1SV5A

Crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse Transcriptase
total genus 131
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1sv5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1sv5A05
2P51A 1MMLA 1VSDA 3Q8RB 4KSEB 4O4GA 3NAIA 4KTZA 1NJWA 5KI6A 2F8EX 4IG0A 2WONA 4DL7A 5KFXA 2BQUA 5J2PB 3L8BA 1S97A 3MFIA 4KHWA 3T3FA 1S6PA 1U47A 5CYMB 1LV5A 1KHVA 1RT1A 3G86A 4C8KA 4AH9A 4LH5A 3NGZA 3NAEA 1Z4UA 2UVWA 1RT5A 1BI4B 2FC0A 1SKWA 3L3VA 3M9OB 4B9LA 2QE5A 4Q0BB 1D0EA 4DL6A 1JLQA 4NRUA 3S3NA 1NK7A 3ITHB 2C22A 5L1IA 4URSA 1TK8A 1TQLA 4N76A 1S1VA 1BCOA 3VA3A 3PX4A 2D0BA 2DPIA 4FLYA 5JUMA 2VG7B 3H5YA 4KE5A 2X6SA 3PW2A 4FLTA 2GUIA 1SL0A 2W9AA 1D9FA 1J5OA 1DLOA 2P5OA 3PX6A 1RA6A 3VQ5A 2R7YA 4CJ4A 5I42B 3KK2B 3OYBA 4DTNA 1FKOA 5KT5A 4JS5A 2R2UA 3HP9A 4MK7A 3BGRA 5DGAA 3GIKA 1RT4A 2HVIA 1I3AA 3P5JA 4CHNA 2YKNB 3EZ5A 2Y1IA 4WXWA 1WSGA 5KFOA 1S1WB 3OYNA 2Q3SA 4CIGA 2ZE2A 3H59A 4ZVGA 5CYQB 5KG4A 3OYHA 4EZ6A 4TLRA 4Z0UA 4CHZA 1RT3B 4DQQA 3QIPB 2W7OA 4O3RA 2PYLA 1ZTWA 4DQIA 4K4XA 4HUGA 1JLFB 3RB0A 3MR5A 4NYNA 2WRMA 2CKWA 5C24B 1NJZA 4L8RB 3LP2A 1JLAB 1OS5A 4DU3A 2ATQA 3ZSWA 1BHLA 3GIMA 1RDCA 1DTTA 3LP1B 1S0MA 1NKEA 4RW4A 1IKVA 3KMQA 1SKRA 3DLGB 4DQPA 4J9KA 5JXSA 3OYKA 2RKIB 2R8KA 3DRPA 1XC9A 3IRXB 2FBVA 4NLXA 3DOLB 3DRSA 5J2NA 4CGIA 1ZBLA 4F3TA 2KFZA 1RT2A 3CJ2A 4K50A 4OPKA 1UAXA 4CK2A 3QERA 1RTDB 1VSHA 1D8YA 3AVFA 3GQCA 1WAFA 4FK4A 3FQKA 5DMRA 2RPIA 4IG3B 2LSNA 3GILA 3CFOA 5FDLA 4B9MA 2VG6A 3IS9A 5I3UA 4ZVEA 5L1KA 4K4SA 2QXFA 5EDWA 1RTJA 4OKJA 2ZKUA 5KFMA 3KK1B 4NLRA 3VQQA 3RWUA 3SYZA 4KI4A 2OH2A 3LPUA 1YTUA 3V9XA 3WNFA 3KLIA 4CHQA 4TSXA 4N56A 4RG8A 3GV5B 1IKXA 4DSEA 4GW6A 1VSEA 3MEDA 3ICLA 5F8IA 2XGPA 4ECRA 3ISNC 1YT3A 2UUTA 3HK2A 5KFGA 5F8LA 4I2PA 1YVFA 4J2DA 1DLOB 2OPQA 1EKEA 4E1MA 4O3PA 3AO2A 1EETA 4W5OA 4NLTA 3DYAA 4O44B 3AA5X 5KT2A 1FKOB 3QEPA 4DF8A 3AA4A 4IDKB 3RR8A 3V4IA 3M8PA 1QSSA 4KHYA 3PHEA 3KLEB 4Y2CA 2E9ZA 2W9CB 4LSNA 2X6NA 5EWFA 5KFWA 1S1UA 4B9NA 3PW0A 3SV3A 3UDLA 3LP3A 5KFTA 3KK3B 3CJ0A 3G10A 3KHLA 1WSHA 3ZSYA 4O0IA 4TXSA 4FJ8A 2FVSA 4Y34A 2ASDA 2BRKA 3CM5A 1JLCB 2VG5B 4JUZA 3K5LA 3T19A 4AILC 3SQ2A 4FBTA 3NH0A 2QK9A 3DMJB 2IGIA 1B92A 1LWCB 4J9LA 3OYCA 4ECQA 3NBPA 4BE2A 4G1QB 1DTQA 3RRGA 3NGIA 1GX5A 1CZ9A 1HYSA 3IN5A 3T5LA 3TI0A 4KHQA 3HP6A 2RKIA 2DY4A 4FJXA 4RW8B 2WOMB 4ZHRA 4ED8A 4CJTA 1JKHA 4CGJA 4URGA 1GOCA 1S9GA 3H5XA 2OYQA 3M8QB 4WZQA 4C8LA 3ISND 5KT7A 1WSEA 1F21A 4CFDA 3MR2A 4PUOB 3NF9A 3PJWA 3HHKA 3KD5E 1IKYA 3VQ6A 4OJRA 4PQUB 1LW2A 2HNZB 2R2SA 5C42A 3NE6A 4NYFA 2C2EA 3LPTA 4KAZA 1N5YB 1JXLA 2Z1GA 3UR0A 1TVRA 2WCXA 2IBKA 4FK0A 4Q8FA 2EX3A 4QWAA 4CJVA 3BJYA 4JS4A 1S4FA 1N6QB 1TL3A 2OPPB 3AVIA 1Z26A 4FJ5A 4FM0A 2DTUA 4KKOA 1C1CA 3M8SA 4FYDA 3HVRA 1T03A 1BCMA 3HL8A 5DQHA 1QSYA 3KLFA 2HHVA 2GV9A 3TAGA 1WNEA 5KT3A 4MFBB 4N41A 3OYAA 3OL7A 5KTQA 3OYGA 3K5NA 2KW4A 4IFYA 5HROA 2J6SA 2FVPA 2YNHB 3OYFA 3S3MA 2RF2B 2YHAA 3KHHA 1S1XA 1KVBA 1NJXA 4XPCA 1BQNA 3PO5A 2B6AB 2OPSA 3DYAB 3ZCMA 4M95A 3ASMA 4KB1A 5K14B 3TWHA 3PW5A 3AVJA 4QOZB 3ZT1A 4EYHB 4WZMA 4KFBA 3OYLA 4U7CA 4IFVA 5CZ1A 2IC3A 4NLQA 5KG3A 1KFSA 3BGRB 3DLBA 4B9UA 4RW9A 1X9MA 3BQ0A 2HWIA 1C1BA 4KHUA 4R0EA 4H8KA 2IMWP 4CJUA 4AHUA 3THVA 4CEZA 4ZTJA 2ILZA 3DOKB 1N48A 3NAHA 4FW1A 3DLHA 1O1WA 4KPYA 1JLCA 4DQRA 2F96A 1LW0B 1C0UA 4FLVA 3ZT0A 4FS2A 1S10A 4I9QA 1WSFA 4CIEA 5FRNA 1NOYA 2RDIA 3AVMA 4DF4A 1NKBA 3SPYA 4DSKA 3SUPA 2QKBA 2Y1JA 1KVCA 3NDKA 1CXUA 1TKXA 3KD1E 4H4MA 3QLHA 4FVMA 5KFEA 4RW8A 1XHXA 4HCCA 2FLPA 4ID1A 3KOAA 4TQSA 4CJEA 3OLBA 1REVB 3WNGA 4IQXA 1U48A 3DLKA 2FBYA 1U04A 2HHXA 5HLFA 3H40A 3C94A 4AHCA 1RT7A 1TK0A 4ZPDA 4CF1A 4J9QA 2ATLA 1RNHA 3MXIA 3SI8A 4MKAA 1J9AA 1U4BA 4M3WA 4TN2A 2FBTA 3H4BA 4IRDA 2HHTA 3GYNA 3HPGA 1S6QA 3DM2A 4YR0A 2J6TA 3V1QA 4NLDA 5F8GA 1RBRA 3RTVA 5J2MB 4GVMA 3PX0A 3SJJA 4FJGA 1X9SA 2HHQA 4LSLB 3SUNA 3K57A 4Y1DA 3IGNA 3TARA 3ZSQA 1SH2A 4F4ZA 3SFUA 1RBUA 4IH7A 3OYMA 1T05A 4O3NA 2VWKA 4NCBA 1FXXA 2R8HA 3CFPA 2R8IA 4RW6B 4I2QA 3TR8A 3SV4A 3EY1A 2G8UA 2RF2A 4Q43A 1HJRA 1EX4A 4ZPCA 2GIQA 4LQ3A 5KFQA 5C25A 2OPQB 3KMSA 2FVRA 3SUQA 4ED0A 4ZP7A 1JLEA 4TQRA 4E7KA 1LWFA 3AVAA 4KAIA 4NCGA 5KFNA 4IFVB 1S5JA 4O4RA 5KT6A 4J9SA 4ECTA 4MIAA 5EWEA 4CFAA 3KJVB 3EYZA 4CJKA 3TAQA 2O4IA 3DI6A 3DLEA 3NGDA 2W8KA 2I5JA 3QO9A 2ITGA 3L2WA 3PR5B 1KCFA 1HNVB 5KFUA 4DTXA 2ILYA 4IH6A 3O4NA 1JLBA 4Q45A 4F4KA 2XO7A 4K4ZA 3N6NA 3AVKA 1RT6B 3QNNA 1B9FA 1QHTA 3I0SB 3QGGA 3QIPA 5HBMA 5J2QA 4YMEA 1ZETA 1K1QA 4DTRA 3AO4A 3V1RA 5KFRA 3MEGB 1KFDA 4CF8A 1EP4A 4WYLA 3U3GA 4IG0B 3NBPB 3OSPA 4B3OB 4EBDA 4JV2A 4NLUA 3I0RB 3OLAA 4RW7B 4YR2A 2P5GA 3DLGA 1KLMA 2JC0A 1BL3A 3MR3A 3AO5A 4K4TA 1C6VA 4LY7A 1HNIB 2FJVA 4CHOA 1D9DA 1LAVA 1ZBHA 3DRRB 2IM3A 1T7PA 5CY4A 3V6KA 3DLRA 3C6UB 3CDEA 2ASLA 4DLGA 1D1UA 1W9HA 4M3UA 3Q8SB 1VSMA 2ZD1B 1J5OB 4FLWA 2O4GA 4CJSA 4Z4GA 1A5VA 5L1JA 1QUVA 4MQ3A 2VG6B 3OS2A 1RTHB 4DFPA 1RILA 4RNOA 3RBEA 1ZBUA 2R2TA 4KHRA 1QAJA 4ECXA 3UIQA 2IM0A 3BREA 3E01B 1RT4B 2BDPA 2D3UA 5KFBA 4M3XA 3KLGA 4FJLA 2XY8A 2BRLA 3BSOA 4E1NA 1JL2A 4ZPBA 3LP0A 3FRZA 3HYFA 1C0TB 4CE9A 4Z4EA 3BQ2A 2ALZA 1HARA 3GIIA 3MEEB 5KFSA 3V81B 3OL8A 4E7IA 4N5SA 4FJIA 4MKBA 4CHPA 1NHVA 3N6LA 2BE2A 4FZYA 4IKFA 4DL4A 4DTOA 5K14A 4CK1A 2PZSA 5C24A 4FJMA 5HRPA 4LD0A 3V9SA 4KFBB 1XR6A 3D5MA 3S9HA 4E7HA 4O5BA 2I5JB 4RNNA 4ELUA 4ZVFA 2E4LA 3CFRA 4RZRA 4KREA 3RAQA 4DSJA 3Q8PB 3OL6A 4Z4HA 3C6TB 1TK5A 3L2QA 3JSMA 2FLNA 1HQUA 1K1SA 1I39A 1L3SA 1SH3A 4FJ9A 3L2UA 2O5DA 2KTQA 5CZ2A 2XY6A 4OLBA 3RMAA 4BE1A 3NCIA 1NK9A 5J2NB 3LWMA 3NHGA 3RMBA 1C1AA 4DS4A 5HBMB 3M9NB 2JGUA 4PY5A 4DG1A 1L3VA 4WE1B 4K4UA 2R8JA 3PV8A 2W7PA 3H2LA 4F4WA 2C2RA 4JRPA 3O3FA 4O4GB 3VQDA 1SV5B 3V6DA 3VQEA 3PW7A 4FM2A 4ID5A 3I5AA 3M9MB 1Q9YA 1A5XA 4DMNA 4EEYA 5KFKA 4K4YA 5DQGA 2B4JA 4TY8A 3CYMA 4DFMA 4DWIA 3LP2B 2HMIA 4KRFA 2G8HA 4QCLA 4ZHRB 1VRUB 4K4VA 1S0OA 5HLFB 3EPGA 3C95A 3HSTB 3VQ7A 3TANA 4DU1A 1RBVA 3M8QA 4KV8B 1IKWA 3DDKA 3EZUA 3DRPB 4DTSA 3C6UA 3MFHA 4WFZA 5L9XA 1VSLA 4DS5A 1RDRA 1ASVA 1TGOA 4H54A 3IRXA 3CWJA 4F8RA 1BGXT 1EETB 3V1OA 4QWCA 3KKSA 4J2EA 4X2BA 3G6VA 4K4WA 1N6QA 4J9OA 2XRIA 4KHNA 4TYBA 1SUQA 1TL1B 4O0JA 3SCXA 2XWYA 2OPPA 4RNHA 3P83D 4OGCA 3SUOA 2XI2A 3ZSZA 4H4OA 1ASWA 4F2SA 3KK1A 4FJHA 1L3TA 5D3GB 4ECSA 3IS9B 1IG9A 1MU2A 4LSNB 4GC6A 4WFXA 1RTJB 1ZBIA 3CQ8A 2DPJA 1R0AB 1S0NA 2E9TA 3H5UA 4CJWA 2HAIA 1SKSA 2BQ3A 5JS1A 3QEWA 4IFYB 1Y97A 3ULDA 1S1TA 4NRTA 3KKRA 3VQ4A 4QAGA 3G0ZA 4EO8A 2OZMA 1ITGA 1RA7A 5F9LA 3OJUA 1L5UA 4RNMA 4E7JA 1TP7A 3KNAA 1IM4A 2NUBA 4NCGB 1UWBB 2G8VA 5HRNA 4ZP9A 3KJVA 2V0NA 5FROA 4F2RA 3DI6B 4JV0A 2HNDB 1GOBA 3QO9B 3AO1A 2G8WA 5KG6A 2JLEA 4O44A 4RW4B 4CERA 4GC7A 4DL2A 4CFBA 5J1EA 1VK0A 3FFIB 4BDZA 2VWJA 3SQ1A 4FJJA 3I5CA 4FW2A 2C2DA 3JYTB 4KHSA 3H08A 4CHYA 3NH2A 4PQUA 3KHRA 2HNZA 5DG8A 3GV7B 1A5WA 4PWDA 2D7SA 2ZE2B 1Q8IA 1BISA 1NK4A 3K58A 1SV5A 2DFFA 3O4QA 5F8MA 4R8UA 4CGGA 1HMVA 2BQRA 4OKKA 1RT3A 5KRSA 4TY8B 1WSIA 4ZTFA 2IAJB 5L1LA 1HYZA 4DU4A 1QS4A 4F4XA 3KTQA 4NZ0A 4HUEA 3HPOA 2X74A 3KLFB 3RR7A 1NNDA 2BANB 1JKHB 1TKTB 4DSLA 4RNFA 3LP1A 3VQ8A 4Q5VA 4B9TA 3MECB 4ICLA 4QWDA 4KO0B 3OS1A 1IKXB 4EP5A 4FZZA 2D0CA 3NF8A 1VSJA 3AVHA 1RTIA 3CO9A 2GBZA 4FJNA 1IKYB 5C42B 4ECUA 3M8RA 3AVCA 4QW9A 4TYAA 2VG7A 1TKZA 1VRTB 4M3RA 2B6AA 2OPSB 4NLSA 4ED7A 3SQ0A 1RTHA 4FS1A 2WTFA 4H4OB 1N5YA 1NK0A 5KFIA 2XI3A 1TVRB 2IC3B 2D41A 5D3GA 4KHMA 4ED1A 1MU2B 3VN5A 4AHTA 3PJXA 3CG7A 4ED2A 3KLGB 5J2PA 2IJFA 1JXBA 1JX4A 4CEEA 1KHWA 4KKOB 5SZTA 2YKNA 4NLYA 1KTQA 4BWMA 3OYEA 5KFHA 1T03B 4MFBA 1RYSA 1RT1B 1LWEB 1VSKA 1NOZA 4K8XA 3KLIB 2HHUA 1BIUA 1HQEA 3KLVA 1HRHA 3LZJA 3HJFA 2XGQA 3L2RA 4Z4CA 1BQNB 1KVAA 2OA8A 3QZ8A 2UVRA 1JLFA 3K59A 1LWCA 4I9LA 2JC1A 2KZMA 1TV6B 3MR6A 2FLLA 3KLHB 4MH8A 3BR9A 1C2PA 5KFFA 1ZTTA 1JLGA 2GC8A 1BQMA 4HCBA 1TKXB 3RB4A 2AGQA 1QE1B 4B8AB 1HQUB 2J6UA 2YV0X 3OVNA 4DLEA 3RRHA 3TAPA 1JLBB 3LDSA 3AVLA 2AWZA 1RCHA 4B8CA 2W9CA 1FK9B 4LH4A 1Q9XA 3RMCA 3CM6A 3T5KA 1LW0A 3ZSVA 1C0UB 1RT2B 3DOKA 4AHSA 3OYIA 1S1WA 4C8OA 3V6JA 2B5JA 3OHAA 5DK5A 2DFEA 2X78A 3CDWA 1UOCA 2YKMB 1UA1A 1I6JA 3FSIA 2EHGA 2IAJA 4B3OA 4W5QA 3H98A 3NMAA 3MF5A 3ZSXA 3K2PA 3OYJA 3TAEA 4BE0A 1XHZA 1Z25A 2W9BA 2YNFA 4RW7A 3QETA 4FLXA 3V9ZA 4CF9A 2HMIB 3DMJA 3QLHB 4H4MB 4O55A 4I7FB 4M42A 4CESA 5EU7A 2WONB 1REVA 4KV8A 4J9RA 4R5PA 3AO3A 3O3GA 4CGHA 4FK2A 2IOCA 3QYYA 4Q0BA 2WOMA 5HP1B 1RT5B 1S9GB 3NF6A 3NKYA 1CZBA 5HRSA 2YNIA 1WNSA 3ITHA 4J9MA 2BR0A 1KRPA 3WNEA 4EO6A 3ZSOA 3LAMA 2I1RA 1S6QB 3DM2B 3HVTA 4Y3CA 2HVHA 4CJRA 1KSPA 3H5SA 4M3TA 4DFJA 2IA6A 4IR1A 3VQSA 4CECA 4RW9B 4PA1A 4KB7A 1JXEA 3QEVA 4URQU 2HNYB 2XHBA 1TAUA 1TL3B 4O3QA 4Y2AA 4CEFA 4NYZA 4WFYA 4ZP8A 1VSFA 2WHOA 1GOAA 1SL2A 1N56A 4EBCA 3KK3A 4ELVA 2AX1A 4B9VA 3BSCA 1S1TB 2PYJA 2AGPA 1LAWA 1T94A 5DG9A 2VG5A 2QKKA 5J2QB 1QAIA 3K5MA 4IBNA 4FXDA 2AJQA 1JLQB 2WK4A 4OLAA 5HROB 5CYQA 3HVWA 4B08A 1WSJA 1TV6A 4C8NA 2G8IA 3PR4A 3NF7A 2IS3A 2HWHA 4HYKA 4I2PB 4E19A 1WLJA 4N47A 5KGWA 3VA0A 3IGVA 5DLFA 1SH0A 1DTQB 4FZXC 3HVAA 4O3OA 4BACA 1LWFB 4Q8EA 4BDPA 1ZYQA 2EC0A 2XY5A 5KFLA 1HNVA 2FVQA 5DLGA 1KLNA 3LWLA 2UVUA 3DRRA 3MTKA 3ZT2A 5KG1A 5DG7A 4M41A 4DTPA 4Z4IA 4FM1A 4F50A 2HB5A 3AA3A 5E41A 2V4QA 2V9WA 2F8TA 3OHBA 1TKDA 1J54A 3NGYA 1S9EA 2Z1IA 3MAQA 4NLPA 3RMDA 4XO0A 1RT6A 3SNNA 4ID5B 4M3ZA 1HYVA 4CGDA 3SI6A 5J2MA 4IKAA 1QSLA 3G6YA 5KFVA 4E7LA 5SWMA 4J2AA 3U6FA 2IM1A 3FQLA 4CCHA 4I7FA 4IRCA 2KZZA 4CJPA 5F8HA 3HPHA 2AX0A 4R5PB 2UVVA 5KT4A 2YNGA 3NL0A 1QTMA 2BANA 4G1QA 3AA2A 1G15A 3NFAA 1S6PB 4OVLA 3CDUA 4OL8A 5KFZA 3QNOA 3LZIA 1GX6A 4AHVA 3MEDB 1CSJA 5HRRA 3MXMA 4DSIA 2P1JA 3V81A 1RT7B 4UQGA 1IO2A 2CJQA 2UUWA 2JEJA 1B9DA 2C28A 3AVBA 4CJFA 1S1VB 4YNQA 1LW2B 2RDJA 2WB4A 1CXQA 2VA3A 1XWLA 4BWJA 2A1SA 3VQCA 1RDDA 4Q44A 3SFGA 3OL9A 2HHWA 3GIJA 4F4YA 4HTUA 3IAYA 3V4IB 4FJ7A 2B43A 2IM2A 3KLEA 3Q8QB 3KHGA 1R0AA 4LSLA 2HW3A 2OPRB 2GIRA 4IDKA 5T14A 1RAJA 4DTMA 1C0TA 4KTQA 4DG1B 5KRTA 3QZ7A 3I5BA 4QW8A 3WNHA 2DFHA 5KG0A 4CFCA 1HPZB 3SZ2A 3TAMA 1X1PA 4KI6A 2Z1JA 4NLGA 3AV9A 3RAXA 3MEEA 1S49A 3VQAA 3KIOA 3RBDA 4RUCA 3GV8B 3VQPA 4FLUA 2ZQBA 2W42A 1XR5A 1KLMB 4O3SA 3BSNA 3OY9A 3ZSRA 4J9PA 1JLAA 3PW4A 2XCPA 2BGGA 4Y1CA 4HVJA 3O3HA 5KFPA 3OSNA 1FK9A 3RB3A 3M8PB 3I8DA 4LQ9A 4YQWA 1NHUA 4HKQA 1S9EB 3OYDA 1S1UB 3PVXA 4PWDB 2XY7A 5JS2A 4CGFA 5KFJA 1U49A 4JV1A 4KTWA 4FBUA 3QINA 5FRMA 4DL3A 1J53A 3IG1B 4DSFA 4MIBA 3DOLA 3DRSB 1YTAA 3V6DB 4FCYA 1NK6A 2IJNA 4AHRA 1SUQB 4WE1A 2YNFB 4ED6A 4WXOA 1RTDA 1RBTA 3SPZA 4CIFA 3T5HA 1WAJA 2KQ2A 2YNGB 4DTJA 4HHTA 3E01A 4EBEA 4ZMMA 1VRUA 4E0DA 1TKTA 4KB0A 3I0RA 1T05B 4W5NA 4EP4A 2YHBA 3K5OA 2FBXA 2FJWA 4RW6A 1FKPB 5HP1A 4M94A 3QEIA 1BIZA 3ALYA 2RN2A 4CEOA 4IRKA 3BQ1A 2JEFA 4U6PA 4W5TA 4DEZA 2VA2A 2YNIB 1BI4A 4OKEA 1TKZB 1VRTA 3CIZA 1WN7A 3D0PA 2KFNA 1XR7A 2PY5A 3G6XA 1JIHA 3RB6A 4CJQA 2D0AA 4NCAA 2YNHA 4CF2A 1JLEB 4NLOA 4CF0A 1C0MA 3EPIA 2ZD1A 1ZBFA 4RU9A 1S1XB 3TABA 3F73A 2HNYA 1TL1A 4HUFA 4CEDA 5J1EB 1S48A 5F9NA 3PY8A 2D5RA 2W8LA 4JLHA 1UA0A 1K6YA 3KK2A 5I42A 4EZ9A 1X9WA 3BDPA 4WYWA 3AVNA 1W25A 1C1CB 1C1BB 3V9UA 5C5JA 4CEAA 4CJ3A 1IH7A 3N6MA 1HQEB 4YFUA 4DL5A 1HPZA 2A1RA 3I0SA 3HO1A 4DQSA 5EWGA 2G8FA 5EUHA 2XC9A 3H4DA 1HMVB 1ASUA 3PO4A 3SQ4A 3FDSA 2BE2B 3KLHA 3T5JA 3QEXA 2E9RX 1U45A 1JLGB 2HNDA 3QIOA 1QE1A 3TQ1A 5KFCA 2V4RA 3V9WA 3ZT4A 4YP3A 2ASJA 1EXQA 2Z1HA 1NK8A 1L3UA 1HNIA 3FFIA 3F9KA 1RDBA 5KG5A 1HYSB 4IOBA 4E89A 3V6HA 4OGEA 1DTTB 3JSMB 1XI1A 1IKVB 4MK8A 5KGXA 2XCAA 1RDAA 3DLKB 3L2VA 3HKWA 2B5JB 4XPEA 3E51A 2F8SA 3IG1A 1RBSA 4CEBA 4ED3A 2YKMA 4EYIB 3P1GA 4E3SA 4JRQA 5T7BA 4M45A 4IH5A 3QESA 4ZVHA 3TAFA 3MEGA 5F8JA 3AVGA 3HXMA 4R8UB 1TAQA 4ZPAA 5KFYA 2JEIA 4DTUA 1S9FA 3NH1A 3OS0A 4F3OA 4IG3A 5KG2A 1SL1A 3U3YA 3BSAA 5FDLB 5I3UB 2QV6A 3MECA 4ICLB 1FKPA 3CJ3A 3LALA 4BDYA 1U09A 3PUFA 5CYMA 3B6OA 1RTIB 4CEQA 3HT3A 3MXJA 1W0HA 2IDOA 3HM9A 4KO0A 4ZP6A 3QIDA 2JEGA 4MK9A 5C25B 4I2QB 2FJXA 1NK5A 4ECYA 3UPFA 2AQ4A 1UWBA 2E6LA 3HVTB 1T3NA 3B6PA 2AU0A 4M3YA 4C8MA 2G8KA 1VSIA 2D3ZA 3D28A 3CVKA 1N4LA 4XIUA 2OPRA 3A2FA 3D45A 1NKCA 4FLZA 3DLEB 5KFAA 3L3UA 4DFKA 4YR3A 4QWEA 4KBIA 4NLWA 5KFDA 1D5AA 2ETJA 3LANA 4OPJA 2R8GA 1LWEA 4IR9A 3TAMB 4G3IA 4QWBA 4B9SA 3LP0B 3ZT3A 3QGHA 4RUAA 1CLQA 4FJKA 4W5RA 4CJLA 3UQSA 4ECZA 4NLVA 4ELTA 4K8ZA 5DQIA 3S3OA 4CJ5A 1JL1A 3VQBA 1EP4B 3VQ9A 2FVCA 1QQCA 5F8NA 3LAKA 1RYRA 2HHSA 1T8EA 4ECWA 1BQMB 2R2RA 1IKWB 3TVKA 4CK3A 3CJ5A 3C6TA 4ECVA 4J2BA 4J9NA 3T1AA 5DGBA 3CJ4A 3QGIA 4TY9A 2OZSA 2E6MA 1NJYA 2AGOA 3JYTA 5KG7A 3PZPA 1YVUA 3OJSA 4PUOA 4QPXA 4Z4FA 4GMJB 2W9BB
chains in the Genus database with same CATH superfamily
1QQMA 3P6YC 1MMLA 1OWXA 3N01A 4DR6K 1NJWA 1ZH5A 4YOEA 3MM6A 3RZAA 9ATCB 3L8BA 4ZS6A 1S6PA 2RQMA 3W2WB 3C2PA 2H4YB 1LV5A 1RT1A 4C8KA 1CULB 4LT6A 3SLCA 1Z4UA 3CCZA 1NGBA 2DHXA 4B9LA 2QE5A 1H3DA 1D0EA 4NOHA 2ZH8A 3ITHB 4CI6A 1U26A 1EQYA 1BUXA 1BCOA 1WD6A 3PX4A 5JUMA 3H5YA 2LMIA 5DS7A 2VQFF 3GFYA 2OO4A 4H4KA 2XYPB 1WHWA 3MMAB 1A0OB 4BQZA 1VQMS 1IR0A 2L3MA 4BRMA 2H48B 2LECA 2VZ9A 4HACB 2ZC4A 1RT4A 2HVIA 2IVNA 3ULHA 3P5JA 2BUPA 4JD2B 4JI8J 1YZ7A 2YKNB 3EX7B 3PKMA 2POKA 4WXWA 1T95A 3GU0A 1RISA 3H59A 4ZVGA 3PJ9A 3MPWA 3T9NA 1FD8A 3TUPA 2XTJP 4ES2A 4Z0UA 4CHZA 2V4JB 4BRCA 3HF5A 3QIPB 2W7OA 5I4MA 2DNZA 1ZTWA 4DQIA 3M2UA 5HVHA 4DV2J 5IS2A 3RB0A 3NY0A 3MR5A 1NGEA 1VQSA 1OS5A 2ATQA 1TMJA 4A5AA 3QJPA 2HZAA 4DV2F 2VU5A 1DTTA 1X9JA 3LP1B 4RW4A 3HHEA 1FFSB 3G71S 1SVDA 5AR0A 3D68A 3DOMA 5LMNJ 2Y8YA 4OYIA 1MMNA 4KGZB 4DBQA 1UJ5A 4DR5J 4RUHA 3CD6S 1WHVA 5J1PA 4FWLA 3DOLB 4F3TA 1RHJB 5K5MA 2OGUA 4OHZA 3HHLD 2W24A 3WEEB 2B8PA 1UAXA 4CK2A 1VSHA 1X31C 2GWJA 3GQCA 1WAFA 4LRCA 3FQKA 2LSNA 3GILA 1RGIA 3IS9A 1VQ4S 3V4MA 2Y9HA 4K4SA 1RTJA 4OKJA 4CLSA 2E44A 1TTHB 4KI4A 3P31A 2H5EA 3LPUA 3K7RA 4ZCLA 4AL5A 3V9XA 3WNFA 3QBWA 4B02A 1NPRA 1Z6RA 4TSXA 5ETTA 4RG8A 3EGVA 1IKXA 4DSEA 4YOVA 2CQPA 5B7WA 3MEDA 2JH3A 3R7NB 5KFGA 1RDUA 2PSZA 1KVIA 5F8LA 3A5MC 2M52A 5CCLA 3PSFA 1WDTA 4E1MA 5LM7E 4OX6A 5E2QA 3FBCA 2VGMA 4CT8A 4C0HA 4GVBA 3AA5X 4X66J 3QEPA 2GVDA 5CR4A 1UW9A 3D6TB 2V9KA 4DF8A 2EWSA 4KHYA 5E3PA 3KLEB 4AD6A 2CPFA 4B9NA 3VZHA 3UDLA 1HI8A 3HJVA 4R79A 5KFTA 4DV5J 3CJ0A 5F0WA 5AQPA 1EX8A 4TXSA 3BDEA 1I94K 4FJ8A 2D1CA 2FVSA 4WTYA 4B3RK 2BRKA 1JLCB 1GMUA 2VG5B 4JUZA 4JKAA 3GE1A 5A2QY 3JSYA 4WF9Q 5JMNA 3TX0A 3SQ2A 2O8FB 2DCLA 1H2UX 3DMJB 2MY7A 1B92A 1CZAN 3NBPA 4BE2A 4G1QB 4UY8O 3AHPA 2LCWA 4NEZA 1M5VC 3TI0A 2WUSA 1UCNA 2XNRA 2DY4A 4RW8B 6FDRA 1LWXA 4ZHRA 2CPDA 1ESVA 4CJTA 5KT7A 1WSEA 3OVAA 3WX8A 5GAHI 2B3TB 2AF6A 3HHKA 4I6MB 2NRZA 4CO4A 1LW2A 3D4JA 1KQSM 1QAXA 3NE6A 4JI3K 2ADBA 2OD4A 4H4KC 4PAAA 1N5YB 3W8GA 2A2CA 2WCXA 2FF6A 1FXLA 2K7KA 4JS4A 2AYGA 2QN6B 1Y7PA 4Z7CA 1YTYA 1TL3A 2HRUA 3G71N 4YHHF 2PN6A 4FM0A 3WX4A 1J27A 4P52A 4KKOA 1C1CA 3CCMS 3HVRA 1XQIA 5DQHA 3SBMA 2AMCB 3H90A 4QIGA 4Q2LA 3THYA 1UEKA 1NMEB 2KHCA 1CBKA 2Q2RA 4MFBB 2IFXA 3U1NA 1O6XA 3K5NA 3RVCA 4IFYA 5HROA 3R7BB 3VF2A 4UQTA 3S3MA 4IEEA 3T1YK 1WHYA 2RF2B 4DR3K 5LSRA 5AJ3F 2YHAA 2NSCA 2VONA 1S1XA 3POTA 4KB1A 1R89A 3PW5A 4DV5K 4EYHB 4WZMA 4NLQA 3DLBA 2OP5A 1X9MA 2QA1A 2HWIA 2M5YA 4R0EA 2N3LA 3BO4A 3SAHA 4H8KA 2IMWP 3QAUA 3QRPA 4AHUA 2MHNA 3CCSN 1QQNA 3H45C 1V4SA 4ZLLA 2G0JA 3DOKB 1M90T 4LF6K 3DLHA 4FW1A 3N5FA 3GLJA 1JLCA 4DQRA 4FOIA 1B99A 3MMBB 3HX9A 1SJ3P 3JAMY 3WBZA 2ZVIA 1C0UA 4C0BA 2PE8A 3ZT0A 4I9QA 2LQ5A 1NU4A 3I56S 4DOZA 4CIOA 3TUIC 1GMWA 3KWMA 1RWKB 3ZETA 4DSKA 1KVCA 2V34A 4ZK7M 1XMBA 1ELOA 4RW8A 4J9VA 5JICA 2DGVA 2ROEA 2CNNB 1Z05A 1ZAWA 4OJ3A 3BBCA 2BABA 2HHXA 5HLFA 4DZDA 3DAWA 4FXWA 4F0KA 3O9QA 2HSEB 1RT7A 2F9JA 1E6YA 4EWTA 2C3YA 4ZPDA 2P9GA 3HT0A 3O08A 3W3SA 3KJNB 3H4BA 2YQ0A 4IRDA 1HNZK 3GYNA 1M1KT 2D1KA 2O8DA 1KQFB 2LXUA 4JI4J 4GVMA 2QFIA 2V5HG 1AZSB 3SJJA 1Q18A 5C0YA 2HHQA 5LMNK 3IGNA 2GMLA 3SFUA 4IH7A 2VWKA 4EFHA 1HNWF 1VQ7N 4HTLA 1YX2A 4IO9Q 2L9WA 1XIQA 2GX9A 2QWNA 2E29A 3KDOA 2G8UA 1IXKA 2RF2A 1VC5A 4Q43A 2GHVC 1HJRA 4ZIVA 3R2CJ 5C25A 2AEFA 2PC6A 3TA0A 1F6TA 1JLEA 3CCVS 4CH1A 1GLCG 4E7KA 3AVAA 4R25A 3R9LA 5CZVA 4U8VA 5EWEA 3EYZA 1F3VA 3THWB 3DLEA 1HW8A 2W8KA 3EL2A 3QO9A 2ITGA 3GFXA 4PL7A 4C97A 1Y10A 5G0RB 3ELHA 3CNQP 2QSWA 2B9WA 2NZTA 2DGOA 1XMQF 1HNXJ 4USMA 4LJMA 4WFAQ 1P1LA 2P9KA 2BJ1A 2FPHX 2LA4A 3QNNA 5A8WA 5AZJB 1I94J 5J2QA 4YMEA 2D9OA 1ZETA 4DTRA 3V1RA 4OV1A 1KFDA 1CJKA 4WYLA 3CCQS 2HBYB 4IG0B 3OSPA 2IY5B 2BM1A 4PG7A 3NNHA 3I0RB 1X60A 5BJRA 1X4EA 3DLGA 1KLMA 2X3GA 2JC0A 1BL3A 3MR3A 4U7UK 1C6VA 2WBRA 2FHOB 3PFOA 2YWFA 2HS3A 1VS3A 4RWXA 2QLWA 3SSSA 4RR5A 4WKYA 3V6KA 3UVJB 2J0WA 4OJHA 3C6HA 1SJ4P 2HZVA 4RU2A 1D1UA 1W9HA 1SC1B 2WC9A 4KC5A 3UN5A 1KVJA 3BPSP 1J5OB 4FLWA 2O4GA 2GHPA 4NMXA 4FPIA 3NOCA 3NNAA 1RU1A 1YJRA 3RBEA 1ZBUA 4LFBF 2OJ3A 5CXTA 1QAJA 3BP8A 4K43A 4X62K 3BREA 2VH7A 2UV8A 4Y65A 3UN3A 4LBIA 1UFKA 3EXYA 3KLGA 4M3XA 4FJLA 4JEPA 3FJ2A 3KWIA 1O8BA 1FWKA 2FSNA 1SBRA 4USTA 1C0TB 4FKXA 3HDSA 1NAQA 2ALZA 4WQ4A 5J1NA 2KRRA 3V81B 2P9NA 4WJBA 3D0IE 4YS2A 3AH6A 4MKBA 4D3GA 4N77A 2ZJPQ 4PYAA 1TL5A 2PZSA 1TUWA 5HATA 5HRPA 4LD0A 3M2RB 4Z2XA 4E7HA 4LVNP 2MZRA 4BG8A 3F0NA 1K8KA 4DSJA 2CGKA 3C6TB 5HVGA 1TK5A 1PBAA 1K1SA 2D74B 2W2OP 3W5XA 2FLNA 1I39A 4H5TA 1SH3A 4FJ9A 3DFEA 2DITA 5EGYA 3D1QA 1VQLN 4L73A 3RMAA 3W3DA 3NCIA 2LYVA 5D4OA 1VQMN 3J81U 4K8RA 4EI2A 1C1AA 4CWBA 5HBMB 2JGUA 3S8SA 4PY5A 4DG1A 3IDHA 4WIIA 2Z57B 3G25A 1VLOA 1YJ9N 3H2LA 4M63A 1GTEA 4FZVA 4JRPA 3A8YA 3PW7A 4ID5A 3I5AA 1JB0C 1A5XA 5DETA 4DMNA 3T69A 2RE2A 5A8KB 4BRQA 4LRAA 4F4AA 2B4JA 1Q81O 4OPHA 4DFMA 1WOQA 3GR0A 2BJ8A 4QCLA 1NMNA 4V19J 1VRUB 4K4VA 3A13A 3TANA 3M8QA 4X4VA 1SXLA 4P10A 1T9TA 3O1WA 3WUHA 1VSLA 1HBNA 4DS5A 3AD8C 1RWNB 3AT1B 1SCJB 3DC2A 4KH6A 2CPXA 4BR0A 1GFWB 2M0GB 1EETB 3AXMA 1N5VA 4DV6J 2RS2A 3R5AA 1BWVA 1YHQN 1N6QA 4J9OA 4AYBD 4RNHA 3P83D 3SUOA 4HTIA 4H4OA 2WTUA 3IMXA 4DV6F 4ECSA 1Q8LA 1K9MT 3IS9B 3VEVA 3ENOA 3CMAS 4LSNB 4PXCA 1R6VA 1ZBIA 2CJAA 3DCAA 1S0NA 2FY1A 3H5UA 5GAEP 2HBJA 2JWNA 3B54A 1E3MA 2RDDA 5LJ3Y 2Z0GA 5GMKa 1QM9A 4NRTA 3VQ4A 1KBRA 5BR8F 3OJUA 1L5UA 1OO0B 1HLUA 3VTHA 1UWBB 2G8VA 2HQDA 3KJVA 4B3MF 4PYDA 3DI6B 4JKGA 3KJFB 2HNDB 2WVDA 8ATCB 3A3NB 3AO1A 2G8WA 2HFNA 1NBWA 4RWWA 3MK6A 4DL2A 2VBZA 2NLWA 2BH1A 1BDGA 3HSDA 4BQLA 4LF7F 1URNA 3I87A 4NX9A 4FJJA 3I5CA 4DR1F 3A3OB 3JYTB 4KHSA 4LF7J 3WXJA 2LEPA 1G3OA 4PQUA 3CJRA 1VYAA 3MPUB 2I7PA 4JI6J 1Q95G 4B1UB 1N54B 4I67A 3G82A 2PFFB 4M5IA 4CGGA 2O67A 5KRSA 4ZTFA 5F1XA 5LXRA 5L1LA 3OQ2A 1WEXA 2I8EA 2FXUA 3BKFA 1HYZA 4Z37A 2BJ3A 3KTQA 3R8EA 4NZ0A 2X74A 3RR7A 2G2OA 4USIA 4RNFA 4ANCA 1I51B 3R5GA 4JV5K 4QWDA 3CERA 3QGPA 4C0OC 4WQ4C 2QA4S 3AVHA 2FZGB 2MKIA 1ZBSA 3DXKA 1RBOB 3OHRA 3HBTA 5CH7B 4ECUA 4QW9A 1OMSA 2VG7A 2YHWA 2WSCC 4I6MA 2B6AA 3W9JA 3W62A 1RTHA 1FVSA 4FS1A 3D1OA 1AA1B 2IC3B 2ACMA 3SDEA 5HQLA 4KHMA 4NA1A 4ED1A 4UF4A 1FE4A 3VN5A 1DQ8A 5MLCV 4NZ7A 2EFVA 4YY3F 3SJHA 2IJFA 3FRYA 4KKOB 1T03B 4O8KA 1M1HA 4OV6A 2DHGA 1VSKA 4ZN1A 4K8XA 2F1FA 2NLXA 3TPQA 2BOAA 3H1VX 1HRHA 4OI2A 2D0OA 2ZZNA 3L2RA 1SC4B 2ZWPA 3O1LA 2A1BA 1KVAA 5LMUF 3CC2S 3POTB 3QZ8A 2UVRA 3DGPB 3CDBA 3K59A 4GRSA 4I9LA 2JC1A 4Q2MA 2OI2A 3I31A 4OFZA 4X64K 4MH8A 5IQ6A 4B8AB 2GJFA 1HQUB 2KN4A 2J6UA 1NLVA 3OVNA 4DLEA 4CVNE 3Q2SC 3BKUA 3K17A 3LDSA 1X5PA 3MCPA 4IFEA 1OSCA 5EX5A 1MMDA 2ASYA 3T5KA 3ZSVA 3FK4A 1RT2B 4WIQA 5K8OA 1U24A 1S1WA 3MR7A 3MURP 5LXYA 2X78A 4CLPA 2QWLA 3CDWA 1UOCA 4B3OA 1DRZA 3MF5A 3NMAA 3OYJA 1XHZA 2XMKA 4NO7A 2GELA 4RW7A 3OR2A 3QT5A 2YQ1A 3PTWA 3LM9A 4H4MB 4I7FB 2Q1LA 3MXHP 4OI3A 5EU7A 2V51B 1CJVA 2DR7A 3ILJA 2F40A 3A5NC 4KV8A 4J9RA 4R5PA 4CGHA 4M5MA 2ZGYA 3U9DA 2CPJA 2I7NA 3BF4A 5HRSA 3NKYA 2ACYA 4CO3A 4WK1A 1WNSA 1KRPA 3ZZ0A 1FRMA 2FGOA 1MN9A 3ENBA 2NXCA 2EC2A 3ZSOA 3UKUA 3NEKA 4KT0C 3DN9A 2IA6A 3J81Y 1YHQS 4RW9B 2HNYB 2CQ0A 3ZZOA 3C14B 2KL8A 4O3QA 1ZA2B 4ILHA 4BR5A 2QWOA 4ZP8A 1GOAA 3JS6A 3BEGB 3X3UA 1MWYA 2AX1A 2V94A 4B9VA 4BBYA 4CO2A 2F65A 2W2MP 2VG5A 1NSAA 3ZFVA 3Q24A 4YDUA 4GKJF 2PT0A 4LBHA 2WK4A 4OLAA 1VQ7S 3BGLA 3PM9A 2LEBA 5CYQA 2DNLA 1WSJA 2G8IA 3L4QA 3H1QA 3NF7A 4DU8A 1OYDA 4I2PB 4N47A 5KGWA 3IGVA 5CAAA 3DXBA 5D78A 4O3OA 1KP6A 4LF8K 5EXWA 2RQKA 4P73A 2ZH4A 1KLNA 2LQ9A 2UVUA 1OKJA 3TNVA 3ZT2A 1FO1A 5KG1A 1PO6A 5DG7A 2CH6A 2RILA 4DTPA 2GQCA 3AA3A 5E41A 2V4QA 2ZBCA 2QFJA 1BQXA 2EK1A 2E2NA 2Q6CA 2L9NA 1JNRB 1K0VA 3LDNA 1RT6A 5KAKA 5FJ4A 1YJTA 2V67A 1RXOB 2W4DA 4E7LA 1OH8A 3KXDA 2IM1A 2Y0BB 1EARA 3H6EA 5KT4A 1FF2A 2YHXA 2BANA 1TR0A 2VC1A 1G15A 1XN9A 2UUAK 2CJYB 2KB2A 3FCVA 5KFZA 3LZIA 3GTYX 1VJWA 4DV7F 4AHVA 1S22A 4A2BA 1VFJA 5EN1A 1RAHB 4HH0A 5A6WA 3SMZA 1NUEA 5LSLA 2HAFA 3L3CA 4DV7J 1ZPVA 3QFUA 1B4SA 4YY3K 3OT9A 1FNXH 1KS2A 2C28A 2GQQA 1JNZB 4CJFA 1S1VB 1XWLA 2VA3A 2DGSA 1BMQB 3VQCA 1OPZA 3SFGA 2AZ1A 4MDAA 3OL9A 3TSQA 4F4YA 3FZ2A 4HTUA 4GKJK 3V4IB 3LPEA 4FJ7A 2QL7B 2IM2A 3KLEA 4F0MA 2ALYB 2OPRB 2CUYA 3CEDA 4DTMA 1SB6A 4L75A 4DR2F 1C0TA 3J7ZT 2A0FB 8RUCA 2H9ZA 5B0DA 3QZ7A 3I5BA 3O6WA 4QW8A 2DFHA 3HHNB 4DV0F 4CFCA 2HQFA 2C3OA 2XLIA 2Z1JA 3AV9A 3BH6B 3G2XA 1NJIT 2Q97A 3VQAA 2J7UA 2BW7A 1XR5A 2GWKA 1P6TA 1DJ0A 2E7XA 4O3SA 4Z94A 3WC0A 3OY9A 3TOQA 4QIEA 4FWKA 1S4EA 1FFGB 1ITPA 3WXIA 1W2IA 2BGGA 4Y1CA 4KIAA 2E8AA 1VBKA 3OSNA 1X5OA 1AUSL 4NL5A 3CF5L 4YQWA 1NHUA 4KBOA 2DJWA 2L08A 5EVZA 2DRBA 3CO0P 5JS2A 3TTDA 4X64F 3O9UA 2HFZA 5IQQA 4KTWA 4FNHA 3UKRB 2KHDA 2X7IA 1M5HA 4DSFA 3I4PA 3EICA 1YTAA 3E9PA 1KEKA 1QZ6A 3MN6A 4AHRA 1SUQB 1RWVB 4WXOA 4B3MK 4JKDA 3SPZA 3SEOA 1FJGF 3T5HA 1VQPN 4BR7A 2HFSA 3M1VB 4HHTA 3E01A 3GG0A 2GNKA 4W5NA 3VAJA 4UY85 1S77D 1BE4A 4RUBA 4CLTA 2YHBA 2YKPA 2AW0A 5HP1A 5HOOA 4M94A 1BIZA 1X5SA 2RN2A 4QIVA 3BQ1A 1R0CB 2HIYA 3HFVA 3FZHA 3UFCX 3P38A 1VRTA 4JOUA 3D0PA 3G6XA 2CDQA 4F26A 1FX2A 3T1HJ 4CBUA 1RAOA 1JLEB 5MAOA 4H0YB 2ZD1A 4WK3A 1RP5A 4RU9A 2D3O1 3JAMU 4WF9L 4CM2A 4AXIA 5D8HB 2XS5A 4HUFA 2KG1A 3M1FA 3PY8A 2D5RA 2YPYA 2MLZA 2HGNA 1D3WA 2BBEA 1XNQK 1C1BB 3W5ZA 5C5JA 1NSKL 4USVA 3IKMA 4ZLJA 1IH7A 2CPYA 2J5AA 7AT1B 4BR9A 2ZZTA 4DQSA 2G8FA 1P90A 1EQ0A 3UDVA 1BG3A 2DXDA 1NO8A 4KH4A 3IWLA 3CPWM 3PO4A 2PA3A 3CJCA 3SQ4A 3QNWB 4FL9A 4FWRA 3QEXA 2E9RX 2CWXA 2M2BA 2LDIA 3C3LA 2HNDA 1QE1A 5KFCA 2NXJA 4OI6A 1EXQA 1P8GA 5EY4A 2FHKA 4B1ZA 1WEZA 1GAOA 3CIMA 4UZBA 3JSMB 1IKVB 4OZ5A 1R31A 2DIUA 3DLKB 5IC6B 4X4UA 2W2NP 3GIRA 2B5JB 4OZNA 2EEYA 2E5GA 3CMEN 4W90B 1ATNA 1NGCA 4QS7A 2YKMA 1N36F 2Q6BA 2MGZA 1QVGR 3W61A 1FERA 4DUYK 3TJ8A 1MROB 3QESA 4IH5A 2AZ3A 2HQCA 5IFMA 3TAFA 3J7A1 3L9ZA 3MEGA 3JB9k 3AVGA 2JEIA 3NH1A 5KG2A 2R7VA 3BSAA 1D4XA 3SBTA 2IBOA 4MMOA 1WG4A 3RYLA 3MECA 4ICLB 4BGAA 2MQLA 2WW8A 3B6OA 2PMWA 2QM1A 1RTIB 4MTPA 1W0HA 4Y6IA 3ZX3A 4KO0A 2E1MC 3M6VA 4ZP6A 1S72S 3IWNC 2HRYA 3AY9A 2ZH7A 2JSXA 2CNKB 5C25B 4E8UA 2YXLA 1NK5A 4UOCA 2QWQA 4ECYA 2UU9J 2AQ4A 1P9YA 3MMCA 3HVTB 4IUFA 3IFRA 3VGVA 3VF6A 4YHHJ 3JXOA 2AU0A 2AP6A 1OY8A 2G8KA 1VSIA 3LL3A 4DR7F 1ZZNA 2GVDB 4DX8H 2C42A 1X4FA 3M5RA 4DFKA 4FWQA 2EG1A 4NLWA 5KFDA 3LA0A 4DR7J 3M8WA 4K5SA 1B0PA 5IWAK 1NGAA 3TAMB 5AJ3J 5CA5A 3BGFA 4WP9A 2V2QA 2MZQA 3ENHA 4FJKA 4W5RA 2E2QA 1MN7A 4H5NA 2O8FA 1EP4B 2F7VA 2RU3A 1GXTA 4PCQA 4ECWA 4NEYA 4DPXA 3F9MA 1W2BM 3I33A 4CK3A 2H65B 4ECVA 4J9NA 1YAGA 3UVJA 4LC9B 3QGIA 4TY9A 2ZNYA 2QW9A 4JK8A 1YIJS 2B51A 3JS9A 1WUAA 4ILMA 1XMOK 5E84A 3PZPA 1OH5A 3ENAA 2UXCF 4QPXA 1UVNA 3TR5A 1Q5VA 3S7RA 4ENOA 3RUBL 3FZKA 2QLBB 3NLCA 2G2YA 5E7OB 2JFKA 3Q8RB 4KSEB 2DGQA 4BRKA 3TSUA 3R9PA 2F8EX 2IDEA 4IG0A 1CJVB 4DL7A 3D7EO 2W41A 3CGIA 2BZ2A 2R7TA 1S97A 5HN0A 4JYAF 4DR4K 1KHVA 4AH9A 3G4SS 4IJAA 1HWLA 1BHNA 2UVWA 2FC0A 3L3VA 1T9XA 3CI5A 4BC4A 2AEMA 4DL6A 3S3NA 4J91A 1NHKL 2C22A 2KFYA 4P72A 4ISGA 1NNEA 4WBFA 1TK8A 1TQLA 3L6QA 1DQAA 4DB3A 4MYTA 2D0BA 4FLYA 1FWLA 3MAHA 4KE5A 2Q31A 3X1LB 4B3SK 2X6SA 2ERRA 1SL0A 4OX9K 1UTAA 1J5OA 2EPIA 4YB1P 3PX6A 3E2EA 2R42A 2RB7A 4ALZA 4N8NA 1XNQF 2R7SA 3Q0AA 5DM6L 2IMOA 5IT9O 2X51A 3ZZPA 5HMWA 3OYBA 1HNWJ 4DTNA 1RAAB 2DVIA 1J5EJ 3G6EN 2R2UA 3FLCO 2A10A 3FCWA 1T3OA 3C14A 5DGAA 4FP9A 3GIKA 2F8HA 3K0JA 2B4VA 3ULEB 2AHOB 2FYXA 3AAWB 5KFOA 4CIGA 4X62F 2E2OA 3CJ1A 3U27A 5KG4A 4TNOA 3OYHA 5IWAF 2VJVA 5BRDA 3FCHA 2EWHA 1T0TV 4DQQA 4O3RA 3J7ZO 3CPEA 3VERA 3J7YP 3ZTRA 4YB7A 1YBAA 3DGVA 4ZLNA 3MUMP 2CKWA 5C24B 2CG4A 1XNQJ 1NJZA 1VISA 3LP2A 4IOCQ 4F04B 2RD5C 4AUKA 3CCRN 2HVZA 3LGMA 1FNMA 3SCJE 3ZLJA 4H5RA 1S0MA 2DH8A 3KMQA 1CVJA 2EBEA 1V3SA 2HQIA 4J9KA 2K06A 2XMJA 3UCZP 2OANA 5JXSA 2R8KA 2XS2A 2MYFA 5C7PA 3CCJS 3DRPA 2FBVA 1UZDA 1IWAA 3DRSA 1GK8A 1X7VA 3Q7BA 4CGIA 2PFDA 1SJQA 3FEYB 4C3LA 2F9DA 2LA6A 2CNOB 4K50A 3PFEA 4OPKA 4H0OA 2GVZB 4KGMA 3F5TA 3AVFA 4ZVOB 3L4BC 1TL7B 5DMRA 4M5NA 3DLLL 2ADCA 3TZWA 4FF4A 4P2MA 4I6YA 4B9MA 5LJVA 1NGJA 2JOQA 5EDWA 4NLRA 3RWUA 4XEIA 5A2QO 4DZ6A 3Q7CA 5KPTA 2RRNA 4N56A 4M8LA 1N36K 5JMVA 2NRRA 3LM2A 2XGPA 4FWMA 3ISNC 1YT3A 4OYPA 4DV0K 2DNGA 1PKUA 3DGPA 2N4DA 1F0XA 3F44A 3RW6A 2NZ4A 1YVFA 2QYGA 4A8WA 4LFBJ 3MN5A 2OPQA 4DR2K 1BY9A 2YX6A 4NXNK 2A6OA 4NLTA 2V8DA 3NMRA 1LOTB 1FKOB 4JI6F 2LXFA 3GZ7A 3RR8A 3V4IA 3M8PA 5BYQA 1CG2A 1QSSA 5HSPA 3NCQA 4LSNA 4YOXA 5EWFA 1S1UA 4B17A 3TTCA 1JCEA 4ISFA 3F56A 3JXUA 2VD3A 4CLUA 2WW4A 2OAUA 4Y34A 2MLXA 5BPMA 1H98A 2DH7A 3NGKA 3MMBA 3CCMN 2NYHA 2MTLA 2ASMA 4YY3J 3GSDA 2UP1A 4DV7K 2V2KA 2IGIA 1UL3A 1G4CA 4G65A 4J9LA 4K0KK 1RAIB 4ITSA 2MB0B 4LF9F 4X4RA 3RRGA 4DU7A 3NGIA 2H4WB 1FE0A 1UWAA 2V2ZA 1Q53A 4KHQA 4PXDA 2GO9A 4WKRA 1R7IA 4FJXA 3FMWA 4NZ6A 3CQXA 3NS7B 2WVFA 4CGJA 4URGA 2OYQA 1XTZA 4WZQA 1T9UA 4CFDA 1Q7YT 4CW7B 3T6JA 3KD5E 2P9LA 4PQUB 1F9EB 2HNZB 5C42A 4NYFA 1FDNA 3A5OC 1VJQA 1JXLA 2Z1GA 3H0PA 1SAZA 2EX3A 1S0VA 2MZTA 2MMYA 4OIXA 2OPPB 4Y2MA 3AVIA 1I1GA 4DUZF 1PJ5A 3M8SA 4FYDA 1T03A 1BCMA 3HL8A 3EGZA 1Q16B 2MPUA 2HHVA 3KLFA 3VF0B 2GV9A 4WCEQ 1WNEA 5KT3A 3IUCA 4HDHA 1R6YA 5FPMA 2E7WA 3OYGA 3I96A 2J6SA 2M88A 1BLUA 4QIFA 3GONA 2R9LA 4M5GA 2R7UA 3OPKA 3KHHA 2J0SD 1KVBA 3K8VA 5ELZA 3GWCA 4CBXA 2B6AB 1UEUA 3ZCMA 4E98A 5DZ6A 1LQ9A 4AL7A 3TWHA 4QOZB 3AVJA 3MN7A 2NZCA 2B7BB 3L7PA 3AOBA 3RU0A 2J7KA 4P2XA 3BGRB 4ZLPA 4M5DB 3EGNA 1C1BA 1JXVA 3A3PB 3T7ZA 1FJ7A 3R5DA 4A8KA 3IAS9 2A6AA 2E88A 4ZVRB 3WQPA 4EFAC 2FC8A 4WYBA 1F2GA 2GTDA 3I9ZA 5K8NA 1N48A 4RL1A 4KPYA 1UETA 1LW0B 3OUYB 3VENA 2E1AA 4FLVA 4FS2A 1WSFA 2X1GA 2CGJA 2VQEK 1NOYA 2H5JB 4DF4A 2DBBA 1RHMB 4B3RF 1NKBA 3SPYA 3IMQJ 3P39A 2Y1JA 3D6MB 3CHWA 1UAWA 2GS8A 4FVMA 3CETA 5KFEA 1XHXA 1REVB 3L95X 1U48A 3WNGA 3DLKA 1OIAA 4CZIA 1S6UA 3C94A 4AHCA 3SMPA 5I9EB 4UY8T 2ITMA 4JI0F 1QD1A 4CF1A 2XYHB 5AXLA 1RNHA 3MXIA 1U4BA 5E26A 3IR6B 1J9AA 2N82B 3CJKB 3GL1A 1SKUB 3TZYA 5F8GA 3RTVA 4B3RJ 2NRTA 3V5RA 3I55S 3LDQA 3FGVA 5F0UA 1X9SA 2KHOA 3O8WA 2V2VA 3C6AA 2VHGA 3CD5A 5IM0B 2MKCA 3OYMA 2CH5A 4NCBA 4IJNA 1A7GE 5M1PA 3FUYA 4DR1J 3P4UB 4P2FA 3LOUA 4RW6B 4DR5F 4X65J 5GIOA 1EX4A 2GIQA 4XH5A 3EE3A 3KMSA 1R27B 4JI4K 3DHWC 4DPTA 4O5FA 3SUQA 4LBPA 2YX7A 3THXA 3W2VA 5KFNA 1K73T 5M1FA 3M30B 4O4RA 4ECTA 5GAEI 3JTNA 2GEMA 4CFAA 3D54A 4M63C 2R7WA 1RWXB 2O4IA 4UT4A 2EKYA 5ETSA 3L2WA 3PR5B 1KCFA 5TKWA 5KFUA 4DTXA 3M8ZA 1H1VA 2LVWA 5C12A 2L48A 5THWA 5AQHA 5C10A 3BBBA 4J7CA 4OI4A 4K4ZA 1P8ZA 1B0TA 1RT6B 3M4XA 2OEJA 4EHTA 2V4JA 1NXIA 3A1YG 5HBMA 3EKUA 1S76D 3CMQA 3KG0A 3EE8A 2O8CA 1FHTA 4DMZA 4CF8A 1V3RA 3W60A 3U3GA 4I68A 4BC7A 4K0KF 2YPZA 3GPAA 2KXNB 1U02A 4NLUA 2Q1NA 2VIHA 1ZXOA 2DGTA 4YR2A 2P5GA 4LRFA 2YH0A 4JV5J 1JCFA 4QZVB 3AO5A 3CC7N 2KT3A 5D15A 5A6PA 3DRRB 2CPIA 4BR2A 4OHWA 4DUZJ 2NNWA 5CY4A 3DLRA 3KNGA 2HFUA 1SC3B 5F3TA 3BR8A 3CDEA 1YJUA 4K59A 1N8RO 2F63A 1HWJA 3Q8SB 2ZD1B 1VSMA 4Z4GA 1A5VA 4GNIA 1QUVA 4DR1K 1NDLA 1N0UA 2HFVA 4DFPA 4ISEA 4KHRA 2HZCA 4LUBA 1HNXK 3KDNA 5TKYA 3EE9A 4KGXB 4C48A 1E4GT 5KFBA 2N3OA 2XY8A 3W0LA 2BRLA 1NWKA 4FF2A 3K9KA 4E1NA 3ZO7A 2E20A 3CUNA 4YB5A 3CJ7A 4Z4EA 2QO3A 3OL8A 3N79A 3HZ6A 2W6KA 1NHVA 2BE2A 2I0XA 2DNMA 4C9DA 3DXMB 5K14A 1VQ5S 4L72B 1VBYA 3GYGA 4KFBB 1C4CA 1XR6A 4AXJA 3D5MA 3S9HA 3O9SA 3Q8VA 3J8AA 1FCAA 4O5BA 4ELUA 4DX5A 2AD9A 4KREA 4HACA 5JJBA 3J80O 1SIZA 3JSMA 1HQUA 1YUWA 4LFCF 3H42A 5AQZA 3GDQA 1VMBA 4DXLA 2X1AA 3G6ES 4DS4A 3M9NB 1NGIA 3R1XA 4IOCL 4PXEA 2P9EA 2R8JA 2NRXA 4BS2A 2DGXA 3ET6A 4JI3J 2NYIA 3OXGA 4JI0J 3M9MB 1Q9YA 3K9JA 5H9EJ 5KFKA 4K4YA 5CZXA 5DQGA 2HURA 3NS6A 2HGLA 3AD9C 3LP2B 4OI0A 2G8HA 4KRFA 1KAYA 3KVGA 2V7ZA 3ZX2A 3E1YA 4ZHRB 4MLEA 2BA9A 3HSTB 5BRHA 4M5KA 1RBVA 4KV8B 1IKWA 3DDKA 3FNNA 4OX9J 3DRPB 4OMFG 4ES3A 1HKGA 3GBTA 4FF1A 2YJEA 4DTSA 3MFHA 4V1Ak 2YKAA 4WFZA 1RDRA 3BO2A 2DR5A 2PI4A 5M1QA 3OA9A 4RBUA 3K2YA 3IRXA 2CADA 2PA8D 5DO2A 1U1LA 1WB9A 1RSCA 1RKJA 4OO1J 2XRIA 3SCXA 2XWYA 5GADP 3ZSZA 4DR4J 4OZ0A 5BN9A 3OBYA 4F2SA 3JTPA 2PMZD 4DPYA 1IG9A 2DHSA 1QVFR 2DNOA 4WFXA 4JBCA 2DPJA 2E9TA 1FW6A 1WUUA 2E5JA 2HAIA 3HCXA 1SKSA 2DD8S 4O0NA 3ATVA 4LR7A 1DAXA 1KNZA 1VQ8N 2K8GA 2C2OB 2AJ1A 2DO4A 4EO8A 3G0ZA 3WC2A 1ITGA 5F9LA 1TELA 1XMOJ 2BE7D 3N4QA 3ETOA 4LFAK 3KNAA 5LT5A 4NCGB 4J5OA 5CQGA 3OTEA 4ZP9A 2MKSA 4TU7A 4OJ1A 2QEXN 3T41A 1GOBA 1RUSA 1QHAA 4JK7A 4O44A 4RW4B 2X1BA 1T9VA 4M5LA 1N33K 1VC0A 1VK0A 4LMZA 3FFIB 1NLKL 4BDZA 2VWJA 3LGNA 2KI2A 2KJWA 4IYQA 4CQ1A 1YGYA 1EHWA 4F36A 2C2DA 3J7YI 3VGTA 3IBFB 2QLXA 3MWBA 2M70A 5LJWA 8AT1B 2EK6A 3KHRA 5DG8A 2DK2A 4PWDA 2ZE2B 1Q8IA 3PCOB 5KQ8A 1DBDA 2DFFA 2YJFA 4PWWA 1R59O 3O1BA 1TL4A 3LDOA 4NE9C 1DHMA 1HMVA 4G6VB 2BQRA 1RT3A 1VQKS 1IR1A 5L39A 2BYCA 3PYGA 1IBKK 3Q23A 2NQPA 4FOEA 4HUEA 3HPOA 4CZMA 3RBXA 3EVOA 1NNDA 2BANB 2MKHA 1TKTB 4DHYA 4B9TA 2O8EB 4KO0B 1HR0J 4DR2J 4PG4A 2D0CA 3NF8A 5M2UA 2O3DA 1T02A 3LTOA 4MKVA 4FJNA 1C4AA 5C42B 3A8EA 1M90O 3AVCA 2QLFB 2OPSB 2M7SA 3NWRA 2VJUA 4NLSA 2MQQA 3CTRA 2WTFA 5DM7Q 1NK0A 5KFIA 2XI3A 2MZ1A 2E5LJ 3PJXA 2CJBA 1CJTB 1VQ9N 2QWMA 3ENVA 5AQYA 4ZJQA 3MUTP 3WT0A 3FFKB 1KHWA 2YKNA 4BWMA 3ULEA 2KVIA 4MFBA 1RYSA 1U0SA 2F7TA 1B70B 2ROPA 4UTGA 3DDIA 1NOZA 2FHMA 3F41A 2HHUA 1WELA 3KLVA 3H7HB 3HJFA 2AT1B 4Z4CA 1RWOB 4ZJOA 3M2UB 2ZHAA 5C2GA 1LWCA 3Q8UA 1D09B 3FMBA 3MR6A 3IM8A 1C2PA 1ZTTA 3HOTA 1JLGA 2QGFB 1TU0B 3RB4A 2JNJA 2YV0X 2JWKA 2DXFA 6FD1A 1Y0HA 1R8BA 3U8XA 1K0TA 3AVLA 5IV4A 3D9BA 4FYWB 4RWTA 2P9PA 5A8RA 3TZXA 2EXUA 1HBOB 1LW0A 1C0UB 3N0VA 3VALA 3D2WA 2KXHA 3MDQA 3V6JA 3T1HF 3LDPA 4OI1A 2RQCA 3B4MA 2IAJA 1PCAA 1FRHA 4W5QA 3TAEA 2W2QP 2YNFA 2OFGX 3V9ZA 4CF9A 4YDXA 2HMIB 3MAAA 1REVA 3HKZD 1H7WA 3AO3A 2HBLA 1RDWX 1VBZA 1UFLA 1J6ZA 1WSRA 2F9TA 5HP1B 2ZWOA 1RT5B 1S9GB 1HNZJ 1CZBA 1NJIO 3CCEN 3MDFA 1DQ9A 4KQZA 2P9IB 2ZH2A 2R3VA 4EO6A 3CJKA 3WEEA 2EFQA 4M3TA 4CECA 3EMTA 4PA1A 5GINA 1IN0A 4CZFA 1TAUA 3ZTPA 1NZAA 4CEFA 2EKNA 4WFYA 3C7NB 1N56A 2YY3A 5IZHA 2GGPA 5G4DA 2QWPA 2CQBA 4ELVA 2VGNA 1RWUA 3FEZA 2AGPA 1LAWA 1VIXA 4QU7A 2KLAA 1T94A 2BJDA 4YOWA 3B8AX 1QAIA 3G8SA 4NLCA 3HHLA 2G9OA 4B08A 3M2RA 2Y1LB 4Y00A 3FE1A 3PR4A 3T1YJ 3IXQA 4HYKA 3QRQA 2DGUA 1JJ4A 3VA0A 2MQOA 3HVAA 3NGRA 4BACA 4I56A 3M6UA 1ZYQA 3EZOA 4B9QA 5GAGI 2OEKA 2YHYA 1M0SA 5IWAJ 1YKWA 1XNRJ 1OJ4A 1GXUA 2F3JA 3MM5B 2YQ3A 2VCPA 3DRXA 3QAEA 2K2PA 1HD0A 1E6VA 4F50A 2HB5A 2F8TA 3OHBA 4RJVA 1J54A 4QYRA 2Z1IA 1RABB 2MJUA 4JKCA 5K20B 3B8HA 3SNNA 4JI5F 3ZTOA 2J9DE 3T1YF 4M3ZA 4IKAA 1QSLA 1UPMB 4J2AA 1MROA 3FQLA 2WBMA 4IRCA 3EN9A 2W4CA 4CJPA 2CJ9A 3HPHA 2UVVA 3NL0A 1QTMA 4K41A 1HW9A 4G1QA 3AA2A 3NFAA 5AQRA 3MM8A 4OVLA 2G1DA 3LH2S 3THYB 1VQ6S 4KH0B 2VYPA 3C66A 4OL8A 3CDUA 3QNOA 5CD4H 4YHHK 2DNRA 1HBNB 3MUVP 1FJCA 1GX6A 3ZX0A 2ZJRL 2QJ3A 5HRRA 3MXMA 2Y8WA 1U1NA 3ENQA 5CCMA 4FDFA 3QPIA 1JCGA 2QT7A 1B9DA 5FD1A 2MKYA 5GAEU 5GMEA 3AFGA 3AVBA 2F9WA 5D0HA 1CXQA 2FJBB 2WB4A 4FPBA 3AQPA 4A48A 2Y1RI 2UUAJ 3FZBA 1JJHA 2RMLA 3Q8QB 3N4WA 4P7TA 4OYZA 5G0RA 4LSLA 4QYZJ 3HLUA 2HW3A 4IDKA 5T14A 2OHDA 1S6OA 3VEZA 1V5VA 2RT3A 1Y5NB 4LF9J 4CTAA 4KTQA 4JD2A 4JHDB 1UJ6A 5KRTA 1QY7A 3SZ2A 5KG0A 2DISA 3TAMA 4NLGA 5HANA 3VGSA 3MEEA 5BPLA 4X84A 3PIPL 4GV6A 4BC2A 3VQPA 1VGYA 2ZQBA 2ZHOA 1VCTA 2UV8G 3WHIA 2W25A 1KLMB 4OYOA 2PBDA 3ZZRA 2KT5A 4HVJA 2HWTA 4DX6A 4J9UE 5KFPA 4NXMJ 2BVZA 1FK9A 3M8PB 1IG8A 3CJ8A 4X62J 1EKSA 3VETA 1S1UB 1VAZA 2B9EA 4BRDA 4CGFA 5KFJA 1U49A 4JV1A 3UE2A 5D0EA 2DT9A 5FRMA 3VHQA 3AJDA 3OR1B 4MIBA 3O80A 1YJNN 4PZVA 4FCYA 1NK6A 4KR0B 3H2VE 4WE1A 1URRA 1RBTA 2P5VA 1X0FA 1ZAVA 2YBVA 4CIFA 3SAGA 3ID8A 2QEXS 1QAYA 4DPOA 3QMQA 4GVEA 3KG1A 2O01C 1B7FA 3HI0A 1VRUA 1DARA 1LFWA 4KB0A 4EP4A 3K5OA 2FBXA 4CZEA 4RW6A 3MCOA 4B1YB 3HHLC 4KGVB 5ETOA 2YNIB 3AGRA 1WC5A 5FLXO 1CJUA 1TKZB 2KFNA 2PY5A 1X4HA 2A2DA 3RB6A 1YWXA 1KOHA 2YNHA 2HBKA 3PRDA 1C0MA 2XSJA 3EPIA 1E4FT 4BRHA 3MMCB 2IVFB 4C3MA 3TABA 3F73A 4YEAA 2Q79A 3CPWR 4LF9K 2XM3A 3U1MA 5F9NA 2BJEA 4CRJA 4I0WA 2E1ZA 4ZCIA 1X9WA 3P5TL 1VIOA 2NPFA 1KR4A 4CO5A 1C1CB 2FB0A 3V9UA 4CNZA 3RW7A 1QZ5A 3AGKA 4B3MJ 3PKYA 2KXFA 4CJ3A 4DV2K 2P9KB 2MQNA 4DL5A 1RBLA 4JI1K 1ZM9A 3D1HA 5EWGA 5EUHA 2XC9A 3L7UA 3U4LA 3PIPQ 2A3JA 1R0BG 3FDSA 4JAXA 1MLAA 2M4MA 2B0GA 5DDRC 4ZA1A 5IT0A 2Z56B 3QIOA 2ZZMA 4WP3A 4C8ZA 3V9WA 4BRAA 3Q86A 5KQDA 2HHHJ 2CQ3A 3ZT4A 4C1NI 4NXNF 1L3UA 1PYTA 2DRAA 3FFIA 2UXBK 3GYXB 3FEXB 1DTTB 2CG8A 3A8IA 1NGDA 5DM7L 4A57A 1EKRA 4MK8A 3G9CA 1RDAA 3I9V9 2BUNA 3N5BA 2UXDJ 3HKWA 4XPEA 4RKUC 1Q82T 1RBSA 2VQFK 4GKJJ 4DV3K 2HVDA 5EX0A 3LO3A 2VWBA 4M45A 1XUPO 4ZVHA 3R5BA 3L0QA 4ZPAA 3MI7X 1S9FA 3CXCR 3OS0A 1ZM2A 2UU9K 2B7CB 1RKIA 3U3YA 4F3MA 2DEIA 3GG1A 5IM0A 3SSRA 3MN9A 2APOA 2MQMA 2J7WA 5LMUK 2XQCA 2ZC3A 2XMUA 3KK7A 3LALA 2Z2YB 2E1CA 2KYZA 3PUFA 2AA4A 2IRYA 3AOAA 2NCKL 2CQHA 4MK9A 4ZKAA 2FJXA 4I2QB 1H74A 2DY1A 3BGOP 1QQOA 1UWBA 4YUDA 3UE5A 2E6LA 1FDAA 1S12A 3B6PA 4XH1A 4CT9A 5ETPA 4DUYJ 3C65A 3CVKA 1N4LA 4K2JA 4MT1A 3A2FA 1NKCA 4FLZA 1TZ0A 2FF3B 5T7LA 3MHYA 2KG0A 2AJ0A 1LWEA 3O2IA 1UJ4A 4RBVA 3LP0B 5AQSA 4JV5F 3U7JA 1N32K 4RUAA 1CLQA 5AQKA 1DGKN 4ECZA 4NLVA 4ELTA 3CMAN 4TU9A 3VQ9A 3VF4A 2GW8A 3ONQA 1WKKA 1QQCA 3J7YU 1H38A 1RYRA 3NGUA 1T8EA 1YJVA 1BQMB 2R2RA 1K8KB 4DCPB 4B3SF 3C6TA 5IC4B 3T1AA 2QTWA 1LNQA 1HLWA 1HBOA 2OZSA 5H9EK 4WP8A 3U1LA 4JI5K 3OJSA 1YVUA 1VQYA 5FPEA 1UEVA 4MO4A 1IUJA 3A0IX 2P51A 1VLYA 2JRSA 1MA9B 1VSDA 2OTLS 4O4GA 3NAIA 1SIWB 4KTZA 5KI6A 2EW9A 4ZCMA 1Y00A 2VBYA 3VAIA 5J2PB 3CD6N 2M8HA 3MFIA 3T3FA 3CJBA 5AZIA 3A4TA 3G87A 4NMLA 1VR6A 1WHXA 2W1BA 2G4BA 3NGZA 2OD6A 1RT5A 1BI4B 5F3ZA 1R8PA 5M2PA 4NRUA 1NK7A 4DV3J 4URSA 2VQFJ 4M7YA 2EG2A 1S1VA 3MPDA 2ZDOA 3EUNA 3UNGC 3ILOA 3PW2A 2GUIA 2P5OA 1FT8A 1SQEA 3GP9A 3MOJB 3DWLA 4UOGA 5ETQA 2HG4A 4JKEA 4CJ4A 5I42B 3KK2B 4OYWA 1FKOA 5KT5A 3HP9A 4H5WA 3N28A 4CH0S 1G2EA 3B4DA 3HD2A 1I3AA 1HR0K 4DN9A 3EZ5A 5E0OA 2Y1IA 1WSGA 3TYTA 1S1WB 3CQYA 1Z2LA 4NA3A 5CYQB 2V68A 3NRBA 4X64J 3MPVA 2CJXB 4DHVA 1Y3KA 3ADAC 4K4XA 1PYSB 2BJ7A 1JLFB 1XC3A 4L8RB 3EKSA 1JLAB 2V8GA 4DU3A 4LR9A 1BHLA 1NKEA 3DLGB 2YKQA 2SXLA 4OPAA 3G8TA 2ZVSA 1IQTA 1XC9A 1WF1A 2Z4PA 3IRXB 1P1TA 4FSVA 4IOAQ 5FLXU 2KFZA 5A2QU 2ZGZA 1RTDB 3BUZB 1XBWA 5C2DA 3CFOA 5FDLA 2N4CA 2VG6A 5AXMA 2PEHA 1EWRA 5I3UA 4ZVEA 2ZUGA 4JI2K 2QXFA 4OZLA 2ZEJA 3KK1B 1FFWB 3SYZA 4QJVA 2OH2A 3CCES 3CW2C 3CCUN 1YTUA 1J5EK 4NASA 1OH7A 4MIWA 1U6BA 2GJIA 2DEJA 2V7YA 4GW6A 3QT6A 1VSEA 3HD1A 2XLKA 3ICLA 4YOUA 4ECRA 2UUTA 4UUXA 4I2PA 2E1RA 1U8WA 4ZVPB 1EKEA 3T1HK 1EETA 4BRFA 3ETMA 4QU6A 2OMOA 4W5OA 1M1GA 4O44B 3FGUA 2UUCK 3S01A 2EFOA 4HT5A 3AA4A 3R97A 2RHSB 1WC3A 1X3NA 3AAQA 1GNKA 2J4RA 1TFYA 2RSQA 4OHXA 5KFWA 1I5OB 3OXFA 3R3LA 3SV3A 2LQJA 1U0HA 4PXBA 2FY8A 3KK3B 3A12A 3KHLA 3AXKA 1R3NA 1P9QC 2EFPA 4AE5A 2ASDA 1S59A 3K5LA 4ILGB 4L6V3 1HR0F 1EO1A 3OXLA 4PHTX 4F02A 4FBTA 5JLHA 3CXCM 2MSTA 5AE3A 1GEHA 4ECQA 4LFCJ 1ACMB 1DTQA 1R8HA 3FBBA 2CAJA 2E5HA 1HYSA 1V4TA 3C16A 3IN5A 3T5LA 2MQPA 4DQ8A 1HBUB 3ILIA 2CQGA 3CC4S 5EX3A 1IBKF 1JMTA 2WFBA 1M1KO 5AQOA 1S9GA 1O5JA 3JSBA 1YBUA 3ISND 1VHFA 5EOYA 3D2FA 2J76E 4PUOB 1FI4A 2GCFA 3VAHA 3AD7C 4YOTA 3VQ6A 4JNEA 5GIPA 3UR0A 1TVRA 2IBKA 2HYIB 1KONA 4CJVA 4C1NK 3BJYA 3ZXWA 2VBXA 3TJAA 2UUCF 1S4FA 2OFHX 1GLDG 4FWPA 2K3KA 1Z26A 4FJ5A 2DTUA 2MQ8A 1XQSC 1PJ7A 1F9HA 2QZ8A 5M1KA 2R7RA 2OLWA 3CCLS 2QL9B 1X4DA 5ETNA 4N41A 2KYXA 3OYAA 3OL7A 5HJYA 5KTQA 4EHUA 2P9UA 5B0CA 2KW4A 3H3OB 1NM1A 2YNHB 3IRWP 4NLBA 4WFBL 4DI6A 2NUHA 4HDGA 4A46A 1NJXA 2VODA 1UW4A 2OPSA 3DYAB 3ASMA 1T11A 3DXMA 5L9NA 3ZT1A 2C2ZB 5CZ1A 2IC3A 1F5CA 2HBRB 3QBXA 4KH1B 4W4MA 1HNZF 3OTOJ 1R8AA 1E6VB 4CJUA 2QMWA 5K8MA 1YLXA 4CEZA 3JQKA 2XHWA 2ILZA 3NP5A 2FSKA 3CCSS 1O1WA 1RWPB 2F96A 1Y64A 1O13A 4USKA 1W2BR 1H2TZ 3SIPB 1GXLA 4P7VA 1S10A 2QIFA 3PIOQ 4CIEA 5FRNA 2HF4A 2RDIA 3AVMA 3AA8A 1I3OB 1FA0A 4GY2B 4OLOA 4FYVB 2CQCA 2YCHA 2CVIA 2BX6A 2QKBA 3D3CJ 5A8KA 5AE2A 3NDKA 5GADU 4H0PA 3QLHA 2E1YA 3AB2B 4HCCA 2AYEA 2FLPA 4ID1A 4CJEA 4TQSA 2M3DA 4IQXA 2FBYA 1YF5L 1OVQA 1U04A 3H40A 2MDAA 3G8QA 3D2FB 3J7AP 4DR3J 4Q7AA 2P9IA 4J9QA 2EVZA 4MKAA 4HHHA 4TN2A 2FBTA 2L41A 2HHTA 2FJEB 1WC1A 4LIRA 4BC3A 1S6QA 3DM2A 1OQ6A 2J6TA 3R27A 3V1QA 4NLDA 2I38A 5J2MB 3MM6B 2V50A 4C98A 5KPRA 2P6SA 1P27B 5AQVA 2UU9F 4LSLB 1QTNB 3TARA 1VOMA 3ZSQA 1RBUA 1T9WA 2C2KB 4DCHA 3T6BA 1T05A 2X3DA 2AV5A 1FXXA 2BTFA 3CFPA 4A2AA 4MYUA 4I2QA 3MX2A 2OKQA 1UKUA 2Y3YA 2VKRA 2Z2ZA 4U8YA 3BZCA 4B3TJ 2ZM6K 2MLYA 5KFQA 4ZITA 2LKZA 2FVRA 4DV4F 2RH3A 3TO8A 4ZP7A 4JI4F 4TQRA 1FJEB 3DU6A 4KAIA 4NCGA 1NB2A 2UXBF 1WORA 5KT6A 3CIPA 3MMAA 3KJVB 1S99A 3IP0A 5KPZA 3TAQA 3DI6A 3NGDA 1QVGM 2MXYA 4LFCK 1KC8O 1HNXF 2AJFE 1HNVB 3IWXA 2IVOA 4C7QA 2ILYA 1D8ZA 3IM9A 1S57A 4IH6A 3O4NA 1JLBA 2E5LK 4Q45A 1NG9A 4F4KA 1VBXA 2XSFA 2XO7A 4C6AA 3N6NA 2EBGA 4BY9C 5DDPC 3KFWX 4B3TF 2GQ2A 2GIFA 2IIHA 3I0SB 1HQ2A 3QGGA 3QIPA 5I3PA 4DV4J 4H0XB 1K1QA 4ETXA 4C4WA 3AO4A 3VGKA 3VGLA 1WKLA 1WG1A 5KFRA 3D2EA 2XMTA 1EP4A 3ET6B 2DNPA 5I3QA 1FTRA 3M1VA 5GAHP 4B3OB 1SC6A 2AYBA 4EBDA 4JV2A 2HLUA 3MGJA 1EJ7L 1IVZA 2XULA 4BREA 4Y0FA 5AFUA 2IDLA 3JTOA 4K4TA 3OW2R 4LY7A 4F9OA 2IVMA 2W7AA 4MAKA 1D9DA 1LAVA 3IO1A 1ZBHA 4OHVA 1T7PA 3LUYA 2P8IA 1CJUB 3TX8A 4CP5A 4CI0B 2DPNA 2ASLA 4AM6A 4DLGA 4JYAJ 3HZEA 5A76A 2A6MA 1UMJA 5D0RA 4CJSA 5E3AA 3M3ZA 1Q81T 3A5LC 1RTHB 4PQAA 5BREA 4RNOA 5D4NA 3DU5A 3T9ZA 3QICA 2XLJA 3ILLA 4ECXA 1H0HB 4NYOA 2IM0A 3E01B 1RT4B 2BDPA 2GV1A 3FVYA 1KAZA 2MJNA 1CJTA 2KKHA 2CDRB 5AZIB 4CJ7A 1REGX 2CQ2A 2VL1A 1BC6A 2WZ1A 4CTAB 2Q43A 1Y3JA 3C8YA 3BSOA 4KRWA 1JL2A 4ZPBA 3FRZA 3HYFA 4KHPK 3BQ2A 3GG4A 3MEEB 5KFSA 2UUAF 4N5SA 4Z7YA 2AJ4A 4CHPA 3OFEA 4DR5K 4FZYA 4IKFA 1MDUB 4CK1A 3VAFA 3V9SA 4KGKA 2D69A 3H3NO 2WBNA 2VICA 5BRFA 1H7XA 5GVQA 2E4LA 4RZRA 4HHUA 2YTCA 4CLKA 3RAQA 1VQ9S 3OL6A 2O8BA 5B0GA 3MM9A 2YWKA 4QYZK 3NOGA 2O5DA 3L2UA 3E66A 5CZ2A 2VPZB 2XY6A 4OLBA 5LL6d 2PIIA 4P71A 5AQTA 5AQUA 1NK9A 2PEBA 5J2NB 3NHGA 4Y2IA 3RMBA 2MGZB 3J80Y 2A42A 1Y5IB 1L3VA 1FRLA 3VZIA 4WE1B 2W7PA 4B1VA 3VQTA 2LDYA 4F4WA 4A8MP 1WBDA 2C2RA 2VFTA 1L3KA 3V6DA 1CPZA 3VQEA 4D3HA 2MKJA 3VGUA 4KY3A 2AIRB 2NUUG 3UI3A 4L3NA 3CC4N 2A18A 1YITN 5LJ5Y 3ZZZA 2XMAA 4JKHA 3VWSA 1G6BA 3DDNA 3UW1A 5HLFB 1U6ZA 3C95A 2QTDA 2JVRA 4DU1A 4OYXA 3NVMA 4P6QA 3EZUA 1WG5A 3QFHA 3C6UA 2QMUB 3H8YA 1VQNS 5L9XA 3O3LA 3V2UC 1K8AO 4PWUA 4H54A 1S3XA 5BR8J 4X4SA 4UW2A 1WEYA 2RS8A 1X4BA 4F8RA 2ZBPA 1LFPA 1Q82O 3V1OA 4QWCA 2CWKA 3KKSA 3J7Z5 3B78A 3G6VA 4HT7A 4LF5J 4TYBA 1SUQA 4O0JA 4ANDA 4OGCA 2XI2A 4G9ZA 2RHQB 5ETKA 2CPZA 3KUGA 4FJHA 1PSDA 2FUG9 1Q1KA 4GC6A 2DHHA 5T7LB 1XNRF 2Z30B 3CQ8A 1R0AB 5ETMA 4DR6J 4CJWA 4ED4A 2DNQA 5JS1A 2HHHF 4IFYB 1DT9A 3PYDA 1Y97A 1S79A 3CCRS 4NXNJ 3EEQA 4WU3A 3KKRA 4QAGA 3GOIA 1NGHA 4ZPWR 2OZMA 4KJIA 1RA7A 4RNMA 1QUPA 2CNLB 4E7JA 4XTTA 2KJVA 1IM4A 3VV2B 2NUBA 2VKZG 1YXQA 2UXDF 3IR5B 2P9SA 4U95A 2V0NA 3AA9A 1YJ9S 5FROA 3FZMA 1YJNS 4HTJA 4F2RA 1MSWD 1W7AA 3THWA 4JV0A 2W2PP 5HMZA 3QO9B 5KG6A 4CFBA 3DOMB 2KU7A 2LLZA 3PG9A 2HMPA 4IO9L 4EU0A 1YQHA 2HOEA 1V5IB 4LF1A 1IQZA 1SQGA 3FKBA 1BWEA 3H08A 4CHYA 1VHIA 3UO0A 1RLCL 3GV7B 1NDKA 1BISA 2GMJA 1FWPA 3K58A 1Q8BA 1SV5A 5GAGP 5F8MA 4R8UA 1U2VA 1EZZB 4OKKA 3BN7A 1WSIA 2IAJB 3C16B 2K3IA 4DU4A 5E3CA 2F4VF 3W9HA 2K1RA 3GJSB 4KH5A 2G0IA 4BGBA 3AJ1A 3QFWA 1G99A 1V9OA 1HA1A 3CCTA 2F4VJ 1IKXB 4EP5A 1HD1A 2PD1A 1UVMA 2JLFA 1RU2A 2C1EB 3CO9A 2GBZA 2ZJQQ 3M8RA 4TYAA 1VRTB 3L09A 3BEXA 4YDUC 3ZNUA 3SQ0A 2NPIA 1AZSA 1NGFA 1W26A 3BS9A 2RU9A 1TVRB 4OZ1A 3RJMB 2D41A 1J2VA 1IBLF 3SMSA 1MU2B 5C2CA 1X4AA 4M7XA 4YDDB 2IRUA 4DJBA 4ED2A 2ASOA 4M5JA 4CH7A 4WWSA 4JI2J 3TUZC 4TVAB 1HHSA 1UP1A 1ZBTA 1JX4A 5SZTA 1YJWN 3W2WA 1KTQA 4C11A 2GO8A 1RT1B 1LWEB 3C7NA 2ZOMA 2GGPB 3KLIB 5AQJA 1RFQA 1FESA 1BIUA 2IIRA 1HQEA 4BRLA 2XGQA 4CZKA 4B3SJ 4JHDA 3TJ9A 3FBEA 1RHQB 1X4GA 2OA8A 3ZTSA 4YB6A 3PLAA 3ZETB 4P74A 4USUA 2FLLA 3WQUA 3KLHB 5KFFA 2GC8A 1BQMA 4HCBA 1TKXB 1QE1B 4GKKK 4CZGA 3MCSA 4PPZA 1DURA 5B8HA 1XJWB 5M1OA 2CZ9A