1WSFA

Co-crystal structure of e.coli rnase hi active site mutant (d134a*) with mn2+
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCAELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Identification of Single Mn(2+) Binding Sites Required for Activation of the Mutant Proteins of E.coli RNase HI at Glu48 and/or Asp134 by X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 155
sequence length 155
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsfA00
4KI4A 3KLHA 4R5PA 3P83D 1DTTA 1HRHA 1REVA 2P5GA 3TABA 2G8FA 1S9EA 2OPPA 1EXQA 1RT7A 5I3UA 2DFHA 4B9LA 1HYSA 1WSHA 2YNIA 2P51A 3L3VA 1JLAA 4CJPA 2HB5A 5CYQA 1NKEA 4KHSA 5T7BA 2HW3A 1A5VA 4KAZA 5J2NA 1RCHA 4CHNA 3EYZA 4DSLA 1WSEA 3CM6A 4DTNA 1W0HA 4CFCA 3QINA 4CJEA 2KW4A 4DTSA 1TK0A 1JLFA 4CEDA 3EZ5A 1J9AA 2FBVA 5DMRA 1S1XA 3V81A 1KLNA 1UWBA 3O3GA 2ITGA 4BACA 3SPZA 4CJ5A 1D8YA 3ZSVA 3NDKA 3AO2A 2XY5A 4FLTA 3QNOA 1VSMA 3CM5A 3L2QA 4E0DA 3DYAA 4GMJB 3VA0A 3V9WA 1ZBUA 1T7PA 1JKHA 3VQBA 1UA1A 4AHRA 3VQAA 4NCBA 4FJ7A 1J54A 1RTIA 3AA5X 4Y1CA 4CJTA 4O0IA 3HM9A 3NHGA 3V9SA 3VA3A 3TAEA 2VG5A 3NFAA 2OPRA 3AA2A 4CEQA 3RMAA 4CEZA 3LP3A 3TAMA 4FJNA 1VSJA 4FLZA 4I9LA 4O55A 4CGJA 3V1OA 3HT3A 3HJFA 4CJFA 1S1VA 1BI4A 3VQ7A 4CEOA 1GOCA 1VSLA 3OJSA 3JYTA 4JS4A 4QCLA 4KKOA 4EP5A 2HNZA 1NOZA 3SPYA 4FJJA 1BQMA 4M41A 1NJWA 1RILA 3ASMA 4FLXA 4GW6A 4LH4A 1YTUA 1G15A 1DTQA 2Z1JA 4FJXA 1VSIA 4OKEA 4O0JA 1EX4A 3L2UA 3DM2A 3K5OA 5SZTA 3AVIA 4JS5A 4E7KA 3SUNA 1QSSA 5J2PA 4KPYA 2HHTA 5C25A 3ZT4A 4DTUA 2BGGA 2Q3SA 4H4MA 2HNDA 4B8CA 2VWKA 3OYJA 1T03A 1NKBA 3M8PA 4FZXC 4F3TA 4Z4HA 4Z4CA 1VRUA 3SQ2A 2IC3A 3SI6A 2IOCA 3TI0A 1LAVA 4E89A 4DLGA 2QKBA 4CJWA 1I39A 1RDBA 1QSYA 1ZBIA 1C1BA 3B6PA 4CGIA 3QESA 1X9MA 2KTQA 4Y1DA 5HRPA 3ITHA 4CHZA 3SV4A 1BIUA 3NF6A 2OPSA 2VG6A 2D5RA 1NK9A 3SQ4A 1IG9A 3HYFA 5HP1A 1RTHA 1KVCA 1KVBA 4RW8A 3QEWA 2PY5A 2HVHA 4W5RA 3RMBA 1IKYA 1C0TA 1KVAA 1RT6A 3F73A 1B92A 4W5QA 3S3MA 1Q9YA 3NF7A 3SCXA 4FJLA 1L3UA 3PV8A 4J2AA 5KRTA 4CJLA 1JLQA 1TGOA 3BDPA 3O4QA 3HPOA 4EZ6A 3SZ2A 4KHUA 4CFBA 2OYQA 3NF8A 4RW7A 4ZHRA 1VK0A 4KTQA 4NCAA 3MXJA 3L3UA 3TAFA 1IKXA 4DLEA 3LP1A 4CF0A 3SNNA 1TKTA 3P1GA 4CK2A 3DLRA 2E4LA 2XY8A 3T1AA 4CGHA 3OYBA 3OJUA 2HMIA 3SYZA 1C1AA 3ZCMA 3OYKA 1LWEA 3VN5A 1WSFA 4DWIA 3M8QA 3WNGA 3LALA 4CCHA 3LDSA 1Z26A 1UOCA 1C0UA 4OVLA 3ZT0A 1WNSA 3SQ0A 1NJZA 5CZ1A 1SL1A 4PY5A 4Z4EA 3AO5A 1A5WA 1RBUA 4BDZA 3DLEA 3DRRA 5KTQA 4FZZA 4AHCA 1CZBA 1HQUA 1YT3A 2E6LA 4NYNA 1XHXA 4NYFA 3ZSRA 3DLHA 1N5YA 4BWMA 4FK2A 4CFAA 5CY4A 2Z1HA 1HYVA 1WSGA 3IG1A 2HNYA 4LH5A 4K8ZA 4LSNA 1ITGA 1CLQA 3VQ9A 4QAGA 4AHSA 1FK9A 3V6DA 2YHAA 4CK3A 1RBTA 3DRPA 3AVAA 3CQ8A 4CECA 4HTUA 2Z1GA 3KIOA 2GBZA 5FROA 2QKKA 2PYLA 1XWLA 2HHUA 2A1RA 2FC0A 4DU1A 4CF9A 3LPUA 4FJIA 4FM2A 2HVIA 3CG7A 3BGRA 3ALYA 3PUFA 4CFDA 3KK3A 4Q5VA 3TAPA 3LWLA 3ZT2A 4IG0A 1BCOA 1NOYA 2RKIA 4F4KA 1U48A 3KLEA 1U04A 3HPGA 4RW9A 4M3TA 3A2FA 2E6MA 4FJMA 2YHBA 1J53A 3KLIA 1J5OA 1IH7A 3NH1A 2IAJA 3ZT1A 4DQRA 4DTXA 4CJVA 2DTUA 3CFOA 4YFUA 1U45A 4F3OA 4KRFA 1HMVA 3C6UA 3RR8A 2KZMA 3RMCA 3DRSA 1NJXA 5JS2A 5C42A 1O1WA 5I42A 3OYFA 3PX0A 3RRGA 2Y1IA 1KRPA 1WSJA 3AA3A 4DSKA 1RBVA 4ID1A 1ASUA 1GOBA 4B8AB 4XIUA 3L8BA 3TAQA 1L5UA 5KRSA 4FYDA 4DS4A 3KKSA 1A5XA 5KGWA 3VQ8A 4QOZB 5FRNA 1F21A 3WNFA 4AH9A 2XHBA 3AVBA 3T3FA 4DF8A 3MXIA 2VG7A 4FM0A 4CK1A 3NE6A 4DU3A 3B6OA 3SUOA 1RTJA 4KB1A 1L3VA 2DFFA 4CHPA 4J2BA 1BQNA 1S9GA 3L2VA 3C94A 2GV9A 4KV8A 3RR7A 3MECA 3QEVA 1ZBFA 3OVNA 3AVGA 3VQ4A 4OPKA 3DOLA 5HRNA 4IG3A 3TR8A 3HO1A 3ZSWA 1U47A 1S1WA 2BANA 4JRPA 4E7HA 4DSEA 4DFKA 1KCFA 3K57A 1B9DA 2KQ2A 4DTRA 3QEPA 3EY1A 4ZTFA 4BDPA 2R7YA 4FVMA 3MEGA 1RTDA 4HCCA 4PQUA 1X9SA 4DF4A 4FW2A 2W42A 3OYLA 4CF2A 3ZSXA 1U4BA 1NK7A 4DQIA 2IGIA 2YNFA 3NH2A 4HHTA 2JGUA 1JLGA 4CESA 3OYMA 1DLOA 1BCMA 3AO4A 2P5OA 4MFBA 4CHQA 4N5SA 4F2SA 5C24A 4E7IA 3I0RA 1JL1A 3WNHA 4CJRA 4FM1A 3IRXA 3OS1A 4CJSA 3HSTB 4AHTA 5DK5A 1QS4A 3QERA 3QLHA 4IDKA 3ZSZA 1VSHA 3NAEA 4RG8A 3AVCA 3V9XA 5CZ2A 5J1EA 2X6NA 1ZBHA 2DFEA 3KD1E 3PO4A 2HHWA 4B9UA 3I8DA 2RN2A 4DTPA 3ISNC 1NKCA 2ZD1A 3M8RA 3I0SA 1D9FA 1Y97A 4DTJA 5HBMA 1UA0A 4IBNA 3V1QA 2D0CA 2YV0X 2YKNA 3NBPA 4FCYA 4DSFA 1TKDA 4F2RA 5D3GA 1YTAA 1JLCA 4CJ3A 1SUQA 4FJ9A 1WSIA 4Z0UA 4CGGA 2O4IA 4JLHA 3K2PA 4CERA 1LWFA 3RMDA 4ELTA 4N47A 4E1MA 3C6TA 1ZYQA 1GOAA 4C8OA 4DSIA 3C95A 3VQ6A 2B6AA 1XI1A 4WE1A 3T19A 3AVJA 1K6YA 2YNHA 1KFDA 3QO9A 4ID5A 1IKWA 1S1TA 3VQDA 3DLKA 3G0ZA 3K58A 2Y1JA 3KTQA 1X9WA 3D45A 4DFMA 1RT1A 1BI4B 1L3TA 1SL0A 2IDOA 3V9ZA 4ELVA 4KI6A 3HK2A 3V1RA 3OYAA 4H4OA 2G8IA 1C6VA 4LY7A 4E1NA 3LZIA 1RBRA 3S3NA 1C1CA 1LW2A 3CYMA 3ZT3A 4I2PA 4CJQA 4DTMA 4J2DA 1JXEA 3U6FA 4PA1A 1LV5A 4FJKA 4M3YA 1LAWA 3VQCA 4HVJA 3TANA 1D9DA 3AVMA 4H8KA 1SKSA 4KHQA 2KFZA 4AHVA 1ASWA 3SUQA 1MU2A 3TARA 3V4IA 3AV9A 4OKJA 2I5JA 4CGDA 3HP6A 2XO7A 2O4GA 4BE1A 2PZSA 1B9FA 3DI6A 2B5JA 3G10A 5EU7A 4CEAA 5J2QA 4MQ3A 3PY8A 1KSPA 1YVUA 4CEFA 1JXBA 1TV6A 3QEXA 3WNEA 3PX4A 1L3SA 3E01A 3HVRA 1S5JA 1TAQA 2G8HA 3UIQA 3QNNA 1HNVA 3PX6A 4M3WA 4OLBA 4B3OA 4K8XA 1RT3A 4KO0A 4M3RA 4BDYA 4W5TA 3OS0A 5K14A 3O4NA 4CF8A 2ZE2A 4HUGA 4HCBA 2BE2A 1NK6A 2IS3A 3HVTA 2ZQBA 4B9VA 4N41A 3O3FA 2KFNA 4IFYA 4CEEA 4CHOA 1TVRA 4HUFA 2P1JA 3VQQA 3AO1A 2WONA 3RWUA 4FXDA 2X6SA 4FLUA 4C8LA 4M45A 4Z4IA 4M3ZA 1TAUA 3MXMA 3LAKA 3OYEA 4CGFA 2LSNA 4HUEA 4BE2A 4OGEA 1SKWA 1FKPA 3IS9A 4CF1A 4CIFA 3MAQA 1HJRA 4J2EA 3ULDA 4F8RA 3H08A 4LSLA 5FRMA 1QHTA 2NUBA 4BE0A 1U49A 3AVNA 2FBXA 4KB0A 3HP9A 1SL2A 3DOKA 4DS5A 1TL1A 3NGIA 4CJ4A 2G8WA 4FW1A 3NGYA 4B9SA 5FDLA 4E7LA 1T8EA 4B9NA 1QQCA 3L2RA 2G8UA 4M3UA 4PWDA 1LWCA 2RF2A 3S9HA 4FZYA 2EX3A 1TKZA 3DMJA 3K5MA 1BIZA 4E7JA 1KFSA 1IKVA 1BISA 3KLGA 4FJ5A 3VQ5A 1R0AA 3KLFA 1XHZA 3QIOA 1NK8A 3OYHA 1ASVA 4C8KA 3NF9A 4DFPA 3U3YA 1NK4A 4Q0BA 3V9UA 1NK5A 4KHYA 1HYZA 4BWJA 5HRSA 3TWHA 4FK0A 4GVMA 2FBYA 4DQQA 3KK1A 4W5NA 3ZSYA 1FKOA 4G1QA 3U3GA 4Z4FA 2ATQA 5SWMA 3OYIA 1BHLA 3AVLA 4EP4A 3NGZA 3CFPA 4RW6A 1RT4A 3MEEA 1VSEA 4DTOA 1RDAA 3HL8A 3L2WA 3K5LA 1FXXA 4DU4A 1HNIA 4L8RB 1T05A 3HPHA 4CJKA 2JLEA 3OYDA 3AO3A 3JSMA 5KGXA 4KHWA 2X74A 1NJYA 4O5BA 2AJQA 4E19A 3AA4A 3LPTA 1D5AA 3LWMA 4E3SA 2G8VA 4KREA 1VSFA 4M3XA 3TAGA 1LW0A 4ELUA 4DG1A 1EETA 3O3HA 1RDCA 1VRTA 1KLMA 4M42A 1UAXA 3OYGA 2WOMA 4ZTJA 1VSKA 1S1UA 5HROA 2G8KA 1JLBA 3KJVA 2YKMA 2QK9A 5JS1A 1W9HA 3OS2A 2OA8A 1RNHA 2HHXA 4B08A 1CXQA 3QETA 3KKRA 2GUIA 3CFRA 2XRIA 1IO2A 2HHQA 1RBSA 2XY6A 2ETJA 4RW4A 3IAYA 5E41A 1XC9A 3THVA 1KTQA 1SKRA 1QSLA 2D0BA 1CXUA 2QXFA 1TK8A 1EKEA 3VQPA 5HLFA 4C8NA 2RPIA 4FK4A 2EHGA 4OLAA 1QE1A 4CEBA 3D0PA 1EP4A 2OZSA 3DLBA 1WAJA 1Q9XA 2F8TA 4DMNA 3LP0A 3QIPA 4I2QA 1CZ9A 3MEDA 3KD5E 2PYJA 4ICLA 3HXMA 1RT2A 3LAMA 1Q8IA 2VWJA 3SQ1A 4B9TA 5HRRA 4LD0A 1JLEA 4N56A 2OZMA 2KZZA 3RRHA 1NK0A 1WLJA 3PO5A 3NH0A 1BL3A 2Z1IA 4FLVA 2BDPA 3OYCA 4AILC 4IFVA 1HPZA 1S6PA 1I3AA 1S6QA 3NCIA 1TKXA 1TK5A 4I9QA 1WN7A 1RT5A 4EZ9A 1X1PA 3P5JA 2X78A 1JL2A 1N6QA 4W5OA 1C0MA 4CHYA 3SJJA 5CYMA 3ZSQA 3LZJA 4CIGA 4O4GA 1QTMA 4UQGA 1ZBLA 4KTZA 4CJUA 4CIEA 2DY4A 2F96A 4AHUA 3SV3A 4FJ8A 4JRQA 4KTWA 4KHNA 1RDDA 3FFIA 4YNQA 3OYNA 3AVFA 3AVHA 2OPQA 1WAFA 3LP2A 3K59A 2B4JA 4DFJA 1BGXT 4OPJA 3M8SA 3SUPA 3RTVA 2HHVA 4KFBA 4OJRA 4FJHA 4OGCA 3AVKA 4DQSA 4B9MA 4FLWA 4IKFA 1SV5A 3K5NA 4Z4GA 4I7FA 2A1SA 5KI6A 3LANA 3S3OA 4OKKA 5J2MA 4TSXA 4N76A 4C8MA 2FBTA 4FJGA 2D0AA 3VQEA 4CE9A 3QEIA 4PUOA 2F8SA 3F9KA 1HQEA 3DLGA 4FLYA 4DSJA 1TL3A 4O44A 4NCGA 3ZSOA 1VSDA 2XY7A 1Z25A 3KK2A 2HHSA 3OY9A 2YNGA 4DQPA
chains in the Genus database with same CATH superfamily
4R5PA 2P9PB 2QWQA 3ENOA 4H0VB 3TABA 3ENHA 1RT7A 1BU6O 1OVYA 5CYQA 4CJPA 4KHSA 5T7BA 3H3OB 2HW3A 4JNEA 2HBKA 5M1NA 4CHNA 3EYZA 1FJGK 4JKDA 4DTNA 4CFCA 1TK0A 5GAEP 3V81A 1KLNA 4CJ5A 5FPDA 1ATRA 1VSMA 3CM5A 3VETA 1M90O 4IJAA 1JKHA 3VQBA 3C0BA 4Y1CA 3H3NO 3A5LC 4CEZA 4FJNA 4CZLA 1VSJA 4FLZA 4CGJA 4YOTA 1S1VA 2O8BB 1BI4A 2IVOA 3VQ7A 5AQYA 4MO5A 3OJSA 4KKOA 3EE8A 4G9ZA 1HR0K 4M41A 3GBTA 2FLOA 4GW6A 4LH4A 3RSEA 3N4QA 1HNXK 2NZTA 4E0DA 3AVIA 3HZ6A 1QSSA 2HHTA 5C25A 4X64K 4CJ7A 2HSTA 3OYJA 4FZXC 4K43A 4DR6K 4BG8A 4Z4CA 3CJ7A 4E89A 4DLGA 1QSYA 1C1BA 4BC5A 3F9MA 3J7YP 5HRPA 5JMVA 4U67L 1BIUA 2D5RA 3QBXA 1IG9A 3HYFA 2I7PA 5HP1A 4BR0A 2HVHA 4RW8A 3QEWA 2YX6A 3S3MA 1Q9YA 2A41A 4J2AA 3PV8A 1JLQA 3BDPA 3UKUA 4A59A 1LCUA 2KKZA 1VK0A 2QWRA 1MDUB 2QWNA 3T1AA 5M1OA 3ZCMA 3WNGA 1Z26A 3ZT0A 1WNSA 1SL1A 2BUPA 2CGKA 2ITMA 4YHHK 2FXUA 2ZM6K 1N5YA 4BWMA 4FK2A 4XH4A 3CCMN 5CY4A 3AY9A 4JV5K 1ATNA 2UXDK 3VQ9A 1NGFA 3V6DA 2YHAA 1RFQA 3KIOA 5FROA 2GBZA 4H0OA 2PYLA 3KWIA 4CF9A 5AQSA 4FJIA 2HVIA 5EOYA 1JCGA 3KK3A 4IG0A 5AQZA 2RKIA 2E6MA 3QFPA 2E20A 2P9IB 4LC9B 1U45A 3BF3A 1T44A 4IO9L 2A40A 4QS7A 3RR8A 2KZMA 2CH5A 5JS2A 5I42A 3OYFA 3W3DA 1WSJA 3AA3A 3WEEA 4PKHA 1ASUA 4JI2K 3THWB 1OVQA 1A5XA 3VQ8A 2XHBA 5BR8K 4FM0A 4CK1A 4IFEA 4CHPA 4J2BA 1BQNA 3ZX0A 3VQ4A 3AVGA 3DOLA 3TR8A 3HO1A 3BY5A 2V7ZA 1KCFA 3CJCA 3K57A 1S22A 2KQ2A 4ZTFA 4FVMA 1SS6A 2ZF5O 2YJFA 2W42A 3LM2A 3D7EO 5JVGL 2NNWA 3THYB 1NNEA 1U2VA 2YNFA 2HBJA 3AAQA 4JKHA 4BY9C 4CESA 1BCMA 1GLCG 4MFBA 4CHQA 4N5SA 3MX2A 4CJSA 3QERA 3DLLL 2NRXA 5J1EA 3IKMA 3G71N 2DFEA 4R79A 2NRRA 3PO4A 2HHWA 4B9UA 2RN2A 3I0SA 1D9FA 4DTJA 4RWTA 3EN9A 3N4PA 1IV0A 4FCYA 1TKDA 5D3GA 3SLCA 4CJ3A 3H45C 1HKGA 2O4IA 5AQFA 3K2PA 1QZ5A 4CERA 3H1VX 3C6TA 4C8OA 1V4SA 3VQ6A 3O1WA 4EFHA 4IEIA 4RCHA 4WE1A 2YNHA 3QO9A 1Q81O 4EZ6A 3D6RA 4DUZK 4IOCL 4DFMA 1BI4B 4ELVA 3V1RA 2G8IA 4HWIA 1O13A 3CYMA 1JXEA 4PA1A 1LAWA 3WUHA 4HVJA 3TANA 1D9DA 4H8KA 1SKSA 4KHQA 4AHVA 3SUQA 1MU2A 3TARA 3V4IA 4F9OA 2CH6A 2O4GA 3G10A 1OH8A 3R6MA 2AA4A 1HKCA 2D1KA 4CEFA 1TV6A 5AQNA 3WNEA 4GV6A 1NG9A 1FW6A 1S5JA 1HNVA 3PX6A 4WFAL 2NRVA 5I9EB 4KO0A 4HCBA 2ZE2A 4B3RK 4Z94A 4B9VA 2KFNA 4IFYA 5BRFA 4HUFA 3AO1A 2QWMA 3CC7N 4HTLA 4M45A 3ZETB 1NGBA 3VGMA 4HUEA 4BE2A 3C6HA 2WTUA 2F9TA 3IS9A 3MAQA 4LSLA 3AVNA 1W2BM 3K9JA 3DOKA 3GG4A 1TL1A 2VQEK 3MX5A 2G8WA 3L2RA 2RF2A 2EX3A 1BIZA 1IKVA 2ASOA 3QIOA 3HI0A 1ZC6A 1NK4A 3V9UA 1NK5A 1HYZA 4GVMA 2FBYA 5GADP 1K8KA 3OYIA 5M1KA 3MK6A 3CJAA 3VPZA 3D2FB 4EP4A 2EWSA 1RT4A 3E9OA 4DTOA 3ZYYX 5M1FA 1HNIA 4B1ZA 4L8RB 1T05A 4JKGB 4IOAL 3JSMA 3VEVA 2X74A 4O5BA 2AJQA 3AA4A 3LWMA 4E3SA 4AM7A 4WQ5C 1XUPO 4ELUA 2UU9K 3IUCA 1VRTA 4M42A 2FF3B 5HROA 1W9HA 2OA8A 3G25A 2HHXA 1DT9A 4JI4K 5FPNA 3O6WA 2ZWHA 5AZIA 2XRIA 3ZX3A 4LFCK 2ETJA 1XC9A 1IBKK 1P90A 5AQQA 1CXUA 2D4WA 2QXFA 1EKEA 4C23A 4OLAA 5BR9A 2PFUA 1XMOK 4FWQA 4PKGA 4EHUA 3FGUA 3MEDA 4YOYA 3TSUA 1T3VA 3HXMA 3IDHA 3L0QA 4LD0A 4N56A 2KZZA 4WCEL 1KD1O 3PO5A 2A3ZA 2Z1IA 3EEQA 1IBLK 3OYCA 4IFVA 1HPZA 1WN7A 3A5OC 4WF9L 1YJWN 1X1PA 4GKJK 3AAPA 1NGHA 4H5NA 1C0MA 3SJJA 3ZSQA 3ATVA 3LZJA 1QTMA 3EKSA 3S41A 4JRQA 2CGJA 4CW7B 4KHNA 1RDDA 3I55N 4YNQA 3OYNA 2OTLN 2OPQA 1WAFA 3QBWA 3WT0A 2GTDA 3QMLA 4KHPK 4OPJA 1HNWK 4FJHA 1E4GT 4JI0K 4B9MA 4FLWA 3NMUA 3K5NA 4M7XA 3AGKA 5GINA 3S3OA 3LANA 5J2MA 1VQMN 2D0AA 1NGDA 3VQEA 4KH5A 4CE9A 4PKIA 4FOEA 1HLUA 4DSJA 1TL3A 3ZSOA 4BRQA 1I94K 1VSDA 1RGIA 1Z25A 3MDQA 3KK2A 4FLVA 4KI4A 3KLHA 2QXLA 1DTTA 1HRHA 3HM8A 4BQZA 2G8FA 2OPPA 5AQXA 5I3UA 1HYSA 1JLAA 2O8CA 3BUZB 3FR0A 3U9DA 3CM6A 2O8FA 2GWKA 3QINA 4IOXA 1NGAA 2P9UB 1JLFA 1YAGA 4H0YB 5DMRA 1S1XA 3SPZA 3ZSVA 3NDKA 1VAZA 3F5TA 4MO4A 3LL3A 4KH4A 4GMJB 5IWAK 3V9WA 3FZFA 1ZBSA 4FJ7A 4JAXA 4LF6K 2VG5A 4CVNE 4JD2A 5LL6Z 4DV6K 1VQ5N 4O55A 4BR2A 2WFBA 5BREA 1GOCA 2HNZA 3SPYA 4FJJA 1NJWA 3ASMA 4MLHA 1YTUA 1G15A 4NB4A 1VSIA 4OKEA 4O0JA 1EX4A 3CERA 3U9ZA 4KPYA 1YF5L 4H4MA 4MLEA 2HNDA 1T03A 2KHOA 3M8PA 1NKBA 1NM1A 3EE9A 1GLFO 3FZMA 3TI0A 3FE1A 1LAVA 2QKBA 1I39A 3IFRA 5C15A 3B6PA 2KTQA 4YOUA 2VG6A 3PSFA 2VGMA 4BRAA 4JHDB 3LDPA 4X66K 3RMBA 3TSPA 2BTFA 4CJLA 5KRTA 3O4QA 1IJJA 1E4FT 4NCAA 4DLEA 3O1BA 4CK2A 3OYBA 3OJUA 2HMIA 3KZBA 1LWEA 4DWIA 3M8QA 3LALA 4CCHA 4OVLA 5KPTA 4PY5A 5CZ1A 1NGGA 3VGLA 4Z4EA 4BDZA 1A5WA 1Q82O 5KTQA 4FZZA 4AHCA 5AZJB 1Q86O 4NYNA 3ZSRA 3DLHA 2FSJA 4CFAA 1BOTO 2P9LB 3IG1A 4K8ZA 1ITGA 4QAGA 4CK3A 1RBTA 3DRPA 4CECA 2QKKA 2Q36A 3I56N 1OH7A 1XWLA 4JN4A 2FC0A 4DU1A 3LPUA 3MN7A 4FM2A 3ALYA 4FPBA 4CFDA 2GEMA 3LWLA 3ZT2A 4DR7K 2WUSA 1BCOA 1NOYA 1XNRK 3R8EA 3T1YK 4RW9A 1YXQA 2YHBA 2J4RA 2IAJA 1BO5O 4DTXA 2DTUA 4NXMK 3VERA 4L3QA 2OTJN 1P8ZA 3DXMA 4FWPA 5C12A 4DSKA 1L5UA 5TKWA 4M63C 4B8AB 3L8BA 5GIOA 3EL2A 5FRNA 1F21A 3WNFA 1EWRA 4FO0A 3MXIA 2VG7A 2W6LA 4DU3A 3B6OA 1RTJA 4OPAA 1L3VA 3F2KA 2DFFA 5AR0A 4I6MA 4DR1K 3MECA 1ZBFA 1EWQA 5AQKA 4OPKA 5HRNA 4DFKA 3EO3A 3EY1A 2R7YA 4PQUA 3MEGA 4HCCA 5EXWA 4DF4A 3M3ZA 4H0TB 4BROA 1U4BA 4JI7K 1Z05A 4HHTA 4B9QA 3R1XA 4BRPA 1JLGA 1MWKA 5AJ3K 3CCEN 4WFNL 1DLOA 3OBYA 1ILYA 5C24A 1QVFM 1JL1A 2HHHK 4LF9K 2IVPA 3ID8A 2QM1A 3HSTB 4AHTA 1KC8O 1NWKA 3AGRA 3CC2N 3AVCA 3DJCA 5CZ2A 3TTCA 2X6NA 5CR4A 3KD1E 1QQMA 4DV0K 3ISNC 2ZD1A 3M8RA 3P38A 3VOVA 1CZAN 4DR3K 4F2RA 1YTAA 3WQUA 4H0PA 2O8DA 3ZEUB 4Z0UA 3VF6A 3O4WA 1KQSM 4GKKK 4DSIA 3C95A 1XI1A 3VN5A 3AVJA 1K6YA 3VQDA 4ID5A 1IKWA 1S1TA 3G4SN 1X9WA 2VWBA 4BC4A 3D45A 1K8AO 3O5BA 1SL0A 4KI6A 3HK2A 3OYAA 4H4OA 1C6VA 4LY7A 4E1NA 3BF1A 3M6GA 1RBRA 3LZIA 3S3NA 3ZT3A 3DWLA 2E2PA 2CGLA 2KFZA 1ASWA 4OKJA 4NXNK 4CGDA 3THXA 2P9KA 4ISGA 4JEPA 4CEAA 3PY8A 5CE3A 1KSPA 1YVUA 1QZ6A 3PX4A 1L3SA 3VEYA 3E01A 3H46O 3UIQA 3GOIA 3VEOA 3QNNA 5BPLA 4M3WA 4BGBA 4OLBA 2YHWA 4B3OA 4BDYA 3FZLA 3OS0A 4A5BA 4HUGA 2IS3A 1OH5A 1VQON 1TVRA 2P1JA 3VQQA 2WONA 5M1QA 4FXDA 2X6SA 3WXKA 4M3ZA 3CPWM 3LAKA 4IDHA 4A57A 4CGFA 3LDQA 4CIFA 2JWLA 4F8RA 3H08A 1QHTA 4CZEA 1U49A 2FBXA 1SL2A 4X65K 4DS5A 1NMNA 2D0OA 4FW1A 3NGYA 1T8EA 4DQ8A 3ID6A 1TUYA 3ZX2A 3S9HA 1QVGM 4EIAA 4FPAA 5LY3A 1BISA 1S3XA 1GLEG 5AQTA 1GLDG 1XHZA 4Q0BA 4KHYA 4BWJA 5HRSA 4DQQA 4W5NA 2H3GX 4FWRA 1FKOA 1BHLA 4FWLA 3CQXA 4OO1J 4RW6A 3R9PA 3HOSA 1RDAA 5ADXA 4BC3A 3HPHA 4FSVA 3UKRA 3CMEN 1T6CA 3AO3A 4DB3A 3LDOA 4KREA 1VSFA 4GY2B 1LW0A 1V4TA 5E84A 4DG1A 3O3HA 1RDCA 3CQYA 1JCEA 2QWPA 3TPQA 1KLMA 2WC9A 4AF1A 1VSKA 2YKMA 2BH1A 1RNHA 1CXQA 4K25A 3KKRA 5ADXH 3CFRA 1G99A 4RW4A 3IAYA 5E41A 1TK8A 2ZJPL 5HLFA 2EHGA 3E1YA 3D0PA 1ATSA 2OZSA 3DLBA 1TYQA 1TUUA 4H5WA 3SBTA 3QIPA 2UYTA 2HOEA 3CJ1A 3CIPA 5AQWA 4O5FA 1KAYA 3O9QA 4I2QA 4ICLA 4CI6A 2UXBK 1RT2A 3LAMA 4B9TA 4JI6K 3SQ1A 2ASPA 2OZMA 2WBNA 3RSEB 1BL3A 4JI5K 2BDPA 4CZIA 4AILC 4AM6A 3H6EA 1RT5A 3P5JA 2Q1NA 1N6QA 4JKCA 4OPHA 4W5OA 4CIGA 4O4GA 2P9NA 1HX1A 4UQGA 1T6DA 3JXUA 4CZGA 3PIOL 4WYBA 1YJNN 2UUAK 3FFIA 3LP2A 3K59A 2B4JA 3WXIA 4BR7A 1BGXT 3M8SA 3SUPA 4KH6A 3RTVA 4DV3K 3U4LA 4IKFA 1SV5A 3BEXA 4Z4GA 4KBOA 5KI6A 3O9RA 2F9WA 4OKKA 4E1JA 3A0IX 3UKUB 3O08A 4NLBA 4JK8A 3CCLN 3QEIA 3F9KA 1HQEA 1VQKN 4NCGA 2Q2RA 2HHSA 3ULEA 3CQ8A 3OY9A 4BG9A 3P83D 1REVA 2P5GA 4B9LA 2DFHA 5FPEA 1WSHA 4FVUA 2HB5A 1NKEA 4KAZA 1RCHA 4K41A 1NLVA 5GAHP 1WSEA 4BRLA 4DTSA 3EZ5A 5MLCQ 2FBVA 3O3GA 1NBWA 4CBWA 2E88A 3MN6A 3MMVA 3HSCA 1WUAA 4JI1K 3L2QA 3DYAA 3D2EA 1T7PA 1ZBUA 4B1XB 1UA1A 3VQAA 3AA5X 3HM9A 4O0IA 3NHGA 3VA3A 5AQLA 3AA2A 2GX9A 4IWVA 3RMAA 4I9LA 3V1OA 3HT3A 3CI5A 4CJFA 3P31A 1GLAG 3O9UA 4H5VA 1VSLA 4JS4A 5B8HA 1RILA 3WEEB 3CMAN 3EKUA 4FJXA 3L2UA 5SZTA 1YIJN 4C1NK 3ZT4A 1WBDA 3DXKA 4DV4K 3DAWA 2P9SA 3WXMB 3SQ2A 4BRKA 2GUPA 1X3MA 1ZBIA 1RDBA 4B3MK 5GAGP 4CGIA 4BVOA 1X9MA 4Y1DA 3J7AP 4CHZA 4LFBK 3NF6A 2OPSA 1NK9A 5C0YA 1RTHA 1KVCA 1KVBA 3CPEA 4CBXA 4XEIA 1C0GA 1KVAA 3F73A 1B92A 4FJLA 4BGAA 1U2VB 3NF7A 3SCXA 4YY3K 3C7NA 3HPOA 3CCVN 4ZHRA 3I8BA 3L3UA 3TAFA 1IKXA 2ASMA 3LP1A 3SNNA 2NLXA 2E4LA 2XY8A 2P9PA 1C1AA 4WQ4A 1WSFA 4FWMA 3LDSA 1UOCA 1C0UA 1NJZA 4PL8A 3UB5A 3MN9A 3O80A 1RBUA 3ATUA 3DLEA 4B1UB 3DRRA 4YORA 1CZBA 4J8FA 2E1ZA 2O8EA 2Z1HA 3OBWA 3J8AA 4H5RA 1WSGA 3T1HK 2HNYA 1XMQK 1QQOA 2VYPA 4HTUA 2A6AA 3CCUN 4LF7K 2HHUA 5DM7L 3G6EN 4B3TK 3CG7A 3TAPA 4Q5VA 3VF4A 1U48A 5AQRA 3KLEA 1U04A 4LFAK 3A2FA 4YDUA 1J5OA 3SBGA 3ZT1A 2O8BA 4CJVA 4H5TA 1VQ9N 4YFUA 3WXJA 4F3OA 4KRFA 5ELZA 3DRSA 1Y64A 1O1WA 3PX0A 2KLAA 1KRPA 4FYDA 4IZ9A 4XIUA 4MDBA 5KRSA 4DS4A 4K42A 4QOZB 5KGWA 2AP1A 3A8YA 2A5XA 3SMPA 4AH9A 3T3FA 1YITN 3R3LA 1OH6A 2YHXA 3SUOA 4KB1A 1J6ZA 2QWOA 1N36K 3RR7A 3OVNA 4IG3A 5KPZA 1S1WA 2BANA 4E7HA 1BUPA 1RDUA 4DTRA 3QEPA 4BDPA 2HMPA 4FW2A 1SAZA 3OYLA 3ZSXA 1NK7A 4DQIA 2IGIA 1EQYA 3TSQA 4BRMA 1H1VA 3AO4A 2P5OA 2Q0RA 4F2SA 1M1KO 3WNHA 4FWKA 4CJRA 3IRXA 3OS1A 4JI3K 5DK5A 1QS4A 2YJEA 3QLHA 4IDKA 1VSHA 3ZSZA 3NAEA 4B1VA 3V9XA 1NJIO 3C65A 1HNZK 4DR2K 3O8MA 5AQPA 3I8DA 4DTPA 3LM9A 4CZFA 5TKYA 1Y97A 5HBMA 1UA0A 2IVNA 2YKNA 2YV0X 3NBPA 4FWOA 1JLCA 1SUQA 4FJ9A 1K8KB 1WSIA 5BRDA 4JLHA 4A61A 4FWNA 4ELTA 4E1MA 1ZYQA 1GOAA 4DV2K 1X3NA 2B6AA 3GE1A 1KFDA 1NMDA 3DLKA 3G0ZA 1N32K 4CZHA 1RT1A 2HF3A 3QICA 1L3TA 3V9ZA 4DHYA 3OA9A 3FLCO 5E26A 4BRIA 3UE5A 3WQTA 2P9IA 4I2PA 4CJQA 4J2DA 3U6FA 4A5AA 1LV5A 3VF2A 3AVMA 3IMXA 3CJBA 1J5EK 3AV9A 2I5JA 2FSNA 3HP6A 4BE1A 1B9FA 3DI6A 5AZIB 5EU7A 2W40A 4MQ3A 3THWA 1JXBA 4JK9A 1NGCA 2PAVA 3QEXA 3K0SA 3HVRA 2G8HA 1Q18A 2F7TA 4K8XA 1RT3A 1YI2N 4W5TA 3O4NA 4JI8K 2BE2A 1NK6A 4DKWA 3HVTA 3O3FA 4CEEA 1BA1A 4K0KK 4CHOA 3MCPA 3CC4N 1TAUA 3OYEA 2LSNA 4A2BA 4EAHD 5M1PA 4BC2A 1HJRA 4J2EA 3ULDA 5FRMA 3THYA 2NUBA 4CBUA 1NGJA 3HP9A 3PSIA 4PHTX 3VESA 4PL7A 5CHIA 1GLLO 4B9NA 2G8UA 4O8KA 1ESVA 5BRHA 3K5MA 5LJWA 5LMNK 1KFSA 3BZKA 2ZGYA 1LOTB 1SZ2A 3VQ5A 1VQ7N 1VHXA 1NK8A 5HOOA 2O8EB 3NF9A 3VGKA 3QFUA 3PIPL 3CHWA 3P39A 4FK0A 4H03B 3KK1A 3ZSYA 2QW9A 4G1QA 3U3GA 4B1WB 2ATQA 5SWMA 1KAXA 3NGZA 3CFPA 1VSEA 3HL8A 3K5LA 1QHAA 2YHYA 1FXXA 4NO7A 4DV7K 4DU4A 5AQVA 3HOTA 4CJKA 2JLEA 5FPMA 3OYDA 1S72N 3I33A 1VQ4N 5KGXA 4KHWA 2O8CB 1NJYA 5H1SQ 2F4VK 4E19A 2O8FB 1X9JA 4BRHA 1EETA 3JAMO 1UAXA 3OYGA 3CXCM 4ZTJA 2QK9A 3KJVA 5JS1A 4CZKA 4IEEA 3QETA 1R59O 2GUIA 2QTDA 1RBSA 1DKGD 4WQ5A 3THVA 1KTQA 1SKRA 1QSLA 3RVCA 4B3SK 3VQPA 4JD2B 4FK4A 4CEBA 1KXPA 4ISFA 1EP4A 5BN8A 1WAJA 2F8TA 1NGEA 2PYJA 5AQJA 1Q8IA 4WQ4C 5HRRA 3RRHA 1NK0A 5AQOA 1WLJA 3ZETA 1S6QA 1S6PA 1I3AA 1TK5A 1YVNA 3KHYA 2X78A 4DR4K 4LF4K 5CYMA 5LMUK 3M5RA 2V7YA 2VGNA 2DY4A 3SV3A 3AVFA 3AVHA 4BREA 2ZJQL 2E2NA 4IO8A 2HHVA 3CCJN 3AVKA 4DQSA 2UUCK 5F2RA 2VQFK 4YDUC 5KPRA 4YOXA 4N76A 5HL7L 4PUOA 3DLGA 1QQNA 4FLYA 5C2FA 4O44A 4YOWA 2XY7A 3W0LA 4M3UA 3D2FA 4QS9A 3P4IA 1S9EA 4C1NI 1EXQA 2YNIA 2P51A 3L3VA 3L4QA 4JKGA 3A5NC 1A5VA 5J2NA 4DSLA 1W0HA 4GNIA 4CJEA 2KW4A 4CEDA 1J9AA 1UWBA 2ITGA 4BACA 1WB9A 1D8YA 4JK7A 3ZLJA 3AO2A 2XY5A 1Z6RA 4BRFA 4FLTA 3QNOA 3K9KA 5BN9A 4JKAA 5DM6L 3VA0A 1N8RO 2QWLA 4MDAA 2E8AA 4AHRA 4NCBA 1J54A 1RTIA 4CJTA 3TAEA 3V9SA 3SAGA 3NFAA 2OPRA 4CEQA 2NRHA 2A42A 3LDNA 3LP3A 4H0XB 3TAMA 3TTFA 4DV1K 3HJFA 2ZJRL 5JICA 4CEOA 3JYTA 4CZMA 4QCLA 4EP5A 4UY8O 1NOZA 4BQLA 4ILHA 1BQMA 2FSKA 3L6QA 4FLXA 3DXMB 1DTQA 2Z1JA 2E2OA 2QA4N 2GWJA 4JS5A 3DM2A 3K5OA 4E7KA 3SUNA 5J2PA 2V52B 4DTUA 2BGGA 2Q3SA 4B8CA 2VWKA 4F3TA 3SJHA 3VENA 4Z4HA 1VRUA 2IC3A 3SI6A 2IOCA 4I6MB 4CJWA 3SK3A 2HF4A 3QESA 3ITHA 3SV4A 1HKBA 3SQ4A 1WBBA 1YUWA 4JKFA 2FF6A 2PY5A 3E9PA 4W5RA 1W7AA 1IKYA 1C0TA 3CCQN 5AQUA 1OKJA 1RT6A 4W5QA 3E9LA 1L3UA 3CETA 1TGOA 3SZ2A 4KHUA 4CFBA 1XNQK 2OYQA 3AARA 3NF8A 4RW7A 4KTQA 4A62A 3MXJA 3KK7A 4CF0A 1TKTA 3P1GA 3VEZA 3DLRA 4CGHA 3SYZA 3H1QA 4BR5A 3OYKA 3J81O 4CD3A 4U7BA 1VQLN 3SQ0A 2E2QA 3AO5A 2YCHA 3GDQA 1HQUA 1YT3A 2E6LA 1XHXA 4NYFA 2P9UA 1HYVA 2O8DB 4FL9A 3MN5A 3Q7CA 4LH5A 4LSNA 1CLQA 4AHSA 1FK9A 3AVAA 2Z1GA 3QDKA 1YJ9N 2A1RA 2W6KA 4BRGA 3BGRA 3PUFA 3KVGA 1EO1A 4OX9K 4F4KA 3HPGA 2IIRA 4M3TA 4FJMA 1J53A 3KLIA 1IH7A 1MA9B 3NH1A 4O8UA 3HRGA 4FWSA 4DQRA 1N33K 3CFOA 3VTIA 1HMVA 3C6UA 3MCAB 4X62K 3Q7BA 3RMCA 1NJXA 5C42A 5LJVA 3THXB 2P9KB 3RRGA 3WXLA 2Y1IA 2V51B 2Q97A 5C10A 1RBVA 4ID1A 1GOBA 3E66A 4B1YB 4EHTA 3TAQA 4FJKA 1VQNN 4GV9A 3KKSA 2Q0UA 4IXCA 3TU5A 3CJ9A 3LDLA 1IG8A 3AVBA 4BRCA 4DF8A 4A2AA 1HUXA 3NE6A 1E3MA 2NRWA 1S9GA 3L2VA 3C94A 2GV9A 4BRDA 4KV8A 3QEVA 3HTVA 4XH5A 3KWGA 5BPNA 3SAFA 3ZSWA 1U47A 4JRPA 4DSEA 3SMSA 4JHDA 4Y0WA 1B9DA 2OCEA 1RTDA 1X9SA 1NGIA 4CF2A 3NH2A 1VQ8N 2JGUA 3CD6N 3OYMA 1K73O 3U8XA 3J80O 1BA0A 1WOQA 1C0FA 4E7IA 3I0RA 2Q31A 4FM1A 3BP8A 4RG8A 2E1YA 1ZBHA 4ILJA 1NKCA 2DPNA 5GIPA 5AZJA 4IBNA 3V1QA 2D0CA 4DSFA 2QI2A 1VQPN 2P9LA 3J7ZO 4DV5K 4CGGA 5EY4A 5IT9O 4LF8K 4QS8A 3TTDA 1LWFA 3RMDA 4N47A 4JKEA 5EX5A 1GLBG 1BG3A 3T19A 3PLAA 2Y1JA 4JKBA 3K58A 3KTQA 3UKRB 1K9MO 5JLHA 4DCHA 2IDOA 2I7NA 5AFUA 1C1CA 1LW2A 4JYAK 2NRZA 5AQMA 5KQ8A 4DTMA 4M3YA 2YI1A 2QEXN 3VQCA 3SAHA 5AQGA 3VMFB 1JJ2M 3C6AA 2XO7A 2PZSA 2UXCK 2B5JA 1HPMA 5J2QA 1NU0A 4V19S 3CCRN 1TAQA 3MWPA 3OW2M 5AFUH 5C2DA 4M3RA 1TYQB 5K14A 1BDGA 1U6ZA 2RHKA 4CF8A 1N34K 4N41A 2ZQBA 3OHRA 3T7ZA 3CF5L 3EZWA 3RWUA 4FLUA 4C8LA 4Z4IA 1W97L 3MXMA 4OGEA 1SKWA 1FKPA 3VTHA 4CF1A 5JLFA 1MWMA 1IBMK 4BE0A 4KB0A 4RTFD 5AQIA 3NGIA 2P9NB 4CJ4A 3FZKA 4B9SA 1BWFO 5FDLA 4WFBL 4E7LA 1QQCA 4PWDA 1LWCA 4FZYA 3BZCA 1TKZA 3DMJA 4E7JA 1VQ6N 5F1XA 3KLGA 4FJ5A 1R0AA 3O9SA 5BPMA 3KLFA 4C8KA 3OYHA 1ASVA 1RDWX 4DFPA 4YOVA 1D4XA 2RE2A 4DR5K 3U3YA 4ISEA 3TWHA 1DEJA 1SQKA 2JWKA 3JS6A 5KQDA 3ZEUA 4Z4FA 3AVLA 3OTOK 4IJNA 3ULEB 4CZJA 2D0PA 3MEEA 4XH1A 5A2QO 3L2WA 5AQHA 3VEWA 5FLXO 2GELA 3LPTA 1D5AA 2G8VA 3NVKA 4M3XA 3TAGA 1GLJO 2WOMA 2UUBK 3FFKB 2G8KA 1KAZA 1S1UA 1JLBA 1DGKN 3OS2A 5JVHL 4B08A 3D2EB 1JCFA 5EVZA 1IO2A 2HHQA 2XY6A 2D0BA 2PBDA 4C8NA 4CD1A 2RPIA 1QE1A 4NLCA 3MWTA 2HBMA 1Q9XA 4GV3A 4GVEA 4BR4A 4DMNA 3LP0A 4LF5K 1CZ9A 3KD5E 2NRTA 2ZGZA 2VWJA 3HBTA 4M7YA 1JLEA 3NH0A 4I9QA 3ENBA 3NCIA 1TKXA 3T69A 3A5MC 4EZ9A 4AQYK 1YHQN 5F0XA 1JL2A 4CHYA 1Q7YO 3DXKB 1HJOA 3GL1A 3QB0A 3M1FA 2P9SB 1ZBLA 4KTZA 4CJUA 4CIEA 2F96A 4AHUA 4FJ8A 3CCSN 4DUYK 4KTWA 4BRNA 4DFJA 4KFBA 4OJRA 4OGCA 3L4IA 4I7FA 1ZXOA 1XQSC 2A1SA 4ILGB 2W41A 4FOIA 2OANA 4BVPA 3C7NB 4TSXA 2HBLA 4C8MA 1XC3A 2FBTA 3NVMA 4FJGA 2E5LK 3FZHA 4BR9A 2F8SA 3B8AX 2VCPA 3VEXA 2YNGA 4DQPA 3O9TA
chains in the Genus database with same CATH topology
4KI4A 3KLHA 4R5PA 3P83D 1DTTA 1HRHA 1REVA 2P5GA 3TABA 2G8FA 1S9EA 2OPPA 1EXQA 1RT7A 5I3UA 2DFHA 4B9LA 1HYSA 1WSHA 2YNIA 2P51A 3L3VA 1JLAA 4CJPA 2HB5A 5CYQA 1NKEA 4KHSA 5T7BA 2HW3A 1A5VA 4KAZA 5J2NA 1RCHA 4CHNA 3EYZA 4DSLA 1WSEA 3CM6A 4DTNA 1W0HA 4CFCA 3QINA 4CJEA 2KW4A 4DTSA 1TK0A 1JLFA 4CEDA 3EZ5A 1J9AA 2FBVA 5DMRA 1S1XA 3V81A 1KLNA 1UWBA 3O3GA 2ITGA 4BACA 3SPZA 4CJ5A 1D8YA 3ZSVA 3NDKA 3AO2A 2XY5A 4FLTA 3QNOA 1VSMA 3CM5A 3L2QA 4E0DA 3DYAA 4GMJB 3VA0A 3V9WA 1ZBUA 1T7PA 1JKHA 3VQBA 1UA1A 4AHRA 3VQAA 4NCBA 4FJ7A 1J54A 1RTIA 3AA5X 4Y1CA 4CJTA 4O0IA 3HM9A 3NHGA 3V9SA 3VA3A 3TAEA 2VG5A 3NFAA 2OPRA 3AA2A 4CEQA 3RMAA 4CEZA 3LP3A 3TAMA 4FJNA 1VSJA 4FLZA 4I9LA 4O55A 4CGJA 3V1OA 3HT3A 3HJFA 4CJFA 1S1VA 1BI4A 3VQ7A 4CEOA 1GOCA 1VSLA 3OJSA 3JYTA 4JS4A 4QCLA 4KKOA 4EP5A 2HNZA 1NOZA 3SPYA 4FJJA 1BQMA 4M41A 1NJWA 1RILA 3ASMA 4FLXA 4GW6A 4LH4A 1YTUA 1G15A 1DTQA 2Z1JA 4FJXA 1VSIA 4OKEA 4O0JA 1EX4A 3L2UA 3DM2A 3K5OA 5SZTA 3AVIA 4JS5A 4E7KA 3SUNA 1QSSA 5J2PA 4KPYA 2HHTA 5C25A 3ZT4A 4DTUA 2BGGA 2Q3SA 4H4MA 2HNDA 4B8CA 2VWKA 3OYJA 1T03A 1NKBA 3M8PA 4FZXC 4F3TA 4Z4HA 4Z4CA 1VRUA 3SQ2A 2IC3A 3SI6A 2IOCA 3TI0A 1LAVA 4E89A 4DLGA 2QKBA 4CJWA 1I39A 1RDBA 1QSYA 1ZBIA 1C1BA 3B6PA 4CGIA 3QESA 1X9MA 2KTQA 4Y1DA 5HRPA 3ITHA 4CHZA 3SV4A 1BIUA 3NF6A 2OPSA 2VG6A 2D5RA 1NK9A 3SQ4A 1IG9A 3HYFA 5HP1A 1RTHA 1KVCA 1KVBA 4RW8A 3QEWA 2PY5A 2HVHA 4W5RA 3RMBA 1IKYA 1C0TA 1KVAA 1RT6A 3F73A 1B92A 4W5QA 3S3MA 1Q9YA 3NF7A 3SCXA 4FJLA 1L3UA 3PV8A 4J2AA 5KRTA 4CJLA 1JLQA 1TGOA 3BDPA 3O4QA 3HPOA 4EZ6A 3SZ2A 4KHUA 4CFBA 2OYQA 3NF8A 4RW7A 4ZHRA 1VK0A 4KTQA 4NCAA 3MXJA 3L3UA 3TAFA 1IKXA 4DLEA 3LP1A 4CF0A 3SNNA 1TKTA 3P1GA 4CK2A 3DLRA 2E4LA 2XY8A 3T1AA 4CGHA 3OYBA 3OJUA 2HMIA 3SYZA 1C1AA 3ZCMA 3OYKA 1LWEA 3VN5A 1WSFA 4DWIA 3M8QA 3WNGA 3LALA 4CCHA 3LDSA 1Z26A 1UOCA 1C0UA 4OVLA 3ZT0A 1WNSA 3SQ0A 1NJZA 5CZ1A 1SL1A 4PY5A 4Z4EA 3AO5A 1A5WA 1RBUA 4BDZA 3DLEA 3DRRA 5KTQA 4FZZA 4AHCA 1CZBA 1HQUA 1YT3A 2E6LA 4NYNA 1XHXA 4NYFA 3ZSRA 3DLHA 1N5YA 4BWMA 4FK2A 4CFAA 5CY4A 2Z1HA 1HYVA 1WSGA 3IG1A 2HNYA 4LH5A 4K8ZA 4LSNA 1ITGA 1CLQA 3VQ9A 4QAGA 4AHSA 1FK9A 3V6DA 2YHAA 4CK3A 1RBTA 3DRPA 3AVAA 3CQ8A 4CECA 4HTUA 2Z1GA 3KIOA 2GBZA 5FROA 2QKKA 2PYLA 1XWLA 2HHUA 2A1RA 2FC0A 4DU1A 4CF9A 3LPUA 4FJIA 4FM2A 2HVIA 3CG7A 3BGRA 3ALYA 3PUFA 4CFDA 3KK3A 4Q5VA 3TAPA 3LWLA 3ZT2A 4IG0A 1BCOA 1NOYA 2RKIA 4F4KA 1U48A 3KLEA 1U04A 3HPGA 4RW9A 4M3TA 3A2FA 2E6MA 4FJMA 2YHBA 1J53A 3KLIA 1J5OA 1IH7A 3NH1A 2IAJA 3ZT1A 4DQRA 4DTXA 4CJVA 2DTUA 3CFOA 4YFUA 1U45A 4F3OA 4KRFA 1HMVA 3C6UA 3RR8A 2KZMA 3RMCA 3DRSA 1NJXA 5JS2A 5C42A 1O1WA 5I42A 3OYFA 3PX0A 3RRGA 2Y1IA 1KRPA 1WSJA 3AA3A 4DSKA 1RBVA 4ID1A 1ASUA 1GOBA 4B8AB 4XIUA 3L8BA 3TAQA 1L5UA 5KRSA 4FYDA 4DS4A 3KKSA 1A5XA 5KGWA 3VQ8A 4QOZB 5FRNA 1F21A 3WNFA 4AH9A 2XHBA 3AVBA 3T3FA 4DF8A 3MXIA 2VG7A 4FM0A 4CK1A 3NE6A 4DU3A 3B6OA 3SUOA 1RTJA 4KB1A 1L3VA 2DFFA 4CHPA 4J2BA 1BQNA 1S9GA 3L2VA 3C94A 2GV9A 4KV8A 3RR7A 3MECA 3QEVA 1ZBFA 3OVNA 3AVGA 3VQ4A 4OPKA 3DOLA 5HRNA 4IG3A 3TR8A 3HO1A 3ZSWA 1U47A 1S1WA 2BANA 4JRPA 4E7HA 4DSEA 4DFKA 1KCFA 3K57A 1B9DA 2KQ2A 4DTRA 3QEPA 3EY1A 4ZTFA 4BDPA 2R7YA 4FVMA 3MEGA 1RTDA 4HCCA 4PQUA 1X9SA 4DF4A 4FW2A 2W42A 3OYLA 4CF2A 3ZSXA 1U4BA 1NK7A 4DQIA 2IGIA 2YNFA 3NH2A 4HHTA 2JGUA 1JLGA 4CESA 3OYMA 1DLOA 1BCMA 3AO4A 2P5OA 4MFBA 4CHQA 4N5SA 4F2SA 5C24A 4E7IA 3I0RA 1JL1A 3WNHA 4CJRA 4FM1A 3IRXA 3OS1A 4CJSA 3HSTB 4AHTA 5DK5A 1QS4A 3QERA 3QLHA 4IDKA 3ZSZA 1VSHA 3NAEA 4RG8A 3AVCA 3V9XA 5CZ2A 5J1EA 2X6NA 1ZBHA 2DFEA 3KD1E 3PO4A 2HHWA 4B9UA 3I8DA 2RN2A 4DTPA 3ISNC 1NKCA 2ZD1A 3M8RA 3I0SA 1D9FA 1Y97A 4DTJA 5HBMA 1UA0A 4IBNA 3V1QA 2D0CA 2YV0X 2YKNA 3NBPA 4FCYA 4DSFA 1TKDA 4F2RA 5D3GA 1YTAA 1JLCA 4CJ3A 1SUQA 4FJ9A 1WSIA 4Z0UA 4CGGA 2O4IA 4JLHA 3K2PA 4CERA 1LWFA 3RMDA 4ELTA 4N47A 4E1MA 3C6TA 1ZYQA 1GOAA 4C8OA 4DSIA 3C95A 3VQ6A 2B6AA 1XI1A 4WE1A 3T19A 3AVJA 1K6YA 2YNHA 1KFDA 3QO9A 4ID5A 1IKWA 1S1TA 3VQDA 3DLKA 3G0ZA 3K58A 2Y1JA 3KTQA 1X9WA 3D45A 4DFMA 1RT1A 1BI4B 1L3TA 1SL0A 2IDOA 3V9ZA 4ELVA 4KI6A 3HK2A 3V1RA 3OYAA 4H4OA 2G8IA 1C6VA 4LY7A 4E1NA 3LZIA 1RBRA 3S3NA 1C1CA 1LW2A 3CYMA 3ZT3A 4I2PA 4CJQA 4DTMA 4J2DA 1JXEA 3U6FA 4PA1A 1LV5A 4FJKA 4M3YA 1LAWA 3VQCA 4HVJA 3TANA 1D9DA 3AVMA 4H8KA 1SKSA 4KHQA 2KFZA 4AHVA 1ASWA 3SUQA 1MU2A 3TARA 3V4IA 3AV9A 4OKJA 2I5JA 4CGDA 3HP6A 2XO7A 2O4GA 4BE1A 2PZSA 1B9FA 3DI6A 2B5JA 3G10A 5EU7A 4CEAA 5J2QA 4MQ3A 3PY8A 1KSPA 1YVUA 4CEFA 1JXBA 1TV6A 3QEXA 3WNEA 3PX4A 1L3SA 3E01A 3HVRA 1S5JA 1TAQA 2G8HA 3UIQA 3QNNA 1HNVA 3PX6A 4M3WA 4OLBA 4B3OA 4K8XA 1RT3A 4KO0A 4M3RA 4BDYA 4W5TA 3OS0A 5K14A 3O4NA 4CF8A 2ZE2A 4HUGA 4HCBA 2BE2A 1NK6A 2IS3A 3HVTA 2ZQBA 4B9VA 4N41A 3O3FA 2KFNA 4IFYA 4CEEA 4CHOA 1TVRA 4HUFA 2P1JA 3VQQA 3AO1A 2WONA 3RWUA 4FXDA 2X6SA 4FLUA 4C8LA 4M45A 4Z4IA 4M3ZA 1TAUA 3MXMA 3LAKA 3OYEA 4CGFA 2LSNA 4HUEA 4BE2A 4OGEA 1SKWA 1FKPA 3IS9A 4CF1A 4CIFA 3MAQA 1HJRA 4J2EA 3ULDA 4F8RA 3H08A 4LSLA 5FRMA 1QHTA 2NUBA 4BE0A 1U49A 3AVNA 2FBXA 4KB0A 3HP9A 1SL2A 3DOKA 4DS5A 1TL1A 3NGIA 4CJ4A 2G8WA 4FW1A 3NGYA 4B9SA 5FDLA 4E7LA 1T8EA 4B9NA 1QQCA 3L2RA 2G8UA 4M3UA 4PWDA 1LWCA 2RF2A 3S9HA 4FZYA 2EX3A 1TKZA 3DMJA 3K5MA 1BIZA 4E7JA 1KFSA 1IKVA 1BISA 3KLGA 4FJ5A 3VQ5A 1R0AA 3KLFA 1XHZA 3QIOA 1NK8A 3OYHA 1ASVA 4C8KA 3NF9A 4DFPA 3U3YA 1NK4A 4Q0BA 3V9UA 1NK5A 4KHYA 1HYZA 4BWJA 5HRSA 3TWHA 4FK0A 4GVMA 2FBYA 4DQQA 3KK1A 4W5NA 3ZSYA 1FKOA 4G1QA 3U3GA 4Z4FA 2ATQA 5SWMA 3OYIA 1BHLA 3AVLA 4EP4A 3NGZA 3CFPA 4RW6A 1RT4A 3MEEA 1VSEA 4DTOA 1RDAA 3HL8A 3L2WA 3K5LA 1FXXA 4DU4A 1HNIA 4L8RB 1T05A 3HPHA 4CJKA 2JLEA 3OYDA 3AO3A 3JSMA 5KGXA 4KHWA 2X74A 1NJYA 4O5BA 2AJQA 4E19A 3AA4A 3LPTA 1D5AA 3LWMA 4E3SA 2G8VA 4KREA 1VSFA 4M3XA 3TAGA 1LW0A 4ELUA 4DG1A 1EETA 3O3HA 1RDCA 1VRTA 1KLMA 4M42A 1UAXA 3OYGA 2WOMA 4ZTJA 1VSKA 1S1UA 5HROA 2G8KA 1JLBA 3KJVA 2YKMA 2QK9A 5JS1A 1W9HA 3OS2A 2OA8A 1RNHA 2HHXA 4B08A 1CXQA 3QETA 3KKRA 2GUIA 3CFRA 2XRIA 1IO2A 2HHQA 1RBSA 2XY6A 2ETJA 4RW4A 3IAYA 5E41A 1XC9A 3THVA 1KTQA 1SKRA 1QSLA 2D0BA 1CXUA 2QXFA 1TK8A 1EKEA 3VQPA 5HLFA 4C8NA 2RPIA 4FK4A 2EHGA 4OLAA 1QE1A 4CEBA 3D0PA 1EP4A 2OZSA 3DLBA 1WAJA 1Q9XA 2F8TA 4DMNA 3LP0A 3QIPA 4I2QA 1CZ9A 3MEDA 3KD5E 2PYJA 4ICLA 3HXMA 1RT2A 3LAMA 1Q8IA 2VWJA 3SQ1A 4B9TA 5HRRA 4LD0A 1JLEA 4N56A 2OZMA 2KZZA 3RRHA 1NK0A 1WLJA 3PO5A 3NH0A 1BL3A 2Z1IA 4FLVA 2BDPA 3OYCA 4AILC 4IFVA 1HPZA 1S6PA 1I3AA 1S6QA 3NCIA 1TKXA 1TK5A 4I9QA 1WN7A 1RT5A 4EZ9A 1X1PA 3P5JA 2X78A 1JL2A 1N6QA 4W5OA 1C0MA 4CHYA 3SJJA 5CYMA 3ZSQA 3LZJA 4CIGA 4O4GA 1QTMA 4UQGA 1ZBLA 4KTZA 4CJUA 4CIEA 2DY4A 2F96A 4AHUA 3SV3A 4FJ8A 4JRQA 4KTWA 4KHNA 1RDDA 3FFIA 4YNQA 3OYNA 3AVFA 3AVHA 2OPQA 1WAFA 3LP2A 3K59A 2B4JA 4DFJA 1BGXT 4OPJA 3M8SA 3SUPA 3RTVA 2HHVA 4KFBA 4OJRA 4FJHA 4OGCA 3AVKA 4DQSA 4B9MA 4FLWA 4IKFA 1SV5A 3K5NA 4Z4GA 4I7FA 2A1SA 5KI6A 3LANA 3S3OA 4OKKA 5J2MA 4TSXA 4N76A 4C8MA 2FBTA 4FJGA 2D0AA 3VQEA 4CE9A 3QEIA 4PUOA 2F8SA 3F9KA 1HQEA 3DLGA 4FLYA 4DSJA 1TL3A 4O44A 4NCGA 3ZSOA 1VSDA 2XY7A 1Z25A 3KK2A 2HHSA 3OY9A 2YNGA 4DQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KI4 A;  3KLH A;  4R5P A;  3P83 D;  1DTT A;  1HRH A;  1REV A;  2P5G A;  3TAB A;  2G8F A;  1S9E A;  2OPP A;  1EXQ A;  1RT7 A;  5I3U A;  2DFH A;  4B9L A;  1HYS A;  1WSH A;  2YNI A;  2P51 A;  3L3V A;  1JLA A;  4CJP A;  2HB5 A;  5CYQ A;  1NKE A;  4KHS A;  5T7B A;  2HW3 A;  1A5V A;  4KAZ A;  5J2N A;  1RCH A;  4CHN A;  3EYZ A;  4DSL A;  1WSE A;  3CM6 A;  4DTN A;  1W0H A;  4CFC A;  3QIN A;  4CJE A;  2KW4 A;  4DTS A;  1TK0 A;  1JLF A;  4CED A;  3EZ5 A;  1J9A A;  2FBV A;  5DMR A;  1S1X A;  3V81 A;  1KLN A;  1UWB A;  3O3G A;  2ITG A;  4BAC A;  3SPZ A;  4CJ5 A;  1D8Y A;  3ZSV A;  3NDK A;  3AO2 A;  2XY5 A;  4FLT A;  3QNO A;  1VSM A;  3CM5 A;  3L2Q A;  4E0D A;  3DYA A;  4GMJ B;  3VA0 A;  3V9W A;  1ZBU A;  1T7P A;  1JKH A;  3VQB A;  1UA1 A;  4AHR A;  3VQA A;  4NCB A;  4FJ7 A;  1J54 A;  1RTI A;  3AA5 X;  4Y1C A;  4CJT A;  4O0I A;  3HM9 A;  3NHG A;  3V9S A;  3VA3 A;  3TAE A;  2VG5 A;  3NFA A;  2OPR A;  3AA2 A;  4CEQ A;  3RMA A;  4CEZ A;  3LP3 A;  3TAM A;  4FJN A;  1VSJ A;  4FLZ A;  4I9L A;  4O55 A;  4CGJ A;  3V1O A;  3HT3 A;  3HJF A;  4CJF A;  1S1V A;  1BI4 A;  3VQ7 A;  4CEO A;  1GOC A;  1VSL A;  3OJS A;  3JYT A;  4JS4 A;  4QCL A;  4KKO A;  4EP5 A;  2HNZ A;  1NOZ A;  3SPY A;  4FJJ A;  1BQM A;  4M41 A;  1NJW A;  1RIL A;  3ASM A;  4FLX A;  4GW6 A;  4LH4 A;  1YTU A;  1G15 A;  1DTQ A;  2Z1J A;  4FJX A;  1VSI A;  4OKE A;  4O0J A;  1EX4 A;  3L2U A;  3DM2 A;  3K5O A;  5SZT A;  3AVI A;  4JS5 A;  4E7K A;  3SUN A;  1QSS A;  5J2P A;  4KPY A;  2HHT A;  5C25 A;  3ZT4 A;  4DTU A;  2BGG A;  2Q3S A;  4H4M A;  2HND A;  4B8C A;  2VWK A;  3OYJ A;  1T03 A;  1NKB A;  3M8P A;  4FZX C;  4F3T A;  4Z4H A;  4Z4C A;  1VRU A;  3SQ2 A;  2IC3 A;  3SI6 A;  2IOC A;  3TI0 A;  1LAV A;  4E89 A;  4DLG A;  2QKB A;  4CJW A;  1I39 A;  1RDB A;  1QSY A;  1ZBI A;  1C1B A;  3B6P A;  4CGI A;  3QES A;  1X9M A;  2KTQ A;  4Y1D A;  5HRP A;  3ITH A;  4CHZ A;  3SV4 A;  1BIU A;  3NF6 A;  2OPS A;  2VG6 A;  2D5R A;  1NK9 A;  3SQ4 A;  1IG9 A;  3HYF A;  5HP1 A;  1RTH A;  1KVC A;  1KVB A;  4RW8 A;  3QEW A;  2PY5 A;  2HVH A;  4W5R A;  3RMB A;  1IKY A;  1C0T A;  1KVA A;  1RT6 A;  3F73 A;  1B92 A;  4W5Q A;  3S3M A;  1Q9Y A;  3NF7 A;  3SCX A;  4FJL A;  1L3U A;  3PV8 A;  4J2A A;  5KRT A;  4CJL A;  1JLQ A;  1TGO A;  3BDP A;  3O4Q A;  3HPO A;  4EZ6 A;  3SZ2 A;  4KHU A;  4CFB A;  2OYQ A;  3NF8 A;  4RW7 A;  4ZHR A;  1VK0 A;  4KTQ A;  4NCA A;  3MXJ A;  3L3U A;  3TAF A;  1IKX A;  4DLE A;  3LP1 A;  4CF0 A;  3SNN A;  1TKT A;  3P1G A;  4CK2 A;  3DLR A;  2E4L A;  2XY8 A;  3T1A A;  4CGH A;  3OYB A;  3OJU A;  2HMI A;  3SYZ A;  1C1A A;  3ZCM A;  3OYK A;  1LWE A;  3VN5 A;  1WSF A;  4DWI A;  3M8Q A;  3WNG A;  3LAL A;  4CCH A;  3LDS A;  1Z26 A;  1UOC A;  1C0U A;  4OVL A;  3ZT0 A;  1WNS A;  3SQ0 A;  1NJZ A;  5CZ1 A;  1SL1 A;  4PY5 A;  4Z4E A;  3AO5 A;  1A5W A;  1RBU A;  4BDZ A;  3DLE A;  3DRR A;  5KTQ A;  4FZZ A;  4AHC A;  1CZB A;  1HQU A;  1YT3 A;  2E6L A;  4NYN A;  1XHX A;  4NYF A;  3ZSR A;  3DLH A;  1N5Y A;  4BWM A;  4FK2 A;  4CFA A;  5CY4 A;  2Z1H A;  1HYV A;  1WSG A;  3IG1 A;  2HNY A;  4LH5 A;  4K8Z A;  4LSN A;  1ITG A;  1CLQ A;  3VQ9 A;  4QAG A;  4AHS A;  1FK9 A;  3V6D A;  2YHA A;  4CK3 A;  1RBT A;  3DRP A;  3AVA A;  3CQ8 A;  4CEC A;  4HTU A;  2Z1G A;  3KIO A;  2GBZ A;  5FRO A;  2QKK A;  2PYL A;  1XWL A;  2HHU A;  2A1R A;  2FC0 A;  4DU1 A;  4CF9 A;  3LPU A;  4FJI A;  4FM2 A;  2HVI A;  3CG7 A;  3BGR A;  3ALY A;  3PUF A;  4CFD A;  3KK3 A;  4Q5V A;  3TAP A;  3LWL A;  3ZT2 A;  4IG0 A;  1BCO A;  1NOY A;  2RKI A;  4F4K A;  1U48 A;  3KLE A;  1U04 A;  3HPG A;  4RW9 A;  4M3T A;  3A2F A;  2E6M A;  4FJM A;  2YHB A;  1J53 A;  3KLI A;  1J5O A;  1IH7 A;  3NH1 A;  2IAJ A;  3ZT1 A;  4DQR A;  4DTX A;  4CJV A;  2DTU A;  3CFO A;  4YFU A;  1U45 A;  4F3O A;  4KRF A;  1HMV A;  3C6U A;  3RR8 A;  2KZM A;  3RMC A;  3DRS A;  1NJX A;  5JS2 A;  5C42 A;  1O1W A;  5I42 A;  3OYF A;  3PX0 A;  3RRG A;  2Y1I A;  1KRP A;  1WSJ A;  3AA3 A;  4DSK A;  1RBV A;  4ID1 A;  1ASU A;  1GOB A;  4B8A B;  4XIU A;  3L8B A;  3TAQ A;  1L5U A;  5KRS A;  4FYD A;  4DS4 A;  3KKS A;  1A5X A;  5KGW A;  3VQ8 A;  4QOZ B;  5FRN A;  1F21 A;  3WNF A;  4AH9 A;  2XHB A;  3AVB A;  3T3F A;  4DF8 A;  3MXI A;  2VG7 A;  4FM0 A;  4CK1 A;  3NE6 A;  4DU3 A;  3B6O A;  3SUO A;  1RTJ A;  4KB1 A;  1L3V A;  2DFF A;  4CHP A;  4J2B A;  1BQN A;  1S9G A;  3L2V A;  3C94 A;  2GV9 A;  4KV8 A;  3RR7 A;  3MEC A;  3QEV A;  1ZBF A;  3OVN A;  3AVG A;  3VQ4 A;  4OPK A;  3DOL A;  5HRN A;  4IG3 A;  3TR8 A;  3HO1 A;  3ZSW A;  1U47 A;  1S1W A;  2BAN A;  4JRP A;  4E7H A;  4DSE A;  4DFK A;  1KCF A;  3K57 A;  1B9D A;  2KQ2 A;  4DTR A;  3QEP A;  3EY1 A;  4ZTF A;  4BDP A;  2R7Y A;  4FVM A;  3MEG A;  1RTD A;  4HCC A;  4PQU A;  1X9S A;  4DF4 A;  4FW2 A;  2W42 A;  3OYL A;  4CF2 A;  3ZSX A;  1U4B A;  1NK7 A;  4DQI A;  2IGI A;  2YNF A;  3NH2 A;  4HHT A;  2JGU A;  1JLG A;  4CES A;  3OYM A;  1DLO A;  1BCM A;  3AO4 A;  2P5O A;  4MFB A;  4CHQ A;  4N5S A;  4F2S A;  5C24 A;  4E7I A;  3I0R A;  1JL1 A;  3WNH A;  4CJR A;  4FM1 A;  3IRX A;  3OS1 A;  4CJS A;  3HST B;  4AHT A;  5DK5 A;  1QS4 A;  3QER A;  3QLH A;  4IDK A;  3ZSZ A;  1VSH A;  3NAE A;  4RG8 A;  3AVC A;  3V9X A;  5CZ2 A;  5J1E A;  2X6N A;  1ZBH A;  2DFE A;  3KD1 E;  3PO4 A;  2HHW A;  4B9U A;  3I8D A;  2RN2 A;  4DTP A;  3ISN C;  1NKC A;  2ZD1 A;  3M8R A;  3I0S A;  1D9F A;  1Y97 A;  4DTJ A;  5HBM A;  1UA0 A;  4IBN A;  3V1Q A;  2D0C A;  2YV0 X;  2YKN A;  3NBP A;  4FCY A;  4DSF A;  1TKD A;  4F2R A;  5D3G A;  1YTA A;  1JLC A;  4CJ3 A;  1SUQ A;  4FJ9 A;  1WSI A;  4Z0U A;  4CGG A;  2O4I A;  4JLH A;  3K2P A;  4CER A;  1LWF A;  3RMD A;  4ELT A;  4N47 A;  4E1M A;  3C6T A;  1ZYQ A;  1GOA A;  4C8O A;  4DSI A;  3C95 A;  3VQ6 A;  2B6A A;  1XI1 A;  4WE1 A;  3T19 A;  3AVJ A;  1K6Y A;  2YNH A;  1KFD A;  3QO9 A;  4ID5 A;  1IKW A;  1S1T A;  3VQD A;  3DLK A;  3G0Z A;  3K58 A;  2Y1J A;  3KTQ A;  1X9W A;  3D45 A;  4DFM A;  1RT1 A;  1BI4 B;  1L3T A;  1SL0 A;  2IDO A;  3V9Z A;  4ELV A;  4KI6 A;  3HK2 A;  3V1R A;  3OYA A;  4H4O A;  2G8I A;  1C6V A;  4LY7 A;  4E1N A;  3LZI A;  1RBR A;  3S3N A;  1C1C A;  1LW2 A;  3CYM A;  3ZT3 A;  4I2P A;  4CJQ A;  4DTM A;  4J2D A;  1JXE A;  3U6F A;  4PA1 A;  1LV5 A;  4FJK A;  4M3Y A;  1LAW A;  3VQC A;  4HVJ A;  3TAN A;  1D9D A;  3AVM A;  4H8K A;  1SKS A;  4KHQ A;  2KFZ A;  4AHV A;  1ASW A;  3SUQ A;  1MU2 A;  3TAR A;  3V4I A;  3AV9 A;  4OKJ A;  2I5J A;  4CGD A;  3HP6 A;  2XO7 A;  2O4G A;  4BE1 A;  2PZS A;  1B9F A;  3DI6 A;  2B5J A;  3G10 A;  5EU7 A;  4CEA A;  5J2Q A;  4MQ3 A;  3PY8 A;  1KSP A;  1YVU A;  4CEF A;  1JXB A;  1TV6 A;  3QEX A;  3WNE A;  3PX4 A;  1L3S A;  3E01 A;  3HVR A;  1S5J A;  1TAQ A;  2G8H A;  3UIQ A;  3QNN A;  1HNV A;  3PX6 A;  4M3W A;  4OLB A;  4B3O A;  4K8X A;  1RT3 A;  4KO0 A;  4M3R A;  4BDY A;  4W5T A;  3OS0 A;  5K14 A;  3O4N A;  4CF8 A;  2ZE2 A;  4HUG A;  4HCB A;  2BE2 A;  1NK6 A;  2IS3 A;  3HVT A;  2ZQB A;  4B9V A;  4N41 A;  3O3F A;  2KFN A;  4IFY A;  4CEE A;  4CHO A;  1TVR A;  4HUF A;  2P1J A;  3VQQ A;  3AO1 A;  2WON A;  3RWU A;  4FXD A;  2X6S A;  4FLU A;  4C8L A;  4M45 A;  4Z4I A;  4M3Z A;  1TAU A;  3MXM A;  3LAK A;  3OYE A;  4CGF A;  2LSN A;  4HUE A;  4BE2 A;  4OGE A;  1SKW A;  1FKP A;  3IS9 A;  4CF1 A;  4CIF A;  3MAQ A;  1HJR A;  4J2E A;  3ULD A;  4F8R A;  3H08 A;  4LSL A;  5FRM A;  1QHT A;  2NUB A;  4BE0 A;  1U49 A;  3AVN A;  2FBX A;  4KB0 A;  3HP9 A;  1SL2 A;  3DOK A;  4DS5 A;  1TL1 A;  3NGI A;  4CJ4 A;  2G8W A;  4FW1 A;  3NGY A;  4B9S A;  5FDL A;  4E7L A;  1T8E A;  4B9N A;  1QQC A;  3L2R A;  2G8U A;  4M3U A;  4PWD A;  1LWC A;  2RF2 A;  3S9H A;  4FZY A;  2EX3 A;  1TKZ A;  3DMJ A;  3K5M A;  1BIZ A;  4E7J A;  1KFS A;  1IKV A;  1BIS A;  3KLG A;  4FJ5 A;  3VQ5 A;  1R0A A;  3KLF A;  1XHZ A;  3QIO A;  1NK8 A;  3OYH A;  1ASV A;  4C8K A;  3NF9 A;  4DFP A;  3U3Y A;  1NK4 A;  4Q0B A;  3V9U A;  1NK5 A;  4KHY A;  1HYZ A;  4BWJ A;  5HRS A;  3TWH A;  4FK0 A;  4GVM A;  2FBY A;  4DQQ A;  3KK1 A;  4W5N A;  3ZSY A;  1FKO A;  4G1Q A;  3U3G A;  4Z4F A;  2ATQ A;  5SWM A;  3OYI A;  1BHL A;  3AVL A;  4EP4 A;  3NGZ A;  3CFP A;  4RW6 A;  1RT4 A;  3MEE A;  1VSE A;  4DTO A;  1RDA A;  3HL8 A;  3L2W A;  3K5L A;  1FXX A;  4DU4 A;  1HNI A;  4L8R B;  1T05 A;  3HPH A;  4CJK A;  2JLE A;  3OYD A;  3AO3 A;  3JSM A;  5KGX A;  4KHW A;  2X74 A;  1NJY A;  4O5B A;  2AJQ A;  4E19 A;  3AA4 A;  3LPT A;  1D5A A;  3LWM A;  4E3S A;  2G8V A;  4KRE A;  1VSF A;  4M3X A;  3TAG A;  1LW0 A;  4ELU A;  4DG1 A;  1EET A;  3O3H A;  1RDC A;  1VRT A;  1KLM A;  4M42 A;  1UAX A;  3OYG A;  2WOM A;  4ZTJ A;  1VSK A;  1S1U A;  5HRO A;  2G8K A;  1JLB A;  3KJV A;  2YKM A;  2QK9 A;  5JS1 A;  1W9H A;  3OS2 A;  2OA8 A;  1RNH A;  2HHX A;  4B08 A;  1CXQ A;  3QET A;  3KKR A;  2GUI A;  3CFR A;  2XRI A;  1IO2 A;  2HHQ A;  1RBS A;  2XY6 A;  2ETJ A;  4RW4 A;  3IAY A;  5E41 A;  1XC9 A;  3THV A;  1KTQ A;  1SKR A;  1QSL A;  2D0B A;  1CXU A;  2QXF A;  1TK8 A;  1EKE A;  3VQP A;  5HLF A;  4C8N A;  2RPI A;  4FK4 A;  2EHG A;  4OLA A;  1QE1 A;  4CEB A;  3D0P A;  1EP4 A;  2OZS A;  3DLB A;  1WAJ A;  1Q9X A;  2F8T A;  4DMN A;  3LP0 A;  3QIP A;  4I2Q A;  1CZ9 A;  3MED A;  3KD5 E;  2PYJ A;  4ICL A;  3HXM A;  1RT2 A;  3LAM A;  1Q8I A;  2VWJ A;  3SQ1 A;  4B9T A;  5HRR A;  4LD0 A;  1JLE A;  4N56 A;  2OZM A;  2KZZ A;  3RRH A;  1NK0 A;  1WLJ A;  3PO5 A;  3NH0 A;  1BL3 A;  2Z1I A;  4FLV A;  2BDP A;  3OYC A;  4AIL C;  4IFV A;  1HPZ A;  1S6P A;  1I3A A;  1S6Q A;  3NCI A;  1TKX A;  1TK5 A;  4I9Q A;  1WN7 A;  1RT5 A;  4EZ9 A;  1X1P A;  3P5J A;  2X78 A;  1JL2 A;  1N6Q A;  4W5O A;  1C0M A;  4CHY A;  3SJJ A;  5CYM A;  3ZSQ A;  3LZJ A;  4CIG A;  4O4G A;  1QTM A;  4UQG A;  1ZBL A;  4KTZ A;  4CJU A;  4CIE A;  2DY4 A;  2F96 A;  4AHU A;  3SV3 A;  4FJ8 A;  4JRQ A;  4KTW A;  4KHN A;  1RDD A;  3FFI A;  4YNQ A;  3OYN A;  3AVF A;  3AVH A;  2OPQ A;  1WAF A;  3LP2 A;  3K59 A;  2B4J A;  4DFJ A;  1BGX T;  4OPJ A;  3M8S A;  3SUP A;  3RTV A;  2HHV A;  4KFB A;  4OJR A;  4FJH A;  4OGC A;  3AVK A;  4DQS A;  4B9M A;  4FLW A;  4IKF A;  1SV5 A;  3K5N A;  4Z4G A;  4I7F A;  2A1S A;  5KI6 A;  3LAN A;  3S3O A;  4OKK A;  5J2M A;  4TSX A;  4N76 A;  4C8M A;  2FBT A;  4FJG A;  2D0A A;  3VQE A;  4CE9 A;  3QEI A;  4PUO A;  2F8S A;  3F9K A;  1HQE A;  3DLG A;  4FLY A;  4DSJ A;  1TL3 A;  4O44 A;  4NCG A;  3ZSO A;  1VSD A;  2XY7 A;  1Z25 A;  3KK2 A;  2HHS A;  3OY9 A;  2YNG A;  4DQP A; 
#chains in the Genus database with same CATH topology
 4R5P A;  2P9P B;  2QWQ A;  3ENO A;  4H0V B;  3TAB A;  3ENH A;  1RT7 A;  1BU6 O;  1OVY A;  5CYQ A;  4CJP A;  4KHS A;  5T7B A;  3H3O B;  2HW3 A;  4JNE A;  2HBK A;  5M1N A;  4CHN A;  3EYZ A;  1FJG K;  4JKD A;  4DTN A;  4CFC A;  1TK0 A;  5GAE P;  3V81 A;  1KLN A;  4CJ5 A;  5FPD A;  1ATR A;  1VSM A;  3CM5 A;  3VET A;  1M90 O;  4IJA A;  1JKH A;  3VQB A;  3C0B A;  4Y1C A;  3H3N O;  3A5L C;  4CEZ A;  4FJN A;  4CZL A;  1VSJ A;  4FLZ A;  4CGJ A;  4YOT A;  1S1V A;  2O8B B;  1BI4 A;  2IVO A;  3VQ7 A;  5AQY A;  4MO5 A;  3OJS A;  4KKO A;  3EE8 A;  4G9Z A;  1HR0 K;  4M41 A;  3GBT A;  2FLO A;  4GW6 A;  4LH4 A;  3RSE A;  3N4Q A;  1HNX K;  2NZT A;  4E0D A;  3AVI A;  3HZ6 A;  1QSS A;  2HHT A;  5C25 A;  4X64 K;  4CJ7 A;  2HST A;  3OYJ A;  4FZX C;  4K43 A;  4DR6 K;  4BG8 A;  4Z4C A;  3CJ7 A;  4E89 A;  4DLG A;  1QSY A;  1C1B A;  4BC5 A;  3F9M A;  3J7Y P;  5HRP A;  5JMV A;  4U67 L;  1BIU A;  2D5R A;  3QBX A;  1IG9 A;  3HYF A;  2I7P A;  5HP1 A;  4BR0 A;  2HVH A;  4RW8 A;  3QEW A;  2YX6 A;  3S3M A;  1Q9Y A;  2A41 A;  4J2A A;  3PV8 A;  1JLQ A;  3BDP A;  3UKU A;  4A59 A;  1LCU A;  2KKZ A;  1VK0 A;  2QWR A;  1MDU B;  2QWN A;  3T1A A;  5M1O A;  3ZCM A;  3WNG A;  1Z26 A;  3ZT0 A;  1WNS A;  1SL1 A;  2BUP A;  2CGK A;  2ITM A;  4YHH K;  2FXU A;  2ZM6 K;  1N5Y A;  4BWM A;  4FK2 A;  4XH4 A;  3CCM N;  5CY4 A;  3AY9 A;  4JV5 K;  1ATN A;  2UXD K;  3VQ9 A;  1NGF A;  3V6D A;  2YHA A;  1RFQ A;  3KIO A;  5FRO A;  2GBZ A;  4H0O A;  2PYL A;  3KWI A;  4CF9 A;  5AQS A;  4FJI A;  2HVI A;  5EOY A;  1JCG A;  3KK3 A;  4IG0 A;  5AQZ A;  2RKI A;  2E6M A;  3QFP A;  2E20 A;  2P9I B;  4LC9 B;  1U45 A;  3BF3 A;  1T44 A;  4IO9 L;  2A40 A;  4QS7 A;  3RR8 A;  2KZM A;  2CH5 A;  5JS2 A;  5I42 A;  3OYF A;  3W3D A;  1WSJ A;  3AA3 A;  3WEE A;  4PKH A;  1ASU A;  4JI2 K;  3THW B;  1OVQ A;  1A5X A;  3VQ8 A;  2XHB A;  5BR8 K;  4FM0 A;  4CK1 A;  4IFE A;  4CHP A;  4J2B A;  1BQN A;  3ZX0 A;  3VQ4 A;  3AVG A;  3DOL A;  3TR8 A;  3HO1 A;  3BY5 A;  2V7Z A;  1KCF A;  3CJC A;  3K57 A;  1S22 A;  2KQ2 A;  4ZTF A;  4FVM A;  1SS6 A;  2ZF5 O;  2YJF A;  2W42 A;  3LM2 A;  3D7E O;  5JVG L;  2NNW A;  3THY B;  1NNE A;  1U2V A;  2YNF A;  2HBJ A;  3AAQ A;  4JKH A;  4BY9 C;  4CES A;  1BCM A;  1GLC G;  4MFB A;  4CHQ A;  4N5S A;  3MX2 A;  4CJS A;  3QER A;  3DLL L;  2NRX A;  5J1E A;  3IKM A;  3G71 N;  2DFE A;  4R79 A;  2NRR A;  3PO4 A;  2HHW A;  4B9U A;  2RN2 A;  3I0S A;  1D9F A;  4DTJ A;  4RWT A;  3EN9 A;  3N4P A;  1IV0 A;  4FCY A;  1TKD A;  5D3G A;  3SLC A;  4CJ3 A;  3H45 C;  1HKG A;  2O4I A;  5AQF A;  3K2P A;  1QZ5 A;  4CER A;  3H1V X;  3C6T A;  4C8O A;  1V4S A;  3VQ6 A;  3O1W A;  4EFH A;  4IEI A;  4RCH A;  4WE1 A;  2YNH A;  3QO9 A;  1Q81 O;  4EZ6 A;  3D6R A;  4DUZ K;  4IOC L;  4DFM A;  1BI4 B;  4ELV A;  3V1R A;  2G8I A;  4HWI A;  1O13 A;  3CYM A;  1JXE A;  4PA1 A;  1LAW A;  3WUH A;  4HVJ A;  3TAN A;  1D9D A;  4H8K A;  1SKS A;  4KHQ A;  4AHV A;  3SUQ A;  1MU2 A;  3TAR A;  3V4I A;  4F9O A;  2CH6 A;  2O4G A;  3G10 A;  1OH8 A;  3R6M A;  2AA4 A;  1HKC A;  2D1K A;  4CEF A;  1TV6 A;  5AQN A;  3WNE A;  4GV6 A;  1NG9 A;  1FW6 A;  1S5J A;  1HNV A;  3PX6 A;  4WFA L;  2NRV A;  5I9E B;  4KO0 A;  4HCB A;  2ZE2 A;  4B3R K;  4Z94 A;  4B9V A;  2KFN A;  4IFY A;  5BRF A;  4HUF A;  3AO1 A;  2QWM A;  3CC7 N;  4HTL A;  4M45 A;  3ZET B;  1NGB A;  3VGM A;  4HUE A;  4BE2 A;  3C6H A;  2WTU A;  2F9T A;  3IS9 A;  3MAQ A;  4LSL A;  3AVN A;  1W2B M;  3K9J A;  3DOK A;  3GG4 A;  1TL1 A;  2VQE K;  3MX5 A;  2G8W A;  3L2R A;  2RF2 A;  2EX3 A;  1BIZ A;  1IKV A;  2ASO A;  3QIO A;  3HI0 A;  1ZC6 A;  1NK4 A;  3V9U A;  1NK5 A;  1HYZ A;  4GVM A;  2FBY A;  5GAD P;  1K8K A;  3OYI A;  5M1K A;  3MK6 A;  3CJA A;  3VPZ A;  3D2F B;  4EP4 A;  2EWS A;  1RT4 A;  3E9O A;  4DTO A;  3ZYY X;  5M1F A;  1HNI A;  4B1Z A;  4L8R B;  1T05 A;  4JKG B;  4IOA L;  3JSM A;  3VEV A;  2X74 A;  4O5B A;  2AJQ A;  3AA4 A;  3LWM A;  4E3S A;  4AM7 A;  4WQ5 C;  1XUP O;  4ELU A;  2UU9 K;  3IUC A;  1VRT A;  4M42 A;  2FF3 B;  5HRO A;  1W9H A;  2OA8 A;  3G25 A;  2HHX A;  1DT9 A;  4JI4 K;  5FPN A;  3O6W A;  2ZWH A;  5AZI A;  2XRI A;  3ZX3 A;  4LFC K;  2ETJ A;  1XC9 A;  1IBK K;  1P90 A;  5AQQ A;  1CXU A;  2D4W A;  2QXF A;  1EKE A;  4C23 A;  4OLA A;  5BR9 A;  2PFU A;  1XMO K;  4FWQ A;  4PKG A;  4EHU A;  3FGU A;  3MED A;  4YOY A;  3TSU A;  1T3V A;  3HXM A;  3IDH A;  3L0Q A;  4LD0 A;  4N56 A;  2KZZ A;  4WCE L;  1KD1 O;  3PO5 A;  2A3Z A;  2Z1I A;  3EEQ A;  1IBL K;  3OYC A;  4IFV A;  1HPZ A;  1WN7 A;  3A5O C;  4WF9 L;  1YJW N;  1X1P A;  4GKJ K;  3AAP A;  1NGH A;  4H5N A;  1C0M A;  3SJJ A;  3ZSQ A;  3ATV A;  3LZJ A;  1QTM A;  3EKS A;  3S41 A;  4JRQ A;  2CGJ A;  4CW7 B;  4KHN A;  1RDD A;  3I55 N;  4YNQ A;  3OYN A;  2OTL N;  2OPQ A;  1WAF A;  3QBW A;  3WT0 A;  2GTD A;  3QML A;  4KHP K;  4OPJ A;  1HNW K;  4FJH A;  1E4G T;  4JI0 K;  4B9M A;  4FLW A;  3NMU A;  3K5N A;  4M7X A;  3AGK A;  5GIN A;  3S3O A;  3LAN A;  5J2M A;  1VQM N;  2D0A A;  1NGD A;  3VQE A;  4KH5 A;  4CE9 A;  4PKI A;  4FOE A;  1HLU A;  4DSJ A;  1TL3 A;  3ZSO A;  4BRQ A;  1I94 K;  1VSD A;  1RGI A;  1Z25 A;  3MDQ A;  3KK2 A;  4FLV A;  4KI4 A;  3KLH A;  2QXL A;  1DTT A;  1HRH A;  3HM8 A;  4BQZ A;  2G8F A;  2OPP A;  5AQX A;  5I3U A;  1HYS A;  1JLA A;  2O8C A;  3BUZ B;  3FR0 A;  3U9D A;  3CM6 A;  2O8F A;  2GWK A;  3QIN A;  4IOX A;  1NGA A;  2P9U B;  1JLF A;  1YAG A;  4H0Y B;  5DMR A;  1S1X A;  3SPZ A;  3ZSV A;  3NDK A;  1VAZ A;  3F5T A;  4MO4 A;  3LL3 A;  4KH4 A;  4GMJ B;  5IWA K;  3V9W A;  3FZF A;  1ZBS A;  4FJ7 A;  4JAX A;  4LF6 K;  2VG5 A;  4CVN E;  4JD2 A;  5LL6 Z;  4DV6 K;  1VQ5 N;  4O55 A;  4BR2 A;  2WFB A;  5BRE A;  1GOC A;  2HNZ A;  3SPY A;  4FJJ A;  1NJW A;  3ASM A;  4MLH A;  1YTU A;  1G15 A;  4NB4 A;  1VSI A;  4OKE A;  4O0J A;  1EX4 A;  3CER A;  3U9Z A;  4KPY A;  1YF5 L;  4H4M A;  4MLE A;  2HND A;  1T03 A;  2KHO A;  3M8P A;  1NKB A;  1NM1 A;  3EE9 A;  1GLF O;  3FZM A;  3TI0 A;  3FE1 A;  1LAV A;  2QKB A;  1I39 A;  3IFR A;  5C15 A;  3B6P A;  2KTQ A;  4YOU A;  2VG6 A;  3PSF A;  2VGM A;  4BRA A;  4JHD B;  3LDP A;  4X66 K;  3RMB A;  3TSP A;  2BTF A;  4CJL A;  5KRT A;  3O4Q A;  1IJJ A;  1E4F T;  4NCA A;  4DLE A;  3O1B A;  4CK2 A;  3OYB A;  3OJU A;  2HMI A;  3KZB A;  1LWE A;  4DWI A;  3M8Q A;  3LAL A;  4CCH A;  4OVL A;  5KPT A;  4PY5 A;  5CZ1 A;  1NGG A;  3VGL A;  4Z4E A;  4BDZ A;  1A5W A;  1Q82 O;  5KTQ A;  4FZZ A;  4AHC A;  5AZJ B;  1Q86 O;  4NYN A;  3ZSR A;  3DLH A;  2FSJ A;  4CFA A;  1BOT O;  2P9L B;  3IG1 A;  4K8Z A;  1ITG A;  4QAG A;  4CK3 A;  1RBT A;  3DRP A;  4CEC A;  2QKK A;  2Q36 A;  3I56 N;  1OH7 A;  1XWL A;  4JN4 A;  2FC0 A;  4DU1 A;  3LPU A;  3MN7 A;  4FM2 A;  3ALY A;  4FPB A;  4CFD A;  2GEM A;  3LWL A;  3ZT2 A;  4DR7 K;  2WUS A;  1BCO A;  1NOY A;  1XNR K;  3R8E A;  3T1Y K;  4RW9 A;  1YXQ A;  2YHB A;  2J4R A;  2IAJ A;  1BO5 O;  4DTX A;  2DTU A;  4NXM K;  3VER A;  4L3Q A;  2OTJ N;  1P8Z A;  3DXM A;  4FWP A;  5C12 A;  4DSK A;  1L5U A;  5TKW A;  4M63 C;  4B8A B;  3L8B A;  5GIO A;  3EL2 A;  5FRN A;  1F21 A;  3WNF A;  1EWR A;  4FO0 A;  3MXI A;  2VG7 A;  2W6L A;  4DU3 A;  3B6O A;  1RTJ A;  4OPA A;  1L3V A;  3F2K A;  2DFF A;  5AR0 A;  4I6M A;  4DR1 K;  3MEC A;  1ZBF A;  1EWQ A;  5AQK A;  4OPK A;  5HRN A;  4DFK A;  3EO3 A;  3EY1 A;  2R7Y A;  4PQU A;  3MEG A;  4HCC A;  5EXW A;  4DF4 A;  3M3Z A;  4H0T B;  4BRO A;  1U4B A;  4JI7 K;  1Z05 A;  4HHT A;  4B9Q A;  3R1X A;  4BRP A;  1JLG A;  1MWK A;  5AJ3 K;  3CCE N;  4WFN L;  1DLO A;  3OBY A;  1ILY A;  5C24 A;  1QVF M;  1JL1 A;  2HHH K;  4LF9 K;  2IVP A;  3ID8 A;  2QM1 A;  3HST B;  4AHT A;  1KC8 O;  1NWK A;  3AGR A;  3CC2 N;  3AVC A;  3DJC A;  5CZ2 A;  3TTC A;  2X6N A;  5CR4 A;  3KD1 E;  1QQM A;  4DV0 K;  3ISN C;  2ZD1 A;  3M8R A;  3P38 A;  3VOV A;  1CZA N;  4DR3 K;  4F2R A;  1YTA A;  3WQU A;  4H0P A;  2O8D A;  3ZEU B;  4Z0U A;  3VF6 A;  3O4W A;  1KQS M;  4GKK K;  4DSI A;  3C95 A;  1XI1 A;  3VN5 A;  3AVJ A;  1K6Y A;  3VQD A;  4ID5 A;  1IKW A;  1S1T A;  3G4S N;  1X9W A;  2VWB A;  4BC4 A;  3D45 A;  1K8A O;  3O5B A;  1SL0 A;  4KI6 A;  3HK2 A;  3OYA A;  4H4O A;  1C6V A;  4LY7 A;  4E1N A;  3BF1 A;  3M6G A;  1RBR A;  3LZI A;  3S3N A;  3ZT3 A;  3DWL A;  2E2P A;  2CGL A;  2KFZ A;  1ASW A;  4OKJ A;  4NXN K;  4CGD A;  3THX A;  2P9K A;  4ISG A;  4JEP A;  4CEA A;  3PY8 A;  5CE3 A;  1KSP A;  1YVU A;  1QZ6 A;  3PX4 A;  1L3S A;  3VEY A;  3E01 A;  3H46 O;  3UIQ A;  3GOI A;  3VEO A;  3QNN A;  5BPL A;  4M3W A;  4BGB A;  4OLB A;  2YHW A;  4B3O A;  4BDY A;  3FZL A;  3OS0 A;  4A5B A;  4HUG A;  2IS3 A;  1OH5 A;  1VQO N;  1TVR A;  2P1J A;  3VQQ A;  2WON A;  5M1Q A;  4FXD A;  2X6S A;  3WXK A;  4M3Z A;  3CPW M;  3LAK A;  4IDH A;  4A57 A;  4CGF A;  3LDQ A;  4CIF A;  2JWL A;  4F8R A;  3H08 A;  1QHT A;  4CZE A;  1U49 A;  2FBX A;  1SL2 A;  4X65 K;  4DS5 A;  1NMN A;  2D0O A;  4FW1 A;  3NGY A;  1T8E A;  4DQ8 A;  3ID6 A;  1TUY A;  3ZX2 A;  3S9H A;  1QVG M;  4EIA A;  4FPA A;  5LY3 A;  1BIS A;  1S3X A;  1GLE G;  5AQT A;  1GLD G;  1XHZ A;  4Q0B A;  4KHY A;  4BWJ A;  5HRS A;  4DQQ A;  4W5N A;  2H3G X;  4FWR A;  1FKO A;  1BHL A;  4FWL A;  3CQX A;  4OO1 J;  4RW6 A;  3R9P A;  3HOS A;  1RDA A;  5ADX A;  4BC3 A;  3HPH A;  4FSV A;  3UKR A;  3CME N;  1T6C A;  3AO3 A;  4DB3 A;  3LDO A;  4KRE A;  1VSF A;  4GY2 B;  1LW0 A;  1V4T A;  5E84 A;  4DG1 A;  3O3H A;  1RDC A;  3CQY A;  1JCE A;  2QWP A;  3TPQ A;  1KLM A;  2WC9 A;  4AF1 A;  1VSK A;  2YKM A;  2BH1 A;  1RNH A;  1CXQ A;  4K25 A;  3KKR A;  5ADX H;  3CFR A;  1G99 A;  4RW4 A;  3IAY A;  5E41 A;  1TK8 A;  2ZJP L;  5HLF A;  2EHG A;  3E1Y A;  3D0P A;  1ATS A;  2OZS A;  3DLB A;  1TYQ A;  1TUU A;  4H5W A;  3SBT A;  3QIP A;  2UYT A;  2HOE A;  3CJ1 A;  3CIP A;  5AQW A;  4O5F A;  1KAY A;  3O9Q A;  4I2Q A;  4ICL A;  4CI6 A;  2UXB K;  1RT2 A;  3LAM A;  4B9T A;  4JI6 K;  3SQ1 A;  2ASP A;  2OZM A;  2WBN A;  3RSE B;  1BL3 A;  4JI5 K;  2BDP A;  4CZI A;  4AIL C;  4AM6 A;  3H6E A;  1RT5 A;  3P5J A;  2Q1N A;  1N6Q A;  4JKC A;  4OPH A;  4W5O A;  4CIG A;  4O4G A;  2P9N A;  1HX1 A;  4UQG A;  1T6D A;  3JXU A;  4CZG A;  3PIO L;  4WYB A;  1YJN N;  2UUA K;  3FFI A;  3LP2 A;  3K59 A;  2B4J A;  3WXI A;  4BR7 A;  1BGX T;  3M8S A;  3SUP A;  4KH6 A;  3RTV A;  4DV3 K;  3U4L A;  4IKF A;  1SV5 A;  3BEX A;  4Z4G A;  4KBO A;  5KI6 A;  3O9R A;  2F9W A;  4OKK A;  4E1J A;  3A0I X;  3UKU B;  3O08 A;  4NLB A;  4JK8 A;  3CCL N;  3QEI A;  3F9K A;  1HQE A;  1VQK N;  4NCG A;  2Q2R A;  2HHS A;  3ULE A;  3CQ8 A;  3OY9 A;  4BG9 A;  3P83 D;  1REV A;  2P5G A;  4B9L A;  2DFH A;  5FPE A;  1WSH A;  4FVU A;  2HB5 A;  1NKE A;  4KAZ A;  1RCH A;  4K41 A;  1NLV A;  5GAH P;  1WSE A;  4BRL A;  4DTS A;  3EZ5 A;  5MLC Q;  2FBV A;  3O3G A;  1NBW A;  4CBW A;  2E88 A;  3MN6 A;  3MMV A;  3HSC A;  1WUA A;  4JI1 K;  3L2Q A;  3DYA A;  3D2E A;  1T7P A;  1ZBU A;  4B1X B;  1UA1 A;  3VQA A;  3AA5 X;  3HM9 A;  4O0I A;  3NHG A;  3VA3 A;  5AQL A;  3AA2 A;  2GX9 A;  4IWV A;  3RMA A;  4I9L A;  3V1O A;  3HT3 A;  3CI5 A;  4CJF A;  3P31 A;  1GLA G;  3O9U A;  4H5V A;  1VSL A;  4JS4 A;  5B8H A;  1RIL A;  3WEE B;  3CMA N;  3EKU A;  4FJX A;  3L2U A;  5SZT A;  1YIJ N;  4C1N K;  3ZT4 A;  1WBD A;  3DXK A;  4DV4 K;  3DAW A;  2P9S A;  3WXM B;  3SQ2 A;  4BRK A;  2GUP A;  1X3M A;  1ZBI A;  1RDB A;  4B3M K;  5GAG P;  4CGI A;  4BVO A;  1X9M A;  4Y1D A;  3J7A P;  4CHZ A;  4LFB K;  3NF6 A;  2OPS A;  1NK9 A;  5C0Y A;  1RTH A;  1KVC A;  1KVB A;  3CPE A;  4CBX A;  4XEI A;  1C0G A;  1KVA A;  3F73 A;  1B92 A;  4FJL A;  4BGA A;  1U2V B;  3NF7 A;  3SCX A;  4YY3 K;  3C7N A;  3HPO A;  3CCV N;  4ZHR A;  3I8B A;  3L3U A;  3TAF A;  1IKX A;  2ASM A;  3LP1 A;  3SNN A;  2NLX A;  2E4L A;  2XY8 A;  2P9P A;  1C1A A;  4WQ4 A;  1WSF A;  4FWM A;  3LDS A;  1UOC A;  1C0U A;  1NJZ A;  4PL8 A;  3UB5 A;  3MN9 A;  3O80 A;  1RBU A;  3ATU A;  3DLE A;  4B1U B;  3DRR A;  4YOR A;  1CZB A;  4J8F A;  2E1Z A;  2O8E A;  2Z1H A;  3OBW A;  3J8A A;  4H5R A;  1WSG A;  3T1H K;  2HNY A;  1XMQ K;  1QQO A;  2VYP A;  4HTU A;  2A6A A;  3CCU N;  4LF7 K;  2HHU A;  5DM7 L;  3G6E N;  4B3T K;  3CG7 A;  3TAP A;  4Q5V A;  3VF4 A;  1U48 A;  5AQR A;  3KLE A;  1U04 A;  4LFA K;  3A2F A;  4YDU A;  1J5O A;  3SBG A;  3ZT1 A;  2O8B A;  4CJV A;  4H5T A;  1VQ9 N;  4YFU A;  3WXJ A;  4F3O A;  4KRF A;  5ELZ A;  3DRS A;  1Y64 A;  1O1W A;  3PX0 A;  2KLA A;  1KRP A;  4FYD A;  4IZ9 A;  4XIU A;  4MDB A;  5KRS A;  4DS4 A;  4K42 A;  4QOZ B;  5KGW A;  2AP1 A;  3A8Y A;  2A5X A;  3SMP A;  4AH9 A;  3T3F A;  1YIT N;  3R3L A;  1OH6 A;  2YHX A;  3SUO A;  4KB1 A;  1J6Z A;  2QWO A;  1N36 K;  3RR7 A;  3OVN A;  4IG3 A;  5KPZ A;  1S1W A;  2BAN A;  4E7H A;  1BUP A;  1RDU A;  4DTR A;  3QEP A;  4BDP A;  2HMP A;  4FW2 A;  1SAZ A;  3OYL A;  3ZSX A;  1NK7 A;  4DQI A;  2IGI A;  1EQY A;  3TSQ A;  4BRM A;  1H1V A;  3AO4 A;  2P5O A;  2Q0R A;  4F2S A;  1M1K O;  3WNH A;  4FWK A;  4CJR A;  3IRX A;  3OS1 A;  4JI3 K;  5DK5 A;  1QS4 A;  2YJE A;  3QLH A;  4IDK A;  1VSH A;  3ZSZ A;  3NAE A;  4B1V A;  3V9X A;  1NJI O;  3C65 A;  1HNZ K;  4DR2 K;  3O8M A;  5AQP A;  3I8D A;  4DTP A;  3LM9 A;  4CZF A;  5TKY A;  1Y97 A;  5HBM A;  1UA0 A;  2IVN A;  2YKN A;  2YV0 X;  3NBP A;  4FWO A;  1JLC A;  1SUQ A;  4FJ9 A;  1K8K B;  1WSI A;  5BRD A;  4JLH A;  4A61 A;  4FWN A;  4ELT A;  4E1M A;  1ZYQ A;  1GOA A;  4DV2 K;  1X3N A;  2B6A A;  3GE1 A;  1KFD A;  1NMD A;  3DLK A;  3G0Z A;  1N32 K;  4CZH A;  1RT1 A;  2HF3 A;  3QIC A;  1L3T A;  3V9Z A;  4DHY A;  3OA9 A;  3FLC O;  5E26 A;  4BRI A;  3UE5 A;  3WQT A;  2P9I A;  4I2P A;  4CJQ A;  4J2D A;  3U6F A;  4A5A A;  1LV5 A;  3VF2 A;  3AVM A;  3IMX A;  3CJB A;  1J5E K;  3AV9 A;  2I5J A;  2FSN A;  3HP6 A;  4BE1 A;  1B9F A;  3DI6 A;  5AZI B;  5EU7 A;  2W40 A;  4MQ3 A;  3THW A;  1JXB A;  4JK9 A;  1NGC A;  2PAV A;  3QEX A;  3K0S A;  3HVR A;  2G8H A;  1Q18 A;  2F7T A;  4K8X A;  1RT3 A;  1YI2 N;  4W5T A;  3O4N A;  4JI8 K;  2BE2 A;  1NK6 A;  4DKW A;  3HVT A;  3O3F A;  4CEE A;  1BA1 A;  4K0K K;  4CHO A;  3MCP A;  3CC4 N;  1TAU A;  3OYE A;  2LSN A;  4A2B A;  4EAH D;  5M1P A;  4BC2 A;  1HJR A;  4J2E A;  3ULD A;  5FRM A;  3THY A;  2NUB A;  4CBU A;  1NGJ A;  3HP9 A;  3PSI A;  4PHT X;  3VES A;  4PL7 A;  5CHI A;  1GLL O;  4B9N A;  2G8U A;  4O8K A;  1ESV A;  5BRH A;  3K5M A;  5LJW A;  5LMN K;  1KFS A;  3BZK A;  2ZGY A;  1LOT B;  1SZ2 A;  3VQ5 A;  1VQ7 N;  1VHX A;  1NK8 A;  5HOO A;  2O8E B;  3NF9 A;  3VGK A;  3QFU A;  3PIP L;  3CHW A;  3P39 A;  4FK0 A;  4H03 B;  3KK1 A;  3ZSY A;  2QW9 A;  4G1Q A;  3U3G A;  4B1W B;  2ATQ A;  5SWM A;  1KAX A;  3NGZ A;  3CFP A;  1VSE A;  3HL8 A;  3K5L A;  1QHA A;  2YHY A;  1FXX A;  4NO7 A;  4DV7 K;  4DU4 A;  5AQV A;  3HOT A;  4CJK A;  2JLE A;  5FPM A;  3OYD A;  1S72 N;  3I33 A;  1VQ4 N;  5KGX A;  4KHW A;  2O8C B;  1NJY A;  5H1S Q;  2F4V K;  4E19 A;  2O8F B;  1X9J A;  4BRH A;  1EET A;  3JAM O;  1UAX A;  3OYG A;  3CXC M;  4ZTJ A;  2QK9 A;  3KJV A;  5JS1 A;  4CZK A;  4IEE A;  3QET A;  1R59 O;  2GUI A;  2QTD A;  1RBS A;  1DKG D;  4WQ5 A;  3THV A;  1KTQ A;  1SKR A;  1QSL A;  3RVC A;  4B3S K;  3VQP A;  4JD2 B;  4FK4 A;  4CEB A;  1KXP A;  4ISF A;  1EP4 A;  5BN8 A;  1WAJ A;  2F8T A;  1NGE A;  2PYJ A;  5AQJ A;  1Q8I A;  4WQ4 C;  5HRR A;  3RRH A;  1NK0 A;  5AQO A;  1WLJ A;  3ZET A;  1S6Q A;  1S6P A;  1I3A A;  1TK5 A;  1YVN A;  3KHY A;  2X78 A;  4DR4 K;  4LF4 K;  5CYM A;  5LMU K;  3M5R A;  2V7Y A;  2VGN A;  2DY4 A;  3SV3 A;  3AVF A;  3AVH A;  4BRE A;  2ZJQ L;  2E2N A;  4IO8 A;  2HHV A;  3CCJ N;  3AVK A;  4DQS A;  2UUC K;  5F2R A;  2VQF K;  4YDU C;  5KPR A;  4YOX A;  4N76 A;  5HL7 L;  4PUO A;  3DLG A;  1QQN A;  4FLY A;  5C2F A;  4O44 A;  4YOW A;  2XY7 A;  3W0L A;  4M3U A;  3D2F A;  4QS9 A;  3P4I A;  1S9E A;  4C1N I;  1EXQ A;  2YNI A;  2P51 A;  3L3V A;  3L4Q A;  4JKG A;  3A5N C;  1A5V A;  5J2N A;  4DSL A;  1W0H A;  4GNI A;  4CJE A;  2KW4 A;  4CED A;  1J9A A;  1UWB A;  2ITG A;  4BAC A;  1WB9 A;  1D8Y A;  4JK7 A;  3ZLJ A;  3AO2 A;  2XY5 A;  1Z6R A;  4BRF A;  4FLT A;  3QNO A;  3K9K A;  5BN9 A;  4JKA A;  5DM6 L;  3VA0 A;  1N8R O;  2QWL A;  4MDA A;  2E8A A;  4AHR A;  4NCB A;  1J54 A;  1RTI A;  4CJT A;  3TAE A;  3V9S A;  3SAG A;  3NFA A;  2OPR A;  4CEQ A;  2NRH A;  2A42 A;  3LDN A;  3LP3 A;  4H0X B;  3TAM A;  3TTF A;  4DV1 K;  3HJF A;  2ZJR L;  5JIC A;  4CEO A;  3JYT A;  4CZM A;  4QCL A;  4EP5 A;  4UY8 O;  1NOZ A;  4BQL A;  4ILH A;  1BQM A;  2FSK A;  3L6Q A;  4FLX A;  3DXM B;  1DTQ A;  2Z1J A;  2E2O A;  2QA4 N;  2GWJ A;  4JS5 A;  3DM2 A;  3K5O A;  4E7K A;  3SUN A;  5J2P A;  2V52 B;  4DTU A;  2BGG A;  2Q3S A;  4B8C A;  2VWK A;  4F3T A;  3SJH A;  3VEN A;  4Z4H A;  1VRU A;  2IC3 A;  3SI6 A;  2IOC A;  4I6M B;  4CJW A;  3SK3 A;  2HF4 A;  3QES A;  3ITH A;  3SV4 A;  1HKB A;  3SQ4 A;  1WBB A;  1YUW A;  4JKF A;  2FF6 A;  2PY5 A;  3E9P A;  4W5R A;  1W7A A;  1IKY A;  1C0T A;  3CCQ N;  5AQU A;  1OKJ A;  1RT6 A;  4W5Q A;  3E9L A;  1L3U A;  3CET A;  1TGO A;  3SZ2 A;  4KHU A;  4CFB A;  1XNQ K;  2OYQ A;  3AAR A;  3NF8 A;  4RW7 A;  4KTQ A;  4A62 A;  3MXJ A;  3KK7 A;  4CF0 A;  1TKT A;  3P1G A;  3VEZ A;  3DLR A;  4CGH A;  3SYZ A;  3H1Q A;  4BR5 A;  3OYK A;  3J81 O;  4CD3 A;  4U7B A;  1VQL N;  3SQ0 A;  2E2Q A;  3AO5 A;  2YCH A;  3GDQ A;  1HQU A;  1YT3 A;  2E6L A;  1XHX A;  4NYF A;  2P9U A;  1HYV A;  2O8D B;  4FL9 A;  3MN5 A;  3Q7C A;  4LH5 A;  4LSN A;  1CLQ A;  4AHS A;  1FK9 A;  3AVA A;  2Z1G A;  3QDK A;  1YJ9 N;  2A1R A;  2W6K A;  4BRG A;  3BGR A;  3PUF A;  3KVG A;  1EO1 A;  4OX9 K;  4F4K A;  3HPG A;  2IIR A;  4M3T A;  4FJM A;  1J53 A;  3KLI A;  1IH7 A;  1MA9 B;  3NH1 A;  4O8U A;  3HRG A;  4FWS A;  4DQR A;  1N33 K;  3CFO A;  3VTI A;  1HMV A;  3C6U A;  3MCA B;  4X62 K;  3Q7B A;  3RMC A;  1NJX A;  5C42 A;  5LJV A;  3THX B;  2P9K B;  3RRG A;  3WXL A;  2Y1I A;  2V51 B;  2Q97 A;  5C10 A;  1RBV A;  4ID1 A;  1GOB A;  3E66 A;  4B1Y B;  4EHT A;  3TAQ A;  4FJK A;  1VQN N;  4GV9 A;  3KKS A;  2Q0U A;  4IXC A;  3TU5 A;  3CJ9 A;  3LDL A;  1IG8 A;  3AVB A;  4BRC A;  4DF8 A;  4A2A A;  1HUX A;  3NE6 A;  1E3M A;  2NRW A;  1S9G A;  3L2V A;  3C94 A;  2GV9 A;  4BRD A;  4KV8 A;  3QEV A;  3HTV A;  4XH5 A;  3KWG A;  5BPN A;  3SAF A;  3ZSW A;  1U47 A;  4JRP A;  4DSE A;  3SMS A;  4JHD A;  4Y0W A;  1B9D A;  2OCE A;  1RTD A;  1X9S A;  1NGI A;  4CF2 A;  3NH2 A;  1VQ8 N;  2JGU A;  3CD6 N;  3OYM A;  1K73 O;  3U8X A;  3J80 O;  1BA0 A;  1WOQ A;  1C0F A;  4E7I A;  3I0R A;  2Q31 A;  4FM1 A;  3BP8 A;  4RG8 A;  2E1Y A;  1ZBH A;  4ILJ A;  1NKC A;  2DPN A;  5GIP A;  5AZJ A;  4IBN A;  3V1Q A;  2D0C A;  4DSF A;  2QI2 A;  1VQP N;  2P9L A;  3J7Z O;  4DV5 K;  4CGG A;  5EY4 A;  5IT9 O;  4LF8 K;  4QS8 A;  3TTD A;  1LWF A;  3RMD A;  4N47 A;  4JKE A;  5EX5 A;  1GLB G;  1BG3 A;  3T19 A;  3PLA A;  2Y1J A;  4JKB A;  3K58 A;  3KTQ A;  3UKR B;  1K9M O;  5JLH A;  4DCH A;  2IDO A;  2I7N A;  5AFU A;  1C1C A;  1LW2 A;  4JYA K;  2NRZ A;  5AQM A;  5KQ8 A;  4DTM A;  4M3Y A;  2YI1 A;  2QEX N;  3VQC A;  3SAH A;  5AQG A;  3VMF B;  1JJ2 M;  3C6A A;  2XO7 A;  2PZS A;  2UXC K;  2B5J A;  1HPM A;  5J2Q A;  1NU0 A;  4V19 S;  3CCR N;  1TAQ A;  3MWP A;  3OW2 M;  5AFU H;  5C2D A;  4M3R A;  1TYQ B;  5K14 A;  1BDG A;  1U6Z A;  2RHK A;  4CF8 A;  1N34 K;  4N41 A;  2ZQB A;  3OHR A;  3T7Z A;  3CF5 L;  3EZW A;  3RWU A;  4FLU A;  4C8L A;  4Z4I A;  1W97 L;  3MXM A;  4OGE A;  1SKW A;  1FKP A;  3VTH A;  4CF1 A;  5JLF A;  1MWM A;  1IBM K;  4BE0 A;  4KB0 A;  4RTF D;  5AQI A;  3NGI A;  2P9N B;  4CJ4 A;  3FZK A;  4B9S A;  1BWF O;  5FDL A;  4WFB L;  4E7L A;  1QQC A;  4PWD A;  1LWC A;  4FZY A;  3BZC A;  1TKZ A;  3DMJ A;  4E7J A;  1VQ6 N;  5F1X A;  3KLG A;  4FJ5 A;  1R0A A;  3O9S A;  5BPM A;  3KLF A;  4C8K A;  3OYH A;  1ASV A;  1RDW X;  4DFP A;  4YOV A;  1D4X A;  2RE2 A;  4DR5 K;  3U3Y A;  4ISE A;  3TWH A;  1DEJ A;  1SQK A;  2JWK A;  3JS6 A;  5KQD A;  3ZEU A;  4Z4F A;  3AVL A;  3OTO K;  4IJN A;  3ULE B;  4CZJ A;  2D0P A;  3MEE A;  4XH1 A;  5A2Q O;  3L2W A;  5AQH A;  3VEW A;  5FLX O;  2GEL A;  3LPT A;  1D5A A;  2G8V A;  3NVK A;  4M3X A;  3TAG A;  1GLJ O;  2WOM A;  2UUB K;  3FFK B;  2G8K A;  1KAZ A;  1S1U A;  1JLB A;  1DGK N;  3OS2 A;  5JVH L;  4B08 A;  3D2E B;  1JCF A;  5EVZ A;  1IO2 A;  2HHQ A;  2XY6 A;  2D0B A;  2PBD A;  4C8N A;  4CD1 A;  2RPI A;  1QE1 A;  4NLC A;  3MWT A;  2HBM A;  1Q9X A;  4GV3 A;  4GVE A;  4BR4 A;  4DMN A;  3LP0 A;  4LF5 K;  1CZ9 A;  3KD5 E;  2NRT A;  2ZGZ A;  2VWJ A;  3HBT A;  4M7Y A;  1JLE A;  3NH0 A;  4I9Q A;  3ENB A;  3NCI A;  1TKX A;  3T69 A;  3A5M C;  4EZ9 A;  4AQY K;  1YHQ N;  5F0X A;  1JL2 A;  4CHY A;  1Q7Y O;  3DXK B;  1HJO A;  3GL1 A;  3QB0 A;  3M1F A;  2P9S B;  1ZBL A;  4KTZ A;  4CJU A;  4CIE A;  2F96 A;  4AHU A;  4FJ8 A;  3CCS N;  4DUY K;  4KTW A;  4BRN A;  4DFJ A;  4KFB A;  4OJR A;  4OGC A;  3L4I A;  4I7F A;  1ZXO A;  1XQS C;  2A1S A;  4ILG B;  2W41 A;  4FOI A;  2OAN A;  4BVP A;  3C7N B;  4TSX A;  2HBL A;  4C8M A;  1XC3 A;  2FBT A;  3NVM A;  4FJG A;  2E5L K;  3FZH A;  4BR9 A;  2F8S A;  3B8A X;  2VCP A;  3VEX A;  2YNG A;  4DQP A;  3O9T A; 
#chains in the Genus database with same CATH homology
 4KI4 A;  3KLH A;  4R5P A;  3P83 D;  1DTT A;  1HRH A;  1REV A;  2P5G A;  3TAB A;  2G8F A;  1S9E A;  2OPP A;  1EXQ A;  1RT7 A;  5I3U A;  2DFH A;  4B9L A;  1HYS A;  1WSH A;  2YNI A;  2P51 A;  3L3V A;  1JLA A;  4CJP A;  2HB5 A;  5CYQ A;  1NKE A;  4KHS A;  5T7B A;  2HW3 A;  1A5V A;  4KAZ A;  5J2N A;  1RCH A;  4CHN A;  3EYZ A;  4DSL A;  1WSE A;  3CM6 A;  4DTN A;  1W0H A;  4CFC A;  3QIN A;  4CJE A;  2KW4 A;  4DTS A;  1TK0 A;  1JLF A;  4CED A;  3EZ5 A;  1J9A A;  2FBV A;  5DMR A;  1S1X A;  3V81 A;  1KLN A;  1UWB A;  3O3G A;  2ITG A;  4BAC A;  3SPZ A;  4CJ5 A;  1D8Y A;  3ZSV A;  3NDK A;  3AO2 A;  2XY5 A;  4FLT A;  3QNO A;  1VSM A;  3CM5 A;  3L2Q A;  4E0D A;  3DYA A;  4GMJ B;  3VA0 A;  3V9W A;  1ZBU A;  1T7P A;  1JKH A;  3VQB A;  1UA1 A;  4AHR A;  3VQA A;  4NCB A;  4FJ7 A;  1J54 A;  1RTI A;  3AA5 X;  4Y1C A;  4CJT A;  4O0I A;  3HM9 A;  3NHG A;  3V9S A;  3VA3 A;  3TAE A;  2VG5 A;  3NFA A;  2OPR A;  3AA2 A;  4CEQ A;  3RMA A;  4CEZ A;  3LP3 A;  3TAM A;  4FJN A;  1VSJ A;  4FLZ A;  4I9L A;  4O55 A;  4CGJ A;  3V1O A;  3HT3 A;  3HJF A;  4CJF A;  1S1V A;  1BI4 A;  3VQ7 A;  4CEO A;  1GOC A;  1VSL A;  3OJS A;  3JYT A;  4JS4 A;  4QCL A;  4KKO A;  4EP5 A;  2HNZ A;  1NOZ A;  3SPY A;  4FJJ A;  1BQM A;  4M41 A;  1NJW A;  1RIL A;  3ASM A;  4FLX A;  4GW6 A;  4LH4 A;  1YTU A;  1G15 A;  1DTQ A;  2Z1J A;  4FJX A;  1VSI A;  4OKE A;  4O0J A;  1EX4 A;  3L2U A;  3DM2 A;  3K5O A;  5SZT A;  3AVI A;  4JS5 A;  4E7K A;  3SUN A;  1QSS A;  5J2P A;  4KPY A;  2HHT A;  5C25 A;  3ZT4 A;  4DTU A;  2BGG A;  2Q3S A;  4H4M A;  2HND A;  4B8C A;  2VWK A;  3OYJ A;  1T03 A;  1NKB A;  3M8P A;  4FZX C;  4F3T A;  4Z4H A;  4Z4C A;  1VRU A;  3SQ2 A;  2IC3 A;  3SI6 A;  2IOC A;  3TI0 A;  1LAV A;  4E89 A;  4DLG A;  2QKB A;  4CJW A;  1I39 A;  1RDB A;  1QSY A;  1ZBI A;  1C1B A;  3B6P A;  4CGI A;  3QES A;  1X9M A;  2KTQ A;  4Y1D A;  5HRP A;  3ITH A;  4CHZ A;  3SV4 A;  1BIU A;  3NF6 A;  2OPS A;  2VG6 A;  2D5R A;  1NK9 A;  3SQ4 A;  1IG9 A;  3HYF A;  5HP1 A;  1RTH A;  1KVC A;  1KVB A;  4RW8 A;  3QEW A;  2PY5 A;  2HVH A;  4W5R A;  3RMB A;  1IKY A;  1C0T A;  1KVA A;  1RT6 A;  3F73 A;  1B92 A;  4W5Q A;  3S3M A;  1Q9Y A;  3NF7 A;  3SCX A;  4FJL A;  1L3U A;  3PV8 A;  4J2A A;  5KRT A;  4CJL A;  1JLQ A;  1TGO A;  3BDP A;  3O4Q A;  3HPO A;  4EZ6 A;  3SZ2 A;  4KHU A;  4CFB A;  2OYQ A;  3NF8 A;  4RW7 A;  4ZHR A;  1VK0 A;  4KTQ A;  4NCA A;  3MXJ A;  3L3U A;  3TAF A;  1IKX A;  4DLE A;  3LP1 A;  4CF0 A;  3SNN A;  1TKT A;  3P1G A;  4CK2 A;  3DLR A;  2E4L A;  2XY8 A;  3T1A A;  4CGH A;  3OYB A;  3OJU A;  2HMI A;  3SYZ A;  1C1A A;  3ZCM A;  3OYK A;  1LWE A;  3VN5 A;  1WSF A;  4DWI A;  3M8Q A;  3WNG A;  3LAL A;  4CCH A;  3LDS A;  1Z26 A;  1UOC A;  1C0U A;  4OVL A;  3ZT0 A;  1WNS A;  3SQ0 A;  1NJZ A;  5CZ1 A;  1SL1 A;  4PY5 A;  4Z4E A;  3AO5 A;  1A5W A;  1RBU A;  4BDZ A;  3DLE A;  3DRR A;  5KTQ A;  4FZZ A;  4AHC A;  1CZB A;  1HQU A;  1YT3 A;  2E6L A;  4NYN A;  1XHX A;  4NYF A;  3ZSR A;  3DLH A;  1N5Y A;  4BWM A;  4FK2 A;  4CFA A;  5CY4 A;  2Z1H A;  1HYV A;  1WSG A;  3IG1 A;  2HNY A;  4LH5 A;  4K8Z A;  4LSN A;  1ITG A;  1CLQ A;  3VQ9 A;  4QAG A;  4AHS A;  1FK9 A;  3V6D A;  2YHA A;  4CK3 A;  1RBT A;  3DRP A;  3AVA A;  3CQ8 A;  4CEC A;  4HTU A;  2Z1G A;  3KIO A;  2GBZ A;  5FRO A;  2QKK A;  2PYL A;  1XWL A;  2HHU A;  2A1R A;  2FC0 A;  4DU1 A;  4CF9 A;  3LPU A;  4FJI A;  4FM2 A;  2HVI A;  3CG7 A;  3BGR A;  3ALY A;  3PUF A;  4CFD A;  3KK3 A;  4Q5V A;  3TAP A;  3LWL A;  3ZT2 A;  4IG0 A;  1BCO A;  1NOY A;  2RKI A;  4F4K A;  1U48 A;  3KLE A;  1U04 A;  3HPG A;  4RW9 A;  4M3T A;  3A2F A;  2E6M A;  4FJM A;  2YHB A;  1J53 A;  3KLI A;  1J5O A;  1IH7 A;  3NH1 A;  2IAJ A;  3ZT1 A;  4DQR A;  4DTX A;  4CJV A;  2DTU A;  3CFO A;  4YFU A;  1U45 A;  4F3O A;  4KRF A;  1HMV A;  3C6U A;  3RR8 A;  2KZM A;  3RMC A;  3DRS A;  1NJX A;  5JS2 A;  5C42 A;  1O1W A;  5I42 A;  3OYF A;  3PX0 A;  3RRG A;  2Y1I A;  1KRP A;  1WSJ A;  3AA3 A;  4DSK A;  1RBV A;  4ID1 A;  1ASU A;  1GOB A;  4B8A B;  4XIU A;  3L8B A;  3TAQ A;  1L5U A;  5KRS A;  4FYD A;  4DS4 A;  3KKS A;  1A5X A;  5KGW A;  3VQ8 A;  4QOZ B;  5FRN A;  1F21 A;  3WNF A;  4AH9 A;  2XHB A;  3AVB A;  3T3F A;  4DF8 A;  3MXI A;  2VG7 A;  4FM0 A;  4CK1 A;  3NE6 A;  4DU3 A;  3B6O A;  3SUO A;  1RTJ A;  4KB1 A;  1L3V A;  2DFF A;  4CHP A;  4J2B A;  1BQN A;  1S9G A;  3L2V A;  3C94 A;  2GV9 A;  4KV8 A;  3RR7 A;  3MEC A;  3QEV A;  1ZBF A;  3OVN A;  3AVG A;  3VQ4 A;  4OPK A;  3DOL A;  5HRN A;  4IG3 A;  3TR8 A;  3HO1 A;  3ZSW A;  1U47 A;  1S1W A;  2BAN A;  4JRP A;  4E7H A;  4DSE A;  4DFK A;  1KCF A;  3K57 A;  1B9D A;  2KQ2 A;  4DTR A;  3QEP A;  3EY1 A;  4ZTF A;  4BDP A;  2R7Y A;  4FVM A;  3MEG A;  1RTD A;  4HCC A;  4PQU A;  1X9S A;  4DF4 A;  4FW2 A;  2W42 A;  3OYL A;  4CF2 A;  3ZSX A;  1U4B A;  1NK7 A;  4DQI A;  2IGI A;  2YNF A;  3NH2 A;  4HHT A;  2JGU A;  1JLG A;  4CES A;  3OYM A;  1DLO A;  1BCM A;  3AO4 A;  2P5O A;  4MFB A;  4CHQ A;  4N5S A;  4F2S A;  5C24 A;  4E7I A;  3I0R A;  1JL1 A;  3WNH A;  4CJR A;  4FM1 A;  3IRX A;  3OS1 A;  4CJS A;  3HST B;  4AHT A;  5DK5 A;  1QS4 A;  3QER A;  3QLH A;  4IDK A;  3ZSZ A;  1VSH A;  3NAE A;  4RG8 A;  3AVC A;  3V9X A;  5CZ2 A;  5J1E A;  2X6N A;  1ZBH A;  2DFE A;  3KD1 E;  3PO4 A;  2HHW A;  4B9U A;  3I8D A;  2RN2 A;  4DTP A;  3ISN C;  1NKC A;  2ZD1 A;  3M8R A;  3I0S A;  1D9F A;  1Y97 A;  4DTJ A;  5HBM A;  1UA0 A;  4IBN A;  3V1Q A;  2D0C A;  2YV0 X;  2YKN A;  3NBP A;  4FCY A;  4DSF A;  1TKD A;  4F2R A;  5D3G A;  1YTA A;  1JLC A;  4CJ3 A;  1SUQ A;  4FJ9 A;  1WSI A;  4Z0U A;  4CGG A;  2O4I A;  4JLH A;  3K2P A;  4CER A;  1LWF A;  3RMD A;  4ELT A;  4N47 A;  4E1M A;  3C6T A;  1ZYQ A;  1GOA A;  4C8O A;  4DSI A;  3C95 A;  3VQ6 A;  2B6A A;  1XI1 A;  4WE1 A;  3T19 A;  3AVJ A;  1K6Y A;  2YNH A;  1KFD A;  3QO9 A;  4ID5 A;  1IKW A;  1S1T A;  3VQD A;  3DLK A;  3G0Z A;  3K58 A;  2Y1J A;  3KTQ A;  1X9W A;  3D45 A;  4DFM A;  1RT1 A;  1BI4 B;  1L3T A;  1SL0 A;  2IDO A;  3V9Z A;  4ELV A;  4KI6 A;  3HK2 A;  3V1R A;  3OYA A;  4H4O A;  2G8I A;  1C6V A;  4LY7 A;  4E1N A;  3LZI A;  1RBR A;  3S3N A;  1C1C A;  1LW2 A;  3CYM A;  3ZT3 A;  4I2P A;  4CJQ A;  4DTM A;  4J2D A;  1JXE A;  3U6F A;  4PA1 A;  1LV5 A;  4FJK A;  4M3Y A;  1LAW A;  3VQC A;  4HVJ A;  3TAN A;  1D9D A;  3AVM A;  4H8K A;  1SKS A;  4KHQ A;  2KFZ A;  4AHV A;  1ASW A;  3SUQ A;  1MU2 A;  3TAR A;  3V4I A;  3AV9 A;  4OKJ A;  2I5J A;  4CGD A;  3HP6 A;  2XO7 A;  2O4G A;  4BE1 A;  2PZS A;  1B9F A;  3DI6 A;  2B5J A;  3G10 A;  5EU7 A;  4CEA A;  5J2Q A;  4MQ3 A;  3PY8 A;  1KSP A;  1YVU A;  4CEF A;  1JXB A;  1TV6 A;  3QEX A;  3WNE A;  3PX4 A;  1L3S A;  3E01 A;  3HVR A;  1S5J A;  1TAQ A;  2G8H A;  3UIQ A;  3QNN A;  1HNV A;  3PX6 A;  4M3W A;  4OLB A;  4B3O A;  4K8X A;  1RT3 A;  4KO0 A;  4M3R A;  4BDY A;  4W5T A;  3OS0 A;  5K14 A;  3O4N A;  4CF8 A;  2ZE2 A;  4HUG A;  4HCB A;  2BE2 A;  1NK6 A;  2IS3 A;  3HVT A;  2ZQB A;  4B9V A;  4N41 A;  3O3F A;  2KFN A;  4IFY A;  4CEE A;  4CHO A;  1TVR A;  4HUF A;  2P1J A;  3VQQ A;  3AO1 A;  2WON A;  3RWU A;  4FXD A;  2X6S A;  4FLU A;  4C8L A;  4M45 A;  4Z4I A;  4M3Z A;  1TAU A;  3MXM A;  3LAK A;  3OYE A;  4CGF A;  2LSN A;  4HUE A;  4BE2 A;  4OGE A;  1SKW A;  1FKP A;  3IS9 A;  4CF1 A;  4CIF A;  3MAQ A;  1HJR A;  4J2E A;  3ULD A;  4F8R A;  3H08 A;  4LSL A;  5FRM A;  1QHT A;  2NUB A;  4BE0 A;  1U49 A;  3AVN A;  2FBX A;  4KB0 A;  3HP9 A;  1SL2 A;  3DOK A;  4DS5 A;  1TL1 A;  3NGI A;  4CJ4 A;  2G8W A;  4FW1 A;  3NGY A;  4B9S A;  5FDL A;  4E7L A;  1T8E A;  4B9N A;  1QQC A;  3L2R A;  2G8U A;  4M3U A;  4PWD A;  1LWC A;  2RF2 A;  3S9H A;  4FZY A;  2EX3 A;  1TKZ A;  3DMJ A;  3K5M A;  1BIZ A;  4E7J A;  1KFS A;  1IKV A;  1BIS A;  3KLG A;  4FJ5 A;  3VQ5 A;  1R0A A;  3KLF A;  1XHZ A;  3QIO A;  1NK8 A;  3OYH A;  1ASV A;  4C8K A;  3NF9 A;  4DFP A;  3U3Y A;  1NK4 A;  4Q0B A;  3V9U A;  1NK5 A;  4KHY A;  1HYZ A;  4BWJ A;  5HRS A;  3TWH A;  4FK0 A;  4GVM A;  2FBY A;  4DQQ A;  3KK1 A;  4W5N A;  3ZSY A;  1FKO A;  4G1Q A;  3U3G A;  4Z4F A;  2ATQ A;  5SWM A;  3OYI A;  1BHL A;  3AVL A;  4EP4 A;  3NGZ A;  3CFP A;  4RW6 A;  1RT4 A;  3MEE A;  1VSE A;  4DTO A;  1RDA A;  3HL8 A;  3L2W A;  3K5L A;  1FXX A;  4DU4 A;  1HNI A;  4L8R B;  1T05 A;  3HPH A;  4CJK A;  2JLE A;  3OYD A;  3AO3 A;  3JSM A;  5KGX A;  4KHW A;  2X74 A;  1NJY A;  4O5B A;  2AJQ A;  4E19 A;  3AA4 A;  3LPT A;  1D5A A;  3LWM A;  4E3S A;  2G8V A;  4KRE A;  1VSF A;  4M3X A;  3TAG A;  1LW0 A;  4ELU A;  4DG1 A;  1EET A;  3O3H A;  1RDC A;  1VRT A;  1KLM A;  4M42 A;  1UAX A;  3OYG A;  2WOM A;  4ZTJ A;  1VSK A;  1S1U A;  5HRO A;  2G8K A;  1JLB A;  3KJV A;  2YKM A;  2QK9 A;  5JS1 A;  1W9H A;  3OS2 A;  2OA8 A;  1RNH A;  2HHX A;  4B08 A;  1CXQ A;  3QET A;  3KKR A;  2GUI A;  3CFR A;  2XRI A;  1IO2 A;  2HHQ A;  1RBS A;  2XY6 A;  2ETJ A;  4RW4 A;  3IAY A;  5E41 A;  1XC9 A;  3THV A;  1KTQ A;  1SKR A;  1QSL A;  2D0B A;  1CXU A;  2QXF A;  1TK8 A;  1EKE A;  3VQP A;  5HLF A;  4C8N A;  2RPI A;  4FK4 A;  2EHG A;  4OLA A;  1QE1 A;  4CEB A;  3D0P A;  1EP4 A;  2OZS A;  3DLB A;  1WAJ A;  1Q9X A;  2F8T A;  4DMN A;  3LP0 A;  3QIP A;  4I2Q A;  1CZ9 A;  3MED A;  3KD5 E;  2PYJ A;  4ICL A;  3HXM A;  1RT2 A;  3LAM A;  1Q8I A;  2VWJ A;  3SQ1 A;  4B9T A;  5HRR A;  4LD0 A;  1JLE A;  4N56 A;  2OZM A;  2KZZ A;  3RRH A;  1NK0 A;  1WLJ A;  3PO5 A;  3NH0 A;  1BL3 A;  2Z1I A;  4FLV A;  2BDP A;  3OYC A;  4AIL C;  4IFV A;  1HPZ A;  1S6P A;  1I3A A;  1S6Q A;  3NCI A;  1TKX A;  1TK5 A;  4I9Q A;  1WN7 A;  1RT5 A;  4EZ9 A;  1X1P A;  3P5J A;  2X78 A;  1JL2 A;  1N6Q A;  4W5O A;  1C0M A;  4CHY A;  3SJJ A;  5CYM A;  3ZSQ A;  3LZJ A;  4CIG A;  4O4G A;  1QTM A;  4UQG A;  1ZBL A;  4KTZ A;  4CJU A;  4CIE A;  2DY4 A;  2F96 A;  4AHU A;  3SV3 A;  4FJ8 A;  4JRQ A;  4KTW A;  4KHN A;  1RDD A;  3FFI A;  4YNQ A;  3OYN A;  3AVF A;  3AVH A;  2OPQ A;  1WAF A;  3LP2 A;  3K59 A;  2B4J A;  4DFJ A;  1BGX T;  4OPJ A;  3M8S A;  3SUP A;  3RTV A;  2HHV A;  4KFB A;  4OJR A;  4FJH A;  4OGC A;  3AVK A;  4DQS A;  4B9M A;  4FLW A;  4IKF A;  1SV5 A;  3K5N A;  4Z4G A;  4I7F A;  2A1S A;  5KI6 A;  3LAN A;  3S3O A;  4OKK A;  5J2M A;  4TSX A;  4N76 A;  4C8M A;  2FBT A;  4FJG A;  2D0A A;  3VQE A;  4CE9 A;  3QEI A;  4PUO A;  2F8S A;  3F9K A;  1HQE A;  3DLG A;  4FLY A;  4DSJ A;  1TL3 A;  4O44 A;  4NCG A;  3ZSO A;  1VSD A;  2XY7 A;  1Z25 A;  3KK2 A;  2HHS A;  3OY9 A;  2YNG A;  4DQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...