4JI5K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji5K00
4X66K 4CVNE 2VQEK 2UUBK 4DV1K 4X64K 4LFBK 4B3RK 4X65K 1XNQK 4DV3K 5LMNK 4JI0K 4B3SK 4JI3K 4JI2K 2UXCK 1XMOK 4DV6K 4JI1K 4JYAK 2UU9K 4DV5K 4DV4K 1N32K 4GKKK 4LF6K 4GKJK 3JAMO 4B3TK 1N33K 5LL6Z 4K0KK 4JI4K 4DR4K 3J7AP 4JI6K 4DV2K 4LF7K 4OX9K 4NXMK 4JV5K 1IBMK 1XNRK 1HNXK 3J80O 4KHPK 4DR3K 4DR1K 1HR0K 2F4VK 1N34K 2UXBK 4JI8K 3T1HK 4LF5K 2VQFK 2UUCK 5IWAK 3OTOK 1J5EK 2UXDK 4DUYK 5IT9O 4LFCK 4LF8K 2HHHK 2E5LK 5A2QO 1HNZK 4DV0K 3J81O 2ZM6K 1HNWK 5LMUK 4DR7K 4NXNK 1N36K 1IBKK 4DUZK 4V19S 1XMQK 1I94K 2UUAK 4B3MK 4JI7K 1FJGK 4YHHK 4AQYK 4X62K 4LFAK 4DV7K 3T1YK 4LF4K 4DR6K 4DR5K 4JI5K 5AJ3K 4YY3K 5BR8K 4LF9K 5FLXO 3J7YP 4CW7B 1IBLK 4DR2K
chains in the Genus database with same CATH superfamily
3L4QA 1LAVA 4B9NA 2VG6A 4H03B 4K8ZA 3HK2A 2QWQA 5GAGP 3ZEUB 3TTCA 3D6RA 5HL7L 4M3XA 3K5NA 4B3RK 4KRFA 4NO7A 3IRXA 1W0HA 1NG9A 4JI3K 1TYQA 5C42A 4CGDA 3C6HA 5JMVA 1NKEA 4CF8A 5BN8A 1MA9B 2LSNA 5C15A 2D0OA 4MDBA 4N5SA 4NCBA 3VTIA 5AQOA 2DTUA 2B6AA 5EY4A 4B08A 1T3VA 3SUQA 3A8YA 2ITGA 2FF3B 3TTFA 3SPYA 1Q8IA 3VEXA 1VHXA 3BZKA 3KK3A 3O4QA 1ZBFA 4CJEA 4NXMK 4DSLA 3ZEUA 4DTOA 4PKHA 3MEDA 1XNRK 3SI6A 4CEEA 1Q81O 3UKRB 2XHBA 1EQYA 3PV8A 3O3HA 1VQ8N 2JWLA 3EE9A 4JHDB 4LY7A 3HO1A 1BWFO 4CK3A 3LALA 4BVPA 3PLAA 1NJZA 1LWCA 3WXLA 3TAGA 2J4RA 3SJJA 3L2UA 1Z25A 5JS2A 3ZT4A 3G25A 5AQIA 3M8RA 3C0BA 3P39A 3CJAA 4AQYK 3AVKA 4FZZA 4JK9A 3OW2M 2E1ZA 4JHDA 3NCIA 3RVCA 3I8BA 1VSEA 4BRQA 4B8CA 1LW2A 5AQTA 1VSLA 4OPJA 4CZEA 1LWFA 3KKSA 2I7PA 2YHBA 1HKGA 3I55N 4N47A 3OYDA 2Q36A 1HNVA 2RKIA 1VSIA 3LWMA 4X65K 5SZTA 4NLCA 3DWLA 4DTXA 4FJHA 3OYFA 4XEIA 4JN4A 4EP4A 3IG1A 4IO8A 1U6ZA 1YXQA 3O9UA 1QSLA 4M3RA 4DSFA 4ISFA 3SUOA 4KHYA 3ZCMA 4B9LA 1N6QA 2WUSA 3CC2N 3AA2A 3ZT0A 2FLOA 3VN5A 4GKKK 3DM2A 3M8PA 3SZ2A 1LCUA 4TSXA 5HROA 4FO0A 4A57A 2NNWA 4CBWA 2E20A 3KJVA 3HXMA 3J7AP 2YNIA 4FLWA 3THWB 4BE1A 3AGRA 4F2SA 4HUEA 1S9GA 4KV8A 2HBLA 3T19A 4B8AB 4CIFA 1HUXA 1EX4A 3GE1A 3GOIA 4F9OA 4DR3K 4CFDA 1J54A 4JI8K 3EO3A 5GAEP 4Z94A 3DRSA 3ASMA 3MN5A 3BY5A 3WQUA 3UIQA 4OKKA 4DQ8A 1NJIO 2G8KA 3CCEN 4M63C 5F2RA 4LF8K 4ISEA 2D1KA 4FWSA 1JKHA 3J81O 3NHGA 3CQ8A 3O4WA 1S22A 5CHIA 3THWA 1L3VA 1TVRA 3JS6A 1YVUA 3EKUA 3V9SA 3QESA 3QIPA 1D4XA 5FPNA 1NK5A 4XH4A 2GV9A 1ATSA 5M1OA 4IXCA 1ZBHA 3MCAB 3SAFA 1NGBA 3VEZA 4I7FA 4C8OA 1SL2A 2HOEA 2P1JA 4DKWA 3HP6A 1U4BA 2O8CB 1BHLA 4RCHA 4B1ZA 3BGRA 3AY9A 3SUNA 3BP8A 1X1PA 4NB4A 2RN2A 4JS5A 3CM5A 3QLHA 1BIUA 2QI2A 3E01A 1VSHA 4CERA 1NGHA 4R79A 2JLEA 1N8RO 2ZGZA 2IS3A 4M7XA 2VCPA 3WUHA 2HVIA 3MDQA 4JI2K 3F2KA 4E0DA 4NLBA 2Q31A 3L3VA 4LH4A 2ZE2A 2YNHA 4CGJA 4CHQA 3AO2A 3P83D 4J2EA 2VWJA 2O8CA 2G8HA 4EZ6A 2HBJA 4M3TA 4K41A 5AQWA 5J2NA 4B9VA 1WBBA 1T03A 2OTLN 3PO5A 2Z1IA 5AR0A 3PX4A 5ADXH 2QWLA 5CZ2A 3EKSA 4CK2A 3AVJA 4A61A 4BR0A 1TAUA 2QEXN 4E89A 2HHSA 1EWRA 5EXWA 4HTUA 5GIPA 4O8KA 1GOAA 5FPDA 2B4JA 1HMVA 4FLYA 3P1GA 5LY3A 2E6LA 2XRIA 2YHAA 2RHKA 1LAWA 1W97L 5HRNA 1EXQA 1GLBG 3VESA 4FJNA 3OTOK 5E26A 1UWBA 2HHXA 3C6AA 5BREA 3PUFA 3B8AX 3CPWM 1M1KO 1ASVA 3HOTA 2ZM6K 1S3XA 4RW4A 3W0LA 3FZHA 4JKEA 1Y64A 4FPAA 3TSPA 1ITGA 2UUAK 3E66A 3TAEA 4IDKA 3V9XA 3MMVA 1NGCA 2QWNA 1JL2A 3KWGA 3A5LC 5CR4A 4H5VA 4IG0A 4DR5K 4DU1A 3TAPA 1KFSA 2P9UB 4LF9K 1HYSA 4JNEA 2F96A 1BQNA 3KWIA 3K5MA 1VQKN 4WQ4C 4QS9A 3H3OB 4M3WA 5HBMA 5C2FA 5HRRA 3KLIA 3ALYA 4BACA 1XNQK 2DFEA 1WB9A 2W41A 3HBTA 2OPQA 3KLHA 4RG8A 3O80A 4DQQA 3LDOA 1JLQA 3OYMA 4E7HA 3UE5A 1JLAA 3EZ5A 1HJRA 4KKOA 4BE0A 3CPEA 4U7BA 3HVRA 1VQ4N 3QBWA 1JLGA 3D0PA 1U2VB 4IWVA 2P9UA 2Z1GA 3B6PA 4DV4K 1N32K 1HX1A 1NK0A 4CZHA 3CCSN 3SCXA 3MEEA 3P31A 4DQPA 2EWSA 4I2PA 3TAQA 1RGIA 4DQSA 2W6LA 4Y0WA 3AO1A 4O0JA 3P38A 2GBZA 5CZ1A 3AA4A 4JRQA 4FJ9A 4KBOA 2PBDA 2G8IA 3CFPA 3LDLA 3U9DA 1J5OA 5FPMA 3VGLA 2HMIA 3VQ9A 3UKUB 4ILGB 1SKWA 2G8VA 2VG7A 3WQTA 2Q2RA 3TPQA 3L2QA 3KLGA 3QINA 1C0UA 1U47A 3IAYA 3C95A 5I9EB 3FZFA 4FLZA 5AQZA 1U2VA 2E8AA 3GG4A 1QQMA 3LDSA 5C10A 4IEIA 1E3MA 1S5JA 4LFCK 3OYCA 1TKXA 1MWMA 4IDHA 4A2AA 3EEQA 3WNFA 2YNFA 3S3NA 3PO4A 2W40A 1VQ7N 3M8SA 1VQON 3LL3A 3MWTA 2O8BB 1YJ9N 4KHSA 1TV6A 2FSNA 1BIZA 3HP9A 3UKUA 1S9EA 2NUBA 5H1SQ 1X9WA 1BGXT 4YY3K 4YDUA 3SJHA 4CCHA 4CF9A 1GLDG 2VGMA 3BDPA 4EHUA 1TKZA 5ADXA 2D4WA 4X66K 3QERA 4ZTFA 4WQ4A 3H46O 4JKGB 5AFUA 1K8KB 1U04A 1NK7A 2KW4A 2OCEA 3VF6A 4YORA 4AHCA 4KTZA 1SAZA 4OKJA 4FLXA 3F9KA 3OYGA 1ASUA 1TUUA 2O8BA 1X9JA 4IOXA 4KPYA 4LSLA 1NGDA 4Z4CA 4BC3A 2VWKA 4CJKA 4KH6A 3C94A 4CGFA 2OPPA 3MXMA 1KAZA 4KTWA 3VQ7A 5EOYA 2HHUA 5J1EA 1VQLN 3KLEA 1N33K 2BH1A 1VSDA 1KLMA 4K0KK 4JI4K 1OVYA 5AQFA 3RR7A 4NYNA 3DLHA 4JKGA 1BDGA 4CEZA 4DFJA 1K8KA 4XH1A 3QDKA 3QEPA 1DLOA 3RWUA 1VSKA 4ID1A 5CY4A 2A5XA 5ELZA 3SAHA 4GW6A 5KRSA 1QSYA 2F4VK 3PSIA 2QXLA 4KREA 5CYMA 2G8FA 1VRUA 3TSUA 1Q18A 1RTIA 3SQ2A 4CF2A 3E9LA 1EETA 1O13A 4DSEA 4H5NA 3NGYA 5CYQA 2DPNA 1TK0A 3DLBA 5M1FA 3AA5X 4FK4A 2I5JA 4CJUA 2YHXA 1JLBA 2PYLA 4C1NK 1YJNN 3KK2A 4FK2A 3MXIA 5AQPA 3BEXA 3RRHA 4M3ZA 1LWEA 3NH0A 4IO9L 3V81A 3VEVA 1GOBA 4Z4EA 3SYZA 1CZAN 4CEOA 5C2DA 3PIPL 3I56N 2PYJA 4JI5K 3M8QA 4DLGA 3SMSA 3J7YP 1ZBLA 4M7YA 5CE3A 3CJBA 3WNGA 2X78A 4CJTA 2XY6A 1IBLK 1C0GA 3VEWA 1DKGD 4GV6A 4KAZA 5BPMA 1XQSC 4B9UA 1G99A 4OPAA 4IOAL 1NJXA 4KB1A 1YTAA 3SQ0A 4FWNA 4CJ5A 1X3MA 2E4LA 3H6EA 4FWOA 1FKPA 4H0OA 1BCMA 2E2OA 2XY8A 3OS1A 3SUPA 3WXKA 4CEAA 3U8XA 3HL8A 3L2RA 4RW9A 3RMCA 3SLCA 4FM2A 1ZBIA 4PY5A 1RTDA 2ZJQL 3A5OC 1K8AO 3NAEA 4CHZA 3K5OA 3TARA 4B3TK 2QWPA 3LM2A 3U3YA 1RT2A 1G15A 1A5XA 2GELA 3HRGA 1KCFA 4B1YB 2YI1A 3QMLA 2IVPA 2KZZA 3LDNA 3U4LA 4CJPA 2QWRA 1VSFA 3OYJA 4JS4A 5FDLA 3K9JA 3VQDA 4DMNA 2O4IA 4OGCA 1NGFA 3VGMA 1WOQA 4JKCA 2G8WA 4YOYA 2UUCK 4H5WA 3DLRA 2QTDA 3V1OA 3B6OA 4DS4A 5IT9O 3OYEA 1ATRA 1P90A 1C6VA 1OVQA 3HM8A 1YHQN 1NGIA 4CJSA 4Z4GA 1HNIA 3F5TA 1YITN 3JXUA 4AHVA 2NLXA 3VTHA 3WNHA 1N36K 2KQ2A 3ULDA 2GUPA 1RTHA 3L0QA 2W42A 1Q86O 2AP1A 3ULEB 4CJ3A 1XHXA 5AZIB 4MLEA 3FFIA 1CXUA 4N41A 1JXBA 4A62A 2ZWHA 4CJQA 4WYBA 5AJ3K 1WSJA 1YT3A 2O8FB 5FLXO 3FLCO 3V9WA 1IKWA 4FM1A 3CC7N 5F0XA 1OH8A 1IJJA 2ASPA 4K25A 4I9LA 4BRAA 4RWTA 4AM7A 1KVAA 3CM6A 2PZSA 2YNGA 3AVCA 1DTQA 4MO4A 2VQEK 4AF1A 3MCPA 3SQ4A 4X64K 2I7NA 2QA4N 2IOCA 2QKKA 1QHAA 3N4PA 3UKRA 3SV4A 1S6QA 2A42A 1YJWN 1D5AA 4BRMA 3OJSA 3ZX3A 4CI6A 3F73A 3ULEA 1B92A 5AZIA 1C0FA 4E3SA 4BG9A 3A5MC 3LM9A 3O9SA 1RDBA 3I33A 3CCMN 1JL1A 2O8FA 4ELUA 4WFBL 1L3TA 4R5PA 4FWPA 3EY1A 3VQ5A 4OJRA 4CK1A 2GWKA 3MAQA 3R9PA 1S1WA 3VGKA 4JI6K 3NVKA 4AHRA 4FJJA 1KRPA 4BY9C 4CECA 1RFQA 1T6DA 2ZQBA 3CD6N 3G6EN 2WC9A 3J80O 5AZJB 4FJXA 1W9HA 4EZ9A 3KK1A 1Q7YO 4WFNL 3UB5A 1I39A 4FLTA 1HRHA 4PKGA 2E2PA 2Z1HA 2ZD1A 3FZKA 4BRNA 5BPNA 5AQXA 4JKAA 1WSGA 2RE2A 1FK9A 2P9KB 4WCEL 1NLVA 2Q0RA 2QW9A 1JCGA 3LANA 1P8ZA 4J2AA 3U6FA 1BO5O 3FE1A 4OLAA 1RT7A 5BRFA 3HVTA 2KHOA 4M3YA 3OA9A 4E7JA 1R0AA 4FWQA 1GLCG 4DTMA 3ENOA 3K2PA 4B3MK 4KHNA 3AGKA 2OPSA 3VEOA 2HNDA 5AZJA 1NU0A 3HPOA 4LFAK 1NGAA 3T1YK 3MN6A 3WXMB 5EVZA 2CGJA 5AQQA 4FJMA 1CLQA 3E9OA 1NMNA 1NOZA 2KFNA 4LSNA 4CW7B 3ZETB 1FKOA 1RBTA 4LH5A 4DR2K 4FJLA 3AV9A 3T69A 2P9KA 3QNNA 4B9TA 3N4QA 3NMUA 3ZX0A 1TUYA 4BR7A 3KK7A 1SL1A 4CZLA 5JLFA 4ILHA 3RTVA 2Q0UA 1KAXA 3VEYA 3HOSA 4C8LA 1SL0A 3TABA 3QNOA 3JSMA 1S6PA 3DLKA 4CF0A 1X9SA 1RNHA 4OGEA 2VG5A 3QO9A 3OHRA 3SAGA 2A40A 2H3GX 2VGNA 3BF1A 2YKNA 4YOXA 2FBXA 4C8KA 3V1QA 4Z4HA 3ZETA 3I0SA 3O5BA 1YI2N 2R7YA 4UQGA 1NK4A 1QE1A 1VQ6N 5AQNA 4E1JA 4OPKA 4DFKA 3D7EO 2B5JA 3IDHA 1QS4A 3R1XA 3KLFA 4IOCL 1KC8O 3VQCA 4DG1A 2UXBK 4CZIA 2PFUA 4W5OA 1ILYA 3V6DA 4E1MA 3VERA 4GV9A 4FYDA 3U9ZA 1OH5A 2GTDA 4O44A 4O8UA 4LD0A 3OBYA 5GIOA 4GVMA 5I3UA 2GX9A 3CXCM 2X6NA 3TSQA 2HHHK 1WBDA 5BPLA 1L3UA 3O9TA 3M1FA 4FZYA 3M5RA 1BA1A 3AVLA 3MECA 4YFUA 3CF5L 3OJUA 2D0AA 2P9IB 4FLUA 3PIOL 1XMQK 3TTDA 3FFKB 3H45C 1MWKA 4DWIA 4FWKA 5J2QA 4G1QA 3ZT2A 4H5TA 4X62K 2V7ZA 4BREA 5AQGA 5AQUA 3T1AA 4BQLA 3QFUA 3HSTB 2O8DB 4QS8A 2HBMA 4FW1A 1JCEA 3C7NB 1RDWX 4MDAA 3IFRA 3CYMA 2ZF5O 4HHTA 3DOLA 1ASWA 2P51A 1HLUA 3T7ZA 2P5GA 1GLEG 4CGGA 1XWLA 3NBPA 4A59A 4JEPA 4Z4FA 3CCRN 4OKEA 4HUGA 1HQUA 1RDCA 4H8KA 3CG7A 3C65A 2D5RA 4YDUC 3L8BA 2P9IA 3O9RA 1A5WA 4KH4A 3OYIA 1VK0A 5MLCQ 4FVMA 2FSKA 5SWMA 3QETA 4BR2A 4ICLA 4BE2A 2OZMA 1BCOA 5AQKA 2NRVA 2NRHA 5M1QA 3PX0A 3PY8A 2O8DA 3OYLA 3C7NA 2BDPA 4DSKA 3LPTA 4RTFD 4B9MA 4MFBA 5KGWA 1NK6A 4KH5A 1SS6A 2GEMA 2CH5A 3QEIA 3AVGA 3J7ZO 3CMAN 4FM0A 2Q1NA 3CFRA 4OX9K 2XY5A 3AVBA 3R6MA 4CGIA 3Q7BA 4B1WB 2QM1A 3NH2A 3O6WA 3V9UA 4CJ4A 1T6CA 4H0YB 4DR1K 3CIPA 2GWJA 5AQYA 3NF9A 2IIRA 1WSIA 4E19A 1C1AA 3R3LA 1NOYA 1M90O 4AM6A 1E4GT 1S1UA 1J5EK 5B8HA 3QB0A 4B9QA 3NVMA 4BG8A 3TR8A 2QWMA 4DV0K 1CXQA 3WXIA 3VETA 3K58A 2X74A 1QQCA 3NGZA 4WFAL 4DUZK 2F7TA 4BDYA 4FL9A 4I6MB 4PL8A 1Q82O 1SKRA 3G10A 2NRRA 4CFBA 5LJVA 2AA4A 1VQMN 1IV0A 4K8XA 3IMXA 3CCLN 1N5YA 4IFEA 3ZSQA 4OO1J 5GADP 3RSEB 3QBXA 1VQPN 2PY5A 4KHQA 1RBVA 3DLLL 5J2PA 2FC0A 1S1XA 4I2QA 1K73O 3EL2A 3O4NA 2E2QA 4DFMA 2VYPA 4DV3K 1KVBA 5LMNK 3A5NC 3WT0A 1REVA 1RCHA 4GVEA 4CJ7A 3MN7A 4I6MA 1KQSM 3VMFB 2ASOA 1T44A 3DOKA 3MEGA 5DMRA 4YOVA 1VQ5N 2A41A 1BA0A 4JYAK 3MWPA 2DY4A 3SPZA 3VQEA 4QS7A 4WQ5A 1HKCA 1WSFA 2D0BA 4IJNA 4CZMA 4BDZA 4BRPA 4U67L 1ZYQA 3SNNA 3RSEA 3DRPA 4B1XB 1WAJA 1OKJA 4ELTA 2F9WA 5FRMA 1WSEA 5AQLA 5HLFA 4PUOA 1MU2A 3ZYYX 1JLCA 3I8DA 5JVHL 4CFCA 1GLFO 3QICA 1HR0K 2WONA 1QQOA 1U45A 3G71N 4N76A 3CQXA 5JLHA 1Q9XA 4DTJA 2VQFK 3KVGA 4CGHA 1ESVA 3VQ8A 4F3OA 4K43A 4RW7A 2BANA 3SBTA 2Y1JA 3ATVA 1EO1A 4DSJA 1NJWA 3O3FA 1ZBSA 1YAGA 3KKRA 5M1PA 4ZHRA 3KZBA 4ISGA 4V19S 5E41A 1I94K 1JCFA 3A0IX 3GBTA 5EU7A 2HBKA 4M45A 4M42A 4JI7K 4CFAA 1W7AA 1FW6A 5F1XA 1FJGK 1DGKN 1XHZA 4PQUA 3HZ6A 2AJQA 1DT9A 4DV7K 2Z1JA 5AQJA 2XY7A 2A1RA 1QHTA 3AO3A 4HCCA 3D2FB 1KAYA 3CCQN 3LP0A 5EX5A 3SQ1A 2HNZA 3AVNA 3DMJA 2OANA 4KO0A 3HT3A 1IG8A 3DXMB 5FPEA 3ZSWA 4CVNE 3MX5A 3MX2A 5DM7L 4QOZB 3OS0A 4PHTX 1A5VA 3WEEB 1NGJA 3HTVA 4JD2B 4FZXC 3O8MA 1RDUA 4G9ZA 3QEWA 3LP2A 3D2FA 4GKJK 3VF2A 1BQMA 3RRGA 2X6SA 4BQZA 3DXMA 3S3MA 1J53A 2FSJA 3O3GA 1OH7A 3DXKB 3H1QA 1NM1A 3SMPA 1KD1O 3S3OA 2HVHA 3CQYA 1EWQA 3EN9A 4CZKA 3M3ZA 4J2BA 4YOWA 1C0MA 4O4GA 2O8EB 5JS1A 3WEEA 5C12A 3VQ6A 3NGIA 4DFPA 4GY2B 4BROA 2E88A 2Q3SA 4JD2A 4W5TA 4LC9B 4RW6A 2HSTA 4DF8A 2HHWA 1NGGA 4CEBA 4FK0A 3QEXA 1TK8A 1NNEA 1GLJO 4HUFA 2FBVA 1IBKK 3ZSXA 3DXKA 3VQ4A 2HB5A 1C0TA 2A6AA 4DCHA 3CC4N 3ZX2A 1CZBA 4H0VB 1L3SA 5T7BA 2O8EA 3CFOA 3HSCA 1D9DA 3NH1A 2QKBA 3HI0A 4FWMA 3ISNC 2V51B 2ZJRL 4DTPA 1K9MO 5FRNA 2W6KA 4UY8O 3ENHA 4PL7A 4JAXA 2JGUA 3ENBA 3VF4A 3NF7A 5I42A 1EKEA 1HJOA 2UUBK 4IKFA 4PA1A 3ZT3A 5M1KA 4MO5A 4DV1K 3CJ7A 4DLEA 1NGEA 1KSPA 4JI0K 3NF6A 2YJEA 5AQVA 2UXCK 4O55A 1B9DA 4Q5VA 4FJIA 3NE6A 1TAQA 2KZMA 3EE8A 1XC9A 4BRGA 1RBUA 4M3UA 5KPRA 1T05A 3NDKA 4A5AA 3E1YA 2P9NB 2RF2A 3LPUA 2BTFA 5AQRA 4DS5A 5GINA 1TKDA 1J6ZA 2JWKA 4CJFA 2OYQA 4DR4K 1NJYA 3CCJN 3W3DA 4AILC 1WLJA 1T8EA 3O9QA 3QFPA 1Z26A 3DRRA 1WUAA 1HNXK 4WE1A 4CIEA 4AHTA 3S41A 3QIOA 1XUPO 1NK8A 3WNEA 4IJAA 3RMAA 4KHUA 3S9HA 3VQPA 3AAPA 1Y97A 5D3GA 1J9AA 1YUWA 1GLLO 1S1TA 1WSHA 2P9NA 3WXJA 3G4SN 1L5UA 2E1YA 2P9SB 4CHNA 4CBUA 1UA1A 3R8EA 1RT1A 4JKDA 3F9MA 5LJWA 1HNWK 4H4MA 4F8RA 1CZ9A 2Q97A 4XH5A 4KI4A 4F2RA 2YHYA 4CEQA 4FJ5A 3ZSZA 1UA0A 3ZSYA 3J8AA 3P4IA 1D8YA 3HPGA 1SZ2A 1TGOA 1RDDA 2UYTA 3V1RA 4BC5A 3BUZB 1KFDA 1QSSA 3TANA 4C8MA 2E6MA 3DJCA 4W5QA 4C1NI 4F4KA 2IAJA 4J2DA 1BG3A 1YTUA 4IBNA 3OBWA 3THXB 3MK6A 2ASMA 4BRIA 2NZTA 2P9SA 2D0PA 3LAKA 4BRFA 5AQSA 4DB3A 2HF4A 4FJ7A 2YJFA 4C23A 2WTUA 2OZSA 1Z05A 2KTQA 2HMPA 4CHYA 4ZTJA 3ZSVA 2IC3A 1XMOK 2YCHA 3DYAA 4JI1K 1WAFA 4CZFA 3ZSOA 4KFBA 4NCGA 4GMJB 3CCUN 3NFAA 3OVNA 3MXJA 4W5NA 1QZ5A 2P9LB 3T3FA 4IG3A 3RR8A 4FWRA 2ETJA 3AO5A 4RW8A 3AAQA 1YF5L 4EIAA 3THXA 2RPIA 2A1SA 3OYNA 2BGGA 1X9MA 1DEJA 1VRTA 3LP3A 4BWMA 1E4FT 3SK3A 4DQRA 4JV5K 1IBMK 4MLHA 5C24A 1RT4A 4FWLA 4CIGA 3C6UA 4IFVA 1N34K 3HJFA 5GAHP 1TK5A 2NRZA 1GLAG 3VENA 4AHUA 4EP5A 5J2MA 4I9QA 4PKIA 4CJVA 4AHSA 4BC2A 2P9LA 2UXDK 2DFFA 4O0IA 3DLEA 1ATNA 4GV3A 1JXEA 4WF9L 4E1NA 1KTQA 2E5LK 1NWKA 3KIOA 2CGLA 1VAZA 3AVMA 2YX6A 5LMUK 4DR7K 3LWLA 3AA3A 1LOTB 3LZJA 3KD5E 2YV0X 1SKSA 4YHHK 3VA0A 1RT5A 4BWJA 3KD1E 4DR6K 3OYKA 1HYZA 3AVAA 3FZMA 3BZCA 2F8SA 4B3OA 4C8NA 2WFBA 4BRKA 5HRPA 5KRTA 5JICA 1TL1A 1NK9A 4FOEA 1BU6O 3D45A 3SV3A 4CZGA 4CHOA 5FROA 3O08A 2XO7A 4H0TB 5AFUH 2HHVA 2VWBA 3TU5A 2D0CA 1RBRA 4HVJA 4E7IA 4KI6A 1LV5A 3TAMA 3EYZA 4A2BA 2BUPA 4FJ8A 1GOCA 3O1BA 2UU9K 2O4GA 1O1WA 4BVOA 1VQ9N 5K14A 5BR9A 3MN9A 4LF6K 4DTNA 3JAMO 4CJRA 3CETA 3H08A 4HWIA 1R59O 3L2WA 5LL6Z 3OYAA 4JKFA 4Y1CA 4AH9A 4L8RB 1D9FA 1C1CA 4WQ5C 3Q7CA 1U49A 4ID5A 1XI1A 3FZLA 1U48A 4FVUA 3GL1A 4M41A 4JKHA 4CESA 4LF5K 1K6YA 1IO2A 1JLEA 2QWOA 3K0SA 3AVFA 1SUQA 2G8UA 5HP1A 5KQ8A 5DM6L 4EFHA 4JK7A 1IKVA 5KGXA 1HNZK 3O1WA 3THVA 2EHGA 4W5RA 4FSVA 4A5BA 2DFHA 3H3NO 4H0PA 4B1VA 5M1NA 4L3QA 2Y1IA 4H4OA 3ITHA 1C1BA 2FBTA 3ID6A 4DTUA 5AQMA 3P5JA 4FXDA 1W2BM 1HPMA 4CHPA 4HTLA 1JLFA 3BF3A 4BRLA 4CE9A 4CJWA 4NYFA 2ATQA 3K5LA 1ZXOA 2YKMA 4CEFA 1IH7A 3THYB 4Z0UA 5DK5A 1IKXA 4XIUA 3DLGA 2FF6A 4KHWA 3AO4A 1YIJN 5TKWA 4B3SK 5C25A 5BRHA 2ITMA 2P9PB 4ILJA 1OH6A 1UOCA 4Q0BA 1HYVA 1RILA 1Q9YA 4OVLA 3CERA 3TAFA 1BISA 3K9KA 4BDPA 4DV5K 2KLAA 3A2FA 1I3AA 2NRWA 4FJKA 4DQIA 3V9ZA 1QZ6A 2IVNA 3ZLJA 2EX3A 4DU4A 3VQAA 2ZGYA 2NRXA 2KFZA 3OS2A 1NKBA 2FXUA 3CJ1A 3IUCA 5KTQA 3THYA 1MDUB 2WOMA 3ZSRA 1RBSA 4JLHA 2HHQA 3QEVA 2KKZA 5HOOA 2ZJPL 1NMDA 2PAVA 4BR4A 4KHPK 1BOTO 1JJ2M 1Z6RA 3E9PA 2P9PA 1SQKA 1DTTA 3PSFA 3CCVN 5IWAK 2HHTA 1KLNA 4DSIA 1EP4A 3OY9A 4ELVA 1X3NA 4YOUA 4DTRA 1VQNN 3D2EB 3VQQA 2CH6A 3LDQA 4O5FA 5KI6A 2QXFA 1FXXA 1BUPA 1QVGM 1QQNA 1RT3A 5KPZA 3OYBA 4NXNK 4KTQA 2HNYA 3AVIA 5TKYA 4FOIA 3KTQA 3V4IA 5AQHA 5C0YA 4DF4A 1YVNA 1ZBUA 2YHWA 4CEDA 4PWDA 4BC4A 3CHWA 3ID8A 2F8TA 2P5OA 4YOTA 3TI0A 4QAGA 3KHYA 5BR8K 2BE2A 1RT6A 4N56A 3IKMA 1XC3A 5BN9A 4JKBA 4CD3A 1F21A 2V7YA 4CBXA 4EHTA 3VPZA 2WBNA 1WN7A 3D2EA 1KXPA 4MQ3A 4BGAA 5KPTA 3PX6A 3K57A 1TL3A 4CJLA 3U3GA 1UAXA 2OTJN 1HPZA 4LFBK 4FW2A 4DU3A 4YNQA 4BRCA 4GNIA 1QVFM 3DI6A 2CGKA 4K42A 4B9SA 3LP1A 5BRDA 3CJ9A 4Y1DA 4FJGA 4JK8A 3EZWA 4DV6K 1H1VA 2OA8A 3ATUA 3L3UA 1V4SA 2FBYA 4FPBA 1QTMA 1RDAA 1WNSA 4O5BA 1B9FA 4H5RA 4F3TA 1NBWA 3HYFA 4CF1A 4IEEA 2E2NA 4DV2K 1SV5A 4LF7K 4BRDA 1IG9A 3VOVA 3GDQA 3L2VA 1VSMA 3CJCA 4FCYA 1TKTA 3RMBA 1RTJA 5E84A 4FLVA 3LZIA 3TWHA 4J8FA 2NRTA 4JRPA 3VA3A 1BI4B 3FGUA 5KQDA 3CMEN 2IVOA 3AARA 4NCAA 2QK9A 3VQBA 4OPHA 4H0XB 3T1HK 2V52B 4BR9A 2OPRA 2A3ZA 4BGBA 1NKCA 2IGIA 3H1VX 4OLBA 3I0RA 3IS9A 3SBGA 3CI5A 1T7PA 4QCLA 4E7KA 4B1UB 4IZ9A 2IDOA 1V4TA 4DUYK 3LDPA 3NF8A 1VSJA 3ZT1A 2HW3A 3AVHA 5A2QO 3HPHA 3DAWA 3LAMA 1BL3A 3G0ZA 1S72N 1S1VA 4IFYA 4EAHD 3JYTA 3K59A 1TYQB 4BR5A 4BRHA 3OYHA 4DTSA 1HQEA 1LW0A 1IKYA 1BI4A 4E7LA 4LF4K 3HM9A 2GUIA 3L4IA 3M6GA 2HF3A 4DHYA 3L6QA 1KVCA 4Z4IA 4KB0A 4HCBA 3C6TA 1HKBA 4CD1A 4CZJA 5HRSA 1ZC6A 2F9TA 3FR0A 5JVGL 3RMDA
chains in the Genus database with same CATH topology
4X66K 4CVNE 2VQEK 2UUBK 4DV1K 4X64K 4LFBK 4B3RK 4X65K 1XNQK 4DV3K 5LMNK 4JI0K 4B3SK 4JI3K 4JI2K 2UXCK 1XMOK 4DV6K 4JI1K 4JYAK 2UU9K 4DV5K 4DV4K 1N32K 4GKKK 4LF6K 4GKJK 3JAMO 4B3TK 1N33K 5LL6Z 4K0KK 4JI4K 4DR4K 3J7AP 4JI6K 4DV2K 4LF7K 4OX9K 4NXMK 4JV5K 1IBMK 1XNRK 1HNXK 3J80O 4KHPK 4DR3K 4DR1K 1HR0K 2F4VK 1N34K 2UXBK 4JI8K 3T1HK 4LF5K 2VQFK 2UUCK 5IWAK 3OTOK 1J5EK 2UXDK 4DUYK 5IT9O 4LFCK 4LF8K 2HHHK 2E5LK 5A2QO 1HNZK 4DV0K 3J81O 2ZM6K 1HNWK 5LMUK 4DR7K 4NXNK 1N36K 1IBKK 4DUZK 4V19S 1XMQK 1I94K 2UUAK 4B3MK 4JI7K 1FJGK 4YHHK 4AQYK 4X62K 4LFAK 4DV7K 3T1YK 4LF4K 4DR6K 4DR5K 4JI5K 5AJ3K 4YY3K 5BR8K 4LF9K 5FLXO 3J7YP 4CW7B 1IBLK 4DR2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 K;  4CVN E;  2VQE K;  2UUB K;  4DV1 K;  4X64 K;  4LFB K;  4B3R K;  4X65 K;  1XNQ K;  4DV3 K;  5LMN K;  4JI0 K;  4B3S K;  4JI3 K;  4JI2 K;  2UXC K;  1XMO K;  4DV6 K;  4JI1 K;  4JYA K;  2UU9 K;  4DV5 K;  4DV4 K;  1N32 K;  4GKK K;  4LF6 K;  4GKJ K;  3JAM O;  4B3T K;  1N33 K;  5LL6 Z;  4K0K K;  4JI4 K;  4DR4 K;  3J7A P;  4JI6 K;  4DV2 K;  4LF7 K;  4OX9 K;  4NXM K;  4JV5 K;  1IBM K;  1XNR K;  1HNX K;  3J80 O;  4KHP K;  4DR3 K;  4DR1 K;  1HR0 K;  2F4V K;  1N34 K;  2UXB K;  4JI8 K;  3T1H K;  4LF5 K;  2VQF K;  2UUC K;  5IWA K;  3OTO K;  1J5E K;  2UXD K;  4DUY K;  5IT9 O;  4LFC K;  4LF8 K;  2HHH K;  2E5L K;  5A2Q O;  1HNZ K;  4DV0 K;  3J81 O;  2ZM6 K;  1HNW K;  5LMU K;  4DR7 K;  4NXN K;  1N36 K;  1IBK K;  4DUZ K;  4V19 S;  1XMQ K;  1I94 K;  2UUA K;  4B3M K;  4JI7 K;  1FJG K;  4YHH K;  4AQY K;  4X62 K;  4LFA K;  4DV7 K;  3T1Y K;  4LF4 K;  4DR6 K;  4DR5 K;  4JI5 K;  5AJ3 K;  4YY3 K;  5BR8 K;  4LF9 K;  5FLX O;  3J7Y P;  4CW7 B;  1IBL K;  4DR2 K; 
#chains in the Genus database with same CATH topology
 3L4Q A;  1LAV A;  4B9N A;  2VG6 A;  4H03 B;  4K8Z A;  3HK2 A;  2QWQ A;  5GAG P;  3ZEU B;  3TTC A;  3D6R A;  5HL7 L;  4M3X A;  3K5N A;  4B3R K;  4KRF A;  4NO7 A;  3IRX A;  1W0H A;  1NG9 A;  4JI3 K;  1TYQ A;  5C42 A;  4CGD A;  3C6H A;  5JMV A;  1NKE A;  4CF8 A;  5BN8 A;  1MA9 B;  2LSN A;  5C15 A;  2D0O A;  4MDB A;  4N5S A;  4NCB A;  3VTI A;  5AQO A;  2DTU A;  2B6A A;  5EY4 A;  4B08 A;  1T3V A;  3SUQ A;  3A8Y A;  2ITG A;  2FF3 B;  3TTF A;  3SPY A;  1Q8I A;  3VEX A;  1VHX A;  3BZK A;  3KK3 A;  3O4Q A;  1ZBF A;  4CJE A;  4NXM K;  4DSL A;  3ZEU A;  4DTO A;  4PKH A;  3MED A;  1XNR K;  3SI6 A;  4CEE A;  1Q81 O;  3UKR B;  2XHB A;  1EQY A;  3PV8 A;  3O3H A;  1VQ8 N;  2JWL A;  3EE9 A;  4JHD B;  4LY7 A;  3HO1 A;  1BWF O;  4CK3 A;  3LAL A;  4BVP A;  3PLA A;  1NJZ A;  1LWC A;  3WXL A;  3TAG A;  2J4R A;  3SJJ A;  3L2U A;  1Z25 A;  5JS2 A;  3ZT4 A;  3G25 A;  5AQI A;  3M8R A;  3C0B A;  3P39 A;  3CJA A;  4AQY K;  3AVK A;  4FZZ A;  4JK9 A;  3OW2 M;  2E1Z A;  4JHD A;  3NCI A;  3RVC A;  3I8B A;  1VSE A;  4BRQ A;  4B8C A;  1LW2 A;  5AQT A;  1VSL A;  4OPJ A;  4CZE A;  1LWF A;  3KKS A;  2I7P A;  2YHB A;  1HKG A;  3I55 N;  4N47 A;  3OYD A;  2Q36 A;  1HNV A;  2RKI A;  1VSI A;  3LWM A;  4X65 K;  5SZT A;  4NLC A;  3DWL A;  4DTX A;  4FJH A;  3OYF A;  4XEI A;  4JN4 A;  4EP4 A;  3IG1 A;  4IO8 A;  1U6Z A;  1YXQ A;  3O9U A;  1QSL A;  4M3R A;  4DSF A;  4ISF A;  3SUO A;  4KHY A;  3ZCM A;  4B9L A;  1N6Q A;  2WUS A;  3CC2 N;  3AA2 A;  3ZT0 A;  2FLO A;  3VN5 A;  4GKK K;  3DM2 A;  3M8P A;  3SZ2 A;  1LCU A;  4TSX A;  5HRO A;  4FO0 A;  4A57 A;  2NNW A;  4CBW A;  2E20 A;  3KJV A;  3HXM A;  3J7A P;  2YNI A;  4FLW A;  3THW B;  4BE1 A;  3AGR A;  4F2S A;  4HUE A;  1S9G A;  4KV8 A;  2HBL A;  3T19 A;  4B8A B;  4CIF A;  1HUX A;  1EX4 A;  3GE1 A;  3GOI A;  4F9O A;  4DR3 K;  4CFD A;  1J54 A;  4JI8 K;  3EO3 A;  5GAE P;  4Z94 A;  3DRS A;  3ASM A;  3MN5 A;  3BY5 A;  3WQU A;  3UIQ A;  4OKK A;  4DQ8 A;  1NJI O;  2G8K A;  3CCE N;  4M63 C;  5F2R A;  4LF8 K;  4ISE A;  2D1K A;  4FWS A;  1JKH A;  3J81 O;  3NHG A;  3CQ8 A;  3O4W A;  1S22 A;  5CHI A;  3THW A;  1L3V A;  1TVR A;  3JS6 A;  1YVU A;  3EKU A;  3V9S A;  3QES A;  3QIP A;  1D4X A;  5FPN A;  1NK5 A;  4XH4 A;  2GV9 A;  1ATS A;  5M1O A;  4IXC A;  1ZBH A;  3MCA B;  3SAF A;  1NGB A;  3VEZ A;  4I7F A;  4C8O A;  1SL2 A;  2HOE A;  2P1J A;  4DKW A;  3HP6 A;  1U4B A;  2O8C B;  1BHL A;  4RCH A;  4B1Z A;  3BGR A;  3AY9 A;  3SUN A;  3BP8 A;  1X1P A;  4NB4 A;  2RN2 A;  4JS5 A;  3CM5 A;  3QLH A;  1BIU A;  2QI2 A;  3E01 A;  1VSH A;  4CER A;  1NGH A;  4R79 A;  2JLE A;  1N8R O;  2ZGZ A;  2IS3 A;  4M7X A;  2VCP A;  3WUH A;  2HVI A;  3MDQ A;  4JI2 K;  3F2K A;  4E0D A;  4NLB A;  2Q31 A;  3L3V A;  4LH4 A;  2ZE2 A;  2YNH A;  4CGJ A;  4CHQ A;  3AO2 A;  3P83 D;  4J2E A;  2VWJ A;  2O8C A;  2G8H A;  4EZ6 A;  2HBJ A;  4M3T A;  4K41 A;  5AQW A;  5J2N A;  4B9V A;  1WBB A;  1T03 A;  2OTL N;  3PO5 A;  2Z1I A;  5AR0 A;  3PX4 A;  5ADX H;  2QWL A;  5CZ2 A;  3EKS A;  4CK2 A;  3AVJ A;  4A61 A;  4BR0 A;  1TAU A;  2QEX N;  4E89 A;  2HHS A;  1EWR A;  5EXW A;  4HTU A;  5GIP A;  4O8K A;  1GOA A;  5FPD A;  2B4J A;  1HMV A;  4FLY A;  3P1G A;  5LY3 A;  2E6L A;  2XRI A;  2YHA A;  2RHK A;  1LAW A;  1W97 L;  5HRN A;  1EXQ A;  1GLB G;  3VES A;  4FJN A;  3OTO K;  5E26 A;  1UWB A;  2HHX A;  3C6A A;  5BRE A;  3PUF A;  3B8A X;  3CPW M;  1M1K O;  1ASV A;  3HOT A;  2ZM6 K;  1S3X A;  4RW4 A;  3W0L A;  3FZH A;  4JKE A;  1Y64 A;  4FPA A;  3TSP A;  1ITG A;  2UUA K;  3E66 A;  3TAE A;  4IDK A;  3V9X A;  3MMV A;  1NGC A;  2QWN A;  1JL2 A;  3KWG A;  3A5L C;  5CR4 A;  4H5V A;  4IG0 A;  4DR5 K;  4DU1 A;  3TAP A;  1KFS A;  2P9U B;  4LF9 K;  1HYS A;  4JNE A;  2F96 A;  1BQN A;  3KWI A;  3K5M A;  1VQK N;  4WQ4 C;  4QS9 A;  3H3O B;  4M3W A;  5HBM A;  5C2F A;  5HRR A;  3KLI A;  3ALY A;  4BAC A;  1XNQ K;  2DFE A;  1WB9 A;  2W41 A;  3HBT A;  2OPQ A;  3KLH A;  4RG8 A;  3O80 A;  4DQQ A;  3LDO A;  1JLQ A;  3OYM A;  4E7H A;  3UE5 A;  1JLA A;  3EZ5 A;  1HJR A;  4KKO A;  4BE0 A;  3CPE A;  4U7B A;  3HVR A;  1VQ4 N;  3QBW A;  1JLG A;  3D0P A;  1U2V B;  4IWV A;  2P9U A;  2Z1G A;  3B6P A;  4DV4 K;  1N32 K;  1HX1 A;  1NK0 A;  4CZH A;  3CCS N;  3SCX A;  3MEE A;  3P31 A;  4DQP A;  2EWS A;  4I2P A;  3TAQ A;  1RGI A;  4DQS A;  2W6L A;  4Y0W A;  3AO1 A;  4O0J A;  3P38 A;  2GBZ A;  5CZ1 A;  3AA4 A;  4JRQ A;  4FJ9 A;  4KBO A;  2PBD A;  2G8I A;  3CFP A;  3LDL A;  3U9D A;  1J5O A;  5FPM A;  3VGL A;  2HMI A;  3VQ9 A;  3UKU B;  4ILG B;  1SKW A;  2G8V A;  2VG7 A;  3WQT A;  2Q2R A;  3TPQ A;  3L2Q A;  3KLG A;  3QIN A;  1C0U A;  1U47 A;  3IAY A;  3C95 A;  5I9E B;  3FZF A;  4FLZ A;  5AQZ A;  1U2V A;  2E8A A;  3GG4 A;  1QQM A;  3LDS A;  5C10 A;  4IEI A;  1E3M A;  1S5J A;  4LFC K;  3OYC A;  1TKX A;  1MWM A;  4IDH A;  4A2A A;  3EEQ A;  3WNF A;  2YNF A;  3S3N A;  3PO4 A;  2W40 A;  1VQ7 N;  3M8S A;  1VQO N;  3LL3 A;  3MWT A;  2O8B B;  1YJ9 N;  4KHS A;  1TV6 A;  2FSN A;  1BIZ A;  3HP9 A;  3UKU A;  1S9E A;  2NUB A;  5H1S Q;  1X9W A;  1BGX T;  4YY3 K;  4YDU A;  3SJH A;  4CCH A;  4CF9 A;  1GLD G;  2VGM A;  3BDP A;  4EHU A;  1TKZ A;  5ADX A;  2D4W A;  4X66 K;  3QER A;  4ZTF A;  4WQ4 A;  3H46 O;  4JKG B;  5AFU A;  1K8K B;  1U04 A;  1NK7 A;  2KW4 A;  2OCE A;  3VF6 A;  4YOR A;  4AHC A;  4KTZ A;  1SAZ A;  4OKJ A;  4FLX A;  3F9K A;  3OYG A;  1ASU A;  1TUU A;  2O8B A;  1X9J A;  4IOX A;  4KPY A;  4LSL A;  1NGD A;  4Z4C A;  4BC3 A;  2VWK A;  4CJK A;  4KH6 A;  3C94 A;  4CGF A;  2OPP A;  3MXM A;  1KAZ A;  4KTW A;  3VQ7 A;  5EOY A;  2HHU A;  5J1E A;  1VQL N;  3KLE A;  1N33 K;  2BH1 A;  1VSD A;  1KLM A;  4K0K K;  4JI4 K;  1OVY A;  5AQF A;  3RR7 A;  4NYN A;  3DLH A;  4JKG A;  1BDG A;  4CEZ A;  4DFJ A;  1K8K A;  4XH1 A;  3QDK A;  3QEP A;  1DLO A;  3RWU A;  1VSK A;  4ID1 A;  5CY4 A;  2A5X A;  5ELZ A;  3SAH A;  4GW6 A;  5KRS A;  1QSY A;  2F4V K;  3PSI A;  2QXL A;  4KRE A;  5CYM A;  2G8F A;  1VRU A;  3TSU A;  1Q18 A;  1RTI A;  3SQ2 A;  4CF2 A;  3E9L A;  1EET A;  1O13 A;  4DSE A;  4H5N A;  3NGY A;  5CYQ A;  2DPN A;  1TK0 A;  3DLB A;  5M1F A;  3AA5 X;  4FK4 A;  2I5J A;  4CJU A;  2YHX A;  1JLB A;  2PYL A;  4C1N K;  1YJN N;  3KK2 A;  4FK2 A;  3MXI A;  5AQP A;  3BEX A;  3RRH A;  4M3Z A;  1LWE A;  3NH0 A;  4IO9 L;  3V81 A;  3VEV A;  1GOB A;  4Z4E A;  3SYZ A;  1CZA N;  4CEO A;  5C2D A;  3PIP L;  3I56 N;  2PYJ A;  4JI5 K;  3M8Q A;  4DLG A;  3SMS A;  3J7Y P;  1ZBL A;  4M7Y A;  5CE3 A;  3CJB A;  3WNG A;  2X78 A;  4CJT A;  2XY6 A;  1IBL K;  1C0G A;  3VEW A;  1DKG D;  4GV6 A;  4KAZ A;  5BPM A;  1XQS C;  4B9U A;  1G99 A;  4OPA A;  4IOA L;  1NJX A;  4KB1 A;  1YTA A;  3SQ0 A;  4FWN A;  4CJ5 A;  1X3M A;  2E4L A;  3H6E A;  4FWO A;  1FKP A;  4H0O A;  1BCM A;  2E2O A;  2XY8 A;  3OS1 A;  3SUP A;  3WXK A;  4CEA A;  3U8X A;  3HL8 A;  3L2R A;  4RW9 A;  3RMC A;  3SLC A;  4FM2 A;  1ZBI A;  4PY5 A;  1RTD A;  2ZJQ L;  3A5O C;  1K8A O;  3NAE A;  4CHZ A;  3K5O A;  3TAR A;  4B3T K;  2QWP A;  3LM2 A;  3U3Y A;  1RT2 A;  1G15 A;  1A5X A;  2GEL A;  3HRG A;  1KCF A;  4B1Y B;  2YI1 A;  3QML A;  2IVP A;  2KZZ A;  3LDN A;  3U4L A;  4CJP A;  2QWR A;  1VSF A;  3OYJ A;  4JS4 A;  5FDL A;  3K9J A;  3VQD A;  4DMN A;  2O4I A;  4OGC A;  1NGF A;  3VGM A;  1WOQ A;  4JKC A;  2G8W A;  4YOY A;  2UUC K;  4H5W A;  3DLR A;  2QTD A;  3V1O A;  3B6O A;  4DS4 A;  5IT9 O;  3OYE A;  1ATR A;  1P90 A;  1C6V A;  1OVQ A;  3HM8 A;  1YHQ N;  1NGI A;  4CJS A;  4Z4G A;  1HNI A;  3F5T A;  1YIT N;  3JXU A;  4AHV A;  2NLX A;  3VTH A;  3WNH A;  1N36 K;  2KQ2 A;  3ULD A;  2GUP A;  1RTH A;  3L0Q A;  2W42 A;  1Q86 O;  2AP1 A;  3ULE B;  4CJ3 A;  1XHX A;  5AZI B;  4MLE A;  3FFI A;  1CXU A;  4N41 A;  1JXB A;  4A62 A;  2ZWH A;  4CJQ A;  4WYB A;  5AJ3 K;  1WSJ A;  1YT3 A;  2O8F B;  5FLX O;  3FLC O;  3V9W A;  1IKW A;  4FM1 A;  3CC7 N;  5F0X A;  1OH8 A;  1IJJ A;  2ASP A;  4K25 A;  4I9L A;  4BRA A;  4RWT A;  4AM7 A;  1KVA A;  3CM6 A;  2PZS A;  2YNG A;  3AVC A;  1DTQ A;  4MO4 A;  2VQE K;  4AF1 A;  3MCP A;  3SQ4 A;  4X64 K;  2I7N A;  2QA4 N;  2IOC A;  2QKK A;  1QHA A;  3N4P A;  3UKR A;  3SV4 A;  1S6Q A;  2A42 A;  1YJW N;  1D5A A;  4BRM A;  3OJS A;  3ZX3 A;  4CI6 A;  3F73 A;  3ULE A;  1B92 A;  5AZI A;  1C0F A;  4E3S A;  4BG9 A;  3A5M C;  3LM9 A;  3O9S A;  1RDB A;  3I33 A;  3CCM N;  1JL1 A;  2O8F A;  4ELU A;  4WFB L;  1L3T A;  4R5P A;  4FWP A;  3EY1 A;  3VQ5 A;  4OJR A;  4CK1 A;  2GWK A;  3MAQ A;  3R9P A;  1S1W A;  3VGK A;  4JI6 K;  3NVK A;  4AHR A;  4FJJ A;  1KRP A;  4BY9 C;  4CEC A;  1RFQ A;  1T6D A;  2ZQB A;  3CD6 N;  3G6E N;  2WC9 A;  3J80 O;  5AZJ B;  4FJX A;  1W9H A;  4EZ9 A;  3KK1 A;  1Q7Y O;  4WFN L;  3UB5 A;  1I39 A;  4FLT A;  1HRH A;  4PKG A;  2E2P A;  2Z1H A;  2ZD1 A;  3FZK A;  4BRN A;  5BPN A;  5AQX A;  4JKA A;  1WSG A;  2RE2 A;  1FK9 A;  2P9K B;  4WCE L;  1NLV A;  2Q0R A;  2QW9 A;  1JCG A;  3LAN A;  1P8Z A;  4J2A A;  3U6F A;  1BO5 O;  3FE1 A;  4OLA A;  1RT7 A;  5BRF A;  3HVT A;  2KHO A;  4M3Y A;  3OA9 A;  4E7J A;  1R0A A;  4FWQ A;  1GLC G;  4DTM A;  3ENO A;  3K2P A;  4B3M K;  4KHN A;  3AGK A;  2OPS A;  3VEO A;  2HND A;  5AZJ A;  1NU0 A;  3HPO A;  4LFA K;  1NGA A;  3T1Y K;  3MN6 A;  3WXM B;  5EVZ A;  2CGJ A;  5AQQ A;  4FJM A;  1CLQ A;  3E9O A;  1NMN A;  1NOZ A;  2KFN A;  4LSN A;  4CW7 B;  3ZET B;  1FKO A;  1RBT A;  4LH5 A;  4DR2 K;  4FJL A;  3AV9 A;  3T69 A;  2P9K A;  3QNN A;  4B9T A;  3N4Q A;  3NMU A;  3ZX0 A;  1TUY A;  4BR7 A;  3KK7 A;  1SL1 A;  4CZL A;  5JLF A;  4ILH A;  3RTV A;  2Q0U A;  1KAX A;  3VEY A;  3HOS A;  4C8L A;  1SL0 A;  3TAB A;  3QNO A;  3JSM A;  1S6P A;  3DLK A;  4CF0 A;  1X9S A;  1RNH A;  4OGE A;  2VG5 A;  3QO9 A;  3OHR A;  3SAG A;  2A40 A;  2H3G X;  2VGN A;  3BF1 A;  2YKN A;  4YOX A;  2FBX A;  4C8K A;  3V1Q A;  4Z4H A;  3ZET A;  3I0S A;  3O5B A;  1YI2 N;  2R7Y A;  4UQG A;  1NK4 A;  1QE1 A;  1VQ6 N;  5AQN A;  4E1J A;  4OPK A;  4DFK A;  3D7E O;  2B5J A;  3IDH A;  1QS4 A;  3R1X A;  3KLF A;  4IOC L;  1KC8 O;  3VQC A;  4DG1 A;  2UXB K;  4CZI A;  2PFU A;  4W5O A;  1ILY A;  3V6D A;  4E1M A;  3VER A;  4GV9 A;  4FYD A;  3U9Z A;  1OH5 A;  2GTD A;  4O44 A;  4O8U A;  4LD0 A;  3OBY A;  5GIO A;  4GVM A;  5I3U A;  2GX9 A;  3CXC M;  2X6N A;  3TSQ A;  2HHH K;  1WBD A;  5BPL A;  1L3U A;  3O9T A;  3M1F A;  4FZY A;  3M5R A;  1BA1 A;  3AVL A;  3MEC A;  4YFU A;  3CF5 L;  3OJU A;  2D0A A;  2P9I B;  4FLU A;  3PIO L;  1XMQ K;  3TTD A;  3FFK B;  3H45 C;  1MWK A;  4DWI A;  4FWK A;  5J2Q A;  4G1Q A;  3ZT2 A;  4H5T A;  4X62 K;  2V7Z A;  4BRE A;  5AQG A;  5AQU A;  3T1A A;  4BQL A;  3QFU A;  3HST B;  2O8D B;  4QS8 A;  2HBM A;  4FW1 A;  1JCE A;  3C7N B;  1RDW X;  4MDA A;  3IFR A;  3CYM A;  2ZF5 O;  4HHT A;  3DOL A;  1ASW A;  2P51 A;  1HLU A;  3T7Z A;  2P5G A;  1GLE G;  4CGG A;  1XWL A;  3NBP A;  4A59 A;  4JEP A;  4Z4F A;  3CCR N;  4OKE A;  4HUG A;  1HQU A;  1RDC A;  4H8K A;  3CG7 A;  3C65 A;  2D5R A;  4YDU C;  3L8B A;  2P9I A;  3O9R A;  1A5W A;  4KH4 A;  3OYI A;  1VK0 A;  5MLC Q;  4FVM A;  2FSK A;  5SWM A;  3QET A;  4BR2 A;  4ICL A;  4BE2 A;  2OZM A;  1BCO A;  5AQK A;  2NRV A;  2NRH A;  5M1Q A;  3PX0 A;  3PY8 A;  2O8D A;  3OYL A;  3C7N A;  2BDP A;  4DSK A;  3LPT A;  4RTF D;  4B9M A;  4MFB A;  5KGW A;  1NK6 A;  4KH5 A;  1SS6 A;  2GEM A;  2CH5 A;  3QEI A;  3AVG A;  3J7Z O;  3CMA N;  4FM0 A;  2Q1N A;  3CFR A;  4OX9 K;  2XY5 A;  3AVB A;  3R6M A;  4CGI A;  3Q7B A;  4B1W B;  2QM1 A;  3NH2 A;  3O6W A;  3V9U A;  4CJ4 A;  1T6C A;  4H0Y B;  4DR1 K;  3CIP A;  2GWJ A;  5AQY A;  3NF9 A;  2IIR A;  1WSI A;  4E19 A;  1C1A A;  3R3L A;  1NOY A;  1M90 O;  4AM6 A;  1E4G T;  1S1U A;  1J5E K;  5B8H A;  3QB0 A;  4B9Q A;  3NVM A;  4BG8 A;  3TR8 A;  2QWM A;  4DV0 K;  1CXQ A;  3WXI A;  3VET A;  3K58 A;  2X74 A;  1QQC A;  3NGZ A;  4WFA L;  4DUZ K;  2F7T A;  4BDY A;  4FL9 A;  4I6M B;  4PL8 A;  1Q82 O;  1SKR A;  3G10 A;  2NRR A;  4CFB A;  5LJV A;  2AA4 A;  1VQM N;  1IV0 A;  4K8X A;  3IMX A;  3CCL N;  1N5Y A;  4IFE A;  3ZSQ A;  4OO1 J;  5GAD P;  3RSE B;  3QBX A;  1VQP N;  2PY5 A;  4KHQ A;  1RBV A;  3DLL L;  5J2P A;  2FC0 A;  1S1X A;  4I2Q A;  1K73 O;  3EL2 A;  3O4N A;  2E2Q A;  4DFM A;  2VYP A;  4DV3 K;  1KVB A;  5LMN K;  3A5N C;  3WT0 A;  1REV A;  1RCH A;  4GVE A;  4CJ7 A;  3MN7 A;  4I6M A;  1KQS M;  3VMF B;  2ASO A;  1T44 A;  3DOK A;  3MEG A;  5DMR A;  4YOV A;  1VQ5 N;  2A41 A;  1BA0 A;  4JYA K;  3MWP A;  2DY4 A;  3SPZ A;  3VQE A;  4QS7 A;  4WQ5 A;  1HKC A;  1WSF A;  2D0B A;  4IJN A;  4CZM A;  4BDZ A;  4BRP A;  4U67 L;  1ZYQ A;  3SNN A;  3RSE A;  3DRP A;  4B1X B;  1WAJ A;  1OKJ A;  4ELT A;  2F9W A;  5FRM A;  1WSE A;  5AQL A;  5HLF A;  4PUO A;  1MU2 A;  3ZYY X;  1JLC A;  3I8D A;  5JVH L;  4CFC A;  1GLF O;  3QIC A;  1HR0 K;  2WON A;  1QQO A;  1U45 A;  3G71 N;  4N76 A;  3CQX A;  5JLH A;  1Q9X A;  4DTJ A;  2VQF K;  3KVG A;  4CGH A;  1ESV A;  3VQ8 A;  4F3O A;  4K43 A;  4RW7 A;  2BAN A;  3SBT A;  2Y1J A;  3ATV A;  1EO1 A;  4DSJ A;  1NJW A;  3O3F A;  1ZBS A;  1YAG A;  3KKR A;  5M1P A;  4ZHR A;  3KZB A;  4ISG A;  4V19 S;  5E41 A;  1I94 K;  1JCF A;  3A0I X;  3GBT A;  5EU7 A;  2HBK A;  4M45 A;  4M42 A;  4JI7 K;  4CFA A;  1W7A A;  1FW6 A;  5F1X A;  1FJG K;  1DGK N;  1XHZ A;  4PQU A;  3HZ6 A;  2AJQ A;  1DT9 A;  4DV7 K;  2Z1J A;  5AQJ A;  2XY7 A;  2A1R A;  1QHT A;  3AO3 A;  4HCC A;  3D2F B;  1KAY A;  3CCQ N;  3LP0 A;  5EX5 A;  3SQ1 A;  2HNZ A;  3AVN A;  3DMJ A;  2OAN A;  4KO0 A;  3HT3 A;  1IG8 A;  3DXM B;  5FPE A;  3ZSW A;  4CVN E;  3MX5 A;  3MX2 A;  5DM7 L;  4QOZ B;  3OS0 A;  4PHT X;  1A5V A;  3WEE B;  1NGJ A;  3HTV A;  4JD2 B;  4FZX C;  3O8M A;  1RDU A;  4G9Z A;  3QEW A;  3LP2 A;  3D2F A;  4GKJ K;  3VF2 A;  1BQM A;  3RRG A;  2X6S A;  4BQZ A;  3DXM A;  3S3M A;  1J53 A;  2FSJ A;  3O3G A;  1OH7 A;  3DXK B;  3H1Q A;  1NM1 A;  3SMP A;  1KD1 O;  3S3O A;  2HVH A;  3CQY A;  1EWQ A;  3EN9 A;  4CZK A;  3M3Z A;  4J2B A;  4YOW A;  1C0M A;  4O4G A;  2O8E B;  5JS1 A;  3WEE A;  5C12 A;  3VQ6 A;  3NGI A;  4DFP A;  4GY2 B;  4BRO A;  2E88 A;  2Q3S A;  4JD2 A;  4W5T A;  4LC9 B;  4RW6 A;  2HST A;  4DF8 A;  2HHW A;  1NGG A;  4CEB A;  4FK0 A;  3QEX A;  1TK8 A;  1NNE A;  1GLJ O;  4HUF A;  2FBV A;  1IBK K;  3ZSX A;  3DXK A;  3VQ4 A;  2HB5 A;  1C0T A;  2A6A A;  4DCH A;  3CC4 N;  3ZX2 A;  1CZB A;  4H0V B;  1L3S A;  5T7B A;  2O8E A;  3CFO A;  3HSC A;  1D9D A;  3NH1 A;  2QKB A;  3HI0 A;  4FWM A;  3ISN C;  2V51 B;  2ZJR L;  4DTP A;  1K9M O;  5FRN A;  2W6K A;  4UY8 O;  3ENH A;  4PL7 A;  4JAX A;  2JGU A;  3ENB A;  3VF4 A;  3NF7 A;  5I42 A;  1EKE A;  1HJO A;  2UUB K;  4IKF A;  4PA1 A;  3ZT3 A;  5M1K A;  4MO5 A;  4DV1 K;  3CJ7 A;  4DLE A;  1NGE A;  1KSP A;  4JI0 K;  3NF6 A;  2YJE A;  5AQV A;  2UXC K;  4O55 A;  1B9D A;  4Q5V A;  4FJI A;  3NE6 A;  1TAQ A;  2KZM A;  3EE8 A;  1XC9 A;  4BRG A;  1RBU A;  4M3U A;  5KPR A;  1T05 A;  3NDK A;  4A5A A;  3E1Y A;  2P9N B;  2RF2 A;  3LPU A;  2BTF A;  5AQR A;  4DS5 A;  5GIN A;  1TKD A;  1J6Z A;  2JWK A;  4CJF A;  2OYQ A;  4DR4 K;  1NJY A;  3CCJ N;  3W3D A;  4AIL C;  1WLJ A;  1T8E A;  3O9Q A;  3QFP A;  1Z26 A;  3DRR A;  1WUA A;  1HNX K;  4WE1 A;  4CIE A;  4AHT A;  3S41 A;  3QIO A;  1XUP O;  1NK8 A;  3WNE A;  4IJA A;  3RMA A;  4KHU A;  3S9H A;  3VQP A;  3AAP A;  1Y97 A;  5D3G A;  1J9A A;  1YUW A;  1GLL O;  1S1T A;  1WSH A;  2P9N A;  3WXJ A;  3G4S N;  1L5U A;  2E1Y A;  2P9S B;  4CHN A;  4CBU A;  1UA1 A;  3R8E A;  1RT1 A;  4JKD A;  3F9M A;  5LJW A;  1HNW K;  4H4M A;  4F8R A;  1CZ9 A;  2Q97 A;  4XH5 A;  4KI4 A;  4F2R A;  2YHY A;  4CEQ A;  4FJ5 A;  3ZSZ A;  1UA0 A;  3ZSY A;  3J8A A;  3P4I A;  1D8Y A;  3HPG A;  1SZ2 A;  1TGO A;  1RDD A;  2UYT A;  3V1R A;  4BC5 A;  3BUZ B;  1KFD A;  1QSS A;  3TAN A;  4C8M A;  2E6M A;  3DJC A;  4W5Q A;  4C1N I;  4F4K A;  2IAJ A;  4J2D A;  1BG3 A;  1YTU A;  4IBN A;  3OBW A;  3THX B;  3MK6 A;  2ASM A;  4BRI A;  2NZT A;  2P9S A;  2D0P A;  3LAK A;  4BRF A;  5AQS A;  4DB3 A;  2HF4 A;  4FJ7 A;  2YJF A;  4C23 A;  2WTU A;  2OZS A;  1Z05 A;  2KTQ A;  2HMP A;  4CHY A;  4ZTJ A;  3ZSV A;  2IC3 A;  1XMO K;  2YCH A;  3DYA A;  4JI1 K;  1WAF A;  4CZF A;  3ZSO A;  4KFB A;  4NCG A;  4GMJ B;  3CCU N;  3NFA A;  3OVN A;  3MXJ A;  4W5N A;  1QZ5 A;  2P9L B;  3T3F A;  4IG3 A;  3RR8 A;  4FWR A;  2ETJ A;  3AO5 A;  4RW8 A;  3AAQ A;  1YF5 L;  4EIA A;  3THX A;  2RPI A;  2A1S A;  3OYN A;  2BGG A;  1X9M A;  1DEJ A;  1VRT A;  3LP3 A;  4BWM A;  1E4F T;  3SK3 A;  4DQR A;  4JV5 K;  1IBM K;  4MLH A;  5C24 A;  1RT4 A;  4FWL A;  4CIG A;  3C6U A;  4IFV A;  1N34 K;  3HJF A;  5GAH P;  1TK5 A;  2NRZ A;  1GLA G;  3VEN A;  4AHU A;  4EP5 A;  5J2M A;  4I9Q A;  4PKI A;  4CJV A;  4AHS A;  4BC2 A;  2P9L A;  2UXD K;  2DFF A;  4O0I A;  3DLE A;  1ATN A;  4GV3 A;  1JXE A;  4WF9 L;  4E1N A;  1KTQ A;  2E5L K;  1NWK A;  3KIO A;  2CGL A;  1VAZ A;  3AVM A;  2YX6 A;  5LMU K;  4DR7 K;  3LWL A;  3AA3 A;  1LOT B;  3LZJ A;  3KD5 E;  2YV0 X;  1SKS A;  4YHH K;  3VA0 A;  1RT5 A;  4BWJ A;  3KD1 E;  4DR6 K;  3OYK A;  1HYZ A;  3AVA A;  3FZM A;  3BZC A;  2F8S A;  4B3O A;  4C8N A;  2WFB A;  4BRK A;  5HRP A;  5KRT A;  5JIC A;  1TL1 A;  1NK9 A;  4FOE A;  1BU6 O;  3D45 A;  3SV3 A;  4CZG A;  4CHO A;  5FRO A;  3O08 A;  2XO7 A;  4H0T B;  5AFU H;  2HHV A;  2VWB A;  3TU5 A;  2D0C A;  1RBR A;  4HVJ A;  4E7I A;  4KI6 A;  1LV5 A;  3TAM A;  3EYZ A;  4A2B A;  2BUP A;  4FJ8 A;  1GOC A;  3O1B A;  2UU9 K;  2O4G A;  1O1W A;  4BVO A;  1VQ9 N;  5K14 A;  5BR9 A;  3MN9 A;  4LF6 K;  4DTN A;  3JAM O;  4CJR A;  3CET A;  3H08 A;  4HWI A;  1R59 O;  3L2W A;  5LL6 Z;  3OYA A;  4JKF A;  4Y1C A;  4AH9 A;  4L8R B;  1D9F A;  1C1C A;  4WQ5 C;  3Q7C A;  1U49 A;  4ID5 A;  1XI1 A;  3FZL A;  1U48 A;  4FVU A;  3GL1 A;  4M41 A;  4JKH A;  4CES A;  4LF5 K;  1K6Y A;  1IO2 A;  1JLE A;  2QWO A;  3K0S A;  3AVF A;  1SUQ A;  2G8U A;  5HP1 A;  5KQ8 A;  5DM6 L;  4EFH A;  4JK7 A;  1IKV A;  5KGX A;  1HNZ K;  3O1W A;  3THV A;  2EHG A;  4W5R A;  4FSV A;  4A5B A;  2DFH A;  3H3N O;  4H0P A;  4B1V A;  5M1N A;  4L3Q A;  2Y1I A;  4H4O A;  3ITH A;  1C1B A;  2FBT A;  3ID6 A;  4DTU A;  5AQM A;  3P5J A;  4FXD A;  1W2B M;  1HPM A;  4CHP A;  4HTL A;  1JLF A;  3BF3 A;  4BRL A;  4CE9 A;  4CJW A;  4NYF A;  2ATQ A;  3K5L A;  1ZXO A;  2YKM A;  4CEF A;  1IH7 A;  3THY B;  4Z0U A;  5DK5 A;  1IKX A;  4XIU A;  3DLG A;  2FF6 A;  4KHW A;  3AO4 A;  1YIJ N;  5TKW A;  4B3S K;  5C25 A;  5BRH A;  2ITM A;  2P9P B;  4ILJ A;  1OH6 A;  1UOC A;  4Q0B A;  1HYV A;  1RIL A;  1Q9Y A;  4OVL A;  3CER A;  3TAF A;  1BIS A;  3K9K A;  4BDP A;  4DV5 K;  2KLA A;  3A2F A;  1I3A A;  2NRW A;  4FJK A;  4DQI A;  3V9Z A;  1QZ6 A;  2IVN A;  3ZLJ A;  2EX3 A;  4DU4 A;  3VQA A;  2ZGY A;  2NRX A;  2KFZ A;  3OS2 A;  1NKB A;  2FXU A;  3CJ1 A;  3IUC A;  5KTQ A;  3THY A;  1MDU B;  2WOM A;  3ZSR A;  1RBS A;  4JLH A;  2HHQ A;  3QEV A;  2KKZ A;  5HOO A;  2ZJP L;  1NMD A;  2PAV A;  4BR4 A;  4KHP K;  1BOT O;  1JJ2 M;  1Z6R A;  3E9P A;  2P9P A;  1SQK A;  1DTT A;  3PSF A;  3CCV N;  5IWA K;  2HHT A;  1KLN A;  4DSI A;  1EP4 A;  3OY9 A;  4ELV A;  1X3N A;  4YOU A;  4DTR A;  1VQN N;  3D2E B;  3VQQ A;  2CH6 A;  3LDQ A;  4O5F A;  5KI6 A;  2QXF A;  1FXX A;  1BUP A;  1QVG M;  1QQN A;  1RT3 A;  5KPZ A;  3OYB A;  4NXN K;  4KTQ A;  2HNY A;  3AVI A;  5TKY A;  4FOI A;  3KTQ A;  3V4I A;  5AQH A;  5C0Y A;  4DF4 A;  1YVN A;  1ZBU A;  2YHW A;  4CED A;  4PWD A;  4BC4 A;  3CHW A;  3ID8 A;  2F8T A;  2P5O A;  4YOT A;  3TI0 A;  4QAG A;  3KHY A;  5BR8 K;  2BE2 A;  1RT6 A;  4N56 A;  3IKM A;  1XC3 A;  5BN9 A;  4JKB A;  4CD3 A;  1F21 A;  2V7Y A;  4CBX A;  4EHT A;  3VPZ A;  2WBN A;  1WN7 A;  3D2E A;  1KXP A;  4MQ3 A;  4BGA A;  5KPT A;  3PX6 A;  3K57 A;  1TL3 A;  4CJL A;  3U3G A;  1UAX A;  2OTJ N;  1HPZ A;  4LFB K;  4FW2 A;  4DU3 A;  4YNQ A;  4BRC A;  4GNI A;  1QVF M;  3DI6 A;  2CGK A;  4K42 A;  4B9S A;  3LP1 A;  5BRD A;  3CJ9 A;  4Y1D A;  4FJG A;  4JK8 A;  3EZW A;  4DV6 K;  1H1V A;  2OA8 A;  3ATU A;  3L3U A;  1V4S A;  2FBY A;  4FPB A;  1QTM A;  1RDA A;  1WNS A;  4O5B A;  1B9F A;  4H5R A;  4F3T A;  1NBW A;  3HYF A;  4CF1 A;  4IEE A;  2E2N A;  4DV2 K;  1SV5 A;  4LF7 K;  4BRD A;  1IG9 A;  3VOV A;  3GDQ A;  3L2V A;  1VSM A;  3CJC A;  4FCY A;  1TKT A;  3RMB A;  1RTJ A;  5E84 A;  4FLV A;  3LZI A;  3TWH A;  4J8F A;  2NRT A;  4JRP A;  3VA3 A;  1BI4 B;  3FGU A;  5KQD A;  3CME N;  2IVO A;  3AAR A;  4NCA A;  2QK9 A;  3VQB A;  4OPH A;  4H0X B;  3T1H K;  2V52 B;  4BR9 A;  2OPR A;  2A3Z A;  4BGB A;  1NKC A;  2IGI A;  3H1V X;  4OLB A;  3I0R A;  3IS9 A;  3SBG A;  3CI5 A;  1T7P A;  4QCL A;  4E7K A;  4B1U B;  4IZ9 A;  2IDO A;  1V4T A;  4DUY K;  3LDP A;  3NF8 A;  1VSJ A;  3ZT1 A;  2HW3 A;  3AVH A;  5A2Q O;  3HPH A;  3DAW A;  3LAM A;  1BL3 A;  3G0Z A;  1S72 N;  1S1V A;  4IFY A;  4EAH D;  3JYT A;  3K59 A;  1TYQ B;  4BR5 A;  4BRH A;  3OYH A;  4DTS A;  1HQE A;  1LW0 A;  1IKY A;  1BI4 A;  4E7L A;  4LF4 K;  3HM9 A;  2GUI A;  3L4I A;  3M6G A;  2HF3 A;  4DHY A;  3L6Q A;  1KVC A;  4Z4I A;  4KB0 A;  4HCB A;  3C6T A;  1HKB A;  4CD1 A;  4CZJ A;  5HRS A;  1ZC6 A;  2F9T A;  3FR0 A;  5JVG L;  3RMD A; 
#chains in the Genus database with same CATH homology
 4X66 K;  4CVN E;  2VQE K;  2UUB K;  4DV1 K;  4X64 K;  4LFB K;  4B3R K;  4X65 K;  1XNQ K;  4DV3 K;  5LMN K;  4JI0 K;  4B3S K;  4JI3 K;  4JI2 K;  2UXC K;  1XMO K;  4DV6 K;  4JI1 K;  4JYA K;  2UU9 K;  4DV5 K;  4DV4 K;  1N32 K;  4GKK K;  4LF6 K;  4GKJ K;  3JAM O;  4B3T K;  1N33 K;  5LL6 Z;  4K0K K;  4JI4 K;  4DR4 K;  3J7A P;  4JI6 K;  4DV2 K;  4LF7 K;  4OX9 K;  4NXM K;  4JV5 K;  1IBM K;  1XNR K;  1HNX K;  3J80 O;  4KHP K;  4DR3 K;  4DR1 K;  1HR0 K;  2F4V K;  1N34 K;  2UXB K;  4JI8 K;  3T1H K;  4LF5 K;  2VQF K;  2UUC K;  5IWA K;  3OTO K;  1J5E K;  2UXD K;  4DUY K;  5IT9 O;  4LFC K;  4LF8 K;  2HHH K;  2E5L K;  5A2Q O;  1HNZ K;  4DV0 K;  3J81 O;  2ZM6 K;  1HNW K;  5LMU K;  4DR7 K;  4NXN K;  1N36 K;  1IBK K;  4DUZ K;  4V19 S;  1XMQ K;  1I94 K;  2UUA K;  4B3M K;  4JI7 K;  1FJG K;  4YHH K;  4AQY K;  4X62 K;  4LFA K;  4DV7 K;  3T1Y K;  4LF4 K;  4DR6 K;  4DR5 K;  4JI5 K;  5AJ3 K;  4YY3 K;  5BR8 K;  4LF9 K;  5FLX O;  3J7Y P;  4CW7 B;  1IBL K;  4DR2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...