2X6NA

Human foamy virus integrase - catalytic core. manganese-bound structure.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
188
structure length
188
Chain Sequence
PQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords INTEGRASE
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 60
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x6nA00
4HUEA 4FLVA 4B9TA 4E1NA 4KHQA 1SL1A 4W5TA 4LSNA 3DYAA 4AHUA 1B9FA 4DS4A 1XC9A 1NJZA 4G1QA 5SWMA 4DFMA 3SJJA 2KZZA 1KRPA 1RTHA 3WNEA 2OA8A 2YNGA 1BQNA 1RCHA 2KQ2A 3HL8A 4QOZB 3ZCMA 4BDZA 4O4GA 3LANA 4ZTFA 4AH9A 1RT1A 4FM0A 1JLGA 2LSNA 3KK2A 4DTMA 2AJQA 4DSFA 1S6PA 4YNQA 2GV9A 3QNNA 4CIGA 3RMCA 4KREA 3ZSOA 1YTUA 3G10A 3KD5E 3DRRA 3QEXA 1N5YA 2QKBA 1BCMA 4OVLA 3LPUA 4Y1CA 3SQ4A 2FBVA 2RN2A 4BDPA 5D3GA 3SQ2A 2D0CA 1C6VA 3QLHA 1HQEA 4M3YA 2VWKA 3VQAA 4OGEA 1C1AA 4FM2A 4CEEA 3NH0A 3AVBA 4DTUA 1BHLA 3QNOA 2YHAA 4DQPA 3VQ7A 4Q5VA 4CF1A 2ZD1A 5KRTA 4HCCA 3AVKA 4CFBA 2IS3A 4DLEA 4L8RB 3NFAA 1WSHA 4PWDA 3TWHA 3VQBA 2BE2A 1VRUA 3WNFA 4CESA 1BCOA 4AHVA 1LAWA 1QHTA 1RILA 2O4GA 3P83D 4E19A 1R0AA 3RR8A 1CZ9A 4DSKA 1S1UA 4B9LA 1NK8A 3KK1A 3LP2A 4CHPA 4E0DA 4DLGA 4KB0A 2Z1JA 1C1CA 1HQUA 2IOCA 4BE0A 3V9UA 1L3SA 3V1OA 1LW0A 4FJMA 3QEIA 1L5UA 1QSYA 4I2PA 2HHVA 5KGXA 3T3FA 4QCLA 3NF6A 1NK5A 4Q0BA 3ZSVA 4H4OA 1XHZA 4BE1A 4O0IA 1T05A 4ELTA 3V9ZA 3NH2A 4DTSA 5J2MA 2KTQA 5FRNA 3MXJA 1UAXA 1IKXA 3CYMA 4JRPA 3QIOA 2B5JA 3OYEA 1IKYA 3JYTA 4W5NA 3IAYA 3TAQA 4O0JA 3TANA 1VK0A 1Q8IA 3SV3A 1TVRA 4E7JA 3QEVA 3ITHA 3ZSZA 3AA3A 2HHWA 1HNVA 1KTQA 2E4LA 3M8PA 4IDKA 1UA0A 3T19A 3T1AA 3SQ0A 3SPZA 1WSEA 4CJQA 4CEDA 2Z1HA 4CECA 3HPHA 1LWEA 1BGXT 2IC3A 2OYQA 1ASUA 3P1GA 3U3YA 1X1PA 4CGDA 1TL3A 3A2FA 1IH7A 1VSKA 2P51A 2A1SA 3SPYA 3MXMA 3F73A 1U45A 1TK5A 4J2AA 3S3OA 3OYFA 3HXMA 3PUFA 3HVRA 1Z26A 4XIUA 4CJVA 4FLTA 4DG1A 3L2QA 4Z0UA 1TAQA 4FJIA 1QQCA 4DQIA 3S3NA 1X9MA 3ZSWA 1ZBIA 3L2UA 1BISA 4E3SA 1NK9A 2G8HA 3TR8A 3AO1A 4EZ6A 3DLRA 3UIQA 3CM6A 2YV0X 1RBTA 3SZ2A 4B9NA 2HHUA 2DTUA 4C8LA 4C8NA 3HPOA 3SCXA 1WAJA 1HYVA 2QXFA 3G0ZA 4ID1A 4CJ4A 3I0RA 4CJ5A 4RW7A 4W5RA 3O3HA 2PZSA 3K2PA 5FRMA 3PX6A 4ID5A 3LAKA 3ZT1A 1VSJA 1RDAA 2RF2A 4IFYA 1U47A 1SL0A 1SKWA 1IO2A 3PY8A 4QAGA 4DTRA 1D9FA 4M3ZA 3O4QA 2O4IA 1FXXA 2OZMA 4FJGA 4N41A 1W9HA 4M41A 3I8DA 5J2PA 4FJ5A 1DTQA 3C95A 3EZ5A 4KHWA 3ASMA 4CJ3A 3MEEA 4DTNA 1RT2A 1RNHA 3AVFA 4FCYA 4CEAA 3AO2A 1FKOA 3AVJA 4BWJA 3VQ6A 3ZSRA 3SYZA 1QSLA 4FJLA 4DU3A 4Z4IA 1JXBA 1WSIA 2FBTA 4M3TA 3FFIA 1SL2A 4FLZA 4ELVA 4O5BA 2R7YA 3THVA 4M42A 1B9DA 3AO3A 1SKSA 2XY7A 1W0HA 4F8RA 3AA5X 1JXEA 3LAMA 1T8EA 1UOCA 2ATQA 3VQQA 1JKHA 1KVBA 4DU1A 4CGJA 1GOCA 4Z4GA 5CZ2A 3LZIA 2D5RA 2F8SA 4GW6A 3V9SA 4DF8A 2HVIA 1J53A 4MFBA 1HPZA 4FLXA 3LWLA 1SUQA 3U6FA 3OYJA 4DF4A 4FXDA 1J9AA 3S3MA 1S1XA 4FJ9A 3SUQA 1NK7A 1IKWA 1TKXA 4KO0A 4CGGA 3DRPA 4CFDA 4FM1A 4BWMA 2OPQA 1D8YA 3DRSA 4AHTA 4CHOA 3QERA 3DOKA 4B8CA 1RT7A 4C8MA 2WOMA 4KRFA 1NJYA 5DK5A 4Z4HA 4HUFA 4B9VA 1LW2A 4B8AB 4DSJA 3KD1E 1G15A 1BQMA 1VRTA 2ETJA 3AVLA 3P5JA 4OKJA 1WSFA 1QSSA 1RDDA 4FJJA 1C0TA 4N5SA 3SNNA 3RMAA 4M3WA 1ASWA 4CIFA 3ZT2A 1YT3A 5T7BA 3KK3A 4BDYA 3H08A 3HYFA 4M3RA 4GMJB 4DMNA 3NF8A 4KB1A 1KCFA 1JLEA 1BL3A 5I42A 2A1RA 3QO9A 1K6YA 1J5OA 4E7IA 2Q3SA 3C6TA 1RT3A 3VN5A 3V9WA 1JL2A 3HP9A 2HMIA 3AO4A 3VA0A 2OPPA 3VQ9A 3OYNA 4RW6A 1NK4A 1Z25A 4I7FA 3VQEA 4E7HA 4N76A 4BACA 3L3UA 1ZBLA 4IG3A 2G8FA 3NGZA 1XWLA 2EHGA 3LPTA 3VA3A 3SQ1A 1DLOA 1Q9YA 1KVAA 2D0AA 1RTJA 2NUBA 4DQRA 4H8KA 4DFPA 4FZYA 2X6SA 1EKEA 1HMVA 2XO7A 4IG0A 3SUNA 5FDLA 1RTIA 1YTAA 4PA1A 3NBPA 3AO5A 3TAMA 3V81A 2HW3A 1MU2A 3ALYA 5C25A 4OPKA 4ZTJA 4CJEA 3HO1A 2P1JA 3LWMA 3BDPA 3HPGA 4FLYA 3KLGA 5C24A 1D9DA 5J2NA 1QE1A 4CF2A 4CF9A 4C8OA 4CEFA 1JLAA 4CFCA 4CHZA 1VSDA 1GOAA 3MEDA 1C0UA 4B9MA 4J2EA 2E6LA 4KPYA 1DTTA 4FK0A 3AVNA 4O44A 3AA4A 3OJSA 4DTXA 3V1RA 3PO5A 4ELUA 3RWUA 3K5MA 3RRGA 2HHSA 2I5JA 4IBNA 3VQ4A 3LP0A 1TKZA 1QTMA 3NDKA 3PO4A 4B9SA 5HRSA 4C8KA 3DOLA 4B08A 3QEPA 3DLHA 4F3TA 1BIUA 1FK9A 4KTZA 2PYLA 3LDSA 1JLFA 3V4IA 4F4KA 1CZBA 2XY5A 4CF0A 4AHCA 3NH1A 4FJXA 4AHRA 5JS1A 4FYDA 4FK2A 3S9HA 1L3TA 1RDBA 3RMBA 1NOZA 4KTWA 1RTDA 4CJWA 4NCGA 1NKEA 1C1BA 3QEWA 1CXUA 1ZBFA 4CFAA 4KHNA 4KHUA 2KW4A 4RW8A 3LZJA 2HHTA 4O55A 4IKFA 3HK2A 2DY4A 1KLNA 1XI1A 1CLQA 3OYLA 3M8SA 2XY6A 1L3VA 1SV5A 1TV6A 3OYGA 4DS5A 2VG5A 3MXIA 3LALA 4OKEA 3QESA 4HHTA 3KKRA 5HROA 3ZT3A 4HUGA 3DLGA 4FW1A 3OY9A 2KFNA 3ULDA 4M3UA 3ZT4A 1Y97A 1NOYA 4FJHA 1VSHA 3HVTA 2F96A 3CFOA 3DLEA 4EZ9A 2HNDA 1VSFA 3AVHA 1D5AA 4RW4A 4CJUA 1YVUA 2Y1JA 4M45A 1TKDA 4FLUA 3OYIA 1JLQA 3AVGA 2X74A 3E01A 3VQDA 4CJPA 1S9EA 2P5GA 3RRHA 2BANA 4CGHA 4FJNA 4R5PA 2QK9A 3L8BA 3O3GA 1WSGA 1U49A 3VQPA 3L3VA 3VQCA 3AVAA 1BI4B 4LD0A 4FJ7A 3ZSYA 1HNIA 1S1VA 1RT4A 3KIOA 3HSTB 3OYKA 1VSEA 4CE9A 3NE6A 1RBSA 3M8RA 5HRNA 3OYBA 3K57A 4JS4A 2ITGA 2YNIA 4UQGA 4CEBA 4ZHRA 3CFRA 4E7KA 4H4MA 3TAGA 3OJUA 3OYDA 2WONA 4KTQA 4W5QA 4DTPA 3K58A 2QKKA 3NF7A 5E41A 3MAQA 2HVHA 3K5LA 4CF8A 3CQ8A 2G8KA 3HM9A 2YNHA 3IRXA 4LH5A 2Z1IA 3NHGA 2ZE2A 2G8VA 4TSXA 4HTUA 1S6QA 1KSPA 4DTJA 1XHXA 4FZXC 4FVMA 1KFDA 5CY4A 1TK8A 3PV8A 1HYSA 1CXQA 3SI6A 3OS0A 4N47A 1IG9A 3V9XA 3AA2A 3RMDA 3DLKA 2KZMA 4OLBA 1BIZA 5CZ1A 1HRHA 4OKKA 3HT3A 4DTOA 1U4BA 3DLBA 4GVMA 3ZSXA 4MQ3A 1RBUA 3V6DA 5DMRA 4CK3A 4PY5A 4E89A 3AV9A 4CJFA 1EX4A 4FLWA 3C94A 2BGGA 4OJRA 1F21A 5HP1A 3V1QA 4FJ8A 1JL1A 1QS4A 1REVA 1TKTA 3LP1A 4LSLA 5SZTA 2D0BA 1VSLA 4NYFA 3DM2A 4CHQA 5KI6A 3O3FA 1X9WA 1UWBA 3TI0A 3CG7A 1ITGA 4K8XA 2PY5A 4F3OA 3SUOA 3C6UA 1HYZA 3CM5A 2XHBA 4ICLA 3KLHA 4FJKA 2ZQBA 4CJTA 1SKRA 3PX4A 5I3UA 2KFZA 1S5JA 1RDCA 2DFEA 2IAJA 5HBMA 5KRSA 3OS1A 2W42A 2OZSA 2RPIA 4OGCA 1GOBA 1NJWA 4DFKA 4KV8A 4DQSA 1U48A 3ZSQA 5J1EA 3KLFA 4KHSA 2JLEA 3OYAA 1EETA 4CJLA 3CFPA 2B6AA 4OPJA 4B3OA 4Z4FA 4J2DA 4NCBA 2DFFA 3VQ8A 1A5VA 5C42A 2JGUA 3LP3A 4I2QA 3KTQA 2F8TA 4CIEA 1UA1A 2HNYA 1TL1A 1TK0A 4M3XA 1S1WA 4J2BA 1WSJA 1N6QA 4DWIA 4RW9A 4YFUA 5HRRA 3VQ5A 3KLEA 3F9KA 4FW2A 4I9LA 3KJVA 4HCBA 4I9QA 1HJRA 4KI4A 4CGIA 4FK4A 4Z4EA 4N56A 3QETA 1LWCA 4KHYA 4Z4CA 4CEOA 3TABA 3OYCA 3RTVA 3RR7A 1S9GA 1FKPA 3D45A 2G8IA 1LAVA 4PQUA 5K14A 3K5OA 1KFSA 1JLBA 3ZT0A 2GUIA 2HHXA 1NKBA 2G8WA 1LV5A 4KAZA 1I39A 4B9UA 1WN7A 4CGFA 2PYJA 4AHSA 4NYNA 3B6OA 4JLHA 3I0SA 5HRPA 3OYHA 4W5OA 1JLCA 4DQQA 4DSLA 3OYMA 5CYQA 1WAFA 2FBXA 2YHBA 3QINA 1X9SA 1RT6A 1B92A 1C0MA 2OPRA 4E7LA 5HLFA 2BDPA 3ISNC 2B4JA 4WE1A 1RBVA 1T03A 1ZBUA 5FROA 1EXQA 3NGIA 3KLIA 2HB5A 3DI6A 1NK0A 4E1MA 1L3UA 5EU7A 3K5NA 5JS2A 4OLAA 3PX0A 1RT5A 1ASVA 1NJXA 3WNGA 4K8ZA 1KLMA 1A5WA 1S1TA 5KGWA 3HP6A 4Y1DA 4PUOA 4LY7A 3HJFA 4JS5A 3WNHA 3AVMA 2VG6A 3SV4A 2XY8A 1EP4A 2FBYA 5KTQA 3TAPA 1LWFA 1NKCA 1T7PA 4CERA 3IS9A 3BGRA 2YKNA 4LH4A 1WLJA 4CHNA 3NAEA 1Q9XA 4DFJA 4F2SA 3D0PA 4CHYA 1J54A 4KKOA 1ZYQA 3NGYA 3JSMA 1U04A 1NK6A 2FC0A 4F2RA 4AILC 4CK2A 3KKSA 4RG8A 2XRIA 2VG7A 4BE2A 3EYZA 3EY1A 1VSMA 3TARA 3IG1A 3NCIA 4NCAA 4FZZA 1TAUA 4CCHA 1BI4A 2X6NA 2OPSA 4CEQA 3DMJA 3AVCA 2E6MA 2HHQA 3AVIA 2DFHA 1IKVA 1O1WA 2YKMA 1ZBHA 3M8QA 2GBZA 4CJKA 2YNFA 1TGOA 4DSIA 4CEZA 3TAEA 2EX3A 3MEGA 4EP5A 2P5OA 3K59A 3NF9A 4CJRA 2HNZA 1A5XA 3OS2A 3B6PA 3L2RA 1RBRA 4KI6A 2IDOA 2Y1IA 4CJSA 1VSIA 4DU4A 1KVCA 5J2QA 3U3GA 4JRQA 3SUPA 5CYMA 3L2WA 3QIPA 3O4NA 4CK1A 4EP4A 2VWJA 1I3AA 4DSEA 2IGIA 2G8UA 1WNSA 2X78A 3OVNA 4KFBA 3L2VA 3MECA 2RKIA 3TAFA 4IFVA 2Z1GA 4HVJA
chains in the Genus database with same CATH superfamily
4FLVA 1VAZA 4KHQA 3VEWA 3DXKB 4DS4A 1XC9A 3DYAA 1B9FA 1C0FA 4A61A 5SWMA 4DV5K 3SJJA 4JD2B 4BGBA 3PLAA 5TKYA 5B8HA 4CVNE 4DCHA 1RCHA 3IUCA 4QOZB 4FM0A 1JLGA 2AJQA 3J8AA 4BRCA 1YTUA 5F2RA 3KD5E 1N5YA 2FBVA 4BDPA 3BY5A 3VQAA 1C1AA 3KVGA 1BHLA 2VYPA 4Q5VA 4AF1A 2H3GX 2IS3A 3D2FA 4BVPA 3NFAA 1WSHA 1VRUA 1X3NA 1R0AA 2O4GA 1RILA 4H0YB 4E19A 4DSKA 3LP2A 4E0DA 3SJHA 2Z1JA 2IOCA 3V1OA 1LW0A 3QEIA 1L5UA 1NGDA 2OCEA 3THXA 4PKGA 5JLFA 3T3FA 2KLAA 1W2BM 1NLVA 4O0IA 3V9ZA 3THWB 4R79A 1K9MO 3MN5A 4JRPA 1S3XA 2P9LA 3OYEA 1IKYA 1Q8IA 4DR7K 4E7JA 2YJEA 1HNVA 3M8PA 3OBYA 3SQ0A 4CZFA 1WSEA 3J80O 4CEDA 5FPEA 2OYQA 4CECA 2O8EA 5AQFA 3MXMA 1TK5A 3WQTA 3HXMA 4PKIA 4LFBK 3UKRB 4DG1A 1KXPA 1Y64A 4Z0UA 2NRXA 3ZSWA 4E3SA 1YI2N 3TR8A 3AO1A 3THYB 2Q36A 1RDWX 2O8CA 3CM6A 3SAFA 2W41A 4BC2A 3G0ZA 4WF9L 3CJ1A 1VQLN 1QVGM 1IBMK 1J5EK 3MWPA 2WTUA 4OPHA 4YHHK 3H3NO 1SKWA 3PY8A 2KKZA 3DAWA 1NWKA 1D9FA 3O4QA 1FXXA 2OZMA 4FJGA 4XH5A 3I8DA 3C95A 2QM1A 4DTNA 2ZM6K 4K42A 4CEAA 3VQ6A 4FJLA 3WUHA 2D0PA 2I7PA 4BC4A 3HOSA 1SL2A 1W0HA 1VQ4N 4F8RA 5EOYA 5BRDA 1JXEA 4GKKK 1JCFA 3DXMA 4Z4GA 2WC9A 3WQUA 3DXKA 4X65K 1HPZA 4FOEA 3JXUA 3OYJA 3OBWA 1NK7A 1IKWA 4CGGA 4CFDA 3CC7N 4BWMA 1VHXA 4B8CA 4KRFA 4Z4HA 3FZKA 4HUFA 1LW2A 3KD1E 2ETJA 4OKJA 3P5JA 4CBWA 1BUPA 1HLUA 3SNNA 3VTIA 4CIFA 1YT3A 5ADXH 4M3RA 4DMNA 1HNZK 3QDKA 3NF8A 2P9IA 4KB1A 4B1YB 1KCFA 4B1ZA 4H5RA 4E7IA 3C6TA 3VN5A 4FWOA 3ATVA 3CERA 3M6GA 3VQ9A 3OYNA 1NK4A 2Q31A 3GDQA 3VQEA 3VA3A 2NUBA 1SAZA 4H8KA 3AGRA 1WUAA 5AQZA 3NVKA 5FDLA 4CZLA 2HW3A 1LCUA 3W3DA 4ZTJA 2UXBK 2E2OA 2P1JA 1I94K 2ITMA 4CEFA 1JLAA 4CFCA 2BUPA 5AQMA 3MEDA 2E6LA 4BRDA 3AVNA 2FF3B 1P90A 3AA4A 1YF5L 4EIAA 2HHSA 2VCPA 3LP0A 3WXJA 3A5NC 3NDKA 4B9SA 3R8EA 3VETA 4B08A 4QS7A 1E4GT 5BREA 2PYLA 5HOOA 1CZBA 2XY5A 4F4KA 5BPMA 1L3TA 1RDBA 2QXLA 4FWPA 1NOZA 4NCGA 3QEWA 1CXUA 4CFAA 4KHUA 2KW4A 5AQOA 4NXMK 4FL9A 4BRKA 1L3VA 1SV5A 1QQOA 1TV6A 3CPWM 1GLCG 1OH5A 4FW1A 3OY9A 3I8BA 3ULDA 1Y97A 4FWSA 1VSHA 3BF3A 4IDHA 5E84A 1VSFA 4CI6A 1YVUA 3C65A 4FLUA 1JLQA 3AVGA 4CJPA 2BANA 3SAGA 2QK9A 3L8BA 3O3GA 4GVEA 4JYAK 1U49A 2O8FB 3VQCA 4A5AA 1NG9A 4FJ7A 3ZSYA 1VSEA 4CE9A 1RBSA 4BRFA 5HRNA 3OYBA 4JS4A 3ZETB 2ITGA 2HBKA 4E7KA 3CJ7A 4H4MA 4KTQA 4W5QA 2P9NA 1HKGA 3K58A 4MDAA 2D0OA 4BR4A 2ZE2A 3EEQA 3R6MA 3DLLL 4FZXC 4FVMA 1KFDA 1T3VA 3PV8A 1CXQA 3OS0A 3EE8A 4KH5A 4BRQA 1BIZA 1ZC6A 4OKKA 5GAEP 3ZSXA 1XUPO 3V6DA 2OTLN 5HP1A 1F21A 4FJ8A 1JL1A 3BUZB 4F9OA 3LP1A 3GOIA 1Q18A 4CHQA 3O3FA 3EKUA 4H0VB 2A6AA 5I3UA 3TSQA 5C10A 2W42A 2DFEA 5HBMA 4OGCA 4DQSA 1U48A 2JLEA 5GADP 3CFPA 4B3OA 1Z6RA 5CHIA 5TKWA 4JV5K 5AQUA 3VQ8A 1A5VA 1UA1A 3UKUB 1S1WA 5FPNA 4J2BA 4J2EA 5AQSA 1N6QA 4RW9A 4YOTA 1GLLO 3CCUN 1HJRA 4CGIA 4A5BA 5AQTA 4FK4A 4N56A 1VQ6N 3WT0A 3RR7A 1S9GA 4PQUA 2A3ZA 1RGIA 1LV5A 1I39A 4G9ZA 1ATRA 3MCPA 1JLCA 5GAGP 3OYMA 1H1VA 4KH4A 1X9SA 1QQMA 1B92A 1C0MA 4K43A 5LJVA 5KPTA 1TUUA 4IZ9A 4OPAA 1EXQA 3NGIA 1X3MA 2HB5A 1HNWK 1L3UA 4IJNA 5EU7A 3J7YP 1RT5A 1ASVA 4K8ZA 1ATSA 3HJFA 3T1YK 5BN9A 3AVMA 4HTLA 3SV4A 1NBWA 4JKCA 1T7PA 3H1QA 2YKNA 1QHAA 1WLJA 4CHNA 2VWBA 3LM2A 4DFJA 4F2SA 4DQ8A 1J54A 3H45C 3NGYA 4CK2A 3KKSA 2XRIA 2VG7A 5C15A 4BC3A 1BO5O 3BP8A 4JKAA 4B1WB 4DV4K 2E6MA 4QS9A 1WB9A 2YKMA 3CJBA 2HOEA 3IKMA 3BEXA 4FOIA 2YNFA 1JJ2M 3MEGA 4EP5A 2HNZA 3OS2A 5M1FA 3U3GA 2VWJA 4CK1A 2GWJA 1WNSA 4HVJA 5H1SQ 4B9TA 1K8AO 2NRTA 1SL1A 4W5TA 4LSNA 4AHUA 1NJZA 4EFHA 4DR3K 2KZZA 1KRPA 1BQNA 2HHHK 4H03B 1RT1A 2LSNA 3KK2A 4DTMA 3CMEN 4DSFA 4YNQA 2GV9A 3RMCA 3HOTA 3QEXA 5AQLA 4OVLA 2RN2A 2GX9A 1VQ9N 1C6VA 3QLHA 4JNEA 2QWPA 2VWKA 4B1XB 2YHAA 4DQPA 3ENBA 4CF1A 2ZD1A 5KRTA 3AVKA 4BR2A 4L8RB 1HNXK 3KZBA 3VQBA 2BE2A 1P8ZA 4LF6K 1NK8A 2QWRA 3KWIA 4DLGA 3FE1A 5JICA 3FZMA 4FJMA 3MDQA 3F2KA 5AZIB 3ZSVA 1XHZA 1VQMN 4ELTA 5J2MA 4DTSA 1WOQA 5FRNA 3MXJA 1NGAA 1IKXA 3QIOA 4KH6A 2IIRA 2PBDA 3IAYA 3TANA 3LM9A 1VK0A 2BH1A 4MLHA 1KTQA 5AQQA 4IDKA 1UA0A 4CJQA 1LWEA 2AP1A 3P1GA 2OTJN 3LDQA 3A2FA 3VPZA 3SPYA 2KHOA 4H0OA 1U45A 3S3OA 3CCSN 1Z26A 2HBLA 1HJOA 2D1KA 4FWRA 1TAQA 3EE9A 2F4VK 3L2UA 1IBLK 4MO4A 4C1NK 4B9NA 4NXNK 2UXCK 4C8NA 2A41A 4IFEA 4IJAA 4ID1A 1HYVA 2NRHA 5AQHA 3O3HA 3PX6A 4ID5A 3ATUA 2NRWA 1JCEA 1U47A 1SL0A 3WEEA 4M3ZA 4N41A 1Q82O 2Q0RA 1W9HA 3G71N 3L4IA 5J2PA 3EZ5A 4KHWA 3OA9A 3AVJA 4BWJA 3ZSRA 4PHTX 3CCQN 4PWDA 3ID8A 4I6MB 4DR2K 2FBTA 4BGAA 4WFAL 4FLZA 4BR7A 3D2EA 1B9DA 3AO3A 4EHTA 4B3TK 4X62K 1T8EA 2ATQA 1NMNA 3EKSA 1KVBA 3MN9A 3N4PA 5CZ2A 2F8SA 3N4QA 3UB5A 2HVIA 4MFBA 5AQYA 3LWLA 1SUQA 4DF4A 5AQRA 4FXDA 3S3MA 5EXWA 4FJ9A 3ZX2A 5AZJB 4FM1A 3HRGA 5AFUA 3DOKA 3CD6N 1NJYA 3P38A 5M1PA 4DSJA 1G15A 1VRTA 5AFUH 1QSSA 1RDDA 4FJJA 3ZT2A 3H08A 2YHWA 2NRZA 3VF6A 2A1RA 3E1YA 2A42A 3CQYA 2WFBA 3HP9A 4JK7A 4UY8O 3AO4A 3VA0A 2OPPA 3L6QA 2E20A 4I7FA 2VGMA 4N76A 3VF4A 2P9KB 1ZBLA 1DLOA 1KVAA 4FWNA 4FZYA 1SS6A 3OHRA 3SK3A 3TAMA 4BRGA 1WBBA 5C25A 4OPKA 3HO1A 5AZIA 3KHYA 3CCJN 2GELA 3HPGA 4X66K 5EY4A 1QE1A 5BRFA 4CF2A 5J2NA 4CHZA 2FXUA 4FK0A 4IWVA 1R59O 3V1RA 5GIPA 3K5MA 1K8KB 3O4WA 1TKZA 2CGLA 1QTMA 5KPRA 4JHDB 4JKGB 3DOLA 1JLFA 3VENA 5M1NA 3A0IX 3RMBA 3O5BA 1BG3A 1W97L 4KTWA 3CCMN 4JAXA 3VGLA 1RFQA 1Q7YO 2HHTA 4IKFA 2DY4A 1OKJA 2UYTA 4O8UA 4CD3A 3FZHA 3LL3A 1QQNA 4DS5A 3ZT3A 2KFNA 4BC5A 5ELZA 3HVTA 2F96A 3CFOA 4A2BA 3T69A 4JKBA 1NGIA 3O9TA 2X74A 1GLJO 2D4WA 4FSVA 3RRHA 4FJNA 1WSGA 3I55N 5JVGL 4ILJA 3MX5A 1NGJA 3KIOA 3HSTB 4JI4K 4NB4A 4BRLA 4CEBA 3TAGA 1T44A 3OJUA 3OYDA 2ZGZA 3R1XA 4DTPA 1ATNA 4BRNA 4PL8A 3CHWA 5E41A 4BG9A 3K5LA 3HM9A 2YNHA 2ZF5O 4JD2A 3UE5A 1NNEA 4JI7K 3A5LC 2FLOA 1NGCA 1QVFM 1S6QA 4NLBA 1NJIO 1KSPA 1IV0A 4DUYK 3VGKA 1MWMA 5CR4A 1TUYA 5AZJA 3A8YA 2I7NA 1HYSA 4N47A 1IG9A 1G99A 3AA2A 5AQIA 5ADXA 3RMDA 1NGEA 2KZMA 1OVQA 4DTOA 4BRMA 1KC8O 3DLBA 1ZXOA 4CK3A 4NO7A 4CJFA 3C94A 2BGGA 1QS4A 5LMNK 2W40A 4NYFA 3DM2A 3QICA 1X9WA 1UWBA 3TI0A 4BQZA 4F3OA 1E3MA 4FJKA 2UUCK 3KLHA 4JI8K 2ZJPL 3C6AA 4CJTA 1YIJN 1T6CA 2KFZA 3GG4A 2IAJA 3OS1A 1NJWA 4DFKA 1XC3A 3ZSQA 3OYAA 3AAQA 2B6AA 2P9SB 1RDUA 3AAPA 4Z4FA 4NCBA 3T1HK 3LP3A 3THWA 4KHPK 2HNYA 1TK0A 3P4IA 1V4SA 3BZCA 4EHUA 4YFUA 3KLEA 4I9LA 3LDOA 4YOYA 2QEXN 3TABA 3OYCA 1DGKN 1VQKN 5K14A 1KFSA 1JLBA 4JHDA 4JKGA 4KAZA 1KD1O 2PYJA 1GLFO 1IG8A 4AQYK 5HRPA 2NRRA 3C7NB 4W5OA 3UKRA 5F0XA 1WAFA 2FBXA 3QBXA 2YHBA 4ILHA 2OPRA 3MX2A 4E7LA 3THYA 4WCEL 4HWIA 4E1MA 1D4XA 4DV1K 3K5NA 4V19S 3ZEUB 5A2QO 3ENOA 1KLMA 1A5WA 5KGWA 3U9DA 5KPZA 2YCHA 1VQPN 3SAHA 3O9UA 2P9PB 3WNHA 2XY8A 1EP4A 2FBYA 1VQ7N 4GKJK 4FWKA 2O8BB 3MK6A 3NAEA 1EWQA 4DR4K 1U04A 4CD1A 3G25A 2ZJRL 1NK6A 2VQEK 3TARA 1VSMA 3TTDA 3JAMO 2X6NA 4CCHA 3DMJA 2ASPA 3SLCA 4CJKA 4IEEA 5GAHP 4O8KA 4CEZA 3TAEA 2JWLA 2EX3A 3OW2M 1A5XA 3L2RA 3B6PA 4KI6A 1RBRA 4JN4A 4ISGA 3E9PA 2V7YA 4H5WA 3W0LA 4DU4A 3QIPA 3ZYYX 5KQ8A 2IGIA 4BRPA 4YY3K 2X78A 1M1KO 4BR9A 3MECA 2Z1GA 4J2AA 4HUEA 2E1YA 4KHYA 4E1NA 2W6LA 5JLHA 3E9LA 2QI2A 2YNGA 3P39A 3ZCMA 4BDZA 1DEJA 1BA1A 3CJCA 4AH9A 3LDLA 1S6PA 4CIGA 4BR0A 2NRVA 1Q81O 3DRRA 2QKBA 1CZAN 3LPUA 4Y1CA 2E2NA 2PFUA 3SQ4A 5D3GA 1HQEA 4BRAA 5AQVA 4FM2A 3NH0A 1VQ8N 3TTCA 3VQ7A 4NLCA 4CFBA 3TWHA 4CBXA 1C0GA 4MDBA 3WNFA 4IEIA 3M3ZA 1LAWA 1SZ2A 3P83D 1YITN 4PY5A 4DV7K 3L0QA 1S1UA 4B9LA 3KK1A 1VQNN 4CHPA 4KB0A 1C1CA 1HQUA 2QWLA 3CCRN 4BE0A 3V9UA 3HSCA 4QCLA 1NK5A 3VERA 5BN8A 3AGKA 4Q0BA 4J8FA 1T05A 2QTDA 3NH2A 4GV3A 3QBWA 1MA9B 2B5JA 1BOTO 1GLAG 3TAQA 3VEYA 1TVRA 3ITHA 3ZSZA 3AA3A 2E4LA 3T19A 4GV6A 1XQSC 4PL7A 1HX1A 5EX5A 2Z1HA 1ASUA 5AQPA 4CGDA 1IH7A 2A1SA 1HR0K 4DR5K 4Y0WA 2YX6A 3OYFA 3PUFA 4CJVA 3F9MA 4FLTA 3ZEUA 4C1NI 4DQIA 1ZBIA 1BISA 1NK9A 2G8HA 4EZ6A 4YOWA 2W6KA 3UIQA 2YV0X 2DTUA 4C8LA 3SCXA 3VEVA 1WAJA 2QXFA 3O1WA 4CJ4A 2O8BA 3I0RA 3U4LA 4W5RA 5FRMA 3K2PA 1NM1A 4CZEA 1J6ZA 3ZT1A 4YDUC 4EAHD 4AM6A 1RDAA 4IFYA 4M63C 2O8FA 4JI1K 4QAGA 2O4IA 3ZETA 4FPBA 4CJ3A 3MEEA 4WQ4C 1RT2A 4FCYA 2DPNA 1QSLA 1FKOA 4Z4IA 1JXBA 1WSIA 1EWRA 3FFIA 3CCEN 4O5BA 1SKSA 2XY7A 4JKEA 5I9EB 3LAMA 2QW9A 3VQQA 4JI2K 4CGJA 1GOCA 4YOXA 2D5RA 4IOXA 4FWMA 4GW6A 4LF5K 3V9SA 4DF8A 4FO0A 3O08A 5AQXA 3I33A 1S1XA 5GINA 1W7AA 1TKXA 1U2VB 4CBUA 1D8YA 1S72N 3QERA 2WUSA 3O80A 2UXDK 2WOMA 5DK5A 4B8AB 1YVNA 1WSFA 1C0TA 4BROA 3RMAA 1ASWA 4BDYA 5T7BA 4GMJB 4ILGB 4JK8A 4CZMA 1JLEA 1BL3A 5I42A 2ZWHA 3QO9A 1K6YA 1J5OA 2Q3SA 3Q7BA 1JL2A 3V9WA 3TPQA 4RW6A 4BREA 1Z25A 2G8IA 3L3UA 4IG3A 2G8FA 1ZBSA 1XWLA 3LPTA 3UKUA 2ZGYA 1Q9YA 5IWAK 1RTJA 4GY2B 2X6SA 1YJWN 1VQ5N 1HMVA 2XO7A 4IG0A 4M7YA 3U8XA 3V81A 1YJNN 3NBPA 3D7EO 2AA4A 2QA4N 3ALYA 3BDPA 4FLYA 3KLGA 5C24A 1D9DA 2GUPA 4CF9A 2CH5A 3ZLJA 5LJWA 1VSDA 1GOAA 4B9MA 4KPYA 4JEPA 2NLXA 3THXB 3PO5A 4ELUA 1N8RO 3RWUA 3VQ4A 3PSIA 3TSPA 2VGNA 3SMSA 4C8KA 2P9LB 4F3TA 1BIUA 1FK9A 3LDSA 3T7ZA 2YHXA 4IO8A 3K9KA 4FJXA 4AHRA 4LF8K 4FK2A 3S9HA 4YDUA 2F7TA 3H3OB 1C1BA 5IT9O 4B1VA 5HL7L 4RW8A 3LZJA 2ASMA 3HK2A 3M5RA 1KLNA 3SBTA 3OYLA 3M8SA 2XY6A 2E5LK 4WQ4A 1SQKA 3D6RA 3NMUA 5BR9A 3LALA 4OKEA 5M1KA 3AARA 4K41A 4HUGA 5AQKA 2O8CB 4FJHA 3PSFA 4EZ9A 3DLEA 2Q97A 4RW4A 4WFBL 3IDHA 4M45A 3OYIA 4LFAK 1X9JA 2CGKA 3VQDA 4DR1K 1S9EA 4CGHA 3IMXA 2UUAK 4R5PA 4LF4K 3CPEA 4LF9K 4LD0A 3TSUA 1S1VA 3VESA 1RT4A 3NE6A 2QWMA 3K57A 2YNIA 4H5NA 4ZHRA 4CZHA 3CFRA 2IVOA 2VQFK 1ILYA 4C23A 1QZ5A 2QKKA 2Q1NA 3NF7A 3MAQA 2HVHA 4CF8A 3IRXA 2Z1IA 3NHGA 2G8VA 4HTUA 4DV6K 4DTJA 3QB0A 4OX9K 4GNIA 3DXMB 1TK8A 3R9PA 3SI6A 1QZ6A 2CH6A 3DLKA 5CZ1A 1HRHA 2A40A 4QS8A 4GVMA 4MQ3A 1RBUA 4BRHA 5C12A 3FFKB 3AV9A 1EX4A 4DHYA 3V1QA 1U6ZA 3O8MA 1S22A 4LSLA 5KI6A 4IO9L 4B3MK 3ULEB 2UU9K 3CG7A 3F5TA 2PY5A 4XH4A 3SUOA 3C6UA 2XHBA 4ICLA 5M1QA 3CC2N 1SKRA 1N36K 1IJJA 2P9IB 2RHKA 1S5JA 1RDCA 5KRSA 4BY9C 2OZSA 1GOBA 3PIPL 4KV8A 2E88A 1EETA 2IVNA 4CJLA 4J2DA 2DFFA 3DWLA 2HSTA 5C42A 4I2QA 3M1FA 3KTQA 4CIEA 1OH8A 4CW7B 4M3XA 1WSJA 1DKGD 4MO5A 3VQ5A 3F9KA 4FW2A 3FZFA 4KI4A 4JKHA 1NU0A 3VEOA 4Z4EA 3QETA 1BWFO 2ASOA 3DJCA 4Z4CA 2E8AA 3E9OA 1FKPA 3D45A 1LAVA 3FR0A 3K5OA 3VMFB 3MCAB 2G8WA 4DB3A 3HBTA 1WN7A 4H0XB 4CGFA 4NYNA 4E1JA 4DSLA 3I0SA 2E2QA 1E4FT 2A5XA 3QFPA 3PIOL 3ISNC 2BDPA 1NGGA 4WE1A 1ZBUA 5FROA 2NNWA 3KLIA 3DI6A 3KK7A 5JS2A 4OLAA 2HBMA 3WNGA 1N32K 1S1TA 3HP6A 4X64K 3C6HA 2HMPA 4JS5A 3CIPA 3TAPA 1LWFA 3CF5L 1NKCA 4CERA 3IS9A 3H1VX 2QWNA 1KAXA 2HF3A 1Q9XA 3D0PA 4CHYA 2FC0A 4F2RA 4XEIA 4I6MA 4RG8A 5DM7L 2FSKA 4BE2A 2O8DB 3O1BA 3EY1A 4NCAA 3IG1A 3NCIA 3I56N 4B3RK 4CEQA 4JI5K 2OANA 1IKVA 1ESVA 2GBZA 1TGOA 2CGJA 3FLCO 2P5OA 4O5FA 3NF9A 1FW6A 2IDOA 2Y1IA 3WXLA 4CJSA 2FSNA 3TTFA 5J2QA 2ZJQL 4JRQA 3SUPA 5CYMA 3L2WA 1RTDA 4EP4A 2G8UA 5LMUK 3OVNA 4KFBA 2RKIA 3O9QA 3TAFA 2P9NB 4H0TB 5C2FA 2RE2A 1NGFA 1MDUB 4G1QA 4DFMA 3HM8A 1RTHA 3HZ6A 4DV2K 5E26A 3WNEA 2OA8A 2WBNA 4CZKA 4JK9A 2KQ2A 3HL8A 1YHQN 4O4GA 3LANA 4ZTFA 4CZIA 3QNNA 4KREA 5F1XA 3ZSOA 1BDGA 3A5MC 3G10A 4GV9A 3ULEA 1BCMA 3SQ2A 2D0CA 4B1UB 2P9KA 4M3YA 4OGEA 4CEEA 4DTUA 3AVBA 3QNOA 3K9JA 2GEMA 4HCCA 3VEZA 4DLEA 4WFNL 4CESA 1BCOA 4AHVA 3RR8A 1QHTA 1Q86O 3WXKA 1CZ9A 2Q2RA 1KAZA 1L3SA 3ENHA 4JKDA 1QSYA 4I2PA 2HHVA 5KGXA 2YI1A 3NF6A 1K8KA 2F9TA 2BTFA 3C0BA 4H4OA 5DM6L 4BE1A 4LF7K 2KTQA 1UAXA 3CYMA 4DKWA 2HBJA 4YORA 3JYTA 4W5NA 5MLCQ 4O0JA 3ZX3A 3SV3A 3QEVA 2HHWA 1HUXA 3RSEB 2J4RA 4MLEA 5FPMA 3T1AA 3SPZA 4B3SK 3HPHA 1BGXT 2IC3A 3ZX0A 5C2DA 3U3YA 1X1PA 2GTDA 1TL3A 2QWOA 2YHYA 5AJ3K 1VSKA 2P51A 4DV3K 3F73A 1GLDG 1GLEG 3NVMA 3HVRA 4XIUA 3L2QA 4FJIA 1QQCA 3S3NA 1X9MA 1Z05A 3A5OC 2QWQA 3DLRA 4YOUA 1VQON 1RBTA 3SZ2A 2HHUA 1IBKK 3HPOA 2E1ZA 3VTHA 3G6EN 4CJ5A 4RW7A 2JWKA 2PZSA 4LFCK 3LAKA 2NZTA 3VF2A 1VSJA 4JI6K 2RF2A 1IO2A 4DTRA 2O8DA 4M41A 4FJ5A 1DTQA 1KAYA 3BF1A 4H0PA 3ASMA 3TU5A 1RNHA 3AVFA 3AO2A 3SYZA 4DU3A 4M3TA 4ELVA 2R7YA 3THVA 1YJ9N 4M42A 4CJ7A 1HKBA 3AA5X 1XNRK 1UOCA 4H5VA 3CJAA 1JKHA 4DU1A 4ISFA 3LZIA 4L3QA 1J53A 1JCGA 1HPMA 4FLXA 3U6FA 1J9AA 2IVPA 1TYQB 3SUQA 4KO0A 3DRPA 3MMVA 2OPQA 3CI5A 3DRSA 4AHTA 4CHOA 3J7AP 3IFRA 1RT7A 4C8MA 5AQJA 4B9VA 1BQMA 3AVLA 5AR0A 4N5SA 4M3WA 4IOCL 3KK3A 3HYFA 5C0YA 5LY3A 2V51B 5BR8K 1RT3A 2HMIA 5CE3A 1HKCA 3CC4N 2P9SA 4BRIA 4DUZK 4FWLA 4FPAA 2V52B 4E7HA 4BACA 2GWKA 3NGZA 3SQ1A 2EHGA 2D0AA 3CJ9A 4IXCA 3J81O 4DQRA 4DFPA 5FLXO 1EKEA 4CZGA 3SUNA 4A62A 4WQ5C 1RTIA 1YTAA 4PA1A 3AO5A 1LOTB 1MU2A 4CJEA 3LWMA 4C8OA 2F9WA 4BR5A 3FZLA 3LDPA 3P31A 1NGBA 3KWGA 3MN6A 1C0UA 1DTTA 4O44A 3OJSA 4DTXA 3C7NA 1YUWA 3RRGA 4IOAL 3RSEA 4RWTA 2I5JA 4IBNA 5BRHA 3SBGA 5AQGA 3PO4A 5HRSA 3H6EA 1N33K 3QEPA 5GIOA 3DLHA 5JVHL 4KTZA 3V4IA 4CF0A 3VGMA 4AHCA 3NH1A 5JS1A 3GBTA 4FYDA 4KBOA 4FVUA 1V4TA 3WXIA 4CJWA 3GE1A 1NKEA 2P9PA 4DR6K 4KHNA 1ZBFA 2V7ZA 4O55A 1XMQK 1CLQA 1XI1A 3EN9A 3BZKA 4CZJA 5BPNA 3OYGA 4FWQA 2VG5A 3MXIA 1EO1A 3QESA 4HHTA 3KKRA 5HROA 3DLGA 2Q0UA 4M3UA 3ZT4A 3CQXA 1NOYA 4BQLA 2HNDA 3AVHA 1D5AA 4CJUA 3CCVN 2Y1JA 1TKDA 4BG8A 3E01A 2P5GA 3U9ZA 3VOVA 1YXQA 3WXMB 3S41A 3VQPA 3L3VA 3WEEB 3AVAA 1BI4B 4A59A 1HNIA 3OYKA 3JS6A 5AQNA 4XH1A 3M8RA 3HI0A 4UQGA 3O6WA 2P9UB 2WONA 3HTVA 3G4SN 3OTOK 5JMVA 1BA0A 3CQ8A 2G8KA 4LH5A 1MWKA 4DV0K 3FGUA 1K73O 3D2EB 4TSXA 3K0SA 1TYQA 1XHXA 3E66A 5CY4A 3RVCA 4JKFA 3V9XA 2YJFA 4M7XA 4OLBA 4K0KK 3HT3A 1U4BA 3Q7CA 2PAVA 5DMRA 2FF6A 4E89A 2HF4A 4FLWA 4OJRA 1N34K 4PKHA 3CETA 1REVA 1TKTA 4WQ5A 2D0BA 4AM7A 5SZTA 4JI3K 1VSLA 5BPLA 1FJGK 1ITGA 3O9RA 3VEXA 4K8XA 3J7ZO 1HYZA 3CM5A 2ZQBA 1NGHA 3PX4A 2FSJA 5EVZA 2RPIA 3D2FB 3EO3A 5J1EA 5KQDA 3KLFA 4KHSA 4B9QA 4A57A 4OPJA 3QMLA 3CCLN 1XMOK 2JGUA 2F8TA 3EL2A 1TL1A 3GL1A 4DWIA 4I9QA 5HRRA 3KJVA 4HCBA 3CMAN 4OO1J 1LWCA 3B8AX 4CEOA 1O13A 5AQWA 1DT9A 3RTVA 1OH7A 1NMDA 1OVYA 3ID6A 3ZT0A 2HHXA 2GUIA 1NKBA 3QFUA 4B9UA 4AHSA 3B6OA 4JLHA 3OYHA 4DQQA 5CYQA 3QINA 2O8EB 1RT6A 5HLFA 1GLBG 1YAGA 2B4JA 1RBVA 1T03A 4JI0K 4U7BA 2EWSA 1NK0A 4A2AA 5M1OA 1OH6A 3PX0A 1NJXA 3L4QA 2E2PA 4Y1DA 4PUOA 4LY7A 4H5TA 3MN7A 4ISEA 4Z94A 4U67L 4K25A 2VG6A 3LDNA 5KTQA 4RCHA 3R3LA 1XNQK 3BGRA 3SMPA 4LH4A 4YOVA 5LL6Z 4RTFD 4WYBA 3O9SA 4KKOA 1ZYQA 3JSMA 1BU6O 4AILC 1T6DA 3AY9A 3EZWA 3EYZA 4FZZA 1WBDA 1TAUA 3H46O 1EQYA 1BI4A 2OPSA 4BVOA 3AVCA 2HHQA 3AVIA 2DFHA 1ZBHA 1O1WA 3M8QA 4DSIA 2UUBK 5FPDA 3K59A 2P9UA 1M90O 4CJRA 3CXCM 3MWTA 1VSIA 1KVCA 1KQSM 4DSEA 3O4NA 1U2VA 1I3AA 3L2VA 4LC9B 4IFVA
chains in the Genus database with same CATH topology
4HUEA 4FLVA 4B9TA 4E1NA 4KHQA 1SL1A 4W5TA 4LSNA 3DYAA 4AHUA 1B9FA 4DS4A 1XC9A 1NJZA 4G1QA 5SWMA 4DFMA 3SJJA 2KZZA 1KRPA 1RTHA 3WNEA 2OA8A 2YNGA 1BQNA 1RCHA 2KQ2A 3HL8A 4QOZB 3ZCMA 4BDZA 4O4GA 3LANA 4ZTFA 4AH9A 1RT1A 4FM0A 1JLGA 2LSNA 3KK2A 4DTMA 2AJQA 4DSFA 1S6PA 4YNQA 2GV9A 3QNNA 4CIGA 3RMCA 4KREA 3ZSOA 1YTUA 3G10A 3KD5E 3DRRA 3QEXA 1N5YA 2QKBA 1BCMA 4OVLA 3LPUA 4Y1CA 3SQ4A 2FBVA 2RN2A 4BDPA 5D3GA 3SQ2A 2D0CA 1C6VA 3QLHA 1HQEA 4M3YA 2VWKA 3VQAA 4OGEA 1C1AA 4FM2A 4CEEA 3NH0A 3AVBA 4DTUA 1BHLA 3QNOA 2YHAA 4DQPA 3VQ7A 4Q5VA 4CF1A 2ZD1A 5KRTA 4HCCA 3AVKA 4CFBA 2IS3A 4DLEA 4L8RB 3NFAA 1WSHA 4PWDA 3TWHA 3VQBA 2BE2A 1VRUA 3WNFA 4CESA 1BCOA 4AHVA 1LAWA 1QHTA 1RILA 2O4GA 3P83D 4E19A 1R0AA 3RR8A 1CZ9A 4DSKA 1S1UA 4B9LA 1NK8A 3KK1A 3LP2A 4CHPA 4E0DA 4DLGA 4KB0A 2Z1JA 1C1CA 1HQUA 2IOCA 4BE0A 3V9UA 1L3SA 3V1OA 1LW0A 4FJMA 3QEIA 1L5UA 1QSYA 4I2PA 2HHVA 5KGXA 3T3FA 4QCLA 3NF6A 1NK5A 4Q0BA 3ZSVA 4H4OA 1XHZA 4BE1A 4O0IA 1T05A 4ELTA 3V9ZA 3NH2A 4DTSA 5J2MA 2KTQA 5FRNA 3MXJA 1UAXA 1IKXA 3CYMA 4JRPA 3QIOA 2B5JA 3OYEA 1IKYA 3JYTA 4W5NA 3IAYA 3TAQA 4O0JA 3TANA 1VK0A 1Q8IA 3SV3A 1TVRA 4E7JA 3QEVA 3ITHA 3ZSZA 3AA3A 2HHWA 1HNVA 1KTQA 2E4LA 3M8PA 4IDKA 1UA0A 3T19A 3T1AA 3SQ0A 3SPZA 1WSEA 4CJQA 4CEDA 2Z1HA 4CECA 3HPHA 1LWEA 1BGXT 2IC3A 2OYQA 1ASUA 3P1GA 3U3YA 1X1PA 4CGDA 1TL3A 3A2FA 1IH7A 1VSKA 2P51A 2A1SA 3SPYA 3MXMA 3F73A 1U45A 1TK5A 4J2AA 3S3OA 3OYFA 3HXMA 3PUFA 3HVRA 1Z26A 4XIUA 4CJVA 4FLTA 4DG1A 3L2QA 4Z0UA 1TAQA 4FJIA 1QQCA 4DQIA 3S3NA 1X9MA 3ZSWA 1ZBIA 3L2UA 1BISA 4E3SA 1NK9A 2G8HA 3TR8A 3AO1A 4EZ6A 3DLRA 3UIQA 3CM6A 2YV0X 1RBTA 3SZ2A 4B9NA 2HHUA 2DTUA 4C8LA 4C8NA 3HPOA 3SCXA 1WAJA 1HYVA 2QXFA 3G0ZA 4ID1A 4CJ4A 3I0RA 4CJ5A 4RW7A 4W5RA 3O3HA 2PZSA 3K2PA 5FRMA 3PX6A 4ID5A 3LAKA 3ZT1A 1VSJA 1RDAA 2RF2A 4IFYA 1U47A 1SL0A 1SKWA 1IO2A 3PY8A 4QAGA 4DTRA 1D9FA 4M3ZA 3O4QA 2O4IA 1FXXA 2OZMA 4FJGA 4N41A 1W9HA 4M41A 3I8DA 5J2PA 4FJ5A 1DTQA 3C95A 3EZ5A 4KHWA 3ASMA 4CJ3A 3MEEA 4DTNA 1RT2A 1RNHA 3AVFA 4FCYA 4CEAA 3AO2A 1FKOA 3AVJA 4BWJA 3VQ6A 3ZSRA 3SYZA 1QSLA 4FJLA 4DU3A 4Z4IA 1JXBA 1WSIA 2FBTA 4M3TA 3FFIA 1SL2A 4FLZA 4ELVA 4O5BA 2R7YA 3THVA 4M42A 1B9DA 3AO3A 1SKSA 2XY7A 1W0HA 4F8RA 3AA5X 1JXEA 3LAMA 1T8EA 1UOCA 2ATQA 3VQQA 1JKHA 1KVBA 4DU1A 4CGJA 1GOCA 4Z4GA 5CZ2A 3LZIA 2D5RA 2F8SA 4GW6A 3V9SA 4DF8A 2HVIA 1J53A 4MFBA 1HPZA 4FLXA 3LWLA 1SUQA 3U6FA 3OYJA 4DF4A 4FXDA 1J9AA 3S3MA 1S1XA 4FJ9A 3SUQA 1NK7A 1IKWA 1TKXA 4KO0A 4CGGA 3DRPA 4CFDA 4FM1A 4BWMA 2OPQA 1D8YA 3DRSA 4AHTA 4CHOA 3QERA 3DOKA 4B8CA 1RT7A 4C8MA 2WOMA 4KRFA 1NJYA 5DK5A 4Z4HA 4HUFA 4B9VA 1LW2A 4B8AB 4DSJA 3KD1E 1G15A 1BQMA 1VRTA 2ETJA 3AVLA 3P5JA 4OKJA 1WSFA 1QSSA 1RDDA 4FJJA 1C0TA 4N5SA 3SNNA 3RMAA 4M3WA 1ASWA 4CIFA 3ZT2A 1YT3A 5T7BA 3KK3A 4BDYA 3H08A 3HYFA 4M3RA 4GMJB 4DMNA 3NF8A 4KB1A 1KCFA 1JLEA 1BL3A 5I42A 2A1RA 3QO9A 1K6YA 1J5OA 4E7IA 2Q3SA 3C6TA 1RT3A 3VN5A 3V9WA 1JL2A 3HP9A 2HMIA 3AO4A 3VA0A 2OPPA 3VQ9A 3OYNA 4RW6A 1NK4A 1Z25A 4I7FA 3VQEA 4E7HA 4N76A 4BACA 3L3UA 1ZBLA 4IG3A 2G8FA 3NGZA 1XWLA 2EHGA 3LPTA 3VA3A 3SQ1A 1DLOA 1Q9YA 1KVAA 2D0AA 1RTJA 2NUBA 4DQRA 4H8KA 4DFPA 4FZYA 2X6SA 1EKEA 1HMVA 2XO7A 4IG0A 3SUNA 5FDLA 1RTIA 1YTAA 4PA1A 3NBPA 3AO5A 3TAMA 3V81A 2HW3A 1MU2A 3ALYA 5C25A 4OPKA 4ZTJA 4CJEA 3HO1A 2P1JA 3LWMA 3BDPA 3HPGA 4FLYA 3KLGA 5C24A 1D9DA 5J2NA 1QE1A 4CF2A 4CF9A 4C8OA 4CEFA 1JLAA 4CFCA 4CHZA 1VSDA 1GOAA 3MEDA 1C0UA 4B9MA 4J2EA 2E6LA 4KPYA 1DTTA 4FK0A 3AVNA 4O44A 3AA4A 3OJSA 4DTXA 3V1RA 3PO5A 4ELUA 3RWUA 3K5MA 3RRGA 2HHSA 2I5JA 4IBNA 3VQ4A 3LP0A 1TKZA 1QTMA 3NDKA 3PO4A 4B9SA 5HRSA 4C8KA 3DOLA 4B08A 3QEPA 3DLHA 4F3TA 1BIUA 1FK9A 4KTZA 2PYLA 3LDSA 1JLFA 3V4IA 4F4KA 1CZBA 2XY5A 4CF0A 4AHCA 3NH1A 4FJXA 4AHRA 5JS1A 4FYDA 4FK2A 3S9HA 1L3TA 1RDBA 3RMBA 1NOZA 4KTWA 1RTDA 4CJWA 4NCGA 1NKEA 1C1BA 3QEWA 1CXUA 1ZBFA 4CFAA 4KHNA 4KHUA 2KW4A 4RW8A 3LZJA 2HHTA 4O55A 4IKFA 3HK2A 2DY4A 1KLNA 1XI1A 1CLQA 3OYLA 3M8SA 2XY6A 1L3VA 1SV5A 1TV6A 3OYGA 4DS5A 2VG5A 3MXIA 3LALA 4OKEA 3QESA 4HHTA 3KKRA 5HROA 3ZT3A 4HUGA 3DLGA 4FW1A 3OY9A 2KFNA 3ULDA 4M3UA 3ZT4A 1Y97A 1NOYA 4FJHA 1VSHA 3HVTA 2F96A 3CFOA 3DLEA 4EZ9A 2HNDA 1VSFA 3AVHA 1D5AA 4RW4A 4CJUA 1YVUA 2Y1JA 4M45A 1TKDA 4FLUA 3OYIA 1JLQA 3AVGA 2X74A 3E01A 3VQDA 4CJPA 1S9EA 2P5GA 3RRHA 2BANA 4CGHA 4FJNA 4R5PA 2QK9A 3L8BA 3O3GA 1WSGA 1U49A 3VQPA 3L3VA 3VQCA 3AVAA 1BI4B 4LD0A 4FJ7A 3ZSYA 1HNIA 1S1VA 1RT4A 3KIOA 3HSTB 3OYKA 1VSEA 4CE9A 3NE6A 1RBSA 3M8RA 5HRNA 3OYBA 3K57A 4JS4A 2ITGA 2YNIA 4UQGA 4CEBA 4ZHRA 3CFRA 4E7KA 4H4MA 3TAGA 3OJUA 3OYDA 2WONA 4KTQA 4W5QA 4DTPA 3K58A 2QKKA 3NF7A 5E41A 3MAQA 2HVHA 3K5LA 4CF8A 3CQ8A 2G8KA 3HM9A 2YNHA 3IRXA 4LH5A 2Z1IA 3NHGA 2ZE2A 2G8VA 4TSXA 4HTUA 1S6QA 1KSPA 4DTJA 1XHXA 4FZXC 4FVMA 1KFDA 5CY4A 1TK8A 3PV8A 1HYSA 1CXQA 3SI6A 3OS0A 4N47A 1IG9A 3V9XA 3AA2A 3RMDA 3DLKA 2KZMA 4OLBA 1BIZA 5CZ1A 1HRHA 4OKKA 3HT3A 4DTOA 1U4BA 3DLBA 4GVMA 3ZSXA 4MQ3A 1RBUA 3V6DA 5DMRA 4CK3A 4PY5A 4E89A 3AV9A 4CJFA 1EX4A 4FLWA 3C94A 2BGGA 4OJRA 1F21A 5HP1A 3V1QA 4FJ8A 1JL1A 1QS4A 1REVA 1TKTA 3LP1A 4LSLA 5SZTA 2D0BA 1VSLA 4NYFA 3DM2A 4CHQA 5KI6A 3O3FA 1X9WA 1UWBA 3TI0A 3CG7A 1ITGA 4K8XA 2PY5A 4F3OA 3SUOA 3C6UA 1HYZA 3CM5A 2XHBA 4ICLA 3KLHA 4FJKA 2ZQBA 4CJTA 1SKRA 3PX4A 5I3UA 2KFZA 1S5JA 1RDCA 2DFEA 2IAJA 5HBMA 5KRSA 3OS1A 2W42A 2OZSA 2RPIA 4OGCA 1GOBA 1NJWA 4DFKA 4KV8A 4DQSA 1U48A 3ZSQA 5J1EA 3KLFA 4KHSA 2JLEA 3OYAA 1EETA 4CJLA 3CFPA 2B6AA 4OPJA 4B3OA 4Z4FA 4J2DA 4NCBA 2DFFA 3VQ8A 1A5VA 5C42A 2JGUA 3LP3A 4I2QA 3KTQA 2F8TA 4CIEA 1UA1A 2HNYA 1TL1A 1TK0A 4M3XA 1S1WA 4J2BA 1WSJA 1N6QA 4DWIA 4RW9A 4YFUA 5HRRA 3VQ5A 3KLEA 3F9KA 4FW2A 4I9LA 3KJVA 4HCBA 4I9QA 1HJRA 4KI4A 4CGIA 4FK4A 4Z4EA 4N56A 3QETA 1LWCA 4KHYA 4Z4CA 4CEOA 3TABA 3OYCA 3RTVA 3RR7A 1S9GA 1FKPA 3D45A 2G8IA 1LAVA 4PQUA 5K14A 3K5OA 1KFSA 1JLBA 3ZT0A 2GUIA 2HHXA 1NKBA 2G8WA 1LV5A 4KAZA 1I39A 4B9UA 1WN7A 4CGFA 2PYJA 4AHSA 4NYNA 3B6OA 4JLHA 3I0SA 5HRPA 3OYHA 4W5OA 1JLCA 4DQQA 4DSLA 3OYMA 5CYQA 1WAFA 2FBXA 2YHBA 3QINA 1X9SA 1RT6A 1B92A 1C0MA 2OPRA 4E7LA 5HLFA 2BDPA 3ISNC 2B4JA 4WE1A 1RBVA 1T03A 1ZBUA 5FROA 1EXQA 3NGIA 3KLIA 2HB5A 3DI6A 1NK0A 4E1MA 1L3UA 5EU7A 3K5NA 5JS2A 4OLAA 3PX0A 1RT5A 1ASVA 1NJXA 3WNGA 4K8ZA 1KLMA 1A5WA 1S1TA 5KGWA 3HP6A 4Y1DA 4PUOA 4LY7A 3HJFA 4JS5A 3WNHA 3AVMA 2VG6A 3SV4A 2XY8A 1EP4A 2FBYA 5KTQA 3TAPA 1LWFA 1NKCA 1T7PA 4CERA 3IS9A 3BGRA 2YKNA 4LH4A 1WLJA 4CHNA 3NAEA 1Q9XA 4DFJA 4F2SA 3D0PA 4CHYA 1J54A 4KKOA 1ZYQA 3NGYA 3JSMA 1U04A 1NK6A 2FC0A 4F2RA 4AILC 4CK2A 3KKSA 4RG8A 2XRIA 2VG7A 4BE2A 3EYZA 3EY1A 1VSMA 3TARA 3IG1A 3NCIA 4NCAA 4FZZA 1TAUA 4CCHA 1BI4A 2X6NA 2OPSA 4CEQA 3DMJA 3AVCA 2E6MA 2HHQA 3AVIA 2DFHA 1IKVA 1O1WA 2YKMA 1ZBHA 3M8QA 2GBZA 4CJKA 2YNFA 1TGOA 4DSIA 4CEZA 3TAEA 2EX3A 3MEGA 4EP5A 2P5OA 3K59A 3NF9A 4CJRA 2HNZA 1A5XA 3OS2A 3B6PA 3L2RA 1RBRA 4KI6A 2IDOA 2Y1IA 4CJSA 1VSIA 4DU4A 1KVCA 5J2QA 3U3GA 4JRQA 3SUPA 5CYMA 3L2WA 3QIPA 3O4NA 4CK1A 4EP4A 2VWJA 1I3AA 4DSEA 2IGIA 2G8UA 1WNSA 2X78A 3OVNA 4KFBA 3L2VA 3MECA 2RKIA 3TAFA 4IFVA 2Z1GA 4HVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HUE A;  4FLV A;  4B9T A;  4E1N A;  4KHQ A;  1SL1 A;  4W5T A;  4LSN A;  3DYA A;  4AHU A;  1B9F A;  4DS4 A;  1XC9 A;  1NJZ A;  4G1Q A;  5SWM A;  4DFM A;  3SJJ A;  2KZZ A;  1KRP A;  1RTH A;  3WNE A;  2OA8 A;  2YNG A;  1BQN A;  1RCH A;  2KQ2 A;  3HL8 A;  4QOZ B;  3ZCM A;  4BDZ A;  4O4G A;  3LAN A;  4ZTF A;  4AH9 A;  1RT1 A;  4FM0 A;  1JLG A;  2LSN A;  3KK2 A;  4DTM A;  2AJQ A;  4DSF A;  1S6P A;  4YNQ A;  2GV9 A;  3QNN A;  4CIG A;  3RMC A;  4KRE A;  3ZSO A;  1YTU A;  3G10 A;  3KD5 E;  3DRR A;  3QEX A;  1N5Y A;  2QKB A;  1BCM A;  4OVL A;  3LPU A;  4Y1C A;  3SQ4 A;  2FBV A;  2RN2 A;  4BDP A;  5D3G A;  3SQ2 A;  2D0C A;  1C6V A;  3QLH A;  1HQE A;  4M3Y A;  2VWK A;  3VQA A;  4OGE A;  1C1A A;  4FM2 A;  4CEE A;  3NH0 A;  3AVB A;  4DTU A;  1BHL A;  3QNO A;  2YHA A;  4DQP A;  3VQ7 A;  4Q5V A;  4CF1 A;  2ZD1 A;  5KRT A;  4HCC A;  3AVK A;  4CFB A;  2IS3 A;  4DLE A;  4L8R B;  3NFA A;  1WSH A;  4PWD A;  3TWH A;  3VQB A;  2BE2 A;  1VRU A;  3WNF A;  4CES A;  1BCO A;  4AHV A;  1LAW A;  1QHT A;  1RIL A;  2O4G A;  3P83 D;  4E19 A;  1R0A A;  3RR8 A;  1CZ9 A;  4DSK A;  1S1U A;  4B9L A;  1NK8 A;  3KK1 A;  3LP2 A;  4CHP A;  4E0D A;  4DLG A;  4KB0 A;  2Z1J A;  1C1C A;  1HQU A;  2IOC A;  4BE0 A;  3V9U A;  1L3S A;  3V1O A;  1LW0 A;  4FJM A;  3QEI A;  1L5U A;  1QSY A;  4I2P A;  2HHV A;  5KGX A;  3T3F A;  4QCL A;  3NF6 A;  1NK5 A;  4Q0B A;  3ZSV A;  4H4O A;  1XHZ A;  4BE1 A;  4O0I A;  1T05 A;  4ELT A;  3V9Z A;  3NH2 A;  4DTS A;  5J2M A;  2KTQ A;  5FRN A;  3MXJ A;  1UAX A;  1IKX A;  3CYM A;  4JRP A;  3QIO A;  2B5J A;  3OYE A;  1IKY A;  3JYT A;  4W5N A;  3IAY A;  3TAQ A;  4O0J A;  3TAN A;  1VK0 A;  1Q8I A;  3SV3 A;  1TVR A;  4E7J A;  3QEV A;  3ITH A;  3ZSZ A;  3AA3 A;  2HHW A;  1HNV A;  1KTQ A;  2E4L A;  3M8P A;  4IDK A;  1UA0 A;  3T19 A;  3T1A A;  3SQ0 A;  3SPZ A;  1WSE A;  4CJQ A;  4CED A;  2Z1H A;  4CEC A;  3HPH A;  1LWE A;  1BGX T;  2IC3 A;  2OYQ A;  1ASU A;  3P1G A;  3U3Y A;  1X1P A;  4CGD A;  1TL3 A;  3A2F A;  1IH7 A;  1VSK A;  2P51 A;  2A1S A;  3SPY A;  3MXM A;  3F73 A;  1U45 A;  1TK5 A;  4J2A A;  3S3O A;  3OYF A;  3HXM A;  3PUF A;  3HVR A;  1Z26 A;  4XIU A;  4CJV A;  4FLT A;  4DG1 A;  3L2Q A;  4Z0U A;  1TAQ A;  4FJI A;  1QQC A;  4DQI A;  3S3N A;  1X9M A;  3ZSW A;  1ZBI A;  3L2U A;  1BIS A;  4E3S A;  1NK9 A;  2G8H A;  3TR8 A;  3AO1 A;  4EZ6 A;  3DLR A;  3UIQ A;  3CM6 A;  2YV0 X;  1RBT A;  3SZ2 A;  4B9N A;  2HHU A;  2DTU A;  4C8L A;  4C8N A;  3HPO A;  3SCX A;  1WAJ A;  1HYV A;  2QXF A;  3G0Z A;  4ID1 A;  4CJ4 A;  3I0R A;  4CJ5 A;  4RW7 A;  4W5R A;  3O3H A;  2PZS A;  3K2P A;  5FRM A;  3PX6 A;  4ID5 A;  3LAK A;  3ZT1 A;  1VSJ A;  1RDA A;  2RF2 A;  4IFY A;  1U47 A;  1SL0 A;  1SKW A;  1IO2 A;  3PY8 A;  4QAG A;  4DTR A;  1D9F A;  4M3Z A;  3O4Q A;  2O4I A;  1FXX A;  2OZM A;  4FJG A;  4N41 A;  1W9H A;  4M41 A;  3I8D A;  5J2P A;  4FJ5 A;  1DTQ A;  3C95 A;  3EZ5 A;  4KHW A;  3ASM A;  4CJ3 A;  3MEE A;  4DTN A;  1RT2 A;  1RNH A;  3AVF A;  4FCY A;  4CEA A;  3AO2 A;  1FKO A;  3AVJ A;  4BWJ A;  3VQ6 A;  3ZSR A;  3SYZ A;  1QSL A;  4FJL A;  4DU3 A;  4Z4I A;  1JXB A;  1WSI A;  2FBT A;  4M3T A;  3FFI A;  1SL2 A;  4FLZ A;  4ELV A;  4O5B A;  2R7Y A;  3THV A;  4M42 A;  1B9D A;  3AO3 A;  1SKS A;  2XY7 A;  1W0H A;  4F8R A;  3AA5 X;  1JXE A;  3LAM A;  1T8E A;  1UOC A;  2ATQ A;  3VQQ A;  1JKH A;  1KVB A;  4DU1 A;  4CGJ A;  1GOC A;  4Z4G A;  5CZ2 A;  3LZI A;  2D5R A;  2F8S A;  4GW6 A;  3V9S A;  4DF8 A;  2HVI A;  1J53 A;  4MFB A;  1HPZ A;  4FLX A;  3LWL A;  1SUQ A;  3U6F A;  3OYJ A;  4DF4 A;  4FXD A;  1J9A A;  3S3M A;  1S1X A;  4FJ9 A;  3SUQ A;  1NK7 A;  1IKW A;  1TKX A;  4KO0 A;  4CGG A;  3DRP A;  4CFD A;  4FM1 A;  4BWM A;  2OPQ A;  1D8Y A;  3DRS A;  4AHT A;  4CHO A;  3QER A;  3DOK A;  4B8C A;  1RT7 A;  4C8M A;  2WOM A;  4KRF A;  1NJY A;  5DK5 A;  4Z4H A;  4HUF A;  4B9V A;  1LW2 A;  4B8A B;  4DSJ A;  3KD1 E;  1G15 A;  1BQM A;  1VRT A;  2ETJ A;  3AVL A;  3P5J A;  4OKJ A;  1WSF A;  1QSS A;  1RDD A;  4FJJ A;  1C0T A;  4N5S A;  3SNN A;  3RMA A;  4M3W A;  1ASW A;  4CIF A;  3ZT2 A;  1YT3 A;  5T7B A;  3KK3 A;  4BDY A;  3H08 A;  3HYF A;  4M3R A;  4GMJ B;  4DMN A;  3NF8 A;  4KB1 A;  1KCF A;  1JLE A;  1BL3 A;  5I42 A;  2A1R A;  3QO9 A;  1K6Y A;  1J5O A;  4E7I A;  2Q3S A;  3C6T A;  1RT3 A;  3VN5 A;  3V9W A;  1JL2 A;  3HP9 A;  2HMI A;  3AO4 A;  3VA0 A;  2OPP A;  3VQ9 A;  3OYN A;  4RW6 A;  1NK4 A;  1Z25 A;  4I7F A;  3VQE A;  4E7H A;  4N76 A;  4BAC A;  3L3U A;  1ZBL A;  4IG3 A;  2G8F A;  3NGZ A;  1XWL A;  2EHG A;  3LPT A;  3VA3 A;  3SQ1 A;  1DLO A;  1Q9Y A;  1KVA A;  2D0A A;  1RTJ A;  2NUB A;  4DQR A;  4H8K A;  4DFP A;  4FZY A;  2X6S A;  1EKE A;  1HMV A;  2XO7 A;  4IG0 A;  3SUN A;  5FDL A;  1RTI A;  1YTA A;  4PA1 A;  3NBP A;  3AO5 A;  3TAM A;  3V81 A;  2HW3 A;  1MU2 A;  3ALY A;  5C25 A;  4OPK A;  4ZTJ A;  4CJE A;  3HO1 A;  2P1J A;  3LWM A;  3BDP A;  3HPG A;  4FLY A;  3KLG A;  5C24 A;  1D9D A;  5J2N A;  1QE1 A;  4CF2 A;  4CF9 A;  4C8O A;  4CEF A;  1JLA A;  4CFC A;  4CHZ A;  1VSD A;  1GOA A;  3MED A;  1C0U A;  4B9M A;  4J2E A;  2E6L A;  4KPY A;  1DTT A;  4FK0 A;  3AVN A;  4O44 A;  3AA4 A;  3OJS A;  4DTX A;  3V1R A;  3PO5 A;  4ELU A;  3RWU A;  3K5M A;  3RRG A;  2HHS A;  2I5J A;  4IBN A;  3VQ4 A;  3LP0 A;  1TKZ A;  1QTM A;  3NDK A;  3PO4 A;  4B9S A;  5HRS A;  4C8K A;  3DOL A;  4B08 A;  3QEP A;  3DLH A;  4F3T A;  1BIU A;  1FK9 A;  4KTZ A;  2PYL A;  3LDS A;  1JLF A;  3V4I A;  4F4K A;  1CZB A;  2XY5 A;  4CF0 A;  4AHC A;  3NH1 A;  4FJX A;  4AHR A;  5JS1 A;  4FYD A;  4FK2 A;  3S9H A;  1L3T A;  1RDB A;  3RMB A;  1NOZ A;  4KTW A;  1RTD A;  4CJW A;  4NCG A;  1NKE A;  1C1B A;  3QEW A;  1CXU A;  1ZBF A;  4CFA A;  4KHN A;  4KHU A;  2KW4 A;  4RW8 A;  3LZJ A;  2HHT A;  4O55 A;  4IKF A;  3HK2 A;  2DY4 A;  1KLN A;  1XI1 A;  1CLQ A;  3OYL A;  3M8S A;  2XY6 A;  1L3V A;  1SV5 A;  1TV6 A;  3OYG A;  4DS5 A;  2VG5 A;  3MXI A;  3LAL A;  4OKE A;  3QES A;  4HHT A;  3KKR A;  5HRO A;  3ZT3 A;  4HUG A;  3DLG A;  4FW1 A;  3OY9 A;  2KFN A;  3ULD A;  4M3U A;  3ZT4 A;  1Y97 A;  1NOY A;  4FJH A;  1VSH A;  3HVT A;  2F96 A;  3CFO A;  3DLE A;  4EZ9 A;  2HND A;  1VSF A;  3AVH A;  1D5A A;  4RW4 A;  4CJU A;  1YVU A;  2Y1J A;  4M45 A;  1TKD A;  4FLU A;  3OYI A;  1JLQ A;  3AVG A;  2X74 A;  3E01 A;  3VQD A;  4CJP A;  1S9E A;  2P5G A;  3RRH A;  2BAN A;  4CGH A;  4FJN A;  4R5P A;  2QK9 A;  3L8B A;  3O3G A;  1WSG A;  1U49 A;  3VQP A;  3L3V A;  3VQC A;  3AVA A;  1BI4 B;  4LD0 A;  4FJ7 A;  3ZSY A;  1HNI A;  1S1V A;  1RT4 A;  3KIO A;  3HST B;  3OYK A;  1VSE A;  4CE9 A;  3NE6 A;  1RBS A;  3M8R A;  5HRN A;  3OYB A;  3K57 A;  4JS4 A;  2ITG A;  2YNI A;  4UQG A;  4CEB A;  4ZHR A;  3CFR A;  4E7K A;  4H4M A;  3TAG A;  3OJU A;  3OYD A;  2WON A;  4KTQ A;  4W5Q A;  4DTP A;  3K58 A;  2QKK A;  3NF7 A;  5E41 A;  3MAQ A;  2HVH A;  3K5L A;  4CF8 A;  3CQ8 A;  2G8K A;  3HM9 A;  2YNH A;  3IRX A;  4LH5 A;  2Z1I A;  3NHG A;  2ZE2 A;  2G8V A;  4TSX A;  4HTU A;  1S6Q A;  1KSP A;  4DTJ A;  1XHX A;  4FZX C;  4FVM A;  1KFD A;  5CY4 A;  1TK8 A;  3PV8 A;  1HYS A;  1CXQ A;  3SI6 A;  3OS0 A;  4N47 A;  1IG9 A;  3V9X A;  3AA2 A;  3RMD A;  3DLK A;  2KZM A;  4OLB A;  1BIZ A;  5CZ1 A;  1HRH A;  4OKK A;  3HT3 A;  4DTO A;  1U4B A;  3DLB A;  4GVM A;  3ZSX A;  4MQ3 A;  1RBU A;  3V6D A;  5DMR A;  4CK3 A;  4PY5 A;  4E89 A;  3AV9 A;  4CJF A;  1EX4 A;  4FLW A;  3C94 A;  2BGG A;  4OJR A;  1F21 A;  5HP1 A;  3V1Q A;  4FJ8 A;  1JL1 A;  1QS4 A;  1REV A;  1TKT A;  3LP1 A;  4LSL A;  5SZT A;  2D0B A;  1VSL A;  4NYF A;  3DM2 A;  4CHQ A;  5KI6 A;  3O3F A;  1X9W A;  1UWB A;  3TI0 A;  3CG7 A;  1ITG A;  4K8X A;  2PY5 A;  4F3O A;  3SUO A;  3C6U A;  1HYZ A;  3CM5 A;  2XHB A;  4ICL A;  3KLH A;  4FJK A;  2ZQB A;  4CJT A;  1SKR A;  3PX4 A;  5I3U A;  2KFZ A;  1S5J A;  1RDC A;  2DFE A;  2IAJ A;  5HBM A;  5KRS A;  3OS1 A;  2W42 A;  2OZS A;  2RPI A;  4OGC A;  1GOB A;  1NJW A;  4DFK A;  4KV8 A;  4DQS A;  1U48 A;  3ZSQ A;  5J1E A;  3KLF A;  4KHS A;  2JLE A;  3OYA A;  1EET A;  4CJL A;  3CFP A;  2B6A A;  4OPJ A;  4B3O A;  4Z4F A;  4J2D A;  4NCB A;  2DFF A;  3VQ8 A;  1A5V A;  5C42 A;  2JGU A;  3LP3 A;  4I2Q A;  3KTQ A;  2F8T A;  4CIE A;  1UA1 A;  2HNY A;  1TL1 A;  1TK0 A;  4M3X A;  1S1W A;  4J2B A;  1WSJ A;  1N6Q A;  4DWI A;  4RW9 A;  4YFU A;  5HRR A;  3VQ5 A;  3KLE A;  3F9K A;  4FW2 A;  4I9L A;  3KJV A;  4HCB A;  4I9Q A;  1HJR A;  4KI4 A;  4CGI A;  4FK4 A;  4Z4E A;  4N56 A;  3QET A;  1LWC A;  4KHY A;  4Z4C A;  4CEO A;  3TAB A;  3OYC A;  3RTV A;  3RR7 A;  1S9G A;  1FKP A;  3D45 A;  2G8I A;  1LAV A;  4PQU A;  5K14 A;  3K5O A;  1KFS A;  1JLB A;  3ZT0 A;  2GUI A;  2HHX A;  1NKB A;  2G8W A;  1LV5 A;  4KAZ A;  1I39 A;  4B9U A;  1WN7 A;  4CGF A;  2PYJ A;  4AHS A;  4NYN A;  3B6O A;  4JLH A;  3I0S A;  5HRP A;  3OYH A;  4W5O A;  1JLC A;  4DQQ A;  4DSL A;  3OYM A;  5CYQ A;  1WAF A;  2FBX A;  2YHB A;  3QIN A;  1X9S A;  1RT6 A;  1B92 A;  1C0M A;  2OPR A;  4E7L A;  5HLF A;  2BDP A;  3ISN C;  2B4J A;  4WE1 A;  1RBV A;  1T03 A;  1ZBU A;  5FRO A;  1EXQ A;  3NGI A;  3KLI A;  2HB5 A;  3DI6 A;  1NK0 A;  4E1M A;  1L3U A;  5EU7 A;  3K5N A;  5JS2 A;  4OLA A;  3PX0 A;  1RT5 A;  1ASV A;  1NJX A;  3WNG A;  4K8Z A;  1KLM A;  1A5W A;  1S1T A;  5KGW A;  3HP6 A;  4Y1D A;  4PUO A;  4LY7 A;  3HJF A;  4JS5 A;  3WNH A;  3AVM A;  2VG6 A;  3SV4 A;  2XY8 A;  1EP4 A;  2FBY A;  5KTQ A;  3TAP A;  1LWF A;  1NKC A;  1T7P A;  4CER A;  3IS9 A;  3BGR A;  2YKN A;  4LH4 A;  1WLJ A;  4CHN A;  3NAE A;  1Q9X A;  4DFJ A;  4F2S A;  3D0P A;  4CHY A;  1J54 A;  4KKO A;  1ZYQ A;  3NGY A;  3JSM A;  1U04 A;  1NK6 A;  2FC0 A;  4F2R A;  4AIL C;  4CK2 A;  3KKS A;  4RG8 A;  2XRI A;  2VG7 A;  4BE2 A;  3EYZ A;  3EY1 A;  1VSM A;  3TAR A;  3IG1 A;  3NCI A;  4NCA A;  4FZZ A;  1TAU A;  4CCH A;  1BI4 A;  2X6N A;  2OPS A;  4CEQ A;  3DMJ A;  3AVC A;  2E6M A;  2HHQ A;  3AVI A;  2DFH A;  1IKV A;  1O1W A;  2YKM A;  1ZBH A;  3M8Q A;  2GBZ A;  4CJK A;  2YNF A;  1TGO A;  4DSI A;  4CEZ A;  3TAE A;  2EX3 A;  3MEG A;  4EP5 A;  2P5O A;  3K59 A;  3NF9 A;  4CJR A;  2HNZ A;  1A5X A;  3OS2 A;  3B6P A;  3L2R A;  1RBR A;  4KI6 A;  2IDO A;  2Y1I A;  4CJS A;  1VSI A;  4DU4 A;  1KVC A;  5J2Q A;  3U3G A;  4JRQ A;  3SUP A;  5CYM A;  3L2W A;  3QIP A;  3O4N A;  4CK1 A;  4EP4 A;  2VWJ A;  1I3A A;  4DSE A;  2IGI A;  2G8U A;  1WNS A;  2X78 A;  3OVN A;  4KFB A;  3L2V A;  3MEC A;  2RKI A;  3TAF A;  4IFV A;  2Z1G A;  4HVJ A; 
#chains in the Genus database with same CATH topology
 4FLV A;  1VAZ A;  4KHQ A;  3VEW A;  3DXK B;  4DS4 A;  1XC9 A;  3DYA A;  1B9F A;  1C0F A;  4A61 A;  5SWM A;  4DV5 K;  3SJJ A;  4JD2 B;  4BGB A;  3PLA A;  5TKY A;  5B8H A;  4CVN E;  4DCH A;  1RCH A;  3IUC A;  4QOZ B;  4FM0 A;  1JLG A;  2AJQ A;  3J8A A;  4BRC A;  1YTU A;  5F2R A;  3KD5 E;  1N5Y A;  2FBV A;  4BDP A;  3BY5 A;  3VQA A;  1C1A A;  3KVG A;  1BHL A;  2VYP A;  4Q5V A;  4AF1 A;  2H3G X;  2IS3 A;  3D2F A;  4BVP A;  3NFA A;  1WSH A;  1VRU A;  1X3N A;  1R0A A;  2O4G A;  1RIL A;  4H0Y B;  4E19 A;  4DSK A;  3LP2 A;  4E0D A;  3SJH A;  2Z1J A;  2IOC A;  3V1O A;  1LW0 A;  3QEI A;  1L5U A;  1NGD A;  2OCE A;  3THX A;  4PKG A;  5JLF A;  3T3F A;  2KLA A;  1W2B M;  1NLV A;  4O0I A;  3V9Z A;  3THW B;  4R79 A;  1K9M O;  3MN5 A;  4JRP A;  1S3X A;  2P9L A;  3OYE A;  1IKY A;  1Q8I A;  4DR7 K;  4E7J A;  2YJE A;  1HNV A;  3M8P A;  3OBY A;  3SQ0 A;  4CZF A;  1WSE A;  3J80 O;  4CED A;  5FPE A;  2OYQ A;  4CEC A;  2O8E A;  5AQF A;  3MXM A;  1TK5 A;  3WQT A;  3HXM A;  4PKI A;  4LFB K;  3UKR B;  4DG1 A;  1KXP A;  1Y64 A;  4Z0U A;  2NRX A;  3ZSW A;  4E3S A;  1YI2 N;  3TR8 A;  3AO1 A;  3THY B;  2Q36 A;  1RDW X;  2O8C A;  3CM6 A;  3SAF A;  2W41 A;  4BC2 A;  3G0Z A;  4WF9 L;  3CJ1 A;  1VQL N;  1QVG M;  1IBM K;  1J5E K;  3MWP A;  2WTU A;  4OPH A;  4YHH K;  3H3N O;  1SKW A;  3PY8 A;  2KKZ A;  3DAW A;  1NWK A;  1D9F A;  3O4Q A;  1FXX A;  2OZM A;  4FJG A;  4XH5 A;  3I8D A;  3C95 A;  2QM1 A;  4DTN A;  2ZM6 K;  4K42 A;  4CEA A;  3VQ6 A;  4FJL A;  3WUH A;  2D0P A;  2I7P A;  4BC4 A;  3HOS A;  1SL2 A;  1W0H A;  1VQ4 N;  4F8R A;  5EOY A;  5BRD A;  1JXE A;  4GKK K;  1JCF A;  3DXM A;  4Z4G A;  2WC9 A;  3WQU A;  3DXK A;  4X65 K;  1HPZ A;  4FOE A;  3JXU A;  3OYJ A;  3OBW A;  1NK7 A;  1IKW A;  4CGG A;  4CFD A;  3CC7 N;  4BWM A;  1VHX A;  4B8C A;  4KRF A;  4Z4H A;  3FZK A;  4HUF A;  1LW2 A;  3KD1 E;  2ETJ A;  4OKJ A;  3P5J A;  4CBW A;  1BUP A;  1HLU A;  3SNN A;  3VTI A;  4CIF A;  1YT3 A;  5ADX H;  4M3R A;  4DMN A;  1HNZ K;  3QDK A;  3NF8 A;  2P9I A;  4KB1 A;  4B1Y B;  1KCF A;  4B1Z A;  4H5R A;  4E7I A;  3C6T A;  3VN5 A;  4FWO A;  3ATV A;  3CER A;  3M6G A;  3VQ9 A;  3OYN A;  1NK4 A;  2Q31 A;  3GDQ A;  3VQE A;  3VA3 A;  2NUB A;  1SAZ A;  4H8K A;  3AGR A;  1WUA A;  5AQZ A;  3NVK A;  5FDL A;  4CZL A;  2HW3 A;  1LCU A;  3W3D A;  4ZTJ A;  2UXB K;  2E2O A;  2P1J A;  1I94 K;  2ITM A;  4CEF A;  1JLA A;  4CFC A;  2BUP A;  5AQM A;  3MED A;  2E6L A;  4BRD A;  3AVN A;  2FF3 B;  1P90 A;  3AA4 A;  1YF5 L;  4EIA A;  2HHS A;  2VCP A;  3LP0 A;  3WXJ A;  3A5N C;  3NDK A;  4B9S A;  3R8E A;  3VET A;  4B08 A;  4QS7 A;  1E4G T;  5BRE A;  2PYL A;  5HOO A;  1CZB A;  2XY5 A;  4F4K A;  5BPM A;  1L3T A;  1RDB A;  2QXL A;  4FWP A;  1NOZ A;  4NCG A;  3QEW A;  1CXU A;  4CFA A;  4KHU A;  2KW4 A;  5AQO A;  4NXM K;  4FL9 A;  4BRK A;  1L3V A;  1SV5 A;  1QQO A;  1TV6 A;  3CPW M;  1GLC G;  1OH5 A;  4FW1 A;  3OY9 A;  3I8B A;  3ULD A;  1Y97 A;  4FWS A;  1VSH A;  3BF3 A;  4IDH A;  5E84 A;  1VSF A;  4CI6 A;  1YVU A;  3C65 A;  4FLU A;  1JLQ A;  3AVG A;  4CJP A;  2BAN A;  3SAG A;  2QK9 A;  3L8B A;  3O3G A;  4GVE A;  4JYA K;  1U49 A;  2O8F B;  3VQC A;  4A5A A;  1NG9 A;  4FJ7 A;  3ZSY A;  1VSE A;  4CE9 A;  1RBS A;  4BRF A;  5HRN A;  3OYB A;  4JS4 A;  3ZET B;  2ITG A;  2HBK A;  4E7K A;  3CJ7 A;  4H4M A;  4KTQ A;  4W5Q A;  2P9N A;  1HKG A;  3K58 A;  4MDA A;  2D0O A;  4BR4 A;  2ZE2 A;  3EEQ A;  3R6M A;  3DLL L;  4FZX C;  4FVM A;  1KFD A;  1T3V A;  3PV8 A;  1CXQ A;  3OS0 A;  3EE8 A;  4KH5 A;  4BRQ A;  1BIZ A;  1ZC6 A;  4OKK A;  5GAE P;  3ZSX A;  1XUP O;  3V6D A;  2OTL N;  5HP1 A;  1F21 A;  4FJ8 A;  1JL1 A;  3BUZ B;  4F9O A;  3LP1 A;  3GOI A;  1Q18 A;  4CHQ A;  3O3F A;  3EKU A;  4H0V B;  2A6A A;  5I3U A;  3TSQ A;  5C10 A;  2W42 A;  2DFE A;  5HBM A;  4OGC A;  4DQS A;  1U48 A;  2JLE A;  5GAD P;  3CFP A;  4B3O A;  1Z6R A;  5CHI A;  5TKW A;  4JV5 K;  5AQU A;  3VQ8 A;  1A5V A;  1UA1 A;  3UKU B;  1S1W A;  5FPN A;  4J2B A;  4J2E A;  5AQS A;  1N6Q A;  4RW9 A;  4YOT A;  1GLL O;  3CCU N;  1HJR A;  4CGI A;  4A5B A;  5AQT A;  4FK4 A;  4N56 A;  1VQ6 N;  3WT0 A;  3RR7 A;  1S9G A;  4PQU A;  2A3Z A;  1RGI A;  1LV5 A;  1I39 A;  4G9Z A;  1ATR A;  3MCP A;  1JLC A;  5GAG P;  3OYM A;  1H1V A;  4KH4 A;  1X9S A;  1QQM A;  1B92 A;  1C0M A;  4K43 A;  5LJV A;  5KPT A;  1TUU A;  4IZ9 A;  4OPA A;  1EXQ A;  3NGI A;  1X3M A;  2HB5 A;  1HNW K;  1L3U A;  4IJN A;  5EU7 A;  3J7Y P;  1RT5 A;  1ASV A;  4K8Z A;  1ATS A;  3HJF A;  3T1Y K;  5BN9 A;  3AVM A;  4HTL A;  3SV4 A;  1NBW A;  4JKC A;  1T7P A;  3H1Q A;  2YKN A;  1QHA A;  1WLJ A;  4CHN A;  2VWB A;  3LM2 A;  4DFJ A;  4F2S A;  4DQ8 A;  1J54 A;  3H45 C;  3NGY A;  4CK2 A;  3KKS A;  2XRI A;  2VG7 A;  5C15 A;  4BC3 A;  1BO5 O;  3BP8 A;  4JKA A;  4B1W B;  4DV4 K;  2E6M A;  4QS9 A;  1WB9 A;  2YKM A;  3CJB A;  2HOE A;  3IKM A;  3BEX A;  4FOI A;  2YNF A;  1JJ2 M;  3MEG A;  4EP5 A;  2HNZ A;  3OS2 A;  5M1F A;  3U3G A;  2VWJ A;  4CK1 A;  2GWJ A;  1WNS A;  4HVJ A;  5H1S Q;  4B9T A;  1K8A O;  2NRT A;  1SL1 A;  4W5T A;  4LSN A;  4AHU A;  1NJZ A;  4EFH A;  4DR3 K;  2KZZ A;  1KRP A;  1BQN A;  2HHH K;  4H03 B;  1RT1 A;  2LSN A;  3KK2 A;  4DTM A;  3CME N;  4DSF A;  4YNQ A;  2GV9 A;  3RMC A;  3HOT A;  3QEX A;  5AQL A;  4OVL A;  2RN2 A;  2GX9 A;  1VQ9 N;  1C6V A;  3QLH A;  4JNE A;  2QWP A;  2VWK A;  4B1X B;  2YHA A;  4DQP A;  3ENB A;  4CF1 A;  2ZD1 A;  5KRT A;  3AVK A;  4BR2 A;  4L8R B;  1HNX K;  3KZB A;  3VQB A;  2BE2 A;  1P8Z A;  4LF6 K;  1NK8 A;  2QWR A;  3KWI A;  4DLG A;  3FE1 A;  5JIC A;  3FZM A;  4FJM A;  3MDQ A;  3F2K A;  5AZI B;  3ZSV A;  1XHZ A;  1VQM N;  4ELT A;  5J2M A;  4DTS A;  1WOQ A;  5FRN A;  3MXJ A;  1NGA A;  1IKX A;  3QIO A;  4KH6 A;  2IIR A;  2PBD A;  3IAY A;  3TAN A;  3LM9 A;  1VK0 A;  2BH1 A;  4MLH A;  1KTQ A;  5AQQ A;  4IDK A;  1UA0 A;  4CJQ A;  1LWE A;  2AP1 A;  3P1G A;  2OTJ N;  3LDQ A;  3A2F A;  3VPZ A;  3SPY A;  2KHO A;  4H0O A;  1U45 A;  3S3O A;  3CCS N;  1Z26 A;  2HBL A;  1HJO A;  2D1K A;  4FWR A;  1TAQ A;  3EE9 A;  2F4V K;  3L2U A;  1IBL K;  4MO4 A;  4C1N K;  4B9N A;  4NXN K;  2UXC K;  4C8N A;  2A41 A;  4IFE A;  4IJA A;  4ID1 A;  1HYV A;  2NRH A;  5AQH A;  3O3H A;  3PX6 A;  4ID5 A;  3ATU A;  2NRW A;  1JCE A;  1U47 A;  1SL0 A;  3WEE A;  4M3Z A;  4N41 A;  1Q82 O;  2Q0R A;  1W9H A;  3G71 N;  3L4I A;  5J2P A;  3EZ5 A;  4KHW A;  3OA9 A;  3AVJ A;  4BWJ A;  3ZSR A;  4PHT X;  3CCQ N;  4PWD A;  3ID8 A;  4I6M B;  4DR2 K;  2FBT A;  4BGA A;  4WFA L;  4FLZ A;  4BR7 A;  3D2E A;  1B9D A;  3AO3 A;  4EHT A;  4B3T K;  4X62 K;  1T8E A;  2ATQ A;  1NMN A;  3EKS A;  1KVB A;  3MN9 A;  3N4P A;  5CZ2 A;  2F8S A;  3N4Q A;  3UB5 A;  2HVI A;  4MFB A;  5AQY A;  3LWL A;  1SUQ A;  4DF4 A;  5AQR A;  4FXD A;  3S3M A;  5EXW A;  4FJ9 A;  3ZX2 A;  5AZJ B;  4FM1 A;  3HRG A;  5AFU A;  3DOK A;  3CD6 N;  1NJY A;  3P38 A;  5M1P A;  4DSJ A;  1G15 A;  1VRT A;  5AFU H;  1QSS A;  1RDD A;  4FJJ A;  3ZT2 A;  3H08 A;  2YHW A;  2NRZ A;  3VF6 A;  2A1R A;  3E1Y A;  2A42 A;  3CQY A;  2WFB A;  3HP9 A;  4JK7 A;  4UY8 O;  3AO4 A;  3VA0 A;  2OPP A;  3L6Q A;  2E20 A;  4I7F A;  2VGM A;  4N76 A;  3VF4 A;  2P9K B;  1ZBL A;  1DLO A;  1KVA A;  4FWN A;  4FZY A;  1SS6 A;  3OHR A;  3SK3 A;  3TAM A;  4BRG A;  1WBB A;  5C25 A;  4OPK A;  3HO1 A;  5AZI A;  3KHY A;  3CCJ N;  2GEL A;  3HPG A;  4X66 K;  5EY4 A;  1QE1 A;  5BRF A;  4CF2 A;  5J2N A;  4CHZ A;  2FXU A;  4FK0 A;  4IWV A;  1R59 O;  3V1R A;  5GIP A;  3K5M A;  1K8K B;  3O4W A;  1TKZ A;  2CGL A;  1QTM A;  5KPR A;  4JHD B;  4JKG B;  3DOL A;  1JLF A;  3VEN A;  5M1N A;  3A0I X;  3RMB A;  3O5B A;  1BG3 A;  1W97 L;  4KTW A;  3CCM N;  4JAX A;  3VGL A;  1RFQ A;  1Q7Y O;  2HHT A;  4IKF A;  2DY4 A;  1OKJ A;  2UYT A;  4O8U A;  4CD3 A;  3FZH A;  3LL3 A;  1QQN A;  4DS5 A;  3ZT3 A;  2KFN A;  4BC5 A;  5ELZ A;  3HVT A;  2F96 A;  3CFO A;  4A2B A;  3T69 A;  4JKB A;  1NGI A;  3O9T A;  2X74 A;  1GLJ O;  2D4W A;  4FSV A;  3RRH A;  4FJN A;  1WSG A;  3I55 N;  5JVG L;  4ILJ A;  3MX5 A;  1NGJ A;  3KIO A;  3HST B;  4JI4 K;  4NB4 A;  4BRL A;  4CEB A;  3TAG A;  1T44 A;  3OJU A;  3OYD A;  2ZGZ A;  3R1X A;  4DTP A;  1ATN A;  4BRN A;  4PL8 A;  3CHW A;  5E41 A;  4BG9 A;  3K5L A;  3HM9 A;  2YNH A;  2ZF5 O;  4JD2 A;  3UE5 A;  1NNE A;  4JI7 K;  3A5L C;  2FLO A;  1NGC A;  1QVF M;  1S6Q A;  4NLB A;  1NJI O;  1KSP A;  1IV0 A;  4DUY K;  3VGK A;  1MWM A;  5CR4 A;  1TUY A;  5AZJ A;  3A8Y A;  2I7N A;  1HYS A;  4N47 A;  1IG9 A;  1G99 A;  3AA2 A;  5AQI A;  5ADX A;  3RMD A;  1NGE A;  2KZM A;  1OVQ A;  4DTO A;  4BRM A;  1KC8 O;  3DLB A;  1ZXO A;  4CK3 A;  4NO7 A;  4CJF A;  3C94 A;  2BGG A;  1QS4 A;  5LMN K;  2W40 A;  4NYF A;  3DM2 A;  3QIC A;  1X9W A;  1UWB A;  3TI0 A;  4BQZ A;  4F3O A;  1E3M A;  4FJK A;  2UUC K;  3KLH A;  4JI8 K;  2ZJP L;  3C6A A;  4CJT A;  1YIJ N;  1T6C A;  2KFZ A;  3GG4 A;  2IAJ A;  3OS1 A;  1NJW A;  4DFK A;  1XC3 A;  3ZSQ A;  3OYA A;  3AAQ A;  2B6A A;  2P9S B;  1RDU A;  3AAP A;  4Z4F A;  4NCB A;  3T1H K;  3LP3 A;  3THW A;  4KHP K;  2HNY A;  1TK0 A;  3P4I A;  1V4S A;  3BZC A;  4EHU A;  4YFU A;  3KLE A;  4I9L A;  3LDO A;  4YOY A;  2QEX N;  3TAB A;  3OYC A;  1DGK N;  1VQK N;  5K14 A;  1KFS A;  1JLB A;  4JHD A;  4JKG A;  4KAZ A;  1KD1 O;  2PYJ A;  1GLF O;  1IG8 A;  4AQY K;  5HRP A;  2NRR A;  3C7N B;  4W5O A;  3UKR A;  5F0X A;  1WAF A;  2FBX A;  3QBX A;  2YHB A;  4ILH A;  2OPR A;  3MX2 A;  4E7L A;  3THY A;  4WCE L;  4HWI A;  4E1M A;  1D4X A;  4DV1 K;  3K5N A;  4V19 S;  3ZEU B;  5A2Q O;  3ENO A;  1KLM A;  1A5W A;  5KGW A;  3U9D A;  5KPZ A;  2YCH A;  1VQP N;  3SAH A;  3O9U A;  2P9P B;  3WNH A;  2XY8 A;  1EP4 A;  2FBY A;  1VQ7 N;  4GKJ K;  4FWK A;  2O8B B;  3MK6 A;  3NAE A;  1EWQ A;  4DR4 K;  1U04 A;  4CD1 A;  3G25 A;  2ZJR L;  1NK6 A;  2VQE K;  3TAR A;  1VSM A;  3TTD A;  3JAM O;  2X6N A;  4CCH A;  3DMJ A;  2ASP A;  3SLC A;  4CJK A;  4IEE A;  5GAH P;  4O8K A;  4CEZ A;  3TAE A;  2JWL A;  2EX3 A;  3OW2 M;  1A5X A;  3L2R A;  3B6P A;  4KI6 A;  1RBR A;  4JN4 A;  4ISG A;  3E9P A;  2V7Y A;  4H5W A;  3W0L A;  4DU4 A;  3QIP A;  3ZYY X;  5KQ8 A;  2IGI A;  4BRP A;  4YY3 K;  2X78 A;  1M1K O;  4BR9 A;  3MEC A;  2Z1G A;  4J2A A;  4HUE A;  2E1Y A;  4KHY A;  4E1N A;  2W6L A;  5JLH A;  3E9L A;  2QI2 A;  2YNG A;  3P39 A;  3ZCM A;  4BDZ A;  1DEJ A;  1BA1 A;  3CJC A;  4AH9 A;  3LDL A;  1S6P A;  4CIG A;  4BR0 A;  2NRV A;  1Q81 O;  3DRR A;  2QKB A;  1CZA N;  3LPU A;  4Y1C A;  2E2N A;  2PFU A;  3SQ4 A;  5D3G A;  1HQE A;  4BRA A;  5AQV A;  4FM2 A;  3NH0 A;  1VQ8 N;  3TTC A;  3VQ7 A;  4NLC A;  4CFB A;  3TWH A;  4CBX A;  1C0G A;  4MDB A;  3WNF A;  4IEI A;  3M3Z A;  1LAW A;  1SZ2 A;  3P83 D;  1YIT N;  4PY5 A;  4DV7 K;  3L0Q A;  1S1U A;  4B9L A;  3KK1 A;  1VQN N;  4CHP A;  4KB0 A;  1C1C A;  1HQU A;  2QWL A;  3CCR N;  4BE0 A;  3V9U A;  3HSC A;  4QCL A;  1NK5 A;  3VER A;  5BN8 A;  3AGK A;  4Q0B A;  4J8F A;  1T05 A;  2QTD A;  3NH2 A;  4GV3 A;  3QBW A;  1MA9 B;  2B5J A;  1BOT O;  1GLA G;  3TAQ A;  3VEY A;  1TVR A;  3ITH A;  3ZSZ A;  3AA3 A;  2E4L A;  3T19 A;  4GV6 A;  1XQS C;  4PL7 A;  1HX1 A;  5EX5 A;  2Z1H A;  1ASU A;  5AQP A;  4CGD A;  1IH7 A;  2A1S A;  1HR0 K;  4DR5 K;  4Y0W A;  2YX6 A;  3OYF A;  3PUF A;  4CJV A;  3F9M A;  4FLT A;  3ZEU A;  4C1N I;  4DQI A;  1ZBI A;  1BIS A;  1NK9 A;  2G8H A;  4EZ6 A;  4YOW A;  2W6K A;  3UIQ A;  2YV0 X;  2DTU A;  4C8L A;  3SCX A;  3VEV A;  1WAJ A;  2QXF A;  3O1W A;  4CJ4 A;  2O8B A;  3I0R A;  3U4L A;  4W5R A;  5FRM A;  3K2P A;  1NM1 A;  4CZE A;  1J6Z A;  3ZT1 A;  4YDU C;  4EAH D;  4AM6 A;  1RDA A;  4IFY A;  4M63 C;  2O8F A;  4JI1 K;  4QAG A;  2O4I A;  3ZET A;  4FPB A;  4CJ3 A;  3MEE A;  4WQ4 C;  1RT2 A;  4FCY A;  2DPN A;  1QSL A;  1FKO A;  4Z4I A;  1JXB A;  1WSI A;  1EWR A;  3FFI A;  3CCE N;  4O5B A;  1SKS A;  2XY7 A;  4JKE A;  5I9E B;  3LAM A;  2QW9 A;  3VQQ A;  4JI2 K;  4CGJ A;  1GOC A;  4YOX A;  2D5R A;  4IOX A;  4FWM A;  4GW6 A;  4LF5 K;  3V9S A;  4DF8 A;  4FO0 A;  3O08 A;  5AQX A;  3I33 A;  1S1X A;  5GIN A;  1W7A A;  1TKX A;  1U2V B;  4CBU A;  1D8Y A;  1S72 N;  3QER A;  2WUS A;  3O80 A;  2UXD K;  2WOM A;  5DK5 A;  4B8A B;  1YVN A;  1WSF A;  1C0T A;  4BRO A;  3RMA A;  1ASW A;  4BDY A;  5T7B A;  4GMJ B;  4ILG B;  4JK8 A;  4CZM A;  1JLE A;  1BL3 A;  5I42 A;  2ZWH A;  3QO9 A;  1K6Y A;  1J5O A;  2Q3S A;  3Q7B A;  1JL2 A;  3V9W A;  3TPQ A;  4RW6 A;  4BRE A;  1Z25 A;  2G8I A;  3L3U A;  4IG3 A;  2G8F A;  1ZBS A;  1XWL A;  3LPT A;  3UKU A;  2ZGY A;  1Q9Y A;  5IWA K;  1RTJ A;  4GY2 B;  2X6S A;  1YJW N;  1VQ5 N;  1HMV A;  2XO7 A;  4IG0 A;  4M7Y A;  3U8X A;  3V81 A;  1YJN N;  3NBP A;  3D7E O;  2AA4 A;  2QA4 N;  3ALY A;  3BDP A;  4FLY A;  3KLG A;  5C24 A;  1D9D A;  2GUP A;  4CF9 A;  2CH5 A;  3ZLJ A;  5LJW A;  1VSD A;  1GOA A;  4B9M A;  4KPY A;  4JEP A;  2NLX A;  3THX B;  3PO5 A;  4ELU A;  1N8R O;  3RWU A;  3VQ4 A;  3PSI A;  3TSP A;  2VGN A;  3SMS A;  4C8K A;  2P9L B;  4F3T A;  1BIU A;  1FK9 A;  3LDS A;  3T7Z A;  2YHX A;  4IO8 A;  3K9K A;  4FJX A;  4AHR A;  4LF8 K;  4FK2 A;  3S9H A;  4YDU A;  2F7T A;  3H3O B;  1C1B A;  5IT9 O;  4B1V A;  5HL7 L;  4RW8 A;  3LZJ A;  2ASM A;  3HK2 A;  3M5R A;  1KLN A;  3SBT A;  3OYL A;  3M8S A;  2XY6 A;  2E5L K;  4WQ4 A;  1SQK A;  3D6R A;  3NMU A;  5BR9 A;  3LAL A;  4OKE A;  5M1K A;  3AAR A;  4K41 A;  4HUG A;  5AQK A;  2O8C B;  4FJH A;  3PSF A;  4EZ9 A;  3DLE A;  2Q97 A;  4RW4 A;  4WFB L;  3IDH A;  4M45 A;  3OYI A;  4LFA K;  1X9J A;  2CGK A;  3VQD A;  4DR1 K;  1S9E A;  4CGH A;  3IMX A;  2UUA K;  4R5P A;  4LF4 K;  3CPE A;  4LF9 K;  4LD0 A;  3TSU A;  1S1V A;  3VES A;  1RT4 A;  3NE6 A;  2QWM A;  3K57 A;  2YNI A;  4H5N A;  4ZHR A;  4CZH A;  3CFR A;  2IVO A;  2VQF K;  1ILY A;  4C23 A;  1QZ5 A;  2QKK A;  2Q1N A;  3NF7 A;  3MAQ A;  2HVH A;  4CF8 A;  3IRX A;  2Z1I A;  3NHG A;  2G8V A;  4HTU A;  4DV6 K;  4DTJ A;  3QB0 A;  4OX9 K;  4GNI A;  3DXM B;  1TK8 A;  3R9P A;  3SI6 A;  1QZ6 A;  2CH6 A;  3DLK A;  5CZ1 A;  1HRH A;  2A40 A;  4QS8 A;  4GVM A;  4MQ3 A;  1RBU A;  4BRH A;  5C12 A;  3FFK B;  3AV9 A;  1EX4 A;  4DHY A;  3V1Q A;  1U6Z A;  3O8M A;  1S22 A;  4LSL A;  5KI6 A;  4IO9 L;  4B3M K;  3ULE B;  2UU9 K;  3CG7 A;  3F5T A;  2PY5 A;  4XH4 A;  3SUO A;  3C6U A;  2XHB A;  4ICL A;  5M1Q A;  3CC2 N;  1SKR A;  1N36 K;  1IJJ A;  2P9I B;  2RHK A;  1S5J A;  1RDC A;  5KRS A;  4BY9 C;  2OZS A;  1GOB A;  3PIP L;  4KV8 A;  2E88 A;  1EET A;  2IVN A;  4CJL A;  4J2D A;  2DFF A;  3DWL A;  2HST A;  5C42 A;  4I2Q A;  3M1F A;  3KTQ A;  4CIE A;  1OH8 A;  4CW7 B;  4M3X A;  1WSJ A;  1DKG D;  4MO5 A;  3VQ5 A;  3F9K A;  4FW2 A;  3FZF A;  4KI4 A;  4JKH A;  1NU0 A;  3VEO A;  4Z4E A;  3QET A;  1BWF O;  2ASO A;  3DJC A;  4Z4C A;  2E8A A;  3E9O A;  1FKP A;  3D45 A;  1LAV A;  3FR0 A;  3K5O A;  3VMF B;  3MCA B;  2G8W A;  4DB3 A;  3HBT A;  1WN7 A;  4H0X B;  4CGF A;  4NYN A;  4E1J A;  4DSL A;  3I0S A;  2E2Q A;  1E4F T;  2A5X A;  3QFP A;  3PIO L;  3ISN C;  2BDP A;  1NGG A;  4WE1 A;  1ZBU A;  5FRO A;  2NNW A;  3KLI A;  3DI6 A;  3KK7 A;  5JS2 A;  4OLA A;  2HBM A;  3WNG A;  1N32 K;  1S1T A;  3HP6 A;  4X64 K;  3C6H A;  2HMP A;  4JS5 A;  3CIP A;  3TAP A;  1LWF A;  3CF5 L;  1NKC A;  4CER A;  3IS9 A;  3H1V X;  2QWN A;  1KAX A;  2HF3 A;  1Q9X A;  3D0P A;  4CHY A;  2FC0 A;  4F2R A;  4XEI A;  4I6M A;  4RG8 A;  5DM7 L;  2FSK A;  4BE2 A;  2O8D B;  3O1B A;  3EY1 A;  4NCA A;  3IG1 A;  3NCI A;  3I56 N;  4B3R K;  4CEQ A;  4JI5 K;  2OAN A;  1IKV A;  1ESV A;  2GBZ A;  1TGO A;  2CGJ A;  3FLC O;  2P5O A;  4O5F A;  3NF9 A;  1FW6 A;  2IDO A;  2Y1I A;  3WXL A;  4CJS A;  2FSN A;  3TTF A;  5J2Q A;  2ZJQ L;  4JRQ A;  3SUP A;  5CYM A;  3L2W A;  1RTD A;  4EP4 A;  2G8U A;  5LMU K;  3OVN A;  4KFB A;  2RKI A;  3O9Q A;  3TAF A;  2P9N B;  4H0T B;  5C2F A;  2RE2 A;  1NGF A;  1MDU B;  4G1Q A;  4DFM A;  3HM8 A;  1RTH A;  3HZ6 A;  4DV2 K;  5E26 A;  3WNE A;  2OA8 A;  2WBN A;  4CZK A;  4JK9 A;  2KQ2 A;  3HL8 A;  1YHQ N;  4O4G A;  3LAN A;  4ZTF A;  4CZI A;  3QNN A;  4KRE A;  5F1X A;  3ZSO A;  1BDG A;  3A5M C;  3G10 A;  4GV9 A;  3ULE A;  1BCM A;  3SQ2 A;  2D0C A;  4B1U B;  2P9K A;  4M3Y A;  4OGE A;  4CEE A;  4DTU A;  3AVB A;  3QNO A;  3K9J A;  2GEM A;  4HCC A;  3VEZ A;  4DLE A;  4WFN L;  4CES A;  1BCO A;  4AHV A;  3RR8 A;  1QHT A;  1Q86 O;  3WXK A;  1CZ9 A;  2Q2R A;  1KAZ A;  1L3S A;  3ENH A;  4JKD A;  1QSY A;  4I2P A;  2HHV A;  5KGX A;  2YI1 A;  3NF6 A;  1K8K A;  2F9T A;  2BTF A;  3C0B A;  4H4O A;  5DM6 L;  4BE1 A;  4LF7 K;  2KTQ A;  1UAX A;  3CYM A;  4DKW A;  2HBJ A;  4YOR A;  3JYT A;  4W5N A;  5MLC Q;  4O0J A;  3ZX3 A;  3SV3 A;  3QEV A;  2HHW A;  1HUX A;  3RSE B;  2J4R A;  4MLE A;  5FPM A;  3T1A A;  3SPZ A;  4B3S K;  3HPH A;  1BGX T;  2IC3 A;  3ZX0 A;  5C2D A;  3U3Y A;  1X1P A;  2GTD A;  1TL3 A;  2QWO A;  2YHY A;  5AJ3 K;  1VSK A;  2P51 A;  4DV3 K;  3F73 A;  1GLD G;  1GLE G;  3NVM A;  3HVR A;  4XIU A;  3L2Q A;  4FJI A;  1QQC A;  3S3N A;  1X9M A;  1Z05 A;  3A5O C;  2QWQ A;  3DLR A;  4YOU A;  1VQO N;  1RBT A;  3SZ2 A;  2HHU A;  1IBK K;  3HPO A;  2E1Z A;  3VTH A;  3G6E N;  4CJ5 A;  4RW7 A;  2JWK A;  2PZS A;  4LFC K;  3LAK A;  2NZT A;  3VF2 A;  1VSJ A;  4JI6 K;  2RF2 A;  1IO2 A;  4DTR A;  2O8D A;  4M41 A;  4FJ5 A;  1DTQ A;  1KAY A;  3BF1 A;  4H0P A;  3ASM A;  3TU5 A;  1RNH A;  3AVF A;  3AO2 A;  3SYZ A;  4DU3 A;  4M3T A;  4ELV A;  2R7Y A;  3THV A;  1YJ9 N;  4M42 A;  4CJ7 A;  1HKB A;  3AA5 X;  1XNR K;  1UOC A;  4H5V A;  3CJA A;  1JKH A;  4DU1 A;  4ISF A;  3LZI A;  4L3Q A;  1J53 A;  1JCG A;  1HPM A;  4FLX A;  3U6F A;  1J9A A;  2IVP A;  1TYQ B;  3SUQ A;  4KO0 A;  3DRP A;  3MMV A;  2OPQ A;  3CI5 A;  3DRS A;  4AHT A;  4CHO A;  3J7A P;  3IFR A;  1RT7 A;  4C8M A;  5AQJ A;  4B9V A;  1BQM A;  3AVL A;  5AR0 A;  4N5S A;  4M3W A;  4IOC L;  3KK3 A;  3HYF A;  5C0Y A;  5LY3 A;  2V51 B;  5BR8 K;  1RT3 A;  2HMI A;  5CE3 A;  1HKC A;  3CC4 N;  2P9S A;  4BRI A;  4DUZ K;  4FWL A;  4FPA A;  2V52 B;  4E7H A;  4BAC A;  2GWK A;  3NGZ A;  3SQ1 A;  2EHG A;  2D0A A;  3CJ9 A;  4IXC A;  3J81 O;  4DQR A;  4DFP A;  5FLX O;  1EKE A;  4CZG A;  3SUN A;  4A62 A;  4WQ5 C;  1RTI A;  1YTA A;  4PA1 A;  3AO5 A;  1LOT B;  1MU2 A;  4CJE A;  3LWM A;  4C8O A;  2F9W A;  4BR5 A;  3FZL A;  3LDP A;  3P31 A;  1NGB A;  3KWG A;  3MN6 A;  1C0U A;  1DTT A;  4O44 A;  3OJS A;  4DTX A;  3C7N A;  1YUW A;  3RRG A;  4IOA L;  3RSE A;  4RWT A;  2I5J A;  4IBN A;  5BRH A;  3SBG A;  5AQG A;  3PO4 A;  5HRS A;  3H6E A;  1N33 K;  3QEP A;  5GIO A;  3DLH A;  5JVH L;  4KTZ A;  3V4I A;  4CF0 A;  3VGM A;  4AHC A;  3NH1 A;  5JS1 A;  3GBT A;  4FYD A;  4KBO A;  4FVU A;  1V4T A;  3WXI A;  4CJW A;  3GE1 A;  1NKE A;  2P9P A;  4DR6 K;  4KHN A;  1ZBF A;  2V7Z A;  4O55 A;  1XMQ K;  1CLQ A;  1XI1 A;  3EN9 A;  3BZK A;  4CZJ A;  5BPN A;  3OYG A;  4FWQ A;  2VG5 A;  3MXI A;  1EO1 A;  3QES A;  4HHT A;  3KKR A;  5HRO A;  3DLG A;  2Q0U A;  4M3U A;  3ZT4 A;  3CQX A;  1NOY A;  4BQL A;  2HND A;  3AVH A;  1D5A A;  4CJU A;  3CCV N;  2Y1J A;  1TKD A;  4BG8 A;  3E01 A;  2P5G A;  3U9Z A;  3VOV A;  1YXQ A;  3WXM B;  3S41 A;  3VQP A;  3L3V A;  3WEE B;  3AVA A;  1BI4 B;  4A59 A;  1HNI A;  3OYK A;  3JS6 A;  5AQN A;  4XH1 A;  3M8R A;  3HI0 A;  4UQG A;  3O6W A;  2P9U B;  2WON A;  3HTV A;  3G4S N;  3OTO K;  5JMV A;  1BA0 A;  3CQ8 A;  2G8K A;  4LH5 A;  1MWK A;  4DV0 K;  3FGU A;  1K73 O;  3D2E B;  4TSX A;  3K0S A;  1TYQ A;  1XHX A;  3E66 A;  5CY4 A;  3RVC A;  4JKF A;  3V9X A;  2YJF A;  4M7X A;  4OLB A;  4K0K K;  3HT3 A;  1U4B A;  3Q7C A;  2PAV A;  5DMR A;  2FF6 A;  4E89 A;  2HF4 A;  4FLW A;  4OJR A;  1N34 K;  4PKH A;  3CET A;  1REV A;  1TKT A;  4WQ5 A;  2D0B A;  4AM7 A;  5SZT A;  4JI3 K;  1VSL A;  5BPL A;  1FJG K;  1ITG A;  3O9R A;  3VEX A;  4K8X A;  3J7Z O;  1HYZ A;  3CM5 A;  2ZQB A;  1NGH A;  3PX4 A;  2FSJ A;  5EVZ A;  2RPI A;  3D2F B;  3EO3 A;  5J1E A;  5KQD A;  3KLF A;  4KHS A;  4B9Q A;  4A57 A;  4OPJ A;  3QML A;  3CCL N;  1XMO K;  2JGU A;  2F8T A;  3EL2 A;  1TL1 A;  3GL1 A;  4DWI A;  4I9Q A;  5HRR A;  3KJV A;  4HCB A;  3CMA N;  4OO1 J;  1LWC A;  3B8A X;  4CEO A;  1O13 A;  5AQW A;  1DT9 A;  3RTV A;  1OH7 A;  1NMD A;  1OVY A;  3ID6 A;  3ZT0 A;  2HHX A;  2GUI A;  1NKB A;  3QFU A;  4B9U A;  4AHS A;  3B6O A;  4JLH A;  3OYH A;  4DQQ A;  5CYQ A;  3QIN A;  2O8E B;  1RT6 A;  5HLF A;  1GLB G;  1YAG A;  2B4J A;  1RBV A;  1T03 A;  4JI0 K;  4U7B A;  2EWS A;  1NK0 A;  4A2A A;  5M1O A;  1OH6 A;  3PX0 A;  1NJX A;  3L4Q A;  2E2P A;  4Y1D A;  4PUO A;  4LY7 A;  4H5T A;  3MN7 A;  4ISE A;  4Z94 A;  4U67 L;  4K25 A;  2VG6 A;  3LDN A;  5KTQ A;  4RCH A;  3R3L A;  1XNQ K;  3BGR A;  3SMP A;  4LH4 A;  4YOV A;  5LL6 Z;  4RTF D;  4WYB A;  3O9S A;  4KKO A;  1ZYQ A;  3JSM A;  1BU6 O;  4AIL C;  1T6D A;  3AY9 A;  3EZW A;  3EYZ A;  4FZZ A;  1WBD A;  1TAU A;  3H46 O;  1EQY A;  1BI4 A;  2OPS A;  4BVO A;  3AVC A;  2HHQ A;  3AVI A;  2DFH A;  1ZBH A;  1O1W A;  3M8Q A;  4DSI A;  2UUB K;  5FPD A;  3K59 A;  2P9U A;  1M90 O;  4CJR A;  3CXC M;  3MWT A;  1VSI A;  1KVC A;  1KQS M;  4DSE A;  3O4N A;  1U2V A;  1I3A A;  3L2V A;  4LC9 B;  4IFV A; 
#chains in the Genus database with same CATH homology
 4HUE A;  4FLV A;  4B9T A;  4E1N A;  4KHQ A;  1SL1 A;  4W5T A;  4LSN A;  3DYA A;  4AHU A;  1B9F A;  4DS4 A;  1XC9 A;  1NJZ A;  4G1Q A;  5SWM A;  4DFM A;  3SJJ A;  2KZZ A;  1KRP A;  1RTH A;  3WNE A;  2OA8 A;  2YNG A;  1BQN A;  1RCH A;  2KQ2 A;  3HL8 A;  4QOZ B;  3ZCM A;  4BDZ A;  4O4G A;  3LAN A;  4ZTF A;  4AH9 A;  1RT1 A;  4FM0 A;  1JLG A;  2LSN A;  3KK2 A;  4DTM A;  2AJQ A;  4DSF A;  1S6P A;  4YNQ A;  2GV9 A;  3QNN A;  4CIG A;  3RMC A;  4KRE A;  3ZSO A;  1YTU A;  3G10 A;  3KD5 E;  3DRR A;  3QEX A;  1N5Y A;  2QKB A;  1BCM A;  4OVL A;  3LPU A;  4Y1C A;  3SQ4 A;  2FBV A;  2RN2 A;  4BDP A;  5D3G A;  3SQ2 A;  2D0C A;  1C6V A;  3QLH A;  1HQE A;  4M3Y A;  2VWK A;  3VQA A;  4OGE A;  1C1A A;  4FM2 A;  4CEE A;  3NH0 A;  3AVB A;  4DTU A;  1BHL A;  3QNO A;  2YHA A;  4DQP A;  3VQ7 A;  4Q5V A;  4CF1 A;  2ZD1 A;  5KRT A;  4HCC A;  3AVK A;  4CFB A;  2IS3 A;  4DLE A;  4L8R B;  3NFA A;  1WSH A;  4PWD A;  3TWH A;  3VQB A;  2BE2 A;  1VRU A;  3WNF A;  4CES A;  1BCO A;  4AHV A;  1LAW A;  1QHT A;  1RIL A;  2O4G A;  3P83 D;  4E19 A;  1R0A A;  3RR8 A;  1CZ9 A;  4DSK A;  1S1U A;  4B9L A;  1NK8 A;  3KK1 A;  3LP2 A;  4CHP A;  4E0D A;  4DLG A;  4KB0 A;  2Z1J A;  1C1C A;  1HQU A;  2IOC A;  4BE0 A;  3V9U A;  1L3S A;  3V1O A;  1LW0 A;  4FJM A;  3QEI A;  1L5U A;  1QSY A;  4I2P A;  2HHV A;  5KGX A;  3T3F A;  4QCL A;  3NF6 A;  1NK5 A;  4Q0B A;  3ZSV A;  4H4O A;  1XHZ A;  4BE1 A;  4O0I A;  1T05 A;  4ELT A;  3V9Z A;  3NH2 A;  4DTS A;  5J2M A;  2KTQ A;  5FRN A;  3MXJ A;  1UAX A;  1IKX A;  3CYM A;  4JRP A;  3QIO A;  2B5J A;  3OYE A;  1IKY A;  3JYT A;  4W5N A;  3IAY A;  3TAQ A;  4O0J A;  3TAN A;  1VK0 A;  1Q8I A;  3SV3 A;  1TVR A;  4E7J A;  3QEV A;  3ITH A;  3ZSZ A;  3AA3 A;  2HHW A;  1HNV A;  1KTQ A;  2E4L A;  3M8P A;  4IDK A;  1UA0 A;  3T19 A;  3T1A A;  3SQ0 A;  3SPZ A;  1WSE A;  4CJQ A;  4CED A;  2Z1H A;  4CEC A;  3HPH A;  1LWE A;  1BGX T;  2IC3 A;  2OYQ A;  1ASU A;  3P1G A;  3U3Y A;  1X1P A;  4CGD A;  1TL3 A;  3A2F A;  1IH7 A;  1VSK A;  2P51 A;  2A1S A;  3SPY A;  3MXM A;  3F73 A;  1U45 A;  1TK5 A;  4J2A A;  3S3O A;  3OYF A;  3HXM A;  3PUF A;  3HVR A;  1Z26 A;  4XIU A;  4CJV A;  4FLT A;  4DG1 A;  3L2Q A;  4Z0U A;  1TAQ A;  4FJI A;  1QQC A;  4DQI A;  3S3N A;  1X9M A;  3ZSW A;  1ZBI A;  3L2U A;  1BIS A;  4E3S A;  1NK9 A;  2G8H A;  3TR8 A;  3AO1 A;  4EZ6 A;  3DLR A;  3UIQ A;  3CM6 A;  2YV0 X;  1RBT A;  3SZ2 A;  4B9N A;  2HHU A;  2DTU A;  4C8L A;  4C8N A;  3HPO A;  3SCX A;  1WAJ A;  1HYV A;  2QXF A;  3G0Z A;  4ID1 A;  4CJ4 A;  3I0R A;  4CJ5 A;  4RW7 A;  4W5R A;  3O3H A;  2PZS A;  3K2P A;  5FRM A;  3PX6 A;  4ID5 A;  3LAK A;  3ZT1 A;  1VSJ A;  1RDA A;  2RF2 A;  4IFY A;  1U47 A;  1SL0 A;  1SKW A;  1IO2 A;  3PY8 A;  4QAG A;  4DTR A;  1D9F A;  4M3Z A;  3O4Q A;  2O4I A;  1FXX A;  2OZM A;  4FJG A;  4N41 A;  1W9H A;  4M41 A;  3I8D A;  5J2P A;  4FJ5 A;  1DTQ A;  3C95 A;  3EZ5 A;  4KHW A;  3ASM A;  4CJ3 A;  3MEE A;  4DTN A;  1RT2 A;  1RNH A;  3AVF A;  4FCY A;  4CEA A;  3AO2 A;  1FKO A;  3AVJ A;  4BWJ A;  3VQ6 A;  3ZSR A;  3SYZ A;  1QSL A;  4FJL A;  4DU3 A;  4Z4I A;  1JXB A;  1WSI A;  2FBT A;  4M3T A;  3FFI A;  1SL2 A;  4FLZ A;  4ELV A;  4O5B A;  2R7Y A;  3THV A;  4M42 A;  1B9D A;  3AO3 A;  1SKS A;  2XY7 A;  1W0H A;  4F8R A;  3AA5 X;  1JXE A;  3LAM A;  1T8E A;  1UOC A;  2ATQ A;  3VQQ A;  1JKH A;  1KVB A;  4DU1 A;  4CGJ A;  1GOC A;  4Z4G A;  5CZ2 A;  3LZI A;  2D5R A;  2F8S A;  4GW6 A;  3V9S A;  4DF8 A;  2HVI A;  1J53 A;  4MFB A;  1HPZ A;  4FLX A;  3LWL A;  1SUQ A;  3U6F A;  3OYJ A;  4DF4 A;  4FXD A;  1J9A A;  3S3M A;  1S1X A;  4FJ9 A;  3SUQ A;  1NK7 A;  1IKW A;  1TKX A;  4KO0 A;  4CGG A;  3DRP A;  4CFD A;  4FM1 A;  4BWM A;  2OPQ A;  1D8Y A;  3DRS A;  4AHT A;  4CHO A;  3QER A;  3DOK A;  4B8C A;  1RT7 A;  4C8M A;  2WOM A;  4KRF A;  1NJY A;  5DK5 A;  4Z4H A;  4HUF A;  4B9V A;  1LW2 A;  4B8A B;  4DSJ A;  3KD1 E;  1G15 A;  1BQM A;  1VRT A;  2ETJ A;  3AVL A;  3P5J A;  4OKJ A;  1WSF A;  1QSS A;  1RDD A;  4FJJ A;  1C0T A;  4N5S A;  3SNN A;  3RMA A;  4M3W A;  1ASW A;  4CIF A;  3ZT2 A;  1YT3 A;  5T7B A;  3KK3 A;  4BDY A;  3H08 A;  3HYF A;  4M3R A;  4GMJ B;  4DMN A;  3NF8 A;  4KB1 A;  1KCF A;  1JLE A;  1BL3 A;  5I42 A;  2A1R A;  3QO9 A;  1K6Y A;  1J5O A;  4E7I A;  2Q3S A;  3C6T A;  1RT3 A;  3VN5 A;  3V9W A;  1JL2 A;  3HP9 A;  2HMI A;  3AO4 A;  3VA0 A;  2OPP A;  3VQ9 A;  3OYN A;  4RW6 A;  1NK4 A;  1Z25 A;  4I7F A;  3VQE A;  4E7H A;  4N76 A;  4BAC A;  3L3U A;  1ZBL A;  4IG3 A;  2G8F A;  3NGZ A;  1XWL A;  2EHG A;  3LPT A;  3VA3 A;  3SQ1 A;  1DLO A;  1Q9Y A;  1KVA A;  2D0A A;  1RTJ A;  2NUB A;  4DQR A;  4H8K A;  4DFP A;  4FZY A;  2X6S A;  1EKE A;  1HMV A;  2XO7 A;  4IG0 A;  3SUN A;  5FDL A;  1RTI A;  1YTA A;  4PA1 A;  3NBP A;  3AO5 A;  3TAM A;  3V81 A;  2HW3 A;  1MU2 A;  3ALY A;  5C25 A;  4OPK A;  4ZTJ A;  4CJE A;  3HO1 A;  2P1J A;  3LWM A;  3BDP A;  3HPG A;  4FLY A;  3KLG A;  5C24 A;  1D9D A;  5J2N A;  1QE1 A;  4CF2 A;  4CF9 A;  4C8O A;  4CEF A;  1JLA A;  4CFC A;  4CHZ A;  1VSD A;  1GOA A;  3MED A;  1C0U A;  4B9M A;  4J2E A;  2E6L A;  4KPY A;  1DTT A;  4FK0 A;  3AVN A;  4O44 A;  3AA4 A;  3OJS A;  4DTX A;  3V1R A;  3PO5 A;  4ELU A;  3RWU A;  3K5M A;  3RRG A;  2HHS A;  2I5J A;  4IBN A;  3VQ4 A;  3LP0 A;  1TKZ A;  1QTM A;  3NDK A;  3PO4 A;  4B9S A;  5HRS A;  4C8K A;  3DOL A;  4B08 A;  3QEP A;  3DLH A;  4F3T A;  1BIU A;  1FK9 A;  4KTZ A;  2PYL A;  3LDS A;  1JLF A;  3V4I A;  4F4K A;  1CZB A;  2XY5 A;  4CF0 A;  4AHC A;  3NH1 A;  4FJX A;  4AHR A;  5JS1 A;  4FYD A;  4FK2 A;  3S9H A;  1L3T A;  1RDB A;  3RMB A;  1NOZ A;  4KTW A;  1RTD A;  4CJW A;  4NCG A;  1NKE A;  1C1B A;  3QEW A;  1CXU A;  1ZBF A;  4CFA A;  4KHN A;  4KHU A;  2KW4 A;  4RW8 A;  3LZJ A;  2HHT A;  4O55 A;  4IKF A;  3HK2 A;  2DY4 A;  1KLN A;  1XI1 A;  1CLQ A;  3OYL A;  3M8S A;  2XY6 A;  1L3V A;  1SV5 A;  1TV6 A;  3OYG A;  4DS5 A;  2VG5 A;  3MXI A;  3LAL A;  4OKE A;  3QES A;  4HHT A;  3KKR A;  5HRO A;  3ZT3 A;  4HUG A;  3DLG A;  4FW1 A;  3OY9 A;  2KFN A;  3ULD A;  4M3U A;  3ZT4 A;  1Y97 A;  1NOY A;  4FJH A;  1VSH A;  3HVT A;  2F96 A;  3CFO A;  3DLE A;  4EZ9 A;  2HND A;  1VSF A;  3AVH A;  1D5A A;  4RW4 A;  4CJU A;  1YVU A;  2Y1J A;  4M45 A;  1TKD A;  4FLU A;  3OYI A;  1JLQ A;  3AVG A;  2X74 A;  3E01 A;  3VQD A;  4CJP A;  1S9E A;  2P5G A;  3RRH A;  2BAN A;  4CGH A;  4FJN A;  4R5P A;  2QK9 A;  3L8B A;  3O3G A;  1WSG A;  1U49 A;  3VQP A;  3L3V A;  3VQC A;  3AVA A;  1BI4 B;  4LD0 A;  4FJ7 A;  3ZSY A;  1HNI A;  1S1V A;  1RT4 A;  3KIO A;  3HST B;  3OYK A;  1VSE A;  4CE9 A;  3NE6 A;  1RBS A;  3M8R A;  5HRN A;  3OYB A;  3K57 A;  4JS4 A;  2ITG A;  2YNI A;  4UQG A;  4CEB A;  4ZHR A;  3CFR A;  4E7K A;  4H4M A;  3TAG A;  3OJU A;  3OYD A;  2WON A;  4KTQ A;  4W5Q A;  4DTP A;  3K58 A;  2QKK A;  3NF7 A;  5E41 A;  3MAQ A;  2HVH A;  3K5L A;  4CF8 A;  3CQ8 A;  2G8K A;  3HM9 A;  2YNH A;  3IRX A;  4LH5 A;  2Z1I A;  3NHG A;  2ZE2 A;  2G8V A;  4TSX A;  4HTU A;  1S6Q A;  1KSP A;  4DTJ A;  1XHX A;  4FZX C;  4FVM A;  1KFD A;  5CY4 A;  1TK8 A;  3PV8 A;  1HYS A;  1CXQ A;  3SI6 A;  3OS0 A;  4N47 A;  1IG9 A;  3V9X A;  3AA2 A;  3RMD A;  3DLK A;  2KZM A;  4OLB A;  1BIZ A;  5CZ1 A;  1HRH A;  4OKK A;  3HT3 A;  4DTO A;  1U4B A;  3DLB A;  4GVM A;  3ZSX A;  4MQ3 A;  1RBU A;  3V6D A;  5DMR A;  4CK3 A;  4PY5 A;  4E89 A;  3AV9 A;  4CJF A;  1EX4 A;  4FLW A;  3C94 A;  2BGG A;  4OJR A;  1F21 A;  5HP1 A;  3V1Q A;  4FJ8 A;  1JL1 A;  1QS4 A;  1REV A;  1TKT A;  3LP1 A;  4LSL A;  5SZT A;  2D0B A;  1VSL A;  4NYF A;  3DM2 A;  4CHQ A;  5KI6 A;  3O3F A;  1X9W A;  1UWB A;  3TI0 A;  3CG7 A;  1ITG A;  4K8X A;  2PY5 A;  4F3O A;  3SUO A;  3C6U A;  1HYZ A;  3CM5 A;  2XHB A;  4ICL A;  3KLH A;  4FJK A;  2ZQB A;  4CJT A;  1SKR A;  3PX4 A;  5I3U A;  2KFZ A;  1S5J A;  1RDC A;  2DFE A;  2IAJ A;  5HBM A;  5KRS A;  3OS1 A;  2W42 A;  2OZS A;  2RPI A;  4OGC A;  1GOB A;  1NJW A;  4DFK A;  4KV8 A;  4DQS A;  1U48 A;  3ZSQ A;  5J1E A;  3KLF A;  4KHS A;  2JLE A;  3OYA A;  1EET A;  4CJL A;  3CFP A;  2B6A A;  4OPJ A;  4B3O A;  4Z4F A;  4J2D A;  4NCB A;  2DFF A;  3VQ8 A;  1A5V A;  5C42 A;  2JGU A;  3LP3 A;  4I2Q A;  3KTQ A;  2F8T A;  4CIE A;  1UA1 A;  2HNY A;  1TL1 A;  1TK0 A;  4M3X A;  1S1W A;  4J2B A;  1WSJ A;  1N6Q A;  4DWI A;  4RW9 A;  4YFU A;  5HRR A;  3VQ5 A;  3KLE A;  3F9K A;  4FW2 A;  4I9L A;  3KJV A;  4HCB A;  4I9Q A;  1HJR A;  4KI4 A;  4CGI A;  4FK4 A;  4Z4E A;  4N56 A;  3QET A;  1LWC A;  4KHY A;  4Z4C A;  4CEO A;  3TAB A;  3OYC A;  3RTV A;  3RR7 A;  1S9G A;  1FKP A;  3D45 A;  2G8I A;  1LAV A;  4PQU A;  5K14 A;  3K5O A;  1KFS A;  1JLB A;  3ZT0 A;  2GUI A;  2HHX A;  1NKB A;  2G8W A;  1LV5 A;  4KAZ A;  1I39 A;  4B9U A;  1WN7 A;  4CGF A;  2PYJ A;  4AHS A;  4NYN A;  3B6O A;  4JLH A;  3I0S A;  5HRP A;  3OYH A;  4W5O A;  1JLC A;  4DQQ A;  4DSL A;  3OYM A;  5CYQ A;  1WAF A;  2FBX A;  2YHB A;  3QIN A;  1X9S A;  1RT6 A;  1B92 A;  1C0M A;  2OPR A;  4E7L A;  5HLF A;  2BDP A;  3ISN C;  2B4J A;  4WE1 A;  1RBV A;  1T03 A;  1ZBU A;  5FRO A;  1EXQ A;  3NGI A;  3KLI A;  2HB5 A;  3DI6 A;  1NK0 A;  4E1M A;  1L3U A;  5EU7 A;  3K5N A;  5JS2 A;  4OLA A;  3PX0 A;  1RT5 A;  1ASV A;  1NJX A;  3WNG A;  4K8Z A;  1KLM A;  1A5W A;  1S1T A;  5KGW A;  3HP6 A;  4Y1D A;  4PUO A;  4LY7 A;  3HJF A;  4JS5 A;  3WNH A;  3AVM A;  2VG6 A;  3SV4 A;  2XY8 A;  1EP4 A;  2FBY A;  5KTQ A;  3TAP A;  1LWF A;  1NKC A;  1T7P A;  4CER A;  3IS9 A;  3BGR A;  2YKN A;  4LH4 A;  1WLJ A;  4CHN A;  3NAE A;  1Q9X A;  4DFJ A;  4F2S A;  3D0P A;  4CHY A;  1J54 A;  4KKO A;  1ZYQ A;  3NGY A;  3JSM A;  1U04 A;  1NK6 A;  2FC0 A;  4F2R A;  4AIL C;  4CK2 A;  3KKS A;  4RG8 A;  2XRI A;  2VG7 A;  4BE2 A;  3EYZ A;  3EY1 A;  1VSM A;  3TAR A;  3IG1 A;  3NCI A;  4NCA A;  4FZZ A;  1TAU A;  4CCH A;  1BI4 A;  2X6N A;  2OPS A;  4CEQ A;  3DMJ A;  3AVC A;  2E6M A;  2HHQ A;  3AVI A;  2DFH A;  1IKV A;  1O1W A;  2YKM A;  1ZBH A;  3M8Q A;  2GBZ A;  4CJK A;  2YNF A;  1TGO A;  4DSI A;  4CEZ A;  3TAE A;  2EX3 A;  3MEG A;  4EP5 A;  2P5O A;  3K59 A;  3NF9 A;  4CJR A;  2HNZ A;  1A5X A;  3OS2 A;  3B6P A;  3L2R A;  1RBR A;  4KI6 A;  2IDO A;  2Y1I A;  4CJS A;  1VSI A;  4DU4 A;  1KVC A;  5J2Q A;  3U3G A;  4JRQ A;  3SUP A;  5CYM A;  3L2W A;  3QIP A;  3O4N A;  4CK1 A;  4EP4 A;  2VWJ A;  1I3A A;  4DSE A;  2IGI A;  2G8U A;  1WNS A;  2X78 A;  3OVN A;  4KFB A;  3L2V A;  3MEC A;  2RKI A;  3TAF A;  4IFV A;  2Z1G A;  4HVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...