1SV5A

Crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse Transcriptase
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 131
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1sv5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1sv5A05
4CJ3A 2W7OA 3A2FA 4NCBA 1RA7A 4EZ6A 4ZPBA 3ITHB 3PR4A 2VG7B 3RAQA 1BQNB 5KRTA 3LANA 3LP0A 4GC6A 2J6UA 1C0UB 4CJPA 4L8RB 3KD1E 4GVMA 4TXSA 3TARA 1QSLA 5HLFB 2RKIA 4WXWA 2IM1A 2X6NA 4JUZA 3SV4A 4IH5A 4O44B 4F50A 3HVAA 4CK2A 1I39A 3ISNC 2XGPA 2HHXA 4ZMMA 4KPYA 4MKAA 3OLBA 3NGIA 4DG1B 4QW8A 5F8IA 4FYDA 4JV2A 3G6XA 3FFIB 1VK0A 3P1GA 3Q8RB 3OHAA 3OVNA 3M8PB 1VSMA 2HNYB 3DYAA 1UA0A 3QO9A 3LP3A 4DLEA 1U48A 1XI1A 4K4SA 4AHCA 2BR0A 4CGDA 1ZBHA 5F8HA 3CM6A 3ZT4A 3U3YA 3OYEA 4ZP6A 2UVWA 3N6LA 2IGIA 2YNGB 3BQ1A 2D3ZA 3KKSA 4QAGA 4URQU 2HVIA 4CK3A 1J53A 2BE2B 1S9GB 2AGPA 4ECQA 3TAEA 4J9QA 3M9OB 4FLZA 4FJHA 4DTJA 3H5SA 3UIQA 3AVJA 3U6FA 3HPGA 3V6DB 3M9NB 1RT3B 2JGUA 4H4OA 2R8GA 4NZ0A 1XHXA 4TYAA 4OPJA 1WSHA 3V9WA 3SI6A 3N6NA 4WZQA 2Q3SA 4HHTA 4FLVA 3DRSA 1S1TA 2OPSA 2BQUA 3GILA 4RW4A 2WRMA 4AILC 2Z1HA 1HARA 2FVPA 1Q9YA 2DFEA 3K59A 3QEWA 4ECXA 3EZ5A 1C0TA 3DLHA 4TSXA 1JLAA 1VSEA 4CHZA 3OYLA 5F8LA 4CFDA 2IJFA 1C2PA 3AA2A 2QKBA 2IC3A 3FDSA 3DDKA 1BIUA 3H2LA 1YTAA 2G8VA 4Q8EA 3SUQA 4XIUA 4O3QA 5J2NA 3I0SA 3HXMA 3BSOA 1QUVA 5DQGA 1CXUA 4MK7A 3DYAB 3QO9B 1SV5B 4E19A 4K4VA 4W5NA 4CECA 4KHMA 4WFZA 4RW7B 4CCHA 4RG8A 2BDPA 4Y1CA 5KFEA 4H4MA 4CEOA 5C25B 4ECRA 4ZP7A 4IFYA 5KG2A 4FJNA 3HM9A 4FZXC 2HMIB 4LSLA 3RMDA 2R7YA 4Z4IA 5CZ2A 2ALZA 3K5MA 5T14A 1XR5A 5KFAA 2B5JB 5EUHA 3BGRA 1JX4A 1JLGB 2I5JA 5HRPA 3QIOA 5KFZA 3S9HA 4FK4A 1ASWA 4IFVB 4C8LA 2X6SA 5EDWA 2FC0A 4H4OB 3ZSVA 1LAVA 2ZE2A 3ZCMA 1RILA 3RRHA 4DTRA 2XI2A 4JS5A 5EU7A 3KK3A 4QWBA 3MTKA 1DLOA 1VRTA 4KSEB 3KHGA 3DRSB 1S1TB 2OPSB 4YR3A 4CIFA 1T8EA 5HP1A 3RWUA 2R2SA 4RW4B 2KQ2A 2AU0A 5EWEA 4OJRA 3QYYA 1HJRA 4O0JA 2VA3A 2W8LA 3AVKA 1UAXA 4BDPA 4QOZB 3LWLA 4B8CA 1NK0A 2W7PA 3V81A 1BCMA 1C0TB 4TN2A 4AHRA 3QESA 5DLFA 3ZSWA 1HQEA 5K14B 4WYLA 4ECUA 1JLAB 4ECVA 1DTTA 4CEAA 4LY7A 1RT1A 4CF1A 1KHWA 4FJ7A 1L3UA 1KVBA 2OPPA 4B8AB 1GOAA 5L1IA 3L8BA 2HWHA 2HNDA 5KTQA 2FLPA 1C1CA 5J2NB 3I0SB 2KFZA 2C22A 3ULDA 2XI3A 3IRXA 4DL5A 3KK2A 1RYRA 1K1SA 1D9DA 4ELTA 3M8QA 1MU2B 4H4MB 1YT3A 4FM0A 3LALA 2JLEA 3Q8PB 2GV9A 1QSYA 3HVTB 5KG0A 4LSLB 4YP3A 3VQ8A 5KFFA 3IN5A 5I42A 1N56A 2ATQA 1IKYA 3BGRB 5L9XA 5DGAA 3I5AA 3OJUA 3D0PA 3MECA 3EPGA 2YKMA 1RT4A 4CFCA 4FXDA 2E9RX 1S9EB 1RDCA 2QKKA 5KFCA 3PW7A 1BCOA 4CEDA 3D5MA 1W0HA 4DQQA 3MAQA 2UVVA 1LWCB 4TQSA 2F96A 2XY8A 3VQ6A 1DLOB 4CE9A 3U3GA 1JLQB 4R0EA 5D3GA 2VG5A 4URSA 1NK4A 1XR6A 4O4RA 4YFUA 5HP1B 3I5CA 4E7JA 2HVHA 3DMJB 4NLQA 4AHTA 4EP5A 3T1AA 3DRPA 3VA3A 3OYHA 1ZTTA 1RDBA 2FBXA 2O5DA 3SCXA 3V81B 1REVA 3SYZA 2OPQA 4CIEA 1HQEB 2IM2A 2DFHA 4XO0A 1DTTB 4RNMA 4KREA 3O3HA 2R8KA 2G8FA 1RT1B 3OLAA 3V6JA 2ILZA 4FJIA 2UUWA 2IMWP 3OS2A 1C1CB 4DTSA 2G8UA 4FS1A 1U45A 3KD5E 4DSLA 3JSMB 3IRXB 4CJSA 3KK2B 3VQAA 3SQ4A 1S9FA 1T03B 3AVGA 3KK1A 5KG4A 3M8QB 1BGXT 2FVCA 1KSPA 3DLEA 4PA1A 4CGHA 4KHRA 1QHTA 3O3FA 1ZBFA 5EWGA 3RMAA 3CJ2A 2DY4A 5KFDA 5I42B 4Q8FA 4LD0A 4PWDA 3NGZA 4YR2A 4OGEA 4HUFA 4NLOA 5KFYA 4DU3A 3HP9A 5F9NA 2XO7A 3MECB 4ZPDA 2C2EA 1HPZB 1SUQB 2Z1JA 1RT4B 3GV5B 2BRKA 1RA6A 4FJKA 4TY8A 5KFHA 4J2BA 2D41A 3L3VA 1TAQA 1RTJB 3SPYA 3OYFA 1TV6A 1VRUA 3RRGA 3ZSZA 4IRDA 3T5HA 4KB0A 3SUOA 4K50A 5D3GB 4DTXA 2FVSA 5EWFA 3V6KA 4Y3CA 4EZ9A 3NAHA 1LW2A 3ALYA 3NGYA 3DI6A 3FSIA 4Z4HA 4IRCA 5F8NA 1JL1A 3ZT0A 1RT6B 3DRPB 4JV1A 1S97A 4Q45A 4NLGA 3K5LA 3JYTA 1REVB 4ELVA 2OPQB 4HYKA 5KT6A 4DFKA 2GIQA 5KG5A 4TYBA 2DPIA 1TVRB 3QNOA 3OL7A 5E41A 2C28A 4FJ8A 2PYJA 4IKAA 1X9MA 4NYZA 4EYHB 1T3NA 1IM4A 3CJ0A 1DTQA 1TKDA 4PUOA 4YQWA 3KIOA 4DLGA 3K58A 4KTWA 4DSKA 3PW4A 1WSGA 3KK1B 3E51A 3FFIA 4DL7A 3DLEB 2E6LA 4CJTA 4NCAA 2HNYA 4KI4A 4OKEA 4M3XA 4NLRA 3PJWA 4DFJA 3P83D 1VSLA 3ZSYA 4ZVGA 3OYKA 4I9LA 4QWDA 1YVUA 4PY5A 1NJXA 3RR8A 4KHNA 1J5OA 5DLGA 3AA5X 2ASJA 3SFGA 3IAYA 4Y2CA 3HSTB 4J9SA 4TY8B 4FM1A 3KNAA 1TV6B 2RF2A 1VRUB 4HCBA 3DLGB 1TL1A 5CYQA 2QXFA 4FCYA 4CJVA 3AVCA 1U04A 1JXBA 2HB5A 3SI8A 4C8NA 3RBEA 2BGGA 3DI6B 4CGFA 4BACA 3QEVA 4CJQA 3LP2A 3JYTB 4WYWA 4CJFA 1EKEA 2YV0X 4HCCA 4E7IA 2WK4A 2DFFA 3V9SA 4J2DA 1L3VA 5KT2A 3S3MA 5J1EB 1QAJA 3GIJA 2Z1IA 3TANA 4DQIA 1W9HA 3MEDA 4ZP8A 1WNEA 4ZVEA 2C2RA 1KVAA 4DL2A 3CM5A 4DTPA 3G6VA 1GOCA 3SUNA 3LP1A 2VA2A 2P1JA 4IG0A 1D0EA 1NK7A 1J54A 3MR5A 4MFBB 3AVIA 5HRSA 1DTQB 1J9AA 2FJVA 4MH8A 4PUOB 4KRFA 4W5QA 3ZT2A 3TR8A 3K2PA 4FW2A 4ED2A 3DOKB 3RMBA 1Z25A 3SUPA 2YNFB 4LH5A 1EETB 4JRPA 1SV5A 4HVJA 3PY8A 4FJLA 1JLCA 4ECYA 3CFPA 2V9WA 3QIPA 4RW7A 1N6QA 1LAWA 3AVLA 5HBMA 4ED6A 4CJWA 2ASDA 5C25A 1LV5A 5SZTA 3BREA 2LSNA 3ZSOA 4Z4EA 4MK9A 2JEFA 2HMIA 5KFRA 4ID1A 4I2PB 1J5OB 2FVQA 4ECSA 4KTZA 2XY7A 2XY6A 4CEFA 3PW2A 3KLIA 2B5JA 1BI4A 1RT7A 4B3OA 4B9LA 4TQRA 3CJ3A 1JLGA 4TY9A 1S4FA 5J2PA 2I1RA 3DLRA 2RF2B 2IM0A 4N41A 4H8KA 4F4WA 2R2UA 2UVUA 1TL1B 5CYQB 4IFVA 3S3NA 4KB1A 4KI6A 1EX4A 4Y34A 2FJXA 1HMVA 4FS2A 2UUTA 1TL3A 4OLAA 1WSJA 5KFUA 3IG1A 3SNNA 1T7PA 4AHUA 4FLYA 3V6HA 3LP2B 1HYVA 4URGA 3FQLA 2OA8A 4FM2A 1T05A 1UWBA 1BHLA 4AH9A 1WNSA 1R0AA 4E1NA 3LZIA 1S6QA 3E01A 3DLKA 3MEDB 4KAIA 4G3IA 3MEEA 1A5WA 1ZYQA 2G8KA 1NKBA 4ZTJA 4IR9A 4OL8A 5K14A 3LP1B 2G8HA 4K4UA 4IG0B 4F8RA 2B4JA 4CGIA 4F4YA 1S0NA 4F3TA 3DRRA 3CJ5A 2YHAA 3HPOA 1BQMA 1ITGA 2JEJA 4CJEA 2ASLA 2W42A 1RBSA 2HNZA 4EBEA 3ZT3A 3RB4A 4IKFA 1JLCB 3NH2A 4J9KA 1JLFA 3QGGA 4FLXA 1D1UA 1JLEB 3QIPB 4RNNA 2OPRB 2W9BA 1N6QB 5HBMB 3WNGA 1MU2A 2O4GA 4E7LA 1O1WA 4DTNA 3BSCA 3BR9A 4K4YA 1VSIA 3VQDA 3NL0A 3HVTA 1RBRA 1L3TA 3VQ5A 1FXXA 4NLDA 5KT4A 4MIBA 3KHRA 1IH7A 1S5JA 1WN7A 1NHUA 2G8IA 3KLIB 4Y1DA 2RN2A 1BI4B 1RT7B 4B3OB 3V9XA 3LPUA 4BWMA 3AV9A 1JIHA 3H5UA 3MFIA 4O3NA 5J2PB 2ZKUA 3PX4A 2XCAA 3V9ZA 1FKPB 1S9EA 1HMVB 4J9NA 1C6VA 1FK9A 3AO5A 1N5YA 1TL3B 3Q8SB 4ZVHA 3LAMA 1LWCA 3UPFA 3IG1B 2FBYA 3F73A 4BE0A 4EBDA 1JLQA 5DG7A 1RTDA 3DLBA 4K4WA 2QE5A 3C95A 3GIMA 2AGQA 4W5TA 3T3FA 4FJ5A 3KMQA 4HKQA 4ZVFA 3H4BA 2G8WA 1T05B 3DMJA 3VQSA 3NGDA 1UWBB 4FW1A 1IKXA 1R0AB 4E7HA 1NOYA 4QPXA 3N6MA 1S6QB 3E01B 3DLKB 1S0MA 4B9VA 3PZPA 2B6AA 4O4GA 3V1QA 3MEEB 4J2EA 3M9MB 3RB6A 3SZ2A 2D7SA 3IGNA 3OS1A 2IS3A 3NH1A 4NLUA 4AHSA 3DRRB 4O3SA 1BIZA 3KLHA 1KHVA 3L2QA 1BQMB 4N56A 2D0CA 3PX6A 5FROA 5KG6A 2R8JA 3AO3A 2HNZB 4F4XA 1GOBA 4M3RA 3JSMA 1Z26A 4YNQA 2YNHA 4NLYA 3ZT1A 1JLFB 1T03A 4IH6A 2W9BB 4CJ5A 3KJVA 5DG8A 4OKKA 5KFVA 1ZBLA 4F2RA 2AX0A 4CEZA 1D9FA 5JS1A 1XWLA 3DOLA 1VSJA 4IDKA 4CJ4A 3KLVA 2BQ3A 3SJJA 4KTQA 3ISND 3LAKA 4K4ZA 4DTMA 2FLNA 4ICLA 4BWJA 2WOMA 2VG6A 1TKXA 1VSDA 1MMLA 5C42A 4CIGA 1HPZA 1SUQA 3SQ0A 4U7CA 4O3RA 4NRUA 4J9LA 5L1JA 1NHVA 4CHPA 1FK9B 1N5YB 4CEEA 1RTJA 3THVA 3EZUA 4O5BA 1QTMA 4ED8A 1RTDB 3OYIA 4CHOA 2FVRA 3I5BA 4RZRA 2JEIA 5CY4A 5KT3A 4FJ9A 1SH3A 4W5RA 2VWKA 1IKXB 1RT6A 1EP4A 2B6AB 4WFXA 1RBVA 4O4GB 3GIIA 4IQXA 3CO9A 1WAFA 4J2AA 4CGJA 3TAMA 3OSPA 2IBKA 5FRMA 4OGCA 2HW3A 4CK1A 4DSFA 2V4QA 5KFTA 4CFAA 4RW9A 4ID5B 1TVRA 3KLHB 3L3UA 2HHUA 3LZJA 1U47A 4JS4A 2W8KA 5SWMA 3H59A 3S3OA 3MEGA 5KG3A 2GUIA 4DFMA 1UA1A 4EBCA 1RBTA 2YNHB 5KG7A 3F9KA 3AVNA 4H54A 3CWJA 5KFPA 2RPIA 4K8XA 4CJRA 2JC1A 3KJVB 3CDWA 4IOBA 5DQHA 3ZSRA 4CJKA 1U09A 3DOLB 3MF5A 4IDKB 1WSIA 3MXJA 1RAJA 1S6PA 3QERA 2Y1JA 1QS4A 3TI0A 4ICLB 2WOMB 2VG6B 1TKXB 1W25A 3L2WA 5C42B 3EY1A 2R8HA 4QCLA 2BQRA 3AO1A 1ZBIA 1RDAA 1X9SA 3H5YA 1TK5A 4FZZA 2R2TA 4J9MA 1ASVA 4DFPA 3O3GA 4Q5VA 2C2DA 5DQIA 3TAQA 5F8JA 3EPIA 2JC0A 4FLWA 2DTUA 3DLGA 1K6YA 4K4XA 2GC8A 1U4BA 5CYMA 4Z4CA 1Q9XA 4DS4A 3GV8B 3OSNA 4FZYA 1RBUA 5KFXA 2BRLA 4DQRA 3KLGA 4X2BA 1TKZB 4OPKA 3TABA 3HO1A 1EP4B 1I3AA 2F8EX 3PUFA 4OKJA 3TAMB 4E1MA 5JS2A 3H08A 5J1EA 1QAIA 3V9UA 3K5NA 4RW9B 1HYSA 4FVMA 1EXQA 5C24B 3UDLA 3MEGB 4FLTA 4WE1A 4IH7A 4FJXA 4NLPA 3VQCA 3C6TA 4MFBA 4NRTA 2F8SA 2CJQA 3TAPA 1L3SA 1RYSA 3HKWA 3RMCA 3DOKA 4CHQA 1KVCA 4M94A 2J6SA 2YNFA 2DPJA 4MKBA 2WTFA 4WZMA 3IS9A 1EETA 1RCHA 1KLNA 2PY5A 1A5XA 3OYNA 5KFWA 4FJMA 3K57A 4Z0UA 4B9NA 5C5JA 1S6PB 4FBTA 1BL3A 3OJSA 2IM3A 4CGGA 3WNHA 4DQSA 4KBIA 3RB0A 2IOCA 3QEXA 3DM2A 3T5JA 1NKEA 3OYBA 4I2PA 4Q0BA 1KFDA 1HQUB 2B43A 1IKWA 1ASUA 2WHOA 4M3ZA 2E6MA 4XPEA 2E4LA 1U49A 3BSAA 4LQ9A 3G6YA 3RAXA 3HJFA 3NFAA 3NF7A 3G10A 3VQEA 4DQPA 5CYMB 2HWIA 2RDIA 4DWIA 3V1RA 4CFBA 1XR7A 2ZQBA 3C6UA 3KLGB 2AGOA 4G1QA 4BDYA 4O55A 2UVRA 2EHGA 3OYGA 2X74A 3UQSA 3V4IA 4IBNA 2GBZA 3HT3A 4KV8A 2ITGA 1CZ9A 4DEZA 4E7KA 1D5AA 1HYSB 3HVWA 1KRPA 4F4KA 3QINA 2KFNA 4LSNB 3H98A 4J9RA 4WE1B 3C6TB 4EO6A 2Y1IA 3H40A 4Y2AA 4BE1A 1Z4UA 2F8TA 4NCGB 5KFBA 4EEYA 3NF8A 3KLFB 3IS9B 3TAFA 3HPHA 3WNEA 1S0OA 1JLEA 2OPRA 4I7FA 1LWEA 1JXEA 1XC9A 2ZD1B 2E9TA 1RT2A 3PR5B 1IKVA 3CVKA 4O3OA 3DM2B 2XWYA 1S1WA 4JRQA 3OYDA 5KRSA 4KHSA 5KG1A 5F8GA 4Q0BB 4ZTFA 1KCFA 2W9AA 3QEIA 4M41A 4NLSA 4I2QB 4ZPAA 1IKWB 5KFSA 1JLBA 4J9PA 3MFHA 1RT5A 5DGBA 4KKOA 4DF8A 2XY5A 1FKPA 4FBUA 4CF8A 4RU9A 3VQPA 1HRHA 2AWZA 1S1VA 5HRNA 3M8SA 2HAIA 3C6UB 4RNOA 4DMNA 4G1QB 4EP4A 2QV6A 4NLVA 4ED3A 2ETJA 3AVAA 4CEQA 4PQUA 3V4IB 4KV8B 4DTUA 4NYFA 4OLBA 3ICLA 3PW5A 3OL6A 2D0BA 1L5UA 3G0ZA 5I3UA 5J2MA 1FKOA 4M95A 4KHWA 3PO5A 1WSFA 3AO4A 3B6OA 3LP0B 4FLUA 3KLEA 4ECWA 3SFUA 2RKIB 4MK8A 3MXIA 2V4RA 5DMRA 3CIZA 3KHHA 1S49A 4LQ3A 3PHEA 3NH0A 2AQ4A 4NYNA 1C0MA 1YTUA 4QWEA 4FK0A 4I7FB 1LWEB 4KHYA 2WONA 1Y97A 4DU4A 1RT2B 3AVBA 1IKVB 4N5SA 1I6JA 4HUEA 4JLHA 4GW6A 1S1WB 2FJWA 3GYNA 3HYFA 3FQKA 3T5KA 4DF4A 1A5VA 4KHUA 4AHVA 1S48A 3VQ7A 5KFGA 1JLBB 2JEGA 1C1AA 3CYMA 1RT5B 4NLXA 4CERA 3D45A 4ED7A 4KKOB 3L2RA 4F4ZA 2R8IA 3L2UA 3NCIA 3PV8A 5HRRA 3WNFA 3OY9A 4CF2A 1S1VB 3IGVA 3M8RA 1YVFA 3VA0A 3OYAA 1X1PA 3QIDA 2ILYA 3LPTA 3TWHA 3RR7A 4F3OA 4B9TA 4RW8A 3CQ8A 5KFNA 3BDPA 3BQ2A 1RTIA 4PQUB 4FK2A 3HHKA 2FBVA 5JXSA 1GX5A 3OYMA 4E89A 2IAJA 2P5GA 3H5XA 5KFQA 5FDLA 4DL4A 3AVHA 4E0DA 4QWAA 3NDKA 4CF0A 4EO8A 3KKRA 1BISA 4LH4A 5I3UB 1SL0A 2EX3A 3ZSQA 5J2MB 5J2QA 1CSJA 2NUBA 2A1SA 3VQQA 1S1UA 1FKOB 3BQ0A 2X78A 1JXLA 4CHYA 3NAIA 3CG7A 4ID5A 1NKCA 3KLEB 1NJZA 3RTVA 3OHBA 3OS0A 4CJUA 4HUGA 3LDSA 4DL3A 2QK9A 1LW0A 3VQ9A 5FRNA 4CJLA 3PVXA 4B9SA 4KE5A 2WONB 4RNFA 5DG9A 2IC3B 4M3YA 4C8OA 1NK5A 3SPZA 3H4DA 3I0RA 2XCPA 2KW4A 3B6PA 1RTHA 1C1BA 1G15A 4Z4FA 2R2RA 2D3UA 5KT7A 1D8YA 1S10A 3ASMA 1NJWA 4DS5A 4IG3A 2XGQA 2GIRA 3TVKA 4GMJB 1TP7A 2VWJA 2KTQA 3G86A 4IFYB 1KLMA 4DSIA 3NKYA 4BDZA 1SKWA 4JV0A 2D0AA 1RDDA 3NF6A 3CDUA 4E3SA 3MXMA 1IG9A 3BJYA 1NK8A 1TGOA 1JKHA 4I9QA 2OH2A 2WCXA 2I5JB 1QE1A 2FLLA 1OS5A 4DU1A 4RW8B 5L1LA 5CZ1A 4ZPCA 1HNIA 2OZSA 1RTIB 5KI6A 5KFIA 5KFMA 2IJNA 3GQCA 1UOCA 1TQLA 2OZMA 2IAJB 4TLRA 4M42A 1TKZA 2ZE2B 3HK2A 5FDLB 4ED1A 4BE2A 2YNIA 1TK8A 2EC0A 3PO4A 3ZSXA 4DTOA 2PYLA 3KK3B 4K8ZA 1NK9A 1VRTB 3PW0A 2Z1GA 1F21A 4QWCA 3QGIA 2CKWA 1SL2A 3HL8A 4RW6A 3CDEA 5J2QB 3OL9A 1KTQA 4DL6A 1VSFA 1K1QA 1S1UB 3C94A 1ZTWA 4ECTA 1T94A 4B9MA 5C24A 1CZBA 5F8MA 3CJ4A 2HHWA 1LWFA 4M45A 1SKRA 5KFOA 1LW0B 3AA3A 4ZHRA 1WSEA 1ZBUA 3TAGA 5L1KA 4KB7A 2D5RA 4KFBA 2BANA 2OPPB 4W5OA 4J9OA 2E9ZA 4M3TA 3NAEA 1IO2A 3TQ1A 2HNDB 3QLHA 3NBPA 3I0RB 4R5PA 2HHTA 4KAZA 1RTHB 3AVMA 1C1BB 1VSHA 2RDJA 3Q8QB 4IR1A 3MR3A 4B9UA 4GC7A 3AO2A 2P51A 1HNVA 4K4TA 1VSKA 4IG3B 1GX6A 2A1RA 2KZZA 3QZ7A 4WFYA 2V0NA 5KGXA 1CLQA 2O4IA 1ZETA 3CFRA 1KLMB 1XHZA 3D28A 2PZSA 3VQBA 5KFKA 1HQUA 1TAUA 2IA6A 3KOAA 4MQ3A 3QZ8A 3AA4A 1JKHB 4CHNA 3T5LA 4M3WA 1IKYB 4RNHA 4Z4GA 1Q8IA 4Q44A 1QE1B 1WLJA 5DK5A 1TKTA 1S1XA 3KMSA 1HNIB 4B08A 2YKMB 1NOZA 4KO0A 3OL8A 1CXQA 2W9CA 3NHGA 4XPCA 3BSNA 2YNIB 4R8UA 3VQ4A 2YKNA 2AX1A 3T19A 1N48A 1NJYA 2HHVA 3MR6A 2VG5B 5KFLA 4RW6B 5KT5A 3NMAA 3OYCA 1TK0A 4DSJA 3PX0A 4ED0A 5HROA 3O4NA 5F9LA 2WB4A 2ATLA 3QETA 4LSNA 4CEBA 1LWFB 3HVRA 3ITHA 2VG7A 4RUAA 1QSSA 1BQNA 4IRKA 1SL1A 4ZHRB 4Q43A 1C0UA 3QGHA 1B9FA 3QNNA 3GIKA 2YHBA 2FBTA 2OYQA 4KFBB 5HLFA 1SH0A 2XRIA 2BANB 4ZP9A 3P5JA 4NCGA 4ECZA 3KLFA 4EYIB 4YR0A 4O44A 3QLHB 1RNHA 3NBPB 4R5PB 5KGWA 3L2VA 2XHBA 4UQGA 1N4LA 2HHSA 4O0IA 2ZD1A 1HNVB 4DG1A 3RBDA 4ELUA 3VN5A 4FJGA 3NF9A 2IDOA 4CESA 4OVLA 1QQCA 3SQ2A 3AVFA 1KFSA 3M8PA 4RUCA 1HYZA 2P5OA 5JUMA 1JL2A 4DSEA 1SKSA 4M3UA 4KHQA 4FJJA 4N47A 3EYZA 3SQ1A 3CFOA 4I2QA 2AJQA 1B9DA 4PWDB 1WAJA 4NLWA 4HTUA 3LWMA 3UR0A 1TKTB 1S1XB 4U6PA 2YNGA 3NE6A 1NNDA 1B92A 3HP6A 2BE2A 4KO0B 1S9GA 4WXOA 1NK6A 3GV7B 4NLTA 4YMEA 3K5OA 4QW9A 4C8KA 3SV3A 4MIAA 2W9CB 3RB3A 3I8DA 1RDRA 4F2SA 3OYJA 4R8UB 2YKNB 4O3PA 2KZMA 5T7BA 5KFJA 2J6TA 3MR2A 3V1OA 3V6DA 3O4QA 1RT3A 3FRZA 3PJXA 1X9WA 1SH2A 3KHLA 1LW2B 2HHQA 4C8MA 3QEPA 4CF9A 4N76A 5HROB 2XC9A 3KTQA
chains in the Genus database with same CATH superfamily
1FNXH 4CJ3A 3A2FA 1RA7A 4EZ6A 3CPEA 4HHHA 1WBDA 3ITHB 2D0OA 2IMOA 1NSQA 2ZJRQ 1S57A 3O3LA 4TXSA 3U27A 2HYIB 4WKRA 4FWPA 4DV0F 1QSLA 1N33J 4DPXA 1PO6A 2J0QD 4F50A 1I39A 3ISNC 3W60A 2XGPA 2CQ3A 2D0PA 4MKAA 3SCLE 1HHTP 1WSRA 5F8IA 2X1GA 4OZ0A 1DARA 4FYDA 1RGIA 3G6XA 1VK0A 3P1GA 3Q8RB 1H72C 1MROA 3QO9A 3MN7A 2E29A 4DLEA 3E3XA 4K4SA 4W90B 3OTCA 2MY7A 3C46A 3FC9A 2FD2A 5F8HA 2LDYA 1WOSA 2NSCA 1NWKA 4PG6A 3M5RA 1VBZA 2MXYA 3N6LA 2RD5C 2IGIA 3CCSN 3KKSA 4QAGA 5JMVA 2CA9A 4CK3A 3K17A 2BE2B 1S9GB 5BPMA 1NSAA 3RG6A 1WTFA 4FJHA 3N5BA 4JAXA 3T9ZA 3C0BA 1GMWD 4P2MA 4C9DA 3BF3A 4V1Ak 3LGNA 2ZH2A 4DR3K 2YKQA 3QFPA 2MLYA 2B4PA 3AJDA 3O2IA 2OD6A 4JI6J 3AY9A 1U2VA 2UU9K 1WSHA 3V9WA 3SI6A 4P52A 3N6NA 1O6XA 3LDOA 2Q3SA 3C65A 1FRMA 2ASYA 2ZKTA 1SQGA 2HFZA 4HHTA 4FLVA 2HPUA 3O1BA 2OPSA 2VH7A 5LMNK 3GILA 1YUWA 2WRMA 3D67A 3CCRN 1ZZFA 5ADXH 2DFEA 3QWUA 3U1NA 3WIUA 2QA4S 3JQKA 4DB3A 5B0EA 2UUCF 1TMJA 3U1LA 3OYLA 2HHHF 2DGQA 1K47A 1C2PA 4E98A 3DDKA 1AROP 1FESA 3K8WA 1BIUA 5GMKa 1VJWA 4OZ5A 4Q8EA 4O3QA 3MAAB 3BSOA 2A40A 4RPFA 1TYQA 4E19A 4W5NA 3ENBA 2DEJA 2WVDA 4CECA 2QW9A 4RW7B 2DR8A 1GLEG 1GH8A 1BU6O 5B09A 2FGCA 4ECRA 4IFYA 5E3RA 4FJNA 4JI5K 1E6VB 2DVIA 3M8ZA 2LYVA 1MLAA 4AXJA 1JLGB 2I5JA 4K59A 1ELOA 2MTLA 1ASWA 4IFVB 4C8LA 2GMLA 4N8OA 1WACA 3ZSVA 5TKWA 2NCKL 2Y9HA 4B3MK 5B08A 3CI5A 1PG5B 2XI2A 5K8OA 4L72B 4J7CA 2V8PA 3PIPL 1YJRA 4QWBA 2ZGZA 4MTPA 3CCUS 2R7TA 2Z58B 2E5GA 5IT9O 2KT3A 1YIJS 4CIFA 5AE3A 3O9SA 2KJVA 2R2SA 3BBFA 2AU0A 4PL8A 5EWEA 2M8HA 2OELA 1HJRA 1RAAB 3MWPA 3AQPA 3TEGA 4OX7A 4B9QA 3LWLA 3U02A 3GZ7A 1NK0A 3V81A 1BCMA 3ZSWA 3GYGA 2HZVA 5BRHA 4WYLA 4ECVA 1ESVA 3WQUA 3AJ1A 4CEAA 2CJAA 2HZAA 5ETKA 1V9OA 1XNRK 2HWHA 4ZVPB 2FF6A 3POTB 2V68A 3R7BB 3ULDA 4DL5A 3KK2A 2QSWA 3W2WA 2YWFA 3AY0A 3U7JA 3RU0A 3M2UA 2DHAA 4C1NK 4H4MB 2L08A 4YORA 4IJAA 1HQ2A 4FM0A 3BKUA 4FSVA 1QSYA 2UXDF 3OUYB 4WP8A 3HHLB 4DV4J 4LSLB 5A2QU 4YP3A 3VQ8A 3TZZA 5KFFA 2MKCA 4JI8J 1N56A 1IKYA 2M70A 3BGRB 3DGPB 2KYZA 4X4UA 3IBFB 1KDNA 2RRBA 4CFCA 1TUGB 4P74A 4ZCMA 2GX9A 2B9YA 1RDCA 1M0SA 2IVYA 5EOYA 2DNOA 1BCOA 4CEDA 2GHPA 2GA7A 4JHDA 3MAQA 1LWCB 3IM8A 2F96A 2XY8A 3IC1A 2XZTB 1MWKA 1WF1A 4R0EA 2ZBQA 5DDQC 2VG5A 4URSA 1HBMA 3MM8B 4OI2A 2PC6A 3MPDA 2F9WA 5HP1B 3I5CA 2DNKA 1EWQA 2G1HA 4KH5A 1IG8A 1IBKJ 3CJSA 3IM9A 4M5KA 1RDBA 3DWLA 2E5HA 4OYWA 2OPQA 2IM2A 3OTOJ 3GJSB 3D2EA 3O3HA 5A6WA 4B3RJ 3SAGA 1RT1B 3V6JA 2MKYA 1EX8A 4CLTA 1RWNB 2ILZA 3OT9A 4FJIA 3AFGA 2DIUA 2FHMA 3WEEA 4CLUA 1QAYA 5D6GA 3I6PA 4FS1A 2XLKA 4LFBJ 1U45A 4K43A 4CBXA 3KD5E 3JSMB 3IRXB 4CJSA 3CMAS 3CCZA 4W98A 3SQ4A 2UUBF 3R3LA 3NNAA 2KXNB 1J5EJ 3M8QB 2FVCA 2AYEA 4ILRA 4DV3J 1HNWJ 1QHTA 5C2CA 5HN0A 2IDEA 5G0RB 4UOCA 2OSQA 3NGZA 4YR2A 4OGEA 2XMVA 4NLOA 4DU3A 3HP9A 4FKXA 5F9NA 2XS2A 1G3OA 5DM6Q 3CJTA 1LEOA 5MAOA 5D8HB 4LIRA 2EC2A 3GV5B 1VQNS 1V6HA 2ZHOA 2D3OR 2JRSA 3KNGA 3R9PA 4HR2A 2DNHA 3L3CA 2D41A 1DQ8A 2E1PA 3VVUA 3ZSZA 3T5HA 2NSBA 1U2FA 2DD8S 3AOBA 2IIRA 1EQ0A 1LW2A 1ITPA 1EKRA 4IRCA 3SCIE 5AQLA 1FJ7A 3DRPB 4JV1A 5CZVA 2QA4N 2KG0A 4DX8H 5KPRA 1RDWX 3HLUA 4DFKA 4DV7J 1IBLJ 1V5VA 1CVJA 4DV1J 4NLBA 1SJ4P 5IFMA 4M63A 2HF4A 3S41A 4QIWD 4RUBA 3P6YC 4IKAA 1X9MA 4NYZA 2V67A 4FF2A 3DCAA 3CJ0A 1JNRB 4OI1A 4PHTX 4LFCF 1KWMA 3KIOA 2R7RA 4DLGA 4KTWA 3E9OA 2Q79A 2E6LA 4CJTA 3MX2A 4CLLA 3F56A 4M3XA 1UW4A 2CQCA 3MXHP 1A7GE 1VSLA 4ZVGA 3W5XA 1NMDA 4I67A 4NZ7A 1XMOJ 2DR5A 4I9LA 4QWDA 3GFXA 1F0XA 1S99A 2V50A 4KHNA 1J5OA 4E2FB 5DLGA 2EFNA 1T6DA 1T9VA 2FZKB 2R7SA 2MGZA 3AA5X 1T95A 2IVMA 4B1UB 1PILA 3HSTB 4YB1P 5E3QA 4CLFA 1ZZNA 3KNAA 1TV6B 5GADP 2RF2A 5HOOA 2GVDB 2I8EA 3MPWA 3DLGB 1R3NA 1YIJN 3ENQA 2V52B 4FCYA 4NXMJ 2PT0A 3AVCA 1JXBA 4QIEA 2BGGA 3DI6B 4CGFA 1BA1A 2YKPA 4PXEA 2XYGB 4WYWA 1RDUA 4ZOSA 4HCCA 4E7IA 2WK4A 2DFFA 4DJBA 1L3VA 1IBMF 1ZM3A 1CQNA 5LOQA 3CTRA 3TANA 2XNQA 3AOAA 3QICA 2GIFA 1JMTA 2R4FA 4DL2A 5LJVA 5GAEU 1NBEB 1NK7A 3T6BA 4W5QA 3ZT2A 4R79A 4FW2A 1PJ6A 2ZJPQ 3MOJB 3RMBA 4BC5A 3NS7B 4LH5A 1SV5A 1ZA1B 1JLCA 2V9WA 3EGVA 3W1YC 3AVLA 3VF2A 3D1QA 5CAAA 2WBMA 1HR0F 5SZTA 4PZVA 2V8GA 4NE9C 2Q36A 3BREA 2G2YA 4MK9A 1CZAN 5AQYA 3US5A 2HMIA 1H2UX 2FVQA 4KTZA 3PW2A 1YVNA 3ATUA 4OYIA 4B3OA 1Q4RA 4P72A 3ZZUA 1ACMB 2X3DA 1W2BM 3DLRA 2IM0A 4N41A 4F4WA 2UVUA 2VFTA 1UWAA 2QZ8A 2FJXA 1LFWA 4N8NA 2YX7A 4QOTA 2ZBPA 4DR4J 3SNNA 1OKJA 3BH6B 4FLYA 1F9FA 3OXGA 5AQGA 3LP2B 3HI0A 3ULEA 2OA8A 4FM2A 4G6VB 1T05A 1PC5A 1YITS 4AH9A 1WNSA 3CJRA 3JQMA 2LXIA 3VTHA 1S6QA 3DLKA 2J76E 4G3IA 2G8KA 4ZTJA 4LR8A 5B0CA 5K14A 3LP1B 4K4UA 2B4JA 4M63C 4RCHA 2I6WA 2P9UA 2N82B 1U6BA 4WIIA 4Y2IA 2W42A 3N28A 2VD3A 2VGNA 2HNZA 1CULB 4EBEA 2MKSA 3ZT3A 4IKFA 1JLFA 3QIPB 1IR0A 3WNGA 4E7LA 4DTNA 4BRKA 4K4YA 3HX9A 4KGZB 3NL0A 3HVTA 1Q8BA 4CP5A 1L3TA 3VQ5A 2O8FB 4MIBA 4M1KA 1VQNN 3FUYA 3QFUA 2EFOA 5D4NA 4JI2J 1R6VA 3M32B 3LPUA 2BJ8A 3R5JB 2HWTA 2UV8G 4WTYA 5J2PB 2ZKUA 3GR0A 1UVNA 4FVUA 2LEBA 1FKPB 3OTEA 4J9NA 3QGPA 1TL3B 5E3AA 3NGTA 3IG1B 5T7LA 1CS4A 2FBYA 5MLCQ 2W2OP 1T02A 1JLQA 2AJ0A 5E0OA 3T3FA 2X51A 4DV0K 3FR0A 2M4MA 1RFQA 3DMJA 1RI7A 3P31A 1OVYA 2LCWA 2EFQA 4DV6J 1IKXA 3VAIA 3E01B 3MGJA 1KC8O 2GMHA 3OFHA 4J2EA 4UTGA 3M9MB 3KJQB 1U8SA 2Q1LA 1AFJA 1FFGB 5GMEA 3ETOA 1VS3A 4O3SA 5LL6Z 1KHVA 2OD4A 3EUNA 2ITMA 3EX7B 4IEIA 5F1XA 5KPTA 5KG6A 2R8JA 1FEHA 3L6QA 1MN7A 1Y00A 1GOBA 2J4RA 4M3RA 4LFBF 4LF9K 3SQGA 4XK8C 2MKIA 4NLYA 4IH6A 3NNCA 2W9BB 3A3NB 4M5MA 3IKMA 4YB7A 1ZBLA 3TTFA 1XWLA 4K2XA 4IDKA 4CJ4A 3KLVA 1KP6A 2BQ3A 4UZCA 3LAKA 1D8ZA 3FGUA 1Y10A 2VG6A 1TKXA 3RJMB 2DH9A 4ENOA 1QHAA 1VSDA 1VQ8S 4ZCKA 4RU2A 1HA1A 1SUQA 1I1GA 3OA9A 3J7ZO 4O3RA 4NRUA 1YWXA 4OPAA 1FK9B 1N5YB 1P1LA 2MJUA 3NGKA 4O5BA 5AQUA 5AE2A 5F41A 1QTMA 5D78A 2DBBA 4KJIA 5AQFA 4XTTA 1KAXA 3OYIA 3MOZA 4C11A 2HBMA 2P9IA 4FJ9A 2NQPA 4EWTA 4W5RA 2VWKA 2GNKA 3M7VA 3SMSA 2YVSA 2B6AB 2IDLA 4O4GB 3GIIA 3CO9A 2U2FA 2H5IB 2HHHK 2FZCB 2IBKA 3KUHA 2KI2A 2NXEA 1U1KA 1CJTB 2DNQA 4DSFA 5KFTA 5H9FK 4DV1F 4RW9A 4ID5B 3KLHB 2HHUA 3LZJA 1URRA 1U47A 4JS4A 2XMUA 5M2RA 1VQ6N 5SWMA 5KG3A 3MEGA 3HDSA 3QFWA 1D3WA 2RHQB 1R7IA 3BZQA 1UA1A 3HMJG 1H6KX 2R7VA 1RBTA 2YNHB 3F9KA 4H54A 2LLZA 4K8XA 4FPRA 1GQEA 3LQVA 3T1YF 3EN9A 3KJVB 4USWA 2O8EA 1UETA 2H5JB 2F4VJ 5DQHA 2VJUA 2RQMA 3DOLB 3MF5A 3MR7A 1X0PA 1GLCG 3A8YA 1XMOF 5C15A 3KJNB 4UZBA 3EY1A 2HQGA 2BQRA 1RDAA 3K9KA 4MYUA 5CH7B 3O3GA 4Q5VA 2C2DA 5DQIA 3TAQA 2LU1A 3EPIA 2H3EB 1NXIA 3D6FB 2VJVA 2DTUA 2RU9A 1K6YA 2E5LJ 4B02A 1JK9B 4ZVTB 4M5JA 3VWSA 4IO8A 2Y0BB 2CYYA 1YITN 1X4AA 2BRLA 1ICEB 4CH1A 1N8RO 1TKZB 3TABA 3VHQA 2CQ4A 4LF5J 1E4GT 2DXDA 1I3AA 4A8OA 2HFOA 1UFWA 4HI1A 3PUFA 4OKJA 2WTUA 4AXIA 5CHIA 3MURP 5J1EA 3MPVA 1Y7PA 2EWSA 5RUBA 2M52A 1HYSA 4Z7YA 1EXQA 4F7VA 2W4CA 3UDLA 1PYTA 4IO1A 2V6AA 3CCVS 1NCLA 4DUZK 5D4PA 4JI3F 3GBTA 4IH7A 4MFBA 4NRTA 2F8SA 2RUGA 1L3SA 1QJHA 1XBWA 2VASA 2IRYA 1VMBA 2UXDK 3DOKA 3W2VB 2VZ9A 2J6SA 2YNFA 5C2GA 2P9SA 3IS9A 1EETA 2GAGC 3NS5A 2CPIA 2PY5A 4LBIA 4X65J 4U8VA 4M7YA 4PQAA 2C3OA 1N36J 5BR8K 1J2VA 3OJSA 1MG7A 4KBIA 3JB9k 2YJEA 3DM2A 4DR6J 1NGAA 3M8YA 4NXNJ 5GMDA 3UO0A 4OIXA 5D4LA 1CG2A 1BHNA 5LL6d 5CD4A 1NM1A 1FE4A 1ASUA 2WHOA 2E4LA 2IA0A 2C3YA 2CQ1A 4FWRA 5M2UA 3RAXA 4CZEA 2X1FA 5CYMB 1U1OA 1L3KA 3G25A 1FDAA 1VRQC 1H98A 3W0LA 2ZQBA 3C6UA 3LO3A 2AGOA 4CD3A 4WP9A 4DR4F 2ZZNA 2DITA 2X74A 3V4IA 5HQLA 4KV8A 2CZ9A 4CLZA 2HVZA 2YJFA 3W5YA 1ZM9A 2QLJB 4NWBA 3EE8A 3PHTA 1D5AA 5T41A 4X4NA 3HVWA 3SEOA 4ETZA 3M6VA 4LSNB 3UE2A 2VKZG 1WG4A 3MMVA 2UUBK 4DX6A 2GWKA 3PYGA 3C6TB 3HHDA 3H40A 3FZ2A 1KQSR 5A8RA 4ZN1A 1U0HB 3F41A 1YSJA 3FFKB 3JS6A 3I56S 1QVFR 4IYQA 1FJGJ 4PKIA 1H7WA 2RSQA 5ETNA 2YX6A 4JI0J 3JTNA 1KNZA 2H65B 2VC0A 1JLEA 2OPRA 4I7FA 3UNGC 2ZD1B 4KGXB 4I6AA 3QBWA 3PR5B 1ROFA 4A8FA 1VQ8N 3SAHA 3ET6A 2ZH1A 2HQDA 3JXOA 2YX4A 5A8WB 3IWLA 3M30A 2P9LB 5KRSA 1WC3A 2KHOA 2UXCJ 4NLSA 4ZPAA 1VQ5S 1IKWB 1WF0A 1G6BA 2EKYA 2QYCA 3GFYA 3VEYA 1FERA 3GMGA 5DGBA 2GO9A 4DF8A 1X4FA 1VOMA 3WX8A 1HRHA 2CNKB 2AJ1A 5HRNA 1HBUB 3SBTA 4LF6J 4RNOA 3RBXA 4JI1J 5AFUA 4EP4A 3HHLD 1KBRA 2MZRA 1TFWA 2E2OA 1RHRB 2WVFA 2WBNA 1YBUA 3DXMA 3F2KA 4Y0WA 4DV6F 1N33K 1MWQA 3FCWA 4LBHA 2D0BA 1LCUA 3SBGA 4LFCK 2V2QA 4KGVB 5FD1A 2XQCA 1XNQJ 5IWAF 4M95A 3LM9A 1SVDA 3PO5A 1KEKA 1WSFA 2VFUA 3AO4A 3B6OA 4FLUA 1SAZA 3L9ZA 1ZPWX 2CPYA 5DMRA 2FUG9 1S49A 2AQ4A 4OX9J 1RAGB 4H5TA 1LWEB 2RUSA 2VC1A 2YQ1A 4DU4A 4LVNP 1RT2B 2QLXA 4N5SA 3F0NA 1Q78A 2Q43A 1ZA2B 4H0PA 1UJ4A 1JCGA 1S1WB 1GMWA 4CO5A 1KOOA 3GYNA 3EM1A 3HYFA 3BEXA 1S7HA 2NPFA 4OZ3A 4QQBA 1C1AA 3AAWB 1RT5B 4NLXA 2GJFA 3FZHA 3D45A 5C10A 2R8IA 3UNYA 3NCIA 4JI6K 3IGVA 3I31A 3L09A 1X1PA 3LPTA 4FZVA 3VALA 3G8QA 1RTIA 1GX5A 1WOOA 4E89A 3UDCA 1LXNA 2QWPA 2MQOA 4DL4A 4H0XB 4G1IA 1HD0A 1FRKA 1HWLA 3BEGB 2PFUA 4LF4J 1UP1A 1NJIT 3CCVN 1DURA 1FKOB 2X78A 1DFDA 1JXLA 4CHYA 2B7BB 1RUSA 3VENA 3R27A 1NKCA 3KLEB 1NJZA 2KT2A 5KOWA 3PYFA 4OI3A 3NVMA 4HUGA 4LFAF 5U47A 3SDEA 5FRNA 1XK8A 2UUAJ 4X64F 1FT8A 4C8OA 1M5KC 3FRYA 4FYWB 4Z94A 3OR2B 3H4DA 2ZVIA 2D1KA 3P4UB 2N3OA 4D3GA 2KW4A 3B6PA 3T69A 2R2RA 3BGUA 1I94J 2YWGA 4ES2A 5M1NA 4W4MA 2YWWA 3CC2S 4GO7X 2RS2A 4GMJB 4IFEA 4FL9A 2GHWA 3HZGA 4Q2MA 1U26A 4AF1A 2D0AA 4KH4A 3CDUA 4CZJA 2O8DB 1IG9A 3BJYA 2UXBJ 1JNZB 4LF7J 1TGOA 4I9QA 1Y3KA 1TL7A 2FLLA 4DU1A 2P9NB 4ZPCA 3G6ES 2DXEA 3CCWA 3L4IA 5B0DA 3CD5A 5ITHA 3GWCA 2OZMA 4IO9Q 4DR5F 4OI0A 5FDLB 3R2DJ 5AT1B 3OHRA 4DTOA 2PYLA 2MB0B 4U96A 1S76D 4JYAJ 3PW0A 2YTCA 2CKWA 1SL2A 3J7A1 3CDEA 5J2QB 1KTQA 1K1QA 1S1UB 2DNLA 2GTDA 1ZTWA 1X31C 2XBPA 3I82A 1NLVA 1T94A 3L95X 3BGLA 1JQGA 3I56N 3QDKA 4FWNA 3FZLA 1HBOA 3CJ4A 1NGCA 1XMBA 1LWFA 2M9KA 2ZHBA 2YWHA 1LW0B 3AA3A 3HSZA 5HVHA 2F1FA 1LK5A 5L1KA 2AA4A 3EEQA 2D5RA 4WQ5A 2OFGX 2DCUB 4W5OA 2E9ZA 2R7XA 4DV4K 4M3TA 1IO2A 3TQ1A 3QLHA 2G2OA 4R5PA 4TU8A 3UKUB 4KAZA 4GKKJ 3TOQA 4JI8K 5A2QY 4AD6A 4O8UA 4AQYJ 1U25A 5K5MA 1SBRA 3MR3A 4BREA 4GC7A 1VQKS 5BPNA 2OANA 1VSKA 1N36F 4PXCA 1VQ5N 4QR2A 2KZZA 3QZ7A 2V0NA 5KGXA 4ZLNA 1KLMB 4JI4J 1JCEA 1HQUA 3GJRB 4XH1A 4MQ3A 3AA4A 1F5AA 2P9EA 4CLYA 3T5LA 4Z4GA 1TKTA 1S1XA 1M5HA 2YKMB 4OJHA 2W2MP 3X1LB 1IBKK 4BY9C 3H42A 1G4CA 1H1VA 4XPCA 4PXBA 2W40A 3VQ4A 4L73A 2YKNA 3OTOK 1GLDG 1NJYA 4JI7F 1OIAA 4CYUB 4B3RK 4P2SA 1RISA 4X4VA 1R59O 3NMAA 3QT7A 3NGUA 1FXLA 1Y11A 3O4NA 4JD2A 3SMZA 4LFBK 2ATLA 4CEBA 3HVRA 2VG7A 1HWUA 1J5EK 1SL1A 4IRKA 4Q43A 1Y0HA 3QGHA 2VDHA 4DV3K 1HNWK 3KG0A 4DR1J 3KLFA 4EYIB 3R3TA 4UY8O 3L2VA 2X3GA 2HHSA 3DDIA 3VEXA 4O0IA 3B54A 4OJ1A 2B8QA 2HG4A 3NWRA 3NF9A 4ZIWA 3R1XA 2IDOA 4P73A 4OVLA 1KFSA 4YOWA 2P5OA 5ETVA 4UW2A 2DHXA 3UB5A 4PG5A 4LRBA 4YHHJ 4OX8A 2P9CA 2LVWA 2AJQA 1WAJA 4QIVA 3UN3A 2XLJA 1UTAA 4U6PA 4BRQA 3E8OA 3BZKA 4KO0B 2OIHA 1W26A 4NLTA 2PA3A 2W9CB 3RB3A 2Q66A 4PKGA 3DNCA 2DR9A 3UDEA 4JNEA 2CH6A 4DV7K 1IBLK 1T9YA 5CCMA 3V6DA 4DV1K 2A41A 5ETMA 1RT3A 3GTYX 2HQCA 3PJXA 3UD3P 1V4SA 3P4IA 4YEAA 2QTDA 1T9UA 2DNPA 2J9CA 2W7OA 2BX6A 1GLAG 1ILYA 1E3MA 2WZ1A 1XNQF 3PR4A 3MHYA 1BQNB 5KRTA 2J6UA 4GC6A 1C0UB 4GVMA 1UVJA 3OV7A 3TARA 2WSEC 5DM7Q 5HLFB 2RKIA 4R0JA 2V34A 4O44B 3SSRA 3M1VB 3HVAA 4WQ5C 4OX9F 4CK2A 4EFHA 3LM2A 1XMOK 2HHXA 4KPYA 2JLFA 3THWB 3E1YA 3ZNUA 4QW8A 3MMBB 1UFKA 3FFIB 2HURA 1IR1A 3OVNA 2YH1A 4UF4A 1CJUA 4H5VA 2HNYB 3LP3A 1XI1A 3IBWA 2K06A 3S8SA 2BR0A 4ILJA 4HHJA 4D3HA 4X62J 3FMBA 4NL5A 3G6EN 1UEVA 3W63A 2YNGB 2CNOB 5K8NA 4WYBA 3TAEA 3OFEA 3UI3A 4J9QA 3M05A 4DTJA 2KO1A 1CBKA 1QM9A 1R27B 4FPBA 3M9NB 3RSEB 2R8GA 1FO1A 1OY9A 2DGTA 3H1VX 2A10A 1QTNB 2W2NP 2Y0SD 3MM9A 1QVGM 5LM7E 5HL7L 2E7XA 2E1ZA 2ZM6F 1IQZA 1S1TA 4BS2A 2Z2LA 1VIOA 2N7YA 2Z1HA 3FSYA 3ZX3A 3VR1A 3WT0A 2PE8A 1YHQN 1G7CB 1RP5A 2J0WA 2BJ3A 1OYEA 3NCPA 3P39A 3D7EO 3ZETA 2E7WA 3CJCA 1VQ4S 3GPAA 3K59A 3QEWA 4ECXA 3CJ7A 2DHGA 1C0TA 3EZ5A 1U1LA 2O67A 3O8WA 1JLAA 1W7AA 1VSEA 2CJBA 1K0TA 1VQKN 2ROPA 1CC7A 2IBOA 5HMZA 4CFDA 2IJFA 3AOCA 3AA2A 3GCXP 1R31A 4XIUA 2B9WA 5J2NA 2FDNA 2QWQA 3Q2SC 4MK7A 3QO9B 1I94F 1PJ5A 4K4VA 2RHKA 1HJOA 4CCHA 4CDIA 4ISEA 1XIQA 4ILMA 3ZZ0A 5KG2A 3P3DA 3HM9A 2E1MC 1Z6RA 3RMDA 2EPIA 2V7YA 2R7YA 2CJXB 5CZ2A 2UXBF 4DR4K 1RCOB 4LF7F 5KFAA 3J7YI 1HNXJ 2B5JB 5EUHA 4AL7A 1YBTA 4DUTA 5AQVA 1YTYA 1WHWA 4WFNQ 2NZTA 3C6AA 5HRPA 1RWMB 1X3NA 1VHFA 4IXCA 2ZDOA 4F0HA 2Q6BA 2LFVA 4IOAQ 3PSFA 3TJ9A 2X6SA 5AQKA 2OUGA 2HGMA 1LAVA 3ZCMA 4DX7A 3Q83A 3RRHA 4DTRA 4FO0A 1WB9A 5EU7A 4RX6A 5AQSA 1U2VB 4NASA 3KK3A 3O1WA 3ZXWA 1FX4A 3MTKA 3H2UB 4FXWA 4KSEB 2CNLB 3C19A 4Q2LA 5FLXO 4JYAF 3QAEA 1WUAA 2OPSB 3L4QA 1S72S 4I6MA 2A0FB 2KQ2A 5AQOA 4OJRA 3QYYA 2YKAA 4BRCA 3QRPA 3Q8VA 2VA3A 1UAXA 4QOZB 3PACA 3B8AX 4TU9A 4B8CA 2HBKA 4M7XA 4AHRA 5DLFA 1HQEA 5HMWA 4J8FA 4X4SA 4ECUA 2DO0A 1DTTA 4QPTA 1KHWA 4FJ7A 3OD2A 1WD6A 2OPPA 5L1IA 2HKEA 2HNDA 2VCPA 5KTQA 2C2NA 2CG8A 3IP0A 3BPDA 3D3BJ 4GKKF 3DU5A 3L7PA 1OYDA 2XI3A 4JI2K 3CHWA 1CPZA 3VGKA 1K1SA 2CJKA 1D9DA 4NA1A 2A3JA 1MU2B 1G1XA 1YT3A 1QZ5A 2AJFE 4RJVA 2CQ2A 3LALA 3J7YP 1CJKA 3ZO7A 1HKCA 3PRVA 4DZ6A 1ZXOA 1GAOA 1YJUA 5I42A 1FNMA 2QN6B 4F3MA 1QDUB 2PMHA 2YBVA 2NRTA 5L9XA 2I7NA 5DGAA 3I5AA 3NVKA 2V63A 4C98A 3O9UA 2JVRA 4DV6K 5IS2A 2V7ZA 3OVAA 3TWZA 4F36A 2HEKA 2QKKA 5AZJA 5KFCA 4UOHA 1KONA 3GE1A 4TQSA 1YZ7A 3U4LA 5D3GA 1PBUA 5L9NA 5KPZA 1RKJA 1OQ6A 4DXLA 4AHTA 1ZAVA 2QRRA 1S4EA 1ZTTA 3V81B 3SYZA 2DXFA 4YN3B 2R7QA 2DFHA 2QEXS 3EZOA 4I68A 4QIGA 2KKZA 3JTOA 2IMWP 1D9AA 4BCAA 4GVLA 3CCLS 2BMBA 3OS2A 1S0VA 2IVFB 2KG1A 4DTSA 4L3KA 4OZJA 3KK2B 3VQAA 3W2WB 1V3RA 1UEUA 1T03B 2DEIA 3M2UB 3KK1A 5KG4A 2IIHA 4G9ZA 3U8XA 2CWXA 4ID8A 4CGHA 1OO0B 1LFPA 1AUSL 4S0MA 2EFVA 5E84A 5EWGA 1YDLA 3M8WA 3RMAA 2B8PA 2DY4A 1U0SA 4K0KF 4ZVUB 4OI4A 1Z2LA 2HBZB 2PI5A 4HUFA 4PYAA 2E44A 5KAKA 4USJC 2D69A 2RE1A 2FZGB 3CJ8A 2BRKA 2Z2YB 4HI2A 4FJKA 3BZCA 3KKFA 4TY8A 4MDAA 4J2BA 4C0HA 3NGSA 3A8IA 4PR6A 3L3VA 4JHDB 1S6OA 4IRDA 2ROEA 3M6WA 4K50A 4O5FA 3UKRA 2FVSA 5EWFA 4LJMA 3V6KA 3ALYA 3NGYA 3R6LB 3W8GA 4DMZA 4PPDA 4ZITA 2LQBA 1RT6B 1VQ4N 1SCJB 3H3NO 4ISFA 3MD1A 1X5OA 2F3JA 3L4BC 3H90A 2OPQB 5KT6A 3D2EB 4TYBA 1RU1A 2Q1NA 4OZ1A 1G2EA 1BC6A 1TVRB 2CFXA 3QNOA 4LF8J 2FJDB 4ETXA 2C28A 3VESA 5GVQA 4OYXA 4EYHB 1T3NA 1IM4A 1BA0A 1DTQA 5GAGP 4PUOA 1WHXA 3HSCA 1WSGA 4RKUC 3E51A 2XMMA 1MWYA 1WTBA 3R1HA 4CM2A 1ATSA 4BRMA 1IXKA 4KPCA 2YHYA 2PDAA 1R8BA 1UVMA 5E3PA 1YVUA 4LVOP 2E5LK 4X62F 2K3IA 3WBZA 1NJXA 4OPHA 2LQJA 5B0BA 4C0OC 1KOHA 4LF5K 2ZBRA 1XEZA 1TELA 4MMOA 4DHVA 4FOEA 3D2FB 2HFSA 3ZTRA 4F0KA 1TL1A 4X84A 2QXFA 1S72N 3SSQA 1U2RA 4F04B 2HB5A 4JK9A 4CH0S 1VLOA 1CQMA 2DB1A 4BACA 2JWNA 4QBUA 1T6CA 1N54B 2WVBA 3WC0A 3J7AN 1EB0A 3V9SA 5FPEA 1RWPB 3GIJA 2KM8B 3VAHA 4IOCL 5A0YA 2C3UA 2F40A 4A57A 3J7Z5 4ZP8A 2AV5A 1WNEA 4ZVEA 1KVAA 3CM5A 4DTPA 1GMVA 4X65K 3SUNA 2VA2A 4IG0A 3P5TL 1Q16B 1N36K 1J54A 3MR5A 3AVIA 1J9AA 3ZZRA 4DKWA 2KJWA 4MYTA 4HDHA 2C2OB 3VV2B 2OHDA 4NXNK 3P38A 3Q7CA 2WVCA 1D09B 1YJ9S 2AHOB 3CCQS 1K8AO 2ZNYA 4RW7A 1LAWA 4LR7A 2WAQD 2ASDA 4NZ6A 1HLWA 4Z4EA 3CIPA 3H46O 4ID1A 4I2PB 1J5OB 2MGZB 5LJ5Y 3MI7X 2OKQA 3LDLA 1RT7A 5AQPA 4DUYF 2ZJQL 3CJ3A 1JLGA 5AQRA 2PMZD 4A2AA 2I1RA 1X4GA 2RF2B 3MWBA 1KR4A 1F2HA 2R2UA 3MPYA 1SC4B 4IFVA 1S79A 1EX4A 3AGKA 2HGNA 4FS2A 2DK2A 2NREA 4YDDB 4KY3A 2KH9A 1LOTB 2GFFA 3JAMO 1EAYC 4IWVA 1R0CB 4AHUA 2OTLS 1HYVA 4URGA 3KVGA 5AQJA 2BW2A 2QEXN 2F5GA 1RSCA 2B56A 3MPUB 1FJGK 1Y4ZB 2ASPA 3HT0A 4KAIA 4JI0K 5M2PA 4WIQA 1NKBA 3CCLN 4OHVA 2RIJA 1N32F 4OL8A 4F8RA 2J7WA 3SCKE 2GZOA 3R1LA 4GRSA 1FE0A 4WCEQ 2V4JA 3CJ5A 2FJEB 3HPOA 1BQMA 2V69A 1C4AA 4B1ZA 3NCRA 2E5IA 2N4CA 3EO3A 5B0GA 2XHCA 4CJEA 2VQFF 2OI2A 5FPMA 2UXCK 2BE7D 1WOQA 1JLCB 2BJEA 3NH2A 1HFEL 4FXVA 3A5OC 3I55S 2FGOA 1FNOA 3BSCA 2QLFB 3PRDA 5DM7L 4LRCA 3R5BA 3N79A 3OUYA 3HHLA 1SI9A 2KB2A 2W1BA 4LF6K 1S5JA 2APOA 1O0PA 2DJWA 4JI1K 4BC4A 4Y1DA 2RN2A 4B3OB 3T1HF 3ZC4A 2R42A 5A6PA 3H5UA 1SIZA 3CJBA 1VIXA 4B17A 3D1HA 2WUSA 3DC2A 1C6VA 1GMUA 3Q7BA 2Q3PA 4ZVHA 3LAMA 1LWCA 1XNQK 4BE0A 2QL9B 3FNNA 5JVGL 2FHJA 5DG7A 4K4WA 2VONA 1MN9A 2AGQA 1NU0A 4FJ5A 2OCEA 4G1PA 3ULEB 2CZ4A 2G8WA 2IJRA 1T05B 2MQ8A 2PEHA 3NGDA 3WZ0A 1UVIA 1FDBA 1BLUA 1S6QB 1S0MA 3DLKB 3PZPA 5E33A 1REGX 4OX9K 1ZM4A 3RB6A 2I9SA 2IS3A 3NH1A 2OP5A 1P1TA 2NRHA 3FKBA 1RBLA 3QWPA 1BIZA 2HQFA 3DFEA 4RUHA 3DXKA 2P9UB 5FROA 1RADB 1NM2A 2I38A 5BRFA 2UUCJ 2HNZB 3JSMA 5AXKA 2ASMA 2HHHJ 1JLFB 2P9KB 2HVDA 3LPEA 3CXCM 1B4SA 4CJ5A 4WFAL 3IR7B 3MM7A 4F2RA 1KD1O 4PEOA 3L7OA 2AX0A 3NGRA 1D9FA 4B3SF 4USHA 3KYLA 1VSJA 4ZIVA 5G0RA 4KTQA 4EK2A 3ISND 3AB2B 4OQJA 4F67A 2FLNA 2JJ4D 5KOXA 2WOMA 2WB1D 4CIOA 1VJQA 1BQXA 1MMLA 2G0IA 4YOXA 1IN0A 1VHXA 4U7CA 4EHTA 3CC7S 2CUYA 4J9LA 4ZS6A 5L1JA 4EGLA 5HVGA 2QWLA 1KQFB 4CHPA 4LF4K 4A8MP 3THVA 3OR1A 5GIOA 5T7LB 2K7JA 1CS4B 2KN4A 4QR0A 4C1NI 4ED8A 4KBOA 3E9LA 1RHQB 2W2QP 3EVWA 2KXFA 1OPIA 2FVRA 1RQ0A 3I5BA 4BLGA 3HHEA 4RZRA 2VQEF 2W4PA 1IKXB 1NGDA 3B6BA 1E4FT 4WFNL 4IQXA 2UUAK 3TAMA 3SBMA 3IO1A 4I6YA 5D77A 2D1CA 3JSBA 1T3VA 1NHKL 3FVYA 1M5VC 3H59A 3PYDA 4NA2A 1I94K 3HF5A 3ULHA 2JH3A 3D0IE 1YJ9N 4ZVSB 3CCQN 5F0XA 3SQGB 4EBCA 5KG7A 5AXMA 3G82A 4CZMA 5F0WA 1FRIA 1T3OA 2ZOGA 1UEKA 1APSA 4CJKA 2UXBK 1SJRA 4LF7K 1RBAA 3A8KA 4IDKB 1TZ0A 1S6PA 1P6TA 2G2ZA 3HHLC 3L0QA 2DTJA 2VG6B 1TKXB 4K5SA 2A18A 2G0CA 2UXDJ 3NOCA 2NXJA 4QCLA 3AO1A 1NH7A 1X9SA 1EARA 3H5YA 4FZZA 2R2TA 3QQCD 4YUDA 4JYAK 5BN9A 2JC0A 2UYTA 2OTLN 3DLGA 4K4XA 2CPEA 3KUGA 2VDIA 3GV8B 4C11B 2QI2A 1RLCL 4ZCIA 4CT8A 1RBUA 2P9IB 3TTCA 3OBIA 4KHPF 4DQRA 4OPKA 1PAEX 3R2CJ 3VEOA 1KC8T 3HO1A 3E2EA 2DNGA 2F8EX 1BDGA 1QY7A 5JS2A 1UVLA 1K73O 3TZXA 3H08A 1N0VC 4K42A 3V9UA 3HZEA 2BZ2A 4RW9B 4ANEA 3N4PA 2DGVA 4GKKK 3FGVA 1YRXA 3M6UA 4AQYK 3MEGB 3DU6A 3U9DA 4WE1A 1AZSB 4FJXA 1H2VZ 1R8PA 1GLBG 2CJQA 5DDRC 3TAPA 5ETLA 2DY9A 2XWXA 3I55N 2RHSB 4A5BA 3I87A 4H4KA 3RMCA 4JI4K 2O8EB 2FC8A 4WF9Q 4MKBA 4CJ7A 4WZMA 3ZLJA 1RCHA 1A5XA 4FJMA 5KFWA 4CWBA 4Z0UA 1WF2A 5C5JA 2UUBJ 4I4BA 1BL3A 1RE1B 2YKOA 4DQSA 2YPYA 2IOCA 4B3TF 3QEXA 2EW9A 3Q22A 3J7ZT 1UFLA 3VEVA 3G2XA 4Q0BA 3J81j 1HKBA 5GAHP 2RE2A 2B43A 4M3ZA 1VBKA 4XPEA 1U49A 2NLWA 1ZOTA 2Q6CA 2CWKA 3BSAA 4LQ9A 3NFAA 3NF7A 3VQEA 3UR3C 1WC4A 4DQPA 5AQIA 1SS6A 3V1RA 4J9UE 3ZTSA 3ZZZA 4J91A 4DR7F 5I3PA 2LA4A 4Z7CA 4UUWA 4PG8A 2ITGA 2BYCA 3VAKA 1CZ9A 3G4SS 4C23A 4DR1K 1NG9A 4E7KA 4TVAB 3N5FA 1F3FA 1HYSB 3CDBA 4F4KA 3QINA 4FF3A 2HRYA 5DJBA 4K41A 4DBQA 3SSSA 4Y2AA 3Q23A 1Z4UA 5AQHA 3ZEUA 4USTA 2F8TA 4NCGB 5KFBA 4EEYA 4YHHK 3IS9B 4FNIA 3WDOA 3P45B 3J80Y 4LFCJ 3MDQA 2H9ZA 1H2TZ 1IKVA 3CVKA 5JJBA 2JWLA 3KDNA 3DM2B 3V2UC 4JRQA 3CC7N 2MYFA 1DZ5A 3QJLA 5KG1A 2NNWA 1KCFA 3QEIA 4I2QB 1TUUA 4J9PA 5D0HA 4C8ZA 2KXHA 4MAKA 3C7NA 1VQPN 4ZVQB 1FKPA 1BUPA 2QWOA 4RU9A 5M1QA 3PKMA 1S1VA 1RTZA 5BPLA 2A6AA 2JX2A 2HAIA 1RACB 2W25A 1N8RT 2VFVA 2R7UA 3C6UB 3VGVA 4LIWA 3J7YU 4CEQA 3VF4A 3V4IB 2XM3A 4O0NA 1W2IA 3N9UC 2QL5B 4KV8B 2H1YA 3ICLA 4M5DA 3L7UA 1X0FA 4FWSA 1OH7A 3C3LA 1VK3A 3TYTA 3OFGA 2D3O1 3VZHA 5I3UA 4AT1B 3FMWA 4DPYA 1IBMJ 4FPAA 3LP0B 5A8RB 4ECWA 3NEKA 5AE1A 3LOUA 3MXIA 2V4RA 3CIZA 1MDUB 4O23A 3IDHA 5I4MA 1N34J 3J81O 4OYBA 1C0MA 1YTUA 4H4KC 4WU2A 4JKFA 3FEZA 4FK0A 4I7FB 4KHYA 2WONA 2KVQE 1Y97A 3FZKA 4X62K 4KH1B 1VBYA 2CQDA 1DY3A 2QMUB 4HL9A 4WKYA 4HUEA 3ET6B 4JLHA 4GW6A 4PYDA 3CCTA 1EQYA 1WC0A 1WG1A 1F6TA 3FQKA 2V9KA 4DF4A 3TTDA 3OTBA 4CLWA 3R5GA 1MMNA 9RUBA 1Q7YO 1P90A 2CPDA 1NDPA 1HR0J 3CPWM 1X3MA 3UVJA 4YY3F 2XYPB 4F4ZA 3EKSA 4ITSA 5FIIA 1VI7A 3OY9A 3SMPA 4KYZA 1YVFA 3CQYA 3ZX2A 4B9TA 4RW8A 2P6SA 2QO3A 3CQ8A 4BG8A 4NMLA 2HZCA 4FK2A 2FBVA 4A8QA 1SJFA 2IAJA 1FRLA 3CQXA 2P5GA 1QZ6A 3AVHA 2QM1A 2KL8A 3S6EA 3NDKA 4JV5F 4EO8A 4LH4A 4KQZA 3ZSQA 3VQQA 1N0UA 2M0GB 3HFZB 4PWUA 1UAWA 3Q24A 2QJ3A 3CG7A 4ID5A 1EJ7L 3RTVA 1JJHA 3OHBA 4QU7A 1S12A 3MD3A 1W7WA 1RAFB 3LDSA 4DL3A 4HHUA 1QLNA 4KC5A 4DHYA 3P5BP 1B70B 3TJAA 5DG9A 2BBEA 2IC3B 2CVEA 4GKJF 3TUJC 3I0RA 2MZTA 1C1BA 1G15A 4Z4FA 2D3UA 3LGHA 3GIRA 1HNXK 5KT7A 3EDQB 4NEZA 2E88A 2ZDPA 2CDRB 4DS5A 4IG3A 4GMKA 3ENVA 3TVKA 1TP7A 3ZTOA 1F3VA 4KH0B 4BVPA 3G86A 4DSIA 4BRNA 3NKYA 4BDZA 4JV0A 3AD9C 4R25A 2OH2A 1FFWB 1QE1A 3VCDA 1DKGD 4BRLA 3GLJA 2MQMA 4YDXA 2XNRA 3DKDA 3TX8A 2OZSA 1RTIB 3D9BA 5A8KA 1Q53A 3G4SN 3VEWA 1TQLA 4P6QA 4M42A 1TKZA 2ZE2B 3HK2A 1UPPA 4ED1A 1TK8A 2YNIA 4BC3A 4BE2A 1N32K 3ZSXA 2BM1A 3SXLA 2PN6A 1VRTB 2Z1GA 2CDQA 3QGIA 4RW6A 3OL9A 1SJ3P 4DL6A 3C94A 4P7VA 2I0XA 4CLPA 4ECTA 4NO7A 3HM8A 2OEKA 5F2RA 1X5SA 3THTA 1K8KA 2HHWA 4OHZA 4M45A 1Q82O 3SDEB 3O5BA 5F3ZA 4U67Q 5KFOA 2XULA 4L6V3 2GELA 2K3KA 4IJNA 2IPOB 4CT9A 1WSEA 1ZBUA 1R6YA 4BGBA 1IJFB 1DHMA 4KFBA 4OYZA 5THWA 3NAEA 3G87A 5AQWA 2K7KA 1VGYA 4IR1A 1T9TA 3Q8QB 1HNVA 3T1HK 3J80O 4K4TA 4M5HA 2JNJA 1GX6A 1WEYA 3W5ZA 2HSTA 3BF1A 3BR8A 5C2DA 1QVGR 3MM6A 2ZWHA 3HJVA 2LDIA 1JJCB 4ZPWR 3NMRA 1ZETA 3D1OA 5CQGA 2XZWA 2PZSA 3VF6A 5JVHQ 1TAUA 2IA6A 3AB4B 4UUXA 1U1PA 4CZHA 1T9XA 4M3WA 2VPXB 4A8KA 4FYXB 4Q44A 1TL7B 3KMSA 1FRXA 3EICA 2HQIA 3QPIA 3GJQB 3RVCA 4NB4A 3OL8A 4C7QA 1YG0A 3LA0A 3PSIA 1ZH5A 2KT5A 4QS7A 5KT5A 5H9EJ 2MHEA 1GLFO 4OLOA 5LJ3Y 2V2ZA 5GADI 2DH7A 4PAAA 4DR3F 1X4HA 3PX0A 3CNQP 4ED0A 5F9LA 2WB4A 1Q81T 2QWNA 3QETA 4LSNA 1EWRA 1LWFB 3FZFA 2QGFB 1U0HA 4V19S 2N4DA 3GIKA 2FBTA 2OYQA 5G4DA 3O4WA 2ROGA 3QLHB 1RNHA 1M5SA 4R5PB 4UQGA 4CQ1A 2ZD1A 2ZH6A 2RQCA 1WUUA 4DG1A 3VN5A 3T1YJ 4FJGA 4CESA 1PCAA 1IJEB 5SUHA 2EBEA 3AVFA 3M8PA 3CJ9A 1VHIA 5JUMA 4DSEA 2V8DA 1SKSA 1QUPA 4EI2A 4KHQA 4N47A 3A1YG 3V4MA 2WBRA 2HAFA 1R8AA 1B9DA 4PWDB 2OMLA 3E9PA 1X4CA 2QXLA 1UPMB 2VQEK 1TKTB 1S1XB 3NE6A 2AYMA 2D4WA 2FY8A 1NK6A 4JI5F 3VAMA 4F02A 3BKFA 3SV3A 3I8DA 5HAOA 2QC3A 2HMPA 2YKNB 4O3PA 2GQCA 2XMKA 3TZWA 3V1OA 1FTRA 4C48A 3C15A 3D0HE 1NDKA 1SQKA 3KHLA 4LF8K 2OEJA 4BC9A 4N76A 2XC9A 3KTQA 4B3MF 3I9ZA 3QAUA 4LRAA 2RQKA 3BDEA 3IWNC 1WHVA 4ZPBA 2VG7B 3LANA 2V51B 3KD1E 3LW5C 1TL4A 2FYXA 3QSYB 5IM0B 4JUZA 2HFNA 4CTAA 1N34F 3T9NA 4JI3J 3CD6S 2F7TA 4ZMMA 3W66A 2GX8A 3NGIA 1DQAA 1EIYB 2AYGA 3TSUA 2DR6A 4ZA1A 1VQ6S 2ACYA 3OVSA 5EX3A 1XNRF 3DYAA 1UA0A 1U48A 4AHCA 4BC7A 1RAHB 1ZBHA 4NMXA 1UL3A 3CJ1A 1NZ8A 3U3YA 3UDVA 4OI6A 3K8VA 4ZP6A 2ZH3A 3BQ1A 1M1KO 3TZYA 4WP3A 2HVIA 4H03B 4Y28C 1J53A 2HQ3A 4F25A 2H3GX 2AGPA 4CO2A 3RAMA 2ADCA 3M9OB 4ZPTR 3H5SA 5D15A 2NXNA 2M3DA 3AVJA 3HPGA 3V6DB 4XDDA 2AMCB 1RT3B 3ZZOA 2JGUA 4H4OA 1XHXA 1H3DA 2C3PA 4TYAA 5GAEI 1QQMA 3G96A 4OPJA 4A2BA 1OY8A 1XJWB 3VMFB 2RS8A 2WFBA 2L9DA 3DGVA 4HTLA 3DRSA 1FTCA 4L3QA 8RUCA 4RW4A 1JB0C 4AILC 5B0FA 1HARA 3IR5B 2FVPA 2RILA 3C8YA 3M2VA 4JK8A 1AFIA 3D6HB 2GMJA 5AQXA 3DLHA 5HK4A 5LSRA 2CVIA 5JICA 4CHZA 2XO6A 2PA8D 3JXUA 2FSJA 4B3TK 3FDSA 3H2LA 3OR2A 3Q89A 1YTAA 2G8VA 2O1PA 3I0SA 3HXMA 1CJUB 1QUVA 5DQGA 5LJWA 2F4FA 2XSJB 4KHMA 4WFZA 1X60A 2ZJRL 1U6ZA 2O3DA 4RG8A 4Y1CA 5KFEA 3K89A 5C25B 3BS9A 5FPDA 3W62A 4ZP7A 4N77A 5DRKA 2YXLA 2VOOA 1MSWD 4HVZA 2VICA 4Z4IA 5T14A 1XR5A 2AZ3A 3DOMA 4MLHA 1FJCA 2BUPA 2X1AA 2MZSA 3OFFA 3QIOA 5GAEP 2QL7B 4K8RA 4L3NA 2DGUA 3OQ2A 3D6RA 3BB5A 1RILA 4OMFG 4JS5A 5DDPC 4E1JA 3MM9B 1DLOA 1WELA 3OW2M 3KHGA 2GQQA 4DPOA 1S1TB 4YR3A 1NNEA 4OHXA 5AJ3F 3OPKA 3VOVA 3GONA 4O0JA 2W8LA 3D6MB 3ZETB 3NOGA 4AM7A 1X4DA 2W7PA 1C0TB 3QESA 1KVJA 3EZWA 4FP9A 1JLAB 5IWAJ 5CD4H 1YRTA 2MQNA 1A9NB 2J7KA 4LY7A 4BR0A 1Q1KA 1L3UA 1ZAWA 3MEKA 4UQTA 4B8AB 1GOAA 3WXKA 1NGHA 2CJ9A 4PXDA 2DRDA 2FJAB 3P49B 3L8BA 3VQTA 2GJ2A 1X5TA 1C1CA 5J2NB 3FBEA 1RCXB 4JKGB 2B51A 3WQPA 1RYRA 4OYOA 1O8BA 2QWRA 3F9MA 1S3XA 4WTOB 1HI1A 1Q8KA 4P2FA 4ELTA 2AP1A 1RAOA 1KTVA 4FKYA 2CQPA 3Q8PB 1X9JA 2HK3A 3NY0A 3CD0A 3IN5A 1IUJA 5K20B 1ZBTA 2FJBB 1VQYA 4AE5A 1Q7LB 3OJUA 3C14A 3MECA 2IVPA 5GINA 3TUPA 3EPGA 2YKMA 1CJVB 1RT4A 2P5VA 2E9RX 2NZ4A 1S9EB 1U6FA 5CA5A 3BYPA 4L74A 3FEYB 1W0HA 4DQQA 2UVVA 3VQ6A 4DOZA 3U3GA 3GR1A 1XR6A 4O4RA 3A4TA 4YFUA 2G9OA 4I6MB 5HJYA 4E7JA 2HVHA 4V19J 1C0FA 4EP5A 3MCOA 2UUCK 3OYHA 3B82A 2HS3A 2FBXA 2O5DA 1REVA 3ILOA 3CD6N 4CIEA 1HQEB 4RO0A 2ERRA 4XO0A 1DTTB 4RNMA 3RGIA 2R8KA 2E1AA 2G8FA 5DS7A 4IZ9A 3KUEA 2PIIA 4N7TA 2HBRB 1RK8A 2RRNA 2HLUA 2VUGA 4LFAJ 1XMQF 2G8UA 1VQMS 1R89A 4DSLA 3A13A 4CI6A 2VYPA 4X64J 3WC2A 2EK1A 4Y2MA 4HLBA 1S9FA 1B7FA 5CCLA 3B4MA 1BGXT 1KSPA 3DLEA 4PA1A 5AFUH 4GVBA 4NI2B 3EE9A 2YHXA 4KHRA 3O3FA 1CJKB 1WDTA 1ZBFA 3CJ2A 5EX0A 5KFDA 5I42B 4Q8FA 1PBAA 2ZBCA 2HBYB 2Q2RA 3HRGA 2XO7A 4ZPDA 1HPZB 4HTIA 4I0WA 4OZNA 3OTDA 4PPZA 5AZJB 2C2ZB 2ZOFA 4EU0A 2GVZA 3VGUA 2E1RA 1RTJB 3SPYA 4ILLA 1VRUA 2LQ8A 3RRGA 5I9EB 5IT9Y 2XMTA 4X4TA 4KB0A 4I6WA 5D3GB 4DQ8A 4Y3CA 2Z0GA 4DR5J 3GB0A 5F8NA 1JL1A 3ZT0A 2O8BA 3AXKA 1S97A 2MEWA 3O9TA 4GV3A 5LT5A 3JYTA 2WSFC 4DZDA 3IWXA 4HYKA 5ETOA 2P2CB 4NYOA 5IXUA 1AUDA 2RNEA 5HATA 4UT4A 3OBYA 3HBTA 3BO4A 2LMIA 5E41A 4RWTA 3PYEA 4I64A 2PYJA 1M1GA 5DETA 5BJRA 3THWA 4DSKA 3PW4A 1I3OB 3KK1B 3FFIA 4P7TA 4ANCA 4DL7A 2BH1A 1YJ7A 2HNYA 4OKEA 3EXCX 4DFJA 3D66A 3P83D 5EX5A 3GOIA 2XS7A 3ZSYA 5ETRA 1BE4A 4H0OA 2V8VA 3OYKA 3PXGa 4JOUA 2MLXA 1B64A 1E6YA 1TFYA 5JMNA 4ZJLA 1NMEB 2ASJA 2DNYA 5CE3A 3KG1A 1FX2A 2BJ7A 3IAYA 4Y2CA 4TY8B 2P9GA 3MMAA 4FM1A 4HCBA 1N52B 5CYQA 2E2QA 3JSYA 4ES1A 4CO3A 4L75A 3SJHA 3UKRB 2KRRA 1NDCA 3CXCR 3SI8A 5JVHL 4C8NA 3QEVA 2BABA 3BO2A 2V8HA 1VBXA 1YXQA 2AP6A 4CJQA 5DM6L 4CJFA 2A3ZA 3NRBA 4JI7J 5EVZA 2YV0X 2V94A 4DI6A 5KT2A 3S3MA 1QAJA 2Z1IA 1IBCB 1W9HA 1K9MT 1V5IB 2CH5A 3MEDA 1WKLA 1JJ4A 3G6VA 2GW8A 2WW8A 4G65A 3Q2TC 4ED4A 2CPFA 3KWIA 2P1JA 4ZDNA 3ZYYX 3R6MA 1D0EA 4Z37A 5HRSA 1XQIA 1DTQB 3PEHA 2FJVA 4PUOB 3HSDA 1KAYA 4KRFA 4Y6IA 5HMXA 3K2PA 4ED2A 3KJFB 2FY1A 4L76A 5CZXA 1Z25A 3SUPA 1P8ZA 3MUTP 3CMES 5CABA 2AEJA 4ZCLA 4HVJA 4FJLA 3CJKA 4ECYA 3CFPA 3QBXA 2Z4PA 4P10A 1N6QA 5HBMA 3O44A 4LF9F 1KAZA 1OPZA 3M6GA 5F0UA 2LSNA 3ZSOA 1B99A 2JEFA 2VPWB 5KFRA 1BWVA 3I4HX 4IDHA 2P9PA 2P8IA 2XY7A 2XY6A 4CEFA 2ADBA 4OFZA 3KLIA 2RVJA 2B5JA 1BI4A 2NUUG 4B9LA 4TY9A 1XC3A 4CZIA 1SKUB 3QSIA 4U7UK 4H8KA 3VGMA 2I2YA 1TL1B 3S3NA 4HH1A 3DHXA 1HMVA 2AZ1A 3HCXA 4Y65A 5ELZA 2UUTA 2LA6A 1WSJA 1V4TA 5KFUA 1RBOB 2BOAA 5E7OB 4RBUA 2MQPA 2KHDA 1T7PA 4TKTA 1WG5A 1O51A 3V6HA 5FPNA 2NRXA 2YCHA 3FQLA 1F5CA 2RMLA 2NRWA 1UWBA 1R0AA 4WBFA 4E1NA 2MKHA 5A0YB 3BP8A 1F5BA 1FRJA 1YLXA 3MEEA 1A5WA 3K2YA 4YDUC 5AR0A 1ZC6A 1VQMN 3V5RA 4IG0B 3R5CA 4F4YA 1S0NA 3DRRA 4ALZA 4FWLA 3O6WA 4DR2J 4NYPA 1ITGA 4BRGA 3B78A 3LDNA 3QRQA 4C3LA 2ASLA 4X66F 4HEA9 3ID6A 3RB4A 1HIYA 2L9NA 3QGGA 1HL6A 1D1UA 2FTRA 4RNNA 4MLEA 1MU2A 3M6XA 1O1WA 3BR9A 3BKTA 1RBRA 3HI9A 1AYEA 2B9EA 2DRBA 5AQNA 1IH7A 4BRHA 5E2QA 1WDDA 1NHUA 2JL9A 3E66A 1Q18A 3M2RA 4CZLA 1RT7B 1YQHA 3V9XA 1FRHA 1N5TA 2WW4A 1N5VA 4BWMA 4ATNA 3AV9A 1JIHA 2Q0UA 3MFIA 2IFXA 4O3NA 4JKAA 2ZJPL 3PEJA 2ZF5O 2MZQA 4J5OA 3TEHB 3V9ZA 1SXLA 2NRZA 3QATA 1NSPA 3Q8SB 3THXA 2BACA 2FC9A 3A0IX 4EBDA 2ALYB 5H1SV 1RTDA 1IBMK 2QE5A 3CCMS 3GIMA 1LK7A 1B0PA 3IMQJ 3KMQA 2YWEA 4HKQA 4ZVFA 3FBCA 3UD5A 2XG8A 4MKYA 4E7HA 1NOYA 4QPXA 1N34K 3H25A 3MCAB 2ZM6J 4OZLA 4AL6A 2D7SA 4NA3A 3IGNA 2YY3A 5HI7A 3H20A 4NLUA 4AHSA 2V4JB 2ZUGA 4MO4A 1BQMB 4M5GA 3PX6A 4DCHA 2H54B 2YQ0A 4JBCA 3G8SA 3AO3A 4BRAA 3T7ZA 4F4XA 5HANA 1UZDA 4Q7AA 1Z26A 1XTZA 4YNQA 1K8AT 2VU5A 3TR5A 4KRWA 4DUZF 3PJ9A 1T03A 1HR0K 1NU4A 5M1PA 5DG8A 3CEDA 5KFVA 1Q95G 5JS1A 2G13A 5BR9A 6FD1A 2XTJP 2XHWA 1I5OB 2VHGA 1RHJB 4K4ZA 4DTMA 4ICLA 3ZX0A 4BWJA 2FXUA 5F3TA 1X4EA 4PABA 5BR8F 5C42A 4CIGA 2IHR1 4CZKA 1ATNA 3VGTA 5L8RC 3WXIA 3C66A 4XAKA 4CEEA 2ZWPA 2F9TA 2NLXA 3OXLA 1J6ZA 2KHCA 3KXDA 4CHOA 5KT3A 4O8KA 4DV5J 2HRTA 4ZN3A 3CF5Q 1SH3A 4XH4A 1RT6A 1EP4A 1VYAA 5FLXU 4WFXA 5J1NA 1WAFA 4CGJA 1WI6A 1GXUA 4BRIA 5ETSA 3OSPA 3PLAA 3W65A 1CLFA 4OGCA 4YOEA 1OWXA 3I9V9 4CK1A 1IV0A 4HDGA 4CFAA 2I7PA 1TVRA 2DT9A 2M8DB 3DXKB 2W8KA 5GADU 1Q86O 3FK4A 4ES3A 1H0HB 2CNNB 1JJ2M 4Y2KA 3CMEN 2GUIA 3H45C 1RLDA 1OSDA 1HKGA 4OHWA 3CWJA 1U7LA 2RPIA 1YHQS 2JC1A 5K9FA 4ZVRB 3MM7B 4IOBA 4K7QA 3BGFA 3F5TA 1U09A 2H48B 2H5EA 1WORA 1VQOS 1CC8A 3MXJA 1WEZA 5LMUJ 2ZH5A 2Y1JA 1QS4A 3TI0A 5ADXA 2WOMB 1W25A 3L2WA 2CJYB 1Q8LA 3EGNA 5CYJA 3SCJE 1FDNA 5CXTA 2R8HA 3MUVP