4JI5K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji5K00
4DV4K 4V19S 5A2QO 5LMNK 4DR2K 4JI6K 4B3RK 4JI4K 4X64K 4DV5K 1N34K 5BR8K 5IWAK 4X65K 3T1HK 2UUBK 4DR5K 4LF6K 4OX9K 1XNRK 4DV3K 4AQYK 2ZM6K 4DV1K 4DV0K 4LF9K 4DR4K 4B3SK 4LFCK 1J5EK 4NXMK 4CW7B 2UXCK 5FLXO 4B3MK 5LL6Z 4CVNE 4DR6K 5IT9O 4DV2K 4DR7K 4DV7K 3T1YK 4JI2K 4JI5K 4JI7K 5LMUK 3J80O 2UXBK 5AJ3K 2UU9K 1HR0K 2HHHK 4GKJK 4JI3K 3JAMO 1IBKK 4X66K 3J7YP 3J7AP 1XMOK 4GKKK 1FJGK 2UUAK 4LFBK 1N36K 2E5LK 3OTOK 4JV5K 4B3TK 1IBLK 1XMQK 1IBMK 4YY3K 4JI0K 4DUYK 2UXDK 4JI8K 2UUCK 4DV6K 4K0KK 4KHPK 2VQEK 2VQFK 4LF5K 4X62K 1N32K 4YHHK 1N33K 1HNXK 4DUZK 4LF7K 1HNWK 2F4VK 4DR1K 4JYAK 4NXNK 4LF4K 1XNQK 1HNZK 4JI1K 4DR3K 1I94K 3J81O 4LFAK 4LF8K
chains in the Genus database with same CATH superfamily
3VGMA 4WF9L 2VWJA 2OA8A 1IKVA 1X3MA 1W0HA 1IG9A 5AQNA 4JS4A 4FL9A 3RVCA 4FVUA 4JAXA 3NF6A 3DLHA 1E4FT 1EWRA 5BRFA 2E20A 3HSTB 4BACA 3ZYYX 3L4QA 3VENA 3QEIA 3F2KA 4E3SA 1C1BA 4YOWA 4Y0WA 3U4LA 4OO1J 1VAZA 3LALA 5DMRA 2NRZA 4A2BA 1VQMN 5AQGA 4B9MA 3DRSA 1VQLN 4JNEA 4DKWA 1NG9A 1NK8A 4CZFA 4E7IA 4H0TB 2Q36A 5JMVA 1VQPN 1YJWN 4PY5A 1HNVA 3WNEA 3NDKA 1SUQA 4BREA 4DV2K 2P5OA 3SMSA 1YT3A 4KH5A 2GTDA 2FXUA 3MEGA 5CE3A 4EHTA 4E7JA 1VQ7N 3OYIA 5AFUA 4GKJK 1HYZA 4DTMA 4KO0A 3CERA 4BR7A 2HBKA 3B6PA 3FZKA 4MLHA 1D8YA 3HBTA 2E6MA 5HRNA 1RILA 4DFMA 1NK9A 2FSJA 3VTIA 3KJVA 4O0JA 1IBMK 2D0AA 3WXKA 2W40A 3KKSA 4B1UB 4DU4A 3D2EB 5AQIA 3LPTA 4DSFA 3DWLA 4FWQA 4FWNA 4DF8A 4JEPA 1N33K 1HNXK 4H0YB 2VYPA 4JHDB 3I8BA 2I7NA 1M90O 5BRDA 5AR0A 1VSIA 3WXIA 4A61A 3CFOA 4B1YB 2DTUA 1BG3A 1HYVA 1JL2A 5F1XA 3EZ5A 3SPYA 1YTAA 4FPBA 4AH9A 5I3UA 4JN4A 1IG8A 1VRUA 3IFRA 3L2RA 1JXBA 2YNFA 2A1SA 4UY8O 5DM6L 3KLGA 1JL1A 5AQXA 3KK3A 4FW2A 4CZIA 3AVCA 1Z05A 3EKUA 2UUBK 2YHAA 1NMDA 3HZ6A 4WFBL 3NGYA 3EYZA 3K5MA 4DV1K 2V7ZA 3IG1A 4ZTFA 3MXIA 2NZTA 3TSQA 1Q18A 3EE8A 2JWLA 3RRGA 3KK7A 2A40A 2VG7A 2ZWHA 4WE1A 5AQUA 2BH1A 2E2NA 2VWKA 2FBYA 5CYQA 4FLTA 1UA0A 4YOTA 2KKZA 4O8KA 1GOAA 4B1XB 4JKBA 1C0FA 4WYBA 5IT9O 4O5BA 3ZETA 2GELA 2R7YA 2KFNA 4CF9A 4M3YA 3VETA 3TAPA 3CF5L 1HMVA 1VQ5N 3SJHA 3MXMA 4JI3K 4DU3A 3I55N 3O9RA 4KHQA 4DG1A 4BRPA 4FWKA 4KB0A 1X1PA 3JS6A 1XMQK 4BE2A 5JLFA 1MA9B 4BRIA 1DEJA 1NGCA 3GE1A 1NK5A 1QTMA 3U3YA 4BRNA 3L8BA 3RMAA 3FZHA 3AARA 3VTHA 3U9DA 4E0DA 4H5WA 1DGKN 1TUYA 3QINA 2KFZA 2HHVA 1KVAA 5JVGL 2F4VK 4E89A 2D1KA 4CD3A 3H3OB 2HMPA 4NLCA 3VF2A 1XNQK 3NF9A 5JS1A 3QBWA 1RTIA 1WB9A 4LF8K 3U8XA 4OPHA 1VSJA 2P1JA 5E84A 5ADXH 2OPRA 5FDLA 4IDHA 2WTUA 2HBMA 1VQ9N 4JD2A 1RTDA 2GUPA 1TL1A 4IBNA 5BR8K 3OYKA 1FW6A 4BRMA 5F0XA 2P9PA 4OVLA 3QNOA 3UKRA 4L8RB 4FWOA 2ZF5O 3MCAB 4CJWA 2D0PA 4DR4K 3CJBA 3HPOA 4QS9A 1FKPA 4DQQA 3QEVA 1VQ4N 1NJYA 1RT2A 1RNHA 1X9JA 3L2WA 3UKUA 2E6LA 5LL6Z 4CVNE 4LSLA 4XH5A 3KLIA 1K73O 2O8CA 4IOXA 3VEZA 3HRGA 5GAHP 4IO9L 4JKGB 5GAGP 3S41A 1ZBHA 3CM5A 1BCMA 2W41A 4FWPA 4DCHA 1BQMA 2A42A 4ISFA 3TABA 1QQNA 4H0OA 4M3UA 3CMAN 4DTUA 4KH6A 4HCBA 3E1YA 4F3OA 4BRQA 4BRFA 2NRTA 4UQGA 1S72N 1KQSM 5KRSA 4Z4CA 3VOVA 4DV6K 1JLEA 2HHSA 2QTDA 4HUGA 4WQ4A 4KAZA 1IJJA 3AVMA 4DFJA 2XY6A 1YIJN 4K43A 5BPLA 4OPKA 2AJQA 2AP1A 1NJWA 3M8RA 2FC0A 3V81A 3BUZB 3H6EA 1B9FA 1W2BM 3NGZA 3K9JA 4CJSA 1VQNN 3U9ZA 1C0UA 1JXEA 1VSLA 3CXCM 1L3VA 5K14A 5CR4A 1CXQA 4AM7A 4LF4K 3HPHA 2QWNA 4B9SA 3O4QA 2O8EB 4AHTA 1VSKA 3ID8A 4JKDA 3AA3A 5C42A 3FR0A 4Z4GA 3DOLA 3KK1A 3S3MA 2O8FA 3T1HK 5KPZA 3MX5A 2CGKA 4F3TA 4CJRA 3K5LA 4CHZA 1BGXT 1F21A 4E1JA 3LP2A 1LAVA 4MO4A 3G6EN 3DXKA 1ESVA 2NRRA 3A5MC 4JKHA 4CK1A 2O8BB 1I39A 2CGJA 4ILJA 1GLDG 3PO4A 1R59O 3IMXA 3L0QA 4Z94A 3SI6A 5FLXO 4B3MK 4M3RA 3THWB 3TAFA 3TSUA 4RG8A 3GDQA 1TK5A 3VF6A 2BANA 2EWSA 3AAQA 2RE2A 1HNIA 4A57A 1SAZA 2A5XA 3VF4A 3V1RA 2QA4N 3QIOA 3O3GA 1OH5A 3T7ZA 3LM9A 4JRQA 2F9TA 4HHTA 3TWHA 1HR0K 1SQKA 1NK4A 1LWCA 3MEEA 3SQ0A 2GX9A 4FM1A 1WSFA 4KB1A 2YKMA 3CCVN 4GY2B 1KAYA 3R6MA 1U2VB 1S1WA 4K42A 4C8OA 3AA5X 2VQEK 3VQ7A 3CCRN 2ZGZA 4WFAL 1U47A 1S3XA 3AVHA 2VQFK 3VEVA 3OYDA 3SMPA 3DLLL 3OS2A 3LPUA 2XY5A 4DTNA 4RW4A 2Q2RA 1HKBA 3P4IA 1NGBA 1ZBFA 3DLGA 3WEEA 3VQBA 1LOTB 2Z1GA 5E26A 3SK3A 3DAWA 4B8AB 4CHYA 3K0SA 3EEQA 2ZJQL 4C23A 2YHXA 3I33A 2UYTA 4CJKA 2XY8A 3ITHA 2QW9A 4C8MA 3ZLJA 4IFYA 5SZTA 4DV4K 4FJJA 2P9LA 1OVQA 1ZBUA 4ZTJA 4JI4K 4HUEA 3VA3A 3DOKA 3AGRA 5SWMA 5AZJA 4M3ZA 3CQ8A 4IOAL 2A1RA 2LSNA 3F9KA 3TTDA 3PSIA 3ENHA 4IKFA 5M1FA 3QFPA 2Y1IA 2Q0RA 2PYJA 4PUOA 3T3FA 3OBWA 4CGIA 3PIPL 2YHYA 1HPMA 1JLCA 3ULEB 3M3ZA 3K58A 3VA0A 3WQTA 4ELTA 4W5NA 1N8RO 4CJEA 1RDWX 2Q1NA 4K41A 5H1SQ 1RTJA 3QNNA 4CJQA 3TARA 3CFPA 3F73A 3VEXA 3VQ6A 4DHYA 4M45A 4CJVA 4KHUA 1QZ6A 1BWFO 4QCLA 2P9SA 1T6DA 3RR7A 1KAXA 5M1QA 4GKKK 1FJGK 1K6YA 3NF8A 1ASWA 4QOZB 1RT6A 4B3TK 1IBLK 3NHGA 1BL3A 2PYLA 1R0AA 3D2FB 3C7NA 3CETA 4CFCA 3DLEA 3LWLA 4J2DA 3T69A 5F2RA 4Z4HA 1GLEG 2F8SA 3QETA 2B6AA 3VQDA 5CY4A 2DFEA 2CH6A 4N56A 4FLVA 1N5YA 3MX2A 1RBSA 4BRLA 4L3QA 4HCCA 3V9XA 3LL3A 4BDYA 2IVOA 4O44A 1S1XA 3HJFA 1TGOA 3ULDA 4CD1A 3ZSYA 3DI6A 1HUXA 1OH6A 1WSJA 3CJ1A 2P9NB 1NU0A 1NMNA 3KKRA 4MDAA 4BC5A 4ISEA 3FLCO 2EX3A 5AQKA 5IWAK 3CYMA 5AQMA 1YAGA 3NH2A 3OYNA 4OKKA 1ATNA 1XNRK 3HL8A 1YJ9N 3VEYA 4BRDA 3QO9A 1NKEA 1K9MO 2ZJRL 4FSVA 5HLFA 1TL3A 2OPSA 1J5EK 3NE6A 4NXMK 3GL1A 2HHTA 3R9PA 4LD0A 5AQHA 1T8EA 4O55A 4OKJA 2OCEA 1MWMA 2JGUA 2PY5A 2QWQA 1WSIA 1SKSA 4OLAA 1TKTA 4RCHA 4CEEA 1JCEA 2W6LA 2YX6A 2D0BA 1NK7A 3HYFA 3WUHA 2P9KA 3TAQA 5J1EA 1CLQA 3PIOL 4I9QA 4FCYA 3AA2A 1WOQA 3EN9A 3TTFA 2DFFA 1TKZA 5LMUK 3EL2A 2RPIA 4HVJA 2KLAA 4B9LA 3VMFB 4JKCA 1YITN 3TSPA 3TTCA 1XMOK 2QWOA 1S6QA 1EQYA 3AVJA 5BPMA 2E2OA 4JV5K 4AHSA 3L2VA 4BWJA 2UXDK 4HUFA 1S22A 2ZJPL 4K0KK 3HVRA 1LWFA 4RW9A 3A5OC 2P9UB 3TR8A 2YKNA 3H46O 3SZ2A 3C94A 3C95A 4CEFA 3O3FA 4X62K 1VQON 4DTRA 2KQ2A 1QQCA 1TK8A 4DSKA 3O08A 3OYHA 4EFHA 2WBNA 1NGFA 3A2FA 1D4XA 3THXA 3SAGA 5EVZA 2HBJA 4CFAA 3ZX3A 2GBZA 3HPGA 1HLUA 1VRTA 5D3GA 1TYQA 2YV0X 1UA1A 1SZ2A 1QE1A 2O8DB 1Q8IA 4K8XA 3UE5A 3A5NC 4CBWA 3ZT1A 4PQUA 5LJWA 4DS4A 3S3NA 2YI1A 3WXMB 3SQ2A 4FJHA 4X64K 4H4MA 4DQ8A 1TUUA 3MDQA 3M8SA 1YTUA 3T1AA 4QAGA 4FJIA 3QBXA 3NH1A 4LF6K 2Q31A 3D45A 3I56N 3VQ4A 3UB5A 4CFDA 3NGIA 5MLCQ 4YFUA 3CJAA 2GV9A 3IDHA 1LWEA 1BA0A 3AY9A 3TAEA 4JKEA 3LZJA 4BDZA 4HWIA 2G8HA 3O9TA 4FO0A 4BR5A 3MEDA 5KQDA 3P5JA 2IS3A 3KHYA 1P90A 4CF2A 4FXDA 3LANA 2Y1JA 1WLJA 2NRVA 4CZEA 4CHQA 2OTJN 2P9IA 4FJ5A 2HHQA 4DV7K 2FF6A 1LCUA 2F96A 4DS5A 4CFBA 1BA1A 3GOIA 4EP4A 5C2DA 2YNGA 5KPRA 1RT7A 4BQZA 3O9QA 2HF4A 3OY9A 3SUOA 4LH5A 3BZCA 4DSEA 2FBTA 4JK8A 2XY7A 2VG6A 4BR9A 3KWGA 4FJ8A 3G10A 5DM7L 1UOCA 4G1QA 4CJLA 2RF2A 5FROA 3NF7A 1YF5L 3QIPA 3HSCA 1U4BA 4CCHA 3TPQA 4LF5K 1TK0A 4C8NA 4H5NA 1EXQA 2PZSA 2OANA 1YVUA 5AZIB 3Q7CA 5E41A 2KTQA 3SNNA 4OPJA 4IXCA 3FFKB 4KTZA 3EO3A 1DTQA 1QSLA 5EX5A 4MDBA 3W3DA 4PKHA 5M1NA 3MN7A 4FZZA 4B9VA 3VQ5A 5CZ1A 3ENBA 1SV5A 4YNQA 3PX0A 5J2PA 2IGIA 4J2AA 3H1QA 3OS0A 4DFKA 4B9TA 4I6MB 4FZYA 3SV3A 3TU5A 4GMJB 4X65K 3LZIA 3AVFA 5I42A 3M8QA 1T05A 4AQYK 1NKBA 1OKJA 1TKDA 2YJFA 4I2QA 2FSKA 4JRPA 4OPAA 3OYFA 4DLGA 2P5GA 3ZEUB 4CI6A 3SBTA 5AQLA 5HOOA 3CCUN 4DU1A 1N6QA 3E9OA 1KFSA 1ZBIA 3LDOA 4R79A 1NM1A 3A0IX 2HMIA 4KV8A 3VESA 4DR6K 3CCSN 4YORA 3V9UA 4KKOA 3D2EA 3RR8A 2JLEA 1RFQA 4PKGA 2HHHK 1VSEA 1Q7YO 4BG8A 4X66K 3J7AP 5CHIA 4JHDA 1YHQN 2I5JA 2AA4A 4OJRA 3S9HA 1L3TA 4N41A 5ADXA 2WOMA 3HXMA 1GOCA 2V51B 3WNHA 3SAFA 2HHXA 5JICA 4OLBA 3OA9A 3IKMA 1RDDA 4W5TA 3SUNA 5BPNA 3OYAA 3DJCA 1GLJO 4AF1A 3ZX2A 2J4RA 4B1ZA 3VEOA 1RDCA 5GAEP 3T19A 3CCMN 5HROA 1LAWA 4IFVA 3NVKA 4AHVA 3EY1A 2B4JA 4NXNK 4KHYA 1QS4A 1X3NA 3P38A 4JLHA 3GG4A 1HYSA 3M1FA 4FK2A 1OH7A 1NLVA 4CJ3A 2QKBA 1P8ZA 4KRFA 2HVHA 2IC3A 3FZMA 3D0PA 1QZ5A 4LY7A 1FXXA 3HO1A 3NBPA 4Y1CA 4EZ6A 2F7TA 2E8AA 3CPEA 4OX9K 2YNHA 3ASMA 5AZJB 4CJTA 3DM2A 3EE9A 2D4WA 3AO4A 2HW3A 1RBTA 1HX1A 3P31A 1NWKA 4CGJA 3NMUA 2ETJA 3R3LA 1G99A 3RWUA 2E2QA 4IG0A 4MLEA 4Q0BA 1K8KB 4FVMA 2BUPA 3R8EA 3DLKA 1BO5O 2FF3B 2E4LA 3MCPA 4O4GA 4CZLA 5KGXA 4FJXA 1BU6O 1RBVA 1RGIA 4DR7K 4N5SA 3KLFA 4GNIA 3QMLA 2HB5A 2ITMA 4E7HA 1T6CA 4KHSA 4DTPA 2HBLA 4KHNA 3PX6A 4OKEA 4QS8A 4BGAA 2ZE2A 4RTFD 5KI6A 1CXUA 3KIOA 2OZMA 4CEBA 3BEXA 3AVIA 2CGLA 3AVGA 3PV8A 4JK7A 5HRSA 2FBVA 1C1CA 5LJVA 3J8AA 3OYCA 3BF1A 3ZSXA 4FYDA 4JI8K 3VQ9A 1QSSA 1Q82O 4C1NI 1RT3A 3HM9A 4FJGA 4NYNA 4BC2A 4FJKA 2A41A 2CH5A 1ATSA 4CESA 4PHTX 3OJSA 4B8CA 2YCHA 4KI4A 4H5VA 4GV6A 1CZAN 2W42A 1JJ2M 2YHBA 2OPPA 1B9DA 2HVIA 4DUZK 1HNWK 4FK0A 3G0ZA 1QVGM 2G8WA 3CD6N 4JI1K 4IZ9A 3FGUA 2E2PA 3DXMB 4M3XA 3QDKA 3OYBA 4LFAK 4Z4FA 3VQ8A 4NLBA 3CJCA 4KH4A 3PSFA 2QXLA 4A62A 2KZZA 3B6OA 4FWLA 5BRHA 1M1KO 5A2QO 4E19A 1KRPA 1MWKA 1KFDA 4BE0A 1NJXA 1VSMA 4YOUA 1NNEA 1KLNA 3H08A 3ZSWA 1NJIO 1E3MA 4JKGA 3OW2M 3OVNA 4CHPA 2KW4A 3ATVA 2DY4A 1MU2A 4NCAA 1XC9A 4E7LA 1WBBA 4M63C 4DLEA 4EZ9A 3TAGA 3AVNA 3AVBA 3QLHA 2HNYA 1LV5A 1V4TA 3THYB 2X6NA 4CEAA 5HBMA 4K25A 4AHRA 2RKIA 2ITGA 3AVKA 1K8AO 2F9WA 4BR2A 3A5LC 1Z26A 4GW6A 5M1PA 3WNFA 5AQTA 3THVA 3KVGA 3VQAA 4FM2A 3TAMA 3V6DA 3MMVA 1VQKN 1NOZA 4MQ3A 1ZC6A 1TV6A 4JI2K 4CZJA 4BWMA 1IKYA 2QK9A 2QKKA 4U67L 2ASMA 1W9HA 4MFBA 2BE2A 3OYJA 4A5BA 4C1NK 3QEPA 2D0CA 4ELVA 1ATRA 2I7PA 1KCFA 2G8FA 3L4IA 3A8YA 4JKFA 1ZBSA 3AV9A 2O8EA 3BGRA 5AQJA 1IKXA 1HKCA 1RT5A 4N76A 1LW2A 2NRWA 1BDGA 1L5UA 4FJ9A 4CF8A 3V1QA 3HTVA 1LW0A 1KC8O 4YHHK 2X78A 1JLAA 1YI2N 1RDAA 4HTLA 4AHUA 3RSEA 3ZSQA 4CEQA 2QEXN 3JYTA 4DQRA 3RMBA 3AGKA 4I7FA 5I9EB 4O5FA 2H3GX 4BR0A 3ISNC 1IV0A 2O8BA 1WSGA 4NYFA 2HNZA 3IS9A 1WAFA 1NK0A 3LDPA 3MN6A 5TKYA 3VGLA 5GADP 2GUIA 3O4WA 3M6GA 4O8UA 4PA1A 4CZKA 3THWA 5BN8A 1CZ9A 3C6AA 3CIPA 4BE1A 4AHCA 3QFUA 1QQMA 1N34K 1WN7A 4CBXA 1KVCA 4FWSA 5AQVA 1Q9YA 5AQOA 1C1AA 1JLFA 3SAHA 3NAEA 1L3SA 5AQYA 4GVMA 2BGGA 3CMEN 4B3SK 2ASOA 3SQ4A 3WNGA 5HL7L 3ENOA 1RTHA 5JS2A 2P51A 1JCGA 4TSXA 4IJNA 3NH0A 5FRMA 1KTQA 2ATQA 4J2BA 5BREA 1U2VA 2HOEA 2XO7A 1O1WA 3QESA 4W5QA 4BRHA 5JLHA 2P9IB 4DSLA 4JS5A 5LY3A 4YOYA 1Q81O 3V9ZA 1T7PA 3CCEN 4IO8A 4RW6A 3FZLA 1T3VA 3JAMO 3J7YP 3VEWA 4LSNA 3NFAA 1HRHA 3MXJA 5HP1A 3PO5A 4I2PA 3SCXA 1DLOA 5AQWA 2NUBA 2BDPA 1TAQA 3W0LA 2UUCK 4WQ5A 4K8ZA 3ZETB 1JKHA 4CZMA 3DRRA 3ZX0A 1Y97A 5GIPA 3K5NA 4M3WA 4DTSA 1EO1A 3N4PA 1JCFA 4CEDA 3C6HA 3CJ7A 4LF7K 4J8FA 3F5TA 3VERA 3RRHA 1HPZA 1TKXA 4BQLA 1S1UA 3CC4N 4BRGA 5KGWA 1J53A 3NVMA 5AFUH 2GWKA 3J81O 3LDQA 4R5PA 4G9ZA 3ULEA 1D5AA 2YJEA 4V19S 2QM1A 1UWBA 3AO2A 3S3OA 2WFBA 1VK0A 4A5AA 4EHUA 1BI4A 3AVAA 4CGFA 2RN2A 3VN5A 1U49A 3ZT2A 2IVPA 1Q9XA 4Z4EA 4KPYA 4DQSA 3E01A 4B1WB 2QWPA 2FLOA 1XWLA 2IVNA 1I3AA 4LF9K 4BC4A 3HP6A 5AQPA 1NGIA 4JK9A 4KTWA 4KREA 1RCHA 4CJUA 3V9SA 1HJRA 3WXJA 2UXCK 3CQXA 1FK9A 3AO1A 3U3GA 3J7ZO 1WSEA 4B3OA 4CF1A 2HHUA 4H5RA 3P1GA 5C10A 4KFBA 3CI5A 3MWTA 3V1OA 5C12A 5C25A 2HNDA 4BROA 4JD2B 3MK6A 2ASPA 3D2FA 4RWTA 1SL0A 4F8RA 4CHOA 4CF0A 2P9PB 4MO5A 4GVEA 5KTQA 3JSMA 3UKRB 4GV3A 3O1WA 3DYAA 3ZT4A 1UAXA 1KLMA 4IDKA 4M7YA 4DFPA 4A59A 2V52B 1C0MA 4CZGA 5GINA 2UUAK 2Q3SA 4CEZA 1C0TA 2NNWA 3H45C 4LFBK 1V4SA 1DTTA 3UKUB 5HRPA 3SYZA 3FFIA 4FLWA 2O8CB 4AM6A 3ZCMA 2P9NA 3ZSZA 1FKOA 4DF4A 2HSTA 3EKSA 3SPZA 3QB0A 4NCBA 1XUPO 3CQYA 3TI0A 4YDUA 5J2NA 4B1VA 3BF3A 1BQNA 4IJAA 2G8KA 2E1YA 1IKWA 3VQEA 3MN5A 1XHZA 1WUAA 4H0VB 1GLFO 5FPMA 2QWMA 2Q0UA 1IO2A 4XH4A 1GLLO 1S1VA 1JLGA 1SL1A 3PX4A 3K9KA 1NGDA 4BVPA 5J2QA 3VGKA 1C6VA 1ILYA 1H1VA 4KTQA 5M1KA 2G8UA 1EP4A 1RT4A 4IG3A 3N4QA 3ZSOA 2IOCA 4LC9B 1REVA 1NGHA 4RW7A 1KVBA 4JI6K 4FPAA 1U6ZA 3HP9A 2O4IA 2V7YA 3OHRA 5EU7A 2B5JA 4DMNA 3CCJN 4F2SA 3KD1E 4BR4A 4BRAA 4DB3A 5C0YA 3KWIA 4KI6A 1A5VA 3ZT0A 3WXLA 2NLXA 2ZM6K 3QEWA 3AO3A 4DV0K 3G71N 5CZ2A 4CJ5A 4FLYA 1RDBA 4I9LA 4C8LA 4AILC 2XHBA 4Y1DA 1YJNN 3RTVA 2IIRA 3P39A 5C24A 1HJOA 5AQFA 4IOCL 3L6QA 4CIGA 1NGJA 4WQ5C 1TAUA 4Q5VA 1WSHA 2O8FB 3H3NO 1RBUA 1KAZA 2P9UA 2Z1JA 3O3HA 4JKAA 3AAPA 3DLBA 3R1XA 4H03B 4BY9C 5M1OA 4M3TA 2UXBK 1ZXOA 3DXKB 1ITGA 4CGGA 5AJ3K 2VCPA 4IWVA 3LAMA 3MWPA 3CCQN 1OH8A 3L2UA 4DQIA 1JLQA 1A5XA 3OTOK 4FW1A 4IFEA 2G8IA 3ZSRA 4FWMA 2GWJA 5KPTA 4JI0K 5EY4A 3LM2A 5AQQA 1W97L 2O8DA 1X9SA 4BC3A 1A5WA 1GOBA 2FBXA 3BP8A 4CE9A 2O4GA 3MN9A 4E7KA 3M5RA 3SV4A 4U7BA 3WT0A 3SUPA 2EHGA 4CJ4A 3VQQA 3CG7A 4DR3K 5DK5A 4FJMA 1I94K 5CYMA 3OJUA 3O4NA 4YOXA 1RDUA 2Z1HA 3K5OA 3GBTA 4H0XB 3LP1A 1C0GA 3OYLA 4DTOA 1VQ6N 4ID5A 4ID1A 3LDSA 2NRHA 4B3RK 2ZQBA 4DV5K 1MDUB 1ZYQA 4M7XA 2HHWA 2PBDA 3WEEB 4DSIA 1QHTA 4CK3A 3C6TA 3OYEA 2X74A 1KXPA 3OYGA 4DV3K 3SJJA 4H8KA 4OGEA 3BZKA 4E1MA 2WUSA 2KZMA 1BISA 4NB4A 3CM6A 2D0OA 3BY5A 3K59A 2W6KA 3HT3A 4Z4IA 1DKGD 1WNSA 1Z25A 3H1VX 1SKRA 1D9DA 4FM0A 2P9LB 2VWBA 3LDNA 5KQ8A 3PUFA 4EIAA 3ZSVA 3O80A 1T03A 3SQ1A 2Z1IA 4FWRA 4B08A 5B8HA 4B9NA 1U45A 4CIEA 3I0SA 3V9WA 4YDUC 4NO7A 1GLCG 4NCGA 1EKEA 1JLBA 5C2FA 1HKGA 5T7BA 3AA4A 5AZIA 1KSPA 2G8VA 1SKWA 2A6AA 5GIOA 1Y64A 4M42A 3FE1A 4N47A 1XHXA 2E5LK 2PFUA 2JWKA 4YY3K 1BCOA 4DUYK 2X6SA 4FLUA 5BN9A 3C0BA 1OVYA 4KBOA 4BG9A 3UIQA 1WAJA 4CK2A 4IEIA 1TVRA 2DFHA 4FOEA 4CEOA 4C8KA 4LH4A 1NGAA 1VHXA 4I6MA 4CZHA 4FJNA 3TANA 4CGHA 4PKIA 3E9PA 3G4SN 1VSDA 5J2MA 1W7AA 1Z6RA 2P9SB 4XEIA 4F2RA 3KD5E 5JVHL 1J5OA 3CCLN 3RSEB 5FPEA 1QHAA 2QWLA 4J2EA 3D7EO 1QQOA 1NK6A 3VPZA 4ELUA 1VSFA 4DSJA 3C7NB 1IH7A 4H0PA 3ZEUA 1O13A 2IAJA 2YHWA 5LMNK 5AQSA 4PWDA 4RW8A 3E9LA 2OTLN 4F9OA 4EAHD 2QI2A 4BRKA 1NKCA 2OYQA 3LWMA 3ID6A 5EOYA 4DR5K 3B8AX 3ZT3A 4CERA 2A3ZA 3OBYA 3O8MA 5ELZA 1E4GT 4ILGB 4O0IA 3KLHA 4DQPA 1HQEA 4LFCK 3Q7BA 4FK4A 4CW7B 3NCIA 3HOSA 3L2QA 3OYMA 2IDOA 2ZGYA 4CBUA 1BHLA 1BOTO 3O1BA 1S1TA 3HI0A 3KTQA 3BDPA 4KHWA 3D6RA 3SLCA 1S9GA 1NGEA 3T1YK 2WONA 2VG5A 1EX4A 3F9MA 1RBRA 1SS6A 1VSHA 4JI7K 4PL8A 1ASUA 3LDLA 1U48A 4WCEL 2UU9K 3KLEA 2VGMA 1NBWA 1IBKK 3WQUA 1GLBG 3DRPA 4CGDA 2VGNA 5C15A 3DMJA 3FZFA 3HOTA 3HM8A 3LP3A 1ASVA 3O9UA 4W5RA 3CPWM 1WBDA 4FJ7A 4A2AA 3K57A 3O9SA 4KHPK 4E1NA 1QVFM 2P9KB 3K2PA 1VQ8N 4ILHA 4EP5A 2YNIA 3AVLA 2GEMA 2NRXA 3ALYA 4CHNA 5TKWA 2DPNA 3O5BA 4BVOA 3CC7N 2BTFA 4FLZA 3MECA 3QERA 1X9WA 3RMCA 1NJZA 3KK2A 4BDPA 2F8TA 4DR1K 4JYAK 4ISGA 5AQRA 4OGCA 3RMDA 4DWIA 2FSNA 1XI1A 3JXUA 3SBGA 2XRIA 2RHKA 1J54A 4CJ7A 3CFRA 2KHOA 1RT1A 3LP0A 4GV9A 5EXWA 1U04A 1YXQA 1K8KA 3OS1A 5AQZA 4BGBA 1SL2A 1EWQA 4DR2K 4XIUA 1BI4B 2QXFA 1J6ZA 1CZBA 4WQ4C 1D9FA 4XH1A 3IAYA 3HK2A 3VQCA 2D5RA 3THXB 1L3UA 3SUQA 4BRCA 3L3VA 3MAQA 1BIUA 4CJFA 1KD1O 5HRRA 2Q97A 2OPQA 1TYQB 3G25A 1J9AA 3P83D 2ZD1A 1X9MA 2OZSA 5BR9A 3CHWA 3AO5A 4Z0UA 4DTJA 4FZXC 3C6UA 4FLXA 3PLAA 3QICA 1NOYA 1BIZA 1XQSC 1NGGA 4CIFA 3CC2N 2E1ZA 1ZBLA 2E88A 1Q86O 4JI5K 3J80O 3VQPA 4ICLA 3IUCA 3L3UA 2PAVA 4FOIA 2QWRA 3DLRA 3ATUA 3I8DA 3O6WA 4M41A 1N36K 4IEEA 3IRXA 4W5OA 4ZHRA 1T44A 4YOVA 1S9EA 3V4IA 3DXMA 4F4KA 2WC9A 1S5JA 1S6PA 5FPDA 3KZBA 1DT9A 3PY8A 3HVTA 4B9UA 1G15A 4PL7A 1N32K 1YUWA 4H5TA 4B9QA 5KRTA 5FPNA 4QS7A 3EZWA 3QEXA 4CECA 1BUPA 4WFNL 1XC3A 3M8PA 5FRNA 1EETA 3C65A 3E66A 1QSYA 4H4OA 3CJ9A 1GLAG 3I0RA 1HNZK 1YVNA 4DTXA 4FJLA 3LAKA 1HQUA 4HTUA 2HF3A 3U6FA 1B92A 3THYA 4CJPA
chains in the Genus database with same CATH topology
4DV4K 4V19S 5A2QO 5LMNK 4DR2K 4JI6K 4B3RK 4JI4K 4X64K 4DV5K 1N34K 5BR8K 5IWAK 4X65K 3T1HK 2UUBK 4DR5K 4LF6K 4OX9K 1XNRK 4DV3K 4AQYK 2ZM6K 4DV1K 4DV0K 4LF9K 4DR4K 4B3SK 4LFCK 1J5EK 4NXMK 4CW7B 2UXCK 5FLXO 4B3MK 5LL6Z 4CVNE 4DR6K 5IT9O 4DV2K 4DR7K 4DV7K 3T1YK 4JI2K 4JI5K 4JI7K 5LMUK 3J80O 2UXBK 5AJ3K 2UU9K 1HR0K 2HHHK 4GKJK 4JI3K 3JAMO 1IBKK 4X66K 3J7YP 3J7AP 1XMOK 4GKKK 1FJGK 2UUAK 4LFBK 1N36K 2E5LK 3OTOK 4JV5K 4B3TK 1IBLK 1XMQK 1IBMK 4YY3K 4JI0K 4DUYK 2UXDK 4JI8K 2UUCK 4DV6K 4K0KK 4KHPK 2VQEK 2VQFK 4LF5K 4X62K 1N32K 4YHHK 1N33K 1HNXK 4DUZK 4LF7K 1HNWK 2F4VK 4DR1K 4JYAK 4NXNK 4LF4K 1XNQK 1HNZK 4JI1K 4DR3K 1I94K 3J81O 4LFAK 4LF8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 K;  4V19 S;  5A2Q O;  5LMN K;  4DR2 K;  4JI6 K;  4B3R K;  4JI4 K;  4X64 K;  4DV5 K;  1N34 K;  5BR8 K;  5IWA K;  4X65 K;  3T1H K;  2UUB K;  4DR5 K;  4LF6 K;  4OX9 K;  1XNR K;  4DV3 K;  4AQY K;  2ZM6 K;  4DV1 K;  4DV0 K;  4LF9 K;  4DR4 K;  4B3S K;  4LFC K;  1J5E K;  4NXM K;  4CW7 B;  2UXC K;  5FLX O;  4B3M K;  5LL6 Z;  4CVN E;  4DR6 K;  5IT9 O;  4DV2 K;  4DR7 K;  4DV7 K;  3T1Y K;  4JI2 K;  4JI5 K;  4JI7 K;  5LMU K;  3J80 O;  2UXB K;  5AJ3 K;  2UU9 K;  1HR0 K;  2HHH K;  4GKJ K;  4JI3 K;  3JAM O;  1IBK K;  4X66 K;  3J7Y P;  3J7A P;  1XMO K;  4GKK K;  1FJG K;  2UUA K;  4LFB K;  1N36 K;  2E5L K;  3OTO K;  4JV5 K;  4B3T K;  1IBL K;  1XMQ K;  1IBM K;  4YY3 K;  4JI0 K;  4DUY K;  2UXD K;  4JI8 K;  2UUC K;  4DV6 K;  4K0K K;  4KHP K;  2VQE K;  2VQF K;  4LF5 K;  4X62 K;  1N32 K;  4YHH K;  1N33 K;  1HNX K;  4DUZ K;  4LF7 K;  1HNW K;  2F4V K;  4DR1 K;  4JYA K;  4NXN K;  4LF4 K;  1XNQ K;  1HNZ K;  4JI1 K;  4DR3 K;  1I94 K;  3J81 O;  4LFA K;  4LF8 K; 
#chains in the Genus database with same CATH topology
 3VGM A;  4WF9 L;  2VWJ A;  2OA8 A;  1IKV A;  1X3M A;  1W0H A;  1IG9 A;  5AQN A;  4JS4 A;  4FL9 A;  3RVC A;  4FVU A;  4JAX A;  3NF6 A;  3DLH A;  1E4F T;  1EWR A;  5BRF A;  2E20 A;  3HST B;  4BAC A;  3ZYY X;  3L4Q A;  3VEN A;  3QEI A;  3F2K A;  4E3S A;  1C1B A;  4YOW A;  4Y0W A;  3U4L A;  4OO1 J;  1VAZ A;  3LAL A;  5DMR A;  2NRZ A;  4A2B A;  1VQM N;  5AQG A;  4B9M A;  3DRS A;  1VQL N;  4JNE A;  4DKW A;  1NG9 A;  1NK8 A;  4CZF A;  4E7I A;  4H0T B;  2Q36 A;  5JMV A;  1VQP N;  1YJW N;  4PY5 A;  1HNV A;  3WNE A;  3NDK A;  1SUQ A;  4BRE A;  4DV2 K;  2P5O A;  3SMS A;  1YT3 A;  4KH5 A;  2GTD A;  2FXU A;  3MEG A;  5CE3 A;  4EHT A;  4E7J A;  1VQ7 N;  3OYI A;  5AFU A;  4GKJ K;  1HYZ A;  4DTM A;  4KO0 A;  3CER A;  4BR7 A;  2HBK A;  3B6P A;  3FZK A;  4MLH A;  1D8Y A;  3HBT A;  2E6M A;  5HRN A;  1RIL A;  4DFM A;  1NK9 A;  2FSJ A;  3VTI A;  3KJV A;  4O0J A;  1IBM K;  2D0A A;  3WXK A;  2W40 A;  3KKS A;  4B1U B;  4DU4 A;  3D2E B;  5AQI A;  3LPT A;  4DSF A;  3DWL A;  4FWQ A;  4FWN A;  4DF8 A;  4JEP A;  1N33 K;  1HNX K;  4H0Y B;  2VYP A;  4JHD B;  3I8B A;  2I7N A;  1M90 O;  5BRD A;  5AR0 A;  1VSI A;  3WXI A;  4A61 A;  3CFO A;  4B1Y B;  2DTU A;  1BG3 A;  1HYV A;  1JL2 A;  5F1X A;  3EZ5 A;  3SPY A;  1YTA A;  4FPB A;  4AH9 A;  5I3U A;  4JN4 A;  1IG8 A;  1VRU A;  3IFR A;  3L2R A;  1JXB A;  2YNF A;  2A1S A;  4UY8 O;  5DM6 L;  3KLG A;  1JL1 A;  5AQX A;  3KK3 A;  4FW2 A;  4CZI A;  3AVC A;  1Z05 A;  3EKU A;  2UUB K;  2YHA A;  1NMD A;  3HZ6 A;  4WFB L;  3NGY A;  3EYZ A;  3K5M A;  4DV1 K;  2V7Z A;  3IG1 A;  4ZTF A;  3MXI A;  2NZT A;  3TSQ A;  1Q18 A;  3EE8 A;  2JWL A;  3RRG A;  3KK7 A;  2A40 A;  2VG7 A;  2ZWH A;  4WE1 A;  5AQU A;  2BH1 A;  2E2N A;  2VWK A;  2FBY A;  5CYQ A;  4FLT A;  1UA0 A;  4YOT A;  2KKZ A;  4O8K A;  1GOA A;  4B1X B;  4JKB A;  1C0F A;  4WYB A;  5IT9 O;  4O5B A;  3ZET A;  2GEL A;  2R7Y A;  2KFN A;  4CF9 A;  4M3Y A;  3VET A;  3TAP A;  3CF5 L;  1HMV A;  1VQ5 N;  3SJH A;  3MXM A;  4JI3 K;  4DU3 A;  3I55 N;  3O9R A;  4KHQ A;  4DG1 A;  4BRP A;  4FWK A;  4KB0 A;  1X1P A;  3JS6 A;  1XMQ K;  4BE2 A;  5JLF A;  1MA9 B;  4BRI A;  1DEJ A;  1NGC A;  3GE1 A;  1NK5 A;  1QTM A;  3U3Y A;  4BRN A;  3L8B A;  3RMA A;  3FZH A;  3AAR A;  3VTH A;  3U9D A;  4E0D A;  4H5W A;  1DGK N;  1TUY A;  3QIN A;  2KFZ A;  2HHV A;  1KVA A;  5JVG L;  2F4V K;  4E89 A;  2D1K A;  4CD3 A;  3H3O B;  2HMP A;  4NLC A;  3VF2 A;  1XNQ K;  3NF9 A;  5JS1 A;  3QBW A;  1RTI A;  1WB9 A;  4LF8 K;  3U8X A;  4OPH A;  1VSJ A;  2P1J A;  5E84 A;  5ADX H;  2OPR A;  5FDL A;  4IDH A;  2WTU A;  2HBM A;  1VQ9 N;  4JD2 A;  1RTD A;  2GUP A;  1TL1 A;  4IBN A;  5BR8 K;  3OYK A;  1FW6 A;  4BRM A;  5F0X A;  2P9P A;  4OVL A;  3QNO A;  3UKR A;  4L8R B;  4FWO A;  2ZF5 O;  3MCA B;  4CJW A;  2D0P A;  4DR4 K;  3CJB A;  3HPO A;  4QS9 A;  1FKP A;  4DQQ A;  3QEV A;  1VQ4 N;  1NJY A;  1RT2 A;  1RNH A;  1X9J A;  3L2W A;  3UKU A;  2E6L A;  5LL6 Z;  4CVN E;  4LSL A;  4XH5 A;  3KLI A;  1K73 O;  2O8C A;  4IOX A;  3VEZ A;  3HRG A;  5GAH P;  4IO9 L;  4JKG B;  5GAG P;  3S41 A;  1ZBH A;  3CM5 A;  1BCM A;  2W41 A;  4FWP A;  4DCH A;  1BQM A;  2A42 A;  4ISF A;  3TAB A;  1QQN A;  4H0O A;  4M3U A;  3CMA N;  4DTU A;  4KH6 A;  4HCB A;  3E1Y A;  4F3O A;  4BRQ A;  4BRF A;  2NRT A;  4UQG A;  1S72 N;  1KQS M;  5KRS A;  4Z4C A;  3VOV A;  4DV6 K;  1JLE A;  2HHS A;  2QTD A;  4HUG A;  4WQ4 A;  4KAZ A;  1IJJ A;  3AVM A;  4DFJ A;  2XY6 A;  1YIJ N;  4K43 A;  5BPL A;  4OPK A;  2AJQ A;  2AP1 A;  1NJW A;  3M8R A;  2FC0 A;  3V81 A;  3BUZ B;  3H6E A;  1B9F A;  1W2B M;  3NGZ A;  3K9J A;  4CJS A;  1VQN N;  3U9Z A;  1C0U A;  1JXE A;  1VSL A;  3CXC M;  1L3V A;  5K14 A;  5CR4 A;  1CXQ A;  4AM7 A;  4LF4 K;  3HPH A;  2QWN A;  4B9S A;  3O4Q A;  2O8E B;  4AHT A;  1VSK A;  3ID8 A;  4JKD A;  3AA3 A;  5C42 A;  3FR0 A;  4Z4G A;  3DOL A;  3KK1 A;  3S3M A;  2O8F A;  3T1H K;  5KPZ A;  3MX5 A;  2CGK A;  4F3T A;  4CJR A;  3K5L A;  4CHZ A;  1BGX T;  1F21 A;  4E1J A;  3LP2 A;  1LAV A;  4MO4 A;  3G6E N;  3DXK A;  1ESV A;  2NRR A;  3A5M C;  4JKH A;  4CK1 A;  2O8B B;  1I39 A;  2CGJ A;  4ILJ A;  1GLD G;  3PO4 A;  1R59 O;  3IMX A;  3L0Q A;  4Z94 A;  3SI6 A;  5FLX O;  4B3M K;  4M3R A;  3THW B;  3TAF A;  3TSU A;  4RG8 A;  3GDQ A;  1TK5 A;  3VF6 A;  2BAN A;  2EWS A;  3AAQ A;  2RE2 A;  1HNI A;  4A57 A;  1SAZ A;  2A5X A;  3VF4 A;  3V1R A;  2QA4 N;  3QIO A;  3O3G A;  1OH5 A;  3T7Z A;  3LM9 A;  4JRQ A;  2F9T A;  4HHT A;  3TWH A;  1HR0 K;  1SQK A;  1NK4 A;  1LWC A;  3MEE A;  3SQ0 A;  2GX9 A;  4FM1 A;  1WSF A;  4KB1 A;  2YKM A;  3CCV N;  4GY2 B;  1KAY A;  3R6M A;  1U2V B;  1S1W A;  4K42 A;  4C8O A;  3AA5 X;  2VQE K;  3VQ7 A;  3CCR N;  2ZGZ A;  4WFA L;  1U47 A;  1S3X A;  3AVH A;  2VQF K;  3VEV A;  3OYD A;  3SMP A;  3DLL L;  3OS2 A;  3LPU A;  2XY5 A;  4DTN A;  4RW4 A;  2Q2R A;  1HKB A;  3P4I A;  1NGB A;  1ZBF A;  3DLG A;  3WEE A;  3VQB A;  1LOT B;  2Z1G A;  5E26 A;  3SK3 A;  3DAW A;  4B8A B;  4CHY A;  3K0S A;  3EEQ A;  2ZJQ L;  4C23 A;  2YHX A;  3I33 A;  2UYT A;  4CJK A;  2XY8 A;  3ITH A;  2QW9 A;  4C8M A;  3ZLJ A;  4IFY A;  5SZT A;  4DV4 K;  4FJJ A;  2P9L A;  1OVQ A;  1ZBU A;  4ZTJ A;  4JI4 K;  4HUE A;  3VA3 A;  3DOK A;  3AGR A;  5SWM A;  5AZJ A;  4M3Z A;  3CQ8 A;  4IOA L;  2A1R A;  2LSN A;  3F9K A;  3TTD A;  3PSI A;  3ENH A;  4IKF A;  5M1F A;  3QFP A;  2Y1I A;  2Q0R A;  2PYJ A;  4PUO A;  3T3F A;  3OBW A;  4CGI A;  3PIP L;  2YHY A;  1HPM A;  1JLC A;  3ULE B;  3M3Z A;  3K58 A;  3VA0 A;  3WQT A;  4ELT A;  4W5N A;  1N8R O;  4CJE A;  1RDW X;  2Q1N A;  4K41 A;  5H1S Q;  1RTJ A;  3QNN A;  4CJQ A;  3TAR A;  3CFP A;  3F73 A;  3VEX A;  3VQ6 A;  4DHY A;  4M45 A;  4CJV A;  4KHU A;  1QZ6 A;  1BWF O;  4QCL A;  2P9S A;  1T6D A;  3RR7 A;  1KAX A;  5M1Q A;  4GKK K;  1FJG K;  1K6Y A;  3NF8 A;  1ASW A;  4QOZ B;  1RT6 A;  4B3T K;  1IBL K;  3NHG A;  1BL3 A;  2PYL A;  1R0A A;  3D2F B;  3C7N A;  3CET A;  4CFC A;  3DLE A;  3LWL A;  4J2D A;  3T69 A;  5F2R A;  4Z4H A;  1GLE G;  2F8S A;  3QET A;  2B6A A;  3VQD A;  5CY4 A;  2DFE A;  2CH6 A;  4N56 A;  4FLV A;  1N5Y A;  3MX2 A;  1RBS A;  4BRL A;  4L3Q A;  4HCC A;  3V9X A;  3LL3 A;  4BDY A;  2IVO A;  4O44 A;  1S1X A;  3HJF A;  1TGO A;  3ULD A;  4CD1 A;  3ZSY A;  3DI6 A;  1HUX A;  1OH6 A;  1WSJ A;  3CJ1 A;  2P9N B;  1NU0 A;  1NMN A;  3KKR A;  4MDA A;  4BC5 A;  4ISE A;  3FLC O;  2EX3 A;  5AQK A;  5IWA K;  3CYM A;  5AQM A;  1YAG A;  3NH2 A;  3OYN A;  4OKK A;  1ATN A;  1XNR K;  3HL8 A;  1YJ9 N;  3VEY A;  4BRD A;  3QO9 A;  1NKE A;  1K9M O;  2ZJR L;  4FSV A;  5HLF A;  1TL3 A;  2OPS A;  1J5E K;  3NE6 A;  4NXM K;  3GL1 A;  2HHT A;  3R9P A;  4LD0 A;  5AQH A;  1T8E A;  4O55 A;  4OKJ A;  2OCE A;  1MWM A;  2JGU A;  2PY5 A;  2QWQ A;  1WSI A;  1SKS A;  4OLA A;  1TKT A;  4RCH A;  4CEE A;  1JCE A;  2W6L A;  2YX6 A;  2D0B A;  1NK7 A;  3HYF A;  3WUH A;  2P9K A;  3TAQ A;  5J1E A;  1CLQ A;  3PIO L;  4I9Q A;  4FCY A;  3AA2 A;  1WOQ A;  3EN9 A;  3TTF A;  2DFF A;  1TKZ A;  5LMU K;  3EL2 A;  2RPI A;  4HVJ A;  2KLA A;  4B9L A;  3VMF B;  4JKC A;  1YIT N;  3TSP A;  3TTC A;  1XMO K;  2QWO A;  1S6Q A;  1EQY A;  3AVJ A;  5BPM A;  2E2O A;  4JV5 K;  4AHS A;  3L2V A;  4BWJ A;  2UXD K;  4HUF A;  1S22 A;  2ZJP L;  4K0K K;  3HVR A;  1LWF A;  4RW9 A;  3A5O C;  2P9U B;  3TR8 A;  2YKN A;  3H46 O;  3SZ2 A;  3C94 A;  3C95 A;  4CEF A;  3O3F A;  4X62 K;  1VQO N;  4DTR A;  2KQ2 A;  1QQC A;  1TK8 A;  4DSK A;  3O08 A;  3OYH A;  4EFH A;  2WBN A;  1NGF A;  3A2F A;  1D4X A;  3THX A;  3SAG A;  5EVZ A;  2HBJ A;  4CFA A;  3ZX3 A;  2GBZ A;  3HPG A;  1HLU A;  1VRT A;  5D3G A;  1TYQ A;  2YV0 X;  1UA1 A;  1SZ2 A;  1QE1 A;  2O8D B;  1Q8I A;  4K8X A;  3UE5 A;  3A5N C;  4CBW A;  3ZT1 A;  4PQU A;  5LJW A;  4DS4 A;  3S3N A;  2YI1 A;  3WXM B;  3SQ2 A;  4FJH A;  4X64 K;  4H4M A;  4DQ8 A;  1TUU A;  3MDQ A;  3M8S A;  1YTU A;  3T1A A;  4QAG A;  4FJI A;  3QBX A;  3NH1 A;  4LF6 K;  2Q31 A;  3D45 A;  3I56 N;  3VQ4 A;  3UB5 A;  4CFD A;  3NGI A;  5MLC Q;  4YFU A;  3CJA A;  2GV9 A;  3IDH A;  1LWE A;  1BA0 A;  3AY9 A;  3TAE A;  4JKE A;  3LZJ A;  4BDZ A;  4HWI A;  2G8H A;  3O9T A;  4FO0 A;  4BR5 A;  3MED A;  5KQD A;  3P5J A;  2IS3 A;  3KHY A;  1P90 A;  4CF2 A;  4FXD A;  3LAN A;  2Y1J A;  1WLJ A;  2NRV A;  4CZE A;  4CHQ A;  2OTJ N;  2P9I A;  4FJ5 A;  2HHQ A;  4DV7 K;  2FF6 A;  1LCU A;  2F96 A;  4DS5 A;  4CFB A;  1BA1 A;  3GOI A;  4EP4 A;  5C2D A;  2YNG A;  5KPR A;  1RT7 A;  4BQZ A;  3O9Q A;  2HF4 A;  3OY9 A;  3SUO A;  4LH5 A;  3BZC A;  4DSE A;  2FBT A;  4JK8 A;  2XY7 A;  2VG6 A;  4BR9 A;  3KWG A;  4FJ8 A;  3G10 A;  5DM7 L;  1UOC A;  4G1Q A;  4CJL A;  2RF2 A;  5FRO A;  3NF7 A;  1YF5 L;  3QIP A;  3HSC A;  1U4B A;  4CCH A;  3TPQ A;  4LF5 K;  1TK0 A;  4C8N A;  4H5N A;  1EXQ A;  2PZS A;  2OAN A;  1YVU A;  5AZI B;  3Q7C A;  5E41 A;  2KTQ A;  3SNN A;  4OPJ A;  4IXC A;  3FFK B;  4KTZ A;  3EO3 A;  1DTQ A;  1QSL A;  5EX5 A;  4MDB A;  3W3D A;  4PKH A;  5M1N A;  3MN7 A;  4FZZ A;  4B9V A;  3VQ5 A;  5CZ1 A;  3ENB A;  1SV5 A;  4YNQ A;  3PX0 A;  5J2P A;  2IGI A;  4J2A A;  3H1Q A;  3OS0 A;  4DFK A;  4B9T A;  4I6M B;  4FZY A;  3SV3 A;  3TU5 A;  4GMJ B;  4X65 K;  3LZI A;  3AVF A;  5I42 A;  3M8Q A;  1T05 A;  4AQY K;  1NKB A;  1OKJ A;  1TKD A;  2YJF A;  4I2Q A;  2FSK A;  4JRP A;  4OPA A;  3OYF A;  4DLG A;  2P5G A;  3ZEU B;  4CI6 A;  3SBT A;  5AQL A;  5HOO A;  3CCU N;  4DU1 A;  1N6Q A;  3E9O A;  1KFS A;  1ZBI A;  3LDO A;  4R79 A;  1NM1 A;  3A0I X;  2HMI A;  4KV8 A;  3VES A;  4DR6 K;  3CCS N;  4YOR A;  3V9U A;  4KKO A;  3D2E A;  3RR8 A;  2JLE A;  1RFQ A;  4PKG A;  2HHH K;  1VSE A;  1Q7Y O;  4BG8 A;  4X66 K;  3J7A P;  5CHI A;  4JHD A;  1YHQ N;  2I5J A;  2AA4 A;  4OJR A;  3S9H A;  1L3T A;  4N41 A;  5ADX A;  2WOM A;  3HXM A;  1GOC A;  2V51 B;  3WNH A;  3SAF A;  2HHX A;  5JIC A;  4OLB A;  3OA9 A;  3IKM A;  1RDD A;  4W5T A;  3SUN A;  5BPN A;  3OYA A;  3DJC A;  1GLJ O;  4AF1 A;  3ZX2 A;  2J4R A;  4B1Z A;  3VEO A;  1RDC A;  5GAE P;  3T19 A;  3CCM N;  5HRO A;  1LAW A;  4IFV A;  3NVK A;  4AHV A;  3EY1 A;  2B4J A;  4NXN K;  4KHY A;  1QS4 A;  1X3N A;  3P38 A;  4JLH A;  3GG4 A;  1HYS A;  3M1F A;  4FK2 A;  1OH7 A;  1NLV A;  4CJ3 A;  2QKB A;  1P8Z A;  4KRF A;  2HVH A;  2IC3 A;  3FZM A;  3D0P A;  1QZ5 A;  4LY7 A;  1FXX A;  3HO1 A;  3NBP A;  4Y1C A;  4EZ6 A;  2F7T A;  2E8A A;  3CPE A;  4OX9 K;  2YNH A;  3ASM A;  5AZJ B;  4CJT A;  3DM2 A;  3EE9 A;  2D4W A;  3AO4 A;  2HW3 A;  1RBT A;  1HX1 A;  3P31 A;  1NWK A;  4CGJ A;  3NMU A;  2ETJ A;  3R3L A;  1G99 A;  3RWU A;  2E2Q A;  4IG0 A;  4MLE A;  4Q0B A;  1K8K B;  4FVM A;  2BUP A;  3R8E A;  3DLK A;  1BO5 O;  2FF3 B;  2E4L A;  3MCP A;  4O4G A;  4CZL A;  5KGX A;  4FJX A;  1BU6 O;  1RBV A;  1RGI A;  4DR7 K;  4N5S A;  3KLF A;  4GNI A;  3QML A;  2HB5 A;  2ITM A;  4E7H A;  1T6C A;  4KHS A;  4DTP A;  2HBL A;  4KHN A;  3PX6 A;  4OKE A;  4QS8 A;  4BGA A;  2ZE2 A;  4RTF D;  5KI6 A;  1CXU A;  3KIO A;  2OZM A;  4CEB A;  3BEX A;  3AVI A;  2CGL A;  3AVG A;  3PV8 A;  4JK7 A;  5HRS A;  2FBV A;  1C1C A;  5LJV A;  3J8A A;  3OYC A;  3BF1 A;  3ZSX A;  4FYD A;  4JI8 K;  3VQ9 A;  1QSS A;  1Q82 O;  4C1N I;  1RT3 A;  3HM9 A;  4FJG A;  4NYN A;  4BC2 A;  4FJK A;  2A41 A;  2CH5 A;  1ATS A;  4CES A;  4PHT X;  3OJS A;  4B8C A;  2YCH A;  4KI4 A;  4H5V A;  4GV6 A;  1CZA N;  2W42 A;  1JJ2 M;  2YHB A;  2OPP A;  1B9D A;  2HVI A;  4DUZ K;  1HNW K;  4FK0 A;  3G0Z A;  1QVG M;  2G8W A;  3CD6 N;  4JI1 K;  4IZ9 A;  3FGU A;  2E2P A;  3DXM B;  4M3X A;  3QDK A;  3OYB A;  4LFA K;  4Z4F A;  3VQ8 A;  4NLB A;  3CJC A;  4KH4 A;  3PSF A;  2QXL A;  4A62 A;  2KZZ A;  3B6O A;  4FWL A;  5BRH A;  1M1K O;  5A2Q O;  4E19 A;  1KRP A;  1MWK A;  1KFD A;  4BE0 A;  1NJX A;  1VSM A;  4YOU A;  1NNE A;  1KLN A;  3H08 A;  3ZSW A;  1NJI O;  1E3M A;  4JKG A;  3OW2 M;  3OVN A;  4CHP A;  2KW4 A;  3ATV A;  2DY4 A;  1MU2 A;  4NCA A;  1XC9 A;  4E7L A;  1WBB A;  4M63 C;  4DLE A;  4EZ9 A;  3TAG A;  3AVN A;  3AVB A;  3QLH A;  2HNY A;  1LV5 A;  1V4T A;  3THY B;  2X6N A;  4CEA A;  5HBM A;  4K25 A;  4AHR A;  2RKI A;  2ITG A;  3AVK A;  1K8A O;  2F9W A;  4BR2 A;  3A5L C;  1Z26 A;  4GW6 A;  5M1P A;  3WNF A;  5AQT A;  3THV A;  3KVG A;  3VQA A;  4FM2 A;  3TAM A;  3V6D A;  3MMV A;  1VQK N;  1NOZ A;  4MQ3 A;  1ZC6 A;  1TV6 A;  4JI2 K;  4CZJ A;  4BWM A;  1IKY A;  2QK9 A;  2QKK A;  4U67 L;  2ASM A;  1W9H A;  4MFB A;  2BE2 A;  3OYJ A;  4A5B A;  4C1N K;  3QEP A;  2D0C A;  4ELV A;  1ATR A;  2I7P A;  1KCF A;  2G8F A;  3L4I A;  3A8Y A;  4JKF A;  1ZBS A;  3AV9 A;  2O8E A;  3BGR A;  5AQJ A;  1IKX A;  1HKC A;  1RT5 A;  4N76 A;  1LW2 A;  2NRW A;  1BDG A;  1L5U A;  4FJ9 A;  4CF8 A;  3V1Q A;  3HTV A;  1LW0 A;  1KC8 O;  4YHH K;  2X78 A;  1JLA A;  1YI2 N;  1RDA A;  4HTL A;  4AHU A;  3RSE A;  3ZSQ A;  4CEQ A;  2QEX N;  3JYT A;  4DQR A;  3RMB A;  3AGK A;  4I7F A;  5I9E B;  4O5F A;  2H3G X;  4BR0 A;  3ISN C;  1IV0 A;  2O8B A;  1WSG A;  4NYF A;  2HNZ A;  3IS9 A;  1WAF A;  1NK0 A;  3LDP A;  3MN6 A;  5TKY A;  3VGL A;  5GAD P;  2GUI A;  3O4W A;  3M6G A;  4O8U A;  4PA1 A;  4CZK A;  3THW A;  5BN8 A;  1CZ9 A;  3C6A A;  3CIP A;  4BE1 A;  4AHC A;  3QFU A;  1QQM A;  1N34 K;  1WN7 A;  4CBX A;  1KVC A;  4FWS A;  5AQV A;  1Q9Y A;  5AQO A;  1C1A A;  1JLF A;  3SAH A;  3NAE A;  1L3S A;  5AQY A;  4GVM A;  2BGG A;  3CME N;  4B3S K;  2ASO A;  3SQ4 A;  3WNG A;  5HL7 L;  3ENO A;  1RTH A;  5JS2 A;  2P51 A;  1JCG A;  4TSX A;  4IJN A;  3NH0 A;  5FRM A;  1KTQ A;  2ATQ A;  4J2B A;  5BRE A;  1U2V A;  2HOE A;  2XO7 A;  1O1W A;  3QES A;  4W5Q A;  4BRH A;  5JLH A;  2P9I B;  4DSL A;  4JS5 A;  5LY3 A;  4YOY A;  1Q81 O;  3V9Z A;  1T7P A;  3CCE N;  4IO8 A;  4RW6 A;  3FZL A;  1T3V A;  3JAM O;  3J7Y P;  3VEW A;  4LSN A;  3NFA A;  1HRH A;  3MXJ A;  5HP1 A;  3PO5 A;  4I2P A;  3SCX A;  1DLO A;  5AQW A;  2NUB A;  2BDP A;  1TAQ A;  3W0L A;  2UUC K;  4WQ5 A;  4K8Z A;  3ZET B;  1JKH A;  4CZM A;  3DRR A;  3ZX0 A;  1Y97 A;  5GIP A;  3K5N A;  4M3W A;  4DTS A;  1EO1 A;  3N4P A;  1JCF A;  4CED A;  3C6H A;  3CJ7 A;  4LF7 K;  4J8F A;  3F5T A;  3VER A;  3RRH A;  1HPZ A;  1TKX A;  4BQL A;  1S1U A;  3CC4 N;  4BRG A;  5KGW A;  1J53 A;  3NVM A;  5AFU H;  2GWK A;  3J81 O;  3LDQ A;  4R5P A;  4G9Z A;  3ULE A;  1D5A A;  2YJE A;  4V19 S;  2QM1 A;  1UWB A;  3AO2 A;  3S3O A;  2WFB A;  1VK0 A;  4A5A A;  4EHU A;  1BI4 A;  3AVA A;  4CGF A;  2RN2 A;  3VN5 A;  1U49 A;  3ZT2 A;  2IVP A;  1Q9X A;  4Z4E A;  4KPY A;  4DQS A;  3E01 A;  4B1W B;  2QWP A;  2FLO A;  1XWL A;  2IVN A;  1I3A A;  4LF9 K;  4BC4 A;  3HP6 A;  5AQP A;  1NGI A;  4JK9 A;  4KTW A;  4KRE A;  1RCH A;  4CJU A;  3V9S A;  1HJR A;  3WXJ A;  2UXC K;  3CQX A;  1FK9 A;  3AO1 A;  3U3G A;  3J7Z O;  1WSE A;  4B3O A;  4CF1 A;  2HHU A;  4H5R A;  3P1G A;  5C10 A;  4KFB A;  3CI5 A;  3MWT A;  3V1O A;  5C12 A;  5C25 A;  2HND A;  4BRO A;  4JD2 B;  3MK6 A;  2ASP A;  3D2F A;  4RWT A;  1SL0 A;  4F8R A;  4CHO A;  4CF0 A;  2P9P B;  4MO5 A;  4GVE A;  5KTQ A;  3JSM A;  3UKR B;  4GV3 A;  3O1W A;  3DYA A;  3ZT4 A;  1UAX A;  1KLM A;  4IDK A;  4M7Y A;  4DFP A;  4A59 A;  2V52 B;  1C0M A;  4CZG A;  5GIN A;  2UUA K;  2Q3S A;  4CEZ A;  1C0T A;  2NNW A;  3H45 C;  4LFB K;  1V4S A;  1DTT A;  3UKU B;  5HRP A;  3SYZ A;  3FFI A;  4FLW A;  2O8C B;  4AM6 A;  3ZCM A;  2P9N A;  3ZSZ A;  1FKO A;  4DF4 A;  2HST A;  3EKS A;  3SPZ A;  3QB0 A;  4NCB A;  1XUP O;  3CQY A;  3TI0 A;  4YDU A;  5J2N A;  4B1V A;  3BF3 A;  1BQN A;  4IJA A;  2G8K A;  2E1Y A;  1IKW A;  3VQE A;  3MN5 A;  1XHZ A;  1WUA A;  4H0V B;  1GLF O;  5FPM A;  2QWM A;  2Q0U A;  1IO2 A;  4XH4 A;  1GLL O;  1S1V A;  1JLG A;  1SL1 A;  3PX4 A;  3K9K A;  1NGD A;  4BVP A;  5J2Q A;  3VGK A;  1C6V A;  1ILY A;  1H1V A;  4KTQ A;  5M1K A;  2G8U A;  1EP4 A;  1RT4 A;  4IG3 A;  3N4Q A;  3ZSO A;  2IOC A;  4LC9 B;  1REV A;  1NGH A;  4RW7 A;  1KVB A;  4JI6 K;  4FPA A;  1U6Z A;  3HP9 A;  2O4I A;  2V7Y A;  3OHR A;  5EU7 A;  2B5J A;  4DMN A;  3CCJ N;  4F2S A;  3KD1 E;  4BR4 A;  4BRA A;  4DB3 A;  5C0Y A;  3KWI A;  4KI6 A;  1A5V A;  3ZT0 A;  3WXL A;  2NLX A;  2ZM6 K;  3QEW A;  3AO3 A;  4DV0 K;  3G71 N;  5CZ2 A;  4CJ5 A;  4FLY A;  1RDB A;  4I9L A;  4C8L A;  4AIL C;  2XHB A;  4Y1D A;  1YJN N;  3RTV A;  2IIR A;  3P39 A;  5C24 A;  1HJO A;  5AQF A;  4IOC L;  3L6Q A;  4CIG A;  1NGJ A;  4WQ5 C;  1TAU A;  4Q5V A;  1WSH A;  2O8F B;  3H3N O;  1RBU A;  1KAZ A;  2P9U A;  2Z1J A;  3O3H A;  4JKA A;  3AAP A;  3DLB A;  3R1X A;  4H03 B;  4BY9 C;  5M1O A;  4M3T A;  2UXB K;  1ZXO A;  3DXK B;  1ITG A;  4CGG A;  5AJ3 K;  2VCP A;  4IWV A;  3LAM A;  3MWP A;  3CCQ N;  1OH8 A;  3L2U A;  4DQI A;  1JLQ A;  1A5X A;  3OTO K;  4FW1 A;  4IFE A;  2G8I A;  3ZSR A;  4FWM A;  2GWJ A;  5KPT A;  4JI0 K;  5EY4 A;  3LM2 A;  5AQQ A;  1W97 L;  2O8D A;  1X9S A;  4BC3 A;  1A5W A;  1GOB A;  2FBX A;  3BP8 A;  4CE9 A;  2O4G A;  3MN9 A;  4E7K A;  3M5R A;  3SV4 A;  4U7B A;  3WT0 A;  3SUP A;  2EHG A;  4CJ4 A;  3VQQ A;  3CG7 A;  4DR3 K;  5DK5 A;  4FJM A;  1I94 K;  5CYM A;  3OJU A;  3O4N A;  4YOX A;  1RDU A;  2Z1H A;  3K5O A;  3GBT A;  4H0X B;  3LP1 A;  1C0G A;  3OYL A;  4DTO A;  1VQ6 N;  4ID5 A;  4ID1 A;  3LDS A;  2NRH A;  4B3R K;  2ZQB A;  4DV5 K;  1MDU B;  1ZYQ A;  4M7X A;  2HHW A;  2PBD A;  3WEE B;  4DSI A;  1QHT A;  4CK3 A;  3C6T A;  3OYE A;  2X74 A;  1KXP A;  3OYG A;  4DV3 K;  3SJJ A;  4H8K A;  4OGE A;  3BZK A;  4E1M A;  2WUS A;  2KZM A;  1BIS A;  4NB4 A;  3CM6 A;  2D0O A;  3BY5 A;  3K59 A;  2W6K A;  3HT3 A;  4Z4I A;  1DKG D;  1WNS A;  1Z25 A;  3H1V X;  1SKR A;  1D9D A;  4FM0 A;  2P9L B;  2VWB A;  3LDN A;  5KQ8 A;  3PUF A;  4EIA A;  3ZSV A;  3O80 A;  1T03 A;  3SQ1 A;  2Z1I A;  4FWR A;  4B08 A;  5B8H A;  4B9N A;  1U45 A;  4CIE A;  3I0S A;  3V9W A;  4YDU C;  4NO7 A;  1GLC G;  4NCG A;  1EKE A;  1JLB A;  5C2F A;  1HKG A;  5T7B A;  3AA4 A;  5AZI A;  1KSP A;  2G8V A;  1SKW A;  2A6A A;  5GIO A;  1Y64 A;  4M42 A;  3FE1 A;  4N47 A;  1XHX A;  2E5L K;  2PFU A;  2JWK A;  4YY3 K;  1BCO A;  4DUY K;  2X6S A;  4FLU A;  5BN9 A;  3C0B A;  1OVY A;  4KBO A;  4BG9 A;  3UIQ A;  1WAJ A;  4CK2 A;  4IEI A;  1TVR A;  2DFH A;  4FOE A;  4CEO A;  4C8K A;  4LH4 A;  1NGA A;  1VHX A;  4I6M A;  4CZH A;  4FJN A;  3TAN A;  4CGH A;  4PKI A;  3E9P A;  3G4S N;  1VSD A;  5J2M A;  1W7A A;  1Z6R A;  2P9S B;  4XEI A;  4F2R A;  3KD5 E;  5JVH L;  1J5O A;  3CCL N;  3RSE B;  5FPE A;  1QHA A;  2QWL A;  4J2E A;  3D7E O;  1QQO A;  1NK6 A;  3VPZ A;  4ELU A;  1VSF A;  4DSJ A;  3C7N B;  1IH7 A;  4H0P A;  3ZEU A;  1O13 A;  2IAJ A;  2YHW A;  5LMN K;  5AQS A;  4PWD A;  4RW8 A;  3E9L A;  2OTL N;  4F9O A;  4EAH D;  2QI2 A;  4BRK A;  1NKC A;  2OYQ A;  3LWM A;  3ID6 A;  5EOY A;  4DR5 K;  3B8A X;  3ZT3 A;  4CER A;  2A3Z A;  3OBY A;  3O8M A;  5ELZ A;  1E4G T;  4ILG B;  4O0I A;  3KLH A;  4DQP A;  1HQE A;  4LFC K;  3Q7B A;  4FK4 A;  4CW7 B;  3NCI A;  3HOS A;  3L2Q A;  3OYM A;  2IDO A;  2ZGY A;  4CBU A;  1BHL A;  1BOT O;  3O1B A;  1S1T A;  3HI0 A;  3KTQ A;  3BDP A;  4KHW A;  3D6R A;  3SLC A;  1S9G A;  1NGE A;  3T1Y K;  2WON A;  2VG5 A;  1EX4 A;  3F9M A;  1RBR A;  1SS6 A;  1VSH A;  4JI7 K;  4PL8 A;  1ASU A;  3LDL A;  1U48 A;  4WCE L;  2UU9 K;  3KLE A;  2VGM A;  1NBW A;  1IBK K;  3WQU A;  1GLB G;  3DRP A;  4CGD A;  2VGN A;  5C15 A;  3DMJ A;  3FZF A;  3HOT A;  3HM8 A;  3LP3 A;  1ASV A;  3O9U A;  4W5R A;  3CPW M;  1WBD A;  4FJ7 A;  4A2A A;  3K57 A;  3O9S A;  4KHP K;  4E1N A;  1QVF M;  2P9K B;  3K2P A;  1VQ8 N;  4ILH A;  4EP5 A;  2YNI A;  3AVL A;  2GEM A;  2NRX A;  3ALY A;  4CHN A;  5TKW A;  2DPN A;  3O5B A;  4BVO A;  3CC7 N;  2BTF A;  4FLZ A;  3MEC A;  3QER A;  1X9W A;  3RMC A;  1NJZ A;  3KK2 A;  4BDP A;  2F8T A;  4DR1 K;  4JYA K;  4ISG A;  5AQR A;  4OGC A;  3RMD A;  4DWI A;  2FSN A;  1XI1 A;  3JXU A;  3SBG A;  2XRI A;  2RHK A;  1J54 A;  4CJ7 A;  3CFR A;  2KHO A;  1RT1 A;  3LP0 A;  4GV9 A;  5EXW A;  1U04 A;  1YXQ A;  1K8K A;  3OS1 A;  5AQZ A;  4BGB A;  1SL2 A;  1EWQ A;  4DR2 K;  4XIU A;  1BI4 B;  2QXF A;  1J6Z A;  1CZB A;  4WQ4 C;  1D9F A;  4XH1 A;  3IAY A;  3HK2 A;  3VQC A;  2D5R A;  3THX B;  1L3U A;  3SUQ A;  4BRC A;  3L3V A;  3MAQ A;  1BIU A;  4CJF A;  1KD1 O;  5HRR A;  2Q97 A;  2OPQ A;  1TYQ B;  3G25 A;  1J9A A;  3P83 D;  2ZD1 A;  1X9M A;  2OZS A;  5BR9 A;  3CHW A;  3AO5 A;  4Z0U A;  4DTJ A;  4FZX C;  3C6U A;  4FLX A;  3PLA A;  3QIC A;  1NOY A;  1BIZ A;  1XQS C;  1NGG A;  4CIF A;  3CC2 N;  2E1Z A;  1ZBL A;  2E88 A;  1Q86 O;  4JI5 K;  3J80 O;  3VQP A;  4ICL A;  3IUC A;  3L3U A;  2PAV A;  4FOI A;  2QWR A;  3DLR A;  3ATU A;  3I8D A;  3O6W A;  4M41 A;  1N36 K;  4IEE A;  3IRX A;  4W5O A;  4ZHR A;  1T44 A;  4YOV A;  1S9E A;  3V4I A;  3DXM A;  4F4K A;  2WC9 A;  1S5J A;  1S6P A;  5FPD A;  3KZB A;  1DT9 A;  3PY8 A;  3HVT A;  4B9U A;  1G15 A;  4PL7 A;  1N32 K;  1YUW A;  4H5T A;  4B9Q A;  5KRT A;  5FPN A;  4QS7 A;  3EZW A;  3QEX A;  4CEC A;  1BUP A;  4WFN L;  1XC3 A;  3M8P A;  5FRN A;  1EET A;  3C65 A;  3E66 A;  1QSY A;  4H4O A;  3CJ9 A;  1GLA G;  3I0R A;  1HNZ K;  1YVN A;  4DTX A;  4FJL A;  3LAK A;  1HQU A;  4HTU A;  2HF3 A;  3U6F A;  1B92 A;  3THY A;  4CJP A; 
#chains in the Genus database with same CATH homology
 4DV4 K;  4V19 S;  5A2Q O;  5LMN K;  4DR2 K;  4JI6 K;  4B3R K;  4JI4 K;  4X64 K;  4DV5 K;  1N34 K;  5BR8 K;  5IWA K;  4X65 K;  3T1H K;  2UUB K;  4DR5 K;  4LF6 K;  4OX9 K;  1XNR K;  4DV3 K;  4AQY K;  2ZM6 K;  4DV1 K;  4DV0 K;  4LF9 K;  4DR4 K;  4B3S K;  4LFC K;  1J5E K;  4NXM K;  4CW7 B;  2UXC K;  5FLX O;  4B3M K;  5LL6 Z;  4CVN E;  4DR6 K;  5IT9 O;  4DV2 K;  4DR7 K;  4DV7 K;  3T1Y K;  4JI2 K;  4JI5 K;  4JI7 K;  5LMU K;  3J80 O;  2UXB K;  5AJ3 K;  2UU9 K;  1HR0 K;  2HHH K;  4GKJ K;  4JI3 K;  3JAM O;  1IBK K;  4X66 K;  3J7Y P;  3J7A P;  1XMO K;  4GKK K;  1FJG K;  2UUA K;  4LFB K;  1N36 K;  2E5L K;  3OTO K;  4JV5 K;  4B3T K;  1IBL K;  1XMQ K;  1IBM K;  4YY3 K;  4JI0 K;  4DUY K;  2UXD K;  4JI8 K;  2UUC K;  4DV6 K;  4K0K K;  4KHP K;  2VQE K;  2VQF K;  4LF5 K;  4X62 K;  1N32 K;  4YHH K;  1N33 K;  1HNX K;  4DUZ K;  4LF7 K;  1HNW K;  2F4V K;  4DR1 K;  4JYA K;  4NXN K;  4LF4 K;  1XNQ K;  1HNZ K;  4JI1 K;  4DR3 K;  1I94 K;  3J81 O;  4LFA K;  4LF8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...