3L4QA

Structural insights into phosphoinositide 3-kinase activation by the influenza a virus ns1 protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
SVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/protein binding
molecule keywords Non-structural protein 1
publication title Structural insights into phosphoinositide 3-kinase activation by the influenza A virus NS1 protein
pubmed doi rcsb
source organism Influenza a virus
total genus 31
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3l4qA00
3KWGA 3KWIA 3EE9A 3P31A 3RVCA 3L4QA 3O9RA 2RHKA 3P38A 3O9QA 3F5TA 3OA9A 4OPAA 3O9UA 3M5RA 3O9SA 2KKZA 4OPHA 3O9TA 3EE8A 3P39A 3D6RA 2GX9A
chains in the Genus database with same CATH superfamily
3D45A 3A5OC 1XHXA 4ID5A 1NKEA 3O9RA 1JXEA 2X78A 3CETA 4B1WB 4IDKA 2WONA 2W42A 3I0SA 3AVFA 2GBZA 1XC3A 5F0XA 2X6NA 4KPYA 2BE2A 3CJ1A 2PY5A 3HM9A 2V7YA 1BG3A 4W5OA 4BRNA 3M8RA 3HOSA 4JRPA 4JS5A 3QEXA 4U67L 1BISA 2HNZA 5M1NA 3TANA 3KK7A 5EOYA 1UWBA 3CXCM 1U4BA 4JKFA 4CEOA 4RCHA 5A2QO 3RR7A 3P31A 3WXLA 4O8UA 3O4NA 3CMEN 3BF1A 4YOXA 1QSYA 1F21A 2HBJA 4MO5A 3JAMO 4FWOA 1M1KO 5AZJA 1VQ6N 4IXCA 2YV0X 5SZTA 2P9PA 3M8PA 2YJEA 4IOXA 5KRSA 5HP1A 2E6MA 4CF2A 3LP0A 5AQTA 1EO1A 2VWJA 1S1TA 2DPNA 3VA0A 4QAGA 3ZX2A 3WQTA 4DS5A 3AA4A 4PKHA 3WEEA 1ATNA 3K9KA 2D0OA 4EP5A 4YOWA 1FJGK 2QXLA 3S41A 3G10A 4DMNA 4FJ7A 2QWPA 2Z1HA 3VEVA 3O9QA 4H0TB 1H1VA 2O8CA 3BGRA 3MEEA 2HBLA 4DR2K 2OZMA 4IFVA 4Q5VA 4CE9A 2WTUA 2QM1A 4KHNA 3SJHA 5I42A 5DM7L 2HVHA 3OW2M 4M42A 3TU5A 3KWGA 1JXBA 4W5NA 3LAKA 4PKIA 3A5MC 4C8LA 1ZBHA 2VYPA 1JCFA 4NYNA 1JKHA 4FM2A 3LM2A 5KQ8A 2ZJQL 3G6EN 3DXKA 3L3UA 2IOCA 4DTSA 1C1CA 2WOMA 3I56N 1ILYA 4M3TA 4O0IA 2NRXA 5HRPA 1VQON 2KZMA 3TTDA 5EY4A 1IH7A 1TGOA 3AVBA 3E9OA 4IO8A 2QWQA 3CM6A 4CFBA 3QEPA 4N76A 2YKNA 4KBOA 5KGXA 2PZSA 2OPQA 3V4IA 3ISNC 4C8NA 1U2VA 3FFKB 4TSXA 4QOZB 4A61A 4GV3A 1ATRA 4JKHA 4H5TA 1RT5A 2IGIA 4DTJA 1VQ9N 2VGNA 1RBUA 2UUCK 3UKUA 3WNGA 2HHXA 1O1WA 4KB1A 4FWKA 3HL8A 3CMAN 5KPTA 2UUBK 4B1ZA 4I6MB 3QO9A 1NK7A 4K8ZA 3OYHA 3SUQA 5KRTA 3ZSZA 3CCEN 1GLLO 3WT0A 4C8OA 1CXUA 2IAJA 3CPEA 4WFNL 2NNWA 2WUSA 1L3UA 1IKXA 3WNEA 4LH4A 1L5UA 3AVKA 3CYMA 4RW9A 3AV9A 1REVA 2NLXA 1LWEA 1C1AA 1NJWA 3ULEB 1J5EK 1VQKN 2OTLN 1HRHA 3O4WA 3DLHA 4KHWA 1C0UA 3ZETA 3O9TA 3ZCMA 1X3MA 3PIOL 2NRHA 4WCEL 3I0RA 3LDSA 1K8AO 4FJGA 1GLBG 1WBDA 3CCMN 3T69A 3LDNA 1TKDA 1TK8A 4YHHK 3LWMA 2YKMA 2ZD1A 4YOTA 3TAFA 4CJ7A 3L2VA 4CJUA 3V6DA 2G8UA 3D0PA 3QETA 1YAGA 4IJAA 5DMRA 3SI6A 4CGDA 4B1XB 2BH1A 3DLBA 1TVRA 2ASPA 1MU2A 4PUOA 1RDAA 2Z1IA 3SUOA 4OLAA 4FPAA 4X64K 3DWLA 4WF9L 5FDLA 3VQDA 4F3OA 4RW4A 4BRLA 1NGDA 3A5NC 4RW8A 4XIUA 3EKSA 5AQGA 1Z26A 3TTFA 3BUZB 4CEDA 4DTOA 2QK9A 3QEVA 3L6QA 3R8EA 3J7ZO 1RFQA 3O8MA 3VERA 4JI5K 1X9MA 5JLHA 1D5AA 2KW4A 4PL8A 1DTTA 3D6RA 4CFAA 3KVGA 3L0QA 1RBRA 4DV0K 3E1YA 3T1HK 3AA2A 5FPMA 4BC3A 4GMJB 3G71N 3RMCA 3CQYA 4JKAA 3AVIA 5CYMA 1NGFA 5E26A 1WOQA 4IOCL 4GY2B 1HNXK 4JI1K 2XY8A 4BRIA 3TSPA 2QWNA 4LD0A 4BDZA 3CPWM 4FK0A 5GAEP 4B9MA 2RPIA 4E3SA 1TK5A 2OZSA 2YJFA 3AVMA 1XI1A 2W40A 3AVGA 3LDLA 2ZF5O 2QW9A 3ZSWA 4EZ9A 2ATQA 1W9HA 4YOVA 3JSMA 3MCPA 1QS4A 3VTIA 3HTVA 4MFBA 4YFUA 3ID6A 2ITGA 5CZ2A 1T7PA 2VG7A 4FJMA 4Y0WA 2CH6A 3H46O 1VHXA 5FRNA 1ESVA 4BRCA 4DB3A 4CHQA 3LDOA 3VQCA 4KHYA 4CHZA 3OYDA 4DSIA 2RN2A 4X65K 3HPOA 3O3FA 5KGWA 1S5JA 3O80A 1JCEA 1OH7A 2HF3A 2P1JA 3CFRA 4JD2B 4HUFA 4MO4A 1HNVA 2NRRA 3EEQA 3LP1A 3OJSA 4RW7A 1GLAG 4JRQA 4ZTFA 4DSKA 4JAXA 1EKEA 1G15A 3VQBA 4GV9A 3D2EB 4K8XA 2XY5A 1NKBA 1KFDA 4CEZA 3TAEA 3D2FB 4KHQA 3K5MA 4KH4A 1VQ7N 1VQLN 2YHXA 4BREA 3H45C 3RSEB 1CXQA 3DLLL 3MN9A 2Q3SA 4JI0K 4F3TA 3GL1A 4H0XB 5HOOA 5B8HA 4E89A 4DUZK 4B3SK 2I7PA 4W5RA 1IG9A 3LP3A 4O4GA 2F9TA 2P9NB 5ADXA 3V1OA 2HSTA 4FJXA 4GKJK 5CHIA 3NBPA 2P5GA 4CGJA 1WUAA 4CCHA 2EHGA 5IWAK 4DV2K 3KLHA 1RTDA 3PO4A 1VSEA 4FPBA 5AZIA 3K2PA 3LAMA 4ILJA 2E1ZA 1VRUA 3MN7A 4FWQA 1VSFA 1SS6A 1KTQA 4C1NK 4DR5K 4FOEA 5JICA 2E2QA 4M7YA 1Y97A 4DTXA 3KKRA 1QQNA 4MQ3A 2A6AA 4CJTA 3KK2A 4EAHD 3TAPA 1D8YA 1UOCA 2FBTA 3VF2A 4JI8K 2O8FB 3H1VX 1YIJN 1S1VA 2B4JA 1HPZA 1YF5L 1VSKA 3OVNA 4CJVA 2FLOA 2O4IA 4KHPK 3A2FA 4YOUA 4DG1A 4M3ZA 4WYBA 2P9IA 3V81A 1RT4A 1GLFO 4JK7A 2YHAA 4IZ9A 3W0LA 1RBVA 4CJ3A 3OYIA 4BG9A 4LF6K 1HR0K 4F9OA 3F73A 2GEMA 4DQ8A 4DQIA 1MWMA 4DV6K 4H5VA 3IS9A 2E8AA 3CJ9A 3MXMA 2GV9A 2A3ZA 3ZT1A 3ZT2A 5KTQA 4I9QA 3CCJN 4IEEA 3OS1A 1BIZA 1IBLK 2YCHA 1QQMA 2E2PA 1HNZK 5JMVA 2VGMA 4FJIA 3BF3A 4DV7K 3VQ5A 2P9LA 3LALA 1NK5A 3PIPL 4JKBA 1ZBSA 1DEJA 2FC0A 3LWLA 1KAXA 3HT3A 1JLFA 4NB4A 1NWKA 3ATUA 3PX4A 1Q81O 3D7EO 5DK5A 3TSQA 4DU1A 3CD6N 3ZT0A 5J2QA 1WB9A 2V51B 1XHZA 4M41A 1GLJO 4DSEA 1GLCG 4JNEA 3SQ1A 1BWFO 3EKUA 1S22A 4H8KA 3O08A 4A59A 4JKCA 1E4FT 4YOYA 3FFIA 1BI4A 4EP4A 3G0ZA 5C10A 4QS7A 4YNQA 4K0KK 3AO3A 2V7ZA 3P5JA 3OYLA 2ZQBA 4KB0A 4IKFA 2F96A 2BANA 3V9WA 1TKXA 1X9JA 3DMJA 3RWUA 1EETA 1SZ2A 1VQ5N 4CJKA 4Z4GA 1RTJA 2E2OA 3ZEUA 3AO1A 3ZSRA 1R0AA 3CERA 1X9WA 3THXB 1NK4A 4B8AB 4FM1A 2YNFA 4CHPA 1JLAA 1VRTA 1J53A 1BQMA 4KH5A 3EL2A 3NF6A 4CGHA 2O8EA 1D9FA 3HBTA 5GIPA 1LCUA 5ADXH 4FL9A 5BPNA 4F2RA 5GAGP 4CIGA 4FO0A 3HJFA 4M63C 4DFJA 4B1YB 4BRPA 1ZYQA 1RDDA 4FLWA 3FZFA 5FLXO 2F7TA 1IG8A 2G8KA 2BUPA 4E7IA 3IKMA 1U48A 1BCMA 2QKKA 1RDWX 4B08A 3KLGA 3SAGA 4JYAK 3T3FA 1RCHA 3SMPA 4A5BA 4IJNA 3QB0A 1A5VA 2AP1A 3AO5A 4AHSA 4AILC 4H5NA 1G99A 3AGKA 3J8AA 3DJCA 5I9EB 5IT9O 3I8BA 1QHAA 2ZGYA 3S9HA 3R3LA 4BVPA 4FJ5A 4JHDB 4CECA 4FK4A 3H1QA 4EZ6A 1P90A 1HJOA 1I94K 4XEIA 3B6PA 4FWLA 1HKBA 4IO9L 3NF9A 5AQYA 3HPGA 3WQUA 3THWA 2NRWA 1J5OA 3K59A 1T3VA 4BE1A 2X6SA 5D3GA 3G4SN 2DFEA 4CHYA 3U3YA 1HMVA 4FLUA 2E20A 3O9UA 4X62K 4OPHA 2IDOA 1NGAA 3S3OA 4JEPA 4L8RB 2QWMA 1HLUA 1W97L 2O8BA 3AA5X 4E7LA 3LDPA 1K9MO 1T44A 4BG8A 4X66K 1TAUA 1S9GA 3OYBA 3PO5A 3K5LA 2GUIA 3AY9A 1TL3A 5BN9A 3H6EA 3MK6A 4O8KA 4CFDA 3MAQA 1HX1A 1TUUA 2H3GX 5AQHA 2D0PA 3OYGA 1SL1A 2E6LA 3MX5A 3ZSXA 1NJIO 4O5FA 3L2WA 4JK8A 3EZ5A 4RW6A 3CC4N 1KVCA 3MN6A 4DV4K 3M3ZA 3SQ4A 1LV5A 3S3NA 1QZ6A 1WBBA 4NLCA 3FZHA 3OYCA 2JWKA 3HSCA 4O5BA 5TKYA 1RNHA 4WFAL 1NMDA 4WQ4C 4LF9K 3QICA 4DV5K 1SUQA 3O9SA 3NHGA 2A40A 4IEIA 3RMBA 1YITN 2P9UA 1K8KA 3OTOK 4BE0A 2CH5A 1YJNN 4CGFA 1B9DA 4DSLA 2A41A 5TKWA 4HCBA 1NGGA 1HKCA 3OBWA 3HYFA 4ZHRA 5AQXA 4FJ8A 4JV5K 1T6DA 3HI0A 1U49A 4H0OA 1FKPA 3AARA 3K5NA 2ASOA 3M1FA 4CZLA 3A8YA 4NXNK 3OS0A 3NH1A 2KLAA 3SAFA 3WXKA 1Q7YO 1KAZA 3IRXA 5AQPA 4CIFA 4LFCK 3Q7CA 3AVLA 4BR2A 3AVJA 2Z1JA 1NM1A 4CJ4A 2VG5A 2G8IA 1KD1O 4FJLA 3KD5E 1U47A 1HPMA 3ZT3A 4ILGB 4OKJA 3HP9A 1BQNA 1TKZA 2Q31A 3NGYA 4AM7A 5AQSA 5CE3A 3UIQA 1Q8IA 1HYVA 5AQRA 2QEXN 3DYAA 2ETJA 4DSJA 4JKGB 3K58A 4A62A 2YHBA 5C24A 3JYTA 4KHSA 3WXMB 2HOEA 4H0VB 3O4QA 3CCUN 3DAWA 4CZKA 3V9SA 3THVA 1XNQK 4YORA 3DXMB 1VSMA 3QERA 4C1NI 2OANA 1NJXA 3M6GA 3U9DA 1GOBA 1EQYA 5EX5A 3CCSN 5FPEA 3PUFA 4CBXA 5CYQA 3HXMA 3MX2A 3Q7BA 4FWMA 2J4RA 1BA0A 4DR6K 3DLKA 1XMOK 1NGJA 1JLBA 3MEGA 4NCBA 4DFMA 4OX9K 4DLEA 4BR4A 3GBTA 2HMIA 3SNNA 4JI2K 3HP6A 3E01A 4GV6A 3QESA 4CBUA 2I5JA 3IMXA 2CGJA 3RVCA 4FZZA 3ZX0A 1SKSA 4MLHA 5M1QA 3F5TA 3MMVA 3EZWA 3ZX3A 2YI1A 3PY8A 4E1NA 1S1WA 4ELTA 5SWMA 2HMPA 3WNFA 3SUPA 4FK2A 2I7NA 3OY9A 1N8RO 3TR8A 4KAZA 3SQ2A 3DRSA 3WNHA 4M7XA 1W0HA 1YJWN 2OCEA 1KVBA 4HVJA 4CERA 4OKEA 1YT3A 2Q1NA 4U7BA 1NNEA 2UYTA 1RT1A 4HUEA 3HVTA 3VN5A 5GAHP 3OYMA 4E0DA 4FOIA 3RMAA 1RTHA 1WNSA 3QIOA 4B3TK 1S6PA 3TTCA 5F1XA 2YHYA 3UKRB 4RTFD 4C23A 4IG0A 4FWSA 1N34K 1NMNA 4BR7A 3ASMA 4BC2A 4CJPA 5ELZA 1YTAA 1BO5O 1NOZA 3ZSYA 2ASMA 1XUPO 3MXJA 2F4VK 4LF5K 5C25A 3C0BA 5AQKA 4BVOA 2DFFA 2X74A 3HRGA 4DV1K 4IWVA 4NXMK 1EP4A 4BR5A 3HO1A 3FLCO 4JKEA 1C0GA 5BR8K 2FBXA 5JVHL 4DSFA 1VQMN 1JL1A 4BRDA 4K25A 1HKGA 2D4WA 1JL2A 5KI6A 4Y1CA 5HROA 2CGLA 1DLOA 4BRKA 4FJKA 1TYQB 1MDUB 1KLNA 2PYJA 4M3WA 3U3GA 5GIOA 3CCQN 4DTPA 5CR4A 3CC7N 4ZTJA 4I6MA 3CC2N 2XY6A 4WE1A 4BWMA 2JLEA 1NJYA 3U6FA 3FZKA 2E4LA 1OH8A 2A1SA 3SZ2A 5J2PA 4AHTA 1EWRA 4GW6A 3IG1A 1ZBLA 3OA9A 1NGBA 4DQPA 1ASVA 4FWRA 3SV4A 1HJRA 4FM0A 2JWLA 3G25A 3V1RA 3O1BA 4C8MA 5E84A 1L3TA 3VEZA 4BRAA 2XRIA 5LMUK 1JLQA 4IG3A 3ULEA 2O8DB 1IBMK 2OTJN 4J2AA 4Z4HA 2B5JA 2JGUA 3RTVA 4FJJA 1IJJA 4UY8O 2P9SB 1X1PA 2PAVA 1GLEG 3VQPA 4E7HA 1RDCA 3BZCA 4CW7B 3QEWA 3THYB 3MEDA 3ITHA 1KC8O 3OYJA 2KKZA 4O55A 4RWTA 4W5TA 1JLEA 4Z4CA 5M1KA 4FW1A 4E19A 2ZM6K 3P1GA 4PY5A 3ENHA 2HHSA 3OJUA 1NLVA 3E66A 5K14A 4CJEA 4BGBA 4CD3A 2RKIA 4XH1A 1S1UA 1HUXA 4BR0A 1CLQA 1ZBFA 4LFAK 1DT9A 3MXIA 1HNWK 1NGIA 3LANA 4DQSA 3DOLA 1BU6O 3VEOA 3CQ8A 2DTUA 3EE8A 5EU7A 4B3MK 1YVUA 3SYZA 3PSIA 1J9AA 3KWIA 4Y1DA 3VF6A 2AJQA 3V9ZA 4CZHA 1KVAA 1NG9A 4WQ5C 4OKKA 4WFBL 1V4TA 4Z94A 4H03B 4DUYK 2ITMA 4HTLA 5GADP 4IOAL 2LSNA 5AQNA 3AAPA 3H3NO 1VK0A 1KXPA 4BACA 2G8VA 2P9KB 3C7NB 4DHYA 4J2BA 3FZMA 4RG8A 3OYFA 1VQNN 4M45A 1S1XA 4PL7A 5AJ3K 2A5XA 4BRQA 4Z4EA 4WQ4A 4A57A 1L3SA 1BA1A 4C8KA 2ZJRL 3RRHA 3IDHA 3PX0A 4CGIA 1LAVA 3HSTB 4BROA 3SK3A 1YTUA 3KJVA 3F2KA 3M8QA 1VAZA 3VQQA 5BRDA 3SAHA 2HNYA 3L3VA 1QVFM 2RHKA 2NRTA 3VQ8A 3VGKA 2ZGZA 3VOVA 4BC4A 1Q9YA 2F8SA 3M5RA 4CF9A 4BWJA 3C6TA 1QHTA 4BQZA 3ENOA 1W2BM 2ZWHA 4JLHA 2FF3B 3SUNA 4G1QA 4B9TA 4DU4A 4DTNA 3V9XA 2YNGA 2P5OA 2VQFK 4F8RA 3KD1E 4H0YB 3P4IA 3CF5L 3NGIA 4Z4FA 1OKJA 3OHRA 3KTQA 2GWJA 1K6YA 4KHUA 1A5WA 1DKGD 1IO2A 2IIRA 4ISFA 4JD2A 4FZXC 5AQOA 5C12A 5AZJB 1BL3A 2D5RA 3DRRA 1WLJA 1O13A 3O5BA 4CF8A 4YY3K 3TWHA 5DM6L 3R9PA 4Z0UA 2QWLA 3TABA 1TUYA 3MCAB 2Q36A 1S72N 4W5QA 3KHYA 3E9PA 2B6AA 3D2EA 3QBWA 4FW2A 3EE9A 5HBMA 3FGUA 4CZIA 4DU3A 3CQXA 3HK2A 3CI5A 3D2FA 2IVPA 1TL1A 3CHWA 2IC3A 3WEEB 3S3MA 4K41A 3RSEA 4CEEA 4JI3K 1E4GT 4ELVA 4OGCA 2O8CB 3CJAA 2ZJPL 2P9NA 3T1AA 4CJLA 4GVMA 1CZAN 5HRNA 4DV3K 4CK2A 1BHLA 4PQUA 4M3UA 5AQVA 1LWFA 4FVMA 3VQ9A 3TAQA 3AGRA 3DOKA 4H4MA 3ZSQA 3DXKB 4PA1A 2OPPA 4FCYA 1S6QA 3JS6A 4FXDA 5EXWA 3QNOA 2FBYA 4FLXA 3QNNA 4OGEA 1LAWA 4CEAA 1YUWA 5KPZA 3SLCA 4GVEA 1KLMA 1P8ZA 4DKWA 2O8FA 4KTQA 2HHTA 2V52B 1WSJA 3R6MA 2QI2A 3V1QA 5T7BA 4EHUA 3O3HA 3IUCA 1NGCA 4FSVA 3KLFA 1JJ2M 1VQPN 3C65A 4BC5A 2FSKA 4LSNA 1VQ4N 4YDUA 5CY4A 3HOTA 3QFPA 1QQOA 4ELUA 1U2VB 1K73O 4B9LA 1RGIA 2OPRA 3SV3A 4KTWA 1FXXA 2XHBA 4J2DA 3EY1A 2EX3A 3AVHA 2D0BA 4H0PA 4MDAA 3UKUB 5HLFA 4DCHA 4J8FA 2Q97A 3AA3A 1ITGA 4H4OA 1C6VA 1XWLA 1B92A 3F9MA 4CEQA 4J2EA 3ID8A 2GTDA 5BR9A 3NH0A 1CZBA 2OPSA 3FZLA 3N4QA 3PSFA 4LSLA 4OPJA 1TV6A 3CFPA 4CZMA 3DI6A 5C2DA 4CZJA 1MWKA 3MWTA 5AR0A 3NAEA 1VQ8N 4FZYA 1QTMA 3K0SA 3WXIA 1RILA 4KO0A 4I9LA 3N4PA 3W3DA 3NF8A 5AQLA 4NCAA 4A2BA 3VTHA 3EO3A 1BOTO 4KRFA 3ALYA 3BZKA 4G9ZA 1NOYA 1L3VA 3SBGA 1S3XA 3VENA 3ULDA 1NK0A 3ZETB 5LL6Z 4O44A 4ILHA 5LJWA 3KKSA 3J7AP 1QZ5A 1UA1A 1WAFA 4Z4IA 1VSDA 4FVUA 2HF4A 1M90O 4E7JA 5FPNA 3VGLA 1FKOA 1J6ZA 3HM8A 5LY3A 3VPZA 1R59O 5GINA 2UXBK 4AHCA 5C0YA 1KAYA 3SCXA 3A5LC 3K9JA 5BRHA 4B9NA 4AHRA 5AQFA 2D0AA 3BDPA 1KSPA 4HCCA 1EX4A 4KREA 1GOAA 3T1YK 4FJHA 2QWOA 3C6UA 4OJRA 2R7YA 3THXA 4XH5A 4DR7K 4ISEA 1UA0A 3SMSA 1T03A 4KV8A 2KQ2A 3QMLA 2G8HA 1N36K 2Y1JA 1BCOA 5AFUA 3HZ6A 1SL0A 2UXCK 3NF7A 4B1VA 3C95A 3J7YP 3V9UA 2YX6A 4KH6A 4FLZA 1VSHA 3NVMA 4XH4A 1VSJA 3H3OB 2NRVA 4LF4K 1NU0A 2P51A 4M3XA 1LWCA 4H5WA 2YNIA 1WSHA 1ZXOA 4MLEA 4F4KA 1U6ZA 1IV0A 1GLDG 4DFPA 4CZFA 1RBTA 3FE1A 3KLIA 3LPUA 5BREA 1OH5A 3T19A 3QEIA 1HYSA 4B9SA 4DR3K 3B8AX 4B3RK 2QWRA 1EXQA 2GX9A 4CI6A 4M3RA 3MN5A 5AQZA 2WFBA 3MDQA 1XNRK 3AAQA 4EHTA 3L8BA 3CJCA 3OYEA 2XO7A 1OH6A 5F2RA 1WSIA 4JHDA 1DGKN 1UAXA 3WXJA 1XC9A 1ZBUA 5M1FA 4OPKA 4KKOA 2BGGA 3TI0A 1HYZA 4CIEA 4V19S 5KQDA 2KZZA 4O0JA 3AO2A 3ENBA 3L2UA 2VWKA 2HW3A 4CBWA 1N6QA 1NK8A 4BE2A 2FSJA 1RTIA 3U9ZA 2VWBA 4JI4K 2YNHA 3VA3A 4EIAA 5BPLA 5E41A 4FLYA 1BIUA 3IAYA 3DLRA 3JXUA 2E5LK 4WQ5A 1RDUA 1KQSM 1DTQA 3NMUA 3TSUA 1QSLA 1Q9XA 1B9FA 3NE6A 4DWIA 4YDUC 2UXDK 4DR4K 1SKRA 4CJRA 2QXFA 1JCGA 1U04A 1ASWA 1RT3A 1WN7A 2FXUA 4B1UB 3VEYA 5LJVA 4DF8A 1XMQK 4UQGA 1LOTB 4OO1J 1IKYA 4B9UA 1LW0A 5MLCQ 4NLBA 3QFUA 4CHNA 4K42A 2VCPA 5LMNK 1TK0A 4AQYK 1Z25A 1RT6A 4I2QA 4LFBK 2EWSA 3NGZA 4AH9A 1J54A 2WC9A 5CZ1A 4CJSA 5AQUA 2F8TA 4CD1A 3OS2A 4JI6K 2AA4A 1SQKA 4B8CA 3VF4A 1RBSA 2Q0RA 4N47A 4BRMA 3K57A 3VEWA 1C0TA 1WSFA 5JS2A 4CF1A 3LP2A 5AZIB 5M1OA 3CCLN 4OLBA 4CJWA 3L4QA 2KFNA 1YVNA 2GELA 5AQJA 3VQ4A 3U8XA 2D0CA 4NYFA 3P38A 3I55N 1HNIA 4DTUA 5EVZA 3UB5A 1ASUA 4DQQA 2O4GA 5AFUH 2FF6A 4JI7K 2CGKA 4AF1A 3P39A 4E1MA 2HBMA 1D9DA 1X3NA 1BGXT 3KK1A 1NK9A 1IKVA 1T05A 4EFHA 4BR9A 4KTZA 2KTQA 4ICLA 2IS3A 2WBNA 3KZBA 2P9IB 4ISGA 3UE5A 3ATVA 4L3QA 3TARA 2DY4A 3HPHA 1SL2A 5BN8A 1SV5A 4E7KA 2BDPA 4KI4A 2D1KA 1LW2A 4N41A 1YHQN 4F2SA 2YHWA 1U45A 3I33A 4JKGA 3WUHA 4PHTX 2HHWA 3A0IX 4I7FA 4A2AA 3KLEA 3BP8A 4QCLA 3LPTA 3DXMA 3BEXA 1ATSA 1E3MA 2P9LB 2G8WA 2UUAK 1I39A 1IKWA 1XQSC 3NVKA 1YJ9N 4FJ9A 4JK9A 4CK3A 4CZGA 5AQQA 4DQRA 5AQWA 1WAJA 3QINA 4HTUA 1X9SA 3CJ7A 3TAGA 2PYLA 1BI4B 3DLEA 2FSNA 3OBYA 5J2MA 4HHTA 1RT7A 4CEBA 1NGHA 3O6WA 1C1BA 3VMFB 5J1EA 5I3UA 2HHUA 1W7AA 3PLAA 3SJJA 2A1RA 1ZBIA 4B9VA 3KIOA 1IBKK 3C6HA 1QVGM 1I3AA 2E2NA 3ZEUB 4NCGA 1GOCA 5C2FA 3MWPA 4DFKA 4H5RA 4B9QA 3VQAA 4BRGA 3SQ0A 3M8SA 4BGAA 2PFUA 1T6CA 1Q82O 3NCIA 1JLCA 3ZT4A 4AM6A 5BRFA 3J81O 1WSEA 4CJ5A 2O8EB 3RRGA 2NRZA 3LL3A 4PKGA 3NFAA 5HRSA 1WSGA 5JLFA 1ZC6A 3DRPA 5FROA 4BRFA 1RT2A 1QQCA 4AHVA 3L2QA 3LDQA 4B3OA 3NH2A 2HB5A 2UU9K 4BDPA 5FPDA 1OVQA 3FR0A 2A42A 5JVGL 3UKRA 4LH5A 2IVNA 2ZE2A 3PX6A 3RMDA 3PV8A 4FYDA 4CJFA 3OYNA 2E88A 4FWNA 1HQEA 4E1JA 1OVYA 1Z6RA 1A5XA 4JKDA 5J2NA 1N5YA 3VETA 3CCVN 4JS4A 3L2RA 1QSSA 2HVIA 1NBWA 3RR8A 4LF7K 3QIPA 4BY9C 5KPRA 2Q0UA 3EN9A 2HHVA 3E9LA 3MECA 4MDBA 4QS9A 3J80O 3GE1A 4FWPA 4CF0A 3THWB 3F9KA 1TKTA 1SAZA 2FBVA 1TAQA 1BUPA 1TYQA 4OPAA 2VG6A 3ZSVA 3DLGA 3EYZA 2QTDA 3H08A 3LZJA 3K5OA 3C94A 3KK3A 5C42A 4BDYA 4M3YA 3ZYYX 3P83D 3CM5A 2O8BB 5M1PA 3O1WA 3CG7A 4R5PA 1MA9B 1Y64A 3O3GA 4HUGA 1YI2N 3CFOA 1RDBA 2IVOA 2KHOA 4BQLA 5JS1A 3R1XA 4ID1A 4IFYA 4Q0BA 2BTFA 3CJBA 1BDGA 4GNIA 2RF2A 4CZEA 2RE2A 2E1YA 2P9PB 1V4SA 2O8DA 4FJNA 3CIPA 1EWQA 3CCRN 1JLGA 2P9SA 2NUBA 1KFSA 4GKKK 2GWKA 4LF8K 3THYA 3AVAA 4JN4A 4K43A 3SBTA 3VQ6A 3AVCA 4R79A 1T8EA 3VQEA 3L4IA 2W6KA 3OYAA 4BRHA 3T7ZA 2VQEK 4IBNA 3B6OA 4HWIA 3U4LA 4OVLA 2DFHA 1N32K 5AQIA 3HVRA 2G8FA 2P9UB 1K8KB 5H1SQ 5HL7L 2F9WA 1NGEA 1KCFA 4CVNE 1S9EA 4IDHA 3SPYA 3IFRA 4PWDA 2HHQA 3VQ7A 2HNDA 3DM2A 2OA8A 3VGMA 1NKCA 3GDQA 1FW6A 5C15A 2GUPA 1YXQA 4N5SA 1QE1A 5HRRA 2NZTA 1VSIA 4NO7A 4CESA 2HHHK 3OYKA 3TPQA 2OYQA 4DF4A 4CGGA 1N33K 4KFBA 1C0MA 4DR1K 4CEFA 3QLHA 4N56A 3SPZA 1FK9A 1NJZA 1SKWA 3BY5A 3C6AA 1C0FA 1Q86O 2QKBA 1KRPA 2P9KA 4FLVA 2Q2RA 3C7NA 4DS4A 4FLTA 4CFCA 4DTRA 1CZ9A 2QA4N 1NK6A 1VSLA 5BPMA 1HQUA 2Y1IA 3ZSOA 3I8DA 2KFZA 3QDKA 4AHUA 3LZIA 3AO4A 3QBXA 3VESA 3NDKA 4KI6A 4LY7A 4CK1A 3GOIA 2XY7A 3GG4A 2W6LA 3ZLJA 4IFEA 2Z1GA 1D4XA 4QS8A 3AVNA 3LM9A 3VEXA 1Q18A 5AQMA 4LC9B 4CJQA 4DLGA 5FRMA 2W41A 2HBKA 4CHOA 2PBDA 4I2PA 4A5AA 4DTMA 3TAMA 1Z05A
chains in the Genus database with same CATH topology
4I6MA 5JMVA 3CC2N 2VGMA 3A5OC 3BF3A 4CBWA 2P9LA 3FZKA 3O9RA 3CETA 4B1WB 3PIPL 2FSJA 4JKBA 1ZBSA 1DEJA 1XC3A 5F0XA 1KAXA 3U9ZA 2VWBA 3OA9A 1NGBA 4NB4A 3CJ1A 1NWKA 4FWRA 2V7YA 3ATUA 4EIAA 5BPLA 2JWLA 1Q81O 3D7EO 1BG3A 3TSQA 3G25A 3JXUA 4BRNA 3O1BA 3HOSA 3CD6N 5E84A 4WQ5A 1RDUA 3VEZA 4U67L 1KQSM 4BRAA 5M1NA 3KK7A 5EOYA 3CXCM 4JKFA 4RCHA 3NMUA 3TSUA 3ULEA 2OTJN 2V51B 3P31A 3WXLA 1GLJO 4UY8O 1IJJA 1GLCG 2P9SB 4O8UA 3CMEN 2PAVA 4JNEA 1GLEG 1BWFO 3BF1A 3EKUA 4YOXA 2HBJA 1S22A 4MO5A 3O08A 4FWOA 4JKCA 4YDUC 4A59A 5AZJA 1M1KO 1E4FT 4IXCA 4YOYA 2P9PA 1JCGA 1KC8O 2YJEA 4IOXA 5C10A 2KKZA 4RWTA 4QS7A 2FXUA 4B1UB 5AQTA 5M1KA 3VEYA 5LJVA 1EO1A 1LOTB 4OO1J 2DPNA 5MLCQ 4NLBA 3QFUA 2V7ZA 3ENHA 4K42A 2VCPA 3ZX2A 3WQTA 1NLVA 1X9JA 4PKHA 3E66A 3WEEA 2EWSA 1ATNA 3K9KA 2D0OA 1SZ2A 4YOWA 1VQ5N 4BGBA 2WC9A 2QXLA 3S41A 4CD3A 4XH1A 2QWPA 2E2OA 3ZEUA 3VEVA 1HUXA 3O9QA 4BR0A 4H0TB 5AQUA 1H1VA 1DT9A 4CD1A 2HBLA 3CERA 1NGIA 1BU6O 3VEOA 2AA4A 1SQKA 3VF4A 3EE8A 2Q0RA 4BRMA 2QM1A 3VEWA 3SJHA 4KH5A 5DM7L 3EL2A 3OW2M 5M1OA 5AZIB 3CCLN 3TU5A 3KWGA 3HBTA 3KWIA 5GIPA 1LCUA 5ADXH 3L4QA 4FL9A 4PKIA 3VF6A 5BPNA 3A5MC 5GAGP 1YVNA 1JCFA 2GELA 2VYPA 4FO0A 4M63C 5AQJA 3U8XA 4CZHA 3P38A 4WQ5C 4B1YB 3I55N 3LM2A 5KQ8A 5EVZA 4WFBL 4BRPA 3G6EN 3DXKA 1V4TA 3UB5A 4Z94A 4H03B 2ITMA 3I56N 1ILYA 3FZFA 4HTLA 2F7TA 5GADP 4IOAL 1IG8A 5AFUH 2BUPA 2FF6A 5AQNA 2CGKA 3IKMA 3AAPA 2NRXA 3H3NO 4AF1A 1VQON 1RDWX 3P39A 1KXPA 2HBMA 3SAGA 1X3NA 3SMPA 3TTDA 4A5BA 4IJNA 2P9KB 3QB0A 5EY4A 4EFHA 2AP1A 4BR9A 3C7NB 4IO8A 3E9OA 4DHYA 2QWQA 1G99A 4H5NA 2WBNA 3AGKA 3KZBA 2P9IB 3J8AA 3DJCA 4KBOA 5I9EB 3I8BA 1QHAA 3FZMA 2ZGYA 4ISGA 3UE5A 3R3LA 4BVPA 1VQNN 4JHDB 3ATVA 3H1QA 1P90A 1HJOA 4L3QA 1U2VA 4PL7A 3FFKB 4A61A 4GV3A 5BN8A 1ATRA 4JKHA 4H5TA 2A5XA 4XEIA 4BRQA 4FWLA 2D1KA 1HKBA 4WQ4A 4IO9L 2VGNA 4A57A 1VQ9N 1BA1A 5AQYA 1YHQN 2YHWA 2ZJRL 3IDHA 3I33A 4JKGA 3WQUA 3WUHA 4PHTX 3UKUA 2NRWA 3A0IX 4BROA 1T3VA 3SK3A 3F2KA 4FWKA 1VAZA 4A2AA 5BRDA 3SAHA 3CMAN 5KPTA 3BP8A 3G4SN 4B1ZA 4I6MB 1QVFM 2RHKA 2NRTA 3DXMA 3VGKA 2ZGZA 1ATSA 3BEXA 3VOVA 2P9LB 4BC4A 2E20A 3O9UA 3M5RA 3CCEN 1GLLO 4OPHA 3WT0A 4BQZA 1NGAA 1XQSC 4JEPA 3ENOA 4WFNL 3CPEA 1W2BM 2NNWA 1HLUA 1W97L 2QWMA 2WUSA 2ZWHA 3LDPA 3NVKA 1K9MO 2FF3B 1T44A 4BG8A 1YJ9N 4JK9A 4CZGA 5AQQA 3AY9A 5BN9A 4H0YB 5AQWA 3P4IA 3CF5L 2NLXA 3H6EA 1OKJA 3OHRA 2GWJA 3ULEB 3MK6A 4O8KA 1VQKN 1DKGD 2OTLN 1HX1A 3O4WA 2IIRA 4ISFA 4JD2A 1TUUA 5AQOA 5C12A 5AZJB 3ZETA 2H3GX 5AQHA 2D0PA 3CJ7A 3O9TA 2FSNA 3MX5A 1O13A 1X3MA 3O5BA 3PIOL 1NJIO 5DM6L 4O5FA 2NRHA 3OBYA 4JK8A 3R9PA 4WCEL 2QWLA 1NGHA 3O6WA 1TUYA 3CC4N 3MN6A 3MCAB 3M3ZA 1K8AO 2Q36A 1GLBG 1S72N 3CCMN 3T69A 3VMFB 3LDNA 3KHYA 3E9PA 3D2EA 3QBWA 1QZ6A 3EE9A 4CZIA 3FGUA 3PLAA 3CQXA 4NLCA 3FZHA 3CI5A 2JWKA 3HSCA 3D2FA 2IVPA 3ENBA 3CHWA 5TKYA 4YOTA 4WFAL 4CJ7A 3WEEB 1NMDA 4K41A 4WQ4C 3RSEA 3QICA 3C6HA 1QVGM 1E4GT 2E2NA 3O9SA 3ZEUB 1YAGA 4IJAA 2A40A 4B1XB 4IEIA 2BH1A 2ASPA 5C2FA 3MWPA 1YITN 2P9UA 1K8KA 4H5RA 4B9QA 3CJAA 4FPAA 2CH5A 2P9NA 4BRGA 2ZJPL 1YJNN 4BGAA 2PFUA 3DWLA 4WF9L 1T6CA 1Q82O 1CZAN 4BRLA 4AM6A 5BRFA 1NGDA 3A5NC 2A41A 3EKSA 5TKWA 1NGGA 1HKCA 3OBWA 5AQGA 3TTFA 2NRZA 3LL3A 4PKGA 3BUZB 5AQXA 1T6DA 3HI0A 5AQVA 5JLFA 1ZC6A 4H0OA 3L6QA 3R8EA 3J7ZO 4BRFA 1RFQA 3AGRA 3O8MA 3VERA 3AARA 2ASOA 3DXKB 3M1FA 3LDQA 4CZLA 5JLHA 3A8YA 3JS6A 5FPDA 5EXWA 3FR0A 2A42A 4PL8A 5JVGL 3D6RA 3KVGA 3L0QA 3UKRA 2IVNA 2KLAA 3E1YA 5KPZA 1YUWA 3SLCA 4GVEA 3SAFA 1P8ZA 3WXKA 1Q7YO 5FPMA 4DKWA 1KAZA 2E88A 4BC3A 5AQPA 4FWNA 3G71N 4E1JA 3CQYA 1OVYA 3Q7CA 4JKAA 1Z6RA 2V52B 4BR2A 4JKDA 1NGFA 1NM1A 3R6MA 2QI2A 5E26A 3VETA 1WOQA 4IOCL 4GY2B 3CCVN 4EHUA 1KD1O 3IUCA 1NGCA 1NBWA 4FSVA 4BRIA 1HPMA 3TSPA 1JJ2M 2QWNA 1VQPN 4BY9C 3C65A 4ILGB 4BC5A 2FSKA 5KPRA 3CPWM 1VQ4N 4YDUA 5GAEP 3HOTA 3QFPA 1QQOA 1U2VB 2Q31A 2Q0UA 1K73O 3EN9A 3E9LA 2YJFA 1RGIA 4AM7A 4MDBA 4QS9A 5AQSA 2W40A 5CE3A 3LDLA 5AQRA 2ZF5O 3GE1A 2QW9A 2QEXN 4FWPA 4JKGB 4MDAA 4H0PA 4A62A 3UKUB 4YOVA 4DCHA 3MCPA 1SAZA 3WXMB 2HOEA 4H0VB 4J8FA 3CCUN 2Q97A 3VTIA 3DAWA 1BUPA 3HTVA 4CZKA 1TYQA 4OPAA 3ID6A 3F9MA 4YORA 3ID8A 2GTDA 5BR9A 3DXMB 3FZLA 3N4QA 4Y0WA 2CH6A 2QTDA 4C1NI 3H46O 1ESVA 2OANA 4BRCA 3M6GA 3U9DA 1EQYA 5EX5A 3CCSN 4CZMA 5FPEA 3ZYYX 4DB3A 4CZJA 5C2DA 4CBXA 3LDOA 5M1PA 1MWKA 3MWTA 3O1WA 5AR0A 1MA9B 1Y64A 1VQ8N 3MX2A 3Q7BA 4FWMA 3WXIA 1YI2N 2J4RA 1BA0A 2IVOA 3N4PA 3W3DA 2KHOA 5AQLA 4BQLA 4A2BA 3VTHA 3EO3A 1BOTO 3O80A 3R1XA 1JCEA 1NGJA 4G9ZA 2BTFA 3CJBA 3SBGA 2HF3A 1BDGA 1S3XA 4BR4A 4GNIA 4CZEA 2RE2A 2E1YA 2P9PB 1V4SA 3GBTA 4JD2B 3VENA 4MO4A 3CIPA 3ZETB 2NRRA 3CCRN 4GV6A 4ILHA 2P9SA 5LJWA 1QZ5A 1GLAG 4CBUA 2GWKA 4FVUA 2HF4A 3IMXA 2CGJA 3RVCA 1M90O 5FPNA 4JAXA 4JN4A 3VGLA 4K43A 3SBTA 3ZX0A 4GV9A 4MLHA 3D2EB 4R79A 1J6ZA 3HM8A 5LY3A 3VPZA 3L4IA 5M1QA 1R59O 3F5TA 5GINA 3MMVA 3D2FB 3EZWA 3ZX3A 5C0YA 2YI1A 4KH4A 1VQ7N 1VQLN 1KAYA 2YHXA 4BREA 3H45C 3RSEB 2HMPA 4BRHA 3A5LC 3T7ZA 3DLLL 3MN9A 4HWIA 3GL1A 4H0XB 5HOOA 3K9JA 3U4LA 2I7NA 5BRHA 5B8HA 1N8RO 5AQFA 5AQIA 2I7PA 2P9UB 1K8KB 5H1SQ 5HL7L 4M7XA 1YJWN 2ZJQL 2F9TA 2F9WA 1NGEA 2P9NB 5ADXA 2HSTA 2QWOA 4IDHA 3IFRA 2Q1NA 4XH5A 5CHIA 4U7BA 4ISEA 3VGMA 1WUAA 3GDQA 5C15A 2UYTA 2GUPA 3SMSA 1YXQA 3QMLA 5AFUA 2NZTA 4FPBA 3HZ6A 5AZIA 4ILJA 4NO7A 5GAHP 2E1ZA 4B1VA 3MN7A 4FWQA 4FOIA 2YX6A 3TPQA 4KH6A 1SS6A 3NVMA 4XH4A 4C1NK 3TTCA 4FOEA 5F1XA 5JICA 2E2QA 3H3OB 4M7YA 2YHYA 2NRVA 1QQNA 2A6AA 3UKRB 4RTFD 4H5WA 4EAHD 4C23A 4FWSA 3VF2A 3H1VX 4BR7A 1ZXOA 4MLEA 4BC2A 3C6AA 1U6ZA 5ELZA 1C0FA 1GLDG 1Q86O 4CZFA 1VQ6N 1YIJN 1BO5O 2ASMA 3FE1A 1XUPO 2P9KA 5BREA 1YF5L 2Q2RA 3C7NA 3C0BA 3B8AX 5AQKA 4BVOA 2FLOA 2QWRA 4YOUA 2GX9A 4WYBA 4CI6A 3HRGA 3MN5A 2P9IA 5AQZA 2WFBA 4IWVA 5BPMA 2QA4N 3MDQA 4BR5A 1GLFO 4JK7A 4IZ9A 3AAQA 3W0LA 3FLCO 4JKEA 4EHTA 3CJCA 5F2RA 4BG9A 1C0GA 1DGKN 4JHDA 4F9OA 3WXJA 3QDKA 5JVHL 1VQMN 5M1FA 2GEMA 3QBXA 3VESA 4DQ8A 4BRDA 3GOIA 4K25A 1HKGA 3GG4A 1MWMA 2D4WA 4IFEA 4H5VA 2E8AA 3CJ9A 1D4XA 4QS8A 2A3ZA 2CGLA 3LM9A 3VEXA 1Q18A 5AQMA 4LC9B 4BRKA 3CCJN 1TYQB 1MDUB 4IEEA 2W41A 2HBKA 2YCHA 5KQDA 2PBDA 5GIOA 4A5AA 3CCQN 5CR4A 3CC7N 1QQMA 1Z05A 2E2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWG A;  3KWI A;  3EE9 A;  3P31 A;  3RVC A;  3L4Q A;  3O9R A;  2RHK A;  3P38 A;  3O9Q A;  3F5T A;  3OA9 A;  4OPA A;  3O9U A;  3M5R A;  3O9S A;  2KKZ A;  4OPH A;  3O9T A;  3EE8 A;  3P39 A;  3D6R A;  2GX9 A; 
#chains in the Genus database with same CATH topology
 3D45 A;  3A5O C;  1XHX A;  4ID5 A;  1NKE A;  3O9R A;  1JXE A;  2X78 A;  3CET A;  4B1W B;  4IDK A;  2WON A;  2W42 A;  3I0S A;  3AVF A;  2GBZ A;  1XC3 A;  5F0X A;  2X6N A;  4KPY A;  2BE2 A;  3CJ1 A;  2PY5 A;  3HM9 A;  2V7Y A;  1BG3 A;  4W5O A;  4BRN A;  3M8R A;  3HOS A;  4JRP A;  4JS5 A;  3QEX A;  4U67 L;  1BIS A;  2HNZ A;  5M1N A;  3TAN A;  3KK7 A;  5EOY A;  1UWB A;  3CXC M;  1U4B A;  4JKF A;  4CEO A;  4RCH A;  5A2Q O;  3RR7 A;  3P31 A;  3WXL A;  4O8U A;  3O4N A;  3CME N;  3BF1 A;  4YOX A;  1QSY A;  1F21 A;  2HBJ A;  4MO5 A;  3JAM O;  4FWO A;  1M1K O;  5AZJ A;  1VQ6 N;  4IXC A;  2YV0 X;  5SZT A;  2P9P A;  3M8P A;  2YJE A;  4IOX A;  5KRS A;  5HP1 A;  2E6M A;  4CF2 A;  3LP0 A;  5AQT A;  1EO1 A;  2VWJ A;  1S1T A;  2DPN A;  3VA0 A;  4QAG A;  3ZX2 A;  3WQT A;  4DS5 A;  3AA4 A;  4PKH A;  3WEE A;  1ATN A;  3K9K A;  2D0O A;  4EP5 A;  4YOW A;  1FJG K;  2QXL A;  3S41 A;  3G10 A;  4DMN A;  4FJ7 A;  2QWP A;  2Z1H A;  3VEV A;  3O9Q A;  4H0T B;  1H1V A;  2O8C A;  3BGR A;  3MEE A;  2HBL A;  4DR2 K;  2OZM A;  4IFV A;  4Q5V A;  4CE9 A;  2WTU A;  2QM1 A;  4KHN A;  3SJH A;  5I42 A;  5DM7 L;  2HVH A;  3OW2 M;  4M42 A;  3TU5 A;  3KWG A;  1JXB A;  4W5N A;  3LAK A;  4PKI A;  3A5M C;  4C8L A;  1ZBH A;  2VYP A;  1JCF A;  4NYN A;  1JKH A;  4FM2 A;  3LM2 A;  5KQ8 A;  2ZJQ L;  3G6E N;  3DXK A;  3L3U A;  2IOC A;  4DTS A;  1C1C A;  2WOM A;  3I56 N;  1ILY A;  4M3T A;  4O0I A;  2NRX A;  5HRP A;  1VQO N;  2KZM A;  3TTD A;  5EY4 A;  1IH7 A;  1TGO A;  3AVB A;  3E9O A;  4IO8 A;  2QWQ A;  3CM6 A;  4CFB A;  3QEP A;  4N76 A;  2YKN A;  4KBO A;  5KGX A;  2PZS A;  2OPQ A;  3V4I A;  3ISN C;  4C8N A;  1U2V A;  3FFK B;  4TSX A;  4QOZ B;  4A61 A;  4GV3 A;  1ATR A;  4JKH A;  4H5T A;  1RT5 A;  2IGI A;  4DTJ A;  1VQ9 N;  2VGN A;  1RBU A;  2UUC K;  3UKU A;  3WNG A;  2HHX A;  1O1W A;  4KB1 A;  4FWK A;  3HL8 A;  3CMA N;  5KPT A;  2UUB K;  4B1Z A;  4I6M B;  3QO9 A;  1NK7 A;  4K8Z A;  3OYH A;  3SUQ A;  5KRT A;  3ZSZ A;  3CCE N;  1GLL O;  3WT0 A;  4C8O A;  1CXU A;  2IAJ A;  3CPE A;  4WFN L;  2NNW A;  2WUS A;  1L3U A;  1IKX A;  3WNE A;  4LH4 A;  1L5U A;  3AVK A;  3CYM A;  4RW9 A;  3AV9 A;  1REV A;  2NLX A;  1LWE A;  1C1A A;  1NJW A;  3ULE B;  1J5E K;  1VQK N;  2OTL N;  1HRH A;  3O4W A;  3DLH A;  4KHW A;  1C0U A;  3ZET A;  3O9T A;  3ZCM A;  1X3M A;  3PIO L;  2NRH A;  4WCE L;  3I0R A;  3LDS A;  1K8A O;  4FJG A;  1GLB G;  1WBD A;  3CCM N;  3T69 A;  3LDN A;  1TKD A;  1TK8 A;  4YHH K;  3LWM A;  2YKM A;  2ZD1 A;  4YOT A;  3TAF A;  4CJ7 A;  3L2V A;  4CJU A;  3V6D A;  2G8U A;  3D0P A;  3QET A;  1YAG A;  4IJA A;  5DMR A;  3SI6 A;  4CGD A;  4B1X B;  2BH1 A;  3DLB A;  1TVR A;  2ASP A;  1MU2 A;  4PUO A;  1RDA A;  2Z1I A;  3SUO A;  4OLA A;  4FPA A;  4X64 K;  3DWL A;  4WF9 L;  5FDL A;  3VQD A;  4F3O A;  4RW4 A;  4BRL A;  1NGD A;  3A5N C;  4RW8 A;  4XIU A;  3EKS A;  5AQG A;  1Z26 A;  3TTF A;  3BUZ B;  4CED A;  4DTO A;  2QK9 A;  3QEV A;  3L6Q A;  3R8E A;  3J7Z O;  1RFQ A;  3O8M A;  3VER A;  4JI5 K;  1X9M A;  5JLH A;  1D5A A;  2KW4 A;  4PL8 A;  1DTT A;  3D6R A;  4CFA A;  3KVG A;  3L0Q A;  1RBR A;  4DV0 K;  3E1Y A;  3T1H K;  3AA2 A;  5FPM A;  4BC3 A;  4GMJ B;  3G71 N;  3RMC A;  3CQY A;  4JKA A;  3AVI A;  5CYM A;  1NGF A;  5E26 A;  1WOQ A;  4IOC L;  4GY2 B;  1HNX K;  4JI1 K;  2XY8 A;  4BRI A;  3TSP A;  2QWN A;  4LD0 A;  4BDZ A;  3CPW M;  4FK0 A;  5GAE P;  4B9M A;  2RPI A;  4E3S A;  1TK5 A;  2OZS A;  2YJF A;  3AVM A;  1XI1 A;  2W40 A;  3AVG A;  3LDL A;  2ZF5 O;  2QW9 A;  3ZSW A;  4EZ9 A;  2ATQ A;  1W9H A;  4YOV A;  3JSM A;  3MCP A;  1QS4 A;  3VTI A;  3HTV A;  4MFB A;  4YFU A;  3ID6 A;  2ITG A;  5CZ2 A;  1T7P A;  2VG7 A;  4FJM A;  4Y0W A;  2CH6 A;  3H46 O;  1VHX A;  5FRN A;  1ESV A;  4BRC A;  4DB3 A;  4CHQ A;  3LDO A;  3VQC A;  4KHY A;  4CHZ A;  3OYD A;  4DSI A;  2RN2 A;  4X65 K;  3HPO A;  3O3F A;  5KGW A;  1S5J A;  3O80 A;  1JCE A;  1OH7 A;  2HF3 A;  2P1J A;  3CFR A;  4JD2 B;  4HUF A;  4MO4 A;  1HNV A;  2NRR A;  3EEQ A;  3LP1 A;  3OJS A;  4RW7 A;  1GLA G;  4JRQ A;  4ZTF A;  4DSK A;  4JAX A;  1EKE A;  1G15 A;  3VQB A;  4GV9 A;  3D2E B;  4K8X A;  2XY5 A;  1NKB A;  1KFD A;  4CEZ A;  3TAE A;  3D2F B;  4KHQ A;  3K5M A;  4KH4 A;  1VQ7 N;  1VQL N;  2YHX A;  4BRE A;  3H45 C;  3RSE B;  1CXQ A;  3DLL L;  3MN9 A;  2Q3S A;  4JI0 K;  4F3T A;  3GL1 A;  4H0X B;  5HOO A;  5B8H A;  4E89 A;  4DUZ K;  4B3S K;  2I7P A;  4W5R A;  1IG9 A;  3LP3 A;  4O4G A;  2F9T A;  2P9N B;  5ADX A;  3V1O A;  2HST A;  4FJX A;  4GKJ K;  5CHI A;  3NBP A;  2P5G A;  4CGJ A;  1WUA A;  4CCH A;  2EHG A;  5IWA K;  4DV2 K;  3KLH A;  1RTD A;  3PO4 A;  1VSE A;  4FPB A;  5AZI A;  3K2P A;  3LAM A;  4ILJ A;  2E1Z A;  1VRU A;  3MN7 A;  4FWQ A;  1VSF A;  1SS6 A;  1KTQ A;  4C1N K;  4DR5 K;  4FOE A;  5JIC A;  2E2Q A;  4M7Y A;  1Y97 A;  4DTX A;  3KKR A;  1QQN A;  4MQ3 A;  2A6A A;  4CJT A;  3KK2 A;  4EAH D;  3TAP A;  1D8Y A;  1UOC A;  2FBT A;  3VF2 A;  4JI8 K;  2O8F B;  3H1V X;  1YIJ N;  1S1V A;  2B4J A;  1HPZ A;  1YF5 L;  1VSK A;  3OVN A;  4CJV A;  2FLO A;  2O4I A;  4KHP K;  3A2F A;  4YOU A;  4DG1 A;  4M3Z A;  4WYB A;  2P9I A;  3V81 A;  1RT4 A;  1GLF O;  4JK7 A;  2YHA A;  4IZ9 A;  3W0L A;  1RBV A;  4CJ3 A;  3OYI A;  4BG9 A;  4LF6 K;  1HR0 K;  4F9O A;  3F73 A;  2GEM A;  4DQ8 A;  4DQI A;  1MWM A;  4DV6 K;  4H5V A;  3IS9 A;  2E8A A;  3CJ9 A;  3MXM A;  2GV9 A;  2A3Z A;  3ZT1 A;  3ZT2 A;  5KTQ A;  4I9Q A;  3CCJ N;  4IEE A;  3OS1 A;  1BIZ A;  1IBL K;  2YCH A;  1QQM A;  2E2P A;  1HNZ K;  5JMV A;  2VGM A;  4FJI A;  3BF3 A;  4DV7 K;  3VQ5 A;  2P9L A;  3LAL A;  1NK5 A;  3PIP L;  4JKB A;  1ZBS A;  1DEJ A;  2FC0 A;  3LWL A;  1KAX A;  3HT3 A;  1JLF A;  4NB4 A;  1NWK A;  3ATU A;  3PX4 A;  1Q81 O;  3D7E O;  5DK5 A;  3TSQ A;  4DU1 A;  3CD6 N;  3ZT0 A;  5J2Q A;  1WB9 A;  2V51 B;  1XHZ A;  4M41 A;  1GLJ O;  4DSE A;  1GLC G;  4JNE A;  3SQ1 A;  1BWF O;  3EKU A;  1S22 A;  4H8K A;  3O08 A;  4A59 A;  4JKC A;  1E4F T;  4YOY A;  3FFI A;  1BI4 A;  4EP4 A;  3G0Z A;  5C10 A;  4QS7 A;  4YNQ A;  4K0K K;  3AO3 A;  2V7Z A;  3P5J A;  3OYL A;  2ZQB A;  4KB0 A;  4IKF A;  2F96 A;  2BAN A;  3V9W A;  1TKX A;  1X9J A;  3DMJ A;  3RWU A;  1EET A;  1SZ2 A;  1VQ5 N;  4CJK A;  4Z4G A;  1RTJ A;  2E2O A;  3ZEU A;  3AO1 A;  3ZSR A;  1R0A A;  3CER A;  1X9W A;  3THX B;  1NK4 A;  4B8A B;  4FM1 A;  2YNF A;  4CHP A;  1JLA A;  1VRT A;  1J53 A;  1BQM A;  4KH5 A;  3EL2 A;  3NF6 A;  4CGH A;  2O8E A;  1D9F A;  3HBT A;  5GIP A;  1LCU A;  5ADX H;  4FL9 A;  5BPN A;  4F2R A;  5GAG P;  4CIG A;  4FO0 A;  3HJF A;  4M63 C;  4DFJ A;  4B1Y B;  4BRP A;  1ZYQ A;  1RDD A;  4FLW A;  3FZF A;  5FLX O;  2F7T A;  1IG8 A;  2G8K A;  2BUP A;  4E7I A;  3IKM A;  1U48 A;  1BCM A;  2QKK A;  1RDW X;  4B08 A;  3KLG A;  3SAG A;  4JYA K;  3T3F A;  1RCH A;  3SMP A;  4A5B A;  4IJN A;  3QB0 A;  1A5V A;  2AP1 A;  3AO5 A;  4AHS A;  4AIL C;  4H5N A;  1G99 A;  3AGK A;  3J8A A;  3DJC A;  5I9E B;  5IT9 O;  3I8B A;  1QHA A;  2ZGY A;  3S9H A;  3R3L A;  4BVP A;  4FJ5 A;  4JHD B;  4CEC A;  4FK4 A;  3H1Q A;  4EZ6 A;  1P90 A;  1HJO A;  1I94 K;  4XEI A;  3B6P A;  4FWL A;  1HKB A;  4IO9 L;  3NF9 A;  5AQY A;  3HPG A;  3WQU A;  3THW A;  2NRW A;  1J5O A;  3K59 A;  1T3V A;  4BE1 A;  2X6S A;  5D3G A;  3G4S N;  2DFE A;  4CHY A;  3U3Y A;  1HMV A;  4FLU A;  2E20 A;  3O9U A;  4X62 K;  4OPH A;  2IDO A;  1NGA A;  3S3O A;  4JEP A;  4L8R B;  2QWM A;  1HLU A;  1W97 L;  2O8B A;  3AA5 X;  4E7L A;  3LDP A;  1K9M O;  1T44 A;  4BG8 A;  4X66 K;  1TAU A;  1S9G A;  3OYB A;  3PO5 A;  3K5L A;  2GUI A;  3AY9 A;  1TL3 A;  5BN9 A;  3H6E A;  3MK6 A;  4O8K A;  4CFD A;  3MAQ A;  1HX1 A;  1TUU A;  2H3G X;  5AQH A;  2D0P A;  3OYG A;  1SL1 A;  2E6L A;  3MX5 A;  3ZSX A;  1NJI O;  4O5F A;  3L2W A;  4JK8 A;  3EZ5 A;  4RW6 A;  3CC4 N;  1KVC A;  3MN6 A;  4DV4 K;  3M3Z A;  3SQ4 A;  1LV5 A;  3S3N A;  1QZ6 A;  1WBB A;  4NLC A;  3FZH A;  3OYC A;  2JWK A;  3HSC A;  4O5B A;  5TKY A;  1RNH A;  4WFA L;  1NMD A;  4WQ4 C;  4LF9 K;  3QIC A;  4DV5 K;  1SUQ A;  3O9S A;  3NHG A;  2A40 A;  4IEI A;  3RMB A;  1YIT N;  2P9U A;  1K8K A;  3OTO K;  4BE0 A;  2CH5 A;  1YJN N;  4CGF A;  1B9D A;  4DSL A;  2A41 A;  5TKW A;  4HCB A;  1NGG A;  1HKC A;  3OBW A;  3HYF A;  4ZHR A;  5AQX A;  4FJ8 A;  4JV5 K;  1T6D A;  3HI0 A;  1U49 A;  4H0O A;  1FKP A;  3AAR A;  3K5N A;  2ASO A;  3M1F A;  4CZL A;  3A8Y A;  4NXN K;  3OS0 A;  3NH1 A;  2KLA A;  3SAF A;  3WXK A;  1Q7Y O;  1KAZ A;  3IRX A;  5AQP A;  4CIF A;  4LFC K;  3Q7C A;  3AVL A;  4BR2 A;  3AVJ A;  2Z1J A;  1NM1 A;  4CJ4 A;  2VG5 A;  2G8I A;  1KD1 O;  4FJL A;  3KD5 E;  1U47 A;  1HPM A;  3ZT3 A;  4ILG B;  4OKJ A;  3HP9 A;  1BQN A;  1TKZ A;  2Q31 A;  3NGY A;  4AM7 A;  5AQS A;  5CE3 A;  3UIQ A;  1Q8I A;  1HYV A;  5AQR A;  2QEX N;  3DYA A;  2ETJ A;  4DSJ A;  4JKG B;  3K58 A;  4A62 A;  2YHB A;  5C24 A;  3JYT A;  4KHS A;  3WXM B;  2HOE A;  4H0V B;  3O4Q A;  3CCU N;  3DAW A;  4CZK A;  3V9S A;  3THV A;  1XNQ K;  4YOR A;  3DXM B;  1VSM A;  3QER A;  4C1N I;  2OAN A;  1NJX A;  3M6G A;  3U9D A;  1GOB A;  1EQY A;  5EX5 A;  3CCS N;  5FPE A;  3PUF A;  4CBX A;  5CYQ A;  3HXM A;  3MX2 A;  3Q7B A;  4FWM A;  2J4R A;  1BA0 A;  4DR6 K;  3DLK A;  1XMO K;  1NGJ A;  1JLB A;  3MEG A;  4NCB A;  4DFM A;  4OX9 K;  4DLE A;  4BR4 A;  3GBT A;  2HMI A;  3SNN A;  4JI2 K;  3HP6 A;  3E01 A;  4GV6 A;  3QES A;  4CBU A;  2I5J A;  3IMX A;  2CGJ A;  3RVC A;  4FZZ A;  3ZX0 A;  1SKS A;  4MLH A;  5M1Q A;  3F5T A;  3MMV A;  3EZW A;  3ZX3 A;  2YI1 A;  3PY8 A;  4E1N A;  1S1W A;  4ELT A;  5SWM A;  2HMP A;  3WNF A;  3SUP A;  4FK2 A;  2I7N A;  3OY9 A;  1N8R O;  3TR8 A;  4KAZ A;  3SQ2 A;  3DRS A;  3WNH A;  4M7X A;  1W0H A;  1YJW N;  2OCE A;  1KVB A;  4HVJ A;  4CER A;  4OKE A;  1YT3 A;  2Q1N A;  4U7B A;  1NNE A;  2UYT A;  1RT1 A;  4HUE A;  3HVT A;  3VN5 A;  5GAH P;  3OYM A;  4E0D A;  4FOI A;  3RMA A;  1RTH A;  1WNS A;  3QIO A;  4B3T K;  1S6P A;  3TTC A;  5F1X A;  2YHY A;  3UKR B;  4RTF D;  4C23 A;  4IG0 A;  4FWS A;  1N34 K;  1NMN A;  4BR7 A;  3ASM A;  4BC2 A;  4CJP A;  5ELZ A;  1YTA A;  1BO5 O;  1NOZ A;  3ZSY A;  2ASM A;  1XUP O;  3MXJ A;  2F4V K;  4LF5 K;  5C25 A;  3C0B A;  5AQK A;  4BVO A;  2DFF A;  2X74 A;  3HRG A;  4DV1 K;  4IWV A;  4NXM K;  1EP4 A;  4BR5 A;  3HO1 A;  3FLC O;  4JKE A;  1C0G A;  5BR8 K;  2FBX A;  5JVH L;  4DSF A;  1VQM N;  1JL1 A;  4BRD A;  4K25 A;  1HKG A;  2D4W A;  1JL2 A;  5KI6 A;  4Y1C A;  5HRO A;  2CGL A;  1DLO A;  4BRK A;  4FJK A;  1TYQ B;  1MDU B;  1KLN A;  2PYJ A;  4M3W A;  3U3G A;  5GIO A;  3CCQ N;  4DTP A;  5CR4 A;  3CC7 N;  4ZTJ A;  4I6M A;  3CC2 N;  2XY6 A;  4WE1 A;  4BWM A;  2JLE A;  1NJY A;  3U6F A;  3FZK A;  2E4L A;  1OH8 A;  2A1S A;  3SZ2 A;  5J2P A;  4AHT A;  1EWR A;  4GW6 A;  3IG1 A;  1ZBL A;  3OA9 A;  1NGB A;  4DQP A;  1ASV A;  4FWR A;  3SV4 A;  1HJR A;  4FM0 A;  2JWL A;  3G25 A;  3V1R A;  3O1B A;  4C8M A;  5E84 A;  1L3T A;  3VEZ A;  4BRA A;  2XRI A;  5LMU K;  1JLQ A;  4IG3 A;  3ULE A;  2O8D B;  1IBM K;  2OTJ N;  4J2A A;  4Z4H A;  2B5J A;  2JGU A;  3RTV A;  4FJJ A;  1IJJ A;  4UY8 O;  2P9S B;  1X1P A;  2PAV A;  1GLE G;  3VQP A;  4E7H A;  1RDC A;  3BZC A;  4CW7 B;  3QEW A;  3THY B;  3MED A;  3ITH A;  1KC8 O;  3OYJ A;  2KKZ A;  4O55 A;  4RWT A;  4W5T A;  1JLE A;  4Z4C A;  5M1K A;  4FW1 A;  4E19 A;  2ZM6 K;  3P1G A;  4PY5 A;  3ENH A;  2HHS A;  3OJU A;  1NLV A;  3E66 A;  5K14 A;  4CJE A;  4BGB A;  4CD3 A;  2RKI A;  4XH1 A;  1S1U A;  1HUX A;  4BR0 A;  1CLQ A;  1ZBF A;  4LFA K;  1DT9 A;  3MXI A;  1HNW K;  1NGI A;  3LAN A;  4DQS A;  3DOL A;  1BU6 O;  3VEO A;  3CQ8 A;  2DTU A;  3EE8 A;  5EU7 A;  4B3M K;  1YVU A;  3SYZ A;  3PSI A;  1J9A A;  3KWI A;  4Y1D A;  3VF6 A;  2AJQ A;  3V9Z A;  4CZH A;  1KVA A;  1NG9 A;  4WQ5 C;  4OKK A;  4WFB L;  1V4T A;  4Z94 A;  4H03 B;  4DUY K;  2ITM A;  4HTL A;  5GAD P;  4IOA L;  2LSN A;  5AQN A;  3AAP A;  3H3N O;  1VK0 A;  1KXP A;  4BAC A;  2G8V A;  2P9K B;  3C7N B;  4DHY A;  4J2B A;  3FZM A;  4RG8 A;  3OYF A;  1VQN N;  4M45 A;  1S1X A;  4PL7 A;  5AJ3 K;  2A5X A;  4BRQ A;  4Z4E A;  4WQ4 A;  4A57 A;  1L3S A;  1BA1 A;  4C8K A;  2ZJR L;  3RRH A;  3IDH A;  3PX0 A;  4CGI A;  1LAV A;  3HST B;  4BRO A;  3SK3 A;  1YTU A;  3KJV A;  3F2K A;  3M8Q A;  1VAZ A;  3VQQ A;  5BRD A;  3SAH A;  2HNY A;  3L3V A;  1QVF M;  2RHK A;  2NRT A;  3VQ8 A;  3VGK A;  2ZGZ A;  3VOV A;  4BC4 A;  1Q9Y A;  2F8S A;  3M5R A;  4CF9 A;  4BWJ A;  3C6T A;  1QHT A;  4BQZ A;  3ENO A;  1W2B M;  2ZWH A;  4JLH A;  2FF3 B;  3SUN A;  4G1Q A;  4B9T A;  4DU4 A;  4DTN A;  3V9X A;  2YNG A;  2P5O A;  2VQF K;  4F8R A;  3KD1 E;  4H0Y B;  3P4I A;  3CF5 L;  3NGI A;  4Z4F A;  1OKJ A;  3OHR A;  3KTQ A;  2GWJ A;  1K6Y A;  4KHU A;  1A5W A;  1DKG D;  1IO2 A;  2IIR A;  4ISF A;  4JD2 A;  4FZX C;  5AQO A;  5C12 A;  5AZJ B;  1BL3 A;  2D5R A;  3DRR A;  1WLJ A;  1O13 A;  3O5B A;  4CF8 A;  4YY3 K;  3TWH A;  5DM6 L;  3R9P A;  4Z0U A;  2QWL A;  3TAB A;  1TUY A;  3MCA B;  2Q36 A;  1S72 N;  4W5Q A;  3KHY A;  3E9P A;  2B6A A;  3D2E A;  3QBW A;  4FW2 A;  3EE9 A;  5HBM A;  3FGU A;  4CZI A;  4DU3 A;  3CQX A;  3HK2 A;  3CI5 A;  3D2F A;  2IVP A;  1TL1 A;  3CHW A;  2IC3 A;  3WEE B;  3S3M A;  4K41 A;  3RSE A;  4CEE A;  4JI3 K;  1E4G T;  4ELV A;  4OGC A;  2O8C B;  3CJA A;  2ZJP L;  2P9N A;  3T1A A;  4CJL A;  4GVM A;  1CZA N;  5HRN A;  4DV3 K;  4CK2 A;  1BHL A;  4PQU A;  4M3U A;  5AQV A;  1LWF A;  4FVM A;  3VQ9 A;  3TAQ A;  3AGR A;  3DOK A;  4H4M A;  3ZSQ A;  3DXK B;  4PA1 A;  2OPP A;  4FCY A;  1S6Q A;  3JS6 A;  4FXD A;  5EXW A;  3QNO A;  2FBY A;  4FLX A;  3QNN A;  4OGE A;  1LAW A;  4CEA A;  1YUW A;  5KPZ A;  3SLC A;  4GVE A;  1KLM A;  1P8Z A;  4DKW A;  2O8F A;  4KTQ A;  2HHT A;  2V52 B;  1WSJ A;  3R6M A;  2QI2 A;  3V1Q A;  5T7B A;  4EHU A;  3O3H A;  3IUC A;  1NGC A;  4FSV A;  3KLF A;  1JJ2 M;  1VQP N;  3C65 A;  4BC5 A;  2FSK A;  4LSN A;  1VQ4 N;  4YDU A;  5CY4 A;  3HOT A;  3QFP A;  1QQO A;  4ELU A;  1U2V B;  1K73 O;  4B9L A;  1RGI A;  2OPR A;  3SV3 A;  4KTW A;  1FXX A;  2XHB A;  4J2D A;  3EY1 A;  2EX3 A;  3AVH A;  2D0B A;  4H0P A;  4MDA A;  3UKU B;  5HLF A;  4DCH A;  4J8F A;  2Q97 A;  3AA3 A;  1ITG A;  4H4O A;  1C6V A;  1XWL A;  1B92 A;  3F9M A;  4CEQ A;  4J2E A;  3ID8 A;  2GTD A;  5BR9 A;  3NH0 A;  1CZB A;  2OPS A;  3FZL A;  3N4Q A;  3PSF A;  4LSL A;  4OPJ A;  1TV6 A;  3CFP A;  4CZM A;  3DI6 A;  5C2D A;  4CZJ A;  1MWK A;  3MWT A;  5AR0 A;  3NAE A;  1VQ8 N;  4FZY A;  1QTM A;  3K0S A;  3WXI A;  1RIL A;  4KO0 A;  4I9L A;  3N4P A;  3W3D A;  3NF8 A;  5AQL A;  4NCA A;  4A2B A;  3VTH A;  3EO3 A;  1BOT O;  4KRF A;  3ALY A;  3BZK A;  4G9Z A;  1NOY A;  1L3V A;  3SBG A;  1S3X A;  3VEN A;  3ULD A;  1NK0 A;  3ZET B;  5LL6 Z;  4O44 A;  4ILH A;  5LJW A;  3KKS A;  3J7A P;  1QZ5 A;  1UA1 A;  1WAF A;  4Z4I A;  1VSD A;  4FVU A;  2HF4 A;  1M90 O;  4E7J A;  5FPN A;  3VGL A;  1FKO A;  1J6Z A;  3HM8 A;  5LY3 A;  3VPZ A;  1R59 O;  5GIN A;  2UXB K;  4AHC A;  5C0Y A;  1KAY A;  3SCX A;  3A5L C;  3K9J A;  5BRH A;  4B9N A;  4AHR A;  5AQF A;  2D0A A;  3BDP A;  1KSP A;  4HCC A;  1EX4 A;  4KRE A;  1GOA A;  3T1Y K;  4FJH A;  2QWO A;  3C6U A;  4OJR A;  2R7Y A;  3THX A;  4XH5 A;  4DR7 K;  4ISE A;  1UA0 A;  3SMS A;  1T03 A;  4KV8 A;  2KQ2 A;  3QML A;  2G8H A;  1N36 K;  2Y1J A;  1BCO A;  5AFU A;  3HZ6 A;  1SL0 A;  2UXC K;  3NF7 A;  4B1V A;  3C95 A;  3J7Y P;  3V9U A;  2YX6 A;  4KH6 A;  4FLZ A;  1VSH A;  3NVM A;  4XH4 A;  1VSJ A;  3H3O B;  2NRV A;  4LF4 K;  1NU0 A;  2P51 A;  4M3X A;  1LWC A;  4H5W A;  2YNI A;  1WSH A;  1ZXO A;  4MLE A;  4F4K A;  1U6Z A;  1IV0 A;  1GLD G;  4DFP A;  4CZF A;  1RBT A;  3FE1 A;  3KLI A;  3LPU A;  5BRE A;  1OH5 A;  3T19 A;  3QEI A;  1HYS A;  4B9S A;  4DR3 K;  3B8A X;  4B3R K;  2QWR A;  1EXQ A;  2GX9 A;  4CI6 A;  4M3R A;  3MN5 A;  5AQZ A;  2WFB A;  3MDQ A;  1XNR K;  3AAQ A;  4EHT A;  3L8B A;  3CJC A;  3OYE A;  2XO7 A;  1OH6 A;  5F2R A;  1WSI A;  4JHD A;  1DGK N;  1UAX A;  3WXJ A;  1XC9 A;  1ZBU A;  5M1F A;  4OPK A;  4KKO A;  2BGG A;  3TI0 A;  1HYZ A;  4CIE A;  4V19 S;  5KQD A;  2KZZ A;  4O0J A;  3AO2 A;  3ENB A;  3L2U A;  2VWK A;  2HW3 A;  4CBW A;  1N6Q A;  1NK8 A;  4BE2 A;  2FSJ A;  1RTI A;  3U9Z A;  2VWB A;  4JI4 K;  2YNH A;  3VA3 A;  4EIA A;  5BPL A;  5E41 A;  4FLY A;  1BIU A;  3IAY A;  3DLR A;  3JXU A;  2E5L K;  4WQ5 A;  1RDU A;  1KQS M;  1DTQ A;  3NMU A;  3TSU A;  1QSL A;  1Q9X A;  1B9F A;  3NE6 A;  4DWI A;  4YDU C;  2UXD K;  4DR4 K;  1SKR A;  4CJR A;  2QXF A;  1JCG A;  1U04 A;  1ASW A;  1RT3 A;  1WN7 A;  2FXU A;  4B1U B;  3VEY A;  5LJV A;  4DF8 A;  1XMQ K;  4UQG A;  1LOT B;  4OO1 J;  1IKY A;  4B9U A;  1LW0 A;  5MLC Q;  4NLB A;  3QFU A;  4CHN A;  4K42 A;  2VCP A;  5LMN K;  1TK0 A;  4AQY K;  1Z25 A;  1RT6 A;  4I2Q A;  4LFB K;  2EWS A;  3NGZ A;  4AH9 A;  1J54 A;  2WC9 A;  5CZ1 A;  4CJS A;  5AQU A;  2F8T A;  4CD1 A;  3OS2 A;  4JI6 K;  2AA4 A;  1SQK A;  4B8C A;  3VF4 A;  1RBS A;  2Q0R A;  4N47 A;  4BRM A;  3K57 A;  3VEW A;  1C0T A;  1WSF A;  5JS2 A;  4CF1 A;  3LP2 A;  5AZI B;  5M1O A;  3CCL N;  4OLB A;  4CJW A;  3L4Q A;  2KFN A;  1YVN A;  2GEL A;  5AQJ A;  3VQ4 A;  3U8X A;  2D0C A;  4NYF A;  3P38 A;  3I55 N;  1HNI A;  4DTU A;  5EVZ A;  3UB5 A;  1ASU A;  4DQQ A;  2O4G A;  5AFU H;  2FF6 A;  4JI7 K;  2CGK A;  4AF1 A;  3P39 A;  4E1M A;  2HBM A;  1D9D A;  1X3N A;  1BGX T;  3KK1 A;  1NK9 A;  1IKV A;  1T05 A;  4EFH A;  4BR9 A;  4KTZ A;  2KTQ A;  4ICL A;  2IS3 A;  2WBN A;  3KZB A;  2P9I B;  4ISG A;  3UE5 A;  3ATV A;  4L3Q A;  3TAR A;  2DY4 A;  3HPH A;  1SL2 A;  5BN8 A;  1SV5 A;  4E7K A;  2BDP A;  4KI4 A;  2D1K A;  1LW2 A;  4N41 A;  1YHQ N;  4F2S A;  2YHW A;  1U45 A;  3I33 A;  4JKG A;  3WUH A;  4PHT X;  2HHW A;  3A0I X;  4I7F A;  4A2A A;  3KLE A;  3BP8 A;  4QCL A;  3LPT A;  3DXM A;  3BEX A;  1ATS A;  1E3M A;  2P9L B;  2G8W A;  2UUA K;  1I39 A;  1IKW A;  1XQS C;  3NVK A;  1YJ9 N;  4FJ9 A;  4JK9 A;  4CK3 A;  4CZG A;  5AQQ A;  4DQR A;  5AQW A;  1WAJ A;  3QIN A;  4HTU A;  1X9S A;  3CJ7 A;  3TAG A;  2PYL A;  1BI4 B;  3DLE A;  2FSN A;  3OBY A;  5J2M A;  4HHT A;  1RT7 A;  4CEB A;  1NGH A;  3O6W A;  1C1B A;  3VMF B;  5J1E A;  5I3U A;  2HHU A;  1W7A A;  3PLA A;  3SJJ A;  2A1R A;  1ZBI A;  4B9V A;  3KIO A;  1IBK K;  3C6H A;  1QVG M;  1I3A A;  2E2N A;  3ZEU B;  4NCG A;  1GOC A;  5C2F A;  3MWP A;  4DFK A;  4H5R A;  4B9Q A;  3VQA A;  4BRG A;  3SQ0 A;  3M8S A;  4BGA A;  2PFU A;  1T6C A;  1Q82 O;  3NCI A;  1JLC A;  3ZT4 A;  4AM6 A;  5BRF A;  3J81 O;  1WSE A;  4CJ5 A;  2O8E B;  3RRG A;  2NRZ A;  3LL3 A;  4PKG A;  3NFA A;  5HRS A;  1WSG A;  5JLF A;  1ZC6 A;  3DRP A;  5FRO A;  4BRF A;  1RT2 A;  1QQC A;  4AHV A;  3L2Q A;  3LDQ A;  4B3O A;  3NH2 A;  2HB5 A;  2UU9 K;  4BDP A;  5FPD A;  1OVQ A;  3FR0 A;  2A42 A;  5JVG L;  3UKR A;  4LH5 A;  2IVN A;  2ZE2 A;  3PX6 A;  3RMD A;  3PV8 A;  4FYD A;  4CJF A;  3OYN A;  2E88 A;  4FWN A;  1HQE A;  4E1J A;  1OVY A;  1Z6R A;  1A5X A;  4JKD A;  5J2N A;  1N5Y A;  3VET A;  3CCV N;  4JS4 A;  3L2R A;  1QSS A;  2HVI A;  1NBW A;  3RR8 A;  4LF7 K;  3QIP A;  4BY9 C;  5KPR A;  2Q0U A;  3EN9 A;  2HHV A;  3E9L A;  3MEC A;  4MDB A;  4QS9 A;  3J80 O;  3GE1 A;  4FWP A;  4CF0 A;  3THW B;  3F9K A;  1TKT A;  1SAZ A;  2FBV A;  1TAQ A;  1BUP A;  1TYQ A;  4OPA A;  2VG6 A;  3ZSV A;  3DLG A;  3EYZ A;  2QTD A;  3H08 A;  3LZJ A;  3K5O A;  3C94 A;  3KK3 A;  5C42 A;  4BDY A;  4M3Y A;  3ZYY X;  3P83 D;  3CM5 A;  2O8B B;  5M1P A;  3O1W A;  3CG7 A;  4R5P A;  1MA9 B;  1Y64 A;  3O3G A;  4HUG A;  1YI2 N;  3CFO A;  1RDB A;  2IVO A;  2KHO A;  4BQL A;  5JS1 A;  3R1X A;  4ID1 A;  4IFY A;  4Q0B A;  2BTF A;  3CJB A;  1BDG A;  4GNI A;  2RF2 A;  4CZE A;  2RE2 A;  2E1Y A;  2P9P B;  1V4S A;  2O8D A;  4FJN A;  3CIP A;  1EWQ A;  3CCR N;  1JLG A;  2P9S A;  2NUB A;  1KFS A;  4GKK K;  2GWK A;  4LF8 K;  3THY A;  3AVA A;  4JN4 A;  4K43 A;  3SBT A;  3VQ6 A;  3AVC A;  4R79 A;  1T8E A;  3VQE A;  3L4I A;  2W6K A;  3OYA A;  4BRH A;  3T7Z A;  2VQE K;  4IBN A;  3B6O A;  4HWI A;  3U4L A;  4OVL A;  2DFH A;  1N32 K;  5AQI A;  3HVR A;  2G8F A;  2P9U B;  1K8K B;  5H1S Q;  5HL7 L;  2F9W A;  1NGE A;  1KCF A;  4CVN E;  1S9E A;  4IDH A;  3SPY A;  3IFR A;  4PWD A;  2HHQ A;  3VQ7 A;  2HND A;  3DM2 A;  2OA8 A;  3VGM A;  1NKC A;  3GDQ A;  1FW6 A;  5C15 A;  2GUP A;  1YXQ A;  4N5S A;  1QE1 A;  5HRR A;  2NZT A;  1VSI A;  4NO7 A;  4CES A;  2HHH K;  3OYK A;  3TPQ A;  2OYQ A;  4DF4 A;  4CGG A;  1N33 K;  4KFB A;  1C0M A;  4DR1 K;  4CEF A;  3QLH A;  4N56 A;  3SPZ A;  1FK9 A;  1NJZ A;  1SKW A;  3BY5 A;  3C6A A;  1C0F A;  1Q86 O;  2QKB A;  1KRP A;  2P9K A;  4FLV A;  2Q2R A;  3C7N A;  4DS4 A;  4FLT A;  4CFC A;  4DTR A;  1CZ9 A;  2QA4 N;  1NK6 A;  1VSL A;  5BPM A;  1HQU A;  2Y1I A;  3ZSO A;  3I8D A;  2KFZ A;  3QDK A;  4AHU A;  3LZI A;  3AO4 A;  3QBX A;  3VES A;  3NDK A;  4KI6 A;  4LY7 A;  4CK1 A;  3GOI A;  2XY7 A;  3GG4 A;  2W6L A;  3ZLJ A;  4IFE A;  2Z1G A;  1D4X A;  4QS8 A;  3AVN A;  3LM9 A;  3VEX A;  1Q18 A;  5AQM A;  4LC9 B;  4CJQ A;  4DLG A;  5FRM A;  2W41 A;  2HBK A;  4CHO A;  2PBD A;  4I2P A;  4A5A A;  4DTM A;  3TAM A;  1Z05 A; 
#chains in the Genus database with same CATH homology
 4I6M A;  5JMV A;  3CC2 N;  2VGM A;  3A5O C;  3BF3 A;  4CBW A;  2P9L A;  3FZK A;  3O9R A;  3CET A;  4B1W B;  3PIP L;  2FSJ A;  4JKB A;  1ZBS A;  1DEJ A;  1XC3 A;  5F0X A;  1KAX A;  3U9Z A;  2VWB A;  3OA9 A;  1NGB A;  4NB4 A;  3CJ1 A;  1NWK A;  4FWR A;  2V7Y A;  3ATU A;  4EIA A;  5BPL A;  2JWL A;  1Q81 O;  3D7E O;  1BG3 A;  3TSQ A;  3G25 A;  3JXU A;  4BRN A;  3O1B A;  3HOS A;  3CD6 N;  5E84 A;  4WQ5 A;  1RDU A;  3VEZ A;  4U67 L;  1KQS M;  4BRA A;  5M1N A;  3KK7 A;  5EOY A;  3CXC M;  4JKF A;  4RCH A;  3NMU A;  3TSU A;  3ULE A;  2OTJ N;  2V51 B;  3P31 A;  3WXL A;  1GLJ O;  4UY8 O;  1IJJ A;  1GLC G;  2P9S B;  4O8U A;  3CME N;  2PAV A;  4JNE A;  1GLE G;  1BWF O;  3BF1 A;  3EKU A;  4YOX A;  2HBJ A;  1S22 A;  4MO5 A;  3O08 A;  4FWO A;  4JKC A;  4YDU C;  4A59 A;  5AZJ A;  1M1K O;  1E4F T;  4IXC A;  4YOY A;  2P9P A;  1JCG A;  1KC8 O;  2YJE A;  4IOX A;  5C10 A;  2KKZ A;  4RWT A;  4QS7 A;  2FXU A;  4B1U B;  5AQT A;  5M1K A;  3VEY A;  5LJV A;  1EO1 A;  1LOT B;  4OO1 J;  2DPN A;  5MLC Q;  4NLB A;  3QFU A;  2V7Z A;  3ENH A;  4K42 A;  2VCP A;  3ZX2 A;  3WQT A;  1NLV A;  1X9J A;  4PKH A;  3E66 A;  3WEE A;  2EWS A;  1ATN A;  3K9K A;  2D0O A;  1SZ2 A;  4YOW A;  1VQ5 N;  4BGB A;  2WC9 A;  2QXL A;  3S41 A;  4CD3 A;  4XH1 A;  2QWP A;  2E2O A;  3ZEU A;  3VEV A;  1HUX A;  3O9Q A;  4BR0 A;  4H0T B;  5AQU A;  1H1V A;  1DT9 A;  4CD1 A;  2HBL A;  3CER A;  1NGI A;  1BU6 O;  3VEO A;  2AA4 A;  1SQK A;  3VF4 A;  3EE8 A;  2Q0R A;  4BRM A;  2QM1 A;  3VEW A;  3SJH A;  4KH5 A;  5DM7 L;  3EL2 A;  3OW2 M;  5M1O A;  5AZI B;  3CCL N;  3TU5 A;  3KWG A;  3HBT A;  3KWI A;  5GIP A;  1LCU A;  5ADX H;  3L4Q A;  4FL9 A;  4PKI A;  3VF6 A;  5BPN A;  3A5M C;  5GAG P;  1YVN A;  1JCF A;  2GEL A;  2VYP A;  4FO0 A;  4M63 C;  5AQJ A;  3U8X A;  4CZH A;  3P38 A;  4WQ5 C;  4B1Y B;  3I55 N;  3LM2 A;  5KQ8 A;  5EVZ A;  4WFB L;  4BRP A;  3G6E N;  3DXK A;  1V4T A;  3UB5 A;  4Z94 A;  4H03 B;  2ITM A;  3I56 N;  1ILY A;  3FZF A;  4HTL A;  2F7T A;  5GAD P;  4IOA L;  1IG8 A;  5AFU H;  2BUP A;  2FF6 A;  5AQN A;  2CGK A;  3IKM A;  3AAP A;  2NRX A;  3H3N O;  4AF1 A;  1VQO N;  1RDW X;  3P39 A;  1KXP A;  2HBM A;  3SAG A;  1X3N A;  3SMP A;  3TTD A;  4A5B A;  4IJN A;  2P9K B;  3QB0 A;  5EY4 A;  4EFH A;  2AP1 A;  4BR9 A;  3C7N B;  4IO8 A;  3E9O A;  4DHY A;  2QWQ A;  1G99 A;  4H5N A;  2WBN A;  3AGK A;  3KZB A;  2P9I B;  3J8A A;  3DJC A;  4KBO A;  5I9E B;  3I8B A;  1QHA A;  3FZM A;  2ZGY A;  4ISG A;  3UE5 A;  3R3L A;  4BVP A;  1VQN N;  4JHD B;  3ATV A;  3H1Q A;  1P90 A;  1HJO A;  4L3Q A;  1U2V A;  4PL7 A;  3FFK B;  4A61 A;  4GV3 A;  5BN8 A;  1ATR A;  4JKH A;  4H5T A;  2A5X A;  4XEI A;  4BRQ A;  4FWL A;  2D1K A;  1HKB A;  4WQ4 A;  4IO9 L;  2VGN A;  4A57 A;  1VQ9 N;  1BA1 A;  5AQY A;  1YHQ N;  2YHW A;  2ZJR L;  3IDH A;  3I33 A;  4JKG A;  3WQU A;  3WUH A;  4PHT X;  3UKU A;  2NRW A;  3A0I X;  4BRO A;  1T3V A;  3SK3 A;  3F2K A;  4FWK A;  1VAZ A;  4A2A A;  5BRD A;  3SAH A;  3CMA N;  5KPT A;  3BP8 A;  3G4S N;  4B1Z A;  4I6M B;  1QVF M;  2RHK A;  2NRT A;  3DXM A;  3VGK A;  2ZGZ A;  1ATS A;  3BEX A;  3VOV A;  2P9L B;  4BC4 A;  2E20 A;  3O9U A;  3M5R A;  3CCE N;  1GLL O;  4OPH A;  3WT0 A;  4BQZ A;  1NGA A;  1XQS C;  4JEP A;  3ENO A;  4WFN L;  3CPE A;  1W2B M;  2NNW A;  1HLU A;  1W97 L;  2QWM A;  2WUS A;  2ZWH A;  3LDP A;  3NVK A;  1K9M O;  2FF3 B;  1T44 A;  4BG8 A;  1YJ9 N;  4JK9 A;  4CZG A;  5AQQ A;  3AY9 A;  5BN9 A;  4H0Y B;  5AQW A;  3P4I A;  3CF5 L;  2NLX A;  3H6E A;  1OKJ A;  3OHR A;  2GWJ A;  3ULE B;  3MK6 A;  4O8K A;  1VQK N;  1DKG D;  2OTL N;  1HX1 A;  3O4W A;  2IIR A;  4ISF A;  4JD2 A;  1TUU A;  5AQO A;  5C12 A;  5AZJ B;  3ZET A;  2H3G X;  5AQH A;  2D0P A;  3CJ7 A;  3O9T A;  2FSN A;  3MX5 A;  1O13 A;  1X3M A;  3O5B A;  3PIO L;  1NJI O;  5DM6 L;  4O5F A;  2NRH A;  3OBY A;  4JK8 A;  3R9P A;  4WCE L;  2QWL A;  1NGH A;  3O6W A;  1TUY A;  3CC4 N;  3MN6 A;  3MCA B;  3M3Z A;  1K8A O;  2Q36 A;  1GLB G;  1S72 N;  3CCM N;  3T69 A;  3VMF B;  3LDN A;  3KHY A;  3E9P A;  3D2E A;  3QBW A;  1QZ6 A;  3EE9 A;  4CZI A;  3FGU A;  3PLA A;  3CQX A;  4NLC A;  3FZH A;  3CI5 A;  2JWK A;  3HSC A;  3D2F A;  2IVP A;  3ENB A;  3CHW A;  5TKY A;  4YOT A;  4WFA L;  4CJ7 A;  3WEE B;  1NMD A;  4K41 A;  4WQ4 C;  3RSE A;  3QIC A;  3C6H A;  1QVG M;  1E4G T;  2E2N A;  3O9S A;  3ZEU B;  1YAG A;  4IJA A;  2A40 A;  4B1X B;  4IEI A;  2BH1 A;  2ASP A;  5C2F A;  3MWP A;  1YIT N;  2P9U A;  1K8K A;  4H5R A;  4B9Q A;  3CJA A;  4FPA A;  2CH5 A;  2P9N A;  4BRG A;  2ZJP L;  1YJN N;  4BGA A;  2PFU A;  3DWL A;  4WF9 L;  1T6C A;  1Q82 O;  1CZA N;  4BRL A;  4AM6 A;  5BRF A;  1NGD A;  3A5N C;  2A41 A;  3EKS A;  5TKW A;  1NGG A;  1HKC A;  3OBW A;  5AQG A;  3TTF A;  2NRZ A;  3LL3 A;  4PKG A;  3BUZ B;  5AQX A;  1T6D A;  3HI0 A;  5AQV A;  5JLF A;  1ZC6 A;  4H0O A;  3L6Q A;  3R8E A;  3J7Z O;  4BRF A;  1RFQ A;  3AGR A;  3O8M A;  3VER A;  3AAR A;  2ASO A;  3DXK B;  3M1F A;  3LDQ A;  4CZL A;  5JLH A;  3A8Y A;  3JS6 A;  5FPD A;  5EXW A;  3FR0 A;  2A42 A;  4PL8 A;  5JVG L;  3D6R A;  3KVG A;  3L0Q A;  3UKR A;  2IVN A;  2KLA A;  3E1Y A;  5KPZ A;  1YUW A;  3SLC A;  4GVE A;  3SAF A;  1P8Z A;  3WXK A;  1Q7Y O;  5FPM A;  4DKW A;  1KAZ A;  2E88 A;  4BC3 A;  5AQP A;  4FWN A;  3G71 N;  4E1J A;  3CQY A;  1OVY A;  3Q7C A;  4JKA A;  1Z6R A;  2V52 B;  4BR2 A;  4JKD A;  1NGF A;  1NM1 A;  3R6M A;  2QI2 A;  5E26 A;  3VET A;  1WOQ A;  4IOC L;  4GY2 B;  3CCV N;  4EHU A;  1KD1 O;  3IUC A;  1NGC A;  1NBW A;  4FSV A;  4BRI A;  1HPM A;  3TSP A;  1JJ2 M;  2QWN A;  1VQP N;  4BY9 C;  3C65 A;  4ILG B;  4BC5 A;  2FSK A;  5KPR A;  3CPW M;  1VQ4 N;  4YDU A;  5GAE P;  3HOT A;  3QFP A;  1QQO A;  1U2V B;  2Q31 A;  2Q0U A;  1K73 O;  3EN9 A;  3E9L A;  2YJF A;  1RGI A;  4AM7 A;  4MDB A;  4QS9 A;  5AQS A;  2W40 A;  5CE3 A;  3LDL A;  5AQR A;  2ZF5 O;  3GE1 A;  2QW9 A;  2QEX N;  4FWP A;  4JKG B;  4MDA A;  4H0P A;  4A62 A;  3UKU B;  4YOV A;  4DCH A;  3MCP A;  1SAZ A;  3WXM B;  2HOE A;  4H0V B;  4J8F A;  3CCU N;  2Q97 A;  3VTI A;  3DAW A;  1BUP A;  3HTV A;  4CZK A;  1TYQ A;  4OPA A;  3ID6 A;  3F9M A;  4YOR A;  3ID8 A;  2GTD A;  5BR9 A;  3DXM B;  3FZL A;  3N4Q A;  4Y0W A;  2CH6 A;  2QTD A;  4C1N I;  3H46 O;  1ESV A;  2OAN A;  4BRC A;  3M6G A;  3U9D A;  1EQY A;  5EX5 A;  3CCS N;  4CZM A;  5FPE A;  3ZYY X;  4DB3 A;  4CZJ A;  5C2D A;  4CBX A;  3LDO A;  5M1P A;  1MWK A;  3MWT A;  3O1W A;  5AR0 A;  1MA9 B;  1Y64 A;  1VQ8 N;  3MX2 A;  3Q7B A;  4FWM A;  3WXI A;  1YI2 N;  2J4R A;  1BA0 A;  2IVO A;  3N4P A;  3W3D A;  2KHO A;  5AQL A;  4BQL A;  4A2B A;  3VTH A;  3EO3 A;  1BOT O;  3O80 A;  3R1X A;  1JCE A;  1NGJ A;  4G9Z A;  2BTF A;  3CJB A;  3SBG A;  2HF3 A;  1BDG A;  1S3X A;  4BR4 A;  4GNI A;  4CZE A;  2RE2 A;  2E1Y A;  2P9P B;  1V4S A;  3GBT A;  4JD2 B;  3VEN A;  4MO4 A;  3CIP A;  3ZET B;  2NRR A;  3CCR N;  4GV6 A;  4ILH A;  2P9S A;  5LJW A;  1QZ5 A;  1GLA G;  4CBU A;  2GWK A;  4FVU A;  2HF4 A;  3IMX A;  2CGJ A;  3RVC A;  1M90 O;  5FPN A;  4JAX A;  4JN4 A;  3VGL A;  4K43 A;  3SBT A;  3ZX0 A;  4GV9 A;  4MLH A;  3D2E B;  4R79 A;  1J6Z A;  3HM8 A;  5LY3 A;  3VPZ A;  3L4I A;  5M1Q A;  1R59 O;  3F5T A;  5GIN A;  3MMV A;  3D2F B;  3EZW A;  3ZX3 A;  5C0Y A;  2YI1 A;  4KH4 A;  1VQ7 N;  1VQL N;  1KAY A;  2YHX A;  4BRE A;  3H45 C;  3RSE B;  2HMP A;  4BRH A;  3A5L C;  3T7Z A;  3DLL L;  3MN9 A;  4HWI A;  3GL1 A;  4H0X B;  5HOO A;  3K9J A;  3U4L A;  2I7N A;  5BRH A;  5B8H A;  1N8R O;  5AQF A;  5AQI A;  2I7P A;  2P9U B;  1K8K B;  5H1S Q;  5HL7 L;  4M7X A;  1YJW N;  2ZJQ L;  2F9T A;  2F9W A;  1NGE A;  2P9N B;  5ADX A;  2HST A;  2QWO A;  4IDH A;  3IFR A;  2Q1N A;  4XH5 A;  5CHI A;  4U7B A;  4ISE A;  3VGM A;  1WUA A;  3GDQ A;  5C15 A;  2UYT A;  2GUP A;  3SMS A;  1YXQ A;  3QML A;  5AFU A;  2NZT A;  4FPB A;  3HZ6 A;  5AZI A;  4ILJ A;  4NO7 A;  5GAH P;  2E1Z A;  4B1V A;  3MN7 A;  4FWQ A;  4FOI A;  2YX6 A;  3TPQ A;  4KH6 A;  1SS6 A;  3NVM A;  4XH4 A;  4C1N K;  3TTC A;  4FOE A;  5F1X A;  5JIC A;  2E2Q A;  3H3O B;  4M7Y A;  2YHY A;  2NRV A;  1QQN A;  2A6A A;  3UKR B;  4RTF D;  4H5W A;  4EAH D;  4C23 A;  4FWS A;  3VF2 A;  3H1V X;  4BR7 A;  1ZXO A;  4MLE A;  4BC2 A;  3C6A A;  1U6Z A;  5ELZ A;  1C0F A;  1GLD G;  1Q86 O;  4CZF A;  1VQ6 N;  1YIJ N;  1BO5 O;  2ASM A;  3FE1 A;  1XUP O;  2P9K A;  5BRE A;  1YF5 L;  2Q2R A;  3C7N A;  3C0B A;  3B8A X;  5AQK A;  4BVO A;  2FLO A;  2QWR A;  4YOU A;  2GX9 A;  4WYB A;  4CI6 A;  3HRG A;  3MN5 A;  2P9I A;  5AQZ A;  2WFB A;  4IWV A;  5BPM A;  2QA4 N;  3MDQ A;  4BR5 A;  1GLF O;  4JK7 A;  4IZ9 A;  3AAQ A;  3W0L A;  3FLC O;  4JKE A;  4EHT A;  3CJC A;  5F2R A;  4BG9 A;  1C0G A;  1DGK N;  4JHD A;  4F9O A;  3WXJ A;  3QDK A;  5JVH L;  1VQM N;  5M1F A;  2GEM A;  3QBX A;  3VES A;  4DQ8 A;  4BRD A;  3GOI A;  4K25 A;  1HKG A;  3GG4 A;  1MWM A;  2D4W A;  4IFE A;  4H5V A;  2E8A A;  3CJ9 A;  1D4X A;  4QS8 A;  2A3Z A;  2CGL A;  3LM9 A;  3VEX A;  1Q18 A;  5AQM A;  4LC9 B;  4BRK A;  3CCJ N;  1TYQ B;  1MDU B;  4IEE A;  2W41 A;  2HBK A;  2YCH A;  5KQD A;  2PBD A;  5GIO A;  4A5A A;  3CCQ N;  5CR4 A;  3CC7 N;  1QQM A;  1Z05 A;  2E2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...