3KLFA

Crystal structure of wild-type hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
total genus 139
structure length 553
sequence length 553
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klfA05
3K5OA 1ZBHA 3WNFA 1EETB 4LSLA 5KFMA 4M3TA 3WNHA 3C95A 1LW0B 3KLEA 4OLAA 2B43A 5DLFA 2A1SA 3O4NA 4WYLA 2OPSA 3K59A 3CM6A 2HW3A 4FJ8A 1S9EA 4CFDA 3OYCA 1QSLA 1UWBB 3PW7A 1JLQB 4CIFA 4Y2AA 5KFSA 1N5YB 1J9AA 4K4XA 4URQU 4K4ZA 1VSFA 1HMVB 1RT6A 2ITGA 5HRNA 4PUOA 3PY8A 4Z4GA 3O3FA 3SUOA 3KK3B 1T03A 1RT1A 5FDLA 3CWJA 3H4DA 1JLAA 5K14B 1A5WA 2VG5A 1YVFA 3G86A 4CFCA 3JYTB 1RBSA 1K1QA 4K50A 1D9DA 3MAQA 4IFYB 1N4LA 1EXQA 1RA7A 3VQBA 5DLGA 4OJRA 3L8BA 3QEIA 4IKAA 1DTTB 1MMLA 4OGCA 5KFNA 2YNFA 1A5XA 2FVRA 1TKTB 4ELUA 4JLHA 4ZVFA 4CF1A 4RW9A 2ALZA 4M3XA 4CJLA 3V81B 5KFPA 2XY6A 2IM0A 5F8GA 4NCGB 2GIRA 3CVKA 3KLIB 4NCGA 3OYEA 3V9ZA 4FJ9A 3DRRA 1XC9A 3D0PA 5C5JA 3V81A 3GQCA 5SWMA 4B9VA 5EWGA 4E89A 1ZTTA 3B6PA 1SKRA 3FQLA 3THVA 1LWCB 4CERA 4J9NA 1YVUA 4Q0BB 3NF8A 1F21A 1KSPA 3HHKA 3MTKA 3V6KA 1RTHA 5CYMB 4DTXA 4IFYA 4O44A 3TWHA 2ILYA 3Q8PB 5K14A 4FLUA 3IG1A 4FLYA 3HPGA 1KVAA 1HNIA 1T03B 2D0CA 4CCHA 4O3SA 4TQSA 1HMVA 4CK2A 4CEZA 3QESA 3NGZA 4NCAA 4KB7A 3I5BA 4FJ5A 3EPGA 3QGGA 3QYYA 1S1TA 4Z0UA 1D0EA 4JS5A 4CHOA 3L3VA 4FM2A 4N56A 2OPQA 4KHNA 4DLGA 3QO9A 2QKKA 3DLHA 1LW2B 3SNNA 4O3OA 3SJJA 1RT3A 2ZE2B 2GC8A 1ZYQA 1FKOA 1QSSA 3DYAA 2YNIA 4CFBA 4ECZA 4MIBA 1CZ9A 1IKXB 1S1UA 1CSJA 4AHSA 4ID1A 4WXOA 2X78A 1HQEB 1VSIA 1J53A 2ZQBA 3BSOA 4Q43A 1TQLA 4KFBB 4XIUA 3N6NA 4EZ9A 3LPUA 2JGUA 5J2MA 4J2DA 1LWEA 2IGIA 3LP3A 2G8KA 5L1IA 4KHMA 4DLEA 4R5PB 2KTQA 1RCHA 2ZD1A 1IKYB 2R2SA 4HHTA 3TAFA 1BIZA 5KFZA 1T05A 3DMJA 3DMJB 4QPXA 2UVWA 1C1BB 4EBCA 3VQEA 3OYFA 4CGFA 1Z26A 1TVRA 4Y3CA 5KFYA 1REVA 3SZ2A 3ZT1A 4DQIA 3KKRA 3BSAA 4TYBA 4M3UA 1VK0A 3CO9A 3DLBA 4CJ4A 3ITHB 2J6SA 1IKXA 2B6AB 2HWHA 4J9OA 5CY4A 1Z4UA 2AJQA 4PWDB 3DI6B 5KFRA 2VG6A 4CK1A 1YT3A 1IM4A 5EU7A 3AV9A 1WSIA 2QXFA 5KFBA 4KPYA 4IR1A 3NHGA 2FBXA 2JEFA 4KRFA 5KFCA 3SUNA 3T5HA 1YTUA 1RDAA 2YV0X 5KFOA 3KLGB 4FJGA 4E1MA 3QETA 4CHPA 1D9FA 4QWAA 4J9LA 2PYLA 1TAQA 5KFKA 4FLWA 1FXXA 2HHVA 2ETJA 1TP7A 4AHVA 3AVHA 3AVKA 2P5GA 4FCYA 3P5JA 4NZ0A 1ZBLA 4ZP7A 2EHGA 3MR6A 5C42B 5HROB 2O4GA 1SKWA 4EO6A 2C28A 2FBVA 2R7YA 4CJRA 1U04A 3NL0A 1KVCA 3QIDA 4N41A 5KFFA 4GW6A 3ZSVA 1IO2A 2HHSA 1LWCA 3IGNA 3UDLA 4JRPA 4KHWA 3CDWA 2YNHA 4FM0A 1TL3A 4I9QA 4O0IA 1S48A 1UOCA 1LV5A 3RB4A 1RT5A 3RMBA 4K4TA 4IH6A 3UPFA 4IG3A 3SCXA 2OPPA 1NJWA 4XO0A 1NK0A 4OKKA 1TKTA 4R8UB 2HNDA 1N6QA 3C94A 4QWBA 2WB4A 1NK7A 4M41A 1QQCA 4FJ7A 4FZZA 3HP6A 3PVXA 1REVB 3SFUA 4B9TA 4NRTA 2GUIA 3DRPB 5J2QA 4ECQA 1CXQA 5KRTA 3JYTA 2PY5A 2YHBA 1BHLA 5F8IA 1RT1B 5FDLB 4QW9A 5DQIA 4IG0B 4C8KA 3DRPA 4MFBA 4I2PA 1A5VA 3PUFA 3PW5A 5C24A 1RTDB 5J2MB 1D8YA 1N5YA 4RW7A 2GIQA 1HPZA 1JLQA 4YMEA 2FJWA 4KHUA 1HYSA 4Q44A 4H54A 1IKVB 4GVMA 5KT5A 1ZTWA 4TQRA 1MU2A 2IA6A 4IOBA 4M3WA 2W9CA 4BACA 3S3OA 1S1XB 4IG3B 4URGA 1DLOB 4DSIA 5F9LA 4J9SA 1X9SA 2R8HA 4O3NA 2AGOA 2FVCA 4B9MA 4RW6B 4C8LA 3IRXA 1WNEA 1QAJA 2OPQB 5KG3A 2YNHB 3OL6A 1EKEA 2E9RX 1J54A 3CIZA 3CQ8A 3M8PA 2RDJA 4K4YA 4ZP6A 4O3RA 4YQWA 3H40A 4RW4B 3NAHA 2BANA 2BE2B 3NBPA 1JL1A 1RDBA 4IQXA 3BGRA 4JRQA 1FK9B 3KHLA 1TKXB 3NKYA 2FLPA 2R2RA 3BR9A 1RT7A 4J9RA 3MECA 4F8RA 3RBDA 2W9BB 4J9KA 3CJ3A 3H4BA 5DK5A 1NNDA 4RW4A 1RTHB 5SZTA 4DFPA 4BDPA 5KFJA 1WSGA 3BSCA 4HVJA 4FK4A 1C0MA 3OYLA 4AHCA 4K4WA 4DTSA 1CLQA 2PZSA 1KTQA 1VSJA 3DLGB 2XO7A 3M9MB 2XWYA 1BISA 4EZ6A 2DFHA 1X9MA 4LSNB 1X1PA 4CJEA 4CEDA 3PJWA 2W9CB 3VN5A 2FVPA 4PWDA 4BE2A 2B6AA 1HARA 3ITHA 4CJTA 4B9UA 4F4XA 4FJXA 4CF0A 3KK1A 2VA3A 3PHEA 3GV7B 2RKIA 4DTOA 1XR5A 4KB1A 3TI0A 1SH2A 3CDEA 1RDDA 4RNHA 3HVTA 4G3IA 3LP1B 4ZPDA 3OYKA 2HNZA 4B08A 2BGGA 3KKSA 3HT3A 4CGDA 5DG7A 4ZPBA 4R5PA 3SQ0A 5DQGA 1IH7A 2V0NA 1ASUA 4O5BA 3MEGB 3OL8A 1IKWB 4OPKA 4ZHRB 4F4KA 1N6QB 5KG0A 4KSEB 1S1UB 4H8KA 3RR8A 2JC0A 4O55A 1Q8IA 4EYIB 1TK0A 1WSHA 2UUTA 4IDKA 4MKAA 3ZT2A 3DYAB 3OY9A 5C25A 3HVAA 3GILA 1QS4A 1BIUA 4J2BA 3V1RA 1LW2A 2IAJB 3QO9B 3H98A 1VSLA 3GV8B 3NFAA 4DFMA 3HM9A 1FKPB 2HMIB 3QEXA 3QIPA 3KJVA 3U3GA 3KMQA 2XCPA 4IH7A 4IRDA 1XR6A 4F4ZA 2JEJA 2RPIA 2B5JB 4KTQA 3OLBA 3TABA 4NLDA 2BQRA 3NF7A 4NCBA 2RN2A 2ASDA 4NLTA 1BQMA 2HVIA 3TAMB 2V4QA 3E01A 4Y2CA 4JV2A 3NF9A 2QKBA 3WNGA 3K58A 3M8QA 4CIGA 4E19A 1ZETA 5KRSA 5HRRA 3MEEB 3ZSQA 5KFEA 2E4LA 4ELTA 5I3UA 2IS3A 1VSHA 4MK9A 3SFGA 3NGIA 4KO0B 4E7JA 4IBNA 3SYZA 4E1NA 3KLFB 5J2PA 2P1JA 2W42A 3H08A 2Z1GA 3C6TA 5F8JA 2ILZA 4DWIA 4FXDA 5F8LA 4YP3A 3RMAA 3OJUA 4OLBA 5JXSA 4CJ5A 2R2TA 3DRRB 5J2NB 2HHQA 1JX4A 3KLIA 4KKOB 5KG1A 3D5MA 3I0RA 2UVRA 3LPTA 4KE5A 4ZVEA 3VQ6A 4CF8A 4CHZA 3SQ2A 3DLKB 3QNOA 3HSTB 1D1UA 3MR2A 4DL3A 3QEWA 1S49A 2YNFB 3AVNA 4DL2A 3PX6A 3ZSZA 3QLHB 3AVGA 3CJ4A 4ID5B 3AVAA 1NJYA 5HP1B 4J9MA 5J1EA 2AX1A 3L3UA 4KHQA 3SUQA 3SI6A 3V4IB 4EP5A 3G6VA 4FLTA 3IGVA 2D41A 4CEQA 2HHWA 2ATLA 3PX0A 4U6PA 5EUHA 4YNQA 3ZSYA 4RU9A 1VRUA 4NLYA 4WFYA 4XPEA 3B6OA 3RB0A 1SH3A 2E6LA 1S1WB 2OZSA 4IFVA 4Q45A 3OYMA 1HYZA 3VQ4A 1SV5A 1RT2B 4DQQA 3RWUA 3I5CA 4IH5A 5KFQA 4O0JA 4B9SA 1HQEA 4ZVHA 3V1QA 3GIIA 1LAWA 1JKHA 4B8AB 4FJHA 4B9NA 3KK2A 3T19A 2A1RA 3KLVA 4F4YA 1JLEA 1LW0A 2XY7A 4FJMA 2ZE2A 2CKWA 4LY7A 5KG7A 1QHTA 2PYJA 1S1VB 1RA6A 4CJQA 3CJ5A 4OL8A 2XRIA 4E3SA 1KHWA 3TANA 3KMSA 4I7FA 2YKNB 4KBIA 3T5JA 4AHTA 4RNOA 3OYJA 4W5NA 4ED0A 4Q8EA 3PO4A 3DLRA 3OJSA 3I0RB 1LWFB 3DRSB 4FLVA 3ZT0A 3UR0A 1B9DA 1Q9XA 2UVVA 3V9SA 1TGOA 1JLBB 2RF2A 4DQRA 1KCFA 4EO8A 3KD1E 1ZBFA 3ZT3A 4HUEA 3C6TB 5HLFB 5JS2A 3A2FA 3AVBA 1SUQA 3RRHA 2JLEA 1S0OA 1TL1B 3MEDA 3K5NA 3RRGA 3LWLA 5HRSA 4TXSA 3PR5B 2DTUA 1L3VA 5CZ1A 4HUFA 5I3UB 4F2RA 4F4WA 2E9TA 4L8RB 3DLEA 2R8GA 4Q0BA 4CJFA 1UA0A 3OYHA 3HK2A 4QAGA 1U47A 2KQ2A 5HLFA 4M3RA 4DQSA 3EPIA 1C2PA 2RF2B 5KT6A 3TAMA 2JEGA 3TAPA 2BR0A 5DGBA 2XY5A 3KD5E 2HVHA 1NHUA 1JLCB 5KFGA 4M94A 1LWFA 3DRSA 4DL4A 1HNVB 2D7SA 2XHBA 4G1QA 1WN7A 2YKNA 5HBMA 3M9NB 3LAKA 4DFJA 4QW8A 2IDOA 3ASMA 3MXJA 5EWFA 3NH1A 1RDCA 3JSMA 3AVMA 1J5OA 5C25B 3VQPA 5I42A 3KK2B 3KOAA 4IDKB 3RAXA 1JKHB 4JUZA 3F9KA 3IAYA 2VG5B 1BQNB 4MIAA 2D0BA 5CYQA 3AA5X 1R0AA 1SV5B 4ZTFA 1S9GB 1X9WA 1ZBIA 1VSDA 3VQ9A 4CGHA 1S1WA 3CFOA 4J2EA 5EDWA 2O4IA 5CYQB 3P1GA 4O4GB 2WOMA 3AO4A 4I9LA 4QWDA 1RTJA 3T1AA 2HNYA 1ASWA 2OPSB 1W25A 3OSPA 2W8LA 3PZPA 1L5UA 4RNFA 3KLEB 3LZIA 5KT7A 4EBEA 4FYDA 4DS5A 2VG7A 4ID5A 1VSMA 1EETA 4NLVA 3BSNA 2F96A 4ZP8A 3UQSA 2DFFA 2RKIB 4ZP9A 5L9XA 1LAVA 4N47A 1KLMB 3DDKA 4AHRA 4DU1A 1Z25A 4CHQA 1JL2A 5HBMB 2HHXA 1C0TA 5KT3A 4G1QB 1N56A 1SH0A 2KW4A 4KAIA 4O3PA 4M42A 1EX4A 4H4OB 2VA2A 1O1WA 3FQKA 2IM1A 3CM5A 4TLRA 1UAXA 2IJFA 4DSLA 4DTJA 4U7CA 4ZVGA 1U48A 2DPIA 1NK4A 1WSJA 1QE1B 4W5RA 3QEVA 4J9QA 4DTUA 1T94A 3ICLA 5KT2A 4KO0A 4H4MA 4FLXA 3OL7A 1WNSA 4DF4A 2W9AA 2RDIA 4IRCA 4C8NA 1RILA 4KI6A 4HCBA 2YKMB 4QWCA 3MEEA 3C6UA 4CF9A 1U09A 2W9BA 1TL1A 2G8UA 3FSIA 2I5JA 2Z1IA 4BWMA 1YTAA 2R8IA 1XWLA 1SUQB 1KFSA 4JV1A 3TR8A 5L1LA 2J6TA 3LP2B 5KFIA 4E7IA 3HP9A 2WRMA 3TARA 3HVWA 1JLBA 3NBPB 2BE2A 2BANB 2P51A 1DTQB 5F8MA 3OHBA 3AA2A 2BRLA 2C2RA 4CE9A 1SKSA 2G8HA 4Z4FA 3L2VA 3L2QA 3KJVB 2WONA 4I7FB 4NYNA 3OYDA 4CEOA 1NOZA 3QIOA 3RBEA 2BQ3A 2E6MA 4UQGA 1C1CA 3BJYA 3HPHA 3MR3A 2IM3A 3QZ7A 3GYNA 3VQDA 3H5XA 2X74A 5KT4A 3FFIB 1S6QA 4WE1A 3SQ1A 4HKQA 1DLOA 3DOKB 3LZJA 1EP4A 2XC9A 3I0SB 4X2BA 2FC0A 4BE1A 4TSXA 2YNGA 2WOMB 3IRXB 3QGHA 3NGYA 3ZCMA 3SV3A 4KV8A 4PY5A 4LQ3A 3QINA 1GOAA 3ZSOA 4AHUA 4TYAA 3SPZA 4I2PB 1S0MA 3BQ0A 2D3ZA 3LP0B 4EBDA 4CJVA 4FJJA 4KTWA 4DTMA 1RYRA 1VRUB 4FBTA 4ED1A 4K8ZA 2ASLA 3GIJA 1RBUA 3I8DA 3NH0A 2O5DA 3FRZA 4WZMA 5DMRA 3V9UA 1SL2A 4DMNA 1T8EA 1C0UB 4CHYA 3Q8RB 3DM2B 5J2QB 3HVTB 4ECRA 3CYMA 3H2LA 3NH2A 2FBYA 3G6YA 1VSKA 5HP1A 1J5OB 3HJFA 4NLPA 3ZSWA 4F3OA 1NK9A 2IBKA 4FS1A 3E51A 2WHOA 2OPRA 2AU0A 2V9WA 2DPJA 1RT4B 1WAFA 4E7LA 2OYQA 3F73A 1TKDA 3AA4A 1QAIA 1S0NA 3OS1A 3VQQA 2OPPB 1RT4A 1TAUA 1NKCA 3ALYA 3KNAA 1NKEA 2AQ4A 2HB5A 1JLCA 1I39A 3KLHA 4B8CA 5J2NA 4DU3A 5JUMA 1NKBA 4NYZA 1U4BA 4BWJA 1BI4B 3DM2A 5KI6A 4WFXA 3CDUA 2JEIA 5J2PB 3D28A 1KHVA 4OKEA 4Z4CA 5FRMA 4MK8A 1VRTA 4TY8A 4CJSA 2G8WA 4RZRA 1RTIA 3LP0A 2Y1IA 5L1JA 3T5LA 2BDPA 3D45A 4LQ9A 4ICLB 3PR4A 4NLSA 2OZMA 1JLFB 1S6PB 3K2PA 3NF6A 4FW2A 4CGGA 1RT7B 3ULDA 2YNGB 3P83D 5KGXA 1FK9A 1HQUB 3VQSA 4ECUA 2WK4A 2EC0A 1EP4B 4FLZA 2F8SA 4FJKA 5KTQA 3RTVA 2B5JA 1T7PA 1RAJA 5FROA 3V6HA 4NLQA 3HXMA 4URSA 4FS2A 4W5QA 3M8SA 3G6XA 3PO5A 5KFLA 2IAJA 1KRPA 1ITGA 1GOCA 4RW6A 5KFAA 1G15A 2KZZA 4DQPA 3L2UA 3KHHA 3CG7A 1S1XA 2R8JA 3AO5A 3IN5A 3DI6A 3RMDA 2G8IA 1IKVA 4NLXA 1HYSB 4ZHRA 1NJZA 3EY1A 4EYHB 3QNNA 4CK3A 3MEGA 1BCMA 3I5AA 4ZPCA 3OYIA 3S3NA 3SUPA 4IG0A 1RTIB 1XR7A 4CJUA 1VRTB 2C22A 1C1BA 3LAMA 3OSNA 2AGPA 1I6JA 3GV5B 3AVCA 3AVLA 3BREA 4OPJA 1WLJA 3VA3A 4FK2A 3HPOA 4K4VA 2XGPA 1QE1A 2CJQA 5DG9A 3V6DB 3RB3A 1BI4A 4DTRA 4N76A 5J1EB 3BQ2A 4NRUA 4KI4A 1VSEA 2FVSA 4ZMMA 3KLHB 4HTUA 3BQ1A 4ED6A 1L3TA 3QLHA 4R8UA 4KAZA 4CJKA 3VQ8A 1RDRA 3HL8A 5EWEA 4M3YA 1HRHA 3DLKA 3ZSRA 1I3AA 1RNHA 2Z1JA 3AO1A 1RYSA 1U49A 2BRKA 3NMAA 4YFUA 5T14A 1RT5B 1Y97A 4KKOA 4ECWA 1TKZA 1W0HA 4M45A 3NE6A 4JV0A 3CJ2A 4QCLA 3V6DA 2HNYB 1KVBA 1C0UA 1NK6A 3SQ4A 1S1TB 2XGQA 2DY4A 3OYGA 3AO3A 2WCXA 4MK7A 4ED3A 1S10A 3NDKA 3VQAA 1L3UA 4BDYA 3RB6A 4CEBA 4F2SA 1S5JA 5C42A 1UA1A 4QOZB 1R0AB 3SV4A 1B9FA 4DG1A 2AWZA 1N48A 3WNEA 3U6FA 2FLNA 2IC3B 3TAQA 3E01B 3I0SA 3LWMA 2ATQA 4KHRA 4O44B 4RW8B 3TAEA 1BQMB 4Z4EA 1OS5A 1HYVA 3DOKA 4IR9A 4RNNA 2HAIA 3JSMB 2DFEA 3OYAA 4LH4A 3V6JA 3FFIA 4W5TA 3V9WA 4JS4A 4NYFA 1CZBA 3M8PB 5KFDA 3DOLA 3AVFA 4FZXC 3L2RA 1C1CB 2UUWA 3KLGA 2HMIA 4CESA 2WONB 3N6LA 3U3YA 3G10A 3ISND 3S3MA 3DOLB 2D0AA 4AILC 3LDSA 3M9OB 4J9PA 3PX4A 2Z1HA 3QERA 2HHTA 4RNMA 1C1AA 4RW8A 3CFPA 2AGQA 4TN2A 4DL5A 1W9HA 1HQUA 2KFZA 2IC3A 1NK8A 4Y1CA 3MFIA 4OGEA 4DG1B 1JLFA 1S6PA 3G0ZA 5KFXA 4MKBA 3DLEB 1HPZB 3TVKA 4ICLA 4O3QA 4FJIA 1BGXT 2F8EX 5C24B 1RTDA 2FVQA 3VQ7A 4CJ3A 2AX0A 1S4FA 2YHAA 3VQCA 3O4QA 3LALA 4TY8B 3HO1A 3VA0A 4CGIA 3QEPA 1S9FA 4C8MA 2P5OA 1GX5A 3S9HA 2HNZB 4E7KA 4PUOB 2FBTA 4TY9A 4KB0A 4NLRA 3RAQA 5F8HA 1TKZB 4H4OA 3ZSXA 2R2UA 4CGJA 3KIOA 2V4RA 1KFDA 4FJNA 5KG2A 1L3SA 3UIQA 5E41A 4Z4IA 1KLMA 2OPRB 1FKOB 4DL7A 4LSNA 4LSLB 1RT3B 2VG7B 3EZ5A 1JLEB 1TL3B 3VQ5A 1NOYA 4LH5A 3GIKA 2XCAA 4FM1A 4E7HA 4EEYA 1C6VA 4DEZA 5KFUA 4DSEA 1TV6B 2JC1A 3ZT4A 2I1RA 4ED7A 1Q9YA 1RT2A 1BCOA 1JXBA 4IFVB 5KG5A 5CZ2A 3RMCA 4ZPAA 1QTMA 1ASVA 2XY8A 1GX6A 1S9GA 3O3GA 3L2WA 1WSEA 1HNIB 4M3ZA 4KV8B 3K5LA 4PQUB 4Z4HA 4Y34A 4ECSA 4WFZA 3IG1B 1K1SA 3M8RA 1TKXA 3K5MA 3BGRB 3V4IA 4DFKA 3EZUA 5DG8A 3CFRA 5I42B 2E9ZA 1RBRA 3OYNA 4YR2A 2VWKA 5T7BA 4GC6A 4DSFA 2OA8A 4DU4A 3HYFA 3MF5A 2IM2A 5KFVA 3PW0A 3PW4A 3HKWA 4RG8A 2GV9A 2G8VA 3PV8A 1U45A 4HYKA 4B9LA 2OH2A 4B3OB 1NHVA 3SPYA 2G8FA 2VG6B 1IG9A 1DTQA 5KFTA 4YR0A 1GOBA 1TK5A 3RR7A 3NCIA 1MU2B 4WXWA 4RW9B 3LP2A 3OVNA 4OKJA 1DTTA 2I5JB 3AA3A 3QGIA 1ZBUA 3C6UB 4IKFA 4RW7B 2YKMA 4CF2A 1NK5A 5KGWA 1TVRB 4MFBB 4QWEA 3O3HA 4FK0A 4H4MB 2XI2A 4DF8A 4J2AA 4K8XA 3HVRA 3MEDB 4F50A 2R8KA 4M95A 4FJLA 1JLAB 3MXMA 4Q8FA 1IKYA 3H5UA 1QSYA 1SL1A 3KK3A 4IRKA 4DTNA 4FVMA 3SI8A 1RT6B 3KHGA 4CEFA 5DGAA 1LWEB 3MXIA 3CJ0A 3V9XA 3AVIA 2KFNA 4FBUA 1K6YA 3OHAA 4NLWA 4DSKA 3IS9B 3LANA 3H5SA 1UWBA 2HNDB 4K4UA 1WSFA 4WZQA 1S9EB 2D5RA 1C0TB 3QIPB 3V1OA 1FKPA 3KTQA 4C8OA 1S1VA 4RUCA 1SL0A 4CEEA 1WAJA 4I2QA 3AVJA 4E0DA 1JIHA 4I2QB 4CEAA 2IJNA 4FW1A 2J6UA 4MH8A 4CJWA 2LSNA 4KHYA 3OYBA 5F9NA 5KFWA 2Y1JA 2KZMA 4K4SA 1RTJB 4ELVA 4Y1DA 4AH9A 1XHXA 2FJXA 3H59A 2C2EA 4O4GA 3H5YA 3EYZA 2FJVA 5DQHA 3IS9A 3TAGA 2IOCA 2HWIA 1IKWA 3PJXA 4O4RA 4KREA 4DL6A 4ECYA 2X6NA 4CJPA 1KLNA 4EP4A 5HROA 1CXUA 2W8KA 2Q3SA 1BQNA 5D3GA 2ASJA 5KFHA 1JXEA 1BL3A 3LP1A 3K57A 2XI3A 4GMJB 1HJRA 1JLGA 4HUGA 1RBVA 2QE5A 5CYMA 1B92A 4WE1B 1S6QB 4CHNA 3OS2A 2F8TA 3ISNC 1XHZA 3KK1B 4ECXA 3NAIA 4GC7A 3GIMA 3MFHA 4ECVA 3Q8SB 4PA1A 4DTPA 1JXLA 4BE0A 2C2DA 1HNVA 4ED8A 1XI1A 4OVLA 4CIEA 2GBZA 4B3OA 2QV6A 3OL9A 2HHUA 1TK8A 4ED2A 3AO2A 5KG4A 3DLGA 3QZ8A 2QK9A 3NAEA 4KHSA 5L1KA 2FLLA 2BQUA 4CFAA 4RUAA 4FZYA 2W7OA 4DSJA 3KLFA 4N5SA 3OLAA 5F8NA 3MR5A 5JS1A 2IMWP 4Q5VA 1JLGB 3KHRA 3FDSA 1RBTA 2VWJA 4XPCA 5HRPA 4NLOA 2B4JA 3T3FA 5D3GB 4KTZA 1T05B 3MECB 2W7PA 3M8QB 3T5KA 1T3NA 4PQUA 3NGDA 4DS4A 4ZTJA 2ZD1B 4WYWA 1QUVA 4NLGA 4YR3A 4W5OA 2X6SA 5FRNA 3N6MA 4HCCA 4CECA 2NUBA 3OS0A 4NLUA 4MQ3A 4ECTA 4KFBA 4F3TA 2UVUA 4BDZA 2WTFA 1TV6A 1D5AA 2ZKUA 3Q8QB 2D3UA 3BDPA 4R0EA 1NJXA 5KG6A 3PW2A 1S97A 2YNIB 2EX3A 4LD0A 3TQ1A
chains in the Genus database with same CATH superfamily
3K5OA 1ZBHA 1EETB 4LSLA 4M3TA 5CQGA 4OLAA 5DLFA 2A1SA 2DT9A 4WYLA 3UVJB 3CM6A 2LFVA 3HHNB 1WKKA 1IBLJ 2M0GB 2RS2A 2BMBA 3T9ZA 2YH1A 1UWBB 4MJKA 3PW7A 1BA0A 3RW7A 2ZHAA 4Y2AA 2PN6A 5KFSA 1KQGB 4LF7K 3FKBA 1HMVB 2DJWA 1T03A 3MM8B 1AUDA 1A5WA 3Q89A 2BJDA 3G86A 3J81U 2GEMA 1D9DA 3MAQA 4IFYB 2BJ9A 1ACMB 2UXBJ 3CGIA 5D4PA 1NWKA 3ID8A 2XZWA 1C0FA 4HTJA 4IKAA 4ITSA 1MMLA 3CD7A 1TKTB 1N36F 1NGFA 2ALZA 3H45C 4CJLA 3V81B 2R42A 2IM0A 2AJ0A 3HHEA 3LPYA 2AJ1A 1WHWA 2GIRA 4ZVSB 3TVZA 4BVOA 1R8AA 3OYEA 2HSEB 5F3TA 2FYXA 2PBDA 3DRRA 1F9EB 2M70A 2B8PA 4FNIA 1RHJB 5EWGA 4GO5X 3U1LA 1LWCB 4CERA 2BBEA 4B3TF 3O44A 4FWQA 4Q0BB 1RKIA 1F21A 4DV3K 1KSPA 5ETTA 1QAXA 3OPKA 1WF1A 5I4MA 4LF9J 3HI0A 4DTXA 3D1QA 4G1PA 5FLXY 2HBMA 5HOOA 3HMJG 3TWHA 4X4TA 1YJ9S 5K14A 4FVCA 2DGXA 1ZS6A 2K06A 3PYGA 4O3SA 1HMVA 3EN9A 3GJRB 4CK2A 3QESA 2DNNA 2YTCA 1VR6A 3NGZA 4C0HA 2DNQA 3IR7B 3I5BA 3QGGA 3QYYA 1F2GA 4JS5A 3GE1A 3HJVA 3WEEB 2CZVC 5M1KA 3HHLA 1FJCA 3L3VA 3BF3A 1QQMA 5ETLA 1DBDA 2RH3A 4CLYA 3SQOP 5LJ5Y 4O3OA 3RBXA 4WIQA 4MIWA 2GC8A 1GLBG 3ZTQA 4DN9A 2NREA 2DGQA 5KAKA 4ZVUB 2AZ3A 1JJ2M 3WUHA 4ID1A 4WXOA 1J53A 3AOCA 3VZHA 4WFAL 2ZQBA 3MM7A 2X3DA 4XIUA 3T1YJ 2PO4A 2HMPA 4EZ9A 3LPUA 2BW2A 5GADI 2JGUA 5E3RA 1LWEA 1ZH5A 3LP3A 3SAHA 1P27B 2ZD1A 4HHTA 3TAFA 4NYPA 1BIZA 3TP2A 3CJCA 2J9DA 5KFZA 1T05A 3DMJB 4U67Q 2V8PA 4QR0A 3BYRA 3OYFA 4KR0B 4Y3CA 4ETXA 5E0OA 4JD2B 1SQKA 4DQIA 1PGZA 3BSAA 4M3UA 4I64A 2VH7A 2U1AA 3GR1A 4YOYA 1VK0A 1UJ4A 2VFVA 2CUYA 2J6SA 2W2OP 3B54A 3DRYA 5JVGQ 4FXWA 2DH9A 4DV6J 1IM4A 4LFAF 1K0TA 2C3UA 5M2UA 4LF2A 2QXFA 2KRBA 2F63A 2Q36A 2W7AA 3NHGA 3MPUB 2FBXA 5KFCA 3T5HA 3CF5L 3A12A 2QFJA 4DXLA 3HHLB 1X5SA 4WCEQ 3X3UA 1N5TA 2BVZA 5CXTA 2PIIA 4P2FA 2JNJA 3SCLE 1FXXA 1OPIA 2HHVA 4DV5J 4AM7A 1TP7A 4BC7A 3Q2SC 1FHTA 2UXBF 3AVKA 2O8FB 4RBVA 4FCYA 4H0XB 1RE1B 2BKPA 1AT1B 3BF1A 2P8IA 1VQPS 1ZBLA 1FEEA 1P1TA 2BW7A 2EHGA 4ED5A 3EKSA 5E3CA 3L4IA 4P9SA 5TKYA 4ZVOB 2A18A 1UTAA 2VJVA 4JI8J 3L95X 4KGMA 4NA1A 3G82B 3QIDA 2Z2YB 1HBUA 2XB2D 3ZSVA 1IO2A 3PYFA 4X62K 4EMDA 3UDLA 3R6GB 5EXWA 3CDWA 2QL5B 3WQPA 2YNHA 2B51A 2Z58B 4GRSA 4MKYA 3TW0A 1JNZB 4E8UA 1RT5A 4FF3A 2BUNA 4QQBA 3L7OA 4L72B 4OX7A 3UPFA 2QSFA 2U2FA 1NJWA 2KB2A 3CCTA 4XO0A 1NJIT 3B78A 1NK0A 4M5KA 2WB4A 2HQGA 4P2XA 1QQCA 2ZOMA 1ZC6A 4FZZA 2WSEC 3SFUA 4NRTA 2K7JA 1F60B 4OZ0A 4CIOA 2LMIA 3IWXA 5J2QA 4ECQA 5B08A 1DY3A 4C6AA 4M5HA 1WC0A 3VETA 4ZVQB 2RUGA 1RT1B 5FDLB 1PJ5A 5E3PA 3V5RA 5DQIA 3MUTP 4C8KA 3DRPA 1A5VA 3PW5A 2O8BA 1UW9A 3C7NB 2MQ8A 2FJWA 4KHUA 4DX5A 2DGWA 4H54A 1ZTWA 4TQRA 2IA6A 1WWHA 3EVWA 2W9CA 3ZTSA 3O2IA 3S3OA 1OSDA 1N52B 4J9SA 4O3NA 2HBZB 3GPAA 2UU9F 4DR4K 2Q0UA 5D77A 4B9MA 5CCLA 5BR8J 3UD3P 2H3GX 1WNEA 1I94J 1HHSA 1YF5L 2OPQB 3DKDA 3QRRA 1J54A 2RDJA 4DCOB 3KG1A 3MDFA 4OYXA 4ZP6A 1NGGA 3WZ0A 1T11A 3H40A 2M2BA 5CZVA 3R5GA 4P71A 3NAHA 2CQ4A 2BANA 3DNCA 3NBPA 2Z2MA 3GU0A 1FK9B 5CD4A 1R8HA 3NKYA 4H0PA 1FWLA 1ROFA 4Y28C 2LU1A 5HMXA 2E2OA 2AHOB 2H48B 3RBDA 3CJ3A 4X65K 3H25A 2NZTA 1VQ7N 3TEGA 4RW4A 2A3JA 4ZCMA 1WSGA 1RAFB 4HVJA 1C0MA 1H6KX 2HZAA 2ZH2A 4AHCA 4V19S 4DTSA 2D1CA 4KQZA 1KTQA 3EICA 1UL3A 1VSJA 3LGHA 3M9MB 2JDJA 2FY1A 2JLFA 1X9MA 3H8YA 1P9YA 2Z2ZA 1X1PA 2MQNA 4K5RA 3MM5B 2W9CB 1MMDA 3VN5A 4I6AA 1HARA 3S1TA 1N54B 4F4XA 2ZGZA 2V8GA 2LEAA 2IBOA 3HSZA 2V5HG 1RDDA 4RNHA 1VQNS 3J81j 3UO0A 3OYKA 3N4PA 1HI1A 3W65A 4B08A 3TA2A 3TVYA 3J7YU 3HT3A 2P9EA 4CDIA 1U6ZA 3O08A 5CAAA 2VL1A 5DG7A 3HOSA 1ASUA 4DV1J 4MKVA 2H9ZA 3TWZA 3ZZ0A 1N6QB 5F1XA 1EKRA 4FWKA 1VJWA 1T0TV 2QLJB 1WDDA 5HL7Q 5C25A 2N82B 4M1KA 1KXPA 4ZOSA 5AFUH 3GILA 3MMCA 3K17A 1VQYA 3UCUP 3V1RA 3UE2A 3EZOA 3NFAA 3A13A 2L9WA 1RISA 2CJAA 3U3GA 3KMQA 3RGIA 1GMUA 3CC2S 4K0KK 4DR2F 4KTQA 1HBUB 4AQYF 1X4GA 5A8RA 1K44A 2BQRA 3NF7A 1WEZA 4NCBA 2ASDA 5AZIB 4CM0A 2JVOA 4JKEA 3H0PA 1KQSR 1V9OA 3G2XA 4Y2MA 3JTNA 3M8QA 2DTJA 3ZLJA 3POTB 2B56A 3VWSA 3MEEB 5JVHQ 2VCPA 2E4LA 1Q95G 5DDOC 2KRRA 3F2KA 2M7SA 1VSHA 3SFGA 3OXGA 3SYZA 2ZJQQ 2ZWPA 5J2PA 3GOIA 3IC1A 4DWIA 1VQ4N 5F8LA 5B0EA 4OLBA 3TJ8A 4LFBK 5GINA 2DR7A 2DIUA 2W25A 2UVRA 3I0RA 2BKOA 5E33A 4CF8A 4K0KJ 3BO3A 3I82A 1RCXB 4EFAC 5AXNA 3VHQA 2RUSA 2VHGA 1JQGA 4DL3A 4IO8A 3DRXA 1WHYA 3AVNA 3G6EN 2IPOB 3OQ2A 3W2WA 1FCAA 2EBGA 4ID5B 3Q7BA 2DBBA 2P9LB 2VQFF 8ATCB 3JB9k 3CJ1A 2NPFA 2HS3A 2WBRA 1SJFA 2QO3A 4YB5A 2WVFA 4ANDA 3V4IB 2MQOA 4IDHA 4FLTA 4CEQA 1XUPO 4RU9A 3LDNA 4P75A 2BYCA 3RB0A 2E6LA 2I7PA 1WOPA 4Q45A 1FO1A 1SV5A 1V3ZA 1RT2B 4DQQA 2A2CA 3H6EA 4B9SA 4PPDA 5DM6L 2DGSA 3H42A 3JAMY 3V1QA 1RB0A 3GIIA 3QT5A 4FJHA 3KK2A 2QX0A 1HLWA 4GV9A 3KLVA 2E8AA 4F4YA 1LW0A 3R6LB 4ILHA 4JKGA 5KOXA 4LY7A 1QHTA 2UXCF 4E3SA 3CJKA 3M05A 3R1LA 2YKNB 4KBIA 3M5RA 4DR2K 1VHXA 4USIA 1WEXA 2I2YA 1EWQA 3CI5A 3WC0A 2C3OA 1LWFB 2FXUA 4Z7CA 2OSQA 4JV5F 2OCEA 3D9BA 4N8OA 1JLBB 1L3KA 1RACB 5JLHA 3KD1E 5HLFB 2EK6A 3EKUA 2JLEA 1PG5B 2ZBCA 3GR0A 4X65J 5EX5A 2ZJRQ 3MMBB 5B0DA 2GJ2A 3EEQA 1LCUA 4TXSA 2DTUA 1L3VA 3O1WA 4B1YB 2DEJA 4L8RB 1CC7A 4CZFA 4Q0BA 1VQ9N 3QT6A 3OYHA 3HK2A 1V4TA 3EPIA 4GKJJ 2DIVA 5KT6A 1GXUA 3TAMA 3KG4A 1IBKK 1GLEG 1K9MT 2VFUA 2ZBPA 1Q81O 5GVQA 1HNVB 5A6WA 4CZKA 2K7KA 3KZBA 4BRGA 3M9NB 3E1YA 4DFJA 2ZH4A 2H3EB 2OD6A 3GE9A 1FX2A 1DGKN 3JSMA 2QWQA 2IRXA 4D3GA 3KOAA 3RAXA 1JKHB 2VPZB 4JI3J 3IAYA 2VG5B 3M2RA 2ZOFA 3NCRA 1YJUA 2MZ1A 4ZTFA 4KIAA 5IWAF 1X9WA 5E3QA 5EOYA 2NXNA 5EDWA 4Y65A 1IJEB 4CH0S 3DLJA 1NJIO 1RTJA 3T1AA 1GQEA 2HNYA 3AOBA 3CF5Q 4DV6F 4S0MA 4FXVA 3NNAA 1HWKA 4F02A 1RQ0A 1VSMA 3IR5B 1FI4A 4ZP9A 3WXKA 5L9XA 1KLMB 3OW2R 3D3BJ 3ZX3A 1GNKA 2HHXA 5KT3A 4LRAA 4XH5A 3DCAA 1SH0A 2F65A 1MN9A 1OMSA 2GS8A 1I5OB 2IIHA 2WVEA 1EX4A 1PJ6A 4OI0A 5MAOA 1YJVA 4EHTA 1ATRA 1N34K 1Q8BA 4WQ5A 3VF4A 3DOMB 1UAXA 5ELZA 3M8WA 4DTJA 1U48A 2DPIA 4NX9A 1NK4A 5BPMA 1QE1B 4W5RA 4X62J 4J9QA 2EFVA 1T94A 1SZ2A 3OFEA 5KT2A 4J90A 4M7XA 2XS7A 2CPDA 4H4MA 3OL7A 1F1BB 1B64A 1H0HB 2DNLA 1B70B 2RDIA 4IRCA 2UV8G 2R4FA 2UUAF 4L73A 3C6UA 1B0PA 1U09A 1HW9A 2W9BA 3FSIA 2QLXA 3ZFVA 3Q8YA 2J6TA 2MKIA 5ETRA 1WHVA 4C1NK 3TARA 3O1LA 4RWWA 4KHPF 3KUGA 1KDNA 1RWUA 4FWRA 3OHBA 1IQTA 3AA2A 4LF4F 2G8HA 1Q0NA 4OQJA 1Z6RA 2O8CB 3L2QA 1VC0A 4I7FB 3TTFA 3OYDA 2UXDK 3QZ7A 2HQ3A 3VERA 3VQDA 5KT4A 4WE1A 3SQ1A 1J5EF 1DLOA 3DOKB 4DOZA 5D6GA 3AH6A 5M2PA 1S3XA 2FC0A 1FJGK 4BE1A 1OYEA 4DR5K 4TSXA 3GDQA 3NGYA 3SV3A 5C15A 2BZ2A 4FF4A 4X64J 2YPYA 2IVOA 3CCMN 4TYAA 3EM1A 4DTMA 1RYRA 1HIYA 3OBWA 4K8ZA 2XTJP 1X7VA 1OH7A 3A3OB 1RBUA 1EQ0A 3QFUA 2LQ8A 2N4CA 4MLEA 3TSPA 4PKIA 4YHHF 2JFDA 1Y11A 1ZZNA 5HP1A 4LF6K 4F3OA 4FS1A 1XMQJ 3BEGB 2HGNA 1GLDG 4DPOA 1RT4B 2AYMA 1FFGB 2LQJA 3M6UA 4F7VA 2HF4A 2YKPA 1FFWB 3KG0A 3FLCO 2XSFA 4A8OA 3OS1A 3L7PA 4IJAA 5K8PA 2FHMA 1JLCA 4MYTA 2CQ0A 1UMJA 2F1FA 4NYZA 1U4BA 4LFAK 4ALZA 2I38A 3NWGA 4LF8F 2RMLA 2HGLA 2ZZNA 1H7XA 1ZM3A 1TUYA 5M1NA 3BF4A 3HM8A 4MK8A 1QQNA 4TY8A 1NM1A 2G8WA 3TEHB 2UU9J 2HLTA 5GIPA 2Y1IA 4ZKAA 5L1JA 3T5LA 2BDPA 4LQ9A 1EIYB 4HH0A 4ICLB 3T69A 2IVYA 3D6MB 3R5AA 3VESA 2OZMA 1PSDA 3ULDA 1RT7B 2YNGB 2RAQA 4WQ5C 4ECUA 1JJ2R 2WK4A 2C2OB 1RK8A 3VMFB 2RHSB 2HRTA 1LEOA 4KGKA 5A2QY 3SCKE 2B5JA 1T7PA 5FROA 3ET6A 3CJSA 4URSA 3EVMA 1YK9A 4BRQA 4JI0J 1UZDA 2A10A 4ZCKA 2QLFB 2ZH6A 2IAJA 3ZTPA 3JAMU 2DNHA 5KFAA 3D68A 3MPDA 3S7RA 5IZHA 4B9QA 2B9WA 3BH7B 5LJ3Y 3AO5A 3DI6A 1FRXA 1S76D 2M5YA 4CT9A 1IKVA 3S8SA 5AQQA 2V8VA 2EKNA 1RWOB 3MX5A 1RLDA 5IV3A 1B99A 4QJVA 3MEGA 2CGJA 4PHTX 2Y8WA 3S3NA 2CQIA 2WTUA 2GX9A 1VQ6N 2K1RB 2IMOA 4CLWA 4OPJA 1NZAA 4FK2A 4K4VA 1FRKA 1EB0A 2FJBB 1T9XA 1U8WA 2B4UA 4NRUA 1VSEA 5DDRC 2QWPA 1U0HB 4ZMMA 2AEFA 4OZ2A 3W2WB 2KT3A 3QLHA 4R8UA 2W1BA 1J6ZA 2O67A 2NYHA 3DLKA 4CP5A 1RNHA 4DV5F 4BC9A 1RYSA 2HHHJ 5B0FA 4DUZJ 2C2KB 3SMZA 1QHAA 1RT5B 4JKFA 3GB0A 1VJQA 3C0BA 3BM7A 2CDQA 1ATSA 3FGVA 4CD3A 2R7QA 3ENHA 3FE1A 5IC4B 5C0YA 1NPPA 1C0UA 5KPRA 1NK6A 1YUWA 4DQ8A 5D0EA 3DJCA 4AM6A 4MK7A 1NMEB 3NDKA 1L3UA 4CEBA 1A0OB 2RE2A 1R0AB 4DG1A 1N48A 3OVAA 4ES2A 2XYHB 4NXMJ 1NCLA 3PTWA 2EK1A 1R43A 4KHRA 4O44B 1N0VC 1F5AA 5E84A 3CCJN 3TAEA 4PCQA 4Z4EA 3DU6A 4IR9A 3RU0A 3TA1A 2HAIA 2DFEA 5BYSA 3V9WA 4JS4A 4K42A 1YITN 5CA5A 1CZBA 2HHHK 3AVFA 3CPEA 2GAHC 3KLGA 2HMIA 4CESA 3BDEA 3VEZA 3OFHA 4BR7A 4AQYK 4DV2F 3U3YA 3G10A 3PDNA 3AQOA 5DRKA 3ZC4A 4DV7F 5F0UA 2AIRB 4I6WA 3PX4A 4JKDA 1VBYA 3K2YA 2N3OA 4RW8A 4NYOA 4DL5A 1NDPA 3GSDA 1W9HA 5IS2A 1HQUA 2OGUA 2IC3A 2VBZA 1NH8A 2VC1A 3CPWM 1GTEA 1JLFA 1YZ6A 1HPZB 4ICLA 2ZM6J 2HVEA 2MKHA 5C24B 1RTDA 2FVQA 1RGIA 4CJ3A 3MI7X 1K9MO 2QC3A 2LECA 2EWSA 1N5VA 2F40A 1NSQA 3LALA 4TY8B 3K9KA 3NMRA 1S9FA 2KFYA 1K73T 1GX5A 3TRGA 3TU5A 1MA9B 4XDDA 2A6OA 4PUOB 2EFOA 4ZVPB 2FBTA 3IDHA 1F5BA 2P9UA 3IMXA 3ZZZA 5F41A 5F8HA 1TKZB 1XMQK 5A2QU 3ZSXA 5KPTA 1RFQA 1T9WA 3KIOA 5KG2A 1ZBTA 4PYDA 3HZGA 1L3SA 1YBTA 4Z4IA 3EJMA 1M5HA 4ZJLA 3THWB 4DR1J 4LSLB 4X4RA 2FJAB 4AQYJ 2VG7B 1JLEB 3VQ5A 2YQ0A 4LH5A 3ZYYX 1Q82O 3IKMA 2BM0A 1HD0A 3VZIA 2FC9A 2MLXA 2BJEA 5KFUA 1DQAA 1GLAG 2JC1A 3NY0A 2V69A 3GG4A 3H20A 1RWVB 1ATNA 1BCOA 4OZ1A 1JXBA 5KG5A 5CZ2A 2VQEJ 1QTMA 1WUAA 1GX6A 4P73A 1R8PA 4RUBA 2HYIB 4R25A 2UUAK 3K5LA 4Y34A 3QICA 4WFZA 1U2CA 3IG1B 4PWWA 2EFNA 3DWLA 2P6SA 3M8RA 2BEFA 3WX8A 3SQGA 3BGRB 3EZUA 1ZAXA 1G99A 4W98A 5I42B 3SLCA 1QD1A 3JAMO 4YR2A 2P9LA 4TVAB 4OPAA 2KXNB 1YG0A 2C2NA 3HYFA 1E6YA 2EI5A 3KUHA 3MF5A 1RI7A 2IM2A 1FFSB 3LOUA 1XBWA 2GV9A 2G8VA 4WF9L 2J4RA 3ET6B 2G4BA 2OH2A 5ADZA 1Q79A 2VG6B 2IYGA 1HX1A 3B4DA 1TK5A 1GOBA 3C15B 2AA4A 3ENBA 3NCIA 2CG4A 1YTYA 3OVNA 4OKJA 3W60A 3WQUA 4ISGA 4C48A 4P52A 1T9UA 2IVPA 3HSCA 4DV6K 1N32J 4RW7B 2E5JA 5KGWA 3AA9A 3R3TA 1HFEL 2XMKA 3G9CA 4DF8A 1KS2A 4TNOA 3MEDB 3FBEA 5BRHA 1VCTA 4Q8FA 1IKYA 2A2DA 4F9OA 4AE5A 2DRDA 5A2QO 1LWEB 4AFFA 1CS4B 4LF6J 3HLUA 3THYB 1K6YA 5JMVA 4BGBA 3C16A 4JYAJ 1SVDA 4NLWA 4C11B 3CC7S 1BWFO 3DAWA 1NU4A 3HSDA 1UWBA 4OHYA 2HNDB 2KJVA 4K4UA 1WSFA 1S9EB 1T6CA 4JI7F 4BRDA 3KTQA 5IOLA 4YDDB 4RR5A 2EFQA 5LMUF 4OI4A 3AVJA 2M8DB 1SC3B 2KM8C 4YN3B 4CJWA 4X66K 3C6AA 5F9NA 2X1FA 5BPNA 1H74A 2KZMA 4K4SA 4ILGB 2C2EA 2GELA 1IBKF 3IUCA 5DQHA 2O8DA 3IS9A 3TAGA 3PJXA 4FF2A 4BS2A 3WXMB 4CJPA 2O8EB 4OZ3A 4DUTA 3UD4P 2MTLA 4QS7A 1JXEA 2XI3A 2EXUA 3JXOA 1NDCA 2HIYA 2VGMA 3US5A 4CHNA 3NCQA 2E7VA 3KK1B 2BJ3A 4GC7A 1TZ0A 1HBMB 4J7CA 4K43A 1F0XA 2MGZA 1JXLA 1VIOA 1PC5A 3VAGA 2YH0A 3I33A 4CIEA 2GBZA 4B3OA 3OL9A 2YCHA 4BR0A 1TK8A 1S7HA 2E1YA 3IAS9 1EO1A 3C14B 3DLGA 3UW1A 1HWLA 1UVJA 3NAEA 3Q8VA 1U2FA 4RUAA 4YOVA 5I3PA 2Q1LA 3BS9A 2MLYA 3CC4N 3PXGa 2GGPA 4WCEL 4ZK7M 5CR4A 5F8NA 3PIPQ 4OYZA 4B3MF 5CZXA 5CD4H 1JB0C 3KHRA 3FDSA 4WYBA 2P9SA 3QJLA 4BRCA 1S7IA 2ASMA 3BBCA 3DN9A 1A7GE 1KAYA 2UXBK 3M8QB 1T3NA 5H9EK 4PQUA 4ZTJA 2ZD1B 3PRDA 4WYWA 4NLGA 3RYLA 1HHQA 2R7XA 1SIWB 3CJ9A 5FRNA 3HHLD 2QEXS 1SQFA 1NU0A 1DURA 2CADA 2VU5A 3OS0A 4JHDB 2DITA 2VASA 2RB7A 5A8RB 2X7IA 4C9DA 3GFXA 2V8DA 3FZMA 5BRDA 1OH8A 1GMVA 4AUKA 3BDPA 3LF0A 4U95A 5KG6A 1WI8A 3UKRA 5AQNA 3TQ1A 2JWLA 5H1SV 3WNFA 1HHTP 3WNHA 4OHXA 3I96A 4OYMA 1GH8A 3TSQA 2OPSA 3K59A 4FJ8A 1S9EA 2ZFHA 4M5DB 3OYCA 3MAAA 3MCMA 4KBOA 2DK2A 1TL4A 2J7WA 5CE3A 4HHUA 4CIFA 4B02A 3PACA 2NPIA 3C16B 2IVNA 1N5YB 3NEKA 4K4XA 1J9AA 1RT6A 4M5NA 4PUOA 4IYQA 3O3FA 1NBEB 2GO9A 1VHIA 4BRMA 3K8VA 3H4DA 5K14B 1WBBA 5AQYA 1YVFA 2W41A 3JYTB 1CBKA 2F9TA 3CSKA 3ZEUB 5AQHA 4LJMA 1N4LA 4XDCA 3O9UA 1EXQA 4LF5K 5H9EJ 3D2EB 3OBYA 5DLGA 4OJRA 4BR9A 3A3PB 4OGCA 1A5XA 4ELUA 4JLHA 1Q18A 4ZVFA 3D6TB 1O13A 4RW9A 2OTLN 2XY6A 3OUYB 1B7YB 4NCGB 4K5SA 2E1ZA 3R3LA 3KLIB 4NCGA 2P5VA 4FJ9A 1XC9A 4PG5A 4DCPB 5C5JA 3GQCA 2BX6A 4IXCA 4PEOA 3B6PA 4USKA 1YVUA 1N5QA 3H7HB 1WC5A 3E9LA 3PEJA 3NF8A 2FQQB 4ZITA 3HHKA 3V6KA 1RTHA 5CYMB 2I7NA 4UOGA 1W26A 2OFGX 4O44A 1M1HA 2KDOA 2ILYA 3Q8PB 1OQ3A 1RWNB 5AT1B 1HNIA 4YDUA 1JCFA 3SSSA 3G71N 1U2RA 4EK2A 1LK7A 4NCAA 3EPGA 1S1TA 3TUPA 1S0VA 1D0EA 5G0RA 3QT7A 3QWUA 1URRA 3AAQA 4H5WA 1QVGM 2QKKA 3H3NO 3DLHA 5DZ6A 3SNNA 1RT3A 3Q2TC 4IFEA 2VODA 2C42A 1WOSA 4ECZA 4MIBA 3NGUA 1CZ9A 3JTOA 4AHSA 2X78A 1VSIA 1QVFR 4BRFA 2GHWA 1H2TZ 4LF6F 4BRNA 1M5SA 3LUYA 1TQLA 5HVHA 3N6NA 4P6QA 4TU9A 2P9UB 4J2DA 2J8AA 3FEXB 3LM9A 2P9NA 4DLEA 2HQFA 2KTQA 1RCHA 2R2SA 3W7BA 3ZZPA 4B3SF 3DMJA 1T3VA 1VQ9S 2RSQA 3VQEA 5DDPC 5AQXA 4CGFA 4XK8C 3HULA 1REVA 2VC0A 3VAKA 3D7SB 3KKRA 3JSBA 4TYBA 2NRHA 2LEBA 3CO9A 3ATVA 2ROEA 1S79A 1K8AO 2AEJA 4J9OA 5AFUA 2BV3A 2AJQA 5HJYA 3DI6B 3UR3C 1GAOA 2ZM6K 5EU7A 3QNWB 3AV9A 1YBUA 3SSQA 4JI6K 2V2ZA 5KFBA 2MGZB 4A8YA 2PFFB 4DR4F 2UU9K 1FRMA 2N3LA 5GAEI 2YV0X 3T1YK 2OIHA 1E4GT 1X5OA 3KLGB 4E1MA 3WQTA 3AGRA 4JI4K 3FMBA 4CHPA 2NCKL 4J9LA 2RHKA 5BPLA 4F3MA 2ETJA 3BBBA 3LGMA 2BJ8A 2E1CA 1XK8A 1GXTA 2LEPA 3HFKA 3HHLC 3QB0A 1QVGR 1NSAA 1TFWA 3MR6A 1IBCB 2IJRA 2O4GA 4EO6A 2FBVA 4CLUA 2CGKA 3FEYB 5BR8F 3K0JA 1U04A 3NL0A 1FWKA 1WELA 3AD9C 3W9IA 1HBOA 3CCVN 2WZ1A 3MWBA 2IDEA 3IGNA 1XNRK 4KHWA 2JSXA 4LF1A 1RLCL 4FM0A 1TL3A 1RBLA 1URNA 1NGEA 3THWA 3RB4A 3PIOQ 2FB0A 4U8VA 4IG3A 3SCXA 4NXNJ 1UVKA 2RU3A 7FD1A 4M63A 3VOVA 1VBZA 3W62A 1NK7A 3WX4A 2NRWA 3PVXA 4B9TA 2XMVA 4PL7A 2NRZA 3ZTOA 1A9NB 3JS6A 2FPHX 5F8IA 3MM8A 4QW9A 4JV5K 4IG0B 1S77D 3PUFA 5C24A 1RTDB 3W63A 2GQCA 3T6JA 2QXLA 4A48A 3O3LA 1BE4A 3MCPA 2AV5A 3MMJA 3D7EO 3G4SS 2IVMA 2HFUA 2MQQA 1TUVA 1NPRA 4M3WA 1S1XB 2Y0SD 3HSJA 2PFDA 3VGUA 1DLOB 2R7OA 5F9LA 4JI5J 1WDTA 1I3OB 3AXKA 1LWXA 4RW6B 4C8LA 1KAXA 4PABA 1QAJA 5KG3A 3D2WA 3CIZA 2LA4A 4Z37A 3IM9A 4DU8A 1XIQA 1Q86O 2CQDA 4JI1F 1TL7A 1Y5IB 3HX9A 4UUXA 3CCMS 2R7RA 2XS2A 3BGRA 4JRQA 3KHLA 2XULA 2Y1LB 3BR9A 1RGVA 3MECA 2MQMA 3I9ZA 1Q4RA 2CJKA 4JI5F 3H4BA 5CYJA 2XO6A 1NNDA 1T9TA 4E1JA 2QIFA 4UT4A 3QBCA 5AQOA 3ELHA 4C3KA 3QFPA 3BSCA 3P45B 5IFMA 4FYWB 1S6OA 3C2PA 3IFEA 2Q3PA 1YQHA 3DLGB 2ZWHA 5LOQA 2XO7A 1AZSA 1KC8O 3H2UB 4I67A 3CCZA 4LR8A 2Q2RA 2UYTA 2OJ3A 4C0BA 4CJEA 1X3NA 3KFWX 3A8JA 2RILA 2FC8A 3ZX2A 4ZVRB 1Y3JA 2VA3A 4FPIA 1OYDA 4DTOA 1TMMA 4DV4F 1XR5A 4KB1A 3IM8A 4U9RA 1BD6A 2Z8QA 1SH2A 4Z7YA 2I6WA 3HVTA 3D1OA 4HLBA 3OA9A 4A8QA 1EKSA 1NGDA 4OYWA 3M8YA 3AODA 3W5ZA 5HATA 4QBUA 3M1FA 1UW4A 4PL8A 2Q31A 5DQGA 5AJ3J 1BHNA 1DHMA 4O5BA 4CM2A 4M63C 3MEGB 3CMES 2E5HA 4KC5A 4LF9F 3ZZYA 2ZVIA 5KG0A 4BVPA 1MSWD 5HMZA 2JRSA 2BH1A 2DGTA 2JC0A 4USWA 3AD8C 4J9UE 3ZT2A 3M6XA 3TQEA 4DUYJ 3OY9A 2UUAJ 4HTLA 2AW0A 1QS4A 4AF1A 4J2BA 2J0XA 1VSLA 3UE5A 3GV8B 4DFMA 1IM6A 3HM9A 2HFVA 2YBVA 3O6QA 1JNRB 4PR6A 4IRDA 1XR6A 2R7SA 2FTRA 2Y8YA 4J9VA 3OLBA 3FVYA 2P9PA 2HBRB 3F44A 5AXMA 4A59A 1DZ5A 2HVIA 2CVIA 4NA3A 5BN8A 3E01A 4Y2CA 2QKBA 3WNGA 1GK8A 1YIJN 3O5TB 4E19A 3T41A 2MSTA 1ZETA 4RKUC 5GAHP 3CD0A 5HRRA 2LQ5A 4FO0A 4ELTA 3AAPA 3SBTA 1I94F 1FJGF 2J5AA 1NMDA 4IBNA 2YVSA 3KLFB 1G1XA 5F8JA 2ILZA 5AJ3F 1RKJA 4CLTA 4NI2B 2HFOA 2JLGA 2R2TA 4W4MA 4WKYA 4B1WB 2MZRA 3RSEB 4QIFA 1JX4A 4RTFD 3KLIA 4H0TB 2OEJA 5KG1A 3Q22A 2MEWA 2QWNA 4DU7A 2J7UA 4CO0A 1T3OA 3FZFA 2G13A 2PA3A 4CZHA 2ZBQA 3CJRA 5HQMA 4FKXA 3CJKB 3CHWA 3QEWA 5LMUK 1S49A 3PX6A 4DL2A 3HCXA 2CG8A 3AVGA 3T1HF 2CZ4A 2CZ9A 3M2UA 4LFCK 2CQGA 2AX1A 1GLCG 1X8DA 2FJEB 3SUQA 1CJVA 3MHYA 3G6VA 1SC6A 2LU2A 2HHWA 3PX0A 5EUHA 4X64F 1MMNA 3ZSYA 3L3CA 4JV5J 4WFYA 4XPEA 4RJVA 4ZJOA 1SH3A 4OI1A 3CCJS 3CULA 3VQ4A 3KJNB 5KOWA 4ZS6A 3I5CA 3EE8A 3MN7A 2W4PA 2F7VA 4CLLA 3LTOA 5KFQA 2C2MB 2W4DA 1FXLA 1QQOA 3T6BA 1LAWA 1FE0A 4C7QA 2A1RA 3D0IE 4KH0B 1XTZA 2HG4A 2ZE2A 1VQSA 1NGCA 5KG7A 4DB3A 2GV1A 2MZTA 3CJ5A 1KHWA 1G2EA 3KMSA 4I7FA 3VF2A 2DXDA 3OTCA 4AHTA 4XEIA 3HF5A 4RNOA 4ED0A 3U4LA 3M6VA 3K7RA 4ZLJA 3OJSA 4DV2K 3DRSB 3SBMA 4FLVA 3ULEB 3JQMA 1B9DA 1Q7YT 2UVVA 5JJBA 5FPDA 5LMUJ 3QFHA 2HOEA 1AB8A 4KYZA 4EO8A 3AJ2A 3ZT3A 5ETOA 3AVBA 1SUQA 2CNNB 1S0OA 2NSCA 4NASA 3P4UB 5BR9A 1TL1B 2GAGC 2RNEA 4YB7A 5LMNK 3PR5B 5CZ1A 5I3UB 4F2RA 3O80A 4QR1A 2ZHBA 2CQ2A 2NSBA 2ZVSA 3H1QA 2CPJA 4LBHA 1RHKB 4CJFA 3IO1A 2EWHA 4QAGA 5HLFA 1RHQB 4KHPJ 2WBMA 2GIFA 4C2MA 1S5ZA 4PG6A 2RF2B 2L3MA 3TAPA 2V52B 3OT9A 5DGBA 3J7AP 2CH6A 3KD5E 3M6GA 2F8HA 5KFGA 1Q16B 2AMCB 2ZJRL 1SBRA 5AXLA 4FDFA 2XHBA 5IM0B 4G1QA 2F9DA 5HI7A 7FDRA 1WN7A 1YLXA 2HFSA 2YKNA 1HBNB 5ETVA 2NRTA 4M7YA 5D4OA 4BRIA 4MDBA 2IDOA 4UQTA 4JKAA 1RAIB 2CQ1A 3ASMA 3MXJA 1KWMA 3R9LA 3NH1A 3W3SA 4WQ4C 1J5OA 3VQPA 3U9ZA 3PEHA 5I42A 3CERA 2B4VA 4DR6K 2GWKA 2KYZA 4JUZA 1VQ8S 1VISA 2HZCA 5L39A 1OSCA 5K8MA 1XMQF 2E1RA 5JICA 1BQNB 4MIAA 3RBZA 2D0BA 3R5BA 1NGAA 3AA5X 2HFNA 3J80Y 3E8OA 2PMWA 2E1MC 3FRYA 4PAAA 3OFGA 1S1WA 1IR2A 4DHYA 2NXEA 2A3ZA 4UUWA 4CT8A 3IBCB 2DNGA 2MSSA 2CXEA 5CYQB 3P1GA 4DV0K 2WOMA 2BJ7A 3L9ZA 3CJQA 1I51B 4CD1A 1L5UA 4K8RA 3LZIA 3U7JA 4DV5K 4DS5A 2VG7A 3BSNA 4DZDA 1TYQA 3TZZA 2D3O1 1Z25A 2AF6A 4YB1P 3LQVA 2VJUA 3FZ2A 3GL1A 4L74A 2O8CA 1Q86T 1N56A 1KAZA 1H2VZ 3BGFA 2KW4A 2RQCA 4KAIA 2V67A 2YKAA 1CJKB 4GKJF 1NM2A 4X4VA 1O1WA 3FQKA 2WW8A 3CM5A 2D9PA 4TLRA 1M0SA 3AJ1A 4ZVGA 2RD5C 1HW8A 5E26A 1T9VA 3QPIA 3QEVA 2CFXA 4O23A 2MZQA 2PDAA 1EQYA 1OWXA 4FLXA 4B3RF 2DR5A 3BKUA 4KI6A 2ROGA 2BACA 4CI0B 4NLBA 3HFVA 3MEEA 1VK3A 1TL1A 1LNQA 5M1FA 1SUQB 1HJOA 4JI1K 1UEVA 3LP2B 5KFIA 3HP9A 4KGXB 4JI7J 2ZBIA 2BE2A 2P51A 1PIEA 1VQLS 3R1XA 1DTQB 1VQKS 4CE9A 2C1EB 4CZEA 4Z4FA 2VKRA 1YHQS 1FEHA 2RHQB 4J37A 4YHHJ 2F4FA 4D3HA 1NOZA 5HAOA 3QIOA 1E6YB 2E6MA 3RBEA 1C1CA 2ASOA 2RQ4A 4YUDA 2IM3A 3FSXA 1F3VA 3GYNA 1U25A 4ERDA 3BEXA 2X74A 3FFIB 1S6QA 3N5BA 4HKQA 1FDBA 2MLZA 4NZ6A 3LDOA 3A5OC 4Y2KA 2W2PP 3I0SB 3BZKA 1AFIA 1WBDA 2WOMB 2DR9A 3QGHA 4KV8A 1UEUA 4H03B 3ZSOA 1VBKA 2O8BB 2VPYB 2KKZA 1S0MA 1UCNA 2D3ZA 3NP5A 1RAGB 2HSTA 2B9YA 3PM9A 4R0JA 5T41A 2KXHA 5F2RA 4FBTA 4BR5A 5BR8K 4ED1A 3GIJA 2ZUGA 3I8DA 1OPZA 2L08A 2EFPA 3V9UA 2WB1D 1T8EA 4DMNA 5DZ7A 4ZLNA 3BN4A 4CHYA 3Q8RB 1VRQC 4IJNA 2BOPA 1NEEA 3G6YA 4NLPA 3ZSWA 2Q1NA 1K47A 2IBKA 4PKHA 3E51A 1SS6A 2WHOA 3NRBA 2OP5A 2AU0A 2V9WA 2DPJA 2L9NA 4EUVA 1GXLA 3F73A 1TKDA 3AA4A 1RT4A 1NKCA 3ALYA 4IOCL 2YHWA 4UZCA 2HB5A 4CBWA 4BHQA 4YHHK 4BRHA 4B8CA 4DU3A 3G8TA 1NKBA 2FJDB 3THYA 4CBUA 2VFRA 5A8KA 1LQ9A 1XN9A 1TMJA 1P90A 3DM2A 4OMFG 5KI6A 3CDUA 1A6LA 1KHVA 3C65A 2Q97A 5F0XA 4Z4CA 5FRMA 2GQQA 4USJC 1RWWB 1T95A 4NOHA 5GMKa 2QA4N 3MMBA 2I8EA 4X66J 3PR4A 3SBGA 3POTA 1S6PB 2DY1A 2QL9B 3K2PA 4QZVB 4LFCF 4DR6F 4X66F 4CGGA 3GG1A 4A47A 5BRFA 3HZEA 3AOAA 2NRRA 1SI9A 1EP4B 2EC2A 1HUXA 1SC4B 2HBJA 2MMYA 3ZXWA 4FLZA 2F8SA 2LXFA 2ABYA 2L48A 3RTVA 1RAJA 2HIQA 4NLQA 4ENOA 3TX8A 1RZMA 4W5QA 3FUYA 3B8HA 4FZVA 3C3LA 2AT1B 2QMWA 4OLPA 1KRPA 1GOCA 4RW6A 4DQPA 1VHFA 5AJ3K 3EL2A 2KKHA 4DR7K 2UUBF 3TPQA 4FWSA 2R8JA 3IN5A 2LCWA 3RMDA 3EDRB 3JTPA 3A4TA 5HMWA 1N8RO 4OHWA 1PBAA 3EY1A 5EX0A 5JMNA 3QNNA 1FRJA 2XM3A 1BCMA 3OYIA 4YDUC 2ZWOA 3VF0B 1WB9A 2VYPA 1RTIB 3AHPA 1XR7A 4CJUA 2VIHA 1VRTB 4JKBA 4X4QA 2C22A 4DV0J 3OSNA 1I6JA 3Q86A 2JVRA 4LF7F 1WLJA 3VA3A 2A1BA 5TKWA 2CJQA 2H65B 2R7UA 4DV4J 4DTRA 1Z2ZA 4N76A 1KD1T 5J1EB 2MJNA 4PG8A 1VQOS 4KI4A 3W61A 1L3TA 2MY8A 4I56A 1U1PA 1NZ8A 4NXMF 4L3KA 4CJKA 3VQ8A 3HL8A 2JZ5A 4M3YA 2P9KB 1HRHA 1I3AA 2Z1JA 2NXUA 2PAVA 2BRKA 5T14A 4LBPA 4MYUA 1W2BR 3IP0A 2LLZA 4ECWA 1X4DA 4M45A 4DR1F 3CJ2A 2A41A 2G2YA 1BG3A 2HNYB 3N4QA 2AYBA 1ZPWX 1Y5LB 1FTRA 1HBOB 2YHYA 1S1TB 2ZUAA 3G82A 3AO3A 2WCXA 2X3GA 2E5LK 3VQAA 5KPZA 2ZH8A 2J7KA 4BDYA 5ETMA 2ZC3A 4BR2A 1TELA 4FWOA 4DPTA 4JI8F 1B9FA 5H9FK 1IN0A 3ATUA 4L75A 3BZCA 1CULB 3I0SA 3LWMA 2O8FA 2YPZA 4H5NA 3MM6B 3DOKA 1TL7B 3G6ES 3CIPA 5AQTA 1BLUA 3FFIA 2KYXA 4OX9F 4W5TA 1AXQA 4FZXC 2GWJA 4XTTA 2WONB 3ISND 1ZOTA 3S3MA 3DOLB 2E2PA 2YX6A 3FBCA 1QZ5A 3LDSA 3M9OB 4FYXB 4J9PA 1BWVA 2DR8A 2Z1HA 1YKWA 3QERA 4RNMA 3VGVA 5A0YB 5HL7L 4DR5J 4FSVA 3L6QA 2UUCK 4OGEA 3QWPA 4O3QA 1BGXT 3HDSA 5GAEU 2C3PA 1U7LA 1HI0P 2PFUA 4Y0WA 1S4FA 3C8YA 4WQ4A 2GMHA 4C8MA 2KLAA 4DPXA 3S9HA 3P96A 2HNZB 1UEKA 2OLWA 3EE3A 7AT1B 4Y6IA 2HAFA 4BRKA 4UY8O 1YBAA 4KB0A 1Z05A 1FXDA 3RAQA 4DV7K 3PFOA 3B4MA 4HHHA 2YKOA 1YJ9N 4P72A 4IOCQ 3MCNA 2DXEA 2QJ3A 3UIQA 1D3WA 3AT1B 1KLMA 3FBFA 5AQIA 1RT3B 3WDOA 3EZ5A 1TL3B 1FNXH 2KG1A 3E3XA 3GONA 2A42A 3D6FB 1V4SA 2OHDA 2V6AA 1C6VA 4DEZA 5G0RB 4DSEA 1TV6B 1M1GA 2GVDA 1UWAA 4ED7A 1Q78A 2XMTA 3A0IX 3I87A 4R79A 2WW4A 2XNRA 4A46A 1WKJA 2EW9A 3GBTA 4CO3A 3RMCA 3CJ8A 1C4AA 2BM1A 3ZNJ1 3BO2A 1S9GA 3O3GA 3L2WA 3DXKB 1HNIB 4Z4HA 3HBTA 1UZHA 4ECSA 2KU7A 1K1SA 3NVKA 3K5MA 1YI2N 2VQFK 2X51A 1S4EA 2P9SB 4GVEA 1WG1A 1FRHA 3A8KA 3W3DA 2E9ZA 3NMUA 2HBYB 5I9EB 5DJBA 4CLFA 2FLOA 4GC6A 3CD5A 1PILA 3PW0A 4RG8A 4NLCA 1XERA 1HNXF 3OVSA 3PV8A 4GV3A 3VV2B 1X0FA 4B3OB 1NHVA 1N0UA 5AXKA 3SPYA 1Q1KA 2G8FA 2F9JA 3O1BA 5D0RA 1RSCA 1IG9A 1DTQA 4KRWA 4ZLPA 2JHEA 4RW9B 1IQZA 1NDKA 4PQAA 1DTTA 4LREA 4JI4J 3R7NB 3EGNA 2JOQA 1ZBUA 4JI5K 4JD2A 2QFIA 4MFBB 4BG8A 4DV0F 4H4MB 1BY9A 3HVRA 3CCUS 1CJTA 4UOCA 5LL6Z 4F3QA 4A8MP 3KK3A 4N7TA 4FVMA 3SI8A 1RT6B 1SC1B 4CZLA 2KFNA 1LXJA 3D4JA 1UP1A 3IS9B 3H5SA 2DKOB 4CNZA 2OFHX 4NMLA 3G71S 3Q24A 4CW7B 4CNYA 1MROA 2ZM6F 2H4WB 4C8OA 2QWOA 5BN9A 4GKKJ 1S1VA 4RUCA 1OJ4A 1SL0A 1WAJA 4DCJB 4E0DA 1U8SA 2HKEA 2QA1A 4MH8A 1SQEA 2DB1A 3QRQA 2LSNA 3R1HA 1N36J 1IG8A 2Y1JA 4ZPWR 3UN2A 1RTJB 4ANEA 4Y1DA 1V5IB 4O4GA 3EYZA 4USVA 3CJTA 1LOUA 3TNVA 1REGX 3VEVA 1RU1A 3JS9A 3UDVA 1IKWA 1IR0A 3W8PA 5HROA 1CXUA 3OTBA 3DLLL 2W8KA 2Q3SA 1BQNA 5HVGA 2ASJA 3ZETB 1N33K 3F56A 3ZZRA 1F6TA 1KVKA 1YWXA 4MTPA 2Y0BB 4HUGA 5KQ8A 2QE5A 2AJ4A 5IT9U 1PYOB 1S6QB 5H1SQ 3E9OA 1E6VB 2F8TA 4GKKK 1KQKA 3MN9A 5IXUA 2XLJA 3MFHA 1KVIA 2HVZA 4ECVA 3C14A 3Q8SB 4PA1A 2F8MA 1WACA 4ED8A 1XI1A 2LDYA 2Y9HA 3A5NC 3LPEA 2R7VA 2QV6A 1IR1A 2WBNA 2FSJA 3GMGA 2KH9A 1RHUB 4LFBJ 1RP5A 4F4AA 4RWTA 5ADXH 1TFYA 3KLFA 4TLQA 1FDNA 1YX2A 3MAHA 1K0VA 4QR2A 3OLAA 2HEKA 5HANA 1ZXOA 3MR5A 5JS1A 2IMWP 1JLGB 3ZEUA 1YHQN 2CVEA 2VWJA 3HSGA 4NLOA 3T3FA 2B4JA 2B8QA 4KTZA 1DARA 3MECB 2GW8A 2MJUA 4DS4A 3NGDA 4JK8A 2BXJA 4YR3A 5ADXA 2NUBA 1FJ7A 4I6MB 4ECTA 4KFBA 1BC6A 4MQ3A 2NRXA 1TV6A 2JH3A 2VBWA 1ZAVA 4BRAA 3R8EA 3UVJA 4R0EA 2DH8A 4DR6J 1S97A 4BG9A 2IA0A 3FCWA 1U1LA 3G96A 4OX9J 3S6EA 1LW0B 2B43A 3D66A 4DR7F 4V1Ak 2ZHOA 2PE8A 4QYZJ 3PIOL 2HW3A 4C3LA 3EGWB 2ITMA 5ETKA 2R7WA 3PRBA 3PYDA 4WKRA 1QSLA 1EARA 1JLQB 1OIAA 3NGSA 1HNXJ 5GIOA 4HL9A 1O0PA 3B6BA 1VSFA 3MPVA 3PY8A 4LRBA 2ITGA 5HRNA 3GJSB 3SUOA 1YJ7A 3KK3B 3M2RB 3CWJA 4YOTA 3V4MA 1JLAA 3A8EA 4CFCA 3CCLS 1RBSA 1K1QA 1XMBA 3BB5A 4DR3K 1RA7A 1SKUB 3BGOP 5JLFA 2C3YA 3M2UB 4YOUA 2GVZB 3L8BA 4GVBB 4QYRA 2MXYA 2J0WA 1DTTB 2EBEA 5KFNA 5FIIA 2YNFA 5AE2A 1WSRA 4CF1A 3CUNA 2C3MA 3D0HE 4IOAL 3BPDA 2NXCA 1V3RA 5KFPA 1NXIA 1NGIA 2WUSA 6FDRA 4DPUA 2LXIA 4CLZA 3DXSX 3MR7A 4B9VA 1F2HA 1FNMA 4GMKA 4E89A 3FQLA 3THVA 5M1QA 1VLYA 5ETPA 2VOPA 2Y3YA 3JQJA 2HVDA 3I31A 2M52A 3HD1A 2CDRB 1IBLK 2JX2A 1ZA2B 4EU0A 4IFYA 3J7AN 4WFNL 3FEZA 3JSYA 3SQGB 4F25A 2V9KA 3QBWA 3IG1A 1S72S 4DHVA 2QWLA 3HPGA 1KVAA 4ZDNA 4FPRA 1T03B 2D0CA 2XLKA 4TQSA 5A8WB 3DDNA 5AQJA 3OD2A 2FIUA 3W5YA 3ULEA 4KB7A 2K3KA 2FZKB 3LO3A 2AKWB 2MYFA 1R0CB 3GYGA 4B3TJ 2AEMA 4CHOA 2MDAA 4FM2A 4N56A 4AD6A 4KHNA 3UNYA 3QO9A 1V6HA 1LW2B 2V34A 2ZE2B 2HRUA 1ZYQA 2YKQA 3D54A 1CLFA 3DYAA 2KO1A 4CFBA 2P9KA 4OX6A 4CZMA 1IKXB 1VQPN 2Q66A 4LF5F 3BSOA 2VQFJ 2EG2A 3CCLN 5J2MA 1Q5VA 2IGIA 1RAEB 4CYUB 3CDAA 4KHMA 2KN4A 1CQMA 2FGOA 2Q6BA 2MB0B 3BR8A 2Q0RA 1NDLA 2UVWA 1C1BB 1Y0HA 4EBCA 2BE9B 4YY3J 4CWBA 3QQCD 2DPNA 1Z26A 1TVRA 4PKGA 3SZ2A 1VLOA 3ZT1A 2G1DA 3CD6N 4H4KA 4DUZK 5AQVA 4CTAB 4UY8T 1WSVA 3VAJA 4JKCA 1FT8A 4JI3K 2DGUA 3DLBA 3M30B 1KQFB 1AA1B 4CJ4A 3ITHB 3OTOJ 1IKXA 2QW9A 2B6AB 2HWHA 5CY4A 1Z4UA 2ZH1A 4PWDB 2DISA 3QMQA 3NLCA 4B3TK 2VG6A 4CK1A 5M2RA 1YT3A 3HD2A 1WSIA 1JCGA 1NSPA 2UXCJ 2JEFA 1YTUA 3RVCA 2ZH5A 2VF3A 5KFOA 1VQ8N 2QYCA 3N79A 3QETA 1D9FA 4QWAA 1E6VA 5JVGL 2AJFE 4W90B 3VENA 5KFKA 3UD5A 4FLWA 1ZZFA 3F9MA 1SJRA 2O01C 3AVHA 2P5GA 3P5JA 1CULA 3DDIA 2VPWB 1T02A 4NZ0A 2PI5A 1U1RA 1RABB 3WIVA 1NGJA 1UVLA 1RWPB 5K5MA 2Z56B 1PYTA 5C42B 1IBLF 4BGAA 1SKWA 2XHWA 1XC3A 5GAGU 1FJGJ 4CJRA 4QU7A 2CH5A 3QT8A 1KVCA 2P9PB 5HVFA 3THXB 3Q0AA 1LWCA 1RXOB 4N8NA 4JEPA 3CXCM 4JN4A 4AL7A 4GKJK 1OH6A 3M1VA 1XMOK 3CJBA 4I9QA 1MW7A 3UN5A 2HBLA 1UOCA 4DBQA 3DXMA 3RMBA 2PI4A 2WVCA 4TU7A 2X1GA 1J5EK 2IFXA 2VBXA 4L3QA 3I55N 5MLCV 1TKTA 3EGZA 2HNDA 3VEWA 3C94A 4QWBA 4JI7K 3G8SA 4FJ7A 1DQ9A 4GVBA 1B0VA 1U0HA 1IJFB 3D2EA 1REVB 2DXFA 3K8WA 3N9UC 2GUIA 3DRPB 2VOOA 3J7ZO 2OSRA 5IT4A 5KRTA 3JYTA 2YHBA 4KPCA 1FRIA 4FL9A 4B3SJ 1QDUB 4RL1A 4UF4A 4MFBA 4I2PA 2AD9A 5J2MB 4K0KF 3J81Y 2GIQA 1HPZA 1JLQA 1C0GA 4FOIA 4YMEA 2IRYA 4USTA 3P6YC 2DNMA 1U2VA 1SIZA 4Q44A 4DX7A 1YJNS 1FD2A 5KT5A 4MDAA 1Y9OA 5E5NA 1MU2A 1R3NA 3O9RA 2HPUA 2CRLA 4IG3B 4MO5A 4DSIA 3PG9A 4ZVTB 4A4JA 2SXLA 2M3DA 4HACA 3VQTA 4MMOA 2CAJA 4NXMK 2IHR1 1XMOJ 1CZAN 2H4YB 3FMWA 1EKEA 3D2FA 2E9RX 3VAHA 2Z2LA 2FUG9 4OI3A 4H4KC 5EVZA 3ILLA 3LA0A 1SQGA 3J80U 1P8ZA 4RW4B 4GKKF 1HNZF 3QDKA 1VQMN 2GFFA 2JFKA 4Q7AA 2PEBA 5FLXO 5A8WA 3CC7N 2R2RA 3JSRA 4P2MA 1RT7A 2QMXA 3FCHA 3OR2A 4F8RA 2W9BB 2HWTA 2R7TA 3L4BC 5DK5A 2J9DE 2Z4PA 4HH1A 1RTHB 5SZTA 2K2PA 4DFPA 5KFJA 1W97L 4FK4A 4P74A 2AP6A 4KH4A 3CMQA 1HKGA 4K4WA 3U1MA 1CLQA 4P2SA 2DHXA 2DCUB 2D9OA 2OANA 2XS5A 1WUUA 1BISA 3W0LA 2DFHA 1UFLA 3CXCR 1IWGA 3SMPA 2H5IB 1FW6A 3PJWA 3RG6A 4A2AA 2FVPA 4BE2A 4DCHA 2B6AA 1NUEA 2DY9A 5AZJA 3T1HJ 3KK1A 1X31C 5J1NA 4JI0F 1I94K 5BYRA 3GV7B 4LRCA 1CPZA 2DNZA 3F41A 3KNGA 2PA8D 3F0NA 1LK5A 2E66A 3CCQS 4G3IA 3LP1B 2GJFA 4ZPDA 3TJ9A 3LDPA 2MZJA 2QG9B 4JYAK 1HNWF 1PC4A 2E5GA 2BGGA 4ES3A 5IQQA 2VPXB 2XQCA 1FD8A 3ETOA 3SQ0A 1IH7A 3P31A 2FGCA 1WOQA 4H5TA 3OL8A 1IKWB 2W4CA 3FK4A 4GO7X 2V2KA 2RS8A 2Z30B 4ZHRB 3FBBA 4KSEB 3OHRA 1S1UB 4H8KA 3RR8A 2PMZD 1B3TA 4O55A 1Q8IA 1FDAA 4EYIB 4B3RJ 2UUTA 4IDKA 3AJDA 1ZBSA 4DN0A 2O66A 2YI1A 1FKAF 1BIUA 2VFSA 1LW2A 1UVIA 3H98A 1VQMS 3IAM9 1HBNA 1KBRA 1TUWA 3KKFA 3KJVA 3A5LC 4BC3A 5HK4A 4IH7A 2JEJA 1HD1A 2XHCA 3CCWA 3NGRA 4CLSA 5SUHA 3TTCA 1YI2S 4HDHA 1BQMA 1QLNA 3BKTA 2V4JB 1DRZA 4KGVB 1ZAWA 3HI9A 2NS1B 4DV1K 2FSKA 5KRSA 2W40A 3ZO7A 3BGLA 5KFEA 1B7FA 3AY9A 2IS3A 1VS3A 1QJHA 3CJAA 3NS7B 2KG0A 1RBOB 4KO0B 3D0GE 2W6KA 4C3MA 4E1NA 3GYXB 2P1JA 2W42A 1OVQA 4O8UA 2FF3B 1CJUB 3RMAA 3OJUA 2Q43A 2XMAA 4J8FA 2CQPA 4CJ5A 3DRRB 3MURP 2OTJS 4KKOB 3D5MA 1KNZA 3OUYA 4KE5A 1VI7A 3VQ6A 4CHZA 4MAKA 4X62F 3SQ2A 2PEHA 3QNOA 1PBUA 1D1UA 1K8KA 3ZSZA 2W2NP 3BV8A 3N5FA 3QAUA 4LIWA 1NJYA 5HP1B 4WFBL 3L3UA 3ENAA 3VR1A 1LOTB 3SI6A 2RVJA 4OIXA 2D0PA 4EP5A 3IGVA 2L41A 2K8GA 2ATLA 5IT0A 2O3DA 1VRUA 4QS9A 3B6OA 5L9NA 1RHMB 3U27A 2HFZA 2OZSA 5FPEA 4IFVA 1WD6A 3IFRA 3FCVA 3OYMA 3BYPA 3MMAB 1APSA 3KWIA 3CIMA 1VC6A 2NR0A 4FOEA 4NO7A 3RWUA 3TJAA 1IUJA 3GG0A 1HQEA 1KOOA 3HTVA 2MZSA 4OYIA 1JKHA 4B8AB 1FA0A 1ZM9A 2XY7A 4PXBA 3ZNUA 4WJBA 2CKWA 4F67A 3EXCX 3P5BP 2PYJA 1S1VB 4OX8A 2VQEF 2XRIA 3TANA 1YRTA 2RT3A 4DUZF 2CNLB 1RAOA 4DKWA 3DLRA 3UKUA 1XNRF 4I6MA 3UR0A 1B4SA 5BXIA 5HSPA 2RF2A 3N4WA 1ZBFA 1M90O 1TUGB 5JS2A 3A2FA 4USMA 1DEJA 3MEDA 2FHOB 1HKCA 3HRGA 1WF0A 3K5NA 2ZKTA 3LWLA 2DRAA 1HR0K 4OZ5A 1M5OC 5HN0A 1DJ0A 4O5FA 4WP3A 4OZNA 4USUA 2E9TA 3DLEA 2R8GA 1XNQJ 4BLGA 4DQSA 1C2PA 2DGVA 3DOMA 3NCPA 3KHYA 1IBMJ 4O0NA 2KVQE 4M94A 1LWFA 2G2ZA 2WSCC 4DL4A 2DCLA 3CJ7A 2X1BA 3T7ZA 2D7SA 3CQXA 2HBQB 1SCJB 5HBMA 3M2VB 4ZIWA 4QW8A 4EFHA 2KHOA 3IBWA 3VTIA 1RDCA 3AVMA 5C25B 3AARA 4RBTA 4IDKB 3CMAS 2E5IA 1ZM2A 3W5XA 2PGCA 1S99A 2XZTB 1S9GB 1PKUA 1ZBIA 1VSDA 3VQ9A 1ILYA 2YQ1A 1Y7PA 4GNIA 2FZGB 4JI6J 1HNWK 4JI1J 4AT1B 2ASPA 2O8DB 1YIJS 3J7ZT 4WP8A 4J2EA 1GLFO 4X65F 4QWDA 1UPPA 4X4OA 1CJVB 1ASWA 5HO4A 1XNQK 1W25A 2W8LA 3BN7A 1YVNA 3KLEB 1UJ5A 1O5JA 4EBEA 4FYDA 4A2BA 4ID5A 3NG8A 4NLVA 5IQ6A 4ZP8A 3UQSA 2DFFA 2RKIB 4P7VA 1MWMA 1HWUA 3UCZP 4N47A 3DDKA 5AQWA 4AHRA 4DPWA 3TR5A 4CHQA 5MLCQ 1JL2A 4KH6A 4G1QB 3ZX0A 3WXLA 4ZPTR 4O3PA 2NLWA 2V68A 2P9IB 4M42A 4PKDB 2ZH9A 4H4OB 1P1LA 3O5BA 4PRFA 2IYIA 1AZSB 5ETSA 4DSLA 4U7CA 1FF2A 4DR3J 3N01A 1WSJA 4F04B 4G65A 2LQ9A 4KO0A 1SJ3P 1KN6A 1SJ1A 1WNSA 3THPA 2W9AA 5D8HB 2E7WA 1RILA 4UY85 4HCBA 5FJ4A 4NMXA 3AAWB 2GGPB 5D4LA 2YWKA 4F0MA 3W2VB 2I5JA 4BWMA