3L4QA

Structural insights into phosphoinositide 3-kinase activation by the influenza a virus ns1 protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
SVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into phosphoinositide 3-kinase activation by the influenza A virus NS1 protein
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/protein binding
molecule keywords Non-structural protein 1
total genus 31
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3l4qA00
4OPHA 3O9RA 3L4QA 2GX9A 3KWIA 3D6RA 3M5RA 3EE9A 3P31A 3RVCA 3EE8A 3F5TA 3P38A 4OPAA 3P39A 2KKZA 2RHKA 3O9TA 3O9QA 3KWGA 3O9UA 3OA9A 3O9SA
chains in the Genus database with same CATH superfamily
2FBTA 4CJ4A 4BE0A 4HTLA 3ZSOA 3C0BA 4BR4A 3L3VA 4MO5A 3P1GA 4FJGA 5J1EA 4IOAL 3M8PA 5HLFA 4OJRA 4FLYA 2DTUA 1TK5A 4BDYA 1K8KB 3G6EN 4A2AA 1JXBA 2YHAA 1BQNA 2HHHK 1K73O 4NCBA 3ZSXA 5C0YA 2A3ZA 1SKWA 2O8DA 4RW9A 4HTUA 4DV0K 3IRXA 3BF1A 4KH6A 4DCHA 4ID1A 4BGAA 2B6AA 1NU0A 3ZX2A 5M1KA 4JK7A 4YOTA 5AJ3K 1FXXA 2KTQA 4JKEA 5GAEP 4CHOA 3TAPA 2QKKA 3DOKA 1C0FA 2XY5A 3S41A 3SI6A 3P4IA 2P9NB 4KHPK 1C1CA 5JVHL 2A1SA 3K5LA 4DQIA 4RW6A 1U2VA 1NK0A 2DPNA 2E2QA 3MXIA 1M90O 4JKCA 1F21A 1RFQA 1TAQA 4Y1DA 1HRHA 4DV6K 1L5UA 5AQHA 4B1XB 4FK0A 4M3WA 3MEDA 2KKZA 1FJGK 1QQCA 3AGRA 4DR5K 1IG8A 1T44A 2I7PA 3HTVA 3QBWA 4WCEL 1RT4A 4Z4HA 4C8LA 3SJHA 4FJXA 3C7NB 1WNSA 1Q82O 4XH4A 3PY8A 4C8OA 1W97L 2IVPA 4W5NA 4BG8A 2A5XA 5SZTA 5M1FA 4DTOA 4CHNA 1OKJA 1ITGA 2HBJA 1YJWN 1ASWA 2E2NA 3AGKA 1SKSA 3VQDA 4B9SA 2I7NA 1X9JA 3QIOA 5BR8K 2P9IB 4XIUA 3L4QA 3VN5A 4CZEA 4IOXA 3SV4A 4JK9A 5BN8A 4KTWA 4CECA 3A8YA 2OA8A 4DHYA 2F4VK 1XNRK 3D2EB 2VG6A 4Y1CA 4OLAA 1QZ6A 3K5OA 4F2RA 1VQ8N 3VQBA 3AVCA 1DLOA 4EFHA 1N32K 3W3DA 4I7FA 2PAVA 4CGHA 2CGJA 3DXMB 5DM7L 3RR7A 4CHYA 4MDAA 3T3FA 1TKDA 3T7ZA 1ASUA 1S6QA 4JEPA 5DK5A 2V52B 5DM6L 3TSQA 2VQFK 1HPMA 2NZTA 1K8AO 2A6AA 2PYJA 4HCBA 4CJEA 1JLAA 3TU5A 5HRNA 4H5WA 2VWBA 4AHRA 1TKTA 3KLEA 4CF0A 5EVZA 1FK9A 2Q1NA 4PKHA 4DTPA 1KFSA 3IS9A 4N76A 4M3UA 3RR8A 5LJWA 5FLXO 2Q0RA 4J8FA 3GBTA 3ZT0A 3CPWM 2YI1A 4BGBA 1NGIA 4DSIA 4DV5K 1N36K 3ENBA 4CFAA 4B1WB 4BROA 5GINA 1VSJA 3SMPA 4BRGA 1HX1A 4M3YA 4CJLA 4J2AA 1WAFA 2JWLA 5AZJA 5CZ2A 2D0CA 1HNWK 2P9PB 3LDOA 1D8YA 3MCPA 4GW6A 4YOYA 2EX3A 5KGWA 2IIRA 1BL3A 1RGIA 4K8XA 3MK6A 3A5NC 2BGGA 3BZCA 1RDBA 3CJ1A 3H6EA 4RTFD 1I3AA 3SAHA 4I9LA 5BRDA 1YXQA 3SBGA 5KQ8A 2P9PA 5J2NA 2BE2A 2ZF5O 5AQJA 4RW4A 4CJWA 1KAYA 2E2OA 4IBNA 5FPDA 4DLGA 1QHTA 3VENA 2G8VA 4IEIA 3WEEB 3N4QA 4BG9A 5AFUA 1MDUB 2AP1A 5B8HA 4WFAL 1Z6RA 3AA5X 3WXLA 5KGXA 1YI2N 4IDHA 3QETA 5A2QO 2E4LA 1D5AA 1IBLK 5EX5A 1L3TA 1OH7A 3S3MA 4U67L 1SL0A 5M1OA 2YKNA 3NE6A 5BN9A 1S1TA 3LM9A 3SUNA 5J2MA 4JKGB 1GLCG 2P5OA 1NK9A 1E3MA 4I2PA 4K0KK 1Y64A 4DQPA 1JXEA 3KKSA 1RTHA 3ZETB 3O9SA 4AM6A 1NM1A 4CZHA 4CE9A 4HVJA 2O8FA 3WXIA 4FWRA 4DQQA 3RMAA 3BP8A 1NGDA 3UE5A 3KHYA 4CZLA 1EKEA 1LOTB 3G25A 4ILGB 4OKKA 1NKBA 5GIPA 4M3ZA 1E4GT 3QFPA 3HSCA 2X6SA 3ID8A 4FWMA 4PY5A 3LP2A 3VA3A 4FK4A 1EXQA 3HO1A 3LZIA 3A5OC 3G0ZA 2RKIA 4GVMA 4O44A 3MN7A 5HP1A 3QFUA 4GV3A 3K9JA 4CZGA 5AQTA 3V9UA 4C8NA 1NK4A 1UA0A 1QSYA 3HOTA 1HYSA 3CERA 2DFHA 5C2DA 1ZBFA 4B3TK 4JKAA 3NH2A 1CLQA 3VTIA 4YHHK 4LF5K 4M63C 3DXKA 5F0XA 3NBPA 5GIOA 2F96A 4FJHA 3HVTA 4YOWA 5LL6Z 3K5MA 5AQUA 2IAJA 3MXMA 4O0IA 3TAMA 4CZIA 2D0AA 5FPMA 4GV6A 2GWJA 2Q31A 4CJRA 4FJMA 4CJFA 1VRTA 3PIOL 3CPEA 2HHWA 1J5EK 4DSJA 4O8UA 2XY7A 2NLXA 3OYNA 3GG4A 2YHYA 1RBTA 5FPNA 3CFOA 4FJIA 3AVHA 5AQFA 1G15A 1YVUA 3ZT4A 4HUFA 5AQRA 1VSLA 3H1VX 3HM8A 4BR9A 2CH6A 4ELVA 2WUSA 1ZBSA 4R79A 3U8XA 1WSEA 1KD1O 4CVNE 2BH1A 1RTDA 1QVFM 4DR4K 1NBWA 1LWFA 4CF1A 2GBZA 4J2EA 4E7IA 1WSFA 3Q7BA 2A40A 4O5BA 3TPQA 3CC4N 3QMLA 2ZWHA 1IKWA 3KK1A 3CCEN 4CEZA 3ID6A 4DUZK 4FW2A 5CY4A 3HOSA 4PL7A 5GADP 5F2RA 4ISFA 1IBKK 1GOCA 1T7PA 2F9TA 4DR3K 3VEZA 4KTZA 2DY4A 2ZGZA 2O8BA 1QE1A 3QBXA 3LL3A 2QI2A 3MDQA 1EWQA 3HZ6A 4KTQA 2QXLA 2FSNA 3BUZB 3O80A 3RMBA 2P9SA 4BC3A 4GNIA 5ADXA 3T19A 3CIPA 3VEYA 3K57A 4IJNA 3E9LA 4JN4A 4FO0A 4ELUA 4GKKK 3VPZA 1NGEA 3RRHA 4YOUA 3DOLA 4DFJA 3DRRA 3RRGA 3DLKA 1S9EA 4Z4CA 2UUCK 5IT9O 3KK3A 3C6UA 3I8DA 4A59A 4BRLA 4CGIA 1VK0A 2Y1IA 3P39A 4LFBK 2UYTA 2O8FB 5AQPA 3U9DA 2D0BA 2YX6A 3ZETA 3PX6A 3SUPA 3G10A 3AO1A 5E84A 4CZMA 1S1XA 4LF7K 4LF9K 1WAJA 4CCHA 4U7BA 4OPHA 3VQ6A 3DWLA 2YV0X 3M8RA 4KAZA 1QVGM 3AVJA 1KAXA 4BR2A 3NF8A 3F73A 1GLJO 3VEXA 1A5WA 3EYZA 3O5BA 2F8SA 1BG3A 4LH4A 4B8CA 3AA2A 1UA1A 4CERA 1YAGA 4OX9K 5FRNA 2A1RA 3SMSA 4MQ3A 4AQYK 1U49A 2HNZA 1KSPA 4DR7K 3KLFA 3HM9A 2O4GA 3LDLA 3VETA 3THYA 1T03A 1BQMA 4KBOA 4H5VA 4KV8A 4E0DA 3D2EA 2VQEK 4DLEA 3A2FA 5C2FA 1HMVA 2QWMA 1JKHA 1ATNA 4OLBA 2G8FA 3FZHA 3ZT3A 1QQMA 3F5TA 2HVIA 1EO1A 3CCMN 4ELTA 3HXMA 5AZJB 1S1WA 3ALYA 4CESA 1LW0A 3KZBA 3CM6A 4FLVA 5JLHA 1K9MO 3OW2M 3CD6N 2OPPA 5K14A 2YJEA 4ICLA 1QHAA 3AO3A 2NRRA 5I9EB 4KRFA 4CJSA 3ZX0A 1O13A 3OYLA 4Z0UA 3CCRN 1KFDA 2YCHA 2ZD1A 4PUOA 1BWFO 5GAGP 2E1YA 2IS3A 2J4RA 2QK9A 1NJWA 3M1FA 1QTMA 3IAYA 3L2WA 3HK2A 1BU6O 1TUYA 1JLBA 3QINA 3QEVA 4F9OA 2UXCK 1O1WA 3KWIA 3AV9A 5EOYA 3ZLJA 4LFCK 1JLCA 3S3NA 3LWLA 5AQLA 1BA1A 2EWSA 1ASVA 4GVEA 3ZSRA 4BRMA 5CYQA 4TSXA 1NGGA 1VSHA 2RHKA 1BCMA 4DS4A 4BE2A 3HRGA 5KTQA 4FM1A 4FLWA 3CYMA 3PUFA 4CK2A 3QEIA 3BZKA 2HVHA 5KPTA 1VQ7N 2KHOA 1U4BA 1HJRA 2V7ZA 3MMVA 1XUPO 4WYBA 2Z1HA 3D0PA 1FW6A 3NHGA 3WNEA 3RSEA 3DRSA 2P9IA 3V6DA 3KTQA 2O8EB 4FOIA 2DFFA 4MDBA 4FCYA 2D1KA 1YVNA 4JI4K 3E66A 2E8AA 1N33K 4BACA 2LSNA 4QS7A 5MLCQ 3QIPA 4G9ZA 4MLEA 4FLTA 4K43A 2QM1A 3B6PA 4FL9A 5AQWA 1W9HA 4NCAA 3DMJA 3C7NA 1KVCA 4FZZA 4EAHD 2E1ZA 3MECA 3ITHA 5HRRA 2ASMA 2D5RA 4FPAA 2ZGYA 4QS9A 4NXMK 1RT7A 3AA4A 3BGRA 1Q18A 4O55A 4GKJK 4AHSA 1VSIA 4CJKA 2Y1JA 1IBMK 2AJQA 1WLJA 4IG0A 4V19S 1Q86O 1NGBA 4DTRA 3PSFA 4X65K 3R9PA 3OYEA 1WSJA 1NKCA 3CC7N 1J53A 3O4QA 2F9WA 1ZBLA 3D2FA 1LV5A 3SPZA 4FPBA 5AZIA 2QEXN 3R1XA 1REVA 3LANA 4FSVA 3VQ5A 2ATQA 3TTFA 4B1ZA 3OS2A 4FJ8A 5CE3A 2QW9A 3CFRA 2ASPA 3MN6A 3J7YP 1X1PA 2ZJQL 3I0SA 3DI6A 4B9NA 3RSEB 4QS8A 4IEEA 2YHXA 1RDAA 2JWKA 1YT3A 2ZJRL 2QWPA 3AO5A 4Z4IA 3EZ5A 4CGFA 3PO4A 4CI6A 1BDGA 4FWSA 4CJQA 4IG3A 3JAMO 1T8EA 4B9VA 1RDDA 2KW4A 2HF4A 1IO2A 4H0VB 3L2RA 4DSEA 2FLOA 4IZ9A 2GV9A 5CYMA 3I56N 3FE1A 1XNQK 2W6KA 3AVNA 3LPUA 2VWKA 3EEQA 3CMEN 5T7BA 1W2BM 3L0QA 3K59A 2Q0UA 3EO3A 3NVMA 5AFUH 1GLDG 2F8TA 3R8EA 4DR1K 4DV2K 2Q2RA 2B4JA 1M1KO 4FYDA 2P9UB 1B9DA 4LH5A 1DEJA 4H0PA 1ZC6A 4BDZA 4DKWA 1HLUA 1J5OA 1VQ6N 1MWKA 4CEBA 3PSIA 4XH5A 5AQKA 2BTFA 5FROA 3DXMA 5JS1A 3UKUB 2PBDA 2GUPA 5AQVA 1VSEA 5TKYA 1DGKN 2HMPA 3C65A 3OYAA 4KFBA 2P9SB 4F4KA 2CH5A 3ATVA 3IUCA 4PKGA 4BRPA 3L8BA 4FJJA 3R3LA 3ZSQA 3IKMA 3ZT2A 1TK8A 3OYCA 4CGDA 4KO0A 4DV7K 2WFBA 3WUHA 3TARA 1JLQA 2A41A 4OGCA 1XHZA 3WNGA 3HP9A 1QS4A 4F3TA 2ETJA 3VQQA 1OH5A 4X64K 5BPNA 3VGKA 1WSHA 2Q36A 3RMCA 4GY2B 1ZBUA 3MEEA 2UUBK 4JI0K 2NRZA 4H03B 4H5RA 3ZSVA 4X66K 1NG9A 1LWEA 1GOAA 3WXKA 2XY6A 3U9ZA 4EZ9A 3C6TA 1D9DA 4Q5VA 1IH7A 3DM2A 3CJ9A 2ITGA 4CD3A 3G4SN 4BWMA 2WBNA 4CEOA 4A57A 3TR8A 4JKDA 1ZXOA 4O0JA 4DTUA 4JD2B 3QNNA 4ISGA 1NK6A 4M42A 4C23A 4RW8A 3JXUA 3OS1A 2GELA 3VQCA 4WQ5A 3IDHA 3DLHA 4FM0A 5DMRA 4YY3K 5BRHA 1TL1A 3B8AX 4CJ5A 4BRNA 2PYLA 4M7XA 3LP3A 1KCFA 4FVMA 2P9NA 3QLHA 4IFYA 4M7YA 4AHUA 2ZJPL 2P1JA 2HHQA 2VYPA 5C15A 1GOBA 2P9UA 1GLBG 3KK7A 3EE8A 4M3RA 3OYJA 3F9MA 4WF9L 4BC5A 4B9TA 3FFKB 3T1AA 4CJPA 3DRPA 3EKSA 1BISA 1OVYA 1TL3A 3SQ0A 1C1AA 1S1VA 3ZT1A 4BRIA 5C10A 1NK8A 1GLAG 5C12A 2HHVA 1RT1A 1JCGA 4FJNA 1N5YA 3EE9A 3E1YA 3V1RA 1NGJA 2X74A 3QERA 5LMNK 1EQYA 4WE1A 4Z4EA 3MWPA 3MN5A 1NK5A 4DB3A 3VOVA 3R6MA 1RDUA 1YJNN 3E01A 5HL7L 2IDOA 2NRTA 1KQSM 2Q3SA 3L3UA 4K42A 4DFPA 1TGOA 3AVKA 2HHSA 3ZEUB 3CFPA 3LDQA 1HKGA 3QB0A 4DR2K 1FKOA 4FVUA 4FWKA 1I94K 3OHRA 1QSLA 3M5RA 3NCIA 3J81O 2P5GA 1N34K 2HHTA 2KLAA 3O1BA 3Q7CA 4MFBA 4JLHA 3HYFA 4OKEA 1WBDA 4A62A 3K58A 1JCFA 3MN9A 3HSTB 1DKGD 3NDKA 3QEWA 5D3GA 4JRQA 5AQXA 1VRUA 4BC2A 4PHTX 2X78A 4H0YB 2KZZA 2EHGA 1NJIO 3ZYYX 5IWAK 5J2PA 2GX9A 4E1NA 3WNHA 1ZBHA 4E7JA 3SV3A 3KD5E 3V9ZA 3BF3A 1NGFA 4E1MA 3VTHA 3RTVA 4AILC 1QQOA 1EX4A 3KLIA 3S3OA 4BR0A 4E1JA 3THXA 3VQ4A 3CMAN 2JGUA 4H8KA 3O4WA 4W5QA 1NK7A 4YOVA 3DLLL 3MX2A 1ATSA 4B1VA 3SNNA 4FLXA 1J9AA 4CF9A 3J8AA 4KHSA 5AQGA 3TANA 4BRFA 3MCAB 5J2QA 3SZ2A 4CK3A 4IFVA 1U04A 1WSIA 2P51A 3T69A 5BRFA 3EN9A 3NH0A 5AQZA 4DFMA 3NGIA 2G8HA 4LSNA 1HR0K 3UKUA 1IKXA 3H3OB 1SUQA 3EKUA 3OYHA 1S1UA 3D6RA 3OBWA 3PLAA 4CBUA 3OYDA 2OCEA 5AQYA 4CW7B 2A42A 4FWPA 4CEQA 3VEOA 2QWLA 3SK3A 3NAEA 4JI7K 4KH5A 1NJYA 2YNHA 1RTIA 3OA9A 3WQTA 3VQEA 1RDWX 1IV0A 3KLHA 3TSPA 5CHIA 5CZ1A 4BQZA 4KH4A 1VQON 4JI2K 4CEAA 1X3NA 1X3MA 3CJ7A 4MLHA 2VCPA 1VHXA 1KTQA 4YORA 3AVBA 1BIZA 1RT5A 1VSDA 5H1SQ 4IO9L 4HUEA 4DV1K 3OBYA 4C8KA 3CQXA 3DYAA 4CHZA 1MU2A 2O8BB 4ILHA 2FF3B 5ADXH 4KKOA 2OANA 3M6GA 3UKRB 1WN7A 3KLGA 4H5NA 1ZYQA 4A5AA 3HPHA 1XWLA 3K5NA 4KI6A 4CFBA 1FKPA 3O8MA 3AY9A 3VEWA 2CGLA 3AO2A 3EL2A 1VSKA 1YUWA 1TAUA 1WSGA 2NRWA 2Q97A 3CI5A 4BE1A 4HCCA 3O3GA 4HUGA 1WUAA 3PX0A 2ZE2A 1TYQA 4OKJA 3SBTA 3CCSN 4DR6K 4CF2A 4BRCA 3A5LC 3O4NA 3I33A 4K25A 1Q81O 3L2QA 4LY7A 2HNYA 1WBBA 1C0TA 4Z94A 3OS0A 1KXPA 1RT6A 1VQ5N 2RE2A 4DTMA 4F3OA 4YDUA 4NXNK 4DSLA 1HYVA 3DAWA 3OYFA 3PO5A 4QOZB 1HPZA 4KHYA 3EY1A 4JKBA 3OVNA 2Z1IA 4CK1A 3BEXA 1VQ9N 4H0TB 2H3GX 1S3XA 3J7AP 4FLZA 3TTDA 3WQUA 2ITMA 3HPOA 3DXKB 3CCQN 3WT0A 4BRQA 3LDSA 3WXMB 3ZEUA 4LFAK 2NRXA 4E89A 1S6PA 4B9LA 4UQGA 4KHQA 3IMXA 1I39A 1VQPN 3AVIA 3O1WA 3CC2N 2FBVA 4AM7A 2FBYA 3SQ2A 3QO9A 5FRMA 4WFBL 2PFUA 3ENHA 4JS4A 3G71N 2QWNA 1TV6A 2UUAK 3LZJA 5KRTA 4JI5K 4IXCA 2ASOA 3HL8A 1LAWA 1RNHA 4CZJA 3O3HA 3ASMA 3B6OA 3NF9A 4L3QA 1HKCA 4WFNL 5JVGL 3TTCA 1V4TA 4B9MA 2NNWA 4N5SA 3V9SA 5LMUK 3HVRA 2YNFA 3MAQA 1YTUA 4JV5K 3EZWA 1BHLA 1JL2A 5AQOA 3NH1A 1VQNN 4B3SK 1GLFO 1BA0A 3D45A 1RCHA 4WQ5C 5I3UA 5C24A 3KKRA 4K8ZA 3DLGA 3CCVN 3IFRA 1NKEA 2OTJN 2VG5A 2P9LA 4CEEA 4BC4A 3MXJA 4BRKA 4BQLA 2PY5A 4JI8K 4OPJA 4DU1A 4OPAA 4OPKA 3LP0A 4PKIA 2V51B 2B5JA 4Y0WA 1UWBA 1U48A 5HBMA 2IC3A 1VQLN 5AQSA 1C1BA 2KQ2A 4CGJA 4IDKA 5BPMA 1R0AA 2X6NA 3KIOA 4M3TA 2NRVA 4LF8K 2HBMA 3L2VA 2R7YA 3H08A 1NMNA 3O08A 3ENOA 3CJBA 3PV8A 2D4WA 2GTDA 1GLEG 3A5MC 1YTAA 2VGMA 1RBUA 1SAZA 1NMDA 3NGZA 1G99A 1KRPA 4B9UA 1RBVA 1NGAA 3ULDA 4N56A 3V1QA 3CG7A 3SAFA 1JLEA 3RVCA 2IGIA 5EY4A 4UY8O 3RMDA 4KHNA 3OJUA 1P8ZA 2OZMA 1B92A 4FXDA 3ULEB 2HNDA 3LDPA 4IWVA 2G8WA 4FJ9A 4DV4K 2XY8A 4CFCA 4QCLA 4H4MA 4NLCA 4A5BA 3C6HA 3C95A 4DTJA 1P90A 3A0IX 5GAHP 4E7HA 3LM2A 4WQ4A 1RDCA 4BWJA 2FF6A 3HI0A 2RF2A 4A2BA 4FJ5A 3V9XA 4CIGA 4CEDA 4JNEA 3F2KA 2YKMA 4JS5A 1IG9A 1QZ5A 5AQNA 3NMUA 3M8SA 1IJJA 1XQSC 2YHWA 3NGYA 4LF4K 4FWQA 4N47A 4JAXA 1C0GA 1C6VA 3ULEA 2HF3A 4CGGA 4W5TA 3PX4A 3OJSA 4C8MA 4DQ8A 4YNQA 1WB9A 2VG7A 5CR4A 4XH1A 4JI1K 3P38A 3I0RA 3AA3A 5M1NA 1YJ9N 2CGKA 3AARA 5BREA 1OVQA 1S22A 3HT3A 5E41A 1S9GA 3LDNA 4A61A 1IKYA 3ISNC 3E9OA 4NO7A 1L3SA 3U6FA 1IKVA 2GUIA 2HBLA 3SUQA 3LP1A 4W5RA 1T3VA 4ZHRA 1Z25A 1A5XA 1D4XA 3L4IA 2GEMA 5TKWA 3ZX3A 1KLMA 3O9TA 1K6YA 4KI4A 3KWGA 1KAZA 1RTJA 4IJAA 1HKBA 2FBXA 1H1VA 3T1HK 3DLEA 1SS6A 4I6MA 3THYB 4GMJB 3DJCA 5FPEA 3GE1A 5AR0A 1SL1A 1EETA 3P31A 3OYGA 3VEVA 1HQUA 4LF6K 3CCLN 3CF5L 1J54A 3UKRA 4DG1A 3H3NO 2W40A 4K41A 3OYBA 4I6MB 1SQKA 1C0UA 3IG1A 1L3VA 1BCOA 4CFDA 1ZBIA 2QTDA 3WNFA 3KJVA 4NB4A 4DF8A 4DTNA 3KVGA 3THWB 3O9RA 2E5LK 4BVOA 1L3UA 5SWMA 1TYQB 4O8KA 3SQ1A 1U45A 2IVOA 4KB1A 3ZSYA 2E6MA 3MWTA 4CJUA 3ATUA 3GL1A 1NOYA 2P9LB 3NF6A 5KPZA 2O8CB 1NGCA 4EHTA 3VQPA 4R5PA 4JI6K 4B1UB 4PWDA 1NJZA 2KFNA 4RG8A 4I2QA 5KRSA 1QSSA 2I5JA 3AVMA 3U3GA 1VSFA 4C1NK 5BR9A 4AHTA 1Q7YO 1DTQA 3OTOK 4G1QA 2P9KA 1N8RO 5M1PA 4DF4A 3AAPA 3O6WA 3LAKA 5EU7A 1HNZK 1VQMN 4RW7A 5E26A 5LY3A 2UXDK 1ESVA 5FDLA 2VWJA 3VF6A 2YNGA 4O4GA 4FZYA 4IO8A 1CZBA 4DU3A 2P9KB 2ZQBA 3L2UA 4DS5A 3QEXA 1QQNA 2OYQA 3UB5A 2F7TA 4CIEA 2E20A 1VSMA 5HRSA 3AO4A 2HMIA 2D0OA 3K9KA 4DQRA 1NNEA 2O8CA 1C0MA 2Z1JA 4E7KA 3FGUA 4JHDB 4BRDA 4BY9C 1OH6A 3VERA 1XI1A 2QXFA 4YOXA 2IOCA 3M8QA 3C6AA 2UU9K 4DTSA 1S5JA 1TKZA 4B8AB 3QESA 1X9MA 4LD0A 3SPYA 4NCGA 4JKGA 1KVAA 2WOMA 4AF1A 3SLCA 4EP4A 4FM2A 4EP5A 3TABA 3TAEA 4BVPA 4ZTJA 4ISEA 2WC9A 2HB5A 1EWRA 3DLBA 4BR5A 3CXCM 1UOCA 5HOOA 1EP4A 2ZM6K 3LPTA 4Z4GA 3W0LA 3K2PA 1RBSA 3O9QA 4X62K 4DWIA 2OZSA 3BY5A 1RT3A 3KK2A 4JKHA 4NLBA 4BDPA 1SKRA 3LAMA 3OYIA 4KB0A 2Z1GA 4DSFA 3JS6A 1ATRA 3OYMA 3MEGA 4BREA 1NJXA 2FSKA 1BOTO 3K0SA 2IVNA 4KREA 3CCJN 5HROA 2HW3A 4DU4A 1RBRA 4DV3K 3HPGA 2WTUA 3AVGA 1TK0A 3GOIA 2O4IA 3VA0A 3CQYA 3I8BA 3ZCMA 1LAVA 1U47A 1E4FT 5HRPA 2QWQA 4FZXC 2HBKA 1XC3A 2VGNA 5C42A 1XC9A 3U4LA 4PQUA 3CCUN 1B9FA 1MA9B 4O5FA 4OVLA 3FFIA 3JSMA 4HHTA 4FLUA 4FWLA 2DFEA 2O8DB 1BI4B 1HNIA 3AVAA 3FZLA 1JCEA 3VF4A 1YHQN 3NFAA 1NGHA 1JL1A 4CZKA 4CJ7A 1NLVA 4AH9A 3BDPA 3NF7A 2W41A 1JLGA 3OYKA 2BUPA 3CM5A 1CXQA 3SCXA 4WQ4C 3FR0A 4BRHA 4CJVA 3LALA 1V4SA 3V9WA 3J7ZO 1U6ZA 2HOEA 3SJJA 1J6ZA 3H45C 4OGEA 1D9FA 1A5VA 1Z05A 4RWTA 4DUYK 1SV5A 1HNVA 3H46O 2HHXA 3CHWA 2YHBA 1HQEA 4LSLA 5M1QA 4J2DA 2JLEA 1NOZA 1XMQK 1R59O 4B08A 1BUPA 2W42A 1HYZA 3THXB 4FJKA 5JICA 4H0OA 3QNOA 5KPRA 3AVLA 4RCHA 4M41A 1MWMA 1KVBA 4HWIA 2KZMA 3LWMA 4CZFA 4CBWA 2G8UA 3SQ4A 3WXJA 5KI6A 3HJFA 3D2FB 1DTTA 1HNXK 4FWNA 4E7LA 4EIAA 3U3YA 1VAZA 4B1YB 3VQ9A 1LW2A 1Z26A 3AAQA 3RWUA 2NRHA 4J2BA 4KHUA 1LCUA 4FK2A 4FW1A 4ID5A 3O9UA 3F9KA 1XHXA 1WOQA 4CJ3A 3FLCO 4FOEA 3THWA 3VQAA 2NUBA 4H0XB 3JYTA 3TAQA 4DQSA 3VF2A 3SYZA 3CETA 4AHCA 5JMVA 4B3OA 4NYFA 1CZ9A 1Y97A 1S72N 2HSTA 4B3MK 1ILYA 2W6LA 1W0HA 5ELZA 1U2VB 3P83D 1TKXA 4FWOA 3CQ8A 3SAGA 2XRIA 4JYAK 4ZTFA 4JHDA 2HHUA 5F1XA 5C25A 4IFEA 4JKFA 1RILA 4B9QA 2BANA 3VMFB 3TWHA 3L6QA 1Q9YA 1YF5L 4YFUA 1SZ2A 1T6DA 4LC9B 1JLFA 3D7EO 2O8EA 3I55N 2G8KA 4W5OA 4FJ7A 2QWRA 2OPQA 2E88A 3AVFA 2WONA 2KFZA 1CZAN 4N41A 1N6QA 1CXUA 5AQIA 4NYNA 2PZSA 5KQDA 3V1OA 4KHWA 4MO4A 5EXWA 4Z4FA 2QWOA 3DLRA 4Q0BA 4F8RA 2OPRA 4GV9A 3P5JA 4QAGA 5JS2A 3J80O 4PA1A 4CD1A 1KC8O 1OH8A 4DMNA 5AQMA 3ZSWA 4EZ6A 5I42A 2FSJA 4H5TA 3MX5A 2G8IA 1NWKA 3VESA 2OPSA 1K8KA 3TI0A 3PIPL 2OTLN 3FZKA 4ILJA 3CJCA 1TUUA 5AQQA 4YDUC 2XHBA 1TVRA 4KPYA 1HUXA 4CF8A 1BGXT 5AZIB 2YJFA 1XMOK 4OO1J 5LJVA 1BIUA 4B3RK 2AA4A 4JD2A 1BI4A 3KD1E 4CBXA 4IKFA 2QA4N 3NVKA 1KLNA 4CEFA 3C94A 3FZFA 1GLLO 1X9WA 2GWKA 2RPIA 5JLFA 2FC0A 3TSUA 4DTXA 3VQ7A 3SUOA 1SL2A 3WEEA 1T6CA 1JJ2M 1W7AA 2D0PA 3GDQA 4CIFA 1Q8IA 3QDKA 1VQKN 4XEIA 4IOCL 3QICA 4FJLA 2YNIA 1RT2A 1LWCA 1T05A 3H1QA 2E6LA 3TAGA 1UAXA 4CHPA 1YITN 4BR7A 1YIJN 3ZSZA 4F2SA 3VGLA 1HJOA 3T1YK 4I9QA 3V4IA 3TAFA 4E3SA 1DT9A 3CJAA 2RN2A 1BO5O 1Q9XA 4JK8A 4DFKA 2V7YA 3FZMA 5BPLA 3HBTA 3UIQA 3E9PA 4DSKA 3THVA 4M3XA 4E19A 2QKBA 4JRPA 4C1NI 2XO7A 4CHQA 3S9HA 2UXBK 2FXUA 4EHUA 4M45A 2BDPA 4H4OA 3OY9A 2E2PA 4CJTA 4AHVA 1X9SA 3HP6A 4L8RB 4BRAA 4JI3K 3QEPA 3VGMA 3O3FA 3VQ8A 3V81A 1VQ4N 3M3ZA 3N4PA 4PL8A
chains in the Genus database with same CATH topology
4OPHA 3DWLA 3KVGA 3O9RA 3ZYYX 4BVOA 4HTLA 1QVGM 2GX9A 1KAXA 4BR2A 1GLJO 1TYQB 4O8KA 3VEXA 3C0BA 2IVOA 4BR4A 3O5BA 3MWTA 4MO5A 4U7BA 1BG3A 3BF3A 3ATUA 3GL1A 1YAGA 1NGFA 2P9LB 4IOAL 3VTHA 5KPZA 1NGCA 4EHTA 3SMSA 1K8KB 3G6EN 1QQOA 4A2AA 4B1UB 4BR0A 4E1JA 3CMAN 1K73O 3LDLA 3O4WA 3VETA 4C1NK 5C0YA 5BR9A 2A3ZA 4KBOA 4H5VA 4YOVA 3DLLL 3MX2A 3D2EA 1Q7YO 2P9KA 1N8RO 1ATSA 5M1PA 4B1VA 3AAPA 3O6WA 5C2FA 3J8AA 2QWMA 3BF1A 4KH6A 5AQGA 4DCHA 4BGAA 1ATNA 1VQMN 4BRFA 3MCAB 3FZHA 5E26A 1QQMA 3F5TA 3ZX2A 1EO1A 5M1KA 3CCMN 4JK7A 4YOTA 3T69A 5LY3A 5BRFA 1ESVA 3EN9A 3VF6A 4JKEA 5GAEP 5AZJB 1C0FA 3KZBA 5AQZA 3S41A 5JLHA 1K9MO 3P4IA 2P9NB 3OW2M 4IO8A 3UKUA 3H3OB 3CD6N 3EKUA 2P9KB 5JVHL 1QQNA 3UB5A 2F7TA 2E20A 3D6RA 2YJEA 1QHAA 3OBWA 1U2VA 2NRRA 5I9EB 2D0OA 2DPNA 2E2QA 3K9KA 3ZX0A 3PLAA 4CBUA 1O13A 1M90O 4JKCA 1RFQA 3CCRN 2YCHA 5AQYA 3FGUA 4JHDB 5AQHA 4B1XB 2A42A 1BWFO 4FWPA 5GAGP 2E1YA 4BRDA 2KKZA 4BY9C 3AGRA 3VEOA 2QWLA 3VERA 2J4RA 1IG8A 3SK3A 1T44A 3M1FA 4YOXA 2I7PA 3C6AA 3HTVA 3QBWA 4KH5A 4WCEL 1BU6O 3OA9A 1TUYA 3WQTA 1RDWX 3TSPA 5CHIA 4BQZA 4F9OA 4KH4A 3SJHA 4JKGA 3C7NB 3KWIA 5EOYA 1Q82O 4XH4A 4AF1A 1VQON 1W97L 2IVPA 3SLCA 4BG8A 5AQLA 1X3NA 2A5XA 1BA1A 4BVPA 5M1FA 2EWSA 4GVEA 4ISEA 1OKJA 2WC9A 1X3MA 3CJ7A 4BRMA 4MLHA 1NGGA 4BR5A 3CXCM 2HBJA 1YJWN 2VCPA 2E2NA 2RHKA 5HOOA 4YORA 3AGKA 3HRGA 3W0LA 3O9QA 5H1SQ 4IO9L 2I7NA 3OBYA 1X9JA 4JKHA 3CQXA 4NLBA 4ILHA 5KPTA 2FF3B 1VQ7N 3JS6A 5ADXH 1ATRA 2P9IB 2KHOA 2OANA 4BREA 2FSKA 3L4QA 3M6GA 4CZEA 3UKRB 4IOXA 1BOTO 2V7ZA 4JK9A 5BN8A 2IVNA 3MMVA 3CCJN 1XUPO 3A8YA 4H5NA 4DHYA 4WYBA 3D2EB 4A5AA 1QZ6A 3GOIA 3O8MA 3AY9A 3RSEA 1VQ8N 3CQYA 3VEWA 2P9IA 3I8BA 2CGLA 4EFHA 3EL2A 4FOIA 4MDBA 1YUWA 3W3DA 2D1KA 2PAVA 1YVNA 3DXMB 1E4FT 2CGJA 5DM7L 2NRWA 3E66A 2Q97A 3CI5A 4MDAA 2QWQA 2E8AA 1WUAA 2HBKA 3T7ZA 1XC3A 1TYQA 3SBTA 2VGNA 4JEPA 4QS7A 5MLCQ 3U4LA 4G9ZA 2V52B 3CCUN 5DM6L 4MLEA 3TSQA 1HPMA 2NZTA 3CCSN 1MA9B 4K43A 4O5FA 4BRCA 3A5LC 1K8AO 2QM1A 2A6AA 4FL9A 5AQWA 3I33A 4FWLA 4K25A 1Q81O 3TU5A 3C7NA 4EAHD 4H5WA 2E1ZA 2VWBA 3FZLA 1JCEA 3VF4A 1YHQN 5EVZA 1NGHA 2ASMA 2Q1NA 4CZKA 4CJ7A 4FPAA 1NLVA 2ZGYA 4PKHA 4QS9A 4Z94A 1KXPA 1VQ5N 2W41A 2RE2A 1Q18A 4YDUA 2BUPA 5LJWA 3DAWA 4WQ4C 2Q0RA 4J8FA 3FR0A 3GBTA 4JKBA 4BRHA 3CPWM 1Q86O 2YI1A 4BGBA 1NGBA 1NGIA 3ENBA 3BEXA 4B1WB 4BROA 4H0TB 3R9PA 1VQ9N 5GINA 1V4SA 2H3GX 1S3XA 3SMPA 4BRGA 1HX1A 3TTDA 3WQUA 3J7ZO 2ITMA 3CC7N 3DXKB 2F9WA 1U6ZA 3WT0A 2HOEA 3D2FA 4BRQA 3CCQN 3WXMB 3ZEUA 2JWLA 1J6ZA 4FPBA 5AZIA 2NRXA 2QEXN 3H45C 3R1XA 5AZJA 1Z05A 4RWTA 3IMXA 4FSVA 3H46O 3TTFA 4B1ZA 1VQPN 3CHWA 3O1WA 2P9PB 5CE3A 5M1QA 3LDOA 3CC2N 3MCPA 4AM7A 2QW9A 4YOYA 2ASPA 3MN6A 2ZJQL 1R59O 2IIRA 4WFBL 1RGIA 2PFUA 3MK6A 3A5NC 3ENHA 3RSEB 3CJ1A 3H6EA 4QS8A 3G71N 2QWNA 1BUPA 4IEEA 2YHXA 4RTFD 3SAHA 4IXCA 2JWKA 2ZJRL 5BRDA 2ASOA 1YXQA 3SBGA 2QWPA 5JICA 4H0OA 2P9PA 5KQ8A 4RCHA 5KPRA 4CZJA 4L3QA 4CI6A 1BDGA 1MWMA 4FWSA 1HKCA 4WFNL 5JVGL 4HWIA 3TTCA 1V4TA 2NNWA 4CZFA 2ZF5O 4CBWA 5AQJA 3WXJA 1KAYA 2E2OA 3D2FB 2HF4A 5FPDA 4H0VB 3VENA 3EZWA 4FWNA 4IEIA 2FLOA 3WEEB 4IZ9A 1VAZA 5AQOA 4B1YB 4EIAA 3I56N 3AAQA 3FE1A 2NRHA 3N4QA 1VQNN 4BG9A 1LCUA 5AFUA 1MDUB 1GLFO 1BA0A 2AP1A 5B8HA 3CMEN 3O9UA 4WFAL 1Z6RA 1W2BM 1WOQA 3L0QA 3WXLA 3FLCO 2Q0UA 3EO3A 4FOEA 4WQ5C 4H0XB 3NVMA 5AFUH 1GLDG 1YI2N 4IDHA 3VF2A 3IFRA 3CCVN 2OTJN 3R8EA 3CETA 2P9LA 2Q2RA 5JMVA 1M1KO 5EX5A 2P9UB 4BC4A 4U67L 4BRKA 1S72N 1DEJA 4H0PA 2HSTA 5M1OA 4BQLA 1ZC6A 5BN9A 1ILYA 3LM9A 4JKGB 5ELZA 4DKWA 1GLCG 1HLUA 1U2VB 4OPAA 4PKIA 2V51B 1VQ6N 4Y0WA 1MWKA 4FWOA 4XH5A 1Y64A 2BTFA 5AQKA 3SAGA 3DXMA 1VQLN 3UKUB 4JHDA 2PBDA 3ZETB 3O9SA 2GUPA 5AQVA 5AQSA 4AM6A 1NM1A 5F1XA 5TKYA 4IFEA 1DGKN 2HMPA 4JKFA 3C65A 4CZHA 5BPMA 3WXIA 4FWRA 4B9QA 3VMFB 3L6QA 3BP8A 1NGDA 2P9SB 3UE5A 3KHYA 4CZLA 2NRVA 1LOTB 3G25A 4ILGB 5GIPA 2CH5A 1E4GT 2HBMA 1YF5L 3ATVA 3IUCA 4PKGA 4BRPA 3QFPA 3R3LA 3HSCA 3ID8A 3O08A 4FWMA 1SZ2A 3IKMA 3ENOA 1T6DA 3CJBA 4LC9B 3D7EO 2D4WA 3I55N 2WFBA 3WUHA 2GTDA 1GLEG 3A5MC 2VGMA 2QWRA 3A5OC 1SAZA 1NMDA 2A41A 2E88A 1G99A 3MN7A 3QFUA 4GV3A 1CZAN 5AQIA 1NGAA 3K9JA 3VGKA 2Q36A 4CZGA 5BPNA 5AQTA 5KQDA 4GY2B 3HOTA 3SAFA 4MO4A 5EXWA 2QWOA 3CERA 3RVCA 2NRZA 4H03B 4H5RA 5EY4A 5C2DA 4UY8O 4JKAA 3VTIA 4GV9A 3WXKA 3U9ZA 4M63C 1P8ZA 3DXKA 5F0XA 3ULEB 5GIOA 3LDPA 4IWVA 4YOWA 4CD1A 5AQUA 3CJ9A 4CD3A 3G4SN 1KC8O 5AQMA 4CZIA 2FSJA 2WBNA 4H5TA 4A57A 4NLCA 3MX5A 4JKDA 1ZXOA 1NWKA 3VESA 4A5BA 3C6HA 1K8KA 5FPMA 4GV6A 2GWJA 2Q31A 4JD2B 1P90A 3A0IX 5GAHP 3PIPL 4ISGA 2OTLN 3FZKA 3LM2A 4WQ4A 4C23A 4ILJA 3CPEA 2FF6A 3PIOL 3JXUA 4O8UA 3CJCA 1TUUA 5AQQA 4YDUC 3HI0A 2NLXA 2GELA 3GG4A 4WQ5A 2YHYA 1HUXA 3IDHA 5FPNA 5AZIB 2YJFA 4A2BA 4OO1J 5BRHA 5LJVA 3B8AX 2AA4A 4JD2A 5AQFA 4JNEA 3F2KA 4BRNA 4CBXA 2QA4N 4M7XA 1QZ5A 5AQNA 3NMUA 3NVKA 5AQRA 1IJJA 1XQSC 2YHWA 2P9NA 3H1VX 4M7YA 3HM8A 4FWQA 2ZJPL 4BR9A 2CH6A 4JAXA 1C0GA 3FZFA 1GLLO 3ULEA 2GWKA 2HF3A 2VYPA 5C15A 2WUSA 5JLFA 3TSUA 1ZBSA 4R79A 3U8XA 1KD1O 1QVFM 2P9UA 2BH1A 1GLBG 1NBWA 3KK7A 3EE8A 3F9MA 4DQ8A 3WEEA 1T6CA 5CR4A 4WF9L 4XH1A 1JJ2M 3P38A 3Q7BA 2D0PA 3GDQA 4BC5A 3FFKB 2A40A 5M1NA 3QDKA 3TPQA 3CC4N 1VQKN 4XEIA 3EKSA 1OVYA 3QICA 3QMLA 2ZWHA 4IOCL 2CGKA 1YJ9N 3AARA 5BREA 3CCEN 1S22A 3ID6A 3H1QA 3LDNA 4A61A 4BRIA 4PL7A 3HOSA 5C10A 1YITN 4BR7A 1YIJN 1GLAG 3E9OA 5GADP 4NO7A 5C12A 5F2RA 4ISFA 3VGLA 1JCGA 1HJOA 2HBLA 3EE9A 3E1YA 1DT9A 1NGJA 3CJAA 2F9TA 1EQYA 3VEZA 1BO5O 1T3VA 2ZGZA 4JK8A 3MWPA 3MN5A 2V7YA 3FZMA 4DB3A 3QBXA 3VOVA 1D4XA 1RDUA 2QI2A 3LL3A 3MDQA 3HZ6A 2GEMA 3L4IA 3R6MA 5BPLA 5TKWA 3HBTA 1YJNN 5HL7L 3ZX3A 3BUZB 2FSNA 2NRTA 2QXLA 3O9TA 3O80A 4K42A 1KQSM 3KWGA 2P9SA 3E9PA 4GNIA 4BC3A 5ADXA 3CIPA 1KAZA 4IJAA 3VEYA 1HKBA 4IJNA 1H1VA 3E9LA 3ZEUB 4C1NI 3LDQA 1SS6A 1HKGA 3QB0A 4FO0A 4I6MA 4JN4A 3DJCA 5FPEA 4FVUA 4FWKA 3VPZA 1NGEA 3GE1A 3OHRA 2FXUA 5AR0A 4EHUA 3M5RA 3P31A 4YOUA 2E2PA 2KLAA 3O1BA 3VEVA 3Q7CA 3CCLN 4A59A 3CF5L 3UKRA 4BRLA 4A62A 4BRAA 1JCFA 3H3NO 3MN9A 2W40A 3P39A 1DKGD 2UYTA 4K41A 5AQPA 3U9DA 3VGMA 4I6MB 1SQKA 2YX6A 3ZETA 1VQ4N 2QTDA 3M3ZA 5AQXA 4BC2A 4PHTX 3N4PA 4PL8A 5E84A 4CZMA 4H0YB 1NJIO 4NB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPH A;  3O9R A;  3L4Q A;  2GX9 A;  3KWI A;  3D6R A;  3M5R A;  3EE9 A;  3P31 A;  3RVC A;  3EE8 A;  3F5T A;  3P38 A;  4OPA A;  3P39 A;  2KKZ A;  2RHK A;  3O9T A;  3O9Q A;  3KWG A;  3O9U A;  3OA9 A;  3O9S A; 
#chains in the Genus database with same CATH topology
 2FBT A;  4CJ4 A;  4BE0 A;  4HTL A;  3ZSO A;  3C0B A;  4BR4 A;  3L3V A;  4MO5 A;  3P1G A;  4FJG A;  5J1E A;  4IOA L;  3M8P A;  5HLF A;  4OJR A;  4FLY A;  2DTU A;  1TK5 A;  4BDY A;  1K8K B;  3G6E N;  4A2A A;  1JXB A;  2YHA A;  1BQN A;  2HHH K;  1K73 O;  4NCB A;  3ZSX A;  5C0Y A;  2A3Z A;  1SKW A;  2O8D A;  4RW9 A;  4HTU A;  4DV0 K;  3IRX A;  3BF1 A;  4KH6 A;  4DCH A;  4ID1 A;  4BGA A;  2B6A A;  1NU0 A;  3ZX2 A;  5M1K A;  4JK7 A;  4YOT A;  5AJ3 K;  1FXX A;  2KTQ A;  4JKE A;  5GAE P;  4CHO A;  3TAP A;  2QKK A;  3DOK A;  1C0F A;  2XY5 A;  3S41 A;  3SI6 A;  3P4I A;  2P9N B;  4KHP K;  1C1C A;  5JVH L;  2A1S A;  3K5L A;  4DQI A;  4RW6 A;  1U2V A;  1NK0 A;  2DPN A;  2E2Q A;  3MXI A;  1M90 O;  4JKC A;  1F21 A;  1RFQ A;  1TAQ A;  4Y1D A;  1HRH A;  4DV6 K;  1L5U A;  5AQH A;  4B1X B;  4FK0 A;  4M3W A;  3MED A;  2KKZ A;  1FJG K;  1QQC A;  3AGR A;  4DR5 K;  1IG8 A;  1T44 A;  2I7P A;  3HTV A;  3QBW A;  4WCE L;  1RT4 A;  4Z4H A;  4C8L A;  3SJH A;  4FJX A;  3C7N B;  1WNS A;  1Q82 O;  4XH4 A;  3PY8 A;  4C8O A;  1W97 L;  2IVP A;  4W5N A;  4BG8 A;  2A5X A;  5SZT A;  5M1F A;  4DTO A;  4CHN A;  1OKJ A;  1ITG A;  2HBJ A;  1YJW N;  1ASW A;  2E2N A;  3AGK A;  1SKS A;  3VQD A;  4B9S A;  2I7N A;  1X9J A;  3QIO A;  5BR8 K;  2P9I B;  4XIU A;  3L4Q A;  3VN5 A;  4CZE A;  4IOX A;  3SV4 A;  4JK9 A;  5BN8 A;  4KTW A;  4CEC A;  3A8Y A;  2OA8 A;  4DHY A;  2F4V K;  1XNR K;  3D2E B;  2VG6 A;  4Y1C A;  4OLA A;  1QZ6 A;  3K5O A;  4F2R A;  1VQ8 N;  3VQB A;  3AVC A;  1DLO A;  4EFH A;  1N32 K;  3W3D A;  4I7F A;  2PAV A;  4CGH A;  2CGJ A;  3DXM B;  5DM7 L;  3RR7 A;  4CHY A;  4MDA A;  3T3F A;  1TKD A;  3T7Z A;  1ASU A;  1S6Q A;  4JEP A;  5DK5 A;  2V52 B;  5DM6 L;  3TSQ A;  2VQF K;  1HPM A;  2NZT A;  1K8A O;  2A6A A;  2PYJ A;  4HCB A;  4CJE A;  1JLA A;  3TU5 A;  5HRN A;  4H5W A;  2VWB A;  4AHR A;  1TKT A;  3KLE A;  4CF0 A;  5EVZ A;  1FK9 A;  2Q1N A;  4PKH A;  4DTP A;  1KFS A;  3IS9 A;  4N76 A;  4M3U A;  3RR8 A;  5LJW A;  5FLX O;  2Q0R A;  4J8F A;  3GBT A;  3ZT0 A;  3CPW M;  2YI1 A;  4BGB A;  1NGI A;  4DSI A;  4DV5 K;  1N36 K;  3ENB A;  4CFA A;  4B1W B;  4BRO A;  5GIN A;  1VSJ A;  3SMP A;  4BRG A;  1HX1 A;  4M3Y A;  4CJL A;  4J2A A;  1WAF A;  2JWL A;  5AZJ A;  5CZ2 A;  2D0C A;  1HNW K;  2P9P B;  3LDO A;  1D8Y A;  3MCP A;  4GW6 A;  4YOY A;  2EX3 A;  5KGW A;  2IIR A;  1BL3 A;  1RGI A;  4K8X A;  3MK6 A;  3A5N C;  2BGG A;  3BZC A;  1RDB A;  3CJ1 A;  3H6E A;  4RTF D;  1I3A A;  3SAH A;  4I9L A;  5BRD A;  1YXQ A;  3SBG A;  5KQ8 A;  2P9P A;  5J2N A;  2BE2 A;  2ZF5 O;  5AQJ A;  4RW4 A;  4CJW A;  1KAY A;  2E2O A;  4IBN A;  5FPD A;  4DLG A;  1QHT A;  3VEN A;  2G8V A;  4IEI A;  3WEE B;  3N4Q A;  4BG9 A;  5AFU A;  1MDU B;  2AP1 A;  5B8H A;  4WFA L;  1Z6R A;  3AA5 X;  3WXL A;  5KGX A;  1YI2 N;  4IDH A;  3QET A;  5A2Q O;  2E4L A;  1D5A A;  1IBL K;  5EX5 A;  1L3T A;  1OH7 A;  3S3M A;  4U67 L;  1SL0 A;  5M1O A;  2YKN A;  3NE6 A;  5BN9 A;  1S1T A;  3LM9 A;  3SUN A;  5J2M A;  4JKG B;  1GLC G;  2P5O A;  1NK9 A;  1E3M A;  4I2P A;  4K0K K;  1Y64 A;  4DQP A;  1JXE A;  3KKS A;  1RTH A;  3ZET B;  3O9S A;  4AM6 A;  1NM1 A;  4CZH A;  4CE9 A;  4HVJ A;  2O8F A;  3WXI A;  4FWR A;  4DQQ A;  3RMA A;  3BP8 A;  1NGD A;  3UE5 A;  3KHY A;  4CZL A;  1EKE A;  1LOT B;  3G25 A;  4ILG B;  4OKK A;  1NKB A;  5GIP A;  4M3Z A;  1E4G T;  3QFP A;  3HSC A;  2X6S A;  3ID8 A;  4FWM A;  4PY5 A;  3LP2 A;  3VA3 A;  4FK4 A;  1EXQ A;  3HO1 A;  3LZI A;  3A5O C;  3G0Z A;  2RKI A;  4GVM A;  4O44 A;  3MN7 A;  5HP1 A;  3QFU A;  4GV3 A;  3K9J A;  4CZG A;  5AQT A;  3V9U A;  4C8N A;  1NK4 A;  1UA0 A;  1QSY A;  3HOT A;  1HYS A;  3CER A;  2DFH A;  5C2D A;  1ZBF A;  4B3T K;  4JKA A;  3NH2 A;  1CLQ A;  3VTI A;  4YHH K;  4LF5 K;  4M63 C;  3DXK A;  5F0X A;  3NBP A;  5GIO A;  2F96 A;  4FJH A;  3HVT A;  4YOW A;  5LL6 Z;  3K5M A;  5AQU A;  2IAJ A;  3MXM A;  4O0I A;  3TAM A;  4CZI A;  2D0A A;  5FPM A;  4GV6 A;  2GWJ A;  2Q31 A;  4CJR A;  4FJM A;  4CJF A;  1VRT A;  3PIO L;  3CPE A;  2HHW A;  1J5E K;  4DSJ A;  4O8U A;  2XY7 A;  2NLX A;  3OYN A;  3GG4 A;  2YHY A;  1RBT A;  5FPN A;  3CFO A;  4FJI A;  3AVH A;  5AQF A;  1G15 A;  1YVU A;  3ZT4 A;  4HUF A;  5AQR A;  1VSL A;  3H1V X;  3HM8 A;  4BR9 A;  2CH6 A;  4ELV A;  2WUS A;  1ZBS A;  4R79 A;  3U8X A;  1WSE A;  1KD1 O;  4CVN E;  2BH1 A;  1RTD A;  1QVF M;  4DR4 K;  1NBW A;  1LWF A;  4CF1 A;  2GBZ A;  4J2E A;  4E7I A;  1WSF A;  3Q7B A;  2A40 A;  4O5B A;  3TPQ A;  3CC4 N;  3QML A;  2ZWH A;  1IKW A;  3KK1 A;  3CCE N;  4CEZ A;  3ID6 A;  4DUZ K;  4FW2 A;  5CY4 A;  3HOS A;  4PL7 A;  5GAD P;  5F2R A;  4ISF A;  1IBK K;  1GOC A;  1T7P A;  2F9T A;  4DR3 K;  3VEZ A;  4KTZ A;  2DY4 A;  2ZGZ A;  2O8B A;  1QE1 A;  3QBX A;  3LL3 A;  2QI2 A;  3MDQ A;  1EWQ A;  3HZ6 A;  4KTQ A;  2QXL A;  2FSN A;  3BUZ B;  3O80 A;  3RMB A;  2P9S A;  4BC3 A;  4GNI A;  5ADX A;  3T19 A;  3CIP A;  3VEY A;  3K57 A;  4IJN A;  3E9L A;  4JN4 A;  4FO0 A;  4ELU A;  4GKK K;  3VPZ A;  1NGE A;  3RRH A;  4YOU A;  3DOL A;  4DFJ A;  3DRR A;  3RRG A;  3DLK A;  1S9E A;  4Z4C A;  2UUC K;  5IT9 O;  3KK3 A;  3C6U A;  3I8D A;  4A59 A;  4BRL A;  4CGI A;  1VK0 A;  2Y1I A;  3P39 A;  4LFB K;  2UYT A;  2O8F B;  5AQP A;  3U9D A;  2D0B A;  2YX6 A;  3ZET A;  3PX6 A;  3SUP A;  3G10 A;  3AO1 A;  5E84 A;  4CZM A;  1S1X A;  4LF7 K;  4LF9 K;  1WAJ A;  4CCH A;  4U7B A;  4OPH A;  3VQ6 A;  3DWL A;  2YV0 X;  3M8R A;  4KAZ A;  1QVG M;  3AVJ A;  1KAX A;  4BR2 A;  3NF8 A;  3F73 A;  1GLJ O;  3VEX A;  1A5W A;  3EYZ A;  3O5B A;  2F8S A;  1BG3 A;  4LH4 A;  4B8C A;  3AA2 A;  1UA1 A;  4CER A;  1YAG A;  4OX9 K;  5FRN A;  2A1R A;  3SMS A;  4MQ3 A;  4AQY K;  1U49 A;  2HNZ A;  1KSP A;  4DR7 K;  3KLF A;  3HM9 A;  2O4G A;  3LDL A;  3VET A;  3THY A;  1T03 A;  1BQM A;  4KBO A;  4H5V A;  4KV8 A;  4E0D A;  3D2E A;  2VQE K;  4DLE A;  3A2F A;  5C2F A;  1HMV A;  2QWM A;  1JKH A;  1ATN A;  4OLB A;  2G8F A;  3FZH A;  3ZT3 A;  1QQM A;  3F5T A;  2HVI A;  1EO1 A;  3CCM N;  4ELT A;  3HXM A;  5AZJ B;  1S1W A;  3ALY A;  4CES A;  1LW0 A;  3KZB A;  3CM6 A;  4FLV A;  5JLH A;  1K9M O;  3OW2 M;  3CD6 N;  2OPP A;  5K14 A;  2YJE A;  4ICL A;  1QHA A;  3AO3 A;  2NRR A;  5I9E B;  4KRF A;  4CJS A;  3ZX0 A;  1O13 A;  3OYL A;  4Z0U A;  3CCR N;  1KFD A;  2YCH A;  2ZD1 A;  4PUO A;  1BWF O;  5GAG P;  2E1Y A;  2IS3 A;  2J4R A;  2QK9 A;  1NJW A;  3M1F A;  1QTM A;  3IAY A;  3L2W A;  3HK2 A;  1BU6 O;  1TUY A;  1JLB A;  3QIN A;  3QEV A;  4F9O A;  2UXC K;  1O1W A;  3KWI A;  3AV9 A;  5EOY A;  3ZLJ A;  4LFC K;  1JLC A;  3S3N A;  3LWL A;  5AQL A;  1BA1 A;  2EWS A;  1ASV A;  4GVE A;  3ZSR A;  4BRM A;  5CYQ A;  4TSX A;  1NGG A;  1VSH A;  2RHK A;  1BCM A;  4DS4 A;  4BE2 A;  3HRG A;  5KTQ A;  4FM1 A;  4FLW A;  3CYM A;  3PUF A;  4CK2 A;  3QEI A;  3BZK A;  2HVH A;  5KPT A;  1VQ7 N;  2KHO A;  1U4B A;  1HJR A;  2V7Z A;  3MMV A;  1XUP O;  4WYB A;  2Z1H A;  3D0P A;  1FW6 A;  3NHG A;  3WNE A;  3RSE A;  3DRS A;  2P9I A;  3V6D A;  3KTQ A;  2O8E B;  4FOI A;  2DFF A;  4MDB A;  4FCY A;  2D1K A;  1YVN A;  4JI4 K;  3E66 A;  2E8A A;  1N33 K;  4BAC A;  2LSN A;  4QS7 A;  5MLC Q;  3QIP A;  4G9Z A;  4MLE A;  4FLT A;  4K43 A;  2QM1 A;  3B6P A;  4FL9 A;  5AQW A;  1W9H A;  4NCA A;  3DMJ A;  3C7N A;  1KVC A;  4FZZ A;  4EAH D;  2E1Z A;  3MEC A;  3ITH A;  5HRR A;  2ASM A;  2D5R A;  4FPA A;  2ZGY A;  4QS9 A;  4NXM K;  1RT7 A;  3AA4 A;  3BGR A;  1Q18 A;  4O55 A;  4GKJ K;  4AHS A;  1VSI A;  4CJK A;  2Y1J A;  1IBM K;  2AJQ A;  1WLJ A;  4IG0 A;  4V19 S;  1Q86 O;  1NGB A;  4DTR A;  3PSF A;  4X65 K;  3R9P A;  3OYE A;  1WSJ A;  1NKC A;  3CC7 N;  1J53 A;  3O4Q A;  2F9W A;  1ZBL A;  3D2F A;  1LV5 A;  3SPZ A;  4FPB A;  5AZI A;  2QEX N;  3R1X A;  1REV A;  3LAN A;  4FSV A;  3VQ5 A;  2ATQ A;  3TTF A;  4B1Z A;  3OS2 A;  4FJ8 A;  5CE3 A;  2QW9 A;  3CFR A;  2ASP A;  3MN6 A;  3J7Y P;  1X1P A;  2ZJQ L;  3I0S A;  3DI6 A;  4B9N A;  3RSE B;  4QS8 A;  4IEE A;  2YHX A;  1RDA A;  2JWK A;  1YT3 A;  2ZJR L;  2QWP A;  3AO5 A;  4Z4I A;  3EZ5 A;  4CGF A;  3PO4 A;  4CI6 A;  1BDG A;  4FWS A;  4CJQ A;  4IG3 A;  3JAM O;  1T8E A;  4B9V A;  1RDD A;  2KW4 A;  2HF4 A;  1IO2 A;  4H0V B;  3L2R A;  4DSE A;  2FLO A;  4IZ9 A;  2GV9 A;  5CYM A;  3I56 N;  3FE1 A;  1XNQ K;  2W6K A;  3AVN A;  3LPU A;  2VWK A;  3EEQ A;  3CME N;  5T7B A;  1W2B M;  3L0Q A;  3K59 A;  2Q0U A;  3EO3 A;  3NVM A;  5AFU H;  1GLD G;  2F8T A;  3R8E A;  4DR1 K;  4DV2 K;  2Q2R A;  2B4J A;  1M1K O;  4FYD A;  2P9U B;  1B9D A;  4LH5 A;  1DEJ A;  4H0P A;  1ZC6 A;  4BDZ A;  4DKW A;  1HLU A;  1J5O A;  1VQ6 N;  1MWK A;  4CEB A;  3PSI A;  4XH5 A;  5AQK A;  2BTF A;  5FRO A;  3DXM A;  5JS1 A;  3UKU B;  2PBD A;  2GUP A;  5AQV A;  1VSE A;  5TKY A;  1DGK N;  2HMP A;  3C65 A;  3OYA A;  4KFB A;  2P9S B;  4F4K A;  2CH5 A;  3ATV A;  3IUC A;  4PKG A;  4BRP A;  3L8B A;  4FJJ A;  3R3L A;  3ZSQ A;  3IKM A;  3ZT2 A;  1TK8 A;  3OYC A;  4CGD A;  4KO0 A;  4DV7 K;  2WFB A;  3WUH A;  3TAR A;  1JLQ A;  2A41 A;  4OGC A;  1XHZ A;  3WNG A;  3HP9 A;  1QS4 A;  4F3T A;  2ETJ A;  3VQQ A;  1OH5 A;  4X64 K;  5BPN A;  3VGK A;  1WSH A;  2Q36 A;  3RMC A;  4GY2 B;  1ZBU A;  3MEE A;  2UUB K;  4JI0 K;  2NRZ A;  4H03 B;  4H5R A;  3ZSV A;  4X66 K;  1NG9 A;  1LWE A;  1GOA A;  3WXK A;  2XY6 A;  3U9Z A;  4EZ9 A;  3C6T A;  1D9D A;  4Q5V A;  1IH7 A;  3DM2 A;  3CJ9 A;  2ITG A;  4CD3 A;  3G4S N;  4BWM A;  2WBN A;  4CEO A;  4A57 A;  3TR8 A;  4JKD A;  1ZXO A;  4O0J A;  4DTU A;  4JD2 B;  3QNN A;  4ISG A;  1NK6 A;  4M42 A;  4C23 A;  4RW8 A;  3JXU A;  3OS1 A;  2GEL A;  3VQC A;  4WQ5 A;  3IDH A;  3DLH A;  4FM0 A;  5DMR A;  4YY3 K;  5BRH A;  1TL1 A;  3B8A X;  4CJ5 A;  4BRN A;  2PYL A;  4M7X A;  3LP3 A;  1KCF A;  4FVM A;  2P9N A;  3QLH A;  4IFY A;  4M7Y A;  4AHU A;  2ZJP L;  2P1J A;  2HHQ A;  2VYP A;  5C15 A;  1GOB A;  2P9U A;  1GLB G;  3KK7 A;  3EE8 A;  4M3R A;  3OYJ A;  3F9M A;  4WF9 L;  4BC5 A;  4B9T A;  3FFK B;  3T1A A;  4CJP A;  3DRP A;  3EKS A;  1BIS A;  1OVY A;  1TL3 A;  3SQ0 A;  1C1A A;  1S1V A;  3ZT1 A;  4BRI A;  5C10 A;  1NK8 A;  1GLA G;  5C12 A;  2HHV A;  1RT1 A;  1JCG A;  4FJN A;  1N5Y A;  3EE9 A;  3E1Y A;  3V1R A;  1NGJ A;  2X74 A;  3QER A;  5LMN K;  1EQY A;  4WE1 A;  4Z4E A;  3MWP A;  3MN5 A;  1NK5 A;  4DB3 A;  3VOV A;  3R6M A;  1RDU A;  1YJN N;  3E01 A;  5HL7 L;  2IDO A;  2NRT A;  1KQS M;  2Q3S A;  3L3U A;  4K42 A;  4DFP A;  1TGO A;  3AVK A;  2HHS A;  3ZEU B;  3CFP A;  3LDQ A;  1HKG A;  3QB0 A;  4DR2 K;  1FKO A;  4FVU A;  4FWK A;  1I94 K;  3OHR A;  1QSL A;  3M5R A;  3NCI A;  3J81 O;  2P5G A;  1N34 K;  2HHT A;  2KLA A;  3O1B A;  3Q7C A;  4MFB A;  4JLH A;  3HYF A;  4OKE A;  1WBD A;  4A62 A;  3K58 A;  1JCF A;  3MN9 A;  3HST B;  1DKG D;  3NDK A;  3QEW A;  5D3G A;  4JRQ A;  5AQX A;  1VRU A;  4BC2 A;  4PHT X;  2X78 A;  4H0Y B;  2KZZ A;  2EHG A;  1NJI O;  3ZYY X;  5IWA K;  5J2P A;  2GX9 A;  4E1N A;  3WNH A;  1ZBH A;  4E7J A;  3SV3 A;  3KD5 E;  3V9Z A;  3BF3 A;  1NGF A;  4E1M A;  3VTH A;  3RTV A;  4AIL C;  1QQO A;  1EX4 A;  3KLI A;  3S3O A;  4BR0 A;  4E1J A;  3THX A;  3VQ4 A;  3CMA N;  2JGU A;  4H8K A;  3O4W A;  4W5Q A;  1NK7 A;  4YOV A;  3DLL L;  3MX2 A;  1ATS A;  4B1V A;  3SNN A;  4FLX A;  1J9A A;  4CF9 A;  3J8A A;  4KHS A;  5AQG A;  3TAN A;  4BRF A;  3MCA B;  5J2Q A;  3SZ2 A;  4CK3 A;  4IFV A;  1U04 A;  1WSI A;  2P51 A;  3T69 A;  5BRF A;  3EN9 A;  3NH0 A;  5AQZ A;  4DFM A;  3NGI A;  2G8H A;  4LSN A;  1HR0 K;  3UKU A;  1IKX A;  3H3O B;  1SUQ A;  3EKU A;  3OYH A;  1S1U A;  3D6R A;  3OBW A;  3PLA A;  4CBU A;  3OYD A;  2OCE A;  5AQY A;  4CW7 B;  2A42 A;  4FWP A;  4CEQ A;  3VEO A;  2QWL A;  3SK3 A;  3NAE A;  4JI7 K;  4KH5 A;  1NJY A;  2YNH A;  1RTI A;  3OA9 A;  3WQT A;  3VQE A;  1RDW X;  1IV0 A;  3KLH A;  3TSP A;  5CHI A;  5CZ1 A;  4BQZ A;  4KH4 A;  1VQO N;  4JI2 K;  4CEA A;  1X3N A;  1X3M A;  3CJ7 A;  4MLH A;  2VCP A;  1VHX A;  1KTQ A;  4YOR A;  3AVB A;  1BIZ A;  1RT5 A;  1VSD A;  5H1S Q;  4IO9 L;  4HUE A;  4DV1 K;  3OBY A;  4C8K A;  3CQX A;  3DYA A;  4CHZ A;  1MU2 A;  2O8B B;  4ILH A;  2FF3 B;  5ADX H;  4KKO A;  2OAN A;  3M6G A;  3UKR B;  1WN7 A;  3KLG A;  4H5N A;  1ZYQ A;  4A5A A;  3HPH A;  1XWL A;  3K5N A;  4KI6 A;  4CFB A;  1FKP A;  3O8M A;  3AY9 A;  3VEW A;  2CGL A;  3AO2 A;  3EL2 A;  1VSK A;  1YUW A;  1TAU A;  1WSG A;  2NRW A;  2Q97 A;  3CI5 A;  4BE1 A;  4HCC A;  3O3G A;  4HUG A;  1WUA A;  3PX0 A;  2ZE2 A;  1TYQ A;  4OKJ A;  3SBT A;  3CCS N;  4DR6 K;  4CF2 A;  4BRC A;  3A5L C;  3O4N A;  3I33 A;  4K25 A;  1Q81 O;  3L2Q A;  4LY7 A;  2HNY A;  1WBB A;  1C0T A;  4Z94 A;  3OS0 A;  1KXP A;  1RT6 A;  1VQ5 N;  2RE2 A;  4DTM A;  4F3O A;  4YDU A;  4NXN K;  4DSL A;  1HYV A;  3DAW A;  3OYF A;  3PO5 A;  4QOZ B;  1HPZ A;  4KHY A;  3EY1 A;  4JKB A;  3OVN A;  2Z1I A;  4CK1 A;  3BEX A;  1VQ9 N;  4H0T B;  2H3G X;  1S3X A;  3J7A P;  4FLZ A;  3TTD A;  3WQU A;  2ITM A;  3HPO A;  3DXK B;  3CCQ N;  3WT0 A;  4BRQ A;  3LDS A;  3WXM B;  3ZEU A;  4LFA K;  2NRX A;  4E89 A;  1S6P A;  4B9L A;  4UQG A;  4KHQ A;  3IMX A;  1I39 A;  1VQP N;  3AVI A;  3O1W A;  3CC2 N;  2FBV A;  4AM7 A;  2FBY A;  3SQ2 A;  3QO9 A;  5FRM A;  4WFB L;  2PFU A;  3ENH A;  4JS4 A;  3G71 N;  2QWN A;  1TV6 A;  2UUA K;  3LZJ A;  5KRT A;  4JI5 K;  4IXC A;  2ASO A;  3HL8 A;  1LAW A;  1RNH A;  4CZJ A;  3O3H A;  3ASM A;  3B6O A;  3NF9 A;  4L3Q A;  1HKC A;  4WFN L;  5JVG L;  3TTC A;  1V4T A;  4B9M A;  2NNW A;  4N5S A;  3V9S A;  5LMU K;  3HVR A;  2YNF A;  3MAQ A;  1YTU A;  4JV5 K;  3EZW A;  1BHL A;  1JL2 A;  5AQO A;  3NH1 A;  1VQN N;  4B3S K;  1GLF O;  1BA0 A;  3D45 A;  1RCH A;  4WQ5 C;  5I3U A;  5C24 A;  3KKR A;  4K8Z A;  3DLG A;  3CCV N;  3IFR A;  1NKE A;  2OTJ N;  2VG5 A;  2P9L A;  4CEE A;  4BC4 A;  3MXJ A;  4BRK A;  4BQL A;  2PY5 A;  4JI8 K;  4OPJ A;  4DU1 A;  4OPA A;  4OPK A;  3LP0 A;  4PKI A;  2V51 B;  2B5J A;  4Y0W A;  1UWB A;  1U48 A;  5HBM A;  2IC3 A;  1VQL N;  5AQS A;  1C1B A;  2KQ2 A;  4CGJ A;  4IDK A;  5BPM A;  1R0A A;  2X6N A;  3KIO A;  4M3T A;  2NRV A;  4LF8 K;  2HBM A;  3L2V A;  2R7Y A;  3H08 A;  1NMN A;  3O08 A;  3ENO A;  3CJB A;  3PV8 A;  2D4W A;  2GTD A;  1GLE G;  3A5M C;  1YTA A;  2VGM A;  1RBU A;  1SAZ A;  1NMD A;  3NGZ A;  1G99 A;  1KRP A;  4B9U A;  1RBV A;  1NGA A;  3ULD A;  4N56 A;  3V1Q A;  3CG7 A;  3SAF A;  1JLE A;  3RVC A;  2IGI A;  5EY4 A;  4UY8 O;  3RMD A;  4KHN A;  3OJU A;  1P8Z A;  2OZM A;  1B92 A;  4FXD A;  3ULE B;  2HND A;  3LDP A;  4IWV A;  2G8W A;  4FJ9 A;  4DV4 K;  2XY8 A;  4CFC A;  4QCL A;  4H4M A;  4NLC A;  4A5B A;  3C6H A;  3C95 A;  4DTJ A;  1P90 A;  3A0I X;  5GAH P;  4E7H A;  3LM2 A;  4WQ4 A;  1RDC A;  4BWJ A;  2FF6 A;  3HI0 A;  2RF2 A;  4A2B A;  4FJ5 A;  3V9X A;  4CIG A;  4CED A;  4JNE A;  3F2K A;  2YKM A;  4JS5 A;  1IG9 A;  1QZ5 A;  5AQN A;  3NMU A;  3M8S A;  1IJJ A;  1XQS C;  2YHW A;  3NGY A;  4LF4 K;  4FWQ A;  4N47 A;  4JAX A;  1C0G A;  1C6V A;  3ULE A;  2HF3 A;  4CGG A;  4W5T A;  3PX4 A;  3OJS A;  4C8M A;  4DQ8 A;  4YNQ A;  1WB9 A;  2VG7 A;  5CR4 A;  4XH1 A;  4JI1 K;  3P38 A;  3I0R A;  3AA3 A;  5M1N A;  1YJ9 N;  2CGK A;  3AAR A;  5BRE A;  1OVQ A;  1S22 A;  3HT3 A;  5E41 A;  1S9G A;  3LDN A;  4A61 A;  1IKY A;  3ISN C;  3E9O A;  4NO7 A;  1L3S A;  3U6F A;  1IKV A;  2GUI A;  2HBL A;  3SUQ A;  3LP1 A;  4W5R A;  1T3V A;  4ZHR A;  1Z25 A;  1A5X A;  1D4X A;  3L4I A;  2GEM A;  5TKW A;  3ZX3 A;  1KLM A;  3O9T A;  1K6Y A;  4KI4 A;  3KWG A;  1KAZ A;  1RTJ A;  4IJA A;  1HKB A;  2FBX A;  1H1V A;  3T1H K;  3DLE A;  1SS6 A;  4I6M A;  3THY B;  4GMJ B;  3DJC A;  5FPE A;  3GE1 A;  5AR0 A;  1SL1 A;  1EET A;  3P31 A;  3OYG A;  3VEV A;  1HQU A;  4LF6 K;  3CCL N;  3CF5 L;  1J54 A;  3UKR A;  4DG1 A;  3H3N O;  2W40 A;  4K41 A;  3OYB A;  4I6M B;  1SQK A;  1C0U A;  3IG1 A;  1L3V A;  1BCO A;  4CFD A;  1ZBI A;  2QTD A;  3WNF A;  3KJV A;  4NB4 A;  4DF8 A;  4DTN A;  3KVG A;  3THW B;  3O9R A;  2E5L K;  4BVO A;  1L3U A;  5SWM A;  1TYQ B;  4O8K A;  3SQ1 A;  1U45 A;  2IVO A;  4KB1 A;  3ZSY A;  2E6M A;  3MWT A;  4CJU A;  3ATU A;  3GL1 A;  1NOY A;  2P9L B;  3NF6 A;  5KPZ A;  2O8C B;  1NGC A;  4EHT A;  3VQP A;  4R5P A;  4JI6 K;  4B1U B;  4PWD A;  1NJZ A;  2KFN A;  4RG8 A;  4I2Q A;  5KRS A;  1QSS A;  2I5J A;  3AVM A;  3U3G A;  1VSF A;  4C1N K;  5BR9 A;  4AHT A;  1Q7Y O;  1DTQ A;  3OTO K;  4G1Q A;  2P9K A;  1N8R O;  5M1P A;  4DF4 A;  3AAP A;  3O6W A;  3LAK A;  5EU7 A;  1HNZ K;  1VQM N;  4RW7 A;  5E26 A;  5LY3 A;  2UXD K;  1ESV A;  5FDL A;  2VWJ A;  3VF6 A;  2YNG A;  4O4G A;  4FZY A;  4IO8 A;  1CZB A;  4DU3 A;  2P9K B;  2ZQB A;  3L2U A;  4DS5 A;  3QEX A;  1QQN A;  2OYQ A;  3UB5 A;  2F7T A;  4CIE A;  2E20 A;  1VSM A;  5HRS A;  3AO4 A;  2HMI A;  2D0O A;  3K9K A;  4DQR A;  1NNE A;  2O8C A;  1C0M A;  2Z1J A;  4E7K A;  3FGU A;  4JHD B;  4BRD A;  4BY9 C;  1OH6 A;  3VER A;  1XI1 A;  2QXF A;  4YOX A;  2IOC A;  3M8Q A;  3C6A A;  2UU9 K;  4DTS A;  1S5J A;  1TKZ A;  4B8A B;  3QES A;  1X9M A;  4LD0 A;  3SPY A;  4NCG A;  4JKG A;  1KVA A;  2WOM A;  4AF1 A;  3SLC A;  4EP4 A;  4FM2 A;  4EP5 A;  3TAB A;  3TAE A;  4BVP A;  4ZTJ A;  4ISE A;  2WC9 A;  2HB5 A;  1EWR A;  3DLB A;  4BR5 A;  3CXC M;  1UOC A;  5HOO A;  1EP4 A;  2ZM6 K;  3LPT A;  4Z4G A;  3W0L A;  3K2P A;  1RBS A;  3O9Q A;  4X62 K;  4DWI A;  2OZS A;  3BY5 A;  1RT3 A;  3KK2 A;  4JKH A;  4NLB A;  4BDP A;  1SKR A;  3LAM A;  3OYI A;  4KB0 A;  2Z1G A;  4DSF A;  3JS6 A;  1ATR A;  3OYM A;  3MEG A;  4BRE A;  1NJX A;  2FSK A;  1BOT O;  3K0S A;  2IVN A;  4KRE A;  3CCJ N;  5HRO A;  2HW3 A;  4DU4 A;  1RBR A;  4DV3 K;  3HPG A;  2WTU A;  3AVG A;  1TK0 A;  3GOI A;  2O4I A;  3VA0 A;  3CQY A;  3I8B A;  3ZCM A;  1LAV A;  1U47 A;  1E4F T;  5HRP A;  2QWQ A;  4FZX C;  2HBK A;  1XC3 A;  2VGN A;  5C42 A;  1XC9 A;  3U4L A;  4PQU A;  3CCU N;  1B9F A;  1MA9 B;  4O5F A;  4OVL A;  3FFI A;  3JSM A;  4HHT A;  4FLU A;  4FWL A;  2DFE A;  2O8D B;  1BI4 B;  1HNI A;  3AVA A;  3FZL A;  1JCE A;  3VF4 A;  1YHQ N;  3NFA A;  1NGH A;  1JL1 A;  4CZK A;  4CJ7 A;  1NLV A;  4AH9 A;  3BDP A;  3NF7 A;  2W41 A;  1JLG A;  3OYK A;  2BUP A;  3CM5 A;  1CXQ A;  3SCX A;  4WQ4 C;  3FR0 A;  4BRH A;  4CJV A;  3LAL A;  1V4S A;  3V9W A;  3J7Z O;  1U6Z A;  2HOE A;  3SJJ A;  1J6Z A;  3H45 C;  4OGE A;  1D9F A;  1A5V A;  1Z05 A;  4RWT A;  4DUY K;  1SV5 A;  1HNV A;  3H46 O;  2HHX A;  3CHW A;  2YHB A;  1HQE A;  4LSL A;  5M1Q A;  4J2D A;  2JLE A;  1NOZ A;  1XMQ K;  1R59 O;  4B08 A;  1BUP A;  2W42 A;  1HYZ A;  3THX B;  4FJK A;  5JIC A;  4H0O A;  3QNO A;  5KPR A;  3AVL A;  4RCH A;  4M41 A;  1MWM A;  1KVB A;  4HWI A;  2KZM A;  3LWM A;  4CZF A;  4CBW A;  2G8U A;  3SQ4 A;  3WXJ A;  5KI6 A;  3HJF A;  3D2F B;  1DTT A;  1HNX K;  4FWN A;  4E7L A;  4EIA A;  3U3Y A;  1VAZ A;  4B1Y B;  3VQ9 A;  1LW2 A;  1Z26 A;  3AAQ A;  3RWU A;  2NRH A;  4J2B A;  4KHU A;  1LCU A;  4FK2 A;  4FW1 A;  4ID5 A;  3O9U A;  3F9K A;  1XHX A;  1WOQ A;  4CJ3 A;  3FLC O;  4FOE A;  3THW A;  3VQA A;  2NUB A;  4H0X B;  3JYT A;  3TAQ A;  4DQS A;  3VF2 A;  3SYZ A;  3CET A;  4AHC A;  5JMV A;  4B3O A;  4NYF A;  1CZ9 A;  1Y97 A;  1S72 N;  2HST A;  4B3M K;  1ILY A;  2W6L A;  1W0H A;  5ELZ A;  1U2V B;  3P83 D;  1TKX A;  4FWO A;  3CQ8 A;  3SAG A;  2XRI A;  4JYA K;  4ZTF A;  4JHD A;  2HHU A;  5F1X A;  5C25 A;  4IFE A;  4JKF A;  1RIL A;  4B9Q A;  2BAN A;  3VMF B;  3TWH A;  3L6Q A;  1Q9Y A;  1YF5 L;  4YFU A;  1SZ2 A;  1T6D A;  4LC9 B;  1JLF A;  3D7E O;  2O8E A;  3I55 N;  2G8K A;  4W5O A;  4FJ7 A;  2QWR A;  2OPQ A;  2E88 A;  3AVF A;  2WON A;  2KFZ A;  1CZA N;  4N41 A;  1N6Q A;  1CXU A;  5AQI A;  4NYN A;  2PZS A;  5KQD A;  3V1O A;  4KHW A;  4MO4 A;  5EXW A;  4Z4F A;  2QWO A;  3DLR A;  4Q0B A;  4F8R A;  2OPR A;  4GV9 A;  3P5J A;  4QAG A;  5JS2 A;  3J80 O;  4PA1 A;  4CD1 A;  1KC8 O;  1OH8 A;  4DMN A;  5AQM A;  3ZSW A;  4EZ6 A;  5I42 A;  2FSJ A;  4H5T A;  3MX5 A;  2G8I A;  1NWK A;  3VES A;  2OPS A;  1K8K A;  3TI0 A;  3PIP L;  2OTL N;  3FZK A;  4ILJ A;  3CJC A;  1TUU A;  5AQQ A;  4YDU C;  2XHB A;  1TVR A;  4KPY A;  1HUX A;  4CF8 A;  1BGX T;  5AZI B;  2YJF A;  1XMO K;  4OO1 J;  5LJV A;  1BIU A;  4B3R K;  2AA4 A;  4JD2 A;  1BI4 A;  3KD1 E;  4CBX A;  4IKF A;  2QA4 N;  3NVK A;  1KLN A;  4CEF A;  3C94 A;  3FZF A;  1GLL O;  1X9W A;  2GWK A;  2RPI A;  5JLF A;  2FC0 A;  3TSU A;  4DTX A;  3VQ7 A;  3SUO A;  1SL2 A;  3WEE A;  1T6C A;  1JJ2 M;  1W7A A;  2D0P A;  3GDQ A;  4CIF A;  1Q8I A;  3QDK A;  1VQK N;  4XEI A;  4IOC L;  3QIC A;  4FJL A;  2YNI A;  1RT2 A;  1LWC A;  1T05 A;  3H1Q A;  2E6L A;  3TAG A;  1UAX A;  4CHP A;  1YIT N;  4BR7 A;  1YIJ N;  3ZSZ A;  4F2S A;  3VGL A;  1HJO A;  3T1Y K;  4I9Q A;  3V4I A;  3TAF A;  4E3S A;  1DT9 A;  3CJA A;  2RN2 A;  1BO5 O;  1Q9X A;  4JK8 A;  4DFK A;  2V7Y A;  3FZM A;  5BPL A;  3HBT A;  3UIQ A;  3E9P A;  4DSK A;  3THV A;  4M3X A;  4E19 A;  2QKB A;  4JRP A;  4C1N I;  2XO7 A;  4CHQ A;  3S9H A;  2UXB K;  2FXU A;  4EHU A;  4M45 A;  2BDP A;  4H4O A;  3OY9 A;  2E2P A;  4CJT A;  4AHV A;  1X9S A;  3HP6 A;  4L8R B;  4BRA A;  4JI3 K;  3QEP A;  3VGM A;  3O3F A;  3VQ8 A;  3V81 A;  1VQ4 N;  3M3Z A;  3N4P A;  4PL8 A; 
#chains in the Genus database with same CATH homology
 4OPH A;  3DWL A;  3KVG A;  3O9R A;  3ZYY X;  4BVO A;  4HTL A;  1QVG M;  2GX9 A;  1KAX A;  4BR2 A;  1GLJ O;  1TYQ B;  4O8K A;  3VEX A;  3C0B A;  2IVO A;  4BR4 A;  3O5B A;  3MWT A;  4MO5 A;  4U7B A;  1BG3 A;  3BF3 A;  3ATU A;  3GL1 A;  1YAG A;  1NGF A;  2P9L B;  4IOA L;  3VTH A;  5KPZ A;  1NGC A;  4EHT A;  3SMS A;  1K8K B;  3G6E N;  1QQO A;  4A2A A;  4B1U B;  4BR0 A;  4E1J A;  3CMA N;  1K73 O;  3LDL A;  3O4W A;  3VET A;  4C1N K;  5C0Y A;  5BR9 A;  2A3Z A;  4KBO A;  4H5V A;  4YOV A;  3DLL L;  3MX2 A;  3D2E A;  1Q7Y O;  2P9K A;  1N8R O;  1ATS A;  5M1P A;  4B1V A;  3AAP A;  3O6W A;  5C2F A;  3J8A A;  2QWM A;  3BF1 A;  4KH6 A;  5AQG A;  4DCH A;  4BGA A;  1ATN A;  1VQM N;  4BRF A;  3MCA B;  3FZH A;  5E26 A;  1QQM A;  3F5T A;  3ZX2 A;  1EO1 A;  5M1K A;  3CCM N;  4JK7 A;  4YOT A;  3T69 A;  5LY3 A;  5BRF A;  1ESV A;  3EN9 A;  3VF6 A;  4JKE A;  5GAE P;  5AZJ B;  1C0F A;  3KZB A;  5AQZ A;  3S41 A;  5JLH A;  1K9M O;  3P4I A;  2P9N B;  3OW2 M;  4IO8 A;  3UKU A;  3H3O B;  3CD6 N;  3EKU A;  2P9K B;  5JVH L;  1QQN A;  3UB5 A;  2F7T A;  2E20 A;  3D6R A;  2YJE A;  1QHA A;  3OBW A;  1U2V A;  2NRR A;  5I9E B;  2D0O A;  2DPN A;  2E2Q A;  3K9K A;  3ZX0 A;  3PLA A;  4CBU A;  1O13 A;  1M90 O;  4JKC A;  1RFQ A;  3CCR N;  2YCH A;  5AQY A;  3FGU A;  4JHD B;  5AQH A;  4B1X B;  2A42 A;  1BWF O;  4FWP A;  5GAG P;  2E1Y A;  4BRD A;  2KKZ A;  4BY9 C;  3AGR A;  3VEO A;  2QWL A;  3VER A;  2J4R A;  1IG8 A;  3SK3 A;  1T44 A;  3M1F A;  4YOX A;  2I7P A;  3C6A A;  3HTV A;  3QBW A;  4KH5 A;  4WCE L;  1BU6 O;  3OA9 A;  1TUY A;  3WQT A;  1RDW X;  3TSP A;  5CHI A;  4BQZ A;  4F9O A;  4KH4 A;  3SJH A;  4JKG A;  3C7N B;  3KWI A;  5EOY A;  1Q82 O;  4XH4 A;  4AF1 A;  1VQO N;  1W97 L;  2IVP A;  3SLC A;  4BG8 A;  5AQL A;  1X3N A;  2A5X A;  1BA1 A;  4BVP A;  5M1F A;  2EWS A;  4GVE A;  4ISE A;  1OKJ A;  2WC9 A;  1X3M A;  3CJ7 A;  4BRM A;  4MLH A;  1NGG A;  4BR5 A;  3CXC M;  2HBJ A;  1YJW N;  2VCP A;  2E2N A;  2RHK A;  5HOO A;  4YOR A;  3AGK A;  3HRG A;  3W0L A;  3O9Q A;  5H1S Q;  4IO9 L;  2I7N A;  3OBY A;  1X9J A;  4JKH A;  3CQX A;  4NLB A;  4ILH A;  5KPT A;  2FF3 B;  1VQ7 N;  3JS6 A;  5ADX H;  1ATR A;  2P9I B;  2KHO A;  2OAN A;  4BRE A;  2FSK A;  3L4Q A;  3M6G A;  4CZE A;  3UKR B;  4IOX A;  1BOT O;  2V7Z A;  4JK9 A;  5BN8 A;  2IVN A;  3MMV A;  3CCJ N;  1XUP O;  3A8Y A;  4H5N A;  4DHY A;  4WYB A;  3D2E B;  4A5A A;  1QZ6 A;  3GOI A;  3O8M A;  3AY9 A;  3RSE A;  1VQ8 N;  3CQY A;  3VEW A;  2P9I A;  3I8B A;  2CGL A;  4EFH A;  3EL2 A;  4FOI A;  4MDB A;  1YUW A;  3W3D A;  2D1K A;  2PAV A;  1YVN A;  3DXM B;  1E4F T;  2CGJ A;  5DM7 L;  2NRW A;  3E66 A;  2Q97 A;  3CI5 A;  4MDA A;  2QWQ A;  2E8A A;  1WUA A;  2HBK A;  3T7Z A;  1XC3 A;  1TYQ A;  3SBT A;  2VGN A;  4JEP A;  4QS7 A;  5MLC Q;  3U4L A;  4G9Z A;  2V52 B;  3CCU N;  5DM6 L;  4MLE A;  3TSQ A;  1HPM A;  2NZT A;  3CCS N;  1MA9 B;  4K43 A;  4O5F A;  4BRC A;  3A5L C;  1K8A O;  2QM1 A;  2A6A A;  4FL9 A;  5AQW A;  3I33 A;  4FWL A;  4K25 A;  1Q81 O;  3TU5 A;  3C7N A;  4EAH D;  4H5W A;  2E1Z A;  2VWB A;  3FZL A;  1JCE A;  3VF4 A;  1YHQ N;  5EVZ A;  1NGH A;  2ASM A;  2Q1N A;  4CZK A;  4CJ7 A;  4FPA A;  1NLV A;  2ZGY A;  4PKH A;  4QS9 A;  4Z94 A;  1KXP A;  1VQ5 N;  2W41 A;  2RE2 A;  1Q18 A;  4YDU A;  2BUP A;  5LJW A;  3DAW A;  4WQ4 C;  2Q0R A;  4J8F A;  3FR0 A;  3GBT A;  4JKB A;  4BRH A;  3CPW M;  1Q86 O;  2YI1 A;  4BGB A;  1NGB A;  1NGI A;  3ENB A;  3BEX A;  4B1W B;  4BRO A;  4H0T B;  3R9P A;  1VQ9 N;  5GIN A;  1V4S A;  2H3G X;  1S3X A;  3SMP A;  4BRG A;  1HX1 A;  3TTD A;  3WQU A;  3J7Z O;  2ITM A;  3CC7 N;  3DXK B;  2F9W A;  1U6Z A;  3WT0 A;  2HOE A;  3D2F A;  4BRQ A;  3CCQ N;  3WXM B;  3ZEU A;  2JWL A;  1J6Z A;  4FPB A;  5AZI A;  2NRX A;  2QEX N;  3H45 C;  3R1X A;  5AZJ A;  1Z05 A;  4RWT A;  3IMX A;  4FSV A;  3H46 O;  3TTF A;  4B1Z A;  1VQP N;  3CHW A;  3O1W A;  2P9P B;  5CE3 A;  5M1Q A;  3LDO A;  3CC2 N;  3MCP A;  4AM7 A;  2QW9 A;  4YOY A;  2ASP A;  3MN6 A;  2ZJQ L;  1R59 O;  2IIR A;  4WFB L;  1RGI A;  2PFU A;  3MK6 A;  3A5N C;  3ENH A;  3RSE B;  3CJ1 A;  3H6E A;  4QS8 A;  3G71 N;  2QWN A;  1BUP A;  4IEE A;  2YHX A;  4RTF D;  3SAH A;  4IXC A;  2JWK A;  2ZJR L;  5BRD A;  2ASO A;  1YXQ A;  3SBG A;  2QWP A;  5JIC A;  4H0O A;  2P9P A;  5KQ8 A;  4RCH A;  5KPR A;  4CZJ A;  4L3Q A;  4CI6 A;  1BDG A;  1MWM A;  4FWS A;  1HKC A;  4WFN L;  5JVG L;  4HWI A;  3TTC A;  1V4T A;  2NNW A;  4CZF A;  2ZF5 O;  4CBW A;  5AQJ A;  3WXJ A;  1KAY A;  2E2O A;  3D2F B;  2HF4 A;  5FPD A;  4H0V B;  3VEN A;  3EZW A;  4FWN A;  4IEI A;  2FLO A;  3WEE B;  4IZ9 A;  1VAZ A;  5AQO A;  4B1Y B;  4EIA A;  3I56 N;  3AAQ A;  3FE1 A;  2NRH A;  3N4Q A;  1VQN N;  4BG9 A;  1LCU A;  5AFU A;  1MDU B;  1GLF O;  1BA0 A;  2AP1 A;  5B8H A;  3CME N;  3O9U A;  4WFA L;  1Z6R A;  1W2B M;  1WOQ A;  3L0Q A;  3WXL A;  3FLC O;  2Q0U A;  3EO3 A;  4FOE A;  4WQ5 C;  4H0X B;  3NVM A;  5AFU H;  1GLD G;  1YI2 N;  4IDH A;  3VF2 A;  3IFR A;  3CCV N;  2OTJ N;  3R8E A;  3CET A;  2P9L A;  2Q2R A;  5JMV A;  1M1K O;  5EX5 A;  2P9U B;  4BC4 A;  4U67 L;  4BRK A;  1S72 N;  1DEJ A;  4H0P A;  2HST A;  5M1O A;  4BQL A;  1ZC6 A;  5BN9 A;  1ILY A;  3LM9 A;  4JKG B;  5ELZ A;  4DKW A;  1GLC G;  1HLU A;  1U2V B;  4OPA A;  4PKI A;  2V51 B;  1VQ6 N;  4Y0W A;  1MWK A;  4FWO A;  4XH5 A;  1Y64 A;  2BTF A;  5AQK A;  3SAG A;  3DXM A;  1VQL N;  3UKU B;  4JHD A;  2PBD A;  3ZET B;  3O9S A;  2GUP A;  5AQV A;  5AQS A;  4AM6 A;  1NM1 A;  5F1X A;  5TKY A;  4IFE A;  1DGK N;  2HMP A;  4JKF A;  3C65 A;  4CZH A;  5BPM A;  3WXI A;  4FWR A;  4B9Q A;  3VMF B;  3L6Q A;  3BP8 A;  1NGD A;  2P9S B;  3UE5 A;  3KHY A;  4CZL A;  2NRV A;  1LOT B;  3G25 A;  4ILG B;  5GIP A;  2CH5 A;  1E4G T;  2HBM A;  1YF5 L;  3ATV A;  3IUC A;  4PKG A;  4BRP A;  3QFP A;  3R3L A;  3HSC A;  3ID8 A;  3O08 A;  4FWM A;  1SZ2 A;  3IKM A;  3ENO A;  1T6D A;  3CJB A;  4LC9 B;  3D7E O;  2D4W A;  3I55 N;  2WFB A;  3WUH A;  2GTD A;  1GLE G;  3A5M C;  2VGM A;  2QWR A;  3A5O C;  1SAZ A;  1NMD A;  2A41 A;  2E88 A;  1G99 A;  3MN7 A;  3QFU A;  4GV3 A;  1CZA N;  5AQI A;  1NGA A;  3K9J A;  3VGK A;  2Q36 A;  4CZG A;  5BPN A;  5AQT A;  5KQD A;  4GY2 B;  3HOT A;  3SAF A;  4MO4 A;  5EXW A;  2QWO A;  3CER A;  3RVC A;  2NRZ A;  4H03 B;  4H5R A;  5EY4 A;  5C2D A;  4UY8 O;  4JKA A;  3VTI A;  4GV9 A;  3WXK A;  3U9Z A;  4M63 C;  1P8Z A;  3DXK A;  5F0X A;  3ULE B;  5GIO A;  3LDP A;  4IWV A;  4YOW A;  4CD1 A;  5AQU A;  3CJ9 A;  4CD3 A;  3G4S N;  1KC8 O;  5AQM A;  4CZI A;  2FSJ A;  2WBN A;  4H5T A;  4A57 A;  4NLC A;  3MX5 A;  4JKD A;  1ZXO A;  1NWK A;  3VES A;  4A5B A;  3C6H A;  1K8K A;  5FPM A;  4GV6 A;  2GWJ A;  2Q31 A;  4JD2 B;  1P90 A;  3A0I X;  5GAH P;  3PIP L;  4ISG A;  2OTL N;  3FZK A;  3LM2 A;  4WQ4 A;  4C23 A;  4ILJ A;  3CPE A;  2FF6 A;  3PIO L;  3JXU A;  4O8U A;  3CJC A;  1TUU A;  5AQQ A;  4YDU C;  3HI0 A;  2NLX A;  2GEL A;  3GG4 A;  4WQ5 A;  2YHY A;  1HUX A;  3IDH A;  5FPN A;  5AZI B;  2YJF A;  4A2B A;  4OO1 J;  5BRH A;  5LJV A;  3B8A X;  2AA4 A;  4JD2 A;  5AQF A;  4JNE A;  3F2K A;  4BRN A;  4CBX A;  2QA4 N;  4M7X A;  1QZ5 A;  5AQN A;  3NMU A;  3NVK A;  5AQR A;  1IJJ A;  1XQS C;  2YHW A;  2P9N A;  3H1V X;  4M7Y A;  3HM8 A;  4FWQ A;  2ZJP L;  4BR9 A;  2CH6 A;  4JAX A;  1C0G A;  3FZF A;  1GLL O;  3ULE A;  2GWK A;  2HF3 A;  2VYP A;  5C15 A;  2WUS A;  5JLF A;  3TSU A;  1ZBS A;  4R79 A;  3U8X A;  1KD1 O;  1QVF M;  2P9U A;  2BH1 A;  1GLB G;  1NBW A;  3KK7 A;  3EE8 A;  3F9M A;  4DQ8 A;  3WEE A;  1T6C A;  5CR4 A;  4WF9 L;  4XH1 A;  1JJ2 M;  3P38 A;  3Q7B A;  2D0P A;  3GDQ A;  4BC5 A;  3FFK B;  2A40 A;  5M1N A;  3QDK A;  3TPQ A;  3CC4 N;  1VQK N;  4XEI A;  3EKS A;  1OVY A;  3QIC A;  3QML A;  2ZWH A;  4IOC L;  2CGK A;  1YJ9 N;  3AAR A;  5BRE A;  3CCE N;  1S22 A;  3ID6 A;  3H1Q A;  3LDN A;  4A61 A;  4BRI A;  4PL7 A;  3HOS A;  5C10 A;  1YIT N;  4BR7 A;  1YIJ N;  1GLA G;  3E9O A;  5GAD P;  4NO7 A;  5C12 A;  5F2R A;  4ISF A;  3VGL A;  1JCG A;  1HJO A;  2HBL A;  3EE9 A;  3E1Y A;  1DT9 A;  1NGJ A;  3CJA A;  2F9T A;  1EQY A;  3VEZ A;  1BO5 O;  1T3V A;  2ZGZ A;  4JK8 A;  3MWP A;  3MN5 A;  2V7Y A;  3FZM A;  4DB3 A;  3QBX A;  3VOV A;  1D4X A;  1RDU A;  2QI2 A;  3LL3 A;  3MDQ A;  3HZ6 A;  2GEM A;  3L4I A;  3R6M A;  5BPL A;  5TKW A;  3HBT A;  1YJN N;  5HL7 L;  3ZX3 A;  3BUZ B;  2FSN A;  2NRT A;  2QXL A;  3O9T A;  3O80 A;  4K42 A;  1KQS M;  3KWG A;  2P9S A;  3E9P A;  4GNI A;  4BC3 A;  5ADX A;  3CIP A;  1KAZ A;  4IJA A;  3VEY A;  1HKB A;  4IJN A;  1H1V A;  3E9L A;  3ZEU B;  4C1N I;  3LDQ A;  1SS6 A;  1HKG A;  3QB0 A;  4FO0 A;  4I6M A;  4JN4 A;  3DJC A;  5FPE A;  4FVU A;  4FWK A;  3VPZ A;  1NGE A;  3GE1 A;  3OHR A;  2FXU A;  5AR0 A;  4EHU A;  3M5R A;  3P31 A;  4YOU A;  2E2P A;  2KLA A;  3O1B A;  3VEV A;  3Q7C A;  3CCL N;  4A59 A;  3CF5 L;  3UKR A;  4BRL A;  4A62 A;  4BRA A;  1JCF A;  3H3N O;  3MN9 A;  2W40 A;  3P39 A;  1DKG D;  2UYT A;  4K41 A;  5AQP A;  3U9D A;  3VGM A;  4I6M B;  1SQK A;  2YX6 A;  3ZET A;  1VQ4 N;  2QTD A;  3M3Z A;  5AQX A;  4BC2 A;  4PHT X;  3N4P A;  4PL8 A;  5E84 A;  4CZM A;  4H0Y B;  1NJI O;  4NB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...