3AO5A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
135
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
total genus 49
structure length 135
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao5A00
4C8LA 4FLVA 3KLIA 3OS1A 1NOZA 2Z1GA 3ITHA 4HHTA 1BQMA 4FW2A 2VG7A 4L8RB 1ZBLA 1TV6A 4FLXA 3SQ2A 2BANA 4CJVA 4FVMA 2EX3A 1TGOA 3AVLA 4O5BA 3SQ1A 3LWLA 1KRPA 4DMNA 1XHZA 1D9DA 4FXDA 1ASVA 1A5WA 3AV9A 4AHTA 4CHPA 4HUGA 4DS5A 4B9SA 1LWCA 2XRIA 1FK9A 1Y97A 3AVGA 1WSFA 1RBTA 3K2PA 2X74A 4DTPA 2P51A 3ZT1A 1ZBUA 4PA1A 4GVMA 4C8NA 4FJJA 1C0UA 3DM2A 3HT3A 1S9EA 4BE2A 4E7KA 4KKOA 4IFVA 4E0DA 1Q9YA 3ZSXA 3L2UA 3VA3A 4CECA 3OYEA 3AVMA 3NCIA 4FJHA 1EP4A 3OS2A 4EZ6A 3V4IA 3RMCA 3SZ2A 1N5YA 1B9FA 4AHCA 3VQ7A 4E7IA 2Z1IA 1U48A 3OVNA 1VRUA 4DS4A 1JKHA 1FKPA 4CJUA 4FZYA 3DOKA 3O3HA 2P1JA 3JYTA 3NBPA 3SJJA 2G8FA 5SWMA 3AA3A 3AVNA 3MECA 1NJZA 1HPZA 3MXMA 4CK1A 4WE1A 2YKMA 3NH0A 3KKSA 1RILA 1RCHA 3S3MA 5EU7A 3OJUA 2X6SA 5J2QA 2NUBA 3V9UA 4KV8A 1IKYA 1VSIA 1KLNA 1REVA 4K8XA 4M3YA 4HTUA 1VSMA 2D0BA 1GOBA 1W0HA 2HNYA 3KK1A 2HVHA 1TAQA 3NFAA 4DU3A 1RDAA 3HXMA 3TAPA 3LZIA 4B9VA 3NGYA 4M41A 3NE6A 4CEOA 1YTUA 3G10A 1JLQA 3QLHA 1QSLA 4I2QA 4RG8A 4ELTA 1S5JA 3U3GA 4CJRA 3LZJA 3HP6A 2XY6A 3IG1A 3QIPA 4O44A 1NK4A 4N76A 1HQUA 4ZTFA 4KHQA 1HYZA 1WLJA 1VSKA 1T05A 2KW4A 5CZ2A 4C8MA 2G8HA 4DQPA 1S6PA 1UA1A 4ELVA 1CLQA 4IG3A 4DSEA 5FDLA 3TR8A 3SPZA 3B6PA 4FLYA 1F21A 2HNDA 3TAFA 3AO5A 4J2AA 3HSTB 4CHQA 1GOCA 1NKCA 1I3AA 1YTAA 3DLKA 4O0JA 4YFUA 4XIUA 3K5NA 3QETA 2Y1IA 3AVIA 4KTZA 1Z25A 3OYDA 4HVJA 1U4BA 3DRSA 1ASUA 4B8CA 3IRXA 1RDCA 4B08A 3LDSA 4CIFA 1NK0A 3KK2A 3K5LA 1D8YA 2G8KA 1BCMA 3M8SA 2FBXA 1MU2A 4RW8A 5E41A 4DQQA 2XO7A 4OLAA 1HNVA 4CEQA 1DLOA 4KHNA 3ZT2A 4FK2A 4IKFA 2HHUA 3V1OA 3WNHA 4YNQA 3B6OA 1Z26A 4CGFA 1RTDA 1HNIA 4M3WA 3V1RA 4J2DA 4OGCA 4PQUA 2VWJA 4OJRA 3AO2A 1L3UA 1IG9A 4LH4A 1VK0A 3K5MA 1U04A 1VSDA 4CHNA 3ZSWA 4BWJA 4BDZA 2GUIA 3TAGA 2IAJA 2OYQA 4DQIA 2P5OA 1WAJA 4G1QA 3PX6A 4CJEA 1WSJA 3T19A 3TARA 3VQ9A 4QCLA 4DQSA 3CFRA 1XWLA 4M3XA 3T1AA 2E4LA 5HRSA 3ULDA 4FJMA 5HRNA 3F73A 3VQ4A 3V6DA 1NKBA 4LY7A 1RT2A 4CK2A 4N41A 1VSFA 4M45A 1TKTA 3NHGA 4IDKA 4LSNA 1KVBA 3AA2A 3G0ZA 4DU1A 1KLMA 4CEDA 2QKKA 4K8ZA 4CGJA 3K5OA 2HHXA 3RTVA 3HK2A 1LWFA 1VSEA 1SKWA 5CZ1A 2VG5A 4W5QA 1Q9XA 3TABA 3SUOA 3THVA 2G8WA 4KREA 1S1XA 4CEFA 2OPQA 3T3FA 3KLHA 3PX0A 2PY5A 3UIQA 1WSGA 4F3TA 1RTHA 4LSLA 5HRPA 1RDDA 3DRRA 4GMJB 4B9LA 5SZTA 2KQ2A 3I8DA 3TAEA 3TANA 4R5PA 4AILC 2IGIA 1ZBHA 2G8IA 3EYZA 3LPTA 4CEAA 4DTSA 2OZMA 3PX4A 3L8BA 4KTQA 1C6VA 4ICLA 1CZ9A 2XY8A 1EXQA 3NH1A 2XY5A 3L2WA 3P83D 4B9NA 1UOCA 2RF2A 5K14A 3KD5E 4DFMA 1JLCA 2GV9A 3VQ6A 4DG1A 3EY1A 2Y1JA 3ASMA 1D9FA 1TL3A 2E6MA 2YV0X 4FM0A 1NJWA 2F8TA 3DLEA 2X78A 4CF8A 1WSHA 1RDBA 3O4NA 3SV4A 4PY5A 1LWEA 3U6FA 1J5OA 4DTXA 4KB1A 1ZBIA 3HVTA 2B4JA 3ALYA 4I9LA 1B92A 4FLZA 3KLGA 4MQ3A 1FXXA 2PYJA 4JS5A 1JXEA 3KD1E 1NK5A 2F8SA 4CHZA 3K57A 2WOMA 3OYMA 5HP1A 1TAUA 1HJRA 1BI4A 2D0CA 3LP1A 3VQCA 3QINA 4RW7A 3OYAA 1T03A 3RR8A 3M8PA 4F3OA 2QK9A 3NGIA 2VG6A 1X1PA 4H4MA 3HO1A 2FBVA 2ATQA 4RW4A 1UWBA 5HRRA 4Q0BA 4KHUA 3FFIA 2P5GA 4NCAA 1B9DA 1JL2A 1S6QA 4N5SA 3L2VA 1SKSA 3ZCMA 4CEBA 4OVLA 3OYCA 5HBMA 4B8AB 2HHVA 1LV5A 4KHSA 2Z1HA 3ZSYA 3SYZA 4DLGA 1JXBA 1WAFA 5CYQA 4CJSA 3H08A 1NK7A 4HUFA 3DMJA 2RN2A 4CE9A 4ZHRA 4CJPA 2D5RA 3LALA 4M3RA 3OYLA 3OYKA 1YVUA 2HW3A 4HUEA 4HCBA 1QE1A 4FJ7A 3V81A 4DSIA 3MAQA 2ETJA 1CZBA 1RBVA 2FC0A 5CY4A 3OS0A 3VQBA 4DLEA 3RMDA 4B9TA 3AA4A 2YHBA 4IG0A 3AO4A 3AVKA 4DF4A 3HPHA 4CF0A 4OKJA 5C42A 4ELUA 1S1WA 1VSJA 4J2BA 2LSNA 4DSLA 3KLFA 4Z4EA 3DLBA 3WNEA 2XHBA 3I0SA 4DTOA 5FRMA 2W42A 1U49A 2VWKA 1HQEA 3D0PA 1C0TA 3IS9A 3HL8A 1QTMA 1NK8A 1WSIA 3QEIA 4QOZB 1BIUA 4B9MA 4DTMA 2RKIA 3OYIA 3AO1A 4AHRA 2BDPA 3IAYA 3DYAA 2HHSA 3AVBA 1RTJA 2HB5A 4C8OA 3HPGA 4CGDA 4CK3A 2A1RA 1J53A 3RWUA 4OPKA 2G8UA 5JS1A 4FJGA 5KGXA 4EP5A 3D45A 4CIGA 4B9UA 3MXJA 1W9HA 3CM6A 3LP3A 4MFBA 2ZE2A 4JRPA 2EHGA 2HHWA 1DTTA 4CESA 3TI0A 3QEVA 4KI4A 2F96A 4CEZA 3OJSA 5T7BA 4DWIA 3ZSQA 4KI6A 2ITGA 1RT7A 4O0IA 4FLWA 4CERA 3S3NA 1L5UA 1CXQA 2KZZA 1Q8IA 1ZBFA 1ASWA 3AO3A 2R7YA 4PUOA 4W5NA 1XC9A 2B6AA 4DFPA 3SV3A 1NJYA 3AVFA 3DI6A 1N6QA 4Z4FA 5KGWA 1IKWA 3S9HA 2XY7A 3VQDA 4DF8A 2KZMA 1RT1A 4KFBA 4M42A 4O55A 2FBYA 3DRPA 3ZT0A 1RBRA 1BCOA 4Z4CA 3VQEA 4M3UA 3RRHA 1SV5A 4GW6A 1BL3A 4CJLA 1KVCA 1SL1A 1BI4B 3KLEA 4CGIA 3AVAA 2A1SA 3BGRA 2Z1JA 3WNGA 4CFAA 4FCYA 4W5TA 3A2FA 1XHXA 2OPPA 2PZSA 2PYLA 4HCCA 5HROA 1TK8A 5DMRA 1RNHA 1GOAA 3CYMA 3MEEA 2YNGA 1JLGA 3LAMA 4W5RA 4JS4A 2HVIA 1WSEA 1BIZA 3V9SA 4E7JA 4NCGA 3SPYA 1RT6A 1TKZA 3LP2A 2OA8A 3RRGA 4OLBA 1TVRA 2DFEA 4Y1DA 3C6TA 1G15A 5KRTA 1YT3A 3C94A 4UQGA 1O1WA 4FLUA 1JLBA 3TWHA 3RR7A 4FYDA 1EX4A 2GBZA 4OGEA 4OPJA 4B3OA 4CF1A 3HM9A 4DTRA 4M3ZA 2QKBA 1UAXA 3CG7A 1NKEA 1IKVA 3I0RA 3JSMA 2Q3SA 4NYNA 1A5XA 4BE1A 3HPOA 3TAQA 3PV8A 3DLGA 1TK0A 4FZXC 3L2RA 1TK5A 2HHTA 3AVHA 1RT3A 3NF7A 4F2RA 3VQ8A 5J2PA 3PO5A 3VQQA 1QQCA 1JLEA 1JLFA 4W5OA 5J1EA 4F8RA 4FJIA 3OYFA 2WONA 1I39A 3NGZA 4I9QA 1JL1A 3ZT3A 3S3OA 4AHSA 1KSPA 5HLFA 4LH5A 4F2SA 3HJFA 2O4IA 2JGUA 4O4GA 3AVJA 3PUFA 4Y1CA 3SUPA 4TSXA 2G8VA 1NK6A 2I5JA 1BHLA 1TKXA 3P5JA 4N56A 2ZQBA 1C1AA 3C6UA 3VN5A 3HVRA 3SUQA 1X9SA 1KVAA 4BDPA 4CIEA 1RBUA 3SQ0A 2ZD1A 4NCBA 4E1NA 3QERA 1QHTA 5C25A 1S9GA 4KHYA 4FW1A 1CXUA 3L3VA 4CEEA 4KAZA 5FRNA 1IKXA 4Z4IA 4ID5A 1LAVA 1EKEA 4FJLA 1SKRA 3NF9A 4KTWA 1KCFA 1RT5A 2D0AA 3ZSVA 1X9WA 4OKKA 1WN7A 2O4GA 2B5JA 3K58A 2JLEA 2BGGA 4CJ3A 4DFJA 4AH9A 4E7LA 3PO4A 3QEWA 3EZ5A 4J2EA 1KTQA 4Q5VA 3QNOA 1A5VA 4F4KA 1NOYA 3CQ8A 4DU4A 1HMVA 3VQAA 4DSKA 4FZZA 2FBTA 3V9WA 4Z4GA 4CJ4A 1FKOA 5KI6A 1L3TA 2HHQA 4KB0A 3QEXA 4FJXA 3QESA 1BGXT 4LD0A 4JRQA 4PWDA 5KTQA 1C0MA 4CFCA 1TKDA 3LAKA 4JLHA 4FLTA 3SUNA 1EETA 2YHAA 3QIOA 4CJKA 1NK9A 4ZTJA 1IO2A 3LPUA 3VA0A 4CJFA 4OKEA 1IH7A 4DTNA 1SUQA 4AHVA 2X6NA 3E01A 4RW9A 1SL0A 1RT4A 3OYNA 1S1VA 3OYGA 1SL2A 2DTUA 2IOCA 3MXIA 1NJXA 5I42A 5JS2A 3KIOA 3CFPA 3RMBA 4E1MA 2QXFA 4KO0A 2KFNA 2AJQA 2OPSA 3NH2A 1U45A 3BDPA 4FJ9A 1S1UA 2IDOA 3V1QA 2YNIA 1S1TA 3ZSOA 3V9ZA 4NYFA 1HYSA 4Z0UA 4QAGA 1QS4A 3M8RA 4ID1A 5CYMA 4AHUA 1XI1A 4CJQA 4DSJA 2OZSA 4DSFA 1TL1A 1VRTA 3VQPA 3O3FA 1HYVA 3AA5X 1KFDA 3QNNA 3OYHA 2BE2A 3V9XA 1L3VA 4RW6A 3MEGA 1LW2A 4DTUA 4CHOA 5J2NA 4CF9A 1LW0A 4BWMA 1R0AA 4CCHA 1ITGA 3HP9A 4CGHA 3L2QA 4FK0A 3NF6A 2HNZA 3O4QA 4DTJA 1K6YA 4C8KA 2KFZA 3ZSRA 1HRHA 1L3SA 1J9AA 3RMAA 3OYBA 3SCXA 1C1BA 5KRSA 4FJ5A 4BACA 1BISA 3LP0A 3KK3A 5C24A 2DY4A 1ZYQA 5FROA 2YNFA 1D5AA 3SQ4A 1J54A 5J2MA 3WNFA 3KTQA 3QEPA 2YNHA 3O3GA 5I3UA 4EZ9A 3CFOA 3QO9A 3TAMA 4N47A 3ISNC 5DK5A 4CJWA 4E89A 4FM1A 2KTQA 4BDYA 4KPYA 4FJNA 2E6LA 4FM2A 1QSSA 2IC3A 3DLRA 1X9MA 4CGGA 1T7PA 3ZSZA 2IS3A 3C95A 4H4OA 3DLHA 3NF8A 3SI6A 4M3TA 4FK4A 4IFYA 3PY8A 4CF2A 3LANA 4I2PA 3NDKA 3F9KA 1JLAA 4DFKA 1UA0A 3MEDA 3L3UA 1QSYA 1KFSA 3ZT4A 1RBSA 3U3YA 2RPIA 2OPRA 4CFDA 4E19A 1WNSA 4CJTA 4Z4HA 4H8KA 3K59A 1RTIA 4DQRA 4FJKA 1VSHA 1C1CA 1BQNA 4KHWA 2DFFA 3LWMA 4E3SA 1DTQA 3OYJA 4FJ8A 3OY9A 5D3GA 2YKNA 3VQ5A 4EP4A 1VSLA 1U47A 4BE0A 4I7FA 3SNNA 3M8QA 2HMIA 3CM5A 4IBNA 4E7HA 3KKRA 1LAWA 3DOLA 3KJVA 2DFHA 3HYFA 1T8EA 4KRFA 3AVCA 3P1GA 3NAEA 4CHYA 4CFBA 4CJ5A
chains in the Genus database with same CATH superfamily
3QICA 5EX5A 4FLVA 4FOIA 2Z1GA 3P39A 2NRHA 3DXKA 1TV6A 3ENOA 3SQ2A 4CJVA 1TGOA 3AVLA 4O5BA 4FVUA 1D9DA 3AV9A 4X65K 4HUGA 4DS5A 1LWCA 2XRIA 4HTLA 4OPAA 4A62A 3MN7A 5M1KA 3HT3A 4BE2A 2Q36A 3CERA 2WBNA 1Q9YA 4CECA 3NCIA 3OS2A 3RMCA 1N5YA 3VQ7A 1VRUA 3QB0A 4DS4A 4WFBL 4MDAA 4FZYA 1ATRA 3O3HA 2P1JA 3JYTA 3NBPA 2G8FA 1M1KO 3O1BA 1NJZA 3GE1A 3HM8A 3OJUA 3FZHA 3V9UA 5BRFA 5FLXO 2O8BA 4HTUA 2D0BA 2HVHA 1GOBA 3KK1A 2F4VK 1YHQN 3NFAA 3CIPA 3NGYA 2P9SA 4I2QA 2E1YA 2PFUA 4ELTA 5C10A 3QIPA 4CZKA 4KHQA 4ISEA 3DJCA 3J80O 2KW4A 5CZ2A 4A59A 4C8MA 3VTHA 4DQPA 4C1NK 4IG3A 5FDLA 2P9UB 3U9ZA 1VQ8N 3AO5A 4J2AA 4CHQA 1NKCA 3QETA 1BO5O 3QMLA 2UUCK 5GAGP 3DXKB 4B08A 4CIFA 4BRMA 3KK2A 4JKFA 1MU2A 4RW8A 3NVKA 1DLOA 2QWMA 3WNHA 1Z26A 1RTDA 4JK8A 4QS7A 4M3WA 4J2DA 4JI5K 4PQUA 4LH4A 1U04A 5F1XA 3T69A 3PX6A 4CJEA 5AQMA 4QCLA 2J4RA 2GTDA 3NVMA 4KH5A 2CGLA 4M3XA 4O5FA 5HRSA 3ULDA 3VQ4A 4IZ9A 2ASMA 4LSNA 5EVZA 3WUHA 2QKKA 3IDHA 1Q81O 1Q9XA 2CH6A 1J6ZA 3TABA 3THVA 3K9JA 1S1XA 2E8AA 3VESA 2P9SB 2OPQA 4FSVA 1NGAA 3UB5A 4YOTA 4BRDA 1RTHA 1OH5A 3DRRA 4B3MK 4GMJB 1VQ9N 2KQ2A 5AQJA 3TAEA 3VEYA 1NGDA 2G8IA 5B8HA 4BRCA 2OZMA 3PX4A 3L8BA 4B1UB 4ICLA 1CZ9A 1EXQA 2XY5A 3P83D 2PAVA 2RF2A 2GV9A 3VQ6A 3CMEN 2Y1JA 4CZHA 4B1YB 4IEEA 2NNWA 3HVTA 2P9NA 1B92A 3KLGA 5GAEP 3D2EB 2PYJA 4K42A 1JXEA 3KD1E 3O1WA 3ZEUA 5HP1A 2NRVA 1HJRA 3GG4A 2D0CA 3OYAA 3UKRA 3M8PA 1X1PA 4H4MA 2FBVA 1VQNN 4JYAK 4RTFD 4RW4A 4Q0BA 3FFIA 2P5GA 1B9DA 3L2VA 3ZCMA 4OVLA 5HBMA 4CBUA 2GEMA 3WXJA 4YOVA 4WCEL 3SYZA 3VMFB 2QM1A 3DMJA 4CE9A 1XUPO 3FR0A 2D5RA 3LALA 3V81A 4DSIA 4B3SK 4DLEA 4B9TA 3AA4A 1GLFO 3AO4A 3AVKA 3H6EA 3B8AX 4CF0A 3HOSA 1VSJA 2LSNA 2QWOA 4FL9A 5FRMA 2W42A 1U49A 1XC3A 2VWKA 1C0TA 3D2FA 5LMUK 3IAYA 5F2RA 3RWUA 3THXA 4CGDA 4CK3A 4OPKA 5JS1A 3R8EA 2KHOA 2ZM6K 3D7EO 3SJHA 2V51B 3CM6A 1N34K 1U6ZA 4MLHA 2HHWA 4CESA 4LF7K 3QEVA 3L0QA 4KI4A 4K43A 3OJSA 4JI2K 4NO7A 4O0IA 3S3NA 4BRQA 4PKHA 1ZBFA 3AO3A 4BR0A 4LFAK 1XC9A 3SV3A 5KGWA 3MDQA 3S9HA 3VQDA 2FBYA 3DRPA 5AQHA 4Z4CA 3ZEUB 2WFBA 3UKRB 1KAXA 2H3GX 4CFAA 4W5TA 4YOYA 3A2FA 2OPPA 4HCCA 1TK8A 5DMRA 1RNHA 1JLGA 1N36K 1DT9A 2HVIA 1WSEA 3V9SA 4NCGA 2D0PA 3VF2A 1TKZA 2QWNA 3RRGA 4Y1DA 3C6TA 5KRTA 4BRKA 1O1WA 3RR7A 4Z94A 2GBZA 4CW7B 5AJ3K 4A2AA 4DV3K 2QKBA 3CG7A 1IKVA 4NYNA 1A5XA 4DHYA 1ILYA 3HPOA 3TAQA 3DLGA 1TK0A 4DR5K 4XH1A 3AVHA 3PO5A 1SQKA 4JEPA 3M5RA 3VQQA 3D6RA 1JLEA 1JLFA 4FJIA 2YJEA 4F8RA 3NGZA 2W6LA 4EHTA 3THXB 4TSXA 2I5JA 1BHLA 1KAYA 3SUQA 1GLCG 5TKYA 3SQ0A 3AAQA 2ZD1A 3QERA 3ZLJA 1QHTA 4KHYA 2O8DA 3L3VA 4CEEA 4KAZA 4Z4IA 5IT9O 4LF9K 4DQ8A 5CHIA 1EKEA 1SKRA 1QQMA 1WN7A 2Q1NA 3WXLA 5BN9A 4AH9A 1E3MA 3QNOA 3AGKA 1NOYA 3CQ8A 1HMVA 3IFRA 2O8CB 4B1XB 3ZX3A 3Q7CA 4BQZA 3P31A 2IIRA 4FLTA 3SUNA 2BH1A 4YOWA 1IJJA 4LFBK 4ZTJA 1IO2A 3VA0A 4AHVA 1RT4A 3OYNA 4JI1K 3O9UA 4CZEA 4CBXA 3MXIA 2AA4A 4H0YB 3KIOA 4WQ4A 3CFPA 2QXFA 2KFNA 2AJQA 2OPSA 3BDPA 4FJ9A 1S1UA 3ZSOA 3V1QA 1S1TA 3CQYA 5BRDA 4YHHK 3U4LA 1QS4A 3CJ9A 1XI1A 2HBJA 4U7BA 1VRTA 1KFDA 2BE2A 1NM1A 1L3VA 1NNEA 4YY3K 3SBGA 4CF9A 3JS6A 5C12A 3O4QA 1K6YA 1VQLN 3ZSRA 1HRHA 1P90A 3WEEA 3RMAA 2P9KA 3CJCA 1BISA 3KK3A 4LF5K 5FROA 3SQ4A 4MDBA 2NRZA 2UXCK 3KTQA 3HTVA 2YNHA 2O8DB 3CFOA 5DK5A 4E89A 3WXIA 1NGJA 4FJNA 1QSSA 2FSJA 1X9MA 4JKGB 3ZSZA 4CZLA 2IS3A 2NRTA 3C95A 4CVNE 3WQUA 4DR7K 1EWQA 3LANA 3SAGA 3NDKA 3F9KA 3DXMB 3L3UA 4PKIA 5KPZA 1T44A 4L3QA 2OPRA 4E19A 3K59A 4H8KA 4DQRA 1VSHA 2GWJA 4E3SA 1DTQA 4BRAA 2YKNA 4QS9A 1NGBA 1XQSC 3SNNA 4IBNA 4E7HA 3KKRA 3DOLA 3CC2N 1HKBA 3DAWA 3EL2A 3VEOA 1NOZA 5M1PA 4EIAA 5JICA 5IWAK 2EX3A 4A5BA 3LWLA 4DMNA 4DKWA 1XHZA 4CZJA 1HX1A 3CHWA 3AGRA 3MK6A 4BR4A 1BUPA 1WSFA 4BRGA 4DTPA 4PA1A 1Y64A 4C8NA 4KKOA 3G71N 3ZSXA 1VQPN 1EP4A 3MX2A 3V4IA 1ESVA 2P9KB 3SK3A 3SZ2A 4FWSA 4AHCA 3G25A 3BF1A 4E7IA 1HLUA 5AR0A 1NGIA 2O8EB 4YDUC 1NBWA 2D4WA 1K73O 1T6DA 4IJNA 4DV0K 3AA3A 3AVNA 3MECA 3MXMA 4CK1A 4WE1A 5HOOA 2F9TA 1RILA 1RCHA 4B9QA 4BVOA 5EU7A 5BRHA 2NUBA 1GLDG 3KWGA 1W0HA 4BQLA 3MX5A 3ULEA 3LZIA 3CETA 4GV9A 2JWKA 3G10A 4BC5A 1JLQA 3QLHA 5H1SQ 3U3GA 3E9LA 4DR2K 2P9PB 2G8HA 1UA1A 4FWKA 1CLQA 3THYA 4JI8K 4DSEA 2Q97A 3CJBA 4WFNL 4O0JA 3DLKA 3K5NA 2Y1IA 1R59O 1Z25A 4XH4A 3BUZB 4HVJA 3IRXA 1JJ2M 1K8KB 1DKGD 4BREA 4NXNK 5E41A 5FPEA 1HNVA 4CEQA 3ZT2A 4JD2A 4FK2A 2HHUA 3V1OA 4YNQA 3VF6A 3VEWA 2WTUA 3AO2A 1L3UA 1IG9A 1VK0A 1VSDA 4BDZA 2GUIA 2IAJA 4DQIA 2P5OA 3SMPA 1WAJA 3TSUA 3AAPA 3T19A 3I56N 3VQ9A 3M3ZA 3M1FA 3CC4N 3T1AA 2O8FA 4FJMA 5HRNA 5BR8K 4OPHA 4DV2K 4IDKA 1KVBA 1OH8A 1KLMA 4CEDA 4CGJA 3HK2A 3ULEB 1SKWA 1QVGM 5CZ1A 1IBMK 4KREA 2D0OA 4M63C 5AQPA 4CEFA 3T3FA 4V19S 3KLHA 3O8MA 5DM7L 3UIQA 1WSGA 3MN9A 1V4TA 3TANA 4WF9L 4R5PA 3EYZA 1YJWN 4CEAA 4DTSA 3THYB 3CJ1A 5AQIA 2XY8A 3NH1A 3L2WA 3KD5E 2OCEA 1JLCA 5AQYA 3EY1A 1D9FA 2FF3B 2E6MA 4FM0A 3ATVA 2V7ZA 4CF8A 3O4NA 1K8AO 3N4QA 4KB1A 3U6FA 2B4JA 3ALYA 3U9DA 4MQ3A 4CZFA 1FXXA 3JAMO 3ZETB 4JS5A 3H45C 3O9TA 2WOMA 3OYMA 5BN8A 3LP1A 4IEIA 4RW7A 2QK9A 3NGIA 2IVNA 5LJVA 1C0GA 2ATQA 5HRRA 3E9PA 1BA0A 1JL2A 1SKSA 4N5SA 3A5LC 3BZKA 5CYQA 4CJSA 1EQYA 3RSEA 4KBOA 2EWSA 1XNRK 2O8FB 2E2QA 1CZBA 3RMDA 2FC0A 3EEQA 1YJ9N 2YHBA 1NGFA 4IG0A 1OH7A 2NRXA 1I94K 3DLBA 3I0SA 2HHHK 4IWVA 1QTMA 5AQOA 4QOZB 1BA1A 4DR1K 5KPRA 4DTMA 2RKIA 3AO1A 1YXQA 2E2OA 3FZKA 3DYAA 4NB4A 4AHRA 2HHSA 3HPGA 5JLFA 4FJGA 4EP5A 4MFBA 1XMOK 3TI0A 4I6MA 5F0XA 3ZSQA 1RT7A 4FLWA 1GLAG 1CXQA 2KZZA 1Q8IA 1ASWA 4FWMA 3IKMA 5LY3A 1N6QA 3DI6A 3LDNA 1WUAA 4FWRA 4X66K 4O55A 1X3NA 3AARA 4Y0WA 4LC9B 3VQEA 4JI0K 3RRHA 4GKKK 4GW6A 1KVCA 2QWRA 4OO1J 3H1VX 3AVAA 3IUCA 1YVNA 2A1SA 1YI2N 2PZSA 1K9MO 5HROA 2WUSA 3CYMA 1HKGA 2O8BB 4IJAA 5AZIA 2FLOA 4E7JA 1EWRA 2VQFK 2OA8A 1TVRA 4JKCA 4JHDA 2PBDA 3C94A 4FLUA 3U8XA 2E20A 3AY9A 3Q7BA 4OGEA 4OPJA 2KKZA 1UAXA 3MN5A 3JSMA 3GOIA 2Q3SA 4FZXC 3L2RA 1TK5A 4B1WB 5EY4A 4F2RA 3CCRN 5J2PA 2YI1A 3I55N 4YOUA 4W5OA 1JL1A 3ZT3A 2JGUA 3O9SA 3PUFA 3SUPA 3CQXA 2G8VA 1NK6A 3P5JA 4N56A 2FSNA 3HVRA 3VN5A 1X9SA 5HL7L 3VENA 1NG9A 4BDPA 3ZX0A 5C25A 1S9GA 2HF4A 1IKXA 4ID5A 4JKDA 1LAVA 4BC4A 3O4WA 4KTWA 1X9WA 1LOTB 4E7LA 3A0IX 3QEWA 4J2EA 4KH6A 3C0BA 5CR4A 5JVGL 1A5VA 1T3VA 4B3TK 3VQAA 4DSKA 4FZZA 2FBTA 4Z4GA 5AQWA 4CJ4A 1L3TA 2FSKA 4JN4A 2NRRA 2ASOA 4FJXA 1BGXT 5KTQA 4JLHA 1YITN 1EETA 2YHAA 3QIOA 4CJFA 3E01A 1OH6A 1SL2A 1NJXA 5I42A 5JS2A 3ENHA 5AQTA 4M7YA 4U67L 3TTCA 2YNIA 3EE8A 3V9ZA 4NYFA 5EXWA 4Z0UA 4QAGA 3M8RA 4ID1A 3TU5A 3H3OB 2E2PA 4BVPA 5FPDA 4DSFA 3O3FA 3MMVA 4BRNA 1VAZA 4NLBA 3MN6A 3ZYYX 4CHOA 3PIOL 4EAHD 5J2NA 1LW0A 4BWMA 1R0AA 1KC8O 1S72N 4CGHA 3NF6A 4WFAL 1V4SA 4GY2B 4C8KA 1J9AA 5KRSA 2P9NB 1D5AA 1QQNA 1J54A 1JCEA 4JKBA 5J2MA 3WNFA 3QEPA 5I3UA 4PHTX 3ISNC 3KWIA 3F2KA 3DLRA 2RHKA 5C2DA 4H4OA 1IG8A 4IXCA 3NF8A 2VGNA 2W6KA 4DFKA 4K41A 4PL7A 1QSYA 4E1JA 1W2BM 3ZT4A 3CCQN 4H0OA 4CFDA 4Z4EA 1SS6A 4Z4HA 4J8FA 1U2VA 4H5NA 3LWMA 3OY9A 4EP4A 1VSLA 1P8ZA 4CZGA 3CM5A 4GV6A 3KZBA 5AQNA 2DFHA 3HYFA 3LDPA 4M7XA 3D2FB 3NAEA 4JAXA 4CFBA 2A6AA 2UYTA 2YHYA 4FPBA 4HHTA 4L8RB 4FW2A 2VG7A 3FFKB 4FLXA 1D4XA 3H1QA 3P4IA 2BUPA 5E26A 3W0LA 3SQ1A 4CHPA 4CZIA 1TUYA 4BG8A 1Y97A 1RBTA 2P9LA 2P51A 2Q31A 3MCAB 1C0UA 3DM2A 1S9EA 4E0DA 5AQUA 3L2UA 4FJHA 1VHXA 3AVMA 5EOYA 2HBLA 3FZFA 5AZJA 3I8BA 3OVNA 2GUPA 1JKHA 1NGEA 4CJUA 3DOKA 1VQMN 1KD1O 3SJJA 3PIPL 1HPZA 3DWLA 4MO4A 2YKMA 3KKSA 3S3MA 4WQ5A 5LL6Z 3TTDA 2X6SA 3LDQA 4AM7A 5J2QA 3GBTA 1IBLK 1VSIA 1KLNA 4K8XA 1REVA 4M3YA 5LJWA 4H0VB 1TAQA 4DU3A 1RDAA 5AQLA 3HXMA 3TAPA 4B9VA 4M41A 1RGIA 5JVHL 4LF8K 4A61A 3L4IA 4CJRA 3LZJA 4N76A 3IG1A 4O44A 1NK4A 1X9JA 1VSKA 1T05A 4DV1K 4ELVA 4O8KA 3B6PA 4BROA 1HJOA 2HNDA 3TAFA 1VQ5N 3HSTB 2YHXA 1GOCA 1I3AA 1YTAA 4YFUA 5KPTA 5AFUA 3F9MA 2HBMA 3DRSA 1ASUA 4B8CA 4WQ4C 1RDCA 1NK0A 3K5LA 1BCMA 3M8SA 2FBXA 2XO7A 3A5OC 3B6OA 4CGFA 1NGGA 2P9LB 4OGCA 5E84A 5GAHP 1Q86O 1GLEG 2FXUA 3CPEA 4CHNA 3ZSWA 4BWJA 2GX9A 2OYQA 5AQZA 2VGMA 4G1QA 4C1NI 2E88A 1WSJA 5M1OA 4C23A 4DQSA 3EE9A 3UKUA 3BY5A 4DV6K 2E4LA 1EO1A 4BR2A 4JKEA 3VERA 1NKBA 3ENBA 1RT2A 4LY7A 4CK2A 4N41A 1VSFA 4M45A 1TKTA 3NHGA 1YIJN 5ADXA 3G0ZA 3C7NA 4K8ZA 2OANA 3K5OA 2UU9K 3RTVA 2HHXA 3SUOA 3CXCM 4BG9A 4CJ7A 1RDUA 3QDKA 1BDGA 2PY5A 1MWKA 1RDDA 5BPLA 3G4SN 3VGLA 5SZTA 3I8DA 3C6AA 4BRPA 4AILC 1ZBHA 4G9ZA 4GNIA 2QXLA 2F7TA 3FE1A 4A57A 5M1FA 2Q2RA 2F8TA 1NJWA 3DLEA 3WEEB 2HF3A 2X78A 3KK7A 4AM6A 1WSHA 3CCSN 1RDBA 4PY5A 1LWEA 1J5OA 4DTXA 1ZBIA 4IOCL 4AQYK 2F8SA 1NK5A 3KVGA 3K57A 1TAUA 1KXPA 4GVEA 5LMNK 1T03A 3P38A 4F3OA 1JCGA 2VYPA 5GINA 5C15A 3IMXA 4NCAA 1S6QA 3OYCA 2VCPA 4KH4A 1LV5A 2Z1HA 4KHSA 1JXBA 1WAFA 3H08A 1NK7A 2RN2A 3UKUB 4CJPA 3OYLA 3VF4A 3OYKA 2HW3A 4HUEA 4HCBA 3MAQA 1N33K 1RBVA 5CY4A 3VQBA 3HOTA 1KQSM 3HBTA 3HPHA 1S1WA 4J2BA 3C7NB 2GELA 4DSLA 1NJIO 4GV3A 3EKSA 3D0PA 3IS9A 3HL8A 4JI6K 1NK8A 3QEIA 1BIUA 3RVCA 4B9MA 2WC9A 3ID8A 2BDPA 1E4GT 1NGCA 1RTJA 2HB5A 2A1RA 2G8UA 1S22A 4ILJA 5KGXA 4CIGA 4RWTA 4B9UA 3LP3A 4JRPA 2EHGA 4IO8A 1DTTA 3ATUA 2F96A 4FWPA 3GDQA 4CEZA 1FJGK 2QEXN 1HKCA 4KI6A 4BC3A 3J81O 1L5UA 4DCHA 3LDOA 2R7YA 3F5TA 3R6MA 3AVFA 4Z4FA 1IKWA 2XY7A 4DF8A 1RT1A 3SBTA 3ZT0A 1BCOA 3J7AP 1BL3A 2QTDA 4H5TA 2E5LK 4CJLA 2ZJPL 4CGIA 3CJAA 3MWTA 3BGRA 1YUWA 2Z1JA 3WNGA 2OTJN 5ELZA 1XHXA 4FOEA 2PYLA 4OX9K 4FWNA 3OHRA 2YNGA 3VGKA 3HI0A 1NLVA 4W5RA 3O5BA 3L4QA 3SPYA 1HR0K 1VQON 1ZBSA 4OLBA 2QWPA 3SLCA 1G15A 4UQGA 1YT3A 3EZWA 2KLAA 3LM9A 2YX6A 3TSQA 2YJFA 4B3OA 3I0RA 4BE1A 5AQRA 1HNZK 2HHTA 1G99A 1RT3A 4CD3A 3VQ8A 4K25A 5AQVA 1N8RO 4IOXA 3OYFA 2WONA 1JCFA 1I39A 3UE5A 1IBKK 4LF4K 1BG3A 4LH5A 4F2SA 1XMQK 1WBBA 4Y1CA 3I33A 3CC7N 3VEZA 2ZQBA 1C1AA 4JD2B 1Z6RA 1KVAA 1N32K 4JKHA 1RBUA 4FWLA 2AP1A 4E1NA 5FRNA 1CXUA 5BREA 1E4FT 3OA9A 4GKJK 3W3DA 4FJLA 1OVQA 3NF9A 1RT5A 2D0AA 3ZSVA 4OKKA 2V52B 3K58A 3G6EN 4CJ3A 4DFJA 3EZ5A 4FWQA 3EO3A 3CCUN 4DU4A 3V9WA 1FKOA 2HHQA 4K0KK 5C0YA 3BF3A 4JRQA 4LD0A 3FLCO 4PWDA 1TKDA 4CJKA 1HNXK 4DTNA 4OKEA 1IH7A 3TTFA 5KQDA 1SUQA 2X6NA 4QS8A 1MA9B 4B1VA 4BGAA 3RMBA 1QZ6A 4E1MA 4KO0A 3NH2A 1U45A 3WXKA 2IDOA 1C0FA 3JXUA 1HYSA 4AHUA 4CJQA 2W40A 4DSJA 1TL1A 3VQPA 1HYVA 3AA5X 3V9XA 4O8UA 4RW6A 3MEGA 5JMVA 1ITGA 3HP9A 3ID6A 2HNZA 2NRWA 5FPMA 2ZJQL 3BEXA 2KFZA 3L6QA 3CJ7A 4FJ5A 4BACA 1HPMA 2DY4A 1ZYQA 2YNFA 2ZGZA 4JK7A 3O9QA 3D2EA 4EZ9A 2A5XA 3TAMA 3QO9A 1J5EK 2KTQA 4BDYA 4ISFA 1YF5L 2E6LA 4YOXA 4FM2A 2IC3A 1T7PA 1RFQA 4M3TA 4IFYA 3PY8A 2HOEA 4I2PA 3DLLL 2QW9A 3WQTA 3H3NO 1ATNA 1JLAA 1UA0A 3RSEB 2UUBK 2FF6A 1RBSA 3U3YA 2RPIA 3VEXA 4BR9A 4MLEA 1C1CA 4IDHA 2DFFA 3OBYA 4FJ8A 5D3GA 1U47A 3E1YA 4BE0A 4I7FA 2HMIA 3R3LA 1LAWA 1T8EA 4KRFA 4JKAA 4CJ5A 4C8LA 3KLIA 3QBXA 3OS1A 3ITHA 1BQMA 1ZBLA 2BANA 4FVMA 1BWFO 2QA4N 1KRPA 4LF6K 4FXDA 1ASVA 1A5WA 4AHTA 4H0XB 4B9SA 1FK9A 3AVGA 1MWMA 2I7NA 4DR3K 2A40A 3PLAA 1TUUA 2CH5A 1BOTO 2HBKA 2X74A 3FGUA 3K2PA 4X64K 3ZT1A 1ZBUA 4FJJA 4GVMA 4CI6A 1BU6O 4I6MB 1Q7YO 4E7KA 2P9IA 4IFVA 3J7YP 3VA3A 3PSIA 3OYEA 3VTIA 4EZ6A 3CCJN 4JI3K 1B9FA 2Z1IA 4DV4K 1U48A 3CCEN 1WBDA 1FKPA 3CD6N 3BP8A 1OKJA 5SWMA 3VETA 4DB3A 1NMDA 3NH0A 5AFUH 3QBWA 1VQ7N 4KV8A 1IKYA 5AZIB 3ZX2A 4DV5K 1VSMA 2HNYA 3MWPA 4BRIA 3WT0A 1IV0A 4DR6K 4CD1A 1YTUA 3NE6A 4CEOA 4JHDB 1QSLA 4RG8A 3E66A 3CCLN 1S5JA 3HP6A 2XY6A 1HQUA 4ZTFA 1HYZA 1WLJA 5AQGA 3E9OA 1S6PA 2ASPA 4CBWA 2Q0RA 3TR8A 3SPZA 4FLYA 1F21A 2I7PA 4XIUA 1NU0A 3AVIA 4KTZA 3OYDA 1U4BA 1DEJA 5TKWA 1KAZA 3LDSA 1D8YA 2G8KA 4DQQA 4H0PA 5ADXH 3A5MC 4OLAA 5AQXA 4KHNA 4FWOA 3LDLA 4IKFA 3LL3A 4EHUA 3C65A 5GIPA 1HNIA 3V1RA 2P9IB 2VWJA 3T1HK 1NWKA 4H5VA 4OJRA 1SZ2A 1GLBG 3K5MA 3TAGA 4ILHA 2D1KA 3J8AA 2DPNA 5AQSA 3TARA 1O13A 1ZXOA 3CFRA 2O8CA 4IFEA 1XWLA 3J7ZO 3GL1A 2BTFA 3CF5L 2UXBK 3F73A 3V6DA 3AA2A 4DU1A 3K9KA 4EFHA 1LWFA 1VSEA 4W5QA 2VG5A 4UY8O 3OBWA 1GLLO 2G8WA 3VEVA 3M6GA 4H5WA 3OTOK 4ISGA 2E2NA 3PX0A 4F3TA 4LSLA 5HRPA 1MDUB 1T6CA 4B9LA 4IO9L 2HSTA 1QZ5A 2IGIA 3CMAN 3LPTA 4KTQA 1Z05A 1C6VA 4KHPK 5AQKA 2A3ZA 4B9NA 1UOCA 4HWIA 5K14A 4DFMA 4DG1A 3O9RA 3ASMA 1TL3A 5AQQA 2YV0X 3TSPA 4AF1A 4H0TB 1NGHA 2ZJRL 3SV4A 2F9WA 3KHYA 4I9LA 1DGKN 3WXMB 4RCHA 4FLZA 4CHZA 3NMUA 2NZTA 3RR8A 1BI4A 3VQCA 3QFPA 3QINA 4WYBA 3T7ZA 1H1VA 4H03B 4IOAL 2VG6A 4X62K 3HO1A 4BRLA 2IVOA 2UXDK 4JKGA 1UWBA 4KHUA 4CEBA 4B8AB 2HHVA 3ZSYA 2QI2A 4DLGA 4DUZK 3DXMA 4HUFA 4ZHRA 1QVFM 5FPNA 4M3RA 1ATSA 1YVUA 1HUXA 1QE1A 4FJ7A 5M1QA 3R1XA 2ETJA 3OS0A 1U2VB 5BPNA 4DF4A 5C42A 4OKJA 4ELUA 3EKUA 4WQ5C 3KLFA 3WNEA 4R79A 2XHBA 1NMNA 1Q18A 4DTOA 1VQKN 2ZF5O 1HQEA 4DUYK 1VQ6N 5MLCQ 1WSIA 2A41A 3VPZA 5DM6L 3OYIA 3AVBA 4C8OA 2VWBA 1J53A 5I9EB 3D45A 3MXJA 1W9HA 3VOVA 4JV5K 2ZE2A 2QWLA 2ZGYA 2ITMA 3BZCA 4BR5A 3SAHA 5T7BA 4DWIA 2ITGA 2UUAK 4CERA 2Q0UA 4W5NA 2YCHA 4PUOA 2B6AA 4DFPA 1NJYA 3A5NC 1W97L 5AZJB 2KZMA 4KFBA 4JK9A 4M42A 4NLCA 3O6WA 1RBRA 4M3UA 3SAFA 1SV5A 2CGJA 2O8EA 3FZMA 3O80A 1SL1A 1BI4B 3KLEA 4BRFA 3PSFA 3HRGA 4B3RK 4FCYA 1GOAA 3MEEA 3LAMA 4JS4A 2CGKA 1W7AA 1XNQK 4JNEA 1BIZA 1RT6A 3LP2A 2DFEA 4F9OA 1JLBA 3TWHA 4FYDA 1EX4A 3FZLA 4CF1A 3HM9A 4DTRA 4M3ZA 4BC2A 1NKEA 5GADP 2P9PA 2JWLA 3K0SA 4DR4K 1VQ4N 3PV8A 2GWKA 5BR9A 3NF7A 4H5RA 4XEIA 1SAZA 1QQCA 5J1EA 5M1NA 3LM2A 4I9QA 3S3OA 3N4PA 4AHSA 1KSPA 5HLFA 3HJFA 2O4IA 4PKGA 5JLHA 5KQ8A 4O4GA 3AVJA 1K8KA 4YDUA 1TKXA 1X3MA 3C6UA 4CIEA 1M90O 4NCBA 4FW1A 1Q82O 1TYQA 1FW6A 1KCFA 5CE3A 4JI7K 2O4GA 2B5JA 3THWA 5GIOA 2JLEA 1RDWX 2BGGA 1CZAN 3PO4A 3TPQA 1KTQA 4Q5VA 4F4KA 3OW2M 3MCPA 2RE2A 4YORA 3SMSA 4JI4K 2ZWHA 5KI6A 4KB0A 3QEXA 3QESA 2E1ZA 2NLXA 1C0MA 4CFCA 3LAKA 1QHAA 1NK9A 3CCMN 3EN9A 3LPUA 2QWQA 1WB9A 3C6HA 4RW9A 1SL0A 1S1VA 3OYGA 3HZ6A 2DTUA 2YHWA 2IOCA 3R9PA 4MO5A 4BR7A 4XH5A 3CCVN 5CYMA 4BY9C 4FO0A 2OZSA 4FPAA 3QNNA 3OYHA 1HNWK 1QQOA 1LW2A 4DTUA 5C2FA 2W41A 4CCHA 3L2QA 4FK0A 1YAGA 4DTJA 1S3XA 3O08A 2VQEK 4PL8A 1L3SA 3OYBA 3SCXA 1C1BA 1GLJO 3LP0A 5C24A 3ZETA 3O3GA 3VGMA 1LCUA 3QFUA 4N47A 2IVPA 4CJWA 2HMPA 4FM1A 5A2QO 4KPYA 1TYQB 3S41A 1ZC6A 4CGGA 1YJNN 2V7YA 3THWB 3SI6A 3DLHA 3T1YK 4FK4A 4LFCK 2OTLN 4B1ZA 4BRHA 2A42A 4CF2A 3H46O 3MEDA 3A8YA 1OVYA 4ILGB 1KFSA 4FJKA 1WNSA 4CJTA 1RTIA 4A5AA 1BQNA 4A2BA 4KHWA 3OYJA 3VQ5A 3HSCA 3M8QA 3CI5A 5AQFA 4BGBA 2P9UA 5BPMA 3KJVA 3AVCA 3P1GA 3CPWM 1WOQA 4CHYA 4CZMA 4DV7K 4NXMK
chains in the Genus database with same CATH topology
4C8LA 4FLVA 3KLIA 3OS1A 1NOZA 2Z1GA 3ITHA 4HHTA 1BQMA 4FW2A 2VG7A 4L8RB 1ZBLA 1TV6A 4FLXA 3SQ2A 2BANA 4CJVA 4FVMA 2EX3A 1TGOA 3AVLA 4O5BA 3SQ1A 3LWLA 1KRPA 4DMNA 1XHZA 1D9DA 4FXDA 1ASVA 1A5WA 3AV9A 4AHTA 4CHPA 4HUGA 4DS5A 4B9SA 1LWCA 2XRIA 1FK9A 1Y97A 3AVGA 1WSFA 1RBTA 3K2PA 2X74A 4DTPA 2P51A 3ZT1A 1ZBUA 4PA1A 4GVMA 4C8NA 4FJJA 1C0UA 3DM2A 3HT3A 1S9EA 4BE2A 4E7KA 4KKOA 4IFVA 4E0DA 1Q9YA 3ZSXA 3L2UA 3VA3A 4CECA 3OYEA 3AVMA 3NCIA 4FJHA 1EP4A 3OS2A 4EZ6A 3V4IA 3RMCA 3SZ2A 1N5YA 1B9FA 4AHCA 3VQ7A 4E7IA 2Z1IA 1U48A 3OVNA 1VRUA 4DS4A 1JKHA 1FKPA 4CJUA 4FZYA 3DOKA 3O3HA 2P1JA 3JYTA 3NBPA 3SJJA 2G8FA 5SWMA 3AA3A 3AVNA 3MECA 1NJZA 1HPZA 3MXMA 4CK1A 4WE1A 2YKMA 3NH0A 3KKSA 1RILA 1RCHA 3S3MA 5EU7A 3OJUA 2X6SA 5J2QA 2NUBA 3V9UA 4KV8A 1IKYA 1VSIA 1KLNA 1REVA 4K8XA 4M3YA 4HTUA 1VSMA 2D0BA 1GOBA 1W0HA 2HNYA 3KK1A 2HVHA 1TAQA 3NFAA 4DU3A 1RDAA 3HXMA 3TAPA 3LZIA 4B9VA 3NGYA 4M41A 3NE6A 4CEOA 1YTUA 3G10A 1JLQA 3QLHA 1QSLA 4I2QA 4RG8A 4ELTA 1S5JA 3U3GA 4CJRA 3LZJA 3HP6A 2XY6A 3IG1A 3QIPA 4O44A 1NK4A 4N76A 1HQUA 4ZTFA 4KHQA 1HYZA 1WLJA 1VSKA 1T05A 2KW4A 5CZ2A 4C8MA 2G8HA 4DQPA 1S6PA 1UA1A 4ELVA 1CLQA 4IG3A 4DSEA 5FDLA 3TR8A 3SPZA 3B6PA 4FLYA 1F21A 2HNDA 3TAFA 3AO5A 4J2AA 3HSTB 4CHQA 1GOCA 1NKCA 1I3AA 1YTAA 3DLKA 4O0JA 4YFUA 4XIUA 3K5NA 3QETA 2Y1IA 3AVIA 4KTZA 1Z25A 3OYDA 4HVJA 1U4BA 3DRSA 1ASUA 4B8CA 3IRXA 1RDCA 4B08A 3LDSA 4CIFA 1NK0A 3KK2A 3K5LA 1D8YA 2G8KA 1BCMA 3M8SA 2FBXA 1MU2A 4RW8A 5E41A 4DQQA 2XO7A 4OLAA 1HNVA 4CEQA 1DLOA 4KHNA 3ZT2A 4FK2A 4IKFA 2HHUA 3V1OA 3WNHA 4YNQA 3B6OA 1Z26A 4CGFA 1RTDA 1HNIA 4M3WA 3V1RA 4J2DA 4OGCA 4PQUA 2VWJA 4OJRA 3AO2A 1L3UA 1IG9A 4LH4A 1VK0A 3K5MA 1U04A 1VSDA 4CHNA 3ZSWA 4BWJA 4BDZA 2GUIA 3TAGA 2IAJA 2OYQA 4DQIA 2P5OA 1WAJA 4G1QA 3PX6A 4CJEA 1WSJA 3T19A 3TARA 3VQ9A 4QCLA 4DQSA 3CFRA 1XWLA 4M3XA 3T1AA 2E4LA 5HRSA 3ULDA 4FJMA 5HRNA 3F73A 3VQ4A 3V6DA 1NKBA 4LY7A 1RT2A 4CK2A 4N41A 1VSFA 4M45A 1TKTA 3NHGA 4IDKA 4LSNA 1KVBA 3AA2A 3G0ZA 4DU1A 1KLMA 4CEDA 2QKKA 4K8ZA 4CGJA 3K5OA 2HHXA 3RTVA 3HK2A 1LWFA 1VSEA 1SKWA 5CZ1A 2VG5A 4W5QA 1Q9XA 3TABA 3SUOA 3THVA 2G8WA 4KREA 1S1XA 4CEFA 2OPQA 3T3FA 3KLHA 3PX0A 2PY5A 3UIQA 1WSGA 4F3TA 1RTHA 4LSLA 5HRPA 1RDDA 3DRRA 4GMJB 4B9LA 5SZTA 2KQ2A 3I8DA 3TAEA 3TANA 4R5PA 4AILC 2IGIA 1ZBHA 2G8IA 3EYZA 3LPTA 4CEAA 4DTSA 2OZMA 3PX4A 3L8BA 4KTQA 1C6VA 4ICLA 1CZ9A 2XY8A 1EXQA 3NH1A 2XY5A 3L2WA 3P83D 4B9NA 1UOCA 2RF2A 5K14A 3KD5E 4DFMA 1JLCA 2GV9A 3VQ6A 4DG1A 3EY1A 2Y1JA 3ASMA 1D9FA 1TL3A 2E6MA 2YV0X 4FM0A 1NJWA 2F8TA 3DLEA 2X78A 4CF8A 1WSHA 1RDBA 3O4NA 3SV4A 4PY5A 1LWEA 3U6FA 1J5OA 4DTXA 4KB1A 1ZBIA 3HVTA 2B4JA 3ALYA 4I9LA 1B92A 4FLZA 3KLGA 4MQ3A 1FXXA 2PYJA 4JS5A 1JXEA 3KD1E 1NK5A 2F8SA 4CHZA 3K57A 2WOMA 3OYMA 5HP1A 1TAUA 1HJRA 1BI4A 2D0CA 3LP1A 3VQCA 3QINA 4RW7A 3OYAA 1T03A 3RR8A 3M8PA 4F3OA 2QK9A 3NGIA 2VG6A 1X1PA 4H4MA 3HO1A 2FBVA 2ATQA 4RW4A 1UWBA 5HRRA 4Q0BA 4KHUA 3FFIA 2P5GA 4NCAA 1B9DA 1JL2A 1S6QA 4N5SA 3L2VA 1SKSA 3ZCMA 4CEBA 4OVLA 3OYCA 5HBMA 4B8AB 2HHVA 1LV5A 4KHSA 2Z1HA 3ZSYA 3SYZA 4DLGA 1JXBA 1WAFA 5CYQA 4CJSA 3H08A 1NK7A 4HUFA 3DMJA 2RN2A 4CE9A 4ZHRA 4CJPA 2D5RA 3LALA 4M3RA 3OYLA 3OYKA 1YVUA 2HW3A 4HUEA 4HCBA 1QE1A 4FJ7A 3V81A 4DSIA 3MAQA 2ETJA 1CZBA 1RBVA 2FC0A 5CY4A 3OS0A 3VQBA 4DLEA 3RMDA 4B9TA 3AA4A 2YHBA 4IG0A 3AO4A 3AVKA 4DF4A 3HPHA 4CF0A 4OKJA 5C42A 4ELUA 1S1WA 1VSJA 4J2BA 2LSNA 4DSLA 3KLFA 4Z4EA 3DLBA 3WNEA 2XHBA 3I0SA 4DTOA 5FRMA 2W42A 1U49A 2VWKA 1HQEA 3D0PA 1C0TA 3IS9A 3HL8A 1QTMA 1NK8A 1WSIA 3QEIA 4QOZB 1BIUA 4B9MA 4DTMA 2RKIA 3OYIA 3AO1A 4AHRA 2BDPA 3IAYA 3DYAA 2HHSA 3AVBA 1RTJA 2HB5A 4C8OA 3HPGA 4CGDA 4CK3A 2A1RA 1J53A 3RWUA 4OPKA 2G8UA 5JS1A 4FJGA 5KGXA 4EP5A 3D45A 4CIGA 4B9UA 3MXJA 1W9HA 3CM6A 3LP3A 4MFBA 2ZE2A 4JRPA 2EHGA 2HHWA 1DTTA 4CESA 3TI0A 3QEVA 4KI4A 2F96A 4CEZA 3OJSA 5T7BA 4DWIA 3ZSQA 4KI6A 2ITGA 1RT7A 4O0IA 4FLWA 4CERA 3S3NA 1L5UA 1CXQA 2KZZA 1Q8IA 1ZBFA 1ASWA 3AO3A 2R7YA 4PUOA 4W5NA 1XC9A 2B6AA 4DFPA 3SV3A 1NJYA 3AVFA 3DI6A 1N6QA 4Z4FA 5KGWA 1IKWA 3S9HA 2XY7A 3VQDA 4DF8A 2KZMA 1RT1A 4KFBA 4M42A 4O55A 2FBYA 3DRPA 3ZT0A 1RBRA 1BCOA 4Z4CA 3VQEA 4M3UA 3RRHA 1SV5A 4GW6A 1BL3A 4CJLA 1KVCA 1SL1A 1BI4B 3KLEA 4CGIA 3AVAA 2A1SA 3BGRA 2Z1JA 3WNGA 4CFAA 4FCYA 4W5TA 3A2FA 1XHXA 2OPPA 2PZSA 2PYLA 4HCCA 5HROA 1TK8A 5DMRA 1RNHA 1GOAA 3CYMA 3MEEA 2YNGA 1JLGA 3LAMA 4W5RA 4JS4A 2HVIA 1WSEA 1BIZA 3V9SA 4E7JA 4NCGA 3SPYA 1RT6A 1TKZA 3LP2A 2OA8A 3RRGA 4OLBA 1TVRA 2DFEA 4Y1DA 3C6TA 1G15A 5KRTA 1YT3A 3C94A 4UQGA 1O1WA 4FLUA 1JLBA 3TWHA 3RR7A 4FYDA 1EX4A 2GBZA 4OGEA 4OPJA 4B3OA 4CF1A 3HM9A 4DTRA 4M3ZA 2QKBA 1UAXA 3CG7A 1NKEA 1IKVA 3I0RA 3JSMA 2Q3SA 4NYNA 1A5XA 4BE1A 3HPOA 3TAQA 3PV8A 3DLGA 1TK0A 4FZXC 3L2RA 1TK5A 2HHTA 3AVHA 1RT3A 3NF7A 4F2RA 3VQ8A 5J2PA 3PO5A 3VQQA 1QQCA 1JLEA 1JLFA 4W5OA 5J1EA 4F8RA 4FJIA 3OYFA 2WONA 1I39A 3NGZA 4I9QA 1JL1A 3ZT3A 3S3OA 4AHSA 1KSPA 5HLFA 4LH5A 4F2SA 3HJFA 2O4IA 2JGUA 4O4GA 3AVJA 3PUFA 4Y1CA 3SUPA 4TSXA 2G8VA 1NK6A 2I5JA 1BHLA 1TKXA 3P5JA 4N56A 2ZQBA 1C1AA 3C6UA 3VN5A 3HVRA 3SUQA 1X9SA 1KVAA 4BDPA 4CIEA 1RBUA 3SQ0A 2ZD1A 4NCBA 4E1NA 3QERA 1QHTA 5C25A 1S9GA 4KHYA 4FW1A 1CXUA 3L3VA 4CEEA 4KAZA 5FRNA 1IKXA 4Z4IA 4ID5A 1LAVA 1EKEA 4FJLA 1SKRA 3NF9A 4KTWA 1KCFA 1RT5A 2D0AA 3ZSVA 1X9WA 4OKKA 1WN7A 2O4GA 2B5JA 3K58A 2JLEA 2BGGA 4CJ3A 4DFJA 4AH9A 4E7LA 3PO4A 3QEWA 3EZ5A 4J2EA 1KTQA 4Q5VA 3QNOA 1A5VA 4F4KA 1NOYA 3CQ8A 4DU4A 1HMVA 3VQAA 4DSKA 4FZZA 2FBTA 3V9WA 4Z4GA 4CJ4A 1FKOA 5KI6A 1L3TA 2HHQA 4KB0A 3QEXA 4FJXA 3QESA 1BGXT 4LD0A 4JRQA 4PWDA 5KTQA 1C0MA 4CFCA 1TKDA 3LAKA 4JLHA 4FLTA 3SUNA 1EETA 2YHAA 3QIOA 4CJKA 1NK9A 4ZTJA 1IO2A 3LPUA 3VA0A 4CJFA 4OKEA 1IH7A 4DTNA 1SUQA 4AHVA 2X6NA 3E01A 4RW9A 1SL0A 1RT4A 3OYNA 1S1VA 3OYGA 1SL2A 2DTUA 2IOCA 3MXIA 1NJXA 5I42A 5JS2A 3KIOA 3CFPA 3RMBA 4E1MA 2QXFA 4KO0A 2KFNA 2AJQA 2OPSA 3NH2A 1U45A 3BDPA 4FJ9A 1S1UA 2IDOA 3V1QA 2YNIA 1S1TA 3ZSOA 3V9ZA 4NYFA 1HYSA 4Z0UA 4QAGA 1QS4A 3M8RA 4ID1A 5CYMA 4AHUA 1XI1A 4CJQA 4DSJA 2OZSA 4DSFA 1TL1A 1VRTA 3VQPA 3O3FA 1HYVA 3AA5X 1KFDA 3QNNA 3OYHA 2BE2A 3V9XA 1L3VA 4RW6A 3MEGA 1LW2A 4DTUA 4CHOA 5J2NA 4CF9A 1LW0A 4BWMA 1R0AA 4CCHA 1ITGA 3HP9A 4CGHA 3L2QA 4FK0A 3NF6A 2HNZA 3O4QA 4DTJA 1K6YA 4C8KA 2KFZA 3ZSRA 1HRHA 1L3SA 1J9AA 3RMAA 3OYBA 3SCXA 1C1BA 5KRSA 4FJ5A 4BACA 1BISA 3LP0A 3KK3A 5C24A 2DY4A 1ZYQA 5FROA 2YNFA 1D5AA 3SQ4A 1J54A 5J2MA 3WNFA 3KTQA 3QEPA 2YNHA 3O3GA 5I3UA 4EZ9A 3CFOA 3QO9A 3TAMA 4N47A 3ISNC 5DK5A 4CJWA 4E89A 4FM1A 2KTQA 4BDYA 4KPYA 4FJNA 2E6LA 4FM2A 1QSSA 2IC3A 3DLRA 1X9MA 4CGGA 1T7PA 3ZSZA 2IS3A 3C95A 4H4OA 3DLHA 3NF8A 3SI6A 4M3TA 4FK4A 4IFYA 3PY8A 4CF2A 3LANA 4I2PA 3NDKA 3F9KA 1JLAA 4DFKA 1UA0A 3MEDA 3L3UA 1QSYA 1KFSA 3ZT4A 1RBSA 3U3YA 2RPIA 2OPRA 4CFDA 4E19A 1WNSA 4CJTA 4Z4HA 4H8KA 3K59A 1RTIA 4DQRA 4FJKA 1VSHA 1C1CA 1BQNA 4KHWA 2DFFA 3LWMA 4E3SA 1DTQA 3OYJA 4FJ8A 3OY9A 5D3GA 2YKNA 3VQ5A 4EP4A 1VSLA 1U47A 4BE0A 4I7FA 3SNNA 3M8QA 2HMIA 3CM5A 4IBNA 4E7HA 3KKRA 1LAWA 3DOLA 3KJVA 2DFHA 3HYFA 1T8EA 4KRFA 3AVCA 3P1GA 3NAEA 4CHYA 4CFBA 4CJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8L A;  4FLV A;  3KLI A;  3OS1 A;  1NOZ A;  2Z1G A;  3ITH A;  4HHT A;  1BQM A;  4FW2 A;  2VG7 A;  4L8R B;  1ZBL A;  1TV6 A;  4FLX A;  3SQ2 A;  2BAN A;  4CJV A;  4FVM A;  2EX3 A;  1TGO A;  3AVL A;  4O5B A;  3SQ1 A;  3LWL A;  1KRP A;  4DMN A;  1XHZ A;  1D9D A;  4FXD A;  1ASV A;  1A5W A;  3AV9 A;  4AHT A;  4CHP A;  4HUG A;  4DS5 A;  4B9S A;  1LWC A;  2XRI A;  1FK9 A;  1Y97 A;  3AVG A;  1WSF A;  1RBT A;  3K2P A;  2X74 A;  4DTP A;  2P51 A;  3ZT1 A;  1ZBU A;  4PA1 A;  4GVM A;  4C8N A;  4FJJ A;  1C0U A;  3DM2 A;  3HT3 A;  1S9E A;  4BE2 A;  4E7K A;  4KKO A;  4IFV A;  4E0D A;  1Q9Y A;  3ZSX A;  3L2U A;  3VA3 A;  4CEC A;  3OYE A;  3AVM A;  3NCI A;  4FJH A;  1EP4 A;  3OS2 A;  4EZ6 A;  3V4I A;  3RMC A;  3SZ2 A;  1N5Y A;  1B9F A;  4AHC A;  3VQ7 A;  4E7I A;  2Z1I A;  1U48 A;  3OVN A;  1VRU A;  4DS4 A;  1JKH A;  1FKP A;  4CJU A;  4FZY A;  3DOK A;  3O3H A;  2P1J A;  3JYT A;  3NBP A;  3SJJ A;  2G8F A;  5SWM A;  3AA3 A;  3AVN A;  3MEC A;  1NJZ A;  1HPZ A;  3MXM A;  4CK1 A;  4WE1 A;  2YKM A;  3NH0 A;  3KKS A;  1RIL A;  1RCH A;  3S3M A;  5EU7 A;  3OJU A;  2X6S A;  5J2Q A;  2NUB A;  3V9U A;  4KV8 A;  1IKY A;  1VSI A;  1KLN A;  1REV A;  4K8X A;  4M3Y A;  4HTU A;  1VSM A;  2D0B A;  1GOB A;  1W0H A;  2HNY A;  3KK1 A;  2HVH A;  1TAQ A;  3NFA A;  4DU3 A;  1RDA A;  3HXM A;  3TAP A;  3LZI A;  4B9V A;  3NGY A;  4M41 A;  3NE6 A;  4CEO A;  1YTU A;  3G10 A;  1JLQ A;  3QLH A;  1QSL A;  4I2Q A;  4RG8 A;  4ELT A;  1S5J A;  3U3G A;  4CJR A;  3LZJ A;  3HP6 A;  2XY6 A;  3IG1 A;  3QIP A;  4O44 A;  1NK4 A;  4N76 A;  1HQU A;  4ZTF A;  4KHQ A;  1HYZ A;  1WLJ A;  1VSK A;  1T05 A;  2KW4 A;  5CZ2 A;  4C8M A;  2G8H A;  4DQP A;  1S6P A;  1UA1 A;  4ELV A;  1CLQ A;  4IG3 A;  4DSE A;  5FDL A;  3TR8 A;  3SPZ A;  3B6P A;  4FLY A;  1F21 A;  2HND A;  3TAF A;  3AO5 A;  4J2A A;  3HST B;  4CHQ A;  1GOC A;  1NKC A;  1I3A A;  1YTA A;  3DLK A;  4O0J A;  4YFU A;  4XIU A;  3K5N A;  3QET A;  2Y1I A;  3AVI A;  4KTZ A;  1Z25 A;  3OYD A;  4HVJ A;  1U4B A;  3DRS A;  1ASU A;  4B8C A;  3IRX A;  1RDC A;  4B08 A;  3LDS A;  4CIF A;  1NK0 A;  3KK2 A;  3K5L A;  1D8Y A;  2G8K A;  1BCM A;  3M8S A;  2FBX A;  1MU2 A;  4RW8 A;  5E41 A;  4DQQ A;  2XO7 A;  4OLA A;  1HNV A;  4CEQ A;  1DLO A;  4KHN A;  3ZT2 A;  4FK2 A;  4IKF A;  2HHU A;  3V1O A;  3WNH A;  4YNQ A;  3B6O A;  1Z26 A;  4CGF A;  1RTD A;  1HNI A;  4M3W A;  3V1R A;  4J2D A;  4OGC A;  4PQU A;  2VWJ A;  4OJR A;  3AO2 A;  1L3U A;  1IG9 A;  4LH4 A;  1VK0 A;  3K5M A;  1U04 A;  1VSD A;  4CHN A;  3ZSW A;  4BWJ A;  4BDZ A;  2GUI A;  3TAG A;  2IAJ A;  2OYQ A;  4DQI A;  2P5O A;  1WAJ A;  4G1Q A;  3PX6 A;  4CJE A;  1WSJ A;  3T19 A;  3TAR A;  3VQ9 A;  4QCL A;  4DQS A;  3CFR A;  1XWL A;  4M3X A;  3T1A A;  2E4L A;  5HRS A;  3ULD A;  4FJM A;  5HRN A;  3F73 A;  3VQ4 A;  3V6D A;  1NKB A;  4LY7 A;  1RT2 A;  4CK2 A;  4N41 A;  1VSF A;  4M45 A;  1TKT A;  3NHG A;  4IDK A;  4LSN A;  1KVB A;  3AA2 A;  3G0Z A;  4DU1 A;  1KLM A;  4CED A;  2QKK A;  4K8Z A;  4CGJ A;  3K5O A;  2HHX A;  3RTV A;  3HK2 A;  1LWF A;  1VSE A;  1SKW A;  5CZ1 A;  2VG5 A;  4W5Q A;  1Q9X A;  3TAB A;  3SUO A;  3THV A;  2G8W A;  4KRE A;  1S1X A;  4CEF A;  2OPQ A;  3T3F A;  3KLH A;  3PX0 A;  2PY5 A;  3UIQ A;  1WSG A;  4F3T A;  1RTH A;  4LSL A;  5HRP A;  1RDD A;  3DRR A;  4GMJ B;  4B9L A;  5SZT A;  2KQ2 A;  3I8D A;  3TAE A;  3TAN A;  4R5P A;  4AIL C;  2IGI A;  1ZBH A;  2G8I A;  3EYZ A;  3LPT A;  4CEA A;  4DTS A;  2OZM A;  3PX4 A;  3L8B A;  4KTQ A;  1C6V A;  4ICL A;  1CZ9 A;  2XY8 A;  1EXQ A;  3NH1 A;  2XY5 A;  3L2W A;  3P83 D;  4B9N A;  1UOC A;  2RF2 A;  5K14 A;  3KD5 E;  4DFM A;  1JLC A;  2GV9 A;  3VQ6 A;  4DG1 A;  3EY1 A;  2Y1J A;  3ASM A;  1D9F A;  1TL3 A;  2E6M A;  2YV0 X;  4FM0 A;  1NJW A;  2F8T A;  3DLE A;  2X78 A;  4CF8 A;  1WSH A;  1RDB A;  3O4N A;  3SV4 A;  4PY5 A;  1LWE A;  3U6F A;  1J5O A;  4DTX A;  4KB1 A;  1ZBI A;  3HVT A;  2B4J A;  3ALY A;  4I9L A;  1B92 A;  4FLZ A;  3KLG A;  4MQ3 A;  1FXX A;  2PYJ A;  4JS5 A;  1JXE A;  3KD1 E;  1NK5 A;  2F8S A;  4CHZ A;  3K57 A;  2WOM A;  3OYM A;  5HP1 A;  1TAU A;  1HJR A;  1BI4 A;  2D0C A;  3LP1 A;  3VQC A;  3QIN A;  4RW7 A;  3OYA A;  1T03 A;  3RR8 A;  3M8P A;  4F3O A;  2QK9 A;  3NGI A;  2VG6 A;  1X1P A;  4H4M A;  3HO1 A;  2FBV A;  2ATQ A;  4RW4 A;  1UWB A;  5HRR A;  4Q0B A;  4KHU A;  3FFI A;  2P5G A;  4NCA A;  1B9D A;  1JL2 A;  1S6Q A;  4N5S A;  3L2V A;  1SKS A;  3ZCM A;  4CEB A;  4OVL A;  3OYC A;  5HBM A;  4B8A B;  2HHV A;  1LV5 A;  4KHS A;  2Z1H A;  3ZSY A;  3SYZ A;  4DLG A;  1JXB A;  1WAF A;  5CYQ A;  4CJS A;  3H08 A;  1NK7 A;  4HUF A;  3DMJ A;  2RN2 A;  4CE9 A;  4ZHR A;  4CJP A;  2D5R A;  3LAL A;  4M3R A;  3OYL A;  3OYK A;  1YVU A;  2HW3 A;  4HUE A;  4HCB A;  1QE1 A;  4FJ7 A;  3V81 A;  4DSI A;  3MAQ A;  2ETJ A;  1CZB A;  1RBV A;  2FC0 A;  5CY4 A;  3OS0 A;  3VQB A;  4DLE A;  3RMD A;  4B9T A;  3AA4 A;  2YHB A;  4IG0 A;  3AO4 A;  3AVK A;  4DF4 A;  3HPH A;  4CF0 A;  4OKJ A;  5C42 A;  4ELU A;  1S1W A;  1VSJ A;  4J2B A;  2LSN A;  4DSL A;  3KLF A;  4Z4E A;  3DLB A;  3WNE A;  2XHB A;  3I0S A;  4DTO A;  5FRM A;  2W42 A;  1U49 A;  2VWK A;  1HQE A;  3D0P A;  1C0T A;  3IS9 A;  3HL8 A;  1QTM A;  1NK8 A;  1WSI A;  3QEI A;  4QOZ B;  1BIU A;  4B9M A;  4DTM A;  2RKI A;  3OYI A;  3AO1 A;  4AHR A;  2BDP A;  3IAY A;  3DYA A;  2HHS A;  3AVB A;  1RTJ A;  2HB5 A;  4C8O A;  3HPG A;  4CGD A;  4CK3 A;  2A1R A;  1J53 A;  3RWU A;  4OPK A;  2G8U A;  5JS1 A;  4FJG A;  5KGX A;  4EP5 A;  3D45 A;  4CIG A;  4B9U A;  3MXJ A;  1W9H A;  3CM6 A;  3LP3 A;  4MFB A;  2ZE2 A;  4JRP A;  2EHG A;  2HHW A;  1DTT A;  4CES A;  3TI0 A;  3QEV A;  4KI4 A;  2F96 A;  4CEZ A;  3OJS A;  5T7B A;  4DWI A;  3ZSQ A;  4KI6 A;  2ITG A;  1RT7 A;  4O0I A;  4FLW A;  4CER A;  3S3N A;  1L5U A;  1CXQ A;  2KZZ A;  1Q8I A;  1ZBF A;  1ASW A;  3AO3 A;  2R7Y A;  4PUO A;  4W5N A;  1XC9 A;  2B6A A;  4DFP A;  3SV3 A;  1NJY A;  3AVF A;  3DI6 A;  1N6Q A;  4Z4F A;  5KGW A;  1IKW A;  3S9H A;  2XY7 A;  3VQD A;  4DF8 A;  2KZM A;  1RT1 A;  4KFB A;  4M42 A;  4O55 A;  2FBY A;  3DRP A;  3ZT0 A;  1RBR A;  1BCO A;  4Z4C A;  3VQE A;  4M3U A;  3RRH A;  1SV5 A;  4GW6 A;  1BL3 A;  4CJL A;  1KVC A;  1SL1 A;  1BI4 B;  3KLE A;  4CGI A;  3AVA A;  2A1S A;  3BGR A;  2Z1J A;  3WNG A;  4CFA A;  4FCY A;  4W5T A;  3A2F A;  1XHX A;  2OPP A;  2PZS A;  2PYL A;  4HCC A;  5HRO A;  1TK8 A;  5DMR A;  1RNH A;  1GOA A;  3CYM A;  3MEE A;  2YNG A;  1JLG A;  3LAM A;  4W5R A;  4JS4 A;  2HVI A;  1WSE A;  1BIZ A;  3V9S A;  4E7J A;  4NCG A;  3SPY A;  1RT6 A;  1TKZ A;  3LP2 A;  2OA8 A;  3RRG A;  4OLB A;  1TVR A;  2DFE A;  4Y1D A;  3C6T A;  1G15 A;  5KRT A;  1YT3 A;  3C94 A;  4UQG A;  1O1W A;  4FLU A;  1JLB A;  3TWH A;  3RR7 A;  4FYD A;  1EX4 A;  2GBZ A;  4OGE A;  4OPJ A;  4B3O A;  4CF1 A;  3HM9 A;  4DTR A;  4M3Z A;  2QKB A;  1UAX A;  3CG7 A;  1NKE A;  1IKV A;  3I0R A;  3JSM A;  2Q3S A;  4NYN A;  1A5X A;  4BE1 A;  3HPO A;  3TAQ A;  3PV8 A;  3DLG A;  1TK0 A;  4FZX C;  3L2R A;  1TK5 A;  2HHT A;  3AVH A;  1RT3 A;  3NF7 A;  4F2R A;  3VQ8 A;  5J2P A;  3PO5 A;  3VQQ A;  1QQC A;  1JLE A;  1JLF A;  4W5O A;  5J1E A;  4F8R A;  4FJI A;  3OYF A;  2WON A;  1I39 A;  3NGZ A;  4I9Q A;  1JL1 A;  3ZT3 A;  3S3O A;  4AHS A;  1KSP A;  5HLF A;  4LH5 A;  4F2S A;  3HJF A;  2O4I A;  2JGU A;  4O4G A;  3AVJ A;  3PUF A;  4Y1C A;  3SUP A;  4TSX A;  2G8V A;  1NK6 A;  2I5J A;  1BHL A;  1TKX A;  3P5J A;  4N56 A;  2ZQB A;  1C1A A;  3C6U A;  3VN5 A;  3HVR A;  3SUQ A;  1X9S A;  1KVA A;  4BDP A;  4CIE A;  1RBU A;  3SQ0 A;  2ZD1 A;  4NCB A;  4E1N A;  3QER A;  1QHT A;  5C25 A;  1S9G A;  4KHY A;  4FW1 A;  1CXU A;  3L3V A;  4CEE A;  4KAZ A;  5FRN A;  1IKX A;  4Z4I A;  4ID5 A;  1LAV A;  1EKE A;  4FJL A;  1SKR A;  3NF9 A;  4KTW A;  1KCF A;  1RT5 A;  2D0A A;  3ZSV A;  1X9W A;  4OKK A;  1WN7 A;  2O4G A;  2B5J A;  3K58 A;  2JLE A;  2BGG A;  4CJ3 A;  4DFJ A;  4AH9 A;  4E7L A;  3PO4 A;  3QEW A;  3EZ5 A;  4J2E A;  1KTQ A;  4Q5V A;  3QNO A;  1A5V A;  4F4K A;  1NOY A;  3CQ8 A;  4DU4 A;  1HMV A;  3VQA A;  4DSK A;  4FZZ A;  2FBT A;  3V9W A;  4Z4G A;  4CJ4 A;  1FKO A;  5KI6 A;  1L3T A;  2HHQ A;  4KB0 A;  3QEX A;  4FJX A;  3QES A;  1BGX T;  4LD0 A;  4JRQ A;  4PWD A;  5KTQ A;  1C0M A;  4CFC A;  1TKD A;  3LAK A;  4JLH A;  4FLT A;  3SUN A;  1EET A;  2YHA A;  3QIO A;  4CJK A;  1NK9 A;  4ZTJ A;  1IO2 A;  3LPU A;  3VA0 A;  4CJF A;  4OKE A;  1IH7 A;  4DTN A;  1SUQ A;  4AHV A;  2X6N A;  3E01 A;  4RW9 A;  1SL0 A;  1RT4 A;  3OYN A;  1S1V A;  3OYG A;  1SL2 A;  2DTU A;  2IOC A;  3MXI A;  1NJX A;  5I42 A;  5JS2 A;  3KIO A;  3CFP A;  3RMB A;  4E1M A;  2QXF A;  4KO0 A;  2KFN A;  2AJQ A;  2OPS A;  3NH2 A;  1U45 A;  3BDP A;  4FJ9 A;  1S1U A;  2IDO A;  3V1Q A;  2YNI A;  1S1T A;  3ZSO A;  3V9Z A;  4NYF A;  1HYS A;  4Z0U A;  4QAG A;  1QS4 A;  3M8R A;  4ID1 A;  5CYM A;  4AHU A;  1XI1 A;  4CJQ A;  4DSJ A;  2OZS A;  4DSF A;  1TL1 A;  1VRT A;  3VQP A;  3O3F A;  1HYV A;  3AA5 X;  1KFD A;  3QNN A;  3OYH A;  2BE2 A;  3V9X A;  1L3V A;  4RW6 A;  3MEG A;  1LW2 A;  4DTU A;  4CHO A;  5J2N A;  4CF9 A;  1LW0 A;  4BWM A;  1R0A A;  4CCH A;  1ITG A;  3HP9 A;  4CGH A;  3L2Q A;  4FK0 A;  3NF6 A;  2HNZ A;  3O4Q A;  4DTJ A;  1K6Y A;  4C8K A;  2KFZ A;  3ZSR A;  1HRH A;  1L3S A;  1J9A A;  3RMA A;  3OYB A;  3SCX A;  1C1B A;  5KRS A;  4FJ5 A;  4BAC A;  1BIS A;  3LP0 A;  3KK3 A;  5C24 A;  2DY4 A;  1ZYQ A;  5FRO A;  2YNF A;  1D5A A;  3SQ4 A;  1J54 A;  5J2M A;  3WNF A;  3KTQ A;  3QEP A;  2YNH A;  3O3G A;  5I3U A;  4EZ9 A;  3CFO A;  3QO9 A;  3TAM A;  4N47 A;  3ISN C;  5DK5 A;  4CJW A;  4E89 A;  4FM1 A;  2KTQ A;  4BDY A;  4KPY A;  4FJN A;  2E6L A;  4FM2 A;  1QSS A;  2IC3 A;  3DLR A;  1X9M A;  4CGG A;  1T7P A;  3ZSZ A;  2IS3 A;  3C95 A;  4H4O A;  3DLH A;  3NF8 A;  3SI6 A;  4M3T A;  4FK4 A;  4IFY A;  3PY8 A;  4CF2 A;  3LAN A;  4I2P A;  3NDK A;  3F9K A;  1JLA A;  4DFK A;  1UA0 A;  3MED A;  3L3U A;  1QSY A;  1KFS A;  3ZT4 A;  1RBS A;  3U3Y A;  2RPI A;  2OPR A;  4CFD A;  4E19 A;  1WNS A;  4CJT A;  4Z4H A;  4H8K A;  3K59 A;  1RTI A;  4DQR A;  4FJK A;  1VSH A;  1C1C A;  1BQN A;  4KHW A;  2DFF A;  3LWM A;  4E3S A;  1DTQ A;  3OYJ A;  4FJ8 A;  3OY9 A;  5D3G A;  2YKN A;  3VQ5 A;  4EP4 A;  1VSL A;  1U47 A;  4BE0 A;  4I7F A;  3SNN A;  3M8Q A;  2HMI A;  3CM5 A;  4IBN A;  4E7H A;  3KKR A;  1LAW A;  3DOL A;  3KJV A;  2DFH A;  3HYF A;  1T8E A;  4KRF A;  3AVC A;  3P1G A;  3NAE A;  4CHY A;  4CFB A;  4CJ5 A; 
#chains in the Genus database with same CATH topology
 3QIC A;  5EX5 A;  4FLV A;  4FOI A;  2Z1G A;  3P39 A;  2NRH A;  3DXK A;  1TV6 A;  3ENO A;  3SQ2 A;  4CJV A;  1TGO A;  3AVL A;  4O5B A;  4FVU A;  1D9D A;  3AV9 A;  4X65 K;  4HUG A;  4DS5 A;  1LWC A;  2XRI A;  4HTL A;  4OPA A;  4A62 A;  3MN7 A;  5M1K A;  3HT3 A;  4BE2 A;  2Q36 A;  3CER A;  2WBN A;  1Q9Y A;  4CEC A;  3NCI A;  3OS2 A;  3RMC A;  1N5Y A;  3VQ7 A;  1VRU A;  3QB0 A;  4DS4 A;  4WFB L;  4MDA A;  4FZY A;  1ATR A;  3O3H A;  2P1J A;  3JYT A;  3NBP A;  2G8F A;  1M1K O;  3O1B A;  1NJZ A;  3GE1 A;  3HM8 A;  3OJU A;  3FZH A;  3V9U A;  5BRF A;  5FLX O;  2O8B A;  4HTU A;  2D0B A;  2HVH A;  1GOB A;  3KK1 A;  2F4V K;  1YHQ N;  3NFA A;  3CIP A;  3NGY A;  2P9S A;  4I2Q A;  2E1Y A;  2PFU A;  4ELT A;  5C10 A;  3QIP A;  4CZK A;  4KHQ A;  4ISE A;  3DJC A;  3J80 O;  2KW4 A;  5CZ2 A;  4A59 A;  4C8M A;  3VTH A;  4DQP A;  4C1N K;  4IG3 A;  5FDL A;  2P9U B;  3U9Z A;  1VQ8 N;  3AO5 A;  4J2A A;  4CHQ A;  1NKC A;  3QET A;  1BO5 O;  3QML A;  2UUC K;  5GAG P;  3DXK B;  4B08 A;  4CIF A;  4BRM A;  3KK2 A;  4JKF A;  1MU2 A;  4RW8 A;  3NVK A;  1DLO A;  2QWM A;  3WNH A;  1Z26 A;  1RTD A;  4JK8 A;  4QS7 A;  4M3W A;  4J2D A;  4JI5 K;  4PQU A;  4LH4 A;  1U04 A;  5F1X A;  3T69 A;  3PX6 A;  4CJE A;  5AQM A;  4QCL A;  2J4R A;  2GTD A;  3NVM A;  4KH5 A;  2CGL A;  4M3X A;  4O5F A;  5HRS A;  3ULD A;  3VQ4 A;  4IZ9 A;  2ASM A;  4LSN A;  5EVZ A;  3WUH A;  2QKK A;  3IDH A;  1Q81 O;  1Q9X A;  2CH6 A;  1J6Z A;  3TAB A;  3THV A;  3K9J A;  1S1X A;  2E8A A;  3VES A;  2P9S B;  2OPQ A;  4FSV A;  1NGA A;  3UB5 A;  4YOT A;  4BRD A;  1RTH A;  1OH5 A;  3DRR A;  4B3M K;  4GMJ B;  1VQ9 N;  2KQ2 A;  5AQJ A;  3TAE A;  3VEY A;  1NGD A;  2G8I A;  5B8H A;  4BRC A;  2OZM A;  3PX4 A;  3L8B A;  4B1U B;  4ICL A;  1CZ9 A;  1EXQ A;  2XY5 A;  3P83 D;  2PAV A;  2RF2 A;  2GV9 A;  3VQ6 A;  3CME N;  2Y1J A;  4CZH A;  4B1Y B;  4IEE A;  2NNW A;  3HVT A;  2P9N A;  1B92 A;  3KLG A;  5GAE P;  3D2E B;  2PYJ A;  4K42 A;  1JXE A;  3KD1 E;  3O1W A;  3ZEU A;  5HP1 A;  2NRV A;  1HJR A;  3GG4 A;  2D0C A;  3OYA A;  3UKR A;  3M8P A;  1X1P A;  4H4M A;  2FBV A;  1VQN N;  4JYA K;  4RTF D;  4RW4 A;  4Q0B A;  3FFI A;  2P5G A;  1B9D A;  3L2V A;  3ZCM A;  4OVL A;  5HBM A;  4CBU A;  2GEM A;  3WXJ A;  4YOV A;  4WCE L;  3SYZ A;  3VMF B;  2QM1 A;  3DMJ A;  4CE9 A;  1XUP O;  3FR0 A;  2D5R A;  3LAL A;  3V81 A;  4DSI A;  4B3S K;  4DLE A;  4B9T A;  3AA4 A;  1GLF O;  3AO4 A;  3AVK A;  3H6E A;  3B8A X;  4CF0 A;  3HOS A;  1VSJ A;  2LSN A;  2QWO A;  4FL9 A;  5FRM A;  2W42 A;  1U49 A;  1XC3 A;  2VWK A;  1C0T A;  3D2F A;  5LMU K;  3IAY A;  5F2R A;  3RWU A;  3THX A;  4CGD A;  4CK3 A;  4OPK A;  5JS1 A;  3R8E A;  2KHO A;  2ZM6 K;  3D7E O;  3SJH A;  2V51 B;  3CM6 A;  1N34 K;  1U6Z A;  4MLH A;  2HHW A;  4CES A;  4LF7 K;  3QEV A;  3L0Q A;  4KI4 A;  4K43 A;  3OJS A;  4JI2 K;  4NO7 A;  4O0I A;  3S3N A;  4BRQ A;  4PKH A;  1ZBF A;  3AO3 A;  4BR0 A;  4LFA K;  1XC9 A;  3SV3 A;  5KGW A;  3MDQ A;  3S9H A;  3VQD A;  2FBY A;  3DRP A;  5AQH A;  4Z4C A;  3ZEU B;  2WFB A;  3UKR B;  1KAX A;  2H3G X;  4CFA A;  4W5T A;  4YOY A;  3A2F A;  2OPP A;  4HCC A;  1TK8 A;  5DMR A;  1RNH A;  1JLG A;  1N36 K;  1DT9 A;  2HVI A;  1WSE A;  3V9S A;  4NCG A;  2D0P A;  3VF2 A;  1TKZ A;  2QWN A;  3RRG A;  4Y1D A;  3C6T A;  5KRT A;  4BRK A;  1O1W A;  3RR7 A;  4Z94 A;  2GBZ A;  4CW7 B;  5AJ3 K;  4A2A A;  4DV3 K;  2QKB A;  3CG7 A;  1IKV A;  4NYN A;  1A5X A;  4DHY A;  1ILY A;  3HPO A;  3TAQ A;  3DLG A;  1TK0 A;  4DR5 K;  4XH1 A;  3AVH A;  3PO5 A;  1SQK A;  4JEP A;  3M5R A;  3VQQ A;  3D6R A;  1JLE A;  1JLF A;  4FJI A;  2YJE A;  4F8R A;  3NGZ A;  2W6L A;  4EHT A;  3THX B;  4TSX A;  2I5J A;  1BHL A;  1KAY A;  3SUQ A;  1GLC G;  5TKY A;  3SQ0 A;  3AAQ A;  2ZD1 A;  3QER A;  3ZLJ A;  1QHT A;  4KHY A;  2O8D A;  3L3V A;  4CEE A;  4KAZ A;  4Z4I A;  5IT9 O;  4LF9 K;  4DQ8 A;  5CHI A;  1EKE A;  1SKR A;  1QQM A;  1WN7 A;  2Q1N A;  3WXL A;  5BN9 A;  4AH9 A;  1E3M A;  3QNO A;  3AGK A;  1NOY A;  3CQ8 A;  1HMV A;  3IFR A;  2O8C B;  4B1X B;  3ZX3 A;  3Q7C A;  4BQZ A;  3P31 A;  2IIR A;  4FLT A;  3SUN A;  2BH1 A;  4YOW A;  1IJJ A;  4LFB K;  4ZTJ A;  1IO2 A;  3VA0 A;  4AHV A;  1RT4 A;  3OYN A;  4JI1 K;  3O9U A;  4CZE A;  4CBX A;  3MXI A;  2AA4 A;  4H0Y B;  3KIO A;  4WQ4 A;  3CFP A;  2QXF A;  2KFN A;  2AJQ A;  2OPS A;  3BDP A;  4FJ9 A;  1S1U A;  3ZSO A;  3V1Q A;  1S1T A;  3CQY A;  5BRD A;  4YHH K;  3U4L A;  1QS4 A;  3CJ9 A;  1XI1 A;  2HBJ A;  4U7B A;  1VRT A;  1KFD A;  2BE2 A;  1NM1 A;  1L3V A;  1NNE A;  4YY3 K;  3SBG A;  4CF9 A;  3JS6 A;  5C12 A;  3O4Q A;  1K6Y A;  1VQL N;  3ZSR A;  1HRH A;  1P90 A;  3WEE A;  3RMA A;  2P9K A;  3CJC A;  1BIS A;  3KK3 A;  4LF5 K;  5FRO A;  3SQ4 A;  4MDB A;  2NRZ A;  2UXC K;  3KTQ A;  3HTV A;  2YNH A;  2O8D B;  3CFO A;  5DK5 A;  4E89 A;  3WXI A;  1NGJ A;  4FJN A;  1QSS A;  2FSJ A;  1X9M A;  4JKG B;  3ZSZ A;  4CZL A;  2IS3 A;  2NRT A;  3C95 A;  4CVN E;  3WQU A;  4DR7 K;  1EWQ A;  3LAN A;  3SAG A;  3NDK A;  3F9K A;  3DXM B;  3L3U A;  4PKI A;  5KPZ A;  1T44 A;  4L3Q A;  2OPR A;  4E19 A;  3K59 A;  4H8K A;  4DQR A;  1VSH A;  2GWJ A;  4E3S A;  1DTQ A;  4BRA A;  2YKN A;  4QS9 A;  1NGB A;  1XQS C;  3SNN A;  4IBN A;  4E7H A;  3KKR A;  3DOL A;  3CC2 N;  1HKB A;  3DAW A;  3EL2 A;  3VEO A;  1NOZ A;  5M1P A;  4EIA A;  5JIC A;  5IWA K;  2EX3 A;  4A5B A;  3LWL A;  4DMN A;  4DKW A;  1XHZ A;  4CZJ A;  1HX1 A;  3CHW A;  3AGR A;  3MK6 A;  4BR4 A;  1BUP A;  1WSF A;  4BRG A;  4DTP A;  4PA1 A;  1Y64 A;  4C8N A;  4KKO A;  3G71 N;  3ZSX A;  1VQP N;  1EP4 A;  3MX2 A;  3V4I A;  1ESV A;  2P9K B;  3SK3 A;  3SZ2 A;  4FWS A;  4AHC A;  3G25 A;  3BF1 A;  4E7I A;  1HLU A;  5AR0 A;  1NGI A;  2O8E B;  4YDU C;  1NBW A;  2D4W A;  1K73 O;  1T6D A;  4IJN A;  4DV0 K;  3AA3 A;  3AVN A;  3MEC A;  3MXM A;  4CK1 A;  4WE1 A;  5HOO A;  2F9T A;  1RIL A;  1RCH A;  4B9Q A;  4BVO A;  5EU7 A;  5BRH A;  2NUB A;  1GLD G;  3KWG A;  1W0H A;  4BQL A;  3MX5 A;  3ULE A;  3LZI A;  3CET A;  4GV9 A;  2JWK A;  3G10 A;  4BC5 A;  1JLQ A;  3QLH A;  5H1S Q;  3U3G A;  3E9L A;  4DR2 K;  2P9P B;  2G8H A;  1UA1 A;  4FWK A;  1CLQ A;  3THY A;  4JI8 K;  4DSE A;  2Q97 A;  3CJB A;  4WFN L;  4O0J A;  3DLK A;  3K5N A;  2Y1I A;  1R59 O;  1Z25 A;  4XH4 A;  3BUZ B;  4HVJ A;  3IRX A;  1JJ2 M;  1K8K B;  1DKG D;  4BRE A;  4NXN K;  5E41 A;  5FPE A;  1HNV A;  4CEQ A;  3ZT2 A;  4JD2 A;  4FK2 A;  2HHU A;  3V1O A;  4YNQ A;  3VF6 A;  3VEW A;  2WTU A;  3AO2 A;  1L3U A;  1IG9 A;  1VK0 A;  1VSD A;  4BDZ A;  2GUI A;  2IAJ A;  4DQI A;  2P5O A;  3SMP A;  1WAJ A;  3TSU A;  3AAP A;  3T19 A;  3I56 N;  3VQ9 A;  3M3Z A;  3M1F A;  3CC4 N;  3T1A A;  2O8F A;  4FJM A;  5HRN A;  5BR8 K;  4OPH A;  4DV2 K;  4IDK A;  1KVB A;  1OH8 A;  1KLM A;  4CED A;  4CGJ A;  3HK2 A;  3ULE B;  1SKW A;  1QVG M;  5CZ1 A;  1IBM K;  4KRE A;  2D0O A;  4M63 C;  5AQP A;  4CEF A;  3T3F A;  4V19 S;  3KLH A;  3O8M A;  5DM7 L;  3UIQ A;  1WSG A;  3MN9 A;  1V4T A;  3TAN A;  4WF9 L;  4R5P A;  3EYZ A;  1YJW N;  4CEA A;  4DTS A;  3THY B;  3CJ1 A;  5AQI A;  2XY8 A;  3NH1 A;  3L2W A;  3KD5 E;  2OCE A;  1JLC A;  5AQY A;  3EY1 A;  1D9F A;  2FF3 B;  2E6M A;  4FM0 A;  3ATV A;  2V7Z A;  4CF8 A;  3O4N A;  1K8A O;  3N4Q A;  4KB1 A;  3U6F A;  2B4J A;  3ALY A;  3U9D A;  4MQ3 A;  4CZF A;  1FXX A;  3JAM O;  3ZET B;  4JS5 A;  3H45 C;  3O9T A;  2WOM A;  3OYM A;  5BN8 A;  3LP1 A;  4IEI A;  4RW7 A;  2QK9 A;  3NGI A;  2IVN A;  5LJV A;  1C0G A;  2ATQ A;  5HRR A;  3E9P A;  1BA0 A;  1JL2 A;  1SKS A;  4N5S A;  3A5L C;  3BZK A;  5CYQ A;  4CJS A;  1EQY A;  3RSE A;  4KBO A;  2EWS A;  1XNR K;  2O8F B;  2E2Q A;  1CZB A;  3RMD A;  2FC0 A;  3EEQ A;  1YJ9 N;  2YHB A;  1NGF A;  4IG0 A;  1OH7 A;  2NRX A;  1I94 K;  3DLB A;  3I0S A;  2HHH K;  4IWV A;  1QTM A;  5AQO A;  4QOZ B;  1BA1 A;  4DR1 K;  5KPR A;  4DTM A;  2RKI A;  3AO1 A;  1YXQ A;  2E2O A;  3FZK A;  3DYA A;  4NB4 A;  4AHR A;  2HHS A;  3HPG A;  5JLF A;  4FJG A;  4EP5 A;  4MFB A;  1XMO K;  3TI0 A;  4I6M A;  5F0X A;  3ZSQ A;  1RT7 A;  4FLW A;  1GLA G;  1CXQ A;  2KZZ A;  1Q8I A;  1ASW A;  4FWM A;  3IKM A;  5LY3 A;  1N6Q A;  3DI6 A;  3LDN A;  1WUA A;  4FWR A;  4X66 K;  4O55 A;  1X3N A;  3AAR A;  4Y0W A;  4LC9 B;  3VQE A;  4JI0 K;  3RRH A;  4GKK K;  4GW6 A;  1KVC A;  2QWR A;  4OO1 J;  3H1V X;  3AVA A;  3IUC A;  1YVN A;  2A1S A;  1YI2 N;  2PZS A;  1K9M O;  5HRO A;  2WUS A;  3CYM A;  1HKG A;  2O8B B;  4IJA A;  5AZI A;  2FLO A;  4E7J A;  1EWR A;  2VQF K;  2OA8 A;  1TVR A;  4JKC A;  4JHD A;  2PBD A;  3C94 A;  4FLU A;  3U8X A;  2E20 A;  3AY9 A;  3Q7B A;  4OGE A;  4OPJ A;  2KKZ A;  1UAX A;  3MN5 A;  3JSM A;  3GOI A;  2Q3S A;  4FZX C;  3L2R A;  1TK5 A;  4B1W B;  5EY4 A;  4F2R A;  3CCR N;  5J2P A;  2YI1 A;  3I55 N;  4YOU A;  4W5O A;  1JL1 A;  3ZT3 A;  2JGU A;  3O9S A;  3PUF A;  3SUP A;  3CQX A;  2G8V A;  1NK6 A;  3P5J A;  4N56 A;  2FSN A;  3HVR A;  3VN5 A;  1X9S A;  5HL7 L;  3VEN A;  1NG9 A;  4BDP A;  3ZX0 A;  5C25 A;  1S9G A;  2HF4 A;  1IKX A;  4ID5 A;  4JKD A;  1LAV A;  4BC4 A;  3O4W A;  4KTW A;  1X9W A;  1LOT B;  4E7L A;  3A0I X;  3QEW A;  4J2E A;  4KH6 A;  3C0B A;  5CR4 A;  5JVG L;  1A5V A;  1T3V A;  4B3T K;  3VQA A;  4DSK A;  4FZZ A;  2FBT A;  4Z4G A;  5AQW A;  4CJ4 A;  1L3T A;  2FSK A;  4JN4 A;  2NRR A;  2ASO A;  4FJX A;  1BGX T;  5KTQ A;  4JLH A;  1YIT N;  1EET A;  2YHA A;  3QIO A;  4CJF A;  3E01 A;  1OH6 A;  1SL2 A;  1NJX A;  5I42 A;  5JS2 A;  3ENH A;  5AQT A;  4M7Y A;  4U67 L;  3TTC A;  2YNI A;  3EE8 A;  3V9Z A;  4NYF A;  5EXW A;  4Z0U A;  4QAG A;  3M8R A;  4ID1 A;  3TU5 A;  3H3O B;  2E2P A;  4BVP A;  5FPD A;  4DSF A;  3O3F A;  3MMV A;  4BRN A;  1VAZ A;  4NLB A;  3MN6 A;  3ZYY X;  4CHO A;  3PIO L;  4EAH D;  5J2N A;  1LW0 A;  4BWM A;  1R0A A;  1KC8 O;  1S72 N;  4CGH A;  3NF6 A;  4WFA L;  1V4S A;  4GY2 B;  4C8K A;  1J9A A;  5KRS A;  2P9N B;  1D5A A;  1QQN A;  1J54 A;  1JCE A;  4JKB A;  5J2M A;  3WNF A;  3QEP A;  5I3U A;  4PHT X;  3ISN C;  3KWI A;  3F2K A;  3DLR A;  2RHK A;  5C2D A;  4H4O A;  1IG8 A;  4IXC A;  3NF8 A;  2VGN A;  2W6K A;  4DFK A;  4K41 A;  4PL7 A;  1QSY A;  4E1J A;  1W2B M;  3ZT4 A;  3CCQ N;  4H0O A;  4CFD A;  4Z4E A;  1SS6 A;  4Z4H A;  4J8F A;  1U2V A;  4H5N A;  3LWM A;  3OY9 A;  4EP4 A;  1VSL A;  1P8Z A;  4CZG A;  3CM5 A;  4GV6 A;  3KZB A;  5AQN A;  2DFH A;  3HYF A;  3LDP A;  4M7X A;  3D2F B;  3NAE A;  4JAX A;  4CFB A;  2A6A A;  2UYT A;  2YHY A;  4FPB A;  4HHT A;  4L8R B;  4FW2 A;  2VG7 A;  3FFK B;  4FLX A;  1D4X A;  3H1Q A;  3P4I A;  2BUP A;  5E26 A;  3W0L A;  3SQ1 A;  4CHP A;  4CZI A;  1TUY A;  4BG8 A;  1Y97 A;  1RBT A;  2P9L A;  2P51 A;  2Q31 A;  3MCA B;  1C0U A;  3DM2 A;  1S9E A;  4E0D A;  5AQU A;  3L2U A;  4FJH A;  1VHX A;  3AVM A;  5EOY A;  2HBL A;  3FZF A;  5AZJ A;  3I8B A;  3OVN A;  2GUP A;  1JKH A;  1NGE A;  4CJU A;  3DOK A;  1VQM N;  1KD1 O;  3SJJ A;  3PIP L;  1HPZ A;  3DWL A;  4MO4 A;  2YKM A;  3KKS A;  3S3M A;  4WQ5 A;  5LL6 Z;  3TTD A;  2X6S A;  3LDQ A;  4AM7 A;  5J2Q A;  3GBT A;  1IBL K;  1VSI A;  1KLN A;  4K8X A;  1REV A;  4M3Y A;  5LJW A;  4H0V B;  1TAQ A;  4DU3 A;  1RDA A;  5AQL A;  3HXM A;  3TAP A;  4B9V A;  4M41 A;  1RGI A;  5JVH L;  4LF8 K;  4A61 A;  3L4I A;  4CJR A;  3LZJ A;  4N76 A;  3IG1 A;  4O44 A;  1NK4 A;  1X9J A;  1VSK A;  1T05 A;  4DV1 K;  4ELV A;  4O8K A;  3B6P A;  4BRO A;  1HJO A;  2HND A;  3TAF A;  1VQ5 N;  3HST B;  2YHX A;  1GOC A;  1I3A A;  1YTA A;  4YFU A;  5KPT A;  5AFU A;  3F9M A;  2HBM A;  3DRS A;  1ASU A;  4B8C A;  4WQ4 C;  1RDC A;  1NK0 A;  3K5L A;  1BCM A;  3M8S A;  2FBX A;  2XO7 A;  3A5O C;  3B6O A;  4CGF A;  1NGG A;  2P9L B;  4OGC A;  5E84 A;  5GAH P;  1Q86 O;  1GLE G;  2FXU A;  3CPE A;  4CHN A;  3ZSW A;  4BWJ A;  2GX9 A;  2OYQ A;  5AQZ A;  2VGM A;  4G1Q A;  4C1N I;  2E88 A;  1WSJ A;  5M1O A;  4C23 A;  4DQS A;  3EE9 A;  3UKU A;  3BY5 A;  4DV6 K;  2E4L A;  1EO1 A;  4BR2 A;  4JKE A;  3VER A;  1NKB A;  3ENB A;  1RT2 A;  4LY7 A;  4CK2 A;  4N41 A;  1VSF A;  4M45 A;  1TKT A;  3NHG A;  1YIJ N;  5ADX A;  3G0Z A;  3C7N A;  4K8Z A;  2OAN A;  3K5O A;  2UU9 K;  3RTV A;  2HHX A;  3SUO A;  3CXC M;  4BG9 A;  4CJ7 A;  1RDU A;  3QDK A;  1BDG A;  2PY5 A;  1MWK A;  1RDD A;  5BPL A;  3G4S N;  3VGL A;  5SZT A;  3I8D A;  3C6A A;  4BRP A;  4AIL C;  1ZBH A;  4G9Z A;  4GNI A;  2QXL A;  2F7T A;  3FE1 A;  4A57 A;  5M1F A;  2Q2R A;  2F8T A;  1NJW A;  3DLE A;  3WEE B;  2HF3 A;  2X78 A;  3KK7 A;  4AM6 A;  1WSH A;  3CCS N;  1RDB A;  4PY5 A;  1LWE A;  1J5O A;  4DTX A;  1ZBI A;  4IOC L;  4AQY K;  2F8S A;  1NK5 A;  3KVG A;  3K57 A;  1TAU A;  1KXP A;  4GVE A;  5LMN K;  1T03 A;  3P38 A;  4F3O A;  1JCG A;  2VYP A;  5GIN A;  5C15 A;  3IMX A;  4NCA A;  1S6Q A;  3OYC A;  2VCP A;  4KH4 A;  1LV5 A;  2Z1H A;  4KHS A;  1JXB A;  1WAF A;  3H08 A;  1NK7 A;  2RN2 A;  3UKU B;  4CJP A;  3OYL A;  3VF4 A;  3OYK A;  2HW3 A;  4HUE A;  4HCB A;  3MAQ A;  1N33 K;  1RBV A;  5CY4 A;  3VQB A;  3HOT A;  1KQS M;  3HBT A;  3HPH A;  1S1W A;  4J2B A;  3C7N B;  2GEL A;  4DSL A;  1NJI O;  4GV3 A;  3EKS A;  3D0P A;  3IS9 A;  3HL8 A;  4JI6 K;  1NK8 A;  3QEI A;  1BIU A;  3RVC A;  4B9M A;  2WC9 A;  3ID8 A;  2BDP A;  1E4G T;  1NGC A;  1RTJ A;  2HB5 A;  2A1R A;  2G8U A;  1S22 A;  4ILJ A;  5KGX A;  4CIG A;  4RWT A;  4B9U A;  3LP3 A;  4JRP A;  2EHG A;  4IO8 A;  1DTT A;  3ATU A;  2F96 A;  4FWP A;  3GDQ A;  4CEZ A;  1FJG K;  2QEX N;  1HKC A;  4KI6 A;  4BC3 A;  3J81 O;  1L5U A;  4DCH A;  3LDO A;  2R7Y A;  3F5T A;  3R6M A;  3AVF A;  4Z4F A;  1IKW A;  2XY7 A;  4DF8 A;  1RT1 A;  3SBT A;  3ZT0 A;  1BCO A;  3J7A P;  1BL3 A;  2QTD A;  4H5T A;  2E5L K;  4CJL A;  2ZJP L;  4CGI A;  3CJA A;  3MWT A;  3BGR A;  1YUW A;  2Z1J A;  3WNG A;  2OTJ N;  5ELZ A;  1XHX A;  4FOE A;  2PYL A;  4OX9 K;  4FWN A;  3OHR A;  2YNG A;  3VGK A;  3HI0 A;  1NLV A;  4W5R A;  3O5B A;  3L4Q A;  3SPY A;  1HR0 K;  1VQO N;  1ZBS A;  4OLB A;  2QWP A;  3SLC A;  1G15 A;  4UQG A;  1YT3 A;  3EZW A;  2KLA A;  3LM9 A;  2YX6 A;  3TSQ A;  2YJF A;  4B3O A;  3I0R A;  4BE1 A;  5AQR A;  1HNZ K;  2HHT A;  1G99 A;  1RT3 A;  4CD3 A;  3VQ8 A;  4K25 A;  5AQV A;  1N8R O;  4IOX A;  3OYF A;  2WON A;  1JCF A;  1I39 A;  3UE5 A;  1IBK K;  4LF4 K;  1BG3 A;  4LH5 A;  4F2S A;  1XMQ K;  1WBB A;  4Y1C A;  3I33 A;  3CC7 N;  3VEZ A;  2ZQB A;  1C1A A;  4JD2 B;  1Z6R A;  1KVA A;  1N32 K;  4JKH A;  1RBU A;  4FWL A;  2AP1 A;  4E1N A;  5FRN A;  1CXU A;  5BRE A;  1E4F T;  3OA9 A;  4GKJ K;  3W3D A;  4FJL A;  1OVQ A;  3NF9 A;  1RT5 A;  2D0A A;  3ZSV A;  4OKK A;  2V52 B;  3K58 A;  3G6E N;  4CJ3 A;  4DFJ A;  3EZ5 A;  4FWQ A;  3EO3 A;  3CCU N;  4DU4 A;  3V9W A;  1FKO A;  2HHQ A;  4K0K K;  5C0Y A;  3BF3 A;  4JRQ A;  4LD0 A;  3FLC O;  4PWD A;  1TKD A;  4CJK A;  1HNX K;  4DTN A;  4OKE A;  1IH7 A;  3TTF A;  5KQD A;  1SUQ A;  2X6N A;  4QS8 A;  1MA9 B;  4B1V A;  4BGA A;  3RMB A;  1QZ6 A;  4E1M A;  4KO0 A;  3NH2 A;  1U45 A;  3WXK A;  2IDO A;  1C0F A;  3JXU A;  1HYS A;  4AHU A;  4CJQ A;  2W40 A;  4DSJ A;  1TL1 A;  3VQP A;  1HYV A;  3AA5 X;  3V9X A;  4O8U A;  4RW6 A;  3MEG A;  5JMV A;  1ITG A;  3HP9 A;  3ID6 A;  2HNZ A;  2NRW A;  5FPM A;  2ZJQ L;  3BEX A;  2KFZ A;  3L6Q A;  3CJ7 A;  4FJ5 A;  4BAC A;  1HPM A;  2DY4 A;  1ZYQ A;  2YNF A;  2ZGZ A;  4JK7 A;  3O9Q A;  3D2E A;  4EZ9 A;  2A5X A;  3TAM A;  3QO9 A;  1J5E K;  2KTQ A;  4BDY A;  4ISF A;  1YF5 L;  2E6L A;  4YOX A;  4FM2 A;  2IC3 A;  1T7P A;  1RFQ A;  4M3T A;  4IFY A;  3PY8 A;  2HOE A;  4I2P A;  3DLL L;  2QW9 A;  3WQT A;  3H3N O;  1ATN A;  1JLA A;  1UA0 A;  3RSE B;  2UUB K;  2FF6 A;  1RBS A;  3U3Y A;  2RPI A;  3VEX A;  4BR9 A;  4MLE A;  1C1C A;  4IDH A;  2DFF A;  3OBY A;  4FJ8 A;  5D3G A;  1U47 A;  3E1Y A;  4BE0 A;  4I7F A;  2HMI A;  3R3L A;  1LAW A;  1T8E A;  4KRF A;  4JKA A;  4CJ5 A;  4C8L A;  3KLI A;  3QBX A;  3OS1 A;  3ITH A;  1BQM A;  1ZBL A;  2BAN A;  4FVM A;  1BWF O;  2QA4 N;  1KRP A;  4LF6 K;  4FXD A;  1ASV A;  1A5W A;  4AHT A;  4H0X B;  4B9S A;  1FK9 A;  3AVG A;  1MWM A;  2I7N A;  4DR3 K;  2A40 A;  3PLA A;  1TUU A;  2CH5 A;  1BOT O;  2HBK A;  2X74 A;  3FGU A;  3K2P A;  4X64 K;  3ZT1 A;  1ZBU A;  4FJJ A;  4GVM A;  4CI6 A;  1BU6 O;  4I6M B;  1Q7Y O;  4E7K A;  2P9I A;  4IFV A;  3J7Y P;  3VA3 A;  3PSI A;  3OYE A;  3VTI A;  4EZ6 A;  3CCJ N;  4JI3 K;  1B9F A;  2Z1I A;  4DV4 K;  1U48 A;  3CCE N;  1WBD A;  1FKP A;  3CD6 N;  3BP8 A;  1OKJ A;  5SWM A;  3VET A;  4DB3 A;  1NMD A;  3NH0 A;  5AFU H;  3QBW A;  1VQ7 N;  4KV8 A;  1IKY A;  5AZI B;  3ZX2 A;  4DV5 K;  1VSM A;  2HNY A;  3MWP A;  4BRI A;  3WT0 A;  1IV0 A;  4DR6 K;  4CD1 A;  1YTU A;  3NE6 A;  4CEO A;  4JHD B;  1QSL A;  4RG8 A;  3E66 A;  3CCL N;  1S5J A;  3HP6 A;  2XY6 A;  1HQU A;  4ZTF A;  1HYZ A;  1WLJ A;  5AQG A;  3E9O A;  1S6P A;  2ASP A;  4CBW A;  2Q0R A;  3TR8 A;  3SPZ A;  4FLY A;  1F21 A;  2I7P A;  4XIU A;  1NU0 A;  3AVI A;  4KTZ A;  3OYD A;  1U4B A;  1DEJ A;  5TKW A;  1KAZ A;  3LDS A;  1D8Y A;  2G8K A;  4DQQ A;  4H0P A;  5ADX H;  3A5M C;  4OLA A;  5AQX A;  4KHN A;  4FWO A;  3LDL A;  4IKF A;  3LL3 A;  4EHU A;  3C65 A;  5GIP A;  1HNI A;  3V1R A;  2P9I B;  2VWJ A;  3T1H K;  1NWK A;  4H5V A;  4OJR A;  1SZ2 A;  1GLB G;  3K5M A;  3TAG A;  4ILH A;  2D1K A;  3J8A A;  2DPN A;  5AQS A;  3TAR A;  1O13 A;  1ZXO A;  3CFR A;  2O8C A;  4IFE A;  1XWL A;  3J7Z O;  3GL1 A;  2BTF A;  3CF5 L;  2UXB K;  3F73 A;  3V6D A;  3AA2 A;  4DU1 A;  3K9K A;  4EFH A;  1LWF A;  1VSE A;  4W5Q A;  2VG5 A;  4UY8 O;  3OBW A;  1GLL O;  2G8W A;  3VEV A;  3M6G A;  4H5W A;  3OTO K;  4ISG A;  2E2N A;  3PX0 A;  4F3T A;  4LSL A;  5HRP A;  1MDU B;  1T6C A;  4B9L A;  4IO9 L;  2HST A;  1QZ5 A;  2IGI A;  3CMA N;  3LPT A;  4KTQ A;  1Z05 A;  1C6V A;  4KHP K;  5AQK A;  2A3Z A;  4B9N A;  1UOC A;  4HWI A;  5K14 A;  4DFM A;  4DG1 A;  3O9R A;  3ASM A;  1TL3 A;  5AQQ A;  2YV0 X;  3TSP A;  4AF1 A;  4H0T B;  1NGH A;  2ZJR L;  3SV4 A;  2F9W A;  3KHY A;  4I9L A;  1DGK N;  3WXM B;  4RCH A;  4FLZ A;  4CHZ A;  3NMU A;  2NZT A;  3RR8 A;  1BI4 A;  3VQC A;  3QFP A;  3QIN A;  4WYB A;  3T7Z A;  1H1V A;  4H03 B;  4IOA L;  2VG6 A;  4X62 K;  3HO1 A;  4BRL A;  2IVO A;  2UXD K;  4JKG A;  1UWB A;  4KHU A;  4CEB A;  4B8A B;  2HHV A;  3ZSY A;  2QI2 A;  4DLG A;  4DUZ K;  3DXM A;  4HUF A;  4ZHR A;  1QVF M;  5FPN A;  4M3R A;  1ATS A;  1YVU A;  1HUX A;  1QE1 A;  4FJ7 A;  5M1Q A;  3R1X A;  2ETJ A;  3OS0 A;  1U2V B;  5BPN A;  4DF4 A;  5C42 A;  4OKJ A;  4ELU A;  3EKU A;  4WQ5 C;  3KLF A;  3WNE A;  4R79 A;  2XHB A;  1NMN A;  1Q18 A;  4DTO A;  1VQK N;  2ZF5 O;  1HQE A;  4DUY K;  1VQ6 N;  5MLC Q;  1WSI A;  2A41 A;  3VPZ A;  5DM6 L;  3OYI A;  3AVB A;  4C8O A;  2VWB A;  1J53 A;  5I9E B;  3D45 A;  3MXJ A;  1W9H A;  3VOV A;  4JV5 K;  2ZE2 A;  2QWL A;  2ZGY A;  2ITM A;  3BZC A;  4BR5 A;  3SAH A;  5T7B A;  4DWI A;  2ITG A;  2UUA K;  4CER A;  2Q0U A;  4W5N A;  2YCH A;  4PUO A;  2B6A A;  4DFP A;  1NJY A;  3A5N C;  1W97 L;  5AZJ B;  2KZM A;  4KFB A;  4JK9 A;  4M42 A;  4NLC A;  3O6W A;  1RBR A;  4M3U A;  3SAF A;  1SV5 A;  2CGJ A;  2O8E A;  3FZM A;  3O80 A;  1SL1 A;  1BI4 B;  3KLE A;  4BRF A;  3PSF A;  3HRG A;  4B3R K;  4FCY A;  1GOA A;  3MEE A;  3LAM A;  4JS4 A;  2CGK A;  1W7A A;  1XNQ K;  4JNE A;  1BIZ A;  1RT6 A;  3LP2 A;  2DFE A;  4F9O A;  1JLB A;  3TWH A;  4FYD A;  1EX4 A;  3FZL A;  4CF1 A;  3HM9 A;  4DTR A;  4M3Z A;  4BC2 A;  1NKE A;  5GAD P;  2P9P A;  2JWL A;  3K0S A;  4DR4 K;  1VQ4 N;  3PV8 A;  2GWK A;  5BR9 A;  3NF7 A;  4H5R A;  4XEI A;  1SAZ A;  1QQC A;  5J1E A;  5M1N A;  3LM2 A;  4I9Q A;  3S3O A;  3N4P A;  4AHS A;  1KSP A;  5HLF A;  3HJF A;  2O4I A;  4PKG A;  5JLH A;  5KQ8 A;  4O4G A;  3AVJ A;  1K8K A;  4YDU A;  1TKX A;  1X3M A;  3C6U A;  4CIE A;  1M90 O;  4NCB A;  4FW1 A;  1Q82 O;  1TYQ A;  1FW6 A;  1KCF A;  5CE3 A;  4JI7 K;  2O4G A;  2B5J A;  3THW A;  5GIO A;  2JLE A;  1RDW X;  2BGG A;  1CZA N;  3PO4 A;  3TPQ A;  1KTQ A;  4Q5V A;  4F4K A;  3OW2 M;  3MCP A;  2RE2 A;  4YOR A;  3SMS A;  4JI4 K;  2ZWH A;  5KI6 A;  4KB0 A;  3QEX A;  3QES A;  2E1Z A;  2NLX A;  1C0M A;  4CFC A;  3LAK A;  1QHA A;  1NK9 A;  3CCM N;  3EN9 A;  3LPU A;  2QWQ A;  1WB9 A;  3C6H A;  4RW9 A;  1SL0 A;  1S1V A;  3OYG A;  3HZ6 A;  2DTU A;  2YHW A;  2IOC A;  3R9P A;  4MO5 A;  4BR7 A;  4XH5 A;  3CCV N;  5CYM A;  4BY9 C;  4FO0 A;  2OZS A;  4FPA A;  3QNN A;  3OYH A;  1HNW K;  1QQO A;  1LW2 A;  4DTU A;  5C2F A;  2W41 A;  4CCH A;  3L2Q A;  4FK0 A;  1YAG A;  4DTJ A;  1S3X A;  3O08 A;  2VQE K;  4PL8 A;  1L3S A;  3OYB A;  3SCX A;  1C1B A;  1GLJ O;  3LP0 A;  5C24 A;  3ZET A;  3O3G A;  3VGM A;  1LCU A;  3QFU A;  4N47 A;  2IVP A;  4CJW A;  2HMP A;  4FM1 A;  5A2Q O;  4KPY A;  1TYQ B;  3S41 A;  1ZC6 A;  4CGG A;  1YJN N;  2V7Y A;  3THW B;  3SI6 A;  3DLH A;  3T1Y K;  4FK4 A;  4LFC K;  2OTL N;  4B1Z A;  4BRH A;  2A42 A;  4CF2 A;  3H46 O;  3MED A;  3A8Y A;  1OVY A;  4ILG B;  1KFS A;  4FJK A;  1WNS A;  4CJT A;  1RTI A;  4A5A A;  1BQN A;  4A2B A;  4KHW A;  3OYJ A;  3VQ5 A;  3HSC A;  3M8Q A;  3CI5 A;  5AQF A;  4BGB A;  2P9U A;  5BPM A;  3KJV A;  3AVC A;  3P1G A;  3CPW M;  1WOQ A;  4CHY A;  4CZM A;  4DV7 K;  4NXM K; 
#chains in the Genus database with same CATH homology
 4C8L A;  4FLV A;  3KLI A;  3OS1 A;  1NOZ A;  2Z1G A;  3ITH A;  4HHT A;  1BQM A;  4FW2 A;  2VG7 A;  4L8R B;  1ZBL A;  1TV6 A;  4FLX A;  3SQ2 A;  2BAN A;  4CJV A;  4FVM A;  2EX3 A;  1TGO A;  3AVL A;  4O5B A;  3SQ1 A;  3LWL A;  1KRP A;  4DMN A;  1XHZ A;  1D9D A;  4FXD A;  1ASV A;  1A5W A;  3AV9 A;  4AHT A;  4CHP A;  4HUG A;  4DS5 A;  4B9S A;  1LWC A;  2XRI A;  1FK9 A;  1Y97 A;  3AVG A;  1WSF A;  1RBT A;  3K2P A;  2X74 A;  4DTP A;  2P51 A;  3ZT1 A;  1ZBU A;  4PA1 A;  4GVM A;  4C8N A;  4FJJ A;  1C0U A;  3DM2 A;  3HT3 A;  1S9E A;  4BE2 A;  4E7K A;  4KKO A;  4IFV A;  4E0D A;  1Q9Y A;  3ZSX A;  3L2U A;  3VA3 A;  4CEC A;  3OYE A;  3AVM A;  3NCI A;  4FJH A;  1EP4 A;  3OS2 A;  4EZ6 A;  3V4I A;  3RMC A;  3SZ2 A;  1N5Y A;  1B9F A;  4AHC A;  3VQ7 A;  4E7I A;  2Z1I A;  1U48 A;  3OVN A;  1VRU A;  4DS4 A;  1JKH A;  1FKP A;  4CJU A;  4FZY A;  3DOK A;  3O3H A;  2P1J A;  3JYT A;  3NBP A;  3SJJ A;  2G8F A;  5SWM A;  3AA3 A;  3AVN A;  3MEC A;  1NJZ A;  1HPZ A;  3MXM A;  4CK1 A;  4WE1 A;  2YKM A;  3NH0 A;  3KKS A;  1RIL A;  1RCH A;  3S3M A;  5EU7 A;  3OJU A;  2X6S A;  5J2Q A;  2NUB A;  3V9U A;  4KV8 A;  1IKY A;  1VSI A;  1KLN A;  1REV A;  4K8X A;  4M3Y A;  4HTU A;  1VSM A;  2D0B A;  1GOB A;  1W0H A;  2HNY A;  3KK1 A;  2HVH A;  1TAQ A;  3NFA A;  4DU3 A;  1RDA A;  3HXM A;  3TAP A;  3LZI A;  4B9V A;  3NGY A;  4M41 A;  3NE6 A;  4CEO A;  1YTU A;  3G10 A;  1JLQ A;  3QLH A;  1QSL A;  4I2Q A;  4RG8 A;  4ELT A;  1S5J A;  3U3G A;  4CJR A;  3LZJ A;  3HP6 A;  2XY6 A;  3IG1 A;  3QIP A;  4O44 A;  1NK4 A;  4N76 A;  1HQU A;  4ZTF A;  4KHQ A;  1HYZ A;  1WLJ A;  1VSK A;  1T05 A;  2KW4 A;  5CZ2 A;  4C8M A;  2G8H A;  4DQP A;  1S6P A;  1UA1 A;  4ELV A;  1CLQ A;  4IG3 A;  4DSE A;  5FDL A;  3TR8 A;  3SPZ A;  3B6P A;  4FLY A;  1F21 A;  2HND A;  3TAF A;  3AO5 A;  4J2A A;  3HST B;  4CHQ A;  1GOC A;  1NKC A;  1I3A A;  1YTA A;  3DLK A;  4O0J A;  4YFU A;  4XIU A;  3K5N A;  3QET A;  2Y1I A;  3AVI A;  4KTZ A;  1Z25 A;  3OYD A;  4HVJ A;  1U4B A;  3DRS A;  1ASU A;  4B8C A;  3IRX A;  1RDC A;  4B08 A;  3LDS A;  4CIF A;  1NK0 A;  3KK2 A;  3K5L A;  1D8Y A;  2G8K A;  1BCM A;  3M8S A;  2FBX A;  1MU2 A;  4RW8 A;  5E41 A;  4DQQ A;  2XO7 A;  4OLA A;  1HNV A;  4CEQ A;  1DLO A;  4KHN A;  3ZT2 A;  4FK2 A;  4IKF A;  2HHU A;  3V1O A;  3WNH A;  4YNQ A;  3B6O A;  1Z26 A;  4CGF A;  1RTD A;  1HNI A;  4M3W A;  3V1R A;  4J2D A;  4OGC A;  4PQU A;  2VWJ A;  4OJR A;  3AO2 A;  1L3U A;  1IG9 A;  4LH4 A;  1VK0 A;  3K5M A;  1U04 A;  1VSD A;  4CHN A;  3ZSW A;  4BWJ A;  4BDZ A;  2GUI A;  3TAG A;  2IAJ A;  2OYQ A;  4DQI A;  2P5O A;  1WAJ A;  4G1Q A;  3PX6 A;  4CJE A;  1WSJ A;  3T19 A;  3TAR A;  3VQ9 A;  4QCL A;  4DQS A;  3CFR A;  1XWL A;  4M3X A;  3T1A A;  2E4L A;  5HRS A;  3ULD A;  4FJM A;  5HRN A;  3F73 A;  3VQ4 A;  3V6D A;  1NKB A;  4LY7 A;  1RT2 A;  4CK2 A;  4N41 A;  1VSF A;  4M45 A;  1TKT A;  3NHG A;  4IDK A;  4LSN A;  1KVB A;  3AA2 A;  3G0Z A;  4DU1 A;  1KLM A;  4CED A;  2QKK A;  4K8Z A;  4CGJ A;  3K5O A;  2HHX A;  3RTV A;  3HK2 A;  1LWF A;  1VSE A;  1SKW A;  5CZ1 A;  2VG5 A;  4W5Q A;  1Q9X A;  3TAB A;  3SUO A;  3THV A;  2G8W A;  4KRE A;  1S1X A;  4CEF A;  2OPQ A;  3T3F A;  3KLH A;  3PX0 A;  2PY5 A;  3UIQ A;  1WSG A;  4F3T A;  1RTH A;  4LSL A;  5HRP A;  1RDD A;  3DRR A;  4GMJ B;  4B9L A;  5SZT A;  2KQ2 A;  3I8D A;  3TAE A;  3TAN A;  4R5P A;  4AIL C;  2IGI A;  1ZBH A;  2G8I A;  3EYZ A;  3LPT A;  4CEA A;  4DTS A;  2OZM A;  3PX4 A;  3L8B A;  4KTQ A;  1C6V A;  4ICL A;  1CZ9 A;  2XY8 A;  1EXQ A;  3NH1 A;  2XY5 A;  3L2W A;  3P83 D;  4B9N A;  1UOC A;  2RF2 A;  5K14 A;  3KD5 E;  4DFM A;  1JLC A;  2GV9 A;  3VQ6 A;  4DG1 A;  3EY1 A;  2Y1J A;  3ASM A;  1D9F A;  1TL3 A;  2E6M A;  2YV0 X;  4FM0 A;  1NJW A;  2F8T A;  3DLE A;  2X78 A;  4CF8 A;  1WSH A;  1RDB A;  3O4N A;  3SV4 A;  4PY5 A;  1LWE A;  3U6F A;  1J5O A;  4DTX A;  4KB1 A;  1ZBI A;  3HVT A;  2B4J A;  3ALY A;  4I9L A;  1B92 A;  4FLZ A;  3KLG A;  4MQ3 A;  1FXX A;  2PYJ A;  4JS5 A;  1JXE A;  3KD1 E;  1NK5 A;  2F8S A;  4CHZ A;  3K57 A;  2WOM A;  3OYM A;  5HP1 A;  1TAU A;  1HJR A;  1BI4 A;  2D0C A;  3LP1 A;  3VQC A;  3QIN A;  4RW7 A;  3OYA A;  1T03 A;  3RR8 A;  3M8P A;  4F3O A;  2QK9 A;  3NGI A;  2VG6 A;  1X1P A;  4H4M A;  3HO1 A;  2FBV A;  2ATQ A;  4RW4 A;  1UWB A;  5HRR A;  4Q0B A;  4KHU A;  3FFI A;  2P5G A;  4NCA A;  1B9D A;  1JL2 A;  1S6Q A;  4N5S A;  3L2V A;  1SKS A;  3ZCM A;  4CEB A;  4OVL A;  3OYC A;  5HBM A;  4B8A B;  2HHV A;  1LV5 A;  4KHS A;  2Z1H A;  3ZSY A;  3SYZ A;  4DLG A;  1JXB A;  1WAF A;  5CYQ A;  4CJS A;  3H08 A;  1NK7 A;  4HUF A;  3DMJ A;  2RN2 A;  4CE9 A;  4ZHR A;  4CJP A;  2D5R A;  3LAL A;  4M3R A;  3OYL A;  3OYK A;  1YVU A;  2HW3 A;  4HUE A;  4HCB A;  1QE1 A;  4FJ7 A;  3V81 A;  4DSI A;  3MAQ A;  2ETJ A;  1CZB A;  1RBV A;  2FC0 A;  5CY4 A;  3OS0 A;  3VQB A;  4DLE A;  3RMD A;  4B9T A;  3AA4 A;  2YHB A;  4IG0 A;  3AO4 A;  3AVK A;  4DF4 A;  3HPH A;  4CF0 A;  4OKJ A;  5C42 A;  4ELU A;  1S1W A;  1VSJ A;  4J2B A;  2LSN A;  4DSL A;  3KLF A;  4Z4E A;  3DLB A;  3WNE A;  2XHB A;  3I0S A;  4DTO A;  5FRM A;  2W42 A;  1U49 A;  2VWK A;  1HQE A;  3D0P A;  1C0T A;  3IS9 A;  3HL8 A;  1QTM A;  1NK8 A;  1WSI A;  3QEI A;  4QOZ B;  1BIU A;  4B9M A;  4DTM A;  2RKI A;  3OYI A;  3AO1 A;  4AHR A;  2BDP A;  3IAY A;  3DYA A;  2HHS A;  3AVB A;  1RTJ A;  2HB5 A;  4C8O A;  3HPG A;  4CGD A;  4CK3 A;  2A1R A;  1J53 A;  3RWU A;  4OPK A;  2G8U A;  5JS1 A;  4FJG A;  5KGX A;  4EP5 A;  3D45 A;  4CIG A;  4B9U A;  3MXJ A;  1W9H A;  3CM6 A;  3LP3 A;  4MFB A;  2ZE2 A;  4JRP A;  2EHG A;  2HHW A;  1DTT A;  4CES A;  3TI0 A;  3QEV A;  4KI4 A;  2F96 A;  4CEZ A;  3OJS A;  5T7B A;  4DWI A;  3ZSQ A;  4KI6 A;  2ITG A;  1RT7 A;  4O0I A;  4FLW A;  4CER A;  3S3N A;  1L5U A;  1CXQ A;  2KZZ A;  1Q8I A;  1ZBF A;  1ASW A;  3AO3 A;  2R7Y A;  4PUO A;  4W5N A;  1XC9 A;  2B6A A;  4DFP A;  3SV3 A;  1NJY A;  3AVF A;  3DI6 A;  1N6Q A;  4Z4F A;  5KGW A;  1IKW A;  3S9H A;  2XY7 A;  3VQD A;  4DF8 A;  2KZM A;  1RT1 A;  4KFB A;  4M42 A;  4O55 A;  2FBY A;  3DRP A;  3ZT0 A;  1RBR A;  1BCO A;  4Z4C A;  3VQE A;  4M3U A;  3RRH A;  1SV5 A;  4GW6 A;  1BL3 A;  4CJL A;  1KVC A;  1SL1 A;  1BI4 B;  3KLE A;  4CGI A;  3AVA A;  2A1S A;  3BGR A;  2Z1J A;  3WNG A;  4CFA A;  4FCY A;  4W5T A;  3A2F A;  1XHX A;  2OPP A;  2PZS A;  2PYL A;  4HCC A;  5HRO A;  1TK8 A;  5DMR A;  1RNH A;  1GOA A;  3CYM A;  3MEE A;  2YNG A;  1JLG A;  3LAM A;  4W5R A;  4JS4 A;  2HVI A;  1WSE A;  1BIZ A;  3V9S A;  4E7J A;  4NCG A;  3SPY A;  1RT6 A;  1TKZ A;  3LP2 A;  2OA8 A;  3RRG A;  4OLB A;  1TVR A;  2DFE A;  4Y1D A;  3C6T A;  1G15 A;  5KRT A;  1YT3 A;  3C94 A;  4UQG A;  1O1W A;  4FLU A;  1JLB A;  3TWH A;  3RR7 A;  4FYD A;  1EX4 A;  2GBZ A;  4OGE A;  4OPJ A;  4B3O A;  4CF1 A;  3HM9 A;  4DTR A;  4M3Z A;  2QKB A;  1UAX A;  3CG7 A;  1NKE A;  1IKV A;  3I0R A;  3JSM A;  2Q3S A;  4NYN A;  1A5X A;  4BE1 A;  3HPO A;  3TAQ A;  3PV8 A;  3DLG A;  1TK0 A;  4FZX C;  3L2R A;  1TK5 A;  2HHT A;  3AVH A;  1RT3 A;  3NF7 A;  4F2R A;  3VQ8 A;  5J2P A;  3PO5 A;  3VQQ A;  1QQC A;  1JLE A;  1JLF A;  4W5O A;  5J1E A;  4F8R A;  4FJI A;  3OYF A;  2WON A;  1I39 A;  3NGZ A;  4I9Q A;  1JL1 A;  3ZT3 A;  3S3O A;  4AHS A;  1KSP A;  5HLF A;  4LH5 A;  4F2S A;  3HJF A;  2O4I A;  2JGU A;  4O4G A;  3AVJ A;  3PUF A;  4Y1C A;  3SUP A;  4TSX A;  2G8V A;  1NK6 A;  2I5J A;  1BHL A;  1TKX A;  3P5J A;  4N56 A;  2ZQB A;  1C1A A;  3C6U A;  3VN5 A;  3HVR A;  3SUQ A;  1X9S A;  1KVA A;  4BDP A;  4CIE A;  1RBU A;  3SQ0 A;  2ZD1 A;  4NCB A;  4E1N A;  3QER A;  1QHT A;  5C25 A;  1S9G A;  4KHY A;  4FW1 A;  1CXU A;  3L3V A;  4CEE A;  4KAZ A;  5FRN A;  1IKX A;  4Z4I A;  4ID5 A;  1LAV A;  1EKE A;  4FJL A;  1SKR A;  3NF9 A;  4KTW A;  1KCF A;  1RT5 A;  2D0A A;  3ZSV A;  1X9W A;  4OKK A;  1WN7 A;  2O4G A;  2B5J A;  3K58 A;  2JLE A;  2BGG A;  4CJ3 A;  4DFJ A;  4AH9 A;  4E7L A;  3PO4 A;  3QEW A;  3EZ5 A;  4J2E A;  1KTQ A;  4Q5V A;  3QNO A;  1A5V A;  4F4K A;  1NOY A;  3CQ8 A;  4DU4 A;  1HMV A;  3VQA A;  4DSK A;  4FZZ A;  2FBT A;  3V9W A;  4Z4G A;  4CJ4 A;  1FKO A;  5KI6 A;  1L3T A;  2HHQ A;  4KB0 A;  3QEX A;  4FJX A;  3QES A;  1BGX T;  4LD0 A;  4JRQ A;  4PWD A;  5KTQ A;  1C0M A;  4CFC A;  1TKD A;  3LAK A;  4JLH A;  4FLT A;  3SUN A;  1EET A;  2YHA A;  3QIO A;  4CJK A;  1NK9 A;  4ZTJ A;  1IO2 A;  3LPU A;  3VA0 A;  4CJF A;  4OKE A;  1IH7 A;  4DTN A;  1SUQ A;  4AHV A;  2X6N A;  3E01 A;  4RW9 A;  1SL0 A;  1RT4 A;  3OYN A;  1S1V A;  3OYG A;  1SL2 A;  2DTU A;  2IOC A;  3MXI A;  1NJX A;  5I42 A;  5JS2 A;  3KIO A;  3CFP A;  3RMB A;  4E1M A;  2QXF A;  4KO0 A;  2KFN A;  2AJQ A;  2OPS A;  3NH2 A;  1U45 A;  3BDP A;  4FJ9 A;  1S1U A;  2IDO A;  3V1Q A;  2YNI A;  1S1T A;  3ZSO A;  3V9Z A;  4NYF A;  1HYS A;  4Z0U A;  4QAG A;  1QS4 A;  3M8R A;  4ID1 A;  5CYM A;  4AHU A;  1XI1 A;  4CJQ A;  4DSJ A;  2OZS A;  4DSF A;  1TL1 A;  1VRT A;  3VQP A;  3O3F A;  1HYV A;  3AA5 X;  1KFD A;  3QNN A;  3OYH A;  2BE2 A;  3V9X A;  1L3V A;  4RW6 A;  3MEG A;  1LW2 A;  4DTU A;  4CHO A;  5J2N A;  4CF9 A;  1LW0 A;  4BWM A;  1R0A A;  4CCH A;  1ITG A;  3HP9 A;  4CGH A;  3L2Q A;  4FK0 A;  3NF6 A;  2HNZ A;  3O4Q A;  4DTJ A;  1K6Y A;  4C8K A;  2KFZ A;  3ZSR A;  1HRH A;  1L3S A;  1J9A A;  3RMA A;  3OYB A;  3SCX A;  1C1B A;  5KRS A;  4FJ5 A;  4BAC A;  1BIS A;  3LP0 A;  3KK3 A;  5C24 A;  2DY4 A;  1ZYQ A;  5FRO A;  2YNF A;  1D5A A;  3SQ4 A;  1J54 A;  5J2M A;  3WNF A;  3KTQ A;  3QEP A;  2YNH A;  3O3G A;  5I3U A;  4EZ9 A;  3CFO A;  3QO9 A;  3TAM A;  4N47 A;  3ISN C;  5DK5 A;  4CJW A;  4E89 A;  4FM1 A;  2KTQ A;  4BDY A;  4KPY A;  4FJN A;  2E6L A;  4FM2 A;  1QSS A;  2IC3 A;  3DLR A;  1X9M A;  4CGG A;  1T7P A;  3ZSZ A;  2IS3 A;  3C95 A;  4H4O A;  3DLH A;  3NF8 A;  3SI6 A;  4M3T A;  4FK4 A;  4IFY A;  3PY8 A;  4CF2 A;  3LAN A;  4I2P A;  3NDK A;  3F9K A;  1JLA A;  4DFK A;  1UA0 A;  3MED A;  3L3U A;  1QSY A;  1KFS A;  3ZT4 A;  1RBS A;  3U3Y A;  2RPI A;  2OPR A;  4CFD A;  4E19 A;  1WNS A;  4CJT A;  4Z4H A;  4H8K A;  3K59 A;  1RTI A;  4DQR A;  4FJK A;  1VSH A;  1C1C A;  1BQN A;  4KHW A;  2DFF A;  3LWM A;  4E3S A;  1DTQ A;  3OYJ A;  4FJ8 A;  3OY9 A;  5D3G A;  2YKN A;  3VQ5 A;  4EP4 A;  1VSL A;  1U47 A;  4BE0 A;  4I7F A;  3SNN A;  3M8Q A;  2HMI A;  3CM5 A;  4IBN A;  4E7H A;  3KKR A;  1LAW A;  3DOL A;  3KJV A;  2DFH A;  3HYF A;  1T8E A;  4KRF A;  3AVC A;  3P1G A;  3NAE A;  4CHY A;  4CFB A;  4CJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...