1IKVA

K103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
557
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 147
structure length 556
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikvA05
3V1OA 3D45A 3OYCA 3OS2A 5FRMA 2QV6A 1A5VA 2B4JA 4DTUA 4NRTA 1I39A 2PYLA 3CJ5A 3NH1A 1ZBUA 4DTRA 2XY6A 3G86A 3O4NA 1JLBB 3RMDA 3VQ8A 3I0RA 4OPKA 2JEIA 2XI2A 1XI1A 4TY8B 2XY7A 4Z4IA 4QWAA 1CLQA 1TQLA 4CIEA 3B6OA 4EZ6A 1VSFA 4ZHRB 3OLBA 3NBPA 1HPZB 1ITGA 1JXBA 4HVJA 4O3RA 3LZIA 1S1VB 1FK9A 4J9RA 3H2LA 1TV6A 1NK0A 1S5JA 1S1XA 2VG5A 2HMIA 2NUBA 3NGYA 4ELTA 1CXQA 4QWEA 3ISND 4CJEA 3HYFA 1D1UA 4Q8EA 5J2QB 5EWFA 1RT4A 1ZTTA 2RKIA 3L3VA 2W9BB 4K8ZA 2YNGB 3QGHA 3PJWA 4O4GB 4YFUA 2Y1IA 4K4ZA 1C0TB 3AVNA 4FBUA 1RTIA 4CGHA 4NLRA 4GC6A 2RPIA 5JUMA 3LAKA 2P1JA 4O0JA 1BIZA 4E1NA 5KT2A 3VA0A 4DQQA 5CYQA 3JSMB 4FYDA 3KLHA 4IG0A 1KLNA 4XO0A 4EO6A 3V1QA 3MFIA 4I7FA 3G6YA 1K1QA 2R8KA 3IRXA 3N6LA 1TL3A 1S1UA 5CZ2A 5KFWA 3QNOA 4OKKA 3RBEA 3CO9A 2D0CA 1JLGB 3HHKA 3QLHA 5KFZA 3MTKA 3OY9A 1NK8A 3QEPA 3KHGA 3E01B 3CDEA 1VSLA 3KK1A 3CM6A 4M3WA 3DI6B 1RDCA 3SV4A 1ZBFA 4WFZA 1VRTB 3SFUA 4Z4FA 1X9SA 5CY4A 1TK0A 4CGDA 4DMNA 3NGIA 4KTQA 3V6JA 2YNIB 1EX4A 2HNZA 4ZP9A 5D3GA 1D5AA 5SZTA 3OL9A 3BR9A 3NCIA 5J1EB 1U09A 2FBTA 3ZSZA 2VG7A 1MU2A 4CFDA 4DFKA 4H54A 3BSCA 5J2PA 2HW3A 4RNNA 4RG8A 2O4GA 1GOCA 3AA3A 4DF4A 3OYEA 3IGNA 3WNHA 3V6DB 2YHAA 3PJXA 3KJVB 4K4YA 2WONB 3ZSOA 2G8UA 4IKAA 3DRSB 1JLBA 1HYSB 1JLAA 4ELVA 3VQSA 4KI4A 1RDBA 1L5UA 4KAIA 3G6XA 4URGA 3AVBA 4YMEA 3MXIA 4TY8A 4Z4HA 4FJIA 5KFPA 1T03A 3RRGA 4N41A 2JEJA 4ZHRA 1HRHA 2W9CB 3GV7B 1DTTB 1HPZA 4I2QB 1WNEA 4ED0A 1S10A 4R5PB 3O3GA 5CYMB 3KK2B 5JXSA 4KV8B 4HUEA 2C2EA 1QSLA 3V6HA 1RA7A 4CGJA 4RUAA 3PW2A 5J2QA 2OH2A 2CJQA 3PX0A 2FVPA 4O4GA 3MR3A 4TQRA 1GOBA 1C0TA 2QE5A 4PA1A 3OYGA 2AGOA 2I5JB 2JC0A 4CHZA 1X1PA 3G0ZA 1T05B 1C1AA 1U45A 2QK9A 1NKEA 5K14A 4B9SA 3L8BA 1VSEA 1TK8A 4DTOA 4KKOB 3RBDA 5J2NA 2A1RA 3KLFB 3JSMA 1RT7B 5DQIA 5FROA 2BQ3A 1KHVA 2XC9A 4G1QB 1J53A 3H5XA 3PHEA 2E6MA 4MFBB 3BJYA 4IFYB 3K5MA 3BSOA 4KB1A 4NLXA 2FLLA 2GIRA 3SUNA 2RDIA 4N76A 3DLRA 4OL8A 3SJJA 2RDJA 2HVHA 3ICLA 4TYAA 3E01A 4AILC 3UQSA 3DI6A 3KLVA 1LAVA 3GIIA 1VRTA 2YKMB 3BQ0A 3VQ6A 2YNIA 3OYLA 4CEEA 1ZBLA 4ECUA 4ICLB 1BQMB 4E7JA 1NOYA 1VSMA 3ZSWA 3QINA 1BHLA 1ZTWA 5HROB 4DSFA 3PX4A 3OLAA 3S3OA 3HJFA 3QIDA 4F4KA 1S6QB 4L8RB 3MR5A 3KHLA 4CESA 5DLFA 1S97A 5T14A 3C94A 4ZTFA 1KVCA 2R2RA 3V6DA 4CEDA 3CJ3A 1GOAA 2ZE2B 1SUQB 4ZP7A 5KFMA 3KJVA 1CZBA 2WONA 4JV1A 5KFQA 3I5AA 3DRSA 1HYSA 1FKOB 3SCXA 2B6AA 1SKSA 4J2BA 2IC3B 2R8IA 3NGZA 3NH2A 2F8EX 2R8GA 2VWKA 4IR9A 4OPJA 4FM0A 5KFHA 5EWEA 4RZRA 4MQ3A 1WSGA 4W5RA 1RT6B 3OJSA 3K5LA 2W9CA 4ZP8A 4JS5A 3MFHA 2YHBA 3K57A 3T5HA 4FVMA 2BANB 1N4LA 1DTTA 3T3FA 4I2QA 4Z0UA 2OPQA 4RW6B 3H08A 3QEIA 1TGOA 3H5UA 4R5PA 5CYMA 3KK2A 3OJUA 4KV8A 3OL8A 4WYWA 4CJ3A 3NF7A 2YKNB 4DLGA 2FC0A 4FLZA 2ZD1B 3DOLB 4FS2A 4ID5B 5C5JA 5KFDA 4F3OA 4M95A 2YNHB 4OGEA 1D9FA 1LW2B 3LZJA 2VA2A 2WOMA 1CZ9A 1KFDA 4DL2A 2I5JA 4O3OA 4RNFA 4XPEA 4ZVGA 2XHBA 2WHOA 5KFFA 4CGIA 4IH5A 5KT3A 2R2SA 3KLIB 4KKOA 3HP6A 3T5KA 3Q8QB 1RT7A 3HPGA 4G1QA 1JLEB 2UUWA 1J9AA 4IFYA 4IH7A 3KIOA 4CEOA 4EBEA 1FKPB 4OLAA 3PR4A 3HVRA 3H4BA 4JLHA 3KD5E 2KQ2A 5DG9A 4HYKA 4KPYA 3AO5A 2IGIA 2YKMA 5KRTA 3NBPB 2J6SA 4RNHA 2YV0X 1RA6A 4ED8A 3ZSXA 2OA8A 5KFAA 4HCBA 3K58A 1SV5B 2V4QA 3MR2A 3HP9A 4B9UA 4ICLA 1BQMA 4O4RA 3L2RA 3PY8A 3SQ1A 1RBVA 4E89A 5KT6A 3KTQA 1TVRB 1T7PA 4DG1B 2VG5B 3K5NA 4KHUA 5HROA 4F4WA 1VRUB 2B5JA 4FJLA 1S6QA 1RT4B 1N56A 1Z25A 3MXMA 5KG0A 4MK9A 2E9ZA 3WNEA 4M3UA 2IM1A 4C8LA 1REVA 2HHQA 3VQAA 2ZE2A 4IRKA 2WB4A 1YTAA 1FKOA 3NKYA 5KFXA 2IC3A 4ECZA 4FJXA 2P51A 5SWMA 4B9VA 1WNSA 2FVCA 3RB3A 3OL7A 1CSJA 1RT6A 4IQXA 4UQGA 2RN2A 3OS1A 1RTDB 2O5DA 3P83D 4FLTA 3IRXB 2XO7A 3ZT4A 4NRUA 3GV5B 3LP1B 4RW6A 5KG4A 3HKWA 4MH8A 4AHTA 4FK2A 4W5OA 4C8OA 2UVWA 1BGXT 3DDKA 2YKNA 2GUIA 4NYFA 1YTUA 1JLFB 3DOLA 4IRDA 4ID5A 4IRCA 4ED3A 5DLGA 3RB6A 4ECSA 3JYTB 1JLCA 1F21A 4JS4A 1LW2A 3AVAA 3LWLA 3V9ZA 1XWLA 2EX3A 4HCCA 2I1RA 1MU2B 3CJ4A 3RAQA 5KGXA 1VSHA 2BRLA 3UR0A 5J2PB 3IS9B 3KLIA 4QCLA 3KOAA 3NH0A 5KRSA 4LD0A 3OYIA 3OS0A 3S9HA 3AO4A 3TANA 2ASJA 1S48A 2DPIA 1JLEA 2XY8A 1EETB 4GVMA 2A1SA 1KRPA 3AA5X 1XHXA 4MKBA 4NZ0A 5DG7A 1KFSA 3NGDA 4DSKA 3QEVA 4J2EA 1JLAB 2JLEA 4GW6A 5KG7A 1FKPA 3KKSA 4NYNA 3TARA 4O3QA 1BCMA 2HAIA 3UIQA 3HPOA 4DSLA 4O5BA 3DLEB 3TQ1A 1T03B 4XIUA 1FXXA 4C8KA 4KO0B 5I3UB 4DQRA 5JS2A 2E9RX 1ZETA 4CF1A 1NNDA 1SV5A 1QS4A 5FRNA 4FJKA 3VQ4A 3ITHB 2FBVA 1TVRA 3CM5A 4DG1A 4CHYA 4B3OB 3AVLA 4NLUA 1Q8IA 3RRHA 3TABA 5T7BA 1VRUA 5DQHA 1S6PB 2XY5A 3LP2B 2WK4A 4CHPA 2R8JA 3RMCA 3OHBA 2D5RA 3PO4A 3V4IB 5KFVA 4KHMA 5KTQA 1DTQB 2EC0A 3CYMA 3RTVA 5KFEA 3SQ0A 4YP3A 1LWCA 4K4UA 5K14B 3LPTA 4KHQA 5J2NB 2XWYA 4RW7B 2AX1A 5CZ1A 2XGPA 3GIMA 2HHTA 1Z26A 4CFCA 3VQ5A 2HNDB 5L9XA 1BCOA 3T1AA 1I6JA 1RTDA 4CHNA 4CEFA 1N5YB 2PZSA 4O3PA 3HM9A 3LP1A 2XRIA 3WNFA 4JRPA 3TI0A 2FVSA 4JV2A 1EP4B 1IKXB 4FM2A 4M3ZA 4NLOA 2HNYB 5KI6A 4CFAA 2V0NA 1L3TA 2BDPA 2G8IA 1BIUA 3D5MA 4KBIA 3VQ9A 1JLFA 4NLSA 3VQBA 2W42A 4CEQA 2LSNA 3JYTA 3QZ8A 4HKQA 2D7SA 2HWIA 2W8KA 4DQPA 3CG7A 3SNNA 3I0SA 4KHYA 2FBYA 5HLFB 1RT5B 1SL2A 1S0MA 3OYHA 4B9MA 3IS9A 4WFYA 4EZ9A 4CJQA 3U6FA 1S9EA 3QZ7A 3HVWA 2IS3A 3CDWA 2HHUA 1S49A 4YQWA 4KHRA 1EETA 1SL0A 4Q5VA 4FLYA 5KG5A 1SL1A 4Y3CA 3UPFA 3OYDA 1NJZA 1TP7A 1S0NA 4DTMA 4ZVFA 4RUCA 3AVMA 5DK5A 2B6AB 1L3SA 3BDPA 4MIBA 5HRRA 3G10A 2VG6B 5EUHA 3LP0B 2GV9A 3DLEA 4DL4A 3QIOA 3M8SA 3SQ4A 5EU7A 2X74A 4KO0A 4W5TA 5I3UA 4RNMA 4Z4EA 4FJ5A 4DTXA 2OPQB 2ILZA 3HO1A 1JXLA 1RT3A 3ITHA 2AX0A 4ZTJA 4B3OA 2JC1A 5KFRA 5C24B 5HBMB 3VQCA 4E1MA 1S6PA 4Z4CA 3LP2A 3SUQA 5I42B 3FRZA 3H98A 4ZPAA 1VSJA 1KSPA 3V4IA 4K4TA 3OVNA 4FJNA 3RWUA 3AVIA 3HL8A 2WOMB 4C8NA 1DTQA 3H5YA 4KTWA 4BWJA 3EYZA 4E7HA 1S1WB 4HUGA 3C95A 3OYNA 4RW7A 2WTFA 4K50A 3ZSVA 4J2AA 4PUOA 4R0EA 1RYRA 3TR8A 2HNDA 3RR8A 3V9XA 3NMAA 3H59A 2BE2B 1N5YA 5KFTA 3WNGA 3CFPA 4RNOA 2ZQBA 4X2BA 4NCAA 3ZCMA 3MEDB 3VQQA 3I8DA 1U4BA 1EP4A 1C1BB 1IKXA 1VSKA 2HNYA 3N6NA 3H4DA 3FFIB 1I3AA 1S9FA 3D28A 2Z1JA 3GIJA 2OPRB 4NLQA 4DEZA 4J9LA 1JLQB 3I5BA 1YVUA 3T19A 1SH3A 4AH9A 1L3VA 3EZUA 1WSFA 3ZT3A 4DL6A 4B9TA 5HP1B 3DLGA 5HLFA 1RT5A 3NDKA 3HVAA 1BI4B 1X9WA 4E7LA 3MECB 3BQ2A 1Q9XA 2ASDA 4QPXA 1WSIA 2B5JB 5DQGA 5KFOA 2X6SA 3MEGA 1U47A 3RB4A 3CJ2A 4IKFA 3H5SA 3KK3B 3BGRB 1IKVB 4RU9A 3MR6A 1REVB 5KT5A 2HHSA 2E4LA 3EY1A 1LWFA 3SYZA 1RT2B 3VQDA 5L1IA 4GMJB 3PVXA 1HNIB 3RR7A 4MKAA 2HHVA 2VG6A 3TVKA 4EEYA 3LP0A 3AV9A 3HXMA 3C6TB 1HYVA 1XR6A 2GIQA 2W9AA 5KFSA 5KFBA 4DSJA 5F8GA 4FJ9A 5KG6A 3TAFA 1KHWA 4CEAA 1RDDA 3NHGA 3MXJA 2OPPB 2KFNA 4OKJA 3DLKA 4ZPBA 4QAGA 3IGVA 5C24A 5HBMA 3NF9A 3FQLA 1D8YA 1JLCB 5KT7A 4NYZA 5I42A 3DLBA 2C2DA 1U48A 1TL1B 4CJLA 2R8HA 1VK0A 4IBNA 4Y1DA 4CK2A 3C6UB 2KW4A 2QKKA 2O4IA 4ELUA 4FW2A 4B8AB 3DM2B 4J2DA 4DL5A 3AO1A 1S1WA 3HK2A 3ULDA 4WZQA 3V6KA 3SFGA 3AA4A 3PO5A 3SV3A 1HNVA 1QSSA 5L1LA 4AHUA 3NE6A 4KFBB 4MIAA 5KFNA 4FLUA 4CJVA 3EPIA 1D9DA 2BE2A 4DQIA 4CF9A 2G8FA 3MEDA 5F8NA 1C1BA 1UA1A 4F4XA 1XR5A 1NK4A 3OHAA 1RDRA 2E6LA 4DS4A 1QAIA 3FFIA 3DYAB 4ZPDA 1LWEB 4CF0A 2G8HA 4DWIA 2OPRA 4HUFA 4O44A 1JLQA 1ASUA 3KMQA 4H4MA 4E19A 3LDSA 4FJHA 3ZSYA 2W7OA 4LSLA 4FCYA 3IG1B 5HP1A 3T5LA 1YT3A 1BI4A 3MECA 4ECTA 5KFJA 5F8JA 2IBKA 4Q43A 2ATLA 5F8MA 3M9NB 4YNQA 1NKCA 1QTMA 4OVLA 2X78A 1HQEB 3KK3A 4KRFA 3BGRA 4ECQA 1LW0B 1IKVA 4JRQA 1SKRA 4J9PA 4F3TA 4TXSA 4PY5A 3GYNA 4Y2AA 4NLPA 4B8CA 1IKWB 1RT2A 1J54A 1LWCB 1TKDA 4ECVA 4CGFA 2J6UA 3QO9B 1HNIA 3PW0A 2XGQA 1IKYB 2HB5A 4AHRA 4LH4A 1RBSA 3FDSA 2ATQA 1ZBIA 2PYJA 5J2MB 3F9KA 3C6TA 1RBRA 4N5SA 4M42A 2D3UA 1W25A 1D0EA 2V9WA 2ALZA 3K5OA 4CEZA 3OYJA 2FVQA 1RNHA 4TN2A 1Z4UA 4YR0A 1U49A 2OPPA 3Q8RB 3AVCA 3ZSQA 3D0PA 4Q8FA 2XCAA 3SI6A 2ETJA 4FJ7A 3CQ8A 4E7IA 4JV0A 5KG2A 4OKEA 4KAZA 1TL1A 2XCPA 4CJSA 3PW4A 1B9FA 2IDOA 3F73A 3LANA 3I0SB 3DLHA 3M9MB 2W8LA 4Z4GA 3C6UA 5JS1A 5F8HA 4CEBA 3DM2A 4IDKB 3QGIA 2IAJB 2HHWA 3RMAA 2OPSB 3L2WA 4F4YA 1S9EB 2IMWP 2IM2A 1UAXA 4CJWA 3CWJA 3CFRA 1S1TA 1W0HA 4KFBA 2F8TA 4MK8A 3PW7A 3GILA 3K2PA 1IH7A 2P5OA 1KTQA 1N6QB 4O0IA 3OSNA 3OYAA 4Y2CA 3PW5A 3QEWA 1RAJA 2HHXA 3DYAA 2AGQA 3KMSA 1LWEA 3DOKB 4KSEB 1QE1B 3M8QB 3OSPA 4F2SA 1SH2A 4WXOA 2FBXA 4TSXA 4DQSA 1NK7A 4DF8A 4FZXC 3V81A 4U6PA 3FSIA 3KLEB 4CJTA 2FJWA 4R8UB 1WAFA 1NOZA 3G6VA 1RT3B 3PUFA 4J9OA 3QNNA 3IG1A 4CK1A 4FM1A 3NAEA 4G3IA 1VSDA 1NK9A 4KREA 3O4QA 1C1CB 3SPYA 4ECXA 2UVVA 3AVKA 4TQSA 2HWHA 3P5JA 4QWCA 4ZMMA 1WSHA 3PZPA 4OJRA 2DPJA 4HHTA 1TKXA 1EKEA 1HQEA 4K4SA 1XHZA 1RT1A 1LW0A 2UUTA 2KTQA 4CF8A 4E0DA 4HTUA 2ITGA 3V9SA 1IKWA 5FDLB 2ILYA 4K4WA 4DFMA 4LQ9A 3NFAA 4M41A 3QO9A 4TLRA 1IKYA 4BWMA 3M8PA 3AVGA 5J2MA 1LAWA 1SKWA 4PUOB 1RTHB 2AQ4A 3O3HA 3L2UA 1IO2A 2VWJA 5KFLA 4FJ8A 2F8SA 2G8VA 4Q0BB 3AO2A 1T8EA 3DRRA 4E7KA 4NCBA 3DMJB 4DFPA 3CFOA 4QWBA 1C2PA 4KB7A 3RMBA 4H4OB 3P1GA 1BQNA 3LALA 4FLWA 2CKWA 2QXFA 4EP5A 2D3ZA 4NLYA 2R2UA 3ZT2A 2AJQA 4FLXA 4FBTA 4DSIA 4DSEA 2DTUA 2QKBA 4M3RA 2EHGA 4EBCA 4CE9A 2FJXA 4W5NA 1QSYA 1NJXA 3KLGB 1C0UA 3U3YA 3SQ2A 4WYLA 3AVFA 4AHSA 1ZYQA 4KHSA 3DLGB 5KG3A 3M9OB 4KB0A 4IDKA 2YNFB 1HQUA 3BSAA 4NLDA 2IAJA 2AU0A 4CJKA 1L3UA 4QOZB 4QW8A 5C25B 2OPSA 3MEGB 2J6TA 5KFCA 5KGWA 4ED6A 5L1KA 4Y34A 5L1JA 3S3NA 3OYFA 5F9NA 3PX6A 4K8XA 1X9MA 2OYQA 3IAYA 3TAMB 3H40A 3BREA 1LWFB 1N6QA 1GX5A 3LWMA 2KZZA 4DTSA 2DFEA 4FZZA 2KFZA 3HVTB 1XC9A 3UDLA 1RYSA 4FLVA 1UA0A 5KT4A 3ASMA 2OZMA 4RW9B 4DU4A 5F8LA 2Q3SA 4KTZA 3QESA 4OLBA 1WAJA 2Z1GA 4B9LA 3DOKA 1ASWA 3L2QA 1QE1A 3M8QA 1HJRA 5DGAA 4KI6A 4DL7A 3ISNC 3Q8SB 1KVBA 4JUZA 2Y1JA 1S0OA 4WE1B 1TKZB 3N6MA 4FK0A 3KLEA 4R8UA 4J9MA 2FLPA 4FZYA 4IOBA 4WFXA 5KFKA 3AA2A 3QERA 3ZSRA 4J9SA 4DU3A 3DLKB 3OYKA 1C1CA 1J5OB 2D0AA 2Z1IA 4LH5A 2DY4A 1WSEA 3KHRA 3K59A 4ED7A 3QYYA 1A5XA 4IG3B 3KNAA 4CJ4A 1CXUA 3TWHA 1S1VA 1QUVA 3KHHA 4RW8B 5KFIA 4DTPA 1JIHA 1JKHB 4TY9A 1DLOB 4H8KA 5E41A 1ASVA 5FDLA 1TAQA 2X6NA 4W5QA 2ZKUA 4BDPA 4EP4A 1NJYA 1WLJA 4K4XA 1IG9A 2GBZA 2W9BA 4M45A 5EWGA 2YNGA 2DFHA 3HPHA 1O1WA 4RW4B 4O55A 1HNVB 1B9DA 4CJRA 1RTHA 4LSNB 4KE5A 2RF2B 2IA6A 3U3GA 4I2PB 1UWBB 1S4FA 4AHCA 1NK5A 1JL2A 3EZ5A 4Q0BA 3QIPB 3KKRA 4PQUB 4Q45A 3DMJA 4DL3A 4URSA 2BQUA 4H4OA 3L3UA 4TYBA 4I9LA 4CJFA 3TAPA 3SPZA 2WCXA 4BE0A 1RBTA 4CF2A 4K4VA 2B43A 1T94A 4FXDA 4O44B 4FJJA 1WSJA 4C8MA 3LPUA 3GV8B 1KVAA 5EDWA 3AVJA 4H4MB 1NKBA 1JLGA 3KLGA 2G8WA 1RTJB 1HMVB 4ECYA 4LSLB 3M8RA 1KCFA 2BGGA 1C6VA 4E3SA 2YNFA 1RBUA 3L2VA 4NLTA 4M3YA 4CCHA 5C25A 4J9NA 4KHWA 1T3NA 3I5CA 4FS1A 2IOCA 2R2TA 3HSTB 4O3SA 1R0AB 3B6PA 4CERA 5J1EA 2WRMA 4F4ZA 1SH0A 3TAMA 3V9WA 3FQKA 2KZMA 4ZP6A 4KHNA 1TKTB 4J9KA 1S9GB 5F9LA 3BSNA 4BDYA 3O3FA 1HARA 3HVTA 2FLNA 2IM3A 3SZ2A 3IN5A 5C42B 4RW9A 4LQ3A 4WXWA 4M3TA 2AGPA 1JL1A 4DTJA 1A5WA 4EO8A 2BQRA 2JGUA 4N47A 1KLMB 4BDZA 1BISA 4CJ5A 4O3NA 4NLVA 4WE1A 3TAGA 4IR1A 1TKZA 4CGGA 3TAEA 1MMLA 4U7CA 2DFFA 2VA3A 4AHVA 2GC8A 4CJUA 3Q8PB 3LAMA 1J5OA 3VN5A 5KG1A 2D0BA 3SUOA 1Q9YA 3MEEB 1NK6A 1TAUA 2OZSA 4BACA 4NCGB 4IG3A 1YVFA 4LY7A 1NHUA 2Z1HA 4BE1A 4J9QA 1QHTA 3DRPB 4YR3A 3CIZA 3GIKA 2HVIA 4RW8A 3MF5A 3NAHA 2C2RA 5HRSA 1JKHA 1DLOA 4EYHB 4DS5A 3THVA 3NAIA 4PWDB 1NJWA 4RW4A 4DU1A 4XPCA 1Y97A 3LP3A 4LSNA 2RF2A 5DGBA 1RCHA 4I2PA 1S1TB 1UWBA 1TK5A 3QIPA 4PQUA 4DLEA 4M3XA 3CJ0A 4IFVB 1T05A 2AWZA 1LV5A 2E9TA 4CJPA 1XR7A 2G8KA 3VQEA 1G15A 3VQPA 2W7PA 4Y1CA 3KLFA 4F50A 4F2RA 2PY5A 3OYMA 3SI8A 1N48A 3VQ7A 3OYBA 2IJNA 4CHOA 1NHVA 4MFBA 3QGGA 3HT3A 3I0RB 3V81B 3EPGA 3V1RA 1RTJA 1ZBHA 1HMVA 3T5JA 3CDUA 3VA3A 2C22A 1OS5A 4F8RA 4CIGA 5KFYA 4CHQA 3QETA 3NL0A 4IH6A 4B08A 4FJGA 3NF8A 4M94A 2D41A 4N56A 2BRKA 3RB0A 1RDAA 4FK4A 4ZVEA 4MK7A 3S3MA 1TKXB 4QWDA 3SUPA 3PR5B 1RT1B 5F8IA 4YR2A 2F96A 1R0AA 4FJMA 1B92A 1FK9B 1K1SA 2UVUA 1TV6B 3OL6A 4EBDA 4DFJA 1S1XB 3BQ1A 2HMIB 3V9UA 4CIFA 1TKTA 1BL3A 1S9GA 1QQCA 1RILA 4NLGA 4NLWA 2FVRA 1IM4A 2RKIB 3M8PB 4GC7A 4DTNA 3NF6A 3TAQA 5C42A 4OGCA 4URQU 4FW1A 3ZT1A 2R7YA 5KFGA 5KFUA 1RTIB 2ASLA 1SUQA 4QW9A 2FJVA 4CK3A 3AO3A 1QAJA 4WZMA 3DRRB 5DMRA 1KLMA 4ECRA 4ZPCA 4I9QA 2V4RA 1W9HA 2UVRA 5CYQB 1BQNB 5DG8A 3KLHB 5HRNA 4IG0B 1C0MA 3MAQA 4I7FB 3ZT0A 1HYZA 3MEEA 3PV8A 4Q44A 2BANA 4ID1A 1TL3B 1S1UB 4NCGA 3GQCA 3AVHA 4BE2A 3RAXA 3DRPA 3QEXA 1C0UB 2IJFA 3QLHB 1U04A 1EXQA 3A2FA 3CVKA 2ZD1A 1UOCA 3KK1B 1HQUB 2IM0A 3E51A 2C28A 1K6YA 2YNHA 4ED1A 1VSIA 4PWDA 2BR0A 4B9NA 3ALYA 1JXEA 4CFBA 2HNZB 5D3GB 1WN7A 1JX4A 4EYIB 3KD1E 2VG7B 2JEFA 4ZVHA 4IFVA 4ED2A 2JEGA 4CECA 1GX6A 2XI3A 4ECWA 5HRPA 2P5GA
chains in the Genus database with same CATH superfamily
3V1OA 3OYCA 3OS2A 2QV6A 3TW0A 4UY85 4CZHA 1U0HA 1I39A 1EWQA 3U27A 1VQ8S 2ZM6F 3RMDA 1D9AA 2E5IA 3I0RA 2JEIA 4MAKA 1LK7A 1QY7A 2DH9A 2XI2A 2HFOA 1WWHA 2XY7A 2HVDA 1H73A 2J76E 4CIEA 3B6OA 4IDHA 1XUPO 5ETMA 4JI7K 4CD1A 1TUYA 2N7CA 4DR2K 2XS5A 3CT9A 4HVJA 3HKZD 1ZZNA 1B70B 3FEZA 3H2LA 4LFAK 1TV6A 1NK0A 4QOTA 2HMIA 2NUBA 3NGYA 2DY1A 3ISZA 4BRAA 2XSJB 3D2EB 1D1UA 2H9ZA 4I4BA 1ZTTA 3VZHA 2RKIA 3L3VA 4K8ZA 3O9SA 2YNGB 4K43A 3PJWA 4X4SA 2Y1IA 4DU7A 4ISGA 2L9WA 1RTIA 4Y28C 4PHTX 3PNIA 2GQCA 3JTPA 2RPIA 3IDHA 3BKUA 3LAKA 2P1JA 4O0JA 3UE5A 4IEIA 2M88A 5KT2A 2UXBJ 3WEEA 3JSMB 2QA1A 5CHIA 3KLHA 4UOHA 2BJ3A 3CPWM 3V1QA 4I7FA 4I56A 3R5CA 3F2KA 2R8KA 5AE2A 2RDDA 1TL3A 5AQPA 3FLCO 3QNOA 4B3MF 3JAMU 3CCRS 3CO9A 1G3OA 4C11B 4WTYA 2CG4A 3J7Z5 2QLFB 2XMAA 3CDBA 3MEKA 4C98A 2V2KA 4OLPA 3CDEA 2MZRA 3LGHA 1VSLA 2AT1B 4LF5F 3CM6A 3DI6B 3SV4A 1ZA1B 1RISA 3P4IA 4ZDNA 4YOXA 5JMVA 3KWGA 1EX4A 3LM2A 2QXLA 2A3ZA 4P52A 5J1EB 2FBTA 2YQ1A 1Q18A 3MCAB 1G4CA 2ZZNA 3BSCA 2P6TA 2YPYA 4QS9A 1T11A 4JKEA 4L3KA 1GOCA 2XZTB 1FESA 3MCMA 3FBEA 4QU7A 2YJEA 1RI7A 4GKKJ 2Q6CA 3B4DA 2WONB 3IAM9 4AQYJ 2H51B 5F3ZA 2UP1A 3J7AP 4KI4A 4KAIA 3A8YA 3AVBA 2IVOA 4YMEA 4TY8A 3BZQA 2UUAJ 3W8GA 5KFPA 1RAOA 4B3TK 4LRBA 4X64F 2JEJA 2ITMA 2W9CB 4M63C 1DTTB 3QRPA 4I2QB 4C3MA 2CQBA 2ZWPA 4AUKA 1S10A 2OFHX 5ETOA 1NCLA 1VQYA 2Z2YB 5CYMB 1G2EA 1F5AA 3S6EA 4USTA 2IRUA 3V6HA 4JYAJ 5A8WB 4G9ZA 3MWBA 1HLUA 2JOQA 3MXHP 4AL5A 2FVPA 3BGOP 1NGGA 1C0FA 1X5SA 2ZC4A 5LMNJ 1S6UA 1DJ0A 3GJRB 4PA1A 2W24A 3Q89A 3RBXA 3AFGA 1H2VZ 1Y10A 4M5LA 1TK8A 1YJ9S 3RBDA 2LCWA 3DLLQ 2A1RA 2OUGA 5FROA 2QIFA 1KHVA 2BQ3A 2NRVA 4LT6A 3H5XA 4MMOA 3AGKA 1SJ4P 4JKGA 4UQTA 3UKRA 3P96A 2VBWA 4DPXA 3SQOP 3DCAA 2GO9A 2FLLA 2KYZA 4OMFG 3VAMA 4M7XA 2E1YA 2VKZG 5DDPC 3IO1A 1IBKK 2HVHA 2EEYA 4CLZA 4PKIA 2HFNA 3E01A 4AILC 3UQSA 2QL9B 4JK7A 3QT6A 1VRTA 4DR3F 2W7AA 3NGTA 3WHIA 3VQ6A 3OYLA 1PIEA 3LL3A 3IMXA 4JKAA 2CQDA 4ICLB 1BQMB 4E7JA 1CJKB 1OH8A 5AJ3F 1HBNA 1O0PA 4ZLJA 3JXOA 4F4KA 3TJAA 3KHLA 1S6OA 4ZTFA 3J80O 1DHMA 2R2RA 3W64A 5CH7B 2FGOA 1KC8O 3DRSA 4BLGA 4FL9A 3PRDA 5CCMA 1V5IB 2XHCA 5B0DA 3MM8B 4OPJA 1N32J 1N8RT 4RZRA 1WSGA 1RT6B 1AZSB 3OJSA 4OI2A 1HNZK 4JS5A 1SS6A 5EX0A 2BANB 2GIFA 3T3FA 4OZJA 3D2FB 4DX5A 3D0HE 2E7VA 3QEIA 2AEMA 2P9SA 2M0GB 4KV8A 3NS6A 3OL8A 2LYVA 1R31A 4DLGA 3GG4A 1KOHA 4FLZA 3DOLB 3FUYA 3N4WA 5C5JA 3CJTA 4OGEA 3SLCA 2E66A 4NMLA 4CH7A 1FD2A 1I51B 4O3OA 4RNFA 5A2QY 3R7SB 2R2SA 5ADZA 1Y5NB 2C3PA 3Q2TC 1LOTB 4CZEA 3M2UB 2WC9A 3T5KA 5HAOA 5F2RA 4JHDA 2DT9A 2WBRA 1U26A 5CD4H 2V6AA 3N5FA 2X51A 5AQKA 3ZEUB 1YIJS 3JB9k 3HZ6A 3DDIA 1J9AA 3L3CA 4IH7A 2Z0GA 3LPYA 3GJQB 4OLAA 4NI2B 2C2ZB 3HVRA 3H4BA 3KD5E 1TMMA 4DHVA 2ZUAA 4ES2A 1YITN 3EE9A 4QIEA 1XC3A 2IGIA 2YKMA 5KRTA 2KHOA 2ZGYA 4KQZA 4CYUB 4X4OA 4ILJA 4ED8A 1EIYB 2OA8A 2K1RA 5KFAA 4HCBA 3MMJA 3MR2A 2ASOA 3HP9A 4ZVPB 4B9UA 4DV6K 4E89A 1NJIT 3SCJE 1TVRB 2VG5B 4YEAA 4ZJLA 3MMCA 3EZWA 4LF9F 3WNEA 4M3UA 1YJ7A 1FJ7A 4NXMJ 2HHQA 1TUGB 4P7VA 2RSQA 4PQAA 3C16B 3ADAC 1YTAA 1H38A 3NKYA 3RBZA 2FYXA 3O2IA 5HQMA 2WVEA 4JI1K 3KWMA 3MN7A 3L95X 3AD8C 3DXSX 4RUHA 3PYDA 2CQ3A 3Q2SC 3R2CJ 3OS1A 4C3LA 1IR2A 2FHJD 5B0GA 1N34J 2L9NA 4NRUA 4X66K 3M30A 3LP1B 3NCRA 4IO8A 3TR5A 4LRAA 4FK2A 4W5OA 2UVWA 3KUEA 2YKNA 2MEWA 4MT1A 1YTUA 2NZ4A 5DLGA 9RUBA 3JYTB 2VHGA 4K7QA 1RCOB 3IM8A 1VQKS 1S22A 4FPRA 1VQOS 1U6FA 3S41A 4M5GA 4DX6A 3KG0A 3LWLA 3QDKA 1O51A 4OI4A 2EX3A 1I1GA 1CULA 4GV9A 5KGXA 1VSHA 3UR0A 3IS9B 3D9BA 3KOAA 1OYDA 1KXPA 3NH0A 4CI0B 4LD0A 3OYIA 5BRDA 1S48A 1JLEA 2XY8A 1B7YB 2A1SA 2G2OA 2HURA 4MKBA 1BDGA 1FEHA 2LP4A 5EGYA 4DSKA 4J2EA 1RWMB 1JLAB 2BXJA 1NO8A 3MMAB 2CJXB 3BPDA 1O5JA 3TARA 2GNKA 3OTOK 2DHXA 1QVFM 2VBYA 1XMOF 1OY8A 3K2YA 4UY8O 3HPOA 3J81O 3D7EO 5A0YB 3EVMA 3UO0A 1T03B 3GYXB 3EL2A 4RTFD 3H45C 3SIPB 2I0XA 4BC7A 3DLJA 4OJ1A 3P31A 5JS2A 4CF1A 4DN9A 2CPIA 5FRNA 5AZJB 3LDLA 1EQ0A 4C0OC 3TABA 5DDOC 3VETA 2EWSA 1VRUA 2SXLA 5LT5A 4FWQA 3RMCA 1E6VB 3PO4A 5KFVA 3NMUA 2NYHA 5AXKA 4V1Ak 3RTVA 4FDFA 3SQ0A 3JS6A 1ZBTA 3CMAN 3CGIA 4EIAA 1S3XA 1VQSA 3OTEA 1MA9B 2VDIA 2A18A 4KHQA 3RRKA 5J2NB 5CZ1A 4HHJA 4CFCA 1PYSB 3VQ5A 1M5HA 4DR2J 5GAHI 2XSFA 5CYJA 1N5YB 2O01C 2RQ4A 2A10A 2AD9A 1RBAA 4PG5A 2XRIA 1SI9A 4YOYA 2CQ2A 4GO7X 8AT1B 4JV2A 2L9DA 4M3ZA 4NLOA 4CFAA 1V4SA 1FFWB 2W2OP 1BIUA 3D5MA 4GKJK 5AZIB 1LEOA 1HA1A 4LFCJ 4HKQA 1RB0A 2D7SA 4LRDA 2HWIA 4YOUA 4CO0A 4GY2B 2QLBB 3LO3A 4KHYA 3CCQN 3J7ZO 4USIA 1RT5B 1S0MA 2OTLS 4WQ4A 2LA6A 1Y3KA 2QYGA 4DDFA 4CJQA 3QZ7A 2IS3A 3CDWA 3JSBA 3THWA 3ZZZA 2Z4PA 3SMZA 2HHUA 2CA9A 1SL0A 4Q5VA 2J8SA 1W2BM 1GLCG 4MKYA 4Y3CA 2UV8G 3TTDA 4DPWA 5HQLA 1YTYA 2XS2A 4O23A 3H8YA 3CW2C 5A8KA 5DK5A 2FSKA 2VG6B 3BKTA 1Y11A 1CZAN 3CCMN 2X3DA 3DLEA 2NRWA 3AY0A 2VPXB 1P6TA 5BPNA 2X74A 3SSQA 4KO0A 1IJFB 2ZOGA 3U1NA 5I3UA 4W5TA 3AOCA 4MO4A 4M5HA 4PXEA 3ZTQA 1JXLA 3K8VA 2MSSA 2BKNA 1Q7LB 2UUCK 3SSRA 4BG9A 4Z4CA 3PEJA 1LFPA 1UEVA 3R6GB 4K4TA 3OVNA 4C8NA 1DTQA 4A8WA 2VF3A 2E1CA 2JFDA 1BOTO 5E3PA 3RGIA 3DFEA 5GVQA 4BWJA 4HWIA 1HBMA 1DQ8A 5AQYA 1U6BA 3UD4P 4DR3K 4E7HA 1AB8A 4DOZA 4HUGA 3C95A 2MB0B 4ZPVR 1OSCA 3B8AX 3T1HK 3BM7A 4ZLLA 2XQCA 1T9XA 1KN6A 1P8GA 2PE8A 3H59A 3CFPA 2ZQBA 4NCAA 1OWXA 4W98A 3EO3A 2UV8A 3D67A 1YF5L 2CNNB 2QM1A 1NMDA 1I94F 1U4BA 1EP4A 2QWRA 4IZ9A 2CQPA 1YHQN 3ZNUA 1UTAA 1I3AA 1S9FA 3D28A 1TL7A 4J90A 3SMPA 3GE1A 3QB0A 4K41A 3GIJA 1URRA 2PD1A 2LDYA 2OPRB 3EE3A 4B02A 2G0IA 3AB2B 4CO2A 5H9EK 2Z2ZA 1GLLO 3J80U 2V7ZA 5HP1B 5HLFA 4JI3F 4U95A 3MECB 3BQ2A 1PYOB 4QPXA 1WSIA 2HFUA 2B5JB 5KFOA 2MSTA 2X6SA 2ZJPL 3RB4A 4IKFA 3H5SA 4KBOA 4H5TA 3OUYA 3KK3B 1MROB 2PSZA 1M1KO 3EUNA 3HMJG 3MR6A 3HRGA 4XTTA 2HHSA 1B99A 4DHYA 2E7XA 4OPAA 4CM2A 4GMJB 3PVXA 4QS7A 1VQ9S 5JVGL 1XNRK 2IDLA 5GINA 5GAEI 1T95A 3NP5A 3ZETA 1UJ5A 2GVDA 3TVZA 2LQJA 1XR6A 4O0NA 1VQ4S 1OJ4A 2KXFA 4DSJA 5AQVA 3A8IA 5D4PA 3MM5B 3TAFA 1U2VA 4CEAA 3NHGA 5ADXA 5GAGI 3D6MB 1NUEA 3BS9A 3E3XA 3HFZB 3DU6A 3FQLA 3S01A 3UW1A 4NYZA 3DLBA 2C2DA 2H65B 4L3NA 1Q81O 2R8HA 4IBNA 1S7HA 1HR0F 4LF7K 4ITSA 2O4IA 4B8AB 1JJ2R 1GMWA 4CZCA 3AO1A 1S1WA 2B0GA 2B3TB 2DGOA 5JVHL 4JI8F 3SDEB 1VOMA 3SFGA 3AA4A 3PO5A 3SV3A 1SJRA 1OKJA 5L1LA 1HNZJ 3L9ZA 4BRMA 4KFBB 3M6GA 2CQHA 3AHPA 2BE2A 4Y00A 4USVA 2KXHA 2V2VA 3IM9A 2G8FA 3W5XA 3LM9A 2XLIA 2MKYA 1NM1A 1UA1A 3I4PA 4F4XA 3MMBA 4DV3F 3DYAB 4ZPDA 1JJHA 2QRRA 2KH9A 2CNKB 4BVOA 2AKWB 1YJUA 1J5EF 3KMQA 4CZFA 2X1AA 1VLYA 1P9QC 2V7YA 3D6RA 3ULHA 4LSLA 1KTVA 2N7YA 2FB0A 1RTZA 1R0CB 2Q31A 4OI3A 3RSEA 4UF4A 2RD5C 4JRQA 4J9PA 4Y2AA 3EXCX 2EFPA 3Q86A 1NU4A 1VBXA 1FTCA 4M7YA 4AHRA 4K5RA 2ATQA 1V6HA 5LMUK 1OH6A 3AOAA 1SKUB 4X4TA 4JNEA 2D3UA 1FJCA 4CEZA 1ZXOA 3OYJA 3G71N 1Q79A 4H0XB 1KAXA 1VK8A 1RNHA 4X4NA 1Y0HA 1Z4UA 3W2VB 3Q8RB 4JD2A 3AVCA 3D0GE 1BU6O 2PAVA 3CJ9A 3M5RA 1NGDA 3IRWP 4BC2A 2OSRA 1WC6A 5ETSA 2ROGA 3F73A 2GS8A 3L4BC 2BTFA 3DLHA 4C0BA 3C6UA 5JS1A 1S72S 4CEBA 3QGIA 2FD2A 1HUXA 2V68A 4JI1J 2OO4A 4LBPA 4DV2K 2XHWA 3L2WA 3AGRA 4JK8A 2IMWP 4DZ6A 4A48A 4AM6A 1BLUA 3KG4A 2F8TA 1FRIA 4MDAA 3VV2B 2CDRB 2P5OA 3ZNJ1 3KJFB 5ELZA 4O0IA 2MJUA 2P9GA 3DGPB 1K8AT 3PG9A 4FSVA 4F4AA 4P72A 1NGJA 5L38A 3GZ7A 2ZM6J 3PFEA 4KSEB 1QE1B 4J7CA 2D74B 5AQRA 1SH2A 2FBXA 4TSXA 4DQSA 2ZNYA 4NZ6A 4DF8A 3MR7A 4FZXC 4K2XA 3W63A 4PWWA 1VCTA 3PEHA 1NOZA 1RWXB 4XH1A 1ITPA 4AM7A 3NAEA 3PLAA 1NK9A 4UZBA 3O4QA 5CQGA 4QWCA 3BH6B 1EAYC 2FF3B 3PYFA 4HHTA 1TKXA 4K4SA 1XHZA 5A6PA 4IO1A 4F3QA 1K73O 1HNXF 2YKAA 2KTQA 2DNGA 4HTUA 1IKWA 5FDLB 3TZYA 5CD4A 4LQ9A 4IUFA 4X4RA 1IKYA 4BWMA 3GONA 3HF5A 3AVGA 1Q86O 5J2MA 1SKWA 4CQ1A 4FN5A 2AQ4A 4OYZA 3L2UA 2VWJA 3W9IA 4QPTA 2CPFA 3ENAA 2F8SA 3M7VA 4Q0BB 1CG2A 4E7KA 4JOUA 2CQ0A 5IT9Y 1S79A 5FD1A 2QA4G 5HMWA 2O8DB 3Q22A 2PC6A 4OX9F 3RMBA 5BR9A 1S7IA 3CCJS 3LALA 5DZ7A 1HWIA 4LF8F 2B7BB 1RWPB 2VC1A 4EP5A 2R2UA 4FBTA 4B3MJ 4DSIA 1HWUA 1HWKA 5B0FA 2DTUA 2WBMA 3QJLA 3CJ7A 2PEBA 4CE9A 3DKDA 3U3YA 3SQ2A 5F41A 4LF5J 1FNOA 3SCKE 4DBQA 1HQUA 2BUNA 1X4HA 2F5GA 4U67Q 5C25B 2OPSA 4QW8A 1N5QA 2CAJA 3OFFA 4X4UA 3S3NA 3OYFA 2OYQA 3MCPA 3P5TL 3W60A 2BOPA 3LWMA 3TZZA 4G6VB 2KFZA 1GFWB 4FLVA 2RE1A 1UJ6A 2UXCK 3O6QA 2OZMA 5GADU 5C0YA 2G0CA 1UJ4A 2C3UA 5A2QU 5DDQC 3M8QA 2M3DA 3CCEN 4DL7A 2MQMA 3VALA 4JUZA 4H5RA 1F3FA 5B8HA 3N6MA 3KLEA 4A4JA 4R8UA 2VIHA 4C0HA 5GIOA 2OLWA 1GLJO 1BMQB 5KFKA 4X64J 3BO4A 3ZSRA 2AJFE 3CIPA 1WF1A 4ZCMA 4JKHA 4OZ3A 2HHHF 4ED7A 4IG3B 1RAFB 4CJ4A 4X4QA 1PGZA 1CXUA 2XMMA 3KHHA 1Q7YT 3B82A 4RW8B 2IRXA 4TY9A 3HHEA 3H2UB 4W5QA 1T0TV 2QSWA 4WPAA 4BDPA 1NJYA 2UUBK 4K4XA 2IPOB 2DNQA 2GBZA 4P2SA 2W9BA 2FJDB 4JI6K 3KWIA 3ZZUA 1HNVB 1B9DA 1RTHA 2GJFA 4LSNB 1X5TA 2IA6A 1WACA 4AHCA 2VWBA 4NMXA 1JL2A 4JI3K 3EZ5A 1X31C 3QIPB 1ULRA 4Q45A 3C3LA 3DMJA 4LBHA 1U0SA 2DJWA 4H4OA 3POTA 3QJPA 3MWTA 4KH5A 5KOXA 1UW4A 4NA3A 4BE0A 2MQPA 2RHKA 2OELA 3T6JA 4O44B 2BW2A 3NOGA 3HOSA 1Q5YA 1KVAA 5BYRA 3RJMB 1N5TA 3D54A 4R0JA 5HATA 3WX8A 4A8FA 3K17A 4E3SA 4DR3J 1VC0A 2JLGA 1KVKA 1O13A 4CCHA 5GADP 2D69A 2Y9HA 3IR5B 1T3NA 4CLPA 1U1RA 2FLOA 4AL6A 1RU1A 4CERA 5KQDA 1N5SA 2LEAA 2YXLA 5AJ3J 4F4ZA 4DX8H 4ZP6A 3BSNA 2W6KA 2I6WA 4QR1A 2FLNA 1VQ8N 3SZ2A 3IWLA 3W0LA 1R89A 1H1VA 2VBZA 4LQ3A 3P5BP 3TVYA 2RIJA 4M3TA 2AGPA 1F0XA 4DTJA 1A5WA 3NWGA 2JGUA 4N47A 4Z94A 1RFQA 1KLMB 4BDZA 4PXDA 2Z8QA 2FHOB 2CZVC 4OPHA 4WE1A 3TAGA 4CGGA 4BRDA 1MMLA 2NXCA 4JKCA 1RLDA 3EDQB 4CJUA 1J5OA 4MYTA 2MZJA 1ATSA 5KG1A 3SUOA 3MEEB 5D6GA 4PRFA 1NK6A 4DXLA 2OSQA 4NCGB 2AA4A 4OX6A 4J9QA 3MPVA 3BB5A 2B51A 3CUNA 4YR3A 3CIZA 3WUHA 3I56N 3N28A 3R5BA 4OYMA 2C2RA 1DLOA 3Q7CA 4DV3K 3DXMB 1SQFA 3CXCR 4XAKA 4WK3A 4PXCA 3THVA 1J5EK 3G6EN 1NJWA 4DU1A 2UZAA 2VGNA 2EFNA 4M63A 3DOMA 2RF2A 1E4FT 3QSIA 1N36F 2PGCA 3CJ0A 4UTGA 1T05A 2MKHA 4CJPA 3CSKA 1XR7A 2K2PA 1IUJA 1PO6A 3IFRA 3K5PA 4Y1CA 2X1BA 4H5NA 2DRBA 5GIPA 3QATA 3CCRN 3SI8A 4FPIA 2JLFA 3OYBA 1TZ0A 4RUBA 3MCSA 3J7A1 4FYWB 1V3RA 2O67A 3V1RA 1RTJA 1ZBHA 1HMVA 4ZCLA 4ISEA 1WHVA 3W3DA 3M6XA 1QLNA 5KFYA 4CHQA 2QGFB 4ZVUB 2V52B 1BQXA 1UVKA 1B0PA 1ACMB 2HBKA 2AZ1A 4IH6A 4ANEA 3ET6B 3H90A 4N56A 4YDXA 3BBCA 4YHHF 4FK4A 2GX8A 1RACB 1HL6A 5BREA 2P9KA 5F8IA 3E8OA 1FK9B 4OZ0A 1F60B 3V9UA 1WORA 5AQFA 1BL3A 2F4FA 4KR0B 1PSDA 5IT9O 2QL5B 1QQCA 3T69A 4LF9J 1IM4A 1B64A 4BHQA 1QM9A 3SMSA 4GC7A 5T7LB 2NLWA 4URQU 3ZT1A 5KFGA 1V4TA 1SUQA 1RWOB 2GGPB 3SCIE 4WZMA 4FYVB 4F36A 2C3MA 3KDOA 3GCXP 4ZPCA 3HCXA 4I9QA 4K59A 5LXRA 1CPZA 1W9HA 5C2FA 2HGMA 1HWJA 3MM7B 2DVIA 4IG0B 1KDNA 3CJ8A 3GFYA 5C2CA 3D1HA 3PV8A 4ID1A 1S1UB 1U7LA 4PL7A 1C0UB 2IJFA 1U04A 3R6MA 2IDEA 3A2FA 5M1OA 5D77A 1UOCA 3KK1B 4UOCA 3P3DA 5E26A 2IM0A 3E51A 2V50A 4Q2LA 2VPYB 4ED1A 2KVQE 2LKZA 2DEIA 4PWDA 3D6TB 2HBYB 5IT0A 4Z7YA 1JCEA 2F8MA 2VPWB 3ALYA 1CC7A 4X65F 2VYPA 4WF9L 2QWNA 3GYGA 5D3GB 3KD1E 2JEFA 2QEXN 2JEGA 1KNZA 4ED2A 4CECA 5HRPA 2P5GA 3D45A 2V34A 3W2WB 4WFAQ 2YKPA 3GR0A 1A5VA 3I8BA 1HNXK 4NRTA 2ZJQL 3BZKA 3VEXA 1A0OB 4DPTA 2EKNA 1ZBUA 4IYQA 3I9ZA 2J5AA 4NEZA 3VQ8A 3N4QA 6AT1B 1XMOJ 2WVBA 3VF4A 2AEFA 3A13A 1QQOA 2GA7A 4Z4IA 4CTAA 1CLQA 4CO3A 1HNWF 3W7BA 4ZHRB 3FZLA 2BM1A 3NBPA 2RVJA 1WEYA 4FWNA 3O44A 5DM6L 1SJ1A 1HBOB 3W5YA 1S1VB 3R3LA 2O1PA 1S5JA 1S1XA 4QWEA 5M1KA 3ISND 1JJ4A 4CJEA 4ALZA 3R5AA 4Q8EA 2CYYA 4BR2A 5EWFA 1RT4A 1H7WA 2M8HA 1XMQK 5B09A 3AJDA 4ZCKA 4YFUA 2E8AA 1SIWB 2AJ2A 4K4ZA 1C0TB 3AVNA 4FBUA 5I4MA 1T6CA 1MMNA 4YS2A 4E1NA 3VA0A 5T41A 1V3ZA 2ZJRL 2E1MC 1KLNA 3OW2R 4XO0A 1KD1T 3G6YA 2WBNA 3L7UA 3IRXA 5CZ2A 3IR7B 3FVYA 2R7RA 1G1XA 4OKKA 3QSYB 3RBEA 3VPZA 1D09B 2EBEA 1F2HA 3QLHA 2BJEA 2HBMA 1NK8A 3ILJA 3QEPA 2GMJA 2B9XA 2DRAA 4K2JA 1ZBFA 4WFZA 2CGLA 3SFUA 1GLDG 5D0GA 5BYQA 3ENQA 2LQ9A 3NGIA 2BJ9A 4NWBA 5SZTA 3OL9A 4I6YA 1GEHA 1U09A 3C14A 3NOCA 2AP6A 2BYCA 1EO1A 2Q1LA 1VBKA 5J2PA 2ASPA 1SBRA 5K5MA 2R7TA 1M5SA 4DF4A 1AROP 3IMQJ 3V6DB 3KXDA 3PJXA 4I1TA 3KNGA 5C2DA 4RWTA 4K4YA 3FE1A 4RLEA 1HYSB 2JHEA 2MQ8A 1RDBA 2QWOA 1L5UA 2NXNA 4URGA 3CPEA 4OX7A 2IYIA 5AQSA 4Z4HA 2RH3A 4FJIA 2DNLA 4WFNL 4A47A 3L4IA 5F1XA 1HRHA 1TYQB 3DDNA 1VMBA 2QZ8A 4OI1A 4DV4F 4KT0C 5JXSA 3KK2B 4UT4A 4B1YB 2NXJA 1YBAA 2W6LA 1BWEA 3BF3A 1QSLA 4M5MA 2XSJA 3AJ1A 1RA7A 3D2EA 4RUAA 1FRMA 4KPCA 4DV5K 4OZLA 2OH2A 1IQZA 2CJQA 1JJ2M 1RHJB 1U8SA 3EKSA 3M2RB 2RS8A 2JC0A 1UKUA 4A61A 4C48A 4ZJOA 3G0ZA 2ERRA 4NPOA 2ZH8A 4M5JA 5E2QA 4P73A 1NKEA 2P2CB 3L8BA 3WX4A 5HVHA 4DTOA 1YBTA 2JSXA 3R1LA 4LF6F 3VEZA 3KLFB 1BXNA 3JSMA 2DR7A 4LR9A 2E1AA 1AT1B 1U1PA 1WC1A 3EGVA 2H3GX 4FYYB 3B8HA 3CC2N 2IMOA 3FNNA 3UVJB 2E5JA 3SAGA 4MFBB 3BJYA 3K5MA 3BSOA 3SUNA 4C11A 2YH1A 2QT7A 1WTBA 5CAAA 4DX7A 1KQFB 4F26A 3DI6A 2E5GA 3KLVA 2J4RA 1E4GT 3F41A 3TUJC 1DFDA 4CWBA 1YJNN 1NDCA 2PMHA 1NU0A 4JI3J 4ECUA 1NOYA 2LXUA 1VSMA 1BHLA 2BV3A 3CB4A 1O6XA 3FSYA 3ILIA 4DSFA 4GVBA 3OLAA 3HZEA 4GNIA 1S6QB 1XBWA 2A2DA 3MR5A 3VHQA 1VBYA 3SEOA 4DR1F 4J8FA 1GOAA 2ZE2B 1FX2A 3PYGA 1CZBA 2WONA 2O66A 1PAEX 5KFQA 2P9LB 1FKOB 3FEXB 2CVIA 3SCXA 1SKSA 3DGVA 3NGZA 4YB1P 2F8EX 2VWKA 1EJ7L 2IY5B 3CC4S 2C42A 2P9CA 4MQ3A 2GWKA 2DKOB 4IOXA 3K5LA 3CTRA 1N36K 3MCNA 2W9CA 3UD3P 3MFHA 2YHBA 3O6WA 3T5HA 1H74A 1DTTA 4I2QA 2OPQA 1RAAB 4RW6B 4OHVA 5I3QA 4C7QA 2J9EA 3RU0A 5CYMA 3OJUA 2NNWA 2NXUA 2Q79A 4ANCA 2MY8A 2JRSA 2M2BA 4YB6A 1HBUB 2FC0A 5A8WA 2E20A 2BBEA 4M95A 3CJKB 1RWNB 3C66A 1D9FA 1HR0J 4N77A 1LW2B 3ZFVA 2WOMA 4CDIA 1CZ9A 4DL0C 2POKA 2QLWA 4ZVRB 1ZH5A 5KT3A 3E9OA 4JI8J 4A5AA 5AR0A 3HP6A 3Q8QB 4OV1A 4MLEA 4B3SK 2R4FA 5KQ8A 1MLAA 1YUWA 2OGUA 3TJ9A 1N33K 3N0VA 4CEOA 1EHWA 3IXQA 2CFXA 5GAHU 3PR4A 3TJ8A 1GMVA 4DV3J 3BGLA 4JLHA 4HR2A 4GV3A 4HYKA 3AAWB 2RRAA 1YJTA 1IWAA 1J5EJ 4KPYA 5IT9U 2OTLN 4O5FA 1DEJA 2VFTA 1RA6A 2YV0X 3CCVS 3K58A 1SV5B 2V4QA 3FRYA 4ICLA 1BQMA 4O4RA 3SQ1A 3KTQA 2W01A 1T7PA 4DG1B 2XYGB 3VCDA 3K5NA 1F2GA 2MGZB 4F4WA 2YX4A 4R79A 5GMEA 3OTCA 3BH7B 4BVPA 2UXDF 1N56A 3EN9A 5KG0A 4MK9A 2E9ZA 2IM1A 5AQTA 4ZIVA 4J9UE 4YY3K 4IRKA 8RUCA 2KN4A 2LXFA 2KT3A 4USMA 2Y0BB 5G4DA 4FJXA 2XS7A 1GK8A 3MM8A 5KPTA 1MWZA 2F65A 1T9VA 2NXEA 3CJQA 3OL7A 1RABB 1CSJA 3BYRA 1RT6A 4P9SA 1WSVA 3O1WA 3P83D 4FLTA 1NLKL 2Q0RA 2DGVA 5KG4A 3D2FA 4HH0A 2EC2A 4NXNK 2HVEA 3PIOL 3AOBA 4C8OA 1JNZB 1BGXT 1RLCL 3DDKA 4NYFA 2UYTA 1Q82O 3DOLA 4IRDA 1GMUA 3F9MA 4ECSA 1JLCA 5AQZA 2VFRA 1OH5A 1YG0A 1LFWA 4USWA 5DS7A 1DY3A 3CJ4A 2V8HA 3EEQA 4XDDA 3W66A 2VBXA 4QCLA 3JQMA 1XK8A 2DHAA 3M2UA 4QQBA 2YWFA 2GMLA 3TANA 1M90T 1YXQA 5E3CA 2BJ8A 1SJQA 3IUCA 1RAIB 2VD3A 4CM0A 3MUTP 4M5IA 2CXEA 2ZITA 2ZH3A 3AA5X 2N4DA 3ZEUA 4NZ0A 2HYIB 1FT8A 3QEVA 1KONA 1XTZA 2JNJA 4FWMA 2HBZB 4GW6A 5KG7A 4NYNA 4P7TA 2JZ5A 4NI2A 5H9FK 3H46O 3IBFB 2HAIA 1R0BG 3B4MA 4DSLA 4J9VA 4M5NA 4X62F 2Y1LB 1FXXA 4C8KA 4LIRA 4DQRA 4CYUA 3AA9A 1GH8A 2MLXA 1KQSM 4H0YB 1G7CB 3ITHB 2FBVA 4ZJQA 1TVRA 4MLHA 1KOOA 4B3OB 5LSOA 3JSRA 2ZBRA 3M4XA 4NLUA 2HG4A 3RRHA 3UE2A 3LP2B 4KGXB 2JVOA 3TRGA 4CHPA 2R8JA 1HNXJ 3HD1A 3CC7N 3OHBA 2AIRB 2BEFA 3SBGA 1WC3A 2KXNB 2NYIA 5KTQA 3VAJA 4U7UD 1VQ9N 3O5BA 1KAYA 3C16A 3AD9C 4YP3A 2RS2A 1LWCA 3M6VA 3ZX3A 4ZN1A 4K4UA 3DWLA 2M52A 1U6ZA 3EJMA 1VQPS 3TTFA 2AX1A 4RJVA 2HHTA 4DR4F 3IA0A 2WVDA 1Q53A 4Y65A 4JI7F 5K20B 3NXZA 3UWTA 1H7XA 5IT4A 5GAEU 4OX9J 2PZSA 4WJBA 3HHLD 4O3PA 4CLWA 3HM9A 3LP1A 2VONA 3QAUA 3TI0A 2FVSA 2DNOA 4LF8J 4KJIA 1IKXB 4WU3A 2XMUA 5KI6A 2V0NA 4LFAF 2BDPA 3WXMB 3E1YA 3VQBA 3H3OB 1D4XA 4WP3A 4CEQA 5GAGU 3JYTA 3QZ8A 1YJWS 1Y4ZB 1VQNS 3M32B 3EE8A 4DCOB 5AQLA 2XZDB 2W8KA 3TP2A 1IXKA 3I0SA 3OD2A 4H4KC 1XQIA 5THWA 2MZSA 2I38A 1MN7A 4B9MA 3IS9A 2YWKA 5AE3A 4WFYA 2RRBA 1S9EA 5LL6Z 1RKJA 4KRWA 4P71A 3EGNA 4YQWA 2OTJN 4FLYA 2NRTA 5KG5A 3DN9A 4LRFA 4RR5A 1SL1A 3MX5A 3OYDA 1TP7A 1S0NA 3IWNC 2E1RA 3MMAA 4RUCA 1WI8A 4ZS6A 1XNQK 4H5WA 1T9UA 5F0XA 1L3SA 1TMJA 2E2PA 3G10A 2LQBA 4CT8A 1Y7PA 2VB6A 1BHNA 3LP0B 1KAZA 1F5CA 5A0YA 2XZWA 3G2XA 2H1YA 2HK2A 1VQ6N 1EKSA 4DQ8A 4PCQA 4Z4EA 2FGCA 1RWKB 2NQPA 2ILZA 1UVIA 3A5OC 2PMZD 3S1TA 4LF6K 2NUUG 1RT3A 4JI5K 4C6AA 1XJWB 5AZJA 2AX0A 4ZTJA 4JI4K 4KGKA 1WKLA 3BEGB 2HHHJ 5C24B 5HBMB 2VCPA 4E1MA 2EFQA 3JTOA 3FRZA 1EX8A 3CO0P 3G82A 5GAEP 3RWUA 4FJNA 3TNVA 5A8RB 2NSCA 1X4AA 2GHVC 3G4SN 1DT9A 4J91A 2HS0A 4AXJA 5BN9A 3EYZA 4NLCA 4ZOSA 2WTFA 4HTLA 4J2AA 1FVSA 4PUOA 2GMHA 5GAGP 1NDKA 3TR8A 4B3TF 5B0BA 1N5YA 3WNGA 3THTA 3MEDB 3P45B 3VQQA 3I8DA 2MY7A 1VSKA 1EWRA 5HL7L 2V8VA 1VQ7N 3FFIB 2R7OA 4DR1K 2HIYA 4OYWA 2R7WA 1SQKA 1S72N 4J9LA 3I5BA 4L72B 3ZTSA 5AXMA 1L3VA 1WSFA 3Q8YA 1JXVA 1WELA 3DLGA 2ZDOA 1RT5A 2HGNA 3HVAA 1QAYA 3MUVP 2ZUGA 4F0MA 1N8RO 2FC9A 1I5OB 3VAHA 1X4BA 3BGRB 1IKVB 1Q4RA 3R9LA 3H2VE 2KVIA 1E6YB 2NZCA 1LWFA 1RT2B 5L1IA 1T6DA 2GCFA 1HNIB 3RR7A 5BYSA 1OSDA 2VG6A 1E3MA 4DPOA 1IBKF 3C6TB 1R8PA 3FMWA 5G0RB 2HAFA 2QMUB 5IS2A 3QPIA 2XMWA 5KFBA 9ATCB 5KG6A 3W62A 5JICA 1BWFO 1T9WA 4EFAC 3GG1A 1TELA 2OPPB 2ZZTA 4EWTA 3FEYB 2KFNA 4ED4A 4QAGA 4S0MA 3IGVA 4QYZK 1KQGB 2BA9A 1FRKA 2O8FB 5IV4A 5KT7A 1U48A 1TL1B 4JB8B 4NEYA 4W4MA 2B9EA 2QKKA 3ZZ0A 3DM2B 3K9JA 1CULB 3P6YC 3L7OA 3HK2A 1SC4B 3V6KA 3CCTA 3W5ZA 1HWLA 1N36J 3NE6A 4MIAA 3ZZYA 3EPIA 1D9DA 2EFVA 3ZC4A 4LJMA 2RQCA 4CF9A 2I7PA 3PSFA 1WG4A 5E33A 1NJIO 1H2TZ 2ATCB 2M5YA 1NK4A 4JV5F 1RDRA 3OR2B 3O8WA 4B1VA 3EM1A 4ZIWA 4JBCA 4CF0A 4DWIA 2G8HA 2OPRA 4H0TB 2J0QD 3KG1A 5HI7A 4H4MA 2ALYB 5K8MA 2DGTA 3GBTA 3R7NB 4JK9A 1WG1A 5DM7L 2EI5A 2W7OA 4B9QA 5HP1A 1X5OA 1ZM9A 3MECA 2GO8A 4LR8A 4YHHJ 5F8JA 3M9NB 3TYTA 2V94A 1KVJA 4OVLA 2ZHBA 2CPHA 3KK3A 1LW0B 1XQSC 3WBZA 4TXSA 4PY5A 4GRSA 4I6MB 4B8CA 1D3WA 2COLA 4Y2IA 2CQ4A 4ETZA 1RHKB 2J6UA 4CGFA 3QO9B 3PW0A 2XGQA 1FJEB 4MYUA 3PSIA 4N7TA 2GWJA 3F9KA 1RBRA 1IR0A 3MAHA 4N5SA 1ROFA 4M42A 4Q2MA 2RU9A 2RJZA 2ALZA 3K5OA 4WCEL 3OW2M 7AT1B 3LDNA 5LJ3Y 4PKGA 2HZAA 4TN2A 1FRHA 3VGMA 4DV6F 4BC4A 4BROA 4EHTA 1CJUB 4FF2A 4Q8FA 3BYPA 1QDUB 3CQ8A 2DGSA 5D78A 3MZIA 4E7IA 5KG2A 1DGKN 3MHYA 4YDUC 2LXIA 5EXWA 1ZZFA 1HHQA 3GFHA 4LF4K 2QA2A 3T7ZA 4IDKB 1FXRA 2BM0A 3EDRB 1JJCB 4X65J 4JI1F 3CJCA 3SDEA 3GG0A 2IM2A 1UAXA 3GCWP 1S1TA 1W0HA 4KFBA 2F4VF 1C0GA 1AW0A 3GILA 2VQFF 4H0PA 4X66F 2Z56B 2YVSA 4OFZA 4OYPA 2CZ9A 1UW9A 4Y2CA 2E5LK 1OVYA 1RAJA 5D4LA 3D6HB 3DYAA 2AGQA 2KJWA 4F2SA 2ZJPQ 1UVMA 4QS8A 1UZDA 1NK7A 3F5TA 4CVNE 3Q23A 3V81A 4CJTA 3G6VA 3PUFA 2KLAA 4YOVA 4CK1A 1HNWJ 4DR4K 2OEJA 2D3OR 4KREA 1C1CB 3SPYA 5LSRA 2UVVA 4TQSA 5JVGQ 2HWHA 1JWWA 3JXUA 5DDRC 3NGRA 2DPJA 4NYPA 1URNA 3PACA 3CIMA 5GMKa 3TSUA 2B8QA 2PI4A 2DITA 5CZXA 2ITGA 3EVOA 4DFMA 3OVBA 3I33A 3OTOF 4AE5A 1FF2A 3BBFA 4RKUC 3HDSA 1IO2A 1M1HA 1FDBA 2RAQA 5KOWA 2DPNA 4OHXA 1PJ5A 1T8EA 3DRRA 1OPZA 4NCBA 3CFOA 4QWBA 2ZF5O 5D15A 4B1UB 3FMBA 4KB7A 2XB2D 2RMLA 3W2VA 4FLWA 4DV1K 3HTVA 3QT8A 1TL7B 1UETA 4NLYA 1AUDA 2YWEA 2EK6A 5JVHQ 1NDLA 3ZO7A 2XG8A 3DU5A 1RGVA 1T3VA 2CZ4A 1JB0C 3RW7A 1NJXA 1YITS 3AVFA 3HD2A 3BDEA 5AE1A 1IJEB 4AHSA 1ZYQA 4M1KA 3M9OB 5ETKA 3VEOA 2YNFB 4NLDA 2AU0A 3NGKA 1F1BB 3AARA 3JTNA 4RO0A 4P75A 1DQ9A 2R7VA 4Y34A 2Q0UA 5F9NA 3PX6A 3GTYX 3IAYA 3TAMB 3G8TA 1NMEB 1WC5A 3BREA 3SXLA 1GX5A 2KZZA 1IM6A 4DTSA 3DGPA 4NB4A 5KT4A 2Y1RI 4DU4A 5F8LA 4KTZA 2CJBA 3LPEA 4OLBA 3ZETB 4GKJF 3L2QA 1QE1A 1HJRA 5D0HA 3GWCA 5DGAA 3ISNC 3OTDA 2Y1JA 2G13A 1FWKA 1S0OA 3R1XA 1TKZB 3UCUP 2NSBA 4FK0A 2JFKA 4FZYA 4IOBA 4J9SA 3TU5A 3OYKA 4O8UA 2NS1B 2D0AA 2Z1IA 2RU3A 2EXUA 3OT9A 4K0KF 5D8HB 4DV4J 4OZ1A 1N52B 1H98A 3TWHA 3WQPA 1QUVA 4CBWA 5KFIA 3J81Y 1JKHB 4H8KA 4FKYA 5FDLA 1TAQA 2X6NA 2Q2RA 4ILHA 2MQOA 2N4CA 1IG9A 1N5VA 2CQIA 2H5JB 2DFHA 2E2NA 5AQQA 3OQ2A 5U47A 4Q0BA 2KU7A 3A12A 3NEKA 4OYOA 3NNCA 2BKPA 2RRNA 4LF6J 1W26A 4CZJA 4JI5J 2RHSB 4URSA 2BQUA 3CPWR 4TYBA 3I9V9 4NYOA 4ZITA 2FHJA 5AQWA 2UUCF 1QD1A 1RBLA 8ATCB 3HHLB 2Q6BA 1T94A 3PJ9A 1WKJA 2DNYA 2DEJA 3MAAB 1WSJA 1Y5LB 5M2PA 3D2WA 3GV8B 1VQ5N 3R8YA 1X9JA 1UVJA 3AVJA 1NRKA 1BUPA 1JLGA 3C0BA 3M8RA 4LSLB 4EGLA 4ECYA 5IQQA 2V67A 1C6VA 4DKWA 5F0WA 2QJ3A 2B4VA 1ZPWX 3L2VA 2EFGA 3H25A 1DRZA 3KHYA 4HHUA 2ROEA 5C25A 2HBRB 2IOCA 4A8SA 2DGUA 3K89A 2R2TA 2MPUA 3T1HF 3THPA 2WRMA 3V9WA 3KJQB 3FQKA 1BC6A 3LDQA 4KHNA 1TKTB 4PG7A 1S9GB 3AA8A 3O3FA 3G25A 4CO4A 1YGYA 4CNYA 3T9ZA 2HHPA 1YI2N 3H1QA 1VI7A 4DR1J 2ZGZA 3CMAS 5M1FA 4I68A 3I32A 3U9ZA 2CH6A 2K06A 1VAZA 3C15A 3W61A 1OVQA 4NLVA 4WBFA 2HF4A 5FPEA 2F9DA 4U7CA 2DFFA 1R3NA 2VA3A 3THYA 3GR1A 4WP9A 1FDAA 4ZCIA 1KP6A 4TNOA 1Q9YA 4PG8A 2W2NP 3HOTA 4IG3A 1YVFA 4LY7A 2Z1HA 3ENVA 3DRPB 1M5OC 5M1NA 2UU9F 3GIKA 4JV5K 4RW8A 4MKVA 4ZLNA 3GP9A 3ID6A 3VOVA 4DS5A 1FE0A 1XNRF 3PTWA 3U7JA 3CCQS 3I55N 3D1QA 4NLBA 3LP3A 2HBJA 2QN6B 4LSNA 5E3AA 5DGBA 1TK5A 4UUWA 3QIPA 2QFIA 4IFVB 3DXKB 2AWZA 3TX0A 4WFBL 2YY3A 4RPFA 2W7PA 4ILRA 3UI3A 1CC8A 2R7SA 4ZPWR 4QYZJ 2PY5A 3OYMA 1N48A 3FGUA 3VQ7A 2DTJA 1RHUB 1YJRA 1OYEA 3BF1A 1RAHB 2YWHA 2MZ1A 1NB7A 3ENBA 1NHVA 4P10A 2DGQA 3QGGA 5E5NA 3CCMS 3EPGA 2QA4N 3E9PA 3CDUA 5ETNA 2C22A 1NBEB 3SCLE 4LF7F 2DO0A 4F8RA 1RWVB 3IP0A 2ZBCA 3E66A 1FE4A 3IWXA 5FLXO 3NF8A 2D41A 2WB1D 2BRKA 1RDAA 1ILYA 2MKKA 3S3MA 1TKXB 1TTHB 3CD6S 2F96A 3M1VB 2W4DA 4FJMA 1B92A 3SQGB 4EBDA 4DFJA 1IBLF 3BQ1A 2O3DA 2YQ3A 4M8LA 1G6BA 4Q7AA 2AF6A 3AD7C 3QNWB 2KKZA 2UXDJ 1RILA 4NLGA 4NLWA 2IIHA 3HZGA 4OGCA 1X0FA 2Z57B 2VDHA 3VAKA 1EARA 1RHMB 3TEHB 1P27B 1RDUA 4CK3A 4EHUA 1QTNB 1Q95G 5DMRA 1KLMA 1U1NA 1FNMA 1C4AA 1S59A 4ZK7M 2V4RA 3Q0AA 2UVRA 1NGBA 5CYQB 2CPZA 1VJWA 1AFJA 3VEWA 2FJAB 2F4VK 3MAQA 1KKHA 1C0MA 2NRXA 1UP1A 1SB6A 4P2XA 4AYBD 1HYZA 3MEEA 3CMES 5E7OB 2VQFK 1PILA 4NCGA 3GQCA 2R7XA 3O8MA 5AQOA 4ES3A 2DR9A 3CF5Q 4ES1A 2A40A 3I4HX 1SC6A 2RNEA 4ZPTR 1X3NA 2GEMA 2AYMA 3DXMA 1K8AO 2ZD1A 1HQUB 2B9WA 5LJ5Y 2KT5A 2YNHA 3QWUA 5LMUF 4B9NA 3OPKA 2D3O1 1FHTA 4MDBA 3M8WA 2HNZB 1WN7A 3ZTOA 3PFOA 2VG7B 2CNOB 2DGXA 2PFDA 1RUSA 5EX3A 1UPMB 1XN9A 3ELHA 4CIOA 4OJHA 3MN9A 5E0OA 3QQCD 4BRFA 4CZGA 2B4JA 1MG7A 1SPBP 2D9PA 2PYLA 4IOAL 4DTRA 2XY6A 4OHZA 3G86A 2F63A 5HVGA 1JLBB 1K0TA 2Q66A 4OPKA 2PA3A 2WSEC 1X4FA 3R2DJ 1XI1A 2UXBK 4X62J 1YRTA 3DJCA 1W2IA 4QWAA 3UN5A 3NY0A 4Y6IA 3ET6A 1VSFA 2OD6A 2DNHA 2DNPA 4DV2F 3UR3C 2C2KB 2ZWHA 1V9OA 1HPZB 1ZC6A 2O8EA 4IO9Q 2ZDPA 1JXBA 2RQMA 3F0NA 4O3RA 1FK9A 3THXB 1UEUA 1GTHA 4ELTA 1CXQA 1TFWA 5J2QB 4V19S 1RJJA 2W9BB 5D0RA 5T7LA 4O4GB 4BRIA 1NGHA 2GGPA 3O9TA 2P9NB 3ETMA 4CGHA 2XULA 4NLRA 4GC6A 3EGZA 4DR4J 3G9CA 4BC3A 3MM7A 4FYDA 4JI7J 3GSDA 4IG0A 5CZVA 3DRXA 2I8EA 1K1QA 4GKKK 1NSQA 3N6LA 1S1UA 2K3KA 5KFWA 3Q7BA 4BR5A 4AQYK 3L6QA 1RE1B 4LFAJ 1CQMA 3HHKA 1KVIA 3B78A 5KFZA 1A9NB 2VU5A 3KHGA 1YLXA 3KK1A 4M3WA 2UUAK 1QHAA 1RDCA 3OHRA 3DXBA 2ZVSA 3LOUA 2YNIB 1TUWA 3UDEA 4JI0K 5D3GA 3UNYA 1D5AA 1WOOA 3NCIA 5CCLA 2I9SA 1NZ8A 4A62A 2VL1A 1MU2A 2HQCA 4CFDA 6FD1A 1PJ6A 2GVZB 4H54A 1ZM4A 2FY8A 4K0KK 2HW3A 3GJTB 2XO6A 4JYAK 3M2VB 3CI5A 1PBUA 3W2WA 3AA3A 4P74A 4XK8C 2EWHA 2DH7A 4IJNA 1NSAA 3WNHA 3OTBA 3KKFA 4I6WA 3KJVB 2CNLB 2P5VA 5HSPA 1DURA 4IKAA 1QVFR 3VQSA 3PRBA 1Q7YO 2DRDA 5C7PA 2QFJA 3MXIA 1VGYA 2DCUB 4XH4A 3RRGA 4ZHRA 2AMCB 3G71S 2MLYA 4BRPA 3D66A 2CWKA 1HBOA 1PKUA 3WIVA 1Z1ZA 4R5PB 1HX1A 5KPZA 2LMIA 2A6MA 1IBMK 2C2EA 2OKQA 4CGJA 1QVGM 1BWVA 5E84A 3CNQP 4KHPF 3M6UA 3HHLC 2UXCF 4TQRA 1C0TA 2HGLA 2QE5A 4L6V3 1GOBA 4JKDA 3N9UC 3FZ2A 2G9OA 3OYGA 4LRCA 3C2PA 2I5JB 2JWKA 2FC8A 4PXBA 4CHZA 3QBXA 1X1PA 1CVJA 1T05B 3PXGa 2ACYA 2CPYA 1U45A 2HK3A 4OHYA 5K14A 4KKOB 2GV1A 3HX9A 1RT7B 4B3TJ 1LNQA 2XC9A 4G1QB 2E2QA 3A5NC 3PHEA 4OJGA 1T44A 1YRUA 2E6MA 3PIPL 4IFYB 4KB1A 4WF9Q 2GIRA 1HW9A 1QZ6A 2RDIA 2PEHA 3TZWA 4N76A 1WKKA 4OL8A 3SJJA 3UD5A 2RDJA 3ICLA 5BR8F 1FEEA 4TYAA 2OJ3A 3NNHA 4RBTA 3FCWA 3GIIA 2GQ2A 3BQ0A 2UUBF 1C4CA 4F02A 3MDFA 2AP1A 3LUYA 5IWAF 5IFMA 3F44A 5IXUA 3LH2S 2ZJQQ 4EI2A 4JI6F 2P9KB 5F0UA 2XNRA 3KUGA 2YWWA 3ZSWA 3QINA 3W1YC 1U1OA 1ZTWA 2N82B 4LFBF 5HROB 4BRLA 1UAWA 4ENOA 5T14A 3WQTA 3LGMA 1KVCA 3ULEB 2UU9K 3V6DA 4CEDA 1EZZB 1VIXA 4OI0A 1SUQB 4ZP7A 4CJ7A 1NGAA 1JNRB 5DM6Q 2KKHA 1HYSA 2J9DA 2B6AA 3D0IE 5EOYA 2IC3B 1FXDA 2R8IA 1WC0A 4H4KA 3NH2A 1IBKJ 1M1GA 5KFHA 4AD6A 5EWEA 3O4WA 4B17A 3N01A 3K57A 1TYQA 1N4LA 1BO5O 4Z0UA 5BXIA 2XBPA 3H08A 1TGOA 3H5UA 3VTHA 3KK2A 4WYWA 3E2EA 3ZZTA 4DR7F 4YORA 3MPYA 1BY9A 4FS2A 4ID5B 2MZTA 4LREA 2ZJRQ 2PFFB 1RKIA 2QWMA 1JCFA 3LZJA 2VA2A 2IFXA 5AT1B 2OHDA 2GHWA 3M2RA 2DNKA 3CEDA 2MQNA 4XPEA 2XMJA 3CCZA 4IH5A 4F3MA 4H0VB 3KLIB 3QFHA 2NPIA 2V4JB 1OY9A 4DV0F 3HPGA 4ZN3A 4DUYK 4Z37A 2UUWA 1IBLK 2LVWA 4NXMK 2YWGA 1GT8A 4JV5J 4KGMA 4EBEA 2RB7A 1FKPB 1S99A 2EK1A 3AO5A 2H54B 5CHCB 3PM9A 3NBPB 2J6SA 3BBBA 4RNHA 1RK8A 3ZSXA 2KB2A 2LFVA 3PY8A 1RBVA 5KT6A 3CD7A 3TSPA 4KHUA 4JP8A 1APSA 4FJLA 1S6QA 1RT4B 2HBLA 2RUSA 4F7VA 1Z25A 1GLFO 4WFNQ 2H5IB 1UFWA 3ILLA 2MTLA 5SUHA 2QWPA 1REVA 3OVSA 3PKYA 2ZE2A 4H0OA 2B4PA 2P9LA 3D3CJ 3O1LA 1FKOA 2Z2MA 3FGVA 2K7KA 2GHPA 5CA5A 2QTWA 5MAOA 3WC0A 4B9VA 5SWMA 1WNSA 2FVCA 3C7NB 1QJHA 1K8KB 1WDDA 4OV6A 3A5MC 4UQGA 3S7RA 1RTDB 4BR9A 4TLQA 3VESA 3IRXB 3ZT4A 2L08A 3BY5A 4NO7A 4RW6A 4FXWA 3HKWA 4DV6J 1HKGA 4MH8A 4AHTA 3RG6A 3VZIA 4A57A 3FZMA 2G1HA 2QG9B 2N3LA 2GUIA 2P8IA 1HBUA 1VS3A 1JLFB 2KRBA 4ED3A 1A7GE 3RB6A 3H3NO 1VISA 3CJKA 2ABYA 1F21A 3HSGA 5HQ8A 1WOPA 1LW2A 2AEJA 3AVAA 4BGBA 3WZ0A 5D0EA 2LA4A 3ILOA 3V9ZA 1VFJA 1XWLA 2BE7D 3C14B 1ZAXA 5BRFA 4HCCA 4M5KA 1B0TA 5J1PA 3RAQA 5FPDA 1ZM2A 5J2PB 4C2MA 3OS0A 1EKRA 2F4VJ 4JKFA 3ZZPA 3ATVA 2C2NA 1EETB 3J81U 2VQFJ 1XHXA 1GAOA 4X66J 3A4TA 5DG7A 2DNNA 3NGDA 1CJVB 1GLAG 1HD1A 2L3MA 1U24A 3A8KA 3QWPA 3UIQA 3TQ1A 3QJJA 5AQNA 4QU6A 1RBOB 4XIUA 1RU2A 1MN9A 3A8EA 4NA1A 1ZETA 2H4YB 1Y3JA 1NNDA 1SV5A 1U1LA 2FSJA 4JN4A 4NX9A 3VQ4A 4CHYA 4DG1A 4A8QA 3KDNA 1Q8IA 3K9KA 1X7VA 2MGZA 5T7BA 5DQHA 1S6PB 4WKYA 1SAZA 3TUZC 1T02A 2WK4A 3R5DA 1WI6A 4QZVB 4UZCA 3I56S 3VEVA 2D5RA 1KD1O 3SJHA 3V4IB 4LFCK 1UL3A 3CYMA 1UMJA 5KFEA 2NRRA 4Y0WA 2A3JA 3G6ES 4FWOA 3OTOJ 3MTJA 4F25A 3LGNA 1HI8A 3GSIA 2YX7A 4RW7B 2XGPA 1Z26A 4B1XB 2HNDB 3T1AA 1I6JA 1GTEA 4CEFA 5TKYA 3GIRA 5HO4A 3WNFA 4JRPA 3MOJB 1NPRA 2J0SD 3T6BA 2HNYB 3MWPA 1FCAA 3PHTA 1L3TA 3M6WA 2VASA 3CCUN 2CGKA 4G65A 4KBIA 4EUVA 3VQ9A 2FDNA 4OJ3A 5EN1A 4I6AA 2LSNA 4FVUA 3Q8UA 1XMQF 4IOCL 5ADXH 2CDQA 4DQPA 2WUSA 2FJEB 1UPPA 3CULA 3FJ2A 2QX0A 4U7UK 2C2OB 2HFVA 4W90B 3UKUB 2GAHC 3OYHA 3FZBA 4CLUA 4L75A 3EMTA 5AQHA 3V5RA 3ZZRA 4GVBB 2P9PB 1RSCA 2DXEA 3UFCX 3NCPA 4EZ9A 3U6FA 1MNEA 3HVWA 2IVMA 3OA9A 5LL6d 3FKBA 2FHKA 2GTDA 1EB0A 4YN3B 4FO0A 4KHRA 1RAGB 1MWYA 1BD6A 3ONQA 3P4UB 4YDUA 4FOIA 1NJZA 2BUPA 5HMYA 4ZVFA 2KRRA 4KHPK 3AVMA 1R8HA 2C2MB 3T41A 1P1LA 5HRRA 5HMZA 4GKJJ 4PYDA 5HANA 2GV9A 2YX6A 5EVZA 4LF1A 2AHOB 3I82A 3M8SA 2IHR1 3SQ4A 4RNMA 5AQGA 4FJ5A 4DTXA 2OPQB 4JI0J 3CCSS 1LCUA 3HO1A 2CPXA 1UFKA 2J9DE 1X4GA 3ITHA 2GUPA 4B3OA 3KVGA 2WTUA 4K0KJ 3VR1A 3CE8A 2KG1A 3IKMA 3LP2A 4KYZA 4ID8A 3SUQA 2YH0A 2ZH6A 5I42B 1U1KA 4OYXA 4HT7A 4OYBA 1KSPA 3UN3A 4YB5A 3EXYA 3AVIA 3HL8A 2WOMB 3QICA 4XH5A 1DKGD 5BR8K 1YDLA 3H5YA 4KTWA 4YUDA 1WF0A 2XEXA 3PIOQ 2ZHAA 4ETXA 1BA0A 1PJ7A 5IWAK 3QMLA 4K50A 3ZSVA 2QEXS 1Z05A 4F04B 2W25A 4RCHA 3RR8A 3BKFA 2FZCB 3V9XA 1LK5A 4LFBK 2Z30B 1CQNA 3HM8A 5C15A 1C1BB 1IKXA 1IBMJ 2UUCJ 3N6NA 3H4DA 3MM6B 1HIYA 1NMNA 2LEBA 4NLQA 2MKJA 4DV5F 2BW7A 1JLQB 1YVUA 3VEYA 2QLXA 3M32A 3EZUA 3MMVA 3ZT3A 1N54B 3VVUA 4DL6A 1FO1A 1CLFA 1RDWX 4B9TA 1K9MT 3NDKA 1BI4B 6FDRA 4E7LA 2ASDA 4IQMA 4LBIA 3MEGA 3T1HJ 4QIGA 2ZH9A 1U47A 3CJ2A 3M05A 5BJRA 4B1ZA 3AXKA 3ETOA 2NUHA 5K8PA 3RVCA 4DR7K 3CMQA 2K8GA 2MJNA 3VQDA 5A76A 3CD0A 4OX8A 1R59O 2W41A 1R8CA 3TVKA 4C97A 4CLTA 3LP0A 3AV9A 3HXMA 1CJTB 2HOEA 1Q8LA 2V51B 3H7HB 1NPKA 2Z58B 2GIQA 5H9EJ 3GPAA 5F8GA 3NNAA 1KHWA 2V2ZA 2W2QP 3D1OA 1RDDA 2ZC3A 3MXJA 4DV0K 1TU0B 1SIZA 5M2RA 5MLCQ 3DLKA 3W9HA 4FXVA 3RZAA 1RP5A 5C24A 5HBMA 1GXUA 2A42A 3L4QA 4JEPA 1IR1A 2HLUA 4BRHA 4CNZA 1JLCB 4HI1A 2UU9J 2HEKA 4A8YA 4CJLA 1NBWA 4Y1DA 5A8RA 3BP8A 2YI1A 3FCHA 2MQQA 3PDNA 2A2CA 1XNRJ 4PKDB 4CO5A 3ULDA 4WZQA 2V8GA 4NZ7A 3KZBA 4BRGA 1KWMA 1T3OA 5DRKA 4PKHA 2FXUA 4CJVA 2LLZA 3W65A 4HL9A 3AQPA 4ED5A 3MEDA 3G8SA 5F8NA 3P39A 1P1TA 1XR5A 2YPZA 4LMZA 1MDUB 1R43A 4DS4A 3FFIA