5CR4A

Crystal structure of the sleeping beauty transposase catalytic domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
b'ARKKPLLQNRHKKARLRFATAHGDKDRTFWRNVLWSDETKIELFGHNDHRYVWRKKGEACKPKNTIPTVKHGGGSIMLWGCFAAGGTGALHKIDGIMDAVQYVDILKQHLKTSVRKLKLGRKWVFQHDNDPKHTSKVVAKWLKDNKVKVLEWPSQSPDLNPIENLWAELKKRVRARRPTNLTQLHQLCQEEWAKIHPNYCGKLVEGYPKRLTQVKQFKGNATKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sleeping Beauty transposase, SB100X
publication title Sleeping Beauty transposase structure allows rational design of hyperactive variants for genetic engineering.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5cr4A00
2F7TA 3F2KA 5CR4A 4MDAA 3HOSA 3HOTA 5HOOA 3K9JA 3K9KA 4R79A 4U7BA 4MDBA
chains in the Genus database with same CATH superfamily
2IGIA 3PSFA 4AHTA 1RBVA 3SMPA 4H0VB 2JGUA 4DR2K 1J9AA 4O44A 4YOTA 3NCIA 3QFPA 3NMUA 4A57A 1L3SA 4BRLA 2AJQA 1G15A 3MWPA 3TAEA 1J54A 3DLEA 3ULDA 4LFAK 3VEYA 3QESA 4CHZA 1LOTB 3NE6A 1IJJA 3MK6A 2VQFK 3AVJA 2HHVA 1GLDG 3MEEA 4BR5A 4CEOA 3CFPA 2KHOA 4AHCA 1BQMA 5EVZA 1C1BA 3V9WA 1X9JA 4ZTFA 3HVRA 3RMDA 2DFHA 2IAJA 3AV9A 1RTHA 3H3NO 3SUOA 2HF4A 4FZZA 1BWFO 1A5XA 2OANA 1GLEG 2X74A 1S3XA 3R1XA 1NK6A 3L4QA 2P9SB 3T3FA 2E2OA 4DTNA 4J8FA 2G8UA 1SL2A 1KVBA 5AZJB 3M8PA 3V4IA 4DLEA 1NK9A 3DXMB 1QVGM 3VEWA 3V9XA 4GW6A 4NXMK 4FLUA 1GOBA 4R79A 1KRPA 4N76A 4ISGA 1P8ZA 3LDLA 1VSKA 1RNHA 2P9PA 4H4MA 3T7ZA 3V6DA 4OPJA 4O0IA 4CGIA 4WQ5A 3O9SA 5LJWA 5AQKA 2QWNA 3K2PA 1XHZA 2E8AA 2D0OA 1BCOA 4BR2A 2KTQA 4Y1CA 1U45A 1FK9A 4DTUA 3L4IA 1I3AA 2X6SA 4LF8K 3D0PA 3M3ZA 4MO5A 4MO4A 2Q2RA 2E6MA 3R3LA 4CEQA 4FWMA 3ENOA 3NH1A 1F21A 3P1GA 4CEDA 3FZKA 3HL8A 3MN7A 1DT9A 4OO1J 4PUOA 1XMQK 3WNFA 2B6AA 4OJRA 2B5JA 3P31A 4FJGA 1H1VA 5AQJA 1M1KO 2O8DB 3KLEA 3CJCA 1GOAA 5M1OA 1LWEA 3T1AA 4CJ4A 1RBTA 2UUCK 4CF0A 1RBRA 1T8EA 4F4KA 3CC2N 1T44A 3THXA 4OLBA 3W0LA 4KH6A 2ZGZA 3LL3A 3D2FB 3E1YA 3NGIA 5BPNA 4CCHA 4H03B 3MXJA 4F2RA 1BIZA 4BRKA 1NOZA 1IBLK 2NRXA 2P5OA 1HJOA 2QM1A 2QWLA 3R8EA 1CZBA 4BE2A 4A5AA 2O8FA 1DLOA 1WN7A 4W5RA 3K58A 4EAHD 4KBOA 3D2EB 3JXUA 1WSJA 4CBWA 3EZWA 1Z05A 4DQ8A 4EP5A 3THWB 3SV3A 3S41A 3VQPA 4WFBL 4JNEA 3CCJN 4DR6K 3AVAA 1C0FA 4O0JA 4OPAA 4FWSA 1QS4A 4EHTA 1JLFA 4BQLA 1S9EA 3VENA 1EX4A 2FBYA 3O9RA 3ZSZA 2GWKA 1QE1A 1QSYA 3WXKA 4A62A 1GLBG 4CEAA 3I0SA 3TANA 4FJ7A 3EL2A 3CG7A 4XEIA 3L2VA 4AILC 1RTDA 3F9KA 4H0YB 3ZX2A 4XH5A 1FW6A 1QQNA 2KW4A 2RE2A 3U8XA 2ZM6K 5M1PA 1U49A 4I2QA 2D5RA 4CEZA 3LDPA 1KSPA 2NRZA 4AF1A 4QOZB 3H45C 3LAKA 4H0XB 4K8XA 4O8KA 4CE9A 3CC4N 3HT3A 1RTJA 1Z6RA 4H5VA 3SMSA 3VQ7A 2LSNA 3PX6A 4BRAA 3OYJA 2W41A 4KAZA 4FK2A 4KHUA 3L8BA 4CF2A 3V1QA 5HRPA 4CF1A 3PO5A 4PL8A 2OPRA 3AVBA 2YJFA 3BZCA 2IVNA 1OKJA 1ASWA 5FRNA 4BWJA 4JI6K 3J81O 1J5EK 4DQIA 5GINA 1HR0K 4B1XB 4I6MA 3QEVA 3JS6A 3VTIA 1NGBA 4JKDA 5CYQA 4F9OA 2VWBA 4IZ9A 3MN6A 3HVTA 2P9KB 3H3OB 2YCHA 3PLAA 3NF9A 3MDQA 2E6LA 3VGKA 4FJ9A 5KTQA 1S1TA 3L2RA 3OHRA 1XUPO 4HUFA 4QS8A 2YKMA 1S5JA 4G9ZA 2ZE2A 3O9UA 4E1JA 4C8NA 3SNNA 3IG1A 2ZF5O 4GMJB 2YKNA 4BC2A 4FWNA 4WF9L 3EKSA 1C0GA 2XHBA 2ZJPL 1HNVA 4JD2A 3ULEA 4BRGA 2F9WA 3CJAA 2P9NA 3AO4A 3VEXA 3NHGA 1KVAA 5TKWA 4KO0A 4BG9A 4FW2A 5I9EB 1HRHA 1HLUA 3N4QA 4DQPA 1L5UA 4GV3A 4KHQA 4CERA 4AH9A 4U67L 3AA5X 3CI5A 4JKBA 3VF2A 2Z1GA 4B9LA 2XY5A 3CPWM 1BDGA 1G99A 5M1KA 3KJVA 2OTJN 3L6QA 4DR5K 4KB1A 2YNIA 1T6DA 4OGCA 4JV5K 5AQIA 1VSHA 3C6HA 3TAPA 4DG1A 4CK1A 4CHQA 4LH4A 2UUBK 4ICLA 5LJVA 3NH2A 2Z1HA 3PX0A 4B3TK 1LAWA 3LPTA 3H1VX 2Q97A 1Q18A 3ZT2A 3O1WA 1XC9A 4H5RA 1MWMA 2D0PA 2HVIA 1DTTA 5M1QA 3HTVA 3LM9A 4CFDA 4IWVA 3BDPA 2D1KA 4BRQA 4CEEA 5AQYA 1N8RO 4GKKK 3HZ6A 1J5OA 4O8UA 1NJIO 4LF4K 1T7PA 3EE8A 4EZ6A 3ZETA 3IUCA 3WUHA 2QK9A 2O8CB 4NYFA 4FJHA 3ATUA 2FSNA 3A5LC 5KGWA 2O8BA 4E1NA 3NGYA 2IVOA 4Q0BA 4LSLA 4W5OA 3L2QA 3VQ6A 2A5XA 3WXJA 4CGDA 4HWIA 4A2AA 4JK7A 4FPBA 4B9VA 3AVGA 5HRSA 4G1QA 3CQYA 3KK3A 4KI4A 4H0TB 5AQGA 3QIOA 5EX5A 1Q81O 3VESA 1WNSA 3PUFA 2UXCK 1OH8A 1U2VB 3PIOL 3QO9A 1BI4B 3VERA 3M1FA 1LW2A 1D9FA 2QXLA 5DM6L 5GAGP 5C2FA 3KHYA 4JKEA 3RWUA 1SAZA 1WOQA 4HUEA 3SUQA 1J6ZA 4ILJA 4K41A 3SI6A 4CBUA 4JI2K 2OTLN 2VCPA 3ZT1A 3C6AA 2P9IB 4JHDA 2FF3B 2HHTA 1Q86O 2P9UA 3AY9A 5CZ1A 4CGHA 5AZIB 4EIAA 2W42A 2FC0A 3P38A 3L3VA 4ID1A 3QB0A 1RT6A 4OPKA 3WQUA 2YJEA 1C1AA 1EWRA 2HBKA 3VQCA 4WCEL 3DM2A 3S3NA 1QSLA 2F8SA 1LCUA 1QQOA 2KZZA 4E1MA 4FM0A 1K8AO 2YNGA 4C8LA 5C10A 2OYQA 3C94A 1GLCG 4FLWA 4CK3A 2WFBA 3DLKA 3IDHA 1Q82O 5E26A 1JLAA 3SK3A 1ZBSA 5AQSA 5AQLA 1EXQA 3HPOA 1GLLO 3WT0A 5FDLA 1U04A 4JI4K 3AVCA 3QBXA 4JAXA 5J2MA 3SV4A 3KTQA 3CIPA 4RW9A 2VGNA 3HBTA 2E1YA 4CVNE 1IBKK 3SQ2A 3S3MA 3NAEA 5IWAK 1VQ8N 2VWJA 4E89A 3QINA 3VQ4A 3W3DA 4ELTA 2RHKA 4B8AB 5CY4A 3ZT3A 2E20A 1JCFA 1TL1A 1RBUA 2A1RA 1Y97A 3AARA 3D45A 3ZT4A 4FYDA 5KPZA 1CXUA 2G8FA 4R5PA 3GE1A 1BOTO 4Z4GA 1XC3A 5FLXO 5JLHA 4FWKA 3WXMB 2DTUA 2ZD1A 4E7IA 3OS1A 1XNQK 1KFDA 4DU3A 1TUUA 1WSEA 4PKIA 4DF8A 2HHQA 3G4SN 1DEJA 3H6EA 1YIJN 3AO2A 5KPRA 1LWFA 3GBTA 3F9MA 5CHIA 5E41A 3TSUA 3LP1A 3EE9A 3O3FA 5BRHA 4JK8A 3EY1A 3HO1A 4KI6A 4BVOA 2P9PB 3VEZA 4FWPA 4GVEA 1IKYA 1UOCA 3HSTB 1U4BA 2ITMA 4DV6K 1YJNN 3RVCA 2UU9K 4BRHA 1OVQA 4BC3A 3OYNA 4IJNA 5C12A 4L8RB 3GDQA 2HBJA 3H1QA 1NM1A 4IEEA 1D5AA 3ISNC 1HNXK 1KXPA 4FJMA 3TR8A 3ZSRA 1Y64A 3V9SA 4NO7A 1B9DA 1RFQA 5BREA 4JRPA 1XMOK 5BN8A 3NF6A 4FZXC 1E4FT 3LDNA 2EHGA 3CJ1A 3MN5A 1TUYA 4WQ4A 4CI6A 3WEEA 3AVHA 3OJUA 3CD6N 2F7TA 3AO1A 4LSNA 2ZWHA 4FL9A 1IG9A 3ZLJA 4LF5K 3OBWA 2KZMA 3BY5A 5AFUH 1RDCA 2HNDA 3TSQA 3ID8A 3KKRA 1D4XA 1NLVA 5AR0A 3OYAA 2WBNA 3THXB 4M3WA 5J1EA 4BQZA 3OS2A 3K5LA 4YHHK 4NLBA 3VQEA 3J80O 4AM7A 3VEVA 2O8FB 4DUZK 4H5TA 3DLGA 3U9DA 1NU0A 5LMNK 4CESA 4FSVA 4CIEA 3CCVN 4IO9L 1N6QA 1TK5A 4DV3K 3V1OA 5F2RA 1O13A 4FWLA 5LL6Z 4H0OA 4CZIA 5HP1A 4H5WA 3FLCO 4FLTA 1C0TA 4BC5A 2HB5A 3DYAA 5AQPA 4E3SA 1JLCA 5BRDA 4Y0WA 2BGGA 3THVA 3AVIA 3KLGA 1EWQA 2A1SA 3DRSA 1TGOA 1KVCA 1NK4A 3HP9A 3OYMA 4Z0UA 3ZSWA 4E7KA 3SAGA 4CBXA 5KQDA 4DV1K 2JLEA 4B9NA 3RR8A 1HQUA 2NRHA 1U47A 1HNWK 2KQ2A 4CHPA 1J53A 5AQFA 2E88A 4X65K 2HHUA 4B1VA 1SS6A 4CHNA 3M5RA 2E2PA 2BE2A 1QQMA 1RTIA 1XQSC 4IG3A 1HNZK 5FPDA 4M42A 1JLGA 5B8HA 3DLBA 4EZ9A 2VG5A 4ILHA 3QMLA 5HRRA 3T19A 4FM1A 4EP4A 4M3YA 5JS2A 2HBMA 5FPNA 3H46O 4DB3A 3CQXA 1BUPA 3SUPA 3FZLA 4CGGA 4CJRA 4JI5K 2ASOA 1SL0A 2QWRA 3KZBA 4DV7K 4IFYA 3MXIA 5BR9A 4IKFA 1VK0A 4CHYA 2NNWA 1TKXA 4PQUA 2FF6A 1LAVA 1VQLN 3UIQA 4JN4A 4IG0A 4JLHA 1N34K 4JKGB 1KAZA 4F3TA 5FROA 4LD0A 3RR7A 3OY9A 4I7FA 1IV0A 4WQ4C 2HMIA 4K25A 1TK8A 2NRTA 3OJSA 1FXXA 3CQ8A 3K5MA 3VPZA 1VQPN 5FRMA 2G8WA 5KRSA 3UKRA 2Q3SA 3VQBA 3EYZA 2OPPA 3K9JA 1BISA 3MCAB 1ASUA 4LFBK 5ADXH 1WAJA 4CJSA 3E9OA 5BPLA 3CCSN 4Z4EA 1NMNA 1R59O 2OA8A 2D0BA 2YHYA 1RDBA 1X3MA 4W5NA 3RSEA 4NCGA 5AQHA 4QAGA 2ATQA 1W97L 4ISFA 4KFBA 1WLJA 2F4VK 2WTUA 3CFRA 1NGFA 2HHWA 1HUXA 4W5TA 2V7ZA 4GV9A 1YUWA 3MWTA 2GWJA 2NZTA 2ASMA 4DFPA 3WNEA 1X9MA 4OX9K 4IOAL 4JD2B 2RN2A 3ULEB 2NLXA 5JLFA 2P9NB 3FFIA 2QKKA 4BG8A 4CJFA 1T03A 3PY8A 1N32K 3KLFA 3F73A 1KFSA 1JXEA 4M7YA 3LWLA 3C65A 2KFNA 1JCEA 3TTDA 4J2EA 1YTAA 1VRUA 4CK2A 4LFCK 4IOXA 4H4OA 2IOCA 1NGEA 3DJCA 4FWRA 4IJAA 3SPYA 4DSIA 3O6WA 4DUYK 2G8VA 3L3UA 4XH4A 2Q0RA 1QVFM 1KCFA 4ZHRA 1N5YA 4IFVA 3DWLA 1RDWX 3MEDA 3CM5A 4RW7A 4NLCA 2GTDA 3LP0A 4O4GA 5KGXA 1TYQA 4DF4A 1GOCA 2QI2A 2VGMA 3WNGA 1YHQN 4CIGA 4PL7A 3E9PA 4YFUA 5DM7L 4CJEA 1VRTA 1T6CA 3THYA 2A41A 2ZJRL 3C0BA 1C0MA 3VN5A 3TAFA 1I39A 3IS9A 2VG6A 3I8DA 4NCAA 1ILYA 3RRHA 4DQRA 3ZETB 2WC9A 1NNEA 3B6OA 3HYFA 3LM2A 4ZTJA 3VQ5A 2O8BB 1ITGA 2HNZA 4KB0A 4FJIA 1B92A 1BQNA 2XY8A 4BR4A 1BU6O 4CF9A 3VOVA 4CEFA 1R0AA 2PZSA 5AQWA 4FJNA 4Z4HA 4BE0A 1TKZA 1RCHA 4KTWA 3QNNA 4MDBA 4FWQA 3CJBA 2KFZA 2I5JA 3O80A 4DS4A 4CJVA 1YVNA 1S22A 3LP3A 1NJXA 1V4TA 3HOSA 3TAQA 4B9QA 4QS7A 4BWMA 3F5TA 4E7HA 5AQZA 1DGKN 4BR0A 4RW8A 3OTOK 3BF3A 4CJ3A 2ITGA 1L3UA 3PO4A 5CE3A 4FLVA 4B1UB 3FZFA 1FJGK 1XHXA 5HROA 3O5BA 4JHDB 4OKKA 1O1WA 4MDAA 1HNIA 1GLJO 3ENBA 3HRGA 3MXMA 2P9UB 1KTQA 5E84A 1U6ZA 2O8EA 3WNHA 4OKJA 3ZEUA 1TAUA 3CCQN 1TKDA 1S1VA 5J2NA 2P1JA 1JLEA 3AO3A 5AQQA 3SZ2A 1P90A 2G8KA 4BE1A 4NYNA 3T1HK 4KHWA 4OGEA 1VQ4N 2BDPA 4F2SA 3NH0A 1XI1A 1WSFA 4DFMA 1W0HA 4DCHA 1NWKA 1S9GA 4HTLA 1Q9XA 3O9QA 3BEXA 4B3OA 4NCBA 3OYKA 1SL1A 5F0XA 3QIPA 4LF9K 4Z94A 2BTFA 1WSIA 2CH5A 3HK2A 4IBNA 4BACA 3KLIA 1ZC6A 1LWCA 3ZSOA 3AAQA 3GG4A 1ZBFA 1JCGA 2WUSA 3CPEA 1WBDA 4OPHA 3H08A 1BA1A 4FOEA 4AHUA 3SJHA 5AQTA 3KWGA 3DLLL 2V7YA 1YJ9N 1S72N 4TSXA 1K73O 2NRWA 3QBWA 4HUGA 5M1NA 2CGKA 3U6FA 2Z1JA 4KV8A 1YITN 4JKHA 2H3GX 4FWOA 2I7NA 4HTUA 1NK0A 3FZHA 1UWBA 2PY5A 3NGZA 4FK4A 4ELVA 4JI0K 3DLHA 4XH1A 4JK9A 2FBXA 1U48A 3MMVA 2HHXA 3IKMA 4F3OA 1K9MO 1RT4A 3I8BA 3SQ1A 4O55A 4YOYA 1QZ5A 1Q9YA 3JAMO 1VSDA 3CJ9A 4HCCA 1ZBIA 4JS5A 3HM8A 4FW1A 1VQNN 1ZYQA 5EU7A 2I7PA 1HQEA 3AO5A 3M8SA 1SV5A 1X9WA 3QERA 1RILA 2GX9A 4M3TA 3CM6A 4FM2A 4GNIA 3I0RA 5C42A 4CJ5A 4AHSA 5D3GA 2KLAA 4BRNA 2DFEA 3VQQA 4C1NK 3I55N 3CMAN 3ZT0A 2F9TA 2X6NA 3LPUA 3O8MA 3L2UA 1YAGA 4YOVA 3OVNA 2IDOA 2QKBA 3VQ8A 4Z4CA 1A5VA 3TPQA 3GOIA 4MFBA 3CFOA 1JKHA 3KVGA 3NF8A 4CJTA 4J2DA 3OYCA 4K0KK 2QW9A 4DV2K 4LY7A 1K8KA 4FO0A 3T1YK 3WEEB 1S6QA 2NUBA 4BGBA 3KK7A 3OYHA 1VSFA 4CZGA 2NRRA 4JKCA 1TK0A 4DSEA 1TV6A 2Q36A 4CW7B 3ZSVA 2PFUA 3HI0A 1KD1O 1HPMA 2D4WA 3UKUA 2YNFA 4FPAA 4E19A 1EP4A 3KD5E 1WSGA 4BRIA 1SQKA 2V52B 4CZJA 2CGJA 5LMUK 4I9LA 2UXDK 1C1CA 1VHXA 3FGUA 1MWKA 4CJ7A 2WOMA 3DRRA 4YOXA 3MECA 5HRNA 2XY6A 3VQ9A 1W2BM 1RDAA 2JWLA 1GLFO 1SUQA 3FFKB 4ID5A 2A6AA 4N56A 3J8AA 4CJQA 2HW3A 3DLRA 2YV0X 5EOYA 3SPZA 4E0DA 4Z4IA 4CZMA 3SUNA 1HPZA 4M3XA 1BA0A 2BUPA 1BCMA 2YI1A 3CXCM 1IH7A 4C23A 4YNQA 2KKZA 2OPSA 2PBDA 4WFNL 3AVLA 1OH6A 4FJ8A 4DWIA 3DAWA 3K57A 3LDQA 3C7NA 4M7XA 1DTQA 3IMXA 3CCUN 2HSTA 1EQYA 1N36K 3LWMA 2W40A 1QZ6A 5KQ8A 4LF7K 3K5NA 3OYBA 4DU1A 2D0AA 3EZ5A 4CJWA 3EO3A 4YDUA 2P9LA 4B1ZA 4KREA 4CJLA 3LZJA 2FSJA 3CF5L 3TARA 5A2QO 5CR4A 3G10A 3DI6A 1HKCA 4WFAL 4UQGA 5FPEA 1ATRA 5AQMA 2AP1A 2HBLA 1N33K 4AHRA 2Z1IA 5HOOA 1ESVA 2OPQA 3U3YA 4UY8O 4CEBA 1RT5A 1RT2A 3MCPA 1YI2N 2HMPA 1RT3A 5JVHL 5GAEP 1TL3A 2VWKA 1QHAA 3M8QA 4LC9B 4YOUA 1DKGD 3BUZB 3PSIA 1KAYA 3SQ0A 2YNHA 3T69A 3VMFB 4B9SA 1MDUB 2HF3A 3VF6A 4A5BA 4JKAA 1C0UA 2E1ZA 4KHPK 3A8YA 4X66K 4V19S 5T7BA 1V4SA 3QETA 3TABA 2FBTA 1W7AA 4Y1DA 1E4GT 4BRDA 3UKRB 2QEXN 3CCLN 1Z26A 5BN9A 1RGIA 4PWDA 2DY4A 1BO5O 1NKEA 2B4JA 2ETJA 4E7JA 2Q1NA 2GUIA 5M1FA 3U3GA 1ZBUA 1VSEA 3LDSA 2Y1JA 2RF2A 1NKBA 4BDZA 3L2WA 5GAHP 4PKHA 4BRPA 3RSEB 4ISEA 3TI0A 2Q0UA 3L0QA 4CFAA 3E01A 2QWPA 3AVNA 3G0ZA 4M63C 5BR8K 5GIPA 2EX3A 1QTMA 4IOCL 3E9LA 3KIOA 3DXKA 2GEMA 4RCHA 4FJKA 4PKGA 4B08A 3K59A 3BP8A 4DV0K 1NGHA 1D8YA 2PYJA 1MA9B 1YT3A 1ATNA 1NJYA 4KHSA 4DHYA 4CZEA 2GBZA 3AVFA 4O5FA 4K42A 3KK2A 3IAYA 3SLCA 5JS1A 3OS0A 3P83D 3R9PA 3ZSXA 3LALA 1JL1A 1IO2A 1T05A 2V51B 4RTFD 2NRVA 3MX5A 2Q31A 5AQXA 1JLBA 4DTPA 2P51A 5DK5A 1LW0A 4O5BA 1YF5L 3AVKA 4DKWA 3D6RA 3VTHA 4DTJA 5C2DA 1BL3A 4FVUA 4YDUC 5GIOA 3G6EN 2W6LA 1IKWA 3DOKA 4YOWA 4CZHA 3TTCA 2FXUA 2W6KA 5KRTA 4FJ5A 3AA3A 3P4IA 4M3RA 4N47A 5SZTA 4BDYA 3TSPA 1VQON 3S3OA 3VEOA 1TYQB 3V9ZA 2A3ZA 4C8MA 1NKCA 3HM9A 2QA4N 1EO1A 3NDKA 4M41A 5C15A 4FVMA 3VETA 3JSMA 4I6MB 4CGJA 4B3MK 4HHTA 4DQSA 4FCYA 3THYB 1KLMA 4IO8A 4JYAK 1IBMK 2BANA 3LP2A 3AVMA 1IKXA 3OYIA 3KLHA 3K0SA 5HBMA 3O4QA 3J7AP 3OYGA 4GY2B 5F1XA 5C25A 1NK8A 1SKWA 3U4LA 3ZSQA 3DMJA 1FKOA 4CZFA 4DR4K 5BRFA 3QICA 1K6YA 4BVPA 3U9ZA 1ZBLA 3ZYYX 1NK5A 4BRFA 2DPNA 4LH5A 3RMAA 3NBPA 5HL7L 3KK1A 4FJLA 1NG9A 1KAXA 3GL1A 4OVLA 4PY5A 2QTDA 1REVA 3TWHA 3SAHA 1HYZA 3RMCA 1QSSA 5J2PA 2P9SA 4K43A 5BPMA 3OYFA 5AQRA 2E2NA 2P5GA 5AQUA 1UA0A 4AQYK 4I2PA 5AZJA 5MLCQ 3IFRA 4H0PA 3DXMA 3LDOA 2UXBK 1NMDA 3Q7BA 1NGJA 4OKEA 3DRPA 3B6PA 1FKPA 3K9KA 4DR1K 1WB9A 1NBWA 3MN9A 4BR9A 4WYBA 3WXLA 2HHHK 4JI1K 2GUPA 4J2AA 3AAPA 3BZKA 3S9HA 4M45A 2X78A 3A5MC 4KTQA 4RWTA 3PIPL 2O8EB 5AQVA 3TAGA 3J7YP 3ZEUB 4JI7K 4RW4A 1HKGA 5KPTA 1KC8O 5AQNA 3CJ7A 3SAFA 3P39A 4L3QA 3CHWA 3QEIA 2RKIA 2D0CA 4EHUA 4XIUA 3EEQA 1NJZA 4DMNA 1VSLA 3QEWA 1MU2A 2VG7A 4WQ5C 4H5NA 1TKTA 1CXQA 1RBSA 4DLGA 4YORA 2QWOA 5IT9O 2O8DA 3TAMA 4C1NI 4MLEA 3CYMA 3SBTA 1VQ7N 1VQKN 5JICA 3A0IX 3C95A 5CYMA 3MAQA 3OA9A 3HOTA 3SQ4A 3VGMA 1S1XA 4JKGA 4BDPA 2GELA 4LF6K 3D2FA 5C24A 4CZKA 5AJ3K 4IDHA 1ZBHA 3O9TA 2QXFA 3G71N 4X64K 1HMVA 3OYLA 3HP6A 1X3NA 3BGRA 3OBYA 4I9QA 1NGDA 1S1WA 4JEPA 4BREA 2ZQBA 4DSFA 1XNRK 3QDKA 4DTRA 3D2EA 3A5NC 1GLAG 5CZ2A 3SBGA 5LY3A 3G25A 2OZSA 4DFJA 3JYTA 3THWA 2J4RA 4B8CA 4BR7A 4F8RA 1VQ9N 1EKEA 3PX4A 2ASPA 3ASMA 5AFUA 3ID6A 1VAZA 4JI8K 2YHWA 2XRIA 1L3TA 5HLFA 3WXIA 4PHTX 4GVMA 4GV6A 3UE5A 2UUAK 4PA1A 5JMVA 3VA0A 2IIRA 1BG3A 1IG8A 2FSKA 4ILGB 4DSLA 3QNOA 2IC3A 4DFKA 3TU5A 4CGFA 2FLOA 3TTFA 1NOYA 4KKOA 2CGLA 4H8KA 4BRMA 3AA4A 4CFCA 2A40A 4B9UA 3M8RA 2DFFA 2E5LK 5EXWA 3IRXA 3NVKA 2AA4A 1HYSA 1VQ6N 1ATSA 3R6MA 5K14A 2YHXA 1OH5A 4DR3K 4CJPA 2E4LA 3ATVA 3KWIA 1RDDA 3LANA 1NJWA 1NGCA 2F96A 3N4PA 4DSJA 3ITHA 4N5SA 3QLHA 1M90O 1K8KB 4NB4A 1HX1A 3NF7A 4HVJA 3CC7N 5I42A 1L3VA 3HXMA 3VA3A 1JXBA 5KI6A 1WBBA 1HKBA 3C6UA 1QHTA 4QCLA 3ZX0A 3P5JA 3SYZA 3AGRA 2HHSA 3NVMA 3UKUB 3SCXA 1ASVA 2ZJQL 3ALYA 4X62K 4CFBA 5H1SQ 3HSCA 2R7YA 2P9KA 1T3VA 2QWQA 5J2QA 3SJJA 4B1WB 1B9FA 2VYPA 3A2FA 2YX6A 3FR0A 3HPHA 3RRGA 4MQ3A 2OCEA 1YVUA 1S1UA 2IVPA 2HOEA 2CH6A 4E7LA 1E3MA 4CHOA 1NGAA 3ZX3A 4DS5A 4KHYA 3QEXA 5SWMA 1UAXA 2ZGYA 3MEGA 3AGKA 4JS4A 4N41A 4J2BA 2OZMA 3CCMN 3LZIA 4FZYA 3OW2M 4KPYA 1QQCA 3O4NA 3VGLA 4KH5A 4M3UA 1S6PA 1LV5A 1CZAN 4BGAA 1YTUA 4DV5K 2FBVA 4FXDA 1TVRA 4U7BA 2A42A 3D7EO 3ENHA 1VQ5N 3C7NB 2BH1A 1VSMA 5JVGL 3V9UA 1JLQA 2E2QA 1SKRA 1SZ2A 3O4WA 2PYLA 1KQSM 1RT7A 4KHNA 4EFHA 4DQQA 2QWMA 4M3ZA 3CETA 1VSJA 3KD1E 5ADXA 3OYEA 2P9LB 3O3GA 4FLXA 3WQTA 3A5OC 4CJKA 4FJXA 3BF1A 4JI3K 3RTVA 4JRQA 2VQEK 1HJRA 4DTXA 4ELUA 2Y1IA 4CD1A 3ZSYA 3CCRN 4CECA 2G8HA 3KKSA 1BIUA 4A2BA 3EN9A 3UB5A 3HPGA 4CIFA 3E66A 1OVYA 4Z4FA 4A61A 4A59A 1ZXOA 1BHLA 3QFUA 1UA1A 1NK7A 4C8OA 3HJFA 3FZMA 4K8ZA 1NGIA 4DSKA 1X1PA 1Q7YO 4B1YB 2WONA 5EY4A 4KH4A 4FLYA 1CLQA 1W9HA 2IS3A 4IDKA 3OYDA 2YHBA 1D9DA 3O1BA 3QEPA 4IEIA 4BC4A 2UYTA 2XY7A 3LAMA 1Z25A 4CJUA 4DTSA 4FK0A 3C6TA 4NXNK 4BY9C 1NGGA 3B8AX 3V81A 3EKUA 3CMEN 5DMRA 4B3RK 2O8CA 1X9SA 2YHAA 4BROA 3CERA 3PV8A 3NFAA 3J7ZO 3CCEN 1JL2A 4AHVA 1Q8IA 1OH7A 5FPMA 3I33A 3FE1A 3ZCMA 4B9MA 1BGXT 1C6VA 4KRFA 4IXCA 1VQMN 1RT1A 1HYVA 4FJJA 2GV9A 4DTOA 1U2VA 1TAQA 2O4IA 4DU4A 4QS9A 1VSIA 3RMBA 1IKVA 4AM6A 1BI4A 2RPIA 2G8IA 3VQDA 4DR7K 4BRCA 4CZLA 1I94K 4CF8A 4WE1A 4MLHA 2O4GA 3DXKB 3K5OA 1WAFA 3Q7CA 4RG8A 5I3UA 5TKYA 4FLZA 4DTMA 1KLNA 4JKFA 4C8KA 3F2KA 3VF4A 3M6GA 5C0YA 1XWLA 4OLAA 4GKJK 2HNYA 4YY3K 2P9IA 4RW6A 4W5QA 1RDUA 1EETA 4HCBA 1SKSA 5AZIA 1A5WA 3O3HA 1WUAA 5AQOA 1YJWN 3V1RA 2XO7A 3AA2A 3DOLA 3O08A 4IFEA 4FOIA 4CD3A 1CZ9A 4Q5VA 4B3SK 2HVHA 2PAVA 3VQAA 4DV4K 5ELZA 1WSHA 3I56N 1JJ2M 2JWKA 4B9TA 2EWSA 3MX2A 4KTZA 2F8TA 5GADP 1YXQA
chains in the Genus database with same CATH topology
3CJBA 3SMPA 3U4LA 4H0VB 1Q86O 3O80A 2P9UA 3AY9A 4CZFA 1YVNA 1S22A 5BRFA 3QICA 4YOTA 5AZIB 4EIAA 3QFPA 3NMUA 4BVPA 4A57A 3P38A 1V4TA 3U9ZA 3ZYYX 3QB0A 3HOSA 4B9QA 4BRFA 4QS7A 2DPNA 3F5TA 4BRLA 5AQZA 3WQUA 3MWPA 2YJEA 1DGKN 2HBKA 4WCEL 4BR0A 5HL7L 1LCUA 1KAXA 1QQOA 3BF3A 3GL1A 2QTDA 3VEYA 5CE3A 1K8AO 4B1UB 3SAHA 3FZFA 1LOTB 5C10A 1IJJA 1GLCG 2WFBA 2P9SA 3MK6A 3O5BA 4K43A 4JHDB 5BPMA 3IDHA 5AQRA 2E2NA 4MDAA 1Q82O 1GLJO 5E26A 1GLDG 3ENBA 3HRGA 3SK3A 5AQUA 2P9UB 4BR5A 1ZBSA 5AQSA 5AZJA 5MLCQ 5AQLA 3IFRA 5E84A 1U6ZA 4H0PA 2KHOA 3DXMA 1GLLO 3LDOA 3WT0A 3ZEUA 3CCQN 1NMDA 3QBXA 5EVZA 3Q7BA 1NGJA 4JAXA 5AQQA 3CIPA 1X9JA 1P90A 2VGNA 3HBTA 3K9KA 2E1YA 3H3NO 1NBWA 2HF4A 3MN9A 4WYBA 4BR9A 3WXLA 1BWFO 1VQ4N 1VQ8N 2OANA 1GLEG 4DCHA 1NWKA 1S3XA 3R1XA 2GUPA 4HTLA 3L4QA 2P9SB 3O9QA 2E2OA 3BEXA 3AAPA 4J8FA 3A5MC 3W3DA 5F0XA 4RWTA 5AZJB 2RHKA 3PIPL 4Z94A 2BTFA 5AQVA 3DXMB 2E20A 3ZEUB 1JCFA 2CH5A 1QVGM 3VEWA 1HKGA 1ZC6A 5KPTA 3AARA 1KC8O 3AAQA 4R79A 5AQNA 5KPZA 3CJ7A 3SAFA 3GE1A 1BOTO 3GG4A 1XC3A 3P39A 4L3QA 3CHWA 4FWKA 5JLHA 1JCGA 4ISGA 3WXMB 1P8ZA 2WUSA 3CPEA 3LDLA 4OPHA 2P9PA 1BA1A 4FOEA 4EHUA 3SJHA 3T7ZA 5AQTA 3KWGA 3DLLL 2V7YA 1YJ9N 1S72N 1TUUA 4WQ5A 4WQ5C 3O9SA 4H5NA 4PKIA 5LJWA 5AQKA 2QWNA 2NRWA 3G4SN 1K73O 1DEJA 3H6EA 3QBWA 1YIJN 4YORA 5M1NA 2E8AA 2QWOA 2D0OA 4BR2A 2CGKA 5KPRA 1YITN 4JKHA 4C1NI 3GBTA 3F9MA 4MLEA 5CHIA 2H3GX 3SBTA 3TSUA 4FWOA 1VQ7N 1VQKN 3L4IA 2I7NA 5JICA 3FZHA 3A0IX 3M3ZA 4MO4A 4MO5A 2Q2RA 3R3LA 3EE9A 3OA9A 4JK8A 5BRHA 3HOTA 4FWMA 3VGMA 4BVOA 3ENOA 2P9PB 4JKGA 3VEZA 2GELA 4FWPA 4GVEA 3FZKA 3D2FA 3MN7A 4XH1A 4CZKA 4JK9A 1DT9A 3MMVA 4OO1J 2ITMA 3IKMA 4IDHA 1YJNN 3RVCA 4BRHA 1K9MO 4BC3A 3O9TA 3P31A 4IJNA 5C12A 1H1VA 5AQJA 3G71N 1M1KO 3I8BA 3GDQA 2HBJA 3H1QA 1NM1A 4YOYA 4IEEA 3CJCA 1QZ5A 1X3NA 3OBYA 5M1OA 1KXPA 1NGDA 3CJ9A 4JEPA 1Y64A 3HM8A 4BREA 4NO7A 1VQNN 3QDKA 3D2EA 3A5NC 1RFQA 1GLAG 5LY3A 3SBGA 3G25A 5BREA 2I7PA 3CC2N 1T44A 5BN8A 2J4RA 2GX9A 3W0LA 4BR7A 1E4FT 3LDNA 4GNIA 4KH6A 1VQ9N 2ZGZA 3LL3A 3D2FB 3E1YA 3CJ1A 5BPNA 3MN5A 1TUYA 4H03B 4WQ4A 4CI6A 2ASPA 3WEEA 4BRKA 5AFUA 2KLAA 3ID6A 4BRNA 3CD6N 2NRXA 2F7TA 1VAZA 2ZWHA 4FL9A 1HJOA 2YHWA 4C1NK 2QM1A 2QWLA 3R8EA 3I55N 3CMAN 4A5AA 3OBWA 3WXIA 2F9TA 4PHTX 4GV6A 3O8MA 3UE5A 4EAHD 1YAGA 5JMVA 5AFUH 4YOVA 4KBOA 2IIRA 3D2EB 3TSQA 1BG3A 1IG8A 3ID8A 3JXUA 4CBWA 3EZWA 1Z05A 2FSKA 1D4XA 4DQ8A 3TPQA 1NLVA 3GOIA 4ILGB 5AR0A 3KVGA 3S41A 2WBNA 4WFBL 4JNEA 4BQZA 2QW9A 3CCJN 2P9IB 1K8KA 1C0FA 3TU5A 4OPAA 4FO0A 4FWSA 3WEEB 2FLOA 3TTFA 3KK7A 4BGBA 4EHTA 4NLBA 4CZGA 2NRRA 4BQLA 4JKCA 3VENA 4AM7A 2CGLA 4BRMA 2A40A 3O9RA 3VEVA 5EXWA 2Q36A 3NVKA 2AA4A 4H5TA 1VQ6N 2GWKA 3U9DA 1ATSA 3WXKA 4A62A 2PFUA 3HI0A 1KD1O 1HPMA 1GLBG 2D4WA 3R6MA 3UKUA 2YHXA 4FSVA 4FPAA 4IO9L 3EL2A 3CCVN 4XEIA 3ATVA 3KWIA 1SQKA 4H0YB 4BRIA 3ZX2A 1NGCA 2V52B 3N4PA 4XH5A 4CZJA 5F2RA 1O13A 1QQNA 2CGJA 4FWLA 3U8XA 2RE2A 3FGUA 1M90O 1K8KB 4H0OA 5M1PA 4CZIA 1MWKA 4NB4A 1HX1A 4H5WA 3FLCO 4CJ7A 3LDPA 3CC7N 4BC5A 4YOXA 2NRZA 4AF1A 1W2BM 2JWLA 5AQPA 1GLFO 3FFKB 3H45C 2A6AA 5BRDA 1HKBA 4Y0WA 4H0XB 4O8KA 3ZX0A 3CC4N 3J8AA 1Z6RA 3AGRA 4H5VA 3NVMA 3SMSA 3UKUB 3SAGA 5EOYA 4CBXA 5KQDA 4CZMA 4BRAA 2ZJQL 5H1SQ 2NRHA 3HSCA 2P9KA 1T3VA 2W41A 5AQFA 1BA0A 2BUPA 2E88A 2QWQA 2YI1A 4B1VA 4B1WB 3CXCM 1SS6A 2VYPA 3FR0A 2YX6A 4C23A 2KKZA 2IVPA 2HOEA 2PBDA 2CH6A 2E2PA 3M5RA 4PL8A 4WFNL 1NGAA 1QQMA 2YJFA 3ZX3A 1XQSC 2IVNA 3DAWA 5FPDA 3LDQA 1OKJA 3C7NA 2ZGYA 5B8HA 4ILHA 3QMLA 4M7XA 5GINA 3AGKA 4B1XB 3IMXA 4I6MA 3CCUN 2HSTA 1EQYA 3CCMN 2HBMA 5FPNA 3JS6A 3H46O 2W40A 1QZ6A 3VTIA 3CQXA 1NGBA 4DB3A 1BUPA 5KQ8A 3OW2M 4JKDA 3FZLA 3VGLA 4F9OA 4KH5A 2ASOA 2QWRA 2VWBA 4IZ9A 3EO3A 3KZBA 3MN6A 2P9LA 4YDUA 1CZAN 4B1ZA 2P9KB 3H3OB 4BGAA 5BR9A 2YCHA 3CF5L 2FSJA 3PLAA 3MDQA 5CR4A 3VGKA 2NNWA 1HKCA 4U7BA 2A42A 2FF6A 3D7EO 4WFAL 1VQLN 3ENHA 5FPEA 1ATRA 4JN4A 5AQMA 3C7NB 2BH1A 1VQ5N 2AP1A 5JVGL 3OHRA 2E2QA 1KAZA 1SZ2A 1XUPO 4JKGB 3O4WA 1KQSM 2HBLA 4EFHA 4QS8A 2QWMA 4WQ4C 5HOOA 4G9ZA 3O9UA 4K25A 1ESVA 4E1JA 3CETA 2NRTA 2ZF5O 5ADXA 4UY8O 3VPZA 1VQPN 3MCPA 2P9LB 1YI2N 2HMPA 4BC2A 3WQTA 4FWNA 3A5OC 3UKRA 4WF9L 5JVHL 3EKSA 3BF1A 1C0GA 3K9JA 5GAEP 2ZJPL 3MCAB 4JD2A 4CD1A 5ADXH 3ULEA 4BRGA 2F9WA 3E9OA 3CJAA 1QHAA 2P9NA 3VEXA 4LC9B 3CCRN 4YOUA 1DKGD 3BUZB 5BPLA 4A2BA 1KAYA 3EN9A 3CCSN 3T69A 1R59O 3VMFB 3UB5A 1MDUB 5TKWA 4BG9A 2YHYA 2HF3A 1X3MA 3E66A 1OVYA 3VF6A 4JKAA 4A5BA 5I9EB 3RSEA 2E1ZA 4A61A 1ZXOA 1HLUA 3QFUA 4A59A 5AQHA 3N4QA 3A8YA 1W97L 4ISFA 4GV3A 3FZMA 1NGIA 1V4SA 4U67L 3CI5A 1Q7YO 4JKBA 3VF2A 4B1YB 5EY4A 1NGFA 4KH4A 1HUXA 2V7ZA 4GV9A 1E4GT 1YUWA 4BRDA 3MWTA 3UKRB 2QEXN 3CCLN 2GWJA 5BN9A 2NZTA 2ASMA 1RGIA 1BO5O 3O1BA 3CPWM 1BDGA 4IEIA 1G99A 5M1KA 4IOAL 2Q1NA 4JD2B 2OTJN 4BC4A 2UYTA 3L6QA 3ULEB 5M1FA 2NLXA 5JLFA 2P9NB 1T6DA 5AQIA 4BG8A 3C6HA 4BY9C 1NGGA 5GAHP 3B8AX 4PKHA 4BRPA 3EKUA 3CMEN 5LJVA 3RSEB 4ISEA 2Q0UA 4M7YA 3L0QA 3H1VX 3C65A 4BROA 2QWPA 3CERA 1JCEA 3TTDA 4M63C 3J7ZO 3CCEN 2Q97A 1Q18A 5GIPA 4IOXA 3O1WA 4H5RA 4IOCL 1MWMA 3E9LA 2D0PA 1NGEA 3DJCA 2GEMA 3DXKA 4FWRA 4IJAA 3O6WA 4RCHA 3I33A 3FE1A 5FPMA 5M1QA 3HTVA 3LM9A 4IXCA 4PKGA 3BP8A 1NGHA 1VQMN 4XH4A 2Q0RA 4IWVA 1MA9B 2D1KA 4BRQA 5AQYA 1N8RO 1ATNA 3HZ6A 1QVFM 4O8UA 4DHYA 1NJIO 4CZEA 4O5FA 4K42A 3SLCA 1U2VA 3EE8A 3DWLA 4QS9A 1RDWX 3ZETA 3IUCA 3WUHA 4AM6A 3R9PA 3ATUA 2FSNA 4NLCA 3A5LC 4BRCA 2V51B 2GTDA 4RTFD 2NRVA 4CZLA 3MX5A 2Q31A 1TYQA 2IVOA 5AQXA 2QI2A 2VGMA 1YHQN 4PL7A 3E9PA 4MLHA 2A5XA 3DXKB 1YF5L 3WXJA 4HWIA 5DM7L 3Q7CA 4JK7A 4FPBA 4A2AA 5TKYA 4DKWA 1T6CA 3CQYA 3D6RA 4H0TB 5AQGA 3VTHA 2A41A 2ZJRL 3C0BA 5EX5A 1Q81O 3VESA 5C2DA 4JKFA 3F2KA 4FVUA 3VF4A 4YDUC 1U2VB 3M6GA 5GIOA 3G6EN 3PIOL 5C0YA 1ILYA 4YOWA 4CZHA 3TTCA 2FXUA 3ZETB 2WC9A 3VERA 3M1FA 4FWQA 2P9IA 2QXLA 3P4IA 5DM6L 5GAGP 5C2FA 1VQON 3KHYA 3TSPA 3LM2A 4JKEA 3VEOA 1TYQB 1RDUA 2A3ZA 1SAZA 2QA4N 1WOQA 5AZIA 1EO1A 1WUAA 5AQOA 1YJWN 1J6ZA 5C15A 3VETA 4ILJA 4I6MB 3O08A 4IFEA 4K41A 4FOIA 4BR4A 1BU6O 4CD3A 3VOVA 2PAVA 4IO8A 5AQWA 4CBUA 5ELZA 1JJ2M 3I56N 2JWKA 2OTLN 2EWSA 2VCPA 3MX2A 4GY2B 5F1XA 5GADP 1YXQA 4MDBA 3C6AA 4JHDA 2FF3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F7T A;  3F2K A;  5CR4 A;  4MDA A;  3HOS A;  3HOT A;  5HOO A;  3K9J A;  3K9K A;  4R79 A;  4U7B A;  4MDB A; 
#chains in the Genus database with same CATH topology
 2IGI A;  3PSF A;  4AHT A;  1RBV A;  3SMP A;  4H0V B;  2JGU A;  4DR2 K;  1J9A A;  4O44 A;  4YOT A;  3NCI A;  3QFP A;  3NMU A;  4A57 A;  1L3S A;  4BRL A;  2AJQ A;  1G15 A;  3MWP A;  3TAE A;  1J54 A;  3DLE A;  3ULD A;  4LFA K;  3VEY A;  3QES A;  4CHZ A;  1LOT B;  3NE6 A;  1IJJ A;  3MK6 A;  2VQF K;  3AVJ A;  2HHV A;  1GLD G;  3MEE A;  4BR5 A;  4CEO A;  3CFP A;  2KHO A;  4AHC A;  1BQM A;  5EVZ A;  1C1B A;  3V9W A;  1X9J A;  4ZTF A;  3HVR A;  3RMD A;  2DFH A;  2IAJ A;  3AV9 A;  1RTH A;  3H3N O;  3SUO A;  2HF4 A;  4FZZ A;  1BWF O;  1A5X A;  2OAN A;  1GLE G;  2X74 A;  1S3X A;  3R1X A;  1NK6 A;  3L4Q A;  2P9S B;  3T3F A;  2E2O A;  4DTN A;  4J8F A;  2G8U A;  1SL2 A;  1KVB A;  5AZJ B;  3M8P A;  3V4I A;  4DLE A;  1NK9 A;  3DXM B;  1QVG M;  3VEW A;  3V9X A;  4GW6 A;  4NXM K;  4FLU A;  1GOB A;  4R79 A;  1KRP A;  4N76 A;  4ISG A;  1P8Z A;  3LDL A;  1VSK A;  1RNH A;  2P9P A;  4H4M A;  3T7Z A;  3V6D A;  4OPJ A;  4O0I A;  4CGI A;  4WQ5 A;  3O9S A;  5LJW A;  5AQK A;  2QWN A;  3K2P A;  1XHZ A;  2E8A A;  2D0O A;  1BCO A;  4BR2 A;  2KTQ A;  4Y1C A;  1U45 A;  1FK9 A;  4DTU A;  3L4I A;  1I3A A;  2X6S A;  4LF8 K;  3D0P A;  3M3Z A;  4MO5 A;  4MO4 A;  2Q2R A;  2E6M A;  3R3L A;  4CEQ A;  4FWM A;  3ENO A;  3NH1 A;  1F21 A;  3P1G A;  4CED A;  3FZK A;  3HL8 A;  3MN7 A;  1DT9 A;  4OO1 J;  4PUO A;  1XMQ K;  3WNF A;  2B6A A;  4OJR A;  2B5J A;  3P31 A;  4FJG A;  1H1V A;  5AQJ A;  1M1K O;  2O8D B;  3KLE A;  3CJC A;  1GOA A;  5M1O A;  1LWE A;  3T1A A;  4CJ4 A;  1RBT A;  2UUC K;  4CF0 A;  1RBR A;  1T8E A;  4F4K A;  3CC2 N;  1T44 A;  3THX A;  4OLB A;  3W0L A;  4KH6 A;  2ZGZ A;  3LL3 A;  3D2F B;  3E1Y A;  3NGI A;  5BPN A;  4CCH A;  4H03 B;  3MXJ A;  4F2R A;  1BIZ A;  4BRK A;  1NOZ A;  1IBL K;  2NRX A;  2P5O A;  1HJO A;  2QM1 A;  2QWL A;  3R8E A;  1CZB A;  4BE2 A;  4A5A A;  2O8F A;  1DLO A;  1WN7 A;  4W5R A;  3K58 A;  4EAH D;  4KBO A;  3D2E B;  3JXU A;  1WSJ A;  4CBW A;  3EZW A;  1Z05 A;  4DQ8 A;  4EP5 A;  3THW B;  3SV3 A;  3S41 A;  3VQP A;  4WFB L;  4JNE A;  3CCJ N;  4DR6 K;  3AVA A;  1C0F A;  4O0J A;  4OPA A;  4FWS A;  1QS4 A;  4EHT A;  1JLF A;  4BQL A;  1S9E A;  3VEN A;  1EX4 A;  2FBY A;  3O9R A;  3ZSZ A;  2GWK A;  1QE1 A;  1QSY A;  3WXK A;  4A62 A;  1GLB G;  4CEA A;  3I0S A;  3TAN A;  4FJ7 A;  3EL2 A;  3CG7 A;  4XEI A;  3L2V A;  4AIL C;  1RTD A;  3F9K A;  4H0Y B;  3ZX2 A;  4XH5 A;  1FW6 A;  1QQN A;  2KW4 A;  2RE2 A;  3U8X A;  2ZM6 K;  5M1P A;  1U49 A;  4I2Q A;  2D5R A;  4CEZ A;  3LDP A;  1KSP A;  2NRZ A;  4AF1 A;  4QOZ B;  3H45 C;  3LAK A;  4H0X B;  4K8X A;  4O8K A;  4CE9 A;  3CC4 N;  3HT3 A;  1RTJ A;  1Z6R A;  4H5V A;  3SMS A;  3VQ7 A;  2LSN A;  3PX6 A;  4BRA A;  3OYJ A;  2W41 A;  4KAZ A;  4FK2 A;  4KHU A;  3L8B A;  4CF2 A;  3V1Q A;  5HRP A;  4CF1 A;  3PO5 A;  4PL8 A;  2OPR A;  3AVB A;  2YJF A;  3BZC A;  2IVN A;  1OKJ A;  1ASW A;  5FRN A;  4BWJ A;  4JI6 K;  3J81 O;  1J5E K;  4DQI A;  5GIN A;  1HR0 K;  4B1X B;  4I6M A;  3QEV A;  3JS6 A;  3VTI A;  1NGB A;  4JKD A;  5CYQ A;  4F9O A;  2VWB A;  4IZ9 A;  3MN6 A;  3HVT A;  2P9K B;  3H3O B;  2YCH A;  3PLA A;  3NF9 A;  3MDQ A;  2E6L A;  3VGK A;  4FJ9 A;  5KTQ A;  1S1T A;  3L2R A;  3OHR A;  1XUP O;  4HUF A;  4QS8 A;  2YKM A;  1S5J A;  4G9Z A;  2ZE2 A;  3O9U A;  4E1J A;  4C8N A;  3SNN A;  3IG1 A;  2ZF5 O;  4GMJ B;  2YKN A;  4BC2 A;  4FWN A;  4WF9 L;  3EKS A;  1C0G A;  2XHB A;  2ZJP L;  1HNV A;  4JD2 A;  3ULE A;  4BRG A;  2F9W A;  3CJA A;  2P9N A;  3AO4 A;  3VEX A;  3NHG A;  1KVA A;  5TKW A;  4KO0 A;  4BG9 A;  4FW2 A;  5I9E B;  1HRH A;  1HLU A;  3N4Q A;  4DQP A;  1L5U A;  4GV3 A;  4KHQ A;  4CER A;  4AH9 A;  4U67 L;  3AA5 X;  3CI5 A;  4JKB A;  3VF2 A;  2Z1G A;  4B9L A;  2XY5 A;  3CPW M;  1BDG A;  1G99 A;  5M1K A;  3KJV A;  2OTJ N;  3L6Q A;  4DR5 K;  4KB1 A;  2YNI A;  1T6D A;  4OGC A;  4JV5 K;  5AQI A;  1VSH A;  3C6H A;  3TAP A;  4DG1 A;  4CK1 A;  4CHQ A;  4LH4 A;  2UUB K;  4ICL A;  5LJV A;  3NH2 A;  2Z1H A;  3PX0 A;  4B3T K;  1LAW A;  3LPT A;  3H1V X;  2Q97 A;  1Q18 A;  3ZT2 A;  3O1W A;  1XC9 A;  4H5R A;  1MWM A;  2D0P A;  2HVI A;  1DTT A;  5M1Q A;  3HTV A;  3LM9 A;  4CFD A;  4IWV A;  3BDP A;  2D1K A;  4BRQ A;  4CEE A;  5AQY A;  1N8R O;  4GKK K;  3HZ6 A;  1J5O A;  4O8U A;  1NJI O;  4LF4 K;  1T7P A;  3EE8 A;  4EZ6 A;  3ZET A;  3IUC A;  3WUH A;  2QK9 A;  2O8C B;  4NYF A;  4FJH A;  3ATU A;  2FSN A;  3A5L C;  5KGW A;  2O8B A;  4E1N A;  3NGY A;  2IVO A;  4Q0B A;  4LSL A;  4W5O A;  3L2Q A;  3VQ6 A;  2A5X A;  3WXJ A;  4CGD A;  4HWI A;  4A2A A;  4JK7 A;  4FPB A;  4B9V A;  3AVG A;  5HRS A;  4G1Q A;  3CQY A;  3KK3 A;  4KI4 A;  4H0T B;  5AQG A;  3QIO A;  5EX5 A;  1Q81 O;  3VES A;  1WNS A;  3PUF A;  2UXC K;  1OH8 A;  1U2V B;  3PIO L;  3QO9 A;  1BI4 B;  3VER A;  3M1F A;  1LW2 A;  1D9F A;  2QXL A;  5DM6 L;  5GAG P;  5C2F A;  3KHY A;  4JKE A;  3RWU A;  1SAZ A;  1WOQ A;  4HUE A;  3SUQ A;  1J6Z A;  4ILJ A;  4K41 A;  3SI6 A;  4CBU A;  4JI2 K;  2OTL N;  2VCP A;  3ZT1 A;  3C6A A;  2P9I B;  4JHD A;  2FF3 B;  2HHT A;  1Q86 O;  2P9U A;  3AY9 A;  5CZ1 A;  4CGH A;  5AZI B;  4EIA A;  2W42 A;  2FC0 A;  3P38 A;  3L3V A;  4ID1 A;  3QB0 A;  1RT6 A;  4OPK A;  3WQU A;  2YJE A;  1C1A A;  1EWR A;  2HBK A;  3VQC A;  4WCE L;  3DM2 A;  3S3N A;  1QSL A;  2F8S A;  1LCU A;  1QQO A;  2KZZ A;  4E1M A;  4FM0 A;  1K8A O;  2YNG A;  4C8L A;  5C10 A;  2OYQ A;  3C94 A;  1GLC G;  4FLW A;  4CK3 A;  2WFB A;  3DLK A;  3IDH A;  1Q82 O;  5E26 A;  1JLA A;  3SK3 A;  1ZBS A;  5AQS A;  5AQL A;  1EXQ A;  3HPO A;  1GLL O;  3WT0 A;  5FDL A;  1U04 A;  4JI4 K;  3AVC A;  3QBX A;  4JAX A;  5J2M A;  3SV4 A;  3KTQ A;  3CIP A;  4RW9 A;  2VGN A;  3HBT A;  2E1Y A;  4CVN E;  1IBK K;  3SQ2 A;  3S3M A;  3NAE A;  5IWA K;  1VQ8 N;  2VWJ A;  4E89 A;  3QIN A;  3VQ4 A;  3W3D A;  4ELT A;  2RHK A;  4B8A B;  5CY4 A;  3ZT3 A;  2E20 A;  1JCF A;  1TL1 A;  1RBU A;  2A1R A;  1Y97 A;  3AAR A;  3D45 A;  3ZT4 A;  4FYD A;  5KPZ A;  1CXU A;  2G8F A;  4R5P A;  3GE1 A;  1BOT O;  4Z4G A;  1XC3 A;  5FLX O;  5JLH A;  4FWK A;  3WXM B;  2DTU A;  2ZD1 A;  4E7I A;  3OS1 A;  1XNQ K;  1KFD A;  4DU3 A;  1TUU A;  1WSE A;  4PKI A;  4DF8 A;  2HHQ A;  3G4S N;  1DEJ A;  3H6E A;  1YIJ N;  3AO2 A;  5KPR A;  1LWF A;  3GBT A;  3F9M A;  5CHI A;  5E41 A;  3TSU A;  3LP1 A;  3EE9 A;  3O3F A;  5BRH A;  4JK8 A;  3EY1 A;  3HO1 A;  4KI6 A;  4BVO A;  2P9P B;  3VEZ A;  4FWP A;  4GVE A;  1IKY A;  1UOC A;  3HST B;  1U4B A;  2ITM A;  4DV6 K;  1YJN N;  3RVC A;  2UU9 K;  4BRH A;  1OVQ A;  4BC3 A;  3OYN A;  4IJN A;  5C12 A;  4L8R B;  3GDQ A;  2HBJ A;  3H1Q A;  1NM1 A;  4IEE A;  1D5A A;  3ISN C;  1HNX K;  1KXP A;  4FJM A;  3TR8 A;  3ZSR A;  1Y64 A;  3V9S A;  4NO7 A;  1B9D A;  1RFQ A;  5BRE A;  4JRP A;  1XMO K;  5BN8 A;  3NF6 A;  4FZX C;  1E4F T;  3LDN A;  2EHG A;  3CJ1 A;  3MN5 A;  1TUY A;  4WQ4 A;  4CI6 A;  3WEE A;  3AVH A;  3OJU A;  3CD6 N;  2F7T A;  3AO1 A;  4LSN A;  2ZWH A;  4FL9 A;  1IG9 A;  3ZLJ A;  4LF5 K;  3OBW A;  2KZM A;  3BY5 A;  5AFU H;  1RDC A;  2HND A;  3TSQ A;  3ID8 A;  3KKR A;  1D4X A;  1NLV A;  5AR0 A;  3OYA A;  2WBN A;  3THX B;  4M3W A;  5J1E A;  4BQZ A;  3OS2 A;  3K5L A;  4YHH K;  4NLB A;  3VQE A;  3J80 O;  4AM7 A;  3VEV A;  2O8F B;  4DUZ K;  4H5T A;  3DLG A;  3U9D A;  1NU0 A;  5LMN K;  4CES A;  4FSV A;  4CIE A;  3CCV N;  4IO9 L;  1N6Q A;  1TK5 A;  4DV3 K;  3V1O A;  5F2R A;  1O13 A;  4FWL A;  5LL6 Z;  4H0O A;  4CZI A;  5HP1 A;  4H5W A;  3FLC O;  4FLT A;  1C0T A;  4BC5 A;  2HB5 A;  3DYA A;  5AQP A;  4E3S A;  1JLC A;  5BRD A;  4Y0W A;  2BGG A;  3THV A;  3AVI A;  3KLG A;  1EWQ A;  2A1S A;  3DRS A;  1TGO A;  1KVC A;  1NK4 A;  3HP9 A;  3OYM A;  4Z0U A;  3ZSW A;  4E7K A;  3SAG A;  4CBX A;  5KQD A;  4DV1 K;  2JLE A;  4B9N A;  3RR8 A;  1HQU A;  2NRH A;  1U47 A;  1HNW K;  2KQ2 A;  4CHP A;  1J53 A;  5AQF A;  2E88 A;  4X65 K;  2HHU A;  4B1V A;  1SS6 A;  4CHN A;  3M5R A;  2E2P A;  2BE2 A;  1QQM A;  1RTI A;  1XQS C;  4IG3 A;  1HNZ K;  5FPD A;  4M42 A;  1JLG A;  5B8H A;  3DLB A;  4EZ9 A;  2VG5 A;  4ILH A;  3QML A;  5HRR A;  3T19 A;  4FM1 A;  4EP4 A;  4M3Y A;  5JS2 A;  2HBM A;  5FPN A;  3H46 O;  4DB3 A;  3CQX A;  1BUP A;  3SUP A;  3FZL A;  4CGG A;  4CJR A;  4JI5 K;  2ASO A;  1SL0 A;  2QWR A;  3KZB A;  4DV7 K;  4IFY A;  3MXI A;  5BR9 A;  4IKF A;  1VK0 A;  4CHY A;  2NNW A;  1TKX A;  4PQU A;  2FF6 A;  1LAV A;  1VQL N;  3UIQ A;  4JN4 A;  4IG0 A;  4JLH A;  1N34 K;  4JKG B;  1KAZ A;  4F3T A;  5FRO A;  4LD0 A;  3RR7 A;  3OY9 A;  4I7F A;  1IV0 A;  4WQ4 C;  2HMI A;  4K25 A;  1TK8 A;  2NRT A;  3OJS A;  1FXX A;  3CQ8 A;  3K5M A;  3VPZ A;  1VQP N;  5FRM A;  2G8W A;  5KRS A;  3UKR A;  2Q3S A;  3VQB A;  3EYZ A;  2OPP A;  3K9J A;  1BIS A;  3MCA B;  1ASU A;  4LFB K;  5ADX H;  1WAJ A;  4CJS A;  3E9O A;  5BPL A;  3CCS N;  4Z4E A;  1NMN A;  1R59 O;  2OA8 A;  2D0B A;  2YHY A;  1RDB A;  1X3M A;  4W5N A;  3RSE A;  4NCG A;  5AQH A;  4QAG A;  2ATQ A;  1W97 L;  4ISF A;  4KFB A;  1WLJ A;  2F4V K;  2WTU A;  3CFR A;  1NGF A;  2HHW A;  1HUX A;  4W5T A;  2V7Z A;  4GV9 A;  1YUW A;  3MWT A;  2GWJ A;  2NZT A;  2ASM A;  4DFP A;  3WNE A;  1X9M A;  4OX9 K;  4IOA L;  4JD2 B;  2RN2 A;  3ULE B;  2NLX A;  5JLF A;  2P9N B;  3FFI A;  2QKK A;  4BG8 A;  4CJF A;  1T03 A;  3PY8 A;  1N32 K;  3KLF A;  3F73 A;  1KFS A;  1JXE A;  4M7Y A;  3LWL A;  3C65 A;  2KFN A;  1JCE A;  3TTD A;  4J2E A;  1YTA A;  1VRU A;  4CK2 A;  4LFC K;  4IOX A;  4H4O A;  2IOC A;  1NGE A;  3DJC A;  4FWR A;  4IJA A;  3SPY A;  4DSI A;  3O6W A;  4DUY K;  2G8V A;  3L3U A;  4XH4 A;  2Q0R A;  1QVF M;  1KCF A;  4ZHR A;  1N5Y A;  4IFV A;  3DWL A;  1RDW X;  3MED A;  3CM5 A;  4RW7 A;  4NLC A;  2GTD A;  3LP0 A;  4O4G A;  5KGX A;  1TYQ A;  4DF4 A;  1GOC A;  2QI2 A;  2VGM A;  3WNG A;  1YHQ N;  4CIG A;  4PL7 A;  3E9P A;  4YFU A;  5DM7 L;  4CJE A;  1VRT A;  1T6C A;  3THY A;  2A41 A;  2ZJR L;  3C0B A;  1C0M A;  3VN5 A;  3TAF A;  1I39 A;  3IS9 A;  2VG6 A;  3I8D A;  4NCA A;  1ILY A;  3RRH A;  4DQR A;  3ZET B;  2WC9 A;  1NNE A;  3B6O A;  3HYF A;  3LM2 A;  4ZTJ A;  3VQ5 A;  2O8B B;  1ITG A;  2HNZ A;  4KB0 A;  4FJI A;  1B92 A;  1BQN A;  2XY8 A;  4BR4 A;  1BU6 O;  4CF9 A;  3VOV A;  4CEF A;  1R0A A;  2PZS A;  5AQW A;  4FJN A;  4Z4H A;  4BE0 A;  1TKZ A;  1RCH A;  4KTW A;  3QNN A;  4MDB A;  4FWQ A;  3CJB A;  2KFZ A;  2I5J A;  3O80 A;  4DS4 A;  4CJV A;  1YVN A;  1S22 A;  3LP3 A;  1NJX A;  1V4T A;  3HOS A;  3TAQ A;  4B9Q A;  4QS7 A;  4BWM A;  3F5T A;  4E7H A;  5AQZ A;  1DGK N;  4BR0 A;  4RW8 A;  3OTO K;  3BF3 A;  4CJ3 A;  2ITG A;  1L3U A;  3PO4 A;  5CE3 A;  4FLV A;  4B1U B;  3FZF A;  1FJG K;  1XHX A;  5HRO A;  3O5B A;  4JHD B;  4OKK A;  1O1W A;  4MDA A;  1HNI A;  1GLJ O;  3ENB A;  3HRG A;  3MXM A;  2P9U B;  1KTQ A;  5E84 A;  1U6Z A;  2O8E A;  3WNH A;  4OKJ A;  3ZEU A;  1TAU A;  3CCQ N;  1TKD A;  1S1V A;  5J2N A;  2P1J A;  1JLE A;  3AO3 A;  5AQQ A;  3SZ2 A;  1P90 A;  2G8K A;  4BE1 A;  4NYN A;  3T1H K;  4KHW A;  4OGE A;  1VQ4 N;  2BDP A;  4F2S A;  3NH0 A;  1XI1 A;  1WSF A;  4DFM A;  1W0H A;  4DCH A;  1NWK A;  1S9G A;  4HTL A;  1Q9X A;  3O9Q A;  3BEX A;  4B3O A;  4NCB A;  3OYK A;  1SL1 A;  5F0X A;  3QIP A;  4LF9 K;  4Z94 A;  2BTF A;  1WSI A;  2CH5 A;  3HK2 A;  4IBN A;  4BAC A;  3KLI A;  1ZC6 A;  1LWC A;  3ZSO A;  3AAQ A;  3GG4 A;  1ZBF A;  1JCG A;  2WUS A;  3CPE A;  1WBD A;  4OPH A;  3H08 A;  1BA1 A;  4FOE A;  4AHU A;  3SJH A;  5AQT A;  3KWG A;  3DLL L;  2V7Y A;  1YJ9 N;  1S72 N;  4TSX A;  1K73 O;  2NRW A;  3QBW A;  4HUG A;  5M1N A;  2CGK A;  3U6F A;  2Z1J A;  4KV8 A;  1YIT N;  4JKH A;  2H3G X;  4FWO A;  2I7N A;  4HTU A;  1NK0 A;  3FZH A;  1UWB A;  2PY5 A;  3NGZ A;  4FK4 A;  4ELV A;  4JI0 K;  3DLH A;  4XH1 A;  4JK9 A;  2FBX A;  1U48 A;  3MMV A;  2HHX A;  3IKM A;  4F3O A;  1K9M O;  1RT4 A;  3I8B A;  3SQ1 A;  4O55 A;  4YOY A;  1QZ5 A;  1Q9Y A;  3JAM O;  1VSD A;  3CJ9 A;  4HCC A;  1ZBI A;  4JS5 A;  3HM8 A;  4FW1 A;  1VQN N;  1ZYQ A;  5EU7 A;  2I7P A;  1HQE A;  3AO5 A;  3M8S A;  1SV5 A;  1X9W A;  3QER A;  1RIL A;  2GX9 A;  4M3T A;  3CM6 A;  4FM2 A;  4GNI A;  3I0R A;  5C42 A;  4CJ5 A;  4AHS A;  5D3G A;  2KLA A;  4BRN A;  2DFE A;  3VQQ A;  4C1N K;  3I55 N;  3CMA N;  3ZT0 A;  2F9T A;  2X6N A;  3LPU A;  3O8M A;  3L2U A;  1YAG A;  4YOV A;  3OVN A;  2IDO A;  2QKB A;  3VQ8 A;  4Z4C A;  1A5V A;  3TPQ A;  3GOI A;  4MFB A;  3CFO A;  1JKH A;  3KVG A;  3NF8 A;  4CJT A;  4J2D A;  3OYC A;  4K0K K;  2QW9 A;  4DV2 K;  4LY7 A;  1K8K A;  4FO0 A;  3T1Y K;  3WEE B;  1S6Q A;  2NUB A;  4BGB A;  3KK7 A;  3OYH A;  1VSF A;  4CZG A;  2NRR A;  4JKC A;  1TK0 A;  4DSE A;  1TV6 A;  2Q36 A;  4CW7 B;  3ZSV A;  2PFU A;  3HI0 A;  1KD1 O;  1HPM A;  2D4W A;  3UKU A;  2YNF A;  4FPA A;  4E19 A;  1EP4 A;  3KD5 E;  1WSG A;  4BRI A;  1SQK A;  2V52 B;  4CZJ A;  2CGJ A;  5LMU K;  4I9L A;  2UXD K;  1C1C A;  1VHX A;  3FGU A;  1MWK A;  4CJ7 A;  2WOM A;  3DRR A;  4YOX A;  3MEC A;  5HRN A;  2XY6 A;  3VQ9 A;  1W2B M;  1RDA A;  2JWL A;  1GLF O;  1SUQ A;  3FFK B;  4ID5 A;  2A6A A;  4N56 A;  3J8A A;  4CJQ A;  2HW3 A;  3DLR A;  2YV0 X;  5EOY A;  3SPZ A;  4E0D A;  4Z4I A;  4CZM A;  3SUN A;  1HPZ A;  4M3X A;  1BA0 A;  2BUP A;  1BCM A;  2YI1 A;  3CXC M;  1IH7 A;  4C23 A;  4YNQ A;  2KKZ A;  2OPS A;  2PBD A;  4WFN L;  3AVL A;  1OH6 A;  4FJ8 A;  4DWI A;  3DAW A;  3K57 A;  3LDQ A;  3C7N A;  4M7X A;  1DTQ A;  3IMX A;  3CCU N;  2HST A;  1EQY A;  1N36 K;  3LWM A;  2W40 A;  1QZ6 A;  5KQ8 A;  4LF7 K;  3K5N A;  3OYB A;  4DU1 A;  2D0A A;  3EZ5 A;  4CJW A;  3EO3 A;  4YDU A;  2P9L A;  4B1Z A;  4KRE A;  4CJL A;  3LZJ A;  2FSJ A;  3CF5 L;  3TAR A;  5A2Q O;  5CR4 A;  3G10 A;  3DI6 A;  1HKC A;  4WFA L;  4UQG A;  5FPE A;  1ATR A;  5AQM A;  2AP1 A;  2HBL A;  1N33 K;  4AHR A;  2Z1I A;  5HOO A;  1ESV A;  2OPQ A;  3U3Y A;  4UY8 O;  4CEB A;  1RT5 A;  1RT2 A;  3MCP A;  1YI2 N;  2HMP A;  1RT3 A;  5JVH L;  5GAE P;  1TL3 A;  2VWK A;  1QHA A;  3M8Q A;  4LC9 B;  4YOU A;  1DKG D;  3BUZ B;  3PSI A;  1KAY A;  3SQ0 A;  2YNH A;  3T69 A;  3VMF B;  4B9S A;  1MDU B;  2HF3 A;  3VF6 A;  4A5B A;  4JKA A;  1C0U A;  2E1Z A;  4KHP K;  3A8Y A;  4X66 K;  4V19 S;  5T7B A;  1V4S A;  3QET A;  3TAB A;  2FBT A;  1W7A A;  4Y1D A;  1E4G T;  4BRD A;  3UKR B;  2QEX N;  3CCL N;  1Z26 A;  5BN9 A;  1RGI A;  4PWD A;  2DY4 A;  1BO5 O;  1NKE A;  2B4J A;  2ETJ A;  4E7J A;  2Q1N A;  2GUI A;  5M1F A;  3U3G A;  1ZBU A;  1VSE A;  3LDS A;  2Y1J A;  2RF2 A;  1NKB A;  4BDZ A;  3L2W A;  5GAH P;  4PKH A;  4BRP A;  3RSE B;  4ISE A;  3TI0 A;  2Q0U A;  3L0Q A;  4CFA A;  3E01 A;  2QWP A;  3AVN A;  3G0Z A;  4M63 C;  5BR8 K;  5GIP A;  2EX3 A;  1QTM A;  4IOC L;  3E9L A;  3KIO A;  3DXK A;  2GEM A;  4RCH A;  4FJK A;  4PKG A;  4B08 A;  3K59 A;  3BP8 A;  4DV0 K;  1NGH A;  1D8Y A;  2PYJ A;  1MA9 B;  1YT3 A;  1ATN A;  1NJY A;  4KHS A;  4DHY A;  4CZE A;  2GBZ A;  3AVF A;  4O5F A;  4K42 A;  3KK2 A;  3IAY A;  3SLC A;  5JS1 A;  3OS0 A;  3P83 D;  3R9P A;  3ZSX A;  3LAL A;  1JL1 A;  1IO2 A;  1T05 A;  2V51 B;  4RTF D;  2NRV A;  3MX5 A;  2Q31 A;  5AQX A;  1JLB A;  4DTP A;  2P51 A;  5DK5 A;  1LW0 A;  4O5B A;  1YF5 L;  3AVK A;  4DKW A;  3D6R A;  3VTH A;  4DTJ A;  5C2D A;  1BL3 A;  4FVU A;  4YDU C;  5GIO A;  3G6E N;  2W6L A;  1IKW A;  3DOK A;  4YOW A;  4CZH A;  3TTC A;  2FXU A;  2W6K A;  5KRT A;  4FJ5 A;  3AA3 A;  3P4I A;  4M3R A;  4N47 A;  5SZT A;  4BDY A;  3TSP A;  1VQO N;  3S3O A;  3VEO A;  1TYQ B;  3V9Z A;  2A3Z A;  4C8M A;  1NKC A;  3HM9 A;  2QA4 N;  1EO1 A;  3NDK A;  4M41 A;  5C15 A;  4FVM A;  3VET A;  3JSM A;  4I6M B;  4CGJ A;  4B3M K;  4HHT A;  4DQS A;  4FCY A;  3THY B;  1KLM A;  4IO8 A;  4JYA K;  1IBM K;  2BAN A;  3LP2 A;  3AVM A;  1IKX A;  3OYI A;  3KLH A;  3K0S A;  5HBM A;  3O4Q A;  3J7A P;  3OYG A;  4GY2 B;  5F1X A;  5C25 A;  1NK8 A;  1SKW A;  3U4L A;  3ZSQ A;  3DMJ A;  1FKO A;  4CZF A;  4DR4 K;  5BRF A;  3QIC A;  1K6Y A;  4BVP A;  3U9Z A;  1ZBL A;  3ZYY X;  1NK5 A;  4BRF A;  2DPN A;  4LH5 A;  3RMA A;  3NBP A;  5HL7 L;  3KK1 A;  4FJL A;  1NG9 A;  1KAX A;  3GL1 A;  4OVL A;  4PY5 A;  2QTD A;  1REV A;  3TWH A;  3SAH A;  1HYZ A;  3RMC A;  1QSS A;  5J2P A;  2P9S A;  4K43 A;  5BPM A;  3OYF A;  5AQR A;  2E2N A;  2P5G A;  5AQU A;  1UA0 A;  4AQY K;  4I2P A;  5AZJ A;  5MLC Q;  3IFR A;  4H0P A;  3DXM A;  3LDO A;  2UXB K;  1NMD A;  3Q7B A;  1NGJ A;  4OKE A;  3DRP A;  3B6P A;  1FKP A;  3K9K A;  4DR1 K;  1WB9 A;  1NBW A;  3MN9 A;  4BR9 A;  4WYB A;  3WXL A;  2HHH K;  4JI1 K;  2GUP A;  4J2A A;  3AAP A;  3BZK A;  3S9H A;  4M45 A;  2X78 A;  3A5M C;  4KTQ A;  4RWT A;  3PIP L;  2O8E B;  5AQV A;  3TAG A;  3J7Y P;  3ZEU B;  4JI7 K;  4RW4 A;  1HKG A;  5KPT A;  1KC8 O;  5AQN A;  3CJ7 A;  3SAF A;  3P39 A;  4L3Q A;  3CHW A;  3QEI A;  2RKI A;  2D0C A;  4EHU A;  4XIU A;  3EEQ A;  1NJZ A;  4DMN A;  1VSL A;  3QEW A;  1MU2 A;  2VG7 A;  4WQ5 C;  4H5N A;  1TKT A;  1CXQ A;  1RBS A;  4DLG A;  4YOR A;  2QWO A;  5IT9 O;  2O8D A;  3TAM A;  4C1N I;  4MLE A;  3CYM A;  3SBT A;  1VQ7 N;  1VQK N;  5JIC A;  3A0I X;  3C95 A;  5CYM A;  3MAQ A;  3OA9 A;  3HOT A;  3SQ4 A;  3VGM A;  1S1X A;  4JKG A;  4BDP A;  2GEL A;  4LF6 K;  3D2F A;  5C24 A;  4CZK A;  5AJ3 K;  4IDH A;  1ZBH A;  3O9T A;  2QXF A;  3G71 N;  4X64 K;  1HMV A;  3OYL A;  3HP6 A;  1X3N A;  3BGR A;  3OBY A;  4I9Q A;  1NGD A;  1S1W A;  4JEP A;  4BRE A;  2ZQB A;  4DSF A;  1XNR K;  3QDK A;  4DTR A;  3D2E A;  3A5N C;  1GLA G;  5CZ2 A;  3SBG A;  5LY3 A;  3G25 A;  2OZS A;  4DFJ A;  3JYT A;  3THW A;  2J4R A;  4B8C A;  4BR7 A;  4F8R A;  1VQ9 N;  1EKE A;  3PX4 A;  2ASP A;  3ASM A;  5AFU A;  3ID6 A;  1VAZ A;  4JI8 K;  2YHW A;  2XRI A;  1L3T A;  5HLF A;  3WXI A;  4PHT X;  4GVM A;  4GV6 A;  3UE5 A;  2UUA K;  4PA1 A;  5JMV A;  3VA0 A;  2IIR A;  1BG3 A;  1IG8 A;  2FSK A;  4ILG B;  4DSL A;  3QNO A;  2IC3 A;  4DFK A;  3TU5 A;  4CGF A;  2FLO A;  3TTF A;  1NOY A;  4KKO A;  2CGL A;  4H8K A;  4BRM A;  3AA4 A;  4CFC A;  2A40 A;  4B9U A;  3M8R A;  2DFF A;  2E5L K;  5EXW A;  3IRX A;  3NVK A;  2AA4 A;  1HYS A;  1VQ6 N;  1ATS A;  3R6M A;  5K14 A;  2YHX A;  1OH5 A;  4DR3 K;  4CJP A;  2E4L A;  3ATV A;  3KWI A;  1RDD A;  3LAN A;  1NJW A;  1NGC A;  2F96 A;  3N4P A;  4DSJ A;  3ITH A;  4N5S A;  3QLH A;  1M90 O;  1K8K B;  4NB4 A;  1HX1 A;  3NF7 A;  4HVJ A;  3CC7 N;  5I42 A;  1L3V A;  3HXM A;  3VA3 A;  1JXB A;  5KI6 A;  1WBB A;  1HKB A;  3C6U A;  1QHT A;  4QCL A;  3ZX0 A;  3P5J A;  3SYZ A;  3AGR A;  2HHS A;  3NVM A;  3UKU B;  3SCX A;  1ASV A;  2ZJQ L;  3ALY A;  4X62 K;  4CFB A;  5H1S Q;  3HSC A;  2R7Y A;  2P9K A;  1T3V A;  2QWQ A;  5J2Q A;  3SJJ A;  4B1W B;  1B9F A;  2VYP A;  3A2F A;  2YX6 A;  3FR0 A;  3HPH A;  3RRG A;  4MQ3 A;  2OCE A;  1YVU A;  1S1U A;  2IVP A;  2HOE A;  2CH6 A;  4E7L A;  1E3M A;  4CHO A;  1NGA A;  3ZX3 A;  4DS5 A;  4KHY A;  3QEX A;  5SWM A;  1UAX A;  2ZGY A;  3MEG A;  3AGK A;  4JS4 A;  4N41 A;  4J2B A;  2OZM A;  3CCM N;  3LZI A;  4FZY A;  3OW2 M;  4KPY A;  1QQC A;  3O4N A;  3VGL A;  4KH5 A;  4M3U A;  1S6P A;  1LV5 A;  1CZA N;  4BGA A;  1YTU A;  4DV5 K;  2FBV A;  4FXD A;  1TVR A;  4U7B A;  2A42 A;  3D7E O;  3ENH A;  1VQ5 N;  3C7N B;  2BH1 A;  1VSM A;  5JVG L;  3V9U A;  1JLQ A;  2E2Q A;  1SKR A;  1SZ2 A;  3O4W A;  2PYL A;  1KQS M;  1RT7 A;  4KHN A;  4EFH A;  4DQQ A;  2QWM A;  4M3Z A;  3CET A;  1VSJ A;  3KD1 E;  5ADX A;  3OYE A;  2P9L B;  3O3G A;  4FLX A;  3WQT A;  3A5O C;  4CJK A;  4FJX A;  3BF1 A;  4JI3 K;  3RTV A;  4JRQ A;  2VQE K;  1HJR A;  4DTX A;  4ELU A;  2Y1I A;  4CD1 A;  3ZSY A;  3CCR N;  4CEC A;  2G8H A;  3KKS A;  1BIU A;  4A2B A;  3EN9 A;  3UB5 A;  3HPG A;  4CIF A;  3E66 A;  1OVY A;  4Z4F A;  4A61 A;  4A59 A;  1ZXO A;  1BHL A;  3QFU A;  1UA1 A;  1NK7 A;  4C8O A;  3HJF A;  3FZM A;  4K8Z A;  1NGI A;  4DSK A;  1X1P A;  1Q7Y O;  4B1Y B;  2WON A;  5EY4 A;  4KH4 A;  4FLY A;  1CLQ A;  1W9H A;  2IS3 A;  4IDK A;  3OYD A;  2YHB A;  1D9D A;  3O1B A;  3QEP A;  4IEI A;  4BC4 A;  2UYT A;  2XY7 A;  3LAM A;  1Z25 A;  4CJU A;  4DTS A;  4FK0 A;  3C6T A;  4NXN K;  4BY9 C;  1NGG A;  3B8A X;  3V81 A;  3EKU A;  3CME N;  5DMR A;  4B3R K;  2O8C A;  1X9S A;  2YHA A;  4BRO A;  3CER A;  3PV8 A;  3NFA A;  3J7Z O;  3CCE N;  1JL2 A;  4AHV A;  1Q8I A;  1OH7 A;  5FPM A;  3I33 A;  3FE1 A;  3ZCM A;  4B9M A;  1BGX T;  1C6V A;  4KRF A;  4IXC A;  1VQM N;  1RT1 A;  1HYV A;  4FJJ A;  2GV9 A;  4DTO A;  1U2V A;  1TAQ A;  2O4I A;  4DU4 A;  4QS9 A;  1VSI A;  3RMB A;  1IKV A;  4AM6 A;  1BI4 A;  2RPI A;  2G8I A;  3VQD A;  4DR7 K;  4BRC A;  4CZL A;  1I94 K;  4CF8 A;  4WE1 A;  4MLH A;  2O4G A;  3DXK B;  3K5O A;  1WAF A;  3Q7C A;  4RG8 A;  5I3U A;  5TKY A;  4FLZ A;  4DTM A;  1KLN A;  4JKF A;  4C8K A;  3F2K A;  3VF4 A;  3M6G A;  5C0Y A;  1XWL A;  4OLA A;  4GKJ K;  2HNY A;  4YY3 K;  2P9I A;  4RW6 A;  4W5Q A;  1RDU A;  1EET A;  4HCB A;  1SKS A;  5AZI A;  1A5W A;  3O3H A;  1WUA A;  5AQO A;  1YJW N;  3V1R A;  2XO7 A;  3AA2 A;  3DOL A;  3O08 A;  4IFE A;  4FOI A;  4CD3 A;  1CZ9 A;  4Q5V A;  4B3S K;  2HVH A;  2PAV A;  3VQA A;  4DV4 K;  5ELZ A;  1WSH A;  3I56 N;  1JJ2 M;  2JWK A;  4B9T A;  2EWS A;  3MX2 A;  4KTZ A;  2F8T A;  5GAD P;  1YXQ A; 
#chains in the Genus database with same CATH homology
 3CJB A;  3SMP A;  3U4L A;  4H0V B;  1Q86 O;  3O80 A;  2P9U A;  3AY9 A;  4CZF A;  1YVN A;  1S22 A;  5BRF A;  3QIC A;  4YOT A;  5AZI B;  4EIA A;  3QFP A;  3NMU A;  4BVP A;  4A57 A;  3P38 A;  1V4T A;  3U9Z A;  3ZYY X;  3QB0 A;  3HOS A;  4B9Q A;  4BRF A;  4QS7 A;  2DPN A;  3F5T A;  4BRL A;  5AQZ A;  3WQU A;  3MWP A;  2YJE A;  1DGK N;  2HBK A;  4WCE L;  4BR0 A;  5HL7 L;  1LCU A;  1KAX A;  1QQO A;  3BF3 A;  3GL1 A;  2QTD A;  3VEY A;  5CE3 A;  1K8A O;  4B1U B;  3SAH A;  3FZF A;  1LOT B;  5C10 A;  1IJJ A;  1GLC G;  2WFB A;  2P9S A;  3MK6 A;  3O5B A;  4K43 A;  4JHD B;  5BPM A;  3IDH A;  5AQR A;  2E2N A;  4MDA A;  1Q82 O;  1GLJ O;  5E26 A;  1GLD G;  3ENB A;  3HRG A;  3SK3 A;  5AQU A;  2P9U B;  4BR5 A;  1ZBS A;  5AQS A;  5AZJ A;  5MLC Q;  5AQL A;  3IFR A;  5E84 A;  1U6Z A;  4H0P A;  2KHO A;  3DXM A;  1GLL O;  3LDO A;  3WT0 A;  3ZEU A;  3CCQ N;  1NMD A;  3QBX A;  5EVZ A;  3Q7B A;  1NGJ A;  4JAX A;  5AQQ A;  3CIP A;  1X9J A;  1P90 A;  2VGN A;  3HBT A;  3K9K A;  2E1Y A;  3H3N O;  1NBW A;  2HF4 A;  3MN9 A;  4WYB A;  4BR9 A;  3WXL A;  1BWF O;  1VQ4 N;  1VQ8 N;  2OAN A;  1GLE G;  4DCH A;  1NWK A;  1S3X A;  3R1X A;  2GUP A;  4HTL A;  3L4Q A;  2P9S B;  3O9Q A;  2E2O A;  3BEX A;  3AAP A;  4J8F A;  3A5M C;  3W3D A;  5F0X A;  4RWT A;  5AZJ B;  2RHK A;  3PIP L;  4Z94 A;  2BTF A;  5AQV A;  3DXM B;  2E20 A;  3ZEU B;  1JCF A;  2CH5 A;  1QVG M;  3VEW A;  1HKG A;  1ZC6 A;  5KPT A;  3AAR A;  1KC8 O;  3AAQ A;  4R79 A;  5AQN A;  5KPZ A;  3CJ7 A;  3SAF A;  3GE1 A;  1BOT O;  3GG4 A;  1XC3 A;  3P39 A;  4L3Q A;  3CHW A;  4FWK A;  5JLH A;  1JCG A;  4ISG A;  3WXM B;  1P8Z A;  2WUS A;  3CPE A;  3LDL A;  4OPH A;  2P9P A;  1BA1 A;  4FOE A;  4EHU A;  3SJH A;  3T7Z A;  5AQT A;  3KWG A;  3DLL L;  2V7Y A;  1YJ9 N;  1S72 N;  1TUU A;  4WQ5 A;  4WQ5 C;  3O9S A;  4H5N A;  4PKI A;  5LJW A;  5AQK A;  2QWN A;  2NRW A;  3G4S N;  1K73 O;  1DEJ A;  3H6E A;  3QBW A;  1YIJ N;  4YOR A;  5M1N A;  2E8A A;  2QWO A;  2D0O A;  4BR2 A;  2CGK A;  5KPR A;  1YIT N;  4JKH A;  4C1N I;  3GBT A;  3F9M A;  4MLE A;  5CHI A;  2H3G X;  3SBT A;  3TSU A;  4FWO A;  1VQ7 N;  1VQK N;  3L4I A;  2I7N A;  5JIC A;  3FZH A;  3A0I X;  3M3Z A;  4MO4 A;  4MO5 A;  2Q2R A;  3R3L A;  3EE9 A;  3OA9 A;  4JK8 A;  5BRH A;  3HOT A;  4FWM A;  3VGM A;  4BVO A;  3ENO A;  2P9P B;  4JKG A;  3VEZ A;  2GEL A;  4FWP A;  4GVE A;  3FZK A;  3D2F A;  3MN7 A;  4XH1 A;  4CZK A;  4JK9 A;  1DT9 A;  3MMV A;  4OO1 J;  2ITM A;  3IKM A;  4IDH A;  1YJN N;  3RVC A;  4BRH A;  1K9M O;  4BC3 A;  3O9T A;  3P31 A;  4IJN A;  5C12 A;  1H1V A;  5AQJ A;  3G71 N;  1M1K O;  3I8B A;  3GDQ A;  2HBJ A;  3H1Q A;  1NM1 A;  4YOY A;  4IEE A;  3CJC A;  1QZ5 A;  1X3N A;  3OBY A;  5M1O A;  1KXP A;  1NGD A;  3CJ9 A;  4JEP A;  1Y64 A;  3HM8 A;  4BRE A;  4NO7 A;  1VQN N;  3QDK A;  3D2E A;  3A5N C;  1RFQ A;  1GLA G;  5LY3 A;  3SBG A;  3G25 A;  5BRE A;  2I7P A;  3CC2 N;  1T44 A;  5BN8 A;  2J4R A;  2GX9 A;  3W0L A;  4BR7 A;  1E4F T;  3LDN A;  4GNI A;  4KH6 A;  1VQ9 N;  2ZGZ A;  3LL3 A;  3D2F B;  3E1Y A;  3CJ1 A;  5BPN A;  3MN5 A;  1TUY A;  4H03 B;  4WQ4 A;  4CI6 A;  2ASP A;  3WEE A;  4BRK A;  5AFU A;  2KLA A;  3ID6 A;  4BRN A;  3CD6 N;  2NRX A;  2F7T A;  1VAZ A;  2ZWH A;  4FL9 A;  1HJO A;  2YHW A;  4C1N K;  2QM1 A;  2QWL A;  3R8E A;  3I55 N;  3CMA N;  4A5A A;  3OBW A;  3WXI A;  2F9T A;  4PHT X;  4GV6 A;  3O8M A;  3UE5 A;  4EAH D;  1YAG A;  5JMV A;  5AFU H;  4YOV A;  4KBO A;  2IIR A;  3D2E B;  3TSQ A;  1BG3 A;  1IG8 A;  3ID8 A;  3JXU A;  4CBW A;  3EZW A;  1Z05 A;  2FSK A;  1D4X A;  4DQ8 A;  3TPQ A;  1NLV A;  3GOI A;  4ILG B;  5AR0 A;  3KVG A;  3S41 A;  2WBN A;  4WFB L;  4JNE A;  4BQZ A;  2QW9 A;  3CCJ N;  2P9I B;  1K8K A;  1C0F A;  3TU5 A;  4OPA A;  4FO0 A;  4FWS A;  3WEE B;  2FLO A;  3TTF A;  3KK7 A;  4BGB A;  4EHT A;  4NLB A;  4CZG A;  2NRR A;  4BQL A;  4JKC A;  3VEN A;  4AM7 A;  2CGL A;  4BRM A;  2A40 A;  3O9R A;  3VEV A;  5EXW A;  2Q36 A;  3NVK A;  2AA4 A;  4H5T A;  1VQ6 N;  2GWK A;  3U9D A;  1ATS A;  3WXK A;  4A62 A;  2PFU A;  3HI0 A;  1KD1 O;  1HPM A;  1GLB G;  2D4W A;  3R6M A;  3UKU A;  2YHX A;  4FSV A;  4FPA A;  4IO9 L;  3EL2 A;  3CCV N;  4XEI A;  3ATV A;  3KWI A;  1SQK A;  4H0Y B;  4BRI A;  3ZX2 A;  1NGC A;  2V52 B;  3N4P A;  4XH5 A;  4CZJ A;  5F2R A;  1O13 A;  1QQN A;  2CGJ A;  4FWL A;  3U8X A;  2RE2 A;  3FGU A;  1M90 O;  1K8K B;  4H0O A;  5M1P A;  4CZI A;  1MWK A;  4NB4 A;  1HX1 A;  4H5W A;  3FLC O;  4CJ7 A;  3LDP A;  3CC7 N;  4BC5 A;  4YOX A;  2NRZ A;  4AF1 A;  1W2B M;  2JWL A;  5AQP A;  1GLF O;  3FFK B;  3H45 C;  2A6A A;  5BRD A;  1HKB A;  4Y0W A;  4H0X B;  4O8K A;  3ZX0 A;  3CC4 N;  3J8A A;  1Z6R A;  3AGR A;  4H5V A;  3NVM A;  3SMS A;  3UKU B;  3SAG A;  5EOY A;  4CBX A;  5KQD A;  4CZM A;  4BRA A;  2ZJQ L;  5H1S Q;  2NRH A;  3HSC A;  2P9K A;  1T3V A;  2W41 A;  5AQF A;  1BA0 A;  2BUP A;  2E88 A;  2QWQ A;  2YI1 A;  4B1V A;  4B1W B;  3CXC M;  1SS6 A;  2VYP A;  3FR0 A;  2YX6 A;  4C23 A;  2KKZ A;  2IVP A;  2HOE A;  2PBD A;  2CH6 A;  2E2P A;  3M5R A;  4PL8 A;  4WFN L;  1NGA A;  1QQM A;  2YJF A;  3ZX3 A;  1XQS C;  2IVN A;  3DAW A;  5FPD A;  3LDQ A;  1OKJ A;  3C7N A;  2ZGY A;  5B8H A;  4ILH A;  3QML A;  4M7X A;  5GIN A;  3AGK A;  4B1X B;  3IMX A;  4I6M A;  3CCU N;  2HST A;  1EQY A;  3CCM N;  2HBM A;  5FPN A;  3JS6 A;  3H46 O;  2W40 A;  1QZ6 A;  3VTI A;  3CQX A;  1NGB A;  4DB3 A;  1BUP A;  5KQ8 A;  3OW2 M;  4JKD A;  3FZL A;  3VGL A;  4F9O A;  4KH5 A;  2ASO A;  2QWR A;  2VWB A;  4IZ9 A;  3EO3 A;  3KZB A;  3MN6 A;  2P9L A;  4YDU A;  1CZA N;  4B1Z A;  2P9K B;  3H3O B;  4BGA A;  5BR9 A;  2YCH A;  3CF5 L;  2FSJ A;  3PLA A;  3MDQ A;  5CR4 A;  3VGK A;  2NNW A;  1HKC A;  4U7B A;  2A42 A;  2FF6 A;  3D7E O;  4WFA L;  1VQL N;  3ENH A;  5FPE A;  1ATR A;  4JN4 A;  5AQM A;  3C7N B;  2BH1 A;  1VQ5 N;  2AP1 A;  5JVG L;  3OHR A;  2E2Q A;  1KAZ A;  1SZ2 A;  1XUP O;  4JKG B;  3O4W A;  1KQS M;  2HBL A;  4EFH A;  4QS8 A;  2QWM A;  4WQ4 C;  5HOO A;  4G9Z A;  3O9U A;  4K25 A;  1ESV A;  4E1J A;  3CET A;  2NRT A;  2ZF5 O;  5ADX A;  4UY8 O;  3VPZ A;  1VQP N;  3MCP A;  2P9L B;  1YI2 N;  2HMP A;  4BC2 A;  3WQT A;  4FWN A;  3A5O C;  3UKR A;  4WF9 L;  5JVH L;  3EKS A;  3BF1 A;  1C0G A;  3K9J A;  5GAE P;  2ZJP L;  3MCA B;  4JD2 A;  4CD1 A;  5ADX H;  3ULE A;  4BRG A;  2F9W A;  3E9O A;  3CJA A;  1QHA A;  2P9N A;  3VEX A;  4LC9 B;  3CCR N;  4YOU A;  1DKG D;  3BUZ B;  5BPL A;  4A2B A;  1KAY A;  3EN9 A;  3CCS N;  3T69 A;  1R59 O;  3VMF B;  3UB5 A;  1MDU B;  5TKW A;  4BG9 A;  2YHY A;  2HF3 A;  1X3M A;  3E66 A;  1OVY A;  3VF6 A;  4JKA A;  4A5B A;  5I9E B;  3RSE A;  2E1Z A;  4A61 A;  1ZXO A;  1HLU A;  3QFU A;  4A59 A;  5AQH A;  3N4Q A;  3A8Y A;  1W97 L;  4ISF A;  4GV3 A;  3FZM A;  1NGI A;  1V4S A;  4U67 L;  3CI5 A;  1Q7Y O;  4JKB A;  3VF2 A;  4B1Y B;  5EY4 A;  1NGF A;  4KH4 A;  1HUX A;  2V7Z A;  4GV9 A;  1E4G T;  1YUW A;  4BRD A;  3MWT A;  3UKR B;  2QEX N;  3CCL N;  2GWJ A;  5BN9 A;  2NZT A;  2ASM A;  1RGI A;  1BO5 O;  3O1B A;  3CPW M;  1BDG A;  4IEI A;  1G99 A;  5M1K A;  4IOA L;  2Q1N A;  4JD2 B;  2OTJ N;  4BC4 A;  2UYT A;  3L6Q A;  3ULE B;  5M1F A;  2NLX A;  5JLF A;  2P9N B;  1T6D A;  5AQI A;  4BG8 A;  3C6H A;  4BY9 C;  1NGG A;  5GAH P;  3B8A X;  4PKH A;  4BRP A;  3EKU A;  3CME N;  5LJV A;  3RSE B;  4ISE A;  2Q0U A;  4M7Y A;  3L0Q A;  3H1V X;  3C65 A;  4BRO A;  2QWP A;  3CER A;  1JCE A;  3TTD A;  4M63 C;  3J7Z O;  3CCE N;  2Q97 A;  1Q18 A;  5GIP A;  4IOX A;  3O1W A;  4H5R A;  4IOC L;  1MWM A;  3E9L A;  2D0P A;  1NGE A;  3DJC A;  2GEM A;  3DXK A;  4FWR A;  4IJA A;  3O6W A;  4RCH A;  3I33 A;  3FE1 A;  5FPM A;  5M1Q A;  3HTV A;  3LM9 A;  4IXC A;  4PKG A;  3BP8 A;  1NGH A;  1VQM N;  4XH4 A;  2Q0R A;  4IWV A;  1MA9 B;  2D1K A;  4BRQ A;  5AQY A;  1N8R O;  1ATN A;  3HZ6 A;  1QVF M;  4O8U A;  4DHY A;  1NJI O;  4CZE A;  4O5F A;  4K42 A;  3SLC A;  1U2V A;  3EE8 A;  3DWL A;  4QS9 A;  1RDW X;  3ZET A;  3IUC A;  3WUH A;  4AM6 A;  3R9P A;  3ATU A;  2FSN A;  4NLC A;  3A5L C;  4BRC A;  2V51 B;  2GTD A;  4RTF D;  2NRV A;  4CZL A;  3MX5 A;  2Q31 A;  1TYQ A;  2IVO A;  5AQX A;  2QI2 A;  2VGM A;  1YHQ N;  4PL7 A;  3E9P A;  4MLH A;  2A5X A;  3DXK B;  1YF5 L;  3WXJ A;  4HWI A;  5DM7 L;  3Q7C A;  4JK7 A;  4FPB A;  4A2A A;  5TKY A;  4DKW A;  1T6C A;  3CQY A;  3D6R A;  4H0T B;  5AQG A;  3VTH A;  2A41 A;  2ZJR L;  3C0B A;  5EX5 A;  1Q81 O;  3VES A;  5C2D A;  4JKF A;  3F2K A;  4FVU A;  3VF4 A;  4YDU C;  1U2V B;  3M6G A;  5GIO A;  3G6E N;  3PIO L;  5C0Y A;  1ILY A;  4YOW A;  4CZH A;  3TTC A;  2FXU A;  3ZET B;  2WC9 A;  3VER A;  3M1F A;  4FWQ A;  2P9I A;  2QXL A;  3P4I A;  5DM6 L;  5GAG P;  5C2F A;  1VQO N;  3KHY A;  3TSP A;  3LM2 A;  4JKE A;  3VEO A;  1TYQ B;  1RDU A;  2A3Z A;  1SAZ A;  2QA4 N;  1WOQ A;  5AZI A;  1EO1 A;  1WUA A;  5AQO A;  1YJW N;  1J6Z A;  5C15 A;  3VET A;  4ILJ A;  4I6M B;  3O08 A;  4IFE A;  4K41 A;  4FOI A;  4BR4 A;  1BU6 O;  4CD3 A;  3VOV A;  2PAV A;  4IO8 A;  5AQW A;  4CBU A;  5ELZ A;  1JJ2 M;  3I56 N;  2JWK A;  2OTL N;  2EWS A;  2VCP A;  3MX2 A;  4GY2 B;  5F1X A;  5GAD P;  1YXQ A;  4MDB A;  3C6A A;  4JHD A;  2FF3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...