1WSFA

Co-crystal structure of e.coli rnase hi active site mutant (d134a*) with mn2+
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCAELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Identification of Single Mn(2+) Binding Sites Required for Activation of the Mutant Proteins of E.coli RNase HI at Glu48 and/or Asp134 by X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 49
structure length 155
sequence length 155
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsfA00
1BHLA 4FLWA 2ZD1A 2G8UA 1IG9A 3ZSZA 3QEVA 1C1BA 1L5UA 1S9GA 1HYZA 3TAPA 1LWCA 3MAQA 4CJRA 2D0AA 2G8WA 1ZBIA 4O44A 4PY5A 3TAEA 2F96A 3MEGA 1JLGA 4IG0A 2O4GA 2RF2A 3CG7A 1IKXA 3RMBA 1WSGA 4ZTFA 4B9VA 4EZ6A 3AVKA 1NKCA 1Q9XA 4CGJA 1JXEA 3SUQA 3K5OA 3P5JA 1Q9YA 2YHAA 4CJUA 3OYHA 1QE1A 4CHNA 1QTMA 2ETJA 3AO4A 1UWBA 1X1PA 4FJGA 1GOCA 1KTQA 1VSIA 3PUFA 4OKKA 1YVUA 4RW9A 1JL2A 1NJWA 4FJIA 4W5OA 3DOKA 1D8YA 3LAMA 4EP5A 4FJLA 2GUIA 3LP0A 3AVJA 4KB0A 3MEEA 3CFPA 3I0SA 5T7BA 1L3TA 5CZ1A 1ASUA 4DG1A 4KPYA 5FRMA 1S1VA 4OGCA 2XY6A 4CF2A 4KTWA 3K59A 4KHNA 3B6OA 1IO2A 2DY4A 3I0RA 3RRHA 3M8PA 1BI4A 2ZQBA 3THVA 1VSFA 3VQDA 4FLVA 1KVCA 3V9WA 4PQUA 3LP3A 3NCIA 4DQSA 3ZSRA 3AO1A 2B6AA 4BDPA 4B9LA 2HNDA 2Y1IA 4FJKA 3V1OA 1T8EA 4AHSA 2G8IA 4B3OA 2YKNA 1VSJA 4FLZA 3VQ4A 4QCLA 1HQEA 1RDBA 1RT3A 3SYZA 2HVIA 3L3VA 2GV9A 3SQ4A 4FJHA 4ELUA 1RTJA 3JSMA 1S5JA 5HRNA 3JYTA 2ITGA 1KLMA 1TV6A 4RW7A 1WSEA 4KTZA 1MU2A 2YKMA 4B8CA 3P1GA 3ZCMA 4CERA 1QQCA 1TKXA 1HQUA 5SZTA 4UQGA 3V81A 1SKWA 3DMJA 1BISA 1RBTA 4Z0UA 2X6SA 1JKHA 4ELTA 1TAQA 1R0AA 3QO9A 3TANA 3LZIA 3ASMA 1G15A 4AHCA 3SQ2A 1RT4A 2XY8A 2IC3A 1DTQA 3B6PA 4CF9A 3OYLA 4E7JA 4DTRA 5HRPA 4OLBA 4MQ3A 3AVMA 1RNHA 1A5VA 4KI4A 1CLQA 2XRIA 2VWJA 3KK2A 3WNFA 3KTQA 4DTOA 2VG6A 4M3WA 1NK6A 3E01A 2YNHA 3P83D 4W5QA 2QK9A 3VQQA 4M3ZA 1VSDA 4C8LA 1J9AA 1Z25A 3OYKA 1WSIA 3NGYA 3KLIA 1C6VA 2ZE2A 3OYIA 1RILA 2VG7A 1W9HA 3K2PA 4I7FA 3OJSA 4DQRA 1S6QA 4CFCA 3DLHA 1S9EA 1BCOA 1JLAA 1FXXA 4Z4EA 3ZSWA 1FK9A 3DM2A 3MXMA 1NKBA 5FRNA 1XHXA 2LSNA 1F21A 3DLKA 4QOZB 1NK7A 2Z1GA 2X78A 3U3YA 1NKEA 2HHVA 3O4NA 4J2EA 1VSHA 4RW6A 3VQ7A 1ZBLA 1RTIA 3SZ2A 3OYNA 4I2QA 1SKRA 4Z4IA 3VQ5A 1C0TA 3BGRA 4JRPA 4K8ZA 1CXUA 1XI1A 3HYFA 3RMAA 1FKOA 1LV5A 3OJUA 1J5OA 4ID5A 3CQ8A 3DLEA 4E1NA 4ZHRA 3SV4A 4YNQA 1TK8A 4LH4A 5C25A 4OVLA 3HPHA 4CHOA 4NCBA 4HVJA 3AA4A 3S3MA 4CIGA 4KRFA 4IDKA 2HHSA 5FROA 1O1WA 4KTQA 2OZSA 1GOAA 4DSKA 3MEDA 4E7IA 4N76A 4DFMA 3LAKA 4FLUA 4LSNA 4HTUA 3QINA 3LP2A 4DS4A 4K8XA 1HPZA 1FKPA 4DQQA 3OYMA 4Q5VA 1JLCA 2BANA 4FYDA 4N56A 4BE1A 5CYQA 1YTUA 2IOCA 4TSXA 3AVCA 4CJ5A 4J2BA 4N5SA 4DFJA 1HRHA 5J2NA 4B9UA 1N5YA 4DSJA 4FJNA 2YNFA 5JS2A 4DTPA 3VQAA 3SUNA 4O55A 3LWMA 3DOLA 1RTHA 4CHPA 2RPIA 5J2QA 3V6DA 1C0MA 1TKDA 1NOYA 1U04A 4AHRA 4FM1A 4F4KA 4C8KA 3HPOA 4CGFA 4HUGA 4DQIA 3L3UA 4GVMA 3V9ZA 1BIUA 3DLGA 3MECA 4CGIA 4CESA 4OKJA 3SJJA 3O3FA 1IKVA 3V1RA 1HJRA 3KD1E 4J2AA 4KV8A 2B5JA 4E3SA 3CM6A 1XC9A 5CY4A 4CGHA 1RBVA 5SWMA 2KW4A 4CEBA 1JLQA 4FM2A 3NDKA 1UOCA 1RT5A 2OZMA 2QXFA 3AA2A 4MFBA 3AVBA 3HT3A 3SUOA 5KGWA 3I8DA 3QEPA 1RDAA 2A1RA 1QSYA 1LW0A 1QHTA 2B4JA 4RG8A 3KD5E 4OGEA 3RMDA 2G8KA 1JXBA 2QKBA 3RWUA 4B9SA 4F8RA 3VQ6A 1U49A 4CEQA 1JLBA 1VSLA 1BQNA 3IAYA 1RT1A 2WONA 3HP9A 2IGIA 4LH5A 1IH7A 4FW1A 4RW8A 4CF8A 3EZ5A 1TAUA 3OYEA 4ID1A 1U48A 4KHUA 3ITHA 4M41A 4DLGA 1EKEA 1WNSA 4FJ9A 2KFNA 4C8MA 3IRXA 3HPGA 1XWLA 3ZSOA 4DF8A 3QLHA 3QNOA 3SQ0A 2DTUA 1C1CA 4DU3A 3V4IA 4OKEA 3PY8A 1WSJA 4CE9A 4FJMA 3VN5A 1SUQA 2QKKA 3SPZA 1RT7A 1TVRA 3AVLA 4BDYA 4DU1A 4DFKA 4J2DA 1VSMA 2WOMA 1NOZA 3HK2A 2D0CA 3L2VA 3ULDA 2EHGA 3T3FA 3TABA 3NF8A 3S3NA 4KO0A 1RT6A 2VG5A 3DI6A 4KHWA 5FDLA 4KREA 3L2RA 2OA8A 3RRGA 3MXIA 4KHYA 4OPKA 1UAXA 2KZZA 3C6TA 4QAGA 1LAWA 5HROA 1CZBA 4DSEA 3KLHA 3PX4A 1QS4A 3LPUA 4BACA 1TKZA 4FJ8A 4E0DA 4CF1A 3SV3A 1RBSA 1JLEA 3HXMA 1KCFA 3LALA 1VRTA 1T05A 3OS0A 4CJVA 2Z1IA 3K5MA 5HRRA 3AVNA 1HMVA 4W5TA 3L2QA 1KSPA 1ITGA 1RBUA 2DFHA 3EY1A 3NGZA 3ZSYA 3VQEA 4M3UA 3SQ1A 1S1UA 1VRUA 3C94A 5HBMA 4CFDA 3ZT3A 4CJLA 4ICLA 4CHZA 4KKOA 3HJFA 3FFIA 3NE6A 3LDSA 1S6PA 2P5OA 5KI6A 1CXQA 2E4LA 5I42A 3ZSVA 1KLNA 4CECA 2YNGA 4R5PA 4O5BA 4XIUA 4HCBA 4IG3A 3WNGA 3AVAA 3O4QA 3KKSA 4CEDA 2IAJA 3OYFA 4JS5A 4M42A 3DRPA 3BDPA 4O4GA 1I3AA 2OPSA 3RTVA 3NAEA 1K6YA 4E7KA 3VQ8A 1VSKA 3HO1A 3L2UA 4CFAA 1KVBA 3NF6A 3HP6A 4NCAA 4CJ4A 2R7YA 1LAVA 4ZTJA 3PX0A 2HHUA 4CEEA 4IBNA 2HVHA 4CF0A 3NFAA 4OJRA 1J54A 3LANA 4FZYA 4HUFA 2P51A 1HYVA 5E41A 3O3GA 3RMCA 5HLFA 4ELVA 3NF9A 5KRSA 4AHUA 3D0PA 2P5GA 1X9MA 3TAFA 1IKWA 3F9KA 4DS5A 1U45A 3KJVA 1SL2A 1C0UA 3KIOA 1L3VA 1WLJA 1QSSA 1NK4A 2PY5A 1NK0A 4DTXA 3PO4A 2D0BA 4C8NA 2Z1JA 4CJKA 3TR8A 1LWFA 4FZXC 1D9FA 4KHQA 3AVFA 2Z1HA 4F2SA 2HNZA 3SUPA 4B9TA 3EYZA 3DYAA 2KFZA 3QIOA 1TL3A 3OYDA 4BE2A 1J53A 1SL0A 4DTSA 1Q8IA 4FCYA 2BGGA 1BCMA 1GOBA 1S1WA 1C1AA 1W0HA 5C42A 3VQBA 5J2PA 2RKIA 2A1SA 4M3XA 2FBVA 1WSHA 4CEOA 1IKYA 3OYCA 4DTJA 1HNIA 5KTQA 1D9DA 4GMJB 4PA1A 4M3RA 4OPJA 3QEXA 4CHQA 3KK1A 5I3UA 4DU4A 4CJFA 3HVRA 3SPYA 2F8SA 3SI6A 1JLFA 3U6FA 3KKRA 4FK4A 3G0ZA 1ASVA 3OYJA 2HHWA 1KFSA 1KRPA 1TKTA 2EX3A 4CJPA 3A2FA 1NK5A 1WN7A 4NYNA 4B08A 4CJ3A 3M8SA 3K5LA 1VSEA 2D5RA 4KAZA 4KHSA 1ZBHA 3CYMA 3V9SA 3AO5A 3HM9A 1L3SA 4M3TA 2OPQA 4DWIA 2I5JA 1U4BA 1Z26A 2YV0X 1NK9A 3VQPA 1BL3A 4B9NA 4EZ9A 1EX4A 4N41A 4B9MA 4KFBA 2GBZA 3T19A 4CIEA 3D45A 2JLEA 3L2WA 3WNEA 1BIZA 4FJJA 2NUBA 1SV5A 4BE0A 1NJYA 2HHQA 3L8BA 3AA3A 4M45A 1TGOA 4JLHA 1REVA 4O0IA 1ASWA 1UA1A 1NK8A 4FK0A 5J2MA 4BWJA 3ZSQA 3C6UA 3PX6A 2PYLA 1S1XA 1S1TA 3ALYA 3AV9A 5EU7A 4CHYA 2O4IA 2YNIA 4LSLA 1KFDA 2Q3SA 4Z4CA 3VA3A 4CJQA 2DFFA 3M8RA 3OY9A 3QNNA 2ATQA 4FLXA 1ZYQA 1N6QA 1BI4B 2E6LA 2OPPA 3QEWA 4C8OA 4OLAA 2HW3A 2FBYA 1HNVA 1EXQA 1BQMA 1JL1A 2IS3A 1A5XA 5DK5A 3DLRA 1RCHA 1ZBFA 3OS2A 4DF4A 1A5WA 3HVTA 4JS4A 4CK1A 4DSFA 2PYJA 2Y1JA 1WAJA 4G1QA 1RDDA 2FBXA 4RW4A 4CCHA 4E19A 1UA0A 4KI6A 4W5RA 3AO2A 4IKFA 2YHBA 3LPTA 3HSTB 4NCGA 1VK0A 3TARA 1U47A 3AO3A 4CGDA 4E89A 3DRRA 1DLOA 4CGGA 3NH1A 1HYSA 2W42A 1RT2A 3IG1A 4HCCA 3K57A 3NH2A 4H4MA 1ZBUA 3ISNC 1SKSA 3QEIA 3LWLA 3U3GA 2RN2A 4IFVA 3DRSA 4DQPA 3WNHA 3AA5X 1CZ9A 3AVHA 3PO5A 3CFRA 4HHTA 2KQ2A 3V9XA 5C24A 1QSLA 3NGIA 4E7HA 4CIFA 3RR7A 4CJTA 2G8HA 4B8AB 4DLEA 4FJXA 1BGXT 4E1MA 3HL8A 4GW6A 1B92A 1TK5A 2G8VA 3KLGA 2XHBA 3RR8A 4CJWA 2G8FA 4FVMA 3PV8A 2P1JA 3NBPA 3NH0A 3TWHA 3LP1A 2OYQA 2KTQA 3K58A 4DTUA 1DTTA 1RDCA 3K5NA 4BDZA 4FLYA 3QERA 3KLEA 4H8KA 1EP4A 4N47A 4CK3A 3S3OA 4DTMA 1X9WA 2E6MA 4FW2A 4LY7A 3V1QA 1NJZA 4IFYA 4KB1A 4Z4FA 2FC0A 4WE1A 2AJQA 4FLTA 4CEFA 3QETA 3KLFA 3QESA 4Z4GA 2FBTA 1RBRA 4Q0BA 5J1EA 2OPRA 3CM5A 4NYFA 1B9DA 4DFPA 4CK2A 4JRQA 4I2PA 4F3TA 3F73A 4FXDA 1NJXA 4AHVA 3OVNA 3VQ9A 4PWDA 2BE2A 3TI0A 1B9FA 3AVGA 4W5NA 2DFEA 4F3OA 4YFUA 3VQCA 1I39A 3MXJA 5KGXA 3TAMA 4FM0A 3UIQA 1Y97A 4Z4HA 2BDPA 4H4OA 4CEAA 3ZT0A 5HP1A 1L3UA 2JGUA 3S9HA 3OYGA 3SNNA 3SCXA 2F8TA 4M3YA 4DMNA 3G10A 2HMIA 3OYAA 4EP4A 3NHGA 4L8RB 3OS1A 1KVAA 2XY5A 2XY7A 2HHXA 2KZMA 4O0JA 4DSLA 4BWMA 5KRTA 3KK3A 4DSIA 1EETA 2X6NA 4AHTA 4CJSA 4CFBA 1T7PA 5D3GA 1TL1A 5K14A 1YTAA 4I9QA 3V9UA 4Y1CA 3QIPA 4PUOA 1WAFA 4Y1DA 1LWEA 3T1AA 1T03A 3TAGA 3ZT2A 5HRSA 3ZT1A 1X9SA 1YT3A 3ZT4A 3H08A 1LW2A 4AH9A 3NF7A 4FJ7A 3CFOA 5CZ2A 4AILC 2PZSA 4CEZA 3TAQA 1WSFA 4FZZA 2IDOA 2VWKA 3VA0A 5JS1A 3M8QA 1RTDA 3O3HA 2HB5A 3IS9A 4HUEA 4DTNA 1SL1A 5CYMA 3DLBA 4F2RA 2X74A 4LD0A 3ZSXA 5DMRA 2XO7A 2HHTA 2HNYA 3OYBA 3LZJA 4E7LA 1D5AA 3AVIA 4I9LA 4CJEA 1XHZA 4FK2A 4FJ5A 1TK0A 3C95A
chains in the Genus database with same CATH superfamily
1FJGK 2ZD1A 4IWVA 1HYZA 1ZBIA 4JYAK 4CJRA 4ILHA 4O44A 3C65A 3MEGA 3CG7A 1WSGA 4B9VA 2P9PB 3SUQA 3LM9A 3K5OA 2W6LA 3L4QA 4JI0K 4CJUA 3TTFA 3QB0A 1QVGM 2ETJA 3AO4A 2UUCK 1KTQA 4OKKA 1NJWA 4W5OA 1V4TA 3LAMA 2GUIA 3AVJA 4KB0A 5T7BA 5GAGP 1XNQK 3ZETB 3N4PA 2XY6A 4KTWA 3K59A 4LF4K 4KHNA 3B6OA 2NRTA 1BI4A 2ZQBA 3THVA 5M1FA 3FZLA 3PLAA 2P9UA 3LP3A 1WOQA 2B6AA 2HNDA 4BRKA 5EXWA 4FJKA 2NLXA 4GV9A 2YKNA 1HQEA 3SYZA 3L3VA 1RTJA 2F9WA 1OH7A 1TV6A 4RW7A 5LJWA 3DLLL 3QBWA 3P1GA 5SZTA 1QQCA 4YHHK 1WBBA 4UQGA 2X6SA 1DT9A 1JKHA 4ELTA 4CZIA 4JN4A 1RDUA 2IIRA 4AHCA 2NRRA 4E7JA 2IC3A 1DTQA 3SK3A 1A5VA 2XRIA 3WNFA 2WFBA 3BZCA 3P83D 2QK9A 3VQQA 1QVFM 4ISFA 1J9AA 1Z25A 3CQXA 3L0QA 1C6VA 3KWIA 3LL3A 3W0LA 1RILA 1G99A 4BR0A 1BCOA 1JLAA 4MDBA 4FWLA 1FK9A 3O4WA 2Q36A 4JK8A 4BR5A 2A41A 1NKEA 2HHVA 3O4NA 3C7NB 3O80A 1WB9A 3OYNA 1ZC6A 4I2QA 3EKUA 4JD2B 1C0TA 3CCQN 3U9DA 1OH6A 4ZHRA 5IWAK 1T6CA 3H1VX 2NRZA 3Q7BA 3EEQA 1TUUA 3O6WA 4IDKA 3SMPA 4GKKK 2OZSA 5F2RA 4I6MB 3LAKA 4KBOA 3A8YA 4LSNA 3EKSA 1T3VA 5LMUK 3D6RA 1NNEA 1FKPA 4DQQA 3OYMA 2BANA 3L4IA 4BE1A 2IOCA 4CJ5A 4J2BA 5JS2A 4CBWA 1RTHA 2QWPA 1U04A 5KPRA 4DQIA 3SAFA 5AQHA 2VQEK 3CC7N 3DLGA 4A5BA 4CESA 4OKJA 3O3FA 5F0XA 1VQ6N 1NJIO 4J2AA 1XC9A 4CGHA 3G6EN 1RBVA 1YUWA 1NGEA 3NDKA 1UOCA 1RT5A 2E2PA 2QXFA 3AA2A 3AVBA 4FVUA 5TKYA 1LW0A 3CIPA 2Q0RA 3RMDA 1HKGA 1JXBA 2QKBA 1Q18A 1HX1A 4B9SA 3VQ6A 1JLBA 1VSLA 2AA4A 3HP9A 3FE1A 3CJAA 4LH5A 1IH7A 5GIPA 2ZWHA 2ASMA 3OYEA 3ITHA 4PKHA 3IRXA 3FGUA 3HPGA 3VTHA 4DF8A 3QNOA 3SQ0A 4JV5K 2QWMA 4OKEA 4FJMA 5MLCQ 3AAQA 5AQQA 1BDGA 3JXUA 4JKEA 4BDYA 4J2DA 1XQSC 1TYQA 2D0CA 3T3FA 1MDUB 1EQYA 1OVYA 4KO0A 4KREA 2OA8A 4QAGA 5JVGL 3A5NC 2CH5A 3HI0A 3PX4A 4FJ8A 3CCUN 4BC5A 4E0DA 3BZKA 3SV3A 5ADXH 1T05A 3HSCA 3OS0A 1HNZK 1KAXA 2IVNA 4DR1K 2YCHA 3FZFA 1KSPA 3VMFB 1RBUA 5I9EB 3GG4A 3VQEA 4CFDA 1VRUA 3CJ9A 2P9SB 4ICLA 4KKOA 3LDSA 1S6PA 1CXQA 3QFUA 3CCMN 5AQRA 2YNGA 4FPAA 4IG3A 4CEDA 4JS5A 3DRPA 3E9PA 3BDPA 3RTVA 3NAEA 1XNRK 3VQ8A 1HR0K 1KVBA 4NLCA 4BY9C 2F9TA 4NCAA 2HVHA 4IBNA 4CF0A 1MWMA 3LANA 5BPLA 4X62K 3O3GA 3RMCA 5C12A 4U7BA 5KRSA 1X9MA 3TAFA 1IKWA 3CC4N 5AZJA 4BRAA 5FPDA 4CJKA 5GAEP 4FWOA 4KHQA 4F2SA 4LFCK 3WXMB 3OYDA 2BGGA 2ZJQL 4FCYA 4DTSA 5JICA 1C1AA 1S3XA 2RKIA 2GUPA 1IG8A 3A5LC 3OTOK 1DGKN 3OYCA 3ID6A 1MWKA 4PA1A 2NRXA 3SPYA 1N33K 1QZ5A 4LF6K 3U6FA 3GDQA 2HHWA 4QS9A 3H3OB 1TKTA 1KFSA 1KRPA 3A2FA 3H1QA 4BRIA 4B08A 1VSEA 1S72N 1E4GT 3HM9A 1YI2N 3SAGA 1JCFA 4DWIA 2I5JA 3OBYA 2O8EA 4EZ9A 3H46O 5AQJA 2JWKA 3AGRA 3D45A 2JLEA 3N4QA 3IMXA 4AM6A 3DAWA 4JLHA 1ASWA 3BEXA 3O9SA 4BWJA 1U6ZA 2PYLA 5BN9A 3ALYA 2O4IA 2YNIA 1VQ5N 3VA3A 4FSVA 4M42A 3T1HK 4IO8A 3MN5A 4IXCA 1HNVA 1JL1A 2IS3A 5DK5A 4DF4A 1ZBFA 1YJNN 4BRGA 1Q82O 2Y1JA 4DKWA 4G1QA 2PYJA 4RW4A 3ENHA 1UA0A 4BRNA 3TARA 4WQ4C 3AO3A 4JI4K 4H0PA 1HYSA 1O13A 2W42A 3IG1A 3HBTA 5DM7L 3S41A 3ISNC 5LJVA 2RN2A 4IFVA 5BR8K 3THWB 3WNHA 1LOTB 3AA5X 1CZ9A 1EO1A 3MWPA 4M7YA 3AVHA 3D2FA 5C24A 4L3QA 4B8AB 5TKWA 4GW6A 1I94K 3ID8A 5JMVA 5CE3A 3LDOA 4FWKA 3PV8A 3NBPA 3NH0A 3TWHA 2KTQA 2P9KA 3AGKA 1K8KB 3R1XA 2WC9A 3KLEA 4N47A 4FLYA 1SQKA 3A5MC 4LY7A 1NJZA 2NNWA 3C6AA 4IFYA 4YDUC 4CEFA 4J8FA 3QETA 3CM5A 1HPMA 4DFPA 1YVNA 3CD6N 3ZX3A 4AHVA 3OVNA 3U4LA 3M1FA 3TI0A 1GLEG 2DFEA 2IVPA 3VQCA 2P9NB 5BRHA 1NGFA 3TAMA 4FM0A 3UIQA 3VERA 4Z4HA 1NWKA 3VENA 4DMNA 3G10A 2XY7A 4OPHA 4DSLA 3KK3A 4XEIA 5D3GA 3NVKA 4FOEA 4WQ4A 3IDHA 4Y1CA 1WAFA 4ISEA 3TAGA 3ZT2A 5HRSA 4JK7A 4IEIA 5EOYA 3ZT1A 4AH9A 1KAYA 5CZ2A 1IJJA 3TAQA 1WSFA 4CI6A 3O9UA 3M8QA 1VHXA 1RTDA 1R59O 4HUEA 4DTNA 4BR2A 3DLBA 3ZSXA 2XO7A 2ZGYA 1QZ6A 2E2NA 1D5AA 3E9OA 3UKUA 5BN8A 4FJ5A 1Q7YO 3D7EO 3C95A 2P9IA 1BHLA 4FLWA 1MA9B 3THYA 3ZSZA 1L5UA 3MAQA 2G8WA 3E66A 4IG0A 3RWUA 1V4SA 2O4GA 4M3XA 1IKXA 4EZ6A 4JI5K 4B3SK 1NKCA 1JXEA 2YHAA 3OYHA 2PAVA 4CHNA 1UWBA 1VSIA 1YAGA 1JL2A 1VQ9N 3GBTA 3LP0A 1L3TA 2O8CB 1NU0A 4BG9A 4EIAA 4Y0WA 5FRMA 1S1VA 2W6KA 4CF2A 2V7ZA 2A42A 4FWMA 3T1YK 3CF5L 3ENOA 4PQUA 3AO1A 4BDPA 1N36K 2JWLA 2Y1IA 4JKHA 2G8IA 4K43A 3VQ4A 3TU5A 1RT3A 1S5JA 1E3MA 5HRNA 3JYTA 1VQMN 1NM1A 3R8EA 2NZTA 4JKAA 2YKMA 4B8CA 2CH6A 3L6QA 1TKXA 1HQUA 4LF8K 1BISA 4Z0UA 3MWTA 3H6EA 1G15A 3SQ2A 4OLBA 3OYLA 4MQ3A 4KI4A 2VWJA 3WQTA 3KTQA 4M3WA 1NK6A 3E01A 4H5VA 4XH4A 4JI2K 4M3ZA 1WSIA 3NGYA 2QTDA 3CMAN 4K0KK 3AAPA 2VG7A 4YOTA 2EWSA 1W9HA 3K2PA 4I7FA 4DQRA 3UKRA 4CFCA 3DLHA 1FXXA 3SMSA 4FL9A 3MXMA 1YXQA 2YHXA 3O1BA 4CW7B 4QOZB 1NK7A 1BO5O 4J2EA 3FR0A 3VQ7A 1XC3A 1CZAN 1RTIA 3SZ2A 3I8BA 3O9QA 1DKGD 1SKRA 3BGRA 2UXDK 1CXUA 1XI1A 3FZHA 3CCEN 1FKOA 1J5OA 4ID5A 2OCEA 5GIOA 4LH4A 3HPHA 4X66K 4HVJA 3AA4A 1NGJA 2VGMA 1GOAA 1M1KO 3MEDA 1XMQK 3QINA 4DS4A 5M1QA 4MLHA 1JLCA 4DV2K 4FYDA 1GLCG 4MO4A 5CYQA 2HF3A 2FF3B 3AVCA 4QS7A 3A5OC 2O8FA 1N5YA 4DSJA 3F2KA 4YOYA 3SUNA 4CHPA 5J2QA 2RPIA 4F4KA 1HLUA 2YI1A 3L3UA 3MECA 1IKVA 3B8AX 1HJRA 3CQYA 3KD1E 4E3SA 4DV1K 5SWMA 1JLQA 3QEPA 3VEZA 3HT3A 3HM8A 2A1RA 2ASPA 4CZLA 1QSYA 2I7NA 2B4JA 5LMNK 4JI7K 2BUPA 4OGEA 3MN6A 2P9PA 1U49A 4CEQA 1OH8A 3IAYA 1RT1A 2WONA 3TTDA 1N32K 1P90A 3IUCA 5AQOA 4RTFD 4B3MK 4ID1A 4M41A 1WNSA 2UXCK 4JK9A 4WYBA 3V4IA 3PY8A 1WSJA 4DU1A 3AVLA 4JI8K 4WFAL 1VSMA 4AF1A 2HOEA 1NOZA 2ITMA 3HK2A 5AQLA 3L2VA 2EHGA 3TABA 2J4RA 1RT6A 4H5RA 4BRDA 3O9RA 3MXIA 4DR7K 4OPKA 3C6TA 4IEEA 3H45C 1TUYA 1QS4A 2E88A 1TKZA 3K9KA 1XMOK 4CF1A 1RBSA 1X3MA 4OX9K 4CJVA 1HNWK 3WXJA 3L2QA 1BU6O 4B1VA 3ZSYA 4EHUA 3SQ1A 3ZT3A 3VF2A 4CJLA 3FFIA 2P5OA 2CGKA 3ZSVA 1K73O 4O5BA 4XIUA 3WNGA 3AVAA 4B9QA 2IAJA 3OYFA 5AR0A 1GLFO 5A2QO 1K6YA 3CHWA 1Z05A 3HO1A 3AY9A 3DXMB 4JI3K 2UYTA 4CD1A 4CJ4A 2HHUA 3U8XA 4IFEA 4ELVA 2YJEA 4PKGA 1W7AA 4DV3K 3KJVA 1SL2A 3CCRN 1L3VA 3K0SA 1NK4A 5AZIA 2PY5A 4C8NA 1D4XA 2HMPA 4B9TA 4A62A 1SZ2A 1J53A 4C1NI 1Q8IA 1GOBA 1W0HA 3VETA 3VQBA 1U2VA 2A1SA 5AFUH 1IKYA 1HNIA 4JHDA 4FPBA 3MCAB 1D9DA 1HJOA 3Q7CA 4M3RA 2HSTA 3KK1A 3HVRA 4FK4A 2P9LA 1BA0A 5KPTA 3OYJA 4CJPA 4DV5K 2FSNA 1N8RO 4B3TK 1ZBHA 3V9SA 3GOIA 2OPQA 1NK9A 4NXMK 4B9NA 4DV0K 4BREA 4B9MA 2E1YA 4KFBA 2GBZA 3T19A 3L2WA 2UUAK 1BIZA 4BE0A 2HHQA 3AA3A 4M45A 1TGOA 4DV4K 1NK8A 4BGBA 3ZSQA 4CZKA 1NGGA 4FWPA 4Z4CA 5LY3A 3FFKB 3J81O 2E8AA 3O5BA 2ATQA 3OY9A 4X65K 4DCHA 2E6LA 3QEWA 1BQMA 3DLRA 1RCHA 3KVGA 1A5WA 3HVTA 4PL8A 4DSFA 4CBUA 1WAJA 5AQKA 1RDDA 2FBXA 3FLCO 4E19A 4R79A 4KI6A 1X3NA 3LPTA 3NVMA 2HF4A 2OTLN 3NH1A 4CGGA 3BF1A 3NH2A 1TYQB 1ZBUA 1SKSA 1ZBSA 2QW9A 4M7XA 3I55N 4PHTX 1YITN 3CFRA 3PO5A 5M1KA 1SAZA 3R3LA 3PIPL 2KKZA 1ILYA 4WF9L 3V9XA 1HKCA 1QSLA 3NGIA 4E7HA 1XUPO 4CJTA 3CJ7A 2G8HA 1NGBA 3K9JA 4FJXA 3J80O 3HL8A 1B92A 1TK5A 3KLGA 2XHBA 4CJWA 3VEXA 2A5XA 4JEPA 2OYQA 2D0OA 2E20A 1RDCA 4H0YB 1DEJA 1X9WA 4DTMA 4FW2A 3J7AP 3QESA 2FBTA 2KLAA 4O5FA 4BVPA 2WTUA 5AQXA 4I2PA 4JRQA 3F73A 5BR9A 3EZWA 4K42A 4KH6A 5C10A 4YFUA 5KGXA 1NMDA 1VQ8N 2O8BA 3M3ZA 3ZT0A 5HP1A 5JVHL 2JGUA 1K8AO 2F8TA 4ILGB 1GLJO 4M3YA 3CETA 1W2BM 3OS1A 1KVAA 2XY5A 5E26A 4BWMA 5KRTA 4CFBA 3D2EB 4CJSA 5K14A 1YTAA 2HBKA 5AQMA 4JKGA 1LWEA 4AM7A 1T03A 4JAXA 1X9SA 3WQUA 4FJ7A 4CEZA 1C0GA 4A57A 5AFUA 4DQ8A 3M5RA 2HB5A 4M63C 5CYMA 1SS6A 4LD0A 5DMRA 2RHKA 4I9LA 4BQZA 4WQ5C 3U9ZA 1EWQA 1ATSA 4JKBA 4H0VB 2G8UA 2UU9K 1QQMA 2QWLA 4V19S 1C1BA 1Z6RA 4BC2A 2QWOA 3TAPA 5CHIA 1LWCA 3E9LA 4NXNK 4PY5A 3TAEA 2O8EB 3C0BA 3ULEB 2RF2A 4ZTFA 3AVKA 3CJ1A 4CGJA 1JCEA 3ZX0A 2VYPA 1QTMA 2VQFK 1Y64A 1X1PA 4NLBA 3SAHA 4FJGA 1GOCA 1KAZA 4FJIA 3DOKA 4EP5A 4C23A 4MDAA 3P38A 3MEEA 1IBKK 3DXKA 4DHYA 2YHYA 3THXB 3RRHA 3M8PA 3JS6A 3T7ZA 1VSFA 4FLVA 1KVCA 3V9WA 4JI6K 3KWGA 3ZSRA 4CD3A 3QMLA 4B1ZA 3GL1A 3V1OA 4AHSA 1T8EA 4BRHA 2GV9A 4LF5K 3TSQA 3VF4A 5M1PA 5EY4A 1WBDA 2VWBA 3CJBA 1KLMA 1WSEA 4KTZA 4CERA 3ZEUA 1SKWA 3DMJA 4JKFA 4A2BA 1IBLK 5M1NA 3LZIA 1RT4A 3B6PA 4CF9A 4DTRA 4BROA 3CC2N 1RNHA 3CCJN 1CLQA 2QA4N 1T44A 4DUZK 2VG6A 3SBTA 2O8DA 4WQ5A 2YNHA 2P9KB 3PSFA 2HBLA 4BR4A 3J8AA 4C8LA 1OH5A 1VQ7N 2Q0UA 3KLIA 4C1NK 3WUHA 2ZE2A 3P39A 4EFHA 3OJSA 1S6QA 3ZSWA 5FRNA 3DM2A 1NKBA 1XHXA 3BP8A 2V52B 3LDPA 1ZBLA 3H3NO 4LC9B 1OKJA 4GVEA 4JRPA 3RMAA 4H0XB 3CQ8A 4E1NA 3SV4A 3DWLA 1TK8A 5HOOA 4CHOA 4NCBA 4CIGA 4KRFA 5KQDA 2HHSA 5BREA 5FROA 4KTQA 4IDHA 4DFMA 4FLUA 3EE8A 4B1UB 1HPZA 3RSEA 4DR5K 1YTUA 5F1XA 5AQUA 4N5SA 4DFJA 5J2NA 3O8MA 2YNFA 4DTPA 2A3ZA 4IO9L 1TKDA 3V6DA 3UKUB 1C0MA 4CGFA 4KHPK 4HUGA 2P9IB 3V9ZA 3THYB 3V1RA 2B5JA 3O9TA 2Q97A 2KW4A 4CEBA 4FM2A 2OZMA 5AQNA 3I8DA 1KQSM 1RDAA 1QHTA 1LCUA 2ZF5O 1VQ4N 4CZFA 3WEEA 3HOSA 4B1YB 5KPZA 2HBMA 1BQNA 3IFRA 4FW1A 1TAUA 4CF8A 1U48A 4KHUA 2KFNA 4DLGA 1EKEA 4C8MA 1XWLA 3ZSOA 3KHYA 2HBJA 1JCGA 2A6AA 3VGLA 4CE9A 3VN5A 1SUQA 3LM2A 3SPZA 1RT7A 2Q31A 5B8HA 1J5EK 3OHRA 5C2FA 1TVRA 4DFKA 2WOMA 3EO3A 3ULDA 1FW6A 5EX5A 3NF8A 2VG5A 3E1YA 4UY8O 3L2RA 3RRGA 1GLLO 1YF5L 1KXPA 4KHYA 1UAXA 2KZZA 4BR7A 5C15A 1CZBA 4DSEA 3KLHA 2DPNA 2PBDA 4BACA 3J7YP 3LDQA 1JLEA 1KCFA 3LALA 1X9JA 2NRWA 2Z1IA 5HRRA 4BG8A 1HMVA 4W5TA 3QFPA 3EY1A 3NGZA 4NO7A 4M3UA 3QBXA 2ZM6K 1S1UA 5M1OA 3HJFA 3ZX2A 2CGLA 1VQNN 2QWRA 3VEWA 1KLNA 4CECA 3UKRB 3IKMA 4CJ7A 3MN7A 3F9MA 4O8UA 4O4GA 1I3AA 2OPSA 4E7KA 1RDWX 3L2UA 4A2AA 3NF6A 4YOWA 3HP6A 2HHHK 2R7YA 4CEEA 5BPNA 5AJ3K 4RWTA 1J54A 3NMUA 2P51A 4KH4A 4AHUA 2P5GA 3ZYYX 3EE9A 3CXCM 4DS5A 1C0UA 1QSSA 4ILJA 3PO4A 2D0BA 1RGIA 1LWFA 4FZXC 3PSIA 4GY2B 3DYAA 2KFZA 3QIOA 2VGNA 4BE2A 1SL0A 4A61A 5J2PA 5AQPA 2FBVA 1WSHA 1BOTO 4DTJA 4K25A 2O8FB 4GMJB 3QEXA 4OPJA 3VF6A 5DM6L 4DU4A 3OBWA 3SI6A 3TSUA 1JLFA 3KKRA 4A59A 4IOXA 1ASVA 5LL6Z 2EX3A 1GLBG 1WN7A 3K5LA 4KHSA 3M8SA 4KAZA 4BRCA 3CYMA 4M3TA 3CJCA 1Q86O 2OANA 3MMVA 1U4BA 2YV0X 3VQPA 1BL3A 1C0FA 3T69A 4N41A 3WNEA 4FJJA 2NUBA 1SV5A 5H1SQ 4PL7A 4XH5A 3TTCA 3CCSN 1REVA 4O0IA 3I56N 1UA1A 2GEMA 3ZLJA 3C6UA 4CHYA 4LSLA 2D0PA 4CJQA 2DFFA 1ZYQA 2E5LK 4B3OA 1BI4B 3HZ6A 2HW3A 2FBYA 2P9UB 3ZETA 2YX6A 1EXQA 4HTLA 1A5XA 3OS2A 4JS4A 4CK1A 4CCHA 4DUYK 1HUXA 4BRMA 3HRGA 5EVZA 4NCGA 1YIJN 3J7ZO 1U47A 4CGDA 5BRDA 4E89A 1DLOA 4U67L 1RT2A 3K57A 4ISGA 2V51B 3DRSA 4DQPA 2UUBK 1KC8O 1W97L 2KQ2A 2AP1A 3QDKA 4FWRA 4CIFA 3RR7A 2NRHA 4DLEA 4E1MA 3WT0A 3RR8A 3CERA 4CBXA 2G8FA 2F4VK 2P1JA 3LP1A 2VCPA 1GLAG 3DJCA 1NG9A 1DTTA 1NLVA 4BC3A 1YHQN 4H8KA 1EP4A 1S22A 1ATRA 4B1WB 2E6MA 3F5TA 3CI5A 4KB1A 4Z4FA 2AJQA 4BR9A 3KLFA 4Z4GA 1RBRA 1BUPA 2A40A 5J1EA 4NYFA 4FXDA 4F3TA 4BRFA 3JAMO 4OPAA 3VQ9A 2BE2A 3CCVN 3EL2A 4H0TB 3C7NA 1Y97A 4H4OA 5C0YA 4LF7K 3S9HA 4JD2A 4BRPA 3DXMA 3MX5A 2HMIA 3OYAA 4EP4A 3NHGA 4L8RB 2KZMA 4O0JA 4DSIA 5AZIB 2X6NA 1OVQA 2WBNA 3QIPA 3T1AA 4Y1DA 4EHTA 2FLOA 2OTJN 4I6MA 3ZT4A 2D4WA 1LW2A 4LFBK 3VEVA 1U2VB 4AILC 5AQFA 4FZZA 3VA0A 3GE1A 4JHDB 5JS1A 4X64K 4B1XB 3IS9A 1SL1A 4F2RA 4GKJK 4CJEA 4FK2A 2P9LB 2ZJPL 4PKIA 4FZYA 3G4SN 2BTFA 1IG9A 1NBWA 5CR4A 3QEVA 1S9GA 2D0AA 4FWNA 2H3GX 2F96A 3RMBA 1JLGA 4DR4K 3BUZB 4MO5A 3VESA 4E1JA 5AQVA 4CZEA 1Q9XA 1BG3A 1P8ZA 3P5JA 1Q9YA 4H5TA 1QE1A 3ENBA 3PUFA 4RW9A 1YVUA 3PIOL 1D8YA 2W41A 4FJLA 3CFPA 3I0SA 4O8KA 5CZ1A 1ASUA 4H03B 4DG1A 4KPYA 4OGCA 2DY4A 1IO2A 3I0RA 2WUSA 3VQDA 4CZHA 5AQGA 3NCIA 4DQSA 3ATUA 1K9MO 4DB3A 4B9LA 4FO0A 4IOCL 1E4FT 1VSJA 4FLZA 4QCLA 1RDBA 5FPMA 2HVIA 3SQ4A 4FJHA 4ELUA 3JSMA 4EAHD 3MN9A 2ITGA 1QQOA 1VQKN 1MU2A 3ZCMA 3V81A 3A0IX 1RBTA 3C6HA 1TAQA 1R0AA 2FSJA 3QO9A 3HTVA 1IBMK 3TANA 2ASOA 3ASMA 4H0OA 2XY8A 4FOIA 3OA9A 5HRPA 3AVMA 1BWFO 3KK2A 4Z94A 4DTOA 4W5QA 5FPNA 1KD1O 1VSDA 2BH1A 3OYKA 1JJ2M 2P9SA 2QWNA 1QQNA 2GTDA 4FWSA 3OYIA 3KZBA 1S9EA 4Z4EA 4G9ZA 2LSNA 3VEOA 1F21A 3DLKA 2Z1GA 2X78A 3U3YA 1ZXOA 1VSHA 5BRFA 4RW6A 2I7PA 2O8BB 2QI2A 3R9PA 5AZJB 5FPEA 4CZGA 4Z4IA 3VQ5A 4K8ZA 3HYFA 1LV5A 3OJUA 1NMNA 3DLEA 4K41A 4YNQA 3G71N 5C25A 4OVLA 2D1KA 4JKDA 2QWQA 4KH5A 3S3MA 3O1WA 3P31A 4JKGB 1O1WA 4DSKA 4E7IA 4N76A 3D2EA 4HTUA 3WXLA 3LP2A 4K8XA 4JNEA 4H5WA 5AQWA 4Q5VA 1EWRA 1VQLN 1BA1A 4N56A 5GINA 4TSXA 1YJ9N 1HRHA 4B9UA 4FJNA 1HKBA 3VQAA 4O55A 5KQ8A 3DOLA 5GAHP 3LWMA 1NOYA 4AHRA 4FM1A 4C8KA 3HPOA 3MX2A 4GVMA 4MLEA 1BIUA 4CGIA 3SJJA 4KV8A 3CPEA 3CM6A 5CY4A 2E2QA 3KK7A 4MFBA 4FJ9A 3SUOA 3LDLA 3LDNA 5KGWA 4DR3K 4F9OA 4YORA 2PFUA 4RG8A 3KD5E 3ULEA 3O08A 1IV0A 2G8KA 4F8RA 4XH1A 4GV6A 3DXKB 2IGIA 4RW8A 3EZ5A 3QLHA 2DTUA 1C1CA 4DU3A 4BC4A 1NGCA 5AQTA 1ATNA 3THXA 2QKKA 1WUAA 4WFNL 4YY3K 3MDQA 1VAZA 3UB5A 4QS8A 3S3NA 4IZ9A 3D2FB 3DI6A 3THWA 2QM1A 5FDLA 4CVNE 4KHWA 3ZEUB 4BVOA 1LAWA 5HROA 3LPUA 4OO1J 1H1VA 3HXMA 4DR6K 4CZMA 1VRTA 5ELZA 5E84A 3K5MA 3AVNA 2GWJA 3W3DA 2E1ZA 1ITGA 2DFHA 2V7YA 5ADXA 2O8DB 3C94A 5HBMA 1N34K 1K8KA 4CHZA 4WCEL 3NE6A 5KI6A 2E4LA 5I42A 4LF9K 1T6DA 4BRQA 4R5PA 3SBGA 4HCBA 3O4QA 3KKSA 4GV3A 1VSKA 2NRVA 4CFAA 2IVOA 3VPZA 3VGKA 2W40A 2P9NA 1LAVA 5GADP 3PX0A 4ZTJA 2CGJA 3NFAA 4OJRA 4HUFA 5E41A 1HYVA 2KHOA 5HLFA 3NF9A 3D0PA 3SLCA 3BY5A 3F9KA 1U45A 3KIOA 1WLJA 3VEYA 1NK0A 4DTXA 2Z1JA 3TR8A 3QICA 1D9FA 3AVFA 2Z1HA 2HNZA 3SUPA 3FZMA 3EYZA 1TL3A 4OLAA 3RSEB 1BCMA 1S1WA 5C42A 3HOTA 1YJWN 5HL7L 4CEOA 5C2DA 2ZGZA 2ZJRL 2YHWA 4BGAA 5KTQA 2GELA 4CHQA 4IJAA 5I3UA 4CJFA 2F8SA 1VQPN 3OW2M 1VQON 3G0ZA 1NK5A 4NYNA 4CJ3A 2D5RA 4JI1K 4NB4A 1L3SA 3AO5A 1NGDA 1Z26A 3I33A 1EX4A 4CIEA 3G25A 2FSKA 4FWQA 4AQYK 1NJYA 3L8BA 4DV6K 3WEEB 4FK0A 5BPMA 5J2MA 3M6GA 3PX6A 1NGAA 1S1XA 1S1TA 2FF6A 3AV9A 5EU7A 4RCHA 3AARA 4YDUA 1HNXK 1KFDA 2Q3SA 3QNNA 3M8RA 1QHAA 4FLXA 1N6QA 2Q1NA 4C8OA 2OPPA 4YOXA 2O8CA 4GNIA 4CZJA 4W5RA 3AO2A 3WXIA 2UXBK 4IKFA 2YHBA 3HSTB 1VK0A 1NGIA 2QXLA 3DRRA 4HCCA 1NGHA 4H4MA 2FXUA 3QEIA 3LWLA 3U3GA 3R6MA 2QEXN 3VOVA 4B3RK 2E2OA 4HHTA 3CPWM 2F7TA 1BGXT 3MCPA 2G8VA 3TSPA 4FVMA 3FZKA 3ATVA 1GLDG 3K58A 4DTUA 3CMEN 3K5NA 4BDZA 3QERA 5AQZA 3S3OA 4CK3A 3V1QA 4IOAL 3WXKA 2FC0A 4WE1A 4WFBL 4LFAK 4FLTA 4DR2K 4Q0BA 2OPRA 1B9DA 5AQYA 4CK2A 5AQIA 1NJXA 5FLXO 3VTIA 4PWDA 3TPQA 1B9FA 3AVGA 2RE2A 1RFQA 4W5NA 3BF3A 4F3OA 1ESVA 1I39A 2YJFA 3EN9A 3MXJA 2BDPA 4BRLA 4CEAA 4JKCA 5AQSA 4BQLA 1L3UA 4YOUA 3OYGA 3SNNA 3SCXA 2GX9A 2HHXA 2GWKA 4H5NA 4IJNA 4A5AA 1EETA 3MK6A 4AHTA 1T7PA 2Q2RA 1TL1A 3VGMA 4I9QA 3V9UA 4PUOA 1M90O 1YT3A 3CCLN 3H08A 1J6ZA 5JLHA 4DV7K 5JLFA 4HWIA 3NF7A 3RVCA 3CFOA 4YOVA 2PZSA 5IT9O 2IDOA 2VWKA 3O3HA 3UE5A 2HHTA 2X74A 1Q81O 2HNYA 3OYBA 3LZJA 4E7LA 3AVIA 1XHZA 3SJHA 3P4IA 1TK0A
chains in the Genus database with same CATH topology
1BHLA 4FLWA 2ZD1A 2G8UA 1IG9A 3ZSZA 3QEVA 1C1BA 1L5UA 1S9GA 1HYZA 3TAPA 1LWCA 3MAQA 4CJRA 2D0AA 2G8WA 1ZBIA 4O44A 4PY5A 3TAEA 2F96A 3MEGA 1JLGA 4IG0A 2O4GA 2RF2A 3CG7A 1IKXA 3RMBA 1WSGA 4ZTFA 4B9VA 4EZ6A 3AVKA 1NKCA 1Q9XA 4CGJA 1JXEA 3SUQA 3K5OA 3P5JA 1Q9YA 2YHAA 4CJUA 3OYHA 1QE1A 4CHNA 1QTMA 2ETJA 3AO4A 1UWBA 1X1PA 4FJGA 1GOCA 1KTQA 1VSIA 3PUFA 4OKKA 1YVUA 4RW9A 1JL2A 1NJWA 4FJIA 4W5OA 3DOKA 1D8YA 3LAMA 4EP5A 4FJLA 2GUIA 3LP0A 3AVJA 4KB0A 3MEEA 3CFPA 3I0SA 5T7BA 1L3TA 5CZ1A 1ASUA 4DG1A 4KPYA 5FRMA 1S1VA 4OGCA 2XY6A 4CF2A 4KTWA 3K59A 4KHNA 3B6OA 1IO2A 2DY4A 3I0RA 3RRHA 3M8PA 1BI4A 2ZQBA 3THVA 1VSFA 3VQDA 4FLVA 1KVCA 3V9WA 4PQUA 3LP3A 3NCIA 4DQSA 3ZSRA 3AO1A 2B6AA 4BDPA 4B9LA 2HNDA 2Y1IA 4FJKA 3V1OA 1T8EA 4AHSA 2G8IA 4B3OA 2YKNA 1VSJA 4FLZA 3VQ4A 4QCLA 1HQEA 1RDBA 1RT3A 3SYZA 2HVIA 3L3VA 2GV9A 3SQ4A 4FJHA 4ELUA 1RTJA 3JSMA 1S5JA 5HRNA 3JYTA 2ITGA 1KLMA 1TV6A 4RW7A 1WSEA 4KTZA 1MU2A 2YKMA 4B8CA 3P1GA 3ZCMA 4CERA 1QQCA 1TKXA 1HQUA 5SZTA 4UQGA 3V81A 1SKWA 3DMJA 1BISA 1RBTA 4Z0UA 2X6SA 1JKHA 4ELTA 1TAQA 1R0AA 3QO9A 3TANA 3LZIA 3ASMA 1G15A 4AHCA 3SQ2A 1RT4A 2XY8A 2IC3A 1DTQA 3B6PA 4CF9A 3OYLA 4E7JA 4DTRA 5HRPA 4OLBA 4MQ3A 3AVMA 1RNHA 1A5VA 4KI4A 1CLQA 2XRIA 2VWJA 3KK2A 3WNFA 3KTQA 4DTOA 2VG6A 4M3WA 1NK6A 3E01A 2YNHA 3P83D 4W5QA 2QK9A 3VQQA 4M3ZA 1VSDA 4C8LA 1J9AA 1Z25A 3OYKA 1WSIA 3NGYA 3KLIA 1C6VA 2ZE2A 3OYIA 1RILA 2VG7A 1W9HA 3K2PA 4I7FA 3OJSA 4DQRA 1S6QA 4CFCA 3DLHA 1S9EA 1BCOA 1JLAA 1FXXA 4Z4EA 3ZSWA 1FK9A 3DM2A 3MXMA 1NKBA 5FRNA 1XHXA 2LSNA 1F21A 3DLKA 4QOZB 1NK7A 2Z1GA 2X78A 3U3YA 1NKEA 2HHVA 3O4NA 4J2EA 1VSHA 4RW6A 3VQ7A 1ZBLA 1RTIA 3SZ2A 3OYNA 4I2QA 1SKRA 4Z4IA 3VQ5A 1C0TA 3BGRA 4JRPA 4K8ZA 1CXUA 1XI1A 3HYFA 3RMAA 1FKOA 1LV5A 3OJUA 1J5OA 4ID5A 3CQ8A 3DLEA 4E1NA 4ZHRA 3SV4A 4YNQA 1TK8A 4LH4A 5C25A 4OVLA 3HPHA 4CHOA 4NCBA 4HVJA 3AA4A 3S3MA 4CIGA 4KRFA 4IDKA 2HHSA 5FROA 1O1WA 4KTQA 2OZSA 1GOAA 4DSKA 3MEDA 4E7IA 4N76A 4DFMA 3LAKA 4FLUA 4LSNA 4HTUA 3QINA 3LP2A 4DS4A 4K8XA 1HPZA 1FKPA 4DQQA 3OYMA 4Q5VA 1JLCA 2BANA 4FYDA 4N56A 4BE1A 5CYQA 1YTUA 2IOCA 4TSXA 3AVCA 4CJ5A 4J2BA 4N5SA 4DFJA 1HRHA 5J2NA 4B9UA 1N5YA 4DSJA 4FJNA 2YNFA 5JS2A 4DTPA 3VQAA 3SUNA 4O55A 3LWMA 3DOLA 1RTHA 4CHPA 2RPIA 5J2QA 3V6DA 1C0MA 1TKDA 1NOYA 1U04A 4AHRA 4FM1A 4F4KA 4C8KA 3HPOA 4CGFA 4HUGA 4DQIA 3L3UA 4GVMA 3V9ZA 1BIUA 3DLGA 3MECA 4CGIA 4CESA 4OKJA 3SJJA 3O3FA 1IKVA 3V1RA 1HJRA 3KD1E 4J2AA 4KV8A 2B5JA 4E3SA 3CM6A 1XC9A 5CY4A 4CGHA 1RBVA 5SWMA 2KW4A 4CEBA 1JLQA 4FM2A 3NDKA 1UOCA 1RT5A 2OZMA 2QXFA 3AA2A 4MFBA 3AVBA 3HT3A 3SUOA 5KGWA 3I8DA 3QEPA 1RDAA 2A1RA 1QSYA 1LW0A 1QHTA 2B4JA 4RG8A 3KD5E 4OGEA 3RMDA 2G8KA 1JXBA 2QKBA 3RWUA 4B9SA 4F8RA 3VQ6A 1U49A 4CEQA 1JLBA 1VSLA 1BQNA 3IAYA 1RT1A 2WONA 3HP9A 2IGIA 4LH5A 1IH7A 4FW1A 4RW8A 4CF8A 3EZ5A 1TAUA 3OYEA 4ID1A 1U48A 4KHUA 3ITHA 4M41A 4DLGA 1EKEA 1WNSA 4FJ9A 2KFNA 4C8MA 3IRXA 3HPGA 1XWLA 3ZSOA 4DF8A 3QLHA 3QNOA 3SQ0A 2DTUA 1C1CA 4DU3A 3V4IA 4OKEA 3PY8A 1WSJA 4CE9A 4FJMA 3VN5A 1SUQA 2QKKA 3SPZA 1RT7A 1TVRA 3AVLA 4BDYA 4DU1A 4DFKA 4J2DA 1VSMA 2WOMA 1NOZA 3HK2A 2D0CA 3L2VA 3ULDA 2EHGA 3T3FA 3TABA 3NF8A 3S3NA 4KO0A 1RT6A 2VG5A 3DI6A 4KHWA 5FDLA 4KREA 3L2RA 2OA8A 3RRGA 3MXIA 4KHYA 4OPKA 1UAXA 2KZZA 3C6TA 4QAGA 1LAWA 5HROA 1CZBA 4DSEA 3KLHA 3PX4A 1QS4A 3LPUA 4BACA 1TKZA 4FJ8A 4E0DA 4CF1A 3SV3A 1RBSA 1JLEA 3HXMA 1KCFA 3LALA 1VRTA 1T05A 3OS0A 4CJVA 2Z1IA 3K5MA 5HRRA 3AVNA 1HMVA 4W5TA 3L2QA 1KSPA 1ITGA 1RBUA 2DFHA 3EY1A 3NGZA 3ZSYA 3VQEA 4M3UA 3SQ1A 1S1UA 1VRUA 3C94A 5HBMA 4CFDA 3ZT3A 4CJLA 4ICLA 4CHZA 4KKOA 3HJFA 3FFIA 3NE6A 3LDSA 1S6PA 2P5OA 5KI6A 1CXQA 2E4LA 5I42A 3ZSVA 1KLNA 4CECA 2YNGA 4R5PA 4O5BA 4XIUA 4HCBA 4IG3A 3WNGA 3AVAA 3O4QA 3KKSA 4CEDA 2IAJA 3OYFA 4JS5A 4M42A 3DRPA 3BDPA 4O4GA 1I3AA 2OPSA 3RTVA 3NAEA 1K6YA 4E7KA 3VQ8A 1VSKA 3HO1A 3L2UA 4CFAA 1KVBA 3NF6A 3HP6A 4NCAA 4CJ4A 2R7YA 1LAVA 4ZTJA 3PX0A 2HHUA 4CEEA 4IBNA 2HVHA 4CF0A 3NFAA 4OJRA 1J54A 3LANA 4FZYA 4HUFA 2P51A 1HYVA 5E41A 3O3GA 3RMCA 5HLFA 4ELVA 3NF9A 5KRSA 4AHUA 3D0PA 2P5GA 1X9MA 3TAFA 1IKWA 3F9KA 4DS5A 1U45A 3KJVA 1SL2A 1C0UA 3KIOA 1L3VA 1WLJA 1QSSA 1NK4A 2PY5A 1NK0A 4DTXA 3PO4A 2D0BA 4C8NA 2Z1JA 4CJKA 3TR8A 1LWFA 4FZXC 1D9FA 4KHQA 3AVFA 2Z1HA 4F2SA 2HNZA 3SUPA 4B9TA 3EYZA 3DYAA 2KFZA 3QIOA 1TL3A 3OYDA 4BE2A 1J53A 1SL0A 4DTSA 1Q8IA 4FCYA 2BGGA 1BCMA 1GOBA 1S1WA 1C1AA 1W0HA 5C42A 3VQBA 5J2PA 2RKIA 2A1SA 4M3XA 2FBVA 1WSHA 4CEOA 1IKYA 3OYCA 4DTJA 1HNIA 5KTQA 1D9DA 4GMJB 4PA1A 4M3RA 4OPJA 3QEXA 4CHQA 3KK1A 5I3UA 4DU4A 4CJFA 3HVRA 3SPYA 2F8SA 3SI6A 1JLFA 3U6FA 3KKRA 4FK4A 3G0ZA 1ASVA 3OYJA 2HHWA 1KFSA 1KRPA 1TKTA 2EX3A 4CJPA 3A2FA 1NK5A 1WN7A 4NYNA 4B08A 4CJ3A 3M8SA 3K5LA 1VSEA 2D5RA 4KAZA 4KHSA 1ZBHA 3CYMA 3V9SA 3AO5A 3HM9A 1L3SA 4M3TA 2OPQA 4DWIA 2I5JA 1U4BA 1Z26A 2YV0X 1NK9A 3VQPA 1BL3A 4B9NA 4EZ9A 1EX4A 4N41A 4B9MA 4KFBA 2GBZA 3T19A 4CIEA 3D45A 2JLEA 3L2WA 3WNEA 1BIZA 4FJJA 2NUBA 1SV5A 4BE0A 1NJYA 2HHQA 3L8BA 3AA3A 4M45A 1TGOA 4JLHA 1REVA 4O0IA 1ASWA 1UA1A 1NK8A 4FK0A 5J2MA 4BWJA 3ZSQA 3C6UA 3PX6A 2PYLA 1S1XA 1S1TA 3ALYA 3AV9A 5EU7A 4CHYA 2O4IA 2YNIA 4LSLA 1KFDA 2Q3SA 4Z4CA 3VA3A 4CJQA 2DFFA 3M8RA 3OY9A 3QNNA 2ATQA 4FLXA 1ZYQA 1N6QA 1BI4B 2E6LA 2OPPA 3QEWA 4C8OA 4OLAA 2HW3A 2FBYA 1HNVA 1EXQA 1BQMA 1JL1A 2IS3A 1A5XA 5DK5A 3DLRA 1RCHA 1ZBFA 3OS2A 4DF4A 1A5WA 3HVTA 4JS4A 4CK1A 4DSFA 2PYJA 2Y1JA 1WAJA 4G1QA 1RDDA 2FBXA 4RW4A 4CCHA 4E19A 1UA0A 4KI6A 4W5RA 3AO2A 4IKFA 2YHBA 3LPTA 3HSTB 4NCGA 1VK0A 3TARA 1U47A 3AO3A 4CGDA 4E89A 3DRRA 1DLOA 4CGGA 3NH1A 1HYSA 2W42A 1RT2A 3IG1A 4HCCA 3K57A 3NH2A 4H4MA 1ZBUA 3ISNC 1SKSA 3QEIA 3LWLA 3U3GA 2RN2A 4IFVA 3DRSA 4DQPA 3WNHA 3AA5X 1CZ9A 3AVHA 3PO5A 3CFRA 4HHTA 2KQ2A 3V9XA 5C24A 1QSLA 3NGIA 4E7HA 4CIFA 3RR7A 4CJTA 2G8HA 4B8AB 4DLEA 4FJXA 1BGXT 4E1MA 3HL8A 4GW6A 1B92A 1TK5A 2G8VA 3KLGA 2XHBA 3RR8A 4CJWA 2G8FA 4FVMA 3PV8A 2P1JA 3NBPA 3NH0A 3TWHA 3LP1A 2OYQA 2KTQA 3K58A 4DTUA 1DTTA 1RDCA 3K5NA 4BDZA 4FLYA 3QERA 3KLEA 4H8KA 1EP4A 4N47A 4CK3A 3S3OA 4DTMA 1X9WA 2E6MA 4FW2A 4LY7A 3V1QA 1NJZA 4IFYA 4KB1A 4Z4FA 2FC0A 4WE1A 2AJQA 4FLTA 4CEFA 3QETA 3KLFA 3QESA 4Z4GA 2FBTA 1RBRA 4Q0BA 5J1EA 2OPRA 3CM5A 4NYFA 1B9DA 4DFPA 4CK2A 4JRQA 4I2PA 4F3TA 3F73A 4FXDA 1NJXA 4AHVA 3OVNA 3VQ9A 4PWDA 2BE2A 3TI0A 1B9FA 3AVGA 4W5NA 2DFEA 4F3OA 4YFUA 3VQCA 1I39A 3MXJA 5KGXA 3TAMA 4FM0A 3UIQA 1Y97A 4Z4HA 2BDPA 4H4OA 4CEAA 3ZT0A 5HP1A 1L3UA 2JGUA 3S9HA 3OYGA 3SNNA 3SCXA 2F8TA 4M3YA 4DMNA 3G10A 2HMIA 3OYAA 4EP4A 3NHGA 4L8RB 3OS1A 1KVAA 2XY5A 2XY7A 2HHXA 2KZMA 4O0JA 4DSLA 4BWMA 5KRTA 3KK3A 4DSIA 1EETA 2X6NA 4AHTA 4CJSA 4CFBA 1T7PA 5D3GA 1TL1A 5K14A 1YTAA 4I9QA 3V9UA 4Y1CA 3QIPA 4PUOA 1WAFA 4Y1DA 1LWEA 3T1AA 1T03A 3TAGA 3ZT2A 5HRSA 3ZT1A 1X9SA 1YT3A 3ZT4A 3H08A 1LW2A 4AH9A 3NF7A 4FJ7A 3CFOA 5CZ2A 4AILC 2PZSA 4CEZA 3TAQA 1WSFA 4FZZA 2IDOA 2VWKA 3VA0A 5JS1A 3M8QA 1RTDA 3O3HA 2HB5A 3IS9A 4HUEA 4DTNA 1SL1A 5CYMA 3DLBA 4F2RA 2X74A 4LD0A 3ZSXA 5DMRA 2XO7A 2HHTA 2HNYA 3OYBA 3LZJA 4E7LA 1D5AA 3AVIA 4I9LA 4CJEA 1XHZA 4FK2A 4FJ5A 1TK0A 3C95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHL A;  4FLW A;  2ZD1 A;  2G8U A;  1IG9 A;  3ZSZ A;  3QEV A;  1C1B A;  1L5U A;  1S9G A;  1HYZ A;  3TAP A;  1LWC A;  3MAQ A;  4CJR A;  2D0A A;  2G8W A;  1ZBI A;  4O44 A;  4PY5 A;  3TAE A;  2F96 A;  3MEG A;  1JLG A;  4IG0 A;  2O4G A;  2RF2 A;  3CG7 A;  1IKX A;  3RMB A;  1WSG A;  4ZTF A;  4B9V A;  4EZ6 A;  3AVK A;  1NKC A;  1Q9X A;  4CGJ A;  1JXE A;  3SUQ A;  3K5O A;  3P5J A;  1Q9Y A;  2YHA A;  4CJU A;  3OYH A;  1QE1 A;  4CHN A;  1QTM A;  2ETJ A;  3AO4 A;  1UWB A;  1X1P A;  4FJG A;  1GOC A;  1KTQ A;  1VSI A;  3PUF A;  4OKK A;  1YVU A;  4RW9 A;  1JL2 A;  1NJW A;  4FJI A;  4W5O A;  3DOK A;  1D8Y A;  3LAM A;  4EP5 A;  4FJL A;  2GUI A;  3LP0 A;  3AVJ A;  4KB0 A;  3MEE A;  3CFP A;  3I0S A;  5T7B A;  1L3T A;  5CZ1 A;  1ASU A;  4DG1 A;  4KPY A;  5FRM A;  1S1V A;  4OGC A;  2XY6 A;  4CF2 A;  4KTW A;  3K59 A;  4KHN A;  3B6O A;  1IO2 A;  2DY4 A;  3I0R A;  3RRH A;  3M8P A;  1BI4 A;  2ZQB A;  3THV A;  1VSF A;  3VQD A;  4FLV A;  1KVC A;  3V9W A;  4PQU A;  3LP3 A;  3NCI A;  4DQS A;  3ZSR A;  3AO1 A;  2B6A A;  4BDP A;  4B9L A;  2HND A;  2Y1I A;  4FJK A;  3V1O A;  1T8E A;  4AHS A;  2G8I A;  4B3O A;  2YKN A;  1VSJ A;  4FLZ A;  3VQ4 A;  4QCL A;  1HQE A;  1RDB A;  1RT3 A;  3SYZ A;  2HVI A;  3L3V A;  2GV9 A;  3SQ4 A;  4FJH A;  4ELU A;  1RTJ A;  3JSM A;  1S5J A;  5HRN A;  3JYT A;  2ITG A;  1KLM A;  1TV6 A;  4RW7 A;  1WSE A;  4KTZ A;  1MU2 A;  2YKM A;  4B8C A;  3P1G A;  3ZCM A;  4CER A;  1QQC A;  1TKX A;  1HQU A;  5SZT A;  4UQG A;  3V81 A;  1SKW A;  3DMJ A;  1BIS A;  1RBT A;  4Z0U A;  2X6S A;  1JKH A;  4ELT A;  1TAQ A;  1R0A A;  3QO9 A;  3TAN A;  3LZI A;  3ASM A;  1G15 A;  4AHC A;  3SQ2 A;  1RT4 A;  2XY8 A;  2IC3 A;  1DTQ A;  3B6P A;  4CF9 A;  3OYL A;  4E7J A;  4DTR A;  5HRP A;  4OLB A;  4MQ3 A;  3AVM A;  1RNH A;  1A5V A;  4KI4 A;  1CLQ A;  2XRI A;  2VWJ A;  3KK2 A;  3WNF A;  3KTQ A;  4DTO A;  2VG6 A;  4M3W A;  1NK6 A;  3E01 A;  2YNH A;  3P83 D;  4W5Q A;  2QK9 A;  3VQQ A;  4M3Z A;  1VSD A;  4C8L A;  1J9A A;  1Z25 A;  3OYK A;  1WSI A;  3NGY A;  3KLI A;  1C6V A;  2ZE2 A;  3OYI A;  1RIL A;  2VG7 A;  1W9H A;  3K2P A;  4I7F A;  3OJS A;  4DQR A;  1S6Q A;  4CFC A;  3DLH A;  1S9E A;  1BCO A;  1JLA A;  1FXX A;  4Z4E A;  3ZSW A;  1FK9 A;  3DM2 A;  3MXM A;  1NKB A;  5FRN A;  1XHX A;  2LSN A;  1F21 A;  3DLK A;  4QOZ B;  1NK7 A;  2Z1G A;  2X78 A;  3U3Y A;  1NKE A;  2HHV A;  3O4N A;  4J2E A;  1VSH A;  4RW6 A;  3VQ7 A;  1ZBL A;  1RTI A;  3SZ2 A;  3OYN A;  4I2Q A;  1SKR A;  4Z4I A;  3VQ5 A;  1C0T A;  3BGR A;  4JRP A;  4K8Z A;  1CXU A;  1XI1 A;  3HYF A;  3RMA A;  1FKO A;  1LV5 A;  3OJU A;  1J5O A;  4ID5 A;  3CQ8 A;  3DLE A;  4E1N A;  4ZHR A;  3SV4 A;  4YNQ A;  1TK8 A;  4LH4 A;  5C25 A;  4OVL A;  3HPH A;  4CHO A;  4NCB A;  4HVJ A;  3AA4 A;  3S3M A;  4CIG A;  4KRF A;  4IDK A;  2HHS A;  5FRO A;  1O1W A;  4KTQ A;  2OZS A;  1GOA A;  4DSK A;  3MED A;  4E7I A;  4N76 A;  4DFM A;  3LAK A;  4FLU A;  4LSN A;  4HTU A;  3QIN A;  3LP2 A;  4DS4 A;  4K8X A;  1HPZ A;  1FKP A;  4DQQ A;  3OYM A;  4Q5V A;  1JLC A;  2BAN A;  4FYD A;  4N56 A;  4BE1 A;  5CYQ A;  1YTU A;  2IOC A;  4TSX A;  3AVC A;  4CJ5 A;  4J2B A;  4N5S A;  4DFJ A;  1HRH A;  5J2N A;  4B9U A;  1N5Y A;  4DSJ A;  4FJN A;  2YNF A;  5JS2 A;  4DTP A;  3VQA A;  3SUN A;  4O55 A;  3LWM A;  3DOL A;  1RTH A;  4CHP A;  2RPI A;  5J2Q A;  3V6D A;  1C0M A;  1TKD A;  1NOY A;  1U04 A;  4AHR A;  4FM1 A;  4F4K A;  4C8K A;  3HPO A;  4CGF A;  4HUG A;  4DQI A;  3L3U A;  4GVM A;  3V9Z A;  1BIU A;  3DLG A;  3MEC A;  4CGI A;  4CES A;  4OKJ A;  3SJJ A;  3O3F A;  1IKV A;  3V1R A;  1HJR A;  3KD1 E;  4J2A A;  4KV8 A;  2B5J A;  4E3S A;  3CM6 A;  1XC9 A;  5CY4 A;  4CGH A;  1RBV A;  5SWM A;  2KW4 A;  4CEB A;  1JLQ A;  4FM2 A;  3NDK A;  1UOC A;  1RT5 A;  2OZM A;  2QXF A;  3AA2 A;  4MFB A;  3AVB A;  3HT3 A;  3SUO A;  5KGW A;  3I8D A;  3QEP A;  1RDA A;  2A1R A;  1QSY A;  1LW0 A;  1QHT A;  2B4J A;  4RG8 A;  3KD5 E;  4OGE A;  3RMD A;  2G8K A;  1JXB A;  2QKB A;  3RWU A;  4B9S A;  4F8R A;  3VQ6 A;  1U49 A;  4CEQ A;  1JLB A;  1VSL A;  1BQN A;  3IAY A;  1RT1 A;  2WON A;  3HP9 A;  2IGI A;  4LH5 A;  1IH7 A;  4FW1 A;  4RW8 A;  4CF8 A;  3EZ5 A;  1TAU A;  3OYE A;  4ID1 A;  1U48 A;  4KHU A;  3ITH A;  4M41 A;  4DLG A;  1EKE A;  1WNS A;  4FJ9 A;  2KFN A;  4C8M A;  3IRX A;  3HPG A;  1XWL A;  3ZSO A;  4DF8 A;  3QLH A;  3QNO A;  3SQ0 A;  2DTU A;  1C1C A;  4DU3 A;  3V4I A;  4OKE A;  3PY8 A;  1WSJ A;  4CE9 A;  4FJM A;  3VN5 A;  1SUQ A;  2QKK A;  3SPZ A;  1RT7 A;  1TVR A;  3AVL A;  4BDY A;  4DU1 A;  4DFK A;  4J2D A;  1VSM A;  2WOM A;  1NOZ A;  3HK2 A;  2D0C A;  3L2V A;  3ULD A;  2EHG A;  3T3F A;  3TAB A;  3NF8 A;  3S3N A;  4KO0 A;  1RT6 A;  2VG5 A;  3DI6 A;  4KHW A;  5FDL A;  4KRE A;  3L2R A;  2OA8 A;  3RRG A;  3MXI A;  4KHY A;  4OPK A;  1UAX A;  2KZZ A;  3C6T A;  4QAG A;  1LAW A;  5HRO A;  1CZB A;  4DSE A;  3KLH A;  3PX4 A;  1QS4 A;  3LPU A;  4BAC A;  1TKZ A;  4FJ8 A;  4E0D A;  4CF1 A;  3SV3 A;  1RBS A;  1JLE A;  3HXM A;  1KCF A;  3LAL A;  1VRT A;  1T05 A;  3OS0 A;  4CJV A;  2Z1I A;  3K5M A;  5HRR A;  3AVN A;  1HMV A;  4W5T A;  3L2Q A;  1KSP A;  1ITG A;  1RBU A;  2DFH A;  3EY1 A;  3NGZ A;  3ZSY A;  3VQE A;  4M3U A;  3SQ1 A;  1S1U A;  1VRU A;  3C94 A;  5HBM A;  4CFD A;  3ZT3 A;  4CJL A;  4ICL A;  4CHZ A;  4KKO A;  3HJF A;  3FFI A;  3NE6 A;  3LDS A;  1S6P A;  2P5O A;  5KI6 A;  1CXQ A;  2E4L A;  5I42 A;  3ZSV A;  1KLN A;  4CEC A;  2YNG A;  4R5P A;  4O5B A;  4XIU A;  4HCB A;  4IG3 A;  3WNG A;  3AVA A;  3O4Q A;  3KKS A;  4CED A;  2IAJ A;  3OYF A;  4JS5 A;  4M42 A;  3DRP A;  3BDP A;  4O4G A;  1I3A A;  2OPS A;  3RTV A;  3NAE A;  1K6Y A;  4E7K A;  3VQ8 A;  1VSK A;  3HO1 A;  3L2U A;  4CFA A;  1KVB A;  3NF6 A;  3HP6 A;  4NCA A;  4CJ4 A;  2R7Y A;  1LAV A;  4ZTJ A;  3PX0 A;  2HHU A;  4CEE A;  4IBN A;  2HVH A;  4CF0 A;  3NFA A;  4OJR A;  1J54 A;  3LAN A;  4FZY A;  4HUF A;  2P51 A;  1HYV A;  5E41 A;  3O3G A;  3RMC A;  5HLF A;  4ELV A;  3NF9 A;  5KRS A;  4AHU A;  3D0P A;  2P5G A;  1X9M A;  3TAF A;  1IKW A;  3F9K A;  4DS5 A;  1U45 A;  3KJV A;  1SL2 A;  1C0U A;  3KIO A;  1L3V A;  1WLJ A;  1QSS A;  1NK4 A;  2PY5 A;  1NK0 A;  4DTX A;  3PO4 A;  2D0B A;  4C8N A;  2Z1J A;  4CJK A;  3TR8 A;  1LWF A;  4FZX C;  1D9F A;  4KHQ A;  3AVF A;  2Z1H A;  4F2S A;  2HNZ A;  3SUP A;  4B9T A;  3EYZ A;  3DYA A;  2KFZ A;  3QIO A;  1TL3 A;  3OYD A;  4BE2 A;  1J53 A;  1SL0 A;  4DTS A;  1Q8I A;  4FCY A;  2BGG A;  1BCM A;  1GOB A;  1S1W A;  1C1A A;  1W0H A;  5C42 A;  3VQB A;  5J2P A;  2RKI A;  2A1S A;  4M3X A;  2FBV A;  1WSH A;  4CEO A;  1IKY A;  3OYC A;  4DTJ A;  1HNI A;  5KTQ A;  1D9D A;  4GMJ B;  4PA1 A;  4M3R A;  4OPJ A;  3QEX A;  4CHQ A;  3KK1 A;  5I3U A;  4DU4 A;  4CJF A;  3HVR A;  3SPY A;  2F8S A;  3SI6 A;  1JLF A;  3U6F A;  3KKR A;  4FK4 A;  3G0Z A;  1ASV A;  3OYJ A;  2HHW A;  1KFS A;  1KRP A;  1TKT A;  2EX3 A;  4CJP A;  3A2F A;  1NK5 A;  1WN7 A;  4NYN A;  4B08 A;  4CJ3 A;  3M8S A;  3K5L A;  1VSE A;  2D5R A;  4KAZ A;  4KHS A;  1ZBH A;  3CYM A;  3V9S A;  3AO5 A;  3HM9 A;  1L3S A;  4M3T A;  2OPQ A;  4DWI A;  2I5J A;  1U4B A;  1Z26 A;  2YV0 X;  1NK9 A;  3VQP A;  1BL3 A;  4B9N A;  4EZ9 A;  1EX4 A;  4N41 A;  4B9M A;  4KFB A;  2GBZ A;  3T19 A;  4CIE A;  3D45 A;  2JLE A;  3L2W A;  3WNE A;  1BIZ A;  4FJJ A;  2NUB A;  1SV5 A;  4BE0 A;  1NJY A;  2HHQ A;  3L8B A;  3AA3 A;  4M45 A;  1TGO A;  4JLH A;  1REV A;  4O0I A;  1ASW A;  1UA1 A;  1NK8 A;  4FK0 A;  5J2M A;  4BWJ A;  3ZSQ A;  3C6U A;  3PX6 A;  2PYL A;  1S1X A;  1S1T A;  3ALY A;  3AV9 A;  5EU7 A;  4CHY A;  2O4I A;  2YNI A;  4LSL A;  1KFD A;  2Q3S A;  4Z4C A;  3VA3 A;  4CJQ A;  2DFF A;  3M8R A;  3OY9 A;  3QNN A;  2ATQ A;  4FLX A;  1ZYQ A;  1N6Q A;  1BI4 B;  2E6L A;  2OPP A;  3QEW A;  4C8O A;  4OLA A;  2HW3 A;  2FBY A;  1HNV A;  1EXQ A;  1BQM A;  1JL1 A;  2IS3 A;  1A5X A;  5DK5 A;  3DLR A;  1RCH A;  1ZBF A;  3OS2 A;  4DF4 A;  1A5W A;  3HVT A;  4JS4 A;  4CK1 A;  4DSF A;  2PYJ A;  2Y1J A;  1WAJ A;  4G1Q A;  1RDD A;  2FBX A;  4RW4 A;  4CCH A;  4E19 A;  1UA0 A;  4KI6 A;  4W5R A;  3AO2 A;  4IKF A;  2YHB A;  3LPT A;  3HST B;  4NCG A;  1VK0 A;  3TAR A;  1U47 A;  3AO3 A;  4CGD A;  4E89 A;  3DRR A;  1DLO A;  4CGG A;  3NH1 A;  1HYS A;  2W42 A;  1RT2 A;  3IG1 A;  4HCC A;  3K57 A;  3NH2 A;  4H4M A;  1ZBU A;  3ISN C;  1SKS A;  3QEI A;  3LWL A;  3U3G A;  2RN2 A;  4IFV A;  3DRS A;  4DQP A;  3WNH A;  3AA5 X;  1CZ9 A;  3AVH A;  3PO5 A;  3CFR A;  4HHT A;  2KQ2 A;  3V9X A;  5C24 A;  1QSL A;  3NGI A;  4E7H A;  4CIF A;  3RR7 A;  4CJT A;  2G8H A;  4B8A B;  4DLE A;  4FJX A;  1BGX T;  4E1M A;  3HL8 A;  4GW6 A;  1B92 A;  1TK5 A;  2G8V A;  3KLG A;  2XHB A;  3RR8 A;  4CJW A;  2G8F A;  4FVM A;  3PV8 A;  2P1J A;  3NBP A;  3NH0 A;  3TWH A;  3LP1 A;  2OYQ A;  2KTQ A;  3K58 A;  4DTU A;  1DTT A;  1RDC A;  3K5N A;  4BDZ A;  4FLY A;  3QER A;  3KLE A;  4H8K A;  1EP4 A;  4N47 A;  4CK3 A;  3S3O A;  4DTM A;  1X9W A;  2E6M A;  4FW2 A;  4LY7 A;  3V1Q A;  1NJZ A;  4IFY A;  4KB1 A;  4Z4F A;  2FC0 A;  4WE1 A;  2AJQ A;  4FLT A;  4CEF A;  3QET A;  3KLF A;  3QES A;  4Z4G A;  2FBT A;  1RBR A;  4Q0B A;  5J1E A;  2OPR A;  3CM5 A;  4NYF A;  1B9D A;  4DFP A;  4CK2 A;  4JRQ A;  4I2P A;  4F3T A;  3F73 A;  4FXD A;  1NJX A;  4AHV A;  3OVN A;  3VQ9 A;  4PWD A;  2BE2 A;  3TI0 A;  1B9F A;  3AVG A;  4W5N A;  2DFE A;  4F3O A;  4YFU A;  3VQC A;  1I39 A;  3MXJ A;  5KGX A;  3TAM A;  4FM0 A;  3UIQ A;  1Y97 A;  4Z4H A;  2BDP A;  4H4O A;  4CEA A;  3ZT0 A;  5HP1 A;  1L3U A;  2JGU A;  3S9H A;  3OYG A;  3SNN A;  3SCX A;  2F8T A;  4M3Y A;  4DMN A;  3G10 A;  2HMI A;  3OYA A;  4EP4 A;  3NHG A;  4L8R B;  3OS1 A;  1KVA A;  2XY5 A;  2XY7 A;  2HHX A;  2KZM A;  4O0J A;  4DSL A;  4BWM A;  5KRT A;  3KK3 A;  4DSI A;  1EET A;  2X6N A;  4AHT A;  4CJS A;  4CFB A;  1T7P A;  5D3G A;  1TL1 A;  5K14 A;  1YTA A;  4I9Q A;  3V9U A;  4Y1C A;  3QIP A;  4PUO A;  1WAF A;  4Y1D A;  1LWE A;  3T1A A;  1T03 A;  3TAG A;  3ZT2 A;  5HRS A;  3ZT1 A;  1X9S A;  1YT3 A;  3ZT4 A;  3H08 A;  1LW2 A;  4AH9 A;  3NF7 A;  4FJ7 A;  3CFO A;  5CZ2 A;  4AIL C;  2PZS A;  4CEZ A;  3TAQ A;  1WSF A;  4FZZ A;  2IDO A;  2VWK A;  3VA0 A;  5JS1 A;  3M8Q A;  1RTD A;  3O3H A;  2HB5 A;  3IS9 A;  4HUE A;  4DTN A;  1SL1 A;  5CYM A;  3DLB A;  4F2R A;  2X74 A;  4LD0 A;  3ZSX A;  5DMR A;  2XO7 A;  2HHT A;  2HNY A;  3OYB A;  3LZJ A;  4E7L A;  1D5A A;  3AVI A;  4I9L A;  4CJE A;  1XHZ A;  4FK2 A;  4FJ5 A;  1TK0 A;  3C95 A; 
#chains in the Genus database with same CATH topology
 1FJG K;  2ZD1 A;  4IWV A;  1HYZ A;  1ZBI A;  4JYA K;  4CJR A;  4ILH A;  4O44 A;  3C65 A;  3MEG A;  3CG7 A;  1WSG A;  4B9V A;  2P9P B;  3SUQ A;  3LM9 A;  3K5O A;  2W6L A;  3L4Q A;  4JI0 K;  4CJU A;  3TTF A;  3QB0 A;  1QVG M;  2ETJ A;  3AO4 A;  2UUC K;  1KTQ A;  4OKK A;  1NJW A;  4W5O A;  1V4T A;  3LAM A;  2GUI A;  3AVJ A;  4KB0 A;  5T7B A;  5GAG P;  1XNQ K;  3ZET B;  3N4P A;  2XY6 A;  4KTW A;  3K59 A;  4LF4 K;  4KHN A;  3B6O A;  2NRT A;  1BI4 A;  2ZQB A;  3THV A;  5M1F A;  3FZL A;  3PLA A;  2P9U A;  3LP3 A;  1WOQ A;  2B6A A;  2HND A;  4BRK A;  5EXW A;  4FJK A;  2NLX A;  4GV9 A;  2YKN A;  1HQE A;  3SYZ A;  3L3V A;  1RTJ A;  2F9W A;  1OH7 A;  1TV6 A;  4RW7 A;  5LJW A;  3DLL L;  3QBW A;  3P1G A;  5SZT A;  1QQC A;  4YHH K;  1WBB A;  4UQG A;  2X6S A;  1DT9 A;  1JKH A;  4ELT A;  4CZI A;  4JN4 A;  1RDU A;  2IIR A;  4AHC A;  2NRR A;  4E7J A;  2IC3 A;  1DTQ A;  3SK3 A;  1A5V A;  2XRI A;  3WNF A;  2WFB A;  3BZC A;  3P83 D;  2QK9 A;  3VQQ A;  1QVF M;  4ISF A;  1J9A A;  1Z25 A;  3CQX A;  3L0Q A;  1C6V A;  3KWI A;  3LL3 A;  3W0L A;  1RIL A;  1G99 A;  4BR0 A;  1BCO A;  1JLA A;  4MDB A;  4FWL A;  1FK9 A;  3O4W A;  2Q36 A;  4JK8 A;  4BR5 A;  2A41 A;  1NKE A;  2HHV A;  3O4N A;  3C7N B;  3O80 A;  1WB9 A;  3OYN A;  1ZC6 A;  4I2Q A;  3EKU A;  4JD2 B;  1C0T A;  3CCQ N;  3U9D A;  1OH6 A;  4ZHR A;  5IWA K;  1T6C A;  3H1V X;  2NRZ A;  3Q7B A;  3EEQ A;  1TUU A;  3O6W A;  4IDK A;  3SMP A;  4GKK K;  2OZS A;  5F2R A;  4I6M B;  3LAK A;  4KBO A;  3A8Y A;  4LSN A;  3EKS A;  1T3V A;  5LMU K;  3D6R A;  1NNE A;  1FKP A;  4DQQ A;  3OYM A;  2BAN A;  3L4I A;  4BE1 A;  2IOC A;  4CJ5 A;  4J2B A;  5JS2 A;  4CBW A;  1RTH A;  2QWP A;  1U04 A;  5KPR A;  4DQI A;  3SAF A;  5AQH A;  2VQE K;  3CC7 N;  3DLG A;  4A5B A;  4CES A;  4OKJ A;  3O3F A;  5F0X A;  1VQ6 N;  1NJI O;  4J2A A;  1XC9 A;  4CGH A;  3G6E N;  1RBV A;  1YUW A;  1NGE A;  3NDK A;  1UOC A;  1RT5 A;  2E2P A;  2QXF A;  3AA2 A;  3AVB A;  4FVU A;  5TKY A;  1LW0 A;  3CIP A;  2Q0R A;  3RMD A;  1HKG A;  1JXB A;  2QKB A;  1Q18 A;  1HX1 A;  4B9S A;  3VQ6 A;  1JLB A;  1VSL A;  2AA4 A;  3HP9 A;  3FE1 A;  3CJA A;  4LH5 A;  1IH7 A;  5GIP A;  2ZWH A;  2ASM A;  3OYE A;  3ITH A;  4PKH A;  3IRX A;  3FGU A;  3HPG A;  3VTH A;  4DF8 A;  3QNO A;  3SQ0 A;  4JV5 K;  2QWM A;  4OKE A;  4FJM A;  5MLC Q;  3AAQ A;  5AQQ A;  1BDG A;  3JXU A;  4JKE A;  4BDY A;  4J2D A;  1XQS C;  1TYQ A;  2D0C A;  3T3F A;  1MDU B;  1EQY A;  1OVY A;  4KO0 A;  4KRE A;  2OA8 A;  4QAG A;  5JVG L;  3A5N C;  2CH5 A;  3HI0 A;  3PX4 A;  4FJ8 A;  3CCU N;  4BC5 A;  4E0D A;  3BZK A;  3SV3 A;  5ADX H;  1T05 A;  3HSC A;  3OS0 A;  1HNZ K;  1KAX A;  2IVN A;  4DR1 K;  2YCH A;  3FZF A;  1KSP A;  3VMF B;  1RBU A;  5I9E B;  3GG4 A;  3VQE A;  4CFD A;  1VRU A;  3CJ9 A;  2P9S B;  4ICL A;  4KKO A;  3LDS A;  1S6P A;  1CXQ A;  3QFU A;  3CCM N;  5AQR A;  2YNG A;  4FPA A;  4IG3 A;  4CED A;  4JS5 A;  3DRP A;  3E9P A;  3BDP A;  3RTV A;  3NAE A;  1XNR K;  3VQ8 A;  1HR0 K;  1KVB A;  4NLC A;  4BY9 C;  2F9T A;  4NCA A;  2HVH A;  4IBN A;  4CF0 A;  1MWM A;  3LAN A;  5BPL A;  4X62 K;  3O3G A;  3RMC A;  5C12 A;  4U7B A;  5KRS A;  1X9M A;  3TAF A;  1IKW A;  3CC4 N;  5AZJ A;  4BRA A;  5FPD A;  4CJK A;  5GAE P;  4FWO A;  4KHQ A;  4F2S A;  4LFC K;  3WXM B;  3OYD A;  2BGG A;  2ZJQ L;  4FCY A;  4DTS A;  5JIC A;  1C1A A;  1S3X A;  2RKI A;  2GUP A;  1IG8 A;  3A5L C;  3OTO K;  1DGK N;  3OYC A;  3ID6 A;  1MWK A;  4PA1 A;  2NRX A;  3SPY A;  1N33 K;  1QZ5 A;  4LF6 K;  3U6F A;  3GDQ A;  2HHW A;  4QS9 A;  3H3O B;  1TKT A;  1KFS A;  1KRP A;  3A2F A;  3H1Q A;  4BRI A;  4B08 A;  1VSE A;  1S72 N;  1E4G T;  3HM9 A;  1YI2 N;  3SAG A;  1JCF A;  4DWI A;  2I5J A;  3OBY A;  2O8E A;  4EZ9 A;  3H46 O;  5AQJ A;  2JWK A;  3AGR A;  3D45 A;  2JLE A;  3N4Q A;  3IMX A;  4AM6 A;  3DAW A;  4JLH A;  1ASW A;  3BEX A;  3O9S A;  4BWJ A;  1U6Z A;  2PYL A;  5BN9 A;  3ALY A;  2O4I A;  2YNI A;  1VQ5 N;  3VA3 A;  4FSV A;  4M42 A;  3T1H K;  4IO8 A;  3MN5 A;  4IXC A;  1HNV A;  1JL1 A;  2IS3 A;  5DK5 A;  4DF4 A;  1ZBF A;  1YJN N;  4BRG A;  1Q82 O;  2Y1J A;  4DKW A;  4G1Q A;  2PYJ A;  4RW4 A;  3ENH A;  1UA0 A;  4BRN A;  3TAR A;  4WQ4 C;  3AO3 A;  4JI4 K;  4H0P A;  1HYS A;  1O13 A;  2W42 A;  3IG1 A;  3HBT A;  5DM7 L;  3S41 A;  3ISN C;  5LJV A;  2RN2 A;  4IFV A;  5BR8 K;  3THW B;  3WNH A;  1LOT B;  3AA5 X;  1CZ9 A;  1EO1 A;  3MWP A;  4M7Y A;  3AVH A;  3D2F A;  5C24 A;  4L3Q A;  4B8A B;  5TKW A;  4GW6 A;  1I94 K;  3ID8 A;  5JMV A;  5CE3 A;  3LDO A;  4FWK A;  3PV8 A;  3NBP A;  3NH0 A;  3TWH A;  2KTQ A;  2P9K A;  3AGK A;  1K8K B;  3R1X A;  2WC9 A;  3KLE A;  4N47 A;  4FLY A;  1SQK A;  3A5M C;  4LY7 A;  1NJZ A;  2NNW A;  3C6A A;  4IFY A;  4YDU C;  4CEF A;  4J8F A;  3QET A;  3CM5 A;  1HPM A;  4DFP A;  1YVN A;  3CD6 N;  3ZX3 A;  4AHV A;  3OVN A;  3U4L A;  3M1F A;  3TI0 A;  1GLE G;  2DFE A;  2IVP A;  3VQC A;  2P9N B;  5BRH A;  1NGF A;  3TAM A;  4FM0 A;  3UIQ A;  3VER A;  4Z4H A;  1NWK A;  3VEN A;  4DMN A;  3G10 A;  2XY7 A;  4OPH A;  4DSL A;  3KK3 A;  4XEI A;  5D3G A;  3NVK A;  4FOE A;  4WQ4 A;  3IDH A;  4Y1C A;  1WAF A;  4ISE A;  3TAG A;  3ZT2 A;  5HRS A;  4JK7 A;  4IEI A;  5EOY A;  3ZT1 A;  4AH9 A;  1KAY A;  5CZ2 A;  1IJJ A;  3TAQ A;  1WSF A;  4CI6 A;  3O9U A;  3M8Q A;  1VHX A;  1RTD A;  1R59 O;  4HUE A;  4DTN A;  4BR2 A;  3DLB A;  3ZSX A;  2XO7 A;  2ZGY A;  1QZ6 A;  2E2N A;  1D5A A;  3E9O A;  3UKU A;  5BN8 A;  4FJ5 A;  1Q7Y O;  3D7E O;  3C95 A;  2P9I A;  1BHL A;  4FLW A;  1MA9 B;  3THY A;  3ZSZ A;  1L5U A;  3MAQ A;  2G8W A;  3E66 A;  4IG0 A;  3RWU A;  1V4S A;  2O4G A;  4M3X A;  1IKX A;  4EZ6 A;  4JI5 K;  4B3S K;  1NKC A;  1JXE A;  2YHA A;  3OYH A;  2PAV A;  4CHN A;  1UWB A;  1VSI A;  1YAG A;  1JL2 A;  1VQ9 N;  3GBT A;  3LP0 A;  1L3T A;  2O8C B;  1NU0 A;  4BG9 A;  4EIA A;  4Y0W A;  5FRM A;  1S1V A;  2W6K A;  4CF2 A;  2V7Z A;  2A42 A;  4FWM A;  3T1Y K;  3CF5 L;  3ENO A;  4PQU A;  3AO1 A;  4BDP A;  1N36 K;  2JWL A;  2Y1I A;  4JKH A;  2G8I A;  4K43 A;  3VQ4 A;  3TU5 A;  1RT3 A;  1S5J A;  1E3M A;  5HRN A;  3JYT A;  1VQM N;  1NM1 A;  3R8E A;  2NZT A;  4JKA A;  2YKM A;  4B8C A;  2CH6 A;  3L6Q A;  1TKX A;  1HQU A;  4LF8 K;  1BIS A;  4Z0U A;  3MWT A;  3H6E A;  1G15 A;  3SQ2 A;  4OLB A;  3OYL A;  4MQ3 A;  4KI4 A;  2VWJ A;  3WQT A;  3KTQ A;  4M3W A;  1NK6 A;  3E01 A;  4H5V A;  4XH4 A;  4JI2 K;  4M3Z A;  1WSI A;  3NGY A;  2QTD A;  3CMA N;  4K0K K;  3AAP A;  2VG7 A;  4YOT A;  2EWS A;  1W9H A;  3K2P A;  4I7F A;  4DQR A;  3UKR A;  4CFC A;  3DLH A;  1FXX A;  3SMS A;  4FL9 A;  3MXM A;  1YXQ A;  2YHX A;  3O1B A;  4CW7 B;  4QOZ B;  1NK7 A;  1BO5 O;  4J2E A;  3FR0 A;  3VQ7 A;  1XC3 A;  1CZA N;  1RTI A;  3SZ2 A;  3I8B A;  3O9Q A;  1DKG D;  1SKR A;  3BGR A;  2UXD K;  1CXU A;  1XI1 A;  3FZH A;  3CCE N;  1FKO A;  1J5O A;  4ID5 A;  2OCE A;  5GIO A;  4LH4 A;  3HPH A;  4X66 K;  4HVJ A;  3AA4 A;  1NGJ A;  2VGM A;  1GOA A;  1M1K O;  3MED A;  1XMQ K;  3QIN A;  4DS4 A;  5M1Q A;  4MLH A;  1JLC A;  4DV2 K;  4FYD A;  1GLC G;  4MO4 A;  5CYQ A;  2HF3 A;  2FF3 B;  3AVC A;  4QS7 A;  3A5O C;  2O8F A;  1N5Y A;  4DSJ A;  3F2K A;  4YOY A;  3SUN A;  4CHP A;  5J2Q A;  2RPI A;  4F4K A;  1HLU A;  2YI1 A;  3L3U A;  3MEC A;  1IKV A;  3B8A X;  1HJR A;  3CQY A;  3KD1 E;  4E3S A;  4DV1 K;  5SWM A;  1JLQ A;  3QEP A;  3VEZ A;  3HT3 A;  3HM8 A;  2A1R A;  2ASP A;  4CZL A;  1QSY A;  2I7N A;  2B4J A;  5LMN K;  4JI7 K;  2BUP A;  4OGE A;  3MN6 A;  2P9P A;  1U49 A;  4CEQ A;  1OH8 A;  3IAY A;  1RT1 A;  2WON A;  3TTD A;  1N32 K;  1P90 A;  3IUC A;  5AQO A;  4RTF D;  4B3M K;  4ID1 A;  4M41 A;  1WNS A;  2UXC K;  4JK9 A;  4WYB A;  3V4I A;  3PY8 A;  1WSJ A;  4DU1 A;  3AVL A;  4JI8 K;  4WFA L;  1VSM A;  4AF1 A;  2HOE A;  1NOZ A;  2ITM A;  3HK2 A;  5AQL A;  3L2V A;  2EHG A;  3TAB A;  2J4R A;  1RT6 A;  4H5R A;  4BRD A;  3O9R A;  3MXI A;  4DR7 K;  4OPK A;  3C6T A;  4IEE A;  3H45 C;  1TUY A;  1QS4 A;  2E88 A;  1TKZ A;  3K9K A;  1XMO K;  4CF1 A;  1RBS A;  1X3M A;  4OX9 K;  4CJV A;  1HNW K;  3WXJ A;  3L2Q A;  1BU6 O;  4B1V A;  3ZSY A;  4EHU A;  3SQ1 A;  3ZT3 A;  3VF2 A;  4CJL A;  3FFI A;  2P5O A;  2CGK A;  3ZSV A;  1K73 O;  4O5B A;  4XIU A;  3WNG A;  3AVA A;  4B9Q A;  2IAJ A;  3OYF A;  5AR0 A;  1GLF O;  5A2Q O;  1K6Y A;  3CHW A;  1Z05 A;  3HO1 A;  3AY9 A;  3DXM B;  4JI3 K;  2UYT A;  4CD1 A;  4CJ4 A;  2HHU A;  3U8X A;  4IFE A;  4ELV A;  2YJE A;  4PKG A;  1W7A A;  4DV3 K;  3KJV A;  1SL2 A;  3CCR N;  1L3V A;  3K0S A;  1NK4 A;  5AZI A;  2PY5 A;  4C8N A;  1D4X A;  2HMP A;  4B9T A;  4A62 A;  1SZ2 A;  1J53 A;  4C1N I;  1Q8I A;  1GOB A;  1W0H A;  3VET A;  3VQB A;  1U2V A;  2A1S A;  5AFU H;  1IKY A;  1HNI A;  4JHD A;  4FPB A;  3MCA B;  1D9D A;  1HJO A;  3Q7C A;  4M3R A;  2HST A;  3KK1 A;  3HVR A;  4FK4 A;  2P9L A;  1BA0 A;  5KPT A;  3OYJ A;  4CJP A;  4DV5 K;  2FSN A;  1N8R O;  4B3T K;  1ZBH A;  3V9S A;  3GOI A;  2OPQ A;  1NK9 A;  4NXM K;  4B9N A;  4DV0 K;  4BRE A;  4B9M A;  2E1Y A;  4KFB A;  2GBZ A;  3T19 A;  3L2W A;  2UUA K;  1BIZ A;  4BE0 A;  2HHQ A;  3AA3 A;  4M45 A;  1TGO A;  4DV4 K;  1NK8 A;  4BGB A;  3ZSQ A;  4CZK A;  1NGG A;  4FWP A;  4Z4C A;  5LY3 A;  3FFK B;  3J81 O;  2E8A A;  3O5B A;  2ATQ A;  3OY9 A;  4X65 K;  4DCH A;  2E6L A;  3QEW A;  1BQM A;  3DLR A;  1RCH A;  3KVG A;  1A5W A;  3HVT A;  4PL8 A;  4DSF A;  4CBU A;  1WAJ A;  5AQK A;  1RDD A;  2FBX A;  3FLC O;  4E19 A;  4R79 A;  4KI6 A;  1X3N A;  3LPT A;  3NVM A;  2HF4 A;  2OTL N;  3NH1 A;  4CGG A;  3BF1 A;  3NH2 A;  1TYQ B;  1ZBU A;  1SKS A;  1ZBS A;  2QW9 A;  4M7X A;  3I55 N;  4PHT X;  1YIT N;  3CFR A;  3PO5 A;  5M1K A;  1SAZ A;  3R3L A;  3PIP L;  2KKZ A;  1ILY A;  4WF9 L;  3V9X A;  1HKC A;  1QSL A;  3NGI A;  4E7H A;  1XUP O;  4CJT A;  3CJ7 A;  2G8H A;  1NGB A;  3K9J A;  4FJX A;  3J80 O;  3HL8 A;  1B92 A;  1TK5 A;  3KLG A;  2XHB A;  4CJW A;  3VEX A;  2A5X A;  4JEP A;  2OYQ A;  2D0O A;  2E20 A;  1RDC A;  4H0Y B;  1DEJ A;  1X9W A;  4DTM A;  4FW2 A;  3J7A P;  3QES A;  2FBT A;  2KLA A;  4O5F A;  4BVP A;  2WTU A;  5AQX A;  4I2P A;  4JRQ A;  3F73 A;  5BR9 A;  3EZW A;  4K42 A;  4KH6 A;  5C10 A;  4YFU A;  5KGX A;  1NMD A;  1VQ8 N;  2O8B A;  3M3Z A;  3ZT0 A;  5HP1 A;  5JVH L;  2JGU A;  1K8A O;  2F8T A;  4ILG B;  1GLJ O;  4M3Y A;  3CET A;  1W2B M;  3OS1 A;  1KVA A;  2XY5 A;  5E26 A;  4BWM A;  5KRT A;  4CFB A;  3D2E B;  4CJS A;  5K14 A;  1YTA A;  2HBK A;  5AQM A;  4JKG A;  1LWE A;  4AM7 A;  1T03 A;  4JAX A;  1X9S A;  3WQU A;  4FJ7 A;  4CEZ A;  1C0G A;  4A57 A;  5AFU A;  4DQ8 A;  3M5R A;  2HB5 A;  4M63 C;  5CYM A;  1SS6 A;  4LD0 A;  5DMR A;  2RHK A;  4I9L A;  4BQZ A;  4WQ5 C;  3U9Z A;  1EWQ A;  1ATS A;  4JKB A;  4H0V B;  2G8U A;  2UU9 K;  1QQM A;  2QWL A;  4V19 S;  1C1B A;  1Z6R A;  4BC2 A;  2QWO A;  3TAP A;  5CHI A;  1LWC A;  3E9L A;  4NXN K;  4PY5 A;  3TAE A;  2O8E B;  3C0B A;  3ULE B;  2RF2 A;  4ZTF A;  3AVK A;  3CJ1 A;  4CGJ A;  1JCE A;  3ZX0 A;  2VYP A;  1QTM A;  2VQF K;  1Y64 A;  1X1P A;  4NLB A;  3SAH A;  4FJG A;  1GOC A;  1KAZ A;  4FJI A;  3DOK A;  4EP5 A;  4C23 A;  4MDA A;  3P38 A;  3MEE A;  1IBK K;  3DXK A;  4DHY A;  2YHY A;  3THX B;  3RRH A;  3M8P A;  3JS6 A;  3T7Z A;  1VSF A;  4FLV A;  1KVC A;  3V9W A;  4JI6 K;  3KWG A;  3ZSR A;  4CD3 A;  3QML A;  4B1Z A;  3GL1 A;  3V1O A;  4AHS A;  1T8E A;  4BRH A;  2GV9 A;  4LF5 K;  3TSQ A;  3VF4 A;  5M1P A;  5EY4 A;  1WBD A;  2VWB A;  3CJB A;  1KLM A;  1WSE A;  4KTZ A;  4CER A;  3ZEU A;  1SKW A;  3DMJ A;  4JKF A;  4A2B A;  1IBL K;  5M1N A;  3LZI A;  1RT4 A;  3B6P A;  4CF9 A;  4DTR A;  4BRO A;  3CC2 N;  1RNH A;  3CCJ N;  1CLQ A;  2QA4 N;  1T44 A;  4DUZ K;  2VG6 A;  3SBT A;  2O8D A;  4WQ5 A;  2YNH A;  2P9K B;  3PSF A;  2HBL A;  4BR4 A;  3J8A A;  4C8L A;  1OH5 A;  1VQ7 N;  2Q0U A;  3KLI A;  4C1N K;  3WUH A;  2ZE2 A;  3P39 A;  4EFH A;  3OJS A;  1S6Q A;  3ZSW A;  5FRN A;  3DM2 A;  1NKB A;  1XHX A;  3BP8 A;  2V52 B;  3LDP A;  1ZBL A;  3H3N O;  4LC9 B;  1OKJ A;  4GVE A;  4JRP A;  3RMA A;  4H0X B;  3CQ8 A;  4E1N A;  3SV4 A;  3DWL A;  1TK8 A;  5HOO A;  4CHO A;  4NCB A;  4CIG A;  4KRF A;  5KQD A;  2HHS A;  5BRE A;  5FRO A;  4KTQ A;  4IDH A;  4DFM A;  4FLU A;  3EE8 A;  4B1U B;  1HPZ A;  3RSE A;  4DR5 K;  1YTU A;  5F1X A;  5AQU A;  4N5S A;  4DFJ A;  5J2N A;  3O8M A;  2YNF A;  4DTP A;  2A3Z A;  4IO9 L;  1TKD A;  3V6D A;  3UKU B;  1C0M A;  4CGF A;  4KHP K;  4HUG A;  2P9I B;  3V9Z A;  3THY B;  3V1R A;  2B5J A;  3O9T A;  2Q97 A;  2KW4 A;  4CEB A;  4FM2 A;  2OZM A;  5AQN A;  3I8D A;  1KQS M;  1RDA A;  1QHT A;  1LCU A;  2ZF5 O;  1VQ4 N;  4CZF A;  3WEE A;  3HOS A;  4B1Y B;  5KPZ A;  2HBM A;  1BQN A;  3IFR A;  4FW1 A;  1TAU A;  4CF8 A;  1U48 A;  4KHU A;  2KFN A;  4DLG A;  1EKE A;  4C8M A;  1XWL A;  3ZSO A;  3KHY A;  2HBJ A;  1JCG A;  2A6A A;  3VGL A;  4CE9 A;  3VN5 A;  1SUQ A;  3LM2 A;  3SPZ A;  1RT7 A;  2Q31 A;  5B8H A;  1J5E K;  3OHR A;  5C2F A;  1TVR A;  4DFK A;  2WOM A;  3EO3 A;  3ULD A;  1FW6 A;  5EX5 A;  3NF8 A;  2VG5 A;  3E1Y A;  4UY8 O;  3L2R A;  3RRG A;  1GLL O;  1YF5 L;  1KXP A;  4KHY A;  1UAX A;  2KZZ A;  4BR7 A;  5C15 A;  1CZB A;  4DSE A;  3KLH A;  2DPN A;  2PBD A;  4BAC A;  3J7Y P;  3LDQ A;  1JLE A;  1KCF A;  3LAL A;  1X9J A;  2NRW A;  2Z1I A;  5HRR A;  4BG8 A;  1HMV A;  4W5T A;  3QFP A;  3EY1 A;  3NGZ A;  4NO7 A;  4M3U A;  3QBX A;  2ZM6 K;  1S1U A;  5M1O A;  3HJF A;  3ZX2 A;  2CGL A;  1VQN N;  2QWR A;  3VEW A;  1KLN A;  4CEC A;  3UKR B;  3IKM A;  4CJ7 A;  3MN7 A;  3F9M A;  4O8U A;  4O4G A;  1I3A A;  2OPS A;  4E7K A;  1RDW X;  3L2U A;  4A2A A;  3NF6 A;  4YOW A;  3HP6 A;  2HHH K;  2R7Y A;  4CEE A;  5BPN A;  5AJ3 K;  4RWT A;  1J54 A;  3NMU A;  2P51 A;  4KH4 A;  4AHU A;  2P5G A;  3ZYY X;  3EE9 A;  3CXC M;  4DS5 A;  1C0U A;  1QSS A;  4ILJ A;  3PO4 A;  2D0B A;  1RGI A;  1LWF A;  4FZX C;  3PSI A;  4GY2 B;  3DYA A;  2KFZ A;  3QIO A;  2VGN A;  4BE2 A;  1SL0 A;  4A61 A;  5J2P A;  5AQP A;  2FBV A;  1WSH A;  1BOT O;  4DTJ A;  4K25 A;  2O8F B;  4GMJ B;  3QEX A;  4OPJ A;  3VF6 A;  5DM6 L;  4DU4 A;  3OBW A;  3SI6 A;  3TSU A;  1JLF A;  3KKR A;  4A59 A;  4IOX A;  1ASV A;  5LL6 Z;  2EX3 A;  1GLB G;  1WN7 A;  3K5L A;  4KHS A;  3M8S A;  4KAZ A;  4BRC A;  3CYM A;  4M3T A;  3CJC A;  1Q86 O;  2OAN A;  3MMV A;  1U4B A;  2YV0 X;  3VQP A;  1BL3 A;  1C0F A;  3T69 A;  4N41 A;  3WNE A;  4FJJ A;  2NUB A;  1SV5 A;  5H1S Q;  4PL7 A;  4XH5 A;  3TTC A;  3CCS N;  1REV A;  4O0I A;  3I56 N;  1UA1 A;  2GEM A;  3ZLJ A;  3C6U A;  4CHY A;  4LSL A;  2D0P A;  4CJQ A;  2DFF A;  1ZYQ A;  2E5L K;  4B3O A;  1BI4 B;  3HZ6 A;  2HW3 A;  2FBY A;  2P9U B;  3ZET A;  2YX6 A;  1EXQ A;  4HTL A;  1A5X A;  3OS2 A;  4JS4 A;  4CK1 A;  4CCH A;  4DUY K;  1HUX A;  4BRM A;  3HRG A;  5EVZ A;  4NCG A;  1YIJ N;  3J7Z O;  1U47 A;  4CGD A;  5BRD A;  4E89 A;  1DLO A;  4U67 L;  1RT2 A;  3K57 A;  4ISG A;  2V51 B;  3DRS A;  4DQP A;  2UUB K;  1KC8 O;  1W97 L;  2KQ2 A;  2AP1 A;  3QDK A;  4FWR A;  4CIF A;  3RR7 A;  2NRH A;  4DLE A;  4E1M A;  3WT0 A;  3RR8 A;  3CER A;  4CBX A;  2G8F A;  2F4V K;  2P1J A;  3LP1 A;  2VCP A;  1GLA G;  3DJC A;  1NG9 A;  1DTT A;  1NLV A;  4BC3 A;  1YHQ N;  4H8K A;  1EP4 A;  1S22 A;  1ATR A;  4B1W B;  2E6M A;  3F5T A;  3CI5 A;  4KB1 A;  4Z4F A;  2AJQ A;  4BR9 A;  3KLF A;  4Z4G A;  1RBR A;  1BUP A;  2A40 A;  5J1E A;  4NYF A;  4FXD A;  4F3T A;  4BRF A;  3JAM O;  4OPA A;  3VQ9 A;  2BE2 A;  3CCV N;  3EL2 A;  4H0T B;  3C7N A;  1Y97 A;  4H4O A;  5C0Y A;  4LF7 K;  3S9H A;  4JD2 A;  4BRP A;  3DXM A;  3MX5 A;  2HMI A;  3OYA A;  4EP4 A;  3NHG A;  4L8R B;  2KZM A;  4O0J A;  4DSI A;  5AZI B;  2X6N A;  1OVQ A;  2WBN A;  3QIP A;  3T1A A;  4Y1D A;  4EHT A;  2FLO A;  2OTJ N;  4I6M A;  3ZT4 A;  2D4W A;  1LW2 A;  4LFB K;  3VEV A;  1U2V B;  4AIL C;  5AQF A;  4FZZ A;  3VA0 A;  3GE1 A;  4JHD B;  5JS1 A;  4X64 K;  4B1X B;  3IS9 A;  1SL1 A;  4F2R A;  4GKJ K;  4CJE A;  4FK2 A;  2P9L B;  2ZJP L;  4PKI A;  4FZY A;  3G4S N;  2BTF A;  1IG9 A;  1NBW A;  5CR4 A;  3QEV A;  1S9G A;  2D0A A;  4FWN A;  2H3G X;  2F96 A;  3RMB A;  1JLG A;  4DR4 K;  3BUZ B;  4MO5 A;  3VES A;  4E1J A;  5AQV A;  4CZE A;  1Q9X A;  1BG3 A;  1P8Z A;  3P5J A;  1Q9Y A;  4H5T A;  1QE1 A;  3ENB A;  3PUF A;  4RW9 A;  1YVU A;  3PIO L;  1D8Y A;  2W41 A;  4FJL A;  3CFP A;  3I0S A;  4O8K A;  5CZ1 A;  1ASU A;  4H03 B;  4DG1 A;  4KPY A;  4OGC A;  2DY4 A;  1IO2 A;  3I0R A;  2WUS A;  3VQD A;  4CZH A;  5AQG A;  3NCI A;  4DQS A;  3ATU A;  1K9M O;  4DB3 A;  4B9L A;  4FO0 A;  4IOC L;  1E4F T;  1VSJ A;  4FLZ A;  4QCL A;  1RDB A;  5FPM A;  2HVI A;  3SQ4 A;  4FJH A;  4ELU A;  3JSM A;  4EAH D;  3MN9 A;  2ITG A;  1QQO A;  1VQK N;  1MU2 A;  3ZCM A;  3V81 A;  3A0I X;  1RBT A;  3C6H A;  1TAQ A;  1R0A A;  2FSJ A;  3QO9 A;  3HTV A;  1IBM K;  3TAN A;  2ASO A;  3ASM A;  4H0O A;  2XY8 A;  4FOI A;  3OA9 A;  5HRP A;  3AVM A;  1BWF O;  3KK2 A;  4Z94 A;  4DTO A;  4W5Q A;  5FPN A;  1KD1 O;  1VSD A;  2BH1 A;  3OYK A;  1JJ2 M;  2P9S A;  2QWN A;  1QQN A;  2GTD A;  4FWS A;  3OYI A;  3KZB A;  1S9E A;  4Z4E A;  4G9Z A;  2LSN A;  3VEO A;  1F21 A;  3DLK A;  2Z1G A;  2X78 A;  3U3Y A;  1ZXO A;  1VSH A;  5BRF A;  4RW6 A;  2I7P A;  2O8B B;  2QI2 A;  3R9P A;  5AZJ B;  5FPE A;  4CZG A;  4Z4I A;  3VQ5 A;  4K8Z A;  3HYF A;  1LV5 A;  3OJU A;  1NMN A;  3DLE A;  4K41 A;  4YNQ A;  3G71 N;  5C25 A;  4OVL A;  2D1K A;  4JKD A;  2QWQ A;  4KH5 A;  3S3M A;  3O1W A;  3P31 A;  4JKG B;  1O1W A;  4DSK A;  4E7I A;  4N76 A;  3D2E A;  4HTU A;  3WXL A;  3LP2 A;  4K8X A;  4JNE A;  4H5W A;  5AQW A;  4Q5V A;  1EWR A;  1VQL N;  1BA1 A;  4N56 A;  5GIN A;  4TSX A;  1YJ9 N;  1HRH A;  4B9U A;  4FJN A;  1HKB A;  3VQA A;  4O55 A;  5KQ8 A;  3DOL A;  5GAH P;  3LWM A;  1NOY A;  4AHR A;  4FM1 A;  4C8K A;  3HPO A;  3MX2 A;  4GVM A;  4MLE A;  1BIU A;  4CGI A;  3SJJ A;  4KV8 A;  3CPE A;  3CM6 A;  5CY4 A;  2E2Q A;  3KK7 A;  4MFB A;  4FJ9 A;  3SUO A;  3LDL A;  3LDN A;  5KGW A;  4DR3 K;  4F9O A;  4YOR A;  2PFU A;  4RG8 A;  3KD5 E;  3ULE A;  3O08 A;  1IV0 A;  2G8K A;  4F8R A;  4XH1 A;  4GV6 A;  3DXK B;  2IGI A;  4RW8 A;  3EZ5 A;  3QLH A;  2DTU A;  1C1C A;  4DU3 A;  4BC4 A;  1NGC A;  5AQT A;  1ATN A;  3THX A;  2QKK A;  1WUA A;  4WFN L;  4YY3 K;  3MDQ A;  1VAZ A;  3UB5 A;  4QS8 A;  3S3N A;  4IZ9 A;  3D2F B;  3DI6 A;  3THW A;  2QM1 A;  5FDL A;  4CVN E;  4KHW A;  3ZEU B;  4BVO A;  1LAW A;  5HRO A;  3LPU A;  4OO1 J;  1H1V A;  3HXM A;  4DR6 K;  4CZM A;  1VRT A;  5ELZ A;  5E84 A;  3K5M A;  3AVN A;  2GWJ A;  3W3D A;  2E1Z A;  1ITG A;  2DFH A;  2V7Y A;  5ADX A;  2O8D B;  3C94 A;  5HBM A;  1N34 K;  1K8K A;  4CHZ A;  4WCE L;  3NE6 A;  5KI6 A;  2E4L A;  5I42 A;  4LF9 K;  1T6D A;  4BRQ A;  4R5P A;  3SBG A;  4HCB A;  3O4Q A;  3KKS A;  4GV3 A;  1VSK A;  2NRV A;  4CFA A;  2IVO A;  3VPZ A;  3VGK A;  2W40 A;  2P9N A;  1LAV A;  5GAD P;  3PX0 A;  4ZTJ A;  2CGJ A;  3NFA A;  4OJR A;  4HUF A;  5E41 A;  1HYV A;  2KHO A;  5HLF A;  3NF9 A;  3D0P A;  3SLC A;  3BY5 A;  3F9K A;  1U45 A;  3KIO A;  1WLJ A;  3VEY A;  1NK0 A;  4DTX A;  2Z1J A;  3TR8 A;  3QIC A;  1D9F A;  3AVF A;  2Z1H A;  2HNZ A;  3SUP A;  3FZM A;  3EYZ A;  1TL3 A;  4OLA A;  3RSE B;  1BCM A;  1S1W A;  5C42 A;  3HOT A;  1YJW N;  5HL7 L;  4CEO A;  5C2D A;  2ZGZ A;  2ZJR L;  2YHW A;  4BGA A;  5KTQ A;  2GEL A;  4CHQ A;  4IJA A;  5I3U A;  4CJF A;  2F8S A;  1VQP N;  3OW2 M;  1VQO N;  3G0Z A;  1NK5 A;  4NYN A;  4CJ3 A;  2D5R A;  4JI1 K;  4NB4 A;  1L3S A;  3AO5 A;  1NGD A;  1Z26 A;  3I33 A;  1EX4 A;  4CIE A;  3G25 A;  2FSK A;  4FWQ A;  4AQY K;  1NJY A;  3L8B A;  4DV6 K;  3WEE B;  4FK0 A;  5BPM A;  5J2M A;  3M6G A;  3PX6 A;  1NGA A;  1S1X A;  1S1T A;  2FF6 A;  3AV9 A;  5EU7 A;  4RCH A;  3AAR A;  4YDU A;  1HNX K;  1KFD A;  2Q3S A;  3QNN A;  3M8R A;  1QHA A;  4FLX A;  1N6Q A;  2Q1N A;  4C8O A;  2OPP A;  4YOX A;  2O8C A;  4GNI A;  4CZJ A;  4W5R A;  3AO2 A;  3WXI A;  2UXB K;  4IKF A;  2YHB A;  3HST B;  1VK0 A;  1NGI A;  2QXL A;  3DRR A;  4HCC A;  1NGH A;  4H4M A;  2FXU A;  3QEI A;  3LWL A;  3U3G A;  3R6M A;  2QEX N;  3VOV A;  4B3R K;  2E2O A;  4HHT A;  3CPW M;  2F7T A;  1BGX T;  3MCP A;  2G8V A;  3TSP A;  4FVM A;  3FZK A;  3ATV A;  1GLD G;  3K58 A;  4DTU A;  3CME N;  3K5N A;  4BDZ A;  3QER A;  5AQZ A;  3S3O A;  4CK3 A;  3V1Q A;  4IOA L;  3WXK A;  2FC0 A;  4WE1 A;  4WFB L;  4LFA K;  4FLT A;  4DR2 K;  4Q0B A;  2OPR A;  1B9D A;  5AQY A;  4CK2 A;  5AQI A;  1NJX A;  5FLX O;  3VTI A;  4PWD A;  3TPQ A;  1B9F A;  3AVG A;  2RE2 A;  1RFQ A;  4W5N A;  3BF3 A;  4F3O A;  1ESV A;  1I39 A;  2YJF A;  3EN9 A;  3MXJ A;  2BDP A;  4BRL A;  4CEA A;  4JKC A;  5AQS A;  4BQL A;  1L3U A;  4YOU A;  3OYG A;  3SNN A;  3SCX A;  2GX9 A;  2HHX A;  2GWK A;  4H5N A;  4IJN A;  4A5A A;  1EET A;  3MK6 A;  4AHT A;  1T7P A;  2Q2R A;  1TL1 A;  3VGM A;  4I9Q A;  3V9U A;  4PUO A;  1M90 O;  1YT3 A;  3CCL N;  3H08 A;  1J6Z A;  5JLH A;  4DV7 K;  5JLF A;  4HWI A;  3NF7 A;  3RVC A;  3CFO A;  4YOV A;  2PZS A;  5IT9 O;  2IDO A;  2VWK A;  3O3H A;  3UE5 A;  2HHT A;  2X74 A;  1Q81 O;  2HNY A;  3OYB A;  3LZJ A;  4E7L A;  3AVI A;  1XHZ A;  3SJH A;  3P4I A;  1TK0 A; 
#chains in the Genus database with same CATH homology
 1BHL A;  4FLW A;  2ZD1 A;  2G8U A;  1IG9 A;  3ZSZ A;  3QEV A;  1C1B A;  1L5U A;  1S9G A;  1HYZ A;  3TAP A;  1LWC A;  3MAQ A;  4CJR A;  2D0A A;  2G8W A;  1ZBI A;  4O44 A;  4PY5 A;  3TAE A;  2F96 A;  3MEG A;  1JLG A;  4IG0 A;  2O4G A;  2RF2 A;  3CG7 A;  1IKX A;  3RMB A;  1WSG A;  4ZTF A;  4B9V A;  4EZ6 A;  3AVK A;  1NKC A;  1Q9X A;  4CGJ A;  1JXE A;  3SUQ A;  3K5O A;  3P5J A;  1Q9Y A;  2YHA A;  4CJU A;  3OYH A;  1QE1 A;  4CHN A;  1QTM A;  2ETJ A;  3AO4 A;  1UWB A;  1X1P A;  4FJG A;  1GOC A;  1KTQ A;  1VSI A;  3PUF A;  4OKK A;  1YVU A;  4RW9 A;  1JL2 A;  1NJW A;  4FJI A;  4W5O A;  3DOK A;  1D8Y A;  3LAM A;  4EP5 A;  4FJL A;  2GUI A;  3LP0 A;  3AVJ A;  4KB0 A;  3MEE A;  3CFP A;  3I0S A;  5T7B A;  1L3T A;  5CZ1 A;  1ASU A;  4DG1 A;  4KPY A;  5FRM A;  1S1V A;  4OGC A;  2XY6 A;  4CF2 A;  4KTW A;  3K59 A;  4KHN A;  3B6O A;  1IO2 A;  2DY4 A;  3I0R A;  3RRH A;  3M8P A;  1BI4 A;  2ZQB A;  3THV A;  1VSF A;  3VQD A;  4FLV A;  1KVC A;  3V9W A;  4PQU A;  3LP3 A;  3NCI A;  4DQS A;  3ZSR A;  3AO1 A;  2B6A A;  4BDP A;  4B9L A;  2HND A;  2Y1I A;  4FJK A;  3V1O A;  1T8E A;  4AHS A;  2G8I A;  4B3O A;  2YKN A;  1VSJ A;  4FLZ A;  3VQ4 A;  4QCL A;  1HQE A;  1RDB A;  1RT3 A;  3SYZ A;  2HVI A;  3L3V A;  2GV9 A;  3SQ4 A;  4FJH A;  4ELU A;  1RTJ A;  3JSM A;  1S5J A;  5HRN A;  3JYT A;  2ITG A;  1KLM A;  1TV6 A;  4RW7 A;  1WSE A;  4KTZ A;  1MU2 A;  2YKM A;  4B8C A;  3P1G A;  3ZCM A;  4CER A;  1QQC A;  1TKX A;  1HQU A;  5SZT A;  4UQG A;  3V81 A;  1SKW A;  3DMJ A;  1BIS A;  1RBT A;  4Z0U A;  2X6S A;  1JKH A;  4ELT A;  1TAQ A;  1R0A A;  3QO9 A;  3TAN A;  3LZI A;  3ASM A;  1G15 A;  4AHC A;  3SQ2 A;  1RT4 A;  2XY8 A;  2IC3 A;  1DTQ A;  3B6P A;  4CF9 A;  3OYL A;  4E7J A;  4DTR A;  5HRP A;  4OLB A;  4MQ3 A;  3AVM A;  1RNH A;  1A5V A;  4KI4 A;  1CLQ A;  2XRI A;  2VWJ A;  3KK2 A;  3WNF A;  3KTQ A;  4DTO A;  2VG6 A;  4M3W A;  1NK6 A;  3E01 A;  2YNH A;  3P83 D;  4W5Q A;  2QK9 A;  3VQQ A;  4M3Z A;  1VSD A;  4C8L A;  1J9A A;  1Z25 A;  3OYK A;  1WSI A;  3NGY A;  3KLI A;  1C6V A;  2ZE2 A;  3OYI A;  1RIL A;  2VG7 A;  1W9H A;  3K2P A;  4I7F A;  3OJS A;  4DQR A;  1S6Q A;  4CFC A;  3DLH A;  1S9E A;  1BCO A;  1JLA A;  1FXX A;  4Z4E A;  3ZSW A;  1FK9 A;  3DM2 A;  3MXM A;  1NKB A;  5FRN A;  1XHX A;  2LSN A;  1F21 A;  3DLK A;  4QOZ B;  1NK7 A;  2Z1G A;  2X78 A;  3U3Y A;  1NKE A;  2HHV A;  3O4N A;  4J2E A;  1VSH A;  4RW6 A;  3VQ7 A;  1ZBL A;  1RTI A;  3SZ2 A;  3OYN A;  4I2Q A;  1SKR A;  4Z4I A;  3VQ5 A;  1C0T A;  3BGR A;  4JRP A;  4K8Z A;  1CXU A;  1XI1 A;  3HYF A;  3RMA A;  1FKO A;  1LV5 A;  3OJU A;  1J5O A;  4ID5 A;  3CQ8 A;  3DLE A;  4E1N A;  4ZHR A;  3SV4 A;  4YNQ A;  1TK8 A;  4LH4 A;  5C25 A;  4OVL A;  3HPH A;  4CHO A;  4NCB A;  4HVJ A;  3AA4 A;  3S3M A;  4CIG A;  4KRF A;  4IDK A;  2HHS A;  5FRO A;  1O1W A;  4KTQ A;  2OZS A;  1GOA A;  4DSK A;  3MED A;  4E7I A;  4N76 A;  4DFM A;  3LAK A;  4FLU A;  4LSN A;  4HTU A;  3QIN A;  3LP2 A;  4DS4 A;  4K8X A;  1HPZ A;  1FKP A;  4DQQ A;  3OYM A;  4Q5V A;  1JLC A;  2BAN A;  4FYD A;  4N56 A;  4BE1 A;  5CYQ A;  1YTU A;  2IOC A;  4TSX A;  3AVC A;  4CJ5 A;  4J2B A;  4N5S A;  4DFJ A;  1HRH A;  5J2N A;  4B9U A;  1N5Y A;  4DSJ A;  4FJN A;  2YNF A;  5JS2 A;  4DTP A;  3VQA A;  3SUN A;  4O55 A;  3LWM A;  3DOL A;  1RTH A;  4CHP A;  2RPI A;  5J2Q A;  3V6D A;  1C0M A;  1TKD A;  1NOY A;  1U04 A;  4AHR A;  4FM1 A;  4F4K A;  4C8K A;  3HPO A;  4CGF A;  4HUG A;  4DQI A;  3L3U A;  4GVM A;  3V9Z A;  1BIU A;  3DLG A;  3MEC A;  4CGI A;  4CES A;  4OKJ A;  3SJJ A;  3O3F A;  1IKV A;  3V1R A;  1HJR A;  3KD1 E;  4J2A A;  4KV8 A;  2B5J A;  4E3S A;  3CM6 A;  1XC9 A;  5CY4 A;  4CGH A;  1RBV A;  5SWM A;  2KW4 A;  4CEB A;  1JLQ A;  4FM2 A;  3NDK A;  1UOC A;  1RT5 A;  2OZM A;  2QXF A;  3AA2 A;  4MFB A;  3AVB A;  3HT3 A;  3SUO A;  5KGW A;  3I8D A;  3QEP A;  1RDA A;  2A1R A;  1QSY A;  1LW0 A;  1QHT A;  2B4J A;  4RG8 A;  3KD5 E;  4OGE A;  3RMD A;  2G8K A;  1JXB A;  2QKB A;  3RWU A;  4B9S A;  4F8R A;  3VQ6 A;  1U49 A;  4CEQ A;  1JLB A;  1VSL A;  1BQN A;  3IAY A;  1RT1 A;  2WON A;  3HP9 A;  2IGI A;  4LH5 A;  1IH7 A;  4FW1 A;  4RW8 A;  4CF8 A;  3EZ5 A;  1TAU A;  3OYE A;  4ID1 A;  1U48 A;  4KHU A;  3ITH A;  4M41 A;  4DLG A;  1EKE A;  1WNS A;  4FJ9 A;  2KFN A;  4C8M A;  3IRX A;  3HPG A;  1XWL A;  3ZSO A;  4DF8 A;  3QLH A;  3QNO A;  3SQ0 A;  2DTU A;  1C1C A;  4DU3 A;  3V4I A;  4OKE A;  3PY8 A;  1WSJ A;  4CE9 A;  4FJM A;  3VN5 A;  1SUQ A;  2QKK A;  3SPZ A;  1RT7 A;  1TVR A;  3AVL A;  4BDY A;  4DU1 A;  4DFK A;  4J2D A;  1VSM A;  2WOM A;  1NOZ A;  3HK2 A;  2D0C A;  3L2V A;  3ULD A;  2EHG A;  3T3F A;  3TAB A;  3NF8 A;  3S3N A;  4KO0 A;  1RT6 A;  2VG5 A;  3DI6 A;  4KHW A;  5FDL A;  4KRE A;  3L2R A;  2OA8 A;  3RRG A;  3MXI A;  4KHY A;  4OPK A;  1UAX A;  2KZZ A;  3C6T A;  4QAG A;  1LAW A;  5HRO A;  1CZB A;  4DSE A;  3KLH A;  3PX4 A;  1QS4 A;  3LPU A;  4BAC A;  1TKZ A;  4FJ8 A;  4E0D A;  4CF1 A;  3SV3 A;  1RBS A;  1JLE A;  3HXM A;  1KCF A;  3LAL A;  1VRT A;  1T05 A;  3OS0 A;  4CJV A;  2Z1I A;  3K5M A;  5HRR A;  3AVN A;  1HMV A;  4W5T A;  3L2Q A;  1KSP A;  1ITG A;  1RBU A;  2DFH A;  3EY1 A;  3NGZ A;  3ZSY A;  3VQE A;  4M3U A;  3SQ1 A;  1S1U A;  1VRU A;  3C94 A;  5HBM A;  4CFD A;  3ZT3 A;  4CJL A;  4ICL A;  4CHZ A;  4KKO A;  3HJF A;  3FFI A;  3NE6 A;  3LDS A;  1S6P A;  2P5O A;  5KI6 A;  1CXQ A;  2E4L A;  5I42 A;  3ZSV A;  1KLN A;  4CEC A;  2YNG A;  4R5P A;  4O5B A;  4XIU A;  4HCB A;  4IG3 A;  3WNG A;  3AVA A;  3O4Q A;  3KKS A;  4CED A;  2IAJ A;  3OYF A;  4JS5 A;  4M42 A;  3DRP A;  3BDP A;  4O4G A;  1I3A A;  2OPS A;  3RTV A;  3NAE A;  1K6Y A;  4E7K A;  3VQ8 A;  1VSK A;  3HO1 A;  3L2U A;  4CFA A;  1KVB A;  3NF6 A;  3HP6 A;  4NCA A;  4CJ4 A;  2R7Y A;  1LAV A;  4ZTJ A;  3PX0 A;  2HHU A;  4CEE A;  4IBN A;  2HVH A;  4CF0 A;  3NFA A;  4OJR A;  1J54 A;  3LAN A;  4FZY A;  4HUF A;  2P51 A;  1HYV A;  5E41 A;  3O3G A;  3RMC A;  5HLF A;  4ELV A;  3NF9 A;  5KRS A;  4AHU A;  3D0P A;  2P5G A;  1X9M A;  3TAF A;  1IKW A;  3F9K A;  4DS5 A;  1U45 A;  3KJV A;  1SL2 A;  1C0U A;  3KIO A;  1L3V A;  1WLJ A;  1QSS A;  1NK4 A;  2PY5 A;  1NK0 A;  4DTX A;  3PO4 A;  2D0B A;  4C8N A;  2Z1J A;  4CJK A;  3TR8 A;  1LWF A;  4FZX C;  1D9F A;  4KHQ A;  3AVF A;  2Z1H A;  4F2S A;  2HNZ A;  3SUP A;  4B9T A;  3EYZ A;  3DYA A;  2KFZ A;  3QIO A;  1TL3 A;  3OYD A;  4BE2 A;  1J53 A;  1SL0 A;  4DTS A;  1Q8I A;  4FCY A;  2BGG A;  1BCM A;  1GOB A;  1S1W A;  1C1A A;  1W0H A;  5C42 A;  3VQB A;  5J2P A;  2RKI A;  2A1S A;  4M3X A;  2FBV A;  1WSH A;  4CEO A;  1IKY A;  3OYC A;  4DTJ A;  1HNI A;  5KTQ A;  1D9D A;  4GMJ B;  4PA1 A;  4M3R A;  4OPJ A;  3QEX A;  4CHQ A;  3KK1 A;  5I3U A;  4DU4 A;  4CJF A;  3HVR A;  3SPY A;  2F8S A;  3SI6 A;  1JLF A;  3U6F A;  3KKR A;  4FK4 A;  3G0Z A;  1ASV A;  3OYJ A;  2HHW A;  1KFS A;  1KRP A;  1TKT A;  2EX3 A;  4CJP A;  3A2F A;  1NK5 A;  1WN7 A;  4NYN A;  4B08 A;  4CJ3 A;  3M8S A;  3K5L A;  1VSE A;  2D5R A;  4KAZ A;  4KHS A;  1ZBH A;  3CYM A;  3V9S A;  3AO5 A;  3HM9 A;  1L3S A;  4M3T A;  2OPQ A;  4DWI A;  2I5J A;  1U4B A;  1Z26 A;  2YV0 X;  1NK9 A;  3VQP A;  1BL3 A;  4B9N A;  4EZ9 A;  1EX4 A;  4N41 A;  4B9M A;  4KFB A;  2GBZ A;  3T19 A;  4CIE A;  3D45 A;  2JLE A;  3L2W A;  3WNE A;  1BIZ A;  4FJJ A;  2NUB A;  1SV5 A;  4BE0 A;  1NJY A;  2HHQ A;  3L8B A;  3AA3 A;  4M45 A;  1TGO A;  4JLH A;  1REV A;  4O0I A;  1ASW A;  1UA1 A;  1NK8 A;  4FK0 A;  5J2M A;  4BWJ A;  3ZSQ A;  3C6U A;  3PX6 A;  2PYL A;  1S1X A;  1S1T A;  3ALY A;  3AV9 A;  5EU7 A;  4CHY A;  2O4I A;  2YNI A;  4LSL A;  1KFD A;  2Q3S A;  4Z4C A;  3VA3 A;  4CJQ A;  2DFF A;  3M8R A;  3OY9 A;  3QNN A;  2ATQ A;  4FLX A;  1ZYQ A;  1N6Q A;  1BI4 B;  2E6L A;  2OPP A;  3QEW A;  4C8O A;  4OLA A;  2HW3 A;  2FBY A;  1HNV A;  1EXQ A;  1BQM A;  1JL1 A;  2IS3 A;  1A5X A;  5DK5 A;  3DLR A;  1RCH A;  1ZBF A;  3OS2 A;  4DF4 A;  1A5W A;  3HVT A;  4JS4 A;  4CK1 A;  4DSF A;  2PYJ A;  2Y1J A;  1WAJ A;  4G1Q A;  1RDD A;  2FBX A;  4RW4 A;  4CCH A;  4E19 A;  1UA0 A;  4KI6 A;  4W5R A;  3AO2 A;  4IKF A;  2YHB A;  3LPT A;  3HST B;  4NCG A;  1VK0 A;  3TAR A;  1U47 A;  3AO3 A;  4CGD A;  4E89 A;  3DRR A;  1DLO A;  4CGG A;  3NH1 A;  1HYS A;  2W42 A;  1RT2 A;  3IG1 A;  4HCC A;  3K57 A;  3NH2 A;  4H4M A;  1ZBU A;  3ISN C;  1SKS A;  3QEI A;  3LWL A;  3U3G A;  2RN2 A;  4IFV A;  3DRS A;  4DQP A;  3WNH A;  3AA5 X;  1CZ9 A;  3AVH A;  3PO5 A;  3CFR A;  4HHT A;  2KQ2 A;  3V9X A;  5C24 A;  1QSL A;  3NGI A;  4E7H A;  4CIF A;  3RR7 A;  4CJT A;  2G8H A;  4B8A B;  4DLE A;  4FJX A;  1BGX T;  4E1M A;  3HL8 A;  4GW6 A;  1B92 A;  1TK5 A;  2G8V A;  3KLG A;  2XHB A;  3RR8 A;  4CJW A;  2G8F A;  4FVM A;  3PV8 A;  2P1J A;  3NBP A;  3NH0 A;  3TWH A;  3LP1 A;  2OYQ A;  2KTQ A;  3K58 A;  4DTU A;  1DTT A;  1RDC A;  3K5N A;  4BDZ A;  4FLY A;  3QER A;  3KLE A;  4H8K A;  1EP4 A;  4N47 A;  4CK3 A;  3S3O A;  4DTM A;  1X9W A;  2E6M A;  4FW2 A;  4LY7 A;  3V1Q A;  1NJZ A;  4IFY A;  4KB1 A;  4Z4F A;  2FC0 A;  4WE1 A;  2AJQ A;  4FLT A;  4CEF A;  3QET A;  3KLF A;  3QES A;  4Z4G A;  2FBT A;  1RBR A;  4Q0B A;  5J1E A;  2OPR A;  3CM5 A;  4NYF A;  1B9D A;  4DFP A;  4CK2 A;  4JRQ A;  4I2P A;  4F3T A;  3F73 A;  4FXD A;  1NJX A;  4AHV A;  3OVN A;  3VQ9 A;  4PWD A;  2BE2 A;  3TI0 A;  1B9F A;  3AVG A;  4W5N A;  2DFE A;  4F3O A;  4YFU A;  3VQC A;  1I39 A;  3MXJ A;  5KGX A;  3TAM A;  4FM0 A;  3UIQ A;  1Y97 A;  4Z4H A;  2BDP A;  4H4O A;  4CEA A;  3ZT0 A;  5HP1 A;  1L3U A;  2JGU A;  3S9H A;  3OYG A;  3SNN A;  3SCX A;  2F8T A;  4M3Y A;  4DMN A;  3G10 A;  2HMI A;  3OYA A;  4EP4 A;  3NHG A;  4L8R B;  3OS1 A;  1KVA A;  2XY5 A;  2XY7 A;  2HHX A;  2KZM A;  4O0J A;  4DSL A;  4BWM A;  5KRT A;  3KK3 A;  4DSI A;  1EET A;  2X6N A;  4AHT A;  4CJS A;  4CFB A;  1T7P A;  5D3G A;  1TL1 A;  5K14 A;  1YTA A;  4I9Q A;  3V9U A;  4Y1C A;  3QIP A;  4PUO A;  1WAF A;  4Y1D A;  1LWE A;  3T1A A;  1T03 A;  3TAG A;  3ZT2 A;  5HRS A;  3ZT1 A;  1X9S A;  1YT3 A;  3ZT4 A;  3H08 A;  1LW2 A;  4AH9 A;  3NF7 A;  4FJ7 A;  3CFO A;  5CZ2 A;  4AIL C;  2PZS A;  4CEZ A;  3TAQ A;  1WSF A;  4FZZ A;  2IDO A;  2VWK A;  3VA0 A;  5JS1 A;  3M8Q A;  1RTD A;  3O3H A;  2HB5 A;  3IS9 A;  4HUE A;  4DTN A;  1SL1 A;  5CYM A;  3DLB A;  4F2R A;  2X74 A;  4LD0 A;  3ZSX A;  5DMR A;  2XO7 A;  2HHT A;  2HNY A;  3OYB A;  3LZJ A;  4E7L A;  1D5A A;  3AVI A;  4I9L A;  4CJE A;  1XHZ A;  4FK2 A;  4FJ5 A;  1TK0 A;  3C95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...