1SV5A

Crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse Transcriptase
total genus 131
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1sv5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1sv5A05
4LQ3A 1S1WB 1IKYB 5HP1A 2R8IA 3OJUA 4JLHA 3V9SA 3DDKA 4DS5A 4NLXA 4M3WA 5J1EA 4HCBA 4DTPA 5KFOA 3NF6A 1N4LA 2XY7A 5C25B 4F2RA 4K4UA 4FJ8A 3KD5E 1SUQA 4PA1A 3DLKA 4RW8B 1TL1A 3KKSA 1IKYA 4CIFA 5I42B 4K8XA 3QZ7A 4FS2A 3AVNA 3TANA 3V9WA 1VSMA 1QTMA 1DLOA 3DI6A 2VWJA 4AHCA 3CDWA 5KGXA 4XPEA 3AVMA 1JLGB 5HBMB 3O3HA 1JL1A 4O4GA 1LWCB 2W7PA 4CK3A 3S3OA 4FLVA 2Y1IA 1DTQA 5DGAA 3KOAA 4ZPBA 1N6QB 2QK9A 2DFFA 4DTSA 1QSYA 2AX0A 4TY9A 2AGQA 3SQ4A 4CJRA 4N5SA 1WSJA 4TY8A 1RTDA 5KT6A 1N5YB 5J2PB 1RT5B 1TV6A 1HMVB 1KHWA 2ETJA 3C6TB 3CFRA 3M9OB 3MR5A 1B9DA 2W42A 2RDIA 1K6YA 2C2RA 5HRNA 4F2SA 1RT7B 1TV6B 1VSLA 4RW9B 1VSIA 1RT5A 4DSKA 4J9SA 3MFHA 2FJXA 3ZT1A 4CJVA 1DTTA 3OYNA 4FJGA 4FYDA 3QYYA 4ZHRB 3FDSA 3M9MB 1JLBB 3OYMA 4ZVFA 3I0SB 3MXIA 4KHWA 4IFYA 4PY5A 1SL0A 3V1OA 4O4GB 4NLYA 3VN5A 2IM1A 4GC6A 2P1JA 1FKPA 4ICLA 5J2MA 1U04A 3L3UA 3SV4A 4J9PA 4HUGA 1T94A 3AVAA 1YVFA 3TAQA 3PR5B 3PR4A 3DLKB 4IG3B 4NLGA 5C5JA 1MU2A 4M41A 2QV6A 3AO2A 1TGOA 1JLEB 3QEPA 3B6OA 2IAJB 2YNIB 2OH2A 4IQXA 2OZSA 3DRRA 4Q0BA 5JUMA 4NLOA 1S97A 1GOBA 4CIGA 3H59A 4FZYA 4M94A 4FVMA 5KFVA 3KLEA 4Y3CA 4NLDA 1S48A 2E6LA 4I7FA 3GV7B 2AJQA 5KFQA 4JRQA 1C2PA 1QS4A 3ZSRA 4CEQA 2G8WA 3PW0A 1NJWA 1VRUA 5KFXA 4F4XA 3TAEA 2ZKUA 4E1NA 2XY8A 3H08A 5KFFA 4ZVHA 3HYFA 2YNGA 4NCAA 3QERA 1KVBA 4H4MA 2R2RA 4DL6A 4N56A 3DRSA 4I9QA 3E01B 4K4ZA 2FVQA 4Z4HA 2FLNA 3QLHA 3DLEB 4B08A 1GOAA 3AO5A 4HUEA 3HPOA 2I5JB 4GC7A 3ZSVA 2G8HA 3KIOA 1L3VA 1IKXB 1CZ9A 3L2QA 4O3SA 2Z1GA 3PY8A 3ZSXA 1TKZB 3IS9B 4WYWA 3KLHB 2NUBA 3QINA 1UAXA 2IMWP 3DMJB 3CWJA 1S6PB 4CIEA 3DOKB 1IKWA 3RRGA 3AO3A 3RB6A 4F3OA 4LD0A 1SKSA 1RT4B 4MK7A 3QESA 3F9KA 4JUZA 3K5MA 5DMRA 1JLAA 2XCAA 1KFSA 4IRCA 4BE0A 4NYFA 1VRTA 3OLBA 4MIAA 1RDRA 2IJNA 3GIJA 3ZSOA 4O5BA 4FM0A 2QKBA 3ITHA 3OL6A 2KZZA 3ULDA 3L3VA 4KV8B 2FBYA 4KHRA 4DTXA 4AHVA 3IGNA 4KKOB 3OHBA 3UDLA 2W9BA 2B5JB 3KMQA 1JLEA 4NLTA 2BDPA 1Q9XA 1C1BA 3KK2B 3OYIA 3KK1B 4E7IA 3BGRB 4MH8A 4PWDA 3KKRA 4DTMA 1QE1B 3CVKA 4AHSA 2GBZA 3BREA 2WOMB 4Q45A 5CZ1A 2AX1A 3ISND 3O4NA 4TSXA 2ASLA 1C0MA 5C24A 4I2PB 3V81A 4IRKA 1NHUA 1VRTB 1BIUA 2WB4A 4N47A 3GIKA 4YR2A 2BE2A 2X78A 2RN2A 1D8YA 5KFCA 1C1CB 2KFZA 1WNEA 3DRPA 3DLGB 3HXMA 1SH2A 4Q43A 4ELTA 4HYKA 1C0TB 3AVIA 1NNDA 4Q8FA 3DMJA 4DSIA 3NH0A 1U09A 3RMBA 1RT7A 5D3GA 2VG5B 4CJKA 4KTQA 3OHAA 3O3FA 1D9FA 4PQUA 1VSKA 4LSLA 1NKCA 1LAVA 3QO9A 5J2NB 3AA3A 4HCCA 3DLGA 4B8AB 4DMNA 2XI2A 2JEIA 3QGGA 4QCLA 4O3OA 4PUOA 3AO4A 4RW7A 4M3UA 2FJWA 3T19A 3VQPA 3OL7A 4E7LA 4I2PA 3KK3A 1EETB 2EX3A 1ZBFA 1NKBA 4AH9A 2XY6A 4IH7A 4I2QB 2VWKA 4ZVEA 4YQWA 3V9XA 3TAFA 5DQHA 5FRMA 1LV5A 3G6XA 1JXEA 2WOMA 2QE5A 1QSSA 1VRUB 5KFRA 3KLHA 3BGRA 3VQEA 3U6FA 1WN7A 4F4YA 3RTVA 1N48A 3EYZA 2IA6A 5EWEA 3CDUA 1UWBA 4G1QA 3P5JA 4CEAA 2FBTA 1X9SA 1O1WA 1J53A 3DLEA 5F8NA 1KLMB 1YTAA 3ITHB 5CYMA 1S1VA 1QAIA 3DLHA 2JLEA 2YNGB 1EKEA 3AA2A 4CEBA 1HQEB 1JKHA 3OLAA 4EBEA 4B9MA 4CHPA 2F8TA 1R0AA 1R0AB 3BQ1A 4CFAA 3NDKA 4TYAA 4OKEA 1T8EA 2XHBA 2D7SA 3BQ0A 3KJVA 3BSAA 4DWIA 3CJ2A 1RAJA 4CJ3A 4FJKA 5KFSA 4FJ7A 1WAJA 4CCHA 2PY5A 3K5NA 3PV8A 4CJUA 4B9TA 3T5JA 4CFDA 3V1RA 4DTOA 4K8ZA 2RF2A 1IKXA 2XWYA 1S0OA 3SPYA 3E51A 3BJYA 1BCMA 1NK0A 3CDEA 4NLRA 5KG0A 3TAMB 1NJXA 1BI4A 2HHVA 4DQPA 3C6UA 1T05B 4LSNA 2O5DA 2JC1A 4DTJA 1TKXA 1L3TA 4KHYA 3A2FA 4I2QA 4BACA 4W5NA 2IJFA 1RT1A 3LALA 2WK4A 2O4GA 3AVKA 1S9EA 5HLFB 3AVGA 2JC0A 4Z0UA 1CLQA 2YNFA 4FZZA 3BSNA 3VQSA 1FKOB 5E41A 4OJRA 4TN2A 4URSA 2IC3A 4IG0B 4CECA 4LSLB 4J2EA 3M9NB 3BR9A 1W0HA 2VG5A 1BHLA 5KG2A 4URGA 3VQQA 2HHQA 1RT3A 4O44A 2ZQBA 3EZ5A 1S1TB 1SKRA 1TK5A 4B3OB 1VSDA 4QWCA 4BE2A 3RMCA 2KW4A 3PJXA 1C0TA 2WRMA 3LP2B 4DFKA 4FK4A 1KFDA 3V4IA 1JLGA 5HBMA 3LWLA 2D0CA 3SPZA 4GW6A 1HMVA 1TKXB 3JSMA 4OPJA 3PX0A 1JLQA 4RUCA 4F4WA 3HO1A 4M3RA 1I39A 4EP4A 1QE1A 3CO9A 2RDJA 3AO1A 1LW0A 4IFYB 4Y34A 5JXSA 4DSLA 1X9MA 1A5VA 1KVCA 4AHRA 3KLFA 3L2RA 2IM2A 2FC0A 1BQNA 2BGGA 2WONA 2FVCA 1DTTB 4HVJA 3NF7A 4DTRA 3PW4A 3ZT4A 3KD1E 5FDLB 1S1XA 3BQ2A 2AU0A 3MEGB 1FKOA 3EPGA 4CEFA 3HJFA 1JIHA 1S9EB 5HLFA 2HHTA 3UQSA 3NH2A 4KFBA 3MR2A 1S0NA 1NK5A 4DQIA 1K1SA 1HNVB 5CYMB 2E6MA 2PYJA 2BANB 1KRPA 2YKMA 4KB1A 3MECB 3CJ3A 4DTNA 1RTDB 3LWMA 4CHZA 1HYSB 2JEJA 4TLRA 4F3TA 4KTZA 2W8KA 2OYQA 2W9CB 4RG8A 5T14A 3LP3A 4FJ9A 4LH4A 1CXUA 2D0BA 2XGPA 4DSEA 1RT2A 4KHSA 2PYLA 1U4BA 4J2BA 4KHQA 3VQBA 2XI3A 3F73A 2WTFA 4RNMA 3GQCA 2ILYA 3HM9A 2ZE2A 4KO0A 1B92A 4M42A 3HT3A 3DRSB 2HMIA 1LW2A 3TR8A 1SUQB 4B9UA 3TAMA 5KFEA 3OYLA 3RAXA 1XWLA 3K58A 3I5BA 3SV3A 5J1EB 4CF9A 4FW2A 3MF5A 3NF8A 1ZBUA 1S1VB 3SI6A 2EC0A 3MEGA 2P5OA 3G86A 1RBSA 3SUPA 2HVHA 2KFNA 4W5TA 3DYAA 1S1UB 2XRIA 4CESA 2UVVA 3KJVB 1BGXT 3L2UA 3ZSQA 3HK2A 4E19A 4DFMA 3RWUA 4LY7A 4RNFA 4CF2A 3L8BA 2ZD1A 4AILC 5F9LA 4IOBA 4NYZA 2IAJA 2YNIA 4G3IA 4KFBB 2DPIA 3SQ2A 3KHGA 5KFKA 1JLQB 4ED2A 4WXWA 4AHUA 3OYHA 2BQRA 2YHAA 4CGJA 3H5YA 4H4OA 4OGCA 1MMLA 1RDBA 3RR8A 1S1XB 1XHXA 4RU9A 4KAIA 4O55A 3JYTA 4ZP8A 1T7PA 1NK6A 5C42B 3LPUA 3RBDA 1RBTA 4Z4EA 3HKWA 1RT2B 1U47A 2C22A 4J9NA 4NLPA 2QXFA 4U7CA 5HRPA 2B6AA 2XCPA 1A5XA 4ZHRA 5T7BA 4CJFA 4CEEA 4JS4A 3V6KA 4J9OA 3TABA 2XO7A 3TAPA 1LWEB 4RNHA 3K5LA 3ALYA 3QEXA 1NK9A 4K50A 4CJQA 2GIQA 4EZ6A 4FLUA 3PW5A 4RW7B 4F50A 1JLAB 3NFAA 1RILA 1LAWA 2O4IA 5CY4A 1IH7A 1TVRA 2GIRA 2D41A 4CEZA 4KHUA 2WHOA 3S9HA 3LP2A 4QW9A 3RB3A 4ZPCA 4WYLA 5D3GB 5CYQA 3M8PA 1FK9B 5SZTA 4KAZA 3M8SA 1WAFA 2IBKA 2HVIA 3NKYA 4FLWA 2YNFB 4FJHA 3C94A 1C1CA 1N6QA 2R2UA 3P83D 5CZ2A 3TI0A 3JYTB 1A5WA 3OYCA 4ZP6A 1Z25A 4KV8A 2BE2B 1EXQA 2G8KA 3SFGA 4QPXA 1NHVA 4HHTA 4NCGB 3FQKA 4F4KA 1TAQA 1S0MA 2GC8A 2V0NA 4CF1A 1RTHA 3D0PA 4LSNB 2F8EX 1BCOA 4CEOA 3ZT3A 3PX4A 2IDOA 4YP3A 2E4LA 3AVBA 5C25A 4CE9A 1T03A 1RT4A 5DLGA 1SKWA 4BE1A 5JS1A 4O0JA 3DYAB 1D0EA 1ZBHA 1QHTA 2GUIA 3GV8B 2D5RA 5DQGA 4O44B 1W25A 2B43A 5HRSA 3KHRA 4QOZB 4YFUA 1KLNA 3LP0A 4DSFA 1LWFB 1YT3A 1KCFA 2IOCA 4DL2A 5HROB 4K4XA 3SUOA 3FRZA 3T5HA 4M45A 2W9AA 2OZMA 1T03B 2XC9A 1QSLA 4CGHA 1TP7A 2FVSA 1REVA 4IBNA 1RYSA 3PO4A 4IG3A 4LQ9A 4Q44A 4E7KA 4IRDA 5EWFA 3N6NA 4ZVGA 2X74A 3QGHA 5F9NA 1RDDA 5SWMA 3O4QA 3VQ8A 2ILZA 3QZ8A 4RUAA 3LP1A 4H54A 3QIDA 4OGEA 3THVA 1TK8A 1L3UA 1REVB 4YR3A 2RKIB 4MKBA 2DTUA 4MKAA 1UWBB 4G1QB 4FCYA 3NMAA 4RZRA 2C2DA 3MTKA 2ALZA 5F8IA 5KT4A 1G15A 1U49A 2YKMB 3RR7A 3C95A 3QEWA 1ZETA 3EPIA 4C8MA 3OYDA 1HNVA 4ECVA 2UUWA 4EO8A 3CQ8A 2HAIA 3BSCA 3IN5A 4DF4A 1EETA 4U6PA 4K4TA 1ZTWA 3GIIA 3ZSZA 4ED8A 3OYEA 4CFBA 4E7JA 1WNSA 3C6TA 4FJLA 3DLBA 1XC9A 3HVWA 2IS3A 4NYNA 4DEZA 3VA0A 4DTUA 3QNOA 3GYNA 4ZTFA 3V6DB 4DG1B 1HQEA 2DY4A 4DQQA 4K4YA 2C28A 1C0UB 1LWFA 4NCGA 4BWJA 3D5MA 3VQDA 1BQNB 3WNEA 3K57A 5F8GA 3MFIA 3SYZA 4ZP9A 2FVRA 3PW2A 3MXMA 1KLMA 1I3AA 1XI1A 3QIPA 1ZBLA 1Y97A 1LW0B 3SJJA 4FJNA 4NLVA 4WFXA 2CJQA 4KI4A 3OY9A 4KKOA 3SNNA 4OLBA 3UPFA 4B9NA 1D5AA 4BDYA 4X2BA 4CJ5A 4M95A 1UA1A 4FJMA 1TL3B 4FJ5A 4H8KA 1S9GA 3EY1A 2OPRB 1QAJA 5KFPA 4MK9A 4DL3A 1JL2A 4Z4GA 1BIZA 4J2DA 4NLWA 3I0SA 1S1TA 1S1WA 1J9AA 1HPZA 4ZPAA 4RW4B 4TQSA 4KB7A 3PO5A 3KMSA 4EEYA 1NOYA 2VG6A 3KHLA 3SFUA 4BDPA 3M8RA 1FK9A 4QWBA 4FLXA 4WFZA 3PZPA 3NH1A 5I3UA 1X1PA 5CYQB 2VG7B 1S10A 1UOCA 4IKAA 4NRTA 1WSHA 1JXLA 2ATLA 2I5JA 1U45A 1S6QB 3H2LA 1RT1B 4R8UB 3O3GA 2IM3A 3S3MA 4CHOA 2AWZA 3H40A 5I42A 3NBPB 2LSNA 3PX6A 1T05A 1VK0A 4DQSA 1CXQA 3KHHA 3DOLB 3D28A 3SUNA 3DOKA 4Y2CA 2B6AB 3MEDA 4ED3A 3VQ7A 4J9RA 5HP1B 3OS1A 2FJVA 4YNQA 3KK1A 2BQ3A 4MK8A 1JXBA 4DU1A 4E3SA 4DSJA 2W9CA 5HROA 3T5KA 4JV1A 4J9LA 4I7FB 4FK2A 1RTIA 4ECSA 2FLLA 4XO0A 4E89A 5KFNA 3GILA 3TAGA 1EP4A 3DI6B 5FRNA 2ASJA 4Y1CA 1RT6B 3NE6A 5KFGA 3MEEA 2F8SA 3DM2B 4IH6A 3Q8RB 1Q8IA 1X9WA 2R8HA 3LZIA 5KG1A 3OS0A 1Z4UA 2KTQA 4HKQA 2V4RA 5F8HA 1J54A 1VSFA 2DFHA 4OLAA 1RBRA 3IGVA 1OS5A 4JS5A 4KHNA 4ECQA 1NK4A 2J6UA 3G6YA 2R2SA 2Y1JA 2X6NA 3TWHA 1FXXA 2AGPA 2FBXA 4MFBB 2BRLA 3AA5X 4Z4FA 2UVRA 1TKZA 4KI6A 3RB0A 2P51A 5DG8A 4YMEA 3NGZA 4DF8A 2YV0X 3SI8A 3CFOA 1CSJA 4BDZA 3PVXA 1KVAA 3RBEA 3T3FA 4CJEA 3VQ5A 1IM4A 4JRPA 4OL8A 3CIZA 3H5XA 2OA8A 3QO9B 5J2NA 4DFPA 4FS1A 4O3RA 4TXSA 2R8JA 3K2PA 1SV5B 1HYVA 1EX4A 5KFZA 4RNOA 1LWEA 4ECZA 5DQIA 1RA6A 3I5AA 3HPGA 2R8GA 2A1SA 4UQGA 4MIBA 4FBUA 3AVCA 1Z26A 3MECA 3QETA 4ECUA 3HP9A 4RW4A 5KFLA 3QIOA 5KT3A 1NJZA 4KREA 1W9HA 4OVLA 1DTQB 3OL8A 5L1IA 3SCXA 1HARA 4E1MA 3WNHA 4L8RB 1HYZA 3KLIA 4CJ4A 4ZTJA 2VA3A 1QUVA 2RPIA 5C42A 4WZQA 5C24B 4XPCA 3PUFA 3AA4A 1MU2B 4C8KA 1DLOB 1NOZA 5KFAA 1IKVA 3NL0A 1IKVB 3LANA 1TL1B 5EU7A 3CM6A 1QQCA 4NLSA 5KFBA 1NJYA 5HRRA 2RF2B 1SL2A 3KLIB 2FLPA 3MXJA 4N76A 4MFBA 2ZD1B 1JLBA 4EYHB 4B3OA 3DM2A 1D9DA 3MEEB 3OJSA 1HJRA 2GV9A 2Z1HA 3KLVA 1EP4B 4CFCA 3V9ZA 4DL4A 5K14A 3CJ5A 2ITGA 3RRHA 4ED7A 1S4FA 3V6DA 3LDSA 1JLCB 4ID1A 3GIMA 4Y2AA 4ECTA 5KFDA 4NLQA 3NCIA 2JEGA 3KNAA 4FJXA 1JKHB 1S5JA 3V4IB 3NGDA 3V1QA 3T5LA 4QWAA 4CJTA 5L1JA 4KSEB 2KQ2A 1JLFB 3HL8A 5KFWA 4E0DA 1LW2B 4O3NA 3I0RA 3NAEA 2HMIB 4LH5A 3IRXB 3NBPA 5L9XA 5EDWA 3CJ4A 1JX4A 1K1QA 3QEVA 1TKTB 2IGIA 5FROA 2ZE2B 1RTJA 4YR0A 3IS9A 1RTIB 4GVMA 1YTUA 3I5CA 2IC3B 4IG0A 2HHSA 2HNZB 3NGIA 1HNIB 4ELUA 1T3NA 3I8DA 5J2QA 2VG7A 3LAMA 2J6SA 4RW6B 3MEDB 1NK8A 3WNFA 3VQ9A 2VG6B 5KT2A 4CF8A 5KTQA 4Z4IA 1S9FA 3MR6A 1HYSA 5KFHA 3OSNA 2JGUA 3AVHA 3U3YA 4QAGA 2B4JA 2HNDA 2OPSB 3PW7A 2YKNA 4J2AA 3EZUA 3OL9A 1ZTTA 1HPZB 5KT7A 3U3GA 2UVWA 2XGQA 4M3YA 4URQU 4R8UA 3B6PA 3AVLA 1S6QA 1ZYQA 2R8KA 4IR9A 3QEIA 3DLRA 1Q9YA 2HNYA 3G10A 4CGIA 4FLYA 1S9GB 4KTWA 4WE1B 3LP0B 4R5PA 4NZ0A 4F4ZA 1JLCA 5FDLA 5DGBA 3FFIB 3G6VA 3V6JA 1I6JA 3OYFA 3IAYA 4FBTA 2AQ4A 1TQLA 3AVJA 4NCBA 3OYAA 1WLJA 4CJSA 2G8FA 1UA0A 3RMAA 3KLFB 1WSGA 2F96A 3IG1A 4ECXA 1GOCA 2OPPA 3V6HA 1WSFA 3FQLA 4KE5A 5F8LA 3M8QA 2OPRA 4EZ9A 4BWMA 3OSPA 4E7HA 2DFEA 3DOLA 3VQAA 3KK3B 4DG1A 4CJWA 3M8QB 1U48A 4HUFA 3JSMB 3NAIA 4PUOB 4EP5A 4FW1A 4W5QA 4CGGA 3WNGA 3VQ6A 4R0EA 4RNNA 4CF0A 1RA7A 2QKKA 4ECYA 4Q5VA 4DLGA 1VSJA 4PQUB 3LAKA 1RT3B 1GX6A 5KGWA 4OKKA 4CERA 1L3SA 4RW9A 5L1LA 2HB5A 5EWGA 2HNYB 1RYRA 2ASDA 2FVPA 4FXDA 3HVTA 4FLZA 3UR0A 4ED6A 3ASMA 4OKJA 1IO2A 2IM0A 4F8RA 2BQUA 3RB4A 3D45A 2FBVA 4DQRA 2P5GA 2HHUA 5DLFA 4TY8B 4IDKA 4ZMMA 4NLUA 4FZXC 1KHVA 3GV5B 2WCXA 3C6UB 3HP6A 4EBDA 5KG6A 2YNHA 4Z4CA 3KK2A 4B9LA 4ZP7A 4DU3A 3KLGA 2B5JA 3SUQA 4M3XA 3DRPB 3Q8SB 4ED0A 4EBCA 3QIPB 3OYBA 5F8JA 1F21A 1YVUA 4H4OB 1TKDA 4RW8A 4Y1DA 2OPQA 4WE1A 1BQMA 1BL3A 2CKWA 1C0UA 3CG7A 1KSPA 4IH5A 5KRSA 3MR3A 4DS4A 2HW3A 1BISA 4B9VA 1RDAA 3ZT0A 2HWIA 4PWDB 2UVUA 2YHBA 5F8MA 4XIUA 3L2WA 3VA3A 3H5UA 1ASUA 2W9BB 5JS2A 1BQMB 1IKWB 2OPQB 4KB0A 4IFVA 5KFYA 3KLEB 1L5UA 2UUTA 1NKEA 1HQUB 2DPJA 1HQUA 3OVNA 4B9SA 4O0IA 1RT6A 4ED1A 3ICLA 3QNNA 2HHWA 3DRRB 4Q0BB 4IFVB 1J5OB 5EUHA 5J2QB 5KFJA 1ASWA 4FJJA 4FLTA 2RKIA 3OS2A 4ZPDA 3RMDA 3LP1B 1RDCA 2HWHA 4KPYA 1D1UA 4IKFA 3H98A 4IDKB 3HHKA 3TQ1A 5KI6A 1IG9A 3KTQA 3N6LA 4GMJB 1TVRB 3OYKA 1WSEA 4CGDA 4FJIA 3Q8QB 1N56A 3UIQA 2AGOA 1SH3A 3QGIA 4K4WA 4KRFA 4QWEA 1HNIA 3KLGB 3V9UA 4CHYA 3K59A 2R7YA 3SZ2A 3S3NA 1RTJB 2V4QA 3HVAA 3QLHB 1TKTA 4I9LA 5KG7A 5I3UB 4CJLA 3LZJA 2BANA 4KBIA 2V9WA 3CFPA 3IRXA 4KHMA 4CJPA 3Q8PB 4ID5B 1S49A 4H4MB 2A1RA 4W5RA 1JLFA 2G8VA 2E9TA 1CZBA 3ZSWA 1RCHA 2D0AA 4AHTA 3TVKA 1XHZA 3BDPA 5KFTA 1ZBIA 1XR5A 4FM1A 2HHXA 4O3PA 2Z1JA 3CJ0A 3N6MA 4J9MA 5J2PA 4QW8A 4B8CA 1RTHB 2EHGA 4IR1A 5KFUA 1C1AA 2X6SA 3AV9A 3NF9A 3V81B 1XR7A 4J9KA 4K4VA 5K14B 4DL5A 4C8OA 5KT5A 3TARA 1TL3A 4DLEA 5KG3A 4ELVA 4WZMA 4NRUA 1C1BB 3NAHA 3BSOA 1TK0A 1RBUA 3PHEA 5DG7A 3CYMA 5KG5A 4DU4A 1SL1A 2YNHB 4FK0A 5KRTA 3FFIA 3ZCMA 3HPHA 2Q3SA 4K4SA 4C8LA 4ECRA 3NHGA 2E9RX 3M8PB 4TYBA 3ISNC 1SV5A 4EO6A 3G0ZA 4C8NA 1WSIA 4EYIB 2G8IA 4ECWA 1NK7A 1ASVA 2G8UA 1FKPB 4ICLB 3T1AA 5J2MB 1RNHA 4CK2A 1VSHA 1VSEA 1RBVA 3VQ4A 3OYGA 4ID5A 2D3UA 3IG1B 2Z1IA 2JEFA 3HVTB 4KO0B 4WXOA 4CHQA 4TQRA 2W7OA 1C6VA 5KG4A 4HTUA 4DL7A 3CM5A 1S6PA 4CEDA 4M3ZA 2PZSA 4W5OA 3HVRA 2R2TA 4RW6A 4CGFA 4CK1A 2D3ZA 2BR0A 5L1KA 4R5PB 1TAUA 5KFMA 1KTQA 1XR6A 4N41A 4OPKA 5DK5A 2HNZA 3P1GA 1B9FA 3K5OA 2BRKA 4FM2A 1ITGA 2XY5A 2W8LA 3ZT2A 3SQ1A 4WFYA 2I1RA 4QWDA 3E01A 3SQ0A 3VQCA 1N5YA 4MQ3A 3I0RB 3L2VA 2HNDB 2OPSA 2YKNB 3H4BA 4Q8EA 2E9ZA 1BI4B 3RAQA 4J9QA 2ATQA 3AVFA 3ZSYA 2KZMA 4O4RA 2VA2A 2J6TA 4O3QA 3HSTB 1J5OA 3LPTA 2OPPB 3NGYA 3H5SA 4DFJA 2C2EA 5DG9A 3FSIA 5KFIA 1LWCA 4JV0A 1HRHA 4M3TA 4CHNA 3H4DA 1S1UA 1SH0A 3MAQA 2WONB 3PJWA 4JV2A 3OYJA 1GX5A
chains in the Genus database with same CATH superfamily
1W2BR 2DGVA 1FVQA 1R8AA 2R8IA 3M2VB 3W1YC 3PCOB 3AB2B 4NLXA 5KFOA 2NPIA 4LF7J 4QYRA 3ENHA 2OP5A 3SXLA 3CCSS 4RW8B 1TL1A 3CERA 3KKSA 3MMVA 4FS2A 3VF4A 3DI6A 4OYAA 5CZXA 3CB4A 1JB0C 3GE1A 3RUBL 1FX2A 3DOMA 2AEFA 2W7PA 3VVUA 2J0SD 3CJRA 3J80U 2Y1IA 4NO7A 3KOAA 4IOAL 2AX0A 2C1EB 1F5AA 1FE0A 4CJRA 1WSJA 1OY8A 2WVCA 3UDEA 2YVSA 2A2CA 2M4MA 5D6GA 4CW7B 4JI1J 1N5YB 3CPWR 3PYEA 5J2PB 1RT5B 1H7WA 1TV6A 1U2RA 1RHKB 2F8HA 2FYXA 1NB7A 2QT7A 3MR5A 2RDIA 3DXSX 1K6YA 2C2RA 4GNIA 5LXYA 3CD5A 4Y2KA 1VSLA 3EKSA 3QFHA 4DSKA 4J9SA 4L3QA 2DNPA 3OHRA 3KG1A 3A8IA 1DTTA 1S99A 4JP8A 2AYEA 4FYDA 2R7XA 1PGZA 4MIWA 1WACA 2FJAB 4DV6K 2F5GA 3AFGA 4BG9A 1I94F 4QU7A 1JLBB 3OYMA 2SXLA 1H38A 4PG7A 4O4GB 2IM1A 4GC6A 5J2MA 3L3UA 4Y0WA 2NXEA 5E2QA 1YHQS 4ANCA 3AVAA 3ILLA 2E29A 3PR5B 5AQQA 1AROP 3DRYA 4IJAA 2XZDB 1JLEB 3ONQA 4YUDA 3MM8A 2XYHB 3W9HA 4JI3J 5LXRA 3QT5A 2OZSA 3SQGB 4Q0BA 3W3DA 3QPIA 3TPQA 4O23A 3TRGA 2O01C 4FZYA 1Q1KA 5F3ZA 1JJHA 4I7FA 2AJQA 2KU7A 4PG6A 4KRWA 5KFQA 4JRQA 1QS4A 1VJQA 3U7JA 2KJWA 1NGEA 3BPDA 1FFWB 2G8WA 1MN9A 2ABYA 1NJWA 2RT3A 3DN9A 4ILRA 4CLWA 3CMEN 1FWLA 4E1NA 4ZVHA 1EX8A 3QERA 2E2QA 4N56A 1NZAA 2YBVA 2V4JB 3W62A 3IWNC 2FVQA 2GX9A 3HPOA 4KHPK 2BUPA 3O9SA 1FO1A 4GC7A 1VI7A 1IKXB 4A8MP 2DHXA 2YH0A 4O3SA 2J8AA 4BGAA 2Z1GA 5F0XA 1MWZA 3KLHB 3CQXA 2CIMA 2V8HA 4RR5A 5G4DA 2R7SA 5AQMA 3RB6A 1FNXH 1SKSA 4OI6A 4AXJA 1RT4B 4MK7A 2D9PA 5AQSA 3F9KA 2ADCA 4JUZA 3WC0A 4KH5A 1V9OA 1TUUA 4ZJQA 3IMXA 2P2CB 5IT9U 4K0KF 3GBTA 1ROFA 3OBYA 4H5RA 2XMMA 1RDRA 4UQTA 2KM8C 3A5NC 1V6HA 5JVGQ 4R79A 1UWAA 4FM0A 1F2HA 3O5BA 4YB6A 1IXKA 2BZ2A 4P2MA 1PIEA 3CJCA 2CQ2A 3UDLA 2B5JB 3KMQA 4NLTA 1Q9XA 1Z6RA 3KK1B 3OYIA 4PWDA 4AYBD 1QVFR 3M32B 2WOMB 3EICA 2AX1A 1RTZA 3W63A 3UN5A 2ASLA 5C24A 3LM9A 3V81A 1VRTB 4NYOA 4YR2A 2BE2A 4RJVA 5IQ6A 3IR6B 2RN2A 3R97A 1WNEA 4BRHA 1YJ9N 1XNQK 1HI1A 1U2CA 1P8GA 5D77A 1C0TB 3RMBA 2FLOA 4JKFA 3RW6A 3OHAA 1U7LA 1M5VC 2H4YB 4PQUA 2LEBA 1QQMA 1VSKA 3GG4A 4LSLA 5A2QY 1SC1B 4DMNA 2XI2A 3G8SA 3PACA 4QCLA 3AO4A 1JK9B 1PAUB 5KPZA 3T19A 3OL7A 4LFCJ 3H46O 2A5XA 1SJ4P 1CBKA 3VZHA 4OX7A 2M88A 4GKJK 3G6XA 1JXEA 2U1AA 2QE5A 2AP1A 2BKNA 1VRUB 2J9CA 5KFRA 2DH8A 3KLHA 1WN7A 4F4YA 3RTVA 1N48A 3EGNA 2IA6A 2VWBA 5EWEA 1UWBA 4CEAA 1JCGA 2FBTA 3H3OB 1X9SA 4ER8A 1J53A 2Q0RA 3MPWA 5F8NA 2UXBF 3U9ZA 3TJ8A 3BBCA 2OELA 3FGVA 3ITHB 3OR2A 5CYMA 3NGKA 3OV7A 3TX8A 4KY3A 2CVEA 2HHHK 3DLHA 2JLEA 2EBEA 4CEBA 1B0TA 4MT1A 2H5IB 4EBEA 3RG6A 4GMKA 3EE3A 4JI7K 4K0KJ 1VGYA 3L7PA 4J90A 1FRMA 3I87A 5H9EJ 3KUEA 2RRAA 4B02A 4ZKAA 2PI5A 1NU0A 1T8EA 2D7SA 1D9AA 2O1PA 5FPNA 4X84A 4DWIA 3SCJE 4AUKA 4FJ7A 2B8PA 2MQQA 1WC0A 2PY5A 3BEXA 3PV8A 3LTOA 4CFDA 3O9TA 2DO0A 4K8ZA 1EWRA 1YIJS 3W66A 2P6TA 2CG8A 5E33A 2XWYA 4C3LA 3BJYA 1HBOB 3CDEA 4JHDA 2YWKA 2BUNA 5GINA 2HHVA 3C6UA 3QFWA 4LSNA 2NRZA 2JC1A 1RWOB 2W2NP 3A2FA 2E5GA 4NXNK 2IJFA 1QY7A 1RJJA 3ZYYX 2WFBA 1OVYA 2WBMA 5HLFB 4JI3F 3AVGA 2E1YA 1BLUA 4IOXA 2P9PB 3OUYA 1PG5B 5GAHU 2CZ9A 3AJ1A 2NCKL 3MM7A 2ZOFA 4A8SA 3IUCA 2HZAA 2J9EA 4OJRA 4X4UA 2IC3A 4IG0B 4F0KA 4CECA 4LSLB 4J2EA 2QN6B 3M9NB 3BR9A 1QHAA 1W0HA 3D2FB 1SJ3P 4URGA 3J7AP 3M30A 1M90T 1RT3A 2ZQBA 3T7ZA 2FDNA 1SKRA 1VSDA 1QQOA 2NLXA 1C0TA 4AM7A 3LP2B 4CO4A 4CZEA 4FK4A 1KFDA 2YWWA 2PN6A 2CVIA 1JLGA 5HBMA 1KQSM 4DR6K 2D0PA 2D0CA 3W3SA 2CADA 3R2CJ 2PEHA 1RABB 4GW6A 3JSMA 4ILGB 5KOXA 3TUZC 3UVJB 1WELA 1HWUA 3POTA 4OMFG 3JTNA 3MN6A 2W6KA 3HO1A 4F4WA 4LF9J 3E3XA 1QE1A 2RDJA 4ISFA 3D6MB 2UP1A 1N32F 1Z2LA 2UXDF 1N52B 4AHRA 3L2RA 2RUSA 1BQNA 3X3UA 2OFHX 1JNRB 4NLBA 2ZM6F 3P3DA 4I1TA 4J91A 1FKOA 4BR4A 1WKJA 5L39A 3CT9A 3HJFA 1JIHA 2HHTA 1T9TA 3UQSA 3NH2A 3E9LA 4RUBA 1UVIA 5GAEU 1FRKA 5A8KB 3IAS9 5E3RA 1K1SA 1HNVB 4OX6A 2BANB 3EXYA 3FJ2A 1KRPA 4C3KA 2RE1A 2YKMA 4DTNA 1RTDB 3RVCA 2EG2A 1PC4A 2JEJA 3P38A 2W9CB 1NO8A 5DETA 2DNHA 3D2EB 2D0BA 4DSEA 4AQYK 1IM6A 1SJ1A 1CJTA 1U4BA 3PRDA 2IRXA 3I56N 3QB0A 3F73A 2XG8A 4HR2A 2E1ZA 3ATUA 3IFEA 2DTJA 4KH6A 4G9ZA 3HM9A 2KLAA 4KO0A 4Z2XA 4DV0K 1J27A 1LW2A 2ZC3A 4B9UA 5KFEA 3BYRA 1UFLA 4AQYJ 3RAXA 2B0GA 1XWLA 3K58A 3I5BA 3B6BA 5LJWA 2QTDA 4DR4J 2ZH3A 1VDHA 3MF5A 3LGMA 5HAOA 5GADI 1Q78A 1GEHA 3D2EA 3G86A 4JI1F 2KRBA 3SUPA 3Q7CA 1WF0A 3R8YA 5E3CA 4FOEA 4W5TA 3DYAA 2UVVA 2V7YA 2CQPA 1NGCA 2M52A 2XM3A 2I8EA 4E19A 4G1PA 3HSGA 2VIHA 4LY7A 1HQ2A 4MO4A 2FSKA 5F9LA 2CNOB 4NYZA 2IAJA 4CM0A 4G3IA 4S0MA 2VFSA 3SQ2A 3Q23A 5KFKA 4IEEA 3CO0P 2PE8A 5AXMA 3CC4S 3AXKA 3KYLA 3LDLA 3UN3A 3D0GE 5AFUH 2FZCB 4ETXA 3UD3P 1R8CA 3JYTA 2C42A 2A2DA 4YB5A 1S4EA 1IUJA 3RBDA 1URRA 3UD4P 4MO5A 2VQFJ 1RBOB 3UDCA 2G1HA 1N33K 2CPZA 7AT1B 1UVJA 3G8TA 3GL1A 3DHXA 5T7BA 1G7CB 4CJFA 1P1TA 4CEEA 2JVOA 3TABA 1KVJA 5ETOA 2G2OA 4P10A 1LCUA 1LWEB 3DKDA 3JAMO 3EZOA 3K5LA 1NUEA 4K50A 2VBXA 4EZ6A 4FLUA 2XHWA 1EKSA 2RIJA 1LOUA 3NFAA 3ZEUA 1LAWA 4L6V3 2D69A 1IH7A 1YJNN 2FY8A 2GIRA 4KHUA 2WHOA 3E66A 3IM9A 1U24A 3RB3A 3UKUB 2A6MA 2VASA 5SZTA 3GR0A 3CJSA 4PAAA 5HN0A 3M8SA 3EXCX 5IT9Y 2CPHA 2KYXA 2QL5B 3O8WA 5AQLA 3NKYA 1KBRA 3CJ9A 1NPRA 2CJYB 3QQCD 1LNQA 1C1CA 2R2UA 1Y64A 2BE2B 1EXQA 2C3OA 1JXVA 2G8KA 4QPXA 1HBMA 5D8HB 1GQEA 3GONA 4DPWA 3UE2A 1K9MT 2IRUA 4FWKA 1N5VA 1N88A 2PSZA 1CJKB 2V0NA 1RTHA 2FJDB 4LSNB 1BCOA 3ZT3A 2ZM6K 5BPNA 5GMKa 3AVBA 3HFZB 4WTOB 3PYDA 3IXQA 5DLGA 4JI0J 5GAGI 3SCKE 2W2MP 2CYYA 1ZBHA 1QHTA 1ESVA 2GUIA 3GV8B 3BZCA 4BREA 4P7TA 4O44B 2B43A 5HRSA 3W5YA 2E66A 3LP0A 4BQZA 1IBMK 1LWFB 2IDLA 4H0TB 2IOCA 3MM6A 2ZGZA 1QSLA 2KXHA 4CH0S 1TP7A 2FVSA 1RYSA 4EHTA 1PJ5A 3OFFA 5E5NA 4LQ9A 3H0PA 4E7KA 4LSZB 2XMTA 3J8AA 3CMAN 1IBLK 2X74A 5JMVA 1RK8A 4OIXA 3VQ8A 2QRRA 4IO1A 4RUAA 5M1FA 4OGEA 4JI5F 2RJZA 3NOGA 1L3UA 1REVB 1HW8A 2AJ0A 2QL7B 1TUYA 4MKAA 1UWBB 3NMAA 2C2DA 1W7WA 1XTZA 3PDNA 4JV5F 4AL5A 5ADXH 1KAXA 3C95A 2ITMA 1BUPA 4C8MA 2YX1A 3OYDA 5E7OB 3CQ8A 4EO8A 1S79A 3SMZA 2ZH9A 1XMQJ 4U6PA 4JKEA 4HL9A 1FERA 2VZ9A 1H2TZ 3PKYA 2DR9A 4E7JA 2F7VA 5DRKA 3MHYA 1Y4ZB 2HBLA 3QNOA 4ZTFA 3H2UB 3V6DB 2IDEA 3HCXA 4A8KA 4DG1B 4H4KA 1LWFA 3WX4A 5KQDA 3VQDA 3WNEA 3OFHA 5F8GA 3PW2A 4JI3K 1XI1A 3QIPA 1ZBLA 3AT1B 2KT5A 1HBNB 4NLVA 2E7VA 4WFXA 4HTLA 2JJ4D 1UZDA 4EHUA 4OLBA 2BXJA 4B9NA 4CVNE 5AE2A 4CJ5A 4K2JA 4M95A 5T7LB 3PXGa 5BPMA 3SAHA 1CJKA 4H8KA 1WG4A 1S9GA 1RSCA 1WKKA 1NMDA 2OPRB 5KFPA 1RU2A 4DL3A 4A59A 1JL2A 5AQGA 1VQ7N 3I0SA 1S1WA 3AARA 2KXFA 4C8YA 5AT1B 5FPEA 2XSFA 3UCZP 4EEYA 3MAHA 1V3RA 2W1BA 5B08A 4IO8A 4FLXA 2WBRA 3T9ZA 3R7NB 1S10A 2AV5A 5AQYA 1F5CA 1JXLA 2ATLA 2XMWA 4KQZA 3U4LA 2EG1A 2I5JA 1S6QB 2AYMA 4R8UB 1NGFA 2CWKA 4K7QA 2VBZA 1R43A 4Y2MA 4RWTA 1CG2A 1VS3A 4DZ6A 1RWMB 1NDCA 1M5OC 2LSNA 4DQSA 1CXQA 2K06A 2FY1A 4M5IA 5IV4A 4ES1A 2JSXA 4UF4A 5C15A 2B6AB 1WC4A 1Y3JA 4LFBJ 5M1QA 4HWIA 1VQLN 1N5SA 3WEEB 1MROB 2BW2A 3L95X 4J9RA 1YJWN 2RB7A 2FJVA 3KK1A 4BC9A 2ZHOA 2BQ3A 5CQGA 4E3SA 2M70A 3D67A 4DSJA 2W7AA 3T5KA 1N34K 4OZ0A 4E89A 5B0CA 1RGVA 2XYPB 1EP4A 2ASJA 2DR6A 2XLKA 3IFRA 5A8KA 2MYFA 3IRWP 1X9WA 4X66K 2EFGA 2ZVIA 2AT1B 4FWRA 2HBKA 2F9TA 1TUGB 2JLGA 3BO4A 3ILOA 3R1XA 4OLAA 2K7JA 3LDPA 2QMWA 1OS5A 5HQMA 2L9NA 1U6FA 1XC3A 3F5TA 4ECQA 1NK4A 2J6UA 1J2VA 2AGPA 4X4PA 2FBXA 4Z4FA 1PO6A 1UVMA 4ZJOA 3RB0A 2P9GA 1R89A 1RACB 3FMBA 4HACA 4QZVB 3QRPA 3TSPA 3PM9A 2Z2YB 1SIZA 3G25A 4DF8A 2YV0X 1XNRF 3CFOA 1UVKA 2H3EB 4M8LA 3UKUA 4BDZA 2Y1RI 1PILA 2W6LA 5A2QO 4OX9K 3H5XA 4JK8A 4WFAL 4DFPA 4QR0A 1LK7A 2AHOB 4B3SJ 1AW0A 2V34A 1WUAA 4NA3A 2ZWOA 2O8DB 3JQJA 1UKUA 3LPYA 4JKHA 5IS2A 3QETA 1OYDA 5JJBA 3D0HE 2QA4G 3AD9C 1NJZA 1BY9A 4OVLA 1IBMJ 1UEVA 3KLIA 4ZTJA 2VA3A 2H48B 3J7YI 1X5TA 1A9NB 2FC8A 2E20A 1NNEA 1NOZA 2B4VA 5T7LA 1FD8A 2QLWA 4RU2A 2ASYA 3QJPA 3I55S 2EWSA 5LMUF 3CCWA 2RHSB 4C0BA 4RBVA 3P6YC 3MXJA 4N76A 4ILJA 4K43A 2DNOA 1KQKA 1PBAA 3Q8YA 4AFFA 2MZRA 1R27B 2DNZA 3O44A 3V9ZA 4DL4A 1OJ4A 5K14A 2ITGA 2MY7A 3RRHA 4ED7A 5AFUA 3GWCA 4J8FA 3UE5A 3TNVA 5BR8F 2HBMA 3NCIA 1TFYA 2G0JA 3ZZ0A 1QUPA 1O0PA 3VF2A 2ROGA 5G0RA 5BRDA 3TZZA 1H98A 5IZHA 1LW2B 1I94K 3IRXB 3CD6N 3CJ4A 1K1QA 3SLCA 5FROA 2ZE2B 1RTJA 3IS9A 1RTIB 1FJGJ 4FPBA 5BREA 3HHLC 3I5CA 2HHSA 3CSKA 4V1Ak 3NGIA 1EAYC 4ELUA 1XBWA 2OTLN 2KKZA 2DRAA 3VQ9A 4BR5A 4WFBL 3MMCB 4CF8A 3C19A 2Z2LA 3MR6A 4OI0A 3AVHA 2B4JA 2YKNA 4J2AA 1ZTTA 1HPZB 1X0PA 3T1YK 1ATRA 2GVZB 4URQU 4R8UA 3QWPA 3NNCA 2L08A 4JI6F 2VQFF 1S6QA 4IR9A 2OKQA 2ZZTA 5GIOA 4CGIA 1WF2A 3LP0B 4G65A 5GADU 3E9PA 4NZ0A 4F4ZA 4UW2A 3GCXP 2DO4A 2CQ3A 5DGBA 3S7RA 3VENA 3FFIB 2HG4A 3G6VA 4AT1B 3V6JA 3NNHA 1WHVA 2AQ4A 3AVJA 3PSFA 4U8YA 2I7PA 1WLJA 4KGKA 1WSGA 3A8KA 2F96A 2NRXA 1GOCA 3IG1A 2HK2A 1T9VA 1B99A 1S7IA 2V2KA 2NR0A 1VBYA 2P9IB 2IVOA 2P9CA 4KE5A 3H25A 1GAOA 2OPRA 1OKJA 2BKOA 3J7Z5 2DFEA 4K5RA 3DOLA 3PYGA 5C7PA 3JSMB 2LDIA 4WYBA 4CO1A 4W5QA 2K1RA 4CGGA 4ZLNA 3KK7A 3DGPB 5M2RA 1RA7A 3WZ0A 4Q5VA 4ECYA 3EKUA 1VSJA 4CERA 1L3SA 3EO3A 3JAMY 1H2VZ 4MYTA 4ZITA 2HGMA 1M5HA 2PMWA 2ZJPQ 3BGOP 4KH4A 3QBWA 4FXDA 2F9DA 3HVTA 4FLZA 2FUG9 1RZMA 1WOSA 4OKJA 2JNJA 5AQIA 3A1YG 2P9PA 4DR3J 5GAGU 2DGUA 4FWMA 2QL9B 4TY8B 1NG9A 1GNKA 3GV5B 3VESA 4JI5K 4BC4A 4LF5J 3W5ZA 3C6UB 3HP6A 1UAWA 4DV7K 2YNHA 3W8PA 4B9LA 3D6TB 4DU3A 3ZTOA 4M3XA 2HHHJ 1YK9A 4EBCA 3QIPB 2ZBIA 1JWWA 1F21A 3GLJA 4Y1DA 2ZEJA 1FFGB 1KTVA 4WE1A 3QBCA 3J7AN 1VC6A 2FHKA 1KSPA 1YUWA 3MR3A 5E3QA 1FXLA 2HWIA 4PWDB 2UVUA 1X7VA 3L2WA 1WDDA 1DT9A 2R7RA 2Z8QA 3HD2A 1XN9A 4DPUA 4EU0A 2NXCA 3L6QA 1ASUA 2W9BB 2LU1A 1IKWB 2OPQB 3KLEB 4TLQA 1S0VA 1HQUA 4B9SA 3OVNA 4O0IA 1RT6A 3O5TB 1FRHA 2YHXA 3DRRB 4IFVB 5J2QB 3RU0A 1WHYA 3DDIA 4LBPA 2ZGYA 5C2CA 2RKIA 2B4PA 5HVFA 3HMJG 3HSJA 4ZPDA 1LKZA 3BZKA 3RMDA 2LU2A 3RZAA 2HWHA 4XK8C 3VAGA 4I0WA 1YDLA 2AJ4A 1D1UA 4IDKB 2I9SA 3HHKA 3J80Y 1IG9A 4Z7YA 3OYKA 4YEAA 1KS2A 4DX8H 1IWAA 4FDFA 3Q8QB 4F25A 1SH3A 2C3MA 4QWEA 1K8KB 2FF6A 3KLGB 4L73A 1U1KA 2GJFA 1KAZA 1YJVA 3K59A 1RTJB 3QLHB 1IV0A 4KGZB 4GV9A 3LZJA 2BANA 1Y10A 3RJMB 3R1HA 2JFKA 3IRXA 3A8YA 4ID5B 1YZ6A 4WWSA 4C23A 4W5RA 2G8VA 4OZ1A 4AHTA 1EIYB 2QWQA 5KFTA 3N0VA 4Y6IA 1ZBIA 4IZ9A 1XR5A 4BVOA 1KC8T 2E1RA 4LRBA 5J2PA 4B8CA 2EHGA 3W64A 4BG8A 5IV3A 4UOGA 2LCWA 5K14B 4C8OA 5KG3A 5IWAJ 2CQGA 4ELVA 4OV6A 3WT0A 3ZZPA 2KHDA 1YBTA 2CQCA 1F3FA 3PHEA 4B3TK 2V8DA 3CGIA 2VC0A 3POTB 2L3MA 1SL1A 2YNHB 5KRTA 3ZCMA 2CA9A 3SBGA 3ISNC 2W4DA 3G0ZA 2NUHA 1WSIA 2G8IA 1VQNN 1NK7A 1HNWK 2G8UA 4ZCIA 5J2MB 1RNHA 4CK2A 3A5LC 2V2ZA 1VSEA 1RBVA 1YJTA 3G4SS 3OYGA 4ID5A 1NDKA 3P5TL 4JI0K 5ADXA 1V4SA 2JEFA 1HKCA 3WXJA 2IVYA 3D2FA 3F0NA 4ALZA 1C6VA 2E44A 5KG4A 1K47A 2CQBA 4FL9A 5BRFA 3DCAA 4W5OA 3AQPA 3HVRA 2CDRB 2D3ZA 5L1KA 4R5PB 5KFMA 3ZNJ1 4CO5A 5EN1A 5FJ4A 3WEEA 1XR6A 1BO5O 3IC1A 3P8BB 3QJLA 4JD2A 1WC5A 2VBWA 3P1GA 1B9FA 3O1BA 3DGPA 3FBFA 4HI2A 3PRVA 4FM2A 4ILMA 3R5JB 5J1PA 3Q0AA 4RUHA 2XY5A 1VC0A 2VDIA 4RWXA 2UU9K 3OQ2A 3ZT2A 3SQ1A 4OZ5A 5HL7Q 3FRYA 3VQCA 1N5YA 4MQ3A 2E9ZA 4Q8EA 2H54B 4J9QA 5D78A 1K0TA 3JS6A 2AJ2A 2BJ9A 5IWAK 4UOCA 5H9FK 3VAKA 4C6AA 4MAKA 1NAQA 3KJFB 4PWWA 2Q6CA 3MAAB 5F0WA 3LPTA 3H5SA 5DG9A 3OTDA 3FSIA 1O5JA 1LWCA 4DU7A 3C3LA 3H4DA 4PCQA 1SH0A 3EGZA 3PJWA 3CJKB 1GX5A 2Z2MA 3VWSA 3BEGB 2YWHA 1MWKA 3Q83A 2XO6A 1B64A 5HP1A 1XMBA 2VFUA 2KN4A 5ITHA 1HD0A 5GAHP 3DDKA 3D68A 4DS5A 4A4JA 3O2IA 4M3WA 5J1EA 4HCBA 4DTPA 3NF6A 1N4LA 3OD2A 3MN5A 2Z56B 1OQ6A 4FJ8A 1VFJA 4PA1A 1IKYA 2AJ1A 2A1BA 3MCMA 1VSMA 4C9DA 1DLOA 3J7ZT 2N7CA 2B56A 3VGVA 3CDWA 5KGXA 4XPEA 5IWAF 3GFYA 4O4GA 3O8MA 3TSUA 2RU3A 4CK3A 3S3OA 2KL8A 2NPFA 4LBIA 4M5JA 3P4IA 1N6QB 4QYZJ 2QK9A 2GFFA 5AQJA 2IMOA 2DR7A 3ZZTA 4N5SA 1FJEB 3MCSA 4TY8A 1NLVA 5U47A 2W41A 1RTDA 2CUYA 5KT6A 3T69A 2MQLA 4QYZK 1GLFO 2P9KB 2J7KA 4DV1J 2Y8YA 2ETJA 3CFRA 1F0XA 3FK4A 4OYIA 1WEYA 3TU5A 2BV3A 1IJJA 1Q5YA 4LFCF 2AYBA 4DR4K 1RT7B 1RT5A 3BP8A 2FJXA 5ETKA 3ZT1A 4CJVA 1KQGB 5AQOA 1Q86T 2ZNZA 2KXNB 3QYYA 3P49B 1EB0A 1VQLS 4CZKA 1QZ6A 3M9MB 3VEXA 3S41A 2PAVA 1SVDA 4ZVFA 3I0SB 1HNXJ 4BRPA 3MXIA 1HFEL 2PA3A 4NLYA 1HBUA 3A4TA 2P1JA 1FKPA 4ICLA 3DLJA 5DM6L 3AH6A 4F3QA 4HUGA 2EFNA 1ZA2B 3EJMA 3IWXA 3RW7A 4OI1A 3TAQA 2IY5B 2C2ZB 4NLGA 3ETOA 2QV6A 2ADBA 5EVZA 1DBDA 4DV2J 3B6OA 2IAJB 1HBNA 3DDNA 2OH2A 2GHPA 3DRRA 2B4UA 5JUMA 4CIGA 1GOBA 2MLZA 3NG8A 4M94A 5M2PA 5KFVA 3KLEA 2MJUA 4Y3CA 3BGFA 2EFVA 1VQOS 1RCXB 4DCHA 4PG5A 4ED5A 3K89A 3OXFA 1Q0NA 3THWB 2AZ1A 2GO8A 4RWWA 4OI2A 4M7YA 1MROA 2VFRA 1T11A 3U27A 3M8WA 4F4XA 3TAEA 4C7QA 2ZKUA 2MB0B 1T44A 3SMSA 2CQ4A 5KFFA 2QTWA 4X62F 3FGUA 2DNNA 4H4MA 5GADP 4I9QA 2KHCA 1ZC6A 5CABA 4BHQA 4B08A 2P8IA 1HBOA 3FKBA 3ZSVA 4ZPWR 3HZ6A 1TL4A 1CZ9A 5CCMA 3IDHA 2VJVA 1HNWJ 5AJ3J 3PY8A 4WYWA 2ZBPA 2ZH8A 1WJ9A 3SK3A 2NUBA 3SIPB 3NS5A 2IMWP 3DMJB 4X4NA 3CUNA 4CIEA 3AO3A 5JICA 2H5JB 1U2VA 3BYPA 1P1LA 3M3ZA 2BEFA 2KH9A 3K5MA 3OTOF 2IVPA 5DMRA 3RSEB 1KFSA 1UZHA 4IRCA 4BE0A 5AQZA 3CCVS 1C0GA 4NEYA 2ZBQA 1L3KA 2ZJQL 4MIAA 1XNQF 4DHYA 4TKTA 2HQCA 5AZJA 2DH9A 3IBFB 1KD1T 2QJ3A 3OL6A 3CCLN 4NL5A 3ULDA 3L3VA 2FBYA 5M1KA 4KHRA 4DTXA 5M1NA 1TELA 1ICEB 1X4EA 2UXDJ 5L8RC 5B0FA 1QE1B 3CVKA 4AHSA 1VQ9N 4B1XB 1NM1A 1Q86O 4N8OA 4B1YB 4LF5F 4TSXA 2UV8A 4P7VA 3BF3A 3W9IA 3G6ES 4LF4J 3HOTA 3SBMA 3GIKA 2MSTA 1D8YA 5KFCA 1C1CB 3F9MA 3A3OB 3N9UC 3DLGB 1LFWA 4Q43A 2JWKA 2VODA 4H4KC 3AVIA 2HZVA 4WCEL 4EI2A 2F3JA 1RT7A 4BQLA 1NRKA 4MKVA 3O3FA 1D9FA 1N36K 1LAVA 3QO9A 5J2NB 4BVPA 2F4FA 2FHMA 3UD5A 3DLGA 3D6HB 4B8AB 3QGGA 2JFDA 4OJHA 3BM7A 4X64F 2HFUA 4DV6J 4E7LA 3J7ZO 2XY6A 4IH7A 1YGYA 4JYAK 4ZVEA 3V9XA 3PEHA 4ZVTB 2WOMA 1X4GA 1HI8A 1QSSA 1RAIB 2FGCA 4YB1P 2E7XA 3FR0A 4WIIA 1NDPA 4NA2A 1ZZFA 1KLMB 4L72B 1YTAA 4WPAA 5HJXA 2HFVA 1S1VA 2KFYA 2H1YA 2DR5A 2CQHA 2L48A 3JSBA 3NMRA 2DGQA 1AUSL 1HHTP 4B9MA 2G0CA 3MCPA 4CHPA 5I4MA 4OQJA 1IBCB 2F9JA 2CGJA 2N4DA 3ET6B 3WBZA 3NDKA 4OKEA 2RD5C 1U2VB 4KGMA 4DUZF 3CJ2A 1RAJA 4A8QA 4FJKA 4FYYB 2ZH2A 3ZFVA 4ZLLA 5LSRA 4PHTX 3W65A 1S57A 3GCWP 4B9TA 4RX6A 4X62K 2RF2A 2D0OA 3K2YA 2O8CA 2OSQA 3SSRA 2B3TB 1IKXA 3KDOA 3SMPA 1S0OA 3E51A 1BCMA 4AD6A 4ZPTR 2DNRA 4M7XA 4KBOA 2QWMA 2QFIA 4DQPA 3T1HK 5AZIB 2CZ4A 2O5DA 1U6ZA 2QMXA 1TKXA 2IIHA 2I38A 2W4PA 3MGJA 1RBLA 2WK4A 3VAJA 3OFGA 1VQPN 3AVKA 1NDLA 5D4PA 3WXMB 1ZA1B 3THWA 3BSNA 3VQSA 5HMWA 3Q7BA 3SDEB 2W01A 4YY3F 2VV5A 4A5AA 2GQCA 5F1XA 1X3MA 3C2PA 3GG0A 4X66F 1TUWA 2ZZMA 4O44A 3EZ5A 3M05A 4QIWD 4QWCA 3RMCA 2KW4A 4WJBA 3OUYB 4FWNA 4I68A 4DFKA 4JBCA 2LLZA 2HQGA 2OEJA 1VBKA 3ENWA 3LWLA 2YWEA 1TKXB 5IXUA 4CT8A 4CZJA 1TR0A 4BBYA 3QFUA 1HBMB 4EAHD 3ELHA 2LXUA 4LF9F 3MK6A 3IM8A 3SCIE 1LW0A 4Y34A 5JXSA 4OFZA 2LQ8A 2V50A 1X9MA 5KPRA 1KVCA 3CQYA 4B17A 4U9RA 2IM2A 2AYGA 2FC0A 2LMIA 5E26A 2BGGA 4BRFA 2UXBJ 5DDQC 1DQ8A 1DTTB 3CJ7A 2OEMA 1YWXA 2PT0A 4CJ7A 1N36F 4CI6A 1S1XA 5EX5A 5ETSA 3MEGB 1T0TV 3OPKA 1DGKN 1S9EB 2GO9A 1AA1B 1NK5A 2P9KA 5DO2A 4K25A 2PYJA 2MHEA 2CNNB 1TU0B 2E8AA 5GAHI 3CJ3A 1YIJN 1WDTA 1HYSB 5DM7L 4TLRA 2W8KA 2ASPA 2OYQA 5T14A 4IJNA 2XGPA 3WDOA 4YDDB 3GQCA 5AQXA 2PI4A 2VBYA 2ZE2A 3LGHA 1S6OA 1MLAA 3CCEN 2P6SA 3CDBA 4P2XA 2YHYA 1NLKL 3SV3A 5J1EB 2YKAA 1RDUA 4DV2K 2WW4A 3P96A 3SI6A 2EC0A 2HSEB 3LGNA 1FRXA 4WFBQ 3MEGA 2P5OA 3CMES 2HVHA 4X66J 1YRXA 1S1UB 2WVFA 2XRIA 4CESA 2XULA 4BRCA 4BROA 3L2UA 3ZSQA 2HQDA 3HK2A 4DFMA 4CF2A 1BD6A 2NS1B 3AOCA 4PRFA 4UOFA 4X64J 4KFBB 2GQ2A 5KAKA 3KHGA 2DIVA 1RKIA 4ED2A 3DLLL 3S01A 4AHUA 3OYHA 4PXBA 3G2XA 2HFOA 3H5YA 5ETPA 4H4OA 4LT6A 1FVSA 1MMLA 4H0YB 3IP0A 4RU9A 5M1OA 4O55A 2K3KA 1NK6A 4NASA 4Z4EA 1CQMA 3L7UA 4NLPA 3PFOA 7FD1A 1B4SA 4DU8A 4ZHRA 5AXKA 4JS4A 1YF5L 3V6KA 3LDNA 3BH7B 1CULA 2VGMA 1Q95G 2XO7A 3J81O 2DCLA 4RNHA 1NK9A 2GIQA 4GVEA 3PW5A 4F50A 1R31A 4PQAA 2VICA 2O4IA 3KG0A 4USTA 3VGLA 3E8OA 4A8OA 3VEZA 1SQKA 1IR0A 2DITA 3R7SB 4PABA 1OWXA 5CYQA 1VK8A 2H3GX 4NMXA 2ZZNA 1WAFA 2J76E 2WSCC 3LM2A 2QLXA 4DUYK 1Q82O 3R5CA 4EUVA 1VQON 5LY3A 2YNFB 3C94A 5CZ2A 3JYTB 2C3PA 1X4FA 4ZDNA 3OYCA 4AL7A 1HA1A 4DZDA 3RBZA 3UNGC 4K41A 2AD9A 2KJVA 3CCMS 2HS3A 1TAQA 3EVMA 4CF1A 1GT8A 2OEKA 3D0PA 4U8VA 3VR1A 4LJMA 4CT9A 1V3SA 5I3QA 1T03A 5IM0B 2BABA 4Q2LA 2POKA 2GELA 1SC3B 2DEIA 4C1NK 4ANEA 5DQGA 2FHJA 2Q97A 3CC7N 3VMFB 2PC6A 2XBPA 4YFUA 2G13A 1KCFA 4K4XA 3T5HA 3FEZA 2HWTA 1R6VA 2XC9A 1K8KA 3BGUA 2GV1A 4IBNA 3PO4A 4I6MB 4Q44A 2O3DA 5EWFA 2CQDA 4XEIA 3R27A 4CBWA 3QGHA 2CGKA 4OYMA 4WU2A 1RDDA 4JYAJ 5C10A 1H72C 1MWMA 2HGNA 2R42A 3NGTA 1G2EA 1EZZB 3THVA 4PXCA 6FD1A 3PEJA 1NMEB 3JSYA 1SQFA 2RKIB 4LBHA 4MKBA 4A8XA 3VEOA 5CA5A 4G1QB 4FCYA 2COLA 1CJUA 1Y00A 3QGPA 1GLJO 4HHJA 3RR7A 3QEWA 1ZETA 3EPIA 4ERDA 2DXFA 2UUWA 2DPNA 2J9DA 1EETA 5D0EA 2DJWA 4BC7A 2WSEC 4LR8A 1WTBA 3DLBA 1N33F 3MM9A 5JVHQ 3GB0A 2L41A 1HQEA 2DY4A 3Q2SC 2HS0A 5ETLA 1A6LA 1M1KT 1WOQA 3C14B 4NE9C 3FEXB 3NCRA 3O6QA 1T3VA 1OY6A 1X5PA 2IFXA 3T41A 3KNGA 3UW1A 1LW0B 1Y97A 3SJJA 5CE3A 2A41A 1I3OB 2CJQA 4DR2J 5GAGP 3OY9A 2A18A 2KB2A 4JB8B 5JLFA 1D5AA 4BDYA 3UVJA 4FJMA 4FJ5A 4O8KA 5HANA 2XMKA 2F4VJ 3MM5A 3ZETA 3B78A 3EY1A 1B7FA 4F9OA 1TMJA 3QRRA 4FF2A 3AJDA 1DHMA 4OYBA 1X4AA 1RAAB 4Z4GA 2MQPA 1NEEA 1YQHA 1DZ5A 1EQYA 7FDRA 3TTCA 1T3OA 1YXQA 4DR5K 1HPZA 2GS8A 3CCUS 3DFEA 1ZM2A 3KMSA 1NOYA 4BDPA 1JJ4A 5H9EK 2MKJA 5I3UA 3VEYA 2VG7B 4IKAA 4Y28C 1WSHA 3HHEA 1U45A 3M6VA 2ZITA 4IOAQ 2CPXA 3CNQP 3O3GA 1DQ9A 2V7ZA 3H40A 5I42A 3F41A 1B0PA 4EK2A 3KWMA 5IT0A 3WQTA 1ZS6A 3DOLB 3D28A 3DOKA 1N0VC 2Z58B 2O8CB 2HYIB 4YNQA 1DFDA 1OSDA 3CF5Q 3EE8A 4DU1A 3KG4A 2W9CA 4DR2F 2XMVA 3JQMA 4JV1A 4I7FB 2YKOA 4ECSA 3MN7A 2PEBA 2FLLA 3CI5A 5LT5A 2FJEB 3EEQA 3DI6B 5FRNA 4PYDA 3DM2B 4HEA9 4ES2A 4Z94A 4DPYA 2VONA 3NS7B 3US5A 2R8HA 3W2WB 2NZCA 1AB8A 1ZM3A 3OS0A 4J9UE 4HKQA 5BYRA 2P9EA 3TUJC 3D66A 3LW5C 1PSDA 1VSFA 2DFHA 5AJ3K 4YDUC 3J81j 4A8FA 3H1QA 4JS5A 1RWPB 5AQHA 1NGGA 2BTFA 5EGYA 2VKZG 5K9FA 3H3NO 1VLOA 5BR9A 2X6NA 1FTRA 1FXXA 1QM9A 3B4MA 4WK3A 2UVRA 3Q86A 1HNXK 4KI6A 4FWOA 2Q79A 1YLXA 3TA1A 4JK7A 1W7AA 3NGZA 3ZTSA 4L76A 3FZHA 3V2UC 3SI8A 3U8XA 1WTFA 1QDUB 1IM4A 2UUAJ 3MDFA 4CNZA 4JK9A 3R1LA 5G0RB 3MPYA 2GHWA 1MMDA 1HR0J 1CLFA 3QO9B 5J2NA 1ZH5A 1JNZB 2XTJP 3EDQB 2R8JA 2L9DA 3K2PA 1SV5B 1GK8A 2EWHA 1ZPWX 3O3LA 2Q2RA 4WK1A 1KXPA 1LWEA 4MYUA 4U95A 1RA6A 5DJBA 1MWYA 4IO9Q 3HPGA 2R8GA 2A1SA 4FBUA 3AVCA 3U1LA 3FCHA 3MECA 2EK6A 3HP9A 5KFLA 1KNZA 1Y3KA 4FO0A 1IBKF 2YPZA 3WX8A 1MMNA 4KREA 4UOHA 3OL8A 3SCXA 4LVNP 3WNHA 2AJFE 4L8RB 2UXBK 4CJ4A 4ZN1A 4WZQA 5C24B 4XPCA 3E9OA 1YITN 2VU5A 4ZK7M 3AA4A 1DLOB 2HS4A 2XZTB 3EGWB 5KFAA 3M8YA 3NL0A 1TL1B 3ID6A 3CM6A 1QQCA 1NJYA 2HBYB 1K73O 4B3TF 3I9V9 4H0XB 3DLLQ 3C65A 4QS9A 3KLIB 2FLPA 4MFBA 5C2DA 1JLBA 2G0IA 3C16B 3DM2A 1D9DA 4KPCA 2Z1HA 3NWRA 4OHZA 3SBTA 2Q36A 3ZZUA 3QAEA 1S4FA 3FCWA 5BYQA 5A2QU 3V6DA 4X4RA 3LDSA 4DUYF 4Y2AA 1N8RO 2J9DE 1R3NA 2NSBA 4DV7F 4FJXA 4DR1F 1OH8A 1EWQA 4KR0B 2IYGA 1S5JA 1JKHB 1NGHA 3V4IB 4P73A 5ETMA 3V1QA 4DX6A 1PAEX 1J5EK 4JKAA 4CJTA 1EO1A 1JLFB 3HL8A 2MKCA 2MY8A 3NAEA 1BA1A 4LH5A 3UR3C 2ZJQQ 9ATCB 2MXYA 2GHVC 2HLUA 1WC1A 1BOTO 3FZFA 3I55N 4C98A 5BPLA 2Q31A 3MUTP 3OBIA 1YI2S 4JI7F 2DXEA 2JZ5A 4RBTA 1YTUA 4ZLPA 2KO1A 1HNIB 1T3NA 2VG7A 2H65B 4NYPA 2M9KA 1U2FA 2HBRB 2M7SA 2F7TA 4RW6B 2OTJS 3MEDB 1YVNA 1NK8A 4LF8F 2ROEA 2HLTA 5KTQA 5KT2A 2QZ8A 2RRNA 3FZ2A 2YH1A 3OSNA 2JGUA 4QAGA 1Y0HA 1WC6A 1AFJA 3E1YA 2XGQA 3WXLA 2NXUA 2HURA 4Y65A 3CJ8A 4NPOA 1IR2A 2R7WA 2Q1LA 1FESA 1ZYQA 5HQLA 5L46A 1Q9YA 1NSQA 1R0CB 4FLYA 1S9GB 3H6EA 4WE1B 4K0KK 1FT8A 3TUPA 2JOQA 2GMLA 2RQ4A 3NCQA 2RVJA 3M6GA 1X5SA 1I6JA 3IAYA 4FBTA 1IBKJ 1TQLA 4CH7A 1U25A 3MMBB 3S8SA 3RMAA 2HHHF 2K1RB 2OPPA 2A6AA 2OHDA 1P9YA 2GNKA 4OI4A 1RADB 4DR1J 5DDOC 5F8LA 4EZ9A 3VQAA 2KRRA 3NAIA 1U02A 2CH5A 3MMJA 4AL6A 3VQ6A 3R6LB 1N5QA 4R0EA 1E3MA 2W2PP 4BRIA 4CF0A 1RHJB 3VGKA 3WXIA 3I32A 2OMOA 1RT3B 4OKKA 1VLYA 3TWZA 3MZIA 1W97L 1HIYA 2HNYB 5FIIA 2ASDA 1RKJA 1QQNA 4CZMA 2UU9J 4ED6A 5L38A 3BF1A 5MAOA 1IO2A 2BQUA 5LSLA 3RB4A 3RYLA 3D45A 1SAZA 2QI2A 2P5GA 2E5IA 1DEJA 4IDKA 4V19X 1PBUA 4PWUA 4FZXC 4LRFA 2HBQB 3UCUP 2AP6A 3FFKB 1J5EJ 1FJGF 1SI9A 1VOMA 4EBDA 1JMTA 1WG1A 1VC5A 3G6EN 2LXFA 1SC6A 4USMA 3DRPB 1S72N 2ZNYA 3FVYA 4ED0A 1S12A 2OAUA 1YJRA 3CCVN 2CNLB 1YVUA 1F3VA 4NXMJ 4RW8A 5HMZA 2OPQA 3O1WA 4UUWA 1BL3A 3L4QA 4DS4A 5KRSA 1HPMA 4CDIA 1BISA 4LFBF 2KYZA 3KWGA 4JV5K 4USWA 3ZT0A 4XIUA 2VJUA 3D3CJ 3H5UA 2XSJA 2FGOA 3U1MA 5GAEI 3S1TA 3D6RA 2HMPA 1BQMB 3HJVA 3IMQJ 5KFYA 1NKEA 1UPPA 3OR2B 1BQXA 2E5LF 1FJ7A 4Q0BB 5EUHA 3M2UB 2QM1A 1VK3A 2RMLA 3MM8B 1T02A 1VQNS 2CJKA 1H1VA 4FJJA 2VPZB 5IOLA 3CHWA 3KZBA 3MOZA 3G4SN 3QT8A 2R7OA 1NJIT 1EQ0A 3H98A 3QMQA 3TQ1A 2MQMA 1KD1O 1WSEA 3FE1A 4CGDA 2XMAA 2BJEA 5EY4A 1HR0K 4LFCK 2O8FB 2K3IA 4LF9K 2YQ0A 3N01A 3EX7B 4CHYA 3T6JA 3S3NA 2AEMA 3TTFA 1TKTA 4I9LA 2LEAA 3GFZA 4KBIA 2V9WA 2R3VA 2Z4PA 2QX0A 4NXMF 4KHMA 1YJWS 1YKWA 3NCPA 1RCHA 1HLUA 1HNXF 2VOOA 5J1NA 1AZSA 3EGVA 2XEXA 2Z30B 2HHXA 2E1MC 3N6MA 2LA4A 1RTHB 4KHPJ 3V81B 3RGIA 1B0VA 3ZTQA 1XR7A 5LMNJ 2RDDA 3TARA 1TL3A 1WUUA 2CPYA 4DLEA 3EMTA 1UP1A 1NXIA 3W2VA 4C11B 5B8HA 3VF6A 4PG8A 2DISA 1TK0A 1RBUA 5DG7A 3CYMA 5KG5A 2EEYA 2FXUA 4FZVA 1GMUA 3CC2N 4OV1A 1NB2A 3FFIA 4V19J 4C8LA 4K4SA 2O8DA 4ECRA 1OIAA 2E9RX 3QJJA 1SV5A 4KJIA 2YKQA 1VQKS 3UFCX 3B8AX 3ZX3A 3JAMU 2VQEJ 1VSHA 2MEWA 4KIAA 2DRBA 2DK2A 3BN7A 1S59A 3Q89A 2E5LK 5GMEA 4U67L 3FZLA 4KO0B 4CHQA 1RWKB 3HI0A 1T6CA 4XH1A 4HTUA 3ULHA 3CM5A 4FOIA 2C3UA 2PZSA 4CK1A 5CH7B 5B09A 1GLAG 4B1VA 1KTQA 3WHIA 1KVKA 4N41A 5KPTA 5DK5A 3DXKB 2BRKA 1SJRA 2NQPA 1K0VA 2C2OB 2DRDA 2I1RA 4ANDA 2OCEA 3SQ0A 4MKYA 3I0RB 3L2VA 3AVFA 3I4HX 2Y3YA 1X0FA 2VA2A 3FEYB 1RXOB 3W61A 3NVKA 3WIUA 4IXCA 1U1MA 2C2EA 3QT7A 1HRHA 3LO3A 4M3TA 1WEZA 4JV2A 3CETA 4NXNJ 2MQOA 1MWQA 3OR1A 3FSXA 1S1WB 4JI6J 1FHTA 1FDBA 4JLHA 3V9SA 3AAQA 2XY7A 3OVBA 4BRDA 4F2RA 5FD1A 1WEXA 3D6FB 3KD5E 4U67Q 3HSCA 3DLKA 4KH1B 3K7RA 4CIFA 1YZ7A 3D1HA 4UUXA 5I42B 3OR1B 3AVNA 4DJBA 1Q53A 3TANA 2DYAA 1CZAN 4E8UA 4AHCA 3M1FA 4OI3A 3OTOK 4LR7A 4X4OA 3AVMA 1JLGB 5HBMB 3EZWA 2VQEK 4A62A 4WP9A 1KR4A 1SPBP 2QEXS 4LF7K 4ZPBA 4ID8A 2CJ9A 2MDAA 4DTSA 1QSYA 4TY9A 4EWTA 5FPDA 4HHHA 1CPZA 1HMVB 3N79A 3VHQA 2MGZA 3NEKA 5AQWA 1R7IA 2W42A 3ZZOA 4LFAK 4ZJLA 4DR5J 4PEOA 3HBTA 3EDRB 3I9ZA 5HRNA 4F2SA 2QIFA 1TV6B 3DC2A 5FLXY 4YOUA 2CWXA 3R3TA 1Y5IB 2VD3A 1S6UA 4ZVSB 1FA0A 4FJGA 2LYVA 3I96A 4RKUC 1KEKA 2R7VA 1RDWX 2ACYA 4O0NA 4LMZA 2H51B 1I94J 2J7UA 3FDSA 1V5VA 3PLAA 2VL1A 4FSVA 1SQGA 1VQ5S 1S76D 4W4MA 5TKYA 1RAFB 3V1OA 4ES3A 1RHUB 3SV4A 4J9PA 3AD8C 3LDQA 1RAHB 2HPUA 4BR7A 3G87A 1U1OA 1R59O 4IG3B 5C5JA 1MU2A 4OJ3A 1B70B 3NMUA 4BR2A 4JEPA 3AO2A 2FHOB 5IQQA 2QMUB 4GY2B 2YNIB 2O8BA 2DGOA 4AXIA 3P45B 1ZM9A 1CC7A 3KUGA 3ISZA 4NLOA 2DGSA 1S97A 3G71N 4PPDA 1XMOF 2J0QD 4FVMA 4PG4A 2HBZB 2KVQE 4CLLA 4NXNF 3WQUA 3GV7B 4TU7A 3TVYA 3ZSRA 3A5MC 1DAXA 1NWKA 4CEQA 3R5BA 3MM7B 4WQ5C 1VRUA 4K8RA 3ZX2A 2XY8A 3H08A 3C46A 2UUBK 1VQ8S 2YNGA 4QIGA 3M8ZA 3DRSA 4ED4A 1KVIA 1IQTA 4K4ZA 4QR1A 1LEOA 1U0HA 2LVWA 4F4AA 1GXTA 3CCMN 2WUSA 2I5JB 4USUA 2NRRA 2G8HA 3MM6B 4DUTA 5E84A 3L2QA 4DB3A 1TKZB 3IS9B 2UXCK 2RE2A 3N5FA 3H20A 3QINA 4LFAF 3JXUA 2NXNA 3CWJA 2V4JA 1VQ9S 2Q66A 1S6PB 4P9SA 4V19S 1IKWA 1SJFA 4OZJA 4F3OA 4LD0A 2OLWA 4WIQA 4UY8O 4FKYA 4JI4F 3QESA 2YPYA 3CC7S 3HSDA 4FF4A 4NYFA 4XH4A 1U8WA 4ZCMA 6AT1B 1VRTA 3GIJA 3ENVA 3M2UA 2AIRB 3ZO7A 4CLSA 4O5BA 1FXDA 2QKBA 3ITHA 3HHDA 3QDKA 1BA0A 3OHBA 4YHHF 2XSJB 1JLEA 5CHCB 4YORA 1C1BA 1OH6A 4FPRA 2BE7D 2R7QA 2G1DA 3SSSA 2K2PA 3KKRA 2VKRA 5EX3A 2FQQB 2XZWA 2UZAA 3BREA 3M7VA 1M5SA 1N36J 4EFHA 2Y0SD 1VQMN 4IRKA 2G4BA 1NHUA 1BIUA 2WB4A 3A8EA 4X4SA 1V3ZA 3A8JA 3D2WA 2E1CA 3DRPA 3ATVA 2NYHA 2NRVA 2Z2ZA 3OXLA 3C15A 4EMDA 4HYKA 1JJ2R 2BOAA 1NNDA 4Q8FA 3DMJA 3W9JA 3NH0A 3C14A 2XNRA 5C12A 3NWGA 5D3GA 2VG5B 4CJKA 4OYPA 2JHEA 2P9UB 2LQBA 4PKHA 1NKCA 3AA3A 4M5KA 4HCCA 5C2GA 2BOPA 1FE4A 2JEIA 1NU4A 3MXHP 3MPVA 1KONA 4M5DB 2UXDK 1GMVA 5D0RA 3ZXWA 1EETB 4BC3A 2EX3A 2W4CA 1NKBA 1ZBFA 2VWKA 1YSJA 5FRMA 1LV5A 2OSRA 3GMGA 3CCES 2P9IA 1HNWF 1FDAA 4OHVA 4IOCL 3VQEA 3AD7C 4CLKA 1GLEG 2D1CA 4OYZA 2LQ5A 3CDUA 2BACA 3P5JA 1ZPVA 1O1WA 3DLEA 4CLZA 3NGUA 4FWQA 1U1PA 3TX0A 3OT9A 1EKEA 1M5PC 3AA2A 4ILHA 1RGIA 2X3GA 2CQ0A 3R6GB 3L4IA 3OLAA 5CZVA 5CD4H 2F8TA 1R0AB 4CFAA 3ZX0A 1Y9OA 1XNQJ 2XHBA 4W98A 4LFBK 3BQ0A 3BSAA 5AXNA 3TZXA 3UI3A 3O80A 4CJ3A 5KFSA 3OTEA 5HQ8A 4DR6F 2FHJD 2M8HA 1DRZA 3QRQA 1LXNA 3CD7A 1NBEB 2PMHA 4LRCA 5H1SQ 2DHSA 1PYOB 4TNOA 4KGVB 4JI4K 3KHYA 3SPYA 4NLRA 5KG0A 3TAMB 3VGTA 3I6PA 1NJXA 4JKCA 1A0OB 4IO9L 3UWTA 2HZCA 1VCTA 4NI2A 4P2FA 1L3TA 3HLUA 3VGSA 1XMOK 4KHYA 3MMAB 1VYAA 4I2QA 1TL7A 4OYXA 2ZH4A 3LALA 3FLCO 2O4GA 2ZH5A 4ZVUB 2RH3A 4WKYA 4U7UK 1HJOA 1S9EA 2ZOMA 2JC0A 1OY9A 2D3O1 1F60B 3ZEUB 4AQYF 3UN2A 2E1AA 1FKOB 5E41A 5ETQA 4LRAA 4URSA 4Y2IA 5A0YB 3MD3A 1XIQA 1P8ZA 3H1VX 2VG5A 1KP6A 3ADAC 4C1NI 1XNRK 1TK5A 4B3OB 3AAPA 4BE2A 5GMDA 1VQKN 2Y8WA 1RE1B 3ULEA 3SPZA 5I3PA 2LEPA 4OPJA 2DNYA 3NLCA 3CCJS 2VH7A 2QWPA 3PX0A 2AMCB 3VTIA 5B0EA 2RAQA 4LIWA 2XHCA 4RUCA 4EP4A 3CO9A 3AO1A 4IFYB 2EI5A 1KQSR 4OPHA 3W5XA 3KLFA 1GFWB 4L75A 4M5NA 3M30B 5IC6B 4I56A 2F4VK 2WONA 3CCQS 4HVJA 1XMQK 3ZT4A 3KD1E 5FDLB 2AU0A 4DHVA 5LSOA 3EPGA 2X7IA 3RBXA 2EBGA 2NSCA 4GO5X 4FWSA 2IRYA 4DN0A 2FB0A 3EWGA 1O13A 3MEKA 2JLFA 1WORA 3TJAA 4KFBA 1VQ4N 1S0NA 2HRYA 3TO8A 1R6YA 2Q0UA 2VF3A 2ZH1A 5CYMB 2IPOB 1Q81T 1YJ7A 4KB1A 3MECB 1GMWA 2N82B 3JB9k 3L09A 4CHZA 3J80O 4KTZA 4LF5K 4HACB 4RG8A 2KM8B 1CXUA 2P9LA 1RT2A 4E1JA 4KHSA 5MLCQ 2CAJA 2ZFHA 1HLWA 3C7NB 2KT2A 1QAXA 2C2NA 2X1GA 2ILYA 4A46A 4QS8A 5AE1A 1B92A 1U1LA 1XQSC 3HT3A 3K8WA 3IR5B 2HMIA 4FXVA 1FD2A 1VQ6S 3OYLA 3UB5A 4A8YA 2PGCA 5ETVA 3DXKA 3IBCB 4FW2A 3VEVA 1WBBA 3NF8A 1S1VB 4LF6J 2HFNA 8AT1B 2NXJA 4F0MA 2RHKA 1M90O 2Q6BA 3KJVB 1BGXT 2EPIA 4DV5F 4YDXA 3OVSA 4K42A 4LF8K 3RWUA 4USKA 4RNFA 3L8BA 2ZD1A 2DGXA 4AILC 4IOBA 5BN9A 3WUHA 1FCAA 3C6AA 3R3LA 4WXWA 2YHAA 5AQVA 4CGJA 1BWEA 5A6WA 4OGCA 4B3MF 1RDBA 3RR8A 1S1XB 3VTHA 1XHXA 2JVRA 4KAIA 3QAUA 4ZP8A 1HKBA 1PCAA 5C42B 3LPUA 3N4WA 1GTHA 4P74A 2HBJA 1PYTA 3FNNA 4PKGA 4DMZA 3FZKA 4M1KA 4B3SF 1BG3A 2BKPA 4J9NA 3NGSA 1VQ5N 5HRPA 2FSNA 2XCPA 4KH0B 1VQ4S 4PR6A 2V67A 1RCOB 1BHNA 4CO0A 4J9OA 4DR7J 1UW4A 3TAPA 1UJ5A 4JKGB 1VQPS 3QFPA 3UCGA 4CZCA 3MCOA 4CP5A 4RW7B 3Q8UA 2CZVC 1FF2A 1XMQF 1YBUA 3HHLA 3X1LB 5CY4A 3R8EA 3GZ7A 2D41A 2AA4A 4CEZA 4QW9A 2DB1A 4ZPCA 4WYLA 4LUBA 5B7WA 3M8PA 3PYFA 2HKEA 1FK9B 4KAZA 2HVIA 4DI6A 3NOCA 1NGIA 3M2RA 5ETNA 1B7YB 2IIRA 3R6MA 2O66A 1UJ4A 3TI0A 1A5WA 2DVIA 4ZP6A 2HK3A 3SFGA 1NHVA 3KWIA 1WG5A 3I33A 5JMNA 3FQKA 4F4KA 4CZHA 2GZOA 1S0MA 2GC8A 5AJ3F 2IDOA 3PNIA 4OYWA 4YP3A 2E4LA 5C25A 2ALYB 4L74A 2EFPA 1HR0F 1SKWA 4BE1A 5JS1A 4O0JA 3DYAB 1GTEA 3B82A 3CC2S 6FDRA 4ZPVR 1D0EA 3CULA 5RUBA 4CTAA 2F1FA 2A42A 2D5RA 3QBXA 1W25A 3MURP 3THXB 3PFEA 5HROB 3VZIA 4Z7CA 4X65J 3FRZA 4M45A 2XB2D 2OZMA 4NZ7A 4JI6K 2CDQA 4CGHA 4PL7A 2RNEA 1C4AA 1REVA 1OQ3A 1MDUB 3VPZA 4NXMK 3TZYA 3N6NA 4ZOSA 4ZVGA 1E6YB 3MX2A 5F9NA 2F4VF 1BXNA 5IFMA 1R8BA 4B3MJ 5SWMA 3O4QA 3QMLA 3MMAA 2ILZA 3DJCA 3ID8A 3LP1A 4H54A 2DNLA 4RPFA 4YR3A 1SJQA 1XJWB 3LPEA 3DXMB 3SSQA 2XMJA 4ZVRB 2YX4A 3MTKA 4C8ZA 5F8IA 4YOTA 4DX5A 1G15A 4PPZA 2YKMB 4WBFA 3TUIC 5IT9O 1HNVA 2M2BA 3BB5A 2MKYA 5HL7L 3CDAA 1CJVA 4UTGA 3IN5A 4HI1A 4IEIA 4B1WB 3M1VA 1ZTWA 3GIIA 1CC8A 4ED8A 3OYEA 2BX6A 3TP2A 4FJLA 3HVWA 2IS3A 4NYNA 4HVZA 2VFVA 4DEZA 3VA0A 4OJGA 4NA1A 4WF9L 3N28A 1GLDG 3BY5A 1OSCA 1YG0A 4DQQA 2C28A 4K4YA 1HHSA 1O6XA 3EVOA 3W0LA 2VDHA 1CVJA 3AA9A 4YY3K 1BQNB 1SBRA 2U2FA 3MFIA 4ZP9A 1RLDA 2FVRA 2CH6A 3S6EA 3GG1A 1E4FT 3C15B 2LFVA 3CPEA 3P4UB 3TTDA 4KKOA 4RTFD 3CCSN 2J7WA 4X2BA 4NZ6A 1X4HA 1TL3B 1SQEA 4I64A 4PXEA 2KG1A 1B3TA 1QAJA 4BC5A 4MK9A 4USIA 3D1QA 5DM7Q 3UKRA 5HJYA 4J2DA 4Y0FA 2HQIA 2I2YA 1AZSB 1G99A 2VGNA 1WB9A 3KKFA 2PMZD 4GO7X 4ZPAA 1URNA 4TQSA 4BRNA 3PO5A 3MWBA 1HWIA 1D8ZA 2VG6A 1ELOA 2MHNA 4QR2A 3SFUA 3KHLA 3CJQA 2GCFA 3M8RA 1FK9A 2BM0A 4QWBA 3PZPA 1KOHA 1X1PA 3KJQB 2OD4A 4X65F 1VISA 4NRTA 1M0SA 4Q2MA 1WHWA 1K73T 1VR6A 1RT1B 3HHLB 2IM3A 2XYGB 4CHOA 2AWZA 3PX6A 1T05A 5D0HA