1SV5A

Crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse Transcriptase
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 131
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1sv5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1sv5A05
3MEDA 5CYMA 3VQAA 2BANB 2HMIA 1SH3A 4ZPDA 1B9DA 3CDWA 2FC0A 4DQIA 2QKBA 1FKPA 1VSLA 2R8GA 2R8JA 1NHVA 4HCBA 3H98A 5KFIA 4IRDA 1JLFA 2W9AA 1RT3B 4FZXC 3CJ5A 3OHAA 1MMLA 2FBTA 3MECA 3ZSOA 4ED0A 3HVAA 2Z1IA 1G15A 4EYHB 2W8KA 4E19A 3OYKA 4KV8B 1JX4A 4FJIA 4M3YA 4NLSA 4WXOA 5F9LA 3NAHA 5DGBA 1TKZB 4NLTA 1JLQB 3V1RA 4F4ZA 1C6VA 3ZT1A 4YR2A 4M3RA 4KSEB 1KLMB 4FLUA 4DTPA 3M8PB 4RUCA 4NCAA 2LSNA 4RW7B 4ZPCA 3SPZA 4JRQA 4U6PA 3B6OA 2Y1IA 4EZ6A 3RBEA 4NLOA 4PWDA 3DLHA 3RR7A 3FRZA 4B9NA 3MR6A 3KHGA 1DLOB 1ZBHA 3V81B 4TYBA 3ZSVA 4NLVA 4DSKA 3O3FA 4TY8A 4KFBA 1VSIA 3TR8A 4H4OA 1SL1A 2W7PA 1ZBIA 1S97A 3H5XA 4URSA 3VQ4A 1A5WA 5KG5A 3S3OA 2B6AA 3HM9A 2G8KA 4OJRA 4NCBA 5HBMB 4WE1B 4K4YA 2IM1A 3OSPA 2JEFA 4J9KA 3I0RA 3H5SA 1JIHA 3UQSA 1T03A 3C6TB 3OYIA 3UDLA 2FLNA 3CYMA 3KLIB 4Q8EA 1VSMA 5KFHA 4KV8A 3VN5A 4YQWA 4LH5A 3NDKA 2XCPA 4O55A 3KK3B 5KFLA 3S9HA 4DL2A 3SFGA 3KK1B 4NLGA 4MQ3A 1NJXA 1WNSA 1UA1A 1JXEA 4TLRA 1TL1A 3VQSA 1QS4A 5EWEA 4CJEA 4CEEA 1B9FA 1D5AA 2VG5A 3GILA 4NRTA 4I9LA 4NLQA 3SUQA 4ZMMA 3NGZA 4K50A 1NK5A 4NLWA 4M3ZA 2HAIA 3PUFA 3DI6A 2GV9A 3NE6A 2ZD1B 1Q9XA 5L1JA 2J6TA 2AX0A 3BDPA 4QPXA 3JSMB 2WCXA 3KD5E 3H2LA 3I5AA 3L8BA 5SZTA 3PW5A 3BQ0A 1C0UB 1RCHA 3DDKA 3V1OA 5HBMA 4QWBA 4IG3B 3TAFA 2BE2A 4NCGB 1KTQA 3KMQA 3FDSA 3RRGA 3AA5X 4OGCA 1JLAB 3V9XA 4RZRA 4CGHA 4DQQA 3NKYA 3ZT0A 2DY4A 2HNZA 4I2PA 1SL2A 2AX1A 4CEQA 5KG6A 1IO2A 1REVA 1S6PB 5I42B 3OJUA 1S10A 4FJ8A 3M8QA 2Z1GA 1N5YA 2DFHA 4J9NA 5T7BA 2FVCA 4OLAA 2I5JB 3SJJA 3KK1A 4OL8A 5CY4A 2WONB 4FLZA 3BQ2A 3DM2B 3KLVA 1S9FA 3QO9B 1K1QA 5F9NA 1HYSB 4MKBA 3KHLA 2XGPA 4YMEA 2IJNA 1GX5A 2O4IA 2JLEA 2ITGA 3QIPB 3V9UA 4KKOA 3RBDA 4DTJA 3FSIA 4TN2A 5DK5A 3SI8A 3HT3A 1TQLA 1S1TB 3H59A 4ZPAA 3HL8A 1JLCB 4KHWA 2FJWA 3K57A 3G6YA 3JSMA 5KFRA 4FJHA 1Q9YA 4IR9A 3I5CA 1C0UA 5KTQA 3IRXB 1VSJA 1WAJA 3TI0A 4NZ0A 1R0AA 4NCGA 2GBZA 3CWJA 2V4RA 2UUTA 1ZBFA 5DGAA 1BQNB 1RT2A 4KHQA 1HQEB 4ZPBA 4DG1B 2KZZA 1RTDB 3VQ9A 4FJKA 2IAJA 2UUWA 3CIZA 1GOCA 5J2PB 4RG8A 2WB4A 3CJ0A 1S6PA 4CHZA 3G86A 1D9FA 2FVQA 1S9EB 4KI6A 4DL7A 4FS1A 4KHYA 2B5JA 2GC8A 4DLGA 4ELVA 4ECQA 1KVCA 3MEGB 2A1SA 4B9VA 2YNFA 1XR7A 3PJWA 4BWJA 5KG3A 1N6QB 3CVKA 3SZ2A 4DU4A 1QTMA 2X78A 4Y3CA 4IQXA 1HYSA 2G8HA 2IBKA 4DL3A 3N6LA 4DS5A 3MR3A 4CK2A 4DSJA 4CJTA 3QGIA 3VA0A 3DRSB 2E6LA 2ZE2B 4OGEA 3SI6A 4Q0BB 3LP0B 5KG4A 2XI3A 3TAEA 4J2AA 1VK0A 2ILZA 3L2UA 1N56A 1JLCA 4CCHA 4I9QA 2AU0A 4JS5A 3QLHB 2ASDA 1RT4A 4EBEA 4FM0A 1MU2B 5KFSA 2EHGA 4K4UA 3OYHA 1S1WA 1TL3B 1HPZA 3AV9A 4CK3A 5KG0A 2HHWA 3DLGB 4G3IA 5HLFA 3PO5A 4DG1A 4B3OA 2R2SA 3RAQA 1RTDA 2IGIA 4ECRA 3PJXA 4ZP6A 1QHTA 4HKQA 2XGQA 2VA2A 3OHBA 4J2BA 3HXMA 4LH4A 1GX6A 5KT3A 4K8XA 4QWDA 1J5OB 3AO4A 3RMBA 3TAGA 4H8KA 2HW3A 2YHAA 2YKMB 5FDLB 3ZSWA 3DOKB 1CXQA 4ELUA 3OL6A 2V4QA 1SKWA 5CYQB 2IM0A 3P83D 5JXSA 4DQSA 3AVNA 4CGJA 4PY5A 2D3UA 3IG1A 1KRPA 4F50A 3MR2A 3DRSA 4K4WA 4R5PA 2GUIA 1TV6B 2RKIB 4N5SA 3OYAA 1IKXA 3AVKA 4Y2AA 1RDDA 3LP0A 2R8IA 1BCMA 3I0SB 4KHRA 1KFSA 2XI2A 1EETB 2X6NA 2YNHB 2IM2A 4FJMA 1IKVA 1W0HA 3OS1A 1MU2A 4F3TA 4BDZA 4CHYA 3ZSZA 4MIAA 3ISND 2JGUA 4Z4GA 3CJ4A 4CFAA 4DS4A 3BQ1A 2JC0A 2O4GA 3HSTB 1NJWA 3TARA 1OS5A 3CFRA 2BR0A 4IG0B 3DMJA 4WZMA 1XHXA 2IJFA 4O44A 2ETJA 3DOLA 4HTUA 2KFNA 3SQ4A 3RMCA 2BQRA 1NK0A 4WFXA 2GIQA 4CHNA 4FK0A 3V6DB 4F4XA 5FDLA 1S5JA 4I7FB 3M8SA 3TABA 2OA8A 4ID5A 3KHRA 2XHBA 3AA2A 1X1PA 4XIUA 3L2RA 4RNHA 5EUHA 5KFKA 4NLUA 4OKJA 1S49A 5C24B 4ECUA 3C95A 4RW4B 4E7LA 1VSKA 1RTJB 4EZ9A 1LWCB 4O0IA 1T94A 4KBIA 3V6KA 3EZ5A 5HROB 2R2UA 3NBPA 1UWBB 4CECA 4CEZA 2AGPA 2WOMA 4ED8A 1S0MA 4CJVA 4O3PA 4HUFA 4RNMA 4H54A 4F2RA 1RT1A 3O3HA 5J2NB 4KHNA 2YHBA 1BI4B 3V6HA 1C1BA 3BSAA 4KB7A 4RNNA 4ZVGA 4ZVHA 1EP4B 4Q45A 1SH0A 1N4LA 4IDKB 3IS9A 5KFAA 5L1KA 4M3UA 4KB1A 1VRUB 1EKEA 4FJ5A 4M45A 4MH8A 2YKNB 3NF9A 2R8KA 3F73A 3G6VA 3AVAA 3V6DA 4ED1A 5FROA 4FM2A 4ECWA 4DTMA 1HNVA 4KB0A 1RAJA 4URGA 2QE5A 1LW0A 3GYNA 5C24A 4RW4A 4YNQA 3OS0A 3NH0A 1RTJA 3PV8A 4BE2A 4KAZA 1W9HA 1SUQA 2HVHA 4ZTJA 1XC9A 1FK9A 3KNAA 3SV4A 4ZP7A 5DG7A 3CO9A 3V4IB 1WLJA 4JS4A 1UAXA 2HHUA 3V9ZA 4FW1A 2WRMA 1L3UA 4ED3A 3V6JA 4LQ9A 2HNDA 1RTHB 5KFUA 4J9QA 4W5RA 2F8TA 3EYZA 3T5KA 3D45A 5HRRA 4X2BA 5EDWA 4WYLA 4GC6A 3KK2B 1HQUB 3HPOA 3LP2A 1RT5A 3RB6A 3SNNA 1S0OA 1NOZA 1JLGB 4DL5A 1JLBA 2B4JA 3BGRB 3THVA 4FS2A 1ASVA 3KLHB 2KW4A 3E51A 3PW7A 1NK4A 1F21A 5KT4A 1WSFA 1WSEA 4IFVB 4ECVA 3T5HA 4NLPA 4J9RA 3NHGA 3LP1A 2CKWA 5JS1A 4NRUA 1BQMB 4RUAA 3L3VA 2XWYA 1EXQA 3C94A 1NHUA 1NK8A 1U45A 2HNYB 1NKBA 2RPIA 2D41A 4EO6A 2VG7A 4FM1A 4J9OA 4JRPA 3KD1E 2V0NA 4FZZA 3DLEB 3SUPA 2G8WA 4I2QB 4KO0B 5HP1A 2YNGB 1LWEB 5KRTA 1RA7A 4CF1A 3H4BA 3FFIB 4E7IA 3DLBA 2QKKA 3V4IA 1S1XA 1ZYQA 4QWCA 3LP3A 2XY6A 2OPRB 2E9RX 2FLPA 3TAMA 4L8RB 4F4WA 2C2RA 2BANA 3O3GA 4EBDA 3KK2A 4FVMA 2ZQBA 1TKDA 1J53A 1RT3A 4CFDA 3BGRA 3NAIA 4FXDA 4M42A 3QERA 4DQRA 3GV7B 3MR5A 3P5JA 3BSOA 1TKZA 3FQLA 4J9LA 4E7KA 5KG7A 1JLQA 3P1GA 2FJVA 4M3TA 1BQMA 1KLMA 1XR6A 1S1UB 2OYQA 2WTFA 3KOAA 3H5UA 3M8PA 3DRPB 4AHCA 1C1CB 4QAGA 4RW7A 2JEIA 1JKHB 4Z4FA 1QUVA 3ITHB 4AHRA 3DLKB 4B8CA 3NMAA 4ECXA 1C2PA 3OJSA 5DLGA 1L3SA 2YNIB 2YNGA 4BDYA 1DLOA 1S9GB 3V81A 2YV0X 4LD0A 1NK7A 2KTQA 1NOYA 5F8MA 5KFOA 3PW0A 2R2RA 3PW4A 3VQ5A 5KFBA 4XPCA 2OPRA 3HK2A 4CEFA 2AJQA 3AVHA 1CSJA 1S1VB 3SUNA 3VQ7A 5J2QB 4WE1A 4CJRA 3OLAA 4K4TA 3MFHA 3KTQA 3C6TA 2FBYA 4YR3A 3A2FA 4ID1A 4Q5VA 3NF6A 3QYYA 2KQ2A 4CJPA 2RN2A 2GIRA 3ZT4A 1I6JA 4IKAA 3KLIA 1RT6B 4DSFA 3TQ1A 3ULDA 4CE9A 4DMNA 2VG6B 3QETA 2BQ3A 4KE5A 3OYEA 4AH9A 4J2DA 3KLFB 2IC3B 5DQHA 2XCAA 1I39A 4GC7A 5KFNA 4ECTA 4QW9A 3KK3A 2E9ZA 1BL3A 1HARA 4EBCA 2R2TA 5FRNA 2D0BA 4CESA 4DTOA 4O3OA 2WHOA 5JUMA 3K58A 4BE0A 3V1QA 1T05B 3RAXA 1KHVA 5KT5A 4B9LA 3NF7A 2G8UA 1IH7A 4F2SA 1T8EA 5KT7A 1KFDA 2J6SA 3LAMA 4C8OA 3LDSA 1KLNA 4RW9B 3VQDA 4E7HA 2ZD1A 2C2DA 3LALA 3LPTA 3DRRB 3MFIA 3WNGA 1S1VA 4DFKA 4F3OA 3K2PA 3KKSA 4IG3A 4KTQA 3QEWA 3L2VA 3M8RA 4E89A 5KG2A 1DTTB 4FJXA 4RNOA 3ASMA 1JLAA 5DQIA 2HHSA 3TWHA 3BSCA 4G1QB 3VQEA 3AVJA 5I42A 4ZTFA 3RTVA 2C2EA 3CQ8A 1BGXT 1FKOB 4FLTA 3T1AA 4O4RA 4B8AB 3LAKA 5HRSA 1RA6A 2I5JA 2DTUA 2UVWA 2WONA 3KLEB 4O3NA 2W7OA 3DM2A 2UVVA 1U48A 4MK8A 3QO9A 3GV8B 1LV5A 4JV2A 3GQCA 1T05A 1IKWB 1D1UA 5CZ2A 5KFVA 3TAQA 4CJUA 3QIPA 4UQGA 3D0PA 5I3UB 4LSNB 4B9TA 4KPYA 1LAVA 3WNHA 1NK6A 1S1TA 4RW9A 3WNEA 4MKAA 4DQPA 3G10A 1YTAA 3O4QA 3QNOA 3E01B 2FVPA 4XPEA 1LWFB 3IRXA 2AGQA 3SFUA 4FLWA 4ECSA 2P5OA 1BQNA 5J2MB 3KJVB 3HVWA 4CHQA 1HQEA 1RTIB 1A5XA 3VA3A 1TGOA 4Z4IA 2PYLA 4NLYA 4R8UB 5J2PA 1VRTB 1SH2A 4QWEA 1RDBA 5KI6A 2BGGA 3AO2A 3PZPA 1S9EA 1FKOA 2W9BB 5KFFA 3M9NB 4WYWA 3MEGA 2Z1HA 4CJLA 4K4XA 2DPIA 4JLHA 3VQCA 3KMSA 1ZETA 4O0JA 4FJ9A 1N6QA 1W25A 3AA4A 2IOCA 3SV3A 3OYFA 4H4MB 2QK9A 4FJJA 3N6NA 4M41A 2OH2A 4DFMA 2ILYA 5K14B 4O3RA 1RDCA 2ZE2A 4MIBA 4Q0BA 5L1IA 4EYIB 1B92A 3QESA 1TVRB 1QQCA 3EPGA 2XC9A 2I1RA 4IFYB 3MEEB 4LY7A 4YR0A 3OL8A 1TKTB 4ED2A 1D8YA 3QLHA 1RBSA 2KZMA 1L3VA 3AVFA 3Q8PB 2E4LA 1TL3A 4FLYA 3LPUA 4Z4CA 3DLGA 3BJYA 4O5BA 3MF5A 2W42A 2FBVA 3IGVA 5KFZA 5D3GB 4ZP9A 5KFCA 2C22A 1VRTA 1HMVB 3HJFA 3K59A 5CZ1A 3LWLA 2VWKA 1J5OA 3AO3A 4KTZA 1VSEA 2IDOA 1S4FA 3CDUA 1T7PA 4KAIA 2YKMA 3ZT3A 3C6UB 3OYJA 5KT2A 3DOKA 2VWJA 1ZBUA 2IMWP 4OKEA 3HO1A 5CYQA 4M3XA 1U04A 5DMRA 3RB3A 1J54A 3OYBA 1TV6A 2RKIA 4HUEA 1ITGA 4O3QA 4F4YA 3L2WA 1TVRA 2PYJA 3I0SA 4RW8B 1EETA 4J9PA 4RW6B 4K8ZA 2JC1A 2YNHA 1TKTA 2W9CB 1RBVA 3NL0A 3HVTB 5C25B 3L3UA 2RF2B 1CLQA 4CEAA 4ZVEA 1S6QB 4LSLB 5C5JA 4CGFA 4IG0A 4CJ3A 4OPKA 5C42B 4PQUB 5KFEA 3LANA 4EO8A 3MEDB 3G6XA 4IRKA 3HP6A 5CYMB 2HHXA 4FBUA 3H08A 1HMVA 2HMIB 3EZUA 3O4NA 1RNHA 1FKPB 1SV5B 3H4DA 1VSFA 1Z26A 1I3AA 4CGIA 1JLFB 4Q44A 3Q8QB 3U3GA 3NF8A 3QEIA 4DTNA 1YT3A 3MECB 4DU3A 1X9SA 4I7FA 3OLBA 4NYNA 1KSPA 4Y34A 3N6MA 1HYVA 1RBUA 2E6MA 1QSYA 4N76A 4CGGA 3SQ1A 3VQBA 4M94A 1LWCA 1U47A 4QOZB 4TYAA 4IKFA 3RMDA 4AHTA 3NAEA 4RW6A 3TANA 5HROA 1UWBA 3T3FA 4WFYA 3K5OA 2KFZA 4PWDB 4WXWA 3SYZA 2O5DA 5KGXA 2QV6A 3M9OB 4FJLA 3RB4A 3U3YA 5J2NA 2RF2A 1BI4A 4TY8B 4KFBB 1KVAA 3IN5A 1S6QA 4DFPA 2UVUA 4CF9A 1QSLA 5C42A 4QWAA 2B6AB 1QAJA 3DLRA 1X9WA 1EP4A 4CERA 4IDKA 4MFBB 4CJFA 2D3ZA 4IBNA 2FVRA 3KLGB 3ZSRA 3D28A 4ECZA 4DLEA 1VRUA 4CJQA 4ED6A 3PX4A 2IS3A 1NKCA 5L9XA 1SV5A 4OLBA 3I0RB 3AVMA 2F8SA 2DFFA 4XO0A 1JXLA 1D9DA 2YKNA 4ZHRB 1T03B 5KFGA 3NGDA 1VSHA 4CIEA 3NCIA 1QAIA 1C0TB 3HPHA 1JLEB 4OVLA 1NK9A 1KHWA 2W8LA 4E7JA 1U09A 4CJKA 5F8LA 4CF0A 1GOAA 3BR9A 3QGHA 2D7SA 4Y1DA 3MXIA 3T5LA 4M95A 3Q8RB 2JEGA 4NLDA 4JV0A 3ZSQA 3SCXA 1TL1B 3GIJA 3PY8A 1WSIA 4KREA 1RTHA 2ATQA 3LZIA 3BSNA 2XY7A 4WFZA 2VG5B 4PA1A 1NNDA 1WSHA 1HYZA 4OKKA 2D0CA 5F8GA 2OPPB 3OL9A 3HYFA 3DI6B 4HYKA 1HQUA 4E3SA 3M9MB 1SKSA 4CF2A 4C8KA 4YFUA 4J9MA 3T19A 2ALZA 3PR5B 1JLGA 3QGGA 3OYCA 2QXFA 2P1JA 4MFBA 3RWUA 4EP4A 3SQ2A 3KLGA 2BE2B 3KLHA 4CJWA 4IR1A 3AVBA 4FJ7A 4DFJA 4IFVA 4K4SA 2G8VA 3HPGA 4ZHRA 4IOBA 2UVRA 1N48A 1IG9A 1C0TA 4W5QA 2HNZB 1JLEA 4I2PB 3ZCMA 1BIUA 3KIOA 3VQPA 2HNYA 5F8IA 4DU1A 3K5MA 1REVB 1JL1A 4Q8FA 4QW8A 3AO5A 2Z1JA 5JS2A 3M8QB 3QZ7A 3FQKA 1L3TA 1N5YB 4FBTA 3DLEA 2E9TA 4I2QA 4KO0A 3H5YA 4CEBA 3OYMA 1LWEA 1RT7B 3CG7A 3FFIA 4Y2CA 1IKYB 2C28A 3PO4A 3QZ8A 2HB5A 2ASJA 1Z25A 2HWHA 4JUZA 5FRMA 1XI1A 4CFCA 2NUBA 3MXJA 4FLXA 4LQ3A 1QE1B 4KKOB 4CFBA 1TK0A 4FYDA 4DF4A 2OPPA 3OS2A 4RNFA 4DTXA 3OL7A 3HHKA 4WZQA 2DFEA 3RR8A 4W5NA 3D5MA 2FBXA 5KG1A 2JEJA 1J9AA 1R0AB 4K4ZA 3RRHA 3RMAA 2HVIA 3ISNC 4URQU 3OYLA 1RT2B 1WSGA 4CJ4A 1HJRA 1TAUA 4CF8A 3VQ8A 1S1UA 3PVXA 2XO7A 2IAJB 3K5NA 3EPIA 3DRPA 1C1CA 1RYRA 1JKHA 1SKRA 4IRCA 3ITHA 5F8JA 3HVRA 5L1LA 3DLKA 4DSIA 4CIGA 3ZSXA 2B5JB 4CK1A 4F4KA 2YNIA 1RT7A 2YNFB 2IA6A 1S9GA 1NJYA 4J2EA 1IKYA 4ZVFA 3NH2A 4DTSA 4DF8A 4FLVA 2VA3A 3F9KA 4PUOB 3TAPA 1JL2A 4J9SA 3DYAB 2ZKUA 4CEDA 5DQGA 2BQUA 4E1NA 1TK8A 1RDAA 4ECYA 1X9MA 4TQSA 1BHLA 4B9SA 1QE1A 5J2QA 1GOBA 4FW2A 4KI4A 3SQ0A 3BREA 3KKRA 2IM3A 4DSLA 3QEXA 5SWMA 4QCLA 3PX6A 1CZ9A 4FK2A 3CFPA 3ZSYA 1TKXB 4JV1A 1RT6A 4CIFA 1RT4B 3LWMA 4ZP8A 3G0ZA 5KFTA 3H40A 4NYFA 1S1WB 2VG6A 1QSSA 2HHQA 2AWZA 1HPZB 1ASWA 3PR4A 5DG9A 3KLFA 2IC3A 4EP5A 1WNEA 4TQRA 3MXMA 5HLFB 3ALYA 2ATLA 2G8FA 4M3WA 4B3OB 3EY1A 2FJXA 2R8HA 4RU9A 3CFOA 5EWGA 3OVNA 5J1EB 3HKWA 1WN7A 1HRHA 4NLRA 2Y1JA 2XY8A 1YTUA 4GW6A 3MAQA 5KFMA 4FJGA 2X6SA 3GIIA 4PUOA 3CJ2A 5KFQA 1YVFA 3DRRA 4N47A 3DYAA 3AVLA 4B9UA 3SUOA 4CJ5A 3IG1B 2A1RA 4O4GB 1CZBA 4R5PB 3OYNA 3QIOA 1IKXB 3GIMA 2V9WA 1LAWA 1Y97A 4CEOA 4E0DA 3QEPA 2PZSA 1KCFA 1DTTA 3GV5B 3S3MA 4G1QA 4GMJB 1IKVB 3S3NA 4BDPA 1NKEA 1WSJA 1TKXA 4FJNA 4DL6A 3VQQA 1DTQB 1XR5A 2XRIA 3CM5A 4GVMA 3I8DA 2ASLA 3L2QA 4AILC 4YP3A 2P51A 3DMJB 4FZYA 3AO1A 3KLEA 3JYTB 3B6PA 3NFAA 4O44B 5J1EA 3DOLB 5EU7A 3T5JA 4N56A 1C1AA 4TXSA 1IKWA 1RBTA 3KHHA 3SPYA 5KFDA 2X74A 3NH1A 3OSNA 4BACA 2EC0A 1BISA 5I3UA 4LSNA 2G8IA 1L5UA 4MK9A 4ID5B 3NGIA 3CM6A 5T14A 3AA3A 3AVGA 4B08A 1Z4UA 4KHUA 4Z4HA 4DWIA 2BDPA 3AVCA 3E01A 1ZTTA 1K6YA 1LWFA 4O4GA 1U49A 2PY5A 5HRNA 4FK4A 3OYGA 1JXBA 2HHTA 5J2MA 2OZMA 3KJVA 2OPQB 1HNIB 1RTIA 3ICLA 3NBPB 5DLFA 2WOMB 4EEYA 4R8UA 4R0EA 1A5VA 1ASUA 4Q43A 1RBRA 1DTQA 2RDIA 4HVJA 3UIQA 3QINA 4F8RA 5KGWA 1CXUA 1RT1B 4E1MA 1RDRA 3MTKA 2W9BA 4CGDA 4BE1A 4ICLB 2XY5A 1C1BB 1LW2B 1RILA 3Q8SB 4W5OA 1UA0A 4DSEA 5E41A 2F96A 3LZJA 3PHEA 3GIKA 4Y1CA 2AGOA 5KFJA 4NYZA 5KRSA 4DTRA 3JYTA 1WAFA 1S48A 2Q3SA 4H4MA 3IS9B 1BIZA 5EWFA 1SL0A 2RDJA 4CHPA 5KFWA 1EX4A 5DG8A 2HWIA 2HHVA 3QEVA 2OPSB 2CJQA 2DPJA 1U4BA 5K14A 1T3NA 1YVUA 5F8HA 2EX3A 4AHUA 3IAYA 4N41A 4IFYA 5KFPA 1HNVB 3I5BA 4KTWA 1VSDA 2AQ4A 3MEEA 4CHOA 4KHSA 4C8LA 5F8NA 1LW0B 4OPJA 3TVKA 3K5LA 4HUGA 3OY9A 4KRFA 4O3SA 2WK4A 1S0NA 1O1WA 4C8MA 1SUQB 1FK9B 1UOCA 4DL4A 2J6UA 2OPQA 1HNIA 4Z0UA 1XHZA 2D0AA 2HNDB 5D3GA 4AHSA 5HRPA 4MK7A 3PW2A 2FLLA 3UR0A 3UPFA 4U7CA 4BWMA 3V9WA 4ICLA 4HCCA 4W5TA 1LW2A 3CDEA 3WNFA 1TP7A 4AHVA 5KFYA 3LP2B 3U6FA 1RT5B 3VQ6A 1JLBB 2F8EX 3C6UA 2R7YA 4CJSA 1TK5A 3ZT2A 4B9MA 1ZBLA 4ED7A 4C8NA 1FXXA 4KHMA 3OYDA 4FCYA 2B43A 1ZTWA 1D0EA 2OPSA 1Q8IA 3QNNA 4DEZA 3LP1B 3NGYA 4IH7A 2OZSA 1C0MA 4ELTA 3PX0A 1KVBA 4IH5A 2D5RA 3IGNA 5KFXA 1NJZA 4TY9A 4RW8A 3RB0A 3CJ3A 2FVSA 4TSXA 4K4VA 2VG7B 3HP9A 4Z4EA 1K1SA 2W9CA 1IM4A 5HP1B 4NLXA 2BRKA 1XWLA 3HVTA 5C25A 2P5GA 4HHTA 4H4OB 1RYSA 1S1XB 5KT6A 3AVIA 4LSLA 1BCOA 2BRLA 4DTUA 3V9SA 4IH6A 1TAQA 4PQUA 3QIDA 3TAMB
chains in the Genus database with same CATH superfamily
2XMJA 5CYMA 3VQAA 3BGFA 3S6EA 2HMIA 1Z2ZA 4DQIA 1B9DA 4M5DA 3R5DA 3H98A 5KFIA 4IRDA 3UE2A 2VC0A 2WW4A 3O9TA 4FZXC 2FZKB 4DU7A 4M7YA 2PMHA 2Z1IA 1G15A 4E19A 2EPIA 4KV8B 4FJIA 1RDUA 4M3YA 4WXOA 3WXJA 2H54B 2MLXA 3MCMA 3FZLA 4YR2A 5K8OA 2AW0A 3KG0A 4JI7F 1R43A 4ZPCA 3GG1A 1VHIA 2VGNA 4C23A 3QQCD 3B6OA 5DETA 5AQSA 3Q8YA 1ZZNA 2QLXA 3DLHA 3TX8A 4B9NA 3MR6A 3KHGA 2ZH4A 2CGLA 1ZBHA 4TYBA 3OBYA 4NLVA 2YH1A 3W61A 1S97A 3H5XA 2YHXA 1FJGK 4LF4J 2JOQA 5KG5A 2KHOA 2B6AA 4EFHA 4NCBA 1VQ6N 1F2GA 5BN8A 2ZVIA 3MPDA 2IM1A 3OSPA 4M5MA 4J9KA 2KI2A 2ASPA 3UQSA 4DX7A 3C6TB 1S6UA 3UDLA 3D67A 1CBKA 2J8SA 2I6WA 4B1VA 3CYMA 1WEXA 3MPYA 4Q8EA 4LF5F 4I6MB 3VN5A 1RLDA 3B82A 4LH5A 3NDKA 1T9UA 5EHHA 2DB1A 4OI2A 3GCXP 3S9HA 2C3UA 4CZKA 2BJ7A 2A42A 3SFGA 2HZCA 2AYBA 1VBXA 3SXLA 4MQ3A 1HNZK 3ENWA 1KOHA 1NO8A 1OQ3A 3HSDA 1JXEA 4TLRA 1TL1A 2EFVA 2J0SD 1TL7A 4AUKA 4CEEA 1B9FA 2VG5A 1WORA 2Z0GA 2X1AA 4ZMMA 1YLXA 3QWPA 5T7LB 1NK5A 2DNPA 4CZFA 4NLWA 1YJTA 4FZVA 2B56A 1AUDA 3DI6A 3NE6A 4H5TA 2CYYA 2J6TA 3SMPA 1Q7LB 2AX0A 3BDPA 2WCXA 2QMUB 3PW5A 3J80Y 3L95X 4QWBA 5M1OA 2YJFA 3CQXA 5GVQA 3KMQA 5LMUJ 1YRXA 2P9IA 1LWXA 1NCLA 2XZTB 3V9XA 4P2XA 3NKYA 3ZT0A 1PC4A 1REVA 4CDIA 1VQOS 4B1ZA 1S6PB 1I5OB 2AKWB 2A6MA 2A2DA 1S10A 1N5YA 4G65A 3H8YA 4WU2A 1HBUB 4DZ6A 4B3SF 2M5YA 2M2BA 1H6KX 3VV2B 4OL8A 4Y2KA 2WONB 3GU0A 4FLZA 2KJWA 4X4NA 1VHFA 3KLVA 2BACA 1KQSR 3QO9B 5F9NA 5GAHP 4YMEA 2R7WA 1GX5A 2ZHAA 2O4IA 1HNXJ 2L9WA 3CCMN 3VGTA 4IO9L 4USVA 5AQKA 7AT1B 1R7IA 3BGUA 4GVEA 3THYA 3Q23A 2FF3B 4OJ1A 1PJ5A 4K2JA 3HT3A 1S1TB 1V5IB 2F4VF 3IWNC 3MPWA 1GMWA 2EFGA 3VEXA 3G6YA 1NSPA 3NNHA 4U9RA 2HVDA 1Q9YA 4IR9A 1M1KT 1VSJA 3WIVA 3TI0A 4PL8A 2UUTA 1BQNB 2PEBA 4ANCA 1AB8A 4OMFG 1HQEB 3H1VX 2IVOA 2KZZA 1RKJA 2K8GA 3VQ9A 4RG8A 1GOCA 5J2PB 4DV2F 5E5NA 1IWGA 4WFNL 3CJ0A 1D9FA 2GMJA 1S9EB 2H5EA 5IV3A 3CCLN 4FS1A 1Y9OA 3CCWA 4P2FA 3TJ9A 2YNFA 3PJWA 3BGLA 2F9DA 2P9LA 5KG3A 1JCGA 5B7WA 3W9JA 2YX1A 1QTMA 1NZAA 4Y3CA 4C9DA 4FYVB 2V69A 1NGEA 4DL3A 4O5FA 4CK2A 1C0GA 3QGIA 3VA0A 1GTHA 4Q0BB 2A10A 3W60A 4A8FA 5LM7E 4DV7K 4I4BA 3CC7N 1VIOA 1JLCA 2VPWB 4I9QA 4JS5A 2MHEA 1RT4A 4EBEA 4FM0A 3CULA 2ABYA 1HPZA 4CK3A 5LMNJ 4G3IA 1Y11A 2PI4A 3GG0A 3HULA 1IBLJ 1VQLS 2FC9A 2M52A 4GRSA 2ZJPL 2VA2A 2IIHA 4LH4A 1GX6A 4FKXA 1J5OB 3FJ2A 2P9UA 4QIFA 3NOCA 2FY1A 2HW3A 1S4EA 2UUBJ 4QIVA 5FDLB 4X64J 5KQ8A 2FUG9 4M8LA 4J5OA 1CXQA 4NA3A 3A8EA 1U1NA 5CYQB 3S7RA 2YY3A 3CF5Q 1I94K 3AVNA 4PY5A 3IG1A 4BC9A 3MR2A 4R5PA 2RKIB 1IKXA 2VKRA 1YQHA 3PFOA 4Y2AA 1U2RA 4RTFD 3LP0A 2CH6A 1FDDA 3I0SB 1PBUA 1TU0B 1FESA 2UXBJ 2HS0A 1KFSA 5IFMA 3UKRA 3OVBA 4AE5A 2D3O1 4OX6A 3OS1A 3MCPA 1H38A 1MU2A 4QZVB 3EE3A 4F3TA 1F5BA 4ZVOB 4QJVA 4MIAA 1ILYA 1U25A 4JD2A 5A6WA 2NLXA 3LPEA 3BQ1A 2JC0A 2O4GA 3HSTB 1P8ZA 3TARA 2H4YB 4OI1A 3CFRA 3R6LB 4U8VA 3HKZD 1WHXA 3W9HA 2ETJA 3DOLA 5H9FK 3FCWA 1DQ8A 5A8WA 3B8HA 3AGKA 5GINA 2PD1A 1CJVB 3D6FB 2F4FA 4CHNA 4FK0A 1S5JA 3DCAA 1PGZA 3TABA 4BRMA 2XHBA 5TKWA 3L2RA 5EUHA 2ROPA 2AD9A 1CZAN 4OKJA 5LJ5Y 4ECUA 3G71N 3GWCA 4E7LA 3NWRA 2M0GB 4DV4J 3O1LA 4YDUA 1EAYC 3KK7A 4DR3J 3J7YP 4KBIA 2BOPA 4LRAA 3U1MA 3TUJC 4CEZA 2WOMA 5HQ8A 4QS7A 4ED8A 1E6VA 4CJVA 2RQ4A 3FMWA 1S7HA 2WVEA 4P74A 5F0UA 5J2NB 4CO4A 2O8BA 3IWXA 4M5KA 1C1BA 2ZOFA 4KB7A 4RNNA 4ZVGA 3D54A 5JVGL 5HMZA 4XTTA 1VFJA 2B4VA 4ZVHA 1EP4B 5G0RB 4Q45A 1N4LA 4IDKB 1IBKF 3UN5A 3R2CJ 4CTAB 3THTA 4ISGA 5KFAA 4CLUA 4HT7A 4FJ5A 2NYIA 4M45A 4MH8A 3NF9A 2MTLA 2KVQE 1X5SA 3EE9A 4AT1B 5FROA 1RAFB 2CQPA 2UV8G 3ZEUB 3GL1A 1B70B 1WUAA 2QJ3A 1RAJA 1S0VA 5CYJA 1M0SA 2QE5A 5D4OA 3DLLL 3GYNA 4X65J 4RW4A 4YNQA 5C2CA 2H5IB 3OS0A 3NH0A 3MAHA 1MWKA 4BE2A 1W9HA 1SUQA 2XSFA 1FK9A 3SV4A 2QA4S 2WVCA 1MWQA 2YKAA 5FPMA 4OLOA 3LGNA 3V6JA 2YKOA 3WUHA 1WHWA 4JI0J 5HRRA 1N5VA 4X2BA 3VOVA 2YH0A 3DU6A 1IG8A 2OELA 4OZNA 4GC6A 1DURA 3T7ZA 1FXLA 5KQDA 3D4JA 2X7IA 3SNNA 1S0OA 4UTGA 3O8MA 2B4JA 4ES1A 4IFEA 3SEOA 5F3ZA 2QWPA 3D2WA 3TTFA 2KW4A 3PW7A 1NK4A 1SVDA 3A3NB 4ECVA 2WBNA 3NHGA 4JI1K 1WC6A 1NHUA 3PACA 2HNYB 3W2WA 1T02A 4A5BA 2RPIA 5AQRA 2LEPA 2HIQA 4J9OA 3SSSA 2V0NA 3JS6A 1UEVA 3QAUA 2RE2A 4H5RA 4NZ7A 3DLEB 2ASOA 2YNGB 1X9JA 1KONA 2C2OB 3DKDA 2LECA 1UFLA 3EEQA 1S1XA 3NVKA 3Q2TC 2OPRB 2QTWA 1RGIA 1GLEG 4BRKA 2JRSA 2IRYA 3M2VA 3O80A 4EBDA 3L4QA 2AHOB 4WQ4A 5JMNA 1OQ6A 1P9QC 2RU3A 4CFDA 3TZWA 3HFZB 3QERA 1RISA 2MQPA 4DQRA 1VI7A 2FHJD 2MKYA 4NMXA 2Q3PA 3AOBA 2X3DA 3L7OA 1BQMA 1KLMA 2WTFA 1IVZA 5I3QA 3KOAA 3H5UA 3M8PA 3EXCX 4AHCA 1RAAB 2JEIA 4Z4FA 1QUVA 4YHHK 1RWOB 2CPJA 2IFXA 4AHRA 3CJ9A 4B8CA 4CZHA 4HDHA 3NMAA 1HNWK 1C2PA 5A8KA 2DBBA 1L3SA 1U26A 7FDRA 2YNIB 2LDYA 3EGNA 1DLOA 4LVOP 4JN4A 1K8AO 1JQGA 2HYIB 3UN2A 3W66A 3CJAA 3CCSS 3MEKA 3VQ5A 4XPCA 4JI3J 2JFDA 2KKHA 2M9KA 2AYGA 2ZM6J 1CSJA 1YZ7A 2HRYA 4OI0A 1M5SA 2VB6A 2EK1A 3UDVA 5CD4A 4UT4A 4V19X 1Y10A 5LL6Z 3KTQA 1X0PA 1XMOJ 3A2FA 4Q5VA 3QYYA 2PEHA 2RN2A 3ZT4A 4RWXA 2HGMA 4NXNF 3KLIA 1RT6B 1MWZA 4KIAA 4JI2F 2W2OP 1WWHA 2BJ8A 2DGOA 1T9YA 4LR7A 5D15A 2VG6B 5K5MA 3OYEA 5HL7Q 2F8MA 4HWIA 2V50A 3CD0A 4ECTA 3IMXA 3ULHA 2Q1NA 3QBXA 3D2FB 2UP1A 3CD6S 1NBWA 2VF3A 1HARA 1G1XA 5FRNA 2D0BA 4CESA 1ZAXA 4O3OA 1CJTA 3PJ9A 1XNRF 3LDOA 3V1QA 2J9CA 5ADXH 5KT5A 4B9LA 1Z6RA 4LFCF 4NA2A 4NEYA 4A48A 1KLNA 4E7HA 3LALA 3DRRB 4J90A 3S41A 3WNGA 2QYGA 5AQVA 3G8QA 2YX6A 1R6YA 4DFKA 3OW2M 1R8CA 3W5ZA 3ZTOA 2KJVA 4IG3A 2DISA 2XZDB 3A5OC 5K8MA 3KNGA 1DTTB 3ZETA 1JLAA 3QBCA 1Q81T 3TWHA 1VQKS 2HBYB 1ZH5A 2QO3A 3AVJA 1N8RT 3ENHA 4JKAA 4QU7A 4ZTFA 3VAMA 3CQ8A 1FKOB 4ES3A 3CCES 3VF2A 4PHTX 3FEXB 3DN9A 1YHQN 4I69A 4O3NA 2HHHK 1HR0J 5FPEA 2H3GX 3GV8B 4JV2A 1T05A 1IKWB 1D1UA 5CZ2A 1NGFA 4KBOA 3QT5A 4CJUA 1F60B 1G99A 4I67A 2A6AA 4XH4A 4LF7F 3D0PA 4B9TA 5J1PA 2HQGA 1H98A 4KPYA 3WNHA 2BKNA 1QUPA 4DQPA 2X1FA 1X5TA 2DY9A 4XPEA 2ZJQQ 4B1UB 4FVUA 4FLWA 2P5OA 4YORA 1A5XA 1ITPA 4Z4IA 3F2KA 2PYLA 1XMQJ 2C2ZB 2G4BA 1VRTB 4QWEA 2P9KB 1RDBA 2BGGA 3AO2A 3NMRA 5KFFA 5AQUA 2ZH2A 5AQPA 3M9NB 3H2VE 3SJHA 3JTNA 2Z1HA 1CJKA 4CJLA 4JLHA 2KRRA 2M4MA 4FJ9A 2FC8A 1O6XA 2QK9A 1Q82T 1W7WA 1PJ6A 3DXKA 2OH2A 2FGOA 1XK8A 3I56S 2FHMA 1NB2A 5L1IA 4EYIB 3LTOA 1OVYA 3CD7A 1TVRB 1VQPN 2I1RA 1QVGR 3BBCA 1H2TZ 2OGUA 1GMVA 2ZZNA 1LK7A 3QLHA 1M1KO 3QJPA 4NE9C 2D3OR 1B3TA 3EDQB 5EXWA 1TL3A 4ENOA 2C3MA 2FF6A 4FLYA 4J7CA 1H1VA 3H3NO 3NGKA 2YJEA 4MYUA 3BJYA 3I9ZA 2HIYA 3TW0A 1IN0A 3MAAA 2FBVA 2NNWA 3OT9A 1K0TA 3G6ES 1Y7PA 1HMVB 3Q83A 4K0KJ 3U9DA 4W4MA 2G0IA 5IXUA 4H0XB 1ATSA 1AUSL 3CDUA 3M2UA 1TUUA 3FK4A 4P7VA 2MQ8A 3R8EA 2QTDA 2BJ9A 1Q7YO 3C6UB 5KT2A 4LF4K 1ZBUA 3HO1A 3PG9A 1ACMB 2RRNA 2RRAA 1J54A 3KKFA 2L3MA 2VPZB 3J81U 2OCEA 4RW8B 3Q0AA 1FJGF 4RW6B 2HQCA 3MM6B 2EG1A 1QDUB 4CLSA 3NCQA 1TKTA 4WPAA 4GKKK 3G2XA 5E3CA 5GAGU 5C7PA 5M1KA 1N5SA 2KXFA 3JQMA 3HZEA 1CLQA 1RTZA 4Q7AA 2FB0A 3THXA 3MWTA 3VR1A 4ZVEA 2PE8A 3TJAA 3EE8A 4CGFA 4FO0A 2LMIA 5A76A 4LF5J 1VQLN 3I4PA 3O4NA 2QWOA 1FW6A 5LXYA 2DY1A 1VSFA 3PTWA 4PG8A 1H73A 1Z26A 1I3AA 1T9XA 4CGIA 1JLFB 4Q44A 1R0CB 2VFUA 4PG4A 4JI5K 1HNZF 2A41A 4ITSA 5BN9A 1KSPA 4A8SA 1QSYA 5GAEI 4N76A 3ZZZA 2CPFA 1PBAA 3WBZA 5LMUK 1BY9A 3VGUA 2KL8A 4QOZB 1HFEL 1ZXOA 4H03B 4IKFA 1NDPA 3QDKA 3RBZA 3PFEA 1Y5LB 4IO9Q 4OYBA 3K5OA 2KFZA 4CLWA 4PWDB 3NRBA 3JB9k 2E66A 2QV6A 4FJLA 2D0PA 5M2UA 2RF2A 4TY8B 4M5LA 1KVAA 1HBNB 3EGVA 4C8ZA 2KT2A 1RAEB 1QZ6A 2B3TB 2AJ2A 2V6AA 3N4WA 3KLGB 1RWMB 3LL3A 4DLEA 3CETA 1GLDG 4CJQA 3EKSA 1SV5A 3I0RB 4B3SJ 2Q43A 3AVMA 2DFFA 4ZHRB 3MCSA 4NASA 4NMLA 2DVIA 3ILIA 5FLXO 2FHJA 3FC9A 4CF0A 3MXIA 5IQ6A 1OH7A 4BVOA 2I8EA 3Q8RB 4WIQA 4H0YB 2GQQA 2F4VJ 1K9MT 2YI1A 4NLDA 1HWIA 3ZSQA 4FVCA 3C8YA 1OO0B 4OI4A 3PY8A 1NMEB 1RTHA 2ATQA 3U02A 3BSNA 4X4VA 1FJCA 3J8AA 3DHXA 1CJUB 3A5NC 2LXIA 3QATA 2G1HA 4K25A 1S12A 3M1FA 1K73O 3UN3A 2OPPB 1RWKB 2BJ3A 1HQUA 3M32B 4J9MA 3T19A 3OR2B 4DV2J 2V2ZA 2HS3A 1WSRA 2P1JA 4E2FB 3SQ2A 1UVMA 2BE2B 1H2UX 2MQNA 1FXDA 3AVBA 2F3JA 4W5QA 4I2PB 1BIUA 5FD1A 3K5MA 3ZYYX 4Q8FA 5ETRA 3AO5A 4LIRA 3M8QB 1BQXA 2GFFA 1HA1A 2M88A 4K5SA 3S8SA 4I2QA 5LMNK 1AW0A 1LWEA 1RT7B 4MTPA 2GJ2A 3CG7A 2JSXA 4P6QA 1IKYB 2AV5A 3NY0A 4DV7F 1UCNA 2CPZA 4PL7A 3PO4A 2QA4N 3MX5A 5FRMA 2R7UA 3BPSP 4NZ6A 2KRBA 3CCJS 1FDAA 2W01A 1A0OB 1PKUA 4BC7A 4KKOB 2ZH9A 4CFBA 1TK0A 4ETXA 3C16A 3OS2A 1R59O 3OL7A 2IPOB 3HHKA 4CBWA 4UZBA 4CD1A 3FGVA 2XLIA 1YITS 3MM5A 1V4SA 2JEJA 4URQU 1PG5B 1RT2B 3ULEA 2Y1LB 1S1UA 3BF1A 3DRPA 5M1PA 1SKRA 4CW7B 1NUEA 5L1LA 1I94F 2L41A 4CI0B 1S9GA 1NJYA 4N7TA 2F40A 4YEAA 4J2EA 1DQAA 1WG5A 2HS4A 2FHKA 4OJ3A 2BQUA 1HHQA 1IUJA 4C11A 3VF4A 2MKHA 4JB8B 1BHLA 2QA2A 2PFDA 5J2QA 4ISEA 1KTVA 3SQ0A 2O8DB 1XERA 2NPIA 4YOTA 2HWTA 1NAQA 5DM6L 1JJHA 3CFPA 3ZSYA 3HFVA 1TKXB 2DO4A 2KXHA 5KFTA 3H40A 2HFOA 3G96A 2C3PA 1BDGA 5JVGQ 1ASWA 5DG9A 1WG1A 4LREA 4EP5A 3MXMA 3QFHA 5HLFB 4OHZA 5I3PA 4J37A 4LFAK 4B3OB 1DZ5A 1SC6A 2V8GA 5FJ4A 2K7JA 1OY8A 4ZPVR 3O1WA 5ETQA 1Q8LA 3CPWR 4I56A 3ET6B 2V8DA 3CMAN 5AJ3K 4NLRA 2HK3A 2R9LA 2XY8A 4DV3K 1AYEA 4YDUC 3DLLQ 5GADP 4PUOA 5KFQA 2JJ4D 3BYRA 4N47A 2AEFA 4U7UD 1E6YA 4ZCLA 4CJ5A 1FCAA 3G9CA 2YQ3A 2A1RA 2EW9A 1CZBA 3GONA 5D0EA 2BJEA 3D2EA 3T1YJ 2PBDA 1ZBTA 3AOAA 4OZ3A 3GV5B 2DNZA 3U1LA 1IBKJ 2VZ9A 4BDPA 1BE4A 5IT4A 1WSJA 2B9XA 4FJNA 5B0AA 2CGKA 1S6OA 4XAKA 1VQ5N 3VEVA 1X4AA 4BRDA 2P51A 3D1OA 3RU0A 2CJYB 1YKWA 4OZ2A 1O5JA 2OIHA 2Q2RA 5GIPA 3B6PA 4JI0K 1YJWN 2QA4G 4PZVA 2NZ4A 2V52B 1YXQA 1VQNN 3BM7A 2X74A 5DDOC 3OSNA 2IBOA 4LJMA 1SAZA 4LSNA 4OJGA 3D9BA 4ID5B 1K8KA 3NGIA 3B4MA 3CM6A 2RHQB 3PRVA 4PXEA 2XZWA 1K6YA 2P9PB 3NGTA 2QGFB 3RSEA 2PY5A 4FK4A 3BP8A 4KH1B 3AB4B 3QRQA 3OYGA 4RBUA 1YWXA 2OZMA 1HNIB 1RTIA 3ICLA 4WYBA 2B4PA 1H74A 1X4BA 5AQLA 3CIMA 3K2YA 2VODA 1N8RO 1A5VA 1ASUA 4Q43A 1VQKN 2ZZMA 6AT1B 4YN3B 1TR0A 4E1MA 3CXCM 2W9BA 3ZZUA 4CGDA 4BE1A 2HBRB 4ICLB 2V67A 3QRPA 1LW2B 4W5OA 4JI1F 3CCEN 4B3RK 1KQSM 4MDAA 3J7AP 2RE1A 2VL1A 4BRNA 5KRSA 2Z8QA 3JYTA 1WACA 4H4MA 3AOCA 1BIZA 4TKTA 4PR6A 1K44A 5GAGI 1FFWB 4JNEA 1NNEA 1EX4A 5DG8A 2HWIA 2DPJA 3UVJB 5K14A 1YVUA 5F8HA 4AHUA 3O08A 4IFYA 3I5BA 3MM9A 4KTWA 4ZVRB 4KHSA 4CHOA 3ZC4A 2HBMA 5F8NA 4OPJA 3P5TL 4HUGA 4R0JA 1SS6A 4BG9A 2WK4A 1YJRA 1F9HA 4IJNA 4DR2K 2NREA 1QAXA 3X1LB 1U1PA 4Z0UA 3G82B 2CG8A 2HNDB 5A2QO 1F1BB 2HBKA 2LQ5A 3EN9A 3R1XA 3OTEA 1DAXA 1GFWB 2H5JB 5BR9A 1OMSA 2ZZTA 5M1FA 2AZ1A 1OYEA 2Z4PA 1HIYA 3LP2B 2GX8A 1RT5B 5JVHQ 2VBXA 1NGCA 4CJSA 1TK5A 4YHHF 1VQ7S 1Q82O 5B0FA 2LFVA 2J9EA 3M6UA 1ZBLA 1HNWF 1P1TA 5KPZA 3G8SA 2EFPA 1RDWX 1ELOA 4K7QA 3LP1B 2OANA 1WD6A 5L38A 4FYXB 2OZSA 1XMOK 4ELTA 1C0MA 5SUHA 3I56N 3N28A 1NJZA 5KFXA 5D6GA 4CIOA 4DZDA 2DT9A 2KYXA 4HH1A 2HURA 2W24A 2ZOGA 2W9CA 4CVNE 3CCUS 2EFNA 2E7VA 1F3VA 2I7PA 4QYZK 3QGPA 5C25A 2DNRA 1RAIB 2X3GA 5B0GA 1NU0A 4JKFA 3THWA 1RYSA 2Z2MA 3AVIA 3IFEA 4BRQA 5AZIB 2BRLA 4DTUA 1TAQA 4JI2J 3QIDA 5LOQA 4UY85 5BRHA 4C1NI 1SH3A 4ZPDA 2FC0A 2QKBA 1FKPA 1QQOA 2PSZA 1B7YB 4HCBA 2CGJA 4N77A 1RT3B 3W9IA 3CJ5A 1MMLA 3SAHA 3ZSOA 4ED0A 1KAXA 4EYHB 1XNRJ 2W8KA 2R42A 3NAHA 4LFCJ 1RWUA 2JWKA 2CFXA 3V1RA 4KY3A 4IWVA 1OSCA 3KUHA 3C19A 1S57A 4HACA 2N3OA 3SDEB 4NCAA 4RW7B 1ATNA 1VLOA 3SPZA 1TL7B 3WC0A 1WKJA 2F7TA 2Y0BB 2DH9A 2J0WA 3ZSVA 3DHWC 4DSKA 3K5PA 4KFBA 4RJVA 1VSIA 3BBBA 3TR8A 3C14B 3TU5A 2E1PA 4URSA 3GFXA 1KD1T 4H0VB 1A5WA 4BRPA 3KWGA 3HM9A 2LU2A 3BEXA 4ETZA 1NGIA 2XLKA 1NPRA 2G9OA 4ZPWR 3H5SA 3UD3P 2CNLB 2CJXB 1YJNN 3OYIA 5LJ3Y 1AZSB 2FLNA 2HHHF 4DUZK 2MKIA 1VQ8N 4DL0C 3H3OB 2HQ3A 4DL2A 4LF7J 2BW2A 2QI2A 3CHWA 2CQDA 1UA1A 1R6VA 2DR6A 4PXBA 5E3PA 3KFWX 3VQSA 3UO0A 4RCHA 5EWEA 4CJEA 3ZX0A 1ZPWX 1D5AA 2G2YA 4P52A 3GILA 2BEFA 4NRTA 2POKA 3RYLA 4E8UA 1RU2A 4KH0B 3D3CJ 2MQLA 2Z30B 1QHAA 3THYB 2JWLA 2D4WA 5HAOA 2WVDA 4ED5A 1Q9XA 1T9VA 2GAHC 5L1JA 3WXLA 3OXLA 1D3WA 3H2LA 3L8BA 4ZPTR 3KJNB 1RCHA 4F9OA 2GVDA 3TAFA 4K2XA 4QR0A 5AZJB 3J7AN 2QL9B 3AD8C 2XWXA 4CGHA 3ENAA 1WC1A 4DQQA 2DY4A 2HNZA 1NB7A 2AX1A 4CEQA 2YWWA 5I42B 4DPTA 3I8BA 4FJ8A 2KFYA 3PIPL 3OR1A 2DFHA 5T7BA 2P9LB 1VOMA 4RKUC 1K9MO 2DTJA 3DM2B 1FE0A 3DGPB 3RG6A 3R6GB 1RB0A 1WB9A 2GZOA 3KHLA 5AE1A 2IVMA 1OVQA 1Q0NA 4K0KK 3GYXB 5B8HA 4KGVB 3QIPB 3MHYA 3RBDA 4DTJA 4TN2A 2YXLA 3MUMP 2HMPA 3SI8A 1REGX 4BGBA 3H59A 4ZPAA 2QWRA 2RMLA 1JLCB 4KHWA 2FJWA 3CCRS 4JI4K 4EHTA 2ZDOA 3I5CA 3JSYA 1R0AA 4NCGA 4Z2XA 2Z57B 2JHEA 3CWJA 2V68A 3R5CA 5DGAA 3OXGA 3CB4A 3MXHP 4ZPBA 3BPDA 1NM2A 3PSFA 3O3LA 2WB4A 4LF4F 2OSRA 4CHZA 2FVQA 1HKGA 2MZ1A 4WIIA 2B5JA 2GC8A 4DLGA 4ELVA 1KVCA 2P9UB 2A1SA 4B9VA 1XR7A 3SQGA 1U2VB 3CVKA 3SZ2A 3B78A 3PRBA 1HYSA 4D3HA 2G8HA 4OHYA 4GKKF 1NSKL 4LBIA 3MR3A 3A8IA 3O2IA 3M6WA 4A61A 2KXNB 3CCJN 2ZE2B 4OGEA 3SI6A 2HQFA 1Q78A 3LP0B 3D6HB 3TAEA 2ILZA 3AA8A 2BOAA 1V9OA 2B51A 5GMKa 4FNIA 3OBIA 1YITN 4C3LA 3C7NB 3OQ2A 1MU2B 2EHGA 2DHAA 8ATCB 1S1WA 2XQCA 3MD1A 3PCOB 2CH5A 4JD2B 1IV0A 1KKHA 1P9YA 4DHVA 2HHWA 3DLGB 2J5AA 5F0XA 5G4DA 1HNZJ 4DG1A 1EQ0A 1HL6A 1RTDA 4JI5F 4X66K 1FWLA 3GJTB 5LL6d 4B3TK 2VUGA 4Y2IA 4J2BA 3HXMA 4YB7A 3MM8A 2KT3A 2Q97A 1HKAA 3EZOA 5A8WB 4QWDA 3TNVA 1W2BR 5FLXY 3EUNA 5LMUF 2FZCB 1H7XA 3GPAA 4X4OA 4RWWA 3ZSWA 1RK8A 1XTZA 3GCWP 3KDOA 5GMDA 2ZH1A 4P71A 4BRCA 1OY6A 3OL6A 1DARA 3S01A 1WSVA 5JXSA 3T9ZA 2EKNA 1DY3A 2D3UA 4F50A 2OUGA 3O5BA 4K4WA 1TV6B 4N5SA 3IBFB 4YUDA 2XEXA 2R8IA 1BCMA 5E0OA 4OQJA 1EETB 4F04B 1KQFB 3R2DJ 2X6NA 2VBYA 3PXGa 5GAGP 4FJMA 1KC8T 1BO5O 1RCXB 1AFIA 4WFBL 2E2NA 4CHYA 1F3FA 2OAUA 2AF6A 2OKQA 2E29A 3ISND 3CJ4A 4USIA 4RWTA 2IVYA 4IG0B 1M5VC 1V3ZA 1DJ0A 4O44A 1FVSA 4WQ5A 1HWJA 2KFNA 4USMA 4CP5A 3SQ4A 1OKJA 3ZZOA 3RMCA 2BQRA 2GHWA 1NK0A 3TUZC 3KHYA 2JVOA 2D1CA 1OJ4A 1RWNB 4I7FB 3VAHA 4LIWA 1N34J 3KHRA 4ZVUB 1UZHA 3ID6A 4W90B 4NLUA 4RW4B 2ZOMA 4EMDA 1VSKA 3BF3A 3OTCA 3F9MA 1E3MA 1T0TV 2DCUB 2G0JA 4EK2A 2ZDPA 5HROB 3NBPA 1UWBB 3VWSA 1C0FA 2NUHA 3LW5C 2GA7A 2MY7A 3WXMB 3VZIA 4HUFA 4FYYB 1TFWA 1RT1A 1R8HA 4IUFA 3O3HA 4KHNA 4RBVA 2EFOA 2YHBA 1BI4B 4BRAA 3MMJA 4BY9C 2C2NA 2XMWA 3BKTA 4CLZA 2WAQD 2M70A 2HF3A 1SH0A 1X4HA 4M3UA 4KB1A 1VRUB 1MROA 1EKEA 4NOHA 1QVFR 2BE9B 2BKPA 3AA9A 4C98A 5LMNF 2KU7A 3EDRB 3AVAA 4ED1A 1HBOA 2M3DA 2XYGB 1NM1A 4ECWA 1HNVA 2RH3A 1N36J 1VS3A 5C2GA 4BLGA 1LXNA 4LR9A 2GO8A 2KG0A 5C24A 3CJ1A 4A4JA 1UEKA 1XMBA 2RSQA 2YVSA 4ZK7M 1HJOA 1RTJA 1MW7A 3EM1A 2M7SA 2FJEB 5DG7A 4JS4A 2HHUA 2AJ1A 1XN9A 3Q89A 1MWYA 3VAFA 4OFZA 4J9QA 1R27B 1D9AA 1WOSA 1WF0A 2I2YA 3MURP 1MMDA 3M2VB 5DM6Q 4WTYA 1UWAA 4A47A 5THWA 3BN4A 4JHDA 5D0RA 3PYGA 1JLGB 4DL5A 5CE3A 3THVA 4FS2A 1NGHA 3KLHB 1I94J 5ITHA 1IJFB 5KT4A 4PXDA 4BROA 4IFVB 2PT0A 4NRUA 1BQMB 2CPDA 2YQ0A 2K7KA 1WBBA 4MLEA 4FM1A 2VG7A 4JRPA 4RX6A 4FZZA 3BZKA 3I55N 3SUPA 1VR6A 2XHWA 3CJCA 4KO0B 5HP1A 4DUTA 2D0OA 3FEYB 2B4OA 3FFIB 4X4RA 3DLBA 3V4IA 5IC4B 2NR0A 5ETMA 4CT8A 1ZYQA 4QWCA 2FLPA 3TAMA 1WC3A 2W2PP 3U4LA 2UUAK 5H9FJ 4FPAA 4UOCA 5RUBA 2BVZA 2RT3A 2HFSA 4FVMA 2RS2A 1QM9A 2ZQBA 1ZZFA 3LO3A 4LFAF 2R7VA 3JXOA 3BGRA 3RJMB 9ATCB 4TU8A 3P5JA 1VQ7N 3BSOA 2CXEA 3T1YK 3CCZA 4QQBA 2FJVA 5AJ3F 3ELHA 2B7BB 1XR6A 2OYQA 2LP4A 2DHXA 4DV3F 1C1CB 1JKHB 4P10A 1NHKL 1Z2LA 2RVJA 2APOA 4A59A 3DLKB 2PAVA 4DXLA 4LFBK 4CZLA 2BM0A 3DAWA 5DO2A 4CRJA 3CCUN 4OHWA 4LF2A 1SXLA 3UNYA 3PW4A 5EX0A 5DS7A 3HK2A 3CCQS 2AYMA 2Z56B 2AJQA 1A9NB 2DYAA 4ZJQA 5DM7L 4UOHA 1FI4A 3GOIA 2FLOA 3C6TA 4YR3A 4ID1A 1U7LA 3ZETB 4X62K 2KQ2A 5AQGA 1P1LA 4IKAA 4CJ7A 4RBTA 4ZS6A 4JI0F 1UVKA 2CJ9A 3BZCA 4DMNA 3QETA 2W4PA 4KE5A 2XMUA 4USWA 2QL5B 3BO3A 1I39A 2IC3B 5DQHA 3T69A 3DOMA 4GC7A 4QW9A 4MKVA 2E9ZA 2N4DA 3IR7B 4C1NK 4DTOA 1XJWB 1RXOB 2P2CB 5H1SV 1GXTA 2BH1A 5JUMA 1T05B 3TP2A 4JEPA 2G8UA 1FJEB 3W0LA 3EWGA 1IH7A 5AT1B 1T8EA 1BG3A 1KFDA 4KHPJ 2P9NB 5T7LA 3DU5A 2V2KA 3M1VB 4C8OA 3M2RB 3HHLB 3LDSA 2PFFB 1KD1O 3LQVA 4DV6J 3T1HK 1IJJA 1S1VA 3ZZ0A 5C15A 1G2EA 3QEWA 1FNXH 4JI1J 2J9DA 1U02A 3PKMA 3P3DA 4E89A 1DT9A 4RNOA 4A8WA 5A8RB 4B3RF 3BSCA 2ZNYA 3VQEA 4ZVSB 4FF3A 5F1XA 2LVWA 1V5VA 2C2EA 1BGXT 2ZGYA 1IBCB 1GTEA 2K3KA 3N4PA 2DXDA 3T1AA 4B8AB 5HRSA 1HBUA 1U1MA 2RHSB 2DTUA 2NSBA 4L73A 2UVWA 2WONA 3VZHA 4Y00A 3KLEB 2NQPA 4LF1A 5K9FA 5U47A 3QO9A 2GEMA 2DRAA 2O3DA 3GQCA 5KFVA 2C2KB 2D9PA 4DX6A 2XMVA 5AFUA 3R5JB 4OYPA 3MOZA 4UQGA 2E1ZA 2FJBB 1NK6A 2XBPA 4DR2F 1LAVA 1S1TA 2C2MB 1JCEA 2W40A 3QICA 3CPEA 1YTAA 3EGZA 3B4DA 3FZFA 1ESVA 3ZO7A 4BQLA 4IOXA 2J76E 4WWSA 2GVZB 3LDQA 3B6BA 3H42A 4RO0A 1UJ6A 3NG8A 4ECSA 1BQNA 5J2MB 3R6MA 3PEJA 1HQEA 2HSEB 5AQZA 4NXMK 1CQNA 4NLYA 4R8UB 4YHHJ 1FD8A 5J2PA 1UFKA 1SH2A 3J7A1 2K1RB 5GIOA 1HNWJ 1S9EA 3QFWA 3TSPA 1VRQC 2CQHA 2CNNB 5E26A 2YHWA 4FF4A 2XSJB 1XMOF 4I6AA 1N32K 4O0JA 1W25A 1T9TA 3MMAB 4S0MA 4HTJA 3OYFA 4U8YA 4FJJA 3O9RA 2MSTA 1R89A 3CC4S 5DDRC 5D8HB 3O6QA 3ZFVA 4M41A 4DFMA 1YBTA 4O3RA 1TL4A 4U95A 4Q0BA 1VHXA 3KYLA 1PO6A 1QQCA 4Y28C 2PFUA 5D77A 5K8NA 1V6HA 4QOTA 3SAFA 3A3OB 1TKTB 1D8YA 2YX4A 2Q1LA 1RBSA 1KBRA 2KZMA 3QFUA 1UFWA 5CHCB 5AQXA 1B0PA 3HFKA 4W98A 1JCFA 4DMZA 4OYZA 3A0IX 2V63A 1VQMS 2XS2A 3IKMA 4Z4CA 1CC7A 5D3GB 4ZN1A 5KFCA 2NCKL 2NSCA 2C22A 2VIHA 3W5YA 3GMGA 2F7VA 2V7ZA 1GK8A 1HD0A 4FWNA 3K0SA 2F65A 1J5OA 2IDOA 2GHPA 1LFWA 2ITMA 4AL5A 2VV5A 4FWKA 1YRTA 2VWJA 3BDEA 5CYQA 1YBAA 1U04A 1T44A 3RB3A 3OYBA 2YPYA 2RKIA 4HUEA 4EHUA 2E5LK 1NZ8A 3I0SA 2I7NA 4IEEA 4J9PA 4DV0K 2C3YA 3WEEB 2JC1A 5AQQA 2MSSA 3TJ8A 1GEHA 2JH3A 1WKKA 1Q86O 3JAMO 3A12A 4O8KA 2RF2B 4MJKA 3DXMB 2MMYA 3VF0B 2ZWOA 4LSLB 3P4UB 2HHHJ 1WBDA 4CJ3A 4PQUB 4DUZF 4EO8A 3MEDB 3GFHA 3G6XA 3TPQA 3HP6A 2HHXA 4I68A 3F41A 4MT1A 3EZUA 3CPWM 1RNHA 4OX7A 3VMFB 4DCOB 1SV5B 3H4DA 3CUNA 3AB2B 1YIJN 1CJVA 2E7WA 2RQCA 4YOVA 1FDBA 1OY9A 3MECB 3OLBA 4DV1J 4V19S 4Y34A 3O6WA 3HLUA 4BRHA 1RBUA 4NYPA 1PYSB 2XMMA 3VERA 3SQ1A 3VAGA 1FXRA 5AE2A 3EVWA 4ZLPA 5AXLA 2BABA 4L74A 4PPDA 4AHTA 3NAEA 4FSVA 4Q2LA 1KC8O 2FIUA 3PYEA 4CD3A 1O8BA 4GV6A 5JLHA 3SYZA 3EVOA 4WBFA 4F25A 4JP8A 5J2NA 3RBXA 1NG9A 1CQMA 1HI8A 3IN5A 1QSLA 2UVUA 4CF9A 2IYIA 2W25A 3JTOA 5C42A 1EP4A 5G0RA 4IDKA 3HT0A 2D3ZA 4B17A 4CTAA 2FVRA 1XEZA 2CQBA 2UUCK 3D28A 1SCJB 3QT7A 3BH6B 3EXYA 2IS3A 5L9XA 5B0DA 4OLBA 1V3SA 3W7BA 2F8SA 1T03B 1VSHA 3AQPA 2ZHOA 1CULB 3HPHA 4ZN3A 4NA1A 3O9QA 2W8LA 4E7JA 2A2CA 2CPHA 2RS8A 3ZEUA 1U09A 2DGSA 2CDQA 2PDAA 3F44A 5AQFA 5CZXA 4O23A 4K0KF 2Q66A 1GOAA 4YY3K 3QGHA 3WX8A 3T5LA 2WW8A 3DNCA 4M95A 3EO3A 3CNQP 3CJKB 2CQ4A 1Y64A 4JV0A 3PLAA 3SCXA 4QIWD 2GTDA 2MQMA 1WSIA 4KREA 3G4SN 1WC0A 4JI4F 4WFZA 2MQQA 3BV8A 4PA1A 2L08A 2CNOB 3EGWB 3W1YC 1PCAA 4OZ0A 4DU8A 4IQMA 5F8GA 3TSUA 2FSKA 4JK7A 3LM9A 1P8GA 1Q8KA 4HYKA 2CPXA 4E3SA 1SKSA 2O67A 4YFUA 5HANA 4GO7X 4M5IA 1J27A 3QWUA 3VF6A 3OYCA 2KHCA 1GLFO 4MFBA 3RWUA 3H25A 4EP4A 3OTOK 4IR1A 3CJQA 4FJ7A 3CD5A 4DFJA 1D4XA 2QA1A 3ULEB 2O8CA 1CS4A 4LF8K 1N48A 1IG9A 1C0TA 4YB6A 1JLEA 2ACYA 2B9EA 4KRWA 2HNYA 2VJUA 2H48B 1JL1A 2P9SA 4DV5K 4QW8A 4GKKJ 3I6PA 2K3IA 1L3TA 2HBLA 3DLEA 2E9TA 1YG0A 2VASA 5DDQC 5AQIA 1GNKA 3I87A 2HB5A 2ASJA 1ZC6A 2HWHA 4U96A 4C11B 2NUBA 4GVLA 3MXJA 4LQ3A 2BE7D 4U67L 5TKYA 4LBHA 2A6OA 2COLA 2QFJA 3ZTPA 1O51A 4RNFA 2HFNA 3V2UC 2VPYB 4JI5J 1VQ9S 1FVQA 2V4JB 4WFBQ 1YI2S 2QFIA 2MJUA 2LQBA 4X66F 3D5MA 4B3TF 5KG1A 2FBXA 5I9EB 3US5A 1LOTB 1WKLA 2BYCA 1FX2A 3CJ7A 4UUWA 1N0UA 3KZBA 1KOOA 4CJ4A 1TAUA 3GDQA 1KXPA 3VQ8A 2IAJB 3K5NA 3W5XA 2ZNZA 2E88A 5F8JA 1VK3A 1XIQA 4A2BA 2XLJA 4F4KA 2YNIA 2QEXN 2AEMA 3NH2A 2KM8B 3F9KA 4BRGA 4PUOB 2WSCC 3AH6A 3TAPA 3H1QA 2FPHX 5DJBA 3ZNUA 2C3OA 2YWKA 2KHDA 2I38A 4C3MA 2QSFA 3CJRA 3OBWA 4FW2A 4KI4A 1I3OB 3D2EB 3KKRA 2IM3A 1T3VA 3OFEA 2A5XA 4QCLA 4F67A 3ZX3A 1N34K 4CNZA 3C0BA 1CZ9A 4CWBA 1RT6A 3NLCA 1RADB 3BYPA 1WOOA 4ZVTB 3G0ZA 3RGIA 2VG6A 2HHQA 3CDAA 4HL9A 2DGTA 4R25A 2UXDK 2J0QD 4WQ5C 3VTIA 2W2MP 4CM2A 2ATLA 4M3WA 3QB0A 3D2FA 3GSDA 2FJXA 4KGZB 5EWGA 4PKDB 3CMEN 2OTLS 5H9EK 2PI5A 2MEWA 2PA3A 4TLQA 1FRKA 1X3NA 1VQYA 2MGZB 3EMTA 2Y1JA 1MA9B 2B8QA 2IVPA 3TO8A 5HVGA 2E2QA 1Q7YT 3R3LA 4FJGA 4TNOA 3GIIA 3DRRA 3DYAA 3AVLA 1J5EK 2C42A 4QIEA 2VOPA 2GGPB 3CCQN 4USUA 4WKRA 2V9WA 5IOLA 1LAWA 2IA0A 2XNRA 4E0DA 3QEPA 1DTTA 1UEUA 1PC5A 4FPBA 3S3MA 1IKVB 1N36K 3L7UA 4DL6A 1S72N 4EI2A 5CD4H 1EO1A 1XR5A 2E20A 3L2QA 3ILJA 4AILC 2WVBA 4OX9K 3DMJB 2P9CA 5IT9O 3VQTA 3JYTB 4CZMA 3NFAA 4RPFA 3T5JA 3MMBA 2QLBB 2KYZA 2HZVA 3BBFA 1IKWA 1RBTA 4F0KA 2ZH6A 4BACA 1FNMA 3E66A 1Y5NB 1BISA 3GJQB 2QZ8A 2G8IA 3D7SB 1L5UA 4L72B 3MM9B 1GLCG 4UW2A 1SJQA 3AVGA 5GADU 3OPKA 4PG6A 1H72C 1ZTTA 3M8WA 1EB0A 1U49A 3M30B 2KVIA 4IOAL 3DDNA 1JXBA 2HHTA 3J80O 5HVFA 3WHIA 1VJQA 2LEBA 2J4RA 2WFBA 3SSQA 4DQ8A 3MN9A 4JYAK 2P9KA 3CQYA 1DTQA 4HVJA 3QINA 2NXNA 1KS2A 3NOGA 2WC9A 3THPA 4TU7A 4YOEA 1YBUA 2F96A 5D4LA 1FJ7A 5KFJA 5HJXA 1WAFA 4PKHA 4A8OA 3IS9B 5EWFA 2X51A 2RDJA 2HHVA 4DN9A 5HQMA 5EN1A 3NVMA 1URRA 3QEVA 2RIJA 1U4BA 1DQ9A 3TSQA 5IS2A 1K47A 1VJWA 3SK3A 2DEIA 1LW0B 3TVKA 3VHQA 4KRFA 2UUAF 2O8FB 1EHWA 3Q2SC 2VKZG 1NGAA 3KWIA 4QYRA 4LMZA 4QR1A 4C8MA 4GKJK 4DL4A 3MUTP 4LFAJ 2J6UA 2OPQA 2QN6B 4OJHA 5GMEA 1T95A 4AHSA 5CQGA 5DM7Q 2VICA 4OI3A 3PW2A 3U27A 2FLLA 3UPFA 3W63A 4BWMA 3V9WA 1K73T 5ELZA 5KPRA 3T1YF 5AJ3J 1XC3A 2VU5A 5BREA 3Q8UA 1S77D 4W5TA 3TA1A 4HCCA 4PXCA 4RU2A 4AHVA 1N5QA 5KFYA 4DV3J 5AR0A 3VQ6A 3C6HA 1JLBB 3C15B 3C6UA 2R7YA 2R7XA 1JJ2R 4C8NA 4ED7A 2O01C 3OYDA 1HBMB 5B0BA 4LFBF 4FCYA 1FDNA 4DJBA 1AFJA 4DEZA 4M63C 3OVAA 3NGYA 3Q7BA 4I0WA 2HAFA 2D5RA 3IGNA 3RUBL 3F5TA 4RW8A 1TZ0A 3CJ3A 4K4VA 3MM6A 4K43A 4CZJA 3AXMA 5T41A 1XWLA 4A46A 3C46A 4BR4A 4ZKAA 4X62F 3V9SA 1X4DA 4HDGA 1S59A 3OFFA 2KB2A 1WF2A 1W2BM 2BANB 3CDWA 4KQZA 2JDJA 4KH4A 4WF9L 2OLWA 4CH7A 4KHPK 1UTAA 1JLFA 2L9DA 4UOFA 3MCOA 3WIUA 1SQGA 3OHAA 2FBTA 2IY5B 3MD3A 3LDNA 4DV6K 3AJ2A 1SIWB 3OYKA 1JX4A 4NLSA 5F9LA 3FEZA 1EWRA 1TKZB 4DCPB 4DR6J 1PAEX 1JLQB 1C6VA 4FOEA 4OI6A 3ZT1A 1Q5YA 3ENQA 3PIOL 4DTPA 2G2OA 1YK9A 4RUCA 1WI6A 4JRQA 3NNAA 1FEEA 1FRIA 2PC6A 4QBUA 2Y1IA 3CCMS 3RBEA 2QMXA 3T1HF 1V3RA 4PWDA 4OPAA 3M3ZA 3FRZA 3ZNJ1 4A5AA 3GE1A 3V81B 2WZ1A 3JQKA 3OD2A 4JV5K 4TY8A 4H4OA 5D0GA 1SL1A 4B3RJ 1MDUB 1ZBIA 2EKYA 2YX7A 2PMWA 1MN9A 1ZM2A 2DR9A 3S3OA 1S22A 1HBNA 2G8KA 3FCVA 4OJRA 5BRDA 1BOTO 3W3SA 2GVDB 2NPFA 1O13A 3BF4A 3HX9A 4WE1B 1U0HB 3M6VA 3UDCA 1F9FA 3I0RA 2CIMA 3E1YA 2MY8A 2YPZA 4IYQA 4YQWA 3BGOP 2V8VA 3OR1B 4DDFA 2NRZA 4FXWA 2P6SA 3KK3B 3CCTA 5FLXU 4NLGA 1H2VZ 4DR2J 1NJXA 4FN5A 2E1AA 3N0VA 3DXBA 1QS4A 1TTHB 4UF4A 2B9WA 1G3OA 2W6KA 4CBXA 2Q79A 4I9LA 4NLQA 3SUQA 1CJUA 3NGZA 4K50A 4CI6A 1MSWD 2HAIA 3PUFA 3PSIA 1APSA 2GV9A 2ZD1B 3M32A 2Q6CA 3AARA 5D4NA 4NXMF 3OR2A 4QPXA 4M5NA 3CW2C 1WTBA 4ES2A 5HBMA 4EU0A 3QSIA 2BE2A 1QVFM 4NCGB 4NLCA 1WDDA 3FDSA 3RRGA 2P6TA 2DCLA 1VQ4S 2GCFA 4OGCA 1BU6O 5CXTA 4RZRA 1R8BA 1JXVA 2GJIA 2DNQA 1N32F 4I2PA 5KG6A 5JVHL 3OJUA 1I1GA 2CJKA 3U7JA 2Y1RI 3M8QA 1Y3KA 4G1PA 1M1GA 1YSJA 2MZJA 4QYZJ 5ETOA 1S5ZA 1SI9A 2I5JB 3SJJA 3KK1A 5CY4A 3LF0A 3K9KA 4HVZA 1FKAF 3HHNB 1K1QA 1CVJA 1Q95G 1HYSB 2XGPA 1HX1A 4DHYA 4G6VB 2UXCJ 3DXSX 2JLEA 1S99A 4USTA 3TR5A 4KKOA 3FSIA 1IQZA 4D3GA 3M8YA 3SCKE 3ZX2A 3HL8A 3JAMY 3K57A 1GMUA 2NRRA 3JSMA 5KFRA 3RAMA 4FJHA 4C97A 1C0UA 5KTQA 3IRXB 2HGNA 4IEIA 4Q2MA 1WAJA 3MWPA 2LXFA 2GBZA 1H3DA 1TUVA 1UETA 1RT2A 3P39A 2B8PA 2E44A 4DG1B 1RTDB 3I96A 4FJKA 4DR7K 2UUWA 3IXQA 3G86A 2VDHA 4KI6A 3M4XA 4ECQA 3MEGB 5AQHA 2E5LF 4H4KC 2V8PA 1WEYA 1N6QB 4DU4A 4J9UE 2W7AA 4DV0F 2QWLA 3TZXA 2MKJA 3MGJA 4K41A 4DSJA 3D6TB 2SXLA 3NCRA 1M5HA 2E6LA 5CAAA 3GZ7A 2CQIA 1B0VA 2Q0RA 2DXEA 2XI3A 5ETNA 2JFKA 3QAEA 2XM3A 1VK0A 3L2UA 1N56A 4DUZJ 4CCHA 4DV1K 4JI6K 2ASDA 1YI2N 3TWZA 2QWNA 5AXMA 5KFSA 1GLJO 3FUYA 3IBCB 3OYHA 1BA0A 4P7TA 1QY7A 3AV9A 2MPUA 3E9OA 2E5HA 3WQPA 5KG0A 5HLFA 4B3OA 2R2SA 3RAQA 4H0OA 3MCAB 4ECRA 3PYFA 4ZP6A 4CO1A 4AL6A 5GADI 4HKQA 2ALYB 3OHBA 2Q31A 5KOWA 5KT3A 2JX2A 2XMKA 4YB1P 4K8XA 1VQON 3CT9A 3VALA 2ZGZA 3VGVA 3DWLA 3ET6A 3ENBA 3RMBA 3TAGA 2XS7A 2KKZA 3HRGA 2YKMB 3DOKB 2DO0A 2OFGX 2GWJA 3I31A 1SKWA 2IM0A 4F36A 4DQSA 4BC3A 2GAGC 3OHRA 3MUVP 3IUCA 1FE4A 3DRSA 2DXFA 4ISFA 3KVGA 5FPNA 3OYAA 1H0HB 2CPYA 4KHRA 2R4FA 2XI2A 3O4WA 4P2SA 1FRHA 4JKGB 2YNHB 1SJ3P 4TU9A 4OIXA 3MR7A 3IP0A 2AZ3A 2UUCF 4BDZA 2VH7A 3ZXWA 4Z4GA 1BWFO 2MB0B 1OS5A 1JNRB 1D8ZA 4NO7A 2ZH7A 3Q86A 4HTUA 2OTLN 5M2RA 1EQMA 4YY3F 4C0HA 3Q24A 2OTJS 5BXIA 1EIYB 1R0BG 1VMBA 4PRFA 5AQJA 1HI1A 1VBZA 4F4XA 1HWUA 4MAKA 4ALZA 1M90O 3DC2A 3M8SA 4UY8T 2PA8D 4JI8K 4ID5A 3GE9A 4JI4J 2ACMA 1B99A 5C24B 2DGVA 2P9PA 1FNOA 1HPMA 2F63A 1UJ4A 1RTJB 4EZ9A 1LWCB 1OYDA 4HLBA 4O0IA 2E5GA 4JKDA 3NGRA 3V6KA 3RRKA 1XNQJ 4U67Q 2LU1A 3EZ5A 1JWWA 2R2UA 4LF6K 2KDOA 4CECA 4WK1A 4OLPA 1S0MA 4C2MA 1LQ9A 1YJ9S 1HHSA 4G9ZA 3OTOF 4F2RA 5IQQA 1ZOTA 3V6HA 1R8AA 3BSAA 2ZFHA 2E2PA 4LF8F 4HHJA 4PG7A 3TEHB 4DV5F 2QLJB 2EBGA 5L1KA 5CA5A 3UKUB 4DR5J 2ZBRA 4NL5A 3BKUA 3R3TA 2YKNB 3A5MC 2R8KA 4M1KA 4CLKA 1NLVA 1KAZA 3FZBA 3V6DA 1KVIA 2RILA 4JAXA 4FM2A 3TA0A 1A7GE 4KB0A 4LF9J 4URGA 4I64A 2E5IA 1SJ4P 1GQEA 2W1BA 2VFVA 4NB4A 2ZH3A 5C0YA 5CH7B 4KAZA 4FF1A 1XC9A 3KNAA 1BUXA 2DRBA 3KJQB 4OYWA 3V4IB 1WLJA 3V9ZA 2RQKA 2WRMA 4FP9A 3G82A 4X66J 1L3UA 2LQ8A 4KJIA 2HNDA 4B3TJ 5KFUA 3OA9A 3CJSA 1NSAA 3D45A 4OZJA 4WYLA 3POTA 5M1QA 1UVLA 5A2QU 3D66A 1U24A 1VC6A 3HPOA 3LP2A 1RT5A 3R1LA 3RB6A 2A40A 1NOZA 5E3QA 2NRXA 2DD8S 4UUXA 3BGRB 1NEEA 2KH9A 1ASVA 2OFHX 4KC5A 1DRZA 1F21A 1LCUA 1WSFA 1WOPA 5KOXA 2QSWA 1MNEA 3T5HA 4ZLLA 4J9RA 3LP1A 2CKWA 4ANEA 2ZJRL 5JS1A 4RUAA 1Q53A 3UE5A 1EXQA 2F9TA 1NK8A 5HK4A 3TZZA 1VYAA 1NKBA 2CQCA 3C66A 2D41A 4EO6A 1X7VA 1CLFA 1WDTA 4OX8A 1Q4RA 2DNNA 4K59A 5KRTA 1RA7A 4CF1A 8RUCA 4E7IA 1VGYA 2QKKA 4BR0A 2NS1B 5AQMA 5AZIA 3C3LA 1N34F 3MM7B 4L8RB 2J0XA 4F4WA 2C2RA 5C12A 3OUYB 2LQJA 3LUYA 3O3GA 2PN6A 3D6MB 3EICA 2UXDF 2HLTA 3KK2A 3MDFA 4OZ1A 1RT3A 3P45B 5ADZA 1FRXA 3MMCB 1BWEA 3NAIA 4FXDA 4M42A 2QX0A 2JWNA 4KR0B 4IOCQ 4MMOA 3FQLA 4J9LA 4BRIA 3HZGA 5IT9Y 1Q18A 5KG7A 2YWEA 3BS9A 3DOMB 2ASMA 1T11A 1YHQS 1IR1A 3ID8A 2P9EA 3M6XA 3SDEA 2QC3A 3UCZP 1IQTA 2HQDA 2ADCA 4RW7A 3ITHB 1YAGA 1J5EF 5L8RC 4ECXA 3OJSA 5DLGA 1MWMA 2VDIA 1TYQB 2YV0X 5BYRA 3D1QA 1EWQA 3AQOA 1RBAA 2O1PA 1NOYA 3C14A 2VQEK 5AQNA 5KFOA 2EXUA 2MZQA 2R2RA 3PW0A 5KFBA 1KVKA 5F41A 3L0QA 1N36F 4IOAQ 3AVHA 1S1VB 3SCJE 3SUNA 3CGIA 3VQ7A 3CDBA 3FE1A 3HCXA 4AM6A 3OLAA 1XBWA 3IDHA 2WB1D 3VAKA 1UKUA 4LRFA 3CERA 4OX9F 1AZSA 4YOWA 1HLWA 2GIRA 4CYUB 2CZVC 1I6JA 5F2RA 4DSFA 1X0FA 3TQ1A 3HM8A 2BQ3A 3O5TB 4A8XA 3KLFB 3LOUA 5KPTA 3P49B 1W97L 5KFNA 3CXCR 2DEJA 4M5HA 1BL3A 3FRYA 2O8EB 3TZYA 2DNHA 1H7WA 2WHOA 4BE0A 3RAXA 1KHVA 4ZVQB 2GV1A 3GLJA 3NF7A 6FDRA 2ZKTA 2VOOA 4F2SA 1RJJA 2VC1A 3SSRA 4EFAC 5KT7A 1FERA 1VQPS 2J6SA 1AA1B 1OWXA 2QMWA 3UI3A 3VQDA 2C2DA 1SZ2A 2K2PA 1RHJB 4CH1A 7FD1A 4JKCA 3MFIA 4FWMA 2ZBQA 1ZBSA 2GWKA 1BC6A 2DNKA 4JYAF 3FFKB 3K2PA 3IAS9 4F0MA 3KKSA 1BD6A 1QLNA 5AZJA 1U1LA 4BVPA 3L2VA 2RU9A 3M8RA 1CG2A 5KG2A 3HHEA 2YHYA 5DQIA 2HHSA 4HTLA 4G1QB 4A8QA 1GT8A 4E98A 1HW8A 5I42A 1PILA 2EK6A 1VK8A 1R3NA 3GYGA 2XMAA 4O4RA 3ILOA 3SQOP 3LAKA 5AQWA 3BO4A 1RA6A 2EBEA 3I33A 5IWAJ 2G1DA 3DM2A 2IDEA 3DGPA 3G87A 2E5JA 3H7HB 4DBQA 2IMOA 3EL2A 4BRLA 2UUAJ 2BXJA 4LRDA 2D69A 3ENVA 1VCTA 1KAYA 2VFTA 3QIPA 3IA0A 2CRLA 4GKJF 5I3UB 4RW9A 3WNEA 5CHIA 4MKAA 3NNCA 4F4AA 3G10A 1UVIA 3CCSN 1TFYA 4DR4K 3NP5A 2PIIA 3E01B 2FVPA 2MKCA 1LWFB 1MN7A 2V2QA 2AGQA 3SFUA 2ZITA 3TX0A 2XMTA 4HT5A 3KJVB 3HVWA 2NXEA 1RWXB 3VA3A 1TGOA 1VQ4N 4WF9Q 1F0XA 3BUZB 4Z7CA 4LFBJ 4OPHA 5E7OB 4HEA9 1WOQA 4WYWA 3FCHA 1U1OA 1EKRA 4K4XA 2DPIA 2HFZA 4ZIVA 1RHQB 3VQCA 3KMSA 1ZETA 1U2VA 3CD6N 5JMVA 1QTNB 1U6ZA 3HHLD 1AROP 4CH0S 3F0NA 3PIOQ 1URNA 2ZH5A 4DPWA 1NSQA 1FO1A 4Z7YA 1RDCA 2ZE2A 4MIBA 3IAM9 2DH8A 3PM9A 1B92A 3QESA 4X62J 2YKPA 3MEEB 2FXUA 3A4TA 2HBZB 3LGHA 3C7NA 4DR6K 2E4LA 2W6LA 4KHPF 3BY5A 3OXFA 2OP5A 3DLGA 1VDHA 3P38A 4O5BA 3MF5A 2CG4A 2PO4A 2VHGA 2W42A 2BJDA 4GO5X 1RWWB 4RR5A 4ZP9A 2H65B 4DV6F 4GMKA 2FY8A 1WC4A 2CADA 3MN7A 2CVIA 4U7UK 2VWKA 1TL5A 1PYTA 2OHDA 3ZT3A 2MZTA 3T1HJ 4OKEA 2QIFA 3K8WA 2HBJA 2ZWHA 2VQFJ 1ZA1B 1JNZB 3HDSA 5HQLA 1TV6A 3TTDA 4O3QA 4O0NA <