3AO5A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
135
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
molecule keywords POL polyprotein
total genus 49
structure length 135
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao5A00
2IDOA 3ITHA 5FROA 1NOYA 1LWEA 1NJWA 1L5UA 3AA5X 4GVMA 4N47A 2B5JA 1T03A 3KD5E 4J2AA 1BQMA 5HRSA 1XWLA 5J2MA 3B6PA 1U4BA 1KTQA 3SPYA 3KJVA 3VA3A 2IS3A 4LSLA 3RRGA 2E6LA 3LPTA 5HP1A 4C8LA 4FLYA 1S1UA 4CJKA 4CESA 3HVRA 1U45A 4DSIA 4E7LA 4Z4EA 3EY1A 4OPKA 4CEZA 4CJQA 4DU3A 4AHRA 1EP4A 1S6QA 3OS1A 2Y1IA 3SUPA 4ZTJA 3CYMA 4KTZA 1S1VA 3VQBA 1BHLA 4FLUA 3TAQA 3U3GA 1WSIA 3O4QA 4B9NA 2Z1JA 3IG1A 4FK4A 4O4GA 4CE9A 3AO1A 4AILC 1SUQA 3AVMA 3BGRA 4DTNA 3BDPA 1VRUA 3KIOA 3MAQA 3ZT4A 1EXQA 2B6AA 3DYAA 1JL2A 1QE1A 2YHBA 3AO4A 4N5SA 3HM9A 4DFJA 1NKCA 2O4IA 4E7JA 4CJTA 4DU4A 2D0BA 4F2SA 3VQDA 3KLIA 1NKBA 1NJXA 4Z4CA 3QESA 1QSLA 1ASUA 3K58A 3AVBA 1JLCA 1DTTA 2ATQA 2VG6A 3SQ4A 4FJJA 3HK2A 4CGFA 2BDPA 3QEVA 1RT1A 4FJGA 4CK2A 4AH9A 3DLRA 4RW9A 4J2EA 3ZSOA 3I0RA 3C6TA 3ULDA 2JGUA 2HHVA 2OPPA 4CFBA 1RDAA 3WNFA 2KFNA 2NUBA 4C8OA 1NOZA 1XC9A 4HUEA 1X9WA 3O4NA 2OZMA 1RT6A 1WSEA 1BCMA 2W42A 2HMIA 3AO2A 2P51A 3TAMA 3JYTA 1NK5A 2YNGA 3HP9A 1L3VA 1U47A 3ZSYA 4AHVA 3K5LA 5CYQA 4M45A 3NAEA 2P5GA 3SV3A 1RBSA 2ETJA 2OYQA 1I39A 3SJJA 4FLZA 2Y1JA 4RW6A 1TAUA 1N5YA 3PUFA 3DRPA 3PO4A 3AVKA 4DU1A 3HXMA 2FBYA 3H08A 4CJLA 4KO0A 1TK8A 3L2WA 3ZCMA 3VQ4A 2KW4A 4CJ5A 4M41A 4KI4A 1BL3A 1R0AA 3ISNC 2KTQA 2HVHA 3P1GA 4DQRA 1CZBA 4ELUA 1Z26A 2E6MA 1Q9XA 3QNNA 1TKTA 4CHPA 2HHQA 4E19A 3O3FA 3NGYA 2PY5A 1C0UA 4EP5A 1UOCA 3QINA 2F8TA 2XY5A 3E01A 3V1OA 3VQ8A 2ZQBA 1FXXA 2IAJA 5DK5A 3QNOA 2HNDA 5I42A 4Y1CA 4KPYA 1Z25A 3B6OA 3ZSZA 4FVMA 4FM2A 1NKEA 2DTUA 4B9TA 1S5JA 4AHSA 2XY6A 1B92A 4B3OA 4C8MA 4E0DA 1QQCA 1CZ9A 2P5OA 1WSJA 4W5TA 3AVLA 3OVNA 1TKDA 2HNYA 2DY4A 1UA0A 3KK3A 4KHYA 3RR8A 2OPSA 5KGWA 3OYDA 4KHQA 4OLBA 2P1JA 4Y1DA 4CJVA 4DSFA 1J5OA 1C1CA 1JXEA 1LV5A 5KRSA 1HNIA 4CGGA 4HUGA 4OPJA 5J2QA 3TARA 4B9MA 4PUOA 4KHUA 3ZT2A 3DI6A 1YTUA 4N41A 4BE2A 3FFIA 3IS9A 3OYNA 4CIGA 4DTJA 4CFDA 1RT5A 3U3YA 2GV9A 5FDLA 1IH7A 3OS2A 3OYLA 3OYJA 4F3OA 3T19A 1QTMA 4FJ8A 4FM0A 1TK0A 5HRPA 4QCLA 3TAPA 4M3WA 2HB5A 3LALA 3RMBA 4L8RB 3DLBA 4RG8A 4IG3A 3T1AA 4Q5VA 3VQ9A 3NH0A 3SV4A 1WSFA 1C1BA 4CHOA 1S1XA 1BGXT 3OY9A 3RMCA 1D8YA 3D45A 4BACA 3HPHA 1IO2A 1MU2A 1O1WA 4CJ4A 5J2PA 4OGCA 5SWMA 1IG9A 3SCXA 4C8NA 3AO5A 3D0PA 1CLQA 2OPRA 4KI6A 2G8UA 4FW1A 3QIPA 3OYEA 4B8AB 3RR7A 4Z4IA 3K5NA 3NH1A 2X6NA 4M3RA 3L2UA 4OKKA 2F96A 1W0HA 4H8KA 4AHCA 4DTOA 2G8KA 4B08A 4FJ7A 3EYZA 4JLHA 2DFEA 4BE1A 2RF2A 3S3NA 3DOKA 1KSPA 4FJIA 1SL2A 1VSLA 1ZBUA 3LPUA 1VSEA 4N76A 4QOZB 1C0TA 3U6FA 2HHTA 3M8SA 3RMDA 1J9AA 1LWCA 3AVNA 3O3GA 4IG0A 3KTQA 4FJXA 1JLEA 1ZBFA 1TGOA 1YT3A 3LZJA 4DMNA 1ZBHA 2QK9A 4M3XA 1KVBA 4ID1A 4CEAA 4DS4A 4DTXA 3C95A 3TWHA 1CXUA 4LSNA 3KD1E 2D0AA 3F9KA 1U04A 4O55A 4CJEA 4BDZA 1WAJA 4Q0BA 4KB0A 3DMJA 1IKWA 3WNGA 3C6UA 3NDKA 2BE2A 4JRQA 4EP4A 4IKFA 3KK2A 3OJUA 4CEFA 4DLGA 1RT2A 3SQ0A 4F4KA 4KHNA 3DM2A 3SUNA 1XHXA 1TL1A 1TV6A 4CJ3A 3MEDA 4K8ZA 1U48A 1EETA 3PX4A 4I2QA 4FJ9A 1TK5A 3V9UA 3QLHA 1RBVA 4E89A 2WOMA 4K8XA 1DLOA 3S3OA 4CCHA 1KRPA 2AJQA 1ZYQA 4WE1A 3SI6A 3VQ5A 3HO1A 3ZSVA 4BE0A 2DFFA 3OYKA 4FZXC 4M3ZA 1B9DA 1RT7A 4LH4A 1SV5A 4YFUA 3OYHA 3LZIA 4HHTA 4W5NA 4OKJA 3VQQA 1RTIA 1JLBA 4OVLA 3O3HA 4C8KA 4E1MA 1A5XA 1KLMA 1TAQA 4ICLA 4CJWA 3ASMA 1REVA 2E4LA 1HQUA 3S3MA 1G15A 4RW8A 2PYLA 1FKPA 2GBZA 4H4MA 4CGIA 4CK1A 1QSYA 4JRPA 5EU7A 3AA2A 4KTWA 4DTRA 4DFMA 1Q8IA 3ZSRA 4OKEA 3IAYA 3CQ8A 4FJKA 1UWBA 1U49A 3M8RA 3DLKA 3QEWA 2EHGA 2RPIA 1WSHA 2OPQA 2QKKA 4B9UA 1X9MA 4HCBA 1JXBA 4DF4A 4W5QA 2LSNA 5CZ1A 3T3FA 4I7FA 3V4IA 3SPZA 1VRTA 4FLVA 3CFOA 5KI6A 4DFPA 4EZ9A 1KVAA 3AVHA 2X78A 4O0IA 3VN5A 4RW4A 3RRHA 3V81A 1SL0A 1DTQA 4CEQA 4DLEA 4DSJA 4EZ6A 1RTJA 2OZSA 2FBTA 1RBTA 4FK2A 5DMRA 5KTQA 1BQNA 4KV8A 4FYDA 1W9HA 3ZSWA 1VSIA 3PX0A 1J54A 2Z1HA 3P83D 1KFSA 1L3SA 3DRRA 3VQEA 1C6VA 4LD0A 1NK6A 1VK0A 4KKOA 5FRMA 2D5RA 3ZSXA 4AHUA 1HYVA 1RT3A 4PA1A 3PX6A 4J2BA 4FJLA 1S1WA 1YVUA 3PO5A 1I3AA 4FLTA 1NJZA 4DWIA 4ELTA 1KLNA 2BANA 1NK9A 1ASWA 3HT3A 4FLWA 4YNQA 4PQUA 3KLHA 4CF1A 3VQAA 2VG7A 3NF6A 3QEPA 4IFYA 5KRTA 4B9SA 2YKNA 1GOBA 4DTUA 1VSHA 5HROA 4M42A 2X6SA 1QSSA 3KLGA 1VSFA 3LP3A 1RDDA 4OLAA 1HYSA 5HRNA 2ZD1A 3AVAA 3MXMA 3V1QA 4CEOA 4I9QA 3SQ1A 2HVIA 2G8IA 4CHZA 3NF7A 4R5PA 4FM1A 3AVJA 4HTUA 4E1NA 3MECA 4CF2A 1IKVA 3SUQA 4FZYA 1JLFA 4CEEA 5FRNA 4TSXA 1KVCA 4DF8A 3K59A 4FJMA 4LH5A 4PY5A 3V1RA 5CYMA 3THVA 4CHNA 4FJ5A 1EX4A 2ZE2A 2QXFA 3QETA 3TI0A 3K57A 4Z0UA 3IRXA 2XY7A 1C0MA 3HYFA 4E7IA 1BI4B 5C42A 3K5MA 2KZZA 1X9SA 3MXJA 1T7PA 3NF9A 4ID5A 2FBVA 2QKBA 4ZTFA 4NCAA 1HPZA 3DRSA 3TABA 4NCGA 4PWDA 4UQGA 4I9LA 1C1AA 4CJUA 4DG1A 3HP6A 1NK0A 1SKWA 4DQIA 3L2VA 4DSKA 4CGHA 4DQSA 5J2NA 3K2PA 4HVJA 5J1EA 3TAGA 1KFDA 4NYNA 1JLQA 2Z1GA 1NJYA 2D0CA 3OS0A 3HJFA 1VSDA 5SZTA 4KFBA 4LY7A 4BDPA 4IFVA 1WNSA 1RTDA 3M8PA 4FXDA 2Q3SA 4W5OA 3DLEA 3HPOA 4KAZA 3UIQA 3KKSA 2KFZA 3RWUA 2XRIA 3G0ZA 1Q9YA 1Y97A 1WN7A 4MFBA 5CY4A 3HPGA 1HMVA 1F21A 1RT4A 3AVGA 3M8QA 1QHTA 3TR8A 1YTAA 4OGEA 3WNHA 3LDSA 3CFPA 2PZSA 3CG7A 1J53A 4FK0A 3VQCA 4FCYA 4DQPA 2RKIA 1S9GA 5E41A 4F2RA 3NGZA 3L2RA 4J2DA 4JS5A 3KK1A 4CGDA 4FZZA 1JL1A 3NE6A 1LW2A 4DSLA 3VA0A 4ELVA 3OYAA 5D3GA 3NH2A 3QERA 4M3YA 2I5JA 3OYGA 4DS5A 2PYJA 4O44A 3ZSQA 4AHTA 1SL1A 1BIZA 3SNNA 1NK4A 3OYMA 3OYFA 3ALYA 2IOCA 4FJHA 4DFKA 4NYFA 4Z4HA 1JLAA 4M3TA 3AV9A 4CECA 1HJRA 1HYZA 1TKZA 5HBMA 3ZT1A 4CJPA 2HHXA 3NBPA 5JS1A 1QS4A 3CM5A 3L3VA 1VSKA 1JLGA 4Z4FA 4DTSA 1FK9A 2VWJA 3TAEA 2XY8A 1L3UA 4B9VA 4KHSA 4CF0A 4FW2A 1D9DA 1SKRA 3SZ2A 3DLHA 1RNHA 1SKSA 4E7KA 2G8HA 3CFRA 3NFAA 1LAVA 5I3UA 1XI1A 4M3UA 2BGGA 1RBUA 3CM6A 2IC3A 2X74A 4N56A 3V9ZA 2OA8A 5KGXA 2VWKA 3EZ5A 4DTPA 3V6DA 3P5JA 5HRRA 1S9EA 3HVTA 3NHGA 2HNZA 1FKOA 4CIFA 1HNVA 3I8DA 1D5AA 3AVCA 3AVFA 4RW7A 2XHBA 2Z1IA 3LAKA 4FLXA 3MEEA 1VSMA 1RCHA 1JKHA 4DSEA 1VSJA 1S1TA 4W5RA 3OJSA 4HUFA 1A5WA 3LP1A 4QAGA 4BWJA 4DTMA 4CF9A 3VQ6A 3DOLA 4CFAA 3JSMA 2HW3A 4F3TA 3F73A 1T05A 2DFHA 3AA3A 1BISA 3ZT3A 4E7HA 1NK7A 2G8VA 4BDYA 3SQ2A 1XHZA 3G10A 1A5VA 3NF8A 5C24A 1BCOA 4E3SA 3QIOA 3NCIA 4HCCA 1HQEA 3ZT0A 2YNIA 2YKMA 3OYBA 3L3UA 1N6QA 1WSGA 3LP2A 1RILA 3KKRA 3A2FA 2R7YA 1CXQA 4KTQA 3V9SA 1RBRA 4CK3A 3VQPA 1IKYA 3LAMA 2A1SA 2ITGA 1L3TA 2WONA 3QEIA 3I0SA 2FC0A 4O5BA 2KQ2A 2G8FA 2A1RA 4KREA 4CJFA 5HLFA 3C94A 2EX3A 2XO7A 1TVRA 1IKXA 3AVIA 5CZ2A 1KCFA 4IDKA 4B9LA 1GOAA 3QO9A 1WLJA 4B8CA 1RDCA 3L8BA 3LANA 3L2QA 1NK8A 4CF8A 2G8WA 5C25A 2VG5A 4JS4A 4CIEA 3AA4A 1X1PA 1TKXA 3V9WA 3LP0A 1BI4A 3AO3A 4MQ3A 3TANA 1LW0A 5T7BA 3QEXA 4F8RA 2RN2A 5JS2A 3RTVA 2GUIA 1S6PA 4CHYA 1LWFA 2IGIA 2YNHA 3MEGA 4BWMA 4GMJB 3RMAA 1B9FA 4KRFA 1GOCA 3HSTB 3TAFA 2B4JA 1WAFA 4GW6A 4KHWA 1T8EA 4CEBA 1K6YA 3WNEA 4NCBA 4O0JA 1TL3A 4I2PA 3HL8A 3VQ7A 2YHAA 2HHUA 5K14A 4CFCA 3KLFA 1UAXA 1RDBA 4DQQA 1ZBLA 2YV0X 4CJSA 1UA1A 3PY8A 2KZMA 4ZHRA 3NGIA 4IBNA 4CJRA 2FBXA 4CGJA 4XIUA 1ZBIA 4Z4GA 4H4OA 3K5OA 4CERA 2O4GA 1EKEA 2YNFA 3LWLA 2HHSA 3LWMA 3S9HA 1RTHA 3SUOA 3OYIA 1LAWA 4G1QA 4OJRA 3DLGA 4CEDA 4KB1A 4FJNA 3OYCA 2HHWA 1ASVA 1ITGA 3SYZA 3KLEA 1BIUA 4CHQA 3MXIA 1HRHA 2JLEA 2F8SA 3PV8A 3V9XA 1D9FA
chains in the Genus database with same CATH superfamily
2IDOA 4BGBA 5FROA 1LWEA 4EFHA 2B5JA 4BRHA 3RVCA 3CCQN 2OTJN 4CD3A 3M3ZA 3VA3A 2E6LA 5HP1A 4C8LA 3WT0A 4CESA 4E7LA 4OPKA 4B9QA 1OVYA 3CJCA 4KTZA 4GY2B 3VQBA 1BHLA 1RFQA 3U3GA 3NVMA 5BR8K 3G71N 3BDPA 4B1ZA 1N32K 3ZT4A 3AY9A 2B6AA 3AO4A 5AQLA 2FLOA 4DU4A 2D0BA 3THWA 2ITMA 3KLIA 3SK3A 3VQDA 2A41A 2BTFA 2YJEA 1NJXA 5FPDA 1JLCA 1DTTA 3SQ4A 4B3SK 2UXBK 4NB4A 3EE9A 3KK7A 3DLRA 3I0RA 4M7YA 3VGKA 2GUPA 1JCFA 2KFNA 1X9WA 2OZMA 4JHDA 1ATSA 2NNWA 3QB0A 4M45A 2ETJA 1ATRA 3LDQA 4RW6A 4C1NI 2Y1JA 4JKHA 3HXMA 3H08A 2D0PA 2ZGZA 4JHDB 1BL3A 1R0AA 4DV6K 5AQGA 1Z26A 1Q9XA 3QNNA 1TKTA 4U67L 4EP5A 1E3MA 1NGJA 3E01A 3V1OA 2IAJA 3QNOA 3ZSZA 4FM2A 2YCHA 1NKEA 2XY6A 1B92A 4C8MA 1CZ9A 1WSJA 3OVNA 4J8FA 5H1SQ 4QS7A 2F9WA 4JI8K 4Y1DA 3A5OC 1JXEA 3ENBA 5J2QA 2KHOA 1YTUA 3OYNA 4CIGA 2GV9A 5FDLA 3ULEA 3OS2A 4RWTA 3T19A 1WOQA 2VWBA 4FJ8A 4FM0A 3D2FA 3TAPA 1J6ZA 3LALA 3RMBA 3DLBA 3NH0A 2E2PA 3VQ9A 4DQ8A 4CBUA 4IZ9A 2YX6A 1S1XA 1BGXT 3P38A 3D45A 3MN7A 4CJ4A 3BUZB 2NRWA 5IWAK 3H6EA 2O8BB 3KWGA 4JK7A 1CLQA 2KKZA 3QIPA 4MO5A 3RR7A 2CGJA 4A62A 1HR0K 3L2UA 2P9SB 1QQOA 2F96A 3RSEA 1Q81O 4B08A 1FJGK 3FR0A 3O80A 4BE1A 2RF2A 4DV3K 3DOKA 4FJIA 1SL2A 2D0OA 4IEIA 1IBKK 4LF7K 3M8SA 3DXKA 3HRGA 1LWCA 4BG8A 1TGOA 5AZIA 4YHHK 4M3XA 1KVBA 4ID1A 2NRVA 3C95A 3TWHA 4O55A 1U04A 1QHAA 2VQFK 3CJAA 4CZKA 3CHWA 2BE2A 5EOYA 3BZKA 3EE8A 4DLGA 1VQ5N 3DJCA 3MEDA 4BROA 4I2QA 4E89A 1XUPO 3S3OA 1ZYQA 4DCHA 1C0FA 3HO1A 4FZXC 1B9DA 3CC7N 4YFUA 2A40A 4OKJA 3CCVN 1JLBA 4OVLA 3SMSA 4E1MA 5BRHA 3H46O 3OW2M 3ASMA 4MO4A 5AQIA 3GBTA 2PYLA 2W6LA 4CGIA 1N8RO 3U4LA 4YORA 4JRPA 5EU7A 4DTRA 2YHWA 4B1VA 3ZSRA 4OKEA 3CQ8A 1HX1A 1UWBA 2RPIA 2OPQA 4B9UA 3LL3A 4DF4A 2LSNA 5CZ1A 3ID8A 3SPZA 3LDLA 4FLVA 3CFOA 5AQMA 4O0IA 3VN5A 3RRHA 4EZ6A 4F9OA 1DTQA 4DLEA 4JK9A 1BU6O 4H5TA 1DGKN 5KTQA 2E1ZA 1NK6A 4AHUA 4J2BA 5CE3A 3JXUA 4FJLA 1I3AA 4DWIA 2BANA 3SLCA 1DT9A 5M1QA 4M42A 1GOBA 2X6SA 4H0OA 3MK6A 4ISFA 3LP3A 4BRQA 1RDDA 3H1VX 1HYSA 3IMXA 2E20A 3THYB 2G8IA 4Z94A 2UUCK 5GAHP 3NF7A 4FM1A 4HTUA 4E1NA 3W0LA 4CEEA 5FRNA 4TSXA 4FJMA 3A5MC 2QWQA 5M1OA 3IRXA 1KQSM 3MMVA 1VQMN 3K5MA 2KZZA 1T7PA 2QKBA 4RTFD 4LFBK 1HPZA 3DRSA 2UUBK 4PWDA 2Q31A 4DG1A 3HP6A 4DSKA 3K2PA 4H0XB 4PKHA 3TAGA 3OS0A 5AZIB 4LY7A 1RTDA 3KKSA 3RWUA 2XRIA 4CVNE 1YIJN 2F7TA 3HPGA 1CZAN 2RE2A 3M8QA 1YTAA 4OGEA 3LDSA 3VOVA 3WXJA 3C6AA 2RKIA 2P9PA 3NGZA 3Q7BA 4CGDA 3VA0A 4ELVA 3MCPA 2QI2A 5FPNA 3QERA 2I5JA 4DS5A 4K41A 4O44A 1OKJA 3ZSQA 2O8BA 2AA4A 2QXLA 4BVOA 1BIZA 1NK4A 2RHKA 1RGIA 4DV2K 4FJHA 4DFKA 4M3TA 3VF2A 4CECA 3CM5A 3L3VA 1VSKA 3TSQA 1FK9A 4B9VA 3AAPA 1SKRA 3SZ2A 3DLHA 1SKSA 4E7KA 3M5RA 3CFRA 3KHYA 2GX9A 3NFAA 5FLXO 1RBUA 1NGFA 2IC3A 4M7XA 4N56A 5KGXA 1P90A 4IO8A 3E9PA 3CCSN 2Z1IA 4FLXA 2NZTA 1GLDG 2ZM6K 1A5WA 3E9OA 4DTMA 4CFAA 3JSMA 2P9NA 3THXB 1BISA 1NK7A 2G8VA 4BDYA 4B3RK 1XHZA 3G10A 3NF8A 5C24A 1BCOA 2Q0UA 4FOEA 3NCIA 1HNZK 4BQLA 1HQEA 3ZT0A 3L3UA 4JEPA 3NMUA 1NLVA 2BUPA 5GIOA 1CXQA 3FLCO 1RBRA 4V19S 4MLEA 3FFKB 2WONA 3CC2N 4O5BA 3TTDA 2KQ2A 1QQNA 3MN9A 4CZEA 4KREA 3C94A 4B9LA 5CZ2A 1IV0A 4G9ZA 3UKRB 2GTDA 4B8CA 1RDCA 3L2QA 1HKGA 1RDUA 1BI4A 3AGKA 3LP0A 4MQ3A 1XNRK 5T7BA 4JD2B 4F8RA 2RN2A 5JS2A 5HOOA 3VEVA 4CHYA 1VQON 3VPZA 1YUWA 3RMAA 2DPNA 1WBDA 5GINA 3AAQA 1VQNN 4BY9C 3HSTB 3VENA 3TAFA 1TUUA 3VQ7A 3EN9A 4CFCA 1UAXA 3THWB 3R6MA 2P9NB 4WQ5A 2FBXA 3K5OA 2YNFA 4KB1A 3DLGA 4BC3A 4KHPK 3OYCA 3F2KA 3O1BA 1ITGA 4CHQA 3W3DA 3U9DA 3KD5E 4GVMA 4LF4K 5IT9O 4LFCK 1U4BA 3KJVA 3VESA 1S1UA 2NRXA 3N4PA 3HBTA 1U45A 4CEZA 3J7YP 1EP4A 3OS1A 1BO5O 5ELZA 1S1VA 4FWLA 3HI0A 1WSIA 2ZGYA 3O4QA 4JKAA 1ILYA 2Z1JA 1MWKA 3IG1A 4O4GA 4B3MK 4FK4A 4AILC 3ZETB 3AVMA 3U9ZA 4DTNA 5AZJB 3KIOA 1EXQA 2P9PB 1JL2A 2YHBA 5JMVA 2OCEA 4WQ4C 4EIAA 4N5SA 4E7JA 4CJTA 4F2SA 3D2EA 5C10A 1NKBA 3J80O 3O9QA 3K58A 2VG6A 1NG9A 4FJGA 1YITN 4RW9A 4J2EA 3C6TA 2OPPA 3ATVA 4BRDA 1VAZA 5KQ8A 1XC9A 2W42A 1BCMA 4K25A 3CC4N 4GV3A 4DR1K 2P51A 3JYTA 3HP9A 5E26A 4WFNL 4O8KA 3ZSYA 1Q18A 5CYQA 3UE5A 3NAEA 2OYQA 5FPMA 3J7ZO 2E8AA 1TAUA 4IEEA 3PO4A 4DU1A 4DR7K 2FBYA 4BRLA 4KO0A 2HMPA 3L2WA 2KW4A 4FPAA 2A6AA 3ISNC 1SS6A 3JAMO 4DQRA 4ELUA 4DHYA 1C0UA 2F8TA 3QINA 3LM9A 2ZQBA 5DK5A 5GIPA 2HNDA 3B6OA 3WEEA 3THYA 4AHSA 4E0DA 3CI5A 3GG4A 1TKDA 3KK3A 3RR8A 2OPSA 4OLBA 4I6MB 2P1JA 4CJVA 3FZLA 2YHYA 5KRSA 4CGGA 4HUGA 4OPJA 3H45C 1OVQA 2VYPA 4BE2A 3FFIA 4CZHA 4CFDA 1RT5A 4BC2A 1IH7A 4K43A 3OYLA 3OYJA 1NGHA 4PL7A 3DLLL 1K8AO 5M1PA 2O8CA 4QCLA 4IJNA 4M3WA 2YI1A 4CZJA 3ENOA 4L8RB 4IG3A 3T1AA 5KQDA 3LDNA 4LFAK 1C1BA 1HKBA 3OY9A 1D8YA 3HPHA 3T7ZA 3SCXA 4H0PA 4XH5A 3AO5A 4H5WA 4GV6A 2IVOA 4WFAL 5GAEP 3K5NA 2X6NA 4M3RA 2P9UB 1K9MO 4OKKA 3CCRN 1W0HA 4AHCA 5AQRA 2G8KA 2A42A 1KSPA 2FF6A 1VSLA 1VSEA 2HHTA 3RMDA 2QWRA 3HTVA 3O3GA 4DUYK 2VQEK 3CCLN 4FJXA 1JLEA 1ZBFA 1YT3A 3F9KA 1HUXA 4Q0BA 4CJEA 1Q82O 3A0IX 3DMJA 1IKWA 3WNGA 4EP4A 3KK2A 4ISEA 3OJUA 4KHNA 4F4KA 3K9KA 2QEXN 3SUNA 1XHXA 1TV6A 4CJ3A 3K9JA 3OTOK 4K8ZA 4R79A 3AARA 1EETA 1U48A 5AQVA 3PX4A 5AJ3K 3QLHA 1RBVA 4YOVA 4K8XA 2HBLA 4CCHA 1KRPA 4M3ZA 1Q7YO 3ZEUB 3DXKB 1A5XA 1KLMA 3H3OB 1R59O 4KH4A 1REVA 1HQUA 2GBZA 4XH1A 3AA2A 4FJKA 3G25A 4EHUA 4JI5K 1U49A 3O9RA 3QEWA 4BR0A 2QKKA 1X9MA 4I7FA 3F5TA 3V4IA 1VRTA 4EZ9A 4RW4A 1SL0A 3G6EN 2JWLA 2OZSA 2HF3A 1RBTA 5KPZA 1BQNA 4KV8A 2GEMA 1VSIA 3PX0A 2Z1HA 3QICA 3P83D 1T6DA 1L3SA 3DRRA 3VQEA 1C6VA 4LD0A 3VF6A 1MA9B 5FRMA 2D1KA 4FWMA 2D5RA 4PA1A 3PX6A 1S1WA 1YVUA 4JKGB 3O8MA 1DKGD 2HBMA 4ELTA 4FLWA 4DR4K 4CF1A 4IFYA 2YKNA 2GWJA 1U2VB 1RDWX 4DR5K 1QSSA 2E1YA 1HPMA 3AVAA 4I9QA 2HVIA 3V1QA 4CEOA 5BPNA 2ZJRL 4CF2A 4BR5A 2Q97A 4FZYA 1JLFA 1NGBA 3TU5A 3K59A 4LH5A 4PY5A 1W7AA 5CYMA 4JAXA 4CHNA 3UB5A 4FJ5A 1EX4A 2ZE2A 3TPQA 3K57A 4Z0UA 3QBXA 1C0MA 4E7IA 1J5EK 1VQLN 1W2BM 5AQWA 3CETA 5C42A 3T69A 4BRMA 1YJWN 5EVZA 4B1WB 4ZTFA 4NCAA 4NCGA 4UQGA 4EHTA 2JWKA 4HVJA 1KFDA 4FWQA 2D0CA 3HJFA 5JLHA 1GLJO 1YAGA 4KFBA 4CZMA 2WC9A 1WNSA 3LDOA 3M8PA 2Q3SA 5GAGP 3HPOA 4KAZA 2KFZA 4M63C 5LL6Z 1Q9YA 3EEQA 1Y97A 2PBDA 3VETA 1HMVA 1F21A 1RT4A 3TR8A 1QHTA 2P9KB 3WNHA 4FK0A 3WUHA 5AQKA 1S9GA 4MDBA 4QS8A 3L2RA 4JS5A 4FZZA 1JL1A 3NE6A 4YY3K 3OYAA 4M3YA 3OYGA 1GLCG 2ZJPL 2YJFA 3IUCA 2UU9K 4AHTA 4A5BA 3SNNA 4WQ5C 4BGAA 3OYFA 4NYFA 1Q86O 1JLAA 2HHXA 4CJPA 3ZT1A 5JS1A 4GNIA 3CXCM 4DTSA 1JJ2M 4JI0K 4CF0A 1D9DA 1RNHA 1LAVA 1XI1A 2BGGA 3N4QA 3MX5A 4B1XB 4K42A 5CHIA 5BREA 3V9ZA 2OA8A 3EZ5A 4DV5K 3V6DA 3P5JA 5TKYA 4H5RA 3HVTA 4BG9A 2HNZA 4CIFA 1FW6A 4RW7A 4A2AA 3OA9A 5JLFA 1S1TA 3OJSA 3MDQA 2ASPA 4QAGA 4BC4A 3DOLA 3CF5L 2DFHA 3AA3A 4E7HA 3I33A 3SQ2A 4BR7A 5BN8A 3OYBA 3KKRA 5EX5A 1QZ5A 5ADXA 3VQPA 1IKYA 3NVKA 3LAMA 2A1SA 4DV7K 2A1RA 5HLFA 5C15A 2EX3A 4IWVA 1KCFA 2CGLA 4IDKA 3HOTA 3ZX3A 4H5NA 4AQYK 3MWTA 1VQ9N 4JS4A 4CIEA 1TKXA 3V9WA 2CH6A 3AO3A 4CZLA 4IOCL 1VQ8N 4YOTA 3S41A 4GKKK 5AQFA 3CJ7A 1LWFA 2IGIA 2YNHA 3DXMA 4H03B 1B9FA 2IVNA 4KHWA 4A2BA 1T8EA 4CEBA 1K6YA 4FL9A 4O0JA 3IKMA 3GL1A 1ATNA 2P9IB 3VEWA 2HHUA 4DQQA 1ZC6A 2YV0X 4CJSA 5DM7L 1NM1A 3PY8A 3PLAA 4CJRA 4H4OA 4CERA 3LWMA 5KPRA 3SUOA 4OJRA 4CEDA 1ASVA 3SYZA 2JLEA 4BRCA 3UKUB 3HM8A 4Y0WA 1HKCA 1NJWA 1T03A 4N47A 4J2AA 1XWLA 5J2MA 2O8DA 3B6PA 1E4GT 1KTQA 3M6GA 3HOSA 3SPYA 4OX9K 1NGAA 2IS3A 4LSLA 3RRGA 3LPTA 1G99A 4YDUC 3HVRA 4DSIA 2VGMA 3EY1A 3C6HA 4AHRA 4ZTJA 1N33K 4LF6K 3T1YK 5AQOA 1K8KA 4FWNA 3TAQA 1EWQA 3AO1A 1SUQA 3BGRA 1VRUA 3MAQA 3R1XA 1QE1A 3HM9A 2O4IA 1NKCA 4Z4CA 4DR3K 1QSLA 4JI7K 1IG8A 2ATQA 3HK2A 3QEVA 1RT1A 2QW9A 4AH9A 3ZEUA 4MLHA 2JGUA 4CBWA 4A57A 3ZX2A 2NUBA 3BY5A 2D4WA 3O4NA 1RT6A 5F1XA 1NK5A 3TAMA 1V4SA 2P5GA 5E84A 3SV3A 1C0GA 3SJJA 4FLZA 3DRPA 3AVKA 4CJLA 4O8UA 5AQJA 3VQ4A 4CJ5A 3R3LA 2BH1A 3P1GA 3L4QA 4WCEL 2J4RA 4CHPA 4DV4K 2HHQA 3O3FA 3NGYA 1UOCA 4YOXA 2XY5A 4JI1K 2HBKA 3VQ8A 4L3QA 4Y1CA 3CCMN 4CBXA 2DTUA 1S5JA 4B3OA 3MN5A 4CZGA 2P5OA 3AVLA 1WB9A 2DY4A 4KHYA 5KGWA 4DSFA 1BA1A 4IO9L 1C1CA 1LV5A 3R9PA 4PUOA 3TARA 4AM6A 4BRFA 4BR2A 4WQ4A 1ZBSA 4N41A 3IS9A 3Q7CA 4DTJA 1VQKN 4F3OA 1QTMA 4OPAA 5HRPA 1LOTB 3SJHA 4FPBA 4CZIA 1TUYA 3KWIA 4RG8A 2O8DB 4PKGA 5AQQA 4YDUA 3RMCA 1S22A 5CR4A 1IO2A 1MU2A 5J2PA 1YI2N 4OGCA 3QFPA 1XQSC 3J7AP 4KH5A 4C8NA 1GLAG 3D0PA 2OPRA 4Z4IA 2WTUA 3A5LC 3NH1A 1NGEA 5LMUK 4DTOA 4FJ7A 3VEXA 4JLHA 1OH7A 3WEEB 4XEIA 3CMAN 3SBTA 1QVGM 1ZBUA 3LPUA 4QOZB 1NGDA 5JVHL 3AVNA 2PFUA 4IG0A 3EL2A 3PIOL 1ZBHA 3DXMB 3OBYA 5LY3A 4DS4A 4DTXA 2NRTA 1CXUA 5M1NA 3KD1E 2D0AA 4FWOA 1WAJA 3PSFA 3C6UA 3NDKA 4JRQA 4FO0A 4CEFA 1RT2A 3WXLA 1XC3A 2ZF5O 4HWIA 4DB3A 4YOUA 4FJ9A 4DR6K 2HSTA 2WOMA 2O8EA 2AJQA 3C0BA 1GLBG 3VQ5A 2DFFA 3OYKA 2QA4N 4BR4A 3LZIA 1RTIA 3CMEN 1TAQA 4ICLA 4CJWA 2QWLA 5LJWA 1KC8O 1NWKA 3O08A 3S3MA 3VERA 4RW8A 1FKPA 4H4MA 1M1KO 4CK1A 4NLBA 3IAYA 1XNQK 1Q8IA 5BRDA 3O1WA 3ZETA 3DLKA 2EHGA 1WSHA 2ZWHA 3FZMA 3TSPA 3CJ9A 4PL8A 3T3FA 2NRZA 1P8ZA 5KI6A 1KVAA 2QWMA 1EWRA 3CD6N 4CEQA 3QBWA 4JNEA 1RTJA 4WFBL 4PHTX 2FBTA 5DMRA 3H1QA 4FYDA 1W9HA 3ZSWA 4NLCA 3VEZA 1N36K 5AQYA 1HNWK 3BZCA 4FOIA 3VTHA 3FZHA 4JI4K 4FVUA 4ISGA 2WBNA 5BN9A 4CZFA 2O8FB 3CQXA 5ADXH 1HYVA 1RT3A 1N34K 1NJZA 1ASWA 4JV5K 3VQAA 2VG7A 4H5VA 3QEPA 4OO1J 5KRTA 1KD1O 1VSHA 5HROA 3BEXA 3MWPA 4IFEA 2FSNA 3L6QA 2UXDK 5HRNA 5HL7L 3MXMA 1DEJA 2P9KA 3SQ1A 5TKWA 1IBLK 3SUQA 1IKVA 4MDAA 1KVCA 3K0SA 1X3MA 1BA0A 3MN6A 2QXFA 3TTFA 4JD2A 1S72N 1BI4B 3MX2A 2ASOA 3GOIA 1X9SA 3SAHA 5DM6L 5KPTA 2FBVA 3VGLA 4I9LA 1C1AA 1OH8A 4DQIA 1SKWA 4DQSA 5J2NA 1XMQK 4NYNA 5FPEA 1VSDA 4EAHD 2P9LA 5SZTA 2V52B 4FXDA 3DLEA 3CIPA 3UIQA 4A59A 1KAZA 1WN7A 2A5XA 5CY4A 4B1YB 2OTLN 3KK1A 3AVGA 1K73O 3M1FA 3CFPA 4B3TK 4BRPA 4LF9K 2E2QA 3CG7A 1J53A 3VQCA 3DAWA 3WQUA 4FCYA 3THXA 4F2RA 1GLFO 1U2VA 2WUSA 2IIRA 2IOCA 3VEOA 3AV9A 4JKBA 1HYZA 5JICA 3NBPA 1QS4A 3G4SN 4Z4FA 5AQSA 2VWJA 3TAEA 2XY8A 1L3UA 4KHSA 5C0YA 2AP1A 4FW2A 5AR0A 4GKJK 2G8HA 4DUZK 1QVFM 4M3UA 1YJ9N 3HSCA 2X74A 4FWRA 5EXWA 5HRRA 1S9EA 1FKOA 3I8DA 1HNVA 1NBWA 1D5AA 3AVCA 3AVFA 2XHBA 2ASMA 1VSMA 1RCHA 4DSEA 4JI6K 4K0KK 4HUFA 1BWFO 1NGGA 4BWJA 4CF9A 5F2RA 4GVEA 2HW3A 3F73A 1T05A 3ZT3A 4BRIA 5I9EB 1Z05A 4HCCA 1N6QA 2YKMA 3WQTA 1RILA 5C2FA 3A2FA 2R7YA 2GELA 5F0XA 1BUPA 3MCAB 2ITGA 1NU0A 4FWPA 2W6KA 3TTCA 4CJFA 3VEYA 1TVRA 3AVIA 1GOAA 4BC5A 2HOEA 2Q36A 5AQTA 1WLJA 4XH4A 3F9MA 1NK8A 2VG5A 1VQ7N 2OANA 1X1PA 4JN4A 3RTVA 3QFUA 2GUIA 4RCHA 4GV9A 4DKWA 1JCGA 4GMJB 2E88A 4UY8O 1NGIA 1BG3A 4CD1A 1NMNA 2B4JA 1WAFA 3WNEA 4NCBA 1TL3A 4JI3K 3HL8A 4BREA 1NNEA 3C65A 3O5BA 5K14A 1UA1A 1RDBA 4DV0K 3NGIA 4IBNA 4JKDA 4XIUA 2HHHK 1ZBIA 4Z4GA 1JCEA 2O4GA 1EKEA 3LWLA 2HHSA 3OYIA 1LAWA 4G1QA 3EKUA 4FJNA 4KH6A 3CCEN 3O9SA 2F8SA 2PZSA 3V9XA 4OLAA 4J2DA 3ITHA 4LC9B 1NOYA 4A61A 2NRRA 3ZX0A 3AA5X 1L5UA 1BQMA 5HRSA 3QDKA 3BF3A 2O8CB 1EQYA 4FLYA 2Q2RA 3I56N 4CJKA 4Z4EA 4CJQA 3EZWA 4DU3A 1S6QA 2Y1IA 3SUPA 3CYMA 4PKIA 4NO7A 1GLEG 4FLUA 3ZYYX 4X66K 2HBJA 1QQMA 4B9NA 2W41A 3SAFA 1T6CA 4CE9A 5LJVA 1QZ6A 4I6MA 3A8YA 4DFJA 3DYAA 3ATUA 3QESA 1ASUA 3AVBA 4H0TB 4FJJA 4CGFA 2BDPA 3ENHA 4CK2A 1KAYA 3ZSOA 3VTIA 3ULDA 2HHVA 4X65K 4CFBA 1RDAA 2P9LB 3WNFA 2H3GX 4C8OA 1NOZA 3KZBA 4HUEA 1WSEA 4BRAA 3A5NC 2HMIA 5EY4A 3AO2A 2YNGA 4BVPA 1L3VA 1U47A 3B8AX 4AHVA 3K5LA 2F9TA 1RBSA 1YJNN 4KBOA 1I39A 1KAXA 1N5YA 3PUFA 4ILGB 4IOXA 3DWLA 5C2DA 2Q1NA 5AQHA 3ZCMA 1TK8A 4M41A 4KI4A 2KTQA 2WFBA 4IXCA 2HVHA 4CW7B 1CZBA 1X9JA 2E6MA 4E19A 2PY5A 2NRHA 4WYBA 5LMNK 1FXXA 4KPYA 5I42A 3WXIA 1Z25A 4FVMA 4B9TA 4BR9A 3D2EB 1QQCA 3RSEB 3I55N 4W5TA 2HNYA 2P9SA 1UA0A 5BPMA 5AZJA 3OYDA 2VGNA 4KHQA 1J5OA 1M90O 4IOAL 1HNIA 4FWSA 4KHUA 4B9MA 1MWMA 3ZT2A 3PSIA 3DI6A 2I7NA 2E2OA 4FSVA 1BDGA 1Y64A 2VCPA 5B8HA 3U3YA 2A3ZA 2O8FA 1TK0A 4C1NK 3OBWA 2HB5A 1GLLO 4Q5VA 2QWPA 2V7YA 3SV4A 3D2FB 3HZ6A 1WSFA 4JKFA 4CHOA 4IDHA 3ULEB 2QWNA 3CJ1A 5AQPA 4BRGA 4BACA 2F4VK 1O1WA 1IG9A 5SWMA 1KXPA 3SAGA 5MLCQ 1EO1A 5GADP 3L0QA 4KI6A 2G8UA 4FW1A 3OYEA 4B8AB 2YHXA 4CJ7A 2V7ZA 3FZFA 4AF1A 5AFUA 1T3VA 4H8KA 2FSJA 3IDHA 3EYZA 2DFEA 2UXCK 3S3NA 4JKEA 4N76A 1C0TA 3GDQA 3U6FA 1J9AA 3KTQA 4E1JA 2V51B 3LZJA 2E2NA 4DMNA 2QK9A 2O8EB 4FWKA 4CEAA 3EO3A 4LSNA 1YVNA 4JI2K 4H0VB 4BDZA 3WXKA 4KB0A 4IKFA 5AQUA 3ZLJA 2KLAA 3SQ0A 3UKRA 3DM2A 1XMOK 1S3XA 1TL1A 3J81O 3I8BA 1TK5A 3V9UA 5BRFA 1OH6A 1DLOA 4U7BA 4WE1A 3SI6A 3ZSVA 4BE0A 1RT7A 4LH4A 1SV5A 3SBGA 3OYHA 4HHTA 1ZXOA 4A5AA 4W5NA 3VQQA 2FXUA 4C8KA 3O3HA 4WF9L 3L4IA 4O5FA 2E4LA 2Q0RA 1G15A 2CGKA 3E1YA 1NMDA 1QSYA 4DFMA 4KTWA 3EKSA 5BPLA 3M8RA 4HCBA 1JXBA 4W5QA 3OHRA 1VQ4N 4JKGA 4JK8A 4DFPA 1O13A 3AVHA 2X78A 1NGCA 4DSJA 3D6RA 3V81A 5AQXA 1Z6RA 4FK2A 3CCJN 4AM7A 4H0YB 3IFRA 1J54A 3O9TA 1KFSA 1VK0A 4KKOA 3D7EO 3ZSXA 1X3NA 3FZKA 1YXQA 3JS6A 3PO5A 4FLTA 1KLNA 1NK9A 3HT3A 4YNQA 4PQUA 3KLHA 3NF6A 4B9SA 4DTUA 1YHQN 3KLGA 1VSFA 3H3NO 2ZD1A 2IVPA 3C7NB 4CHZA 5AQZA 4R5PA 3GE1A 3AVJA 3MECA 3FGUA 4DF8A 5AQNA 3E66A 3LM2A 3V1RA 1HJOA 3THVA 4NXMK 3QETA 3TI0A 4ILHA 4JYAK 3J8AA 2XY7A 1TYQB 3HYFA 3VF4A 3LDPA 4DV1K 3CJBA 1T44A 4CI6A 3MXJA 4LF5K 1HNXK 3NF9A 4ID5A 4OPHA 3AGRA 3TABA 4CJUA 1NK0A 3BF1A 5A2QO 3L2VA 4CGHA 4JKCA 5J1EA 1JLQA 2Z1GA 1NJYA 4BDPA 4IFVA 4W5OA 1SQKA 3G0ZA 3P4IA 4MFBA 1VQ6N 5C12A 3E9LA 3O4WA 4DQPA 5E41A 2QWOA 2P9UA 2GWKA 3BP8A 1VQPN 1LW2A 4DSLA 3PIPL 5D3GA 3NH2A 1SZ2A 3CPEA 4X62K 1MDUB 3TSUA 2PYJA 1K8KB 3U8XA 1SL1A 3OYMA 1V4TA 1IJJA 3ALYA 4Z4HA 1HJRA 1TKZA 5HBMA 3ID6A 1JLGA 2FF3B 1HLUA 4HTLA 2UUAK 5I3UA 3CM6A 2CH5A 2VWKA 4IJAA 3SMPA 4DTPA 1VHXA 3UKUA 3NHGA 1H1VA 3O9UA 5M1KA 3LAKA 3MEEA 4NXNK 1JKHA 1VSJA 3CERA 4W5RA 3LP1A 3P31A 3VQ6A 4ILJA 4F3TA 3QMLA 2I7PA 5BR9A 1A5VA 4E3SA 3QIOA 3P39A 2P9IA 2YNIA 1WSGA 3LP2A 4BQZA 4KTQA 2HF4A 3V9SA 4CK3A 4YOWA 1W97L 3CCUN 1L3TA 3QEIA 3I0SA 2FC0A 2G8FA 5JVGL 3VMFB 1OH5A 2XO7A 1BOTO 1IKXA 1WUAA 3QO9A 3L8BA 3R8EA 3KVGA 3LANA 4CF8A 2G8WA 5C25A 3T1HK 3O6WA 3AA4A 3FE1A 1ESVA 4BRNA 1YF5L 1LW0A 3TANA 1TYQA 1LCUA 2ZJQL 4BRKA 3QEXA 2E5LK 2FSKA 1S6PA 5AFUH 4YOYA 3CPWM 2W40A 4BWMA 1SAZA 3MEGA 5M1FA 2QTDA 4KRFA 4X64K 1GOCA 1U6ZA 3WXMB 3VGMA 4GW6A 1E4FT 4I2PA 4QS9A 2YHAA 3C7NA 1ZBLA 3KLFA 2KZMA 4DR2K 1D4XA 4ZHRA 1NJIO 4LF8K 4CGJA 2UYTA 1I94K 3CQYA 4B1UB 1IBMK 3S9HA 1RTHA 1WBBA 2NLXA 2EWSA 2QM1A 2HHWA 3KLEA 1BIUA 3MXIA 1HRHA 2PAVA 3PV8A 4C23A 1D9FA
chains in the Genus database with same CATH topology
2IDOA 3ITHA 5FROA 1NOYA 1LWEA 1NJWA 1L5UA 3AA5X 4GVMA 4N47A 2B5JA 1T03A 3KD5E 4J2AA 1BQMA 5HRSA 1XWLA 5J2MA 3B6PA 1U4BA 1KTQA 3SPYA 3KJVA 3VA3A 2IS3A 4LSLA 3RRGA 2E6LA 3LPTA 5HP1A 4C8LA 4FLYA 1S1UA 4CJKA 4CESA 3HVRA 1U45A 4DSIA 4E7LA 4Z4EA 3EY1A 4OPKA 4CEZA 4CJQA 4DU3A 4AHRA 1EP4A 1S6QA 3OS1A 2Y1IA 3SUPA 4ZTJA 3CYMA 4KTZA 1S1VA 3VQBA 1BHLA 4FLUA 3TAQA 3U3GA 1WSIA 3O4QA 4B9NA 2Z1JA 3IG1A 4FK4A 4O4GA 4CE9A 3AO1A 4AILC 1SUQA 3AVMA 3BGRA 4DTNA 3BDPA 1VRUA 3KIOA 3MAQA 3ZT4A 1EXQA 2B6AA 3DYAA 1JL2A 1QE1A 2YHBA 3AO4A 4N5SA 3HM9A 4DFJA 1NKCA 2O4IA 4E7JA 4CJTA 4DU4A 2D0BA 4F2SA 3VQDA 3KLIA 1NKBA 1NJXA 4Z4CA 3QESA 1QSLA 1ASUA 3K58A 3AVBA 1JLCA 1DTTA 2ATQA 2VG6A 3SQ4A 4FJJA 3HK2A 4CGFA 2BDPA 3QEVA 1RT1A 4FJGA 4CK2A 4AH9A 3DLRA 4RW9A 4J2EA 3ZSOA 3I0RA 3C6TA 3ULDA 2JGUA 2HHVA 2OPPA 4CFBA 1RDAA 3WNFA 2KFNA 2NUBA 4C8OA 1NOZA 1XC9A 4HUEA 1X9WA 3O4NA 2OZMA 1RT6A 1WSEA 1BCMA 2W42A 2HMIA 3AO2A 2P51A 3TAMA 3JYTA 1NK5A 2YNGA 3HP9A 1L3VA 1U47A 3ZSYA 4AHVA 3K5LA 5CYQA 4M45A 3NAEA 2P5GA 3SV3A 1RBSA 2ETJA 2OYQA 1I39A 3SJJA 4FLZA 2Y1JA 4RW6A 1TAUA 1N5YA 3PUFA 3DRPA 3PO4A 3AVKA 4DU1A 3HXMA 2FBYA 3H08A 4CJLA 4KO0A 1TK8A 3L2WA 3ZCMA 3VQ4A 2KW4A 4CJ5A 4M41A 4KI4A 1BL3A 1R0AA 3ISNC 2KTQA 2HVHA 3P1GA 4DQRA 1CZBA 4ELUA 1Z26A 2E6MA 1Q9XA 3QNNA 1TKTA 4CHPA 2HHQA 4E19A 3O3FA 3NGYA 2PY5A 1C0UA 4EP5A 1UOCA 3QINA 2F8TA 2XY5A 3E01A 3V1OA 3VQ8A 2ZQBA 1FXXA 2IAJA 5DK5A 3QNOA 2HNDA 5I42A 4Y1CA 4KPYA 1Z25A 3B6OA 3ZSZA 4FVMA 4FM2A 1NKEA 2DTUA 4B9TA 1S5JA 4AHSA 2XY6A 1B92A 4B3OA 4C8MA 4E0DA 1QQCA 1CZ9A 2P5OA 1WSJA 4W5TA 3AVLA 3OVNA 1TKDA 2HNYA 2DY4A 1UA0A 3KK3A 4KHYA 3RR8A 2OPSA 5KGWA 3OYDA 4KHQA 4OLBA 2P1JA 4Y1DA 4CJVA 4DSFA 1J5OA 1C1CA 1JXEA 1LV5A 5KRSA 1HNIA 4CGGA 4HUGA 4OPJA 5J2QA 3TARA 4B9MA 4PUOA 4KHUA 3ZT2A 3DI6A 1YTUA 4N41A 4BE2A 3FFIA 3IS9A 3OYNA 4CIGA 4DTJA 4CFDA 1RT5A 3U3YA 2GV9A 5FDLA 1IH7A 3OS2A 3OYLA 3OYJA 4F3OA 3T19A 1QTMA 4FJ8A 4FM0A 1TK0A 5HRPA 4QCLA 3TAPA 4M3WA 2HB5A 3LALA 3RMBA 4L8RB 3DLBA 4RG8A 4IG3A 3T1AA 4Q5VA 3VQ9A 3NH0A 3SV4A 1WSFA 1C1BA 4CHOA 1S1XA 1BGXT 3OY9A 3RMCA 1D8YA 3D45A 4BACA 3HPHA 1IO2A 1MU2A 1O1WA 4CJ4A 5J2PA 4OGCA 5SWMA 1IG9A 3SCXA 4C8NA 3AO5A 3D0PA 1CLQA 2OPRA 4KI6A 2G8UA 4FW1A 3QIPA 3OYEA 4B8AB 3RR7A 4Z4IA 3K5NA 3NH1A 2X6NA 4M3RA 3L2UA 4OKKA 2F96A 1W0HA 4H8KA 4AHCA 4DTOA 2G8KA 4B08A 4FJ7A 3EYZA 4JLHA 2DFEA 4BE1A 2RF2A 3S3NA 3DOKA 1KSPA 4FJIA 1SL2A 1VSLA 1ZBUA 3LPUA 1VSEA 4N76A 4QOZB 1C0TA 3U6FA 2HHTA 3M8SA 3RMDA 1J9AA 1LWCA 3AVNA 3O3GA 4IG0A 3KTQA 4FJXA 1JLEA 1ZBFA 1TGOA 1YT3A 3LZJA 4DMNA 1ZBHA 2QK9A 4M3XA 1KVBA 4ID1A 4CEAA 4DS4A 4DTXA 3C95A 3TWHA 1CXUA 4LSNA 3KD1E 2D0AA 3F9KA 1U04A 4O55A 4CJEA 4BDZA 1WAJA 4Q0BA 4KB0A 3DMJA 1IKWA 3WNGA 3C6UA 3NDKA 2BE2A 4JRQA 4EP4A 4IKFA 3KK2A 3OJUA 4CEFA 4DLGA 1RT2A 3SQ0A 4F4KA 4KHNA 3DM2A 3SUNA 1XHXA 1TL1A 1TV6A 4CJ3A 3MEDA 4K8ZA 1U48A 1EETA 3PX4A 4I2QA 4FJ9A 1TK5A 3V9UA 3QLHA 1RBVA 4E89A 2WOMA 4K8XA 1DLOA 3S3OA 4CCHA 1KRPA 2AJQA 1ZYQA 4WE1A 3SI6A 3VQ5A 3HO1A 3ZSVA 4BE0A 2DFFA 3OYKA 4FZXC 4M3ZA 1B9DA 1RT7A 4LH4A 1SV5A 4YFUA 3OYHA 3LZIA 4HHTA 4W5NA 4OKJA 3VQQA 1RTIA 1JLBA 4OVLA 3O3HA 4C8KA 4E1MA 1A5XA 1KLMA 1TAQA 4ICLA 4CJWA 3ASMA 1REVA 2E4LA 1HQUA 3S3MA 1G15A 4RW8A 2PYLA 1FKPA 2GBZA 4H4MA 4CGIA 4CK1A 1QSYA 4JRPA 5EU7A 3AA2A 4KTWA 4DTRA 4DFMA 1Q8IA 3ZSRA 4OKEA 3IAYA 3CQ8A 4FJKA 1UWBA 1U49A 3M8RA 3DLKA 3QEWA 2EHGA 2RPIA 1WSHA 2OPQA 2QKKA 4B9UA 1X9MA 4HCBA 1JXBA 4DF4A 4W5QA 2LSNA 5CZ1A 3T3FA 4I7FA 3V4IA 3SPZA 1VRTA 4FLVA 3CFOA 5KI6A 4DFPA 4EZ9A 1KVAA 3AVHA 2X78A 4O0IA 3VN5A 4RW4A 3RRHA 3V81A 1SL0A 1DTQA 4CEQA 4DLEA 4DSJA 4EZ6A 1RTJA 2OZSA 2FBTA 1RBTA 4FK2A 5DMRA 5KTQA 1BQNA 4KV8A 4FYDA 1W9HA 3ZSWA 1VSIA 3PX0A 1J54A 2Z1HA 3P83D 1KFSA 1L3SA 3DRRA 3VQEA 1C6VA 4LD0A 1NK6A 1VK0A 4KKOA 5FRMA 2D5RA 3ZSXA 4AHUA 1HYVA 1RT3A 4PA1A 3PX6A 4J2BA 4FJLA 1S1WA 1YVUA 3PO5A 1I3AA 4FLTA 1NJZA 4DWIA 4ELTA 1KLNA 2BANA 1NK9A 1ASWA 3HT3A 4FLWA 4YNQA 4PQUA 3KLHA 4CF1A 3VQAA 2VG7A 3NF6A 3QEPA 4IFYA 5KRTA 4B9SA 2YKNA 1GOBA 4DTUA 1VSHA 5HROA 4M42A 2X6SA 1QSSA 3KLGA 1VSFA 3LP3A 1RDDA 4OLAA 1HYSA 5HRNA 2ZD1A 3AVAA 3MXMA 3V1QA 4CEOA 4I9QA 3SQ1A 2HVIA 2G8IA 4CHZA 3NF7A 4R5PA 4FM1A 3AVJA 4HTUA 4E1NA 3MECA 4CF2A 1IKVA 3SUQA 4FZYA 1JLFA 4CEEA 5FRNA 4TSXA 1KVCA 4DF8A 3K59A 4FJMA 4LH5A 4PY5A 3V1RA 5CYMA 3THVA 4CHNA 4FJ5A 1EX4A 2ZE2A 2QXFA 3QETA 3TI0A 3K57A 4Z0UA 3IRXA 2XY7A 1C0MA 3HYFA 4E7IA 1BI4B 5C42A 3K5MA 2KZZA 1X9SA 3MXJA 1T7PA 3NF9A 4ID5A 2FBVA 2QKBA 4ZTFA 4NCAA 1HPZA 3DRSA 3TABA 4NCGA 4PWDA 4UQGA 4I9LA 1C1AA 4CJUA 4DG1A 3HP6A 1NK0A 1SKWA 4DQIA 3L2VA 4DSKA 4CGHA 4DQSA 5J2NA 3K2PA 4HVJA 5J1EA 3TAGA 1KFDA 4NYNA 1JLQA 2Z1GA 1NJYA 2D0CA 3OS0A 3HJFA 1VSDA 5SZTA 4KFBA 4LY7A 4BDPA 4IFVA 1WNSA 1RTDA 3M8PA 4FXDA 2Q3SA 4W5OA 3DLEA 3HPOA 4KAZA 3UIQA 3KKSA 2KFZA 3RWUA 2XRIA 3G0ZA 1Q9YA 1Y97A 1WN7A 4MFBA 5CY4A 3HPGA 1HMVA 1F21A 1RT4A 3AVGA 3M8QA 1QHTA 3TR8A 1YTAA 4OGEA 3WNHA 3LDSA 3CFPA 2PZSA 3CG7A 1J53A 4FK0A 3VQCA 4FCYA 4DQPA 2RKIA 1S9GA 5E41A 4F2RA 3NGZA 3L2RA 4J2DA 4JS5A 3KK1A 4CGDA 4FZZA 1JL1A 3NE6A 1LW2A 4DSLA 3VA0A 4ELVA 3OYAA 5D3GA 3NH2A 3QERA 4M3YA 2I5JA 3OYGA 4DS5A 2PYJA 4O44A 3ZSQA 4AHTA 1SL1A 1BIZA 3SNNA 1NK4A 3OYMA 3OYFA 3ALYA 2IOCA 4FJHA 4DFKA 4NYFA 4Z4HA 1JLAA 4M3TA 3AV9A 4CECA 1HJRA 1HYZA 1TKZA 5HBMA 3ZT1A 4CJPA 2HHXA 3NBPA 5JS1A 1QS4A 3CM5A 3L3VA 1VSKA 1JLGA 4Z4FA 4DTSA 1FK9A 2VWJA 3TAEA 2XY8A 1L3UA 4B9VA 4KHSA 4CF0A 4FW2A 1D9DA 1SKRA 3SZ2A 3DLHA 1RNHA 1SKSA 4E7KA 2G8HA 3CFRA 3NFAA 1LAVA 5I3UA 1XI1A 4M3UA 2BGGA 1RBUA 3CM6A 2IC3A 2X74A 4N56A 3V9ZA 2OA8A 5KGXA 2VWKA 3EZ5A 4DTPA 3V6DA 3P5JA 5HRRA 1S9EA 3HVTA 3NHGA 2HNZA 1FKOA 4CIFA 1HNVA 3I8DA 1D5AA 3AVCA 3AVFA 4RW7A 2XHBA 2Z1IA 3LAKA 4FLXA 3MEEA 1VSMA 1RCHA 1JKHA 4DSEA 1VSJA 1S1TA 4W5RA 3OJSA 4HUFA 1A5WA 3LP1A 4QAGA 4BWJA 4DTMA 4CF9A 3VQ6A 3DOLA 4CFAA 3JSMA 2HW3A 4F3TA 3F73A 1T05A 2DFHA 3AA3A 1BISA 3ZT3A 4E7HA 1NK7A 2G8VA 4BDYA 3SQ2A 1XHZA 3G10A 1A5VA 3NF8A 5C24A 1BCOA 4E3SA 3QIOA 3NCIA 4HCCA 1HQEA 3ZT0A 2YNIA 2YKMA 3OYBA 3L3UA 1N6QA 1WSGA 3LP2A 1RILA 3KKRA 3A2FA 2R7YA 1CXQA 4KTQA 3V9SA 1RBRA 4CK3A 3VQPA 1IKYA 3LAMA 2A1SA 2ITGA 1L3TA 2WONA 3QEIA 3I0SA 2FC0A 4O5BA 2KQ2A 2G8FA 2A1RA 4KREA 4CJFA 5HLFA 3C94A 2EX3A 2XO7A 1TVRA 1IKXA 3AVIA 5CZ2A 1KCFA 4IDKA 4B9LA 1GOAA 3QO9A 1WLJA 4B8CA 1RDCA 3L8BA 3LANA 3L2QA 1NK8A 4CF8A 2G8WA 5C25A 2VG5A 4JS4A 4CIEA 3AA4A 1X1PA 1TKXA 3V9WA 3LP0A 1BI4A 3AO3A 4MQ3A 3TANA 1LW0A 5T7BA 3QEXA 4F8RA 2RN2A 5JS2A 3RTVA 2GUIA 1S6PA 4CHYA 1LWFA 2IGIA 2YNHA 3MEGA 4BWMA 4GMJB 3RMAA 1B9FA 4KRFA 1GOCA 3HSTB 3TAFA 2B4JA 1WAFA 4GW6A 4KHWA 1T8EA 4CEBA 1K6YA 3WNEA 4NCBA 4O0JA 1TL3A 4I2PA 3HL8A 3VQ7A 2YHAA 2HHUA 5K14A 4CFCA 3KLFA 1UAXA 1RDBA 4DQQA 1ZBLA 2YV0X 4CJSA 1UA1A 3PY8A 2KZMA 4ZHRA 3NGIA 4IBNA 4CJRA 2FBXA 4CGJA 4XIUA 1ZBIA 4Z4GA 4H4OA 3K5OA 4CERA 2O4GA 1EKEA 2YNFA 3LWLA 2HHSA 3LWMA 3S9HA 1RTHA 3SUOA 3OYIA 1LAWA 4G1QA 4OJRA 3DLGA 4CEDA 4KB1A 4FJNA 3OYCA 2HHWA 1ASVA 1ITGA 3SYZA 3KLEA 1BIUA 4CHQA 3MXIA 1HRHA 2JLEA 2F8SA 3PV8A 3V9XA 1D9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDO A;  3ITH A;  5FRO A;  1NOY A;  1LWE A;  1NJW A;  1L5U A;  3AA5 X;  4GVM A;  4N47 A;  2B5J A;  1T03 A;  3KD5 E;  4J2A A;  1BQM A;  5HRS A;  1XWL A;  5J2M A;  3B6P A;  1U4B A;  1KTQ A;  3SPY A;  3KJV A;  3VA3 A;  2IS3 A;  4LSL A;  3RRG A;  2E6L A;  3LPT A;  5HP1 A;  4C8L A;  4FLY A;  1S1U A;  4CJK A;  4CES A;  3HVR A;  1U45 A;  4DSI A;  4E7L A;  4Z4E A;  3EY1 A;  4OPK A;  4CEZ A;  4CJQ A;  4DU3 A;  4AHR A;  1EP4 A;  1S6Q A;  3OS1 A;  2Y1I A;  3SUP A;  4ZTJ A;  3CYM A;  4KTZ A;  1S1V A;  3VQB A;  1BHL A;  4FLU A;  3TAQ A;  3U3G A;  1WSI A;  3O4Q A;  4B9N A;  2Z1J A;  3IG1 A;  4FK4 A;  4O4G A;  4CE9 A;  3AO1 A;  4AIL C;  1SUQ A;  3AVM A;  3BGR A;  4DTN A;  3BDP A;  1VRU A;  3KIO A;  3MAQ A;  3ZT4 A;  1EXQ A;  2B6A A;  3DYA A;  1JL2 A;  1QE1 A;  2YHB A;  3AO4 A;  4N5S A;  3HM9 A;  4DFJ A;  1NKC A;  2O4I A;  4E7J A;  4CJT A;  4DU4 A;  2D0B A;  4F2S A;  3VQD A;  3KLI A;  1NKB A;  1NJX A;  4Z4C A;  3QES A;  1QSL A;  1ASU A;  3K58 A;  3AVB A;  1JLC A;  1DTT A;  2ATQ A;  2VG6 A;  3SQ4 A;  4FJJ A;  3HK2 A;  4CGF A;  2BDP A;  3QEV A;  1RT1 A;  4FJG A;  4CK2 A;  4AH9 A;  3DLR A;  4RW9 A;  4J2E A;  3ZSO A;  3I0R A;  3C6T A;  3ULD A;  2JGU A;  2HHV A;  2OPP A;  4CFB A;  1RDA A;  3WNF A;  2KFN A;  2NUB A;  4C8O A;  1NOZ A;  1XC9 A;  4HUE A;  1X9W A;  3O4N A;  2OZM A;  1RT6 A;  1WSE A;  1BCM A;  2W42 A;  2HMI A;  3AO2 A;  2P51 A;  3TAM A;  3JYT A;  1NK5 A;  2YNG A;  3HP9 A;  1L3V A;  1U47 A;  3ZSY A;  4AHV A;  3K5L A;  5CYQ A;  4M45 A;  3NAE A;  2P5G A;  3SV3 A;  1RBS A;  2ETJ A;  2OYQ A;  1I39 A;  3SJJ A;  4FLZ A;  2Y1J A;  4RW6 A;  1TAU A;  1N5Y A;  3PUF A;  3DRP A;  3PO4 A;  3AVK A;  4DU1 A;  3HXM A;  2FBY A;  3H08 A;  4CJL A;  4KO0 A;  1TK8 A;  3L2W A;  3ZCM A;  3VQ4 A;  2KW4 A;  4CJ5 A;  4M41 A;  4KI4 A;  1BL3 A;  1R0A A;  3ISN C;  2KTQ A;  2HVH A;  3P1G A;  4DQR A;  1CZB A;  4ELU A;  1Z26 A;  2E6M A;  1Q9X A;  3QNN A;  1TKT A;  4CHP A;  2HHQ A;  4E19 A;  3O3F A;  3NGY A;  2PY5 A;  1C0U A;  4EP5 A;  1UOC A;  3QIN A;  2F8T A;  2XY5 A;  3E01 A;  3V1O A;  3VQ8 A;  2ZQB A;  1FXX A;  2IAJ A;  5DK5 A;  3QNO A;  2HND A;  5I42 A;  4Y1C A;  4KPY A;  1Z25 A;  3B6O A;  3ZSZ A;  4FVM A;  4FM2 A;  1NKE A;  2DTU A;  4B9T A;  1S5J A;  4AHS A;  2XY6 A;  1B92 A;  4B3O A;  4C8M A;  4E0D A;  1QQC A;  1CZ9 A;  2P5O A;  1WSJ A;  4W5T A;  3AVL A;  3OVN A;  1TKD A;  2HNY A;  2DY4 A;  1UA0 A;  3KK3 A;  4KHY A;  3RR8 A;  2OPS A;  5KGW A;  3OYD A;  4KHQ A;  4OLB A;  2P1J A;  4Y1D A;  4CJV A;  4DSF A;  1J5O A;  1C1C A;  1JXE A;  1LV5 A;  5KRS A;  1HNI A;  4CGG A;  4HUG A;  4OPJ A;  5J2Q A;  3TAR A;  4B9M A;  4PUO A;  4KHU A;  3ZT2 A;  3DI6 A;  1YTU A;  4N41 A;  4BE2 A;  3FFI A;  3IS9 A;  3OYN A;  4CIG A;  4DTJ A;  4CFD A;  1RT5 A;  3U3Y A;  2GV9 A;  5FDL A;  1IH7 A;  3OS2 A;  3OYL A;  3OYJ A;  4F3O A;  3T19 A;  1QTM A;  4FJ8 A;  4FM0 A;  1TK0 A;  5HRP A;  4QCL A;  3TAP A;  4M3W A;  2HB5 A;  3LAL A;  3RMB A;  4L8R B;  3DLB A;  4RG8 A;  4IG3 A;  3T1A A;  4Q5V A;  3VQ9 A;  3NH0 A;  3SV4 A;  1WSF A;  1C1B A;  4CHO A;  1S1X A;  1BGX T;  3OY9 A;  3RMC A;  1D8Y A;  3D45 A;  4BAC A;  3HPH A;  1IO2 A;  1MU2 A;  1O1W A;  4CJ4 A;  5J2P A;  4OGC A;  5SWM A;  1IG9 A;  3SCX A;  4C8N A;  3AO5 A;  3D0P A;  1CLQ A;  2OPR A;  4KI6 A;  2G8U A;  4FW1 A;  3QIP A;  3OYE A;  4B8A B;  3RR7 A;  4Z4I A;  3K5N A;  3NH1 A;  2X6N A;  4M3R A;  3L2U A;  4OKK A;  2F96 A;  1W0H A;  4H8K A;  4AHC A;  4DTO A;  2G8K A;  4B08 A;  4FJ7 A;  3EYZ A;  4JLH A;  2DFE A;  4BE1 A;  2RF2 A;  3S3N A;  3DOK A;  1KSP A;  4FJI A;  1SL2 A;  1VSL A;  1ZBU A;  3LPU A;  1VSE A;  4N76 A;  4QOZ B;  1C0T A;  3U6F A;  2HHT A;  3M8S A;  3RMD A;  1J9A A;  1LWC A;  3AVN A;  3O3G A;  4IG0 A;  3KTQ A;  4FJX A;  1JLE A;  1ZBF A;  1TGO A;  1YT3 A;  3LZJ A;  4DMN A;  1ZBH A;  2QK9 A;  4M3X A;  1KVB A;  4ID1 A;  4CEA A;  4DS4 A;  4DTX A;  3C95 A;  3TWH A;  1CXU A;  4LSN A;  3KD1 E;  2D0A A;  3F9K A;  1U04 A;  4O55 A;  4CJE A;  4BDZ A;  1WAJ A;  4Q0B A;  4KB0 A;  3DMJ A;  1IKW A;  3WNG A;  3C6U A;  3NDK A;  2BE2 A;  4JRQ A;  4EP4 A;  4IKF A;  3KK2 A;  3OJU A;  4CEF A;  4DLG A;  1RT2 A;  3SQ0 A;  4F4K A;  4KHN A;  3DM2 A;  3SUN A;  1XHX A;  1TL1 A;  1TV6 A;  4CJ3 A;  3MED A;  4K8Z A;  1U48 A;  1EET A;  3PX4 A;  4I2Q A;  4FJ9 A;  1TK5 A;  3V9U A;  3QLH A;  1RBV A;  4E89 A;  2WOM A;  4K8X A;  1DLO A;  3S3O A;  4CCH A;  1KRP A;  2AJQ A;  1ZYQ A;  4WE1 A;  3SI6 A;  3VQ5 A;  3HO1 A;  3ZSV A;  4BE0 A;  2DFF A;  3OYK A;  4FZX C;  4M3Z A;  1B9D A;  1RT7 A;  4LH4 A;  1SV5 A;  4YFU A;  3OYH A;  3LZI A;  4HHT A;  4W5N A;  4OKJ A;  3VQQ A;  1RTI A;  1JLB A;  4OVL A;  3O3H A;  4C8K A;  4E1M A;  1A5X A;  1KLM A;  1TAQ A;  4ICL A;  4CJW A;  3ASM A;  1REV A;  2E4L A;  1HQU A;  3S3M A;  1G15 A;  4RW8 A;  2PYL A;  1FKP A;  2GBZ A;  4H4M A;  4CGI A;  4CK1 A;  1QSY A;  4JRP A;  5EU7 A;  3AA2 A;  4KTW A;  4DTR A;  4DFM A;  1Q8I A;  3ZSR A;  4OKE A;  3IAY A;  3CQ8 A;  4FJK A;  1UWB A;  1U49 A;  3M8R A;  3DLK A;  3QEW A;  2EHG A;  2RPI A;  1WSH A;  2OPQ A;  2QKK A;  4B9U A;  1X9M A;  4HCB A;  1JXB A;  4DF4 A;  4W5Q A;  2LSN A;  5CZ1 A;  3T3F A;  4I7F A;  3V4I A;  3SPZ A;  1VRT A;  4FLV A;  3CFO A;  5KI6 A;  4DFP A;  4EZ9 A;  1KVA A;  3AVH A;  2X78 A;  4O0I A;  3VN5 A;  4RW4 A;  3RRH A;  3V81 A;  1SL0 A;  1DTQ A;  4CEQ A;  4DLE A;  4DSJ A;  4EZ6 A;  1RTJ A;  2OZS A;  2FBT A;  1RBT A;  4FK2 A;  5DMR A;  5KTQ A;  1BQN A;  4KV8 A;  4FYD A;  1W9H A;  3ZSW A;  1VSI A;  3PX0 A;  1J54 A;  2Z1H A;  3P83 D;  1KFS A;  1L3S A;  3DRR A;  3VQE A;  1C6V A;  4LD0 A;  1NK6 A;  1VK0 A;  4KKO A;  5FRM A;  2D5R A;  3ZSX A;  4AHU A;  1HYV A;  1RT3 A;  4PA1 A;  3PX6 A;  4J2B A;  4FJL A;  1S1W A;  1YVU A;  3PO5 A;  1I3A A;  4FLT A;  1NJZ A;  4DWI A;  4ELT A;  1KLN A;  2BAN A;  1NK9 A;  1ASW A;  3HT3 A;  4FLW A;  4YNQ A;  4PQU A;  3KLH A;  4CF1 A;  3VQA A;  2VG7 A;  3NF6 A;  3QEP A;  4IFY A;  5KRT A;  4B9S A;  2YKN A;  1GOB A;  4DTU A;  1VSH A;  5HRO A;  4M42 A;  2X6S A;  1QSS A;  3KLG A;  1VSF A;  3LP3 A;  1RDD A;  4OLA A;  1HYS A;  5HRN A;  2ZD1 A;  3AVA A;  3MXM A;  3V1Q A;  4CEO A;  4I9Q A;  3SQ1 A;  2HVI A;  2G8I A;  4CHZ A;  3NF7 A;  4R5P A;  4FM1 A;  3AVJ A;  4HTU A;  4E1N A;  3MEC A;  4CF2 A;  1IKV A;  3SUQ A;  4FZY A;  1JLF A;  4CEE A;  5FRN A;  4TSX A;  1KVC A;  4DF8 A;  3K59 A;  4FJM A;  4LH5 A;  4PY5 A;  3V1R A;  5CYM A;  3THV A;  4CHN A;  4FJ5 A;  1EX4 A;  2ZE2 A;  2QXF A;  3QET A;  3TI0 A;  3K57 A;  4Z0U A;  3IRX A;  2XY7 A;  1C0M A;  3HYF A;  4E7I A;  1BI4 B;  5C42 A;  3K5M A;  2KZZ A;  1X9S A;  3MXJ A;  1T7P A;  3NF9 A;  4ID5 A;  2FBV A;  2QKB A;  4ZTF A;  4NCA A;  1HPZ A;  3DRS A;  3TAB A;  4NCG A;  4PWD A;  4UQG A;  4I9L A;  1C1A A;  4CJU A;  4DG1 A;  3HP6 A;  1NK0 A;  1SKW A;  4DQI A;  3L2V A;  4DSK A;  4CGH A;  4DQS A;  5J2N A;  3K2P A;  4HVJ A;  5J1E A;  3TAG A;  1KFD A;  4NYN A;  1JLQ A;  2Z1G A;  1NJY A;  2D0C A;  3OS0 A;  3HJF A;  1VSD A;  5SZT A;  4KFB A;  4LY7 A;  4BDP A;  4IFV A;  1WNS A;  1RTD A;  3M8P A;  4FXD A;  2Q3S A;  4W5O A;  3DLE A;  3HPO A;  4KAZ A;  3UIQ A;  3KKS A;  2KFZ A;  3RWU A;  2XRI A;  3G0Z A;  1Q9Y A;  1Y97 A;  1WN7 A;  4MFB A;  5CY4 A;  3HPG A;  1HMV A;  1F21 A;  1RT4 A;  3AVG A;  3M8Q A;  1QHT A;  3TR8 A;  1YTA A;  4OGE A;  3WNH A;  3LDS A;  3CFP A;  2PZS A;  3CG7 A;  1J53 A;  4FK0 A;  3VQC A;  4FCY A;  4DQP A;  2RKI A;  1S9G A;  5E41 A;  4F2R A;  3NGZ A;  3L2R A;  4J2D A;  4JS5 A;  3KK1 A;  4CGD A;  4FZZ A;  1JL1 A;  3NE6 A;  1LW2 A;  4DSL A;  3VA0 A;  4ELV A;  3OYA A;  5D3G A;  3NH2 A;  3QER A;  4M3Y A;  2I5J A;  3OYG A;  4DS5 A;  2PYJ A;  4O44 A;  3ZSQ A;  4AHT A;  1SL1 A;  1BIZ A;  3SNN A;  1NK4 A;  3OYM A;  3OYF A;  3ALY A;  2IOC A;  4FJH A;  4DFK A;  4NYF A;  4Z4H A;  1JLA A;  4M3T A;  3AV9 A;  4CEC A;  1HJR A;  1HYZ A;  1TKZ A;  5HBM A;  3ZT1 A;  4CJP A;  2HHX A;  3NBP A;  5JS1 A;  1QS4 A;  3CM5 A;  3L3V A;  1VSK A;  1JLG A;  4Z4F A;  4DTS A;  1FK9 A;  2VWJ A;  3TAE A;  2XY8 A;  1L3U A;  4B9V A;  4KHS A;  4CF0 A;  4FW2 A;  1D9D A;  1SKR A;  3SZ2 A;  3DLH A;  1RNH A;  1SKS A;  4E7K A;  2G8H A;  3CFR A;  3NFA A;  1LAV A;  5I3U A;  1XI1 A;  4M3U A;  2BGG A;  1RBU A;  3CM6 A;  2IC3 A;  2X74 A;  4N56 A;  3V9Z A;  2OA8 A;  5KGX A;  2VWK A;  3EZ5 A;  4DTP A;  3V6D A;  3P5J A;  5HRR A;  1S9E A;  3HVT A;  3NHG A;  2HNZ A;  1FKO A;  4CIF A;  1HNV A;  3I8D A;  1D5A A;  3AVC A;  3AVF A;  4RW7 A;  2XHB A;  2Z1I A;  3LAK A;  4FLX A;  3MEE A;  1VSM A;  1RCH A;  1JKH A;  4DSE A;  1VSJ A;  1S1T A;  4W5R A;  3OJS A;  4HUF A;  1A5W A;  3LP1 A;  4QAG A;  4BWJ A;  4DTM A;  4CF9 A;  3VQ6 A;  3DOL A;  4CFA A;  3JSM A;  2HW3 A;  4F3T A;  3F73 A;  1T05 A;  2DFH A;  3AA3 A;  1BIS A;  3ZT3 A;  4E7H A;  1NK7 A;  2G8V A;  4BDY A;  3SQ2 A;  1XHZ A;  3G10 A;  1A5V A;  3NF8 A;  5C24 A;  1BCO A;  4E3S A;  3QIO A;  3NCI A;  4HCC A;  1HQE A;  3ZT0 A;  2YNI A;  2YKM A;  3OYB A;  3L3U A;  1N6Q A;  1WSG A;  3LP2 A;  1RIL A;  3KKR A;  3A2F A;  2R7Y A;  1CXQ A;  4KTQ A;  3V9S A;  1RBR A;  4CK3 A;  3VQP A;  1IKY A;  3LAM A;  2A1S A;  2ITG A;  1L3T A;  2WON A;  3QEI A;  3I0S A;  2FC0 A;  4O5B A;  2KQ2 A;  2G8F A;  2A1R A;  4KRE A;  4CJF A;  5HLF A;  3C94 A;  2EX3 A;  2XO7 A;  1TVR A;  1IKX A;  3AVI A;  5CZ2 A;  1KCF A;  4IDK A;  4B9L A;  1GOA A;  3QO9 A;  1WLJ A;  4B8C A;  1RDC A;  3L8B A;  3LAN A;  3L2Q A;  1NK8 A;  4CF8 A;  2G8W A;  5C25 A;  2VG5 A;  4JS4 A;  4CIE A;  3AA4 A;  1X1P A;  1TKX A;  3V9W A;  3LP0 A;  1BI4 A;  3AO3 A;  4MQ3 A;  3TAN A;  1LW0 A;  5T7B A;  3QEX A;  4F8R A;  2RN2 A;  5JS2 A;  3RTV A;  2GUI A;  1S6P A;  4CHY A;  1LWF A;  2IGI A;  2YNH A;  3MEG A;  4BWM A;  4GMJ B;  3RMA A;  1B9F A;  4KRF A;  1GOC A;  3HST B;  3TAF A;  2B4J A;  1WAF A;  4GW6 A;  4KHW A;  1T8E A;  4CEB A;  1K6Y A;  3WNE A;  4NCB A;  4O0J A;  1TL3 A;  4I2P A;  3HL8 A;  3VQ7 A;  2YHA A;  2HHU A;  5K14 A;  4CFC A;  3KLF A;  1UAX A;  1RDB A;  4DQQ A;  1ZBL A;  2YV0 X;  4CJS A;  1UA1 A;  3PY8 A;  2KZM A;  4ZHR A;  3NGI A;  4IBN A;  4CJR A;  2FBX A;  4CGJ A;  4XIU A;  1ZBI A;  4Z4G A;  4H4O A;  3K5O A;  4CER A;  2O4G A;  1EKE A;  2YNF A;  3LWL A;  2HHS A;  3LWM A;  3S9H A;  1RTH A;  3SUO A;  3OYI A;  1LAW A;  4G1Q A;  4OJR A;  3DLG A;  4CED A;  4KB1 A;  4FJN A;  3OYC A;  2HHW A;  1ASV A;  1ITG A;  3SYZ A;  3KLE A;  1BIU A;  4CHQ A;  3MXI A;  1HRH A;  2JLE A;  2F8S A;  3PV8 A;  3V9X A;  1D9F A; 
#chains in the Genus database with same CATH topology
 2IDO A;  4BGB A;  5FRO A;  1LWE A;  4EFH A;  2B5J A;  4BRH A;  3RVC A;  3CCQ N;  2OTJ N;  4CD3 A;  3M3Z A;  3VA3 A;  2E6L A;  5HP1 A;  4C8L A;  3WT0 A;  4CES A;  4E7L A;  4OPK A;  4B9Q A;  1OVY A;  3CJC A;  4KTZ A;  4GY2 B;  3VQB A;  1BHL A;  1RFQ A;  3U3G A;  3NVM A;  5BR8 K;  3G71 N;  3BDP A;  4B1Z A;  1N32 K;  3ZT4 A;  3AY9 A;  2B6A A;  3AO4 A;  5AQL A;  2FLO A;  4DU4 A;  2D0B A;  3THW A;  2ITM A;  3KLI A;  3SK3 A;  3VQD A;  2A41 A;  2BTF A;  2YJE A;  1NJX A;  5FPD A;  1JLC A;  1DTT A;  3SQ4 A;  4B3S K;  2UXB K;  4NB4 A;  3EE9 A;  3KK7 A;  3DLR A;  3I0R A;  4M7Y A;  3VGK A;  2GUP A;  1JCF A;  2KFN A;  1X9W A;  2OZM A;  4JHD A;  1ATS A;  2NNW A;  3QB0 A;  4M45 A;  2ETJ A;  1ATR A;  3LDQ A;  4RW6 A;  4C1N I;  2Y1J A;  4JKH A;  3HXM A;  3H08 A;  2D0P A;  2ZGZ A;  4JHD B;  1BL3 A;  1R0A A;  4DV6 K;  5AQG A;  1Z26 A;  1Q9X A;  3QNN A;  1TKT A;  4U67 L;  4EP5 A;  1E3M A;  1NGJ A;  3E01 A;  3V1O A;  2IAJ A;  3QNO A;  3ZSZ A;  4FM2 A;  2YCH A;  1NKE A;  2XY6 A;  1B92 A;  4C8M A;  1CZ9 A;  1WSJ A;  3OVN A;  4J8F A;  5H1S Q;  4QS7 A;  2F9W A;  4JI8 K;  4Y1D A;  3A5O C;  1JXE A;  3ENB A;  5J2Q A;  2KHO A;  1YTU A;  3OYN A;  4CIG A;  2GV9 A;  5FDL A;  3ULE A;  3OS2 A;  4RWT A;  3T19 A;  1WOQ A;  2VWB A;  4FJ8 A;  4FM0 A;  3D2F A;  3TAP A;  1J6Z A;  3LAL A;  3RMB A;  3DLB A;  3NH0 A;  2E2P A;  3VQ9 A;  4DQ8 A;  4CBU A;  4IZ9 A;  2YX6 A;  1S1X A;  1BGX T;  3P38 A;  3D45 A;  3MN7 A;  4CJ4 A;  3BUZ B;  2NRW A;  5IWA K;  3H6E A;  2O8B B;  3KWG A;  4JK7 A;  1CLQ A;  2KKZ A;  3QIP A;  4MO5 A;  3RR7 A;  2CGJ A;  4A62 A;  1HR0 K;  3L2U A;  2P9S B;  1QQO A;  2F96 A;  3RSE A;  1Q81 O;  4B08 A;  1FJG K;  3FR0 A;  3O80 A;  4BE1 A;  2RF2 A;  4DV3 K;  3DOK A;  4FJI A;  1SL2 A;  2D0O A;  4IEI A;  1IBK K;  4LF7 K;  3M8S A;  3DXK A;  3HRG A;  1LWC A;  4BG8 A;  1TGO A;  5AZI A;  4YHH K;  4M3X A;  1KVB A;  4ID1 A;  2NRV A;  3C95 A;  3TWH A;  4O55 A;  1U04 A;  1QHA A;  2VQF K;  3CJA A;  4CZK A;  3CHW A;  2BE2 A;  5EOY A;  3BZK A;  3EE8 A;  4DLG A;  1VQ5 N;  3DJC A;  3MED A;  4BRO A;  4I2Q A;  4E89 A;  1XUP O;  3S3O A;  1ZYQ A;  4DCH A;  1C0F A;  3HO1 A;  4FZX C;  1B9D A;  3CC7 N;  4YFU A;  2A40 A;  4OKJ A;  3CCV N;  1JLB A;  4OVL A;  3SMS A;  4E1M A;  5BRH A;  3H46 O;  3OW2 M;  3ASM A;  4MO4 A;  5AQI A;  3GBT A;  2PYL A;  2W6L A;  4CGI A;  1N8R O;  3U4L A;  4YOR A;  4JRP A;  5EU7 A;  4DTR A;  2YHW A;  4B1V A;  3ZSR A;  4OKE A;  3CQ8 A;  1HX1 A;  1UWB A;  2RPI A;  2OPQ A;  4B9U A;  3LL3 A;  4DF4 A;  2LSN A;  5CZ1 A;  3ID8 A;  3SPZ A;  3LDL A;  4FLV A;  3CFO A;  5AQM A;  4O0I A;  3VN5 A;  3RRH A;  4EZ6 A;  4F9O A;  1DTQ A;  4DLE A;  4JK9 A;  1BU6 O;  4H5T A;  1DGK N;  5KTQ A;  2E1Z A;  1NK6 A;  4AHU A;  4J2B A;  5CE3 A;  3JXU A;  4FJL A;  1I3A A;  4DWI A;  2BAN A;  3SLC A;  1DT9 A;  5M1Q A;  4M42 A;  1GOB A;  2X6S A;  4H0O A;  3MK6 A;  4ISF A;  3LP3 A;  4BRQ A;  1RDD A;  3H1V X;  1HYS A;  3IMX A;  2E20 A;  3THY B;  2G8I A;  4Z94 A;  2UUC K;  5GAH P;  3NF7 A;  4FM1 A;  4HTU A;  4E1N A;  3W0L A;  4CEE A;  5FRN A;  4TSX A;  4FJM A;  3A5M C;  2QWQ A;  5M1O A;  3IRX A;  1KQS M;  3MMV A;  1VQM N;  3K5M A;  2KZZ A;  1T7P A;  2QKB A;  4RTF D;  4LFB K;  1HPZ A;  3DRS A;  2UUB K;  4PWD A;  2Q31 A;  4DG1 A;  3HP6 A;  4DSK A;  3K2P A;  4H0X B;  4PKH A;  3TAG A;  3OS0 A;  5AZI B;  4LY7 A;  1RTD A;  3KKS A;  3RWU A;  2XRI A;  4CVN E;  1YIJ N;  2F7T A;  3HPG A;  1CZA N;  2RE2 A;  3M8Q A;  1YTA A;  4OGE A;  3LDS A;  3VOV A;  3WXJ A;  3C6A A;  2RKI A;  2P9P A;  3NGZ A;  3Q7B A;  4CGD A;  3VA0 A;  4ELV A;  3MCP A;  2QI2 A;  5FPN A;  3QER A;  2I5J A;  4DS5 A;  4K41 A;  4O44 A;  1OKJ A;  3ZSQ A;  2O8B A;  2AA4 A;  2QXL A;  4BVO A;  1BIZ A;  1NK4 A;  2RHK A;  1RGI A;  4DV2 K;  4FJH A;  4DFK A;  4M3T A;  3VF2 A;  4CEC A;  3CM5 A;  3L3V A;  1VSK A;  3TSQ A;  1FK9 A;  4B9V A;  3AAP A;  1SKR A;  3SZ2 A;  3DLH A;  1SKS A;  4E7K A;  3M5R A;  3CFR A;  3KHY A;  2GX9 A;  3NFA A;  5FLX O;  1RBU A;  1NGF A;  2IC3 A;  4M7X A;  4N56 A;  5KGX A;  1P90 A;  4IO8 A;  3E9P A;  3CCS N;  2Z1I A;  4FLX A;  2NZT A;  1GLD G;  2ZM6 K;  1A5W A;  3E9O A;  4DTM A;  4CFA A;  3JSM A;  2P9N A;  3THX B;  1BIS A;  1NK7 A;  2G8V A;  4BDY A;  4B3R K;  1XHZ A;  3G10 A;  3NF8 A;  5C24 A;  1BCO A;  2Q0U A;  4FOE A;  3NCI A;  1HNZ K;  4BQL A;  1HQE A;  3ZT0 A;  3L3U A;  4JEP A;  3NMU A;  1NLV A;  2BUP A;  5GIO A;  1CXQ A;  3FLC O;  1RBR A;  4V19 S;  4MLE A;  3FFK B;  2WON A;  3CC2 N;  4O5B A;  3TTD A;  2KQ2 A;  1QQN A;  3MN9 A;  4CZE A;  4KRE A;  3C94 A;  4B9L A;  5CZ2 A;  1IV0 A;  4G9Z A;  3UKR B;  2GTD A;  4B8C A;  1RDC A;  3L2Q A;  1HKG A;  1RDU A;  1BI4 A;  3AGK A;  3LP0 A;  4MQ3 A;  1XNR K;  5T7B A;  4JD2 B;  4F8R A;  2RN2 A;  5JS2 A;  5HOO A;  3VEV A;  4CHY A;  1VQO N;  3VPZ A;  1YUW A;  3RMA A;  2DPN A;  1WBD A;  5GIN A;  3AAQ A;  1VQN N;  4BY9 C;  3HST B;  3VEN A;  3TAF A;  1TUU A;  3VQ7 A;  3EN9 A;  4CFC A;  1UAX A;  3THW B;  3R6M A;  2P9N B;  4WQ5 A;  2FBX A;  3K5O A;  2YNF A;  4KB1 A;  3DLG A;  4BC3 A;  4KHP K;  3OYC A;  3F2K A;  3O1B A;  1ITG A;  4CHQ A;  3W3D A;  3U9D A;  3KD5 E;  4GVM A;  4LF4 K;  5IT9 O;  4LFC K;  1U4B A;  3KJV A;  3VES A;  1S1U A;  2NRX A;  3N4P A;  3HBT A;  1U45 A;  4CEZ A;  3J7Y P;  1EP4 A;  3OS1 A;  1BO5 O;  5ELZ A;  1S1V A;  4FWL A;  3HI0 A;  1WSI A;  2ZGY A;  3O4Q A;  4JKA A;  1ILY A;  2Z1J A;  1MWK A;  3IG1 A;  4O4G A;  4B3M K;  4FK4 A;  4AIL C;  3ZET B;  3AVM A;  3U9Z A;  4DTN A;  5AZJ B;  3KIO A;  1EXQ A;  2P9P B;  1JL2 A;  2YHB A;  5JMV A;  2OCE A;  4WQ4 C;  4EIA A;  4N5S A;  4E7J A;  4CJT A;  4F2S A;  3D2E A;  5C10 A;  1NKB A;  3J80 O;  3O9Q A;  3K58 A;  2VG6 A;  1NG9 A;  4FJG A;  1YIT N;  4RW9 A;  4J2E A;  3C6T A;  2OPP A;  3ATV A;  4BRD A;  1VAZ A;  5KQ8 A;  1XC9 A;  2W42 A;  1BCM A;  4K25 A;  3CC4 N;  4GV3 A;  4DR1 K;  2P51 A;  3JYT A;  3HP9 A;  5E26 A;  4WFN L;  4O8K A;  3ZSY A;  1Q18 A;  5CYQ A;  3UE5 A;  3NAE A;  2OYQ A;  5FPM A;  3J7Z O;  2E8A A;  1TAU A;  4IEE A;  3PO4 A;  4DU1 A;  4DR7 K;  2FBY A;  4BRL A;  4KO0 A;  2HMP A;  3L2W A;  2KW4 A;  4FPA A;  2A6A A;  3ISN C;  1SS6 A;  3JAM O;  4DQR A;  4ELU A;  4DHY A;  1C0U A;  2F8T A;  3QIN A;  3LM9 A;  2ZQB A;  5DK5 A;  5GIP A;  2HND A;  3B6O A;  3WEE A;  3THY A;  4AHS A;  4E0D A;  3CI5 A;  3GG4 A;  1TKD A;  3KK3 A;  3RR8 A;  2OPS A;  4OLB A;  4I6M B;  2P1J A;  4CJV A;  3FZL A;  2YHY A;  5KRS A;  4CGG A;  4HUG A;  4OPJ A;  3H45 C;  1OVQ A;  2VYP A;  4BE2 A;  3FFI A;  4CZH A;  4CFD A;  1RT5 A;  4BC2 A;  1IH7 A;  4K43 A;  3OYL A;  3OYJ A;  1NGH A;  4PL7 A;  3DLL L;  1K8A O;  5M1P A;  2O8C A;  4QCL A;  4IJN A;  4M3W A;  2YI1 A;  4CZJ A;  3ENO A;  4L8R B;  4IG3 A;  3T1A A;  5KQD A;  3LDN A;  4LFA K;  1C1B A;  1HKB A;  3OY9 A;  1D8Y A;  3HPH A;  3T7Z A;  3SCX A;  4H0P A;  4XH5 A;  3AO5 A;  4H5W A;  4GV6 A;  2IVO A;  4WFA L;  5GAE P;  3K5N A;  2X6N A;  4M3R A;  2P9U B;  1K9M O;  4OKK A;  3CCR N;  1W0H A;  4AHC A;  5AQR A;  2G8K A;  2A42 A;  1KSP A;  2FF6 A;  1VSL A;  1VSE A;  2HHT A;  3RMD A;  2QWR A;  3HTV A;  3O3G A;  4DUY K;  2VQE K;  3CCL N;  4FJX A;  1JLE A;  1ZBF A;  1YT3 A;  3F9K A;  1HUX A;  4Q0B A;  4CJE A;  1Q82 O;  3A0I X;  3DMJ A;  1IKW A;  3WNG A;  4EP4 A;  3KK2 A;  4ISE A;  3OJU A;  4KHN A;  4F4K A;  3K9K A;  2QEX N;  3SUN A;  1XHX A;  1TV6 A;  4CJ3 A;  3K9J A;  3OTO K;  4K8Z A;  4R79 A;  3AAR A;  1EET A;  1U48 A;  5AQV A;  3PX4 A;  5AJ3 K;  3QLH A;  1RBV A;  4YOV A;  4K8X A;  2HBL A;  4CCH A;  1KRP A;  4M3Z A;  1Q7Y O;  3ZEU B;  3DXK B;  1A5X A;  1KLM A;  3H3O B;  1R59 O;  4KH4 A;  1REV A;  1HQU A;  2GBZ A;  4XH1 A;  3AA2 A;  4FJK A;  3G25 A;  4EHU A;  4JI5 K;  1U49 A;  3O9R A;  3QEW A;  4BR0 A;  2QKK A;  1X9M A;  4I7F A;  3F5T A;  3V4I A;  1VRT A;  4EZ9 A;  4RW4 A;  1SL0 A;  3G6E N;  2JWL A;  2OZS A;  2HF3 A;  1RBT A;  5KPZ A;  1BQN A;  4KV8 A;  2GEM A;  1VSI A;  3PX0 A;  2Z1H A;  3QIC A;  3P83 D;  1T6D A;  1L3S A;  3DRR A;  3VQE A;  1C6V A;  4LD0 A;  3VF6 A;  1MA9 B;  5FRM A;  2D1K A;  4FWM A;  2D5R A;  4PA1 A;  3PX6 A;  1S1W A;  1YVU A;  4JKG B;  3O8M A;  1DKG D;  2HBM A;  4ELT A;  4FLW A;  4DR4 K;  4CF1 A;  4IFY A;  2YKN A;  2GWJ A;  1U2V B;  1RDW X;  4DR5 K;  1QSS A;  2E1Y A;  1HPM A;  3AVA A;  4I9Q A;  2HVI A;  3V1Q A;  4CEO A;  5BPN A;  2ZJR L;  4CF2 A;  4BR5 A;  2Q97 A;  4FZY A;  1JLF A;  1NGB A;  3TU5 A;  3K59 A;  4LH5 A;  4PY5 A;  1W7A A;  5CYM A;  4JAX A;  4CHN A;  3UB5 A;  4FJ5 A;  1EX4 A;  2ZE2 A;  3TPQ A;  3K57 A;  4Z0U A;  3QBX A;  1C0M A;  4E7I A;  1J5E K;  1VQL N;  1W2B M;  5AQW A;  3CET A;  5C42 A;  3T69 A;  4BRM A;  1YJW N;  5EVZ A;  4B1W B;  4ZTF A;  4NCA A;  4NCG A;  4UQG A;  4EHT A;  2JWK A;  4HVJ A;  1KFD A;  4FWQ A;  2D0C A;  3HJF A;  5JLH A;  1GLJ O;  1YAG A;  4KFB A;  4CZM A;  2WC9 A;  1WNS A;  3LDO A;  3M8P A;  2Q3S A;  5GAG P;  3HPO A;  4KAZ A;  2KFZ A;  4M63 C;  5LL6 Z;  1Q9Y A;  3EEQ A;  1Y97 A;  2PBD A;  3VET A;  1HMV A;  1F21 A;  1RT4 A;  3TR8 A;  1QHT A;  2P9K B;  3WNH A;  4FK0 A;  3WUH A;  5AQK A;  1S9G A;  4MDB A;  4QS8 A;  3L2R A;  4JS5 A;  4FZZ A;  1JL1 A;  3NE6 A;  4YY3 K;  3OYA A;  4M3Y A;  3OYG A;  1GLC G;  2ZJP L;  2YJF A;  3IUC A;  2UU9 K;  4AHT A;  4A5B A;  3SNN A;  4WQ5 C;  4BGA A;  3OYF A;  4NYF A;  1Q86 O;  1JLA A;  2HHX A;  4CJP A;  3ZT1 A;  5JS1 A;  4GNI A;  3CXC M;  4DTS A;  1JJ2 M;  4JI0 K;  4CF0 A;  1D9D A;  1RNH A;  1LAV A;  1XI1 A;  2BGG A;  3N4Q A;  3MX5 A;  4B1X B;  4K42 A;  5CHI A;  5BRE A;  3V9Z A;  2OA8 A;  3EZ5 A;  4DV5 K;  3V6D A;  3P5J A;  5TKY A;  4H5R A;  3HVT A;  4BG9 A;  2HNZ A;  4CIF A;  1FW6 A;  4RW7 A;  4A2A A;  3OA9 A;  5JLF A;  1S1T A;  3OJS A;  3MDQ A;  2ASP A;  4QAG A;  4BC4 A;  3DOL A;  3CF5 L;  2DFH A;  3AA3 A;  4E7H A;  3I33 A;  3SQ2 A;  4BR7 A;  5BN8 A;  3OYB A;  3KKR A;  5EX5 A;  1QZ5 A;  5ADX A;  3VQP A;  1IKY A;  3NVK A;  3LAM A;  2A1S A;  4DV7 K;  2A1R A;  5HLF A;  5C15 A;  2EX3 A;  4IWV A;  1KCF A;  2CGL A;  4IDK A;  3HOT A;  3ZX3 A;  4H5N A;  4AQY K;  3MWT A;  1VQ9 N;  4JS4 A;  4CIE A;  1TKX A;  3V9W A;  2CH6 A;  3AO3 A;  4CZL A;  4IOC L;  1VQ8 N;  4YOT A;  3S41 A;  4GKK K;  5AQF A;  3CJ7 A;  1LWF A;  2IGI A;  2YNH A;  3DXM A;  4H03 B;  1B9F A;  2IVN A;  4KHW A;  4A2B A;  1T8E A;  4CEB A;  1K6Y A;  4FL9 A;  4O0J A;  3IKM A;  3GL1 A;  1ATN A;  2P9I B;  3VEW A;  2HHU A;  4DQQ A;  1ZC6 A;  2YV0 X;  4CJS A;  5DM7 L;  1NM1 A;  3PY8 A;  3PLA A;  4CJR A;  4H4O A;  4CER A;  3LWM A;  5KPR A;  3SUO A;  4OJR A;  4CED A;  1ASV A;  3SYZ A;  2JLE A;  4BRC A;  3UKU B;  3HM8 A;  4Y0W A;  1HKC A;  1NJW A;  1T03 A;  4N47 A;  4J2A A;  1XWL A;  5J2M A;  2O8D A;  3B6P A;  1E4G T;  1KTQ A;  3M6G A;  3HOS A;  3SPY A;  4OX9 K;  1NGA A;  2IS3 A;  4LSL A;  3RRG A;  3LPT A;  1G99 A;  4YDU C;  3HVR A;  4DSI A;  2VGM A;  3EY1 A;  3C6H A;  4AHR A;  4ZTJ A;  1N33 K;  4LF6 K;  3T1Y K;  5AQO A;  1K8K A;  4FWN A;  3TAQ A;  1EWQ A;  3AO1 A;  1SUQ A;  3BGR A;  1VRU A;  3MAQ A;  3R1X A;  1QE1 A;  3HM9 A;  2O4I A;  1NKC A;  4Z4C A;  4DR3 K;  1QSL A;  4JI7 K;  1IG8 A;  2ATQ A;  3HK2 A;  3QEV A;  1RT1 A;  2QW9 A;  4AH9 A;  3ZEU A;  4MLH A;  2JGU A;  4CBW A;  4A57 A;  3ZX2 A;  2NUB A;  3BY5 A;  2D4W A;  3O4N A;  1RT6 A;  5F1X A;  1NK5 A;  3TAM A;  1V4S A;  2P5G A;  5E84 A;  3SV3 A;  1C0G A;  3SJJ A;  4FLZ A;  3DRP A;  3AVK A;  4CJL A;  4O8U A;  5AQJ A;  3VQ4 A;  4CJ5 A;  3R3L A;  2BH1 A;  3P1G A;  3L4Q A;  4WCE L;  2J4R A;  4CHP A;  4DV4 K;  2HHQ A;  3O3F A;  3NGY A;  1UOC A;  4YOX A;  2XY5 A;  4JI1 K;  2HBK A;  3VQ8 A;  4L3Q A;  4Y1C A;  3CCM N;  4CBX A;  2DTU A;  1S5J A;  4B3O A;  3MN5 A;  4CZG A;  2P5O A;  3AVL A;  1WB9 A;  2DY4 A;  4KHY A;  5KGW A;  4DSF A;  1BA1 A;  4IO9 L;  1C1C A;  1LV5 A;  3R9P A;  4PUO A;  3TAR A;  4AM6 A;  4BRF A;  4BR2 A;  4WQ4 A;  1ZBS A;  4N41 A;  3IS9 A;  3Q7C A;  4DTJ A;  1VQK N;  4F3O A;  1QTM A;  4OPA A;  5HRP A;  1LOT B;  3SJH A;  4FPB A;  4CZI A;  1TUY A;  3KWI A;  4RG8 A;  2O8D B;  4PKG A;  5AQQ A;  4YDU A;  3RMC A;  1S22 A;  5CR4 A;  1IO2 A;  1MU2 A;  5J2P A;  1YI2 N;  4OGC A;  3QFP A;  1XQS C;  3J7A P;  4KH5 A;  4C8N A;  1GLA G;  3D0P A;  2OPR A;  4Z4I A;  2WTU A;  3A5L C;  3NH1 A;  1NGE A;  5LMU K;  4DTO A;  4FJ7 A;  3VEX A;  4JLH A;  1OH7 A;  3WEE B;  4XEI A;  3CMA N;  3SBT A;  1QVG M;  1ZBU A;  3LPU A;  4QOZ B;  1NGD A;  5JVH L;  3AVN A;  2PFU A;  4IG0 A;  3EL2 A;  3PIO L;  1ZBH A;  3DXM B;  3OBY A;  5LY3 A;  4DS4 A;  4DTX A;  2NRT A;  1CXU A;  5M1N A;  3KD1 E;  2D0A A;  4FWO A;  1WAJ A;  3PSF A;  3C6U A;  3NDK A;  4JRQ A;  4FO0 A;  4CEF A;  1RT2 A;  3WXL A;  1XC3 A;  2ZF5 O;  4HWI A;  4DB3 A;  4YOU A;  4FJ9 A;  4DR6 K;  2HST A;  2WOM A;  2O8E A;  2AJQ A;  3C0B A;  1GLB G;  3VQ5 A;  2DFF A;  3OYK A;  2QA4 N;  4BR4 A;  3LZI A;  1RTI A;  3CME N;  1TAQ A;  4ICL A;  4CJW A;  2QWL A;  5LJW A;  1KC8 O;  1NWK A;  3O08 A;  3S3M A;  3VER A;  4RW8 A;  1FKP A;  4H4M A;  1M1K O;  4CK1 A;  4NLB A;  3IAY A;  1XNQ K;  1Q8I A;  5BRD A;  3O1W A;  3ZET A;  3DLK A;  2EHG A;  1WSH A;  2ZWH A;  3FZM A;  3TSP A;  3CJ9 A;  4PL8 A;  3T3F A;  2NRZ A;  1P8Z A;  5KI6 A;  1KVA A;  2QWM A;  1EWR A;  3CD6 N;  4CEQ A;  3QBW A;  4JNE A;  1RTJ A;  4WFB L;  4PHT X;  2FBT A;  5DMR A;  3H1Q A;  4FYD A;  1W9H A;  3ZSW A;  4NLC A;  3VEZ A;  1N36 K;  5AQY A;  1HNW K;  3BZC A;  4FOI A;  3VTH A;  3FZH A;  4JI4 K;  4FVU A;  4ISG A;  2WBN A;  5BN9 A;  4CZF A;  2O8F B;  3CQX A;  5ADX H;  1HYV A;  1RT3 A;  1N34 K;  1NJZ A;  1ASW A;  4JV5 K;  3VQA A;  2VG7 A;  4H5V A;  3QEP A;  4OO1 J;  5KRT A;  1KD1 O;  1VSH A;  5HRO A;  3BEX A;  3MWP A;  4IFE A;  2FSN A;  3L6Q A;  2UXD K;  5HRN A;  5HL7 L;  3MXM A;  1DEJ A;  2P9K A;  3SQ1 A;  5TKW A;  1IBL K;  3SUQ A;  1IKV A;  4MDA A;  1KVC A;  3K0S A;  1X3M A;  1BA0 A;  3MN6 A;  2QXF A;  3TTF A;  4JD2 A;  1S72 N;  1BI4 B;  3MX2 A;  2ASO A;  3GOI A;  1X9S A;  3SAH A;  5DM6 L;  5KPT A;  2FBV A;  3VGL A;  4I9L A;  1C1A A;  1OH8 A;  4DQI A;  1SKW A;  4DQS A;  5J2N A;  1XMQ K;  4NYN A;  5FPE A;  1VSD A;  4EAH D;  2P9L A;  5SZT A;  2V52 B;  4FXD A;  3DLE A;  3CIP A;  3UIQ A;  4A59 A;  1KAZ A;  1WN7 A;  2A5X A;  5CY4 A;  4B1Y B;  2OTL N;  3KK1 A;  3AVG A;  1K73 O;  3M1F A;  3CFP A;  4B3T K;  4BRP A;  4LF9 K;  2E2Q A;  3CG7 A;  1J53 A;  3VQC A;  3DAW A;  3WQU A;  4FCY A;  3THX A;  4F2R A;  1GLF O;  1U2V A;  2WUS A;  2IIR A;  2IOC A;  3VEO A;  3AV9 A;  4JKB A;  1HYZ A;  5JIC A;  3NBP A;  1QS4 A;  3G4S N;  4Z4F A;  5AQS A;  2VWJ A;  3TAE A;  2XY8 A;  1L3U A;  4KHS A;  5C0Y A;  2AP1 A;  4FW2 A;  5AR0 A;  4GKJ K;  2G8H A;  4DUZ K;  1QVF M;  4M3U A;  1YJ9 N;  3HSC A;  2X74 A;  4FWR A;  5EXW A;  5HRR A;  1S9E A;  1FKO A;  3I8D A;  1HNV A;  1NBW A;  1D5A A;  3AVC A;  3AVF A;  2XHB A;  2ASM A;  1VSM A;  1RCH A;  4DSE A;  4JI6 K;  4K0K K;  4HUF A;  1BWF O;  1NGG A;  4BWJ A;  4CF9 A;  5F2R A;  4GVE A;  2HW3 A;  3F73 A;  1T05 A;  3ZT3 A;  4BRI A;  5I9E B;  1Z05 A;  4HCC A;  1N6Q A;  2YKM A;  3WQT A;  1RIL A;  5C2F A;  3A2F A;  2R7Y A;  2GEL A;  5F0X A;  1BUP A;  3MCA B;  2ITG A;  1NU0 A;  4FWP A;  2W6K A;  3TTC A;  4CJF A;  3VEY A;  1TVR A;  3AVI A;  1GOA A;  4BC5 A;  2HOE A;  2Q36 A;  5AQT A;  1WLJ A;  4XH4 A;  3F9M A;  1NK8 A;  2VG5 A;  1VQ7 N;  2OAN A;  1X1P A;  4JN4 A;  3RTV A;  3QFU A;  2GUI A;  4RCH A;  4GV9 A;  4DKW A;  1JCG A;  4GMJ B;  2E88 A;  4UY8 O;  1NGI A;  1BG3 A;  4CD1 A;  1NMN A;  2B4J A;  1WAF A;  3WNE A;  4NCB A;  1TL3 A;  4JI3 K;  3HL8 A;  4BRE A;  1NNE A;  3C65 A;  3O5B A;  5K14 A;  1UA1 A;  1RDB A;  4DV0 K;  3NGI A;  4IBN A;  4JKD A;  4XIU A;  2HHH K;  1ZBI A;  4Z4G A;  1JCE A;  2O4G A;  1EKE A;  3LWL A;  2HHS A;  3OYI A;  1LAW A;  4G1Q A;  3EKU A;  4FJN A;  4KH6 A;  3CCE N;  3O9S A;  2F8S A;  2PZS A;  3V9X A;  4OLA A;  4J2D A;  3ITH A;  4LC9 B;  1NOY A;  4A61 A;  2NRR A;  3ZX0 A;  3AA5 X;  1L5U A;  1BQM A;  5HRS A;  3QDK A;  3BF3 A;  2O8C B;  1EQY A;  4FLY A;  2Q2R A;  3I56 N;  4CJK A;  4Z4E A;  4CJQ A;  3EZW A;  4DU3 A;  1S6Q A;  2Y1I A;  3SUP A;  3CYM A;  4PKI A;  4NO7 A;  1GLE G;  4FLU A;  3ZYY X;  4X66 K;  2HBJ A;  1QQM A;  4B9N A;  2W41 A;  3SAF A;  1T6C A;  4CE9 A;  5LJV A;  1QZ6 A;  4I6M A;  3A8Y A;  4DFJ A;  3DYA A;  3ATU A;  3QES A;  1ASU A;  3AVB A;  4H0T B;  4FJJ A;  4CGF A;  2BDP A;  3ENH A;  4CK2 A;  1KAY A;  3ZSO A;  3VTI A;  3ULD A;  2HHV A;  4X65 K;  4CFB A;  1RDA A;  2P9L B;  3WNF A;  2H3G X;  4C8O A;  1NOZ A;  3KZB A;  4HUE A;  1WSE A;  4BRA A;  3A5N C;  2HMI A;  5EY4 A;  3AO2 A;  2YNG A;  4BVP A;  1L3V A;  1U47 A;  3B8A X;  4AHV A;  3K5L A;  2F9T A;  1RBS A;  1YJN N;  4KBO A;  1I39 A;  1KAX A;  1N5Y A;  3PUF A;  4ILG B;  4IOX A;  3DWL A;  5C2D A;  2Q1N A;  5AQH A;  3ZCM A;  1TK8 A;  4M41 A;  4KI4 A;  2KTQ A;  2WFB A;  4IXC A;  2HVH A;  4CW7 B;  1CZB A;  1X9J A;  2E6M A;  4E19 A;  2PY5 A;  2NRH A;  4WYB A;  5LMN K;  1FXX A;  4KPY A;  5I42 A;  3WXI A;  1Z25 A;  4FVM A;  4B9T A;  4BR9 A;  3D2E B;  1QQC A;  3RSE B;  3I55 N;  4W5T A;  2HNY A;  2P9S A;  1UA0 A;  5BPM A;  5AZJ A;  3OYD A;  2VGN A;  4KHQ A;  1J5O A;  1M90 O;  4IOA L;  1HNI A;  4FWS A;  4KHU A;  4B9M A;  1MWM A;  3ZT2 A;  3PSI A;  3DI6 A;  2I7N A;  2E2O A;  4FSV A;  1BDG A;  1Y64 A;  2VCP A;  5B8H A;  3U3Y A;  2A3Z A;  2O8F A;  1TK0 A;  4C1N K;  3OBW A;  2HB5 A;  1GLL O;  4Q5V A;  2QWP A;  2V7Y A;  3SV4 A;  3D2F B;  3HZ6 A;  1WSF A;  4JKF A;  4CHO A;  4IDH A;  3ULE B;  2QWN A;  3CJ1 A;  5AQP A;  4BRG A;  4BAC A;  2F4V K;  1O1W A;  1IG9 A;  5SWM A;  1KXP A;  3SAG A;  5MLC Q;  1EO1 A;  5GAD P;  3L0Q A;  4KI6 A;  2G8U A;  4FW1 A;  3OYE A;  4B8A B;  2YHX A;  4CJ7 A;  2V7Z A;  3FZF A;  4AF1 A;  5AFU A;  1T3V A;  4H8K A;  2FSJ A;  3IDH A;  3EYZ A;  2DFE A;  2UXC K;  3S3N A;  4JKE A;  4N76 A;  1C0T A;  3GDQ A;  3U6F A;  1J9A A;  3KTQ A;  4E1J A;  2V51 B;  3LZJ A;  2E2N A;  4DMN A;  2QK9 A;  2O8E B;  4FWK A;  4CEA A;  3EO3 A;  4LSN A;  1YVN A;  4JI2 K;  4H0V B;  4BDZ A;  3WXK A;  4KB0 A;  4IKF A;  5AQU A;  3ZLJ A;  2KLA A;  3SQ0 A;  3UKR A;  3DM2 A;  1XMO K;  1S3X A;  1TL1 A;  3J81 O;  3I8B A;  1TK5 A;  3V9U A;  5BRF A;  1OH6 A;  1DLO A;  4U7B A;  4WE1 A;  3SI6 A;  3ZSV A;  4BE0 A;  1RT7 A;  4LH4 A;  1SV5 A;  3SBG A;  3OYH A;  4HHT A;  1ZXO A;  4A5A A;  4W5N A;  3VQQ A;  2FXU A;  4C8K A;  3O3H A;  4WF9 L;  3L4I A;  4O5F A;  2E4L A;  2Q0R A;  1G15 A;  2CGK A;  3E1Y A;  1NMD A;  1QSY A;  4DFM A;  4KTW A;  3EKS A;  5BPL A;  3M8R A;  4HCB A;  1JXB A;  4W5Q A;  3OHR A;  1VQ4 N;  4JKG A;  4JK8 A;  4DFP A;  1O13 A;  3AVH A;  2X78 A;  1NGC A;  4DSJ A;  3D6R A;  3V81 A;  5AQX A;  1Z6R A;  4FK2 A;  3CCJ N;  4AM7 A;  4H0Y B;  3IFR A;  1J54 A;  3O9T A;  1KFS A;  1VK0 A;  4KKO A;  3D7E O;  3ZSX A;  1X3N A;  3FZK A;  1YXQ A;  3JS6 A;  3PO5 A;  4FLT A;  1KLN A;  1NK9 A;  3HT3 A;  4YNQ A;  4PQU A;  3KLH A;  3NF6 A;  4B9S A;  4DTU A;  1YHQ N;  3KLG A;  1VSF A;  3H3N O;  2ZD1 A;  2IVP A;  3C7N B;  4CHZ A;  5AQZ A;  4R5P A;  3GE1 A;  3AVJ A;  3MEC A;  3FGU A;  4DF8 A;  5AQN A;  3E66 A;  3LM2 A;  3V1R A;  1HJO A;  3THV A;  4NXM K;  3QET A;  3TI0 A;  4ILH A;  4JYA K;  3J8A A;  2XY7 A;  1TYQ B;  3HYF A;  3VF4 A;  3LDP A;  4DV1 K;  3CJB A;  1T44 A;  4CI6 A;  3MXJ A;  4LF5 K;  1HNX K;  3NF9 A;  4ID5 A;  4OPH A;  3AGR A;  3TAB A;  4CJU A;  1NK0 A;  3BF1 A;  5A2Q O;  3L2V A;  4CGH A;  4JKC A;  5J1E A;  1JLQ A;  2Z1G A;  1NJY A;  4BDP A;  4IFV A;  4W5O A;  1SQK A;  3G0Z A;  3P4I A;  4MFB A;  1VQ6 N;  5C12 A;  3E9L A;  3O4W A;  4DQP A;  5E41 A;  2QWO A;  2P9U A;  2GWK A;  3BP8 A;  1VQP N;  1LW2 A;  4DSL A;  3PIP L;  5D3G A;  3NH2 A;  1SZ2 A;  3CPE A;  4X62 K;  1MDU B;  3TSU A;  2PYJ A;  1K8K B;  3U8X A;  1SL1 A;  3OYM A;  1V4T A;  1IJJ A;  3ALY A;  4Z4H A;  1HJR A;  1TKZ A;  5HBM A;  3ID6 A;  1JLG A;  2FF3 B;  1HLU A;  4HTL A;  2UUA K;  5I3U A;  3CM6 A;  2CH5 A;  2VWK A;  4IJA A;  3SMP A;  4DTP A;  1VHX A;  3UKU A;  3NHG A;  1H1V A;  3O9U A;  5M1K A;  3LAK A;  3MEE A;  4NXN K;  1JKH A;  1VSJ A;  3CER A;  4W5R A;  3LP1 A;  3P31 A;  3VQ6 A;  4ILJ A;  4F3T A;  3QML A;  2I7P A;  5BR9 A;  1A5V A;  4E3S A;  3QIO A;  3P39 A;  2P9I A;  2YNI A;  1WSG A;  3LP2 A;  4BQZ A;  4KTQ A;  2HF4 A;  3V9S A;  4CK3 A;  4YOW A;  1W97 L;  3CCU N;  1L3T A;  3QEI A;  3I0S A;  2FC0 A;  2G8F A;  5JVG L;  3VMF B;  1OH5 A;  2XO7 A;  1BOT O;  1IKX A;  1WUA A;  3QO9 A;  3L8B A;  3R8E A;  3KVG A;  3LAN A;  4CF8 A;  2G8W A;  5C25 A;  3T1H K;  3O6W A;  3AA4 A;  3FE1 A;  1ESV A;  4BRN A;  1YF5 L;  1LW0 A;  3TAN A;  1TYQ A;  1LCU A;  2ZJQ L;  4BRK A;  3QEX A;  2E5L K;  2FSK A;  1S6P A;  5AFU H;  4YOY A;  3CPW M;  2W40 A;  4BWM A;  1SAZ A;  3MEG A;  5M1F A;  2QTD A;  4KRF A;  4X64 K;  1GOC A;  1U6Z A;  3WXM B;  3VGM A;  4GW6 A;  1E4F T;  4I2P A;  4QS9 A;  2YHA A;  3C7N A;  1ZBL A;  3KLF A;  2KZM A;  4DR2 K;  1D4X A;  4ZHR A;  1NJI O;  4LF8 K;  4CGJ A;  2UYT A;  1I94 K;  3CQY A;  4B1U B;  1IBM K;  3S9H A;  1RTH A;  1WBB A;  2NLX A;  2EWS A;  2QM1 A;  2HHW A;  3KLE A;  1BIU A;  3MXI A;  1HRH A;  2PAV A;  3PV8 A;  4C23 A;  1D9F A; 
#chains in the Genus database with same CATH homology
 2IDO A;  3ITH A;  5FRO A;  1NOY A;  1LWE A;  1NJW A;  1L5U A;  3AA5 X;  4GVM A;  4N47 A;  2B5J A;  1T03 A;  3KD5 E;  4J2A A;  1BQM A;  5HRS A;  1XWL A;  5J2M A;  3B6P A;  1U4B A;  1KTQ A;  3SPY A;  3KJV A;  3VA3 A;  2IS3 A;  4LSL A;  3RRG A;  2E6L A;  3LPT A;  5HP1 A;  4C8L A;  4FLY A;  1S1U A;  4CJK A;  4CES A;  3HVR A;  1U45 A;  4DSI A;  4E7L A;  4Z4E A;  3EY1 A;  4OPK A;  4CEZ A;  4CJQ A;  4DU3 A;  4AHR A;  1EP4 A;  1S6Q A;  3OS1 A;  2Y1I A;  3SUP A;  4ZTJ A;  3CYM A;  4KTZ A;  1S1V A;  3VQB A;  1BHL A;  4FLU A;  3TAQ A;  3U3G A;  1WSI A;  3O4Q A;  4B9N A;  2Z1J A;  3IG1 A;  4FK4 A;  4O4G A;  4CE9 A;  3AO1 A;  4AIL C;  1SUQ A;  3AVM A;  3BGR A;  4DTN A;  3BDP A;  1VRU A;  3KIO A;  3MAQ A;  3ZT4 A;  1EXQ A;  2B6A A;  3DYA A;  1JL2 A;  1QE1 A;  2YHB A;  3AO4 A;  4N5S A;  3HM9 A;  4DFJ A;  1NKC A;  2O4I A;  4E7J A;  4CJT A;  4DU4 A;  2D0B A;  4F2S A;  3VQD A;  3KLI A;  1NKB A;  1NJX A;  4Z4C A;  3QES A;  1QSL A;  1ASU A;  3K58 A;  3AVB A;  1JLC A;  1DTT A;  2ATQ A;  2VG6 A;  3SQ4 A;  4FJJ A;  3HK2 A;  4CGF A;  2BDP A;  3QEV A;  1RT1 A;  4FJG A;  4CK2 A;  4AH9 A;  3DLR A;  4RW9 A;  4J2E A;  3ZSO A;  3I0R A;  3C6T A;  3ULD A;  2JGU A;  2HHV A;  2OPP A;  4CFB A;  1RDA A;  3WNF A;  2KFN A;  2NUB A;  4C8O A;  1NOZ A;  1XC9 A;  4HUE A;  1X9W A;  3O4N A;  2OZM A;  1RT6 A;  1WSE A;  1BCM A;  2W42 A;  2HMI A;  3AO2 A;  2P51 A;  3TAM A;  3JYT A;  1NK5 A;  2YNG A;  3HP9 A;  1L3V A;  1U47 A;  3ZSY A;  4AHV A;  3K5L A;  5CYQ A;  4M45 A;  3NAE A;  2P5G A;  3SV3 A;  1RBS A;  2ETJ A;  2OYQ A;  1I39 A;  3SJJ A;  4FLZ A;  2Y1J A;  4RW6 A;  1TAU A;  1N5Y A;  3PUF A;  3DRP A;  3PO4 A;  3AVK A;  4DU1 A;  3HXM A;  2FBY A;  3H08 A;  4CJL A;  4KO0 A;  1TK8 A;  3L2W A;  3ZCM A;  3VQ4 A;  2KW4 A;  4CJ5 A;  4M41 A;  4KI4 A;  1BL3 A;  1R0A A;  3ISN C;  2KTQ A;  2HVH A;  3P1G A;  4DQR A;  1CZB A;  4ELU A;  1Z26 A;  2E6M A;  1Q9X A;  3QNN A;  1TKT A;  4CHP A;  2HHQ A;  4E19 A;  3O3F A;  3NGY A;  2PY5 A;  1C0U A;  4EP5 A;  1UOC A;  3QIN A;  2F8T A;  2XY5 A;  3E01 A;  3V1O A;  3VQ8 A;  2ZQB A;  1FXX A;  2IAJ A;  5DK5 A;  3QNO A;  2HND A;  5I42 A;  4Y1C A;  4KPY A;  1Z25 A;  3B6O A;  3ZSZ A;  4FVM A;  4FM2 A;  1NKE A;  2DTU A;  4B9T A;  1S5J A;  4AHS A;  2XY6 A;  1B92 A;  4B3O A;  4C8M A;  4E0D A;  1QQC A;  1CZ9 A;  2P5O A;  1WSJ A;  4W5T A;  3AVL A;  3OVN A;  1TKD A;  2HNY A;  2DY4 A;  1UA0 A;  3KK3 A;  4KHY A;  3RR8 A;  2OPS A;  5KGW A;  3OYD A;  4KHQ A;  4OLB A;  2P1J A;  4Y1D A;  4CJV A;  4DSF A;  1J5O A;  1C1C A;  1JXE A;  1LV5 A;  5KRS A;  1HNI A;  4CGG A;  4HUG A;  4OPJ A;  5J2Q A;  3TAR A;  4B9M A;  4PUO A;  4KHU A;  3ZT2 A;  3DI6 A;  1YTU A;  4N41 A;  4BE2 A;  3FFI A;  3IS9 A;  3OYN A;  4CIG A;  4DTJ A;  4CFD A;  1RT5 A;  3U3Y A;  2GV9 A;  5FDL A;  1IH7 A;  3OS2 A;  3OYL A;  3OYJ A;  4F3O A;  3T19 A;  1QTM A;  4FJ8 A;  4FM0 A;  1TK0 A;  5HRP A;  4QCL A;  3TAP A;  4M3W A;  2HB5 A;  3LAL A;  3RMB A;  4L8R B;  3DLB A;  4RG8 A;  4IG3 A;  3T1A A;  4Q5V A;  3VQ9 A;  3NH0 A;  3SV4 A;  1WSF A;  1C1B A;  4CHO A;  1S1X A;  1BGX T;  3OY9 A;  3RMC A;  1D8Y A;  3D45 A;  4BAC A;  3HPH A;  1IO2 A;  1MU2 A;  1O1W A;  4CJ4 A;  5J2P A;  4OGC A;  5SWM A;  1IG9 A;  3SCX A;  4C8N A;  3AO5 A;  3D0P A;  1CLQ A;  2OPR A;  4KI6 A;  2G8U A;  4FW1 A;  3QIP A;  3OYE A;  4B8A B;  3RR7 A;  4Z4I A;  3K5N A;  3NH1 A;  2X6N A;  4M3R A;  3L2U A;  4OKK A;  2F96 A;  1W0H A;  4H8K A;  4AHC A;  4DTO A;  2G8K A;  4B08 A;  4FJ7 A;  3EYZ A;  4JLH A;  2DFE A;  4BE1 A;  2RF2 A;  3S3N A;  3DOK A;  1KSP A;  4FJI A;  1SL2 A;  1VSL A;  1ZBU A;  3LPU A;  1VSE A;  4N76 A;  4QOZ B;  1C0T A;  3U6F A;  2HHT A;  3M8S A;  3RMD A;  1J9A A;  1LWC A;  3AVN A;  3O3G A;  4IG0 A;  3KTQ A;  4FJX A;  1JLE A;  1ZBF A;  1TGO A;  1YT3 A;  3LZJ A;  4DMN A;  1ZBH A;  2QK9 A;  4M3X A;  1KVB A;  4ID1 A;  4CEA A;  4DS4 A;  4DTX A;  3C95 A;  3TWH A;  1CXU A;  4LSN A;  3KD1 E;  2D0A A;  3F9K A;  1U04 A;  4O55 A;  4CJE A;  4BDZ A;  1WAJ A;  4Q0B A;  4KB0 A;  3DMJ A;  1IKW A;  3WNG A;  3C6U A;  3NDK A;  2BE2 A;  4JRQ A;  4EP4 A;  4IKF A;  3KK2 A;  3OJU A;  4CEF A;  4DLG A;  1RT2 A;  3SQ0 A;  4F4K A;  4KHN A;  3DM2 A;  3SUN A;  1XHX A;  1TL1 A;  1TV6 A;  4CJ3 A;  3MED A;  4K8Z A;  1U48 A;  1EET A;  3PX4 A;  4I2Q A;  4FJ9 A;  1TK5 A;  3V9U A;  3QLH A;  1RBV A;  4E89 A;  2WOM A;  4K8X A;  1DLO A;  3S3O A;  4CCH A;  1KRP A;  2AJQ A;  1ZYQ A;  4WE1 A;  3SI6 A;  3VQ5 A;  3HO1 A;  3ZSV A;  4BE0 A;  2DFF A;  3OYK A;  4FZX C;  4M3Z A;  1B9D A;  1RT7 A;  4LH4 A;  1SV5 A;  4YFU A;  3OYH A;  3LZI A;  4HHT A;  4W5N A;  4OKJ A;  3VQQ A;  1RTI A;  1JLB A;  4OVL A;  3O3H A;  4C8K A;  4E1M A;  1A5X A;  1KLM A;  1TAQ A;  4ICL A;  4CJW A;  3ASM A;  1REV A;  2E4L A;  1HQU A;  3S3M A;  1G15 A;  4RW8 A;  2PYL A;  1FKP A;  2GBZ A;  4H4M A;  4CGI A;  4CK1 A;  1QSY A;  4JRP A;  5EU7 A;  3AA2 A;  4KTW A;  4DTR A;  4DFM A;  1Q8I A;  3ZSR A;  4OKE A;  3IAY A;  3CQ8 A;  4FJK A;  1UWB A;  1U49 A;  3M8R A;  3DLK A;  3QEW A;  2EHG A;  2RPI A;  1WSH A;  2OPQ A;  2QKK A;  4B9U A;  1X9M A;  4HCB A;  1JXB A;  4DF4 A;  4W5Q A;  2LSN A;  5CZ1 A;  3T3F A;  4I7F A;  3V4I A;  3SPZ A;  1VRT A;  4FLV A;  3CFO A;  5KI6 A;  4DFP A;  4EZ9 A;  1KVA A;  3AVH A;  2X78 A;  4O0I A;  3VN5 A;  4RW4 A;  3RRH A;  3V81 A;  1SL0 A;  1DTQ A;  4CEQ A;  4DLE A;  4DSJ A;  4EZ6 A;  1RTJ A;  2OZS A;  2FBT A;  1RBT A;  4FK2 A;  5DMR A;  5KTQ A;  1BQN A;  4KV8 A;  4FYD A;  1W9H A;  3ZSW A;  1VSI A;  3PX0 A;  1J54 A;  2Z1H A;  3P83 D;  1KFS A;  1L3S A;  3DRR A;  3VQE A;  1C6V A;  4LD0 A;  1NK6 A;  1VK0 A;  4KKO A;  5FRM A;  2D5R A;  3ZSX A;  4AHU A;  1HYV A;  1RT3 A;  4PA1 A;  3PX6 A;  4J2B A;  4FJL A;  1S1W A;  1YVU A;  3PO5 A;  1I3A A;  4FLT A;  1NJZ A;  4DWI A;  4ELT A;  1KLN A;  2BAN A;  1NK9 A;  1ASW A;  3HT3 A;  4FLW A;  4YNQ A;  4PQU A;  3KLH A;  4CF1 A;  3VQA A;  2VG7 A;  3NF6 A;  3QEP A;  4IFY A;  5KRT A;  4B9S A;  2YKN A;  1GOB A;  4DTU A;  1VSH A;  5HRO A;  4M42 A;  2X6S A;  1QSS A;  3KLG A;  1VSF A;  3LP3 A;  1RDD A;  4OLA A;  1HYS A;  5HRN A;  2ZD1 A;  3AVA A;  3MXM A;  3V1Q A;  4CEO A;  4I9Q A;  3SQ1 A;  2HVI A;  2G8I A;  4CHZ A;  3NF7 A;  4R5P A;  4FM1 A;  3AVJ A;  4HTU A;  4E1N A;  3MEC A;  4CF2 A;  1IKV A;  3SUQ A;  4FZY A;  1JLF A;  4CEE A;  5FRN A;  4TSX A;  1KVC A;  4DF8 A;  3K59 A;  4FJM A;  4LH5 A;  4PY5 A;  3V1R A;  5CYM A;  3THV A;  4CHN A;  4FJ5 A;  1EX4 A;  2ZE2 A;  2QXF A;  3QET A;  3TI0 A;  3K57 A;  4Z0U A;  3IRX A;  2XY7 A;  1C0M A;  3HYF A;  4E7I A;  1BI4 B;  5C42 A;  3K5M A;  2KZZ A;  1X9S A;  3MXJ A;  1T7P A;  3NF9 A;  4ID5 A;  2FBV A;  2QKB A;  4ZTF A;  4NCA A;  1HPZ A;  3DRS A;  3TAB A;  4NCG A;  4PWD A;  4UQG A;  4I9L A;  1C1A A;  4CJU A;  4DG1 A;  3HP6 A;  1NK0 A;  1SKW A;  4DQI A;  3L2V A;  4DSK A;  4CGH A;  4DQS A;  5J2N A;  3K2P A;  4HVJ A;  5J1E A;  3TAG A;  1KFD A;  4NYN A;  1JLQ A;  2Z1G A;  1NJY A;  2D0C A;  3OS0 A;  3HJF A;  1VSD A;  5SZT A;  4KFB A;  4LY7 A;  4BDP A;  4IFV A;  1WNS A;  1RTD A;  3M8P A;  4FXD A;  2Q3S A;  4W5O A;  3DLE A;  3HPO A;  4KAZ A;  3UIQ A;  3KKS A;  2KFZ A;  3RWU A;  2XRI A;  3G0Z A;  1Q9Y A;  1Y97 A;  1WN7 A;  4MFB A;  5CY4 A;  3HPG A;  1HMV A;  1F21 A;  1RT4 A;  3AVG A;  3M8Q A;  1QHT A;  3TR8 A;  1YTA A;  4OGE A;  3WNH A;  3LDS A;  3CFP A;  2PZS A;  3CG7 A;  1J53 A;  4FK0 A;  3VQC A;  4FCY A;  4DQP A;  2RKI A;  1S9G A;  5E41 A;  4F2R A;  3NGZ A;  3L2R A;  4J2D A;  4JS5 A;  3KK1 A;  4CGD A;  4FZZ A;  1JL1 A;  3NE6 A;  1LW2 A;  4DSL A;  3VA0 A;  4ELV A;  3OYA A;  5D3G A;  3NH2 A;  3QER A;  4M3Y A;  2I5J A;  3OYG A;  4DS5 A;  2PYJ A;  4O44 A;  3ZSQ A;  4AHT A;  1SL1 A;  1BIZ A;  3SNN A;  1NK4 A;  3OYM A;  3OYF A;  3ALY A;  2IOC A;  4FJH A;  4DFK A;  4NYF A;  4Z4H A;  1JLA A;  4M3T A;  3AV9 A;  4CEC A;  1HJR A;  1HYZ A;  1TKZ A;  5HBM A;  3ZT1 A;  4CJP A;  2HHX A;  3NBP A;  5JS1 A;  1QS4 A;  3CM5 A;  3L3V A;  1VSK A;  1JLG A;  4Z4F A;  4DTS A;  1FK9 A;  2VWJ A;  3TAE A;  2XY8 A;  1L3U A;  4B9V A;  4KHS A;  4CF0 A;  4FW2 A;  1D9D A;  1SKR A;  3SZ2 A;  3DLH A;  1RNH A;  1SKS A;  4E7K A;  2G8H A;  3CFR A;  3NFA A;  1LAV A;  5I3U A;  1XI1 A;  4M3U A;  2BGG A;  1RBU A;  3CM6 A;  2IC3 A;  2X74 A;  4N56 A;  3V9Z A;  2OA8 A;  5KGX A;  2VWK A;  3EZ5 A;  4DTP A;  3V6D A;  3P5J A;  5HRR A;  1S9E A;  3HVT A;  3NHG A;  2HNZ A;  1FKO A;  4CIF A;  1HNV A;  3I8D A;  1D5A A;  3AVC A;  3AVF A;  4RW7 A;  2XHB A;  2Z1I A;  3LAK A;  4FLX A;  3MEE A;  1VSM A;  1RCH A;  1JKH A;  4DSE A;  1VSJ A;  1S1T A;  4W5R A;  3OJS A;  4HUF A;  1A5W A;  3LP1 A;  4QAG A;  4BWJ A;  4DTM A;  4CF9 A;  3VQ6 A;  3DOL A;  4CFA A;  3JSM A;  2HW3 A;  4F3T A;  3F73 A;  1T05 A;  2DFH A;  3AA3 A;  1BIS A;  3ZT3 A;  4E7H A;  1NK7 A;  2G8V A;  4BDY A;  3SQ2 A;  1XHZ A;  3G10 A;  1A5V A;  3NF8 A;  5C24 A;  1BCO A;  4E3S A;  3QIO A;  3NCI A;  4HCC A;  1HQE A;  3ZT0 A;  2YNI A;  2YKM A;  3OYB A;  3L3U A;  1N6Q A;  1WSG A;  3LP2 A;  1RIL A;  3KKR A;  3A2F A;  2R7Y A;  1CXQ A;  4KTQ A;  3V9S A;  1RBR A;  4CK3 A;  3VQP A;  1IKY A;  3LAM A;  2A1S A;  2ITG A;  1L3T A;  2WON A;  3QEI A;  3I0S A;  2FC0 A;  4O5B A;  2KQ2 A;  2G8F A;  2A1R A;  4KRE A;  4CJF A;  5HLF A;  3C94 A;  2EX3 A;  2XO7 A;  1TVR A;  1IKX A;  3AVI A;  5CZ2 A;  1KCF A;  4IDK A;  4B9L A;  1GOA A;  3QO9 A;  1WLJ A;  4B8C A;  1RDC A;  3L8B A;  3LAN A;  3L2Q A;  1NK8 A;  4CF8 A;  2G8W A;  5C25 A;  2VG5 A;  4JS4 A;  4CIE A;  3AA4 A;  1X1P A;  1TKX A;  3V9W A;  3LP0 A;  1BI4 A;  3AO3 A;  4MQ3 A;  3TAN A;  1LW0 A;  5T7B A;  3QEX A;  4F8R A;  2RN2 A;  5JS2 A;  3RTV A;  2GUI A;  1S6P A;  4CHY A;  1LWF A;  2IGI A;  2YNH A;  3MEG A;  4BWM A;  4GMJ B;  3RMA A;  1B9F A;  4KRF A;  1GOC A;  3HST B;  3TAF A;  2B4J A;  1WAF A;  4GW6 A;  4KHW A;  1T8E A;  4CEB A;  1K6Y A;  3WNE A;  4NCB A;  4O0J A;  1TL3 A;  4I2P A;  3HL8 A;  3VQ7 A;  2YHA A;  2HHU A;  5K14 A;  4CFC A;  3KLF A;  1UAX A;  1RDB A;  4DQQ A;  1ZBL A;  2YV0 X;  4CJS A;  1UA1 A;  3PY8 A;  2KZM A;  4ZHR A;  3NGI A;  4IBN A;  4CJR A;  2FBX A;  4CGJ A;  4XIU A;  1ZBI A;  4Z4G A;  4H4O A;  3K5O A;  4CER A;  2O4G A;  1EKE A;  2YNF A;  3LWL A;  2HHS A;  3LWM A;  3S9H A;  1RTH A;  3SUO A;  3OYI A;  1LAW A;  4G1Q A;  4OJR A;  3DLG A;  4CED A;  4KB1 A;  4FJN A;  3OYC A;  2HHW A;  1ASV A;  1ITG A;  3SYZ A;  3KLE A;  1BIU A;  4CHQ A;  3MXI A;  1HRH A;  2JLE A;  2F8S A;  3PV8 A;  3V9X A;  1D9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...