3L4QA

Structural insights into phosphoinositide 3-kinase activation by the influenza a virus ns1 protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
b'SVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural insights into phosphoinositide 3-kinase activation by the influenza A virus NS1 protein
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/protein binding
total genus 31
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3l4qA00
2RHKA 3D6RA 3M5RA 3KWGA 3O9UA 3P31A 2GX9A 3O9QA 2KKZA 3L4QA 3EE9A 3F5TA 3P39A 3O9TA 3O9SA 4OPHA 3RVCA 3EE8A 3KWIA 3P38A 3OA9A 3O9RA 4OPAA
chains in the Genus database with same CATH superfamily
5BR9A 5H1SQ 2P9PB 1NGBA 4DSEA 4C8MA 1YTUA 3QLHA 3E1YA 1KTQA 1FJGK 2DPNA 5ADXH 2VCPA 4FL9A 1ZBIA 4JNEA 4A62A 4CJTA 1IG8A 1G15A 5GIPA 3DLGA 3ZEUB 1KLMA 5BPNA 3CJCA 4Z4IA 5AQQA 2HF4A 3U9ZA 3M8QA 1LOTB 1JXEA 2HHXA 4FOIA 4KBOA 2GTDA 5BRDA 1K8KB 4WQ5A 4DG1A 1NKBA 3MN9A 3EKUA 5EVZA 3QEVA 2HW3A 4CEEA 1J5OA 2OZSA 5E41A 4FZXC 1ATRA 2NRXA 4L3QA 4GVMA 1EXQA 3G25A 1ASVA 5LL6Z 3G10A 4EP4A 3L2RA 1W97L 4ILGB 4NCBA 4I7FA 3VQ9A 4H4OA 1QE1A 4JKHA 4FJNA 4CZKA 4Z4CA 4ID5A 4KTQA 1NJZA 1E4GT 3CCRN 4RTFD 2FXUA 2QWQA 2B6AA 4FPBA 4AHVA 1TKXA 3LP3A 4Z4HA 3PO5A 3HVTA 3VEXA 4YOWA 4EFHA 1YHQN 1GLBG 4M42A 4FSVA 5CHIA 4JRQA 1NJXA 2CH6A 1JCEA 3AVAA 3L0QA 1JL2A 2R7YA 2E2QA 4BRFA 3DWLA 4Z4EA 1NK9A 3QEWA 1N5YA 1BDGA 4B3MK 2A1RA 2UUAK 5JVHL 4OLAA 3SAFA 2OPSA 1TYQA 4B8CA 3OYDA 3AA3A 4CZGA 4BRPA 3BY5A 4CD1A 1HJRA 4ZHRA 1S9GA 4I2PA 3RRHA 3CERA 3ITHA 3ULEB 4YOVA 2HHTA 2OPQA 2QWNA 3AO2A 5AQWA 2P9NB 4XH1A 4IG3A 2B5JA 3IDHA 3KK1A 3TR8A 2HB5A 1LW0A 4KRFA 4LFAK 4GKJK 4DTPA 1S1TA 3PY8A 4M7XA 3C6TA 1SV5A 2HHHK 1ZBUA 4BQLA 1Q7YO 2Y1JA 4GKKK 2EX3A 5TKWA 5BR8K 1RBUA 3H1QA 4BWJA 1BUPA 4JLHA 4IFYA 4MFBA 4DV3K 1NG9A 3UIQA 2KZZA 1CLQA 2FC0A 1LWFA 3PIOL 1HRHA 4HTUA 3G0ZA 3V9SA 4DSKA 3UB5A 4FYDA 3RTVA 1X3MA 2GX9A 1X9MA 4I6MB 4BRAA 4Y1CA 2RN2A 3OYNA 4Z4GA 2CGLA 2Q3SA 5J2QA 2VGMA 3DAWA 3WXLA 4CF1A 4A2AA 2ZQBA 3SZ2A 4BVOA 3UKRA 2YV0X 3ZT1A 3CC4N 1ITGA 5BRFA 5KRSA 4H5VA 4FJHA 3KIOA 4CIFA 4DKWA 4E1MA 5GINA 2FBTA 2NRTA 5AZIB 2WTUA 3H6EA 1EO1A 2Q0RA 4YDUA 2YCHA 4W5RA 3LM9A 4KTZA 2FBYA 4BRQA 1NGDA 3A8YA 1T05A 3LAMA 2XO7A 2OPRA 4DV1K 1KAYA 3QICA 3ZSYA 4CBXA 2UYTA 1NK0A 3WXKA 2QKBA 4DFPA 3A5NC 4KH5A 1I3AA 1MWKA 4F3OA 1L3SA 3E9LA 3PUFA 4DFMA 4CGGA 4CD3A 4RW7A 2OCEA 5BRHA 3L3UA 3DRRA 1ESVA 2DFEA 3DLKA 3HTVA 5LJVA 4DR5K 1NM1A 3I8BA 4CJEA 2BTFA 5AQNA 4LFBK 2E2OA 3AVIA 4B3OA 1A5XA 3NF6A 1A5WA 4E7HA 2PBDA 2HBJA 1P90A 3KLFA 3KLIA 3MECA 3CCVN 3LP0A 3SMPA 4PKGA 4DSFA 3V9XA 3SUPA 2IDOA 1EX4A 4KB0A 1J6ZA 3QFUA 1GOCA 4CZEA 2QWMA 4QCLA 4BG9A 4DTXA 2FSKA 2A5XA 4BACA 4FWMA 1ZYQA 3QBWA 4BY9C 2YHWA 2O8CA 5M1KA 3VENA 4B3TK 1B92A 5M1NA 2RHKA 4FWLA 4CW7B 2YNHA 4IEEA 4JKBA 1RCHA 4F2SA 1YIJN 1RDCA 1BOTO 3K5MA 3BZKA 4JI7K 4CF8A 2I7NA 2B4JA 3M8SA 2IIRA 3IUCA 3MCPA 2W6KA 1BIZA 1VSJA 5FRNA 3ZSWA 4DQ8A 2UUCK 3K5LA 4YOXA 2BH1A 1VAZA 2UXCK 4LC9B 2FSJA 2NUBA 2X78A 2Y1IA 3FGUA 1HKBA 4WFAL 4H4MA 4BREA 3R1XA 3LPUA 4GNIA 3DMJA 1KSPA 1OH5A 2P5OA 1IV0A 1TUYA 3ZSRA 4OX9K 2DTUA 3FZHA 4B3SK 4GV6A 3BDPA 5AQLA 1Q82O 2VGNA 1RT1A 2IVNA 1DKGD 4PL8A 3KTQA 3MEGA 3AVGA 3TTFA 4CF0A 3QINA 4FXDA 3J8AA 4X64K 3CM5A 1HJOA 3KJVA 3I8DA 3HJFA 3EEQA 1TKTA 2KLAA 2D0OA 2QKKA 1T44A 3WQUA 3O6WA 2VG6A 2E2NA 1DT9A 4CVNE 1L5UA 2YJFA 1GOAA 1C0FA 3LDPA 2HNYA 2RE2A 3C7NB 4K25A 2VWBA 3C94A 3G71N 2P9LA 1XHZA 3NFAA 5AZJA 4DV2K 3SJJA 4CEOA 4B1WB 1YXQA 5F1XA 3L6QA 3VTIA 1GLAG 3HL8A 4FM1A 5TKYA 1ZBLA 4HHTA 3QEIA 3OS0A 4CBWA 4RG8A 4DUZK 3FZKA 1HQEA 3ALYA 3QEPA 5LMUK 1VQKN 2BGGA 2O8BB 2GELA 1WAJA 2LSNA 4DFJA 1M90O 1EQYA 4KHPK 3CCQN 4ILJA 4JK9A 4OLBA 1KFDA 4OKEA 1VSDA 4YORA 4EHTA 1C0MA 1KD1O 3JAMO 2JWLA 4XEIA 4CZFA 1BQNA 4FJ8A 5CZ2A 2QWPA 3DXKB 3QMLA 3FLCO 3NVMA 2P9SA 1BQMA 1TKDA 2QEXN 5HROA 4BRGA 5HRNA 1TV6A 2QXFA 5AFUA 2IS3A 2V7ZA 3J7ZO 3TAEA 4JD2A 2Q2RA 3V1RA 5BREA 3WNFA 4WYBA 4CGFA 1VQ8N 3HPOA 3H46O 2QXLA 2OPPA 3SPYA 3OYCA 3VERA 5FPEA 4IOCL 4BC4A 3THYB 4W5TA 3THXB 2F96A 3GOIA 4F3TA 1QVGM 1RDDA 1KC8O 5ADXA 1YF5L 3EZWA 2UXBK 1D4XA 2GUIA 2YNFA 3H1VX 4J2DA 3TTCA 4IFVA 4QS8A 4LSLA 3BUZB 5FDLA 3A0IX 3ZX2A 4BC5A 3O9RA 1SL1A 3RMDA 3K58A 4CHQA 3KK7A 4CE9A 5AQRA 4FLYA 3D6RA 1J53A 1XMQK 1DLOA 3ID6A 4JKGB 3TANA 3I56N 1UWBA 4FWNA 2ASPA 1IKVA 1S72N 1VSMA 3KD1E 4YOYA 2UXDK 3SUNA 3THWB 1XMOK 1C0UA 3FZLA 2XHBA 1NJYA 2P9UB 4J8FA 2Z1HA 4JV5K 1WLJA 3VEVA 4FWPA 1TL1A 3OYHA 4BE1A 4FM0A 3T1YK 4M3YA 1JJ2M 1OVYA 4NXNK 5F2RA 3D2FA 1F21A 4AHRA 1D8YA 1RT6A 3NAEA 3NGZA 3SMSA 5J1EA 2QWOA 2G8VA 1YUWA 4H8KA 3CC7N 5AQPA 1WSHA 3UE5A 4CHPA 3OBWA 2XY5A 4K8ZA 1JLCA 4YNQA 4DQSA 3SBTA 3LZIA 1D9DA 4FJKA 3CETA 3NF7A 3NDKA 3ZETB 1YAGA 4NLCA 2OTJN 4CHZA 3OYGA 3P5JA 4U67L 2W42A 3B6PA 4B9NA 3DXMB 1CZ9A 2NRVA 5M1OA 3LDNA 1T3VA 4I2QA 5F0XA 4DTUA 4IO8A 3CJBA 1HQUA 1NOZA 4FJMA 3CQ8A 4JHDA 3CFRA 1U48A 4H0PA 3CC2N 4A61A 4DR7K 3MCAB 3TSPA 4CHOA 1VRTA 1TVRA 3L2QA 4PKIA 3O1WA 4HUEA 3CYMA 2FLOA 4B1UB 1REVA 2Q31A 3VF6A 3WQTA 2E5LK 3V4IA 2ZD1A 3MEDA 1TUUA 4RCHA 4KAZA 3SV4A 3F9KA 1WAFA 3V9UA 4LF7K 3O3HA 4UQGA 3LDSA 4B9UA 2BANA 5C15A 1IJJA 5KPTA 4LD0A 3O3FA 4YHHK 2GUPA 4BR2A 5I3UA 2VWJA 1S1XA 3KLEA 1W9HA 3H3NO 5K14A 4W5OA 4DWIA 3NF9A 4FW2A 2O8DB 5AQVA 2ZWHA 3I33A 5HOOA 1NBWA 3OS1A 3VPZA 5M1FA 4EP5A 1VQ5N 3RMCA 4C8OA 5CR4A 3M3ZA 4DTNA 3LM2A 2QM1A 3NCIA 2IGIA 1TK8A 3CCSN 1BI4A 4LF4K 3DOLA 2VG7A 3H45C 4E0DA 3CQYA 4FW1A 4LH5A 4FK4A 3MX5A 1X9SA 1X9JA 3AVFA 4E7IA 3P1GA 1ASUA 1U2VA 2VWKA 1JLQA 4KI4A 2GV9A 1D9FA 3CIPA 2YJEA 4IOAL 2HOEA 4V19S 3K9JA 3EE9A 4BQZA 4CF2A 1NGCA 4I9QA 2YHAA 4H5NA 1FXXA 3AV9A 1TYQB 1NJIO 2O8DA 3GG4A 4M45A 1VSFA 3OYEA 3T3FA 5AQSA 1R59O 1WBBA 3NGIA 5GADP 1BO5O 5AQKA 2OYQA 3SI6A 3VF4A 2ZGZA 1QTMA 5T7BA 3RR7A 1EP4A 3MX2A 4HUGA 2IVOA 1NKCA 4AHSA 1G99A 2PYJA 3DLRA 5J2PA 4MO4A 1YT3A 1VSKA 2PZSA 4BR5A 3HOSA 5SWMA 3NMUA 4BR9A 1GLDG 5KQDA 4OJRA 4Y0WA 4JS5A 3KWIA 4FOEA 1LCUA 3VF2A 4FJ5A 4N41A 3ENBA 3NGYA 1KQSM 2F8SA 2O8FB 1V4TA 4BR0A 2V52B 2P9IA 2ZGYA 3VQEA 1HNXK 2HNDA 3OY9A 4DCHA 3HP6A 5EOYA 1DTQA 3TU5A 3OYJA 4CCHA 2HHSA 5B8HA 1BWFO 2G8UA 3LWLA 4ICLA 1Q9XA 4JYAK 3VEYA 4A5BA 4K0KK 4X62K 1W0HA 4KFBA 1NGGA 5FLXO 2PFUA 1QSLA 4CJWA 1BHLA 2UUBK 4CJVA 4O5BA 4BVPA 1HYZA 2H3GX 3UKRB 1TAUA 3IRXA 4BRNA 4IBNA 3MN6A 4MDAA 1WSEA 3VQ5A 3GDQA 4AH9A 3VOVA 5IWAK 2UU9K 2QW9A 4BRMA 3CD6N 2O8FA 1OH8A 3D7EO 4BDYA 3QIPA 3C0BA 1CZAN 3WUHA 4KKOA 4CZHA 2J4RA 4DQQA 3SPZA 2VQFK 5M1QA 3JSMA 2W41A 1B9DA 3Q7BA 5KPZA 3O9UA 2ITMA 2E6MA 5DMRA 4G9ZA 5KRTA 4JI4K 4J2EA 4BGBA 4DV6K 5C10A 5FPMA 3EYZA 3O4WA 3WEEA 1ZC6A 4C8KA 5GIOA 3CQXA 4FLVA 1N8RO 3K5NA 3OVNA 3FZMA 3U3GA 3CMEN 5AQMA 4KTWA 1XNQK 1T6DA 1MDUB 1WUAA 4AM6A 3SCXA 4LF8K 4CEBA 4M3RA 3DRPA 3E9PA 4AF1A 3V9WA 1NK6A 1GLLO 2GWKA 4CEFA 2XY8A 3DM2A 3S41A 3HVRA 4BGAA 1N34K 4PL7A 1NGAA 2WC9A 3MEEA 1YJNN 1VQ7N 3N4PA 3T69A 1SS6A 3O3GA 3VETA 4OPAA 2D1KA 2E88A 2NRHA 2O8CB 1IKWA 2PAVA 3S3MA 4PA1A 3C95A 1YJWN 3HRGA 5BN9A 5JS2A 1RTHA 3QBXA 4YY3K 2KFZA 3LDOA 4IZ9A 4B08A 5GAEP 4CK2A 2NRZA 4CIEA 3TAPA 4BROA 3DOKA 2HBKA 2ATQA 1HNVA 2V7YA 3EN9A 1ATSA 3EKSA 4K41A 3QDKA 1RT7A 4JKCA 5DK5A 3CHWA 4E1JA 1Z05A 4CGDA 4HUFA 1NKEA 4YOUA 3L8BA 1HNZK 4IDKA 3HZ6A 3VQ8A 3QESA 5JLHA 3QO9A 2P1JA 4IDHA 3F9MA 1C0TA 2CGKA 2HF3A 3LDQA 1RDWX 3RMAA 2KQ2A 2EHGA 4JI2K 4B8AB 4JS4A 3L4IA 1Z26A 1OVQA 4DU4A 1I94K 4CIGA 4ILHA 4DTRA 1BCMA 3NH2A 4OVLA 4BRKA 4BRDA 4MDBA 3LDLA 3RVCA 3JYTA 5AQTA 3QERA 3CXCM 3ZSOA 4ISGA 4N47A 1LV5A 1YJ9N 5JS1A 5AR0A 4KI6A 1NWKA 4WQ4A 1JKHA 1OKJA 5HL7L 3CMAN 4DU3A 3K57A 4MQ3A 1XUPO 2P9LB 1W7AA 5AZJB 3O8MA 4DMNA 1ZBFA 3SUOA 4KHSA 2E20A 5HLFA 1NGJA 3VQQA 3AVNA 2QI2A 3NVKA 2KTQA 1BA1A 3KK2A 3OJUA 4BG8A 3VGMA 5AQUA 2YHYA 3IS9A 3LL3A 3ATVA 4MLEA 4B1YB 3RR8A 3LALA 1C1BA 5LJWA 4CFBA 3UKUB 1RT2A 3W3DA 3OS2A 2QWLA 3F5TA 1KVAA 4B9TA 4CFDA 3VQDA 2RPIA 4IKFA 4ZTJA 3PLAA 4C1NK 3V6DA 4ELUA 1VSHA 3WNEA 3I55N 1SAZA 1YI2N 3AO4A 1VQ9N 4EIAA 1IH7A 2P9SB 4IO9L 4BRLA 1SL2A 4DU1A 1C6VA 4KHWA 5I9EB 4FJJA 3ENHA 4B3RK 2KZMA 4H0VB 3OYKA 4JD2B 4B9QA 4KPYA 4B9MA 3OBYA 3O9TA 3A5LC 1L3TA 3OYLA 3TPQA 4OPHA 3N4QA 2E2PA 4O0JA 1X3NA 4CZIA 4E1NA 5HRRA 4FJ7A 5C12A 3ZSXA 1KVCA 3T19A 2ITGA 4AHTA 4N76A 2WFBA 4LY7A 5FRMA 3EO3A 4ELTA 3ZX3A 3SYZA 1IG9A 4BE0A 2JLEA 5AQGA 1TGOA 3VQBA 2XY7A 4JKDA 5E26A 2CGJA 4PY5A 3CFOA 3UKUA 4AHCA 3CM6A 1HUXA 3SAHA 1HKGA 4NO7A 3HYFA 2ZJPL 4DV0K 3THVA 4B9SA 4DR6K 2HHQA 1BL3A 2BE2A 3JS6A 2FBXA 3RSEB 2G8KA 3V81A 5KGWA 3M1FA 1NK8A 4I9LA 1UAXA 4CHYA 4F2RA 1N36K 1Q81O 4CJKA 4IFEA 1WN7A 2HBLA 1IBMK 3OYIA 4CJRA 1NGFA 1RBSA 2G8IA 1BCOA 1NNEA 5GAGP 4YFUA 1QZ5A 4X65K 4E7JA 2D0AA 3ZX0A 2NRWA 3GBTA 3EE8A 4E89A 3LZJA 4K8XA 2G8FA 5AQXA 3WXIA 1NMDA 3PO4A 1X9WA 2G8HA 1RBRA 1QQOA 4FWQA 3CCUN 4DHYA 1YVUA 3O4NA 3ZT2A 3KWGA 3MN5A 4IJNA 2ZJQL 3ZLJA 3RSEA 3D2FB 4BC3A 1U47A 1ILYA 3MWTA 1P8ZA 2QWRA 1RTIA 3SV3A 2BDPA 4BRCA 1N6QA 3D2EA 2Q1NA 5AQYA 1OH7A 3PIPL 1A5VA 1JXBA 5KI6A 1H1VA 1RFQA 2I5JA 1Z6RA 1K6YA 4E7LA 4DV7K 3VESA 4DV5K 3S3NA 4WF9L 1SUQA 3ID8A 5E84A 2X6NA 3LP1A 2ASMA 4JHDB 1QQCA 5CE3A 4Z94A 3TAMA 2Z1GA 1FKPA 2W40A 2F8TA 2E4LA 1S1VA 3CI5A 3C65A 4CERA 3ZYYX 4CESA 3S9HA 3KLGA 2E8AA 3B6OA 3V1QA 4BR7A 4H0OA 5KQ8A 2Q36A 2OA8A 3DLLL 1VSIA 3SQ2A 1S3XA 1QSYA 4HCBA 2D5RA 3CG7A 3K9KA 3AVKA 4CFCA 1RDUA 4JI5K 4O44A 4A59A 4FJXA 4CHNA 3AGRA 1FKOA 4B1VA 4B9LA 4CK3A 3AVMA 3B8AX 4CJ5A 4IOXA 4XH5A 3K59A 4MLHA 2BUPA 3WT0A 3AVCA 4DB3A 2RKIA 1ZBSA 4Q5VA 3HM9A 2HMPA 2QTDA 1QS4A 3EZ5A 4WFBL 4FWSA 3IAYA 1TK0A 3VQ7A 3HSCA 1GLFO 3DLEA 5HRSA 4K43A 1NK4A 1BG3A 3TSQA 1RGIA 3FFKB 4EAHD 5AQIA 1TAQA 4DSLA 3AAPA 4ID1A 1NOYA 3AGKA 4J2AA 2IOCA 4O8UA 4CFAA 3MMVA 3RRGA 3E01A 4NXMK 1BIUA 3CCJN 3O80A 3NH1A 3AA2A 4CZMA 4BE2A 2A1SA 1T7PA 4O55A 1UA0A 3JXUA 1BI4B 4KREA 2AJQA 4CJFA 1HMVA 3VQPA 1HPZA 1U2VB 2XY6A 3ZSQA 4DTMA 4PKHA 1T6CA 4HWIA 1WSGA 3ZSZA 2E6LA 5EXWA 4FK0A 3VN5A 1RDAA 1DTTA 5J2NA 3VQAA 4H5RA 5BPLA 1KAXA 1HYVA 3O9SA 3H3OB 4CZLA 2NZTA 3MN7A 3QFPA 1J54A 4FVMA 3QEXA 4CJUA 4CGHA 3CFPA 1RBTA 4RW9A 4EHUA 4YOTA 3TSUA 1SKRA 4KH4A 2O8EA 3T7ZA 3SAGA 2ZF5O 1HNIA 2A40A 4FVUA 4QS7A 1BU6O 1Y64A 4WQ4C 3VGKA 1LAVA 5KGXA 2IVPA 1QHTA 2F9WA 4PUOA 2FF3B 1K8AO 4FJIA 4GW6A 1U04A 2YNGA 4Z4FA 4DR1K 2P9IB 2ZM6K 3RWUA 3ATUA 1GOBA 1GLEG 1JLAA 2ZJRL 1YTAA 4JI0K 3LANA 3PSIA 5JMVA 1VQPN 1QZ6A 3HM8A 3ASMA 2X74A 1C1AA 5BN8A 3G4SN 4HTLA 5C25A 5JICA 4BDPA 4ISEA 2WONA 3DI6A 2GBZA 5DM6L 1GLJO 2Z1IA 4JK8A 1BA0A 2WOMA 3HO1A 4CEZA 2HBMA 3OHRA 5D3GA 5CYQA 1DGKN 4LF5K 4W5NA 3E66A 2E1ZA 3NE6A 1Z25A 2P9KA 3D0PA 1XNRK 5LMNK 1LWCA 4U7BA 3ISNC 3OA9A 3KZBA 2XRIA 2GWJA 1KAZA 3J80O 4OGCA 2D4WA 2NNWA 5DM7L 2P9PA 4FCYA 4CK1A 4CZJA 3IKMA 1JLGA 3VEOA 3SJHA 4PQUA 5CYMA 3L4QA 4CGJA 3ZEUA 4M3XA 2HNZA 5HRPA 4DQIA 3OYFA 4UY8O 1JLBA 5LY3A 3A5OC 2HHVA 2YX6A 1WOQA 3SLCA 4FK2A 3HPHA 1K8KA 3AARA 3WEEB 3HBTA 4GY2B 4HCCA 1KFSA 3I0SA 4LFCK 3K5OA 1ZBHA 3M8RA 3U9DA 4H0XB 4ISFA 4FZZA 4C1NI 1LWEA 1VQMN 2IC3A 5AQHA 5HBMA 3ENOA 3DLBA 4NYNA 3FR0A 3DJCA 1SL0A 2OANA 1S5JA 2HHWA 4RW6A 4DS5A 5KTQA 4BRIA 4DUYK 1O13A 2YHBA 4JI1K 1IKXA 1VSEA 2A3ZA 1GLCG 3NH0A 1C1CA 1NMNA 1NU0A 2DY4A 3TAGA 4X66K 3DYAA 3LP2A 3OJSA 4NB4A 3HXMA 1MU2A 3AO1A 2QA4N 3PX0A 4EZ6A 4TSXA 4FJ9A 4CJ4A 1XWLA 3L2WA 4H03B 3GL1A 1B9FA 4E3SA 4B1XB 2HVIA 4L8RB 1VQON 3AAQA 3WXJA 4JK7A 3VEWA 3R9PA 4CEDA 3M6GA 4IJAA 3O08A 1W2BM 4JKFA 4JRPA 4IXCA 1WBDA 4JI3K 3W0LA 5CZ1A 3R3LA 1JCFA 4G1QA 4XIUA 4A2BA 4NCGA 1IKYA 4GVEA 3ULEA 4CJLA 4NLBA 1N32K 4OKJA 3OYMA 4FWKA 4DV4K 5C0YA 3BF1A 2P9NA 4DF4A 3VQCA 1S1UA 2VG5A 1CXUA 4KHQA 3QIOA 3SNNA 3P31A 4DLGA 3V9ZA 3KK3A 2KFNA 3TAQA 4GV3A 3PV8A 1JCGA 4KHNA 1L3VA 3CJ1A 3U3YA 4Q0BA 4M3UA 1JL1A 2A42A 3P83D 2Q97A 4BR4A 3L3VA 5C42A 1BISA 1KRPA 4EZ9A 3K2PA 4QAGA 1T8EA 2YHXA 4I6MA 4M63C 3FE1A 3QETA 2NLXA 2VQEK 2FF6A 2E1YA 4FWRA 3KLHA 4FLWA 3AA4A 1I39A 2WUSA 4IEIA 4DFKA 3P38A 4KHYA 3OYAA 4DTJA 4C8NA 3KD5E 1VQNN 3AA5X 2DFFA 1EETA 3M5RA 3CPEA 4H0TB 3C6AA 3AO3A 1NJWA 4OO1J 2O4GA 5AZIA 3CCMN 1QVFM 4R5PA 1WNSA 1SQKA 3G6EN 4N5SA 4FO0A 2Q0UA 1RNHA 3HPGA 1NGHA 1C0GA 4FWOA 2GEMA 2O4IA 4W5QA 5SZTA 5JVGL 1XQSC 4RW8A 1Q86O 1QSSA 2DFHA 3T1HK 2PYLA 4PHTX 1VRUA 2KKZA 5MLCQ 2RF2A 1E3MA 4ELVA 3A2FA 3IMXA 1EWRA 3AVHA 1S9EA 3TWHA 4LH4A 5ELZA 5C24A 1U45A 2P5GA 4FJGA 3ZCMA 1WSIA 1T03A 2JGUA 4KH6A 3IFRA 4E7KA 4CJ3A 4DS4A 3AO5A 2YI1A 4OKKA 3I0RA 3VA3A 3F2KA 3V1OA 3J81O 1NGEA 5C2DA 1LAWA 3VQ4A 1UA1A 4B9VA 3TTDA 5IT9O 1RTDA 1SKWA 4FLXA 2ZE2A 3EY1A 4JAXA 4QS9A 1V4SA 1RILA 2YNIA 3QNNA 1WSJA 1DEJA 4NYFA 1HX1A 2V51B 4KV8A 1TL3A 2HVHA 1X1PA 3VGLA 2F4VK 1HLUA 4BC2A 4QOZB 3SQ1A 2A6AA 1J9AA 3L2VA 1WB9A 2X6SA 2VYPA 1OH6A 4FZYA 4DF8A 2P51A 2Z1JA 4O4GA 3FFIA 4O0IA 1NK5A 1S22A 4B1ZA 5I42A 3BGRA 3H08A 3SQ4A 3Q7CA 2D0BA 3WNGA 1Q18A 4WE1A 4AM7A 4BDZA 4KB1A 4M3ZA 4AQYK 2F9TA 5JLFA 4JKAA 3QNOA 3ULDA 3HP9A 3SK3A 3K0SA 4DTSA 3HK2A 4Z0UA 1K73O 4WQ5C 2NRRA 4GMJB 2EWSA 1O1WA 3BF3A 4Y1DA 3MXJA 1VHXA 4CJQA 4KHUA 1EWQA 1IO2A 4CJ7A 5GAHP 1XI1A 1HR0K 3TABA 5KPRA 1KXPA 5EY4A 5A2QO 1CXQA 3D2EB 4AHUA 4IG0A 3A5MC 4FLUA 1RTJA 4IWVA 1E4FT 4WFNL 4M7YA 5FPDA 4F8RA 4JKEA 2FBVA 4M41A 5FPNA 3F73A 1CZBA 5FROA 3SQ0A 5AQJA 3C7NA 4FLZA 1UOCA 2D0CA 3VTHA 4F9OA 1XHXA 3O4QA 1QHAA 1Q9YA 5EX5A 4WCEL 2KHOA 4DSIA 1IBKK 3ZT4A 3U6FA 4RW4A 3CCEN 3TAFA 3HSTB 3C6UA 2FSNA 1SKSA 1N33K 1U6ZA 3O9QA 3AY9A 3HI0A 1XC3A 4DR2K 4M3TA 3VQ6A 4GV9A 2I7PA 2O8BA 3CPWM 3MXIA 1IBLK 4M3WA 4DSJA 3D45A 3KKSA 4LF9K 3SBGA 4DQPA 4FJLA 3MDQA 3AVLA 3O5BA 3ZSVA 1R0AA 1RBVA 2AP1A 1TK5A 1FK9A 3DRSA 3VEZA 4DLEA 4J2BA 3DXKA 3PSFA 4ZTFA 1D5AA 4CJPA 3J7AP 1RT4A 4KO0A 4E19A 3TI0A 4LF6K 4OPJA 3U8XA 3HOTA 2AA4A 1QQNA 2QK9A 2D0PA 4XH4A 3ZT3A 3OW2M 3MWPA 4O8KA 4OGEA 4DQRA 1KVBA 1EKEA 1VQ6N 3BEXA 3S3OA 3C6HA 1S6QA 3WNHA 4R79A 4N56A 1KCFA 3KVGA 4PWDA 1MA9B 3DLHA 1VQ4N 4H5WA 2W6LA 3VMFB 1JLEA 2HMIA 3THYA 2ASOA 1ASWA 3CJAA 1KLNA 1MWMA 1HPMA 4CBUA 3THXA 3U4LA 2WBNA 5AQZA 4CJSA 4NCAA 2KW4A 1SZ2A 1RDBA 5J2MA 1QQMA 1U49A 1HKCA 3VA0A 3MK6A 4CECA 1TKZA 2CH5A 5AQOA 1JLFA 3PX6A 1VK0A 3P39A 3HT3A 2G8WA 1M1KO 1Y97A 4BWMA 3IG1A 1FW6A 1RT5A 4CGIA 1K9MO 3R8EA 1U4BA 3KKRA 4JI6K 4FM2A 3ZT0A 1J5EK 4JKGA 5CY4A 4JN4A 4RWTA 2F7TA 1BGXT 4YDUC 4A5AA 2YKNA 3FZFA 3CCLN 3GE1A 1HNWK 2ETJA 3NBPA 4K42A 4A57A 2O8EB 3THWA 4C8LA 2OZMA 4AILC 1VSLA 3WXMB 5AQFA 4JEPA 4F4KA 2P9UA 2HSTA 2IAJA 3OYBA 4LSNA 1NK7A 4FPAA 4DR3K 1XC9A 4DR4K 4DTOA 4CEQA 4CI6A 3CF5L 3PX4A 2A41A 3RMBA 1LW2A 3CJ9A 3J7YP 3BZCA 4C23A 1Q8IA 5M1PA 3T1AA 1HYSA 3R6MA 4CF9A 1ZXOA 3L2UA 3CJ7A 3LWMA 4H0YB 5AJ3K 3NHGA 4BRHA 3E9OA 1ATNA 3O1BA 5EU7A 1S1WA 1S6PA 3EL2A 3TARA 3LAKA 3ZETA 3SUQA 3AVBA 2YKMA 2HHUA 5BPMA 3OTOK 4JI8K 3DXMA 1YVNA 1RT3A 1WSFA 4O5FA 3LPTA 4HVJA 2JWKA 3P4IA 5AFUH 1L3UA 3MAQA 3NF8A 3QB0A 3M8PA 4CEAA 1VQLN 3BP8A 4OPKA 2OTLN 3KHYA 5C2FA 1YITN 1NLVA 4H5TA 2PY5A 2P9KB 4FLTA 1NGIA 5HP1A 3MXMA 4MO5A 3AVJA
chains in the Genus database with same CATH topology
5AQRA 4JK7A 3VEWA 3LL3A 3R9PA 3ATVA 3D6RA 3M6GA 2P9PB 4MLEA 4B1YB 1NGBA 3ID6A 3O08A 4IJAA 4JKGB 5H1SQ 1W2BM 5LJWA 4JKFA 3I56N 4FWNA 3E1YA 4IXCA 3UKUB 2ASPA 2DPNA 3W3DA 1S72N 3W0LA 2QWLA 5ADXH 2VCPA 1JCFA 3F5TA 3R3LA 4FL9A 4JNEA 4A2BA 4A62A 4YOYA 1IG8A 5GIPA 3FZLA 4GVEA 3ULEA 3ZEUB 4NLBA 5BPNA 3PLAA 4C1NK 3CJCA 2P9UB 4J8FA 5AQQA 2HF4A 3U9ZA 3VEVA 4FWPA 3I55N 4FWKA 1SAZA 1YI2N 1VQ9N 5C0YA 3BF1A 2P9NA 1LOTB 4EIAA 4FOIA 2P9SB 4KBOA 2GTDA 4IO9L 5BRDA 4BRLA 1K8KB 1JJ2M 4WQ5A 3MN9A 1OVYA 3EKUA 5EVZA 5F2RA 3D2FA 3P31A 5I9EB 3ENHA 4H0VB 4JD2B 1ATRA 2NRXA 3SMSA 4B9QA 4GV3A 2QWOA 3OBYA 3O9TA 3A5LC 1JCGA 1YUWA 4L3QA 3TPQA 4OPHA 3N4QA 2E2PA 3CJ1A 3CC7N 3G25A 5AQPA 1W97L 1X3NA 2A42A 4ILGB 4CZIA 3UE5A 3OBWA 5C12A 4JKHA 2WFBA 3SBTA 2Q97A 3EO3A 4CZKA 3ZX3A 4BR4A 3CETA 1E4GT 5AQGA 3CCRN 3ZETB 1YAGA 4JKDA 4RTFD 2FXUA 2CGJA 4NLCA 5E26A 2QWQA 4FPBA 2OTJN 2YHXA 4I6MA 4M63C 3UKUA 3FE1A 4U67L 2NLXA 1HUXA 3DXMB 1HKGA 2NRVA 4NO7A 5M1OA 3VEXA 1GLBG 4EFHA 2FF6A 3LDNA 2ZJPL 1YHQN 2E1YA 1T3VA 4FSVA 5F0XA 5CHIA 4IO8A 4FWRA 3CJBA 3JS6A 3RSEB 2CH6A 1JCEA 3L0QA 4JHDA 4H0PA 2E2QA 2WUSA 3M1FA 4IEIA 3P38A 3CC2N 4A61A 4BRFA 3MCAB 3DWLA 3TSPA 1Q81O 4PKIA 1VQNN 3O1WA 2FLOA 3M5RA 1BDGA 5JVHL 4IFEA 2HBLA 3CPEA 4H0TB 3C6AA 3SAFA 4B1UB 2Q31A 4OO1J 3VF6A 1TYQA 3WQTA 1NGFA 5AZIA 4CZGA 4BRPA 3CCMN 1QVFM 1SQKA 5GAGP 1QZ5A 3G6EN 4CD1A 4FO0A 2Q0UA 1TUUA 4RCHA 3ZX0A 2NRWA 3GBTA 3EE8A 5AQXA 3CERA 1NMDA 1NGHA 3ULEB 3WXIA 4YOVA 1C0GA 1QQOA 4FWOA 5C15A 4FWQA 2QWNA 2GEMA 1IJJA 4DHYA 5KPTA 3CCUN 5AQWA 2P9NB 2GUPA 5JVGL 1XQSC 4XH1A 1Q86O 4BR2A 3KWGA 3IDHA 3MN5A 4IJNA 4PHTX 2KKZA 5MLCQ 2ZJQL 3RSEA 3D2FB 3IMXA 4M7XA 5BR9A 3H3NO 4BC3A 5ELZA 4BQLA 1Q7YO 1ILYA 4KH6A 5AQVA 3IFRA 3MWTA 5TKWA 1P8ZA 2QWRA 2ZWHA 3H1QA 2YI1A 3I33A 5HOOA 1BUPA 1NBWA 4BRCA 3PIOL 3F2KA 3VPZA 1NGEA 5C2DA 5M1FA 1VQ5N 3D2EA 2Q1NA 5AQYA 3TTDA 3UB5A 3PIPL 5CR4A 1X3MA 3M3ZA 2GX9A 3LM2A 2QM1A 1H1VA 1RFQA 3CCSN 1Z6RA 4I6MB 4JAXA 4QS9A 4BRAA 1V4SA 3H45C 3VESA 4WF9L 3CQYA 3MX5A 1DEJA 2CGLA 3ID8A 2VGMA 5E84A 1X9JA 3DAWA 1HX1A 3WXLA 2V51B 1U2VA 2ASMA 4JHDB 4A2AA 5CE3A 4Z94A 4BVOA 3UKRA 2W40A 3VGLA 3CC4N 1HLUA 5BRFA 4BC2A 3CI5A 3C65A 3CIPA 2YJEA 3ZYYX 4IOAL 2A6AA 2HOEA 4H5VA 3K9JA 2E8AA 3EE9A 4BQZA 4DKWA 2VYPA 4BR7A 1NGCA 4H0OA 5KQ8A 2Q36A 5GINA 4H5NA 3DLLL 1TYQB 1NJIO 2NRTA 3GG4A 5AZIB 3H6EA 1S22A 1S3XA 4B1ZA 2Q0RA 4YDUA 1EO1A 2YCHA 5AQSA 1R59O 3K9KA 3LM9A 3Q7CA 1RDUA 4BRQA 1BO5O 5GADP 1NGDA 5AQKA 1Q18A 4A59A 4AM7A 3AGRA 3VF4A 2ZGZA 2F9TA 4B1VA 5JLFA 3A8YA 4JKAA 3B8AX 4IOXA 4XH5A 3MX2A 3SK3A 1KAYA 3QICA 2IVOA 2BUPA 4MLHA 3WT0A 4CBXA 2UYTA 4DB3A 3WXKA 1G99A 1ZBSA 3A5NC 4MO4A 3WXJA 4KH5A 4BR5A 2HMPA 2QTDA 1K73O 1MWKA 2NRRA 4WQ5C 4FWSA 4WFBL 2EWSA 3E9LA 3HOSA 3BF3A 4CD3A 3HSCA 4BR9A 3NMUA 5BRHA 1GLDG 1GLFO 5KQDA 4Y0WA 3KWIA 4FOEA 1LCUA 3VF2A 1ESVA 4K43A 4CJ7A 5GAHP 3HTVA 5LJVA 3ENBA 1NM1A 1BG3A 3I8BA 3TSQA 5KPRA 2BTFA 5AQNA 1KQSM 1KXPA 1RGIA 3FFKB 2E2OA 4EAHD 5AQIA 1V4TA 3AAPA 4BR0A 2V52B 2P9IA 3AGKA 5EY4A 2ZGYA 2PBDA 2HBJA 1P90A 4O8UA 3MMVA 4DCHA 5EOYA 3D2EB 3A5MC 3SMPA 3CCVN 4IWVA 4PKGA 3CCJN 1E4FT 3O80A 3TU5A 4CZMA 5B8HA 1BWFO 4WFNL 4M7YA 5FPDA 4JKEA 1J6ZA 3JXUA 3QFUA 4CZEA 5FPNA 2QWMA 3VEYA 4A5BA 5AQJA 3C7NA 4BG9A 2FSKA 3VTHA 2A5XA 4F9OA 4FWMA 3QBWA 1NGGA 4BY9C 2PFUA 2YHWA 1QHAA 5EX5A 5M1KA 4WCEL 2KHOA 3VENA 1U2VB 5M1NA 2RHKA 4FWLA 4BVPA 3CCEN 4PKHA 2H3GX 1T6CA 3UKRB 2FSNA 4HWIA 4BRNA 3MN6A 4MDAA 1U6ZA 3O9QA 4IEEA 4JKBA 3AY9A 5EXWA 4YOWA 3HI0A 1XC3A 4H5RA 5BPLA 1KAXA 3GDQA 1YIJN 3O9SA 3H3OB 4CZLA 2I7PA 2NZTA 1BOTO 3MN7A 3QFPA 3VOVA 4GV9A 2QW9A 4BRMA 3CD6N 2I7NA 3CPWM 3D7EO 2IIRA 3C0BA 1CZAN 3IUCA 3MCPA 3WUHA 4EHUA 4CZHA 4YOTA 2J4RA 3SBGA 3TSUA 4KH4A 4DQ8A 3T7ZA 3MDQA 5M1QA 2W41A 3O5BA 4YOXA 3SAGA 2BH1A 2AP1A 1VAZA 2ZF5O 3Q7BA 5KPZA 2A40A 3O9UA 4LC9B 2ITMA 4FVUA 2FSJA 3VEZA 4QS7A 4G9ZA 3FGUA 3SAHA 1HKBA 1BU6O 3DXKA 4WFAL 4BREA 3R1XA 1Y64A 4WQ4C 4BGBA 5C10A 4GNIA 5FPMA 3O4WA 3VGKA 1ZC6A 3WEEA 1TUYA 5GIOA 3CQXA 1N8RO 2IVPA 3U8XA 3HOTA 2AA4A 2F9WA 3FZHA 1QQNA 3FZMA 2FF3B 3CMEN 2D0PA 4GV6A 5AQLA 5AQMA 4XH4A 3OW2M 1Q82O 1K8AO 1T6DA 2VGNA 3MWPA 4O8KA 1MDUB 1DKGD 2IVNA 4PL8A 1WUAA 3BEXA 1VQ6N 3C6HA 4AM6A 3TTFA 3J8AA 4R79A 3E9PA 2P9IB 4AF1A 1HJOA 1GLLO 2GWKA 1MA9B 3ATUA 3KVGA 1GLEG 1VQ4N 2ZJRL 4H5WA 3VMFB 5JMVA 1VQPN 2KLAA 3S41A 2D0OA 2ASOA 4BGAA 1T44A 3CJAA 3WQUA 1QZ6A 3O6WA 4PL7A 1NGAA 2WC9A 2E2NA 1DT9A 1MWMA 3HM8A 2YJFA 1YJNN 1HPMA 4CBUA 1VQ7N 5BN8A 3U4LA 1C0FA 3N4PA 3T69A 1SS6A 2WBNA 3LDPA 5AQZA 3G4SN 3VETA 2RE2A 4HTLA 5JICA 4OPAA 3C7NB 4K25A 1SZ2A 2VWBA 4ISEA 3G71N 2D1KA 2E88A 2P9LA 5AZJA 2NRHA 2PAVA 5DM6L 4B1WB 1GLJO 1QQMA 1YXQA 4JK8A 1BA0A 1HKCA 5F1XA 1YJWN 3L6QA 3MK6A 2HBMA 1GLAG 2CH5A 3HRGA 3OHRA 5AQOA 5BN9A 3VTIA 3QBXA 1DGKN 3P39A 5TKYA 3E66A 2E1ZA 3LDOA 4IZ9A 5GAEP 1M1KO 2P9KA 2NRZA 4CBWA 3FZKA 4BROA 4U7BA 1K9MO 3OA9A 3KZBA 3R8EA 2GWJA 1KAZA 1VQKN 2D4WA 2NNWA 5DM7L 2P9PA 2GELA 2HBKA 4JKGA 4CZJA 3IKMA 4JN4A 2F7TA 4RWTA 1M90O 1EQYA 2V7YA 4YDUC 4A5AA 3VEOA 3FZFA 3CCQN 4ILJA 4JK9A 3SJHA 3GE1A 3CCLN 3EN9A 1ATSA 4K42A 3EKSA 4YORA 4A57A 3L4QA 4K41A 3QDKA 4JKCA 4EHTA 2JWLA 1KD1O 3ZEUA 3WXMB 5AQFA 4JEPA 3CHWA 2P9UA 4XEIA 2HSTA 4CZFA 4E1JA 1Z05A 4YOUA 4UY8O 2QWPA 4FPAA 5LY3A 3A5OC 3DXKB 2YX6A 3QMLA 3FLCO 1WOQA 3HZ6A 3NVMA 4CI6A 3SLCA 2P9SA 3CF5L 2A41A 1K8KA 3AARA 3WEEB 3HBTA 4GY2B 5JLHA 2QEXN 3CJ9A 4IDHA 3F9MA 4BRGA 4C23A 2CGKA 2HF3A 3LDQA 1RDWX 4H0XB 4ISFA 5M1PA 2V7ZA 3U9DA 5AFUA 4JD2A 4C1NI 3J7ZO 2Q2RA 3L4IA 3R6MA 1VQMN 5BREA 1ZXOA 4WYBA 5AQHA 3CJ7A 3ENOA 1VQ8N 4H0YB 4ILHA 3H46O 3FR0A 3E9OA 1ATNA 3DJCA 3O1BA 4BRHA 4BRKA 4BRDA 2OANA 2QXLA 3LDLA 4MDBA 3RVCA 5AQTA 3VERA 5FPEA 3CXCM 4IOCL 4ISGA 3EL2A 4BC4A 3ZETA 4BRIA 1YJ9N 1O13A 5AR0A 5BPMA 1NWKA 2A3ZA 3GOIA 4WQ4A 1OKJA 5HL7L 3CMAN 1GLCG 3DXMA 1QVGM 1YVNA 4O5FA 1KC8O 5ADXA 2JWKA 3P4IA 5AFUH 1YF5L 1XUPO 2P9LB 3EZWA 5AZJB 3O8MA 1D4XA 3H1VX 3QB0A 2E20A 3TTCA 1NGJA 1VQLN 4QS8A 3BP8A 4NB4A 3BUZB 2OTLN 2QI2A 3A0IX 3KHYA 5C2FA 2QA4N 1YITN 1NLVA 3NVKA 4H5TA 3ZX2A 4H03B 4BC5A 1BA1A 3GL1A 2P9KB 3O9RA 4BG8A 1NGIA 3VGMA 5AQUA 4B1XB 1VQON 3KK7A 3AAQA 4MO5A 2YHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHK A;  3D6R A;  3M5R A;  3KWG A;  3O9U A;  3P31 A;  2GX9 A;  3O9Q A;  2KKZ A;  3L4Q A;  3EE9 A;  3F5T A;  3P39 A;  3O9T A;  3O9S A;  4OPH A;  3RVC A;  3EE8 A;  3KWI A;  3P38 A;  3OA9 A;  3O9R A;  4OPA A; 
#chains in the Genus database with same CATH topology
 5BR9 A;  5H1S Q;  2P9P B;  1NGB A;  4DSE A;  4C8M A;  1YTU A;  3QLH A;  3E1Y A;  1KTQ A;  1FJG K;  2DPN A;  5ADX H;  2VCP A;  4FL9 A;  1ZBI A;  4JNE A;  4A62 A;  4CJT A;  1IG8 A;  1G15 A;  5GIP A;  3DLG A;  3ZEU B;  1KLM A;  5BPN A;  3CJC A;  4Z4I A;  5AQQ A;  2HF4 A;  3U9Z A;  3M8Q A;  1LOT B;  1JXE A;  2HHX A;  4FOI A;  4KBO A;  2GTD A;  5BRD A;  1K8K B;  4WQ5 A;  4DG1 A;  1NKB A;  3MN9 A;  3EKU A;  5EVZ A;  3QEV A;  2HW3 A;  4CEE A;  1J5O A;  2OZS A;  5E41 A;  4FZX C;  1ATR A;  2NRX A;  4L3Q A;  4GVM A;  1EXQ A;  3G25 A;  1ASV A;  5LL6 Z;  3G10 A;  4EP4 A;  3L2R A;  1W97 L;  4ILG B;  4NCB A;  4I7F A;  3VQ9 A;  4H4O A;  1QE1 A;  4JKH A;  4FJN A;  4CZK A;  4Z4C A;  4ID5 A;  4KTQ A;  1NJZ A;  1E4G T;  3CCR N;  4RTF D;  2FXU A;  2QWQ A;  2B6A A;  4FPB A;  4AHV A;  1TKX A;  3LP3 A;  4Z4H A;  3PO5 A;  3HVT A;  3VEX A;  4YOW A;  4EFH A;  1YHQ N;  1GLB G;  4M42 A;  4FSV A;  5CHI A;  4JRQ A;  1NJX A;  2CH6 A;  1JCE A;  3AVA A;  3L0Q A;  1JL2 A;  2R7Y A;  2E2Q A;  4BRF A;  3DWL A;  4Z4E A;  1NK9 A;  3QEW A;  1N5Y A;  1BDG A;  4B3M K;  2A1R A;  2UUA K;  5JVH L;  4OLA A;  3SAF A;  2OPS A;  1TYQ A;  4B8C A;  3OYD A;  3AA3 A;  4CZG A;  4BRP A;  3BY5 A;  4CD1 A;  1HJR A;  4ZHR A;  1S9G A;  4I2P A;  3RRH A;  3CER A;  3ITH A;  3ULE B;  4YOV A;  2HHT A;  2OPQ A;  2QWN A;  3AO2 A;  5AQW A;  2P9N B;  4XH1 A;  4IG3 A;  2B5J A;  3IDH A;  3KK1 A;  3TR8 A;  2HB5 A;  1LW0 A;  4KRF A;  4LFA K;  4GKJ K;  4DTP A;  1S1T A;  3PY8 A;  4M7X A;  3C6T A;  1SV5 A;  2HHH K;  1ZBU A;  4BQL A;  1Q7Y O;  2Y1J A;  4GKK K;  2EX3 A;  5TKW A;  5BR8 K;  1RBU A;  3H1Q A;  4BWJ A;  1BUP A;  4JLH A;  4IFY A;  4MFB A;  4DV3 K;  1NG9 A;  3UIQ A;  2KZZ A;  1CLQ A;  2FC0 A;  1LWF A;  3PIO L;  1HRH A;  4HTU A;  3G0Z A;  3V9S A;  4DSK A;  3UB5 A;  4FYD A;  3RTV A;  1X3M A;  2GX9 A;  1X9M A;  4I6M B;  4BRA A;  4Y1C A;  2RN2 A;  3OYN A;  4Z4G A;  2CGL A;  2Q3S A;  5J2Q A;  2VGM A;  3DAW A;  3WXL A;  4CF1 A;  4A2A A;  2ZQB A;  3SZ2 A;  4BVO A;  3UKR A;  2YV0 X;  3ZT1 A;  3CC4 N;  1ITG A;  5BRF A;  5KRS A;  4H5V A;  4FJH A;  3KIO A;  4CIF A;  4DKW A;  4E1M A;  5GIN A;  2FBT A;  2NRT A;  5AZI B;  2WTU A;  3H6E A;  1EO1 A;  2Q0R A;  4YDU A;  2YCH A;  4W5R A;  3LM9 A;  4KTZ A;  2FBY A;  4BRQ A;  1NGD A;  3A8Y A;  1T05 A;  3LAM A;  2XO7 A;  2OPR A;  4DV1 K;  1KAY A;  3QIC A;  3ZSY A;  4CBX A;  2UYT A;  1NK0 A;  3WXK A;  2QKB A;  4DFP A;  3A5N C;  4KH5 A;  1I3A A;  1MWK A;  4F3O A;  1L3S A;  3E9L A;  3PUF A;  4DFM A;  4CGG A;  4CD3 A;  4RW7 A;  2OCE A;  5BRH A;  3L3U A;  3DRR A;  1ESV A;  2DFE A;  3DLK A;  3HTV A;  5LJV A;  4DR5 K;  1NM1 A;  3I8B A;  4CJE A;  2BTF A;  5AQN A;  4LFB K;  2E2O A;  3AVI A;  4B3O A;  1A5X A;  3NF6 A;  1A5W A;  4E7H A;  2PBD A;  2HBJ A;  1P90 A;  3KLF A;  3KLI A;  3MEC A;  3CCV N;  3LP0 A;  3SMP A;  4PKG A;  4DSF A;  3V9X A;  3SUP A;  2IDO A;  1EX4 A;  4KB0 A;  1J6Z A;  3QFU A;  1GOC A;  4CZE A;  2QWM A;  4QCL A;  4BG9 A;  4DTX A;  2FSK A;  2A5X A;  4BAC A;  4FWM A;  1ZYQ A;  3QBW A;  4BY9 C;  2YHW A;  2O8C A;  5M1K A;  3VEN A;  4B3T K;  1B92 A;  5M1N A;  2RHK A;  4FWL A;  4CW7 B;  2YNH A;  4IEE A;  4JKB A;  1RCH A;  4F2S A;  1YIJ N;  1RDC A;  1BOT O;  3K5M A;  3BZK A;  4JI7 K;  4CF8 A;  2I7N A;  2B4J A;  3M8S A;  2IIR A;  3IUC A;  3MCP A;  2W6K A;  1BIZ A;  1VSJ A;  5FRN A;  3ZSW A;  4DQ8 A;  2UUC K;  3K5L A;  4YOX A;  2BH1 A;  1VAZ A;  2UXC K;  4LC9 B;  2FSJ A;  2NUB A;  2X78 A;  2Y1I A;  3FGU A;  1HKB A;  4WFA L;  4H4M A;  4BRE A;  3R1X A;  3LPU A;  4GNI A;  3DMJ A;  1KSP A;  1OH5 A;  2P5O A;  1IV0 A;  1TUY A;  3ZSR A;  4OX9 K;  2DTU A;  3FZH A;  4B3S K;  4GV6 A;  3BDP A;  5AQL A;  1Q82 O;  2VGN A;  1RT1 A;  2IVN A;  1DKG D;  4PL8 A;  3KTQ A;  3MEG A;  3AVG A;  3TTF A;  4CF0 A;  3QIN A;  4FXD A;  3J8A A;  4X64 K;  3CM5 A;  1HJO A;  3KJV A;  3I8D A;  3HJF A;  3EEQ A;  1TKT A;  2KLA A;  2D0O A;  2QKK A;  1T44 A;  3WQU A;  3O6W A;  2VG6 A;  2E2N A;  1DT9 A;  4CVN E;  1L5U A;  2YJF A;  1GOA A;  1C0F A;  3LDP A;  2HNY A;  2RE2 A;  3C7N B;  4K25 A;  2VWB A;  3C94 A;  3G71 N;  2P9L A;  1XHZ A;  3NFA A;  5AZJ A;  4DV2 K;  3SJJ A;  4CEO A;  4B1W B;  1YXQ A;  5F1X A;  3L6Q A;  3VTI A;  1GLA G;  3HL8 A;  4FM1 A;  5TKY A;  1ZBL A;  4HHT A;  3QEI A;  3OS0 A;  4CBW A;  4RG8 A;  4DUZ K;  3FZK A;  1HQE A;  3ALY A;  3QEP A;  5LMU K;  1VQK N;  2BGG A;  2O8B B;  2GEL A;  1WAJ A;  2LSN A;  4DFJ A;  1M90 O;  1EQY A;  4KHP K;  3CCQ N;  4ILJ A;  4JK9 A;  4OLB A;  1KFD A;  4OKE A;  1VSD A;  4YOR A;  4EHT A;  1C0M A;  1KD1 O;  3JAM O;  2JWL A;  4XEI A;  4CZF A;  1BQN A;  4FJ8 A;  5CZ2 A;  2QWP A;  3DXK B;  3QML A;  3FLC O;  3NVM A;  2P9S A;  1BQM A;  1TKD A;  2QEX N;  5HRO A;  4BRG A;  5HRN A;  1TV6 A;  2QXF A;  5AFU A;  2IS3 A;  2V7Z A;  3J7Z O;  3TAE A;  4JD2 A;  2Q2R A;  3V1R A;  5BRE A;  3WNF A;  4WYB A;  4CGF A;  1VQ8 N;  3HPO A;  3H46 O;  2QXL A;  2OPP A;  3SPY A;  3OYC A;  3VER A;  5FPE A;  4IOC L;  4BC4 A;  3THY B;  4W5T A;  3THX B;  2F96 A;  3GOI A;  4F3T A;  1QVG M;  1RDD A;  1KC8 O;  5ADX A;  1YF5 L;  3EZW A;  2UXB K;  1D4X A;  2GUI A;  2YNF A;  3H1V X;  4J2D A;  3TTC A;  4IFV A;  4QS8 A;  4LSL A;  3BUZ B;  5FDL A;  3A0I X;  3ZX2 A;  4BC5 A;  3O9R A;  1SL1 A;  3RMD A;  3K58 A;  4CHQ A;  3KK7 A;  4CE9 A;  5AQR A;  4FLY A;  3D6R A;  1J53 A;  1XMQ K;  1DLO A;  3ID6 A;  4JKG B;  3TAN A;  3I56 N;  1UWB A;  4FWN A;  2ASP A;  1IKV A;  1S72 N;  1VSM A;  3KD1 E;  4YOY A;  2UXD K;  3SUN A;  3THW B;  1XMO K;  1C0U A;  3FZL A;  2XHB A;  1NJY A;  2P9U B;  4J8F A;  2Z1H A;  4JV5 K;  1WLJ A;  3VEV A;  4FWP A;  1TL1 A;  3OYH A;  4BE1 A;  4FM0 A;  3T1Y K;  4M3Y A;  1JJ2 M;  1OVY A;  4NXN K;  5F2R A;  3D2F A;  1F21 A;  4AHR A;  1D8Y A;  1RT6 A;  3NAE A;  3NGZ A;  3SMS A;  5J1E A;  2QWO A;  2G8V A;  1YUW A;  4H8K A;  3CC7 N;  5AQP A;  1WSH A;  3UE5 A;  4CHP A;  3OBW A;  2XY5 A;  4K8Z A;  1JLC A;  4YNQ A;  4DQS A;  3SBT A;  3LZI A;  1D9D A;  4FJK A;  3CET A;  3NF7 A;  3NDK A;  3ZET B;  1YAG A;  4NLC A;  2OTJ N;  4CHZ A;  3OYG A;  3P5J A;  4U67 L;  2W42 A;  3B6P A;  4B9N A;  3DXM B;  1CZ9 A;  2NRV A;  5M1O A;  3LDN A;  1T3V A;  4I2Q A;  5F0X A;  4DTU A;  4IO8 A;  3CJB A;  1HQU A;  1NOZ A;  4FJM A;  3CQ8 A;  4JHD A;  3CFR A;  1U48 A;  4H0P A;  3CC2 N;  4A61 A;  4DR7 K;  3MCA B;  3TSP A;  4CHO A;  1VRT A;  1TVR A;  3L2Q A;  4PKI A;  3O1W A;  4HUE A;  3CYM A;  2FLO A;  4B1U B;  1REV A;  2Q31 A;  3VF6 A;  3WQT A;  2E5L K;  3V4I A;  2ZD1 A;  3MED A;  1TUU A;  4RCH A;  4KAZ A;  3SV4 A;  3F9K A;  1WAF A;  3V9U A;  4LF7 K;  3O3H A;  4UQG A;  3LDS A;  4B9U A;  2BAN A;  5C15 A;  1IJJ A;  5KPT A;  4LD0 A;  3O3F A;  4YHH K;  2GUP A;  4BR2 A;  5I3U A;  2VWJ A;  1S1X A;  3KLE A;  1W9H A;  3H3N O;  5K14 A;  4W5O A;  4DWI A;  3NF9 A;  4FW2 A;  2O8D B;  5AQV A;  2ZWH A;  3I33 A;  5HOO A;  1NBW A;  3OS1 A;  3VPZ A;  5M1F A;  4EP5 A;  1VQ5 N;  3RMC A;  4C8O A;  5CR4 A;  3M3Z A;  4DTN A;  3LM2 A;  2QM1 A;  3NCI A;  2IGI A;  1TK8 A;  3CCS N;  1BI4 A;  4LF4 K;  3DOL A;  2VG7 A;  3H45 C;  4E0D A;  3CQY A;  4FW1 A;  4LH5 A;  4FK4 A;  3MX5 A;  1X9S A;  1X9J A;  3AVF A;  4E7I A;  3P1G A;  1ASU A;  1U2V A;  2VWK A;  1JLQ A;  4KI4 A;  2GV9 A;  1D9F A;  3CIP A;  2YJE A;  4IOA L;  2HOE A;  4V19 S;  3K9J A;  3EE9 A;  4BQZ A;  4CF2 A;  1NGC A;  4I9Q A;  2YHA A;  4H5N A;  1FXX A;  3AV9 A;  1TYQ B;  1NJI O;  2O8D A;  3GG4 A;  4M45 A;  1VSF A;  3OYE A;  3T3F A;  5AQS A;  1R59 O;  1WBB A;  3NGI A;  5GAD P;  1BO5 O;  5AQK A;  2OYQ A;  3SI6 A;  3VF4 A;  2ZGZ A;  1QTM A;  5T7B A;  3RR7 A;  1EP4 A;  3MX2 A;  4HUG A;  2IVO A;  1NKC A;  4AHS A;  1G99 A;  2PYJ A;  3DLR A;  5J2P A;  4MO4 A;  1YT3 A;  1VSK A;  2PZS A;  4BR5 A;  3HOS A;  5SWM A;  3NMU A;  4BR9 A;  1GLD G;  5KQD A;  4OJR A;  4Y0W A;  4JS5 A;  3KWI A;  4FOE A;  1LCU A;  3VF2 A;  4FJ5 A;  4N41 A;  3ENB A;  3NGY A;  1KQS M;  2F8S A;  2O8F B;  1V4T A;  4BR0 A;  2V52 B;  2P9I A;  2ZGY A;  3VQE A;  1HNX K;  2HND A;  3OY9 A;  4DCH A;  3HP6 A;  5EOY A;  1DTQ A;  3TU5 A;  3OYJ A;  4CCH A;  2HHS A;  5B8H A;  1BWF O;  2G8U A;  3LWL A;  4ICL A;  1Q9X A;  4JYA K;  3VEY A;  4A5B A;  4K0K K;  4X62 K;  1W0H A;  4KFB A;  1NGG A;  5FLX O;  2PFU A;  1QSL A;  4CJW A;  1BHL A;  2UUB K;  4CJV A;  4O5B A;  4BVP A;  1HYZ A;  2H3G X;  3UKR B;  1TAU A;  3IRX A;  4BRN A;  4IBN A;  3MN6 A;  4MDA A;  1WSE A;  3VQ5 A;  3GDQ A;  4AH9 A;  3VOV A;  5IWA K;  2UU9 K;  2QW9 A;  4BRM A;  3CD6 N;  2O8F A;  1OH8 A;  3D7E O;  4BDY A;  3QIP A;  3C0B A;  1CZA N;  3WUH A;  4KKO A;  4CZH A;  2J4R A;  4DQQ A;  3SPZ A;  2VQF K;  5M1Q A;  3JSM A;  2W41 A;  1B9D A;  3Q7B A;  5KPZ A;  3O9U A;  2ITM A;  2E6M A;  5DMR A;  4G9Z A;  5KRT A;  4JI4 K;  4J2E A;  4BGB A;  4DV6 K;  5C10 A;  5FPM A;  3EYZ A;  3O4W A;  3WEE A;  1ZC6 A;  4C8K A;  5GIO A;  3CQX A;  4FLV A;  1N8R O;  3K5N A;  3OVN A;  3FZM A;  3U3G A;  3CME N;  5AQM A;  4KTW A;  1XNQ K;  1T6D A;  1MDU B;  1WUA A;  4AM6 A;  3SCX A;  4LF8 K;  4CEB A;  4M3R A;  3DRP A;  3E9P A;  4AF1 A;  3V9W A;  1NK6 A;  1GLL O;  2GWK A;  4CEF A;  2XY8 A;  3DM2 A;  3S41 A;  3HVR A;  4BGA A;  1N34 K;  4PL7 A;  1NGA A;  2WC9 A;  3MEE A;  1YJN N;  1VQ7 N;  3N4P A;  3T69 A;  1SS6 A;  3O3G A;  3VET A;  4OPA A;  2D1K A;  2E88 A;  2NRH A;  2O8C B;  1IKW A;  2PAV A;  3S3M A;  4PA1 A;  3C95 A;  1YJW N;  3HRG A;  5BN9 A;  5JS2 A;  1RTH A;  3QBX A;  4YY3 K;  2KFZ A;  3LDO A;  4IZ9 A;  4B08 A;  5GAE P;  4CK2 A;  2NRZ A;  4CIE A;  3TAP A;  4BRO A;  3DOK A;  2HBK A;  2ATQ A;  1HNV A;  2V7Y A;  3EN9 A;  1ATS A;  3EKS A;  4K41 A;  3QDK A;  1RT7 A;  4JKC A;  5DK5 A;  3CHW A;  4E1J A;  1Z05 A;  4CGD A;  4HUF A;  1NKE A;  4YOU A;  3L8B A;  1HNZ K;  4IDK A;  3HZ6 A;  3VQ8 A;  3QES A;  5JLH A;  3QO9 A;  2P1J A;  4IDH A;  3F9M A;  1C0T A;  2CGK A;  2HF3 A;  3LDQ A;  1RDW X;  3RMA A;  2KQ2 A;  2EHG A;  4JI2 K;  4B8A B;  4JS4 A;  3L4I A;  1Z26 A;  1OVQ A;  4DU4 A;  1I94 K;  4CIG A;  4ILH A;  4DTR A;  1BCM A;  3NH2 A;  4OVL A;  4BRK A;  4BRD A;  4MDB A;  3LDL A;  3RVC A;  3JYT A;  5AQT A;  3QER A;  3CXC M;  3ZSO A;  4ISG A;  4N47 A;  1LV5 A;  1YJ9 N;  5JS1 A;  5AR0 A;  4KI6 A;  1NWK A;  4WQ4 A;  1JKH A;  1OKJ A;  5HL7 L;  3CMA N;  4DU3 A;  3K57 A;  4MQ3 A;  1XUP O;  2P9L B;  1W7A A;  5AZJ B;  3O8M A;  4DMN A;  1ZBF A;  3SUO A;  4KHS A;  2E20 A;  5HLF A;  1NGJ A;  3VQQ A;  3AVN A;  2QI2 A;  3NVK A;  2KTQ A;  1BA1 A;  3KK2 A;  3OJU A;  4BG8 A;  3VGM A;  5AQU A;  2YHY A;  3IS9 A;  3LL3 A;  3ATV A;  4MLE A;  4B1Y B;  3RR8 A;  3LAL A;  1C1B A;  5LJW A;  4CFB A;  3UKU B;  1RT2 A;  3W3D A;  3OS2 A;  2QWL A;  3F5T A;  1KVA A;  4B9T A;  4CFD A;  3VQD A;  2RPI A;  4IKF A;  4ZTJ A;  3PLA A;  4C1N K;  3V6D A;  4ELU A;  1VSH A;  3WNE A;  3I55 N;  1SAZ A;  1YI2 N;  3AO4 A;  1VQ9 N;  4EIA A;  1IH7 A;  2P9S B;  4IO9 L;  4BRL A;  1SL2 A;  4DU1 A;  1C6V A;  4KHW A;  5I9E B;  4FJJ A;  3ENH A;  4B3R K;  2KZM A;  4H0V B;  3OYK A;  4JD2 B;  4B9Q A;  4KPY A;  4B9M A;  3OBY A;  3O9T A;  3A5L C;  1L3T A;  3OYL A;  3TPQ A;  4OPH A;  3N4Q A;  2E2P A;  4O0J A;  1X3N A;  4CZI A;  4E1N A;  5HRR A;  4FJ7 A;  5C12 A;  3ZSX A;  1KVC A;  3T19 A;  2ITG A;  4AHT A;  4N76 A;  2WFB A;  4LY7 A;  5FRM A;  3EO3 A;  4ELT A;  3ZX3 A;  3SYZ A;  1IG9 A;  4BE0 A;  2JLE A;  5AQG A;  1TGO A;  3VQB A;  2XY7 A;  4JKD A;  5E26 A;  2CGJ A;  4PY5 A;  3CFO A;  3UKU A;  4AHC A;  3CM6 A;  1HUX A;  3SAH A;  1HKG A;  4NO7 A;  3HYF A;  2ZJP L;  4DV0 K;  3THV A;  4B9S A;  4DR6 K;  2HHQ A;  1BL3 A;  2BE2 A;  3JS6 A;  2FBX A;  3RSE B;  2G8K A;  3V81 A;  5KGW A;  3M1F A;  1NK8 A;  4I9L A;  1UAX A;  4CHY A;  4F2R A;  1N36 K;  1Q81 O;  4CJK A;  4IFE A;  1WN7 A;  2HBL A;  1IBM K;  3OYI A;  4CJR A;  1NGF A;  1RBS A;  2G8I A;  1BCO A;  1NNE A;  5GAG P;  4YFU A;  1QZ5 A;  4X65 K;  4E7J A;  2D0A A;  3ZX0 A;  2NRW A;  3GBT A;  3EE8 A;  4E89 A;  3LZJ A;  4K8X A;  2G8F A;  5AQX A;  3WXI A;  1NMD A;  3PO4 A;  1X9W A;  2G8H A;  1RBR A;  1QQO A;  4FWQ A;  3CCU N;  4DHY A;  1YVU A;  3O4N A;  3ZT2 A;  3KWG A;  3MN5 A;  4IJN A;  2ZJQ L;  3ZLJ A;  3RSE A;  3D2F B;  4BC3 A;  1U47 A;  1ILY A;  3MWT A;  1P8Z A;  2QWR A;  1RTI A;  3SV3 A;  2BDP A;  4BRC A;  1N6Q A;  3D2E A;  2Q1N A;  5AQY A;  1OH7 A;  3PIP L;  1A5V A;  1JXB A;  5KI6 A;  1H1V A;  1RFQ A;  2I5J A;  1Z6R A;  1K6Y A;  4E7L A;  4DV7 K;  3VES A;  4DV5 K;  3S3N A;  4WF9 L;  1SUQ A;  3ID8 A;  5E84 A;  2X6N A;  3LP1 A;  2ASM A;  4JHD B;  1QQC A;  5CE3 A;  4Z94 A;  3TAM A;  2Z1G A;  1FKP A;  2W40 A;  2F8T A;  2E4L A;  1S1V A;  3CI5 A;  3C65 A;  4CER A;  3ZYY X;  4CES A;  3S9H A;  3KLG A;  2E8A A;  3B6O A;  3V1Q A;  4BR7 A;  4H0O A;  5KQ8 A;  2Q36 A;  2OA8 A;  3DLL L;  1VSI A;  3SQ2 A;  1S3X A;  1QSY A;  4HCB A;  2D5R A;  3CG7 A;  3K9K A;  3AVK A;  4CFC A;  1RDU A;  4JI5 K;  4O44 A;  4A59 A;  4FJX A;  4CHN A;  3AGR A;  1FKO A;  4B1V A;  4B9L A;  4CK3 A;  3AVM A;  3B8A X;  4CJ5 A;  4IOX A;  4XH5 A;  3K59 A;  4MLH A;  2BUP A;  3WT0 A;  3AVC A;  4DB3 A;  2RKI A;  1ZBS A;  4Q5V A;  3HM9 A;  2HMP A;  2QTD A;  1QS4 A;  3EZ5 A;  4WFB L;  4FWS A;  3IAY A;  1TK0 A;  3VQ7 A;  3HSC A;  1GLF O;  3DLE A;  5HRS A;  4K43 A;  1NK4 A;  1BG3 A;  3TSQ A;  1RGI A;  3FFK B;  4EAH D;  5AQI A;  1TAQ A;  4DSL A;  3AAP A;  4ID1 A;  1NOY A;  3AGK A;  4J2A A;  2IOC A;  4O8U A;  4CFA A;  3MMV A;  3RRG A;  3E01 A;  4NXM K;  1BIU A;  3CCJ N;  3O80 A;  3NH1 A;  3AA2 A;  4CZM A;  4BE2 A;  2A1S A;  1T7P A;  4O55 A;  1UA0 A;  3JXU A;  1BI4 B;  4KRE A;  2AJQ A;  4CJF A;  1HMV A;  3VQP A;  1HPZ A;  1U2V B;  2XY6 A;  3ZSQ A;  4DTM A;  4PKH A;  1T6C A;  4HWI A;  1WSG A;  3ZSZ A;  2E6L A;  5EXW A;  4FK0 A;  3VN5 A;  1RDA A;  1DTT A;  5J2N A;  3VQA A;  4H5R A;  5BPL A;  1KAX A;  1HYV A;  3O9S A;  3H3O B;  4CZL A;  2NZT A;  3MN7 A;  3QFP A;  1J54 A;  4FVM A;  3QEX A;  4CJU A;  4CGH A;  3CFP A;  1RBT A;  4RW9 A;  4EHU A;  4YOT A;  3TSU A;  1SKR A;  4KH4 A;  2O8E A;  3T7Z A;  3SAG A;  2ZF5 O;  1HNI A;  2A40 A;  4FVU A;  4QS7 A;  1BU6 O;  1Y64 A;  4WQ4 C;  3VGK A;  1LAV A;  5KGX A;  2IVP A;  1QHT A;  2F9W A;  4PUO A;  2FF3 B;  1K8A O;  4FJI A;  4GW6 A;  1U04 A;  2YNG A;  4Z4F A;  4DR1 K;  2P9I B;  2ZM6 K;  3RWU A;  3ATU A;  1GOB A;  1GLE G;  1JLA A;  2ZJR L;  1YTA A;  4JI0 K;  3LAN A;  3PSI A;  5JMV A;  1VQP N;  1QZ6 A;  3HM8 A;  3ASM A;  2X74 A;  1C1A A;  5BN8 A;  3G4S N;  4HTL A;  5C25 A;  5JIC A;  4BDP A;  4ISE A;  2WON A;  3DI6 A;  2GBZ A;  5DM6 L;  1GLJ O;  2Z1I A;  4JK8 A;  1BA0 A;  2WOM A;  3HO1 A;  4CEZ A;  2HBM A;  3OHR A;  5D3G A;  5CYQ A;  1DGK N;  4LF5 K;  4W5N A;  3E66 A;  2E1Z A;  3NE6 A;  1Z25 A;  2P9K A;  3D0P A;  1XNR K;  5LMN K;  1LWC A;  4U7B A;  3ISN C;  3OA9 A;  3KZB A;  2XRI A;  2GWJ A;  1KAZ A;  3J80 O;  4OGC A;  2D4W A;  2NNW A;  5DM7 L;  2P9P A;  4FCY A;  4CK1 A;  4CZJ A;  3IKM A;  1JLG A;  3VEO A;  3SJH A;  4PQU A;  5CYM A;  3L4Q A;  4CGJ A;  3ZEU A;  4M3X A;  2HNZ A;  5HRP A;  4DQI A;  3OYF A;  4UY8 O;  1JLB A;  5LY3 A;  3A5O C;  2HHV A;  2YX6 A;  1WOQ A;  3SLC A;  4FK2 A;  3HPH A;  1K8K A;  3AAR A;  3WEE B;  3HBT A;  4GY2 B;  4HCC A;  1KFS A;  3I0S A;  4LFC K;  3K5O A;  1ZBH A;  3M8R A;  3U9D A;  4H0X B;  4ISF A;  4FZZ A;  4C1N I;  1LWE A;  1VQM N;  2IC3 A;  5AQH A;  5HBM A;  3ENO A;  3DLB A;  4NYN A;  3FR0 A;  3DJC A;  1SL0 A;  2OAN A;  1S5J A;  2HHW A;  4RW6 A;  4DS5 A;  5KTQ A;  4BRI A;  4DUY K;  1O13 A;  2YHB A;  4JI1 K;  1IKX A;  1VSE A;  2A3Z A;  1GLC G;  3NH0 A;  1C1C A;  1NMN A;  1NU0 A;  2DY4 A;  3TAG A;  4X66 K;  3DYA A;  3LP2 A;  3OJS A;  4NB4 A;  3HXM A;  1MU2 A;  3AO1 A;  2QA4 N;  3PX0 A;  4EZ6 A;  4TSX A;  4FJ9 A;  4CJ4 A;  1XWL A;  3L2W A;  4H03 B;  3GL1 A;  1B9F A;  4E3S A;  4B1X B;  2HVI A;  4L8R B;  1VQO N;  3AAQ A;  3WXJ A;  4JK7 A;  3VEW A;  3R9P A;  4CED A;  3M6G A;  4IJA A;  3O08 A;  1W2B M;  4JKF A;  4JRP A;  4IXC A;  1WBD A;  4JI3 K;  3W0L A;  5CZ1 A;  3R3L A;  1JCF A;  4G1Q A;  4XIU A;  4A2B A;  4NCG A;  1IKY A;  4GVE A;  3ULE A;  4CJL A;  4NLB A;  1N32 K;  4OKJ A;  3OYM A;  4FWK A;  4DV4 K;  5C0Y A;  3BF1 A;  2P9N A;  4DF4 A;  3VQC A;  1S1U A;  2VG5 A;  1CXU A;  4KHQ A;  3QIO A;  3SNN A;  3P31 A;  4DLG A;  3V9Z A;  3KK3 A;  2KFN A;  3TAQ A;  4GV3 A;  3PV8 A;  1JCG A;  4KHN A;  1L3V A;  3CJ1 A;  3U3Y A;  4Q0B A;  4M3U A;  1JL1 A;  2A42 A;  3P83 D;  2Q97 A;  4BR4 A;  3L3V A;  5C42 A;  1BIS A;  1KRP A;  4EZ9 A;  3K2P A;  4QAG A;  1T8E A;  2YHX A;  4I6M A;  4M63 C;  3FE1 A;  3QET A;  2NLX A;  2VQE K;  2FF6 A;  2E1Y A;  4FWR A;  3KLH A;  4FLW A;  3AA4 A;  1I39 A;  2WUS A;  4IEI A;  4DFK A;  3P38 A;  4KHY A;  3OYA A;  4DTJ A;  4C8N A;  3KD5 E;  1VQN N;  3AA5 X;  2DFF A;  1EET A;  3M5R A;  3CPE A;  4H0T B;  3C6A A;  3AO3 A;  1NJW A;  4OO1 J;  2O4G A;  5AZI A;  3CCM N;  1QVF M;  4R5P A;  1WNS A;  1SQK A;  3G6E N;  4N5S A;  4FO0 A;  2Q0U A;  1RNH A;  3HPG A;  1NGH A;  1C0G A;  4FWO A;  2GEM A;  2O4I A;  4W5Q A;  5SZT A;  5JVG L;  1XQS C;  4RW8 A;  1Q86 O;  1QSS A;  2DFH A;  3T1H K;  2PYL A;  4PHT X;  1VRU A;  2KKZ A;  5MLC Q;  2RF2 A;  1E3M A;  4ELV A;  3A2F A;  3IMX A;  1EWR A;  3AVH A;  1S9E A;  3TWH A;  4LH4 A;  5ELZ A;  5C24 A;  1U45 A;  2P5G A;  4FJG A;  3ZCM A;  1WSI A;  1T03 A;  2JGU A;  4KH6 A;  3IFR A;  4E7K A;  4CJ3 A;  4DS4 A;  3AO5 A;  2YI1 A;  4OKK A;  3I0R A;  3VA3 A;  3F2K A;  3V1O A;  3J81 O;  1NGE A;  5C2D A;  1LAW A;  3VQ4 A;  1UA1 A;  4B9V A;  3TTD A;  5IT9 O;  1RTD A;  1SKW A;  4FLX A;  2ZE2 A;  3EY1 A;  4JAX A;  4QS9 A;  1V4S A;  1RIL A;  2YNI A;  3QNN A;  1WSJ A;  1DEJ A;  4NYF A;  1HX1 A;  2V51 B;  4KV8 A;  1TL3 A;  2HVH A;  1X1P A;  3VGL A;  2F4V K;  1HLU A;  4BC2 A;  4QOZ B;  3SQ1 A;  2A6A A;  1J9A A;  3L2V A;  1WB9 A;  2X6S A;  2VYP A;  1OH6 A;  4FZY A;  4DF8 A;  2P51 A;  2Z1J A;  4O4G A;  3FFI A;  4O0I A;  1NK5 A;  1S22 A;  4B1Z A;  5I42 A;  3BGR A;  3H08 A;  3SQ4 A;  3Q7C A;  2D0B A;  3WNG A;  1Q18 A;  4WE1 A;  4AM7 A;  4BDZ A;  4KB1 A;  4M3Z A;  4AQY K;  2F9T A;  5JLF A;  4JKA A;  3QNO A;  3ULD A;  3HP9 A;  3SK3 A;  3K0S A;  4DTS A;  3HK2 A;  4Z0U A;  1K73 O;  4WQ5 C;  2NRR A;  4GMJ B;  2EWS A;  1O1W A;  3BF3 A;  4Y1D A;  3MXJ A;  1VHX A;  4CJQ A;  4KHU A;  1EWQ A;  1IO2 A;  4CJ7 A;  5GAH P;  1XI1 A;  1HR0 K;  3TAB A;  5KPR A;  1KXP A;  5EY4 A;  5A2Q O;  1CXQ A;  3D2E B;  4AHU A;  4IG0 A;  3A5M C;  4FLU A;  1RTJ A;  4IWV A;  1E4F T;  4WFN L;  4M7Y A;  5FPD A;  4F8R A;  4JKE A;  2FBV A;  4M41 A;  5FPN A;  3F73 A;  1CZB A;  5FRO A;  3SQ0 A;  5AQJ A;  3C7N A;  4FLZ A;  1UOC A;  2D0C A;  3VTH A;  4F9O A;  1XHX A;  3O4Q A;  1QHA A;  1Q9Y A;  5EX5 A;  4WCE L;  2KHO A;  4DSI A;  1IBK K;  3ZT4 A;  3U6F A;  4RW4 A;  3CCE N;  3TAF A;  3HST B;  3C6U A;  2FSN A;  1SKS A;  1N33 K;  1U6Z A;  3O9Q A;  3AY9 A;  3HI0 A;  1XC3 A;  4DR2 K;  4M3T A;  3VQ6 A;  4GV9 A;  2I7P A;  2O8B A;  3CPW M;  3MXI A;  1IBL K;  4M3W A;  4DSJ A;  3D45 A;  3KKS A;  4LF9 K;  3SBG A;  4DQP A;  4FJL A;  3MDQ A;  3AVL A;  3O5B A;  3ZSV A;  1R0A A;  1RBV A;  2AP1 A;  1TK5 A;  1FK9 A;  3DRS A;  3VEZ A;  4DLE A;  4J2B A;  3DXK A;  3PSF A;  4ZTF A;  1D5A A;  4CJP A;  3J7A P;  1RT4 A;  4KO0 A;  4E19 A;  3TI0 A;  4LF6 K;  4OPJ A;  3U8X A;  3HOT A;  2AA4 A;  1QQN A;  2QK9 A;  2D0P A;  4XH4 A;  3ZT3 A;  3OW2 M;  3MWP A;  4O8K A;  4OGE A;  4DQR A;  1KVB A;  1EKE A;  1VQ6 N;  3BEX A;  3S3O A;  3C6H A;  1S6Q A;  3WNH A;  4R79 A;  4N56 A;  1KCF A;  3KVG A;  4PWD A;  1MA9 B;  3DLH A;  1VQ4 N;  4H5W A;  2W6L A;  3VMF B;  1JLE A;  2HMI A;  3THY A;  2ASO A;  1ASW A;  3CJA A;  1KLN A;  1MWM A;  1HPM A;  4CBU A;  3THX A;  3U4L A;  2WBN A;  5AQZ A;  4CJS A;  4NCA A;  2KW4 A;  1SZ2 A;  1RDB A;  5J2M A;  1QQM A;  1U49 A;  1HKC A;  3VA0 A;  3MK6 A;  4CEC A;  1TKZ A;  2CH5 A;  5AQO A;  1JLF A;  3PX6 A;  1VK0 A;  3P39 A;  3HT3 A;  2G8W A;  1M1K O;  1Y97 A;  4BWM A;  3IG1 A;  1FW6 A;  1RT5 A;  4CGI A;  1K9M O;  3R8E A;  1U4B A;  3KKR A;  4JI6 K;  4FM2 A;  3ZT0 A;  1J5E K;  4JKG A;  5CY4 A;  4JN4 A;  4RWT A;  2F7T A;  1BGX T;  4YDU C;  4A5A A;  2YKN A;  3FZF A;  3CCL N;  3GE1 A;  1HNW K;  2ETJ A;  3NBP A;  4K42 A;  4A57 A;  2O8E B;  3THW A;  4C8L A;  2OZM A;  4AIL C;  1VSL A;  3WXM B;  5AQF A;  4JEP A;  4F4K A;  2P9U A;  2HST A;  2IAJ A;  3OYB A;  4LSN A;  1NK7 A;  4FPA A;  4DR3 K;  1XC9 A;  4DR4 K;  4DTO A;  4CEQ A;  4CI6 A;  3CF5 L;  3PX4 A;  2A41 A;  3RMB A;  1LW2 A;  3CJ9 A;  3J7Y P;  3BZC A;  4C23 A;  1Q8I A;  5M1P A;  3T1A A;  1HYS A;  3R6M A;  4CF9 A;  1ZXO A;  3L2U A;  3CJ7 A;  3LWM A;  4H0Y B;  5AJ3 K;  3NHG A;  4BRH A;  3E9O A;  1ATN A;  3O1B A;  5EU7 A;  1S1W A;  1S6P A;  3EL2 A;  3TAR A;  3LAK A;  3ZET A;  3SUQ A;  3AVB A;  2YKM A;  2HHU A;  5BPM A;  3OTO K;  4JI8 K;  3DXM A;  1YVN A;  1RT3 A;  1WSF A;  4O5F A;  3LPT A;  4HVJ A;  2JWK A;  3P4I A;  5AFU H;  1L3U A;  3MAQ A;  3NF8 A;  3QB0 A;  3M8P A;  4CEA A;  1VQL N;  3BP8 A;  4OPK A;  2OTL N;  3KHY A;  5C2F A;  1YIT N;  1NLV A;  4H5T A;  2PY5 A;  2P9K B;  4FLT A;  1NGI A;  5HP1 A;  3MXM A;  4MO5 A;  3AVJ A; 
#chains in the Genus database with same CATH homology
 5AQR A;  4JK7 A;  3VEW A;  3LL3 A;  3R9P A;  3ATV A;  3D6R A;  3M6G A;  2P9P B;  4MLE A;  4B1Y B;  1NGB A;  3ID6 A;  3O08 A;  4IJA A;  4JKG B;  5H1S Q;  1W2B M;  5LJW A;  4JKF A;  3I56 N;  4FWN A;  3E1Y A;  4IXC A;  3UKU B;  2ASP A;  2DPN A;  3W3D A;  1S72 N;  3W0L A;  2QWL A;  5ADX H;  2VCP A;  1JCF A;  3F5T A;  3R3L A;  4FL9 A;  4JNE A;  4A2B A;  4A62 A;  4YOY A;  1IG8 A;  5GIP A;  3FZL A;  4GVE A;  3ULE A;  3ZEU B;  4NLB A;  5BPN A;  3PLA A;  4C1N K;  3CJC A;  2P9U B;  4J8F A;  5AQQ A;  2HF4 A;  3U9Z A;  3VEV A;  4FWP A;  3I55 N;  4FWK A;  1SAZ A;  1YI2 N;  1VQ9 N;  5C0Y A;  3BF1 A;  2P9N A;  1LOT B;  4EIA A;  4FOI A;  2P9S B;  4KBO A;  2GTD A;  4IO9 L;  5BRD A;  4BRL A;  1K8K B;  1JJ2 M;  4WQ5 A;  3MN9 A;  1OVY A;  3EKU A;  5EVZ A;  5F2R A;  3D2F A;  3P31 A;  5I9E B;  3ENH A;  4H0V B;  4JD2 B;  1ATR A;  2NRX A;  3SMS A;  4B9Q A;  4GV3 A;  2QWO A;  3OBY A;  3O9T A;  3A5L C;  1JCG A;  1YUW A;  4L3Q A;  3TPQ A;  4OPH A;  3N4Q A;  2E2P A;  3CJ1 A;  3CC7 N;  3G25 A;  5AQP A;  1W97 L;  1X3N A;  2A42 A;  4ILG B;  4CZI A;  3UE5 A;  3OBW A;  5C12 A;  4JKH A;  2WFB A;  3SBT A;  2Q97 A;  3EO3 A;  4CZK A;  3ZX3 A;  4BR4 A;  3CET A;  1E4G T;  5AQG A;  3CCR N;  3ZET B;  1YAG A;  4JKD A;  4RTF D;  2FXU A;  2CGJ A;  4NLC A;  5E26 A;  2QWQ A;  4FPB A;  2OTJ N;  2YHX A;  4I6M A;  4M63 C;  3UKU A;  3FE1 A;  4U67 L;  2NLX A;  1HUX A;  3DXM B;  1HKG A;  2NRV A;  4NO7 A;  5M1O A;  3VEX A;  1GLB G;  4EFH A;  2FF6 A;  3LDN A;  2ZJP L;  1YHQ N;  2E1Y A;  1T3V A;  4FSV A;  5F0X A;  5CHI A;  4IO8 A;  4FWR A;  3CJB A;  3JS6 A;  3RSE B;  2CH6 A;  1JCE A;  3L0Q A;  4JHD A;  4H0P A;  2E2Q A;  2WUS A;  3M1F A;  4IEI A;  3P38 A;  3CC2 N;  4A61 A;  4BRF A;  3MCA B;  3DWL A;  3TSP A;  1Q81 O;  4PKI A;  1VQN N;  3O1W A;  2FLO A;  3M5R A;  1BDG A;  5JVH L;  4IFE A;  2HBL A;  3CPE A;  4H0T B;  3C6A A;  3SAF A;  4B1U B;  2Q31 A;  4OO1 J;  3VF6 A;  1TYQ A;  3WQT A;  1NGF A;  5AZI A;  4CZG A;  4BRP A;  3CCM N;  1QVF M;  1SQK A;  5GAG P;  1QZ5 A;  3G6E N;  4CD1 A;  4FO0 A;  2Q0U A;  1TUU A;  4RCH A;  3ZX0 A;  2NRW A;  3GBT A;  3EE8 A;  5AQX A;  3CER A;  1NMD A;  1NGH A;  3ULE B;  3WXI A;  4YOV A;  1C0G A;  1QQO A;  4FWO A;  5C15 A;  4FWQ A;  2QWN A;  2GEM A;  1IJJ A;  4DHY A;  5KPT A;  3CCU N;  5AQW A;  2P9N B;  2GUP A;  5JVG L;  1XQS C;  4XH1 A;  1Q86 O;  4BR2 A;  3KWG A;  3IDH A;  3MN5 A;  4IJN A;  4PHT X;  2KKZ A;  5MLC Q;  2ZJQ L;  3RSE A;  3D2F B;  3IMX A;  4M7X A;  5BR9 A;  3H3N O;  4BC3 A;  5ELZ A;  4BQL A;  1Q7Y O;  1ILY A;  4KH6 A;  5AQV A;  3IFR A;  3MWT A;  5TKW A;  1P8Z A;  2QWR A;  2ZWH A;  3H1Q A;  2YI1 A;  3I33 A;  5HOO A;  1BUP A;  1NBW A;  4BRC A;  3PIO L;  3F2K A;  3VPZ A;  1NGE A;  5C2D A;  5M1F A;  1VQ5 N;  3D2E A;  2Q1N A;  5AQY A;  3TTD A;  3UB5 A;  3PIP L;  5CR4 A;  1X3M A;  3M3Z A;  2GX9 A;  3LM2 A;  2QM1 A;  1H1V A;  1RFQ A;  3CCS N;  1Z6R A;  4I6M B;  4JAX A;  4QS9 A;  4BRA A;  1V4S A;  3H45 C;  3VES A;  4WF9 L;  3CQY A;  3MX5 A;  1DEJ A;  2CGL A;  3ID8 A;  2VGM A;  5E84 A;  1X9J A;  3DAW A;  1HX1 A;  3WXL A;  2V51 B;  1U2V A;  2ASM A;  4JHD B;  4A2A A;  5CE3 A;  4Z94 A;  4BVO A;  3UKR A;  2W40 A;  3VGL A;  3CC4 N;  1HLU A;  5BRF A;  4BC2 A;  3CI5 A;  3C65 A;  3CIP A;  2YJE A;  3ZYY X;  4IOA L;  2A6A A;  2HOE A;  4H5V A;  3K9J A;  2E8A A;  3EE9 A;  4BQZ A;  4DKW A;  2VYP A;  4BR7 A;  1NGC A;  4H0O A;  5KQ8 A;  2Q36 A;  5GIN A;  4H5N A;  3DLL L;  1TYQ B;  1NJI O;  2NRT A;  3GG4 A;  5AZI B;  3H6E A;  1S22 A;  1S3X A;  4B1Z A;  2Q0R A;  4YDU A;  1EO1 A;  2YCH A;  5AQS A;  1R59 O;  3K9K A;  3LM9 A;  3Q7C A;  1RDU A;  4BRQ A;  1BO5 O;  5GAD P;  1NGD A;  5AQK A;  1Q18 A;  4A59 A;  4AM7 A;  3AGR A;  3VF4 A;  2ZGZ A;  2F9T A;  4B1V A;  5JLF A;  3A8Y A;  4JKA A;  3B8A X;  4IOX A;  4XH5 A;  3MX2 A;  3SK3 A;  1KAY A;  3QIC A;  2IVO A;  2BUP A;  4MLH A;  3WT0 A;  4CBX A;  2UYT A;  4DB3 A;  3WXK A;  1G99 A;  1ZBS A;  3A5N C;  4MO4 A;  3WXJ A;  4KH5 A;  4BR5 A;  2HMP A;  2QTD A;  1K73 O;  1MWK A;  2NRR A;  4WQ5 C;  4FWS A;  4WFB L;  2EWS A;  3E9L A;  3HOS A;  3BF3 A;  4CD3 A;  3HSC A;  4BR9 A;  3NMU A;  5BRH A;  1GLD G;  1GLF O;  5KQD A;  4Y0W A;  3KWI A;  4FOE A;  1LCU A;  3VF2 A;  1ESV A;  4K43 A;  4CJ7 A;  5GAH P;  3HTV A;  5LJV A;  3ENB A;  1NM1 A;  1BG3 A;  3I8B A;  3TSQ A;  5KPR A;  2BTF A;  5AQN A;  1KQS M;  1KXP A;  1RGI A;  3FFK B;  2E2O A;  4EAH D;  5AQI A;  1V4T A;  3AAP A;  4BR0 A;  2V52 B;  2P9I A;  3AGK A;  5EY4 A;  2ZGY A;  2PBD A;  2HBJ A;  1P90 A;  4O8U A;  3MMV A;  4DCH A;  5EOY A;  3D2E B;  3A5M C;  3SMP A;  3CCV N;  4IWV A;  4PKG A;  3CCJ N;  1E4F T;  3O80 A;  3TU5 A;  4CZM A;  5B8H A;  1BWF O;  4WFN L;  4M7Y A;  5FPD A;  4JKE A;  1J6Z A;  3JXU A;  3QFU A;  4CZE A;  5FPN A;  2QWM A;  3VEY A;  4A5B A;  5AQJ A;  3C7N A;  4BG9 A;  2FSK A;  3VTH A;  2A5X A;  4F9O A;  4FWM A;  3QBW A;  1NGG A;  4BY9 C;  2PFU A;  2YHW A;  1QHA A;  5EX5 A;  5M1K A;  4WCE L;  2KHO A;  3VEN A;  1U2V B;  5M1N A;  2RHK A;  4FWL A;  4BVP A;  3CCE N;  4PKH A;  2H3G X;  1T6C A;  3UKR B;  2FSN A;  4HWI A;  4BRN A;  3MN6 A;  4MDA A;  1U6Z A;  3O9Q A;  4IEE A;  4JKB A;  3AY9 A;  5EXW A;  4YOW A;  3HI0 A;  1XC3 A;  4H5R A;  5BPL A;  1KAX A;  3GDQ A;  1YIJ N;  3O9S A;  3H3O B;  4CZL A;  2I7P A;  2NZT A;  1BOT O;  3MN7 A;  3QFP A;  3VOV A;  4GV9 A;  2QW9 A;  4BRM A;  3CD6 N;  2I7N A;  3CPW M;  3D7E O;  2IIR A;  3C0B A;  1CZA N;  3IUC A;  3MCP A;  3WUH A;  4EHU A;  4CZH A;  4YOT A;  2J4R A;  3SBG A;  3TSU A;  4KH4 A;  4DQ8 A;  3T7Z A;  3MDQ A;  5M1Q A;  2W41 A;  3O5B A;  4YOX A;  3SAG A;  2BH1 A;  2AP1 A;  1VAZ A;  2ZF5 O;  3Q7B A;  5KPZ A;  2A40 A;  3O9U A;  4LC9 B;  2ITM A;  4FVU A;  2FSJ A;  3VEZ A;  4QS7 A;  4G9Z A;  3FGU A;  3SAH A;  1HKB A;  1BU6 O;  3DXK A;  4WFA L;  4BRE A;  3R1X A;  1Y64 A;  4WQ4 C;  4BGB A;  5C10 A;  4GNI A;  5FPM A;  3O4W A;  3VGK A;  1ZC6 A;  3WEE A;  1TUY A;  5GIO A;  3CQX A;  1N8R O;  2IVP A;  3U8X A;  3HOT A;  2AA4 A;  2F9W A;  3FZH A;  1QQN A;  3FZM A;  2FF3 B;  3CME N;  2D0P A;  4GV6 A;  5AQL A;  5AQM A;  4XH4 A;  3OW2 M;  1Q82 O;  1K8A O;  1T6D A;  2VGN A;  3MWP A;  4O8K A;  1MDU B;  1DKG D;  2IVN A;  4PL8 A;  1WUA A;  3BEX A;  1VQ6 N;  3C6H A;  4AM6 A;  3TTF A;  3J8A A;  4R79 A;  3E9P A;  2P9I B;  4AF1 A;  1HJO A;  1GLL O;  2GWK A;  1MA9 B;  3ATU A;  3KVG A;  1GLE G;  1VQ4 N;  2ZJR L;  4H5W A;  3VMF B;  5JMV A;  1VQP N;  2KLA A;  3S41 A;  2D0O A;  2ASO A;  4BGA A;  1T44 A;  3CJA A;  3WQU A;  1QZ6 A;  3O6W A;  4PL7 A;  1NGA A;  2WC9 A;  2E2N A;  1DT9 A;  1MWM A;  3HM8 A;  2YJF A;  1YJN N;  1HPM A;  4CBU A;  1VQ7 N;  5BN8 A;  3U4L A;  1C0F A;  3N4P A;  3T69 A;  1SS6 A;  2WBN A;  3LDP A;  5AQZ A;  3G4S N;  3VET A;  2RE2 A;  4HTL A;  5JIC A;  4OPA A;  3C7N B;  4K25 A;  1SZ2 A;  2VWB A;  4ISE A;  3G71 N;  2D1K A;  2E88 A;  2P9L A;  5AZJ A;  2NRH A;  2PAV A;  5DM6 L;  4B1W B;  1GLJ O;  1QQM A;  1YXQ A;  4JK8 A;  1BA0 A;  1HKC A;  5F1X A;  1YJW N;  3L6Q A;  3MK6 A;  2HBM A;  1GLA G;  2CH5 A;  3HRG A;  3OHR A;  5AQO A;  5BN9 A;  3VTI A;  3QBX A;  1DGK N;  3P39 A;  5TKY A;  3E66 A;  2E1Z A;  3LDO A;  4IZ9 A;  5GAE P;  1M1K O;  2P9K A;  2NRZ A;  4CBW A;  3FZK A;  4BRO A;  4U7B A;  1K9M O;  3OA9 A;  3KZB A;  3R8E A;  2GWJ A;  1KAZ A;  1VQK N;  2D4W A;  2NNW A;  5DM7 L;  2P9P A;  2GEL A;  2HBK A;  4JKG A;  4CZJ A;  3IKM A;  4JN4 A;  2F7T A;  4RWT A;  1M90 O;  1EQY A;  2V7Y A;  4YDU C;  4A5A A;  3VEO A;  3FZF A;  3CCQ N;  4ILJ A;  4JK9 A;  3SJH A;  3GE1 A;  3CCL N;  3EN9 A;  1ATS A;  4K42 A;  3EKS A;  4YOR A;  4A57 A;  3L4Q A;  4K41 A;  3QDK A;  4JKC A;  4EHT A;  2JWL A;  1KD1 O;  3ZEU A;  3WXM B;  5AQF A;  4JEP A;  3CHW A;  2P9U A;  4XEI A;  2HST A;  4CZF A;  4E1J A;  1Z05 A;  4YOU A;  4UY8 O;  2QWP A;  4FPA A;  5LY3 A;  3A5O C;  3DXK B;  2YX6 A;  3QML A;  3FLC O;  1WOQ A;  3HZ6 A;  3NVM A;  4CI6 A;  3SLC A;  2P9S A;  3CF5 L;  2A41 A;  1K8K A;  3AAR A;  3WEE B;  3HBT A;  4GY2 B;  5JLH A;  2QEX N;  3CJ9 A;  4IDH A;  3F9M A;  4BRG A;  4C23 A;  2CGK A;  2HF3 A;  3LDQ A;  1RDW X;  4H0X B;  4ISF A;  5M1P A;  2V7Z A;  3U9D A;  5AFU A;  4JD2 A;  4C1N I;  3J7Z O;  2Q2R A;  3L4I A;  3R6M A;  1VQM N;  5BRE A;  1ZXO A;  4WYB A;  5AQH A;  3CJ7 A;  3ENO A;  1VQ8 N;  4H0Y B;  4ILH A;  3H46 O;  3FR0 A;  3E9O A;  1ATN A;  3DJC A;  3O1B A;  4BRH A;  4BRK A;  4BRD A;  2OAN A;  2QXL A;  3LDL A;  4MDB A;  3RVC A;  5AQT A;  3VER A;  5FPE A;  3CXC M;  4IOC L;  4ISG A;  3EL2 A;  4BC4 A;  3ZET A;  4BRI A;  1YJ9 N;  1O13 A;  5AR0 A;  5BPM A;  1NWK A;  2A3Z A;  3GOI A;  4WQ4 A;  1OKJ A;  5HL7 L;  3CMA N;  1GLC G;  3DXM A;  1QVG M;  1YVN A;  4O5F A;  1KC8 O;  5ADX A;  2JWK A;  3P4I A;  5AFU H;  1YF5 L;  1XUP O;  2P9L B;  3EZW A;  5AZJ B;  3O8M A;  1D4X A;  3H1V X;  3QB0 A;  2E20 A;  3TTC A;  1NGJ A;  1VQL N;  4QS8 A;  3BP8 A;  4NB4 A;  3BUZ B;  2OTL N;  2QI2 A;  3A0I X;  3KHY A;  5C2F A;  2QA4 N;  1YIT N;  1NLV A;  3NVK A;  4H5T A;  3ZX2 A;  4H03 B;  4BC5 A;  1BA1 A;  3GL1 A;  2P9K B;  3O9R A;  4BG8 A;  1NGI A;  3VGM A;  5AQU A;  4B1X B;  1VQO N;  3KK7 A;  3AAQ A;  4MO5 A;  2YHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...