1IKVA

K103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
557
structure length
556
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 147
structure length 556
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikvA05
2FVCA 3SNNA 2WOMB 4M3YA 2PY5A 4NZ0A 1IKWA 4I2PB 1EX4A 5C25A 3DM2B 3HT3A 3AA5X 2HNZA 3V9WA 4K4SA 5F9LA 4K4WA 3OJUA 3DRSA 4BDYA 3QZ8A 3EY1A 3HP9A 5I3UA 3HVWA 4M3ZA 5HRRA 4CGFA 2VA3A 4AHTA 4C8KA 4NLXA 4DS4A 4FK0A 4O3QA 3HPGA 4IH5A 4ZVHA 4IG3B 4J9KA 2KFZA 1TL3B 4DEZA 1S1UB 1UWBB 5F9NA 4WZQA 1NK5A 2UVRA 3MXJA 3RRGA 3LPUA 2RN2A 1ZYQA 3SI6A 1LWEA 3HVTA 3NF7A 3WNEA 2Y1JA 2E6LA 4ZHRA 5KFRA 2HHUA 4DTMA 3QGGA 1WAFA 3SJJA 1SH2A 1NK6A 3ZSZA 4KI6A 4FJJA 4DL6A 3AVBA 3KLGB 3M8SA 4IH6A 1J5OA 1S0MA 1FKPB 2F96A 5KI6A 4KREA 1RT3B 2KFNA 4YR3A 3OSNA 1EETB 5T7BA 4LD0A 1NK0A 3FSIA 3I0SA 1S6QA 4OPKA 4KI4A 2XRIA 1IH7A 2HHQA 2D0CA 1RT2A 4O4GA 4DG1A 5L9XA 2UUTA 4DQRA 4ZP8A 1WSEA 4K4UA 2YNIB 1XWLA 1NHUA 5KT6A 3LAKA 4CJQA 1WNSA 4H4OB 3NMAA 1DTQA 2X74A 3Q8PB 1WSHA 4URGA 2ZD1A 2YKMA 3NFAA 2FBXA 2W9BB 2HNDA 4CERA 4FYDA 1D1UA 4ECQA 4IQXA 4ECXA 4ECSA 1HPZB 1TKDA 1MU2B 5KFLA 3FFIB 1HQEA 3PY8A 4IR9A 1L3UA 5KFVA 2J6UA 2VG6B 4OKJA 1HQUB 4DTNA 4CEDA 2HB5A 2OZMA 4KTZA 1JL2A 3JYTA 2BQUA 2ETJA 5DLFA 4LQ9A 4DFJA 4E1NA 3MR2A 3SUNA 3TAMB 1XR6A 2D3UA 4CJVA 2VG5B 2HMIA 2YNGA 3CJ5A 3OLBA 2WHOA 1I39A 3THVA 3OL8A 3GILA 1GOAA 3HO1A 1SV5B 3NKYA 4TQSA 3PZPA 4F4XA 5HRPA 4HVJA 1WLJA 4FBTA 4PUOA 2DFFA 4WE1A 1NK8A 1HMVA 5KFDA 2FJXA 4CF2A 1TKXA 4ZP9A 2I5JA 1NJWA 3OL6A 2FLPA 4M3RA 4WZMA 2QKBA 4I9LA 2YHAA 2FVPA 1RT1A 4CHOA 3IG1B 4B9TA 4B9SA 4CGIA 3M9NB 1FK9B 3OYKA 1JXBA 5L1JA 3FRZA 1B9DA 2B5JA 4J9LA 3ULDA 4BE1A 4FM2A 3CFRA 5J2PB 1C0UA 3DOLA 1VSJA 4J9RA 1EKEA 3G86A 5FRNA 2JEFA 4Q8FA 2G8FA 4YR0A 4ZVGA 4MK9A 1K6YA 4B9UA 5KFYA 4ID5B 5C24A 4NLPA 3DLRA 3SCXA 1T94A 4TY8A 3NCIA 4ICLA 3BDPA 1QSYA 5KG1A 4IOBA 4QWDA 4CK3A 2R8GA 4FS2A 4KHUA 2HHTA 3UQSA 4DQQA 3PX0A 3PW0A 1KVCA 2WTFA 3KJVB 3BQ2A 2BANB 3H59A 3MECA 4ELUA 4DFPA 2R2UA 4NCGB 1B9FA 1ZBIA 1BIUA 4CCHA 3LP0B 4NYFA 3KD1E 3HP6A 2IBKA 3C6TA 1GX5A 3K5OA 4K8ZA 1KFDA 4RG8A 1N48A 3U6FA 1LWCB 1RTJB 4BACA 2QKKA 2XCAA 5J2NA 3PW7A 5KFXA 1HYSA 4DQSA 4YNQA 1RT5A 2BQRA 4IFVB 1TL1A 4URSA 3PO4A 1ZBUA 2ASLA 4BWMA 3TAFA 4IFYB 3NBPA 1RTIA 5F8LA 3H5UA 1KSPA 3MEGA 5KFZA 4KO0A 1VRUB 3QETA 4CEQA 3SUPA 1JLAB 1LWFA 2V0NA 2ALZA 3L3VA 2YNHA 1IO2A 2GV9A 3V4IA 2HVIA 4IRDA 5J2MA 1DTTA 3K5LA 3KK2A 2ZKUA 4KV8B 4QW9A 3WNHA 3Q8RB 3KMSA 1U49A 3G10A 4WFYA 3LALA 3SV4A 5EDWA 1IKXB 3QIDA 3K57A 1I3AA 5F8JA 4CESA 4IDKB 3WNFA 5KGXA 4RNNA 3M8RA 3CO9A 3P5JA 1S9GB 3KOAA 3O3FA 3DYAB 4CJFA 5HBMB 2XY8A 3MFIA 4Y2CA 1GOBA 4X2BA 3ZSWA 5EWGA 3ZT1A 3I5BA 4DSEA 4WXWA 4K4TA 3OL7A 3V81A 2AX0A 2D7SA 4ZMMA 3MFHA 3PVXA 4TQRA 4O5BA 1S6PA 3M8QB 2HHVA 3SZ2A 4CIGA 4J2EA 1I6JA 1NKCA 1HNVA 5KFFA 1LW0B 3V6DA 3JSMA 4TSXA 3OYDA 5D3GB 2XC9A 3V9XA 4FJGA 2IM3A 2D0AA 4DQPA 3QGIA 5JUMA 1X1PA 1XHXA 4DTSA 3LP2A 2BDPA 4BE0A 4CJKA 2ATLA 4JRQA 5CZ1A 1S1TB 4CFBA 4AHCA 4JLHA 3QZ7A 4B9VA 1WSGA 1RT6B 1R0AB 4RW7A 2R8IA 1HJRA 4DL7A 3VQQA 4J9OA 4FZYA 4HYKA 3LZIA 1MMLA 4Z4FA 2ASJA 3OL9A 2AGOA 3VA3A 1LAVA 2B6AB 1KHWA 1Q9XA 1GOCA 4WFZA 2AU0A 4Q5VA 4Z4IA 1Y97A 3RB4A 3KK1B 1N5YB 3OYJA 3TI0A 5HRSA 4O3SA 2G8KA 5T14A 4K4XA 4PQUA 4DU1A 2GUIA 1KLNA 4C8OA 4CGJA 4CK2A 1S1XA 4ZPCA 4GW6A 4F50A 3D0PA 2OPSB 1RT7A 2RKIB 3BSCA 3AO4A 5C42B 2I1RA 4H4MB 4K4YA 3SQ1A 4ED7A 4AHRA 1Q8IA 3DMJB 2YNFB 3RB3A 4CHQA 2FVRA 4W5QA 3V1RA 1JKHB 2ILYA 4B9MA 1S1WA 3KKSA 2IAJA 4DFKA 3S3MA 1IG9A 2IM1A 4N76A 1ZBFA 1FKOA 4IH7A 3B6OA 3VQEA 1C0TB 3RRHA 4KFBB 4R8UA 2HNYB 2UVWA 3PHEA 4Q8EA 2Z1HA 3C6UB 2FVSA 3VN5A 2QE5A 2E9TA 1T03B 3QIOA 4DSFA 2IC3A 3QEWA 4JS5A 1RNHA 1CZ9A 3T3FA 4RUAA 3L8BA 1JLQB 4O3PA 3PX4A 3ZCMA 4FLYA 1ASWA 5FDLB 1BI4B 4IBNA 4PWDA 1WNEA 3L2RA 3DI6A 3P1GA 4F2RA 1F21A 2Q3SA 3SI8A 1J9AA 1RDCA 5KT4A 4RW4B 4QPXA 2JEGA 4RNMA 4OKEA 2R2SA 3MTKA 1LAWA 1BL3A 4Q44A 3V6HA 1TKTB 4R5PB 4E1MA 4Q0BA 1JLFA 1EP4B 1LW2A 5KG4A 2FLNA 4KHYA 5J2QA 3GIKA 5K14A 3Q8QB 3V9ZA 1REVB 3DRPA 1A5WA 4CEZA 1W25A 4CGGA 4Z4EA 4KHRA 4CJEA 4RW9A 4QCLA 5HP1A 3T5LA 3QEPA 3UPFA 3SPZA 4LSLA 2XHBA 1S1VB 2HHSA 4QOZB 1S10A 1T05A 3RTVA 4KHWA 1X9WA 1JLBB 2EX3A 3VQ5A 4NCBA 3OSPA 4GVMA 4WXOA 3PX6A 3H5XA 3VQPA 3KLIA 1RBVA 4DF4A 4OPJA 2E6MA 3TANA 1ASUA 3AVCA 4GC6A 1SKRA 2C2EA 3HKWA 2OZSA 3SQ2A 5L1LA 1TVRB 3MEEB 1BQNB 2JC1A 4G1QA 2OPPB 3GIMA 3CM5A 3G6YA 1WSIA 3SPYA 4EP4A 4RW8B 5I42A 4O44A 2BGGA 2ZE2B 4FW1A 1ZETA 2IA6A 1BQMB 1ZTWA 4KRFA 5KFOA 3AO1A 3PV8A 3DLKA 4ED0A 3KLEA 3K59A 3ICLA 1YVUA 4I2QB 3DRRB 1BIZA 2NUBA 5CYQA 3BR9A 1S9EB 2XGQA 5KFCA 3SFGA 3QNOA 5F8GA 3NDKA 3M9MB 5KFGA 3AVFA 4KKOA 2XGPA 3AA3A 2R2TA 4M45A 3MR3A 3BREA 2WB4A 4J9NA 4LSNA 5J1EA 3QO9A 2BRLA 5F8NA 3KMQA 5KTQA 1RTHB 3ITHB 1L3TA 3PO5A 3DOKB 4NRTA 4JV0A 4CJSA 4RNOA 2G8VA 2AJQA 2B43A 3QIPB 3HHKA 1DLOA 3K5MA 3L2WA 4B3OA 5CZ2A 3QEIA 4CHPA 1HNIA 4CJ4A 1RT4A 2HWIA 3O3HA 4KB7A 3UIQA 4KHSA 3AVKA 4J2BA 3QINA 2O4IA 3CFOA 5HLFA 3ZSVA 1NK4A 1IKVA 1JLGB 4QWBA 4CEFA 4RNHA 4YQWA 1HYZA 4CJTA 4Y1DA 3AVHA 4I7FA 4CEEA 1QE1B 3E01B 4AH9A 2R8HA 4CHYA 1VRTA 4FLVA 4ECRA 3UDLA 1NOZA 3DLEA 1A5VA 3LP1A 3PR4A 4RNFA 4KHQA 3A2FA 4AHUA 4Z4HA 4MFBB 2XI2A 2UVUA 4KPYA 5C5JA 1Z26A 3H98A 3BGRB 3S3NA 1Q9YA 3GIIA 3H4DA 2X6NA 4DSKA 3G0ZA 3TVKA 3PW5A 3CJ3A 1TK8A 4EZ9A 1IKWB 3AO2A 4DF8A 1SUQA 3KLHA 3KK3A 4MIBA 3TAGA 3L2QA 1QUVA 3P83D 5C25B 2OA8A 2HNZB 3OHBA 3C94A 2ILZA 2OPQA 1X9SA 3TQ1A 3DRSB 4FCYA 4DL4A 4NLDA 4Q43A 3NF6A 4ID1A 5I3UB 1RCHA 3I0RA 3IS9A 4CJ3A 2XCPA 3OYHA 1N6QA 4F4WA 1U04A 3AA2A 1NKBA 3SV3A 4U6PA 3T1AA 3G6VA 4E7KA 2FBTA 4W5OA 1XI1A 1RA7A 3V9UA 4FJ8A 3GV5B 2IOCA 2G8WA 3TARA 3DLBA 3EZ5A 3CJ0A 4LY7A 3HXMA 4FZZA 1KCFA 1IKYA 1LWEB 3HVTB 1NOYA 3RMCA 3CJ2A 5HROA 3OYFA 5EWFA 3HL8A 4ZHRB 5CYMA 3GV8B 4JUZA 4NYZA 3ZT0A 4B9LA 2W42A 5HRNA 4PA1A 3OHAA 3RR8A 4DFMA 1SL1A 2YKNA 1BGXT 1NJZA 1J5OB 1RDRA 2VWJA 3QEVA 4DTJA 4E89A 3OJSA 2G8UA 4DL3A 4RW6A 3I0SB 4PY5A 1S6QB 4FJ7A 4KKOB 4FBUA 1S97A 3EYZA 1RT2B 4HUFA 5KG5A 4HUGA 4ED2A 4O4GB 4NCAA 4DG1B 4LH5A 1KLMA 2F8SA 1QSLA 3VQBA 3V1QA 4DTRA 2VG7A 1K1SA 5KT7A 3ZT4A 2WCXA 4DMNA 2W9AA 1DTQB 2FJVA 4IKAA 4NLQA 3IGVA 4J9SA 3MEDA 2ZD1B 2YKMB 2HNDB 4RZRA 1EXQA 3SYZA 4ZVEA 3QNNA 3CJ4A 4CFCA 4ZTFA 5KFUA 4O3RA 1C1CA 5EU7A 1HQEB 5HLFB 3V6JA 4Y1CA 4AHSA 4W5RA 3RMAA 3DLGA 4FS1A 3FQLA 3B6PA 4ZP7A 3JYTB 4E7LA 3CIZA 4Y3CA 1RTDA 3ISNC 2KQ2A 4NYNA 3D45A 3ZSXA 4YP3A 1RYSA 1KTQA 1YTUA 4ECYA 3LZJA 5DQIA 3MXIA 1C1BA 2FLLA 2HMIB 2YNGB 3IAYA 1S5JA 3U3GA 2C28A 2HWHA 2WRMA 3AVIA 3IRXA 3MR5A 3M8PA 5SZTA 1SUQB 3OYMA 4RU9A 5KG7A 2GIRA 1T3NA 1JLEA 2F8EX 2BE2A 4PUOB 3L2UA 1VSIA 4KTQA 1IM4A 4WE1B 1T8EA 3N6NA 3NH2A 1W0HA 3OY9A 1HMVB 3V6KA 4QWEA 1VSHA 5KFWA 2W8KA 2DPIA 2IMWP 1TKXB 3KLVA 3ZT3A 4HCCA 2I5JB 5SWMA 3N6LA 3IS9B 3M9OB 3EZUA 1RT1B 2HAIA 1OS5A 3QEXA 3BQ0A 2B5JB 2ASDA 3KLFA 2HHWA 1C0UB 5KFSA 3DOLB 4J2AA 3MXMA 1TKZA 2GIQA 4CJ5A 2RPIA 3S9HA 5L1IA 5KFPA 4E3SA 5C24B 1U45A 1NNDA 4TY8B 4OLBA 4NLRA 2JEIA 4ICLB 4DTUA 2W8LA 3VQ8A 3ZSYA 4ZPBA 3KD5E 5KFAA 3MR6A 4NLGA 2P5GA 2R2RA 4BWJA 1CXUA 4L8RB 2X78A 1YVFA 4IG0A 4FJ5A 2WONA 2W9CA 1S0OA 3QLHA 1TV6A 4ZVFA 5DGAA 5KFTA 3OYAA 1QS4A 3MECB 4Y2AA 2WOMA 2VA2A 2J6SA 2AGPA 4N56A 3AO3A 4CF8A 5DG7A 4I2PA 4FLWA 3DM2A 3CDUA 2Z1IA 3C6TB 1TGOA 1NK7A 2Z1JA 3AVJA 1S49A 2IM0A 3OYEA 4O3NA 3NF9A 3SQ4A 5J2NB 4ELTA 3VQCA 1HYSB 1JIHA 1RT5B 1TQLA 2AX1A 5DK5A 4HCBA 3VQSA 1TL1B 3O4NA 1YT3A 4IG3A 4NLWA 1A5XA 1QTMA 5FROA 1TL3A 4K4ZA 1S1UA 1UWBA 3K2PA 4FJIA 3NGZA 3NBPB 4H54A 1C1AA 1RTIB 4CIEA 1LV5A 4N47A 4Y34A 4E7IA 3GQCA 3MEGB 4KO0B 4J9MA 3AVNA 3N6MA 3DLGB 1LWFB 3LWLA 4F2SA 2YNHB 3KLGA 1G15A 3VQDA 4CF1A 2KTQA 3V4IB 2LSNA 3GIJA 2IS3A 4H8KA 3CYMA 4GMJB 1FKPA 5J2MB 1DTTB 4M3WA 4DLEA 3KK2B 1RT3A 1Z4UA 4ZTJA 3HPOA 1EETA 3ZSRA 3H5YA 2EC0A 3SQ0A 1K1QA 2DFEA 2KZZA 5KG3A 5KFEA 4JRPA 3HVRA 2FC0A 3T19A 3BSAA 3IN5A 3AVAA 2BE2B 4CK1A 4R0EA 2YNIA 3NGDA 4ECVA 3D28A 4B8AB 2C2RA 5JXSA 1J54A 4FJMA 2X6SA 1RBSA 3TR8A 1NHVA 3KHGA 3OS0A 1UOCA 4IKFA 1TAUA 1BCMA 3V81B 3CVKA 4W5NA 4DU3A 2W9BA 4O0JA 4TYBA 1S6PB 3L3UA 4OGCA 4DTPA 4C8NA 4NLVA 3VQ9A 3RBDA 3NH0A 3VQ4A 3KKRA 4TYAA 1HPZA 2AWZA 5KT3A 1L5UA 1HNVB 1MU2A 3CG7A 3V6DB 3JSMB 3FFIA 4HKQA 4DQIA 4CJPA 3AA4A 4BE2A 1U48A 1W9HA 2VG6A 4M41A 3K5NA 1HQUA 3LP2B 4FW2A 3NAEA 4Z4GA 5FRMA 5F8HA 4N5SA 4FJKA 3NGIA 1SL2A 5KGWA 5CY4A 3VA0A 3O3GA 4RW7B 2VG5A 1S9FA 3BSOA 2BQ3A 1NJXA 3GV7B 1S0NA 3NL0A 1N56A 2C22A 1SV5A 1NK9A 3MAQA 3ASMA 4XPCA 4FLXA 4M94A 2JC0A 4MK8A 4KB0A 4FJHA 1SKSA 3QYYA 2D3ZA 3TABA 2CJQA 4ED6A 5DG9A 4DU4A 1NKEA 2RDJA 3O4QA 4CJWA 3OYBA 4AHVA 2V4RA 4PQUB 1U47A 2XI3A 3OYLA 4OLAA 4QWCA 3IG1A 1FK9A 1S1XB 1CXQA 4ECUA 5J2PA 4ECWA 5KG2A 1RT7B 4ECTA 4YR2A 4BDPA 4ID5A 1XHZA 2W7OA 4FJLA 1BHLA 1WSJA 1S1WB 5KFBA 2IAJB 2FJWA 3KIOA 1RDDA 1U09A 3F9KA 5KFQA 1XC9A 4MKBA 4NLTA 1FKOB 4FLTA 1X9MA 3EPIA 2YV0X 4F4YA 4CEAA 4YMEA 4R8UB 2DFHA 4KE5A 3AVLA 3KHLA 3RB0A 3E51A 3U3YA 3KJVA 2BANA 3T5JA 4DSIA 4C8MA 4F3OA 3RWUA 2JGUA 4OKKA 2XWYA 2IC3B 3I5AA 4RUCA 3RAQA 4Z4CA 3IGNA 5KG0A 4NCGA 4KB1A 3LP0A 1ASVA 1FXXA 4HHTA 2KZMA 3KHHA 4CECA 5F8MA 4OJRA 4OL8A 4NLSA 3HM9A 4EBEA 3NH1A 2HHXA 4PWDB 4Q45A 1QQCA 1ZBLA 4CEBA 1LWCA 1RTJA 1C0MA 1HARA 4EP5A 3DI6B 2R8JA 3Q8SB 1JLCA 3H08A 4CGDA 4IFVA 4CHZA 4CE9A 1QAJA 4M95A 1UA0A 2BRKA 4NRUA 1RDBA 2JLEA 4DTXA 4M3UA 4FM1A 4Q0BB 1JLFB 2O4GA 4IFYA 2AQ4A 1LW2B 4WYWA 2J6TA 5J2QB 5K14B 2FBVA 1JL1A 4EZ6A 1SH3A 1VRUA 5KFJA 3S3OA 4K8XA 3DRPB 4FK4A 3H2LA 5KFHA 1JLAA 3RB6A 3KNAA 2B4JA 3TWHA 1HRHA 4E7JA 3ZSQA 4JV1A 1CLQA 3ISND 4RW9B 5HP1B 2XY5A 3K58A 3HJFA 4KV8A 1VSKA 4LSLB 3PR5B 4WYLA 4ED8A 4QW8A 2HVHA 1T05B 3V9SA 3BJYA 3LPTA 1D8YA 3SUQA 1IKXA 4CGHA 4CJRA 2UUWA 3BSNA 4MQ3A 5L1KA 3KLIB 4IDKA 4CEOA 4URQU 4KBIA 1RILA 1ITGA 1UAXA 4TY9A 3VQ7A 1S9GA 4J9QA 3BQ1A 1KVBA 4DLGA 3DYAA 5HBMA 3EPGA 2EHGA 4G1QB 4FJ9A 1D9FA 1QAIA 1D5AA 1BISA 1HYVA 2E9ZA 5I42B 4O44B 2UVVA 5DGBA 3CFPA 4WFXA 4ED1A 2QV6A 3M8QA 4ZPDA 4MH8A 3TAQA 3PJWA 1L3VA 3DLKB 2A1SA 3KLEB 1RA6A 2E9RX 2Y1IA 3RR7A 5CYQB 1LW0A 4ECZA 2D0BA 2KW4A 5D3GA 4OVLA 3TAEA 4HTUA 4FK2A 3PW2A 4FZXC 3LP3A 2G8IA 4EBDA 2RF2A 4KHNA 4GC7A 3WNGA 5KFMA 1S1TA 3T5HA 4LQ3A 2OYQA 3HK2A 4LSNB 5J1EB 4IRKA 4CFDA 5KFNA 3QO9B 4KAZA 1RT6A 3OYIA 4CJLA 1R0AA 4KHMA 1BCOA 1TK5A 1ZBHA 5KRTA 1WAJA 4QWAA 1DLOB 4EBCA 4G3IA 2B6AA 4B3OB 5DG8A 1HNIB 1RT4B 3TAPA 4MKAA 4DL2A 3OS2A 1KHVA 3KK1A 2D5RA 3OLAA 1VSFA 1N5YA 3QGHA 3KHRA 3I5CA 1IKVB 4KSEB 1JLCB 4K4VA 4CF0A 4JV2A 4KTWA 4I7FB 3KTQA 4ELVA 3F73A 4MK7A 1RBUA 3HSTB 4DWIA 1VRTB 2DTUA 3AV9A 2OPSA 3DLEB 3LP1B 3UR0A 2RKIA 2RDIA 4J9PA 4EYIB 3ALYA 5C42A 4ZPAA 5KT2A 1SH0A 1TK0A 4H4MA 4F4KA 3H40A 2ATQA 3DMJA 3V1OA 2YNFA 3LAMA 2DY4A 2P51A 1JKHA 3KLHB 3KK3B 4XIUA 4DSJA 4M3XA 3GYNA 4M3TA 1WSFA 4FJNA 1TAQA 1C0TA 2OPQB 4KFBA 2HNYA 2GC8A 4Z0UA 2G8HA 3MF5A 1VK0A 3C6UA 4CIFA 1U4BA 4B8CA 1L3SA 2A1RA 3I0RB 4E19A 2R8KA 3HVAA 1T03A 4C8LA 1N6QB 4EO6A 1T7PA 2F8TA 2IM2A 3HPHA 3CDWA 3AVMA 1D0EA 2CKWA 2VWKA 1JLQA 4E0DA 2WK4A 4F4ZA 4K50A 4F3TA 3AVGA 2PYJA 5FDLA 1BI4A 2AGQA 1J53A 4FM0A 1S48A 4J2DA 1IKYB 2V4QA 3H5SA 5HROB 5DMRA 2XO7A 1N4LA 5CYMB 2OPRA 3NAHA 1VSMA 4DL5A 3LANA 5DQGA 3CM6A 1RYRA 4RW4A 2JEJA 4O55A 4TLRA 4IR1A 1UA1A 2YKNB 2P1JA 4I9QA 1GX6A 4CJUA 4W5TA 3I8DA 4TN2A 1TKTA 4R5PA 1EP4A 2QXFA 3QESA 2BR0A 3D5MA 3HYFA 3LWMA 4NLUA 4RW6B 3RBEA 3ZSOA 4KAIA 3T5KA 1REVA 4ED3A 1JXLA 2O5DA 3H4BA 3RAXA 5F8IA 3OS1A 2RF2B 3VQAA 1KFSA 3SFUA 1QSSA 1NJYA 1KRPA 1CZBA 4DSLA 1KLMB 1XR5A 4FJXA 4M42A 3VQ6A 4IRCA 3L2VA 2GBZA 2VG7B 5EWEA 4HUEA 1S1VA 4EO8A 1RBTA 4FLZA 4YFUA 1YTAA 1JLBA 4MIAA 4U7CA 1C2PA 1ZTTA 3MEDB 2D41A 2R7YA 4TXSA 2ITGA 3OYCA 2PZSA 5DQHA 1RDAA 4FLUA 3CWJA 4O4RA 1KVAA 2FBYA 4QAGA 3NGYA 1C1CB 1TVRA 3MEEA 2XY6A 1BQNA 3NE6A 2ZQBA 5DLGA 2OPPA 1RAJA 1SKWA 5KRSA 4RW8A 5KFIA 4XO0A 4EEYA 2ZE2A 4AILC 1BQMA 1RBRA 4XPEA 4E7HA 3FDSA 4F8RA 1XR7A 2XY7A 1JXEA 4OGEA 4CHNA 1RTDB 1Z25A 1C6VA 3DDKA 1VSEA 3ZT2A 3CDEA 4FXDA 5JS2A 4NLOA 4NLYA 3RMDA 1VSDA 4I2QA 3DRRA 2C2DA 4JS4A 3C95A 1S9EA 1C1BB 5EUHA 1CSJA 2OH2A 2IDOA 3OVNA 1SL0A 3IRXB 3PUFA 5KG6A 3PW4A 3FQKA 3NAIA 3OYNA 3M8PB 2E4LA 3DLHA 1JLEB 4FVMA 3RMBA 4ZP6A 4CF9A 4DS5A 5KFKA 1RTHA 3LDSA 2IJNA 3ITHA 2HW3A 2W7PA 3DOKA 4H4OA 4UQGA 1S4FA 3CQ8A 3NHGA 3SUOA 5E41A 3QIPA 1TP7A 2P5OA 2Z1GA 3KLFB 1TKZB 4B9NA 1QHTA 4EYHB 3AO5A 3OYGA 2OPRB 2DPJA 2IGIA 2YHBA 1JLGA 2FVQA 3NF8A 2QK9A 2IJFA 1JX4A 3PJXA 5JS1A 1QE1A 4B08A 3E01A 2V9WA 3QERA 1WN7A 4BDZA 4DTOA 4IG0B 2PYLA 4O3OA 4CFAA 2WONB 2W9CB 4O0IA 3QLHB 4MFBA 3TAMA 1TV6B 1B92A 5KT5A 1O1WA 4N41A 3BGRA 1D9DA 4LH4A 1VSLA 3G6XA
chains in the Genus database with same CATH superfamily
4C1NI 1HHQA 4BRAA 3VGTA 4DX7A 3SEOA 4Y6IA 5C25A 5C2FA 4FWMA 3MMBA 4DHVA 3SAGA 5EVZA 2HNZA 3V9WA 3ILOA 4LBHA 3ULHA 3VALA 2F7VA 4P75A 3QZ8A 3EDQB 3DGPB 3HP9A 1GNKA 5HRRA 3EX7B 5AQWA 4JI3J 5A6WA 4GO7X 3OR1B 2QW9A 4O3QA 2CUYA 3HPGA 3TU5A 1RLDA 4IH5A 4ZVHA 4J9KA 3MOJB 5BN9A 2W4PA 1TL3B 1NK5A 2RN2A 1UL3A 2CYYA 1WC6A 4H5NA 4PKGA 3PFOA 5BREA 4KH4A 3M8SA 3IR5B 2VOOA 3D1QA 3MAAB 1J5OA 1S0MA 1FKPB 4IO8A 2C2OB 1GMUA 4PRFA 4A61A 5T7BA 4LFBJ 2EI5A 3R7BB 1IH7A 2E2QA 3SXLA 1CULB 1FRLA 2WB1D 3A5MC 3AAWB 2GMHA 3VENA 5DDPC 1OJ4A 2WSCC 4ETZA 4DR2F 2YNIB 1XWLA 1TMJA 3H45C 4CZIA 4H0XB 2DT9A 4P6QA 4MO5A 2D0PA 1FESA 3AHPA 3VTIA 3FZFA 1DTQA 1CBKA 4DMZA 3MX5A 4DV2J 2WBRA 3HFZB 1GAOA 5FPMA 2YKMA 1OKJA 3NFAA 4CERA 4EI2A 1ZM9A 2RRNA 4WYBA 3BGOP 3GJRB 4JI6K 1YGYA 3J80Y 2DGXA 5KFLA 1T44A 4V19J 2CGKA 3OTBA 2F5GA 3D66A 1L3UA 4V19X 2Q66A 3IWNC 4DTNA 4CEDA 2HB5A 4KTZA 1IBMF 1ZS6A 3JYTA 4USUA 2HAFA 2UU9F 3CQXA 1OH5A 1R6VA 2H4WB 2J7KA 3HSDA 3VF4A 2GZOA 3MR2A 3S41A 3SUNA 3TAMB 2Z30B 2A2DA 4MIWA 3K7RA 1XR6A 3S6EA 2Y9HA 4CZEA 4JV5K 2AYMA 4V19S 3RU0A 3OLBA 3N79A 3F5TA 4ZCIA 4JHDA 2AJ2A 2J4RA 4TQSA 3CPEA 1V4SA 5HRPA 1YLXA 4DV0F 1FWLA 1NRKA 1YDLA 1TKXA 3NWRA 3UD3P 5A76A 3W7BA 1Q5VA 4NI2A 1W26A 4XK8C 4QR0A 4IDHA 3IG1B 2Q3PA 4B9SA 1SJRA 1NWKA 2B5JA 4J9LA 4LRCA 4FM2A 1T3VA 3DOLA 1VSJA 3M6GA 3KJFB 4DV2F 3IFEA 4Q8FA 2G8FA 1FJ7A 5C24A 4QQBA 1B99A 4TY8A 3HZ6A 1YJNN 3CCZA 3N01A 3R1HA 3QICA 3M2UA 4OI6A 1VAZA 3AB4B 5B0FA 4CI0B 4QWDA 4F67A 3CDBA 3KJNB 1IBKJ 4YN3B 4L76A 4DN9A 3VESA 3IA0A 2WTFA 2H4YB 3KJVB 2BANB 1KKHA 2VPWB 1R8CA 3C46A 1XC3A 4JAXA 3BGLA 2VBYA 4LRAA 4G1IA 2M3DA 2KG0A 3KD1E 2GUPA 5DDRC 1ZPWX 3CGIA 4X4VA 3C6TA 2RS2A 3K5OA 1U2VB 3TZYA 4K8ZA 1MNEA 5LJWA 1JCGA 3AJ1A 3U6FA 1RTJB 1MA9B 3PIOQ 4KGKA 3D9BA 5KFXA 3VF0B 1RT5A 2BQRA 2GJ2A 2HSTA 2FC8A 4URSA 3PO4A 1SVDA 1DJ0A 2GV1A 5KFZA 1VQ7S 1VJWA 3HBTA 1VRUB 4AM7A 3EGWB 2VICA 2YNHA 2ZJPQ 1U1NA 1M5PC 1N8RT 4Y28C 2GV9A 1X8DA 2BMBA 2HVIA 3W3DA 3W2WA 2OEJA 2QA4G 2ZKUA 3VERA 2HIYA 5A8RA 3Q8RB 3MN6A 3WC2A 4BRIA 1FDBA 4WCEL 4EWTA 3AB2B 3SMSA 2VBXA 3QIDA 2MHNA 4RNNA 3CO9A 3KOAA 4AM6A 4CJFA 2ZITA 3PSFA 2LKZA 2NPIA 1GOBA 1QQOA 3CJ9A 4X2BA 3ZSWA 1OPZA 4M1KA 4WCEQ 3V81A 2AX0A 1B0TA 2D7SA 3MFHA 5I9EB 4TQRA 2PSZA 4ZPWR 4O5BA 4ED5A 2NXCA 4F04B 3ID8A 2LQJA 3Q0AA 2I7PA 2I0XA 3SZ2A 3S01A 2ZJRL 1U1OA 1I6JA 5DETA 1FRMA 3ULEB 5BR9A 1R0BG 2IM3A 2E1YA 1DGKN 2NUUG 5JUMA 1X1PA 1XHXA 5U47A 1OH8A 3LP2A 3BF4A 1FDDA 5ELZA 4JRQA 5CZ1A 3Q24A 2OLWA 2NZCA 3ZZRA 1M90T 4RW7A 3L9ZA 2R8IA 4OFZA 4UY8O 1AB8A 3SCLE 4FZYA 4HYKA 2Q6CA 1RBOB 2AGOA 1I94K 2QRRA 2HZAA 4HLBA 3CC7S 1LAVA 2JL9A 1KHWA 4HACA 3DNCA 3RBZA 1GOCA 1F0XA 3BM7A 5AZIA 4CH0S 4OX8A 4YY3J 1MN7A 2EFVA 3W5ZA 2DR6A 1BUXA 1E6YB 2KU7A 2FDNA 3TI0A 3KHYA 2D69A 5T14A 2CQ3A 2J9CA 2Q6BA 4PQUA 1PJ6A 2FJEB 2ERRA 4DU1A 1S99A 4CK2A 1F6TA 3TUJC 3D0PA 4ZA1A 3D0IE 2I1RA 4K5SA 4LRFA 1I94J 4F3MA 3A8YA 2MQ8A 4AHRA 1Q8IA 2GVDA 2V8VA 2YNFB 3THYB 1JKHB 3KKSA 3QT7A 4DFKA 3NP5A 1PKUA 1ZBFA 2DJWA 2CVEA 2YWKA 3KNGA 5LL6d 3VQEA 3RRHA 4KFBB 2VHGA 4EK2A 2FUG9 3VEVA 2HNYB 2QA1A 3PHEA 2Z1HA 1MMDA 2FVSA 2GTDA 3VN5A 5JICA 1RHQB 2YKAA 1R89A 1T03B 1BA1A 4DSFA 5E26A 2IC3A 3IM8A 2DGWA 4FYXB 2QSWA 3SCKE 3J81O 4FKYA 4IJNA 4BS2A 3L8BA 5B0DA 3PX4A 5IQ6A 3TR5A 2RUSA 3NWGA 4YHHK 4L3QA 3PYFA 3NOCA 4IBNA 2UXCF 3TA1A 1MLAA 1T6CA 4CO2A 1T9YA 3GR0A 3DI6A 1ZA1B 1JNRB 3K89A 4MKYA 1J9AA 1ZAVA 5KT4A 4RW4B 4QPXA 3WC0A 2R2SA 1LNQA 5EXWA 4Q44A 3MWPA 1TKTB 3LGHA 1XMOJ 1EP4B 3GTYX 2EFPA 2IVNA 5K14A 3M6VA 1AFJA 2A6AA 4M5JA 3AAPA 1GT8A 2MSSA 2VPZB 4CGGA 5IV3A 2V63A 3SSSA 2DGTA 4KHRA 4LBPA 4CJEA 3UDVA 2P9NA 3FZ2A 4RBTA 1J5EK 3SPZA 2NQPA 1B7FA 1B64A 1S1VB 1XMQF 1T05A 2EX3A 4NCBA 4GVMA 2E7VA 3PX6A 2OAUA 3KLIA 4DF4A 4OPJA 2E6MA 1SBRA 2IBOA 3TANA 1HHTP 2H54B 2C2EA 5L1LA 1TVRB 1UVIA 3TUIC 2JC1A 3GIMA 3CM5A 3TX0A 3G6YA 1WSIA 5LJ3Y 4RW8B 5I42A 4LF4K 1VHFA 1J5EJ 2DRDA 3V2UC 4H5WA 4WQ4C 3CJRA 3DLKA 3HCXA 2ZH9A 1YVUA 5CD4H 1VQKS 4C23A 3JXUA 1S9EB 3QNOA 1YG0A 5GVQA 2VC0A 1UVJA 3JAMO 3NDKA 3ENQA 4JI5F 1CJUA 3M9MB 5KFGA 4J5OA 3I8BA 4DV1J 1BXNA 4AXJA 1O8BA 2RS8A 2LVWA 5A8KA 4DV6J 4M45A 2O8CA 3A1YG 1K8AO 2RVJA 3LL3A 5J1EA 1X4CA 5GAGU 4B3SK 4JKEA 4LF4J 1HL6A 1S5ZA 3ITHB 3DFEA 2DEIA 3G71N 3HHLD 2E29A 3T1HJ 2H51B 5AQQA 5CZ2A 1RT4A 2HWIA 2K7KA 2D3O1 2W25A 2P6TA 3GWCA 1YXQA 1YJ9S 3QINA 5AQMA 2YPYA 4PPDA 3ZSVA 1IKVA 4LFAJ 1N33K 4LFCK 4CJTA 4JI7F 1SC1B 3SQGA 3I6PA 1GXTA 3BR8A 1VRTA 4FLVA 4ECRA 3WXLA 1NOZA 2QA4N 4C11B 3A2FA 3W8PA 2UVUA 4KPYA 2IVPA 3WUHA 4DSKA 3IWXA 1SJ4P 4OJ1A 2ZM6K 3C16B 3KLHA 3TAGA 1HBNB 1VMBA 3J7AN 3DXBA 2VQEK 3H3NO 2G1DA 3NF6A 2FHOB 3MM8A 2XCPA 4F4WA 4OV6A 1U04A 1NKBA 1YWXA 4E7KA 2FBTA 1RA7A 3QBCA 1YBUA 2E1ZA 2M8HA 1DFDA 3VGMA 4FJ8A 1RAGB 1KAXA 4LR7A 1NDCA 1R59O 4CI6A 3DLBA 3ZZPA 5HJYA 2BJ9A 3CCWA 5M1OA 3C66A 3HL8A 4ZHRB 2B3TB 3GV8B 4NYZA 2P9UB 5FLXU 5B0AA 2Z57B 1BGXT 2FSKA 1U1LA 3CJ8A 4CLLA 4CH1A 2G8UA 4LFAF 4MYUA 1NMDA 1M5HA 5HJXA 2YY3A 3B8AX 4PY5A 3KG1A 4K25A 4EGLA 3RW7A 1BE4A 4OMFG 4KKOB 1MROB 1N5SA 2R7VA 2F8MA 4ED2A 1URNA 3M8ZA 2KO1A 4JKAA 2LLZA 1KLMA 2P8IA 1VQMS 2I6WA 4PYAA 3V1QA 4DTRA 1BC6A 1EB0A 3D2EB 5H9EK 2VUGA 2CNNB 4ZVEA 4F25A 4OZ1A 1RDWX 3KWIA 2VIHA 1WC1A 1AT1B 2AA4A 4X65J 1C1CA 1KDNA 2B56A 1HQEB 4B3MJ 5HOOA 4JI8F 2DXDA 4W5RA 4QS7A 2KXNB 3EEQA 2HHHF 4FF2A 1PYSB 2CGJA 3R3TA 4JI0K 7FDRA 3QATA 4M63A 5AZJB 4YP3A 1KTQA 1RYSA 1VIXA 1GLAG 4ECYA 2DNRA 4DUTA 1DEJA 1HWKA 3G9CA 2FLLA 3CIMA 2HMIB 1NGEA 2YNGB 4H5RA 1S5JA 3U3GA 2QM1A 3AVIA 4WBFA 4JI2J 3DHWC 3OTEA 2ZC4A 5KG7A 2GIRA 4DCOB 1JLEA 2BE2A 3CMEN 1IM4A 1RAEB 4OHVA 1T8EA 2UXDF 4DCPB 3NH2A 3WZ0A 3AD7C 2BTFA 1PO6A 1F9HA 1YZ7A 3KLVA 2I5JB 4JI0J 1JK9B 4FPAA 2OTJN 2QG9B 1BUPA 3EZUA 1RK8A 4DPOA 5MLCV 2WW8A 4HWIA 2DVIA 4CH7A 1Y5IB 2IIHA 3TEGA 3NEKA 3ET6A 4A57A 2B4OA 3TQEA 5KFPA 3R6GB 2CG4A 4E3SA 5AJ3J 1U45A 2OI2A 4FPIA 3K0JA 4OLBA 4BGAA 2CQ2A 4ICLB 3TW0A 3ZSYA 3VQ8A 4X66K 3UCUP 3KDNA 2EWSA 2R2RA 4BWJA 4OYZA 3W9HA 2X78A 3CF5L 2ZH3A 4QBUA 4FJ5A 1WKKA 1AFIA 4F4AA 2GHWA 2C3YA 4GO5X 2CQ0A 1TV6A 2IVOA 2DB1A 4ANEA 3HHEA 3MWTA 1QS4A 4Y2AA 3AH6A 1UW9A 3FSYA 2AGPA 2CJXB 4CF8A 1OYDA 2QWPA 3PG9A 2QJ3A 4GKKJ 2Z1IA 4UTGA 1RAIB 4X66J 3DGPA 3D0HE 3I55N 3SQ4A 4BRLA 5J2NB 1Y0HA 2EG2A 1ZBSA 3M3ZA 3NMUA 3OR1A 3L0QA 1WOOA 1YT3A 1A5XA 3OXLA 2WAQD 2XS5A 3LF0A 1TL3A 4ILLA 4K4ZA 1T11A 3K2PA 4AL5A 2HYIB 1RTIB 4ETXA 2WVDA 1LV5A 4Y34A 2RNEA 3M4XA 3BH7B 2D9PA 4ZIVA 1NPKA 1Y3JA 4F2SA 4PQAA 1G15A 3R6MA 3MAAA 1BOTO 4H8KA 3CYMA 2RU9A 5ETOA 2CNKB 1FKPA 3T6JA 4M3WA 4DLEA 1Z4UA 3ZSRA 2JLGA 3DN9A 2JDJA 3H5YA 1S6OA 1RQ0A 4GVBB 3VTHA 3SQ0A 2FD2A 2KZZA 5KG3A 5KFEA 1YIJN 1N52B 1CULA 5SUHA 3HVRA 3WXMB 3SDEB 5K8OA 2YNIA 2OANA 2V8HA 4X4QA 4U96A 3C15B 3EXYA 2C2RA 2V5HG 2X6SA 5BYSA 4A48A 4O8UA 4AQYJ 3NNCA 2RD5C 4IKFA 4W5NA 2QTWA 4DU3A 4CLFA 3P38A 3P4IA 1F5AA 4A59A 4NLVA 3UO0A 5A2QO 1BLUA 2O67A 3VQ4A 3KKRA 1IUJA 4J9VA 4TYAA 1YHQS 1HNVB 5LSRA 3V6DB 4WF9Q 3JSMB 4HKQA 1WACA 4CBUA 3OD2A 2CVIA 3DWLA 4DQIA 2E5LJ 3C3LA 3AA4A 2PEBA 4BE2A 3J7ZT 1W9HA 2VB6A 1FHTA 5CA5A 2C3UA 2CPEA 3NAEA 3GFXA 3BZQA 5K8PA 4Z4GA 3IXQA 5FRMA 1A9NB 1OH7A 2DH8A 2F40A 3US5A 2YKQA 5D0HA 1WWHA 5CY4A 5ETMA 3BSOA 1NJXA 1O51A 1QAXA 4QU6A 6FD1A 3I56S 4KHPK 2CQCA 2C22A 4ZOSA 3E3XA 3WIVA 4XPCA 2DBBA 2JC0A 4MK8A 1UPMB 1JJ4A 5M2RA 3TABA 4GKJF 2CJQA 5DZ6A 1PSDA 5E3AA 4DU4A 3MM7B 4DU8A 4USIA 4QWCA 3IG1A 1P8GA 1S1XB 4ECUA 3W62A 4DPWA 4AQYF 1RT7B 5EX0A 1JNZB 3G4SS 1P6TA 2XMKA 2B8QA 3R27A 3R1LA 4I1TA 1XHZA 3EVOA 1BHLA 1S1WB 3SBTA 5KFBA 4C3MA 1RDDA 3IKMA 3THWB 4B3RK 4MKBA 1NJIO 4NXNK 4CLUA 3KK7A 2DFHA 2P9LB 1Z2ZA 1ZH5A 3U4LA 3E51A 3KJVA 1IJFB 2BANA 2K8GA 2VPYB 2RRAA 4C8MA 2MXYA 2OHDA 2MQOA 2XWYA 3HHNB 1RHRB 3RAQA 4Z4CA 3LUYA 4U9RA 4YOXA 4KB1A 1EAYC 1ASVA 2Q1NA 4CJ7A 2H65B 2M70A 3H3OB 1U2VA 1K0TA 1IR0A 4EBEA 5FLXY 3JSRA 4F7VA 5JVGL 3ZTSA 4FP9A 3J81j 1QQCA 1ZBLA 1MMNA 4OX9F 1RTJA 2V52B 5GAHI 3G2XA 2ZZTA 1RDUA 3R1XA 4DV3F 1JLCA 4M63C 4CHZA 4CE9A 1D9AA 2KB2A 1WHYA 3GIRA 1S6UA 5CCMA 3CJAA 1JLFB 2P9KB 4Y2KA 2FBVA 5D0GA 3CMAS 2DR9A 1VRUA 5KFJA 5JVGQ 3DRPB 1QTNB 3J7A1 4CNZA 2YHYA 2PFFB 3KNAA 2M4MA 4E7JA 3ZSQA 1GLFO 1CLQA 4RW9B 4P52A 3HJFA 4B02A 1WD6A 4ED8A 3B8HA 3RGIA 3LPTA 2MJNA 2ZJQL 3CD5A 1U8SA 4MQ3A 4DUZJ 1FA0A 4X4PA 2RAQA 4CEOA 5H9FJ 1UAXA 3VQ7A 2HRUA 2NUHA 1KVBA 4GVEA 4DLGA 3CHWA 3EPGA 2EHGA 1QAIA 5IT4A 1BISA 2RE1A 4YEAA 6FDRA 4O44B 2CGLA 4WFXA 2EK1A 2ACYA 4E1JA 2I2YA 1L3VA 2A1SA 3KLEB 1HR0J 1FX4A 2E2PA 3RR7A 3ULEA 2XLIA 2KW4A 4HTUA 4FK2A 5K20B 1VQ5S 4PXEA 4LIWA 2LQBA 3OTOJ 2RF2A 4BC7A 4GC7A 3TRGA 2BJ3A 5KFMA 4IRKA 4FN5A 3NLCA 4FYWB 3MUVP 4JI6F 3OYIA 2X3GA 1HNZK 2M9KA 4KGXB 1TK5A 4TU7A 2MKIA 4B3TJ 3G96A 4DV7K 3ZZOA 5KRTA 4DR1J 2JNJA 3QFHA 4AUKA 1OY8A 4CTAB 2OGUA 1S72N 4WFBL 1DLOB 1QJHA 2R7SA 5DS7A 4EBCA 2RH3A 5DG8A 4EMDA 4WIIA 3OS2A 2YWHA 1IVZA 4DUZF 4F02A 1T9UA 3OLAA 1E6YA 3H25A 2MSTA 3MDFA 4YUDA 4FNIA 3I5CA 3QT6A 3EUNA 5K9FA 4F3QA 4K4VA 2BUPA 4X4SA 4JV5F 3THTA 2ZH5A 3KTQA 4MK7A 3HSTB 1V3RA 3EKUA 1HNZJ 4MDAA 2DTUA 3LP1B 2VWBA 4M5MA 5B0BA 9RUBA 2HRYA 3ALYA 4ZPAA 4OYOA 1TK0A 4K59A 4F36A 4TKTA 2YNFA 2DY4A 3THYA 2E1AA 1JKHA 4FYVB 3KK3B 1VQNN 3U1MA 3H46O 3DHXA 2KI2A 2LEPA 4KFBA 4ZPTR 3H20A 2HNYA 5CHIA 4CIFA 3Q7CA 3I0RB 4E19A 2V2KA 3HVAA 1T03A 3A8EA 4C8LA 1KC8O 4Y65A 1T7PA 3CDWA 3AVMA 3CCMN 4LR9A 4LF9K 2BJDA 1HWIA 2LXFA 2CKWA 4LF7J 4DI6A 1NGDA 3UDEA 4FM0A 4MYTA 5HROB 1C0GA 2KDOA 3ENHA 3P5BP 1VSMA 3QRRA 4DL5A 2DHSA 3E8OA 1EARA 1RYRA 4RW4A 2BXJA 3FBBA 2QWRA 2VZ9A 1U6ZA 4O55A 4TLRA 2YKNB 4KC5A 5M1QA 4CJUA 4WKYA 1TKTA 2ZBRA 2D4WA 1EP4A 2Z2ZA 1TL5A 2M8DB 3OQ2A 3LWMA 2MHEA 3R5AA 3RG6A 4LF9J 2EC2A 3T5KA 3NGKA 2O5DA 3N5BA 3OS1A 4YOTA 4CWBA 3VQAA 2NXEA 1QSSA 3I4HX 1KRPA 4H03B 3C0BA 4M42A 4K43A 1VBKA 2VG7B 4A5BA 5EWEA 4QU7A 4HUEA 3AA8A 1S1VA 1M1KT 1R8HA 1ZZFA 1TYQB 2LQ8A 3NGUA 3W2VB 5LSLA 3VQTA 5ETNA 3MWBA 3CWJA 4LF8J 2DIUA 8ATCB 1K44A 3C8YA 1TVRA 1KOOA 3TTFA 3PYEA 3NE6A 5DLGA 1CS4B 2BV3A 1X4GA 2ZDOA 1EIYB 5KRSA 1WELA 3CD6N 2OTLS 4RW8A 4FO0A 4JI4J 2GO8A 3I31A 4GV9A 3UDCA 4XPEA 3BPDA 1UPPA 3D0GE 4ZVQB 2VFUA 4OGEA 1C6VA 5E0OA 3CDAA 1VSEA 4NLOA 2QWLA 3SK3A 2DY1A 3C95A 1S9EA 3M6UA 1TUGB 1SB6A 3CC2S 3UN2A 2ZWOA 1SL0A 1ATSA 3FQKA 4KJIA 2DCLA 3ATUA 2ZH7A 4YB1P 2BOAA 2CA9A 3Q8UA 4DS5A 1LK5A 3EKSA 5KFKA 3ITHA 2HW3A 3VR1A 1RSCA 4H4OA 3X3UA 1G99A 3NHGA 1GLJO 2VQFJ 5IT9U 3HD1A 1VQLN 4ISGA 3KLFB 1VQON 3AD8C 1FRIA 3HOSA 1CPZA 4EYHB 2IGIA 2CQDA 1WKLA 2RHSB 3NF8A 2IJFA 3CCQS 5JS1A 3RW6A 5I3QA 4B08A 2V9WA 2ZH8A 1WOQA 4UT4A 3BBCA 3BEXA 2PYLA 1HNXJ 4O3OA 4CFAA 2W9CB 4C11A 5L9NA 2QWMA 2MEWA 3I4PA 3UE5A 2ZFHA 2NRWA 3L3CA 4LH4A 1XJWB 3G6XA 2FVCA 3SNNA 1DBDA 5M1KA 1ROFA 3C16A 4NZ0A 5K8NA 2G9OA 2L08A 1HBNA 3AA5X 4A2AA 4K4SA 1CC8A 3OJUA 4H0TB 3EY1A 1YJUA 4C3LA 4M3ZA 3Q23A 3JTOA 5ADXA 3FCWA 2L41A 1VQ4S 3NNHA 2C3MA 4FF3A 1RGIA 4LVOP 5AQKA 4IG3B 4MT1A 2OJ3A 4DR6K 4X4TA 2UVRA 3RRGA 3NF7A 3WNEA 2LECA 5KPRA 3GONA 4ZHRA 2HHUA 1B0VA 3QBWA 1SH2A 1NK6A 2P9UA 5DM6Q 4FJJA 4DL6A 3M30B 1G1XA 2RB7A 1IXKA 1EX8A 1HI0P 1S7IA 1NUEA 4JK9A 2AYGA 3GCXP 4LIRA 4YR3A 3OSNA 1EETB 4LD0A 4OPKA 4X4UA 2XRIA 1MROA 5FJ4A 2YWFA 5M2PA 4YHHF 4DR6J 4DV4J 3DXMB 3SQOP 2VKRA 2WVBA 1UEUA 5L9XA 3TPQA 4ZP8A 3MCPA 2QX0A 4KH0B 1HKAA 2LA6A 3A8IA 3LAKA 2KHCA 3EGZA 2CADA 4CJQA 1XNRK 1NGIA 3D2EA 2MKHA 3NMAA 2G2ZA 3Q22A 4LF6K 2XO6A 4JKBA 1WSHA 4NLCA 4OX6A 3ZO7A 3JTPA 3FJ2A 3ZETB 2VD3A 1GLCG 2B4PA 3BB5A 2HFUA 3MMVA 1TKDA 1MU2B 1YUWA 5C7PA 1HQEA 1KD1O 1YJ7A 4Z94A 5JVHL 1U2RA 3MD3A 2VG6B 1UAWA 2M7SA 5B7WA 4LF5J 2ETJA 3CCUN 4JK7A 2EWHA 3FLCO 1VYAA 1N36K 4LQ9A 5AZJA 5LMUK 5LJVA 2D3UA 2HMIA 2YNGA 2KHOA 3OL8A 3GILA 1HHSA 3PZPA 3MPUB 2QEXS 2E44A 4ITSA 3L6QA 1NDLA 5KFDA 1EQ0A 4DV4F 1WB9A 2E2OA 2I5JA 2Q1LA 4BY9C 3OL6A 2WBMA 2FLPA 4IOAL 4M3RA 2BM0A 5GAEP 1B3TA 1R8AA 3KUEA 3JS6A 1IJEB 1XBWA 4CGIA 2J8AA 1FK9B 1PC5A 2BKPA 3EGNA 1B9DA 4BE1A 5ETTA 3CFRA 4HVZA 4JB8B 3LO3A 1NBWA 3GYXB 2CNLB 3LDQA 3G86A 2JEFA 3B6BA 1TUUA 3KG4A 4YR0A 4MK9A 1K47A 2O8BB 5KFYA 4ID5B 4B3SF 1XNQK 3SCXA 1T94A 3NCIA 4ICLA 3OA9A 3BDPA 3CCVN 2W1BA 1W7AA 3QNWB 4L73A 5KG1A 2MMYA 3DRYA 4J91A 1QAYA 4FS2A 4FVCA 1KVKA 4KHUA 2HHTA 1CVJA 2L9DA 3PX0A 1WC5A 2D1CA 2ASOA 1FNXH 2GCFA 4BR7A 2IDEA 2BKOA 4LF5F 1FJGK 3HOTA 3TUPA 4QIGA 4ELUA 2IYIA 2DHAA 3HHLC 2A6OA 2R2UA 1UFWA 1N33F 3J80O 1Y00A 1ZBIA 1BIUA 3GG4A 3HP6A 4LFCF 1QQNA 2QA2A 2IBKA 1FFWB 2YQ3A 1GX5A 3MCAB 1GMVA 4K8RA 1SS6A 1DURA 4FNHA 1N48A 1NH7A 1NPPA 1LWCB 3O3LA 4I68A 2XCAA 4CVNE 5GMDA 5J2NA 1V4TA 4DQSA 4YNQA 1XERA 3MEKA 3PCOB 4C1NK 2ZM6F 3UN3A 3DOMB 1WHWA 4BWMA 2ASLA 4IFYB 1RTIA 2GW8A 5F8LA 1KSPA 3FK4A 2RMLA 3U1LA 1H2UX 3MM9B 1XMBA 1YJVA 3VEXA 2VQEF 4FWRA 3QETA 2ZUGA 2ALZA 4OZ5A 1IO2A 2V6AA 3BUZB 4IRDA 1VQYA 4KV8B 3WNHA 3KMSA 3O9TA 3EWGA 4GVBA 5DM7Q 2NREA 3TWZA 4CESA 3WNFA 2OEKA 3AGKA 3SDEA 1U24A 3M8RA 2Q97A 3P5JA 3GOIA 3R5BA 1S9GB 3N9UC 1N54B 1LFWA 4J7CA 5HBMB 3C15A 3FRYA 3MI7X 1F9EB 1JJCB 2LFVA 3W66A 3OL7A 4K4TA 3PXGa 3PVXA 2D1KA 4OHZA 2YH1A 4WQ5A 2HHVA 1QZ6A 3NGTA 1V3SA 1PILA 5HL7L 1HNVA 1LW0B 3V6DA 3JSMA 1UEVA 4AT1B 3OYDA 5D3GB 5AQXA 2XC9A 1NBEB 2OD4A 4DQPA 4UUXA 3QGIA 2I38A 4DTSA 1WTFA 1V9OA 1Q82T 1ITPA 2O8EB 1EWRA 5BPLA 3QZ7A 3O6QA 3FBEA 1WSGA 1CJVB 5HL7Q 4A8OA 3BF1A 3MM5B 1PC4A 1RKIA 1GH8A 5CAAA 5IT9Y 4DL7A 3VQQA 1UETA 4J9OA 1BHNA 2FIUA 2ASJA 2Z56B 4NZ7A 4W90B 4OZ2A 4IOXA 1C4CA 1OPIA 4RBUA 4WFZA 2F4VF 1YITN 4JKDA 1QVGM 1N5YB 4XDDA 5HRSA 2UXBK 2DR5A 4O3SA 3W8GA 3MM7A 2I8EA 4K4XA 4YB7A 3SAHA 4J90A 2DITA 1KEKA 1S1XA 2O8FB 4GW6A 4F50A 4QS8A 2NPFA 3MMJA 1RT7A 3AO4A 1HNWK 4USMA 1FO1A 4K4YA 2YX6A 1NEEA 3AQPA 3PACA 4ED7A 4E2FB 5E7OB 4I64A 3J81U 3OVSA 3HZGA 2FVRA 4PG7A 2RT3A 1S1WA 3CSKA 3BP8A 2V94A 3THWA 1VFJA 2JVRA 4QIWD 5HQ8A 3B6OA 2P9LA 4DR4J 3QWUA 2F3JA 3RSEB 3WIUA 1H3DA 2NXUA 4Q8EA 3BZCA 1YK9A 3BS9A 5BXIA 4XH4A 5HMZA 1RWVB 4H4KC 4JS5A 5BRHA 1KN6A 3FBCA 4L6V3 5IQQA 2HFNA 2ZZNA 4IOCL 2H48B 3CC4S 4O8KA 1JLQB 3ZCMA 4FLYA 3NG8A 2GQ2A 1IBLJ 4DXLA 3R8YA 5CABA 1KXPA 5IC4B 3MPVA 2MLXA 4D3HA 1SCJB 1WNEA 1R6YA 4F0KA 1F21A 5D77A 3F0NA 4OKEA 1LAWA 4K2JA 1K9MT 1U25A 4BR9A 1JLFA 5ETSA 4DV5J 4BRKA 2P9KA 3HJVA 2FLNA 4CYUB 4DR5J 3Q8QB 4X64J 3UR3C 2XSJB 3AQOA 2NRRA 3OFGA 3DRPA 1A5WA 1QVGR 2H3EB 4Z4EA 4FWPA 4R79A 1RADB 4RW9A 2GVZB 4QCLA 5IWAJ 3RZAA 3DDIA 3O9SA 5JMNA 5F0WA 4QIEA 4QOZB 4KHWA 1WJ9A 2E7WA 3ELHA 4IO9L 3OSPA 2OIHA 5M1FA 3FUYA 5ETLA 3H5XA 3LTOA 2MQLA 5GAEU 1RBVA 3CQYA 2QN6B 4IWVA 2V51B 1CJTB 1XTZA 1QVFM 4DR4F 1GXUA 1TL7B 3U9DA 3JB9k 4UY8T 4KT0C 1ASUA 5D8HB 3AVCA 1LOTB 2B9XA 3HKWA 5AQZA 3JAMU 3M7VA 5ETRA 4BHQA 4DKWA 3SPYA 4O44A 2BGGA 4FW1A 1A7GE 3BGUA 4DZDA 4UQTA 2AEMA 2DGQA 1ZTWA 2YPZA 3SMZA 3GZ7A 5IS2A 3PV8A 4ED0A 3KLEA 5L38A 4BR2A 1SXLA 3SFGA 2LEBA 4OJGA 4WK3A 1BQXA 4LF2A 3AA3A 2OP5A 4P71A 2WC9A 2WB4A 4J9NA 4DR5F 2AYBA 1NGAA 1IM6A 3O1BA 2BRLA 3TZWA 3A0IX 4PL8A 1WOPA 4Z37A 3FFKB 4C3KA 1RTHB 2KN4A 1L3TA 2GWJA 3OBWA 1FX2A 4NXMK 2NRZA 3OXGA 1YRTA 4UUWA 4F26A 2CWKA 5HSPA 2B43A 4CTAA 1SJ3P 3UNYA 4I6AA 3QT8A 1DLOA 5D0EA 4CJ4A 3O3HA 3PHTA 1K8KB 2BH1A 3SBMA 4KHSA 4LR8A 3FGUA 4J2BA 1MWKA 2ZOGA 4ILRA 3M8WA 4DJBA 1N8RO 5HLFA 1Y4ZB 1JLGB 2RDDA 2MKKA 3FKBA 1Y5NB 4YQWA 3J7AP 4Y1DA 3AVHA 4C98A 3E01B 1EQMA 4KHPF 4AH9A 2OFGX 3D67A 4P72A 3AAQA 3UDLA 2JX2A 3THPA 3LP1A 4X62F 3PR4A 1QVFR 3CCRN 4IUFA 4DPXA 5DZ7A 3H98A 2ADCA 3BGRB 3S3NA 4HEA9 3N4QA 1HBOB 1QHAA 4FXWA 3TVKA 4DF8A 1SUQA 2RHQB 3KK3A 1QUVA 3P83D 2UUAK 2OA8A 1N34J 3OHBA 1T02A 2ILZA 4HH0A 4HTJA 3P31A 3DRSB 4DUYJ 5HATA 2UUCJ 4I69A 4DL4A 4ID1A 5I3UB 1RCHA 3NGSA 3I0RA 2UYTA 2MQQA 5FPNA 4CO4A 3OYHA 4X4NA 2DHHA 4W5OA 3V9UA 3ENVA 3GV5B 2G8WA 1SC6A 3TOQA 5AXNA 3K8WA 2HQ3A 4M7XA 4B3RF 4ZJQA 3HXMA 4YDDB 1KCFA 3HVTB 1S77D 2O66A 3KVGA 5HROA 4DQ8A 4FPBA 3ZT0A 2O1PA 2W42A 3THXA 4PA1A 1M90O 1Q81O 1CQMA 4DFMA 1VQ6S 2YKNA 1NJZA 2KT2A 3QEVA 4E89A 4HHHA 4OO1J 4DR7F 2VODA 2FHJA 2AP6A 1KTVA 3I0SB 1S6QB 1PJ7A 3VPZA 1HKBA 4FBUA 1S97A 1RT2B 4XDCA 2VGNA 3I96A 4NCAA 4DG1B 2ZH6A 1NNEA 2R7OA 2VG7A 1K1SA 2HMPA 2WCXA 1TYQA 3H6EA 2W9AA 4KRWA 4NLQA 3W2VA 5HQLA 2HNDB 3MCOA 2CQIA 1EXQA 1GLBG 4TLQA 3QNNA 5IV4A 1S79A 3CJ4A 3HRGA 5TKWA 2CJBA 1N32J 4O3RA 3M5RA 3FEYB 1CS4A 3CCSN 4Y1CA 3AY9A 3OFEA 3RMAA 1ESVA 4NO7A 1XN9A 1LEOA 1U26A 3B6PA 1DQ9A 5IOLA 1AW0A 4E7LA 1TZ0A 4Y3CA 1WKJA 4NYNA 1YTUA 3PEJA 2UZAA 5AT1B 3IAYA 3TTCA 2C28A 2V67A 1X9JA 4FOIA 2AJFE 3VVTA 1KAYA 2R3VA 3HTVA 4CZGA 3OYMA 3E9PA 1YQHA 3GB0A 2HEKA 4PUOB 2XM3A 4NMXA 1WSVA 5DRKA 3EM1A 1VSHA 4PKDB 1VC0A 3CCJS 5THWA 4HCCA 3ZT3A 2V2ZA 1SZ2A 4PWWA 3NS6A 3ILJA 3WT0A 1U6BA 4CLSA 3M9OB 2UUBJ 1OS5A 3QEXA 3BQ0A 4BCAA 4H0PA 2E5GA 1BY9A 1RU1A 3IWLA 2ASDA 2DISA 3KLFA 2HHWA 5AQHA 3KXDA 2CJYB 2VJUA 3ZNUA 3MMCB 3J81Y 1BWEA 2GQQA 4C2MA 2PN6A 4P73A 5L1IA 2EBGA 5ETPA 4NLRA 2JEIA 2W8LA 3T1YJ 4ZPBA 3E66A 1U1RA 2NRVA 2DNMA 2JSXA 4DV7F 1VHIA 1YVFA 2Q43A 1WG1A 1T9TA 2W9CA 2CH5A 4A47A 3EJMA 4ZVFA 2XMVA 2C2ZB 1Q53A 1HX1A 2MDAA 4IZ9A 2M5YA 3MECB 3O9QA 4N56A 2H1YA 2J5AA 4RL1A 4FLWA 1JJHA 3O1WA 1W97L 2EFQA 3LM9A 2KL8A 1NSQA 3TZZA 4NEYA 1NK7A 2Z1JA 5HAOA 1UTAA 4NZ6A 2COLA 1S49A 2IM0A 3NF9A 5B0CA 2HSEB 1UP1A 1WEZA 2EG1A 1GFWB 4ELTA 1OQ6A 1HYSB 1WBBA 2ZDPA 5FPEA 5DK5A 3S7RA 3TYTA 3O4NA 4IG3A 4NLWA 4ENOA 3A8JA 3ZZZA 2MQNA 3D1HA 4FJIA 2LEAA 4HDHA 4CIEA 1LKZA 3GQCA 3MEGB 4WTOB 1YBTA 3MPYA 1BD6A 2X51A 4HDGA 1LWFB 4H0VB 3LWLA 4A8WA 5KPTA 2APOA 3M30A 3SSQA 4CLYA 2KTQA 2LSNA 2E1CA 1X60A 1P1LA 5J2MB 1DTTB 1XQSC 3KK2B 1H74A 4PKHA 4OPHA 1FEEA 1Q86O 1EETA 3LGMA 2A5XA 4E98A 5DDOC 4F9OA 2DFEA 3DXMA 4JRPA 3T19A 3IN5A 3JAMY 5A2QU 2BE2B 1O0PA 4CK1A 3NGDA 3GJQB 3TNVA 4B8AB 2F4FA 4FJMA 2CIMA 2A42A 1RBSA 3KHGA 4ZCMA 1TAUA 1XIQA 3CVKA 4TYBA 4DR2K 4DU7A 1RHJB 4JYAK 1S6PB 3P96A 2ZH2A 1X4AA 3ZETA 1R27B 3VQ9A 4OHYA 3RBDA 4M8LA 4OYAA 2HK3A 4B1WB 1VI7A 1MU2A 3UB5A 1QQMA 2YWEA 3NNAA 1RXOB 2XSFA 4A8SA 4NPOA 4AL7A 3JXOA 4CJPA 2GHPA 4ZVPB 1U48A 2RE2A 2VG6A 4M41A 5M2UA 2OMLA 2X3DA 2B8PA 5F8HA 4JI3K 2IRUA 1FRXA 2KVIA 1SL2A 2DY9A 4DR2J 1FRKA 4PABA 4DDFA 2BQ3A 1NGGA 3FZHA 5EOYA 2B51A 1KONA 4M94A 4KB0A 1SKSA 1NLVA 1W2BM 2SXLA 3VWSA 5DG9A 2QMXA 2WFBA 3O4QA 1TFWA 1U47A 2XI3A 4LFBK 3VCDA 4OLAA 3TVYA 1FK9A 1CXQA 4FVUA 5B08A 2CH6A 1GLDG 1IBMJ 3CJCA 2UU9J 3AGRA 2CXEA 1AUSL 1VCTA 4G9ZA 2Z2MA 4OI0A 2O8BA 4ID5A 4YOVA 4JN4A 3HD2A 2W7OA 3GE9A 3FC9A 2P9SB 3LDLA 1WSJA 3HX9A 2IAJB 1K0VA 2V2QA 4EU0A 3HKZD 3KIOA 3UVJB 2AW0A 4ZVSB 1SI9A 4DV2K 2JVOA 1JCEA 1FKOB 4FLTA 2YV0X 2CRLA 4DV0J 4HT7A 1N5QA 1I51B 3HDSA 3RB0A 2PDAA 1HIYA 4DSIA 1FRJA 4F3OA 3ZX0A 4OKKA 1Q79A 3MGJA 4OYBA 4RUCA 5GIOA 2DNOA 1T9XA 1VDHA 2HS3A 4QIVA 5LJ5Y 2XMUA 7AT1B 3S8SA 1PAEX 1WEYA 4BC3A 4QYZJ 3KHHA 3ZZUA 4OL8A 3NH1A 4PWDB 2AT1B 3SSRA 4CEBA 1LWCA 3N0VA 1HARA 2A10A 5HMWA 2NYIA 4BQZA 3ENWA 2PBDA 4CBWA 1H72C 1RBAA 3ZNJ1 1UA0A 2JLEA 3DOMA 1WC4A 4FM1A 4Q0BB 3MCMA 2O4GA 4IFYA 1LW2B 5FD1A 2F9TA 4RWWA 1W2BR 2JFDA 3L4QA 2L3MA 1SH3A 3MM9A 4K8XA 2HFSA 1VQ7N 3CCES 1T9VA 4YDUC 5H1SQ 1FXRA 1HRHA 4JV1A 3ISND 1X4FA 2QTDA 2HQDA 2PC6A 4NOHA 4KV8A 1RWKB 4LSLB 1U1MA 4WYLA 4I6MB 1EZZB 3QBXA 3BJYA 2PFDA 1D8YA 2XHCA 2UUWA 4URQU 1BO5O 4FWOA 4KBIA 1ITGA 2AEFA 4TY9A 4DX8H 5AQPA 1S9GA 4J9QA 3PYGA 3D7SB 1P27B 5HBMA 4K0KF 1NAQA 2R7QA 5LMNJ 4EFAC 1IBKK 2ZWHA 4DX6A 5BRDA 2LA4A 3CXCM 2N7YA 2VL1A 2ZOMA 4ZPDA 4MH8A 3DJCA 3PJWA 2P6SA 3A4TA 1RA6A 8AT1B 1Q8BA 3G82B 3I82A 5CYQB 1LW0A 4ECZA 2D0BA 5D3GA 1UZDA 5ADZA 4OVLA 4K42A 1VC6A 2DR8A 2E66A 1V5VA 4H5VA 2G8IA 5E33A 3BF3A 3CULA 3M6WA 2RSQA 1Q7YT 4LF6F 4WQ4A 4IYQA 4LQ3A 4LSNB 4CFDA 2O8EA 5KFNA 2YHWA 3D3CJ 1GMWD 3R5GA 2P9EA 1CJVA 3PIOL 5GADP 3MM5A 4OYIA 4W4MA 1ZBHA 1XEZA 3WXKA 4QWAA 1U0HB 4G3IA 4G1PA 4B3OB 3CC7N 3NY0A 4FWLA 3FMBA 3QFPA 4DL2A 1KHVA 1VSFA 1N5YA 1N36F 1KQGB 3KHRA 2ZJPL 2DTJA 2DH9A 1JLCB 4C4WA 3CJKB 2J9EA 4I7FB 3CPWM 2E88A 2O8FA 2RQMA 5LMNF 2YVSA 4NYOA 2L9NA 4J9PA 3UKRB 1G4CA 5BYRA 5KT2A 2HHPA 2C2MB 2Y1RI 2IHR1 3H40A 1RE1B 3LAMA 3W63A 1Z1ZA 2V34A 4XIUA 1NZ8A 3DU6A 1RB0A 2MZRA 5AQRA 1PG5B 3CXCR 3PLAA 4AF1A 2N3OA 3RSEA 2GC8A 3ZZ0A 2C42A 2BUNA 1U4BA 1L3SA 4S0MA 2HBLA 4ZLPA 4EO6A 4JK8A 2IIRA 2IM2A 3HPHA 1XNQF 5GMKa 1JLQA 4E0DA 2W41A 4K50A 3A3OB 2WVEA 2PYJA 1NM2A 1SAZA 4J2DA 1IKYB 2QWQA 2XO7A 5CYMB 2OPRA 3LANA 5DQGA 1WSRA 5KOWA 3MOZA 1ZM2A 4I9QA 1GX6A 4W5TA 1Q4RA 1FE4A 3ZZYA 2QXFA 3G25A 3D5MA 4CYUA 4RW6B 2XSJA 5A2QY 3D68A 4EHUA 4YY3K 2M88A 5B0EA 2BYCA 3RAXA 2RF2B 1KFSA 4QJVA 3B54A 1CZBA 2GVZA 3MMAB 3L2VA 2GBZA 3CPWR 4H0YB 1RBTA 4FLZA 3CCLS 2N82B 3FR0A 1YTAA 4U7CA 1ZOTA 3MUMP 2UXCJ 3MEDB 2L48A 1UFKA 2R7YA 4TXSA 2ZH1A 4FWQA 2ITGA 2PZSA 1CJTA 2NZ4A 2LU2A 4PG6A 1TL7A 4O4RA 3E1YA 3J7YP 4RTFD 2R7XA 5DDQC 2CDQA 2GO9A 2W40A 2ZBIA 4QAGA 2VASA 1VQ9S 3NGYA 3Q83A 2ZQBA 3NCQA 4IQMA 1RAJA 3PYDA 1YI2S 2ZH4A 2W6KA 4FYYB 4XO0A 1URRA 4EEYA 4BQLA 1GLLO 2Z2YB 5AXMA 4E7HA 2XY7A 2OEMA 3CNQP 5F3TA 4X4RA 3KUHA 4GVLA 1C1BB 5EUHA 1CSJA 5BR8J 3BO2A 4PZVA 1VQKN 4IEIA 1FI4A 5J1NA 3E9LA 1XMQJ 3IRXB 3GFZA 3PW4A 2LXIA 2YKOA 5KG6A 2VYPA 3M8PB 2KJVA 4BR4A 3B4MA 3TSUA 4BRCA 2M0GB 4ZP6A 4YB6A 4BRPA 4JI5K 1RTHA 3LDSA 2IJNA 2W7PA 1XMOK 4UQGA 4ISFA 2QZ8A 2F9DA 4DR3F 4CBXA 2Z1GA 1K8KA 5HMYA 1P8ZA 1KC8T 2GELA 2WZ1A 1YJ9N 1JLGA 2FVQA 4ZPVR 2EFOA 2AJ1A 1Y3KA 1JX4A 3GG0A 2XNQA 4JI5J 5LXRA 2RQ4A 3E01A 3MXHP 4JBCA 1WN7A 4UOHA 4IG0B 1TL4A 2KXHA 4O0IA 3GBTA 3EDRB 3BN4A 4N41A 3BGRA 2ZWPA 2FYXA 1VSLA 1M5OC 4JI7K 3AXKA 1HBOA 4XAKA 2WOMB 4M3YA 2Z0GA 2PY5A 2UXBF 1PJ5A 1YAGA 4WIQA 2NLXA 1EX4A 5BR8F 3PKYA 3GU0A 1LWXA 3DM2B 3EXCX 4LF1A 3HT3A 1C4AA 4QOTA 2Q36A 3ID6A 4K4WA 1DQ8A 3DRSA 4LT6A 5I3UA 4OQJA 3HVWA 5AQUA 2NNWA 1HNWF 2N7CA 2VA3A 4W92B 4AHTA 3HHLB 4C8KA 4DS4A 3CIPA 3F2KA 2KFZA 4DV1K 1UEKA 5KAKA 4JI7J 2RHKA 4DEZA 1S1UB 1UWBB 1ILYA 4WZQA 4DV6K 2Y8WA 3MXJA 1G7CB 1ZYQA 3HVTA 1HI8A 2EFGA 3EZWA 2Y1JA 4JI1F 3QGGA 3ZSZA 3QJLA 3MPDA 4QPTA 3AVBA 2C2NA 4CZMA 3HSZA 3OV7A 4IH6A 4BG9A 1WUUA 2ZUAA 5KI6A 3T1HK 1B70B 2GGPB 3FSIA 3I0SA 1S6QA 3A13A 4KI4A 1VC5A 3G6ES 4M5DB 5GADU 1RT2A 1I5OB 2RILA 4DG1A 1NDKA 2UUTA 4LFAK 5GAGI 1WSEA 2XB2D 3VEYA 2GMJA 2K7JA 3O9RA 1VQMN 1NHUA 1HKGA 3ZX2A 1HWJA 1WNSA 2GNKA 4CLKA 1W2IA 1NGFA 3D6TB 4H4OB 2X74A 3Q8PB 4YOWA 3OFFA 2IY5B 4Q2LA 4URGA 2FBXA 2W9BB 2HNDA 2Y8YA 1V5IB 4FYDA 1CQNA 1D1UA 4ECQA 3AA9A 1APSA 3OW2M 4IQXA 1OQ3A 4UF4A 2YHXA 4ECSA 3R5JB 1HPZB 1FT8A 3FFIB 4BG8A 3VGLA 3PY8A 4IR9A 3HFKA 1HQUB 5ITHA 3QFUA 1JL2A 2MTLA 1SJFA 2BQUA 2C3OA 2ZHBA 1TMMA 3D2WA 2DD8S 1SJ1A 4JI8K 4CO1A 2QMWA 2V8DA 2VG5B 4BRQA 1HW8A 3THVA 4BBYA 1GOAA 3ZXWA 1SV5B 5CD4A 3NKYA 4KQZA 2QWNA 2W2QP 4QS9A 3IUCA 4HVJA 3TJAA 1WLJA 2CQGA 4PUOA 4U67Q 1G3OA 2DFFA 2HQCA 1NK8A 3F41A 2FJXA 4CF2A 4BLGA 5M1PA 1WC3A 4WZMA 3E2EA 4XH5A 3DAWA 4XTTA 2P9CA 5CE3A 1REGX 2FVPA 2E2NA 4JI8J 4B9TA 3QJPA 2KM8C 3M9NB 1WOSA 2HHHJ 2JJ4D 5J2PB 4J9RA 3MMCA 2XTJP 1HD0A 3U7JA 2EK6A 5EHHA 1K6YA 3DLRA 2FQQB 2GA7A 3DDNA 3J80U 1VQ8S 1WC0A 2JWLA 4ZVRB 1FXDA 1QSYA 3IBCB 1YJWS 1M1KO 3BPSP 4RCHA 4TVAB 1RWMB 4CK3A 2GEMA 4CP5A 4JKGB 4JNEA 2BABA 1QY7A 5LL6Z 3OW2R 2XBPA 2V69A 4K2XA 3TJ9A 2UXDJ 1KVCA 2RJZA 1YJRA 2BKNA 3BQ2A 3X1LB 4X65K 1KQFB 3MECA 4WFNQ 1X31C 4DFPA 2NYHA 2QI2A 2FTRA 4B3MK 4NCGB 1BU6O 2DGOA 2MKSA 3LP0B 2EKNA 4QIFA 3J7YU 1R3NA 3BZKA 4BACA 3GYGA 5D78A 3PW7A 1HYSA 2LQ9A 2HQIA 3W0LA 7FD1A 4C0HA 1NLKL 4PYDA 1Y64A 2FGOA 1WG4A 2VJVA 4JI2K 1U6FA 3TAFA 1RWNB 2QL5B 3QSIA 1PGZA 3QPIA 3TSQA 4P2SA 2UUAF 3MEGA 2WSEC 3H1VX 3L09A 2ZVSA 4AFFA 4CEQA 3SUPA 1JLAB 1LWFA 1ZM3A 3T69A 3FCHA 3PIPQ 1KD1T 3VZIA 4NB4A 5J2MA 1DTTA 3KK2A 2GAGC 4JP8A 4QW9A 2CQPA 1RACB 4DB3A 3GSIA 3LALA 3SV4A 5EDWA 4KGVB 2MYFA 3WX4A 3DCAA 4IDKB 2GMLA 5AJ3K 4I0WA 3G8SA 4BRFA 1OVQA 1KAZA 5JMVA 3TP2A 2E7XA 3D54A 2G4BA 2XY8A 3LA0A 1OY6A 1X7VA 5BRFA 4USHA 5EWGA 3ZT1A 3TEHB 2DNGA 4WTYA 2WBNA 5ETKA 4WXWA 4R25A 4ZMMA 1HW9A 2CJAA 3NVMA 1S6PA 3ZZTA 1TFYA 3P3DA 2H5JB 2NCKL 4CIGA 2IJRA 4ZIWA 1NKCA 5KFFA 2HBYB 2N4CA 4WP8A 2MZQA 1YHQN 3TZXA 3V9XA 4GKKK 2FLOA 2D0AA 3CCTA 3CJQA 3UWTA 3VGVA 4BE0A 4CJKA 4N8OA 4BC4A 2ROGA 2HS0A 1QM9A 2MB0B 1ZM4A 1S1TB 4E8UA 4JLHA 5MLCQ 4B9VA 3CB4A 3CJBA 1RT6B 4B1UB 2AZ3A 2MJUA 1KVIA 3H0PA 2K1RB 3LZIA 2J7UA 3I56N 3OL9A 3VA3A 1UVNA 3FZBA 1YKWA 3OVAA 4OPAA 2DPNA 3GP9A 2IRYA 2AU0A 3UNGC 4Q5VA 1Y97A 3RB4A 4KH6A 1WI6A 2DGVA 5CZVA 2G8KA 2R7RA 2PA3A 2GUIA 4N7TA 4CGJA 2XMMA 5KPZA 4L3NA 1A0OB 2ZNYA 5AXLA 2OPSB 5J1PA 2HLTA 3ADAC 5C42B 4H4MB 1GTHA 3SQ1A 2ZVIA 2R42A 1U7LA 3G4SN 4W5QA 3MN5A 3V1RA 2P9SA 3AT1B 3O2IA 2IAJA 2GS8A 4LRBA 4AQYK 3UVJA 2BJEA 3QJJA 1IG9A 2IM1A 3QWPA 2CNOB 3BY5A 2U2FA 1FKOA 4IH7A 1KP6A 3H1QA 5AQIA 4GKJJ 1MWZA 3R9LA 3PSIA 4NA3A 1FVSA 2E5LK 1CZ9A 4RUAA 4A8FA 1VLYA 1X5TA 4O3PA 2A1BA 2B4VA 2EW9A 4WF9L 5FDLB 2PO4A 1BI4B 5C10A 4PWDA 3L2RA 1NDPA 4M5NA 4F2RA 2Q3SA 3JSYA 4AD6A 1RDCA 2V7YA 5BPMA 3R8EA 1IV0A 3AJ2A 4USVA 3V6HA 3NCRA 4R5PB 4E1MA 4Q0BA 5IT9O 1LW2A 4OX9K 5KG4A 2OUGA 4KHYA 2CQ1A 5C12A 2CPXA 2BA9A 3V9ZA 1REVB 4KGMA 3CMAN 2ZEJA 1VQPS 4CEZA 3O44A 2VF3A 1U8WA 1PBAA 2LQ5A 3EVWA 5CYJA 2KHDA 1WDDA 3HMJG 2DKOB 3UE2A 3T5LA 4EHTA 1JXVA 3HSGA 3GL1A 4DBQA 2ASYA 3UPFA 4LSLA 4TU8A 2XHBA 3RTVA 1GMWA 2XYPB 4I6MA 1ICEB 5AFUH 1JLBB 4WXOA 2PMHA 4CD1A 4OX9J 4DV3J 1YSJA 2DNPA 1NGJA 3RYLA 1YX2A 3SQ2A 4ZITA 3MEEB 1BQNB 2JFKA 2OPPB 1DY3A 3NXZA 3ENBA 4EP4A 4FF4A 1F3VA 1RAFB 3MX2A 2ZE2B 1ZETA 2DNKA 1BQMB 3SMPA 4DN0A 1E4FT 2OELA 3PRDA 2HPUA 4PXBA 1NU0A 4KRFA 4L3KA 5E84A 1UJ5A 3N4WA 4IXCA 3K2YA 4A8KA 3G82A 3ICLA 1OY9A 2LP4A 4I2QB 5CYQA 4QR1A 3BR9A 5KFCA 1R7IA 4MLEA 3Q8VA 3AVFA 2XGPA 1V3ZA 1VQ5N 3WQPA 4V1Ak 2R2TA 3BDEA 3SIPB 5CQGA 2LYVA 4CM2A 4LSNA 4JYAF 2E1RA 3KMQA 1ZAWA 1AYEA 5KTQA 2PD1A 3PO5A 1YBAA 4NRTA 5H1SV 4CJSA 5IC6B 2IVMA 2AJQA 5BJRA 3QIPB 1U0HA 2OO4A 4B3OA 1HWUA 3QEIA 4CHPA 1NGCA 2VCPA 5AFUA 3VHQA 2XYGB 3UIQA 1NU4A 4DOZA 2HVDA 1UVKA 3AVKA 2PI5A 1RI7A 4O5FA 4JI3F 1SQGA 1NK4A 1SKUB 1XK8A 2HBJA 1HA1A 3CJKA 4LBIA 3MM6B 4I7FA 3AJDA 4CHYA 1S4EA 4DUZK 4FDFA 5AQNA 4NYPA 1A5VA 2D3OR 5H9FK 3UKRA 4KHQA 4AHUA 4Z4HA 5CR4A 3VGUA 3QRQA 5C5JA 1Z26A 2E5HA 3BBBA 1BA0A 1Q9YA 3GIIA 1WHVA 2X6NA 2FF3B 4JI6J 4NEZA 5EGYA 5BYQA 3G0ZA 4JOUA 1TK8A 3VGSA 2CAJA 1IKWB 3AO2A 3L2QA 2YWWA 2XMAA 4LFBF 3JQKA 2XG8A 4FF1A 1OO0B 3C94A 5EN1A 3SAFA 3DGVA 2KRRA 3UFCX 2QLWA 4RPFA 4FCYA 2F8HA 3PJ9A 4NLDA 4I6YA 1HR0K 4C0OC 1NB7A 5L46A 3IS9A 4CJ3A 1T95A 2W2NP 3AA2A 1TR0A 4U6PA 3T1AA 1Q0NA 1XI1A 1DKGD 3UCZP 5LXYA 4JV5J 2IOCA 4U8YA 3OTOK 1HUXA 1IKYA 1Q82O 1LWEB 1NOYA 3RMCA 3CJ2A 3OYFA 3C2PA 5CYMA 4JUZA 1CJKB 5F2RA 5FPDA 2ITMA 1VBXA 4B3TK 1SL1A 1RWWB 1RDRA 2GJIA 4DR1K 4DTJA 2FF6A 4RU2A 3OJSA 4NA2A 2HVZA 1PAUB 1K73T 4OHWA 4QYRA 5E5NA 4RW6A 4FJ7A 2GIFA 2MLZA 3LGNA 5F1XA 3EYZA 5KG5A 4HUGA 1VJQA 4O4GB 5HK4A 1RCOB 4LH5A 2DGSA 3AXMA 4ZCKA 4GV6A 3P5TL 4BRMA 5GAGP 1P9QC 3MMAA 4UOFA 2KH9A 3M6XA 3ENOA 3B78A 4O23A 2VOPA 1FNMA 4CZHA 4DMNA 5AQJA 4RKUC 3VF2A 3IGVA 4ISEA 3HSJA 4J9SA 3MEDA 2W01A 2ZD1B 3IBWA 4CNYA 1HBUB 3D4JA 2BVZA 2LCWA 2HKEA 3EICA 5AQVA 1AZSB 3LDPA 5HLFB 3V6JA 3QMQA 1MG7A 2W2MP 3Q89A 4B1VA 3VMFB 4PG8A 3D7EO 3DLGA 2OTLN 1Q8KA 3FQLA 1VS3A 3S1TA 1NGBA 3BKTA 1FNOA 3CIZA 3ISNC 4Y0WA 3D45A 5HQMA 1BWVA 3DXSX 1IR1A 3H8YA 3LZJA 2AF6A 3PDNA 3MXIA 3DC2A 1C1BA 4LF7K 1RCXB 2YKPA 2ZBQA 4DCHA 1MWMA 5D6GA 2QFJA 2DNZA 4ES1A 3IRXA 3CC2N 3M8PA 1UVMA 3MN7A 5SZTA 1SUQB 3UCGA 3EO3A 4O0NA 4UOGA 2HLUA 1IBKF 1T3NA 4WE1B 2KVQE 2NSBA 4HTLA 5LY3A 1EWQA 4OZJA 3OY9A 1HMVB 3OT9A 4QWEA 3V6KA 2IA0A 1FJCA 1TU0B 1R8PA 5KFWA 2IMWP 5GIPA 5JJBA 1F5BA 5SWMA 3N6LA 5A0YB 5JLHA 1ATNA 1K9MO 2KT5A 5GMEA 1RT1B 2HAIA 2Q2RA 1M1GA 3IMXA 3WXJA 4BC2A 3CD0A 5LOQA 3L7PA 1C0UB 3BBFA 5KFSA 3WXIA 4J2AA 2GIQA 2HS4A 4CJ5A 4OI1A 3S9HA 1YJNS 1NNDA 2A6MA 1RAOA 5DO2A 3MZIA 3THXB 2HVEA 2IDLA 1EQYA 4OZLA 5KFAA 3VAMA 3CCQN 4NLGA 2P5GA 3TA2A 2E1PA 4IG0A 1S0OA 3IR6B 3FBFA 2ZJRQ 1Q81T 2HWTA 1N0VC 5KFTA 4LF8K 1Q1KA 1R43A 2WOMA 5E3CA 2VA2A 2J6SA 3GFHA 4M5IA 2F9JA 4DX5A 4WP9A 3JQJA 1U1KA 4JI4K 3DM2A 4MAKA 3CDUA 2HGNA 4EUVA 4K7QA 2I7NA