5CR4A

Crystal structure of the sleeping beauty transposase catalytic domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
ARKKPLLQNRHKKARLRFATAHGDKDRTFWRNVLWSDETKIELFGHNDHRYVWRKKGEACKPKNTIPTVKHGGGSIMLWGCFAAGGTGALHKIDGIMDAVQYVDILKQHLKTSVRKLKLGRKWVFQHDNDPKHTSKVVAKWLKDNKVKVLEWPSQSPDLNPIENLWAELKKRVRARRPTNLTQLHQLCQEEWAKIHPNYCGKLVEGYPKRLTQVKQFKGNATKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sleeping Beauty transposase, SB100X
publication title Sleeping Beauty transposase structure allows rational design of hyperactive variants for genetic engineering.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5cr4A00
4U7BA 4MDAA 3K9JA 3HOSA 3HOTA 5HOOA 3F2KA 4R79A 4MDBA 2F7TA 5CR4A 3K9KA
chains in the Genus database with same CATH superfamily
3S9HA 2XO7A 1WAJA 1S1UA 3IUCA 4DV6K 4HUFA 4JKCA 3QO9A 1CXUA 5HRSA 3CCJN 2WUSA 2ITMA 1QSYA 4BRLA 3AAPA 4YOVA 1EWQA 1C1CA 4DFJA 3Q7BA 1QQOA 1RT6A 4MFBA 4DV7K 4U67L 3S3MA 1ILYA 3VQDA 2DFEA 4MO5A 2GWJA 3I33A 4GVMA 4JK9A 2QWNA 4X64K 4CZFA 2UXBK 2KW4A 3VQPA 1JCGA 4ILJA 4DTUA 4B9TA 2IOCA 3LM2A 1KAYA 3QB0A 1DGKN 4LF5K 3BEXA 4K0KK 1ZBFA 3P1GA 1ATNA 2O8BB 3A5NC 1P90A 4Z4CA 5AQNA 4B1UB 1X9WA 2BUPA 2NZTA 4H0TB 1U04A 5CE3A 1XUPO 3FE1A 4FJ9A 4CJWA 4J2AA 1WOQA 2IVPA 3TSPA 2NUBA 3VTHA 3KTQA 1TUUA 2A5XA 5F0XA 1Q9XA 4CZMA 2QXLA 1TUYA 3TPQA 3NBPA 1EQYA 4FLVA 2X6NA 4DG1A 3W3DA 3NHGA 4CJQA 1ATRA 4IKFA 4F2SA 3WNGA 2RHKA 3L3UA 4NCBA 4CIEA 4O5BA 3CCVN 3ASMA 4O4GA 3VF6A 4FOIA 4BRDA 1RDUA 4H0XB 4E7HA 2CH6A 4FM2A 3OBWA 3FZMA 5AQWA 4CJPA 3O4WA 3IRXA 1ZBIA 3RVCA 3SPZA 2E8AA 3V81A 2ZJPL 2HHUA 3C6UA 1HNVA 3ZSRA 4N56A 4I9LA 3ZETA 1OH7A 4LSLA 3ZETB 1TVRA 3DWLA 3M8PA 4CE9A 3NDKA 4FM0A 2OZSA 3HOSA 4FPAA 2WC9A 2E1YA 1IH7A 4H5TA 4K8ZA 3SUOA 3AGRA 5JVGL 4YOWA 1NKBA 3OYJA 1IJJA 2HBMA 1ATSA 1TGOA 3S3NA 1N6QA 1HX1A 3MN7A 3AVNA 4ELVA 4CJVA 1YT3A 3O9QA 4JKFA 2FXUA 4FWSA 4OJRA 4HTUA 4K43A 3RR8A 3HBTA 1YIJN 3L4IA 3LZIA 3VENA 3AVHA 3O1WA 4YOXA 3QESA 4QS8A 5ELZA 2VGMA 4NXMK 3ZLJA 4X65K 3WXJA 4YDUC 5DMRA 3JYTA 4I6MA 1QTMA 4CZKA 4CGDA 3LPTA 4I6MB 3Q7CA 3R9PA 2HNYA 3CG7A 5KI6A 4IOAL 1ITGA 4FJ5A 1DT9A 1OH5A 3ZSVA 3HXMA 1RT5A 3VEVA 4FWRA 4RW6A 2NLXA 1WAFA 3SAFA 1GOBA 1RDDA 2D0PA 1NGDA 3CETA 2HHXA 3RSEA 4CD1A 4KTZA 3RSEB 2OPPA 4AHRA 4CHOA 4R79A 4B3RK 3CM6A 5GAHP 2HHTA 3H3OB 3SV4A 3SAHA 2P9SA 3OYLA 3TSQA 4JK7A 2FBXA 1U48A 1VSFA 3F73A 3KZBA 4RCHA 1YTUA 1LWCA 4N47A 1GLFO 1NOYA 2W6LA 1VQ9N 2ZQBA 2ZJRL 3LM9A 3O4QA 1FK9A 1OVYA 4CFBA 3CQXA 2KLAA 3SPYA 2DTUA 2Y1IA 3G6EN 4J8FA 5DK5A 1DTTA 1V4SA 4CVNE 4CFCA 3EYZA 3EL2A 2UXCK 3NF6A 1D9DA 5HRRA 2F8SA 4M7YA 1JL1A 4B1ZA 1LOTB 1O13A 3CJ9A 1LW0A 3RWUA 5M1NA 1D9FA 4LH4A 5BREA 4DTJA 1M1KO 3O4NA 5C2DA 3TANA 4RW4A 5BN9A 5HRNA 1KFSA 2HMPA 1HYVA 2G8WA 1Q9YA 4DQSA 1NKEA 3HT3A 4A57A 1JCEA 3D45A 3CMAN 1MWKA 3AVCA 4WQ4A 3ZX0A 3THXA 4MQ3A 4JI4K 4JKGA 3THXB 4JKGB 2YKMA 4JRPA 1NM1A 4BRGA 3HPGA 4CGJA 3TABA 2W40A 5EXWA 3WQUA 3KLFA 1JLFA 3OS1A 3VGKA 3BP8A 4V19S 1VQ6N 1NJZA 1IBKK 4EIAA 3MEDA 4Y1CA 4DR1K 1UAXA 1RCHA 4ISGA 3U8XA 4XH4A 4DV5K 5E41A 4H4MA 3CCMN 4YNQA 2PZSA 3DLBA 4BDZA 1Z25A 1GOAA 3RRGA 4E7KA 2O4GA 1BWFO 4M41A 4FYDA 1DLOA 4BRHA 3ZSOA 3AY9A 4F8RA 2QEXN 2GUIA 1HKGA 4H0VB 2Q1NA 1N32K 3MN9A 1BCOA 1SAZA 4KAZA 4DQRA 1U2VA 3OJUA 1SZ2A 4FJKA 1VK0A 1U2VB 2P51A 3GG4A 5AR0A 1WN7A 3VQAA 4J2BA 4C8NA 5HBMA 3T3FA 3KIOA 1SKSA 3B8AX 3ZX2A 3CFRA 3KHYA 2NRTA 2ASOA 4DS4A 4A61A 1TKDA 4YOUA 4FCYA 1L3VA 4AHTA 1YVUA 3FFIA 4EHUA 2HOEA 3OS2A 3FGUA 3OYCA 4CEBA 3QNNA 3HVTA 3DI6A 3PLAA 3HPHA 1IG8A 4JKEA 1A5XA 4IG3A 4GKJK 3HK2A 1S6QA 1HYZA 2QWPA 2H3GX 4ILHA 1YVNA 4NLCA 4GV6A 1L3UA 4KTWA 1BL3A 2XY7A 5C15A 5KGXA 1Q18A 4CF2A 2YHAA 4BE0A 1S1XA 2UU9K 3WEEA 1RT1A 3B6PA 1FXXA 4OX9K 4DR6K 3WEEB 2AP1A 1QSLA 4CZLA 3QEIA 1I3AA 3OBYA 4DTPA 1N5YA 4CI6A 2YJEA 2P1JA 4CF8A 4B9QA 1TAQA 3SYZA 4KH5A 1KC8O 4BRFA 4AM7A 1T03A 4JI0K 4ZTJA 1J54A 3OHRA 2D5RA 3AA2A 2YHXA 4PWDA 1XHXA 2Q2RA 3QIPA 5FRNA 4QOZB 4LF7K 4JAXA 3ZSWA 4BREA 1YUWA 3UKUA 2QWRA 1QVFM 3AO1A 4JKBA 3UKUB 4W5TA 2IC3A 4M7XA 2RE2A 4F9OA 2UYTA 4H4OA 5BR9A 1UOCA 1BU6O 3A8YA 4FJHA 1NGCA 2FSNA 3LZJA 4DWIA 4HTLA 1BHLA 2NRVA 4JI1K 3L3VA 3M3ZA 3P39A 5SWMA 1XWLA 3NCIA 3ZSZA 3PSIA 4CIFA 1S9EA 1RGIA 1HQEA 4BWJA 3QEPA 3QNOA 4OLBA 3OYKA 3DLRA 3CQ8A 1YI2N 1UWBA 4DMNA 4DR4K 1WSJA 3FZFA 4Z4FA 3NH1A 3DOKA 5LL6Z 4WFBL 3QERA 5HROA 4H5WA 4H5VA 5A2QO 3V9SA 4BR7A 1QQMA 3NGYA 4B3TK 2F7TA 3VQQA 3SQ0A 5LY3A 3F9KA 2YJFA 3P4IA 1K6YA 3AO4A 1TK5A 2JWKA 1QQCA 3SI6A 4BC5A 5BR8K 4DTRA 3BF3A 4UY8O 3SBTA 1KLNA 4HUGA 3M6GA 1VQPN 2RN2A 2YHWA 3G10A 3TAMA 4WYBA 3A2FA 1J6ZA 4A62A 4G1QA 5I42A 3QEWA 1X3NA 2YNGA 3U6FA 4GNIA 1VQMN 2E1ZA 3MEGA 3EY1A 5I3UA 3VQ4A 4WQ5C 4B1VA 4F2RA 1HNXK 2WONA 4ID5A 4DF4A 1LWFA 4AHUA 2WOMA 5FRMA 2IDOA 4JD2B 4LFCK 1XQSC 2P9LA 4KKOA 2GEMA 4PKHA 2HBLA 1HYSA 4KI6A 1ZBSA 5AQKA 3F2KA 4DSLA 4AQYK 3NH0A 4PHTX 4B1YB 4L8RB 5BRHA 3VF4A 2FF3B 3FZLA 4DLEA 3MECA 3BY5A 3KK3A 4CERA 4E7JA 2OTLN 1VHXA 3TTDA 4DB3A 4BRMA 4BC2A 1X3MA 2FC0A 4KHSA 4YHHK 1C0GA 1TKTA 4B9MA 3NAEA 3OYGA 4KHPK 2QI2A 1WSEA 3ZT3A 3CPEA 4CJSA 3IS9A 2GWKA 1J5EK 3FFKB 4LH5A 5J2NA 3OW2M 1OH8A 2DPNA 4ILGB 4DQPA 1WUAA 2QKBA 2YNHA 4JI5K 3L2VA 2IVNA 1IBLK 1NBWA 2UUAK 3CHWA 3WNFA 2XY8A 4IOXA 4BR2A 2DY4A 3QFUA 2BTFA 2V52B 3IDHA 5AQYA 2VG7A 1U6ZA 4CZHA 3UIQA 4GW6A 4OVLA 4LFBK 3D7EO 4M3RA 3G71N 4O5FA 5AQTA 1RFQA 1KXPA 3AVIA 3OYBA 1XI1A 2HF4A 3VEWA 3MXIA 3N4PA 5BN8A 4CJ7A 4N41A 1SL0A 5F1XA 2GELA 4DTXA 2ZGZA 3ULEA 4DTMA 3ULEB 3DYAA 3ENBA 3QBWA 3O8MA 4FLYA 1QSSA 4DFKA 4DSEA 3MN6A 2E2PA 4JK8A 3AO3A 3V4IA 3HSTB 3H1VX 3DXMA 4OPAA 4WQ4C 4CHPA 3GDQA 3DXMB 4FM1A 4W5NA 2G8IA 2HBJA 3CJBA 4FZZA 4O44A 5DM6L 2Q31A 4CGHA 3TR8A 3VQ7A 4FJ8A 2HHSA 1NGHA 3VTIA 1Q86O 1BDGA 4BGBA 2G8HA 5JVHL 1LCUA 3NH2A 3TARA 3WUHA 4O55A 3HOTA 2OCEA 4FJIA 2FBVA 3M8RA 3LAMA 5C0YA 1R0AA 1CZ9A 4CK3A 2IS3A 2ZWHA 4B9NA 2GBZA 3WXMB 2ITGA 1K9MO 5H1SQ 4FJLA 3I0RA 2HBKA 3C6AA 4BR0A 3TAFA 5HP1A 4L3QA 3AVAA 4K41A 3QBXA 1JLCA 4CFAA 3AVGA 4CJTA 3H08A 4BRCA 4IDHA 3NGIA 2XY6A 2G8KA 5JS1A 3C6HA 4CF9A 4OGEA 5KPRA 3TAGA 1VSHA 3AVLA 3HM8A 4U7BA 2G8VA 5SZTA 3PX0A 3GE1A 3VQ9A 4NYNA 3WXLA 1NK6A 3MWPA 4JI7K 1RT2A 1VQ7N 2FF6A 2YI1A 3CQYA 4FWNA 3RMAA 1VSLA 4EHTA 4DV4K 4DF8A 5JMVA 1S1VA 3TU5A 1KSPA 5FROA 1MA9B 1QHTA 4RW7A 4IOCL 1VSMA 3CFPA 5IT9O 5C25A 1RDAA 3LP1A 3MX2A 4C1NI 1TK8A 3EEQA 1KAXA 4B8CA 1XMQK 3EKSA 1VQ4N 1GLJO 3E9PA 4A2BA 4CD3A 5E84A 4A2AA 1RTHA 2Z1GA 3M8QA 4TSXA 4M3UA 5AQQA 1TKZA 3HPOA 1K8AO 4ELUA 4B3SK 5GADP 1IBMK 4BDYA 4EZ9A 2NRZA 4IEEA 5MLCQ 3V9XA 5J1EA 4M3TA 2QWQA 3QMLA 3MXMA 1SUQA 4DSKA 4Z94A 4QS9A 4H5RA 2FSKA 3WXIA 4B3OA 2ZJQL 2I5JA 3VQ6A 2LSNA 3U3YA 3AVFA 4IJNA 4MDBA 4FW1A 4DSJA 3CJCA 3ZEUA 3SQ2A 2PYLA 4CGGA 3WT0A 2DFFA 1RBVA 4PUOA 1HNZK 3K5MA 1VQON 3KLGA 4CEEA 4O0JA 5CZ2A 2EX3A 1YXQA 1KQSM 2OTJN 2HNZA 1B92A 4KV8A 1Q82O 4J2EA 5IWAK 2ATQA 1C0UA 4HVJA 1IKYA 4CHQA 3VEOA 3I56N 4AILC 1C1BA 1QQNA 4ZHRA 4KO0A 4CZEA 2OPSA 3CI5A 3K2PA 4WFNL 3U3GA 4BC3A 4PY5A 1XNQK 3UB5A 3NMUA 1M90O 3MAQA 3IAYA 2ZGYA 1KCFA 3VQ8A 3CC7N 1HQUA 4JI3K 1OVQA 3SAGA 3LWLA 2F96A 3M5RA 4F3TA 5AQMA 2F9TA 1KFDA 1RT4A 4CJKA 4FJXA 3P5JA 1VSDA 3PO4A 1W0HA 2P9SB 3ALYA 1YF5L 4CZIA 1X9JA 4DSIA 1BIZA 4HUEA 3RR7A 1KD1O 1KTQA 1E4GT 4DKWA 3CCRN 1CLQA 4DV0K 5AQLA 3FZKA 1FW6A 5C12A 3AO2A 4FLTA 4LY7A 4KB0A 4Z4GA 2E6LA 1WB9A 4KH4A 3O08A 2O4IA 2WTUA 3BZKA 4KTQA 5JICA 2YKNA 4UQGA 5AQGA 4EP5A 4I7FA 1NK8A 3J80O 2P9PA 3V1OA 4AHSA 1Z6RA 1H1VA 2P9PB 4B1WB 1JKHA 2B4JA 5AQFA 3K0SA 4G9ZA 3ENOA 1JJ2M 2HSTA 5KQDA 1RTDA 3A5OC 5AQZA 5E26A 2QM1A 4FZXC 4OGCA 1J53A 1TV6A 4C23A 1T05A 2IGIA 5LMUK 2UXDK 1VQNN 4CJ4A 3O80A 3LPUA 5EX5A 1F21A 3V9UA 1ZBUA 5M1PA 4CJFA 1X1PA 4CBUA 3L2WA 4YORA 1L3SA 3IFRA 1YHQN 4FWLA 1DKGD 3LL3A 4B8AB 4M3WA 4PQUA 2EWSA 4FLWA 4OPJA 4NLBA 2QXFA 4IO9L 5TKWA 4FLZA 3DLHA 1WSHA 2VG5A 1RDWX 5KRTA 1VSJA 4CW7B 1RBSA 4CEZA 1WSGA 2X78A 4Y1DA 1DEJA 3KLEA 3KWGA 3L0QA 1D5AA 1O1WA 3AVKA 3P38A 3SBGA 3QFPA 1KVAA 3V9ZA 1BOTO 3DRRA 5EY4A 3SMPA 5JLFA 1BGXT 1HNIA 4N76A 3S3OA 3O3HA 4GKKK 1NLVA 2D1KA 1SL2A 3C65A 2G8FA 1GLCG 1N33K 3KLIA 3PIOL 3CM5A 4CGFA 3QICA 2V7YA 5C24A 1RTIA 4DSFA 3C6TA 2Q3SA 3H46O 1Q7YO 4FLXA 2G8UA 5FPDA 3ATVA 3I0SA 3PX6A 5M1FA 5F2RA 2RPIA 1S3XA 3NVKA 3L2RA 3SUQA 1CZBA 3CYMA 5JLHA 2Z1JA 2P9KA 4JEPA 2P9KB 4CEFA 1T6DA 1EKEA 1HPMA 1V4TA 4LF8K 4CJRA 1CXQA 3DM2A 2YV0X 1TL3A 3SLCA 4PKGA 3H45C 4JKHA 1NGJA 4FWMA 3TTFA 4BE2A 1JLGA 4A5BA 2YNFA 3ZT2A 1IKVA 1XNRK 2XRIA 3HM9A 3QLHA 4AHCA 4FK4A 4Z4EA 1JLBA 5JS2A 4XH5A 4ISEA 4MO4A 3WNEA 4QAGA 3U9DA 5T7BA 3KKSA 2QWOA 1SV5A 4X66K 4NXNK 4NYFA 2KHOA 4CJEA 3CXCM 3O9RA 4H8KA 1SL1A 4IFEA 2HHHK 1T3VA 1RBRA 2V51B 5C42A 2KTQA 3VA3A 4KHNA 3UKRA 4BGAA 1IKXA 3VQCA 4ZTFA 4BRIA 3F5TA 4DTOA 5I9EB 2OPQA 3AVMA 1YJNN 5AJ3K 3L6QA 3DRSA 2P9NA 5J2QA 4K8XA 2P9NB 2W41A 3EE8A 3OYDA 1YITN 2Q0RA 3L8BA 5AQJA 1S22A 4JYAK 2P5OA 4EFHA 1Q81O 1RBUA 3VQEA 2W6KA 3SV3A 4FO0A 1IG9A 4JI8K 1HR0K 3OYAA 2W42A 1RDCA 3VEYA 2F9WA 2VWBA 4JV5K 4C8LA 1LAVA 4C8OA 3G0ZA 4JNEA 3MWTA 4YDUA 4R5PA 2ZM6K 4HCCA 1HKBA 3DLGA 4LSNA 1E3MA 1Q8IA 2VWKA 1VAZA 3QIOA 3K9KA 2ASPA 4RTFD 4EP4A 1S5JA 4CZGA 1EX4A 4KHUA 2PBDA 4W5RA 3ID8A 3NF7A 5FPMA 1WBBA 1QZ6A 2WFBA 1HJRA 1HJOA 3TAQA 4JKDA 4DHYA 3CMEN 4N5SA 3J7ZO 4ISFA 4CFDA 3KVGA 1E4FT 4DCHA 3MCAB 4JN4A 4A59A 3KK1A 4JLHA 3VMFB 4BQZA 4KHQA 3ENHA 4OKJA 3EN9A 2XY5A 3RMCA 5EU7A 4NCGA 4MLEA 1T44A 1C6VA 4BG8A 5LJWA 2P9LB 2PYJA 3KK7A 4FJGA 4CZJA 1ZBHA 2V7ZA 5BRFA 1U47A 5K14A 2BDPA 3FR0A 4B1XB 3TAPA 2A40A 4QCLA 1GOCA 4YOYA 1BCMA 4WCEL 3FZHA 2E20A 4WFAL 4F4KA 3HO1A 4ELTA 3BUZB 4BVOA 4LFAK 4JS5A 4GV9A 1MU2A 2E88A 1REVA 4E1MA 2EHGA 5BPMA 5GAEP 5FDLA 4CJUA 1JL2A 4B9VA 2RKIA 4FWPA 3R1XA 4FZYA 2VQFK 1BQMA 2OANA 5KQ8A 4IFYA 4Z4HA 2JGUA 1LWEA 1QHAA 3D2EA 3DLKA 3L2QA 3D2EB 2R7YA 4FSVA 3R6MA 3JAMO 4Q0BA 1L3TA 2A42A 5KRSA 4IJAA 4DV2K 1NGGA 1NJWA 4FJ7A 2E5LK 3OY9A 1VQKN 3HI0A 2A3ZA 1TAUA 1C0TA 3HP6A 2A41A 4BC4A 4DQ8A 3RMBA 1U4BA 4BWMA 5GINA 2NRHA 5AFUA 5AQSA 1N8RO 4C1NK 2ASMA 4CIGA 5AQOA 1NK9A 2VCPA 2Z1IA 3SMSA 4FLUA 1S9GA 5BPLA 1I39A 2OZMA 1GLLO 4BRPA 4QS7A 3T1YK 3GOIA 3WXKA 4I2QA 4EAHD 3P83D 2J4RA 4ICLA 3ISNC 3HVRA 5AZJA 2FLOA 5CZ1A 3K5OA 5AZJB 2JWLA 1BISA 1D8YA 3HYFA 3CFOA 4H0OA 4CCHA 2KKZA 5AFUH 4XEIA 1JCFA 3G25A 3VOVA 2Z1HA 5CY4A 1XC9A 1NK0A 4B9UA 1KLMA 4BE1A 4JRQA 4DU1A 4RW8A 3CC2N 3ULDA 2CGLA 3N4QA 5FPEA 3DXKA 1T6CA 1RT3A 2O8BA 3VN5A 1YAGA 3DXKB 3OS0A 3V6DA 4EZ6A 4OLAA 1GLAG 3OYEA 1LAWA 1NGBA 2NRXA 4Y0WA 3O9TA 1XMOK 2HW3A 1FJGK 1NNEA 3J7AP 3ZX3A 3PV8A 1SS6A 2A1RA 4BRKA 4BRNA 1LW2A 4NB4A 3IMXA 1VQ8N 1S1WA 3DMJA 3E01A 5HRPA 1BQNA 1BA1A 1Y97A 3MK6A 3UE5A 4BR9A 1JLQA 3NE6A 4BQLA 2YHBA 3J81O 1G99A 3LP0A 3O3FA 4KRFA 4ID1A 4DTNA 2B5JA 4B9SA 4B3MK 1B9DA 2GX9A 3TSUA 4KB1A 3MX5A 3CIPA 4IZ9A 3LDPA 4FOEA 1ASUA 1K73O 4DUYK 3DLEA 3VEXA 3P31A 4Z0UA 2HF3A 4K25A 3VEZA 1ZBLA 3D2FA 1XC3A 1NK5A 3D2FB 1I94K 3THYA 3OTOK 4DS5A 3THYB 4DU3A 3S41A 3PIPL 4CHNA 2F4VK 4W5QA 2E2QA 4WF9L 2KZZA 3SK3A 3CC4N 1NGAA 4A5AA 4LF6K 2HHQA 4KHYA 5HOOA 2HHWA 1C1AA 2OPRA 4NCAA 3QETA 5CHIA 1XHZA 1GLEG 1W9HA 2KFNA 3ZEUB 1VQLN 4M3ZA 1VRTA 4M42A 5KGWA 1W97L 4C8KA 1R59O 4BR5A 3JSMA 3O6WA 1S6PA 1BA0A 4DR2K 3SJJA 2GUPA 4LF9K 4YFUA 5EVZA 1NK4A 1NJIO 3AGKA 3KK2A 3AAQA 1NGIA 4DFMA 2O8DA 3L4QA 1VQ5N 2O8DB 3ZT0A 1TYQA 3AVJA 3AO5A 2QK9A 3SCXA 1TYQB 3QINA 4PL8A 2I7NA 3I8BA 4E3SA 1S72N 4DU4A 3KJVA 5AQPA 2PAVA 3KWIA 5TKYA 2CGJA 1YTAA 3O9SA 5BPNA 3HL8A 3J8AA 1Y64A 4BRQA 4IDKA 3CJ1A 2D0CA 5LMNK 3DAWA 3OVNA 4KPYA 4AM6A 4WQ5A 4WE1A 4YY3K 3SZ2A 2OYQA 4OPKA 3O5BA 1RNHA 5CYMA 4OO1J 1HUXA 1NG9A 2YCHA 1ASWA 1EO1A 1GLDG 2GV9A 4BVPA 1WBDA 4JI6K 3HJFA 3TWHA 1ZYQA 3A0IX 1ASVA 4CEQA 4FVUA 3QEXA 1VSKA 4LD0A 3LDSA 1JXEA 4M3XA 3THVA 4CEDA 3JS6A 3LWMA 2UUCK 4F3OA 3ID6A 1QE1A 5C2FA 1UA1A 3SJHA 1IKWA 2RF2A 4KBOA 2QWLA 1ZXOA 1U49A 1MWMA 1T7PA 3T1HK 1TKXA 2HNDA 4MDAA 1EP4A 3CCQN 4FPBA 1VSIA 1ZC6A 3AA4A 3BDPA 1NJYA 2D0AA 4GMJB 3T69A 1NKCA 1BIUA 4DV3K 2OA8A 3G4SN 3QEVA 3K58A 1EXQA 3NF8A 4CJ5A 2VQEK 1D4XA 4RG8A 3JXUA 2X74A 1BO5O 1S1TA 3LP2A 1WSIA 1JLEA 4MLHA 4DFPA 3V9WA 4FWOA 1T8EA 3H6EA 3KLHA 1G15A 4DQIA 2ZF5O 2JLEA 4E7LA 3NFAA 3U4LA 4XH1A 3PUFA 3HTVA 4O8KA 3V1QA 2YNIA 3C94A 3CCUN 1NWKA 1W7AA 3M8SA 3T19A 2HMIA 4CBXA 4CGIA 1N36K 2BE2A 3NVMA 4HWIA 4RW9A 2P9UA 3BGRA 2P9UB 2WBNA 3TTCA 4LC9B 4OKEA 4FL9A 2CH5A 5J2PA 3EE9A 3H1QA 3E66A 1NU0A 3K5LA 4CEOA 1VRUA 4DR7K 3VQ5A 1KVCA 3THWA 2NNWA 2AJQA 1NGFA 3THWB 1J5OA 3HSCA 2HB5A 2D0OA 4X62K 5LJVA 1N34K 4GVEA 4IWVA 3HZ6A 5EOYA 4PL7A 1NOZA 4CHZA 3KD5E 4IBNA 4JHDA 4E1NA 4JHDB 3OA9A 1EETA 3C95A 3R3LA 4Z4IA 1HMVA 3PX4A 5AQIA 4BG9A 1X9SA 3EZWA 2QWMA 2FSJA 3D6RA 3OYNA 3AVBA 4FJMA 2Q36A 2DFHA 2HHVA 1A5WA 4XIUA 4CK1A 1MDUB 3ITHA 2YHYA 1OKJA 4KREA 5C10A 3VGMA 3HP9A 3LDQA 3IKMA 5AQXA 5KPTA 3K57A 4C8MA 3I55N 3CF5L 2QKKA 5M1QA 2HVIA 5M1KA 4CK2A 3H3NO 3ZT4A 1OH6A 1UA0A 3IG1A 2E2NA 4E19A 3M1FA 3F9MA 3CCEN 5DM7L 1K8KA 3KD1E 1K8KB 2I7PA 2P9IA 3CCSN 3DJCA 2P9IB 3B6OA 5HL7L 1IV0A 4B08A 4DV1K 3BZCA 5GIPA 2BGGA 3ZSYA 3L2UA 4O8UA 5KPZA 2Y1JA 3VQBA 5AQHA 5D3GA 2F8TA 4BDPA 4FWQA 3MN5A 2IVOA 1NMNA 2A1SA 2ETJA 1B9FA 3DOLA 4E7IA 1QS4A 4FJJA 3LDNA 4E1JA 2A6AA 4J2DA 3VERA 3EO3A 1GLBG 1RILA 4JS4A 5AQVA 3MCPA 5KTQA 1KAZA 3TAEA 2QA4N 3ZCMA 2UUBK 4IG0A 5AQUA 3OYFA 3UKRB 4CHYA 4YOTA 1W2BM 1NK7A 4M45A 2VG6A 1QVGM 4DTSA 3E9OA 3PSFA 2AA4A 5J2MA 2NRWA 4H03B 3MMVA 2Q0UA 3EZ5A 1C0MA 4KFBA 3VETA 3ZSQA 3AV9A 4OPHA 4E0DA 1HPZA 2O8CA 4IO8A 4IXCA 4FWKA 2O8CB 3CJAA 4JI2K 1Z05A 3A5LC 4Q5VA 1RBTA 3SQ1A 1WLJA 3J7YP 3MEEA 3U9ZA 1HRHA 2KZMA 2IAJA 3HRGA 1FKOA 5GIOA 3VGLA 3OYMA 3MDQA 1A5VA 2E2OA 3SQ4A 1HKCA 3LANA 4CESA 2QTDA 1SQKA 3NF9A 3NGZA 4HCBA 1JXBA 3WNHA 2CGKA 3KKRA 5FPNA 1HNWK 3RTVA 5HLFA 4RWTA 3OJSA 1QZ5A 4H0YB 1LV5A 5BRDA 4CECA 3RMDA 4DUZK 1BUPA 4LF4K 4BRAA 4BACA 2D4WA 1ESVA 4GY2B 4FW2A 1RTJA 3EKUA 1KRPA 4OKKA 3V1RA 3LAKA 3BF1A 4FK2A 3MXJA 2NRRA 1RDBA 4I9QA 1U45A 3CCLN 1BG3A 1RT7A 1FKPA 3O1BA 4FVMA 4BY9C 3VF2A 4BROA 2B6AA 3OYIA 3T7ZA 5ADXA 3K9JA 3CD6N 3O3GA 4PKIA 4AHVA 3ZT1A 4E89A 3AA5X 1WNSA 3LALA 1SKRA 4KHWA 5B8HA 3OYHA 3RRHA 3O9UA 3CPWM 4AH9A 3SUPA 1J9AA 3WQTA 1NMDA 4JD2A 4BR4A 1SKWA 1WSFA 3PO5A 4I2PA 4KI4A 1YJ9N 2KFZA 5FLXO 3A5MC 4CBWA 1TK0A 2IIRA 1EWRA 3T1AA 4CF1A 3LP3A 3ATUA 1YJWN 2X6SA 3AARA 1Z26A 5AQRA 3LDLA 4CEAA 3K5NA 5AZIA 4JKAA 5GAGP 3VPZA 5AZIB 3C7NA 4CF0A 2PFUA 2QW9A 5CYQA 3VESA 4CJLA 3FLCO 4FJNA 3C7NB 1NGEA 2XHBA 5ADXH 2VWJA 3E1YA 2VYPA 5M1OA 4GV3A 3CJ7A 4FK0A 4NO7A 3PY8A 4DLGA 3VA0A 2ZD1A 3ZSXA 2KQ2A 1NJXA 1KVBA 4H5NA 4PA1A 3R8EA 4FXDA 1X9MA 3C0BA 4IFVA 3DRPA 1VSEA 3K59A 4DQQA 2E6MA 1DTQA 3LDOA 3W0LA 3E9LA 1JLAA 4DR5K 3D0PA 4DR3K 3SUNA 1HLUA 1L5UA 2HVHA 2O8FA 2O8EA 4AF1A 2P5GA 4KH6A 2O8FB 2O8EB 4K42A 3QDKA 2VGNA 4B9LA 1IO2A 3GL1A 1TL1A 2GTDA 1C0FA 1P8ZA 2BANA 3ZYYX 2D0BA 4H0PA 4M63C 3SNNA 2PY5A 1BI4A 3CERA 4IEIA 1BI4B 3GBTA 5CR4A 2FBYA 2E4LA 2BH1A 4W5OA 3DLLL 3I8DA 2Q97A 2ZE2A 2YX6A 4CJ3A 1CZAN 4O0IA 2FBTA 3AA3A 3TI0A 4HHTA 4M3YA
chains in the Genus database with same CATH topology
3O6WA 1BA0A 3KWGA 3L0QA 2GUPA 3IUCA 4BR7A 2F7TA 3P38A 3SBGA 5EVZA 3QFPA 4JKCA 5LY3A 3AGKA 1NJIO 3CCJN 2YJFA 1BOTO 1NGIA 3AAQA 3P4IA 5EY4A 3SMPA 5JLFA 2WUSA 3L4QA 2ITMA 1VQ5N 1TYQA 2JWKA 4BRLA 3AAPA 4YOVA 1TYQB 4PL8A 4BC5A 1NLVA 2D1KA 3Q7BA 1QQOA 2I7NA 3C65A 3BF3A 3I8BA 1S72N 1GLCG 4U67L 4UY8O 3PIOL 3SBTA 1ILYA 3M6GA 5AQPA 2PAVA 2V7YA 3KWIA 3QICA 4MO5A 5TKYA 2GWJA 3I33A 2CGJA 4JK9A 2QWNA 3O9SA 5BPNA 1VQPN 3H46O 2YHWA 3J8AA 4CZFA 1Y64A 1Q7YO 4BRQA 3CJ1A 5FPDA 3ATVA 1JCGA 4WYBA 4ILJA 3DAWA 1J6ZA 4A62A 4AM6A 5M1FA 4WQ5A 5F2RA 3LM2A 1S3XA 1KAYA 3QB0A 1X3NA 1DGKN 3O5BA 3NVKA 3BEXA 4OO1J 1ATNA 1HUXA 3A5NC 4GNIA 5JLHA 1P90A 1VQMN 2E1ZA 2YCHA 2P9KA 5AQNA 4JEPA 1EO1A 1GLDG 4B1UB 2BUPA 2P9KB 1T6DA 4WQ5C 4BVPA 2NZTA 4H0TB 4B1VA 1HPMA 1V4TA 3A0IX 4JD2B 1XUPO 3SLCA 5CE3A 1XQSC 2P9LA 4PKGA 4FVUA 2GEMA 4PKHA 2HBLA 3H45C 4JKHA 3FE1A 1ZBSA 1NGJA 3JS6A 5AQKA 3F2KA 3ID6A 4FWMA 5C2FA 3SJHA 4PHTX 3TTFA 4B1YB 4KBOA 2QWLA 4A5BA 5BRHA 1WOQA 1ZXOA 3VF4A 1MWMA 2FF3B 2IVPA 3TSPA 3VTHA 4MDAA 1TUUA 2A5XA 3FZLA 5F0XA 4CZMA 3CCQN 2QXLA 4FPBA 1ZC6A 1TUYA 3TPQA 1EQYA 2OTLN 3TTDA 3T69A 4DB3A 4BRMA 3W3DA 1X3MA 4XH5A 4BC2A 1C0GA 3G4SN 4ISEA 2QI2A 1ATRA 4MO4A 3CPEA 2GWKA 2RHKA 3FFKB 3U9DA 3OW2M 1D4XA 2DPNA 4ILGB 2QWOA 3CCVN 1WUAA 3JXUA 3VF6A 1BO5O 4FOIA 2KHOA 4BRDA 1RDUA 4H0XB 3CXCM 2CH6A 3O9RA 4IFEA 4MLHA 1T3VA 2IVNA 3OBWA 3FZMA 4FWOA 5AQWA 2V51B 3O4WA 1NBWA 3H6EA 3CHWA 3RVCA 2ZF5O 3UKRA 2E8AA 4IOXA 4BGAA 4BR2A 3QFUA 2ZJPL 2BTFA 2V52B 3U4LA 3IDHA 4XH1A 5AQYA 4BRIA 3F5TA 1U6ZA 4CZHA 3HTVA 4O8KA 5I9EB 3ZETA 3CCUN 3D7EO 3G71N 4O5FA 5AQTA 1RFQA 1NWKA 1KXPA 1YJNN 3ZETB 2HF4A 3L6QA 4CBXA 2P9NA 3VEWA 3DWLA 3NVMA 4HWIA 3N4PA 2P9NB 2W41A 3HOSA 4FPAA 3EE8A 5BN8A 2P9UA 2WC9A 4CJ7A 2E1YA 5F1XA 2GELA 1YITN 2P9UB 4H5TA 2ZGZA 2WBNA 3ULEA 2Q0RA 3TTCA 3AGRA 5JVGL 5AQJA 4LC9B 3ULEB 4YOWA 1S22A 3QBWA 3ENBA 2CH5A 3O8MA 4FL9A 1IJJA 2HBMA 4EFHA 3EE9A 1ATSA 1Q81O 3H1QA 1HX1A 3MN6A 4FO0A 2E2PA 3E66A 4JK8A 3MN7A 3H1VX 3VEYA 2F9WA 3DXMA 4OPAA 2NNWA 3O9QA 2VWBA 3GDQA 1NGFA 4JKFA 4WQ4C 2FXUA 3DXMB 4FWSA 3HSCA 4K43A 4JNEA 3MWTA 4YDUA 2D0OA 3HBTA 1YIJN 2HBJA 3CJBA 3L4IA 5LJVA 3VENA 5DM6L 2Q31A 1HKBA 3O1WA 4YOXA 4GVEA 4IWVA 3HZ6A 4QS8A 5EOYA 1NGHA 5ELZA 2VGMA 3VTIA 4PL7A 1Q86O 1BDGA 1VAZA 4BGBA 3WXJA 3K9KA 2ASPA 4JHDA 4RTFD 4YDUC 5JVHL 1LCUA 4CZGA 3WUHA 4JHDB 3HOTA 3OA9A 4I6MA 2PBDA 4CZKA 3R3LA 3ID8A 3Q7CA 4I6MB 5FPMA 1QZ6A 5C0YA 2WFBA 3R9PA 5AQIA 4BG9A 3EZWA 2QWMA 2FSJA 3D6RA 4IOAL 1HJOA 2ZWHA 1DT9A 2Q36A 4JKDA 4DHYA 3CMEN 3J7ZO 4ISFA 1MDUB 3KVGA 3VEVA 3WXMB 1E4FT 4FWRA 4DCHA 2NLXA 3MCAB 2YHYA 4JN4A 3SAFA 1K9MO 1OKJA 4A59A 5H1SQ 5C10A 2D0PA 3VGMA 3VMFB 3LDQA 4BQZA 3IKMA 2HBKA 5AQXA 1NGDA 3C6AA 4BR0A 5KPTA 4L3QA 3CETA 3I55N 3CF5L 4K41A 3ENHA 3QBXA 3EN9A 5M1QA 5M1KA 3RSEA 4CD1A 3H3NO 3RSEB 4BRCA 4IDHA 2E2NA 4MLEA 1T44A 4BG8A 5LJWA 2P9LB 3C6HA 3KK7A 3M1FA 4CZJA 4R79A 2V7ZA 5KPRA 3F9MA 5GAHP 5BRFA 3HM8A 3H3OB 4U7BA 3CCEN 5DM7L 1K8KA 3SAHA 2P9SA 3FR0A 4B1XB 3GE1A 2A40A 3TSQA 1K8KB 4JK7A 2I7PA 3WXLA 2P9IA 3CCSN 3DJCA 3MWPA 1VQ7N 2FF6A 2YI1A 2P9IB 3CQYA 4FWNA 4EHTA 4YOYA 5HL7L 3KZBA 4WCEL 3FZHA 5JMVA 4RCHA 3TU5A 2E20A 5GIPA 4WFAL 1GLFO 1MA9B 4O8UA 5KPZA 1VQ9N 5AQHA 2ZJRL 3LM9A 3BUZB 4BVOA 4IOCL 1OVYA 3CQXA 2KLAA 4FWQA 3MN5A 2IVOA 3G6EN 3MX2A 4C1NI 4GV9A 4J8FA 1KAXA 2E88A 3EKSA 1V4SA 1VQ4N 1GLJO 3EL2A 5BPMA 3E9PA 4A2BA 4CD3A 5GAEP 3LDNA 5E84A 2A6AA 4E1JA 4FWPA 4A2AA 3R1XA 3EO3A 3VERA 4M7YA 1GLBG 2OANA 5KQ8A 5AQVA 3MCPA 5AQQA 4B1ZA 1LOTB 1O13A 1KAZA 3CJ9A 1QHAA 2QA4N 5AQUA 3D2EA 5M1NA 1K8AO 3UKRB 5GADP 4YOTA 3D2EB 5BREA 1W2BM 1M1KO 1QVGM 4FSVA 3R6MA 2NRZA 5C2DA 2A42A 4IEEA 3E9OA 5MLCQ 5BN9A 2AA4A 4IJAA 2NRWA 4H03B 3MMVA 2Q0UA 2HMPA 1NGGA 2QWQA 3QMLA 3VETA 4OPHA 4Z94A 4QS9A 1VQKN 4H5RA 3HI0A 2FSKA 3WXIA 1JCEA 2A3ZA 4A57A 3CMAN 1MWKA 2ZJQL 4IO8A 4WQ4A 3ZX0A 2A41A 4IXCA 4BC4A 4FWKA 4DQ8A 3CJAA 4JKGA 1Z05A 4IJNA 4MDBA 2NRHA 4JKGB 5AFUA 5GINA 1NM1A 3A5LC 4BRGA 5AQSA 1N8RO 2W40A 5EXWA 3WQUA 4C1NK 3CJCA 2ASMA 3VGKA 3BP8A 1VQ6N 3ZEUA 3U9ZA 5AQOA 2VCPA 4EIAA 3HRGA 3SMSA 3WT0A 3VGLA 5GIOA 3MDQA 4ISGA 5BPLA 3U8XA 2E2OA 4XH4A 1HKCA 2QTDA 3CCMN 1VQON 1SQKA 1GLLO 4BRPA 4QS7A 2CGKA 1YXQA 5FPNA 1KQSM 2OTJN 3GOIA 3WXKA 4RWTA 1QZ5A 1Q82O 1BWFO 4EAHD 4H0YB 5BRDA 4BRHA 2J4RA 3AY9A 1BUPA 5AZJA 2FLOA 3VEOA 4BRAA 3I56N 2D4WA 2QEXN 1HKGA 1ESVA 2JWLA 2Q1NA 1QQNA 3MN9A 4H0VB 4GY2B 5AZJB 4CZEA 3CI5A 4H0OA 1SAZA 3EKUA 4WFNL 1U2VA 4BC3A 2KKZA 1SZ2A 1U2VB 3BF1A 3GG4A 5AR0A 5AFUH 4XEIA 1JCFA 3UB5A 3G25A 3VOVA 3NMUA 2NRRA 1M90O 3CCLN 1BG3A 2ZGYA 3B8AX 3ZX2A 3O1BA 3CC7N 3KHYA 2NRTA 4BY9C 2ASOA 3VF2A 4BROA 3SAGA 4A61A 3T7ZA 5ADXA 3M5RA 5AQMA 2F9TA 4YOUA 3K9JA 3CC2N 2CGLA 3N4QA 5FPEA 3DXKA 1T6CA 3CD6N 4EHUA 1YAGA 3DXKB 2HOEA 4PKIA 3FGUA 1GLAG 2P9SB 1NGBA 2NRXA 1YF5L 3PLAA 4Y0WA 3O9TA 1IG8A 4JKEA 4CZIA 1X9JA 5B8HA 3O9UA 3CPWM 3WQTA 1NMDA 3ZX3A 4JD2A 1SS6A 2QWPA 2H3GX 4ILHA 1KD1O 4BR4A 1YVNA 4NLCA 4GV6A 4BRKA 1YJ9N 4BRNA 3A5MC 4CBWA 5C15A 1E4GT 1Q18A 2IIRA 4DKWA 4NB4A 3IMXA 3CCRN 3ATUA 1VQ8N 1YJWN 5AQLA 3AARA 5AQRA 3WEEA 3LDLA 3FZKA 5C12A 1BA1A 5AZIA 4JKAA 3WEEB 5GAGP 2AP1A 3MK6A 5AZIB 3C7NA 3UE5A 2PFUA 3VPZA 4BR9A 2QW9A 3OBYA 3VESA 4CZLA 3FLCO 3C7NB 1NGEA 3O08A 4KH4A 2YJEA 4BQLA 4CI6A 4B9QA 1G99A 4KH5A 5ADXH 4BRFA 3E1YA 1KC8O 4AM7A 2VYPA 5M1OA 5JICA 4GV3A 3OHRA 2GX9A 3TSUA 3CJ7A 3MX5A 2YHXA 3CIPA 4IZ9A 2Q2RA 5AQGA 3LDPA 4FOEA 4NO7A 4JAXA 2P9PA 1K73O 1Z6RA 1H1VA 2P9PB 3P31A 1YUWA 5AQFA 3UKUA 2QWRA 3VEXA 4B1WB 4BREA 4H5NA 1QVFM 4G9ZA 2HF3A 4JKBA 4K25A 3R8EA 3UKUB 3VEZA 3ENOA 3D2FA 4M7XA 2RE2A 1XC3A 3C0BA 1JJ2M 2HSTA 3D2FB 5KQDA 4F9OA 2UYTA 3A5OC 5E26A 3LDOA 5AQZA 5BR9A 1BU6O 3A8YA 2QM1A 3W0LA 1NGCA 3E9LA 4C23A 3S41A 2FSNA 1HLUA 4HTLA 3PIPL 4AF1A 2NRVA 4KH6A 1VQNN 3O80A 3M3ZA 3P39A 3QDKA 4K42A 2E2QA 2VGNA 5EX5A 4WF9L 3GL1A 3SK3A 3CC4N 5M1PA 2GTDA 1C0FA 1RGIA 4CBUA 1NGAA 4YORA 1P8ZA 4A5AA 3ZYYX 3IFRA 1YHQN 4FWLA 1DKGD 3LL3A 1YI2N 5HOOA 4H0PA 4M63C 2EWSA 5CHIA 4NLBA 1GLEG 3ZEUB 1VQLN 3CERA 3FZFA 4IEIA 4IO9L 5TKWA 3GBTA 1W97L 5CR4A 4WFBL 4H5WA 4H5VA 1R59O 1RDWX 2BH1A 3DLLL 2Q97A 2YX6A 1CZAN 4BR5A 1DEJA 1QQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7B A;  4MDA A;  3K9J A;  3HOS A;  3HOT A;  5HOO A;  3F2K A;  4R79 A;  4MDB A;  2F7T A;  5CR4 A;  3K9K A; 
#chains in the Genus database with same CATH topology
 3S9H A;  2XO7 A;  1WAJ A;  1S1U A;  3IUC A;  4DV6 K;  4HUF A;  4JKC A;  3QO9 A;  1CXU A;  5HRS A;  3CCJ N;  2WUS A;  2ITM A;  1QSY A;  4BRL A;  3AAP A;  4YOV A;  1EWQ A;  1C1C A;  4DFJ A;  3Q7B A;  1QQO A;  1RT6 A;  4MFB A;  4DV7 K;  4U67 L;  3S3M A;  1ILY A;  3VQD A;  2DFE A;  4MO5 A;  2GWJ A;  3I33 A;  4GVM A;  4JK9 A;  2QWN A;  4X64 K;  4CZF A;  2UXB K;  2KW4 A;  3VQP A;  1JCG A;  4ILJ A;  4DTU A;  4B9T A;  2IOC A;  3LM2 A;  1KAY A;  3QB0 A;  1DGK N;  4LF5 K;  3BEX A;  4K0K K;  1ZBF A;  3P1G A;  1ATN A;  2O8B B;  3A5N C;  1P90 A;  4Z4C A;  5AQN A;  4B1U B;  1X9W A;  2BUP A;  2NZT A;  4H0T B;  1U04 A;  5CE3 A;  1XUP O;  3FE1 A;  4FJ9 A;  4CJW A;  4J2A A;  1WOQ A;  2IVP A;  3TSP A;  2NUB A;  3VTH A;  3KTQ A;  1TUU A;  2A5X A;  5F0X A;  1Q9X A;  4CZM A;  2QXL A;  1TUY A;  3TPQ A;  3NBP A;  1EQY A;  4FLV A;  2X6N A;  4DG1 A;  3W3D A;  3NHG A;  4CJQ A;  1ATR A;  4IKF A;  4F2S A;  3WNG A;  2RHK A;  3L3U A;  4NCB A;  4CIE A;  4O5B A;  3CCV N;  3ASM A;  4O4G A;  3VF6 A;  4FOI A;  4BRD A;  1RDU A;  4H0X B;  4E7H A;  2CH6 A;  4FM2 A;  3OBW A;  3FZM A;  5AQW A;  4CJP A;  3O4W A;  3IRX A;  1ZBI A;  3RVC A;  3SPZ A;  2E8A A;  3V81 A;  2ZJP L;  2HHU A;  3C6U A;  1HNV A;  3ZSR A;  4N56 A;  4I9L A;  3ZET A;  1OH7 A;  4LSL A;  3ZET B;  1TVR A;  3DWL A;  3M8P A;  4CE9 A;  3NDK A;  4FM0 A;  2OZS A;  3HOS A;  4FPA A;  2WC9 A;  2E1Y A;  1IH7 A;  4H5T A;  4K8Z A;  3SUO A;  3AGR A;  5JVG L;  4YOW A;  1NKB A;  3OYJ A;  1IJJ A;  2HBM A;  1ATS A;  1TGO A;  3S3N A;  1N6Q A;  1HX1 A;  3MN7 A;  3AVN A;  4ELV A;  4CJV A;  1YT3 A;  3O9Q A;  4JKF A;  2FXU A;  4FWS A;  4OJR A;  4HTU A;  4K43 A;  3RR8 A;  3HBT A;  1YIJ N;  3L4I A;  3LZI A;  3VEN A;  3AVH A;  3O1W A;  4YOX A;  3QES A;  4QS8 A;  5ELZ A;  2VGM A;  4NXM K;  3ZLJ A;  4X65 K;  3WXJ A;  4YDU C;  5DMR A;  3JYT A;  4I6M A;  1QTM A;  4CZK A;  4CGD A;  3LPT A;  4I6M B;  3Q7C A;  3R9P A;  2HNY A;  3CG7 A;  5KI6 A;  4IOA L;  1ITG A;  4FJ5 A;  1DT9 A;  1OH5 A;  3ZSV A;  3HXM A;  1RT5 A;  3VEV A;  4FWR A;  4RW6 A;  2NLX A;  1WAF A;  3SAF A;  1GOB A;  1RDD A;  2D0P A;  1NGD A;  3CET A;  2HHX A;  3RSE A;  4CD1 A;  4KTZ A;  3RSE B;  2OPP A;  4AHR A;  4CHO A;  4R79 A;  4B3R K;  3CM6 A;  5GAH P;  2HHT A;  3H3O B;  3SV4 A;  3SAH A;  2P9S A;  3OYL A;  3TSQ A;  4JK7 A;  2FBX A;  1U48 A;  1VSF A;  3F73 A;  3KZB A;  4RCH A;  1YTU A;  1LWC A;  4N47 A;  1GLF O;  1NOY A;  2W6L A;  1VQ9 N;  2ZQB A;  2ZJR L;  3LM9 A;  3O4Q A;  1FK9 A;  1OVY A;  4CFB A;  3CQX A;  2KLA A;  3SPY A;  2DTU A;  2Y1I A;  3G6E N;  4J8F A;  5DK5 A;  1DTT A;  1V4S A;  4CVN E;  4CFC A;  3EYZ A;  3EL2 A;  2UXC K;  3NF6 A;  1D9D A;  5HRR A;  2F8S A;  4M7Y A;  1JL1 A;  4B1Z A;  1LOT B;  1O13 A;  3CJ9 A;  1LW0 A;  3RWU A;  5M1N A;  1D9F A;  4LH4 A;  5BRE A;  4DTJ A;  1M1K O;  3O4N A;  5C2D A;  3TAN A;  4RW4 A;  5BN9 A;  5HRN A;  1KFS A;  2HMP A;  1HYV A;  2G8W A;  1Q9Y A;  4DQS A;  1NKE A;  3HT3 A;  4A57 A;  1JCE A;  3D45 A;  3CMA N;  1MWK A;  3AVC A;  4WQ4 A;  3ZX0 A;  3THX A;  4MQ3 A;  4JI4 K;  4JKG A;  3THX B;  4JKG B;  2YKM A;  4JRP A;  1NM1 A;  4BRG A;  3HPG A;  4CGJ A;  3TAB A;  2W40 A;  5EXW A;  3WQU A;  3KLF A;  1JLF A;  3OS1 A;  3VGK A;  3BP8 A;  4V19 S;  1VQ6 N;  1NJZ A;  1IBK K;  4EIA A;  3MED A;  4Y1C A;  4DR1 K;  1UAX A;  1RCH A;  4ISG A;  3U8X A;  4XH4 A;  4DV5 K;  5E41 A;  4H4M A;  3CCM N;  4YNQ A;  2PZS A;  3DLB A;  4BDZ A;  1Z25 A;  1GOA A;  3RRG A;  4E7K A;  2O4G A;  1BWF O;  4M41 A;  4FYD A;  1DLO A;  4BRH A;  3ZSO A;  3AY9 A;  4F8R A;  2QEX N;  2GUI A;  1HKG A;  4H0V B;  2Q1N A;  1N32 K;  3MN9 A;  1BCO A;  1SAZ A;  4KAZ A;  4DQR A;  1U2V A;  3OJU A;  1SZ2 A;  4FJK A;  1VK0 A;  1U2V B;  2P51 A;  3GG4 A;  5AR0 A;  1WN7 A;  3VQA A;  4J2B A;  4C8N A;  5HBM A;  3T3F A;  3KIO A;  1SKS A;  3B8A X;  3ZX2 A;  3CFR A;  3KHY A;  2NRT A;  2ASO A;  4DS4 A;  4A61 A;  1TKD A;  4YOU A;  4FCY A;  1L3V A;  4AHT A;  1YVU A;  3FFI A;  4EHU A;  2HOE A;  3OS2 A;  3FGU A;  3OYC A;  4CEB A;  3QNN A;  3HVT A;  3DI6 A;  3PLA A;  3HPH A;  1IG8 A;  4JKE A;  1A5X A;  4IG3 A;  4GKJ K;  3HK2 A;  1S6Q A;  1HYZ A;  2QWP A;  2H3G X;  4ILH A;  1YVN A;  4NLC A;  4GV6 A;  1L3U A;  4KTW A;  1BL3 A;  2XY7 A;  5C15 A;  5KGX A;  1Q18 A;  4CF2 A;  2YHA A;  4BE0 A;  1S1X A;  2UU9 K;  3WEE A;  1RT1 A;  3B6P A;  1FXX A;  4OX9 K;  4DR6 K;  3WEE B;  2AP1 A;  1QSL A;  4CZL A;  3QEI A;  1I3A A;  3OBY A;  4DTP A;  1N5Y A;  4CI6 A;  2YJE A;  2P1J A;  4CF8 A;  4B9Q A;  1TAQ A;  3SYZ A;  4KH5 A;  1KC8 O;  4BRF A;  4AM7 A;  1T03 A;  4JI0 K;  4ZTJ A;  1J54 A;  3OHR A;  2D5R A;  3AA2 A;  2YHX A;  4PWD A;  1XHX A;  2Q2R A;  3QIP A;  5FRN A;  4QOZ B;  4LF7 K;  4JAX A;  3ZSW A;  4BRE A;  1YUW A;  3UKU A;  2QWR A;  1QVF M;  3AO1 A;  4JKB A;  3UKU B;  4W5T A;  2IC3 A;  4M7X A;  2RE2 A;  4F9O A;  2UYT A;  4H4O A;  5BR9 A;  1UOC A;  1BU6 O;  3A8Y A;  4FJH A;  1NGC A;  2FSN A;  3LZJ A;  4DWI A;  4HTL A;  1BHL A;  2NRV A;  4JI1 K;  3L3V A;  3M3Z A;  3P39 A;  5SWM A;  1XWL A;  3NCI A;  3ZSZ A;  3PSI A;  4CIF A;  1S9E A;  1RGI A;  1HQE A;  4BWJ A;  3QEP A;  3QNO A;  4OLB A;  3OYK A;  3DLR A;  3CQ8 A;  1YI2 N;  1UWB A;  4DMN A;  4DR4 K;  1WSJ A;  3FZF A;  4Z4F A;  3NH1 A;  3DOK A;  5LL6 Z;  4WFB L;  3QER A;  5HRO A;  4H5W A;  4H5V A;  5A2Q O;  3V9S A;  4BR7 A;  1QQM A;  3NGY A;  4B3T K;  2F7T A;  3VQQ A;  3SQ0 A;  5LY3 A;  3F9K A;  2YJF A;  3P4I A;  1K6Y A;  3AO4 A;  1TK5 A;  2JWK A;  1QQC A;  3SI6 A;  4BC5 A;  5BR8 K;  4DTR A;  3BF3 A;  4UY8 O;  3SBT A;  1KLN A;  4HUG A;  3M6G A;  1VQP N;  2RN2 A;  2YHW A;  3G10 A;  3TAM A;  4WYB A;  3A2F A;  1J6Z A;  4A62 A;  4G1Q A;  5I42 A;  3QEW A;  1X3N A;  2YNG A;  3U6F A;  4GNI A;  1VQM N;  2E1Z A;  3MEG A;  3EY1 A;  5I3U A;  3VQ4 A;  4WQ5 C;  4B1V A;  4F2R A;  1HNX K;  2WON A;  4ID5 A;  4DF4 A;  1LWF A;  4AHU A;  2WOM A;  5FRM A;  2IDO A;  4JD2 B;  4LFC K;  1XQS C;  2P9L A;  4KKO A;  2GEM A;  4PKH A;  2HBL A;  1HYS A;  4KI6 A;  1ZBS A;  5AQK A;  3F2K A;  4DSL A;  4AQY K;  3NH0 A;  4PHT X;  4B1Y B;  4L8R B;  5BRH A;  3VF4 A;  2FF3 B;  3FZL A;  4DLE A;  3MEC A;  3BY5 A;  3KK3 A;  4CER A;  4E7J A;  2OTL N;  1VHX A;  3TTD A;  4DB3 A;  4BRM A;  4BC2 A;  1X3M A;  2FC0 A;  4KHS A;  4YHH K;  1C0G A;  1TKT A;  4B9M A;  3NAE A;  3OYG A;  4KHP K;  2QI2 A;  1WSE A;  3ZT3 A;  3CPE A;  4CJS A;  3IS9 A;  2GWK A;  1J5E K;  3FFK B;  4LH5 A;  5J2N A;  3OW2 M;  1OH8 A;  2DPN A;  4ILG B;  4DQP A;  1WUA A;  2QKB A;  2YNH A;  4JI5 K;  3L2V A;  2IVN A;  1IBL K;  1NBW A;  2UUA K;  3CHW A;  3WNF A;  2XY8 A;  4IOX A;  4BR2 A;  2DY4 A;  3QFU A;  2BTF A;  2V52 B;  3IDH A;  5AQY A;  2VG7 A;  1U6Z A;  4CZH A;  3UIQ A;  4GW6 A;  4OVL A;  4LFB K;  3D7E O;  4M3R A;  3G71 N;  4O5F A;  5AQT A;  1RFQ A;  1KXP A;  3AVI A;  3OYB A;  1XI1 A;  2HF4 A;  3VEW A;  3MXI A;  3N4P A;  5BN8 A;  4CJ7 A;  4N41 A;  1SL0 A;  5F1X A;  2GEL A;  4DTX A;  2ZGZ A;  3ULE A;  4DTM A;  3ULE B;  3DYA A;  3ENB A;  3QBW A;  3O8M A;  4FLY A;  1QSS A;  4DFK A;  4DSE A;  3MN6 A;  2E2P A;  4JK8 A;  3AO3 A;  3V4I A;  3HST B;  3H1V X;  3DXM A;  4OPA A;  4WQ4 C;  4CHP A;  3GDQ A;  3DXM B;  4FM1 A;  4W5N A;  2G8I A;  2HBJ A;  3CJB A;  4FZZ A;  4O44 A;  5DM6 L;  2Q31 A;  4CGH A;  3TR8 A;  3VQ7 A;  4FJ8 A;  2HHS A;  1NGH A;  3VTI A;  1Q86 O;  1BDG A;  4BGB A;  2G8H A;  5JVH L;  1LCU A;  3NH2 A;  3TAR A;  3WUH A;  4O55 A;  3HOT A;  2OCE A;  4FJI A;  2FBV A;  3M8R A;  3LAM A;  5C0Y A;  1R0A A;  1CZ9 A;  4CK3 A;  2IS3 A;  2ZWH A;  4B9N A;  2GBZ A;  3WXM B;  2ITG A;  1K9M O;  5H1S Q;  4FJL A;  3I0R A;  2HBK A;  3C6A A;  4BR0 A;  3TAF A;  5HP1 A;  4L3Q A;  3AVA A;  4K41 A;  3QBX A;  1JLC A;  4CFA A;  3AVG A;  4CJT A;  3H08 A;  4BRC A;  4IDH A;  3NGI A;  2XY6 A;  2G8K A;  5JS1 A;  3C6H A;  4CF9 A;  4OGE A;  5KPR A;  3TAG A;  1VSH A;  3AVL A;  3HM8 A;  4U7B A;  2G8V A;  5SZT A;  3PX0 A;  3GE1 A;  3VQ9 A;  4NYN A;  3WXL A;  1NK6 A;  3MWP A;  4JI7 K;  1RT2 A;  1VQ7 N;  2FF6 A;  2YI1 A;  3CQY A;  4FWN A;  3RMA A;  1VSL A;  4EHT A;  4DV4 K;  4DF8 A;  5JMV A;  1S1V A;  3TU5 A;  1KSP A;  5FRO A;  1MA9 B;  1QHT A;  4RW7 A;  4IOC L;  1VSM A;  3CFP A;  5IT9 O;  5C25 A;  1RDA A;  3LP1 A;  3MX2 A;  4C1N I;  1TK8 A;  3EEQ A;  1KAX A;  4B8C A;  1XMQ K;  3EKS A;  1VQ4 N;  1GLJ O;  3E9P A;  4A2B A;  4CD3 A;  5E84 A;  4A2A A;  1RTH A;  2Z1G A;  3M8Q A;  4TSX A;  4M3U A;  5AQQ A;  1TKZ A;  3HPO A;  1K8A O;  4ELU A;  4B3S K;  5GAD P;  1IBM K;  4BDY A;  4EZ9 A;  2NRZ A;  4IEE A;  5MLC Q;  3V9X A;  5J1E A;  4M3T A;  2QWQ A;  3QML A;  3MXM A;  1SUQ A;  4DSK A;  4Z94 A;  4QS9 A;  4H5R A;  2FSK A;  3WXI A;  4B3O A;  2ZJQ L;  2I5J A;  3VQ6 A;  2LSN A;  3U3Y A;  3AVF A;  4IJN A;  4MDB A;  4FW1 A;  4DSJ A;  3CJC A;  3ZEU A;  3SQ2 A;  2PYL A;  4CGG A;  3WT0 A;  2DFF A;  1RBV A;  4PUO A;  1HNZ K;  3K5M A;  1VQO N;  3KLG A;  4CEE A;  4O0J A;  5CZ2 A;  2EX3 A;  1YXQ A;  1KQS M;  2OTJ N;  2HNZ A;  1B92 A;  4KV8 A;  1Q82 O;  4J2E A;  5IWA K;  2ATQ A;  1C0U A;  4HVJ A;  1IKY A;  4CHQ A;  3VEO A;  3I56 N;  4AIL C;  1C1B A;  1QQN A;  4ZHR A;  4KO0 A;  4CZE A;  2OPS A;  3CI5 A;  3K2P A;  4WFN L;  3U3G A;  4BC3 A;  4PY5 A;  1XNQ K;  3UB5 A;  3NMU A;  1M90 O;  3MAQ A;  3IAY A;  2ZGY A;  1KCF A;  3VQ8 A;  3CC7 N;  1HQU A;  4JI3 K;  1OVQ A;  3SAG A;  3LWL A;  2F96 A;  3M5R A;  4F3T A;  5AQM A;  2F9T A;  1KFD A;  1RT4 A;  4CJK A;  4FJX A;  3P5J A;  1VSD A;  3PO4 A;  1W0H A;  2P9S B;  3ALY A;  1YF5 L;  4CZI A;  1X9J A;  4DSI A;  1BIZ A;  4HUE A;  3RR7 A;  1KD1 O;  1KTQ A;  1E4G T;  4DKW A;  3CCR N;  1CLQ A;  4DV0 K;  5AQL A;  3FZK A;  1FW6 A;  5C12 A;  3AO2 A;  4FLT A;  4LY7 A;  4KB0 A;  4Z4G A;  2E6L A;  1WB9 A;  4KH4 A;  3O08 A;  2O4I A;  2WTU A;  3BZK A;  4KTQ A;  5JIC A;  2YKN A;  4UQG A;  5AQG A;  4EP5 A;  4I7F A;  1NK8 A;  3J80 O;  2P9P A;  3V1O A;  4AHS A;  1Z6R A;  1H1V A;  2P9P B;  4B1W B;  1JKH A;  2B4J A;  5AQF A;  3K0S A;  4G9Z A;  3ENO A;  1JJ2 M;  2HST A;  5KQD A;  1RTD A;  3A5O C;  5AQZ A;  5E26 A;  2QM1 A;  4FZX C;  4OGC A;  1J53 A;  1TV6 A;  4C23 A;  1T05 A;  2IGI A;  5LMU K;  2UXD K;  1VQN N;  4CJ4 A;  3O80 A;  3LPU A;  5EX5 A;  1F21 A;  3V9U A;  1ZBU A;  5M1P A;  4CJF A;  1X1P A;  4CBU A;  3L2W A;  4YOR A;  1L3S A;  3IFR A;  1YHQ N;  4FWL A;  1DKG D;  3LL3 A;  4B8A B;  4M3W A;  4PQU A;  2EWS A;  4FLW A;  4OPJ A;  4NLB A;  2QXF A;  4IO9 L;  5TKW A;  4FLZ A;  3DLH A;  1WSH A;  2VG5 A;  1RDW X;  5KRT A;  1VSJ A;  4CW7 B;  1RBS A;  4CEZ A;  1WSG A;  2X78 A;  4Y1D A;  1DEJ A;  3KLE A;  3KWG A;  3L0Q A;  1D5A A;  1O1W A;  3AVK A;  3P38 A;  3SBG A;  3QFP A;  1KVA A;  3V9Z A;  1BOT O;  3DRR A;  5EY4 A;  3SMP A;  5JLF A;  1BGX T;  1HNI A;  4N76 A;  3S3O A;  3O3H A;  4GKK K;  1NLV A;  2D1K A;  1SL2 A;  3C65 A;  2G8F A;  1GLC G;  1N33 K;  3KLI A;  3PIO L;  3CM5 A;  4CGF A;  3QIC A;  2V7Y A;  5C24 A;  1RTI A;  4DSF A;  3C6T A;  2Q3S A;  3H46 O;  1Q7Y O;  4FLX A;  2G8U A;  5FPD A;  3ATV A;  3I0S A;  3PX6 A;  5M1F A;  5F2R A;  2RPI A;  1S3X A;  3NVK A;  3L2R A;  3SUQ A;  1CZB A;  3CYM A;  5JLH A;  2Z1J A;  2P9K A;  4JEP A;  2P9K B;  4CEF A;  1T6D A;  1EKE A;  1HPM A;  1V4T A;  4LF8 K;  4CJR A;  1CXQ A;  3DM2 A;  2YV0 X;  1TL3 A;  3SLC A;  4PKG A;  3H45 C;  4JKH A;  1NGJ A;  4FWM A;  3TTF A;  4BE2 A;  1JLG A;  4A5B A;  2YNF A;  3ZT2 A;  1IKV A;  1XNR K;  2XRI A;  3HM9 A;  3QLH A;  4AHC A;  4FK4 A;  4Z4E A;  1JLB A;  5JS2 A;  4XH5 A;  4ISE A;  4MO4 A;  3WNE A;  4QAG A;  3U9D A;  5T7B A;  3KKS A;  2QWO A;  1SV5 A;  4X66 K;  4NXN K;  4NYF A;  2KHO A;  4CJE A;  3CXC M;  3O9R A;  4H8K A;  1SL1 A;  4IFE A;  2HHH K;  1T3V A;  1RBR A;  2V51 B;  5C42 A;  2KTQ A;  3VA3 A;  4KHN A;  3UKR A;  4BGA A;  1IKX A;  3VQC A;  4ZTF A;  4BRI A;  3F5T A;  4DTO A;  5I9E B;  2OPQ A;  3AVM A;  1YJN N;  5AJ3 K;  3L6Q A;  3DRS A;  2P9N A;  5J2Q A;  4K8X A;  2P9N B;  2W41 A;  3EE8 A;  3OYD A;  1YIT N;  2Q0R A;  3L8B A;  5AQJ A;  1S22 A;  4JYA K;  2P5O A;  4EFH A;  1Q81 O;  1RBU A;  3VQE A;  2W6K A;  3SV3 A;  4FO0 A;  1IG9 A;  4JI8 K;  1HR0 K;  3OYA A;  2W42 A;  1RDC A;  3VEY A;  2F9W A;  2VWB A;  4JV5 K;  4C8L A;  1LAV A;  4C8O A;  3G0Z A;  4JNE A;  3MWT A;  4YDU A;  4R5P A;  2ZM6 K;  4HCC A;  1HKB A;  3DLG A;  4LSN A;  1E3M A;  1Q8I A;  2VWK A;  1VAZ A;  3QIO A;  3K9K A;  2ASP A;  4RTF D;  4EP4 A;  1S5J A;  4CZG A;  1EX4 A;  4KHU A;  2PBD A;  4W5R A;  3ID8 A;  3NF7 A;  5FPM A;  1WBB A;  1QZ6 A;  2WFB A;  1HJR A;  1HJO A;  3TAQ A;  4JKD A;  4DHY A;  3CME N;  4N5S A;  3J7Z O;  4ISF A;  4CFD A;  3KVG A;  1E4F T;  4DCH A;  3MCA B;  4JN4 A;  4A59 A;  3KK1 A;  4JLH A;  3VMF B;  4BQZ A;  4KHQ A;  3ENH A;  4OKJ A;  3EN9 A;  2XY5 A;  3RMC A;  5EU7 A;  4NCG A;  4MLE A;  1T44 A;  1C6V A;  4BG8 A;  5LJW A;  2P9L B;  2PYJ A;  3KK7 A;  4FJG A;  4CZJ A;  1ZBH A;  2V7Z A;  5BRF A;  1U47 A;  5K14 A;  2BDP A;  3FR0 A;  4B1X B;  3TAP A;  2A40 A;  4QCL A;  1GOC A;  4YOY A;  1BCM A;  4WCE L;  3FZH A;  2E20 A;  4WFA L;  4F4K A;  3HO1 A;  4ELT A;  3BUZ B;  4BVO A;  4LFA K;  4JS5 A;  4GV9 A;  1MU2 A;  2E88 A;  1REV A;  4E1M A;  2EHG A;  5BPM A;  5GAE P;  5FDL A;  4CJU A;  1JL2 A;  4B9V A;  2RKI A;  4FWP A;  3R1X A;  4FZY A;  2VQF K;  1BQM A;  2OAN A;  5KQ8 A;  4IFY A;  4Z4H A;  2JGU A;  1LWE A;  1QHA A;  3D2E A;  3DLK A;  3L2Q A;  3D2E B;  2R7Y A;  4FSV A;  3R6M A;  3JAM O;  4Q0B A;  1L3T A;  2A42 A;  5KRS A;  4IJA A;  4DV2 K;  1NGG A;  1NJW A;  4FJ7 A;  2E5L K;  3OY9 A;  1VQK N;  3HI0 A;  2A3Z A;  1TAU A;  1C0T A;  3HP6 A;  2A41 A;  4BC4 A;  4DQ8 A;  3RMB A;  1U4B A;  4BWM A;  5GIN A;  2NRH A;  5AFU A;  5AQS A;  1N8R O;  4C1N K;  2ASM A;  4CIG A;  5AQO A;  1NK9 A;  2VCP A;  2Z1I A;  3SMS A;  4FLU A;  1S9G A;  5BPL A;  1I39 A;  2OZM A;  1GLL O;  4BRP A;  4QS7 A;  3T1Y K;  3GOI A;  3WXK A;  4I2Q A;  4EAH D;  3P83 D;  2J4R A;  4ICL A;  3ISN C;  3HVR A;  5AZJ A;  2FLO A;  5CZ1 A;  3K5O A;  5AZJ B;  2JWL A;  1BIS A;  1D8Y A;  3HYF A;  3CFO A;  4H0O A;  4CCH A;  2KKZ A;  5AFU H;  4XEI A;  1JCF A;  3G25 A;  3VOV A;  2Z1H A;  5CY4 A;  1XC9 A;  1NK0 A;  4B9U A;  1KLM A;  4BE1 A;  4JRQ A;  4DU1 A;  4RW8 A;  3CC2 N;  3ULD A;  2CGL A;  3N4Q A;  5FPE A;  3DXK A;  1T6C A;  1RT3 A;  2O8B A;  3VN5 A;  1YAG A;  3DXK B;  3OS0 A;  3V6D A;  4EZ6 A;  4OLA A;  1GLA G;  3OYE A;  1LAW A;  1NGB A;  2NRX A;  4Y0W A;  3O9T A;  1XMO K;  2HW3 A;  1FJG K;  1NNE A;  3J7A P;  3ZX3 A;  3PV8 A;  1SS6 A;  2A1R A;  4BRK A;  4BRN A;  1LW2 A;  4NB4 A;  3IMX A;  1VQ8 N;  1S1W A;  3DMJ A;  3E01 A;  5HRP A;  1BQN A;  1BA1 A;  1Y97 A;  3MK6 A;  3UE5 A;  4BR9 A;  1JLQ A;  3NE6 A;  4BQL A;  2YHB A;  3J81 O;  1G99 A;  3LP0 A;  3O3F A;  4KRF A;  4ID1 A;  4DTN A;  2B5J A;  4B9S A;  4B3M K;  1B9D A;  2GX9 A;  3TSU A;  4KB1 A;  3MX5 A;  3CIP A;  4IZ9 A;  3LDP A;  4FOE A;  1ASU A;  1K73 O;  4DUY K;  3DLE A;  3VEX A;  3P31 A;  4Z0U A;  2HF3 A;  4K25 A;  3VEZ A;  1ZBL A;  3D2F A;  1XC3 A;  1NK5 A;  3D2F B;  1I94 K;  3THY A;  3OTO K;  4DS5 A;  3THY B;  4DU3 A;  3S41 A;  3PIP L;  4CHN A;  2F4V K;  4W5Q A;  2E2Q A;  4WF9 L;  2KZZ A;  3SK3 A;  3CC4 N;  1NGA A;  4A5A A;  4LF6 K;  2HHQ A;  4KHY A;  5HOO A;  2HHW A;  1C1A A;  2OPR A;  4NCA A;  3QET A;  5CHI A;  1XHZ A;  1GLE G;  1W9H A;  2KFN A;  3ZEU B;  1VQL N;  4M3Z A;  1VRT A;  4M42 A;  5KGW A;  1W97 L;  4C8K A;  1R59 O;  4BR5 A;  3JSM A;  3O6W A;  1S6P A;  1BA0 A;  4DR2 K;  3SJJ A;  2GUP A;  4LF9 K;  4YFU A;  5EVZ A;  1NK4 A;  1NJI O;  3AGK A;  3KK2 A;  3AAQ A;  1NGI A;  4DFM A;  2O8D A;  3L4Q A;  1VQ5 N;  2O8D B;  3ZT0 A;  1TYQ A;  3AVJ A;  3AO5 A;  2QK9 A;  3SCX A;  1TYQ B;  3QIN A;  4PL8 A;  2I7N A;  3I8B A;  4E3S A;  1S72 N;  4DU4 A;  3KJV A;  5AQP A;  2PAV A;  3KWI A;  5TKY A;  2CGJ A;  1YTA A;  3O9S A;  5BPN A;  3HL8 A;  3J8A A;  1Y64 A;  4BRQ A;  4IDK A;  3CJ1 A;  2D0C A;  5LMN K;  3DAW A;  3OVN A;  4KPY A;  4AM6 A;  4WQ5 A;  4WE1 A;  4YY3 K;  3SZ2 A;  2OYQ A;  4OPK A;  3O5B A;  1RNH A;  5CYM A;  4OO1 J;  1HUX A;  1NG9 A;  2YCH A;  1ASW A;  1EO1 A;  1GLD G;  2GV9 A;  4BVP A;  1WBD A;  4JI6 K;  3HJF A;  3TWH A;  1ZYQ A;  3A0I X;  1ASV A;  4CEQ A;  4FVU A;  3QEX A;  1VSK A;  4LD0 A;  3LDS A;  1JXE A;  4M3X A;  3THV A;  4CED A;  3JS6 A;  3LWM A;  2UUC K;  4F3O A;  3ID6 A;  1QE1 A;  5C2F A;  1UA1 A;  3SJH A;  1IKW A;  2RF2 A;  4KBO A;  2QWL A;  1ZXO A;  1U49 A;  1MWM A;  1T7P A;  3T1H K;  1TKX A;  2HND A;  4MDA A;  1EP4 A;  3CCQ N;  4FPB A;  1VSI A;  1ZC6 A;  3AA4 A;  3BDP A;  1NJY A;  2D0A A;  4GMJ B;  3T69 A;  1NKC A;  1BIU A;  4DV3 K;  2OA8 A;  3G4S N;  3QEV A;  3K58 A;  1EXQ A;  3NF8 A;  4CJ5 A;  2VQE K;  1D4X A;  4RG8 A;  3JXU A;  2X74 A;  1BO5 O;  1S1T A;  3LP2 A;  1WSI A;  1JLE A;  4MLH A;  4DFP A;  3V9W A;  4FWO A;  1T8E A;  3H6E A;  3KLH A;  1G15 A;  4DQI A;  2ZF5 O;  2JLE A;  4E7L A;  3NFA A;  3U4L A;  4XH1 A;  3PUF A;  3HTV A;  4O8K A;  3V1Q A;  2YNI A;  3C94 A;  3CCU N;  1NWK A;  1W7A A;  3M8S A;  3T19 A;  2HMI A;  4CBX A;  4CGI A;  1N36 K;  2BE2 A;  3NVM A;  4HWI A;  4RW9 A;  2P9U A;  3BGR A;  2P9U B;  2WBN A;  3TTC A;  4LC9 B;  4OKE A;  4FL9 A;  2CH5 A;  5J2P A;  3EE9 A;  3H1Q A;  3E66 A;  1NU0 A;  3K5L A;  4CEO A;  1VRU A;  4DR7 K;  3VQ5 A;  1KVC A;  3THW A;  2NNW A;  2AJQ A;  1NGF A;  3THW B;  1J5O A;  3HSC A;  2HB5 A;  2D0O A;  4X62 K;  5LJV A;  1N34 K;  4GVE A;  4IWV A;  3HZ6 A;  5EOY A;  4PL7 A;  1NOZ A;  4CHZ A;  3KD5 E;  4IBN A;  4JHD A;  4E1N A;  4JHD B;  3OA9 A;  1EET A;  3C95 A;  3R3L A;  4Z4I A;  1HMV A;  3PX4 A;  5AQI A;  4BG9 A;  1X9S A;  3EZW A;  2QWM A;  2FSJ A;  3D6R A;  3OYN A;  3AVB A;  4FJM A;  2Q36 A;  2DFH A;  2HHV A;  1A5W A;  4XIU A;  4CK1 A;  1MDU B;  3ITH A;  2YHY A;  1OKJ A;  4KRE A;  5C10 A;  3VGM A;  3HP9 A;  3LDQ A;  3IKM A;  5AQX A;  5KPT A;  3K57 A;  4C8M A;  3I55 N;  3CF5 L;  2QKK A;  5M1Q A;  2HVI A;  5M1K A;  4CK2 A;  3H3N O;  3ZT4 A;  1OH6 A;  1UA0 A;  3IG1 A;  2E2N A;  4E19 A;  3M1F A;  3F9M A;  3CCE N;  5DM7 L;  1K8K A;  3KD1 E;  1K8K B;  2I7P A;  2P9I A;  3CCS N;  3DJC A;  2P9I B;  3B6O A;  5HL7 L;  1IV0 A;  4B08 A;  4DV1 K;  3BZC A;  5GIP A;  2BGG A;  3ZSY A;  3L2U A;  4O8U A;  5KPZ A;  2Y1J A;  3VQB A;  5AQH A;  5D3G A;  2F8T A;  4BDP A;  4FWQ A;  3MN5 A;  2IVO A;  1NMN A;  2A1S A;  2ETJ A;  1B9F A;  3DOL A;  4E7I A;  1QS4 A;  4FJJ A;  3LDN A;  4E1J A;  2A6A A;  4J2D A;  3VER A;  3EO3 A;  1GLB G;  1RIL A;  4JS4 A;  5AQV A;  3MCP A;  5KTQ A;  1KAZ A;  3TAE A;  2QA4 N;  3ZCM A;  2UUB K;  4IG0 A;  5AQU A;  3OYF A;  3UKR B;  4CHY A;  4YOT A;  1W2B M;  1NK7 A;  4M45 A;  2VG6 A;  1QVG M;  4DTS A;  3E9O A;  3PSF A;  2AA4 A;  5J2M A;  2NRW A;  4H03 B;  3MMV A;  2Q0U A;  3EZ5 A;  1C0M A;  4KFB A;  3VET A;  3ZSQ A;  3AV9 A;  4OPH A;  4E0D A;  1HPZ A;  2O8C A;  4IO8 A;  4IXC A;  4FWK A;  2O8C B;  3CJA A;  4JI2 K;  1Z05 A;  3A5L C;  4Q5V A;  1RBT A;  3SQ1 A;  1WLJ A;  3J7Y P;  3MEE A;  3U9Z A;  1HRH A;  2KZM A;  2IAJ A;  3HRG A;  1FKO A;  5GIO A;  3VGL A;  3OYM A;  3MDQ A;  1A5V A;  2E2O A;  3SQ4 A;  1HKC A;  3LAN A;  4CES A;  2QTD A;  1SQK A;  3NF9 A;  3NGZ A;  4HCB A;  1JXB A;  3WNH A;  2CGK A;  3KKR A;  5FPN A;  1HNW K;  3RTV A;  5HLF A;  4RWT A;  3OJS A;  1QZ5 A;  4H0Y B;  1LV5 A;  5BRD A;  4CEC A;  3RMD A;  4DUZ K;  1BUP A;  4LF4 K;  4BRA A;  4BAC A;  2D4W A;  1ESV A;  4GY2 B;  4FW2 A;  1RTJ A;  3EKU A;  1KRP A;  4OKK A;  3V1R A;  3LAK A;  3BF1 A;  4FK2 A;  3MXJ A;  2NRR A;  1RDB A;  4I9Q A;  1U45 A;  3CCL N;  1BG3 A;  1RT7 A;  1FKP A;  3O1B A;  4FVM A;  4BY9 C;  3VF2 A;  4BRO A;  2B6A A;  3OYI A;  3T7Z A;  5ADX A;  3K9J A;  3CD6 N;  3O3G A;  4PKI A;  4AHV A;  3ZT1 A;  4E89 A;  3AA5 X;  1WNS A;  3LAL A;  1SKR A;  4KHW A;  5B8H A;  3OYH A;  3RRH A;  3O9U A;  3CPW M;  4AH9 A;  3SUP A;  1J9A A;  3WQT A;  1NMD A;  4JD2 A;  4BR4 A;  1SKW A;  1WSF A;  3PO5 A;  4I2P A;  4KI4 A;  1YJ9 N;  2KFZ A;  5FLX O;  3A5M C;  4CBW A;  1TK0 A;  2IIR A;  1EWR A;  3T1A A;  4CF1 A;  3LP3 A;  3ATU A;  1YJW N;  2X6S A;  3AAR A;  1Z26 A;  5AQR A;  3LDL A;  4CEA A;  3K5N A;  5AZI A;  4JKA A;  5GAG P;  3VPZ A;  5AZI B;  3C7N A;  4CF0 A;  2PFU A;  2QW9 A;  5CYQ A;  3VES A;  4CJL A;  3FLC O;  4FJN A;  3C7N B;  1NGE A;  2XHB A;  5ADX H;  2VWJ A;  3E1Y A;  2VYP A;  5M1O A;  4GV3 A;  3CJ7 A;  4FK0 A;  4NO7 A;  3PY8 A;  4DLG A;  3VA0 A;  2ZD1 A;  3ZSX A;  2KQ2 A;  1NJX A;  1KVB A;  4H5N A;  4PA1 A;  3R8E A;  4FXD A;  1X9M A;  3C0B A;  4IFV A;  3DRP A;  1VSE A;  3K59 A;  4DQQ A;  2E6M A;  1DTQ A;  3LDO A;  3W0L A;  3E9L A;  1JLA A;  4DR5 K;  3D0P A;  4DR3 K;  3SUN A;  1HLU A;  1L5U A;  2HVH A;  2O8F A;  2O8E A;  4AF1 A;  2P5G A;  4KH6 A;  2O8F B;  2O8E B;  4K42 A;  3QDK A;  2VGN A;  4B9L A;  1IO2 A;  3GL1 A;  1TL1 A;  2GTD A;  1C0F A;  1P8Z A;  2BAN A;  3ZYY X;  2D0B A;  4H0P A;  4M63 C;  3SNN A;  2PY5 A;  1BI4 A;  3CER A;  4IEI A;  1BI4 B;  3GBT A;  5CR4 A;  2FBY A;  2E4L A;  2BH1 A;  4W5O A;  3DLL L;  3I8D A;  2Q97 A;  2ZE2 A;  2YX6 A;  4CJ3 A;  1CZA N;  4O0I A;  2FBT A;  3AA3 A;  3TI0 A;  4HHT A;  4M3Y A; 
#chains in the Genus database with same CATH homology
 3O6W A;  1BA0 A;  3KWG A;  3L0Q A;  2GUP A;  3IUC A;  4BR7 A;  2F7T A;  3P38 A;  3SBG A;  5EVZ A;  3QFP A;  4JKC A;  5LY3 A;  3AGK A;  1NJI O;  3CCJ N;  2YJF A;  1BOT O;  1NGI A;  3AAQ A;  3P4I A;  5EY4 A;  3SMP A;  5JLF A;  2WUS A;  3L4Q A;  2ITM A;  1VQ5 N;  1TYQ A;  2JWK A;  4BRL A;  3AAP A;  4YOV A;  1TYQ B;  4PL8 A;  4BC5 A;  1NLV A;  2D1K A;  3Q7B A;  1QQO A;  2I7N A;  3C65 A;  3BF3 A;  3I8B A;  1S72 N;  1GLC G;  4U67 L;  4UY8 O;  3PIO L;  3SBT A;  1ILY A;  3M6G A;  5AQP A;  2PAV A;  2V7Y A;  3KWI A;  3QIC A;  4MO5 A;  5TKY A;  2GWJ A;  3I33 A;  2CGJ A;  4JK9 A;  2QWN A;  3O9S A;  5BPN A;  1VQP N;  3H46 O;  2YHW A;  3J8A A;  4CZF A;  1Y64 A;  1Q7Y O;  4BRQ A;  3CJ1 A;  5FPD A;  3ATV A;  1JCG A;  4WYB A;  4ILJ A;  3DAW A;  1J6Z A;  4A62 A;  4AM6 A;  5M1F A;  4WQ5 A;  5F2R A;  3LM2 A;  1S3X A;  1KAY A;  3QB0 A;  1X3N A;  1DGK N;  3O5B A;  3NVK A;  3BEX A;  4OO1 J;  1ATN A;  1HUX A;  3A5N C;  4GNI A;  5JLH A;  1P90 A;  1VQM N;  2E1Z A;  2YCH A;  2P9K A;  5AQN A;  4JEP A;  1EO1 A;  1GLD G;  4B1U B;  2BUP A;  2P9K B;  1T6D A;  4WQ5 C;  4BVP A;  2NZT A;  4H0T B;  4B1V A;  1HPM A;  1V4T A;  3A0I X;  4JD2 B;  1XUP O;  3SLC A;  5CE3 A;  1XQS C;  2P9L A;  4PKG A;  4FVU A;  2GEM A;  4PKH A;  2HBL A;  3H45 C;  4JKH A;  3FE1 A;  1ZBS A;  1NGJ A;  3JS6 A;  5AQK A;  3F2K A;  3ID6 A;  4FWM A;  5C2F A;  3SJH A;  4PHT X;  3TTF A;  4B1Y B;  4KBO A;  2QWL A;  4A5B A;  5BRH A;  1WOQ A;  1ZXO A;  3VF4 A;  1MWM A;  2FF3 B;  2IVP A;  3TSP A;  3VTH A;  4MDA A;  1TUU A;  2A5X A;  3FZL A;  5F0X A;  4CZM A;  3CCQ N;  2QXL A;  4FPB A;  1ZC6 A;  1TUY A;  3TPQ A;  1EQY A;  2OTL N;  3TTD A;  3T69 A;  4DB3 A;  4BRM A;  3W3D A;  1X3M A;  4XH5 A;  4BC2 A;  1C0G A;  3G4S N;  4ISE A;  2QI2 A;  1ATR A;  4MO4 A;  3CPE A;  2GWK A;  2RHK A;  3FFK B;  3U9D A;  3OW2 M;  1D4X A;  2DPN A;  4ILG B;  2QWO A;  3CCV N;  1WUA A;  3JXU A;  3VF6 A;  1BO5 O;  4FOI A;  2KHO A;  4BRD A;  1RDU A;  4H0X B;  3CXC M;  2CH6 A;  3O9R A;  4IFE A;  4MLH A;  1T3V A;  2IVN A;  3OBW A;  3FZM A;  4FWO A;  5AQW A;  2V51 B;  3O4W A;  1NBW A;  3H6E A;  3CHW A;  3RVC A;  2ZF5 O;  3UKR A;  2E8A A;  4IOX A;  4BGA A;  4BR2 A;  3QFU A;  2ZJP L;  2BTF A;  2V52 B;  3U4L A;  3IDH A;  4XH1 A;  5AQY A;  4BRI A;  3F5T A;  1U6Z A;  4CZH A;  3HTV A;  4O8K A;  5I9E B;  3ZET A;  3CCU N;  3D7E O;  3G71 N;  4O5F A;  5AQT A;  1RFQ A;  1NWK A;  1KXP A;  1YJN N;  3ZET B;  2HF4 A;  3L6Q A;  4CBX A;  2P9N A;  3VEW A;  3DWL A;  3NVM A;  4HWI A;  3N4P A;  2P9N B;  2W41 A;  3HOS A;  4FPA A;  3EE8 A;  5BN8 A;  2P9U A;  2WC9 A;  4CJ7 A;  2E1Y A;  5F1X A;  2GEL A;  1YIT N;  2P9U B;  4H5T A;  2ZGZ A;  2WBN A;  3ULE A;  2Q0R A;  3TTC A;  3AGR A;  5JVG L;  5AQJ A;  4LC9 B;  3ULE B;  4YOW A;  1S22 A;  3QBW A;  3ENB A;  2CH5 A;  3O8M A;  4FL9 A;  1IJJ A;  2HBM A;  4EFH A;  3EE9 A;  1ATS A;  1Q81 O;  3H1Q A;  1HX1 A;  3MN6 A;  4FO0 A;  2E2P A;  3E66 A;  4JK8 A;  3MN7 A;  3H1V X;  3VEY A;  2F9W A;  3DXM A;  4OPA A;  2NNW A;  3O9Q A;  2VWB A;  3GDQ A;  1NGF A;  4JKF A;  4WQ4 C;  2FXU A;  3DXM B;  4FWS A;  3HSC A;  4K43 A;  4JNE A;  3MWT A;  4YDU A;  2D0O A;  3HBT A;  1YIJ N;  2HBJ A;  3CJB A;  3L4I A;  5LJV A;  3VEN A;  5DM6 L;  2Q31 A;  1HKB A;  3O1W A;  4YOX A;  4GVE A;  4IWV A;  3HZ6 A;  4QS8 A;  5EOY A;  1NGH A;  5ELZ A;  2VGM A;  3VTI A;  4PL7 A;  1Q86 O;  1BDG A;  1VAZ A;  4BGB A;  3WXJ A;  3K9K A;  2ASP A;  4JHD A;  4RTF D;  4YDU C;  5JVH L;  1LCU A;  4CZG A;  3WUH A;  4JHD B;  3HOT A;  3OA9 A;  4I6M A;  2PBD A;  4CZK A;  3R3L A;  3ID8 A;  3Q7C A;  4I6M B;  5FPM A;  1QZ6 A;  5C0Y A;  2WFB A;  3R9P A;  5AQI A;  4BG9 A;  3EZW A;  2QWM A;  2FSJ A;  3D6R A;  4IOA L;  1HJO A;  2ZWH A;  1DT9 A;  2Q36 A;  4JKD A;  4DHY A;  3CME N;  3J7Z O;  4ISF A;  1MDU B;  3KVG A;  3VEV A;  3WXM B;  1E4F T;  4FWR A;  4DCH A;  2NLX A;  3MCA B;  2YHY A;  4JN4 A;  3SAF A;  1K9M O;  1OKJ A;  4A59 A;  5H1S Q;  5C10 A;  2D0P A;  3VGM A;  3VMF B;  3LDQ A;  4BQZ A;  3IKM A;  2HBK A;  5AQX A;  1NGD A;  3C6A A;  4BR0 A;  5KPT A;  4L3Q A;  3CET A;  3I55 N;  3CF5 L;  4K41 A;  3ENH A;  3QBX A;  3EN9 A;  5M1Q A;  5M1K A;  3RSE A;  4CD1 A;  3H3N O;  3RSE B;  4BRC A;  4IDH A;  2E2N A;  4MLE A;  1T44 A;  4BG8 A;  5LJW A;  2P9L B;  3C6H A;  3KK7 A;  3M1F A;  4CZJ A;  4R79 A;  2V7Z A;  5KPR A;  3F9M A;  5GAH P;  5BRF A;  3HM8 A;  3H3O B;  4U7B A;  3CCE N;  5DM7 L;  1K8K A;  3SAH A;  2P9S A;  3FR0 A;  4B1X B;  3GE1 A;  2A40 A;  3TSQ A;  1K8K B;  4JK7 A;  2I7P A;  3WXL A;  2P9I A;  3CCS N;  3DJC A;  3MWP A;  1VQ7 N;  2FF6 A;  2YI1 A;  2P9I B;  3CQY A;  4FWN A;  4EHT A;  4YOY A;  5HL7 L;  3KZB A;  4WCE L;  3FZH A;  5JMV A;  4RCH A;  3TU5 A;  2E20 A;  5GIP A;  4WFA L;  1GLF O;  1MA9 B;  4O8U A;  5KPZ A;  1VQ9 N;  5AQH A;  2ZJR L;  3LM9 A;  3BUZ B;  4BVO A;  4IOC L;  1OVY A;  3CQX A;  2KLA A;  4FWQ A;  3MN5 A;  2IVO A;  3G6E N;  3MX2 A;  4C1N I;  4GV9 A;  4J8F A;  1KAX A;  2E88 A;  3EKS A;  1V4S A;  1VQ4 N;  1GLJ O;  3EL2 A;  5BPM A;  3E9P A;  4A2B A;  4CD3 A;  5GAE P;  3LDN A;  5E84 A;  2A6A A;  4E1J A;  4FWP A;  4A2A A;  3R1X A;  3EO3 A;  3VER A;  4M7Y A;  1GLB G;  2OAN A;  5KQ8 A;  5AQV A;  3MCP A;  5AQQ A;  4B1Z A;  1LOT B;  1O13 A;  1KAZ A;  3CJ9 A;  1QHA A;  2QA4 N;  5AQU A;  3D2E A;  5M1N A;  1K8A O;  3UKR B;  5GAD P;  4YOT A;  3D2E B;  5BRE A;  1W2B M;  1M1K O;  1QVG M;  4FSV A;  3R6M A;  2NRZ A;  5C2D A;  2A42 A;  4IEE A;  3E9O A;  5MLC Q;  5BN9 A;  2AA4 A;  4IJA A;  2NRW A;  4H03 B;  3MMV A;  2Q0U A;  2HMP A;  1NGG A;  2QWQ A;  3QML A;  3VET A;  4OPH A;  4Z94 A;  4QS9 A;  1VQK N;  4H5R A;  3HI0 A;  2FSK A;  3WXI A;  1JCE A;  2A3Z A;  4A57 A;  3CMA N;  1MWK A;  2ZJQ L;  4IO8 A;  4WQ4 A;  3ZX0 A;  2A41 A;  4IXC A;  4BC4 A;  4FWK A;  4DQ8 A;  3CJA A;  4JKG A;  1Z05 A;  4IJN A;  4MDB A;  2NRH A;  4JKG B;  5AFU A;  5GIN A;  1NM1 A;  3A5L C;  4BRG A;  5AQS A;  1N8R O;  2W40 A;  5EXW A;  3WQU A;  4C1N K;  3CJC A;  2ASM A;  3VGK A;  3BP8 A;  1VQ6 N;  3ZEU A;  3U9Z A;  5AQO A;  2VCP A;  4EIA A;  3HRG A;  3SMS A;  3WT0 A;  3VGL A;  5GIO A;  3MDQ A;  4ISG A;  5BPL A;  3U8X A;  2E2O A;  4XH4 A;  1HKC A;  2QTD A;  3CCM N;  1VQO N;  1SQK A;  1GLL O;  4BRP A;  4QS7 A;  2CGK A;  1YXQ A;  5FPN A;  1KQS M;  2OTJ N;  3GOI A;  3WXK A;  4RWT A;  1QZ5 A;  1Q82 O;  1BWF O;  4EAH D;  4H0Y B;  5BRD A;  4BRH A;  2J4R A;  3AY9 A;  1BUP A;  5AZJ A;  2FLO A;  3VEO A;  4BRA A;  3I56 N;  2D4W A;  2QEX N;  1HKG A;  1ESV A;  2JWL A;  2Q1N A;  1QQN A;  3MN9 A;  4H0V B;  4GY2 B;  5AZJ B;  4CZE A;  3CI5 A;  4H0O A;  1SAZ A;  3EKU A;  4WFN L;  1U2V A;  4BC3 A;  2KKZ A;  1SZ2 A;  1U2V B;  3BF1 A;  3GG4 A;  5AR0 A;  5AFU H;  4XEI A;  1JCF A;  3UB5 A;  3G25 A;  3VOV A;  3NMU A;  2NRR A;  1M90 O;  3CCL N;  1BG3 A;  2ZGY A;  3B8A X;  3ZX2 A;  3O1B A;  3CC7 N;  3KHY A;  2NRT A;  4BY9 C;  2ASO A;  3VF2 A;  4BRO A;  3SAG A;  4A61 A;  3T7Z A;  5ADX A;  3M5R A;  5AQM A;  2F9T A;  4YOU A;  3K9J A;  3CC2 N;  2CGL A;  3N4Q A;  5FPE A;  3DXK A;  1T6C A;  3CD6 N;  4EHU A;  1YAG A;  3DXK B;  2HOE A;  4PKI A;  3FGU A;  1GLA G;  2P9S B;  1NGB A;  2NRX A;  1YF5 L;  3PLA A;  4Y0W A;  3O9T A;  1IG8 A;  4JKE A;  4CZI A;  1X9J A;  5B8H A;  3O9U A;  3CPW M;  3WQT A;  1NMD A;  3ZX3 A;  4JD2 A;  1SS6 A;  2QWP A;  2H3G X;  4ILH A;  1KD1 O;  4BR4 A;  1YVN A;  4NLC A;  4GV6 A;  4BRK A;  1YJ9 N;  4BRN A;  3A5M C;  4CBW A;  5C15 A;  1E4G T;  1Q18 A;  2IIR A;  4DKW A;  4NB4 A;  3IMX A;  3CCR N;  3ATU A;  1VQ8 N;  1YJW N;  5AQL A;  3AAR A;  5AQR A;  3WEE A;  3LDL A;  3FZK A;  5C12 A;  1BA1 A;  5AZI A;  4JKA A;  3WEE B;  5GAG P;  2AP1 A;  3MK6 A;  5AZI B;  3C7N A;  3UE5 A;  2PFU A;  3VPZ A;  4BR9 A;  2QW9 A;  3OBY A;  3VES A;  4CZL A;  3FLC O;  3C7N B;  1NGE A;  3O08 A;  4KH4 A;  2YJE A;  4BQL A;  4CI6 A;  4B9Q A;  1G99 A;  4KH5 A;  5ADX H;  4BRF A;  3E1Y A;  1KC8 O;  4AM7 A;  2VYP A;  5M1O A;  5JIC A;  4GV3 A;  3OHR A;  2GX9 A;  3TSU A;  3CJ7 A;  3MX5 A;  2YHX A;  3CIP A;  4IZ9 A;  2Q2R A;  5AQG A;  3LDP A;  4FOE A;  4NO7 A;  4JAX A;  2P9P A;  1K73 O;  1Z6R A;  1H1V A;  2P9P B;  3P31 A;  1YUW A;  5AQF A;  3UKU A;  2QWR A;  3VEX A;  4B1W B;  4BRE A;  4H5N A;  1QVF M;  4G9Z A;  2HF3 A;  4JKB A;  4K25 A;  3R8E A;  3UKU B;  3VEZ A;  3ENO A;  3D2F A;  4M7X A;  2RE2 A;  1XC3 A;  3C0B A;  1JJ2 M;  2HST A;  3D2F B;  5KQD A;  4F9O A;  2UYT A;  3A5O C;  5E26 A;  3LDO A;  5AQZ A;  5BR9 A;  1BU6 O;  3A8Y A;  2QM1 A;  3W0L A;  1NGC A;  3E9L A;  4C23 A;  3S41 A;  2FSN A;  1HLU A;  4HTL A;  3PIP L;  4AF1 A;  2NRV A;  4KH6 A;  1VQN N;  3O80 A;  3M3Z A;  3P39 A;  3QDK A;  4K42 A;  2E2Q A;  2VGN A;  5EX5 A;  4WF9 L;  3GL1 A;  3SK3 A;  3CC4 N;  5M1P A;  2GTD A;  1C0F A;  1RGI A;  4CBU A;  1NGA A;  4YOR A;  1P8Z A;  4A5A A;  3ZYY X;  3IFR A;  1YHQ N;  4FWL A;  1DKG D;  3LL3 A;  1YI2 N;  5HOO A;  4H0P A;  4M63 C;  2EWS A;  5CHI A;  4NLB A;  1GLE G;  3ZEU B;  1VQL N;  3CER A;  3FZF A;  4IEI A;  4IO9 L;  5TKW A;  3GBT A;  1W97 L;  5CR4 A;  4WFB L;  4H5W A;  4H5V A;  1R59 O;  1RDW X;  2BH1 A;  3DLL L;  2Q97 A;  2YX6 A;  1CZA N;  4BR5 A;  1DEJ A;  1QQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...