1IKVA

K103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
557
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 147
structure length 556
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikvA05
5F8HA 4B9NA 3BQ2A 3ZSVA 1BL3A 2WCXA 2YHAA 1VRUA 4KHSA 1ZBFA 3RMAA 2HNZA 2HWHA 3BSCA 2R8KA 4E3SA 2OYQA 4CGHA 2HNYA 4J9MA 3O3GA 3H4DA 5JS2A 2B6AA 2ASJA 4C8MA 3BSOA 3DRRB 2W7PA 1X9SA 3IGNA 3KMSA 1RYSA 1ZBHA 3BSAA 2J6UA 3AVCA 1JKHA 2FBYA 2W9CA 3TAGA 4WFZA 3LP3A 4PQUA 3VQEA 2WRMA 1HMVB 2ZD1A 2HHVA 3GV8B 2C2RA 3SUOA 4IG3A 3I8DA 1NK6A 3AVLA 3F73A 5L1KA 5F8NA 4B9TA 3M8PA 1S9GA 4ZP7A 3DLHA 1WNEA 1JLBB 2AGOA 3SYZA 3GILA 4M3RA 4B9MA 2BQ3A 1KVAA 5KFXA 1BISA 1KHWA 4F4ZA 1S1WB 1HNVB 1TK8A 1HQEA 4R0EA 2BANA 3OSNA 3LDSA 4YNQA 3T5LA 4MKBA 1RT4A 4F4XA 3V1OA 4AH9A 3PJWA 3AA5X 1HNIB 2KTQA 4IFYA 1NJXA 2OA8A 1Z25A 3M8QA 4H4MA 4M3ZA 3I5CA 4CJVA 2DFEA 3HM9A 1S9FA 1J53A 3HKWA 1VSIA 2CKWA 2XHBA 1TVRB 4CJ4A 4K4TA 3AVAA 4E7JA 3V6DB 2JC1A 4RW7B 4DQSA 2HW3A 3ZSWA 4YMEA 1S1TB 1C0MA 1WLJA 3KD5E 4M3UA 3SQ1A 3DMJB 4KFBA 4FJNA 2D7SA 3KLEB 3QO9B 3V1RA 4B8CA 5KG4A 4PY5A 1RT1B 1S6QA 3TAPA 4J9QA 4CGFA 4CJFA 1LWFA 4KV8B 4FLUA 1SL2A 4NCAA 1QUVA 1CZBA 5HRNA 2P5OA 3AVIA 3SCXA 2I5JA 1TVRA 1SKWA 4O44A 4KHNA 5CZ1A 4TSXA 2BQUA 1LW0B 4IR9A 5SWMA 3VQ4A 5C25A 3T1AA 4H54A 3D0PA 2FLPA 3Q8QB 4CJRA 4MIAA 4O0IA 2BE2B 1S6PB 4E1MA 5CYQA 2OPRB 2GIQA 1RT3B 4ZHRB 4J9LA 4BE1A 4EP4A 2E9ZA 5KFMA 2UVWA 1UAXA 4Y34A 1OS5A 3OYAA 4LSLB 4O0JA 2HMIA 3ISNC 1WSJA 3UR0A 1T7PA 1KLMB 4FM1A 1JLEB 4E19A 5JXSA 2AGPA 3DLRA 3SV4A 3PVXA 3AO2A 4CF9A 4BACA 5FDLA 3TAQA 3Q8RB 3IAYA 5DQGA 3FRZA 3ZT1A 4O4GB 3NH2A 3NDKA 3E01A 4FK0A 1B9FA 1RDCA 3CM6A 3LZIA 3QO9A 4EEYA 5CYMB 4M42A 3QESA 1ZETA 2I1RA 1IKYB 3OYNA 1GX6A 4RZRA 4RW6B 3QGHA 4O3OA 3H5YA 4RNHA 4J9OA 4F4KA 4K4ZA 1Y97A 1I6JA 3L3UA 4RW9A 3OHAA 3RB3A 1S1XB 2OH2A 4CF8A 4DTPA 2HAIA 5KFBA 1Q8IA 2E4LA 1MU2A 4TN2A 2IAJB 1RDAA 3EZUA 2HHUA 1HYSA 4ED8A 2DY4A 2XY7A 4HYKA 4FJKA 2YKMA 3SV3A 4FS2A 2O4IA 4BDYA 2E9RX 4R5PA 3DRSB 4B8AB 3G6VA 4XO0A 4IR1A 3LP1B 5KFHA 1L3TA 1ASVA 5KG1A 3M9OB 5KFZA 3GV7B 3M9NB 4FBUA 3KIOA 3QNOA 3VQPA 4FXDA 1DTQB 3UDLA 4HUGA 1C0TB 3KKRA 4NLSA 4JS4A 3OLAA 3F9KA 4RNNA 4N5SA 3KK1A 2HNYB 1L3SA 1S1XA 4K4VA 3NKYA 3CQ8A 3N6NA 3RTVA 4DSJA 3NAEA 1NKEA 1KCFA 1WNSA 3RR8A 3OL9A 3DI6A 1T94A 1UWBB 3NF7A 1CXUA 2Z1IA 3D45A 3ZSYA 3K59A 1QSLA 3KNAA 4E1NA 4IKFA 4KREA 5HP1A 3VA0A 4FJGA 3MEGB 3DRSA 2KFNA 3NBPB 3M8SA 2J6SA 1J9AA 1VSJA 2AJQA 3P1GA 1BI4B 2R8IA 3TAMB 3JYTB 4CF2A 4I2QA 1KSPA 3HPHA 1KVBA 3SQ2A 5F8MA 4UQGA 4NLYA 2R8JA 3VQ5A 3QEVA 4FK2A 3BREA 4KE5A 2YNHB 3H5XA 2JEFA 3VQQA 1C1BA 2FLNA 3V6JA 1QSSA 1NK5A 1KHVA 3HHKA 4ED2A 1FXXA 4N76A 1S1WA 5KFEA 3AVKA 3QERA 2FVPA 4FJ7A 3T3FA 4DG1B 4IFVB 1JX4A 5HRRA 2G8IA 3QEWA 5FRMA 1R0AB 1Q9XA 1Q9YA 3RMBA 3KMQA 2HHXA 2E6MA 4TQSA 4AHRA 3BSNA 3CWJA 2ITGA 4FLTA 4BE0A 4J2AA 3IGVA 3K2PA 4RNFA 3ASMA 4GW6A 2FLLA 5D3GB 4ICLA 4FLYA 2V4RA 1S0OA 1C0UB 5DLFA 4MFBB 3CDEA 1SUQB 3ZT4A 2RDJA 3AA3A 4W5TA 2DFFA 4ELUA 5DG7A 5J2NB 3PX0A 3T5KA 3KK3B 4I9QA 3WNHA 4QWCA 2ZD1B 1KFDA 4FJLA 3MECA 1JLCA 4O3RA 2GBZA 4NZ0A 5D3GA 2KFZA 5HROA 3UIQA 4RNOA 3VQ8A 2AQ4A 1VSKA 3DYAB 1S1VA 4LQ3A 1VSDA 1XHXA 4QWBA 4Z0UA 5KFGA 4F8RA 2QXFA 4E0DA 4GC6A 5KFDA 5J2QB 5FRNA 3QGIA 2WONB 2YNGB 2C22A 3FDSA 4HUFA 4URQU 1S0MA 1U4BA 4CFDA 1S9EB 4DL5A 3OJSA 1YT3A 2G8WA 1SV5B 2FJWA 2YNIA 3DLBA 3OS2A 5KT2A 2AWZA 3AVGA 4CHNA 3TQ1A 3MR2A 4NYFA 1EETA 4Z4GA 4ZVHA 4LQ9A 5KG6A 4KHMA 3VQSA 1WSGA 4I7FA 2IMWP 4H4MB 4RW4B 4CK1A 3MEDA 4CERA 4CJWA 4FJIA 4KKOA 4QPXA 2C2EA 3NL0A 3UPFA 4DL2A 4J9PA 4CHOA 3AVNA 4FJ5A 4CE9A 1TAUA 4QCLA 4MFBA 4DFMA 3DLKB 5FROA 4TQRA 3OS0A 1TV6A 2BQRA 1QE1A 2WOMA 4NRUA 1JLQB 4CGIA 1C1CA 2HWIA 5I3UA 1S48A 4ZPBA 3ZSRA 2XI2A 3BJYA 1HYZA 3NMAA 4CFBA 3U6FA 1W9HA 3CFOA 3ALYA 3LP2A 1TGOA 4FJ8A 4OJRA 4C8NA 1RT5B 1RT2A 2G8UA 4CJUA 4CEQA 5F8JA 3ITHB 4KB7A 3K57A 5KFTA 4I7FB 2W9BB 4CIFA 4DQPA 4KKOB 1N6QB 1S9EA 1GOBA 3M8PB 4AHUA 2YHBA 4KSEB 1I3AA 4CEDA 2BDPA 3AVBA 3PZPA 4DQIA 3ISND 3O4NA 1C1AA 4DTJA 4FLXA 4MK8A 5C25B 2FBXA 3AVHA 4O4RA 1T03B 4M95A 3AO5A 1S6PA 1S0NA 1YTUA 4IG0B 2G8FA 3LP1A 2FVRA 1L5UA 1N6QA 5HRSA 1TKTB 3OL6A 2QKBA 4CEAA 2ZE2A 4DS5A 3RWUA 1ASUA 3OL8A 1QTMA 1RT2B 4Z4CA 1BCOA 4O55A 4DU3A 3OYJA 1RAJA 2FBVA 1RYRA 2QE5A 1HMVA 5KFRA 4J2EA 4R8UA 3VA3A 4I2PB 1JXBA 1TL3B 2G8VA 1TK0A 3DI6B 3H5UA 1NJWA 2UVVA 1S1VB 3V6DA 1N48A 1RBTA 2G8HA 4IFYB 3I0SB 2F8TA 2B4JA 3QEPA 3H40A 3K5LA 3PW5A 4MH8A 3KTQA 5KFIA 3V9UA 4J2DA 3PHEA 3AVMA 1U04A 4URSA 5KT5A 2JEGA 1EP4A 2AGQA 1RT4B 3C95A 3KLIA 2FVQA 4FW2A 2D3ZA 4CJKA 1VRTA 4LSNB 4Q45A 4ECVA 3M8QB 4B9SA 3V6KA 1JXLA 1TKXA 4RW4A 2DTUA 4AILC 2DPIA 1RBUA 1IKWA 3IN5A 3IRXB 4KPYA 3PR4A 2JEIA 3VN5A 1XHZA 1ZYQA 3L2QA 4N47A 3FQLA 1LV5A 3QLHA 4BDPA 4NLPA 1REVB 4XPEA 4H4OB 1VSEA 1IG9A 4FZZA 3G10A 1GOCA 4DSKA 4DQRA 1J54A 3KHLA 3KOAA 1RBSA 1L3UA 3HVAA 1LW0A 2ASLA 4QWDA 5KFYA 4CF0A 2AU0A 2IM1A 2ETJA 3S3MA 2ZQBA 2HNDA 4C8LA 2UUTA 4JRQA 5J2PA 3THVA 2F8SA 1RTDB 3OYEA 1HJRA 4MK9A 4LD0A 4KAZA 5KT4A 1S97A 4X2BA 3DLGB 1D0EA 2IM2A 1DTQA 3L3VA 1TQLA 4OPKA 3MR6A 2IM3A 3GIMA 3MR5A 3EYZA 2PZSA 4CJ5A 2BRLA 3RB0A 1SKSA 4J9RA 1U47A 3FSIA 4NYNA 3WNEA 3HPOA 1LWEB 5F8GA 1RDDA 4URGA 2FVSA 5F9LA 1CLQA 2YNFB 4ID1A 2WHOA 1MU2B 3QIPA 4IOBA 4NLVA 2D3UA 4FJ9A 1L3VA 1S10A 4NLQA 5K14A 4ED6A 1D9FA 4FM2A 3S3OA 3OYDA 3D5MA 2FC0A 5DQHA 3L2UA 4Z4IA 3KKSA 1JLFA 4ECYA 2V9WA 2R2TA 4W5NA 4FJXA 3QEIA 3AO1A 4IH6A 1A5WA 1BI4A 1RTDA 4CEEA 4DL6A 3GQCA 1U49A 1SH0A 2B43A 4IFVA 4N41A 2IC3B 1U48A 3SI6A 1ITGA 3KJVB 4NCGB 2XGPA 5KT3A 4RU9A 4Z4HA 3I0RB 2VG6A 2Z1HA 1WSIA 3BGRA 2RF2A 5DGAA 4O3PA 5KG3A 3OYIA 4DF4A 1T8EA 1TK5A 5EWGA 3DOLA 1EP4B 4DFKA 1YTAA 1JLBA 3OYMA 1FKPA 3SPYA 1VRTB 1UA0A 5HP1B 3RMCA 1KLMA 3HL8A 5KFSA 4B9LA 5J1EB 2OPSB 5C42A 3H5SA 1K6YA 1KTQA 2VWJA 4NLTA 5KG7A 4NLGA 3ZSQA 5SZTA 1SL1A 1JXEA 2R8HA 2AX0A 1EX4A 4KTWA 3GIIA 4L8RB 3DOKB 1JIHA 4KAIA 1JLFB 3JSMB 3OYBA 3NBPA 4F2SA 4Y1DA 1G15A 3LWLA 5KG2A 4I2QB 3VQ9A 4E7LA 1BIUA 1UWBA 3RBDA 4K4UA 2VA2A 3OYHA 2IBKA 1U45A 3DYAA 5HLFB 3LALA 5KGXA 4CJSA 1S1TA 3HPGA 1NK7A 1S1UA 4B08A 3PV8A 2GUIA 5C24A 5T14A 3VQDA 2EHGA 4O3SA 4DG1A 5DLGA 1IKVA 1RBVA 3NGZA 3O3FA 4JV2A 3OHBA 3AVFA 4E7HA 4WE1B 3DRPB 3OLBA 2YKMB 4DSEA 4IBNA 1TKZA 3PY8A 1IM4A 4NLXA 5JUMA 4WXOA 3ITHA 5KFCA 4Y1CA 2WK4A 2F8EX 2OPSA 5J2NA 2J6TA 2E6LA 2ILZA 1WAFA 4DU1A 4M3TA 1JLGB 4EYIB 5F9NA 4DTSA 3CIZA 1XR5A 2XI3A 3SI8A 4CJPA 4RW8B 4PWDB 4CJQA 3LP2B 4KHQA 4OKEA 4LSLA 1BQNB 4EO6A 4OGEA 4DFPA 4TY8B 4GMJB 5L1JA 4ECSA 1S4FA 3CJ2A 3ZT3A 4XPCA 3HT3A 4FBTA 3QIOA 2VG7A 3T5HA 1IKXB 1N56A 2UVRA 2IA6A 4QW9A 4CEBA 1NKCA 2Z1GA 2HB5A 1RT7A 4RUCA 5CY4A 1HQUA 4NCGA 3HVWA 2XCPA 3MR3A 1ZTWA 4OPJA 4IRCA 2HHQA 4CECA 3E51A 3CDWA 3T19A 2BRKA 3MEDB 2FVCA 2W9AA 1T3NA 4TY9A 3K5MA 3SFGA 4TXSA 5KTQA 1KVCA 4RW8A 1FKOB 4IRKA 1U09A 2ZE2B 4DLGA 2R8GA 3SPZA 3V6HA 1EETB 2HHSA 3P83D 1Z4UA 4TYAA 1KFSA 1TL1A 3ZCMA 1LWCB 1X9WA 4EO8A 1N5YB 2B6AB 4BWMA 5J2PB 4DEZA 2R2UA 4AHCA 4IG3B 3Q8SB 3H4BA 4GC7A 1SV5A 5DGBA 3GYNA 4ECQA 4QWEA 4CIEA 4CHQA 2XGQA 1JLAA 2W9CB 2PYLA 4ZVGA 4KI6A 2HNZB 1S5JA 2ATLA 3OYGA 2X6NA 4DU4A 4DL3A 4R8UB 2W9BA 2P5GA 3QEXA 1LWEA 1N5YA 4ICLB 1EXQA 3LP0B 2FJXA 3WNGA 1RA7A 2G8KA 4J2BA 3KHGA 4HUEA 4JRPA 1RT6B 1NK4A 4N56A 2B5JA 4XIUA 4YR0A 4KTQA 4FZXC 4CJLA 5KFAA 3C6TB 3TAFA 4FS1A 1FK9A 4K4WA 1REVA 1LWCA 1C1CB 1WSFA 2HVHA 3L2VA 4K8XA 4JUZA 1D1UA 3SZ2A 1YVUA 3RB6A 1IH7A 1B92A 4C8KA 1UA1A 3IRXA 2O5DA 1CZ9A 3VQ7A 3PO5A 5F8LA 2VG5A 2C2DA 1VSHA 2A1RA 2RPIA 1NKBA 2GV9A 1DLOA 3KK2B 3ICLA 2KQ2A 1W25A 2BR0A 3K58A 3OL7A 4ECUA 3H2LA 2OPQA 2VG6B 1DTTA 1RTJA 4CEOA 2KZMA 4HKQA 2W7OA 5KFWA 2Y1IA 4Q8EA 4CF1A 3OYLA 3L8BA 4IH5A 3LANA 5I42A 3SQ0A 3LP0A 4CFCA 2A1SA 4EBDA 2ASDA 1VRUB 3I5AA 4DTMA 4ZPCA 4B9UA 4I2PA 4ZVEA 4B9VA 4CJEA 3B6PA 4IQXA 4KV8A 4YQWA 3A2FA 4ZP6A 3P5JA 4FYDA 4CHPA 2XC9A 3DLKA 1LW2B 4NLWA 3KLIB 4O5BA 3TR8A 5KFLA 1NHUA 4PQUB 4RUAA 4Q5VA 4CEZA 1NJYA 3V9ZA 1RT3A 4ZHRA 5L1IA 4FLVA 1J5OB 1KLNA 4DTUA 4FJJA 4JV1A 4K50A 2JC0A 3RMDA 4U6PA 1C0UA 3SUPA 2XY5A 2P51A 5HLFA 3KD1E 3TANA 4LH5A 1SUQA 2NUBA 3LWMA 1RILA 5KGWA 4FK4A 1S1UB 1RTHA 1TL1B 3HP6A 1TKDA 1TAQA 3IS9B 2OPRA 2RF2B 3QGGA 4PUOA 1X9MA 1HQEB 3TVKA 1UOCA 2O4GA 4F4WA 1T05B 4YR3A 3OSPA 1VSMA 5DK5A 2JEJA 2Y1JA 2D0AA 4OL8A 1LW2A 1FKPB 3U3GA 1ZBUA 4Z4FA 3RRGA 1C0TA 2XY6A 3H98A 1NOZA 4Y2CA 3QLHB 1SKRA 3NGIA 4FLWA 1ZBIA 4DWIA 4NLOA 1IO2A 3QYYA 4IG0A 5C42B 1HPZA 3NGYA 2IJNA 1IKWB 3B6OA 5EUHA 1QSYA 1QHTA 1T05A 3DDKA 4G1QB 3AA4A 2IC3A 5KFPA 4B3OB 4CEFA 1A5VA 1RT6A 3KJVA 4IH7A 2PYJA 4CFAA 1VK0A 3S9HA 2ZKUA 3I0RA 4H4OA 1MMLA 4E7IA 3L2RA 5KT7A 4W5OA 4GVMA 1CSJA 4EYHB 4RW6A 4DQQA 5DG8A 4WFXA 1TP7A 4NLRA 4B3OA 4WZQA 5K14B 3OY9A 1DLOB 3KK2A 1BCMA 2HHWA 4JLHA 3QNNA 4FCYA 1GX5A 4KHUA 3O3HA 4PUOB 4BDZA 1JLCB 2E9TA 1IKVB 3FQKA 3QIPB 3MFIA 2FBTA 3DRPA 1FKOA 3Q8PB 3VQBA 3MXMA 3ZT2A 1GOAA 1QS4A 1X1PA 4Q0BB 4DSFA 1BQMA 3SQ4A 4ZTJA 3MEGA 3KK1B 4WXWA 5J2QA 2QKKA 5C24B 1RA6A 3HO1A 2ALZA 5J2MA 3FFIA 3MECB 4HCBA 4EBEA 1RBRA 3ZSXA 3PJXA 3LAKA 5KFFA 4ECZA 3HVRA 2YKNB 3HSTB 3CFRA 3S3NA 5KFQA 3K5OA 4MKAA 3GIKA 3KLVA 2R2SA 1BQMB 3HXMA 3RAQA 3RBEA 1YVFA 4H8KA 1IKXA 4K8ZA 2PY5A 2ATQA 5KFKA 1I39A 3MXJA 5KFOA 5KFUA 1RT7B 3AA2A 1D5AA 1R0AA 4RW7A 2JLEA 4CGDA 3OS1A 3QZ8A 4TLRA 4KBIA 4CGJA 4Q0BA 1C1BB 1SH3A 3NFAA 4ECXA 4RW9B 3N6MA 5J1EA 4CJ3A 3OVNA 3BGRB 3HVTA 3PO4A 3ZT0A 4ZTFA 4EZ9A 1JLGA 3KLGB 3TAMA 3JYTA 4TYBA 3EY1A 2XY8A 3NF9A 2RKIB 1RTIB 3TAEA 3C6UB 3OYCA 2VG5B 2YNHA 2DPJA 3NF6A 4DTOA 4K4XA 3CYMA 4FLZA 4I9LA 1D9DA 3IG1B 2WOMB 4DSLA 1NNDA 2KZZA 1JLQA 2XWYA 1HPZB 4M45A 1DTTB 1HNVA 1RTJB 3H59A 4ZPAA 5HBMB 4K4SA 4ZPDA 2BANB 4M94A 4G1QA 4ID5B 4Z4EA 4WE1A 5KFNA 3C6UA 2YV0X 3T5JA 4F50A 4ED3A 2R7YA 4PA1A 2P1JA 3BQ1A 4DSIA 2IM0A 1QE1B 3GV5B 4KO0A 3PW4A 2HMIB 5KFJA 4LSNA 1QAIA 4NRTA 4FZYA 3CFPA 3HVTB 3KLHA 4NLUA 3HK2A 2GIRA 3GIJA 1XR6A 1BIZA 4HTUA 4JV0A 1NK9A 5KFVA 2XO7A 4JS5A 4ED7A 1RNHA 1QAJA 4E7KA 4CGGA 3PX4A 1JLAB 3SNNA 3H08A 3E01B 3CJ5A 4MQ3A 3CJ3A 3BDPA 4AHTA 3I5BA 3SUNA 1XI1A 5HROB 3LPUA 4EP5A 4WFYA 1NOYA 3QINA 5KT6A 3OJUA 2W8LA 4KO0B 2AX1A 1K1QA 1K1SA 1NJZA 2V0NA 3KLHB 3NHGA 3DMJA 4KFBB 4OKKA 3VQCA 3KLEA 2F96A 4FVMA 4QW8A 1JL1A 3DLEB 4ZP9A 3BR9A 1EKEA 2ILYA 2IAJA 1SH2A 3RB4A 5I42B 3NE6A 3DLGA 3AO3A 4C8OA 4TY8A 4LH4A 4RNMA 4J9SA 4BWJA 3VQAA 4WYLA 1WN7A 1TKXB 1XR7A 3TWHA 4J9KA 5C5JA 3PW0A 5HRPA 3CDUA 1NK8A 2W8KA 5L9XA 5EDWA 1HQUB 4KB1A 1JKHB 2VA3A 1F21A 2DFHA 3KHRA 4YFUA 3ZSZA 5I3UB 1XWLA 2CJQA 3MXIA 2LSNA 3KLGA 3NH1A 3EPIA 2RKIA 3C94A 1S9GB 4O3QA 1J5OA 4AHSA 5FDLB 4NYZA 4QAGA 5KG5A 3VQ6A 4KI4A 2QV6A 2GC8A 3SUQA 1TKZB 1D8YA 4FM0A 3PX6A 1RCHA 3TARA 1HARA 3C6TA 1JLEA 5DMRA 1T03A 1Z26A 3ULDA 3V81A 1HRHA 4J9NA 3HJFA 3V4IB 4KTZA 3G6YA 3LPTA 4KHWA 3DLEA 5KRSA 1RT1A 1S6QB 5L1LA 4CJTA 3KHHA 4M3YA 2YNIB 3NCIA 4PWDA 1KRPA 4ELTA 2WB4A 4O4GA 4O44B 2W42A 4M3XA 2IGIA 3OYFA 1LAVA 3V9WA 2R2RA 4YR2A 3TABA 5JS1A 4Y2AA 4DTXA 4M3WA 5F8IA 4OLBA 3V4IA 3SJJA 1N4LA 3SFUA 1TKTA 2EX3A 3QETA 2I5JB 3ZSOA 1NHVA 2D41A 1HYVA 5CZ2A 3CM5A 4DTNA 2UVUA 3DM2A 3JSMA 2UUWA 2OPQB 4U7CA 3CJ4A 4ZVFA 3PW7A 4CK2A 3OYKA 4DL4A 4CIGA 1A5XA 1LWFB 2FJVA 3U3YA 3LAMA 3RAXA 4HHTA 2HVIA 1HYSB 3AO4A 1W0HA 4F4YA 5DQIA 4FJMA 3M8RA 3PR5B 4MK7A 4R5PB 3G86A 3MEEA 4IKAA 4QOZB 4O3NA 3QZ7A 3KK3A 3TI0A 2IDOA 2C28A 4FW1A 5KRTA 3AVJA 2V4QA 4Q44A 2X6SA 1VSFA 4CCHA 4CHZA 1HNIA 4IDKB 3CG7A 2X78A 2Q3SA 3IG1A 3CJ0A 4Y3CA 5KG0A 3V1QA 2JGUA 5CYMA 4W5RA 4DS4A 4LY7A 1SL0A 4ZP8A 4DFJA 3MF5A 4YP3A 5HBMA 3KLFA 3HYFA 2D0BA 3D28A 3RR7A 2KW4A 2YKNA 4IRDA 3PW2A 4CK3A 2OZSA 4OLAA 3MEEB 3DM2B 1RTHB 1C2PA 3BQ0A 2WTFA 2IOCA 4HCCA 4DLEA 3LZJA 3O4QA 1RDBA 4DL7A 2X74A 1JL2A 4EZ6A 5EU7A 4G3IA 1ASWA 4HVJA 3MFHA 2OPPA 4Q43A 3G0ZA 3EPGA 3UQSA 3CO9A 4QWAA 3M9MB 4EBCA 3I0SA 2Z1JA 2HHTA 2EC0A 5T7BA 3N6LA 4ECWA 4M41A 3RRHA 4KB0A 5EWEA 2HNDB 3V81B 2IJFA 5DG9A 5CYQB 2BGGA 3FFIB 1ZBLA 1QQCA 2VWKA 3MTKA 4DTRA 5EWFA 4F3TA 3PUFA 4IDKA 2OPPB 1LAWA 4CESA 1RT5A 4OVLA 1WSHA 3CVKA 1BGXT 3V9SA 2QK9A 3AV9A 2XRIA 4CHYA 3NH0A 2D0CA 4NLDA 1C6VA 4OGCA 4KRFA 3KLFB 4MIBA 4F3OA 4ZMMA 2OZMA 1XC9A 3NAHA 4AHVA 4ECTA 2IS3A 4W5QA 4FJHA 4ECRA 2RDIA 4RG8A 4WYWA 2VG7B 1IKYA 1B9DA 4OKJA 1RTIA 2D5RA 3NGDA 3HP9A 3K5NA 4ID5A 1WAJA 4K4YA 4Q8FA 4KHRA 3EZ5A 1BQNA 2B5JB 3V9XA 3NF8A 1FK9B 2WONA 2YNGA 3IS9A 3G6XA 4WZMA 2XCAA 1TL3A 4NCBA 3DOLB 1NK0A 1ZTTA 4F2RA 3L2WA 1RDRA 4ED1A 4KHYA 4E89A 5E41A 3MAQA 3DOKA 1BHLA 1TV6B 3QIDA 4BE2A 4ED0A 3NAIA 1CXQA 2RN2A 2BE2A 3WNFA 5J2MB 4ELVA 4DMNA 5KI6A 4DF8A 2YNFA 1WSEA 1O1WA 3DRRA 1VSLA 1S49A
chains in the Genus database with same CATH superfamily
1G4CA 2DRDA 4B9NA 1BL3A 3AY9A 4OX9K 1ZBFA 4P9SA 5C7PA 1S6OA 1YF5L 2HWHA 3UD5A 5AQRA 2IJRA 4E3SA 4OI4A 4CGHA 3H4DA 3NMRA 5JS2A 1S57A 2ASJA 3CQXA 4C8MA 5ETTA 2IVOA 3ETOA 3BSOA 3DRRB 1X9SA 2DJWA 4ED4A 5BREA 3KMSA 1ZBHA 3AVCA 1EKSA 2U1AA 2W9CA 4WFZA 2LU1A 4QU7A 3P4UB 4FWMA 1VJWA 2M7SA 3G71S 4IG3A 3I8DA 4ZJOA 3M8PA 3PRVA 1JLBB 3S6EA 1YXQA 1WG1A 1Q86O 4BR2A 4M3RA 3W9HA 3A8EA 1P90A 5KFXA 2ZNYA 2BJ7A 1KHWA 3L4BC 1TUVA 2UUAJ 4RWTA 3KKFA 2E7VA 3OSNA 2CJKA 3I4HX 5MAOA 3KUHA 2CPDA 3W9JA 1NHKL 1OH7A 4MKBA 1RT4A 3KFWX 4AH9A 2KTQA 5D0EA 4LFBF 1GMUA 2KLAA 1VOMA 4H4MA 3I5CA 4CJVA 3OQ2A 2CPJA 1M1KT 2FXUA 1G1XA 1YIJN 1TVRB 4CJ4A 1K8KA 4E7JA 1NGIA 4RW7B 1X0PA 3NWGA 1FRXA 1Q7YO 3ZSWA 4YMEA 1S1TB 1C0MA 2UXCK 1LCUA 4JI0J 1YI2N 4A8KA 3DMJB 4LIRA 5AQGA 2D7SA 3J81j 3KLEB 1RT1B 4O5FA 3WC0A 1QUVA 1CZBA 3AVIA 2ZZNA 1TVRA 4O44A 4KHNA 2DGUA 2R7SA 1S6UA 2YKPA 3T1AA 3RAMA 1J5EF 3Q8QB 4CJRA 2IIHA 3NCPA 3AT1B 4QR0A 4E1MA 1HWJA 3P3DA 3MUMP 2F40A 1B64A 3UD3P 2HSEB 4LFCJ 4A8FA 4Y34A 2HMIA 3ISNC 1HX1A 3TU5A 3VAJA 3UR0A 4L6V3 1T7PA 4BRQA 1VC0A 2AGPA 4H0YB 2ZVIA 4BACA 2LXIA 3TAQA 2YWKA 1U6BA 3H90A 3S7RA 3IAYA 1UJ6A 4K0KF 3ILOA 4DR3F 3ZT1A 4O4GB 1RAEB 2B8PA 1IBKJ 3NDKA 3R5DA 3E01A 4W4MA 2DBBA 2M8HA 5H1SV 3FSYA 4FK0A 3A0IX 4IO9Q 1EKRA 5IM0B 1B9FA 4EEYA 2LQ9A 4UUXA 1IKYB 4CQ1A 4DN0A 1N0VC 3TA1A 4RW6B 4KC5A 1HBMB 3GYXB 4USMA 3TJAA 4GKJK 2M3DA 4K4ZA 1HLUA 2CQBA 4FNIA 1VR6A 1S1XB 4JI1K 3ZTQA 1WHXA 4CF8A 4DTPA 1Q8IA 2AKWB 3QBWA 4JI2F 4HYKA 4KRWA 3JAMU 2O4IA 3BBBA 4BDYA 4R5PA 3G6VA 4P73A 4M5KA 2HQFA 1L3TA 3MOZA 3L9ZA 3UKUA 3K7RA 2P9KA 5EXWA 4BRKA 2M0GB 3M9NB 4RCHA 4Y00A 4ILJA 4J7CA 3U02A 3DXKA 3UDLA 4HUGA 4WTYA 1N33F 2A5XA 2EBGA 4N5SA 3CETA 2HNYB 1KEKA 4HDHA 1FE4A 1VQ6S 2XZTB 3NAEA 5KAKA 1N5QA 3RR8A 1GLLO 4FWRA 2Z2YB 1HKCA 4ISEA 3ZSYA 1D8ZA 4JKAA 1I94J 4CIOA 4KREA 3EE9A 3VA0A 3DRSA 2W2OP 3SK3A 2RHKA 2A2CA 5EOYA 3EKUA 1XERA 4YOYA 3IR6B 1BI4B 2R8IA 4DV4J 4ZN3A 3HPHA 1KVBA 3SQ2A 1CS4B 5F8MA 2QL5B 2V7YA 4FK2A 2XHCA 4KE5A 2IDEA 1PJ7A 4U67L 2PEBA 3IWXA 4BC2A 2HHHF 2CZ9A 1QSSA 1KHVA 2WTUA 4ED2A 4FL9A 1S1WA 1K0TA 3MXHP 2FVPA 4Z94A 4FJ7A 1BOTO 2W1BA 1JX4A 2G8IA 2Q97A 4E8UA 2M9KA 4QS8A 3N79A 1PSDA 5FLXY 1WOPA 2CG8A 1N32F 2HBRB 4X64F 2E6MA 3BSNA 2ZGYA 3CWJA 2ITGA 4FLTA 1IBCB 1JXVA 2V69A 4BE0A 1O51A 2W25A 4KR0B 4BRDA 4J9UE 3ASMA 5F0UA 2J5AA 4JOUA 2FLLA 2YWHA 4R25A 2KI2A 1KD1T 4MFBB 1RK8A 1Z2ZA 4I6MA 2AJ4A 3SQGB 5HQMA 1SUQB 2ZH3A 3KJQB 1RHRB 2FZKB 3ZT4A 2DFFA 5DG7A 2Q0UA 1FJGK 3KK3B 2H9ZA 3A8IA 3HD1A 2B0GA 3TX0A 2ZBQA 2LFVA 5LJWA 4FPRA 4NZ0A 3FKBA 2YX6A 4JI2J 1UAWA 2KFZA 4RNOA 3VQ8A 1MROA 4Y0FA 2G2YA 5FD1A 2JVOA 2V8PA 3DYAB 3GPAA 1K73O 1S1VA 3PRBA 4LQ3A 3W2VA 1VQ4S 3SQGA 2DR6A 2QXFA 4GC6A 1QLNA 1E4FT 5FRNA 3U9ZA 2XYPB 4M63C 4J8FA 1YJWN 1MA9B 3L95X 2C22A 4URQU 1S0MA 1ATRA 5A0YB 3OJSA 1FHTA 2ZM6F 1ATSA 1SV5B 1RADB 2FJWA 2QA1A 2YNIA 3TWZA 3C14B 3PRDA 3PNIA 2YKAA 1NZ8A 1MW7A 1VQ7S 2HRYA 1MWKA 4Z4GA 3HMJG 3QSYB 4FOEA 2N7YA 4I7FA 2IMWP 4H4MB 2Q79A 3G8QA 4KKOA 4QPXA 2X51A 2C2EA 3ULEA 3UPFA 4JI7F 3QGPA 4J9PA 2BYCA 3WBZA 1TAUA 3W60A 4TQRA 3OS0A 1SIWB 2Q2RA 4FXWA 1QE1A 3O8MA 2HEKA 1YI2S 1JLQB 2N4DA 4TU7A 3VAFA 1VQMS 2P9IA 4C4WA 4P72A 4OHZA 3DXMA 1YWXA 1VQLN 1GAOA 5LMNJ 4CFBA 4AL5A 2C2OB 1EHWA 3MM8A 4CTAA 3ALYA 5EGYA 4IOXA 2P8IA 3GFXA 4FJ8A 3CD6N 5HI7A 1RT5B 2YWFA 1RAFB 3ITHB 1B99A 3GFZA 5KFTA 2ZVSA 4DX6A 1ZM4A 4KKOB 2YX1A 3OW2R 3LL3A 3OHRA 3CCUN 4BS2A 2QZ8A 5IWAK 3ATUA 3ISND 1C1AA 2MY8A 4FLXA 4MK8A 3MM9A 3VGVA 3AVHA 2GGPA 4M95A 2I9SA 4CZIA 2IY5B 4DV3F 1S0NA 5FPEA 1YTUA 2F9JA 2HGLA 5HRSA 1TKTB 2BVZA 3OL6A 3THYA 2EFGA 1WOQA 2V68A 2VODA 2XMJA 3OL8A 1RT2B 4KGZB 2CGLA 2ZHBA 1VQYA 4DU3A 3OYJA 1RAJA 9RUBA 1RYRA 1PGZA 4CO1A 4J2EA 4R8UA 2FHJA 2VJUA 3PKMA 1JJ2M 1E6YB 4LF9K 3LDNA 5HVHA 3IWNC 4DV1J 2UVVA 1S1VB 2HBZB 4PWUA 1N48A 2Z30B 1KAXA 2P9PA 1UVLA 2QT7A 2APOA 2CGKA 3BF3A 2W4PA 3CJ9A 2UUCJ 4MH8A 1VLYA 2MSSA 4URSA 1EP4A 4PCQA 1RT4B 2X7IA 2FVQA 2PMHA 4NA2A 1UJ4A 4CJKA 4ZPTR 1X0FA 2HQGA 1WG4A 4A8WA 1X9JA 2AEMA 4ZLJA 5HSPA 3IRXB 5A6PA 2W2MP 1XHZA 1ZYQA 4W98A 3LOUA 4BR7A 3EZOA 5AJ3F 2PFDA 4BDPA 1REVB 4XPEA 3GB0A 4OHYA 3NLCA 4FF2A 4K7QA 1YDLA 2ZDPA 2MKSA 3SXLA 1D9AA 4YDUC 1EZZB 3GFHA 2FZGB 3MAHA 4QWDA 2F4FA 4MKVA 1NSQA 2ETJA 1WOSA 2CZ4A 4U8YA 2R7WA 4CLUA 3EO3A 2HKEA 5J2PA 5AZIB 2F8SA 3OYEA 1HLWA 4CD3A 4KAZA 4A8MP 1TL5A 1RKIA 3MX2A 1RWNB 5AQSA 3VALA 1N36J 3CCEN 2NS1B 2BXJA 4GKJF 1TQLA 2OI2A 3AY0A 3GIMA 4CZMA 4YORA 1U47A 3AD9C 2NZTA 1HWLA 3CCLN 2J7KA 2DO4A 3KJNB 2NRWA 1RDDA 2P9NB 5HN0A 1VGYA 4FYVB 5FIIA 1A6LA 4ZN1A 4A8QA 3D0HE 4C0HA 2GAHC 4ILHA 3OYDA 3BB5A 3D5MA 2Y1RI 3PIPQ 1GT8A 1TUYA 1E6VB 2R2TA 4U96A 4FJXA 3ENHA 4ZS6A 4DL6A 4IJNA 3ULEB 2B43A 2UUBJ 2E66A 2AEFA 1HUXA 2VFVA 4NCGB 2GUPA 4ETZA 2ZGZA 4IOAQ 3ENBA 3BGRA 3BPDA 2HGNA 2RF2A 4WQ4C 1F3FA 3QJPA 5THWA 1TK5A 3CT9A 1U2VB 1YTAA 2QFIA 3OYMA 3ENOA 4G6VB 3FBEA 3HM8A 1IR0A 1N34K 3UVJB 2IYGA 1KLMA 3HL8A 1I51B 3FCVA 5BYQA 5J1EB 3AXKA 1KTQA 1SJRA 2VWJA 4NLTA 2WW8A 1HW9A 1SL1A 3U9DA 2MB0B 3IAS9 4P2FA 3M6UA 2CWKA 2R8HA 4KTWA 2MSTA 3LGHA 4L8RB 4DV6F 1JLFB 3OYBA 1SJ4P 4F2SA 3TA2A 1G15A 5KG2A 4YHHF 4XEIA 1XN9A 4DV0F 4CZFA 4E7LA 1C4CA 4K4UA 4DJBA 3OYHA 3N4WA 1CULA 1KD1O 3ZEUB 1VLOA 5KGXA 3X3UA 2OMLA 4HVZA 3HPGA 4TNOA 2XEXA 3FZLA 2GUIA 4X65F 1FT8A 2ASMA 1RBVA 3NGZA 4HHHA 1RBAA 2CPHA 1TYQB 3DRPB 1U25A 1F5AA 3M32B 5BJRA 2YKMB 1GMVA 3F2KA 3C0BA 5JUMA 4B3RK 3T9NA 4WXOA 1NB2A 5KFCA 2C3PA 2HPUA 3O44A 4OJ3A 4X66K 4DR3J 4DU1A 2FJBB 3VGSA 3VESA 4M3TA 1JLGB 5F9NA 2V52B 4DTSA 3CIZA 4RW8B 4O8KA 4CJQA 1BC6A 4NB4A 3I8BA 4OKEA 4EO6A 1LQ9A 4ECSA 4NXMK 1K44A 4USUA 4PG4A 2Q36A 1NKCA 1TYQA 2HB5A 1YRUA 4FO0A 4RUCA 5CY4A 1HQUA 3P96A 1V3SA 2F63A 2F5GA 2QMWA 2QL7B 4DCOB 3HSJA 5M1QA 2HHQA 2GW8A 4NXNK 5C15A 4CZKA 1JNRB 3CDWA 3MWBA 5M2UA 4FZVA 2DIUA 1RCOB 4LF8J 2BE7D 4TY9A 4DV2K 2RSQA 4RW8A 1TR0A 2XYHB 1FKOB 4IRKA 1KOOA 4DLGA 3J80Y 3SPZA 4P7VA 1MLAA 5E3QA 3M3ZA 4BG9A 3Q22A 1TL1A 1LWCB 5JMVA 4P2MA 2B6AB 1U1OA 5HOOA 4BWMA 5J2PB 1J6ZA 4GKJJ 3FLCO 3H4BA 1SV5A 3GYNA 3UKRA 5HJXA 5ETNA 3GR1A 4UY85 4CIEA 1HNWF 4DKWA 3D6HB 1JLAA 3D1HA 4B3TF 2EFQA 2ATLA 1QZ5A 2X6NA 2GEMA 4DL3A 5B7WA 5K20B 5D0GA 2JVRA 4CO5A 1N5YA 2YQ1A 4C9DA 3BKUA 4ZCKA 3A1YG 1EXQA 3O9SA 4BGAA 3E66A 3BF1A 2K7KA 4Q2MA 3UCZP 3LP0B 2V34A 3WNGA 2G8KA 1VQ8S 4J2BA 4HLBA 1SQFA 4FZXC 3I31A 2E5LJ 5M1NA 3CJSA 4JEPA 3NOGA 1YVUA 1YVNA 1B92A 4C8KA 2O5DA 3OBYA 2XO6A 2VG5A 5CR4A 4KH4A 1NKBA 5LMNF 1ZAXA 1H72C 1UFKA 3MUTP 2KQ2A 1W25A 2ZC3A 3CC7N 3W64A 2RE1A 1UEKA 2OPQA 2VG6B 4LFAJ 4CEOA 2H51B 1H1VA 4JV5K 4IOCQ 2B3TB 3L7UA 4K42A 2VBXA 3L8BA 4IH5A 4OZ1A 3LANA 5I42A 3SQ0A 3LP0A 2QXLA 1VRUB 2VQEK 4A4JA 3I5AA 1XQSC 4ZPCA 1UTAA 3DN9A 5EY4A 2KL8A 5AJ3K 3QT7A 1BWVA 2QLBB 3UD4P 3P5JA 2YKOA 2D9PA 3RZAA 4O5BA 2OUGA 4FNHA 3M6XA 5IC4B 5IV3A 3N5BA 1LFPA 3OBWA 2MLYA 1T9WA 5L1IA 2WZ1A 3QWUA 5ADXA 4FKXA 3FZFA 4K50A 1H38A 1C0UA 3SUPA 5HLFA 3BZQA 1Y3JA 1PIEA 4LH5A 3LWMA 1VC6A 2F3JA 4FK4A 1WHWA 1TL1B 1TKDA 1TAQA 3IS9B 1T9YA 2OPRA 2A2DA 4A2BA 4PUOA 3ZO7A 1QUPA 1BWFO 1UOCA 1ZA2B 4F4WA 4J9VA 2HFSA 4M5GA 1BHNA 5DK5A 2XSJA 2FY8A 5M2RA 2PGCA 2AYMA 3RRGA 4Z4FA 4IXCA 1NPPA 3VWSA 3QLHB 2XMWA 3NGIA 2FJAB 1IO2A 7FD1A 2IJNA 1ICEB 1UPPA 5EUHA 3R7BB 3MM6A 2Q3PA 2IC3A 5KFPA 4CEFA 1A5VA 3KJVA 4CFAA 5DZ7A 2D3O1 5AFUA 1ZAVA 3PLAA 2IFXA 1SQEA 4RW6A 2RS2A 3VEWA 5AZJB 1Y5NB 5DM6L 4AYBD 2J7WA 3OY9A 2E1AA 2WSCC 2YTCA 2C1EB 3BO3A 3CC4N 1T95A 1U1QA 4RTFD 1JLCB 1X5OA 4DR4J 2HZVA 3MCOA 1U7LA 2QWPA 3MFIA 2A41A 2FBTA 3DRPA 1PAUB 1FKOA 3Q8PB 1VJQA 3ZT2A 3TTCA 1GOAA 2DTJA 2LEAA 4ZVQB 4NOHA 1X1PA 3QMLA 1BQMA 2RQKA 4ZTJA 2FGOA 3Q0AA 3KK1B 4WXWA 5J2QA 1GFWB 3TW0A 3MMCB 3HO1A 4BVOA 4LR7A 5L46A 4BRNA 3FFIA 1DFDA 1YJUA 4R79A 3CC7S 5KFFA 3HVRA 2JL9A 2Q0RA 4JYAJ 3CMQA 3S3NA 5E5NA 4UT4A 4X4OA 3GIKA 2HOEA 3KLVA 5IWAJ 2YX4A 1WDTA 3GBTA 1BG3A 4DR1K 4BR5A 1IKXA 3NVKA 4L3KA 1GLAG 2J8AA 2VDIA 1FJGJ 3AA2A 3HRGA 5JVHL 3N4QA 1SIZA 4N7TA 3AAPA 4TU8A 3NFAA 4ECXA 1DGKN 5J1EA 1AB8A 3OVNA 3BGRB 4CLSA 1Y0HA 2VJVA 2Q31A 3ZT0A 4ZTFA 1FERA 4EZ9A 4OV1A 2XY8A 1U02A 2MKYA 3C6UB 1NSPA 2DGSA 1U1RA 4CZHA 3ZZYA 4DSLA 4RX6A 1FW6A 2A1BA 1VYAA 1OJ4A 2B9EA 1HNVA 2ZKTA 2OELA 1LK5A 1NJIO 3AOAA 1EQYA 3SBTA 1RBOB 4WE1A 2QLXA 2YV0X 4DZ6A 2G1HA 4F50A 4PA1A 1AT1B 3BQ1A 2FUG9 2CAJA 2HMIB 2LXFA 2HS3A 2E1RA 4QPTA 1QAIA 3KLHA 4NLUA 3K17A 4CLKA 1OKJA 2GVZB 4JV0A 4DU7A 3M32A 2A6MA 1TMMA 4U7UK 2WUSA 3TPQA 2DO0A 3H08A 1HD1A 3E01B 3UWTA 5H1SQ 3CJ5A 4F02A 2HAFA 3O3LA 4P2XA 2RHSB 4AHTA 3SUNA 4B1YB 2AZ3A 2NCKL 3D2EA 3LPUA 1YX2A 4KGMA 3V4MA 4FYWB 4WFYA 1SZ2A 4EP5A 1YJNN 4ATNA 3P4IA 3OJUA 2RRBA 1K1SA 1RHMB 1NJZA 2CPIA 3KLHB 2EC2A 4OKKA 4CDIA 2F96A 1APSA 4QW8A 3BR9A 1UP1A 1I3OB 1EKEA 2ILYA 2IAJA 2HQCA 3OW2M 2WAQD 3DLGA 4DR5J 1H2TZ 4YDDB 4LH4A 1RGIA 3LA0A 1OSDA 4BWJA 4J9SA 1TKXB 2WBNA 5HANA 1Q4RA 2HGMA 2MHNA 4BGBA 2HG4A 4LFBJ 3PW0A 5B0AA 4LRAA 1OH6A 4DR5F 2MTLA 1NK8A 1HQUB 2LECA 4ZVTB 2VA3A 1F21A 3KK7A 3HTVA 3R5JB 5G0RA 1Z1ZA 4XK8C 1T02A 5LMNK 1VBXA 2JRSA 2CJQA 2LSNA 2FC8A 2V2VA 2OTJS 3EPIA 1S9GB 4O3QA 4JI0F 3C94A 4JHDB 5FDLB 3NCRA 4JI6J 3GE1A 4IDHA 4ZA1A 5AT1B 2VFTA 3SUQA 1TKZB 3QDKA 4F04B 2RQCA 1RCHA 4I69A 4LFCK 2FIUA 3C6TA 1JLEA 1X60A 5HMXA 4J9NA 3HJFA 4KTZA 3CDBA 2EFPA 5KRSA 1S6QB 3D2FB 4PRFA 3UKRB 1CJVA 3CD7A 1MWMA 4JKEA 2XULA 1PG5B 2MZRA 1RE1B 2YNIB 2DNPA 3NCQA 3BDEA 5M1FA 4O4GA 3UCGA 4O44B 4DU8A 4J90A 5FPNA 2ZWPA 3VGTA 1ZAWA 3TABA 3HDSA 5F8IA 2B7CB 1N4LA 3SFUA 1TKTA 4EIAA 2ZC4A 3MWPA 1DBDA 3POTA 3HHLD 1NHVA 4OV6A 2D41A 3NMUA 3W5YA 2AMCB 3H42A 4DTNA 2KT3A 3JSMA 1S7IA 4QU6A 3CCUS 2FJDB 4AXIA 3VEXA 4CZEA 1LWFB 2VIHA 2BM1A 3RAXA 1HYSB 1W0HA 1XMOF 3DU6A 5I3PA 2MQOA 3PR5B 2Y8WA 3SCIE 1VQNS 3E3XA 4B1WB 3NS5A 3EX7B 3QZ7A 4LFCF 1HW8A 3P6YC 3VAKA 2DNZA 2V4QA 2ROGA 1VSFA 2X3GA 3CG7A 1OWXA 2C3YA 2MGZA 3I56S 5KG0A 2G13A 3NWRA 3CB4A 5M1KA 1NGHA 2E7XA 1SL0A 3D6FB 4ZP8A 2JZ5A 2IVPA 3FZBA 4YOTA 3KYLA 3U8XA 4IRDA 2P9SB 2OZSA 2CJYB 1P8GA 3VGKA 4JI5F 3BQ0A 5AQLA 1RGVA 2H65B 2FY1A 3DAWA 3BN7A 3O4QA 3MN7A 1FWLA 3QMQA 4DL7A 5EU7A 3ET6B 1ASWA 1XIQA 3PIOL 4HVJA 4BCAA 5KQDA 3EPGA 4F3QA 3CO9A 1RDWX 2JNJA 3N0VA 2EC0A 5T7BA 3N6LA 2O8BB 4M41A 2HNDB 2BBEA 1BE4A 2BGGA 2OANA 4DV0J 2VWKA 2WVFA 3MTKA 4USTA 2E2NA 2LQ8A 2DT9A 1BY9A 2DNYA 5E26A 4IUFA 1LAWA 4CESA 4ZOSA 1YRTA 2V9KA 3CVKA 5BPLA 2EK1A 3NH0A 3QT6A 3W66A 3HOTA 3CJQA 3KLFB 2DNRA 2EFNA 2LQJA 3ZFVA 2IS3A 3OVAA 2OGUA 1RHKB 4USHA 1QVGM 1T6CA 4GVEA 4LF1A 1E6VA 3BN4A 2HLTA 1YK9A 2FHMA 2VG7B 2G0JA 2X1FA 4ZVRB 3BGUA 2VPWB 2PA8D 1RTIA 3NGDA 4ID5A 1U1MA 4B3MJ 4Q8FA 1HD0A 2KT2A 3MTJA 5HATA 3T1HJ 3NF8A 1UVJA 1FK9B 4JI4F 1Q8KA 3MCNA 3G6XA 2XCAA 3EEQA 2H3GX 1MMNA 2BW7A 1HBOA 3D6RA 1U8WA 4B3RJ 4WKYA 3BEXA 2Q1NA 2JOQA 1YQHA 3MAQA 4RL1A 5DRKA 4Z7YA 3OPKA 1M5SA 3NAIA 3I9ZA 4C2MA 5FPMA 4DMNA 5KI6A 1WSEA 1O1WA 3ZZOA 2E1YA 1B70B 4KHPK 3ZZTA 3AH6A 1VDHA 2WCXA 3GP9A 2YHAA 1NSKL 5A8KB 2ADBA 4BC5A 5C10A 3RMAA 3BSCA 3NXZA 2IRUA 2OYQA 4AXJA 4A8SA 3O3GA 4WQ5A 5EHHA 4AQYK 3I96A 2VD3A 1NM1A 1KVIA 2LCWA 5A0YA 3H1VX 3J7ZT 4L3QA 1MROB 1HI8A 1JNZB 3IGNA 1K8KB 1RYSA 4PR6A 4PPDA 2J6UA 3HOSA 4KH6A 3WXMB 1IBLJ 4DCJB 4PQUA 3VQEA 2B51A 5T7LB 3AVLA 1S4EA 2ZHAA 4B9TA 2RQ4A 1WNEA 2M88A 3H25A 1DARA 5E3CA 3R6GB 2M70A 3FGVA 2MJUA 5MLCQ 4K8RA 3SYZA 1Z05A 4JKGA 4CLFA 4HH1A 2BQ3A 2DXFA 1BISA 2E5LF 4YOWA 1HNVB 2I2YA 5A2QO 3T69A 1GMWD 2KJWA 4R0EA 1LXNA 2PN6A 3D2FA 2O8CA 3T5LA 1R8HA 4F4XA 3FZ2A 3DXSX 3GMGA 3AAQA 3PJWA 3ULHA 2EFOA 6FD1A 4XH4A 5EX5A 2XSFA 1NJXA 4DR6F 3M8QA 4M3ZA 2DFEA 3CSKA 3HM9A 2RRAA 1S9FA 3WXLA 1X4CA 1GTEA 3NOCA 3CUNA 4QIWD 3AVAA 3HHEA 3TTFA 4F26A 2JC1A 2M4MA 3QBCA 4DQSA 5ETRA 4OZ3A 1WLJA 3KD5E 1VI7A 2P9UA 4ZIVA 1KDNA 4J37A 2BZ2A 3CIPA 1G2EA 8AT1B 5KG4A 4PY5A 4CH0S 1LWFA 3D9BA 1TTHB 3G2XA 3HX9A 2P5OA 3OD2A 4JI3J 4X4UA 1Y10A 2E44A 2BQUA 1Y64A 4IR9A 5SWMA 1HQ2A 2HS4A 3MM9B 1FE0A 4WFNL 2FLPA 4YB1P 1Y5LB 2LDYA 3RGIA 4IO1A 4ILRA 2N4CA 2VQEJ 1W7WA 4N8OA 2HVDA 2VOPA 3J7ZO 2UVWA 1OS5A 3E9OA 2CNNB 2GQ2A 3UVJA 1XMQJ 1KR4A 4WFAQ 1KLMB 1R8PA 1WEYA 3ZX2A 5JXSA 3PVXA 3AO2A 4CF9A 3AJ2A 3ZZPA 4BRGA 2VONA 3VTIA 4LF5K 1QAYA 3AAWB 3Q8RB 4USWA 1NLVA 3WXIA 3EVMA 1OH5A 2G0IA 2P9PB 1YLXA 2GMLA 3E9LA 2IPOB 1RTZA 2I6WA 3G9CA 3CM6A 3K5PA 3QO9A 1JJCB 3N28A 4M42A 1ZETA 1GX6A 4W90B 2EXUA 4ILLA 3L7OA 3HHNB 2E1ZA 1R8AA 4ZDNA 3F9MA 4EI2A 4J9OA 5ETLA 4FWLA 2E88A 3KWGA 4RW9A 4YOXA 1MNEA 3GYGA 2GHWA 4JKHA 1RFQA 4CD1A 3TNVA 2HAIA 2MQQA 1V3ZA 1WC6A 1RDAA 2DY4A 2XY7A 4B1VA 1KVKA 3TZZA 1RAOA 3SV3A 2E9RX 2FTRA 3GJTB 4YHHJ 5C2DA 1HWIA 3AODA 4IR1A 3LP1B 1ASVA 3K9JA 3M9OB 2VKRA 2W2PP 2OCEA 1XNQK 3GV7B 3VCDA 2X1AA 1N36F 2ABYA 4FBUA 5HMYA 2VOOA 4FXDA 1DTQB 4JS4A 2A6OA 4U7BA 2DGTA 3KK1A 1IBMJ 2PBDA 1NWKA 4DSJA 1S72S 3J8AA 3DI6A 1T94A 1BUPA 3TYTA 3HSGA 3QAEA 1CXUA 1HBMA 4P6QA 2LXUA 4FKYA 3TUZC 4E1NA 1BO5O 1WORA 4FJGA 5AE3A 4WJBA 2UUBK 2J6SA 2HURA 2K7JA 1AZSA 1R6YA 2AJQA 4DV6K 2BUNA 2HRTA 4PG6A 4L74A 4I2QA 1VQ6N 3VQ5A 1YUWA 3J7YU 3QEVA 4DCHA 2YNHB 4DV4K 1Y00A 3H5XA 2JEFA 2LYVA 1Y9OA 2WVDA 3V6JA 3V2UC 1NK5A 4DL0C 3AHPA 2QLJB 3BO4A 4OYWA 1FXXA 4DR2K 3QERA 1Y7PA 5FRMA 1X4FA 1VQNN 4JK8A 3RMBA 2MDAA 1SC3B 3I55S 1RHUB 4TQSA 4AHRA 1HWKA 3E2EA 3BH6B 1HNWK 1X5TA 4J2AA 3IGVA 5AQKA 4YOUA 4RNFA 5D6GA 3MMAB 3QFWA 2BMBA 2HWTA 1RACB 3N4PA 3M6WA 1ZBSA 2KJVA 1S0OA 2DGXA 5IQQA 1TU0B 5AQXA 3CXCM 3BV8A 2KDOA 4ELUA 3PX0A 2RMLA 1VQ9N 3EGZA 2ZD1B 5FLXU 4JKDA 3MECA 1JLCA 3EZWA 1ATNA 3NP5A 3OFHA 2HMPA 1VSDA 1X3MA 4QWBA 4Z0UA 3THPA 1FA0A 2MY7A 1NMNA 4CT8A 5KFDA 5J2QB 2OEKA 3FDSA 4HUFA 1SI9A 2NXUA 2G8WA 1CJTA 2UV8A 3OS2A 2FSNA 2AWZA 2A0FB 4NYFA 1YZ7A 1EETA 2ZH2A 4KGXB 2CVIA 2FYXA 4LQ9A 4KHMA 3VQSA 2ASOA 1EWRA 2MKJA 3KVGA 1KQFB 3NG8A 2KM8C 1SJFA 4EHUA 3TEGA 2AJFE 3M8ZA 4F36A 2ADCA 4DL2A 1LOUA 5F41A 2MZSA 5BN9A 1GLBG 4ZJLA 2QWRA 4NRUA 3VV2B 2HWIA 1S48A 2ACYA 1X3NA 2XI2A 3NMAA 3T1YK 1JB0C 4O23A 3ZTOA 2EG2A 4WP9A 3OR1B 4I0WA 3VZIA 4KB7A 4ISFA 2HQ3A 3P45B 5B0CA 1NH7A 3QB0A 2DNLA 2VF3A 2W9BB 4CIFA 3AGKA 2F8MA 5F1XA 3M8PB 4DB3A 2YHBA 4KSEB 3BPSP 3RSEA 3AVBA 2KG1A 4LR8A 2O8FB 3PZPA 3ATVA 4RR5A 4DPYA 1QTNB 5GVQA 4O4RA 1T03B 4FVUA 3KDOA 3KNGA 1L5UA 2GO9A 1NLKL 2HBYB 4OZ5A 3CXCR 5AQFA 4NXMJ 4CEAA 1S0VA 5IZHA 2OMOA 1QTMA 2QWLA 4BC4A 1BCOA 4O55A 2QTDA 1QVFR 4CWBA 4C23A 2QE5A 5KFRA 2IMOA 3VA3A 1SS6A 4Q2LA 4AFFA 1HHSA 3FBBA 2ROPA 4ANDA 2G8VA 4QOTA 2VCPA 4ZPVR 1TK0A 3DI6B 3TVYA 2FZCB 2AZ1A 4IFYB 2KHDA 3A8JA 1FXDA 3KJFB 4O0NA 2NUHA 3K5LA 3JQKA 3PW5A 3KXDA 5KFIA 1LOTB 3V9UA 3PHEA 3HBTA 4FF3A 2D4WA 5KT5A 3HZ6A 1N32J 2AGQA 3C95A 1RWOB 3RRKA 2IRYA 3QFHA 1VRTA 5L9NA 4ECVA 5F3TA 3M8QB 1HWUA 1JXLA 2L48A 1TKXA 2DB1A 4JD2B 2V4JA 1H98A 5ETSA 4QR1A 2FGCA 3BKTA 3EL2A 5AJ3J 3WEEA 1LV5A 3H8YA 4PPZA 2O3DA 4NLPA 1VQ7N 4H4OB 1LK7A 1PKUA 3G10A 2KFYA 4JD2A 4DSKA 2GHPA 4M1KA 4WIIA 1NGFA 3JS6A 3KHLA 3KOAA 2GIFA 4NMLA 1L3UA 1LW0A 1U6ZA 4CF0A 1IJJA 2ZQBA 4C8LA 2NXNA 4BLGA 4JRQA 2VU5A 4UOGA 3MAAA 4HEA9 1RTDB 2P9KB 1PJ5A 1GNKA 4LD0A 1S97A 4X2BA 4CLWA 1HR0J 2YCHA 4R0JA 3L3VA 1ZC6A 1R8CA 2EPIA 3D1QA 1BDGA 2PZSA 2BRLA 3RB0A 1SKSA 4J9RA 4FPAA 3WNEA 5DM7L 5IC6B 3TA0A 3WUHA 4NA3A 5F9LA 1CLQA 2YNFB 2A42A 4ID1A 4WFBL 3M2VB 2VASA 4NLVA 2D3UA 1C0FA 3EWGA 3EJMA 4FM2A 4JB8B 1LWXA 5AQQA 2DISA 5DQHA 3L2UA 4NASA 1JLFA 4ECYA 3M1VA 4W5NA 3K0SA 2UUBF 4CEEA 2CDRB 3GQCA 1U49A 2N7CA 3B82A 1SH0A 1IJFB 1RWPB 1FJ7A 2M2BA 4N41A 2BOPA 2IC3B 1RWWB 1KP6A 2D1KA 4BVPA 1UZHA 4DR4K 3KJVB 1F9HA 4DV0K 5KT3A 4RU9A 4X62K 2H3EB 4Z4HA 3I0RB 1WSIA 2BA9A 5DGAA 1NGEA 1VQ9S 1M90T 1T8EA 1M1KO 1HBUB 3C19A 3ZTRA 1JLBA 2J9CA 1FXLA 4DR1F 3P5TL 4I68A 4DPOA 1YSJA 1VRTB 3A12A 3RMCA 1C0GA 2XWXA 3SCLE 5KFSA 3PYEA 1RAGB 5GAGP 1K6YA 5U47A 1YBAA 3ZSQA 3OVBA 2M52A 2DCUB 1JXEA 2MXYA 3M2UB 2VGMA 1VQKS 2AX0A 1T9XA 3CQYA 2DCLA 4LF7J 3Q8YA 2V5HG 2QA4G 4USVA 2QA4N 4HWIA 1JIHA 3JSMB 2PE8A 2YX7A 1HI1A 2OLWA 4D3GA 4Y1DA 2WVBA 3A5LC 2YKQA 4I2QB 4OIXA 1WB9A 4LF6J 4BRMA 3HHDA 3C6AA 1U45A 3DYAA 3R5CA 1ESVA 3LALA 2ZM6K 4U8VA 3DWLA 3BR8A 3JXOA 4NWBA 1S1TA 3A8KA 4BY9C 4X4TA 3JAMY 2F4VF 2O67A 1NG9A 4CYUA 2YWGA 3MAAB 4UZCA 4DG1A 3FZHA 1G7CB 2AW0A 3AVFA 3TTDA 2QJ3A 4WE1B 3FEXB 3T7ZA 4HTIA 2DIVA 4UOHA 4IBNA 3NEKA 3PY8A 4NLXA 4DUYJ 2R7VA 1CJUA 2B56A 2OPSA 1EO1A 1Q78A 2E6LA 4PKDB 3UO0A 2PFUA 4EYIB 2QMXA 3MPUB 3R97A 2UXDK 3W3DA 2YH1A 4DR3K 1YJ9S 4PWDB 5HJYA 3Q24A 4NO7A 3Q7BA 4LSLA 1BQNB 4AQYJ 4OGEA 2H5IB 5AQJA 5L1JA 4BREA 4LC9B 1TL7A 4HACB 4XPCA 3VAMA 3L4IA 2CPXA 4NE9C 4DUZK 1WI8A 5LSLA 3RJMB 2Z1GA 3CCVS 1RT7A 3GL1A 3SSQA 3PSIA 4RWWA 1ZTWA 4OPJA 3MD1A 3T19A 2E5HA 2VH7A 3CMAS 4FOIA 1VCTA 1T3NA 2Y3YA 3K5MA 2ZBPA 1KVCA 1U09A 2ZE2B 1YZ6A 2MYFA 4ZK7M 1W2BM 2O8EA 4BRFA 1EETB 2HHSA 5H9EJ 3JTPA 2BTFA 2V6AA 1N8RO 2DR9A 3AARA 4DEZA 4OI0A 1O6XA 4F0HA 2GZOA 4IWVA 4AHCA 4IG3B 2HFNA 4QWEA 3D2EB 1R31A 1S99A 4A5BA 4BG8A 5CD4A 2KVQE 2W9CB 4KI6A 3H20A 1BXNA 1XNRJ 1UFWA 2AYEA 3J80U 1LWEA 4ICLB 5L39A 1KAYA 2YXLA 4QIEA 1RDUA 1Y11A 3B8HA 1RA7A 4JRPA 2LU2A 1NK4A 4I6WA 4YR0A 3C6TB 3TAFA 4FS1A 4K4WA 1PC4A 3GCWP 2UP1A 3L2VA 4QQBA 4JUZA 2CQHA 1D1UA 3SZ2A 1JMTA 3RB6A 5BRDA 1UA1A 3VQ7A 3ET6A 3BKFA 3UW1A 3K9KA 4PABA 2AP6A 1DLOA 1XJWB 4U67Q 2CPFA 2B9YA 3AOBA 2Y1LB 3DCAA 1DTTA 4OHXA 2NYIA 3J7Z5 5KFWA 2RDDA 1N5TA 1XMQK 2NLXA 2XSJB 4CFCA 3B8AX 4OZLA 2ASDA 4DTMA 2E20A 1FI4A 1XMOK 4NPOA 2JFDA 3GWCA 4I2PA 1F5BA 4ZVEA 2J7UA 4IQXA 2D69A 4KV8A 1WC0A 3OV7A 2RUSA 3IKMA 1D3WA 3UKUB 3A2FA 4ZP6A 4U9RA 1EJ7L 3DLKA 5BR8K 1YITN 1VHIA 1X8DA 5KFLA 4RUAA 5CHCB 2DHHA 1RJJA 2EEYA 1NJYA 3V9ZA 4DTUA 3AJ1A 4FJJA 4MYTA 1M5OC 2EFVA 4A48A 2JC0A 4LBIA 4U6PA 3C2PA 1XEZA 1IXKA 3TANA 1WBDA 2NUBA 3CE8A 5KGWA 1S1UB 1RTHA 5CE3A 3QGGA 2P9NA 1HQEB 3TVKA 1KQSR 4I64A 4YR3A 4P74A 3SSRA 2JEJA 2D0AA 3M4XA 3T41A 1LW2A 1FKPB 3M8WA 1C0TA 1KWMA 4RUHA 2DD8S 2F8HA 2CADA 1XNQJ 2YY3A 1ZBIA 2ACMA 1HPZA 2OP5A 1K8AO 2V2ZA 1QQNA 3NGYA 3HI9A 4YY3F 1QSYA 1Q8BA 1KQKA 3WZ0A 1T05A 2J0SD 4G1QB 3AA4A 4OYBA 4B3OB 3GFYA 2LA6A 4CO0A 1SB6A 4U95A 1MMLA 3L2RA 5KT7A 4W5OA 4GVMA 1MWQA 1GLDG 4WFXA 3SMPA 3AQOA 3IM9A 2A6AA 4ENOA 4WZQA 4JKBA 3KK2A 3VZHA 1NXIA 2HHWA 2Q66A 5KPRA 4KHUA 4PUOB 3DXBA 3K8WA 1M1GA 4BDZA 2V94A 3WQPA 4BBYA 3GG0A 3QIPB 2RE2A 4YHHK 1O0PA 4OZJA 3ZEUA 1Q16B 3MXMA 4ZLPA 2BKNA 1B7FA 4GVBB 1QS4A 4Q0BB 3W61A 3ENVA 2GVDB 3T1YJ 2KYZA 5A8WA 2QKKA 1PYSB 4G1IA 2AIRB 2ALZA 2P9GA 1B0PA 1RBRA 3PJXA 4IJAA 4NLBA 3LAKA 3D6TB 1XNRK 2NRTA 4G65A 2BJ3A 2YKNB 4H4KA 3TQEA 3EDRB 5KFQA 5GADU 4ZCMA 4AL6A 2DR7A 2CJBA 4LRCA 1N33K 2LMIA 3RAQA 1LKZA 2OKQA 1S59A 2RUGA 2HLUA 2PY5A 2ATQA 1I39A 5KFOA 4MKYA 1RT7B 1NGCA 4DR7K 2R4FA 3CCWA 1PJ6A 2JLEA 2R7UA 4CGDA 1NDPA 2ZEJA 4X4QA 1C1BB 3PG9A 3OA9A 1UPMB 4RW9B 3HVTA 1Q8LA 1JLGA 3EY1A 1SJ1A 1CZAN 1VQ8N 1RTIB 1YJ7A 1IM6A 4GV3A 1KOHA 4P52A 2X3DA 2MZJA 1GLEG 2MQMA 4DR2J 4KHPJ 3CYMA 4WCEL 4I6AA 2H5JB 1D9DA 4OX6A 2WOMB 1NUEA 1NNDA 3O2IA 4M45A 2VYPA 1RTJB 3H59A 5HBMB 4K4SA 5D4LA 4ZPDA 4FWPA 3M6VA 2W2QP 4JI4K 1WHVA 2POKA 2P1JA 1OIAA 2DGOA 4KO0A 5KFJA 4LSNA 3QAUA 4FZYA 3HVTB 3UDEA 1ZM2A 2GIRA 2QA2A 2NREA 3SDEA 3CD6S 1O5JA 1F5CA 2XO7A 4ED7A 1PBUA 1FO1A 4OPHA 4CGGA 1JLAB 3SNNA 3QNWB 5A8KA 2CQIA 3R2CJ 1DQAA 3CCRN 4PKGA 1SKUB 3JXUA 4MQ3A 1D09B 3D0IE 3LW5C 1XI1A 1OSCA 1RI7A 3C14A 1KAZA 2FQQB 3HJVA 1YJWS 2W8LA 2AX1A 4C0BA 1RZMA 3NHGA 3DMJA 4UOFA 2B4VA 3DHWC 3VQCA 3KLEA 4FVMA 5LT5A 5C12A 3EMTA 1UZDA 4ES3A 3CPWM 1OVYA 3EM1A 4DR7F 4BR4A 3RB4A 1NBEB 5GAEU 4C8OA 5AQMA 4QYZK 5CQGA 4YY3J 4K41A 3TR5A 2Z2MA 3PYFA 4FF4A 3CCMN 1BD6A 4DX7A 1SAZA 2C3UA 1WN7A 1WOOA 3TWHA 4J9KA 3DXMB 2QYCA 5K5MA 5C5JA 5HRPA 4KB1A 4JKGB 3KHRA 4YFUA 2UUAF 1FTRA 3CJ8A 1RAHB 5BYRA 5I3UB 1I94K 2WC9A 3NH1A 2UU9K 4Q7AA 1J5OA 4M7YA 4AHSA 4NYZA 1Y3KA 2GC8A 4CO4A 4LFAF 1Q79A 3J7AN 3MPVA 1GTHA 3B78A 3NGRA 5AXNA 1CG2A 1TL4A 1HRHA 4AM6A 3G6YA 1WACA 4KHWA 3DLEA 2C2KB 4FXVA 3ZYYX 4DV3J 4QJVA 4WFNQ 3GOIA 3RW6A 2W42A 1LAVA 2DRBA 2UXDF 3JSBA 1DAXA 1OQ6A 4DR4F 3S41A 3V9WA 4YR2A 5JS1A 4Y2AA 2KM8B 4LUBA 4OLBA 2EX3A 1XMQF 2E1PA 4FWNA 2M5YA 3PFEA 3HF5A 1DQ8A 4AT1B 2HRUA 4XDDA 1RBLA 5AQTA 5B0FA 5LL6d 2P9SA 3CM5A 2DR8A 4ZIWA 2UUWA 4I56A 4ZITA 4B3TJ 3OFFA 4U7CA 3CJ4A 4CK2A 4WK3A 1R6VA 1O13A 2UU9F 2KB2A 4GKKK 5CHIA 3VR1A 4F4YA 4FJMA 4P7TA 1RLCL 2VL1A 2BKOA 4RKUC 2EBEA 4O3NA 4BC7A 2PI4A 2OSQA 3TI0A 1F3VA 4JI3K 5K8MA 1QD1A 5K8OA 2C28A 3WX4A 4FW1A 2PI5A 4A59A 3O9RA 5AFUH 3LQVA 3VETA 1HNIA 4IDKB 1CC8A 2XHWA 3HSCA 3IG1A 4Y3CA 2CG4A 4JI4J 3A4TA 4DS4A 4LY7A 3A5MC 3MF5A 5DETA 1IQZA 2DGWA 5HBMA 3HYFA 3VVTA 3OTOJ 3D28A 4LT6A 1NMDA 3RR7A 4LREA 2CH5A 3MM5A 1B0TA 3PW2A 4CK3A 2B4OA 1F9FA 4OLAA 3MEEB 4MLHA 3BYRA 4ANCA 5BRFA 4ISGA 5IM0A 1U2RA 4A57A 1WSVA 2Z57B 3D54A 4HCCA 3QWPA 4WCEQ 3MMCA 2F1FA 3LZJA 3R8YA 1RDBA 4WU2A 1JL2A 2X74A 4EZ6A 4BRAA 1TUWA 4G3IA 1AXQA 4Q43A 4QWAA 4EBCA 3RRHA 4ECWA 4WYBA 5EWEA 5CYQB 2IVNA 3DOMA 3ZZRA 4ZCLA 3S01A 5BYSA 2ERRA 3SBGA 1IUJA 4F3TA 4OVLA 2EVZA 2IDLA 1WSHA 5DDPC 2ZFHA 3AV9A 1VRQC 3O5TB 1C6VA 3BBCA 4OGCA 3ENQA 2YH0A 4RWXA 4A8YA 2E2OA 4FDFA 4ZMMA 2OZMA 1XC9A 3O9TA 4AHVA 3G71N 4ECTA 3MMVA 3OR2B 3RG6A 4ECRA 2GTDA 3ZTPA 2VQFK 1VMBA 1FJGF 3NGSA 3GSDA 3UB5A 4KJIA 1IKYA 6AT1B 3O6QA 3H3NO 3HP9A 4PAAA 3TO8A 3PCOB 3MM7A 3BH7B 4K4YA 1BQNA 2B5JB 4PEOA 4X64J 3V9XA 3D7EO 2WONA 3IS9A 2JJ4D 2CXEA 4WZMA 4GO7X 4MDBA 1FNMA 1H6KX 1BWEA 4DPUA 3DOLB 2XM3A 1VQPS 1ZTTA 4F2RA 3P8BB 5BR9A 4B17A 4GVBA 1NGDA 3ZNUA 3CJTA 3HKZD 2DHSA 3CTRA 3N01A 3OXFA 5GAHP 3RVCA 2YNFA 4YN3B 3OVSA 3DNCA 1VSLA 1F0XA 1HHQA 2DEIA 1DZ5A 5LJ3Y 3VGMA 3ZSVA 1VRUA 1S3XA 2ZUAA 1V4SA 2HNZA 1D4XA 3FNNA 2HNYA 2HF4A 5LL6Z 3WXKA 1I1GA 2BJEA 3GG1A 4TLQA 3CJKA 1IWAA 3EUNA 3HZGA 1EAYC 3BSAA 1JKHA 2K1RA 2EWHA 1ULRA 1HR0F 3LP3A 1NPRA 4B3MK 2WRMA 2FHKA 1HMVB 1XBWA 1VQPN 3GV8B 4JI1F 1RCXB 2VPZB 4CH7A 4LMZA 1NK6A 3F73A 5L1KA 2Z2ZA 5DO2A 3DLHA 2AHOB 2L9WA 2UUCK 4M5DA 2OD6A 2AGOA 2PAVA 5AE1A 3GILA 1UEVA 4B9MA 3ZNJ1 1KVAA 3GE9A 1VS3A 4K0KJ 5MLCV 4F4ZA 3A3OB 1S1WB 1Q0NA 3VMFB 4CVNE 4QIVA 3LDSA 3CHWA 2NPIA 3V1OA 1Y5IB 1VBZA 2HHHJ 1HNIB 2E5JA 4OX9F 2MEWA 3NRBA 1ZM3A 4LRFA 3W63A 1FDAA 2RIJA 4LF4K 1VSIA 2CKWA 2XHBA 4K4TA 1M5HA 2HFUA 1CPZA 1MWZA 3J7YI 2HW3A 4B3RF 4OJGA 2ZWHA 4M3UA 3SQ1A 2H48B 4WF9Q 3BP8A 4FJNA 1W26A 3M1VB 3QO9B 4B8CA 5T7LA 3Q89A 1S6QA 2JH3A 4KV8B 3MGJA 5H9EK 4MO4A 3SCXA 1SKWA 5CZ1A 3K8VA 1JJ2R 3U27A 4LVOP 5L8RC 5C25A 3JSYA 1QDUB 2XZWA 3KHYA 4MIAA 4DMZA 2CQPA 4CBUA 5CYQA 3NNCA 2OPRB 2MQLA 2HQIA 2HBLA 4BE1A 1FDNA 3FUYA 2MQ8A 2V51B 4EP4A 2C42A 3TSUA 4FYXB 1UAXA 4LSLB 4O0JA 1Q82O 3TZYA 3LDOA 2PC6A 3US5A 3S8SA 4FM1A 1JLEB 1N88A 3DLRA 1QVGR 2JX2A 2HFOA 2WVCA 3SJHA 5DQGA 3NH2A 4NYOA 3BS9A 2QSWA 5CYMB 3ILIA 3QESA 2I1RA 3KWIA 3OYNA 1HJOA 4DUZF 3AB4B 1NB7A 4O3OA 4RNHA 2XS7A 3WDOA 3P31A 3QRRA 3JQJA 3AXMA 5GAEP 1EB0A 2OTLS 3OXLA 1Y97A 1I6JA 1SXLA 3OHAA 3BGOP 4B3MF 1FVSA 4XH5A 2OH2A 2WVEA 1IJEB 2MZQA 2DK2A 4OHWA 1MU2A 4JP8A 2IAJB 3EZUA 2HHUA 1HYSA 4ED8A 3RU0A 4FJKA 2RJZA 4EFAC 2ZJPL 1QY7A 4EAHD 4PG5A 3SCJE 3DRSB 1OO0B 4M5IA 3W5XA 5BR8J 5KFHA 1NDKA 5H9FJ 2Z8QA 5FPDA 1Q1KA 5LMUJ 2LA4A 3QNOA 5ETKA 1FEEA 3VQPA 2ZOFA 3EVWA 4NLSA 3F9KA 1FRIA 1S1XA 4K4VA 2O1PA 3NKYA 2ALYB 1QQOA 3N6NA 3RTVA 3CQ8A 2D1CA 1NKEA 5AXKA 4KT0C 2GX8A 1WNSA 3OL9A 1UWBB 2JLGA 2ZH6A 3NF7A 2DPNA 2Z1IA 4OLPA 3K59A 1AFJA 1QSLA 3KNAA 4HT7A 5AR0A 3G82A 3Q2TC 4IKFA 1T0TV 2QIFA 4PHTX 3NBPB 3M8SA 3ZX3A 3MPWA 3O1BA 1J9AA 1UKUA 4OZ0A 1KVJA 1VSJA 2ZHOA 5IV4A 3IBFB 4CF2A 2BOAA 4K0KK 4UQGA 4JI7K 1U0HA 4NLYA 2R8JA 5IXUA 1G3OA 1FDBA 4JI2K 2LDIA 4DUYF 4P10A 3FR0A 3M5RA 1C1BA 2WBRA 1ZH5A 2OFHX 3C46A 4OPAA 4N76A 5AE2A 3PYGA 3CF5Q 3T3FA 1P9YA 4IFVB 5HRRA 1YJ9N 4QS9A 1SBRA 1VIOA 1R0AB 5JLFA 2HHXA 2CZVC 3TJ9A 5B09A 3ENAA 3MMJA 4GV9A 5D4OA 1MSWD 3QT5A 1OMSA 3K2PA 3T1HF 4GW6A 5ETMA 4ICLA 4FLYA 2N3OA 3J7A1 3CCES 1S76D 5BRHA 2RH3A 3CDEA 2ASPA 1HFEL 2KXNB 4C11A 4CNYA 2RDJA 1HBNB 3AA3A 1OQ3A 5J2NB 4I9QA 4H0OA 1R7IA 4Y2MA 2CQDA 1RWVB 3OFGA 2YPZA 1T9UA 2NLWA 4OZNA 3PM9A 2AQ4A 1VSKA 3H46O 1GQEA 1XHXA 2UU9J 4A47A 1PO6A 2UXDJ 1XUPO 1RWXB 3CC2S 2OJ3A 4USIA 2RT3A 5I4MA 4FWOA 2YNGB 2JWKA 1U4BA 4CFDA 4X4NA 4KGVB 1YT3A 1VQSA 5A76A 3IDHA 4F9OA 4WIQA 3BGLA 2ZBCA 1F2GA 4C3MA 1N33J 4K5RA 3TQ1A 3A13A 2KG0A 4ZVHA 2W01A 1WSGA 1KONA 3SAHA 4CERA 1N8RT 1KBRA 2DH8A 3J7YP 1YTYA 2OD4A 2E5LK 3QPIA 4FJ5A 4CE9A 4QCLA 3CDAA 3DLKB 2OFGX 4KPCA 5F0WA 2O8EB 2Q6CA 1TV6A 1XC3A 3Q8UA 3VF2A 3G8TA 1Q5VA 3JSRA 2CA9A 4QBUA 1C1CA 2QX0A 1ZZNA 4BQZA 4FP9A 2FF6A 1HYZA 5LSOA 4KBOA 3U6FA 1W9HA 4JAXA 1TGOA 3W1YC 1AW0A 4C8NA 4OJRA 2IVYA 1RT2A 1S77D 2LLZA 5GINA 3ZXWA 2G8UA 4CEQA 5F8JA 3K57A 1ZBTA 4I7FB 1FJEB 3MMBA 1JCEA 3ELHA 4DQPA 3LH2S 5D0HA 1S9EA 3R8EA 4AHUA 3J81Y 2E5GA 3QBXA 1I3AA 4CEDA 5IQ6A 2B9WA 4CRJA 2HQDA 2HSTA 2NPFA 1GH8A 3O4NA 4DTJA 3B6BA 2FBXA 5FJ4A 4G1PA 5B08A 1N36K 5ETQA 1S6PA 1WWHA 3CJKB 2G8FA 4KH5A 1QHAA 4OJ1A 2QKBA 3VVUA 1BA1A 2ZE2A 4NEYA 4DS5A 1GLCG 2DY9A 3CW2C 3FVYA 4Z4CA 4Z37A 2FBVA 4QS7A 1HMVA 4RBUA 4KH1B 1VQ5S 2KXFA 3FMBA 3A5NC 1CJKA 1AFIA 4GKKF 3IA0A 1YG0A 4X4RA 3H5UA 3ZTSA 1VIXA 3R7SB 3V6DA 5A8RB 3HFKA 1RBTA 2G8HA 3I0SB 1J5EJ 5G0RB 3QEPA 2L9DA 3R3LA 3H40A 1RWUA 3MUVP 1FRHA 1R0CB 3CCJS 3KTQA 4J2DA 2VBZA 4V19S 4ES2A 3F44A 2HBJA 2JEGA 1U2VA 4CBXA 4XDCA 4IO8A 3SAGA 4DI6A 3KLIA 2UYTA 3OBIA 2D3ZA 4LSNB 1AUDA 3CCZA 3CCRS 1FNOA 4I67A 2NRRA 1IKWA 4KPYA 3BM7A 1ELOA 1L3KA 4N47A 4DR1J 2KKHA 3FQLA 4CZGA 2DYAA 4LF9J 3O5BA 3FEYB 3QLHA 3P49B 1VSEA 4FZZA 2B4PA 4JI5J 4DZDA 1J54A 4JI0K 1RLDA 4YEAA 1FFGB 3HVAA 3CCMS 3VERA 2ASLA 2LEPA 5KFYA 3PTWA 1Q81T 2IM1A 3S3MA 3TP2A 2HNDA 3AJDA 2UUTA 5ETOA 4DV3K 3O9UA 4BRCA 3THVA 3BZCA 1HNXF 2RHQB 2V8GA 1NRKA 1HJRA 4MK9A 1FX4A 5KT4A 1RSCA 2FLOA 1UETA 1DTQA 2R7OA 3QATA 3QRQA 3GU0A 4K43A 4NXMF 3MR6A 2IM3A 4DN9A 3A8YA 4NYNA 2DRAA 3HPOA 5AQHA 5F8GA 3H2UB 3Q86A 3SBMA 2CQ4A 1XMOJ 4IO9L 2FDNA 4FJ9A 1L3VA 1S10A 5K14A 4X84A 4ED6A 1D9FA 1YJTA 4AF1A 1T44A 1M0SA 2GNKA 4ETXA 1OY8A 3H45C 3QEIA 1A5WA 5GAGI 1WD6A 5HAOA 3SDEB 4M8LA 1X4GA 3FZMA 4PL8A 3FC9A 1VQLS 1U48A 1DY3A 2C2MB 5B0EA 4UOCA 6FDRA 5AQVA 5HVFA 4PG8A 2MGZB 1U1NA 4F25A 3EICA 2VG6A 2Z1HA 1NGJA 3FFKB 5EX3A 3DGPB 4O3PA 2A3ZA 3OYIA 1J5EK 4LF9F 2BH1A 5RUBA 2CH6A 1EP4B 4IYQA 2YJEA 4B02A 3SPYA 1WJ9A 3ONQA 5LY3A 4GMKA 5HP1B 3OTOK 4B9LA 2E2PA 2OPSB 5C42A 1VHXA 4FPBA 4CBWA 3FSXA 5KG7A 1JJHA 4NLGA 1X4HA 4OYOA 1HKAA 1WEZA 2IIRA 4NLCA 3VEZA 1HNZK 3G82B 3GIIA 5BPNA 1Q5YA 4KAIA 5IT4A 3RBXA 3NBPA 4K2XA 1X5SA 1FEHA 5E2QA 3LWLA 2QTWA 1XK8A 2JDJA 2UXBJ 1BIUA 1UWBA 3U1NA 2VA2A 4P75A 5F0XA 2ZJRL 2ATCB 2IBKA 2ZITA 5HLFB 2WSEC 2R7XA 4CJSA 4GRSA 4OYZA 3DDNA 1H2VZ 5C24A 4J91A 5T14A 3VQDA 1XNRF 3R1XA 1PILA 2ZM6J 4O3SA 1T3OA 1FXRA 4ZVUB 5DLGA 1R8BA 4JV2A 4NXNJ 4E7HA 1SPBP 2K3KA 2K8GA 5JICA 4FF1A 3MN6A 4H03B 3CI5A 4DSEA 1JJ4A 3ITHA 1N54B 1CC7A 2J6TA 4Y1CA 3MMBB 5BXIA 2A40A 2WBMA 1HBOB 1XR5A 2XI3A 3SI8A 4H0VB 1Q95G 4H0PA 3THXB 3D6MB 3LP2B 5CABA 1I5OB 4HHUA 4LFBK 1Q7YT 4DFPA 2Y8YA 2QW9A 1S4FA 1MN9A 3A3PB 3HT3A 4OYAA 3QIOA 1J2VA 3T5HA 1IKXB 1N56A 2UVRA 5CH7B 4EU0A 3ZX0A 2CIMA 4E2FB 3EVOA 1P1TA 1VK3A 3FEZA 3BBFA 4YB6A 4M5JA 3L3CA 4NCGA 3GJQB 3HVWA 2ZZTA 2XCPA 4A8OA 4PWWA 3MR3A 4CECA 3E51A 3VAGA 3DGPA 3MEDB 2VPYB 3SFGA 3NGTA 3D3BJ 2R8GA 2K2PA 3V6HA 2QWQA 1TMJA 1BMQB 4H0TB 4TYAA 2CRLA 3QFUA 1UVIA 3ZCMA 2QRRA 1X9WA 1XQIA 1N5YB 4U7UD 2CPZA 2HHHK 3Q8SB 4GC7A 5KOXA 3TVZA 1S12A 1B0VA 2GMHA 1M5VC 3S1TA 2HNZB 1S5JA 4WF9L 3H1QA 1RHQB 4GO5X 2Q1LA 2F4VJ 2W9BA 4C48A 3QEXA 2QYGA 4OX7A 5CCMA 1HL6A 3W65A 2D0OA 1EIYB 1H7XA 4F4AA 3KWMA 4OYIA 2BV3A 2FJXA 3MM5B 4HUEA 2EKYA 4N56A 2B5JA 2NZCA 4XIUA 2QN6B 4Y28C 5J1PA 1REVA 1LWCA 1C1CB 2XNRA 1WSFA 2HVHA 3G6EN 2V4JB 1X4DA 4ALZA 2K3IA 1DKGD 3MM8B 4CTAB 3VOVA 5F8LA 4HHJA 2C2DA 1VSHA 2ZOMA 2QM1A 3WIVA 5F3ZA 3Q83A 3I4PA 3LPEA 2GV9A 2HBQB 2RQMA 1URRA 3JAMO 3K58A 3H2LA 3BY5A 4HKQA 2W7OA 5D4NA 4CF1A 1X4AA 3OYLA 3MCMA 4Y2KA 2A1SA 2E2QA 3ZETB 3UDVA 5AQUA 4B9UA 1RABB 1FVQA 1VK8A 4B9VA 4CJEA 3SSSA 2QWOA 3MWTA 5GAHU 2ZH4A 2XC9A 3OR2A 4I1TA 3FCWA