1IKVA

K103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
557
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 147
structure length 556
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikvA05
3NBPA 2DY4A 2QK9A 1S49A 1HYZA 2C2DA 4B9UA 4OJRA 2HB5A 2IM2A 4NCGA 4DFPA 3IRXA 1IKVB 3V6KA 1LW0B 2R2RA 3UR0A 4HUGA 3VQSA 4PUOA 2W8KA 4W5RA 4ELTA 3L2UA 4ECTA 2P5OA 5DG9A 1T05A 2BR0A 4FLZA 1LWCB 4FS2A 4ZP7A 2PY5A 2GIRA 3CFRA 3VQAA 5F8NA 3CJ0A 4CGJA 3ZCMA 3H5YA 2RDIA 4TQSA 4PY5A 4BE1A 1NK5A 3RMCA 4AHVA 4CFAA 3CJ2A 1WSGA 3K59A 1TGOA 3K5OA 4J9PA 2JEGA 3PV8A 1RTHA 4N76A 1KSPA 3KLGA 3NGDA 2JEIA 2OPPA 1S1XB 4FLTA 4DQSA 3BQ2A 1QSYA 3H98A 5F8JA 5C24B 3SPZA 3OYBA 4CHQA 3QNOA 3RR7A 1GOAA 2VG7A 1JKHA 4NLGA 4FJJA 4JV2A 3DRRA 3OSNA 1RCHA 4M3YA 4QW8A 4Q43A 1C1CB 2UUTA 3OYFA 1QUVA 4Z4IA 5CY4A 3N6NA 2V0NA 4KHUA 3MXMA 4Z4EA 3LPUA 5J2PB 4BWJA 3KLHA 2WONA 3CJ3A 5K14B 4I2QB 4NYFA 4DFKA 3QIPB 3KHLA 5J2QA 5KG5A 1X9SA 2IC3B 1C0TA 5E41A 1JLBA 2V9WA 3KLIA 1BI4A 4DSKA 4F4YA 4NLDA 4IRCA 1XWLA 4DSFA 4IBNA 4KV8B 3VA3A 4FJNA 4BDZA 3LPTA 3OLAA 3OYHA 5KG1A 5KFDA 4K4UA 5C25A 3SPYA 3KK1A 2JLEA 3AVIA 3ICLA 4HHTA 4Y2AA 3AVNA 4IDKA 4FK0A 1LWCA 3I0SA 2OPRB 1Z25A 1TK0A 3ITHB 3V1OA 4CGIA 4BWMA 2WRMA 2B6AA 2RDJA 4QAGA 1B92A 1UWBA 4E1NA 5HRNA 4B9SA 3QEVA 1FKPB 2B43A 2PYLA 4OLAA 3TAPA 1K1QA 2D5RA 5KFNA 3KLEA 4CERA 4NCAA 1NOZA 4IFVA 5KFQA 1S1VB 2EC0A 4ED2A 2BQUA 3SQ4A 2R2UA 3OYNA 5HBMB 4BE0A 5KFVA 3NL0A 2NUBA 4JV0A 3O4QA 1TK8A 2E9TA 2BE2A 3G10A 4M42A 1RT2B 4YFUA 4OKEA 2EHGA 1A5WA 3B6PA 3OYLA 1NJYA 3IG1B 3QEIA 3ASMA 4DTNA 3WNHA 2E9ZA 1S9EA 3QINA 2E9RX 3AVCA 4F2RA 4NRUA 1KLMB 4G3IA 4O3SA 3QEXA 5HLFB 3P83D 4FZZA 2XGPA 5FRMA 1RT1B 1S10A 2KZZA 4M95A 4B3OB 2R8IA 2UVWA 1LV5A 4WZMA 3QGGA 3Q8SB 3H4BA 4Y3CA 4DTMA 2HAIA 4DU4A 3K5LA 2WOMB 3H5XA 4R8UA 4H8KA 3KHHA 3VQ7A 1RTDB 4FLUA 4B8AB 1D9FA 1NJXA 2VG6B 3HHKA 4CFDA 1RTJA 3G6XA 1SL1A 4CK1A 1S6QA 4NLOA 4I2PB 3BQ0A 4DU1A 4Q44A 1NKCA 1D9DA 2ZD1B 3C6TA 4IR1A 4NZ0A 5KGWA 1W9HA 3DDKA 3RBDA 4PQUA 4NRTA 2IAJA 1L3VA 3KK3A 1SH0A 4ECWA 3IAYA 3K5MA 4C8OA 4ED6A 2IBKA 4J9MA 1QAJA 2YKMB 1DTQB 1C6VA 4YR3A 4CHPA 4K4WA 1IKXA 5KFAA 3OL8A 4HCCA 2ZE2A 4FYDA 1KHVA 3KMSA 3DI6A 4B9TA 4EO8A 2G8VA 1RBTA 5KFYA 4IG3B 3AO3A 2XC9A 4IG0B 1WSFA 3EY1A 3LZJA 3FSIA 4FK4A 5J1EB 2IA6A 2ASJA 2VA2A 1RT5A 1NHVA 5DG8A 3MEGA 4GC7A 2X6NA 1BGXT 4NLRA 3CJ5A 4DTJA 3DLEA 2OZSA 4CJEA 4URSA 3NF7A 1Y97A 3VQCA 3ULDA 4Y34A 3QEPA 4CJUA 1X1PA 3KTQA 1XHZA 4W5TA 1TKTA 1DLOA 2UVUA 1N6QA 4WZQA 4K4VA 3SUQA 4Z4GA 4NLSA 3PJWA 4DS4A 3DM2A 1BCOA 3NF8A 3K5NA 2HMIB 5JS2A 4K4XA 1T3NA 5J2NA 1RA7A 2HW3A 1S0NA 4ELUA 4H4OB 1CXUA 1SL2A 1C2PA 3NFAA 2FLLA 1HYSA 4N47A 2AX0A 2YNIA 4O3OA 2JEFA 3QO9A 4O3QA 1VSLA 1LW2B 4DTXA 1VSHA 4RNHA 2AQ4A 1TKZB 3VN5A 1KTQA 1SUQA 3V81A 2FBTA 3OHAA 2BRKA 3ZSRA 4L8RB 2KFNA 1SH2A 1BQMA 4B9NA 2QV6A 3AVGA 5CYMA 2W9CA 1L5UA 4IH7A 2PZSA 2C22A 5KFMA 3OL9A 3H4DA 4WE1B 3BSCA 1SV5B 2IGIA 4ED7A 3T5KA 4OPJA 1T8EA 5J1EA 4FM2A 3MEDB 5KG7A 1QHTA 3RB6A 3AVHA 4MK7A 4DMNA 2FJXA 3QERA 2YNGA 4CEQA 4RW8A 3V6DB 1REVB 3V9UA 3I8DA 3PW2A 3QGIA 1R0AA 2YNFA 4ZP6A 4DLEA 3DLBA 3BDPA 2JEJA 2JC1A 3DOKB 4C8LA 4Q8EA 3IGNA 3V9XA 1J53A 4QCLA 1RT7B 4F4XA 1S5JA 4CJPA 4O4RA 3KHRA 3CFOA 4F3OA 2DPJA 1RDCA 1D0EA 3BSNA 3CYMA 3PX0A 3F73A 3SNNA 1IG9A 4KI6A 2WK4A 4ID5A 4CF0A 2A1SA 1UA1A 3CFPA 3OYCA 2FVPA 4AILC 4Y2CA 1Z4UA 1Q9YA 1IM4A 4W5NA 4HKQA 4O3PA 4NYNA 4ICLB 1T03B 1HPZA 3NBPB 4N41A 2R7YA 3C6UA 2BGGA 2KZMA 2ASDA 2BANA 4CEEA 3U3YA 4TLRA 4WXOA 3VQ8A 1HNVA 3GILA 4NCGB 4RU9A 3IRXB 4F4ZA 3TABA 2RN2A 1TP7A 1S9GA 3PX6A 4PUOB 4KB7A 2QE5A 4J2DA 3MFHA 4ECXA 1VSMA 2OA8A 2HNZA 2VWJA 3LP0A 1T05B 5SWMA 1TQLA 1S0MA 4KHQA 4FJHA 4YR0A 3AO5A 4ZPCA 4DL3A 2LSNA 2DFHA 1NK4A 3QLHA 3V6DA 3O3GA 1NK9A 4OKJA 2V4QA 1RAJA 1D1UA 4AHRA 5KFUA 2HNDA 3ZT2A 2AJQA 1KVBA 4EBCA 5KG4A 1OS5A 1T94A 2AGOA 1RTHB 3G6VA 3HPOA 2D41A 3KLGB 3OL6A 2HHWA 2OPPB 3NAHA 2XY5A 3OYGA 3O3FA 5KFIA 3NF6A 2BRLA 2VG7B 1JKHB 4NLWA 1HQEA 1RBUA 4IFYA 4M3TA 3DRRB 3MECA 5L1LA 3KLFA 1FXXA 5KFSA 3CO9A 4R5PA 3TAEA 3DMJA 5KFPA 3O4NA 3PX4A 3NAIA 4KHWA 1S1TA 1S0OA 1WNSA 3KLHB 3MEEA 2WONB 3MR2A 1XR5A 4KSEB 2IDOA 4K4YA 2AX1A 2UVVA 5J2QB 1RYSA 3V9ZA 4JRQA 2A1RA 3WNFA 4HVJA 4U7CA 1C0TB 1JLBB 3KLIB 2BQRA 1J9AA 1BI4B 2QKBA 1JIHA 4PWDA 4OL8A 4TQRA 2XWYA 4DFMA 2AGPA 4MH8A 4ZPDA 1NK0A 5L1IA 4F8RA 3TQ1A 2FBXA 5DG7A 5C25B 3RB3A 2BQ3A 3NH2A 1XR7A 3OYKA 2G8HA 1QE1A 1KFDA 3KK1B 3AA3A 1LWFA 4XIUA 2W7PA 2F8TA 5KT7A 4ED3A 4IDKB 1NJWA 4WYLA 3I0SB 1WLJA 4K4TA 1JLQA 3ZSYA 3H40A 3EZUA 1ZYQA 2B5JA 4RNNA 1JXLA 2ATQA 3CM5A 1GOCA 4DTPA 4CJFA 2B6AB 4I7FA 3SFUA 1UWBB 4OVLA 3NE6A 2HHSA 2V4RA 2FJWA 2E6LA 3T5HA 4E1MA 5DQGA 4QW9A 3BSOA 2Z1HA 4OGCA 3FFIA 5F8HA 4RW9A 4WFXA 4M45A 3TI0A 3KLEB 4YR2A 2IM0A 4FW2A 4IFVB 1CZ9A 4CEZA 3V1QA 1JLCA 3HVRA 5D3GA 5EUHA 3HP6A 4CHZA 1WAFA 4O4GA 1TKXA 2BE2B 3ALYA 1EETA 4QWEA 1BQNA 2JC0A 2FLPA 1S9EB 1S48A 2O4GA 1YTUA 4O3NA 5SZTA 1IKWB 4KREA 1G15A 4CHOA 4FJMA 3VQ4A 4QPXA 5KFCA 2XY8A 3AA2A 4DSIA 4H4MA 2E4LA 4YQWA 2FC0A 5C42A 4TSXA 5DK5A 1K6YA 3M8SA 4R8UB 2OH2A 1RDDA 4FZYA 4IOBA 4FLYA 2OZMA 4MQ3A 3G6YA 3DOLA 3UDLA 1UA0A 2RF2A 4Y1DA 4F2SA 3CWJA 4OLBA 3OYIA 1D8YA 4KO0A 4AHSA 1RTJB 3LP2A 3AV9A 1RBVA 4FZXC 3WNEA 3KK2A 4JS5A 1S6QB 1RTIA 1WNEA 4KHSA 3GV5B 4CK2A 1C0UA 4QWBA 1EP4A 3C6TB 3DRSA 1HQUA 1JL2A 4GMJB 4DU3A 4PQUB 3IN5A 3QEWA 2IAJB 5KRSA 3JYTB 3KK3B 4TY8A 1ZTWA 4MFBA 4NLQA 3AVJA 4LD0A 1TL1A 5KG6A 2AWZA 4JV1A 1C0MA 1S1WA 1QQCA 1ZBFA 2O4IA 2YV0X 4CFBA 4E7HA 3TAMA 4KHYA 3SUOA 1IKXB 3I5BA 2D0BA 3L3UA 3HVAA 3RB4A 3THVA 3OVNA 2ZE2B 1RNHA 2X78A 3DI6B 2D3UA 3KIOA 1KRPA 1BIZA 1S1UA 3M8PA 4IRDA 5CZ2A 1L3UA 2ATLA 3LP3A 5KI6A 3SV3A 2P1JA 4TY9A 5L9XA 2R8JA 5DQHA 4IH5A 4FJXA 2IMWP 3FRZA 2ITGA 4DL7A 1RT5B 3VQQA 3MEGB 4J9SA 1U4BA 4LQ3A 4J2BA 5F9LA 4KTZA 2RKIA 1A5XA 2ALZA 3LAMA 2XGQA 1IKWA 3RBEA 2FLNA 3DLEB 4CFCA 3L2RA 1LWEA 3RWUA 4FJLA 1SKWA 1C1BA 4FLWA 2W9BA 2B4JA 3KKSA 4CF8A 1RA6A 1RBSA 4F3TA 4FCYA 1TAQA 1ZBLA 1TKTB 3S3OA 2DFFA 5F8LA 3KOAA 4FK2A 1DLOB 4CECA 1HNIA 1N6QB 1TV6A 4RNMA 3DM2B 2G8WA 3DRPA 3L3VA 5HRRA 1BISA 4IQXA 5DGBA 4RW7A 1TL3A 4ELVA 5J2NB 3HPHA 4N5SA 1NK6A 4IKAA 4O44A 2FVQA 5KT6A 1JLGA 3CJ4A 1HYSB 3MAQA 3LP1A 4KKOA 3NCIA 5J2MA 2YNIB 3HVWA 4HYKA 3UPFA 3QO9B 4FBUA 2HWHA 1UOCA 4GW6A 3JYTA 3CVKA 5KFJA 4E89A 3OJUA 5I3UA 3CM6A 4C8NA 3CDWA 1CSJA 3D5MA 1SUQB 3V81B 4TXSA 1NNDA 4LSNA 4BDYA 1BQMB 4O0IA 4DSEA 2IJNA 5CYMB 5F8GA 2W9CB 4HCBA 2IM1A 3NMAA 4LSLA 4DQRA 4YNQA 4HUFA 1S4FA 4RNOA 4EZ9A 5DMRA 4Z4FA 3IS9A 5HROA 4NLXA 4DTUA 1J54A 3L2WA 2IM3A 4E7IA 3AVAA 4DL5A 3D0PA 3HVTA 2YNGB 3KMQA 4RW8B 2X6SA 1B9DA 2Q3SA 3RR8A 3E01A 1R0AB 4J9OA 2YNFB 2E6MA 4DG1A 4AHCA 4K4ZA 4CJLA 4Q45A 3DYAA 3GIKA 3S3NA 4CHNA 1VK0A 3G86A 1HJRA 4Q0BA 4AHTA 3PO4A 3KLVA 2QKKA 4J2AA 2CJQA 2QXFA 4DTRA 2I5JA 3TARA 4TN2A 4FLXA 4ID5B 3GIIA 2WCXA 2W7OA 1B9FA 5KT4A 2XRIA 2Z1GA 3OS1A 3SI6A 3EZ5A 4QOZB 3QGHA 4EP4A 5FRNA 2ZQBA 4O5BA 4F50A 2F96A 3P1GA 1HPZB 4Q5VA 1LAWA 4FJ8A 4ECVA 4K4SA 2ILYA 3SUNA 3C6UB 1GX5A 2F8SA 1U04A 2BANB 2RPIA 3H2LA 3AVLA 4ED1A 1HNVB 3VQ6A 2VWKA 3QZ8A 3OHBA 3MR5A 1S9GB 3TWHA 5JXSA 5KFLA 4NCBA 3ZT0A 1WAJA 5HRSA 4ZTJA 4KRFA 4F4KA 3P5JA 1ZTTA 2HNZB 4J9LA 4CF9A 3QIDA 3LAKA 3AVKA 3LP0B 1WSIA 4WFYA 2HWIA 1TVRA 4FBTA 1RT6A 4FJ9A 4TYAA 4MK8A 3QLHB 1J5OA 4FW1A 1JXBA 1VSJA 1DTTA 4M3UA 1NOYA 2HNDB 4M3ZA 3SJJA 2ETJA 4CEDA 2C2RA 1UAXA 1XI1A 2XO7A 5HP1A 3HK2A 4BACA 2Z1JA 3TAQA 3H08A 3SQ0A 2GC8A 2KW4A 1HQEB 4IFYB 4DSJA 1WSJA 3MECB 2CKWA 1VRTA 3O3HA 1FKOA 4KAIA 3KLFB 3V6HA 3HJFA 4R5PB 4DQPA 4M3RA 2VG5A 3DMJB 4EP5A 2W8LA 1QSSA 3SQ2A 3BJYA 3NGZA 3PW0A 1S1TB 4M41A 3NH0A 4KPYA 3MEEB 5L1JA 1JL1A 2OPSA 5KFRA 4JS4A 3GIJA 1TAUA 3IGVA 4ZP8A 5KFZA 2HNYA 4ZVFA 1ASWA 2GBZA 1RBRA 2XCAA 2R2SA 1I3AA 2OPQA 2BDPA 3CQ8A 4PWDB 2HHXA 5F9NA 5I42A 1JLFA 3HPGA 4JRPA 4EO6A 2YHAA 4CJQA 1QE1B 5EWFA 1LWFB 4MKAA 2YNHA 2HHUA 3PW7A 1VSEA 4Z0UA 3K57A 2W9AA 1JLQB 2B5JB 4EZ6A 3MR3A 3CDEA 1XR6A 3N6LA 4JUZA 3SV4A 4I7FB 2DPIA 3VQ5A 1RT4A 3QZ7A 5F8IA 4J9QA 2YKNA 5KTQA 5EWGA 1ITGA 4I9LA 2FBYA 1FK9A 2C28A 4G1QA 3M9NB 1RDBA 3FFIB 3T5LA 4RW9B 2IOCA 2W42A 1EXQA 4LH5A 4QWCA 2KTQA 1WSEA 1JLCB 3SQ1A 1RT3A 1X9MA 5D3GB 3V6JA 4O4GB 1TKXB 3CDUA 2G8UA 1MU2A 2FVSA 2HVIA 4CF2A 1EETB 4I9QA 3I0RA 1JLAA 2J6TA 2DTUA 1BQNB 4CJWA 1X9WA 4NLTA 2IS3A 4FXDA 3DLGA 1Q8IA 1YVUA 5KFGA 4H4MB 5EWEA 4GVMA 2AU0A 2HHTA 5FDLA 4C8KA 5C42B 2VA3A 3SCXA 4NLVA 1JLEA 4RW6A 1JX4A 3DOLB 5KT3A 3OS0A 4KFBA 4B9MA 3BR9A 1IO2A 2G8FA 2RF2B 3M8QA 3OYDA 4KO0B 3CG7A 3M9MB 3RMBA 3LP2B 4ZHRA 3KK2B 2G8IA 1RTIB 4RW4A 5L1KA 4OKKA 4CEAA 1KFSA 4B9VA 3PO5A 1C0UB 1EP4B 3LALA 3DRSB 1HQUB 3LWLA 3HO1A 2PYJA 3TANA 2Y1JA 3DLKA 4DWIA 3ZT1A 3V4IA 4CEOA 3GYNA 4TY8B 3OYEA 1U47A 1KLNA 4MFBB 2WHOA 3AO2A 2XCPA 3L8BA 4K8ZA 1TL1B 3AVMA 4ZMMA 1S1WB 3G0ZA 3TAMB 1N5YA 2FJVA 5KT5A 3TR8A 1NKEA 4DQQA 1GOBA 4F4WA 3ISNC 3SUPA 4NLUA 4YP3A 2Y1IA 5KG3A 3MTKA 2WTFA 3PUFA 2WB4A 3ZSVA 3MF5A 1S1UB 3M8PB 4MKBA 2I1RA 1YT3A 3ZSXA 3AO1A 4XPCA 4DFJA 4DL6A 3NF9A 1GX6A 4EBDA 1RYRA 4ECYA 4H54A 3OSPA 3C95A 1VRUA 2RKIB 5CYQA 1Z26A 1SKRA 4CJRA 1HMVA 3Q8QB 1TKDA 4NYZA 2J6UA 2R2TA 1LWEB 1N56A 4CF1A 1QTMA 4IRKA 4J9RA 4URQU 3KHGA 3D45A 4XPEA 4E7KA 3FDSA 4EEYA 1C1BB 4FJ5A 3SFGA 4KE5A 5KFHA 1HRHA 3BGRA 2W9BB 3AA4A 3PR5B 5F8MA 3AO4A 3LWMA 1IKYA 1ASUA 4QWAA 4DQIA 4MIAA 1HNIB 4OPKA 1TV6B 3DRPB 5DLGA 3KJVA 2GIQA 3E51A 3H59A 5T7BA 3GIMA 2HVHA 4Q8FA 4DSLA 2R8GA 2D0AA 1S9FA 4PA1A 4LH4A 4RW7B 1TL3B 5KFEA 1K1SA 3HP9A 3HT3A 3FQKA 4O44B 4CGDA 2FVRA 3PJXA 1JLGB 2XY6A 3U6FA 2X74A 4GC6A 3LP1B 4KKOB 5J2MB 1IKVA 3DLRA 1LW0A 1YVFA 4KHNA 5I3UB 4C8MA 4Z4CA 2HHVA 4LSNB 5HRPA 3B6OA 2P5GA 5KG2A 4B9LA 4ED8A 4LSLB 4NLYA 2D0CA 1BIUA 2FVCA 4CGGA 4ZVEA 4KB0A 3M8RA 1CZBA 3F9KA 5KT2A 3C94A 3ISND 4ID1A 3IS9B 5HROB 2JGUA 4CGFA 1SL0A 3HVTB 3GV8B 2OYQA 3HKWA 4ZVHA 1ASVA 1S1XA 2UVRA 5EDWA 4CK3A 2ILZA 5C24A 3VA0A 5DGAA 3E01B 4CJ3A 1S6PB 4CGHA 1QS4A 3VQ9A 4DG1B 3MXJA 1QSLA 4DTSA 3QIOA 4ED0A 3NH1A 1C1CA 2ZKUA 3DYAB 1A5VA 3T19A 4K8XA 3NDKA 1U45A 2GV9A 3NGIA 4Q0BB 2Z1IA 3RAQA 3RRHA 4RG8A 4FM1A 1N4LA 4RUAA 5JS1A 1KVCA 1WN7A 1XC9A 5J2PA 3HYFA 5JUMA 5K14A 2DFEA 2I5JB 1EX4A 1HYVA 2XHBA 4I2QA 4B08A 3QIPA 3T3FA 4UQGA 2IC3A 3ZSZA 4RNFA 4DTOA 3VQEA 4RZRA 4EYHB 4FJGA 5KFOA 3NHGA 4KV8A 3CIZA 1NJZA 1KVAA 3T5JA 4KHRA 1RILA 4CE9A 1WSHA 2O5DA 4KBIA 4WFZA 4ECZA 1VSFA 3EPGA 1U48A 4CJVA 1CLQA 1YTAA 4CESA 4MK9A 4M94A 1VSKA 4CIGA 4FLVA 2OPRA 4DS5A 4TYBA 3ITHA 3VQBA 4BDPA 3PW5A 3ZSOA 3EYZA 3AA5X 1NK8A 4AH9A 3NAEA 2EX3A 5KFBA 1U49A 1ZBUA 3N6MA 2KQ2A 4CJKA 3MFIA 1FKPA 4LY7A 1N48A 1TVRB 5KG0A 1RT6B 3RTVA 1NKBA 4ZTFA 4WXWA 1J5OB 1S1VA 2HHQA 4Z4HA 1L3SA 1QAIA 3OS2A 1DTTB 5HBMA 1ZETA 4CJ4A 3DLHA 1S6PA 3H5SA 1VSDA 4CCHA 4KAZA 2YHBA 2C2EA 1RT2A 5KFWA 4E7JA 3IG1A 3K58A 3K2PA 5HP1B 4O55A 4R0EA 2XY7A 4FJKA 3BSAA 4K50A 1RDRA 3MXIA 3OY9A 4CEFA 1KLMA 4DL2A 4QWDA 4RUCA 4AHUA 5HLFA 2GUIA 1RT1A 4MIBA 3HSTB 4B3OA 1I6JA 4ZP9A 3HL8A 1VRTB 1NHUA 1FKOB 3SI8A 4CJTA 3NKYA 4IKFA 4WYWA 4DLGA 1ZBHA 4E3SA 2WOMA 1KCFA 4ECRA 2VG5B 5CZ1A 3Q8PB 1RTDA 4O3RA 3SYZA 4NLPA 1XHXA 2G8KA 4CHYA 5C5JA 2VG6A 2OPSB 3S3MA 4ZPAA 1T7PA 5KFTA 3BREA 3U3GA 2HNYB 4I2PA 1SH3A 3RRGA 3EPIA 2AGQA 5KGXA 3RMAA 4IH6A 2ZD1A 2OPQB 3KD1E 4ECQA 3RAXA 3ZSQA 3L2VA 1BHLA 5I42B 1JLFB 3T1AA 3QETA 4XO0A 3GV7B 1IH7A 4E19A 4DF8A 3UQSA 1D5AA 4O0JA 2YNHB 3H5UA 5DLFA 2YKMA 1DTQA 3QYYA 4CJ5A 4KHMA 2F8EX 3OYJA 3WNGA 2IJFA 3I5AA 4KB1A 1RT4B 1O1WA 3AVBA 4IG3A 4IR9A 3VQDA 2D3ZA 1RDAA 2YKNB 4JLHA 4IG0A 5KFXA 1FK9B 2R8HA 4W5OA 3PZPA 4G1QB 3HM9A 3FQLA 3TAGA 3A2FA 3QESA 4E0DA 5EU7A 4DEZA 3VQPA 1RT3B 5T14A 1HARA 4CJSA 3MR6A 4OGEA 1MU2B 4URGA 3BQ1A 2ASLA 3I0RB 1JLAB 4FS1A 2UUWA 3UIQA 4DF4A 4E7LA 3ZT4A 3DLGB 4CEBA 2P51A 2J6SA 5DQIA 4KTQA 4HTUA 5FDLB 2HMIA 1I39A 2R8KA 4LQ9A 3LZIA 5KFKA 3JSMB 1F21A 1S97A 4H4OA 3HXMA 3L2QA 1JLEB 4RW6B 1MMLA 4KFBB 3I5CA 3M8QB 1ZBIA 3PW4A 3QNNA 4M3XA 3LDSA 1LW2A 4ZHRB 4CIFA 1TKZA 3TVKA 1Q9XA 4RW4B 3KD5E 4J9NA 5KFFA 1CXQA 3SZ2A 3OJSA 1U09A 3RB0A 1TK5A 4ECUA 3DLKB 2XI2A 4ECSA 4N56A 3M9OB 3V4IB 3RMDA 1W0HA 3ZSWA 3OYAA 3V9SA 4BE2A 2KFZA 4WE1A 1SV5A 1L3TA 3NGYA 3PY8A 1SKSA 4EBEA 3MEDA 1N5YB 3V9WA 1VSIA 5FROA 4FJIA 4B8CA 4U6PA 3D28A 3AVFA 4ZVGA 2FBVA 3TAFA 1REVA 3OLBA 4FVMA 4DL4A 4KI4A 1BL3A 4FM0A 1LAVA 3PR4A 4CIEA 4HUEA 4KTWA 4M3WA 3V1RA 3DOKA 4X2BA 3GQCA 1KHWA 1NK7A 1VRUB 5CYQB 4Y1CA 1EKEA 4ZPBA 1HMVB 4FJ7A 4YMEA 1RT7A 3PVXA 2D7SA 3KKRA 4W5QA 3OYMA 2XI3A 4J2EA 3BGRB 3LANA 3ZT3A 3PHEA 3JSMA 3KNAA 1BCMA 1W25A 1IKYB 1C1AA 5KRTA 3OL7A 3S9HA 4EYIB 3Q8RB 4ICLA 1T03A 1JXEA 4J9KA 3KJVB
chains in the Genus database with same CATH superfamily
5AXNA 2UYTA 2C2DA 3N4PA 3GE9A 1W7WA 1XMBA 2HB5A 4OJ1A 4KHPJ 4KH0B 4A2AA 5F0UA 3SMPA 1M5SA 4P2XA 2W40A 4PUOA 3MPUB 3FRYA 1HD1A 3A5MC 4NE9C 4W5RA 4X4OA 4ELTA 3L2UA 1FDDA 2P5OA 1FWPA 1R7IA 1DKGD 2YHYA 4I67A 3CFRA 3VQAA 4AXIA 5F8NA 3DXMA 5FD1A 2AIRB 2V34A 5HMXA 4TQSA 1HI8A 2V52B 3DXKB 1DQ9A 3RMCA 1ULRA 3JTPA 3VGKA 2VPWB 4DV3J 3C66A 4CFAA 3CJ2A 1WSGA 3K59A 1YLXA 4D3HA 2EBEA 1RHJB 2GMLA 1RTHA 4N76A 4H5WA 5LL6d 1RBOB 4FLTA 1T0TV 4CLKA 5CH7B 3SBTA 4CHQA 3QNOA 1RCXB 2VG7A 1RAAB 1RBAA 1JKHA 2EFGA 3MAHA 3OSNA 4LIWA 3SIPB 3BYRA 3L09A 1RCHA 1S12A 2QLXA 3G8QA 1CJTB 2CQ0A 4ISEA 2V6AA 5BPMA 1UEUA 3ZNUA 2WTUA 3A13A 2ZOMA 8ATCB 4B1UB 4IOAQ 2DKOB 4EHUA 3P8BB 3QAEA 3CCJN 4NYFA 1XMOF 4GKJF 1WEZA 2CQ3A 1X9SA 3VF4A 1J2VA 1FT8A 3WUHA 3KLIA 1BI4A 4C11B 4DSKA 4F4YA 4DSFA 4IBNA 1VQ9N 4M5NA 5C7PA 1SJ1A 1GTEA 3OLAA 4XTTA 4GKKF 2R7XA 5KFDA 5C25A 2WW8A 3KK1A 2YWGA 2JLEA 3LDNA 1ICEB 3AVNA 5BR8K 3I0SA 3ZTPA 4FWOA 2X1FA 3TPQA 3VERA 1FRLA 3D2FA 1Q78A 1U6ZA 2WRMA 4MYTA 3OVSA 3ISZA 3N5FA 3ETMA 1EZZB 3QEVA 5ADZA 2DO4A 3TAPA 1VQ4S 3CCSS 3BP8A 1K1QA 4DX5A 5H9EJ 1YAGA 4K0KK 3M4XA 4X62F 4BCAA 2HGLA 4CERA 3QGPA 2HSTA 1N33K 4OMFG 3OT9A 3OYNA 4BE0A 4USMA 2HZVA 2NUBA 3O4QA 3OR1B 1TK8A 2DR9A 1YJUA 2HS3A 3W2WA 4GV9A 2HBKA 4NMXA 3WXMB 3QEIA 2NXJA 2O8DA 1T9UA 2E9ZA 1S9EA 4GV6A 3QINA 4JKEA 2E9RX 1VI7A 1XUPO 1WC5A 1KLMB 3QEXA 3T6BA 5C15A 2PIIA 4FZZA 5FRMA 1S10A 2N3OA 4CVNE 2ZGZA 3S7RA 2RNEA 2ZWOA 4JI6K 3Q8SB 3UR3C 3CJKB 5M2RA 3W2VB 1RLDA 4R8UA 1ATNA 5K20B 1S7IA 1D9FA 3CF5L 1Q8KA 3Q86A 4ZVOB 1RTJA 4ILHA 1VQLN 5AQFA 4CK1A 1S6QA 4NLOA 5EOYA 3VGLA 4DU1A 3N4WA 3MCMA 3C6TA 5DM6L 1WTFA 1P9YA 3GE1A 2IAJA 3MMJA 3A3OB 2V8PA 1GT8A 1L3VA 1IXKA 1SH0A 2CPDA 3IAYA 2KT5A 2HQDA 1WKLA 3OXGA 2V2ZA 1OPIA 2PDAA 4CYUB 4K4WA 4X84A 4C9DA 5B7WA 1KHVA 3DI6A 4B9TA 3DNCA 2GCFA 3O5BA 5KFYA 4IG3B 2XC9A 1V5IB 2BXJA 4N7TA 3EY1A 4CZGA 3LZJA 3FSIA 4K41A 2ASJA 4RWTA 1RT5A 4LVOP 3FZBA 4FNHA 4EAHD 3DAWA 5DDOC 1BGXT 4NLRA 3W0LA 2VC1A 4ZLNA 3KK7A 4MKYA 4DXLA 5AJ3J 1VQNN 1SQGA 2W2MP 4OHYA 1HNWF 1XHZA 3QQCD 1W2IA 3R2CJ 3W64A 4K0KJ 1QJHA 2BYCA 1APSA 2OJ3A 5B0CA 1N33J 4WZQA 4OX6A 4Z4GA 4DS4A 4X65K 1QVGM 5B09A 3NF8A 2HMIB 4K4XA 4B3RK 4ELUA 5JMNA 3EL2A 1Z2LA 1FXRA 1WWHA 2FLLA 5BN9A 3H1QA 3PM9A 4IO9L 2Q3PA 4LF9K 4B1WB 2YKPA 4O3QA 2GMJA 3V81A 2MGZA 3ZZ0A 1SC4B 3HX9A 1ZZNA 4L8RB 3M1VA 1RBLA 3CCQN 1Y7PA 1RXOB 1L5UA 2IRXA 1E6VB 2F40A 2RQKA 2VL1A 5KFMA 3CO0P 2IGIA 1MLAA 3T5KA 1F5CA 4OPJA 1MN7A 5J1EA 3MEDB 4DV5K 3L7OA 5ITHA 3QWUA 4I64A 4OHVA 1IR1A 2W2QP 3BPDA 1IBMF 1OSDA 2KXFA 4JI4J 3PW2A 1O5JA 3K5PA 4HHUA 4DLEA 3DLBA 3BDPA 5F2RA 4L3QA 1S6UA 4DU8A 1HUXA 4H0VB 3R6GB 1J53A 4QCLA 4CZMA 2FJDB 2YJEA 1S5JA 3RAMA 3SQGA 3CQXA 3CFOA 2DY9A 3J81O 5E3QA 3Q2SC 3PX0A 3SNNA 3MUMP 1IG9A 1REGX 4CF0A 1UA1A 3H46O 3A3NB 5FLXY 3OYCA 2FVPA 3BF1A 1PKUA 1Q9YA 1X60A 4DR1F 2HHHK 2G1DA 3E9PA 2QT7A 1T03B 1HPZA 4IOXA 1QZ5A 2J0QD 3GFXA 2KZMA 4C7QA 2OSQA 4A59A 2R9LA 2BANA 3FNNA 2YH1A 2WBMA 1FX2A 3I6PA 2CZVC 4WXOA 2O3DA 1HNVA 4G6VB 4DR5K 4RU9A 4GVLA 4F4ZA 2CADA 1TP7A 3FKBA 3E9LA 4PUOB 4LRCA 2FZGB 3LP0A 4B3RJ 4JI1K 1VBXA 5IT9O 2XNRA 1W97L 1OH5A 3HD2A 2E29A 3VGUA 3DXMB 1Q8LA 3B54A 1D3WA 4J7CA 3AO5A 4RTFD 4ZPCA 1EO1A 2CG8A 4DL3A 1Q82T 2DFHA 3QLHA 2FDNA 1XQIA 4OKJA 4EIAA 4CQ1A 3WXJA 4I4BA 1RAJA 1RKIA 4AHRA 5ETNA 4FSVA 3EGWB 3UD3P 2HNDA 4M5DA 1MWZA 2EVZA 4EBCA 2I2YA 1OS5A 4C97A 2AGOA 2V9KA 1RTHB 1MMDA 1BHNA 2HHWA 3NAHA 4ZLLA 3OYGA 1FD2A 5HVFA 4X4SA 2GWJA 3AH6A 2VG7B 1JKHB 1RBUA 2BZ2A 2FHJA 3MECA 3VETA 3OXLA 3CO9A 4HH0A 4CT9A 2V4JA 3NAIA 2QWOA 3RZAA 1S1TA 1WNSA 3MEEA 1TUYA 1NAQA 4DQ8A 3ZETA 1XR5A 2IDOA 2OIHA 1IBKJ 3H0PA 4F0KA 3CCRS 3T9NA 3D6RA 3WNFA 4HVJA 1UTAA 4UOFA 3KLIB 1J9AA 1BI4B 3CDAA 3QJLA 5IM0A 2RH3A 1JIHA 2V67A 4TQRA 4HI1A 2XWYA 4DFMA 4MH8A 4FF1A 4KHPF 5DG7A 5C25B 3NH2A 3OYKA 1XR7A 2G0JA 3CPWR 3KK1B 1FTRA 4XIUA 2W7PA 2CQ4A 1NJWA 2VQEK 3W9JA 1V3ZA 3I0SB 4K4TA 3EZUA 3H40A 1ZYQA 2B5JA 3D2FB 3KJFB 1H7XA 3CM5A 3MCPA 3BZQA 4DTPA 4I7FA 2HLUA 4OVLA 2V4RA 3R8EA 5DJBA 3ZYYX 4KT0C 4QW9A 1VQ9S 4ERDA 1NZ8A 2Y3YA 4KJIA 3J7AP 4RW9A 4DV3F 1S7HA 3TI0A 3DXSX 2F8MA 4A8KA 4PR6A 2PN6A 1CZ9A 2V5HG 1U1QA 2YHWA 5D3GA 4OX9F 3AOAA 1RWVB 1T6CA 3JSRA 1CC7A 3W2WB 2KXHA 3ALYA 4JI1J 4QWEA 3C6HA 2O8DB 1LQ9A 2V2VA 1S9EB 4O3NA 3DLLQ 5SZTA 4JKGA 3Q83A 4CHOA 4QPXA 5LSRA 1H38A 1NHKL 4IJNA 3O9SA 3K0JA 1P8ZA 2EXUA 1L3KA 4ANEA 4R8UB 2OH2A 4IOBA 4XH5A 4MQ3A 3A8YA 2WBNA 2YCHA 3GCWP 3W3DA 2YHXA 3J7ZT 3OPKA 2QG9B 4ZVRB 4YOEA 3IRWP 1RTJB 3AV9A 1RBVA 3TSQA 4JS5A 1S6QB 5AT1B 2H9ZA 4KHSA 4P71A 2V7YA 4QWBA 2GVDA 3VHQA 3C6TB 2CQDA 4OYBA 4DU3A 3IN5A 2C2OB 2IAJB 3GP9A 5KRSA 4RL1A 4AFFA 1WACA 3JYTB 5GAHP 2HQIA 5E3AA 2XTJP 3HSDA 1S1WA 1XNQF 4ISGA 2KO1A 3SUOA 3I5BA 1KAXA 3L3UA 2MQMA 3D1HA 1FFWB 2GHPA 4BQLA 2X78A 3DI6B 1VQLS 3CD0A 1BIZA 3BB5A 4IYQA 1L3UA 5L9XA 2R8JA 4C0BA 2OUGA 3FRZA 1RT5B 2R3VA 3VQQA 5LJ3Y 4LQ3A 3EVMA 4J2BA 1S6OA 3T69A 4C1NK 3IR6B 4OX7A 1A5XA 2XGQA 2FLNA 4CFCA 1RHMB 4FYYB 5ETOA 1G6BA 1OWXA 1BMQB 2CPHA 4FJLA 3ILLA 1UJ5A 3BR8A 5AZIA 4H5TA 2B4JA 4CF8A 4AT1B 2YWWA 4F3TA 1KR4A 3S3OA 2UUBJ 1QVFR 3KOAA 1PAUB 3O9UA 1XTZA 2G8WA 1M1HA 5A2QY 5DGBA 4Z2XA 1URNA 3ZTOA 5L46A 2YKOA 1VQNS 3HM8A 4JI7J 3MAAA 2VODA 1G99A 2A5XA 2IVFB 1CSJA 1VC0A 3D5MA 3V81B 2MGZB 4DPYA 2GQCA 1BG3A 3M1VB 3JXUA 4HCBA 3AY9A 2IM1A 5E0OA 3NMAA 2XZWA 1CEZA 4HUFA 3O8WA 1HWIA 1DY3A 4RNOA 4V19S 3GG4A 3PLAA 2QWQA 4EZ9A 4LF6K 4Z4FA 4DTUA 3D6MB 1JJHA 3JSBA 3HI0A 1XQSC 3L2WA 3D0PA 3HVTA 2X6SA 4A61A 2AYEA 2UV8G 1NPRA 2Q43A 3NGKA 3E01A 2AJ1A 2W2OP 3CCQS 2JZ5A 4I6WA 3CNQP 4CZFA 3C6AA 5DM7L 3U9ZA 1NM1A 3S3NA 5AJ3F 3G86A 4Q0BA 3SQGB 3MWTA 2QKKA 2DGXA 5D4LA 3N0VA 3H42A 2QXFA 2I5JA 3TARA 4FLXA 2Z1GA 2J7KA 1ZA1B 2UUAF 4C23A 3SI6A 3EZ5A 1VISA 4CO1A 5BR9A 2UXBJ 3QGHA 3D1OA 4F50A 2AZ3A 1NSPA 2KRRA 1HPZB 2Z57B 4Q5VA 1H7WA 4FJ8A 4NA3A 3NNAA 3SMSA 1GX5A 2NSCA 2VF3A 3C46A 4H5VA 2ZH1A 4WFBL 1U04A 2BANB 1W2BR 3AVLA 4AM7A 2MQQA 2QTDA 1HNVB 1HI1A 4P10A 8AT1B 5SUHA 4KQZA 4U67L 3P5JA 1PJ7A 3QIDA 3LP0B 1WSIA 3DC2A 4A8OA 1TVRA 4FBTA 4FJ9A 4LF7K 2V2KA 3QLHB 4EHTA 1J5OA 4KY3A 1NLVA 3BN7A 3F41A 2HNDB 4M5DB 4H0PA 4HHJA 2QWLA 4JI4F 2HF3A 4CEDA 2C2RA 1VCTA 2AJ0A 2ZC4A 4K42A 3NCRA 1PAEX 2OTLN 2Z1JA 7AT1B 2AKWB 3HT0A 1HNXK 4KH1B 4LF6J 1WSJA 3MECB 2OD6A 4MKVA 4KAIA 2HHPA 3V6HA 3MR7A 1Q53A 2Q36A 1T6DA 2V4JB 1N36J 5CHIA 4OV1A 1S1TB 3UKUA 3MEEB 1JB0C 3TX8A 5L1JA 4GNIA 3ZETB 5KFRA 1TAUA 5F3ZA 5KFZA 3KWMA 1EWRA 3J81Y 1RUSA 2VPZB 2KH9A 2QIFA 4FYVB 1A0OB 2FHMA 4PQAA 1PSDA 3CQ8A 5IM0B 1JLFA 5F0WA 1XEZA 4JRPA 1RAHB 4CJQA 1I94J 2HHUA 3HKZD 4PXDA 2M3DA 4Q2MA 2R7TA 4X4RA 2L08A 4WU3A 2M8DB 2B5JB 5LT5A 1RKJA 3CDEA 1XR6A 3HBTA 4I7FB 1RT4A 3QZ7A 2YKAA 4J9QA 1B0TA 1B4SA 5LM7E 2YKNA 3NGSA 5T7LA 5KTQA 1G4CA 1FK9A 3IR5B 5BREA 1U2VA 3R5BA 1V3RA 4RW9B 3IP0A 2W42A 5IT9Y 4QWCA 3VWSA 1WSEA 3UE2A 5D3GB 2E2NA 3V6JA 2B4UA 5E7OB 2E1RA 1NGHA 1DGKN 1GMWA 4ZLPA 4M1KA 3RGIA 3V2UC 4CJWA 4B02A 4OZ1A 5HATA 1SJQA 4JKGB 4LF2A 2CPFA 3DLGA 3OQ2A 1YVUA 4ZVUB 2YWHA 5HVGA 2VIHA 3C16A 5JVHQ 2AU0A 2HHTA 3PJ9A 1Q7YO 3QFHA 4KYZA 4YUDA 4X64J 4JKCA 3H7HB 1IBKF 3QJJA 4B9MA 4KFBA 5GINA 1TELA 4LJMA 3FE1A 3MUVP 5AZJA 3M8QA 4ZPTR 5AE3A 4U96A 2XLIA 3OYDA 1HNXJ 4DR3J 4ZHRA 3FSYA 3M2VA 2G8IA 1SC3B 3CPWM 3HO1A 1UFWA 4GV3A 2ACMA 3GYNA 3TUIC 7FD1A 2KHCA 5CAAA 3OFHA 4IZ9A 3OYEA 1RWPB 1U47A 3X1LB 2R7SA 2BTFA 3AO2A 1O0PA 4JKFA 1S1WB 5AQJA 1NKEA 1GOBA 3MOZA 1ZM3A 3ISNC 2NRTA 4NLUA 1FCAA 4M5IA 2Y1IA 2H5JB 4YHHK 3MF5A 1SQEA 5BYQA 5HI7A 4F04B 3G8TA 3HJVA 3V4MA 2H5EA 1NSQA 4AL6A 1VRUA 1LFPA 1Z26A 1SKRA 4DR6F 1HMVA 4CJRA 3VEVA 5FPEA 4ZITA 4NYZA 4DMZA 4CF1A 1K44A 5G4DA 2HFUA 5EN1A 5AZIB 4QBUA 4EEYA 1WC4A 5KFHA 3MN6A 2HGNA 1VQMN 1SIZA 2VJUA 1WELA 2LQJA 4QWAA 4DQIA 3HSZA 3TVZA 3M3ZA 2CDQA 3J8AA 4CO2A 2E88A 2NRVA 5DLGA 2ZH5A 2HVHA 4Q8FA 4DSLA 2RIJA 3O9RA 5KFEA 4ANCA 3HZGA 1PIEA 2XY6A 2P9LA 4GC6A 1IKVA 2GJIA 2D0OA 1LW0A 2RS8A 1FWKA 4KHNA 3IMXA 2W24A 2VQFJ 3MAAB 1NO8A 4AQYJ 3L7UA 1RWOB 2HHVA 1IG8A 5HRPA 1KOHA 3DXBA 4DN0A 4CDIA 3R27A 3MWBA 3W7BA 2D0CA 5LJ5Y 4CGGA 4ZVEA 4UY8T 4NO7A 3ISND 2AD9A 2JGUA 1WORA 1Q95G 3A1YG 4NWBA 1O13A 3R7BB 4BR2A 4DOZA 3HVTB 3KUGA 4EFAC 1N34K 3PEHA 1S1XA 2UVRA 5EDWA 3VA0A 1S5ZA 3QT6A 1XC3A 4A8FA 3AXKA 3E01B 4C1NI 3TOQA 1QS4A 2AP1A 4X4UA 1BA1A 4V19J 4ED0A 1Y5NB 3U4LA 1C1CA 1U2CA 2ZKUA 4USJC 3T19A 3HOTA 1NGAA 1U45A 1WDDA 4Q0BB 2YWFA 4MJKA 4JI0K 1GLDG 1WN7A 5J2PA 3HYFA 5JUMA 5GAGU 5K14A 4FL9A 2I5JB 2KFYA 1HYVA 1YVNA 3W65A 5HQLA 2UUBF 1QVFM 3QIPA 3GJQB 3SMZA 4UQGA 3ZSZA 2YBVA 4HT7A 4B3TK 4EYHB 2QZ8A 2ZBRA 3CB4A 1FE4A 4J90A 1RILA 4KHRA 3US5A 4GO5X 4WFZA 3N79A 1T3OA 3KG0A 1VMBA 3EPGA 4JI7F 1U48A 5AQYA 4CJVA 1YTAA 4CESA 4M94A 4DS5A 4BRDA 4YN3B 1WSVA 4U7BA 2J8SA 4O23A 4CLLA 3TUZC 2MZTA 4OX8A 4X4QA 1T9YA 4WFNL 1NK8A 3MD3A 2E66A 2NZ4A 3NS5A 1X4HA 4DPXA 1UMJA 1N48A 4KC5A 1TVRB 5KG0A 4FWRA 2WFBA 5DZ6A 3DOMA 1J5OB 2UU9K 1H98A 3FZKA 3OS2A 3DDNA 2LU2A 4Q7AA 3BH6B 2W1BA 1S6PA 1MROA 2BUPA 2J9DA 1ESVA 2C2EA 2BACA 1RT2A 2MXYA 2ZITA 4LFCK 2GELA 3FZMA 2IVMA 5ETKA 3D2EB 1BY9A 2FHJD 1AFJA 4R0EA 3OY9A 5A2QU 1X9JA 1RT1A 2GAGC 3HSTB 1I6JA 1ZAVA 4BC5A 3SI8A 4CJTA 2EPIA 4IKFA 2C1EB 4WP8A 4PCQA 1KCFA 2VCPA 5CZ1A 1F5AA 5CE3A 1RTDA 1Q8BA 1N34J 5AQVA 3SYZA 3LM9A 4NLPA 3UKUB 2FZCB 3BF3A 3SDEA 2ZVSA 4W4MA 5C5JA 2UXBF 3S3MA 1T7PA 5A76A 1WHVA 3U3GA 1QHAA 2OTLS 1N8RT 1ZOTA 4LR8A 4IOCQ 1UVMA 4PG4A 4ECQA 4M63A 3RAXA 3E8OA 3KDNA 1WKJA 2HVZA 1W2BM 1JLFB 4XO0A 8RUCA 3ZZRA 1D5AA 4O0JA 2BMBA 4B1VA 4OV6A 5DLFA 4RUBA 3T9ZA 2YKMA 2MHEA 4DUTA 1X0FA 4CJ5A 3CXCR 1OH7A 4KHMA 1VQ7N 2C3OA 2Q2RA 2F8EX 3QMQA 3I55N 4WFAQ 2JH3A 2IJFA 3BO3A 1EJ7L 1RT4B 1U1LA 1RDAA 2YKNB 2VDIA 4JLHA 1FK9B 2R8HA 2W7AA 3LH2S 2V7ZA 3IM9A 5D8HB 2FYXA 3FQLA 2KHOA 1RU2A 5EU7A 2HBQB 3DHXA 3VQPA 1OJ4A 5T14A 4CJSA 1TU0B 5I4MA 3MMBA 4OGEA 3MI7X 4URGA 2QSFA 4RBTA 4HEA9 4H0OA 4RCHA 3R1HA 1E6YA 3VCDA 1AB8A 2QTWA 4BRAA 1YBUA 4CO5A 4E7LA 1K0VA 2YJFA 1YI2S 3DLGB 2X7IA 2P9UA 3C16B 2ASOA 1VHXA 1N36F 2R8KA 5KFKA 4ILRA 4H4OA 2RU3A 4KFBB 3DDIA 4M5JA 1GTHA 5AZJB 1GK8A 3M8QB 1ZBIA 4P2FA 4BRPA 2RDDA 3PW4A 2B56A 5LSLA 4N8NA 3LDSA 4ZHRB 2DR6A 3EE8A 3VTHA 4I6MA 2D1KA 3W9IA 3CJ9A 1CXQA 2V8VA 3UB5A 1I94F 3RB0A 1TK5A 3SK3A 3VAKA 2YI1A 1W0HA 5EX0A 1AYEA 2WC9A 4ZA1A 1PYSB 3WXIA 5J1NA 3NGYA 3NGUA 3PY8A 2VWBA 1JJ4A 5AQNA 3TYTA 3O9TA 2B4VA 1BXNA 3SBMA 3HHNB 4ZVGA 1HWKA 3LF0A 4M5LA 1REVA 2DY1A 5AFUA 1HR0J 4UUXA 1Y00A 2M88A 4KI4A 4CH0S 2DR5A 3BPSP 5EXWA 4M3WA 4F67A 4UOGA 1T9WA 3T1YF 4L3NA 5CXTA 1VRUB 2DRDA 1HMVB 2FY1A 3VAHA 3VPZA 2CA9A 4DCOB 2G2OA 2A10A 3M30A 4ZIVA 3LGNA 1F1BB 1BDGA 3EEQA 3F9MA 3JSMA 2DH7A 2E1MC 4UOHA 2PC6A 3OL7A 3TZZA 5AE2A 4X64F 3Q8RB 4ICLA 4JV5K 3G4SN 1X4EA 5I9EB 3NBPA 1F9EB 2UV8A 4U7UD 1F5BA 5A0YA 4HL9A 4DR3F 2IM2A 4U9RA 2P9LB 5FPDA 4DFPA 4LVNP 4JAXA 1KNZA 3IRXA 1IKVB 3ENAA 1LW0B 5MLCQ 2R2RA 3UR0A 1F6TA 1R8CA 5C2FA 4HUGA 1XMQK 4FYWB 3VQSA 2W8KA 1VQMS 3UO0A 2ZH7A 5CCMA 4YY3J 4ZP7A 4M7YA 3J81j 3RG6A 2NYIA 3CJ0A 4CT8A 5BRHA 2QA4S 4JKDA 2F9DA 1FXDA 3HD1A 3ENVA 1SBRA 2PA8D 4BE1A 2NXCA 4AHVA 2VFTA 1TGOA 5DDRC 2GEMA 2JEGA 3PV8A 4I1TA 1V4SA 3DLJA 3I96A 5E33A 3KLGA 3JAMO 2OPPA 1S1XB 3BQ2A 3TQEA 4JBCA 9ATCB 3SPZA 3RR7A 4C4WA 3DRRA 1EARA 2ZWPA 1C1CB 1OYEA 2HF4A 4FYXB 3OYFA 3T7ZA 4Z4IA 2AEFA 1T44A 4L6V3 6AT1B 4NXMK 2CPYA 1QQNA 4JYAJ 5EVZA 1CG2A 4Z4EA 2IA0A 4JI2K 4DUZJ 5J2PB 1GXUA 3CJ3A 5K14B 2HFNA 3M6VA 2KYXA 4ZPWR 1RZMA 3QIPB 1C0TA 3P45B 2OMOA 1EQYA 1XWLA 4IRCA 1VQ6N 3EX7B 5CR4A 2AMCB 4BDZA 3VA3A 3LPTA 4FJNA 2DR8A 2RE1A 4USKA 1XNRJ 5KG1A 3ZXWA 3B4MA 2AJ4A 3T6JA 3AVIA 3ICLA 1RHUB 1NJIT 5RUBA 4HHTA 4Y2AA 5C2DA 4JN4A 3CC7N 2LU1A 2VQFF 1LWCA 2F7VA 4AQYF 4WK3A 1N5QA 1J5EJ 4CGIA 4BWMA 4JV5J 5IS2A 2FXUA 4KGXB 1F3VA 1OH6A 5HRNA 4LC9B 2PFUA 4USTA 4OLAA 3DGVA 3KG4A 2ZH4A 2D5RA 3GIRA 3EUNA 2YVSA 5KFNA 3DOMB 4P74A 4NCAA 4IFVA 1AT1B 2R2UA 1I5OB 2R4FA 2QEXN 2YX1A 1MROB 2B3TB 3G10A 4M42A 1RT2B 2J9DE 2H54B 2UUCJ 2EHGA 2QWRA 1A5WA 3HCXA 3B6PA 1NJYA 2DEJA 2GQQA 2VONA 4WCEQ 1Y5IB 2PAVA 4G3IA 4CI6A 2GNKA 2XGPA 1RT1B 2JVRA 2JWNA 4M95A 4KIAA 2E1YA 4YDUA 2QI2A 4IOAL 4H8KA 3KHHA 1X3MA 3VQ7A 1RTDB 4FLUA 3MM7A 3BM7A 2M7SA 5IQQA 3SDEB 3T1HJ 3HHKA 2RRBA 4YOVA 4ILMA 3KYLA 3RJMB 3QICA 1D9DA 2JSXA 2BV3A 4RPFA 3SLCA 3I33A 1W9HA 3DDKA 3RBDA 3M8YA 3LDPA 4PQUA 4NRTA 1KQFB 1YKWA 1R8PA 5M1FA 1GXTA 4C8OA 3KUHA 4DX7A 1PJ6A 3IBFB 2I8EA 4J9MA 2YKMB 1C6VA 4U7UK 4ID8A 3J80U 3Q8YA 2WUSA 5KFAA 4J9UE 2Z4PA 3A0IX 2E5JA 2DGUA 4FP9A 4IDHA 3HFZB 2JWLA 1YG0A 4B3MK 3Q8UA 2VA2A 1NHVA 5DG8A 2NRRA 4BRMA 1IBCB 3WC0A 4L74A 1U8WA 1GMWD 3MPWA 2JWKA 3CJ5A 2MY7A 2GA7A 1OQ6A 3RBZA 1D8ZA 4URSA 3NF7A 3MMBB 3QMLA 2PFDA 1VQ7S 3U8XA 4XEIA 4YOXA 3I55S 3P4UB 1U1KA 4WP3A 4CJUA 2HFZA 3KTQA 3E9OA 2CJAA 1IQTA 2LQ5A 3NS7B 3ET6A 2H4YB 1N6QA 1HBNA 3SUQA 4MO4A 2AF6A 2QGFB 4NLSA 2P9UB 3DM2A 3VV2B 2EKYA 4XK8C 3NMUA 3K5NA 1QLNA 2EC2A 5JS2A 2RUGA 3SAFA 2OTJN 1T3NA 1OMSA 1FWLA 2HW3A 1OQ3A 4H4OB 1SL2A 1CXUA 1JNRB 3R1XA 4HWIA 1HYSA 1RGVA 2V63A 3R5JB 3AQPA 4DTXA 1NGGA 3LDQA 4OI6A 1XERA 4I6MB 3VN5A 1SUQA 1H0HB 2BRKA 4PYDA 4UZBA 4LF4J 1NPKA 3O08A 1YGYA 2VYPA 2PZSA 5BXIA 4HTJA 3HFKA 3CXCM 3H4DA 4CZIA 2DXFA 5LMUJ 3EDRB 3NOGA 7FDRA 3UW1A 4C3LA 4BGAA 1DT9A 1J27A 3B6BA 2YNGA 2DVIA 2P6SA 3AAQA 1FERA 5AQOA 3V6DB 2ZM6K 3P38A 3EJMA 1REVB 3V9UA 3I8DA 1DQAA 4BRNA 5L39A 1B0VA 3QGIA 2KKZA 4AF1A 1R0AA 1CVJA 2JEJA 4LF5J 2L9DA 4Q8EA 1WOOA 3V9XA 4X66J 4PWWA 2ZGYA 1RHRB 3HHLA 5IC6B 2DPJA 3AQOA 4IFEA 3BSNA 3K2YA 1B64A 3BO4A 3M30B 1KBRA 2WK4A 1D4XA 3O1BA 1CJUA 2A1SA 1S76D 4JI3J 4Y2CA 1KD1O 4LBPA 1IM4A 3UN2A 2BVZA 4ICLB 3NBPB 3J7YU 5KPTA 2BGGA 4ILGB 2ASDA 4CEEA 1RCOB 1K8KA 4BRQA 5A0YB 2O1PA 5A8WA 3VQ8A 3D9BA 2HZAA 2RB7A 3CC2N 4AL7A 3IRXB 4DV7K 2EG2A 2C3PA 1S9GA 4J2DA 1F9FA 3VMFB 4H5NA 5C2CA 1YX2A 1VSMA 3U02A 2F63A 5E2QA 5G0RA 4CBXA 1S0MA 2D1CA 5KAKA 2ASMA 4JP8A 4YR0A 2V8DA 3FMBA 2X3GA 3F2KA 1NK9A 2QFJA 4DKWA 2DTJA 5KFUA 4YEAA 2AJQA 3ILJA 1HR0F 1KVBA 4JKAA 1B7YB 3OXFA 3G6VA 2D41A 5GMKa 1SXLA 3KLGB 1U6FA 3CW2C 1JQGA 2OPPB 1U02A 3Q23A 3O3FA 3R2DJ 3TEHB 4KH5A 2N4DA 2LMIA 1X3NA 4M3TA 3DRRB 2GGPA 4A8XA 3D4JA 1G3OA 2E1AA 5L1LA 4L76A 1FXXA 1WHXA 1HX1A 5KFSA 4R5PA 5HQ8A 3TAEA 5A6PA 5KFPA 3OTOK 3CCVS 3PX4A 2ERRA 5HANA 4KHWA 3JTOA 4FWPA 1ZS6A 4DR4F 3MR2A 4KSEB 2FHOB 1EKSA 3FZLA 4DUYK 2AX1A 3WBZA 1OY6A 3QSIA 3V9ZA 4JRQA 2A1RA 3EO3A 4U7CA 1C0TB 4A5AA 4M63C 3P39A 2BQRA 1FW6A 3KWIA 4KR0B 3IBWA 1NK0A 4F8RA 4PXCA 2QA1A 3J7A1 2BQ3A 3OTBA 1TYQA 1QE1A 1LWFA 5JJBA 4I68A 5KT7A 1B3TA 1UVKA 1JLQA 3ZSYA 2RSQA 4KBOA 2F4VK 3LPEA 2O66A 1TL4A 4YY3F 2DGVA 3SFUA 3UCGA 2A6MA 1RHQB 5FJ4A 3EWGA 1HBOA 2E6LA 5BYRA 3T5HA 3BSOA 2Z1HA 3LO3A 1WBDA 4BS2A 5F8HA 2JJ4D 4FDFA 3UNGC 4WFXA 1T9VA 4YR2A 5D77A 1HWJA 1U1RA 4IFVB 1NBEB 5BPNA 3DCAA 2NZCA 2V50A 3MMCA 5LMNJ 5EUHA 3D0IE 3MN5A 3HP6A 4CHZA 5F41A 4O4GA 5E3CA 3POTA 5M1OA 2VKZG 4WPAA 2JC0A 2FLPA 1FESA 3GU0A 1HQ2A 4USUA 1IKWB 4KREA 1WI8A 1G15A 4FJMA 4ENOA 3AA2A 2ZVIA 4DSIA 2MZJA 2P9CA 1X5TA 4BRFA 5HSPA 2IRYA 2OHDA 4JYAF 1S3XA 2E4LA 4K5SA 5A8KA 2AJFE 3P6YC 3A8IA 5C42A 3H20A 1RAOA 5DK5A 4DUZF 2NRWA 3CF5Q 3MM7B 3ZX2A 1ZM4A 1MDUB 2QEXS 3KG1A 2V8HA 3MM6A 4OLBA 3MM8A 3D0HE 4KH6A 1KVKA 3Q7CA 4DX8H 5DM6Q 1WNEA 2MLZA 2P5VA 2I7NA 3IWXA 3GV5B 4DBQA 4CK2A 1XNRF 1GMVA 4LF8K 4GMJB 4DV4F 4PQUB 2BJ3A 2KDOA 2R7VA 1ZTWA 2PO4A 1J5EF 2B9EA 4NLQA 1UW9A 4LD0A 4A8YA 4NOHA 2O4IA 3RB4A 3EGNA 3NG8A 2A42A 1KRPA 4KPCA 5CZ2A 1WC3A 3SV3A 2HIYA 3ENWA 4IH5A 1FFGB 2IMWP 1JJCB 2ITGA 2MYFA 2DIVA 5GIPA 4OYAA 2QMWA 3V5RA 2OGUA 4V1Ak 2ALZA 5U47A 2UZAA 2UUCF 3JXOA 2GTDA 4Z94A 1Q82O 5LXYA 1AXQA 2IMOA 1SKWA 4K43A 2HEKA 1C1BA 2D9OA 4FLWA 1GMUA 3KKSA 4USVA 3KDOA 1RBSA 5F8LA 4NLCA 4FK2A 3ET6B 1N6QB 5D4NA 1HBNB 2W4DA 1TV6A 4RNMA 3DM2B 3BGOP 2DK2A 3MEKA 1QAYA 3DU6A 4LT6A 4IQXA 2QWPA 3EZWA 4RW7A 1LKZA 4ELVA 4IO9Q 3H6EA 3T1HF 1DJ0A 4O44A 2KJWA 3CCWA 5KT6A 4Z7CA 4FZVA 1HYSB 3LP1A 4KKOA 1MW7A 3CMAN 2NS1B 1YITN 3W62A 4M5GA 1VIXA 2MTLA 1F60B 3UPFA 3D6FB 2HWHA 1UOCA 1ZAXA 4BRHA 5IFMA 3CDWA 1SUQB 1Q1KA 4TXSA 3HOSA 1NNDA 4LSNA 2JRSA 3A12A 4OHZA 2P9KA 5K8NA 5LY3A 3LUYA 2Y8YA 4LSLA 1U24A 4F7VA 3ZC4A 4OHXA 4CLFA 1R8AA 2MKJA 1O8BA 5AE1A 3IS9A 2FTRA 4JI5J 1Y10A 2Q0UA 4E7IA 2NCKL 2M2BA 4DL5A 3MOJB 2R7RA 2YNGB 2FGCA 4MT1A 1TFWA 2Q3SA 1KXPA 1R0AB 4J9OA 3I4HX 2E6MA 4DG1A 1RAGB 3TUJC 2Z2YB 3BEGB 4W90B 4FWNA 4Q45A 4K2JA 4M5HA 3ULEB 3R97A 1OO0B 5IC4B 2PA3A 2EKNA 4AHTA 3HHLB 3AJ1A 3PO4A 1S99A 3CULA 2CYYA 4NZ6A 4DTRA 2MMYA 3GIIA 1CJUB 3Q7BA 5KT4A 4OI1A 2XRIA 2X1GA 4ZVSB 3VOVA 4BRIA 1FDBA 2DCUB 3G8SA 1W7AA 1YZ7A 3OFGA 2J8AA 4BR4A 1VQON 4O5BA 2XZTB 2ZZMA 1Z2ZA 3FBBA 2BW2A 2F7TA 3QFPA 4RUHA 4DR2J 3OFFA 3SUNA 4PRFA 3ATUA 2O8FA 2F8SA 1V9OA 1WOSA 2RPIA 1K8KB 1GLAG 5A8WB 5IWAK 3MPYA 4DV0F 2VFRA 3QZ8A 4WQ4A 1W26A 1R27B 1HL6A 1S9GB 1ZC6A 4LF4F 5HRSA 1RDUA 4F4KA 3DGPA 3AAWB 4P6QA 4J9LA 4CF9A 1FA0A 3LAKA 2GV1A 3WIVA 5G0RB 4JI8K 2HWIA 1GH8A 3D6HB 4DR4K 4TYAA 5LMUF 4WBFA 3KJNB 3F5TA 4GMKA 2WB1D 2V94A 1VSJA 1F2HA 3ETOA 4M3ZA 4TKTA 1VRQC 2EFOA 1KQGB 4O5FA 1UAXA 1XI1A 2XO7A 3QBXA 3CCTA 3LM2A 2M5YA 4LF5F 3CEDA 3TAQA 3H08A 4JNEA 2KKHA 2GC8A 1RWWB 1IBLK 5AQGA 4X66F 2A3JA 1T3VA 5FLXO 2GGPB 3O3HA 4RBUA 1QTNB 4R5PB 4DQPA 2RQ4A 1Y3KA 4M3RA 1QAXA 2DHHA 4PXBA 5DRKA 3J7AN 4LFBK 2HRYA 2V68A 1MA9B 4JI3F 1JL1A 2K1RA 3SCJE 1GQEA 1M5VC 3GIJA 1X31C 2VV5A 4ZCIA 2HNYA 4ZVFA 4PEOA 2HKEA 1QDUB 1RBRA 2XCAA 1VFJA 1I3AA 2OPQA 2BDPA 1GFWB 3K0SA 4ZJQA 5I42A 2WAQD 2CDRB 5ETQA 2E5LJ 4BC2A 2YHAA 5GAGP 1TYQB 1QE1B 5EWFA 2PT0A 1LWFB 2YNHA 5E84A 4Z0UA 3K57A 2J9CA 2W9AA 1JLQB 1FF2A 4YOYA 3FCWA 2EBGA 3HHEA 1LWXA 3MX2A 4XH1A 3N6LA 3GTYX 4JUZA 1HLUA 2DR7A 2DPIA 3VQ5A 4WKRA 5C10A 3PIOQ 1U1OA 1ITGA 2OANA 1HBOB 1ZAWA 2C28A 1FJGJ 2DNGA 3UCZP 1K8AT 4G1QA 3BH7B 1MG7A 5GAEU 4EK2A 3M9NB 2IYGA 3T5LA 2W6KA 2E2PA 2XG8A 3ZO7A 3O4WA 2E7XA 3C8YA 4CBUA 5GADP 1EXQA 3GFYA 3IUCA 2KTQA 3MMCB 4ZJOA 1X9MA 2Z2MA 3PRDA 1XK8A 1H72C 4O4GB 3CDUA 3MGJA 4NXNK 3MDFA 5E5NA 2FVSA 4BC3A 3POTB 4LR7A 3I0RA 5JVGL 1IUJA 2QLJB 1X4BA 2FIUA 4CLPA 2RRAA 1X9WA 3E1YA 2IS3A 1WDTA 4DL0C 2B9WA 3P31A 4GVMA 5A8KB 5C42B 2VA3A 2YQ0A 4NLVA 4DI6A 2XSFA 5KT3A 5D15A 3BR9A 2E8AA 5ETLA 1GXLA 3MM6B 4CD3A 3MM8B 3VEOA 1I3OB 4RW4A 4LBIA 4OKKA 2WVCA 4CEAA 4B9VA 3PO5A 3WZ0A 4ZDNA 4F0HA 1HLWA 1N32J 3LWLA 2Y1JA 4H0XB 4DWIA 3V4IA 2BJEA 4M8LA 1Q79A 2W4CA 3NLCA 4QIFA 2NLWA 5LXRA 1KLNA 1YHQS 4F3QA 3WQUA 3L8BA 3LQVA 3AVMA 4ZMMA 1HIYA 4NMLA 1N5YA 5KT5A 4DQQA 3TJ9A 3EXCX 1ROFA 4CLWA 3PUFA 4J8FA 1UFLA 1K73O 2LECA 2J9EA 3FSXA 4MKBA 5GMDA 2I1RA 3AO1A 2L9WA 1FRKA 2Z58B 3NF9A 1RYRA 5LMNF 3LOUA 1Q81O 4ECYA 4H54A 3OSPA 3C95A 3CCRN 2Y8WA 3PYGA 4HHHA 3M8WA 1N56A 1QTMA 4IRKA 4J9RA 4URQU 2QLWA 5CD4A 3UNYA 4XAKA 3KHGA 1F2GA 2PMWA 5DDPC 4XPEA 3KWGA 3FDSA 1C1BB 2BKOA 4IWVA 1KQKA 3PR5B 4HTLA 1D9AA 5T41A 3Q8VA 5F8MA 5TKWA 4L72B 4MIAA 1WBBA 1TV6B 3BKUA 4OI2A 4BVPA 2OKQA 2PEHA 1BUPA 5T7BA 4NEYA 3AXMA 2R8GA 1S9FA 5MAOA 4NXNJ 4RW7B 3OFEA 4PKGA 1K1SA 3HT3A 3FQKA 4O44B 3Q89A 3NVKA 2Q79A 1S77D 3U6FA 3LP1B 4KKOB 1WF1A 5K8PA 1NGCA 3DLRA 1N5TA 4LFAJ 4ANDA 2PSZA 4BREA 1ITPA 1GLEG 3CCEN 2FB0A 4LSNB 3BN4A 5FPNA 2CJKA 4RBVA 1LOTB 3CJAA 4B9LA 2P9KB 2YQ1A 1UZHA 5HQMA 2E7VA 4LRFA 4LSLB 2DNYA 2F9JA 3ONQA 2D3OR 1BIUA 3TJAA 1HNZJ 4DV2J 3C94A 3IS9B 1KN6A 3CMAS 1YITS 4CGFA 3AY0A 2NUUG 3ZFVA 2LVWA 3F56A 2OYQA 1KDNA 1EKRA 2KI2A 3I9V9 2CPIA 5C24A 1Z05A 3MX5A 3WC2A 1R8BA 2H3GX 5H9FK 4WIQA 4DG1B 4DV0K 3QIOA 4R25A 2AV5A 2R7OA 4A8WA 4B3SF 4K8XA 5A2QO 3NGIA 3O2IA 2KG0A 1N4LA 5BRDA 1IJJA 3ZZUA 3L3CA 2XHBA 2YKQA 4B08A 1A6LA 2CPXA 2IC3A 3W3SA 2I6WA 4RNFA 5BYSA 2ADCA 2YWEA 2BE9B 4M5MA 3OUYB 5KFOA 3BY5A 3NHGA 4WFBQ 2XMWA 3VF2A 4CE9A 1WSHA 4DV1K 2O8FB 4KBIA 1NH8A 3GL1A 3IM8A 1VSFA 4I6AA 3R9LA 3H25A 1CLQA 4YOWA 2MJNA 1VSKA 2OPRA 4TYBA 3ITHA 1X4GA 3SCLE 4U67Q 3JQJA 2W01A 4BDPA 1VJQA 1P90A 4AH9A 3BKTA 2M4MA 2EX3A 3DGPB 3A8JA 1FKPA 1VQOS 4CWBA 3RTVA 4ZTFA 4WXWA 5HL7L 2BJ8A 2QO3A 2APOA 3D1QA 3P49B 4OI3A 2HURA 2UXDK 1Q7YT 1ZETA 3DLHA 3H5SA 3IDHA 3S6EA 5BR8J 1M5KC 4RLEA 4CO4A 4E7JA 3IG1A 2XLKA 2GVZA 3GR0A 2BX6A 3K2PA 3UD5A 4FJKA 1RISA 1RDRA 3MXIA 1C4CA 2WSCC 4MIBA 3CMEN 3HL8A 1OPZA 4P9SA 2WOMA 4ECRA 2P9NA 1LNQA 3W5XA 2E44A 1WHWA 2G8KA 2VG6A 2K1RB 1OY8A 3ZX3A 4ZPAA 3NXZA 5B0GA 5IQ6A 2PBDA 2RT3A 4Z37A 2HNYB 4I2PA 3RRGA 1U1MA 2ZHBA 2AGQA 5KGXA 4DR2F 5ETMA 3RMAA 5F1XA 2OPQB 2DNLA 3L2VA 5I42B 3ILOA 1ZBTA 1IH7A 4DF8A 4WWSA 4JI6J 3B8HA 2YNHB 1PJ5A 3TJ8A 2I7PA 2XO6A 1DTQA 2B51A 3FEXB 3UN5A 3CJ8A 3PKYA 1DZ5A 1RGIA 2QL5B 2COLA 5BJRA 1O1WA 4EI2A 2VBWA 5HAOA 1RP5A 2D3ZA 4UF4A 3FCVA 4QOTA 1TFYA 2HWTA 4G1QB 4DR7F 3O1LA 3A2FA 3OR2A 3QESA 3OBYA 4E8UA 3QNWB 3M2RA 4UY8O 2XMKA 3CJRA 2K2PA 4BRCA 3ZZTA 4EU0A 2H48B 3C65A 3I0RB 1FHTA 3VEYA 1GEHA 1G2EA 1VQPN 3FR0A 1RSCA 2ZOFA 5C12A 4DF4A 3D54A 5KPRA 5GAHU 4KTQA 4HTUA 4I56A 1TZ0A 3WQPA 1UVNA 2QSWA 1NGFA 4LQ9A 5F0XA 4PZVA 1SQFA 1RTZA 4X4TA 3BGUA 4DPTA 4IOCL 3QNNA 4M3XA 3SEOA 3TVKA 4RW4B 2V51B 4DCPB 3KD5E 2OAUA 3TA1A 4J9NA 5KFFA 2E5LF 3GYGA 3SZ2A 3OJSA 1U09A 3B4DA 4ECUA 3IXQA 4ECSA 3M9OB 3V4IB 3PXGa 4X65J 3VAMA 3KZBA 4MIWA 1PILA 2XZDB 4BE2A 2HQCA 1SV5A 1QZ6A 4FWMA 4WFAL 5B0FA 4TLQA 3RUBL 3M6UA 1N5YB 2FC8A 3V9WA 2FPHX 1YJ7A 5FROA 4G1IA 1R0CB 4CLZA 4CZCA 3VF0B 4LF9J 1FJGF 3F0NA 2FBVA 3TAFA 2QYCA 1XMOK 2Z8QA 4GKJK 5AXKA 4DL4A 5AQKA 4DU7A 4FM0A 1NMEB 2MKCA 4CIEA 4HUEA 4KTWA 4UTGA 3V1RA 3CD6N 3DOKA 4GKKK 2Z2LA 1NGIA 1EKEA 1AW0A 3LDOA 3PVXA 2X1AA 2NLXA 3TUPA 1SQKA 2UXCF 4FWSA 4DV5J 1FVQA 1VC5A 3KNAA 4Q2LA 5GAGI 1NMDA 1Q7LB 2VJVA 4TVAB 5KRTA 1AZSA 1P1LA 2HPUA 2BJ7A 4DV6F 2IRUA 1HYZA 3FMWA 3G87A 4X62K 2DGOA 2W2PP 5MLCV 3H3NO 2XEXA 1WUUA 5CCLA 4WQ4C 5JMVA 2HG4A 4C8ZA 3HLUA 3V6KA 1KAYA 2ZDPA 2WSEC 2J0SD 2IHR1 3CHWA 3WIUA 4F0MA 1N32F 4OZLA 3QATA 4B3SK 5GADI 2WVFA 5AQZA 4ECTA 1T05A 2BR0A 1N54B 5D4PA 2PY5A 4YDXA 1GNKA 3P96A 2ZJQQ 2HHHJ 4CGJA 5HOOA 4C6AA 4ITSA 1S0VA 2KYZA 3ZCMA 1Q0NA 2C3MA 2RDIA 4PY5A 1NK5A 3THPA 2P8IA 4A48A 5HO4A 3R8YA 3JQMA 5AQHA 2F5GA 2C2MB 2HQ3A 4PAAA 2DNRA 1ZPVA 2BE7D 4DR5J 3TTCA 4PG5A 2QM1A 3IWNC 3NGDA 2JEIA 1JCEA 1QSYA 4MDAA 3H98A 3CCES 5GMEA 2A6OA 4FF2A 5C24B 1K9MO 3O1WA 5IZHA 4FJJA 1MN9A 2C42A 1HHSA 3BF4A 2M52A 1QUVA 2DT9A 5CY4A 3M5RA 1ZPWX 3N6NA 3QWPA 2V0NA 4KHUA 2N7CA 2LEBA 2DIUA 3LPUA 2WONA 5M2PA 1FNOA 5KG5A 2IC3B 5E41A 2ZNZA 1JLBA 2BJDA 2IDLA 5CQGA 1FRIA 4NLDA 4ETZA 1SAZA 3ZLJA 2KJVA 3ZNJ1 3QJPA 3HFVA 3GYXB 3MUTP 3SPYA 1OYDA 3DJCA 4LFAF 3PDNA 5LOQA 4LIRA 1QD1A 5IOLA 2E2QA 2OPRB 5KQDA 3W61A 3ITHB 3V1OA 3CD7A 5CYJA 2G2ZA 2GJFA 3LTOA 3HRGA 4NEZA 4PXEA 2HRTA 3K7RA 3H1VX 3EKSA 2C2NA 1HNWK 2J7WA 2RDJA 2LA4A 3CUNA 3J7YP 4WU2A 4B9SA 5AR0A 3VR1A 1FKPB 1HNZF 2PYLA 4DV2F 3ZTSA 2EFNA 2HIQA 1P27B 4WF9L 3KLEA 4TU7A 1NOZA 4PHTX 2V69A 3SQ4A 5KFVA 2G4BA 3NL0A 4JV0A 3M7VA 2VQEJ 4OKEA 2RHQB 2NQPA 1T9TA 3IG1B 3C3LA 1R43A 2FF3B 3AVCA 1MMNA 3AJ2A 3P83D 1KVJA 2B7CB 3PSFA 2UVWA 1LV5A 3SAHA 4NL5A 3MK6A 1NNEA 3H4BA 4NPOA 4DTMA 1FDAA 3D66A 2HAIA 3GG1A 3W8PA 2PFFB 1O51A 3K5LA 2WOMB 3H5XA 2P9NB 4WQ5C 4WYBA 4C11A 3E66A 4USWA 1FTCA 3EXYA 3O9QA 3IWLA 3EN9A 2DCLA 1M5OC 2VG6B 4CFDA 3AARA 4TU8A 3G6XA 3N28A 3P3DA 4I2PB 1IBMK 4Q44A 1NB7A 2E5GA 4IR1A 4NZ0A 4USHA 3CMES 1WUAA 3C2PA 3WX8A 1VR6A 1DARA 4ECWA 3K5MA 1M1KO 1M0SA 1NZAA 2YX6A 4K5RA 2BJ9A 1QAJA 1DTQB 4CHPA 4YR3A 1UKUA 3N5BA 3CJ7A 3R6LB 3OL8A 4HCCA 3UVJA 4FYDA 3KMSA 1QQMA 5K8MA 5F3TA 1BWVA 3HDSA 2HQFA 1YRTA 3AO3A 2KT2A 1WSFA 3F44A 3FUYA 4R79A 5J1EB 4DR1K 3EM1A 2IA6A 1HKBA 3PYEA 1X5SA 2LEAA 1PYOB 3OR2B 2X6NA 3OBWA 2YWKA 5BR8F 4DTJA 3DLEA 3M2RB 1B7FA 1CLFA 1Y97A 3VQCA 2IDEA 3ULDA 2GHVC 2RILA 3QEPA 4AE5A 1X7VA 2ITMA 3LA0A 3TEGA 1WB9A 3NWGA 5ELZA 1TKTA 1U0SA 5FIIA 2UVUA 4CW7B 3ID6A 2HS4A 2MEWA 3PJWA 4K0KF 4NASA 4CZJA 4ZVPB 1N33F 3GJTB 4PWUA 1RA7A 1S0NA 3BBCA 3BEXA 3PCOB 4N47A 2AX0A 5HVHA 4OYPA 2YNIA 1JJ2R 4O3OA 4V19X 2HBZB 4FPIA 2QC3A 2JEFA 2F65A 1VSLA 1VSHA 4RNHA 2AQ4A 4JB8B 1VQPS 3MMVA 3OHAA 3ZSRA 4DHVA 2RHSB 2KFNA 4CYUA 4B9NA 2QV6A 4JI6F 1UVIA 2W9CA 1TR0A 5ETVA 4IH7A 3RW7A 2E1CA 2D74B 3R9PA 2C22A 2I0XA 1LFWA 2SXLA 2ZUAA 4CRJA 1FXLA 1SV5B 4FVCA 1OVQA 1T8EA 3IO1A 3Q2TC 4FM2A 4HLBA 1QHTA 2VICA 2P2CB 3RB6A 4MK7A 1U25A 1VHFA 2YPYA 4DMNA 2FJXA 4KGKA 3QERA 4CEQA 4OI0A 4RW8A 4DV6K 1VLOA 1E4FT 4QYZK 4E2FB 2YX7A 4A62A 2IPOB 3BBBA 5LSOA 1CJKA 3LPYA 3CQYA 2YNFA 3O6QA 4J5OA 2FSNA 1WC1A 3U1NA 3DOKB 3GZ7A 2NSBA 1IR2A 5AQPA 2HBYB 4KHPK 1RADB 3WDOA 4DCJB 4OJHA 1X4FA 4O4RA 3KHRA 3OA9A 4RR5A 1D0EA 4C98A 4FVUA 2DNZA 3R5AA 3F73A 4C2MA 2K7JA 4NA1A 4ID5A 4AYBD 2W4PA 5IT0A 1BWEA 3HULA 4AILC 4IXCA 1Z4UA 2RQMA 1AZSB 4OYMA 2VH7A 4NYNA 4ALZA 1MWMA 3CD6S 3FZ2A 4N41A 5EX5A 4QIEA 2R7YA 3C6UA 5CD4H 4WK1A 4DV3K 4B9QA 5EY4A 2EK6A 2DXDA 2A40A 2HBRB 3HSCA 1DEJA 4PKIA 3SCIE 2AEMA 4HT5A 2PE8A 2KT3A 4OX9K 4CM2A 4MAKA 1R8HA 2H65B 1LOUA 3DWLA 3MD1A 3PX6A 4KB7A 2A6AA 1FEEA 2QE5A 3QFUA 4QS8A 5DO2A 3MFHA 4ECXA 2GHWA 3EMTA 2OA8A 2HNZA 3R5CA 1T05B 4X65F 5SWMA 3A8EA 4LSZB 1TQLA 2J0WA 4ER8A 4KHQA 4B3RF 3PIPQ 1CC8A 2HLTA 3O3GA 3MMAA 1DHMA 2V4QA 1IM6A 1D1UA 1IR0A 1YI2N 4LF9F 1H2VZ 3ZT2A 2H5IB 3IKMA 1EIYB 1Y4ZB 1Y9OA 3K8WA 1U6BA 4YOUA 3OL6A 3EZOA 1HKCA 3AAPA 2XY5A 3H3OB 4FPAA 3KXDA 3NF6A 2BRLA 3U1MA 5D0RA 4NLWA 1HQEA 4IFYA 2XLJA 1VK3A 2HOEA 1NEEA 1TMMA 2H1YA 5HJYA 2WW4A 3M32A 1VGYA 1X4AA 2D69A 3KLFA 3OD2A 2CNOB 4LF7J 2R7WA 2VB6A 3O4NA 2XM3A 1JK9B 4DV5F 1S0OA 4BGBA 1XNQK 2WONB 2IIHA 2A41A 4ZCLA 3H2VE 2UVVA 1RYSA 3DFEA 4J91A 2MZRA 4JOUA 1JLBB 1WOQA 3MDQA 1TUWA 5H9EK 1NPPA 3CTRA 4IO8A 2OEJA 3LL3A 1U1PA 4ZPDA 2GFFA 5LJWA 2OCEA 3TQ1A 1DQ8A 2FBXA 3RB3A 2K3KA 1KFDA 3AA3A 3VAJA 2Z30B 2MLXA 3GFZA 3MWPA 4HDGA 4ED3A 5DDQC 2GVDB 4ZOSA 4WYLA 2DGWA 4RNNA 3ZZOA 2XSJA 2BKPA 2ATQA 3NCQA 3BUZB 1IJFB 2QLFB 4PG6A 4CJFA 3CPEA 3AODA 2IY5B 2JNJA 2HHSA 3NE6A 2FJWA 2HHHF 3P5TL 4ZN3A 5DQGA 3VEZA 1MWQA 3C0BA 3FFIA 4OX9J 2CPEA 4PPZA 3NS6A 2Q97A 3KLEB 3HF5A 3K89A 4FW2A 1JMTA 4DJBA 4CEZA 3V1QA 1JLCA 2BOAA 4DR5F 3IMQJ 2Q1LA 2C3UA 1N52B 3IR7B 2QA4G 5CZXA 1S79A 2ZJRQ 2AT1B 2MHNA 1EETA 3H8YA 4FKXA 1BQNA 2ZH2A 3Q0AA 1Q86T 4E98A 4JI1F 4CI0B 3VQ4A 1FI4A 5KFCA 2XY8A 3OW2R 4YQWA 2CNNB 1M5PC 2FC0A 4WTOB 2CWXA 4OPAA 3SJHA 4TSXA 4OO1J 1WHYA 1K6YA 2RRNA 4QYRA 3M8SA 3DHWC 1RDDA 3PFOA 4FZYA 1UJ6A 4P2MA 3AB2B 3UDLA 3TA0A 1M5HA 2QN6B 4K2XA 3G6YA 4M7XA 2RF2A 2MKKA 4Y1DA 3CWJA 3OYIA 2AA4A 1RLCL 4C0OC 4AHSA 3D6TB 5KOWA 2POKA 3LP2A 1UVLA 2QA4N 3GSIA 2QA2A 3WNEA 3KK2A 1R89A 4WIIA 2EFQA 4CO0A 1XN9A 2A2DA 1HQUA 1JL2A 2CGLA 3QEWA 2P9SA 2R7UA 4K59A 1XNQJ 4TY8A 2KXNB 3GOIA 2BH1A 3VQTA 2L48A 5HMYA 2LFVA 1CBKA 5AQSA 1LK5A 5AJ3K 5KG6A 2AWZA 2D3O1 1C0MA 5E26A 3UE5A 2YV0X 3TAMA 4BG8A 1ATSA 3CCMN 3HVAA 3O5TB 3THVA 3OVNA 4IEEA 1RNHA 3UVJB 4BRGA 3JAMU 4IRDA 2UUAK 2ATLA 2P1JA 3TSPA 3O8MA 5DQHA 3QFWA 3GJRB 3LDLA 2CNLB 3H90A 4NYPA 4DL7A 4X4VA 1UAWA 1KD1T 4R0JA 4J9SA 3J80Y 4KTZA 1ZXOA 2ASYA 1CS4A 2VQEF 4YB5A 3RBEA 5A6WA 3LGMA 2MQPA 3DLEB 3L2RA 2PMZD 1SJRA 4X4PA 2XYHB 4XH4A 5GAEP 2XMMA 2W9BA 1RA6A 2ZC3A 2LA6A 3ZZPA 1NDPA 4FCYA 1TKTB 2DFFA 5LL6Z 2VZ9A 4YHHJ 4MLEA 2OI2A 3PSIA 1YJTA 2P9IA 4B1YB 2Y1RI 3DRPA 3L3VA 2DNMA 2DGSA 3R7SB 3PACA 4N5SA 3THXA 2FVQA 1JLGA 2RVJA 3FGVA 3J7YI 2P6TA 4Y6IA 3MAQA 3QBWA 4BHQA 2YNIB 3OTEA 3UI3A 4CP5A 3HVWA 3A5OC 4HYKA 4GW6A 2BJ1A 3JYTA 3CVKA 4JI4K 1Z1ZA 1RJJA 3OJUA 3CM6A 3RYLA 2F3JA 4C8NA 2NUHA 1YTYA 2ZHAA 4CH1A 5F8GA 2W9CB 3I4PA 2V2QA 3GBTA 1UCNA 4QS9A 3KKFA 1S4FA 4C0HA 5HROA 4NLXA 4IO1A 5I3QA 5IT4A 2IM3A 5AQMA 4RW8B 2MLYA 4RO0A 1B9DA 3HZEA 3TSUA 2IFXA 1WEYA 2BW7A 3RR8A 4J37A 1CJKB 1KC8T 2YNFB 2B4PA 1RE1B 4A5BA 1KQSR 4LREA 3TNVA 2CGJA 2BOPA 1OKJA 3A4TA 3KLVA 2G1HA 3UN3A 3VEXA 2UUAJ 2X1BA 3VAIA 1VLYA 2QRRA 1M90O 3VALA 4P72A 4TN2A 4ID5B 2WCXA 3OS1A 1B9FA 4Y0WA 2HFVA 4QOZB 3I32A 4UZCA 4EGLA 1FVSA 4EP4A 5HMWA 5FRNA 2MPUA 2F96A 4ZKAA 3P1GA 2DISA 1X8DA 2HAFA 4ECVA 2M0GB 3C6UB 2XYGB 4RKUC 1JJ2M 4ED1A 3TA2A 3VQ6A 4NB4A 2BEFA 4UOCA 1FNXH 5ADXA 2L9NA 2VWKA