3AO5A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
135
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/transferase inhibitor
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 49
structure length 135
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao5A00
3PO5A 4KI4A 1TV6A 4AHUA 3O3GA 1HQEA 2WOMA 3EY1A 2Y1IA 4B9TA 1S1WA 3RTVA 2P5OA 2JGUA 5DK5A 3AVHA 4KHQA 1VSEA 3SNNA 2PYJA 4FLYA 1DLOA 3OYBA 4DFKA 4CJKA 4DFJA 3OYKA 1RDAA 3QEIA 2BANA 1KVCA 1WSHA 4DTJA 3V81A 2KTQA 4CEZA 1X1PA 3KKSA 1S1XA 4LH4A 3HM9A 3CFOA 4CE9A 3I8DA 1VK0A 1EKEA 1XWLA 3LP1A 3LZIA 3VA3A 1J9AA 4CIEA 3LAKA 4EZ6A 4BACA 4CFCA 2DY4A 2HHXA 2XHBA 3VQAA 1WAFA 1A5VA 3LZJA 3V9ZA 2OYQA 4ELTA 4KB0A 1WNSA 2KW4A 5HRNA 4NCGA 1HYVA 4BE2A 2P1JA 3IRXA 5CY4A 3K57A 4FZZA 4DQQA 1LV5A 4F3OA 4M3UA 4RW6A 1J53A 1YT3A 2YKNA 3L3UA 4BWMA 4DMNA 3QNOA 4XIUA 3FFIA 1L3SA 2BE2A 3KKRA 4Z0UA 2D0CA 1YTAA 2HNDA 4Q5VA 3SV3A 3SJJA 3KTQA 1BI4B 3SUPA 4OKEA 3NHGA 2YNFA 3O4QA 2QKKA 1WN7A 2Z1JA 3NGZA 1TAUA 4O5BA 3RR7A 3O3HA 3LALA 4CGIA 2G8FA 2DFFA 3LAMA 5J2NA 4PY5A 1TVRA 2D0BA 1IKXA 3EYZA 4DSLA 4FJ9A 1L3UA 1KSPA 2F8SA 4JRPA 1HQUA 4FLUA 3L8BA 4ID1A 3OS0A 5E41A 4F8RA 1JLEA 1D5AA 4CJEA 2YNIA 1VSLA 1KVAA 1EXQA 1W0HA 2A1SA 3AVGA 1S6PA 2ZD1A 2FBTA 3LP3A 4CFAA 3AO3A 1RT5A 4AHTA 4HUFA 4I2PA 2DFEA 3PY8A 3L2QA 4E89A 1C0MA 1XC9A 1KCFA 2XRIA 1U45A 2YHBA 4DU1A 1RT3A 1CZ9A 3M8RA 2VWJA 3QO9A 3ZT1A 3LDSA 3LANA 1VSHA 1JLQA 3AO4A 4CGDA 3C95A 4CJFA 4HCCA 1RT1A 1VRUA 1J5OA 3E01A 3NDKA 1NK6A 1KLNA 3RR8A 4Z4EA 3DM2A 4W5RA 5J2MA 1HRHA 2NUBA 3NF7A 5HP1A 3ZSRA 1N6QA 4C8OA 4CK3A 2O4IA 3HVRA 4CJRA 3LWLA 3AO2A 3AVCA 2HNYA 4E1NA 4FJKA 1VRTA 4CERA 3DMJA 2HMIA 2HW3A 1VSDA 2RN2A 3T3FA 1WSIA 4FJ5A 4N41A 2KFNA 3M8QA 2G8VA 4GMJB 1RTHA 4CFDA 4CHYA 3SQ0A 1NK9A 3SCXA 4DS5A 3QESA 4EZ9A 4KREA 2LSNA 3C94A 4C8LA 4CEOA 3AVJA 3HYFA 4M45A 3SQ2A 1D9DA 2HHSA 3OYFA 1TKTA 2HVIA 5SZTA 3G10A 1IKVA 2G8HA 3P5JA 1T8EA 4FLWA 3PO4A 2A1RA 4CGFA 3D0PA 3V1OA 3VQQA 1SL1A 3K5MA 1IKYA 4ID5A 3SUQA 4CJSA 3V4IA 5K14A 1WLJA 3K2PA 3L2UA 2FBVA 4E19A 1A5XA 3AA2A 4AHSA 5HRPA 4FYDA 3OYNA 4C8NA 3V1RA 4CEFA 1U04A 1HMVA 3KLHA 4KHUA 1HNIA 3VQ7A 2W42A 5JS1A 4AHRA 4KKOA 3HVTA 3HT3A 3JSMA 4DQPA 4ELUA 3RMCA 3TARA 3S3NA 4LSNA 5HRRA 3OVNA 4Q0BA 4CEDA 2GUIA 3HPGA 2B5JA 4B08A 4IKFA 4LD0A 1WSJA 2IOCA 1JLAA 4B8AB 3DLBA 1KFSA 4KPYA 1RDBA 4FJ8A 1QTMA 3G0ZA 4DTOA 3U6FA 3DOLA 3SPYA 1K6YA 4PQUA 2HNZA 2AJQA 3ZT2A 2FC0A 4CHOA 3V9WA 3L2WA 4H8KA 3NH1A 3AA5X 4KTWA 1EETA 1RT7A 1GOBA 4HTUA 1RT6A 1C6VA 2YNHA 4JLHA 4OPJA 4UQGA 1BQNA 4CJ5A 2XY5A 2PZSA 5FRMA 1JLGA 5HBMA 2OPPA 1BCOA 2G8KA 1TL3A 1RT4A 1W9HA 1DTQA 4CEAA 1X9WA 4O0JA 1NKEA 1KTQA 4IG0A 1GOAA 3S3MA 1NKCA 1IO2A 1LWFA 1RBUA 4KO0A 3VQ5A 4N5SA 1RBRA 4F4KA 3AO1A 3KLFA 4NYNA 2DTUA 1Q8IA 4FLZA 4CGGA 3DYAA 4IFVA 4OJRA 3P83D 1RTJA 3SQ1A 4KHWA 3CM6A 4W5NA 1KFDA 3VN5A 4DTMA 3SUNA 2DFHA 4N47A 4BE1A 3ULDA 2ATQA 1KRPA 1X9SA 5KRSA 4DSIA 3AVLA 1C1AA 3VQ9A 3V9XA 3RMAA 3DRSA 1TAQA 2ITGA 4J2DA 1SKRA 3SQ4A 3S9HA 4DWIA 1NJZA 4L8RB 3OYEA 4CF0A 4FJMA 2ZQBA 2HVHA 3VA0A 5C24A 1Y97A 2XY7A 4W5OA 4FJIA 3QINA 2XY6A 4W5QA 4QAGA 1FKOA 1BQMA 1S1VA 4CEQA 1C1CA 3AV9A 1G15A 1UA1A 1YTUA 1SUQA 1LWCA 4CK2A 4F3TA 2BGGA 1HJRA 2XO7A 4DQSA 4O44A 4B8CA 5C25A 5FROA 4FXDA 3CG7A 4DU3A 3KK1A 1JLFA 4KTZA 2R7YA 1U49A 2B4JA 4HHTA 4DLGA 3DRRA 4CHPA 4OKJA 3CM5A 2G8UA 1RTIA 1CXUA 3NCIA 4KAZA 4CIFA 3PV8A 1CZBA 4DTNA 3NFAA 3IG1A 4IDKA 3P1GA 3VQPA 5J2QA 4FJNA 4N76A 1XHXA 3LP2A 4CGJA 3BGRA 4FLTA 1SL0A 3DLRA 1RDDA 4Y1CA 3WNHA 4YFUA 3SYZA 3PX4A 1BI4A 4DSFA 4M3XA 4FLXA 5HROA 4NCAA 3K5OA 2RF2A 1WSFA 4B9LA 4B9MA 1RILA 4AHVA 1JLCA 5KTQA 3QEXA 4NYFA 2RKIA 3K5LA 1CLQA 4R5PA 4K8XA 1I39A 3MXIA 2HHVA 1FXXA 2P51A 3MEGA 4E7LA 4E7IA 4OKKA 3VQEA 3WNFA 3RRHA 1BL3A 4CJVA 4RG8A 3AO5A 3KLIA 4HVJA 4O4GA 4BDYA 4DFMA 3LWMA 3NF9A 1SKWA 3AVKA 1FK9A 3HL8A 4MFBA 1VSIA 4DFPA 1X9MA 3F9KA 4DTPA 4BE0A 4E0DA 3AVBA 1ZYQA 1NJWA 2B6AA 3IS9A 1VSFA 2ETJA 1SKSA 1JXEA 2F8TA 1LW2A 2Q3SA 3L2RA 3JYTA 4CEBA 1BGXT 4E7HA 3TABA 1JL1A 3ZSWA 4DTXA 3NE6A 3TWHA 3S3OA 4KHSA 2GV9A 1C0UA 3V9SA 2G8WA 4AHCA 1BISA 3RRGA 1ASWA 3VQ8A 2E6LA 1QS4A 3A2FA 3WNGA 4M3TA 5D3GA 4KI6A 4M41A 4Z4GA 4FW2A 1IKWA 2Z1IA 3M8SA 3B6PA 3I0SA 1ASUA 4KV8A 3MEEA 4CJQA 4E7JA 4OGEA 2HHWA 1RCHA 4GW6A 1RDCA 4CJ4A 1D9FA 2JLEA 4CJPA 4DU4A 4J2BA 3K59A 5J1EA 3CQ8A 4JS4A 1TK0A 4FJLA 4Z4FA 3ISNC 4F2SA 4FK4A 3HK2A 1KLMA 4CJWA 1TL1A 2VG6A 3M8PA 3MXMA 4NCBA 5SWMA 3ZSYA 3ZSVA 4CEEA 3OJUA 3QERA 3PX0A 1TK8A 3NBPA 4M3WA 1D8YA 3T19A 3OYJA 3AVFA 4B9NA 2KZZA 2PY5A 2RPIA 5KGXA 4DLEA 3TAFA 4M3YA 3VQDA 3KD1E 1F21A 3ALYA 4OLAA 4HUGA 2OZSA 4FLVA 3QIPA 4JRQA 3HSTB 1ASVA 5CZ2A 1ITGA 1VSMA 4FJXA 3RWUA 5EU7A 3OYLA 3OYDA 1J54A 3KK3A 4PA1A 3ZSQA 3ZT3A 4PUOA 3EZ5A 3H08A 4KRFA 1TKZA 1QE1A 3HP6A 3IAYA 4ZTJA 3I0RA 1KVBA 4DTRA 3AVAA 5C42A 3NGYA 1VSKA 3T1AA 3SZ2A 2VG5A 3RMDA 2F96A 4CK1A 3DOKA 3SUOA 5HLFA 1S9GA 4CJTA 5I3UA 1XHZA 4M3ZA 4QCLA 3DRPA 2IDOA 3AVIA 1C1BA 3HPOA 4FCYA 3TI0A 1QSSA 2IAJA 4E1MA 2VG7A 4B9UA 2GBZA 2EHGA 4FVMA 2D0AA 4CF2A 3U3YA 3O3FA 1O1WA 1NK8A 2FBXA 2HB5A 4CGHA 3KIOA 1RT2A 3ZCMA 1NJXA 2OZMA 4ICLA 3OYMA 1IG9A 4E3SA 2KQ2A 2QKBA 1NK4A 2XY8A 1SV5A 3CFRA 3PX6A 3VQ6A 3OYAA 4J2AA 1JL2A 4O0IA 2YNGA 3U3GA 3TANA 3NF6A 3TAMA 3L3VA 4BDPA 4CHZA 4JS5A 4B9VA 4I9QA 4Z4CA 3D45A 4TSXA 4CIGA 1NJYA 4FZXC 3K58A 4FJ7A 1S1UA 1LWEA 3QEPA 1U4BA 1LW0A 3MXJA 4RW8A 3DLGA 4DQRA 2E6MA 3NGIA 4H4OA 4FM2A 4FK0A 3OJSA 1LAWA 4DF4A 5FDLA 1EX4A 4DSJA 4HUEA 2HHUA 1RTDA 3NF8A 1BHLA 1NK7A 1I3AA 2YHAA 3LPTA 4CHNA 4E7KA 4OLBA 4YNQA 1B92A 4IG3A 3KD5E 5CYQA 3O4NA 1UA0A 1Q9XA 2HHTA 1QSLA 2IGIA 1NK5A 3AVMA 4CJ3A 1B9DA 1HYZA 4RW9A 2I5JA 5JS2A 3SV4A 3RMBA 4Y1DA 5J2PA 3C6UA 1HPZA 4FJJA 1ZBUA 5CYMA 2QXFA 1XI1A 3MECA 3KJVA 4AILC 1ZBFA 3OS2A 4FM1A 4HCBA 3NAEA 4C8MA 4Z4HA 2IS3A 4O55A 1S5JA 3HPHA 1JKHA 3TR8A 4H4MA 4FM0A 3ASMA 3QIOA 2BDPA 1FKPA 1GOCA 1JXBA 4IFYA 4CESA 3QETA 2PYLA 4B3OA 3V9UA 4KFBA 3NH0A 4IBNA 1WSGA 4CF8A 3MEDA 2E4LA 4FJGA 4QOZB 1TGOA 2D5RA 1Q9YA 3L2VA 5I42A 4I9LA 1L3VA 4DF8A 1QQCA 5KRTA 1RNHA 2X6NA 3C6TA 1B9FA 4DSEA 3TAEA 3WNEA 2P5GA 1ZBHA 2OPRA 4N56A 3TAGA 4OPKA 5HRSA 1YVUA 1L5UA 4Z4IA 4PWDA 3HP9A 3K5NA 4WE1A 4M3RA 3QNNA 3AA4A 1JLBA 3DLKA 4BWJA 4CF9A 3SI6A 4ZHRA 1HNVA 3UIQA 4W5TA 1N5YA 4J2EA 4CF1A 3ZSZA 3CYMA 4AH9A 1L3TA 1U47A 1UOCA 2Z1HA 1EP4A 1A5WA 1U48A 2Z1GA 3VQBA 3KLGA 4BDZA 1VSJA 1R0AA 4ELVA 2KFZA 4CJLA 3THVA 3AVNA 3CFPA 2G8IA 1LAVA 1Z26A 2ZE2A 4MQ3A 4OGCA 3ZT0A 3HXMA 3MAQA 2X78A 5CZ1A 3TAQA 4LSLA 3BDPA 1UWBA 2O4GA 3NH2A 4LY7A 4RW4A 4KHNA 4OVLA 3ZT4A 3F73A 4C8KA 4I2QA 3V1QA 2OPQA 4EP5A 1BIUA 1C0TA 1TKXA 1BCMA 4EP4A 4ZTFA 2QK9A 3V6DA 1SL2A 1Z25A 3OYIA 2X74A 1CXQA 1RBVA 1BIZA 4G1QA 5T7BA 1REVA 1T7PA 1ZBIA 1NOYA 3VQ4A 4DQIA 4DSKA 1HYSA 4RW7A 4CFBA 1QSYA 3LP0A 1S6QA 4DS4A 2WONA 4FK2A 2OA8A 4M42A 1S1TA 4KHYA 1QHTA 3KLEA 4KB1A 1ZBLA 1T05A 3ZSXA 1T03A 1RBSA 4FJHA 3OS1A 1NKBA 2Y1JA 3OYHA 3HJFA 1UAXA 4CHQA 3VQCA 3OY9A 3OYGA 3DLHA 3QLHA 4DTSA 1NK0A 1WAJA 4FW1A 4K8ZA 3DI6A 2HHQA 2VWKA 2KZMA 1TKDA 3KK2A 1RBTA 4CCHA 4I7FA 4B9SA 3QEVA 2OPSA 3B6OA 5DMRA 4KTQA 1S9EA 3ITHA 3TAPA 1MU2A 1IH7A 2IC3A 5KGWA 4CECA 2EX3A 4CJUA 2FBYA 3OYCA 2YKMA 4DTUA 3PUFA 3ZSOA 2X6SA 5FRNA 3QEWA 3AA3A 1NOZA 1TK5A 4F2RA 4GVMA 4LH5A 3LPUA 1DTTA 5KI6A 3DLEA 1WSEA 4DG1A 4FZYA 2YV0X 3SPZA 3HO1A
chains in the Genus database with same CATH superfamily
3PO5A 1TV6A 4B9TA 1S1WA 4LF8K 2JGUA 1SZ2A 2PYJA 4FLYA 4DCHA 5FPNA 4DFJA 1RDAA 3FR0A 4DTJA 1Q18A 3ENOA 3HM9A 3D7EO 2ITMA 3VA3A 3ID6A 4EZ6A 5H1SQ 2HHXA 4A59A 3VQAA 2GWJA 1A5VA 4JHDB 2YCHA 4DQQA 1LV5A 3RSEB 4EHUA 4IOXA 1NGJA 4MLHA 2Q1NA 2HNDA 3SJJA 3KTQA 3SUPA 4OKEA 3KK7A 3NHGA 3O4QA 1H1VA 1WN7A 2RE2A 1SQKA 4PY5A 3WQTA 1IKXA 4DSLA 2F8SA 1X3NA 1OH6A 5E41A 4IEEA 1KVAA 2A1SA 2EWSA 4CFAA 4HUFA 3PY8A 3L2QA 2XRIA 4DU1A 4DR6K 3M8RA 3LDSA 1VSHA 1JLQA 3GG4A 3AO4A 3P39A 3QB0A 4HCCA 1BOTO 4FL9A 1RT1A 1EO1A 3T7ZA 4JI0K 3E01A 4H5TA 3NDKA 1KLNA 3DM2A 3J7ZO 4CK3A 2E5LK 4LFBK 3AO2A 5AQLA 3AVCA 3FZFA 3TSQA 1RGIA 4FJKA 1RDUA 5A2QO 4CZFA 1NGFA 3TTCA 4N41A 2KFNA 3M8QA 1I94K 1RTHA 4CHYA 1T6DA 2O8EA 3SCXA 4DS5A 2P9UB 3HYFA 1TKTA 1KXPA 5AQKA 2HVIA 2V7ZA 3P5JA 1T8EA 2QWQA 3VTHA 3SAFA 2HBLA 2GEMA 2WC9A 5CR4A 3V1OA 3K5MA 4IXCA 4YOUA 3V4IA 4JI1K 4K0KK 2FBVA 2NRVA 4CEFA 3ZX0A 1OH7A 3ZEUA 4AHRA 4KKOA 3TARA 2P9LA 4LSNA 4BQLA 3ULEA 3G6EN 4CEDA 2GUIA 2B5JA 3P4IA 4R79A 3DLBA 1KFSA 4KPYA 1RDBA 4FJ8A 1QTMA 4B3MK 2E1YA 3CPEA 4PHTX 1K6YA 3CD6N 2AJQA 3V9WA 2FC0A 1J6ZA 4RTFD 1GOBA 2E20A 4H5VA 4OPJA 1C6VA 2BUPA 2P9KB 2ZF5O 3D2FA 4CJ5A 2XY5A 5FRMA 1W9HA 2FSJA 3AAPA 4FWRA 1C0FA 3S3MA 1GOAA 1LWFA 3VQ5A 3KLFA 2UYTA 4NYNA 2DTUA 1Q8IA 4CGGA 4GNIA 2GX9A 4OJRA 3P83D 1RTJA 2W6LA 3VN5A 4DTMA 4BE1A 2ATQA 5C0YA 1X9SA 5KRSA 4JKGB 1HNXK 4JV5K 3VQ9A 3RMAA 1TAQA 4L8RB 1SAZA 4FJMA 2ZQBA 2HVHA 1Y97A 3QINA 3E9LA 1HKBA 3CETA 2E2QA 2UUAK 1GLJO 1C1CA 3CJ9A 1SUQA 1V4SA 2BGGA 4CI6A 1HJRA 2XO7A 1HNZK 1HLUA 4BC2A 3FE1A 4FWSA 5FROA 4FXDA 4JKBA 4JI7K 3K9JA 1U49A 2P9PA 4YOTA 5B8HA 4B3SK 3D2EB 1T44A 4CIFA 3C7NB 4BC5A 2IVPA 5E84A 4IDKA 5AQRA 5E26A 4N76A 4FLTA 1SL0A 3U9ZA 3JAMO 4DSFA 1BDGA 1K8AO 3MN9A 4FLXA 5DM7L 4B9LA 4YDUA 3H1QA 4AHVA 3QEXA 2RKIA 2HHVA 4WYBA 3W3DA 3WNFA 1BL3A 5KPTA 1KQSM 2V52B 5AQHA 4BVPA 4BG8A 2HBMA 4DTPA 1VQ6N 2B6AA 2F8TA 1SKSA 1JXEA 1JL1A 3ZSWA 4DTXA 2GV9A 1BISA 4JKHA 3A2FA 4M3TA 5D3GA 4KI6A 5GIPA 2A3ZA 3O80A 1IBMK 1VAZA 1RCHA 1RDCA 4CJ4A 1D9FA 4B1WB 5FPDA 5HL7L 3T1YK 3HK2A 4CJWA 4H0TB 3ZSYA 3PX0A 5AQWA 3THXA 1D8YA 1BA0A 3AVFA 3GOIA 2JWKA 5KGXA 4DLEA 3TAFA 2O8BA 4C1NI 3ALYA 3L4IA 2PFUA 1ASVA 4YOYA 1Q7YO 3RWUA 5EU7A 4GKJK 3OYDA 4DR3K 3ZSQA 4GV3A 4JD2B 4BRQA 4NLBA 1TKZA 1YXQA 4BRFA 3EEQA 4ZTJA 4CZGA 5C42A 3RMDA 1VSKA 3T1AA 3SUOA 3DOKA 4JKCA 4YDUC 4FCYA 3UE5A 2EHGA 1YAGA 2OZMA 2J4RA 3MWPA 4XEIA 5BPNA 4E3SA 1BO5O 2QKBA 1NK4A 2XY8A 3PX6A 3VQ6A 3OYAA 4J2AA 3TAMA 3L3VA 4CHZA 4JS5A 2HMPA 1NGBA 3LDPA 3D45A 4TSXA 2FSNA 2YHYA 4GY2B 3K58A 4FZXC 3CCMN 3QEPA 3LDNA 4ISEA 3DLGA 1LCUA 4FK0A 5FDLA 1RTDA 4GVEA 1NK7A 3LPTA 4YNQA 4AQYK 4IG3A 1X9JA 2UXDK 1YVNA 1Q9XA 3VF6A 3AVMA 1HYZA 2I5JA 3SV4A 5JLFA 3DLLL 4BROA 4AILC 3CHWA 1GLCG 3HPHA 3ASMA 2BDPA 1FKPA 1JXBA 4K25A 3DXMB 4IBNA 4DR2K 3BY5A 4XH4A 3L2VA 4I9LA 1Z05A 4OPAA 4DF8A 1QQCA 5KPZA 1L3VA 4DSEA 2P5GA 1YVUA 3CC7N 4PWDA 4FWMA 2GUPA 3VGMA 4BRPA 4ZHRA 2QWRA 3M5RA 3UIQA 4J2EA 2VQFK 4CF1A 4JEPA 1U47A 2YJFA 2Z1GA 1K73O 3O9RA 4CJLA 1ZXOA 2WBNA 3ZT0A 3HXMA 2X78A 3A5NC 4LY7A 3O4WA 4C8KA 4DV2K 4EP4A 2ZJRL 3H46O 1NGCA 4DV3K 2X74A 1RBVA 1BIZA 2FSKA 1REVA 3MN7A 3SBGA 1NOYA 3VQ4A 3H45C 4DSKA 1MA9B 2V51B 2WONA 4M42A 2QM1A 5JLHA 4K43A 1OVQA 3E9OA 4KB1A 1T03A 5ADXA 3CQYA 3VQCA 4DKWA 3OY9A 4MO5A 4DTSA 1ATNA 3AARA 3DI6A 2KZMA 2E8AA 4B9SA 5AQPA 4IFEA 5KGWA 1QQMA 3CCLN 2EX3A 2NRRA 5EOYA 4CJUA 3OYCA 5ADXH 4DTUA 4LFCK 3ZSOA 2X6SA 1NOZA 3QBWA 4F2RA 2NLXA 4GVMA 3LPUA 3O08A 1BG3A 5KI6A 4FZYA 1WSEA 2YV0X 3SPZA 3HO1A 1QVGM 3VEXA 3O3GA 4BRIA 3EY1A 1P8ZA 2Q97A 4DB3A 3SNNA 1YF5L 1DLOA 4X62K 4CJKA 2BANA 4LF6K 3C6AA 4O5FA 1W2BM 5EXWA 4X65K 3KKSA 1S1XA 3I8DA 3KWIA 3LP1A 3LZIA 4AM6A 5AR0A 4CZEA 1ILYA 5HRNA 1HYVA 3P31A 2FF6A 4FZZA 1VQLN 4M3UA 1TYQA 4JI5K 2YKNA 3FFIA 4V19S 2BE2A 4JI4K 4WFAL 2HOEA 3KKRA 4CZIA 1M90O 3L6QA 5KQDA 2QKKA 3NGZA 1TAUA 4O5BA 2G8FA 1TVRA 2D0BA 5AQJA 4FJ9A 5AZJA 4JRPA 3L8BA 3BP8A 1D5AA 3CQXA 4BRDA 2QW9A 3AVGA 2W40A 2Q0RA 4K41A 1RT5A 2DFEA 2D0OA 4CZJA 3DXKA 3CERA 4IOAL 4M7YA 4BG9A 2VWJA 3ZX3A 1NJIO 1VRUA 1NK6A 4W5RA 5LL6Z 3ZSRA 3A5OC 2NRWA 3H1VX 3O6WA 4A5AA 4CJRA 3HVRA 4DV1K 3THYA 3VF2A 4E1NA 1NU0A 2WUSA 4CERA 1NMDA 3DMJA 3GL1A 3FZLA 1VSDA 2RN2A 3T3FA 5BN9A 3ZYYX 4KREA 4JKAA 2LSNA 4WQ4A 3AVJA 5LY3A 5SZTA 4CD3A 4FLWA 4ILHA 2HBJA 2A1RA 4CGFA 3B8AX 3VQQA 1SL1A 1IKYA 3VESA 4ID5A 1Y64A 4F9OA 3SUQA 4CJSA 5K14A 1K8KA 3V1RA 4KHUA 1HNIA 2W42A 3HRGA 3WXLA 3S3NA 4Q0BA 3HPGA 2O8FB 2IOCA 4B8AB 5AQQA 4K42A 3G0ZA 3Q7BA 1ZC6A 4DTOA 3DOLA 2HNZA 1QZ6A 4BRAA 4EIAA 4FPAA 4CHOA 3L2WA 3VEOA 1WBBA 3AA5X 4KTWA 1EETA 1RT7A 4HTUA 4UQGA 1BQNA 1JLGA 2V7YA 4IWVA 5C2FA 3RVCA 5M1FA 2G8KA 1DTQA 3L4QA 1NKCA 4F4KA 4KO0A 3CMEN 4EAHD 3IFRA 4IFVA 4KHWA 4W5NA 3SUNA 1IBKK 2DFHA 3SAGA 4DSIA 4IZ9A 3AVLA 4JKDA 3DRSA 5AQZA 1OH5A 1Q81O 5BPMA 2XY7A 4WQ4C 4QAGA 4RWTA 2KLAA 1FKOA 4DR1K 4CEQA 3AV9A 1G15A 1UA1A 4CK2A 1SS6A 5AQSA 3UKUB 4LFAK 4CZKA 5BPLA 2R7YA 4KTZA 3QMLA 3PIPL 4DLGA 4OKJA 2G8UA 1KD1O 4H5RA 3PSFA 4JK8A 2E2PA 3LL3A 2QWLA 1U2VA 3NFAA 3VERA 3P1GA 1YJ9N 5J2QA 3LP2A 5LJWA 4YFUA 4M3XA 3PX4A 1BI4A 2NRXA 4JI8K 4BR0A 4NCAA 3K5LA 3OBYA 5GAEP 4H03B 3MXIA 4IO8A 4FO0A 4OKKA 3OBWA 3RRHA 2O8CB 4DUZK 3HL8A 4MFBA 1VSIA 1TUYA 3MCPA 4DFPA 1X9MA 4E0DA 1ZYQA 5AQGA 1VSFA 3QICA 1LW2A 3L2RA 5AQIA 4FWQA 1ASWA 3VQ8A 1T6CA 3VEWA 1GLAG 3O1BA 4JAXA 3TTFA 4FW2A 2P9IB 1ASUA 2A42A 3M3ZA 2A40A 3MEEA 2I7PA 4OGEA 4E7JA 1QHAA 2JLEA 4CJPA 3CQ8A 4JI6K 5J1EA 3HZ6A 1TK0A 5IT9O 4CD1A 5GAGP 1TL1A 2VG6A 3M8PA 5SWMA 3J8AA 2BH1A 4YOWA 1TK8A 3NBPA 2KZZA 3ID8A 1IV0A 3VQDA 5LMUK 1F21A 4HUGA 4FLVA 3E1YA 1IBLK 1VSMA 2NRZA 3OYLA 1J54A 3KK3A 3CCEN 4ISGA 3G4SN 3EZ5A 4KRFA 3C65A 3FLCO 4DTRA 1KVBA 5FPEA 4FJGA 2WFBA 3SZ2A 1K9MO 2A41A 3TSUA 4M3ZA 1S9GA 4CJTA 4BGAA 1NNEA 2IDOA 1QSSA 3TI0A 4E1MA 1VQ8N 3S41A 2VG7A 2GBZA 3CIPA 4IJAA 4CF2A 1QQNA 1NK8A 2FBXA 1VQMN 3KIOA 1RT2A 3ZCMA 4ICLA 3OYMA 2KQ2A 1XQSC 1JL2A 3U3GA 4XH5A 2ASMA 4FOIA 1ATRA 1HUXA 1KAZA 3A5LC 1NGGA 2ZM6K 1OVYA 3D6RA 2F4VK 1U4BA 4YY3K 5TKWA 3MXJA 4DQRA 1M1KO 2KKZA 4FM2A 3I33A 1Z6RA 1EX4A 2ZGZA 3NF8A 3UKRA 1T3VA 4E7KA 1QQOA 1B92A 3KD5E 1IJJA 2HHTA 1QVFM 4EHTA 1QSLA 1NK5A 4CJ3A 1B9DA 4BR5A 3O5BA 3RMBA 5J2PA 1HPZA 5CYMA 5IWAK 3WQUA 2FF3B 3ZX2A 4HCBA 4C8MA 4Z4HA 3C0BA 4IDHA 1W7AA 1JKHA 4FM0A 3JXUA 3QIOA 1Q82O 1GOCA 4KH5A 4KFBA 1ATSA 4DV6K 2E4LA 4QOZB 3VEVA 3WEEB 3TAEA 4M63C 2OPRA 3SAHA 3IUCA 4Z4IA 3HP9A 3K5NA 4BWJA 4CF9A 1ZBSA 2O8EB 1BA1A 4JN4A 4LF9K 4AH9A 1U48A 1EP4A 1A5WA 1FW6A 3VENA 4ELVA 3CF5L 5ELZA 4A61A 3THVA 1LAVA 5CZ1A 3TAQA 4LSLA 3LDLA 4I2QA 4BR4A 2QK9A 4ZTFA 1C0TA 5BN8A 3FZKA 1J5EK 5JVHL 2QTDA 1DGKN 3ZEUB 3OYIA 4G1QA 4DR7K 1TUUA 4BR2A 1ZBIA 2YHXA 2P9LB 4OPHA 3P38A 3ULEB 4CFBA 2E88A 3LP0A 1KC8O 4FK2A 2OA8A 1GLBG 1S1TA 3KLEA 4FJHA 3OS1A 4CHQA 5I9EB 3DLHA 1NK0A 1WAJA 4FW1A 4K8ZA 2VWKA 2YHWA 3KK2A 1RBTA 2OPSA 3B6OA 3D2FB 5DMRA 3TAPA 3CJCA 3Q7CA 1MU2A 3WXKA 4B1YB 4H5NA 3FFKB 4CVNE 2CGJA 4LH5A 3DLEA 3A8YA 4DG1A 3CMAN 2ASOA 1JLAA 3N4PA 5CHIA 2Y1IA 3AAQA 5AZIB 2OCEA 1N33K 5DK5A 4RCHA 5AJ3K 3VEYA 3OYBA 1KVCA 3VGLA 3V81A 1X1PA 4LH4A 3CFOA 1N34K 3PIOL 1EKEA 4CIEA 3LAKA 4BACA 1YHQN 3A0IX 2XHBA 4ELTA 4KB0A 1NGAA 5AQXA 3EZWA 4NCGA 2P1JA 5AQYA 1E4GT 3T1HK 1NG9A 1J53A 3LM9A 1YT3A 4DMNA 3QNOA 4XIUA 1L3SA 1XMQK 4PKHA 5JICA 1YTAA 3SV3A 4H0YB 3CPWM 3H6EA 2P9NA 2Q0UA 4DQ8A 2Z1JA 3O3HA 3LALA 2DFFA 3LAMA 3E66A 5J2NA 3EYZA 3LM2A 1HQUA 4FLUA 4ID1A 4YOVA 4IO9L 4BR7A 2QWNA 2YNIA 4CJEA 1EXQA 1W0HA 1S6PA 2FBTA 3LP3A 4E1JA 3AO3A 4AHTA 4BRHA 1C0MA 1XC9A 3BZCA 1U45A 2YHBA 5AQVA 4BC3A 1RT3A 2UUBK 1CZ9A 3QO9A 3ZT1A 2Q31A 3LANA 4CGDA 3C95A 4CJFA 2O8DB 3LDQA 3RR8A 3CCSN 1R59O 4YOXA 4Z4EA 5J2MA 1HRHA 4C8OA 1YI2N 1E3MA 1VHXA 3R3LA 2HNYA 4OO1J 1KAXA 3TSPA 2HMIA 3PLAA 1WSIA 2G8VA 4EZ9A 3SQ0A 1NK9A 5JVGL 3QESA 1NGHA 4CZMA 3C94A 4C8LA 2HHSA 4M45A 3SQ2A 3J7AP 2O8BB 3VOVA 3THWA 3PO4A 3ZETA 5AQUA 4PKIA 3FZMA 3AGKA 1VQ9N 2KHOA 3J80O 1WLJA 3L2UA 4E19A 3AA2A 4AHSA 5HRPA 4FYDA 4C8NA 1HMVA 3VQ7A 3SJHA 3VPZA 3RMCA 3MMVA 5HRRA 3U8XA 3OVNA 3H3OB 4U7BA 1KAYA 3WUHA 4DV7K 4IKFA 4LD0A 1WSJA 3CCJN 4GV6A 5M1PA 3U6FA 4I6MA 1EQYA 1P90A 5BR8K 4IJNA 1WUAA 4H8KA 2VQEK 4A57A 1XNQK 5AQNA 1NWKA 1RT6A 4FVUA 2OPPA 2UUCK 1BCOA 1JCFA 4JI2K 1RT4A 2AP1A 3ENHA 1X9WA 4FJ5A 4IG0A 5BRFA 1IO2A 3TPQA 1RBUA 4N5SA 1HKCA 3AO1A 3DYAA 2CGLA 4DV4K 3U9DA 3ULDA 3O9SA 4YORA 4J2DA 2ITGA 5BR9A 1SKRA 4LF7K 4DWIA 4CF0A 1V4TA 5F0XA 3VA0A 4BGBA 2NRTA 2I7NA 2FXUA 2IVNA 4KH4A 3T69A 4M7XA 1XMOK 4O8UA 3ENBA 4H0PA 4DQSA 3O9TA 5C25A 3ZLJA 4UY8O 4PKGA 4IOCL 2UXBK 4HHTA 3DRRA 4CHPA 4JHDA 1CXUA 2OTJN 4KAZA 4BRLA 3RSEA 3IG1A 3VQPA 1RFQA 4CGJA 3DLRA 1RDDA 1EWRA 4Y1CA 3SYZA 1GLDG 4CZHA 2RF2A 1WSFA 3UKUA 4B9MA 1RILA 4B9QA 5KTQA 3I55N 3MWTA 1CLQA 4R5PA 2QA4N 3NMUA 1FXXA 2P51A 3MEGA 4E7LA 4E7IA 3VQEA 4CJVA 4RG8A 3AO5A 4DFMA 3NF9A 1SKWA 3AVKA 1FK9A 3HTVA 3F9KA 4CW7B 4BE0A 4AF1A 2D1KA 3IS9A 3VGKA 3FGUA 1HX1A 2Q3SA 3JYTA 4CEBA 1BGXT 5AFUA 4BRMA 3NE6A 2G8WA 3I8BA 3CXCM 1NGIA 3WNGA 4M41A 4AM7A 5AQMA 3M8SA 3B6PA 4GV9A 1BUPA 3I0SA 4MO4A 3MN6A 4CJQA 2HHWA 3OHRA 4DU4A 3MDQA 3K59A 4Z4FA 3EKSA 5AQTA 3ISNC 1OKJA 4B3RK 1DKGD 4F2SA 4ISFA 5LMNK 4NCBA 3MXMA 4CEEA 1NGDA 2P9UA 3OJUA 2QI2A 3NVMA 4M3WA 3T19A 5M1KA 2PY5A 2RPIA 4FWNA 4PL7A 2ZGYA 4OLAA 2OZSA 3QIPA 4JRQA 3HSTB 3MN5A 5CZ2A 1ITGA 4FJXA 4WFNL 1XUPO 4PA1A 3ZT3A 4LC9B 3H08A 2NNWA 1QE1A 5FPMA 3NGYA 3AGRA 5HLFA 1XHZA 4QCLA 3DRPA 4QS8A 3N4QA 3HPOA 2IAJA 3BZKA 3EE9A 2D0AA 3O3FA 1O1WA 2HB5A 4CGHA 2HBKA 3E9PA 1NJXA 3JS6A 1IG9A 1SV5A 3CFRA 1TYQB 3TANA 4O0IA 4BDPA 4I9QA 4B9VA 1BWFO 2ZJQL 4H5WA 2H3GX 2P9KA 1NJYA 4FJ7A 4MLEA 2E2OA 5JMVA 1XNRK 5C15A 4RW8A 4ILJA 2E6MA 3NGIA 4DR4K 4H4OA 4BRCA 4DF4A 4DSJA 5AZJB 4HUEA 2W41A 1BHLA 1I3AA 2YHAA 4CHNA 4OLBA 3O4NA 1UA0A 3HI0A 3HM8A 4WQ5A 4NXNK 4JKGA 1MWKA 3O9QA 2P9SB 4FSVA 5JS2A 3DXKB 4Y1DA 3C6UA 2QXFA 1S72N 3CJ1A 3KJVA 3OS2A 3TU5A 3IDHA 1EWQA 2IS3A 1S5JA 4H4MA 4FOEA 4IFYA 3W0LA 3QETA 4CESA 4B3OA 3DJCA 3NH0A 1WSGA 4CF8A 3MEDA 1TGOA 2D5RA 1Q9YA 4G9ZA 3THYB 1B9FA 1ZBHA 2QWMA 4N56A 3EKUA 3LDOA 4OPKA 5HRSA 2E1ZA 1L5UA 3D2EA 3QNNA 4M3RA 3C7NA 4L3QA 1JLBA 4W5TA 3ZSZA 3CYMA 1L3TA 2Z1HA 3QDKA 3VQBA 3SBTA 5GADP 1VSJA 4BDZA 1R0AA 2KFZA 3ATVA 1ESVA 4ILGB 4OGCA 4BVOA 4MQ3A 5KQ8A 3MAQA 4KHPK 3BDPA 2GTDA 3NH2A 4KHNA 3F73A 3WEEA 3ZT4A 1K8KB 1X3MA 2OPQA 1BIUA 1TKXA 3V6DA 1SL2A 1Z25A 4BRNA 4DQIA 2YJEA 1VQPN 1HYSA 4DS4A 1S6QA 1S22A 3HBTA 1NBWA 3CJ7A 3WXJA 1YJWN 3A5MC 3ATUA 3ZSXA 4X66K 1NKBA 1UAXA 3CC2N 4WQ5C 3F9MA 4JI3K 3EE8A 1JCGA 2HHQA 1OH8A 4JK9A 3KZBA 4CCHA 3BF3A 3PSIA 4BRKA 1IH7A 4CECA 4LF5K 3GBTA 3U4LA 2YKMA 4FWPA 3PUFA 2AA4A 5FRNA 3VETA 3AA3A 1N36K 4I7FA 2Q2RA 1N8RO 1CZAN 4KI4A 2YI1A 4AHUA 1HQEA 1NMNA 2IVOA 2WOMA 3CI5A 4O8KA 2P5OA 3RTVA 3F2KA 4JD2A 3AVHA 4KHQA 1VSEA 3UB5A 4FWKA 4DFKA 3QEIA 2VCPA 3OYKA 1WSHA 5F2RA 2KTQA 4CEZA 2D0PA 4OX9K 2Q36A 3G71N 4CE9A 5GAHP 1VK0A 1XWLA 1J9AA 3G25A 4CFCA 2RHKA 5GINA 1GLLO 2DY4A 3HOSA 1WAFA 3LZJA 3V9ZA 2OYQA 1WNSA 2KW4A 2F7TA 5LJVA 3WXIA 2E2NA 2IIRA 4BE2A 5M1OA 3EO3A 3IRXA 5CY4A 3K57A 5AZIA 4F3OA 4RW6A 3L3UA 4BWMA 3KHYA 1IG8A 1U2VB 2CH5A 5M1QA 4Z0UA 2D0CA 2HF4A 2GWKA 4Q5VA 1BI4B 4NXMK 2YNFA 4DV0K 1D4XA 3RR7A 4CGIA 5F1XA 2ZJPL 1YIJN 2OTLN 1L3UA 5MLCQ 4DUYK 1KSPA 3EL2A 3OS0A 4F8RA 1JLEA 1VSLA 2ZD1A 1WBDA 3HSCA 4I2PA 2OANA 2CH6A 4E89A 1KCFA 5BRHA 1WOQA 3R1XA 4A2BA 4A62A 4C23A 2DPNA 1VQ4N 2VGNA 1WB9A 1J5OA 1GLFO 3DXMA 2NUBA 3NF7A 5HP1A 3IKMA 1N6QA 2O4IA 3LWLA 4DR5K 1DEJA 5C10A 4J8FA 1VRTA 3SMSA 2HW3A 5C2DA 4WF9L 1N32K 3O1WA 4GMJB 4CFDA 4H0OA 4HWIA 4CEOA 1D9DA 3OYFA 3G10A 1IKVA 2G8HA 4H0VB 2O8DA 3SMPA 4WCEL 3D0PA 3EN9A 4DHYA 3MX2A 3K2PA 1A5XA 3OA9A 3OYNA 1U04A 3KLHA 5JS1A 3HVTA 3R9PA 1E4FT 3CCRN 3HT3A 3JSMA 4DQPA 4ELUA 5AQOA 4B08A 4B3TK 4A2AA 4KH6A 3WXMB 5C12A 3SPYA 4PQUA 3QFUA 3ZT2A 3C6HA 3QFPA 3NH1A 3J81O 2YNHA 3SLCA 4JLHA 2PZSA 4CZLA 5HBMA 1TL3A 4CEAA 4O0JA 1NKEA 4CBWA 1RBRA 4MDBA 4FLZA 3I56N 1VQNN 3UKRB 3SQ1A 3CM6A 1KFDA 4KBOA 3J7YP 4N47A 4YHHK 1KRPA 5KPRA 1FJGK 1C1AA 2P9PB 3V9XA 2GELA 3SQ4A 3S9HA 1NJZA 3OYEA 5C24A 2ZWHA 4W5OA 4FJIA 2XY6A 4W5QA 1BQMA 1S1VA 1YTUA 1RDWX 1LWCA 4F3TA 1MWMA 3CJAA 5HOOA 3CC4N 2CGKA 4O44A 4B8CA 4LF4K 4JYAK 3CG7A 4DU3A 4HTLA 3KK1A 3F5TA 1JLFA 2B4JA 3MK6A 2VGMA 4B1ZA 3CM5A 1RTIA 3NCIA 4BREA 3H3NO 3PV8A 3O9UA 1CZBA 4DTNA 3CCUN 4JNEA 4FJNA 1XHXA 3BGRA 3WNHA 3VTIA 4BRGA 1JCEA 5HROA 5EY4A 3K5OA 3TTDA 1JLCA 4NYFA 3VEZA 3R8EA 4K8XA 1I39A 1LOTB 3KLIA 4HVJA 4O4GA 4BDYA 3NVKA 3LWMA 5M1NA 4A5BA 2HHHK 3AVBA 5CE3A 1NJWA 4CJ7A 2ETJA 4E7HA 5EX5A 3TABA 4CBXA 2QWOA 1HNWK 1YITN 3THXB 3S3OA 3TWHA 4KHSA 3V9SA 1C0UA 3DAWA 4AHCA 5BRDA 3RRGA 3GDQA 2E6LA 1QS4A 1O13A 4B1UB 3MCAB 4JKFA 1YUWA 2VYPA 1VQKN 4Z4GA 1IKWA 2Z1IA 4BR9A 4WFBL 1HR0K 4KV8A 4CBUA 3WT0A 4GW6A 4J2BA 1VQON 4JS4A 4FJLA 4FK4A 1KLMA 2QWPA 3ZSVA 3QERA 4PL8A 2F9TA 3OYJA 4QS7A 1YJNN 4B9NA 4M3YA 3KD1E 5AQFA 1C0GA 5BREA 1GLEG 4PUOA 1VQ7N 3HP6A 1XC3A 3IAYA 3FZHA 3I0RA 3AVAA 3HOTA 4C1NK 2VG5A 2F96A 1U6ZA 4CK1A 5I3UA 3AVIA 1C1BA 2UXCK 4B9UA 2O8FA 4FVMA 3OW2M 4BY9C 3L0QA 3U3YA 5GIOA 3CJBA 4MDAA 1NGEA 2D4WA 5EVZA 2YNGA 4GKKK 3KVGA 3NF6A 4QS9A 1HKGA 4Z4CA 2HSTA 4CIGA 4IEIA 1S3XA 1S1UA 2JWLA 4B1XB 2P9NB 1LWEA 4NO7A 1MDUB 1LW0A 4Z94A 3OTOK 4JK7A 5DM6L 3OJSA 1LAWA 5FLXO 1Q86O 2HHUA 1VQ5N 2VWBA 5CYQA 3R6MA 3DWLA 4H0XB 2IGIA 4RW9A 2PBDA 4DV5K 3BUZB 4FJJA 1ZBUA 1XI1A 3MECA 3VMFB 3M1FA 1ZBFA 4FM1A 2NZTA 3SK3A 4B1VA 3NAEA 4BC4A 4O55A 3TR8A 3GE1A 1W97L 3KWGA 3K0SA 1QZ5A 2PYLA 2BTFA 3V9UA 3AY9A 4FWOA 1JJ2M 2HF3A 4X64K 5I42A 5KRTA 1NM1A 1RNHA 2X6NA 3C6TA 3WNEA 2A5XA 2FLOA 2UU9K 3TAGA 2P9SA 2WTUA 4WE1A 3AA4A 3DLKA 3SI6A 1HNVA 1N5YA 4JKEA 3VF4A 1UOCA 3KLGA 1NLVA 3THWB 3AVNA 3K9KA 3M6GA 3ZETB 3CFPA 2G8IA 1Z26A 2ZE2A 3IMXA 3CCVN 1UWBA 2O4GA 4RW4A 3O8MA 4OVLA 4U67L 2O8CA 2YX6A 3V1QA 4EP5A 1BCMA 4BQZA 2A6AA 1CXQA 4XH1A 5T7BA 1T7PA 5AFUH 1BU6O 4RW7A 2W6KA 1QSYA 5TKYA 3BF1A 4FWLA 4KHYA 2QXLA 1QHTA 3QBXA 4EFHA 1ZBLA 1T05A 2QEXN 1RBSA 4I6MB 3OYHA 2Y1JA 3HJFA 2NRHA 3OYGA 3QLHA 2P9IA 1HPMA 4NB4A 3BEXA 2ASPA 1TKDA 1G99A 1HJOA 3QEVA 4FPBA 3CCQN 4KTQA 1S9EA 3ITHA 4Y0WA 2IC3A 4NLCA 2FBYA 2F9WA 3MX5A 3QEWA 1DT9A 1TK5A 2PAVA 1DTTA 1KTQA
chains in the Genus database with same CATH topology
3PO5A 4KI4A 1TV6A 4AHUA 3O3GA 1HQEA 2WOMA 3EY1A 2Y1IA 4B9TA 1S1WA 3RTVA 2P5OA 2JGUA 5DK5A 3AVHA 4KHQA 1VSEA 3SNNA 2PYJA 4FLYA 1DLOA 3OYBA 4DFKA 4CJKA 4DFJA 3OYKA 1RDAA 3QEIA 2BANA 1KVCA 1WSHA 4DTJA 3V81A 2KTQA 4CEZA 1X1PA 3KKSA 1S1XA 4LH4A 3HM9A 3CFOA 4CE9A 3I8DA 1VK0A 1EKEA 1XWLA 3LP1A 3LZIA 3VA3A 1J9AA 4CIEA 3LAKA 4EZ6A 4BACA 4CFCA 2DY4A 2HHXA 2XHBA 3VQAA 1WAFA 1A5VA 3LZJA 3V9ZA 2OYQA 4ELTA 4KB0A 1WNSA 2KW4A 5HRNA 4NCGA 1HYVA 4BE2A 2P1JA 3IRXA 5CY4A 3K57A 4FZZA 4DQQA 1LV5A 4F3OA 4M3UA 4RW6A 1J53A 1YT3A 2YKNA 3L3UA 4BWMA 4DMNA 3QNOA 4XIUA 3FFIA 1L3SA 2BE2A 3KKRA 4Z0UA 2D0CA 1YTAA 2HNDA 4Q5VA 3SV3A 3SJJA 3KTQA 1BI4B 3SUPA 4OKEA 3NHGA 2YNFA 3O4QA 2QKKA 1WN7A 2Z1JA 3NGZA 1TAUA 4O5BA 3RR7A 3O3HA 3LALA 4CGIA 2G8FA 2DFFA 3LAMA 5J2NA 4PY5A 1TVRA 2D0BA 1IKXA 3EYZA 4DSLA 4FJ9A 1L3UA 1KSPA 2F8SA 4JRPA 1HQUA 4FLUA 3L8BA 4ID1A 3OS0A 5E41A 4F8RA 1JLEA 1D5AA 4CJEA 2YNIA 1VSLA 1KVAA 1EXQA 1W0HA 2A1SA 3AVGA 1S6PA 2ZD1A 2FBTA 3LP3A 4CFAA 3AO3A 1RT5A 4AHTA 4HUFA 4I2PA 2DFEA 3PY8A 3L2QA 4E89A 1C0MA 1XC9A 1KCFA 2XRIA 1U45A 2YHBA 4DU1A 1RT3A 1CZ9A 3M8RA 2VWJA 3QO9A 3ZT1A 3LDSA 3LANA 1VSHA 1JLQA 3AO4A 4CGDA 3C95A 4CJFA 4HCCA 1RT1A 1VRUA 1J5OA 3E01A 3NDKA 1NK6A 1KLNA 3RR8A 4Z4EA 3DM2A 4W5RA 5J2MA 1HRHA 2NUBA 3NF7A 5HP1A 3ZSRA 1N6QA 4C8OA 4CK3A 2O4IA 3HVRA 4CJRA 3LWLA 3AO2A 3AVCA 2HNYA 4E1NA 4FJKA 1VRTA 4CERA 3DMJA 2HMIA 2HW3A 1VSDA 2RN2A 3T3FA 1WSIA 4FJ5A 4N41A 2KFNA 3M8QA 2G8VA 4GMJB 1RTHA 4CFDA 4CHYA 3SQ0A 1NK9A 3SCXA 4DS5A 3QESA 4EZ9A 4KREA 2LSNA 3C94A 4C8LA 4CEOA 3AVJA 3HYFA 4M45A 3SQ2A 1D9DA 2HHSA 3OYFA 1TKTA 2HVIA 5SZTA 3G10A 1IKVA 2G8HA 3P5JA 1T8EA 4FLWA 3PO4A 2A1RA 4CGFA 3D0PA 3V1OA 3VQQA 1SL1A 3K5MA 1IKYA 4ID5A 3SUQA 4CJSA 3V4IA 5K14A 1WLJA 3K2PA 3L2UA 2FBVA 4E19A 1A5XA 3AA2A 4AHSA 5HRPA 4FYDA 3OYNA 4C8NA 3V1RA 4CEFA 1U04A 1HMVA 3KLHA 4KHUA 1HNIA 3VQ7A 2W42A 5JS1A 4AHRA 4KKOA 3HVTA 3HT3A 3JSMA 4DQPA 4ELUA 3RMCA 3TARA 3S3NA 4LSNA 5HRRA 3OVNA 4Q0BA 4CEDA 2GUIA 3HPGA 2B5JA 4B08A 4IKFA 4LD0A 1WSJA 2IOCA 1JLAA 4B8AB 3DLBA 1KFSA 4KPYA 1RDBA 4FJ8A 1QTMA 3G0ZA 4DTOA 3U6FA 3DOLA 3SPYA 1K6YA 4PQUA 2HNZA 2AJQA 3ZT2A 2FC0A 4CHOA 3V9WA 3L2WA 4H8KA 3NH1A 3AA5X 4KTWA 1EETA 1RT7A 1GOBA 4HTUA 1RT6A 1C6VA 2YNHA 4JLHA 4OPJA 4UQGA 1BQNA 4CJ5A 2XY5A 2PZSA 5FRMA 1JLGA 5HBMA 2OPPA 1BCOA 2G8KA 1TL3A 1RT4A 1W9HA 1DTQA 4CEAA 1X9WA 4O0JA 1NKEA 1KTQA 4IG0A 1GOAA 3S3MA 1NKCA 1IO2A 1LWFA 1RBUA 4KO0A 3VQ5A 4N5SA 1RBRA 4F4KA 3AO1A 3KLFA 4NYNA 2DTUA 1Q8IA 4FLZA 4CGGA 3DYAA 4IFVA 4OJRA 3P83D 1RTJA 3SQ1A 4KHWA 3CM6A 4W5NA 1KFDA 3VN5A 4DTMA 3SUNA 2DFHA 4N47A 4BE1A 3ULDA 2ATQA 1KRPA 1X9SA 5KRSA 4DSIA 3AVLA 1C1AA 3VQ9A 3V9XA 3RMAA 3DRSA 1TAQA 2ITGA 4J2DA 1SKRA 3SQ4A 3S9HA 4DWIA 1NJZA 4L8RB 3OYEA 4CF0A 4FJMA 2ZQBA 2HVHA 3VA0A 5C24A 1Y97A 2XY7A 4W5OA 4FJIA 3QINA 2XY6A 4W5QA 4QAGA 1FKOA 1BQMA 1S1VA 4CEQA 1C1CA 3AV9A 1G15A 1UA1A 1YTUA 1SUQA 1LWCA 4CK2A 4F3TA 2BGGA 1HJRA 2XO7A 4DQSA 4O44A 4B8CA 5C25A 5FROA 4FXDA 3CG7A 4DU3A 3KK1A 1JLFA 4KTZA 2R7YA 1U49A 2B4JA 4HHTA 4DLGA 3DRRA 4CHPA 4OKJA 3CM5A 2G8UA 1RTIA 1CXUA 3NCIA 4KAZA 4CIFA 3PV8A 1CZBA 4DTNA 3NFAA 3IG1A 4IDKA 3P1GA 3VQPA 5J2QA 4FJNA 4N76A 1XHXA 3LP2A 4CGJA 3BGRA 4FLTA 1SL0A 3DLRA 1RDDA 4Y1CA 3WNHA 4YFUA 3SYZA 3PX4A 1BI4A 4DSFA 4M3XA 4FLXA 5HROA 4NCAA 3K5OA 2RF2A 1WSFA 4B9LA 4B9MA 1RILA 4AHVA 1JLCA 5KTQA 3QEXA 4NYFA 2RKIA 3K5LA 1CLQA 4R5PA 4K8XA 1I39A 3MXIA 2HHVA 1FXXA 2P51A 3MEGA 4E7LA 4E7IA 4OKKA 3VQEA 3WNFA 3RRHA 1BL3A 4CJVA 4RG8A 3AO5A 3KLIA 4HVJA 4O4GA 4BDYA 4DFMA 3LWMA 3NF9A 1SKWA 3AVKA 1FK9A 3HL8A 4MFBA 1VSIA 4DFPA 1X9MA 3F9KA 4DTPA 4BE0A 4E0DA 3AVBA 1ZYQA 1NJWA 2B6AA 3IS9A 1VSFA 2ETJA 1SKSA 1JXEA 2F8TA 1LW2A 2Q3SA 3L2RA 3JYTA 4CEBA 1BGXT 4E7HA 3TABA 1JL1A 3ZSWA 4DTXA 3NE6A 3TWHA 3S3OA 4KHSA 2GV9A 1C0UA 3V9SA 2G8WA 4AHCA 1BISA 3RRGA 1ASWA 3VQ8A 2E6LA 1QS4A 3A2FA 3WNGA 4M3TA 5D3GA 4KI6A 4M41A 4Z4GA 4FW2A 1IKWA 2Z1IA 3M8SA 3B6PA 3I0SA 1ASUA 4KV8A 3MEEA 4CJQA 4E7JA 4OGEA 2HHWA 1RCHA 4GW6A 1RDCA 4CJ4A 1D9FA 2JLEA 4CJPA 4DU4A 4J2BA 3K59A 5J1EA 3CQ8A 4JS4A 1TK0A 4FJLA 4Z4FA 3ISNC 4F2SA 4FK4A 3HK2A 1KLMA 4CJWA 1TL1A 2VG6A 3M8PA 3MXMA 4NCBA 5SWMA 3ZSYA 3ZSVA 4CEEA 3OJUA 3QERA 3PX0A 1TK8A 3NBPA 4M3WA 1D8YA 3T19A 3OYJA 3AVFA 4B9NA 2KZZA 2PY5A 2RPIA 5KGXA 4DLEA 3TAFA 4M3YA 3VQDA 3KD1E 1F21A 3ALYA 4OLAA 4HUGA 2OZSA 4FLVA 3QIPA 4JRQA 3HSTB 1ASVA 5CZ2A 1ITGA 1VSMA 4FJXA 3RWUA 5EU7A 3OYLA 3OYDA 1J54A 3KK3A 4PA1A 3ZSQA 3ZT3A 4PUOA 3EZ5A 3H08A 4KRFA 1TKZA 1QE1A 3HP6A 3IAYA 4ZTJA 3I0RA 1KVBA 4DTRA 3AVAA 5C42A 3NGYA 1VSKA 3T1AA 3SZ2A 2VG5A 3RMDA 2F96A 4CK1A 3DOKA 3SUOA 5HLFA 1S9GA 4CJTA 5I3UA 1XHZA 4M3ZA 4QCLA 3DRPA 2IDOA 3AVIA 1C1BA 3HPOA 4FCYA 3TI0A 1QSSA 2IAJA 4E1MA 2VG7A 4B9UA 2GBZA 2EHGA 4FVMA 2D0AA 4CF2A 3U3YA 3O3FA 1O1WA 1NK8A 2FBXA 2HB5A 4CGHA 3KIOA 1RT2A 3ZCMA 1NJXA 2OZMA 4ICLA 3OYMA 1IG9A 4E3SA 2KQ2A 2QKBA 1NK4A 2XY8A 1SV5A 3CFRA 3PX6A 3VQ6A 3OYAA 4J2AA 1JL2A 4O0IA 2YNGA 3U3GA 3TANA 3NF6A 3TAMA 3L3VA 4BDPA 4CHZA 4JS5A 4B9VA 4I9QA 4Z4CA 3D45A 4TSXA 4CIGA 1NJYA 4FZXC 3K58A 4FJ7A 1S1UA 1LWEA 3QEPA 1U4BA 1LW0A 3MXJA 4RW8A 3DLGA 4DQRA 2E6MA 3NGIA 4H4OA 4FM2A 4FK0A 3OJSA 1LAWA 4DF4A 5FDLA 1EX4A 4DSJA 4HUEA 2HHUA 1RTDA 3NF8A 1BHLA 1NK7A 1I3AA 2YHAA 3LPTA 4CHNA 4E7KA 4OLBA 4YNQA 1B92A 4IG3A 3KD5E 5CYQA 3O4NA 1UA0A 1Q9XA 2HHTA 1QSLA 2IGIA 1NK5A 3AVMA 4CJ3A 1B9DA 1HYZA 4RW9A 2I5JA 5JS2A 3SV4A 3RMBA 4Y1DA 5J2PA 3C6UA 1HPZA 4FJJA 1ZBUA 5CYMA 2QXFA 1XI1A 3MECA 3KJVA 4AILC 1ZBFA 3OS2A 4FM1A 4HCBA 3NAEA 4C8MA 4Z4HA 2IS3A 4O55A 1S5JA 3HPHA 1JKHA 3TR8A 4H4MA 4FM0A 3ASMA 3QIOA 2BDPA 1FKPA 1GOCA 1JXBA 4IFYA 4CESA 3QETA 2PYLA 4B3OA 3V9UA 4KFBA 3NH0A 4IBNA 1WSGA 4CF8A 3MEDA 2E4LA 4FJGA 4QOZB 1TGOA 2D5RA 1Q9YA 3L2VA 5I42A 4I9LA 1L3VA 4DF8A 1QQCA 5KRTA 1RNHA 2X6NA 3C6TA 1B9FA 4DSEA 3TAEA 3WNEA 2P5GA 1ZBHA 2OPRA 4N56A 3TAGA 4OPKA 5HRSA 1YVUA 1L5UA 4Z4IA 4PWDA 3HP9A 3K5NA 4WE1A 4M3RA 3QNNA 3AA4A 1JLBA 3DLKA 4BWJA 4CF9A 3SI6A 4ZHRA 1HNVA 3UIQA 4W5TA 1N5YA 4J2EA 4CF1A 3ZSZA 3CYMA 4AH9A 1L3TA 1U47A 1UOCA 2Z1HA 1EP4A 1A5WA 1U48A 2Z1GA 3VQBA 3KLGA 4BDZA 1VSJA 1R0AA 4ELVA 2KFZA 4CJLA 3THVA 3AVNA 3CFPA 2G8IA 1LAVA 1Z26A 2ZE2A 4MQ3A 4OGCA 3ZT0A 3HXMA 3MAQA 2X78A 5CZ1A 3TAQA 4LSLA 3BDPA 1UWBA 2O4GA 3NH2A 4LY7A 4RW4A 4KHNA 4OVLA 3ZT4A 3F73A 4C8KA 4I2QA 3V1QA 2OPQA 4EP5A 1BIUA 1C0TA 1TKXA 1BCMA 4EP4A 4ZTFA 2QK9A 3V6DA 1SL2A 1Z25A 3OYIA 2X74A 1CXQA 1RBVA 1BIZA 4G1QA 5T7BA 1REVA 1T7PA 1ZBIA 1NOYA 3VQ4A 4DQIA 4DSKA 1HYSA 4RW7A 4CFBA 1QSYA 3LP0A 1S6QA 4DS4A 2WONA 4FK2A 2OA8A 4M42A 1S1TA 4KHYA 1QHTA 3KLEA 4KB1A 1ZBLA 1T05A 3ZSXA 1T03A 1RBSA 4FJHA 3OS1A 1NKBA 2Y1JA 3OYHA 3HJFA 1UAXA 4CHQA 3VQCA 3OY9A 3OYGA 3DLHA 3QLHA 4DTSA 1NK0A 1WAJA 4FW1A 4K8ZA 3DI6A 2HHQA 2VWKA 2KZMA 1TKDA 3KK2A 1RBTA 4CCHA 4I7FA 4B9SA 3QEVA 2OPSA 3B6OA 5DMRA 4KTQA 1S9EA 3ITHA 3TAPA 1MU2A 1IH7A 2IC3A 5KGWA 4CECA 2EX3A 4CJUA 2FBYA 3OYCA 2YKMA 4DTUA 3PUFA 3ZSOA 2X6SA 5FRNA 3QEWA 3AA3A 1NOZA 1TK5A 4F2RA 4GVMA 4LH5A 3LPUA 1DTTA 5KI6A 3DLEA 1WSEA 4DG1A 4FZYA 2YV0X 3SPZA 3HO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO5 A;  4KI4 A;  1TV6 A;  4AHU A;  3O3G A;  1HQE A;  2WOM A;  3EY1 A;  2Y1I A;  4B9T A;  1S1W A;  3RTV A;  2P5O A;  2JGU A;  5DK5 A;  3AVH A;  4KHQ A;  1VSE A;  3SNN A;  2PYJ A;  4FLY A;  1DLO A;  3OYB A;  4DFK A;  4CJK A;  4DFJ A;  3OYK A;  1RDA A;  3QEI A;  2BAN A;  1KVC A;  1WSH A;  4DTJ A;  3V81 A;  2KTQ A;  4CEZ A;  1X1P A;  3KKS A;  1S1X A;  4LH4 A;  3HM9 A;  3CFO A;  4CE9 A;  3I8D A;  1VK0 A;  1EKE A;  1XWL A;  3LP1 A;  3LZI A;  3VA3 A;  1J9A A;  4CIE A;  3LAK A;  4EZ6 A;  4BAC A;  4CFC A;  2DY4 A;  2HHX A;  2XHB A;  3VQA A;  1WAF A;  1A5V A;  3LZJ A;  3V9Z A;  2OYQ A;  4ELT A;  4KB0 A;  1WNS A;  2KW4 A;  5HRN A;  4NCG A;  1HYV A;  4BE2 A;  2P1J A;  3IRX A;  5CY4 A;  3K57 A;  4FZZ A;  4DQQ A;  1LV5 A;  4F3O A;  4M3U A;  4RW6 A;  1J53 A;  1YT3 A;  2YKN A;  3L3U A;  4BWM A;  4DMN A;  3QNO A;  4XIU A;  3FFI A;  1L3S A;  2BE2 A;  3KKR A;  4Z0U A;  2D0C A;  1YTA A;  2HND A;  4Q5V A;  3SV3 A;  3SJJ A;  3KTQ A;  1BI4 B;  3SUP A;  4OKE A;  3NHG A;  2YNF A;  3O4Q A;  2QKK A;  1WN7 A;  2Z1J A;  3NGZ A;  1TAU A;  4O5B A;  3RR7 A;  3O3H A;  3LAL A;  4CGI A;  2G8F A;  2DFF A;  3LAM A;  5J2N A;  4PY5 A;  1TVR A;  2D0B A;  1IKX A;  3EYZ A;  4DSL A;  4FJ9 A;  1L3U A;  1KSP A;  2F8S A;  4JRP A;  1HQU A;  4FLU A;  3L8B A;  4ID1 A;  3OS0 A;  5E41 A;  4F8R A;  1JLE A;  1D5A A;  4CJE A;  2YNI A;  1VSL A;  1KVA A;  1EXQ A;  1W0H A;  2A1S A;  3AVG A;  1S6P A;  2ZD1 A;  2FBT A;  3LP3 A;  4CFA A;  3AO3 A;  1RT5 A;  4AHT A;  4HUF A;  4I2P A;  2DFE A;  3PY8 A;  3L2Q A;  4E89 A;  1C0M A;  1XC9 A;  1KCF A;  2XRI A;  1U45 A;  2YHB A;  4DU1 A;  1RT3 A;  1CZ9 A;  3M8R A;  2VWJ A;  3QO9 A;  3ZT1 A;  3LDS A;  3LAN A;  1VSH A;  1JLQ A;  3AO4 A;  4CGD A;  3C95 A;  4CJF A;  4HCC A;  1RT1 A;  1VRU A;  1J5O A;  3E01 A;  3NDK A;  1NK6 A;  1KLN A;  3RR8 A;  4Z4E A;  3DM2 A;  4W5R A;  5J2M A;  1HRH A;  2NUB A;  3NF7 A;  5HP1 A;  3ZSR A;  1N6Q A;  4C8O A;  4CK3 A;  2O4I A;  3HVR A;  4CJR A;  3LWL A;  3AO2 A;  3AVC A;  2HNY A;  4E1N A;  4FJK A;  1VRT A;  4CER A;  3DMJ A;  2HMI A;  2HW3 A;  1VSD A;  2RN2 A;  3T3F A;  1WSI A;  4FJ5 A;  4N41 A;  2KFN A;  3M8Q A;  2G8V A;  4GMJ B;  1RTH A;  4CFD A;  4CHY A;  3SQ0 A;  1NK9 A;  3SCX A;  4DS5 A;  3QES A;  4EZ9 A;  4KRE A;  2LSN A;  3C94 A;  4C8L A;  4CEO A;  3AVJ A;  3HYF A;  4M45 A;  3SQ2 A;  1D9D A;  2HHS A;  3OYF A;  1TKT A;  2HVI A;  5SZT A;  3G10 A;  1IKV A;  2G8H A;  3P5J A;  1T8E A;  4FLW A;  3PO4 A;  2A1R A;  4CGF A;  3D0P A;  3V1O A;  3VQQ A;  1SL1 A;  3K5M A;  1IKY A;  4ID5 A;  3SUQ A;  4CJS A;  3V4I A;  5K14 A;  1WLJ A;  3K2P A;  3L2U A;  2FBV A;  4E19 A;  1A5X A;  3AA2 A;  4AHS A;  5HRP A;  4FYD A;  3OYN A;  4C8N A;  3V1R A;  4CEF A;  1U04 A;  1HMV A;  3KLH A;  4KHU A;  1HNI A;  3VQ7 A;  2W42 A;  5JS1 A;  4AHR A;  4KKO A;  3HVT A;  3HT3 A;  3JSM A;  4DQP A;  4ELU A;  3RMC A;  3TAR A;  3S3N A;  4LSN A;  5HRR A;  3OVN A;  4Q0B A;  4CED A;  2GUI A;  3HPG A;  2B5J A;  4B08 A;  4IKF A;  4LD0 A;  1WSJ A;  2IOC A;  1JLA A;  4B8A B;  3DLB A;  1KFS A;  4KPY A;  1RDB A;  4FJ8 A;  1QTM A;  3G0Z A;  4DTO A;  3U6F A;  3DOL A;  3SPY A;  1K6Y A;  4PQU A;  2HNZ A;  2AJQ A;  3ZT2 A;  2FC0 A;  4CHO A;  3V9W A;  3L2W A;  4H8K A;  3NH1 A;  3AA5 X;  4KTW A;  1EET A;  1RT7 A;  1GOB A;  4HTU A;  1RT6 A;  1C6V A;  2YNH A;  4JLH A;  4OPJ A;  4UQG A;  1BQN A;  4CJ5 A;  2XY5 A;  2PZS A;  5FRM A;  1JLG A;  5HBM A;  2OPP A;  1BCO A;  2G8K A;  1TL3 A;  1RT4 A;  1W9H A;  1DTQ A;  4CEA A;  1X9W A;  4O0J A;  1NKE A;  1KTQ A;  4IG0 A;  1GOA A;  3S3M A;  1NKC A;  1IO2 A;  1LWF A;  1RBU A;  4KO0 A;  3VQ5 A;  4N5S A;  1RBR A;  4F4K A;  3AO1 A;  3KLF A;  4NYN A;  2DTU A;  1Q8I A;  4FLZ A;  4CGG A;  3DYA A;  4IFV A;  4OJR A;  3P83 D;  1RTJ A;  3SQ1 A;  4KHW A;  3CM6 A;  4W5N A;  1KFD A;  3VN5 A;  4DTM A;  3SUN A;  2DFH A;  4N47 A;  4BE1 A;  3ULD A;  2ATQ A;  1KRP A;  1X9S A;  5KRS A;  4DSI A;  3AVL A;  1C1A A;  3VQ9 A;  3V9X A;  3RMA A;  3DRS A;  1TAQ A;  2ITG A;  4J2D A;  1SKR A;  3SQ4 A;  3S9H A;  4DWI A;  1NJZ A;  4L8R B;  3OYE A;  4CF0 A;  4FJM A;  2ZQB A;  2HVH A;  3VA0 A;  5C24 A;  1Y97 A;  2XY7 A;  4W5O A;  4FJI A;  3QIN A;  2XY6 A;  4W5Q A;  4QAG A;  1FKO A;  1BQM A;  1S1V A;  4CEQ A;  1C1C A;  3AV9 A;  1G15 A;  1UA1 A;  1YTU A;  1SUQ A;  1LWC A;  4CK2 A;  4F3T A;  2BGG A;  1HJR A;  2XO7 A;  4DQS A;  4O44 A;  4B8C A;  5C25 A;  5FRO A;  4FXD A;  3CG7 A;  4DU3 A;  3KK1 A;  1JLF A;  4KTZ A;  2R7Y A;  1U49 A;  2B4J A;  4HHT A;  4DLG A;  3DRR A;  4CHP A;  4OKJ A;  3CM5 A;  2G8U A;  1RTI A;  1CXU A;  3NCI A;  4KAZ A;  4CIF A;  3PV8 A;  1CZB A;  4DTN A;  3NFA A;  3IG1 A;  4IDK A;  3P1G A;  3VQP A;  5J2Q A;  4FJN A;  4N76 A;  1XHX A;  3LP2 A;  4CGJ A;  3BGR A;  4FLT A;  1SL0 A;  3DLR A;  1RDD A;  4Y1C A;  3WNH A;  4YFU A;  3SYZ A;  3PX4 A;  1BI4 A;  4DSF A;  4M3X A;  4FLX A;  5HRO A;  4NCA A;  3K5O A;  2RF2 A;  1WSF A;  4B9L A;  4B9M A;  1RIL A;  4AHV A;  1JLC A;  5KTQ A;  3QEX A;  4NYF A;  2RKI A;  3K5L A;  1CLQ A;  4R5P A;  4K8X A;  1I39 A;  3MXI A;  2HHV A;  1FXX A;  2P51 A;  3MEG A;  4E7L A;  4E7I A;  4OKK A;  3VQE A;  3WNF A;  3RRH A;  1BL3 A;  4CJV A;  4RG8 A;  3AO5 A;  3KLI A;  4HVJ A;  4O4G A;  4BDY A;  4DFM A;  3LWM A;  3NF9 A;  1SKW A;  3AVK A;  1FK9 A;  3HL8 A;  4MFB A;  1VSI A;  4DFP A;  1X9M A;  3F9K A;  4DTP A;  4BE0 A;  4E0D A;  3AVB A;  1ZYQ A;  1NJW A;  2B6A A;  3IS9 A;  1VSF A;  2ETJ A;  1SKS A;  1JXE A;  2F8T A;  1LW2 A;  2Q3S A;  3L2R A;  3JYT A;  4CEB A;  1BGX T;  4E7H A;  3TAB A;  1JL1 A;  3ZSW A;  4DTX A;  3NE6 A;  3TWH A;  3S3O A;  4KHS A;  2GV9 A;  1C0U A;  3V9S A;  2G8W A;  4AHC A;  1BIS A;  3RRG A;  1ASW A;  3VQ8 A;  2E6L A;  1QS4 A;  3A2F A;  3WNG A;  4M3T A;  5D3G A;  4KI6 A;  4M41 A;  4Z4G A;  4FW2 A;  1IKW A;  2Z1I A;  3M8S A;  3B6P A;  3I0S A;  1ASU A;  4KV8 A;  3MEE A;  4CJQ A;  4E7J A;  4OGE A;  2HHW A;  1RCH A;  4GW6 A;  1RDC A;  4CJ4 A;  1D9F A;  2JLE A;  4CJP A;  4DU4 A;  4J2B A;  3K59 A;  5J1E A;  3CQ8 A;  4JS4 A;  1TK0 A;  4FJL A;  4Z4F A;  3ISN C;  4F2S A;  4FK4 A;  3HK2 A;  1KLM A;  4CJW A;  1TL1 A;  2VG6 A;  3M8P A;  3MXM A;  4NCB A;  5SWM A;  3ZSY A;  3ZSV A;  4CEE A;  3OJU A;  3QER A;  3PX0 A;  1TK8 A;  3NBP A;  4M3W A;  1D8Y A;  3T19 A;  3OYJ A;  3AVF A;  4B9N A;  2KZZ A;  2PY5 A;  2RPI A;  5KGX A;  4DLE A;  3TAF A;  4M3Y A;  3VQD A;  3KD1 E;  1F21 A;  3ALY A;  4OLA A;  4HUG A;  2OZS A;  4FLV A;  3QIP A;  4JRQ A;  3HST B;  1ASV A;  5CZ2 A;  1ITG A;  1VSM A;  4FJX A;  3RWU A;  5EU7 A;  3OYL A;  3OYD A;  1J54 A;  3KK3 A;  4PA1 A;  3ZSQ A;  3ZT3 A;  4PUO A;  3EZ5 A;  3H08 A;  4KRF A;  1TKZ A;  1QE1 A;  3HP6 A;  3IAY A;  4ZTJ A;  3I0R A;  1KVB A;  4DTR A;  3AVA A;  5C42 A;  3NGY A;  1VSK A;  3T1A A;  3SZ2 A;  2VG5 A;  3RMD A;  2F96 A;  4CK1 A;  3DOK A;  3SUO A;  5HLF A;  1S9G A;  4CJT A;  5I3U A;  1XHZ A;  4M3Z A;  4QCL A;  3DRP A;  2IDO A;  3AVI A;  1C1B A;  3HPO A;  4FCY A;  3TI0 A;  1QSS A;  2IAJ A;  4E1M A;  2VG7 A;  4B9U A;  2GBZ A;  2EHG A;  4FVM A;  2D0A A;  4CF2 A;  3U3Y A;  3O3F A;  1O1W A;  1NK8 A;  2FBX A;  2HB5 A;  4CGH A;  3KIO A;  1RT2 A;  3ZCM A;  1NJX A;  2OZM A;  4ICL A;  3OYM A;  1IG9 A;  4E3S A;  2KQ2 A;  2QKB A;  1NK4 A;  2XY8 A;  1SV5 A;  3CFR A;  3PX6 A;  3VQ6 A;  3OYA A;  4J2A A;  1JL2 A;  4O0I A;  2YNG A;  3U3G A;  3TAN A;  3NF6 A;  3TAM A;  3L3V A;  4BDP A;  4CHZ A;  4JS5 A;  4B9V A;  4I9Q A;  4Z4C A;  3D45 A;  4TSX A;  4CIG A;  1NJY A;  4FZX C;  3K58 A;  4FJ7 A;  1S1U A;  1LWE A;  3QEP A;  1U4B A;  1LW0 A;  3MXJ A;  4RW8 A;  3DLG A;  4DQR A;  2E6M A;  3NGI A;  4H4O A;  4FM2 A;  4FK0 A;  3OJS A;  1LAW A;  4DF4 A;  5FDL A;  1EX4 A;  4DSJ A;  4HUE A;  2HHU A;  1RTD A;  3NF8 A;  1BHL A;  1NK7 A;  1I3A A;  2YHA A;  3LPT A;  4CHN A;  4E7K A;  4OLB A;  4YNQ A;  1B92 A;  4IG3 A;  3KD5 E;  5CYQ A;  3O4N A;  1UA0 A;  1Q9X A;  2HHT A;  1QSL A;  2IGI A;  1NK5 A;  3AVM A;  4CJ3 A;  1B9D A;  1HYZ A;  4RW9 A;  2I5J A;  5JS2 A;  3SV4 A;  3RMB A;  4Y1D A;  5J2P A;  3C6U A;  1HPZ A;  4FJJ A;  1ZBU A;  5CYM A;  2QXF A;  1XI1 A;  3MEC A;  3KJV A;  4AIL C;  1ZBF A;  3OS2 A;  4FM1 A;  4HCB A;  3NAE A;  4C8M A;  4Z4H A;  2IS3 A;  4O55 A;  1S5J A;  3HPH A;  1JKH A;  3TR8 A;  4H4M A;  4FM0 A;  3ASM A;  3QIO A;  2BDP A;  1FKP A;  1GOC A;  1JXB A;  4IFY A;  4CES A;  3QET A;  2PYL A;  4B3O A;  3V9U A;  4KFB A;  3NH0 A;  4IBN A;  1WSG A;  4CF8 A;  3MED A;  2E4L A;  4FJG A;  4QOZ B;  1TGO A;  2D5R A;  1Q9Y A;  3L2V A;  5I42 A;  4I9L A;  1L3V A;  4DF8 A;  1QQC A;  5KRT A;  1RNH A;  2X6N A;  3C6T A;  1B9F A;  4DSE A;  3TAE A;  3WNE A;  2P5G A;  1ZBH A;  2OPR A;  4N56 A;  3TAG A;  4OPK A;  5HRS A;  1YVU A;  1L5U A;  4Z4I A;  4PWD A;  3HP9 A;  3K5N A;  4WE1 A;  4M3R A;  3QNN A;  3AA4 A;  1JLB A;  3DLK A;  4BWJ A;  4CF9 A;  3SI6 A;  4ZHR A;  1HNV A;  3UIQ A;  4W5T A;  1N5Y A;  4J2E A;  4CF1 A;  3ZSZ A;  3CYM A;  4AH9 A;  1L3T A;  1U47 A;  1UOC A;  2Z1H A;  1EP4 A;  1A5W A;  1U48 A;  2Z1G A;  3VQB A;  3KLG A;  4BDZ A;  1VSJ A;  1R0A A;  4ELV A;  2KFZ A;  4CJL A;  3THV A;  3AVN A;  3CFP A;  2G8I A;  1LAV A;  1Z26 A;  2ZE2 A;  4MQ3 A;  4OGC A;  3ZT0 A;  3HXM A;  3MAQ A;  2X78 A;  5CZ1 A;  3TAQ A;  4LSL A;  3BDP A;  1UWB A;  2O4G A;  3NH2 A;  4LY7 A;  4RW4 A;  4KHN A;  4OVL A;  3ZT4 A;  3F73 A;  4C8K A;  4I2Q A;  3V1Q A;  2OPQ A;  4EP5 A;  1BIU A;  1C0T A;  1TKX A;  1BCM A;  4EP4 A;  4ZTF A;  2QK9 A;  3V6D A;  1SL2 A;  1Z25 A;  3OYI A;  2X74 A;  1CXQ A;  1RBV A;  1BIZ A;  4G1Q A;  5T7B A;  1REV A;  1T7P A;  1ZBI A;  1NOY A;  3VQ4 A;  4DQI A;  4DSK A;  1HYS A;  4RW7 A;  4CFB A;  1QSY A;  3LP0 A;  1S6Q A;  4DS4 A;  2WON A;  4FK2 A;  2OA8 A;  4M42 A;  1S1T A;  4KHY A;  1QHT A;  3KLE A;  4KB1 A;  1ZBL A;  1T05 A;  3ZSX A;  1T03 A;  1RBS A;  4FJH A;  3OS1 A;  1NKB A;  2Y1J A;  3OYH A;  3HJF A;  1UAX A;  4CHQ A;  3VQC A;  3OY9 A;  3OYG A;  3DLH A;  3QLH A;  4DTS A;  1NK0 A;  1WAJ A;  4FW1 A;  4K8Z A;  3DI6 A;  2HHQ A;  2VWK A;  2KZM A;  1TKD A;  3KK2 A;  1RBT A;  4CCH A;  4I7F A;  4B9S A;  3QEV A;  2OPS A;  3B6O A;  5DMR A;  4KTQ A;  1S9E A;  3ITH A;  3TAP A;  1MU2 A;  1IH7 A;  2IC3 A;  5KGW A;  4CEC A;  2EX3 A;  4CJU A;  2FBY A;  3OYC A;  2YKM A;  4DTU A;  3PUF A;  3ZSO A;  2X6S A;  5FRN A;  3QEW A;  3AA3 A;  1NOZ A;  1TK5 A;  4F2R A;  4GVM A;  4LH5 A;  3LPU A;  1DTT A;  5KI6 A;  3DLE A;  1WSE A;  4DG1 A;  4FZY A;  2YV0 X;  3SPZ A;  3HO1 A; 
#chains in the Genus database with same CATH topology
 3PO5 A;  1TV6 A;  4B9T A;  1S1W A;  4LF8 K;  2JGU A;  1SZ2 A;  2PYJ A;  4FLY A;  4DCH A;  5FPN A;  4DFJ A;  1RDA A;  3FR0 A;  4DTJ A;  1Q18 A;  3ENO A;  3HM9 A;  3D7E O;  2ITM A;  3VA3 A;  3ID6 A;  4EZ6 A;  5H1S Q;  2HHX A;  4A59 A;  3VQA A;  2GWJ A;  1A5V A;  4JHD B;  2YCH A;  4DQQ A;  1LV5 A;  3RSE B;  4EHU A;  4IOX A;  1NGJ A;  4MLH A;  2Q1N A;  2HND A;  3SJJ A;  3KTQ A;  3SUP A;  4OKE A;  3KK7 A;  3NHG A;  3O4Q A;  1H1V A;  1WN7 A;  2RE2 A;  1SQK A;  4PY5 A;  3WQT A;  1IKX A;  4DSL A;  2F8S A;  1X3N A;  1OH6 A;  5E41 A;  4IEE A;  1KVA A;  2A1S A;  2EWS A;  4CFA A;  4HUF A;  3PY8 A;  3L2Q A;  2XRI A;  4DU1 A;  4DR6 K;  3M8R A;  3LDS A;  1VSH A;  1JLQ A;  3GG4 A;  3AO4 A;  3P39 A;  3QB0 A;  4HCC A;  1BOT O;  4FL9 A;  1RT1 A;  1EO1 A;  3T7Z A;  4JI0 K;  3E01 A;  4H5T A;  3NDK A;  1KLN A;  3DM2 A;  3J7Z O;  4CK3 A;  2E5L K;  4LFB K;  3AO2 A;  5AQL A;  3AVC A;  3FZF A;  3TSQ A;  1RGI A;  4FJK A;  1RDU A;  5A2Q O;  4CZF A;  1NGF A;  3TTC A;  4N41 A;  2KFN A;  3M8Q A;  1I94 K;  1RTH A;  4CHY A;  1T6D A;  2O8E A;  3SCX A;  4DS5 A;  2P9U B;  3HYF A;  1TKT A;  1KXP A;  5AQK A;  2HVI A;  2V7Z A;  3P5J A;  1T8E A;  2QWQ A;  3VTH A;  3SAF A;  2HBL A;  2GEM A;  2WC9 A;  5CR4 A;  3V1O A;  3K5M A;  4IXC A;  4YOU A;  3V4I A;  4JI1 K;  4K0K K;  2FBV A;  2NRV A;  4CEF A;  3ZX0 A;  1OH7 A;  3ZEU A;  4AHR A;  4KKO A;  3TAR A;  2P9L A;  4LSN A;  4BQL A;  3ULE A;  3G6E N;  4CED A;  2GUI A;  2B5J A;  3P4I A;  4R79 A;  3DLB A;  1KFS A;  4KPY A;  1RDB A;  4FJ8 A;  1QTM A;  4B3M K;  2E1Y A;  3CPE A;  4PHT X;  1K6Y A;  3CD6 N;  2AJQ A;  3V9W A;  2FC0 A;  1J6Z A;  4RTF D;  1GOB A;  2E20 A;  4H5V A;  4OPJ A;  1C6V A;  2BUP A;  2P9K B;  2ZF5 O;  3D2F A;  4CJ5 A;  2XY5 A;  5FRM A;  1W9H A;  2FSJ A;  3AAP A;  4FWR A;  1C0F A;  3S3M A;  1GOA A;  1LWF A;  3VQ5 A;  3KLF A;  2UYT A;  4NYN A;  2DTU A;  1Q8I A;  4CGG A;  4GNI A;  2GX9 A;  4OJR A;  3P83 D;  1RTJ A;  2W6L A;  3VN5 A;  4DTM A;  4BE1 A;  2ATQ A;  5C0Y A;  1X9S A;  5KRS A;  4JKG B;  1HNX K;  4JV5 K;  3VQ9 A;  3RMA A;  1TAQ A;  4L8R B;  1SAZ A;  4FJM A;  2ZQB A;  2HVH A;  1Y97 A;  3QIN A;  3E9L A;  1HKB A;  3CET A;  2E2Q A;  2UUA K;  1GLJ O;  1C1C A;  3CJ9 A;  1SUQ A;  1V4S A;  2BGG A;  4CI6 A;  1HJR A;  2XO7 A;  1HNZ K;  1HLU A;  4BC2 A;  3FE1 A;  4FWS A;  5FRO A;  4FXD A;  4JKB A;  4JI7 K;  3K9J A;  1U49 A;  2P9P A;  4YOT A;  5B8H A;  4B3S K;  3D2E B;  1T44 A;  4CIF A;  3C7N B;  4BC5 A;  2IVP A;  5E84 A;  4IDK A;  5AQR A;  5E26 A;  4N76 A;  4FLT A;  1SL0 A;  3U9Z A;  3JAM O;  4DSF A;  1BDG A;  1K8A O;  3MN9 A;  4FLX A;  5DM7 L;  4B9L A;  4YDU A;  3H1Q A;  4AHV A;  3QEX A;  2RKI A;  2HHV A;  4WYB A;  3W3D A;  3WNF A;  1BL3 A;  5KPT A;  1KQS M;  2V52 B;  5AQH A;  4BVP A;  4BG8 A;  2HBM A;  4DTP A;  1VQ6 N;  2B6A A;  2F8T A;  1SKS A;  1JXE A;  1JL1 A;  3ZSW A;  4DTX A;  2GV9 A;  1BIS A;  4JKH A;  3A2F A;  4M3T A;  5D3G A;  4KI6 A;  5GIP A;  2A3Z A;  3O80 A;  1IBM K;  1VAZ A;  1RCH A;  1RDC A;  4CJ4 A;  1D9F A;  4B1W B;  5FPD A;  5HL7 L;  3T1Y K;  3HK2 A;  4CJW A;  4H0T B;  3ZSY A;  3PX0 A;  5AQW A;  3THX A;  1D8Y A;  1BA0 A;  3AVF A;  3GOI A;  2JWK A;  5KGX A;  4DLE A;  3TAF A;  2O8B A;  4C1N I;  3ALY A;  3L4I A;  2PFU A;  1ASV A;  4YOY A;  1Q7Y O;  3RWU A;  5EU7 A;  4GKJ K;  3OYD A;  4DR3 K;  3ZSQ A;  4GV3 A;  4JD2 B;  4BRQ A;  4NLB A;  1TKZ A;  1YXQ A;  4BRF A;  3EEQ A;  4ZTJ A;  4CZG A;  5C42 A;  3RMD A;  1VSK A;  3T1A A;  3SUO A;  3DOK A;  4JKC A;  4YDU C;  4FCY A;  3UE5 A;  2EHG A;  1YAG A;  2OZM A;  2J4R A;  3MWP A;  4XEI A;  5BPN A;  4E3S A;  1BO5 O;  2QKB A;  1NK4 A;  2XY8 A;  3PX6 A;  3VQ6 A;  3OYA A;  4J2A A;  3TAM A;  3L3V A;  4CHZ A;  4JS5 A;  2HMP A;  1NGB A;  3LDP A;  3D45 A;  4TSX A;  2FSN A;  2YHY A;  4GY2 B;  3K58 A;  4FZX C;  3CCM N;  3QEP A;  3LDN A;  4ISE A;  3DLG A;  1LCU A;  4FK0 A;  5FDL A;  1RTD A;  4GVE A;  1NK7 A;  3LPT A;  4YNQ A;  4AQY K;  4IG3 A;  1X9J A;  2UXD K;  1YVN A;  1Q9X A;  3VF6 A;  3AVM A;  1HYZ A;  2I5J A;  3SV4 A;  5JLF A;  3DLL L;  4BRO A;  4AIL C;  3CHW A;  1GLC G;  3HPH A;  3ASM A;  2BDP A;  1FKP A;  1JXB A;  4K25 A;  3DXM B;  4IBN A;  4DR2 K;  3BY5 A;  4XH4 A;  3L2V A;  4I9L A;  1Z05 A;  4OPA A;  4DF8 A;  1QQC A;  5KPZ A;  1L3V A;  4DSE A;  2P5G A;  1YVU A;  3CC7 N;  4PWD A;  4FWM A;  2GUP A;  3VGM A;  4BRP A;  4ZHR A;  2QWR A;  3M5R A;  3UIQ A;  4J2E A;  2VQF K;  4CF1 A;  4JEP A;  1U47 A;  2YJF A;  2Z1G A;  1K73 O;  3O9R A;  4CJL A;  1ZXO A;  2WBN A;  3ZT0 A;  3HXM A;  2X78 A;  3A5N C;  4LY7 A;  3O4W A;  4C8K A;  4DV2 K;  4EP4 A;  2ZJR L;  3H46 O;  1NGC A;  4DV3 K;  2X74 A;  1RBV A;  1BIZ A;  2FSK A;  1REV A;  3MN7 A;  3SBG A;  1NOY A;  3VQ4 A;  3H45 C;  4DSK A;  1MA9 B;  2V51 B;  2WON A;  4M42 A;  2QM1 A;  5JLH A;  4K43 A;  1OVQ A;  3E9O A;  4KB1 A;  1T03 A;  5ADX A;  3CQY A;  3VQC A;  4DKW A;  3OY9 A;  4MO5 A;  4DTS A;  1ATN A;  3AAR A;  3DI6 A;  2KZM A;  2E8A A;  4B9S A;  5AQP A;  4IFE A;  5KGW A;  1QQM A;  3CCL N;  2EX3 A;  2NRR A;  5EOY A;  4CJU A;  3OYC A;  5ADX H;  4DTU A;  4LFC K;  3ZSO A;  2X6S A;  1NOZ A;  3QBW A;  4F2R A;  2NLX A;  4GVM A;  3LPU A;  3O08 A;  1BG3 A;  5KI6 A;  4FZY A;  1WSE A;  2YV0 X;  3SPZ A;  3HO1 A;  1QVG M;  3VEX A;  3O3G A;  4BRI A;  3EY1 A;  1P8Z A;  2Q97 A;  4DB3 A;  3SNN A;  1YF5 L;  1DLO A;  4X62 K;  4CJK A;  2BAN A;  4LF6 K;  3C6A A;  4O5F A;  1W2B M;  5EXW A;  4X65 K;  3KKS A;  1S1X A;  3I8D A;  3KWI A;  3LP1 A;  3LZI A;  4AM6 A;  5AR0 A;  4CZE A;  1ILY A;  5HRN A;  1HYV A;  3P31 A;  2FF6 A;  4FZZ A;  1VQL N;  4M3U A;  1TYQ A;  4JI5 K;  2YKN A;  3FFI A;  4V19 S;  2BE2 A;  4JI4 K;  4WFA L;  2HOE A;  3KKR A;  4CZI A;  1M90 O;  3L6Q A;  5KQD A;  2QKK A;  3NGZ A;  1TAU A;  4O5B A;  2G8F A;  1TVR A;  2D0B A;  5AQJ A;  4FJ9 A;  5AZJ A;  4JRP A;  3L8B A;  3BP8 A;  1D5A A;  3CQX A;  4BRD A;  2QW9 A;  3AVG A;  2W40 A;  2Q0R A;  4K41 A;  1RT5 A;  2DFE A;  2D0O A;  4CZJ A;  3DXK A;  3CER A;  4IOA L;  4M7Y A;  4BG9 A;  2VWJ A;  3ZX3 A;  1NJI O;  1VRU A;  1NK6 A;  4W5R A;  5LL6 Z;  3ZSR A;  3A5O C;  2NRW A;  3H1V X;  3O6W A;  4A5A A;  4CJR A;  3HVR A;  4DV1 K;  3THY A;  3VF2 A;  4E1N A;  1NU0 A;  2WUS A;  4CER A;  1NMD A;  3DMJ A;  3GL1 A;  3FZL A;  1VSD A;  2RN2 A;  3T3F A;  5BN9 A;  3ZYY X;  4KRE A;  4JKA A;  2LSN A;  4WQ4 A;  3AVJ A;  5LY3 A;  5SZT A;  4CD3 A;  4FLW A;  4ILH A;  2HBJ A;  2A1R A;  4CGF A;  3B8A X;  3VQQ A;  1SL1 A;  1IKY A;  3VES A;  4ID5 A;  1Y64 A;  4F9O A;  3SUQ A;  4CJS A;  5K14 A;  1K8K A;  3V1R A;  4KHU A;  1HNI A;  2W42 A;  3HRG A;  3WXL A;  3S3N A;  4Q0B A;  3HPG A;  2O8F B;  2IOC A;  4B8A B;  5AQQ A;  4K42 A;  3G0Z A;  3Q7B A;  1ZC6 A;  4DTO A;  3DOL A;  2HNZ A;  1QZ6 A;  4BRA A;  4EIA A;  4FPA A;  4CHO A;  3L2W A;  3VEO A;  1WBB A;  3AA5 X;  4KTW A;  1EET A;  1RT7 A;  4HTU A;  4UQG A;  1BQN A;  1JLG A;  2V7Y A;  4IWV A;  5C2F A;  3RVC A;  5M1F A;  2G8K A;  1DTQ A;  3L4Q A;  1NKC A;  4F4K A;  4KO0 A;  3CME N;  4EAH D;  3IFR A;  4IFV A;  4KHW A;  4W5N A;  3SUN A;  1IBK K;  2DFH A;  3SAG A;  4DSI A;  4IZ9 A;  3AVL A;  4JKD A;  3DRS A;  5AQZ A;  1OH5 A;  1Q81 O;  5BPM A;  2XY7 A;  4WQ4 C;  4QAG A;  4RWT A;  2KLA A;  1FKO A;  4DR1 K;  4CEQ A;  3AV9 A;  1G15 A;  1UA1 A;  4CK2 A;  1SS6 A;  5AQS A;  3UKU B;  4LFA K;  4CZK A;  5BPL A;  2R7Y A;  4KTZ A;  3QML A;  3PIP L;  4DLG A;  4OKJ A;  2G8U A;  1KD1 O;  4H5R A;  3PSF A;  4JK8 A;  2E2P A;  3LL3 A;  2QWL A;  1U2V A;  3NFA A;  3VER A;  3P1G A;  1YJ9 N;  5J2Q A;  3LP2 A;  5LJW A;  4YFU A;  4M3X A;  3PX4 A;  1BI4 A;  2NRX A;  4JI8 K;  4BR0 A;  4NCA A;  3K5L A;  3OBY A;  5GAE P;  4H03 B;  3MXI A;  4IO8 A;  4FO0 A;  4OKK A;  3OBW A;  3RRH A;  2O8C B;  4DUZ K;  3HL8 A;  4MFB A;  1VSI A;  1TUY A;  3MCP A;  4DFP A;  1X9M A;  4E0D A;  1ZYQ A;  5AQG A;  1VSF A;  3QIC A;  1LW2 A;  3L2R A;  5AQI A;  4FWQ A;  1ASW A;  3VQ8 A;  1T6C A;  3VEW A;  1GLA G;  3O1B A;  4JAX A;  3TTF A;  4FW2 A;  2P9I B;  1ASU A;  2A42 A;  3M3Z A;  2A40 A;  3MEE A;  2I7P A;  4OGE A;  4E7J A;  1QHA A;  2JLE A;  4CJP A;  3CQ8 A;  4JI6 K;  5J1E A;  3HZ6 A;  1TK0 A;  5IT9 O;  4CD1 A;  5GAG P;  1TL1 A;  2VG6 A;  3M8P A;  5SWM A;  3J8A A;  2BH1 A;  4YOW A;  1TK8 A;  3NBP A;  2KZZ A;  3ID8 A;  1IV0 A;  3VQD A;  5LMU K;  1F21 A;  4HUG A;  4FLV A;  3E1Y A;  1IBL K;  1VSM A;  2NRZ A;  3OYL A;  1J54 A;  3KK3 A;  3CCE N;  4ISG A;  3G4S N;  3EZ5 A;  4KRF A;  3C65 A;  3FLC O;  4DTR A;  1KVB A;  5FPE A;  4FJG A;  2WFB A;  3SZ2 A;  1K9M O;  2A41 A;  3TSU A;  4M3Z A;  1S9G A;  4CJT A;  4BGA A;  1NNE A;  2IDO A;  1QSS A;  3TI0 A;  4E1M A;  1VQ8 N;  3S41 A;  2VG7 A;  2GBZ A;  3CIP A;  4IJA A;  4CF2 A;  1QQN A;  1NK8 A;  2FBX A;  1VQM N;  3KIO A;  1RT2 A;  3ZCM A;  4ICL A;  3OYM A;  2KQ2 A;  1XQS C;  1JL2 A;  3U3G A;  4XH5 A;  2ASM A;  4FOI A;  1ATR A;  1HUX A;  1KAZ A;  3A5L C;  1NGG A;  2ZM6 K;  1OVY A;  3D6R A;  2F4V K;  1U4B A;  4YY3 K;  5TKW A;  3MXJ A;  4DQR A;  1M1K O;  2KKZ A;  4FM2 A;  3I33 A;  1Z6R A;  1EX4 A;  2ZGZ A;  3NF8 A;  3UKR A;  1T3V A;  4E7K A;  1QQO A;  1B92 A;  3KD5 E;  1IJJ A;  2HHT A;  1QVF M;  4EHT A;  1QSL A;  1NK5 A;  4CJ3 A;  1B9D A;  4BR5 A;  3O5B A;  3RMB A;  5J2P A;  1HPZ A;  5CYM A;  5IWA K;  3WQU A;  2FF3 B;  3ZX2 A;  4HCB A;  4C8M A;  4Z4H A;  3C0B A;  4IDH A;  1W7A A;  1JKH A;  4FM0 A;  3JXU A;  3QIO A;  1Q82 O;  1GOC A;  4KH5 A;  4KFB A;  1ATS A;  4DV6 K;  2E4L A;  4QOZ B;  3VEV A;  3WEE B;  3TAE A;  4M63 C;  2OPR A;  3SAH A;  3IUC A;  4Z4I A;  3HP9 A;  3K5N A;  4BWJ A;  4CF9 A;  1ZBS A;  2O8E B;  1BA1 A;  4JN4 A;  4LF9 K;  4AH9 A;  1U48 A;  1EP4 A;  1A5W A;  1FW6 A;  3VEN A;  4ELV A;  3CF5 L;  5ELZ A;  4A61 A;  3THV A;  1LAV A;  5CZ1 A;  3TAQ A;  4LSL A;  3LDL A;  4I2Q A;  4BR4 A;  2QK9 A;  4ZTF A;  1C0T A;  5BN8 A;  3FZK A;  1J5E K;  5JVH L;  2QTD A;  1DGK N;  3ZEU B;  3OYI A;  4G1Q A;  4DR7 K;  1TUU A;  4BR2 A;  1ZBI A;  2YHX A;  2P9L B;  4OPH A;  3P38 A;  3ULE B;  4CFB A;  2E88 A;  3LP0 A;  1KC8 O;  4FK2 A;  2OA8 A;  1GLB G;  1S1T A;  3KLE A;  4FJH A;  3OS1 A;  4CHQ A;  5I9E B;  3DLH A;  1NK0 A;  1WAJ A;  4FW1 A;  4K8Z A;  2VWK A;  2YHW A;  3KK2 A;  1RBT A;  2OPS A;  3B6O A;  3D2F B;  5DMR A;  3TAP A;  3CJC A;  3Q7C A;  1MU2 A;  3WXK A;  4B1Y B;  4H5N A;  3FFK B;  4CVN E;  2CGJ A;  4LH5 A;  3DLE A;  3A8Y A;  4DG1 A;  3CMA N;  2ASO A;  1JLA A;  3N4P A;  5CHI A;  2Y1I A;  3AAQ A;  5AZI B;  2OCE A;  1N33 K;  5DK5 A;  4RCH A;  5AJ3 K;  3VEY A;  3OYB A;  1KVC A;  3VGL A;  3V81 A;  1X1P A;  4LH4 A;  3CFO A;  1N34 K;  3PIO L;  1EKE A;  4CIE A;  3LAK A;  4BAC A;  1YHQ N;  3A0I X;  2XHB A;  4ELT A;  4KB0 A;  1NGA A;  5AQX A;  3EZW A;  4NCG A;  2P1J A;  5AQY A;  1E4G T;  3T1H K;  1NG9 A;  1J53 A;  3LM9 A;  1YT3 A;  4DMN A;  3QNO A;  4XIU A;  1L3S A;  1XMQ K;  4PKH A;  5JIC A;  1YTA A;  3SV3 A;  4H0Y B;  3CPW M;  3H6E A;  2P9N A;  2Q0U A;  4DQ8 A;  2Z1J A;  3O3H A;  3LAL A;  2DFF A;  3LAM A;  3E66 A;  5J2N A;  3EYZ A;  3LM2 A;  1HQU A;  4FLU A;  4ID1 A;  4YOV A;  4IO9 L;  4BR7 A;  2QWN A;  2YNI A;  4CJE A;  1EXQ A;  1W0H A;  1S6P A;  2FBT A;  3LP3 A;  4E1J A;  3AO3 A;  4AHT A;  4BRH A;  1C0M A;  1XC9 A;  3BZC A;  1U45 A;  2YHB A;  5AQV A;  4BC3 A;  1RT3 A;  2UUB K;  1CZ9 A;  3QO9 A;  3ZT1 A;  2Q31 A;  3LAN A;  4CGD A;  3C95 A;  4CJF A;  2O8D B;  3LDQ A;  3RR8 A;  3CCS N;  1R59 O;  4YOX A;  4Z4E A;  5J2M A;  1HRH A;  4C8O A;  1YI2 N;  1E3M A;  1VHX A;  3R3L A;  2HNY A;  4OO1 J;  1KAX A;  3TSP A;  2HMI A;  3PLA A;  1WSI A;  2G8V A;  4EZ9 A;  3SQ0 A;  1NK9 A;  5JVG L;  3QES A;  1NGH A;  4CZM A;  3C94 A;  4C8L A;  2HHS A;  4M45 A;  3SQ2 A;  3J7A P;  2O8B B;  3VOV A;  3THW A;  3PO4 A;  3ZET A;  5AQU A;  4PKI A;  3FZM A;  3AGK A;  1VQ9 N;  2KHO A;  3J80 O;  1WLJ A;  3L2U A;  4E19 A;  3AA2 A;  4AHS A;  5HRP A;  4FYD A;  4C8N A;  1HMV A;  3VQ7 A;  3SJH A;  3VPZ A;  3RMC A;  3MMV A;  5HRR A;  3U8X A;  3OVN A;  3H3O B;  4U7B A;  1KAY A;  3WUH A;  4DV7 K;  4IKF A;  4LD0 A;  1WSJ A;  3CCJ N;  4GV6 A;  5M1P A;  3U6F A;  4I6M A;  1EQY A;  1P90 A;  5BR8 K;  4IJN A;  1WUA A;  4H8K A;  2VQE K;  4A57 A;  1XNQ K;  5AQN A;  1NWK A;  1RT6 A;  4FVU A;  2OPP A;  2UUC K;  1BCO A;  1JCF A;  4JI2 K;  1RT4 A;  2AP1 A;  3ENH A;  1X9W A;  4FJ5 A;  4IG0 A;  5BRF A;  1IO2 A;  3TPQ A;  1RBU A;  4N5S A;  1HKC A;  3AO1 A;  3DYA A;  2CGL A;  4DV4 K;  3U9D A;  3ULD A;  3O9S A;  4YOR A;  4J2D A;  2ITG A;  5BR9 A;  1SKR A;  4LF7 K;  4DWI A;  4CF0 A;  1V4T A;  5F0X A;  3VA0 A;  4BGB A;  2NRT A;  2I7N A;  2FXU A;  2IVN A;  4KH4 A;  3T69 A;  4M7X A;  1XMO K;  4O8U A;  3ENB A;  4H0P A;  4DQS A;  3O9T A;  5C25 A;  3ZLJ A;  4UY8 O;  4PKG A;  4IOC L;  2UXB K;  4HHT A;  3DRR A;  4CHP A;  4JHD A;  1CXU A;  2OTJ N;  4KAZ A;  4BRL A;  3RSE A;  3IG1 A;  3VQP A;  1RFQ A;  4CGJ A;  3DLR A;  1RDD A;  1EWR A;  4Y1C A;  3SYZ A;  1GLD G;  4CZH A;  2RF2 A;  1WSF A;  3UKU A;  4B9M A;  1RIL A;  4B9Q A;  5KTQ A;  3I55 N;  3MWT A;  1CLQ A;  4R5P A;  2QA4 N;  3NMU A;  1FXX A;  2P51 A;  3MEG A;  4E7L A;  4E7I A;  3VQE A;  4CJV A;  4RG8 A;  3AO5 A;  4DFM A;  3NF9 A;  1SKW A;  3AVK A;  1FK9 A;  3HTV A;  3F9K A;  4CW7 B;  4BE0 A;  4AF1 A;  2D1K A;  3IS9 A;  3VGK A;  3FGU A;  1HX1 A;  2Q3S A;  3JYT A;  4CEB A;  1BGX T;  5AFU A;  4BRM A;  3NE6 A;  2G8W A;  3I8B A;  3CXC M;  1NGI A;  3WNG A;  4M41 A;  4AM7 A;  5AQM A;  3M8S A;  3B6P A;  4GV9 A;  1BUP A;  3I0S A;  4MO4 A;  3MN6 A;  4CJQ A;  2HHW A;  3OHR A;  4DU4 A;  3MDQ A;  3K59 A;  4Z4F A;  3EKS A;  5AQT A;  3ISN C;  1OKJ A;  4B3R K;  1DKG D;  4F2S A;  4ISF A;  5LMN K;  4NCB A;  3MXM A;  4CEE A;  1NGD A;  2P9U A;  3OJU A;  2QI2 A;  3NVM A;  4M3W A;  3T19 A;  5M1K A;  2PY5 A;  2RPI A;  4FWN A;  4PL7 A;  2ZGY A;  4OLA A;  2OZS A;  3QIP A;  4JRQ A;  3HST B;  3MN5 A;  5CZ2 A;  1ITG A;  4FJX A;  4WFN L;  1XUP O;  4PA1 A;  3ZT3 A;  4LC9 B;  3H08 A;  2NNW A;  1QE1 A;  5FPM A;  3NGY A;  3AGR A;  5HLF A;  1XHZ A;  4QCL A;  3DRP A;  4QS8 A;  3N4Q A;  3HPO A;  2IAJ A;  3BZK A;  3EE9 A;  2D0A A;  3O3F A;  1O1W A;  2HB5 A;  4CGH A;  2HBK A;  3E9P A;  1NJX A;  3JS6 A;  1IG9 A;  1SV5 A;  3CFR A;  1TYQ B;  3TAN A;  4O0I A;  4BDP A;  4I9Q A;  4B9V A;  1BWF O;  2ZJQ L;  4H5W A;  2H3G X;  2P9K A;  1NJY A;  4FJ7 A;  4MLE A;  2E2O A;  5JMV A;  1XNR K;  5C15 A;  4RW8 A;  4ILJ A;  2E6M A;  3NGI A;  4DR4 K;  4H4O A;  4BRC A;  4DF4 A;  4DSJ A;  5AZJ B;  4HUE A;  2W41 A;  1BHL A;  1I3A A;  2YHA A;  4CHN A;  4OLB A;  3O4N A;  1UA0 A;  3HI0 A;  3HM8 A;  4WQ5 A;  4NXN K;  4JKG A;  1MWK A;  3O9Q A;  2P9S B;  4FSV A;  5JS2 A;  3DXK B;  4Y1D A;  3C6U A;  2QXF A;  1S72 N;  3CJ1 A;  3KJV A;  3OS2 A;  3TU5 A;  3IDH A;  1EWQ A;  2IS3 A;  1S5J A;  4H4M A;  4FOE A;  4IFY A;  3W0L A;  3QET A;  4CES A;  4B3O A;  3DJC A;  3NH0 A;  1WSG A;  4CF8 A;  3MED A;  1TGO A;  2D5R A;  1Q9Y A;  4G9Z A;  3THY B;  1B9F A;  1ZBH A;  2QWM A;  4N56 A;  3EKU A;  3LDO A;  4OPK A;  5HRS A;  2E1Z A;  1L5U A;  3D2E A;  3QNN A;  4M3R A;  3C7N A;  4L3Q A;  1JLB A;  4W5T A;  3ZSZ A;  3CYM A;  1L3T A;  2Z1H A;  3QDK A;  3VQB A;  3SBT A;  5GAD P;  1VSJ A;  4BDZ A;  1R0A A;  2KFZ A;  3ATV A;  1ESV A;  4ILG B;  4OGC A;  4BVO A;  4MQ3 A;  5KQ8 A;  3MAQ A;  4KHP K;  3BDP A;  2GTD A;  3NH2 A;  4KHN A;  3F73 A;  3WEE A;  3ZT4 A;  1K8K B;  1X3M A;  2OPQ A;  1BIU A;  1TKX A;  3V6D A;  1SL2 A;  1Z25 A;  4BRN A;  4DQI A;  2YJE A;  1VQP N;  1HYS A;  4DS4 A;  1S6Q A;  1S22 A;  3HBT A;  1NBW A;  3CJ7 A;  3WXJ A;  1YJW N;  3A5M C;  3ATU A;  3ZSX A;  4X66 K;  1NKB A;  1UAX A;  3CC2 N;  4WQ5 C;  3F9M A;  4JI3 K;  3EE8 A;  1JCG A;  2HHQ A;  1OH8 A;  4JK9 A;  3KZB A;  4CCH A;  3BF3 A;  3PSI A;  4BRK A;  1IH7 A;  4CEC A;  4LF5 K;  3GBT A;  3U4L A;  2YKM A;  4FWP A;  3PUF A;  2AA4 A;  5FRN A;  3VET A;  3AA3 A;  1N36 K;  4I7F A;  2Q2R A;  1N8R O;  1CZA N;  4KI4 A;  2YI1 A;  4AHU A;  1HQE A;  1NMN A;  2IVO A;  2WOM A;  3CI5 A;  4O8K A;  2P5O A;  3RTV A;  3F2K A;  4JD2 A;  3AVH A;  4KHQ A;  1VSE A;  3UB5 A;  4FWK A;  4DFK A;  3QEI A;  2VCP A;  3OYK A;  1WSH A;  5F2R A;  2KTQ A;  4CEZ A;  2D0P A;  4OX9 K;  2Q36 A;  3G71 N;  4CE9 A;  5GAH P;  1VK0 A;  1XWL A;  1J9A A;  3G25 A;  4CFC A;  2RHK A;  5GIN A;  1GLL O;  2DY4 A;  3HOS A;  1WAF A;  3LZJ A;  3V9Z A;  2OYQ A;  1WNS A;  2KW4 A;  2F7T A;  5LJV A;  3WXI A;  2E2N A;  2IIR A;  4BE2 A;  5M1O A;  3EO3 A;  3IRX A;  5CY4 A;  3K57 A;  5AZI A;  4F3O A;  4RW6 A;  3L3U A;  4BWM A;  3KHY A;  1IG8 A;  1U2V B;  2CH5 A;  5M1Q A;  4Z0U A;  2D0C A;  2HF4 A;  2GWK A;  4Q5V A;  1BI4 B;  4NXM K;  2YNF A;  4DV0 K;  1D4X A;  3RR7 A;  4CGI A;  5F1X A;  2ZJP L;  1YIJ N;  2OTL N;  1L3U A;  5MLC Q;  4DUY K;  1KSP A;  3EL2 A;  3OS0 A;  4F8R A;  1JLE A;  1VSL A;  2ZD1 A;  1WBD A;  3HSC A;  4I2P A;  2OAN A;  2CH6 A;  4E89 A;  1KCF A;  5BRH A;  1WOQ A;  3R1X A;  4A2B A;  4A62 A;  4C23 A;  2DPN A;  1VQ4 N;  2VGN A;  1WB9 A;  1J5O A;  1GLF O;  3DXM A;  2NUB A;  3NF7 A;  5HP1 A;  3IKM A;  1N6Q A;  2O4I A;  3LWL A;  4DR5 K;  1DEJ A;  5C10 A;  4J8F A;  1VRT A;  3SMS A;  2HW3 A;  5C2D A;  4WF9 L;  1N32 K;  3O1W A;  4GMJ B;  4CFD A;  4H0O A;  4HWI A;  4CEO A;  1D9D A;  3OYF A;  3G10 A;  1IKV A;  2G8H A;  4H0V B;  2O8D A;  3SMP A;  4WCE L;  3D0P A;  3EN9 A;  4DHY A;  3MX2 A;  3K2P A;  1A5X A;  3OA9 A;  3OYN A;  1U04 A;  3KLH A;  5JS1 A;  3HVT A;  3R9P A;  1E4F T;  3CCR N;  3HT3 A;  3JSM A;  4DQP A;  4ELU A;  5AQO A;  4B08 A;  4B3T K;  4A2A A;  4KH6 A;  3WXM B;  5C12 A;  3SPY A;  4PQU A;  3QFU A;  3ZT2 A;  3C6H A;  3QFP A;  3NH1 A;  3J81 O;  2YNH A;  3SLC A;  4JLH A;  2PZS A;  4CZL A;  5HBM A;  1TL3 A;  4CEA A;  4O0J A;  1NKE A;  4CBW A;  1RBR A;  4MDB A;  4FLZ A;  3I56 N;  1VQN N;  3UKR B;  3SQ1 A;  3CM6 A;  1KFD A;  4KBO A;  3J7Y P;  4N47 A;  4YHH K;  1KRP A;  5KPR A;  1FJG K;  1C1A A;  2P9P B;  3V9X A;  2GEL A;  3SQ4 A;  3S9H A;  1NJZ A;  3OYE A;  5C24 A;  2ZWH A;  4W5O A;  4FJI A;  2XY6 A;  4W5Q A;  1BQM A;  1S1V A;  1YTU A;  1RDW X;  1LWC A;  4F3T A;  1MWM A;  3CJA A;  5HOO A;  3CC4 N;  2CGK A;  4O44 A;  4B8C A;  4LF4 K;  4JYA K;  3CG7 A;  4DU3 A;  4HTL A;  3KK1 A;  3F5T A;  1JLF A;  2B4J A;  3MK6 A;  2VGM A;  4B1Z A;  3CM5 A;  1RTI A;  3NCI A;  4BRE A;  3H3N O;  3PV8 A;  3O9U A;  1CZB A;  4DTN A;  3CCU N;  4JNE A;  4FJN A;  1XHX A;  3BGR A;  3WNH A;  3VTI A;  4BRG A;  1JCE A;  5HRO A;  5EY4 A;  3K5O A;  3TTD A;  1JLC A;  4NYF A;  3VEZ A;  3R8E A;  4K8X A;  1I39 A;  1LOT B;  3KLI A;  4HVJ A;  4O4G A;  4BDY A;  3NVK A;  3LWM A;  5M1N A;  4A5B A;  2HHH K;  3AVB A;  5CE3 A;  1NJW A;  4CJ7 A;  2ETJ A;  4E7H A;  5EX5 A;  3TAB A;  4CBX A;  2QWO A;  1HNW K;  1YIT N;  3THX B;  3S3O A;  3TWH A;  4KHS A;  3V9S A;  1C0U A;  3DAW A;  4AHC A;  5BRD A;  3RRG A;  3GDQ A;  2E6L A;  1QS4 A;  1O13 A;  4B1U B;  3MCA B;  4JKF A;  1YUW A;  2VYP A;  1VQK N;  4Z4G A;  1IKW A;  2Z1I A;  4BR9 A;  4WFB L;  1HR0 K;  4KV8 A;  4CBU A;  3WT0 A;  4GW6 A;  4J2B A;  1VQO N;  4JS4 A;  4FJL A;  4FK4 A;  1KLM A;  2QWP A;  3ZSV A;  3QER A;  4PL8 A;  2F9T A;  3OYJ A;  4QS7 A;  1YJN N;  4B9N A;  4M3Y A;  3KD1 E;  5AQF A;  1C0G A;  5BRE A;  1GLE G;  4PUO A;  1VQ7 N;  3HP6 A;  1XC3 A;  3IAY A;  3FZH A;  3I0R A;  3AVA A;  3HOT A;  4C1N K;  2VG5 A;  2F96 A;  1U6Z A;  4CK1 A;  5I3U A;  3AVI A;  1C1B A;  2UXC K;  4B9U A;  2O8F A;  4FVM A;  3OW2 M;  4BY9 C;  3L0Q A;  3U3Y A;  5GIO A;  3CJB A;  4MDA A;  1NGE A;  2D4W A;  5EVZ A;  2YNG A;  4GKK K;  3KVG A;  3NF6 A;  4QS9 A;  1HKG A;  4Z4C A;  2HST A;  4CIG A;  4IEI A;  1S3X A;  1S1U A;  2JWL A;  4B1X B;  2P9N B;  1LWE A;  4NO7 A;  1MDU B;  1LW0 A;  4Z94 A;  3OTO K;  4JK7 A;  5DM6 L;  3OJS A;  1LAW A;  5FLX O;  1Q86 O;  2HHU A;  1VQ5 N;  2VWB A;  5CYQ A;  3R6M A;  3DWL A;  4H0X B;  2IGI A;  4RW9 A;  2PBD A;  4DV5 K;  3BUZ B;  4FJJ A;  1ZBU A;  1XI1 A;  3MEC A;  3VMF B;  3M1F A;  1ZBF A;  4FM1 A;  2NZT A;  3SK3 A;  4B1V A;  3NAE A;  4BC4 A;  4O55 A;  3TR8 A;  3GE1 A;  1W97 L;  3KWG A;  3K0S A;  1QZ5 A;  2PYL A;  2BTF A;  3V9U A;  3AY9 A;  4FWO A;  1JJ2 M;  2HF3 A;  4X64 K;  5I42 A;  5KRT A;  1NM1 A;  1RNH A;  2X6N A;  3C6T A;  3WNE A;  2A5X A;  2FLO A;  2UU9 K;  3TAG A;  2P9S A;  2WTU A;  4WE1 A;  3AA4 A;  3DLK A;  3SI6 A;  1HNV A;  1N5Y A;  4JKE A;  3VF4 A;  1UOC A;  3KLG A;  1NLV A;  3THW B;  3AVN A;  3K9K A;  3M6G A;  3ZET B;  3CFP A;  2G8I A;  1Z26 A;  2ZE2 A;  3IMX A;  3CCV N;  1UWB A;  2O4G A;  4RW4 A;  3O8M A;  4OVL A;  4U67 L;  2O8C A;  2YX6 A;  3V1Q A;  4EP5 A;  1BCM A;  4BQZ A;  2A6A A;  1CXQ A;  4XH1 A;  5T7B A;  1T7P A;  5AFU H;  1BU6 O;  4RW7 A;  2W6K A;  1QSY A;  5TKY A;  3BF1 A;  4FWL A;  4KHY A;  2QXL A;  1QHT A;  3QBX A;  4EFH A;  1ZBL A;  1T05 A;  2QEX N;  1RBS A;  4I6M B;  3OYH A;  2Y1J A;  3HJF A;  2NRH A;  3OYG A;  3QLH A;  2P9I A;  1HPM A;  4NB4 A;  3BEX A;  2ASP A;  1TKD A;  1G99 A;  1HJO A;  3QEV A;  4FPB A;  3CCQ N;  4KTQ A;  1S9E A;  3ITH A;  4Y0W A;  2IC3 A;  4NLC A;  2FBY A;  2F9W A;  3MX5 A;  3QEW A;  1DT9 A;  1TK5 A;  2PAV A;  1DTT A;  1KTQ A; 
#chains in the Genus database with same CATH homology
 3PO5 A;  4KI4 A;  1TV6 A;  4AHU A;  3O3G A;  1HQE A;  2WOM A;  3EY1 A;  2Y1I A;  4B9T A;  1S1W A;  3RTV A;  2P5O A;  2JGU A;  5DK5 A;  3AVH A;  4KHQ A;  1VSE A;  3SNN A;  2PYJ A;  4FLY A;  1DLO A;  3OYB A;  4DFK A;  4CJK A;  4DFJ A;  3OYK A;  1RDA A;  3QEI A;  2BAN A;  1KVC A;  1WSH A;  4DTJ A;  3V81 A;  2KTQ A;  4CEZ A;  1X1P A;  3KKS A;  1S1X A;  4LH4 A;  3HM9 A;  3CFO A;  4CE9 A;  3I8D A;  1VK0 A;  1EKE A;  1XWL A;  3LP1 A;  3LZI A;  3VA3 A;  1J9A A;  4CIE A;  3LAK A;  4EZ6 A;  4BAC A;  4CFC A;  2DY4 A;  2HHX A;  2XHB A;  3VQA A;  1WAF A;  1A5V A;  3LZJ A;  3V9Z A;  2OYQ A;  4ELT A;  4KB0 A;  1WNS A;  2KW4 A;  5HRN A;  4NCG A;  1HYV A;  4BE2 A;  2P1J A;  3IRX A;  5CY4 A;  3K57 A;  4FZZ A;  4DQQ A;  1LV5 A;  4F3O A;  4M3U A;  4RW6 A;  1J53 A;  1YT3 A;  2YKN A;  3L3U A;  4BWM A;  4DMN A;  3QNO A;  4XIU A;  3FFI A;  1L3S A;  2BE2 A;  3KKR A;  4Z0U A;  2D0C A;  1YTA A;  2HND A;  4Q5V A;  3SV3 A;  3SJJ A;  3KTQ A;  1BI4 B;  3SUP A;  4OKE A;  3NHG A;  2YNF A;  3O4Q A;  2QKK A;  1WN7 A;  2Z1J A;  3NGZ A;  1TAU A;  4O5B A;  3RR7 A;  3O3H A;  3LAL A;  4CGI A;  2G8F A;  2DFF A;  3LAM A;  5J2N A;  4PY5 A;  1TVR A;  2D0B A;  1IKX A;  3EYZ A;  4DSL A;  4FJ9 A;  1L3U A;  1KSP A;  2F8S A;  4JRP A;  1HQU A;  4FLU A;  3L8B A;  4ID1 A;  3OS0 A;  5E41 A;  4F8R A;  1JLE A;  1D5A A;  4CJE A;  2YNI A;  1VSL A;  1KVA A;  1EXQ A;  1W0H A;  2A1S A;  3AVG A;  1S6P A;  2ZD1 A;  2FBT A;  3LP3 A;  4CFA A;  3AO3 A;  1RT5 A;  4AHT A;  4HUF A;  4I2P A;  2DFE A;  3PY8 A;  3L2Q A;  4E89 A;  1C0M A;  1XC9 A;  1KCF A;  2XRI A;  1U45 A;  2YHB A;  4DU1 A;  1RT3 A;  1CZ9 A;  3M8R A;  2VWJ A;  3QO9 A;  3ZT1 A;  3LDS A;  3LAN A;  1VSH A;  1JLQ A;  3AO4 A;  4CGD A;  3C95 A;  4CJF A;  4HCC A;  1RT1 A;  1VRU A;  1J5O A;  3E01 A;  3NDK A;  1NK6 A;  1KLN A;  3RR8 A;  4Z4E A;  3DM2 A;  4W5R A;  5J2M A;  1HRH A;  2NUB A;  3NF7 A;  5HP1 A;  3ZSR A;  1N6Q A;  4C8O A;  4CK3 A;  2O4I A;  3HVR A;  4CJR A;  3LWL A;  3AO2 A;  3AVC A;  2HNY A;  4E1N A;  4FJK A;  1VRT A;  4CER A;  3DMJ A;  2HMI A;  2HW3 A;  1VSD A;  2RN2 A;  3T3F A;  1WSI A;  4FJ5 A;  4N41 A;  2KFN A;  3M8Q A;  2G8V A;  4GMJ B;  1RTH A;  4CFD A;  4CHY A;  3SQ0 A;  1NK9 A;  3SCX A;  4DS5 A;  3QES A;  4EZ9 A;  4KRE A;  2LSN A;  3C94 A;  4C8L A;  4CEO A;  3AVJ A;  3HYF A;  4M45 A;  3SQ2 A;  1D9D A;  2HHS A;  3OYF A;  1TKT A;  2HVI A;  5SZT A;  3G10 A;  1IKV A;  2G8H A;  3P5J A;  1T8E A;  4FLW A;  3PO4 A;  2A1R A;  4CGF A;  3D0P A;  3V1O A;  3VQQ A;  1SL1 A;  3K5M A;  1IKY A;  4ID5 A;  3SUQ A;  4CJS A;  3V4I A;  5K14 A;  1WLJ A;  3K2P A;  3L2U A;  2FBV A;  4E19 A;  1A5X A;  3AA2 A;  4AHS A;  5HRP A;  4FYD A;  3OYN A;  4C8N A;  3V1R A;  4CEF A;  1U04 A;  1HMV A;  3KLH A;  4KHU A;  1HNI A;  3VQ7 A;  2W42 A;  5JS1 A;  4AHR A;  4KKO A;  3HVT A;  3HT3 A;  3JSM A;  4DQP A;  4ELU A;  3RMC A;  3TAR A;  3S3N A;  4LSN A;  5HRR A;  3OVN A;  4Q0B A;  4CED A;  2GUI A;  3HPG A;  2B5J A;  4B08 A;  4IKF A;  4LD0 A;  1WSJ A;  2IOC A;  1JLA A;  4B8A B;  3DLB A;  1KFS A;  4KPY A;  1RDB A;  4FJ8 A;  1QTM A;  3G0Z A;  4DTO A;  3U6F A;  3DOL A;  3SPY A;  1K6Y A;  4PQU A;  2HNZ A;  2AJQ A;  3ZT2 A;  2FC0 A;  4CHO A;  3V9W A;  3L2W A;  4H8K A;  3NH1 A;  3AA5 X;  4KTW A;  1EET A;  1RT7 A;  1GOB A;  4HTU A;  1RT6 A;  1C6V A;  2YNH A;  4JLH A;  4OPJ A;  4UQG A;  1BQN A;  4CJ5 A;  2XY5 A;  2PZS A;  5FRM A;  1JLG A;  5HBM A;  2OPP A;  1BCO A;  2G8K A;  1TL3 A;  1RT4 A;  1W9H A;  1DTQ A;  4CEA A;  1X9W A;  4O0J A;  1NKE A;  1KTQ A;  4IG0 A;  1GOA A;  3S3M A;  1NKC A;  1IO2 A;  1LWF A;  1RBU A;  4KO0 A;  3VQ5 A;  4N5S A;  1RBR A;  4F4K A;  3AO1 A;  3KLF A;  4NYN A;  2DTU A;  1Q8I A;  4FLZ A;  4CGG A;  3DYA A;  4IFV A;  4OJR A;  3P83 D;  1RTJ A;  3SQ1 A;  4KHW A;  3CM6 A;  4W5N A;  1KFD A;  3VN5 A;  4DTM A;  3SUN A;  2DFH A;  4N47 A;  4BE1 A;  3ULD A;  2ATQ A;  1KRP A;  1X9S A;  5KRS A;  4DSI A;  3AVL A;  1C1A A;  3VQ9 A;  3V9X A;  3RMA A;  3DRS A;  1TAQ A;  2ITG A;  4J2D A;  1SKR A;  3SQ4 A;  3S9H A;  4DWI A;  1NJZ A;  4L8R B;  3OYE A;  4CF0 A;  4FJM A;  2ZQB A;  2HVH A;  3VA0 A;  5C24 A;  1Y97 A;  2XY7 A;  4W5O A;  4FJI A;  3QIN A;  2XY6 A;  4W5Q A;  4QAG A;  1FKO A;  1BQM A;  1S1V A;  4CEQ A;  1C1C A;  3AV9 A;  1G15 A;  1UA1 A;  1YTU A;  1SUQ A;  1LWC A;  4CK2 A;  4F3T A;  2BGG A;  1HJR A;  2XO7 A;  4DQS A;  4O44 A;  4B8C A;  5C25 A;  5FRO A;  4FXD A;  3CG7 A;  4DU3 A;  3KK1 A;  1JLF A;  4KTZ A;  2R7Y A;  1U49 A;  2B4J A;  4HHT A;  4DLG A;  3DRR A;  4CHP A;  4OKJ A;  3CM5 A;  2G8U A;  1RTI A;  1CXU A;  3NCI A;  4KAZ A;  4CIF A;  3PV8 A;  1CZB A;  4DTN A;  3NFA A;  3IG1 A;  4IDK A;  3P1G A;  3VQP A;  5J2Q A;  4FJN A;  4N76 A;  1XHX A;  3LP2 A;  4CGJ A;  3BGR A;  4FLT A;  1SL0 A;  3DLR A;  1RDD A;  4Y1C A;  3WNH A;  4YFU A;  3SYZ A;  3PX4 A;  1BI4 A;  4DSF A;  4M3X A;  4FLX A;  5HRO A;  4NCA A;  3K5O A;  2RF2 A;  1WSF A;  4B9L A;  4B9M A;  1RIL A;  4AHV A;  1JLC A;  5KTQ A;  3QEX A;  4NYF A;  2RKI A;  3K5L A;  1CLQ A;  4R5P A;  4K8X A;  1I39 A;  3MXI A;  2HHV A;  1FXX A;  2P51 A;  3MEG A;  4E7L A;  4E7I A;  4OKK A;  3VQE A;  3WNF A;  3RRH A;  1BL3 A;  4CJV A;  4RG8 A;  3AO5 A;  3KLI A;  4HVJ A;  4O4G A;  4BDY A;  4DFM A;  3LWM A;  3NF9 A;  1SKW A;  3AVK A;  1FK9 A;  3HL8 A;  4MFB A;  1VSI A;  4DFP A;  1X9M A;  3F9K A;  4DTP A;  4BE0 A;  4E0D A;  3AVB A;  1ZYQ A;  1NJW A;  2B6A A;  3IS9 A;  1VSF A;  2ETJ A;  1SKS A;  1JXE A;  2F8T A;  1LW2 A;  2Q3S A;  3L2R A;  3JYT A;  4CEB A;  1BGX T;  4E7H A;  3TAB A;  1JL1 A;  3ZSW A;  4DTX A;  3NE6 A;  3TWH A;  3S3O A;  4KHS A;  2GV9 A;  1C0U A;  3V9S A;  2G8W A;  4AHC A;  1BIS A;  3RRG A;  1ASW A;  3VQ8 A;  2E6L A;  1QS4 A;  3A2F A;  3WNG A;  4M3T A;  5D3G A;  4KI6 A;  4M41 A;  4Z4G A;  4FW2 A;  1IKW A;  2Z1I A;  3M8S A;  3B6P A;  3I0S A;  1ASU A;  4KV8 A;  3MEE A;  4CJQ A;  4E7J A;  4OGE A;  2HHW A;  1RCH A;  4GW6 A;  1RDC A;  4CJ4 A;  1D9F A;  2JLE A;  4CJP A;  4DU4 A;  4J2B A;  3K59 A;  5J1E A;  3CQ8 A;  4JS4 A;  1TK0 A;  4FJL A;  4Z4F A;  3ISN C;  4F2S A;  4FK4 A;  3HK2 A;  1KLM A;  4CJW A;  1TL1 A;  2VG6 A;  3M8P A;  3MXM A;  4NCB A;  5SWM A;  3ZSY A;  3ZSV A;  4CEE A;  3OJU A;  3QER A;  3PX0 A;  1TK8 A;  3NBP A;  4M3W A;  1D8Y A;  3T19 A;  3OYJ A;  3AVF A;  4B9N A;  2KZZ A;  2PY5 A;  2RPI A;  5KGX A;  4DLE A;  3TAF A;  4M3Y A;  3VQD A;  3KD1 E;  1F21 A;  3ALY A;  4OLA A;  4HUG A;  2OZS A;  4FLV A;  3QIP A;  4JRQ A;  3HST B;  1ASV A;  5CZ2 A;  1ITG A;  1VSM A;  4FJX A;  3RWU A;  5EU7 A;  3OYL A;  3OYD A;  1J54 A;  3KK3 A;  4PA1 A;  3ZSQ A;  3ZT3 A;  4PUO A;  3EZ5 A;  3H08 A;  4KRF A;  1TKZ A;  1QE1 A;  3HP6 A;  3IAY A;  4ZTJ A;  3I0R A;  1KVB A;  4DTR A;  3AVA A;  5C42 A;  3NGY A;  1VSK A;  3T1A A;  3SZ2 A;  2VG5 A;  3RMD A;  2F96 A;  4CK1 A;  3DOK A;  3SUO A;  5HLF A;  1S9G A;  4CJT A;  5I3U A;  1XHZ A;  4M3Z A;  4QCL A;  3DRP A;  2IDO A;  3AVI A;  1C1B A;  3HPO A;  4FCY A;  3TI0 A;  1QSS A;  2IAJ A;  4E1M A;  2VG7 A;  4B9U A;  2GBZ A;  2EHG A;  4FVM A;  2D0A A;  4CF2 A;  3U3Y A;  3O3F A;  1O1W A;  1NK8 A;  2FBX A;  2HB5 A;  4CGH A;  3KIO A;  1RT2 A;  3ZCM A;  1NJX A;  2OZM A;  4ICL A;  3OYM A;  1IG9 A;  4E3S A;  2KQ2 A;  2QKB A;  1NK4 A;  2XY8 A;  1SV5 A;  3CFR A;  3PX6 A;  3VQ6 A;  3OYA A;  4J2A A;  1JL2 A;  4O0I A;  2YNG A;  3U3G A;  3TAN A;  3NF6 A;  3TAM A;  3L3V A;  4BDP A;  4CHZ A;  4JS5 A;  4B9V A;  4I9Q A;  4Z4C A;  3D45 A;  4TSX A;  4CIG A;  1NJY A;  4FZX C;  3K58 A;  4FJ7 A;  1S1U A;  1LWE A;  3QEP A;  1U4B A;  1LW0 A;  3MXJ A;  4RW8 A;  3DLG A;  4DQR A;  2E6M A;  3NGI A;  4H4O A;  4FM2 A;  4FK0 A;  3OJS A;  1LAW A;  4DF4 A;  5FDL A;  1EX4 A;  4DSJ A;  4HUE A;  2HHU A;  1RTD A;  3NF8 A;  1BHL A;  1NK7 A;  1I3A A;  2YHA A;  3LPT A;  4CHN A;  4E7K A;  4OLB A;  4YNQ A;  1B92 A;  4IG3 A;  3KD5 E;  5CYQ A;  3O4N A;  1UA0 A;  1Q9X A;  2HHT A;  1QSL A;  2IGI A;  1NK5 A;  3AVM A;  4CJ3 A;  1B9D A;  1HYZ A;  4RW9 A;  2I5J A;  5JS2 A;  3SV4 A;  3RMB A;  4Y1D A;  5J2P A;  3C6U A;  1HPZ A;  4FJJ A;  1ZBU A;  5CYM A;  2QXF A;  1XI1 A;  3MEC A;  3KJV A;  4AIL C;  1ZBF A;  3OS2 A;  4FM1 A;  4HCB A;  3NAE A;  4C8M A;  4Z4H A;  2IS3 A;  4O55 A;  1S5J A;  3HPH A;  1JKH A;  3TR8 A;  4H4M A;  4FM0 A;  3ASM A;  3QIO A;  2BDP A;  1FKP A;  1GOC A;  1JXB A;  4IFY A;  4CES A;  3QET A;  2PYL A;  4B3O A;  3V9U A;  4KFB A;  3NH0 A;  4IBN A;  1WSG A;  4CF8 A;  3MED A;  2E4L A;  4FJG A;  4QOZ B;  1TGO A;  2D5R A;  1Q9Y A;  3L2V A;  5I42 A;  4I9L A;  1L3V A;  4DF8 A;  1QQC A;  5KRT A;  1RNH A;  2X6N A;  3C6T A;  1B9F A;  4DSE A;  3TAE A;  3WNE A;  2P5G A;  1ZBH A;  2OPR A;  4N56 A;  3TAG A;  4OPK A;  5HRS A;  1YVU A;  1L5U A;  4Z4I A;  4PWD A;  3HP9 A;  3K5N A;  4WE1 A;  4M3R A;  3QNN A;  3AA4 A;  1JLB A;  3DLK A;  4BWJ A;  4CF9 A;  3SI6 A;  4ZHR A;  1HNV A;  3UIQ A;  4W5T A;  1N5Y A;  4J2E A;  4CF1 A;  3ZSZ A;  3CYM A;  4AH9 A;  1L3T A;  1U47 A;  1UOC A;  2Z1H A;  1EP4 A;  1A5W A;  1U48 A;  2Z1G A;  3VQB A;  3KLG A;  4BDZ A;  1VSJ A;  1R0A A;  4ELV A;  2KFZ A;  4CJL A;  3THV A;  3AVN A;  3CFP A;  2G8I A;  1LAV A;  1Z26 A;  2ZE2 A;  4MQ3 A;  4OGC A;  3ZT0 A;  3HXM A;  3MAQ A;  2X78 A;  5CZ1 A;  3TAQ A;  4LSL A;  3BDP A;  1UWB A;  2O4G A;  3NH2 A;  4LY7 A;  4RW4 A;  4KHN A;  4OVL A;  3ZT4 A;  3F73 A;  4C8K A;  4I2Q A;  3V1Q A;  2OPQ A;  4EP5 A;  1BIU A;  1C0T A;  1TKX A;  1BCM A;  4EP4 A;  4ZTF A;  2QK9 A;  3V6D A;  1SL2 A;  1Z25 A;  3OYI A;  2X74 A;  1CXQ A;  1RBV A;  1BIZ A;  4G1Q A;  5T7B A;  1REV A;  1T7P A;  1ZBI A;  1NOY A;  3VQ4 A;  4DQI A;  4DSK A;  1HYS A;  4RW7 A;  4CFB A;  1QSY A;  3LP0 A;  1S6Q A;  4DS4 A;  2WON A;  4FK2 A;  2OA8 A;  4M42 A;  1S1T A;  4KHY A;  1QHT A;  3KLE A;  4KB1 A;  1ZBL A;  1T05 A;  3ZSX A;  1T03 A;  1RBS A;  4FJH A;  3OS1 A;  1NKB A;  2Y1J A;  3OYH A;  3HJF A;  1UAX A;  4CHQ A;  3VQC A;  3OY9 A;  3OYG A;  3DLH A;  3QLH A;  4DTS A;  1NK0 A;  1WAJ A;  4FW1 A;  4K8Z A;  3DI6 A;  2HHQ A;  2VWK A;  2KZM A;  1TKD A;  3KK2 A;  1RBT A;  4CCH A;  4I7F A;  4B9S A;  3QEV A;  2OPS A;  3B6O A;  5DMR A;  4KTQ A;  1S9E A;  3ITH A;  3TAP A;  1MU2 A;  1IH7 A;  2IC3 A;  5KGW A;  4CEC A;  2EX3 A;  4CJU A;  2FBY A;  3OYC A;  2YKM A;  4DTU A;  3PUF A;  3ZSO A;  2X6S A;  5FRN A;  3QEW A;  3AA3 A;  1NOZ A;  1TK5 A;  4F2R A;  4GVM A;  4LH5 A;  3LPU A;  1DTT A;  5KI6 A;  3DLE A;  1WSE A;  4DG1 A;  4FZY A;  2YV0 X;  3SPZ A;  3HO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...