5CR4A

Crystal structure of the sleeping beauty transposase catalytic domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
ARKKPLLQNRHKKARLRFATAHGDKDRTFWRNVLWSDETKIELFGHNDHRYVWRKKGEACKPKNTIPTVKHGGGSIMLWGCFAAGGTGALHKIDGIMDAVQYVDILKQHLKTSVRKLKLGRKWVFQHDNDPKHTSKVVAKWLKDNKVKVLEWPSQSPDLNPIENLWAELKKRVRARRPTNLTQLHQLCQEEWAKIHPNYCGKLVEGYPKRLTQVKQFKGNATKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Sleeping Beauty transposase, SB100X
publication title Sleeping Beauty transposase structure allows rational design of hyperactive variants for genetic engineering.
pubmed doi rcsb
source organism Synthetic construct
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5cr4A00
3K9JA 5HOOA 3K9KA 3HOTA 4MDAA 4MDBA 4U7BA 5CR4A 3F2KA 2F7TA 3HOSA 4R79A
chains in the Genus database with same CATH superfamily
3M8PA 3OYGA 5AQJA 2P9KB 4E0DA 1BUPA 2E5LK 1XMQK 1SAZA 2RF2A 3CG7A 4DSFA 4JK9A 4QS7A 3DWLA 5EX5A 3CM6A 3WXLA 4K8ZA 4A2BA 2A40A 3MX2A 5BR9A 5C25A 3K5OA 3R1XA 3ZETB 3ENHA 3LDLA 4JKCA 1IG8A 4DG1A 4BY9C 4AHUA 3BZKA 2PAVA 3CC7N 1KXPA 4PL7A 4RTFD 3V9UA 3D2FB 3M8SA 4CK1A 3C94A 1KAYA 4XH1A 1I94K 3O3GA 3HJFA 3VMFB 3CQ8A 4DUZK 4BRNA 3L2RA 3PX0A 3UKRB 3KZBA 1BISA 3CMEN 3TAFA 2XY5A 1O13A 4O5FA 1GLAG 4KV8A 3I56N 4CESA 4X64K 4B3SK 3KTQA 1ZBSA 2A6AA 5M1PA 3SUPA 2OPSA 5JVGL 5I42A 4Z4CA 3WUHA 3LDOA 3KWGA 3CJ1A 2NRVA 3ZSOA 3MWTA 1RDWX 4BREA 1W97L 3C6UA 2G8WA 2BANA 3ID8A 5AFUA 2F8TA 2HBJA 4EZ6A 2RKIA 1HUXA 4FW1A 3AGKA 3ZX0A 2BTFA 3ITHA 3NH1A 2HHSA 4M3UA 3C0BA 1Q81O 4ICLA 4B9QA 4DTNA 3AA4A 2YX6A 2V7YA 1FK9A 3ZSWA 1C0FA 4GMJB 1BIZA 2VG6A 4H5VA 3DOKA 1NGCA 1L5UA 1NG9A 5LMNK 3PLAA 4E89A 3AVCA 3L4QA 2F4VK 5AQOA 2QW9A 2D5RA 3DXMB 4W5RA 3JSMA 1F21A 2P1JA 3CQXA 3K57A 5HOOA 3DRSA 1NGIA 4DF4A 4ILJA 4DV2K 2Q3SA 4ZTJA 2NRTA 3OW2M 4FCYA 4DR4K 3BF1A 5HRSA 5AR0A 2IGIA 2P51A 2FBXA 5M1KA 3SUNA 4RW6A 4XH5A 1HQEA 2A3ZA 1ASWA 2YNHA 3HOTA 1KAZA 5LJVA 1WSEA 2IVPA 4FJ5A 3C6AA 1BQNA 3QIPA 1RFQA 3E66A 1GLEG 1K8KB 4BRGA 1J5OA 2P9LA 2V52B 1SKRA 3KVGA 1QHTA 1U2VB 2HNYA 3KWIA 1HR0K 1HNIA 4CFCA 2P5OA 3A5LC 3TR8A 3LP0A 2JWLA 3SAGA 2HSTA 4IFVA 4CZMA 3NH2A 3C65A 2YCHA 3FFKB 1Y64A 3M8RA 2BUPA 2P9SA 1CZ9A 1QQMA 1T6DA 3VF2A 1NK9A 1T05A 3CJ9A 3EZWA 1VQ8N 1Q9YA 1X3MA 1VK0A 1WSFA 5AQMA 4CGFA 4FL9A 3NHGA 4Z4EA 2OTJN 1NMNA 3CCQN 4LF7K 1RT4A 4CZKA 4IXCA 1IO2A 3EEQA 3NE6A 3IDHA 3BP8A 3SV4A 2G8FA 3AA2A 3KK7A 4FXDA 3NBPA 3FZFA 2OZSA 3K5LA 4BC3A 4YOTA 4J2BA 3SMSA 3MX5A 4W5QA 4PHTX 1KFDA 1VQNN 3HRGA 4CGDA 3PIOL 2YHYA 3NFAA 5C24A 4M42A 4KTQA 4R5PA 3M5RA 1DLOA 1QE1A 3TANA 4KI4A 5KPRA 4AILC 3OTOK 2GWJA 3NF8A 1DEJA 3ENOA 4DV1K 1SUQA 4JI7K 5C10A 1N36K 1GLLO 2ZE2A 1LWEA 3V81A 2HVHA 4CZIA 1JLCA 3TSPA 1NGHA 4MO5A 3VENA 5C0YA 2VG5A 4CFDA 2KKZA 1IKXA 1SV5A 4CVNE 4MLHA 1HKCA 4EAHD 1RGIA 2WC9A 2HHVA 3CCUN 3AO1A 1JLAA 1QQOA 3B6OA 4ZHRA 3V9ZA 4LH5A 1IG9A 1C0TA 2J4RA 3K9JA 2KFNA 3Q7CA 1JXBA 3SYZA 2ZJRL 3J8AA 5CE3A 3KLEA 3THXB 1OKJA 5AZIB 1RT1A 4JI6K 1N33K 4HUEA 4B1WB 1VSLA 4IO9L 5M1QA 3E9PA 1JLFA 4CI6A 2NZTA 4X65K 5H1SQ 3J7ZO 3VA3A 4QOZB 2X6SA 4CF0A 1WAJA 4CJ4A 4DTSA 4F2RA 3HBTA 3QNOA 3ZSYA 4BR9A 1U49A 1LAVA 3U4LA 3RMAA 5AZJB 3D2EB 4FJXA 3P83D 3CIPA 3O9QA 5KI6A 2G8IA 2OPRA 4B08A 1JL2A 3ULEA 3SAFA 1HMVA 3CC4N 4C8LA 1C1AA 2HHTA 2HBKA 3EO3A 1S6PA 3CFRA 2DPNA 4NYFA 4JKHA 3QINA 2O8DA 4OGCA 2DFHA 2O8CB 2P9NA 2PFUA 3M1FA 5T7BA 5ELZA 5KRSA 3CI5A 1VQ4N 4IOAL 4FVMA 1K73O 3THVA 1S9GA 4CIGA 3FR0A 4RG8A 1JCFA 1S1WA 3KLIA 3OJUA 4YDUC 4DQ8A 2HMIA 2QWRA 4DLGA 3P1GA 3AO3A 2RPIA 4FLVA 4OLBA 2IS3A 3QEVA 3E9OA 3ZSQA 3KD5E 1JXEA 1TKDA 4BRMA 4KHNA 4A59A 1DKGD 2OANA 5BPMA 2IVNA 5HLFA 3KKRA 5E26A 1V4SA 4WQ4C 2QEXN 3G71N 3I55N 1L3SA 3A2FA 1WLJA 3O9RA 4A5BA 1KVBA 3SMPA 5BN8A 1JCGA 4DSJA 3UIQA 4WE1A 1CZAN 3L2QA 4K43A 3DMJA 5E41A 1OH7A 4DR1K 3HI0A 4IBNA 4BDYA 1LW0A 1NK7A 3IG1A 4M3XA 2ZJPL 2HF4A 4FYDA 3C7NA 4GV9A 1X1PA 1VSDA 4M3TA 3FFIA 2ZGYA 5FPNA 4ELTA 4H5NA 2Z1HA 5BR8K 4MO4A 1QSSA 4J2DA 3WXKA 4RWTA 3AY9A 4RW9A 4O44A 3HZ6A 2JGUA 1UA1A 1NJWA 2D0PA 1Q18A 5ADXH 4KB0A 2IIRA 3O80A 3D6RA 1QZ6A 1ESVA 3VQ8A 5JVHL 3VQAA 1VSIA 5FPEA 4GNIA 4MLEA 2F7TA 1HYVA 3MN5A 4Z94A 4CJQA 3VEXA 5SWMA 3CMAN 3TAQA 1A5XA 4DMNA 3HSTB 3O1WA 3QETA 3THWA 4CJKA 1RTHA 3ASMA 2OYQA 4IO8A 4B1YB 3THYA 4CZHA 3TAPA 3AAQA 1RBTA 2FSNA 4IWVA 4YDUA 5EVZA 1NK0A 3NVKA 3L3UA 1HYSA 1BI4A 4B3MK 4A62A 1QZ5A 2ZQBA 3UB5A 4AM6A 3JAMO 2GUPA 3IFRA 3HVRA 3CHWA 1Z05A 3OYJA 4F4KA 2Z1IA 3CC2N 4DR7K 3AVGA 3OHRA 3ZYYX 2Y1JA 4ISFA 2AP1A 2X78A 4DTUA 4JI8K 1NJYA 4WQ4A 3AGRA 1NNEA 2X74A 4MQ3A 3CJCA 4DSLA 2UUAK 3RRHA 1BO5O 5BREA 1QVFM 2P9PB 4EFHA 4DV5K 5HRRA 3PX4A 3A5OC 3VEZA 1VSFA 3I8DA 4LF8K 3FE1A 2P5GA 5FPMA 1MWKA 3U9DA 3U3YA 1RT7A 3AAPA 3FZLA 3TARA 1EXQA 2F96A 1KC8O 1J53A 1HNXK 2ZF5O 1HYZA 4HCCA 1VRUA 2UUCK 2E2QA 2QWLA 5CZ2A 4NXNK 4GVMA 4JKAA 3QEWA 4DTXA 4B9TA 5K14A 5BRHA 3J81O 1RTDA 4N76A 3OYEA 4JKGB 1W2BM 3VQDA 3LDSA 2NRHA 2W40A 3LAMA 3SPYA 3WEEB 5AQGA 4CEBA 2PYLA 1OVQA 2E4LA 2FSJA 4FWQA 1P8ZA 1H1VA 4FM1A 3I0SA 2P9KA 4CZJA 2QK9A 1RDAA 1HLUA 4NCGA 3P39A 4CGIA 4C8MA 4IDHA 4LF6K 1NGDA 4W5NA 2JWKA 3AVIA 4CJ3A 4OPKA 1YVNA 2QI2A 2G8KA 3IRXA 4FK2A 3ZT0A 3R3LA 3ZETA 4C23A 3NVMA 4M41A 2VYPA 4GV6A 2QTDA 3VEVA 1A5WA 1KD1O 4HTUA 3LPTA 3QMLA 2I7NA 5AQWA 2ZJQL 2VQFK 2LSNA 4CE9A 4Y1DA 1RT2A 4BDZA 5CZ1A 5C15A 4BVOA 3RTVA 1ZYQA 2KW4A 4PY5A 2KZMA 3BZCA 1LWCA 3K2PA 1LWFA 1N8RO 4HCBA 3CCMN 1NK6A 3UKRA 1YJNN 2F8SA 1GLDG 4LFBK 3L6QA 1NU0A 3D45A 4KH5A 1RTIA 3M3ZA 1HJRA 4FPBA 3CCJN 1X9WA 4FJJA 2UXDK 3TU5A 2DFFA 4YNQA 3A8YA 3OA9A 3F5TA 3ZT2A 4EHUA 4Y1CA 3VGLA 3KLFA 2IAJA 3IMXA 2VWKA 4FJ9A 1ZC6A 1TV6A 1A5VA 3WNGA 2FXUA 4KHPK 2IVOA 1WNSA 3BY5A 3EY1A 3QLHA 4FLZA 4DFMA 4WFBL 4ELUA 3B8AX 2O4IA 3EKSA 4KI6A 3FZMA 2PBDA 1N5YA 4QAGA 3RMCA 2PYJA 4DR3K 1KFSA 3SV3A 3D7EO 3R8EA 4G1QA 5LMUK 4CEQA 1NJZA 3HO1A 1TK5A 2YNIA 4B3RK 4GY2B 3CM5A 1BA0A 4B1VA 3O4NA 4B9VA 4J2AA 2VWBA 5E84A 3VTIA 4MFBA 3TSQA 3DLRA 4BGAA 2AA4A 1YAGA 3DXMA 4CJ7A 3TSUA 1U04A 4EIAA 4DSKA 5KQDA 3BDPA 2Y1IA 4IG0A 3DRPA 1HRHA 3T19A 5DM7L 4BRKA 3RWUA 3V4IA 1GLBG 1LW2A 3A0IX 2Z1GA 3HM8A 3ZX3A 4BQLA 2AJQA 3KHYA 4FZXC 3AVJA 3HSCA 2X6NA 1NGGA 1OH6A 4U67L 1U6ZA 4ISEA 5IWAK 4E7LA 1SL2A 1TK8A 2E88A 5KGWA 5I9EB 3SI6A 3H3NO 1XUPO 1NGBA 1TUUA 3N4PA 4FLTA 5FRMA 4BG8A 3ZSZA 2OA8A 1K8KA 1EWRA 3OS1A 3HPOA 1YF5L 4FK4A 3EZ5A 5C2DA 1U2VA 4H0VB 4DWIA 4IFYA 3RMBA 1C1CA 3CJ7A 3V1RA 2ZM6K 1P90A 5F0XA 1BOTO 3AO4A 2P9UB 3LPUA 4A57A 2W6LA 5LY3A 3QICA 4BGBA 1XNRK 4FJNA 3AV9A 3CERA 3CETA 1TKTA 2BE2A 4KBOA 2XY7A 1EETA 3CJBA 4FOEA 5GADP 4FZZA 1R0AA 4FJIA 1VHXA 3MEGA 1B9DA 1CZBA 3O9TA 1IKYA 4JK7A 5M1NA 4HWIA 1Z25A 3VQ4A 3O4WA 4C1NK 2ASPA 3AVBA 3H3OB 4DTRA 3LALA 1VSKA 1J54A 2V7ZA 3VF4A 1GLCG 3K9KA 4BR2A 4XIUA 3KLGA 2IC3A 4E7JA 3O8MA 1QSLA 3DLHA 2O8FB 4LFCK 4FLUA 4PA1A 4FJLA 3K5MA 4DV3K 4XH4A 4B9SA 4DB3A 1XQSC 3TAGA 2ASMA 1NLVA 3FZKA 3AA3A 3OYLA 2KTQA 3LDQA 4JLHA 2H3GX 1IBLK 2HHHK 1UOCA 2QWPA 2YJEA 3HTVA 1VSHA 2GTDA 3G10A 2BGGA 4BC5A 4HHTA 3TTDA 1ZXOA 2NRWA 3MN7A 4I2PA 1CLQA 4KH4A 4NCAA 4CK3A 3G25A 1ITGA 4H5TA 5ADXA 4ILGB 5AQYA 4QS9A 2Q97A 1NGAA 5C12A 5GAGP 3KIOA 1S1UA 3LDNA 3NMUA 3PO4A 4M3YA 4AHTA 1SKWA 4WQ5C 3D0PA 3OYBA 4E7HA 1YTAA 3WQTA 4A61A 3FGUA 4M3ZA 3HP9A 2OZMA 3EKUA 3O9SA 5KQ8A 3C6HA 4BE0A 2GBZA 1U47A 3O08A 4A2AA 5HBMA 1C1BA 4M63C 3MN9A 3NGYA 2XY8A 3CF5L 2DTUA 4NB4A 4WYBA 3R9PA 1QQNA 3AVLA 3LAKA 3RRGA 2KLAA 3THXA 2RN2A 3NF9A 5AZIA 4JV5K 4KRFA 2UXBK 2RHKA 4FPAA 1VSJA 2IDOA 3L0QA 4PKIA 1KLNA 4IZ9A 1LV5A 1EO1A 3ZSXA 4CIEA 1RT3A 4JD2A 5EOYA 1HX1A 1BG3A 3HXMA 3EN9A 3SLCA 3QFUA 4I9LA 1ASVA 4B9UA 4FWSA 5AZJA 4Z4IA 2EHGA 3D2EA 1S1TA 1NMDA 2ASOA 3QEPA 4GKKK 1T7PA 4AHVA 1DT9A 1LAWA 1QS4A 1N34K 2QWMA 4M7YA 2HHUA 1KTQA 2HW3A 5CYQA 4CECA 4K25A 1RT5A 5DM6L 3L3VA 4I6MB 3NDKA 4OLAA 1BA1A 2O8CA 4F8RA 3KKSA 1MWMA 1BCOA 3VQQA 1Q8IA 4FK0A 4CZFA 5KPZA 5JICA 2YHXA 1TGOA 4F3TA 1S6QA 4CBXA 2HB5A 3T3FA 2A5XA 3N4QA 4JI0K 1GLFO 1C0UA 4KTWA 4WQ5A 3HT3A 2QXFA 1FJGK 1K8AO 4JD2B 4LY7A 5IT9O 3VQ6A 3OVNA 5CY4A 1KVAA 4JKFA 4KHWA 1HPMA 1WOQA 4OPHA 3WXJA 3OYFA 1VAZA 1KLMA 1NGEA 2QWNA 1NK8A 1QHAA 2KZZA 4JS5A 5C2FA 4DV4K 5AFUH 5AQQA 4M3RA 3U3GA 3LZJA 3T1AA 3S9HA 1TKXA 4NLCA 3UE5A 1WUAA 1ZBUA 4B3TK 3NH0A 5CYMA 1S9EA 4F3OA 1MDUB 2HBLA 1T8EA 3F73A 4HTLA 3LP2A 2V51B 3G6EN 2Q31A 4AHCA 1VQ5N 4Z4GA 3OBWA 4Z4HA 3IS9A 1D9FA 1VQ6N 2D4WA 4O8KA 5GINA 3MN6A 4E1MA 4Q0BA 4B3OA 2RE2A 1NM1A 1TAQA 1YT3A 2Q0UA 5TKYA 1OH8A 2O8EA 4CEFA 1L3UA 3WNFA 1IH7A 4IFEA 4W5TA 2OCEA 3S41A 3EL2A 4FJMA 4JNEA 4A5AA 4LD0A 4FJKA 4RW7A 4CEOA 1NGFA 5FRNA 4WFAL 3J7AP 1WBBA 4CJSA 2G8UA 2Q0RA 1ASUA 2XHBA 4CZEA 3SAHA 3IAYA 1Y97A 4BRCA 2FBYA 4KKOA 5D3GA 1C6VA 3O1BA 4OO1J 3K0SA 1NOZA 3LM9A 3LWMA 4JRPA 5FPDA 3C6TA 3QFPA 4BQZA 2FF3B 2OPPA 1C0MA 2D1KA 3DLLL 1CXQA 4KB1A 4DR6K 4CHOA 4JI2K 3VF6A 1WN7A 2E8AA 3KK2A 1KRPA 4XEIA 4DFPA 1KVCA 3TABA 5CHIA 2ATQA 2I5JA 2O8EB 4JRQA 1BQMA 2OPQA 2P9PA 5BRDA 1YJ9N 4CF1A 5M1FA 2FBTA 4FLXA 1CXUA 1TYQB 3MECA 4CGJA 1BWFO 4BRQA 3KD1E 1HJOA 4M7XA 5JLFA 3SZ2A 3MCPA 3J80O 4BC4A 3GBTA 4FM0A 4CEAA 1JLGA 3S3NA 3SJHA 4CJWA 4FWPA 5J2MA 2UUBK 5AQSA 4H8KA 3QNNA 4PQUA 2HHWA 4CF9A 4JYAK 2FC0A 3BEXA 3A5NC 4ISGA 2E1YA 1SKSA 4BROA 4ELVA 3S3OA 3VQBA 2VGNA 4JKGA 3J7YP 1BL3A 2NRZA 2WFBA 1VQ7N 2WTUA 2HHQA 1HPZA 4AM7A 1NKCA 4K41A 3WEEA 3SPZA 3SCXA 4KTZA 1U45A 3KK1A 4L3QA 3S3MA 4FWKA 2YV0X 3LL3A 3M8QA 3ZSRA 4E19A 1Z26A 4CZLA 4FSVA 3F9MA 3V9XA 1S5JA 1VQON 1IBMK 1TUYA 2CH5A 3H1QA 4JHDB 4BR4A 3BUZB 1ATSA 4ID5A 1XMOK 2B4JA 4W5OA 3PV8A 1T03A 5BPLA 4X66K 2D0OA 3DXKA 4FJHA 4JKEA 4JI5K 5KRTA 3V9SA 3LWLA 1FKPA 3AVKA 3KJVA 1HKBA 3RSEA 3WQUA 3K59A 3O4QA 4J2EA 2YNFA 1T6CA 5DK5A 2WOMA 5DMRA 3VQ9A 2NNWA 3JYTA 4BVPA 2UXCK 5AQLA 4JS4A 1UAXA 3CCEN 2YHAA 3CCVN 1JL1A 3W0LA 4CJEA 1NK4A 1SS6A 2I7PA 4GV3A 4YY3K 1BDGA 1ZBFA 1WBDA 4DCHA 4CF8A 4X62K 2BDPA 2G8HA 4N5SA 3QEIA 3C95A 4MDAA 3L2UA 4AQYK 2VQEK 5AJ3K 4FJ7A 4DQQA 1X9SA 3OS2A 2YKNA 4BWJA 2E2PA 2P9IB 3V1QA 4Y0WA 3K5NA 3NAEA 3DXKB 3VGKA 3CD6N 4C1NI 4FWOA 3RSEB 3QBWA 4DUYK 3VETA 2KFZA 1JKHA 1XC9A 1U48A 3OYNA 4CJ5A 1C0GA 1RBUA 2W42A 3ALYA 4YHHK 3H46O 2CGKA 4C8NA 4HUFA 4FWLA 2BH1A 1WSHA 4N47A 5AQFA 5KGXA 4H0OA 2DY4A 4FLWA 5MLCQ 3QB0A 4H0TB 2ITGA 3O9UA 5C42A 5GIOA 4O55A 5AQXA 3OS0A 3VEOA 3T7ZA 3VQ7A 2WONA 5FDLA 3SUQA 4DU1A 4NXMK 1VQPN 4BR5A 3AVNA 4JKBA 3I33A 3VEWA 3DLKA 3ZCMA 1L3TA 3CCRN 3SQ4A 1W7AA 5SZTA 1XHXA 2UYTA 1NJXA 1M1KO 3MXJA 1IV0A 1RDUA 2ITMA 1S1VA 4JI1K 3O3FA 5J2QA 3CQYA 3KLHA 2QKBA 3U6FA 1IBKK 2F9WA 4DLEA 3MEEA 3DYAA 3L2VA 2PY5A 3MXIA 3T69A 3ID6A 2GELA 1I3AA 3PSIA 4EZ9A 1WSGA 1BHLA 1MA9B 5FLXO 4CFAA 4H4OA 3VQCA 1DTTA 4DV0K 5HROA 4KHYA 1RT6A 4AF1A 2D0BA 4EP4A 4DU4A 1NKEA 1J6ZA 3LANA 1QQCA 2QWOA 5A2QO 2E6LA 4HUGA 1ILYA 2P9UA 4OX9K 3ULDA 1HQUA 4CEDA 3MWPA 1G99A 2KQ2A 3WXIA 1JLEA 4FJGA 4M3WA 1S22A 4LSNA 4CJPA 3KK3A 4G9ZA 2E2NA 1E3MA 1LOTB 4KHQA 5M1OA 4BRAA 3NGZA 2FSKA 3I8BA 2GV9A 1IJJA 5BN9A 1XNQK 3SNNA 3DI6A 4R79A 1TK0A 2VG7A 5EY4A 3O5BA 4BRHA 1TL3A 5I3UA 1GOCA 2O8FA 1N6QA 1GOAA 3H45C 1T3VA 4CEEA 1YTUA 1TKZA 2YNGA 2ETJA 4LFAK 1NWKA 1IKVA 2YJFA 4IOXA 3DRRA 4CHPA 5AQIA 5LJWA 4U7BA 1YITN 2E2OA 5J2NA 4TSXA 3SQ1A 3HYFA 1X9JA 2FBVA 1ZBIA 3F2KA 1NOYA 3TPQA 2QWQA 4H03B 4RCHA 3BF3A 4YORA 4YOYA 2HNDA 4CD1A 4FWRA 1K6YA 3JS6A 4CGHA 4BDPA 1G15A 4OGEA 2R7YA 2DFEA 1WB9A 3O3HA 4LF5K 4B9LA 4K0KK 3IKMA 3B6PA 1D8YA 3R6MA 3TAMA 2EX3A 3GDQA 3GE1A 2HNZA 2YHBA 3I0RA 3E9LA 2GWKA 3MDQA 2ZD1A 3V9WA 1NGJA 3OYAA 4F9OA 3EE8A 3NCIA 1RTJA 4O0IA 2HBMA 5BRFA 3CFPA 4EHTA 5AQTA 4PWDA 2CH6A 4C8KA 3AO5A 4BE2A 4HVJA 3WNHA 4DS5A 4YOUA 4OKJA 3VPZA 4OJRA 4DSIA 2Q2RA 3CYMA 1HNVA 4H0PA 1JJ2M 3AVHA 4JN4A 1RDBA 1I39A 2FF6A 3QERA 2GUIA 1D9DA 4BRDA 3ZT4A 4CHNA 2XY6A 4PL8A 3TWHA 4BC2A 2EWSA 4LF4K 5HP1A 3OYKA 1VSEA 1UWBA 4GKJK 1MU2A 3RR8A 3UKUA 2Q36A 4DKWA 1ZBLA 1KSPA 4AH9A 2E20A 1V4TA 1RILA 2GEMA 3L2WA 5CR4A 2QA4N 1JLBA 4NO7A 4FOIA 4OKKA 1T44A 1OVYA 1VRTA 1NK5A 4BWMA 1SL1A 4N41A 3P38A 3DJCA 1N32K 4RW8A 1XC3A 1Q86O 1EP4A 1BIUA 3LM2A 2A41A 4CBWA 4IJNA 2IOCA 4YFUA 3VQ5A 2ZGZA 4E1JA 1SQKA 3PUFA 4H0XB 3G4SN 2JLEA 4DHYA 1GLJO 1RDDA 4I6MA 3U9ZA 4IKFA 4F2SA 4KFBA 4CHZA 1DGKN 1X3NA 2B6AA 4BRLA 3OYIA 2P9LB 3AVAA 4UY8O 3HM9A 4BE1A 4LF9K 4QS8A 3QEXA 5AQHA 4H4MA 3K58A 3RR7A 3V1OA 4MDBA 2NLXA 3UKUB 4UQGA 2P9SB 3DAWA 3MMVA 1TVRA 4CD3A 4DFJA 4DQSA 1Q7YO 1YJWN 4Q5VA 3MXMA 1FW6A 1VSMA 3VERA 4O0JA 4DF8A 2CGLA 4KREA 2ZWHA 4B8AB 3FLCO 3F9KA 3OYCA 3SJJA 3P31A 1VQKN 4KPYA 2XRIA 4I7FA 3HP6A 5JS1A 2O4GA 2HHXA 4DQRA 4O8UA 3ENBA 3GOIA 1RCHA 3SBGA 2HVIA 5BPNA 1R59O 5AQUA 4E3SA 3DOLA 5EU7A 1RBRA 3ATVA 2W41A 3LP1A 4KO0A 1YI2N 4ZTFA 3VESA 1J5EK 4CGGA 1L3VA 2GX9A 1FKOA 3PX6A 4LC9B 4YOVA 4DSEA 3MEDA 3ZSVA 3A5MC 4CJUA 2YKMA 4H5WA 2QKKA 1WSIA 4IG3A 3T1YK 4BRPA 5GAEP 4DTPA 2QXLA 3H1VX 4IEEA 3U8XA 4GW6A 4J8FA 4FJ8A 1QTMA 4B1UB 4DQPA 4I9QA 1FXXA 2UU9K 3T1HK 3SBTA 1OH5A 3G0ZA 2Q1NA 2NUBA 4BACA 1KAXA 3AA5X 4IJAA 3AO2A 4DTOA 5JMVA 2FLOA 1JLQA 2HOEA 2VCPA 5AQKA 3DM2A 4I2QA 4BG9A 1HNWK 4EP5A 5J2PA 2G8VA 3PO5A 3RMDA 3Q7BA 2WUSA 3ZT1A 4L8RB 4K8XA 1YUWA 5TKWA 1XI1A 4WFNL 5HRNA 3MK6A 5EXWA 1W9HA 3OY9A 1GOBA 4WF9L 2OTLN 5LL6Z 1BGXT 2HF3A 3QBXA 4PUOA 3CPEA 1RBSA 3WT0A 2KHOA 2A1RA 3QDKA 2A1SA 2NRXA 1WAFA 4FO0A 2WBNA 4B1ZA 2Z1JA 4JKDA 1J9AA 3PY8A 4WCEL 1YXQA 1RBVA 3EE9A 3EYZA 1IKWA 2PZSA 1BU6O 3LDPA 3OYDA 1TYQA 1ZBHA 1YVUA 1LCUA 1EX4A 5KPTA 5AQNA 3CJAA 3ZX2A 1JCEA 3GL1A 4C8OA 1X9MA 1BCMA 1EKEA 3ULEB 4CBUA 3M6GA 1NBWA 4OKEA 3TAEA 1K9MO 1EQYA 1HKGA 3QIOA 2O8DB 5B8HA 2P9NB 3VTHA 1YIJN 3VOVA 4PKHA 4BR7A 4JK8A 4JAXA 4GVEA 3H6EA 3LP3A 5HL7L 3DLGA 3VA0A 3AARA 1D5AA 4JEPA 1UA0A 4CF2A 3JXUA 4NLBA 5F2RA 4OPAA 1SL0A 5AQPA 4B8CA 4CJFA 1S3XA 4Z4FA 1O1WA 1U4BA 4JHDA 5FROA 3MCAB 3NGIA 4H0YB 4CW7B 2D0AA 3ZLJA 1QSYA 1TL1A 1Q82O 4DTJA 3O6WA 5AQRA 4YOXA 2E6MA 3ZEUA 1ATNA 3HL8A 1NKBA 3TI0A 1TAUA 5HRPA 4BR0A 3CCLN 1B92A 4E7IA 2NRRA 3HPGA 3QO9A 3CCSN 2O8BA 3IUCA 2W6KA 3QESA 4E1NA 1WSJA 3C7NB 4CJRA 4CCHA 4AHRA 4ILHA 3DLEA 4B9MA 4RW4A 5AQVA 2YHWA 4DS4A 1B9FA 3L4IA 4IDKA 4H5RA 3P5JA 2F9TA 4DTMA 4FWMA 1ATRA 4M45A 4CHYA 4CJLA 4OVLA 3PSFA 5F1XA 4CERA 4NYNA 4DFKA 1QVGM 4ID1A 1RDCA 4YOWA 1YHQN 4BRFA 2P9IA 4OPJA 3CXCM 4CEZA 4JI3K 3TTCA 3OYMA 1VQMN 4E7KA 3HOSA 3ZEUB 3THWB 3WNEA 2E1ZA 1RNHA 3CFOA 4LH4A 4FW2A 1REVA 1S72N 3P4IA 3L8BA 3HPHA 3THYB 4LSLA 1E4GT 4IEIA 4V19S 3OYHA 1S1XA 2O8BB 3GG4A 4Z0UA 2D0CA 1BI4B 4KHUA 4BRIA 1KQSM 3NF7A 3SK3A 4CIFA 3SUOA 3AVMA 4QCLA 4O5BA 3CPWM 3SQ2A 3OBYA 1SZ2A 5GIPA 4K42A 3WXMB 2HMPA 4FVUA 5KTQA 1NJIO 2VWJA 3TTFA 1VQ9N 3LZIA 5AQZA 3OJSA 1E4FT 3HK2A 3W3DA 2A42A 3H08A 4DU3A 3HVTA 4DR2K 4JI4K 5JLHA 3DLBA 3VEYA 4PKGA 1M90O 4FZYA 4B1XB 3SQ0A 3E01A 5JS2A 4DV6K 4DV7K 3VN5A 4DR5K 1D4XA 2QM1A 1XWLA 4FM2A 4AHSA 4CFBA 2XO7A 3VGMA 3FZHA 3E1YA 3BGRA 1Z6RA 3V6DA 2VGMA 5GAHP 1Q9XA 2YI1A 4KH6A 5J1EA 1KCFA 4N56A 3RVCA 1DTQA 4IOCL 2CGJA 3MAQA 4KAZA 4CJTA 4B9NA 2B5JA 3D2FA 4CK2A 1EWQA 3ISNC 3PIPL 4FWNA 4DQIA 4KHSA 4CZGA 4CJVA 1XHZA 1VQLN 3AVFA 3ATUA 3VQPA 3VQEA 4O4GA 3ZT3A 4CHQA 1HNZK 3NF6A 4NCBA 1W0HA 4FLYA
chains in the Genus database with same CATH topology
3MDQA 4CBXA 4IO8A 2A5XA 3N4QA 5AQJA 4B1YB 1GLFO 1NGJA 2P9KB 1BUPA 4CZHA 4F9OA 3EE8A 1SAZA 3AAQA 4WQ5A 2FSNA 4IWVA 4YDUA 1K8AO 4JD2B 4JK9A 5EVZA 2HBMA 4QS7A 3NVKA 5BRFA 4EHTA 3DWLA 5AQTA 2CH6A 5EX5A 1QZ5A 4A62A 4JKFA 3UB5A 1HPMA 3WXLA 1WOQA 4A2BA 2A40A 3MX2A 4AM6A 4YOUA 3VPZA 2GUPA 3IFRA 2Q2RA 4H0PA 5BR9A 1JJ2M 3R1XA 4OPHA 3ZETB 3CHWA 4JN4A 3WXJA 1Z05A 3ENHA 1VAZA 2FF6A 3LDLA 4BRDA 1NGEA 4JKCA 1IG8A 2QWNA 1QHAA 3CC2N 5C2FA 4BY9C 5AFUH 3OHRA 5AQQA 3ZYYX 4PL8A 4BC2A 2EWSA 2PAVA 4ISFA 2AP1A 3CC7N 4WQ4A 4NLCA 3AGRA 1KXPA 3UE5A 4PL7A 3CJCA 1WUAA 4RTFD 1BO5O 5BREA 3D2FB 3UKUA 2Q36A 4DKWA 1QVFM 2P9PB 4EFHA 1MDUB 1KAYA 1V4TA 2E20A 2GEMA 4XH1A 2HBLA 5CR4A 3A5OC 3VMFB 2QA4N 4BRNA 3VEZA 4HTLA 3FE1A 4NO7A 2V51B 4FOIA 3KZBA 3UKRB 3G6EN 3CMEN 5FPMA 1T44A 1O13A 1OVYA 2Q31A 4O5FA 1GLAG 1MWKA 1VQ5N 3U9DA 3AAPA 3P38A 3I56N 3DJCA 3FZLA 1KC8O 1XC3A 1Q86O 3OBWA 1VQ6N 2D4WA 3LM2A 4O8KA 2A41A 5GINA 2ZF5O 1ZBSA 2A6AA 3MN6A 4IJNA 4CBWA 5M1PA 2E2QA 2ZGZA 2QWLA 4E1JA 1SQKA 4H0XB 5JVGL 4JKAA 3G4SN 4DHYA 1GLJO 4I6MA 2RE2A 1NM1A 2Q0UA 5TKYA 3U9ZA 3WUHA 3LDOA 3KWGA 5BRHA 1DGKN 1X3NA 3CJ1A 4BRLA 2P9LB 4IFEA 2NRVA 4UY8O 3MWTA 1RDWX 4JKGB 4BREA 1W97L 3S41A 1W2BM 2NRHA 2W40A 4QS8A 3EL2A 3ID8A 5AFUA 5AQHA 3WEEB 5AQGA 4JNEA 2HBJA 2FSJA 4FWQA 4A5AA 1HUXA 1P8ZA 1H1VA 1NGFA 2P9KA 3AGKA 3ZX0A 4CZJA 4WFAL 4MDBA 2BTFA 2NLXA 3UKUB 1HLUA 3P39A 3C0BA 2P9SB 3DAWA 3MMVA 1Q81O 4CD3A 4B9QA 2Q0RA 4IDHA 1NGDA 2YX6A 2V7YA 4CZEA 1Q7YO 2JWKA 3SAHA 1YJWN 4BRCA 1C0FA 1YVNA 2QI2A 3O1BA 4OO1J 4H5VA 3VERA 1NGCA 3LM9A 2CGLA 3R3LA 5FPDA 2ZWHA 3ZETA 4C23A 3QFPA 4BQZA 3PLAA 3FLCO 2FF3B 3NVMA 2D1KA 3DLLL 3L4QA 5AQOA 2QW9A 3P31A 1VQKN 3VF6A 2E8AA 3DXMB 2VYPA 4XEIA 4GV6A 2QTDA 3VEVA 4O8UA 3CQXA 3ENBA 3GOIA 1KD1O 5HOOA 1NGIA 3SBGA 4ILJA 3QMLA 5CHIA 2I7NA 5AQWA 2ZJQL 5BPNA 1R59O 2P9PA 5AQUA 2NRTA 5BRDA 3OW2M 1YJ9N 5C15A 4BVOA 5M1FA 3BF1A 5AR0A 3ATVA 2W41A 1YI2N 1N8RO 3CCMN 3UKRA 3VESA 1YJNN 1TYQB 1GLDG 5M1KA 1BWFO 2GX9A 4XH5A 4BRQA 3L6QA 1HJOA 4M7XA 4LC9B 4KH5A 5JLFA 4YOVA 3MCPA 3M3ZA 2A3ZA 4BC4A 3A5MC 3GBTA 4FPBA 4H5WA 3CCJN 3SJHA 3TU5A 4BRPA 2QXLA 5GAEP 3H1VX 4IEEA 4FWPA 3A8YA 3U8XA 3HOTA 4J8FA 5AQSA 3OA9A 1KAZA 3F5TA 5LJVA 2IVPA 4EHUA 3VGLA 4B1UB 3C6AA 3IMXA 3BEXA 4ISGA 3A5NC 3SBTA 1RFQA 3E66A 1GLEG 2E1YA 1K8KB 4BRGA 2Q1NA 4BROA 1KAXA 2P9LA 2V52B 2VGNA 1ZC6A 3KVGA 4IJAA 4JKGA 1VQ7N 2NRZA 2WFBA 1U2VB 5JMVA 2FLOA 4AM7A 4K41A 2HOEA 3WEEA 2FXUA 2VCPA 3KWIA 2IVOA 3A5LC 5AQKA 4WFBL 3B8AX 2JWLA 4L3QA 4BG9A 3SAGA 2HSTA 3EKSA 4CZMA 3FZMA 4FWKA 2PBDA 2YCHA 3C65A 1Y64A 3FFKB 2BUPA 2P9SA 1QQMA 1T6DA 3LL3A 3Q7BA 3VF2A 2WUSA 1YUWA 3CJ9A 4CZLA 5TKWA 3D7EO 3EZWA 3R8EA 1VQ8N 4FSVA 3F9MA 4WFNL 3MK6A 5EXWA 1X3MA 1VQON 4WF9L 2OTLN 5AQMA 4GY2B 1TUYA 2CH5A 1BA0A 2HF3A 3QBXA 3H1QA 4FL9A 4B1VA 3CPEA 2OTJN 4JHDB 2VWBA 3BUZB 5E84A 2KHOA 3VTIA 1ATSA 3WT0A 3TSQA 4BR4A 3CCQN 4BGAA 3QDKA 2AA4A 4CZKA 4IXCA 1YAGA 3DXMA 4CJ7A 3TSUA 4EIAA 5BPLA 5KQDA 2D0OA 2NRXA 4FO0A 3DXKA 3IDHA 4JKEA 2WBNA 3BP8A 4B1ZA 4JKDA 5DM7L 1HKBA 3KK7A 3FZFA 3RSEA 3WQUA 4BRKA 4WCEL 1YXQA 3EE9A 4BC3A 1GLBG 4YOTA 3A0IX 1T6CA 3SMSA 3HM8A 3ZX3A 4BQLA 2NNWA 3MX5A 1BU6O 3KHYA 3LDPA 3HSCA 1TYQA 4PHTX 1NGGA 4U67L 1LCUA 1U6ZA 4ISEA 4BVPA 1VQNN 5AQLA 3HRGA 3PIOL 2YHYA 3CCEN 3CCVN 3W0LA 2E88A 5I9EB 5KPTA 5AQNA 1SS6A 2I7PA 3M5RA 4GV3A 3CJAA 3ZX2A 1JCEA 3GL1A 1BDGA 5KPRA 3ULEB 3H3NO 1XUPO 1NGBA 2GWJA 4CBUA 3M6GA 1TUUA 1DEJA 3N4PA 3ENOA 1NBWA 1K9MO 4BG8A 4DCHA 1EQYA 1K8KA 1HKGA 1YF5L 4MDAA 5C10A 1GLLO 5C2DA 1U2VA 5B8HA 4H0VB 2P9NB 3VTHA 1YIJN 3VOVA 4PKHA 4BR7A 4CZIA 3CJ7A 2E2PA 2P9IB 4JK8A 4Y0WA 4JAXA 4GVEA 3TSPA 1NGHA 3DXKB 4MO5A 1P90A 3VENA 3H6EA 5F0XA 5C0YA 1BOTO 5HL7L 3VGKA 2P9UB 3CD6N 4C1NI 3AARA 4A57A 2KKZA 4FWOA 3RSEB 3QBWA 5LY3A 3VETA 3QICA 4BGBA 4JEPA 3CERA 3JXUA 3CETA 1C0GA 4NLBA 4KBOA 4MLHA 1HKCA 5F2RA 3H46O 4EAHD 2CGKA 4OPAA 1RGIA 3CJBA 2WC9A 4FWLA 4FOEA 2BH1A 1S3XA 5AQPA 5GADP 3CCUN 5AQFA 4H0OA 3O9TA 5MLCQ 3QB0A 1QQOA 4H0TB 4JK7A 3MCAB 4HWIA 4JHDA 5M1NA 4H0YB 3O9UA 5GIOA 2J4RA 3K9JA 3O4WA 4C1NK 3Q7CA 5AQXA 1Q82O 2ASPA 3H3OB 3O6WA 3T7ZA 3VEOA 5AQRA 2ZJRL 3J8AA 4YOXA 3VF4A 2V7ZA 1GLCG 5CE3A 3K9KA 4BR2A 3ZEUA 1VQPN 1OKJA 4BR5A 5AZIB 3O8MA 1ATNA 4B1WB 4IO9L 4JKBA 3I33A 3VEWA 4XH4A 5M1QA 4BR0A 3CCLN 3E9PA 4DB3A 1XQSC 3CCRN 2ASMA 1NLVA 3FZKA 2NRRA 4CI6A 2NZTA 3CCSN 2UYTA 3IUCA 1M1KO 5H1SQ 3J7ZO 3LDQA 3C7NB 2H3GX 3HBTA 1RDUA 2ITMA 2QWPA 4ILHA 2YJEA 3HTVA 4BR9A 3CQYA 3U4LA 2GTDA 5AZJB 3D2EB 2F9WA 4BC5A 3CIPA 3TTDA 1ZXOA 2NRWA 3O9QA 3MN7A 3ULEA 5AQVA 4KH4A 3SAFA 2YHWA 3CC4N 3T69A 3ID6A 3L4IA 4H5RA 2GELA 2F9TA 2HBKA 3EO3A 1MA9B 2DPNA 3G25A 4FWMA 1ATRA 4H5TA 4JKHA 5ADXA 4ILGB 5F1XA 5AQYA 1QVGM 4QS9A 4AF1A 2P9NA 2PFUA 2Q97A 1NGAA 3M1FA 4YOWA 5ELZA 1YHQN 4BRFA 2P9IA 3CI5A 3CXCM 1J6ZA 5C12A 5GAGP 1VQ4N 4IOAL 1K73O 3TTCA 1VQMN 2QWOA 3HOSA 1ILYA 3FR0A 3ZEUB 3LDNA 2P9UA 3NMUA 2E1ZA 1JCFA 4WQ5C 4YDUC 4DQ8A 1S72N 3MWPA 3P4IA 1G99A 3WXIA 2QWRA 3WQTA 1E4GT 4IEIA 4A61A 3FGUA 1S22A 3GG4A 4G9ZA 3EKUA 3O9SA 5KQ8A 3E9OA 2E2NA 3C6HA 1LOTB 3O08A 5M1OA 4A2AA 4BRAA 4BRIA 2FSKA 1KQSM 3I8BA 4BRMA 4M63C 1IJJA 5BN9A 3SK3A 4A59A 1DKGD 3MN9A 2OANA 5BPMA 4R79A 3CF5L 2IVNA 3CPWM 4NB4A 3OBYA 4WYBA 5EY4A 1SZ2A 5E26A 1QQNA 1V4SA 4WQ4C 3R9PA 5GIPA 3O5BA 2QEXN 4BRHA 2KLAA 3I55N 3G71N 5AZIA 4K42A 3WXMB 2HMPA 2RHKA 4FPAA 3O9RA 4A5BA 1NJIO 4FVUA 3SMPA 3TTFA 5BN8A 1VQ9N 1JCGA 3H45C 1CZAN 3L0QA 4K43A 5AQZA 4PKIA 4IZ9A 1E4FT 3W3DA 2A42A 1EO1A 1T3VA 3HI0A 4JD2A 5JLHA 3VEYA 5EOYA 4PKGA 2HF4A 2ZJPL 1M90O 1HX1A 1NWKA 3C7NA 4GV9A 1BG3A 2YJFA 4IOXA 4B1XB 5AQIA 2ZGYA 3EN9A 3SLCA 5LJWA 4U7BA 1YITN 2E2OA 5FPNA 3QFUA 4FWSA 5AZJA 4H5NA 3D2EA 1D4XA 4MO4A 3WXKA 2QM1A 4RWTA 1X9JA 3F2KA 3AY9A 1NMDA 3TPQA 3FZHA 3E1YA 3VGMA 1Z6RA 2QWQA 3HZ6A 2ASOA 3BF3A 4H03B 4RCHA 4YORA 4YOYA 1DT9A 2VGMA 5GAHP 2QWMA 4FWRA 4M7YA 2YI1A 2D0PA 4CD1A 4KH6A 4IOCL 3RVCA 1Q18A 3JS6A 2CGJA 2IIRA 5ADXH 3O80A 3D6RA 1QZ6A 1ESVA 4K25A 5DM6L 4I6MB 5JVHL 1BA1A 3D2FA 3IKMA 5FPEA 4GNIA 3R6MA 4MLEA 3PIPL 4FWNA 2F7TA 3GDQA 3GE1A 3MN5A 4Z94A 1MWMA 3VEXA 4CZGA 3CMAN 1VQLN 3ATUA 4CZFA 5KPZA 3O1WA 5JICA 3E9LA 2YHXA 2GWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9J A;  5HOO A;  3K9K A;  3HOT A;  4MDA A;  4MDB A;  4U7B A;  5CR4 A;  3F2K A;  2F7T A;  3HOS A;  4R79 A; 
#chains in the Genus database with same CATH topology
 3M8P A;  3OYG A;  5AQJ A;  2P9K B;  4E0D A;  1BUP A;  2E5L K;  1XMQ K;  1SAZ A;  2RF2 A;  3CG7 A;  4DSF A;  4JK9 A;  4QS7 A;  3DWL A;  5EX5 A;  3CM6 A;  3WXL A;  4K8Z A;  4A2B A;  2A40 A;  3MX2 A;  5BR9 A;  5C25 A;  3K5O A;  3R1X A;  3ZET B;  3ENH A;  3LDL A;  4JKC A;  1IG8 A;  4DG1 A;  4BY9 C;  4AHU A;  3BZK A;  2PAV A;  3CC7 N;  1KXP A;  4PL7 A;  4RTF D;  3V9U A;  3D2F B;  3M8S A;  4CK1 A;  3C94 A;  1KAY A;  4XH1 A;  1I94 K;  3O3G A;  3HJF A;  3VMF B;  3CQ8 A;  4DUZ K;  4BRN A;  3L2R A;  3PX0 A;  3UKR B;  3KZB A;  1BIS A;  3CME N;  3TAF A;  2XY5 A;  1O13 A;  4O5F A;  1GLA G;  4KV8 A;  3I56 N;  4CES A;  4X64 K;  4B3S K;  3KTQ A;  1ZBS A;  2A6A A;  5M1P A;  3SUP A;  2OPS A;  5JVG L;  5I42 A;  4Z4C A;  3WUH A;  3LDO A;  3KWG A;  3CJ1 A;  2NRV A;  3ZSO A;  3MWT A;  1RDW X;  4BRE A;  1W97 L;  3C6U A;  2G8W A;  2BAN A;  3ID8 A;  5AFU A;  2F8T A;  2HBJ A;  4EZ6 A;  2RKI A;  1HUX A;  4FW1 A;  3AGK A;  3ZX0 A;  2BTF A;  3ITH A;  3NH1 A;  2HHS A;  4M3U A;  3C0B A;  1Q81 O;  4ICL A;  4B9Q A;  4DTN A;  3AA4 A;  2YX6 A;  2V7Y A;  1FK9 A;  3ZSW A;  1C0F A;  4GMJ B;  1BIZ A;  2VG6 A;  4H5V A;  3DOK A;  1NGC A;  1L5U A;  1NG9 A;  5LMN K;  3PLA A;  4E89 A;  3AVC A;  3L4Q A;  2F4V K;  5AQO A;  2QW9 A;  2D5R A;  3DXM B;  4W5R A;  3JSM A;  1F21 A;  2P1J A;  3CQX A;  3K57 A;  5HOO A;  3DRS A;  1NGI A;  4DF4 A;  4ILJ A;  4DV2 K;  2Q3S A;  4ZTJ A;  2NRT A;  3OW2 M;  4FCY A;  4DR4 K;  3BF1 A;  5HRS A;  5AR0 A;  2IGI A;  2P51 A;  2FBX A;  5M1K A;  3SUN A;  4RW6 A;  4XH5 A;  1HQE A;  2A3Z A;  1ASW A;  2YNH A;  3HOT A;  1KAZ A;  5LJV A;  1WSE A;  2IVP A;  4FJ5 A;  3C6A A;  1BQN A;  3QIP A;  1RFQ A;  3E66 A;  1GLE G;  1K8K B;  4BRG A;  1J5O A;  2P9L A;  2V52 B;  1SKR A;  3KVG A;  1QHT A;  1U2V B;  2HNY A;  3KWI A;  1HR0 K;  1HNI A;  4CFC A;  2P5O A;  3A5L C;  3TR8 A;  3LP0 A;  2JWL A;  3SAG A;  2HST A;  4IFV A;  4CZM A;  3NH2 A;  3C65 A;  2YCH A;  3FFK B;  1Y64 A;  3M8R A;  2BUP A;  2P9S A;  1CZ9 A;  1QQM A;  1T6D A;  3VF2 A;  1NK9 A;  1T05 A;  3CJ9 A;  3EZW A;  1VQ8 N;  1Q9Y A;  1X3M A;  1VK0 A;  1WSF A;  5AQM A;  4CGF A;  4FL9 A;  3NHG A;  4Z4E A;  2OTJ N;  1NMN A;  3CCQ N;  4LF7 K;  1RT4 A;  4CZK A;  4IXC A;  1IO2 A;  3EEQ A;  3NE6 A;  3IDH A;  3BP8 A;  3SV4 A;  2G8F A;  3AA2 A;  3KK7 A;  4FXD A;  3NBP A;  3FZF A;  2OZS A;  3K5L A;  4BC3 A;  4YOT A;  4J2B A;  3SMS A;  3MX5 A;  4W5Q A;  4PHT X;  1KFD A;  1VQN N;  3HRG A;  4CGD A;  3PIO L;  2YHY A;  3NFA A;  5C24 A;  4M42 A;  4KTQ A;  4R5P A;  3M5R A;  1DLO A;  1QE1 A;  3TAN A;  4KI4 A;  5KPR A;  4AIL C;  3OTO K;  2GWJ A;  3NF8 A;  1DEJ A;  3ENO A;  4DV1 K;  1SUQ A;  4JI7 K;  5C10 A;  1N36 K;  1GLL O;  2ZE2 A;  1LWE A;  3V81 A;  2HVH A;  4CZI A;  1JLC A;  3TSP A;  1NGH A;  4MO5 A;  3VEN A;  5C0Y A;  2VG5 A;  4CFD A;  2KKZ A;  1IKX A;  1SV5 A;  4CVN E;  4MLH A;  1HKC A;  4EAH D;  1RGI A;  2WC9 A;  2HHV A;  3CCU N;  3AO1 A;  1JLA A;  1QQO A;  3B6O A;  4ZHR A;  3V9Z A;  4LH5 A;  1IG9 A;  1C0T A;  2J4R A;  3K9J A;  2KFN A;  3Q7C A;  1JXB A;  3SYZ A;  2ZJR L;  3J8A A;  5CE3 A;  3KLE A;  3THX B;  1OKJ A;  5AZI B;  1RT1 A;  4JI6 K;  1N33 K;  4HUE A;  4B1W B;  1VSL A;  4IO9 L;  5M1Q A;  3E9P A;  1JLF A;  4CI6 A;  2NZT A;  4X65 K;  5H1S Q;  3J7Z O;  3VA3 A;  4QOZ B;  2X6S A;  4CF0 A;  1WAJ A;  4CJ4 A;  4DTS A;  4F2R A;  3HBT A;  3QNO A;  3ZSY A;  4BR9 A;  1U49 A;  1LAV A;  3U4L A;  3RMA A;  5AZJ B;  3D2E B;  4FJX A;  3P83 D;  3CIP A;  3O9Q A;  5KI6 A;  2G8I A;  2OPR A;  4B08 A;  1JL2 A;  3ULE A;  3SAF A;  1HMV A;  3CC4 N;  4C8L A;  1C1A A;  2HHT A;  2HBK A;  3EO3 A;  1S6P A;  3CFR A;  2DPN A;  4NYF A;  4JKH A;  3QIN A;  2O8D A;  4OGC A;  2DFH A;  2O8C B;  2P9N A;  2PFU A;  3M1F A;  5T7B A;  5ELZ A;  5KRS A;  3CI5 A;  1VQ4 N;  4IOA L;  4FVM A;  1K73 O;  3THV A;  1S9G A;  4CIG A;  3FR0 A;  4RG8 A;  1JCF A;  1S1W A;  3KLI A;  3OJU A;  4YDU C;  4DQ8 A;  2HMI A;  2QWR A;  4DLG A;  3P1G A;  3AO3 A;  2RPI A;  4FLV A;  4OLB A;  2IS3 A;  3QEV A;  3E9O A;  3ZSQ A;  3KD5 E;  1JXE A;  1TKD A;  4BRM A;  4KHN A;  4A59 A;  1DKG D;  2OAN A;  5BPM A;  2IVN A;  5HLF A;  3KKR A;  5E26 A;  1V4S A;  4WQ4 C;  2QEX N;  3G71 N;  3I55 N;  1L3S A;  3A2F A;  1WLJ A;  3O9R A;  4A5B A;  1KVB A;  3SMP A;  5BN8 A;  1JCG A;  4DSJ A;  3UIQ A;  4WE1 A;  1CZA N;  3L2Q A;  4K43 A;  3DMJ A;  5E41 A;  1OH7 A;  4DR1 K;  3HI0 A;  4IBN A;  4BDY A;  1LW0 A;  1NK7 A;  3IG1 A;  4M3X A;  2ZJP L;  2HF4 A;  4FYD A;  3C7N A;  4GV9 A;  1X1P A;  1VSD A;  4M3T A;  3FFI A;  2ZGY A;  5FPN A;  4ELT A;  4H5N A;  2Z1H A;  5BR8 K;  4MO4 A;  1QSS A;  4J2D A;  3WXK A;  4RWT A;  3AY9 A;  4RW9 A;  4O44 A;  3HZ6 A;  2JGU A;  1UA1 A;  1NJW A;  2D0P A;  1Q18 A;  5ADX H;  4KB0 A;  2IIR A;  3O80 A;  3D6R A;  1QZ6 A;  1ESV A;  3VQ8 A;  5JVH L;  3VQA A;  1VSI A;  5FPE A;  4GNI A;  4MLE A;  2F7T A;  1HYV A;  3MN5 A;  4Z94 A;  4CJQ A;  3VEX A;  5SWM A;  3CMA N;  3TAQ A;  1A5X A;  4DMN A;  3HST B;  3O1W A;  3QET A;  3THW A;  4CJK A;  1RTH A;  3ASM A;  2OYQ A;  4IO8 A;  4B1Y B;  3THY A;  4CZH A;  3TAP A;  3AAQ A;  1RBT A;  2FSN A;  4IWV A;  4YDU A;  5EVZ A;  1NK0 A;  3NVK A;  3L3U A;  1HYS A;  1BI4 A;  4B3M K;  4A62 A;  1QZ5 A;  2ZQB A;  3UB5 A;  4AM6 A;  3JAM O;  2GUP A;  3IFR A;  3HVR A;  3CHW A;  1Z05 A;  3OYJ A;  4F4K A;  2Z1I A;  3CC2 N;  4DR7 K;  3AVG A;  3OHR A;  3ZYY X;  2Y1J A;  4ISF A;  2AP1 A;  2X78 A;  4DTU A;  4JI8 K;  1NJY A;  4WQ4 A;  3AGR A;  1NNE A;  2X74 A;  4MQ3 A;  3CJC A;  4DSL A;  2UUA K;  3RRH A;  1BO5 O;  5BRE A;  1QVF M;  2P9P B;  4EFH A;  4DV5 K;  5HRR A;  3PX4 A;  3A5O C;  3VEZ A;  1VSF A;  3I8D A;  4LF8 K;  3FE1 A;  2P5G A;  5FPM A;  1MWK A;  3U9D A;  3U3Y A;  1RT7 A;  3AAP A;  3FZL A;  3TAR A;  1EXQ A;  2F96 A;  1KC8 O;  1J53 A;  1HNX K;  2ZF5 O;  1HYZ A;  4HCC A;  1VRU A;  2UUC K;  2E2Q A;  2QWL A;  5CZ2 A;  4NXN K;  4GVM A;  4JKA A;  3QEW A;  4DTX A;  4B9T A;  5K14 A;  5BRH A;  3J81 O;  1RTD A;  4N76 A;  3OYE A;  4JKG B;  1W2B M;  3VQD A;  3LDS A;  2NRH A;  2W40 A;  3LAM A;  3SPY A;  3WEE B;  5AQG A;  4CEB A;  2PYL A;  1OVQ A;  2E4L A;  2FSJ A;  4FWQ A;  1P8Z A;  1H1V A;  4FM1 A;  3I0S A;  2P9K A;  4CZJ A;  2QK9 A;  1RDA A;  1HLU A;  4NCG A;  3P39 A;  4CGI A;  4C8M A;  4IDH A;  4LF6 K;  1NGD A;  4W5N A;  2JWK A;  3AVI A;  4CJ3 A;  4OPK A;  1YVN A;  2QI2 A;  2G8K A;  3IRX A;  4FK2 A;  3ZT0 A;  3R3L A;  3ZET A;  4C23 A;  3NVM A;  4M41 A;  2VYP A;  4GV6 A;  2QTD A;  3VEV A;  1A5W A;  1KD1 O;  4HTU A;  3LPT A;  3QML A;  2I7N A;  5AQW A;  2ZJQ L;  2VQF K;  2LSN A;  4CE9 A;  4Y1D A;  1RT2 A;  4BDZ A;  5CZ1 A;  5C15 A;  4BVO A;  3RTV A;  1ZYQ A;  2KW4 A;  4PY5 A;  2KZM A;  3BZC A;  1LWC A;  3K2P A;  1LWF A;  1N8R O;  4HCB A;  3CCM N;  1NK6 A;  3UKR A;  1YJN N;  2F8S A;  1GLD G;  4LFB K;  3L6Q A;  1NU0 A;  3D45 A;  4KH5 A;  1RTI A;  3M3Z A;  1HJR A;  4FPB A;  3CCJ N;  1X9W A;  4FJJ A;  2UXD K;  3TU5 A;  2DFF A;  4YNQ A;  3A8Y A;  3OA9 A;  3F5T A;  3ZT2 A;  4EHU A;  4Y1C A;  3VGL A;  3KLF A;  2IAJ A;  3IMX A;  2VWK A;  4FJ9 A;  1ZC6 A;  1TV6 A;  1A5V A;  3WNG A;  2FXU A;  4KHP K;  2IVO A;  1WNS A;  3BY5 A;  3EY1 A;  3QLH A;  4FLZ A;  4DFM A;  4WFB L;  4ELU A;  3B8A X;  2O4I A;  3EKS A;  4KI6 A;  3FZM A;  2PBD A;  1N5Y A;  4QAG A;  3RMC A;  2PYJ A;  4DR3 K;  1KFS A;  3SV3 A;  3D7E O;  3R8E A;  4G1Q A;  5LMU K;  4CEQ A;  1NJZ A;  3HO1 A;  1TK5 A;  2YNI A;  4B3R K;  4GY2 B;  3CM5 A;  1BA0 A;  4B1V A;  3O4N A;  4B9V A;  4J2A A;  2VWB A;  5E84 A;  3VTI A;  4MFB A;  3TSQ A;  3DLR A;  4BGA A;  2AA4 A;  1YAG A;  3DXM A;  4CJ7 A;  3TSU A;  1U04 A;  4EIA A;  4DSK A;  5KQD A;  3BDP A;  2Y1I A;  4IG0 A;  3DRP A;  1HRH A;  3T19 A;  5DM7 L;  4BRK A;  3RWU A;  3V4I A;  1GLB G;  1LW2 A;  3A0I X;  2Z1G A;  3HM8 A;  3ZX3 A;  4BQL A;  2AJQ A;  3KHY A;  4FZX C;  3AVJ A;  3HSC A;  2X6N A;  1NGG A;  1OH6 A;  4U67 L;  1U6Z A;  4ISE A;  5IWA K;  4E7L A;  1SL2 A;  1TK8 A;  2E88 A;  5KGW A;  5I9E B;  3SI6 A;  3H3N O;  1XUP O;  1NGB A;  1TUU A;  3N4P A;  4FLT A;  5FRM A;  4BG8 A;  3ZSZ A;  2OA8 A;  1K8K A;  1EWR A;  3OS1 A;  3HPO A;  1YF5 L;  4FK4 A;  3EZ5 A;  5C2D A;  1U2V A;  4H0V B;  4DWI A;  4IFY A;  3RMB A;  1C1C A;  3CJ7 A;  3V1R A;  2ZM6 K;  1P90 A;  5F0X A;  1BOT O;  3AO4 A;  2P9U B;  3LPU A;  4A57 A;  2W6L A;  5LY3 A;  3QIC A;  4BGB A;  1XNR K;  4FJN A;  3AV9 A;  3CER A;  3CET A;  1TKT A;  2BE2 A;  4KBO A;  2XY7 A;  1EET A;  3CJB A;  4FOE A;  5GAD P;  4FZZ A;  1R0A A;  4FJI A;  1VHX A;  3MEG A;  1B9D A;  1CZB A;  3O9T A;  1IKY A;  4JK7 A;  5M1N A;  4HWI A;  1Z25 A;  3VQ4 A;  3O4W A;  4C1N K;  2ASP A;  3AVB A;  3H3O B;  4DTR A;  3LAL A;  1VSK A;  1J54 A;  2V7Z A;  3VF4 A;  1GLC G;  3K9K A;  4BR2 A;  4XIU A;  3KLG A;  2IC3 A;  4E7J A;  3O8M A;  1QSL A;  3DLH A;  2O8F B;  4LFC K;  4FLU A;  4PA1 A;  4FJL A;  3K5M A;  4DV3 K;  4XH4 A;  4B9S A;  4DB3 A;  1XQS C;  3TAG A;  2ASM A;  1NLV A;  3FZK A;  3AA3 A;  3OYL A;  2KTQ A;  3LDQ A;  4JLH A;  2H3G X;  1IBL K;  2HHH K;  1UOC A;  2QWP A;  2YJE A;  3HTV A;  1VSH A;  2GTD A;  3G10 A;  2BGG A;  4BC5 A;  4HHT A;  3TTD A;  1ZXO A;  2NRW A;  3MN7 A;  4I2P A;  1CLQ A;  4KH4 A;  4NCA A;  4CK3 A;  3G25 A;  1ITG A;  4H5T A;  5ADX A;  4ILG B;  5AQY A;  4QS9 A;  2Q97 A;  1NGA A;  5C12 A;  5GAG P;  3KIO A;  1S1U A;  3LDN A;  3NMU A;  3PO4 A;  4M3Y A;  4AHT A;  1SKW A;  4WQ5 C;  3D0P A;  3OYB A;  4E7H A;  1YTA A;  3WQT A;  4A61 A;  3FGU A;  4M3Z A;  3HP9 A;  2OZM A;  3EKU A;  3O9S A;  5KQ8 A;  3C6H A;  4BE0 A;  2GBZ A;  1U47 A;  3O08 A;  4A2A A;  5HBM A;  1C1B A;  4M63 C;  3MN9 A;  3NGY A;  2XY8 A;  3CF5 L;  2DTU A;  4NB4 A;  4WYB A;  3R9P A;  1QQN A;  3AVL A;  3LAK A;  3RRG A;  2KLA A;  3THX A;  2RN2 A;  3NF9 A;  5AZI A;  4JV5 K;  4KRF A;  2UXB K;  2RHK A;  4FPA A;  1VSJ A;  2IDO A;  3L0Q A;  4PKI A;  1KLN A;  4IZ9 A;  1LV5 A;  1EO1 A;  3ZSX A;  4CIE A;  1RT3 A;  4JD2 A;  5EOY A;  1HX1 A;  1BG3 A;  3HXM A;  3EN9 A;  3SLC A;  3QFU A;  4I9L A;  1ASV A;  4B9U A;  4FWS A;  5AZJ A;  4Z4I A;  2EHG A;  3D2E A;  1S1T A;  1NMD A;  2ASO A;  3QEP A;  4GKK K;  1T7P A;  4AHV A;  1DT9 A;  1LAW A;  1QS4 A;  1N34 K;  2QWM A;  4M7Y A;  2HHU A;  1KTQ A;  2HW3 A;  5CYQ A;  4CEC A;  4K25 A;  1RT5 A;  5DM6 L;  3L3V A;  4I6M B;  3NDK A;  4OLA A;  1BA1 A;  2O8C A;  4F8R A;  3KKS A;  1MWM A;  1BCO A;  3VQQ A;  1Q8I A;  4FK0 A;  4CZF A;  5KPZ A;  5JIC A;  2YHX A;  1TGO A;  4F3T A;  1S6Q A;  4CBX A;  2HB5 A;  3T3F A;  2A5X A;  3N4Q A;  4JI0 K;  1GLF O;  1C0U A;  4KTW A;  4WQ5 A;  3HT3 A;  2QXF A;  1FJG K;  1K8A O;  4JD2 B;  4LY7 A;  5IT9 O;  3VQ6 A;  3OVN A;  5CY4 A;  1KVA A;  4JKF A;  4KHW A;  1HPM A;  1WOQ A;  4OPH A;  3WXJ A;  3OYF A;  1VAZ A;  1KLM A;  1NGE A;  2QWN A;  1NK8 A;  1QHA A;  2KZZ A;  4JS5 A;  5C2F A;  4DV4 K;  5AFU H;  5AQQ A;  4M3R A;  3U3G A;  3LZJ A;  3T1A A;  3S9H A;  1TKX A;  4NLC A;  3UE5 A;  1WUA A;  1ZBU A;  4B3T K;  3NH0 A;  5CYM A;  1S9E A;  4F3O A;  1MDU B;  2HBL A;  1T8E A;  3F73 A;  4HTL A;  3LP2 A;  2V51 B;  3G6E N;  2Q31 A;  4AHC A;  1VQ5 N;  4Z4G A;  3OBW A;  4Z4H A;  3IS9 A;  1D9F A;  1VQ6 N;  2D4W A;  4O8K A;  5GIN A;  3MN6 A;  4E1M A;  4Q0B A;  4B3O A;  2RE2 A;  1NM1 A;  1TAQ A;  1YT3 A;  2Q0U A;  5TKY A;  1OH8 A;  2O8E A;  4CEF A;  1L3U A;  3WNF A;  1IH7 A;  4IFE A;  4W5T A;  2OCE A;  3S41 A;  3EL2 A;  4FJM A;  4JNE A;  4A5A A;  4LD0 A;  4FJK A;  4RW7 A;  4CEO A;  1NGF A;  5FRN A;  4WFA L;  3J7A P;  1WBB A;  4CJS A;  2G8U A;  2Q0R A;  1ASU A;  2XHB A;  4CZE A;  3SAH A;  3IAY A;  1Y97 A;  4BRC A;  2FBY A;  4KKO A;  5D3G A;  1C6V A;  3O1B A;  4OO1 J;  3K0S A;  1NOZ A;  3LM9 A;  3LWM A;  4JRP A;  5FPD A;  3C6T A;  3QFP A;  4BQZ A;  2FF3 B;  2OPP A;  1C0M A;  2D1K A;  3DLL L;  1CXQ A;  4KB1 A;  4DR6 K;  4CHO A;  4JI2 K;  3VF6 A;  1WN7 A;  2E8A A;  3KK2 A;  1KRP A;  4XEI A;  4DFP A;  1KVC A;  3TAB A;  5CHI A;  2ATQ A;  2I5J A;  2O8E B;  4JRQ A;  1BQM A;  2OPQ A;  2P9P A;  5BRD A;  1YJ9 N;  4CF1 A;  5M1F A;  2FBT A;  4FLX A;  1CXU A;  1TYQ B;  3MEC A;  4CGJ A;  1BWF O;  4BRQ A;  3KD1 E;  1HJO A;  4M7X A;  5JLF A;  3SZ2 A;  3MCP A;  3J80 O;  4BC4 A;  3GBT A;  4FM0 A;  4CEA A;  1JLG A;  3S3N A;  3SJH A;  4CJW A;  4FWP A;  5J2M A;  2UUB K;  5AQS A;  4H8K A;  3QNN A;  4PQU A;  2HHW A;  4CF9 A;  4JYA K;  2FC0 A;  3BEX A;  3A5N C;  4ISG A;  2E1Y A;  1SKS A;  4BRO A;  4ELV A;  3S3O A;  3VQB A;  2VGN A;  4JKG A;  3J7Y P;  1BL3 A;  2NRZ A;  2WFB A;  1VQ7 N;  2WTU A;  2HHQ A;  1HPZ A;  4AM7 A;  1NKC A;  4K41 A;  3WEE A;  3SPZ A;  3SCX A;  4KTZ A;  1U45 A;  3KK1 A;  4L3Q A;  3S3M A;  4FWK A;  2YV0 X;  3LL3 A;  3M8Q A;  3ZSR A;  4E19 A;  1Z26 A;  4CZL A;  4FSV A;  3F9M A;  3V9X A;  1S5J A;  1VQO N;  1IBM K;  1TUY A;  2CH5 A;  3H1Q A;  4JHD B;  4BR4 A;  3BUZ B;  1ATS A;  4ID5 A;  1XMO K;  2B4J A;  4W5O A;  3PV8 A;  1T03 A;  5BPL A;  4X66 K;  2D0O A;  3DXK A;  4FJH A;  4JKE A;  4JI5 K;  5KRT A;  3V9S A;  3LWL A;  1FKP A;  3AVK A;  3KJV A;  1HKB A;  3RSE A;  3WQU A;  3K59 A;  3O4Q A;  4J2E A;  2YNF A;  1T6C A;  5DK5 A;  2WOM A;  5DMR A;  3VQ9 A;  2NNW A;  3JYT A;  4BVP A;  2UXC K;  5AQL A;  4JS4 A;  1UAX A;  3CCE N;  2YHA A;  3CCV N;  1JL1 A;  3W0L A;  4CJE A;  1NK4 A;  1SS6 A;  2I7P A;  4GV3 A;  4YY3 K;  1BDG A;  1ZBF A;  1WBD A;  4DCH A;  4CF8 A;  4X62 K;  2BDP A;  2G8H A;  4N5S A;  3QEI A;  3C95 A;  4MDA A;  3L2U A;  4AQY K;  2VQE K;  5AJ3 K;  4FJ7 A;  4DQQ A;  1X9S A;  3OS2 A;  2YKN A;  4BWJ A;  2E2P A;  2P9I B;  3V1Q A;  4Y0W A;  3K5N A;  3NAE A;  3DXK B;  3VGK A;  3CD6 N;  4C1N I;  4FWO A;  3RSE B;  3QBW A;  4DUY K;  3VET A;  2KFZ A;  1JKH A;  1XC9 A;  1U48 A;  3OYN A;  4CJ5 A;  1C0G A;  1RBU A;  2W42 A;  3ALY A;  4YHH K;  3H46 O;  2CGK A;  4C8N A;  4HUF A;  4FWL A;  2BH1 A;  1WSH A;  4N47 A;  5AQF A;  5KGX A;  4H0O A;  2DY4 A;  4FLW A;  5MLC Q;  3QB0 A;  4H0T B;  2ITG A;  3O9U A;  5C42 A;  5GIO A;  4O55 A;  5AQX A;  3OS0 A;  3VEO A;  3T7Z A;  3VQ7 A;  2WON A;  5FDL A;  3SUQ A;  4DU1 A;  4NXM K;  1VQP N;  4BR5 A;  3AVN A;  4JKB A;  3I33 A;  3VEW A;  3DLK A;  3ZCM A;  1L3T A;  3CCR N;  3SQ4 A;  1W7A A;  5SZT A;  1XHX A;  2UYT A;  1NJX A;  1M1K O;  3MXJ A;  1IV0 A;  1RDU A;  2ITM A;  1S1V A;  4JI1 K;  3O3F A;  5J2Q A;  3CQY A;  3KLH A;  2QKB A;  3U6F A;  1IBK K;  2F9W A;  4DLE A;  3MEE A;  3DYA A;  3L2V A;  2PY5 A;  3MXI A;  3T69 A;  3ID6 A;  2GEL A;  1I3A A;  3PSI A;  4EZ9 A;  1WSG A;  1BHL A;  1MA9 B;  5FLX O;  4CFA A;  4H4O A;  3VQC A;  1DTT A;  4DV0 K;  5HRO A;  4KHY A;  1RT6 A;  4AF1 A;  2D0B A;  4EP4 A;  4DU4 A;  1NKE A;  1J6Z A;  3LAN A;  1QQC A;  2QWO A;  5A2Q O;  2E6L A;  4HUG A;  1ILY A;  2P9U A;  4OX9 K;  3ULD A;  1HQU A;  4CED A;  3MWP A;  1G99 A;  2KQ2 A;  3WXI A;  1JLE A;  4FJG A;  4M3W A;  1S22 A;  4LSN A;  4CJP A;  3KK3 A;  4G9Z A;  2E2N A;  1E3M A;  1LOT B;  4KHQ A;  5M1O A;  4BRA A;  3NGZ A;  2FSK A;  3I8B A;  2GV9 A;  1IJJ A;  5BN9 A;  1XNQ K;  3SNN A;  3DI6 A;  4R79 A;  1TK0 A;  2VG7 A;  5EY4 A;  3O5B A;  4BRH A;  1TL3 A;  5I3U A;  1GOC A;  2O8F A;  1N6Q A;  1GOA A;  3H45 C;  1T3V A;  4CEE A;  1YTU A;  1TKZ A;  2YNG A;  2ETJ A;  4LFA K;  1NWK A;  1IKV A;  2YJF A;  4IOX A;  3DRR A;  4CHP A;  5AQI A;  5LJW A;  4U7B A;  1YIT N;  2E2O A;  5J2N A;  4TSX A;  3SQ1 A;  3HYF A;  1X9J A;  2FBV A;  1ZBI A;  3F2K A;  1NOY A;  3TPQ A;  2QWQ A;  4H03 B;  4RCH A;  3BF3 A;  4YOR A;  4YOY A;  2HND A;  4CD1 A;  4FWR A;  1K6Y A;  3JS6 A;  4CGH A;  4BDP A;  1G15 A;  4OGE A;  2R7Y A;  2DFE A;  1WB9 A;  3O3H A;  4LF5 K;  4B9L A;  4K0K K;  3IKM A;  3B6P A;  1D8Y A;  3R6M A;  3TAM A;  2EX3 A;  3GDQ A;  3GE1 A;  2HNZ A;  2YHB A;  3I0R A;  3E9L A;  2GWK A;  3MDQ A;  2ZD1 A;  3V9W A;  1NGJ A;  3OYA A;  4F9O A;  3EE8 A;  3NCI A;  1RTJ A;  4O0I A;  2HBM A;  5BRF A;  3CFP A;  4EHT A;  5AQT A;  4PWD A;  2CH6 A;  4C8K A;  3AO5 A;  4BE2 A;  4HVJ A;  3WNH A;  4DS5 A;  4YOU A;  4OKJ A;  3VPZ A;  4OJR A;  4DSI A;  2Q2R A;  3CYM A;  1HNV A;  4H0P A;  1JJ2 M;  3AVH A;  4JN4 A;  1RDB A;  1I39 A;  2FF6 A;  3QER A;  2GUI A;  1D9D A;  4BRD A;  3ZT4 A;  4CHN A;  2XY6 A;  4PL8 A;  3TWH A;  4BC2 A;  2EWS A;  4LF4 K;  5HP1 A;  3OYK A;  1VSE A;  1UWB A;  4GKJ K;  1MU2 A;  3RR8 A;  3UKU A;  2Q36 A;  4DKW A;  1ZBL A;  1KSP A;  4AH9 A;  2E20 A;  1V4T A;  1RIL A;  2GEM A;  3L2W A;  5CR4 A;  2QA4 N;  1JLB A;  4NO7 A;  4FOI A;  4OKK A;  1T44 A;  1OVY A;  1VRT A;  1NK5 A;  4BWM A;  1SL1 A;  4N41 A;  3P38 A;  3DJC A;  1N32 K;  4RW8 A;  1XC3 A;  1Q86 O;  1EP4 A;  1BIU A;  3LM2 A;  2A41 A;  4CBW A;  4IJN A;  2IOC A;  4YFU A;  3VQ5 A;  2ZGZ A;  4E1J A;  1SQK A;  3PUF A;  4H0X B;  3G4S N;  2JLE A;  4DHY A;  1GLJ O;  1RDD A;  4I6M A;  3U9Z A;  4IKF A;  4F2S A;  4KFB A;  4CHZ A;  1DGK N;  1X3N A;  2B6A A;  4BRL A;  3OYI A;  2P9L B;  3AVA A;  4UY8 O;  3HM9 A;  4BE1 A;  4LF9 K;  4QS8 A;  3QEX A;  5AQH A;  4H4M A;  3K58 A;  3RR7 A;  3V1O A;  4MDB A;  2NLX A;  3UKU B;  4UQG A;  2P9S B;  3DAW A;  3MMV A;  1TVR A;  4CD3 A;  4DFJ A;  4DQS A;  1Q7Y O;  1YJW N;  4Q5V A;  3MXM A;  1FW6 A;  1VSM A;  3VER A;  4O0J A;  4DF8 A;  2CGL A;  4KRE A;  2ZWH A;  4B8A B;  3FLC O;  3F9K A;  3OYC A;  3SJJ A;  3P31 A;  1VQK N;  4KPY A;  2XRI A;  4I7F A;  3HP6 A;  5JS1 A;  2O4G A;  2HHX A;  4DQR A;  4O8U A;  3ENB A;  3GOI A;  1RCH A;  3SBG A;  2HVI A;  5BPN A;  1R59 O;  5AQU A;  4E3S A;  3DOL A;  5EU7 A;  1RBR A;  3ATV A;  2W41 A;  3LP1 A;  4KO0 A;  1YI2 N;  4ZTF A;  3VES A;  1J5E K;  4CGG A;  1L3V A;  2GX9 A;  1FKO A;  3PX6 A;  4LC9 B;  4YOV A;  4DSE A;  3MED A;  3ZSV A;  3A5M C;  4CJU A;  2YKM A;  4H5W A;  2QKK A;  1WSI A;  4IG3 A;  3T1Y K;  4BRP A;  5GAE P;  4DTP A;  2QXL A;  3H1V X;  4IEE A;  3U8X A;  4GW6 A;  4J8F A;  4FJ8 A;  1QTM A;  4B1U B;  4DQP A;  4I9Q A;  1FXX A;  2UU9 K;  3T1H K;  3SBT A;  1OH5 A;  3G0Z A;  2Q1N A;  2NUB A;  4BAC A;  1KAX A;  3AA5 X;  4IJA A;  3AO2 A;  4DTO A;  5JMV A;  2FLO A;  1JLQ A;  2HOE A;  2VCP A;  5AQK A;  3DM2 A;  4I2Q A;  4BG9 A;  1HNW K;  4EP5 A;  5J2P A;  2G8V A;  3PO5 A;  3RMD A;  3Q7B A;  2WUS A;  3ZT1 A;  4L8R B;  4K8X A;  1YUW A;  5TKW A;  1XI1 A;  4WFN L;  5HRN A;  3MK6 A;  5EXW A;  1W9H A;  3OY9 A;  1GOB A;  4WF9 L;  2OTL N;  5LL6 Z;  1BGX T;  2HF3 A;  3QBX A;  4PUO A;  3CPE A;  1RBS A;  3WT0 A;  2KHO A;  2A1R A;  3QDK A;  2A1S A;  2NRX A;  1WAF A;  4FO0 A;  2WBN A;  4B1Z A;  2Z1J A;  4JKD A;  1J9A A;  3PY8 A;  4WCE L;  1YXQ A;  1RBV A;  3EE9 A;  3EYZ A;  1IKW A;  2PZS A;  1BU6 O;  3LDP A;  3OYD A;  1TYQ A;  1ZBH A;  1YVU A;  1LCU A;  1EX4 A;  5KPT A;  5AQN A;  3CJA A;  3ZX2 A;  1JCE A;  3GL1 A;  4C8O A;  1X9M A;  1BCM A;  1EKE A;  3ULE B;  4CBU A;  3M6G A;  1NBW A;  4OKE A;  3TAE A;  1K9M O;  1EQY A;  1HKG A;  3QIO A;  2O8D B;  5B8H A;  2P9N B;  3VTH A;  1YIJ N;  3VOV A;  4PKH A;  4BR7 A;  4JK8 A;  4JAX A;  4GVE A;  3H6E A;  3LP3 A;  5HL7 L;  3DLG A;  3VA0 A;  3AAR A;  1D5A A;  4JEP A;  1UA0 A;  4CF2 A;  3JXU A;  4NLB A;  5F2R A;  4OPA A;  1SL0 A;  5AQP A;  4B8C A;  4CJF A;  1S3X A;  4Z4F A;  1O1W A;  1U4B A;  4JHD A;  5FRO A;  3MCA B;  3NGI A;  4H0Y B;  4CW7 B;  2D0A A;  3ZLJ A;  1QSY A;  1TL1 A;  1Q82 O;  4DTJ A;  3O6W A;  5AQR A;  4YOX A;  2E6M A;  3ZEU A;  1ATN A;  3HL8 A;  1NKB A;  3TI0 A;  1TAU A;  5HRP A;  4BR0 A;  3CCL N;  1B92 A;  4E7I A;  2NRR A;  3HPG A;  3QO9 A;  3CCS N;  2O8B A;  3IUC A;  2W6K A;  3QES A;  4E1N A;  1WSJ A;  3C7N B;  4CJR A;  4CCH A;  4AHR A;  4ILH A;  3DLE A;  4B9M A;  4RW4 A;  5AQV A;  2YHW A;  4DS4 A;  1B9F A;  3L4I A;  4IDK A;  4H5R A;  3P5J A;  2F9T A;  4DTM A;  4FWM A;  1ATR A;  4M45 A;  4CHY A;  4CJL A;  4OVL A;  3PSF A;  5F1X A;  4CER A;  4NYN A;  4DFK A;  1QVG M;  4ID1 A;  1RDC A;  4YOW A;  1YHQ N;  4BRF A;  2P9I A;  4OPJ A;  3CXC M;  4CEZ A;  4JI3 K;  3TTC A;  3OYM A;  1VQM N;  4E7K A;  3HOS A;  3ZEU B;  3THW B;  3WNE A;  2E1Z A;  1RNH A;  3CFO A;  4LH4 A;  4FW2 A;  1REV A;  1S72 N;  3P4I A;  3L8B A;  3HPH A;  3THY B;  4LSL A;  1E4G T;  4IEI A;  4V19 S;  3OYH A;  1S1X A;  2O8B B;  3GG4 A;  4Z0U A;  2D0C A;  1BI4 B;  4KHU A;  4BRI A;  1KQS M;  3NF7 A;  3SK3 A;  4CIF A;  3SUO A;  3AVM A;  4QCL A;  4O5B A;  3CPW M;  3SQ2 A;  3OBY A;  1SZ2 A;  5GIP A;  4K42 A;  3WXM B;  2HMP A;  4FVU A;  5KTQ A;  1NJI O;  2VWJ A;  3TTF A;  1VQ9 N;  3LZI A;  5AQZ A;  3OJS A;  1E4F T;  3HK2 A;  3W3D A;  2A42 A;  3H08 A;  4DU3 A;  3HVT A;  4DR2 K;  4JI4 K;  5JLH A;  3DLB A;  3VEY A;  4PKG A;  1M90 O;  4FZY A;  4B1X B;  3SQ0 A;  3E01 A;  5JS2 A;  4DV6 K;  4DV7 K;  3VN5 A;  4DR5 K;  1D4X A;  2QM1 A;  1XWL A;  4FM2 A;  4AHS A;  4CFB A;  2XO7 A;  3VGM A;  3FZH A;  3E1Y A;  3BGR A;  1Z6R A;  3V6D A;  2VGM A;  5GAH P;  1Q9X A;  2YI1 A;  4KH6 A;  5J1E A;  1KCF A;  4N56 A;  3RVC A;  1DTQ A;  4IOC L;  2CGJ A;  3MAQ A;  4KAZ A;  4CJT A;  4B9N A;  2B5J A;  3D2F A;  4CK2 A;  1EWQ A;  3ISN C;  3PIP L;  4FWN A;  4DQI A;  4KHS A;  4CZG A;  4CJV A;  1XHZ A;  1VQL N;  3AVF A;  3ATU A;  3VQP A;  3VQE A;  4O4G A;  3ZT3 A;  4CHQ A;  1HNZ K;  3NF6 A;  4NCB A;  1W0H A;  4FLY A; 
#chains in the Genus database with same CATH homology
 3MDQ A;  4CBX A;  4IO8 A;  2A5X A;  3N4Q A;  5AQJ A;  4B1Y B;  1GLF O;  1NGJ A;  2P9K B;  1BUP A;  4CZH A;  4F9O A;  3EE8 A;  1SAZ A;  3AAQ A;  4WQ5 A;  2FSN A;  4IWV A;  4YDU A;  1K8A O;  4JD2 B;  4JK9 A;  5EVZ A;  2HBM A;  4QS7 A;  3NVK A;  5BRF A;  4EHT A;  3DWL A;  5AQT A;  2CH6 A;  5EX5 A;  1QZ5 A;  4A62 A;  4JKF A;  3UB5 A;  1HPM A;  3WXL A;  1WOQ A;  4A2B A;  2A40 A;  3MX2 A;  4AM6 A;  4YOU A;  3VPZ A;  2GUP A;  3IFR A;  2Q2R A;  4H0P A;  5BR9 A;  1JJ2 M;  3R1X A;  4OPH A;  3ZET B;  3CHW A;  4JN4 A;  3WXJ A;  1Z05 A;  3ENH A;  1VAZ A;  2FF6 A;  3LDL A;  4BRD A;  1NGE A;  4JKC A;  1IG8 A;  2QWN A;  1QHA A;  3CC2 N;  5C2F A;  4BY9 C;  5AFU H;  3OHR A;  5AQQ A;  3ZYY X;  4PL8 A;  4BC2 A;  2EWS A;  2PAV A;  4ISF A;  2AP1 A;  3CC7 N;  4WQ4 A;  4NLC A;  3AGR A;  1KXP A;  3UE5 A;  4PL7 A;  3CJC A;  1WUA A;  4RTF D;  1BO5 O;  5BRE A;  3D2F B;  3UKU A;  2Q36 A;  4DKW A;  1QVF M;  2P9P B;  4EFH A;  1MDU B;  1KAY A;  1V4T A;  2E20 A;  2GEM A;  4XH1 A;  2HBL A;  5CR4 A;  3A5O C;  3VMF B;  2QA4 N;  4BRN A;  3VEZ A;  4HTL A;  3FE1 A;  4NO7 A;  2V51 B;  4FOI A;  3KZB A;  3UKR B;  3G6E N;  3CME N;  5FPM A;  1T44 A;  1O13 A;  1OVY A;  2Q31 A;  4O5F A;  1GLA G;  1MWK A;  1VQ5 N;  3U9D A;  3AAP A;  3P38 A;  3I56 N;  3DJC A;  3FZL A;  1KC8 O;  1XC3 A;  1Q86 O;  3OBW A;  1VQ6 N;  2D4W A;  3LM2 A;  4O8K A;  2A41 A;  5GIN A;  2ZF5 O;  1ZBS A;  2A6A A;  3MN6 A;  4IJN A;  4CBW A;  5M1P A;  2E2Q A;  2ZGZ A;  2QWL A;  4E1J A;  1SQK A;  4H0X B;  5JVG L;  4JKA A;  3G4S N;  4DHY A;  1GLJ O;  4I6M A;  2RE2 A;  1NM1 A;  2Q0U A;  5TKY A;  3U9Z A;  3WUH A;  3LDO A;  3KWG A;  5BRH A;  1DGK N;  1X3N A;  3CJ1 A;  4BRL A;  2P9L B;  4IFE A;  2NRV A;  4UY8 O;  3MWT A;  1RDW X;  4JKG B;  4BRE A;  1W97 L;  3S41 A;  1W2B M;  2NRH A;  2W40 A;  4QS8 A;  3EL2 A;  3ID8 A;  5AFU A;  5AQH A;  3WEE B;  5AQG A;  4JNE A;  2HBJ A;  2FSJ A;  4FWQ A;  4A5A A;  1HUX A;  1P8Z A;  1H1V A;  1NGF A;  2P9K A;  3AGK A;  3ZX0 A;  4CZJ A;  4WFA L;  4MDB A;  2BTF A;  2NLX A;  3UKU B;  1HLU A;  3P39 A;  3C0B A;  2P9S B;  3DAW A;  3MMV A;  1Q81 O;  4CD3 A;  4B9Q A;  2Q0R A;  4IDH A;  1NGD A;  2YX6 A;  2V7Y A;  4CZE A;  1Q7Y O;  2JWK A;  3SAH A;  1YJW N;  4BRC A;  1C0F A;  1YVN A;  2QI2 A;  3O1B A;  4OO1 J;  4H5V A;  3VER A;  1NGC A;  3LM9 A;  2CGL A;  3R3L A;  5FPD A;  2ZWH A;  3ZET A;  4C23 A;  3QFP A;  4BQZ A;  3PLA A;  3FLC O;  2FF3 B;  3NVM A;  2D1K A;  3DLL L;  3L4Q A;  5AQO A;  2QW9 A;  3P31 A;  1VQK N;  3VF6 A;  2E8A A;  3DXM B;  2VYP A;  4XEI A;  4GV6 A;  2QTD A;  3VEV A;  4O8U A;  3CQX A;  3ENB A;  3GOI A;  1KD1 O;  5HOO A;  1NGI A;  3SBG A;  4ILJ A;  3QML A;  5CHI A;  2I7N A;  5AQW A;  2ZJQ L;  5BPN A;  1R59 O;  2P9P A;  5AQU A;  2NRT A;  5BRD A;  3OW2 M;  1YJ9 N;  5C15 A;  4BVO A;  5M1F A;  3BF1 A;  5AR0 A;  3ATV A;  2W41 A;  1YI2 N;  1N8R O;  3CCM N;  3UKR A;  3VES A;  1YJN N;  1TYQ B;  1GLD G;  5M1K A;  1BWF O;  2GX9 A;  4XH5 A;  4BRQ A;  3L6Q A;  1HJO A;  4M7X A;  4LC9 B;  4KH5 A;  5JLF A;  4YOV A;  3MCP A;  3M3Z A;  2A3Z A;  4BC4 A;  3A5M C;  3GBT A;  4FPB A;  4H5W A;  3CCJ N;  3SJH A;  3TU5 A;  4BRP A;  2QXL A;  5GAE P;  3H1V X;  4IEE A;  4FWP A;  3A8Y A;  3U8X A;  3HOT A;  4J8F A;  5AQS A;  3OA9 A;  1KAZ A;  3F5T A;  5LJV A;  2IVP A;  4EHU A;  3VGL A;  4B1U B;  3C6A A;  3IMX A;  3BEX A;  4ISG A;  3A5N C;  3SBT A;  1RFQ A;  3E66 A;  1GLE G;  2E1Y A;  1K8K B;  4BRG A;  2Q1N A;  4BRO A;  1KAX A;  2P9L A;  2V52 B;  2VGN A;  1ZC6 A;  3KVG A;  4IJA A;  4JKG A;  1VQ7 N;  2NRZ A;  2WFB A;  1U2V B;  5JMV A;  2FLO A;  4AM7 A;  4K41 A;  2HOE A;  3WEE A;  2FXU A;  2VCP A;  3KWI A;  2IVO A;  3A5L C;  5AQK A;  4WFB L;  3B8A X;  2JWL A;  4L3Q A;  4BG9 A;  3SAG A;  2HST A;  3EKS A;  4CZM A;  3FZM A;  4FWK A;  2PBD A;  2YCH A;  3C65 A;  1Y64 A;  3FFK B;  2BUP A;  2P9S A;  1QQM A;  1T6D A;  3LL3 A;  3Q7B A;  3VF2 A;  2WUS A;  1YUW A;  3CJ9 A;  4CZL A;  5TKW A;  3D7E O;  3EZW A;  3R8E A;  1VQ8 N;  4FSV A;  3F9M A;  4WFN L;  3MK6 A;  5EXW A;  1X3M A;  1VQO N;  4WF9 L;  2OTL N;  5AQM A;  4GY2 B;  1TUY A;  2CH5 A;  1BA0 A;  2HF3 A;  3QBX A;  3H1Q A;  4FL9 A;  4B1V A;  3CPE A;  2OTJ N;  4JHD B;  2VWB A;  3BUZ B;  5E84 A;  2KHO A;  3VTI A;  1ATS A;  3WT0 A;  3TSQ A;  4BR4 A;  3CCQ N;  4BGA A;  3QDK A;  2AA4 A;  4CZK A;  4IXC A;  1YAG A;  3DXM A;  4CJ7 A;  3TSU A;  4EIA A;  5BPL A;  5KQD A;  2D0O A;  2NRX A;  4FO0 A;  3DXK A;  3IDH A;  4JKE A;  2WBN A;  3BP8 A;  4B1Z A;  4JKD A;  5DM7 L;  1HKB A;  3KK7 A;  3FZF A;  3RSE A;  3WQU A;  4BRK A;  4WCE L;  1YXQ A;  3EE9 A;  4BC3 A;  1GLB G;  4YOT A;  3A0I X;  1T6C A;  3SMS A;  3HM8 A;  3ZX3 A;  4BQL A;  2NNW A;  3MX5 A;  1BU6 O;  3KHY A;  3LDP A;  3HSC A;  1TYQ A;  4PHT X;  1NGG A;  4U67 L;  1LCU A;  1U6Z A;  4ISE A;  4BVP A;  1VQN N;  5AQL A;  3HRG A;  3PIO L;  2YHY A;  3CCE N;  3CCV N;  3W0L A;  2E88 A;  5I9E B;  5KPT A;  5AQN A;  1SS6 A;  2I7P A;  3M5R A;  4GV3 A;  3CJA A;  3ZX2 A;  1JCE A;  3GL1 A;  1BDG A;  5KPR A;  3ULE B;  3H3N O;  1XUP O;  1NGB A;  2GWJ A;  4CBU A;  3M6G A;  1TUU A;  1DEJ A;  3N4P A;  3ENO A;  1NBW A;  1K9M O;  4BG8 A;  4DCH A;  1EQY A;  1K8K A;  1HKG A;  1YF5 L;  4MDA A;  5C10 A;  1GLL O;  5C2D A;  1U2V A;  5B8H A;  4H0V B;  2P9N B;  3VTH A;  1YIJ N;  3VOV A;  4PKH A;  4BR7 A;  4CZI A;  3CJ7 A;  2E2P A;  2P9I B;  4JK8 A;  4Y0W A;  4JAX A;  4GVE A;  3TSP A;  1NGH A;  3DXK B;  4MO5 A;  1P90 A;  3VEN A;  3H6E A;  5F0X A;  5C0Y A;  1BOT O;  5HL7 L;  3VGK A;  2P9U B;  3CD6 N;  4C1N I;  3AAR A;  4A57 A;  2KKZ A;  4FWO A;  3RSE B;  3QBW A;  5LY3 A;  3VET A;  3QIC A;  4BGB A;  4JEP A;  3CER A;  3JXU A;  3CET A;  1C0G A;  4NLB A;  4KBO A;  4MLH A;  1HKC A;  5F2R A;  3H46 O;  4EAH D;  2CGK A;  4OPA A;  1RGI A;  3CJB A;  2WC9 A;  4FWL A;  4FOE A;  2BH1 A;  1S3X A;  5AQP A;  5GAD P;  3CCU N;  5AQF A;  4H0O A;  3O9T A;  5MLC Q;  3QB0 A;  1QQO A;  4H0T B;  4JK7 A;  3MCA B;  4HWI A;  4JHD A;  5M1N A;  4H0Y B;  3O9U A;  5GIO A;  2J4R A;  3K9J A;  3O4W A;  4C1N K;  3Q7C A;  5AQX A;  1Q82 O;  2ASP A;  3H3O B;  3O6W A;  3T7Z A;  3VEO A;  5AQR A;  2ZJR L;  3J8A A;  4YOX A;  3VF4 A;  2V7Z A;  1GLC G;  5CE3 A;  3K9K A;  4BR2 A;  3ZEU A;  1VQP N;  1OKJ A;  4BR5 A;  5AZI B;  3O8M A;  1ATN A;  4B1W B;  4IO9 L;  4JKB A;  3I33 A;  3VEW A;  4XH4 A;  5M1Q A;  4BR0 A;  3CCL N;  3E9P A;  4DB3 A;  1XQS C;  3CCR N;  2ASM A;  1NLV A;  3FZK A;  2NRR A;  4CI6 A;  2NZT A;  3CCS N;  2UYT A;  3IUC A;  1M1K O;  5H1S Q;  3J7Z O;  3LDQ A;  3C7N B;  2H3G X;  3HBT A;  1RDU A;  2ITM A;  2QWP A;  4ILH A;  2YJE A;  3HTV A;  4BR9 A;  3CQY A;  3U4L A;  2GTD A;  5AZJ B;  3D2E B;  2F9W A;  4BC5 A;  3CIP A;  3TTD A;  1ZXO A;  2NRW A;  3O9Q A;  3MN7 A;  3ULE A;  5AQV A;  4KH4 A;  3SAF A;  2YHW A;  3CC4 N;  3T69 A;  3ID6 A;  3L4I A;  4H5R A;  2GEL A;  2F9T A;  2HBK A;  3EO3 A;  1MA9 B;  2DPN A;  3G25 A;  4FWM A;  1ATR A;  4H5T A;  4JKH A;  5ADX A;  4ILG B;  5F1X A;  5AQY A;  1QVG M;  4QS9 A;  4AF1 A;  2P9N A;  2PFU A;  2Q97 A;  1NGA A;  3M1F A;  4YOW A;  5ELZ A;  1YHQ N;  4BRF A;  2P9I A;  3CI5 A;  3CXC M;  1J6Z A;  5C12 A;  5GAG P;  1VQ4 N;  4IOA L;  1K73 O;  3TTC A;  1VQM N;  2QWO A;  3HOS A;  1ILY A;  3FR0 A;  3ZEU B;  3LDN A;  2P9U A;  3NMU A;  2E1Z A;  1JCF A;  4WQ5 C;  4YDU C;  4DQ8 A;  1S72 N;  3MWP A;  3P4I A;  1G99 A;  3WXI A;  2QWR A;  3WQT A;  1E4G T;  4IEI A;  4A61 A;  3FGU A;  1S22 A;  3GG4 A;  4G9Z A;  3EKU A;  3O9S A;  5KQ8 A;  3E9O A;  2E2N A;  3C6H A;  1LOT B;  3O08 A;  5M1O A;  4A2A A;  4BRA A;  4BRI A;  2FSK A;  1KQS M;  3I8B A;  4BRM A;  4M63 C;  1IJJ A;  5BN9 A;  3SK3 A;  4A59 A;  1DKG D;  3MN9 A;  2OAN A;  5BPM A;  4R79 A;  3CF5 L;  2IVN A;  3CPW M;  4NB4 A;  3OBY A;  4WYB A;  5EY4 A;  1SZ2 A;  5E26 A;  1QQN A;  1V4S A;  4WQ4 C;  3R9P A;  5GIP A;  3O5B A;  2QEX N;  4BRH A;  2KLA A;  3I55 N;  3G71 N;  5AZI A;  4K42 A;  3WXM B;  2HMP A;  2RHK A;  4FPA A;  3O9R A;  4A5B A;  1NJI O;  4FVU A;  3SMP A;  3TTF A;  5BN8 A;  1VQ9 N;  1JCG A;  3H45 C;  1CZA N;  3L0Q A;  4K43 A;  5AQZ A;  4PKI A;  4IZ9 A;  1E4F T;  3W3D A;  2A42 A;  1EO1 A;  1T3V A;  3HI0 A;  4JD2 A;  5JLH A;  3VEY A;  5EOY A;  4PKG A;  2HF4 A;  2ZJP L;  1M90 O;  1HX1 A;  1NWK A;  3C7N A;  4GV9 A;  1BG3 A;  2YJF A;  4IOX A;  4B1X B;  5AQI A;  2ZGY A;  3EN9 A;  3SLC A;  5LJW A;  4U7B A;  1YIT N;  2E2O A;  5FPN A;  3QFU A;  4FWS A;  5AZJ A;  4H5N A;  3D2E A;  1D4X A;  4MO4 A;  3WXK A;  2QM1 A;  4RWT A;  1X9J A;  3F2K A;  3AY9 A;  1NMD A;  3TPQ A;  3FZH A;  3E1Y A;  3VGM A;  1Z6R A;  2QWQ A;  3HZ6 A;  2ASO A;  3BF3 A;  4H03 B;  4RCH A;  4YOR A;  4YOY A;  1DT9 A;  2VGM A;  5GAH P;  2QWM A;  4FWR A;  4M7Y A;  2YI1 A;  2D0P A;  4CD1 A;  4KH6 A;  4IOC L;  3RVC A;  1Q18 A;  3JS6 A;  2CGJ A;  2IIR A;  5ADX H;  3O80 A;  3D6R A;  1QZ6 A;  1ESV A;  4K25 A;  5DM6 L;  4I6M B;  5JVH L;  1BA1 A;  3D2F A;  3IKM A;  5FPE A;  4GNI A;  3R6M A;  4MLE A;  3PIP L;  4FWN A;  2F7T A;  3GDQ A;  3GE1 A;  3MN5 A;  4Z94 A;  1MWM A;  3VEX A;  4CZG A;  3CMA N;  1VQL N;  3ATU A;  4CZF A;  5KPZ A;  3O1W A;  5JIC A;  3E9L A;  2YHX A;  2GWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...