3L4QA

Structural insights into phosphoinositide 3-kinase activation by the influenza a virus ns1 protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
b'SVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
molecule tags Viral protein/protein binding
source organism Influenza a virus
publication title Structural insights into phosphoinositide 3-kinase activation by the influenza A virus NS1 protein
pubmed doi rcsb
total genus 31
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3l4qA00
3P38A 3KWIA 3M5RA 2KKZA 3OA9A 3KWGA 4OPHA 3O9QA 3L4QA 3O9SA 3F5TA 3D6RA 4OPAA 3EE9A 2RHKA 3P39A 3O9UA 3RVCA 3EE8A 3O9TA 3O9RA 3P31A 2GX9A
chains in the Genus database with same CATH superfamily
1NK4A 1Q82O 4DSFA 1QVFM 3DM2A 5BR9A 3VGMA 3A5MC 3QESA 2O8DA 3E9OA 1YVNA 4JYAK 3ID8A 4PL7A 4N56A 4NXNK 3EE9A 4GV9A 1NWKA 2GBZA 1D9DA 5BPLA 3K5NA 3UIQA 3AA3A 1XC9A 4G9ZA 3IKMA 4WYBA 3O4WA 4CZIA 1KQSM 2P9PA 4N47A 5ADXA 4BE0A 4HTLA 4H0TB 4LH5A 4BRLA 5DM6L 5H1SQ 3KLIA 1HR0K 1RT2A 1Y64A 3LDNA 1P8ZA 3E1YA 4CEZA 1QTMA 5J2MA 4DTOA 3CJAA 2HBJA 2XY6A 2WOMA 4OKJA 4CHZA 2WTUA 1C6VA 3KJVA 3TAQA 3SAGA 3VEVA 2A1SA 2P9KB 1Q7YO 2P9UA 1YHQN 4CEAA 2KLAA 1NGBA 5BRDA 4JRQA 2QWNA 4DTUA 3TTFA 3SV4A 4C1NI 4DKWA 1HRHA 1T3VA 4FWRA 4WF9L 4M7XA 3AVGA 4O0JA 3MDQA 3ZT1A 3TPQA 1KXPA 3P5JA 1MWKA 4YY3K 4BGAA 3SQ4A 4V19S 3UKUB 4E19A 3J80O 2JLEA 2E6MA 2ZJRL 1M90O 3VGLA 2W6LA 2EWSA 5M1PA 3VERA 1QS4A 1UWBA 5FPMA 3MXIA 3PUFA 3LWLA 4FLVA 3FFIA 4BQLA 4A2BA 2WONA 3HOTA 3EYZA 3LALA 5LJWA 2QM1A 1EXQA 2DTUA 1QQOA 1VQMN 4H8KA 3WXJA 1LV5A 1U04A 4W5NA 5BR8K 1QVGM 3THYB 3TAMA 1YAGA 4FPAA 4FWSA 2RE2A 5LMUK 1SV5A 1ZBFA 4B3TK 3CPEA 1LW2A 1TKDA 4XIUA 3BF1A 4GY2B 4DQIA 4ZTJA 4A59A 3L6QA 2P9UB 4DG1A 2NRTA 3T1YK 3ZSOA 1NGEA 5EXWA 3TTDA 4DB3A 3S3NA 3P4IA 4I6MB 4AM7A 4JRPA 2DFEA 2HB5A 3WXLA 4K0KK 5KRTA 1VSEA 4NB4A 4JI7K 3TU5A 2YKNA 2G8UA 4BRQA 1IG8A 3CI5A 4A5AA 1HQUA 3SZ2A 3SMSA 5JS1A 3OYBA 1BI4B 4FYDA 3FZMA 4DFPA 1FW6A 1C0UA 3QBXA 1KVAA 4DQSA 1NNEA 2WUSA 4CEBA 5KI6A 1JLGA 1RT1A 1YJNN 3Q7CA 3KIOA 2NRVA 4M3YA 3T1AA 1RTJA 4JHDA 4DV6K 2X74A 1CZAN 3F5TA 1IKWA 2QKKA 4BROA 5DM7L 3UB5A 5FRNA 1EETA 5M1QA 4BWMA 4Z4FA 4RW6A 4N5SA 1JL1A 2IVPA 1RGIA 3OYAA 3EZWA 3EO3A 4IEIA 1YTUA 3LZIA 2IIRA 3L3VA 5M1KA 3NE6A 4BE1A 3SMPA 4IG3A 2HBKA 4C8NA 3VEWA 2B6AA 4IG0A 2KFZA 3V4IA 4E7HA 2B4JA 1U2VA 4LF5K 3MECA 5AQKA 2YV0X 2JWLA 1QQMA 3LM9A 4Z4CA 4E3SA 1T6DA 3VQPA 4QOZB 3BDPA 4KH4A 2ASPA 2QEXN 1Q86O 2XY7A 4FWPA 1NMNA 2FBVA 4FLZA 3KK1A 4LSNA 2J4RA 3C6TA 3VQ5A 3ENHA 1L3TA 1IKXA 3KD1E 3C7NB 3AVIA 3RRGA 3OYFA 1V4SA 2FXUA 4ZHRA 1OH8A 1A5VA 3A5NC 1KFDA 3LDOA 3R1XA 4H4MA 3LP3A 5EU7A 1ZBHA 4DQ8A 4FWNA 4XEIA 4JKAA 2VG5A 5FPDA 3QNOA 2A40A 3NH0A 4QAGA 4DFMA 2OPPA 4E89A 3H1QA 3NVMA 2E88A 2Q0UA 5HROA 1TUYA 4YOYA 4NCBA 3MCPA 3QBWA 4JEPA 4O8KA 1S3XA 1GOAA 3QFPA 4JKDA 3KD5E 1UOCA 3BZCA 4WCEL 1QZ6A 3U4LA 3VQQA 4Z0UA 4EZ9A 2OCEA 3ZSYA 1D5AA 4DR2K 3ZETA 1T7PA 1VSDA 3CF5L 4EP5A 4M41A 3ATUA 1OH7A 3IS9A 1QZ5A 2OZSA 4FLXA 3EN9A 1SL0A 2E2OA 1J53A 3CD6N 3OYGA 3M3ZA 1U49A 4DSJA 3AARA 1EWRA 1KAYA 3DYAA 1W97L 3QEIA 3QEXA 1S9EA 3HM9A 2GWJA 4BACA 3OS2A 4KHNA 1GLCG 2IOCA 4J2DA 3FZHA 3VF6A 4RG8A 1U45A 5HOOA 1BCOA 2I7PA 1S1WA 2ZGZA 4CZFA 4LFBK 2HBLA 4ZTFA 5KQ8A 1JLEA 4FWKA 3DWLA 5IWAK 4NO7A 3FLCO 4FVMA 4IKFA 3PO5A 3GL1A 2PYJA 2P9KA 3SJJA 3R3LA 4CF2A 2F4VK 3ITHA 1VHXA 2HHXA 1UA0A 5JS2A 3RR7A 2A41A 3VQ7A 4YDUC 3HOSA 1BGXT 3ZSWA 1XQSC 3TAEA 1HNWK 3F9MA 1KLMA 1EQYA 4JI1K 5JMVA 3VQDA 3QNNA 4JKFA 4OX9K 4BR0A 2E2PA 1NJWA 4CBXA 1N8RO 3K9KA 2ZJPL 3D45A 2YHWA 2Q36A 2P9LB 3IG1A 4CGDA 2Z1JA 4BY9C 4MDAA 1VRUA 4ICLA 3J81O 2VYPA 3M6GA 4PHTX 4NLBA 4QCLA 3AVFA 4FM0A 4CJ5A 4JK9A 3OYDA 3W3DA 4JD2B 1VQON 3RMAA 1T8EA 5CYQA 3BY5A 1HMVA 1VQLN 2UXDK 2FC0A 4CZGA 3H3OB 3V1OA 3DXKB 2OA8A 4CJTA 1C0GA 4B3OA 4PKIA 2A42A 3V9UA 4KTWA 3TWHA 3ZCMA 4E1NA 5EOYA 4XH4A 5AQMA 4DLEA 4FZYA 4YOVA 1V4TA 4QS7A 5AJ3K 2O8EA 1DTTA 2X6SA 3DRSA 1FJGK 3FZLA 1HKCA 3QINA 5J1EA 3KK3A 4IZ9A 1GLBG 3A0IX 3J7AP 3KZBA 4DQQA 4GKKK 4ISEA 3FE1A 4DR6K 3TAFA 4BQZA 1U6ZA 3WNHA 3LPTA 3OYIA 3V1RA 4JI0K 2EHGA 3AVKA 1N36K 5C0YA 2F9WA 3NF6A 4B9NA 3WXKA 1BCMA 3HSTB 4AHSA 3DJCA 4IBNA 3HI0A 3IUCA 5AQRA 3C94A 4CJFA 3CCEN 1QQCA 2RN2A 3LP1A 4W5RA 2YX6A 4UQGA 3PX6A 3O9SA 4F4KA 1ATRA 3V9ZA 2B5JA 3T7ZA 1ZBLA 1JCFA 3E9LA 3THXA 4B3SK 4JI8K 1C1BA 4IOCL 2BGGA 2DFHA 4BE2A 4DLGA 3SQ0A 1KAXA 1U2VB 2DY4A 1WAFA 2PZSA 4OKEA 5CE3A 3T1HK 1S6QA 4YOUA 3K5LA 3PX4A 3PIPL 4F2RA 4GKJK 4L8RB 4CESA 3SAFA 4FO0A 4CJKA 3WEEB 4DSEA 3SUPA 4R79A 1WBDA 1NK9A 3LAMA 1N33K 3K5MA 4EHUA 2GV9A 2YNHA 2UXBK 1NKBA 4KAZA 1XC3A 4A5BA 3VETA 4KTQA 4IXCA 4DTSA 5AQFA 4JI3K 2IS3A 1HPMA 1OKJA 4PQUA 1C0FA 1JL2A 4FZZA 2LSNA 1X1PA 1NGIA 4AHRA 1R0AA 3ENBA 4LF6K 3O08A 4HWIA 1BIZA 1HJRA 3VQEA 4CHYA 1WUAA 5ADXH 4K8ZA 2NLXA 1VQ5N 4AF1A 4IOXA 3L2UA 4M45A 4CBWA 2ETJA 4BRHA 2YCHA 1RBSA 2YHBA 1YIJN 1Z6RA 1GLFO 4B1WB 1BQNA 3OYCA 1XMOK 4I9LA 4JKBA 4YDUA 3N4PA 4OJRA 1WN7A 2I7NA 2UUAK 4CJSA 3QO9A 5BRFA 4JN4A 4DTPA 1ZC6A 4FCYA 3O9QA 4LD0A 5HRNA 2OPSA 3SYZA 1VQPN 3KVGA 2RF2A 4CD1A 2CGKA 1NOZA 4ILJA 5FDLA 3SQ2A 3G10A 1XWLA 4PKHA 2YNFA 3ZYYX 4FJMA 3LDSA 5KPRA 1ILYA 1EX4A 3GDQA 4M42A 1LAWA 2OTLN 3A5LC 4IOAL 3WXMB 2X78A 2KKZA 4GV3A 2XO7A 1J5OA 1FK9A 1TK5A 4JK8A 3E9PA 4HUEA 3AAQA 4LSLA 3KK2A 2P9SB 3RWUA 2WFBA 3VQ6A 3FZFA 5AQTA 4JI2K 4DR1K 4DR7K 3DRPA 4FK0A 5AQOA 1TYQB 1XHZA 4CFCA 1TKZA 2V52B 4G1QA 3PSFA 3U9DA 4IWVA 4BRCA 4HTUA 4OPJA 4H0XB 4BRPA 1WAJA 5LJVA 1NGHA 5B8HA 1GLLO 3TAPA 5AQHA 4JI5K 1A5WA 3E01A 3P39A 4OGEA 2Q1NA 2F96A 3AVNA 3C6UA 2UXCK 4DSIA 5AQPA 3DLKA 1T03A 3HT3A 1G15A 1BA1A 3VF2A 3G71N 2O8DB 1RTDA 1WOQA 2UU9K 1DLOA 4XH5A 3U6FA 4FJIA 4Y1CA 4CGGA 1K8AO 4M3XA 1Z26A 2Q97A 1IBLK 5DMRA 4Q5VA 3IFRA 5I9EB 1X3MA 2P9PB 4KHWA 4CGHA 5HLFA 1Q8IA 4ISFA 3OYHA 4DV4K 1BISA 1IG9A 2P5GA 4NLCA 2W40A 4F2SA 2Q31A 4BRGA 1N6QA 1JLBA 3L2RA 3K57A 4KKOA 4K41A 4CJPA 2BE2A 3U8XA 1RILA 1HNVA 4DV0K 2XRIA 2KW4A 1J54A 4BC3A 1NM1A 2VQEK 4DQPA 1YF5L 1YITN 4BR4A 3CFPA 3BEXA 4CF1A 3SPYA 3ISNC 3OS0A 3PIOL 3HPOA 2HMPA 5CZ2A 3K2PA 2O8FB 5MLCQ 3IAYA 4BVPA 4IFYA 1HNXK 4IDHA 4BGBA 5M1OA 4YOTA 1VQ8N 1RBUA 4JNEA 3TARA 1WSIA 1KRPA 3CHWA 3A8YA 2KFNA 1HYSA 1NKEA 5HRPA 4B08A 3I8BA 1QSYA 3DMJA 2UUCK 4YOXA 4GVEA 2GELA 5E26A 2HHQA 2ZE2A 3QEVA 5SWMA 3WT0A 5JLFA 3HVTA 4L3QA 1SL2A 2VQFK 4BC4A 1GLDG 4OLAA 4A2AA 4CF9A 2BTFA 2CH6A 3Q7BA 3P38A 3VQCA 3AV9A 5HRSA 3QICA 1U4BA 2NRWA 1FKOA 1HKGA 3MXJA 1SUQA 3AVAA 2OPQA 3VEXA 2E8AA 3PO4A 4B3RK 3R8EA 1YUWA 4AH9A 4X62K 1I3AA 3O1WA 2ZGYA 3O3HA 5AZJB 5GIPA 2O4GA 1GOCA 4FM1A 1BQMA 5CYMA 1BL3A 4CJ4A 1TL3A 2YNIA 3ZEUA 5AQVA 5AR0A 3HM8A 2GUIA 3NH1A 2G8IA 1B9DA 2HHHK 1KFSA 4YORA 3G25A 3R9PA 2O8FA 3CFRA 3CMEN 2VGMA 3D2EA 4DFJA 2D1KA 4OKKA 2ZF5O 1CLQA 2YHYA 4BG9A 2IVNA 3MK6A 2IC3A 4HHTA 2QI2A 3MN6A 3DRRA 3CCRN 5M1NA 4WQ5C 1RDUA 3T3FA 4H0OA 1GLJO 1HJOA 4JHDB 4ELVA 3TSPA 5F2RA 4KREA 2HW3A 4JS4A 3QDKA 3OYNA 3GOIA 4OLBA 5I42A 3HP6A 4FJ8A 4CJRA 2XY8A 1T05A 3VQ4A 5J2NA 2HHUA 1ATSA 1ZXOA 3M8RA 2ZJQL 4NYFA 3AVLA 3RTVA 4IJNA 2Y1IA 2P5OA 1BU6O 1RFQA 4TSXA 2KQ2A 2P51A 3IMXA 1OVQA 4BC2A 1IJJA 1NK5A 1Q18A 2UYTA 5FLXO 4B1VA 4Z4GA 1SKWA 4BRIA 2QA4N 4CK3A 5BN9A 4DU1A 4M3UA 3TR8A 1RTIA 3CPWM 4LC9B 1RT5A 1SQKA 2BANA 4W5TA 2IDOA 1LWFA 3TI0A 4XH1A 1JLCA 3ATVA 2HF4A 4FL9A 2PYLA 2YI1A 3U3YA 2HHTA 4O55A 1P90A 3NGZA 4DTXA 2KTQA 4BR9A 5GAGP 1X9JA 4HUFA 4FSVA 4DCHA 3D2FA 4LH4A 3MN5A 2G8KA 1TKTA 4AHCA 3MN9A 3MWPA 3S3OA 1NGAA 3BZKA 4KPYA 5BPMA 4E7KA 3AVJA 1L3VA 3MEEA 4FWMA 3QFUA 5C12A 5CY4A 4JS5A 4CW7B 1ASUA 1BUPA 4QS9A 2E4LA 3NF8A 5C24A 1S72N 3TSQA 4BR5A 1Q81O 3ZSZA 4DV3K 4CJEA 2G8HA 3MAQA 3C0BA 3RMBA 3OYLA 1JLFA 3CCUN 4C8KA 5BREA 4YNQA 4M63C 4FJNA 2F9TA 2ZM6K 3O1BA 3LP2A 2O8CB 2D4WA 2IAJA 2VWKA 2QTDA 4KRFA 3AVBA 4DV2K 1TUUA 1LOTB 4OPAA 5K14A 5KQDA 3CQYA 3CMAN 2P9NA 4W5OA 1OVYA 3ZETB 4AQYK 2ITGA 2QWQA 3O9RA 3LDQA 5C10A 4KHPK 4B9MA 1RCHA 3CERA 4ILHA 3KHYA 1ATNA 3HPGA 4X65K 1SL1A 1G99A 4WQ4C 4DTJA 4ISGA 5IT9O 3I33A 4CZMA 2XHBA 1NGDA 1SZ2A 1TGOA 1ZYQA 3ID6A 5AFUA 4HCBA 2Q0RA 4JKEA 3WNEA 2HMIA 4DU4A 4FJKA 3SUNA 3H45C 4W5QA 1VQ6N 2E1YA 3KLHA 3OHRA 1K8KA 3HYFA 3O4NA 3CYMA 1JXBA 2P9LA 3SAHA 3UE5A 1NK6A 4M3ZA 3NMUA 2NRHA 5C25A 2OTJN 1KTQA 3ULEB 1K6YA 3OA9A 4KHYA 4KI6A 1HNIA 3L4QA 3ZSQA 4YHHK 1SKSA 5JVGL 1EWQA 4H4OA 4X64K 5LY3A 3KLGA 4FLUA 2VG6A 2GWKA 4KB0A 3PX0A 1YT3A 1WSEA 1RT6A 2HNZA 1OH5A 3SBGA 4M3RA 3SJHA 1BO5O 3J7YP 4MLHA 2FSJA 3QEWA 3EEQA 2NNWA 4H0YB 3GBTA 3L4IA 2GX9A 1RDCA 3ASMA 3AO4A 4C8LA 2ZWHA 1W2BM 3H3NO 4ID1A 4FJLA 2D0AA 3OYEA 1HQEA 4X66K 5LL6Z 3JAMO 3FR0A 3WNGA 4CE9A 5FPEA 3CC7N 3EKSA 2QWMA 1WNSA 3CG7A 3TANA 3MXMA 1D9FA 1RBTA 3OBYA 1VK0A 3K58A 4H0VB 4RCHA 3QB0A 4WFBL 4LF9K 1HPZA 1GLEG 3H08A 3QLHA 1NGFA 3PV8A 5JLHA 5AZJA 2IGIA 5C42A 3SPZA 5E41A 3M8SA 4IFVA 4Z4EA 3OBWA 4B1ZA 5C2DA 2QW9A 3IDHA 1Q9XA 4BRNA 1NOYA 4OO1J 3BF3A 4J2BA 4K43A 2D0OA 3D2EB 4JK7A 4B1XB 2P1JA 4DR4K 3DLRA 1LAVA 4CFBA 1T6CA 4CVNE 1K8KB 2V7YA 1CXUA 3V9WA 3THXB 2AJQA 3ULEA 4JI4K 1I94K 2NZTA 4DV7K 4O44A 2IVOA 4PL8A 3VQAA 3FFKB 4CFDA 2DPNA 3HZ6A 4KH5A 3SCXA 4CEDA 3ULDA 1YVUA 1YJ9N 1BWFO 3AVMA 4F3TA 2YJFA 5HP1A 3EE8A 4CHQA 3I0RA 4JKGA 2A3ZA 4B9SA 4DSLA 3DLBA 2VG7A 4E1JA 4F9OA 4I2PA 2OANA 1ITGA 1S1VA 2NUBA 3KKRA 3WQUA 1NK8A 4DR3K 3OYMA 3U3GA 2NRXA 3J8AA 1W7AA 1MU2A 4U67L 4DQRA 4FLYA 1KSPA 1WSGA 1HLUA 4CIFA 1NJYA 3NVKA 4A57A 4E7JA 4B3MK 3DOKA 5AQWA 3W0LA 3ZT4A 5CHIA 4WQ5A 3P83D 1S6PA 1TAQA 4HUGA 2V7ZA 4JAXA 4Q0BA 4KI4A 3HSCA 2ASOA 2Y1JA 1RBRA 3O80A 1NKCA 2BH1A 3OVNA 1JLAA 1NMDA 1HNZK 3MX5A 1BI4A 1VSLA 2ASMA 1VSIA 3F9KA 3VPZA 4H5RA 3M8QA 4GV6A 4C1NK 1NK0A 3I56N 4DUZK 3QETA 1S9GA 1S1TA 1S5JA 1O1WA 1IO2A 4A62A 2FBXA 5F1XA 5T7BA 5EY4A 1RTHA 4CIEA 4R5PA 1U48A 3ZSVA 4KBOA 4JI6K 4J8FA 1ASVA 3A2FA 2HBMA 4DF4A 3NGYA 3AGKA 4WQ4A 1H1VA 2RKIA 4C8OA 4PKGA 4EAHD 4M7YA 1KCFA 4N41A 1LCUA 4DTMA 4CF8A 4Y1DA 1JJ2M 5TKYA 2OPRA 1IBMK 4F3OA 2E1ZA 5J2QA 2FF3B 4I9QA 3KLFA 5AQSA 4N76A 3G6EN 4FJ7A 1W9HA 4NCAA 4RW4A 3OTOK 3AO2A 5AQIA 2R7YA 4B1YB 4EFHA 3FGUA 4CJ3A 5M1FA 1KC8O 1XMQK 2OZMA 5SZTA 2HF3A 1KD1O 2H3GX 5HBMA 5A2QO 4CEFA 1UAXA 3WNFA 2F8SA 2E2NA 2AA4A 4B9TA 3SUOA 1F21A 5I3UA 1DGKN 3O6WA 3HK2A 4BR7A 1NU0A 5KTQA 4NCGA 2JGUA 3G0ZA 1KVBA 4DS4A 3EY1A 1TYQA 3JSMA 4O8UA 3VQBA 1N32K 4FOIA 4BRFA 4CZJA 3RSEA 4PA1A 2FSKA 3LM2A 1VQNN 1FXXA 3AVCA 4RTFD 2HVHA 5BN8A 3LANA 1VQ4N 3JXUA 4FW2A 3NFAA 1BG3A 1C0TA 4DHYA 3VEZA 3R6MA 3T69A 4FK4A 5BPNA 3UKRA 4PUOA 2P9IA 4RW9A 4K42A 3UKUA 3NCIA 4AHUA 1ZBUA 1DEJA 2D0BA 1S1XA 1VQ9N 3EL2A 5AQNA 2QWLA 1L3SA 2UUBK 4DTRA 1BIUA 1QQNA 2YNGA 4O5FA 3HRGA 1NJZA 1W0HA 1J9AA 4CIGA 2W6KA 1X9SA 1NK7A 4FJGA 2YJEA 3JS6A 4CHOA 3CCVN 3VA3A 1OH6A 1YXQA 3VOVA 4CEOA 4LY7A 2D0PA 4H5NA 4CJVA 2AP1A 3QMLA 4LF7K 3KK7A 3S9HA 2HOEA 4CZKA 2DFFA 4U7BA 4CZLA 2QK9A 3P31A 3VEOA 3K59A 1Z05A 2HSTA 3CJ1A 4OPKA 3E66A 4FM2A 1YTAA 1X9MA 2QWPA 3RR8A 5KPTA 4BDZA 3M8PA 3DLHA 1WLJA 3TAGA 1SKRA 1X3NA 3D6RA 3LL3A 4CEEA 2FF6A 2VWJA 4I6MA 3OYKA 3VENA 2GEMA 5HL7L 4BREA 1KAZA 1REVA 4FPBA 4CJQA 3L8BA 3LZJA 3THWA 3F73A 1XUPO 5JICA 1DTQA 2YKMA 3L2QA 5AQXA 3OJSA 2E5LK 3HPHA 3V81A 5LMNK 1E3MA 3H1VX 3NF9A 1WSFA 1VSHA 4CI6A 1K9MO 1SAZA 1T44A 4E7IA 1VRTA 1ZBIA 4DMNA 4FOEA 1VQ7N 5C2FA 1ASWA 3CM5A 4CJLA 3DXMB 2RPIA 3CCJN 5TKWA 3NDKA 4CF0A 1IH7A 1LWCA 1MA9B 1J5EK 5AFUH 4CD3A 3CXCM 3GG4A 3CETA 4H5TA 2D5RA 4FZXC 3O4QA 3P1GA 1HX1A 3MN7A 4CK2A 3NBPA 4E0DA 4IO9L 4DS5A 1RNHA 1TVRA 3LAKA 5GADP 4FJHA 4AILC 1ZBSA 1D8YA 4PY5A 3CCMN 4JD2A 3L0QA 1HYVA 4CECA 3LWMA 4FJ5A 5D3GA 4J2AA 4B9LA 5CZ1A 3VQ8A 3AVHA 3ZX2A 1YJWN 2QXLA 1RDAA 1FKPA 4EHTA 3O8MA 4H0PA 4HCCA 4JKGB 1B9FA 1BDGA 1MDUB 3HP9A 4BR2A 4EIAA 4GNIA 4QS8A 3O3FA 1LW0A 1S1UA 2ATQA 3WUHA 2VWBA 4JKHA 3DLLL 1S22A 2VCPA 4BVOA 4FVUA 4FWLA 5GIOA 3V9SA 1RDBA 1NJIO 3I55N 1E4GT 2P9SA 1HYZA 2Z1GA 3KKSA 2HVIA 4BG8A 3HXMA 3QEPA 1U47A 1R59O 4DU3A 5HRRA 4KH6A 4O4GA 1Z25A 4M3WA 2HHSA 4LFAK 2X6NA 2O4IA 3AO3A 3O9TA 2ZQBA 3HVRA 4B8CA 2O8BA 3M5RA 5AQQA 1IBKK 3ZT0A 1TL1A 5J2PA 1XI1A 4BDPA 3ALYA 4B8AB 1MWMA 2V51B 5GAHP 3V6DA 4FWQA 1VAZA 2YHXA 3V1QA 4JLHA 1WSHA 5KRSA 1JLQA 4Z94A 3TSUA 1BHLA 4FWOA 4DUYK 1C1CA 3VA0A 1JCGA 1WB9A 3AA2A 3HL8A 4LF4K 5AQGA 4CHNA 2F8TA 3DAWA 3OJUA 3LP0A 3NHGA 1NGJA 3I0SA 3VQ9A 4ELTA 4CEQA 3VESA 3I8DA 4KHQA 3T19A 1TV6A 4H5WA 4FXDA 3DOLA 3RSEB 1NJXA 3CIPA 4I2QA 1N5YA 3B6PA 5AZIA 1D4XA 3AO5A 3RVCA 4B9QA 1WSJA 1TK0A 3D2FB 3TABA 3SK3A 5EVZA 1M1KO 3CCQN 4BRAA 1A5XA 1RDDA 3CQXA 4AHVA 5JVHL 1K73O 2WC9A 4UY8O 2PFUA 4DV5K 2GUPA 4KV8A 1TKXA 3ENOA 3C65A 2A5XA 3SUQA 1J6ZA 1KLNA 1QE1A 3VF4A 3EKUA 4IFEA 4AM6A 2NRZA 4DFKA 5C15A 5BRHA 3KWGA 3ZX0A 1CZBA 3CM6A 2Z1IA 3CC2N 4IJAA 2A1RA 3BP8A 3UKRB 3AO1A 3QERA 1IV0A 2P9IB 3O5BA 3NGIA 4RW7A 5AQYA 3RMDA 1QHAA 3LDPA 2P9NB 1VSMA 4BRKA 4CHPA 1O13A 4ID5A 2QKBA 1NLVA 4OGCA 4IO8A 3SV3A 2KZZA 2FSNA 4WFNL 4ILGB 3RMCA 1IKYA 3MMVA 1XNQK 1EO1A 2FBYA 3FZKA 2D0CA 1CZ9A 3KLEA 2O8CA 4K25A 4IDKA 3DXKA 4B1UB 4MDBA 1QHTA 3SNNA 3SQ1A 3DLGA 2HHVA 1NGCA 4CJWA 2Q2RA 3DI6A 2FBTA 4M3TA 3PSIA 2F7TA 3NAEA 3KWIA 4KTZA 1EKEA 2O8EB 3HO1A 3G4SN 4CJUA 4BRMA 3THWB 3AA5X 2ITMA 4YOWA 4FJ9A 4CZHA 3U9ZA 3QIPA 3VN5A 3OW2M 4DWIA 1XNRK 3OY9A 3VEYA 4FW1A 4CGFA 1GOBA 1B92A 4KFBA 3MWTA 5EX5A 1VSJA 4DSKA 1HKBA 2Z1HA 3B8AX 3NH2A 2I5JA 3H46O 3CCLN 3V9XA 4CERA 3PY8A 4NXMK 1E4FT 3MCAB 3ZEUB 3K0SA 4OPHA 3AA4A 4C23A 4E1MA 4CGJA 4NYNA 3N4QA 3CCSN 4MQ3A 4BDYA 1RT4A 1XHXA 3IRXA 5DK5A 2Q3SA 4FLWA 3ZT2A 4KO0A 1LWEA 3L3UA 5GINA 4K8XA 4CK1A 3CC4N 3HBTA 5FRMA 1L3UA 4BRDA 4RW8A 3ZX3A 3OS1A 1YI2N 4FJJA 3ZSXA 4A61A 2G8WA 1JXEA 4LF8K 2E6LA 3CFOA 3AGRA 2E20A 3DXMA 3AY9A 2RHKA 4GW6A 4C8MA 3JYTA 2VGNA 3WXIA 3D0PA 2FLOA 4EZ6A 3S41A 3O3GA 3WEEA 1RT3A 4DV1K 4FK2A 4Z4IA 1DT9A 3THYA 4RWTA 1EP4A 3AAPA 4I7FA 4H5VA 1I39A 4O5BA 5FPNA 3SBTA 3VGKA 3HJFA 4Y0WA 1NGGA 2CGJA 3B6OA 2G8FA 4EP4A 2CGLA 4IEEA 5CR4A 1C1AA 1GLAG 2CH5A 1VSKA 4FJXA 3NF7A 3CQ8A 4MO5A 1SS6A 1KVCA 4CFAA 2JWKA 2GTDA 3DLEA 5KGWA 4MFBA 2OYQA 2QWOA 1QSSA 2O8BB 3S3MA 2BDPA 4DR5K 2YHAA 4BC5A 2G8VA 2HNYA 3SI6A 4KHSA 1NG9A 3ZSRA 4WE1A 1Q9YA 4CJ7A 3OYJA 1DKGD 1JKHA 2HNDA 2E2QA 2QWRA 2WBNA 4JKCA 2W42A 3A5OC 5ELZA 1C0MA 3TTCA 3H6EA 1L5UA 1WBBA 3J7ZO 5E84A 3CJBA 1BOTO 4Z4HA 4F8RA 3CJ9A 4KHUA 2HHWA 3HTVA 1NBWA 1Y97A 3KTQA 3GE1A 3RRHA 3C95A 1JCEA 4H03B 1IKVA 4DF8A 4CCHA 1BA0A 2W41A 5AQLA 1TAUA 3VTIA 3MX2A 4AHTA 4MO4A 1RBVA 5GAEP 4CBUA 4FLTA 4OVLA 1ESVA 5AZIB 3M1FA 5KGXA 3VMFB 3QIOA 1X9WA 3L2WA 2PAVA 4KB1A 2ZD1A 2A6AA 3K5OA 1RDWX 3LPUA 5AQZA 3K9JA 1UA1A 3MEDA 1N34K 4LFCK 3THVA 1RT7A 1TK8A 2NRRA 3CJCA 3O9UA 3PLAA 1VSFA 5AQUA 4CGIA 2QXFA 3ZLJA 5KPZA 2KZMA 4O0IA 4GMJB 2PY5A 4E7LA 2BUPA 3VTHA 3C6HA 4ELUA 3MEGA 3BUZB 4J2EA 1CXQA 3CJ7A 3D7EO 3LDLA 4B9VA 1HUXA 3C7NA 4GVMA 4YFUA 3SLCA 4B9UA 3EZ5A 1VQKN 2KHOA 5AQJA 3ZT3A 1QSLA 3L2VA 4WFAL 4BWJA 3F2KA 4PWDA 4MLEA 4CZEA 4HVJA 4DTNA 5F0XA 3C6AA 3BGRA 2XY5A 3WQTA 4JV5K 2EX3A 5FROA 2PBDA
chains in the Genus database with same CATH topology
5TKWA 4FWMA 3QFUA 5C12A 1MA9B 1Q82O 1QVFM 5AFUH 1BUPA 4QS9A 2YX6A 4CD3A 5BR9A 3CXCM 3VGMA 3A5MC 3GG4A 3CETA 4H5TA 3O9SA 1S72N 1ATRA 3TSQA 3E9OA 1YVNA 4BR5A 1Q81O 3T7ZA 1HX1A 3MN7A 3ID8A 4PL7A 3EE9A 4GV9A 1NWKA 1JCFA 3C0BA 5BPLA 3E9LA 4IO9L 4G9ZA 3IKMA 5GADP 3CCUN 4WYBA 3O4WA 4CZIA 5BREA 4IOCL 1KQSM 4M63C 2P9PA 5ADXA 1ZBSA 4HTLA 4H0TB 2F9TA 4BRLA 3CCMN 4JD2A 3O1BA 5DM6L 3L0QA 1KAXA 1U2VB 5H1SQ 2D4WA 1Y64A 3LDNA 1P8ZA 3E1YA 5CE3A 2QTDA 4YOUA 3ZX2A 1YJWN 2QXLA 3CJAA 3PIPL 2HBJA 1TUUA 1LOTB 4FO0A 4OPAA 3WEEB 3CQYA 4EHTA 3O8MA 5KQDA 4H0PA 3CMAN 2P9NA 4JKGB 1BDGA 1MDUB 1OVYA 3ZETB 4BR2A 4EIAA 4R79A 3SAGA 3VEVA 4GNIA 4QS8A 2QWQA 2P9KB 4EHUA 3O9RA 3LDQA 3WUHA 1Q7YO 2P9UA 2VWBA 4JKHA 5C10A 3DLLL 1YHQN 1S22A 2VCPA 2KLAA 3CERA 4BVOA 1XC3A 1NGBA 4FVUA 4A5BA 4ILHA 5BRDA 3KHYA 2QWNA 3TTFA 4FWLA 3VETA 5GIOA 1ATNA 4C1NI 4DKWA 1G99A 1T3VA 4WQ4C 1NJIO 3I55N 1E4GT 4FWRA 4ISGA 4WF9L 2P9SA 3I33A 4IXCA 4M7XA 4CZMA 3CCEN 5AQFA 4BG8A 1NGDA 1R59O 1SZ2A 3ID6A 1HPMA 4KH6A 2Q0RA 4JKEA 5AFUA 1OKJA 1C0FA 3MDQA 3H45C 3TPQA 1VQ6N 2E1YA 3OHRA 1KXPA 1K8KA 1MWKA 1NGIA 3O9TA 4BGAA 3ENBA 2P9LA 3SAHA 3UE5A 3O08A 4HWIA 3NMUA 2NRHA 3UKUB 2OTJN 3M5RA 5AQQA 3ULEB 2ZJRL 1M90O 3OA9A 3VGLA 2EWSA 1WUAA 5M1PA 1MWMA 2V51B 3VERA 5ADXH 3L4QA 5GAHP 5JVGL 2NLXA 5FPMA 5LY3A 4FWQA 1VAZA 2YHXA 4AF1A 1VQ5N 2GWKA 4BQLA 4A2BA 4IOXA 3HOTA 4CBWA 2QM1A 3SBGA 5LJWA 3SJHA 3TSUA 1BO5O 4BRHA 4Z94A 4MLHA 1QQOA 2YCHA 4FWOA 1YIJN 1VQMN 1Z6RA 2FSJA 1JCGA 1GLFO 3WXJA 4B1WB 2NNWA 4H0YB 3GBTA 3L4IA 2GX9A 1QVGM 4JKBA 5AQGA 3DAWA 1YAGA 3N4PA 4YDUA 2I7NA 2ZWHA 1W2BM 1NGJA 3H3NO 5BRFA 4FPAA 4JN4A 4FWSA 1ZC6A 3VESA 3O9QA 2RE2A 3FR0A 5FPEA 3CC7N 1VQPN 3EKSA 2QWMA 3KVGA 4H5WA 4CD1A 2CGKA 3CPEA 3RSEB 4ILJA 3OBYA 3CIPA 4H0VB 4RCHA 3QB0A 4WFBL 4PKHA 5AZIA 3BF1A 1D4XA 1GLEG 4GY2B 3RVCA 4B9QA 3ZYYX 4A59A 1NGFA 3D2FB 3L6QA 5KPRA 2P9UB 1ILYA 2NRTA 5JLHA 5AZJA 3GDQA 5EVZA 3SK3A 1NGEA 5EXWA 3TTDA 4DB3A 3CCQN 1M1KO 3P4IA 2OTLN 4I6MB 4AM7A 3A5LC 4BRAA 4IOAL 3WXMB 2KKZA 3CQXA 3WXLA 4GV3A 3OBWA 4B1ZA 4NB4A 5C2DA 2QW9A 4JK8A 3IDHA 3E9PA 4BRNA 3AAQA 5JVHL 3TU5A 2P9SB 4OO1J 3BF3A 4K43A 1K73O 2WFBA 4BRQA 2D0OA 1IG8A 3CI5A 2WC9A 4A5AA 4UY8O 2PFUA 3SMSA 3D2EB 4JK7A 4B1XB 2GUPA 3FZMA 3ENOA 3QBXA 3C65A 3FZFA 2WUSA 2A5XA 1T6CA 5AQTA 1K8KB 2V7YA 1J6ZA 5AQOA 3VF4A 1TYQB 3EKUA 1YJNN 3Q7CA 2V52B 4IFEA 4AM6A 3ULEA 2NRVA 2NRZA 5C15A 5BRHA 2NZTA 3U9DA 4JHDA 2IVOA 3KWGA 3ZX0A 4IWVA 4PL8A 4BRCA 1CZAN 3F5TA 4H0XB 3FFKB 4BRPA 3CC2N 4IJAA 4BROA 1NGHA 5B8HA 5LJVA 1GLLO 5DM7L 3UB5A 5M1QA 2DPNA 3HZ6A 3BP8A 5AQHA 4KH5A 3UKRB 3P39A 2P9IB 2Q1NA 3O5BA 1YJ9N 2IVPA 1RGIA 1BWFO 3EZWA 3EO3A 5AQYA 4IEIA 2YJFA 1QHAA 3EE8A 3LDPA 2IIRA 2P9NB 4JKGA 4BRKA 5M1KA 2A3ZA 1O13A 5AQPA 1NLVA 3SMPA 4IO8A 2HBKA 3VEWA 4E1JA 4F9OA 2OANA 1BA1A 3VF2A 3G71N 2FSNA 4WFNL 4ILGB 1WOQA 3MMVA 1EO1A 3WQUA 3FZKA 4XH5A 1U2VA 2NRXA 3J8AA 3DXKA 4K25A 1K8AO 2Q97A 4U67L 4B1UB 4MDBA 3IFRA 5I9EB 5AQKA 1X3MA 2P9PB 1HLUA 1NGCA 2JWLA 4ISFA 1QQMA 3LM9A 4A57A 3NVKA 2Q2RA 1T6DA 2F7TA 4NLCA 5AQWA 3W0LA 3KWIA 2W40A 4KH4A 5CHIA 4WQ5A 2Q31A 4BRGA 2V7ZA 2ASPA 4JAXA 3G4SN 2QEXN 3HSCA 4BRMA 1Q86O 2ITMA 2ASOA 4YOWA 3O80A 4FWPA 4K41A 4CZHA 2BH1A 1NMDA 3U8XA 3U9ZA 3OW2M 3MX5A 2ASMA 2J4RA 3ENHA 3VPZA 3VEYA 4H5RA 4BC3A 1NM1A 4GV6A 4C1NK 1YF5L 3C7NB 3I56N 3MWTA 1YITN 4BR4A 5EX5A 1HKBA 1V4SA 3B8AX 3BEXA 2FXUA 3H46O 4A62A 5F1XA 3A5NC 3CCLN 5EY4A 1E4FT 3MCAB 3ZEUB 3LDOA 3R1XA 4OPHA 3PIOL 4C23A 4KBOA 2HMPA 4J8FA 4DQ8A 3N4QA 3CCSN 4FWNA 4XEIA 2HBMA 4JKAA 5MLCQ 3AGKA 4WQ4A 1H1VA 5FPDA 2A40A 4PKGA 4EAHD 4M7YA 4BVPA 5GINA 3H1QA 1LCUA 3NVMA 2E88A 3SAFA 3CC4N 4IDHA 1JJ2M 2Q0UA 5M1OA 4YOTA 1TUYA 3HBTA 5TKYA 4BGBA 4YOYA 1VQ8N 4JNEA 3MCPA 4BRDA 3CHWA 3A8YA 3QBWA 2E1ZA 4JEPA 4O8KA 3ZX3A 1S3XA 2FF3B 1YI2N 3I8BA 3QFPA 4JKDA 5AQSA 4A61A 4WCEL 4YOXA 3G6EN 4GVEA 1QZ6A 2GELA 5E26A 5AQIA 3U4LA 3AGRA 4B1YB 2E20A 4EFHA 3FGUA 5M1FA 1KC8O 3DXMA 3AY9A 2RHKA 2VGNA 2HF3A 3WT0A 3WXIA 5JLFA 2H3GX 1KD1O 3ZETA 4L3QA 2FLOA 4BC4A 2E2NA 3CF5L 1GLDG 2AA4A 3S41A 3WEEA 3ATUA 4A2AA 1DT9A 1QZ5A 4RWTA 1DGKN 3EN9A 3AAPA 2BTFA 4H5VA 2CH6A 5FPNA 2E2OA 3Q7BA 3O6WA 3SBTA 3P38A 3VGKA 4BR7A 4Y0WA 1NGGA 2CGJA 3CD6N 3M3ZA 3QICA 2NRWA 3AARA 1TYQA 4O8UA 1HKGA 1KAYA 2CGLA 4FOIA 4BRFA 4CZJA 4IEEA 5CR4A 1GLAG 2FSKA 2CH5A 3LM2A 3RSEA 3VEXA 4RTFD 1W97L 2E8AA 1VQNN 5BN8A 1VQ4N 3JXUA 2GWJA 3R8EA 1YUWA 1BG3A 1GLCG 4DHYA 4MO5A 1SS6A 2JWKA 2GTDA 2ZGYA 3FZHA 3O1WA 3R6MA 3VEZA 3VF6A 3T69A 5AZJB 5HOOA 5GIPA 2QWOA 5BPNA 3UKRA 2I7PA 2ZGZA 4CZFA 2P9IA 2HBLA 3UKUA 4K42A 4BC5A 3ZEUA 5AQVA 5AR0A 3HM8A 5KQ8A 1DEJA 1VQ9N 4FWKA 3DWLA 3EL2A 4CJ7A 1DKGD 3FLCO 4NO7A 2QWLA 5AQNA 3GL1A 2P9KA 4YORA 2E2QA 2QWRA 2WBNA 3G25A 3R3LA 3A5OC 4JKCA 3R9PA 3CMEN 2VGMA 3D2EA 5ELZA 1QQNA 3TTCA 2D1KA 4O5FA 3H6EA 3HRGA 3J7ZO 5E84A 3CJBA 2ZF5O 1BOTO 2A41A 2YHYA 4BG9A 2IVNA 3MK6A 2QI2A 3MN6A 4YDUC 3CJ9A 3HOSA 3CCRN 5M1NA 2YJEA 4WQ5C 3JS6A 3HTVA 1NBWA 1RDUA 1XQSC 3GE1A 4H0OA 1GLJO 1HJOA 3F9MA 5JMVA 1EQYA 1JCEA 4JHDB 3CCVN 3TSPA 1YXQA 4H03B 5F2RA 4JKFA 3VOVA 4BR0A 2E2PA 1BA0A 2D0PA 2W41A 3QDKA 4H5NA 5AQLA 4CBXA 1N8RO 2AP1A 3VTIA 3K9KA 2ZJPL 3GOIA 3MX2A 2YHWA 3QMLA 3KK7A 2Q36A 2P9LB 2HOEA 4MO4A 4BY9C 4CZKA 4MDAA 5GAEP 4CBUA 1ATSA 1ZXOA 2ZJQL 1ESVA 2VYPA 3M6GA 5AZIB 4CZLA 4PHTX 3M1FA 4IJNA 4U7BA 4NLBA 3P31A 3VEOA 1BU6O 1RFQA 4JK9A 3VMFB 1Z05A 3W3DA 2HSTA 3CJ1A 4JD2B 3E66A 3IMXA 1VQON 2PAVA 4BC2A 1IJJA 1VQLN 4CZGA 1Q18A 2UYTA 2A6AA 2QWPA 3H3OB 3DXKB 5KPTA 4B1VA 1C0GA 1RDWX 5AQZA 4BRIA 2QA4N 3K9JA 1X3NA 3D6RA 3LL3A 4PKIA 5BN9A 2A42A 2FF6A 4I6MA 3VENA 3CPWM 4LC9B 2GEMA 5EOYA 1SQKA 5HL7L 4BREA 4XH4A 1KAZA 5AQMA 4FPBA 2NRRA 4YOVA 3CJCA 1V4TA 3O9UA 4QS7A 3PLAA 4XH1A 3ATVA 3FZLA 5AQUA 5KPZA 1HKCA 1XUPO 5JICA 2BUPA 2HF4A 4IZ9A 3VTHA 4FL9A 1GLBG 3A0IX 2YI1A 3C6HA 5AQXA 3KZBA 3BUZB 4ISEA 3CJ7A 1P90A 3H1VX 3D7EO 3FE1A 3LDLA 4BQZA 1HUXA 1U6ZA 4BR9A 5GAGP 1X9JA 3C7NA 4CI6A 4FSVA 4DCHA 1K9MO 3D2FA 3SLCA 1SAZA 1T44A 3MN5A 1VQKN 2KHOA 5C0YA 5AQJA 2F9WA 4FOEA 1VQ7N 3MN9A 5C2FA 4WFAL 3MWPA 3F2KA 4MLEA 4CZEA 1NGAA 3WXKA 3DJCA 5F0XA 3C6AA 3HI0A 3WQTA 3IUCA 5AQRA 5BPMA 2PBDA 3DXMB 3CCJN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P38 A;  3KWI A;  3M5R A;  2KKZ A;  3OA9 A;  3KWG A;  4OPH A;  3O9Q A;  3L4Q A;  3O9S A;  3F5T A;  3D6R A;  4OPA A;  3EE9 A;  2RHK A;  3P39 A;  3O9U A;  3RVC A;  3EE8 A;  3O9T A;  3O9R A;  3P31 A;  2GX9 A; 
#chains in the Genus database with same CATH topology
 1NK4 A;  1Q82 O;  4DSF A;  1QVF M;  3DM2 A;  5BR9 A;  3VGM A;  3A5M C;  3QES A;  2O8D A;  3E9O A;  1YVN A;  4JYA K;  3ID8 A;  4PL7 A;  4N56 A;  4NXN K;  3EE9 A;  4GV9 A;  1NWK A;  2GBZ A;  1D9D A;  5BPL A;  3K5N A;  3UIQ A;  3AA3 A;  1XC9 A;  4G9Z A;  3IKM A;  4WYB A;  3O4W A;  4CZI A;  1KQS M;  2P9P A;  4N47 A;  5ADX A;  4BE0 A;  4HTL A;  4H0T B;  4LH5 A;  4BRL A;  5DM6 L;  5H1S Q;  3KLI A;  1HR0 K;  1RT2 A;  1Y64 A;  3LDN A;  1P8Z A;  3E1Y A;  4CEZ A;  1QTM A;  5J2M A;  4DTO A;  3CJA A;  2HBJ A;  2XY6 A;  2WOM A;  4OKJ A;  4CHZ A;  2WTU A;  1C6V A;  3KJV A;  3TAQ A;  3SAG A;  3VEV A;  2A1S A;  2P9K B;  1Q7Y O;  2P9U A;  1YHQ N;  4CEA A;  2KLA A;  1NGB A;  5BRD A;  4JRQ A;  2QWN A;  4DTU A;  3TTF A;  3SV4 A;  4C1N I;  4DKW A;  1HRH A;  1T3V A;  4FWR A;  4WF9 L;  4M7X A;  3AVG A;  4O0J A;  3MDQ A;  3ZT1 A;  3TPQ A;  1KXP A;  3P5J A;  1MWK A;  4YY3 K;  4BGA A;  3SQ4 A;  4V19 S;  3UKU B;  4E19 A;  3J80 O;  2JLE A;  2E6M A;  2ZJR L;  1M90 O;  3VGL A;  2W6L A;  2EWS A;  5M1P A;  3VER A;  1QS4 A;  1UWB A;  5FPM A;  3MXI A;  3PUF A;  3LWL A;  4FLV A;  3FFI A;  4BQL A;  4A2B A;  2WON A;  3HOT A;  3EYZ A;  3LAL A;  5LJW A;  2QM1 A;  1EXQ A;  2DTU A;  1QQO A;  1VQM N;  4H8K A;  3WXJ A;  1LV5 A;  1U04 A;  4W5N A;  5BR8 K;  1QVG M;  3THY B;  3TAM A;  1YAG A;  4FPA A;  4FWS A;  2RE2 A;  5LMU K;  1SV5 A;  1ZBF A;  4B3T K;  3CPE A;  1LW2 A;  1TKD A;  4XIU A;  3BF1 A;  4GY2 B;  4DQI A;  4ZTJ A;  4A59 A;  3L6Q A;  2P9U B;  4DG1 A;  2NRT A;  3T1Y K;  3ZSO A;  1NGE A;  5EXW A;  3TTD A;  4DB3 A;  3S3N A;  3P4I A;  4I6M B;  4AM7 A;  4JRP A;  2DFE A;  2HB5 A;  3WXL A;  4K0K K;  5KRT A;  1VSE A;  4NB4 A;  4JI7 K;  3TU5 A;  2YKN A;  2G8U A;  4BRQ A;  1IG8 A;  3CI5 A;  4A5A A;  1HQU A;  3SZ2 A;  3SMS A;  5JS1 A;  3OYB A;  1BI4 B;  4FYD A;  3FZM A;  4DFP A;  1FW6 A;  1C0U A;  3QBX A;  1KVA A;  4DQS A;  1NNE A;  2WUS A;  4CEB A;  5KI6 A;  1JLG A;  1RT1 A;  1YJN N;  3Q7C A;  3KIO A;  2NRV A;  4M3Y A;  3T1A A;  1RTJ A;  4JHD A;  4DV6 K;  2X74 A;  1CZA N;  3F5T A;  1IKW A;  2QKK A;  4BRO A;  5DM7 L;  3UB5 A;  5FRN A;  1EET A;  5M1Q A;  4BWM A;  4Z4F A;  4RW6 A;  4N5S A;  1JL1 A;  2IVP A;  1RGI A;  3OYA A;  3EZW A;  3EO3 A;  4IEI A;  1YTU A;  3LZI A;  2IIR A;  3L3V A;  5M1K A;  3NE6 A;  4BE1 A;  3SMP A;  4IG3 A;  2HBK A;  4C8N A;  3VEW A;  2B6A A;  4IG0 A;  2KFZ A;  3V4I A;  4E7H A;  2B4J A;  1U2V A;  4LF5 K;  3MEC A;  5AQK A;  2YV0 X;  2JWL A;  1QQM A;  3LM9 A;  4Z4C A;  4E3S A;  1T6D A;  3VQP A;  4QOZ B;  3BDP A;  4KH4 A;  2ASP A;  2QEX N;  1Q86 O;  2XY7 A;  4FWP A;  1NMN A;  2FBV A;  4FLZ A;  3KK1 A;  4LSN A;  2J4R A;  3C6T A;  3VQ5 A;  3ENH A;  1L3T A;  1IKX A;  3KD1 E;  3C7N B;  3AVI A;  3RRG A;  3OYF A;  1V4S A;  2FXU A;  4ZHR A;  1OH8 A;  1A5V A;  3A5N C;  1KFD A;  3LDO A;  3R1X A;  4H4M A;  3LP3 A;  5EU7 A;  1ZBH A;  4DQ8 A;  4FWN A;  4XEI A;  4JKA A;  2VG5 A;  5FPD A;  3QNO A;  2A40 A;  3NH0 A;  4QAG A;  4DFM A;  2OPP A;  4E89 A;  3H1Q A;  3NVM A;  2E88 A;  2Q0U A;  5HRO A;  1TUY A;  4YOY A;  4NCB A;  3MCP A;  3QBW A;  4JEP A;  4O8K A;  1S3X A;  1GOA A;  3QFP A;  4JKD A;  3KD5 E;  1UOC A;  3BZC A;  4WCE L;  1QZ6 A;  3U4L A;  3VQQ A;  4Z0U A;  4EZ9 A;  2OCE A;  3ZSY A;  1D5A A;  4DR2 K;  3ZET A;  1T7P A;  1VSD A;  3CF5 L;  4EP5 A;  4M41 A;  3ATU A;  1OH7 A;  3IS9 A;  1QZ5 A;  2OZS A;  4FLX A;  3EN9 A;  1SL0 A;  2E2O A;  1J53 A;  3CD6 N;  3OYG A;  3M3Z A;  1U49 A;  4DSJ A;  3AAR A;  1EWR A;  1KAY A;  3DYA A;  1W97 L;  3QEI A;  3QEX A;  1S9E A;  3HM9 A;  2GWJ A;  4BAC A;  3OS2 A;  4KHN A;  1GLC G;  2IOC A;  4J2D A;  3FZH A;  3VF6 A;  4RG8 A;  1U45 A;  5HOO A;  1BCO A;  2I7P A;  1S1W A;  2ZGZ A;  4CZF A;  4LFB K;  2HBL A;  4ZTF A;  5KQ8 A;  1JLE A;  4FWK A;  3DWL A;  5IWA K;  4NO7 A;  3FLC O;  4FVM A;  4IKF A;  3PO5 A;  3GL1 A;  2PYJ A;  2P9K A;  3SJJ A;  3R3L A;  4CF2 A;  2F4V K;  3ITH A;  1VHX A;  2HHX A;  1UA0 A;  5JS2 A;  3RR7 A;  2A41 A;  3VQ7 A;  4YDU C;  3HOS A;  1BGX T;  3ZSW A;  1XQS C;  3TAE A;  1HNW K;  3F9M A;  1KLM A;  1EQY A;  4JI1 K;  5JMV A;  3VQD A;  3QNN A;  4JKF A;  4OX9 K;  4BR0 A;  2E2P A;  1NJW A;  4CBX A;  1N8R O;  3K9K A;  2ZJP L;  3D45 A;  2YHW A;  2Q36 A;  2P9L B;  3IG1 A;  4CGD A;  2Z1J A;  4BY9 C;  4MDA A;  1VRU A;  4ICL A;  3J81 O;  2VYP A;  3M6G A;  4PHT X;  4NLB A;  4QCL A;  3AVF A;  4FM0 A;  4CJ5 A;  4JK9 A;  3OYD A;  3W3D A;  4JD2 B;  1VQO N;  3RMA A;  1T8E A;  5CYQ A;  3BY5 A;  1HMV A;  1VQL N;  2UXD K;  2FC0 A;  4CZG A;  3H3O B;  3V1O A;  3DXK B;  2OA8 A;  4CJT A;  1C0G A;  4B3O A;  4PKI A;  2A42 A;  3V9U A;  4KTW A;  3TWH A;  3ZCM A;  4E1N A;  5EOY A;  4XH4 A;  5AQM A;  4DLE A;  4FZY A;  4YOV A;  1V4T A;  4QS7 A;  5AJ3 K;  2O8E A;  1DTT A;  2X6S A;  3DRS A;  1FJG K;  3FZL A;  1HKC A;  3QIN A;  5J1E A;  3KK3 A;  4IZ9 A;  1GLB G;  3A0I X;  3J7A P;  3KZB A;  4DQQ A;  4GKK K;  4ISE A;  3FE1 A;  4DR6 K;  3TAF A;  4BQZ A;  1U6Z A;  3WNH A;  3LPT A;  3OYI A;  3V1R A;  4JI0 K;  2EHG A;  3AVK A;  1N36 K;  5C0Y A;  2F9W A;  3NF6 A;  4B9N A;  3WXK A;  1BCM A;  3HST B;  4AHS A;  3DJC A;  4IBN A;  3HI0 A;  3IUC A;  5AQR A;  3C94 A;  4CJF A;  3CCE N;  1QQC A;  2RN2 A;  3LP1 A;  4W5R A;  2YX6 A;  4UQG A;  3PX6 A;  3O9S A;  4F4K A;  1ATR A;  3V9Z A;  2B5J A;  3T7Z A;  1ZBL A;  1JCF A;  3E9L A;  3THX A;  4B3S K;  4JI8 K;  1C1B A;  4IOC L;  2BGG A;  2DFH A;  4BE2 A;  4DLG A;  3SQ0 A;  1KAX A;  1U2V B;  2DY4 A;  1WAF A;  2PZS A;  4OKE A;  5CE3 A;  3T1H K;  1S6Q A;  4YOU A;  3K5L A;  3PX4 A;  3PIP L;  4F2R A;  4GKJ K;  4L8R B;  4CES A;  3SAF A;  4FO0 A;  4CJK A;  3WEE B;  4DSE A;  3SUP A;  4R79 A;  1WBD A;  1NK9 A;  3LAM A;  1N33 K;  3K5M A;  4EHU A;  2GV9 A;  2YNH A;  2UXB K;  1NKB A;  4KAZ A;  1XC3 A;  4A5B A;  3VET A;  4KTQ A;  4IXC A;  4DTS A;  5AQF A;  4JI3 K;  2IS3 A;  1HPM A;  1OKJ A;  4PQU A;  1C0F A;  1JL2 A;  4FZZ A;  2LSN A;  1X1P A;  1NGI A;  4AHR A;  1R0A A;  3ENB A;  4LF6 K;  3O08 A;  4HWI A;  1BIZ A;  1HJR A;  3VQE A;  4CHY A;  1WUA A;  5ADX H;  4K8Z A;  2NLX A;  1VQ5 N;  4AF1 A;  4IOX A;  3L2U A;  4M45 A;  4CBW A;  2ETJ A;  4BRH A;  2YCH A;  1RBS A;  2YHB A;  1YIJ N;  1Z6R A;  1GLF O;  4B1W B;  1BQN A;  3OYC A;  1XMO K;  4I9L A;  4JKB A;  4YDU A;  3N4P A;  4OJR A;  1WN7 A;  2I7N A;  2UUA K;  4CJS A;  3QO9 A;  5BRF A;  4JN4 A;  4DTP A;  1ZC6 A;  4FCY A;  3O9Q A;  4LD0 A;  5HRN A;  2OPS A;  3SYZ A;  1VQP N;  3KVG A;  2RF2 A;  4CD1 A;  2CGK A;  1NOZ A;  4ILJ A;  5FDL A;  3SQ2 A;  3G10 A;  1XWL A;  4PKH A;  2YNF A;  3ZYY X;  4FJM A;  3LDS A;  5KPR A;  1ILY A;  1EX4 A;  3GDQ A;  4M42 A;  1LAW A;  2OTL N;  3A5L C;  4IOA L;  3WXM B;  2X78 A;  2KKZ A;  4GV3 A;  2XO7 A;  1J5O A;  1FK9 A;  1TK5 A;  4JK8 A;  3E9P A;  4HUE A;  3AAQ A;  4LSL A;  3KK2 A;  2P9S B;  3RWU A;  2WFB A;  3VQ6 A;  3FZF A;  5AQT A;  4JI2 K;  4DR1 K;  4DR7 K;  3DRP A;  4FK0 A;  5AQO A;  1TYQ B;  1XHZ A;  4CFC A;  1TKZ A;  2V52 B;  4G1Q A;  3PSF A;  3U9D A;  4IWV A;  4BRC A;  4HTU A;  4OPJ A;  4H0X B;  4BRP A;  1WAJ A;  5LJV A;  1NGH A;  5B8H A;  1GLL O;  3TAP A;  5AQH A;  4JI5 K;  1A5W A;  3E01 A;  3P39 A;  4OGE A;  2Q1N A;  2F96 A;  3AVN A;  3C6U A;  2UXC K;  4DSI A;  5AQP A;  3DLK A;  1T03 A;  3HT3 A;  1G15 A;  1BA1 A;  3VF2 A;  3G71 N;  2O8D B;  1RTD A;  1WOQ A;  2UU9 K;  1DLO A;  4XH5 A;  3U6F A;  4FJI A;  4Y1C A;  4CGG A;  1K8A O;  4M3X A;  1Z26 A;  2Q97 A;  1IBL K;  5DMR A;  4Q5V A;  3IFR A;  5I9E B;  1X3M A;  2P9P B;  4KHW A;  4CGH A;  5HLF A;  1Q8I A;  4ISF A;  3OYH A;  4DV4 K;  1BIS A;  1IG9 A;  2P5G A;  4NLC A;  2W40 A;  4F2S A;  2Q31 A;  4BRG A;  1N6Q A;  1JLB A;  3L2R A;  3K57 A;  4KKO A;  4K41 A;  4CJP A;  2BE2 A;  3U8X A;  1RIL A;  1HNV A;  4DV0 K;  2XRI A;  2KW4 A;  1J54 A;  4BC3 A;  1NM1 A;  2VQE K;  4DQP A;  1YF5 L;  1YIT N;  4BR4 A;  3CFP A;  3BEX A;  4CF1 A;  3SPY A;  3ISN C;  3OS0 A;  3PIO L;  3HPO A;  2HMP A;  5CZ2 A;  3K2P A;  2O8F B;  5MLC Q;  3IAY A;  4BVP A;  4IFY A;  1HNX K;  4IDH A;  4BGB A;  5M1O A;  4YOT A;  1VQ8 N;  1RBU A;  4JNE A;  3TAR A;  1WSI A;  1KRP A;  3CHW A;  3A8Y A;  2KFN A;  1HYS A;  1NKE A;  5HRP A;  4B08 A;  3I8B A;  1QSY A;  3DMJ A;  2UUC K;  4YOX A;  4GVE A;  2GEL A;  5E26 A;  2HHQ A;  2ZE2 A;  3QEV A;  5SWM A;  3WT0 A;  5JLF A;  3HVT A;  4L3Q A;  1SL2 A;  2VQF K;  4BC4 A;  1GLD G;  4OLA A;  4A2A A;  4CF9 A;  2BTF A;  2CH6 A;  3Q7B A;  3P38 A;  3VQC A;  3AV9 A;  5HRS A;  3QIC A;  1U4B A;  2NRW A;  1FKO A;  1HKG A;  3MXJ A;  1SUQ A;  3AVA A;  2OPQ A;  3VEX A;  2E8A A;  3PO4 A;  4B3R K;  3R8E A;  1YUW A;  4AH9 A;  4X62 K;  1I3A A;  3O1W A;  2ZGY A;  3O3H A;  5AZJ B;  5GIP A;  2O4G A;  1GOC A;  4FM1 A;  1BQM A;  5CYM A;  1BL3 A;  4CJ4 A;  1TL3 A;  2YNI A;  3ZEU A;  5AQV A;  5AR0 A;  3HM8 A;  2GUI A;  3NH1 A;  2G8I A;  1B9D A;  2HHH K;  1KFS A;  4YOR A;  3G25 A;  3R9P A;  2O8F A;  3CFR A;  3CME N;  2VGM A;  3D2E A;  4DFJ A;  2D1K A;  4OKK A;  2ZF5 O;  1CLQ A;  2YHY A;  4BG9 A;  2IVN A;  3MK6 A;  2IC3 A;  4HHT A;  2QI2 A;  3MN6 A;  3DRR A;  3CCR N;  5M1N A;  4WQ5 C;  1RDU A;  3T3F A;  4H0O A;  1GLJ O;  1HJO A;  4JHD B;  4ELV A;  3TSP A;  5F2R A;  4KRE A;  2HW3 A;  4JS4 A;  3QDK A;  3OYN A;  3GOI A;  4OLB A;  5I42 A;  3HP6 A;  4FJ8 A;  4CJR A;  2XY8 A;  1T05 A;  3VQ4 A;  5J2N A;  2HHU A;  1ATS A;  1ZXO A;  3M8R A;  2ZJQ L;  4NYF A;  3AVL A;  3RTV A;  4IJN A;  2Y1I A;  2P5O A;  1BU6 O;  1RFQ A;  4TSX A;  2KQ2 A;  2P51 A;  3IMX A;  1OVQ A;  4BC2 A;  1IJJ A;  1NK5 A;  1Q18 A;  2UYT A;  5FLX O;  4B1V A;  4Z4G A;  1SKW A;  4BRI A;  2QA4 N;  4CK3 A;  5BN9 A;  4DU1 A;  4M3U A;  3TR8 A;  1RTI A;  3CPW M;  4LC9 B;  1RT5 A;  1SQK A;  2BAN A;  4W5T A;  2IDO A;  1LWF A;  3TI0 A;  4XH1 A;  1JLC A;  3ATV A;  2HF4 A;  4FL9 A;  2PYL A;  2YI1 A;  3U3Y A;  2HHT A;  4O55 A;  1P90 A;  3NGZ A;  4DTX A;  2KTQ A;  4BR9 A;  5GAG P;  1X9J A;  4HUF A;  4FSV A;  4DCH A;  3D2F A;  4LH4 A;  3MN5 A;  2G8K A;  1TKT A;  4AHC A;  3MN9 A;  3MWP A;  3S3O A;  1NGA A;  3BZK A;  4KPY A;  5BPM A;  4E7K A;  3AVJ A;  1L3V A;  3MEE A;  4FWM A;  3QFU A;  5C12 A;  5CY4 A;  4JS5 A;  4CW7 B;  1ASU A;  1BUP A;  4QS9 A;  2E4L A;  3NF8 A;  5C24 A;  1S72 N;  3TSQ A;  4BR5 A;  1Q81 O;  3ZSZ A;  4DV3 K;  4CJE A;  2G8H A;  3MAQ A;  3C0B A;  3RMB A;  3OYL A;  1JLF A;  3CCU N;  4C8K A;  5BRE A;  4YNQ A;  4M63 C;  4FJN A;  2F9T A;  2ZM6 K;  3O1B A;  3LP2 A;  2O8C B;  2D4W A;  2IAJ A;  2VWK A;  2QTD A;  4KRF A;  3AVB A;  4DV2 K;  1TUU A;  1LOT B;  4OPA A;  5K14 A;  5KQD A;  3CQY A;  3CMA N;  2P9N A;  4W5O A;  1OVY A;  3ZET B;  4AQY K;  2ITG A;  2QWQ A;  3O9R A;  3LDQ A;  5C10 A;  4KHP K;  4B9M A;  1RCH A;  3CER A;  4ILH A;  3KHY A;  1ATN A;  3HPG A;  4X65 K;  1SL1 A;  1G99 A;  4WQ4 C;  4DTJ A;  4ISG A;  5IT9 O;  3I33 A;  4CZM A;  2XHB A;  1NGD A;  1SZ2 A;  1TGO A;  1ZYQ A;  3ID6 A;  5AFU A;  4HCB A;  2Q0R A;  4JKE A;  3WNE A;  2HMI A;  4DU4 A;  4FJK A;  3SUN A;  3H45 C;  4W5Q A;  1VQ6 N;  2E1Y A;  3KLH A;  3OHR A;  1K8K A;  3HYF A;  3O4N A;  3CYM A;  1JXB A;  2P9L A;  3SAH A;  3UE5 A;  1NK6 A;  4M3Z A;  3NMU A;  2NRH A;  5C25 A;  2OTJ N;  1KTQ A;  3ULE B;  1K6Y A;  3OA9 A;  4KHY A;  4KI6 A;  1HNI A;  3L4Q A;  3ZSQ A;  4YHH K;  1SKS A;  5JVG L;  1EWQ A;  4H4O A;  4X64 K;  5LY3 A;  3KLG A;  4FLU A;  2VG6 A;  2GWK A;  4KB0 A;  3PX0 A;  1YT3 A;  1WSE A;  1RT6 A;  2HNZ A;  1OH5 A;  3SBG A;  4M3R A;  3SJH A;  1BO5 O;  3J7Y P;  4MLH A;  2FSJ A;  3QEW A;  3EEQ A;  2NNW A;  4H0Y B;  3GBT A;  3L4I A;  2GX9 A;  1RDC A;  3ASM A;  3AO4 A;  4C8L A;  2ZWH A;  1W2B M;  3H3N O;  4ID1 A;  4FJL A;  2D0A A;  3OYE A;  1HQE A;  4X66 K;  5LL6 Z;  3JAM O;  3FR0 A;  3WNG A;  4CE9 A;  5FPE A;  3CC7 N;  3EKS A;  2QWM A;  1WNS A;  3CG7 A;  3TAN A;  3MXM A;  1D9F A;  1RBT A;  3OBY A;  1VK0 A;  3K58 A;  4H0V B;  4RCH A;  3QB0 A;  4WFB L;  4LF9 K;  1HPZ A;  1GLE G;  3H08 A;  3QLH A;  1NGF A;  3PV8 A;  5JLH A;  5AZJ A;  2IGI A;  5C42 A;  3SPZ A;  5E41 A;  3M8S A;  4IFV A;  4Z4E A;  3OBW A;  4B1Z A;  5C2D A;  2QW9 A;  3IDH A;  1Q9X A;  4BRN A;  1NOY A;  4OO1 J;  3BF3 A;  4J2B A;  4K43 A;  2D0O A;  3D2E B;  4JK7 A;  4B1X B;  2P1J A;  4DR4 K;  3DLR A;  1LAV A;  4CFB A;  1T6C A;  4CVN E;  1K8K B;  2V7Y A;  1CXU A;  3V9W A;  3THX B;  2AJQ A;  3ULE A;  4JI4 K;  1I94 K;  2NZT A;  4DV7 K;  4O44 A;  2IVO A;  4PL8 A;  3VQA A;  3FFK B;  4CFD A;  2DPN A;  3HZ6 A;  4KH5 A;  3SCX A;  4CED A;  3ULD A;  1YVU A;  1YJ9 N;  1BWF O;  3AVM A;  4F3T A;  2YJF A;  5HP1 A;  3EE8 A;  4CHQ A;  3I0R A;  4JKG A;  2A3Z A;  4B9S A;  4DSL A;  3DLB A;  2VG7 A;  4E1J A;  4F9O A;  4I2P A;  2OAN A;  1ITG A;  1S1V A;  2NUB A;  3KKR A;  3WQU A;  1NK8 A;  4DR3 K;  3OYM A;  3U3G A;  2NRX A;  3J8A A;  1W7A A;  1MU2 A;  4U67 L;  4DQR A;  4FLY A;  1KSP A;  1WSG A;  1HLU A;  4CIF A;  1NJY A;  3NVK A;  4A57 A;  4E7J A;  4B3M K;  3DOK A;  5AQW A;  3W0L A;  3ZT4 A;  5CHI A;  4WQ5 A;  3P83 D;  1S6P A;  1TAQ A;  4HUG A;  2V7Z A;  4JAX A;  4Q0B A;  4KI4 A;  3HSC A;  2ASO A;  2Y1J A;  1RBR A;  3O80 A;  1NKC A;  2BH1 A;  3OVN A;  1JLA A;  1NMD A;  1HNZ K;  3MX5 A;  1BI4 A;  1VSL A;  2ASM A;  1VSI A;  3F9K A;  3VPZ A;  4H5R A;  3M8Q A;  4GV6 A;  4C1N K;  1NK0 A;  3I56 N;  4DUZ K;  3QET A;  1S9G A;  1S1T A;  1S5J A;  1O1W A;  1IO2 A;  4A62 A;  2FBX A;  5F1X A;  5T7B A;  5EY4 A;  1RTH A;  4CIE A;  4R5P A;  1U48 A;  3ZSV A;  4KBO A;  4JI6 K;  4J8F A;  1ASV A;  3A2F A;  2HBM A;  4DF4 A;  3NGY A;  3AGK A;  4WQ4 A;  1H1V A;  2RKI A;  4C8O A;  4PKG A;  4EAH D;  4M7Y A;  1KCF A;  4N41 A;  1LCU A;  4DTM A;  4CF8 A;  4Y1D A;  1JJ2 M;  5TKY A;  2OPR A;  1IBM K;  4F3O A;  2E1Z A;  5J2Q A;  2FF3 B;  4I9Q A;  3KLF A;  5AQS A;  4N76 A;  3G6E N;  4FJ7 A;  1W9H A;  4NCA A;  4RW4 A;  3OTO K;  3AO2 A;  5AQI A;  2R7Y A;  4B1Y B;  4EFH A;  3FGU A;  4CJ3 A;  5M1F A;  1KC8 O;  1XMQ K;  2OZM A;  5SZT A;  2HF3 A;  1KD1 O;  2H3G X;  5HBM A;  5A2Q O;  4CEF A;  1UAX A;  3WNF A;  2F8S A;  2E2N A;  2AA4 A;  4B9T A;  3SUO A;  1F21 A;  5I3U A;  1DGK N;  3O6W A;  3HK2 A;  4BR7 A;  1NU0 A;  5KTQ A;  4NCG A;  2JGU A;  3G0Z A;  1KVB A;  4DS4 A;  3EY1 A;  1TYQ A;  3JSM A;  4O8U A;  3VQB A;  1N32 K;  4FOI A;  4BRF A;  4CZJ A;  3RSE A;  4PA1 A;  2FSK A;  3LM2 A;  1VQN N;  1FXX A;  3AVC A;  4RTF D;  2HVH A;  5BN8 A;  3LAN A;  1VQ4 N;  3JXU A;  4FW2 A;  3NFA A;  1BG3 A;  1C0T A;  4DHY A;  3VEZ A;  3R6M A;  3T69 A;  4FK4 A;  5BPN A;  3UKR A;  4PUO A;  2P9I A;  4RW9 A;  4K42 A;  3UKU A;  3NCI A;  4AHU A;  1ZBU A;  1DEJ A;  2D0B A;  1S1X A;  1VQ9 N;  3EL2 A;  5AQN A;  2QWL A;  1L3S A;  2UUB K;  4DTR A;  1BIU A;  1QQN A;  2YNG A;  4O5F A;  3HRG A;  1NJZ A;  1W0H A;  1J9A A;  4CIG A;  2W6K A;  1X9S A;  1NK7 A;  4FJG A;  2YJE A;  3JS6 A;  4CHO A;  3CCV N;  3VA3 A;  1OH6 A;  1YXQ A;  3VOV A;  4CEO A;  4LY7 A;  2D0P A;  4H5N A;  4CJV A;  2AP1 A;  3QML A;  4LF7 K;  3KK7 A;  3S9H A;  2HOE A;  4CZK A;  2DFF A;  4U7B A;  4CZL A;  2QK9 A;  3P31 A;  3VEO A;  3K59 A;  1Z05 A;  2HST A;  3CJ1 A;  4OPK A;  3E66 A;  4FM2 A;  1YTA A;  1X9M A;  2QWP A;  3RR8 A;  5KPT A;  4BDZ A;  3M8P A;  3DLH A;  1WLJ A;  3TAG A;  1SKR A;  1X3N A;  3D6R A;  3LL3 A;  4CEE A;  2FF6 A;  2VWJ A;  4I6M A;  3OYK A;  3VEN A;  2GEM A;  5HL7 L;  4BRE A;  1KAZ A;  1REV A;  4FPB A;  4CJQ A;  3L8B A;  3LZJ A;  3THW A;  3F73 A;  1XUP O;  5JIC A;  1DTQ A;  2YKM A;  3L2Q A;  5AQX A;  3OJS A;  2E5L K;  3HPH A;  3V81 A;  5LMN K;  1E3M A;  3H1V X;  3NF9 A;  1WSF A;  1VSH A;  4CI6 A;  1K9M O;  1SAZ A;  1T44 A;  4E7I A;  1VRT A;  1ZBI A;  4DMN A;  4FOE A;  1VQ7 N;  5C2F A;  1ASW A;  3CM5 A;  4CJL A;  3DXM B;  2RPI A;  3CCJ N;  5TKW A;  3NDK A;  4CF0 A;  1IH7 A;  1LWC A;  1MA9 B;  1J5E K;  5AFU H;  4CD3 A;  3CXC M;  3GG4 A;  3CET A;  4H5T A;  2D5R A;  4FZX C;  3O4Q A;  3P1G A;  1HX1 A;  3MN7 A;  4CK2 A;  3NBP A;  4E0D A;  4IO9 L;  4DS5 A;  1RNH A;  1TVR A;  3LAK A;  5GAD P;  4FJH A;  4AIL C;  1ZBS A;  1D8Y A;  4PY5 A;  3CCM N;  4JD2 A;  3L0Q A;  1HYV A;  4CEC A;  3LWM A;  4FJ5 A;  5D3G A;  4J2A A;  4B9L A;  5CZ1 A;  3VQ8 A;  3AVH A;  3ZX2 A;  1YJW N;  2QXL A;  1RDA A;  1FKP A;  4EHT A;  3O8M A;  4H0P A;  4HCC A;  4JKG B;  1B9F A;  1BDG A;  1MDU B;  3HP9 A;  4BR2 A;  4EIA A;  4GNI A;  4QS8 A;  3O3F A;  1LW0 A;  1S1U A;  2ATQ A;  3WUH A;  2VWB A;  4JKH A;  3DLL L;  1S22 A;  2VCP A;  4BVO A;  4FVU A;  4FWL A;  5GIO A;  3V9S A;  1RDB A;  1NJI O;  3I55 N;  1E4G T;  2P9S A;  1HYZ A;  2Z1G A;  3KKS A;  2HVI A;  4BG8 A;  3HXM A;  3QEP A;  1U47 A;  1R59 O;  4DU3 A;  5HRR A;  4KH6 A;  4O4G A;  1Z25 A;  4M3W A;  2HHS A;  4LFA K;  2X6N A;  2O4I A;  3AO3 A;  3O9T A;  2ZQB A;  3HVR A;  4B8C A;  2O8B A;  3M5R A;  5AQQ A;  1IBK K;  3ZT0 A;  1TL1 A;  5J2P A;  1XI1 A;  4BDP A;  3ALY A;  4B8A B;  1MWM A;  2V51 B;  5GAH P;  3V6D A;  4FWQ A;  1VAZ A;  2YHX A;  3V1Q A;  4JLH A;  1WSH A;  5KRS A;  1JLQ A;  4Z94 A;  3TSU A;  1BHL A;  4FWO A;  4DUY K;  1C1C A;  3VA0 A;  1JCG A;  1WB9 A;  3AA2 A;  3HL8 A;  4LF4 K;  5AQG A;  4CHN A;  2F8T A;  3DAW A;  3OJU A;  3LP0 A;  3NHG A;  1NGJ A;  3I0S A;  3VQ9 A;  4ELT A;  4CEQ A;  3VES A;  3I8D A;  4KHQ A;  3T19 A;  1TV6 A;  4H5W A;  4FXD A;  3DOL A;  3RSE B;  1NJX A;  3CIP A;  4I2Q A;  1N5Y A;  3B6P A;  5AZI A;  1D4X A;  3AO5 A;  3RVC A;  4B9Q A;  1WSJ A;  1TK0 A;  3D2F B;  3TAB A;  3SK3 A;  5EVZ A;  1M1K O;  3CCQ N;  4BRA A;  1A5X A;  1RDD A;  3CQX A;  4AHV A;  5JVH L;  1K73 O;  2WC9 A;  4UY8 O;  2PFU A;  4DV5 K;  2GUP A;  4KV8 A;  1TKX A;  3ENO A;  3C65 A;  2A5X A;  3SUQ A;  1J6Z A;  1KLN A;  1QE1 A;  3VF4 A;  3EKU A;  4IFE A;  4AM6 A;  2NRZ A;  4DFK A;  5C15 A;  5BRH A;  3KWG A;  3ZX0 A;  1CZB A;  3CM6 A;  2Z1I A;  3CC2 N;  4IJA A;  2A1R A;  3BP8 A;  3UKR B;  3AO1 A;  3QER A;  1IV0 A;  2P9I B;  3O5B A;  3NGI A;  4RW7 A;  5AQY A;  3RMD A;  1QHA A;  3LDP A;  2P9N B;  1VSM A;  4BRK A;  4CHP A;  1O13 A;  4ID5 A;  2QKB A;  1NLV A;  4OGC A;  4IO8 A;  3SV3 A;  2KZZ A;  2FSN A;  4WFN L;  4ILG B;  3RMC A;  1IKY A;  3MMV A;  1XNQ K;  1EO1 A;  2FBY A;  3FZK A;  2D0C A;  1CZ9 A;  3KLE A;  2O8C A;  4K25 A;  4IDK A;  3DXK A;  4B1U B;  4MDB A;  1QHT A;  3SNN A;  3SQ1 A;  3DLG A;  2HHV A;  1NGC A;  4CJW A;  2Q2R A;  3DI6 A;  2FBT A;  4M3T A;  3PSI A;  2F7T A;  3NAE A;  3KWI A;  4KTZ A;  1EKE A;  2O8E B;  3HO1 A;  3G4S N;  4CJU A;  4BRM A;  3THW B;  3AA5 X;  2ITM A;  4YOW A;  4FJ9 A;  4CZH A;  3U9Z A;  3QIP A;  3VN5 A;  3OW2 M;  4DWI A;  1XNR K;  3OY9 A;  3VEY A;  4FW1 A;  4CGF A;  1GOB A;  1B92 A;  4KFB A;  3MWT A;  5EX5 A;  1VSJ A;  4DSK A;  1HKB A;  2Z1H A;  3B8A X;  3NH2 A;  2I5J A;  3H46 O;  3CCL N;  3V9X A;  4CER A;  3PY8 A;  4NXM K;  1E4F T;  3MCA B;  3ZEU B;  3K0S A;  4OPH A;  3AA4 A;  4C23 A;  4E1M A;  4CGJ A;  4NYN A;  3N4Q A;  3CCS N;  4MQ3 A;  4BDY A;  1RT4 A;  1XHX A;  3IRX A;  5DK5 A;  2Q3S A;  4FLW A;  3ZT2 A;  4KO0 A;  1LWE A;  3L3U A;  5GIN A;  4K8X A;  4CK1 A;  3CC4 N;  3HBT A;  5FRM A;  1L3U A;  4BRD A;  4RW8 A;  3ZX3 A;  3OS1 A;  1YI2 N;  4FJJ A;  3ZSX A;  4A61 A;  2G8W A;  1JXE A;  4LF8 K;  2E6L A;  3CFO A;  3AGR A;  2E20 A;  3DXM A;  3AY9 A;  2RHK A;  4GW6 A;  4C8M A;  3JYT A;  2VGN A;  3WXI A;  3D0P A;  2FLO A;  4EZ6 A;  3S41 A;  3O3G A;  3WEE A;  1RT3 A;  4DV1 K;  4FK2 A;  4Z4I A;  1DT9 A;  3THY A;  4RWT A;  1EP4 A;  3AAP A;  4I7F A;  4H5V A;  1I39 A;  4O5B A;  5FPN A;  3SBT A;  3VGK A;  3HJF A;  4Y0W A;  1NGG A;  2CGJ A;  3B6O A;  2G8F A;  4EP4 A;  2CGL A;  4IEE A;  5CR4 A;  1C1A A;  1GLA G;  2CH5 A;  1VSK A;  4FJX A;  3NF7 A;  3CQ8 A;  4MO5 A;  1SS6 A;  1KVC A;  4CFA A;  2JWK A;  2GTD A;  3DLE A;  5KGW A;  4MFB A;  2OYQ A;  2QWO A;  1QSS A;  2O8B B;  3S3M A;  2BDP A;  4DR5 K;  2YHA A;  4BC5 A;  2G8V A;  2HNY A;  3SI6 A;  4KHS A;  1NG9 A;  3ZSR A;  4WE1 A;  1Q9Y A;  4CJ7 A;  3OYJ A;  1DKG D;  1JKH A;  2HND A;  2E2Q A;  2QWR A;  2WBN A;  4JKC A;  2W42 A;  3A5O C;  5ELZ A;  1C0M A;  3TTC A;  3H6E A;  1L5U A;  1WBB A;  3J7Z O;  5E84 A;  3CJB A;  1BOT O;  4Z4H A;  4F8R A;  3CJ9 A;  4KHU A;  2HHW A;  3HTV A;  1NBW A;  1Y97 A;  3KTQ A;  3GE1 A;  3RRH A;  3C95 A;  1JCE A;  4H03 B;  1IKV A;  4DF8 A;  4CCH A;  1BA0 A;  2W41 A;  5AQL A;  1TAU A;  3VTI A;  3MX2 A;  4AHT A;  4MO4 A;  1RBV A;  5GAE P;  4CBU A;  4FLT A;  4OVL A;  1ESV A;  5AZI B;  3M1F A;  5KGX A;  3VMF B;  3QIO A;  1X9W A;  3L2W A;  2PAV A;  4KB1 A;  2ZD1 A;  2A6A A;  3K5O A;  1RDW X;  3LPU A;  5AQZ A;  3K9J A;  1UA1 A;  3MED A;  1N34 K;  4LFC K;  3THV A;  1RT7 A;  1TK8 A;  2NRR A;  3CJC A;  3O9U A;  3PLA A;  1VSF A;  5AQU A;  4CGI A;  2QXF A;  3ZLJ A;  5KPZ A;  2KZM A;  4O0I A;  4GMJ B;  2PY5 A;  4E7L A;  2BUP A;  3VTH A;  3C6H A;  4ELU A;  3MEG A;  3BUZ B;  4J2E A;  1CXQ A;  3CJ7 A;  3D7E O;  3LDL A;  4B9V A;  1HUX A;  3C7N A;  4GVM A;  4YFU A;  3SLC A;  4B9U A;  3EZ5 A;  1VQK N;  2KHO A;  5AQJ A;  3ZT3 A;  1QSL A;  3L2V A;  4WFA L;  4BWJ A;  3F2K A;  4PWD A;  4MLE A;  4CZE A;  4HVJ A;  4DTN A;  5F0X A;  3C6A A;  3BGR A;  2XY5 A;  3WQT A;  4JV5 K;  2EX3 A;  5FRO A;  2PBD A; 
#chains in the Genus database with same CATH homology
 5TKW A;  4FWM A;  3QFU A;  5C12 A;  1MA9 B;  1Q82 O;  1QVF M;  5AFU H;  1BUP A;  4QS9 A;  2YX6 A;  4CD3 A;  5BR9 A;  3CXC M;  3VGM A;  3A5M C;  3GG4 A;  3CET A;  4H5T A;  3O9S A;  1S72 N;  1ATR A;  3TSQ A;  3E9O A;  1YVN A;  4BR5 A;  1Q81 O;  3T7Z A;  1HX1 A;  3MN7 A;  3ID8 A;  4PL7 A;  3EE9 A;  4GV9 A;  1NWK A;  1JCF A;  3C0B A;  5BPL A;  3E9L A;  4IO9 L;  4G9Z A;  3IKM A;  5GAD P;  3CCU N;  4WYB A;  3O4W A;  4CZI A;  5BRE A;  4IOC L;  1KQS M;  4M63 C;  2P9P A;  5ADX A;  1ZBS A;  4HTL A;  4H0T B;  2F9T A;  4BRL A;  3CCM N;  4JD2 A;  3O1B A;  5DM6 L;  3L0Q A;  1KAX A;  1U2V B;  5H1S Q;  2D4W A;  1Y64 A;  3LDN A;  1P8Z A;  3E1Y A;  5CE3 A;  2QTD A;  4YOU A;  3ZX2 A;  1YJW N;  2QXL A;  3CJA A;  3PIP L;  2HBJ A;  1TUU A;  1LOT B;  4FO0 A;  4OPA A;  3WEE B;  3CQY A;  4EHT A;  3O8M A;  5KQD A;  4H0P A;  3CMA N;  2P9N A;  4JKG B;  1BDG A;  1MDU B;  1OVY A;  3ZET B;  4BR2 A;  4EIA A;  4R79 A;  3SAG A;  3VEV A;  4GNI A;  4QS8 A;  2QWQ A;  2P9K B;  4EHU A;  3O9R A;  3LDQ A;  3WUH A;  1Q7Y O;  2P9U A;  2VWB A;  4JKH A;  5C10 A;  3DLL L;  1YHQ N;  1S22 A;  2VCP A;  2KLA A;  3CER A;  4BVO A;  1XC3 A;  1NGB A;  4FVU A;  4A5B A;  4ILH A;  5BRD A;  3KHY A;  2QWN A;  3TTF A;  4FWL A;  3VET A;  5GIO A;  1ATN A;  4C1N I;  4DKW A;  1G99 A;  1T3V A;  4WQ4 C;  1NJI O;  3I55 N;  1E4G T;  4FWR A;  4ISG A;  4WF9 L;  2P9S A;  3I33 A;  4IXC A;  4M7X A;  4CZM A;  3CCE N;  5AQF A;  4BG8 A;  1NGD A;  1R59 O;  1SZ2 A;  3ID6 A;  1HPM A;  4KH6 A;  2Q0R A;  4JKE A;  5AFU A;  1OKJ A;  1C0F A;  3MDQ A;  3H45 C;  3TPQ A;  1VQ6 N;  2E1Y A;  3OHR A;  1KXP A;  1K8K A;  1MWK A;  1NGI A;  3O9T A;  4BGA A;  3ENB A;  2P9L A;  3SAH A;  3UE5 A;  3O08 A;  4HWI A;  3NMU A;  2NRH A;  3UKU B;  2OTJ N;  3M5R A;  5AQQ A;  3ULE B;  2ZJR L;  1M90 O;  3OA9 A;  3VGL A;  2EWS A;  1WUA A;  5M1P A;  1MWM A;  2V51 B;  3VER A;  5ADX H;  3L4Q A;  5GAH P;  5JVG L;  2NLX A;  5FPM A;  5LY3 A;  4FWQ A;  1VAZ A;  2YHX A;  4AF1 A;  1VQ5 N;  2GWK A;  4BQL A;  4A2B A;  4IOX A;  3HOT A;  4CBW A;  2QM1 A;  3SBG A;  5LJW A;  3SJH A;  3TSU A;  1BO5 O;  4BRH A;  4Z94 A;  4MLH A;  1QQO A;  2YCH A;  4FWO A;  1YIJ N;  1VQM N;  1Z6R A;  2FSJ A;  1JCG A;  1GLF O;  3WXJ A;  4B1W B;  2NNW A;  4H0Y B;  3GBT A;  3L4I A;  2GX9 A;  1QVG M;  4JKB A;  5AQG A;  3DAW A;  1YAG A;  3N4P A;  4YDU A;  2I7N A;  2ZWH A;  1W2B M;  1NGJ A;  3H3N O;  5BRF A;  4FPA A;  4JN4 A;  4FWS A;  1ZC6 A;  3VES A;  3O9Q A;  2RE2 A;  3FR0 A;  5FPE A;  3CC7 N;  1VQP N;  3EKS A;  2QWM A;  3KVG A;  4H5W A;  4CD1 A;  2CGK A;  3CPE A;  3RSE B;  4ILJ A;  3OBY A;  3CIP A;  4H0V B;  4RCH A;  3QB0 A;  4WFB L;  4PKH A;  5AZI A;  3BF1 A;  1D4X A;  1GLE G;  4GY2 B;  3RVC A;  4B9Q A;  3ZYY X;  4A59 A;  1NGF A;  3D2F B;  3L6Q A;  5KPR A;  2P9U B;  1ILY A;  2NRT A;  5JLH A;  5AZJ A;  3GDQ A;  5EVZ A;  3SK3 A;  1NGE A;  5EXW A;  3TTD A;  4DB3 A;  3CCQ N;  1M1K O;  3P4I A;  2OTL N;  4I6M B;  4AM7 A;  3A5L C;  4BRA A;  4IOA L;  3WXM B;  2KKZ A;  3CQX A;  3WXL A;  4GV3 A;  3OBW A;  4B1Z A;  4NB4 A;  5C2D A;  2QW9 A;  4JK8 A;  3IDH A;  3E9P A;  4BRN A;  3AAQ A;  5JVH L;  3TU5 A;  2P9S B;  4OO1 J;  3BF3 A;  4K43 A;  1K73 O;  2WFB A;  4BRQ A;  2D0O A;  1IG8 A;  3CI5 A;  2WC9 A;  4A5A A;  4UY8 O;  2PFU A;  3SMS A;  3D2E B;  4JK7 A;  4B1X B;  2GUP A;  3FZM A;  3ENO A;  3QBX A;  3C65 A;  3FZF A;  2WUS A;  2A5X A;  1T6C A;  5AQT A;  1K8K B;  2V7Y A;  1J6Z A;  5AQO A;  3VF4 A;  1TYQ B;  3EKU A;  1YJN N;  3Q7C A;  2V52 B;  4IFE A;  4AM6 A;  3ULE A;  2NRV A;  2NRZ A;  5C15 A;  5BRH A;  2NZT A;  3U9D A;  4JHD A;  2IVO A;  3KWG A;  3ZX0 A;  4IWV A;  4PL8 A;  4BRC A;  1CZA N;  3F5T A;  4H0X B;  3FFK B;  4BRP A;  3CC2 N;  4IJA A;  4BRO A;  1NGH A;  5B8H A;  5LJV A;  1GLL O;  5DM7 L;  3UB5 A;  5M1Q A;  2DPN A;  3HZ6 A;  3BP8 A;  5AQH A;  4KH5 A;  3UKR B;  3P39 A;  2P9I B;  2Q1N A;  3O5B A;  1YJ9 N;  2IVP A;  1RGI A;  1BWF O;  3EZW A;  3EO3 A;  5AQY A;  4IEI A;  2YJF A;  1QHA A;  3EE8 A;  3LDP A;  2IIR A;  2P9N B;  4JKG A;  4BRK A;  5M1K A;  2A3Z A;  1O13 A;  5AQP A;  1NLV A;  3SMP A;  4IO8 A;  2HBK A;  3VEW A;  4E1J A;  4F9O A;  2OAN A;  1BA1 A;  3VF2 A;  3G71 N;  2FSN A;  4WFN L;  4ILG B;  1WOQ A;  3MMV A;  1EO1 A;  3WQU A;  3FZK A;  4XH5 A;  1U2V A;  2NRX A;  3J8A A;  3DXK A;  4K25 A;  1K8A O;  2Q97 A;  4U67 L;  4B1U B;  4MDB A;  3IFR A;  5I9E B;  5AQK A;  1X3M A;  2P9P B;  1HLU A;  1NGC A;  2JWL A;  4ISF A;  1QQM A;  3LM9 A;  4A57 A;  3NVK A;  2Q2R A;  1T6D A;  2F7T A;  4NLC A;  5AQW A;  3W0L A;  3KWI A;  2W40 A;  4KH4 A;  5CHI A;  4WQ5 A;  2Q31 A;  4BRG A;  2V7Z A;  2ASP A;  4JAX A;  3G4S N;  2QEX N;  3HSC A;  4BRM A;  1Q86 O;  2ITM A;  2ASO A;  4YOW A;  3O80 A;  4FWP A;  4K41 A;  4CZH A;  2BH1 A;  1NMD A;  3U8X A;  3U9Z A;  3OW2 M;  3MX5 A;  2ASM A;  2J4R A;  3ENH A;  3VPZ A;  3VEY A;  4H5R A;  4BC3 A;  1NM1 A;  4GV6 A;  4C1N K;  1YF5 L;  3C7N B;  3I56 N;  3MWT A;  1YIT N;  4BR4 A;  5EX5 A;  1HKB A;  1V4S A;  3B8A X;  3BEX A;  2FXU A;  3H46 O;  4A62 A;  5F1X A;  3A5N C;  3CCL N;  5EY4 A;  1E4F T;  3MCA B;  3ZEU B;  3LDO A;  3R1X A;  4OPH A;  3PIO L;  4C23 A;  4KBO A;  2HMP A;  4J8F A;  4DQ8 A;  3N4Q A;  3CCS N;  4FWN A;  4XEI A;  2HBM A;  4JKA A;  5MLC Q;  3AGK A;  4WQ4 A;  1H1V A;  5FPD A;  2A40 A;  4PKG A;  4EAH D;  4M7Y A;  4BVP A;  5GIN A;  3H1Q A;  1LCU A;  3NVM A;  2E88 A;  3SAF A;  3CC4 N;  4IDH A;  1JJ2 M;  2Q0U A;  5M1O A;  4YOT A;  1TUY A;  3HBT A;  5TKY A;  4BGB A;  4YOY A;  1VQ8 N;  4JNE A;  3MCP A;  4BRD A;  3CHW A;  3A8Y A;  3QBW A;  2E1Z A;  4JEP A;  4O8K A;  3ZX3 A;  1S3X A;  2FF3 B;  1YI2 N;  3I8B A;  3QFP A;  4JKD A;  5AQS A;  4A61 A;  4WCE L;  4YOX A;  3G6E N;  4GVE A;  1QZ6 A;  2GEL A;  5E26 A;  5AQI A;  3U4L A;  3AGR A;  4B1Y B;  2E20 A;  4EFH A;  3FGU A;  5M1F A;  1KC8 O;  3DXM A;  3AY9 A;  2RHK A;  2VGN A;  2HF3 A;  3WT0 A;  3WXI A;  5JLF A;  2H3G X;  1KD1 O;  3ZET A;  4L3Q A;  2FLO A;  4BC4 A;  2E2N A;  3CF5 L;  1GLD G;  2AA4 A;  3S41 A;  3WEE A;  3ATU A;  4A2A A;  1DT9 A;  1QZ5 A;  4RWT A;  1DGK N;  3EN9 A;  3AAP A;  2BTF A;  4H5V A;  2CH6 A;  5FPN A;  2E2O A;  3Q7B A;  3O6W A;  3SBT A;  3P38 A;  3VGK A;  4BR7 A;  4Y0W A;  1NGG A;  2CGJ A;  3CD6 N;  3M3Z A;  3QIC A;  2NRW A;  3AAR A;  1TYQ A;  4O8U A;  1HKG A;  1KAY A;  2CGL A;  4FOI A;  4BRF A;  4CZJ A;  4IEE A;  5CR4 A;  1GLA G;  2FSK A;  2CH5 A;  3LM2 A;  3RSE A;  3VEX A;  4RTF D;  1W97 L;  2E8A A;  1VQN N;  5BN8 A;  1VQ4 N;  3JXU A;  2GWJ A;  3R8E A;  1YUW A;  1BG3 A;  1GLC G;  4DHY A;  4MO5 A;  1SS6 A;  2JWK A;  2GTD A;  2ZGY A;  3FZH A;  3O1W A;  3R6M A;  3VEZ A;  3VF6 A;  3T69 A;  5AZJ B;  5HOO A;  5GIP A;  2QWO A;  5BPN A;  3UKR A;  2I7P A;  2ZGZ A;  4CZF A;  2P9I A;  2HBL A;  3UKU A;  4K42 A;  4BC5 A;  3ZEU A;  5AQV A;  5AR0 A;  3HM8 A;  5KQ8 A;  1DEJ A;  1VQ9 N;  4FWK A;  3DWL A;  3EL2 A;  4CJ7 A;  1DKG D;  3FLC O;  4NO7 A;  2QWL A;  5AQN A;  3GL1 A;  2P9K A;  4YOR A;  2E2Q A;  2QWR A;  2WBN A;  3G25 A;  3R3L A;  3A5O C;  4JKC A;  3R9P A;  3CME N;  2VGM A;  3D2E A;  5ELZ A;  1QQN A;  3TTC A;  2D1K A;  4O5F A;  3H6E A;  3HRG A;  3J7Z O;  5E84 A;  3CJB A;  2ZF5 O;  1BOT O;  2A41 A;  2YHY A;  4BG9 A;  2IVN A;  3MK6 A;  2QI2 A;  3MN6 A;  4YDU C;  3CJ9 A;  3HOS A;  3CCR N;  5M1N A;  2YJE A;  4WQ5 C;  3JS6 A;  3HTV A;  1NBW A;  1RDU A;  1XQS C;  3GE1 A;  4H0O A;  1GLJ O;  1HJO A;  3F9M A;  5JMV A;  1EQY A;  1JCE A;  4JHD B;  3CCV N;  3TSP A;  1YXQ A;  4H03 B;  5F2R A;  4JKF A;  3VOV A;  4BR0 A;  2E2P A;  1BA0 A;  2D0P A;  2W41 A;  3QDK A;  4H5N A;  5AQL A;  4CBX A;  1N8R O;  2AP1 A;  3VTI A;  3K9K A;  2ZJP L;  3GOI A;  3MX2 A;  2YHW A;  3QML A;  3KK7 A;  2Q36 A;  2P9L B;  2HOE A;  4MO4 A;  4BY9 C;  4CZK A;  4MDA A;  5GAE P;  4CBU A;  1ATS A;  1ZXO A;  2ZJQ L;  1ESV A;  2VYP A;  3M6G A;  5AZI B;  4CZL A;  4PHT X;  3M1F A;  4IJN A;  4U7B A;  4NLB A;  3P31 A;  3VEO A;  1BU6 O;  1RFQ A;  4JK9 A;  3VMF B;  1Z05 A;  3W3D A;  2HST A;  3CJ1 A;  4JD2 B;  3E66 A;  3IMX A;  1VQO N;  2PAV A;  4BC2 A;  1IJJ A;  1VQL N;  4CZG A;  1Q18 A;  2UYT A;  2A6A A;  2QWP A;  3H3O B;  3DXK B;  5KPT A;  4B1V A;  1C0G A;  1RDW X;  5AQZ A;  4BRI A;  2QA4 N;  3K9J A;  1X3N A;  3D6R A;  3LL3 A;  4PKI A;  5BN9 A;  2A42 A;  2FF6 A;  4I6M A;  3VEN A;  3CPW M;  4LC9 B;  2GEM A;  5EOY A;  1SQK A;  5HL7 L;  4BRE A;  4XH4 A;  1KAZ A;  5AQM A;  4FPB A;  2NRR A;  4YOV A;  3CJC A;  1V4T A;  3O9U A;  4QS7 A;  3PLA A;  4XH1 A;  3ATV A;  3FZL A;  5AQU A;  5KPZ A;  1HKC A;  1XUP O;  5JIC A;  2BUP A;  2HF4 A;  4IZ9 A;  3VTH A;  4FL9 A;  1GLB G;  3A0I X;  2YI1 A;  3C6H A;  5AQX A;  3KZB A;  3BUZ B;  4ISE A;  3CJ7 A;  1P90 A;  3H1V X;  3D7E O;  3FE1 A;  3LDL A;  4BQZ A;  1HUX A;  1U6Z A;  4BR9 A;  5GAG P;  1X9J A;  3C7N A;  4CI6 A;  4FSV A;  4DCH A;  1K9M O;  3D2F A;  3SLC A;  1SAZ A;  1T44 A;  3MN5 A;  1VQK N;  2KHO A;  5C0Y A;  5AQJ A;  2F9W A;  4FOE A;  1VQ7 N;  3MN9 A;  5C2F A;  4WFA L;  3MWP A;  3F2K A;  4MLE A;  4CZE A;  1NGA A;  3WXK A;  3DJC A;  5F0X A;  3C6A A;  3HI0 A;  3WQT A;  3IUC A;  5AQR A;  5BPM A;  2PBD A;  3DXM B;  3CCJ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...