3MEDA

Hiv-1 k103n reverse transcriptase in complex with tmc125
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 150
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3medA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3medA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3medA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3medA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3medA05
4W5QA 3L2UA 1NOYA 4Y2AA 2GIRA 4J9OA 4CHQA 1LWFB 4CJUA 4LD0A 3D45A 3VQ9A 3H4BA 3RB0A 4CFCA 5F8MA 1A5WA 1S0NA 1JLEB 3HKWA 5EUHA 2DFFA 4CJQA 3NHGA 5KFBA 3LANA 5KFDA 4XPEA 5HBMA 1N56A 3P83D 2J6SA 3V9SA 3VA3A 4YR0A 3NGDA 3KK3B 1TKZB 3OYLA 2FC0A 2X74A 1S1VB 3DLHA 5J2QA 1CSJA 3EPIA 5KFTA 5HROB 3KLFA 2DPJA 1LW0B 2G8FA 4G3IA 2IM3A 5CY4A 4JRPA 5DG7A 4MKAA 3RAQA 3IG1A 4HHTA 3OL9A 4YNQA 4X2BA 1JXEA 3O3HA 4RW6B 3N6NA 1S6QA 4IDKA 3MXMA 2WONA 4OL8A 2FVRA 3L2RA 1G15A 1I6JA 4F4YA 3DLKB 4LH4A 3PHEA 2P5GA 1TAUA 1SUQB 4DTRA 3QINA 3DMJB 4KHSA 4F3OA 1K6YA 1IKXA 3G6XA 3SYZA 4FVMA 1RA7A 4YMEA 3SI6A 4G1QB 4Y3CA 3ZSQA 2D3ZA 1ZTTA 4ED6A 4IKFA 1WSFA 4DL5A 2KW4A 1MMLA 1GOCA 1TV6A 1EP4B 1U49A 3THVA 2ASLA 4E7HA 1SL1A 4FZYA 3GIJA 3TANA 3ZSVA 2YHBA 5D3GB 3PUFA 4WZMA 4DTJA 4KRFA 3OL8A 1CZ9A 4PWDA 3RMDA 1J53A 4B9MA 4YR3A 1W0HA 1JLFB 5KT7A 3PJXA 5I42A 4RNNA 4NCAA 4QWEA 3IRXA 1N5YB 2YNHA 2W9BB 4F4ZA 1HYVA 2FJVA 4NLSA 4KI4A 1KFDA 3I5BA 4BACA 2YKMB 2IDOA 4K8XA 5CYMA 3V1OA 1LWEB 3DM2B 4PUOB 2QE5A 1U47A 4FLTA 3PX6A 2R7YA 4B9LA 5KG6A 1A5XA 1REVA 4JV2A 2WOMB 3H4DA 2UUTA 1HPZB 2B6AA 4EBDA 4HTUA 4IFVB 2OPSB 3V9WA 3RB6A 1KLNA 1RT3A 3SUOA 4DS5A 5HLFA 2C2EA 3LZJA 5EWGA 3NKYA 1LAWA 2O4GA 4CEQA 4H4OA 1RDCA 4LH5A 4CJRA 2HB5A 2JGUA 2YKNB 4DF4A 3PVXA 3NBPA 4ZP9A 4FJGA 1S5JA 3L3VA 4ZPDA 3D0PA 5F8JA 3C95A 1RBSA 4CEZA 3LPTA 1RBRA 1WN7A 3ZSOA 3BSAA 3TQ1A 4ZMMA 1FXXA 4TN2A 1XHZA 4RUAA 3CVKA 1NJZA 2QK9A 4DTPA 1QUVA 3CG7A 4CJLA 1KHVA 2IJFA 4FYDA 4DSKA 2OPPA 1NKEA 1QHTA 2GUIA 4W5RA 3C6TA 4FW1A 4DQSA 1JLAB 3GV5B 4EZ6A 3M8RA 3FQLA 2IC3A 4ICLB 3NGIA 3BGRB 1S4FA 3I0SA 1C1AA 2CJQA 3CJ3A 1QSYA 2YNGA 1JKHA 1W9HA 3B6OA 3KHGA 3DRPA 3WNGA 3RRHA 1C1BB 2XY6A 4FBTA 5KG4A 2IS3A 2IM2A 3RTVA 3KNAA 4FJHA 2OPRB 2FBTA 4ZTFA 3OYAA 3G10A 3QEIA 2BE2B 3LP0B 1SH2A 5T14A 5KFLA 1HNIA 3OYFA 4O4GB 3DLEB 1LWCA 1QE1A 3TABA 1FKPB 2ILYA 4Y1CA 5KFIA 4IFYB 2RF2A 1VSIA 4CIEA 4NLUA 1Z4UA 1KSPA 1Z26A 1ZETA 3TAGA 2VG6A 2QKKA 3O3GA 5CYQB 4OLAA 3QGGA 3V9XA 2BRKA 3KKSA 4AHSA 1ASVA 1BQMA 1S6PA 2AU0A 1ASWA 2V0NA 3AO4A 3HHKA 3SV3A 2Z1IA 4RNMA 4Q8FA 1VSMA 1EETB 1Z25A 4Q0BB 4DFKA 1UWBA 2Y1JA 5J2PB 2WRMA 4K50A 1S0MA 2BQRA 3AVMA 1NOZA 3M9NB 1DLOB 4Y1DA 3O4QA 4HCBA 1D0EA 2W8LA 3K59A 4WXWA 4DG1A 4JV0A 3V6JA 4IRDA 1JXBA 4QW9A 4RU9A 3Q8PB 2PZSA 4J2AA 3K5OA 4B08A 4FCYA 3MAQA 3LZIA 3KHHA 1WSHA 4JS5A 2NUBA 3CYMA 1F21A 3OYIA 1BCOA 3HXMA 1QSSA 4HUGA 4KSEB 2XGQA 1RILA 4ECYA 2XCAA 4OVLA 4RW4B 4FK0A 3HPHA 4CJ4A 1JLBA 4C8MA 3I5AA 4E89A 3HT3A 3QEVA 4FJ5A 4KKOB 3NAIA 4O3QA 4ZPAA 2AWZA 3I5CA 4RG8A 3RMBA 2HMIB 2W42A 2P51A 3U6FA 4OPJA 3V4IA 4ZVHA 1T7PA 1KTQA 2WCXA 3HP6A 4LSLA 1J5OA 3AV9A 1YVUA 3HM9A 3TI0A 2A1RA 4Q8EA 4M94A 2HHSA 3IN5A 4O44B 1RT4A 3MR2A 1U45A 4BDYA 4DTNA 4Z4IA 3ZSRA 4I9QA 1KVBA 4CJEA 3T1AA 1RTJB 2YNFB 1TKTA 3H59A 3NAHA 1ZYQA 5KFXA 3OLAA 4FJ7A 3AA4A 3UIQA 2R2RA 3PY8A 4CJ5A 3MR5A 3NF7A 2FLLA 4E1NA 2WK4A 3AO3A 4WE1A 4Z4FA 5KT4A 2W8KA 1TVRA 1S9GB 4DLEA 2FVQA 3F73A 3PX4A 5C24B 4DSFA 4L8RB 1C0UB 3RBDA 4CFDA 3V9ZA 1HMVA 4LSNA 3KLEB 1I39A 4FW2A 1RT1B 3K2PA 4GW6A 3AVAA 2HHVA 3KLGB 5HP1B 3MFHA 3GQCA 3KLVA 2V9WA 4ED8A 2FLPA 3ITHA 2J6UA 1KVAA 4WYLA 3OJUA 3UR0A 3ZSXA 3HO1A 3SUNA 4Q43A 4BE2A 3SV4A 2PY5A 4M3XA 3VQBA 4K4TA 5K14A 2ITGA 2VA2A 4NLDA 5HBMB 5CZ2A 1KRPA 3HVWA 2OH2A 4KHUA 2X6SA 5KFWA 4J2DA 4I2PA 3RR8A 2D0AA 2IAJA 4E7LA 5J2QB 4TSXA 3KLFB 4K4XA 4NLVA 2LSNA 3AVJA 4FBUA 5HRSA 1A5VA 3BQ1A 3NF6A 4M3YA 3IG1B 1NNDA 1ZBFA 4KREA 3VN5A 3QEPA 4KB1A 1BQNA 1S6QB 4IDKB 2B43A 2WONB 3SUPA 1BIZA 3MEDA 1JXLA 2O4IA 3MEEA 1B92A 3PW7A 2BQ3A 1L3UA 1NK4A 3HL8A 1IKYA 3T19A 4XO0A 3KTQA 5KFOA 2VG5A 5KFFA 4KHMA 2HNDA 3WNFA 3BDPA 1JX4A 5CZ1A 3RR7A 1U4BA 3D5MA 4M95A 4O4RA 3G86A 2PYJA 4URSA 4FJMA 1IKXB 5FRNA 4Z4EA 3N6MA 3S3NA 3MR3A 2I5JA 1NK0A 4MIAA 4ED2A 3V9UA 4ED3A 4ZVFA 5F9NA 1IKWA 3PJWA 5KGXA 3VQAA 4F4WA 3VQPA 1TV6B 4DU1A 1DTTA 4E7JA 5KTQA 4CJSA 4FS2A 3ZSZA 3QO9A 1XR7A 3VQEA 3VQ8A 4BE1A 4ELVA 1ZBUA 5KFNA 2Z1GA 4PWDB 1IKVA 4ECZA 5JS2A 1L5UA 3HP9A 4N76A 4KAIA 3QESA 3T3FA 1T05A 3QYYA 3CJ0A 5I42B 3IS9A 3QETA 3U3GA 1EXQA 2GBZA 3ULDA 2FVSA 3IRXB 4ECVA 2YNHB 2AGOA 1U09A 5KT2A 4EBCA 1SV5A 4ED0A 5FRMA 4EO8A 4CERA 4LQ9A 1C0TA 3KLHA 5CYMB 3QEWA 2KFNA 4O3PA 1Q8IA 4W5NA 1D9DA 4GC6A 3OJSA 1REVB 2AX0A 1L3VA 4TY9A 3OHBA 3TAQA 4FLWA 2B6AB 4H4MA 1S1WA 4DSEA 1K1SA 1RT3B 1GOBA 3H5XA 5HLFB 5J2MA 5KI6A 5L1JA 3ICLA 4H4OB 5JUMA 2IGIA 2HHWA 4DQPA 5J2NA 5F8IA 3NBPB 3KK2A 4EYHB 3HPOA 2ZD1A 3C94A 1LW2A 3AVNA 1IG9A 5DK5A 4QOZB 3SJJA 3VQ7A 1ZTWA 3AO5A 3AA2A 3L2WA 1XI1A 3QNNA 1BGXT 4KHQA 4O0IA 5C25B 2XWYA 1HJRA 1S49A 4CEBA 4IOBA 3SZ2A 1VSDA 3QZ8A 3SFGA 1HNVA 4NRUA 4RUCA 4MQ3A 3HVRA 4IRCA 2KFZA 4HVJA 1S1UA 4IBNA 4N41A 3DRSA 1QS4A 3KK1A 5KFQA 2A1SA 3QERA 1RAJA 4MH8A 1XR5A 2OPPB 4KO0A 4B8CA 3AVGA 4O3NA 2WHOA 2OPQA 4ECQA 4AH9A 3Q8SB 2FBVA 3BQ0A 3C6TB 4J2BA 2IM1A 4CF1A 1OS5A 1NK5A 4KAZA 2JEIA 3NF9A 5KFVA 3UDLA 3FSIA 4C8OA 1RTHA 2IC3B 4DSLA 1SH0A 3LALA 4ZVEA 3PZPA 2BR0A 3I0SB 2D0BA 4QWAA 1T03A 5DQIA 3K58A 4B9TA 4J2EA 3FFIA 3QLHA 1S97A 1S1XA 2YNGB 1JKHB 4YP3A 4MFBA 1YVFA 3OVNA 3DRPB 3DOLA 3DLGA 4R8UA 4ID1A 2E6LA 2XC9A 4M41A 2RPIA 4J9KA 1FKOA 4E7KA 2CKWA 5F8HA 4FLVA 3Q8RB 4ZP6A 3DLBA 4M3RA 1ZBHA 3PW0A 1HNIB 3MXJA 3L8BA 1LWCB 3CJ4A 2QKBA 5JS1A 3MTKA 3H40A 2XRIA 2RF2B 2XI3A 4W5OA 4BDZA 3TARA 5F8LA 3EY1A 1TL3A 4CIFA 5DGBA 3H5YA 5KFYA 1VSJA 3VQSA 2VG6B 1WLJA 2KQ2A 4FJXA 4JRQA 4J9NA 1T3NA 3TAMA 3NCIA 4DTOA 2HWHA 1BQMB 1S6PB 4TLRA 1RTIA 2ETJA 1XC9A 2HHQA 5KT5A 2BRLA 5F9LA 4QWDA 4DL4A 3OYBA 5L1LA 4RW8B 2C2RA 1BISA 3QGHA 5SZTA 3T5KA 1UAXA 4FLYA 2P5OA 4Y34A 1KFSA 1RA6A 1UWBB 3GIMA 2X6NA 5L9XA 2UVUA 2JC1A 2R2TA 3BSNA 3V6DA 1FK9A 1N48A 2V4QA 1TKXA 4DG1B 1RTDA 4NLXA 4KV8A 3GYNA 2W9AA 1YTUA 1XWLA 3L3UA 3S9HA 2FJXA 2PYLA 2FVPA 2DFEA 1L3TA 4Q45A 2EHGA 1HQEA 1VSLA 4KTWA 3MECA 2ALZA 4KPYA 4ECXA 4CJ3A 4KHYA 3WNHA 3PV8A 1KLMA 4B9SA 4FZZA 5JXSA 3TWHA 4B9VA 3HK2A 2KZZA 2ATLA 4I9LA 2IM0A 5DQGA 1TL1A 4DL3A 3OL6A 3FDSA 5KT3A 3VQ6A 3V4IB 5KFPA 4LSLB 1J9AA 1J5OB 4OLBA 4DU4A 1RCHA 4M3TA 4FLUA 1RT4B 2JC0A 1RNHA 1HYZA 1TK8A 1LWEA 1TKTB 4IH5A 3V1RA 1VRUA 3DRRA 5DG9A 4F4XA 3PO5A 1RT6A 1RBUA 3ZT4A 1L3SA 5DLFA 3TR8A 3V1QA 4ZP7A 4CEEA 4DU3A 4NLPA 3ZT0A 4WFXA 4EP5A 5C42A 4Z4CA 5KFZA 3LDSA 4WE1B 4IR9A 1TVRB 3AVKA 1QTMA 2E9TA 3SFUA 4K4VA 3LP3A 2HHTA 3OSPA 3HVTA 3CWJA 4ECUA 1HMVB 1HYSA 2UVRA 4C8LA 4LSNB 2FBYA 5HRPA 5J1EA 3VQ4A 4IKAA 1HQUA 2EC0A 1QSLA 3SQ4A 1GOAA 4CECA 3ITHB 3KD1E 3PR5B 2HHUA 2Q3SA 4CHPA 2BDPA 3CFRA 4CFAA 4BDPA 1S10A 3KMSA 2DFHA 3CIZA 3OYKA 2E9RX 4AHCA 4NLRA 1BHLA 2R8GA 4FK2A 4E0DA 2R8HA 5K14B 2BANA 4ZHRA 4NYFA 3OS1A 2GIQA 3E51A 4I2PB 3NH2A 3RMAA 2J6TA 2IAJB 4DL6A 2HNYA 4XPCA 3RBEA 3JSMA 4CHZA 2W9CA 1C1CB 3DOKA 3Q8QB 3SNNA 4ECSA 3KHLA 5KFMA 3SUQA 4U7CA 4KHRA 3HYFA 3KLIA 4ECTA 3H08A 1XR6A 4NLYA 1BQNB 3KJVA 3MEDB 3PW4A 3MEEB 2JEFA 5HRNA 2F8TA 3H5SA 1IKYB 4CK1A 2UUWA 2R2SA 4J9MA 2VG5B 4ID5A 3SQ0A 1EX4A 2HHXA 2HNDB 4K8ZA 2X78A 1UA0A 4NLQA 4YQWA 5DGAA 4QAGA 4DFMA 3LP2A 4FJNA 3DI6A 2DPIA 3JYTA 1GX5A 2R8JA 3MXIA 2ZE2A 4NLWA 3I8DA 1SKRA 1TP7A 4I7FA 4AHRA 5I3UA 3BJYA 4F2SA 2F8SA 3HJFA 1Q9YA 3P5JA 4IG0A 1NJXA 3U3YA 4LQ3A 1DTTB 2P1JA 1S9EA 1JLQA 3QO9B 2ASDA 3C6UA 4CK2A 2BGGA 3AVHA 4OKJA 4QWBA 1S9FA 4O0JA 1VK0A 4CK3A 3KHRA 1T05B 2KTQA 5DLGA 3AVFA 3NMAA 1LAVA 3M8PA 5EU7A 1NHUA 3L2VA 3IS9B 2I1RA 2RKIA 3KKRA 1O1WA 2D41A 4CF2A 4ED1A 3NAEA 4NLTA 1VSEA 2O5DA 1SV5B 2D3UA 4WXOA 2V4RA 2R8KA 1C0TB 4UQGA 1CXUA 3KLHB 1QAJA 4E1MA 4DS4A 2AGPA 4BE0A 5KFUA 4IRKA 3CM5A 3K57A 4CCHA 4RZRA 2ILZA 4IH7A 4I2QA 4H4MB 4FS1A 1WAJA 1S1WB 4U6PA 3DYAA 4DTMA 3I0RA 3M9OB 5J2MB 4H8KA 1KHWA 4CGFA 1TK5A 3PX0A 1SL2A 2OZSA 5J2NB 3KK2B 3RB3A 2Z1JA 3TAFA 3G0ZA 2ZD1B 4R5PA 1J54A 1LW2B 4IG3A 2XI2A 5DG8A 3QZ7A 4B3OA 1ZBIA 5FROA 2BQUA 1RT7A 1RDRA 4CEDA 4J9PA 4WZQA 3VQQA 5FDLA 2Y1IA 4BWMA 2FJWA 4CFBA 1HNVB 4CGDA 4DQQA 1TK0A 3OSNA 1S1UB 3DRSB 1UOCA 1JLGA 1JL2A 4EYIB 5DMRA 3QIPA 3MFIA 4KO0B 4CEOA 1JL1A 1S1TA 2OPQB 5KFRA 3QIOA 5T7BA 2XO7A 4KB7A 1D9FA 4M42A 3QIDA 1WSJA 1TKDA 3V6HA 1TGOA 4DL7A 4OGEA 4CGGA 1QQCA 1D5AA 4TYAA 3L2QA 3GIIA 3M8QA 3KD5E 1RT2A 4RW9A 2ATQA 3S3OA 1RTHB 3O4NA 1RDAA 4PQUA 2HNZA 3KLGA 4NCGA 4CHOA 1T03B 1T94A 3ZT3A 4KTQA 4Q5VA 2ZKUA 3FFIB 4URQU 4W5TA 3QLHB 4IQXA 1S1XB 3MEGA 4MFBB 1JLCA 2QXFA 3AVCA 2XY7A 2B5JA 3DOLB 4LY7A 3DLGB 4R8UB 2AGQA 1VSFA 3P1GA 3HVAA 2VG7A 3CQ8A 2AX1A 3A2FA 3ZT2A 2W7OA 1DTQA 1FKOB 4FJJA 4QCLA 4CEFA 3OS2A 4JV1A 2C28A 4KE5A 3TAEA 3F9KA 4CJFA 3V81A 3GV8B 1IO2A 2QV6A 3RB4A 3NE6A 4FJLA 2RDJA 1VSHA 4OJRA 3ZCMA 2G8UA 3LWMA 4DSJA 2HWIA 3LWLA 4NYZA 4IR1A 2IBKA 1TL3B 4WFYA 1UA1A 4CESA 2HVIA 2YNIA 4AHUA 1MU2A 4EP4A 3BSCA 2ASJA 2AJQA 5KFHA 4RW7A 5EWEA 3CO9A 4ELTA 4CEAA 3TAMB 1RTIB 1RT5A 1X1PA 3RAXA 4J9SA 5F8NA 4O3SA 3PW2A 2IJNA 1BI4A 3KIOA 2FLNA 4FJKA 4M3ZA 4TY8A 1NK8A 2W7PA 5KFGA 1R0AA 4B9NA 1WNEA 3V6DB 3CJ5A 1FK9B 1S48A 3CFOA 2R8IA 3VA0A 1RDBA 1TKXB 1RTDB 4KV8B 4NLOA 4KTZA 4DTUA 4F2RA 4CGJA 4HCCA 1T8EA 5E41A 4KFBA 4TQRA 1B9FA 3NDKA 1HRHA 3CDUA 4OKEA 4TXSA 3AO2A 3OS0A 4B9UA 1HQEB 5KRTA 5KG0A 3MECB 4RNOA 3M8SA 4FJ8A 1N6QA 3DLRA 3QNOA 1KLMB 4ZPCA 4HUFA 3E01A 1VRTA 3LP1A 1VSKA 3DDKA 4MIBA 2EX3A 4MK7A 4B8AB 2G8VA 1LWFA 2JLEA 2DTUA 2GC8A 1D8YA 1TL1B 4CIGA 3OY9A 1NJWA 3KOAA 1LV5A 4CJKA 4YFUA 4WFZA 4QPXA 2C22A 1JLEA 4O5BA 3HPGA 4M3WA 1W25A 3SPZA 3UQSA 3LAKA 4CF0A 3PR4A 1NHVA 1BL3A 3OYHA 1TAQA 1QE1B 2OYQA 3KK3A 2OA8A 4KBIA 4FXDA 1TKZA 4ZPBA 4ECRA 2G8IA 4FLZA 1VRUB 3DRRB 4FLXA 1S1VA 3VQDA 1NKBA 4DFPA 2WB4A 3NL0A 1RT6B 4C8KA 1BIUA 3SQ2A 5HROA 5F8GA 1K1QA 1LW0A 4KI6A 4CJPA 1RBVA 3NGZA 5C42B 4HYKA 5KG5A 4Q44A 2AQ4A 4XIUA 2C2DA 3HVTB 4DF8A 4EEYA 4RW6A 1WNSA 3AA5X 4O3OA 1HYSB 3HSTB 1Q9XA 5J1EB 3ZT1A 4Y2CA 1U04A 1HQUB 3DLKA 1SUQA 4JLHA 4Z4HA 5EWFA 4NLGA 4FZXC 3DMJA 5EDWA 3OYNA 1S0OA 5C25A 2D0CA 3CDEA 3NFAA 4DFJA 3RMCA 4G1QA 2R2UA 5L1IA 1JIHA 5DQHA 4DWIA 3H5UA 4FJ9A 4K4ZA 2XY5A 3MF5A 4EZ9A 2BANB 5KFCA 4QWCA 1EP4A 2YHAA 3NF8A 1RYRA 4ZHRB 1D1UA 3BSOA 3GIKA 1C6VA 3QGIA 1NJYA 4AHTA 3MR6A 4MK9A 1JLBB 5D3GA 2HNYB 4K4YA 2B4JA 3JSMB 5KGWA 2W9CB 3DOKB 4FM2A 3N6LA 3G6YA 1YT3A 3AA3A 1JLFA 3RRGA 4RNHA 2WTFA 4Z0UA 4KHNA 3OYCA 4EO6A 1WSGA 3GV7B 3KLIB 4M3UA 1N5YA 2W9BA 4J9QA 4GMJB 5KG7A 3AVLA 4CF9A 3IGNA 3KJVB 2YKMA 3ISNC 3CM6A 2E6MA 4AILC 3LAMA 3OLBA 3DM2A 4HKQA 4DEZA 4PUOA 4NZ0A 2GV9A 4ID5B 4URGA 3ISND 3NH0A 3S3MA 3OYGA 4FK4A 1I3AA 1RDDA 4CGHA 2WOMA 4O3RA 3OYMA 3BQ2A 1HPZA 2XGPA 1ASUA 4IFVA 3ZSYA 4CHNA 2OPSA 3LP2B 4NCBA 3DI6B 3JYTB 1ITGA 2HVHA 4CF8A 1U48A 2F8EX 1N4LA 2JEGA 2ZE2B 3B6PA 3SPYA 3EZ5A 4O55A 1CXQA 2DY4A 2HAIA 4I7FB 5I3UB 2YKNA 4TYBA 4E7IA 4IG0B 2G8HA 2IOCA 4OPKA 1S9EB 1SH3A 3ALYA 3GILA 3AVIA 1JLQB 2E4LA 3C6UB 4BWJA 1C2PA 5KG2A 4ED7A 4CGIA 5SWMA 3O3FA 4IH6A 2RN2A 5KFJA 4HUEA 1KCFA 4OGCA 5KFAA 4RW8A 1EKEA 4H54A 3CJ2A 3M8PB 1RBTA 4WYWA 3OL7A 2Z1HA 1X9MA 2RKIB 4E3SA 4R0EA 4GC7A 1NK7A 1X9WA 5HRRA 3AO1A 4NRTA 3AVBA 3NGYA 2D5RA 4DSIA 3G6VA 4TQSA 2XCPA 5KG1A 4F50A 3H2LA 3PW5A 4K4WA 4JUZA 1JLAA 3ZSWA 4I2QB 5KFEA 3NH1A 3QEXA 4ICLA 4F3TA 3BGRA 2F96A 1HARA 3DYAB 3I0RB 2FVCA 4M45A 3K5NA 1KVCA 4CJWA 4J9RA 3TVKA 1X9SA 1C1BA 3V6KA 3T5HA 3VQCA 2OPRA 4R5PB 3LPUA 4IG3B 2BE2A 3LP0A 2UVVA 4N47A 3UPFA 1CZBA 4B3OB 4N5SA 4DTSA 4O4GA 3DLEA 1RT7B 2I5JB 1NKCA 3RWUA 4AHVA 5FDLB 1FKPA 1WAFA 1IH7A 4IFYA 2D7SA 5C5JA 1IKWB 3IAYA 4DLGA 5KFKA 1B9DA 4CJTA 1JLGB 2ZQBA 3QIPB 2VWJA 5CYQA 3T5LA 1S1TB 2XY8A 5KRSA 4DL2A 2KZMA 4FJIA 3EPGA 3ASMA 4K4SA 3PO4A 3M8QB 1IKVB 4FM1A 4KB0A 1RT2B 4RW9B 4DQIA 1EETA 3OHAA 1QAIA 4PQUB 4Q0BA 2HNZB 1WSIA 2G8WA 4NCGB 1RYSA 4NYNA 3EYZA 4Z4GA 5J2PA 1XHXA 3VQ5A 1TQLA 3K5LA 3KMQA 4ZVGA 1DLOA 4DQRA 4MK8A 2VA3A 2E9ZA 3MEGB 4J9LA 1JLCB 2YV0X 4F4KA 2B5JB 1SL0A 4CE9A 5KG3A 3OYJA 2VG7B 1DTQB 2XHBA 3FRZA 3M9MB 2VWKA 1ZBLA 3SQ1A 2IMWP 4EBEA 4QW8A 4ZP8A 3H98A 2G8KA 1YTAA 1SKSA 3V81B 4C8NA 4RW4A 4CHYA 4RNFA 4DTXA 1NK9A 4KKOA 3OYEA 4PA1A 3FQKA 1IM4A 4ZTJA 1C1CA 2YNIB 2HMIA 3EZUA 1Y97A 1MU2B 4RW7B 2FBXA 1WSEA 2IA6A 3K5MA 3CDWA 1RT5B 4PY5A 4K4UA 4OKKA 2HW3A 2UVWA 4GVMA 4O44A 4FM0A 1NK6A 1BI4B 4CJVA 4ECWA 5KFSA 4YR2A 1GX6A 1RTJA 2YNFA 3WNEA 2OZMA 4TY8B 4ELUA 3T5JA 1BCMA 4MKBA 2RDIA 1R0AB 4KHWA 3KK1B 5KT6A 3OYDA 3SCXA 3TAPA 1CLQA 1S9GA 3IGVA 4F8RA 5C24A 1C0UA 4KFBB 3CFPA 2JEJA 3D28A 5L1KA 4E19A 3KLEA 1RT1A 1C0MA 4N56A 4JS4A 4DMNA 1N6QB 5HP1A 3E01B 3BREA 1VRTB 3LP1B 3SI8A 1SKWA 3BR9A
chains in the Genus database with same CATH superfamily
4W5QA 4CHQA 4NMXA 2F40A 2OFHX 2UU9J 3VQ9A 2IBOA 3WIVA 5BRFA 3WHIA 1YGYA 1U26A 2XZDB 2CZ4A 5F8MA 1A5WA 1VQ6S 1S99A 2N7CA 2Q66A 1WC3A 4PRFA 2E7WA 1B70B 1K8AO 3M1VA 1H7XA 1B4SA 1YG0A 1N56A 1SCJB 3TEGA 3NGDA 3W65A 1TKZB 3CCJN 3OTOJ 2FC0A 3DLHA 2P9LB 2N3OA 3AD7C 3P3DA 4NB4A 1NLKL 1HX1A 2PBDA 4DX5A 4G3IA 3DKDA 2IM3A 5CY4A 3PACA 3RAQA 2F8MA 5GMKa 4HHTA 3QT8A 3CCRS 3GB0A 3QNWB 1S6OA 4RW6B 1P6TA 2B9XA 1S6QA 1IN0A 2DGSA 2WONA 1MWZA 4UY8T 3L2RA 3KG1A 4CH1A 4WIQA 4BC4A 3DLKB 2P5GA 3QAUA 1SUQB 4MTPA 4JI1K 3H3NO 3QINA 3OFGA 4KYZA 1F2HA 5JVGQ 3G6XA 3SYZA 3KWMA 3SSSA 3ZSQA 4IKFA 2Y0SD 1JQGA 2KW4A 2NRZA 1ZXOA 1WTBA 1EP4B 4DR5F 4E7HA 2OTLN 1N8RT 1C0FA 3PUFA 3PFEA 2CGLA 5M1PA 5C2FA 5EOYA 4PWDA 1VC6A 4B9MA 3ISZA 1NB7A 2G0JA 2GMHA 3P45B 3GFXA 3FUYA 3PJXA 3QT7A 3TA0A 5I42A 1HIYA 1CVJA 4NCAA 4DV5J 4LR9A 4F4ZA 3MTJA 2EBGA 4J9VA 3PRVA 2YKMB 4OX8A 2IDOA 2ERRA 4OV1A 4U67L 5CYMA 3V1OA 1LWEB 3DM2B 5BRHA 2QE5A 4FLTA 1SIWB 5KG6A 3SCJE 5HOOA 2UUTA 4HTUA 3V9WA 2XMTA 4CYUA 3SK3A 1K47A 4EMDA 1KLNA 3S1TA 2C2EA 1LAWA 1RDCA 2ADBA 4CJRA 2JGUA 3MMCB 2YKNB 4H0OA 4DR5K 2GW8A 4H0PA 4ZP9A 4FJGA 3L3VA 4TU9A 3LM9A 1OVQA 1N52B 4M5MA 3BEGB 1EJ7L 4A8QA 4I56A 1Y11A 3BYRA 4TN2A 5CR4A 2KI2A 3CVKA 1FCAA 1QUVA 1WBBA 1HKGA 2ASMA 2IJFA 5A76A 5HMYA 2IIRA 3IMXA 4RTFD 1NDKA 4DSKA 2KT5A 1X4BA 3PRBA 5T41A 1HI1A 1QHTA 2GUIA 1M5HA 1DURA 2PI5A 3ZTSA 4CLYA 4YS2A 1PYOB 3GV5B 4IWVA 2E8AA 2J5AA 2IC3A 4A2BA 2NXCA 4KH1B 1GEHA 1QSYA 2ZITA 5DJBA 1CC8A 4BRMA 2ZUGA 3FGVA 2YNGA 1YJNN 1IQZA 1YHQS 5AQIA 3MM6A 4E8UA 5A2QU 3FE1A 1YBAA 3ZETB 1HWIA 4PCQA 1ITPA 2FBTA 3QEIA 3ZLJA 4AL5A 2ALYB 2VWBA 5CE3A 3H3OB 3GZ7A 4WK1A 3I96A 3DLEB 2PA3A 1LWCA 2W2OP 4I69A 2ILYA 3HFVA 1R59O 5F0UA 2GHVC 1Z4UA 3UCGA 1X31C 2E2QA 3MX2A 4ES2A 3TAGA 2QKKA 2MSTA 1HWLA 3D1HA 1GXUA 3C7NA 1BQMA 5AQZA 2V0NA 2WBRA 2FYXA 3AO4A 3ZZYA 3HHKA 2QA1A 3DRXA 1VSMA 3IUCA 2WRMA 5LY3A 2ZWPA 2EVZA 4LF8F 1DLOB 4I6MA 1KQGB 2MKJA 4WXWA 4DG1A 4H5NA 4QW9A 4FNHA 4F3QA 4NXMJ 3ULHA 3KHHA 2NUBA 3T1HJ 1F21A 4KSEB 2CDRB 3IWLA 1RILA 2QL5B 4Y00A 1YJ7A 2EFPA 4FK0A 1BA1A 2KHOA 5FPDA 1R8PA 1SIZA 1S5ZA 1X8DA 4TLQA 5A8RB 4DPTA 2RRBA 4E89A 1VQMS 3QEVA 4KKOB 4YB5A 3C16B 1HBNB 4O3QA 2AWZA 4IOCL 2RDDA 1JK9B 2DGOA 3U6FA 4X62F 4PL8A 3V4IA 1R31A 4CBUA 4LSLA 3QDKA 3N4PA 4Q8EA 2DGQA 4O44B 2DR7A 2BM1A 3MR2A 3J81Y 1G6BA 4Z4IA 2FUG9 2LEPA 1RTJB 2YNFB 3K9KA 1TU0B 5ETRA 1Y4ZB 3H59A 1OJ4A 3Q8VA 2GA7A 4CWBA 3E9OA 5KFXA 4LF8K 3POTA 1Q18A 2RQMA 3UIQA 2XM3A 2HFZA 2OCEA 3PY8A 4CJ5A 3MR5A 3S6EA 3NF7A 1VQPN 3N5FA 3THWA 1UJ5A 2WK4A 4R79A 4Z4FA 5JJBA 2W8KA 1TVRA 1S9GB 3FZ2A 2OEKA 3F41A 5DDQC 3V9ZA 1HMVA 1VOMA 3UDCA 3UNGC 2HHVA 3KLGB 3HI0A 3MFHA 2RD5C 3ENBA 3KLVA 3KUEA 3I8BA 2BW2A 1TFWA 3MURP 3MMAA 5E26A 2O1PA 1S7HA 1KVAA 2IRXA 1FRIA 4WYLA 4F0HA 4BRKA 2RUGA 3H2VE 2AIRB 2GJ2A 2VC0A 3HM8A 3HO1A 3SUNA 5CYJA 1UJ6A 4Q43A 5IQQA 2VKZG 3SV4A 2PY5A 4M3XA 3R3TA 3M1VB 3BBCA 1CJUA 1EARA 4NLDA 3HVWA 2OH2A 2V94A 3R1HA 5LMUF 2IVNA 2YI1A 4E7LA 5E3CA 3SCIE 1GXTA 1V4SA 1X5TA 1Y3KA 3H7HB 3FVYA 2QFIA 1VLYA 2DHHA 4K4XA 4NLVA 1VBXA 5HRSA 1A5VA 2DBBA 3ZZ0A 3NF6A 2VQEJ 1NNDA 1ZBFA 4C98A 4CLSA 3VN5A 4H5TA 4BC9A 3OFHA 4KB1A 4OYIA 1S6QB 1SI9A 5F1XA 2WONB 2QT7A 3G96A 2MTLA 2DRDA 1B3TA 3MM8A 2VG5A 1GQEA 2O01C 4M5DA 3RR7A 1U4BA 2VHGA 4A8OA 3D5MA 2FIUA 5FRNA 1SC4B 4Z4EA 2HK3A 3MUVP 3O9SA 1EHWA 1T9TA 2I5JA 3VGSA 2L3MA 2PE8A 2HIQA 2Q79A 4ED2A 1RKIA 4ED3A 4ZVFA 1NJIO 3TJAA 4HR2A 4YY3J 4F4WA 1RJJA 3VQPA 2M8HA 4KH6A 2E5LJ 1DTTA 2CPZA 5KTQA 4DV0F 5LMUK 4CJSA 2ZHBA 4FS2A 1BXNA 4GO7X 3QO9A 3NRBA 3CJ8A 2YKOA 1UAWA 3IO1A 4FF2A 4ELVA 1ZBUA 2V4JA 4PWDB 1IKVA 5JS2A 2H5EA 2P9CA 3QESA 2G2YA 3A8KA 3CJ0A 5IWAK 5I42B 3IS9A 2ZUAA 5ETTA 3U3GA 2GBZA 2QMXA 1FXRA 3NGKA 3DLLL 2ZEJA 1FWPA 2FVSA 4RR5A 4BRFA 1SV5A 5FRMA 4ZN1A 2KT3A 4CERA 1C0TA 1APSA 3GDQA 4LRDA 5CYMB 3QEWA 3L4QA 5EX0A 1D9DA 4FWKA 1RLCL 3OJSA 2AX0A 2GFFA 3TAQA 1PBUA 1IWAA 1RI7A 1PKUA 4JI7J 1MLAA 4DSEA 2XZTB 5KI6A 1T9XA 4WWSA 3CO0P 3UE2A 2RUSA 4B9QA 1P9QC 4FWSA 1S0VA 4KGXB 2HQ3A 4EYHB 4DV0K 1LW2A 3AVNA 2A6AA 5DK5A 4QOZB 2VBXA 3VQ7A 4WTOB 3AA2A 5K20B 4UZBA 4KHQA 5C25B 4CZHA 1XNQK 4IOBA 1RWKB 1HNVA 4RUCA 3HVRA 4A8MP 2KFZA 4HVJA 1MWQA 5ETMA 3CCUS 5CAAA 2GCFA 4A48A 4BRLA 1RWWB 3QERA 1RAJA 4M7YA 1XR5A 2BJ1A 4KO0A 4DV7F 4B8CA 4O3NA 2FTRA 1TYQA 2UXCJ 3HD1A 2I2YA 3BQ0A 2YQ3A 4CF1A 1NDCA 4UUWA 5AJ3J 1NK5A 3DC2A 2M4MA 2I7PA 2NRRA 2IC3B 2IRYA 3PZPA 3BR8A 4Q7AA 3K58A 3ZX3A 3MOJB 4FWOA 3AD9C 3G6EN 4LBIA 3D9BA 1S1XA 1OH6A 2YNGB 4YP3A 4OI4A 4MFBA 3OVNA 3MM6B 3SQOP 3AHPA 2ZH8A 4M41A 1SJ3P 2CKWA 5HVFA 4BRPA 3CI5A 4LSZB 4ZP6A 3VZIA 2VODA 3SBMA 1HHSA 1JWWA 2W24A 3PW0A 1MW7A 3L8BA 5EHHA 1LWCB 3CJ4A 3HZGA 4EFAC 1WDDA 3VAIA 3GG4A 5E3QA 3A5NC 4BDZA 2X3DA 5F3TA 2B9EA 1RQ0A 1XMQK 3H42A 1LQ9A 1N36J 3VQTA 1VSJA 4FJXA 1H2TZ 2DCUB 3CPEA 3C7NB 3NCIA 1BQMB 2ZH7A 2ETJA 3PSIA 5HI7A 2RQCA 1IXKA 2HHQA 2Z2ZA 1Q81T 3DXBA 3JTOA 2OSQA 1MWKA 1UAXA 2P5OA 1YWXA 3B8HA 3Q2SC 3R5DA 2OGUA 2NPIA 4P73A 5L9XA 2R2TA 4AL6A 1HW8A 3V6DA 1BA0A 1FK9A 4I6MB 1N48A 3W63A 5L38A 4DG1B 1VC5A 2LLZA 4OI2A 4A61A 3S9HA 1YVNA 3D2FA 2PYLA 2FVPA 4FYVB 4ZIWA 4BS2A 1IWGA 3MECA 4KPYA 3NXZA 2YWKA 4DR6J 4KHYA 4WCEL 3AOBA 3L7OA 4FWNA 3PKYA 4J91A 2BBEA 3Q0AA 3CETA 3OBIA 2IM0A 1TL1A 1OQ6A 4PG5A 2VCPA 2MHEA 3FDSA 1SQGA 1RHQB 3O8MA 3V4IB 4NYPA 2N3LA 1SVDA 4PXBA 1KD1T 4ANDA 4LSLB 1J9AA 5G4DA 1TMJA 3F56A 2Y8YA 3A5MC 4OX6A 1XNRJ 1HYZA 4ANCA 3DDIA 4J37A 4LF7J 4LRCA 1WHWA 3POTB 4DR1J 4CEEA 1VHIA 4WFXA 4HLBA 3THWB 2DHXA 2L08A 2DGTA 4IR9A 1TVRB 4A8XA 3OSPA 2FQQB 3Q8YA 1HMVB 5H1SV 5IM0A 1J27A 2K7JA 1NGJA 1UFLA 3E1YA 1GOAA 4GVEA 4X66J 4HDGA 3MPWA 4CHPA 2OEJA 2MQOA 2NCKL 3UE5A 5I3QA 2EWSA 2DFHA 4NLRA 1BHLA 2HZCA 2R8GA 4ED4A 1WELA 2RE2A 2BANA 3EE3A 1CJUB 1HQ2A 3IR6B 5EX3A 2VZ9A 1VQLN 4ZHRA 2CG4A 4NYFA 1HI8A 2BM0A 4QJVA 3RMAA 2J6TA 2RU3A 5C2CA 4DL6A 2HNYA 4XPCA 4CHZA 1VQ4N 3Q8QB 4DR7J 3K0JA 4PG8A 4ECSA 4M5IA 5KFMA 3CXCR 3SUQA 1MG7A 4OYZA 1V6HA 3NGUA 1VYAA 1X5OA 3HYFA 4K5RA 5D77A 2LU1A 5HQLA 4ECTA 2DNQA 4AF1A 1N5VA 2OP5A 2EXUA 2RHKA 3FZHA 4DL0C 1FX4A 1B7YB 3MM8B 2VG5B 1QAYA 1U25A 4M5DB 3ZFVA 2ZDPA 5CABA 3TZXA 3KG4A 4K8ZA 4NLQA 4YQWA 4QAGA 3EMTA 3G71S 3LP2A 1RWMB 3L4IA 4AE5A 2AW0A 1U2RA 5J1NA 4AT1B 5EXWA 2MQ8A 3HJFA 3OFFA 2ZZNA 1NJXA 3U3YA 4LQ3A 1DTTB 5ETLA 3T1YF 2HHHF 3QO9B 1RDWX 3C6UA 2CH5A 5AE3A 4OKJA 2V4JB 3CD6S 4M7XA 1RU1A 1HBUA 2QA4G 5AQFA 5DLGA 3AVFA 2YWGA 1NHUA 3IS9B 4JB8B 2D41A 2Y1RI 4YOWA 4I4BA 2O5DA 1SV5B 4E98A 4WXOA 3B8AX 2GZOA 2R8KA 1C0TB 2F4FA 4OJ1A 4E1MA 1T6CA 2O8FB 3AA8A 3CERA 4WIIA 5KFUA 3CM5A 3C19A 3K57A 5BJRA 1FRLA 1NM1A 2HRYA 3GFHA 3FMBA 4YOEA 2VFSA 4CGFA 2GHWA 3UB5A 2OZSA 2F9TA 3CMAS 3UO0A 2G1HA 1YLXA 2Z1JA 3TAFA 3T1YK 4QYZK 3M2VA 1LW2B 1J54A 2HHHK 1Q5VA 3PKMA 1D9AA 4R25A 5DG8A 1VQON 4FPBA 4WZQA 3VAKA 2Y1IA 3VQQA 3L09A 4BWMA 5L39A 2FJWA 3CQXA 1HNVB 3VMFB 4CH0S 4FSVA 1KVKA 2M3DA 2ZC4A 1UOCA 1JL2A 3HHNB 4ZKAA 1KC8T 4KO0B 1TYQB 2AKWB 4RLEA 5D15A 2A40A 1N5QA 4M42A 3QIDA 3V6HA 1TGOA 4CGGA 4TYAA 3WEEA 4QR2A 4CM0A 3ID6A 2P9GA 3M8QA 3L2QA 1W7AA 2B3TB 4XK8C 1RT2A 1LOTB 1GMUA 3D68A 4PQUA 4CHOA 4KTQA 2W6KA 4Q5VA 1S4EA 4URQU 3BP8A 1S1XB 4OHVA 4JAXA 4MFBB 1JLCA 2QXFA 4BR5A 4LY7A 2AGQA 5HATA 2RQKA 2DHSA 5KPZA 1DTQA 3MX5A 4DDFA 1G7CB 1KOHA 2V7YA 4CJFA 3V81A 4B3MJ 4OZNA 1PBAA 2UUAF 3NE6A 1K9MT 4I6WA 3GONA 2HWIA 4NYZA 4DV4F 4U7UD 3MUTP 4AQYF 1RAGB 2IBKA 3TRGA 4CESA 4HTIA 4AHUA 3FBCA 2EG1A 1MU2A 4PKDB 2YQ1A 3NVKA 2P9PA 4IEIA 5EWEA 4CEAA 1WF2A 2G0CA 2KKZA 5L9NA 4F0MA 2GHPA 3RAXA 5B8HA 4O3SA 1NGAA 3PW2A 1P27B 2IJNA 3C2PA 1BI4A 2E2PA 3QSYB 2EFGA 1WTFA 4TY8A 2QWRA 2Z0GA 1YI2S 3TNVA 3JQJA 2LEBA 2X3GA 1WNEA 3V6DB 3CJ5A 5AXNA 1FK9B 3TEHB 1HPMA 3J81j 5ETKA 4KTZA 1TUWA 2VJUA 1DY3A 4LF6J 5A0YA 3CT9A 4TQRA 1B9FA 3D2FB 3CGIA 1RHUB 2NS1B 3CDUA 4TXSA 3MECB 4FJ8A 1N6QA 3UKRA 3DLRA 3QNOA 3VR1A 4ZPCA 4HUFA 3E01A 2UUAK 1VRTA 3LP1A 3DDKA 3H1VX 2B9WA 2D9PA 3C46A 5I3PA 4MK7A 4DV4K 4AQYK 4WQ5A 1LWFA 1YITS 2QLJB 1D8YA 1TL1B 1RGIA 4CIGA 2QI2A 1XN9A 4CJKA 3ZZPA 2ZBRA 2FPHX 3W8GA 1JLEA 4B17A 4M3WA 5B0AA 2BA9A 3M8YA 3UQSA 2RHQB 4B02A 4CF0A 2XWXA 5E3RA 2MJNA 3OQ2A 4BCAA 2OA8A 4X4NA 3UDVA 4KBIA 2AJ4A 1R7IA 4DFPA 1BIUA 2GX9A 3U9ZA 4O23A 1RBVA 3IBFB 3K17A 1HNZF 2Y9HA 4Q44A 5GAEP 2DRBA 2AQ4A 5CA5A 1KD1O 4XIUA 2Q6BA 1WNSA 4HVZA 4X4PA 2KVIA 1ESVA 3AA5X 1W26A 2VYPA 4MMOA 4J9UE 5IM0B 4A59A 2JOQA 1UW4A 1WC6A 3H0PA 4ZPVR 1UFKA 3DMJA 4LFCF 3O3LA 2O8CA 3FR0A 5IZHA 1RUSA 3VEWA 3HHDA 3NLCA 3OW2R 2R2UA 4ZDNA 4U7BA 2UUCF 5IXUA 1FJEB 2NRWA 5DQHA 2V8PA 3U8XA 4FJ9A 4K4ZA 1OWXA 2BANB 3PLAA 3BKUA 5KFCA 4JI4F 3ULEA 4QWCA 1RYRA 4ZHRB 1D1UA 4LFAJ 3GJTB 4F3MA 3M6UA 1NJYA 2HF3A 4AHTA 3MR6A 2WBNA 1DKGD 2XMMA 1JLBB 3DJCA 5IC4B 2HNYB 2EFNA 1QVGM 3TP2A 4DKWA 3HBTA 3W1YC 4FM2A 5D0EA 3GBTA 5AQVA 1IG8A 1HD0A 4Z0UA 4KHNA 1Y3JA 4Y65A 2OIHA 3GV7B 4CZFA 3N28A 2W9BA 2R4FA 4GMJB 5KG7A 3I82A 3AVLA 3J80O 1RBAA 2XYHB 2E6MA 2DGUA 2QEXN 2HGLA 2VASA 3FZKA 4HKQA 1DBDA 4B3TJ 2BE7D 1R8AA 3NH0A 4FK4A 3OYGA 3RBXA 3ZX2A 2WOMA 1V5IB 1HPZA 3B54A 2XGPA 1ASUA 4CHNA 1WEXA 3LP2B 3BN4A 2UUCK 1N4LA 1Q0NA 2GJFA 3EZ5A 2HFOA 1YSJA 2FZGB 3KJNB 4JI4K 4NXNK 4E7IA 3SAGA 2HS4A 5D6GA 3GILA 4ILMA 3C6UB 4BWJA 5KG2A 1WOQA 5F3ZA 4MLHA 5KFJA 4HUEA 5KFAA 4RW8A 1HBUB 4BRIA 1XTZA 1NU4A 1FJGJ 2J0XA 3OL7A 3O5BA 2D69A 1ZOTA 5KAKA 4MO5A 1H72C 4ED5A 5HRRA 2DITA 5FIIA 3AVBA 2YJEA 4ZK7M 3NGYA 5A6WA 2N82B 3QGPA 4QR1A 4TQSA 3D0IE 5RUBA 4JI2F 2HS3A 5E84A 3H2LA 1VQ9S 3PW5A 1BY9A 4WKRA 3O9QA 3MWTA 1JLAA 3I32A 1SAZA 3J7Z5 2YPYA 1RB0A 2FC8A 1SB6A 4JI8J 2OAUA 1KVCA 3ONQA 1J5EF 2HS0A 3CC7S 1VHFA 5LMNF 3T5HA 1HUXA 2OPRA 1FHTA 3M2VB 1KS2A 2B8QA 2BE2A 3LP0A 1PCAA 3UPFA 3HHLD 4FPAA 4Y0WA 3THXA 3GFZA 1NKCA 2M5YA 3NP5A 3IP0A 2EBEA 1UVIA 1QAXA 1Q5YA 4YDDB 1RXOB 2R7OA 4DLGA 3CEDA 1HNXF 5KFKA 3QJLA 3A8YA 3W5YA 1GMWD 2RAQA 2AYMA 2DNZA 1LWXA 2VQFJ 1T9VA 4JI2K 4OV6A 1E6YA 2KZMA 3WEEB 3EPGA 3TO8A 3M8QB 1NCLA 1RT2B 3U7JA 1E6VA 4PQUB 3UKUA 4OX9F 4C11A 4JI6J 4NYNA 2LVWA 5J2PA 3VQ5A 1UFWA 3EUNA 1J5EK 2CNKB 2BH1A 4DQRA 2FDNA 4M1KA 1T9WA 2VA3A 4MK8A 1I1GA 1JLCB 2YV0X 4F4KA 4A8SA 1QLNA 4QR0A 5KG3A 5LMNK 3O1BA 1K73O 1YKWA 3Q23A 1VQKN 1WKLA 1YJ9S 4BROA 1DTQB 1FFSB 2W4PA 2VWKA 5AXLA 5LL6d 2VGNA 1ZBLA 2I9SA 2MZRA 2G8KA 3MDFA 3KG0A 4CIOA 3V81B 2C3OA 2XMAA 3J7ZT 3LPEA 3DFEA 2QXLA 4RBVA 2J76E 2QZ8A 5K5MA 3QBCA 1SC6A 1HNXK 3FQKA 1EO1A 4ZTJA 2HMIA 1Y97A 1MU2B 3GCXP 3AAPA 2P9PB 2PN6A 2LA6A 1WSEA 1FEHA 4U96A 4FDFA 3K5MA 3MPDA 4PY5A 1H98A 5CH7B 4K4UA 4OKKA 1O5JA 2VV5A 1KKHA 1VI7A 3D6MB 5G0RA 2E5JA 1BI4B 4ECWA 4OX9K 2OZMA 4TY8B 3KJFB 1Q82O 1K9MO 2RSQA 1RFQA 1BCMA 3BDEA 1WC0A 2RDIA 2CPYA 1XQSC 4X4VA 3VOVA 2XQCA 1F5BA 2BJDA 3CUNA 4I64A 3BZKA 5FJ4A 1N54B 2EG2A 3M6XA 4C2MA 5E3AA 1WSVA 1KDNA 5GAGI 1C0UA 5A0YB 3HDSA 1LXJA 2IHR1 2JEJA 5L1KA 2XS5A 1YBUA 3KLEA 1VQ8N 4DB3A 3CC2N 4DMNA 3G8SA 1N6QB 3UKRB 3CF5Q 4LREA 3E01B 2LXUA 3BREA 1VRTB 2Y0BB 3LP1B 1NHKL 5AR0A 1NOYA 4FVCA 3HD2A 4KBOA 1LWFB 2HBQB 1RGVA 2MYFA 3NS6A 2QA2A 1XJWB 3D45A 1EKSA 4JI5F 3RB0A 5BYRA 1JLEB 1U2CA 5EUHA 5L8RC 3O08A 5KFBA 3LANA 4XPEA 3AD8C 4FPIA 5AQGA 3MN7A 1Q8BA 1UVMA 3VGKA 2QA4N 2JZ5A 3P83D 1FDBA 2J6SA 1YF5L 3H6EA 2DR5A 3ZNUA 5CCLA 2A1BA 2QO3A 1NRKA 4P2FA 3W3SA 1YQHA 5J2QA 1BWFO 1CSJA 5H9EK 5KFTA 2VF3A 2Z56B 1RBLA 2DPJA 2W6LA 2G8FA 2UU9F 4CTAA 5GAHI 1GLBG 1V3SA 5HL7L 2KG1A 5DG7A 2HBKA 1VCTA 3AY9A 4YNQA 4X2BA 2BKPA 2FVRA 3UI3A 5KQ8A 1I6JA 4LH4A 4X4RA 1OSCA 1TAUA 4DTRA 3DMJB 3OTOF 4KHSA 2O8CB 1IKXA 2A6MA 2KB2A 4JI5K 3JAMO 1RA7A 1FRXA 4HL9A 4NLCA 2D3ZA 4XH5A 4JV5F 3FC9A 3OA9A 3ILIA 2H4YB 2LXFA 3TA2A 1LFWA 3HSJA 4JN4A 3ULEB 1KQSR 2D3OR 2ASLA 2PT0A 1Y9OA 2XMWA 5SUHA 1YJWS 4FZYA 4F26A 5BYSA 4WK3A 1Q8KA 2AD9A 1NDPA 4WZMA 4DPUA 4YOXA 4YEAA 3Q86A 3R2DJ 1J53A 2JFDA 2XMJA 4YR3A 2VICA 2DR6A 2YWEA 4FYWB 5KT7A 2WTUA 5DDRC 4JYAJ 4QWEA 3IRXA 2W9BB 3LGHA 3CCSN 4BACA 3A3PB 3VEZA 3K8VA 2M2BA 3ZZZA 3TZWA 1X60A 3PX6A 3OTOK 2FZCB 4JV2A 1QVFR 2WOMB 1NPPA 1HPZB 4IO9L 1YRXA 2QW9A 5A8KA 4BC2A 1RT3A 1PIEA 5EWGA 1Y5LB 4JV5K 1NEEA 3C0BA 2P9NA 2IIHA 2BABA 4H4OA 2MGZA 4GV9A 4O0NA 5KOXA 4DF4A 4C8ZA 4OZ0A 2AEJA 1S5JA 5GADI 1SC3B 4IO1A 7FDRA 3D0PA 1ZAXA 5F8JA 2D0PA 5CQGA 1N32J 1RBSA 2BW7A 1IJEB 1RBRA 5D0HA 3DAWA 3ZSOA 2P5VA 3LTOA 1RKJA 2CIMA 3TQ1A 4ZMMA 1FXXA 1VHXA 1XHZA 2QK9A 4C3MA 4HT7A 5AQOA 4CJLA 4A8FA 2J9DE 2DNPA 2B7BB 2K2PA 4DU8A 1QZ6A 1AA1B 2WBMA 2I7NA 4MT1A 4FW1A 4GMKA 1H3DA 3UN3A 1JLAB 4EZ6A 1X4GA 1T9UA 3FSYA 1S4FA 4WFAQ 4A46A 4DR3F 1NGDA 3CCQN 2HRTA 1HA1A 4L75A 1T95A 1U1MA 3NS7B 2OO4A 3DRPA 2HFNA 2YBVA 1RADB 4FBTA 5KG4A 2IS3A 4KHPF 4HHUA 2XMKA 3DGVA 2OPRB 3A12A 3QFHA 4LF5J 3S41A 3CCVN 3G10A 4H0YB 2BE2B 3LP0B 3SAFA 3SMSA 2GO8A 5KFLA 1HNIA 1CQMA 2P2CB 3THXB 5HJXA 3TABA 4Y1CA 3GL1A 1U6FA 2E29A 2CQHA 1VSIA 2CVEA 2MZJA 7FD1A 1KSPA 3EKUA 5GAHU 2MZTA 1N5TA 5M1FA 5LSOA 9ATCB 2MY7A 2J7WA 4CO4A 2BUNA 1IBCB 4D3GA 2BRKA 3KKSA 1ASVA 1RWOB 2AU0A 1S6PA 1E6YB 4K7QA 1X0FA 1N5SA 2PEBA 4C6AA 3PM9A 4RNMA 2LU2A 4Q8FA 5K8NA 1E6VB 1IBLF 3UKUB 4DFKA 1JJCB 4C11B 2Y1JA 5J2PB 4DR3K 2B4PA 2Q2RA 2NSCA 2BQRA 3AVMA 1NOZA 2ASOA 4Y1DA 2DO0A 4CT8A 4DR2J 4HCBA 2CNLB 2KU7A 3D4JA 4KHPK 2ZVSA 4RU9A 4LF4J 2PZSA 1NNEA 4B08A 4FCYA 1QQOA 3CCMN 2UV8A 2ZHAA 1BCOA 4HUGA 2W2PP 5CD4H 4ECYA 2F63A 4S0MA 2HBMA 3F44A 2G2ZA 1Q7YT 4EUVA 3HPHA 4CJ4A 1N34F 3I5AA 2BOPA 3E66A 1IJJA 3R5JB 3NAIA 3R7NB 3CW2C 3CCLN 3S7RA 4P2SA 4WU3A 4RG8A 3RMBA 2HMIB 4KIAA 2GWKA 2DEIA 4ZLPA 2P51A 3HI9A 4P6QA 3HRGA 1YZ7A 1J5OA 2J7KA 3TI0A 4NXMF 1WKJA 4M94A 4QZVB 2RT3A 3IN5A 3MM9A 3RUBL 1RT4A 5G0RB 1IBLK 2QN6B 3O4WA 3ZSRA 3M32A 4OYXA 4I9QA 2DNRA 4KGKA 2O8DA 3J7ZO 3FLCO 1ZYQA 3OLAA 4FJ7A 2R2RA 2KL8A 2V8HA 4UZCA 3AO3A 3U9DA 1U1NA 4DLEA 1SBRA 4DSFA 4L8RB 3BUZB 1C0UB 4YHHJ 3QRRA 1ZA1B 4CFDA 2YH1A 3D3CJ 2HZAA 3KLEB 3GJQB 1LFPA 1VQ5N 1WG4A 1WHYA 3AVAA 3GQCA 1RBOB 2V9WA 2QX0A 4ED8A 1N34K 3WQTA 2ASPA 3OJUA 3D6RA 2NZTA 3AJ2A 2FGOA 1Y5IB 5IV3A 2IFXA 3VQBA 4K4TA 3PNIA 5K14A 4NXMK 2ITGA 1FJCA 1SQKA 3RGIA 5LJ5Y 4DMZA 4DOZA 3EX7B 2X6SA 1ZZNA 1FNMA 5KFWA 4J2DA 4I2PA 4BR0A 2CQBA 2D0AA 3B78A 5J2QB 3AODA 2NZ4A 5DO2A 5C12A 3RU0A 5FLXO 4CTAB 3AVJA 4FBUA 4B3SF 4HHJA 1CEZA 1BQNA 3OR1A 4FWMA 4USJC 1BIZA 2CFXA 1RWNB 1FDAA 4JI1J 1L3UA 1NK4A 1IKYA 5ITHA 3KTQA 1N33F 5KFFA 1TMMA 4QOTA 3WNFA 1OMSA 5C2GA 1IVZA 1IKXB 1WOSA 3S3NA 3P6YC 2DIVA 3V9UA 4DV3K 2N4CA 1IKWA 1AB8A 2CUYA 2QWQA 3PJWA 3CJRA 1PJ5A 1JXVA 1CS4A 5DS7A 2KKHA 1RHJB 3ZSZA 2XMUA 3VQEA 4ILGB 1KAZA 2GQ2A 3LDNA 2RS2A 2HURA 4N8NA 4GO5X 4CLTA 2FGCA 4N76A 3HP9A 4KAIA 1BWVA 4B3SK 4ATNA 3QYYA 2Q0RA 3LDLA 2MKCA 2BOAA 3DN9A 1EXQA 2Z4PA 1F3VA 2AGOA 3IRXB 2CQIA 2XB2D 3EGZA 1U09A 3G4SS 4EBCA 2CZVC 1Y7PA 1FF2A 4EO8A 3KLHA 4HI2A 1JCFA 2FJDB 2E5LF 2V9KA 1N33K 2EFQA 4JK7A 1RWUA 3VTHA 3W60A 3BO4A 5AZJA 3W64A 1L3VA 4B3RF 5AQQA 4TU8A 4TY9A 3OHBA 3CJ9A 3MPVA 4FLWA 5A8KB 1RT3B 3H5XA 2BEFA 2CPFA 2P9NB 5L1JA 3ICLA 4H4OB 2MGZB 2HBLA 4DR5J 2B0GA 5GINA 2Z2YB 2ZNZA 5J2NA 1U1OA 2DD8S 3HPOA 4EU0A 3C94A 1IG9A 1ZM9A 4UT4A 1I94F 5BR8F 3SJJA 1ZTWA 1S7IA 3JSBA 5GMDA 4CEBA 4ANEA 2YKPA 2ZM6F 1VSDA 3QZ8A 1ATRA 4JI7F 4NRUA 3L7UA 4MQ3A 4USKA 4UOHA 2ZH6A 1S1UA 4X65F 3DRSA 1QS4A 4MDAA 5LJ3Y 2QYCA 3P8BB 5KFQA 2F4VJ 2NRHA 5BN9A 1ZBSA 4YB6A 5MAOA 1FD8A 2WHOA 2WVCA 1DQ9A 2LQ9A 4FKYA 1DQ8A 3WQPA 2EK6A 3EKSA 2F9JA 2IM1A 4KT0C 2LA4A 4KAZA 2YX7A 4B3RK 3NF9A 3UDLA 1FVSA 3LALA 2BR0A 3ZC4A 4QWAA 1T03A 4JKBA 1ROFA 5B0BA 1S3XA 1UMJA 3W2WA 3DRPB 2P9IA 4R8UA 4ID1A 2VFUA 2CA9A 2QWOA 1RK8A 2RPIA 2OD6A 1FKOA 3JSRA 1I94K 5BR8K 4FLVA 3Q8RB 4V19X 3D66A 2GEMA 1HNIB 2RVJA 3MXJA 4BGBA 4P7TA 2BMBA 1W2BM 3G8QA 1OKJA 1XEZA 2ZM6K 3M6VA 3QWUA 2PDAA 1LNQA 4JI7K 2XI3A 4ZPWR 5F8LA 4X65K 2DTJA 3KHYA 4MKYA 3VQSA 2JSXA 1MA9B 3SSQA 4J9NA 1T3NA 4DHVA 1S6PB 2UXDK 4TLRA 3OPKA 4U67Q 1AROP 3CE8A 3CCJS 2BRLA 4DL4A 3OYBA 3QGHA 1KQKA 1EZZB 1SS6A 4FLYA 1FE0A 4PPZA 3B82A 5KPTA 2JC1A 2JLFA 3BSNA 4MLEA 1LK5A 5CHIA 2CJAA 3TZYA 1JCEA 4B1XB 1WI6A 1CG2A 3ZZUA 1YTUA 4Y2MA 3L3UA 4PWUA 2W40A 4Q45A 3CJ7A 5D8HB 5ADXH 2E1MC 2ALZA 1K0VA 4Y28C 2WW8A 4K41A 4BHQA 3WNHA 1KLMA 2U2FA 1PG5B 4B9SA 4FZZA 2XBPA 2A0FB 1KWMA 4CLLA 4ERDA 3TWHA 3UD4P 3FKBA 4HI1A 1GMVA 3QSIA 4RJVA 2EC2A 2NSBA 2WVBA 3LPYA 3R6MA 2M70A 2DY1A 3PYFA 3BF1A 1WEYA 3VQ6A 3R6GB 2QSFA 2J9CA 2DNLA 2J9EA 2EEYA 3T9ZA 2OTLS 2WVEA 1J5OB 4DU4A 1KEKA 4BRHA 1RCHA 4M3TA 3MM9B 2APOA 1RT4B 1U0HA 2E1PA 1RNHA 3M32B 3P5TL 1LWEA 4LF8J 1M0SA 2ATCB 1NLVA 4DR6F 3PO5A 2O8DB 1W2BR 3HCXA 1RBUA 3ZT4A 3TR8A 3V1QA 3OXGA 3TU5A 3ZT0A 3RG6A 4EP5A 5C42A 4NOHA 4Z4CA 4JI3J 2XLIA 4KPCA 1R43A 3IA0A 2E9TA 2HHTA 5AQHA 3A0IX 3VAHA 2UVRA 2FBYA 5HRPA 3R9PA 2GNKA 2J0SD 1VC0A 1HQUA 1PYSB 2EC0A 1Y00A 4XH1A 3FMWA 4ILRA 1GTHA 5GIPA 2CVIA 2HHUA 3TA1A 2BDPA 1NSKL 4CZIA 3CFRA 4C48A 4DR1F 1H38A 4BDPA 1IBMF 3JTPA 5THWA 1KTVA 4FK2A 2R8HA 5K14B 2YPZA 3J81O 4C7QA 2P8IA 4ZOSA 1E4GT 3OS1A 1IR0A 3AXKA 4I2PB 3NH2A 2CJKA 2DXEA 3MM7A 4FYXB 3RBEA 3JSMA 3EO3A 2W9CA 3CJQA 4PL7A 1C1CB 1BE4A 3SAHA 3PYEA 3KHLA 2R7QA 3EICA 4O5FA 2QLXA 4UQTA 3H08A 1BQNB 3EJMA 1OY6A 2ZWHA 3KJVA 3OR1B 3BBFA 2XSFA 4N77A 3V5RA 3N0VA 1XERA 1IKYB 2R2SA 3M2RA 3FBEA 3QB0A 3AB2B 2VKRA 1GAOA 2VB6A 2X78A 4MYTA 1WBDA 2A2CA 1ZC6A 3ZZRA 1N0VC 1IBMK 2DPIA 2CXEA 4OHXA 4KRWA 5B08A 4DR7F 2R8JA 3MXIA 1W7WA 3CD5A 3I8DA 3N4QA 2C2MB 2BJ7A 3BJYA 1CS4B 5LMUJ 4IG0A 3T41A 2P1JA 4OI3A 5ETVA 3O6QA 1JLQA 5U47A 4K59A 2BJEA 3JS6A 5AXKA 3QJJA 2R7SA 3R97A 5HK4A 3I9ZA 3SIPB 4CK3A 3W5XA 3KHRA 1PILA 3V2UC 5IWAJ 3NMAA 2Q36A 2ABYA 3M8PA 2RKIA 2VDIA 4BC5A 2BJ8A 1KP6A 2C1EB 2GTDA 1KONA 1FT8A 2GX8A 2O8EA 1RAEB 3KLHB 1FDDA 1Y5NB 1JJHA 1V5VA 2AGPA 1B64A 4IRKA 3ADAC 3P5BP 3CPWR 4C0BA 5AZJB 4XAKA 4CCHA 2ILZA 4IH7A 4I2QA 1YIJN 6FDRA 1WAJA 2IJRA 4K0KF 4CZLA 4U6PA 3QT6A 4DTMA 1BU6O 2YX6A 3O9TA 4H8KA 2CPJA 1KHWA 1U6ZA 2D4WA 3LO3A 4YN3B 4DV0J 2RQ4A 3PXGa 5J2NB 1UEKA 2M7SA 3RB3A 1RHRB 2YKQA 2DY9A 1X4EA 1XNQJ 3GYGA 3TTCA 4AM7A 4P72A 5AQMA 2BQUA 4BC7A 1RT7A 1RDRA 1YITN 3UR3C 3ZTRA 2COLA 4M63C 5AQKA 1FTRA 1S1UB 1RU2A 3DRSB 3T9NA 5EN1A 1YBTA 2EFOA 3MFIA 4OLOA 4CEOA 4DUYK 1JL1A 1S1TA 3ZTOA 1X3MA 5KFRA 1D9FA 4I0WA 4JKCA 2D1CA 1D5AA 1PSDA 1P8ZA 3DU6A 4K0KK 2HNZA 3KLGA 1RP5A 4NCGA 1T03B 3ZT3A 2C2ZB 4ISFA 1NO8A 4WPAA 5IOLA 3MEGA 2XMVA 3ILJA 3W2WB 2P9IB 4R8UB 2V2VA 1VSFA 3P1GA 2VG7A 2AP6A 2V8GA 2JNJA 2AX1A 3IM9A 4K2JA 1FKOB 4FJJA 4CEFA 4JV1A 4X4QA 2OI2A 3AFGA 2C28A 4NEZA 3TAEA 5ETOA 1QZ5A 1TR0A 1REGX 4ZVUB 1IO2A 2QV6A 3RB4A 5AQTA 1VSHA 2HQCA 5B0FA 2V5HG 2G8UA 1XMQJ 4DSJA 2LQBA 4GVBA 2ROGA 4WFYA 1UA1A 1JMTA 1ZBTA 2DPNA 4EP4A 3DLLQ 4RW7A 2YXLA 4ELTA 4LF9F 2AMCB 4YOYA 1JCGA 2NLWA 5F8NA 2CPHA 1TTHB 4K25A 4WYBA 4DV2K 1VR6A 3DXMA 3KIOA 4DCHA 3ZTPA 5IT0A 2MKYA 3R1LA 4AFFA 5KFGA 1R0AA 2MMYA 1M90T 5IT9U 3VA0A 3OTEA 3GMGA 2W25A 4Y2KA 4YB7A 4CO1A 5LM7E 4DTUA 1OH7A 1F5CA 4HCCA 4I1TA 1MN7A 5E41A 4KFBA 3VGVA 1HRHA 2NXNA 1YRUA 2E44A 4OKEA 3AO2A 3OS0A 4B9UA 2GS8A 5KG0A 5LSRA 2O67A 4RNOA 3R2CJ 1KLMB 1VQSA 1VSKA 2EX3A 4MIBA 1WWHA 2C2NA 1UP1A 1TL5A 4FKXA 2GC8A 4DPOA 4Z37A 1LV5A 1GT8A 2DYAA 4RU2A 4PYDA 1UVNA 4O5BA 4GVLA 3T7ZA 3HPGA 4LF9K 1W25A 3SPZA 4PKIA 2HF4A 4LR8A 4M8LA 3LAKA 4CLPA 3OYHA 1TAQA 1QE1B 2W2NP 1U0HB 4OYMA 5AE1A 2IDEA 2V68A 2B4VA 4BG9A 2G8IA 3O9RA 4Y6IA 2MDAA 1S1VA 5H9FK 2WB4A 3NY0A 3WXJA 5T7LA 3SQ2A 5HROA 2AZ3A 5F8GA 2YHYA 1K1QA 4KI6A 1ILYA 4MAKA 4CJPA 5C42B 4MO4A 5HQ8A 2PI4A 3LGMA 1YJTA 4F04B 2YWHA 4DF8A 2XNQA 3HSTB 4CLKA 3KFWX 4OI0A 3NCRA 1QJHA 2CPIA 1U04A 2XLJA 1HQUB 2X51A 2OLWA 2AF6A 2ROEA 1NAQA 2BKOA 1OY9A 1TUYA 2KHCA 1EAYC 4ES1A 1URRA 3OYNA 5C25A 3CDEA 4DFJA 3NFAA 3CC7N 5L1IA 2E5GA 1JIHA 4PXDA 5HN0A 3IC1A 4EZ9A 4FXVA 2YHAA 4YOTA 2CQGA 4V1Ak 3MM7B 1FRMA 1P8GA 3JSMB 2W9CB 1QM9A 3B4DA 2CAJA 3FCHA 4PG4A 3G6YA 3N9UC 1U7LA 2WTFA 2DR9A 1TUGB 1WSGA 2E5IA 4ISGA 2E66A 1N5YA 3IGNA 3KJVB 3CM6A 2HQGA 4AILC 2AJ0A 4LFAF 2FSNA 4NZ0A 4URGA 3M3ZA 3M2RB 4V19S 4EAHD 4WCEQ 4CGHA 2JWNA 4OZ2A 3OYMA 3BQ2A 1RLDA 2OPSA 4P2MA 1CZAN 1NZ8A 1RISA 1M5PC 4UF4A 4FVUA 5AQRA 1D09B 2JEGA 2E7XA 3IRWP 2DY4A 1F2GA 3VWSA 4A5AA 2CG8A 4IG0B 2G8HA 5CZXA 3FGUA 3ALYA 3AVIA 1JLQB 2GQQA 2XO6A 3X3UA 3O44A 2FHKA 1Y64A 3O3FA 4IH6A 3IKMA 4CLFA 1MNEA 4UUXA 4OGCA 4OJHA 5F0WA 3DWLA 3OBYA 1YJRA 1MMDA 2CQ0A 3M8PB 3EE8A 2RKIB 2X1FA 4I6YA 1SJ4P 4DCJB 1NK7A 1X9WA 4U95A 4GRSA 2A3ZA 4NRTA 3AAQA 2O8EB 3G6VA 4F7VA 4ZJOA 2XCPA 3AA9A 4LFAK 2H5JB 1UPMB 4BQZA 4O8UA 4PG7A 4NA1A 3A13A 1LK7A 2K3KA 4I2QB 5KFEA 3NH1A 3BGRA 4BVOA 2MQLA 4DHYA 4M45A 3K5NA 4FPRA 2CPXA 2D1KA 2DNHA 3OXFA 1FJGF 2M52A 3IR7B 4ILLA 2DHGA 1X9SA 3T1YJ 2HHHJ 4QYZJ 5FLXU 4K5SA 3V6KA 2GMJA 3NOCA 2MZSA 1WEZA 1X0PA 4Z7YA 1VS3A 1NPKA 1S77D 1VQ7N 3OTDA 5CCMA 2VPZB 4BRGA 4DTSA 1RT7B 1HKCA 2A6OA 3TVZA 1FKPA 3RBZA 1HWKA 3BZQA 1U24A 2EI5A 4CD3A 3OD2A 5E33A 3R5GA 2VWJA 3F9MA 3T5LA 1S1TB 4DPWA 2PFFB 1GLLO 2HSTA 3BKFA 5KRSA 4DL2A 1NSAA 3ASMA 1WDTA 2HBYB 3M2UA 3RAMA 3BB5A 3AH6A 3D0GE 1U1KA 4DQIA 3EVWA 4Q0BA 2HNZB 4L76A 4Z2XA 4NCGB 1YTYA 1TQLA 4D3HA 4B1UB 4XTTA 4YDXA 3JTNA 2E9ZA 3MEGB 4LVOP 3M6GA 4ZVQB 3CMEN 2CRLA 4WJBA 1HNWF 2MSSA 2VG7B 4X62K 2R9LA 2VQFF 3MCNA 2IMWP 4EBEA 4XEIA 3H98A 4DV6F 4M63A 1FA0A 4DX6A 4CHYA 2OEMA 3LH2S 3VGLA 4GVBB 1IM4A 1KXPA 1W2IA 2DH9A 2XULA 4RW7B 2OSRA 2WSEC 3CDWA 1ICEB 4L73A 4CO5A 1NK6A 3DXMB 2IVMA 1VQ4S 3R7SB 3WNEA 2DRAA 2VBYA 3T5JA 2GUPA 1R0AB 2KXHA 3KK1B 2KM8C 1A7GE 3LW5C 2Y3YA 2IY5B 1HNWK 3OYDA 3TAPA 3W5ZA 1CLQA 3IGVA 4RUHA 2A5XA 3PRDA 1QD1A 5C24A 1FFWB 1SJ1A 4ZLJA 4KFBB 2VQFK 1F60B 3CD7A 3D28A 4JK8A 4F25A 3NEKA 4DV6K 2EW9A 1RT1A 4H0TB 2UUAJ 4N56A 5HP1A 1FNOA 2X1GA 1OVYA 4DV4J 3EGWB 4AQYJ 4UY8O 4WP8A 1D8ZA 1GTEA 3MMVA 3BR9A 3L2UA 4WF9L 5DZ6A 1N0UA 4Y2AA 1AZSA 4WKYA 3EGNA 2QLBB 1M90O 4P74A 2VIHA 4HTLA 3H4BA 3SBTA 2FHJA 1V3ZA 4CFCA 3VVUA 2RS8A 3NHGA 3M05A 2DFFA 2NYHA 4Y2IA 4WTYA 3R6LB 3MAHA 5HBMA 1HR0F 1VQNN 3VA3A 1X5SA 1RHKB 1NGHA 3HJVA 4ZLLA 1N8RO 2O8FA 1S1VB 1R89A 3D7SB 5IT4A 5T7LB 2UUBF 5HROB 3KLFA 3IG1A 4ZPTR 1JXEA 2MKHA 3O3HA 2FF6A 4G1IA 4IDKA 4XDCA 4OL8A 1IR2A 1T3OA 4QYRA 4F4YA 2OTJN 2VU5A 3BN7A 4DZDA 4F3OA 4KH0B 1F9FA 5AXMA 4IJAA 4FVMA 4QS7A 1XC3A 4YMEA 4Z94A 1DT9A 2FHJD 4Y3CA 1ZTTA 1WSFA 4BR9A 1MMLA 1GOCA 2PIIA 1O6XA 4OZ5A 3FZLA 1CQNA 1HR0K 5CXTA 1S72S 4DCOB 1U49A 1SL1A 1S12A 3EN9A 1VQOS 2R3VA 3ZSVA 4DTJA 2HLUA 4KRFA 3OL8A 4I67A 1CZ9A 1XMOF 2UUBK 3RMDA 3MCPA 1CBKA 1ACMB 2UYTA 4ZVSB 2ZBIA 2GJIA 1QHAA 1N5YB 2YNHA 4EHUA 2FJVA 1AXQA 4NLSA 4KI4A 3GFYA 3I5BA 3OT9A 1E3MA 1WG1A 3EEQA 2BJ9A 4J5OA 8ATCB 3PFOA 1RCXB 4BREA 1A5XA 4FP9A 3H4DA 2B6AA 3I55S 2OPSB 2UUCJ 3SUOA 4USIA 4LJMA 5HLFA 2A41A 3NKYA 4CEQA 4JI4J 4NXNJ 5LOQA 2V2KA 3OUYA 2ACYA 3I56N 1UCNA 4DV7K 4WQ5C 2R42A 2MKIA 2BV3A 4XDDA 3Q2TC 3H25A 1M5OC 1XMOK 4LRFA 2RJZA 1RWPB 2QMWA 3PYGA 3VF4A 5B0GA 3D3BJ 3L9ZA 4IUFA 1URNA 1OH8A 4RUAA 3MDQA 3D67A 3SJHA 2ACMA 1B7FA 2F1FA 2N4DA 4FYDA 3S8SA 3WC0A 2YHXA 4DUZF 1NKEA 1UETA 5LT5A 2YX4A 2JX2A 4W5RA 2QTWA 5GAGP 7AT1B 4RWTA 3NGIA 3BGRB 4DJBA 4W90B 3IAM9 3I0SA 1C1AA 5IT9Y 3CXCM 1W9HA 1AW0A 3KHGA 2ZGYA 2P6SA 2XY6A 3WNGA 4JK9A 3FZBA 4WFNL 3R7BB 1GLJO 2IM2A 3KNAA 4CH7A 3HX9A 4FJHA 2Q0UA 4C3KA 4ZTFA 2W2QP 4EK2A 5HO4A 4KJIA 2V8VA 2DEJA 2KRRA 4DQ8A 2FHMA 1ZPVA 2HFVA 5FPNA 3DXKA 4DXLA 1FKPB 3KUHA 4FL9A 2H4WB 2RF2A 3A1YG 3DCAA 3SXLA 3GSIA 4CLUA 2CQDA 4CIEA 1VGYA 1A0OB 1HWUA 4QIEA 4HEA9 1PO6A 1ZETA 2VG6A 4JI2J 4DUZK 4OLAA 3QGGA 5GAHP 3V9XA 4FF4A 1KVJA 1ASWA 5B0EA 4JKDA 4KQZA 4NASA 3THTA 3M2UB 5BN8A 4FWRA 2AEMA 3JXUA 1Z25A 4Q0BB 4NEYA 4AD6A 1UWBA 4DI6A 4ILJA 3TUPA 1S0MA 5M2UA 3M9NB 2KXNB 1IUJA 3BYPA 5LMNJ 2F9WA 1D0EA 1F5AA 3V6JA 4JV0A 3O80A 3TX8A 2NNWA 4LRBA 1J2VA 3GTYX 5CD4A 4JEPA 3K5OA 3MAQA 1ELOA 4JS5A 1XK8A 3CYMA 1QSSA 4OYBA 3A3OB 2XGQA 3AARA 3TZZA 4OVLA 1MMNA 1VFJA 1UVJA 3TR5A 1X4HA 4OI1A 1JLBA 2P9KA 4C8MA 2CQ1A 3U27A 4A8WA 3WXMB 4FJ5A 3I5CA 2W42A 4OPJA 1ZS6A 2QL9B 4QIVA 1T7PA 2WCXA 3NVMA 1YVUA 4C97A 4P71A 2PEHA 4CI0B 4OX9J 2ZOFA 3CJBA 4M5NA 2J4RA 2VL1A 4PKHA 3T1AA 4CJEA 1TKTA 3BH7B 2V2QA 3M7VA 2I0XA 2EFVA 3PIOQ 3L95X 2B51A 5HANA 1FX2A 1H2VZ 3ILLA 2IDLA 3VAFA 4E1NA 1V9OA 2ZH4A 3R5BA 3CD0A 3VEYA 3ELHA 4WE1A 2UXBF 3D6FB 3QAEA 3DNCA 4TNOA 5KT4A 3G4SN 2UV8G 4A4JA 5A2QY 3F73A 5C24B 3NCQA 2QEXS 1WJ9A 4J90A 2PD1A 4LSNA 4KC5A 1RT1B 5HP1B 5ADZA 5GADP 2NRXA 1AZSB 3KNGA 5D4LA 2J6UA 3TOQA 1B99A 3UR0A 3ZSXA 3LL3A 4LT6A 3OTBA 3NMUA 3VAGA 3O1LA 4LFBJ 1HLWA 3WXLA 1W97L 5HBMB 4DV1F 3QRPA 1NGBA 1BHNA 1U1LA 3E2EA 1X4FA 2QIFA 1F3FA 6AT1B 5H9EJ 3RR8A 2IAJA 4ZVPB 2J8SA 3GOIA 1IQTA 1O0PA 3GLJA 4CO2A 3KLFB 2YKAA 1F1BB 2UXBK 4OO1J 4M3YA 1PJ6A 3IG1B 4KREA 5AZIA 3QEPA 4JBCA 1UVKA 2Q6CA 4RCHA 3ET6A 2POKA 1XQIA 4C23A 4IDKB 2B43A 3HF5A 4G6VB 3MEDA 1JXLA 1TFYA 2JVOA 1FW6A 3MEEA 4CZKA 2QWNA 2BQ3A 4ZS6A 5M2RA 4KHMA 2HNDA 3BDPA 1JX4A 4JI5J 3G86A 1NB2A 2PYJA 1NDLA 2GMLA 3N6MA 2F5GA 3U4LA 3MR3A 4MIAA 5C2DA 5AQLA 4WFBQ 3CJAA 1AT1B 5MLCQ 5F9NA 4GY2B 5KGXA 3VQAA 2DGWA 3GYXB 1DJ0A 2H48B 4DV1K 4DU1A 4E7JA 2Z2MA 5KOWA 2JDJA 3U1NA 4OMFG 2Z30B 3VQ8A 3GR0A 4BE1A 1NGIA 2Z1GA 1UTAA 3BV8A 4ECZA 2CPEA 1Q7LB 4IJNA 3T3FA 1T05A 4W92B 2L9NA 1T3VA 3QETA 3EDQB 2JHEA 3RZAA 3ULDA 2PSZA 4ECVA 2YNHB 2P6TA 4ALZA 1HFEL 4ED0A 4LQ9A 3L4BC 4NMLA 1U1RA 2ZBQA 4BR7A 2OANA 1I5OB 4W5NA 2NYIA 1VBYA 2EWHA 2KYXA 2B6AB 1U2VA 1S1WA 4JV5J 4KR0B 4OYOA 2GAGC 5HLFB 1R6YA 5J2MA 1NJIT 1RTZA 4YORA 5EVZA 2EPIA 2HHWA 1VQKS 3AQOA 2V8DA 3OUYB 2KXFA 1ATSA 4BC3A 3CCEN 5F8IA 3KK2A 4MIWA 5CZVA 4UW2A 4PPDA 3ETMA 3AO5A 3L2WA 3KKFA 3NOGA 1WOOA 2J7UA 3SZ2A 3MGJA 4QQBA 1UZDA 3SFGA 2YQ0A 1S59A 2F7TA 4IRCA 4H0XB 5HL7Q 2G13A 4RBUA 4IBNA 4A47A 3ENHA 3OW2M 4NZ6A 3RVCA 2A1SA 2KJVA 2KDOA 4MH8A 2OPQA 3CC4S 5HVHA 3M1FA 3CTRA 3Q8SB 2B7CB 2FBVA 3H2UB 5DDPC 4J2BA 3LDQA 1GLAG 3T6JA 2Q1LA 3JB9k 1OS5A 2JEIA 2F3JA 5KFVA 3FSIA 4ENOA 1Q81O 5IQ6A 1NH8A 3NGSA 1SH0A 5AQSA 3I0SB 1X9JA 3AB4B 2D0BA 1TZ0A 2FJAB 3W8PA 4J2EA 4QIFA 3FFIA 1VQYA 3QLHA 1DHMA 4J7CA 1S97A 2WSFC 1YVFA 3KDNA 3DLGA 3JQKA 2F4VF 2E6LA 1VQ8S 3CC2S 5F8HA 1HBMA 2HBJA 4X4TA 4M3RA 4QPTA 3DXKB 3TUIC 5DM6Q 2QKBA 4U9RA 3THPA 5JS1A 3H40A 1M5KC 3PYDA 2RF2B 3DHXA 2FF3B 1FRJA 2LP4A 3EGVA 3H5YA 5KFYA 3WX8A 2VG6B 1WLJA 1FDNA 2KO1A 4JKFA 4USVA 4JRQA 2QA4S 2KJWA 3TAMA 2HWHA 1RTIA 1PGZA 2ZJPL 1XC9A 4OFZA 3IFEA 3AY0A 1FI4A 3ZYYX 5F9LA 1FESA 4QWDA 1FERA 1BISA 3W61A 5SZTA 4DR3J 1FXDA 3T5KA 1AFJA 4ZCKA 4Y34A 1RA6A 1UWBB 1VBKA 4IO9Q 3GIMA 2XSJA 3G9CA 2X6NA 1ZZFA 5D4NA 3P4IA 2XTJP 4KHPJ 5AQJA 4GV3A 4CVNE 2V4QA 1TKXA 1RTDA 1ZAVA 4LIRA 4NLXA 1U1PA 5ADXA 2F4VK 3GYNA 2W9AA 1QDUB 2PMHA 3D0HE 1XWLA 2ZH3A 3ATUA 2KRBA 2DFEA 1L3TA 1RAHB 5K8OA 1HQEA 4H4KC 4KTWA 4X64F 1BMQB 4ECXA 4CJ3A 1IBKF 2XHWA 5CHCB 2P9KB 3HK2A 3DRYA 2ATLA 4I9LA 4USUA 5DZ7A 2XHCA 3A5OC 1U8WA 4FYYB 4DL3A 4H5VA 3OL6A 1L3KA 1HNZK 4PR6A 5KT3A 2BX6A 1R27B 3NGRA 4JKEA 3TTDA 4OLBA 4YDUC 1RZMA 1IBLJ 2CJYB 5FPMA 4FLUA 3DLJA 2JC0A 2GVZA 2LDYA 3ENOA 1TK8A 1ZA2B 2RIJA 1TKTB 2JJ4D 1VRUA 3DRRA 1C0GA 1WACA 5DLFA 4LFCK 4ZP7A 2HEKA 5D0RA 3PSFA 1R6VA 5LJVA 3CCSS 4WE1B 4KGMA 1QTMA 3L6QA 1Z6RA 3LP3A 5L46A 3U02A 2L9WA 4C8LA 4LSNB 2JH3A 2QL7B 3QICA 2GAHC 2A18A 3Q24A 5J1EA 3TQEA 4X64K 2IVFB 2GV1A 1N34J 3VQ4A 5JVHQ 1IBKK 1Z2ZA 4FNIA 1QSLA 3SQ4A 5EX5A 4HHHA 2O8BA 2WVFA 4P75A 4A8YA 2Q3SA 3HHLA 4NYOA 5E2QA 3UN5A 4X4SA 4CZGA 3L3CA 1S10A 3CIZA 2QJ3A 2E9RX 5AQUA 3GG0A 4OPAA 1FRKA 4JI3F 3UD5A 4AHCA 2Q31A 3C14A 4P9SA 2SXLA 1GMWA 2HVDA 3FK4A 2DT9A 5DM7L 3TJ8A 3C8YA 2KM8B 4BRCA 1PAEX 2IAJB 5BR9A 3AQPA 5H1SQ 4CRJA 3NNCA 1DZ5A 3SNNA 3PIOL 4IOAL 4BVPA 2YY3A 2Z8QA 3Q89A 2HG4A 1CJVA 5M1KA 5AZIB 3QBXA 2MPUA 3ET6B 4OI6A 1XR6A 4NLYA 5E5NA 2XZWA 3MEDB 2K1RA 3PW4A 1M1HA 3MEEB 2JEFA 5HRNA 5LXYA 3K9JA 2OJ3A 3H5SA 2UUWA 2UZAA 1BQXA 4J9MA 3SQ0A 1EX4A 2HHXA 2HNDB 3RJMB 1NSQA 1KAXA 1B0TA 3AJ1A 4W98A 3G2XA 3W9JA 4CLZA 3CCQS 5DGAA 4C0OC 4DFMA 4G1PA 4DBQA 4DV3J 3DI6A 3HTVA 1GX5A 5AQYA 1OO0B 2BKNA 4MKVA 4JI3K 2ZE2A 2H51B 1XMBA 1SKRA 2LCWA 3MEKA 2FY1A 4USWA 4I7FA 4F2SA 1VQ6N 3CCVS 1U6BA 1T6DA 4V19J 3P5JA 3OTCA 4OLPA