1SV5A

Crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
552
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse Transcriptase
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 131
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1sv5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1sv5A05
3QETA 4CFCA 2ZD1B 4ID1A 3NE6A 3DRRA 1QAIA 2RPIA 4B9VA 3GV8B 3VA3A 3RB6A 4LSLB 5F8IA 5KT4A 3V6DA 4NZ0A 4RUAA 4DL3A 3OYGA 1NK4A 1BISA 1DTTA 3DRPA 3KK3A 2UVWA 1YT3A 3SV4A 1R0AB 3DLRA 4CJTA 4FZZA 5KFQA 2OH2A 3PX6A 1ZBUA 1ZBLA 3QIPA 5F8LA 4CCHA 1TL3A 3IS9A 4U6PA 2FBXA 2QE5A 1YTAA 4CF1A 2W8KA 2RF2B 2V4QA 4CHZA 4DQQA 5HP1A 4GW6A 3AVAA 4YQWA 1IKXA 2XGQA 4J2BA 5KG0A 1GOAA 5DQIA 3CJ2A 1D9FA 2DFEA 3DYAB 1IM4A 2XC9A 3BSOA 3RMAA 4CGDA 5FDLA 3PO5A 3EZUA 4Q0BA 4KKOB 1TAUA 5KG1A 1QHTA 3NBPA 4AH9A 1KHVA 2LSNA 1CXUA 1KFSA 1RTHB 1TV6B 2YKNB 3DM2A 4R5PB 2A1RA 2WRMA 4ECXA 4NCBA 1KSPA 4M42A 5J2NB 4U7CA 5HROB 3T5KA 4QWCA 1FXXA 3LPTA 2AGPA 2XCAA 3I8DA 3OYLA 4KHWA 3IN5A 3FQLA 1ZETA 5C42A 2UUTA 3IGVA 3NGYA 2FVSA 1RTIA 2D7SA 1X9MA 3VQSA 4DU1A 1BQMA 1VSIA 4WYLA 5DLGA 4IH6A 3LWMA 1NJZA 2YNHA 2FVCA 4CFAA 4F2RA 4M3ZA 1TKTA 3OS2A 4FJ5A 4IQXA 4WZMA 2HVIA 1C1AA 4CIGA 3QLHB 2EHGA 2WHOA 4WXOA 4QPXA 4MFBB 1VSHA 4IOBA 4JRQA 2HVHA 3PW4A 1EKEA 3NH1A 3RB4A 5I3UA 3H5YA 4KB0A 3DMJB 2CJQA 1SUQA 3SPYA 1WSEA 4PWDA 3ULDA 2R8IA 1IKYB 1LWFB 5DG9A 3KLEA 1LWCB 2DFFA 1SV5B 3HT3A 2FJWA 3AVIA 1FKOA 4NLQA 1N48A 2OPRB 3OYFA 3KHRA 2HHXA 4WE1B 1RBVA 4Z4CA 2W9BB 3OYNA 4BDZA 4E0DA 4DLGA 3TQ1A 1TKZB 3HM9A 3NDKA 3RAQA 1JX4A 5J2MA 3M8RA 1TKXA 3ITHA 4ZVHA 2D0AA 1FKPA 1UAXA 3VQQA 5KFBA 1S6QA 4WFZA 1IKVB 1S1VB 4G1QA 3RAXA 4FJGA 5JXSA 5KTQA 4NCAA 3M9OB 3PR4A 3T1AA 4M94A 1S97A 1FK9B 2BANB 2WCXA 3EY1A 2Z1HA 3QIDA 4BWMA 2IM3A 4GMJB 2WTFA 4PY5A 4RW6B 1VRTB 2YNIA 3V1RA 4EP4A 1JKHA 2HHVA 2YNGB 4XPCA 3M9MB 3O4NA 3C6UB 3UPFA 1S1UA 1RBRA 3KMSA 4CERA 1RT1B 1HMVA 4CEDA 3QEXA 4E7LA 3KLHA 1N5YA 1LW2B 4F2SA 4DG1B 1S5JA 2D41A 2F96A 3CIZA 1NOZA 2VG5A 2VWJA 5KT2A 3KK1B 3LWLA 5KFIA 4NLYA 1SH3A 5HLFB 3SNNA 1T03B 3SUNA 4AHCA 2WK4A 4FJ9A 3NCIA 4KFBB 4KHYA 3RWUA 4DSIA 3L2RA 3PR5B 4FJLA 2A1SA 4IFVA 1HARA 4KI6A 4KI4A 1HQUB 1BL3A 2VG6A 1DTQA 3CJ4A 4EBDA 4RW9B 3NL0A 3QEWA 5JUMA 3N6NA 1RT7B 3QYYA 1NK7A 3EZ5A 4QWEA 3CDWA 3MXIA 4MIBA 4RZRA 2FJVA 1B9FA 4E7HA 3ZSWA 3H5XA 4O4GA 1RT4B 4W5NA 4CJVA 2QK9A 3ZSZA 4YP3A 3QZ7A 1KCFA 4YMEA 5D3GA 3VN5A 3DLKA 1I3AA 3KD5E 2P5OA 4CFDA 2KW4A 1B92A 2DPJA 1T7PA 5EWEA 1W9HA 1T3NA 1K1SA 1N6QB 4M95A 3DLBA 4I2PA 1S1XB 2FVQA 4F4XA 4B08A 3CJ3A 3MFHA 3I5CA 1HPZA 2RDIA 3V1OA 4J9PA 1JLAB 5KFAA 4KHNA 2O4IA 4ECYA 1ITGA 4Y2CA 1RILA 1NJWA 3KKRA 3HVAA 4ECVA 2YKMB 5KFJA 2WOMA 4F4ZA 3TAFA 1TK8A 1JLBA 2B43A 4CJLA 4FK0A 4PA1A 3SI6A 4I2QA 3DOKA 1S9FA 2X6SA 3G6VA 3L2WA 4DF8A 4K8ZA 4ECQA 3DRSB 4HKQA 2D3ZA 3CM5A 5KFYA 3BSCA 3KD1E 4WYWA 4NYNA 4K4WA 3MF5A 3FSIA 1MU2A 4AHRA 3FFIA 1RBUA 1C0UB 4CF0A 1RDDA 3LP1B 1CSJA 4FLZA 1JLFB 1BQNB 3TAGA 4O3OA 2C2RA 3DOLB 4DQPA 1IKWB 3AVMA 3ICLA 4CK2A 5HRNA 1QS4A 4UQGA 1A5XA 1TKDA 4K8XA 3QZ8A 1HYSA 2IJNA 2ZKUA 3KOAA 1XR6A 2ALZA 3QGHA 5DQGA 4GC7A 3NH0A 1C0MA 3ZSQA 1EX4A 2CKWA 3NGDA 4DQRA 4MH8A 4IRCA 3RB0A 3VQEA 2E6LA 1S10A 3S3MA 1UWBB 5KFHA 3BQ2A 3I0RB 1VK0A 3CYMA 3BGRA 4XPEA 4NLSA 4CE9A 1HNIB 2RKIB 5KFPA 3QINA 4CEOA 5KGWA 2VG7B 1RT5A 4O3PA 1JLEB 2P1JA 3K5MA 2ATLA 4W5RA 2JC0A 2OYQA 3MECA 4FLUA 4KHSA 1EETA 4ICLB 3NAIA 3KHHA 1JLGB 3VQ4A 3V6DB 2J6TA 2O5DA 2JEIA 3GYNA 4OKEA 1Q8IA 3DRPB 2IJFA 3OYEA 3FQKA 1NK9A 2R2UA 4B8CA 5E41A 3BSAA 3PW2A 3RR7A 2JEFA 3PHEA 3NF7A 4H8KA 3QIPB 4JV0A 4Q45A 4NLOA 2R8HA 1TVRA 3H98A 2YNFA 3ASMA 1XHZA 1KTQA 4DL2A 1ZYQA 1RT3A 1KVCA 4Y1CA 3L8BA 3OYJA 4DQSA 3I0SA 4J9OA 4Z4FA 4KSEB 2WONA 4WZQA 3NFAA 3MTKA 4KO0A 1D0EA 4IRDA 4YFUA 3CFPA 3KLFB 4ZP9A 4ZVFA 4MKBA 4O0IA 4Z4GA 1S9GB 3LP0A 2R8JA 2I5JA 1BCOA 3OYAA 3N6MA 2W42A 4CIEA 4CGIA 3ZSOA 4NRUA 2C2EA 1YTUA 2HNDB 2HMIA 1NOYA 1VSDA 2QXFA 4DS5A 3SV3A 1F21A 2W8LA 4O4RA 3HPOA 4MK8A 4J9LA 2YNHB 3MEDA 1ASWA 3GIIA 1XR7A 3V6HA 4DWIA 4DU4A 3OSNA 4HYKA 3LP2A 4RW4B 1RDBA 5L1KA 4ECTA 1CXQA 3U6FA 1KRPA 1I6JA 4NLVA 4HTUA 5I42A 1LW0A 3SUOA 5DGBA 2OZSA 3TI0A 2X78A 4Y34A 1DLOB 4Q44A 5I3UB 1OS5A 2W9CA 3BJYA 1C1CA 1T8EA 4QW9A 2YHBA 3HVTA 3NGZA 4DSFA 2R2RA 2FLPA 3H5UA 3NF6A 5KFTA 5DMRA 1SL2A 1T05A 4LSNB 4CJEA 3KHGA 3P1GA 4PQUA 1RTJA 1J53A 5J2QA 2RDJA 1JIHA 3HHKA 4ED6A 4J9RA 4Z4HA 5HRPA 2OPPB 4O44A 4ELUA 3C95A 4DL5A 4NLUA 3DLGB 3FDSA 4Q43A 4H4MB 3O3FA 2OPQB 3SCXA 1C0TA 1NK6A 1JL2A 1GX6A 4I7FA 1RT6B 4JV1A 2HAIA 3DLEA 3ZT1A 2D3UA 3M8QB 4DTXA 4HUEA 3OYHA 2AGOA 3IGNA 4IRKA 1S9EB 2HHQA 3OJUA 4E3SA 3G6YA 4TLRA 4QWDA 2PZSA 4FLYA 4IFYB 2B5JA 2Z1JA 4HUGA 4CF2A 1C2PA 1HJRA 3PY8A 3HPHA 3OYCA 3RB3A 4CEBA 3K58A 3V9UA 4CHPA 3O3HA 4KBIA 3DDKA 3M8PB 5KFCA 4DF4A 4RW7B 3KLVA 2XI3A 1S6PA 5KT5A 5CY4A 1RCHA 1S1UB 1W0HA 1XC9A 5SZTA 2BE2A 4FZXC 2OPSB 3BQ0A 1L5UA 2GIQA 3AA5X 3DI6B 1HQEB 4K4YA 3SQ2A 3HVWA 1RAJA 5FRNA 4XIUA 4DU3A 3TANA 3DLHA 3CM6A 3U3YA 3CFRA 3OL8A 1SL0A 3IG1A 2R8KA 5J2PB 4YNQA 4O5BA 3K5NA 1QE1B 5KG4A 4PUOA 4C8OA 2D5RA 1BIUA 2BQRA 1BCMA 4DTUA 3B6PA 1SKWA 4NCGA 1RA7A 4J9KA 1UA0A 3AA3A 2DTUA 3OLBA 3OHAA 3IRXA 3AO1A 4FLTA 1S1WA 4IDKA 3RTVA 5KG6A 2W7PA 1GX5A 1UA1A 3MEEA 2RN2A 1DTQB 1J5OB 1NKCA 3OYDA 3CVKA 4OLAA 5C24A 1JLQA 4Y1DA 5CYQB 4W5OA 1LWEB 2XGPA 4NLWA 5DK5A 3HVRA 2ATQA 1REVA 3H2LA 1QTMA 4ZHRA 4CGGA 4FJKA 3CJ0A 1VSEA 1ZTTA 2KZZA 4TXSA 1QQCA 1WNSA 4FLXA 4H54A 3QNNA 4DQIA 1JLCA 4ZTFA 4OPKA 1BI4A 1C1BB 3SUQA 3QGGA 3RRGA 2G8KA 1KLMA 1VRUB 1GOCA 3KLGB 3TVKA 4RUCA 4N56A 4BDYA 4YR2A 2ILYA 4I2PB 3RRHA 1QSSA 5KFLA 3V6JA 5KGXA 3MR3A 1HPZB 3S3OA 1JXEA 3M9NB 4AHUA 2XWYA 2ZE2A 2R2TA 4DFKA 2W9AA 2JLEA 4ECUA 2JC1A 4KHRA 4B9TA 1XHXA 4F4KA 2IC3B 3QEIA 4DTRA 3V9SA 4CK1A 2G8UA 3HP9A 4RW8B 3E51A 4CHQA 4FK4A 3L2VA 3SQ4A 4M3TA 4CJFA 4KTZA 5J1EB 1WAJA 4CEFA 5DG7A 4R8UA 3OS0A 3CFOA 3I5AA 4ZPDA 5KFOA 2IM0A 2VWKA 4IBNA 2XY7A 2BQUA 3KK2B 1TQLA 4FW2A 4OVLA 3K5LA 2ITGA 4TY8A 2GV9A 1ZBHA 2ZD1A 5T7BA 4FZYA 4L8RB 3TAMB 4OGCA 4E7JA 4ECWA 5F9LA 1LV5A 4H4OB 4LSLA 3L3UA 4CF8A 1HNVB 1L3TA 4CJ3A 3S9HA 3EYZA 4DTMA 3E01B 3TR8A 2UUWA 1B9DA 1A5WA 4CHYA 2PY5A 1TL1A 2DY4A 3RBEA 3JYTB 3KJVB 3V9WA 1S49A 4JUZA 2KTQA 4CEAA 2RF2A 3TAQA 3KLIB 2C28A 3MXMA 1S0MA 3QEVA 1CZ9A 3VQ8A 3V6KA 1X9SA 3MECB 1QAJA 2BGGA 4QCLA 3AVHA 5HRRA 1S1TB 4M3YA 4KKOA 3U3GA 2IM2A 3BSNA 2J6SA 4C8LA 4DSLA 2KQ2A 4Q5VA 1RTHA 1TV6A 4DSEA 3SPZA 4R5PA 5J2NA 3Q8PB 4DFPA 4BWJA 2WB4A 4CHOA 4Z4IA 4KRFA 1L3VA 4FYDA 3RR8A 1TVRB 2IBKA 2YNFB 1S0OA 4FJ8A 4CHNA 3KTQA 2E9ZA 4RU9A 3PX4A 3WNHA 4DFMA 3CO9A 2Z1GA 1WSHA 2IAJB 4FM2A 3I0SB 3MXJA 1VSFA 4Z4EA 3C6TB 4KV8B 5KFMA 1Z25A 4WFYA 2BDPA 2B6AB 3ZSXA 2KFZA 4O3SA 3ZT4A 1MMLA 3D0PA 3ZSRA 3VQPA 4QOZB 3QLHA 1WSIA 4FJIA 1L3UA 5L9XA 2FLLA 4DL6A 5HBMA 1WSGA 2XY8A 2YHAA 4URSA 1TK0A 4KAZA 2E6MA 3DMJA 4FLVA 5KI6A 2XI2A 1EP4B 4IG3B 1IKYA 1LWFA 1RT2B 2AJQA 1ZBIA 4TQSA 4FJJA 2HNYB 2OPRA 4ECZA 3OYMA 3G86A 2HNZB 3LALA 4WE1A 5C5JA 3CDEA 4NLDA 4R0EA 4EO8A 1N56A 4IR1A 3D45A 1WSFA 3T5JA 1WAFA 3OYKA 4JLHA 4ELTA 4XO0A 4GVMA 1S0NA 4Q8EA 4B3OB 3UDLA 3LZJA 1YVUA 4EZ6A 3Q8SB 1GOBA 4Y3CA 1RTDB 3SZ2A 3G6XA 2OZMA 5CYMB 3H5SA 1U4BA 4RNOA 2PYLA 4RNNA 4BACA 5CZ2A 4ID5A 1CLQA 4B9SA 3HSTB 1IKVA 3V81B 1T05B 4KREA 1S1VA 2QKKA 4TSXA 4M41A 3PZPA 4IG0A 4YR0A 5T14A 2GBZA 1NK8A 4F3OA 2HW3A 4FXDA 1FK9A 5KRSA 4O44B 5EU7A 5FRMA 3AVNA 4E1MA 4RW6A 4FBTA 1VRTA 4QWBA 3MEGB 1VSKA 2G8IA 2HB5A 5C25B 3SQ1A 1JXLA 3NF8A 2YNGA 4J2DA 3JSMA 4Q8FA 2G8FA 3C6UA 3DRRB 3THVA 1I39A 1RT1A 3OSPA 3KKSA 4K50A 4NLTA 4NYZA 4KTQA 1LW2A 2XCPA 3CG7A 4LQ9A 4DG1A 1JL1A 3MR2A 3F9KA 2QKBA 3S3NA 5L1JA 4N76A 2J6UA 3CWJA 2AU0A 2UVVA 4KHUA 4DTPA 4CEEA 1DTTB 3KK3B 3HL8A 3VQ7A 1N4LA 3PW5A 4CF9A 3LDSA 1Z26A 4WXWA 5HLFA 1T03A 1KFDA 1TL3B 3IS9B 4ZP6A 4KFBA 3FRZA 1JXBA 2HHUA 1O1WA 1TP7A 5HP1B 4K4VA 4CJWA 2AWZA 4O3NA 1IKXB 4CJ4A 4CGFA 4J9QA 2FJXA 5KT6A 4RW9A 2R8GA 5FDLB 2DFHA 1K6YA 4J2EA 4M3UA 4Q0BB 3KIOA 3SI8A 3NBPB 3AVJA 2XY6A 2IOCA 1HYVA 1IG9A 1RT7A 3DM2B 3HXMA 5KFZA 4K4SA 3NKYA 3MR6A 5K14A 3QO9A 4RNFA 1RT4A 2EC0A 1C6VA 4DL7A 5C42B 3IRXB 5JS2A 1RTIB 1U09A 3Q8QB 5KG5A 1BQMB 4CK3A 1NHVA 3K5OA 4DSKA 3RMBA 4J9SA 4OPJA 1RNHA 3OY9A 1N6QA 2R2SA 1S1XA 2IS3A 1NJXA 3VQAA 3HKWA 1WNEA 4MK9A 1TKTB 3BR9A 4ELVA 1JLAA 5KFWA 4CGHA 1RDRA 3VQCA 4FVMA 5KRTA 2YKMA 4C8NA 2R7YA 2BR0A 4HCCA 1ZTWA 5HRSA 3VQBA 4LY7A 4W5TA 5SWMA 3H59A 2OA8A 3DRSA 1SUQB 4PWDB 4ZPAA 3OL9A 1S48A 3KLEB 1U48A 3PVXA 1FKOB 1C0UA 3LP1A 3SYZA 3V4IA 1JLFA 1BQNA 5KFRA 3Q8RB 4RNHA 3AVLA 1IKWA 4RNMA 2ZE2B 3CQ8A 5DLFA 5KG2A 4FJNA 2E9RX 5DG8A 3G0ZA 5F8JA 3KNAA 2YV0X 4LQ3A 1WSJA 5J2MB 3ISNC 4NLPA 2XRIA 1TKXB 3ITHB 2IM1A 2F8TA 1FKPB 3BQ1A 4KHQA 3BREA 1VSMA 1S6QB 4B9NA 4ED0A 2Y1IA 1UWBA 4NRTA 4HCBA 1Q9YA 4G1QB 2ASJA 4OL8A 3I0RA 2C22A 4OKJA 4JV2A 2ASDA 4LH4A 4TY8B 1KVBA 4E89A 1WN7A 4ZTJA 3AVFA 4O0JA 4E7KA 4NLRA 1HNIA 2RKIA 1NHUA 2VG7A 3G10A 3TABA 2YNIB 1JLEA 1RDCA 5KFDA 1JKHB 1TK5A 3OL6A 1NNDA 4DTSA 4FM0A 4ICLA 1JLGA 3PV8A 4TN2A 1HMVB 3KLHB 1N5YB 1U04A 3KHLA 1YVFA 4JS4A 1TL1B 3AO4A 3SFUA 3GIMA 3PO4A 3OL7A 2VG5B 5KFEA 5KFGA 4BDPA 3ZT3A 3H40A 4NLXA 4IKFA 5F8MA 3T5LA 3OVNA 2IMWP 4IKAA 3GV5B 3SUPA 1Y97A 4EYIB 4IFVB 1LAWA 3N6LA 4CESA 3D28A 3GIJA 3KLFA 4KB7A 3HK2A 3UR0A 4DTOA 4EZ9A 4C8KA 4CEQA 2D0BA 2VG6B 1S9GA 1KVAA 1HRHA 1D5AA 1ASUA 4K4XA 2BQ3A 2HNDA 4OJRA 4BE1A 1XI1A 3T3FA 4CJQA 4M3XA 3IAYA 5KFNA 2FBYA 2IA6A 4O3RA 3NH2A 4O4GB 4G3IA 4NYFA 2FBTA 5D3GB 2BRKA 4J2AA 4CFBA 3K59A 3DLKB 4RW4A 2AX0A 2V4RA 3SFGA 2VA2A 1SH0A 5DQHA 5JS1A 4OLBA 5HBMB 2E4LA 4DTJA 3AO5A 4N41A 5EWFA 1DLOA 3F73A 2QV6A 4TYBA 3NMAA 3RMDA 5F8GA 4Z0UA 3AO3A 3C94A 3LP3A 2AQ4A 1NJYA 2WOMB 4LSNA 1JLBB 1BGXT 1RDAA 4I2QB 3DOKB 2NUBA 4EO6A 4LH5A 4ZVGA 4CEZA 4HVJA 5KFXA 2OPPA 4AHSA 4O55A 4RG8A 2AX1A 1LAVA 3DLGA 2AGQA 1MU2B 4H4MA 3FFIB 3K57A 2OPQA 4JRPA 5EUHA 1RT6A 5FROA 4DFJA 3LAKA 3GIKA 2IDOA 2XHBA 2G8WA 3M8QA 3QERA 1TAQA 4W5QA 3V1QA 4DTNA 4ID5B 3VA0A 1IO2A 1S9EA 1HYSB 3EPIA 4FJHA 4QW8A 4IG0B 4IFYA 4FJ7A 1R0AA 5EDWA 4FCYA 2FC0A 3HO1A 3ZSYA 3M8PA 3O4QA 4M3RA 1SKSA 4RW7A 4J9MA 4B9LA 1S4FA 3JSMB 5KFKA 1SH2A 3BGRB 4DLEA 1NKEA 4ZPBA 1QSLA 2UVUA 4F50A 2OPSA 3ALYA 3OYIA 1KHWA 3DI6A 1HQEA 1RT5B 1U47A 3DYAA 4F3TA 3M8SA 1K1QA 4C8MA 4ZPCA 1X1PA 1EETB 1J54A 5L1IA 1XR5A 2YKNA 5J2PA 4KE5A 3LANA 1QE1A 5HROA 4MK7A 2F8SA 3OS1A 3VQ5A 4N47A 3LZIA 4AILC 5KG3A 3V9ZA 4ED2A 2EX3A 4O3QA 1RT3B 1J5OA 3AVGA 4E19A 5F8HA 2X6NA 1ZBFA 4ED3A 5CYQA 2WONB 4KO0B 1LWEA 3SQ0A 3HJFA 3LAMA 1SL1A 2X74A 3NGIA 2B4JA 4B9MA 1RA6A 3HPGA 1SKRA 3LP0B 3NAEA 4TQRA 2I5JB 4MFBA 2G8VA 4LD0A 5K14B 4CECA 3QO9B 1KLNA 3LPUA 3KMQA 2HMIB 2UVRA 1VSJA 2XO7A 4KB1A 3AVBA 4IH5A 3AVKA 1C1BA 4KTWA 4JS5A 4F4WA 3V9XA 1VRUA 3VQ6A 3MEDB 2Z1IA 3KLGA 1LWCA 1SV5A 4FJMA 4QWAA 4CJ5A 2Q3SA 3ZCMA 4F4YA 4WFXA 2GC8A 3HYFA 3NHGA 2HHTA 5KFSA 2D0CA 3LP2B 1X9WA 2W9BA 5KT3A 3WNEA 3NF9A 1TKZA 3I5BA 2FBVA 4B8AB 3MR5A 5I42B 1LW0B 4ZP8A 3D5MA 2IC3A 3O3GA 4DMNA 2ASLA 4E7IA 3ISND 4K4UA 2KFNA 4RW8A 3L3VA 4BE2A 2W9CB 4URQU 3A2FA 4B9UA 4CJRA 2FVRA 5J1EA 1C1CB 4FK2A 2V9WA 3AA4A 3HVTB 3CJ5A 1CZBA 3H08A 2HHSA 1Z4UA 2O4GA 5L1LA 4ECRA 1RYSA 3KK2A 4FBUA 1QSYA 4PQUB 1RTJB 3V4IB 3QIOA 4CIFA 4K4ZA 5J2QB 4KPYA 5KFFA 3UQSA 1T94A 4J9NA 2C2DA 3TWHA 2BANA 2IGIA 4FJXA 2FLNA 3TAMA 3ZT0A 3RMCA 4GC6A 3WNFA 1C0TB 4DEZA 3GQCA 2XY5A 4H4OA 4I7FB 1RBTA 3AA2A 1HNVA 3DLEB 2VA3A 2Y1JA 2PYJA 4ZVEA 1EXQA 5KG7A 3T5HA 3ZSVA 4ED7A 3E01A 3PJXA 3K2PA 4ED8A 4AHVA 4I9QA 3PUFA 3TARA 3JYTA 3KJVA 2G8HA 2ETJA 5KT7A 2B5JB 3QGIA 4Y2AA 4BE0A 3KK1A 4M45A 3KLIA 4ZP7A 1U45A 1VSLA 2W7OA 3AVCA 4M3WA 3PW0A 2JEGA 3PJWA 4CJKA 1Q9XA 3MFIA 4NLGA 1S6PB 4DL4A 5CZ1A 1D9DA 1S1TA 4DS4A 4QAGA 4EBEA 2BE2B 3L2QA 4IR9A 1HQUA 3TAPA 2KZMA 2FVPA 4I9LA 5KFUA 3VQDA 4MQ3A 3HP6A 1L3SA 2DPIA 1RBSA 1NKBA 3PW7A 3OJSA 5EWGA 4HUFA 2E9TA 1QUVA 4X2BA 3L2UA 3IG1B 3TAEA 2JEJA 5KFVA 3P5JA 3P83D 4PUOB 4EBCA 4AHTA 1NK0A 4FS1A 2IAJA 4DSJA 4NCGB 1TGOA 3C6TA 4KV8A 2JGUA 3QEPA 1XWLA 1S1WB 4IDKB 2B6AA 4CJSA 3MEEB 3AO2A 3ZT2A 4OKKA 4CGJA 1ASVA 5C24B 3OLAA 3QESA 1JLQB 3NAHA 5F9NA 4EP5A 3PX0A 2ILZA 4HHTA 4ZMMA 2BRLA 4N5SA 3T19A 1REVB 2F8EX 4URGA 4ZHRB 1D8YA 1EP4A 4IG3A 1J9AA 1RT2A 4YR3A 2GIRA 2I1RA 4TYAA 1BHLA 1JLCB 1U49A 3H4BA 1IH7A 2HNYA 1BIZA 1G15A 2HWHA 2ZQBA 2HNZA 4ED1A 1BI4B 1KLMB 3UIQA 3MAQA 4FM1A 2HHWA 3WNGA 4FW1A 2GUIA 4MIAA 4B3OA 1D1UA 3GILA 4FS2A 3AV9A 3SJJA 3DOLA 4EEYA 3OYBA 3EPGA 1RTDA 4CJUA 1UOCA 4CJPA 1NK5A 2P5GA 2P51A 1RYRA 5CYMA 4KHMA 4OGEA 3V81A 2HWIA 4IH7A 4F8RA 3OHBA 3CDUA 4MKAA 4E1NA 1W25A 5F8NA 4K4TA 1A5VA 4TY9A 4FLWA 3QNOA 4R8UB 3VQ9A 3H4DA 3GV7B 5DGAA 4ECSA 3RBDA 1WLJA 3MEGA 2V0NA 3BDPA 1HYZA 5C25A 4KAIA 3B6OA 4EYHB
chains in the Genus database with same CATH superfamily
3QETA 2DNHA 1S57A 3NE6A 3QQCD 2KKZA 3M7VA 3OFGA 4A8XA 2RPIA 2DGTA 3J7YI 3VA3A 2AYGA 3V6DA 4RUAA 3OYGA 2HZCA 1RADB 1V5VA 1DTTA 2KN4A 1DQ9A 3KK3A 3DKDA 3O9TA 4LIWA 5KFQA 2CYYA 3PX6A 2VBWA 1ZBUA 2XULA 4KIAA 5GAHI 3TTDA 4I67A 2QX0A 5C2CA 1EJ7L 3V2UC 2PD1A 2FBXA 1Z2ZA 4RBTA 3MCAB 2AD9A 5HI7A 3WQUA 2XGQA 3ELHA 5B0BA 1YBUA 2C2MB 4P52A 3CI5A 2OFHX 3ONQA 3L09A 4F0HA 1NMDA 4CGDA 3EZUA 4PWUA 3Q2TC 4TVAB 2LQBA 3NBPA 1G3OA 2E1YA 2I0XA 2LSNA 3L0QA 1CXUA 3A13A 2WRMA 2Y3YA 5J2NB 2EXUA 4QWCA 2NPIA 2AGPA 1GXUA 4KHWA 3IN5A 1NB2A 1U1NA 1VC6A 2PO4A 4ZVPB 3IGVA 3VAKA 3NGYA 2FGCA 2FVSA 3D6TB 1N5VA 6FDRA 1UVLA 2FVCA 2KFYA 1TMMA 1F9EB 4YN3B 5LXYA 4P71A 3I82A 3FZMA 3R27A 3BZCA 2XMJA 2IHR1 3OS2A 4IQXA 4DV6K 4WZMA 2WHOA 3L95X 4QPXA 1VSHA 5A8WB 4IOBA 1FRLA 2CG4A 4C6AA 1VC0A 1G7CB 5B7WA 2DNRA 3WHIA 5GADI 5AFUA 5I3UA 2CJQA 2VQEK 4IFEA 3CCEN 1KBRA 4JOUA 4F25A 2PMHA 5AQUA 2FJWA 5EX3A 3LM9A 1VQYA 5DDOC 2GS8A 4K0KF 2HHXA 1RBVA 1YJ7A 5M1PA 4DPUA 3OYNA 4E0DA 1Q81T 4DLGA 1TKZB 3DGPA 1Y7PA 2ZH8A 3H42A 4AL6A 1GLAG 3LDQA 2ZC3A 4J9UE 2PSZA 2M52A 1TKXA 4JHDA 3CCZA 3OVSA 1PC4A 5ETSA 5FLXY 1A6LA 1UAXA 3MM7B 1E3MA 3DDNA 2IDLA 1S6QA 3OTOK 2EFVA 2FUG9 3AFGA 1S1VB 2PEBA 5KTQA 3HDSA 1S97A 1FT8A 2DGSA 2LEAA 3F9MA 2VQEJ 3EY1A 2CQHA 3CCSN 3I8BA 1Q7YT 5KPZA 1GQEA 5FLXU 1VRTB 2YNIA 1UVMA 5AQRA 4LF6F 1YJTA 3BF4A 3C6UB 1V4TA 3KMSA 4QS9A 4CERA 4CZFA 4CEDA 4E7LA 2K3IA 3J7ZO 4F2SA 2NRXA 3QGPA 5F0WA 3CIZA 4MMOA 5JVGL 2R7UA 3OFHA 3D68A 4ZJOA 1WC5A 4FP9A 5CQGA 5HLFB 3SNNA 1T03B 3SUNA 3MAAA 4AHCA 3HTVA 2JSXA 2WK4A 3NCIA 1A9NB 4WWSA 3RWUA 1F1BB 3VAHA 1PBAA 2DISA 3L2RA 1OYEA 4GNIA 2YPZA 3M1VA 1HQUB 4DXLA 4FF1A 2E1CA 4ZN1A 3OUYA 2OTJS 3ISZA 5B0CA 4EBDA 3NGTA 1YGYA 3QEWA 2E88A 2XYHB 2DY1A 3CXCR 1N5TA 1RT7B 5IWAK 3EZ5A 3R1LA 4IOXA 4PQAA 3CDWA 3MXIA 2OHDA 3ZZUA 1A7GE 4KT0C 2P9LB 1H72C 1AZSB 4KJIA 2DIVA 3ZSWA 4O4GA 3GR0A 1RI7A 9ATCB 1VQ5N 2PDAA 4YP3A 3QZ7A 4FYVB 1T3VA 2P9NA 1I3AA 2P5OA 4CFDA 3SK3A 2JH3A 2M7SA 1PIEA 4P7TA 3VAGA 5E3RA 1N6QB 4M95A 3F44A 4UOFA 3E66A 5D0HA 2DH7A 3VAJA 3I5CA 1ATRA 4ANEA 1EHWA 4DPOA 2BJ7A 3PNIA 4HLBA 4ZJQA 4CRJA 4J9PA 5KFAA 4PXDA 1FNMA 4CNZA 4QIEA 1VQ6N 4ECVA 1SPBP 3M2RB 2YKMB 4BRPA 1W26A 1JLBA 4PA1A 1FX2A 3VEVA 4K8ZA 4ECQA 1F60B 3DRSB 2D3ZA 3BSCA 3LF0A 1F5CA 3MF5A 6AT1B 2QWPA 4HHHA 2W41A 1U0HB 2C2RA 2O3DA 5HRNA 2YX7A 1QS4A 3CCUS 1TKDA 2BH1A 3QZ8A 2OTLS 5HSPA 1XR6A 4GC7A 1NGAA 1K73O 1C0MA 2QYGA 1JJ2M 3TX8A 3D66A 4DQRA 2JFDA 4BRNA 4MH8A 3QMLA 4IRCA 1VAZA 3RB0A 3CCVS 1D09B 1S10A 3OHRA 3BQ2A 2QLXA 1N36K 5ETLA 3CYMA 2HQDA 4GRSA 3HSZA 1HNIB 4DPYA 5KFPA 1CULA 4CEOA 5KGWA 1JLEB 4JI3F 2P1JA 3MECA 4E2FB 3KHHA 3VQ4A 2O5DA 2JEIA 2WBNA 3ID6A 1RHQB 4ISFA 1NK9A 3TPQA 2NRTA 2XHWA 3W8GA 3MWTA 3RR7A 3PHEA 3QIPB 2FJAB 4DV2K 1CJKB 2R8HA 2A41A 2NLWA 1TVRA 3ASMA 1KTQA 2LXFA 5FPMA 3FCWA 4OZJA 1WTFA 2PN6A 4DQSA 4J9OA 4Z4FA 2BW7A 4V19S 3NFAA 2CPFA 4JKDA 4LF7F 1Q16B 5HOOA 4C98A 2RRAA 5FLXO 1ZPVA 3CFPA 3KLFB 2W2NP 4PG4A 2DR6A 1WC1A 1S9GB 1MG7A 3LP0A 2R8JA 5JVHQ 1REGX 4CIEA 4A46A 4WFAL 4NRUA 2C2EA 3A3NB 3ET6B 1U2VB 1VSDA 1DHMA 4NEZA 3HPOA 1SI9A 2UU9J 4MK8A 1ASWA 2YNHB 3GIIA 1XC3A 1XR7A 3M2UB 3W0LA 4CH7A 3LP2A 1X7VA 2FTRA 4JEPA 2UV8G 3CO0P 4FL9A 4ECTA 1YBAA 3U6FA 5GAGP 1LW0A 1VS3A 3SUOA 2HHHJ 2OZSA 4RR5A 3M8WA 4Y34A 1DLOB 4LFCF 1E6VB 3OW2M 5BYRA 2E1AA 3PSFA 1NBWA 3T9NA 5JJBA 1WTBA 5T7LA 3FFKB 3HVTA 5KFTA 4H4KC 2C3MA 4CJEA 3P1GA 1KQGB 3CC7N 1RTJA 5J2QA 3HHKA 4ED6A 4CBWA 4FWMA 1AFJA 2I2YA 2GNKA 2OSRA 2IMOA 2RNEA 2ZJPQ 2XYGB 4OQJA 4CI6A 2Z58B 4I7FA 1JK9B 4RLEA 2D3UA 3HCXA 4LBHA 3M8ZA 1ATSA 4ZOSA 4HUEA 1RXOB 5BXIA 1XNRF 2BX6A 1U24A 4IRKA 1S9EB 2KXFA 1S7HA 4C0HA 4QWDA 4OJ1A 2UUBJ 4IFYB 3SMPA 3VGTA 4HUGA 3PY8A 3RB3A 1JWWA 4JI4K 4CHPA 3J7AP 3KLVA 3QNWB 1S6PA 2DNOA 4Y6IA 5SZTA 2R7SA 2BE2A 4LFAK 2E5GA 1Q95G 3HFVA 4HL9A 2GIQA 3J7A1 3DI6B 1TYQB 3TZXA 3G8QA 3CJ1A 2HQFA 3HVWA 2A5XA 1QQOA 3CM6A 3CFRA 2VONA 3OL8A 3IG1A 1WBBA 2I7NA 1UJ6A 1Q7LB 2CJXB 2J4RA 4KR0B 1QE1B 1Q5YA 1EWRA 4BR9A 4NCGA 4NMLA 2Y0SD 3OLBA 4B3MF 3AO1A 2FHKA 5AT1B 4IJNA 4X62K 1BY9A 2RN2A 4IO9Q 2UXCK 3OYDA 1DQ8A 5C24A 3W9IA 2XMTA 4PG8A 4DOZA 2VQFK 1QZ6A 3UKUA 2ATQA 3SQOP 3N4QA 2J76E 3MN9A 4JK9A 3FE1A 3NXZA 4FJKA 2DNMA 1VSEA 5I3PA 3H45C 1ZTTA 3EDRB 1W2BM 5LJWA 4TXSA 5H9EK 4XH1A 1N32F 2HQCA 3KDNA 4DR3F 4EHTA 4OPKA 1NU4A 5LSOA 1WOSA 2G8KA 5LJ3Y 3KLGB 4BDYA 1QDUB 2ILYA 4I2PB 2BM0A 4GKJJ 5KFLA 3V6JA 1HPZB 3Q8UA 4AHUA 2HS3A 3THXA 1YX2A 3DRYA 4BC3A 2ZE2A 2R2TA 5CD4H 1NLVA 3W60A 4P72A 2JLEA 4ECUA 3CCJN 4PXBA 2JC1A 1XHXA 2IC3B 2QLBB 4LF9F 2YQ1A 2FD2A 4RW8B 3T6BA 4FK4A 3L2VA 4M3TA 2YKPA 1PG5B 1FJGK 4BVPA 4NPOA 4RWWA 5LMNF 2IJRA 2IM0A 4DUYF 2VWKA 2BQUA 3VGSA 3Q86A 1TQLA 4MT1A 2GVDB 4JYAF 2GV9A 4L8RB 1NU0A 1G1XA 3K8VA 3VGVA 1S3XA 4OGCA 4EGLA 3GE1A 2OI2A 3MM8B 4LSLA 3M1FA 4CF8A 4CJ3A 3L7PA 2IYGA 7FDRA 2ZBRA 3VEXA 3E01B 3MMAA 3J80O 3C0BA 4CHYA 4DBQA 1W2BR 4FWRA 1T9UA 4UQTA 3RBEA 4ILMA 4JUZA 3CJKA 3AT1B 3FZHA 5AJ3J 3MI7X 1NPPA 3W5YA 2C28A 4OI6A 4ETXA 1CZ9A 1X9SA 2BGGA 2MQ8A 3ATVA 3AVHA 2FHOB 5HRRA 4KKOA 1R6VA 3MK6A 3CF5L 2J6SA 2V2VA 1VLOA 1RTHA 1TV6A 1FE4A 4R5PA 1H6KX 1WC6A 1Q53A 4FWKA 2V8HA 2B56A 1IBKF 3EL2A 2XNQA 4LRFA 3SXLA 2YKAA 1TELA 1VDHA 3CSKA 3MTJA 1H38A 2GMJA 4JI7J 5M2UA 3WNHA 1MMNA 1WSHA 2IAJB 2G0IA 2PFUA 1U1KA 2W40A 5EVZA 4Z4EA 4ZLJA 4KV8B 2V4JA 5KFMA 4WFYA 2CQDA 2XTJP 2B6AB 5TKYA 4CTAB 2ZH4A 3WXKA 1MMLA 2ACYA 5K9FA 3VERA 4QOZB 5BN8A 3AODA 4FJIA 3DNCA 1L3UA 5F41A 3EXCX 2CADA 2EPIA 2HRTA 4LIRA 5FIIA 4URSA 3NOCA 4K7QA 4KAZA 4F26A 2HS4A 2NRHA 4FLVA 1VBYA 4JI6K 2XI2A 1WSRA 1VIXA 3UE2A 4IG3B 1RT2B 1P90A 4LSZB 1ZBIA 2VPXB 2MZTA 2DIUA 4ZITA 5IS2A 3OYMA 2HNZB 5AZJB 4NLDA 4EO8A 4IR1A 4X4VA 2YHXA 4IO1A 3TUJC 3NGRA 2MKYA 1RKIA 4JLHA 1XMQK 3Q8YA 1C0FA 4EZ6A 3Q8SB 4Y3CA 2FC8A 3HI0A 4X4RA 1BQXA 3NVMA 3K0SA 3SZ2A 5CYMB 1U4BA 2MQPA 4RNOA 3SCLE 2ZJQQ 3LUYA 7AT1B 5GAHU 1IKVA 3AD8C 6FD1A 3HRGA 1VQKN 4KREA 1GTEA 3UCUP 4BRIA 1HI0P 4IG0A 2JFKA 4PKDB 4O23A 1FK9A 4K42A 5EU7A 4RUBA 3AVNA 4RW6A 2CQBA 3MD3A 3SQGB 3MEGB 1VSKA 2G8IA 1FD8A 3SQ1A 3NF8A 4Q8FA 5D0EA 3KKFA 2HHPA 3THVA 3L7OA 3PIPL 3I32A 2EEYA 3CPEA 4K50A 4WFBL 4MKYA 4AFFA 4OI4A 5DM6Q 5L1JA 3CWJA 1Z2LA 4DTPA 1DTTB 1I1GA 4EFAC 3KK3B 2ACMA 3LDSA 3TZZA 4WXWA 5HQMA 4KHPJ 1IBLK 4KFBA 2HHUA 3J7ZT 4CQ1A 2XM3A 4K4VA 5DETA 4UY8T 4CM2A 1OH6A 2ZF5O 4FF4A 3WXIA 1VK8A 2YX1A 3G71S 2R8GA 4J2EA 2AA4A 1UPPA 3NBPB 2DO4A 3HMJG 3AVJA 5FPNA 2V9KA 2IOCA 3TA0A 1T9VA 3A5MC 4DZ6A 4YOTA 1OPIA 2CQ2A 1NMEB 3OVBA 2XSJA 2LQJA 3T1YJ 2EC0A 2I7PA 3DWLA 2ZGZA 2H9ZA 3Q0AA 1U8WA 4YB7A 3JB9k 4DR4J 3VPZA 1U09A 3Q8QB 1XK8A 2CGLA 3IFEA 4DSKA 4DR7F 4H5NA 1P1LA 3OY9A 1S1XA 1NJXA 4DN0A 2DYAA 4ELVA 3IBWA 1IJFB 3B8AX 4RBVA 5KFWA 3MD1A 3NCQA 4RWTA 4ZCIA 4F36A 3OXGA 4FVMA 3LDPA 3B82A 2B4UA 4ISGA 2QO3A 3OD2A 1BU6O 3M3ZA 2YHWA 1HNWF 5DM7Q 3UDEA 2KHOA 1OVQA 2QWMA 4FPIA 2EG2A 1LCUA 4KH1B 5C0YA 1JLFA 4ITSA 4C9DA 1C4AA 2DT9A 1G99A 4WQ4C 5GAEU 1SC3B 4WQ5C 2E9RX 2FB0A 3DGPB 5DG8A 3HSJA 3QDKA 2RRNA 1TKXB 3CD6S 2BJ3A 4JHDB 3KG0A 4OLPA 4WP9A 1U7LA 4KHQA 3EZWA 3BREA 1VSMA 1S6QB 4C0OC 2AJ4A 5H1SQ 5GMEA 1AXQA 1DRZA 4AE5A 2IVYA 3AVFA 4O0JA 1TR0A 2VDHA 4QYRA 1IWAA 4NLRA 2K06A 1KDNA 4HI1A 1K73T 2VG7A 3ZTQA 3G10A 2YNIB 4PR6A 1TK5A 1M1HA 1NNDA 3GWCA 1VQNS 5BRDA 4KPCA 4ICLA 2JWNA 1JLGA 2CA9A 1YXQA 2P9IA 1KXPA 3VAFA 2HFZA 2ASYA 3KHLA 4JS4A 1TL1B 3SFUA 2E5LJ 1XNQF 4E1JA 4LBIA 1QM9A 2O8BA 1WELA 1CJTA 2O8FA 2CQ4A 2GUPA 3GSDA 2C2OB 5KFGA 1AW0A 3JXUA 3OTDA 3H40A 3MAAB 2IMWP 5IV3A 2DR9A 4LJMA 5BPNA 4Z94A 4DR6F 3GV5B 2RU3A 4GVEA 4H4KA 1Y97A 1IBMF 4EYIB 4K0KK 1CC8A 2KM8C 3D28A 3M1VB 4CLYA 3X3UA 4BRLA 2VODA 4CEQA 2QG9B 3BBCA 1UMJA 1D5AA 2LP4A 4EI2A 4YOYA 3PRVA 2YH1A 1Y4ZB 3VEYA 5IQ6A 3C6AA 3IAYA 5KFNA 4EAHD 4C8YA 2ZEJA 3CCTA 4XEIA 4X65F 4O4GB 2DTJA 1CLFA 1FJCA 2FBTA 2CQ0A 4ZN3A 4J2AA 2P9NB 2AX0A 4OI2A 1SH0A 4MDAA 2B4PA 2M2BA 2FJDB 4LF6K 3VALA 2RE2A 4A61A 2D3O1 5H9FK 3F73A 3ZNJ1 2XNRA 4BRFA 4ZVQB 3UFCX 1N33F 5E33A 4Z0UA 4A47A 1ZZNA 3C94A 1D9AA 2FDNA 3BH6B 3N4WA 2H51B 4Y2KA 4LSNA 1JLBB 3VTIA 1BGXT 3GE9A 4EO6A 2V52B 4ZVGA 2POKA 1RAOA 1HWJA 4HVJA 4OMFG 4RG8A 4C0BA 3DLGA 2ZHAA 4H0OA 3O9QA 2V50A 3W65A 1RT6A 1VHXA 2G8WA 2VC1A 1XQIA 4H0PA 3V1QA 4DV7F 3EVOA 4OYZA 3C66A 2VPYB 2V94A 3QMQA 4YORA 1TFYA 3OTEA 1YJWN 3PRBA 4FJ7A 1R0AA 3CC4S 3KXDA 1NPKA 4NI2A 3PXGa 2XB2D 3GP9A 2QMWA 1WHWA 4J9MA 2V6AA 4YOUA 4DLEA 2JNJA 4ZPBA 2RQMA 1JNRB 1PC5A 3ALYA 1CULB 1U47A 2O8EB 3EE8A 4F3TA 4ZPCA 3ZTSA 2FPHX 5L1IA 4OPAA 2DNNA 2FJEB 3CDAA 4MDBA 5J2PA 4ZLPA 2EFPA 4DDFA 2F8SA 4I6AA 1DBDA 4N47A 3V9ZA 2UV8A 3KZBA 1P8GA 4NWBA 2SXLA 2GAHC 2UUAF 1Q8BA 2HS0A 4JKAA 2EKNA 4E19A 3ENBA 2YQ3A 3CERA 3LGNA 2EBGA 1LWEA 2HWTA 2XEXA 2IVPA 3CMAN 1FRJA 1SL1A 1K9MO 4PG5A 2E7WA 2W2MP 3UD3P 1B0TA 2W6LA 1X8DA 4B9MA 2B4JA 3HPGA 3LP0B 1RZMA 3NAEA 2XSFA 2ZM6J 5CR4A 3HT0A 5K14B 1RGIA 4F4AA 5JVGQ 1KLNA 3HULA 3KMQA 3RW7A 1VSJA 4F3QA 2QA2A 4WIIA 3FSXA 3G2XA 1VGYA 3PACA 2MJUA 3AVBA 3AVKA 2MEWA 1UL3A 2D1CA 3BN4A 5B0FA 2LVWA 3MZIA 3V9XA 1VRUA 3D3BJ 1ELOA 1SV5A 1X3MA 4QWAA 1NB7A 1F6TA 1NSQA 4WFXA 3FJ2A 2HHTA 1UETA 3LP2B 1X9WA 5CAAA 3WNEA 3O3LA 4JI3K 2LA6A 4FKXA 4WTYA 1WACA 3MR5A 1LW0B 1JXVA 4YOXA 4DMNA 2KFNA 4F67A 2KG0A 1V6HA 5KQDA 1Z6RA 2RE1A 3HHEA 2W4PA 2FVRA 1IJJA 3W1YC 3SAGA 5T7LB 2V9WA 3HVTB 4B3TJ 1Z4UA 2Q66A 4ECRA 1RYSA 3LM2A 1RTJB 4CIFA 4K4ZA 5J2QB 2M0GB 1Q82O 1T94A 3IWXA 2BKNA 3RU0A 2W7AA 2ZH7A 3JXOA 1YQHA 4DV3F 1WEYA 3C2PA 4I7FB 3U02A 1HNVA 3H2UB 4PL7A 2Y1JA 2CXEA 2PYJA 4ZVEA 3C65A 2G0CA 4NB4A 2QIFA 1WG1A 3K2PA 3ZFVA 2R7VA 4ED8A 3TARA 3TJAA 2NNWA 1CPZA 2DO0A 2RQCA 2G8HA 2Z4PA 4X64F 1S12A 2V51B 3KK1A 4M45A 3KLIA 4ZP7A 1NDPA 1U45A 4OYOA 3AVCA 2ZH3A 3PJWA 2G2ZA 3MN5A 1S6PB 5CZ1A 4DS4A 4NA2A 1Q86T 2YHYA 3SMZA 2BE2B 1YRTA 2P5VA 2K8GA 1GXTA 1T44A 3BM7A 4P2MA 3KG1A 1ZAVA 1FDNA 3T1HJ 4MQ3A 1L3SA 2DPIA 4LF7J 2HQ3A 2YKQA 3OJSA 1U6FA 4LFCK 3NGUA 3IG1B 2K2PA 4C97A 3P5JA 1K0TA 2Q43A 1OPZA 2BJ9A 3R5BA 1MLAA 1P27B 4FS1A 3CCRS 4NCGB 2GMHA 3C8YA 1PCAA 1JJCB 2QL7B 2DH8A 3H1QA 3AO2A 1QAXA 4WFNL 1YIJN 4OKKA 2KH9A 3R9LA 5C24B 5A2QU 3QESA 3E8OA 5F9NA 4HHTA 3KJQB 1NDCA 3A4TA 3T19A 3ZZRA 3WT0A 3BF1A 3WQTA 2P9PA 1XNRK 3H7HB 3IMXA 2DK2A 3OA9A 3I55N 3P5TL 4AL5A 4YR3A 4FXVA 4TYAA 3NP5A 1IH7A 2XYPB 1KAYA 1TFWA 2AHOB 3EICA 1QVGR 4ED1A 2Z56B 3P5BP 4DB3A 4O8KA 3MAQA 1SJ3P 2GUIA 4B3OA 4FYXB 3OT9A 4NL5A 1VQON 2CJKA 3THXB 5C12A 1R3NA 1RTDA 3SSSA 4ZDNA 2P51A 2F9TA 4ES3A 2WBRA 4WFAQ 3L3CA 2GQCA 4EU0A 3BB5A 4MIWA 3OHBA 3NGKA 3CDUA 2UYTA 4F0MA 1FI4A 1VYAA 3W3SA 4K4TA 1X5PA 1M5KC 2APOA 3I33A 5HAOA 4BGAA 4KAIA 3B6OA 2G1HA 4EYHB 5CXTA 4B3MK 2MLXA 4ID1A 4JKHA 4LSLB 5KT4A 1B4SA 3R6LB 2OKQA 1VQPN 3G87A 2OP5A 1NK4A 1BISA 3DRPA 1H2TZ 3MMAB 5ETPA 4CJTA 4UZBA 2OH2A 3DXBA 2LDIA 2LQ8A 1M90O 3K8WA 3MURP 4JAXA 1HNZJ 1TL3A 3IS9A 3Q2SC 2O66A 3TRGA 3MUTP 3QBXA 1N32K 3I56N 3CJKB 1YTAA 2IRYA 4DCJB 2W8KA 2V4QA 4CHZA 4DR3K 5HP1A 3AY0A 2J5AA 4CD1A 4QR0A 1D9FA 2DFEA 3DYAB 1R0CB 1IM4A 2UXDJ 4NYPA 3R7NB 3QBCA 3PYGA 4KKOB 3DHWC 4YDUC 4AH9A 2DR5A 1RTHB 1TV6B 2B7CB 5AQWA 4R5PB 2A1RA 4NCBA 4OYWA 4XDDA 1KSPA 5HROB 2M8DB 1S72N 1XQSC 5M1NA 3M4XA 9RUBA 4IOCL 4LF9K 1ZETA 3ILLA 2JX2A 2D7SA 4OYMA 5M1FA 4DU1A 3AAWB 3VEOA 1VSIA 5LMNK 4NMXA 4DUYK 3LWMA 4CZJA 1NJZA 5FPDA 4CFAA 2AP6A 3CCMN 4USJC 1R8AA 3ETOA 2V4JB 4JYAK 2HLUA 4DR3J 4OV1A 4JI8J 2CAJA 4FF2A 1F2GA 4FJ5A 4OX6A 1R0BG 3NVKA 3ENVA 1NXIA 2U2FA 2ZWPA 4JRQA 1NAQA 3NH1A 2GHVC 2DD8S 3OV7A 5DDRC 3H5YA 4IO8A 1WSEA 4EUVA 1KVKA 5DG9A 2QSWA 2DFFA 3FBCA 3HT3A 3TP2A 1FKOA 2N4CA 4NLQA 4KH0B 2QTDA 3KHRA 4Z4CA 2ZJRL 4BVOA 2BKPA 2XHCA 2F5GA 2ITMA 2W9BB 2CQPA 4BDZA 4DX8H 2VBZA 4CLTA 3HM9A 1QJHA 5HK4A 1IJEB 1JX4A 2P9EA 3ITHA 1WHXA 3CIPA 1ITPA 3RZAA 3S1TA 3VQQA 5A2QO 1QAYA 3MOJB 1IBKK 4WFZA 4BREA 1IKVB 3JQMA 1AA1B 2E1MC 4FJGA 2G2YA 3IM9A 2XS2A 3C16A 4NCAA 3M9OB 2P6TA 1FK9B 5BREA 2BANB 2Z1HA 3QIDA 4D3HA 4GMJB 1RP5A 4RW6B 1CS4A 4OJHA 3MMVA 4W4MA 3V1RA 1KP6A 2HHVA 1JMTA 4L3NA 3U9ZA 1RBRA 3VESA 2V7YA 2FF3B 1HMVA 3MCMA 4TNOA 2IY5B 1GAOA 5F1XA 2GHWA 1WKLA 1NOZA 2DGUA 2VWJA 1FFWB 1KNZA 1RAIB 3R1HA 1FTRA 1RLDA 3DXSX 4DR1J 3LWLA 1S6OA 1V3SA 4HDGA 4FJ9A 3BF3A 4KFBB 1YZ6A 3EO3A 4KHYA 4DSIA 1Q78A 2IIHA 2QGFB 1N5SA 1HARA 4KI6A 2HKEA 2P6SA 4J91A 2DXDA 4OX8A 1DTQA 5EN1A 3MUMP 4U7UK 4ATNA 3TU5A 1X60A 4KGMA 1NK7A 1N8RO 2ZBIA 3WXJA 4MIBA 1I94J 3MCPA 2QWQA 2FJVA 2V8PA 2XSJB 3H5XA 5AXNA 4CJVA 4IJAA 2F40A 2QRRA 5D3GA 2XLKA 4NA3A 1WKKA 3VN5A 2MDAA 1RTZA 1B92A 4X4TA 2C2ZB 2VGNA 1T7PA 1V3ZA 2OJ3A 3DLBA 1AB8A 1S1XB 2FVQA 3CF5Q 1VOMA 3MFHA 2CNKB 2KHDA 2RDIA 3V1OA 4P9SA 2O4IA 3NGSA 4OI3A 1RILA 2W1BA 1BC6A 3LO3A 5B0EA 1NJWA 3U4LA 3HVAA 3AJ2A 1VQ8N 2I8EA 1X4EA 4CLSA 5KFJA 3BO2A 2WOMA 3TAFA 4JI1J 4FK0A 1UVJA 4I2QA 3DOKA 3B6BA 2X6SA 4P7VA 3G6VA 3PKYA 3QSIA 1XUPO 5E3PA 4HKQA 2BOAA 3CM5A 2D3OR 4WYWA 4K4WA 4OFZA 3FSIA 2YWKA 1RBUA 2A6AA 4U8YA 2G13A 3FKBA 4CF0A 1JLFB 2BMBA 3IR5B 1RB0A 4O3OA 3DOLB 1DKGD 1TL4A 3AVMA 3ICLA 1SQKA 3CJSA 1EIYB 4UQGA 1S77D 1N52B 4BRKA 2WSFC 3US5A 5GAGU 2ZKUA 3OBYA 1Y00A 4ES1A 3NH0A 1EX4A 2CKWA 3HZEA 3QRQA 2MZSA 4FWSA 2HPUA 3R7SB 4PABA 2E6LA 5KFHA 1FEHA 2C3PA 1ZAXA 4A4JA 3E2EA 3IRWP 2HFUA 3AAPA 3NG8A 1VQ7S 1QY7A 4XPEA 2DRDA 4A2AA 3BBFA 2P8IA 4DHYA 2VG7B 4OZ3A 4DR7K 3K5MA 3GOIA 2ATLA 2B4OA 4CH0S 4ICLB 3NAIA 2F8HA 1JLGB 2P9UA 2RHQB 2P9IB 2PC6A 4OKEA 1NWKA 3FQKA 3WZ0A 4R79A 4B8CA 2DNLA 3O8WA 3BSAA 3PW2A 1BUPA 1NGEA 3IMQJ 2WVEA 3NF7A 2QC3A 4JV0A 2O8BB 1CJTB 2O8FB 2LYVA 2OGUA 2YNFA 4PG7A 3G4SN 1ZYQA 1RT3A 1HNWK 3WC0A 4Y1CA 1X9JA 1YBTA 2MZQA 1UPMB 3OYJA 2MGZA 2XS5A 4WZQA 5JMNA 3PIPQ 2JRSA 4ID8A 1URNA 3C6HA 2MKCA 3O08A 3UB5A 4X84A 4MKBA 1KAZA 4WFBQ 1BCOA 1U26A 4LF8F 2RHSB 1YAGA 2HMIA 3DXKA 2KVQE 2NZCA 2QXFA 3PG9A 3SV3A 4HTIA 3R8YA 2DKOB 3RBXA 3R3LA 1K9MT 3MEDA 4DR2J 1EQMA 3V6HA 3J7YP 4DWIA 3G9CA 3OSNA 5BJRA 2FF6A 2PFFB 4USIA 1EARA 2PEHA 1KVJA 4LFBJ 2F4VJ 4NLVA 2JDJA 5GAHP 5I42A 5FJ4A 2UU9F 3OR1A 2IA0A 5DGBA 4DV1J 3WX4A 5M2PA 4Q44A 2KG1A 3CC2N 3QT7A 2W9CA 2E5HA 1C1CA 1T8EA 1CEZA 1U8SA 2QW9A 3J7AN 2R2RA 2FLPA 3NF6A 2XQCA 5B8HA 1SL2A 4LSNB 4Z37A 2F7TA 2MLYA 3SBMA 4PQUA 4WKRA 1BA0A 2GX8A 2RDJA 3Q83A 1B99A 2QWNA 4J9RA 2HHHF 3TZWA 1VFJA 4ELUA 3C95A 3DLGB 4HT7A 3WXLA 3O3FA 4DR6K 4AL7A 2YBVA 1RT6B 2L08A 1IBMK 3ZT1A 1FEEA 1WSVA 3UDVA 3MM9A 1SXLA 2GJFA 1S79A 4DQ8A 4GKKJ 2DNYA 3IGNA 3R5JB 1S7IA 3U7JA 1VK3A 2VFTA 3OJUA 2ADCA 2QXLA 4E3SA 2ZOFA 4WCEL 2VUGA 2PZSA 2Z1JA 4WJBA 5KOXA 4CF2A 4BRHA 1YJNN 3FBFA 4LR9A 4NI2B 4KH4A 4CEBA 3V9UA 3GBTA 3W63A 3POTA 4KBIA 1XNQJ 3O3HA 1KAXA 2V67A 4X65K 5KFCA 2R7QA 2DGWA 2XI3A 2HBRB 5KT5A 3P49B 3R6MA 1S1UB 2XMAA 1YITN 1NZAA 1V4SA 2YQ0A 1FJEB 2UUBF 5GADP 3CHWA 4K4YA 2L9WA 1RDWX 2G2OA 2VH7A 3FVYA 4CWBA 2CDQA 3P39A 4ZVSB 1VBKA 4WU2A 5J2PB 3L4BC 2MQNA 4O5BA 1N33K 3K5NA 4PUOA 4BY9C 5HJXA 1BCMA 2BUNA 4FWLA 1RA7A 4J9KA 1UA0A 3AA3A 1W7WA 3TEHB 3IRXA 1URRA 1S1WA 3RTVA 2W7PA 1GX5A 4DU7A 4X4PA 3W2VA 1SC6A 1NKCA 4OLAA 2CIMA 1QZ5A 1U6BA 4LF2A 3D67A 1LWEB 2XGPA 5AQYA 4NLWA 1UFWA 5DK5A 3RSEA 2H65B 2AEMA 1REVA 4WK3A 3O4WA 3A5NC 4DV7K 3D6MB 2ZH5A 2AKWB 2KZZA 2BYCA 1AYEA 3K89A 4DPTA 3H8YA 1HNXJ 1JLCA 3ENAA 4BLGA 1K8KA 4OYPA 2CPIA 1BI4A 2QLJB 5BYQA 3SUQA 2GIFA 3M8YA 1MA9B 4LVOP 1VRUB 1GOCA 1AROP 1TUUA 2EK6A 2ROGA 1WUAA 4BRCA 3MR3A 1WOPA 1JXEA 1VQMN 1LK7A 3IM8A 2HURA 2CQCA 2W9AA 4OV6A 5I4MA 3KYLA 3IAS9 5GIPA 3QEIA 1PAUB 3V9SA 2M9KA 3HP9A 4QQBA 3E51A 3D1QA 4GKJF 3A0IX 3SQ4A 2KDOA 4OZ2A 1HA1A 3FSYA 4ZS6A 4AT1B 1HI1A 2AJFE 1A0OB 3CJAA 4KGZB 4JK8A 1PAEX 4FW2A 3K5LA 4TY8A 3TZYA 2ZHBA 1YI2N 4FZYA 2UUAK 1HKCA 3IUCA 2ASPA 3MPDA 4ECWA 2RDDA 5F9LA 4E7JA 1LV5A 4UOGA 1HNVB 2BTFA 3AJDA 4DTMA 1QLNA 3TR8A 1B9DA 1A5WA 1KR4A 2PY5A 2EK1A 3AOBA 4QYZJ 2KTQA 1T6DA 2ZUGA 1KOOA 3O8MA 1CC7A 3JAMY 4BR7A 3KLIB 2B8QA 2LMIA 4ED5A 3MXMA 1ZM9A 2Q31A 3QJLA 4IWVA 4EIAA 2J9DE 2VV5A 1M90T 4C8LA 2NXNA 2VJVA 2AJ1A 3D6HB 3SPZA 4DSEA 1EWQA 3CCLS 1CG2A 2LKZA 3Q8PB 5AJ3F 3JAMU 3T7ZA 4Z4IA 4QIFA 4RTFD 4FYDA 3DU5A 3RR8A 4IQMA 2IBKA 1F5BA 4FNHA 4FJ8A 2A2CA 4CHNA 4I68A 3A8IA 3PX4A 5BRFA 4I6MA 1B0PA 4UUXA 3I0SB 1SC4B 1SCJB 4KH6A 2EKYA 4B1YB 4ZLNA 1Z25A 1D4XA 4O3SA 4IZ9A 3ZSRA 1T11A 3VQPA 3MCNA 4CBUA 2M88A 3CD0A 2IVNA 3MPVA 1ZA2B 2YKOA 4JI7F 3VENA 4DV3K 2CZ4A 1YHQN 2FLLA 2FY8A 1V5IB 5HBMA 3ULEA 2MHNA 2P9PB 3DMJA 4NA1A 4H5RA 1IKYA 2AJQA 2CQGA 2Q1NA 4X64K 4TQSA 4PXCA 1UFLA 4FJJA 2OPRA 3PJ9A 3G86A 5E3QA 2V34A 4R0EA 1KWMA 3RGIA 1RCOB 3UVJA 3IWLA 3MPWA 1FX4A 4GVMA 2K1RA 5KPRA 4B3OB 3AARA 3BGLA 1YVUA 2GEMA 1RTDB 1RAGB 2J7WA 2M3DA 3G6XA 3W5ZA 4JI5J 3H5SA 4UOCA 2PYLA 2JL9A 1CLQA 1T05B 3OBWA 1X31C 2RUSA 4OX9J 1FRHA 1RK8A 4YHHJ 1ZPWX 5KRSA 4O44B 2I9SA 3HSCA 1HWKA 4E1MA 4DUZJ 1HW9A 4PZVA 2M8HA 3BKUA 2YWEA 1NSKL 2YNGA 4J2DA 3JSMA 1NGGA 2ZOGA 3OSPA 3EE3A 4HEA9 1HWUA 1VISA 4NLTA 1LW2A 4LQ9A 4CZMA 1CBKA 3S3NA 4N76A 3PIOL 4CVNE 2ZBPA 2J7UA 2V8VA 4CT9A 2DBBA 1S76D 1VQ4S 3HHLD 3CMES 3O44A 3J81O 1WC3A 3GYXB 3D2EA 2EWSA 2M70A 1TL3B 3IS9B 1MROA 4ZP6A 4JV5J 1F9HA 4CLKA 3FRZA 4WIQA 3SAFA 4JK7A 1ZM3A 5HP1B 3BO3A 2EFNA 1F5AA 3SBGA 3R8EA 5D15A 1ZOTA 4RW9A 2DFHA 1K6YA 3KIOA 3SI8A 2D4WA 4KHPF 4WTOB 2GW8A 1HYVA 3HXMA 4K4SA 3C14B 2GJ2A 3NKYA 1YDLA 3MR6A 2AV5A 1Y5LB 4XAKA 4OHWA 3QO9A 1RT4A 2OO4A 5LSRA 3BGFA 1UEKA 5JS2A 4P2FA 4OJGA 1BA1A 1NHVA 3K5OA 3RMBA 2NREA 4J9SA 2OEMA 1N8RT 2F3JA 3THYA 3FBEA 3VQAA 3HKWA 2CVEA 5HANA 1YG0A 2R7RA 1W97L 4DR4F 4QU6A 1RDRA 4CGHA 2VKRA 2QJ3A 4PHTX 1FA0A 3ZX3A 4HCCA 1ZTWA 2NXUA 1QVFM 4JN4A 1RU2A 2MYFA 1R7IA 5SWMA 2ZH1A 3K9KA 5AQOA 4E8UA 5LL6d 2HQGA 3GLJA 1FRXA 2DCLA 5J1NA 4ZPAA 3OL9A 1S48A 3ILJA 4BBYA 2AEFA 4F04B 1KN6A 1FKOB 1C0UA 2NZTA 3V4IA 1BQNA 3QFUA 5KFRA 2D0PA 3Q8RB 4FSVA 3AVLA 4WFNQ 4RNMA 2UP1A 3K0JA 4LQ3A 1WSJA 2XRIA 3ITHB 1Y11A 4QZVB 2IM1A 2F8TA 2H1YA 3BQ1A 4A8WA 1ATNA 4CZGA 4ED0A 1R27B 3LGHA 1IR0A 1YTYA 1JNZB 2ASJA 3I0RA 2C22A 4LH4A 3UKRA 4E89A 2B0GA 3D54A 4NE9C 4E7KA 1Y9OA 1NSPA 3K5PA 2RKIA 2E29A 1CS4B 3RYLA 1SBRA 1UVNA 2KLAA 2P9KB 2H3GX 4Z7YA 3OL6A 3G8SA 2QFJA 2E5IA 4FM0A 3PV8A 1GLBG 4PKGA 4TN2A 1HMVB 2VBYA 1FFGB 3SDEA 5K8MA 3MEKA 1U04A 1YVFA 1UWAA 4XH5A 3AQOA 2CQ1A 1BG3A 4DX5A 3KUHA 3GIMA 1HL6A 4PPZA 2OMLA 1K8AT 5AQMA 1S5ZA 2G4BA 3ZT3A 4PEOA 4NLXA 1MNEA 2FSNA 3Q22A 2BACA 2BOPA 3SUPA 2E5LF 1LAWA 4K41A 3OVAA 4C1NI 4CESA 3GIJA 4KB7A 3HK2A 2W01A 3J81j 4PAAA 2EG1A 2QTWA 3P4UB 1SVDA 1RAAB 3VGMA 3AJ1A 3S7RA 4NZ6A 2OTJN 4BE1A 5CE3A 4AF1A 3I9ZA 4CJQA 5ADXH 2DHGA 4JBCA 1UW9A 4M3XA 4KC5A 3MMBA 1Q8LA 4O3RA 2CUYA 1WKJA 2YWFA 3H25A 4G3IA 2DGOA 1FRIA 3I4HX 3FBBA 2J8SA 5D3GB 2HBJA 3K59A 4DV5J 4RW4A 1ULRA 2YVSA 4HTLA 1VRQC 2BJEA 5DQHA 3F0NA 2J0XA 5JS1A 4OLBA 4DTJA 1H0HB 2QV6A 4L3KA 1UEUA 2NXEA 4P74A 3AO3A 2DR7A 3LP3A 4IOCQ 2HZAA 1BE4A 5D78A 1NJYA 4J7CA 2CPZA 2WOMB 3DN9A 3ETMA 4I2QB 3DOKB 2NUBA 1E4FT 2OPPA 3NS7B 5CH7B 4AHSA 4O55A 3HHLA 1IBCB 2MQMA 3M5RA 2N82B 3DC2A 2OPQA 1RHUB 2YX4A 4ZVTB 4DFJA 1M1KT 2IDOA 4AXJA 3LPEA 4A48A 3MX2A 3JQKA 2LU1A 2DR8A 2HF4A 3PYDA 4CBXA 4ID5B 1YK9A 1J27A 1RBLA 1SJRA 2WW8A 1DZ5A 3GB0A 3CCUN 4QW8A 2OTLN 5H1SV 2MY7A 4Y28C 4FCYA 2FC0A 1R59O 1RUSA 1R8BA 1H7XA 4I1TA 1DGKN 3M8PA 3O4QA 4BC5A 1SKSA 4RW7A 2WVBA 4IEIA 3CCVN 5KFKA 2EWHA 1SH2A 4G6VB 2ZJRQ 1NKEA 2ROEA 3JS9A 1QSLA 2UVUA 3UNGC 1HQEA 3M8SA 1K1QA 2WFBA 1E6YA 4DCPB 3HHNB 1J54A 2P9UB 3UI3A 2H4YB 1YJ9S 4PYAA 1X4DA 4B3SF 2HBKA 1RLCL 2KRBA 3AAQA 2PBDA 1H2VZ 1T9WA 3R2DJ 4USHA 3LZIA 2XMKA 1OH8A 2E2NA 4AILC 5KG3A 4HWIA 1J2VA 4ED2A 2EX3A 5LSLA 3QWUA 4O3QA 2B9YA 4X4UA 1RT3B 2CH5A 3WDOA 3AVGA 1ZBFA 2OCEA 2J9DA 2NUUG 4DI6A 1XIQA 4AM7A 3LAMA 1GLEG 2R3VA 2X74A 3O1LA 3WX8A 3MXHP 2Y0BB 3NGIA 3LTOA 1OY8A 5MLCV 3GFYA 2F9DA 4CECA 2QSFA 2HMIB 3H1VX 3DXKB 5THWA 2DNZA 2XO7A 3W5XA 3CTRA 1O0PA 4A8QA 2O8DA 4C11A 4JS5A 3TSPA 4F4WA 2QZ8A 4EHUA 3MEDB 2Z1IA 1X4HA 3O5TB 1B70B 2D0OA 2M4MA 3CD7A 4FJMA 2NS1B 2ZM6F 4CJ5A 2Q3SA 2DHAA 2NZ4A 3THWA 4BC2A 3NRBA 2LLZA 2OLWA 2HGLA 1TKZA 5HQ8A 4OPHA 3I5BA 4B8AB 5I42B 4ZP8A 3OR1B 3J7Z5 2BEFA 1N54B 2ASLA 3GCWP 3GG1A 4B3RF 4UY85 2W9CB 3GJQB 3A2FA 1TMJA 5CCMA 4CJRA 1DT9A 1C1CB 4FK2A 3WIUA 1CZBA 1IWGA 4WYBA 2HHSA 1C4CA 4FBUA 1APSA 1QSYA 4PQUB 3C7NA 1RWUA 5KFFA 3WQPA 4DN9A 2C2DA 3TWHA 1S4EA 2EW9A 3NY0A 2IGIA 4NXNJ 2ERRA 5L46A 2MKIA 3TAMA 3D6RA 2AMCB 1FWKA 4QR2A 4WBFA 4DEZA 2XY5A 1RBTA 4B3TF 2VA3A 1YRUA 2V7ZA 5HMXA 2O01C 3UN3A 3MM9B 4ED7A 1GMWD 3NNAA 1LFPA 3PUFA 1DFDA 4A8KA 3JYTA 2ETJA 4JI2J 2N7YA 3IBFB 1X5OA 5AQFA 3G6ES 1XJWB 4YB5A 3POTB 4M3WA 2E7XA 3PW0A 3U1MA 2Y9HA 3BEGB 3Q7BA 1Q9XA 2H5EA 4K43A 4CLPA 3RUBL 3TUZC 3D0GE 2AP1A 2MKJA 2RQ4A 1HQUA 2ZOMA 2KZMA 2WAQD 3R5AA 5CHCB 3HKZD 3VQDA 5DDQC 2RILA 1RBSA 2UU9K 3PW7A 8AT1B 1QUPA 4HUFA 4X2BA 3TSQA 3TAEA 2IRXA 4JNEA 1FXLA 5KFVA 4KY3A 4LF8J 4PUOB 4EBCA 5AE3A 2X3GA 3S8SA 3BN7A 4RJVA 4DSJA 5IXUA 2WVCA 3C6TA 3T1HF 4XK8C 1WORA 3QEPA 5ADZA 5I9EB 3W8PA 4QIGA 4I4BA 4LRDA 1S1WB 2HHHK 2ZZMA 2NQPA 4AD6A 5AR0A 3W2VB 3GFHA 1KQSM 2RQKA 4M7YA 3OLAA 2WBMA 3NAHA 2E5JA 4EP5A 1JJ2R 3RSEB 4ZMMA 4E98A 4N5SA 1PJ5A 1REVB 1GH8A 1KTVA 2A2DA 1FFSB 1Y5NB 1HR0J 1HD0A 1J9AA 3WEEA 3NCPA 1LOTB 3M2RA 1O6XA 2GIRA 1P6TA 1OO0B 4DHVA 2QEXS 1JLCB 4DV2F 1U49A 4Q2LA 3ZC4A 3HOSA 1Q81O 1BIZA 3AOCA 1K8KB 3TYTA 3CCQS 2NRVA 4S0MA 1FVSA 1BI4B 3NWGA 4LVNP 2BABA 2DXEA 2F4FA 1NG9A 2HHWA 2Q6BA 4ILLA 4MIAA 4C23A 3ZZPA 4L73A 4Y00A 2UUBK 3TSUA 3OFEA 3GL1A 1FDBA 3L6QA 1SIWB 2C3UA 2PI5A 4F8RA 3QRPA 1Q7YO 1NSAA 2JHEA 3BH7B 2MSTA 4ANCA 1NUEA 1HQ2A 5LJVA 4M63A 4BRGA 3QNOA 3VQ9A 3H4DA 3GV7B 1FKAF 1WLJA 2V0NA 3W62A 3QT5A 3BDPA 1RWKB 1HYZA 3DDIA 2Z2YB 2JZ5A 5DS7A 4CFCA 3EZOA 3VZHA 4LBPA 2BV3A 3DRRA 4MTPA 4A62A 1KQSR 2ATCB 2ZVIA 1QAIA 4RL1A 4IO9L 3BY5A 4ZPVR 3RB6A 4LF5J 2XMWA 5HMWA 1RWXB 4YOEA 2RSQA 2UVWA 3DLRA 4DV4J 4RO0A 2NR0A 1ZBLA 3QIPA 3JTNA 5F8LA 4CCHA 1LNQA 1VQ9S 1IN0A 4OO1J 2QE5A 2ZKTA 3QFWA 1CJKA 5BR8J 4M8LA 4DQQA 4X4QA 2H3EB 4GW6A 1F3FA 3AVAA 1PILA 4DMZA 4J2BA 5KG0A 2RB7A 5DQIA 3CJ2A 1GLDG 4C48A 4DL0C 3ZZYA 2PE8A 2RJZA 1H73A 3BSOA 3RMAA 4FDFA 4L72B 4FWPA 5FDLA 3PO5A 4OLOA 4Q0BA 1TAUA 5KG1A 1MN9A 1HNZF 3MOZA 4ZCMA 1KFSA 3OW2R 2YKNB 4IXCA 4M42A 3R97A 3T5KA 5D4OA 3LPTA 4WCEQ 2XCAA 3I8DA 3M30A 2CNLB 3FQLA 3QT8A 2UXDF 2V8GA 4KGXB 5C42A 4GKJK 1KVIA 3RRKA 3KUEA 1HUXA 1RTIA 1X9MA 3VQSA 3NMRA 4WYLA 4I6MB 5DLGA 4IH6A 1RQ0A 2YNHA 3O9RA 3KDOA 4F2RA 2HIYA 4P2SA 3AHPA 4M3ZA 1TKTA 3T69A 2IIRA 2HVIA 4CIGA 3FEZA 2EHGA 1YVNA 4WXOA 2CJYB 4MFBB 3A5OC 3R5GA 5KOWA 2HVHA 3ULEB 1IM6A 1EKEA 3R2CJ 3RB4A 4FN5A 1Q79A 3CIMA 3ZETA 4JI8F 3DMJB 3G82A 1JCGA 2KT2A 1SUQA 3SPYA 4PWDA 1IKYB 2GQ2A 2OEJA 3KLEA 5LMUJ 4DPXA 4W98A 1LWCB 2H48B 3W61A 3MCOA 2OPRB 3OYFA 5GVQA 3UVJB 2VFSA 2WVDA 3AY9A 2O67A 2ZDPA 3NDKA 2K1RB 1VHIA 2F7VA 2HBZB 5AQLA 3JSYA 2W2QP 3VHQA 2P9SA 4JI0J 1MWKA 1HBNA 4F9OA 2F9WA 2D0AA 1FKPA 4U96A 5AJ3K 1XMOJ 5KFBA 4FWNA 2V2ZA 3JSRA 4B1ZA 3RAXA 4G1QA 2ZWOA 3D3CJ 2KT3A 5JXSA 3PR4A 3T1AA 4M94A 5DDPC 4MO4A 3GJRB 3S41A 3MR7A 2IM3A 1EO1A 1HFEL 3BR8A 2WTFA 3FZKA 5HJYA 3ZZOA 3TUIC 1SAZA 4EP4A 5U47A 1DURA 2PA3A 2YNGB 3M9MB 3O4NA 3SCIE 2HFOA 3ZTOA 1NDKA 3QEXA 1RWNB 5D8HB 3KLHA 1N5YA 2BJ1A 4JI7K 2HAFA 1LW2B 3CDBA 2D41A 2F96A 4U7BA 4K5SA 4TLQA 1RFQA 3OFFA 4H5VA 1N34J 1BWEA 1NM2A 4LRBA 2BUPA 4B1UB 1LKZA 1SH3A 4LR7A 1OSCA 1FE0A 4N7TA 4FKYA 3LDOA 1P9QC 2IBOA 3PEJA 1GMUA 2IRUA 1MROB 4JKBA 8RUCA 1HW8A 2JLGA 5F2RA 3AB2B 5AE2A 2Y8WA 2VWBA 2GZOA 3FUYA 4FOIA 1S6UA 2FC9A 4KI4A 1BL3A 4XDCA 3CJ4A 2ZDOA 3EX7B 4DR1F 1WWHA 2KVIA 4RW9B 5MAOA 2KXHA 3G71N 3JTPA 3QYYA 1I3OB 3QPIA 2NXCA 4RZRA 3KG4A 5AFUH 4M5KA 4E7HA 2X1FA 2WC9A 3P8BB 4H0VB 5IOLA 1RT4B 4NXMJ 2LEBA 1C0GA 4HACA 3ZSZA 2QK9A 3AH6A 1WJ9A 1HHTP 2QFIA 2GO8A 3H2VE 3DLKA 2KW4A 1TUYA 5EWEA 4WK1A 1WI6A 3BV8A 1FRMA 2HIQA 1W9HA 1I94F 2ASMA 5GMDA 2N3LA 3C15A 2VOOA 4I2PA 3F5TA 3THYB 4B08A 2P2CB 1HPZA 3TVYA 2UXBJ 1SQGA 1BDGA 4M5GA 1BHNA 1OWXA 1ITGA 2QLFB 4Y2CA 3JS6A 3KKRA 3ZNUA 3HZGA 4F4ZA 1TK8A 2B43A 4CJLA 4HHUA 3UW1A 3SI6A 3EM1A 1FNXH 4PPDA 4PKIA 1IR2A 3KD1E 4NYNA 1IR1A 5C15A 2EVZA 2MXYA 4AHRA 2HK2A 2CVIA 5M1QA 1JB0C 1C0UB 1RDDA 3J7YU 3M2VA 4FLZA 1BQNB 2KT5A 5HN0A 3HZ6A 4JI1F 4DQPA 4NLBA 3KNGA 1J5EJ 4RCHA 1A5XA 3E1YA 2MB0B 2QWOA 1UTAA 2IJNA 2H5JB 3KOAA 2ALZA 3QGHA 5DQGA 2E44A 4KGVB 4KHPK 1D8ZA 3CW2C 1ESVA 4LR8A 3ZSQA 4NZ7A 3OPKA 3NGDA 2HFVA 3CD6N 3L7UA 4ZKAA 4J5OA 2AYBA 3S3MA 3QRRA 3IA0A 2ADBA 2UUCJ 3I0RB 2VICA 4J8FA 3D2FA 1HKAA 4NLSA 4CE9A 2RKIB 3CGIA 3QINA 2KYXA 1RT5A 4O3PA 1U0SA 2GJIA 2JC0A 2OYQA 2YPYA 1FF2A 4FLUA 4KHSA 1EETA 3V6DB 3T1YK 1VQNN 5E2QA 1Q8IA 2HBQB 3UNYA 3SDEB 3OYEA 2XWXA 4DR4K 3GJTB 2CNOB 1WEZA 2JEFA 4H8KA 2PAVA 5D0GA 4Q45A 4NLOA 2DNQA 2A6MA 2J0WA 4DL2A 1HKGA 2B3TB 2ASOA 2VFUA 2CG8A 2R9LA 1PBUA 5AQGA 3MTKA 4DCHA 1D0EA 2CPJA 1BWFO 1IV0A 5GADU 4ZP9A 4ZVFA 2NRZA 3S01A 4Z4GA 4IYQA 3N6MA 3PIOQ 2W42A 3A8YA 2CQ3A 3ZSOA 5SUHA 2XG8A 5A6WA 4O8UA 1F21A 2LA4A 2W8LA 4O4RA 5AXLA 2FHJD 3MMBB 2VASA 2D69A 1B64A 3HM8A 4USKA 4KGKA 2VFRA 3FR0A 2G1DA 4NASA 1KD1O 1MWZA 2C42A 4AM6A 4DU4A 1FNOA 4RW4B 5L1KA 1R89A 3FMWA 3AXKA 1RHKB 3OTCA 1I6JA 2CRLA 2DPNA 4DR2F 1HBOA 3W9JA 4RUHA 5I3UB 3BJYA 3KJNB 1G6BA 1I51B 3X1LB 3RG6A 2YHBA 3C19A 3L4IA 3NGZA 2V63A 1WF0A 1Z1ZA 5DMRA 3TTCA 3ZYYX 1GT8A 3KHGA 1RBAA 4LFBF 2F4VF 5AQQA 5AQIA 4K8RA 2ZUAA 1JIHA 4CDIA 2N4DA 4BQLA 4DV1F 4Q7AA 5HRPA 2OPPB 1NBEB 3UD4P 4DL5A 4NLUA 4X66J 3HHLB 4Q43A 1H3DA 3VMFB 2NRRA 1NGJA 2OPQB 3SCXA 4LC9B 1C0TA 1JL2A 1GX6A 2ZHOA 2BW2A 5CD4A 4JV1A 2HAIA 1NLKL 2E5LK 2NSCA 3CJ8A 3GSIA 3BKTA 4L3QA 4CZCA 3O1WA 3CJCA 5HMYA 2AGOA 1JJ4A 2WUSA 1VQLN 2HHQA 3UO0A 4LF4J 4TLRA 3AGRA 1HJRA 4YB6A 2B8PA 5L8RC 1CQMA 3HPHA 2QN6B 3T9ZA 3OYCA 3K58A 1RCXB 4MJKA 4YY3J 3DDKA 3M8PB 3CC4N 1BO5O 1FRKA 4RW7B 2C2KB 4GKKF 5KQ8A 2XBPA 3A5LC 2ROPA 1RCHA 1M5OC 3BQ0A 2VHGA 1L5UA 1HQEB 3SQ2A 1RAJA 3V5RA 5FRNA 1DAXA 1JQGA 4XIUA 1E6YB 4DU3A 3TANA 3U3YA 4M7XA 3MWBA 2CPXA 1SL0A 3ATUA 4RWXA 1SJ1A 4K5RA 3LH2S 1BIUA 4B17A 1B7YB 3B6PA 3IFRA 1ZM4A 4B1XB 2DTUA 3BZKA 4OZ5A 4FLTA 1YRXA 3OTBA 4CLZA 1UA1A 4TU8A 3MEEA 2GX9A 4KH5A 3OUYB 3FK4A 3VWSA 3HSGA 1JLQA 2JWKA 3QAUA 1X5SA 1U1QA 2Z2MA 3HVRA 5MLCQ 3F41A 1ILYA 1NNEA 2RS8A 3H2LA 4OYBA 2V2KA 4RKUC 1I5OB 3O5BA 2B9WA 1WD6A 1QQCA 4FLXA 4H54A 3QNNA 1MDUB 3PFOA 4A8MP 1IQTA 3V4MA 2O8DB 1LXJA 2DITA 1VMBA 3QGGA 1FXDA 4OZNA 2HF3A 4C11B 2I38A 4RUCA 4YR2A 3M32A 3RRHA 2HLTA 5D6GA 2YI1A 1XBWA 5KGXA 3S3OA 4EWTA 2CJ9A 1NO8A 3THWB 1HNXF 4BRDA 1U6ZA 4DFKA 5E7OB 2QL9B 4YOWA 2B9XA 2HBLA 2Z57B 4KHRA 4B9TA 1G4CA 4F4KA 3CULA 5ETRA 4CK1A 4DV6J 2Q0UA 2G8UA 4B3SK 3EKSA 3H0PA 3CXCM 5EX0A 1WAJA 3OS0A 4BC4A 3I5AA 5KFOA 1U02A 4IBNA 2XY7A 2FQQB 2QWLA 2CFXA 2ITGA 3C7NB 1ZBHA 2ZD1A 1ICEB 1FO1A 3P96A 3THPA 3TAMB 4BR5A 2CJAA 1LXNA 3L3UA 1L3TA 1RAFB 3S9HA 3EYZA 2CPDA 2RD5C 4LF1A 5GAEI 1AUSL 3O6QA 2UUWA 5A0YA 2ZH2A 4UUWA 1TL1A 1GLCG 3JYTB 4UY8O 4B3SJ 1UJ5A 3W9HA 3V9WA 4CEAA 4L76A 2RF2A 3EMTA 3TAQA 3HFKA 2WVFA 2AIRB 2HBYB 3OTOJ 4FPBA 1RHRB 1S0MA 5B08A 2OD6A 3VQ8A 3V6KA 2FHJA 3D7SB 3MECB 2QA4N 2ZM6K 3UDCA 4M5JA 4QCLA 1WHVA 2KL8A 2IM2A 2ZGYA 3BSNA 1RHJB 3SLCA 4DFPA 5IT9Y 2G0JA 3B78A 1YZ7A 1L3VA 5EOYA 4A8OA 1TVRB 4B3RK 5CCLA 1S0OA 3CT9A 4ZLLA 1KONA 1TL5A 3P31A 2E9ZA 4RU9A 3GCXP 4DFMA 3CO9A 3VAMA 2Z1GA 1SQFA 2MJNA 5ETKA 4ZK7M 3MXJA 1OMSA 1VSFA 3IC1A 3C6TB 2P9GA 3BDEA 3ZZ0A 5IT9U 3CCRN 4CZKA 7FD1A 2ZZTA 1XTZA 3R5DA 2KFZA 3ZT4A 3D0PA 1UKUA 3FNNA 4CP5A 2GGPA 1WHYA 3QLHA 1WSIA 2N3OA 4V1Ak 4B3TK 4DL6A 1WSGA 2YHAA 3BZQA 3R5CA 3CCES 1TK0A 3FZLA 5TKWA 4WF9L 2RHKA 5KI6A 1K47A 4I6YA 1LWFA 3WEEB 3B54A 1UW4A 2YWHA 3CETA 3Q89A 5HQLA 4B3RJ 3AB4B 5IWAJ 3OBIA 4M5DA 3VVUA 2VGMA 3LALA 1Q1KA 4WE1A 3CDEA 1N56A 2R4FA 3R6GB 3D45A 1WAFA 1WG4A 2K7KA 4WKYA 4OZ1A 4ELTA 3E3XA 1S0NA 4Q8EA 2Q1LA 3UDLA 3LZJA 2NUHA 5DRKA 5DJBA 3Q8VA 1GOBA 3KJFB 4QPTA 2OZMA 4A5BA 3QICA 4RNNA 5CZ2A 4EFHA 4B9SA 2ZNZA 2QKKA 3EEQA 3PZPA 1LOUA 3CCSS 2GBZA 4FXDA 5ITHA 3DGVA 2FSJA 5FRMA 5G0RA 4M5NA 4JI5F 2YY3A 3T1HK 4LF7K 2C3YA 2DHHA 2ZFHA 3DRRB 1RT1A 4OX9F 3U9DA 4CW7B