3KLFA

Crystal structure of wild-type hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
b'ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 139
structure length 553
sequence length 553
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klfA05
5KFCA 4CJRA 3AVBA 3OYEA 2D0CA 1RTHB 3AO1A 1CZ9A 4CJQA 2R8IA 1HNIB 3G6VA 1EX4A 2YKNB 2BQUA 3I0RA 4CGDA 1QAJA 4CK1A 4ELTA 4EZ9A 3LZJA 1Q8IA 2FVSA 2QXFA 3V4IB 4DTPA 5KFBA 2W9CB 4CEZA 4G1QB 3MEDA 1TK8A 3QZ8A 3MXMA 1NNDA 3KK1B 3GIIA 1CZBA 1IKYB 3C6UA 3V81B 3JYTB 3OS0A 3PO5A 4PUOA 5KT6A 1XR7A 3ALYA 5J1EA 3OYFA 3L3VA 2FJVA 1CSJA 4JUZA 4CF0A 1LWFB 1NHUA 3KLHA 3SPYA 3LALA 2F8TA 4NRUA 1FK9A 2ZQBA 2C2DA 4B8AB 3TAPA 1N56A 2HNZB 2D3UA 3E01A 2KFZA 3IRXB 4CJUA 1C2PA 3CDEA 4E1MA 2WHOA 4AHCA 3LPTA 1RBUA 3KLFA 3SUPA 4HUGA 3G6YA 2DY4A 1NKEA 4I7FB 4B3OB 5KG5A 1LW2A 2QV6A 2R2TA 3M8QB 4BDPA 1LWEA 1S1XB 1L3UA 1ASUA 2BE2A 4GC6A 5C24A 3PW5A 2VWJA 3VQ8A 4F50A 4DTRA 3NH1A 5D3GB 1B9FA 1XHZA 1VSKA 3DOKB 2HMIB 1C0TB 3H4BA 5L1LA 4B9TA 4RG8A 3MECB 2DFFA 1UA0A 4WFYA 3IS9B 4E7KA 3P5JA 5KFDA 5FDLA 2HAIA 2UUWA 5KFAA 2GBZA 3QEWA 1RDAA 3DYAB 2BDPA 3VQ4A 4F4XA 4KE5A 3KK2A 1NJWA 4HUEA 3H4DA 3H5XA 1IH7A 2RN2A 4NCBA 2YNIA 3KLVA 4O4GA 4J9LA 1D9DA 4DFKA 4WFXA 3DRSB 3KLIB 2IJNA 1XWLA 3HXMA 4TXSA 3WNFA 5DLFA 1JL2A 2HNYB 4ECVA 2W9BA 4ECQA 5HLFB 4LSNB 3SYZA 4M3XA 4K8XA 4PQUA 1CXQA 1VSDA 2IM2A 4Z4CA 1S49A 1BIUA 2ILZA 1XI1A 2OA8A 4EYHB 3I0SB 5KG0A 3UDLA 1HYSA 4YR2A 4CJ3A 1DTQB 4FJXA 2XY8A 3ZSOA 1SH2A 4CECA 4LSLA 2D0AA 1KLMB 3SUQA 4OLAA 4J9QA 3LP1A 1EETB 4MIAA 4CFBA 4NLPA 3V9UA 3LWMA 2HHXA 4CJSA 4KFBB 4WE1B 3OYAA 1RDDA 5J2MA 4NLVA 2VG6A 2E9TA 4CJPA 1WAJA 3BSCA 2VG5B 4JV0A 1U4BA 3MR2A 1JLCA 3VQCA 5DG8A 3Q8RB 3VQBA 1F21A 2IGIA 1XC9A 5I42A 3KJVB 1WN7A 3OHAA 1JLEB 5KGWA 1JLBA 4KV8B 4WYWA 4CHPA 3DLKB 4MK9A 5FRMA 1X9MA 2JGUA 3OHBA 3NAHA 4DFPA 3RMBA 3DLEB 3NBPA 3S3NA 3KD1E 4K4TA 4Q43A 4FBUA 2YNHA 4IG0B 4W5RA 4URQU 2HHVA 3TAMB 4ZP7A 2D5RA 4TYBA 4B9VA 4IDKB 4DU4A 1RBTA 2XHBA 2HHQA 1KRPA 1RA6A 1VRUB 2HHUA 4RW7A 3IGVA 1TKXA 3MFIA 4CEQA 3N6MA 5F8GA 1W9HA 1KCFA 4NZ0A 5KRSA 4H8KA 1RDCA 2WRMA 4EBCA 4O3NA 3MR3A 1J9AA 3KTQA 1QHTA 3OSPA 4M3ZA 4TYAA 3T3FA 2AGOA 1G15A 4J9OA 4RU9A 3RAQA 1L5UA 4M3TA 4CFCA 4IFYA 3KKSA 3I0RB 1TQLA 5E41A 3BDPA 3Q8QB 4Q0BA 2FVCA 4OJRA 3SQ0A 4RW8B 4R8UA 3LAKA 3H5SA 5KFVA 3DOLB 2O4IA 4M3WA 4DL3A 4FJHA 3MEDB 2AU0A 3LPUA 1LAVA 2O5DA 4RUAA 2P51A 3V1RA 1FXXA 1RTHA 1D8YA 2JLEA 3WNGA 4E3SA 1S48A 3C6UB 3BR9A 3RB4A 3OYLA 4NLTA 4LQ3A 4PUOB 4NYFA 4CHOA 1VSEA 5J1EB 3RMCA 4QAGA 4CEDA 2EHGA 3V4IA 3K5NA 1BI4A 3AVJA 4ED2A 1FK9B 2YHAA 3N6LA 4ECWA 3GYNA 3ZT1A 4JV2A 3VA3A 3TARA 4CF2A 3HP6A 1I39A 2C2RA 5KFFA 3KLFB 4YQWA 1JL1A 4H4MA 4FJLA 4CEFA 4MIBA 2WTFA 2D7SA 2JEIA 4KB1A 1LW2B 1BQNB 3AVGA 3SPZA 1LWFA 1LWEB 3SCXA 4C8LA 3VA0A 3IAYA 4BE2A 2BE2B 5C24B 3QNOA 4YNQA 2HNZA 1K1SA 4PY5A 3DM2A 3GILA 3TQ1A 2HHTA 3KKRA 3TAEA 5EUHA 2OPQB 4N5SA 4HKQA 3FQLA 5L1JA 5KFLA 4B3OA 3K5LA 3P83D 4QW8A 1C0MA 4W5TA 5FDLB 4IRCA 2B4JA 3KNAA 1VK0A 3KOAA 5KGXA 1S6QB 2WCXA 4CJVA 3CQ8A 4ZP8A 1YT3A 1RT4A 4FK2A 2PY5A 3DLGA 4DTOA 4CK2A 3KHHA 2IS3A 3HPGA 4DL2A 1SKRA 2LSNA 4G3IA 1QTMA 2W8KA 3BGRB 3QIPA 3GIMA 4ED1A 4N41A 1S4FA 4BWMA 1C0TA 4FLZA 4FLYA 4QWBA 3TI0A 3RWUA 2KFNA 1Y97A 3H5UA 2AX0A 3UPFA 3NMAA 2C28A 1TAUA 4H4OA 2DPIA 2RPIA 4CJTA 2FLLA 3AO4A 4DTJA 1XR6A 3AA4A 2W9BB 3O4QA 4NLDA 3ITHA 3WNEA 5C5JA 3H5YA 2ILYA 4PWDB 3NGYA 1HYVA 3ZCMA 1HYSB 3TR8A 3CVKA 3KHGA 1S5JA 3KLIA 4TQSA 2G8WA 4KKOB 4W5QA 4LSLB 4NLUA 3LP1B 1D9FA 3OYDA 4OGEA 4BE1A 4N47A 2O4GA 5J2MB 2VG6B 1TKZB 3OL7A 2XGQA 3Q8PB 3AVAA 4CGIA 4J9NA 3V6DB 2R8JA 5KT4A 1JXEA 1VSMA 3HPHA 5SWMA 1VRTA 5I42B 1KLMA 4QCLA 3CDUA 2FBXA 2OPRA 3GIKA 3QIOA 1IM4A 3U3GA 4ELVA 4O44B 2VG7A 1RDBA 4AH9A 2XI2A 3PV8A 4O3QA 4Q44A 4TSXA 3NBPB 4CF9A 4DTXA 1RT7A 3NAEA 4FCYA 3AV9A 2ITGA 2PYJA 4DSKA 4RUCA 4J9MA 1JLGA 1HJRA 5DG9A 1RT1A 1K6YA 3HJFA 3T5KA 3KJVA 2R8HA 2AGQA 3PY8A 4FK0A 4RW7B 4DL4A 3HHKA 3DLKA 3PJWA 3V9WA 4WXWA 3BSNA 4JRQA 4QWEA 2QE5A 2UVUA 1QS4A 3BREA 3OLAA 1RT5A 2JC1A 2DPJA 4OL8A 4IG0A 3V9SA 2E4LA 4IFYB 1L3SA 1HYZA 4Y2CA 1A5VA 2W9AA 4Q0BB 3SJJA 5K14A 2R2SA 3FFIB 3CM6A 4XPEA 4Z4GA 5KFTA 3SZ2A 4R8UB 3RB6A 2XY7A 3ULDA 1Z26A 1QAIA 5F8HA 5CYMA 2AGPA 4KHQA 4FJ7A 2YKMA 3RBEA 1JLFA 3DRRA 3NGDA 4WXOA 3ISND 1JKHA 5KFIA 3F9KA 4J2DA 3QLHA 2ALZA 1BISA 4B9NA 3C6TA 4IOBA 3U3YA 4K4YA 3C95A 2IM0A 1BL3A 4ID5A 1S0MA 1U48A 4RW8A 3HPOA 3QO9A 4ICLA 3M8PA 3FQKA 1ZTWA 1BIZA 3DOLA 1BI4B 3LP2B 3D5MA 3PUFA 3QINA 1IKXB 3UQSA 4Z4EA 1RT3A 4YR3A 2R2RA 1T7PA 3MR6A 4RW6A 3VQ6A 3AVMA 2JEFA 3N6NA 1BHLA 4ZVEA 4N76A 1KFDA 4M45A 4H4MB 4CJKA 4O3SA 2E6MA 3LP0B 4J2BA 3M8SA 4KBIA 2XY6A 4CJLA 4WZMA 5L1IA 1KSPA 5KT5A 3P1GA 1VSLA 5KFUA 3KIOA 2W42A 3LZIA 2RKIB 3G0ZA 3PVXA 3VN5A 4OPJA 1HRHA 3DM2B 4KSEB 2Y1JA 4NCGA 4ZTJA 2DFHA 5KFHA 4DTSA 4FW2A 4M95A 3BQ2A 4TLRA 4KHNA 2G8KA 4KHWA 3OS2A 4ED6A 2P5GA 1W25A 4Y1CA 5KFGA 2B5JA 1BQNA 3KK3A 3MEEB 1HNVA 5DMRA 1ZYQA 3NKYA 1S1TA 1TKDA 5JUMA 2VA3A 4YR0A 4EO6A 4MQ3A 1RT4B 2ATLA 3K5MA 3OSNA 2OPSA 3DLGB 5DGAA 1SKWA 3OYIA 4DL5A 4FBTA 4CIGA 3QIPB 4DFJA 2OPQA 2W8LA 3T5HA 4C8OA 4MKBA 2AJQA 4Z4IA 3EZUA 4H4OB 1J54A 3ZSZA 2CJQA 4C8NA 2PYLA 4IH7A 1S6QA 3L2RA 4DQIA 1L3VA 4FLVA 2OPPB 2XO7A 3ITHB 3AVHA 4FYDA 4BDZA 3BGRA 3GV8B 4JLHA 3KMSA 4FJ8A 4CFDA 4E1NA 2FBYA 4F2RA 2KZMA 3MXIA 1FKOA 1ASWA 4M3UA 5F8MA 3PW2A 3QGIA 4FVMA 3SQ1A 1U49A 3OJSA 3RTVA 3V1QA 3H08A 1C0UA 1QQCA 3LANA 4PWDA 1N4LA 4URSA 3T19A 1KLNA 5CZ2A 1MMLA 3SQ2A 1WNSA 4FLUA 4AHRA 3I5BA 4DS4A 3VQ9A 4KKOA 4DQQA 5KT2A 1VRTB 4KB7A 4TQRA 4H54A 5KFKA 2OPRB 5EWFA 3HYFA 3AVNA 4CGGA 3PX0A 1NK6A 2VG7B 3GV7B 1DTTA 3PHEA 5FRNA 4DFMA 3AO2A 4IKFA 4W5NA 2ZD1A 1TKZA 3I5CA 3SI6A 1RT7B 4ZPCA 3ZSVA 3TVKA 3AVKA 4TN2A 1WSEA 4PA1A 3V6DA 1JXLA 1JLGB 1RT1B 4E0DA 2IC3A 4OKJA 2I5JA 1LWCA 3O4NA 4ELUA 5HROB 3ASMA 4HCCA 3H59A 3KHLA 3NCIA 1Z25A 2D3ZA 1IKWA 4OPKA 4IRDA 3S9HA 4DF8A 3O3HA 3PX4A 3MFHA 4KTZA 4O44A 1TVRA 1ZBFA 3CM5A 2G8UA 1T8EA 3JSMA 4U7CA 1RT5B 3V9XA 4RW4A 4QWDA 3EPIA 4X2BA 5K14B 1T3NA 4XO0A 5DGBA 1ZETA 5CYQB 2UVWA 1S9GA 3TAGA 1NJZA 1VSHA 4AHVA 5CYMB 1SV5A 1TL3B 2YKMB 2Z1HA 4F8RA 4KHSA 4FM0A 1NKBA 3NL0A 1JLFB 3DRRB 4FM2A 3FSIA 2HWHA 1JKHB 1U04A 5KRTA 1BQMA 3QLHB 3NF6A 5HP1A 3C6TB 1RA7A 3BSAA 2R8KA 4IRKA 4FM1A 4WZQA 2GIQA 1O1WA 4ID5B 2HWIA 3FFIA 3SUNA 5KFNA 2KQ2A 3QO9B 4ICLB 3M8PB 2ASLA 3G86A 4Y34A 2PZSA 3RRGA 3VQEA 1KVBA 2FBVA 3OYKA 3ZSQA 1TAQA 2IA6A 1WAFA 5C25A 1RT3B 3QGHA 3ZT2A 1TK0A 4HCBA 4RW6B 4F4WA 4RNHA 1S1UA 2BRKA 4OVLA 4CEOA 3K58A 1Q9XA 3DMJA 1UWBB 5HRRA 4F3OA 2KZZA 3LP2A 1SL0A 4K4ZA 4DSEA 4NLGA 1IKXA 2P5OA 3QESA 3ZSRA 2RDJA 3D28A 4NCGB 3KLGB 3B6OA 4KI6A 2XRIA 4QWAA 1WSGA 4DSIA 4K8ZA 5T7BA 1TP7A 1YVUA 5F8JA 4F4ZA 3OLBA 3S3OA 4IR1A 3SV3A 3RR8A 3LP0A 2B5JB 3KK3B 2D41A 1HNVB 5F8LA 1S1TB 2QKBA 3Q8SB 1IO2A 4E7HA 2RKIA 1TK5A 3L8BA 5J2QB 4JS5A 4FS2A 1J53A 3TAFA 1RBVA 5J2NA 3EYZA 1HQEA 2DTUA 2OPSB 3DLRA 1NKCA 2KTQA 1NK5A 4YP3A 4E7LA 3OL8A 4LY7A 4KREA 3SQ4A 3AVCA 1UOCA 1B9DA 4J9KA 3OYCA 4IH6A 3NAIA 4LH5A 4DQRA 3MEEA 2EC0A 3A2FA 2YV0X 1ZBIA 1SL1A 1ZBUA 1RTIA 3SUOA 3PX6A 3RMAA 2GC8A 1Q9YA 2C22A 5KG7A 4HYKA 2AQ4A 2QK9A 2AWZA 2FLPA 4DL6A 2A1SA 4N56A 1RTJA 3CWJA 4CJFA 4J9SA 3CJ3A 2FBTA 4QOZB 1FKOB 3U6FA 3S3MA 4CE9A 3CIZA 4EYIB 1ITGA 2XCPA 5JS2A 2CKWA 3QEXA 1B92A 1A5XA 3IG1A 2OPPA 4WYLA 4I9QA 4KTWA 1GX6A 2W7PA 1C0UB 4E7JA 4FS1A 4HHTA 1YVFA 3QIDA 2BRLA 1HPZA 5KG3A 2IAJB 4J9PA 4Y1DA 3TWHA 5KI6A 4XIUA 2Z1IA 3OYHA 4MK7A 4O0IA 4GC7A 3VQQA 5DQGA 4CK3A 1QE1A 3PW4A 3HL8A 3V1OA 2V4QA 3VQ7A 3VQSA 5KTQA 4ZP9A 3G6XA 3MEGA 4RNOA 2X78A 3QZ7A 3H2LA 1DTTB 2ZD1B 3SV4A 1MU2A 1RT2B 3LWLA 2HB5A 3OVNA 3VQDA 1SL2A 3UIQA 1DLOA 2VA2A 1CLQA 1RYSA 4CESA 4KAZA 4FK4A 4MKAA 1NK0A 2IC3B 2WONB 3GQCA 2I5JB 2XC9A 1LWCB 4DS5A 1JLAA 1J5OA 2R2UA 4ECUA 1IKWB 1NK4A 2E9RX 5KG4A 1NOYA 2XI3A 4OKKA 5EWEA 2FVPA 5F8NA 5EU7A 1BCMA 1TVRB 4M3RA 1S0NA 4CERA 2BQ3A 4CIFA 5DQIA 3LAMA 4RNNA 3JSMB 4JRPA 3GIJA 4Q45A 4CHZA 3QEPA 3MR5A 1RT6B 4RW4B 2YNGA 2XWYA 4E89A 3O3FA 4O5BA 4R5PB 3HP9A 3AO5A 3MF5A 4ZPDA 5HROA 2BANB 1S9GB 4BE0A 4YFUA 3T5LA 4O0JA 3OY9A 3FDSA 1KVAA 4AHUA 5KFJA 1SV5B 4CJ5A 4ECYA 1T05B 1BQMB 5KT7A 4LQ9A 4KI4A 1S6PA 2F8SA 1SUQA 3NF7A 1SH0A 5HP1B 4CF8A 4DMNA 4R0EA 4LD0A 3HVWA 5F9LA 1WNEA 5CYQA 1N5YA 2YHBA 3BQ1A 3CFPA 3M9OB 3HVTA 4DQPA 4Q8FA 2WOMA 1RILA 1TL3A 1X9SA 2A1RA 2C2EA 1I3AA 2XCAA 5C25B 4JV1A 3NE6A 3QERA 4DU3A 3OYMA 1S1UB 3C94A 1ZTTA 2JEGA 4AHSA 3DMJB 3HVAA 2Z1JA 1C1CA 3QGGA 5EWGA 3L3UA 5KFSA 1JIHA 4M41A 1X1PA 4RW9B 3M9NB 4B8CA 5KFQA 1QSSA 2HVIA 3D45A 5T14A 1NK7A 4ED8A 1CXUA 3K57A 3CFOA 4E7IA 4FJ9A 1EKEA 4QWCA 1C1AA 5KT3A 3RR7A 4Z0UA 1UWBA 4KRFA 3SFUA 4KAIA 3L2WA 1QUVA 1TL1B 5J2NB 1HQEB 3CDWA 4DTMA 4FJMA 4ZHRB 3VQ5A 4B9LA 3KLGA 4CFAA 5KFEA 3MXJA 2DFEA 2YNFA 4Z4FA 2X6NA 2WB4A 1ZBLA 4RNMA 4K50A 4Y2AA 4DG1A 1KTQA 3CO9A 4B08A 4QPXA 4DSJA 4NLWA 1FKPB 4MH8A 4NYZA 3LDSA 3DI6A 3DRPA 5J2QA 1RTIB 2IBKA 4NLQA 2Z1GA 2ATQA 2RDIA 3PR5B 2NUBA 3NH2A 3QEIA 1SKSA 1QSLA 3OYNA 2P1JA 2R8GA 1TKTA 5HRSA 2E6LA 2IM1A 1RTJB 3V9ZA 2D0BA 1RAJA 3EPGA 3HM9A 4ED3A 2HNDA 5HRPA 2QKKA 5J2PA 4FXDA 3VQPA 3NF9A 4NLSA 3M8RA 4FLTA 2UVRA 3OJUA 1U09A 1HMVB 1S1VA 2FVRA 3NHGA 3DLBA 1UAXA 2V0NA 3KD5E 3IG1B 1D1UA 1QSYA 4HVJA 3KHRA 3TANA 2ASDA 3ZT0A 2G8VA 3CJ0A 5L1KA 1GX5A 3VQAA 1HPZB 3H40A 4E19A 3O3GA 5DG7A 2JEJA 1TGOA 1EP4A 3AVIA 4CF1A 4CGJA 2I1RA 5DLGA 1QE1B 3L2VA 5CY4A 2IJFA 4DTUA 3T1AA 3V6JA 3MEGB 3KMQA 3SFGA 4ECXA 4KO0A 2BR0A 1LW0A 4TY8A 4TY9A 4C8MA 2XY5A 4ZPAA 1MU2B 4BACA 4LH4A 4QW9A 4K4XA 4FJ5A 1DLOB 2BGGA 2F8EX 3OL9A 2IAJA 4O3RA 3QNNA 2FJWA 1S1WA 4UQGA 4EP5A 5F9NA 3QEVA 2HVHA 5KFXA 2R7YA 3E51A 4RNFA 3RB0A 3PR4A 3OYBA 4ED0A 1R0AA 1JLAB 2B6AA 1J5OB 3F73A 2G8IA 2RF2A 1T03A 1C6VA 1GOCA 3ICLA 1RTDA 3CG7A 1S97A 4EBEA 4B9UA 2F96A 4NLXA 2XGPA 1RT2A 1GOAA 2HW3A 1LAWA 1SH3A 4F4YA 1NJYA 3ZT3A 3PZPA 2YNGB 4MK8A 4C8KA 1XR5A 3K59A 4I2PA 3PJXA 2WONA 5KFRA 4CEBA 2FJXA 4MFBB 1X9WA 3NH0A 3AVLA 2UUTA 1C1BA 3B6PA 3PW7A 4F3TA 2FC0A 1REVA 5CZ1A 2FVQA 4ECSA 4BWJA 1S6PB 1W0HA 4KHYA 1SUQB 4K4SA 2KW4A 1JLQA 5HBMB 2IOCA 1N6QB 3TABA 5DK5A 1RT6A 2W7OA 3RBDA 3MAQA 5C42A 5KFOA 4CGFA 4R5PA 4NRTA 5I3UA 4FJKA 4O3PA 1N5YB 2BANA 4XPCA 4CJ4A 3HVTB 3HO1A 2WOMB 1RCHA 3BSOA 1NJXA 1T05A 4DWIA 4I2QB 1VSFA 4O3OA 2IM3A 3AA3A 4O55A 1YTAA 4DLEA 4F2SA 2J6UA 1JXBA 2B43A 3THVA 1OS5A 2G8FA 4DL7A 3RRHA 4DTNA 2VWKA 4EZ6A 1HQUA 2ASJA 3TAQA 1S9EA 4IR9A 4M42A 4DU1A 1C1CB 4IFVA 3KLEA 2ZE2A 1IKVA 2IDOA 1ZBHA 2EX3A 2WK4A 3OL6A 2OH2A 3HVRA 1TV6A 4IG3A 4BDYA 4HUFA 1D0EA 1RDRA 3SI8A 4IQXA 4K4WA 4NLRA 4DQSA 3HK2A 4J2EA 3WNHA 3NGIA 3CJ5A 4O4RA 4F4KA 4ZPBA 3BJYA 3RAXA 1JX4A 1KHWA 3QYYA 5KG2A 4ZVFA 4IKAA 2GUIA 3HKWA 1HNIA 3I5AA 2ZKUA 4CGHA 2YKNA 4FJJA 4AHTA 2Q3SA 4RW9A 4CJWA 3NGZA 4FJGA 4Q8EA 4NYNA 4FZZA 4KTQA 2YNFB 4RZRA 3AVFA 1S9FA 3KLHB 4DG1B 4ZMMA 3EY1A 2W9CA 4J2AA 3NF8A 4G1QA 4CCHA 1KVCA 4KHRA 2Y1IA 4K4VA 4OKEA 3E01B 4IH5A 3KK1A 1Z4UA 4K4UA 3HT3A 3DI6B 3DRPB 4DF4A 1IKYA 1TL1A 3T5JA 4FLWA 3FRZA 3V81A 3JYTA 4ZHRA 1RNHA 4EEYA 5KFMA 5JS1A 3ISNC 3PW0A 3AA2A 5KFWA 3D0PA 5DQHA 4WFZA 1LV5A 1TKTB 3V6HA 2BQRA 4ZVGA 2HNDB 3EZ5A 5J2PB 2GV9A 3L2UA 1FKPA 4AILC 4CIEA 3PO4A 2JC0A 1KHVA 4ECTA 1S1VB 3IRXA 4IBNA 1HARA 5JXSA 3M9MB 4FLXA 2IMWP 3HSTB 2V9WA 4I7FA 1UA1A 4EO8A 1KFSA 3M8QA 1N48A 2GIRA 1NOZA 1EP4B 3V6KA 5KG6A 1S1XA 1RYRA 1NK8A 4M3YA 4ZTFA 3KK2B 2OYQA 3DDKA 1BGXT 3CYMA 2UVVA 4OLBA 1HMVA 4ZP6A 2YNIB 4FJIA 4O4GB 4YMEA 3ZSXA 2J6TA 5D3GA 4NLYA 4GMJB 4KO0B 3DOKA 2HMIA 1LW0B 4TY8B 4L8RB 5KFZA 3GV5B 3MECA 2ETJA 4EP4A 3IS9A 4Z4HA 1EXQA 4ZVHA 4I9LA 1S10A 4J9RA 5KFYA 2OZSA 4FW1A 2E9ZA 4DSLA 1S1WB 1YTUA 3ZSYA 1L3TA 3NFAA 4CHQA 3QETA 3DYAA 3BQ0A 1R0AB 2B6AB 2X6SA 2RF2B 4PQUB 1T03B 4EBDA 1NK9A 4FZXC 1RTDB 3DRSA 5FROA 3AA5X 1XHXA 4GVMA 4ED7A 4Q5VA 4KB0A 1WLJA 3IGNA 3OS1A 4FZYA 2J6SA 3AO3A 4I2PB 1WSJA 2HNYA 3ZSWA 1VSJA 4CJEA 4CEAA 5HLFA 4LSNA 1C1BB 2FLNA 5SZTA 3IN5A 4B9SA 3K5OA 2G8HA 2HHSA 1REVB 4GW6A 4KHMA 3I0SA 3UR0A 4B9MA 3H98A 1JLCB 1WSFA 1DTQA 1WSHA 3CJ4A 1JLQB 1ASVA 1NHVA 4JS4A 4M94A 3MTKA 4NCAA 1EETA 3CFRA 4ID1A 4OGCA 1A5WA 1JLBB 5C42B 5KFPA 3LP3A 4MFBA 5I3UB 4ECRA 3OYJA 4CHYA 4KFBA 4WE1A 1U45A 1K1QA 2AX1A 3L2QA 3RB3A 5HRNA 3DLHA 3I8DA 2VG5A 2YNHB 1S0OA 1T94A 4W5OA 3K2PA 4CHNA 3CJ2A 4DSFA 1N6QA 5HBMA 4ECZA 1U47A 1JLEA 3G10A 3NDKA 1RBSA 1TKXB 4KV8A 1WSIA 4KHUA 5L9XA 4HTUA 1BCOA 1HQUB 5EDWA 1IG9A 1S9EB 2HHWA 1GOBA 4URGA 4IFVB 3KLEB 3DLEA 4DEZA 4FJNA 2ZE2B 1IKVB 4KPYA 4DLGA 5F8IA 4I2QA 3SNNA 1TV6B 3TAMA 3ZT4A 4IG3B 2X74A 5KG1A 2OZMA 4U6PA 4IDKA 4CEEA 1RBRA 3OYGA 1VRUA 1D5AA 1I6JA 1VSIA 2V4RA 3RMDA 4Y3CA 4NLOA
chains in the Genus database with same CATH superfamily
2MKKA 1F2GA 2C2NA 3JB9k 5AQOA 1KAYA 4NLCA 3WDOA 3VAJA 3K8WA 1MWYA 5A8WA 3OYEA 2W4CA 2QLBB 4MJKA 4I0WA 2ZM6J 3G6VA 2YBVA 2ACYA 1HA1A 3UFCX 3I0RA 5DO2A 3CJCA 4CK1A 4ELTA 3VQTA 2QW9A 3AH6A 3BBFA 2NNWA 2B56A 1SJFA 1X5PA 3NG8A 2RS2A 3C6UA 3OS0A 2OJ3A 2E7VA 1HIYA 4PUOA 1XR7A 1IJJA 1H2UX 1WC6A 4G6VB 5EXWA 1RAIB 4EMDA 3HRGA 2LEBA 4CF0A 3O8MA 1WACA 3KLHA 3SPYA 4NZ6A 4DPUA 1IR2A 2XS2A 1WELA 9ATCB 1U25A 4B8AB 1N34F 4LF6J 2D3UA 2E5LF 1IJEB 3IM8A 1GEHA 1C2PA 2WHOA 4RWTA 3DXSX 3MR7A 4HUGA 3G6YA 1NKEA 3KWMA 4I7FB 1LW2A 5C2CA 1K73T 3M8QB 4OI2A 4BDPA 1L3UA 3JSYA 4NEZA 5D6GA 2A6OA 4OJGA 4LFCJ 2CZ4A 3EEQA 3P31A 3H90A 3NH1A 2KI2A 1HHSA 3Q8YA 4DPWA 1VSKA 3WXIA 1C0TB 1Q8BA 1XK8A 5AXMA 3H4BA 4B9TA 1HBMA 4WFYA 4R0JA 2QSWA 5LMNF 4P2MA 2KU7A 2G0JA 1OWXA 1ATSA 3ULEA 3BGLA 2ZZMA 5KFAA 2HF3A 3VQ4A 4F4XA 4K5RA 4NI2B 3KK2A 1NJWA 4HUEA 3EVMA 3H5XA 3VEVA 2DTJA 4PZVA 2OKQA 2RE2A 9RUBA 5L38A 1SC6A 2IHR1 4RWWA 3WNFA 5DLFA 5LY3A 1JL2A 1CJKA 4FOEA 2HNYB 3ZETA 1FFGB 4ECQA 1N34K 1N34J 1ZAWA 4KH6A 3MI7X 4O5FA 1KEKA 1CXQA 2E5LK 3NS6A 2E5LJ 4QQBA 5HL7Q 2C42A 4AXIA 1XI1A 4EYHB 3TJAA 3VTIA 1HYSA 1WJ9A 4CJ3A 4YDDB 1DTQB 3IAS9 3ZSOA 4NA2A 1OH6A 3CJ1A 3OPKA 4PEOA 4M8LA 4OLAA 4J9QA 3HX9A 2YHXA 4CFBA 2BJ3A 1A0OB 2LP4A 3T9ZA 4KFBB 4WE1B 1URNA 3NNHA 2M88A 3OYAA 3KG0A 5J2MA 4ZDNA 1GXUA 2KT5A 4A48A 2VG5B 1U4BA 4MDBA 6FDRA 2H51B 4WTOB 1ROFA 5DG8A 2E7XA 3SDEB 3VEXA 4ZVPB 1FJGF 2IGIA 4W92B 1XC9A 5LMNK 5I42A 5LMNJ 1WN7A 3OHAA 4NXMF 2HFZA 2OELA 1RWVB 3AJ2A 1YJWN 3DLKB 1Q16B 2O3DA 5FRMA 2DBBA 4LRFA 5ETTA 1SJQA 2VGMA 3RG6A 4M5DA 4K4TA 4FBUA 1E6VB 4WBFA 1IR0A 3QB0A 4AYBD 1MN9A 4IO1A 3DXBA 4UUWA 1P8GA 2MMYA 3PACA 3M8WA 2HHQA 5JJBA 1RBTA 3O9QA 1KRPA 2XYPB 2HAFA 1MWQA 1TKXA 5DDRC 4CEQA 3THXA 2HS3A 1I5OB 5BPMA 2WRMA 3MR3A 3CMAN 2XLJA 3JSBA 4M3ZA 3T3FA 2AF6A 4Y0FA 4J9OA 2RU9A 4HH1A 3ENAA 2UUCF 2BA9A 1L5UA 3KKSA 1HWKA 2FVCA 3B8AX 4RW8B 3MMCB 4PXDA 3ZTOA 3G6ES 4B3SJ 2QYGA 3H5SA 5IWAF 2HRYA 2O4IA 1ZPVA 4BS2A 3ZXWA 4C7QA 1LAVA 2O5DA 1GH8A 4DV5K 2CRLA 1D8YA 3MDQA 3M6VA 1FVQA 4E3SA 4H5RA 1S48A 4NLTA 4LQ3A 3DU5A 1FJGK 2XNQA 2RHQB 3RMCA 4NXMK 4NXMJ 1B70B 3C7NB 3M5RA 1BI4A 3QWPA 1D9AA 1FK9B 2Z8QA 2D4WA 4ECWA 3GYNA 3GG0A 3HP6A 1I39A 5D78A 2C2RA 2Q1NA 2JLGA 2DR9A 5DZ7A 5K8MA 4FJLA 4FWOA 4CEFA 4CWBA 4MIBA 1H73A 1PC5A 4PG7A 1S6UA 1BQNB 2QX0A 4FF4A 4TNOA 3CQXA 3MURP 3VOVA 2ZH3A 3CCJS 3QNOA 5SUHA 4PL8A 3DHXA 3DM2A 4NASA 5C12A 2O67A 3ILOA 2YX6A 4WFNL 3RW6A 5EUHA 2OCEA 2UUCK 2UUCJ 1A6LA 3FQLA 3P83D 4ZCIA 1C0MA 4IRCA 1APSA 2LEAA 1LNQA 5IWAJ 5KGXA 2WCXA 4CJVA 1RZMA 3MX5A 2RMLA 4CH0S 3DLGA 4C97A 2DVIA 1WOPA 3WZ0A 1SKRA 1QTMA 3HI0A 4CDIA 2W8KA 4N41A 4BWMA 1C0TA 4OYPA 4WU3A 4DU7A 1NHKL 3TI0A 3QJLA 4H0VB 1AT1B 2AX0A 2V8PA 1HD0A 3I55N 3J7YP 1TAUA 3QNWB 3V2UC 1T6DA 4G1PA 3ZC4A 4NLDA 4YN3B 2J9EA 4NI2A 3ITHA 3WNEA 2IY5B 3H5YA 3QDKA 5IT0A 1RHJB 3ZCMA 3VGUA 5HMYA 4ZVQB 3KHGA 1S5JA 2FSKA 3TZYA 2JWNA 2GHWA 1FKAF 4U95A 3SIPB 4TQSA 4KKOB 1DAXA 4DR7F 5H9EK 4W5QA 4LSLB 2VQEJ 2VPYB 3Q89A 2ZJRQ 1NJIT 4BREA 5HSPA 2YPYA 3DLLQ 4OGEA 3GTYX 4N47A 2BV3A 1FRIA 2Q2RA 2GELA 2P5VA 4USKA 4CGIA 2LXIA 3PG9A 2R8JA 3HPHA 2JH3A 1EAYC 5IT9U 4D3HA 4PYDA 2DH9A 4M7XA 2A3ZA 3QIOA 1JK9B 4X4VA 4ELVA 4O44B 5DM7L 2UUBJ 3PV8A 4IOAL 5AJ3F 3OR2A 4FWPA 1RE1B 3NAEA 2RAQA 4FCYA 2L48A 2ZOMA 4J9MA 8RUCA 6AT1B 4WCEQ 3FZLA 2R8HA 3R7NB 4FK0A 4WYBA 4RW7B 4DL4A 3QSYB 2F9DA 5ETRA 3DLKA 3HD2A 1H74A 2HS0A 3V9WA 1N36F 4WXWA 1R59O 3BSNA 3HFZB 1RWWB 3N4WA 1FRXA 4FNHA 3OLAA 2HFOA 1RT5A 2JC1A 2MLZA 3DGVA 4JNEA 3F41A 2E4LA 3C3LA 4Q0BB 3SJJA 2J0XA 3CM6A 4DR7K 4DR7J 4H0PA 3AJDA 1HLUA 4R8UB 2HK2A 3RB6A 3ULDA 2AGPA 2AZ3A 4FJ7A 2AZ1A 4CTAB 2R7UA 3DRRA 3ET6A 3BDEA 5KFIA 1BA1A 3F9KA 4E1JA 2AYGA 1HUXA 3OVSA 4JKBA 5K20B 4TU9A 2OIHA 2QL9B 1VRQC 1H3DA 4IOXA 1FWKA 1U48A 4RW8A 1RP5A 1NG9A 4PPZA 4JKDA 3U9DA 3JAMU 4C23A 1SIZA 5AQPA 1VQNS 1JQGA 3WC0A 4IQMA 3HJVA 3I31A 1IQTA 3NMRA 4Z4EA 4CNZA 5AJ3K 4JI5F 5HQ8A 4BGBA 2P9PB 3ONQA 3AVMA 2JEFA 4KH4A 4FYVB 3UKRA 4ZVEA 4N76A 4M45A 4WQ5A 3MEKA 4CJKA 1WUAA 3U1MA 1BC6A 2XNRA 4QIFA 3THTA 3P1GA 2W42A 2E2QA 2LXFA 4C8YA 3LZIA 2RIJA 5CZVA 3O9SA 4K43A 1N36J 2Q66A 3CCQN 3B82A 2QC3A 4ZTJA 3BQ2A 3C0BA 4TLRA 1VBZA 1H1VA 4KHNA 3OS2A 3AARA 4ED6A 4JYAF 1R43A 5KFGA 2AJ1A 1BQNA 1RFQA 1Y64A 1SB6A 1HNVA 1ZYQA 3FEXB 3CB4A 2V68A 4FNIA 4I67A 5JUMA 3MD1A 1YBAA 4USWA 3O1WA 1BE4A 1RT4B 1S12A 5AQMA 2IVOA 4NLBA 1AYEA 1L3KA 1UJ5A 3EUNA 3QIPB 5E84A 4C8OA 2AJQA 2HEKA 4Z4IA 1J54A 3ZSZA 2CJQA 5LOQA 4BQLA 2PYLA 5A2QY 2ADCA 2QGFB 3L2RA 3E66A 3EDQB 1L3VA 2XZTB 1DQ9A 3IXQA 4JI5K 1CULB 2KYXA 2MB0B 2FHJD 3M6UA 4FYDA 1RAGB 3KMSA 1SJRA 4LVOP 4ZPWR 2YQ1A 3TUIC 2QWOA 4CFDA 3IUCA 1FERA 4E1NA 2KVQE 2KZMA 1VMBA 4RJVA 4CO4A 4M3UA 1MNEA 3QGIA 3FFKB 4KGXB 4DX7A 3P5TL 1U49A 3SQ1A 4J91A 1C0UA 1UEKA 4HLBA 2RRBA 1N4LA 3FUYA 3SSQA 3GU0A 5FJ4A 4JYAK 4JYAJ 1G1XA 2LQ9A 4KKOA 3DWLA 2W25A 1ELOA 2OPRB 1MDUB 2QFIA 3ETOA 4MYUA 3AVNA 3H42A 4AT1B 3PIPQ 2GX8A 2HG4A 1DTTA 3PHEA 1GMUA 5JVHL 5FRNA 4W5NA 2HGMA 1RT7B 3ZSVA 2H65B 4W98A 1N0UA 1PKUA 3KHLA 4C1NI 1IV0A 4DF8A 3IP0A 5D4NA 3PX4A 3MFHA 1S72S 3J81O 4O44A 1ZBFA 2MLXA 4ZVUB 1VQOS 4RBTA 4U7CA 4H03B 4PQAA 2GWJA 3GFYA 4QJVA 5K14B 2MQLA 2XMKA 2UVWA 3TAGA 1KQGB 3FZKA 3HULA 1U2FA 2F9WA 3M2RA 2CPXA 4F8RA 4KHSA 1JLFB 2DYAA 4FM2A 4BRMA 1JKHB 2CQ0A 4USIA 2DRBA 2D69A 3NF6A 4YOYA 3MGJA 3MK6A 1X9JA 2CGJA 5LJVA 3MUVP 1RA7A 4FM1A 5IOLA 3BPSP 4WZQA 2ZUAA 4ID5B 2HWIA 3QO9B 4DR6J 3OQ2A 2ASLA 4DBQA 1OH7A 3GBTA 5ELZA 3RRGA 2BJ9A 1M90T 3NMUA 1WAFA 1GK8A 5C25A 3QGHA 3K8VA 4RW6B 1G4CA 4NYPA 4WFBL 2R7XA 3PYFA 3EVOA 2V52B 1HLWA 4OVLA 1Y4ZB 4YS2A 4DXLA 4CEOA 3WT0A 1VOMA 3LDOA 4YOXA 3MAAA 1Q9XA 2P9LA 5AE2A 4MYTA 5IS2A 3CJAA 1AA1B 4X64F 2VQFF 1SL0A 4DN0A 4NLGA 2CZ9A 3ZSRA 4ZVOB 3EXYA 4NCGB 4YUDA 3FCWA 3THPA 5T7BA 1S59A 1W2IA 3AXKA 4OJ1A 3CD6N 3GLJA 3KK3B 4YDUC 1VHXA 3KYLA 3Q8SB 5AE3A 3L8BA 5J2QB 4FS2A 1J53A 1U0SA 1V4SA 1RJJA 2YX4A 3M05A 3A8EA 1RKIA 1UPMB 1KXPA 4KH0B 3EICA 2YWHA 1WHWA 2HF4A 3AVCA 3C8YA 3UKUB 1RWXB 1OSDA 1B9DA 1BOTO 5F2RA 4IH6A 3CHWA 4LH5A 4DQRA 2ZUGA 3KJFB 1WWHA 1ZBIA 5L39A 2LQJA 3MOZA 1T02A 4J9VA 2RQKA 3MMBB 2XSFA 3BR8A 1W7WA 1NDLA 2BUPA 4X4TA 1Q9YA 5HI7A 1OQ6A 2MZTA 2FLPA 2VD3A 3DNCA 1U8SA 3CJ3A 2MZ1A 1NDKA 3NNAA 4CE9A 3VGMA 2DGUA 1GLLO 2CNNB 3PHTA 4X64K 4X64J 2CKWA 4B1YB 2VQFJ 1HHTP 1HWLA 3IG1A 4KTWA 1LFPA 3QSIA 3KWIA 1YVFA 2R9LA 1B7YB 4LF5F 1YSJA 4IOCL 1MWMA 4Y1DA 4LRDA 1PAEX 4P9SA 3OYHA 4O0IA 1NGBA 5J1PA 4CK3A 1QE1A 3PW4A 1PGZA 3CJQA 5HATA 3VQ7A 3VQSA 2HPUA 3R1XA 3QZ7A 4IO8A 2GGPB 1GT8A 1OQ3A 2ZD1B 3LWLA 2HB5A 3OVNA 3JS6A 2VA2A 1CLQA 4NPOA 2C2ZB 2F3JA 5AT1B 4CNYA 4MKAA 4NOHA 2XC9A 1W26A 4YHHF 1JLAA 2JFDA 2R2UA 1IKWB 2WVCA 2E9RX 2APOA 1FRMA 1NOYA 1RWOB 4N77A 2FVPA 1RCXB 2DR7A 4M3RA 3Q8UA 5DQIA 3LAMA 1S6OA 5AQGA 3MWBA 3QEPA 3CIMA 3QWUA 4RW4B 5AXNA 2XWYA 3V4MA 4E89A 3A5MC 1RHRB 2W40A 3HP9A 3EGVA 3IR7B 4K8RA 3MF5A 5AQQA 4YFUA 3T5LA 4LBHA 3IR5B 1IWAA 1SV5B 2HYIB 1RAOA 3LPEA 2AA4A 1FNXH 2BXJA 4A8QA 4ANDA 4OYAA 4KI4A 3P6YC 1SH0A 4CF8A 4DMNA 4LF5K 4LF5J 4PG5A 1DFDA 2LQ5A 1Q86O 4JV5F 4NMXA 1WNEA 1YQHA 1KOHA 1N5YA 2YHBA 3PTWA 2FZCB 4P72A 3CFPA 2E1AA 2NCKL 2HURA 3LH2S 4Q8FA 4ID8A 2WOMA 1TELA 2C2EA 3Q2TC 3CCQS 1I94F 1SKUB 4HEA9 1QQNA 3NE6A 4A61A 2XSJB 2Y0SD 4FF2A 2G9OA 4DU3A 4YY3J 2G2OA 4PXCA 2ZHAA 4ALZA 3H25A 5ADZA 1N88A 1ZTTA 4QS7A 1AROP 2ZHBA 4BC9A 2IVMA 4LUBA 2HFSA 5BPNA 4ILGB 2HIYA 2FC9A 4YHHK 3MCOA 4JN4A 1C1CA 1YRUA 5EWGA 3EXCX 4L74A 2M7SA 4OHXA 1OPIA 5IQ6A 3N0VA 4NA1A 2K1RA 3A3PB 3TTFA 3FLCO 2KO1A 1NK7A 2DNOA 1YJNN 4E7IA 2EWSA 4WF9L 5J1NA 1EKEA 3RR7A 2CNLB 1RUSA 4Z0UA 1NBWA 4KRFA 3DN9A 3VEWA 2J8AA 3L2WA 3BS9A 5J2NB 4FJMA 3OXLA 1VQ9S 3VQ5A 3AHPA 2PI5A 2RE1A 2P9SB 3MXJA 2YNFA 3NP5A 4OLOA 3GOIA 2WB4A 4JV5K 4RNMA 5AQKA 1KTQA 3DXKB 3CO9A 4NO7A 3G4SN 2H5IB 4QPXA 4DSJA 3OTDA 4MH8A 5J2QA 2GX9A 2WVDA 3ENWA 2IBKA 1I94K 4NLQA 1I94J 3T1YF 1JJ2M 2RDIA 3NH2A 2XULA 4LREA 3IDHA 1WUUA 5F1XA 1TKTA 1M5PC 2D0BA 3OUYB 4BRCA 5J2PA 5D4PA 3VQPA 1ZPWX 4RPFA 3M8RA 1NU0A 3OJUA 1NNEA 3HT0A 3AB2B 2FVRA 1S99A 1UAXA 3KD5E 2JVRA 3NRBA 3ZT0A 5L1KA 4CI6A 3ILJA 1S57A 2Y1LB 3H40A 2HQDA 3O3GA 1GQEA 2JEJA 3W62A 3MM8B 4Z94A 3I56N 1PIEA 1EP4A 3UVJA 3IAM9 3AVIA 3CT9A 4CGJA 3UW1A 5DS7A 4I1TA 3CC4N 1URRA 4NEYA 3PRDA 3KMQA 4KO0A 3R3LA 2ROPA 2BR0A 4TY8A 2QTDA 3J7ZO 2PFFB 1MU2B 4LH4A 4K4XA 2LA4A 4OMFG 1Q8KA 4O3RA 3AGKA 2F8HA 1S1WA 5ETNA 3ENQA 5M1OA 5GMKa 5KFXA 1BHNA 2R7YA 3GYGA 3E51A 3RB0A 4O8KA 1QY7A 2NRHA 3TR5A 5M1FA 3RZAA 3IMXA 4IO9L 1EWQA 3Q23A 3VGVA 1UPPA 2E29A 1K47A 2GGPA 1WTFA 3T1YK 2OTJN 2B4OA 1LAWA 1U1KA 4PCQA 2GAHC 2OSRA 2QTWA 4ETXA 1XR5A 3PJXA 1HWUA 4MFBB 2Q36A 3L95X 5KOXA 3NH0A 3AVLA 3MPUB 3NGSA 1NGGA 3B6PA 2U1AA 2RQMA 4F3TA 2EK6A 3MMVA 1Q0NA 1REVA 4YOTA 2L9NA 4FPIA 5E5NA 1HW8A 4MLHA 1EO1A 4BWJA 3BH7B 3NLCA 2CPHA 3W65A 3QATA 3ZZ0A 4GV3A 4CO5A 5KFOA 2JDJA 2ZWHA 5I3UA 4PR6A 4FJKA 4O3PA 4XPCA 2QI2A 1RCHA 5IC6B 4DR1J 2C2KB 2BYCA 2J8SA 4I2QB 4O3OA 3AA3A 4O55A 3L4QA 3HFKA 2R7OA 4JHDB 3CD6S 2VWKA 2NYHA 2ASJA 4M42A 1FO1A 4DV3K 3PEJA 5FD1A 4KHPF 3ZO7A 4WTYA 3GP9A 2WK4A 3W9IA 3NY0A 4CLPA 4M5MA 1TV6A 4IG3A 1LXNA 5HVHA 2XSJA 1LXJA 4NLRA 4DQSA 4YB5A 2ZGZA 4ZPBA 4CZKA 3OTCA 1JX4A 2BJDA 1KHWA 3QYYA 1XTZA 4ZVFA 1ZBSA 4RU2A 1CC8A 2GUIA 3P3DA 3HKWA 4WFAL 2DGQA 2ZKUA 2YKNA 2J7WA 4CJWA 4OZ1A 2EBGA 1G7CB 2QN6B 4XEIA 1S9FA 1FTRA 4DG1B 1S5ZA 1IBLF 2L41A 4F0KA 4KHRA 2Y1IA 2YI1A 1HW9A 3MM5B 4JKGA 4RX6A 4OKEA 3E01B 4LMZA 2AJ2A 4OYXA 3DRPB 4HTJA 3T5JA 1QAXA 3FRZA 2ZBIA 4U7UK 3AAWB 3MPDA 1RNHA 5KFMA 1R8BA 1H0HB 4QIEA 4ZIWA 2DY1A 5AZIB 3CDBA 3V6HA 3DXKA 2BQRA 2P6SA 4ZVGA 5HANA 3EZ5A 5A2QO 3H8YA 3NVKA 3E9OA 3VEYA 3IRXA 4KHPK 4KHPJ 1DQAA 1HARA 1NUEA 3OBYA 3CCRN 3R27A 3MCNA 1FRLA 4LC9B 3KZBA 3MMJA 3T1HF 1G2EA 1JJ4A 1BUPA 5C2FA 1BWVA 4EO8A 4KYZA 2VBYA 1AUSL 3V6KA 5KG6A 1S1XA 1CVJA 1RWPB 1T6CA 3DDKA 3CYMA 1BA0A 4A2BA 4OLBA 4BR7A 1VQPN 4O4GB 4X66F 2E1RA 5D3GA 1OY9A 5KPRA 1LW0B 4L8RB 2M0GB 4WKRA 4IFEA 2RD5C 3GV5B 3MECA 4EP4A 2H4WB 1FESA 2CPJA 1EXQA 4ZVHA 2OZSA 3F44A 1JCEA 2NSBA 3GFXA 2PBDA 1YTUA 3ZSYA 1BU6O 3OFHA 4DX8H 1IBLK 2MYFA 1IBLJ 1U1QA 1R0AB 2XHWA 4PQUB 1T03B 2VCPA 2V67A 3ZZYA 4CW7B 3ZEUB 1XHXA 4ED7A 5A8RA 2QWPA 4Q5VA 1WLJA 3IGNA 4FZYA 2HS4A 1VSJA 4CJEA 2CPEA 2XMWA 2CFXA 5AQFA 1W97L 3H7HB 4CZHA 1C1BB 4YOEA 3D9BA 1RWMB 3IN5A 3K5OA 4LJMA 3ENOA 3KFWX 2QMWA 1FJ7A 1R89A 5G4DA 3T1HK 1JLQB 4EU0A 3FVYA 1VQKN 4P2SA 3JQKA 4NCAA 4MFBA 3WC2A 1FDDA 2LFVA 2DNQA 2YWKA 4X4UA 2PA3A 3D6FB 3DOMB 3T7ZA 8ATCB 2IVNA 3RB3A 4X66K 4X66J 3DLHA 3QAUA 4HHHA 2YNHB 1S0OA 3IKMA 1TMMA 4KGZB 2KHCA 4ETZA 2VL1A 1M5KC 5T41A 4GKKF 4ECZA 1U47A 4M5IA 2NLWA 4I6AA 3NDKA 1RACB 3OVAA 1BCOA 3CJ7A 4BCAA 2QA4S 2HHWA 3WQTA 5A0YB 5MAOA 4IFVB 1MW7A 4UTGA 3DLEA 4X62J 3TJ8A 2V8GA 2Z2ZA 2BE9B 4I2QA 5LL6d 3SBGA 3L4BC 2X74A 4CLFA 5KG1A 2MQMA 4ZJQA 4IDKA 4CEEA 3US5A 4Y3CA 1KN6A 2CQ4A 4USUA 3PM9A 4CJRA 3AVBA 2PMZD 1RTHB 5CCMA 1CZ9A 4CJQA 2R8IA 1P27B 1QZ5A 1HNIB 1Q7YO 3LGMA 1LOTB 3ZYYX 2OANA 3BZQA 3R6MA 4BRDA 3VAIA 2O8FB 3LZJA 3W2VB 1VQLN 1HPMA 2CJAA 1VQ6S 5BR8F 2QXFA 1HR0F 2W9CB 3R8YA 2V2VA 5D0EA 4G1QB 4CIOA 1UAWA 1UVNA 3QZ8A 1K8KB 3MXMA 2R7SA 3AD7C 3KK1B 2GHPA 2MZRA 1IKYB 3DGPA 3V81B 3RUBL 1TU0B 2CPDA 2EFGA 1XNRK 3GG1A 3JXOA 3I56S 3L3VA 2FJVA 3D66A 4JUZA 3OYFA 3BKFA 4C0BA 4GKKK 1XC3A 3O8WA 3LALA 4NRUA 2KLAA 2C2DA 3GR0A 2YPZA 1HNXJ 3E01A 3L0QA 3TTDA 1N5TA 2ZH4A 3CC4S 4QU7A 3QFUA 1WF2A 2CG8A 1RBUA 3KLFA 2E2NA 1R8PA 2V8DA 4B3OB 2CQPA 2W24A 2QV6A 2WVBA 2R2TA 5GADI 5LMUF 3BN4A 5EX3A 2DT9A 2OEJA 1ASUA 2BE2A 5C24A 3HI9A 1NGEA 3R8EA 4BBYA 2RSQA 5EGYA 1B9FA 3DOKB 1NDPA 1N32F 1G6BA 3THYB 5L1LA 4QS8A 4RG8A 1QUPA 2DFFA 2WBMA 3IS9B 3P5JA 2WW8A 2ZITA 5BR8K 1HR0K 1HR0J 1YZ6A 3NCQA 2XYHB 4Y00A 2VOOA 2FF3B 1IWGA 4HTLA 3GJSB 2YX7A 2L3MA 4KE5A 1BG3A 3SCLE 1X4BA 1YJ9S 3KDOA 4BRGA 5FLXU 4O4GA 1D9DA 2MKCA 2JWKA 3DRSB 1HD1A 3OTEA 3MAHA 3KLIB 1FT8A 1U1NA 3K7RA 3C6AA 2IJNA 1XWLA 3HXMA 1X7VA 4TXSA 2DHAA 1NCLA 2QYCA 2B4UA 5KAKA 4AUKA 1YAGA 1Q53A 1FJEB 2W9BA 5HLFB 1VDHA 1WHYA 1Q5VA 4K8XA 4CZJA 1Z2ZA 4PQUA 5LSRA 1VSDA 3R5CA 4IDHA 1KS2A 2IM2A 4N7TA 2CH6A 1BIUA 4OPHA 1F2HA 2NZ4A 3I0SB 3UDLA 2F9JA 4FL9A 2UP1A 1WBDA 2EKYA 4CLWA 2KM8B 3CCLN 4CECA 2LMIA 2NRVA 4LF7K 2HBJA 3LP1A 1TUWA 4QIVA 3PXGa 2GQCA 2HHXA 5LMUK 3OBIA 4CJSA 1YXQA 4DV1F 1RDDA 2VG6A 4JI0J 1ULRA 4I6WA 2ATCB 3BSCA 2GA7A 4JV0A 3C2PA 4H0OA 3WHIA 2IMOA 3TA1A 1N32J 4BG8A 3KJVB 2KH9A 1JLEB 1WHXA 4JD2B 4WYWA 1HNZF 1HKBA 3TP2A 4Q2LA 2HBZB 3CMES 2JGUA 3NAHA 4FXVA 3EZWA 2OSQA 3R5DA 2YNHA 2XZDB 1VLYA 3TAMB 5DDOC 2HHVA 4ZP7A 1GNKA 2CWXA 2EI5A 4FYWB 2XHBA 4QR2A 4OZJA 1TUYA 2HHUA 2YWGA 4JI6F 1W9HA 2V4JB 4NZ0A 5E3PA 3ZLJA 1FX2A 1RDCA 1J9AA 3KTQA 1KP6A 4QZVB 4TYAA 2AGOA 1O0PA 4OYWA 4DV6F 3RAQA 4M3TA 4IFYA 5IV3A 3BBCA 4PL7A 3MDFA 3HKZD 1RLDA 2BE7D 2QEXN 3LAKA 4ZLJA 5G0RB 1MLAA 4F36A 4DL3A 3MEDB 2VPXB 4DV1K 3M32B 4DV1J 2AP6A 1VC0A 4RUAA 4UY8O 1KNZA 5KPTA 4LR9A 1FXXA 1RTHA 3PKYA 2JLEA 4HR2A 3FSYA 3WNGA 3BKUA 1UJ6A 1O13A 3OYLA 4ITSA 2B0GA 2EG2A 2QLWA 3FK4A 4NYFA 4KC5A 1FD2A 5J1EB 3F2KA 3W2VA 5JVGL 4Y0WA 2EHGA 3JQJA 3OTOF 4KBOA 1HNZK 1HNZJ 1QVFM 4ED2A 4A2AA 3N6LA 2LDIA 3ZT1A 1G3OA 2FSNA 3VA3A 3TARA 2NXEA 1KONA 1H2TZ 1FTCA 2NSCA 3O5BA 5KFFA 4HACA 5A6WA 4FKXA 4H4MA 4K0KK 4CO2A 2LU2A 5AQZA 5M2UA 1U0HB 2D7SA 3SPZA 5HAOA 3DLJA 2VGNA 1HQ2A 2CYYA 1LWEB 3SCXA 4JI6K 4JI6J 3AJ1A 4PY5A 3TQ1A 3KKRA 2O8CB 3G2XA 2W2MP 3SBMA 2V2KA 4DV6K 3U9ZA 4N5SA 4DV6J 1NLKL 2HBKA 2FB0A 2UV8A 5L1JA 4B3OA 1CQMA 3K5LA 4W5TA 5FDLB 3KNAA 1VK0A 3KOAA 1S6QB 2D3O1 4BRKA 2DGSA 2DHHA 2I2YA 3N4QA 3TEGA 2KJWA 2YKPA 4DTOA 5F0XA 3HPGA 1PBAA 4DL2A 2H3EB 2MY7A 4C3MA 2LSNA 3DFEA 4ED1A 4FLZA 1WORA 2GVDA 1F6TA 3UPFA 4FPAA 2C28A 1SJ4P 4H4OA 2RPIA 3WX8A 4CJTA 2FLLA 2I7PA 3OTOK 4KGMA 1VCTA 3OTOJ 2BVZA 1XR6A 2CDRB 3O4QA 2KHOA 3DU6A 3W64A 2X1BA 4ZITA 4E8UA 5HL7L 2O8DB 1HYVA 2DGOA 3VPZA 1ACMB 1N0VC 2L08A 3M2UB 3KLIA 4DHVA 1GXTA 3A12A 5BXIA 3W5YA 1IBCB 1T44A 2WW4A 3W66A 3A1YG 2GW8A 4HH0A 4B3TF 2AW0A 2OUGA 2C3OA 2B9YA 1TKZB 3OL7A 4AM6A 2XGQA 2IFXA 3VGSA 4M5HA 3Q8PB 3L09A 1TL4A 4EI2A 2V5HG 3V6DB 2ZDPA 4FSVA 4DX6A 2V6AA 4I56A 3QFHA 2C2MB 4ISGA 2O8EA 3GG4A 2FPHX 3R2CJ 2CAJA 3D6HB 4KH1B 1IM4A 3W5ZA 1MMDA 2XBPA 3U3GA 1JJHA 2VG7A 1RDBA 4AH9A 3VF2A 1X8DA 1Y5LB 4O3QA 3NBPB 4IEIA 4DB3A 4CF9A 2HZVA 3M4XA 1KTVA 4B3MF 4DTXA 1SS6A 3AV9A 2ITGA 1JLGA 1RT1A 4M5KA 3HJFA 3T5KA 3KJVA 2AGQA 1BUXA 3ZZOA 2QA2A 3HHKA 3PJWA 3CC2N 1TZ0A 3AGRA 4PAAA 3BREA 5F3ZA 4TU8A 3RGIA 4GO5X 2PT0A 4OL8A 2VZ9A 1PYTA 4DR5J 4CZIA 3CXCR 5GIPA 1VK8A 2B9XA 4TVAB 4CZLA 3FFIB 5KPZA 3GONA 3I9V9 1Z26A 5F8HA 5CYMA 1NBEB 1YI2N 2YKMA 2FGOA 2DNYA 2DNPA 5ETOA 4B3TK 4B3TJ 3AAQA 4CZFA 2QWNA 2ALZA 2VKRA 2NQPA 4H5WA 4IOBA 3U3YA 3C95A 3MM7A 2WZ1A 2IM0A 1BL3A 3M30B 4WIQA 4Z2XA 1K8AO 2IDLA 1BIZA 1GLDG 5G0RA 1X3NA 1ESVA 3PUFA 3D2EB 3GDQA 3LDNA 3UQSA 3M32A 3MR6A 1DEJA 2QWRA 3N6NA 4B3MK 4B3MJ 2F63A 2V8HA 1KFDA 2PI4A 2M70A 2OD6A 4BVOA 1XMOF 1GLFO 3LP0B 2ZNYA 4J2BA 4LF1A 4KBIA 5L1IA 5KT5A 2Z57B 1HNWK 2QWQA 1LFWA 4GO7X 2NS1B 2GJIA 4JI2J 3VN5A 2MKHA 1YJ7A 2MJNA 2Y1JA 5GAGI 2DFHA 1REGX 4DTSA 4ZPVR 3C16B 5BJRA 4KHWA 1LEOA 1Y11A 2YKAA 3ZZPA 2EVZA 2POKA 1W25A 3OVBA 3MEEB 2EXUA 4Q2MA 1IBKF 1YK9A 4C48A 1TKDA 3D1HA 4EO6A 3A3NB 4MQ3A 4ILMA 1WOOA 2ATLA 2CGKA 3K5MA 3H3NO 4A5AA 3ZX3A 3OSNA 2OPSA 1TFWA 3FCVA 4WFNQ 4DL5A 4H0YB 2L9DA 2UXDF 2W8LA 1YG0A 4MKBA 2FHMA 4HI2A 1BY9A 4FWRA 2GMJA 3POTA 4X4SA 3L7OA 3TU5A 1S6QA 4MMOA 2DD8S 3M2VB 2XO7A 2VBWA 2DCUB 1FRKA 2LVWA 1KC8O 1X4GA 1VIXA 4JLHA 4AM7A 4LRAA 4RL1A 1VIOA 2LA6A 1XMOK 1N8RO 1XMOJ 2IYIA 4F2RA 2FBYA 1FJCA 3S6EA 3VMFB 2P9GA 3E2EA 3HZEA 4P7TA 3GYXB 2QJ3A 3QT6A 1IN0A 2K2PA 3DLLL 3V1QA 3AA8A 3A5LC 2P9NB 2NUHA 3LANA 1C4AA 3CO0P 5KQ8A 3G25A 3WUHA 5IQQA 3T19A 5CZ2A 1MMLA 1WNSA 3I5BA 4DS4A 4DQQA 5KT2A 4OYOA 1VRTB 4KB7A 1E4FT 5DJBA 4DUTA 1IBKK 2M9KA 1IBKJ 2YJFA 1Y3KA 4FP9A 5EWFA 1TL7A 3PX0A 3G8SA 1T3OA 4H0TB 4IKFA 4UQTA 1TKZA 3SI6A 4NZ7A 4ZPCA 3AVKA 3N5BA 4TN2A 4PA1A 3V6DA 2UXDK 1JXLA 4E0DA 2ZFHA 3HHLB 1MG7A 3MCSA 3B4DA 4ELUA 4HCCA 3H59A 2DHXA 3WXJA 2D3ZA 2EFNA 4IRDA 3F9MA 5DM7Q 1TVRA 3CM5A 4I69A 4HDHA 1YIJS 2CQ3A 1W2BR 1EQMA 4R25A 2E7WA 3V9XA 3E3XA 5IM0B 3EPIA 1ZA2B 2WFBA 1ZETA 3I8BA 5MLCQ 1NJZA 2V2QA 1AFJA 4AHVA 3LO3A 3W8GA 1T9VA 1A9NB 1N33F 1TL3B 2KJVA 4FM0A 3NL0A 5GAEI 1BQMA 4NXNF 4PPDA 3SJHA 3QLHB 4ED5A 2IIRA 3C6TB 2KG0A 4IRKA 1H98A 3R5BA 5F0WA 2GIQA 3FFIA 4C11B 1KQSM 5KFNA 2N7CA 4ICLB 4BRPA 2QLXA 3M8PB 2GQQA 3VQEA 3OYKA 3HSJA 3ZSQA 4A8MP 2IA6A 1RT3B 1TK0A 4HCBA 4ER8A 1M1KT 3BGUA 2BRKA 1NSQA 5H1SV 3TQEA 1RBAA 2N3LA 2PMWA 4C1NK 2WSFC 1UEUA 6FD1A 5E3RA 3O44A 3IM9A 4N8NA 4USHA 5HRRA 2OGUA 1SQEA 2KZZA 4ANCA 1NGJA 1CPZA 3ZZRA 3MM6B 4OQJA 2JRSA 2RDJA 1YHQN 3B6OA 4KI6A 3BPDA 4QWAA 3FCHA 5F8JA 2EEYA 4AQYF 1VBYA 4IR1A 4B9QA 3LP0A 2B5JB 2HZCA 2HBRB 1S1TB 2QKBA 4USMA 3NS7B 1TK5A 1N33K 1N33J 1K9MO 4CLUA 2DTUA 1NK5A 3Q24A 4NXNK 1NH8A 4NXNJ 3H6EA 3OL8A 5GADU 2F4VF 2MKSA 4YDUA 5ETKA 3C16A 2U2FA 2HSTA 1UOCA 1SZ2A 3BEGB 2PEHA 4J9KA 5B09A 2CQ2A 3MPYA 3U7JA 1Q82T 3MEEA 1QD1A 2YV0X 3FBEA 3EMTA 1X5TA 3FZBA 1SQFA 1WI8A 1OMSA 3VGKA 1RTIA 3SUOA 3LM9A 3CF5Q 3U02A 3CTRA 1EQYA 1VQMS 2ZJPQ 1A7GE 1JNRB 1Q18A 2AQ4A 4JKFA 2F5GA 2QK9A 5K8PA 2AWZA 2LLZA 2A1SA 4N56A 5LXRA 1RTJA 1IBMF 3L9ZA 1U1OA 3MMAA 4DKWA 2FBTA 4ES1A 3CCZA 1FKOB 4DV7F 1MROA 4EYIB 3WIUA 1ITGA 2AJ0A 1B92A 5HJYA 3M3ZA 3M2VA 4WYLA 4OZ0A 1GX6A 4E7JA 4FS1A 2BH1A 4HHTA 2ROGA 2BRLA 2IYGA 4XK8C 3H0PA 1VQSA 3T41A 5KI6A 4GC7A 4AQYJ 1UFWA 4FYXB 1JJ2R 3CCJN 1VR6A 5AQLA 1IXKA 2FLOA 5KTQA 1OYDA 4ZP9A 3MEGA 4RNOA 2ACMA 4OX7A 3VZHA 2N3OA 3SV4A 3MX2A 3J80U 2F4VK 2F4VJ 1SXLA 1XQIA 1RYSA 4FK4A 3BY5A 2W2PP 3IMQJ 2IC3B 3GQCA 2I5JB 1LWCB 4DS5A 3CD0A 3TEHB 4L75A 4RCHA 4EWTA 1J5OA 5LJ5Y 4ECUA 2E88A 2XMAA 1YI2S 1OYEA 4JAXA 5KG4A 4OKKA 3W2WB 1BCMA 4YOUA 1TUVA 3OFFA 1T9XA 2HQIA 4P71A 3JSMB 3GIJA 3EDRB 4R79A 5BR9A 3W8PA 4GKJF 2KT2A 3UWTA 4DZ6A 3VTHA 3A8JA 2YNGA 2XB2D 2MKYA 4O5BA 4ANEA 1OPZA 3SMZA 2X1FA 1IBMK 1IBMJ 2OEMA 3R97A 1S9GB 2HLUA 2FXUA 4DV7K 3OY9A 4DV7J 3FDSA 2DR6A 4ECYA 1XNQF 4NMLA 2R4FA 1T05B 3K2YA 3BM7A 1AZSB 1S6PA 2F8SA 2ZBPA 4L3NA 5HP1B 2QFJA 1V9OA 2NRRA 5IM0A 3UN5A 5F9LA 4C8ZA 3SCKE 4LF6F 4PWWA 3A8IA 2XWXA 4DQPA 1E3MA 5I9EB 1TL3A 4OZNA 2QRRA 4E2FB 2A1RA 2PGCA 4JV1A 2VV5A 3MN5A 1QZ6A 3E1YA 1S1UB 2UV8G 4WPAA 4LFBF 3TZXA 3R7SB 2NUUG 4LFCF 4ZPTR 4AHSA 4L72B 3DMJB 5IZHA 2Z1JA 4LR7A 3QGGA 1M5OC 2Q31A 1HX1A 3SAHA 1JIHA 1UVJA 3P39A 2ZM6K 1CEZA 4ISFA 1F3FA 4ZLPA 4F3QA 2PEBA 4WFBQ 3R5GA 5JLHA 1EX8A 3IA0A 4H5NA 4H5TA 1PILA 4GKJK 4GKJJ 3TSUA 5DZ6A 1CXUA 3RAMA 3MWPA 5FPEA 1C1AA 2SXLA 4NB4A 1X4DA 5AQUA 2PDAA 5U47A 2ZBRA 3M8ZA 1HBOB 1XNQK 3MM6A 1XNQJ 1TR0A 2XS5A 3Q8VA 5GINA 1R6YA 1HQEB 2JNJA 3DXMB 4CZCA 1S3XA 1U6BA 1HI1A 3K5PA 1ZBLA 2N82B 1F0XA 4Y2AA 2AP1A 2G13A 1FKPB 4LF6K 5E0OA 2ZKTA 1FFWB 2BX6A 4NYZA 3K9KA 1OO0B 3MN6A 4ISEA 3MUTP 2FZGB 3G71N 5ETVA 2GJ2A 4RUBA 2VPZB 5AXLA 3I33A 3NS5A 3OYNA 2XG8A 1DARA 4LFBJ 3O1BA 3ENBA 3HM9A 4FXDA 5HRPA 4LFCK 1VQNN 2JLFA 1B99A 3HFVA 1R7IA 2Y8WA 5M1KA 5L46A 1U09A 1HMVB 1UW9A 4G65A 2VB6A 2V0NA 3JSRA 3J8AA 2DNZA 5BN8A 4HVJA 2G8VA 4WK3A 4MKVA 2B3TB 3JS9A 1HPZB 1CJVB 3D2FA 3OR1B 4DV2F 3IBCB 1FHTA 1X4HA 1WC3A 1HHQA 4HT7A 4CZMA 5LSOA 5D15A 5DLGA 5CY4A 1NGCA 3VAHA 1TTHB 3T1AA 2XEXA 2P9UB 3KUEA 3CJBA 1Q81O 3SFGA 5B8HA 4DI6A 4YB6A 4TY9A 3D68A 4FJ5A 1DLOB 2F8EX 2IA0A 1OH8A 5ETLA 2W6LA 4EP5A 3VWSA 3QEVA 3OA9A 2MEWA 5T7LB 3W1YC 2DXDA 2B6AA 3F73A 3AODA 2GS8A 1QTNB 1GOCA 4PYAA 1RTDA 4ES3A 3CG7A 2FF6A 4B9UA 2F96A 2OTLS 1IUJA 1RKJA 1B4SA 1VGYA 1NJYA 1Y10A 4I64A 3PZPA 4B3SF 1GLBG 4FN5A 3K59A 3DKDA 1QJHA 4CEBA 2QMUB 2FJXA 1X9WA 2UUTA 3PYEA 2VC0A 4WP8A 5CZ1A 2KN4A 5A8KA 1KD1O 4CYUB 4RTFD 3FZ2A 4ECSA 1W0HA 1SUQB 4K4SA 2KW4A 2GTDA 5HBMB 3SSSA 4DV2K 2W7OA 4DV2J 3MAQA 2B4PA 2FHKA 1YITS 4CGFA 4NRTA 3SCJE 2DNKA 4H4KC 3NWRA 2J7UA 3HVTB 3HO1A 2FY1A 3VEOA 1NGFA 1T05A 3TOQA 1VSFA 1YHQS 3CCUS 4B17A 1WSRA 5CA5A 3CPWR 3THVA 1OS5A 2G8FA 1BD6A 3HDSA 4DTNA 1R8CA 1X0FA 3BUZB 1S9EA 4IR9A 2DO0A 1T9YA 2EKNA 4U96A 1JWWA 2UXBF 5LJ3Y 1IKVA 4ZCKA 2IDOA 3OL6A 3SQGB 4HUFA 1D0EA 1P9QC 3SI8A 4IQXA 4FVUA 3C14B 3HK2A 3WNHA 3NGIA 4B3SK 1YBTA 4CP5A 4CVNE 4O4RA 3DRYA 1F5CA 3BJYA 1S72N 2XHCA 4QPTA 5KG2A 2OFGX 5B0CA 1YKWA 2KT3A 1VQON 4XDDA 4CGHA 4AHTA 3W60A 5C10A 4Q8EA 2A42A 4NYNA 2A5XA 4EUVA 4KR0B 3PKMA 3O3LA 4WF9Q 1UVKA 3D3CJ 3NF8A 2Z4PA 4DOZA 2A2DA 3VF6A 1HBOA 3DI6B 4BGAA 4DF4A 3SSRA 3TZZA 2HBLA 1YTYA 3Q7CA 1RI7A 1OY8A 1VJWA 3K0JA 2VQEF 3ISNC 3AA2A 5KFWA 2FQQB 5C15A 1RABB 2HNDB 1FKPA 3PEHA 4DPTA 1Y0HA 1D4XA 1K44A 4AILC 3PO4A 2P2CB 4BHQA 3CMQA 2XM3A 1S1VB 1DT9A 1XN9A 2NPFA 4K25A 5EVZA 2UXBK 2UXBJ 3B78A 4CLZA 3A4TA 2IMWP 2VHGA 3BH6B 5CABA 1NLVA 4QS9A 2N4DA 2MQ8A 4HL9A 4Y28C 2V9WA 4I7FA 2P9IB 4OI1A 3UI3A 1UA1A 3M8QA 1N48A 1YRTA 5IWAK 1RYRA 4BR2A 4M3YA 3DC2A 2BMBA 2DEJA 2VFTA 2O8BB 1M5SA 2OHDA 2HHHF 2UUBF 4RWXA 3O80A 4DR2F 4GVBB 4CO3A 2IRXA 5EY4A 3E9PA 3CI5A 1JJCB 1HMVA 5K8OA 2YNIB 3G87A 3H45C 3N9UC 1ZC6A 1K9MT 1RCOB 2D1CA 4F0MA 5IT9Y 1U2RA 4Z4HA 2EBEA 4I9LA 1CJVA 4Y2KA 2E9ZA 5BYSA 4IXCA 4CHQA 1XJWB 3BQ0A 4LF9F 2RQCA 2NRZA 2RF2B 2BEFA 1SQGA 1UP1A 4EBDA 1FDBA 3TSPA 2BTFA 2J5AA 5CZXA 3BBBA 3AA5X 3C15B 4GVMA 4V1Ak 5LJWA 4KB0A 2VQEK 1ZAVA 2YWEA 2PA8D 1C0FA 2HVEA 4I2PB 2HNYA 4BVPA 2RS8A 2KM8C 2MQNA 3D1OA 3OXGA 1NO8A 4KIAA 3DCAA 3UE2A 3UR0A 2YHWA 4B9MA 4OHVA 1JLCB 3PCOB 4GRSA 1DTQA 1OSCA 1WSFA 2UXCF 5EX0A 1WSHA 3CJ4A 1NHVA 4JS4A 4M94A 3MTKA 4P7VA 4G9ZA 3LA0A 3BEXA 5C42B 5I3QA 1RWKB 4ECRA 3OYJA 3NOGA 4KFBA 4WE1A 1K1QA 2HHHK 3CW2C 2HHHJ 2UUBK 2AX1A 4DR2K 4DR2J 5GAHU 1ZZFA 4NE9C 3FGUA 5HRNA 2JVOA 2VG5A 2W1BA 4CBWA 4C6AA 4CYUA 3SMPA 3CNQP 3SDEA 4HVZA 3CJ2A 2A41A 5HBMA 1ZBTA 2CPZA 3JAMY 4KHUA 4P74A 2DNGA 1HQUB 1FI4A 5GAEU 4URGA 4LF9J 2ZNZA 2DR8A 3KLEB 1MA9B 4PKIA 4OFZA 3EE9A 4DEZA 4FJNA 2ZE2B 4KPYA 4DLGA 2BW2A 3OW2R 5AR0A 1E6VA 5RUBA 4U67Q 2Y1RI 4NA3A 5BN9A 3ZT4A 3FJ2A 5D0RA 4BC3A 1CS4B 5FPDA 1S76D 3WXLA 3RMDA 1DZ5A 1V4TA 1HKGA 1JXVA 1VHFA 3KWGA 2P9CA 4JKAA 1X4FA 1WC4A 2MGZB 2ZZTA 3AO1A 1BLUA 3R9LA 5BRHA 1DURA 1CG2A 4AXJA 1C4CA 1EX4A 2BQUA 3G71S 4CGDA 1FRJA 2UXCK 1QAJA 2UXCJ 3ZX0A 4C98A 4F0HA 2QA4G 4EZ9A 3C14A 1NDCA 3MMCA 1K73O 1Q8IA 1NU4A 2FVSA 5BREA 3V4IB 1TYQB 4DTPA 4KQZA 5KFBA 2MKIA 4YDXA 4CEZA 3RYLA 1EARA 1TK8A 2VU5A 2VONA 3GIIA 3JXUA 4CD3A 2KDOA 4TKTA 3JYTB 2Y0BB 3PO5A 2Q6CA 3NCRA 5KT6A 3ALYA 1CSJA 1NHUA 4XDCA 3MWTA 3C7NA 4QIWD 1PBUA 1FK9A 2I6WA 3TAPA 3SMSA 1N36K 2HNZB 2KFZA 2NR0A 4HHUA 4E1MA 1NB2A 2ZOGA 4K2XA 3CCSS 4XH1A 1WKJA 2DK2A 2PE8A 5KG5A 1DHMA 2R7VA 1RXOB 2R7WA 3PIOL 1UTAA 4F50A 1S77D 2HMPA 4DTRA 4CH7A 2V94A 2KFYA 1LK7A 1B0VA 2FJDB 3UD5A 1YDLA 1RDUA 1XHZA 2HMIB 2AHOB 1QVFR 1UA0A 2P9IA 3TZWA 3K17A 1HWJA 2HAIA 2UUWA 4OIXA 4CLYA 3WXKA 4KRWA 2AD9A 2GBZA 3QEWA 3DYAB 2BDPA 1ATRA 2CADA 3H4DA 5D8HB 3ZTSA 4L73A 1IH7A 2RN2A 3I96A 4NCBA 2YNIA 3KLVA 1VQ9N 5AQWA 4DFKA 4WFXA 4HHJA 3FNNA 1HKCA 5K5MA 3SAGA 4BRHA 3H2UB 1B3TA 4C3LA 4A47A 1BQXA 3B4MA 1SBRA 3ZX2A 4ECVA 1WOQA 4LSNB 3SYZA 2KL8A 1UVMA 2CVEA 5HMXA 1RADB 4CO0A 3A5OC 2RILA 1X4EA 2ILZA 2OA8A 2D9OA 5AQIA 4FJXA 1Z1ZA 2CH5A 5CHCB 5B0BA 4LSLA 2D0AA 4DR6F 2Q3PA 1EETB 4MIAA 1IJFB 3M6WA 4NLPA 4ILJA 3V9UA 5CR4A 3LWMA 5ADXH 1SPBP 1ZM4A 4NLVA 4OO1J 2E9TA 1NSAA 3CD5A 2AMCB 3MR2A 1DGKN 3J7Z5 3R1HA 1JLCA 1U1RA 3NWGA 3VQCA 2AJFE 3Q8RB 2MY8A 1F21A 2EW9A 1UFKA 2NYIA 2AYEA 3HF5A 4KV8B 5CXTA 3N01A 4PKDB 1X9MA 3OHBA 2G4BA 3RMBA 4B1UB 3KD1E 4OX8A 3OFGA 1Q78A 4JI8F 4IG0B 1SC4B 4TYBA 4EK2A 4FYYB 5GVQA 5TKYA 1LKZA 5AQSA 2UU9F 1RA6A 1VRUB 4RW7A 3IGVA 5F8GA 1KCFA 4U7BA 4H8KA 1QVGR 4EBCA 1QHTA 5A8WB 3OSPA 1G15A 3WX4A 5GADP 4RU9A 5A76A 3DAWA 4CFCA 3GSDA 3I0RB 1TQLA 5E41A 2HKEA 3H1QA 3Q8QB 4Q0BA 3OHRA 3PRBA 4OJRA 5FPMA 3P38A 4Z37A 1YRXA 3SQ0A 4K2JA 4R8UA 4AL6A 4DR6K 2ZHOA 2FSJA 3DOLB 2E8AA 5F0UA 4CTAA 4M3WA 2V9KA 3LPUA 4CBUA 4PG6A 1S7IA 4W4MA 4MIWA 3OD2A 3C6UB 3C6HA 3RB4A 2MZJA 4PUOB 1SJ3P 3KJNB 4CHOA 2CJXB 4QAGA 3V4IA 4P52A 4MLEA 3IC1A 1DKGD 4C0HA 4JKEA 1T11A 2YHAA 3FEYB 3JTNA 2J9DA 4W90B 2IBOA 3I4HX 2W2NP 4JV2A 1O6XA 2ASOA 1P8ZA 2P9PA 2BJ1A 5IT4A 4GV6A 4JI8K 2MDAA 1JL1A 4JI8J 2UZAA 1RLCL 2WTFA 2JEIA 1LW2B 3AQPA 2UU9K 2UU9J 2J0QD 1EKSA 1NPKA 4C8LA 3VA0A 4BE2A 2ZWOA 1RHUB 1RAEB 3NXZA 2CQGA 4YNQA 2HNZA 4NL5A 1U1LA 5F3TA 3I32A 3UD4P 4YB7A 2FDNA 4HKQA 3O6QA 2EWHA 2RB7A 4OZ5A 5KFLA 4QW8A 5KQDA 3OT9A 2B4JA 3ULEB 1YF5L 1PO6A 3H3OB 2DHGA 1YT3A 1RT4A 2K8GA 1Y5IB 3KHHA 4BC5A 4Y2MA 1WG5A 4G3IA 4C4WA 4UZCA 3BGRB 3QIPA 3GIMA 3GZ7A 2OI2A 1V5IB 4FLYA 4QWBA 1RGIA 3RWUA 2KFNA 4MTPA 3AO4A 2E5HA 3IWXA 4DTJA 3AA4A 4IJAA 2VQFK 2CQHA 2QIFA 2DGXA 3MZIA 1O8BA 4GVLA 4MDAA 5C5JA 2ILYA 1CULA 4PWDB 2C1EB 2ZH8A 3NGYA 4ZKAA 1AXQA 1HYSB 3TR8A 3CVKA 1NAQA 3VVUA 2PMHA 1RISA 4NLUA 3NNCA 3VGLA 1GTEA 3G9CA 1D9FA 1XBWA 3M1FA 3A3OB 3GB0A 1FWPA 5AQVA 1P90A 5J2MB 4YY3F 3BF3A 3CC7N 1N5QA 4J9NA 1IG8A 1VSMA 4PRFA 5SWMA 3QRPA 5I42B 3EKUA 4M5NA 4WQ4C 3CDUA 2OPRA 3GIKA 2JWLA 3HHLC 5B0GA 2QA1A 2GO8A 4Q44A 3VERA 2NRWA 1RT7A 4DSKA 2PYJA 4OHYA 4RUCA 1HJRA 1IM6A 5CYJA 2NXUA 3PY8A 1Z05A 2FC8A 5LSLA 2D9PA 2QWLA 2A0FB 3VAFA 4CM2A 2N7YA 2UVUA 4BRFA 2FUG9 4MKYA 5EHHA 3Q86A 2DPJA 4GV9A 4IG0A 4USTA 3V9SA 5IV4A 3CSKA 1L3SA 1HYZA 4Y2CA 1A5VA 5K14A 1GFWB 2R2SA 3HCXA 1NM2A 4XPEA 4ZLLA 5KFTA 3SZ2A 4AL5A 4Z4GA 4QR1A 2XY7A 3LPYA 3LQVA 2W2OP 2EFVA 4KHQA 4MAKA 5AQXA 2YQ0A 4BRQA 4FOIA 3M7VA 3RBEA 1JLFA 2IRUA 2GQ2A 4WXOA 3ISND 3NGDA 1JKHA 4K42A 4WU2A 4J2DA 3U1LA 4YY3K 2IIHA 3VAMA 1BISA 2E44A 4MO5A 2CJBA 2WVFA 2CGLA 2OEKA 4ID5A 1S0MA 3QO9A 1UKUA 4J8FA 3DOLA 1BI4B 3LP2B 3D5MA 4JBCA 1UWAA 4ZN1A 3QINA 3BO3A 1T7PA 2G1HA 4RW6A 2VASA 3J81U 1ZZNA 2J0SD 2B4VA 1BHLA 3IWLA 2A2CA 2CJ9A 3FBCA 3QAEA 4O8UA 3TA0A 5JVGQ 2XY6A 2QA4N 1KSPA 1VSLA 1NZ8A 3AY0A 3KIOA 2RKIB 3D6TB 2A18A 3G0ZA 3PVXA 4OPJA 2GNKA 3R5AA 3CCEN 3QJJA 3W0LA 1RBOB 3DM2B 4NCGA 2I8EA 1KQSR 2ZZNA 5EOYA 5KFHA 3FMBA 2VIHA 4FW2A 3AOBA 1VQ7S 2G8KA 4UOCA 2JSXA 2P5GA 1NWKA 3N4PA 3D7EO 1KBRA 1FWLA 3KK3A 3CCMS 4PKHA 1PCAA 5HOOA 5DMRA 3NKYA 3RVCA 1XUPO 5CAAA 2VA3A 2DGWA 2Q1LA 3CCTA 2HGNA 2OP5A 3CJKB 3DLGB 1SKWA 5IT9O 2XTJP 4DFJA 3UKUA 4DV0F 3EX7B 2RDDA 1VQ6N 4QYZK 4QYZJ 3EZUA 3O08A 2PFUA 1R6VA 3MMBA 2QL7B 4FLVA 2V2ZA 5I4MA 4FO0A 2OPPB 3ITHB 1AFIA 3ADAC 2V50A 4O0NA 3AVHA 1UVIA 5TKWA 1YBUA 1SIWB 3BGRA 3GV8B 2JZ5A 2UYTA 1VC6A 1U2CA 3CCVS 2CVIA 3D0GE 4A8FA 1R3NA 2M52A 2OO4A 2QLFB 2YX1A 3PRVA 4DR1F 1YUWA 5ETMA 4WJBA 3OJSA 3RTVA 2H4YB 3H08A 3PJ9A 4PWDA 4OZ3A 1YLXA 3QBXA 3EE8A 5CD4H 1KLNA 3D1QA 3SQ2A 1P1TA 4FLUA 1RAHB 4F4AA 3ELHA 4AHRA 3VQ9A 4TQRA 4GNIA 3BO4A 1VQ4S 3HYFA 3PFEA 1PSDA 4CGGA 4FF3A 3QT8A 1NK6A 1U26A 2FZKB 5H9FK 4LT6A 3OR2B 5H9FJ 1VBKA 4DFMA 3AO2A 2ZD1A 4TLQA 4DV5F 1U1MA 4EFHA 3NOCA 3JTPA 1RDWX 3U1NA 3TVKA 2R7RA 2ASPA 1VI7A 4DV0K 3JTOA 4DV0J 3JAMO 4Z7YA 5HQMA 3ASMA 4LF4F 2K7KA 3NCIA 1Z25A 1IKWA 4OPKA 1YJ9N 3MCMA 1T95A 3G82B 1M90O 3HSCA 3MPVA 2G8UA 1S4EA 1T8EA 1Y7PA 5HO4A 3K0SA 3SXLA 5ETSA 4M5GA 2B51A 1RT5B 4CLKA 4RW4A 3TJ9A 4X2BA 2BJ8A 4XO0A 4B3RF 3OV7A 4UOHA 5GAGP 2M2BA 1SV5A 4DR1K 2Z1HA 1NKBA 2NRXA 4QR0A 3DRRB 3ET6B 1F60B 2BACA 1U6ZA 3CJSA 3VVTA 1UETA 3BSAA 4H0XB 2VBZA 1J2VA 3KXDA 3LGNA 4OI0A 5LL6Z 3BV8A 1O1WA 4F02A 4KGVB 3Q0AA 2AEJA 3ZNUA 3BN7A 3G86A 3VAKA 2PZSA 2W4PA 3LGHA 4B02A 4DHYA 1WB9A 3TW0A 4JK8A 3ZT2A 2DITA 1GAOA 3S7RA 1EIYB 4DV5J 4F4WA 2JHEA 3UKRB 1FE0A 3QMQA 1VISA 2QMXA 1Q95G 4K7QA 2GMLA 4DDFA 3IRWP 2XYGB 2VJUA 1FJGJ 2ZF5O 2DJWA 4YEAA 4LF4K 3I9ZA 4LF4J 2DXEA 3CMEN 4U8VA 3CETA 3LP2A 4EGLA 4OYZA 4K4ZA 3A5NC 4BC4A 2YXLA 1NGHA 3D28A 1KDNA 5IFMA 4XAKA 1TUUA 4EFAC 4XTTA 1WSGA 4K8ZA 5IC4B 1TP7A 3L7UA 3S1TA 1YVUA 1QHAA 4F4ZA 3OLBA 2W41A 3MXHP 2LCWA 3SV3A 3RR8A 3HZ6A 4B3RK 4B3RJ 2D41A 3KJQB 1HNVB 2OLWA 2KG1A 2RKIA 5JMNA 2VJVA 3TAFA 1RBVA 4BR4A 5J2NA 4UY85 4A4JA 1NKCA 4LR8A 4YP3A 1VFJA 1VQ5N 1IR1A 2MQPA 2P9SA 3SQ4A 4OX6A