31A 4NMXA 5IZHA 4U9RA 4BC9A 2NXEA 3PHEA 2EFNA 1DAXA 5E3PA 2VGNA 2W7AA 1D9FA 5KRTA 3AOAA 3H7HB 1NLKL 3OUYB 2AGQA 3NVKA 4CF9A 4DV6K 3AA9A 2K2PA 2LMIA 1RA7A 2BKOA 2C3UA 5HL7L 2G8KA 5TKYA 5IT0A 4ZHRA 4O3QA 5HL7Q 1NJYA 2R7XA 5JLFA 2IVMA 3ZT2A 2BW7A 2FZGB 4IUFA 1HWLA 1HBMA 3TA2A 2PIIA 1NGFA 3FDSA 1VLYA 3PM9A 4KHUA 1IR2A 2AV5A 3EKUA 2DGQA 3TJAA 2Q31A 1L5UA 2QKKA 1RTIA 3TOQA 4K5SA 4C8OA 1WF1A 3ZCMA 4NYFA 5IM0A 4G6VB 3V4MA 1Y3KA 1UEUA 1LCUA 1FXRA 1PYOB 2V2QA 4PQUB 2QFJA 4UF4A 2RQKA 3LWLA 4B3RF 3NMRA 3HBTA 4NXMF 2O67A 1U48A 4USVA 1XI1A 2HFZA 1F21A 1RT5B 1LK5A 3M9OB 5HVHA 2WZ1A 1BA1A 1JIHA 1Q7YO 4DN9A 5DDOC 2P9IB 3VA0A 1D0EA 3GR1A 4HHUA 2A1SA 4FXVA 1L3TA 3MM9A 2HBMA 4ZLLA 4ATNA 2FJDB 1Q1KA 1X4CA 3WXIA 4DKWA 1NH8A 2WB1D 1XEZA 5K9FA 2X1FA 3ZEUB 4QR2A 2QLWA 1VQMS 4H54A 2XY5A 1FRJA 2HNZB 4FPAA 4N8NA 3Q23A 4MQ3A 2NRTA 1KN6A 3A3OB 2W8KA 4BRKA 3UN2A 4JI6K 1ZETA 3QLHA 4FNIA 4YY3K 4CBWA 3VQ9A 4FLWA 3MEGA 4LMZA 1HPZA 2O4IA 2V4JB 1FERA 2XG8A 5KOWA 3CE8A 5DDQC 1D5AA 3M32A 3F2KA 1TMMA 4FCYA 4OMFG 2XI3A 4FW1A 1KHWA 1S49A 1FT8A 5ETOA 5H1SV 5GAHI 2OPSB 5J1PA 4H4OA 2IBKA 3VEOA 2C2KB 5CYJA 1VQMN 4MMOA 1K8AO 2FZCB 2HBQB 2NZTA 3PG9A 4PQAA 4XH5A 3MMCB 4KHPF 4FZYA 1RTJB 2UUCK 3PKMA 3CJAA 2F9TA 2CNOB 2V52B 4LVOP 4ED3A 1WHVA 3CDAA 3MEDB 3SUOA 1AUDA 1LWEA 3PW2A 2NUUG 4PL7A 1DJ0A 3TRGA 1JNZB 5HQLA 1IBMJ 2D0AA 3L7PA 2NZCA 3HSCA 1VISA 3SBMA 3ZSRA 1OVQA 2VG5B 4BC3A 3QGPA 4X4SA 3I8DA 3EDRB 2UYTA 3S01A 1HNZF 3C6TA 2KXHA 2D7SA 1IBKK 3KWIA 2HEKA 2ZGZA 1RE1B 1WUUA 3AXMA 1NBEB 2BJ8A 3X3UA 2HFSA 5F3ZA 3ZYYX 1PJ6A 5KT7A 3RBZA 1WWHA 5E3QA 2ITGA 3US5A 2IIRA 4OYAA 2AGOA 4DV5F 2RRAA 4NRTA 3P8BB 4M5HA 4DR6F 4Q0BB 2GQ2A 2GIQA 2A41A 2Z2ZA 2HBLA 4WIQA 3KK1A 5F9LA 3H4DA 2KVQE 5KG7A 1S0VA 2K06A 1ZC6A 4QPTA 1LW2B 1E3MA 4LFAK 3D67A 1AZSB 4ZIWA 2ZF5O 3MTJA 5I9EB 2XGQA 2XYHB 3V1QA 2IJRA 3QO9B 4P71A 4JOUA 4DR4F 3K59A 3VEXA 1NSKL 2MKKA 1T03A 3D3BJ 2DCUB 3KJNB 3UCUP 4NRUA 3KWGA 3M2VA 2LXFA 3AGRA 2B4UA 1R27B 3LPEA 2NSBA 5KT5A 4IQXA 5EUHA 5KFIA 4DDFA 2AX0A 1KAZA 3HF5A 1WHWA 3OA9A 4HUGA 1HL6A 1HW9A 3MN9A 2ZBRA 2JEIA 4AH9A 1V3SA 3EVMA 1U7LA 3NY0A 3WNEA 1BQXA 4K41A 1ATSA 3A1YG 1DLOB 1EKRA 1Q0NA 1U0SA 3ONQA 3TZXA 5BR8J 1WKJA 3MM7A 4AUKA 3VZHA 4PABA 3L0QA 4I7FA 3OW2M 2O01C 1RAJA 1MU2B 5A6WA 3FEYB 4YORA 2PA3A 3VOVA 3VV2B 1RCHA 1VSMA 1A6LA 5BR8F 3K5PA 2W7OA 4JHDB 2FSNA 5T7LB 5C15A 3ISND 5GADI 4KKOA 4DR3J 2MQQA 2W9CB 3MEEB 1JB0C 4I6MA 4FLZA 3VQ7A 3OYHA 4DX7A 2EEYA 2IVPA 2R2UA 3H5UA 2FHJD 3ZTQA 4QPXA 3SBGA 2FJXA 4CJTA 4KSEB 1VLOA 3IRXA 3AO5A 3G4SS 3CUNA 2NRXA 4ISEA 4NL5A 4DN0A 4OJRA 2W01A 1UW9A 1NKBA 4YEAA 2EK6A 4RUAA 1Z6RA 2UUBJ 2KH9A 4JP8A 4PPDA 2HQIA 2DNMA 5GMEA 3LGHA 1U8SA 3MUMP 2M7SA 2ZVSA 2PFFB 2HFVA 2UUBF 2WTFA 2JJ4D 2CDQA 1QS4A 2NRZA 1QJHA 3JSRA 4ICLB 2XZDB 3VQ8A 2A40A 2ROEA 3ENBA 2V8HA 1GX6A 1H1VA 3R8EA 3NGYA 1UA0A 3QSYB 1S1UA 2ZVIA 4O8UA 3I8BA 1XWLA 3CMES 4OZ5A 1JWWA 5BYSA 3CCJN 3G4SN 5IT4A 2VQEJ 4OI1A 1CLFA 2DCLA 3MR7A 4RX6A 2G0JA 1VOMA 3HHKA 4JK7A 5A2QO 1LWFA 1C1CB 5HLFB 2NYIA 5AQIA 4JB8B 1NNEA 1NGBA 1FD2A 1XK8A 3PX6A 1AB8A 4QS9A 1T02A 2VGMA 4RUCA 2MZQA 3VEZA 3MPWA 2IOCA 3DYAA 2HQGA 3UIQA 1S97A 4HCBA 3MFHA 1TVRA 1WC5A 3PEJA 1KTVA 2BA9A 3VALA 3FZFA 4XDCA 7FDRA 4GKJF 3BP8A 1RHRB 1VQ4S 3CO9A 4DV0J 4KIAA 1H0HB 1PJ7A 4PKIA 5AQMA 3K5OA 1KWMA 2IM0A 1REVB 2A1BA 4YOTA 4JV5J 5THWA 5AXNA 4WP8A 2NREA 1TKTB 4OX9K 3LAKA 3SFGA 3ENWA 4DR2F 3R8YA 3I82A 3I9ZA 2XCAA 2F7TA 2LYVA 1IJJA 2QL7B 1ZXOA 1RDWX 2PSZA 1S1TA 3R1HA 1N52B 1WHYA 4HCCA 2G8FA 4Z7CA 4QWEA 3EY1A 1W26A 4KB1A 1P6TA 1IO2A 1BMQB 4UZBA 4OZJA 1HNIB 3JSMB 4JI4K 4CIGA 2QW9A 2VC0A 2CWXA 2C28A 4H0OA 4A8OA 3R97A 1MWKA 2IM3A 4FL9A 4IEEA 1SCJB 4DU3A 3C15A 2D3UA 2UVVA 3P5BP 4L76A 2N4CA 4WFBL 1XN9A 4WFBQ 2W40A 2X7IA 3PVXA 4DUZK 3V6HA 2XGPA 3QFUA 1FK9A 2WHOA 2Q1NA 3CMQA 4ERDA 2QSWA 2WSEC 3TA0A 4GVEA 2M8HA 1Z1ZA 1N8RT 2V2VA 4O44A 5B0AA 3J7ZO 5I42A 3SAFA 3V6KA 1VRUB 4EZ9A 4LSNB 2LA4A 2EK1A 4NCGA 4K4ZA 2MSSA 3RUBL 5AQNA 3MUVP 2DXDA 1UP1A 1HHTP 2EC0A 4RO0A 4LF7F 1W97L 1SBRA 2SXLA 1LOUA 5KFGA 4JI1J 1Y9OA 1UPMB 3QBXA 2L9DA 2OKQA 4DQSA 2EG1A 4PXDA 1SV5B 4CJ5A 4R5PB 1U1NA 1YBUA 5AXMA 1S59A 3ULDA 3T6JA 3ZFVA 3W3SA 3M2UA 1XNQK 3DMJB 3CD6N 1YHQN 4FLTA 2JVRA 3CDUA 2HF4A 3BF3A 3DJCA 1AA1B 5BPMA 4CJWA 3J8AA 3KK7A 5E3RA 2VOPA 2KM8C 1REGX 4Z4CA 5LM7E 4LF8K 4ZVTB 1ITGA 1NGEA 2PYJA 3DNCA 3V9WA 2BVZA 2P5VA 2I5JB 1H7XA 1NK9A 3V5RA 1XIQA 4JK8A 2OAUA 5J2QA 4CBUA 3EZWA 4X84A 3OJUA 2ASLA 2YJFA 4O55A 2H9ZA 4CI0B 2XZWA 4KREA 3PYEA 3QGHA 4RLEA 2EFQA 3ULEA 1YSJA 2CQGA 5F3TA 5DS7A 4C0OC 5SUHA 3J80O 3FBEA 4JI7F 2E8AA 5FD1A 2VA3A 1IVZA 4QU7A 2BGGA 2ACYA 3M2RA 5CH7B 3D2FA 3GTYX 3NGDA 1SKSA 4RTFD 4PR6A 2VD3A 2E1CA 2UUAF 4TVAB 3NFAA 3WNGA 3SJHA 3JTNA 4NLBA 2HRTA 2X1GA 3G9CA 4J2AA 3IA0A 1Q5VA 3NGKA 4CJLA 3P38A 5FLXU 1KSPA 2DGWA 4X65K 2CFXA 3O6WA 5K14A 1F9HA 2QA1A 3TUZC 2GJ2A 4PXCA 5EHHA 3MI7X 3NCPA 3SQGA 1SQKA 3O5BA 3W3DA 2FTRA 3M8WA 3WDOA 4B9MA 4CHNA 2XBPA 2H51B 2VHGA 2ZE2A 1TKXA 4F8RA 4J2BA 4CHOA 3D2WA 3MMVA 3TAMB 4GV6A 5C24A 3K17A 3MWBA 2YQ0A 4X4QA 5KFCA 3QFHA 3SUPA 2AU0A 1NDLA 3I9V9 2FHJA 4NLTA 3ZZOA 1JCFA 4FZXC 1YJ9N 2NPIA 1Y7PA 4FK4A 3NAHA 3HFVA 3DI6B 2JFKA 3GJTB 3JAMU 5LL6d 4W92B 2OPPB 4CF0A 4ILRA 1RAEB 4OZNA 4YDDB 4K4VA 2QWPA 3VENA 2XY8A 2B5JA 2FSJA 4ED0A 4YOEA 1R3NA 1UVLA 1KCFA 3VAHA 3T5HA 1OYEA 4G1IA 3QEPA 4WYLA 3W5YA 2XMAA 4FM0A 1TTHB 1J27A 1S79A 4X4NA 4WYWA 2AZ3A 1F3VA 1ZM3A 1TUUA 3NNHA 2J9DA 2ZUAA 4CIOA 1GTEA 2RB7A 4A8YA 2ALZA 2KYXA 3OHAA 1LXNA 4BWJA 3GJRB 3AD8C 3MXIA 3QNNA 2UXBF 3NS7B 3ZSYA 2HLUA 3DLEB 1EJ7L 2HK3A 4A8QA 1NHVA 1UZHA 3BPSP 4Y3CA 4B9NA 4CGIA 2DNLA 2A6MA 4F3TA 3LOUA 4BS2A 3S41A 2HF3A 3D0PA 1G6BA 4E7KA 2DR9A 3WT0A 4ZOSA 3AAPA 1XNRK 1XQIA 4PUOB 2XQCA 5I3QA 2UUTA 1XMOK 1OSCA 1A5VA 2G13A 2X6SA 1S0OA 5EN1A 4QR0A 1NWKA 3PSIA 6FDRA 1KEKA 1HBOA 2GS8A 1U25A 3SDEB 2MKHA 4CNYA 4L73A 1E6YA 3JYTB 3CC4N 1VSLA 2F5GA 3A8JA 3RMBA 4DCPB 2E20A 3HP9A 3AT1B 4CRJA 3C7NB 3BKFA 3IG1B 5ETRA 3E9PA 4KGZB 5J2NB 3IRWP 3ID6A 2OPRA 5LXYA 1MA9B 4BROA 4CLTA 3CCRS 3QSIA 2UXDJ 2MQPA 4CFAA 4CO2A 3J81O 3PX0A 3V4IB 5DLFA 4AD6A 5LJ3Y 3PRDA 2RAQA 3Q2TC 2QN6B 2BZ2A 4YHHJ 3KWMA 1OQ6A 1QDUB 4JS4A 3A13A 4CEOA 3MXJA 3V2UC 3DLRA 3T5LA 4IBNA 8RUCA 3DXBA 1TU0B 5B0EA 3LF0A 3MMBB 2GMJA 4QIWD 2RILA 1RHKB 4ED6A 3SNNA 3VAJA 1Z4UA 2JL9A 1Q79A 5J1EA 3M4XA 1WDTA 2W2MP 1VSKA 2DY1A 3BGLA 4G3IA 2EPIA 4RNOA 3GB0A 2Z0GA 3MPYA 3AO4A 1UMJA 5FDLA 2IJNA 2MQ8A 3O8WA 3EJMA 4EP4A 4FYDA 3MF5A 2WSCC 4UW2A 2NXUA 5H9EK 1KQGB 1HNWK 1HBNA 1SJFA 1R0AA 1WOOA 3SQ2A 3S3OA 4WFZA 3Q8PB 3HLUA 4ECWA 1WC4A 4ZPWR 1C0UA 5IWAJ 3G86A 5HATA 3V9XA 3D45A 3K0SA 2B4VA 4P6QA 4J9RA 2JWLA 3KLGA 1M90T 4Y1CA 1GOAA 3CJBA 1T9WA 2FXUA 2D0OA 1RTIB 4LFCK 4ZVOB 4PG6A 3IBCB 3J7Z5 4Y2MA 1AFIA 2BOAA 4NA1A 4USMA 4EU0A 4YDXA 2PZSA 3R1XA 2HZAA 3SQOP 4CZGA 1ZBHA 1G1XA 1N56A 2VFUA 3T1AA 1HJRA 1UKUA 3G8TA 5ELZA 1RCOB 1WKLA 2NLWA 4H5VA 4FVUA 3E8OA 1BE4A 5GMDA 4UOFA 4M5MA 4HACA 1JLFA 4USIA 3E01B 4WU3A 4DR1K 2QI2A 1C0GA 1R8AA 1FDAA 4ZP6A 4F25A 5DLGA 2W9BA 2D4WA 4K50A 4CE9A 2XS2A 4EMDA 4O23A 4CYUA 1RT7B 3G6VA 4DB3A 2ZOFA 4BGBA 3CNQP 3OT9A 1RI7A 3ZT1A 3HHEA 1GMWD 4A47A 1SIZA 4ILMA 3CETA 4DLEA 1NJXA 5DZ7A 2OI2A 2PDAA 4FWOA 3SMZA 1TAUA 3O9RA 3CM5A 2P9CA 2YX4A 4JKEA 2YPYA 4M5LA 3EPIA 1E4GT 1NU0A 5KFBA 1HYSA 6AT1B 5E5NA 2A42A 3HI9A 5DZ6A 4BE0A 3DU5A 2RF2A 1RBVA 1UWBA 1SUQA 1WG5A 1YVNA 4Y65A 3ATVA 4CK3A 3MEGB 5AQOA 1RKJA 4NPOA 3QBWA 1S9EA 2BKNA 2XNQA 2G8WA 4CLKA 2W2PP 3RTVA 2N3OA 5HMXA 2D41A 4AM6A 4HEA9 3MD3A 2E5LK 3CVKA 3QPIA 3UNYA 1N33F 1HIYA 3S1TA 3D7EO 2E2OA 3WEEB 2QA4G 4DV4F 4DPUA 1DTTA 1WBBA 3G0ZA 4H4OB 2DHAA 5LMUK 3PTWA 4JYAJ 4BACA 5D0RA 2RRBA 4C8KA 4I56A 3FBBA 2ZGYA 1Q9YA 5AJ3F 5IC6B 3VQDA 1FWKA 1XHZA 2G2YA 4KBIA 4JYAF 1SL1A 1DTQA 3A5MC 4RW4A 1RGIA 1N6QB 3PR5B 1F5CA 4CFBA 3HJFA 4DS4A 5KI6A 1TFWA 2PAVA 1LWEB 1RAFB 4RW8A 5EDWA 3DKDA 1UAXA 3MMAA 2CZ9A 4BR4A 4OZ3A 3VEYA 3SFUA 3NCRA 1VQ8N 2ZNZA 3C6TB 2DNYA 3EN9A 4DMZA 4HYKA 4B3MK 3KNAA 2O8BB 2DR5A 4NLCA 1P1TA 1VHXA 2QV6A 4JKFA 3BJYA