1IKVA

K103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
557
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 147
structure length 556
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikvA05
4WXWA 3EZUA 2FBVA 4FLZA 1U09A 1N48A 2ZQBA 2JLEA 1Q8IA 4IOBA 1D0EA 2D0AA 3QEPA 4KHQA 5EDWA 4K4UA 1TVRA 4O3NA 4FXDA 2J6TA 4BE0A 1T05B 2Z1IA 4IRDA 3HVTA 3QESA 5KFYA 1SL0A 1MU2B 2XRIA 2V0NA 1OS5A 1CXUA 5EWFA 1SH0A 3HVAA 4JV2A 3ZSXA 3IAYA 3H4BA 3SUOA 4FJLA 1EXQA 1S9EA 3Q8SB 1NJZA 2BQRA 1BI4B 2HNZB 2GIRA 1JLQB 4WE1A 4MKBA 3GV8B 5F8LA 3PZPA 2VG6A 1BL3A 3OYJA 2W8KA 3CG7A 1RTIA 3NH1A 4IG0B 3DLGA 2WRMA 1LV5A 4FZZA 1KLMA 3DMJA 3IN5A 3HPHA 5FROA 2E6LA 2RN2A 3QLHA 5C24A 2BE2A 4GW6A 4NLTA 4I7FA 3OYCA 4Q43A 3MFHA 5KI6A 2X78A 2CKWA 4OVLA 4KRFA 1RTJB 1RNHA 1GOAA 4FJMA 3I0RB 2FJWA 4J2DA 2F8EX 3LPTA 1YTAA 3RB4A 5D3GA 1XR5A 4CEDA 1CLQA 3CDWA 1JLEA 3LP0B 3GYNA 3DLHA 4Z4EA 4RW8B 5C42A 1J54A 3TQ1A 3LALA 5DGAA 5F9LA 1UWBA 4KV8B 4IH7A 3VQPA 5FRNA 4BDPA 2JEGA 2I1RA 4FYDA 3FFIB 2NUBA 4BACA 4NLGA 1KVBA 3JSMB 4TQRA 4DTJA 3SCXA 3M9OB 1IKWA 1ASUA 2FLLA 3OS2A 5DGBA 3OYHA 1HPZB 2XCPA 1C1AA 1C1BA 2EHGA 2J6SA 4F4WA 3AVFA 4BE2A 1S1XA 1S48A 5F8NA 4RNFA 1RT2B 4ID1A 1DLOA 3MEGB 4R8UA 4DFKA 1BQNB 4FJ8A 5J1EA 5KG2A 3PX4A 4F4KA 3LANA 3ITHA 2P5OA 3BDPA 4QW9A 4CF1A 2AGQA 3MXJA 3CJ4A 2HMIA 4G1QB 4I9LA 3G10A 1RDRA 3RMDA 1RYRA 4KHUA 3GIJA 1S1WA 3M8QA 2UVRA 1X1PA 1ZTTA 4FJ7A 3DRPA 1QHTA 1Z26A 2HW3A 3OYLA 2IOCA 1TAQA 1QE1A 2G8HA 4O0IA 1WSJA 3DOKB 1ASVA 3V4IA 1T03A 2E9TA 2XY7A 4GC6A 1JLFA 4DL7A 5EU7A 3VQSA 1QSYA 4ZMMA 3BGRB 3PUFA 2VWJA 3NAHA 4IFYA 3KD1E 4YMEA 3RAXA 4H54A 2OPQB 1YT3A 4KFBB 3H5YA 4B9SA 2YNHA 2XGPA 1FK9A 1UAXA 2VWKA 5HROB 4FJXA 1T3NA 4FJGA 4KTZA 4B3OB 1T7PA 4NLVA 4YP3A 4CJKA 3TWHA 2PZSA 1RT4A 1JKHB 3IS9B 2IM1A 4ED8A 4K4WA 3KTQA 2FVQA 2AX1A 4W5OA 3PR5B 1J5OA 3PVXA 3DOLA 1BQMA 3U3YA 2R7YA 4C8KA 4F2SA 2HNYA 3EY1A 4ED2A 2UUTA 1A5WA 3ZSQA 3LWMA 4DSIA 1BCMA 2R8KA 4NCGA 1XWLA 3SUPA 3M8PB 2YKNB 5F8JA 3RMAA 4Q0BA 3GV7B 3NKYA 3DLKB 3BJYA 2GIQA 1LWCA 1WSGA 3B6PA 3CQ8A 1IO2A 1VSDA 1U47A 5KFGA 4KKOA 4FS2A 2UVVA 1RDBA 2WCXA 5KG7A 1CXQA 4BDZA 3PX6A 4CGFA 2YNGB 4I2QA 3MR6A 1HNIB 4ZP6A 4KI6A 5J2MA 2ZE2B 4QOZB 4KE5A 5F8MA 4OPJA 4ECYA 3RBEA 4J2BA 4ZVGA 4B8AB 4E7HA 3KOAA 3TR8A 1LW2A 4MKAA 2D0BA 1R0AA 1TV6A 2X74A 4QWCA 1S6QA 1XHXA 4RW6B 4CIFA 2C2EA 1XI1A 3CJ2A 3PV8A 2AU0A 4WZMA 3ZT0A 1SKRA 3V81A 3H59A 5KG0A 3EPGA 1S97A 4AHTA 2Z1HA 2ZD1B 5KFIA 2ILYA 4W5RA 3PY8A 4O4GA 4EYIB 1JLGB 1TL3B 1NKCA 3BR9A 4OKKA 3MEDA 1N6QA 3Q8RB 4E0DA 4J9LA 5KFOA 3OYIA 3NL0A 1B9FA 4DTRA 4M3YA 1XR6A 1BHLA 3TAGA 3BQ2A 3K5NA 4CEBA 1B9DA 3DRRB 4CERA 3KLHA 1RTDA 3L3VA 3NBPA 4TY9A 3ZT4A 4DL2A 3NDKA 1IG9A 2ITGA 4RW4B 1UA0A 3S3MA 1S1UB 3C94A 3MECB 4CHYA 4HKQA 4Q8EA 2OYQA 1TAUA 2XO7A 5EWEA 4QAGA 1GOBA 2ASDA 2E4LA 3IRXB 2FVRA 5KFMA 4F4ZA 1NNDA 4DG1A 4CGJA 2RDIA 3CFRA 4EBCA 5HBMB 1RYSA 4KHNA 1S10A 1L3VA 5EWGA 4RUAA 3RTVA 1VSIA 1DTTA 5CZ1A 1RT1B 4FJNA 4RNOA 3UQSA 3CJ0A 5T7BA 4KB0A 4PUOB 3H98A 2R2RA 5KT3A 1C0UB 5FDLA 5HP1A 1N5YB 3U6FA 3I8DA 3O3FA 1EETA 4C8LA 2IGIA 2W9CB 2IAJB 3VQAA 4G3IA 4KAZA 2QK9A 3KK1B 1TKTA 2JEFA 4ZTJA 3DLEB 3EPIA 4CEFA 3B6OA 3VQ9A 3RRHA 3PX0A 2WOMA 3ZSRA 4OLAA 2DFEA 1TL1A 5DK5A 1NHUA 4RZRA 1VK0A 4XO0A 3K5LA 1RT6A 4EP5A 3HVRA 2XWYA 4XPEA 4HYKA 4DQQA 3M8SA 3NCIA 1F21A 2WONA 1KFSA 5KFKA 4NYZA 4J9MA 3OYMA 4RW7B 4FS1A 2FVPA 4LY7A 4CJUA 3HP6A 4FBUA 2OZMA 1SH2A 2YNIA 5KFSA 3KKSA 3AVBA 3QINA 5KFNA 2RF2B 4B9UA 4BWMA 4KTQA 3QIPB 4I2PA 4EP4A 2IDOA 4O3PA 1EKEA 3IG1B 1FKPB 5KFTA 3GIKA 1WSIA 3TAMA 4E1MA 1IM4A 4EBDA 1S9FA 2JC1A 4RUCA 4N41A 1S1VB 2RKIB 3OHAA 4ECRA 2YNFA 3ISND 1IKVB 4CGDA 4EYHB 3ZT1A 1S0MA 2IM3A 1NJXA 3ZSYA 1SUQA 3D5MA 4AILC 2YHAA 3NF7A 3KLFA 2XGQA 1TK5A 4J9PA 2W42A 1RT7A 4EO8A 3SV3A 4FK2A 3ZCMA 1K6YA 1S1TA 4PWDB 3LWLA 3C6UA 3JYTB 3MFIA 3N6MA 4DTPA 2IA6A 4YNQA 3CDUA 2ZKUA 1VSMA 1LWFB 1WAFA 1HMVB 1S6PB 4KTWA 1HQUB 4QWBA 1U4BA 4AHCA 4K4ZA 1MU2A 2EX3A 5J2NB 5DQIA 3LAKA 4HCBA 3D45A 4N76A 3MEEB 4K4XA 4WZQA 3M8RA 3OS0A 2XC9A 3AVMA 3CFPA 4RW9A 4IFVB 4DU4A 3RR8A 4QPXA 3V9SA 3OSPA 3MAQA 5KFVA 4ED7A 3VQ8A 3SZ2A 2Z1GA 4CE9A 4FVMA 3OY9A 4O44A 2B43A 4IG0A 2WHOA 3ZSZA 5CZ2A 3ICLA 3V6DB 2GC8A 2DFFA 5DMRA 2Y1IA 3QZ7A 3H5XA 1JLCB 4J9NA 2HHWA 3OVNA 4F4XA 3CDEA 3G0ZA 2X6SA 4FZYA 3I0RA 4B08A 4Z4CA 1WNEA 4K50A 1C1CB 4ID5A 3CM6A 3NE6A 5C25B 3LP0A 2D7SA 4KSEB 4M3ZA 5E41A 4KV8A 4LH5A 3VN5A 4J2EA 2OPRB 1BCOA 3OYEA 4CFAA 3RMCA 4IQXA 3UIQA 3NGZA 1JXEA 4C8MA 1DTQA 1HPZA 3PW4A 3K58A 2BANA 3HT3A 4Z4HA 2IM2A 2C2RA 1QS4A 2PYJA 4Y1CA 1RT2A 1K1QA 1FKOB 3AVIA 3MEGA 3HXMA 4CJSA 4KAIA 5JXSA 4ECUA 5KG4A 1RT3B 3BSCA 2VG7B 4TLRA 3V9ZA 3KJVA 3SQ2A 1SL1A 1RA7A 3ASMA 4G1QA 4KHRA 3GIIA 4DTSA 1JLAA 3CWJA 4IG3A 3OL8A 4ELUA 4Z4GA 2IM0A 2W9BB 1T8EA 2HHUA 1VSKA 1RBVA 3O4NA 1K1SA 2XHBA 3KLIB 4KHWA 3ZSVA 1KVCA 4XIUA 4EZ9A 2IC3B 1D5AA 3TAQA 2AJQA 4YR2A 1S49A 3SFUA 4DQPA 3DM2B 1SL2A 3AO5A 1HJRA 4Z0UA 3VQ5A 2P1JA 3IGVA 1TKXB 4O3RA 3OL7A 1KTQA 1KLNA 3HVTB 3QEWA 2YV0X 5HROA 3TAPA 4F3TA 3HJFA 4MIAA 3SQ0A 1NK4A 3AO4A 5CY4A 5KFQA 1I39A 4ECWA 5J2PB 4FJIA 1W25A 4K4VA 3P5JA 3RR7A 1JKHA 3IS9A 3ZT3A 4WE1B 4LH4A 4CHQA 2D3UA 4K4TA 4DSKA 3TAFA 4NCBA 1VRUA 1RCHA 1QQCA 1ITGA 3SQ1A 4DTMA 3THVA 2HNDB 3SPZA 2QKBA 1C6VA 3BREA 4B8CA 4DTXA 1NK9A 4J9SA 3OYDA 3TARA 4IH5A 4J9OA 1NHVA 4IKFA 4O3OA 4OL8A 3LP2B 2HHTA 3QIOA 2YKNA 2P5GA 1LAVA 3UR0A 4TSXA 3M9MB 5F9NA 4DL5A 2A1SA 3DLKA 1IKXA 3BQ1A 3ZSWA 4ECSA 2QXFA 2UVUA 1G15A 3O3HA 4KHMA 1JLEB 4ZP8A 2HB5A 3IGNA 3VQ4A 5I42B 1TKZB 3D28A 2EC0A 4NYNA 1UWBB 1VSJA 4JLHA 3T5KA 4DU1A 2ZE2A 4IKAA 3T3FA 3KLEB 4O3QA 4CJEA 3S9HA 3KMQA 1IKWB 3VQBA 2PYLA 3AA5X 3S3OA 1GX6A 3V1QA 3DRSA 4GMJB 1FXXA 4NLSA 4CJ5A 3PW2A 4CJ3A 1S1XB 2G8VA 4CJTA 1LWEA 4DFPA 4HTUA 1TKDA 3HO1A 1KFDA 2G8IA 4TY8A 5JS1A 4DTNA 4NLWA 1WNSA 2D3ZA 2HMIB 4DL4A 3HYFA 1TP7A 4NLOA 4E3SA 1WSHA 1TL3A 3SUQA 2GUIA 4Y2CA 1S1WB 4CHNA 3OS1A 2G8WA 4FK0A 4FJ9A 4IDKB 4DS4A 3T1AA 1EP4B 4CGIA 1HNVA 4DU3A 3Q8PB 4NZ0A 2XY8A 3DRRA 3V4IB 1T03B 4CHZA 5F8HA 4DSFA 3RB0A 1JLFB 4B9LA 4MK9A 1ZBUA 2YKMB 1X9SA 1NK8A 4YR3A 1NK7A 2OPPB 4RW4A 4LSNA 4IFYB 3T19A 2BGGA 2ASLA 4EO6A 4R0EA 3AVGA 3BQ0A 2HHVA 4FM2A 1D9FA 1UA1A 4F2RA 1VRTA 3ULDA 4WFXA 1FK9B 4ZP9A 5J2QB 5CYQA 2FJXA 4YFUA 4E19A 1W9HA 2IJNA 3QO9B 4M3TA 4ZPCA 5F8GA 1RT1A 4J9KA 3GQCA 5KGWA 3A2FA 3G6VA 4LQ9A 1RT5B 3OJSA 4DSJA 5HRSA 1N5YA 1RT4B 2O5DA 3TVKA 1VSHA 1Q9YA 4W5TA 3KK1A 3DLBA 3BSOA 1HYVA 2OPSB 5KT5A 2OA8A 4DQSA 4MIBA 3DLEA 3I0SB 3MF5A 4E89A 3P83D 5HRPA 2D0CA 3DLRA 4HCCA 4FBTA 4FM0A 1NKEA 1IKYB 5KFBA 1LAWA 3VQ7A 4QW8A 2X6NA 4CJPA 3SJJA 3TI0A 1C0TB 4Q0BB 5KG5A 3H08A 3NAIA 3OLAA 2A1RA 1LWCB 1SV5A 3KK3A 2XY6A 4ECVA 4H4OB 2KFZA 5KT7A 3NGIA 4B9NA 3KLGB 5CYMB 4ZVHA 4RW7A 4W5NA 1LW0B 4FLUA 4I2QB 3KK2A 4M42A 2R2SA 1HQEA 3MR3A 2B6AB 4NLUA 4Q5VA 3RWUA 5KFAA 4DS5A 3QIPA 3L8BA 4CESA 4MFBB 2KFNA 1FKPA 3RB3A 3AVCA 2HHQA 2G8KA 4M3RA 4FCYA 1HYSB 4NYFA 3SV4A 5SZTA 2AQ4A 1S1VA 3PJWA 1EX4A 3K59A 3CO9A 2RKIA 1QAIA 1HYZA 4ICLB 4M94A 2PY5A 1S6QB 1IKVA 3KHRA 3G6XA 4IRCA 1GOCA 1S9GB 5KFDA 3NF6A 3H5UA 1JLBA 3V81B 3CYMA 4ED1A 2J6UA 1A5VA 4NLDA 4CJVA 4DTUA 5HLFB 2DTUA 3PR4A 4ZVFA 1CSJA 2VA3A 3QERA 1N6QB 1C2PA 2I5JA 2FC0A 2OH2A 4ED3A 3JYTA 3F9KA 3K57A 3DYAB 4DF4A 4NCAA 3V6KA 4CK3A 1LWFA 4CJLA 2JGUA 1HMVA 1S6PA 4FLYA 3C6TA 4LSLA 1TK0A 3KLHB 2OZSA 1N4LA 5L1JA 4OGCA 4M41A 4NRTA 4Z4IA 4HUEA 1MMLA 3DI6B 3O3GA 1YVUA 1HRHA 2AX0A 4CJWA 2BDPA 4GC7A 3QIDA 3RB6A 2C2DA 5KFWA 4Y1DA 3VQEA 4ZHRB 2F96A 2IJFA 3HK2A 2B5JB 2HAIA 2P51A 1KCFA 3KNAA 1REVB 4DG1B 4FLVA 4BWJA 3Q8QB 2DPIA 3PHEA 3OJUA 1U04A 4JUZA 1ASWA 1DTTB 3V6DA 1O1WA 3SYZA 1ZBFA 5HP1B 4DF8A 1JLCA 1EETB 4DL3A 3QNOA 5KFFA 4E7IA 3DDKA 3KHLA 4O4RA 4R5PA 4TYBA 4XPCA 2CJQA 1RTHA 4HUGA 1GX5A 5KFLA 4J9RA 4ZVEA 4MK7A 4CK2A 5JS2A 3RMBA 1L3SA 4CF0A 2KQ2A 4WFYA 3AVJA 4Q45A 4CJQA 2GV9A 1TL1B 3EZ5A 4K8ZA 1T05A 3P1GA 3SI6A 4AHRA 5KFHA 3I5CA 1RDCA 3AVAA 4DMNA 4QWAA 2OPRA 1RILA 2QKKA 1VSEA 2QV6A 3NAEA 4PA1A 5DLFA 3OYFA 5HRRA 3QEIA 5KG1A 1QTMA 3BSNA 1BI4A 2HNZA 4CGGA 2G8UA 1JLQA 2BRLA 1X9WA 1IH7A 2W8LA 5FRMA 4JRQA 4DWIA 5C5JA 1FKOA 3LP1B 4ZPBA 5DLGA 5KRTA 1YTUA 4I2PB 1VSLA 4URGA 4L8RB 3AO1A 3AVKA 2B4JA 4PQUB 3LPUA 2KW4A 2ASJA 3AVLA 1BIUA 3LP3A 1RTJA 3N6LA 3OL6A 3L2WA 4EEYA 1Y97A 4F4YA 3QEXA 4B9VA 3PJXA 3KLIA 4FLWA 4RG8A 2BQ3A 4RW8A 1SUQB 4DLGA 3VA3A 1QSLA 2FJVA 3PW5A 1D1UA 3T5LA 4IH6A 3L2RA 1UOCA 3KIOA 4CK1A 1TGOA 4KREA 1A5XA 3OHBA 4X2BA 5DQGA 3DM2A 3AA3A 3CFOA 3VQ6A 4CFCA 3NHGA 3RBDA 1S1TB 3E01B 1Z25A 3C6UB 3FFIA 3OL9A 4FLXA 4DFMA 4O3SA 3JSMA 2R2UA 2E9ZA 1TKXA 5KG6A 4O5BA 3K2PA 4F8RA 4U6PA 3LAMA 1BGXT 5I3UB 3OSNA 4OJRA 4HHTA 3NGYA 4DQRA 2FVCA 4H4MB 4TQSA 4NLPA 3RRGA 1BQNA 2RPIA 5L1IA 3LDSA 4CFDA 4RW9B 5J2PA 3L2VA 1SKWA 3QNNA 3I5BA 4DFJA 4OPKA 3F73A 2V9WA 4C8OA 2O4IA 2R8JA 3HPOA 4ELTA 4FJ5A 4M3XA 4HVJA 2KZMA 3NH2A 3AO2A 1RAJA 4O44B 5K14B 2HNDA 2WK4A 4KO0B 4JS4A 4AHUA 1RDDA 4CF8A 4KBIA 1D9DA 3LP2A 3HP9A 4CFBA 1C0MA 3DOKA 4DQIA 3AV9A 3V9XA 3SNNA 2BR0A 2VG5B 1U48A 4LQ3A 5KFXA 3BGRA 4O0JA 4ID5B 4OLBA 3QEVA 5F8IA 2OPQA 1JL2A 4KFBA 1TVRB 3PW0A 1RA6A 5I42A 1TKZA 4IBNA 4GVMA 4JS5A 4TYAA 3CIZA 2DY4A 2ILZA 1NJWA 3SQ4A 4B3OA 3KLEA 4CEZA 4NLQA 4DEZA 1S9EB 3OYKA 4B9TA 1DTQB 4FW1A 3FRZA 2BANB 2Q3SA 3O4QA 4JV0A 2VG6B 2G8FA 4NLXA 3SPYA 1RTIB 3H40A 3T5JA 1CZ9A 3DLGB 3K5MA 3WNEA 3DMJB 1KLMB 5KFPA 3L3UA 4NLYA 1RBUA 3QLHB 4TXSA 4ECZA 5C24B 1ZBHA 2BE2B 3KJVB 4OKJA 3M8PA 1S0OA 4Y34A 4I7FB 3HM9A 3AA4A 2C22A 1JLAB 4IG3B 1JIHA 2UUWA 3OLBA 1ZETA 2ATQA 3NF9A 4KHYA 1VSFA 4IDKA 4RU9A 5D3GB 1EP4A 4CECA 3AVNA 4ZPDA 5C42B 5L1KA 2WTFA 2D5RA 3OYAA 2BRKA 2YNGA 4KB7A 1HNIA 2UVWA 1L5UA 2YHBA 2VA2A 2YKMA 3H2LA 3SI8A 3KLVA 2OPPA 3GV5B 3HHKA 2KTQA 3VA0A 2HWIA 4H8KA 4E7KA 2V4RA 1QSSA 3MXIA 4NRUA 2DPJA 1C1BB 2FBYA 3EYZA 3BSAA 1N56A 5J2QA 5HRNA 4RNHA 1TK8A 3QO9A 2XI2A 4PY5A 1DLOB 4R8UB 3OYNA 3NMAA 4RW6A 4U7CA 3AA2A 5J1EB 1RBRA 1RT5A 3ITHB 2XY5A 2ZD1A 5KT6A 3V9UA 1JLGA 2OPSA 1VRUB 3I0SA 3M8QB 3N6NA 5KG3A 5KFEA 4NLRA 3UPFA 3DRPB 4F50A 3CM5A 4EZ6A 5KGXA 2AGPA 1QE1B 1J53A 4AHVA 4K8XA 3L2QA 1IKYA 4AH9A 2IMWP 2R8IA 5KFRA 2R2TA 2ALZA 1C0TA 3MR5A 2HVIA 1IKXB 1SH3A 1TQLA 4BDYA 1U49A 1S1UA 4H4OA 3MECA 3TANA 3KLGA 5CYMA 3ALYA 4WYWA 1CZBA 3WNHA 5KTQA 5SWMA 1RDAA 1LW0A 3IRXA 1J9AA 2YNHB 1WAJA 5DG9A 1U45A 4FZXC 2B6AA 5KT2A 5HBMA 4CGHA 4CIGA 3OYGA 3E51A 4Q44A 1JXBA 4DSEA 4MFBA 4MH8A 4FJJA 3NFAA 4FK4A 4PUOA 2BQUA 4CF2A 1C0UA 2GBZA 3PW7A 3FSIA 5KFCA 2QE5A 1HYSA 2W9CA 2IAJA 3PO5A 1HARA 3DRSB 1S4FA 1T94A 4ED0A 1Q9XA 3C95A 3QZ8A 4ICLA 1LWEB 1J5OB 3DOLB 1BQMB 3LZIA 1S9GA 4RNMA 4M3WA 4TY8B 3SUNA 2HNYB 4M95A 3ZSOA 3NH0A 1QUVA 3V1OA 4CEEA 4NCGB 4JRPA 4URQU 5HLFA 3NGDA 4ZPAA 4FJHA 2HWHA 1S0NA 3G86A 1BIZA 3U3GA 4M3UA 3DYAA 4EBEA 4ECXA 1NK6A 1KHVA 4KKOB 4DL6A 4IRKA 2ETJA 1HNVB 3QYYA 3I5AA 1NOZA 4YQWA 1B92A 2FBTA 3RAQA 4O55A 4Z4FA 3FQKA 5T14A 2IS3A 4ZTFA 5J2MB 3DI6A 2RF2A 1NK5A 1XC9A 2KZZA 4ED6A 3MR2A 4LSNB 3G6YA 4OKEA 4IR1A 2FVSA 3IG1A 4ZHRA 4HUFA 5JUMA 2R8GA 1XR7A 3FQLA 1L3UA 2B5JA 1VRTB 3L2UA 4YR0A 3QGIA 2LSNA 2F8TA 3CJ5A 1LW2B 1REVA 5CYQB 3TABA 1R0AB 1KVAA 1WLJA 1TV6B 4BE1A 4J2AA 3MXMA 2Z1JA 2R8HA 4DSLA 2HVHA 1ZBIA 3ISNC 1RBSA 5L9XA 4UQGA 2IBKA 5KRSA 4E1NA 2E9RX 5L1LA 4O4GB 3TAEA 1JL1A 3QETA 3CJ3A 3MEDB 1I3AA 4PWDA 4RNNA 4WXOA 1KSPA 3T5HA 4N47A 4ECQA 2WB4A 3LZJA 4CJFA 4Q8FA 4QWEA 1WSEA 4CHPA 2HHXA 4CIEA 3QGGA 5KFJA 4MQ3A 1HQUA 5EUHA 4DTOA 4C8NA 4URSA 4F3OA 3V9WA 1RTDB 4DLEA 3NBPB 5J2NA 3HSTB 3VQQA 3AVHA 4QWDA 1W0HA 1SV5B 3MEEA 3KK3B 1NOYA 1JX4A 3KD5E 1NKBA 3UDLA 4M45A 2RDJA 3HL8A 4IFVA 2W9AA 1NK0A 2C28A 3H4DA 3CVKA 4AHSA 4FM1A 3HKWA 3GIMA 1L3TA 3KHHA 1NJYA 3KK2B 4ZP7A 1XHZA 5DG8A 3KHGA 3LP1A 1HQEB 1RBTA 4TN2A 4CJRA 4CCHA 5DG7A 2W7OA 4ECTA 3AO3A 5FDLB 4KPYA 1ZBLA 4PQUA 2HHSA 4ELVA 1BISA 1TKTB 3HVWA 3KMSA 4Y2AA 4IR9A 4FW2A 3OYBA 4W5QA 1C1CA 5KFZA 5C25A 3H5SA 2WOMB 4I9QA 1JLBB 2XCAA 4LD0A 4B9MA 2E6MA 3VQDA 3WNFA 2W7PA 2AWZA 2AGOA 4N56A 3KKRA 4E7LA 1RT6B 4CF9A 3FDSA 4CJ4A 3SFGA 3E01A 1YVFA 4FJKA 2I5JB 3V6JA 5KFUA 1S5JA 5KT4A 4N5SA 3WNGA 4MK8A 2XI3A 2JEJA 2WONB 2FBXA 3M9NB 5I3UA 2JEIA 1WN7A 3C6TB 3QGHA 4KI4A 4LSLB 4JV1A 3PO4A 1ZTWA 2ATLA 2YNIB 4WYLA 4H4MA 1KHWA 4K4YA 4KB1A 4OGEA 3ZT2A 2O4GA 1RT3A 3MTKA 1KRPA 4QCLA 2VG7A 2FLPA 4J9QA 3S3NA 3VQCA 4KHSA 4K4SA 1X9MA 5DQHA 3TAMB 1Z4UA 1D8YA 1JXLA 4CHOA 3K5OA 2W9BA 3NF8A 5K14A 1I6JA 4Y3CA 2FLNA 4KO0A 2YNFB 3GILA 4CEAA 2DFHA 2V4QA 1ZYQA 1WSFA 2F8SA 2D41A 2IC3A 2Y1JA 1QAJA 4WFZA 4CEQA 4CEOA 2JC0A 2VG5A 4FLTA 1SKSA 3KLFB 3HPGA 4E7JA 4R5PB 3V1RA 1RT7B 3D0PA 1RTHB 3V6HA
chains in the Genus database with same CATH superfamily
3EZUA 1MW7A 2MZQA 2JLEA 3BN4A 2ZHOA 1D0EA 4KHQA 3WC2A 4F26A 4BE0A 2NXUA 4F7VA 1SL0A 3ATUA 4AE5A 4TU9A 2QYCA 2L41A 3H4BA 4X4RA 3NG8A 1P1LA 2R7OA 2E7VA 3LOUA 4CO4A 2GIRA 1JLQB 1Q81O 4MKBA 4AQYJ 3PZPA 3FFKB 2AEMA 1DBDA 3LPEA 1AUSL 4PYDA 5HMWA 2QFIA 5HQLA 2GV1A 3IAS9 3HLUA 3V5RA 1KLMA 3DMJA 2YJEA 4JKBA 5T7LB 1X3NA 3QRPA 1RXOB 4LSZB 2Z30B 4I7FA 4NLTA 1OPZA 5KI6A 4U67Q 1RTJB 2B8QA 1VQMN 2BJ8A 3OUYB 1HHSA 1YTAA 3LPTA 5AQTA 3EGWB 2HFSA 1CLQA 2KG0A 4Z94A 3LP0B 4Z4EA 3HOSA 1J54A 3TQ1A 2FJBB 2VPYB 2OEKA 1X4DA 1IR0A 4BROA 1FWKA 4KV8B 4IH7A 3IMXA 4H0XB 4X65F 2I1RA 5ETVA 4FYDA 2CPFA 2GQ2A 1ITPA 1IKWA 3OS2A 2P9KB 3OTCA 3OYHA 3J7ZO 4ZVOB 2J6SA 3AVFA 1IWGA 5F8NA 4GV6A 1RT2B 3HFVA 4DFKA 4CZEA 2JZ5A 5J1EA 2W2OP 3PX4A 2HIQA 3O9RA 3VCDA 4X66F 2P5OA 4DR4K 4CNYA 4ZJQA 5C15A 3ZZOA 5BN8A 4G1QB 2Y8YA 4I9LA 5GMDA 4K25A 1F9EB 4KHUA 3TR5A 3K5PA 4X84A 2ZH9A 1RWXB 2B9YA 4FJ7A 3HCXA 4CZIA 2HW3A 2HRTA 1QE1A 2C1EB 4PCQA 3K7RA 1TUYA 4O5FA 4O0IA 4OZNA 1WSJA 5LOQA 4CO3A 3V4IA 1FJGK 3BKFA 3K17A 2KG1A 2XY7A 1RJJA 3QFWA 1JLFA 1YAGA 4FKYA 5EU7A 2UZAA 3VQSA 4WU2A 3PUFA 1TUGB 1TR0A 4USVA 4HHJA 4YMEA 3A3PB 2OPQB 4BG8A 1ZM3A 2P9SA 3TOQA 4DR1K 5GAEP 2QL7B 2YNHA 2A6OA 1UAXA 3W8PA 4JK8A 1T3NA 2JH3A 3JSBA 4FNIA 1RKJA 1QQNA 8RUCA 4JB8B 4EUVA 3OR2A 2IIHA 4YHHK 4OMFG 4OZLA 1R0BG 1T7PA 4NLVA 4DR7J 4CJKA 1ILYA 3TWHA 3JTPA 2DITA 5LJVA 5AQYA 1YJRA 5DZ7A 1JKHB 3IS9B 4LR9A 2IM1A 3DC2A 2FVQA 2AX1A 1WKKA 3ZZTA 4OYAA 3SJHA 4C8KA 2O8FB 5DRKA 4IEIA 4ED2A 3ENWA 1A5WA 3LWMA 4DSIA 5DM7Q 3U7JA 1RHJB 2FC9A 1QQOA 1WWHA 3UKRA 5F8JA 3CPWR 5BYQA 4DR4J 5K8PA 1LWCA 4PL7A 1CS4B 1IO2A 4MKVA 2GGPB 1U47A 3VVUA 1ZM2A 2LKZA 1WUUA 2WCXA 1CXQA 4WK1A 1QQMA 1WOOA 2N7CA 1QAXA 4PPZA 2EFQA 2F4VK 3ZTSA 4ZP6A 3MMBB 5J2MA 2VPXB 4KY3A 5SUHA 1FJGJ 1B7FA 2HVEA 1VJWA 4ECYA 4CH1A 2QEXS 3O9TA 3VGKA 4AD6A 3W66A 2H9ZA 2QLFB 1KAXA 3K2YA 3BO2A 4FXWA 2D0BA 3GLJA 1CQMA 1NWKA 3AARA 1EWRA 1TV6A 1E4FT 2B4OA 2C2EA 3NVKA 1XMQJ 3ZT0A 3EGZA 3PFOA 1IBCB 4JI0J 4JI2K 2ZD1B 4WPAA 3PY8A 4W5RA 1Z1ZA 3D7SB 1M1HA 3BR9A 1KONA 1DFDA 1SC3B 4OKKA 3WUHA 3OFGA 1HNWF 1Q7YO 3GG1A 3UDEA 1SC4B 2HKEA 1HWIA 3OYIA 3JQMA 4L6V3 1WC4A 3N01A 1B9FA 3TAGA 1BHLA 3C14A 4G9ZA 2HGMA 3PRDA 3HSCA 3P5BP 2V9KA 4TY9A 4P7TA 3CCUS 4DPOA 2E7WA 4RW4B 1RAEB 1UA0A 1V4SA 1S1UB 3S3MA 4Q8EA 3DU6A 2XO7A 3N4WA 1IBMK 2V7ZA 1TU0B 1RAGB 2I7PA 4F4ZA 2QEXN 2EW9A 3CFRA 3UNGC 1RYSA 1S10A 1L3VA 2GMLA 1OIAA 2GHPA 3D1QA 5CZ1A 3FEZA 4FJNA 3P8BB 3IXQA 1N5YB 1EETA 4DV0K 2IGIA 3R27A 4G3IA 4KAZA 1VQ9S 2H1YA 3FZLA 4OFZA 4TU8A 2H5IB 4USWA 1SBRA 3CJQA 2D1KA 3VQ9A 2HMPA 1SVDA 1EKSA 5EY4A 2WOMA 3MOZA 4OLAA 3R5DA 4AM6A 4JN4A 1M0SA 4RZRA 2MKKA 1VQ4S 4NO7A 3CJ1A 5D4PA 1VK0A 4DV4K 3K5LA 4QU7A 1RT6A 2DGOA 3PYGA 2PSZA 4X62F 3P4UB 4DQQA 4MMOA 4DR3J 1GK8A 4FF4A 2WBMA 3CCUN 2UUAK 1I1GA 2WONA 4YDUC 1HBOA 4A46A 3VALA 4CJUA 3HP6A 3RUBL 2PDAA 3QINA 2YQ1A 3B82A 3L6QA 1UCNA 1EKEA 7FDRA 4P72A 3HI0A 4FL9A 1WSIA 2J0SD 1MWMA 3A1YG 1IM4A 1S9FA 3SBTA 2M4MA 2GHVC 1BXNA 2C2ZB 1S1VB 5D6GA 1IBMJ 2RKIB 5HI7A 5H1SV 4U8YA 3ISND 4CGDA 1VQ9N 2BM0A 4EYHB 3MCOA 3P45B 2CPJA 1SUQA 3D5MA 2FB0A 4AILC 4JHDA 2YHAA 2AP6A 1VLOA 5IC4B 4PKHA 4J9PA 3OA9A 4JOUA 2E66A 4FK2A 4DV0J 4DPWA 1VQ4N 3M2UA 1HBNB 1H2UX 2Z0GA 4I0WA 3WXIA 2IA6A 2NZ4A 5LSOA 2ZKUA 1X5TA 1HMVB 1S6PB 5A8WB 4KTWA 4H03B 4BGBA 1M5OC 1FDNA 5A2QO 5DQIA 2GFFA 3MWTA 1RTZA 4K4XA 4WZQA 1KR4A 2XC9A 8ATCB 4BRGA 1H2VZ 3RR8A 3MM9A 4QPXA 2MQLA 4L73A 2XLJA 4PXEA 1IJFB 3VQ8A 3SZ2A 4I68A 3OY9A 3HOTA 2AHOB 2WHOA 2OP5A 1M1GA 3KYLA 3ZSZA 4TU7A 4TNOA 3ICLA 2GC8A 4ZN1A 1SAZA 5AQVA 1S57A 2Q43A 4P75A 1JLCB 2LVWA 1NEEA 3C16B 4F4XA 3CDEA 2YX1A 2X6SA 3I0RA 4B08A 4ISGA 3TW0A 4MKYA 4K50A 2AEFA 1EZZB 2AT1B 3NWRA 4G65A 1YJTA 2AEJA 4DR2J 3MM7A 2EWHA 3ETOA 4LH5A 2NPIA 2KHCA 5AQPA 4M5MA 2R42A 2AP1A 1KC8T 1XIQA 4JI3F 2OTJS 2JJ4D 4GKKJ 4TLQA 3AGKA 1JXEA 3CJRA 4PL8A 1G3OA 1VIXA 1YRUA 3HT3A 2IM2A 1QS4A 2QWMA 3DXSX 2PYJA 3MEGA 3TU5A 2CWKA 1SKUB 2V8HA 5KG4A 3F0NA 1BWVA 4YS2A 3V9ZA 3KJVA 3BR8A 1N88A 3FZBA 1RA7A 2KXNB 3ASMA 1WEYA 3GIIA 3FEYB 3OL8A 4CO1A 2CADA 1T8EA 4A8SA 4ZJLA 2EBEA 3D2EA 1K1SA 2XHBA 1CPZA 1FESA 3MDQA 4YY3K 2MSTA 1KVCA 3KWMA 3AOBA 1H0HB 5EX0A 2IC3B 1D5AA 3GWCA 2VBWA 2AJQA 3GJQB 3AXMA 3SFUA 2ADCA 1VHXA 4Z0UA 4ISFA 3JSRA 4OI2A 3TZYA 3IGVA 4X4QA 1NPRA 2OTJN 2W6LA 2A5XA 2JNJA 5HROA 3TAPA 4ZVTB 1OSDA 2BJ7A 4MIAA 5HVHA 2C3YA 5AZIA 2HRUA 3PYFA 3J7YU 2VZ9A 4WBFA 5AQGA 1XNQK 2H54B 3RR7A 2GCFA 3GFXA 4WE1B 2W40A 1M5KC 4JI1K 4LF4K 4K4TA 3MM6B 1VRUA 3T1HK 1QQCA 3EGNA 1NPPA 3M8ZA 3G25A 3SPZA 1PGZA 3ZTRA 5I3QA 1V6HA 3MAAA 1HR0K 4IKFA 1X4GA 3LP2B 2HHTA 4HTJA 3QIOA 1G6BA 1S99A 2YKNA 4OPAA 1M5SA 2JLFA 3T9ZA 4FO0A 2ZH3A 2KRBA 4OI1A 2OSRA 5DO2A 2AZ1A 4USJC 4CBUA 2UVUA 3O3HA 5AFUH 4IOAQ 2DGWA 3AB4B 2ZM6F 2HLTA 1Y11A 2ZWOA 4NYNA 4LF7J 3R7BB 3QRQA 4YY3J 3SAHA 3FBFA 5AQWA 5AXLA 1OKJA 2JVRA 4JLHA 3T3FA 4O3QA 2KKZA 4CJEA 2VFRA 3S9HA 4EK2A 3KMQA 3SCIE 4H0OA 2ZJPQ 2PYLA 3AA5X 3ZNUA 2K3KA 5JLFA 1RBLA 1LKZA 3BGLA 3KXDA 2BJEA 1XJWB 3FLCO 2RNEA 4AFFA 1QAYA 3VZIA 3NGKA 4DTNA 5HVGA 2CPXA 1WF1A 1FTRA 1Q7YT 1PBAA 4Y2CA 5BRFA 4FJ9A 4LF4J 2NYIA 1D9AA 2A3JA 2DEJA 4DS4A 1DARA 4Z7CA 3J7AN 4DU3A 2M7SA 3Q8PB 5LM7E 4K0KK 4JK9A 3E1YA 1T03B 3MDFA 4O8UA 4DSFA 3VHQA 1HR0J 1X9SA 4LF5J 4ATNA 4R0EA 2JOQA 5CR4A 3MGJA 5B0FA 3ONQA 3BQ0A 1IVZA 1VRTA 1FK9B 1P8GA 4P9SA 4YFUA 1W9HA 4ZPCA 2ZHBA 3U9ZA 1RT1A 3GQCA 5KGWA 4RX6A 3LM2A 5HK4A 3A2FA 3G6VA 2RVJA 1RT5B 5LMUK 5ETPA 3TVKA 1VOMA 1P27B 1Q9YA 2RD5C 4OZ5A 3WIVA 3O2IA 5B8HA 3KK1A 3DLBA 1HYVA 1XERA 5KT5A 4CVNE 4MIBA 3HFKA 3P83D 4B3SF 1QDUB 5CZXA 4LF9K 4QIFA 4DHVA 1BC6A 4M63A 9ATCB 3VGMA 5CQGA 4QW8A 2X6NA 3N0VA 2PGCA 2YJFA 2ZH5A 2QGFB 5GINA 3DFEA 1OQ3A 2ROEA 2KFZA 3P4IA 4YOVA 5CYMB 1W26A 2GMJA 4ZVHA 4FLUA 5A2QY 2HEKA 4M42A 2X3DA 3MR3A 3TZXA 2VQEK 2A0FB 3RWUA 4Q5VA 4K0KJ 4H4KC 4DS5A 2MPUA 4HLBA 4YN3B 1OMSA 2P9LA 3LDPA 5B0BA 3MHYA 2KFNA 4MLEA 3D6FB 2WUSA 3AVCA 5GAGP 2G8KA 2VC1A 2R7UA 4M3RA 1NRKA 1KOOA 2Q6BA 4FCYA 1TELA 2XQCA 3M2VA 3J80O 1X0FA 4DV7J 3K59A 3CO9A 4UQTA 3HI9A 5CXTA 4M94A 5D0EA 1X4AA 1S6QB 4QYRA 1S9GB 5KFDA 1SS6A 1JLBA 4MIWA 2AJ1A 4UUXA 3TA0A 5HLFB 1X31C 2DTUA 3HHLC 3PR4A 5BRDA 4UT4A 1N6QB 2W2NP 1C2PA 2FC0A 3F9KA 2M88A 4FOIA 3K0JA 1NBEB 3W5YA 3C15B 4OJ3A 1N34K 4FLYA 4LF9J 1BWEA 2KL8A 4LSLA 3KLHB 4FF1A 1UWAA 2OZSA 1M5PC 1U02A 5ETNA 2CPEA 1R8PA 1UETA 4CO0A 3O3GA 1FEEA 1YVUA 1K0TA 2QWPA 3KG4A 4J9VA 2BDPA 1A6LA 3QIDA 3RB6A 2C2DA 5KFWA 4DV3K 3DXMB 2RUGA 3BEGB 4IOCQ 2IJFA 3ZX0A 2WFBA 4DG1B 2QL5B 2DPIA 3C6AA 4RUBA 4JUZA 3QMLA 4RWXA 2G2ZA 1IBKK 3MR7A 3R8YA 5GIOA 2F9WA 3QNOA 4I6MB 4E7IA 1P6TA 1UVNA 2A2CA 1XEZA 3R9LA 4HTIA 4IXCA 2CJQA 5KFLA 4ZVEA 1LFWA 1QM9A 4CF0A 2KQ2A 2E1YA 4Q45A 1RISA 3HHLD 4C2MA 3M1FA 1TUVA 3JXUA 3SI6A 4AHRA 3M2RB 4A47A 2FGOA 2HAFA 1KQSM 2KHOA 3AVAA 4OYIA 2NS1B 2QKKA 3NAEA 2MLYA 3QEIA 3TSQA 1N32K 1PO6A 2PA3A 1SQEA 4Y0FA 2YX4A 5MLCQ 1JLQA 4ETXA 3AQOA 3RBXA 1T02A 5C5JA 1FKOA 4BC7A 1YRXA 1N34J 1P1TA 5KRTA 1VS3A 4I2PB 3OFEA 2VWBA 5T7LA 4URGA 1Y5NB 2YWHA 2KW4A 1GTHA 3G6ES 4UY85 3QAUA 1RTJA 1EB0A 4FPIA 4DV3J 4DOZA 3H25A 3OUYA 1NHKL 2F9JA 3PJXA 3KLIA 4FLWA 2O8CA 1GLDG 3CGIA 4A8WA 4RG8A 1CVJA 2FJVA 4JI7F 3L2RA 4JI4J 1R43A 2IVMA 1TGOA 4WFAQ 1RI7A 3DWLA 4QU6A 2ZBCA 3OHBA 4X2BA 4U8VA 3RBDA 4EIAA 4ED5A 1S6UA 3E01B 3VGUA 2R2UA 2JWKA 1YWXA 4F8RA 3AD9C 4A48A 4WTOB 3LAMA 1Y0HA 4M5JA 3M30A 3X3UA 3NGYA 4W90B 2XYPB 1DHMA 4G6VB 2J76E 3K8WA 2A3ZA 3RRGA 1TL5A 4GVEA 4RW9B 5J2PA 3VAKA 1Z6RA 3F73A 2V9WA 2CH6A 5HMXA 2O4IA 4PG6A 3K8VA 5JVHQ 4JI6K 3JXOA 3G6EN 1YG0A 3ZXWA 1NSKL 1AYEA 1W2BM 1GTEA 2JL9A 4CFBA 2M8DB 1C0MA 4A8XA 4DQIA 3V9XA 5M1KA 4Y6IA 3CXCR 2DNHA 1CQNA 1NB7A 2R7RA 3I4HX 2DCUB 3Q2SC 3EVWA 2XYGB 4CO5A 2WAQD 5HL7Q 2OPQA 2Y1RI 4YORA 2K2PA 4JS5A 2DY4A 4C0BA 2CVEA 2N3LA 3NS6A 3CSKA 2KN4A 1F6TA 2CFXA 1S9EB 4AQYF 4B9TA 1DTQB 4FW1A 1HIYA 3S41A 5IT0A 2DVIA 1FRXA 5AQIA 2VG6B 2CJYB 2GZOA 2G8FA 3LGHA 3SPYA 2JWLA 2DRAA 1QTNB 2LQ8A 2HSTA 3KWGA 2HBLA 1RTIB 2JSXA 3TA1A 2PT0A 1CZ9A 3K5MA 4X4VA 2O8FA 2NRTA 3L3UA 1LNQA 3QLHB 4KC5A 1I94K 2LDYA 1FTCA 2E1AA 2HFZA 2V2ZA 2ATQA 4CZHA 3FUYA 4TVAB 3NCQA 2DNGA 3NF9A 2ZBIA 1VSFA 1CS4A 1C4CA 5D3GB 4NA2A 5LXRA 4CECA 4C3LA 4DX7A 5ETOA 3AVNA 4ZPDA 4K8RA 1Q8LA 2VA2A 3MMBA 3H2LA 3BDEA 1VQPS 3GV5B 2KTQA 2ROPA 2FQQB 2IVYA 3I56S 4H8KA 2LXIA 4E7KA 1QSSA 4QIWD 3NOCA 4QIVA 4NRUA 4P52A 1UAWA 1J5EJ 3OVBA 1MLAA 5J2QA 1KDNA 1V5VA 3WXKA 3JB9k 1TK8A 1C0GA 2WVCA 5GAHI 3M5RA 3NMAA 1MN7A 1QZ5A 3G4SS 2CNNB 1CLFA 2B9WA 2VFVA 2ZD1A 1VBXA 4DCJB 4O8KA 3J80Y 2OPSA 4OHZA 3GIRA 3I0SA 3M8QB 5KG3A 4F50A 3NS5A 1GH8A 1SQGA 3ZTQA 1NSPA 1HL6A 1J53A 4F0MA 3KDNA 2DNMA 2NRVA 3SMSA 3FBBA 5A8RB 2R8IA 4OHYA 2Y3YA 3D6TB 4CLSA 4IFEA 2ALZA 1IKXB 4YB6A 4DCPB 1SH3A 1TQLA 5LL6d 1X8DA 4BDYA 1NH7A 1U49A 2J7WA 3D2WA 1S1UA 3IBWA 3W2WB 4I1TA 3KLGA 3ALYA 4MO4A 1IXKA 2ZJQQ 1CZBA 3WNHA 1VQPN 5SWMA 1RDAA 1NGJA 4PPDA 1UVMA 1WAJA 3NGTA 5K8MA 2ZC3A 3I56N 4FZXC 5E7OB 1WC0A 2BJ3A 4CGHA 3ILIA 2P9NB 4UOFA 4KIAA 4LUBA 1U8WA 4LIWA 4FK4A 2YTCA 3DOMB 2UXBK 5AQUA 1FKAF 5KFCA 4ZDNA 1FWPA 1HYSA 3PO5A 1FDBA 2ATCB 5A6PA 3ZZZA 2W01A 3UFCX 3GJSB 4ED0A 4AXIA 3G4SN 1MSWD 1PSDA 4DN0A 1J5OB 2MY8A 2WVBA 3G8SA 4DV5K 1BQMB 3LZIA 4B02A 4M3WA 2MEWA 3CJ7A 4TY8B 3SUNA 4RTFD 1QUVA 3V1OA 5HATA 4DR4F 1JJHA 4OJ1A 1S0NA 1HA1A 2OHDA 1RAOA 1EAYC 1K47A 2E5LK 3G86A 2FD2A 3VETA 4EBEA 1NK6A 1GFWB 1U2CA 1U26A 5CHCB 4KKOB 2ZH8A 3NGRA 4DL6A 4IRKA 2A18A 5AE3A 5HQ8A 3SCKE 4YQWA 1B92A 2FBTA 4IO8A 3BYPA 3LUYA 2D1CA 4CLWA 3A4TA 1FJGF 5T14A 2IVOA 3U1NA 4R0JA 4ILRA 1XC9A 2KZZA 1HI8A 3MR2A 4LSNB 3DJCA 3CCLS 1HJOA 3BH7B 2HBQB 4HEA9 2V69A 1XC3A 1JK9B 4YR0A 2LSNA 1LW2B 3RBZA 2UXCK 4AF1A 4DR1F 2MJNA 1K9MT 3VVTA 1HHQA 4NYPA 3MXMA 4CD3A 3HSJA 3EVMA 4CZFA 4YHHF 2DEIA 3HZ6A 3FC9A 2V2KA 1S7IA 4WU3A 4UQGA 3SAFA 4DV6K 4UZBA 4O4GB 2EG1A 1JL1A 3G8TA 1ZM4A 3HZGA 4FPBA 3MEDB 1HBNA 2V34A 4ZK7M 1XK8A 2YPZA 1IWAA 4ECQA 2WB4A 3LZJA 2X1AA 2HSEB 3CCRS 4YEAA 2W2QP 2HHXA 5A8WA 4DV5J 2LQ9A 5KPZA 2J0QD 4URSA 4PXCA 4DLEA 2ZOFA 4ZLLA 2XEXA 4EFAC 2XMJA 2DHSA 1JX4A 2FF3B 1HNXJ 1W2IA 2F40A 1MNEA 4M45A 1R8CA 1QD1A 2V8GA 1AUDA 2DT9A 5L39A 1NH8A 1Q5YA 2C28A 2E5LJ 4FM1A 2GELA 2NXEA 1DY3A 3CCLN 1NG9A 2HBJA 1XHZA 4E8UA 3ILJA 3I87A 3L9ZA 1RSCA 2F4VF 2HOEA 4KHPJ 1YUWA 1RBTA 2J8AA 3RJMB 1WDDA 3AO3A 3L7PA 4ER8A 4KPYA 4BHQA 4X64K 2WSEC 2XMUA 2LFVA 2AW0A 4X4SA 3BPSP 2CVIA 3OYBA 4W5QA 3NWGA 4QR0A 5KFZA 3ZX3A 4R79A 4I9QA 2E6MA 3VQDA 1T9TA 5D0HA 3VF6A 2KXHA 2E2QA 3PFEA 3KKRA 1BMQB 3DLLQ 1KQFB 4E7LA 2XS7A 3SDEA 4JI2F 1AW0A 3CCRN 4CJ4A 5IWAK 2VYPA 2A2DA 5D4OA 3WNGA 5I3UA 3CTRA 3C6TB 4IOAL 1VAZA 2W41A 5E26A 1ZTWA 4MJKA 2YNIB 2IVFB 5F0UA 3CNQP 2PEBA 3S01A 2WW8A 3ZT2A 1KRPA 1SI9A 1CULB 1YK9A 2CQIA 4AUKA 5H9FK 3S3NA 2KM8C 4KHSA 3T6JA 2DNYA 1Z4UA 1D8YA 2ZJPL 2B56A 2M9KA 1I6JA 1IR1A 3K9KA 3GILA 4CEAA 5D0GA 5K9FA 2IC3A 2GMHA 4N8NA 1QAJA 4WFZA 2Y1JA 4CEQA 3N4PA 4X4TA 3KLFB 2JHEA 4DV0F 1FJCA 4DR5J 3V1RA 2PMWA 4P7VA 2JLGA 1RTHB 3V6HA 5C2FA 1U09A 1N48A 2ZQBA 3QB0A 1Q8IA 5E3PA 4IOBA 4X64J 2EK6A 4KGXB 2HGNA 1TVRA 4O3NA 3CD6S 3VEWA 3UE2A 2D4WA 1RWKB 3QESA 2ZFHA 3A12A 2NPFA 5F3TA 2V0NA 4DV4F 3CW2C 1SH0A 3HVAA 1JJCB 4JV2A 3ZSXA 2QTDA 2NRHA 3Q8SB 2GVZB 3O9SA 5I3PA 5F41A 4DB3A 3MPWA 5IWAJ 4C23A 4NMXA 4WE1A 1BL3A 1PC5A 2UUAF 3MM6A 2GNKA 1CJUA 2XMTA 3PIPQ 2RB7A 3TO8A 1XNRJ 4IG0B 4FZZA 3IN5A 2X3GA 2HHPA 3M6GA 4BQLA 2BE2A 4IOXA 5J1PA 5BR9A 4LC9B 4Q43A 2CNKB 1KQKA 5A0YA 2X78A 2CKWA 3O9UA 3D0IE 1RNHA 4A62A 4NPOA 1VCTA 3H3NO 1U1LA 2OI2A 4CEDA 3CDWA 3GE1A 1GLFO 3DLHA 4RW8B 5C42A 2P6SA 5DGAA 4KR0B 1PBUA 3M8WA 4H0PA 3PIOL 3WDOA 3PG9A 5KOWA 3D3CJ 1JJ2M 4FWKA 2JEGA 3CD6N 3C46A 2VPWB 3FFIB 1M90O 3SCXA 1ZBSA 3M9OB 1NMDA 2FLLA 3CJBA 1U6ZA 2DR7A 2XCPA 2J9DA 1C1BA 2IYIA 2QTWA 4JKGA 4B3RK 3ULEA 1RWWB 1AXQA 1ESVA 4ID1A 5DDRC 4ZLJA 2ZH7A 1LXJA 1DLOA 4IYQA 4R8UA 2VDHA 2VV5A 4NXMJ 2BA9A 7FD1A 3OBWA 3VEXA 3LW5C 3ITHA 3JTOA 4QW9A 4CF1A 1X4FA 3LPYA 3MXJA 4A8QA 1X5PA 4CZCA 3VEOA 1LQ9A 3G10A 2V51B 1YTYA 1DURA 2KVQE 3UN2A 4RO0A 4CI6A 3DRPA 4HDHA 2W7AA 1YDLA 2IOCA 3NOGA 2E1MC 1TAQA 2G8HA 3DOKB 4LRBA 1T03A 1FDAA 2MB0B 1ZAVA 4DL7A 2FSKA 3PYDA 4PKDB 2H3EB 4WIQA 4ZMMA 3BGRB 1IR2A 4PG8A 3NAHA 2SXLA 5EGYA 3RAXA 3QNWB 4J8FA 1YT3A 2KO1A 2E44A 1FK9A 3O9QA 3AY0A 5EX3A 2EEYA 2ERRA 4FJXA 3D2FA 3CIMA 1VI7A 1VLYA 2BOAA 1EARA 1VQYA 5L38A 3MMCB 2C3PA 5IT9Y 2DXFA 3PR5B 4BRPA 3CE8A 3DOLA 2ZHAA 3CCJS 2R7YA 1S4EA 4GMKA 2UUTA 1BCMA 2CQ0A 4NCGA 1E3MA 2NUHA 3NKYA 3DLKB 3H20A 2GIQA 2CRLA 3JSYA 2V8PA 1VSDA 4ES1A 4PWUA 5KFGA 3B8AX 4FS2A 4U9RA 3PX6A 1E6VB 1VHIA 4LF1A 3O6QA 4CGFA 2YNGB 3MM8A 4KI6A 4J91A 2ZE2B 5K5MA 4OPJA 3I55S 1KN6A 4M63C 1I3OB 4DCHA 3S6EA 1LWXA 2E88A 2GIFA 2NZTA 4FWMA 1H38A 1R0AA 2BW7A 2GVDB 5ETSA 1UFLA 3TQEA 3ZZYA 1S6QA 4BC4A 2AU0A 3A5NC 1L3KA 4K2XA 3UR3C 1HKGA 2NCKL 1S97A 4AHTA 2Z1HA 3N4QA 1XNQF 4L3NA 3J81U 3CCJN 1A0OB 3BZCA 2DIVA 2CG4A 4JI1F 4LF4F 1N6QA 3Q8RB 5C7PA 3T1HF 4EAHD 3HBTA 3C15A 4DTRA 4HHHA 3DRRB 3DKDA 2CQGA 1HR0F 3KLHA 4C98A 1NGEA 4CWBA 1R8BA 3NBPA 5GIPA 4DL2A 2QJ3A 2NRZA 3NDKA 3JS6A 2ZZTA 3IBFB 3IM9A 1WI8A 4CHYA 4LR7A 2QA4S 3P6YC 1GOBA 1HBMB 4ENOA 3IRXB 2V50A 4DPTA 3I55N 4DG1A 4CGJA 3RW7A 2PFFB 2FF6A 2OTLS 5EWGA 3PHTA 5EN1A 3M6VA 2CH5A 4RNOA 3UQSA 2OD6A 5KT3A 5FDLA 3VPZA 3I8DA 2IRXA 4C8LA 2W9CB 2IAJB 2J9CA 4WKYA 4I6MA 2LDIA 4E98A 4ZTJA 3OV7A 1C0FA 3B6OA 4LRAA 3O8MA 1VDHA 3RRHA 2BUNA 3MPUB 4C1NK 2Z57B 5JVHL 2KT5A 3SLCA 2OFGX 4S0MA 1VFJA 4WTYA 1MN9A 1GT8A 5GADI 1NHUA 3SMZA 1HHTP 3M2RA 3R5AA 3GTYX 1ZBTA 3THYA 1BE4A 3I82A 4XPEA 1H2TZ 2GQQA 4BREA 1HW9A 2ALYB 3MPVA 1F21A 4JKEA 3NNHA 1XMBA 3UWTA 4DZDA 5AJ3J 1Y9OA 3AAQA 1KFSA 2DY1A 1OWXA 4RW7B 4LY7A 4K0KF 1SH2A 4I4BA 2QA4N 1C4AA 5KFNA 1U7LA 1T9XA 2RF2B 2P9PA 2DR5A 4KTQA 3QIPB 4I2PA 5AQSA 4ZLPA 2QZ8A 2XNQA 2HQIA 4O3PA 1FKPB 2QA4G 2OTLN 5M1QA 4LF6F 2BJ9A 3BGOP 3TAMA 4CI0B 2MLZA 4LF8J 4EBDA 1XMOK 4RUCA 4N41A 2QLXA 4OX6A 1NSAA 1F3VA 3D6RA 2YNFA 1UL3A 2YHXA 2C2OB 1KS2A 3ZT1A 2J0WA 3AODA 3NF7A 5LMUF 1Q5VA 2MKSA 3FE1A 1RT7A 3L7OA 1WOPA 3LWLA 3S8SA 3MFIA 1WKJA 5MLCV 5H1SQ 2HBKA 3UKUA 1LWFB 3RVCA 3BN7A 1DJ0A 3ZO7A 2R7WA 4QWBA 1U4BA 4AHCA 1RWVB 1S72S 4K4ZA 1MU2A 2VKRA 1FNXH 2EX3A 3G82A 4IEEA 5AQNA 2MGZB 2OKQA 4N76A 4YOXA 3OTOK 3M8RA 1FXDA 2RMLA 4BC3A 4ZA1A 3OS0A 1HX1A 1QVFM 4RW9A 2HF3A 4K5RA 2DXEA 1YZ6A 1RAFB 5KFVA 5M1OA 3WT0A 4ED7A 4XEIA 4KH1B 4AM7A 1SJFA 1IM6A 2VQEF 3V6DB 5DMRA 5B08A 7AT1B 3H5XA 4J9NA 2MQPA 3MURP 1SJRA 4I6WA 1G2EA 5B0GA 3EE8A 1H3DA 4CT8A 1T44A 4Z4CA 2NSBA 5AQFA 1D3WA 1XMOJ 5C25B 5HVFA 5CZVA 4KSEB 4I6AA 3CJAA 2V67A 2VQFJ 4LT6A 4UY8O 4DXLA 2AYMA 5KQDA 5U47A 2DGQA 3VN5A 3W63A 5F2RA 3OHRA 2OPRB 4BR5A 3MCSA 1FFGB 4OZ3A 4NLCA 1RP5A 4IQXA 1S72N 5DZ6A 1KVJA 3NGZA 1DTQA 1HPZA 3MUMP 4WWSA 3B4MA 4GVBB 3LDOA 3J7YP 2IVNA 1N34F 2ZJQL 4H0TB 3HXMA 3TA2A 4KAIA 2M70A 5KOXA 1DT9A 1FW6A 4M5DB 4DV3F 4KHRA 2C3MA 3T1YK 2WVFA 2IM0A 3QWUA 2HHUA 4RBVA 3U02A 2H4WB 2DIUA 3O4NA 1CJKB 5B0EA 4KHWA 4CO2A 4EZ9A 3AHPA 2GEMA 4FWLA 1F2GA 1IBKF 1X0PA 4YR2A 3LDLA 4DQPA 2MMYA 3TSUA 1HJRA 1R8AA 3EKUA 2VBZA 2KB2A 1HD1A 2P1JA 3MMVA 2HVDA 1TFWA 4O3RA 3THWA 1YF5L 3O8WA 1V3SA 2EKNA 4FNHA 4FWQA 3QDKA 3GZ7A 1K8AO 1HNZK 1I5OB 2DHAA 5CY4A 2EFOA 2JFDA 2DHHA 4FJIA 4K4VA 3P5JA 3BF1A 2BMBA 1MWKA 5ETMA 1N32F 3ID8A 4HH1A 1OH6A 4LFCK 2D3UA 2LEPA 3VAJA 4NCBA 1RCHA 1ITGA 2QKBA 1C6VA 4B8CA 4DTXA 2VGNA 1XQSC 4IH5A 4PWWA 1NDCA 1NHVA 3QSIA 1W7WA 1FRMA 5A8RA 2P5GA 1ZXOA 1VC6A 4TSXA 2RQMA 3M9MB 5F9NA 4DL5A 1IKXA 1JB0C 4YDDB 2R3VA 4P2MA 2NXJA 2YCHA 3T1YJ 3W2WA 4KHMA 4C97A 2XMMA 3MWBA 1BOTO 2HB5A 4L72B 3QGPA 3IGNA 3W2VB 3VQ4A 5I42B 1TKZB 2XZWA 2EC0A 3D0HE 1UWBB 2VFTA 2GWKA 2Y1LB 3EDRB 4DU1A 4OYPA 1T11A 3N9UC 1M5VC 3IMQJ 2FGCA 4PG5A 1NGHA 4DUTA 5BPLA 4ZPWR 4JI8K 2ACYA 3DOMA 1N0UA 3SCJE 5FPNA 3GG0A 3SQGA 4YOYA 5FPEA 4CJ5A 1KOHA 1S1XB 4WP8A 2Q3PA 4I67A 5L9NA 1VQ8S 4BLGA 4CJTA 1APSA 1YXQA 1ZZFA 3Q8VA 3WXMB 1KFDA 4TY8A 1O13A 2VKZG 2MY7A 4DX6A 2BE7D 1RHKB 1HNZJ 2CPHA 2J4RA 4ES2A 1LEOA 3V4MA 3QFUA 2UUBK 4B3MK 1NCLA 1TL3A 1S1WB 4KQZA 2CQCA 2D9OA 3OS1A 4FK0A 1FWLA 1H74A 4JI6F 1N33J 1EP4B 2QYGA 1NDPA 1WUAA 4BC9A 1RB0A 1FERA 4DV1K 2XY8A 3VTIA 3SIPB 3THPA 3LF0A 2IY5B 5F8HA 3QT7A 1QZ6A 4CHZA 1TYQA 3RB0A 4Y28C 1FEHA 4MK9A 1VISA 1RWUA 1P8ZA 2EVZA 4YR3A 2G1HA 2OPPB 4LSNA 3UNYA 4IFYB 4EO6A 4NA3A 3AVGA 4DQ8A 2HHVA 1D9FA 2ZKTA 4WFXA 3UI3A 1ROFA 3MM5B 4ZP9A 1HKAA 1T9WA 2FJXA 4A4JA 1MMNA 3A8EA 2IJNA 3QO9B 1RAAB 4M3TA 4FPAA 5F8GA 4OV1A 5CD4H 4JAXA 2BTFA 2YKQA 1VQ8N 2ZJRL 5HRSA 2MKHA 1GXTA 3ILOA 3IC1A 3NMRA 3WQTA 2O5DA 3NVMA 4CLLA 1VSHA 3I96A 4PKIA 4JI8J 4FWOA 4BRIA 1G1XA 3DLEA 3MF5A 4E89A 1V4TA 5HRPA 3GU0A 3RZAA 2HS4A 4HCCA 4FBTA 4FM0A 4KGMA 5KFBA 3VQ7A 2F63A 1JQGA 1A9NB 4PYAA 3KDOA 1C0TB 1OH8A 4Q0BB 1I94F 3H08A 3NAIA 2D69A 4V19X 1IQZA 1B0TA 4WFNQ 4C9DA 1LOUA 1PIEA 2UUBJ 4B3MJ 1HKCA 3SSSA 5ETKA 4TKTA 1MWQA 3M32A 1LW0B 2FY8A 4Y0WA 5DDOC 1MA9B 2B6AB 4NLUA 1QJHA 4RL1A 4DV1J 2CQDA 3L8BA 4MFBB 2OLWA 1B0VA 3RB3A 3I33A 2HHQA 4PG4A 5ADZA 5CE3A 1IBLK 3SV4A 5SZTA 1TMJA 3KK7A 1EX4A 2PFUA 4BR9A 4BRKA 4NXNK 4JI5K 4IO1A 1IKVA 3KHRA 1GOCA 3NF6A 2OD4A 4CYUB 2N82B 3H7HB 1ZS6A 3OFHA 4NLDA 2FC8A 2QWQA 4DTUA 2HURA 4BRLA 4OI6A 4B1VA 1JCFA 4BRQA 2VBYA 3P96A 5AZJB 3QERA 3D67A 2OH2A 4AL7A 3JYTA 3R2DJ 3DYAB 3OPKA 2D3O1 4NCAA 5IXUA 3BS9A 2ZWPA 5B0CA 2E5HA 3KJNB 3C6TA 2MQNA 3VAFA 2LCWA 1TK0A 4ES3A 1VK8A 2W4PA 4M41A 5C2DA 3QAEA 4HUEA 3ET6A 2IJRA 3VEZA 2NYHA 4HWIA 1N8RO 3U1MA 1WELA 3C6HA 4Y1DA 4FYWB 2K1RB 3DDIA 5C10A 5A8KB 4RWTA 3M8YA 2HAIA 1Y4ZB 1Y00A 1WBDA 1REVB 4FLVA 2F7TA 4NB4A 3BUZB 5A76A 4OO1J 1RFQA 1ASWA 1DTTB 1W2BR 3SYZA 1O1WA 3CJSA 1UVJA 3O3LA 3A3OB 1ZBFA 5HP1B 2Q97A 2N4DA 4JYAF 4K43A 5KFFA 2UXBF 4A2AA 3KHLA 4EU0A 1FRKA 3M1VB 1T3VA 2F8MA 1RTHA 4FSVA 4J9RA 4MK7A 3P38A 2C2NA 1TFYA 4CK2A 4OX9K 4K42A 5GAEI 4WFYA 4YOUA 2ZBPA 3VV2B 4UW2A 4CJQA 4DV5F 4CH0S 1QVGM 4Y65A 2BJDA 2HZCA 2ZUGA 1Y10A 5IV4A 2KDOA 1VK3A 3CF5L 4HVZA 3UD3P 4CIOA 5E84A 2J9DE 5IM0B 4PA1A 2E5LF 1QTMA 2XWXA 1K73O 2BX6A 2DHXA 3E2EA 2FHJD 2NXCA 1X9WA 3MD1A 2N3OA 4LBIA 1XQIA 1ZAXA 3CCZA 4JRQA 4DWIA 4CZGA 3PRBA 1VSLA 3CMAS 4H0VB 1BQXA 3GCXP 2P9EA 5JVGL 3AO1A 4DZ6A 3BP8A 4HACB 4PQUB 2CXEA 2VHGA 2PBDA 1K8KB 3LP3A 2ZGZA 1M1KT 3E9LA 2VJUA 4BRAA 3L2WA 4EEYA 2UXCF 1HUXA 1Y97A 3QEXA 4B9VA 2OANA 2B4VA 4QR2A 4RW8A 1QSLA 4X4NA 3ZZRA 3PW5A 3T5LA 2YBVA 4CK1A 3CJKB 4QQBA 3DM2A 3D54A 1F3FA 2EK1A 4DV6F 2Q1NA 3FFIA 4FLXA 2V8DA 1TKXA 5KG6A 4O5BA 2I7NA 2EFGA 4EFHA 2F4FA 5C2CA 4OX9J 2UUCK 3MMAB 3VMFB 4H4MB 5CA5A 3B4DA 5L1IA 3HSDA 1FRIA 3OQ2A 1CZAN 1SKWA 3WEEB 3I5BA 2O67A 1EHWA 4OPKA 1Q0NA 1IN0A 4X66J 1IG8A 4GVLA 4FJ5A 3CMAN 2RHKA 1IJEB 4AT1B 4O44B 5K14B 4PAAA 2HNDA 2WK4A 4JS4A 3ZETB 4AHUA 1Q86O 3DHWC 1D9DA 1NU0A 1TL7A 3DOKA 2AA4A 3J7Z5 1U48A 4LQ3A 2NZCA 2E1PA 1V3ZA 4ZN3A 2QMUB 3BGRA 4X64F 3V2UC 3WXLA 3QBXA 4A57A 3R7NB 4ALZA 3QEVA 4Y2IA 4IQMA 3HMJG 2CZ9A 5CH7B 5BRHA 4DR7K 3M6WA 4GY2B 4Y2MA 1NJWA 5GVQA 3OTDA 2A40A 3KLEA 3R6GB 4CEZA 3ZX2A 1X4HA 3PRVA 2CGKA 1RWNB 4U7UD 3QT8A 4RPFA 3MMCA 4DMZA 3FRZA 2BANB 2EFPA 4NLXA 3ATVA 1KAZA 3Q83A 2XSFA 3H40A 3T5JA 4QIGA 3DMJB 1KLMB 2UUCJ 4F4AA 2LXFA 1ZBHA 1GNKA 4Y34A 3PLAA 4I7FB 3LGNA 2RILA 3G2XA 5BYRA 1JLAB 1UP1A 3GONA 4IG3B 1JIHA 1F9HA 2HFVA 1ZETA 2GX9A 3B54A 4USIA 3UE5A 4KHYA 4IDKA 2E7XA 1FRLA 2FJEB 4BRFA 5HO4A 3POTB 2WTFA 1E6VA 3OYAA 1KD1T 2YNGA 1Y3JA 2UVWA 3MN9A 2YKMA 3QT5A 3O1LA 3HHKA 2E8AA 4RBTA 3CJ8A 3OW2R 4U95A 1HLUA 2HFNA 3EYZA 2FBYA 3CD0A 1XMQK 2HZVA 4MDBA 5HRNA 1WC6A 2ASPA 2GVDA 4JI0K 4PY5A 4ILMA 1CEZA 2CGLA 5J1EB 3ETMA 2B7CB 2AJ0A 2QW9A 1OVQA 1HBUA 4MDAA 3N6NA 5KFEA 4NLRA 4H5TA 1PAEX 3CM5A 1R8HA 2H48B 2LEAA 2VC0A 1QE1B 1UTAA 1NJIO 4K8XA 3L2QA 1IKYA 2OELA 4AH9A 2IMWP 2Q66A 4B9QA 2HK3A 1OY8A 3ZZUA 3ZEUB 3MR5A 2FJDB 3AJ1A 4IWVA 2M3DA 3SAGA 2YX6A 4N77A 3CD7A 3EMTA 2CQ4A 4H4OA 3MTJA 2Z58B 2DR9A 1SJ4P 1GLCG 5KTQA 4KPCA 3H8YA 2CA9A 4ZCKA 2UXDK 3IRXA 4PRFA 3SQOP 1J9AA 4OHXA 2YNHB 5DG9A 1U45A 2CG8A 5KT2A 4CIGA 3OYGA 4CLFA 4DSEA 1R3NA 3OR2B 4MH8A 1VR6A 3GR1A 4XH5A 4FJJA 3NFAA 1RQ0A 1RDUA 3FSIA 4K41A 3VAIA 2W9CA 2IAJA 1U1QA 4UF4A 1N52B 3VF0B 1S4FA 1T94A 3TVYA 3OBIA 1XN9A 3DHXA 4ICLA 4B3RF 1LWEB 3GPAA 4UOHA 2MKCA 2Y0BB 3O1WA 2YWEA 4M95A 2V6AA 3NH0A 4CEEA 4JRPA 4URQU 3TPQA 3NGDA 2FUG9 4DR3K 4FJHA 3UKRB 4B1YB 5M1FA 4XK8C 1BIZA 2Q31A 4DUZF 4ZVRB 1SIWB 2VBXA 1RU2A 2XULA 1KHVA 4H5NA 3JAMU 1HNVB 1DEJA 2B7BB 3A8KA 5CABA 3RAQA 3KG1A 4FDFA 4Z4FA 1KBRA 3DNCA 4HR2A 3FVYA 1FRJA 5J2MB 3DI6A 2RF2A 4PEOA 4ED6A 3IP0A 3QT6A 2P6TA 3NMUA 2FVSA 3BF3A 3SK3A 4ZHRA 1XR7A 2VFUA 2B5JA 3L2UA 1RHRB 3QGIA 2F8TA 5E3AA 3CJ5A 1NGGA 1EWQA 5CYQB 4HTLA 4Q2MA 3E9OA 5BPNA 4FP9A 1TV6B 3SEOA 4L3KA 2UXDJ 2Z1JA 1FD8A 1ZBIA 3ISNC 1HWJA 2IHR1 4B1ZA 2DD8S 3CDBA 3EVOA 5L1LA 2XMVA 1I3AA 4BGAA 4K5SA 4Q8FA 4QWEA 2LU1A 2EFNA 2W2MP 4NWBA 3C14B 3N79A 5EUHA 4C8NA 5C12A 4EWTA 4OYOA 3HSTB 3VQQA 3AVHA 1T95A 1W0HA 1SV5B 3KK3B 4OX7A 1NOYA 4HH0A 3MAHA 4B1WB 1SZ2A 4L74A 2Z2LA 1L3TA 1R59O 3KHHA 1FHTA 3KHGA 3LP1A 3ZNJ1 4TN2A 4CJRA 4NL5A 4OJGA 2R7VA 2W7OA 4ECTA 2UU9K 1DAXA 2OMLA 1BLUA 3TTFA 2G13A 3DCAA 3MI7X 4ELVA 1BISA 2YWFA 3KMSA 4Y2AA 1N0VC 3PSIA 4DR2K 3VWSA 5C25A 2WOMB 1H6KX 4B9MA 4LD0A 2G2OA 1RCOB 2W7PA 2Z4PA 3GFZA 1JJ2R 5AQZA 2RRNA 4GKKK 3GCWP 1RT6B 4DV2K 3FDSA 1RHMB 3Q2TC 1YVFA 3DDNA 2Y0SD 2DNLA 5KT4A 2KXFA 4JD2A 3J81j 4MK8A 2B51A 2XI3A 2WONB 1X3MA 1HBOB 2JEIA 3AD8C 1WN7A 3QGHA 3L3CA 1U1KA 2V2VA 3VAGA 4JV1A 3PO4A 5C2GA 4WYLA 4DI6A 4K4YA 3BY5A 2ZDOA 1IV0A 4OGEA 3L7UA 2O4GA 3MTKA 1Q81T 1Q78A 2YH0A 1D4XA 1MWZA 2PE8A 4KYZA 2FLPA 4A8YA 8AT1B 4J9QA 4GKJK 3VQCA 2Q6CA 1IUJA 4QS7A 5DQHA 1JXLA 3IUCA 4OYMA 4LMZA 3NF8A 4Y3CA 5LJ5Y 2E1CA 4KO0A 2XSJB 1YJWS 4YOWA 1CJKA 2DFHA 1KQGB 2DBBA 2XMWA 1WSFA 3BB5A 3VR1A 1U6BA 4R25A 1TUUA 4BVPA 4JHDB 4DUYK 3H1QA 1JXVA 2VG5A 3HPGA 4E7JA 1Y7PA 3D0PA 2UU9J 3M4XA 2CPZA 3R6LB 1GXLA 4JP8A 4K4UA 2J6TA 1ZPWX 2Z1IA 4IRDA 5KFYA 3F44A 1VMBA 2BV3A 5GMEA 1AROP 2XRIA 1EX8A 1OS5A 3Q8UA 2YHYA 1CXUA 5EWFA 2DK2A 1EXQA 2CPDA 4OX8A 3J7ZT 2RJZA 4CLTA 4DV2J 4F0HA 2HNZB 3H46O 3MM9B 4M8LA 3CC4S 5F8LA 3MUTP 2ADBA 1XTZA 1UJ6A 1UW9A 2Z56B 2W8KA 3CG7A 2RUSA 1U25A 2WRMA 3DLGA 1KXPA 5BR8K 2AD9A 4CM2A 2E6LA 3Q86A 5C24A 1YJWN 5ITHA 4GW6A 3W60A 2R9LA 3OYCA 4OVLA 3FRYA 4GKJJ 3VF4A 1GOAA 3I0RB 2FJWA 2F8EX 1XMOF 4LF7K 4A5AA 4RBUA 2QWOA 3LALA 2KM8B 2ZM6J 5F9LA 1UWBA 3A8JA 3A8YA 1R7IA 3VQPA 4BDPA 4K59A 5GAGI 3PKMA 4DUYJ 2RS2A 2OO4A 2NUBA 4BACA 1KVBA 3JSMB 4TQRA 4DTJA 2O3DA 1ASUA 2BM1A 2MZSA 2QWLA 5DGBA 1V3RA 1MG7A 3R1XA 4PR6A 1YBUA 4C8ZA 2EHGA 5M1NA 4F4WA 3U9DA 4BE2A 1S1XA 1VC0A 2F8HA 2MKJA 2GUPA 4A8MP 3MEGB 2IRUA 2G4BA 3CC4N 2CJXB 3H0PA 4YB7A 1BQNB 4FJ8A 4GV3A 5KG2A 2C2KB 5KPTA 3LANA 1VQOS 3OTOF 2XM3A 2AGQA 3CJ4A 2BVZA 2P9UB 3O44A 1RDRA 1W97L 3RMDA 1RYRA 4WKRA 3GIJA 1S1WA 5DM6L 1ZTTA 2RDDA 3D2EB 1U0HA 2BEFA 2GA7A 4DX8H 1WEZA 2QA2A 5LMNK 1X4EA 4LF5K 5BR8J 1ASVA 3W8GA 4GC6A 3FZKA 1QSYA 3QJJA 1FJ7A 4IFYA 1RUSA 4C4WA 3KD1E 3FK4A 1S59A 4LFAK 4KFBB 1J27A 1R27B 2AYGA 3H5YA 4B9SA 2XGPA 3I32A 1NGBA 5HROB 1AZSA 2LU2A 1VJQA 1GLLO 5AZIB 1VIOA 3RG6A 3QICA 2PZSA 4D3HA 3IKMA 1LK7A 2R7QA 1WJ9A 4P10A 3TJ9A 4FWNA 3TYTA 2V7YA 1BA0A 3KTQA 1VQON 4W5OA 1B70B 1WOQA 4A5BA 4F2SA 1HI1A 2HNYA 3MAAB 1D8ZA 3BO4A 4UOCA 3C8YA 2R8KA 1XWLA 3SUPA 3M8PB 1Q53A 2YKNB 2PIIA 1AA1B 4DR6K 3RMAA 4Q0BA 3ENOA 3GV7B 3BJYA 2RT3A 3T1YF 3WQPA 1J6ZA 1NZ8A 2Q0RA 3CQ8A 5BXIA 2ZGYA 2OEJA 1F1BB 4NEZA 2L9NA 4A61A 2FLOA 3S7RA 3RW6A 3MR6A 1HNIB 5L8RC 2K06A 5LMNJ 4QOZB 1RADB 3R1HA 2J5AA 1H98A 1S3XA 4DV7K 5ETRA 1U1PA 2BH1A 2FIUA 4J2BA 3O1BA 3KOAA 3TR8A 4LFAJ 3U8XA 2YH1A 2X74A 4NYOA 1XHXA 4RW6B 1GMUA 4CIFA 1F2HA 3N28A 4X4UA 3CJ2A 3PV8A 1FRHA 4WZMA 1ACMB 3SSRA 5KG0A 4FF3A 2E2NA 3EPGA 5KFIA 1Z2LA 4M1KA 5JLHA 2ILYA 1WSRA 4LFCF 3ENBA 3BKUA 5AZJA 4OPHA 1U6FA 2MHEA 3GYGA 4J9LA 5KFOA 3HRGA 3NL0A 4RLEA 4V1Ak 2ZZNA 2QT7A 3BQ2A 3HFZB 2BE9B 5HJXA 1B9DA 3RGIA 1BU6O 4CZMA 1RTDA 3EICA 3L3VA 4NI2B 3PEJA 2ITGA 3CHWA 3DRYA 3W0LA 4Z2XA 2MLXA 5IFMA 4DR6J 2DTJA 5EWEA 2EI5A 4QAGA 2X7IA 2E4LA 2FVRA 2HBMA 1NNDA 2P9CA 4ZPVR 4RUAA 3RTVA 3MN7A 3J81O 1DTTA 3FMWA 4LR8A 1RT1B 3CJ0A 4PUOB 3H98A 2K3IA 5HP1A 3U6FA 2QXLA 3O3FA 1MROA 4JI8F 3OVSA 2ZOGA 2VFSA 2PAVA 2QK9A 4MTPA 2MZRA 3KK1B 1TKTA 2XLIA 3EPIA 2YY3A 3NGUA 1WACA 3PX0A 2GS8A 2IRYA 1OYDA 2MKIA 2N7YA 2DHGA 2E2PA 4C7QA 3LH2S 4EP5A 5CHIA 1HFEL 3THTA 2UUBF 4B3MF 3IFRA 4U67L 1IJJA 2O8EA 5IM0A 2XNRA 1R6YA 3M8SA 1BWFO 3K0SA 3LA0A 3CCSS 2FVPA 3C65A 2OZMA 4DV1F 3KKSA 3AVBA 3IWLA 3RSEA 1ZZNA 2CQBA 4B9UA 3C3LA 4BWMA 3DLJA 2XLKA 3C7NA 5AQHA 2KT3A 4EP4A 4ZVPB 3IG1B 4K7QA 3GIKA 4DU8A 4OLOA 4E1MA 2JC1A 1RGVA 3M2VB 3R97A 1N5VA 1FVSA 3O08A 4ECRA 3OHAA 4JI4K 3GJTB 2DGVA 1PG5B 1S0MA 2IM3A 4USMA 1NJXA 1DRZA 3ZSYA 3F2KA 5A6WA 3H2UB 1YJVA 3MUVP 2XGQA 5BJRA 4QPTA 3CJKA 1TK5A 2M2BA 4JI7J 1PJ5A 3LTOA 1GLAG 1UZHA 3SV3A 1K6YA 1NGAA 5LSLA 1QUPA 4WJBA 1FXLA 3AJDA 3N6MA 4YNQA 1GEHA 3CDUA 3OXGA 1TMMA 1CJTB 3IR6B 4O0NA 1FNMA 3H2VE 1F5CA 3UDVA 3MMAA 3C19A 2LA4A 1PAUB 5J2NB 3CCSN 1DQ8A 3D45A 2DB1A 4XDDA 2GQCA 3MEEB 4F67A 5AQXA 5E2QA 4RUHA 3AVMA 2RSQA 3CFPA 4IFVB 1YHQS 4DU4A 3BKTA 4CQ1A 1UFWA 3OSPA 2CJAA 5CCLA 3MAQA 2HZAA 2ROGA 2Z1GA 4O44A 2B43A 3G9CA 3GP9A 3UD4P 1SXLA 2CJBA 3QZ7A 1O0PA 1JCGA 2HQDA 2KYXA 3OVNA 1ZOTA 2M0GB 1VYAA 5GAHU 1IBLF 3I9V9 3BBBA 4GO7X 3G0ZA 1V9OA 4FZYA 1WNEA 2KRRA 3HKZD 3L09A 1C1CB 3CM6A 1ATSA 3UO0A 4NXNF 3LP0A 4JI5F 2D7SA 3FSYA 4GV9A 5B7WA 2E5JA 4ZCIA 3L95X 4M3ZA 5DM7L 4KV8A 2HWTA 5H9EK 4J2EA 1J2VA 2NRXA 3ZZ0A 1BCOA 4L3QA 4BY9C 1YLXA 4CFAA 4BRCA 3ENVA 4C8MA 3HM8A 2P9KA 2YWGA 2W6KA 1PYSB 3PW4A 3K58A 2BANA 1HWUA 4Z4HA 1NNEA 3RAMA 1FVQA 4IO9Q 2C2RA 4Y1CA 1YHQN 1RT2A 1K1QA 1FKOB 2LEBA 2AZ3A 1NGCA 4CJSA 5J1NA 2KJVA 5JXSA 3BSCA 2AV5A 3H90A 5M2PA 2VG7B 2RE1A 1ZA1B 4JKAA 1EKRA 1N54B 2AKWB 4C48A 1MDUB 4ITSA 4G1QA 1JLAA 4IG3A 4Z4GA 4PXBA 3NLCA 4OI0A 1ZA2B 2FY1A 2ZVIA 3VGLA 3PNIA 3UCUP 3KLIB 3TNVA 4CLPA 2O8CB 3ZSVA 3F5TA 2ITMA 4XIUA 3POTA 4OHVA 2YKAA 3P3DA 1YITS 3TAQA 2HHHF 2QLJB 3Q24A 5M2RA 3W64A 2UV8G 2DCLA 1SL2A 2P9IB 3G96A 3AO5A 1J5EK 4F3QA 3TX8A 3B78A 4WQ5A 2V5HG 4U7UK 1KC8O 4OX9F 1KTQA 4BS2A 2B4UA 3HVTB 1AT1B 3M30B 2YV0X 1X4CA 2JRSA 4F3TA 2Z2YB 3SQ0A 3AO4A 1IQTA 1NSQA 2R7SA 1YJNS 5H9EJ 3T6BA 3R5CA 5J2PB 2LXUA 3KUEA 1W25A 1JKHA 3IS9A 2MQOA 2HFUA 3FZMA 4LH4A 4CHQA 1JNRB 3LQVA 3SQ1A 4DTMA 3THVA 1B7YB 3BREA 2MXYA 3CQYA 4J9SA 3OYDA 4J9OA 4O3OA 1WB9A 3ZEUA 1P9QC 1LAVA 1VBZA 3UR0A 2A1SA 1KTVA 3H3OB 1YITN 1WHVA 1HD0A 1U0SA 4ECSA 2GGPA 1RABB 1VQLS 1JLEB 3UW1A 2VDIA 3QQCD 1T6CA 2CWXA 3T5KA 4IKAA 4V19S 3W9IA 3R9PA 5AQMA 3AY9A 4EHUA 5D8HB 3GB0A 4ZS6A 2WBRA 1GX6A 2ZF5O 4GMJB 1YJNN 2DH8A 1FXXA 4NLSA 2RAQA 4OI3A 3PW2A 2PMZD 3Q22A 4CJ3A 2G8VA 2QN6B 2LQJA 2QLBB 4YOEA 3CQXA 3J81Y 1LWEA 2UUCF 5AXMA 4HTUA 1TKDA 2O66A 1GMVA 4W4MA 2G8IA 1RDWX 1K0VA 2D3ZA 2HMIB 3HYFA 1TP7A 4E3SA 3R8EA 1WSHA 3SUQA 4J5OA 3OR1B 2GUIA 1LCUA 3X1LB 1O6XA 3GBTA 2G8WA 5E3RA 3M05A 3TVZA 2XS2A 1HNVA 4NZ0A 2PO4A 2DPNA 1GMWD 1WORA 1VQLN 4B9LA 4IJAA 3PXGa 1ZBUA 2EKYA 1NK8A 1LOTB 1NK7A 2AYBA 4RW4A 3T19A 2BGGA 4O23A 2ASLA 3ZLJA 2UP1A 1UA1A 1V5IB 5ETQA 3ULDA 4DN9A 1REGX 1O51A 2Q79A 5J2QB 2Z2ZA 5CYQA 4E19A 4AXJA 4DR7F 4DR1J 4CBXA 4NZ6A 4F3MA 3N5FA 4G1PA 4DSJA 4WFBQ 1N5YA 3LDNA 1RT4B 3FJ2A 2K7JA 1RAIB 4W5TA 4YHHJ 3MX5A 5M2UA 5DS7A 3BF4A 3EGVA 3BSOA 2XO6A 2OPSB 1NDKA 3PDNA 2OA8A 3I0SB 3D68A 1QVGR 2XBPA 1SC6A 2CNOB 3Q7BA 2ZBQA 1LAWA 3AD7C 2OIHA 1HNXK 4CJPA 3TI0A 2A42A 1F60B 3HHDA 1VQNS 1PYTA 1SIZA 2A1RA 1SV5A 3KK3A 1PILA 2XY6A 5K8NA 2VOOA 1E6YB 3KLGB 4KHPK 1VBKA 5FPMA 4I2QB 2KYZA 4NA1A 4KGKA 4P2XA 2EWSA 2R2SA 4DU7A 2GX8A 5G4DA 5KFAA 4RR5A 2F4VJ 1HYSB 1TTHB 4NYFA 5E0OA 3ULHA 2QX0A 1S1VA 4A8FA 3BBFA 2F9TA 4D3GA 1KAYA 2RKIA 2GWJA 1HYZA 1XMQF 2PY5A 2ZZMA 2DNRA 2Q1LA 4IRCA 4JI0F 3V81B 3AFGA 2M8HA 5HAOA 4ZVFA 4ED4A 1WEXA 2VA3A 2E1RA 4JI2J 1WC5A 2AJFE 2ZH1A 4CJLA 1VQNN 1HMVA 1S6PA