2X6NA

Human foamy virus integrase - catalytic core. manganese-bound structure.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
188
structure length
188
Chain Sequence
PQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein
total genus 60
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x6nA00
3CYMA 1LAWA 3H08A 3K2PA 3OYCA 4Z4IA 5J1EA 3V81A 4OGCA 3OYMA 5CY4A 3TAPA 4ICLA 1TL3A 3NCIA 2HHSA 2OZMA 2HHWA 3C95A 2D0BA 4LY7A 2OPQA 2FBVA 2Z1JA 1S1VA 2O4IA 1W0HA 4Z0UA 2YNGA 2P5GA 4O5BA 4CF0A 1IKWA 4DQIA 4CIGA 5HRRA 5I3UA 4CEQA 4H4OA 1KCFA 1X9MA 2LSNA 4DU4A 2ITGA 3AVJA 1YVUA 1BCOA 1VSIA 5SWMA 1WN7A 4E7HA 4CJ5A 3NH0A 4DFMA 3RR8A 1K6YA 3OVNA 4B3OA 1DTQA 2RF2A 1RBVA 1TKXA 1QTMA 3VN5A 4N76A 3VQDA 1JKHA 3P1GA 4CGGA 1S6PA 1RT5A 3ALYA 4DQSA 1TKDA 4FJ8A 2GUIA 3IS9A 3L3VA 4FW1A 5CZ1A 4OPJA 3HJFA 4CK1A 3NF6A 2GBZA 3KLGA 1X1PA 3OYKA 1JLGA 2Z1HA 3NGIA 1HRHA 4FLUA 4CHNA 2Y1JA 2QXFA 3RWUA 3V9SA 3E01A 2E4LA 3F73A 2P51A 4CGJA 4CJLA 4FXDA 3RTVA 2YNIA 3RMAA 4CHPA 2EHGA 1S1UA 5FDLA 3VQ8A 4DTRA 4Z4GA 4HCCA 1B9DA 4DQQA 1Q9XA 3QNNA 3VQEA 4NCBA 3TR8A 4CFCA 3U3YA 4DFJA 1YTUA 4RW4A 4F4KA 3I0RA 5T7BA 5HBMA 2Y1IA 1IH7A 4FJJA 3AA3A 1O1WA 3AV9A 1VSEA 5SZTA 3MEEA 3WNFA 4AHSA 3M8PA 4C8MA 4CEFA 1TK5A 2G8UA 1RT4A 4CK3A 3QESA 4W5RA 4ID5A 4CEEA 3C6UA 3CFPA 4EZ9A 1F21A 2EX3A 4OKKA 4DFKA 2X74A 3K5LA 2BGGA 4FJMA 1VRTA 2YKNA 3ZSYA 3LP0A 4CHYA 1IG9A 3QIOA 3SYZA 1HPZA 5C24A 4KB1A 1KTQA 1J53A 3CG7A 4FVMA 4BWMA 4E0DA 1WLJA 1GOBA 1RNHA 1QS4A 3QLHA 3MAQA 1ZBFA 4DTNA 3SPZA 3DRRA 5DMRA 3DLEA 3TAGA 1S1WA 1CXQA 4JRQA 2ETJA 1J54A 4JS5A 3LPUA 1NJXA 5KI6A 3HT3A 3JYTA 4LH4A 3ZSVA 4CJRA 3V9UA 2HNDA 3G0ZA 4KTZA 1RTDA 2X6NA 3PUFA 4B9UA 3AO5A 4HUEA 4PA1A 3DRPA 4O4GA 4KHQA 4M3YA 4DSIA 2DTUA 3K57A 4RG8A 3LAKA 3MXMA 4AHCA 4RW7A 1NK6A 3NH1A 1HMVA 3T1AA 1FXXA 3K59A 2A1SA 3LANA 4DF4A 4CF9A 1NKCA 3NGYA 1EETA 2E6MA 4OKJA 2HVIA 3AVKA 3CQ8A 2G8IA 4J2BA 4FM1A 4HHTA 4I9QA 2KZZA 1D5AA 3T3FA 3D0PA 4ZTJA 3LAMA 2G8FA 3HPHA 1C0TA 3PO4A 1VSLA 4CHZA 3SUOA 1SV5A 2A1RA 4FJLA 4CEDA 4FLYA 4JRPA 1XWLA 3KIOA 2G8WA 1JLBA 4DSLA 5J2QA 5JS1A 4AHVA 3ITHA 2IAJA 3LALA 4CJEA 4Z4CA 4J2AA 5J2NA 1X9WA 5J2MA 1DLOA 2BE2A 2DFEA 4DQPA 5CYQA 2XY8A 3AA4A 2QKBA 1RDDA 1VRUA 3V9ZA 4M3TA 1D9DA 1WSGA 3LP3A 1CZBA 3OYGA 1WSIA 3ASMA 3O3FA 5KRSA 4KHWA 3P5JA 4W5NA 3K5OA 5HRNA 4G1QA 3OYNA 1BQNA 3OJUA 2DFFA 4IBNA 3ZT0A 1HNVA 1VK0A 1NKBA 4F3TA 3V1RA 2I5JA 2IOCA 5C42A 2JLEA 1T7PA 4B9SA 2F8SA 1S9GA 1TK8A 5KGXA 3AO4A 4OVLA 4Z4HA 4M3WA 4IFYA 5C25A 1QHTA 3VQ9A 3PO5A 4FZXC 4OLBA 3T19A 4W5QA 3TANA 4DS5A 3AVIA 4CFDA 3AVHA 2D5RA 3SPYA 1KFSA 2HHVA 1N5YA 2HNYA 3QEXA 1RILA 1ITGA 2OPPA 1ZYQA 1T8EA 4BDZA 3KLFA 3SCXA 4JLHA 5CZ2A 1UAXA 3VQCA 3SZ2A 3ZSRA 2DFHA 2OPRA 2KZMA 4B8AB 4B08A 4JS4A 3SQ4A 3RMDA 4BDPA 4QOZB 1LW0A 1MU2A 1UWBA 1KFDA 3L2QA 3AVBA 4HTUA 4DS4A 1REVA 3V6DA 3S3OA 3DRSA 3NFAA 1JLAA 2WOMA 3ISNC 2O4GA 1WAJA 2HHTA 3D45A 4OPKA 3NF9A 3SV3A 3QERA 1SKSA 4B9TA 4M3XA 4FJHA 4Z4FA 3DOKA 4RW6A 2PYLA 3VQ5A 3S9HA 3U6FA 3OYJA 3O3HA 4KTWA 1B92A 3CM6A 3VQ6A 3HVRA 1Z26A 1KVCA 2GV9A 1NK4A 4EZ6A 4KTQA 1TAUA 3AVMA 3KK3A 3HSTB 1BIZA 4DTJA 4CK2A 3TAEA 1L3TA 4DG1A 2R7YA 2HHUA 4CGFA 4CJSA 3DLGA 4DU3A 5KGWA 4GMJB 4M3RA 2VG6A 4CF8A 3HK2A 4CGDA 2RN2A 1SL0A 2QKKA 5HLFA 1NJYA 4DWIA 4HCBA 2HNZA 3CFOA 4F2RA 1Q9YA 1VSKA 4E89A 3ZSZA 4CEZA 2B6AA 5I42A 3K5MA 1S1TA 4RW8A 4FM0A 2FBYA 4DQRA 2RKIA 3LP1A 4KHUA 5K14A 4PQUA 1JLCA 4AHUA 1HQUA 3V1QA 3C6TA 4QAGA 4CEAA 4KI4A 3QEPA 4E19A 3DLHA 1NJZA 4HVJA 2PZSA 4AHTA 1HYZA 4CFAA 1ASUA 5J2PA 3QO9A 1U48A 4FZYA 4DLEA 2HVHA 1CLQA 4IG0A 3L2RA 3DOLA 1RBTA 1RBUA 2X6SA 2DY4A 3NAEA 1LWFA 4KAZA 3BGRA 4B9NA 1WSEA 3OYHA 2ZQBA 1JL2A 4FLZA 1BL3A 4NCGA 4OKEA 1WNSA 3ZSWA 4B9LA 4FK4A 3TI0A 5HRSA 3SUPA 1L3UA 4DMNA 1QQCA 3ULDA 1NOYA 4N41A 4KREA 4ID1A 1KLNA 2P5OA 4C8OA 5HRPA 2KQ2A 2D0AA 4IFVA 4CEBA 4E7KA 3MXIA 4OLAA 3HPGA 3HYFA 3AVCA 4BE2A 2B4JA 3M8RA 1IO2A 2G8VA 3I8DA 1ZBUA 4FJNA 4FJ9A 3TARA 2XRIA 3AVNA 4CECA 4LH5A 1L3SA 4KI6A 4HUGA 1XC9A 1ASVA 4CERA 4FK0A 3OYDA 3K58A 4CHOA 1GOAA 3OY9A 1CZ9A 1RBRA 2IGIA 3O3GA 3KKSA 3SQ2A 1ASWA 3TAFA 3ZSXA 1X9SA 1VSFA 4ZHRA 1JLFA 1KVBA 3ZT1A 3HL8A 3SJJA 1C6VA 5KTQA 4FJ5A 3HP9A 3VQPA 3DI6A 4CF2A 3NDKA 1J9AA 2B5JA 3KK2A 3PV8A 1JXBA 4N47A 2XHBA 4BDYA 1RT6A 2YHAA 4KPYA 1BCMA 2D0CA 2PY5A 3HM9A 4FJKA 2Q3SA 4R5PA 1UOCA 1QSLA 4L8RB 4E1NA 4QCLA 4Q5VA 1NK5A 3MEGA 1RT2A 2YHBA 3ZSOA 3NGZA 3KKRA 4CJUA 1T05A 1IKVA 3ZT4A 1UA1A 3B6PA 3IG1A 1JL1A 3VQQA 3KD1E 4M45A 4J2DA 1G15A 4W5TA 4OGEA 3NF8A 3M8SA 4CJVA 3PX4A 2BDPA 3KJVA 1A5WA 4H4MA 1TV6A 3VQAA 4IKFA 4DSEA 4YNQA 4KV8A 1JLQA 1TAQA 1I39A 3LPTA 3PX6A 1C1AA 3RRHA 1N6QA 4ZTFA 3NBPA 1KLMA 3AA5X 3QIPA 4WE1A 4CJKA 1T03A 2WONA 3NHGA 4CGIA 3THVA 1RBSA 1SKRA 4MQ3A 2OZSA 4CIEA 4KO0A 1TKZA 4Y1CA 3NH2A 4DTSA 3F9KA 4CJFA 4BACA 3I0SA 3IRXA 1C0UA 3CFRA 1NK9A 2PYJA 1NK0A 3FFIA 4FW2A 1A5XA 1SL2A 1C0MA 3AVFA 1IKXA 2YNFA 3WNGA 2XY7A 4FJXA 2F96A 4DFPA 1ZBLA 3RR7A 3AA2A 1EP4A 1RDAA 2VWJA 4DTMA 3DLRA 5EU7A 4ELTA 1XI1A 3S3NA 5FROA 2JGUA 3ZT3A 3PX0A 1TKTA 2OYQA 3OS0A 5KRTA 3LWLA 3SUNA 3BDPA 2X78A 4E3SA 1BIUA 2G8HA 4KHSA 4I2PA 3QINA 4KFBA 2W42A 2IDOA 4AH9A 2E6LA 3KLIA 4E7IA 3V9WA 1LWEA 4DU1A 1KSPA 4DSJA 1C1BA 4W5OA 5CYMA 1WAFA 3ZCMA 4B8CA 1KRPA 4J2EA 4AHRA 3OYAA 3KK1A 2ZD1A 4DTOA 2YV0X 1L3VA 4CCHA 4FLVA 2Z1GA 4KKOA 4DLGA 4I2QA 4CJWA 4BE1A 4FLTA 1SL1A 1Y97A 4CIFA 1VSDA 4B9VA 1TK0A 2Z1IA 3KD5E 1HNIA 4E7LA 3RRGA 4M42A 3OYLA 3TAQA 3OYBA 3QNOA 3P83D 4O44A 4CJQA 4FM2A 1J5OA 2FBTA 2QK9A 1WSFA 4AILC 4KB0A 3OJSA 5D3GA 3SUQA 3DYAA 4GVMA 1L5UA 3O4NA 3L8BA 3OYEA 4BE0A 3WNEA 3OYFA 4ELUA 2HMIA 3AVAA 1LAVA 3KTQA 4XIUA 4IG3A 3AVLA 4M41A 1XHXA 1FK9A 2XY6A 1BHLA 3AVGA 1R0AA 2NUBA 4LD0A 1B9FA 2IS3A 4C8NA 3TAMA 4O0IA 2G8KA 4F8RA 4NYNA 3VA3A 3SQ1A 3AO2A 4FK2A 3LZJA 3TABA 1EKEA 3QEIA 2RPIA 1NKEA 4LSNA 2VG5A 4CJPA 1JLEA 3LZIA 1D9FA 4H8KA 4EP5A 3L2UA 3C94A 4Y1DA 3KLHA 1LWCA 3VQBA 4FJIA 5FRMA 1IKYA 4IDKA 3JSMA 4F3OA 4NYFA 1VSJA 1BI4B 3WNHA 3NE6A 1D8YA 3B6OA 3K5NA 4FJGA 2AJQA 1HJRA 1U45A 2HHXA 4TSXA 1RDBA 1Q8IA 3OYIA 3SQ0A 1TVRA 4PWDA 5E41A 1WSJA 1UA0A 4KHYA 4B9MA 2OPSA 4RW9A 3EY1A 2HB5A 4ELVA 2FBXA 2KW4A 3MXJA 3NF7A 4N56A 4N5SA 4DTXA 3QEWA 1ZBHA 4CGHA 4FLWA 2OA8A 4CE9A 3TWHA 2KFZA 4Q0BA 2HW3A 2KTQA 1S6QA 1VSHA 3DLKA 3LP2A 1C1CA 1RTIA 4CFBA 4O55A 3EZ5A 1RDCA 4KHNA 3RMCA 1Z25A 4NCAA 3QEVA 4I7FA 4CJ3A 2FC0A 4E7JA 1YT3A 3VQ4A 3ZT2A 3VA0A 1S1XA 3RMBA 3L2VA 2XO7A 1KVAA 4CJTA 4GW6A 5HROA 3OS2A 2ATQA 2YKMA 3VQ7A 3PY8A 4DSKA 4EP4A 1SKWA 2YNHA 1QE1A 3DM2A 3HXMA 3UIQA 1FKOA 4FJ7A 1QSSA 1RT3A 1TGOA 2BANA 3HPOA 3KLEA 1A5VA 3HP6A 3U3GA 2P1JA 3OS1A 3SNNA 4Z4EA 4KRFA 3AO3A 3DMJA 1RCHA 4OJRA 5JS2A 4DF8A 1NK8A 3O4QA 4F2SA 4FZZA 2XY5A 1ZBIA 1RT1A 3S3MA 1W9HA 4DSFA 2F8TA 4YFUA 1RTJA 3EYZA 1BISA 1WSHA 4K8XA 4K8ZA 1VSMA 2IC3A 1U47A 5FRNA 3V1OA 2KFNA 3HVTA 1HYVA 3ZSQA 3L2WA 4CHQA 3V9XA 1U49A 2ZE2A 4M3ZA 3MECA 1TL1A 1XHZA 4CF1A 4CEOA 1DTTA 1I3AA 1RTHA 1LV5A 1NK7A 2VG7A 4PY5A 4UQGA 3HO1A 1GOCA 4E1MA 4BWJA 3SV4A 3A2FA 4MFBA 2HHQA 3DLBA 3V4IA 1CXUA 5DK5A 5HP1A 1U4BA 1FKPA 1BGXT 1NJWA 1JXEA 3M8QA 1HYSA 4O0JA 3G10A 4DTUA 3AO1A 1NOZA 3MEDA 4PUOA 4FYDA 1LW2A 4DTPA 1SUQA 2VWKA 4C8LA 3LDSA 1S5JA 4LSLA 3LWMA 4FCYA 4C8KA 1QSYA 4I9LA 3L3UA 3IAYA 3SI6A 1BI4A 1EX4A 1U04A 4CJ4A 1RT7A 4FLXA 1BQMA 1EXQA 1YTAA 1HQEA 3CM5A 4CESA 4HUFA 3QETA 4M3UA 1S9EA
chains in the Genus database with same CATH superfamily
4CZFA 4IJNA 3H08A 3OYCA 2QW9A 4Z4IA 3PSIA 2O8FB 3EE8A 3NCIA 3OBWA 2OPQA 2FBVA 3ZLJA 3CJ7A 4NXMK 3T1YK 2O4IA 1W0HA 4Z0UA 2P5GA 4U67L 4CF0A 5I3UA 5HRRA 4CEQA 1QHAA 5JICA 2ITGA 2BTFA 1VSIA 1WN7A 3VN5A 3VQDA 4CGGA 3BP8A 4O8UA 1XMOK 1TKDA 4OPJA 5CZ1A 3EE9A 3NF6A 4MDBA 4DUZK 1X1PA 5JMVA 3EN9A 2D0OA 3T69A 4CHNA 2Y1JA 4LC9B 4H0YB 4CGJA 3O5BA 4M7XA 4WYBA 4DTRA 3T7ZA 1B9DA 4NCBA 3AARA 1ESVA 5AQMA 4DFJA 4AM7A 4DHYA 3I0RA 3L6QA 4FJJA 1VSEA 2F9WA 3C6HA 1HKGA 3OHRA 4C8MA 3BF3A 2W40A 3CFPA 3C6UA 3G71N 1NGHA 5AQLA 4OKKA 2X74A 3K5LA 3LP0A 5AQTA 1RDWX 4E0DA 4B1ZA 3LDLA 1I94K 2QA4N 3QLHA 4DTNA 1Q18A 3R1XA 4A57A 3DLEA 3QICA 2ETJA 1NGCA 3LPUA 5C2FA 1NJXA 3JYTA 2YI1A 4KTZA 2X6NA 1QQOA 4HUEA 2WC9A 3F9MA 1GLJO 4FVUA 4RG8A 1NK6A 4CZEA 3T1AA 1FXXA 1XMQK 2A1SA 4CZIA 3LANA 4DF4A 4GV3A 5AQYA 1NKCA 4ISEA 1EETA 4OKJA 5AR0A 3AVKA 3CQ8A 2G8IA 2HVIA 5AQOA 4FM1A 4HHTA 4J2BA 4B3RK 4I9QA 3D0PA 3LAMA 4XEIA 1VSLA 3C7NA 1WBBA 4FJLA 2G8WA 4JI8K 3TSUA 2OCEA 4MO4A 5J2QA 5CE3A 4MLEA 4DUYK 1VQKN 1DLOA 2BE2A 4DQPA 4U7BA 2JWLA 4M3TA 4FOEA 3J8AA 4W5NA 3OYGA 5KRSA 5BRFA 4KHWA 5AFUA 1YAGA 1EQYA 4YHHK 3V1RA 4PKGA 2HBJA 4FOIA 4RTFD 3JAMO 5C42A 4FWKA 4A5BA 1V4SA 4OLBA 5KPRA 4W5QA 4DS5A 4CFDA 2D5RA 4YDUC 4K25A 1ZYQA 1T8EA 4BDZA 3VTIA 4ILHA 1K73O 2OPRA 3VEYA 4QOZB 1Q7YO 4DV3K 1OH7A 3DRSA 4WCEL 3ISNC 2O4GA 4H03B 2HHTA 3NF9A 3DOKA 4CJ7A 3C7NB 1IBKK 4BRKA 1SZ2A 1E3MA 4HTLA 4EZ6A 3AVMA 3KK3A 3HSTB 1BIZA 1L3TA 1NGDA 4BR7A 2R7YA 5BRDA 3QDKA 4I6MA 4DU3A 4BROA 4CBUA 2QEXN 2QKKA 4HCBA 4DWIA 1Q9YA 4CEZA 2PFUA 2B6AA 3M5RA 4JK7A 1S1TA 5I42A 2FBYA 4KHUA 5K14A 3U4LA 4CEAA 4CI6A 1T6CA 4KBOA 1HYZA 5J2PA 4FZYA 1RBTA 5C10A 2DY4A 1E4FT 4OKEA 3TI0A 5HRSA 3ULDA 1QVFM 2P5OA 5HRPA 2KQ2A 4E7KA 3VOVA 2CGJA 4OLAA 1ZBSA 1KC8O 4PL8A 2QWLA 4LH5A 3ENBA 5AQUA 4CERA 2V7YA 1CZ9A 1C0GA 4B3TK 1RBRA 2IGIA 4I6MB 4LFBK 1KVBA 3ZT1A 3HL8A 3CC7N 3SJJA 5KTQA 4B3MK 4CF2A 3EL2A 1J9AA 3KK2A 2PY5A 2Q3SA 4DR6K 3KKRA 1T05A 3B6PA 3L4IA 4BRCA 2ZGYA 3KD1E 1IJJA 1BDGA 4W5TA 2UYTA 3PX4A 4FWPA 4H4MA 3VQAA 4LF4K 4YNQA 1TAQA 1C1AA 3VEZA 3RRHA 5AQVA 3H46O 3NBPA 1N6QA 3CPEA 4JNEA 3THVA 1SKRA 2UXDK 1KXPA 3CHWA 4CIEA 1TKZA 4Y1CA 5AQIA 3CFRA 1NK9A 2PYJA 3OTOK 1NK0A 5C0YA 4KHPK 1A5XA 1C0MA 1IKXA 3RR7A 3WXLA 5M1KA 5M1QA 3SBGA 2VWJA 1XI1A 3ZT3A 1TKTA 4RCHA 4LF7K 5AQWA 2D0PA 3SUNA 3BDPA 2IVPA 3VEXA 2IIRA 4I2PA 3QINA 3KLIA 4E7IA 4B8CA 1BO5O 4AHRA 3C0BA 5AQNA 4FLTA 1T3VA 1IG8A 3LDNA 3WQTA 3IMXA 1VSDA 4B9VA 2IVNA 2Z1IA 3N4PA 3U9DA 3RRGA 3OYLA 3P83D 4O44A 4GV9A 2QK9A 4PL7A 4MDAA 1OH5A 4GVMA 3O4NA 1YJ9N 4CZGA 3DWLA 1RFQA 3AVGA 2NUBA 3BZKA 4O0IA 4F8RA 3VGMA 3AGKA 1BA0A 1D9FA 3HBTA 3Q7BA 4H8KA 2E1YA 3KLHA 5FRMA 5C2DA 4IDKA 4YOWA 3VGLA 3HM8A 4NYFA 1D8YA 1BI4B 3MN9A 1QZ6A 1U45A 2HHXA 4TSXA 1RDBA 4FSVA 1TVRA 4A5AA 1UA0A 2OPSA 3EY1A 3NF7A 3F2KA 4C23A 1HNXK 4FLWA 2OA8A 2O8CA 2HW3A 4JKBA 2O8BB 3DLKA 4WQ4A 4X65K 3VGKA 1C1CA 3CJ1A 4CFBA 2WTUA 4O55A 1U6ZA 1Z25A 3RMCA 4I7FA 2P9IA 2FC0A 4E7JA 1YT3A 4JKCA 1S1XA 3I33A 4OPHA 1X3NA 1RGIA 3E9LA 4GW6A 5HROA 3C65A 1QE1A 3DM2A 2OTJN 3UIQA 3ZX3A 2BANA 4IXCA 3SJHA 5GAGP 3OS1A 3FZFA 3O8MA 1NK8A 4EAHD 4FZZA 2QI2A 4BR5A 4YFUA 3CCRN 2KFNA 3MX2A 1BOTO 3ZSQA 2QWNA 1U49A 4CF1A 1VQ9N 2QWOA 4UQGA 1XUPO 4MFBA 3DLBA 5DK5A 1JXEA 2W41A 4DTUA 3G10A 3AO1A 3MEDA 4FYDA 1JCFA 4GV6A 1S22A 1S5JA 5AZJA 3QMLA 4FCYA 3OW2M 2GX9A 4I9LA 3G6EN 2FLOA 4FLXA 1MWKA 1U04A 1RT7A 4M3UA 3CM5A 1S9EA 1ZXOA 3GG4A 2P9IB 1LAWA 3K2PA 1NGBA 3V81A 4OGCA 3OYMA 4FPBA 1YJWN 5TKYA 3TAPA 2HHWA 2OZMA 4XH1A 2D0BA 2NRXA 4XH4A 4ILJA 1YI2N 1S1VA 2YNGA 3U8XA 1IKWA 4YOUA 3AVJA 5BPLA 1BCOA 4E7HA 4DFMA 3CC2N 4CJ5A 3E9PA 3CPWM 1DTQA 2RF2A 4EHUA 3FFKB 4CVNE 1S6PA 4DQSA 3L3VA 4FW1A 4CK1A 1NMNA 1IV0A 3CETA 3NGIA 2GEMA 3D2EA 3RWUA 3V9SA 3E01A 2E4LA 4CJLA 3GL1A 5AZJB 5FDLA 1S1UA 4UY8O 2FSKA 1WOQA 1Q9XA 4BVPA 4RW4A 4F4KA 4GKKK 1V4TA 3AV9A 3QFPA 5SZTA 3MEEA 4J8FA 4AHSA 1TK5A 4CK3A 3HTVA 3TU5A 3S41A 1F21A 4BGBA 2BGGA 3IKMA 3JS6A 2YKNA 4KB1A 1KTQA 3K9KA 1NBWA 5F2RA 4FVMA 4WFAL 1WLJA 3MAQA 1QS4A 2CH6A 3TAGA 1S1WA 1J54A 5DM6L 2A42A 4JKGA 5KI6A 2HNDA 4JD2A 3FE1A 4MLHA 2DTUA 5KQ8A 4KHQA 4DSIA 4FWQA 3MXMA 1HMVA 3CQYA 4WQ4C 4DV7K 3K59A 1KD1O 3D2EB 2E6MA 3IUCA 5HOOA 4H0PA 4JKHA 3HPHA 2G8FA 3PO4A 3SUOA 1ATRA 4FLYA 1JLBA 4DSLA 5JS1A 4JI6K 4CJEA 3LALA 5AQPA 2XY8A 3AA4A 1VRUA 2J4RA 1WSGA 2ITMA 2F4VK 4QS7A 5HRNA 3OYNA 5AQQA 3UE5A 1M1KO 3BZCA 1T7PA 2JLEA 4CZHA 1TK8A 4Z4HA 4IFYA 5IWAK 3VQ9A 3BY5A 3E66A 3SAGA 1RILA 4JKGB 2ZF5O 4H0VB 5AQHA 5CZ2A 4JD2B 4DV6K 4M63C 2KZMA 4B8AB 3SQ4A 1MU2A 4YOTA 1KFDA 3L2QA 3V6DA 1REVA 3FZLA 3NFAA 3KZBA 3P38A 4BR9A 4FJHA 2H3GX 3U6FA 4JKDA 4KH5A 3CMEN 3ENOA 4B3SK 3CM6A 3VQ6A 2YX6A 3HVRA 3TTDA 2VCPA 4DTJA 3TAEA 2DPNA 4DG1A 4CJSA 4GVEA 4H5VA 2VG6A 3CCLN 2AA4A 3DXMA 5HLFA 3O9SA 3J81O 3H3OB 5AQFA 4BGAA 3BEXA 3O9UA 2RKIA 2A6AA 2UXBK 4IZ9A 3V1QA 3C6TA 4QAGA 4KI4A 3VPZA 1NJZA 4AHTA 3SAHA 3QO9A 4DLEA 5KPTA 1CLQA 4IG0A 3DOLA 3CCJN 1LWFA 3MWTA 3OYHA 1JL2A 1BA1A 4FLZA 1BL3A 3ZSWA 4B9LA 4BC2A 1L3UA 1NOYA 3QBWA 2FF3B 3CJAA 4KREA 2P9LA 1WB9A 1KLNA 3LM2A 3MXIA 1CZAN 3HPGA 3VEVA 4BE2A 1NG9A 1P8ZA 3M1FA 2XRIA 3AVNA 4CECA 3CJCA 4CHOA 3OY9A 1BUPA 3FZHA 3O3GA 1YITN 3TAFA 3ZSXA 1X9SA 3CCVN 1N8RO 1R59O 3DXMB 2Q97A 2V7ZA 3DI6A 5M1FA 4DKWA 2UUCK 2YHAA 3H6EA 4KPYA 1IBMK 3HM9A 4R5PA 4JK9A 2YJEA 5F1XA 3MEGA 3AGRA 3CCMN 3KWGA 3FLCO 4BR2A 3VQQA 4M45A 1VQLN 1G15A 4OO1J 4FWSA 5AQKA 5GADP 3NF8A 1JCGA 3M8SA 1ZC6A 2BDPA 1A5WA 1TV6A 1T44A 4BQZA 4BG8A 4CJKA 3AA5X 4WE1A 4PKHA 1TUUA 3O6WA 3PSFA 4KO0A 2P9LB 4CJFA 2HHHK 3I0SA 3IRXA 1C0UA 3FFIA 4IOCL 3THXA 1GLBG 4FJXA 4JK8A 5BPMA 3QFUA 2W6KA 5KPZA 1EP4A 4AM6A 5FPNA 4ELTA 5JLHA 4JKAA 1MDUB 3KHYA 2NRHA 3WXMB 4IDHA 2GTDA 2X78A 2G8HA 4IWVA 2E6LA 2Q36A 4BRLA 3HI0A 4DV1K 1DKGD 1LWEA 4DU1A 1KSPA 3ZCMA 1KRPA 3OYAA 2YV0X 5GIPA 4XH5A 4NXNK 5KQDA 1BWFO 4M42A 1YF5L 3OYBA 3QNOA 4BRAA 5C15A 1J5OA 1HKCA 2P9SA 4AILC 4KB0A 3VMFB 3DYAA 1L5UA 2RHKA 3OYFA 4ELUA 2QTDA 2HMIA 2D4WA 4IG3A 3AVLA 1FK9A 4LD0A 1B9FA 3TAMA 4C8NA 2G8KA 1NM1A 3VA3A 4DR3K 3A5OC 3AO2A 3THXB 3LZJA 3LDOA 1EKEA 2RPIA 1NKEA 1NMDA 4CJPA 3LZIA 3D2FA 2O8EA 3L2UA 2ZJQL 3C94A 3CCQN 1LWCA 4JI4K 3SAFA 5EXWA 1IKYA 3JSMA 4F3OA 1VSJA 3B6OA 2WFBA 5MLCQ 3O08A 1VAZA 1X3MA 3RSEB 4Y0WA 4OX9K 4BRGA 1Q8IA 4F9OA 3SQ0A 3PLAA 1WSJA 1OH6A 4IFEA 2FBXA 4CE9A 4FWOA 2KFZA 1RTIA 1T6DA 1O13A 1RDCA 3LL3A 4QS9A 5GAHP 4KHNA 4CJ3A 5AQXA 2P9SB 1HNWK 1NGGA 3VQ4A 2KKZA 3L2VA 2XO7A 1KVAA 3T1HK 4JHDA 2YKMA 4DSKA 3PY8A 2YNHA 3HXMA 4FJ7A 1XNQK 1RT3A 1TGOA 3KLEA 5ELZA 2P1JA 2NRRA 1RCHA 3MK6A 4F2SA 1QVGM 1RT1A 3D2FB 2O8EB 1HKBA 3O1WA 1VSMA 4BREA 1U47A 1ILYA 2JWKA 4CHQA 4M3ZA 1RDUA 3HZ6A 1TL1A 1XHZA 1DEJA 1I3AA 2VG7A 3FZMA 3VERA 3ID8A 3SV4A 3A2FA 3H1QA 2HHQA 1K8AO 1NGJA 4PHTX 5HP1A 3EZWA 4O0JA 1NOZA 4PUOA 1LW2A 4DTPA 3HRGA 2VWKA 2E20A 3TTFA 4JI0K 4JI5K 1QSYA 4FWNA 3AAPA 1BI4A 4J2AA 4IEIA 1EXQA 1YTAA 4CESA 4HUFA 1NNEA 4K8ZA 3CYMA 4DR7K 4BRFA 4JYAK 3UKRA 4ICLA 1TL3A 2HHSA 4JHDB 5M1PA 4LY7A 2HOEA 2HSTA 5JVGL 4O5BA 4DQIA 4CIGA 1GLLO 2NLXA 2O8BA 4BRPA 4H4OA 4A61A 1KCFA 5LMUK 1HPMA 2LSNA 4DU4A 1YVUA 1N32K 5SWMA 3VEOA 3RR8A 4A62A 1K6YA 3OVNA 1XNRK 3MX5A 2QWPA 4B3OA 1QTMA 1RBVA 4DV2K 4N76A 1JKHA 3P1GA 3ALYA 3DXKA 2GUIA 2HMPA 3O1BA 2GBZA 3KLGA 4IO8A 5JVHL 4V19S 1JLGA 2Z1HA 1HRHA 4FLUA 1FJGK 1HR0K 1DGKN 4FXDA 2P51A 3RTVA 3RMAA 5EVZA 4CHPA 2NZTA 3E1YA 4Z4GA 2E8AA 4DQQA 3QNNA 3VQEA 4DR2K 4BR4A 3DJCA 3TR8A 4CFCA 3K0SA 1YTUA 1Z05A 4H5NA 5T7BA 2BUPA 5HBMA 1GLDG 3UKRB 3AA3A 1O1WA 2QWQA 5AFUH 1WBDA 1VQ4N 4CZMA 2HBLA 3R9PA 3WNFA 5BR9A 2G8UA 4BVOA 3QESA 3R8EA 4DFKA 2CGKA 5EOYA 4CHYA 3QIOA 4ISGA 5FPMA 1HPZA 4K0KK 5C24A 3CC4N 2A5XA 3IFRA 4K42A 1NGAA 2NRVA 4NLBA 1ZBFA 3DRRA 4JRQA 4JS5A 3DXKB 5GAEP 4Z94A 4LH4A 4CJRA 3V9UA 2CGLA 3G0ZA 1RTDA 3PUFA 3AO5A 2E1ZA 4DR1K 3DRPA 3EKUA 3K57A 1VQ7N 3LAKA 4RW7A 3L0QA 4C1NK 3NVKA 1YXQA 3VTHA 3NGYA 3VEWA 3T3FA 3O9QA 1C0TA 5M1NA 3CF5L 2A1RA 3ZEUB 3KIOA 4DR5K 1NGFA 4AHVA 3ITHA 2IAJA 1TUYA 5AQGA 2AP1A 2FSJA 5CYQA 2QKBA 3N4QA 1RDDA 3G25A 2O8DA 1WSIA 3ASMA 5TKWA 3P5JA 4G1QA 1BQNA 2DFFA 3ZT0A 1VK0A 3ZX0A 4F3TA 1HNZK 2IOCA 5E84A 5F0XA 4B9SA 5KGXA 3AO4A 1QHTA 4FZXC 4BG9A 3T19A 4DQ8A 3AVHA 1EWQA 4FWMA 2OPPA 3RVCA 3SMPA 3ENHA 3KLFA 3VQCA 1UAXA 3SZ2A 4CD1A 1LCUA 4DCHA 4JS4A 4BDPA 4R79A 3S3OA 3AVBA 2E2QA 5EY4A 3M6GA 2FF6A 4CW7B 2FSNA 5AQSA 3D45A 4OPKA 1SKSA 4M3XA 3VQ5A 3S9HA 3O3HA 4KTWA 1B92A 2P9NB 4FL9A 1Z26A 1NU0A 3O80A 1KVCA 1QQMA 2UU9K 3J7AP 4K41A 4A59A 4CD3A 3DLLL 2Q0RA 2PAVA 5KGWA 4M3RA 4CF8A 3HK2A 4B1UB 4CGDA 3WXIA 2ZGZA 1NJYA 4NLCA 2HNZA 4JKEA 4F2RA 2O8DB 1VSKA 4E89A 3K5MA 4RW8A 4FM0A 2A41A 4DQRA 3LP1A 1SQKA 1Y64A 4PQUA 4WF9L 4AHUA 2P9UA 1HQUA 4CZKA 3QEPA 3BUZB 3UKUA 5FPEA 2HVHA 2YHWA 3EEQA 1RBUA 3VF6A 1VQMN 4H0TB 2QM1A 2ZQBA 4JI7K 2GWJA 1WNSA 4FK4A 2ASOA 5A2QO 4DMNA 2NRTA 4N41A 4BRNA 3SLCA 4IFVA 3LDPA 3HYFA 3AVCA 2B4JA 2W6LA 3QB0A 3I8DA 4FJNA 3TARA 1L3SA 4HUGA 1ASVA 2I7NA 2OTLN 4YORA 3KKSA 4H5WA 3BF1A 1VSFA 3F5TA 3OBYA 3A8YA 4H0OA 1C6VA 4G9ZA 4FJ5A 3HP9A 3THWB 3WUHA 2B5JA 1ATSA 4BDYA 4N47A 1RT6A 4GY2B 3DAWA 3J7ZO 2D0CA 4FK0A 4L8RB 4QCLA 4Q5VA 2P9PA 1RT2A 1NGEA 2Q2RA 2YHBA 3ZSOA 2P9UB 3AAQA 3SBTA 3I56N 1YVNA 3THYA 4X64K 3ZT4A 3CCSN 5BN8A 2UUBK 3WXKA 3UKUB 1QZ5A 5AJ3K 2VWBA 1JLQA 1I39A 3PX6A 4NB4A 1KLMA 3QIPA 2WONA 3O9TA 3CXCM 4CGIA 1RBSA 5AZIA 4MQ3A 1Q81O 3MCAB 3NH2A 4LF5K 5AQRA 3F9KA 1HJOA 2YHYA 3A5LC 4FW2A 3AVFA 3WNGA 4DFPA 3ID6A 2I7PA 4DTMA 1RDAA 3MCPA 4PKIA 2YCHA 3S3NA 1EWRA 5FROA 2JGUA 3O9RA 3PX0A 2OYQA 3OS0A 3LWLA 3GOIA 4E3SA 2W42A 3H3NO 2IDOA 3GE1A 4H5RA 2ZM6K 1P90A 4DSJA 1C1BA 5CYMA 4J2EA 3KK1A 2ZD1A 2P9PB 4CCHA 4FLVA 2Z1GA 4I2QA 1S3XA 3TTCA 3THYB 1Y97A 1TK0A 3KD5E 4E7LA 4JV5K 3TAQA 3Q7CA 4FM2A 1WSFA 2CH5A 2E2OA 1SAZA 3B8AX 3NVMA 4LFCK 3L8BA 3AVAA 1LAVA 1MA9B 3P31A 5AZIB 3TSQA 4XIUA 1TYQA 3U9ZA 3KTQA 1LOTB 1XHXA 4BC3A 1BHLA 3H45C 1KAYA 4FWLA 4HWIA 1DT9A 4NYNA 2HBKA 3SQ1A 2ZWHA 5B8HA 4LSNA 5CHIA 3VF2A 5BN9A 4Y1DA 1W2BM 4K43A 4RWTA 2F9TA 3WNHA 2V52B 3K5NA 4FJGA 4DV0K 1HJRA 1ATNA 3A0IX 5FPDA 4CBXA 4PWDA 5E41A 4RW9A 1ZBHA 2KW4A 3MXJA 3AY9A 4N5SA 1M90O 1H1VA 3TWHA 3JXUA 1OH8A 1S6QA 3EZ5A 4FPAA 1GLAG 1OVQA 3O4WA 5AQZA 2ASPA 3VA0A 3RMBA 4B1VA 2ZJPL 3MMVA 3FGUA 4CJTA 3KVGA 3VQ7A 1GLFO 4EP4A 1TYQB 3I8BA 1SKWA 1N34K 1EO1A 1FKOA 1QSSA 2FXUA 1GLEG 3HPOA 1A5VA 2ASMA 3HP6A 4M7YA 3U3GA 4KRFA 3SNNA 4Z4EA 3AO3A 3DMJA 5JS2A 3O4QA 2XY5A 1ZBIA 1KAZA 3S3MA 1W9HA 4DSFA 5I9EB 4GKJK 1RTJA 1J5EK 1E4GT 4K8XA 5FRNA 2IC3A 5ADXH 4FO0A 3MDQA 3L2WA 4IJAA 5FLXO 1DTTA 1KAXA 1LV5A 1NK7A 3HO1A 4BWJA 3W3DA 3J80O 4A2BA 4O5FA 1OVYA 1CXUA 1NJWA 3M8QA 1SUQA 4C8LA 1N36K 4LSLA 3LWMA 3CJ9A 5LY3A 4C8KA 2A40A 3L3UA 3IAYA 3SI6A 5GINA 1EX4A 4CJ4A 3QETA 3RSEA 3KWIA 3D6RA 5J1EA 2Q0UA 5CY4A 3ZETA 4O8KA 3C95A 2HF3A 2Z1JA 2KLAA 3EKSA 2QWMA 1X9MA 4IO9L 2VGNA 4WQ5C 2YJFA 5CR4A 3NH0A 3ULEA 1GLCG 1TKXA 3MN5A 1RT5A 4FJ8A 3P4IA 3IS9A 2HBMA 3HJFA 3ZYYX 5HL7L 3OYKA 3CD6N 1NWKA 1YJNN 2QXFA 3F73A 4X66K 2YNIA 2UXCK 2EHGA 3VQ8A 1NLVA 4HCCA 5IT9O 4KH6A 3WXJA 4B1XB 3U3YA 4MO5A 2Y1IA 1IH7A 3C6AA 5DM7L 3ZETB 3KK7A 4JEPA 5LJVA 2EWSA 3M8PA 2KHOA 4CEFA 1RT4A 4W5RA 4ID5A 4CEEA 4EZ9A 2EX3A 4FJMA 1VRTA 3ZSYA 3GBTA 1K9MO 3SYZA 1IG9A 1J53A 3CG7A 4BWMA 3ULEB 1X9JA 1GOBA 5BREA 1RNHA 3MN7A 3SPZA 3FZKA 1VQ5N 5DMRA 2E2NA 1CXQA 5EX5A 3HT3A 4B1WB 3ZSVA 4WFNL 3E9OA 4B9UA 2YHXA 4PA1A 4CZJA 4O4GA 4M3YA 4AHCA 3PIOL 3NH1A 4DR4K 4CF9A 2E88A 4ILGB 2KZZA 1D5AA 3VESA 4ZTJA 2WUSA 4CHZA 1SV5A 4CEDA 4JRPA 1XWLA 1G99A 5JLFA 2BH1A 5H1SQ 1VQON 4Z4CA 5J2NA 1X9WA 5J2MA 2DFEA 3HOSA 3CMAN 1JJ2M 3V9ZA 4LF9K 1D9DA 3LP3A 1CZBA 4NO7A 4L3QA 3O3FA 3K5OA 3OJUA 1W97L 4IBNA 1HNVA 1NKBA 4JI3K 4ISFA 4FWRA 2I5JA 2VYPA 2F8SA 1S9GA 4OVLA 4M3WA 4IEEA 3A5MC 5C25A 3PO5A 4AQYK 3TANA 3AVIA 3SPYA 1KFSA 3SK3A 1BU6O 1N5YA 2HNYA 2HHVA 3QEXA 4JN4A 1ITGA 2PBDA 4DV5K 3PIPL 3R6MA 3CIPA 3SCXA 4JLHA 2NRWA 1N33K 3ZSRA 2DFHA 4QS8A 4B08A 3RMDA 3VENA 1LW0A 1UWBA 4HTUA 4DS4A 1JLAA 2WOMA 3LDQA 1WAJA 3QERA 3SV3A 4B9TA 4Z4FA 4RW6A 2PYLA 3OYJA 3A5NC 2VQEK 4BRQA 2GV9A 4YOYA 1NK4A 3UB5A 4KTQA 1TAUA 4X62K 1HX1A 4CK2A 3D7EO 3HOTA 2HHUA 4CGFA 4EIAA 3DLGA 4GMJB 4C1NI 2RN2A 1SL0A 1Z6RA 2A3ZA 2E2PA 3CFOA 5E26A 3ZX2A 3ZSZA 3ZEUA 1OKJA 1JLCA 5AQJA 1XQSC 5GIOA 1VQPN 4DB3A 4E19A 3DLHA 1MWMA 4HVJA 2PZSA 4CFAA 3FR0A 1ASUA 2HF4A 1U48A 3L2RA 2X6SA 3NAEA 1YHQN 4KAZA 3BGRA 4B9NA 1WSEA 4IOAL 3OA9A 4NCGA 4KH4A 1Q86O 3SUPA 1QQCA 4ID1A 4C8OA 2D0AA 4CEBA 3M8RA 1IO2A 2G8VA 4BRDA 5BR8K 1ZBUA 4FJ9A 4KI6A 1XC9A 3OYDA 3K58A 1GOAA 4EHTA 1VQ6N 1IBLK 3SQ2A 1ASWA 1VHXA 4ZHRA 1JLFA 2UUAK 2GWKA 2RE2A 3LM9A 3MN6A 2E5LK 3VQPA 4CBWA 3NDKA 3PV8A 1JXBA 2XHBA 4LF6K 1YUWA 4BC4A 1BCMA 3G4SN 3MWPA 4FJKA 1VQNN 1UOCA 1QSLA 4E1NA 1NK5A 2P9NA 3NGZA 4CJUA 1C0FA 1IKVA 1UA1A 3IG1A 1JL1A 2NRZA 4J2DA 4YOXA 4OGEA 4CJVA 3KJVA 4IKFA 4DSEA 4KV8A 3LPTA 2VGMA 4JKFA 4ZTFA 2D1KA 2Q31A 4E1JA 1T03A 3NHGA 3WQUA 2OZSA 3VF4A 4BRMA 4CZLA 4DTSA 4BACA 3CQXA 5BRHA 1SL2A 2XY7A 2YNFA 2F96A 1ZBLA 3WEEA 1XC3A 3AA2A 2IVOA 2OANA 3CI5A 2O8CB 3DLRA 5EU7A 3P39A 5KRTA 4JAXA 1BIUA 4BQLA 4KHSA 4KFBA 4AH9A 4YOVA 2P9KA 3V9WA 4W5OA 1Q82O 1WAFA 3ATUA 2Q1NA 4DTOA 3WT0A 1L3VA 2ZJRL 4KKOA 4DLGA 4BE1A 4CJWA 3TPQA 1SL1A 4LF8K 3K9JA 4CIFA 3CJBA 1HNIA 1BG3A 4EFHA 1VQ8N 3EO3A 4BR0A 4CJQA 3SMSA 1HLUA 2FBTA 3THWA 3OJSA 5D3GA 3SUQA 4BRIA 1QQNA 5M1OA 2VQFK 4BE0A 3OYEA 3WNEA 1U2VA 4YY3K 4M41A 2XY6A 1R0AA 2IS3A 4B9QA 4OPAA 5ADXA 1W7AA 4FK2A 3TABA 3TSPA 3QEIA 4H0XB 3VETA 2VG5A 3WEEB 1JLEA 4EP5A 1NJIO 1SS6A 2GELA 2QXLA 4JI1K 4AF1A 3VQBA 3J7YP 4FJIA 3NE6A 2WBNA 2AJQA 2P9KB 4B1YB 3OYIA 1D4XA 1YIJN 3W0LA 4JI2K 4KHYA 4B9MA 2HB5A 4ELVA 4N56A 4DTXA 3QEWA 4CGHA 3R3LA 5LL6Z 4Q0BA 5LJWA 2KTQA 1VSHA 3LP2A 1S72N 1K8KA 4NCAA 3QEVA 3I55N 3GDQA 3ZT2A 4GNIA 3NMUA 2O8FA 1JCEA 1U2VB 3OS2A 2ATQA 2QWRA 2V51B 5LMNK 3M3ZA 1J6ZA 4BC5A 2NNWA 4LFAK 3ATVA 1FW6A 3H1VX 4OJRA 3L4QA 4DF8A 4BY9C 1WUAA 3CCEN 3HSCA 1NGIA 1KQSM 1HUXA 3QBXA 2F8TA 3EYZA 1BISA 1WSHA 3V1OA 3HVTA 1HYVA 3V9XA 2ZE2A 3CERA 3MECA 4DV4K 4A2AA 4CEOA 1RTHA 3IDHA 4PY5A 1GOCA 5C12A 4E1MA 4H5TA 2GUPA 4YDUA 3V4IA 1U4BA 1FKPA 5BPNA 1BGXT 1HYSA 4WFBL 4IOXA 3CCUN 3LDSA 4BRHA 4WQ5A 1K8KB 1BQMA 1HQEA 2F7TA
chains in the Genus database with same CATH topology
3CYMA 1LAWA 3H08A 3K2PA 3OYCA 4Z4IA 5J1EA 3V81A 4OGCA 3OYMA 5CY4A 3TAPA 4ICLA 1TL3A 3NCIA 2HHSA 2OZMA 2HHWA 3C95A 2D0BA 4LY7A 2OPQA 2FBVA 2Z1JA 1S1VA 2O4IA 1W0HA 4Z0UA 2YNGA 2P5GA 4O5BA 4CF0A 1IKWA 4DQIA 4CIGA 5HRRA 5I3UA 4CEQA 4H4OA 1KCFA 1X9MA 2LSNA 4DU4A 2ITGA 3AVJA 1YVUA 1BCOA 1VSIA 5SWMA 1WN7A 4E7HA 4CJ5A 3NH0A 4DFMA 3RR8A 1K6YA 3OVNA 4B3OA 1DTQA 2RF2A 1RBVA 1TKXA 1QTMA 3VN5A 4N76A 3VQDA 1JKHA 3P1GA 4CGGA 1S6PA 1RT5A 3ALYA 4DQSA 1TKDA 4FJ8A 2GUIA 3IS9A 3L3VA 4FW1A 5CZ1A 4OPJA 3HJFA 4CK1A 3NF6A 2GBZA 3KLGA 1X1PA 3OYKA 1JLGA 2Z1HA 3NGIA 1HRHA 4FLUA 4CHNA 2Y1JA 2QXFA 3RWUA 3V9SA 3E01A 2E4LA 3F73A 2P51A 4CGJA 4CJLA 4FXDA 3RTVA 2YNIA 3RMAA 4CHPA 2EHGA 1S1UA 5FDLA 3VQ8A 4DTRA 4Z4GA 4HCCA 1B9DA 4DQQA 1Q9XA 3QNNA 3VQEA 4NCBA 3TR8A 4CFCA 3U3YA 4DFJA 1YTUA 4RW4A 4F4KA 3I0RA 5T7BA 5HBMA 2Y1IA 1IH7A 4FJJA 3AA3A 1O1WA 3AV9A 1VSEA 5SZTA 3MEEA 3WNFA 4AHSA 3M8PA 4C8MA 4CEFA 1TK5A 2G8UA 1RT4A 4CK3A 3QESA 4W5RA 4ID5A 4CEEA 3C6UA 3CFPA 4EZ9A 1F21A 2EX3A 4OKKA 4DFKA 2X74A 3K5LA 2BGGA 4FJMA 1VRTA 2YKNA 3ZSYA 3LP0A 4CHYA 1IG9A 3QIOA 3SYZA 1HPZA 5C24A 4KB1A 1KTQA 1J53A 3CG7A 4FVMA 4BWMA 4E0DA 1WLJA 1GOBA 1RNHA 1QS4A 3QLHA 3MAQA 1ZBFA 4DTNA 3SPZA 3DRRA 5DMRA 3DLEA 3TAGA 1S1WA 1CXQA 4JRQA 2ETJA 1J54A 4JS5A 3LPUA 1NJXA 5KI6A 3HT3A 3JYTA 4LH4A 3ZSVA 4CJRA 3V9UA 2HNDA 3G0ZA 4KTZA 1RTDA 2X6NA 3PUFA 4B9UA 3AO5A 4HUEA 4PA1A 3DRPA 4O4GA 4KHQA 4M3YA 4DSIA 2DTUA 3K57A 4RG8A 3LAKA 3MXMA 4AHCA 4RW7A 1NK6A 3NH1A 1HMVA 3T1AA 1FXXA 3K59A 2A1SA 3LANA 4DF4A 4CF9A 1NKCA 3NGYA 1EETA 2E6MA 4OKJA 2HVIA 3AVKA 3CQ8A 2G8IA 4J2BA 4FM1A 4HHTA 4I9QA 2KZZA 1D5AA 3T3FA 3D0PA 4ZTJA 3LAMA 2G8FA 3HPHA 1C0TA 3PO4A 1VSLA 4CHZA 3SUOA 1SV5A 2A1RA 4FJLA 4CEDA 4FLYA 4JRPA 1XWLA 3KIOA 2G8WA 1JLBA 4DSLA 5J2QA 5JS1A 4AHVA 3ITHA 2IAJA 3LALA 4CJEA 4Z4CA 4J2AA 5J2NA 1X9WA 5J2MA 1DLOA 2BE2A 2DFEA 4DQPA 5CYQA 2XY8A 3AA4A 2QKBA 1RDDA 1VRUA 3V9ZA 4M3TA 1D9DA 1WSGA 3LP3A 1CZBA 3OYGA 1WSIA 3ASMA 3O3FA 5KRSA 4KHWA 3P5JA 4W5NA 3K5OA 5HRNA 4G1QA 3OYNA 1BQNA 3OJUA 2DFFA 4IBNA 3ZT0A 1HNVA 1VK0A 1NKBA 4F3TA 3V1RA 2I5JA 2IOCA 5C42A 2JLEA 1T7PA 4B9SA 2F8SA 1S9GA 1TK8A 5KGXA 3AO4A 4OVLA 4Z4HA 4M3WA 4IFYA 5C25A 1QHTA 3VQ9A 3PO5A 4FZXC 4OLBA 3T19A 4W5QA 3TANA 4DS5A 3AVIA 4CFDA 3AVHA 2D5RA 3SPYA 1KFSA 2HHVA 1N5YA 2HNYA 3QEXA 1RILA 1ITGA 2OPPA 1ZYQA 1T8EA 4BDZA 3KLFA 3SCXA 4JLHA 5CZ2A 1UAXA 3VQCA 3SZ2A 3ZSRA 2DFHA 2OPRA 2KZMA 4B8AB 4B08A 4JS4A 3SQ4A 3RMDA 4BDPA 4QOZB 1LW0A 1MU2A 1UWBA 1KFDA 3L2QA 3AVBA 4HTUA 4DS4A 1REVA 3V6DA 3S3OA 3DRSA 3NFAA 1JLAA 2WOMA 3ISNC 2O4GA 1WAJA 2HHTA 3D45A 4OPKA 3NF9A 3SV3A 3QERA 1SKSA 4B9TA 4M3XA 4FJHA 4Z4FA 3DOKA 4RW6A 2PYLA 3VQ5A 3S9HA 3U6FA 3OYJA 3O3HA 4KTWA 1B92A 3CM6A 3VQ6A 3HVRA 1Z26A 1KVCA 2GV9A 1NK4A 4EZ6A 4KTQA 1TAUA 3AVMA 3KK3A 3HSTB 1BIZA 4DTJA 4CK2A 3TAEA 1L3TA 4DG1A 2R7YA 2HHUA 4CGFA 4CJSA 3DLGA 4DU3A 5KGWA 4GMJB 4M3RA 2VG6A 4CF8A 3HK2A 4CGDA 2RN2A 1SL0A 2QKKA 5HLFA 1NJYA 4DWIA 4HCBA 2HNZA 3CFOA 4F2RA 1Q9YA 1VSKA 4E89A 3ZSZA 4CEZA 2B6AA 5I42A 3K5MA 1S1TA 4RW8A 4FM0A 2FBYA 4DQRA 2RKIA 3LP1A 4KHUA 5K14A 4PQUA 1JLCA 4AHUA 1HQUA 3V1QA 3C6TA 4QAGA 4CEAA 4KI4A 3QEPA 4E19A 3DLHA 1NJZA 4HVJA 2PZSA 4AHTA 1HYZA 4CFAA 1ASUA 5J2PA 3QO9A 1U48A 4FZYA 4DLEA 2HVHA 1CLQA 4IG0A 3L2RA 3DOLA 1RBTA 1RBUA 2X6SA 2DY4A 3NAEA 1LWFA 4KAZA 3BGRA 4B9NA 1WSEA 3OYHA 2ZQBA 1JL2A 4FLZA 1BL3A 4NCGA 4OKEA 1WNSA 3ZSWA 4B9LA 4FK4A 3TI0A 5HRSA 3SUPA 1L3UA 4DMNA 1QQCA 3ULDA 1NOYA 4N41A 4KREA 4ID1A 1KLNA 2P5OA 4C8OA 5HRPA 2KQ2A 2D0AA 4IFVA 4CEBA 4E7KA 3MXIA 4OLAA 3HPGA 3HYFA 3AVCA 4BE2A 2B4JA 3M8RA 1IO2A 2G8VA 3I8DA 1ZBUA 4FJNA 4FJ9A 3TARA 2XRIA 3AVNA 4CECA 4LH5A 1L3SA 4KI6A 4HUGA 1XC9A 1ASVA 4CERA 4FK0A 3OYDA 3K58A 4CHOA 1GOAA 3OY9A 1CZ9A 1RBRA 2IGIA 3O3GA 3KKSA 3SQ2A 1ASWA 3TAFA 3ZSXA 1X9SA 1VSFA 4ZHRA 1JLFA 1KVBA 3ZT1A 3HL8A 3SJJA 1C6VA 5KTQA 4FJ5A 3HP9A 3VQPA 3DI6A 4CF2A 3NDKA 1J9AA 2B5JA 3KK2A 3PV8A 1JXBA 4N47A 2XHBA 4BDYA 1RT6A 2YHAA 4KPYA 1BCMA 2D0CA 2PY5A 3HM9A 4FJKA 2Q3SA 4R5PA 1UOCA 1QSLA 4L8RB 4E1NA 4QCLA 4Q5VA 1NK5A 3MEGA 1RT2A 2YHBA 3ZSOA 3NGZA 3KKRA 4CJUA 1T05A 1IKVA 3ZT4A 1UA1A 3B6PA 3IG1A 1JL1A 3VQQA 3KD1E 4M45A 4J2DA 1G15A 4W5TA 4OGEA 3NF8A 3M8SA 4CJVA 3PX4A 2BDPA 3KJVA 1A5WA 4H4MA 1TV6A 3VQAA 4IKFA 4DSEA 4YNQA 4KV8A 1JLQA 1TAQA 1I39A 3LPTA 3PX6A 1C1AA 3RRHA 1N6QA 4ZTFA 3NBPA 1KLMA 3AA5X 3QIPA 4WE1A 4CJKA 1T03A 2WONA 3NHGA 4CGIA 3THVA 1RBSA 1SKRA 4MQ3A 2OZSA 4CIEA 4KO0A 1TKZA 4Y1CA 3NH2A 4DTSA 3F9KA 4CJFA 4BACA 3I0SA 3IRXA 1C0UA 3CFRA 1NK9A 2PYJA 1NK0A 3FFIA 4FW2A 1A5XA 1SL2A 1C0MA 3AVFA 1IKXA 2YNFA 3WNGA 2XY7A 4FJXA 2F96A 4DFPA 1ZBLA 3RR7A 3AA2A 1EP4A 1RDAA 2VWJA 4DTMA 3DLRA 5EU7A 4ELTA 1XI1A 3S3NA 5FROA 2JGUA 3ZT3A 3PX0A 1TKTA 2OYQA 3OS0A 5KRTA 3LWLA 3SUNA 3BDPA 2X78A 4E3SA 1BIUA 2G8HA 4KHSA 4I2PA 3QINA 4KFBA 2W42A 2IDOA 4AH9A 2E6LA 3KLIA 4E7IA 3V9WA 1LWEA 4DU1A 1KSPA 4DSJA 1C1BA 4W5OA 5CYMA 1WAFA 3ZCMA 4B8CA 1KRPA 4J2EA 4AHRA 3OYAA 3KK1A 2ZD1A 4DTOA 2YV0X 1L3VA 4CCHA 4FLVA 2Z1GA 4KKOA 4DLGA 4I2QA 4CJWA 4BE1A 4FLTA 1SL1A 1Y97A 4CIFA 1VSDA 4B9VA 1TK0A 2Z1IA 3KD5E 1HNIA 4E7LA 3RRGA 4M42A 3OYLA 3TAQA 3OYBA 3QNOA 3P83D 4O44A 4CJQA 4FM2A 1J5OA 2FBTA 2QK9A 1WSFA 4AILC 4KB0A 3OJSA 5D3GA 3SUQA 3DYAA 4GVMA 1L5UA 3O4NA 3L8BA 3OYEA 4BE0A 3WNEA 3OYFA 4ELUA 2HMIA 3AVAA 1LAVA 3KTQA 4XIUA 4IG3A 3AVLA 4M41A 1XHXA 1FK9A 2XY6A 1BHLA 3AVGA 1R0AA 2NUBA 4LD0A 1B9FA 2IS3A 4C8NA 3TAMA 4O0IA 2G8KA 4F8RA 4NYNA 3VA3A 3SQ1A 3AO2A 4FK2A 3LZJA 3TABA 1EKEA 3QEIA 2RPIA 1NKEA 4LSNA 2VG5A 4CJPA 1JLEA 3LZIA 1D9FA 4H8KA 4EP5A 3L2UA 3C94A 4Y1DA 3KLHA 1LWCA 3VQBA 4FJIA 5FRMA 1IKYA 4IDKA 3JSMA 4F3OA 4NYFA 1VSJA 1BI4B 3WNHA 3NE6A 1D8YA 3B6OA 3K5NA 4FJGA 2AJQA 1HJRA 1U45A 2HHXA 4TSXA 1RDBA 1Q8IA 3OYIA 3SQ0A 1TVRA 4PWDA 5E41A 1WSJA 1UA0A 4KHYA 4B9MA 2OPSA 4RW9A 3EY1A 2HB5A 4ELVA 2FBXA 2KW4A 3MXJA 3NF7A 4N56A 4N5SA 4DTXA 3QEWA 1ZBHA 4CGHA 4FLWA 2OA8A 4CE9A 3TWHA 2KFZA 4Q0BA 2HW3A 2KTQA 1S6QA 1VSHA 3DLKA 3LP2A 1C1CA 1RTIA 4CFBA 4O55A 3EZ5A 1RDCA 4KHNA 3RMCA 1Z25A 4NCAA 3QEVA 4I7FA 4CJ3A 2FC0A 4E7JA 1YT3A 3VQ4A 3ZT2A 3VA0A 1S1XA 3RMBA 3L2VA 2XO7A 1KVAA 4CJTA 4GW6A 5HROA 3OS2A 2ATQA 2YKMA 3VQ7A 3PY8A 4DSKA 4EP4A 1SKWA 2YNHA 1QE1A 3DM2A 3HXMA 3UIQA 1FKOA 4FJ7A 1QSSA 1RT3A 1TGOA 2BANA 3HPOA 3KLEA 1A5VA 3HP6A 3U3GA 2P1JA 3OS1A 3SNNA 4Z4EA 4KRFA 3AO3A 3DMJA 1RCHA 4OJRA 5JS2A 4DF8A 1NK8A 3O4QA 4F2SA 4FZZA 2XY5A 1ZBIA 1RT1A 3S3MA 1W9HA 4DSFA 2F8TA 4YFUA 1RTJA 3EYZA 1BISA 1WSHA 4K8XA 4K8ZA 1VSMA 2IC3A 1U47A 5FRNA 3V1OA 2KFNA 3HVTA 1HYVA 3ZSQA 3L2WA 4CHQA 3V9XA 1U49A 2ZE2A 4M3ZA 3MECA 1TL1A 1XHZA 4CF1A 4CEOA 1DTTA 1I3AA 1RTHA 1LV5A 1NK7A 2VG7A 4PY5A 4UQGA 3HO1A 1GOCA 4E1MA 4BWJA 3SV4A 3A2FA 4MFBA 2HHQA 3DLBA 3V4IA 1CXUA 5DK5A 5HP1A 1U4BA 1FKPA 1BGXT 1NJWA 1JXEA 3M8QA 1HYSA 4O0JA 3G10A 4DTUA 3AO1A 1NOZA 3MEDA 4PUOA 4FYDA 1LW2A 4DTPA 1SUQA 2VWKA 4C8LA 3LDSA 1S5JA 4LSLA 3LWMA 4FCYA 4C8KA 1QSYA 4I9LA 3L3UA 3IAYA 3SI6A 1BI4A 1EX4A 1U04A 4CJ4A 1RT7A 4FLXA 1BQMA 1EXQA 1YTAA 1HQEA 3CM5A 4CESA 4HUFA 3QETA 4M3UA 1S9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYM A;  1LAW A;  3H08 A;  3K2P A;  3OYC A;  4Z4I A;  5J1E A;  3V81 A;  4OGC A;  3OYM A;  5CY4 A;  3TAP A;  4ICL A;  1TL3 A;  3NCI A;  2HHS A;  2OZM A;  2HHW A;  3C95 A;  2D0B A;  4LY7 A;  2OPQ A;  2FBV A;  2Z1J A;  1S1V A;  2O4I A;  1W0H A;  4Z0U A;  2YNG A;  2P5G A;  4O5B A;  4CF0 A;  1IKW A;  4DQI A;  4CIG A;  5HRR A;  5I3U A;  4CEQ A;  4H4O A;  1KCF A;  1X9M A;  2LSN A;  4DU4 A;  2ITG A;  3AVJ A;  1YVU A;  1BCO A;  1VSI A;  5SWM A;  1WN7 A;  4E7H A;  4CJ5 A;  3NH0 A;  4DFM A;  3RR8 A;  1K6Y A;  3OVN A;  4B3O A;  1DTQ A;  2RF2 A;  1RBV A;  1TKX A;  1QTM A;  3VN5 A;  4N76 A;  3VQD A;  1JKH A;  3P1G A;  4CGG A;  1S6P A;  1RT5 A;  3ALY A;  4DQS A;  1TKD A;  4FJ8 A;  2GUI A;  3IS9 A;  3L3V A;  4FW1 A;  5CZ1 A;  4OPJ A;  3HJF A;  4CK1 A;  3NF6 A;  2GBZ A;  3KLG A;  1X1P A;  3OYK A;  1JLG A;  2Z1H A;  3NGI A;  1HRH A;  4FLU A;  4CHN A;  2Y1J A;  2QXF A;  3RWU A;  3V9S A;  3E01 A;  2E4L A;  3F73 A;  2P51 A;  4CGJ A;  4CJL A;  4FXD A;  3RTV A;  2YNI A;  3RMA A;  4CHP A;  2EHG A;  1S1U A;  5FDL A;  3VQ8 A;  4DTR A;  4Z4G A;  4HCC A;  1B9D A;  4DQQ A;  1Q9X A;  3QNN A;  3VQE A;  4NCB A;  3TR8 A;  4CFC A;  3U3Y A;  4DFJ A;  1YTU A;  4RW4 A;  4F4K A;  3I0R A;  5T7B A;  5HBM A;  2Y1I A;  1IH7 A;  4FJJ A;  3AA3 A;  1O1W A;  3AV9 A;  1VSE A;  5SZT A;  3MEE A;  3WNF A;  4AHS A;  3M8P A;  4C8M A;  4CEF A;  1TK5 A;  2G8U A;  1RT4 A;  4CK3 A;  3QES A;  4W5R A;  4ID5 A;  4CEE A;  3C6U A;  3CFP A;  4EZ9 A;  1F21 A;  2EX3 A;  4OKK A;  4DFK A;  2X74 A;  3K5L A;  2BGG A;  4FJM A;  1VRT A;  2YKN A;  3ZSY A;  3LP0 A;  4CHY A;  1IG9 A;  3QIO A;  3SYZ A;  1HPZ A;  5C24 A;  4KB1 A;  1KTQ A;  1J53 A;  3CG7 A;  4FVM A;  4BWM A;  4E0D A;  1WLJ A;  1GOB A;  1RNH A;  1QS4 A;  3QLH A;  3MAQ A;  1ZBF A;  4DTN A;  3SPZ A;  3DRR A;  5DMR A;  3DLE A;  3TAG A;  1S1W A;  1CXQ A;  4JRQ A;  2ETJ A;  1J54 A;  4JS5 A;  3LPU A;  1NJX A;  5KI6 A;  3HT3 A;  3JYT A;  4LH4 A;  3ZSV A;  4CJR A;  3V9U A;  2HND A;  3G0Z A;  4KTZ A;  1RTD A;  2X6N A;  3PUF A;  4B9U A;  3AO5 A;  4HUE A;  4PA1 A;  3DRP A;  4O4G A;  4KHQ A;  4M3Y A;  4DSI A;  2DTU A;  3K57 A;  4RG8 A;  3LAK A;  3MXM A;  4AHC A;  4RW7 A;  1NK6 A;  3NH1 A;  1HMV A;  3T1A A;  1FXX A;  3K59 A;  2A1S A;  3LAN A;  4DF4 A;  4CF9 A;  1NKC A;  3NGY A;  1EET A;  2E6M A;  4OKJ A;  2HVI A;  3AVK A;  3CQ8 A;  2G8I A;  4J2B A;  4FM1 A;  4HHT A;  4I9Q A;  2KZZ A;  1D5A A;  3T3F A;  3D0P A;  4ZTJ A;  3LAM A;  2G8F A;  3HPH A;  1C0T A;  3PO4 A;  1VSL A;  4CHZ A;  3SUO A;  1SV5 A;  2A1R A;  4FJL A;  4CED A;  4FLY A;  4JRP A;  1XWL A;  3KIO A;  2G8W A;  1JLB A;  4DSL A;  5J2Q A;  5JS1 A;  4AHV A;  3ITH A;  2IAJ A;  3LAL A;  4CJE A;  4Z4C A;  4J2A A;  5J2N A;  1X9W A;  5J2M A;  1DLO A;  2BE2 A;  2DFE A;  4DQP A;  5CYQ A;  2XY8 A;  3AA4 A;  2QKB A;  1RDD A;  1VRU A;  3V9Z A;  4M3T A;  1D9D A;  1WSG A;  3LP3 A;  1CZB A;  3OYG A;  1WSI A;  3ASM A;  3O3F A;  5KRS A;  4KHW A;  3P5J A;  4W5N A;  3K5O A;  5HRN A;  4G1Q A;  3OYN A;  1BQN A;  3OJU A;  2DFF A;  4IBN A;  3ZT0 A;  1HNV A;  1VK0 A;  1NKB A;  4F3T A;  3V1R A;  2I5J A;  2IOC A;  5C42 A;  2JLE A;  1T7P A;  4B9S A;  2F8S A;  1S9G A;  1TK8 A;  5KGX A;  3AO4 A;  4OVL A;  4Z4H A;  4M3W A;  4IFY A;  5C25 A;  1QHT A;  3VQ9 A;  3PO5 A;  4FZX C;  4OLB A;  3T19 A;  4W5Q A;  3TAN A;  4DS5 A;  3AVI A;  4CFD A;  3AVH A;  2D5R A;  3SPY A;  1KFS A;  2HHV A;  1N5Y A;  2HNY A;  3QEX A;  1RIL A;  1ITG A;  2OPP A;  1ZYQ A;  1T8E A;  4BDZ A;  3KLF A;  3SCX A;  4JLH A;  5CZ2 A;  1UAX A;  3VQC A;  3SZ2 A;  3ZSR A;  2DFH A;  2OPR A;  2KZM A;  4B8A B;  4B08 A;  4JS4 A;  3SQ4 A;  3RMD A;  4BDP A;  4QOZ B;  1LW0 A;  1MU2 A;  1UWB A;  1KFD A;  3L2Q A;  3AVB A;  4HTU A;  4DS4 A;  1REV A;  3V6D A;  3S3O A;  3DRS A;  3NFA A;  1JLA A;  2WOM A;  3ISN C;  2O4G A;  1WAJ A;  2HHT A;  3D45 A;  4OPK A;  3NF9 A;  3SV3 A;  3QER A;  1SKS A;  4B9T A;  4M3X A;  4FJH A;  4Z4F A;  3DOK A;  4RW6 A;  2PYL A;  3VQ5 A;  3S9H A;  3U6F A;  3OYJ A;  3O3H A;  4KTW A;  1B92 A;  3CM6 A;  3VQ6 A;  3HVR A;  1Z26 A;  1KVC A;  2GV9 A;  1NK4 A;  4EZ6 A;  4KTQ A;  1TAU A;  3AVM A;  3KK3 A;  3HST B;  1BIZ A;  4DTJ A;  4CK2 A;  3TAE A;  1L3T A;  4DG1 A;  2R7Y A;  2HHU A;  4CGF A;  4CJS A;  3DLG A;  4DU3 A;  5KGW A;  4GMJ B;  4M3R A;  2VG6 A;  4CF8 A;  3HK2 A;  4CGD A;  2RN2 A;  1SL0 A;  2QKK A;  5HLF A;  1NJY A;  4DWI A;  4HCB A;  2HNZ A;  3CFO A;  4F2R A;  1Q9Y A;  1VSK A;  4E89 A;  3ZSZ A;  4CEZ A;  2B6A A;  5I42 A;  3K5M A;  1S1T A;  4RW8 A;  4FM0 A;  2FBY A;  4DQR A;  2RKI A;  3LP1 A;  4KHU A;  5K14 A;  4PQU A;  1JLC A;  4AHU A;  1HQU A;  3V1Q A;  3C6T A;  4QAG A;  4CEA A;  4KI4 A;  3QEP A;  4E19 A;  3DLH A;  1NJZ A;  4HVJ A;  2PZS A;  4AHT A;  1HYZ A;  4CFA A;  1ASU A;  5J2P A;  3QO9 A;  1U48 A;  4FZY A;  4DLE A;  2HVH A;  1CLQ A;  4IG0 A;  3L2R A;  3DOL A;  1RBT A;  1RBU A;  2X6S A;  2DY4 A;  3NAE A;  1LWF A;  4KAZ A;  3BGR A;  4B9N A;  1WSE A;  3OYH A;  2ZQB A;  1JL2 A;  4FLZ A;  1BL3 A;  4NCG A;  4OKE A;  1WNS A;  3ZSW A;  4B9L A;  4FK4 A;  3TI0 A;  5HRS A;  3SUP A;  1L3U A;  4DMN A;  1QQC A;  3ULD A;  1NOY A;  4N41 A;  4KRE A;  4ID1 A;  1KLN A;  2P5O A;  4C8O A;  5HRP A;  2KQ2 A;  2D0A A;  4IFV A;  4CEB A;  4E7K A;  3MXI A;  4OLA A;  3HPG A;  3HYF A;  3AVC A;  4BE2 A;  2B4J A;  3M8R A;  1IO2 A;  2G8V A;  3I8D A;  1ZBU A;  4FJN A;  4FJ9 A;  3TAR A;  2XRI A;  3AVN A;  4CEC A;  4LH5 A;  1L3S A;  4KI6 A;  4HUG A;  1XC9 A;  1ASV A;  4CER A;  4FK0 A;  3OYD A;  3K58 A;  4CHO A;  1GOA A;  3OY9 A;  1CZ9 A;  1RBR A;  2IGI A;  3O3G A;  3KKS A;  3SQ2 A;  1ASW A;  3TAF A;  3ZSX A;  1X9S A;  1VSF A;  4ZHR A;  1JLF A;  1KVB A;  3ZT1 A;  3HL8 A;  3SJJ A;  1C6V A;  5KTQ A;  4FJ5 A;  3HP9 A;  3VQP A;  3DI6 A;  4CF2 A;  3NDK A;  1J9A A;  2B5J A;  3KK2 A;  3PV8 A;  1JXB A;  4N47 A;  2XHB A;  4BDY A;  1RT6 A;  2YHA A;  4KPY A;  1BCM A;  2D0C A;  2PY5 A;  3HM9 A;  4FJK A;  2Q3S A;  4R5P A;  1UOC A;  1QSL A;  4L8R B;  4E1N A;  4QCL A;  4Q5V A;  1NK5 A;  3MEG A;  1RT2 A;  2YHB A;  3ZSO A;  3NGZ A;  3KKR A;  4CJU A;  1T05 A;  1IKV A;  3ZT4 A;  1UA1 A;  3B6P A;  3IG1 A;  1JL1 A;  3VQQ A;  3KD1 E;  4M45 A;  4J2D A;  1G15 A;  4W5T A;  4OGE A;  3NF8 A;  3M8S A;  4CJV A;  3PX4 A;  2BDP A;  3KJV A;  1A5W A;  4H4M A;  1TV6 A;  3VQA A;  4IKF A;  4DSE A;  4YNQ A;  4KV8 A;  1JLQ A;  1TAQ A;  1I39 A;  3LPT A;  3PX6 A;  1C1A A;  3RRH A;  1N6Q A;  4ZTF A;  3NBP A;  1KLM A;  3AA5 X;  3QIP A;  4WE1 A;  4CJK A;  1T03 A;  2WON A;  3NHG A;  4CGI A;  3THV A;  1RBS A;  1SKR A;  4MQ3 A;  2OZS A;  4CIE A;  4KO0 A;  1TKZ A;  4Y1C A;  3NH2 A;  4DTS A;  3F9K A;  4CJF A;  4BAC A;  3I0S A;  3IRX A;  1C0U A;  3CFR A;  1NK9 A;  2PYJ A;  1NK0 A;  3FFI A;  4FW2 A;  1A5X A;  1SL2 A;  1C0M A;  3AVF A;  1IKX A;  2YNF A;  3WNG A;  2XY7 A;  4FJX A;  2F96 A;  4DFP A;  1ZBL A;  3RR7 A;  3AA2 A;  1EP4 A;  1RDA A;  2VWJ A;  4DTM A;  3DLR A;  5EU7 A;  4ELT A;  1XI1 A;  3S3N A;  5FRO A;  2JGU A;  3ZT3 A;  3PX0 A;  1TKT A;  2OYQ A;  3OS0 A;  5KRT A;  3LWL A;  3SUN A;  3BDP A;  2X78 A;  4E3S A;  1BIU A;  2G8H A;  4KHS A;  4I2P A;  3QIN A;  4KFB A;  2W42 A;  2IDO A;  4AH9 A;  2E6L A;  3KLI A;  4E7I A;  3V9W A;  1LWE A;  4DU1 A;  1KSP A;  4DSJ A;  1C1B A;  4W5O A;  5CYM A;  1WAF A;  3ZCM A;  4B8C A;  1KRP A;  4J2E A;  4AHR A;  3OYA A;  3KK1 A;  2ZD1 A;  4DTO A;  2YV0 X;  1L3V A;  4CCH A;  4FLV A;  2Z1G A;  4KKO A;  4DLG A;  4I2Q A;  4CJW A;  4BE1 A;  4FLT A;  1SL1 A;  1Y97 A;  4CIF A;  1VSD A;  4B9V A;  1TK0 A;  2Z1I A;  3KD5 E;  1HNI A;  4E7L A;  3RRG A;  4M42 A;  3OYL A;  3TAQ A;  3OYB A;  3QNO A;  3P83 D;  4O44 A;  4CJQ A;  4FM2 A;  1J5O A;  2FBT A;  2QK9 A;  1WSF A;  4AIL C;  4KB0 A;  3OJS A;  5D3G A;  3SUQ A;  3DYA A;  4GVM A;  1L5U A;  3O4N A;  3L8B A;  3OYE A;  4BE0 A;  3WNE A;  3OYF A;  4ELU A;  2HMI A;  3AVA A;  1LAV A;  3KTQ A;  4XIU A;  4IG3 A;  3AVL A;  4M41 A;  1XHX A;  1FK9 A;  2XY6 A;  1BHL A;  3AVG A;  1R0A A;  2NUB A;  4LD0 A;  1B9F A;  2IS3 A;  4C8N A;  3TAM A;  4O0I A;  2G8K A;  4F8R A;  4NYN A;  3VA3 A;  3SQ1 A;  3AO2 A;  4FK2 A;  3LZJ A;  3TAB A;  1EKE A;  3QEI A;  2RPI A;  1NKE A;  4LSN A;  2VG5 A;  4CJP A;  1JLE A;  3LZI A;  1D9F A;  4H8K A;  4EP5 A;  3L2U A;  3C94 A;  4Y1D A;  3KLH A;  1LWC A;  3VQB A;  4FJI A;  5FRM A;  1IKY A;  4IDK A;  3JSM A;  4F3O A;  4NYF A;  1VSJ A;  1BI4 B;  3WNH A;  3NE6 A;  1D8Y A;  3B6O A;  3K5N A;  4FJG A;  2AJQ A;  1HJR A;  1U45 A;  2HHX A;  4TSX A;  1RDB A;  1Q8I A;  3OYI A;  3SQ0 A;  1TVR A;  4PWD A;  5E41 A;  1WSJ A;  1UA0 A;  4KHY A;  4B9M A;  2OPS A;  4RW9 A;  3EY1 A;  2HB5 A;  4ELV A;  2FBX A;  2KW4 A;  3MXJ A;  3NF7 A;  4N56 A;  4N5S A;  4DTX A;  3QEW A;  1ZBH A;  4CGH A;  4FLW A;  2OA8 A;  4CE9 A;  3TWH A;  2KFZ A;  4Q0B A;  2HW3 A;  2KTQ A;  1S6Q A;  1VSH A;  3DLK A;  3LP2 A;  1C1C A;  1RTI A;  4CFB A;  4O55 A;  3EZ5 A;  1RDC A;  4KHN A;  3RMC A;  1Z25 A;  4NCA A;  3QEV A;  4I7F A;  4CJ3 A;  2FC0 A;  4E7J A;  1YT3 A;  3VQ4 A;  3ZT2 A;  3VA0 A;  1S1X A;  3RMB A;  3L2V A;  2XO7 A;  1KVA A;  4CJT A;  4GW6 A;  5HRO A;  3OS2 A;  2ATQ A;  2YKM A;  3VQ7 A;  3PY8 A;  4DSK A;  4EP4 A;  1SKW A;  2YNH A;  1QE1 A;  3DM2 A;  3HXM A;  3UIQ A;  1FKO A;  4FJ7 A;  1QSS A;  1RT3 A;  1TGO A;  2BAN A;  3HPO A;  3KLE A;  1A5V A;  3HP6 A;  3U3G A;  2P1J A;  3OS1 A;  3SNN A;  4Z4E A;  4KRF A;  3AO3 A;  3DMJ A;  1RCH A;  4OJR A;  5JS2 A;  4DF8 A;  1NK8 A;  3O4Q A;  4F2S A;  4FZZ A;  2XY5 A;  1ZBI A;  1RT1 A;  3S3M A;  1W9H A;  4DSF A;  2F8T A;  4YFU A;  1RTJ A;  3EYZ A;  1BIS A;  1WSH A;  4K8X A;  4K8Z A;  1VSM A;  2IC3 A;  1U47 A;  5FRN A;  3V1O A;  2KFN A;  3HVT A;  1HYV A;  3ZSQ A;  3L2W A;  4CHQ A;  3V9X A;  1U49 A;  2ZE2 A;  4M3Z A;  3MEC A;  1TL1 A;  1XHZ A;  4CF1 A;  4CEO A;  1DTT A;  1I3A A;  1RTH A;  1LV5 A;  1NK7 A;  2VG7 A;  4PY5 A;  4UQG A;  3HO1 A;  1GOC A;  4E1M A;  4BWJ A;  3SV4 A;  3A2F A;  4MFB A;  2HHQ A;  3DLB A;  3V4I A;  1CXU A;  5DK5 A;  5HP1 A;  1U4B A;  1FKP A;  1BGX T;  1NJW A;  1JXE A;  3M8Q A;  1HYS A;  4O0J A;  3G10 A;  4DTU A;  3AO1 A;  1NOZ A;  3MED A;  4PUO A;  4FYD A;  1LW2 A;  4DTP A;  1SUQ A;  2VWK A;  4C8L A;  3LDS A;  1S5J A;  4LSL A;  3LWM A;  4FCY A;  4C8K A;  1QSY A;  4I9L A;  3L3U A;  3IAY A;  3SI6 A;  1BI4 A;  1EX4 A;  1U04 A;  4CJ4 A;  1RT7 A;  4FLX A;  1BQM A;  1EXQ A;  1YTA A;  1HQE A;  3CM5 A;  4CES A;  4HUF A;  3QET A;  4M3U A;  1S9E A; 
#chains in the Genus database with same CATH topology
 4CZF A;  4IJN A;  3H08 A;  3OYC A;  2QW9 A;  4Z4I A;  3PSI A;  2O8F B;  3EE8 A;  3NCI A;  3OBW A;  2OPQ A;  2FBV A;  3ZLJ A;  3CJ7 A;  4NXM K;  3T1Y K;  2O4I A;  1W0H A;  4Z0U A;  2P5G A;  4U67 L;  4CF0 A;  5I3U A;  5HRR A;  4CEQ A;  1QHA A;  5JIC A;  2ITG A;  2BTF A;  1VSI A;  1WN7 A;  3VN5 A;  3VQD A;  4CGG A;  3BP8 A;  4O8U A;  1XMO K;  1TKD A;  4OPJ A;  5CZ1 A;  3EE9 A;  3NF6 A;  4MDB A;  4DUZ K;  1X1P A;  5JMV A;  3EN9 A;  2D0O A;  3T69 A;  4CHN A;  2Y1J A;  4LC9 B;  4H0Y B;  4CGJ A;  3O5B A;  4M7X A;  4WYB A;  4DTR A;  3T7Z A;  1B9D A;  4NCB A;  3AAR A;  1ESV A;  5AQM A;  4DFJ A;  4AM7 A;  4DHY A;  3I0R A;  3L6Q A;  4FJJ A;  1VSE A;  2F9W A;  3C6H A;  1HKG A;  3OHR A;  4C8M A;  3BF3 A;  2W40 A;  3CFP A;  3C6U A;  3G71 N;  1NGH A;  5AQL A;  4OKK A;  2X74 A;  3K5L A;  3LP0 A;  5AQT A;  1RDW X;  4E0D A;  4B1Z A;  3LDL A;  1I94 K;  2QA4 N;  3QLH A;  4DTN A;  1Q18 A;  3R1X A;  4A57 A;  3DLE A;  3QIC A;  2ETJ A;  1NGC A;  3LPU A;  5C2F A;  1NJX A;  3JYT A;  2YI1 A;  4KTZ A;  2X6N A;  1QQO A;  4HUE A;  2WC9 A;  3F9M A;  1GLJ O;  4FVU A;  4RG8 A;  1NK6 A;  4CZE A;  3T1A A;  1FXX A;  1XMQ K;  2A1S A;  4CZI A;  3LAN A;  4DF4 A;  4GV3 A;  5AQY A;  1NKC A;  4ISE A;  1EET A;  4OKJ A;  5AR0 A;  3AVK A;  3CQ8 A;  2G8I A;  2HVI A;  5AQO A;  4FM1 A;  4HHT A;  4J2B A;  4B3R K;  4I9Q A;  3D0P A;  3LAM A;  4XEI A;  1VSL A;  3C7N A;  1WBB A;  4FJL A;  2G8W A;  4JI8 K;  3TSU A;  2OCE A;  4MO4 A;  5J2Q A;  5CE3 A;  4MLE A;  4DUY K;  1VQK N;  1DLO A;  2BE2 A;  4DQP A;  4U7B A;  2JWL A;  4M3T A;  4FOE A;  3J8A A;  4W5N A;  3OYG A;  5KRS A;  5BRF A;  4KHW A;  5AFU A;  1YAG A;  1EQY A;  4YHH K;  3V1R A;  4PKG A;  2HBJ A;  4FOI A;  4RTF D;  3JAM O;  5C42 A;  4FWK A;  4A5B A;  1V4S A;  4OLB A;  5KPR A;  4W5Q A;  4DS5 A;  4CFD A;  2D5R A;  4YDU C;  4K25 A;  1ZYQ A;  1T8E A;  4BDZ A;  3VTI A;  4ILH A;  1K73 O;  2OPR A;  3VEY A;  4QOZ B;  1Q7Y O;  4DV3 K;  1OH7 A;  3DRS A;  4WCE L;  3ISN C;  2O4G A;  4H03 B;  2HHT A;  3NF9 A;  3DOK A;  4CJ7 A;  3C7N B;  1IBK K;  4BRK A;  1SZ2 A;  1E3M A;  4HTL A;  4EZ6 A;  3AVM A;  3KK3 A;  3HST B;  1BIZ A;  1L3T A;  1NGD A;  4BR7 A;  2R7Y A;  5BRD A;  3QDK A;  4I6M A;  4DU3 A;  4BRO A;  4CBU A;  2QEX N;  2QKK A;  4HCB A;  4DWI A;  1Q9Y A;  4CEZ A;  2PFU A;  2B6A A;  3M5R A;  4JK7 A;  1S1T A;  5I42 A;  2FBY A;  4KHU A;  5K14 A;  3U4L A;  4CEA A;  4CI6 A;  1T6C A;  4KBO A;  1HYZ A;  5J2P A;  4FZY A;  1RBT A;  5C10 A;  2DY4 A;  1E4F T;  4OKE A;  3TI0 A;  5HRS A;  3ULD A;  1QVF M;  2P5O A;  5HRP A;  2KQ2 A;  4E7K A;  3VOV A;  2CGJ A;  4OLA A;  1ZBS A;  1KC8 O;  4PL8 A;  2QWL A;  4LH5 A;  3ENB A;  5AQU A;  4CER A;  2V7Y A;  1CZ9 A;  1C0G A;  4B3T K;  1RBR A;  2IGI A;  4I6M B;  4LFB K;  1KVB A;  3ZT1 A;  3HL8 A;  3CC7 N;  3SJJ A;  5KTQ A;  4B3M K;  4CF2 A;  3EL2 A;  1J9A A;  3KK2 A;  2PY5 A;  2Q3S A;  4DR6 K;  3KKR A;  1T05 A;  3B6P A;  3L4I A;  4BRC A;  2ZGY A;  3KD1 E;  1IJJ A;  1BDG A;  4W5T A;  2UYT A;  3PX4 A;  4FWP A;  4H4M A;  3VQA A;  4LF4 K;  4YNQ A;  1TAQ A;  1C1A A;  3VEZ A;  3RRH A;  5AQV A;  3H46 O;  3NBP A;  1N6Q A;  3CPE A;  4JNE A;  3THV A;  1SKR A;  2UXD K;  1KXP A;  3CHW A;  4CIE A;  1TKZ A;  4Y1C A;  5AQI A;  3CFR A;  1NK9 A;  2PYJ A;  3OTO K;  1NK0 A;  5C0Y A;  4KHP K;  1A5X A;  1C0M A;  1IKX A;  3RR7 A;  3WXL A;  5M1K A;  5M1Q A;  3SBG A;  2VWJ A;  1XI1 A;  3ZT3 A;  1TKT A;  4RCH A;  4LF7 K;  5AQW A;  2D0P A;  3SUN A;  3BDP A;  2IVP A;  3VEX A;  2IIR A;  4I2P A;  3QIN A;  3KLI A;  4E7I A;  4B8C A;  1BO5 O;  4AHR A;  3C0B A;  5AQN A;  4FLT A;  1T3V A;  1IG8 A;  3LDN A;  3WQT A;  3IMX A;  1VSD A;  4B9V A;  2IVN A;  2Z1I A;  3N4P A;  3U9D A;  3RRG A;  3OYL A;  3P83 D;  4O44 A;  4GV9 A;  2QK9 A;  4PL7 A;  4MDA A;  1OH5 A;  4GVM A;  3O4N A;  1YJ9 N;  4CZG A;  3DWL A;  1RFQ A;  3AVG A;  2NUB A;  3BZK A;  4O0I A;  4F8R A;  3VGM A;  3AGK A;  1BA0 A;  1D9F A;  3HBT A;  3Q7B A;  4H8K A;  2E1Y A;  3KLH A;  5FRM A;  5C2D A;  4IDK A;  4YOW A;  3VGL A;  3HM8 A;  4NYF A;  1D8Y A;  1BI4 B;  3MN9 A;  1QZ6 A;  1U45 A;  2HHX A;  4TSX A;  1RDB A;  4FSV A;  1TVR A;  4A5A A;  1UA0 A;  2OPS A;  3EY1 A;  3NF7 A;  3F2K A;  4C23 A;  1HNX K;  4FLW A;  2OA8 A;  2O8C A;  2HW3 A;  4JKB A;  2O8B B;  3DLK A;  4WQ4 A;  4X65 K;  3VGK A;  1C1C A;  3CJ1 A;  4CFB A;  2WTU A;  4O55 A;  1U6Z A;  1Z25 A;  3RMC A;  4I7F A;  2P9I A;  2FC0 A;  4E7J A;  1YT3 A;  4JKC A;  1S1X A;  3I33 A;  4OPH A;  1X3N A;  1RGI A;  3E9L A;  4GW6 A;  5HRO A;  3C65 A;  1QE1 A;  3DM2 A;  2OTJ N;  3UIQ A;  3ZX3 A;  2BAN A;  4IXC A;  3SJH A;  5GAG P;  3OS1 A;  3FZF A;  3O8M A;  1NK8 A;  4EAH D;  4FZZ A;  2QI2 A;  4BR5 A;  4YFU A;  3CCR N;  2KFN A;  3MX2 A;  1BOT O;  3ZSQ A;  2QWN A;  1U49 A;  4CF1 A;  1VQ9 N;  2QWO A;  4UQG A;  1XUP O;  4MFB A;  3DLB A;  5DK5 A;  1JXE A;  2W41 A;  4DTU A;  3G10 A;  3AO1 A;  3MED A;  4FYD A;  1JCF A;  4GV6 A;  1S22 A;  1S5J A;  5AZJ A;  3QML A;  4FCY A;  3OW2 M;  2GX9 A;  4I9L A;  3G6E N;  2FLO A;  4FLX A;  1MWK A;  1U04 A;  1RT7 A;  4M3U A;  3CM5 A;  1S9E A;  1ZXO A;  3GG4 A;  2P9I B;  1LAW A;  3K2P A;  1NGB A;  3V81 A;  4OGC A;  3OYM A;  4FPB A;  1YJW N;  5TKY A;  3TAP A;  2HHW A;  2OZM A;  4XH1 A;  2D0B A;  2NRX A;  4XH4 A;  4ILJ A;  1YI2 N;  1S1V A;  2YNG A;  3U8X A;  1IKW A;  4YOU A;  3AVJ A;  5BPL A;  1BCO A;  4E7H A;  4DFM A;  3CC2 N;  4CJ5 A;  3E9P A;  3CPW M;  1DTQ A;  2RF2 A;  4EHU A;  3FFK B;  4CVN E;  1S6P A;  4DQS A;  3L3V A;  4FW1 A;  4CK1 A;  1NMN A;  1IV0 A;  3CET A;  3NGI A;  2GEM A;  3D2E A;  3RWU A;  3V9S A;  3E01 A;  2E4L A;  4CJL A;  3GL1 A;  5AZJ B;  5FDL A;  1S1U A;  4UY8 O;  2FSK A;  1WOQ A;  1Q9X A;  4BVP A;  4RW4 A;  4F4K A;  4GKK K;  1V4T A;  3AV9 A;  3QFP A;  5SZT A;  3MEE A;  4J8F A;  4AHS A;  1TK5 A;  4CK3 A;  3HTV A;  3TU5 A;  3S41 A;  1F21 A;  4BGB A;  2BGG A;  3IKM A;  3JS6 A;  2YKN A;  4KB1 A;  1KTQ A;  3K9K A;  1NBW A;  5F2R A;  4FVM A;  4WFA L;  1WLJ A;  3MAQ A;  1QS4 A;  2CH6 A;  3TAG A;  1S1W A;  1J54 A;  5DM6 L;  2A42 A;  4JKG A;  5KI6 A;  2HND A;  4JD2 A;  3FE1 A;  4MLH A;  2DTU A;  5KQ8 A;  4KHQ A;  4DSI A;  4FWQ A;  3MXM A;  1HMV A;  3CQY A;  4WQ4 C;  4DV7 K;  3K59 A;  1KD1 O;  3D2E B;  2E6M A;  3IUC A;  5HOO A;  4H0P A;  4JKH A;  3HPH A;  2G8F A;  3PO4 A;  3SUO A;  1ATR A;  4FLY A;  1JLB A;  4DSL A;  5JS1 A;  4JI6 K;  4CJE A;  3LAL A;  5AQP A;  2XY8 A;  3AA4 A;  1VRU A;  2J4R A;  1WSG A;  2ITM A;  2F4V K;  4QS7 A;  5HRN A;  3OYN A;  5AQQ A;  3UE5 A;  1M1K O;  3BZC A;  1T7P A;  2JLE A;  4CZH A;  1TK8 A;  4Z4H A;  4IFY A;  5IWA K;  3VQ9 A;  3BY5 A;  3E66 A;  3SAG A;  1RIL A;  4JKG B;  2ZF5 O;  4H0V B;  5AQH A;  5CZ2 A;  4JD2 B;  4DV6 K;  4M63 C;  2KZM A;  4B8A B;  3SQ4 A;  1MU2 A;  4YOT A;  1KFD A;  3L2Q A;  3V6D A;  1REV A;  3FZL A;  3NFA A;  3KZB A;  3P38 A;  4BR9 A;  4FJH A;  2H3G X;  3U6F A;  4JKD A;  4KH5 A;  3CME N;  3ENO A;  4B3S K;  3CM6 A;  3VQ6 A;  2YX6 A;  3HVR A;  3TTD A;  2VCP A;  4DTJ A;  3TAE A;  2DPN A;  4DG1 A;  4CJS A;  4GVE A;  4H5V A;  2VG6 A;  3CCL N;  2AA4 A;  3DXM A;  5HLF A;  3O9S A;  3J81 O;  3H3O B;  5AQF A;  4BGA A;  3BEX A;  3O9U A;  2RKI A;  2A6A A;  2UXB K;  4IZ9 A;  3V1Q A;  3C6T A;  4QAG A;  4KI4 A;  3VPZ A;  1NJZ A;  4AHT A;  3SAH A;  3QO9 A;  4DLE A;  5KPT A;  1CLQ A;  4IG0 A;  3DOL A;  3CCJ N;  1LWF A;  3MWT A;  3OYH A;  1JL2 A;  1BA1 A;  4FLZ A;  1BL3 A;  3ZSW A;  4B9L A;  4BC2 A;  1L3U A;  1NOY A;  3QBW A;  2FF3 B;  3CJA A;  4KRE A;  2P9L A;  1WB9 A;  1KLN A;  3LM2 A;  3MXI A;  1CZA N;  3HPG A;  3VEV A;  4BE2 A;  1NG9 A;  1P8Z A;  3M1F A;  2XRI A;  3AVN A;  4CEC A;  3CJC A;  4CHO A;  3OY9 A;  1BUP A;  3FZH A;  3O3G A;  1YIT N;  3TAF A;  3ZSX A;  1X9S A;  3CCV N;  1N8R O;  1R59 O;  3DXM B;  2Q97 A;  2V7Z A;  3DI6 A;  5M1F A;  4DKW A;  2UUC K;  2YHA A;  3H6E A;  4KPY A;  1IBM K;  3HM9 A;  4R5P A;  4JK9 A;  2YJE A;  5F1X A;  3MEG A;  3AGR A;  3CCM N;  3KWG A;  3FLC O;  4BR2 A;  3VQQ A;  4M45 A;  1VQL N;  1G15 A;  4OO1 J;  4FWS A;  5AQK A;  5GAD P;  3NF8 A;  1JCG A;  3M8S A;  1ZC6 A;  2BDP A;  1A5W A;  1TV6 A;  1T44 A;  4BQZ A;  4BG8 A;  4CJK A;  3AA5 X;  4WE1 A;  4PKH A;  1TUU A;  3O6W A;  3PSF A;  4KO0 A;  2P9L B;  4CJF A;  2HHH K;  3I0S A;  3IRX A;  1C0U A;  3FFI A;  4IOC L;  3THX A;  1GLB G;  4FJX A;  4JK8 A;  5BPM A;  3QFU A;  2W6K A;  5KPZ A;  1EP4 A;  4AM6 A;  5FPN A;  4ELT A;  5JLH A;  4JKA A;  1MDU B;  3KHY A;  2NRH A;  3WXM B;  4IDH A;  2GTD A;  2X78 A;  2G8H A;  4IWV A;  2E6L A;  2Q36 A;  4BRL A;  3HI0 A;  4DV1 K;  1DKG D;  1LWE A;  4DU1 A;  1KSP A;  3ZCM A;  1KRP A;  3OYA A;  2YV0 X;  5GIP A;  4XH5 A;  4NXN K;  5KQD A;  1BWF O;  4M42 A;  1YF5 L;  3OYB A;  3QNO A;  4BRA A;  5C15 A;  1J5O A;  1HKC A;  2P9S A;  4AIL C;  4KB0 A;  3VMF B;  3DYA A;  1L5U A;  2RHK A;  3OYF A;  4ELU A;  2QTD A;  2HMI A;  2D4W A;  4IG3 A;  3AVL A;  1FK9 A;  4LD0 A;  1B9F A;  3TAM A;  4C8N A;  2G8K A;  1NM1 A;  3VA3 A;  4DR3 K;  3A5O C;  3AO2 A;  3THX B;  3LZJ A;  3LDO A;  1EKE A;  2RPI A;  1NKE A;  1NMD A;  4CJP A;  3LZI A;  3D2F A;  2O8E A;  3L2U A;  2ZJQ L;  3C94 A;  3CCQ N;  1LWC A;  4JI4 K;  3SAF A;  5EXW A;  1IKY A;  3JSM A;  4F3O A;  1VSJ A;  3B6O A;  2WFB A;  5MLC Q;  3O08 A;  1VAZ A;  1X3M A;  3RSE B;  4Y0W A;  4OX9 K;  4BRG A;  1Q8I A;  4F9O A;  3SQ0 A;  3PLA A;  1WSJ A;  1OH6 A;  4IFE A;  2FBX A;  4CE9 A;  4FWO A;  2KFZ A;  1RTI A;  1T6D A;  1O13 A;  1RDC A;  3LL3 A;  4QS9 A;  5GAH P;  4KHN A;  4CJ3 A;  5AQX A;  2P9S B;  1HNW K;  1NGG A;  3VQ4 A;  2KKZ A;  3L2V A;  2XO7 A;  1KVA A;  3T1H K;  4JHD A;  2YKM A;  4DSK A;  3PY8 A;  2YNH A;  3HXM A;  4FJ7 A;  1XNQ K;  1RT3 A;  1TGO A;  3KLE A;  5ELZ A;  2P1J A;  2NRR A;  1RCH A;  3MK6 A;  4F2S A;  1QVG M;  1RT1 A;  3D2F B;  2O8E B;  1HKB A;  3O1W A;  1VSM A;  4BRE A;  1U47 A;  1ILY A;  2JWK A;  4CHQ A;  4M3Z A;  1RDU A;  3HZ6 A;  1TL1 A;  1XHZ A;  1DEJ A;  1I3A A;  2VG7 A;  3FZM A;  3VER A;  3ID8 A;  3SV4 A;  3A2F A;  3H1Q A;  2HHQ A;  1K8A O;  1NGJ A;  4PHT X;  5HP1 A;  3EZW A;  4O0J A;  1NOZ A;  4PUO A;  1LW2 A;  4DTP A;  3HRG A;  2VWK A;  2E20 A;  3TTF A;  4JI0 K;  4JI5 K;  1QSY A;  4FWN A;  3AAP A;  1BI4 A;  4J2A A;  4IEI A;  1EXQ A;  1YTA A;  4CES A;  4HUF A;  1NNE A;  4K8Z A;  3CYM A;  4DR7 K;  4BRF A;  4JYA K;  3UKR A;  4ICL A;  1TL3 A;  2HHS A;  4JHD B;  5M1P A;  4LY7 A;  2HOE A;  2HST A;  5JVG L;  4O5B A;  4DQI A;  4CIG A;  1GLL O;  2NLX A;  2O8B A;  4BRP A;  4H4O A;  4A61 A;  1KCF A;  5LMU K;  1HPM A;  2LSN A;  4DU4 A;  1YVU A;  1N32 K;  5SWM A;  3VEO A;  3RR8 A;  4A62 A;  1K6Y A;  3OVN A;  1XNR K;  3MX5 A;  2QWP A;  4B3O A;  1QTM A;  1RBV A;  4DV2 K;  4N76 A;  1JKH A;  3P1G A;  3ALY A;  3DXK A;  2GUI A;  2HMP A;  3O1B A;  2GBZ A;  3KLG A;  4IO8 A;  5JVH L;  4V19 S;  1JLG A;  2Z1H A;  1HRH A;  4FLU A;  1FJG K;  1HR0 K;  1DGK N;  4FXD A;  2P51 A;  3RTV A;  3RMA A;  5EVZ A;  4CHP A;  2NZT A;  3E1Y A;  4Z4G A;  2E8A A;  4DQQ A;  3QNN A;  3VQE A;  4DR2 K;  4BR4 A;  3DJC A;  3TR8 A;  4CFC A;  3K0S A;  1YTU A;  1Z05 A;  4H5N A;  5T7B A;  2BUP A;  5HBM A;  1GLD G;  3UKR B;  3AA3 A;  1O1W A;  2QWQ A;  5AFU H;  1WBD A;  1VQ4 N;  4CZM A;  2HBL A;  3R9P A;  3WNF A;  5BR9 A;  2G8U A;  4BVO A;  3QES A;  3R8E A;  4DFK A;  2CGK A;  5EOY A;  4CHY A;  3QIO A;  4ISG A;  5FPM A;  1HPZ A;  4K0K K;  5C24 A;  3CC4 N;  2A5X A;  3IFR A;  4K42 A;  1NGA A;  2NRV A;  4NLB A;  1ZBF A;  3DRR A;  4JRQ A;  4JS5 A;  3DXK B;  5GAE P;  4Z94 A;  4LH4 A;  4CJR A;  3V9U A;  2CGL A;  3G0Z A;  1RTD A;  3PUF A;  3AO5 A;  2E1Z A;  4DR1 K;  3DRP A;  3EKU A;  3K57 A;  1VQ7 N;  3LAK A;  4RW7 A;  3L0Q A;  4C1N K;  3NVK A;  1YXQ A;  3VTH A;  3NGY A;  3VEW A;  3T3F A;  3O9Q A;  1C0T A;  5M1N A;  3CF5 L;  2A1R A;  3ZEU B;  3KIO A;  4DR5 K;  1NGF A;  4AHV A;  3ITH A;  2IAJ A;  1TUY A;  5AQG A;  2AP1 A;  2FSJ A;  5CYQ A;  2QKB A;  3N4Q A;  1RDD A;  3G25 A;  2O8D A;  1WSI A;  3ASM A;  5TKW A;  3P5J A;  4G1Q A;  1BQN A;  2DFF A;  3ZT0 A;  1VK0 A;  3ZX0 A;  4F3T A;  1HNZ K;  2IOC A;  5E84 A;  5F0X A;  4B9S A;  5KGX A;  3AO4 A;  1QHT A;  4FZX C;  4BG9 A;  3T19 A;  4DQ8 A;  3AVH A;  1EWQ A;  4FWM A;  2OPP A;  3RVC A;  3SMP A;  3ENH A;  3KLF A;  3VQC A;  1UAX A;  3SZ2 A;  4CD1 A;  1LCU A;  4DCH A;  4JS4 A;  4BDP A;  4R79 A;  3S3O A;  3AVB A;  2E2Q A;  5EY4 A;  3M6G A;  2FF6 A;  4CW7 B;  2FSN A;  5AQS A;  3D45 A;  4OPK A;  1SKS A;  4M3X A;  3VQ5 A;  3S9H A;  3O3H A;  4KTW A;  1B92 A;  2P9N B;  4FL9 A;  1Z26 A;  1NU0 A;  3O80 A;  1KVC A;  1QQM A;  2UU9 K;  3J7A P;  4K41 A;  4A59 A;  4CD3 A;  3DLL L;  2Q0R A;  2PAV A;  5KGW A;  4M3R A;  4CF8 A;  3HK2 A;  4B1U B;  4CGD A;  3WXI A;  2ZGZ A;  1NJY A;  4NLC A;  2HNZ A;  4JKE A;  4F2R A;  2O8D B;  1VSK A;  4E89 A;  3K5M A;  4RW8 A;  4FM0 A;  2A41 A;  4DQR A;  3LP1 A;  1SQK A;  1Y64 A;  4PQU A;  4WF9 L;  4AHU A;  2P9U A;  1HQU A;  4CZK A;  3QEP A;  3BUZ B;  3UKU A;  5FPE A;  2HVH A;  2YHW A;  3EEQ A;  1RBU A;  3VF6 A;  1VQM N;  4H0T B;  2QM1 A;  2ZQB A;  4JI7 K;  2GWJ A;  1WNS A;  4FK4 A;  2ASO A;  5A2Q O;  4DMN A;  2NRT A;  4N41 A;  4BRN A;  3SLC A;  4IFV A;  3LDP A;  3HYF A;  3AVC A;  2B4J A;  2W6L A;  3QB0 A;  3I8D A;  4FJN A;  3TAR A;  1L3S A;  4HUG A;  1ASV A;  2I7N A;  2OTL N;  4YOR A;  3KKS A;  4H5W A;  3BF1 A;  1VSF A;  3F5T A;  3OBY A;  3A8Y A;  4H0O A;  1C6V A;  4G9Z A;  4FJ5 A;  3HP9 A;  3THW B;  3WUH A;  2B5J A;  1ATS A;  4BDY A;  4N47 A;  1RT6 A;  4GY2 B;  3DAW A;  3J7Z O;  2D0C A;  4FK0 A;  4L8R B;  4QCL A;  4Q5V A;  2P9P A;  1RT2 A;  1NGE A;  2Q2R A;  2YHB A;  3ZSO A;  2P9U B;  3AAQ A;  3SBT A;  3I56 N;  1YVN A;  3THY A;  4X64 K;  3ZT4 A;  3CCS N;  5BN8 A;  2UUB K;  3WXK A;  3UKU B;  1QZ5 A;  5AJ3 K;  2VWB A;  1JLQ A;  1I39 A;  3PX6 A;  4NB4 A;  1KLM A;  3QIP A;  2WON A;  3O9T A;  3CXC M;  4CGI A;  1RBS A;  5AZI A;  4MQ3 A;  1Q81 O;  3MCA B;  3NH2 A;  4LF5 K;  5AQR A;  3F9K A;  1HJO A;  2YHY A;  3A5L C;  4FW2 A;  3AVF A;  3WNG A;  4DFP A;  3ID6 A;  2I7P A;  4DTM A;  1RDA A;  3MCP A;  4PKI A;  2YCH A;  3S3N A;  1EWR A;  5FRO A;  2JGU A;  3O9R A;  3PX0 A;  2OYQ A;  3OS0 A;  3LWL A;  3GOI A;  4E3S A;  2W42 A;  3H3N O;  2IDO A;  3GE1 A;  4H5R A;  2ZM6 K;  1P90 A;  4DSJ A;  1C1B A;  5CYM A;  4J2E A;  3KK1 A;  2ZD1 A;  2P9P B;  4CCH A;  4FLV A;  2Z1G A;  4I2Q A;  1S3X A;  3TTC A;  3THY B;  1Y97 A;  1TK0 A;  3KD5 E;  4E7L A;  4JV5 K;  3TAQ A;  3Q7C A;  4FM2 A;  1WSF A;  2CH5 A;  2E2O A;  1SAZ A;  3B8A X;  3NVM A;  4LFC K;  3L8B A;  3AVA A;  1LAV A;  1MA9 B;  3P31 A;  5AZI B;  3TSQ A;  4XIU A;  1TYQ A;  3U9Z A;  3KTQ A;  1LOT B;  1XHX A;  4BC3 A;  1BHL A;  3H45 C;  1KAY A;  4FWL A;  4HWI A;  1DT9 A;  4NYN A;  2HBK A;  3SQ1 A;  2ZWH A;  5B8H A;  4LSN A;  5CHI A;  3VF2 A;  5BN9 A;  4Y1D A;  1W2B M;  4K43 A;  4RWT A;  2F9T A;  3WNH A;  2V52 B;  3K5N A;  4FJG A;  4DV0 K;  1HJR A;  1ATN A;  3A0I X;  5FPD A;  4CBX A;  4PWD A;  5E41 A;  4RW9 A;  1ZBH A;  2KW4 A;  3MXJ A;  3AY9 A;  4N5S A;  1M90 O;  1H1V A;  3TWH A;  3JXU A;  1OH8 A;  1S6Q A;  3EZ5 A;  4FPA A;  1GLA G;  1OVQ A;  3O4W A;  5AQZ A;  2ASP A;  3VA0 A;  3RMB A;  4B1V A;  2ZJP L;  3MMV A;  3FGU A;  4CJT A;  3KVG A;  3VQ7 A;  1GLF O;  4EP4 A;  1TYQ B;  3I8B A;  1SKW A;  1N34 K;  1EO1 A;  1FKO A;  1QSS A;  2FXU A;  1GLE G;  3HPO A;  1A5V A;  2ASM A;  3HP6 A;  4M7Y A;  3U3G A;  4KRF A;  3SNN A;  4Z4E A;  3AO3 A;  3DMJ A;  5JS2 A;  3O4Q A;  2XY5 A;  1ZBI A;  1KAZ A;  3S3M A;  1W9H A;  4DSF A;  5I9E B;  4GKJ K;  1RTJ A;  1J5E K;  1E4G T;  4K8X A;  5FRN A;  2IC3 A;  5ADX H;  4FO0 A;  3MDQ A;  3L2W A;  4IJA A;  5FLX O;  1DTT A;  1KAX A;  1LV5 A;  1NK7 A;  3HO1 A;  4BWJ A;  3W3D A;  3J80 O;  4A2B A;  4O5F A;  1OVY A;  1CXU A;  1NJW A;  3M8Q A;  1SUQ A;  4C8L A;  1N36 K;  4LSL A;  3LWM A;  3CJ9 A;  5LY3 A;  4C8K A;  2A40 A;  3L3U A;  3IAY A;  3SI6 A;  5GIN A;  1EX4 A;  4CJ4 A;  3QET A;  3RSE A;  3KWI A;  3D6R A;  5J1E A;  2Q0U A;  5CY4 A;  3ZET A;  4O8K A;  3C95 A;  2HF3 A;  2Z1J A;  2KLA A;  3EKS A;  2QWM A;  1X9M A;  4IO9 L;  2VGN A;  4WQ5 C;  2YJF A;  5CR4 A;  3NH0 A;  3ULE A;  1GLC G;  1TKX A;  3MN5 A;  1RT5 A;  4FJ8 A;  3P4I A;  3IS9 A;  2HBM A;  3HJF A;  3ZYY X;  5HL7 L;  3OYK A;  3CD6 N;  1NWK A;  1YJN N;  2QXF A;  3F73 A;  4X66 K;  2YNI A;  2UXC K;  2EHG A;  3VQ8 A;  1NLV A;  4HCC A;  5IT9 O;  4KH6 A;  3WXJ A;  4B1X B;  3U3Y A;  4MO5 A;  2Y1I A;  1IH7 A;  3C6A A;  5DM7 L;  3ZET B;  3KK7 A;  4JEP A;  5LJV A;  2EWS A;  3M8P A;  2KHO A;  4CEF A;  1RT4 A;  4W5R A;  4ID5 A;  4CEE A;  4EZ9 A;  2EX3 A;  4FJM A;  1VRT A;  3ZSY A;  3GBT A;  1K9M O;  3SYZ A;  1IG9 A;  1J53 A;  3CG7 A;  4BWM A;  3ULE B;  1X9J A;  1GOB A;  5BRE A;  1RNH A;  3MN7 A;  3SPZ A;  3FZK A;  1VQ5 N;  5DMR A;  2E2N A;  1CXQ A;  5EX5 A;  3HT3 A;  4B1W B;  3ZSV A;  4WFN L;  3E9O A;  4B9U A;  2YHX A;  4PA1 A;  4CZJ A;  4O4G A;  4M3Y A;  4AHC A;  3PIO L;  3NH1 A;  4DR4 K;  4CF9 A;  2E88 A;  4ILG B;  2KZZ A;  1D5A A;  3VES A;  4ZTJ A;  2WUS A;  4CHZ A;  1SV5 A;  4CED A;  4JRP A;  1XWL A;  1G99 A;  5JLF A;  2BH1 A;  5H1S Q;  1VQO N;  4Z4C A;  5J2N A;  1X9W A;  5J2M A;  2DFE A;  3HOS A;  3CMA N;  1JJ2 M;  3V9Z A;  4LF9 K;  1D9D A;  3LP3 A;  1CZB A;  4NO7 A;  4L3Q A;  3O3F A;  3K5O A;  3OJU A;  1W97 L;  4IBN A;  1HNV A;  1NKB A;  4JI3 K;  4ISF A;  4FWR A;  2I5J A;  2VYP A;  2F8S A;  1S9G A;  4OVL A;  4M3W A;  4IEE A;  3A5M C;  5C25 A;  3PO5 A;  4AQY K;  3TAN A;  3AVI A;  3SPY A;  1KFS A;  3SK3 A;  1BU6 O;  1N5Y A;  2HNY A;  2HHV A;  3QEX A;  4JN4 A;  1ITG A;  2PBD A;  4DV5 K;  3PIP L;  3R6M A;  3CIP A;  3SCX A;  4JLH A;  2NRW A;  1N33 K;  3ZSR A;  2DFH A;  4QS8 A;  4B08 A;  3RMD A;  3VEN A;  1LW0 A;  1UWB A;  4HTU A;  4DS4 A;  1JLA A;  2WOM A;  3LDQ A;  1WAJ A;  3QER A;  3SV3 A;  4B9T A;  4Z4F A;  4RW6 A;  2PYL A;  3OYJ A;  3A5N C;  2VQE K;  4BRQ A;  2GV9 A;  4YOY A;  1NK4 A;  3UB5 A;  4KTQ A;  1TAU A;  4X62 K;  1HX1 A;  4CK2 A;  3D7E O;  3HOT A;  2HHU A;  4CGF A;  4EIA A;  3DLG A;  4GMJ B;  4C1N I;  2RN2 A;  1SL0 A;  1Z6R A;  2A3Z A;  2E2P A;  3CFO A;  5E26 A;  3ZX2 A;  3ZSZ A;  3ZEU A;  1OKJ A;  1JLC A;  5AQJ A;  1XQS C;  5GIO A;  1VQP N;  4DB3 A;  4E19 A;  3DLH A;  1MWM A;  4HVJ A;  2PZS A;  4CFA A;  3FR0 A;  1ASU A;  2HF4 A;  1U48 A;  3L2R A;  2X6S A;  3NAE A;  1YHQ N;  4KAZ A;  3BGR A;  4B9N A;  1WSE A;  4IOA L;  3OA9 A;  4NCG A;  4KH4 A;  1Q86 O;  3SUP A;  1QQC A;  4ID1 A;  4C8O A;  2D0A A;  4CEB A;  3M8R A;  1IO2 A;  2G8V A;  4BRD A;  5BR8 K;  1ZBU A;  4FJ9 A;  4KI6 A;  1XC9 A;  3OYD A;  3K58 A;  1GOA A;  4EHT A;  1VQ6 N;  1IBL K;  3SQ2 A;  1ASW A;  1VHX A;  4ZHR A;  1JLF A;  2UUA K;  2GWK A;  2RE2 A;  3LM9 A;  3MN6 A;  2E5L K;  3VQP A;  4CBW A;  3NDK A;  3PV8 A;  1JXB A;  2XHB A;  4LF6 K;  1YUW A;  4BC4 A;  1BCM A;  3G4S N;  3MWP A;  4FJK A;  1VQN N;  1UOC A;  1QSL A;  4E1N A;  1NK5 A;  2P9N A;  3NGZ A;  4CJU A;  1C0F A;  1IKV A;  1UA1 A;  3IG1 A;  1JL1 A;  2NRZ A;  4J2D A;  4YOX A;  4OGE A;  4CJV A;  3KJV A;  4IKF A;  4DSE A;  4KV8 A;  3LPT A;  2VGM A;  4JKF A;  4ZTF A;  2D1K A;  2Q31 A;  4E1J A;  1T03 A;  3NHG A;  3WQU A;  2OZS A;  3VF4 A;  4BRM A;  4CZL A;  4DTS A;  4BAC A;  3CQX A;  5BRH A;  1SL2 A;  2XY7 A;  2YNF A;  2F96 A;  1ZBL A;  3WEE A;  1XC3 A;  3AA2 A;  2IVO A;  2OAN A;  3CI5 A;  2O8C B;  3DLR A;  5EU7 A;  3P39 A;  5KRT A;  4JAX A;  1BIU A;  4BQL A;  4KHS A;  4KFB A;  4AH9 A;  4YOV A;  2P9K A;  3V9W A;  4W5O A;  1Q82 O;  1WAF A;  3ATU A;  2Q1N A;  4DTO A;  3WT0 A;  1L3V A;  2ZJR L;  4KKO A;  4DLG A;  4BE1 A;  4CJW A;  3TPQ A;  1SL1 A;  4LF8 K;  3K9J A;  4CIF A;  3CJB A;  1HNI A;  1BG3 A;  4EFH A;  1VQ8 N;  3EO3 A;  4BR0 A;  4CJQ A;  3SMS A;  1HLU A;  2FBT A;  3THW A;  3OJS A;  5D3G A;  3SUQ A;  4BRI A;  1QQN A;  5M1O A;  2VQF K;  4BE0 A;  3OYE A;  3WNE A;  1U2V A;  4YY3 K;  4M41 A;  2XY6 A;  1R0A A;  2IS3 A;  4B9Q A;  4OPA A;  5ADX A;  1W7A A;  4FK2 A;  3TAB A;  3TSP A;  3QEI A;  4H0X B;  3VET A;  2VG5 A;  3WEE B;  1JLE A;  4EP5 A;  1NJI O;  1SS6 A;  2GEL A;  2QXL A;  4JI1 K;  4AF1 A;  3VQB A;  3J7Y P;  4FJI A;  3NE6 A;  2WBN A;  2AJQ A;  2P9K B;  4B1Y B;  3OYI A;  1D4X A;  1YIJ N;  3W0L A;  4JI2 K;  4KHY A;  4B9M A;  2HB5 A;  4ELV A;  4N56 A;  4DTX A;  3QEW A;  4CGH A;  3R3L A;  5LL6 Z;  4Q0B A;  5LJW A;  2KTQ A;  1VSH A;  3LP2 A;  1S72 N;  1K8K A;  4NCA A;  3QEV A;  3I55 N;  3GDQ A;  3ZT2 A;  4GNI A;  3NMU A;  2O8F A;  1JCE A;  1U2V B;  3OS2 A;  2ATQ A;  2QWR A;  2V51 B;  5LMN K;  3M3Z A;  1J6Z A;  4BC5 A;  2NNW A;  4LFA K;  3ATV A;  1FW6 A;  3H1V X;  4OJR A;  3L4Q A;  4DF8 A;  4BY9 C;  1WUA A;  3CCE N;  3HSC A;  1NGI A;  1KQS M;  1HUX A;  3QBX A;  2F8T A;  3EYZ A;  1BIS A;  1WSH A;  3V1O A;  3HVT A;  1HYV A;  3V9X A;  2ZE2 A;  3CER A;  3MEC A;  4DV4 K;  4A2A A;  4CEO A;  1RTH A;  3IDH A;  4PY5 A;  1GOC A;  5C12 A;  4E1M A;  4H5T A;  2GUP A;  4YDU A;  3V4I A;  1U4B A;  1FKP A;  5BPN A;  1BGX T;  1HYS A;  4WFB L;  4IOX A;  3CCU N;  3LDS A;  4BRH A;  4WQ5 A;  1K8K B;  1BQM A;  1HQE A;  2F7T A; 
#chains in the Genus database with same CATH homology
 3CYM A;  1LAW A;  3H08 A;  3K2P A;  3OYC A;  4Z4I A;  5J1E A;  3V81 A;  4OGC A;  3OYM A;  5CY4 A;  3TAP A;  4ICL A;  1TL3 A;  3NCI A;  2HHS A;  2OZM A;  2HHW A;  3C95 A;  2D0B A;  4LY7 A;  2OPQ A;  2FBV A;  2Z1J A;  1S1V A;  2O4I A;  1W0H A;  4Z0U A;  2YNG A;  2P5G A;  4O5B A;  4CF0 A;  1IKW A;  4DQI A;  4CIG A;  5HRR A;  5I3U A;  4CEQ A;  4H4O A;  1KCF A;  1X9M A;  2LSN A;  4DU4 A;  2ITG A;  3AVJ A;  1YVU A;  1BCO A;  1VSI A;  5SWM A;  1WN7 A;  4E7H A;  4CJ5 A;  3NH0 A;  4DFM A;  3RR8 A;  1K6Y A;  3OVN A;  4B3O A;  1DTQ A;  2RF2 A;  1RBV A;  1TKX A;  1QTM A;  3VN5 A;  4N76 A;  3VQD A;  1JKH A;  3P1G A;  4CGG A;  1S6P A;  1RT5 A;  3ALY A;  4DQS A;  1TKD A;  4FJ8 A;  2GUI A;  3IS9 A;  3L3V A;  4FW1 A;  5CZ1 A;  4OPJ A;  3HJF A;  4CK1 A;  3NF6 A;  2GBZ A;  3KLG A;  1X1P A;  3OYK A;  1JLG A;  2Z1H A;  3NGI A;  1HRH A;  4FLU A;  4CHN A;  2Y1J A;  2QXF A;  3RWU A;  3V9S A;  3E01 A;  2E4L A;  3F73 A;  2P51 A;  4CGJ A;  4CJL A;  4FXD A;  3RTV A;  2YNI A;  3RMA A;  4CHP A;  2EHG A;  1S1U A;  5FDL A;  3VQ8 A;  4DTR A;  4Z4G A;  4HCC A;  1B9D A;  4DQQ A;  1Q9X A;  3QNN A;  3VQE A;  4NCB A;  3TR8 A;  4CFC A;  3U3Y A;  4DFJ A;  1YTU A;  4RW4 A;  4F4K A;  3I0R A;  5T7B A;  5HBM A;  2Y1I A;  1IH7 A;  4FJJ A;  3AA3 A;  1O1W A;  3AV9 A;  1VSE A;  5SZT A;  3MEE A;  3WNF A;  4AHS A;  3M8P A;  4C8M A;  4CEF A;  1TK5 A;  2G8U A;  1RT4 A;  4CK3 A;  3QES A;  4W5R A;  4ID5 A;  4CEE A;  3C6U A;  3CFP A;  4EZ9 A;  1F21 A;  2EX3 A;  4OKK A;  4DFK A;  2X74 A;  3K5L A;  2BGG A;  4FJM A;  1VRT A;  2YKN A;  3ZSY A;  3LP0 A;  4CHY A;  1IG9 A;  3QIO A;  3SYZ A;  1HPZ A;  5C24 A;  4KB1 A;  1KTQ A;  1J53 A;  3CG7 A;  4FVM A;  4BWM A;  4E0D A;  1WLJ A;  1GOB A;  1RNH A;  1QS4 A;  3QLH A;  3MAQ A;  1ZBF A;  4DTN A;  3SPZ A;  3DRR A;  5DMR A;  3DLE A;  3TAG A;  1S1W A;  1CXQ A;  4JRQ A;  2ETJ A;  1J54 A;  4JS5 A;  3LPU A;  1NJX A;  5KI6 A;  3HT3 A;  3JYT A;  4LH4 A;  3ZSV A;  4CJR A;  3V9U A;  2HND A;  3G0Z A;  4KTZ A;  1RTD A;  2X6N A;  3PUF A;  4B9U A;  3AO5 A;  4HUE A;  4PA1 A;  3DRP A;  4O4G A;  4KHQ A;  4M3Y A;  4DSI A;  2DTU A;  3K57 A;  4RG8 A;  3LAK A;  3MXM A;  4AHC A;  4RW7 A;  1NK6 A;  3NH1 A;  1HMV A;  3T1A A;  1FXX A;  3K59 A;  2A1S A;  3LAN A;  4DF4 A;  4CF9 A;  1NKC A;  3NGY A;  1EET A;  2E6M A;  4OKJ A;  2HVI A;  3AVK A;  3CQ8 A;  2G8I A;  4J2B A;  4FM1 A;  4HHT A;  4I9Q A;  2KZZ A;  1D5A A;  3T3F A;  3D0P A;  4ZTJ A;  3LAM A;  2G8F A;  3HPH A;  1C0T A;  3PO4 A;  1VSL A;  4CHZ A;  3SUO A;  1SV5 A;  2A1R A;  4FJL A;  4CED A;  4FLY A;  4JRP A;  1XWL A;  3KIO A;  2G8W A;  1JLB A;  4DSL A;  5J2Q A;  5JS1 A;  4AHV A;  3ITH A;  2IAJ A;  3LAL A;  4CJE A;  4Z4C A;  4J2A A;  5J2N A;  1X9W A;  5J2M A;  1DLO A;  2BE2 A;  2DFE A;  4DQP A;  5CYQ A;  2XY8 A;  3AA4 A;  2QKB A;  1RDD A;  1VRU A;  3V9Z A;  4M3T A;  1D9D A;  1WSG A;  3LP3 A;  1CZB A;  3OYG A;  1WSI A;  3ASM A;  3O3F A;  5KRS A;  4KHW A;  3P5J A;  4W5N A;  3K5O A;  5HRN A;  4G1Q A;  3OYN A;  1BQN A;  3OJU A;  2DFF A;  4IBN A;  3ZT0 A;  1HNV A;  1VK0 A;  1NKB A;  4F3T A;  3V1R A;  2I5J A;  2IOC A;  5C42 A;  2JLE A;  1T7P A;  4B9S A;  2F8S A;  1S9G A;  1TK8 A;  5KGX A;  3AO4 A;  4OVL A;  4Z4H A;  4M3W A;  4IFY A;  5C25 A;  1QHT A;  3VQ9 A;  3PO5 A;  4FZX C;  4OLB A;  3T19 A;  4W5Q A;  3TAN A;  4DS5 A;  3AVI A;  4CFD A;  3AVH A;  2D5R A;  3SPY A;  1KFS A;  2HHV A;  1N5Y A;  2HNY A;  3QEX A;  1RIL A;  1ITG A;  2OPP A;  1ZYQ A;  1T8E A;  4BDZ A;  3KLF A;  3SCX A;  4JLH A;  5CZ2 A;  1UAX A;  3VQC A;  3SZ2 A;  3ZSR A;  2DFH A;  2OPR A;  2KZM A;  4B8A B;  4B08 A;  4JS4 A;  3SQ4 A;  3RMD A;  4BDP A;  4QOZ B;  1LW0 A;  1MU2 A;  1UWB A;  1KFD A;  3L2Q A;  3AVB A;  4HTU A;  4DS4 A;  1REV A;  3V6D A;  3S3O A;  3DRS A;  3NFA A;  1JLA A;  2WOM A;  3ISN C;  2O4G A;  1WAJ A;  2HHT A;  3D45 A;  4OPK A;  3NF9 A;  3SV3 A;  3QER A;  1SKS A;  4B9T A;  4M3X A;  4FJH A;  4Z4F A;  3DOK A;  4RW6 A;  2PYL A;  3VQ5 A;  3S9H A;  3U6F A;  3OYJ A;  3O3H A;  4KTW A;  1B92 A;  3CM6 A;  3VQ6 A;  3HVR A;  1Z26 A;  1KVC A;  2GV9 A;  1NK4 A;  4EZ6 A;  4KTQ A;  1TAU A;  3AVM A;  3KK3 A;  3HST B;  1BIZ A;  4DTJ A;  4CK2 A;  3TAE A;  1L3T A;  4DG1 A;  2R7Y A;  2HHU A;  4CGF A;  4CJS A;  3DLG A;  4DU3 A;  5KGW A;  4GMJ B;  4M3R A;  2VG6 A;  4CF8 A;  3HK2 A;  4CGD A;  2RN2 A;  1SL0 A;  2QKK A;  5HLF A;  1NJY A;  4DWI A;  4HCB A;  2HNZ A;  3CFO A;  4F2R A;  1Q9Y A;  1VSK A;  4E89 A;  3ZSZ A;  4CEZ A;  2B6A A;  5I42 A;  3K5M A;  1S1T A;  4RW8 A;  4FM0 A;  2FBY A;  4DQR A;  2RKI A;  3LP1 A;  4KHU A;  5K14 A;  4PQU A;  1JLC A;  4AHU A;  1HQU A;  3V1Q A;  3C6T A;  4QAG A;  4CEA A;  4KI4 A;  3QEP A;  4E19 A;  3DLH A;  1NJZ A;  4HVJ A;  2PZS A;  4AHT A;  1HYZ A;  4CFA A;  1ASU A;  5J2P A;  3QO9 A;  1U48 A;  4FZY A;  4DLE A;  2HVH A;  1CLQ A;  4IG0 A;  3L2R A;  3DOL A;  1RBT A;  1RBU A;  2X6S A;  2DY4 A;  3NAE A;  1LWF A;  4KAZ A;  3BGR A;  4B9N A;  1WSE A;  3OYH A;  2ZQB A;  1JL2 A;  4FLZ A;  1BL3 A;  4NCG A;  4OKE A;  1WNS A;  3ZSW A;  4B9L A;  4FK4 A;  3TI0 A;  5HRS A;  3SUP A;  1L3U A;  4DMN A;  1QQC A;  3ULD A;  1NOY A;  4N41 A;  4KRE A;  4ID1 A;  1KLN A;  2P5O A;  4C8O A;  5HRP A;  2KQ2 A;  2D0A A;  4IFV A;  4CEB A;  4E7K A;  3MXI A;  4OLA A;  3HPG A;  3HYF A;  3AVC A;  4BE2 A;  2B4J A;  3M8R A;  1IO2 A;  2G8V A;  3I8D A;  1ZBU A;  4FJN A;  4FJ9 A;  3TAR A;  2XRI A;  3AVN A;  4CEC A;  4LH5 A;  1L3S A;  4KI6 A;  4HUG A;  1XC9 A;  1ASV A;  4CER A;  4FK0 A;  3OYD A;  3K58 A;  4CHO A;  1GOA A;  3OY9 A;  1CZ9 A;  1RBR A;  2IGI A;  3O3G A;  3KKS A;  3SQ2 A;  1ASW A;  3TAF A;  3ZSX A;  1X9S A;  1VSF A;  4ZHR A;  1JLF A;  1KVB A;  3ZT1 A;  3HL8 A;  3SJJ A;  1C6V A;  5KTQ A;  4FJ5 A;  3HP9 A;  3VQP A;  3DI6 A;  4CF2 A;  3NDK A;  1J9A A;  2B5J A;  3KK2 A;  3PV8 A;  1JXB A;  4N47 A;  2XHB A;  4BDY A;  1RT6 A;  2YHA A;  4KPY A;  1BCM A;  2D0C A;  2PY5 A;  3HM9 A;  4FJK A;  2Q3S A;  4R5P A;  1UOC A;  1QSL A;  4L8R B;  4E1N A;  4QCL A;  4Q5V A;  1NK5 A;  3MEG A;  1RT2 A;  2YHB A;  3ZSO A;  3NGZ A;  3KKR A;  4CJU A;  1T05 A;  1IKV A;  3ZT4 A;  1UA1 A;  3B6P A;  3IG1 A;  1JL1 A;  3VQQ A;  3KD1 E;  4M45 A;  4J2D A;  1G15 A;  4W5T A;  4OGE A;  3NF8 A;  3M8S A;  4CJV A;  3PX4 A;  2BDP A;  3KJV A;  1A5W A;  4H4M A;  1TV6 A;  3VQA A;  4IKF A;  4DSE A;  4YNQ A;  4KV8 A;  1JLQ A;  1TAQ A;  1I39 A;  3LPT A;  3PX6 A;  1C1A A;  3RRH A;  1N6Q A;  4ZTF A;  3NBP A;  1KLM A;  3AA5 X;  3QIP A;  4WE1 A;  4CJK A;  1T03 A;  2WON A;  3NHG A;  4CGI A;  3THV A;  1RBS A;  1SKR A;  4MQ3 A;  2OZS A;  4CIE A;  4KO0 A;  1TKZ A;  4Y1C A;  3NH2 A;  4DTS A;  3F9K A;  4CJF A;  4BAC A;  3I0S A;  3IRX A;  1C0U A;  3CFR A;  1NK9 A;  2PYJ A;  1NK0 A;  3FFI A;  4FW2 A;  1A5X A;  1SL2 A;  1C0M A;  3AVF A;  1IKX A;  2YNF A;  3WNG A;  2XY7 A;  4FJX A;  2F96 A;  4DFP A;  1ZBL A;  3RR7 A;  3AA2 A;  1EP4 A;  1RDA A;  2VWJ A;  4DTM A;  3DLR A;  5EU7 A;  4ELT A;  1XI1 A;  3S3N A;  5FRO A;  2JGU A;  3ZT3 A;  3PX0 A;  1TKT A;  2OYQ A;  3OS0 A;  5KRT A;  3LWL A;  3SUN A;  3BDP A;  2X78 A;  4E3S A;  1BIU A;  2G8H A;  4KHS A;  4I2P A;  3QIN A;  4KFB A;  2W42 A;  2IDO A;  4AH9 A;  2E6L A;  3KLI A;  4E7I A;  3V9W A;  1LWE A;  4DU1 A;  1KSP A;  4DSJ A;  1C1B A;  4W5O A;  5CYM A;  1WAF A;  3ZCM A;  4B8C A;  1KRP A;  4J2E A;  4AHR A;  3OYA A;  3KK1 A;  2ZD1 A;  4DTO A;  2YV0 X;  1L3V A;  4CCH A;  4FLV A;  2Z1G A;  4KKO A;  4DLG A;  4I2Q A;  4CJW A;  4BE1 A;  4FLT A;  1SL1 A;  1Y97 A;  4CIF A;  1VSD A;  4B9V A;  1TK0 A;  2Z1I A;  3KD5 E;  1HNI A;  4E7L A;  3RRG A;  4M42 A;  3OYL A;  3TAQ A;  3OYB A;  3QNO A;  3P83 D;  4O44 A;  4CJQ A;  4FM2 A;  1J5O A;  2FBT A;  2QK9 A;  1WSF A;  4AIL C;  4KB0 A;  3OJS A;  5D3G A;  3SUQ A;  3DYA A;  4GVM A;  1L5U A;  3O4N A;  3L8B A;  3OYE A;  4BE0 A;  3WNE A;  3OYF A;  4ELU A;  2HMI A;  3AVA A;  1LAV A;  3KTQ A;  4XIU A;  4IG3 A;  3AVL A;  4M41 A;  1XHX A;  1FK9 A;  2XY6 A;  1BHL A;  3AVG A;  1R0A A;  2NUB A;  4LD0 A;  1B9F A;  2IS3 A;  4C8N A;  3TAM A;  4O0I A;  2G8K A;  4F8R A;  4NYN A;  3VA3 A;  3SQ1 A;  3AO2 A;  4FK2 A;  3LZJ A;  3TAB A;  1EKE A;  3QEI A;  2RPI A;  1NKE A;  4LSN A;  2VG5 A;  4CJP A;  1JLE A;  3LZI A;  1D9F A;  4H8K A;  4EP5 A;  3L2U A;  3C94 A;  4Y1D A;  3KLH A;  1LWC A;  3VQB A;  4FJI A;  5FRM A;  1IKY A;  4IDK A;  3JSM A;  4F3O A;  4NYF A;  1VSJ A;  1BI4 B;  3WNH A;  3NE6 A;  1D8Y A;  3B6O A;  3K5N A;  4FJG A;  2AJQ A;  1HJR A;  1U45 A;  2HHX A;  4TSX A;  1RDB A;  1Q8I A;  3OYI A;  3SQ0 A;  1TVR A;  4PWD A;  5E41 A;  1WSJ A;  1UA0 A;  4KHY A;  4B9M A;  2OPS A;  4RW9 A;  3EY1 A;  2HB5 A;  4ELV A;  2FBX A;  2KW4 A;  3MXJ A;  3NF7 A;  4N56 A;  4N5S A;  4DTX A;  3QEW A;  1ZBH A;  4CGH A;  4FLW A;  2OA8 A;  4CE9 A;  3TWH A;  2KFZ A;  4Q0B A;  2HW3 A;  2KTQ A;  1S6Q A;  1VSH A;  3DLK A;  3LP2 A;  1C1C A;  1RTI A;  4CFB A;  4O55 A;  3EZ5 A;  1RDC A;  4KHN A;  3RMC A;  1Z25 A;  4NCA A;  3QEV A;  4I7F A;  4CJ3 A;  2FC0 A;  4E7J A;  1YT3 A;  3VQ4 A;  3ZT2 A;  3VA0 A;  1S1X A;  3RMB A;  3L2V A;  2XO7 A;  1KVA A;  4CJT A;  4GW6 A;  5HRO A;  3OS2 A;  2ATQ A;  2YKM A;  3VQ7 A;  3PY8 A;  4DSK A;  4EP4 A;  1SKW A;  2YNH A;  1QE1 A;  3DM2 A;  3HXM A;  3UIQ A;  1FKO A;  4FJ7 A;  1QSS A;  1RT3 A;  1TGO A;  2BAN A;  3HPO A;  3KLE A;  1A5V A;  3HP6 A;  3U3G A;  2P1J A;  3OS1 A;  3SNN A;  4Z4E A;  4KRF A;  3AO3 A;  3DMJ A;  1RCH A;  4OJR A;  5JS2 A;  4DF8 A;  1NK8 A;  3O4Q A;  4F2S A;  4FZZ A;  2XY5 A;  1ZBI A;  1RT1 A;  3S3M A;  1W9H A;  4DSF A;  2F8T A;  4YFU A;  1RTJ A;  3EYZ A;  1BIS A;  1WSH A;  4K8X A;  4K8Z A;  1VSM A;  2IC3 A;  1U47 A;  5FRN A;  3V1O A;  2KFN A;  3HVT A;  1HYV A;  3ZSQ A;  3L2W A;  4CHQ A;  3V9X A;  1U49 A;  2ZE2 A;  4M3Z A;  3MEC A;  1TL1 A;  1XHZ A;  4CF1 A;  4CEO A;  1DTT A;  1I3A A;  1RTH A;  1LV5 A;  1NK7 A;  2VG7 A;  4PY5 A;  4UQG A;  3HO1 A;  1GOC A;  4E1M A;  4BWJ A;  3SV4 A;  3A2F A;  4MFB A;  2HHQ A;  3DLB A;  3V4I A;  1CXU A;  5DK5 A;  5HP1 A;  1U4B A;  1FKP A;  1BGX T;  1NJW A;  1JXE A;  3M8Q A;  1HYS A;  4O0J A;  3G10 A;  4DTU A;  3AO1 A;  1NOZ A;  3MED A;  4PUO A;  4FYD A;  1LW2 A;  4DTP A;  1SUQ A;  2VWK A;  4C8L A;  3LDS A;  1S5J A;  4LSL A;  3LWM A;  4FCY A;  4C8K A;  1QSY A;  4I9L A;  3L3U A;  3IAY A;  3SI6 A;  1BI4 A;  1EX4 A;  1U04 A;  4CJ4 A;  1RT7 A;  4FLX A;  1BQM A;  1EXQ A;  1YTA A;  1HQE A;  3CM5 A;  4CES A;  4HUF A;  3QET A;  4M3U A;  1S9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...