3L4QA

Structural insights into phosphoinositide 3-kinase activation by the influenza a virus ns1 protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
SVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural insights into phosphoinositide 3-kinase activation by the influenza A virus NS1 protein
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/protein binding
total genus 31
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3l4qA00
3D6RA 3O9RA 4OPAA 3KWGA 3RVCA 3EE8A 3O9SA 2GX9A 3O9UA 3EE9A 3O9TA 4OPHA 2RHKA 3P31A 3P38A 3O9QA 3P39A 3M5RA 2KKZA 3L4QA 3KWIA 3OA9A 3F5TA
chains in the Genus database with same CATH superfamily
3D6RA 4JD2A 1SKSA 2A5XA 4CJ7A 2P5OA 3PX6A 5KPRA 1J54A 3IFRA 3MCPA 4Z4CA 4E7KA 1E3MA 1W9HA 1JLGA 3D2FB 3I8BA 4OPHA 3VGMA 4FJ5A 3DXMA 3ALYA 5AQWA 5M1KA 3RSEA 2HHXA 4DS5A 4WFNL 1JLFA 3MX2A 2Y1IA 1I3AA 1VRUA 3NDKA 2QEXN 3DRSA 3U4LA 3BP8A 4DR4K 4DKWA 2GUPA 4JKHA 3OBYA 4B3TK 3O4NA 1HNXK 3J7ZO 1TKZA 2NRRA 1HRHA 4PKHA 2PYLA 1IBMK 1RT6A 3K57A 1TKDA 1T44A 3B8AX 3AARA 4PKGA 2G8FA 4CJWA 1VRTA 4JI6K 2O8EA 3NGIA 4GV9A 3K2PA 4CJUA 4B1VA 2GEMA 1LAVA 5GIPA 4IO8A 5AZJB 2ASOA 3ZX2A 1BIUA 1VSEA 5AQNA 3QEPA 4N47A 4OPKA 4OKEA 3O9RA 1BHLA 3KLHA 3PX4A 2Q2RA 1DLOA 3H45C 5AQFA 4JAXA 3JSMA 1S1UA 1JXEA 5AZIA 3A0IX 3TAGA 3ZSYA 1YJ9N 1RT4A 1WAFA 1V4SA 2G8HA 3UKRA 3CJBA 4JI0K 1TUUA 2PAVA 4QAGA 5CYQA 2XRIA 1JLCA 2P9KB 2JWLA 3F5TA 4PL7A 1Q7YO 4JI5K 4BACA 5J2PA 4IEEA 1RT2A 1WLJA 3SJHA 4O5BA 2Q0UA 3S3NA 3PO4A 4OLAA 1WAJA 5LY3A 4CECA 4EZ9A 4YOYA 1ZYQA 1XUPO 4FM0A 3BF1A 4KHSA 2X74A 4BR2A 3R1XA 1VK0A 3P39A 1KTQA 4H4OA 1OH7A 1D8YA 3HT3A 2IIRA 2YJFA 3NBPA 2HF4A 2F9WA 4E19A 1P90A 5JLHA 1HPZA 3ZT1A 3V81A 3SV3A 2W6KA 4IG3A 5BREA 1QHTA 5LJVA 5J2QA 3MXMA 4CJVA 3M3ZA 4KFBA 1HKBA 3CPWM 4BRGA 1RDUA 1OH8A 3FZLA 1MWKA 4DU4A 1JLQA 1RT7A 1N6QA 3VTIA 3NF8A 4J8FA 3AA2A 3L4QA 2CGLA 3QERA 2FSNA 3VQCA 4EZ6A 1HNIA 3MEEA 1HQEA 4CW7B 2OYQA 2A42A 4U67L 3AAQA 4CESA 5H1SQ 4L8RB 3K5OA 2P9NB 5FPDA 1N5YA 1DTTA 2QA4N 1SAZA 5FRMA 4JRPA 3JYTA 3G71N 4DQIA 5AQRA 2KQ2A 3CETA 4OKKA 3G10A 2EX3A 2QWLA 1XHZA 2WONA 2YCHA 3EO3A 3CJ9A 4CEQA 4DSKA 3AO5A 4HWIA 1XQSC 3VF2A 4PUOA 4M7YA 4DWIA 3E01A 3THVA 2BGGA 1IBLK 1C0TA 1T03A 2E4LA 1KVBA 3U6FA 3MEGA 1VQON 1DGKN 4BVOA 3T1HK 4BY9C 1M1KO 3VTHA 4CJPA 3EY1A 3SNNA 4LC9B 3UKUA 1RCHA 3HBTA 4BC5A 4PHTX 5FROA 4JKGA 1IO2A 3RR8A 4PKIA 4M41A 5AQPA 3MX5A 4NLBA 3THXB 1D9DA 3MN5A 1NKEA 4CI6A 3D2EA 3DM2A 4H0PA 1C6VA 2Q3SA 5FDLA 4IG0A 3KK2A 3M8PA 4FO0A 2V7ZA 1B9FA 1CZAN 3AO3A 3CM6A 5AQTA 4BDYA 4BRDA 3TU5A 3WXLA 4JK8A 4TSXA 3ZSRA 1SKWA 2BTFA 4H4MA 4BREA 1W0HA 1VQ7N 2CGJA 3WNHA 2HMIA 3HI0A 4BE2A 3O08A 3SMSA 5JS2A 3LDOA 3EKUA 1HNWK 3H1QA 3QIOA 4ILGB 1JLAA 4DLGA 4CZMA 5KI6A 2ASPA 5AQKA 2O8FB 3C0BA 4O4GA 4UY8O 1XMQK 4DV3K 4BC3A 4B1UB 4KI6A 3HYFA 4BRCA 4JS4A 4Z4FA 3EKSA 4B9MA 2FBXA 4GKJK 4E7JA 5DMRA 3A5LC 3OYLA 3QESA 4HUFA 3U8XA 2YNFA 4DR5K 1C1BA 2OA8A 4W5NA 1JXBA 4GW6A 3ISNC 3V1QA 3SK3A 3HZ6A 4KHPK 1B9DA 5JS1A 1SUQA 4JI1K 2YJEA 4DTMA 4CJQA 2I7NA 2NRWA 2XY6A 4PY5A 2P9IA 3DMJA 5GINA 3TAEA 2NLXA 1IG9A 1ATSA 1J5EK 1ATRA 3CIPA 3GDQA 3OYCA 2HHSA 1DT9A 4XIUA 3CD6N 3EN9A 4DUYK 4JKBA 3KJVA 4FLZA 4F8RA 1HNVA 3ZEUB 4AILC 1TL3A 3CCMN 1VSMA 1Y64A 4DR3K 1YJWN 3WNEA 5BPLA 3KHYA 3A8YA 1TVRA 4LF6K 3NVKA 4ZTFA 4K25A 1S1TA 2OTLN 4NCBA 3RMBA 2O4GA 3DLKA 4HUGA 4WFBL 3LDPA 1RBTA 4XH5A 4CEZA 1EWQA 3L3UA 3S3OA 3L8BA 1NK4A 5E26A 4DV6K 1HJOA 3CQXA 2NNWA 4DFKA 1NK8A 2WTUA 5HRSA 4DQSA 3L4IA 4LSLA 5HL7L 3FZFA 4BRKA 4CD3A 3IUCA 4FXDA 4HUEA 4E7HA 2A40A 3QB0A 3SZ2A 3FFKB 5BN9A 1BA1A 3PIOL 4CEFA 1X9JA 3QFPA 3JXUA 3AVNA 4O0IA 1DEJA 3PSIA 1OVQA 1X9SA 2I7PA 3KD1E 3EYZA 4CJEA 1HKGA 4KPYA 4YFUA 3EZWA 3E9LA 4LFBK 3E9PA 1YHQN 4B3SK 4LF7K 2NRHA 3ULEB 1KVCA 2V51B 4JI7K 5I9EB 1BISA 3CMEN 3VQ9A 4Z94A 1TAUA 2QM1A 4E1JA 3ITHA 4CZHA 1NGJA 3VQ7A 5GADP 4DTXA 2BH1A 2VGMA 5AQJA 4CJRA 3QICA 4CJTA 3KTQA 3NVMA 4M7XA 4BR9A 1U2VA 3LPUA 5AQMA 2ZE2A 4DV1K 1KQSM 1QHAA 4B1WB 4DLEA 4FW1A 4H0TB 3C6TA 3GOIA 1S9EA 4PL8A 1NU0A 3EE9A 2NRZA 4LF4K 3QEWA 3KLFA 2OZSA 2D1KA 1BI4B 3CYMA 1YVNA 4CHNA 1BU6O 2KW4A 1NKCA 4DTJA 4IZ9A 3CC4N 4KHWA 1VQPN 3VGLA 4W5OA 1S1VA 2BANA 4DS4A 4DCHA 4N76A 3H6EA 3M6GA 4F2SA 4OO1J 4BWMA 4ISGA 3P31A 3PSFA 1RT5A 4A61A 2B4JA 2E2NA 2QWNA 1RDWX 4AHTA 1VQLN 3TTFA 2W40A 1Z26A 4B3MK 2GBZA 4OJRA 2HOEA 3F9KA 3G4SN 5C12A 3HP9A 4BRHA 1U45A 4WQ5C 3MXJA 2GWKA 2IS3A 1W2BM 4W5RA 1NM1A 3M1FA 3ENHA 1ZBHA 4UQGA 4J2DA 3W3DA 4CF9A 2O4IA 2H3GX 4CJFA 2OPRA 5FRNA 3ZSWA 3QBXA 2F8SA 3RRGA 4DQRA 1GOCA 2V52B 4DTSA 3QNOA 1NJZA 1TYQB 2Q36A 1IKYA 3OYKA 4ID5A 5KPTA 3WNGA 5KRTA 1GLAG 1CXUA 2XY5A 4DSEA 5AZJA 4KHUA 1X9WA 5ELZA 4FWQA 4FZXC 3FZKA 4O8UA 5HOOA 1K9MO 4FLVA 4BG8A 3THYB 3VN5A 2LSNA 5AQUA 4BE0A 1NOYA 4FJ9A 3L2WA 1U6ZA 3SQ1A 5JMVA 1LCUA 2ZJRL 3WXKA 1J5OA 4O5FA 1IJJA 3IS9A 4X64K 3C7NA 2A3ZA 4K42A 3TI0A 3HVTA 1GLLO 4YORA 3NCIA 3AGRA 1U4BA 4KAZA 1EETA 4Y0WA 2UUCK 2HB5A 3QNNA 1BCMA 4H5RA 4Z4EA 4DUZK 1EQYA 3V6DA 4F3OA 4Z0UA 2P9KA 3E1YA 3OA9A 4MLHA 3QFUA 3WUHA 3RWUA 1YTUA 1GLJO 2HHVA 1YIJN 5BR8K 2P9LB 1RDAA 3ATUA 4AM6A 3LAMA 4BR7A 1VQ9N 3SQ0A 2EHGA 2P1JA 1VSJA 1TUYA 4BE1A 1NK7A 4K8XA 2VGNA 2A1SA 4DSIA 1IKWA 2YHWA 4FJNA 1GLDG 3AO1A 2HBMA 4WFAL 1B92A 3OY9A 1OH6A 4IFYA 5AFUH 3DXKB 1K8AO 3NF9A 3O5BA 4I2PA 4CEEA 3NE6A 1NGEA 4CZLA 4A57A 3IG1A 4BQZA 4JKAA 3VQEA 4I7FA 2E1ZA 4FK2A 4FWLA 4JS5A 3SCXA 3I8DA 4RW6A 4J2EA 3H08A 4EP4A 1JCEA 4CZEA 1T05A 4A2BA 3LWLA 2NUBA 5LL6Z 2F7TA 3E9OA 3EE8A 3ASMA 3ZT2A 2P9NA 1LWFA 3C94A 3VQBA 3V9XA 3KK1A 2AA4A 3O3GA 3PV8A 1C1AA 1NJWA 3J7AP 4N56A 4IOXA 1LOTB 3AA3A 4XH1A 2ETJA 1S5JA 3CMAN 2AJQA 4FJMA 4L3QA 3SI6A 4E7IA 2A41A 2GTDA 5ADXH 3LDLA 3O9TA 2FLOA 4EHTA 4AHVA 3AVJA 1KD1O 4MO4A 3VEVA 2YHYA 5B8HA 4OGCA 5KRSA 5FLXO 1NJIO 1G99A 4H0YB 3AO4A 2Q31A 3SYZA 1FKPA 5C15A 3OYIA 1N34K 2VQEK 1VSIA 4C1NK 1L3VA 2PYJA 4FK4A 3ZX3A 1L3UA 2E8AA 4KB1A 4MO5A 2E5LK 4RWTA 4CFDA 3SAGA 4AQYK 3WXIA 3THXA 3T69A 3CC7N 4FLWA 2GUIA 4CHPA 3ZCMA 4N41A 4X62K 4Q5VA 4RCHA 2NRTA 3DWLA 2HHWA 1X9MA 3ENOA 2F9TA 1RBSA 1JLBA 1S1WA 4J2BA 3OYMA 2IGIA 1JL2A 5HRPA 4FWKA 3I0RA 4AHSA 3T7ZA 5EVZA 1HR0K 4BRIA 4M3YA 1WSIA 1NNEA 4YDUA 2QTDA 4JI3K 3T1YK 3VEWA 2O8FA 3LP1A 5FPNA 2E6MA 5F0XA 4DSLA 2QWQA 4KKOA 4JRQA 5BN8A 1C0MA 4FK0A 4Y1DA 1REVA 3ID6A 1RTJA 3LDSA 1S6PA 3J80O 3TSUA 3VENA 1YAGA 2UXBK 5AFUA 3ZETB 3SQ4A 3GBTA 3LP3A 3WEEB 3RVCA 1NK5A 5AQYA 2GX9A 5C25A 4CHYA 2D0PA 4FL9A 4Z4HA 2E1YA 2WOMA 3NHGA 3RMDA 4M3XA 3WXJA 3UE5A 5C10A 4B8CA 3U3GA 4QS7A 3ZSXA 1ZXOA 5HLFA 4FJ7A 3CHWA 4WQ4A 4A2AA 4CEBA 4KREA 4CZKA 2VQFK 3V9WA 4KH4A 3V9UA 5TKYA 4BROA 2GELA 5AQVA 5GAGP 4QOZB 1Q82O 3LL3A 2E20A 1T3VA 3SUOA 4C8KA 4JK9A 2HBKA 5AQSA 4CEOA 2Z1GA 3IKMA 1CZBA 2QXLA 1DTQA 4LFAK 1JLEA 5ADXA 4CCHA 4Q0BA 3KD5E 1CZ9A 4CBUA 1J6ZA 4CJ4A 2G8UA 3P83D 1MDUB 4F9OA 1X3NA 3D0PA 2YHAA 4FPBA 3AV9A 1IBKK 1K6YA 5KGXA 2Q0RA 3J7YP 1TK5A 5CHIA 4DQ8A 1WBDA 1IKVA 4ICLA 4BC4A 1YT3A 1NGDA 3GE1A 1SL0A 2KHOA 3C6HA 1T7PA 3KIOA 1X3MA 2F4VK 2UYTA 4JD2B 2D0AA 3M8RA 3NH1A 4LF5K 3GG4A 2WFBA 2YHXA 1BDGA 4CBWA 3K0SA 1KSPA 1XMOK 3CCEN 1QE1A 1N33K 1WSFA 3ENBA 4K0KK 1Z05A 5AR0A 4BVPA 5K14A 2QXFA 1U49A 4FJLA 4FJIA 3T3FA 1KRPA 3ULEA 3HP6A 3TSPA 3DXMB 3NFAA 3HL8A 3CCUN 3RMAA 2B5JA 4C23A 3SUQA 2DPNA 3HM9A 3WQTA 1HYSA 2O8BB 2OANA 1EP4A 4M3UA 2ZGYA 2CGKA 2KFZA 2D0BA 3CPEA 4DFMA 2D5RA 3R3LA 2ITMA 3VA3A 1EXQA 3PUFA 4ZHRA 4PA1A 4CHOA 1HMVA 5SZTA 3O4QA 2FBYA 1ASUA 5C42A 2UXDK 3MAQA 2PFUA 4B9NA 2KLAA 2ZD1A 4DSFA 2XY7A 1BI4A 1IG8A 5CZ2A 1FXXA 2PBDA 4JHDB 3CJCA 3LP0A 1JL1A 2RE2A 1NKBA 5AQHA 4B9VA 1VSHA 3OYNA 1F21A 3U9DA 3SPYA 1U47A 2HNZA 4DV0K 3LM2A 5GAEP 4CJ3A 4ILHA 5LJWA 1NK9A 4JN4A 3D7EO 3O6WA 4GMJB 4LH4A 4BR5A 2X78A 3CERA 4FLXA 4IFVA 3DLHA 1VQ6N 4BRQA 3U9ZA 4KHYA 5M1QA 4NYNA 5M1OA 2VG6A 1NG9A 1BOTO 4FWMA 3CCJN 1NJYA 1N8RO 3QBWA 1J53A 5BPNA 1UOCA 4DTRA 1BWFO 3UKRB 3RR7A 4ISEA 3H3OB 2HNDA 3FZMA 3J8AA 3Q7CA 2P9SB 2V7YA 4IDHA 4GY2B 1ILYA 1LAWA 2QWPA 3U3YA 4DU1A 1QQNA 3OYAA 1TYQA 4B1YB 2ZQBA 3H46O 1A5WA 3T19A 4V19S 4H8KA 1RTIA 4E1NA 1FK9A 3VEOA 1LV5A 2YNIA 4FJ8A 3CG7A 3EEQA 2RKIA 4DR6K 3FZHA 4PQUA 1SQKA 4DMNA 1K8KB 3AVCA 5AQGA 4F2RA 1ZBSA 3VEZA 1IV0A 3HPHA 3E66A 2BDPA 1C0UA 2YX6A 3VF6A 1S22A 4CHQA 3PX0A 4KRFA 4KHNA 1CLQA 1P8ZA 4B9UA 4ELVA 1KFDA 4GVMA 1C0GA 4OLBA 4RTFD 3BEXA 5I42A 1T6CA 4EAHD 4DV7K 1C1CA 3BDPA 3OYJA 1UA0A 1OKJA 2HF3A 1KXPA 3O3FA 4OPAA 1ESVA 3SMPA 2P9LA 1BUPA 2HHTA 4CERA 3ZT3A 1QZ6A 3RTVA 1ITGA 2DFFA 1RDBA 1MWMA 4HCBA 3L0QA 1QQCA 1XC9A 3QETA 1G15A 5M1PA 1L3TA 4KHQA 3F9MA 4JI4K 4LH5A 3N4QA 3P4IA 3DXKA 4FPAA 3O9SA 3K9JA 1QQMA 3AVFA 2WC9A 1RDDA 5AQOA 3P1GA 1XI1A 3AVKA 3OS0A 2P5GA 1BA0A 3THWB 1VQ4N 3DRRA 4CVNE 1ZBUA 4CF2A 3OW2M 3DAWA 4CFCA 4I6MB 1SL2A 3AVLA 4Z4IA 1X1PA 1YF5L 3CJ1A 4Z4GA 3SAFA 1BGXT 4RW4A 1TKTA 4E1MA 1VQ5N 4CF8A 2VCPA 3O80A 4KTZA 5GAHP 4OPJA 1DKGD 2UU9K 3LDNA 3D2FA 4J2AA 3I33A 4AF1A 1HJRA 4BDPA 2GWJA 1NJXA 4H5TA 3KK3A 3TAPA 1GLEG 3MN7A 1KFSA 2Q1NA 3K9KA 4KO0A 3HM8A 5AQIA 3ZSOA 4CZIA 4M42A 4HTLA 4ELTA 3V4IA 1WN7A 1OH5A 3VERA 2G8KA 4CEAA 1VQMN 3FR0A 4DF4A 2RN2A 3CCSN 4XH4A 5CZ1A 2XHBA 1XHXA 2DFHA 4B9QA 4K43A 2EWSA 4BR4A 3ZX0A 5C24A 2QKBA 1Y97A 3O9QA 1A5VA 3JS6A 4GKKK 3TABA 2FSJA 3CI5A 4B3RK 1MU2A 4IFEA 1Q9XA 2QI2A 2Z1IA 4DQQA 4CE9A 2QWOA 3DLRA 3B6OA 4IOAL 5HRRA 2IVOA 2X6NA 1RFQA 3OYBA 1Q18A 1NGCA 1HX1A 4NCGA 1YVUA 3ZSQA 1S3XA 3CJAA 1L3SA 4Y1CA 3T1AA 4YHHK 1K73O 1Q81O 2RF2A 2FBTA 2P9IB 2B6AA 3I55N 1HYZA 1WSHA 4DTUA 4X65K 4CFBA 1YTAA 1BQMA 3WNFA 4FWPA 4BGAA 1QSYA 4DTPA 2ZJQL 4JLHA 3H3NO 1RDCA 5DM6L 3CF5L 1YJNN 2VWKA 3AVHA 3LPTA 5JICA 1GLBG 2CH6A 5EOYA 3CQ8A 1NK6A 4GNIA 3CCVN 4M3WA 3TANA 1ATNA 1VSDA 2FBVA 2VWJA 3OYFA 3V9ZA 5KQ8A 3BZKA 1R0AA 3L2RA 3CXCM 1O13A 3WEEA 1LW0A 4FJGA 1TGOA 1SKRA 5KQDA 4FJJA 4FW2A 4H5VA 3EZ5A 4YOUA 3TWHA 4IEIA 3NF7A 4KTQA 4IXCA 3VOVA 3SAHA 3CC2N 4C8LA 1TK0A 5CR4A 2QWRA 4BR0A 4FLUA 2P51A 3RMCA 1RGIA 1WBBA 4OKJA 4NB4A 1NBWA 4BRLA 2HSTA 3BUZB 3MCAB 4DF8A 4OVLA 3OVNA 2P9UB 3SUPA 1TK8A 4G9ZA 5F1XA 3QEXA 1W97L 4JNEA 1D5AA 2Z1HA 3LDQA 3LZIA 4O8KA 4ISFA 3QLHA 5BRFA 2W41A 4DR1K 2DTUA 1WSGA 4FWSA 2BE2A 2ASMA 3SLCA 5J2NA 2G8VA 2KFNA 1KC8O 3C65A 3MDQA 1BL3A 1A5XA 1BIZA 2HNYA 2QKKA 4X66K 3CQYA 3ZSZA 2IAJA 3OBWA 4WYBA 3O1WA 4A5AA 4WQ5A 5JLFA 3SPZA 3NAEA 2OPQA 5LMNK 3NGZA 3HJFA 4FWRA 4O44A 4IO9L 2E6LA 4ELUA 2UUAK 4BWJA 4LF8K 1NGBA 3CFPA 1H1VA 4FSVA 4CBXA 4FJKA 4NXNK 2Z1JA 2ZF5O 2D0CA 4IOCL 3ZYYX 2O8DB 3ZT0A 4KV8A 5FPMA 1QZ5A 3VETA 4A59A 4JV5K 3TTCA 3CCRN 4EHUA 4FLYA 4JKDA 5BPMA 4FVMA 4YOTA 4BRAA 2NRXA 4MQ3A 2O8BA 3F2KA 4R79A 3R9PA 3CM5A 1VSFA 4DB3A 1NOZA 3J81O 1NGFA 2FSKA 5D3GA 3DLLL 2D4WA 1LWEA 4M3TA 1XNQK 1W7AA 3IRXA 5HRNA 3SBGA 3VQ4A 1R59O 4CGHA 4CGFA 1RTHA 1I39A 1YUWA 3UB5A 2KKZA 5AJ3K 4BC2A 3OTOK 3DOKA 4QS8A 5HBMA 3OYEA 4DU3A 4JHDA 3DOLA 4JI2K 3QIPA 1NLVA 4A62A 4CGJA 1ZBLA 2IOCA 1E4FT 2G8WA 3OYGA 2VYPA 2Y1JA 2XY8A 4IBNA 4NXMK 4FVUA 1NWKA 1UAXA 2YKNA 2R7YA 1IH7A 3EL2A 1YI2N 1QVFM 2OZMA 1TAQA 4AHCA 1VHXA 3KLGA 4B08A 3HSCA 3DRPA 3V1OA 3VA0A 2J4RA 4W5QA 4H0VB 3AGKA 2XO7A 4K8ZA 3NH2A 4WF9L 3HRGA 3WQUA 2YKMA 4IDKA 1QSSA 1V4TA 3C7NB 1WB9A 5KGWA 1WSEA 5CYMA 3R8EA 4FZYA 2VG7A 5IT9O 3TR8A 1N32K 2ATQA 4IJNA 2P9SA 4KB0A 2FXUA 4YY3K 4DV5K 4CFAA 4PWDA 4CGIA 1SL1A 1D9FA 2I5JA 4FOEA 3IMXA 1VQ8N 3O3HA 1KAYA 5TKWA 4FWOA 2P9PB 4CZJA 1HLUA 3OYDA 3TSQA 3LP2A 3AVGA 1ASWA 1VQKN 3ZEUA 3AVBA 4CIEA 1S6QA 3DYAA 1K8KA 3L2UA 2E88A 3FE1A 3ID8A 3AVMA 1S9GA 2QWMA 2YHBA 1NMDA 2HVIA 5DM7L 2HBJA 1Z25A 3SJJA 2O8CB 4RW7A 3K59A 3S9HA 4KI4A 1VSKA 4IWVA 1HKCA 3ATVA 4IJAA 4LD0A 4QS9A 3KZBA 2HVHA 3KK7A 1S72N 4CJ5A 3DLEA 5HROA 2WUSA 2FC0A 3HOTA 1QVGM 4AHUA 2F8TA 4LF9K 4C8NA 5GIOA 1LW2A 1UWBA 3A5NC 4NYFA 3HK2A 3NGYA 4JKFA 1QQOA 1FW6A 4BRNA 4LFCK 1KLMA 3MXIA 4H5NA 1GOBA 3FFIA 2HW3A 1WNSA 4GVEA 3TAFA 5EU7A 5LMUK 3VQ6A 4YNQA 1HQUA 3RSEB 4JYAK 2GV9A 4EP5A 4CK3A 4HCCA 3L2QA 1Q86O 1GLCG 1RBRA 3ZSVA 3WXMB 3VQDA 2IDOA 4R5PA 4DTNA 1M90O 1RTDA 3DLBA 5AQLA 1EWRA 4H03B 4M45A 3THWA 4YOXA 1FJGK 2RPIA 3O1BA 4CEDA 5DK5A 4BG9A 3LAKA 3MMVA 1VSLA 4BQLA 4DFPA 1TV6A 4B9SA 4JK7A 1NK0A 4B1XB 2G8IA 4I6MA 3C95A 1NMNA 3A5MC 4C8OA 1NGAA 3VEYA 4CZGA 1J9AA 2ITGA 2O8EB 4FZZA 3SBTA 3GL1A 4RW9A 1L5UA 3Q7BA 3A5OC 4DR2K 2ZWHA 3VQPA 4HTUA 4EFHA 3VEXA 3VGKA 3DJCA 4FJXA 3KVGA 4EIAA 2VG5A 2JLEA 3LWMA 4DHYA 4BRFA 1WUAA 3L6QA 2YNHA 3W0LA 3OS2A 5AZIB 3KLEA 2CH5A 5IWAK 3M8SA 3AAPA 4CZFA 3AVIA 4I2QA 3IDHA 1JJ2M 1RNHA 5EY4A 2IVNA 4E7LA 2Q97A 3AO2A 4KH5A 3QEIA 3S41A 1VAZA 3FGUA 5KPZA 1WOQA 5J1EA 4W5TA 5M1FA 3BY5A 2IC3A 3TAMA 3BF3A 1SZ2A 2A1RA 3FLCO 1RBVA 2OPSA 1YITN 3K5NA 4AHRA 4BRPA 4DFJA 3G6EN 1XC3A 2A6AA 2W6LA 3KKRA 5EXWA 5C2FA 2HHUA 2NRVA 3ZLJA 1RT3A 1S1XA 5BR9A 3VQ5A 3S3MA 3WT0A 3NH0A 3VPZA 4NLCA 4M3ZA 3CFOA 4ILJA 4JEPA 1KAXA 4RW8A 3THYA 1EO1A 3B6PA 1SS6A 1ZBIA 1SV5A 1NGHA 3OYHA 2PY5A 1JCGA 4O0JA 4F3TA 2ZGZA 3I0SA 2DFEA 2JWKA 5C2DA 1RBUA 5CE3A 1U04A 1D4XA 1ZBFA 3V9SA 3C6AA 3PLAA 3BZCA 3QO9A 1KCFA 3N4PA 3IAYA 3HPGA 1RT1A 1BQNA 3OJUA 4FOIA 3CCQN 4AM7A 4QCLA 3ZT4A 3QMLA 3PO5A 1MA9B 3TAQA 3R6MA 3VF4A 4DV2K 1VQNN 3SUNA 5HP1A 1ASVA 3H1VX 4CD1A 4DR7K 4C1NI 2ZM6K 1QSLA 1YXQA 1RILA 5AQQA 2RHKA 3MK6A 4CIFA 1HPMA 1I94K 3VQQA 4E0DA 4A5BA 3HXMA 3O4WA 4B1ZA 1T6DA 4WCEL 3TTDA 2HHHK 2QK9A 3DI6A 4DV4K 3D45A 4CF0A 3MEDA 4B3OA 2P9UA 4C8MA 2KZMA 3I56N 3HO1A 3BGRA 1Z6RA 4JI8K 4BGBA 3JAMO 5FPEA 1IKXA 4K41A 3MN6A 4CJKA 2FF6A 2ZJPL 5MLCQ 4MFBA 4FWNA 3QEVA 3UKUB 3M5RA 3KWIA 1XNRK 2OTJN 4JKGB 3OHRA 3OJSA 3P5JA 1N36K 4OX9K 4FJHA 4CHZA 2HMPA 3MECA 3RRHA 3D2EB 5CY4A 4GV6A 3PIPL 1BCOA 4OGEA 4E89A 4B8AB 5KTQA 4G1QA 5EX5A 4CK1A 4H0OA 3LM9A 2YI1A 4MDAA 3VMFB 1LWCA 3M8QA 5SWMA 4NO7A 3SQ2A 4KH6A 3ULDA 5BRDA 4E3SA 4LY7A 5BRHA 3KLIA 1OVYA 4M63C 4CIGA 4O55A 5E41A 2E2OA 1U48A 4GV3A 4ZTJA 2O8DA 1JKHA 3MWTA 4YOWA 2D0OA 2E2PA 5T7BA 1T8EA 5AQZA 3MWPA 3CJ7A 4CF1A 4DQPA 5C0YA 4F4KA 3UIQA 4FLTA 1HNZK 3K5LA 3HPOA 1GOAA 3HSTB 4RG8A 1WSJA 3VQ8A 4H0XB 3VQAA 4MDBA 3AY9A 1QS4A 3CCLN 4FCYA 2W42A 4I9QA 5E84A 4CJLA 2X6SA 4HVJA 2DY4A 3OS1A 5JVHL 3O8MA 1HYVA 2OCEA 3A2FA 3NF6A 4N5SA 1KLNA 4U7BA 3KKSA 3AVAA 3KWGA 1NGIA 3V1RA 3QINA 1ZC6A 4WE1A 3NMUA 4KBOA 5J2MA 3LANA 4B9TA 2KTQA 3O9UA 4BRMA 2IVPA 2AP1A 3PY8A 1EX4A 4FM2A 4B9LA 5A2QO 1KAZA 2KZZA 4YOVA 4DG1A 3HTVA 2WBNA 3F73A 3QDKA 1QTMA 1TL1A 4AH9A 2QW9A 3HVRA 1C0FA 1XWLA 3ZETA 3VESA 3CFRA 2HHQA 4KTWA 4CJSA 4CK2A 2YV0X 3G25A 4HHTA 2NZTA 5F2RA 4M3RA 4XEIA 4JKEA 2YNGA 1Q9YA 4CGGA 2E2QA 1Q8IA 3G0ZA 1HUXA 1GLFO 3AA5X 2UXCK 3MN9A 3P38A 4FYDA 2HBLA 1BG3A 4YDUC 3SV4A 1NGGA 1BO5O 2FF3B 1CXQA 1KVAA 4DSJA 3DLGA 5I3UA 4LSNA 1JCFA 3K5MA 2P9PA 1UA1A 4CGDA 5M1NA 3AA4A 3LZJA 2JGUA 5AQXA 3L2VA 3C6UA 4NCAA 2PZSA 1FKOA 4IKFA 3TARA 3LALA 3TPQA 5JVGL 4JKCA 3K58A 3HOSA 1TKXA 2F96A 3L3VA 4ID1A 4FM1A 2OPPA 2O8CA 4WQ4C 4DTOA 4I9LA 2UUBK 2VWBA 1U2VB 4H5WA 1EKEA 4MLEA 2BUPA 4BDZA 1E4GT 1O1WA
chains in the Genus database with same CATH topology
3D6RA 4JD2A 4GY2B 1ILYA 2A5XA 2QWPA 4CJ7A 1QQNA 2HOEA 2QWMA 1NMDA 1TYQA 3G4SN 4B1YB 4BRHA 5C12A 5DM7L 3H46O 2HBJA 4WQ5C 5KPRA 2GWKA 3IFRA 3MCPA 3VEOA 4IWVA 1HKCA 1W2BM 1NM1A 3D2FB 3ENHA 3I8BA 3M1FA 4OPHA 3ATVA 3VGMA 3W3DA 4IJAA 2H3GX 3KZBA 4QS9A 3DXMA 5AQWA 3KK7A 5M1KA 1S72N 3FZHA 3RSEA 1SQKA 1K8KB 5AQGA 2WUSA 4WFNL 3HOTA 1QVGM 3QBXA 1ZBSA 3MX2A 3VEZA 5GIOA 3A5NC 3E66A 4JKFA 1QQOA 2V52B 2YX6A 3VF6A 4BRNA 1TYQB 2Q36A 1S22A 2QEXN 3U4LA 3BP8A 5KPTA 1GLAG 4DKWA 1P8ZA 5AZJA 2GUPA 4H5NA 4JKHA 5ELZA 4GVEA 3OBYA 4FWQA 3FZKA 1C0GA 4O8UA 5HOOA 4RTFD 3BEXA 1K9MO 3J7ZO 2NRRA 1T6CA 4PKHA 4BG8A 4EAHD 5AQUA 1OKJA 1T44A 1U6ZA 2HF3A 3RSEB 1KXPA 5JMVA 3B8AX 1ESVA 1LCUA 3AARA 4OPAA 4PKGA 2ZJRL 3WXKA 4O5FA 3SMPA 1IJJA 1Q86O 2P9LA 1GLCG 1BUPA 3WXMB 4GV9A 3C7NA 2A3ZA 4K42A 4B1VA 1M90O 1QZ6A 2GEMA 1GLLO 4YORA 3AGRA 5AQLA 4IO8A 5GIPA 4H03B 5AZJB 1MWMA 2ASOA 4Y0WA 3ZX2A 4YOXA 3L0QA 3O1BA 4H5RA 1EQYA 4BG9A 3MMVA 5AQNA 4BQLA 2P9KA 5M1PA 3E1YA 4JK7A 3OA9A 4B1XB 4I6MA 3O9RA 3F9MA 3A5MC 2Q2RA 4MLHA 1NGAA 3N4QA 3P4IA 3DXKA 3H45C 3O9SA 3QFUA 4FPAA 3K9JA 4JAXA 5AQFA 1QQMA 1GLJO 3VEYA 3WUHA 2WC9A 1YIJN 2P9LB 5AQOA 5AZIA 3A0IX 3SBTA 3GL1A 3ATUA 4AM6A 1YJ9N 4BR7A 1VQ9N 3Q7BA 3A5OC 2ZWHA 4EFHA 1V4SA 1BA0A 1TUYA 4CZGA 3UKRA 3CJBA 3VEXA 3VGKA 1VQ4N 3DJCA 2BUPA 1TUUA 2PAVA 2VGNA 3KVGA 4EIAA 2YHWA 2P9KB 2JWLA 1GLDG 3F5TA 4PL7A 1Q7YO 3OW2M 2HBMA 3DAWA 4WFAL 4I6MB 1YF5L 4IEEA 4DHYA 5AFUH 4BRFA 1WUAA 3L6QA 3CJ1A 3DXKB 3SJHA 1K8AO 3SAFA 2Q0UA 3O5BA 3W0LA 1NGEA 4CZLA 4A57A 5LY3A 1VQ5N 4YOYA 2VCPA 5AZIB 1XUPO 3O80A 2CH5A 3BF1A 4BQZA 3AAPA 4CZFA 5GAHP 1DKGD 4JKAA 2E1ZA 3IDHA 3LDNA 5EY4A 4FWLA 2IVNA 3D2FA 2Q97A 4KH5A 1JJ2M 3I33A 4AF1A 3S41A 1VAZA 4BR2A 2GWJA 3FGUA 4H5TA 1WOQA 3R1XA 5KPZA 1JCEA 5M1FA 3P39A 1GLEG 3MN7A 4CZEA 2Q1NA 3K9KA 5AQIA 3BF3A 3HM8A 2IIRA 4A2BA 2YJFA 4CZIA 1SZ2A 2F7TA 2HF4A 3FLCO 4HTLA 2F9WA 3E9OA 1YITN 3EE8A 1P90A 2P9NA 4BRPA 5JLHA 3G6EN 1XC3A 2A6AA 2AA4A 5EXWA 3VERA 5C2FA 2NRVA 5BR9A 5BREA 1VQMN 5LJVA 3WT0A 4IOXA 1LOTB 3FR0A 4XH1A 3M3ZA 3VPZA 3CMAN 4NLCA 1HKBA 3CCSN 4XH4A 4BRGA 3CPWM 1RDUA 4L3QA 4B9QA 4ILJA 4K43A 4JEPA 2EWSA 4BR4A 1KAXA 2A41A 3FZLA 1MWKA 2GTDA 3ZX0A 3VTIA 5ADXH 3O9QA 4J8FA 1EO1A 3L4QA 3JS6A 3LDLA 2CGLA 3O9TA 2FSNA 1SS6A 2FLOA 2FSJA 4EHTA 1KD1O 4MO4A 3CI5A 2YHYA 3VEVA 1NGHA 5B8HA 4IFEA 1JCGA 2QI2A 2ZGZA 2A42A 4U67L 2QWOA 3AAQA 5H1SQ 2JWKA 2P9NB 5FPDA 1NJIO 5C2DA 1G99A 4IOAL 4H0YB 2QA4N 2Q31A 1SAZA 1D4XA 5CE3A 2IVOA 1RFQA 3G71N 3C6AA 5C15A 5AQRA 3PLAA 3CETA 1Q18A 1NGCA 1HX1A 3N4PA 2QWLA 1S3XA 4C1NK 3CJAA 3ZX3A 2YCHA 2E8AA 4MO5A 4FOIA 3EO3A 3CCQN 3CJ9A 4RWTA 1K73O 4AM7A 1Q81O 3SAGA 3QMLA 2P9IB 3WXIA 4HWIA 3I55N 1XQSC 3T69A 1MA9B 3CC7N 3VF2A 3R6MA 3VF4A 1VQNN 4FWPA 4BGAA 4M7YA 4RCHA 2NRTA 3DWLA 3H1VX 4CD1A 2ZJQL 3ENOA 3H3NO 4C1NI 2F9TA 5DM6L 1YXQA 3CF5L 1YJNN 5AQQA 1VQON 5JICA 1DGKN 1GLBG 2CH6A 5EOYA 2RHKA 3MK6A 4BVOA 4GNIA 1HPMA 3VTHA 1M1KO 3CCVN 4BY9C 4FWKA 4LC9B 4A5BA 3UKUA 3O4WA 3HBTA 3T7ZA 4B1ZA 4BC5A 1ATNA 4PHTX 1T6DA 4WCEL 5EVZA 3TTDA 4JKGA 5KQ8A 4PKIA 3CXCM 1O13A 3MX5A 4NLBA 5AQPA 3WEEA 3MN5A 4BRIA 4CI6A 3D2EA 4H0PA 2P9UA 4YDUA 5KQDA 2QTDA 4H5VA 3I56N 4FO0A 4YOUA 2V7ZA 1CZAN 1Z6RA 3VEWA 5AQTA 4BRDA 3TU5A 4IEIA 3WXLA 4BGBA 5FPEA 4JK8A 4K41A 3MN6A 4IXCA 5FPNA 3VOVA 5F0XA 3SAHA 2QWQA 2FF6A 2ZJPL 3CC2N 5BN8A 2BTFA 4BREA 5MLCQ 3ID6A 4FWNA 1VQ7N 2CGJA 5CR4A 2QWRA 3UKUB 3M5RA 3TSUA 4BR0A 3KWIA 3VENA 1YAGA 3HI0A 3O08A 2OTJN 3SMSA 4JKGB 3OHRA 5AFUA 3ZETB 3GBTA 1RGIA 3LDOA 3EKUA 3WEEB 3RVCA 2HMPA 4NB4A 1K8KA 1NBWA 3H1QA 4ILGB 4BRLA 5AQYA 2GX9A 2HSTA 3BUZB 3D2EB 3MCAB 2D0PA 4FL9A 4CZMA 2P9UB 2E1YA 4GV6A 2ASPA 3WXJA 3PIPL 3UE5A 4G9ZA 5AQKA 5F1XA 1W97L 3C0BA 4UY8O 5C10A 4JNEA 4QS7A 5EX5A 4BC3A 1ZXOA 4H0OA 3LDQA 4B1UB 3LM9A 4O8KA 2YI1A 3CHWA 4ISFA 4MDAA 4WQ4A 3VMFB 4A2AA 4BRCA 4NO7A 4CZKA 5BRFA 4KH6A 2W41A 5BRDA 3EKSA 4FWSA 4KH4A 5BRHA 2ASMA 5TKYA 1OVYA 3SLCA 4M63C 3A5LC 4BROA 2GELA 5AQVA 5GAGP 1Q82O 3LL3A 2E20A 1T3VA 2E2OA 3U8XA 1KC8O 4GV3A 3C65A 4JK9A 3MDQA 2HBKA 3MWTA 5AQSA 4YOWA 3CQYA 2D0OA 2E2PA 3SK3A 3HZ6A 3IKMA 4WYBA 3OBWA 2QXLA 3O1WA 5AQZA 4A5AA 2YJEA 4WQ5A 5JLFA 3MWPA 5ADXA 3CJ7A 2I7NA 2NRWA 4FWRA 4CBUA 1J6ZA 4IO9L 2P9IA 5GINA 5C0YA 1MDUB 2NLXA 4F9OA 1X3NA 1NGBA 1H1VA 4FSVA 4CBXA 4FPBA 1ATSA 1ATRA 3CIPA 2ZF5O 3GDQA 1DT9A 4H0XB 4IOCL 3CD6N 2Q0RA 3ZYYX 4MDBA 3AY9A 3EN9A 3CCLN 5CHIA 4JKBA 4DQ8A 5FPMA 1QZ5A 3VETA 5E84A 4A59A 4BC4A 3TTCA 3ZEUB 3CCMN 1NGDA 1Y64A 5JVHL 1YJWN 3GE1A 3O8MA 2KHOA 3KHYA 4EHUA 3A8YA 3C6HA 5BPLA 3CCRN 3NVKA 4JKDA 5BPMA 4K25A 4U7BA 1X3MA 2UYTA 4JD2B 2OTLN 4YOTA 4BRAA 2NRXA 3KWGA 3F2KA 3GG4A 1NGIA 2WFBA 3LDPA 4R79A 4WFBL 3R9PA 2YHXA 4XH5A 1ZC6A 3NMUA 1BDGA 4KBOA 4DB3A 4CBWA 1NGFA 2FSKA 3CCEN 3O9UA 5E26A 4BRMA 3DLLL 2D4WA 2IVPA 3ENBA 1Z05A 2AP1A 5AR0A 1HJOA 3CQXA 2NNWA 1KAZA 4BVPA 4YOVA 3HTVA 3L4IA 2WBNA 3SBGA 5HL7L 1R59O 3ULEA 3QDKA 3FZFA 4BRKA 4IDHA 3IUCA 3TSPA 3DXMB 1YUWA 4CD3A 2A40A 3QB0A 3CCUN 3UB5A 2KKZA 3FFKB 5BN9A 2QW9A 1C0FA 4BC2A 4C23A 4QS8A 1BA1A 3ZETA 3PIOL 2DPNA 1X9JA 3QFPA 4JHDA 3JXUA 3VESA 3WQTA 1NLVA 1DEJA 2OANA 2I7PA 2ZGYA 2CGKA 4A62A 1E4FT 3CPEA 1HKGA 3G25A 2NZTA 3EZWA 2VYPA 3R3LA 2ITMA 4FVUA 5F2RA 3E9LA 4XEIA 1NWKA 4JKEA 2E2QA 1YI2N 3EL2A 1HUXA 3E9PA 1YHQN 1QVFM 1GLFO 3MN9A 3P38A 2NRHA 3HSCA 3ULEB 2PFUA 2KLAA 2J4RA 2HBLA 4H0VB 1BG3A 2V51B 3AGKA 4YDUC 5I9EB 1IG8A 1NGGA 1BO5O 2FF3B 4WF9L 3CMEN 2PBDA 4Z94A 3HRGA 4JHDB 2QM1A 3CJCA 4E1JA 3WQUA 4CZHA 1NGJA 1V4TA 5GADP 2RE2A 3C7NB 1JCFA 2BH1A 2VGMA 2P9PA 5AQHA 3R8EA 5AQJA 3QICA 3U9DA 3NVMA 4M7XA 5M1NA 4BR9A 1U2VA 5AQMA 1KQSM 1QHAA 4B1WB 3LM2A 5GAEP 4H0TB 4ILHA 5AQXA 4IJNA 2P9SA 3GOIA 2FXUA 5LJWA 4PL8A 4JN4A 3D7EO 3EE9A 3O6WA 2NRZA 4BR5A 3CERA 2D1KA 3TPQA 5JVGL 1YVNA 4JKCA 1BU6O 3HOSA 4FOEA 1VQ6N 4IZ9A 4BRQA 3CC4N 3U9ZA 1VQPN 3VGLA 3IMXA 5M1QA 1VQ8N 5M1OA 1BOTO 1KAYA 5TKWA 4FWOA 2P9PB 4FWMA 4WQ4C 4DCHA 4CZJA 3H6EA 3CCJN 3M6GA 3QBWA 1N8RO 5BPNA 1HLUA 4OO1J 1BWFO 2VWBA 1U2VB 4ISGA 3P31A 3TSQA 3UKRB 4ISEA 3H3OB 4H5WA 1VQKN 3ZEUA 4A61A 3FZMA 3J8AA 2E2NA 2QWNA 3Q7CA 1RDWX 2P9SB 4MLEA 1VQLN 3TTFA 2V7YA 2W40A 1E4GT 2E88A 3FE1A 3ID8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6R A;  3O9R A;  4OPA A;  3KWG A;  3RVC A;  3EE8 A;  3O9S A;  2GX9 A;  3O9U A;  3EE9 A;  3O9T A;  4OPH A;  2RHK A;  3P31 A;  3P38 A;  3O9Q A;  3P39 A;  3M5R A;  2KKZ A;  3L4Q A;  3KWI A;  3OA9 A;  3F5T A; 
#chains in the Genus database with same CATH topology
 3D6R A;  4JD2 A;  1SKS A;  2A5X A;  4CJ7 A;  2P5O A;  3PX6 A;  5KPR A;  1J54 A;  3IFR A;  3MCP A;  4Z4C A;  4E7K A;  1E3M A;  1W9H A;  1JLG A;  3D2F B;  3I8B A;  4OPH A;  3VGM A;  4FJ5 A;  3DXM A;  3ALY A;  5AQW A;  5M1K A;  3RSE A;  2HHX A;  4DS5 A;  4WFN L;  1JLF A;  3MX2 A;  2Y1I A;  1I3A A;  1VRU A;  3NDK A;  2QEX N;  3DRS A;  3U4L A;  3BP8 A;  4DR4 K;  4DKW A;  2GUP A;  4JKH A;  3OBY A;  4B3T K;  3O4N A;  1HNX K;  3J7Z O;  1TKZ A;  2NRR A;  1HRH A;  4PKH A;  2PYL A;  1IBM K;  1RT6 A;  3K57 A;  1TKD A;  1T44 A;  3B8A X;  3AAR A;  4PKG A;  2G8F A;  4CJW A;  1VRT A;  4JI6 K;  2O8E A;  3NGI A;  4GV9 A;  3K2P A;  4CJU A;  4B1V A;  2GEM A;  1LAV A;  5GIP A;  4IO8 A;  5AZJ B;  2ASO A;  3ZX2 A;  1BIU A;  1VSE A;  5AQN A;  3QEP A;  4N47 A;  4OPK A;  4OKE A;  3O9R A;  1BHL A;  3KLH A;  3PX4 A;  2Q2R A;  1DLO A;  3H45 C;  5AQF A;  4JAX A;  3JSM A;  1S1U A;  1JXE A;  5AZI A;  3A0I X;  3TAG A;  3ZSY A;  1YJ9 N;  1RT4 A;  1WAF A;  1V4S A;  2G8H A;  3UKR A;  3CJB A;  4JI0 K;  1TUU A;  2PAV A;  4QAG A;  5CYQ A;  2XRI A;  1JLC A;  2P9K B;  2JWL A;  3F5T A;  4PL7 A;  1Q7Y O;  4JI5 K;  4BAC A;  5J2P A;  4IEE A;  1RT2 A;  1WLJ A;  3SJH A;  4O5B A;  2Q0U A;  3S3N A;  3PO4 A;  4OLA A;  1WAJ A;  5LY3 A;  4CEC A;  4EZ9 A;  4YOY A;  1ZYQ A;  1XUP O;  4FM0 A;  3BF1 A;  4KHS A;  2X74 A;  4BR2 A;  3R1X A;  1VK0 A;  3P39 A;  1KTQ A;  4H4O A;  1OH7 A;  1D8Y A;  3HT3 A;  2IIR A;  2YJF A;  3NBP A;  2HF4 A;  2F9W A;  4E19 A;  1P90 A;  5JLH A;  1HPZ A;  3ZT1 A;  3V81 A;  3SV3 A;  2W6K A;  4IG3 A;  5BRE A;  1QHT A;  5LJV A;  5J2Q A;  3MXM A;  4CJV A;  3M3Z A;  4KFB A;  1HKB A;  3CPW M;  4BRG A;  1RDU A;  1OH8 A;  3FZL A;  1MWK A;  4DU4 A;  1JLQ A;  1RT7 A;  1N6Q A;  3VTI A;  3NF8 A;  4J8F A;  3AA2 A;  3L4Q A;  2CGL A;  3QER A;  2FSN A;  3VQC A;  4EZ6 A;  1HNI A;  3MEE A;  1HQE A;  4CW7 B;  2OYQ A;  2A42 A;  4U67 L;  3AAQ A;  4CES A;  5H1S Q;  4L8R B;  3K5O A;  2P9N B;  5FPD A;  1N5Y A;  1DTT A;  2QA4 N;  1SAZ A;  5FRM A;  4JRP A;  3JYT A;  3G71 N;  4DQI A;  5AQR A;  2KQ2 A;  3CET A;  4OKK A;  3G10 A;  2EX3 A;  2QWL A;  1XHZ A;  2WON A;  2YCH A;  3EO3 A;  3CJ9 A;  4CEQ A;  4DSK A;  3AO5 A;  4HWI A;  1XQS C;  3VF2 A;  4PUO A;  4M7Y A;  4DWI A;  3E01 A;  3THV A;  2BGG A;  1IBL K;  1C0T A;  1T03 A;  2E4L A;  1KVB A;  3U6F A;  3MEG A;  1VQO N;  1DGK N;  4BVO A;  3T1H K;  4BY9 C;  1M1K O;  3VTH A;  4CJP A;  3EY1 A;  3SNN A;  4LC9 B;  3UKU A;  1RCH A;  3HBT A;  4BC5 A;  4PHT X;  5FRO A;  4JKG A;  1IO2 A;  3RR8 A;  4PKI A;  4M41 A;  5AQP A;  3MX5 A;  4NLB A;  3THX B;  1D9D A;  3MN5 A;  1NKE A;  4CI6 A;  3D2E A;  3DM2 A;  4H0P A;  1C6V A;  2Q3S A;  5FDL A;  4IG0 A;  3KK2 A;  3M8P A;  4FO0 A;  2V7Z A;  1B9F A;  1CZA N;  3AO3 A;  3CM6 A;  5AQT A;  4BDY A;  4BRD A;  3TU5 A;  3WXL A;  4JK8 A;  4TSX A;  3ZSR A;  1SKW A;  2BTF A;  4H4M A;  4BRE A;  1W0H A;  1VQ7 N;  2CGJ A;  3WNH A;  2HMI A;  3HI0 A;  4BE2 A;  3O08 A;  3SMS A;  5JS2 A;  3LDO A;  3EKU A;  1HNW K;  3H1Q A;  3QIO A;  4ILG B;  1JLA A;  4DLG A;  4CZM A;  5KI6 A;  2ASP A;  5AQK A;  2O8F B;  3C0B A;  4O4G A;  4UY8 O;  1XMQ K;  4DV3 K;  4BC3 A;  4B1U B;  4KI6 A;  3HYF A;  4BRC A;  4JS4 A;  4Z4F A;  3EKS A;  4B9M A;  2FBX A;  4GKJ K;  4E7J A;  5DMR A;  3A5L C;  3OYL A;  3QES A;  4HUF A;  3U8X A;  2YNF A;  4DR5 K;  1C1B A;  2OA8 A;  4W5N A;  1JXB A;  4GW6 A;  3ISN C;  3V1Q A;  3SK3 A;  3HZ6 A;  4KHP K;  1B9D A;  5JS1 A;  1SUQ A;  4JI1 K;  2YJE A;  4DTM A;  4CJQ A;  2I7N A;  2NRW A;  2XY6 A;  4PY5 A;  2P9I A;  3DMJ A;  5GIN A;  3TAE A;  2NLX A;  1IG9 A;  1ATS A;  1J5E K;  1ATR A;  3CIP A;  3GDQ A;  3OYC A;  2HHS A;  1DT9 A;  4XIU A;  3CD6 N;  3EN9 A;  4DUY K;  4JKB A;  3KJV A;  4FLZ A;  4F8R A;  1HNV A;  3ZEU B;  4AIL C;  1TL3 A;  3CCM N;  1VSM A;  1Y64 A;  4DR3 K;  1YJW N;  3WNE A;  5BPL A;  3KHY A;  3A8Y A;  1TVR A;  4LF6 K;  3NVK A;  4ZTF A;  4K25 A;  1S1T A;  2OTL N;  4NCB A;  3RMB A;  2O4G A;  3DLK A;  4HUG A;  4WFB L;  3LDP A;  1RBT A;  4XH5 A;  4CEZ A;  1EWQ A;  3L3U A;  3S3O A;  3L8B A;  1NK4 A;  5E26 A;  4DV6 K;  1HJO A;  3CQX A;  2NNW A;  4DFK A;  1NK8 A;  2WTU A;  5HRS A;  4DQS A;  3L4I A;  4LSL A;  5HL7 L;  3FZF A;  4BRK A;  4CD3 A;  3IUC A;  4FXD A;  4HUE A;  4E7H A;  2A40 A;  3QB0 A;  3SZ2 A;  3FFK B;  5BN9 A;  1BA1 A;  3PIO L;  4CEF A;  1X9J A;  3QFP A;  3JXU A;  3AVN A;  4O0I A;  1DEJ A;  3PSI A;  1OVQ A;  1X9S A;  2I7P A;  3KD1 E;  3EYZ A;  4CJE A;  1HKG A;  4KPY A;  4YFU A;  3EZW A;  3E9L A;  4LFB K;  3E9P A;  1YHQ N;  4B3S K;  4LF7 K;  2NRH A;  3ULE B;  1KVC A;  2V51 B;  4JI7 K;  5I9E B;  1BIS A;  3CME N;  3VQ9 A;  4Z94 A;  1TAU A;  2QM1 A;  4E1J A;  3ITH A;  4CZH A;  1NGJ A;  3VQ7 A;  5GAD P;  4DTX A;  2BH1 A;  2VGM A;  5AQJ A;  4CJR A;  3QIC A;  4CJT A;  3KTQ A;  3NVM A;  4M7X A;  4BR9 A;  1U2V A;  3LPU A;  5AQM A;  2ZE2 A;  4DV1 K;  1KQS M;  1QHA A;  4B1W B;  4DLE A;  4FW1 A;  4H0T B;  3C6T A;  3GOI A;  1S9E A;  4PL8 A;  1NU0 A;  3EE9 A;  2NRZ A;  4LF4 K;  3QEW A;  3KLF A;  2OZS A;  2D1K A;  1BI4 B;  3CYM A;  1YVN A;  4CHN A;  1BU6 O;  2KW4 A;  1NKC A;  4DTJ A;  4IZ9 A;  3CC4 N;  4KHW A;  1VQP N;  3VGL A;  4W5O A;  1S1V A;  2BAN A;  4DS4 A;  4DCH A;  4N76 A;  3H6E A;  3M6G A;  4F2S A;  4OO1 J;  4BWM A;  4ISG A;  3P31 A;  3PSF A;  1RT5 A;  4A61 A;  2B4J A;  2E2N A;  2QWN A;  1RDW X;  4AHT A;  1VQL N;  3TTF A;  2W40 A;  1Z26 A;  4B3M K;  2GBZ A;  4OJR A;  2HOE A;  3F9K A;  3G4S N;  5C12 A;  3HP9 A;  4BRH A;  1U45 A;  4WQ5 C;  3MXJ A;  2GWK A;  2IS3 A;  1W2B M;  4W5R A;  1NM1 A;  3M1F A;  3ENH A;  1ZBH A;  4UQG A;  4J2D A;  3W3D A;  4CF9 A;  2O4I A;  2H3G X;  4CJF A;  2OPR A;  5FRN A;  3ZSW A;  3QBX A;  2F8S A;  3RRG A;  4DQR A;  1GOC A;  2V52 B;  4DTS A;  3QNO A;  1NJZ A;  1TYQ B;  2Q36 A;  1IKY A;  3OYK A;  4ID5 A;  5KPT A;  3WNG A;  5KRT A;  1GLA G;  1CXU A;  2XY5 A;  4DSE A;  5AZJ A;  4KHU A;  1X9W A;  5ELZ A;  4FWQ A;  4FZX C;  3FZK A;  4O8U A;  5HOO A;  1K9M O;  4FLV A;  4BG8 A;  3THY B;  3VN5 A;  2LSN A;  5AQU A;  4BE0 A;  1NOY A;  4FJ9 A;  3L2W A;  1U6Z A;  3SQ1 A;  5JMV A;  1LCU A;  2ZJR L;  3WXK A;  1J5O A;  4O5F A;  1IJJ A;  3IS9 A;  4X64 K;  3C7N A;  2A3Z A;  4K42 A;  3TI0 A;  3HVT A;  1GLL O;  4YOR A;  3NCI A;  3AGR A;  1U4B A;  4KAZ A;  1EET A;  4Y0W A;  2UUC K;  2HB5 A;  3QNN A;  1BCM A;  4H5R A;  4Z4E A;  4DUZ K;  1EQY A;  3V6D A;  4F3O A;  4Z0U A;  2P9K A;  3E1Y A;  3OA9 A;  4MLH A;  3QFU A;  3WUH A;  3RWU A;  1YTU A;  1GLJ O;  2HHV A;  1YIJ N;  5BR8 K;  2P9L B;  1RDA A;  3ATU A;  4AM6 A;  3LAM A;  4BR7 A;  1VQ9 N;  3SQ0 A;  2EHG A;  2P1J A;  1VSJ A;  1TUY A;  4BE1 A;  1NK7 A;  4K8X A;  2VGN A;  2A1S A;  4DSI A;  1IKW A;  2YHW A;  4FJN A;  1GLD G;  3AO1 A;  2HBM A;  4WFA L;  1B92 A;  3OY9 A;  1OH6 A;  4IFY A;  5AFU H;  3DXK B;  1K8A O;  3NF9 A;  3O5B A;  4I2P A;  4CEE A;  3NE6 A;  1NGE A;  4CZL A;  4A57 A;  3IG1 A;  4BQZ A;  4JKA A;  3VQE A;  4I7F A;  2E1Z A;  4FK2 A;  4FWL A;  4JS5 A;  3SCX A;  3I8D A;  4RW6 A;  4J2E A;  3H08 A;  4EP4 A;  1JCE A;  4CZE A;  1T05 A;  4A2B A;  3LWL A;  2NUB A;  5LL6 Z;  2F7T A;  3E9O A;  3EE8 A;  3ASM A;  3ZT2 A;  2P9N A;  1LWF A;  3C94 A;  3VQB A;  3V9X A;  3KK1 A;  2AA4 A;  3O3G A;  3PV8 A;  1C1A A;  1NJW A;  3J7A P;  4N56 A;  4IOX A;  1LOT B;  3AA3 A;  4XH1 A;  2ETJ A;  1S5J A;  3CMA N;  2AJQ A;  4FJM A;  4L3Q A;  3SI6 A;  4E7I A;  2A41 A;  2GTD A;  5ADX H;  3LDL A;  3O9T A;  2FLO A;  4EHT A;  4AHV A;  3AVJ A;  1KD1 O;  4MO4 A;  3VEV A;  2YHY A;  5B8H A;  4OGC A;  5KRS A;  5FLX O;  1NJI O;  1G99 A;  4H0Y B;  3AO4 A;  2Q31 A;  3SYZ A;  1FKP A;  5C15 A;  3OYI A;  1N34 K;  2VQE K;  1VSI A;  4C1N K;  1L3V A;  2PYJ A;  4FK4 A;  3ZX3 A;  1L3U A;  2E8A A;  4KB1 A;  4MO5 A;  2E5L K;  4RWT A;  4CFD A;  3SAG A;  4AQY K;  3WXI A;  3THX A;  3T69 A;  3CC7 N;  4FLW A;  2GUI A;  4CHP A;  3ZCM A;  4N41 A;  4X62 K;  4Q5V A;  4RCH A;  2NRT A;  3DWL A;  2HHW A;  1X9M A;  3ENO A;  2F9T A;  1RBS A;  1JLB A;  1S1W A;  4J2B A;  3OYM A;  2IGI A;  1JL2 A;  5HRP A;  4FWK A;  3I0R A;  4AHS A;  3T7Z A;  5EVZ A;  1HR0 K;  4BRI A;  4M3Y A;  1WSI A;  1NNE A;  4YDU A;  2QTD A;  4JI3 K;  3T1Y K;  3VEW A;  2O8F A;  3LP1 A;  5FPN A;  2E6M A;  5F0X A;  4DSL A;  2QWQ A;  4KKO A;  4JRQ A;  5BN8 A;  1C0M A;  4FK0 A;  4Y1D A;  1REV A;  3ID6 A;  1RTJ A;  3LDS A;  1S6P A;  3J80 O;  3TSU A;  3VEN A;  1YAG A;  2UXB K;  5AFU A;  3ZET B;  3SQ4 A;  3GBT A;  3LP3 A;  3WEE B;  3RVC A;  1NK5 A;  5AQY A;  2GX9 A;  5C25 A;  4CHY A;  2D0P A;  4FL9 A;  4Z4H A;  2E1Y A;  2WOM A;  3NHG A;  3RMD A;  4M3X A;  3WXJ A;  3UE5 A;  5C10 A;  4B8C A;  3U3G A;  4QS7 A;  3ZSX A;  1ZXO A;  5HLF A;  4FJ7 A;  3CHW A;  4WQ4 A;  4A2A A;  4CEB A;  4KRE A;  4CZK A;  2VQF K;  3V9W A;  4KH4 A;  3V9U A;  5TKY A;  4BRO A;  2GEL A;  5AQV A;  5GAG P;  4QOZ B;  1Q82 O;  3LL3 A;  2E20 A;  1T3V A;  3SUO A;  4C8K A;  4JK9 A;  2HBK A;  5AQS A;  4CEO A;  2Z1G A;  3IKM A;  1CZB A;  2QXL A;  1DTQ A;  4LFA K;  1JLE A;  5ADX A;  4CCH A;  4Q0B A;  3KD5 E;  1CZ9 A;  4CBU A;  1J6Z A;  4CJ4 A;  2G8U A;  3P83 D;  1MDU B;  4F9O A;  1X3N A;  3D0P A;  2YHA A;  4FPB A;  3AV9 A;  1IBK K;  1K6Y A;  5KGX A;  2Q0R A;  3J7Y P;  1TK5 A;  5CHI A;  4DQ8 A;  1WBD A;  1IKV A;  4ICL A;  4BC4 A;  1YT3 A;  1NGD A;  3GE1 A;  1SL0 A;  2KHO A;  3C6H A;  1T7P A;  3KIO A;  1X3M A;  2F4V K;  2UYT A;  4JD2 B;  2D0A A;  3M8R A;  3NH1 A;  4LF5 K;  3GG4 A;  2WFB A;  2YHX A;  1BDG A;  4CBW A;  3K0S A;  1KSP A;  1XMO K;  3CCE N;  1QE1 A;  1N33 K;  1WSF A;  3ENB A;  4K0K K;  1Z05 A;  5AR0 A;  4BVP A;  5K14 A;  2QXF A;  1U49 A;  4FJL A;  4FJI A;  3T3F A;  1KRP A;  3ULE A;  3HP6 A;  3TSP A;  3DXM B;  3NFA A;  3HL8 A;  3CCU N;  3RMA A;  2B5J A;  4C23 A;  3SUQ A;  2DPN A;  3HM9 A;  3WQT A;  1HYS A;  2O8B B;  2OAN A;  1EP4 A;  4M3U A;  2ZGY A;  2CGK A;  2KFZ A;  2D0B A;  3CPE A;  4DFM A;  2D5R A;  3R3L A;  2ITM A;  3VA3 A;  1EXQ A;  3PUF A;  4ZHR A;  4PA1 A;  4CHO A;  1HMV A;  5SZT A;  3O4Q A;  2FBY A;  1ASU A;  5C42 A;  2UXD K;  3MAQ A;  2PFU A;  4B9N A;  2KLA A;  2ZD1 A;  4DSF A;  2XY7 A;  1BI4 A;  1IG8 A;  5CZ2 A;  1FXX A;  2PBD A;  4JHD B;  3CJC A;  3LP0 A;  1JL1 A;  2RE2 A;  1NKB A;  5AQH A;  4B9V A;  1VSH A;  3OYN A;  1F21 A;  3U9D A;  3SPY A;  1U47 A;  2HNZ A;  4DV0 K;  3LM2 A;  5GAE P;  4CJ3 A;  4ILH A;  5LJW A;  1NK9 A;  4JN4 A;  3D7E O;  3O6W A;  4GMJ B;  4LH4 A;  4BR5 A;  2X78 A;  3CER A;  4FLX A;  4IFV A;  3DLH A;  1VQ6 N;  4BRQ A;  3U9Z A;  4KHY A;  5M1Q A;  4NYN A;  5M1O A;  2VG6 A;  1NG9 A;  1BOT O;  4FWM A;  3CCJ N;  1NJY A;  1N8R O;  3QBW A;  1J53 A;  5BPN A;  1UOC A;  4DTR A;  1BWF O;  3UKR B;  3RR7 A;  4ISE A;  3H3O B;  2HND A;  3FZM A;  3J8A A;  3Q7C A;  2P9S B;  2V7Y A;  4IDH A;  4GY2 B;  1ILY A;  1LAW A;  2QWP A;  3U3Y A;  4DU1 A;  1QQN A;  3OYA A;  1TYQ A;  4B1Y B;  2ZQB A;  3H46 O;  1A5W A;  3T19 A;  4V19 S;  4H8K A;  1RTI A;  4E1N A;  1FK9 A;  3VEO A;  1LV5 A;  2YNI A;  4FJ8 A;  3CG7 A;  3EEQ A;  2RKI A;  4DR6 K;  3FZH A;  4PQU A;  1SQK A;  4DMN A;  1K8K B;  3AVC A;  5AQG A;  4F2R A;  1ZBS A;  3VEZ A;  1IV0 A;  3HPH A;  3E66 A;  2BDP A;  1C0U A;  2YX6 A;  3VF6 A;  1S22 A;  4CHQ A;  3PX0 A;  4KRF A;  4KHN A;  1CLQ A;  1P8Z A;  4B9U A;  4ELV A;  1KFD A;  4GVM A;  1C0G A;  4OLB A;  4RTF D;  3BEX A;  5I42 A;  1T6C A;  4EAH D;  4DV7 K;  1C1C A;  3BDP A;  3OYJ A;  1UA0 A;  1OKJ A;  2HF3 A;  1KXP A;  3O3F A;  4OPA A;  1ESV A;  3SMP A;  2P9L A;  1BUP A;  2HHT A;  4CER A;  3ZT3 A;  1QZ6 A;  3RTV A;  1ITG A;  2DFF A;  1RDB A;  1MWM A;  4HCB A;  3L0Q A;  1QQC A;  1XC9 A;  3QET A;  1G15 A;  5M1P A;  1L3T A;  4KHQ A;  3F9M A;  4JI4 K;  4LH5 A;  3N4Q A;  3P4I A;  3DXK A;  4FPA A;  3O9S A;  3K9J A;  1QQM A;  3AVF A;  2WC9 A;  1RDD A;  5AQO A;  3P1G A;  1XI1 A;  3AVK A;  3OS0 A;  2P5G A;  1BA0 A;  3THW B;  1VQ4 N;  3DRR A;  4CVN E;  1ZBU A;  4CF2 A;  3OW2 M;  3DAW A;  4CFC A;  4I6M B;  1SL2 A;  3AVL A;  4Z4I A;  1X1P A;  1YF5 L;  3CJ1 A;  4Z4G A;  3SAF A;  1BGX T;  4RW4 A;  1TKT A;  4E1M A;  1VQ5 N;  4CF8 A;  2VCP A;  3O80 A;  4KTZ A;  5GAH P;  4OPJ A;  1DKG D;  2UU9 K;  3LDN A;  3D2F A;  4J2A A;  3I33 A;  4AF1 A;  1HJR A;  4BDP A;  2GWJ A;  1NJX A;  4H5T A;  3KK3 A;  3TAP A;  1GLE G;  3MN7 A;  1KFS A;  2Q1N A;  3K9K A;  4KO0 A;  3HM8 A;  5AQI A;  3ZSO A;  4CZI A;  4M42 A;  4HTL A;  4ELT A;  3V4I A;  1WN7 A;  1OH5 A;  3VER A;  2G8K A;  4CEA A;  1VQM N;  3FR0 A;  4DF4 A;  2RN2 A;  3CCS N;  4XH4 A;  5CZ1 A;  2XHB A;  1XHX A;  2DFH A;  4B9Q A;  4K43 A;  2EWS A;  4BR4 A;  3ZX0 A;  5C24 A;  2QKB A;  1Y97 A;  3O9Q A;  1A5V A;  3JS6 A;  4GKK K;  3TAB A;  2FSJ A;  3CI5 A;  4B3R K;  1MU2 A;  4IFE A;  1Q9X A;  2QI2 A;  2Z1I A;  4DQQ A;  4CE9 A;  2QWO A;  3DLR A;  3B6O A;  4IOA L;  5HRR A;  2IVO A;  2X6N A;  1RFQ A;  3OYB A;  1Q18 A;  1NGC A;  1HX1 A;  4NCG A;  1YVU A;  3ZSQ A;  1S3X A;  3CJA A;  1L3S A;  4Y1C A;  3T1A A;  4YHH K;  1K73 O;  1Q81 O;  2RF2 A;  2FBT A;  2P9I B;  2B6A A;  3I55 N;  1HYZ A;  1WSH A;  4DTU A;  4X65 K;  4CFB A;  1YTA A;  1BQM A;  3WNF A;  4FWP A;  4BGA A;  1QSY A;  4DTP A;  2ZJQ L;  4JLH A;  3H3N O;  1RDC A;  5DM6 L;  3CF5 L;  1YJN N;  2VWK A;  3AVH A;  3LPT A;  5JIC A;  1GLB G;  2CH6 A;  5EOY A;  3CQ8 A;  1NK6 A;  4GNI A;  3CCV N;  4M3W A;  3TAN A;  1ATN A;  1VSD A;  2FBV A;  2VWJ A;  3OYF A;  3V9Z A;  5KQ8 A;  3BZK A;  1R0A A;  3L2R A;  3CXC M;  1O13 A;  3WEE A;  1LW0 A;  4FJG A;  1TGO A;  1SKR A;  5KQD A;  4FJJ A;  4FW2 A;  4H5V A;  3EZ5 A;  4YOU A;  3TWH A;  4IEI A;  3NF7 A;  4KTQ A;  4IXC A;  3VOV A;  3SAH A;  3CC2 N;  4C8L A;  1TK0 A;  5CR4 A;  2QWR A;  4BR0 A;  4FLU A;  2P51 A;  3RMC A;  1RGI A;  1WBB A;  4OKJ A;  4NB4 A;  1NBW A;  4BRL A;  2HST A;  3BUZ B;  3MCA B;  4DF8 A;  4OVL A;  3OVN A;  2P9U B;  3SUP A;  1TK8 A;  4G9Z A;  5F1X A;  3QEX A;  1W97 L;  4JNE A;  1D5A A;  2Z1H A;  3LDQ A;  3LZI A;  4O8K A;  4ISF A;  3QLH A;  5BRF A;  2W41 A;  4DR1 K;  2DTU A;  1WSG A;  4FWS A;  2BE2 A;  2ASM A;  3SLC A;  5J2N A;  2G8V A;  2KFN A;  1KC8 O;  3C65 A;  3MDQ A;  1BL3 A;  1A5X A;  1BIZ A;  2HNY A;  2QKK A;  4X66 K;  3CQY A;  3ZSZ A;  2IAJ A;  3OBW A;  4WYB A;  3O1W A;  4A5A A;  4WQ5 A;  5JLF A;  3SPZ A;  3NAE A;  2OPQ A;  5LMN K;  3NGZ A;  3HJF A;  4FWR A;  4O44 A;  4IO9 L;  2E6L A;  4ELU A;  2UUA K;  4BWJ A;  4LF8 K;  1NGB A;  3CFP A;  1H1V A;  4FSV A;  4CBX A;  4FJK A;  4NXN K;  2Z1J A;  2ZF5 O;  2D0C A;  4IOC L;  3ZYY X;  2O8D B;  3ZT0 A;  4KV8 A;  5FPM A;  1QZ5 A;  3VET A;  4A59 A;  4JV5 K;  3TTC A;  3CCR N;  4EHU A;  4FLY A;  4JKD A;  5BPM A;  4FVM A;  4YOT A;  4BRA A;  2NRX A;  4MQ3 A;  2O8B A;  3F2K A;  4R79 A;  3R9P A;  3CM5 A;  1VSF A;  4DB3 A;  1NOZ A;  3J81 O;  1NGF A;  2FSK A;  5D3G A;  3DLL L;  2D4W A;  1LWE A;  4M3T A;  1XNQ K;  1W7A A;  3IRX A;  5HRN A;  3SBG A;  3VQ4 A;  1R59 O;  4CGH A;  4CGF A;  1RTH A;  1I39 A;  1YUW A;  3UB5 A;  2KKZ A;  5AJ3 K;  4BC2 A;  3OTO K;  3DOK A;  4QS8 A;  5HBM A;  3OYE A;  4DU3 A;  4JHD A;  3DOL A;  4JI2 K;  3QIP A;  1NLV A;  4A62 A;  4CGJ A;  1ZBL A;  2IOC A;  1E4F T;  2G8W A;  3OYG A;  2VYP A;  2Y1J A;  2XY8 A;  4IBN A;  4NXM K;  4FVU A;  1NWK A;  1UAX A;  2YKN A;  2R7Y A;  1IH7 A;  3EL2 A;  1YI2 N;  1QVF M;  2OZM A;  1TAQ A;  4AHC A;  1VHX A;  3KLG A;  4B08 A;  3HSC A;  3DRP A;  3V1O A;  3VA0 A;  2J4R A;  4W5Q A;  4H0V B;  3AGK A;  2XO7 A;  4K8Z A;  3NH2 A;  4WF9 L;  3HRG A;  3WQU A;  2YKM A;  4IDK A;  1QSS A;  1V4T A;  3C7N B;  1WB9 A;  5KGW A;  1WSE A;  5CYM A;  3R8E A;  4FZY A;  2VG7 A;  5IT9 O;  3TR8 A;  1N32 K;  2ATQ A;  4IJN A;  2P9S A;  4KB0 A;  2FXU A;  4YY3 K;  4DV5 K;  4CFA A;  4PWD A;  4CGI A;  1SL1 A;  1D9F A;  2I5J A;  4FOE A;  3IMX A;  1VQ8 N;  3O3H A;  1KAY A;  5TKW A;  4FWO A;  2P9P B;  4CZJ A;  1HLU A;  3OYD A;  3TSQ A;  3LP2 A;  3AVG A;  1ASW A;  1VQK N;  3ZEU A;  3AVB A;  4CIE A;  1S6Q A;  3DYA A;  1K8K A;  3L2U A;  2E88 A;  3FE1 A;  3ID8 A;  3AVM A;  1S9G A;  2QWM A;  2YHB A;  1NMD A;  2HVI A;  5DM7 L;  2HBJ A;  1Z25 A;  3SJJ A;  2O8C B;  4RW7 A;  3K59 A;  3S9H A;  4KI4 A;  1VSK A;  4IWV A;  1HKC A;  3ATV A;  4IJA A;  4LD0 A;  4QS9 A;  3KZB A;  2HVH A;  3KK7 A;  1S72 N;  4CJ5 A;  3DLE A;  5HRO A;  2WUS A;  2FC0 A;  3HOT A;  1QVG M;  4AHU A;  2F8T A;  4LF9 K;  4C8N A;  5GIO A;  1LW2 A;  1UWB A;  3A5N C;  4NYF A;  3HK2 A;  3NGY A;  4JKF A;  1QQO A;  1FW6 A;  4BRN A;  4LFC K;  1KLM A;  3MXI A;  4H5N A;  1GOB A;  3FFI A;  2HW3 A;  1WNS A;  4GVE A;  3TAF A;  5EU7 A;  5LMU K;  3VQ6 A;  4YNQ A;  1HQU A;  3RSE B;  4JYA K;  2GV9 A;  4EP5 A;  4CK3 A;  4HCC A;  3L2Q A;  1Q86 O;  1GLC G;  1RBR A;  3ZSV A;  3WXM B;  3VQD A;  2IDO A;  4R5P A;  4DTN A;  1M90 O;  1RTD A;  3DLB A;  5AQL A;  1EWR A;  4H03 B;  4M45 A;  3THW A;  4YOX A;  1FJG K;  2RPI A;  3O1B A;  4CED A;  5DK5 A;  4BG9 A;  3LAK A;  3MMV A;  1VSL A;  4BQL A;  4DFP A;  1TV6 A;  4B9S A;  4JK7 A;  1NK0 A;  4B1X B;  2G8I A;  4I6M A;  3C95 A;  1NMN A;  3A5M C;  4C8O A;  1NGA A;  3VEY A;  4CZG A;  1J9A A;  2ITG A;  2O8E B;  4FZZ A;  3SBT A;  3GL1 A;  4RW9 A;  1L5U A;  3Q7B A;  3A5O C;  4DR2 K;  2ZWH A;  3VQP A;  4HTU A;  4EFH A;  3VEX A;  3VGK A;  3DJC A;  4FJX A;  3KVG A;  4EIA A;  2VG5 A;  2JLE A;  3LWM A;  4DHY A;  4BRF A;  1WUA A;  3L6Q A;  2YNH A;  3W0L A;  3OS2 A;  5AZI B;  3KLE A;  2CH5 A;  5IWA K;  3M8S A;  3AAP A;  4CZF A;  3AVI A;  4I2Q A;  3IDH A;  1JJ2 M;  1RNH A;  5EY4 A;  2IVN A;  4E7L A;  2Q97 A;  3AO2 A;  4KH5 A;  3QEI A;  3S41 A;  1VAZ A;  3FGU A;  5KPZ A;  1WOQ A;  5J1E A;  4W5T A;  5M1F A;  3BY5 A;  2IC3 A;  3TAM A;  3BF3 A;  1SZ2 A;  2A1R A;  3FLC O;  1RBV A;  2OPS A;  1YIT N;  3K5N A;  4AHR A;  4BRP A;  4DFJ A;  3G6E N;  1XC3 A;  2A6A A;  2W6L A;  3KKR A;  5EXW A;  5C2F A;  2HHU A;  2NRV A;  3ZLJ A;  1RT3 A;  1S1X A;  5BR9 A;  3VQ5 A;  3S3M A;  3WT0 A;  3NH0 A;  3VPZ A;  4NLC A;  4M3Z A;  3CFO A;  4ILJ A;  4JEP A;  1KAX A;  4RW8 A;  3THY A;  1EO1 A;  3B6P A;  1SS6 A;  1ZBI A;  1SV5 A;  1NGH A;  3OYH A;  2PY5 A;  1JCG A;  4O0J A;  4F3T A;  2ZGZ A;  3I0S A;  2DFE A;  2JWK A;  5C2D A;  1RBU A;  5CE3 A;  1U04 A;  1D4X A;  1ZBF A;  3V9S A;  3C6A A;  3PLA A;  3BZC A;  3QO9 A;  1KCF A;  3N4P A;  3IAY A;  3HPG A;  1RT1 A;  1BQN A;  3OJU A;  4FOI A;  3CCQ N;  4AM7 A;  4QCL A;  3ZT4 A;  3QML A;  3PO5 A;  1MA9 B;  3TAQ A;  3R6M A;  3VF4 A;  4DV2 K;  1VQN N;  3SUN A;  5HP1 A;  1ASV A;  3H1V X;  4CD1 A;  4DR7 K;  4C1N I;  2ZM6 K;  1QSL A;  1YXQ A;  1RIL A;  5AQQ A;  2RHK A;  3MK6 A;  4CIF A;  1HPM A;  1I94 K;  3VQQ A;  4E0D A;  4A5B A;  3HXM A;  3O4W A;  4B1Z A;  1T6D A;  4WCE L;  3TTD A;  2HHH K;  2QK9 A;  3DI6 A;  4DV4 K;  3D45 A;  4CF0 A;  3MED A;  4B3O A;  2P9U A;  4C8M A;  2KZM A;  3I56 N;  3HO1 A;  3BGR A;  1Z6R A;  4JI8 K;  4BGB A;  3JAM O;  5FPE A;  1IKX A;  4K41 A;  3MN6 A;  4CJK A;  2FF6 A;  2ZJP L;  5MLC Q;  4MFB A;  4FWN A;  3QEV A;  3UKU B;  3M5R A;  3KWI A;  1XNR K;  2OTJ N;  4JKG B;  3OHR A;  3OJS A;  3P5J A;  1N36 K;  4OX9 K;  4FJH A;  4CHZ A;  2HMP A;  3MEC A;  3RRH A;  3D2E B;  5CY4 A;  4GV6 A;  3PIP L;  1BCO A;  4OGE A;  4E89 A;  4B8A B;  5KTQ A;  4G1Q A;  5EX5 A;  4CK1 A;  4H0O A;  3LM9 A;  2YI1 A;  4MDA A;  3VMF B;  1LWC A;  3M8Q A;  5SWM A;  4NO7 A;  3SQ2 A;  4KH6 A;  3ULD A;  5BRD A;  4E3S A;  4LY7 A;  5BRH A;  3KLI A;  1OVY A;  4M63 C;  4CIG A;  4O55 A;  5E41 A;  2E2O A;  1U48 A;  4GV3 A;  4ZTJ A;  2O8D A;  1JKH A;  3MWT A;  4YOW A;  2D0O A;  2E2P A;  5T7B A;  1T8E A;  5AQZ A;  3MWP A;  3CJ7 A;  4CF1 A;  4DQP A;  5C0Y A;  4F4K A;  3UIQ A;  4FLT A;  1HNZ K;  3K5L A;  3HPO A;  1GOA A;  3HST B;  4RG8 A;  1WSJ A;  3VQ8 A;  4H0X B;  3VQA A;  4MDB A;  3AY9 A;  1QS4 A;  3CCL N;  4FCY A;  2W42 A;  4I9Q A;  5E84 A;  4CJL A;  2X6S A;  4HVJ A;  2DY4 A;  3OS1 A;  5JVH L;  3O8M A;  1HYV A;  2OCE A;  3A2F A;  3NF6 A;  4N5S A;  1KLN A;  4U7B A;  3KKS A;  3AVA A;  3KWG A;  1NGI A;  3V1R A;  3QIN A;  1ZC6 A;  4WE1 A;  3NMU A;  4KBO A;  5J2M A;  3LAN A;  4B9T A;  2KTQ A;  3O9U A;  4BRM A;  2IVP A;  2AP1 A;  3PY8 A;  1EX4 A;  4FM2 A;  4B9L A;  5A2Q O;  1KAZ A;  2KZZ A;  4YOV A;  4DG1 A;  3HTV A;  2WBN A;  3F73 A;  3QDK A;  1QTM A;  1TL1 A;  4AH9 A;  2QW9 A;  3HVR A;  1C0F A;  1XWL A;  3ZET A;  3VES A;  3CFR A;  2HHQ A;  4KTW A;  4CJS A;  4CK2 A;  2YV0 X;  3G25 A;  4HHT A;  2NZT A;  5F2R A;  4M3R A;  4XEI A;  4JKE A;  2YNG A;  1Q9Y A;  4CGG A;  2E2Q A;  1Q8I A;  3G0Z A;  1HUX A;  1GLF O;  3AA5 X;  2UXC K;  3MN9 A;  3P38 A;  4FYD A;  2HBL A;  1BG3 A;  4YDU C;  3SV4 A;  1NGG A;  1BO5 O;  2FF3 B;  1CXQ A;  1KVA A;  4DSJ A;  3DLG A;  5I3U A;  4LSN A;  1JCF A;  3K5M A;  2P9P A;  1UA1 A;  4CGD A;  5M1N A;  3AA4 A;  3LZJ A;  2JGU A;  5AQX A;  3L2V A;  3C6U A;  4NCA A;  2PZS A;  1FKO A;  4IKF A;  3TAR A;  3LAL A;  3TPQ A;  5JVG L;  4JKC A;  3K58 A;  3HOS A;  1TKX A;  2F96 A;  3L3V A;  4ID1 A;  4FM1 A;  2OPP A;  2O8C A;  4WQ4 C;  4DTO A;  4I9L A;  2UUB K;  2VWB A;  1U2V B;  4H5W A;  1EKE A;  4MLE A;  2BUP A;  4BDZ A;  1E4G T;  1O1W A; 
#chains in the Genus database with same CATH homology
 3D6R A;  4JD2 A;  4GY2 B;  1ILY A;  2A5X A;  2QWP A;  4CJ7 A;  1QQN A;  2HOE A;  2QWM A;  1NMD A;  1TYQ A;  3G4S N;  4B1Y B;  4BRH A;  5C12 A;  5DM7 L;  3H46 O;  2HBJ A;  4WQ5 C;  5KPR A;  2GWK A;  3IFR A;  3MCP A;  3VEO A;  4IWV A;  1HKC A;  1W2B M;  1NM1 A;  3D2F B;  3ENH A;  3I8B A;  3M1F A;  4OPH A;  3ATV A;  3VGM A;  3W3D A;  4IJA A;  2H3G X;  3KZB A;  4QS9 A;  3DXM A;  5AQW A;  3KK7 A;  5M1K A;  1S72 N;  3FZH A;  3RSE A;  1SQK A;  1K8K B;  5AQG A;  2WUS A;  4WFN L;  3HOT A;  1QVG M;  3QBX A;  1ZBS A;  3MX2 A;  3VEZ A;  5GIO A;  3A5N C;  3E66 A;  4JKF A;  1QQO A;  2V52 B;  2YX6 A;  3VF6 A;  4BRN A;  1TYQ B;  2Q36 A;  1S22 A;  2QEX N;  3U4L A;  3BP8 A;  5KPT A;  1GLA G;  4DKW A;  1P8Z A;  5AZJ A;  2GUP A;  4H5N A;  4JKH A;  5ELZ A;  4GVE A;  3OBY A;  4FWQ A;  3FZK A;  1C0G A;  4O8U A;  5HOO A;  4RTF D;  3BEX A;  1K9M O;  3J7Z O;  2NRR A;  1T6C A;  4PKH A;  4BG8 A;  4EAH D;  5AQU A;  1OKJ A;  1T44 A;  1U6Z A;  2HF3 A;  3RSE B;  1KXP A;  5JMV A;  3B8A X;  1ESV A;  1LCU A;  3AAR A;  4OPA A;  4PKG A;  2ZJR L;  3WXK A;  4O5F A;  3SMP A;  1IJJ A;  1Q86 O;  2P9L A;  1GLC G;  1BUP A;  3WXM B;  4GV9 A;  3C7N A;  2A3Z A;  4K42 A;  4B1V A;  1M90 O;  1QZ6 A;  2GEM A;  1GLL O;  4YOR A;  3AGR A;  5AQL A;  4IO8 A;  5GIP A;  4H03 B;  5AZJ B;  1MWM A;  2ASO A;  4Y0W A;  3ZX2 A;  4YOX A;  3L0Q A;  3O1B A;  4H5R A;  1EQY A;  4BG9 A;  3MMV A;  5AQN A;  4BQL A;  2P9K A;  5M1P A;  3E1Y A;  4JK7 A;  3OA9 A;  4B1X B;  4I6M A;  3O9R A;  3F9M A;  3A5M C;  2Q2R A;  4MLH A;  1NGA A;  3N4Q A;  3P4I A;  3DXK A;  3H45 C;  3O9S A;  3QFU A;  4FPA A;  3K9J A;  4JAX A;  5AQF A;  1QQM A;  1GLJ O;  3VEY A;  3WUH A;  2WC9 A;  1YIJ N;  2P9L B;  5AQO A;  5AZI A;  3A0I X;  3SBT A;  3GL1 A;  3ATU A;  4AM6 A;  1YJ9 N;  4BR7 A;  1VQ9 N;  3Q7B A;  3A5O C;  2ZWH A;  4EFH A;  1V4S A;  1BA0 A;  1TUY A;  4CZG A;  3UKR A;  3CJB A;  3VEX A;  3VGK A;  1VQ4 N;  3DJC A;  2BUP A;  1TUU A;  2PAV A;  2VGN A;  3KVG A;  4EIA A;  2YHW A;  2P9K B;  2JWL A;  1GLD G;  3F5T A;  4PL7 A;  1Q7Y O;  3OW2 M;  2HBM A;  3DAW A;  4WFA L;  4I6M B;  1YF5 L;  4IEE A;  4DHY A;  5AFU H;  4BRF A;  1WUA A;  3L6Q A;  3CJ1 A;  3DXK B;  3SJH A;  1K8A O;  3SAF A;  2Q0U A;  3O5B A;  3W0L A;  1NGE A;  4CZL A;  4A57 A;  5LY3 A;  1VQ5 N;  4YOY A;  2VCP A;  5AZI B;  1XUP O;  3O80 A;  2CH5 A;  3BF1 A;  4BQZ A;  3AAP A;  4CZF A;  5GAH P;  1DKG D;  4JKA A;  2E1Z A;  3IDH A;  3LDN A;  5EY4 A;  4FWL A;  2IVN A;  3D2F A;  2Q97 A;  4KH5 A;  1JJ2 M;  3I33 A;  4AF1 A;  3S41 A;  1VAZ A;  4BR2 A;  2GWJ A;  3FGU A;  4H5T A;  1WOQ A;  3R1X A;  5KPZ A;  1JCE A;  5M1F A;  3P39 A;  1GLE G;  3MN7 A;  4CZE A;  2Q1N A;  3K9K A;  5AQI A;  3BF3 A;  3HM8 A;  2IIR A;  4A2B A;  2YJF A;  4CZI A;  1SZ2 A;  2F7T A;  2HF4 A;  3FLC O;  4HTL A;  2F9W A;  3E9O A;  1YIT N;  3EE8 A;  1P90 A;  2P9N A;  4BRP A;  5JLH A;  3G6E N;  1XC3 A;  2A6A A;  2AA4 A;  5EXW A;  3VER A;  5C2F A;  2NRV A;  5BR9 A;  5BRE A;  1VQM N;  5LJV A;  3WT0 A;  4IOX A;  1LOT B;  3FR0 A;  4XH1 A;  3M3Z A;  3VPZ A;  3CMA N;  4NLC A;  1HKB A;  3CCS N;  4XH4 A;  4BRG A;  3CPW M;  1RDU A;  4L3Q A;  4B9Q A;  4ILJ A;  4K43 A;  4JEP A;  2EWS A;  4BR4 A;  1KAX A;  2A41 A;  3FZL A;  1MWK A;  2GTD A;  3ZX0 A;  3VTI A;  5ADX H;  3O9Q A;  4J8F A;  1EO1 A;  3L4Q A;  3JS6 A;  3LDL A;  2CGL A;  3O9T A;  2FSN A;  1SS6 A;  2FLO A;  2FSJ A;  4EHT A;  1KD1 O;  4MO4 A;  3CI5 A;  2YHY A;  3VEV A;  1NGH A;  5B8H A;  4IFE A;  1JCG A;  2QI2 A;  2ZGZ A;  2A42 A;  4U67 L;  2QWO A;  3AAQ A;  5H1S Q;  2JWK A;  2P9N B;  5FPD A;  1NJI O;  5C2D A;  1G99 A;  4IOA L;  4H0Y B;  2QA4 N;  2Q31 A;  1SAZ A;  1D4X A;  5CE3 A;  2IVO A;  1RFQ A;  3G71 N;  3C6A A;  5C15 A;  5AQR A;  3PLA A;  3CET A;  1Q18 A;  1NGC A;  1HX1 A;  3N4P A;  2QWL A;  1S3X A;  4C1N K;  3CJA A;  3ZX3 A;  2YCH A;  2E8A A;  4MO5 A;  4FOI A;  3EO3 A;  3CCQ N;  3CJ9 A;  4RWT A;  1K73 O;  4AM7 A;  1Q81 O;  3SAG A;  3QML A;  2P9I B;  3WXI A;  4HWI A;  3I55 N;  1XQS C;  3T69 A;  1MA9 B;  3CC7 N;  3VF2 A;  3R6M A;  3VF4 A;  1VQN N;  4FWP A;  4BGA A;  4M7Y A;  4RCH A;  2NRT A;  3DWL A;  3H1V X;  4CD1 A;  2ZJQ L;  3ENO A;  3H3N O;  4C1N I;  2F9T A;  5DM6 L;  1YXQ A;  3CF5 L;  1YJN N;  5AQQ A;  1VQO N;  5JIC A;  1DGK N;  1GLB G;  2CH6 A;  5EOY A;  2RHK A;  3MK6 A;  4BVO A;  4GNI A;  1HPM A;  3VTH A;  1M1K O;  3CCV N;  4BY9 C;  4FWK A;  4LC9 B;  4A5B A;  3UKU A;  3O4W A;  3HBT A;  3T7Z A;  4B1Z A;  4BC5 A;  1ATN A;  4PHT X;  1T6D A;  4WCE L;  5EVZ A;  3TTD A;  4JKG A;  5KQ8 A;  4PKI A;  3CXC M;  1O13 A;  3MX5 A;  4NLB A;  5AQP A;  3WEE A;  3MN5 A;  4BRI A;  4CI6 A;  3D2E A;  4H0P A;  2P9U A;  4YDU A;  5KQD A;  2QTD A;  4H5V A;  3I56 N;  4FO0 A;  4YOU A;  2V7Z A;  1CZA N;  1Z6R A;  3VEW A;  5AQT A;  4BRD A;  3TU5 A;  4IEI A;  3WXL A;  4BGB A;  5FPE A;  4JK8 A;  4K41 A;  3MN6 A;  4IXC A;  5FPN A;  3VOV A;  5F0X A;  3SAH A;  2QWQ A;  2FF6 A;  2ZJP L;  3CC2 N;  5BN8 A;  2BTF A;  4BRE A;  5MLC Q;  3ID6 A;  4FWN A;  1VQ7 N;  2CGJ A;  5CR4 A;  2QWR A;  3UKU B;  3M5R A;  3TSU A;  4BR0 A;  3KWI A;  3VEN A;  1YAG A;  3HI0 A;  3O08 A;  2OTJ N;  3SMS A;  4JKG B;  3OHR A;  5AFU A;  3ZET B;  3GBT A;  1RGI A;  3LDO A;  3EKU A;  3WEE B;  3RVC A;  2HMP A;  4NB4 A;  1K8K A;  1NBW A;  3H1Q A;  4ILG B;  4BRL A;  5AQY A;  2GX9 A;  2HST A;  3BUZ B;  3D2E B;  3MCA B;  2D0P A;  4FL9 A;  4CZM A;  2P9U B;  2E1Y A;  4GV6 A;  2ASP A;  3WXJ A;  3PIP L;  3UE5 A;  4G9Z A;  5AQK A;  5F1X A;  1W97 L;  3C0B A;  4UY8 O;  5C10 A;  4JNE A;  4QS7 A;  5EX5 A;  4BC3 A;  1ZXO A;  4H0O A;  3LDQ A;  4B1U B;  3LM9 A;  4O8K A;  2YI1 A;  3CHW A;  4ISF A;  4MDA A;  4WQ4 A;  3VMF B;  4A2A A;  4BRC A;  4NO7 A;  4CZK A;  5BRF A;  4KH6 A;  2W41 A;  5BRD A;  3EKS A;  4FWS A;  4KH4 A;  5BRH A;  2ASM A;  5TKY A;  1OVY A;  3SLC A;  4M63 C;  3A5L C;  4BRO A;  2GEL A;  5AQV A;  5GAG P;  1Q82 O;  3LL3 A;  2E20 A;  1T3V A;  2E2O A;  3U8X A;  1KC8 O;  4GV3 A;  3C65 A;  4JK9 A;  3MDQ A;  2HBK A;  3MWT A;  5AQS A;  4YOW A;  3CQY A;  2D0O A;  2E2P A;  3SK3 A;  3HZ6 A;  3IKM A;  4WYB A;  3OBW A;  2QXL A;  3O1W A;  5AQZ A;  4A5A A;  2YJE A;  4WQ5 A;  5JLF A;  3MWP A;  5ADX A;  3CJ7 A;  2I7N A;  2NRW A;  4FWR A;  4CBU A;  1J6Z A;  4IO9 L;  2P9I A;  5GIN A;  5C0Y A;  1MDU B;  2NLX A;  4F9O A;  1X3N A;  1NGB A;  1H1V A;  4FSV A;  4CBX A;  4FPB A;  1ATS A;  1ATR A;  3CIP A;  2ZF5 O;  3GDQ A;  1DT9 A;  4H0X B;  4IOC L;  3CD6 N;  2Q0R A;  3ZYY X;  4MDB A;  3AY9 A;  3EN9 A;  3CCL N;  5CHI A;  4JKB A;  4DQ8 A;  5FPM A;  1QZ5 A;  3VET A;  5E84 A;  4A59 A;  4BC4 A;  3TTC A;  3ZEU B;  3CCM N;  1NGD A;  1Y64 A;  5JVH L;  1YJW N;  3GE1 A;  3O8M A;  2KHO A;  3KHY A;  4EHU A;  3A8Y A;  3C6H A;  5BPL A;  3CCR N;  3NVK A;  4JKD A;  5BPM A;  4K25 A;  4U7B A;  1X3M A;  2UYT A;  4JD2 B;  2OTL N;  4YOT A;  4BRA A;  2NRX A;  3KWG A;  3F2K A;  3GG4 A;  1NGI A;  2WFB A;  3LDP A;  4R79 A;  4WFB L;  3R9P A;  2YHX A;  4XH5 A;  1ZC6 A;  3NMU A;  1BDG A;  4KBO A;  4DB3 A;  4CBW A;  1NGF A;  2FSK A;  3CCE N;  3O9U A;  5E26 A;  4BRM A;  3DLL L;  2D4W A;  2IVP A;  3ENB A;  1Z05 A;  2AP1 A;  5AR0 A;  1HJO A;  3CQX A;  2NNW A;  1KAZ A;  4BVP A;  4YOV A;  3HTV A;  3L4I A;  2WBN A;  3SBG A;  5HL7 L;  1R59 O;  3ULE A;  3QDK A;  3FZF A;  4BRK A;  4IDH A;  3IUC A;  3TSP A;  3DXM B;  1YUW A;  4CD3 A;  2A40 A;  3QB0 A;  3CCU N;  3UB5 A;  2KKZ A;  3FFK B;  5BN9 A;  2QW9 A;  1C0F A;  4BC2 A;  4C23 A;  4QS8 A;  1BA1 A;  3ZET A;  3PIO L;  2DPN A;  1X9J A;  3QFP A;  4JHD A;  3JXU A;  3VES A;  3WQT A;  1NLV A;  1DEJ A;  2OAN A;  2I7P A;  2ZGY A;  2CGK A;  4A62 A;  1E4F T;  3CPE A;  1HKG A;  3G25 A;  2NZT A;  3EZW A;  2VYP A;  3R3L A;  2ITM A;  4FVU A;  5F2R A;  3E9L A;  4XEI A;  1NWK A;  4JKE A;  2E2Q A;  1YI2 N;  3EL2 A;  1HUX A;  3E9P A;  1YHQ N;  1QVF M;  1GLF O;  3MN9 A;  3P38 A;  2NRH A;  3HSC A;  3ULE B;  2PFU A;  2KLA A;  2J4R A;  2HBL A;  4H0V B;  1BG3 A;  2V51 B;  3AGK A;  4YDU C;  5I9E B;  1IG8 A;  1NGG A;  1BO5 O;  2FF3 B;  4WF9 L;  3CME N;  2PBD A;  4Z94 A;  3HRG A;  4JHD B;  2QM1 A;  3CJC A;  4E1J A;  3WQU A;  4CZH A;  1NGJ A;  1V4T A;  5GAD P;  2RE2 A;  3C7N B;  1JCF A;  2BH1 A;  2VGM A;  2P9P A;  5AQH A;  3R8E A;  5AQJ A;  3QIC A;  3U9D A;  3NVM A;  4M7X A;  5M1N A;  4BR9 A;  1U2V A;  5AQM A;  1KQS M;  1QHA A;  4B1W B;  3LM2 A;  5GAE P;  4H0T B;  4ILH A;  5AQX A;  4IJN A;  2P9S A;  3GOI A;  2FXU A;  5LJW A;  4PL8 A;  4JN4 A;  3D7E O;  3EE9 A;  3O6W A;  2NRZ A;  4BR5 A;  3CER A;  2D1K A;  3TPQ A;  5JVG L;  1YVN A;  4JKC A;  1BU6 O;  3HOS A;  4FOE A;  1VQ6 N;  4IZ9 A;  4BRQ A;  3CC4 N;  3U9Z A;  1VQP N;  3VGL A;  3IMX A;  5M1Q A;  1VQ8 N;  5M1O A;  1BOT O;  1KAY A;  5TKW A;  4FWO A;  2P9P B;  4FWM A;  4WQ4 C;  4DCH A;  4CZJ A;  3H6E A;  3CCJ N;  3M6G A;  3QBW A;  1N8R O;  5BPN A;  1HLU A;  4OO1 J;  1BWF O;  2VWB A;  1U2V B;  4ISG A;  3P31 A;  3TSQ A;  3UKR B;  4ISE A;  3H3O B;  4H5W A;  1VQK N;  3ZEU A;  4A61 A;  3FZM A;  3J8A A;  2E2N A;  2QWN A;  3Q7C A;  1RDW X;  2P9S B;  4MLE A;  1VQL N;  3TTF A;  2V7Y A;  2W40 A;  1E4G T;  2E88 A;  3FE1 A;  3ID8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...