1IKVA

K103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
557
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 147
structure length 556
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikvA05
4FK2A 3G86A 4DQPA 2UVVA 4RW6A 3V4IB 3KLFB 3TABA 4CF9A 5KFUA 4WFYA 2AQ4A 4U6PA 1TL3B 3Q8SB 4NLQA 4JV2A 1WSEA 4CEAA 1TKXB 3DM2A 4BDPA 4J9MA 2HHXA 4AHRA 2ILZA 3D5MA 3PUFA 4CEBA 5JS1A 4F3OA 4N76A 3QETA 4ZPDA 3SQ4A 1RTHB 1TVRB 1TV6B 5DQHA 3ASMA 4PY5A 2YNIA 4LSLA 4MFBA 1L3UA 2J6UA 3RWUA 5KFLA 2XCPA 3KLEB 1BHLA 4KHMA 4Y2CA 3OSPA 3C94A 4FLWA 4OKKA 3MEEB 4DSJA 3QO9B 5J1EA 2Z1HA 3M8PB 1N48A 1NNDA 3DDKA 1X9MA 3SPYA 1RDBA 1TKTA 4GVMA 4FJ5A 3OS1A 4YNQA 2WOMA 2V0NA 4F50A 1NOZA 2CKWA 2GIQA 1WSFA 5DLGA 5F8IA 1JLEB 3SUNA 2J6TA 5CY4A 4QW8A 3SUPA 4J9SA 3CM6A 4CJKA 1RTIA 3MR2A 2FVQA 3PW5A 1S5JA 3IGNA 1O1WA 2HHWA 4M42A 4PWDB 1C0UB 4AILC 4CJ4A 3PR4A 2XWYA 1KFSA 3DLEB 5L9XA 1WSJA 3TAEA 4ZTJA 4FJJA 3CM5A 4J9PA 1J54A 3RBEA 2LSNA 3TAMB 3IGVA 4FCYA 1EETB 3KMQA 4CJLA 3F73A 4H8KA 3TAGA 4FLZA 4FW2A 4DL7A 3MXMA 1HQEB 3KLFA 4IRCA 4KTZA 3QERA 4CFBA 3KKSA 1CZBA 1NK8A 1C0TB 1RYRA 1WSGA 4RNFA 1K1SA 4MH8A 2RN2A 4E1NA 5KFPA 4F2RA 3RB6A 1XHXA 1UA0A 4I9QA 4NCAA 4GC7A 1RT4B 2R7YA 1TAQA 4LD0A 1RDAA 2OPQB 5HBMA 2E4LA 4KV8B 1QE1A 1WAFA 3NHGA 4CEQA 5DG9A 4PQUB 3HHKA 2OH2A 1XHZA 4CJSA 4TLRA 1R0AB 4EP5A 1RTDB 4LY7A 3HXMA 3VQ9A 4BDYA 2OZMA 3QLHA 4KI6A 4QCLA 1NHVA 3L2RA 1BI4A 3SV4A 4CK1A 4IFVB 3NGIA 3KHHA 1SKSA 5EUHA 4CJTA 4NLVA 4H4MA 1R0AA 1GOAA 2FBVA 4CJRA 3LALA 3OYKA 2BQ3A 4FXDA 3NGYA 1QQCA 4DTUA 4CF8A 2G8KA 3CG7A 3GV8B 3QGIA 2ALZA 2ASJA 3K2PA 3VQ8A 1RDRA 4TY9A 1SL1A 1RTIB 5DQIA 2DPJA 1WSIA 5KG3A 4NLRA 3AVKA 3DRRB 1ZETA 1ZBLA 4O3OA 3OYEA 1HYVA 4ID1A 5KFYA 3SFUA 4FS2A 4KAIA 4IG0B 3LANA 3VQPA 3L2UA 4ECWA 1BQNB 1Y97A 3I8DA 3V1RA 4XPEA 3G0ZA 4Z4EA 4W5TA 4L8RB 4IDKA 3QEVA 1JIHA 3GIIA 4DL6A 3OYNA 3PHEA 5KG1A 1JLGA 1IG9A 2V9WA 2RKIA 4E7IA 3VQSA 2ITGA 3V9XA 4CECA 4LH5A 3HJFA 3CDWA 1RA7A 1JLBB 1S1XA 4ZP6A 4Q43A 4URGA 3BQ2A 1JLFB 4K8XA 1RT1A 4DTXA 4EBCA 4E3SA 2HNYA 4ECTA 2YNIB 4LSLB 4M3YA 5EDWA 4Y2AA 4CJFA 1TK5A 4E7HA 2IBKA 1SKWA 1HPZB 3TAMA 4Y34A 4H4OB 4ED0A 2ASDA 4B9LA 1LWCA 2FVPA 4WFXA 4KI4A 1L3TA 4DTOA 1VSJA 4G1QA 4O0IA 3HVTB 2C22A 2XCAA 3DRPB 3KIOA 2BANB 3DOKB 5HRRA 2C28A 3V6KA 2VA2A 4MIAA 1S6PA 2R2TA 3OL9A 4EO8A 1NK9A 4R5PA 4NLYA 4JLHA 4IFVA 3M9OB 3PX6A 4XIUA 1JLQA 1YTAA 5KFKA 3PO4A 1HQEA 4NCBA 3I0RB 2EHGA 5L1JA 4QAGA 1S9GB 3FQKA 2XY6A 4CGGA 3H5SA 3AA5X 3H4DA 4RW7B 3MXJA 4B8AB 1T03A 3O4QA 5DG7A 3G6XA 3DLKB 3OHBA 3I5BA 3Q8QB 3OJUA 4FJMA 2PZSA 4KTWA 3LWMA 4FZXC 2HVHA 2FVCA 4RG8A 2UUTA 3QINA 3CJ4A 4RW7A 3AVFA 5KG2A 1C1BA 1A5VA 1W9HA 4ZVEA 4B9TA 3C6UB 1IKXA 3VQ6A 5DLFA 4DSKA 4Q0BB 2C2RA 3V6DA 2BRLA 3D28A 1OS5A 4JV1A 3LWLA 5FRMA 3PO5A 1IKYA 5KFDA 3QGGA 3AVLA 2HHVA 2D7SA 4Z4GA 2W8LA 1UAXA 5T14A 3WNEA 4Q8FA 3NGZA 3EY1A 1EXQA 3MAQA 4FM0A 4NLOA 5KFQA 2RPIA 3AVJA 4DMNA 3MEEA 1D8YA 1CZ9A 1JL2A 4DL4A 1J5OA 3VQDA 3PW2A 3CJ0A 4N41A 4Q8EA 4DLGA 1RTHA 1L3VA 3FDSA 3SFGA 2IC3A 1RT1B 4DL3A 2JEJA 5T7BA 1T94A 4MFBB 5KT5A 4DWIA 3KLIA 4FLTA 3T5LA 1VSMA 4URSA 4E89A 3PJXA 2O4GA 3H08A 3MEDA 2YKMB 4AHCA 1KFDA 4BE1A 4KHQA 4J2AA 4QOZB 3I5CA 3U3YA 3MFIA 3DLBA 4IH6A 1JX4A 3PZPA 2B6AB 4NLPA 4ZVHA 4FJNA 3AO5A 2ATQA 3T5KA 1IKVB 1D1UA 2IM2A 4DTRA 1S6QB 3WNFA 3JYTB 4QPXA 3DOLB 3AVIA 2E9TA 4CEZA 3LPUA 4PWDA 4DS4A 2ATLA 4DTSA 3IRXA 4DSIA 4KTQA 3TQ1A 2P5GA 2KFZA 1T05B 3NKYA 4OLAA 4CF0A 1T03B 2RDJA 4J2DA 2FVRA 2G8VA 3NDKA 3NE6A 2I5JA 4N5SA 4CGJA 4M3XA 3HKWA 4CJUA 4H4OA 2Z1GA 1A5WA 4I2QA 1WNEA 2W8KA 1JLQB 3VQ5A 1JXEA 4HUFA 3V81B 4ZHRA 3UQSA 4DL2A 4OVLA 3KK2A 1HYSB 3UPFA 2YHBA 1VSLA 4KO0B 1ZTTA 4FM2A 4ECYA 1S97A 1REVA 3RBDA 3SV3A 1RT4A 2AGOA 3V6DB 2VWKA 3SUOA 1NK5A 2A1RA 4NRTA 4M94A 2YKNB 1KRPA 5HBMB 3BREA 1QS4A 1BISA 2G8FA 1U45A 2KFNA 4RW4A 3A2FA 1NK0A 3KLVA 3RB4A 4IG3A 1IO2A 4HCCA 1DLOA 3CJ3A 3QZ8A 3MTKA 1RTDA 4K4ZA 2FJXA 3OYFA 5K14A 2F8EX 2IDOA 1UOCA 3FQLA 1S10A 3KJVA 3C6TA 2IM3A 4EYHB 4GW6A 3VQBA 5KT7A 4QWCA 4BE2A 4CHOA 4KFBA 3ZSOA 5I3UA 1S4FA 4M3TA 1VRUA 3LP2B 4IR9A 3DLGA 4KHYA 3VQEA 3GQCA 4YQWA 3NF6A 3S3MA 2X6SA 5KT2A 1S0OA 3FRZA 3TI0A 3PW4A 3LP1B 3AVMA 4HUGA 1S9EB 3SJJA 4RNNA 1DTQA 3VQ4A 4K4TA 1IKXB 5J2PA 3D0PA 4NLDA 2CJQA 4NLWA 4O3NA 4Q45A 3O3GA 3PVXA 2HNYB 1HJRA 1LWEB 3QIPA 2W9CA 4E7LA 1LW2A 1D5AA 4IDKB 2X74A 4WE1B 3M8PA 1T3NA 4CCHA 1J53A 3LP0A 4RW9B 1QHTA 3BGRB 4YFUA 3JYTA 4DTPA 4F4WA 1BIZA 4B9VA 4OPJA 3ZSVA 3PX4A 3V81A 2F96A 1UA1A 1L3SA 5DK5A 3C95A 2KZZA 2UUWA 3KLEA 3SYZA 2FJWA 4TN2A 4CGFA 1IKVA 3ZSZA 4O55A 5DQGA 2YKNA 3MEDB 3T19A 5HLFB 1VSIA 4Y3CA 1UWBB 3AA3A 4IR1A 1F21A 3EPGA 1RCHA 3OY9A 3KK2B 3DMJA 1FK9A 1HYSA 1S49A 4W5NA 1EP4A 1KVBA 2OA8A 2OPPB 4KO0A 4K4VA 4CFAA 3VQAA 4ECVA 4CJEA 4FJKA 3OLBA 3JSMA 4FLVA 1XR6A 4FLUA 4E0DA 2B5JA 3AO3A 4RNOA 3HPHA 4NLSA 5C24B 1W25A 3I0RA 2F8TA 4WFZA 2YNGB 2J6SA 3CYMA 1JLCA 3DMJB 3RR7A 3LAMA 5L1KA 3IS9B 3ZSRA 2Y1JA 4F2SA 2AJQA 3L2WA 4MIBA 5KGWA 3MF5A 1T05A 1HNIB 1Z25A 2FLLA 5KTQA 2FJVA 4HVJA 4Z4IA 4Z4HA 4KRFA 4LQ9A 5I42A 4DSFA 4MKAA 3KK1A 5I3UB 4K4WA 3K59A 1N56A 2ZE2B 2BQRA 4KHNA 2B43A 2QK9A 1RBTA 4OKJA 1IKWB 2YHAA 3H2LA 3ZSWA 3HVWA 1N5YA 4J9OA 2RF2A 1S1TB 3ZT1A 5KFVA 4CJWA 1NKCA 4F4ZA 3QEXA 1HMVA 4EBEA 2VWJA 3ZT3A 2P51A 2ZKUA 3L3UA 4J9LA 3P1GA 2NUBA 4KFBB 2IMWP 5KT4A 4RU9A 4RZRA 2R2UA 1IKYB 4ED1A 2E6LA 3ICLA 1HNVA 3KLIB 5DGBA 4R8UB 4BDZA 4IKAA 1QAIA 4CEOA 4QW9A 4CHNA 1TAUA 1EX4A 3TANA 4KREA 5J2MA 3KOAA 2IM0A 4O4RA 1C0MA 2YNHB 2IJFA 1RYSA 1KTQA 4HHTA 3E51A 3PR5B 4PUOA 3U6FA 3OL8A 3N6LA 1BCOA 3BSNA 3QZ7A 4CGIA 4WZMA 4NYZA 4M3ZA 2B4JA 3AVHA 5D3GA 2JEFA 4CJPA 4FLXA 2RKIB 3ZT0A 5KFOA 3RMCA 3SPZA 5KFFA 4MK9A 5KFWA 4ECQA 4M3RA 1U49A 2RDIA 4MK8A 4BWMA 1U4BA 4ZTFA 3NBPB 2OPRA 1BQNA 4KE5A 1N6QA 2VA3A 4WZQA 4ED3A 4G3IA 3UDLA 3E01B 2I5JB 3HVAA 1S1UB 4ZVFA 2YKMA 1RBVA 3B6PA 1TQLA 4KHRA 3DOKA 2HNDA 4FJ7A 2WTFA 3B6OA 4W5RA 5KRSA 1N5YB 2VG7B 1KHVA 4YP3A 2RF2B 3AVCA 2QV6A 3RAXA 2G8UA 2HMIB 4IKFA 4CERA 1C6VA 4DLEA 4KBIA 4FJXA 5KG0A 4ICLB 4ED2A 4CJVA 4GMJB 1IM4A 4K8ZA 3KK1B 3TWHA 4I2QB 4DQRA 1LV5A 4KHUA 4CHQA 3OJSA 5KFRA 4DL5A 1NK4A 3OYLA 3IS9A 3T1AA 4M3UA 3SNNA 3GV5B 4J2EA 3OYGA 2XHBA 3DRSA 1JKHB 4DEZA 2BR0A 4F4KA 1HNIA 3AVNA 3L2VA 1VRTB 2X6NA 3CFOA 1Z26A 3SZ2A 4UQGA 3JSMB 1Q9YA 2XY7A 2G8IA 1RT5A 3V1OA 1KLMA 5L1LA 3HYFA 1DLOB 3V6JA 2XY8A 3S3OA 4DG1B 4DTMA 3CWJA 2HNZA 4F3TA 4NLGA 2DFFA 5DG8A 1HARA 1K6YA 1MMLA 4NCGA 2HHUA 1NKEA 3T3FA 1S48A 2DPIA 2AX1A 5CYMB 4CJ5A 4X2BA 2F8SA 2UVWA 4KB0A 1QAJA 4AHVA 4DG1A 4FYDA 1ZBHA 5CYQB 1Q9XA 3KLHB 1C1CB 3KHLA 4ZP8A 2R8KA 1RT2A 3LP1A 2JGUA 5KFZA 2OZSA 1S1WA 1U48A 1ZBUA 4ZPCA 1TL1A 3IAYA 1RT3A 3EZ5A 1BCMA 3ALYA 1JLAB 4OGCA 1C1AA 5FDLA 2ZD1A 1TGOA 3LP2A 1GX6A 4CF2A 5KG5A 2W9CB 1SV5B 3OYDA 1LWEA 2VG7A 1LWFB 2R2RA 4RNMA 3AO4A 4WE1A 1QSYA 3VQ7A 1LW0A 3RRGA 2FC0A 4JV0A 3M9MB 3TR8A 4CHYA 4C8OA 2FBTA 1EKEA 2G8HA 3QO9A 5J1EB 5J2MB 3M8QA 1RBSA 2FLNA 5FDLB 4CF1A 4FZYA 3NF7A 3LAKA 1C0UA 4NYNA 2GUIA 4HKQA 3I0SA 3NH2A 3KKRA 3V6HA 2R8IA 4I7FA 2HB5A 3NCIA 4TYAA 2Z1JA 3KTQA 5D3GB 3K5NA 5FRNA 2XI3A 3NH1A 4DQSA 3GV7B 3OL6A 1ZYQA 1NK6A 2QXFA 4B3OB 3TAPA 3DOLA 1UWBA 4B9UA 5HRPA 3EPIA 3I0SB 2YV0X 4O5BA 1SKRA 4OJRA 4MKBA 3M8SA 4J9KA 3RTVA 4I2PA 2WCXA 4CK2A 2D0BA 1SUQB 2FLPA 4KAZA 3C6UA 1BGXT 2D3ZA 2XGPA 5C24A 5KFHA 4CESA 3OYCA 1CSJA 3RMAA 4R5PB 3CVKA 1WAJA 4KSEB 5F9LA 2Z1IA 3H98A 2GC8A 3CFPA 4PQUA 5CYQA 4TSXA 1RT6B 1RT7A 1YTUA 3NL0A 2V4QA 1HQUB 3NGDA 3T5JA 2AGQA 4WXOA 3AVBA 4EZ9A 2W9BA 1I3AA 2PYJA 1S1WB 4ZVGA 4O3RA 4KB1A 1NJYA 4FW1A 1DTTA 2IS3A 4O3QA 3BSOA 3MR5A 4QWBA 3V9ZA 2FBYA 4EYIB 4U7CA 2VG5A 3NAIA 2IC3B 3PJWA 5CYMA 2HHSA 4HCBA 1KLMB 4R8UA 1IKWA 3HVRA 3BQ1A 2P1JA 4YMEA 4CE9A 5DGAA 3K5OA 4LSNA 4CGHA 3MXIA 1IH7A 4DQIA 2HWHA 3FFIA 1RAJA 4TY8B 1KHWA 3Q8PB 3CJ2A 4DSEA 4H4MB 1S0MA 3KNAA 3PV8A 4LSNB 2YNFB 5K14B 3IG1B 1DTQB 4NLTA 1YT3A 5J2QA 2JEIA 3NMAA 2OPSA 1U04A 4FJ8A 3WNGA 4FBUA 4F4YA 2AGPA 1J5OB 1KVAA 4J9NA 4EO6A 1JLBA 2DFHA 1T8EA 4CHZA 3H5XA 4WYWA 2YNFA 2HHQA 4KKOA 5KG7A 4FJIA 3IRXB 1TL3A 4Q5VA 1KVCA 1GOCA 4O44A 1NJXA 4AHUA 5L1IA 1T7PA 5KFNA 3OHAA 2W7OA 4ELVA 3T5HA 2KZMA 4KHWA 5F9NA 2JC0A 1FKOB 2R2SA 2R8JA 4EP4A 5J2PB 1J9AA 3MFHA 4YR2A 3NF9A 1QSSA 4M41A 2XRIA 1ZTWA 1ZBIA 3NBPA 1RILA 2WONA 3PW0A 3PY8A 1TP7A 5EU7A 4K50A 3S9HA 2R8HA 3P83D 3MECB 4FBTA 4DSLA 4GC6A 2IAJA 1NJZA 4B8CA 5F8HA 3DLRA 4BWJA 3NAEA 2HNDB 1S6QA 1C0TA 4G1QB 2BDPA 1U09A 4MK7A 3LZJA 1GX5A 1N6QB 4EEYA 2IA6A 4Q44A 1JL1A 5EWFA 2HMIA 4DFJA 4DF8A 3SQ0A 1RDDA 3L3VA 5EWEA 4DFKA 1RBUA 1DTTB 2D3UA 3AA4A 4MQ3A 3KD1E 4NRUA 5KFXA 2KTQA 1VRUB 1HRHA 5JS2A 4FJHA 3HK2A 2FVSA 3CO9A 5FROA 4NLUA 1RTJA 1FKPA 2G8WA 3RB3A 3NAHA 1SL0A 4ZHRB 3N6MA 3GIKA 3LPTA 4Z4CA 2HNZB 1QSLA 4FJGA 4HUEA 2O5DA 3KJVB 3QNOA 2JEGA 3QEWA 2ZE2A 5KFGA 2XO7A 1RT5B 1CXQA 1RNHA 4DTNA 3SI6A 3MEGB 4FLYA 1I6JA 1JXLA 4B9SA 1C1CA 3V9SA 3O4NA 1U47A 1HQUA 4ELUA 4CIEA 4ID5A 3QIDA 3OS0A 3F9KA 2OPQA 2Q3SA 2XGQA 3V9UA 4CGDA 1YVFA 1JLAA 2ZD1B 2ZQBA 3RMDA 3PX0A 1L5UA 4OGEA 2IM1A 3ZCMA 3DI6B 3OVNA 3KLHA 1TV6A 1TVRA 4AHTA 1X1PA 4EBDA 2UVRA 2Y1IA 4CFDA 1TKZB 2QKBA 1S1VA 1NHUA 3MR3A 3RAQA 3BQ0A 4JS4A 1S1XB 1D9FA 4B9NA 4K4UA 3K58A 3O3FA 3D45A 1SV5A 2A1SA 2E9ZA 1X9SA 2D0AA 4KKOB 2ASLA 4CJQA 3G10A 1FK9B 4Z0UA 1HYZA 4OKEA 5HRNA 5J2NA 3EYZA 1S1VB 1XR7A 1JLGB 2WRMA 2BRKA 2DTUA 2OPSB 2B5JB 4K4XA 2QKKA 4ED8A 5KFEA 4CIFA 1TL1B 4ECUA 4O4GB 3OL7A 1JLFA 5KI6A 2WK4A 3LZIA 3QEIA 1X9WA 1B9DA 4OPKA 3ULDA 1S6PB 1NK7A 4RW8B 3GIJA 4CHPA 4QWAA 3BDPA 3DLEA 4HTUA 5HRSA 4ZP7A 1YVUA 2BQUA 3OYBA 4CJ3A 2HW3A 3QNNA 2ETJA 4WYLA 2W42A 3V9WA 1MU2B 4O3SA 2OPRB 1BL3A 4IH5A 1D9DA 4C8NA 1NJWA 4I2PB 4IQXA 3G6YA 4OL8A 3LP3A 4XO0A 4JUZA 4KB7A 3H4BA 5C42A 4JRQA 4DU3A 1SUQA 2W9BB 2AU0A 5F8LA 3ISND 3GIMA 5KFIA 4B3OA 2XI2A 1BIUA 4E1MA 1VSKA 3HVTA 3OLAA 3OYIA 3TAFA 4O0JA 1RT7B 1RTJB 4I9LA 3G6VA 1TKDA 1WNSA 5SWMA 3TARA 2IOCA 3NH0A 3SQ2A 4F8RA 4Q0BA 3OYAA 4K4SA 2IGIA 4ICLA 2YNHA 4J9RA 2D41A 5F8MA 4ZPBA 3RMBA 3L2QA 2VG5B 5HP1A 3K5LA 4ECSA 3AO2A 1CXUA 1HNVB 3HSTB 1JKHA 1RT6A 4W5QA 5J2NB 2HWIA 1I39A 3RRHA 4NZ0A 3C6TB 2DFEA 5KG6A 2GBZA 2AX0A 3DLKA 4TY8A 1S1TA 2VG6B 3DYAA 5F8JA 4NCGB 3FFIB 3BR9A 3CFRA 3AO1A 5HP1B 1TK8A 5C25B 2KQ2A 3HL8A 4PUOB 2X78A 4IFYA 5E41A 4ED7A 1VK0A 3TAQA 3PW7A 4IG0A 3RB0A 4M45A 2C2EA 3KK3A 3KLGA 3VN5A 3U3GA 3BGRA 4BE0A 3LP0B 5KGXA 2BE2B 3THVA 5C25A 1JXBA 5JXSA 4C8MA 1TKTB 1ITGA 2XY5A 4NLXA 4N47A 4M95A 3QIOA 4DFMA 4TXSA 2E9RX 3QIPB 1LW0B 2P5OA 4CIGA 4B08A 1RT2B 4NYFA 3I5AA 5KFCA 1TKZA 3HPOA 2OYQA 1BQMB 4F4XA 4IRKA 5C5JA 2W9AA 2EX3A 2WHOA 4FJLA 4FK0A 3KMSA 2WOMB 2XC9A 3AVGA 4KHSA 4CK3A 2OPPA 3P5JA 2GIRA 2BANA 1EP4B 4O44B 3K57A 4XPCA 1RDCA 4RW8A 1Z4UA 2QE5A 4WXWA 5F8NA 3LDSA 4R0EA 4DQQA 4BACA 3SI8A 2DY4A 1B92A 5HROA 4QWEA 4ZMMA 2BGGA 3NF8A 1XC9A 3HPGA 4E7KA 3ISNC 2D5RA 2YNGA 1JLCB 3OS2A 3QYYA 4FS1A 3FSIA 1KSPA 4O4GA 1N4LA 4QWDA 2WONB 1NOYA 3CDEA 1C1BB 3SQ1A 5HROB 2UVUA 1K1QA 5KFSA 3DRSB 3CDUA 3OYJA 4ZPAA 3Q8RB 3S3NA 4RW4B 4ELTA 4KV8A 4RUCA 4FJ9A 1VSHA 2D0CA 4HYKA 1QE1B 5EWGA 3MEGA 3CIZA 3HO1A 3EZUA 3CQ8A 3ITHB 3BSAA 4YR3A 3QLHB 3KK3B 1HMVB 4FVMA 1QUVA 3HM9A 5SZTA 3H5UA 1A5XA 2BE2A 3DRRA 4TQSA 3RR8A 1BI4B 3GILA 3M9NB 1SH2A 4TYBA 3O3HA 1Q8IA 5I42B 1XI1A 1SL2A 4IG3B 2HHTA 1TK0A 4DFPA 3ITHA 4IFYB 5KT6A 4TQRA 3HP9A 1FKPB 2JC1A 4ECZA 4OLBA 4ZP9A 1RA6A 1LWFA 1S0NA 4M3WA 4ID5B 5KFAA 1TKXA 3DM2B 3V1QA 5CZ2A 3KLGB 1REVB 2VG6A 1BQMA 3OYMA 2JLEA 2GV9A 1VSDA 1WN7A 1ASVA 3OSNA 1RT3B 4RW6B 3V4IA 4N56A 3KHGA 3VA0A 3VQQA 4RNHA 3DI6A 4DU1A 3WNHA 1C2PA 1ASWA 5J2QB 4I7FB 2E6MA 3ZSQA 1S9EA 4IRDA 4RW9A 1WLJA 4W5OA 4CFCA 3VA3A 1XWLA 1LAWA 3SUQA 3DYAB 3H59A 3M8QB 1LAVA 3DRPA 4KPYA 3DLGB 4YR0A 4DS5A 4IBNA 4AHSA 4O3PA 3IN5A 2C2DA 3CJ5A 3QESA 3QEPA 5KFTA 1QTMA 3KHRA 1JLEA 2EC0A 5JUMA 4Z4FA 2B6AA 3QGHA 3E01A 1FKOA 4LQ3A 5KFBA 4AH9A 1HPZA 2V4RA 4LH4A 5KG4A 3SCXA 4CEDA 3OYHA 4B9MA 1S9FA 3HP6A 1MU2A 4PA1A 3UR0A 4K4YA 1LWCB 5CZ1A 1D0EA 4ECRA 2PYLA 3L8BA 3BJYA 1GOBA 1ZBFA 3UIQA 4DU4A 1KCFA 1SH3A 3DLHA 2W7PA 4DF4A 2IJNA 2FBXA 3NFAA 3MECA 4Y1CA 4FM1A 1FXXA 4EZ6A 1LW2B 3H5YA 2HAIA 2IAJB 3AV9A 1S1UA 4J2BA 4FZZA 3ZSYA 4E7JA 2I1RA 4E19A 2WB4A 3ZT2A 4ECXA 5DMRA 1S9GA 3BSCA 3K5MA 2O4IA 3M8RA 4J9QA 2AWZA 4C8LA 1ASUA 3MR6A 1VSFA 4CEFA 5KRTA 1W0HA 3AA2A 2HVIA 1NKBA 5F8GA 4RUAA 4URQU 2R8GA 2PY5A 4JS5A 5HLFA 3HT3A 3N6NA 3AVAA 3VQCA 4ED6A 4FK4A 4IOBA 1B9FA 4JRPA 2KW4A 1RBRA 5KFMA 3KD5E 1CLQA 1SH0A 4C8KA 5KT3A 1VSEA 2ILYA 4IH7A 3ZT4A 1WSHA 3IG1A 1G15A 3GYNA 3H40A 5C42B 3TVKA 5KFJA 1VRTA 3ZSXA 4Y1DA 4H54A 4DTJA 1KLNA 1EETA 1XR5A 4CEEA
chains in the Genus database with same CATH superfamily
2DY1A 1NDKA 3L9ZA 3OFFA 4WFYA 2ACYA 5L46A 3Q8SB 4NLQA 3OFEA 4K25A 3AH6A 2XBPA 4C7QA 2X3DA 1UVJA 4CEAA 4DZ6A 1TKXB 2EFVA 3ZX2A 2ILZA 1JK9B 3D5MA 3QFWA 4M63A 4NLCA 3ZX0A 1NEEA 4BGBA 5JS1A 1RTHB 3ASMA 1L3UA 1LOUA 3RWUA 2HQFA 3W3SA 3KLEB 1QDUB 3TO8A 4Y2CA 3MEEB 3THXA 3EZOA 1X4DA 4YORA 1S7IA 4X62J 1N48A 1NNDA 1X9MA 3OTBA 1YSJA 2BYCA 1TKTA 3NWGA 3HI9A 4OPAA 4F50A 4HACA 3D2FA 2ALYB 4Q7AA 4TVAB 4X66F 3D2EB 1HBNA 4QYRA 3AAQA 3SUNA 3A3PB 3ZLJA 1FCAA 3QT6A 1NCLA 5CY4A 4QW8A 3SUPA 3J7YP 4ZKAA 4AD6A 1RTIA 2D0OA 3IGNA 1G6BA 2HVZA 4PWUA 3TA2A 1MMNA 5LXRA 2B0GA 4PWDB 2G2OA 2DB1A 3PR4A 3DDIA 2RRAA 3DLEB 2J0SD 1D4XA 4DR5K 4KGMA 4FJJA 3MCOA 3CM5A 1Z6RA 4LF1A 1VQYA 3KKFA 2AT1B 2J7UA 3TAMB 2JWLA 4B3RJ 2HFOA 2LKZA 3KMQA 1X4AA 4DV6K 1N52B 2LQ9A 4DL7A 3MXMA 2QWNA 4QS7A 4IRCA 2ZH6A 4M5KA 2V8DA 4E1JA 1NK8A 3PRVA 2ASYA 1Q7LB 3UKRA 4RNFA 3DOMA 3W9HA 4P2XA 4MH8A 1IBKK 4E1NA 4WFBQ 3RB6A 2OD6A 1UVNA 4NCAA 1MG7A 3U27A 1TAQA 4DU7A 1OY6A 5IC4B 2E4LA 4OYBA 4CEQA 1VS3A 3EVOA 1BQXA 2RD5C 4KH5A 2PMWA 1T02A 4EUVA 8AT1B 3HXMA 3VQ9A 2QWQA 4WCEQ 1DARA 1N5SA 1NHVA 1AUDA 4HT7A 1ZA1B 2QWLA 3SV4A 3NGIA 4H4MA 4MKVA 4WKYA 3D2FB 2BQ3A 4NMXA 4K8RA 2YX7A 3QGIA 2ALZA 3FCVA 3K7RA 2QWMA 3K2PA 1RDRA 3LDQA 1S77D 5M1QA 2C3OA 1RTIB 3BYPA 2DPJA 4OX6A 5KG3A 4NLRA 2BXJA 3MMJA 1ZETA 1DAXA 1HI0P 4ID1A 5KFYA 1SXLA 4KAIA 3HFVA 3R27A 2CGKA 3EGZA 1Y97A 1BQNB 4H4KC 3ZEUA 3G0ZA 4Z4EA 2QA4G 1RJJA 4W5TA 1OIAA 2QLWA 1JIHA 3ADAC 2P9PA 3BR8A 3PHEA 4ZPWR 2V9WA 2RKIA 4K5RA 2BJ1A 3TSPA 4LH5A 1GMWD 1RT1A 1T3OA 3H1VX 4EBCA 2P5VA 1Y11A 3HD2A 4E3SA 2YNIB 2GWJA 4I6AA 3UDCA 1U6BA 4ISGA 3HJVA 2ASDA 2DNNA 4B9LA 2FVPA 3L4QA 2YWFA 4KI4A 4N8NA 5AQSA 3WT0A 4A5AA 4G1QA 5ETNA 1NG9A 2XCAA 1U1RA 3AA9A 3THTA 5EN1A 4IO1A 5B0EA 4IOCL 5KQDA 2C28A 1V4TA 3VAJA 1NGFA 1YJRA 1DURA 3UCGA 3OL9A 3BO3A 4NLYA 4JLHA 3M9OB 1YTAA 1RHMB 1Y3JA 5E26A 1MWZA 3I0RB 3FQKA 4BG9A 4HR2A 3C7NA 2PD1A 4A8SA 4B8AB 2Z2YB 2CZ4A 5DG7A 3G71S 3A5OC 2E7WA 3OHBA 3CPEA 5HOOA 3OJUA 2ZHBA 5K5MA 5IT0A 4LRDA 4KTWA 4K43A 3LWMA 4FZXC 5DRKA 5L9NA 4OYPA 3I9ZA 3EICA 4FOIA 2RUGA 2XZTB 4M1KA 4NA3A 4ANEA 2WSFC 4KRWA 4A8KA 3D66A 1Z2LA 3QDKA 1XQSC 2DR8A 1WOPA 1YF5L 3VQ6A 4KT0C 2C2RA 2ZH8A 2RQMA 1QVFR 5M2UA 2FB0A 2FIUA 5FRMA 3ZZYA 2Q2RA 3A1YG 2VC0A 2HHVA 2DNKA 3JXUA 4Z4GA 1Z2ZA 2GELA 5T14A 4OI2A 4CNZA 3AVJA 4A8WA 4MDAA 4DMNA 4M63C 3MEEA 1D8YA 1JL2A 2NSBA 1J5OA 2Y9HA 3WIVA 4JI2K 1WC3A 3PW2A 2F9JA 5AZJA 1N0UA 2R3VA 2GZOA 4L75A 3FDSA 1DBDA 3IO1A 2IC3A 4BR2A 2JEJA 2WW8A 4JV5J 5DM7L 1XNRK 4E89A 2HOEA 2EBEA 3GONA 3LDNA 3MPVA 4C1NI 2Y1LB 1M1KO 2J9DE 3GG0A 1KFDA 1UAWA 2ZH1A 1GXLA 2YWHA 3CDAA 1VQMN 2V68A 3DLBA 3UE5A 1H2TZ 4IH6A 3SK3A 2RIJA 2ATQA 1Q82O 3T5KA 1IKVB 5E7OB 3MMAA 3G82B 1X4EA 2GVZA 2HHPA 2QXLA 3JYTB 1ATSA 3DFEA 1RU2A 2O8CA 1S12A 2DHHA 5T7LA 2ATLA 4KTQA 4KGXB 3TQ1A 1WF1A 1T05B 1QZ6A 4CF0A 3CJQA 1T03B 2RDJA 2KL8A 3EL2A 2G8VA 3NE6A 4PXEA 1RTZA 4IXCA 3CCVN 3TW0A 4RTFD 2Z1GA 3NY0A 2OSRA 1T9TA 3QGPA 2DCUB 4RBTA 2BJ9A 3OVSA 3BYRA 5AT1B 1VSLA 4FM2A 1ZOTA 1REVA 4K42A 3WUHA 1RT4A 4LF9J 2XM3A 1NK5A 4LF4J 2M8HA 4NRTA 4F0KA 1VGYA 1WKJA 1OQ6A 1KRPA 3BREA 4AM6A 4YUDA 2G8FA 1U45A 2E1YA 3A2FA 2E1CA 2W4PA 1UEVA 2XS2A 4JI7J 3M4XA 5AXNA 5FPNA 1KNZA 4K4ZA 2FJXA 2Z30B 2F8EX 1HWUA 1UOCA 1S10A 3EVWA 3KJVA 4YOUA 4EYHB 1VMBA 3GR1A 2V50A 4WP8A 2GAGC 4JYAK 1S4EA 2QYCA 4DV4K 2KXNB 5HQMA 4IR9A 2OSQA 1X9JA 2I38A 4YQWA 4QZVB 3S3MA 2F4VK 3TZWA 3FRZA 2W2OP 4OO1J 3CCTA 3PW4A 1Y0HA 2P9PB 2RE2A 1S9EB 4OPHA 4DCHA 3C46A 4UUWA 1QTNB 4LF9F 3T1HF 1YITN 5J2PA 4NLDA 4PXDA 1XUPO 2CJQA 4NLWA 4JI3K 3PVXA 4NXNJ 2LA4A 1LWEB 2YWKA 2BZ2A 3NNAA 4ZLLA 4E7LA 2KT2A 1WKKA 3IR6B 5JJBA 4IOCQ 2MQMA 3O8WA 3POTB 1NGIA 2HHHK 1WJ9A 2V69A 2CH5A 5L39A 1Q79A 3ET6B 4BRKA 5DK5A 5FD1A 2UUWA 4CZIA 3C14A 5B8HA 1GXTA 1SQFA 3J80U 4CGFA 1IKVA 2EKYA 4O55A 3D0IE 5DQGA 1WF2A 4Y3CA 4U95A 1URNA 2ZJQL 4WFAQ 4P10A 4A8OA 4X66K 1VK3A 4PRFA 3SQOP 2PI4A 3FJ2A 4F26A 4W5NA 2AJ0A 2OA8A 2OPPB 4KO0A 1U1NA 3VQAA 4CJEA 3O3LA 2MKHA 2WVDA 4DDFA 4CLWA 2GNKA 5GAGU 4FLUA 2B5JA 4WK1A 3AO3A 4OLPA 4NLSA 3M32B 2ZM6J 4B3SJ 2J6SA 2AJ4A 2O8BB 1CZAN 2APOA 5ETQA 3LAMA 2YH0A 1SJFA 1Q1KA 2AJQA 2KG1A 5KGWA 1R27B 1HNIB 2FLLA 2HSEB 4KRFA 2HF3A 1FFWB 3NVMA 3UWTA 4MKAA 3KK1A 3OHRA 2FSKA 3K59A 5E3AA 5A2QO 2I6WA 4JV5K 3ZSWA 2KT3A 5AQIA 4FYYB 2RF2A 2I7NA 2H65B 4CZMA 3G71N 2WSEC 3KZBA 4H0VB 2AP6A 1OSCA 3P1GA 1F2HA 2R7VA 2IMWP 2UU9K 4WKRA 4RZRA 1R0CB 3JAMY 1HNVA 3G9CA 2CPXA 2KM8B 1S5ZA 4BDZA 4IKAA 3K89A 4ZPVR 4QW9A 1TAUA 1FDNA 2E7VA 3QWPA 2V8GA 3KOAA 2ZDPA 5D0HA 2XLJA 2DH9A 2IJFA 3Q86A 1RYSA 2YH1A 4L74A 3PR5B 1LXJA 3U6FA 3OL8A 2B56A 4CGIA 3CD5A 4WZMA 4NYZA 1HNZJ 1CJVB 3CB4A 1Q5VA 3VCDA 5D3GA 4BRIA 2JEFA 4CJPA 1F9EB 1BWFO 5E84A 3ZT0A 2GVZB 2VJVA 2DNPA 4BWMA 2OIHA 2V67A 2FQQB 3MURP 3K0SA 4WZQA 1IR0A 1VFJA 3ILLA 3I4HX 2AF6A 3DXKB 1S1UB 4DUZJ 2QO3A 1A0OB 3B6PA 4CO3A 2C3YA 2G13A 2ZC4A 2KXFA 3BZKA 4PG4A 2HNDA 1FEEA 2PFUA 5KRSA 3CJCA 2VG7B 2RF2B 3RAXA 5D77A 1C6VA 2Q97A 4DLEA 4ED2A 2LMIA 3GOIA 4B1YB 5EOYA 2GQQA 1LV5A 2XQCA 3D1OA 3HOSA 1X4GA 2M2BA 4DX6A 2RILA 3BH6B 1U2VB 2GCFA 1SC3B 4JI5K 3GV5B 3A5MC 2XHBA 3DRSA 1JKHB 2BR0A 4F4KA 3NNHA 3DAWA 4OZ2A 1HNIA 3AVNA 3EN9A 3L2VA 3I8BA 2X6NA 1R8HA 3SZ2A 2LFVA 5AQWA 1Q9YA 3MWBA 2XMKA 4WQ4A 3D3CJ 4ETXA 3N9UC 3QRPA 2HQIA 4FSVA 4RX6A 5L1LA 3MPUB 1ELOA 3HYFA 3N5FA 3W2WB 2AMCB 4NPOA 4CZCA 4DG1B 4DTMA 3CWJA 4F3TA 3NCQA 3G2XA 3H7HB 5BR8K 2BEFA 4QYZJ 1K6YA 3IXQA 4PKIA 2HHUA 2W2NP 1NKEA 2GAHC 2UVWA 1NSQA 3ENWA 2P9NA 1QAJA 2Y3YA 5HJXA 2QWRA 1GTEA 5CYQB 2FLOA 2ZC3A 4C98A 3TSQA 4ZP8A 3CCUS 1P8ZA 4P72A 5KFZA 1Q95G 3WC0A 1S1WA 9RUBA 2GTDA 4CH1A 1ZBUA 3TA0A 1RHUB 2ZITA 2VV5A 3CEDA 1GX6A 2XS5A 1FESA 1S6UA 2VG7A 1LWFB 2R2RA 1OMSA 2GO8A 2YQ0A 4JV0A 2FDNA 3JSYA 5K8PA 5LJVA 3TVYA 2KKHA 3THXB 1GH8A 1PKUA 3GFXA 2QMXA 3NF7A 2R7UA 2CH6A 4NLBA 5D4LA 1Q16B 3W5ZA 1LFWA 3NH2A 3DGPB 2R8IA 4I7FA 5DM7Q 2HB5A 4WQ5A 2Z1JA 1SJ3P 2WBMA 3ZZZA 3GV7B 1NGHA 3OL6A 5U47A 1TL5A 2KDOA 3ZZOA 2FHJD 2QXFA 1GLFO 3CF5Q 3PRBA 4HVZA 3EPIA 4O5BA 1PYTA 3WXMB 3LDPA 4J9KA 2DNMA 4I2PA 2XMUA 2HRTA 2YKAA 1SBRA 5C24A 4LRAA 3MX5A 2MDAA 2ROPA 4OI0A 4JHDA 3CJ7A 1WAJA 2DISA 1YTYA 2UUBK 3G8TA 1M90O 5JLFA 3H98A 2GC8A 2O8EA 4PYAA 1BD6A 2J7KA 5C15A 5CYQA 2Q0UA 2V4QA 4FXWA 4ZJOA 1YX2A 3AVBA 4OYIA 4EZ9A 3FBEA 1S1WB 3MUTP 3A13A 1GMUA 1GXUA 3EE8A 1IWGA 3MR5A 2HMPA 3V9ZA 2XULA 2NRZA 2MSSA 1O13A 3PJWA 2O8BA 5HJYA 2P1JA 4CE9A 4GO5X 5KPZA 1A9NB 3KWGA 3K5OA 2I7PA 4KH1B 4C48A 4C97A 1RAJA 4OZLA 1S6OA 2Q66A 2VHGA 4DV0J 3WQPA 2ZJPL 3EX7B 2IVYA 1WG5A 2YNFB 1KAYA 5K14B 2GX8A 2QWOA 3IG1B 3BGLA 5B0CA 2GO9A 1PYSB 4FJ8A 4CYUA 4F4YA 2AGPA 1LOTB 4EO6A 1JLBA 3FEYB 3CCRN 3ZFVA 4QS9A 3NS6A 2DFHA 2UZAA 4WYWA 4DKWA 1ULRA 2HBZB 4GV9A 4Q5VA 1KVCA 1GOCA 4AHUA 2LEBA 4BBYA 2F9DA 5KFNA 1RHJB 5AQJA 2LQBA 4ELVA 4Z2XA 4CH7A 2KZMA 4KHWA 4NEZA 1RQ0A 5AQNA 1MA9B 2R8JA 4EP4A 3IA0A 4RR5A 2OAUA 4LRCA 5CH7B 3AD8C 2EK1A 2ZJRQ 3TUZC 1RILA 3LOUA 4F3QA 3BUZB 3W1YC 1QVFM 3S9HA 3IAS9 3P83D 4USJC 3MECB 2BJEA 4FBTA 3BBFA 3WXIA 4GC6A 4B8CA 1U8SA 4B3SK 5A6WA 4BWJA 4Y2MA 2RJZA 2BDPA 1WC1A 3EE3A 3I96A 3WBZA 4X4UA 4NASA 1DFDA 3LZJA 1VQ8S 3ZZRA 4EEYA 5IC6B 4DFJA 3SQ0A 1RDDA 1C0FA 1XNRJ 2D3UA 2MJNA 3KD1E 1IM6A 4NRUA 1TL7B 2QLJB 3WC2A 3TZYA 1TUUA 3PLAA 3W8PA 3D54A 3VEWA 4NA1A 1G1XA 1Q0NA 4NLUA 1H73A 1FKPA 3QAEA 2G8WA 3RB3A 1SL0A 1U6ZA 3N6MA 4UTGA 3LPTA 1QSLA 2R42A 4HUEA 4OX9K 2D9PA 3KJVB 3QNOA 1QQMA 1ZZFA 2JEGA 2GWKA 2DTJA 1RT5B 1RNHA 4DTNA 1I6JA 3E66A 4B9SA 3O4NA 3KG1A 5B0GA 1XMBA 5AXKA 2C3MA 3OUYA 4ZJQA 2MGZA 1OKJA 3V9UA 2DH8A 3DU5A 1L5UA 4OGEA 1DT9A 3DI6B 4NO7A 1DGKN 1M1HA 4AHTA 1HWKA 2G2YA 3WXJA 2GJIA 1KVJA 3M05A 4CFDA 1TKZB 2Z8QA 1NHUA 2BOPA 2FF6A 3PIOL 2F63A 4WTOB 4DUZF 2JLGA 5JICA 5IQQA 3K58A 1HKCA 4NXMK 3POTA 2VFUA 3GP9A 1RHKB 1X9SA 2D0AA 4EHTA 3AOCA 2UU9J 4CJQA 1FK9B 1S59A 4K0KF 4Z94A 3ZZ0A 1XR7A 3WEEB 3A5NC 2BRKA 2QKKA 5H9FK 1TTHB 5FLXU 1RB0A 3VERA 4CIFA 1BMQB 2PMHA 2XZWA 3NOCA 4FDFA 3H8YA 2WK4A 1X9WA 4DV4J 3HX9A 4OPKA 2M9KA 3ULDA 1S6PB 1SIZA 3OBIA 3CC4N 1SJQA 4LF2A 4HTUA 3BGOP 1RWMB 2HPUA 1RKJA 3DGVA 2W6LA 2DXFA 4CJ3A 3DU6A 2MLZA 1PBUA 3MCNA 4ER8A 3DHWC 3V9WA 1MU2B 4F9OA 4B1UB 4DQ8A 4O3SA 3UNGC 3SDEA 4C8NA 2M0GB 2NRTA 4IQXA 4OL8A 1UPPA 4NYOA 3H1QA 3VV2B 3ENBA 3H4BA 4DU3A 4A59A 4IJNA 3EJMA 4DV3J 1RGIA 2Z2ZA 3D1QA 5KFIA 2VOPA 4DN9A 1WKLA 4HT5A 1RT7B 2WZ1A 1TKDA 4NMLA 2VFRA 2IOCA 2HS4A 4HTJA 1UFLA 1ZS6A 3OYAA 2FJEB 4H4KA 1NM2A 3I32A 1F5BA 2KYZA 2YNHA 2I9SA 4WP3A 2X51A 4J90A 4FYWB 3IM8A 2E5LJ 1E4GT 3T6JA 3B8AX 1CXUA 3WQUA 1HNVB 4DPTA 2EVZA 4DCJB 1WB9A 1N36J 2VDHA 3CJRA 2ZM6F 5C2DA 5KG6A 2GBZA 1L3KA 1RHQB 2VG6B 3SSQA 3BR9A 4A2BA 5D4NA 3UE2A 3CFRA 3IBCB 4PEOA 3ENVA 2A5XA 1M0SA 3M2VB 4DHYA 1YRXA 1M5PC 2W41A 5B0DA 3U3GA 5BRHA 3BGRA 2LEAA 3THVA 5CQGA 4OZ0A 4C8MA 1ITGA 2ZH5A 5AXLA 3OW2R 4N47A 4M95A 2NRHA 3QIOA 2E9RX 4H5RA 4OX8A 1LW0B 4CO1A 2P5OA 4ISFA 2GUPA 1I51B 4LT6A 3TEGA 2E7XA 3HPOA 1BQMB 1FRIA 3TEHB 2BW7A 2FXUA 3AVGA 1X31C 4NXNF 1X7VA 5KAKA 2BANA 1EP4B 4NB4A 4XPCA 2QE5A 4WXWA 2QL9B 4R0EA 4DQQA 4V19S 3OTCA 4EI2A 3SI8A 5HROA 3AD9C 3GR0A 4ZOSA 4BY9C 4FPBA 2PC6A 2QA4S 2BGGA 2VPZB 1XC9A 5HSPA 3ISNC 3ID8A 1JLCB 2R7SA 1S72S 3PSFA 5ETVA 3VF6A 2D0PA 3GBTA 7FDRA 3CDEA 3G6EN 2UVUA 3O6WA 5KFSA 3DRSB 1QJHA 3OVAA 3Q8RB 2CZ9A 2E1MC 4OLOA 4WU2A 4OV1A 1U25A 2V63A 5JVGL 4DV2F 1XNQJ 4FJ9A 3MCSA 3T6BA 1W2BR 3RSEB 3CIZA 1PSDA 3HO1A 2AJ2A 3ITHB 3BH7B 3BSAA 2QL7B 1W7AA 3W2WA 3GL1A 4JD2B 4M5JA 4OHYA 1QUVA 5IXUA 4FWNA 2XYGB 3M9NB 1SH2A 5I3PA 5KQ8A 4TQRA 1FKPB 4ECZA 1FTRA 2F1FA 2UP1A 4GKJJ 3W9JA 2HIYA 4M3WA 4ID5B 2D9OA 2HS0A 2RT3A 3EM1A 4L76A 2Q6CA 4EK2A 3THYB 2VG6A 1JNRB 4L3KA 1V3SA 2CZVC 1BQMA 3CCMN 3V4MA 3V4IA 1VIXA 2E5GA 2C3PA 1H6KX 4UT4A 3VQQA 3OXLA 2BABA 4DU1A 4A2AA 4RLEA 3R5CA 3VAFA 1MWYA 1T0TV 3L3CA 2LDIA 2P6SA 1VCTA 2WBNA 1ZAWA 4KQZA 2QZ8A 2U2FA 1AROP 4W5OA 3CF5L 2P9EA 1XWLA 4X65K 1LAWA 4JI3J 2PO4A 3H59A 4IOXA 5GMEA 4KH4A 4DR3F 4DS5A 4AHSA 5LMUK 3IN5A 3QEPA 5KFTA 2FF3B 3GMGA 5HQ8A 2B6AA 3S01A 3PKYA 5KFBA 4AH9A 5KG4A 3SCXA 3HP6A 3U4LA 2LXUA 1MU2A 4PA1A 1ZBFA 2IA0A 2MQLA 1TUGB 5H9EK 2W7PA 2GFFA 4LC9B 3HOTA 3ZNJ1 3J7YU 4EZ6A 1FXXA 3C6AA 3DWLA 1ZAVA 4EHUA 4FVCA 2YHXA 4FPRA 3ZSYA 2O8FB 2GVDB 2I1RA 4E19A 3FBBA 2XWXA 5CZXA 5CYJA 3O9RA 4X64K 4J9QA 2AWZA 4C8LA 1HHTP 4B1XB 4ZK7M 1UMJA 3J8AA 3S41A 5KRTA 1SQKA 1W0HA 2WBRA 2B4UA 4YDXA 2W24A 5MAOA 1VBXA 3G4SN 3UNYA 3HT3A 3AVAA 3VQCA 3D6FB 2K06A 5CZVA 5BPNA 2MZTA 4A4JA 4O5FA 1VBKA 3KD5E 2HRYA 3C8YA 3PXGa 1VSEA 2ILYA 4IH7A 1VQPS 3GYNA 3H40A 4LRFA 2CVIA 3TVKA 2X7IA 1VRTA 5LL6d 1EETA 1Y5IB 1SS6A 3GG4A 2R7QA 2E8AA 2QX0A 3G86A 1KS2A 2DNOA 2V6AA 2AQ4A 3P6YC 2H54B 1WSEA 3PFOA 1OSDA 3A8JA 2DNZA 1H1VA 4J9MA 2B4PA 1YJVA 2A3ZA 3AFGA 1Q18A 2WFBA 4N76A 1GLJO 3SQ4A 4RKUC 1TV6B 3TTCA 4PY5A 4LSLA 1FX4A 4MFBA 2M5YA 2XCPA 4GKKJ 2XMMA 3C14B 1HHQA 4BRHA 2G0CA 3CPWM 1RWKB 3J80Y 4OKKA 4U8YA 3QO9B 1WHVA 2Z1HA 2MQNA 3M8PB 4O23A 2MSTA 3WX4A 3FSXA 4DPXA 2HZAA 5K8OA 3SCLE 5KOWA 4GVMA 4YNQA 1RLDA 1AFJA 4BRNA 3UVJA 1MROB 1WSFA 5DLGA 2GJFA 5IV4A 2J6TA 1LK5A 4DR2F 1KN6A 1YJTA 2FVQA 3PW5A 1O1WA 1AA1B 1IJEB 2CVEA 1UJ5A 3I9V9 4M42A 2CQ2A 4BS2A 2IHR1 4NXMJ 5L9XA 1WSJA 2DEJA 3GCWP 4QR1A 3ZZPA 4RCHA 4J9PA 4CBXA 3KNGA 1WSVA 3IGVA 2KFYA 1EETB 4P73A 5F3ZA 4H8KA 3BEGB 4C3MA 4DUTA 5GAEP 4FLZA 3FK4A 3L7OA 4USKA 3VAGA 4CFBA 4RJVA 5AQLA 1CZBA 1C0TB 2VCPA 3ETOA 1WSGA 2VFVA 4M5MA 4JD2A 3EGWB 4F2RA 4C8YA 1XHXA 5AZIA 3Q0AA 4GC7A 2R7YA 5IWAF 5HBMA 3J7AP 1OJ4A 1NJIT 4W92B 4LIRA 3HHKA 3AQPA 4ITSA 4X4VA 4YN3B 1S72N 4TLRA 2HG4A 1RTDB 4LY7A 1QQNA 4BDYA 2OZMA 3QLHA 2HGMA 3CCQN 4KI6A 1RWWB 2H5IB 2WSCC 3SBMA 5B08A 2CQ1A 3L2RA 2ADBA 3GJQB 2DR6A 1IBLK 5EUHA 4NLVA 4E8UA 4U67Q 4DR2J 1GOAA 5M1KA 2I8EA 2FBVA 3LALA 1FRXA 2O66A 1SCJB 1KQFB 1MSWD 4DTUA 2JVOA 4CF8A 4WU3A 3CG7A 1KD1T 5B0BA 3HSCA 3VQ8A 3NWRA 2DPNA 2XTJP 5DQIA 2N4DA 4JKFA 4CD3A 1MN9A 4B3RF 5CAAA 2WVCA 2Q79A 4IG0B 3R5AA 3DC2A 3J7YI 3CJBA 3LANA 3VQPA 4ENOA 1H72C 3UO0A 4L8RB 4LFCK 2E1AA 5EXWA 2ZVIA 5KG1A 1IG9A 3QRQA 4E7IA 5GAGI 3VQSA 3CC7S 2ITGA 3V9XA 4CECA 1IBKJ 4BR7A 3HJFA 3CDWA 2QLXA 1JLBB 4JI0F 1N8RO 4Q43A 3PIPQ 4URGA 4X66J 2LECA 4ECTA 2GQ2A 1VLYA 2OTJS 2WVEA 3KJFB 1I94J 2V2QA 2IBKA 1SKWA 2P9SA 4H4OB 2NZTA 4CZKA 3CC7N 4BROA 3IWXA 4X62F 4WFXA 2AEJA 2PEHA 4WFNQ 4DTOA 3J7AN 4DPWA 1VSJA 2KKZA 2C22A 4DMZA 2RHKA 3DOKB 4FYVB 2AZ1A 4DZDA 3V6KA 3IDHA 4MIAA 1Y7PA 4H5TA 2R2TA 1FD2A 4IEEA 3GWCA 3HHLC 1VQNS 2LP4A 2CAJA 2F3JA 2H51B 3IAM9 4XIUA 3AXKA 1K8AO 3PO4A 4NCBA 3C66A 3M32A 2EHGA 2J4RA 1EO1A 1S9GB 3K2YA 4A61A 3MM7B 3H5SA 3AA5X 4RW7B 3G25A 2EC2A 2WTUA 2P9KA 4GVLA 1NGAA 2CDRB 6FD1A 3M1VA 4AL6A 3DLKB 3I5BA 1KWMA 4FJMA 4LFAF 3GJRB 2HVHA 2UXDJ 4RG8A 4XDCA 3QINA 1H7WA 2AZ3A 4ZLJA 2J8AA 4X65F 1HD0A 5KG2A 4CH0S 2B4OA 3OFGA 3LPEA 1X4BA 4ZVEA 4B9TA 1B4SA 3AOBA 5IWAK 5D78A 3V6DA 3G4SS 4I68A 5G4DA 4CLTA 4JV1A 3NGSA 3LWLA 1IKYA 3VZHA 2VFSA 1PGZA 2D7SA 2YKOA 3EY1A 4FM0A 4NLOA 5KFQA 2CYYA 1WORA 4YB7A 2EFOA 4JKGB 1WACA 3JS6A 3O2IA 4DL4A 2XNRA 5H9FJ 3CJ0A 3LGNA 1S57A 1FT8A 4LF7J 1N34F 1QZ5A 4JB8B 2HYIB 4DV5J 5G0RB 2FSJA 2V8HA 3GDQA 4KHPK 3KLIA 4URSA 2O8DA 1PCAA 3T9NA 3VVUA 2K3IA 3MEDA 3H08A 2YKMB 3GSIA 4CTAB 2DGXA 4BE1A 4C6AA 3P96A 4EGLA 1GEHA 3MFIA 3J81j 4BRMA 3NNCA 4JNEA 2D1KA 2NLWA 1MNEA 5LMNF 4F25A 5F0XA 4YDUC 3S6EA 3R1XA 3Q8VA 4ID8A 1H2VZ 1IBLJ 1JX4A 4LF8F 3MEKA 2HFSA 5DETA 4NLPA 4GKJF 3M30B 1BWEA 2IM2A 2AHOB 3LDLA 4YB6A 3C16B 3R5DA 4QPXA 3DOLB 4FWKA 1B7YB 3AVIA 3IMXA 3LPUA 4M5HA 3IRXA 2DEIA 1BG3A 2E2PA 2P5GA 1K8KA 3DKDA 2NXCA 4J2DA 3NDKA 3EZWA 1YJ7A 1WHWA 2I5JA 5B09A 1RWNB 4CGJA 3HKWA 2L41A 3MM6A 1H0HB 4I2QA 4I67A 3VQ5A 1JXEA 2YVSA 5C7PA 4HUFA 4ZHRA 2E20A 2A6AA 4DL2A 3TRGA 3KK2A 1HYSB 2XYHB 3FGVA 3R9LA 2YHBA 2Q1LA 1HA1A 4BR4A 1EHWA 1F6TA 4ECYA 2CQBA 2LXIA 2LCWA 2AW0A 2AGOA 4NEYA 3MWPA 5GIPA 4M94A 1B0PA 4AQYK 2NYIA 1NK0A 2PA8D 5FLXY 4AL7A 4HCCA 3BP8A 3CJ3A 3QZ8A 3MTKA 3ZNUA 1N5QA 1B99A 1F5AA 3OYFA 5K14A 4P7VA 2RU9A 2MLYA 2O3DA 3C6TA 2YY3A 3VQBA 5KT7A 3OR2A 1J2VA 4KFBA 3ZSOA 5I3UA 4MTPA 1VRUA 3I55S 1VQON 1FJGJ 4KHYA 2KB2A 3GQCA 2G9OA 4K2JA 2X6SA 5KT2A 4FZVA 1S0OA 3TI0A 1NHKL 4MO5A 3A8EA 1HD1A 2IFXA 3V5RA 1AW0A 4G1IA 4DR1J 2IVMA 5L8RC 3SJJA 4BRLA 2Z2MA 1IKXB 2CADA 4JI8K 4JK7A 4GVBA 2VYPA 1UFWA 3SXLA 3AGRA 3CJ1A 1UW4A 3O6QA 2ZZMA 1LW2A 2R9LA 4IDKB 5IT9Y 2DHSA 4I56A 1J53A 3AY0A 4RW9B 3H42A 3K9KA 1QHTA 3BGRB 4YFUA 3CW2C 2UXBJ 1R31A 2E5HA 2QIFA 5RUBA 2F96A 1EX8A 3A12A 3FZMA 4O8KA 3HD1A 2KZZA 4LF4K 1W2BM 3CO0P 4W98A 4ZN3A 5B0FA 1VRQC 4CM0A 1BE4A 2JL9A 4H03B 4UUXA 1HNXK 4FXVA 3HF5A 3FZBA 2CNOB 5A8RB 5ADZA 2O8FA 5HLFB 1FVSA 5SUHA 2LXFA 1ZXOA 1UVMA 4IR1A 4CLPA 3AJ1A 4LSZB 4IO8A 1FXDA 3BZCA 1NUEA 3ZETB 1Y9OA 2V52B 4LRBA 4FPIA 1S49A 4CFAA 4ECVA 3OLBA 5DDOC 1XR6A 3FZLA 4L73A 2CJKA 2GHVC 4DPOA 5C24B 2NXJA 1W25A 1T6CA 4ED5A 1U1QA 4DV3F 3D67A 3ULHA 1JLCA 3IS9B 1R8BA 4ILMA 4FPAA 5A76A 1OY9A 4NX9A 4FWOA 3L2WA 1AZSB 1YIJN 3MZIA 4HVJA 3OFHA 4Z4HA 1XTZA 4HLBA 2UXBF 2ZE2B 3BKTA 1CBKA 4KHNA 2QK9A 4OKJA 2Q3PA 2AA4A 1PILA 2MYFA 2YHAA 2YPYA 3ID6A 1S1TB 3ZT1A 1U7LA 3KUGA 4DV4F 2Q1NA 3JSRA 2IIRA 2BKPA 2ZHOA 3ZT3A 2ZKUA 3OW2M 2DYAA 4IOAL 2NUBA 3C0BA 4KFBB 1HWIA 3BBCA 2O1PA 1OYDA 2QA2A 3M1FA 1WDTA 1XIQA 4DR1F 3KLIB 4K0KJ 1N32K 4J5OA 1QAIA 3UN2A 1RABB 3THPA 2UU9F 1X60A 3TANA 4KREA 2GIFA 1HBUB 2EK6A 3ZTPA 3GE9A 1C0MA 1OPIA 4IWVA 3L7PA 3THYA 4HHTA 4BR5A 3JAMU 4ZVSB 5AE3A 2E44A 2K8GA 3N6LA 1KXPA 3HHNB 3EXCX 4M3ZA 1LCUA 4FN5A 1VC5A 3C15B 2DHAA 3TTDA 2OFGX 4IEIA 2LQ8A 3UN5A 3CMEN 5AE1A 2RKIB 2L48A 3SPZA 5KFFA 4MK9A 5CCMA 1XK8A 2SXLA 4M3RA 4C1NK 2RDIA 3NBPB 2E66A 3SDEB 4KE5A 2MEWA 3X1LB 3S1TA 3FE1A 1FJGK 1SQGA 1SJ1A 2VIHA 1PJ6A 2FGOA 3E01B 2I5JB 2B7CB 2K1RB 4R79A 4ZVFA 2YKMA 2QA4N 2KH9A 4AL5A 1TQLA 3VOVA 4FJ7A 2WTFA 1XC3A 1SVDA 1ZBSA 3RGIA 2A3JA 1V5IB 4YP3A 3AVCA 3CJ8A 1EIYB 3E8OA 4CERA 3LL3A 4FJXA 5KG0A 4CJVA 4GMJB 4GY2B 1HBMA 1RFQA 4KHUA 2YWWA 4DL5A 4DR7J 3IS9A 3FZKA 4G65A 2J0XA 3OYGA 2FHJA 3BEXA 4DEZA 1IBLF 3LM9A 1BOTO 1YK9A 4QQBA 3JSMB 3CCWA 4O0NA 3NEKA 1T6DA 4CT8A 3V1OA 1KLMA 1DLOB 1IQZA 3L6QA 4WTYA 3S3OA 4LF8K 3I56S 1N34J 2UXBK 4LF7F 1C4AA 1HARA 2JWNA 3O9QA 1MMLA 2MGZB 1EKSA 1MW7A 1S48A 1B3TA 2DPIA 3IUCA 2AX1A 5CYMB 4X2BA 2GMHA 4BHQA 2F8SA 4DG1A 3GE1A 3VENA 2XHCA 3SEOA 2DNLA 3DXSX 1N5VA 1XMQF 4OI4A 2DNRA 2R8KA 3AY9A 2LU2A 3LP1A 4OYAA 3CC4S 2EI5A 5AQRA 3EZ5A 1BCMA 4A5BA 3DXMB 3IM9A 2VKZG 3W5XA 4OGCA 4QU7A 3EXYA 1EQYA 3OYDA 4WFAL 4WE1A 1QSYA 2ACMA 2FC0A 4DV1F 3TR8A 4C8OA 1WUUA 4X65J 1EKEA 2G8HA 3QO9A 2DNYA 5J2MB 4CF1A 2HQCA 3LAKA 2W2QP 4R0JA 4NYNA 1BC6A 1HNWF 2GUIA 4HKQA 3EKUA 4NXNK 1RBAA 3I0SA 5AJ3K 2CNLB 3QWUA 4RUHA 1E6VB 1MROA 3LM2A 1XERA 3GYXB 1LEOA 1YHQN 4LVOP 4DUZK 4YOWA 3H25A 2HBMA 2PAVA 1ZYQA 1NK6A 3TAPA 2O8CB 3W65A 1VQ8N 4QU6A 2ZBCA 3MN5A 2YV0X 2W4DA 1MWQA 1SKRA 3QQCD 2PIIA 3TJ9A 4OJRA 1VQ9S 4WF9L 3HHLA 4Q2MA 1P1TA 4FKYA 1R59O 3RTVA 2WCXA 1V3ZA 2JDJA 1SUQB 2FLPA 3QATA 3C6UA 4C4WA 4JI0K 3F41A 4QR2A 2D3ZA 3W3DA 4CESA 3OYCA 1JQGA 4R5PB 2DHGA 4J37A 1NGBA 1QAYA 5F9LA 1F0XA 4OIXA 3CFPA 2Q6BA 4PQUA 2XMJA 1RT6B 1RT7A 2LLZA 1YTUA 1HQUB 3H2UB 2AGQA 4WXOA 3AARA 1I3AA 4WBFA 4O3RA 1NJYA 3BO2A 4JI0J 3K9JA 4FW1A 1IQTA 4O3QA 3BSOA 3TNVA 3HDSA 2FBYA 2CQ4A 4EYIB 2VF3A 2VG5A 3J81U 4TU7A 1OH8A 1ROFA 1KLMB 4CZHA 1IKWA 3HVRA 5CXTA 2M3DA 5A2QU 2D3OR 2FUG9 2DNGA 3CIMA 2L9NA 3FFIA 4JI8J 1KHWA 3D2WA 2ZHAA 3CJ2A 4DSEA 4H4MB 1PG5B 1S0MA 3PYEA 4YHHF 3FR0A 1ACMB 4EFAC 2XLKA 3TX8A 4LBHA 1U0HB 3Q7BA 2OPSA 2FHMA 3W2VA 1U04A 2NLXA 3QFHA 3AODA 4WYBA 3WNGA 4FBUA 3KXDA 1HR0K 3WHIA 1X5SA 1T8EA 4CHZA 2YNFA 2HHQA 5KG7A 4C23A 5HVHA 3MUVP 1X3NA 4O44A 2DK2A 3BO4A 2MZSA 3SSRA 1T7PA 2PBDA 1YJ9S 1CEZA 1RHRB 1T95A 4BC5A 1NGCA 1UP1A 2JC0A 4C2MA 5MLCV 4WK3A 3N28A 1HBUA 1R0BG 1G7CB 5IWAJ 2KYXA 4LF5F 4DV7K 3ET6A 1NWKA 4M41A 1ZTWA 4XAKA 1ZBIA 4NL5A 1U02A 2CJAA 2R7TA 1FDBA 1RAAB 1SKUB 4LJMA 2IAJA 3WZ0A 4DR6F 1NGEA 5F8HA 2MZRA 4B9QA 1S6QA 2QMWA 3RU0A 3QSYB 4G1QB 2DRBA 5IT4A 1VQLN 1GX5A 3IWNC 5HATA 3T9ZA 2QWPA 3J7ZO 3D2EA 5EWFA 4NXMF 1MWMA 4ZIWA 2E5IA 1RBUA 1DTTB 4MQ3A 4NYPA 2KTQA 1PJ7A 4JI6J 3MM9B 2EBGA 1KQSR 5JS2A 2FVSA 3CO9A 3GCXP 3HCXA 3D7EO 2HQ3A 4KPCA 1WDDA 4HTLA 4BRGA 3PSIA 3GIKA 4Z4CA 3JQKA 4FJGA 2IYGA 3M1VB 4X4OA 5IT9U 3ONQA 1AYEA 3QEWA 3OR2B 3GYGA 2FHOB 2E5LK 3NGRA 1CXQA 2CPFA 1YIJS 1JJHA 3SI6A 4K0KK 1JXLA 3NGUA 1QLNA 2YWGA 2WVBA 1KQSM 1WTBA 2ZVSA 4ID5A 4OZ3A 2VPWB 3OS0A 1VBZA 2Q3SA 4UOHA 1U0SA 1YVFA 3DJCA 3FEXB 3DXMA 1VJWA 1JCEA 4GVBB 1OH5A 2IM1A 4PG7A 1SC4B 1TVRA 1C4CA 1F60B 4LBIA 4EBDA 2MXYA 2Y1IA 1HNZF 1U0HA 4WIIA 5J1PA 4ZIVA 4FKXA 4USHA 1HWJA 3MGJA 3VF0B 4A8XA 1B7FA 4JS4A 1D9FA 3N01A 2OTLS 1SV5A 3FRYA 2B51A 2XLIA 1FW6A 3I6PA 3G10A 1WG1A 5G0RA 5E33A 5LJWA 1FNXH 2MKIA 2UUCK 2PA3A 3O08A 3ZX3A 5GVQA 1FEHA 1ZM4A 2DTUA 3MXHP 1PC5A 4K4XA 5AQZA 4ED8A 3C2PA 2M4MA 4O4GB 1JLFA 1RU1A 1R43A 3QEIA 2E29A 1EQMA 3UW1A 3GIJA 1ILYA 4CHPA 1RCXB 1NGGA 4QWAA 1YVUA 4K7QA 4P71A 5AZIB 1WEXA 2NUHA 3W8GA 3M6WA 3MD3A 2ETJA 2W42A 3F2KA 3T7ZA 1WBBA 2R7WA 3FEZA 3VAHA 3IBFB 2QEXS 2YCHA 1RACB 2Z0GA 3H2VE 3D9BA 1WI6A 2UUCF 1Y00A 3LP3A 1IN0A 4JUZA 4JI2J 2AU0A 4C0BA 2OKQA 4IQMA 1CJTB 3M2UB 5MLCQ 4OX9J 3MN7A 3GIMA 2CFXA 2IVPA 4BRAA 2W4CA 3Q83A 5DM6Q 1VSKA 2HGLA 2PGCA 1T9YA 1IR1A 4IDHA 3TAFA 4O0JA 1YJNN 1EKRA 1JCFA 3NCRA 3Q24A 5SWMA 3A3OB 2IRUA 4F8RA 3CERA 3LW5C 2CQDA 2IGIA 1RADB 2EFNA 1HBOA 4DR3J 1IBCB 2CPYA 1F5CA 2AEMA 4JI3F 4YDDB 1WF0A 2W1BA 1VQ9N 1X4CA 3LGMA 4CRJA 3CQXA 3F0NA 5HP1A 3UD3P 3UDEA 5E3RA 5HMWA 2NCKL 4U8VA 3WDOA 4CZEA 5F1XA 2Z2LA 4F4AA 1RT6A 3R6GB 2H5EA 2HWIA 1T9UA 2KM8C 3VGKA 4NZ0A 2DFEA 2ATCB 3BZQA 3O5BA 5H1SV 1Q86T 4TY8A 3DYAA 3T1HK 1BUXA 2CPZA 3AO1A 2P9IA 3J81Y 3VALA 5C25B 3HL8A 2X78A 1H2UX 5E41A 4KHPJ 3PW7A 3RB0A 1YBTA 2C2EA 3AQOA 3KLGA 3LP0B 3T1HJ 1TKTB 2HRUA 2YX1A 4NLXA 2CWKA 2JOQA 3JXOA 3PDNA 2B7BB 2XMAA 3RUBL 4X84A 4NA2A 4NYFA 1X3MA 4KH6A 5FPMA 5CE3A 2ZWHA 4DV2J 1XNQF 3CIPA 1NRKA 1NU4A 4F4XA 4PABA 1WHXA 2EX3A 3KMSA 3MWTA 9ATCB 1RWVB 3C19A 3P5JA 1IG8A 4O44B 3PNIA 2DR7A 4JI7F 4ZPTR 2J0WA 1B92A 5AQVA 4QWEA 1CULA 1VYAA 3NF8A 1IBMK 3ATVA 3MM9A 1X5PA 2YNGA 1APSA 3MMCB 3E1YA 2KI2A 3I55N 3FSIA 1KSPA 2K3KA 2EWSA 3DLLQ 2KG0A 5HROB 1Q81O 3CDUA 4ZPAA 1FRLA 3S3NA 3NOGA 5ETPA 2F8MA 4MLHA 4GRSA 4BGAA 1VSHA 4XDDA 4HYKA 4D3HA 2FSNA 5EWGA 4OYOA 1HKGA 4I4BA 1LK7A 5GIOA 4L72B 1S76D 1HJOA 3UD4P 1HMVB 4FVMA 1YG0A 3DRRA 4TQSA 4B1VA 3MD1A 4ZN1A 1I94K 4OYWA 3O3HA 1BA0A 2XG8A 4IG3B 1BXNA 1TK0A 3ITHA 4IFYB 5KT6A 4RUBA 3VF4A 4ZP9A 1RA6A 2OCEA 3DM2B 3V1QA 5CZ2A 2HWTA 4H0TB 1REVB 1P9QC 3I56N 3BKFA 3A8KA 2JLEA 3BDEA 1XN9A 5A8WA 1FDDA 3OV7A 3OQ2A 3CSKA 3OXFA 4ZCMA 4RNHA 1N36F 4OZ5A 2PI5A 2V94A 4IOAQ 1C2PA 1ASWA 1Q53A 2H48B 1S79A 3U1LA 3ZSQA 4CW7B 2EXUA 4CT9A 4IRDA 2ZOGA 2E5LF 1OVQA 3DLJA 4EMDA 4E98A 1H38A 5A0YA 2M70A 3TSUA 2BW2A 2E88A 1N0VC 4O3PA 3CJ5A 5BXIA 1NJIO 2VONA 4UY8T 2DGQA 3NGKA 1LFPA 3R97A 2E2NA 2V4RA 2P9SB 4H0XB 4LH4A 2CWXA 3O1LA 5LM7E 2BA9A 3UR0A 1D0EA 1IUJA 2F9TA 3L8BA 2PYLA 2HQGA 5AQOA 4DU4A 4TU8A 1SH3A 1JJ2R 5ETOA 4DF4A 2EEYA 2ZFHA 3MECA 2NYHA 3H5YA 4MMOA 3IMQJ 1NSKL 1S1UA 4J2BA 2H5JB 4DR3K 4FZZA 3D3BJ 3PG9A 3ZT2A 4CP5A 1Y3KA 3A8IA 5DMRA 3BSCA 5BJRA 3K5MA 2QJ3A 3IP0A 2DITA 4ILLA 3CD7A 4BRFA 3R5BA 1VISA 3JAMO 2MJUA 4G9ZA 1I1GA 1NKBA 5F8GA 1HLWA 3RZAA 2NRWA 2DBBA 5HL7L 1Q8LA 4C0OC 4ED6A 1J5EF 4GMKA 4IOBA 1B9FA 4JRPA 5EHHA 2KW4A 1RBRA 3FCWA 3GFYA 1U2VA 1NMDA 1SH0A 1D09B 1T9WA 3JSBA 2AP1A 1WSHA 3IR7B 3DRYA 2QFJA 1YHQS 3M5RA 1G15A 4L3QA 1PO6A 2K2PA 1DHMA 4H54A 1KLNA 1XR5A 3DXBA 4FK2A 4DQPA 2V2VA 2UVVA 4RW6A 3TABA 1BU6O 4CF9A 3E2EA 2RAQA 4U6PA 1TL3B 1Z05A 3RVCA 5LSRA 3TU5A 3DM2A 2V2ZA 4V1Ak 1GLAG 3NS5A 1YJ9N 3NMRA 1MLAA 3D68A 1RI7A 4TLQA 3A5LC 3PUFA 2OI2A 4CEBA 5JVHQ 1R8PA 4ZPDA 2YNIA 5GMKa 2J6UA 2IBOA 5KFLA 3B4MA 3CMES 5LOQA 3F44A 1BHLA 4KHMA 3C94A 2J8SA 5J1EA 3TUPA 2PE8A 3MPYA 3VAIA 2JFDA 3DDKA 4CBUA 3SPYA 1RDBA 5F41A 2J7WA 4FJ5A 4HH0A 3TOQA 4HDGA 2V0NA 2CKWA 1RDUA 2NRVA 1G2EA 5KPRA 2E1PA 2DT9A 4JOUA 4A46A 5I9EB 1DZ5A 3M30A 1CLFA 3CM6A 5AQHA 4M5NA 4CJKA 3MR2A 3WIUA 3DLLL 1S5JA 2HHWA 4Z7CA 1XNRF 3UVJB 2PFDA 3ELHA 4AILC 5CD4H 2ITMA 2XWYA 4M5DB 4ZTJA 2J9EA 1VHXA 3AT1B 1J54A 2JFKA 4FCYA 3F73A 3CCVS 5E3QA 4FW2A 3JS9A 3R8YA 3KKSA 2GS8A 3KG4A 1VQ7N 1RYRA 3PIPL 4NI2B 2VJUA 5KFPA 1N54B 3VGLA 1UA0A 1NGJA 2EFGA 3N79A 4ETZA 1RT4B 3J7Z5 2MKYA 4MO4A 3TYTA 4WF9Q 4LD0A 4RO0A 1RDAA 2OPQB 2MZQA 1CULB 3OT9A 1TYQA 4KH0B 3RBZA 4KV8B 1QE1A 1WAFA 1AB8A 5B7WA 3NHGA 5DG9A 2FC8A 2A0FB 1XHZA 2UV8A 2F4VF 4JP8A 1S99A 1R0AB 2BMBA 3ZZUA 4EP5A 5IM0A 1OH6A 3VAKA 4V19X 3CCLN 4BQLA 3IFEA 4Y0FA 5TKYA 1Q82T 3THWA 2YKPA 1BI4A 2UXDK 4CK1A 2RSQA 1EWQA 4IFVB 2MHEA 1SKSA 3KHHA 1WC5A 5A8WB 1ZPWX 4Y6IA 4MYUA 5FLXO 5BPLA 3GV8B 2ASJA 4GKJK 1VQ6S 4PAAA 4GO7X 4PR6A 1RLCL 5GADI 1OVYA 4DR7K 1SL1A 3QMQA 4ILRA 1NH7A 1ICEB 5HANA 3DRRB 1NXIA 4BC4A 3CCMS 3E9PA 1ZBLA 4KC5A 4O3OA 3OYEA 4JI4K 3SFUA 2GQCA 3QICA 2J76E 3V1RA 3A8YA 3O44A 2CDQA 3FFKB 4DR6K 1G3OA 2VWBA 2H3GX 2P9LA 1AXQA 1HIYA 5T7LB 1VIOA 2ADCA 4FWLA 1S1XA 4ZP6A 2NZ4A 1YJWN 1JLFB 4HEA9 2ZOMA 4GV3A 2V7ZA 4DV3K 4M3YA 2MZ1A 4Y2AA 2YQ3A 4CJFA 2HBYB 1HPZB 3TAMA 3OD2A 3ZXWA 4ED0A 4RWTA 4AUKA 3IBWA 1Q81T 2BVZA 1TFWA 2GHWA 1KBRA 2YX6A 2ZBQA 4O0IA 3HVTB 1X5TA 5IOLA 2BANB 1HNXF 1QVGM 3DOMB 4B02A 5ETSA 3CHWA 3QJPA 4H5NA 4EO8A 1LWXA 3SQGB 1FHTA 1KKHA 2DD8S 4PZVA 2UUBF 1NLKL 1WC4A 3VGVA 1NLVA 4IFVA 3V2UC 3NG8A 1JLQA 1OWXA 4YOYA 5AFUH 1XMOK 4EIAA 5L1JA 4EFHA 2MQQA 2JSXA 1UZHA 3AOAA 1J27A 2NREA 3D6MB 1B0TA 1T03A 2V34A 3SMSA 3O4QA 3BV8A 3Q89A 3QT8A 3HT0A 2PZSA 5L38A 3BF1A 4RW7A 2N82B 3AVFA 4DPYA 2FPHX 3ZTSA 1C1BA 4C11B 3UKRB 1QHAA 3VGSA 3MM8B 4DSKA 4Q0BB 3R5JB 2BRLA 2P9LB 1RWXB 2MKCA 1OS5A 4ZVOB 2CIMA 1YJUA 1GNKA 5KFDA 2EPIA 4M7YA 2W8LA 1UAXA 3WNEA 4QOTA 4Q8FA 2RPIA 4OX7A 4D3GA 3BF3A 3CD0A 1VHIA 5E3CA 3VQDA 4N41A 4Q8EA 1WSRA 3ATUA 2GGPB 3SFGA 1RT1B 2FD2A 5T7BA 5LY3A 5KT5A 5M1OA 3GFZA 1VQKN 3MN6A 3VEYA 4FLTA 1YLXA 1VSMA 3CJKA 3ISZA 1FXLA 3PJXA 2H1YA 4PCQA 4DV6J 2XSJB 3D6RA 4KHQA 2JHEA 3E3XA 4J2AA 1CPZA 4QOZB 3I5CA 1SPBP 1FKAF 1U26A 5GAHP 3F5TA 2A18A 2R7RA 4USTA 3R1HA 3SBTA 4UZBA 1JJ2M 2OP5A 3KUHA 4P2SA 3PIOQ 3PZPA 2O8DB 2B6AB 4ZVHA 3AO5A 4Y28C 1YJWS 4FNHA 5C2GA 4PG5A 3IR5B 3WNFA 2E9TA 3SAFA 1RWPB 1IBMF 4PWDA 3ZC4A 1VOMA 2UXCF 3NKYA 1EZZB 3VAMA 2G1DA 4IFEA 4QR0A 2WAQD 1XMOF 4N5SA 4IO9L 4M3XA 3HSGA 4CJUA 4DL0C 2DGTA 1WNEA 1JLQB 1K44A 1U8WA 3MMVA 4BLGA 3EE9A 2KVIA 1TL4A 5TKWA 4OVLA 4M5DA 1QD1A 4KO0B 1ZTTA 1EB0A 4JYAJ 1LQ9A 3SV3A 4YY3J 2VWKA 3SUOA 3MPWA 4KYZA 2YBVA 1CJTA 2A1RA 1E6YB 2YKNB 5DS7A 4BR0A 1BISA 2KFNA 3QB0A 1Q7YO 4RW4A 3OTEA 3L95X 4IG3A 1IO2A 3Q22A 4ZCKA 1U1KA 4GW6A 4J91A 4QWCA 2YWEA 2C2ZB 3L7UA 2ROGA 2N7CA 4JI1J 1S4FA 1HQ2A 3ENOA 3FLCO 3LP2B 3DLGA 2FTRA 3NF6A 1RDWX 1R7IA 5FJ4A 2VL1A 4BC3A 1VQ4N 3PEJA 4RNNA 1DTQA 1VQMS 1NNEA 1DQ8A 4ERDA 3NGTA 4YY3F 4CO2A 2V8VA 4JYAF 1WEYA 3D0PA 1KEKA 3M2VA 3O3GA 1FNOA 4G6VB 3QIPA 3UDVA 1D5AA 3M6UA 4WE1B 3OUYB 3M8PA 4A8QA 1T3NA 1YBAA 4CCHA 1OYEA 1HKBA 3JYTA 4F4WA 4B9VA 1KC8T 2R4FA 4OPJA 1K9MO 1DKGD 1MWKA 5BREA 4RWWA 1DY3A 3C95A 5JMVA 2FJWA 3P4IA 4U7BA 2B4VA 3R1LA 3H3NO 2W6KA 4TN2A 2RMLA 5AFUA 4X4PA 4DPUA 2YKNA 2NQPA 4B3SF 3T19A 3TZZA 3AA3A 2YJEA 1F21A 2CGJA 2F5GA 2HFNA 3CJTA 1CQMA 3HM8A 3DMJA 1FK9A 1EP4A 2LU1A 3CTRA 4LF5K 5CABA 1VC6A 5J1NA 4FLVA 4E0DA 4M5IA 3HPHA 4DV6F 2HLTA 2F8TA 1JWWA 3CYMA 4DR1K 4BR9A 3MR7A 1YBUA 1KONA 4F2SA 1P1LA 1WD6A 3PTWA 1M1KT 3MF5A 1T05A 4ZVTB 5KTQA 1RBLA 3U7JA 4BRCA 2JJ4D 4LQ9A 5I42A 4DSFA 2YI1A 4P9SA 2AYBA 1N56A 5E3PA 1U1LA 2J9DA 2Y0SD 4CLKA 4WP9A 1IKWB 2MZJA 4LMZA 3HVWA 4N7TA 4J9OA 1Q4RA 4CJWA 2AYEA 1HW9A 4AE5A 1NKCA 1HMVA 4EBEA 2VWJA 1TFYA 3L3UA 1EJ7L 4F67A 2ZNYA 1FRMA 2BKNA 4A47A 1RCOB 4DBQA 4A62A 5KT4A 4UOCA 2JH3A 4K2XA 3KFWX 2E6LA 2MTLA 1Y4ZB 4EU0A 4R8UB 2ZBPA 4LFCF 3RRKA 1YI2S 2OMLA 2IM0A 2NXEA 5M1FA 2YNHB 3MDFA 4CLFA 4YY3K 3BF4A 1KTQA 3E51A 4PUOA 2ZH3A 4JKDA 3EEQA 2MKKA 3BSNA 1KP6A 3QZ7A 2B4JA 2LEPA 2CG8A 5F3TA 1B64A 3CETA 2YX4A 4JBCA 1RWOB 4ZLPA 4USIA 4FLXA 3FVYA 5KFOA 3RMCA 5KFWA 2UUBJ 1U49A 4DV2K 4HL9A 1BHNA 4LF4F 1U4BA 3HHLD 2MQ8A 3Q8UA 3T1YJ 5AJ3J 4LF6K 3J7ZT 3UDLA 1WHYA 4FNIA 5D8HB 4BC9A 3HVAA 1RBVA 5B0AA 3AAPA 2VUGA 1XMQK 3G8SA 5ETRA 4KHRA 2ZBIA 3DOKA 3SIPB 3B6OA 4FOEA 2YHWA 2QV6A 2OHDA 2Q31A 3MAHA 4IKFA 5BRFA 4J7CA 5HMXA 4B3TK 4K8ZA 3KK1B 3RSEA 3TWHA 2YJFA 3RW7A 5KFRA 1NK4A 1CQNA 3OYLA 1N36K 3HBTA 3R2DJ 3T1AA 3SNNA 4J2EA 4X4NA 2RHSB 5HI7A 5D6GA 3HZEA 3QT5A 1EARA 3JB9k 2G8IA 1RT5A 5DZ6A 2QG9B 1JXVA 2Q43A 3EDQB 1YZ7A 1ZAXA 3CD6S 1M5VC 4JV5F 4FL9A 2ASMA 4NLGA 1FRKA 4JI4F 5ITHA 2UYTA 5HMZA 4NCGA 3R5GA 3T3FA 4UZCA 3U02A 5EVZA 4KB0A 4Q2LA 1VQ5S 1VHFA 3MAAB 1ZBHA 1C1CB 3DRXA 4RWXA 1FTCA 2OZSA 2YQ1A 1U48A 1VDHA 4ZPCA 1JJ4A 3IAYA 1RT3A 1HR0J 3DN9A 1OO0B 1C1AA 5FDLA 1TGOA 3LP2A 1G4CA 5C2FA 2OLWA 2W9CB 1SV5B 4HACB 1LWEA 1RZMA 3QPIA 4JI5F 3AO4A 1M5HA 1SI9A 3VQ7A 3M9MB 4CHYA 3VGMA 2W2MP 2H3EB 1U2RA 5J1EB 4PHTX 2BJ7A 2FLNA 1CS4B 1H74A 1C0UA 3EUNA 3MM5A 3P5BP 1ZM2A 5DDPC 4OJ3A 3V6HA 1EWRA 2KU7A 2PSZA 3NCIA 4TYAA 5D3GB 5FRNA 1FWKA 3DOLA 1UWBA 3BY5A 2F4FA 5JMNA 4B9UA 2Z57B 3SAGA 2JZ5A 2F8HA 3I0SB 2OMOA 2MLXA 5E2QA 2EWHA 1YUWA 1E6VA 4LF6F 4LVNP 1P27B 4YEAA 4CK2A 5IQ6A 2YXLA 4KAZA 2KLAA 1BGXT 2HGNA 2NPIA 2XGPA 2KJWA 2GW8A 2RU3A 1VQNN 1H98A 1CSJA 3RMAA 1KDNA 2DR9A 3VR1A 3CVKA 3U8XA 4B3TF 5ETKA 4KSEB 2Z1IA 2HSTA 1YGYA 3GFHA 3MAAA 2ZH9A 1SAZA 4GV6A 4ILHA 3NGDA 3T5JA 5F2RA 3LO3A 4BVPA 5AQMA 1CJUA 2W9BA 3T1YK 4ZVGA 3BB5A 3O1BA 4QWBA 2F65A 1TL7A 1HBOB 2XO6A 4QIEA 3IFRA 3H6EA 4U7CA 5GAEI 4PKHA 2IC3B 2D69A 1VQSA 2HHSA 4HCBA 3R8EA 4R8UA 3BQ1A 3TUIC 3U1NA 3M8ZA 4YMEA 4LIWA 3OVBA 5AQKA 4LSNA 3MXIA 1N88A 3ZZTA 4DQIA 2OGUA 3JTPA 1RAHB 1G99A 4TY8B 3BS9A 1DRZA 1VQ6N 1R6YA 3KNAA 1DEJA 4LF6J 3B4DA 4LREA 1DQAA 1WEZA 1YT3A 5J2QA 2JEIA 1FERA 3L09A 4YOVA 4MT1A 3BPSP 1T9VA 1U24A 1PIEA