5CR4A

Crystal structure of the sleeping beauty transposase catalytic domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
ARKKPLLQNRHKKARLRFATAHGDKDRTFWRNVLWSDETKIELFGHNDHRYVWRKKGEACKPKNTIPTVKHGGGSIMLWGCFAAGGTGALHKIDGIMDAVQYVDILKQHLKTSVRKLKLGRKWVFQHDNDPKHTSKVVAKWLKDNKVKVLEWPSQSPDLNPIENLWAELKKRVRARRPTNLTQLHQLCQEEWAKIHPNYCGKLVEGYPKRLTQVKQFKGNATKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sleeping Beauty transposase, SB100X
publication title Sleeping Beauty transposase structure allows rational design of hyperactive variants for genetic engineering.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5cr4A00
4U7BA 5CR4A 4MDBA 3K9KA 5HOOA 4MDAA 3HOSA 3K9JA 3HOTA 3F2KA 2F7TA 4R79A
chains in the Genus database with same CATH superfamily
5BN8A 5AZJB 4CF8A 4H5WA 3ZT0A 1IG8A 5LJWA 4PY5A 5GAGP 4B1ZA 4RW9A 3KK2A 4FOIA 1HYSA 4JI0K 2F7TA 3DYAA 4BRHA 4CD1A 4O44A 4JK9A 5ADXA 2JLEA 3IMXA 4CJFA 3LZJA 3BDPA 2PFUA 4O0JA 3AVGA 1EX4A 2ITMA 4CF2A 3MMVA 4CJ3A 4M45A 3VQCA 1BO5O 4CJLA 4KB0A 3KK7A 4O8KA 4BWJA 3C65A 3JAMO 5C24A 3MX2A 2E6MA 3BF1A 4B1WB 3LPUA 4DMNA 1C0FA 1MWKA 3SQ2A 4QS7A 3UKRA 3VESA 3RMAA 1GLLO 2GWJA 3TAPA 3O9QA 4I9QA 1O1WA 5J2NA 3E9PA 4FLZA 3V4IA 2D5RA 1BA1A 2QWNA 1WSFA 3WQTA 3LWLA 3VF4A 2G8WA 4AHTA 2YHBA 5J1EA 4F3TA 5GIPA 1HKBA 3FZHA 1BI4A 2O4IA 1UA1A 3ZEUB 3TR8A 4DR6K 1JXBA 4DR4K 2AP1A 4DV0K 3K9JA 1LV5A 4NYNA 2QW9A 3TSUA 4FLYA 3DWLA 4NCBA 1SKWA 3KLIA 3TAFA 4DV2K 3OJUA 3CD6N 4C8MA 3K5NA 1DEJA 4ZTFA 3V6DA 5C42A 2W41A 2E8AA 4JKGA 1QSYA 3D2FB 2QA4N 1U49A 2GV9A 1QQOA 3AO2A 4YOTA 5AZJA 3O9SA 2JWKA 4BRMA 3O08A 3CCUN 3PIOL 5BRHA 4RW4A 2NNWA 5BRDA 2O8FB 4MDBA 1KVAA 4ISFA 2NRHA 1UWBA 3CCRN 4BR4A 5E84A 4DR3K 1TK5A 1VQKN 4LFCK 2V52B 3VPZA 1QZ6A 1S9GA 2O8BA 1IKYA 3ULDA 2OYQA 2KW4A 1RCHA 3NGYA 4ISEA 1E3MA 3VERA 4G9ZA 1SL2A 3HOSA 1BIZA 1JCFA 4CEOA 3I56N 2YNIA 2E2OA 5J2PA 3PSIA 4EP4A 3K0SA 4M3XA 2YV0X 3QFUA 5AQRA 4Q5VA 2P9LA 1KVBA 2GUIA 1ZBLA 4KHYA 2RPIA 3C6UA 4H03B 4W5TA 2NRWA 3ULEB 2DY4A 2Z1GA 4YHHK 3EZWA 3TSQA 3VA0A 2B6AA 4FWMA 4IBNA 4Y1CA 3TAMA 2IVNA 2Q0RA 4JKDA 3PV8A 3OS0A 3D0PA 5BPMA 4C1NK 4JS4A 3NF8A 1M90O 1C1AA 2WOMA 4CJ5A 1N34K 3QB0A 4Q0BA 3H46O 2BTFA 1KFSA 1E4GT 4KI4A 5I3UA 3ZEUA 4DUYK 1I39A 2P9KA 4H5NA 4U7BA 1W2BM 2UXBK 4G1QA 4WQ4C 1RGIA 4NB4A 4JYAK 4AHSA 3NDKA 2P9NA 1S22A 2QM1A 4FZYA 5EY4A 3FZLA 2QWOA 1REVA 2Q31A 3AA3A 1RT3A 4Z4CA 5AFUA 4OKJA 1Z25A 4Z4IA 1GLBG 1N6QA 3ZSYA 3D2FA 1HQUA 3L8BA 4DSKA 3IFRA 5AZIB 1BIUA 2OZMA 2V51B 2I7NA 3I8BA 4YOWA 1RDDA 3V81A 3QMLA 1QS4A 3ENOA 3AO1A 5M1FA 4B9QA 2O8FA 3VGLA 4BVOA 4A2BA 4FWQA 4EFHA 3NGIA 3VQ5A 3C95A 2YKMA 3CQYA 3TANA 2GBZA 4XH5A 4E1JA 4J2EA 4RG8A 4BQZA 1NG9A 3G10A 5M1KA 4JAXA 2KZMA 4A62A 3QIPA 4DQ8A 4OO1J 1YT3A 5DM6L 3R6MA 1ZBFA 4KH6A 4K8ZA 3MN5A 2YHWA 4CBXA 3WQUA 1CZBA 3K5MA 1X3NA 3QFPA 3CFPA 4B9SA 3OYLA 3MCPA 1T8EA 3VQAA 3OYEA 5J2QA 1ZBHA 1K73O 1NGCA 3PX4A 1FXXA 1QE1A 3UKUB 3NVKA 4DTPA 3T1AA 2D0PA 1HLUA 1S1UA 4KTZA 2DTUA 3KIOA 3ULEA 1VQ9N 3T3FA 4HVJA 1A5WA 4FJ9A 5FDLA 4LSLA 4RTFD 2HMPA 3J7YP 1T03A 4IZ9A 4B9LA 1SL1A 4DSJA 1C0MA 1RDAA 3EO3A 4ILHA 3KLFA 4E1MA 3KVGA 1YI2N 3KKRA 4H0VB 4CJTA 5KGWA 1BGXT 5T7BA 1SZ2A 3LM2A 5BRFA 1SUQA 4DTMA 2NUBA 3RVCA 3OYNA 3RMCA 1IV0A 3AA2A 2X78A 1GLCG 3HVTA 4WCEL 3AVLA 3CMAN 5CY4A 2OPQA 1HJRA 2DPNA 3C6TA 4RCHA 5KRTA 2NRXA 3VEXA 1XI1A 4IDKA 3CCMN 2HHVA 4CZLA 3J80O 1J5OA 4H0OA 1A5VA 1BCMA 4LSNA 4KB1A 3QNOA 4JI7K 1NK5A 3LDLA 2CGKA 3QINA 4J8FA 5CE3A 3QEPA 4FM2A 4I9LA 4B9TA 4AF1A 1D9DA 1KVCA 2IIRA 1JLCA 2ZJPL 4DB3A 1NGHA 4R5PA 3PO4A 4BG8A 4LY7A 2NRTA 1YF5L 2HF4A 3G6EN 4QCLA 4PA1A 4GNIA 5FROA 3SUPA 3GBTA 1KAZA 3MCAB 1VQ6N 3ZLJA 1ASVA 3DRRA 1WSIA 3M8RA 1KAXA 3DLEA 4XH1A 1B92A 1U04A 5M1NA 3V9ZA 1YITN 4FOEA 1KTQA 2FBYA 2UUBK 2A1SA 2VQEK 3G0ZA 4RWTA 1NK9A 3ZSXA 1JXEA 3OYFA 4JI3K 3ZSVA 1QHAA 1YJWN 1X9WA 3CG7A 1RBSA 4CJRA 5FPDA 2PYJA 1HPZA 4DTXA 2HHWA 3KK3A 4YDUC 4DLEA 2XO7A 1SL0A 4BR5A 5JS1A 3CJ7A 3VQEA 1L3UA 1VSJA 4O4GA 1XMOK 5HP1A 2QI2A 3MN7A 5GAEP 4CJQA 4JKBA 2HBKA 3VTHA 4FJHA 3DRSA 2B5JA 3W0LA 1LWCA 4OVLA 4CGIA 2GX9A 2HHTA 1BISA 1JLEA 1DT9A 3VQ9A 2HHUA 5CYMA 4BRKA 1DGKN 3RSEB 4E7IA 3Q7CA 3HP9A 3KLHA 1VSHA 1JL1A 4M42A 3FE1A 2E5LK 3MAQA 2NRZA 3SAHA 1D4XA 5GAHP 1WUAA 4O55A 5AQHA 4KHWA 4HWIA 1R59O 4FL9A 3H1VX 4PQUA 1X3MA 2ITGA 1SKRA 4GW6A 3VTIA 1FW6A 3ALYA 1YXQA 4LC9B 4N56A 2JGUA 5CR4A 2P9PB 4CZMA 4FLVA 3MECA 4YOVA 4I7FA 3L2QA 4I6MB 4PKHA 3G25A 5AQQA 4DSLA 1YTAA 3CC4N 1IBMK 3CMEN 4CF1A 3V1RA 5TKWA 3IAYA 1C0UA 1IKVA 5BR9A 2BUPA 5E26A 4FZXC 2W6LA 4GV6A 3S9HA 4F2SA 4B1VA 4BROA 2ZF5O 3SV3A 3HZ6A 1XQSC 4M3UA 1XHZA 1Z05A 1X9JA 2PBDA 1QQMA 2EHGA 4HTLA 2E20A 4BC4A 5A2QO 1Q9XA 1RNHA 3QESA 1RT5A 4ZHRA 4H4MA 1GLFO 5TKYA 1NU0A 3E66A 3V9XA 4JV5K 4B3OA 1TGOA 4UQGA 1WAJA 3A0IX 3PX0A 4BC3A 4BGAA 1QVFM 3E9OA 3JXUA 5HRNA 3NE6A 4CF0A 1JCGA 2A1RA 1RT1A 2A41A 1S9EA 2P9UB 4OLBA 1W97L 1VSIA 1JJ2M 1TAUA 1S6PA 4PL7A 3H08A 1T05A 3CF5L 2HW3A 3AVFA 3LDPA 4BQLA 5J2MA 1HYZA 3MEEA 4LD0A 4KO0A 4AH9A 1WB9A 5JICA 2X74A 3CETA 5AQFA 5IT9O 3TSPA 4FYDA 1VQ4N 1R0AA 3SYZA 4CFCA 4RW7A 3L3VA 1NGAA 1LWEA 3M8PA 4X65K 2XY6A 4CEQA 1TL3A 3U3GA 3E01A 4AM6A 3KK1A 1MDUB 4IFEA 4B9UA 1EWRA 4CGFA 1S1TA 3LALA 2QXLA 4H0TB 5F1XA 3RRHA 5M1OA 3LDNA 3THXB 5C15A 4DQQA 4N5SA 1U4BA 1TL1A 4I6MA 3P4IA 1L3TA 4QS9A 2F96A 3VEOA 2HF3A 4JK7A 4M63C 3JYTA 1YHQN 1RBUA 1S72N 1BU6O 4B8CA 3ITHA 4DTSA 1RDUA 2Q36A 1ZXOA 1YJ9N 3TAQA 1MWMA 4CGGA 4BRNA 2XRIA 1ZC6A 3ZT2A 1H1VA 2UYTA 4EZ6A 3ATUA 3M8QA 3CERA 2VG5A 3ZCMA 3AVIA 3QETA 2VG6A 4NLBA 2IVPA 4FJXA 4DR2K 3QDKA 1U6ZA 4CJSA 1N36K 1GLJO 3CM6A 3HVRA 3DXMB 4IFVA 3ZYYX 4DHYA 3M5RA 1TK0A 4CESA 4FSVA 4WF9L 2V7ZA 3AVKA 3ZX2A 1FKOA 2F8SA 2OPPA 4F4KA 2QEXN 3PSFA 1TYQA 5C10A 3L4QA 3MN9A 5AQPA 3ZETA 3MXMA 2HHQA 3LP1A 2P9UA 2GUPA 2HNYA 4NXMK 1LWFA 4CFAA 1WBDA 3GDQA 2OPSA 3OYCA 4LH5A 1OH8A 1DLOA 5EVZA 4FWKA 2UU9K 3I8DA 3A5OC 1BOTO 4B3RK 4E19A 3DI6A 4YNQA 4Z4EA 5C0YA 4BRGA 4IEIA 4UY8O 4KH5A 5K14A 3CIPA 5LY3A 1N5YA 4JRPA 4E3SA 3PUFA 5HRRA 4BRAA 4KKOA 1HMVA 2KKZA 1Z26A 3G71N 3DOLA 5KGXA 2Q1NA 1NGDA 1NOYA 1BA0A 2HOEA 2HNDA 3TABA 3FR0A 2Z1IA 1EXQA 4JKCA 2EX3A 3TTFA 4FWSA 5KI6A 4ID5A 1ASWA 1JKHA 4CVNE 2P51A 1SV5A 4IFYA 3OYGA 1NK4A 2A6AA 3WNHA 3PO5A 3OYIA 3EZ5A 4JEPA 5AQOA 3O80A 3U3YA 2XY5A 1NK7A 1NKCA 1ASUA 3F73A 4NXNK 5M1PA 3CCEN 1OKJA 3LANA 4FM0A 3SAFA 4ELVA 3FZMA 4GY2B 1DKGD 4FLXA 1ATSA 3R1XA 3CPEA 1YVNA 4IJNA 2QWPA 1KFDA 2D0OA 3EKUA 3VQQA 3U9DA 4C8LA 1BWFO 4Y1DA 5B8HA 4E7KA 3DXMA 3UIQA 1KLMA 2P9IB 3O5BA 4LF8K 5AQLA 3WXKA 2KFNA 3SQ0A 2KHOA 1GLAG 1RT2A 1KSPA 2HMIA 2VG7A 3P1GA 4L8RB 4FJ7A 2PAVA 4FWOA 3GE1A 4KREA 4B8AB 5KPRA 4FW1A 4W5QA 4Y0WA 1P90A 1QSLA 1CLQA 4OPKA 3HTVA 4BG9A 4BGBA 2OPRA 1XUPO 1RTHA 3O8MA 3O3GA 3ZT3A 4E7LA 4YORA 5AFUH 3WNGA 3AVHA 1TV6A 3SUNA 3WT0A 4FXDA 3DM2A 2VWJA 4HUEA 2YI1A 4FJNA 4X64K 1S1XA 3HP6A 2ZGYA 1EO1A 4ILJA 3IDHA 3OYMA 2ZQBA 3O4WA 5GINA 3VQ4A 3U9ZA 1RDWX 4BR7A 4JHDB 4HHTA 4C8OA 4FK2A 3HSTB 3O4QA 4IEEA 2KTQA 3OJSA 3VQ7A 3THVA 4Z4FA 2YJFA 2OANA 4B9VA 4J2DA 4NO7A 4KHQA 4DF4A 2NRVA 3FGUA 4CHZA 3A8YA 3MEGA 4JI8K 3U6FA 4JLHA 1Q8IA 3L6QA 4DSFA 3AV9A 4DTUA 3CXCM 4BREA 2HVHA 4F2RA 5AR0A 3EYZA 3THWB 4E0DA 3HM9A 1VSFA 1YAGA 3AY9A 3SJJA 4DKWA 2CGJA 4FWRA 1Q9YA 2VCPA 1RBVA 5BN9A 2FF6A 5EX5A 4AM7A 1RTJA 2HBLA 3PX6A 3TTCA 1ZYQA 5AQKA 4FJJA 2XY8A 4JI1K 4A5AA 3AA5X 4CBWA 3CCVN 3L0QA 4DF8A 2ZD1A 3LDOA 4BRFA 1TKTA 3H3NO 4OLAA 4DLGA 3J7ZO 3HI0A 3V1OA 3ZSZA 5EXWA 1S1WA 3LP0A 3LL3A 2OZSA 2J4RA 3EL2A 2RHKA 4F9OA 4WQ4A 1OVQA 3T1YK 4LH4A 1HNZK 4CGHA 4CJVA 3RTVA 4MQ3A 1NGIA 3DLKA 4CZIA 1OH7A 1TKZA 2G8VA 4M7YA 4DQSA 4DS5A 4HCBA 2O8CB 1HQEA 1J9AA 3EEQA 2UXDK 3SMSA 1RDCA 3L4IA 3C0BA 3HYFA 3Q7BA 1EKEA 3OYDA 3WEEB 2QXFA 3WNEA 1T6CA 5F2RA 1NKEA 4DCHA 1K8KB 2R7YA 4JHDA 4DFMA 3NBPA 3QERA 1YJNN 3OYBA 2QWRA 4BRDA 4CK1A 2O8DB 4CD3A 4EHTA 2IC3A 2X6NA 1EQYA 5AZIA 4EP5A 4C8KA 1QZ5A 3THYB 4J2BA 2ZE2A 4MDAA 2FBVA 1ATRA 3N4QA 4DV3K 4AHVA 4BC2A 4JI4K 4FPBA 5IWAK 4E7JA 2UXCK 3H6EA 4DQRA 1BL3A 5AQMA 3BY5A 5BREA 4DR5K 4BVPA 2BGGA 2HHXA 1KD1O 5LMUK 2E1ZA 4O8UA 4CHQA 1K9MO 2YHAA 2WONA 2ASOA 5D3GA 2PZSA 5AQTA 1BUPA 2WFBA 3MXJA 1VQPN 4DQPA 2RE2A 4IDHA 1C6VA 4V19S 2FBXA 1MU2A 3IKMA 2Y1JA 3CFRA 4H5VA 3L2VA 1NK6A 3VA3A 4J2AA 3NF6A 1WLJA 4GVMA 2Q97A 3UKUA 4W5NA 4TSXA 4WFNL 4RW8A 2A3ZA 2VWBA 3W3DA 1ESVA 3VEVA 4FCYA 3SUQA 1TUUA 3J8AA 4CIEA 2XHBA 5F0XA 1NJZA 3VOVA 3K58A 2O8EB 1SQKA 3EE8A 2IDOA 4L3QA 4DFPA 5CHIA 4LF9K 3LP3A 4AHCA 3OS1A 3O1WA 3HXMA 4FJ5A 2O8CA 4B3MK 3SQ1A 1HNWK 5SZTA 1JLQA 3L2RA 4M3TA 2O4GA 4CEFA 4H5RA 3BEXA 4BDPA 4N76A 3CI5A 3CQ8A 4FJGA 4JD2B 3AVJA 2F4VK 4BRCA 4LFAK 3SV4A 4PL8A 1ZBSA 2ZM6K 4BE1A 4KHPK 1XC9A 4BDYA 4B3SK 2QK9A 4LF5K 4JI5K 2YHXA 1UOCA 2QWMA 1VQ5N 2YKNA 4PUOA 3THYA 3HSCA 4CFDA 3BUZB 4XH4A 4FO0A 2DFEA 3DLGA 4K42A 3ASMA 4CZFA 4CEDA 1J6ZA 3VF6A 5HROA 4O5FA 4B08A 4KAZA 4CHOA 4DFKA 3MWTA 1VQNN 1SS6A 3VQPA 1XC3A 4YOYA 3S3MA 4B9MA 4IOXA 1IKXA 1KCFA 1VQLN 1C1BA 3CCJN 1IH7A 1IKWA 4A61A 1XHXA 5CZ2A 1O13A 1VSKA 3TU5A 2FSJA 3R9PA 2YJEA 3DLRA 4A2AA 1WN7A 2QKBA 1NJIO 2HHSA 1OH6A 3CCSN 1K6YA 2E1YA 2Q3SA 3MDQA 3S3NA 4CJ4A 3OYHA 3WXMB 1D8YA 1S5JA 1HKCA 3VEZA 4YDUA 3LWMA 1T3VA 3V9SA 3AO3A 3MN6A 2WC9A 3AVCA 4BE0A 4IG0A 1N33K 2IAJA 1BCOA 4WE1A 5KTQA 4FVUA 2D0BA 3VQ8A 4YY3K 3PIPL 1WAFA 4Z4GA 3AA4A 4MFBA 3OTOK 3NHGA 3CJ1A 3QO9A 4CJ7A 3QBWA 4WQ5C 4H4OA 2BH1A 3CFOA 4DQIA 4K43A 4CHPA 2CH6A 2D4WA 4JN4A 5ELZA 3WXLA 3VQBA 1TKDA 4JKEA 4BRPA 4KTQA 1TUYA 1OVYA 1J54A 5AQXA 2B4JA 1K8AO 3NAEA 3RR8A 3KTQA 4JK8A 2DFHA 1Q7YO 2HB5A 2RKIA 2E4LA 1KQSM 3H1QA 4O5BA 3PLAA 3CQXA 3F2KA 2ASMA 3SBGA 4AHUA 4KBOA 1WSEA 3QNNA 2HSTA 4CEZA 1RILA 4I2QA 4BR2A 3K57A 4IO9L 2Z1JA 3RSEA 3UKRB 2KQ2A 3UB5A 5E41A 4FJMA 4KI6A 3BZCA 2UUCK 3K5LA 1RTIA 4Z0UA 4CZJA 5FLXO 1RT6A 1S1VA 1GLEG 2HBJA 1VSLA 3SK3A 3JS6A 2PY5A 4FPAA 2G8FA 2P9PA 3KD5E 1BI4B 3AVNA 1TVRA 5DM7L 3QEWA 2GWKA 1EETA 4OGCA 1ATNA 3QIOA 4K41A 4CHYA 4KFBA 1VQMN 4EAHD 4CCHA 1YIJN 4IOAL 3DXKB 3M1FA 4KV8A 3ATVA 3P5JA 3EY1A 3NH2A 1X9SA 4WQ5A 3AGRA 3DLHA 3VQ6A 3NVMA 4BRIA 3TTDA 1C0GA 1T7PA 1W7AA 3V9UA 3ZX0A 1NJWA 2D1KA 2I5JA 5M1QA 4BACA 1W0HA 2FSNA 5C2FA 3RR7A 1HUXA 1WOQA 1HYVA 4JS5A 4FLTA 3LPTA 3O4NA 3QEIA 2FLOA 3SCXA 4DV7K 2FBTA 3VEYA 2E2NA 5AQJA 4KH4A 1Q18A 3ID8A 5JVGL 4DS4A 3BP8A 4YOUA 4FJKA 4MLEA 4NCAA 4GKJK 2O8BB 2VGNA 3ENHA 1P8ZA 2DFFA 2HNZA 2F8TA 3HPHA 1Y97A 1WSHA 1Q82O 3U8XA 1ZBUA 3VF2A 1NM1A 3NGZA 2P9LB 3P31A 2UUAK 3VETA 1YUWA 4OPJA 1U2VB 3IG1A 3OHRA 3VN5A 3ZX3A 4DR7K 5DK5A 5JVHL 4B9NA 3C6HA 1IO2A 4JKFA 3KZBA 4CK3A 4FJIA 3G4SN 2ETJA 3QICA 3LAMA 2ATQA 1HJOA 3WXJA 1IBLK 2WBNA 4ELUA 4BRLA 2IVOA 1IBKK 2A40A 4CZHA 3A5LC 4U67L 3A5MC 3THXA 4FZZA 1HKGA 3M8SA 2RN2A 3MXIA 2P9KB 4H0YB 3KHYA 4B3TK 3SAGA 4QS8A 5CZ1A 4WFAL 3HK2A 3AAPA 1MA9B 1VRTA 2D0AA 1NOZA 1KC8O 3DXKA 1RT7A 4W5OA 4H8KA 2P9NB 3B8AX 5JMVA 3A5NC 1HRHA 4ISGA 1QVGM 4M3ZA 5AJ3K 4AQYK 2W42A 4Z94A 1FK9A 1SKSA 1JL2A 4WYBA 1NGGA 3CM5A 1CZAN 3O3HA 1YVUA 4M3WA 1FKPA 3SQ4A 3GG4A 3AO4A 4IJAA 4YOXA 4MO4A 1RBTA 1KXPA 1IJJA 5FPMA 3F9KA 2OTJN 2E2QA 3EE9A 4M3RA 4DFJA 1D9FA 1X1PA 3OYAA 4CGDA 3O9UA 5HRPA 2KFZA 1JLFA 3EKSA 4K25A 3AVBA 2AJQA 2YHYA 3AARA 1NJXA 3I55N 1CXQA 5HBMA 2GTDA 3AVAA 2CGLA 3IS9A 2E2PA 3BF3A 4OGEA 3VEWA 1BDGA 4KHSA 4IWVA 4AHRA 4XEIA 4HCCA 2YX6A 4DSIA 3I0SA 3ID6A 3KWGA 4A5BA 1YTUA 2FF3B 1UA0A 4FVMA 3DLBA 1U2VA 3HM8A 1LW2A 4FLUA 3AAQA 3FZFA 1TKXA 3I33A 5JLHA 3V1QA 4HUGA 1KAYA 3D45A 3B6OA 1VSDA 1CZ9A 2ZJRL 4KHUA 1HNVA 1VQON 5MLCQ 3P83D 5BR8K 3QEXA 1NLVA 3CPWM 3CC7N 1WNSA 4B1UB 1G15A 3L3UA 1LAWA 1RFQA 1NGBA 4CFBA 2P9SB 3SLCA 4PKIA 1NGJA 1FJGK 3S3OA 3ZT1A 3TAEA 4KHNA 4OKKA 3WUHA 1WSGA 3K2PA 1D5AA 3VMFB 1I3AA 3ZSOA 3UE5A 3HL8A 4DUZK 4CZEA 5BPNA 3OBWA 2HHHK 4ICLA 2ZWHA 1J5EK 1S3XA 4FM1A 2VYPA 1XWLA 1Q86O 4NLCA 4A57A 5JLFA 3SNNA 3S41A 1NKBA 1LAVA 3K9KA 3TPQA 4DR1K 3T7ZA 3T1HK 1GOCA 1NNEA 3HPGA 5JS2A 1TK8A 5KPTA 3CCQN 3OYJA 4FK4A 3D6RA 1NWKA 4NCGA 3DRPA 3AGKA 4BDZA 4K8XA 2P9IA 5FRNA 1QTMA 3V9WA 3T19A 3LAKA 5AQNA 3KWIA 4EIAA 3WNFA 1VSMA 3FZKA 3IUCA 3TARA 3AVMA 1RDBA 3CJCA 2W6KA 2BANA 4PKGA 4X66K 3D7EO 3P39A 5AQZA 2RF2A 3SPZA 4DSEA 4OPHA 1VHXA 3LDQA 1L5UA 1B9FA 1W9HA 3OYKA 4ZTJA 3QLHA 3TAGA 4HTUA 5GIOA 3KLEA 2QKKA 2KZZA 1U47A 1LOTB 2XY7A 1V4TA 3QEVA 4CIFA 2QWLA 4FWLA 2NRRA 1F21A 4KPYA 3P38A 4CHNA 2D0CA 3L2WA 4CERA 1V4SA 4BY9C 3B6PA 5AQSA 4XIUA 3D2EB 4GMJB 2YNGA 1Q81O 4KRFA 1HNIA 5AQIA 4FLWA 1JLAA 1VQ7N 3KD1E 3C7NB 4I2PA 1B9DA 1L3SA 4FW2A 2P9SA 4DWIA 4BC5A 1NGFA 4Z4HA 3EN9A 1QSSA 1RTDA 2ASPA 2WUSA 3NF7A 4NYFA 3DAWA 1HNXK 4JI2K 5FRMA 2OCEA 1UAXA 2IGIA 3ZSWA 3O1BA 3AO5A 3ENBA 3TI0A 3E1YA 3MWPA 4LF6K 2YNFA 1TAQA 4BR9A 3HO1A 4BR0A 2H3GX 2OA8A 4QOZB 1VSEA 2CH5A 3BZKA 3SJHA 3SUOA 4R79A 2PYLA 2Q2RA 4OKEA 1JLGA 3HBTA 3WXIA 1L3VA 4MO5A 2BDPA 4WFBL 3THWA 4LF7K 3HOTA 5EOYA 4IOCL 3CCLN 4JKAA 1C0TA 2FSKA 3DLLL 5CYQA 4YFUA 4H0PA 1X9MA 4DV1K 4N47A 4K0KK 2OTLN 3U4LA 3RRGA 3LM9A 1LW0A 2G8IA 3NF9A 3DMJA 3M6GA 5AQGA 2G8HA 4CF9A 3HRGA 2V7YA 4CZKA 4GV9A 3IRXA 4H0XB 3CJBA 1I94K 2VWKA 3VENA 4B1XB 4BE2A 3MX5A 5LL6Z 4CZGA 4M41A 1Y64A 4CEAA 4N41A 3CYMA 4X62K 4C23A 4CI6A 3GOIA 2HVIA 2GELA 1T44A 3PY8A 3H3OB 5LJVA 5H1SQ 3KJVA 2Q0UA 3MEDA 2JWLA 2VGMA 5C25A 4DU4A 3N4PA 4LF4K 2IOCA 4RW6A 4C1NI 3D2EA 4PWDA 3OA9A 1QQNA 3HPOA 4CK2A 5C12A 3OBYA 4JRQA 3WEEA 1BG3A 3CJ9A 3NH0A 1K8KA 3C7NA 4AILC 1NBWA 4DTJA 2O8DA 3KLGA 3RMDA 2ZGZA 4DTOA 1U45A 2Z1HA 4OX9K 5HRSA 4FK0A 3DOKA 4M7XA 4E1NA 3OVNA 4ELTA 4EZ9A 2P5GA 1N32K 1G99A 3M3ZA 3O9TA 1XNRK 4GKKK 2YCHA 2X6SA 1RBRA 4FJLA 1GOAA 3NFAA 1NK8A 5FPNA 4CJPA 3E9LA 3ZSRA 1C1CA 4MLHA 1VRUA 5GADP 3J7AP 2QWQA 3BGRA 1BHLA 2FC0A 4CGJA 1J53A 4QAGA 2P5OA 4GV3A 4DG1A 5I42A 1EP4A 1BQNA 1DTQA 1HX1A 4DV6K 1QQCA 2W40A 4CJEA 1A5XA 3HT3A 3NMUA 4JNEA 5HL7L 4E89A 1VAZA 3FLCO 5KQDA 3R3LA 4OPAA 3MK6A 5AQUA 1HR0K 3JSMA 2EWSA 3SPYA 5HLFA 4H5TA 2G8UA 1JLBA 3A2FA 2IS3A 4EHUA 3FFKB 5AQVA 1NGEA 1ILYA 3NCIA 1BQMA 4BWMA 3C94A 1KLNA 1JCEA 5DMRA 2F9WA 4DV4K 3NH1A 3LP2A 4DTNA 2AA4A 1VK0A 4FWNA 3LZIA 1QHTA 3O9RA 2G8KA 2O8EA 2A42A 5LMNK 1T6DA 1NMNA 2E88A 5SWMA 4CEEA 4DU3A 2KLAA 3SBTA 3SMPA 2A5XA 2I7PA 4CBUA 1IG9A 1WBBA 4W5RA 4IKFA 3VGMA 3HJFA 1XNQK 2LSNA 1NMDA 3DJCA 3QBXA 4A59A 1KRPA 1ITGA 2E6LA 2Y1IA 3CHWA 3VQDA 1CXUA 5I9EB 4JD2A 4BRQA 2P1JA 3H45C 3OY9A 3K59A 3SI6A 5KPZA 5BPLA 3RMBA 4CIGA 4E7HA 3T69A 5FPEA 2NZTA 2FXUA 5HOOA 4PHTX 3I0RA 4CECA 4LFBK 4IO8A 4HUFA 1OH5A 4FWPA 2BE2A 3ZT4A 1Z6RA 4F8RA 1S6QA 4M3YA 1DTTA 5EU7A 1TYQB 1GLDG 2QTDA 1E4FT 3SZ2A 3ZETB 1ZBIA 2GEMA 4GVEA 1NK0A 1EWQA 4ILGB 4IG3A 4CW7B 1XMQK 3ISNC 1M1KO 3F9MA 3C6AA 4IXCA 3OW2M 5KQ8A 4B1YB 1RT4A 4JKHA 1LCUA 4ID1A 2HBMA 5KRSA 3J81O 3VGKA 4O0IA 1GOBA 2ZJQL 5AQYA 2VQFK 4DV5K 3K5OA 4CE9A 2WTUA 3CJAA 3GL1A 1WSJA 1N8RO 5C2DA 3F5TA 4C8NA 4JI6K 3RWUA 3O6WA 4OJRA 3O3FA 3L2UA 4CEBA 3OS2A 4FJ8A 3ZSQA 1U48A 4DU1A 4F3OA 1HPMA 3LDSA 1SAZA 4CJKA 4CJWA 5AQWA 1NJYA 2YNHA 3KKSA 3CC2N 4CJUA 3R8EA 5ADXH 1VQ8N 2NLXA 3FFIA 4KTWA 4JKGB 3TWHA 4DTRA 2F9TA
chains in the Genus database with same CATH topology
3FE1A 5BN8A 2NRZA 5AZJB 3SAHA 2YHYA 3AARA 3Q7BA 1D4XA 4H5WA 5GAHP 3I55N 1WUAA 2GTDA 5AQHA 3WEEB 1T6CA 2CGLA 1IG8A 4HWIA 5F2RA 4DCHA 1R59O 4FL9A 5LJWA 1K8KB 2E2PA 3H1VX 3BF3A 1X3MA 4JHDA 3VEWA 5GAGP 1BDGA 1YJNN 2QWRA 4IWVA 3VTIA 4B1ZA 4BRDA 1YXQA 4LC9B 4XEIA 4FOIA 2YX6A 4CD3A 4EHTA 5CR4A 2P9PB 4CZMA 3ID6A 3KWGA 4A5BA 2FF3B 2F7TA 4BRHA 1U2VA 3HM8A 4CD1A 4YOVA 1EQYA 4JK9A 5AZIA 1QZ5A 5ADXA 3AAQA 3FZFA 3IMXA 4MDAA 3I33A 5JLHA 1ATRA 1KAYA 2PFUA 3N4QA 4I6MB 4PKHA 3G25A 5AQQA 2ITMA 4BC2A 2ZJRL 3MMVA 3CC4N 4FPBA 1VQON 3CMEN 5MLCQ 1BO5O 5TKWA 1NLVA 3H6EA 5BR9A 3CPWM 3CC7N 2BUPA 3KK7A 5AQMA 4O8KA 5BREA 3C65A 5E26A 4B1UB 4BVPA 4GV6A 1RFQA 3MX2A 4B1VA 4BROA 2ZF5O 3BF1A 1NGBA 4B1WB 1KD1O 2P9SB 3SLCA 4PKIA 1C0FA 3HZ6A 2E1ZA 1MWKA 4O8UA 1NGJA 1K9MO 1XQSC 1Z05A 4QS7A 3UKRA 1X9JA 2ASOA 3VESA 2PBDA 1QQMA 1GLLO 2GWJA 3WUHA 5AQTA 1BUPA 3O9QA 2WFBA 1VQPN 4HTLA 3VMFB 2E20A 3E9PA 4BC4A 3UE5A 2RE2A 4IDHA 4CZEA 5BPNA 1BA1A 2QWNA 3OBWA 3IKMA 2ZWHA 1GLFO 1S3XA 4H5VA 5TKYA 3WQTA 3VF4A 2VYPA 3E66A 1Q86O 4NLCA 4A57A 2Q97A 3UKUA 5JLFA 3S41A 5GIPA 3K9KA 4WFNL 1HKBA 3TPQA 2A3ZA 3FZHA 3T7ZA 2VWBA 3W3DA 1ESVA 3VEVA 3A0IX 4BC3A 3ZEUB 1TUUA 3J8AA 4BGAA 1QVFM 3E9OA 2AP1A 5F0XA 3JXUA 3VOVA 1JCGA 5KPTA 3CCQN 2A41A 2P9UB 3D6RA 1NWKA 1W97L 1JJ2M 3AGKA 3K9JA 4PL7A 2P9IA 2QW9A 1SQKA 3TSUA 3DWLA 3EE8A 3CF5L 3LDPA 4L3QA 4BQLA 5AQNA 3KWIA 4EIAA 5CHIA 3CD6N 3FZKA 3O1WA 3IUCA 3CJCA 4PKGA 1DEJA 5JICA 3D7EO 3CETA 2W41A 2E8AA 5AQFA 3P39A 5AQZA 3TSPA 4H5RA 3BEXA 4JKGA 3D2FB 2QA4N 3CI5A 1VQ4N 4OPHA 1QQOA 3LDQA 4YOTA 5AZJA 3O9SA 4JD2B 2JWKA 4BRMA 5GIOA 3O08A 1NGAA 4BRCA 3PIOL 3CCUN 5BRHA 4PL8A 1ZBSA 4AM6A 1LOTB 2NNWA 5BRDA 1V4TA 1MDUB 4MDBA 4IFEA 4ISFA 2NRHA 2QWLA 4FWLA 2NRRA 3CCRN 4BR4A 2QXLA 2YHXA 4H0TB 5F1XA 3P38A 2QWMA 3LDNA 5M1OA 1VQ5N 5E84A 5C15A 3HSCA 3BUZB 1VQKN 1V4SA 4BY9C 2V52B 4XH4A 4FO0A 3VPZA 1QZ6A 4I6MA 3D2EB 3P4IA 5AQSA 4K42A 4CZFA 1Q81O 5AQIA 4QS9A 1J6ZA 3VF6A 4ISEA 3VEOA 2HF3A 4JK7A 4M63C 4O5FA 3VERA 3HOSA 1YHQN 1S72N 4G9ZA 1BU6O 1JCFA 3I56N 3MWTA 3C7NB 1RDUA 1VQNN 2Q36A 2E2OA 1ZXOA 1SS6A 1YJ9N 1MWMA 1XC3A 4YOYA 4BRNA 2P9SA 1ZC6A 3QFUA 4IOXA 1H1VA 1NGFA 2P9LA 5AQRA 4BC5A 1VQLN 2UYTA 3CCJN 4A61A 3EN9A 3ATUA 1O13A 3TU5A 2FSJA 3R9PA 2YJEA 3CERA 2ASPA 2WUSA 3DAWA 4H03B 4A2AA 4NLBA 2IVPA 2NRWA 3ULEB 1NJIO 3CCSN 3EZWA 3TSQA 2E1YA 4FWMA 3O1BA 3QDKA 3MDQA 1U6ZA 3ENBA 2IVNA 3E1YA 2Q0RA 4JKDA 1GLJO 3DXMB 3MWPA 3WXMB 3ZYYX 4DHYA 4C1NK 4BR9A 5BPMA 1HKCA 2H3GX 3VEZA 4BR0A 3M5RA 2CH5A 4YDUA 1T3VA 1M90O 3SJHA 4FSVA 4R79A 3QB0A 2Q2RA 4WF9L 2V7ZA 3MN6A 3ZX2A 2WC9A 3H46O 2BTFA 3HBTA 1E4GT 4MO5A 3WXIA 4WFBL 2QEXN 1TYQA 3ZEUA 5EOYA 3HOTA 5C10A 3L4QA 4IOCL 2P9KA 4H5NA 4U7BA 1W2BM 3MN9A 5AQPA 3ZETA 3CCLN 4JKAA 2FSKA 3DLLL 4WQ4C 4FVUA 1RGIA 2P9UA 2GUPA 3PIPL 4H0PA 3GDQA 4NB4A 2P9NA 2OTLN 3CJ1A 3U4LA 1S22A 4CJ7A 2QM1A 3QBWA 4WQ5C 5EVZA 2BH1A 3FZLA 3LM9A 4FWKA 2QWOA 5EY4A 2Q31A 3A5OC 1BOTO 5AFUA 4K43A 2CH6A 2D4WA 4JN4A 1GLBG 3M6GA 5ELZA 5AQGA 3WXLA 5C0YA 3D2FA 4BRGA 4JKEA 3HRGA 3IFRA 4IEIA 5AZIB 2V7YA 4CZKA 2V51B 4KH5A 4BRPA 4UY8O 4GV9A 2I7NA 1TUYA 3CJBA 3I8BA 4H0XB 3VENA 4YOWA 1OVYA 3CIPA 4B1XB 5LY3A 3QMLA 3MX5A 4CZGA 3ENOA 5AQXA 1Y64A 1K8AO 4C23A 4CI6A 5M1FA 3GOIA 2GELA 4B9QA 1T44A 4JK8A 4BRAA 1Q7YO 3VGLA 4BVOA 2KKZA 4A2BA 4FWQA 4EFHA 3G71N 3H3OB 5LJVA 1KQSM 3H1QA 2Q1NA 1NGDA 3PLAA 3CQXA 3F2KA 1BA0A 2ASMA 3CQYA 5H1SQ 2HOEA 3FR0A 3SBGA 2Q0UA 4KBOA 2HSTA 2JWLA 2VGMA 4JKCA 3TTFA 4BR2A 3N4PA 4XH5A 4E1JA 4BQZA 4IO9L 5M1KA 3RSEA 4FWSA 4JAXA 4C1NI 3D2EA 3UKRB 4A62A 3OA9A 1QQNA 3UB5A 4DQ8A 5DM6L 4OO1J 3R6MA 5C12A 3OBYA 4KH6A 4CZJA 3WEEA 3MN5A 1BG3A 2YHWA 4CBXA 2A6AA 3WQUA 3CJ9A 1K8KA 3C7NA 1X3NA 3QFPA 1NBWA 4JEPA 1GLEG 3MCPA 3O80A 2HBJA 5AQOA 1K73O 3SK3A 2ZGZA 5M1PA 1NGCA 3CCEN 3JS6A 3UKUB 3NVKA 1OKJA 4FPAA 4M7XA 2D0PA 2P9PA 1HLUA 3SAFA 3FZMA 4GY2B 1DKGD 1ATSA 1G99A 3M3ZA 3R1XA 3O9TA 5DM7L 3CPEA 1YVNA 2GWKA 2YCHA 4IJNA 2QWPA 1ATNA 2D0OA 3ULEA 3EKUA 4K41A 3U9DA 1VQ9N 1BWFO 5B8HA 1VQMN 4EAHD 4RTFD 5FPNA 2HMPA 1YIJN 3DXMA 3E9LA 4IZ9A 4IOAL 2P9IB 4MLHA 3DXKB 3M1FA 5GADP 3O5BA 3EO3A 2QWQA 3ATVA 4ILHA 3KVGA 5AQLA 1YI2N 4H0VB 4WQ5A 3WXKA 3AGRA 1SZ2A 3LM2A 5BRFA 3RVCA 2KHOA 1GLAG 4GV3A 3NVMA 4BRIA 3TTDA 1C0GA 2PAVA 4FWOA 1GLCG 4WCEL 3CMAN 1HX1A 3GE1A 2DPNA 3ZX0A 4RCHA 2D1KA 2W40A 5KPRA 5M1QA 2NRXA 4Y0WA 3VEXA 1P90A 3CCMN 3NMUA 4CZLA 4JNEA 3HTVA 4H0OA 5HL7L 2FSNA 1VAZA 3FLCO 4BG9A 3R3LA 5C2FA 4BGBA 4OPAA 5KQDA 1HUXA 1WOQA 1XUPO 3O8MA 3MK6A 5AQUA 2EWSA 3LDLA 4H5TA 2FLOA 2CGKA 3FFKB 4EHUA 4J8FA 4YORA 5AFUH 5AQVA 5CE3A 1NGEA 1ILYA 3VEYA 2E2NA 5AQJA 4KH4A 1Q18A 3ID8A 3WT0A 5JVGL 1JCEA 4AF1A 2F9WA 3BP8A 4YOUA 2YI1A 4MLEA 2AA4A 4FWNA 2VGNA 2IIRA 3ENHA 1P8ZA 2ZJPL 4DB3A 2ZGYA 3O9RA 1EO1A 1NGHA 4ILJA 2A42A 3IDHA 3O4WA 1T6DA 5GINA 3U9ZA 1RDWX 2E88A 4BR7A 4BG8A 2KLAA 1Q82O 4JHDB 3U8XA 3VF2A 2NRTA 3SBTA 1YF5L 2HF4A 3SMPA 2A5XA 2I7PA 4CBUA 3G6EN 4GNIA 3GBTA 1KAZA 1NM1A 3MCAB 4IEEA 1VQ6N 2P9LB 3P31A 3VGMA 1NMDA 3VETA 3DJCA 3QBXA 4A59A 1KAXA 1YUWA 2YJFA 2OANA 1U2VB 3OHRA 4XH1A 3CHWA 4NO7A 3L4IA 5M1NA 2NRVA 5I9EB 4JD2A 3FGUA 4BRQA 1YITN 3H45C 3ZX3A 5JVHL 3A8YA 3C6HA 4FOEA 5KPZA 5BPLA 4JKFA 3KZBA 3G4SN 3T69A 1VQ7N 3L6QA 3QICA 5FPEA 2NZTA 2FXUA 5HOOA 4RWTA 4PHTX 1HJOA 3WXJA 2WBNA 4BRLA 3CXCM 2IVOA 4IO8A 4BREA 4FWPA 2A40A 5AR0A 4CZHA 1Z6RA 3A5LC 4U67L 3A5MC 1QHAA 1HKGA 1YJWN 1TYQB 1GLDG 2QTDA 1YAGA 1E4FT 3AY9A 2P9KB 4H0YB 5FPDA 3KHYA 3ZETB 4DKWA 3SAGA 2CGJA 4FWRA 2VCPA 4QS8A 2GEMA 5BN9A 2FF6A 5EX5A 4WFAL 4GVEA 4AM7A 3AAPA 1MA9B 2HBLA 4ILGB 3TTCA 1KC8O 3DXKA 4YDUC 5AQKA 2P9NB 4A5AA 3F9MA 1M1KO 4CBWA 3C6AA 3CCVN 3B8AX 3L0QA 4IXCA 3OW2M 5JMVA 5KQ8A 3LDOA 4BR5A 3A5NC 4ISGA 4B1YB 4BRFA 3CJ7A 4JKHA 1QVGM 1LCUA 3H3NO 4Z94A 2HBMA 3J7ZO 4WYBA 1NGGA 3HI0A 3VGKA 1CZAN 2ZJQL 5EXWA 5AQYA 2QI2A 3MN7A 5GAEP 3CJAA 3GG4A 3GL1A 1N8RO 3LL3A 2J4RA 3EL2A 5C2DA 3F5TA 4IJAA 4JKBA 2RHKA 4F9OA 4WQ4A 4YOXA 2HBKA 3O6WA 3VTHA 4MO4A 1KXPA 3W0LA 1IJJA 1HPMA 2GX9A 1NGIA 4CZIA 5FPMA 1SAZA 4M7YA 2OTJN 1DT9A 2E2QA 3EE9A 5AQWA 3O9UA 3CC2N 3R8EA 5ADXH 4BRKA 1DGKN 3RSEB 2NLXA 1VQ8N 3EKSA 4JKGB 3Q7CA 3SMSA 4K25A 2F9TA 3C0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7B A;  5CR4 A;  4MDB A;  3K9K A;  5HOO A;  4MDA A;  3HOS A;  3K9J A;  3HOT A;  3F2K A;  2F7T A;  4R79 A; 
#chains in the Genus database with same CATH topology
 5BN8 A;  5AZJ B;  4CF8 A;  4H5W A;  3ZT0 A;  1IG8 A;  5LJW A;  4PY5 A;  5GAG P;  4B1Z A;  4RW9 A;  3KK2 A;  4FOI A;  1HYS A;  4JI0 K;  2F7T A;  3DYA A;  4BRH A;  4CD1 A;  4O44 A;  4JK9 A;  5ADX A;  2JLE A;  3IMX A;  4CJF A;  3LZJ A;  3BDP A;  2PFU A;  4O0J A;  3AVG A;  1EX4 A;  2ITM A;  4CF2 A;  3MMV A;  4CJ3 A;  4M45 A;  3VQC A;  1BO5 O;  4CJL A;  4KB0 A;  3KK7 A;  4O8K A;  4BWJ A;  3C65 A;  3JAM O;  5C24 A;  3MX2 A;  2E6M A;  3BF1 A;  4B1W B;  3LPU A;  4DMN A;  1C0F A;  1MWK A;  3SQ2 A;  4QS7 A;  3UKR A;  3VES A;  3RMA A;  1GLL O;  2GWJ A;  3TAP A;  3O9Q A;  4I9Q A;  1O1W A;  5J2N A;  3E9P A;  4FLZ A;  3V4I A;  2D5R A;  1BA1 A;  2QWN A;  1WSF A;  3WQT A;  3LWL A;  3VF4 A;  2G8W A;  4AHT A;  2YHB A;  5J1E A;  4F3T A;  5GIP A;  1HKB A;  3FZH A;  1BI4 A;  2O4I A;  1UA1 A;  3ZEU B;  3TR8 A;  4DR6 K;  1JXB A;  4DR4 K;  2AP1 A;  4DV0 K;  3K9J A;  1LV5 A;  4NYN A;  2QW9 A;  3TSU A;  4FLY A;  3DWL A;  4NCB A;  1SKW A;  3KLI A;  3TAF A;  4DV2 K;  3OJU A;  3CD6 N;  4C8M A;  3K5N A;  1DEJ A;  4ZTF A;  3V6D A;  5C42 A;  2W41 A;  2E8A A;  4JKG A;  1QSY A;  3D2F B;  2QA4 N;  1U49 A;  2GV9 A;  1QQO A;  3AO2 A;  4YOT A;  5AZJ A;  3O9S A;  2JWK A;  4BRM A;  3O08 A;  3CCU N;  3PIO L;  5BRH A;  4RW4 A;  2NNW A;  5BRD A;  2O8F B;  4MDB A;  1KVA A;  4ISF A;  2NRH A;  1UWB A;  3CCR N;  4BR4 A;  5E84 A;  4DR3 K;  1TK5 A;  1VQK N;  4LFC K;  2V52 B;  3VPZ A;  1QZ6 A;  1S9G A;  2O8B A;  1IKY A;  3ULD A;  2OYQ A;  2KW4 A;  1RCH A;  3NGY A;  4ISE A;  1E3M A;  3VER A;  4G9Z A;  1SL2 A;  3HOS A;  1BIZ A;  1JCF A;  4CEO A;  3I56 N;  2YNI A;  2E2O A;  5J2P A;  3PSI A;  4EP4 A;  3K0S A;  4M3X A;  2YV0 X;  3QFU A;  5AQR A;  4Q5V A;  2P9L A;  1KVB A;  2GUI A;  1ZBL A;  4KHY A;  2RPI A;  3C6U A;  4H03 B;  4W5T A;  2NRW A;  3ULE B;  2DY4 A;  2Z1G A;  4YHH K;  3EZW A;  3TSQ A;  3VA0 A;  2B6A A;  4FWM A;  4IBN A;  4Y1C A;  3TAM A;  2IVN A;  2Q0R A;  4JKD A;  3PV8 A;  3OS0 A;  3D0P A;  5BPM A;  4C1N K;  4JS4 A;  3NF8 A;  1M90 O;  1C1A A;  2WOM A;  4CJ5 A;  1N34 K;  3QB0 A;  4Q0B A;  3H46 O;  2BTF A;  1KFS A;  1E4G T;  4KI4 A;  5I3U A;  3ZEU A;  4DUY K;  1I39 A;  2P9K A;  4H5N A;  4U7B A;  1W2B M;  2UXB K;  4G1Q A;  4WQ4 C;  1RGI A;  4NB4 A;  4JYA K;  4AHS A;  3NDK A;  2P9N A;  1S22 A;  2QM1 A;  4FZY A;  5EY4 A;  3FZL A;  2QWO A;  1REV A;  2Q31 A;  3AA3 A;  1RT3 A;  4Z4C A;  5AFU A;  4OKJ A;  1Z25 A;  4Z4I A;  1GLB G;  1N6Q A;  3ZSY A;  3D2F A;  1HQU A;  3L8B A;  4DSK A;  3IFR A;  5AZI B;  1BIU A;  2OZM A;  2V51 B;  2I7N A;  3I8B A;  4YOW A;  1RDD A;  3V81 A;  3QML A;  1QS4 A;  3ENO A;  3AO1 A;  5M1F A;  4B9Q A;  2O8F A;  3VGL A;  4BVO A;  4A2B A;  4FWQ A;  4EFH A;  3NGI A;  3VQ5 A;  3C95 A;  2YKM A;  3CQY A;  3TAN A;  2GBZ A;  4XH5 A;  4E1J A;  4J2E A;  4RG8 A;  4BQZ A;  1NG9 A;  3G10 A;  5M1K A;  4JAX A;  2KZM A;  4A62 A;  3QIP A;  4DQ8 A;  4OO1 J;  1YT3 A;  5DM6 L;  3R6M A;  1ZBF A;  4KH6 A;  4K8Z A;  3MN5 A;  2YHW A;  4CBX A;  3WQU A;  1CZB A;  3K5M A;  1X3N A;  3QFP A;  3CFP A;  4B9S A;  3OYL A;  3MCP A;  1T8E A;  3VQA A;  3OYE A;  5J2Q A;  1ZBH A;  1K73 O;  1NGC A;  3PX4 A;  1FXX A;  1QE1 A;  3UKU B;  3NVK A;  4DTP A;  3T1A A;  2D0P A;  1HLU A;  1S1U A;  4KTZ A;  2DTU A;  3KIO A;  3ULE A;  1VQ9 N;  3T3F A;  4HVJ A;  1A5W A;  4FJ9 A;  5FDL A;  4LSL A;  4RTF D;  2HMP A;  3J7Y P;  1T03 A;  4IZ9 A;  4B9L A;  1SL1 A;  4DSJ A;  1C0M A;  1RDA A;  3EO3 A;  4ILH A;  3KLF A;  4E1M A;  3KVG A;  1YI2 N;  3KKR A;  4H0V B;  4CJT A;  5KGW A;  1BGX T;  5T7B A;  1SZ2 A;  3LM2 A;  5BRF A;  1SUQ A;  4DTM A;  2NUB A;  3RVC A;  3OYN A;  3RMC A;  1IV0 A;  3AA2 A;  2X78 A;  1GLC G;  3HVT A;  4WCE L;  3AVL A;  3CMA N;  5CY4 A;  2OPQ A;  1HJR A;  2DPN A;  3C6T A;  4RCH A;  5KRT A;  2NRX A;  3VEX A;  1XI1 A;  4IDK A;  3CCM N;  2HHV A;  4CZL A;  3J80 O;  1J5O A;  4H0O A;  1A5V A;  1BCM A;  4LSN A;  4KB1 A;  3QNO A;  4JI7 K;  1NK5 A;  3LDL A;  2CGK A;  3QIN A;  4J8F A;  5CE3 A;  3QEP A;  4FM2 A;  4I9L A;  4B9T A;  4AF1 A;  1D9D A;  1KVC A;  2IIR A;  1JLC A;  2ZJP L;  4DB3 A;  1NGH A;  4R5P A;  3PO4 A;  4BG8 A;  4LY7 A;  2NRT A;  1YF5 L;  2HF4 A;  3G6E N;  4QCL A;  4PA1 A;  4GNI A;  5FRO A;  3SUP A;  3GBT A;  1KAZ A;  3MCA B;  1VQ6 N;  3ZLJ A;  1ASV A;  3DRR A;  1WSI A;  3M8R A;  1KAX A;  3DLE A;  4XH1 A;  1B92 A;  1U04 A;  5M1N A;  3V9Z A;  1YIT N;  4FOE A;  1KTQ A;  2FBY A;  2UUB K;  2A1S A;  2VQE K;  3G0Z A;  4RWT A;  1NK9 A;  3ZSX A;  1JXE A;  3OYF A;  4JI3 K;  3ZSV A;  1QHA A;  1YJW N;  1X9W A;  3CG7 A;  1RBS A;  4CJR A;  5FPD A;  2PYJ A;  1HPZ A;  4DTX A;  2HHW A;  3KK3 A;  4YDU C;  4DLE A;  2XO7 A;  1SL0 A;  4BR5 A;  5JS1 A;  3CJ7 A;  3VQE A;  1L3U A;  1VSJ A;  4O4G A;  1XMO K;  5HP1 A;  2QI2 A;  3MN7 A;  5GAE P;  4CJQ A;  4JKB A;  2HBK A;  3VTH A;  4FJH A;  3DRS A;  2B5J A;  3W0L A;  1LWC A;  4OVL A;  4CGI A;  2GX9 A;  2HHT A;  1BIS A;  1JLE A;  1DT9 A;  3VQ9 A;  2HHU A;  5CYM A;  4BRK A;  1DGK N;  3RSE B;  4E7I A;  3Q7C A;  3HP9 A;  3KLH A;  1VSH A;  1JL1 A;  4M42 A;  3FE1 A;  2E5L K;  3MAQ A;  2NRZ A;  3SAH A;  1D4X A;  5GAH P;  1WUA A;  4O55 A;  5AQH A;  4KHW A;  4HWI A;  1R59 O;  4FL9 A;  3H1V X;  4PQU A;  1X3M A;  2ITG A;  1SKR A;  4GW6 A;  3VTI A;  1FW6 A;  3ALY A;  1YXQ A;  4LC9 B;  4N56 A;  2JGU A;  5CR4 A;  2P9P B;  4CZM A;  4FLV A;  3MEC A;  4YOV A;  4I7F A;  3L2Q A;  4I6M B;  4PKH A;  3G25 A;  5AQQ A;  4DSL A;  1YTA A;  3CC4 N;  1IBM K;  3CME N;  4CF1 A;  3V1R A;  5TKW A;  3IAY A;  1C0U A;  1IKV A;  5BR9 A;  2BUP A;  5E26 A;  4FZX C;  2W6L A;  4GV6 A;  3S9H A;  4F2S A;  4B1V A;  4BRO A;  2ZF5 O;  3SV3 A;  3HZ6 A;  1XQS C;  4M3U A;  1XHZ A;  1Z05 A;  1X9J A;  2PBD A;  1QQM A;  2EHG A;  4HTL A;  2E20 A;  4BC4 A;  5A2Q O;  1Q9X A;  1RNH A;  3QES A;  1RT5 A;  4ZHR A;  4H4M A;  1GLF O;  5TKY A;  1NU0 A;  3E66 A;  3V9X A;  4JV5 K;  4B3O A;  1TGO A;  4UQG A;  1WAJ A;  3A0I X;  3PX0 A;  4BC3 A;  4BGA A;  1QVF M;  3E9O A;  3JXU A;  5HRN A;  3NE6 A;  4CF0 A;  1JCG A;  2A1R A;  1RT1 A;  2A41 A;  1S9E A;  2P9U B;  4OLB A;  1W97 L;  1VSI A;  1JJ2 M;  1TAU A;  1S6P A;  4PL7 A;  3H08 A;  1T05 A;  3CF5 L;  2HW3 A;  3AVF A;  3LDP A;  4BQL A;  5J2M A;  1HYZ A;  3MEE A;  4LD0 A;  4KO0 A;  4AH9 A;  1WB9 A;  5JIC A;  2X74 A;  3CET A;  5AQF A;  5IT9 O;  3TSP A;  4FYD A;  1VQ4 N;  1R0A A;  3SYZ A;  4CFC A;  4RW7 A;  3L3V A;  1NGA A;  1LWE A;  3M8P A;  4X65 K;  2XY6 A;  4CEQ A;  1TL3 A;  3U3G A;  3E01 A;  4AM6 A;  3KK1 A;  1MDU B;  4IFE A;  4B9U A;  1EWR A;  4CGF A;  1S1T A;  3LAL A;  2QXL A;  4H0T B;  5F1X A;  3RRH A;  5M1O A;  3LDN A;  3THX B;  5C15 A;  4DQQ A;  4N5S A;  1U4B A;  1TL1 A;  4I6M A;  3P4I A;  1L3T A;  4QS9 A;  2F96 A;  3VEO A;  2HF3 A;  4JK7 A;  4M63 C;  3JYT A;  1YHQ N;  1RBU A;  1S72 N;  1BU6 O;  4B8C A;  3ITH A;  4DTS A;  1RDU A;  2Q36 A;  1ZXO A;  1YJ9 N;  3TAQ A;  1MWM A;  4CGG A;  4BRN A;  2XRI A;  1ZC6 A;  3ZT2 A;  1H1V A;  2UYT A;  4EZ6 A;  3ATU A;  3M8Q A;  3CER A;  2VG5 A;  3ZCM A;  3AVI A;  3QET A;  2VG6 A;  4NLB A;  2IVP A;  4FJX A;  4DR2 K;  3QDK A;  1U6Z A;  4CJS A;  1N36 K;  1GLJ O;  3CM6 A;  3HVR A;  3DXM B;  4IFV A;  3ZYY X;  4DHY A;  3M5R A;  1TK0 A;  4CES A;  4FSV A;  4WF9 L;  2V7Z A;  3AVK A;  3ZX2 A;  1FKO A;  2F8S A;  2OPP A;  4F4K A;  2QEX N;  3PSF A;  1TYQ A;  5C10 A;  3L4Q A;  3MN9 A;  5AQP A;  3ZET A;  3MXM A;  2HHQ A;  3LP1 A;  2P9U A;  2GUP A;  2HNY A;  4NXM K;  1LWF A;  4CFA A;  1WBD A;  3GDQ A;  2OPS A;  3OYC A;  4LH5 A;  1OH8 A;  1DLO A;  5EVZ A;  4FWK A;  2UU9 K;  3I8D A;  3A5O C;  1BOT O;  4B3R K;  4E19 A;  3DI6 A;  4YNQ A;  4Z4E A;  5C0Y A;  4BRG A;  4IEI A;  4UY8 O;  4KH5 A;  5K14 A;  3CIP A;  5LY3 A;  1N5Y A;  4JRP A;  4E3S A;  3PUF A;  5HRR A;  4BRA A;  4KKO A;  1HMV A;  2KKZ A;  1Z26 A;  3G71 N;  3DOL A;  5KGX A;  2Q1N A;  1NGD A;  1NOY A;  1BA0 A;  2HOE A;  2HND A;  3TAB A;  3FR0 A;  2Z1I A;  1EXQ A;  4JKC A;  2EX3 A;  3TTF A;  4FWS A;  5KI6 A;  4ID5 A;  1ASW A;  1JKH A;  4CVN E;  2P51 A;  1SV5 A;  4IFY A;  3OYG A;  1NK4 A;  2A6A A;  3WNH A;  3PO5 A;  3OYI A;  3EZ5 A;  4JEP A;  5AQO A;  3O80 A;  3U3Y A;  2XY5 A;  1NK7 A;  1NKC A;  1ASU A;  3F73 A;  4NXN K;  5M1P A;  3CCE N;  1OKJ A;  3LAN A;  4FM0 A;  3SAF A;  4ELV A;  3FZM A;  4GY2 B;  1DKG D;  4FLX A;  1ATS A;  3R1X A;  3CPE A;  1YVN A;  4IJN A;  2QWP A;  1KFD A;  2D0O A;  3EKU A;  3VQQ A;  3U9D A;  4C8L A;  1BWF O;  4Y1D A;  5B8H A;  4E7K A;  3DXM A;  3UIQ A;  1KLM A;  2P9I B;  3O5B A;  4LF8 K;  5AQL A;  3WXK A;  2KFN A;  3SQ0 A;  2KHO A;  1GLA G;  1RT2 A;  1KSP A;  2HMI A;  2VG7 A;  3P1G A;  4L8R B;  4FJ7 A;  2PAV A;  4FWO A;  3GE1 A;  4KRE A;  4B8A B;  5KPR A;  4FW1 A;  4W5Q A;  4Y0W A;  1P90 A;  1QSL A;  1CLQ A;  4OPK A;  3HTV A;  4BG9 A;  4BGB A;  2OPR A;  1XUP O;  1RTH A;  3O8M A;  3O3G A;  3ZT3 A;  4E7L A;  4YOR A;  5AFU H;  3WNG A;  3AVH A;  1TV6 A;  3SUN A;  3WT0 A;  4FXD A;  3DM2 A;  2VWJ A;  4HUE A;  2YI1 A;  4FJN A;  4X64 K;  1S1X A;  3HP6 A;  2ZGY A;  1EO1 A;  4ILJ A;  3IDH A;  3OYM A;  2ZQB A;  3O4W A;  5GIN A;  3VQ4 A;  3U9Z A;  1RDW X;  4BR7 A;  4JHD B;  4HHT A;  4C8O A;  4FK2 A;  3HST B;  3O4Q A;  4IEE A;  2KTQ A;  3OJS A;  3VQ7 A;  3THV A;  4Z4F A;  2YJF A;  2OAN A;  4B9V A;  4J2D A;  4NO7 A;  4KHQ A;  4DF4 A;  2NRV A;  3FGU A;  4CHZ A;  3A8Y A;  3MEG A;  4JI8 K;  3U6F A;  4JLH A;  1Q8I A;  3L6Q A;  4DSF A;  3AV9 A;  4DTU A;  3CXC M;  4BRE A;  2HVH A;  4F2R A;  5AR0 A;  3EYZ A;  3THW B;  4E0D A;  3HM9 A;  1VSF A;  1YAG A;  3AY9 A;  3SJJ A;  4DKW A;  2CGJ A;  4FWR A;  1Q9Y A;  2VCP A;  1RBV A;  5BN9 A;  2FF6 A;  5EX5 A;  4AM7 A;  1RTJ A;  2HBL A;  3PX6 A;  3TTC A;  1ZYQ A;  5AQK A;  4FJJ A;  2XY8 A;  4JI1 K;  4A5A A;  3AA5 X;  4CBW A;  3CCV N;  3L0Q A;  4DF8 A;  2ZD1 A;  3LDO A;  4BRF A;  1TKT A;  3H3N O;  4OLA A;  4DLG A;  3J7Z O;  3HI0 A;  3V1O A;  3ZSZ A;  5EXW A;  1S1W A;  3LP0 A;  3LL3 A;  2OZS A;  2J4R A;  3EL2 A;  2RHK A;  4F9O A;  4WQ4 A;  1OVQ A;  3T1Y K;  4LH4 A;  1HNZ K;  4CGH A;  4CJV A;  3RTV A;  4MQ3 A;  1NGI A;  3DLK A;  4CZI A;  1OH7 A;  1TKZ A;  2G8V A;  4M7Y A;  4DQS A;  4DS5 A;  4HCB A;  2O8C B;  1HQE A;  1J9A A;  3EEQ A;  2UXD K;  3SMS A;  1RDC A;  3L4I A;  3C0B A;  3HYF A;  3Q7B A;  1EKE A;  3OYD A;  3WEE B;  2QXF A;  3WNE A;  1T6C A;  5F2R A;  1NKE A;  4DCH A;  1K8K B;  2R7Y A;  4JHD A;  4DFM A;  3NBP A;  3QER A;  1YJN N;  3OYB A;  2QWR A;  4BRD A;  4CK1 A;  2O8D B;  4CD3 A;  4EHT A;  2IC3 A;  2X6N A;  1EQY A;  5AZI A;  4EP5 A;  4C8K A;  1QZ5 A;  3THY B;  4J2B A;  2ZE2 A;  4MDA A;  2FBV A;  1ATR A;  3N4Q A;  4DV3 K;  4AHV A;  4BC2 A;  4JI4 K;  4FPB A;  5IWA K;  4E7J A;  2UXC K;  3H6E A;  4DQR A;  1BL3 A;  5AQM A;  3BY5 A;  5BRE A;  4DR5 K;  4BVP A;  2BGG A;  2HHX A;  1KD1 O;  5LMU K;  2E1Z A;  4O8U A;  4CHQ A;  1K9M O;  2YHA A;  2WON A;  2ASO A;  5D3G A;  2PZS A;  5AQT A;  1BUP A;  2WFB A;  3MXJ A;  1VQP N;  4DQP A;  2RE2 A;  4IDH A;  1C6V A;  4V19 S;  2FBX A;  1MU2 A;  3IKM A;  2Y1J A;  3CFR A;  4H5V A;  3L2V A;  1NK6 A;  3VA3 A;  4J2A A;  3NF6 A;  1WLJ A;  4GVM A;  2Q97 A;  3UKU A;  4W5N A;  4TSX A;  4WFN L;  4RW8 A;  2A3Z A;  2VWB A;  3W3D A;  1ESV A;  3VEV A;  4FCY A;  3SUQ A;  1TUU A;  3J8A A;  4CIE A;  2XHB A;  5F0X A;  1NJZ A;  3VOV A;  3K58 A;  2O8E B;  1SQK A;  3EE8 A;  2IDO A;  4L3Q A;  4DFP A;  5CHI A;  4LF9 K;  3LP3 A;  4AHC A;  3OS1 A;  3O1W A;  3HXM A;  4FJ5 A;  2O8C A;  4B3M K;  3SQ1 A;  1HNW K;  5SZT A;  1JLQ A;  3L2R A;  4M3T A;  2O4G A;  4CEF A;  4H5R A;  3BEX A;  4BDP A;  4N76 A;  3CI5 A;  3CQ8 A;  4FJG A;  4JD2 B;  3AVJ A;  2F4V K;  4BRC A;  4LFA K;  3SV4 A;  4PL8 A;  1ZBS A;  2ZM6 K;  4BE1 A;  4KHP K;  1XC9 A;  4BDY A;  4B3S K;  2QK9 A;  4LF5 K;  4JI5 K;  2YHX A;  1UOC A;  2QWM A;  1VQ5 N;  2YKN A;  4PUO A;  3THY A;  3HSC A;  4CFD A;  3BUZ B;  4XH4 A;  4FO0 A;  2DFE A;  3DLG A;  4K42 A;  3ASM A;  4CZF A;  4CED A;  1J6Z A;  3VF6 A;  5HRO A;  4O5F A;  4B08 A;  4KAZ A;  4CHO A;  4DFK A;  3MWT A;  1VQN N;  1SS6 A;  3VQP A;  1XC3 A;  4YOY A;  3S3M A;  4B9M A;  4IOX A;  1IKX A;  1KCF A;  1VQL N;  1C1B A;  3CCJ N;  1IH7 A;  1IKW A;  4A61 A;  1XHX A;  5CZ2 A;  1O13 A;  1VSK A;  3TU5 A;  2FSJ A;  3R9P A;  2YJE A;  3DLR A;  4A2A A;  1WN7 A;  2QKB A;  1NJI O;  2HHS A;  1OH6 A;  3CCS N;  1K6Y A;  2E1Y A;  2Q3S A;  3MDQ A;  3S3N A;  4CJ4 A;  3OYH A;  3WXM B;  1D8Y A;  1S5J A;  1HKC A;  3VEZ A;  4YDU A;  3LWM A;  1T3V A;  3V9S A;  3AO3 A;  3MN6 A;  2WC9 A;  3AVC A;  4BE0 A;  4IG0 A;  1N33 K;  2IAJ A;  1BCO A;  4WE1 A;  5KTQ A;  4FVU A;  2D0B A;  3VQ8 A;  4YY3 K;  3PIP L;  1WAF A;  4Z4G A;  3AA4 A;  4MFB A;  3OTO K;  3NHG A;  3CJ1 A;  3QO9 A;  4CJ7 A;  3QBW A;  4WQ5 C;  4H4O A;  2BH1 A;  3CFO A;  4DQI A;  4K43 A;  4CHP A;  2CH6 A;  2D4W A;  4JN4 A;  5ELZ A;  3WXL A;  3VQB A;  1TKD A;  4JKE A;  4BRP A;  4KTQ A;  1TUY A;  1OVY A;  1J54 A;  5AQX A;  2B4J A;  1K8A O;  3NAE A;  3RR8 A;  3KTQ A;  4JK8 A;  2DFH A;  1Q7Y O;  2HB5 A;  2RKI A;  2E4L A;  1KQS M;  3H1Q A;  4O5B A;  3PLA A;  3CQX A;  3F2K A;  2ASM A;  3SBG A;  4AHU A;  4KBO A;  1WSE A;  3QNN A;  2HST A;  4CEZ A;  1RIL A;  4I2Q A;  4BR2 A;  3K57 A;  4IO9 L;  2Z1J A;  3RSE A;  3UKR B;  2KQ2 A;  3UB5 A;  5E41 A;  4FJM A;  4KI6 A;  3BZC A;  2UUC K;  3K5L A;  1RTI A;  4Z0U A;  4CZJ A;  5FLX O;  1RT6 A;  1S1V A;  1GLE G;  2HBJ A;  1VSL A;  3SK3 A;  3JS6 A;  2PY5 A;  4FPA A;  2G8F A;  2P9P A;  3KD5 E;  1BI4 B;  3AVN A;  1TVR A;  5DM7 L;  3QEW A;  2GWK A;  1EET A;  4OGC A;  1ATN A;  3QIO A;  4K41 A;  4CHY A;  4KFB A;  1VQM N;  4EAH D;  4CCH A;  1YIJ N;  4IOA L;  3DXK B;  3M1F A;  4KV8 A;  3ATV A;  3P5J A;  3EY1 A;  3NH2 A;  1X9S A;  4WQ5 A;  3AGR A;  3DLH A;  3VQ6 A;  3NVM A;  4BRI A;  3TTD A;  1C0G A;  1T7P A;  1W7A A;  3V9U A;  3ZX0 A;  1NJW A;  2D1K A;  2I5J A;  5M1Q A;  4BAC A;  1W0H A;  2FSN A;  5C2F A;  3RR7 A;  1HUX A;  1WOQ A;  1HYV A;  4JS5 A;  4FLT A;  3LPT A;  3O4N A;  3QEI A;  2FLO A;  3SCX A;  4DV7 K;  2FBT A;  3VEY A;  2E2N A;  5AQJ A;  4KH4 A;  1Q18 A;  3ID8 A;  5JVG L;  4DS4 A;  3BP8 A;  4YOU A;  4FJK A;  4MLE A;  4NCA A;  4GKJ K;  2O8B B;  2VGN A;  3ENH A;  1P8Z A;  2DFF A;  2HNZ A;  2F8T A;  3HPH A;  1Y97 A;  1WSH A;  1Q82 O;  3U8X A;  1ZBU A;  3VF2 A;  1NM1 A;  3NGZ A;  2P9L B;  3P31 A;  2UUA K;  3VET A;  1YUW A;  4OPJ A;  1U2V B;  3IG1 A;  3OHR A;  3VN5 A;  3ZX3 A;  4DR7 K;  5DK5 A;  5JVH L;  4B9N A;  3C6H A;  1IO2 A;  4JKF A;  3KZB A;  4CK3 A;  4FJI A;  3G4S N;  2ETJ A;  3QIC A;  3LAM A;  2ATQ A;  1HJO A;  3WXJ A;  1IBL K;  2WBN A;  4ELU A;  4BRL A;  2IVO A;  1IBK K;  2A40 A;  4CZH A;  3A5L C;  4U67 L;  3A5M C;  3THX A;  4FZZ A;  1HKG A;  3M8S A;  2RN2 A;  3MXI A;  2P9K B;  4H0Y B;  3KHY A;  4B3T K;  3SAG A;  4QS8 A;  5CZ1 A;  4WFA L;  3HK2 A;  3AAP A;  1MA9 B;  1VRT A;  2D0A A;  1NOZ A;  1KC8 O;  3DXK A;  1RT7 A;  4W5O A;  4H8K A;  2P9N B;  3B8A X;  5JMV A;  3A5N C;  1HRH A;  4ISG A;  1QVG M;  4M3Z A;  5AJ3 K;  4AQY K;  2W42 A;  4Z94 A;  1FK9 A;  1SKS A;  1JL2 A;  4WYB A;  1NGG A;  3CM5 A;  1CZA N;  3O3H A;  1YVU A;  4M3W A;  1FKP A;  3SQ4 A;  3GG4 A;  3AO4 A;  4IJA A;  4YOX A;  4MO4 A;  1RBT A;  1KXP A;  1IJJ A;  5FPM A;  3F9K A;  2OTJ N;  2E2Q A;  3EE9 A;  4M3R A;  4DFJ A;  1D9F A;  1X1P A;  3OYA A;  4CGD A;  3O9U A;  5HRP A;  2KFZ A;  1JLF A;  3EKS A;  4K25 A;  3AVB A;  2AJQ A;  2YHY A;  3AAR A;  1NJX A;  3I55 N;  1CXQ A;  5HBM A;  2GTD A;  3AVA A;  2CGL A;  3IS9 A;  2E2P A;  3BF3 A;  4OGE A;  3VEW A;  1BDG A;  4KHS A;  4IWV A;  4AHR A;  4XEI A;  4HCC A;  2YX6 A;  4DSI A;  3I0S A;  3ID6 A;  3KWG A;  4A5B A;  1YTU A;  2FF3 B;  1UA0 A;  4FVM A;  3DLB A;  1U2V A;  3HM8 A;  1LW2 A;  4FLU A;  3AAQ A;  3FZF A;  1TKX A;  3I33 A;  5JLH A;  3V1Q A;  4HUG A;  1KAY A;  3D45 A;  3B6O A;  1VSD A;  1CZ9 A;  2ZJR L;  4KHU A;  1HNV A;  1VQO N;  5MLC Q;  3P83 D;  5BR8 K;  3QEX A;  1NLV A;  3CPW M;  3CC7 N;  1WNS A;  4B1U B;  1G15 A;  3L3U A;  1LAW A;  1RFQ A;  1NGB A;  4CFB A;  2P9S B;  3SLC A;  4PKI A;  1NGJ A;  1FJG K;  3S3O A;  3ZT1 A;  3TAE A;  4KHN A;  4OKK A;  3WUH A;  1WSG A;  3K2P A;  1D5A A;  3VMF B;  1I3A A;  3ZSO A;  3UE5 A;  3HL8 A;  4DUZ K;  4CZE A;  5BPN A;  3OBW A;  2HHH K;  4ICL A;  2ZWH A;  1J5E K;  1S3X A;  4FM1 A;  2VYP A;  1XWL A;  1Q86 O;  4NLC A;  4A57 A;  5JLF A;  3SNN A;  3S41 A;  1NKB A;  1LAV A;  3K9K A;  3TPQ A;  4DR1 K;  3T7Z A;  3T1H K;  1GOC A;  1NNE A;  3HPG A;  5JS2 A;  1TK8 A;  5KPT A;  3CCQ N;  3OYJ A;  4FK4 A;  3D6R A;  1NWK A;  4NCG A;  3DRP A;  3AGK A;  4BDZ A;  4K8X A;  2P9I A;  5FRN A;  1QTM A;  3V9W A;  3T19 A;  3LAK A;  5AQN A;  3KWI A;  4EIA A;  3WNF A;  1VSM A;  3FZK A;  3IUC A;  3TAR A;  3AVM A;  1RDB A;  3CJC A;  2W6K A;  2BAN A;  4PKG A;  4X66 K;  3D7E O;  3P39 A;  5AQZ A;  2RF2 A;  3SPZ A;  4DSE A;  4OPH A;  1VHX A;  3LDQ A;  1L5U A;  1B9F A;  1W9H A;  3OYK A;  4ZTJ A;  3QLH A;  3TAG A;  4HTU A;  5GIO A;  3KLE A;  2QKK A;  2KZZ A;  1U47 A;  1LOT B;  2XY7 A;  1V4T A;  3QEV A;  4CIF A;  2QWL A;  4FWL A;  2NRR A;  1F21 A;  4KPY A;  3P38 A;  4CHN A;  2D0C A;  3L2W A;  4CER A;  1V4S A;  4BY9 C;  3B6P A;  5AQS A;  4XIU A;  3D2E B;  4GMJ B;  2YNG A;  1Q81 O;  4KRF A;  1HNI A;  5AQI A;  4FLW A;  1JLA A;  1VQ7 N;  3KD1 E;  3C7N B;  4I2P A;  1B9D A;  1L3S A;  4FW2 A;  2P9S A;  4DWI A;  4BC5 A;  1NGF A;  4Z4H A;  3EN9 A;  1QSS A;  1RTD A;  2ASP A;  2WUS A;  3NF7 A;  4NYF A;  3DAW A;  1HNX K;  4JI2 K;  5FRM A;  2OCE A;  1UAX A;  2IGI A;  3ZSW A;  3O1B A;  3AO5 A;  3ENB A;  3TI0 A;  3E1Y A;  3MWP A;  4LF6 K;  2YNF A;  1TAQ A;  4BR9 A;  3HO1 A;  4BR0 A;  2H3G X;  2OA8 A;  4QOZ B;  1VSE A;  2CH5 A;  3BZK A;  3SJH A;  3SUO A;  4R79 A;  2PYL A;  2Q2R A;  4OKE A;  1JLG A;  3HBT A;  3WXI A;  1L3V A;  4MO5 A;  2BDP A;  4WFB L;  3THW A;  4LF7 K;  3HOT A;  5EOY A;  4IOC L;  3CCL N;  4JKA A;  1C0T A;  2FSK A;  3DLL L;  5CYQ A;  4YFU A;  4H0P A;  1X9M A;  4DV1 K;  4N47 A;  4K0K K;  2OTL N;  3U4L A;  3RRG A;  3LM9 A;  1LW0 A;  2G8I A;  3NF9 A;  3DMJ A;  3M6G A;  5AQG A;  2G8H A;  4CF9 A;  3HRG A;  2V7Y A;  4CZK A;  4GV9 A;  3IRX A;  4H0X B;  3CJB A;  1I94 K;  2VWK A;  3VEN A;  4B1X B;  4BE2 A;  3MX5 A;  5LL6 Z;  4CZG A;  4M41 A;  1Y64 A;  4CEA A;  4N41 A;  3CYM A;  4X62 K;  4C23 A;  4CI6 A;  3GOI A;  2HVI A;  2GEL A;  1T44 A;  3PY8 A;  3H3O B;  5LJV A;  5H1S Q;  3KJV A;  2Q0U A;  3MED A;  2JWL A;  2VGM A;  5C25 A;  4DU4 A;  3N4P A;  4LF4 K;  2IOC A;  4RW6 A;  4C1N I;  3D2E A;  4PWD A;  3OA9 A;  1QQN A;  3HPO A;  4CK2 A;  5C12 A;  3OBY A;  4JRQ A;  3WEE A;  1BG3 A;  3CJ9 A;  3NH0 A;  1K8K A;  3C7N A;  4AIL C;  1NBW A;  4DTJ A;  2O8D A;  3KLG A;  3RMD A;  2ZGZ A;  4DTO A;  1U45 A;  2Z1H A;  4OX9 K;  5HRS A;  4FK0 A;  3DOK A;  4M7X A;  4E1N A;  3OVN A;  4ELT A;  4EZ9 A;  2P5G A;  1N32 K;  1G99 A;  3M3Z A;  3O9T A;  1XNR K;  4GKK K;  2YCH A;  2X6S A;  1RBR A;  4FJL A;  1GOA A;  3NFA A;  1NK8 A;  5FPN A;  4CJP A;  3E9L A;  3ZSR A;  1C1C A;  4MLH A;  1VRU A;  5GAD P;  3J7A P;  2QWQ A;  3BGR A;  1BHL A;  2FC0 A;  4CGJ A;  1J53 A;  4QAG A;  2P5O A;  4GV3 A;  4DG1 A;  5I42 A;  1EP4 A;  1BQN A;  1DTQ A;  1HX1 A;  4DV6 K;  1QQC A;  2W40 A;  4CJE A;  1A5X A;  3HT3 A;  3NMU A;  4JNE A;  5HL7 L;  4E89 A;  1VAZ A;  3FLC O;  5KQD A;  3R3L A;  4OPA A;  3MK6 A;  5AQU A;  1HR0 K;  3JSM A;  2EWS A;  3SPY A;  5HLF A;  4H5T A;  2G8U A;  1JLB A;  3A2F A;  2IS3 A;  4EHU A;  3FFK B;  5AQV A;  1NGE A;  1ILY A;  3NCI A;  1BQM A;  4BWM A;  3C94 A;  1KLN A;  1JCE A;  5DMR A;  2F9W A;  4DV4 K;  3NH1 A;  3LP2 A;  4DTN A;  2AA4 A;  1VK0 A;  4FWN A;  3LZI A;  1QHT A;  3O9R A;  2G8K A;  2O8E A;  2A42 A;  5LMN K;  1T6D A;  1NMN A;  2E88 A;  5SWM A;  4CEE A;  4DU3 A;  2KLA A;  3SBT A;  3SMP A;  2A5X A;  2I7P A;  4CBU A;  1IG9 A;  1WBB A;  4W5R A;  4IKF A;  3VGM A;  3HJF A;  1XNQ K;  2LSN A;  1NMD A;  3DJC A;  3QBX A;  4A59 A;  1KRP A;  1ITG A;  2E6L A;  2Y1I A;  3CHW A;  3VQD A;  1CXU A;  5I9E B;  4JD2 A;  4BRQ A;  2P1J A;  3H45 C;  3OY9 A;  3K59 A;  3SI6 A;  5KPZ A;  5BPL A;  3RMB A;  4CIG A;  4E7H A;  3T69 A;  5FPE A;  2NZT A;  2FXU A;  5HOO A;  4PHT X;  3I0R A;  4CEC A;  4LFB K;  4IO8 A;  4HUF A;  1OH5 A;  4FWP A;  2BE2 A;  3ZT4 A;  1Z6R A;  4F8R A;  1S6Q A;  4M3Y A;  1DTT A;  5EU7 A;  1TYQ B;  1GLD G;  2QTD A;  1E4F T;  3SZ2 A;  3ZET B;  1ZBI A;  2GEM A;  4GVE A;  1NK0 A;  1EWQ A;  4ILG B;  4IG3 A;  4CW7 B;  1XMQ K;  3ISN C;  1M1K O;  3F9M A;  3C6A A;  4IXC A;  3OW2 M;  5KQ8 A;  4B1Y B;  1RT4 A;  4JKH A;  1LCU A;  4ID1 A;  2HBM A;  5KRS A;  3J81 O;  3VGK A;  4O0I A;  1GOB A;  2ZJQ L;  5AQY A;  2VQF K;  4DV5 K;  3K5O A;  4CE9 A;  2WTU A;  3CJA A;  3GL1 A;  1WSJ A;  1N8R O;  5C2D A;  3F5T A;  4C8N A;  4JI6 K;  3RWU A;  3O6W A;  4OJR A;  3O3F A;  3L2U A;  4CEB A;  3OS2 A;  4FJ8 A;  3ZSQ A;  1U48 A;  4DU1 A;  4F3O A;  1HPM A;  3LDS A;  1SAZ A;  4CJK A;  4CJW A;  5AQW A;  1NJY A;  2YNH A;  3KKS A;  3CC2 N;  4CJU A;  3R8E A;  5ADX H;  1VQ8 N;  2NLX A;  3FFI A;  4KTW A;  4JKG B;  3TWH A;  4DTR A;  2F9T A; 
#chains in the Genus database with same CATH homology
 3FE1 A;  5BN8 A;  2NRZ A;  5AZJ B;  3SAH A;  2YHY A;  3AAR A;  3Q7B A;  1D4X A;  4H5W A;  5GAH P;  3I55 N;  1WUA A;  2GTD A;  5AQH A;  3WEE B;  1T6C A;  2CGL A;  1IG8 A;  4HWI A;  5F2R A;  4DCH A;  1R59 O;  4FL9 A;  5LJW A;  1K8K B;  2E2P A;  3H1V X;  3BF3 A;  1X3M A;  4JHD A;  3VEW A;  5GAG P;  1BDG A;  1YJN N;  2QWR A;  4IWV A;  3VTI A;  4B1Z A;  4BRD A;  1YXQ A;  4LC9 B;  4XEI A;  4FOI A;  2YX6 A;  4CD3 A;  4EHT A;  5CR4 A;  2P9P B;  4CZM A;  3ID6 A;  3KWG A;  4A5B A;  2FF3 B;  2F7T A;  4BRH A;  1U2V A;  3HM8 A;  4CD1 A;  4YOV A;  1EQY A;  4JK9 A;  5AZI A;  1QZ5 A;  5ADX A;  3AAQ A;  3FZF A;  3IMX A;  4MDA A;  3I33 A;  5JLH A;  1ATR A;  1KAY A;  2PFU A;  3N4Q A;  4I6M B;  4PKH A;  3G25 A;  5AQQ A;  2ITM A;  4BC2 A;  2ZJR L;  3MMV A;  3CC4 N;  4FPB A;  1VQO N;  3CME N;  5MLC Q;  1BO5 O;  5TKW A;  1NLV A;  3H6E A;  5BR9 A;  3CPW M;  3CC7 N;  2BUP A;  3KK7 A;  5AQM A;  4O8K A;  5BRE A;  3C65 A;  5E26 A;  4B1U B;  4BVP A;  4GV6 A;  1RFQ A;  3MX2 A;  4B1V A;  4BRO A;  2ZF5 O;  3BF1 A;  1NGB A;  4B1W B;  1KD1 O;  2P9S B;  3SLC A;  4PKI A;  1C0F A;  3HZ6 A;  2E1Z A;  1MWK A;  4O8U A;  1NGJ A;  1K9M O;  1XQS C;  1Z05 A;  4QS7 A;  3UKR A;  1X9J A;  2ASO A;  3VES A;  2PBD A;  1QQM A;  1GLL O;  2GWJ A;  3WUH A;  5AQT A;  1BUP A;  3O9Q A;  2WFB A;  1VQP N;  4HTL A;  3VMF B;  2E20 A;  3E9P A;  4BC4 A;  3UE5 A;  2RE2 A;  4IDH A;  4CZE A;  5BPN A;  1BA1 A;  2QWN A;  3OBW A;  3IKM A;  2ZWH A;  1GLF O;  1S3X A;  4H5V A;  5TKY A;  3WQT A;  3VF4 A;  2VYP A;  3E66 A;  1Q86 O;  4NLC A;  4A57 A;  2Q97 A;  3UKU A;  5JLF A;  3S41 A;  5GIP A;  3K9K A;  4WFN L;  1HKB A;  3TPQ A;  2A3Z A;  3FZH A;  3T7Z A;  2VWB A;  3W3D A;  1ESV A;  3VEV A;  3A0I X;  4BC3 A;  3ZEU B;  1TUU A;  3J8A A;  4BGA A;  1QVF M;  3E9O A;  2AP1 A;  5F0X A;  3JXU A;  3VOV A;  1JCG A;  5KPT A;  3CCQ N;  2A41 A;  2P9U B;  3D6R A;  1NWK A;  1W97 L;  1JJ2 M;  3AGK A;  3K9J A;  4PL7 A;  2P9I A;  2QW9 A;  1SQK A;  3TSU A;  3DWL A;  3EE8 A;  3CF5 L;  3LDP A;  4L3Q A;  4BQL A;  5AQN A;  3KWI A;  4EIA A;  5CHI A;  3CD6 N;  3FZK A;  3O1W A;  3IUC A;  3CJC A;  4PKG A;  1DEJ A;  5JIC A;  3D7E O;  3CET A;  2W41 A;  2E8A A;  5AQF A;  3P39 A;  5AQZ A;  3TSP A;  4H5R A;  3BEX A;  4JKG A;  3D2F B;  2QA4 N;  3CI5 A;  1VQ4 N;  4OPH A;  1QQO A;  3LDQ A;  4YOT A;  5AZJ A;  3O9S A;  4JD2 B;  2JWK A;  4BRM A;  5GIO A;  3O08 A;  1NGA A;  4BRC A;  3PIO L;  3CCU N;  5BRH A;  4PL8 A;  1ZBS A;  4AM6 A;  1LOT B;  2NNW A;  5BRD A;  1V4T A;  1MDU B;  4MDB A;  4IFE A;  4ISF A;  2NRH A;  2QWL A;  4FWL A;  2NRR A;  3CCR N;  4BR4 A;  2QXL A;  2YHX A;  4H0T B;  5F1X A;  3P38 A;  2QWM A;  3LDN A;  5M1O A;  1VQ5 N;  5E84 A;  5C15 A;  3HSC A;  3BUZ B;  1VQK N;  1V4S A;  4BY9 C;  2V52 B;  4XH4 A;  4FO0 A;  3VPZ A;  1QZ6 A;  4I6M A;  3D2E B;  3P4I A;  5AQS A;  4K42 A;  4CZF A;  1Q81 O;  5AQI A;  4QS9 A;  1J6Z A;  3VF6 A;  4ISE A;  3VEO A;  2HF3 A;  4JK7 A;  4M63 C;  4O5F A;  3VER A;  3HOS A;  1YHQ N;  1S72 N;  4G9Z A;  1BU6 O;  1JCF A;  3I56 N;  3MWT A;  3C7N B;  1RDU A;  1VQN N;  2Q36 A;  2E2O A;  1ZXO A;  1SS6 A;  1YJ9 N;  1MWM A;  1XC3 A;  4YOY A;  4BRN A;  2P9S A;  1ZC6 A;  3QFU A;  4IOX A;  1H1V A;  1NGF A;  2P9L A;  5AQR A;  4BC5 A;  1VQL N;  2UYT A;  3CCJ N;  4A61 A;  3EN9 A;  3ATU A;  1O13 A;  3TU5 A;  2FSJ A;  3R9P A;  2YJE A;  3CER A;  2ASP A;  2WUS A;  3DAW A;  4H03 B;  4A2A A;  4NLB A;  2IVP A;  2NRW A;  3ULE B;  1NJI O;  3CCS N;  3EZW A;  3TSQ A;  2E1Y A;  4FWM A;  3O1B A;  3QDK A;  3MDQ A;  1U6Z A;  3ENB A;  2IVN A;  3E1Y A;  2Q0R A;  4JKD A;  1GLJ O;  3DXM B;  3MWP A;  3WXM B;  3ZYY X;  4DHY A;  4C1N K;  4BR9 A;  5BPM A;  1HKC A;  2H3G X;  3VEZ A;  4BR0 A;  3M5R A;  2CH5 A;  4YDU A;  1T3V A;  1M90 O;  3SJH A;  4FSV A;  4R79 A;  3QB0 A;  2Q2R A;  4WF9 L;  2V7Z A;  3MN6 A;  3ZX2 A;  2WC9 A;  3H46 O;  2BTF A;  3HBT A;  1E4G T;  4MO5 A;  3WXI A;  4WFB L;  2QEX N;  1TYQ A;  3ZEU A;  5EOY A;  3HOT A;  5C10 A;  3L4Q A;  4IOC L;  2P9K A;  4H5N A;  4U7B A;  1W2B M;  3MN9 A;  5AQP A;  3ZET A;  3CCL N;  4JKA A;  2FSK A;  3DLL L;  4WQ4 C;  4FVU A;  1RGI A;  2P9U A;  2GUP A;  3PIP L;  4H0P A;  3GDQ A;  4NB4 A;  2P9N A;  2OTL N;  3CJ1 A;  3U4L A;  1S22 A;  4CJ7 A;  2QM1 A;  3QBW A;  4WQ5 C;  5EVZ A;  2BH1 A;  3FZL A;  3LM9 A;  4FWK A;  2QWO A;  5EY4 A;  2Q31 A;  3A5O C;  1BOT O;  5AFU A;  4K43 A;  2CH6 A;  2D4W A;  4JN4 A;  1GLB G;  3M6G A;  5ELZ A;  5AQG A;  3WXL A;  5C0Y A;  3D2F A;  4BRG A;  4JKE A;  3HRG A;  3IFR A;  4IEI A;  5AZI B;  2V7Y A;  4CZK A;  2V51 B;  4KH5 A;  4BRP A;  4UY8 O;  4GV9 A;  2I7N A;  1TUY A;  3CJB A;  3I8B A;  4H0X B;  3VEN A;  4YOW A;  1OVY A;  3CIP A;  4B1X B;  5LY3 A;  3QML A;  3MX5 A;  4CZG A;  3ENO A;  5AQX A;  1Y64 A;  1K8A O;  4C23 A;  4CI6 A;  5M1F A;  3GOI A;  2GEL A;  4B9Q A;  1T44 A;  4JK8 A;  4BRA A;  1Q7Y O;  3VGL A;  4BVO A;  2KKZ A;  4A2B A;  4FWQ A;  4EFH A;  3G71 N;  3H3O B;  5LJV A;  1KQS M;  3H1Q A;  2Q1N A;  1NGD A;  3PLA A;  3CQX A;  3F2K A;  1BA0 A;  2ASM A;  3CQY A;  5H1S Q;  2HOE A;  3FR0 A;  3SBG A;  2Q0U A;  4KBO A;  2HST A;  2JWL A;  2VGM A;  4JKC A;  3TTF A;  4BR2 A;  3N4P A;  4XH5 A;  4E1J A;  4BQZ A;  4IO9 L;  5M1K A;  3RSE A;  4FWS A;  4JAX A;  4C1N I;  3D2E A;  3UKR B;  4A62 A;  3OA9 A;  1QQN A;  3UB5 A;  4DQ8 A;  5DM6 L;  4OO1 J;  3R6M A;  5C12 A;  3OBY A;  4KH6 A;  4CZJ A;  3WEE A;  3MN5 A;  1BG3 A;  2YHW A;  4CBX A;  2A6A A;  3WQU A;  3CJ9 A;  1K8K A;  3C7N A;  1X3N A;  3QFP A;  1NBW A;  4JEP A;  1GLE G;  3MCP A;  3O80 A;  2HBJ A;  5AQO A;  1K73 O;  3SK3 A;  2ZGZ A;  5M1P A;  1NGC A;  3CCE N;  3JS6 A;  3UKU B;  3NVK A;  1OKJ A;  4FPA A;  4M7X A;  2D0P A;  2P9P A;  1HLU A;  3SAF A;  3FZM A;  4GY2 B;  1DKG D;  1ATS A;  1G99 A;  3M3Z A;  3R1X A;  3O9T A;  5DM7 L;  3CPE A;  1YVN A;  2GWK A;  2YCH A;  4IJN A;  2QWP A;  1ATN A;  2D0O A;  3ULE A;  3EKU A;  4K41 A;  3U9D A;  1VQ9 N;  1BWF O;  5B8H A;  1VQM N;  4EAH D;  4RTF D;  5FPN A;  2HMP A;  1YIJ N;  3DXM A;  3E9L A;  4IZ9 A;  4IOA L;  2P9I B;  4MLH A;  3DXK B;  3M1F A;  5GAD P;  3O5B A;  3EO3 A;  2QWQ A;  3ATV A;  4ILH A;  3KVG A;  5AQL A;  1YI2 N;  4H0V B;  4WQ5 A;  3WXK A;  3AGR A;  1SZ2 A;  3LM2 A;  5BRF A;  3RVC A;  2KHO A;  1GLA G;  4GV3 A;  3NVM A;  4BRI A;  3TTD A;  1C0G A;  2PAV A;  4FWO A;  1GLC G;  4WCE L;  3CMA N;  1HX1 A;  3GE1 A;  2DPN A;  3ZX0 A;  4RCH A;  2D1K A;  2W40 A;  5KPR A;  5M1Q A;  2NRX A;  4Y0W A;  3VEX A;  1P90 A;  3CCM N;  3NMU A;  4CZL A;  4JNE A;  3HTV A;  4H0O A;  5HL7 L;  2FSN A;  1VAZ A;  3FLC O;  4BG9 A;  3R3L A;  5C2F A;  4BGB A;  4OPA A;  5KQD A;  1HUX A;  1WOQ A;  1XUP O;  3O8M A;  3MK6 A;  5AQU A;  2EWS A;  3LDL A;  4H5T A;  2FLO A;  2CGK A;  3FFK B;  4EHU A;  4J8F A;  4YOR A;  5AFU H;  5AQV A;  5CE3 A;  1NGE A;  1ILY A;  3VEY A;  2E2N A;  5AQJ A;  4KH4 A;  1Q18 A;  3ID8 A;  3WT0 A;  5JVG L;  1JCE A;  4AF1 A;  2F9W A;  3BP8 A;  4YOU A;  2YI1 A;  4MLE A;  2AA4 A;  4FWN A;  2VGN A;  2IIR A;  3ENH A;  1P8Z A;  2ZJP L;  4DB3 A;  2ZGY A;  3O9R A;  1EO1 A;  1NGH A;  4ILJ A;  2A42 A;  3IDH A;  3O4W A;  1T6D A;  5GIN A;  3U9Z A;  1RDW X;  2E88 A;  4BR7 A;  4BG8 A;  2KLA A;  1Q82 O;  4JHD B;  3U8X A;  3VF2 A;  2NRT A;  3SBT A;  1YF5 L;  2HF4 A;  3SMP A;  2A5X A;  2I7P A;  4CBU A;  3G6E N;  4GNI A;  3GBT A;  1KAZ A;  1NM1 A;  3MCA B;  4IEE A;  1VQ6 N;  2P9L B;  3P31 A;  3VGM A;  1NMD A;  3VET A;  3DJC A;  3QBX A;  4A59 A;  1KAX A;  1YUW A;  2YJF A;  2OAN A;  1U2V B;  3OHR A;  4XH1 A;  3CHW A;  4NO7 A;  3L4I A;  5M1N A;  2NRV A;  5I9E B;  4JD2 A;  3FGU A;  4BRQ A;  1YIT N;  3H45 C;  3ZX3 A;  5JVH L;  3A8Y A;  3C6H A;  4FOE A;  5KPZ A;  5BPL A;  4JKF A;  3KZB A;  3G4S N;  3T69 A;  1VQ7 N;  3L6Q A;  3QIC A;  5FPE A;  2NZT A;  2FXU A;  5HOO A;  4RWT A;  4PHT X;  1HJO A;  3WXJ A;  2WBN A;  4BRL A;  3CXC M;  2IVO A;  4IO8 A;  4BRE A;  4FWP A;  2A40 A;  5AR0 A;  4CZH A;  1Z6R A;  3A5L C;  4U67 L;  3A5M C;  1QHA A;  1HKG A;  1YJW N;  1TYQ B;  1GLD G;  2QTD A;  1YAG A;  1E4F T;  3AY9 A;  2P9K B;  4H0Y B;  5FPD A;  3KHY A;  3ZET B;  4DKW A;  3SAG A;  2CGJ A;  4FWR A;  2VCP A;  4QS8 A;  2GEM A;  5BN9 A;  2FF6 A;  5EX5 A;  4WFA L;  4GVE A;  4AM7 A;  3AAP A;  1MA9 B;  2HBL A;  4ILG B;  3TTC A;  1KC8 O;  3DXK A;  4YDU C;  5AQK A;  2P9N B;  4A5A A;  3F9M A;  1M1K O;  4CBW A;  3C6A A;  3CCV N;  3B8A X;  3L0Q A;  4IXC A;  3OW2 M;  5JMV A;  5KQ8 A;  3LDO A;  4BR5 A;  3A5N C;  4ISG A;  4B1Y B;  4BRF A;  3CJ7 A;  4JKH A;  1QVG M;  1LCU A;  3H3N O;  4Z94 A;  2HBM A;  3J7Z O;  4WYB A;  1NGG A;  3HI0 A;  3VGK A;  1CZA N;  2ZJQ L;  5EXW A;  5AQY A;  2QI2 A;  3MN7 A;  5GAE P;  3CJA A;  3GG4 A;  3GL1 A;  1N8R O;  3LL3 A;  2J4R A;  3EL2 A;  5C2D A;  3F5T A;  4IJA A;  4JKB A;  2RHK A;  4F9O A;  4WQ4 A;  4YOX A;  2HBK A;  3O6W A;  3VTH A;  4MO4 A;  1KXP A;  3W0L A;  1IJJ A;  1HPM A;  2GX9 A;  1NGI A;  4CZI A;  5FPM A;  1SAZ A;  4M7Y A;  2OTJ N;  1DT9 A;  2E2Q A;  3EE9 A;  5AQW A;  3O9U A;  3CC2 N;  3R8E A;  5ADX H;  4BRK A;  1DGK N;  3RSE B;  2NLX A;  1VQ8 N;  3EKS A;  4JKG B;  3Q7C A;  3SMS A;  4K25 A;  2F9T A;  3C0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...