3KLFA

Crystal structure of wild-type hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 139
structure length 553
sequence length 553
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klfA05
5KFOA 3O4NA 4ECRA 1RTJA 1N56A 4F2RA 4WFXA 2RPIA 3PX0A 3OL8A 4FJJA 4F3TA 1RT4A 4FZXC 4O44A 4J9RA 4NCGB 3V1QA 3BQ0A 1WNSA 2ZKUA 4DLEA 1TL3A 4J9OA 1A5XA 1JLBA 4U6PA 2ZE2B 4XPEA 3FFIA 2HHSA 4DFKA 3P5JA 5HRSA 4IDKA 4KHUA 1C0TA 1EP4A 4K4YA 4OKEA 4FLXA 5F9NA 5KG3A 4KSEB 3H59A 1C2PA 3CM5A 4R5PB 4J2BA 2Q3SA 4FVMA 4CGDA 1RTIA 4F4WA 1S9GA 3CDWA 4TXSA 4B9UA 5DLFA 2UUTA 1RBSA 1G15A 2OH2A 1WNEA 3ZSXA 3M8QB 3K5NA 3BREA 3NH0A 5T7BA 2QK9A 2FLNA 3OL7A 4FW2A 5EWGA 4ED8A 3TI0A 4DQPA 5DK5A 3ZSOA 5FROA 2HNYA 3DLHA 4FZZA 4GC6A 1XHZA 1TKXB 4NLYA 2E9RX 3KK1B 3SUNA 3RB0A 2FBTA 4QWDA 1J53A 2ETJA 3AO2A 4NLWA 2QXFA 3MFIA 2ATQA 2BDPA 3OYFA 2G8FA 5KFKA 3C94A 3K58A 4ED7A 3PW2A 3V9SA 3RMAA 2Y1JA 2YNIB 4Y3CA 3RAQA 3QGGA 3OLBA 3KK3A 2AQ4A 1CXQA 4E7HA 4I9QA 4IG0B 4FJ8A 4CEFA 3DOKA 3GIJA 1KLNA 1QQCA 4EO6A 1F21A 3QIPB 4ECSA 3FQLA 2IDOA 2W9BA 2VA3A 4K4WA 3PW4A 4B3OB 1MU2B 1VRUA 1QE1A 4ZTFA 4Q43A 4I2PB 1LW0B 4JUZA 1BISA 3F73A 4DG1B 3PX6A 4J9KA 5F8MA 2V4QA 4K4SA 1SH2A 5KFCA 2DFFA 4BE2A 1S1UA 1S9EB 2XI3A 3KLVA 4RW6A 1HQUB 2OPRB 2OPPB 4JV0A 1IH7A 4BACA 3O3FA 1RT6B 4ID5A 4B08A 4LQ9A 3FRZA 5D3GB 3U3GA 2E9ZA 4ZHRA 2W7PA 3FQKA 5F8LA 4HUFA 1NJWA 2ILZA 4W5TA 3NBPB 3H08A 5E41A 3G10A 1NHUA 4GVMA 3GIMA 1VRTA 5KG0A 4W5RA 1QS4A 4IBNA 1IKXB 3NAEA 4E7LA 1JXBA 3AVHA 4OJRA 4KTWA 4RW8B 4CEZA 1YT3A 1C1CB 4IG3B 3V6DB 3V9XA 2AWZA 3S9HA 5DQHA 3PVXA 3HVTA 1HPZA 3OSPA 3ZSRA 2YNHA 1TAQA 1QSYA 1LAWA 4Z4GA 3MXMA 2QKBA 1FK9B 1I6JA 4FK4A 4DTPA 1FXXA 4CEEA 2RF2A 1D5AA 2KFZA 2QKKA 4NLGA 1TP7A 4M94A 4F3OA 4W5QA 3V6JA 2DFHA 3SI8A 3ZT0A 3MEEB 4QWEA 3DRRA 3QO9B 4NLDA 2XRIA 3CDEA 2D0CA 1R0AA 4BDZA 4EP5A 4QW9A 3LWMA 4YQWA 1SL2A 1BL3A 4KTZA 2HAIA 4ZPDA 4FM1A 2HHWA 1D1UA 4EBCA 5C42B 3LDSA 4JS4A 1KFDA 4CJRA 1BQNB 1S10A 4DL7A 4NCGA 4ZTJA 4MIBA 3SNNA 3RR8A 4Q5VA 4FJ9A 1KVBA 2WCXA 4KKOB 5SWMA 3KHRA 4YFUA 3TAQA 4J9QA 2PY5A 2ZE2A 4XO0A 2FBYA 3AO4A 2UUWA 4FBUA 4CHOA 2WONB 3THVA 1LV5A 4NLUA 5HRRA 1I39A 4R5PA 2FVRA 3OYMA 1ASUA 1SL1A 4DTJA 2XC9A 3OL9A 5KRTA 4J9MA 3M8QA 3IG1B 2HHUA 3TQ1A 1NOYA 4C8NA 3G6VA 3OYIA 3KLGB 3VQDA 4CJQA 3PV8A 4K4UA 1GX6A 1HNIB 2X74A 1CXUA 3V9ZA 1TKXA 3KK1A 2BQ3A 3EZ5A 1KVAA 4KHRA 4CEOA 1N6QB 3P1GA 4F4ZA 4EZ6A 3OSNA 3AVCA 4UQGA 5KI6A 3V9UA 1WSEA 4RNMA 4DQSA 1T3NA 3AA5X 2C2EA 1BCMA 4DSFA 3G0ZA 2YNIA 2ASLA 4N47A 3NL0A 3M8PB 5KFXA 5KT2A 1JX4A 4ELVA 3RB4A 2B43A 4IG0A 4MK9A 4FBTA 4LH4A 4CJSA 3OY9A 3PW7A 2UVUA 4CF9A 3OS0A 4FLWA 1UWBB 4IOBA 4EZ9A 4Y1CA 3QIPA 4HVJA 3AVNA 1B9FA 4R8UB 1W25A 2IM0A 4MQ3A 1L3UA 3DI6B 4B3OA 1MU2A 2QE5A 4Z4HA 4I2PA 1LW0A 4DSEA 1HNVB 4DG1A 4TQRA 1UA1A 3VQ9A 2RDJA 3OYKA 4B9VA 4O3NA 4URQU 1S9EA 3QEVA 1T7PA 5FRMA 1RT2B 3Q8PB 1HQUA 2D41A 2OPRA 4X2BA 3QEIA 3KIOA 2XGQA 1KSPA 1RT6A 3SV3A 1JXLA 3VN5A 3L2RA 4JV2A 3QEXA 5D3GA 4J9LA 2GIRA 3LP0B 2YKMB 4G1QB 3V81B 4O44B 4O3OA 2BR0A 1Z26A 2PYLA 3DYAB 3QZ8A 1IKXA 2GV9A 4TY9A 3LALA 4RW8A 1U4BA 3HKWA 1C1CA 4IG3A 3V6DA 1WSIA 1QSLA 3RAXA 3CJ3A 3MECB 1IKYB 2X6SA 4NCAA 4M42A 4RW9B 3BGRB 5L1LA 3M8SA 3HM9A 1S9FA 4IRDA 2WHOA 1FK9A 3QETA 4M3WA 4CK2A 2VG6B 2JGUA 4FW1A 3ZT4A 4K50A 4IRCA 5J1EB 4M3UA 3MEEA 2AGPA 3QO9A 4NLVA 3GV7B 2B6AB 4KHNA 3Q8RB 3OYAA 4B8CA 1S1TB 4CGFA 1X9SA 4DSLA 2XCPA 4CFAA 1ZBIA 4O3PA 3T5KA 1RTHA 4B8AB 3NGZA 3A2FA 3L8BA 1XR5A 5C42A 3QIDA 3HPHA 3NGYA 1BQNA 1L5UA 3TAPA 4W5NA 4AH9A 4FLVA 1W0HA 2E6LA 5FRNA 5KFUA 3UR0A 4ECQA 3SUQA 5KG2A 2DPIA 2R8IA 3VQ7A 4E0DA 4LSLA 3T5LA 3CVKA 3D45A 2WK4A 1YTAA 3SUOA 1QAIA 4CJWA 1ZBUA 3HPGA 2WONA 3OJSA 1S1VB 2O5DA 5KT4A 2CJQA 1K1SA 4J2AA 5KFTA 4M95A 3IG1A 3AO3A 3JYTB 3LPUA 1RTDB 1WLJA 4HUGA 3KLGA 2D7SA 3PW5A 4FYDA 4E7IA 4J9NA 1HNIA 3K5MA 5DMRA 1BQMB 4RZRA 1N6QA 3SI6A 2BRKA 4DTMA 3ASMA 4FJIA 4O55A 4ELTA 3IS9B 2XI2A 1U45A 5KFJA 3KLFB 2AU0A 3M8PA 1JLFB 2V9WA 4QWAA 3M9OB 3QLHA 1ZETA 1CZ9A 1T05B 1NOZA 1UWBA 3HVRA 3SV4A 4ELUA 1S97A 2YKNB 4R8UA 3V6HA 3DI6A 4CFCA 4IR1A 1HNVA 4M41A 1Q9XA 1RDBA 5DG7A 3WNEA 2D3ZA 5EWFA 3PJXA 4B9LA 1S1WB 1L3SA 3MEGB 3U3YA 4ECZA 3SQ2A 1RT2A 4J9SA 3BQ2A 4DWIA 4FZYA 4CESA 3OYNA 4K8XA 4Z4IA 1S5JA 3LP0A 2C2RA 3RWUA 2YKMA 3TAMB 3OYLA 3ITHB 4G1QA 3V81A 4WFZA 4EBDA 4OLBA 3NF8A 3ZSYA 1VSEA 5K14A 4ID1A 1BI4B 3I0RB 3UDLA 2IGIA 3DYAA 4RW7A 4PQUB 2J6SA 2PYJA 4NLTA 2ALZA 3UQSA 4ECVA 2O4IA 2FLLA 1S48A 4DS5A 5KFAA 3BSOA 4CF1A 1TQLA 4FLUA 1IKYA 3MECA 4RW9A 3BGRA 4DTNA 2W9AA 1GX5A 2BANB 3H40A 3CJ5A 5KTQA 4MH8A 3MF5A 5HBMB 4NLXA 4K4TA 3G6YA 2VG6A 2A1RA 2XY7A 3PJWA 1NK6A 4PY5A 5J1EA 1NK8A 2B6AA 3V4IB 3GIIA 2EX3A 1S1TA 1CSJA 5CZ1A 4DQIA 4KFBB 5F8GA 2HNZB 3CIZA 4CHNA 5DLGA 1WSFA 1X9WA 1LWFB 1VSMA 3KK2B 1UAXA 4W5OA 3HYFA 3LP2B 2XGPA 2DPJA 1J54A 3CJ2A 3OYEA 1EX4A 4WXWA 2D0BA 1L3VA 1X1PA 3L3VA 1LWEB 3G6XA 2IC3B 4H4MB 1WSHA 4CF2A 3H98A 4AHCA 1BGXT 3C6UB 5KFSA 5KFIA 4PA1A 4LQ3A 1ASWA 1RNHA 5HLFB 4EEYA 2KZZA 1S1VA 3HP9A 2G8UA 1ZTTA 4ICLB 1VSLA 2IM3A 3TARA 1NK9A 2KW4A 4IFVB 1LWCB 3NGIA 4EO8A 3OYJA 3QZ7A 5KGXA 4FJXA 3PR5B 1QSSA 4QWCA 2W42A 4M3YA 3JYTA 1RTDA 4BWJA 3DRSB 4K4XA 1TL1B 4FJHA 5L1IA 1NK0A 4DQQA 3AVFA 1BQMA 5F8JA 3CYMA 1LW2B 1XR7A 1XR6A 2VG5B 4QPXA 4NZ0A 5L1KA 3I5CA 2EHGA 3T5JA 1SKSA 3ZCMA 4XPCA 4IKAA 3CG7A 2IJNA 4I9LA 3IS9A 3TVKA 3DMJB 4EYIB 3KLFA 4AHVA 2NUBA 4Y2CA 4NLRA 1JLFA 1RDAA 3QEWA 4K4ZA 1T05A 1JXEA 3L2VA 2OYQA 1S6PB 5KFRA 1WSJA 3BR9A 2YKNA 2CKWA 4CEDA 3KTQA 2E4LA 5T14A 1XHXA 2D0AA 4KO0B 4HKQA 3TR8A 5SZTA 3S3NA 2HHTA 1CZBA 1S1WA 4H8KA 3IGNA 3MEGA 4N56A 2YHAA 1ZBLA 5EDWA 3PY8A 1U49A 3OL6A 3CJ0A 1BIUA 1REVB 5J2MB 4ZP7A 3DLRA 2F96A 1ITGA 2G8HA 1RT1B 1RTHB 4NYZA 3KHGA 1C1BB 3OJUA 1DLOB 3TAMA 3ITHA 2FVQA 4CHPA 4ZVEA 3MEDB 4CJKA 4DTUA 5HROB 3KKSA 3VQAA 4FJ5A 3S3MA 4CFDA 4ECXA 4IH7A 3K5OA 4RNNA 3I0RA 1BI4A 4HCCA 2FVPA 4CHQA 2I5JB 4PQUA 4CGGA 4LSLB 4M45A 4J2DA 4LD0A 4OPJA 2IJFA 4CGIA 3ZSWA 4CK3A 1IKWB 1EXQA 1TK0A 3RMCA 4KB0A 3NAIA 3BSAA 1O1WA 2BANA 4DQRA 3U6FA 2IAJB 3PX4A 3NE6A 5HBMA 3AO5A 4HCBA 4CJ4A 3NF6A 4O4GB 2HMIB 4M3XA 1KHWA 3JSMB 3V9WA 3OS2A 1W9HA 1Z4UA 3HHKA 3PR4A 1X9MA 4QOZB 3V4IA 4EP4A 2V4RA 1DTTB 4ZMMA 1RDDA 3SPZA 2F8SA 4KFBA 1HYZA 2HNZA 1RBTA 5KFEA 2JEIA 1LWFA 4ZP6A 4F50A 3KK2A 1S1XB 4WXOA 3OYDA 5F8NA 4CIGA 1WAFA 3LP2A 4N76A 3GQCA 4NYNA 2X6NA 4KAIA 4FK2A 3C95A 4KHWA 3QLHB 1Q8IA 1LWEA 4DTRA 1WN7A 3IRXB 2IC3A 4H4MA 3NAHA 4LY7A 4CEBA 1C1AA 2XO7A 2HHXA 1FKOB 1TK5A 1Z25A 5JS1A 3C6UA 4RUAA 1QUVA 2YNFB 1RDCA 4O5BA 1EETB 1WAJA 5KFFA 5HLFA 5KT7A 3F9KA 3EZUA 5KFZA 4HHTA 4PUOB 4DTSA 3OYHA 3LPTA 1ASVA 2A1SA 4ICLA 3B6PA 4Q45A 1YTUA 2OA8A 4IFVA 3BSCA 1D0EA 3HP6A 4MKAA 1LWCA 2W8LA 2RN2A 1KTQA 1SH0A 2P5OA 4J2EA 4CF0A 4F4KA 5KFDA 5HRNA 3DRSA 1SH3A 1TL1A 5L9XA 1RBUA 2DTUA 2VA2A 4N5SA 4CJTA 1LW2A 2AGQA 3AA4A 3I8DA 4M3TA 2VG5A 2IA6A 2KQ2A 3KNAA 3DLGA 1J5OB 5K14B 3LAMA 3TAGA 2C22A 3LANA 1RYRA 1T94A 3DMJA 2FC0A 3TWHA 3ISND 1RA7A 1IO2A 4KTQA 4CECA 1D8YA 5KFYA 4CJ5A 3RMBA 1ZYQA 3EYZA 5KG6A 5KGWA 3T1AA 4FCYA 3MR3A 4RW7B 1K1QA 3AA2A 5KG7A 2VWJA 1S6PA 4DSKA 4IQXA 1RT5B 3VQ5A 1N48A 4FS2A 3HK2A 1U09A 4TYAA 4FLZA 1HMVA 5KT3A 4U7CA 1S49A 2W9CB 2IM2A 4KO0A 3LZJA 4J9PA 4QCLA 4DEZA 5EUHA 3DRPB 4CERA 1IKVB 3KLEB 5KFWA 4AHUA 2XY5A 3MFHA 5KFNA 3HVWA 2XY8A 4CJEA 4LSNB 4URSA 3GV5B 4DFJA 4E89A 2KZMA 2F8TA 1REVA 5J2MA 4ED0A 2GBZA 4FM2A 3GYNA 1VSKA 1HRHA 1RT1A 4G3IA 1IG9A 1C1BA 1VSFA 4KV8B 2Z1GA 1DLOA 3RBDA 3UPFA 5KG5A 4DL3A 5KFBA 4ZVHA 4CK1A 4RU9A 3MEDA 3DLEB 5HROA 4TY8B 5KG4A 1TVRB 2Z1JA 2HHVA 4JLHA 4RW4B 4WZQA 3V1OA 3VQBA 3H4DA 3M9NB 2I5JA 1SUQB 4KE5A 4BDPA 4F4YA 4DL2A 3CM6A 3O3GA 4CGHA 1IKWA 1S6QB 5KT5A 4OLAA 2W8KA 3MXJA 1B92A 4YR3A 4BE0A 2IAJA 4DTOA 4Q44A 4O4GA 2HMIA 2J6TA 4WZMA 2WTFA 1OS5A 3JSMA 2R7YA 5F8IA 1JLQB 3LAKA 5KFLA 1C6VA 3TABA 1L3TA 2YV0X 4F8RA 1GOBA 2Y1IA 4ED1A 1DTTA 5KT6A 3QNNA 3SCXA 4KHQA 4Y2AA 5F9LA 3HJFA 4MIAA 4E1MA 1TKDA 4DLGA 3H5UA 4I2QB 1S1XA 3TANA 4GC7A 5DGAA 1RT7B 1YVFA 4NLOA 1SL0A 3ZSQA 2HWIA 3RB3A 3KOAA 2FJVA 3G86A 4WYLA 2BGGA 3IRXA 3D0PA 1IM4A 3VA0A 1FKOA 3AVKA 3IN5A 4DF8A 4KI4A 1FKPB 2IOCA 2AGOA 2YNFA 2G8KA 1EETA 4DS4A 4HYKA 4PUOA 4CJVA 4FLTA 1NJZA 3PO5A 4H4OB 4IRKA 3VQ8A 1VSJA 5F8HA 3HPOA 2I1RA 3SFUA 1TGOA 4DSIA 2HB5A 4QWBA 3NHGA 3QGHA 4WYWA 2YHBA 3L3UA 2YNGB 3HXMA 1RILA 1NHVA 5DG9A 2FBVA 4YR0A 4FJMA 1UOCA 3E01B 3S3OA 3SPYA 3AO1A 4ZPCA 1J5OA 2ATLA 3AVMA 2HNDB 4YMEA 4HUEA 3DOLB 2GC8A 3P83D 3AVIA 1RYSA 1TK8A 3DM2B 3D28A 3GV8B 3SJJA 4R0EA 1RT3B 5KFQA 5J2NB 3C6TB 1RT5A 1VSDA 3L2QA 4MK7A 2WB4A 4O3RA 5HRPA 1BCOA 2W9CA 3AVAA 3PW0A 4HTUA 3NF7A 4OGCA 4B9SA 4ECUA 4ZVFA 2QV6A 2ZD1B 1U47A 1TKTB 3DRPA 4CJ3A 4E7JA 4DL5A 1JLEB 1IKVA 3KLEA 3L2WA 3N6MA 3T19A 4ZPBA 4CEQA 2DFEA 5FDLB 5I42B 1TV6B 3GILA 5JUMA 4KI6A 4LSNA 2UVVA 2R8JA 1D9DA 4RNHA 2IBKA 3ZSZA 1B9DA 4RNOA 2FBXA 3I0SB 4JV1A 2O4GA 4KV8A 3GIKA 3O4QA 1N4LA 1U48A 3N6NA 3DLEA 4TY8A 1TVRA 3CFRA 1JKHB 2J6UA 2HVHA 2C28A 5KRSA 4Z0UA 5KFGA 4RW4A 3T5HA 2OZSA 4TQSA 3VQ4A 2FJXA 4DL6A 3ZT2A 2RDIA 4ZP9A 3HL8A 1SUQA 4CJFA 2VG7B 3I5AA 4ED2A 1C0UB 2IM1A 2V0NA 3ULDA 1S6QA 3MAQA 2C2DA 5CYQB 3KD1E 3RBEA 3QESA 5C24B 4TYBA 4NYFA 1TAUA 1DTQB 5L1JA 1S0MA 1NK5A 4FLYA 3VQSA 3OHAA 4TN2A 2KTQA 3LWLA 2OPQB 4OPKA 1TKZB 3VQQA 5CYMB 4Y34A 3RB6A 1JLQA 3VQ6A 4KREA 3NCIA 4DU4A 1NK4A 4B9MA 1BHLA 4DSJA 4ECWA 5CZ2A 3EY1A 4KBIA 1JL1A 4KHYA 3OS1A 5C25A 2OZMA 4B9NA 4WFYA 1RDRA 3RRGA 3KJVB 4DFMA 4I2QA 4CF8A 3DLGB 3DLKA 4JRQA 3TAFA 1NJYA 3BQ1A 4CGJA 1RT7A 1N5YB 3AA3A 3DDKA 1SV5B 4JRPA 1KVCA 4ZP8A 3H5XA 4PWDB 3KLIB 2VWKA 3QIOA 4MFBB 2LSNA 1Y97A 4B9TA 1JLAB 3E51A 4AILC 1FKPA 1NKEA 4QW8A 1HMVB 3H5YA 2ITGA 5DQGA 3VQPA 4L8RB 5HP1B 3AVGA 3CQ8A 2BRLA 4CEAA 2PZSA 4NCBA 4KAZA 3NFAA 4H4OA 2G8VA 4E3SA 4IFYB 2UVWA 1HYSB 5J2QB 4EBEA 4AHSA 3QNOA 3BDPA 4ED3A 3VA3A 4DF4A 2R2RA 2YNGA 4C8MA 3KHHA 1D9FA 5C5JA 2XCAA 3KLHB 3M8RA 3E01A 5JXSA 1T8EA 5J2PB 2KFNA 4C8LA 2FLPA 3Q8QB 3SQ0A 1NKCA 1YVUA 3IGVA 2HNDA 2JEFA 4OKJA 1ZBFA 3DOLA 4CFBA 2X78A 3CFPA 3MR2A 1JLCB 2W7OA 2BE2B 4FS1A 3DM2A 2R2TA 1RT3A 5DQIA 2ASJA 5J2NA 1HQEB 4DFPA 4YR2A 3DLBA 2P5GA 3C6TA 2F8EX 4KRFA 1A5VA 5KFMA 2IMWP 3FDSA 3NDKA 4EYHB 3V6KA 2AX1A 1J9AA 4O3SA 2BQUA 3OYCA 2UVRA 1I3AA 5CY4A 1KFSA 2XY6A 4Q0BB 1HJRA 3QINA 4GW6A 2AJQA 2ZD1A 3EPGA 1TKTA 4DMNA 3OHBA 1XC9A 1JLEA 3V1RA 3UIQA 4OGEA 2B4JA 5FDLA 4NLQA 5I42A 4NLSA 1TV6A 1RBVA 4KB1A 5I3UB 2P1JA 3ALYA 1BIZA 4DL4A 4FJLA 3H2LA 1RCHA 3AVBA 3HT3A 2XHBA 5EU7A 3I0SA 1ZTWA 4Y1DA 3WNFA 4DU1A 3LP3A 4AHTA 2JEJA 2OPSB 2D5RA 4M3ZA 2R8HA 4WE1B 4CCHA 1JKHA 4Z4EA 4I7FB 1S0OA 3I5BA 4CIEA 3AVJA 3PZPA 2P51A 3AVLA 1UA0A 3MTKA 4CHZA 4E7KA 2WOMB 2VG7A 3K57A 3NKYA 5JS2A 3NGDA 4RUCA 4H54A 1XWLA 1EKEA 3CWJA 1C0UA 4ECTA 5CYQA 3ISNC 3SZ2A 4OKKA 5C24A 3T3FA 3QERA 1JLGB 1DTQA 4KB7A 3NMAA 3L2UA 3LP1B 1T03B 1VSHA 2GUIA 2IS3A 2OPQA 1TKZA 1KLMB 3MR6A 5CYMA 3K59A 1RAJA 4CHYA 1GOCA 1MMLA 4LH5A 5EWEA 1QAJA 5DG8A 1HYVA 3ICLA 3KJVA 2B5JB 1S0NA 4RG8A 4KPYA 4BE1A 3PUFA 2JEGA 3Q8SB 2OPPA 1JL2A 2RKIB 1N5YA 2Z1HA 1SV5A 3PHEA 1RTJB 3RRHA 4PWDA 4NLPA 3KLIA 4MFBA 4BDYA 3AV9A 4Q8EA 4FM0A 1RA6A 4O0JA 2ZQBA 4Z4CA 1NKBA 2HVIA 3RTVA 1RT4B 1JLAA 4FXDA 4FJGA 3NBPA 4IR9A 5HP1A 4N41A 3SQ1A 4K8ZA 3NF9A 1TL3B 1S4FA 4RNFA 4M3RA 1JLBB 3FFIB 4IDKB 4YP3A 3KMQA 3SYZA 3HVAA 4Q8FA 1C0TB 1EP4B 4O0IA 4IFYA 2XWYA 2FVSA 1HYSA 5J2QA 3KMSA 4OVLA 3OVNA 3OYBA 3QYYA 4DU3A 4YNQA 3OLAA 3SFGA 5KFPA 1U04A 1XI1A 1RTIB 3H5SA 3RMDA 4TLRA 2R2SA 1S9GB 3O3HA 3OYGA 4ZVGA 5DGBA 2R2UA 1JIHA 3KLHA 3EPIA 2R8KA 5J2PA 1ZBHA 2HNYB 3IAYA 3VQCA 1NJXA 1QTMA 2FJWA 3K2PA 5KFHA 1JLCA 2R8GA 2BE2A 1RBRA 5KG1A 3CO9A 3KKRA 2E6MA 1HQEA 1WSGA 2AX0A 2JLEA 4ECYA 4CJPA 2DY4A 3PO4A 3ZT1A 3QEPA 3ZT3A 4IH6A 2EC0A 1QHTA 2HHQA 4O4RA 3KHLA 4OL8A 4FK0A 3KK3B 3HO1A 4KKOA 4F4XA 4NRUA 4Q0BA 3DOKB 4KHSA 4BWMA 3D5MA 4XIUA 4Z4FA 1Q9YA 3M9MB 3MR5A 2W9BB 4JS5A 2JC0A 1KRPA 4URGA 1VRUB 1QE1B 2ILYA 4CE9A 3CJ4A 2GIQA 5I3UA 3ZSVA 4CIFA 3WNGA 5C25B 3LZIA 1KHVA 1S1UB 2FVCA 4RW6B 3NH2A 4KHMA 3DLKB 2OPSA 2HW3A 4WE1A 2ASDA 4ID5B 4E1NA 3K5LA 5KFVA 4CJUA 3NH1A 4FJNA 3HSTB 4I7FA 3SUPA 3KD5E 4MKBA 1CLQA 4E19A 1NK7A 2Z1IA 4F2SA 4ZHRB 3B6OA 4DTXA 4FJ7A 3N6LA 2WOMA 4CJLA 4MK8A 3CDUA 4AHRA 2D3UA 2JC1A 4C8KA 4C8OA 1A5WA 1VRTB 4ZPAA 1KCFA 2G8WA 2WRMA 4GMJB 3RR7A 2G8IA 1K6YA 3VQEA 1SKWA 4IKFA 1JLGA 1VSIA 2BQRA 3BSNA 3SQ4A 3LP1A 1T03A 1C0MA 3MXIA 3HVTB 1HPZB 1HARA 3FSIA 2YNHB 4TSXA 2E9TA 4QAGA 1KLMA 4ED6A 3TAEA 2HWHA 3WNHA 3CFOA 1GOAA 2RF2B 4FJKA 4K4VA 3H4BA 3BJYA 1SKRA 3DRRB 1LAVA 2B5JA 4O3QA 4IH5A 1R0AB 1NNDA 1VK0A 3QGIA 2RKIA 4NRTA
chains in the Genus database with same CATH superfamily
4ZIVA 4ECRA 4FOEA 3FRYA 5AQKA 3O6QA 3VQTA 1RAFB 2NSCA 3U7JA 3L7UA 3I32A 2BTFA 1N0UA 3OL8A 2ZM6K 4FJJA 4F3TA 1RT4A 1N54B 3R1HA 4J9RA 4DV3F 4NCGB 2E44A 1DBDA 2EFVA 1R8AA 4DLEA 1WHYA 4GVLA 3UNYA 2XS7A 3LOUA 5GVQA 3P5JA 5HRSA 1GXTA 5D6GA 4L3QA 4JI8K 4FLXA 4OKEA 4JI5K 2V69A 2XULA 2GFFA 3W9IA 3H59A 1H2TZ 3CM5A 5AZIA 3OFHA 2AEMA 2HOEA 5DLFA 5ETSA 1SJ3P 1XNRJ 1G15A 4OYAA 1MMNA 4DV6F 1WNEA 3K5NA 1XK8A 3GDQA 4ZVQB 3R1LA 5BYQA 3RG6A 3ZZ0A 3ZTRA 3K9JA 3TI0A 1YRXA 3IBFB 3ZSOA 5FROA 4JNEA 4X62F 3S7RA 3KK1B 2HFSA 9RUBA 5GADP 3QNWB 1DT9A 1WJ9A 3AO2A 4LRAA 3MFIA 2MY8A 2MKHA 1Y5NB 4KBOA 3N28A 2OTLN 1NPKA 1UVJA 4DV2J 4Y3CA 3RAQA 5JVGL 3QGGA 1O6XA 3EICA 1Q86T 3VGUA 5ADXH 4CEFA 3DOKA 3M2RA 3GIJA 3H46O 4EO6A 3I6PA 3FQLA 2W9BA 1DFDA 1MU2B 4ZTFA 1QE1A 3W8GA 3GJTB 4GKJK 1VQ9N 1S7IA 1HR0K 1IBKK 6FDRA 3BR8A 4BE2A 1S1UA 3ILLA 4CTAA 4WP3A 4XEIA 4N7TA 4JV0A 2CPEA 3KUGA 4DV5J 4LRDA 1RCXB 2CQCA 1RT6B 3EUNA 3JSRA 4KJIA 3SAGA 4LQ9A 1X4GA 5I9EB 4CO1A 5D3GB 3MOZA 2E9ZA 2RAQA 4ZHRA 4WQ4A 5F8LA 4HUFA 2UU9K 4HT5A 4M63C 1LFPA 2B9XA 3H08A 3EN9A 4QU6A 1NHUA 1EARA 3GIMA 5KG0A 5BN8A 4IBNA 2CQBA 3I9ZA 1HBNB 4E7LA 2FSJA 1JXBA 3AVHA 2BKOA 4CZJA 4OX9K 4CH0S 5CD4A 3O8MA 3BO2A 4I1TA 3VERA 4IG3B 4LBPA 4DHVA 5A8KA 3V9XA 3S9HA 3HVTA 1QSYA 3C14A 2FY1A 2GMHA 3MXMA 3KXDA 1JJCB 4BR5A 4FK4A 1NGBA 4CZKA 4F3OA 1TR0A 2DFHA 4WYBA 3QO9B 3D2EB 4K2JA 1VQ4S 4BDZA 4QW9A 1IBMK 3LWMA 4YQWA 1SL2A 2K1RB 1BL3A 1KOOA 1FXDA 3J80U 4FM1A 2HHWA 3LO3A 2XLJA 4JS4A 4USVA 4CJRA 1BQNB 2F40A 1YJWN 4ZTJA 4MIBA 4DR3J 3SNNA 4U7UK 3PM9A 4LR8A 5SWMA 3K0SA 4NWBA 4LF8F 3TAQA 2CGLA 2GJFA 3FCHA 1FWKA 3ONQA 2IVOA 5AQQA 3MMAA 1F3VA 3EKSA 2CZ4A 1I5OB 3CCUN 2W01A 3CIPA 2ZEJA 2QTWA 5HRRA 1I39A 3L4BC 1SL1A 4DTJA 2XC9A 2AMCB 5KRTA 2M8HA 4YB1P 1RHQB 3IG1B 1RDUA 3D67A 3AB4B 2FHOB 3TQ1A 4JBCA 5KOXA 4F0HA 3G6VA 1Q1KA 5H9EK 2QMUB 2KVIA 2I7NA 4QS9A 1GX6A 2X74A 2RDDA 1Y00A 2QJ3A 2XHWA 2YHYA 1N6QB 4B3RF 1FDBA 5JLFA 2MGZB 3PSFA 4DSFA 3G0ZA 2YNIA 1F2GA 4A8FA 1S4EA 4RBTA 4BR4A 4ELVA 4FBTA 4LH4A 2W2PP 3M2VA 4F3QA 2UVUA 2FZGB 1BG3A 1WC3A 2EFQA 4IOBA 3M8ZA 4EZ9A 1ZM4A 4BRMA 3QIPA 2AEFA 3B4DA 2IM0A 4LFAJ 4OYWA 3Q7CA 4I2PA 2HSEB 4DSEA 2DRAA 5LMNJ 2A0FB 1X31C 2JL9A 3VQ9A 2DCUB 3CC7S 2M0GB 4URQU 3BGUA 1S9EA 5FRMA 3Q8PB 2Z2MA 1Y5LB 1OY8A 2XHCA 3SV3A 1VQ5S 3L2RA 1MA9B 3QEXA 3CPWR 2BJ9A 2XMTA 5JJBA 4TU9A 3THXA 3V81B 3DHWC 1Y9OA 2AD9A 4EWTA 1Z26A 2PYLA 3QZ8A 4DUZF 5H9FK 2YI1A 4RW8A 2W2QP 1K0TA 1QSLA 1WSIA 2VODA 3CJKA 1ZAXA 4RW9B 1DQ8A 3HI0A 4BRGA 2H48B 1FK9A 3ZEUB 3VAGA 3QETA 4PPZA 3HHEA 2BW2A 1B0PA 4K50A 4IRCA 4FKYA 3TUPA 2V8HA 3GV7B 1WEYA 4KHNA 2HF4A 3N5BA 1FJ7A 4WP8A 2XCPA 5HO4A 1VISA 4O3PA 2WFBA 3B78A 1RTHA 4H0TB 2NYHA 3G8QA 3QIDA 3J7ZO 3NGYA 3DOMB 2HFZA 3EE8A 3JS6A 3L7PA 4YN3B 3QFWA 2RRAA 3VPZA 2WVFA 5FRNA 3UR0A 4CP5A 1IJFB 2FF3B 1FERA 1RWUA 3CVKA 4X65F 2FZCB 1ZBUA 3HPGA 2KXHA 2RVJA 4PZVA 5RUBA 2CJQA 1X5TA 5TKWA 2BE9B 1K1SA 3GJRB 4CZEA 5KFTA 3B6BA 4X64J 4P7VA 1VK3A 1UTAA 2CFXA 2FHJA 1WEXA 4HUGA 1N8RO 3KLGA 2D7SA 1I1GA 1HNIA 4L75A 2AF6A 1U8WA 3K5MA 1BQMB 1HWJA 3W61A 1Q18A 2XM3A 4DTMA 4FJIA 2N7YA 2VASA 3ET6B 4ELTA 3ZO7A 3ZTOA 2DO4A 4HHUA 2GQCA 2P9IA 1VBXA 2V9WA 3M9OB 1NOZA 1GEHA 2FHJD 1T05B 3GG1A 3W8PA 4NEZA 1NB7A 5A8KB 1UWBA 1JJHA 1KD1T 5IM0B 3SV4A 3THTA 3GE9A 4R8UA 3DI6A 3TZXA 2ROGA 1HNVA 3BH7B 5JMVA 2CJKA 4I69A 3ZTPA 2YKQA 1W7AA 2AJFE 5DG7A 1D4XA 2D3ZA 2DGTA 1L3SA 3J7A1 3I55S 4NLCA 1RT2A 3BQ2A 3QAEA 4CESA 3OTCA 2P9KB 2SXLA 1S5JA 3FUYA 2AJ0A 4YS2A 2GHPA 2MZJA 2YKMA 1ZBSA 1CJTA 3ZZYA 3LUYA 4G1QA 2RRNA 3NF8A 5HQLA 2YVSA 4ID1A 3PIPL 5CZVA 2VKZG 1XERA 4ZOSA 3ZNUA 1BI4B 1B7YB 1NZ8A 2IGIA 2DB1A 2PEBA 2GIFA 3CD6N 1XNQJ 1TMJA 4NLTA 2ALZA 3UQSA 2O4IA 2FLLA 4MT1A 4DS5A 3E3XA 1ZOTA 2GJIA 5KFAA 1AZSB 5JVHQ 4FLUA 1IKYA 2F1FA 3PRBA 3BGRA 4DTNA 2W9AA 1GX5A 4M5NA 3CJ5A 2AKWB 4MH8A 4LF9K 1GMVA 4K4TA 1S72N 3X3UA 2XMUA 3JS9A 3MM7B 4ZITA 4Y0FA 2VG6A 4CZMA 4BBYA 2X1AA 4WKYA 1KQGB 4F7VA 2B6AA 3CE8A 4DX8H 2P9PB 1S1TA 2ZF5O 2WUSA 2MDAA 4NXNK 2HNZB 2IRYA 4BVPA 3G71S 1WSFA 2KKZA 1LWFB 3KK2B 1SPBP 1N5QA 3D4JA 4WJBA 4ES1A 3IA0A 2XGPA 3CJ2A 2CQ3A 2D0BA 5E3QA 1NM2A 4UY85 3Q86A 3PYEA 5BR8F 3FEZA 4CF2A 2CZ9A 3H98A 4AHCA 1LOTB 1BGXT 2ZNYA 5KFIA 4ILLA 2WBMA 3QB0A 3D9BA 1GXLA 1XEZA 4OIXA 2DJWA 1U02A 1G99A 3GLJA 5GAEP 5KGXA 4FJXA 2LVWA 4QWCA 1N34F 3JYTA 1NMNA 1RTDA 4LF4J 4BWJA 4BGBA 1NK0A 1XC3A 1UVKA 5KOWA 2QL9B 4GNIA 2O1PA 1F9HA 2Q66A 1XR7A 1XR6A 2VG5B 3HCXA 4NZ0A 4DR4F 8AT1B 2EHGA 1Y10A 3CG7A 3WEEB 3IS9A 4C48A 3KLFA 4OQJA 1U1MA 4AHVA 4Y2CA 2RRBA 3FVYA 3UCGA 4K4ZA 4HI1A 1RTZA 3VEXA 4GO7X 3NWGA 2UXDF 2F5GA 2C3UA 1N36J 2CKWA 1GMUA 4B3MF 4QBUA 1LNQA 4DR1J 5D0GA 1YVNA 4HKQA 1RJJA 5AQNA 4DU8A 3FSXA 2HHTA 1M5PC 1CZBA 1S1WA 4YB5A 2YHAA 1U49A 1FFGB 3CJTA 4ZP7A 4MKYA 1SIZA 1RTHB 3KHGA 3OJUA 3TAMA 2QFIA 1XN9A 4ZVEA 3MEDB 3BGFA 2PA3A 2W2NP 1NCLA 3I0RA 4HCCA 1FNXH 3SMPA 1KKHA 2I5JB 2B9EA 2RILA 4CGGA 2VQEJ 2MQNA 4LD0A 2YX7A 3NY0A 3M6WA 4BC7A 3RMCA 3H42A 4KB0A 4DQRA 3U6FA 1RWOB 4NE9C 4A8OA 5HBMA 1XNRK 4WFAQ 1KAZA 2ATCB 4M3XA 1KHWA 2DHSA 2Z57B 1Z4UA 3PR4A 4YOYA 4QOZB 3TR5A 3ZYYX 4DV4K 1C0GA 4OI6A 2F8SA 3ZZUA 4DR7F 2FJEB 4AXJA 4P2SA 4F50A 1Q5VA 3FEYB 3CMAN 4LF7F 4WXOA 5F8NA 3LP2A 3VHQA 1XMQF 1RISA 1S99A 3IUCA 3OR1A 1EHWA 1F60B 4P73A 3ETMA 4DTRA 4M5HA 3NAHA 2XO7A 1C1AA 1TK5A 1Z25A 3KK7A 5AQSA 2E66A 2Y1RI 5DZ6A 2YNFB 1EETB 1WAJA 5HLFA 3F9KA 1M5VC 3QJPA 4DTSA 1TMMA 4EIAA 3LPTA 1CULB 3B6PA 2F4FA 2LA6A 2ZH9A 2ADCA 4RX6A 1UJ5A 3EGWB 2E29A 2V50A 4CF0A 2UXCJ 1BO5O 2HVEA 3LM9A 3F44A 5TKYA 3D2FB 5AQTA 1LW2A 3JB9k 2M5YA 2APOA 1MWYA 4FPAA 2KQ2A 1HLUA 1YAGA 3TAGA 3LANA 2CWXA 3ISND 1IO2A 1VC5A 2EXUA 4KTQA 4CECA 5KFYA 4CJ5A 5U47A 5KGWA 3BEGB 2QWQA 3N4QA 2O8FB 2DGXA 1BMQB 2GS8A 5KG7A 5BPNA 4ZJLA 1S6PA 1BD6A 5AFUA 3VQ5A 3AXKA 3W7BA 2YXLA 1U09A 1SAZA 3C65A 2MZQA 1HMVA 4FLZA 2GZOA 1S49A 3QATA 2PC6A 8RUCA 4KO0A 2D9PA 1BA0A 2CGKA 9ATCB 3EJMA 4OJ1A 1GFWB 1CC7A 1T11A 4IO1A 5KFWA 2BJ7A 4AHUA 3R9LA 2XY5A 2XNRA 4DKWA 5AQXA 3VR1A 5KFNA 2YWFA 3HVWA 3TW0A 1WF0A 3GV5B 4WQ5A 4E89A 3PIOQ 2NRWA 5J2MA 2CQ2A 3IRWP 3H90A 3VF0B 4GVEA 1SC4B 4FM2A 2OTJN 1C1BA 4ZVPB 5FLXO 3VF2A 3UPFA 5AE2A 2CQIA 5KFBA 4A5BA 4CK1A 2MQ8A 2GHWA 5HROA 4TY8B 2KJVA 3LPYA 4WZQA 2DCLA 1PIEA 4ERDA 3VQBA 2KFYA 3JXUA 2JNJA 1SS6A 5B0EA 3R1XA 1M1HA 5DS7A 2Z2ZA 3BZCA 4CBUA 1HHTP 1QAXA 4F4YA 4XH1A 4CD1A 2QLWA 1S5ZA 1RQ0A 1X8DA 4DTOA 3L95X 2GGPA 2J6TA 1U1KA 2EFNA 4CLTA 5A8RA 3J7ZT 2DHHA 5EX0A 3MPYA 3VGKA 2RD5C 1JLQB 1C6VA 1L3TA 2YV0X 1GOBA 5LJWA 4ED1A 1DTTA 2YWHA 2KI2A 5HI7A 4CLWA 3FLCO 1WHWA 4DUYF 3SCXA 3HJFA 4MIAA 4DR6F 1GAOA 4FP9A 4PHTX 1VQ8S 3TTCA 2E1AA 5T7LB 4DR5K 4NLOA 3KOAA 2AV5A 2HK2A 3VGVA 4DPWA 3THYB 4CO3A 3ENWA 1DJ0A 4KI4A 1S6UA 4C7QA 2C42A 2G8KA 1N8RT 4DS4A 4BRPA 4KY3A 5LMNK 1NDKA 4PUOA 3G82A 1KEKA 4FLTA 1QHAA 4C9DA 1NJZA 3PO5A 3KWGA 2XYPB 2EG1A 4FVCA 4RWWA 3UDEA 4YDUA 2BEFA 2VC0A 3B54A 2JJ4D 1FF2A 3SFUA 4A8WA 1ACMB 2V9KA 2VB6A 4QWBA 5LL6d 3L3UA 1W2BR 3GJSB 1PILA 4PG8A 1RILA 2AZ1A 3UCUP 3E2EA 3HHLD 2RU3A 2H5IB 2V2QA 4D3HA 3S3OA 3MCPA 4HL9A 4ZPCA 2ATLA 4FF2A 4HUEA 2ZBQA 2XEXA 2X7IA 2E5LF 3DOLB 2GC8A 2H4YB 4I4BA 1RYSA 2XB2D 2HRYA 3CF5L 3ULEA 3H25A 2QN6B 1RT3B 4FWLA 5KFQA 3C6TB 2M52A 5DO2A 3KVGA 3H1VX 1IWGA 1M1GA 4O3RA 3GFHA 3LDLA 2MKKA 3WBZA 3UVJA 1AFJA 3JSYA 2ZD1B 1DY3A 4QS8A 2O3DA 1UPMB 3DRPA 3OA9A 1X7VA 3KLEA 3A5NC 3IO1A 2MZ1A 5FDLB 3OTBA 5I42B 2UYTA 3GILA 3G4SS 2DNQA 4O8KA 1RB0A 4RNHA 4NB4A 1UW9A 2XNQA 4X4SA 1KAYA 1B9DA 2FBXA 4O8UA 4KV8A 1N4LA 1U48A 4BG9A 4JV5K 2E20A 3V4MA 3DLEA 1TVRA 3CFRA 1JKHB 5BRFA 1X4AA 5KPTA 2J6UA 4AQYK 2HVHA 2C28A 5KRSA 4Z0UA 1BLUA 4A62A 4RW4A 2C3OA 3T5HA 3QJLA 3FC9A 3HL8A 4CO5A 1WC4A 2IM1A 3ULDA 4AUKA 4H5NA 2FTRA 3VVTA 3KD1E 1TAUA 1WBBA 1S22A 3C3LA 4LF1A 3DC2A 2DGSA 2BUPA 2KB2A 3OHAA 3VQQA 4KREA 4DU4A 2OJ3A 1NK4A 4DSJA 1BHLA 4ECWA 3JQKA 3EY1A 1B0TA 4C2MA 1UZDA 4KHYA 3OS1A 2RUGA 3A8JA 3CCQS 2OZMA 4B9NA 5EVZA 2CZVC 3EX7B 3Q83A 3UI3A 2HQDA 2RHSB 3KJVB 1R8BA 4USMA 3CXCM 1G2EA 5AQJA 4I2QA 2QWMA 3TAFA 1AB8A 3O5TB 3OR2B 3BQ1A 3SQGA 1N5YB 3AA3A 2BUNA 3W2WB 2CXEA 3DDKA 4H4KA 2UUCK 4AL7A 1RGVA 3QIOA 4MFBB 4LF6J 3BKUA 1EQYA 2Z30B 3E51A 3MMVA 1C0FA 2C2KB 1FKPA 3J80Y 1BA1A 1NKEA 3DRYA 1HMVB 3NXZA 5DQGA 5HP1B 5HL7Q 3CQ8A 2BRLA 3Q22A 2P9NA 2PZSA 1FFWB 1R27B 1TUVA 2IVYA 3OD2A 1IXKA 4ED3A 3CUNA 2VU5A 3VA3A 4FF4A 2EG2A 4K59A 2G0JA 2D69A 3KHHA 3BYRA 1R31A 1D9FA 3WQUA 3KLHB 2WBRA 3M8RA 2F8HA 5JXSA 1T8EA 2KFNA 4QYRA 3R6MA 1NKCA 1YVUA 2HNDA 4OZLA 2N82B 4CW7B 1WORA 2X78A 1QQOA 3CFPA 2W7OA 3GBTA 2RS2A 3M6GA 5DQIA 3T1HJ 2LQJA 1E6YA 5J2NA 1CJVA 3MCOA 3DXMB 2NCKL 4IOXA 1P9QC 3D6HB 3FDSA 2QG9B 4EYHB 3V6KA 3VGSA 1J9AA 4DPUA 2UVRA 3IMQJ 4CLKA 5CY4A 5I3QA 2B7CB 4LC9B 4Q0BB 2AJQA 3Q23A 1TKTA 2GELA 2DNOA 4DR2K 4G1PA 5M2RA 1XC9A 1JLEA 1XUPO 2E2PA 4UF4A 4OGEA 2DISA 4NLSA 5I3UB 3ALYA 3T1YK 1DURA 3CQYA 3H2LA 4DPYA 3AB2B 4X4RA 2M7SA 5EU7A 2LFVA 2LEPA 3I0SA 1ZTWA 4KGVB 5LXYA 2X51A 4GVBB 3LP3A 2JEJA 2OPSB 1LK7A 4HWIA 4M3ZA 5CD4H 2E5IA 4KT0C 4ED5A 4Z4EA 2GCFA 1GQEA 3HI9A 4CIEA 5BXIA 2QA4N 8ATCB 3MTKA 4CHZA 2VG7A 3BBBA 3K57A 3NKYA 1YJWS 1YI2N 1N33K 1XWLA 1FWLA 1KP6A 2P5VA 3HHLB 1YRTA 4UQTA 1Y7PA 2GO8A 2PMHA 5K5MA 2BJEA 1XMOJ 3G8SA 1QZ6A 1DTQA 1KTVA 3L2UA 1T03B 3PCOB 4HACB 1KR4A 1D09B 2GUIA 2OPQA 1VBKA 2CPZA 4UOFA 4IOCL 3GG0A 3VGLA 3SAFA 1RHJB 1NG9A 2HG4A 1Q82O 2O8EA 4LH5A 4EHUA 5EOYA 4JP8A 3CJ1A 4YY3K 1QLNA 2UXBJ 1HYVA 2B5JB 1S0NA 3SBGA 2JEGA 3Q8SB 2OPPA 1ZPWX 1V4SA 1JL2A 2ZWHA 2NQPA 3RRHA 4NLPA 2CH5A 3UKRA 3KLIA 4BDYA 2J9EA 4Q8EA 3ZZTA 1RA6A 4M8LA 2HVIA 1RAAB 2EI5A 4JI1K 3KG1A 1N36K 3NBPA 3M2UA 3IAS9 3C2PA 4UOHA 4N41A 4DR1K 4K8ZA 2CPIA 3TSPA 1PAUB 1H98A 2HBMA 1MROA 3FFIB 4IDKB 1KXPA 4H0YB 1H1VA 1FD8A 3SSQA 1EP4B 4IFYA 1EZZB 2E88A 3HZ6A 3O6WA 2AP6A 3OYBA 2HFUA 2FLOA 2PBDA 5KFPA 1UW4A 4WFNQ 4TLRA 1S9GB 3O3HA 1NDPA 3DXBA 4MO4A 3P39A 1FJGK 2VCPA 3CHWA 3QFHA 3QWUA 3I31A 3TTFA 3EPIA 2F9JA 3MCSA 4A8MP 1IBLJ 2F8MA 4TVAB 5BREA 3NCPA 3K2PA 1W7WA 2R8GA 4NXMJ 1N32F 2VQEK 2HAFA 1WSGA 2AX0A 2L08A 3NS5A 4CJPA 4RBUA 3ZT1A 2P8IA 3A12A 1VQKS 4LFBF 3ZT3A 4IH6A 5M1NA 4QQBA 4DV1K 3KK3B 4RO0A 4F4XA 3DCAA 2FJAB 3OBIA 3O1WA 4KHSA 2ITMA 2VQFF 1KWMA 1Q9YA 1WKJA 1VRUB 3TTDA 1G1XA 2ILYA 1SC1B 3CJ4A 2GIQA 2HRUA 2PDAA 3BDEA 2QEXN 2JOQA 1VQLS 4JD2B 3LZIA 3DGPA 1KHVA 2KYZA 1FE0A 2HBYB 4KHMA 1Q53A 2ASDA 4E1NA 1V5IB 3K5LA 3C7NB 3HSTB 3SUPA 3FBEA 1HNZJ 2HS4A 3P49B 3R7NB 4GKKJ 2Z1IA 1VQNN 2VPXB 4XH5A 4F67A 4B3SF 4CJLA 3CDUA 3AT1B 2M3DA 4RLEA 2DBBA 4M5LA 4C8KA 4C8OA 1VRTB 4FYWB 2G8WA 4RTFD 5F0WA 3KKFA 2V4JB 3QT7A 4R25A 3O44A 3T9ZA 4KPCA 2H3EB 1EWRA 3HSCA 4TSXA 2YNHB 4CJ7A 3SSSA 2UXCK 2GWKA 5LT5A 3GFYA 1JK9B 2NRHA 2P9GA 2CQDA 3WNHA 3CFOA 2UXDJ 1NM1A 4FJKA 4K4VA 4XDDA 1F3FA 3MUMP 1SKRA 3ATVA 2JRSA 3H1QA 1LEOA 4IH5A 1IR2A 3OT9A 1R0AB 1O13A 3BYPA 5ADXA 3QGIA 2F7VA 2BZ2A 2LP4A 1RTJA 4YDXA 2G0IA 2R7TA 2R7OA 1VQ6N 4K2XA 3AJDA 3QPIA 4FZXC 3HULA 3ID6A 3MURP 2MKJA 3FZMA 1RHUB 1WNSA 1YJNS 2X3DA 1TL3A 2J0SD 1KDNA 2H1YA 1VQPS 1JLBA 4EU0A 2ZE2B 4XPEA 4B1YB 4NO7A 5ETMA 5F0UA 5F9NA 5KG3A 3KWMA 1NH8A 2LU1A 1C2PA 2WC9A 2Q3SA 4FVMA 1RTIA 4RR5A 2E5HA 3OXFA 3ZSXA 3M8QB 3NH0A 5T7BA 1VLYA 2NRZA 5M1OA 2H4WB 3HFVA 1VC6A 2N3LA 2HNYA 2DRBA 1RWNB 3QBXA 4OZ1A 2VFVA 3WT0A 2XMKA 1TKXB 4ZLPA 3SUNA 1ULRA 5J1PA 2FBTA 3BF4A 3IAM9 1T9YA 1LCUA 4X62K 3EVOA 2EEYA 2EKNA 1P6TA 3V9SA 2Y1JA 3D1HA 3Q24A 4IOCQ 1JNRB 4I9QA 4E7HA 5CE3A 3J7YI 1KLNA 1QQCA 1F21A 2ZH2A 4J90A 2J0QD 3PW4A 4H03B 4B3OB 5GIPA 4Q43A 1T6CA 3TSQA 4P9SA 1M1KO 6AT1B 5AZJA 4U67L 3MM8B 2HQFA 2DFFA 4BRDA 3CCLN 4RW6A 3KWIA 2VKRA 4JI3F 2OPPB 2P9LB 1PC5A 2ZITA 5IT9U 3R8EA 1OQ3A 1VHIA 1MW7A 5IT9O 1NJWA 4OMFG 5HAOA 5ETQA 1QVFR 3BY5A 3WXKA 4JI7F 4W5TA 3NBPB 2DNGA 4LF5F 3M7VA 3J8AA 1IVZA 3AJ1A 3L09A 1QS4A 4B3TF 4BRAA 3CC2N 1IKXB 1REGX 1E4GT 1H2UX 5LSOA 4OJRA 1K8AO 3V6DB 2AWZA 3OBYA 4KH0B 3PVXA 1HPZA 1B70B 2ASPA 2RUSA 1VQSA 4Z4GA 5AQPA 1SQKA 2ZJPQ 2AEJA 1T9WA 2RH3A 1FXXA 4CEEA 1D5AA 4E98A 2QKKA 2XMJA 3Q2TC 4YHHF 1NHKL 3ZT0A 3MEEB 3DRRA 1RKJA 4NLDA 2XRIA 4PQAA 4IEEA 1SI9A 2W41A 4KTZA 2HAIA 1U25A 2U2FA 2YKOA 3G9CA 1KFDA 4CRJA 4CVNE 4OI4A 3LW5C 2KG0A 1CLFA 2V5HG 1WHVA 1ZPVA 1ZA1B 2WCXA 3ENAA 1U1NA 2IBOA 1H2VZ 3VZIA 3A5OC 4USUA 4DMZA 2Q3PA 2CQ0A 1U26A 5K8NA 2YJEA 3QT6A 3VAIA 2FBYA 2XMWA 2UUWA 5CCLA 5DDOC 1FTRA 2RSQA 4CHOA 4LF8K 3CETA 4R5PA 2NYIA 3OYMA 1LQ9A 5M1FA 2P9EA 1UP1A 3KDNA 5BPLA 1NOYA 2OANA 3VQDA 4CO4A 2BQ3A 2XLKA 4JKBA 4WF9L 5LMUF 3P1GA 1YIJS 4F4ZA 4Q2MA 3W63A 3OSNA 3JQJA 5KI6A 4OYOA 1TUWA 4R79A 4B3RK 2QWRA 3A8IA 2ASLA 1FVSA 3M8PB 1FRXA 5KFXA 3UE2A 5ADZA 1OWXA 5ETNA 3RB4A 1RABB 2C2MB 4IG0A 1UKUA 3UN5A 4CJSA 3PW7A 4CF9A 3UCZP 1RHKB 1HWUA 1IUJA 5FD1A 2OIHA 3A13A 4HVJA 3AVNA 1B9FA 4MQ3A 1H73A 1TL7A 1KQSR 4Z4HA 1LW0A 2QA2A 5AQVA 3O8WA 4DG1A 1WKKA 4ZLLA 2OKQA 1UA1A 4BRLA 2DNPA 4CLLA 4YOEA 1AA1B 4CLSA 5AE3A 3LDQA 2UUAF 4X4TA 2B4OA 3O9RA 1HQUA 4ZVTB 2OPRA 4X2BA 3QEIA 3NRBA 4ZN1A 3KIOA 1HWLA 4HT7A 2XGQA 4FDFA 3W62A 4P2FA 3VN5A 4JV2A 3GIRA 2GIRA 3LP0B 2A3JA 2LQ8A 3T41A 3AARA 1PJ7A 2VPZB 3ENQA 2YCHA 4M5DA 3MUVP 1JMTA 1YHQS 2OELA 4IO9Q 1CJUA 1UETA 1VRQC 3DYAB 5ETKA 1WOSA 3IR6B 1S6OA 2V94A 4TY9A 3LALA 4J9UE 3HKWA 1C1CA 3IM9A 2ZM6J 3MPUB 1W97L 2HURA 3MECB 4DUZK 4F26A 4M42A 2EFGA 5L1LA 3CCJN 2YTCA 1U0HB 1S9FA 2P9UA 3VF6A 1NDLA 2XO6A 2NS1B 1E3MA 2B9WA 3R7SB 2JGUA 2ZOMA 4YB7A 3ZT4A 5JLHA 3MM6B 3IP0A 5J1EB 1K47A 4JI8J 4JI5J 3QSYB 2MMYA 4BQZA 3AD7C 5ITHA 1CS4B 3T5KA 4B8AB 3NGZA 3T1HK 3P4UB 5C42A 1BWVA 2VBYA 1WOOA 4PRFA 2O8BA 4YOTA 3HT0A 3DFEA 1HNXF 4C11B 3TAPA 5HMWA 2IA0A 1TFWA 1W0HA 5KFUA 3QFPA 4E0DA 2Z8QA 3T5LA 2L9DA 1B3TA 2WK4A 3C15A 3MMJA 5JICA 1F5AA 3QMLA 2RB7A 2WONA 1YBUA 4Z94A 1S1VB 5A2QO 4CO2A 3CMES 1HLWA 1HKBA 3VF4A 1HHSA 4J5OA 4M95A 5B0DA 1LWXA 4Z2XA 4UT4A 1WLJA 1DZ5A 4EMDA 2LDIA 4FYDA 5BRHA 4E7IA 1QY7A 1Q8BA 3KHYA 2AHOB 4GKJJ 5G4DA 5AJ3F 1HR0J 1IBKJ 3ASMA 2ZH1A 2XI2A 3C8YA 4JI2J 1E6VA 1RAEB 2ZH5A 1U45A 5KFJA 1RHRB 1I94J 3B82A 1X0FA 2A2CA 3BBCA 4H0PA 3PG9A 2GVDA 4I6MA 4JKGA 2GW8A 4QWAA 1ZETA 1YBTA 2BVZA 1VQOS 1CZ9A 2F7TA 3W2VB 1S59A 4DCPB 1DHMA 5DDRC 1S97A 1URRA 3GJQB 1FRIA 1Q9XA 2FHMA 3DWLA 5EWFA 3R27A 3MMCA 3J81U 3MEGB 4DWIA 4DV0F 1ZZFA 2P6TA 3SMSA 4HHJA 1M5OC 2C2RA 3RWUA 2L9WA 3OYLA 3ITHB 4NL5A 1R6VA 5K14A 2ALYB 3MM9B 1ZM2A 1IBMJ 3OTDA 2V7ZA 4XDCA 2W7AA 1Q78A 2GAHC 4PQUB 2J6SA 3I56N 4X66J 1S48A 4PWUA 2ADBA 3BSOA 1U24A 4CF1A 3M05A 3MF5A 4NLXA 2AYEA 4ZCKA 2VC1A 1NK6A 2AJ1A 2KHDA 3CPEA 5MAOA 1AW0A 3OW2R 4IYQA 3V4IB 2FB0A 2EX3A 1CSJA 3FCVA 2ZJQQ 3N9UC 3SCJE 2VFSA 1FDDA 3MWPA 3N4WA 4CHNA 3W66A 1P9YA 1UAXA 4W5OA 3FK4A 3D2WA 4U8VA 3HYFA 1OH5A 2DPJA 2NXCA 5IV4A 1GK8A 4WXWA 3R2CJ 3VAJA 3MAHA 4OHZA 2QYGA 3L3VA 4DPTA 3G6XA 2YWKA 4JKCA 3D3CJ 3BPDA 1V6HA 2HQGA 2YX1A 1WHXA 5IWAF 5KFSA 1T3OA 4ZLJA 4NLBA 2GX9A 2VBXA 1FRJA 4ICLB 4PG5A 1UFLA 4JI6J 2A18A 2IM3A 4PXEA 3NGKA 1FX2A 4IFVB 2MQPA 1NJIT 3M30A 4PPDA 2W42A 3RYLA 4IO8A 3DRSB 4K4XA 1O8BA 2UU9F 1HNZK 2NXJA 1KC8O 1N34K 3O9SA 3TEGA 4GKKK 4DQQA 3WXJA 1UCNA 5F8JA 4USWA 5AXLA 1VQ7N 2KVQE 4QIVA 3EVWA 1YTYA 3PRVA 1QVFM 2I7PA 4OX9F 3DMJB 4DR4K 4OI2A 1M1KT 4NLRA 1HD1A 1JLFA 1CJKB 1JXEA 4XTTA 2V2KA 5KFRA 1ZBTA 1WSJA 3BR9A 2YKNA 2DIVA 3MUTP 4OZNA 2PFDA 4CEDA 1NAQA 2EBGA 1XHXA 2UXDK 4WWSA 2D0AA 3LA0A 3TR8A 2W24A 3CJBA 4IZ9A 5H9FJ 4B3MK 2DH9A 5FPEA 4H8KA 1QQNA 1EB0A 1ZBLA 5M2UA 4P71A 1UVIA 2GQQA 1REVB 5G0RA 3RSEA 2Q97A 4NOHA 1RT1B 1H0HB 3LDPA 4NYZA 1IQZA 2COLA 1SVDA 5ETPA 4USKA 4M7YA 1U0SA 2MQOA 3BZQA 4CFDA 4ECXA 3CD0A 2BV3A 4BY9C 2DIUA 4KGKA 4H0OA 3LGNA 2F4VF 4FSVA 3WHIA 4FWKA 4M45A 3K8VA 2IJFA 1UJ4A 2PEHA 4CGIA 3K7RA 5HMYA 1IKWB 4OZ0A 3NAIA 3BSAA 2QMWA 1O1WA 2BANA 4IJNA 1OKJA 2IAJB 3NE6A 3WQPA 4HCBA 4CJ4A 5E0OA 3JSMB 4BRFA 2RQ4A 3LDNA 2CPYA 3OS2A 3HHKA 2NXNA 4ZMMA 1X5PA 5A6WA 1RDDA 2FSKA 4KFBA 1HYZA 5KFEA 3CJSA 1A6LA 1H72C 1FJCA 2KYXA 1S1XB 1SJ1A 4L3KA 1WAFA 2MHEA 4I6YA 1YLXA 3OBWA 2HBKA 3GQCA 1D3WA 4LF7K 1KOHA 2FGOA 5D77A 2VJUA 4I6MB 4PR6A 4JKGB 4KHWA 2O8CB 1GNKA 1LWEA 3IRXB 2IC3A 4H4MA 3CCSN 1YWXA 1FKOB 1IQTA 1XMBA 7AT1B 3CMQA 5JS1A 3C6UA 5K8MA 2MQQA 4ZS6A 1WUAA 4O5BA 2ZOGA 3NCRA 5KT7A 1KQSM 4OPHA 3UDCA 4W90B 1NXIA 2ZHOA 4MAKA 2V8PA 1YITN 1LWCA 3MMCB 2RN2A 3W65A 4F3MA 2P5OA 2WVCA 3FZKA 4CZCA 5HRNA 1SH3A 1TL1A 5HJXA 4NA2A 4L74A 5A0YB 1RBUA 3D6MB 4CO0A 2LLZA 4N5SA 2QL7B 3SSRA 4KHPJ 5K14B 3LAMA 5B0BA 1RAOA 1OVQA 4X4QA 3MD1A 4WCEQ 4KGXB 3TWHA 1D8YA 1Y4ZB 3RMBA 3EYZA 3H0PA 6FD1A 2RE2A 2GUPA 5KG6A 3T1AA 4FCYA 1OH6A 3AA2A 3CCVS 2KJWA 2VWJA 2BM0A 4IQXA 1N48A 1RUSA 4TYAA 5AQRA 1PO6A 5KT3A 2MHNA 3ZXWA 2J7WA 2W9CB 2IM2A 3LZJA 4QIWD 4DEZA 3HLUA 5KPZA 2Q36A 4G65A 1RACB 1U6FA 3DXKA 3DDNA 1NBEB 4E8UA 5GINA 3UDVA 4DX7A 2XY8A 4LSNB 4LF2A 4RCHA 4LRFA 2J5AA 2PIIA 3M1FA 3GFZA 3NOCA 4ED0A 3D6TB 4K5SA 3TYTA 4BC3A 4KYZA 1DLOA 1V3ZA 3RBDA 3H20A 1NH7A 4BG8A 4JYAJ 2RIJA 4RU9A 3K89A 2DNNA 1YKWA 2Y0BB 2ASMA 4DBQA 2OUGA 5LOQA 3UD4P 4BCAA 2IVMA 3HTVA 4JHDA 1SUQB 3OVAA 1NNEA 2UZAA 3KJFB 3MMBB 4KE5A 3CM6A 4HHHA 1SJ4P 4A8YA 5I4MA 3VEWA 1SBRA 4F25A 1FEEA 3RAMA 3KUEA 4DN9A 4O4GA 1B0VA 2HMIA 4WZMA 2WTFA 4PKHA 1OS5A 3UO0A 3ZFVA 4CLPA 1P90A 5F8IA 3AAWB 1RDWX 2Q0RA 3LAKA 3X1LB 5HVGA 2HHHF 5DDQC 2CQPA 4CBWA 3CD7A 1K8KB 5DRKA 3QNNA 3P38A 3AGRA 1CQNA 4Y2AA 1EWQA 3OHRA 4DV7F 1TKDA 4E1MA 3THWA 4LSZB 4BROA 3H5UA 2DGWA 2DNRA 2RJZA 5DGAA 4DUYK 4F36A 1TZ0A 1YVFA 1SL0A 2HSTA 3RB3A 1VR6A 3MCNA 5F3TA 2BGGA 4C3MA 2M70A 3EL2A 1HNWJ 1PSDA 2I38A 3AVKA 5D4LA 2BX6A 2M4MA 4JK7A 4E1JA 5F1XA 3VGTA 3A0IX 3H3NO 2UP1A 1SB6A 5DM6Q 4RUBA 4H4OB 4H5VA 4B1VA 2ASOA 4X84A 4CH1A 3VQ8A 5F8HA 4DSIA 1NMEB 2XSFA 4ES3A 4JI4F 3OXGA 3G8TA 1TELA 3QGHA 1PKUA 3OFEA 4WYWA 4DCOB 2YNGB 1CBKA 2IHR1 1UEVA 2ZKTA 1NHVA 4F04B 3D68A 1EJ7L 3HHNB 4C98A 4YR0A 4FJMA 2YBVA 2FSNA 2BJ3A 4LFCF 2PFFB 1GLBG 1J5OA 3AVMA 2JHEA 2Q0UA 4YMEA 2AP1A 1VLOA 3O9UA 3OUYA 1VQNS 2YHXA 2DHAA 3SJJA 3OXLA 4ANCA 3LF0A 3P45B 1RT5A 4ZK7M 1VSDA 2FY8A 2FJBB 4LF9F 3AJ2A 5IS2A 3O1LA 4A46A 5HRPA 2JLFA 3NF7A 4CH7A 4B9SA 1NGAA 3GFXA 3W60A 2QLFB 4DL5A 1IKVA 4NXNF 3W5ZA 4ZPBA 2DFEA 4CM0A 1TV6B 3OTOJ 5B0AA 2R7UA 3OW2M 2UVVA 1G6BA 2R8JA 2DITA 1D9DA 4YOXA 2IBKA 4NZ6A 3EDRB 1V3RA 4RNOA 3TQEA 3UN2A 2ZZMA 2O4GA 2P9CA 3GIKA 4ID8A 2GV1A 3MHYA 4OV6A 5L8RC 2J9DA 2W1BA 4DV4J 1UPPA 4JI0J 4DL6A 2GVZA 4ZP9A 4CJFA 4F0MA 3I5AA 3K2YA 2XMAA 2V34A 3C16B 1S6QA 3O9TA 2C2DA 2XBPA 5C24B 3J7AN 4TYBA 3DLLQ 5JMNA 2HQCA 5L1JA 1JWWA 3SJHA 4RPFA 3POTB 1NK5A 5B0GA 4FLYA 4TN2A 1TKZB 4TLQA 3TA1A 4K0KF 4QR1A 5CZ2A 1VQ4N 1IG8A 1YJUA 4JK8A 1JL1A 3NS6A 4B9QA 4WFYA 4BS2A 4WPAA 1UVNA 1RDRA 4DFMA 4JI2K 4CI6A 2D4WA 4CF8A 3DLKA 1XTZA 4JRQA 4H4KC 3BN4A 1I94K 1RT7A 3M3ZA 1M90O 1N0VC 4ZP8A 2UUBJ 4PWDB 3CJRA 2CPXA 5E3AA 1OH7A 1NWKA 1Y97A 1IWAA 4NA1A 4NMLA 5AXNA 3QRRA 1MN7A 4EUVA 3K17A 4U8YA 4QPTA 1QJHA 3MAAA 3VQPA 1WB9A 3UKUB 2CPFA 2CYYA 1KC8T 4I67A 3AGKA 2NRTA 3FMWA 3NFAA 4Y2MA 3GP9A 3RW6A 2R7VA 2G8VA 1L3KA 2WAQD 2ZC3A 1FCAA 4EBEA 4DF4A 3E66A 2LU2A 1HBMB 3W5XA 2A6OA 3GPAA 1WC0A 2VD3A 1ATRA 4U95A 3CCLS 4FWSA 3E01A 4ANDA 4C8LA 4M1KA 3SQ0A 2DO0A 3IGVA 2JEFA 5GAHI 1HIYA 3I33A 1WDTA 1KBRA 3Q2SC 1JLCB 2BE2B 3DM2A 4IOAQ 4X66K 2ASJA 3JTPA 4DFPA 3THPA 4YR2A 2P5GA 3CJQA 4KRFA 4HLBA 1A5VA 1XNRF 2IMWP 1ZH5A 3TOQA 4MLEA 5CXTA 4O3SA 5FPMA 2BQUA 3OYCA 1FW6A 2YJFA 1Y3JA 4GW6A 4UZCA 3AY0A 3D0IE 3NGUA 3CC7N 1G4CA 2VFRA 3UIQA 3HSGA 1FRLA 5HMZA 3HHDA 3T6JA 4WBFA 3FKBA 4FJLA 2IYGA 3ZETB 2FGCA 3N0VA 3R5DA 1VQ5N 4DV2F 3PEJA 3WNFA 4UUWA 5JVHL 2HFVA 4FZVA 3CJCA 3RBXA 3D7SB 1FVQA 1KVIA 2HZVA 4ZCLA 1VQMS 3M6UA 3MX5A 3I5BA 3R5BA 3AOBA 2ZBRA 3PZPA 4WU2A 3NG8A 3H6EA 1J5EJ 5GMDA 2NLXA 3CWJA 1C0UA 4ECTA 4C23A 5CYQA 4C6AA 2DGUA 2QWNA 4DR5J 4JI6K 2QX0A 3M1VB 3J81j 4DV5F 3FMBA 4WIQA 3ILOA 3MM5B 4FYYB 5AXMA 2IS3A 2MJUA 3BF3A 2V51B 3MR6A 1Q7YO 5CYMA 3K59A 1RAJA 2VWBA 2NUUG 4CHYA 1VIXA 4V19J 1GOCA 1HBUB 3SDEA 5DG8A 3ICLA 3N5FA 4RG8A 3SLCA 4KPYA 4BE1A 3NOGA 4RUHA 3T7ZA 3HSJA 2P9SB 2RKIB 2O8DA 2V63A 3A1YG 1SV5A 2B0GA 1EO1A 2ZUGA 1K73O 2V8VA 2PT0A 2ZQBA 1NUEA 4DV0J 1RT4B 1JLAA 1JXVA 3MI7X 4IR9A 3Q7BA 3J7AP 1KS2A 5L39A 2M9KA 2V68A 3F0NA 4RNFA 2G13A 4Y2KA 3TRGA 5IQQA 4YOWA 3BEXA 4S0MA 3HVAA 1U2VA 3ZZOA 4Z37A 1XQIA 2RHKA 1HYSA 5J2QA 3KMSA 4OVLA 3QYYA 3U27A 3RUBL 5DJBA 2VIHA 1XJWB 5AZIB 5IT0A 3H5SA 5DGBA 4ZVUB 4DR3F 2CNNB 2AYMA 1LKZA 3PNIA 2HLUA 4X4UA 3D7EO 2R8KA 5J2PA 4E2FB 2VUGA 2KM8C 2HGMA 4ZIWA 1NJXA 1NGFA 1QTMA 4CYUA 4M5KA 5KFHA 2DTJA 1RAGB 3GSDA 1NLKL 1FNOA 1HQEA 1HBOA 2MY7A 5AQLA 3C6AA 3D0HE 1N32K 2CVEA 4JV5J 4UY8O 2N3OA 4FK0A 4AQYJ 3DOKB 3M2RB 4LFBK 3VVUA 3G96A 3MR5A 2W9BB 1R7IA 1KRPA 4URGA 4B1ZA 1QE1B 2DNLA 3CCJS 3UR3C 3I55N 4FWNA 2VQFK 1FI4A 4NI2A 4HH1A 4MDAA 3C46A 5IWAJ 3E9PA 5E7OB 1S1UB 3HD1A 3IR7B 2FVCA 4CTAB 1RBOB 3DLKB 4A2AA 1OMSA 4HTIA 5LL6Z 2HW3A 4WE1A 4FJNA 2RNEA 4I7FA 4WFAL 3J81Y 4E19A 4LFAF 1BUPA 4ZHRB 4DTXA 3EO3A 4K25A 2MZTA 1IM6A 2VL1A 5LMNF 2WOMA 4FWQA 4MK8A 2YY3A 1M5HA 4JK9A 3MAAB 1YJ9S 4AHRA 2BW7A 3MN5A 4ZPAA 1NMDA 3RR7A 1U2RA 2CNLB 5HATA 4DCHA 4U96A 5D4PA 4UOGA 1IJEB 2CNOB 4IKFA 2UUCJ 1VFJA 1JLGA 3U1NA 2BQRA 3LP1A 1C0MA 3MXIA 3HVTB 2X1BA 2DEJA 3C14B 1KLMA 4ED6A 4UW2A 3TAEA 4L72B 1VMBA 1X3MA 1B4SA 2HWHA 3A3PB 1GOAA 3QSIA 4P75A 3BUZB 4KHPK 3BJYA 3HF5A 3G71N 2Y9HA 3MK6A 5GAHU 2XLIA 3QAUA 1NNDA 2EFPA 2E5GA 1VK0A 4FYVB 1D9AA 2W4DA 3BP8A 5KFOA 5HMXA 3O4NA 3WUHA 3VEOA 3EKUA 1N56A 3AAPA 3CCES 2C1EB 3M8WA 3PX0A 2BABA 2NZTA 4CT8A 2HGNA 3V1QA 3BQ0A 3IWNC 1MNEA 2B8QA 2ZKUA 2R7QA 1DAXA 3NNCA 3GYXB 1A5XA 4U6PA 5E84A 1U7LA 4PAAA 4DFKA 1MMDA 3TP2A 1IJJA 2G2ZA 1C0TA 4EGLA 5A8WA 3MMAB 4K4YA 1S76D 1FWPA 1EKSA 1R8PA 4KSEB 3GG4A 3SEOA 4J2BA 3HSZA 1RHMB 3U1LA 4CGDA 4F4WA 1Q86O 4B9UA 1EAYC 3BREA 3DJCA 3OL7A 4DR2J 4UTGA 4JYAK 5EWGA 4DQPA 4G9ZA 2Q6BA 4GC6A 2V8GA 1EIYB 2ZJRQ 3T1YJ 4NLYA 4CLZA 3HOSA 1F9FA 3TX8A 2A5XA 2WSEC 3IFRA 3E9LA 2R7WA 1NSAA 4NLWA 2QXFA 4OJGA 4QR2A 3OYFA 3EGVA 3K58A 3C94A 1EKRA 4ED7A 4PG4A 3PIOL 2LYVA 3PW2A 2BJDA 2K06A 2YNIB 4X64F 4O0NA 3OLBA 1CXQA 2AQ4A 3M2VB 4FJ8A 4ZJOA 4ZDNA 2VOPA 2D1CA 3QIPB 4ECSA 2DR5A 1AUDA 4I2PB 1N33J 4ALZA 4JUZA 1BISA 3IMXA 4BRNA 3PX6A 1UEKA 4P52A 3CCMS 5E5NA 2V4QA 4K4SA 4WIIA 3ZX3A 1SH2A 3GE1A 5KFCA 1S9EB 2XI3A 5A76A 2KT3A 3BKTA 3FZFA 1IH7A 3G6ES 2O8DB 4ID5A 4JKHA 2PAVA 3FRZA 4KH1B 4CIOA 2J8AA 4USHA 4JI3K 3THXB 3VEZA 4PL7A 1HNWK 1H7XA 3MCAB 1PYOB 3FQKA 2J0XA 4YY3J 2CPDA 2ILZA 2Z58B 3M32A 4V19S 1P8GA 4DPOA 5E41A 4ZPTR 4W5RA 3GB0A 2VOOA 4JI7K 4RW8B 3IFEA 3E8OA 4DB3A 4MO5A 3CJKB 1TAQA 1LAWA 4JI1J 1YG0A 2BKNA 4KC5A 4DCJB 2QKBA 1C4CA 2QIFA 1FK9B 1I6JA 4C3LA 4DTPA 2RF2A 2KFZA 1JQGA 1TP7A 4M94A 4KH5A 1VGYA 1UFWA 2QGFB 2VFTA 3CDEA 1XNQF 1B99A 4X4NA 4H0XB 5D78A 2W4CA 5CAAA 1GT8A 4ZPDA 4EBCA 1FJGJ 4AFFA 4A5AA 3LDSA 4ZPWR 3ENBA 1S10A 4OYZA 4DL7A 4NCGA 3PYDA 2QZ8A 5K8OA 4FJ9A 3TEHB 2VV5A 1WG1A 2E1YA 4YFUA 3TUZC 4J9QA 2PY5A 4JN4A 3D1QA 4GO5X 3AO4A 2D3O1 2DNHA 4OHXA 4BC4A 3OTOK 4FBUA 1S12A 3THVA 1LV5A 4BR9A 1VBYA 3CJ7A 2R7SA 2F3JA 5AQFA 4A48A 1QQMA 2E1ZA 4DV1J 4CQ1A 1UJ6A 4J9MA 2NR0A 2GMLA 5AR0A 2FC9A 2XZWA 1NZAA 3FJ2A 4OZ2A 3KLGB 1YSJA 2ZGZA 1MG7A 2W2OP 1HNIB 4G6VB 1CXUA 3PXGa 4DQ8A 4JI0K 2MQLA 4V19X 2F63A 5CZXA 3KK1A 3EZ5A 4I68A 1KVAA 4CEOA 3NWRA 3N79A 3KZBA 4OYBA 4WTOB 4UQGA 2CIMA 1T3NA 3AA5X 5LMUK 3MN7A 1X5SA 5DDPC 4N47A 4J9VA 4K5RA 4ZJQA 2P9IB 2QTDA 1VC0A 4LF4F 4ETXA 2B43A 4MK9A 3OY9A 4FLWA 3OS0A 2YWGA 1UWBB 4AT1B 1K9MO 4Y1CA 1SC3B 4W92B 4R8UB 1W25A 1L3UA 3DI6B 1MU2A 5DETA 1MDUB 1HNVB 4GY2B 4TQRA 5E3CA 2RDJA 2BYCA 4B9VA 3OYKA 4KRWA 4O3NA 1ILYA 3CDAA 1T7PA 1RT2B 5E33A 5AE1A 2D41A 2RS8A 1VS3A 2VGNA 1KSPA 1RT6A 2UUBK 5D3GA 1YGYA 2OHDA 3CPWM 2YKMB 5BR9A 1CJTB 4G1QB 4DR1F 2I8EA 2KHOA 3MX2A 3CJ9A 4O3OA 4FN5A 1V5VA 3I4PA 3IKMA 3JTNA 2I9SA 1HBNA 3IWLA 3D6FB 2Q79A 3BH6B 3ENVA 1U4BA 1RI7A 4IG3A 2NRXA 3G2XA 3TVZA 1CPZA 1IKYB 5H1SQ 2IIRA 3BGRB 3WC0A 2NRVA 2RQKA 4PYAA 3M8SA 3HM9A 2VBWA 4ZVRB 4IRDA 2D1KA 4M3WA 5C2FA 4CK2A 4JKEA 1WEZA 1K73T 4DV3J 2VG6B 3RRKA 2B3TB 1OH8A 4QIFA 3JAMY 4M3UA 1HFEL 2AGPA 2PFUA 3QO9A 2B6AB 5HL7L 1VQ8N 2NLWA 1BU6O 3D2EA 4MKVA 3OYAA 4B8CA 1S1TB 4CGFA 2VQEF 2BJ1A 5FLXU 2K1RA 4CFAA 1N5TA 2HVDA 1X4DA 4GV9A 5C15A 2W6LA 3A2FA 2O67A 2HGLA 4I6AA 3P5TL 7FDRA 1UWAA 1BQNA 1EX8A 1T6DA 1PJ5A 1SQFA 2ZH7A 2BXJA 1L5UA 4N8NA 4DV6J 3H2VE 4AH9A 3Q8VA 3SUQA 4ECQA 2DPIA 2JWLA 2R8IA 1HNXK 3K8WA 3VQ7A 3TJ9A 4X62J 3D45A 2KT5A 1A9NB 5FPNA 4BRKA 1F6TA 3BF1A 3LDOA 3SCIE 3CC4S 5GMKa 5KT4A 4F0KA 3NP5A 3AOAA 2B7BB 3IG1A 3AO3A 3JYTB 3FZHA 3LPUA 1RTDB 4WK3A 2X1GA 2XSJA 2DT9A 4UY8T 5MLCQ 3L3CA 2L41A 2LXFA 3FE1A 1N6QA 3SI6A 2QA1A 2BRKA 2VGMA 1J5EK 4K41A 3IS9B 3HM8A 2MGZA 5BN9A 4ISGA 3KLFB 2CJYB 5ETRA 3WZ0A 3ADAC 5EX5A 4DL0C 2UXCF 4DHYA 2BOPA 1NO8A 3HVRA 4IFEA 4ELUA 2A1BA 3ENOA 3EM1A 3CQXA 2MZRA 2R3VA 4DI6A 4M41A 1HWKA 3G4SN 5HOOA 2B56A 4GV3A 3A3OB 1H38A 2WVBA 4OPAA 1SJRA 2H5JB 1S1WB 1NGHA 3QRPA 4F9OA 1XIQA 3HD2A 4J9SA 4FZYA 5ETTA 1FXRA 3R97A 4Z4IA 1RP5A 2VHGA 2ZVSA 2V52B 5D15A 3ID8A 4B1UB 2ZH6A 4DV0K 1RKIA 3TAMB 4BLGA 1FFSB 2QSWA 3V81A 5IQ6A 4OLBA 3OPKA 3ZSYA 1HQ2A 2GMJA 3ILIA 4QYZJ 3R6LB 2QC3A 2RE1A 3I0RB 3UDLA 2ACYA 2ZDOA 4LUBA 1BWEA 2PYJA 4JKFA 2WBNA 3WX8A 4ECVA 2K3KA 1U8SA 2VJVA 1TQLA 4OYIA 4RW9A 3H40A 5KTQA 4AYBD 3ZEUA 5HBMB 5LJ3Y 2OFHX 3G6YA 1J2VA 2N4DA 2A1RA 3CCQN 1NK8A 1BHNA 4HH0A 4KH4A 4LF8J 1OY9A 3JSBA 2W6KA 1X4BA 3CIZA 1F5BA 5DLGA 1X9WA 2QLBB 3DOMA 3LP2B 1X60A 2LDYA 1X4EA 2W4PA 1J54A 4WFNL 5BJRA 3QT5A 3OR1B 1ZXOA 3KNGA 1X1PA 1YXQA 3NVMA 1CEZA 2PE8A 3PHTA 5L46A 1WSHA 2QW9A 2EVZA 2V67A 1DARA 2YX6A 4C0BA 1KONA 4B3RJ 1ASWA 5HLFB 1RNHA 3EVMA 1GLFO 4EEYA 2KZZA 2G8UA 4C1NK 5IWAK 3TARA 4MYUA 3OYJA 5AQGA 2KO1A 1QSSA 4EHTA 3FBCA 4BRHA 4LBHA 3RBZA 3CCTA 4YOUA 4AL5A 5L1IA 1OSCA 2PI4A 5DM7Q 1X4HA 1SQEA 2ABYA 2I6WA 1BQMA 2HS3A 1LW2B 1U2CA 4UUXA 5F2RA 3H8YA 2ZBIA 5L1KA 3R3LA 2IFXA 1SKSA 2E7XA 3ZCMA 3ET6A 2IJNA 4I9LA 4BRCA 3UE5A 3DKDA 2HQ3A 2JDJA 2NUBA 3I96A 1AYEA 1RDAA 3QEWA 4EK2A 1T05A 2OTLS 1S6PB 4BC2A 2E7VA 5IM0A 2QI2A 3BGLA 2KRRA 4LJMA 3Q0AA 3KTQA 5KAKA 5T14A 1HA1A 1Z2LA 4KO0B 2MJNA 4CNYA 5SZTA 2CQ1A 4XK8C 4LIRA 5D0EA 3IGNA 4PG7A 2DHGA 4DPXA 3PY8A 5EDWA 4DUZJ 1KAXA 3OL6A 3CJ0A 2CAJA 5C7PA 2WVDA 5J2MB 1VQ9S 2P9KA 2F96A 2Q31A 1ITGA 3ZTQA 2HMPA 1C1BB 1NGCA 3VWSA 2IJRA 3U4LA 1T9TA 4I6WA 1IV0A 2R7XA 2CVIA 3QICA 3J80O 4CHPA 1LOUA 4CJKA 4FJ5A 5HROB 4EAHD 3S3MA 3R6GB 1OYDA 4IH7A 4H5RA 4RNNA 1BI4A 2AA4A 5D8HB 4AD6A 1Y11A 3IWXA 4BR0A 1VCTA 2FDNA 2DK2A 4FPRA 4L3NA 1AZSA 2F4VK 1TK0A 3LL3A 2C2OB 3FR0A 4FO0A 3PX4A 2BM1A 5E3RA 2GGPB 3MM7A 3C66A 5A8RB 3AD8C 3UD5A 1YUWA 2FYXA 2GX8A 3C19A 2XSJB 1X9MA 2M88A 2P9PA 1DTTB 1PCAA 3SPZA 4KR0B 4Q2LA 1M5KC 3ZC4A 4X65J 5M1PA 2HNZA 1RBTA 4WFBQ 1SJFA 3KDOA 1LWFA 4O5FA 3KK2A 3Q8UA 3OYDA 2OCEA 4CIGA 2ZWPA 2H9ZA 3SCLE 4V1Ak 4N76A 1BWFO 2X6NA 4KAIA 3ATUA 4R0JA 5LXRA 2ZFHA 1NBWA 1WN7A 3LGHA 1UAWA 3EXCX 4RUAA 1DQ9A 2XYHB 1WWHA 1RDCA 4MTPA 5GAHP 2HBQB 5KFZA 3G82B 4PUOB 1QD1A 4HHTA 2OEMA 3OYHA 2A1SA 4Q45A 4YEAA 2OA8A 3PRDA 5E26A 4FXVA 3HP6A 4MKAA 1H3DA 1NSPA 3IBCB 4ZKAA 1IR0A 4GRSA 3CCUS 4RWXA 4LF6F 4CZLA 1BDGA 4J2EA 4F4KA 1DRZA 2EC2A 5CYJA 5L9XA 1ZC6A 3QJJA 2DTUA 1OYEA 2CADA 2DGOA 2J8SA 2X3GA 4PCQA 2AGQA 3AA4A 2VG5A 2IA6A 1K9MT 3CJ8A 2LEAA 3WEEA 3K5PA 2MLYA 3R5JB 1T94A 2HIQA 2QFJA 2PD1A 1VQKN 1NGDA 1AROP 3ULEB 1NEEA 4B17A 3MR3A 2MEWA 4K42A 4FS2A 2JWKA 1WI8A 1WD6A 4QCLA 2KHCA 3UVJB 1VQLN 2QM1A 3KG4A 5B09A 3EEQA 3DRPB 2E7WA 2EWSA 2J9DE 1SCJB 3KLEB 3MFHA 3AODA 1MWMA 3NVKA 3AY9A 2A41A 1M0SA 3T1HF 4URSA 1ZM3A 2KZMA 1OVYA 2F8TA 3WDOA 3HX9A 4DJBA 3GYNA 4OJ3A 1HRHA 5JVGQ 3PACA 3NGRA 1IG9A 1VSFA 4KV8B 2Z1GA 1T95A 2QSFA 5CHCB 2CWKA 3DGVA 2CJBA 1P1LA 4ZVHA 3QWPA 1HX1A 3JTOA 2ZJPL 3MEDA 3DLEB 2M2BA 5KG4A 1FHTA 2E8AA 4ILGB 1TVRB 1KVKA 4JLHA 3BO4A 2YWEA 4RW4B 2QRRA 4ENOA 4MDBA 3EDQB 1RZMA 3L7OA 2FPHX 2POKA 2I5JA 3R8YA 3O3GA 4CGHA 3ELHA 1U2FA 3HOTA 4OLAA 2W8KA 4LVNP 3U1MA 3MXJA 3FFKB 4YR3A 4BE0A