2X6NA

Human foamy virus integrase - catalytic core. manganese-bound structure.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
188
structure length
188
Chain Sequence
PQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein
molecule keywords INTEGRASE
total genus 60
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x6nA00
4KTQA 4KV8A 1JL1A 3TR8A 3V1QA 1T03A 4DFPA 3AA2A 2YKMA 3ALYA 3CG7A 5I3UA 1QSSA 4E7HA 5KGXA 4B9UA 4DSLA 4CJTA 5JS1A 4DTSA 1W9HA 3VA0A 4FJHA 3NDKA 1TAUA 4M3ZA 1HRHA 4FCYA 4HHTA 3L2RA 1X9MA 4AHVA 1LAWA 1BHLA 4ELTA 3S9HA 3OYLA 4CFBA 3SV3A 3L2UA 3V9SA 2DFFA 3NHGA 1VK0A 1LWFA 3DM2A 3K5MA 3V9WA 4DS4A 3DLBA 4B9MA 4N56A 3IRXA 3AV9A 1JLQA 3T19A 4KHNA 3HXMA 1BISA 1Q8IA 1EKEA 3K2PA 4NYFA 1C0MA 3TARA 3E01A 4CGDA 5HRPA 4DTOA 2JGUA 4C8MA 2W42A 3NGYA 2F96A 3DLEA 5K14A 2EX3A 4M3YA 3ZT2A 3VQ7A 1TK5A 3WNFA 4Z0UA 3OYCA 3SQ1A 2P51A 1L3VA 1VSHA 1MU2A 2OPPA 2VG5A 4FVMA 3ZT4A 3NH0A 3KLEA 4OJRA 3RRHA 3SQ2A 3RWUA 3AVHA 3TAMA 1IH7A 1LW2A 5DMRA 3SZ2A 2X6NA 4H4MA 1IG9A 3AVIA 1REVA 3NF7A 4DQIA 1BGXT 4M3RA 4RW6A 3VQCA 4FJJA 2IDOA 3D0PA 1LW0A 1S1WA 3M8QA 4RG8A 1RTDA 1LAVA 4O0JA 3DLHA 4KB1A 1KSPA 1W0HA 3HO1A 4HCCA 1C0UA 4FLYA 1FKOA 1I39A 3HP9A 4OKKA 1JL2A 3ZT1A 4CEOA 3PO5A 5FRMA 1WSEA 1L3UA 2I5JA 3OYBA 3OYAA 3NFAA 1RILA 3OVNA 1BCMA 3HPHA 4JS4A 4DSJA 2OPRA 3V9ZA 3DRSA 2FBXA 1KFDA 3CYMA 3CFRA 2E4LA 1HNIA 3TAQA 4M42A 4GVMA 4E7JA 1EX4A 1TL1A 3AVMA 2Y1JA 2KQ2A 1U48A 3G10A 4W5QA 4QCLA 4IFYA 2B4JA 4KTWA 2LSNA 1GOCA 3IS9A 4JLHA 4Y1DA 3OS2A 1NJZA 4RW9A 1X9SA 3V1OA 4FJ8A 4DTJA 3TABA 4CEQA 3O4NA 1R0AA 4KHSA 5J2MA 3T3FA 4CGGA 4K8XA 4IBNA 1CXQA 4W5NA 4C8KA 3VQDA 1QTMA 1FK9A 1D5AA 3QINA 3OY9A 3S3NA 4CJSA 3K5LA 2GV9A 5CY4A 4CF2A 1XHZA 2HNYA 4J2AA 1D9FA 1WN7A 3CM6A 4YFUA 3QEWA 1ZBIA 4W5TA 4HUFA 1T05A 2YNHA 1S9GA 3RMDA 3D45A 3SUOA 4EZ9A 2Z1HA 4KFBA 1B92A 4CHNA 4Z4IA 4DTUA 5J2NA 3HK2A 4DFMA 4KHYA 4DTRA 4E3SA 2ETJA 4CJQA 1XC9A 3ZCMA 1XWLA 3AVGA 4RW8A 3L2VA 4BE1A 3SQ0A 4E89A 1ASWA 2XY6A 3PX4A 3KLHA 4DS5A 2BE2A 1QE1A 1KVBA 3VQ9A 3QESA 4ZTJA 4CGJA 4FJ7A 5FRNA 3OYGA 1S6QA 3C95A 1JLAA 4G1QA 1FKPA 4IFVA 4Q5VA 3MAQA 2HNZA 3ZSQA 3O3HA 3OYHA 4FJGA 1C0TA 3AA3A 3SPYA 4GW6A 1U45A 3SI6A 3C94A 4CIFA 4PQUA 1BI4A 4E7IA 4AILC 3V9UA 2YNIA 1SL1A 2PZSA 2RPIA 4B08A 4OPJA 4HUEA 4NYNA 1VRTA 3HVRA 1N5YA 4E0DA 3IAYA 1BIZA 5I42A 3LAKA 3PUFA 2QK9A 3NF8A 1RT5A 4CHOA 2XRIA 3QETA 4FJLA 4BACA 1JXBA 1HQUA 4DLEA 4M41A 3SUNA 1D9DA 4FJNA 1ASUA 1RT3A 4BDZA 3KD1E 2WONA 4K8ZA 4J2DA 2BGGA 4CEZA 3K5NA 3S3MA 4QOZB 1A5WA 4O44A 1JLBA 2VG7A 4FM1A 1Z25A 5CZ1A 3VN5A 1D8YA 1BL3A 4BWJA 3F9KA 1O1WA 1WLJA 1SKRA 3RMCA 1L3TA 4ICLA 1GOBA 4DSEA 4CGIA 4OGEA 1K6YA 2WOMA 1BQMA 4LD0A 2D0CA 4ZHRA 3OS1A 3V4IA 5HRSA 4DU3A 1SL0A 4IKFA 3VQ8A 3SCXA 4CHQA 4O0IA 4CFDA 4C8NA 3V9XA 4CEFA 1SL2A 1JLEA 3JSMA 2HHXA 3TAEA 1LWCA 4E1NA 4FLUA 1SUQA 5HP1A 4F8RA 1NK5A 1B9FA 3TAGA 3AA5X 3LWLA 4CCHA 4O4GA 1S1UA 1TGOA 2E6MA 3AVJA 1RNHA 3ASMA 1KTQA 1U49A 4IDKA 4DSIA 2ZQBA 4KAZA 1HYSA 3LALA 3MECA 3K59A 2KFZA 3CM5A 5DK5A 4GMJB 1A5VA 1KVCA 4DTMA 1C1AA 4ELVA 2VWKA 3SUQA 3QIOA 1KRPA 4CK2A 3SYZA 2KFNA 2YV0X 2ATQA 2AJQA 3A2FA 3P1GA 4KTZA 3U3GA 3ZSXA 4CJPA 4Z4HA 1WAFA 4ID5A 1NOZA 3ULDA 1NJXA 4ELUA 3KTQA 4Z4EA 3THVA 1KFSA 3K58A 4CJKA 3DLRA 4PWDA 4E1MA 1T8EA 2FC0A 3M8SA 2OPSA 1WSJA 3TI0A 3G0ZA 1HYVA 3B6PA 4CJ4A 1WSGA 1C1BA 3AO4A 4N5SA 3CFOA 5C24A 1DTTA 3KLGA 4O5BA 1TVRA 3DOKA 4DTPA 3ITHA 5HRRA 4JRQA 1NKBA 4KREA 1XHXA 1YTUA 2HHQA 3H08A 4QAGA 2P1JA 1L3SA 1T7PA 1NK4A 3CQ8A 4FK4A 1QSLA 3KJVA 3QEVA 4CESA 4I9QA 2GUIA 4TSXA 2IC3A 5HBMA 3OYEA 2HHTA 3I0SA 1X1PA 4CEBA 3AVLA 1ZBLA 4FK0A 3HP6A 2FBTA 4FLWA 4E7KA 3TAPA 4CJLA 4J2BA 3LANA 4Y1CA 2XY8A 2Z1GA 3OYMA 1EETA 3TAFA 2DFEA 2Q3SA 4NCBA 2OYQA 3WNEA 4AHRA 3HJFA 3VQPA 3I0RA 4OPKA 4DG1A 4BE0A 1UWBA 2XO7A 1QHTA 1ITGA 3RTVA 4E7LA 1UA0A 4LH5A 1RDBA 1RCHA 3UIQA 5J2QA 1ASVA 1X9WA 1JXEA 4Z4FA 1IO2A 3L2WA 2X6SA 5J2PA 4B8AB 1TKDA 4CJVA 2OZMA 1TKZA 1JKHA 1TV6A 4C8LA 4M3TA 4O55A 4CF8A 3EYZA 4DSKA 3NF9A 2HB5A 1B9DA 1C6VA 3AVKA 3DRPA 2X78A 4CF0A 2G8UA 4N41A 2OPQA 3VQ4A 3MXJA 1A5XA 3DMJA 4I2QA 4LSNA 3VA3A 1S1VA 4E19A 1EP4A 4PUOA 4CFAA 2DY4A 3ISNC 2FBVA 2O4GA 3JYTA 1KLMA 1N6QA 3F73A 4CGHA 4CHZA 2RKIA 5C42A 2YHBA 1JLGA 3KKRA 3LP3A 3TANA 4FW1A 2HMIA 3AVCA 1TKTA 3QEXA 1NKCA 1Q9XA 3V81A 3NF6A 1NKEA 3VQQA 4DQSA 4KPYA 3OYIA 3HVTA 5HLFA 1Z26A 1WSHA 3NBPA 1UOCA 1SV5A 1VSLA 4FM2A 1Y97A 2NUBA 3ZSOA 3ZSWA 3NH1A 1C1CA 2ITGA 3VQEA 4CJWA 4F2SA 4JS5A 1RTIA 5FDLA 3QERA 1RT1A 3NCIA 5KGWA 4M3UA 4B3OA 1WSFA 2YKNA 2F8SA 2ZD1A 3ZSYA 5J1EA 4AH9A 2YNGA 3SNNA 4BWMA 1HMVA 1VSJA 2HHUA 4F3TA 2DFHA 3WNHA 5FROA 1RDDA 1RTJA 4AHCA 4DLGA 3KKSA 4F2RA 3IG1A 1I3AA 2PY5A 3EY1A 4C8OA 3OS0A 2VWJA 4I9LA 4FLTA 4NCGA 4LSLA 2G8WA 3AVBA 1JLCA 3LPTA 4B8CA 5T7BA 3OYKA 1VSKA 3SJJA 3HYFA 5D3GA 1CZBA 2Z1JA 3DOLA 3MEGA 4IG3A 4OVLA 3SV4A 4OGCA 4I7FA 4DF4A 4CF9A 3NGZA 3QIPA 3QNOA 2BANA 3O3FA 1HYZA 5SZTA 1LV5A 1RT2A 4ID1A 4B9NA 4JRPA 4DFKA 1HJRA 4B9TA 5KRTA 4OLBA 1ZBFA 3PX6A 1NK0A 4FLZA 1ZBUA 1BCOA 4FZYA 2X74A 4MFBA 2A1SA 3C6TA 1CZ9A 3LZJA 3RR8A 1RT7A 3RR7A 1VSFA 1FXXA 1QS4A 2VG6A 2HHWA 3ZT3A 4FLXA 4IG0A 3L2QA 4DF8A 1RBRA 1TKXA 4FZZA 3LP0A 3VQAA 3HPOA 4FLVA 3VQBA 4LH4A 2KW4A 3AVAA 1SKSA 3AA4A 4FJMA 1RT4A 2HNDA 3RRGA 4HUGA 1TAQA 2HVIA 4DTXA 4FJ5A 2G8FA 4M3WA 3OJUA 4FW2A 4OLAA 1NK7A 1IKXA 1U04A 1Q9YA 4DU1A 3WNGA 4KO0A 2ZE2A 3MEDA 2G8HA 2HVHA 4CEAA 3SQ4A 4BDYA 2OZSA 1VRUA 4KRFA 1J53A 4CJEA 3VQ5A 2B6AA 4CGFA 4XIUA 1TL3A 2B5JA 3AO1A 3FFIA 5CZ2A 4FZXC 4KB0A 4FJXA 4R5PA 4M3XA 4FJKA 1RT6A 2XY7A 4CF1A 4FK2A 2P5GA 3C6UA 2P5OA 3O3GA 3EZ5A 1CXUA 1HPZA 1S1TA 1S9EA 3PO4A 3OYFA 4FM0A 3NGIA 3L3VA 4EP5A 4RW4A 4CHYA 4Z4GA 3SUPA 1VSDA 3P83D 1BIUA 2A1RA 1BI4B 2D5RA 3B6OA 2O4IA 4EP4A 2GBZA 1RTHA 3LWMA 4BDPA 2YNFA 4CIGA 3AVNA 2HW3A 1KLNA 1NK9A 1RDAA 2XY5A 4OKEA 4DQQA 2YHAA 3AO5A 3RMBA 4EZ6A 5EU7A 5SWMA 2OA8A 4KKOA 4MQ3A 4CERA 4F4KA 2HHSA 1ZBHA 2FBYA 1L5UA 4WE1A 4PY5A 4CECA 4KHWA 4N47A 2PYLA 1QQCA 2G8IA 4I2PA 2JLEA 4DU4A 2PYJA 1RBTA 4DFJA 1UA1A 2KTQA 3K57A 4KHQA 4J2EA 4CJRA 3DRRA 3HT3A 1XI1A 2D0AA 1WSIA 4CJ3A 3MXIA 1G15A 1RBUA 5JS2A 3AO3A 3L3UA 1HNVA 1IKWA 4FJIA 2QXFA 1NJWA 2QKKA 2HHVA 4Z4CA 2KZMA 3KLFA 2BDPA 3U3YA 1IKYA 3DLGA 4FXDA 4AHUA 4YNQA 3ZSRA 5E41A 3LP1A 4LY7A 3NAEA 4B9VA 1NOYA 1VSEA 1BQNA 1EXQA 1WNSA 5CYMA 4FJ9A 2EHGA 3QLHA 4KI4A 4Q0BA 3PY8A 1NK8A 3KLIA 2IGIA 3AVFA 4W5RA 4PA1A 4N76A 5KTQA 2Y1IA 3ZSZA 2G8VA 4KI6A 1U4BA 1S1XA 5KRSA 2D0BA 4B9LA 2XHBA 1GOAA 3OYJA 3QNNA 3VQ6A 3KK1A 2R7YA 3OYNA 2IS3A 5HROA 4B9SA 4FYDA 3M8PA 3DYAA 3LP2A 4DTNA 4H4OA 3LZIA 4M45A 1DTQA 5CYQA 5HRNA 3MEEA 3HSTB 4CIEA 3OJSA 4CFCA 3OYDA 3HM9A 3V6DA 4KHUA 2KZZA 4DQRA 4HVJA 1ZYQA 1RBVA 1VSIA 3L8BA 3S3OA 4HTUA 4F3OA 4UQGA 4BE2A 1YTAA 4DWIA 1IKVA 1SKWA 3DLKA 3KD5E 3T1AA 3HL8A 4H8KA 3ZSVA 5C25A 1HQEA 4RW7A 1NK6A 3BDPA 3BGRA 4AHSA 3LPUA 1RBSA 2F8TA 3DI6A 3O4QA 3KK3A 3AO2A 3PV8A 3U6FA 1RDCA 2RN2A 1VSMA 4CJUA 1NJYA 1TK8A 1DLOA 3MXMA 2IAJA 4CK3A 4W5OA 4DSFA 3KIOA 3HPGA 3M8RA 4CEEA 4CK1A 2Z1IA 1QSYA 3LDSA 3QEIA 1UAXA 1TK0A 2E6LA 1U47A 3LAMA 4ZTFA 2DTUA 1YVUA 4OKJA 4CJ5A 4DMNA 3KK2A 2G8KA 1LWEA 2IOCA 5KI6A 3V1RA 3P5JA 3CFPA 3TWHA 1CLQA 3NH2A 1J54A 1J9AA 3ZT0A 4DQPA 2QKBA 1S5JA 3RMAA 3QEPA 4HCBA 3NE6A 3PX0A 4CE9A 1J5OA 1S6PA 4CEDA 4CHPA 3I8DA 1F21A 1WAJA 3QO9A 4NCAA 1KVAA 1JLFA 1KCFA 3SPZA 4CJFA 3K5OA 4AHTA 1YT3A 2RF2A 4L8RB
chains in the Genus database with same CATH superfamily
4KV8A 4EAHD 3V1QA 1T03A 4LF5K 4DFPA 1NGCA 5KQDA 3FZMA 2Q0UA 3CG7A 4E7HA 2PFUA 4DSLA 5JS1A 1W9HA 3VA0A 4K0KK 1R59O 4JI7K 3UKUA 2UUAK 3I55N 4AHVA 5LJWA 5GAGP 3OYLA 3SV3A 3L2UA 2DFFA 3UKUB 4UY8O 4FWRA 1LWFA 2OTJN 4B3TK 3DLBA 2A6AA 2Q97A 3IRXA 4LFAK 4GKKK 1YJNN 1EKEA 4NYFA 4WQ5A 2YCHA 3KHYA 3O1BA 3CD6N 3NGYA 2ZJRL 4XEIA 3WXJA 2GTDA 3ZT2A 3VQ7A 1TK5A 4Z0UA 2NLXA 4FK4A 2IVOA 1MU2A 2ASMA 3RRHA 3TAMA 2FF3B 3AVIA 1REVA 3NF7A 5CHIA 5EOYA 4CD1A 2WTUA 1VQ4N 1GLJO 3DLHA 2P9NB 1LAVA 3R8EA 2VQEK 1KSPA 4JAXA 3ZX2A 1C0UA 2OTLN 4CEOA 3F5TA 3PO5A 3J7AP 3VF4A 4A59A 3NFAA 4JN4A 3OVNA 4DR3K 1Z05A 3J80O 2OPRA 2FBXA 3CFRA 3BUZB 3VGLA 4W5QA 2A5XA 5C12A 4BR7A 3IS9A 3OS2A 4DV2K 1R0AA 3T3FA 4IBNA 4AQYK 4W5NA 3QINA 3OY9A 4BROA 1T3VA 2ZGZA 1D9FA 3VEXA 3D7EO 3HI0A 1O13A 3CCJN 3QEWA 3FZHA 4FWQA 2YNHA 1S9GA 3RMDA 2NRHA 2QWRA 5BPNA 4Z4IA 3F2KA 3AGKA 4DTUA 3E9LA 4E3SA 3NVMA 4BE1A 3L2VA 4WQ4C 2F4VK 1ASWA 2XY6A 3KLHA 2BE2A 4BRLA 2NRVA 1K9MO 1TYQA 3QESA 4CGJA 4FJ7A 3OYGA 4YOXA 3ZSQA 4AM7A 4FJGA 3SPYA 4GW6A 1HKBA 4PL7A 4CIFA 1Q18A 4AILC 3EEQA 3UB5A 2CGLA 4NYNA 2QK9A 1J6ZA 2O8CB 3T1YK 4CHOA 2ZWHA 4FJLA 1HQUA 1D9DA 3KD1E 3H45C 2WONA 4J2DA 2BGGA 2BH1A 2O8DA 3ZETA 1KC8O 2FF6A 1K73O 3GG4A 2VG7A 3VESA 1D8YA 1X3NA 1O1WA 2V52B 4OGEA 1WBDA 4LD0A 4ZHRA 2D0CA 4JHDB 4DU3A 3DXKA 5JICA 4C8NA 1SL2A 3JSMA 3SAHA 1LWCA 3A8YA 1SUQA 1RFQA 1VQ5N 1RNHA 4KAZA 1GLDG 3K59A 3CM5A 5DK5A 2WBNA 1KVCA 4ELVA 1C1AA 2BUPA 4CBUA 1BO5O 2AJQA 1DT9A 5TKYA 4KTZA 3U3GA 1S22A 1NJXA 4ELUA 1JCGA 2P9PB 4Z4EA 1KFSA 3K58A 3ATVA 1VQPN 4JKGB 4DV4K 4DR6K 5EXWA 1WSJA 3B6PA 4CJ4A 3O1WA 3AO4A 3H1QA 4BRNA 1RDUA 1YUWA 1TVRA 1NJIO 1V4TA 5HOOA 1VQ7N 1XHXA 3H08A 2P9IA 3O6WA 3CQ8A 3GL1A 4PL8A 1QSLA 4I9QA 3QEVA 4JKCA 2JWKA 2EWSA 2BTFA 4NB4A 4U67L 1BWFO 3I0SA 1NMDA 1ZBLA 4J2BA 3LANA 2Z1GA 2DFEA 2YJFA 4FPAA 4L3QA 4AHRA 2Q36A 3I0RA 5F0XA 4JI6K 4OPKA 3U8XA 1ITGA 3RTVA 4E7LA 1RCHA 1S72N 4WFBL 3UIQA 1ASVA 4JI0K 2UUBK 1IO2A 2WFBA 3BZCA 2X6SA 1JKHA 3LDPA 4BR0A 3JAMO 2UXDK 1B9DA 4BR5A 1C6VA 3AVKA 4O5FA 4KHPK 3QFPA 5F2RA 4JI1K 2G8UA 3CCEN 4B3SK 2QWLA 2FSJA 5AJ3K 1WUAA 4OPHA 1N6QA 5C42A 2RKIA 1C0GA 1K8AO 1JLGA 4U7BA 4DR5K 3FZFA 4I6MB 1NKCA 3V81A 4FSVA 1NKEA 3ID8A 3OYIA 4M7YA 1Z26A 3NBPA 4FM2A 1VSLA 3ZSOA 3C65A 1RTIA 3QERA 5KGWA 3OHRA 3DXMA 4BRFA 5J1EA 3T1HK 4BWMA 2HHUA 4PKIA 4H0TB 3PSFA 4AHCA 4H5VA 3KKSA 3CETA 4RCHA 3J81O 5AQNA 4I9LA 2F9TA 3AVBA 3LPTA 1VSKA 4FOEA 3DOLA 1LCUA 2YHWA 3CI5A 3E66A 3NGZA 1LV5A 4IOXA 4JRPA 4DFKA 1HJRA 1NGHA 2QWNA 3CJBA 4YOYA 5DM7L 1ZBUA 4FZYA 2A1SA 5KPTA 1VAZA 3FGUA 4K42A 3R1XA 1FXXA 3S41A 4FZZA 1QQNA 4DR7K 4NXNK 4LH4A 3AA4A 4FJMA 2HVIA 4YOUA 2YHYA 2IVNA 3L4QA 1U04A 3L6QA 2ZE2A 3MEDA 3MWTA 3MMVA 4BDYA 2OZSA 2O8FB 4Z94A 4CGFA 3FFIA 3AO1A 5CZ2A 4FZXC 2P9KB 1RT6A 1RGIA 3GBTA 2P5GA 3C6UA 3MWPA 3SUPA 1VSDA 2W40A 3CJ1A 1BI4B 2O4IA 2GBZA 2UU9K 2YNFA 4FWOA 1VQ6N 4CZIA 4DQQA 3AO5A 4KH5A 5EU7A 4F4KA 2HHSA 3W0LA 4WE1A 1X9JA 2JLEA 2PYJA 3K57A 4GV3A 2WUSA 1WSIA 3BEXA 3IFRA 4JKGA 4X65K 3DLGA 5M1NA 4FXDA 5FPDA 5E41A 4LY7A 1T6CA 3VERA 4FJ9A 2E1YA 2EHGA 3VTHA 5EVZA 4Q0BA 1NK8A 2IGIA 4PA1A 5KTQA 5AQJA 4WQ4A 2Y1IA 3A0IX 4KI6A 2NRRA 1S1XA 1JJ2M 3CJAA 3KK1A 1ZC6A 3DYAA 3LP2A 4DTNA 3AAPA 3LZIA 5AZJA 3HSTB 3G25A 2KZZA 4HVJA 4BG9A 4PKGA 4HTUA 1HLUA 2O8BA 3MN9A 4H8KA 5C25A 1RBSA 2F8TA 1I94K 3WXKA 4FOIA 5AQLA 3KK3A 3U6FA 1RDCA 2RN2A 2HOEA 4FL9A 1DLOA 2IAJA 3VEWA 3HPGA 4CK1A 2Z1IA 1QSYA 3QEIA 1UAXA 1TK0A 2E6LA 4IOAL 3KK2A 4H0VB 1VQ8N 3V1RA 1LWEA 1CLQA 3TWHA 3H1VX 3MN6A 3NH2A 1J54A 2HF3A 3VEVA 3RMAA 2P9LB 4HCBA 3NE6A 3M1FA 4CE9A 1SZ2A 1J5OA 1WAJA 3QO9A 4GNIA 4B1XB 4DHYA 2QA4N 4AHTA 1TV6A 3TR8A 1JL1A 1VQLN 3AA2A 1YVNA 1QSSA 4B9UA 4CJTA 4DTSA 4FJHA 3NDKA 1TAUA 4M3ZA 1HRHA 4A61A 3H3NO 4ELTA 5I9EB 5AQWA 4CFBA 5BRDA 3NHGA 1VK0A 3K5MA 3G6EN 2NRTA 3T19A 4KHNA 2H3GX 3HXMA 3CPWM 3LDOA 4K41A 3TARA 3E01A 4CGDA 3H46O 4DTOA 2QWMA 4C8MA 2W42A 1Q86O 2F96A 3DLEA 5K14A 5AQMA 2NZTA 2P9LA 3OYCA 4KI4A 2OPPA 3SQ2A 2VG5A 4QS7A 2OANA 3RWUA 1IG9A 1BGXT 4RW6A 4JK8A 3VQCA 2IDOA 4DUZK 3D0PA 2UXBK 1S1WA 3M8QA 3LM2A 1RTDA 4KB1A 4O0JA 1W0HA 3HP9A 2ASPA 1JL2A 4DV5K 4M63C 3ZT1A 4WYBA 5AQIA 3FE1A 3KWIA 1WSEA 3CCLN 4O8UA 2P9SB 1BA0A 5JLFA 1BCMA 1HPMA 2I7NA 2UUCK 4GVMA 3ATUA 5LJVA 4CJ7A 1U48A 4NXMK 1FJGK 1NG9A 2B4JA 2LSNA 1GOCA 1S3XA 4BRCA 1X9SA 4QS9A 4RW9A 4FJ8A 1MA9B 4CEQA 4WF9L 4BQLA 3SMPA 5LMUK 4BRHA 1CXQA 3NVKA 4JK7A 2HBMA 3O9TA 1QTMA 4BGAA 2GV9A 4DKWA 4K43A 4J2AA 3CC4N 4HUFA 4BVOA 1EWQA 3QBWA 3SUOA 3O9QA 3FFKB 2UYTA 4KFBA 4H0OA 5J2NA 3HK2A 2ETJA 4RW8A 3SQ0A 3LDQA 1DGKN 4J8FA 1KVBA 3BF1A 2AP1A 4GV9A 1JLAA 4Q5VA 3MAQA 3U4LA 1YITN 5BN8A 3OYHA 1ATNA 3AA3A 1U45A 1SS6A 3SI6A 1T6DA 4ISEA 3V9UA 2YNIA 3P4IA 1SL1A 2RPIA 4B08A 4A5AA 1N5YA 3IAYA 1BIZA 5AQTA 3K9KA 3E9PA 5I42A 4G9ZA 2XRIA 4BR9A 4CI6A 2UXCK 4BACA 3SUNA 3EKSA 5TKWA 1BDGA 1IJJA 2QM1A 4CEZA 2O8FA 3S3MA 4QOZB 1JLBA 4BC2A 5FPEA 1Z25A 1SKRA 2I7PA 1L3TA 4ICLA 1VQNN 1BQMA 2HF4A 3V4IA 5HRSA 2P9PA 3VQ8A 3SCXA 4CHQA 1GLFO 4O0IA 4CEFA 3TAEA 3O5BA 4CZLA 4FLUA 4YOWA 1XNRK 4CZEA 4CZMA 4CCHA 4O4GA 4LFCK 1U49A 1KTQA 4NO7A 2KFZA 1HYSA 2YHXA 2YV0X 1IG8A 3WQTA 3A2FA 3P1GA 4Z4HA 3U9ZA 4ID5A 3WXIA 3O9SA 4CJKA 4DR4K 4PWDA 2FC0A 3R3LA 3M8SA 4JKAA 3G0ZA 3SAGA 2HMPA 3HRGA 1N33K 2FSKA 2VCPA 1KAZA 2QWQA 3DOKA 3ZETB 3SBTA 3ITHA 5HRRA 4KREA 1T44A 1L3SA 2P9NA 4BR2A 4CESA 2GUIA 3THXB 1YHQN 5HBMA 5AQUA 2HHTA 1X1PA 4FK0A 4FLWA 5CE3A 3THWB 4CZGA 3TAPA 2QTDA 1BG3A 3TAFA 3QDKA 4NCBA 4I6MA 3HJFA 4BE0A 3SK3A 1UA0A 1RDBA 1NM1A 3CMAN 1X9WA 4ILJA 1JXEA 1YJ9N 3L2WA 4Z4FA 4FWSA 5J2PA 3EKUA 1OKJA 4CJVA 1TKZA 2OZMA 4YOVA 4CF8A 4DSKA 3NF9A 4ISFA 2QI2A 4N41A 2OPQA 2GX9A 3VQ4A 3LL3A 1H1VA 5DM6L 4LSNA 1NGIA 3TPQA 3G71N 1S1VA 4BGBA 2DY4A 4PUOA 4H5RA 4LF7K 4IO9L 2O4GA 1KLMA 5M1FA 3F73A 4AM6A 2YHBA 3HOTA 4MLHA 5AFUA 4FW1A 4JD2B 2HMIA 3AVCA 1VQON 4DQSA 4NLBA 3TTCA 5HLFA 2GELA 1WSHA 2W6KA 1SV5A 3O4WA 2NUBA 4CZFA 3NH1A 1C1CA 4CJWA 3EN9A 2ZJQL 1TUYA 3CC2N 4JKEA 2HHHK 3NCIA 3VGMA 2YKNA 3OW2M 2F7TA 3TSPA 2ZD1A 2E88A 5F1XA 1HMVA 1VSJA 5FLXO 4CBWA 4F3TA 5FROA 5LY3A 1RDDA 1QQMA 2PY5A 2ZJPL 3CCRN 4FLTA 5AQXA 1JLCA 2CH5A 4B8CA 5T7BA 3OYKA 3ID6A 3HYFA 5D3GA 2Z1JA 5AQSA 1HKCA 3O3FA 4IXCA 3I8BA 3PIOL 3N4QA 4B9TA 4OLBA 1ZBFA 3R9PA 1TUUA 4WFAL 1BCOA 2CH6A 3E1YA 4BRIA 2DPNA 4FLXA 3VEOA 3KVGA 4JI2K 4YY3K 4DF8A 3LP0A 3VQAA 5GINA 4BRQA 3VQBA 4JHDA 3RRGA 4MO4A 2G8FA 3BF3A 4FW2A 1NK7A 1IKXA 5C0YA 3C6HA 4KH6A 3WNGA 2HVHA 1GLEG 1NGEA 4DR2K 1K8KB 4KRFA 5BPMA 2ITMA 5C10A 4XIUA 2B5JA 4KB0A 1HNWK 1GLCG 4FJXA 4R5PA 4FJKA 4CF1A 3EZ5A 1U2VB 1S9EA 1NGBA 3CERA 3WEEB 3L3VA 4EP5A 5KPRA 4Z4GA 3P83D 2A1RA 2PAVA 3LWMA 4BDPA 5GIPA 2HW3A 3AVNA 1KLNA 1HKGA 4OKEA 4YHHK 3RMBA 5AQYA 4CERA 4MQ3A 3CC7N 2E1ZA 2FBYA 2AA4A 2PYLA 1QQCA 3TU5A 2G8IA 1K8KA 4DU4A 4DFJA 2KTQA 4KHQA 4CJRA 3HT3A 2D0AA 5JS2A 3AO3A 1Q82O 3L3UA 5AQVA 4FJIA 2QXFA 3J8AA 3C0BA 3U3YA 4DUYK 2OCEA 1P90A 3NAEA 3TSUA 4QS8A 1D4XA 1WNSA 2ZGYA 4HTLA 3QLHA 2ASOA 2KHOA 3CJ7A 4W5RA 4EHTA 3SAFA 3BY5A 2D0BA 4B9LA 1GLBG 2XHBA 3CMEN 3A5NC 3QNNA 3VQ6A 3OYNA 4H0XB 3M8PA 5AZIA 4H4OA 4M45A 1W7AA 3Q7BA 5HRNA 3MEEA 4BC3A 3OYDA 3SMSA 4KHUA 4FWLA 4F3OA 1RBVA 1VSIA 3WUHA 4UQGA 4BE2A 4DWIA 3O9UA 3T1AA 1NK6A 3BDPA 4JNEA 5AQZA 4AHSA 3NMUA 4CZHA 1X3MA 4A62A 4CK3A 4W5OA 3M8RA 3DLLL 3LAMA 5AQFA 4BRGA 1YVUA 4OKJA 5AQOA 4DMNA 2CGKA 3CFPA 3H3OB 3OBYA 4O8KA 1J9AA 4GVEA 4CHPA 4NCAA 4B3RK 1KVAA 2RF2A 2XY5A 4KTQA 2V51B 4FWNA 4C1NI 1IV0A 2QXLA 2YKMA 3ALYA 3CF5L 3KZBA 5KGXA 2Q0RA 4DV3K 3L2RA 1NMNA 2ZM6K 1XC3A 5AQQA 2E20A 5AQPA 3DJCA 3V9SA 4B9MA 2NNWA 1ZXOA 3WXMB 3AV9A 5IT9O 1JLQA 1V4SA 4X66K 1Q8IA 4JKBA 2JGUA 3O8MA 3CCVN 1WBBA 1NGDA 3TSQA 3WNFA 3VF6A 2P9UA 4CW7B 4DV1K 2P5OA 4FVMA 3KLEA 1Y64A 3NH0A 4OJRA 2V7ZA 3AVHA 1LW2A 5DMRA 4DQIA 4KBOA 4FJJA 3I33A 4ILGB 3ENOA 4B1YB 3ZEUA 1XMOK 4OKKA 3CQYA 3FLCO 4JKHA 2I5JA 3OYBA 3OYAA 3D2EB 1RILA 1HJOA 1KFDA 3CYMA 3IDHA 1HNIA 4YOTA 4E7JA 3AVMA 2KQ2A 3VPZA 1HNZK 3KWGA 4KTWA 5AZIB 4JLHA 4Y1DA 4DTJA 3J7ZO 3O4NA 4M7XA 4KHSA 2KKZA 4JKFA 4CGGA 5J2MA 1KD1O 4K25A 3VQDA 4BRAA 1D5AA 3S3NA 4CF2A 3CM6A 4YFUA 4W5TA 4RWTA 1B92A 3C6AA 3QFUA 3ZCMA 1QZ5A 4E89A 3CQXA 1NGGA 1QE1A 3VQ9A 3OA9A 2E2PA 1S6QA 3C95A 4OO1J 1FKPA 4IFVA 2HNZA 4V19S 3H6EA 4WQ5C 5AQKA 1E4GT 2HBJA 3GDQA 3C94A 3QICA 1OVYA 4E7IA 2GEMA 2PZSA 1N32K 4OPJA 4HUEA 5BR8K 1VRTA 3HVRA 3O08A 1YXQA 4DB3A 3NF8A 1RT5A 4H5NA 4LFBK 3QETA 4M41A 4FJNA 1N36K 5ADXH 4K8ZA 3HOSA 5EX5A 3Q7CA 3K5NA 5B8HA 3RVCA 1A5WA 2E8AA 2HBKA 3VN5A 4BWJA 3F9KA 1GOBA 3MCPA 3VEYA 4CGIA 3OS1A 5GAEP 4IKFA 2D4WA 4A2AA 1KAYA 2HHXA 4F8RA 4E1NA 1NK5A 1B9FA 3TAGA 3LWLA 1TGOA 3AVJA 3ASMA 4XH1A 3LALA 5BN9A 5MLCQ 1DEJA 1A5VA 1KAXA 3QIOA 3SLCA 2ATQA 3SBGA 4CBXA 3MX2A 3ZSXA 4B1VA 1WAFA 3OBWA 4LF9K 1BU6O 4E1JA 4WCEL 3TI0A 2P9SA 5C15A 1WSGA 1C1BA 3CIPA 5C24A 5C2DA 1MWKA 4JRQA 1NGAA 4FWPA 1XMQK 1T7PA 2RHKA 3R6MA 1XUPO 3RSEA 2ZF5O 3MX5A 1W97L 3OYEA 4HWIA 1NGFA 4CEBA 2FBTA 4CJLA 4IEEA 2XY8A 3LDNA 3OYMA 1EETA 2Q3SA 1VQ9N 2OYQA 4GV6A 3LDLA 3VQPA 4B3MK 4IWVA 4DG1A 1UWBA 2XO7A 2YJEA 4BREA 1MWMA 3CCUN 4B8AB 1TKDA 3EYZA 3DRPA 2X78A 3CHWA 4CF0A 1Q81O 4BR4A 5LMNK 3DMJA 2V7YA 4I2QA 2GWJA 4LF4K 4E19A 4YDUC 4CFAA 4YDUA 1IBKK 4CHZA 3L0QA 3KKRA 4BQZA 1XNQK 1NU0A 3TTDA 1Q9XA 3IKMA 3VQQA 4JI4K 3HVTA 4FWMA 1XQSC 5LL6Z 1EQYA 1UOCA 1QVFM 3ZSWA 4BVPA 3THWA 3CXCM 1W2BM 5ELZA 4JS5A 1RT1A 4B3OA 4M3UA 1WSFA 3ENHA 2F8SA 4MO5A 3ZSYA 4AH9A 3SNNA 3EO3A 2A3ZA 2O8EA 1ILYA 3WNHA 4DLGA 3IG1A 3EY1A 2VWJA 4JYAK 4NCGA 1OH7A 1YI2N 1ATRA 1CZBA 3MEGA 3SV4A 4OVLA 5AZJB 4OGCA 3VF2A 1ATSA 4DF4A 4CF9A 3QNOA 3QIPA 5SZTA 3CCSN 3FZLA 3ENBA 2HBLA 4JK9A 4CD3A 1NK0A 3A5OC 4MFBA 3C6TA 3RR8A 3T7ZA 1QS4A 4IG0A 3L2QA 1TKXA 3HPOA 3AVAA 3D2FA 3B8AX 2HNDA 3ULEA 1TAQA 4DTXA 3KK7A 4FJ5A 4M3WA 3OJUA 3SJHA 4DU1A 4KO0A 3SQ4A 2VGMA 1J53A 3VQ5A 2B6AA 3AGRA 2NRWA 3THYB 2FLOA 4FK2A 2E2OA 1CXUA 2Q31A 4FM0A 3NGIA 1YIJN 4RW4A 1JCEA 3K0SA 1BIUA 2D5RA 3B6OA 4FPBA 4EP4A 1RTHA 5JLHA 4H5WA 4FO0A 4CIGA 5BREA 5AQHA 4MDAA 3CJ9A 2YHAA 2VYPA 2OA8A 4KKOA 4C1NK 1ZBHA 4KHWA 3VGKA 1UA1A 3MCAB 3LM9A 2NRZA 2RE2A 1G15A 4IJNA 1IKWA 2HHVA 3BP8A 4BC5A 4IOCL 4Z4CA 2O8BB 2W6LA 4A5BA 4AHUA 4B9VA 1WOQA 1BQNA 1EXQA 3VMFB 3A5LC 5M1OA 1QHAA 3PY8A 4N76A 1HR0K 4CVNE 3ZSZA 2G8VA 2D1KA 2QW9A 1U4BA 5KRSA 1FW6A 3WXLA 4LC9B 2R7YA 4FYDA 5BRFA 4JI5K 4EFHA 1KQSM 1SAZA 3T69A 4CFCA 3V6DA 3QB0A 1ZYQA 3L8BA 5H1SQ 1OVQA 2Q1NA 5AQGA 3DLKA 3KD5E 3HL8A 5AR0A 3ZSVA 4RW7A 2PBDA 3LPUA 1EO1A 1OH6A 3O4QA 3VEZA 1RDWX 3AO2A 4X62K 2GWKA 1VSMA 4CJUA 3P38A 1N34K 1VQKN 1YAGA 4OX9K 4DSFA 4GKJK 3KIOA 3LDSA 2IIRA 1U47A 4ZTFA 2DTUA 4DV6K 2G8KA 2IOCA 5KI6A 1YJWN 2D0OA 3O80A 3ZT0A 4MDBA 3PX0A 1G99A 3PIPL 1S6PA 4CEDA 4IEIA 3ZYYX 1F21A 3I8DA 1Z6RA 1JLFA 1KCFA 3SPZA 4KPYA 1YT3A 5JVHL 4L8RB 2P9KA 3OTOK 5AQRA 3L4IA 4OPAA 5I3UA 3U9DA 2W41A 1IBLK 4FCYA 4HHTA 2J4RA 5CR4A 1X9MA 3EE8A 1LAWA 2D0PA 1BHLA 1NWKA 3S9HA 3D2FB 5JVGL 3DM2A 3V9WA 3M5RA 4DS4A 4N56A 3PSIA 3IMXA 1BISA 3DAWA 4R79A 3K2PA 1C0MA 4C23A 1HX1A 5HRPA 2VWBA 1LOTB 2CGJA 4M3YA 2EX3A 1J5EK 1L3VA 2E2NA 4H5TA 3SQ1A 2P51A 1QVGM 1VSHA 1OH8A 3ZT4A 1E3MA 5IWAK 3SZ2A 1IH7A 2KLAA 1N8RO 4LF6K 4FVUA 2X6NA 4H4MA 5M1QA 4M3RA 1DKGD 1LW0A 3EL2A 4RG8A 3GE1A 3HO1A 4HCCA 2A41A 4FLYA 1FKOA 1I39A 3VENA 4GY2B 1U6ZA 4ISGA 4RTFD 5A2QO 5GADP 5FRMA 2O8EB 1L3UA 4H0PA 3HPHA 2IVPA 4JS4A 4DSJA 3V9ZA 3DRSA 3TAQA 2E4LA 4M42A 2QEXN 1EX4A 1TL1A 2Y1JA 4QCLA 3G10A 4BC4A 4IFYA 1ESVA 1NJZA 4H03B 2P9UB 3V1OA 3TABA 1BA1A 1KXPA 4K8XA 4C8KA 1FK9A 4CJSA 3K5LA 5CY4A 1XHZA 2HNYA 1WN7A 1ZBIA 2VQFK 1T05A 4EZ9A 3D45A 2Z1HA 3W3DA 4CHNA 4DFMA 4KHYA 3HM8A 4DTRA 4CJQA 1XC9A 3FZKA 5AFUH 1XWLA 2F9WA 3AVGA 5BR9A 3PX4A 4DS5A 3MN7A 4ZTJA 4PKHA 2A42A 2O8DB 5FRNA 4G1QA 4BRMA 4MLEA 3O3HA 3ZX0A 1C0TA 4EHUA 4PQUA 1BI4A 2Q2RA 4E0DA 3BZKA 3LAKA 3PUFA 1HNXK 3THYA 3MN5A 1JXBA 4PHTX 4DLEA 1ASUA 1RT3A 3EE9A 3DWLA 4BDZA 5C2FA 3CJCA 3TTFA 3J7YP 1Q7YO 4O44A 4FM1A 5CZ1A 1BL3A 4B9QA 2YI1A 1BOTO 1WLJA 3RMCA 4CZKA 4DSEA 3ULEB 1K6YA 2WOMA 1SL0A 4CFDA 3V9XA 5FPNA 1JLEA 5HP1A 4EIAA 2GUPA 3AA5X 1S1UA 2E6MA 1OH5A 4IDKA 4DSIA 2ZQBA 3MECA 3M6GA 4GMJB 4DTMA 2JWLA 2VWKA 3F9MA 3SUQA 1KRPA 4CK2A 3SYZA 2KFNA 4JEPA 4CJPA 3ULDA 1NOZA 3DXKB 4F9OA 3KTQA 4A57A 4BRKA 3THVA 3DLRA 4E1MA 1T8EA 3ZX3A 5KQ8A 2OPSA 4DR1K 3D2EA 1HYVA 5GIOA 4N5SA 3CFOA 1DTTA 4JKDA 4O5BA 3KLGA 3D6RA 4DTPA 1NKBA 5ADXA 1YTUA 2HHQA 4QAGA 2P1JA 3VOVA 1NK4A 3QBXA 3KJVA 3DXMB 4TSXA 2IC3A 3AVLA 3HP6A 4DV0K 1QQOA 4E7KA 3K9JA 4IO8A 4B1WB 4Y1CA 1CZAN 3WNEA 4DV7K 1QHTA 3MK6A 4LH5A 5J2QA 4B1ZA 4IZ9A 3E9OA 3GOIA 4C8LA 4M3TA 4O55A 1MDUB 2HB5A 4JI8K 4IFEA 4DQ8A 3UE5A 3MXJA 3G4SN 1A5XA 4B1UB 3VA3A 1EP4A 3ISNC 2FBVA 1VQMN 5BPLA 5E26A 4JI3K 3JYTA 2QWOA 4CGHA 3FR0A 1P8ZA 2HSTA 3P31A 3LP3A 5M1KA 3TANA 1TKTA 3QEXA 3NF6A 1Y97A 2ITGA 3VQEA 3N4PA 4F2SA 5FDLA 1M90O 4KH4A 5EY4A 3P39A 3EZWA 3QMLA 3RSEB 3A5MC 2YNGA 3CCQN 2P9IB 3AY9A 2DFHA 1RTJA 1YF5L 4F2RA 1I3AA 4C8OA 3OS0A 4LSLA 2G8WA 3SJJA 3C7NB 1NGJA 2VGNA 1WB9A 4IG3A 1IBMK 4I7FA 4B9NA 2BANA 1HYZA 1RT2A 4ID1A 4X64K 3AAQA 1M1KO 5KRTA 2WC9A 4WFNL 3PX6A 4FLZA 4IJAA 2X74A 1NLVA 3JXUA 4JD2A 1JCFA 4NLCA 1CZ9A 3LZJA 1RT7A 3RR7A 1VSFA 3HTVA 2QWPA 3CPEA 2VG6A 2HHWA 3ZT3A 1RBRA 3VETA 4FLVA 2FXUA 2KW4A 1SKSA 1QZ6A 1RT4A 3AARA 4HUGA 1HUXA 4BRDA 4OLAA 1Q9YA 2G8HA 4CEAA 1GLAG 1VRUA 4FWKA 4CJEA 1TL3A 4M3XA 3WQUA 2YX6A 2XY7A 2A40A 1NBWA 2O8CA 3O3GA 1S1TA 1HPZA 5JMVA 3PO4A 3OYFA 4BG8A 4CHYA 4XH4A 2E5LK 3WEEA 1EWRA 3THXA 1NK9A 1RDAA 3MDQA 2NRXA 4EZ6A 3HBTA 5SWMA 3O9RA 1L5UA 4PY5A 4CECA 4N47A 4I2PA 3HZ6A 3UKRB 1RBTA 1TYQB 3JS6A 4J2EA 5HL7L 3DRRA 1XI1A 4CJ3A 3MXIA 1GLLO 1RBUA 1ZBSA 3I56N 3PLAA 1HNVA 2QKKA 1NJWA 2KZMA 3KLFA 4BY9C 5GAHP 3ZLJA 1VHXA 2BDPA 1IKYA 3M3ZA 4YNQA 3ZSRA 3LP1A 5KPZA 1NOYA 1VSEA 3CCMN 5CYMA 1C0FA 4Y0WA 5E84A 3KLIA 3AVFA 4LF8K 4A2BA 5M1PA 1GOAA 3OYJA 1NNEA 2IS3A 5HROA 4B9SA 1DTQA 5CYQA 4CIEA 3OJSA 3HM9A 5FPMA 4ILHA 4DQRA 3C7NA 3S3OA 1YTAA 1IKVA 1SKWA 4YORA 2E2QA 1HQEA 4JV5K 3BGRA 3IUCA 3DI6A 4DCHA 3UKRA 4XH5A 3HSCA 3PV8A 1NJYA 2FSNA 1TK8A 3ZEUB 3MXMA 3WT0A 4H0YB 4CEEA 4IDHA 5BRHA 4CJ5A 3VTIA 1SQKA 3P5JA 4AF1A 2QKBA 4CZJA 4DQPA 1E4FT 1S5JA 4BRPA 3QEPA 1BUPA 1U2VA 4CJFA 3K5OA
chains in the Genus database with same CATH topology
4KTQA 4KV8A 1JL1A 3TR8A 3V1QA 1T03A 4DFPA 3AA2A 2YKMA 3ALYA 3CG7A 5I3UA 1QSSA 4E7HA 5KGXA 4B9UA 4DSLA 4CJTA 5JS1A 4DTSA 1W9HA 3VA0A 4FJHA 3NDKA 1TAUA 4M3ZA 1HRHA 4FCYA 4HHTA 3L2RA 1X9MA 4AHVA 1LAWA 1BHLA 4ELTA 3S9HA 3OYLA 4CFBA 3SV3A 3L2UA 3V9SA 2DFFA 3NHGA 1VK0A 1LWFA 3DM2A 3K5MA 3V9WA 4DS4A 3DLBA 4B9MA 4N56A 3IRXA 3AV9A 1JLQA 3T19A 4KHNA 3HXMA 1BISA 1Q8IA 1EKEA 3K2PA 4NYFA 1C0MA 3TARA 3E01A 4CGDA 5HRPA 4DTOA 2JGUA 4C8MA 2W42A 3NGYA 2F96A 3DLEA 5K14A 2EX3A 4M3YA 3ZT2A 3VQ7A 1TK5A 3WNFA 4Z0UA 3OYCA 3SQ1A 2P51A 1L3VA 1VSHA 1MU2A 2OPPA 2VG5A 4FVMA 3ZT4A 3NH0A 3KLEA 4OJRA 3RRHA 3SQ2A 3RWUA 3AVHA 3TAMA 1IH7A 1LW2A 5DMRA 3SZ2A 2X6NA 4H4MA 1IG9A 3AVIA 1REVA 3NF7A 4DQIA 1BGXT 4M3RA 4RW6A 3VQCA 4FJJA 2IDOA 3D0PA 1LW0A 1S1WA 3M8QA 4RG8A 1RTDA 1LAVA 4O0JA 3DLHA 4KB1A 1KSPA 1W0HA 3HO1A 4HCCA 1C0UA 4FLYA 1FKOA 1I39A 3HP9A 4OKKA 1JL2A 3ZT1A 4CEOA 3PO5A 5FRMA 1WSEA 1L3UA 2I5JA 3OYBA 3OYAA 3NFAA 1RILA 3OVNA 1BCMA 3HPHA 4JS4A 4DSJA 2OPRA 3V9ZA 3DRSA 2FBXA 1KFDA 3CYMA 3CFRA 2E4LA 1HNIA 3TAQA 4M42A 4GVMA 4E7JA 1EX4A 1TL1A 3AVMA 2Y1JA 2KQ2A 1U48A 3G10A 4W5QA 4QCLA 4IFYA 2B4JA 4KTWA 2LSNA 1GOCA 3IS9A 4JLHA 4Y1DA 3OS2A 1NJZA 4RW9A 1X9SA 3V1OA 4FJ8A 4DTJA 3TABA 4CEQA 3O4NA 1R0AA 4KHSA 5J2MA 3T3FA 4CGGA 4K8XA 4IBNA 1CXQA 4W5NA 4C8KA 3VQDA 1QTMA 1FK9A 1D5AA 3QINA 3OY9A 3S3NA 4CJSA 3K5LA 2GV9A 5CY4A 4CF2A 1XHZA 2HNYA 4J2AA 1D9FA 1WN7A 3CM6A 4YFUA 3QEWA 1ZBIA 4W5TA 4HUFA 1T05A 2YNHA 1S9GA 3RMDA 3D45A 3SUOA 4EZ9A 2Z1HA 4KFBA 1B92A 4CHNA 4Z4IA 4DTUA 5J2NA 3HK2A 4DFMA 4KHYA 4DTRA 4E3SA 2ETJA 4CJQA 1XC9A 3ZCMA 1XWLA 3AVGA 4RW8A 3L2VA 4BE1A 3SQ0A 4E89A 1ASWA 2XY6A 3PX4A 3KLHA 4DS5A 2BE2A 1QE1A 1KVBA 3VQ9A 3QESA 4ZTJA 4CGJA 4FJ7A 5FRNA 3OYGA 1S6QA 3C95A 1JLAA 4G1QA 1FKPA 4IFVA 4Q5VA 3MAQA 2HNZA 3ZSQA 3O3HA 3OYHA 4FJGA 1C0TA 3AA3A 3SPYA 4GW6A 1U45A 3SI6A 3C94A 4CIFA 4PQUA 1BI4A 4E7IA 4AILC 3V9UA 2YNIA 1SL1A 2PZSA 2RPIA 4B08A 4OPJA 4HUEA 4NYNA 1VRTA 3HVRA 1N5YA 4E0DA 3IAYA 1BIZA 5I42A 3LAKA 3PUFA 2QK9A 3NF8A 1RT5A 4CHOA 2XRIA 3QETA 4FJLA 4BACA 1JXBA 1HQUA 4DLEA 4M41A 3SUNA 1D9DA 4FJNA 1ASUA 1RT3A 4BDZA 3KD1E 2WONA 4K8ZA 4J2DA 2BGGA 4CEZA 3K5NA 3S3MA 4QOZB 1A5WA 4O44A 1JLBA 2VG7A 4FM1A 1Z25A 5CZ1A 3VN5A 1D8YA 1BL3A 4BWJA 3F9KA 1O1WA 1WLJA 1SKRA 3RMCA 1L3TA 4ICLA 1GOBA 4DSEA 4CGIA 4OGEA 1K6YA 2WOMA 1BQMA 4LD0A 2D0CA 4ZHRA 3OS1A 3V4IA 5HRSA 4DU3A 1SL0A 4IKFA 3VQ8A 3SCXA 4CHQA 4O0IA 4CFDA 4C8NA 3V9XA 4CEFA 1SL2A 1JLEA 3JSMA 2HHXA 3TAEA 1LWCA 4E1NA 4FLUA 1SUQA 5HP1A 4F8RA 1NK5A 1B9FA 3TAGA 3AA5X 3LWLA 4CCHA 4O4GA 1S1UA 1TGOA 2E6MA 3AVJA 1RNHA 3ASMA 1KTQA 1U49A 4IDKA 4DSIA 2ZQBA 4KAZA 1HYSA 3LALA 3MECA 3K59A 2KFZA 3CM5A 5DK5A 4GMJB 1A5VA 1KVCA 4DTMA 1C1AA 4ELVA 2VWKA 3SUQA 3QIOA 1KRPA 4CK2A 3SYZA 2KFNA 2YV0X 2ATQA 2AJQA 3A2FA 3P1GA 4KTZA 3U3GA 3ZSXA 4CJPA 4Z4HA 1WAFA 4ID5A 1NOZA 3ULDA 1NJXA 4ELUA 3KTQA 4Z4EA 3THVA 1KFSA 3K58A 4CJKA 3DLRA 4PWDA 4E1MA 1T8EA 2FC0A 3M8SA 2OPSA 1WSJA 3TI0A 3G0ZA 1HYVA 3B6PA 4CJ4A 1WSGA 1C1BA 3AO4A 4N5SA 3CFOA 5C24A 1DTTA 3KLGA 4O5BA 1TVRA 3DOKA 4DTPA 3ITHA 5HRRA 4JRQA 1NKBA 4KREA 1XHXA 1YTUA 2HHQA 3H08A 4QAGA 2P1JA 1L3SA 1T7PA 1NK4A 3CQ8A 4FK4A 1QSLA 3KJVA 3QEVA 4CESA 4I9QA 2GUIA 4TSXA 2IC3A 5HBMA 3OYEA 2HHTA 3I0SA 1X1PA 4CEBA 3AVLA 1ZBLA 4FK0A 3HP6A 2FBTA 4FLWA 4E7KA 3TAPA 4CJLA 4J2BA 3LANA 4Y1CA 2XY8A 2Z1GA 3OYMA 1EETA 3TAFA 2DFEA 2Q3SA 4NCBA 2OYQA 3WNEA 4AHRA 3HJFA 3VQPA 3I0RA 4OPKA 4DG1A 4BE0A 1UWBA 2XO7A 1QHTA 1ITGA 3RTVA 4E7LA 1UA0A 4LH5A 1RDBA 1RCHA 3UIQA 5J2QA 1ASVA 1X9WA 1JXEA 4Z4FA 1IO2A 3L2WA 2X6SA 5J2PA 4B8AB 1TKDA 4CJVA 2OZMA 1TKZA 1JKHA 1TV6A 4C8LA 4M3TA 4O55A 4CF8A 3EYZA 4DSKA 3NF9A 2HB5A 1B9DA 1C6VA 3AVKA 3DRPA 2X78A 4CF0A 2G8UA 4N41A 2OPQA 3VQ4A 3MXJA 1A5XA 3DMJA 4I2QA 4LSNA 3VA3A 1S1VA 4E19A 1EP4A 4PUOA 4CFAA 2DY4A 3ISNC 2FBVA 2O4GA 3JYTA 1KLMA 1N6QA 3F73A 4CGHA 4CHZA 2RKIA 5C42A 2YHBA 1JLGA 3KKRA 3LP3A 3TANA 4FW1A 2HMIA 3AVCA 1TKTA 3QEXA 1NKCA 1Q9XA 3V81A 3NF6A 1NKEA 3VQQA 4DQSA 4KPYA 3OYIA 3HVTA 5HLFA 1Z26A 1WSHA 3NBPA 1UOCA 1SV5A 1VSLA 4FM2A 1Y97A 2NUBA 3ZSOA 3ZSWA 3NH1A 1C1CA 2ITGA 3VQEA 4CJWA 4F2SA 4JS5A 1RTIA 5FDLA 3QERA 1RT1A 3NCIA 5KGWA 4M3UA 4B3OA 1WSFA 2YKNA 2F8SA 2ZD1A 3ZSYA 5J1EA 4AH9A 2YNGA 3SNNA 4BWMA 1HMVA 1VSJA 2HHUA 4F3TA 2DFHA 3WNHA 5FROA 1RDDA 1RTJA 4AHCA 4DLGA 3KKSA 4F2RA 3IG1A 1I3AA 2PY5A 3EY1A 4C8OA 3OS0A 2VWJA 4I9LA 4FLTA 4NCGA 4LSLA 2G8WA 3AVBA 1JLCA 3LPTA 4B8CA 5T7BA 3OYKA 1VSKA 3SJJA 3HYFA 5D3GA 1CZBA 2Z1JA 3DOLA 3MEGA 4IG3A 4OVLA 3SV4A 4OGCA 4I7FA 4DF4A 4CF9A 3NGZA 3QIPA 3QNOA 2BANA 3O3FA 1HYZA 5SZTA 1LV5A 1RT2A 4ID1A 4B9NA 4JRPA 4DFKA 1HJRA 4B9TA 5KRTA 4OLBA 1ZBFA 3PX6A 1NK0A 4FLZA 1ZBUA 1BCOA 4FZYA 2X74A 4MFBA 2A1SA 3C6TA 1CZ9A 3LZJA 3RR8A 1RT7A 3RR7A 1VSFA 1FXXA 1QS4A 2VG6A 2HHWA 3ZT3A 4FLXA 4IG0A 3L2QA 4DF8A 1RBRA 1TKXA 4FZZA 3LP0A 3VQAA 3HPOA 4FLVA 3VQBA 4LH4A 2KW4A 3AVAA 1SKSA 3AA4A 4FJMA 1RT4A 2HNDA 3RRGA 4HUGA 1TAQA 2HVIA 4DTXA 4FJ5A 2G8FA 4M3WA 3OJUA 4FW2A 4OLAA 1NK7A 1IKXA 1U04A 1Q9YA 4DU1A 3WNGA 4KO0A 2ZE2A 3MEDA 2G8HA 2HVHA 4CEAA 3SQ4A 4BDYA 2OZSA 1VRUA 4KRFA 1J53A 4CJEA 3VQ5A 2B6AA 4CGFA 4XIUA 1TL3A 2B5JA 3AO1A 3FFIA 5CZ2A 4FZXC 4KB0A 4FJXA 4R5PA 4M3XA 4FJKA 1RT6A 2XY7A 4CF1A 4FK2A 2P5GA 3C6UA 2P5OA 3O3GA 3EZ5A 1CXUA 1HPZA 1S1TA 1S9EA 3PO4A 3OYFA 4FM0A 3NGIA 3L3VA 4EP5A 4RW4A 4CHYA 4Z4GA 3SUPA 1VSDA 3P83D 1BIUA 2A1RA 1BI4B 2D5RA 3B6OA 2O4IA 4EP4A 2GBZA 1RTHA 3LWMA 4BDPA 2YNFA 4CIGA 3AVNA 2HW3A 1KLNA 1NK9A 1RDAA 2XY5A 4OKEA 4DQQA 2YHAA 3AO5A 3RMBA 4EZ6A 5EU7A 5SWMA 2OA8A 4KKOA 4MQ3A 4CERA 4F4KA 2HHSA 1ZBHA 2FBYA 1L5UA 4WE1A 4PY5A 4CECA 4KHWA 4N47A 2PYLA 1QQCA 2G8IA 4I2PA 2JLEA 4DU4A 2PYJA 1RBTA 4DFJA 1UA1A 2KTQA 3K57A 4KHQA 4J2EA 4CJRA 3DRRA 3HT3A 1XI1A 2D0AA 1WSIA 4CJ3A 3MXIA 1G15A 1RBUA 5JS2A 3AO3A 3L3UA 1HNVA 1IKWA 4FJIA 2QXFA 1NJWA 2QKKA 2HHVA 4Z4CA 2KZMA 3KLFA 2BDPA 3U3YA 1IKYA 3DLGA 4FXDA 4AHUA 4YNQA 3ZSRA 5E41A 3LP1A 4LY7A 3NAEA 4B9VA 1NOYA 1VSEA 1BQNA 1EXQA 1WNSA 5CYMA 4FJ9A 2EHGA 3QLHA 4KI4A 4Q0BA 3PY8A 1NK8A 3KLIA 2IGIA 3AVFA 4W5RA 4PA1A 4N76A 5KTQA 2Y1IA 3ZSZA 2G8VA 4KI6A 1U4BA 1S1XA 5KRSA 2D0BA 4B9LA 2XHBA 1GOAA 3OYJA 3QNNA 3VQ6A 3KK1A 2R7YA 3OYNA 2IS3A 5HROA 4B9SA 4FYDA 3M8PA 3DYAA 3LP2A 4DTNA 4H4OA 3LZIA 4M45A 1DTQA 5CYQA 5HRNA 3MEEA 3HSTB 4CIEA 3OJSA 4CFCA 3OYDA 3HM9A 3V6DA 4KHUA 2KZZA 4DQRA 4HVJA 1ZYQA 1RBVA 1VSIA 3L8BA 3S3OA 4HTUA 4F3OA 4UQGA 4BE2A 1YTAA 4DWIA 1IKVA 1SKWA 3DLKA 3KD5E 3T1AA 3HL8A 4H8KA 3ZSVA 5C25A 1HQEA 4RW7A 1NK6A 3BDPA 3BGRA 4AHSA 3LPUA 1RBSA 2F8TA 3DI6A 3O4QA 3KK3A 3AO2A 3PV8A 3U6FA 1RDCA 2RN2A 1VSMA 4CJUA 1NJYA 1TK8A 1DLOA 3MXMA 2IAJA 4CK3A 4W5OA 4DSFA 3KIOA 3HPGA 3M8RA 4CEEA 4CK1A 2Z1IA 1QSYA 3LDSA 3QEIA 1UAXA 1TK0A 2E6LA 1U47A 3LAMA 4ZTFA 2DTUA 1YVUA 4OKJA 4CJ5A 4DMNA 3KK2A 2G8KA 1LWEA 2IOCA 5KI6A 3V1RA 3P5JA 3CFPA 3TWHA 1CLQA 3NH2A 1J54A 1J9AA 3ZT0A 4DQPA 2QKBA 1S5JA 3RMAA 3QEPA 4HCBA 3NE6A 3PX0A 4CE9A 1J5OA 1S6PA 4CEDA 4CHPA 3I8DA 1F21A 1WAJA 3QO9A 4NCAA 1KVAA 1JLFA 1KCFA 3SPZA 4CJFA 3K5OA 4AHTA 1YT3A 2RF2A 4L8RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTQ A;  4KV8 A;  1JL1 A;  3TR8 A;  3V1Q A;  1T03 A;  4DFP A;  3AA2 A;  2YKM A;  3ALY A;  3CG7 A;  5I3U A;  1QSS A;  4E7H A;  5KGX A;  4B9U A;  4DSL A;  4CJT A;  5JS1 A;  4DTS A;  1W9H A;  3VA0 A;  4FJH A;  3NDK A;  1TAU A;  4M3Z A;  1HRH A;  4FCY A;  4HHT A;  3L2R A;  1X9M A;  4AHV A;  1LAW A;  1BHL A;  4ELT A;  3S9H A;  3OYL A;  4CFB A;  3SV3 A;  3L2U A;  3V9S A;  2DFF A;  3NHG A;  1VK0 A;  1LWF A;  3DM2 A;  3K5M A;  3V9W A;  4DS4 A;  3DLB A;  4B9M A;  4N56 A;  3IRX A;  3AV9 A;  1JLQ A;  3T19 A;  4KHN A;  3HXM A;  1BIS A;  1Q8I A;  1EKE A;  3K2P A;  4NYF A;  1C0M A;  3TAR A;  3E01 A;  4CGD A;  5HRP A;  4DTO A;  2JGU A;  4C8M A;  2W42 A;  3NGY A;  2F96 A;  3DLE A;  5K14 A;  2EX3 A;  4M3Y A;  3ZT2 A;  3VQ7 A;  1TK5 A;  3WNF A;  4Z0U A;  3OYC A;  3SQ1 A;  2P51 A;  1L3V A;  1VSH A;  1MU2 A;  2OPP A;  2VG5 A;  4FVM A;  3ZT4 A;  3NH0 A;  3KLE A;  4OJR A;  3RRH A;  3SQ2 A;  3RWU A;  3AVH A;  3TAM A;  1IH7 A;  1LW2 A;  5DMR A;  3SZ2 A;  2X6N A;  4H4M A;  1IG9 A;  3AVI A;  1REV A;  3NF7 A;  4DQI A;  1BGX T;  4M3R A;  4RW6 A;  3VQC A;  4FJJ A;  2IDO A;  3D0P A;  1LW0 A;  1S1W A;  3M8Q A;  4RG8 A;  1RTD A;  1LAV A;  4O0J A;  3DLH A;  4KB1 A;  1KSP A;  1W0H A;  3HO1 A;  4HCC A;  1C0U A;  4FLY A;  1FKO A;  1I39 A;  3HP9 A;  4OKK A;  1JL2 A;  3ZT1 A;  4CEO A;  3PO5 A;  5FRM A;  1WSE A;  1L3U A;  2I5J A;  3OYB A;  3OYA A;  3NFA A;  1RIL A;  3OVN A;  1BCM A;  3HPH A;  4JS4 A;  4DSJ A;  2OPR A;  3V9Z A;  3DRS A;  2FBX A;  1KFD A;  3CYM A;  3CFR A;  2E4L A;  1HNI A;  3TAQ A;  4M42 A;  4GVM A;  4E7J A;  1EX4 A;  1TL1 A;  3AVM A;  2Y1J A;  2KQ2 A;  1U48 A;  3G10 A;  4W5Q A;  4QCL A;  4IFY A;  2B4J A;  4KTW A;  2LSN A;  1GOC A;  3IS9 A;  4JLH A;  4Y1D A;  3OS2 A;  1NJZ A;  4RW9 A;  1X9S A;  3V1O A;  4FJ8 A;  4DTJ A;  3TAB A;  4CEQ A;  3O4N A;  1R0A A;  4KHS A;  5J2M A;  3T3F A;  4CGG A;  4K8X A;  4IBN A;  1CXQ A;  4W5N A;  4C8K A;  3VQD A;  1QTM A;  1FK9 A;  1D5A A;  3QIN A;  3OY9 A;  3S3N A;  4CJS A;  3K5L A;  2GV9 A;  5CY4 A;  4CF2 A;  1XHZ A;  2HNY A;  4J2A A;  1D9F A;  1WN7 A;  3CM6 A;  4YFU A;  3QEW A;  1ZBI A;  4W5T A;  4HUF A;  1T05 A;  2YNH A;  1S9G A;  3RMD A;  3D45 A;  3SUO A;  4EZ9 A;  2Z1H A;  4KFB A;  1B92 A;  4CHN A;  4Z4I A;  4DTU A;  5J2N A;  3HK2 A;  4DFM A;  4KHY A;  4DTR A;  4E3S A;  2ETJ A;  4CJQ A;  1XC9 A;  3ZCM A;  1XWL A;  3AVG A;  4RW8 A;  3L2V A;  4BE1 A;  3SQ0 A;  4E89 A;  1ASW A;  2XY6 A;  3PX4 A;  3KLH A;  4DS5 A;  2BE2 A;  1QE1 A;  1KVB A;  3VQ9 A;  3QES A;  4ZTJ A;  4CGJ A;  4FJ7 A;  5FRN A;  3OYG A;  1S6Q A;  3C95 A;  1JLA A;  4G1Q A;  1FKP A;  4IFV A;  4Q5V A;  3MAQ A;  2HNZ A;  3ZSQ A;  3O3H A;  3OYH A;  4FJG A;  1C0T A;  3AA3 A;  3SPY A;  4GW6 A;  1U45 A;  3SI6 A;  3C94 A;  4CIF A;  4PQU A;  1BI4 A;  4E7I A;  4AIL C;  3V9U A;  2YNI A;  1SL1 A;  2PZS A;  2RPI A;  4B08 A;  4OPJ A;  4HUE A;  4NYN A;  1VRT A;  3HVR A;  1N5Y A;  4E0D A;  3IAY A;  1BIZ A;  5I42 A;  3LAK A;  3PUF A;  2QK9 A;  3NF8 A;  1RT5 A;  4CHO A;  2XRI A;  3QET A;  4FJL A;  4BAC A;  1JXB A;  1HQU A;  4DLE A;  4M41 A;  3SUN A;  1D9D A;  4FJN A;  1ASU A;  1RT3 A;  4BDZ A;  3KD1 E;  2WON A;  4K8Z A;  4J2D A;  2BGG A;  4CEZ A;  3K5N A;  3S3M A;  4QOZ B;  1A5W A;  4O44 A;  1JLB A;  2VG7 A;  4FM1 A;  1Z25 A;  5CZ1 A;  3VN5 A;  1D8Y A;  1BL3 A;  4BWJ A;  3F9K A;  1O1W A;  1WLJ A;  1SKR A;  3RMC A;  1L3T A;  4ICL A;  1GOB A;  4DSE A;  4CGI A;  4OGE A;  1K6Y A;  2WOM A;  1BQM A;  4LD0 A;  2D0C A;  4ZHR A;  3OS1 A;  3V4I A;  5HRS A;  4DU3 A;  1SL0 A;  4IKF A;  3VQ8 A;  3SCX A;  4CHQ A;  4O0I A;  4CFD A;  4C8N A;  3V9X A;  4CEF A;  1SL2 A;  1JLE A;  3JSM A;  2HHX A;  3TAE A;  1LWC A;  4E1N A;  4FLU A;  1SUQ A;  5HP1 A;  4F8R A;  1NK5 A;  1B9F A;  3TAG A;  3AA5 X;  3LWL A;  4CCH A;  4O4G A;  1S1U A;  1TGO A;  2E6M A;  3AVJ A;  1RNH A;  3ASM A;  1KTQ A;  1U49 A;  4IDK A;  4DSI A;  2ZQB A;  4KAZ A;  1HYS A;  3LAL A;  3MEC A;  3K59 A;  2KFZ A;  3CM5 A;  5DK5 A;  4GMJ B;  1A5V A;  1KVC A;  4DTM A;  1C1A A;  4ELV A;  2VWK A;  3SUQ A;  3QIO A;  1KRP A;  4CK2 A;  3SYZ A;  2KFN A;  2YV0 X;  2ATQ A;  2AJQ A;  3A2F A;  3P1G A;  4KTZ A;  3U3G A;  3ZSX A;  4CJP A;  4Z4H A;  1WAF A;  4ID5 A;  1NOZ A;  3ULD A;  1NJX A;  4ELU A;  3KTQ A;  4Z4E A;  3THV A;  1KFS A;  3K58 A;  4CJK A;  3DLR A;  4PWD A;  4E1M A;  1T8E A;  2FC0 A;  3M8S A;  2OPS A;  1WSJ A;  3TI0 A;  3G0Z A;  1HYV A;  3B6P A;  4CJ4 A;  1WSG A;  1C1B A;  3AO4 A;  4N5S A;  3CFO A;  5C24 A;  1DTT A;  3KLG A;  4O5B A;  1TVR A;  3DOK A;  4DTP A;  3ITH A;  5HRR A;  4JRQ A;  1NKB A;  4KRE A;  1XHX A;  1YTU A;  2HHQ A;  3H08 A;  4QAG A;  2P1J A;  1L3S A;  1T7P A;  1NK4 A;  3CQ8 A;  4FK4 A;  1QSL A;  3KJV A;  3QEV A;  4CES A;  4I9Q A;  2GUI A;  4TSX A;  2IC3 A;  5HBM A;  3OYE A;  2HHT A;  3I0S A;  1X1P A;  4CEB A;  3AVL A;  1ZBL A;  4FK0 A;  3HP6 A;  2FBT A;  4FLW A;  4E7K A;  3TAP A;  4CJL A;  4J2B A;  3LAN A;  4Y1C A;  2XY8 A;  2Z1G A;  3OYM A;  1EET A;  3TAF A;  2DFE A;  2Q3S A;  4NCB A;  2OYQ A;  3WNE A;  4AHR A;  3HJF A;  3VQP A;  3I0R A;  4OPK A;  4DG1 A;  4BE0 A;  1UWB A;  2XO7 A;  1QHT A;  1ITG A;  3RTV A;  4E7L A;  1UA0 A;  4LH5 A;  1RDB A;  1RCH A;  3UIQ A;  5J2Q A;  1ASV A;  1X9W A;  1JXE A;  4Z4F A;  1IO2 A;  3L2W A;  2X6S A;  5J2P A;  4B8A B;  1TKD A;  4CJV A;  2OZM A;  1TKZ A;  1JKH A;  1TV6 A;  4C8L A;  4M3T A;  4O55 A;  4CF8 A;  3EYZ A;  4DSK A;  3NF9 A;  2HB5 A;  1B9D A;  1C6V A;  3AVK A;  3DRP A;  2X78 A;  4CF0 A;  2G8U A;  4N41 A;  2OPQ A;  3VQ4 A;  3MXJ A;  1A5X A;  3DMJ A;  4I2Q A;  4LSN A;  3VA3 A;  1S1V A;  4E19 A;  1EP4 A;  4PUO A;  4CFA A;  2DY4 A;  3ISN C;  2FBV A;  2O4G A;  3JYT A;  1KLM A;  1N6Q A;  3F73 A;  4CGH A;  4CHZ A;  2RKI A;  5C42 A;  2YHB A;  1JLG A;  3KKR A;  3LP3 A;  3TAN A;  4FW1 A;  2HMI A;  3AVC A;  1TKT A;  3QEX A;  1NKC A;  1Q9X A;  3V81 A;  3NF6 A;  1NKE A;  3VQQ A;  4DQS A;  4KPY A;  3OYI A;  3HVT A;  5HLF A;  1Z26 A;  1WSH A;  3NBP A;  1UOC A;  1SV5 A;  1VSL A;  4FM2 A;  1Y97 A;  2NUB A;  3ZSO A;  3ZSW A;  3NH1 A;  1C1C A;  2ITG A;  3VQE A;  4CJW A;  4F2S A;  4JS5 A;  1RTI A;  5FDL A;  3QER A;  1RT1 A;  3NCI A;  5KGW A;  4M3U A;  4B3O A;  1WSF A;  2YKN A;  2F8S A;  2ZD1 A;  3ZSY A;  5J1E A;  4AH9 A;  2YNG A;  3SNN A;  4BWM A;  1HMV A;  1VSJ A;  2HHU A;  4F3T A;  2DFH A;  3WNH A;  5FRO A;  1RDD A;  1RTJ A;  4AHC A;  4DLG A;  3KKS A;  4F2R A;  3IG1 A;  1I3A A;  2PY5 A;  3EY1 A;  4C8O A;  3OS0 A;  2VWJ A;  4I9L A;  4FLT A;  4NCG A;  4LSL A;  2G8W A;  3AVB A;  1JLC A;  3LPT A;  4B8C A;  5T7B A;  3OYK A;  1VSK A;  3SJJ A;  3HYF A;  5D3G A;  1CZB A;  2Z1J A;  3DOL A;  3MEG A;  4IG3 A;  4OVL A;  3SV4 A;  4OGC A;  4I7F A;  4DF4 A;  4CF9 A;  3NGZ A;  3QIP A;  3QNO A;  2BAN A;  3O3F A;  1HYZ A;  5SZT A;  1LV5 A;  1RT2 A;  4ID1 A;  4B9N A;  4JRP A;  4DFK A;  1HJR A;  4B9T A;  5KRT A;  4OLB A;  1ZBF A;  3PX6 A;  1NK0 A;  4FLZ A;  1ZBU A;  1BCO A;  4FZY A;  2X74 A;  4MFB A;  2A1S A;  3C6T A;  1CZ9 A;  3LZJ A;  3RR8 A;  1RT7 A;  3RR7 A;  1VSF A;  1FXX A;  1QS4 A;  2VG6 A;  2HHW A;  3ZT3 A;  4FLX A;  4IG0 A;  3L2Q A;  4DF8 A;  1RBR A;  1TKX A;  4FZZ A;  3LP0 A;  3VQA A;  3HPO A;  4FLV A;  3VQB A;  4LH4 A;  2KW4 A;  3AVA A;  1SKS A;  3AA4 A;  4FJM A;  1RT4 A;  2HND A;  3RRG A;  4HUG A;  1TAQ A;  2HVI A;  4DTX A;  4FJ5 A;  2G8F A;  4M3W A;  3OJU A;  4FW2 A;  4OLA A;  1NK7 A;  1IKX A;  1U04 A;  1Q9Y A;  4DU1 A;  3WNG A;  4KO0 A;  2ZE2 A;  3MED A;  2G8H A;  2HVH A;  4CEA A;  3SQ4 A;  4BDY A;  2OZS A;  1VRU A;  4KRF A;  1J53 A;  4CJE A;  3VQ5 A;  2B6A A;  4CGF A;  4XIU A;  1TL3 A;  2B5J A;  3AO1 A;  3FFI A;  5CZ2 A;  4FZX C;  4KB0 A;  4FJX A;  4R5P A;  4M3X A;  4FJK A;  1RT6 A;  2XY7 A;  4CF1 A;  4FK2 A;  2P5G A;  3C6U A;  2P5O A;  3O3G A;  3EZ5 A;  1CXU A;  1HPZ A;  1S1T A;  1S9E A;  3PO4 A;  3OYF A;  4FM0 A;  3NGI A;  3L3V A;  4EP5 A;  4RW4 A;  4CHY A;  4Z4G A;  3SUP A;  1VSD A;  3P83 D;  1BIU A;  2A1R A;  1BI4 B;  2D5R A;  3B6O A;  2O4I A;  4EP4 A;  2GBZ A;  1RTH A;  3LWM A;  4BDP A;  2YNF A;  4CIG A;  3AVN A;  2HW3 A;  1KLN A;  1NK9 A;  1RDA A;  2XY5 A;  4OKE A;  4DQQ A;  2YHA A;  3AO5 A;  3RMB A;  4EZ6 A;  5EU7 A;  5SWM A;  2OA8 A;  4KKO A;  4MQ3 A;  4CER A;  4F4K A;  2HHS A;  1ZBH A;  2FBY A;  1L5U A;  4WE1 A;  4PY5 A;  4CEC A;  4KHW A;  4N47 A;  2PYL A;  1QQC A;  2G8I A;  4I2P A;  2JLE A;  4DU4 A;  2PYJ A;  1RBT A;  4DFJ A;  1UA1 A;  2KTQ A;  3K57 A;  4KHQ A;  4J2E A;  4CJR A;  3DRR A;  3HT3 A;  1XI1 A;  2D0A A;  1WSI A;  4CJ3 A;  3MXI A;  1G15 A;  1RBU A;  5JS2 A;  3AO3 A;  3L3U A;  1HNV A;  1IKW A;  4FJI A;  2QXF A;  1NJW A;  2QKK A;  2HHV A;  4Z4C A;  2KZM A;  3KLF A;  2BDP A;  3U3Y A;  1IKY A;  3DLG A;  4FXD A;  4AHU A;  4YNQ A;  3ZSR A;  5E41 A;  3LP1 A;  4LY7 A;  3NAE A;  4B9V A;  1NOY A;  1VSE A;  1BQN A;  1EXQ A;  1WNS A;  5CYM A;  4FJ9 A;  2EHG A;  3QLH A;  4KI4 A;  4Q0B A;  3PY8 A;  1NK8 A;  3KLI A;  2IGI A;  3AVF A;  4W5R A;  4PA1 A;  4N76 A;  5KTQ A;  2Y1I A;  3ZSZ A;  2G8V A;  4KI6 A;  1U4B A;  1S1X A;  5KRS A;  2D0B A;  4B9L A;  2XHB A;  1GOA A;  3OYJ A;  3QNN A;  3VQ6 A;  3KK1 A;  2R7Y A;  3OYN A;  2IS3 A;  5HRO A;  4B9S A;  4FYD A;  3M8P A;  3DYA A;  3LP2 A;  4DTN A;  4H4O A;  3LZI A;  4M45 A;  1DTQ A;  5CYQ A;  5HRN A;  3MEE A;  3HST B;  4CIE A;  3OJS A;  4CFC A;  3OYD A;  3HM9 A;  3V6D A;  4KHU A;  2KZZ A;  4DQR A;  4HVJ A;  1ZYQ A;  1RBV A;  1VSI A;  3L8B A;  3S3O A;  4HTU A;  4F3O A;  4UQG A;  4BE2 A;  1YTA A;  4DWI A;  1IKV A;  1SKW A;  3DLK A;  3KD5 E;  3T1A A;  3HL8 A;  4H8K A;  3ZSV A;  5C25 A;  1HQE A;  4RW7 A;  1NK6 A;  3BDP A;  3BGR A;  4AHS A;  3LPU A;  1RBS A;  2F8T A;  3DI6 A;  3O4Q A;  3KK3 A;  3AO2 A;  3PV8 A;  3U6F A;  1RDC A;  2RN2 A;  1VSM A;  4CJU A;  1NJY A;  1TK8 A;  1DLO A;  3MXM A;  2IAJ A;  4CK3 A;  4W5O A;  4DSF A;  3KIO A;  3HPG A;  3M8R A;  4CEE A;  4CK1 A;  2Z1I A;  1QSY A;  3LDS A;  3QEI A;  1UAX A;  1TK0 A;  2E6L A;  1U47 A;  3LAM A;  4ZTF A;  2DTU A;  1YVU A;  4OKJ A;  4CJ5 A;  4DMN A;  3KK2 A;  2G8K A;  1LWE A;  2IOC A;  5KI6 A;  3V1R A;  3P5J A;  3CFP A;  3TWH A;  1CLQ A;  3NH2 A;  1J54 A;  1J9A A;  3ZT0 A;  4DQP A;  2QKB A;  1S5J A;  3RMA A;  3QEP A;  4HCB A;  3NE6 A;  3PX0 A;  4CE9 A;  1J5O A;  1S6P A;  4CED A;  4CHP A;  3I8D A;  1F21 A;  1WAJ A;  3QO9 A;  4NCA A;  1KVA A;  1JLF A;  1KCF A;  3SPZ A;  4CJF A;  3K5O A;  4AHT A;  1YT3 A;  2RF2 A;  4L8R B; 
#chains in the Genus database with same CATH topology
 4KV8 A;  4EAH D;  3V1Q A;  1T03 A;  4LF5 K;  4DFP A;  1NGC A;  5KQD A;  3FZM A;  2Q0U A;  3CG7 A;  4E7H A;  2PFU A;  4DSL A;  5JS1 A;  1W9H A;  3VA0 A;  4K0K K;  1R59 O;  4JI7 K;  3UKU A;  2UUA K;  3I55 N;  4AHV A;  5LJW A;  5GAG P;  3OYL A;  3SV3 A;  3L2U A;  2DFF A;  3UKU B;  4UY8 O;  4FWR A;  1LWF A;  2OTJ N;  4B3T K;  3DLB A;  2A6A A;  2Q97 A;  3IRX A;  4LFA K;  4GKK K;  1YJN N;  1EKE A;  4NYF A;  4WQ5 A;  2YCH A;  3KHY A;  3O1B A;  3CD6 N;  3NGY A;  2ZJR L;  4XEI A;  3WXJ A;  2GTD A;  3ZT2 A;  3VQ7 A;  1TK5 A;  4Z0U A;  2NLX A;  4FK4 A;  2IVO A;  1MU2 A;  2ASM A;  3RRH A;  3TAM A;  2FF3 B;  3AVI A;  1REV A;  3NF7 A;  5CHI A;  5EOY A;  4CD1 A;  2WTU A;  1VQ4 N;  1GLJ O;  3DLH A;  2P9N B;  1LAV A;  3R8E A;  2VQE K;  1KSP A;  4JAX A;  3ZX2 A;  1C0U A;  2OTL N;  4CEO A;  3F5T A;  3PO5 A;  3J7A P;  3VF4 A;  4A59 A;  3NFA A;  4JN4 A;  3OVN A;  4DR3 K;  1Z05 A;  3J80 O;  2OPR A;  2FBX A;  3CFR A;  3BUZ B;  3VGL A;  4W5Q A;  2A5X A;  5C12 A;  4BR7 A;  3IS9 A;  3OS2 A;  4DV2 K;  1R0A A;  3T3F A;  4IBN A;  4AQY K;  4W5N A;  3QIN A;  3OY9 A;  4BRO A;  1T3V A;  2ZGZ A;  1D9F A;  3VEX A;  3D7E O;  3HI0 A;  1O13 A;  3CCJ N;  3QEW A;  3FZH A;  4FWQ A;  2YNH A;  1S9G A;  3RMD A;  2NRH A;  2QWR A;  5BPN A;  4Z4I A;  3F2K A;  3AGK A;  4DTU A;  3E9L A;  4E3S A;  3NVM A;  4BE1 A;  3L2V A;  4WQ4 C;  2F4V K;  1ASW A;  2XY6 A;  3KLH A;  2BE2 A;  4BRL A;  2NRV A;  1K9M O;  1TYQ A;  3QES A;  4CGJ A;  4FJ7 A;  3OYG A;  4YOX A;  3ZSQ A;  4AM7 A;  4FJG A;  3SPY A;  4GW6 A;  1HKB A;  4PL7 A;  4CIF A;  1Q18 A;  4AIL C;  3EEQ A;  3UB5 A;  2CGL A;  4NYN A;  2QK9 A;  1J6Z A;  2O8C B;  3T1Y K;  4CHO A;  2ZWH A;  4FJL A;  1HQU A;  1D9D A;  3KD1 E;  3H45 C;  2WON A;  4J2D A;  2BGG A;  2BH1 A;  2O8D A;  3ZET A;  1KC8 O;  2FF6 A;  1K73 O;  3GG4 A;  2VG7 A;  3VES A;  1D8Y A;  1X3N A;  1O1W A;  2V52 B;  4OGE A;  1WBD A;  4LD0 A;  4ZHR A;  2D0C A;  4JHD B;  4DU3 A;  3DXK A;  5JIC A;  4C8N A;  1SL2 A;  3JSM A;  3SAH A;  1LWC A;  3A8Y A;  1SUQ A;  1RFQ A;  1VQ5 N;  1RNH A;  4KAZ A;  1GLD G;  3K59 A;  3CM5 A;  5DK5 A;  2WBN A;  1KVC A;  4ELV A;  1C1A A;  2BUP A;  4CBU A;  1BO5 O;  2AJQ A;  1DT9 A;  5TKY A;  4KTZ A;  3U3G A;  1S22 A;  1NJX A;  4ELU A;  1JCG A;  2P9P B;  4Z4E A;  1KFS A;  3K58 A;  3ATV A;  1VQP N;  4JKG B;  4DV4 K;  4DR6 K;  5EXW A;  1WSJ A;  3B6P A;  4CJ4 A;  3O1W A;  3AO4 A;  3H1Q A;  4BRN A;  1RDU A;  1YUW A;  1TVR A;  1NJI O;  1V4T A;  5HOO A;  1VQ7 N;  1XHX A;  3H08 A;  2P9I A;  3O6W A;  3CQ8 A;  3GL1 A;  4PL8 A;  1QSL A;  4I9Q A;  3QEV A;  4JKC A;  2JWK A;  2EWS A;  2BTF A;  4NB4 A;  4U67 L;  1BWF O;  3I0S A;  1NMD A;  1ZBL A;  4J2B A;  3LAN A;  2Z1G A;  2DFE A;  2YJF A;  4FPA A;  4L3Q A;  4AHR A;  2Q36 A;  3I0R A;  5F0X A;  4JI6 K;  4OPK A;  3U8X A;  1ITG A;  3RTV A;  4E7L A;  1RCH A;  1S72 N;  4WFB L;  3UIQ A;  1ASV A;  4JI0 K;  2UUB K;  1IO2 A;  2WFB A;  3BZC A;  2X6S A;  1JKH A;  3LDP A;  4BR0 A;  3JAM O;  2UXD K;  1B9D A;  4BR5 A;  1C6V A;  3AVK A;  4O5F A;  4KHP K;  3QFP A;  5F2R A;  4JI1 K;  2G8U A;  3CCE N;  4B3S K;  2QWL A;  2FSJ A;  5AJ3 K;  1WUA A;  4OPH A;  1N6Q A;  5C42 A;  2RKI A;  1C0G A;  1K8A O;  1JLG A;  4U7B A;  4DR5 K;  3FZF A;  4I6M B;  1NKC A;  3V81 A;  4FSV A;  1NKE A;  3ID8 A;  3OYI A;  4M7Y A;  1Z26 A;  3NBP A;  4FM2 A;  1VSL A;  3ZSO A;  3C65 A;  1RTI A;  3QER A;  5KGW A;  3OHR A;  3DXM A;  4BRF A;  5J1E A;  3T1H K;  4BWM A;  2HHU A;  4PKI A;  4H0T B;  3PSF A;  4AHC A;  4H5V A;  3KKS A;  3CET A;  4RCH A;  3J81 O;  5AQN A;  4I9L A;  2F9T A;  3AVB A;  3LPT A;  1VSK A;  4FOE A;  3DOL A;  1LCU A;  2YHW A;  3CI5 A;  3E66 A;  3NGZ A;  1LV5 A;  4IOX A;  4JRP A;  4DFK A;  1HJR A;  1NGH A;  2QWN A;  3CJB A;  4YOY A;  5DM7 L;  1ZBU A;  4FZY A;  2A1S A;  5KPT A;  1VAZ A;  3FGU A;  4K42 A;  3R1X A;  1FXX A;  3S41 A;  4FZZ A;  1QQN A;  4DR7 K;  4NXN K;  4LH4 A;  3AA4 A;  4FJM A;  2HVI A;  4YOU A;  2YHY A;  2IVN A;  3L4Q A;  1U04 A;  3L6Q A;  2ZE2 A;  3MED A;  3MWT A;  3MMV A;  4BDY A;  2OZS A;  2O8F B;  4Z94 A;  4CGF A;  3FFI A;  3AO1 A;  5CZ2 A;  4FZX C;  2P9K B;  1RT6 A;  1RGI A;  3GBT A;  2P5G A;  3C6U A;  3MWP A;  3SUP A;  1VSD A;  2W40 A;  3CJ1 A;  1BI4 B;  2O4I A;  2GBZ A;  2UU9 K;  2YNF A;  4FWO A;  1VQ6 N;  4CZI A;  4DQQ A;  3AO5 A;  4KH5 A;  5EU7 A;  4F4K A;  2HHS A;  3W0L A;  4WE1 A;  1X9J A;  2JLE A;  2PYJ A;  3K57 A;  4GV3 A;  2WUS A;  1WSI A;  3BEX A;  3IFR A;  4JKG A;  4X65 K;  3DLG A;  5M1N A;  4FXD A;  5FPD A;  5E41 A;  4LY7 A;  1T6C A;  3VER A;  4FJ9 A;  2E1Y A;  2EHG A;  3VTH A;  5EVZ A;  4Q0B A;  1NK8 A;  2IGI A;  4PA1 A;  5KTQ A;  5AQJ A;  4WQ4 A;  2Y1I A;  3A0I X;  4KI6 A;  2NRR A;  1S1X A;  1JJ2 M;  3CJA A;  3KK1 A;  1ZC6 A;  3DYA A;  3LP2 A;  4DTN A;  3AAP A;  3LZI A;  5AZJ A;  3HST B;  3G25 A;  2KZZ A;  4HVJ A;  4BG9 A;  4PKG A;  4HTU A;  1HLU A;  2O8B A;  3MN9 A;  4H8K A;  5C25 A;  1RBS A;  2F8T A;  1I94 K;  3WXK A;  4FOI A;  5AQL A;  3KK3 A;  3U6F A;  1RDC A;  2RN2 A;  2HOE A;  4FL9 A;  1DLO A;  2IAJ A;  3VEW A;  3HPG A;  4CK1 A;  2Z1I A;  1QSY A;  3QEI A;  1UAX A;  1TK0 A;  2E6L A;  4IOA L;  3KK2 A;  4H0V B;  1VQ8 N;  3V1R A;  1LWE A;  1CLQ A;  3TWH A;  3H1V X;  3MN6 A;  3NH2 A;  1J54 A;  2HF3 A;  3VEV A;  3RMA A;  2P9L B;  4HCB A;  3NE6 A;  3M1F A;  4CE9 A;  1SZ2 A;  1J5O A;  1WAJ A;  3QO9 A;  4GNI A;  4B1X B;  4DHY A;  2QA4 N;  4AHT A;  1TV6 A;  3TR8 A;  1JL1 A;  1VQL N;  3AA2 A;  1YVN A;  1QSS A;  4B9U A;  4CJT A;  4DTS A;  4FJH A;  3NDK A;  1TAU A;  4M3Z A;  1HRH A;  4A61 A;  3H3N O;  4ELT A;  5I9E B;  5AQW A;  4CFB A;  5BRD A;  3NHG A;  1VK0 A;  3K5M A;  3G6E N;  2NRT A;  3T19 A;  4KHN A;  2H3G X;  3HXM A;  3CPW M;  3LDO A;  4K41 A;  3TAR A;  3E01 A;  4CGD A;  3H46 O;  4DTO A;  2QWM A;  4C8M A;  2W42 A;  1Q86 O;  2F96 A;  3DLE A;  5K14 A;  5AQM A;  2NZT A;  2P9L A;  3OYC A;  4KI4 A;  2OPP A;  3SQ2 A;  2VG5 A;  4QS7 A;  2OAN A;  3RWU A;  1IG9 A;  1BGX T;  4RW6 A;  4JK8 A;  3VQC A;  2IDO A;  4DUZ K;  3D0P A;  2UXB K;  1S1W A;  3M8Q A;  3LM2 A;  1RTD A;  4KB1 A;  4O0J A;  1W0H A;  3HP9 A;  2ASP A;  1JL2 A;  4DV5 K;  4M63 C;  3ZT1 A;  4WYB A;  5AQI A;  3FE1 A;  3KWI A;  1WSE A;  3CCL N;  4O8U A;  2P9S B;  1BA0 A;  5JLF A;  1BCM A;  1HPM A;  2I7N A;  2UUC K;  4GVM A;  3ATU A;  5LJV A;  4CJ7 A;  1U48 A;  4NXM K;  1FJG K;  1NG9 A;  2B4J A;  2LSN A;  1GOC A;  1S3X A;  4BRC A;  1X9S A;  4QS9 A;  4RW9 A;  4FJ8 A;  1MA9 B;  4CEQ A;  4WF9 L;  4BQL A;  3SMP A;  5LMU K;  4BRH A;  1CXQ A;  3NVK A;  4JK7 A;  2HBM A;  3O9T A;  1QTM A;  4BGA A;  2GV9 A;  4DKW A;  4K43 A;  4J2A A;  3CC4 N;  4HUF A;  4BVO A;  1EWQ A;  3QBW A;  3SUO A;  3O9Q A;  3FFK B;  2UYT A;  4KFB A;  4H0O A;  5J2N A;  3HK2 A;  2ETJ A;  4RW8 A;  3SQ0 A;  3LDQ A;  1DGK N;  4J8F A;  1KVB A;  3BF1 A;  2AP1 A;  4GV9 A;  1JLA A;  4Q5V A;  3MAQ A;  3U4L A;  1YIT N;  5BN8 A;  3OYH A;  1ATN A;  3AA3 A;  1U45 A;  1SS6 A;  3SI6 A;  1T6D A;  4ISE A;  3V9U A;  2YNI A;  3P4I A;  1SL1 A;  2RPI A;  4B08 A;  4A5A A;  1N5Y A;  3IAY A;  1BIZ A;  5AQT A;  3K9K A;  3E9P A;  5I42 A;  4G9Z A;  2XRI A;  4BR9 A;  4CI6 A;  2UXC K;  4BAC A;  3SUN A;  3EKS A;  5TKW A;  1BDG A;  1IJJ A;  2QM1 A;  4CEZ A;  2O8F A;  3S3M A;  4QOZ B;  1JLB A;  4BC2 A;  5FPE A;  1Z25 A;  1SKR A;  2I7P A;  1L3T A;  4ICL A;  1VQN N;  1BQM A;  2HF4 A;  3V4I A;  5HRS A;  2P9P A;  3VQ8 A;  3SCX A;  4CHQ A;  1GLF O;  4O0I A;  4CEF A;  3TAE A;  3O5B A;  4CZL A;  4FLU A;  4YOW A;  1XNR K;  4CZE A;  4CZM A;  4CCH A;  4O4G A;  4LFC K;  1U49 A;  1KTQ A;  4NO7 A;  2KFZ A;  1HYS A;  2YHX A;  2YV0 X;  1IG8 A;  3WQT A;  3A2F A;  3P1G A;  4Z4H A;  3U9Z A;  4ID5 A;  3WXI A;  3O9S A;  4CJK A;  4DR4 K;  4PWD A;  2FC0 A;  3R3L A;  3M8S A;  4JKA A;  3G0Z A;  3SAG A;  2HMP A;  3HRG A;  1N33 K;  2FSK A;  2VCP A;  1KAZ A;  2QWQ A;  3DOK A;  3ZET B;  3SBT A;  3ITH A;  5HRR A;  4KRE A;  1T44 A;  1L3S A;  2P9N A;  4BR2 A;  4CES A;  2GUI A;  3THX B;  1YHQ N;  5HBM A;  5AQU A;  2HHT A;  1X1P A;  4FK0 A;  4FLW A;  5CE3 A;  3THW B;  4CZG A;  3TAP A;  2QTD A;  1BG3 A;  3TAF A;  3QDK A;  4NCB A;  4I6M A;  3HJF A;  4BE0 A;  3SK3 A;  1UA0 A;  1RDB A;  1NM1 A;  3CMA N;  1X9W A;  4ILJ A;  1JXE A;  1YJ9 N;  3L2W A;  4Z4F A;  4FWS A;  5J2P A;  3EKU A;  1OKJ A;  4CJV A;  1TKZ A;  2OZM A;  4YOV A;  4CF8 A;  4DSK A;  3NF9 A;  4ISF A;  2QI2 A;  4N41 A;  2OPQ A;  2GX9 A;  3VQ4 A;  3LL3 A;  1H1V A;  5DM6 L;  4LSN A;  1NGI A;  3TPQ A;  3G71 N;  1S1V A;  4BGB A;  2DY4 A;  4PUO A;  4H5R A;  4LF7 K;  4IO9 L;  2O4G A;  1KLM A;  5M1F A;  3F73 A;  4AM6 A;  2YHB A;  3HOT A;  4MLH A;  5AFU A;  4FW1 A;  4JD2 B;  2HMI A;  3AVC A;  1VQO N;  4DQS A;  4NLB A;  3TTC A;  5HLF A;  2GEL A;  1WSH A;  2W6K A;  1SV5 A;  3O4W A;  2NUB A;  4CZF A;  3NH1 A;  1C1C A;  4CJW A;  3EN9 A;  2ZJQ L;  1TUY A;  3CC2 N;  4JKE A;  2HHH K;  3NCI A;  3VGM A;  2YKN A;  3OW2 M;  2F7T A;  3TSP A;  2ZD1 A;  2E88 A;  5F1X A;  1HMV A;  1VSJ A;  5FLX O;  4CBW A;  4F3T A;  5FRO A;  5LY3 A;  1RDD A;  1QQM A;  2PY5 A;  2ZJP L;  3CCR N;  4FLT A;  5AQX A;  1JLC A;  2CH5 A;  4B8C A;  5T7B A;  3OYK A;  3ID6 A;  3HYF A;  5D3G A;  2Z1J A;  5AQS A;  1HKC A;  3O3F A;  4IXC A;  3I8B A;  3PIO L;  3N4Q A;  4B9T A;  4OLB A;  1ZBF A;  3R9P A;  1TUU A;  4WFA L;  1BCO A;  2CH6 A;  3E1Y A;  4BRI A;  2DPN A;  4FLX A;  3VEO A;  3KVG A;  4JI2 K;  4YY3 K;  4DF8 A;  3LP0 A;  3VQA A;  5GIN A;  4BRQ A;  3VQB A;  4JHD A;  3RRG A;  4MO4 A;  2G8F A;  3BF3 A;  4FW2 A;  1NK7 A;  1IKX A;  5C0Y A;  3C6H A;  4KH6 A;  3WNG A;  2HVH A;  1GLE G;  1NGE A;  4DR2 K;  1K8K B;  4KRF A;  5BPM A;  2ITM A;  5C10 A;  4XIU A;  2B5J A;  4KB0 A;  1HNW K;  1GLC G;  4FJX A;  4R5P A;  4FJK A;  4CF1 A;  3EZ5 A;  1U2V B;  1S9E A;  1NGB A;  3CER A;  3WEE B;  3L3V A;  4EP5 A;  5KPR A;  4Z4G A;  3P83 D;  2A1R A;  2PAV A;  3LWM A;  4BDP A;  5GIP A;  2HW3 A;  3AVN A;  1KLN A;  1HKG A;  4OKE A;  4YHH K;  3RMB A;  5AQY A;  4CER A;  4MQ3 A;  3CC7 N;  2E1Z A;  2FBY A;  2AA4 A;  2PYL A;  1QQC A;  3TU5 A;  2G8I A;  1K8K A;  4DU4 A;  4DFJ A;  2KTQ A;  4KHQ A;  4CJR A;  3HT3 A;  2D0A A;  5JS2 A;  3AO3 A;  1Q82 O;  3L3U A;  5AQV A;  4FJI A;  2QXF A;  3J8A A;  3C0B A;  3U3Y A;  4DUY K;  2OCE A;  1P90 A;  3NAE A;  3TSU A;  4QS8 A;  1D4X A;  1WNS A;  2ZGY A;  4HTL A;  3QLH A;  2ASO A;  2KHO A;  3CJ7 A;  4W5R A;  4EHT A;  3SAF A;  3BY5 A;  2D0B A;  4B9L A;  1GLB G;  2XHB A;  3CME N;  3A5N C;  3QNN A;  3VQ6 A;  3OYN A;  4H0X B;  3M8P A;  5AZI A;  4H4O A;  4M45 A;  1W7A A;  3Q7B A;  5HRN A;  3MEE A;  4BC3 A;  3OYD A;  3SMS A;  4KHU A;  4FWL A;  4F3O A;  1RBV A;  1VSI A;  3WUH A;  4UQG A;  4BE2 A;  4DWI A;  3O9U A;  3T1A A;  1NK6 A;  3BDP A;  4JNE A;  5AQZ A;  4AHS A;  3NMU A;  4CZH A;  1X3M A;  4A62 A;  4CK3 A;  4W5O A;  3M8R A;  3DLL L;  3LAM A;  5AQF A;  4BRG A;  1YVU A;  4OKJ A;  5AQO A;  4DMN A;  2CGK A;  3CFP A;  3H3O B;  3OBY A;  4O8K A;  1J9A A;  4GVE A;  4CHP A;  4NCA A;  4B3R K;  1KVA A;  2RF2 A;  2XY5 A;  4KTQ A;  2V51 B;  4FWN A;  4C1N I;  1IV0 A;  2QXL A;  2YKM A;  3ALY A;  3CF5 L;  3KZB A;  5KGX A;  2Q0R A;  4DV3 K;  3L2R A;  1NMN A;  2ZM6 K;  1XC3 A;  5AQQ A;  2E20 A;  5AQP A;  3DJC A;  3V9S A;  4B9M A;  2NNW A;  1ZXO A;  3WXM B;  3AV9 A;  5IT9 O;  1JLQ A;  1V4S A;  4X66 K;  1Q8I A;  4JKB A;  2JGU A;  3O8M A;  3CCV N;  1WBB A;  1NGD A;  3TSQ A;  3WNF A;  3VF6 A;  2P9U A;  4CW7 B;  4DV1 K;  2P5O A;  4FVM A;  3KLE A;  1Y64 A;  3NH0 A;  4OJR A;  2V7Z A;  3AVH A;  1LW2 A;  5DMR A;  4DQI A;  4KBO A;  4FJJ A;  3I33 A;  4ILG B;  3ENO A;  4B1Y B;  3ZEU A;  1XMO K;  4OKK A;  3CQY A;  3FLC O;  4JKH A;  2I5J A;  3OYB A;  3OYA A;  3D2E B;  1RIL A;  1HJO A;  1KFD A;  3CYM A;  3IDH A;  1HNI A;  4YOT A;  4E7J A;  3AVM A;  2KQ2 A;  3VPZ A;  1HNZ K;  3KWG A;  4KTW A;  5AZI B;  4JLH A;  4Y1D A;  4DTJ A;  3J7Z O;  3O4N A;  4M7X A;  4KHS A;  2KKZ A;  4JKF A;  4CGG A;  5J2M A;  1KD1 O;  4K25 A;  3VQD A;  4BRA A;  1D5A A;  3S3N A;  4CF2 A;  3CM6 A;  4YFU A;  4W5T A;  4RWT A;  1B92 A;  3C6A A;  3QFU A;  3ZCM A;  1QZ5 A;  4E89 A;  3CQX A;  1NGG A;  1QE1 A;  3VQ9 A;  3OA9 A;  2E2P A;  1S6Q A;  3C95 A;  4OO1 J;  1FKP A;  4IFV A;  2HNZ A;  4V19 S;  3H6E A;  4WQ5 C;  5AQK A;  1E4G T;  2HBJ A;  3GDQ A;  3C94 A;  3QIC A;  1OVY A;  4E7I A;  2GEM A;  2PZS A;  1N32 K;  4OPJ A;  4HUE A;  5BR8 K;  1VRT A;  3HVR A;  3O08 A;  1YXQ A;  4DB3 A;  3NF8 A;  1RT5 A;  4H5N A;  4LFB K;  3QET A;  4M41 A;  4FJN A;  1N36 K;  5ADX H;  4K8Z A;  3HOS A;  5EX5 A;  3Q7C A;  3K5N A;  5B8H A;  3RVC A;  1A5W A;  2E8A A;  2HBK A;  3VN5 A;  4BWJ A;  3F9K A;  1GOB A;  3MCP A;  3VEY A;  4CGI A;  3OS1 A;  5GAE P;  4IKF A;  2D4W A;  4A2A A;  1KAY A;  2HHX A;  4F8R A;  4E1N A;  1NK5 A;  1B9F A;  3TAG A;  3LWL A;  1TGO A;  3AVJ A;  3ASM A;  4XH1 A;  3LAL A;  5BN9 A;  5MLC Q;  1DEJ A;  1A5V A;  1KAX A;  3QIO A;  3SLC A;  2ATQ A;  3SBG A;  4CBX A;  3MX2 A;  3ZSX A;  4B1V A;  1WAF A;  3OBW A;  4LF9 K;  1BU6 O;  4E1J A;  4WCE L;  3TI0 A;  2P9S A;  5C15 A;  1WSG A;  1C1B A;  3CIP A;  5C24 A;  5C2D A;  1MWK A;  4JRQ A;  1NGA A;  4FWP A;  1XMQ K;  1T7P A;  2RHK A;  3R6M A;  1XUP O;  3RSE A;  2ZF5 O;  3MX5 A;  1W97 L;  3OYE A;  4HWI A;  1NGF A;  4CEB A;  2FBT A;  4CJL A;  4IEE A;  2XY8 A;  3LDN A;  3OYM A;  1EET A;  2Q3S A;  1VQ9 N;  2OYQ A;  4GV6 A;  3LDL A;  3VQP A;  4B3M K;  4IWV A;  4DG1 A;  1UWB A;  2XO7 A;  2YJE A;  4BRE A;  1MWM A;  3CCU N;  4B8A B;  1TKD A;  3EYZ A;  3DRP A;  2X78 A;  3CHW A;  4CF0 A;  1Q81 O;  4BR4 A;  5LMN K;  3DMJ A;  2V7Y A;  4I2Q A;  2GWJ A;  4LF4 K;  4E19 A;  4YDU C;  4CFA A;  4YDU A;  1IBK K;  4CHZ A;  3L0Q A;  3KKR A;  4BQZ A;  1XNQ K;  1NU0 A;  3TTD A;  1Q9X A;  3IKM A;  3VQQ A;  4JI4 K;  3HVT A;  4FWM A;  1XQS C;  5LL6 Z;  1EQY A;  1UOC A;  1QVF M;  3ZSW A;  4BVP A;  3THW A;  3CXC M;  1W2B M;  5ELZ A;  4JS5 A;  1RT1 A;  4B3O A;  4M3U A;  1WSF A;  3ENH A;  2F8S A;  4MO5 A;  3ZSY A;  4AH9 A;  3SNN A;  3EO3 A;  2A3Z A;  2O8E A;  1ILY A;  3WNH A;  4DLG A;  3IG1 A;  3EY1 A;  2VWJ A;  4JYA K;  4NCG A;  1OH7 A;  1YI2 N;  1ATR A;  1CZB A;  3MEG A;  3SV4 A;  4OVL A;  5AZJ B;  4OGC A;  3VF2 A;  1ATS A;  4DF4 A;  4CF9 A;  3QNO A;  3QIP A;  5SZT A;  3CCS N;  3FZL A;  3ENB A;  2HBL A;  4JK9 A;  4CD3 A;  1NK0 A;  3A5O C;  4MFB A;  3C6T A;  3RR8 A;  3T7Z A;  1QS4 A;  4IG0 A;  3L2Q A;  1TKX A;  3HPO A;  3AVA A;  3D2F A;  3B8A X;  2HND A;  3ULE A;  1TAQ A;  4DTX A;  3KK7 A;  4FJ5 A;  4M3W A;  3OJU A;  3SJH A;  4DU1 A;  4KO0 A;  3SQ4 A;  2VGM A;  1J53 A;  3VQ5 A;  2B6A A;  3AGR A;  2NRW A;  3THY B;  2FLO A;  4FK2 A;  2E2O A;  1CXU A;  2Q31 A;  4FM0 A;  3NGI A;  1YIJ N;  4RW4 A;  1JCE A;  3K0S A;  1BIU A;  2D5R A;  3B6O A;  4FPB A;  4EP4 A;  1RTH A;  5JLH A;  4H5W A;  4FO0 A;  4CIG A;  5BRE A;  5AQH A;  4MDA A;  3CJ9 A;  2YHA A;  2VYP A;  2OA8 A;  4KKO A;  4C1N K;  1ZBH A;  4KHW A;  3VGK A;  1UA1 A;  3MCA B;  3LM9 A;  2NRZ A;  2RE2 A;  1G15 A;  4IJN A;  1IKW A;  2HHV A;  3BP8 A;  4BC5 A;  4IOC L;  4Z4C A;  2O8B B;  2W6L A;  4A5B A;  4AHU A;  4B9V A;  1WOQ A;  1BQN A;  1EXQ A;  3VMF B;  3A5L C;  5M1O A;  1QHA A;  3PY8 A;  4N76 A;  1HR0 K;  4CVN E;  3ZSZ A;  2G8V A;  2D1K A;  2QW9 A;  1U4B A;  5KRS A;  1FW6 A;  3WXL A;  4LC9 B;  2R7Y A;  4FYD A;  5BRF A;  4JI5 K;  4EFH A;  1KQS M;  1SAZ A;  3T69 A;  4CFC A;  3V6D A;  3QB0 A;  1ZYQ A;  3L8B A;  5H1S Q;  1OVQ A;  2Q1N A;  5AQG A;  3DLK A;  3KD5 E;  3HL8 A;  5AR0 A;  3ZSV A;  4RW7 A;  2PBD A;  3LPU A;  1EO1 A;  1OH6 A;  3O4Q A;  3VEZ A;  1RDW X;  3AO2 A;  4X62 K;  2GWK A;  1VSM A;  4CJU A;  3P38 A;  1N34 K;  1VQK N;  1YAG A;  4OX9 K;  4DSF A;  4GKJ K;  3KIO A;  3LDS A;  2IIR A;  1U47 A;  4ZTF A;  2DTU A;  4DV6 K;  2G8K A;  2IOC A;  5KI6 A;  1YJW N;  2D0O A;  3O80 A;  3ZT0 A;  4MDB A;  3PX0 A;  1G99 A;  3PIP L;  1S6P A;  4CED A;  4IEI A;  3ZYY X;  1F21 A;  3I8D A;  1Z6R A;  1JLF A;  1KCF A;  3SPZ A;  4KPY A;  1YT3 A;  5JVH L;  4L8R B;  2P9K A;  3OTO K;  5AQR A;  3L4I A;  4OPA A;  5I3U A;  3U9D A;  2W41 A;  1IBL K;  4FCY A;  4HHT A;  2J4R A;  5CR4 A;  1X9M A;  3EE8 A;  1LAW A;  2D0P A;  1BHL A;  1NWK A;  3S9H A;  3D2F B;  5JVG L;  3DM2 A;  3V9W A;  3M5R A;  4DS4 A;  4N56 A;  3PSI A;  3IMX A;  1BIS A;  3DAW A;  4R79 A;  3K2P A;  1C0M A;  4C23 A;  1HX1 A;  5HRP A;  2VWB A;  1LOT B;  2CGJ A;  4M3Y A;  2EX3 A;  1J5E K;  1L3V A;  2E2N A;  4H5T A;  3SQ1 A;  2P51 A;  1QVG M;  1VSH A;  1OH8 A;  3ZT4 A;  1E3M A;  5IWA K;  3SZ2 A;  1IH7 A;  2KLA A;  1N8R O;  4LF6 K;  4FVU A;  2X6N A;  4H4M A;  5M1Q A;  4M3R A;  1DKG D;  1LW0 A;  3EL2 A;  4RG8 A;  3GE1 A;  3HO1 A;  4HCC A;  2A41 A;  4FLY A;  1FKO A;  1I39 A;  3VEN A;  4GY2 B;  1U6Z A;  4ISG A;  4RTF D;  5A2Q O;  5GAD P;  5FRM A;  2O8E B;  1L3U A;  4H0P A;  3HPH A;  2IVP A;  4JS4 A;  4DSJ A;  3V9Z A;  3DRS A;  3TAQ A;  2E4L A;  4M42 A;  2QEX N;  1EX4 A;  1TL1 A;  2Y1J A;  4QCL A;  3G10 A;  4BC4 A;  4IFY A;  1ESV A;  1NJZ A;  4H03 B;  2P9U B;  3V1O A;  3TAB A;  1BA1 A;  1KXP A;  4K8X A;  4C8K A;  1FK9 A;  4CJS A;  3K5L A;  5CY4 A;  1XHZ A;  2HNY A;  1WN7 A;  1ZBI A;  2VQF K;  1T05 A;  4EZ9 A;  3D45 A;  2Z1H A;  3W3D A;  4CHN A;  4DFM A;  4KHY A;  3HM8 A;  4DTR A;  4CJQ A;  1XC9 A;  3FZK A;  5AFU H;  1XWL A;  2F9W A;  3AVG A;  5BR9 A;  3PX4 A;  4DS5 A;  3MN7 A;  4ZTJ A;  4PKH A;  2A42 A;  2O8D B;  5FRN A;  4G1Q A;  4BRM A;  4MLE A;  3O3H A;  3ZX0 A;  1C0T A;  4EHU A;  4PQU A;  1BI4 A;  2Q2R A;  4E0D A;  3BZK A;  3LAK A;  3PUF A;  1HNX K;  3THY A;  3MN5 A;  1JXB A;  4PHT X;  4DLE A;  1ASU A;  1RT3 A;  3EE9 A;  3DWL A;  4BDZ A;  5C2F A;  3CJC A;  3TTF A;  3J7Y P;  1Q7Y O;  4O44 A;  4FM1 A;  5CZ1 A;  1BL3 A;  4B9Q A;  2YI1 A;  1BOT O;  1WLJ A;  3RMC A;  4CZK A;  4DSE A;  3ULE B;  1K6Y A;  2WOM A;  1SL0 A;  4CFD A;  3V9X A;  5FPN A;  1JLE A;  5HP1 A;  4EIA A;  2GUP A;  3AA5 X;  1S1U A;  2E6M A;  1OH5 A;  4IDK A;  4DSI A;  2ZQB A;  3MEC A;  3M6G A;  4GMJ B;  4DTM A;  2JWL A;  2VWK A;  3F9M A;  3SUQ A;  1KRP A;  4CK2 A;  3SYZ A;  2KFN A;  4JEP A;  4CJP A;  3ULD A;  1NOZ A;  3DXK B;  4F9O A;  3KTQ A;  4A57 A;  4BRK A;  3THV A;  3DLR A;  4E1M A;  1T8E A;  3ZX3 A;  5KQ8 A;  2OPS A;  4DR1 K;  3D2E A;  1HYV A;  5GIO A;  4N5S A;  3CFO A;  1DTT A;  4JKD A;  4O5B A;  3KLG A;  3D6R A;  4DTP A;  1NKB A;  5ADX A;  1YTU A;  2HHQ A;  4QAG A;  2P1J A;  3VOV A;  1NK4 A;  3QBX A;  3KJV A;  3DXM B;  4TSX A;  2IC3 A;  3AVL A;  3HP6 A;  4DV0 K;  1QQO A;  4E7K A;  3K9J A;  4IO8 A;  4B1W B;  4Y1C A;  1CZA N;  3WNE A;  4DV7 K;  1QHT A;  3MK6 A;  4LH5 A;  5J2Q A;  4B1Z A;  4IZ9 A;  3E9O A;  3GOI A;  4C8L A;  4M3T A;  4O55 A;  1MDU B;  2HB5 A;  4JI8 K;  4IFE A;  4DQ8 A;  3UE5 A;  3MXJ A;  3G4S N;  1A5X A;  4B1U B;  3VA3 A;  1EP4 A;  3ISN C;  2FBV A;  1VQM N;  5BPL A;  5E26 A;  4JI3 K;  3JYT A;  2QWO A;  4CGH A;  3FR0 A;  1P8Z A;  2HST A;  3P31 A;  3LP3 A;  5M1K A;  3TAN A;  1TKT A;  3QEX A;  3NF6 A;  1Y97 A;  2ITG A;  3VQE A;  3N4P A;  4F2S A;  5FDL A;  1M90 O;  4KH4 A;  5EY4 A;  3P39 A;  3EZW A;  3QML A;  3RSE B;  3A5M C;  2YNG A;  3CCQ N;  2P9I B;  3AY9 A;  2DFH A;  1RTJ A;  1YF5 L;  4F2R A;  1I3A A;  4C8O A;  3OS0 A;  4LSL A;  2G8W A;  3SJJ A;  3C7N B;  1NGJ A;  2VGN A;  1WB9 A;  4IG3 A;  1IBM K;  4I7F A;  4B9N A;  2BAN A;  1HYZ A;  1RT2 A;  4ID1 A;  4X64 K;  3AAQ A;  1M1K O;  5KRT A;  2WC9 A;  4WFN L;  3PX6 A;  4FLZ A;  4IJA A;  2X74 A;  1NLV A;  3JXU A;  4JD2 A;  1JCF A;  4NLC A;  1CZ9 A;  3LZJ A;  1RT7 A;  3RR7 A;  1VSF A;  3HTV A;  2QWP A;  3CPE A;  2VG6 A;  2HHW A;  3ZT3 A;  1RBR A;  3VET A;  4FLV A;  2FXU A;  2KW4 A;  1SKS A;  1QZ6 A;  1RT4 A;  3AAR A;  4HUG A;  1HUX A;  4BRD A;  4OLA A;  1Q9Y A;  2G8H A;  4CEA A;  1GLA G;  1VRU A;  4FWK A;  4CJE A;  1TL3 A;  4M3X A;  3WQU A;  2YX6 A;  2XY7 A;  2A40 A;  1NBW A;  2O8C A;  3O3G A;  1S1T A;  1HPZ A;  5JMV A;  3PO4 A;  3OYF A;  4BG8 A;  4CHY A;  4XH4 A;  2E5L K;  3WEE A;  1EWR A;  3THX A;  1NK9 A;  1RDA A;  3MDQ A;  2NRX A;  4EZ6 A;  3HBT A;  5SWM A;  3O9R A;  1L5U A;  4PY5 A;  4CEC A;  4N47 A;  4I2P A;  3HZ6 A;  3UKR B;  1RBT A;  1TYQ B;  3JS6 A;  4J2E A;  5HL7 L;  3DRR A;  1XI1 A;  4CJ3 A;  3MXI A;  1GLL O;  1RBU A;  1ZBS A;  3I56 N;  3PLA A;  1HNV A;  2QKK A;  1NJW A;  2KZM A;  3KLF A;  4BY9 C;  5GAH P;  3ZLJ A;  1VHX A;  2BDP A;  1IKY A;  3M3Z A;  4YNQ A;  3ZSR A;  3LP1 A;  5KPZ A;  1NOY A;  1VSE A;  3CCM N;  5CYM A;  1C0F A;  4Y0W A;  5E84 A;  3KLI A;  3AVF A;  4LF8 K;  4A2B A;  5M1P A;  1GOA A;  3OYJ A;  1NNE A;  2IS3 A;  5HRO A;  4B9S A;  1DTQ A;  5CYQ A;  4CIE A;  3OJS A;  3HM9 A;  5FPM A;  4ILH A;  4DQR A;  3C7N A;  3S3O A;  1YTA A;  1IKV A;  1SKW A;  4YOR A;  2E2Q A;  1HQE A;  4JV5 K;  3BGR A;  3IUC A;  3DI6 A;  4DCH A;  3UKR A;  4XH5 A;  3HSC A;  3PV8 A;  1NJY A;  2FSN A;  1TK8 A;  3ZEU B;  3MXM A;  3WT0 A;  4H0Y B;  4CEE A;  4IDH A;  5BRH A;  4CJ5 A;  3VTI A;  1SQK A;  3P5J A;  4AF1 A;  2QKB A;  4CZJ A;  4DQP A;  1E4F T;  1S5J A;  4BRP A;  3QEP A;  1BUP A;  1U2V A;  4CJF A;  3K5O A; 
#chains in the Genus database with same CATH homology
 4KTQ A;  4KV8 A;  1JL1 A;  3TR8 A;  3V1Q A;  1T03 A;  4DFP A;  3AA2 A;  2YKM A;  3ALY A;  3CG7 A;  5I3U A;  1QSS A;  4E7H A;  5KGX A;  4B9U A;  4DSL A;  4CJT A;  5JS1 A;  4DTS A;  1W9H A;  3VA0 A;  4FJH A;  3NDK A;  1TAU A;  4M3Z A;  1HRH A;  4FCY A;  4HHT A;  3L2R A;  1X9M A;  4AHV A;  1LAW A;  1BHL A;  4ELT A;  3S9H A;  3OYL A;  4CFB A;  3SV3 A;  3L2U A;  3V9S A;  2DFF A;  3NHG A;  1VK0 A;  1LWF A;  3DM2 A;  3K5M A;  3V9W A;  4DS4 A;  3DLB A;  4B9M A;  4N56 A;  3IRX A;  3AV9 A;  1JLQ A;  3T19 A;  4KHN A;  3HXM A;  1BIS A;  1Q8I A;  1EKE A;  3K2P A;  4NYF A;  1C0M A;  3TAR A;  3E01 A;  4CGD A;  5HRP A;  4DTO A;  2JGU A;  4C8M A;  2W42 A;  3NGY A;  2F96 A;  3DLE A;  5K14 A;  2EX3 A;  4M3Y A;  3ZT2 A;  3VQ7 A;  1TK5 A;  3WNF A;  4Z0U A;  3OYC A;  3SQ1 A;  2P51 A;  1L3V A;  1VSH A;  1MU2 A;  2OPP A;  2VG5 A;  4FVM A;  3ZT4 A;  3NH0 A;  3KLE A;  4OJR A;  3RRH A;  3SQ2 A;  3RWU A;  3AVH A;  3TAM A;  1IH7 A;  1LW2 A;  5DMR A;  3SZ2 A;  2X6N A;  4H4M A;  1IG9 A;  3AVI A;  1REV A;  3NF7 A;  4DQI A;  1BGX T;  4M3R A;  4RW6 A;  3VQC A;  4FJJ A;  2IDO A;  3D0P A;  1LW0 A;  1S1W A;  3M8Q A;  4RG8 A;  1RTD A;  1LAV A;  4O0J A;  3DLH A;  4KB1 A;  1KSP A;  1W0H A;  3HO1 A;  4HCC A;  1C0U A;  4FLY A;  1FKO A;  1I39 A;  3HP9 A;  4OKK A;  1JL2 A;  3ZT1 A;  4CEO A;  3PO5 A;  5FRM A;  1WSE A;  1L3U A;  2I5J A;  3OYB A;  3OYA A;  3NFA A;  1RIL A;  3OVN A;  1BCM A;  3HPH A;  4JS4 A;  4DSJ A;  2OPR A;  3V9Z A;  3DRS A;  2FBX A;  1KFD A;  3CYM A;  3CFR A;  2E4L A;  1HNI A;  3TAQ A;  4M42 A;  4GVM A;  4E7J A;  1EX4 A;  1TL1 A;  3AVM A;  2Y1J A;  2KQ2 A;  1U48 A;  3G10 A;  4W5Q A;  4QCL A;  4IFY A;  2B4J A;  4KTW A;  2LSN A;  1GOC A;  3IS9 A;  4JLH A;  4Y1D A;  3OS2 A;  1NJZ A;  4RW9 A;  1X9S A;  3V1O A;  4FJ8 A;  4DTJ A;  3TAB A;  4CEQ A;  3O4N A;  1R0A A;  4KHS A;  5J2M A;  3T3F A;  4CGG A;  4K8X A;  4IBN A;  1CXQ A;  4W5N A;  4C8K A;  3VQD A;  1QTM A;  1FK9 A;  1D5A A;  3QIN A;  3OY9 A;  3S3N A;  4CJS A;  3K5L A;  2GV9 A;  5CY4 A;  4CF2 A;  1XHZ A;  2HNY A;  4J2A A;  1D9F A;  1WN7 A;  3CM6 A;  4YFU A;  3QEW A;  1ZBI A;  4W5T A;  4HUF A;  1T05 A;  2YNH A;  1S9G A;  3RMD A;  3D45 A;  3SUO A;  4EZ9 A;  2Z1H A;  4KFB A;  1B92 A;  4CHN A;  4Z4I A;  4DTU A;  5J2N A;  3HK2 A;  4DFM A;  4KHY A;  4DTR A;  4E3S A;  2ETJ A;  4CJQ A;  1XC9 A;  3ZCM A;  1XWL A;  3AVG A;  4RW8 A;  3L2V A;  4BE1 A;  3SQ0 A;  4E89 A;  1ASW A;  2XY6 A;  3PX4 A;  3KLH A;  4DS5 A;  2BE2 A;  1QE1 A;  1KVB A;  3VQ9 A;  3QES A;  4ZTJ A;  4CGJ A;  4FJ7 A;  5FRN A;  3OYG A;  1S6Q A;  3C95 A;  1JLA A;  4G1Q A;  1FKP A;  4IFV A;  4Q5V A;  3MAQ A;  2HNZ A;  3ZSQ A;  3O3H A;  3OYH A;  4FJG A;  1C0T A;  3AA3 A;  3SPY A;  4GW6 A;  1U45 A;  3SI6 A;  3C94 A;  4CIF A;  4PQU A;  1BI4 A;  4E7I A;  4AIL C;  3V9U A;  2YNI A;  1SL1 A;  2PZS A;  2RPI A;  4B08 A;  4OPJ A;  4HUE A;  4NYN A;  1VRT A;  3HVR A;  1N5Y A;  4E0D A;  3IAY A;  1BIZ A;  5I42 A;  3LAK A;  3PUF A;  2QK9 A;  3NF8 A;  1RT5 A;  4CHO A;  2XRI A;  3QET A;  4FJL A;  4BAC A;  1JXB A;  1HQU A;  4DLE A;  4M41 A;  3SUN A;  1D9D A;  4FJN A;  1ASU A;  1RT3 A;  4BDZ A;  3KD1 E;  2WON A;  4K8Z A;  4J2D A;  2BGG A;  4CEZ A;  3K5N A;  3S3M A;  4QOZ B;  1A5W A;  4O44 A;  1JLB A;  2VG7 A;  4FM1 A;  1Z25 A;  5CZ1 A;  3VN5 A;  1D8Y A;  1BL3 A;  4BWJ A;  3F9K A;  1O1W A;  1WLJ A;  1SKR A;  3RMC A;  1L3T A;  4ICL A;  1GOB A;  4DSE A;  4CGI A;  4OGE A;  1K6Y A;  2WOM A;  1BQM A;  4LD0 A;  2D0C A;  4ZHR A;  3OS1 A;  3V4I A;  5HRS A;  4DU3 A;  1SL0 A;  4IKF A;  3VQ8 A;  3SCX A;  4CHQ A;  4O0I A;  4CFD A;  4C8N A;  3V9X A;  4CEF A;  1SL2 A;  1JLE A;  3JSM A;  2HHX A;  3TAE A;  1LWC A;  4E1N A;  4FLU A;  1SUQ A;  5HP1 A;  4F8R A;  1NK5 A;  1B9F A;  3TAG A;  3AA5 X;  3LWL A;  4CCH A;  4O4G A;  1S1U A;  1TGO A;  2E6M A;  3AVJ A;  1RNH A;  3ASM A;  1KTQ A;  1U49 A;  4IDK A;  4DSI A;  2ZQB A;  4KAZ A;  1HYS A;  3LAL A;  3MEC A;  3K59 A;  2KFZ A;  3CM5 A;  5DK5 A;  4GMJ B;  1A5V A;  1KVC A;  4DTM A;  1C1A A;  4ELV A;  2VWK A;  3SUQ A;  3QIO A;  1KRP A;  4CK2 A;  3SYZ A;  2KFN A;  2YV0 X;  2ATQ A;  2AJQ A;  3A2F A;  3P1G A;  4KTZ A;  3U3G A;  3ZSX A;  4CJP A;  4Z4H A;  1WAF A;  4ID5 A;  1NOZ A;  3ULD A;  1NJX A;  4ELU A;  3KTQ A;  4Z4E A;  3THV A;  1KFS A;  3K58 A;  4CJK A;  3DLR A;  4PWD A;  4E1M A;  1T8E A;  2FC0 A;  3M8S A;  2OPS A;  1WSJ A;  3TI0 A;  3G0Z A;  1HYV A;  3B6P A;  4CJ4 A;  1WSG A;  1C1B A;  3AO4 A;  4N5S A;  3CFO A;  5C24 A;  1DTT A;  3KLG A;  4O5B A;  1TVR A;  3DOK A;  4DTP A;  3ITH A;  5HRR A;  4JRQ A;  1NKB A;  4KRE A;  1XHX A;  1YTU A;  2HHQ A;  3H08 A;  4QAG A;  2P1J A;  1L3S A;  1T7P A;  1NK4 A;  3CQ8 A;  4FK4 A;  1QSL A;  3KJV A;  3QEV A;  4CES A;  4I9Q A;  2GUI A;  4TSX A;  2IC3 A;  5HBM A;  3OYE A;  2HHT A;  3I0S A;  1X1P A;  4CEB A;  3AVL A;  1ZBL A;  4FK0 A;  3HP6 A;  2FBT A;  4FLW A;  4E7K A;  3TAP A;  4CJL A;  4J2B A;  3LAN A;  4Y1C A;  2XY8 A;  2Z1G A;  3OYM A;  1EET A;  3TAF A;  2DFE A;  2Q3S A;  4NCB A;  2OYQ A;  3WNE A;  4AHR A;  3HJF A;  3VQP A;  3I0R A;  4OPK A;  4DG1 A;  4BE0 A;  1UWB A;  2XO7 A;  1QHT A;  1ITG A;  3RTV A;  4E7L A;  1UA0 A;  4LH5 A;  1RDB A;  1RCH A;  3UIQ A;  5J2Q A;  1ASV A;  1X9W A;  1JXE A;  4Z4F A;  1IO2 A;  3L2W A;  2X6S A;  5J2P A;  4B8A B;  1TKD A;  4CJV A;  2OZM A;  1TKZ A;  1JKH A;  1TV6 A;  4C8L A;  4M3T A;  4O55 A;  4CF8 A;  3EYZ A;  4DSK A;  3NF9 A;  2HB5 A;  1B9D A;  1C6V A;  3AVK A;  3DRP A;  2X78 A;  4CF0 A;  2G8U A;  4N41 A;  2OPQ A;  3VQ4 A;  3MXJ A;  1A5X A;  3DMJ A;  4I2Q A;  4LSN A;  3VA3 A;  1S1V A;  4E19 A;  1EP4 A;  4PUO A;  4CFA A;  2DY4 A;  3ISN C;  2FBV A;  2O4G A;  3JYT A;  1KLM A;  1N6Q A;  3F73 A;  4CGH A;  4CHZ A;  2RKI A;  5C42 A;  2YHB A;  1JLG A;  3KKR A;  3LP3 A;  3TAN A;  4FW1 A;  2HMI A;  3AVC A;  1TKT A;  3QEX A;  1NKC A;  1Q9X A;  3V81 A;  3NF6 A;  1NKE A;  3VQQ A;  4DQS A;  4KPY A;  3OYI A;  3HVT A;  5HLF A;  1Z26 A;  1WSH A;  3NBP A;  1UOC A;  1SV5 A;  1VSL A;  4FM2 A;  1Y97 A;  2NUB A;  3ZSO A;  3ZSW A;  3NH1 A;  1C1C A;  2ITG A;  3VQE A;  4CJW A;  4F2S A;  4JS5 A;  1RTI A;  5FDL A;  3QER A;  1RT1 A;  3NCI A;  5KGW A;  4M3U A;  4B3O A;  1WSF A;  2YKN A;  2F8S A;  2ZD1 A;  3ZSY A;  5J1E A;  4AH9 A;  2YNG A;  3SNN A;  4BWM A;  1HMV A;  1VSJ A;  2HHU A;  4F3T A;  2DFH A;  3WNH A;  5FRO A;  1RDD A;  1RTJ A;  4AHC A;  4DLG A;  3KKS A;  4F2R A;  3IG1 A;  1I3A A;  2PY5 A;  3EY1 A;  4C8O A;  3OS0 A;  2VWJ A;  4I9L A;  4FLT A;  4NCG A;  4LSL A;  2G8W A;  3AVB A;  1JLC A;  3LPT A;  4B8C A;  5T7B A;  3OYK A;  1VSK A;  3SJJ A;  3HYF A;  5D3G A;  1CZB A;  2Z1J A;  3DOL A;  3MEG A;  4IG3 A;  4OVL A;  3SV4 A;  4OGC A;  4I7F A;  4DF4 A;  4CF9 A;  3NGZ A;  3QIP A;  3QNO A;  2BAN A;  3O3F A;  1HYZ A;  5SZT A;  1LV5 A;  1RT2 A;  4ID1 A;  4B9N A;  4JRP A;  4DFK A;  1HJR A;  4B9T A;  5KRT A;  4OLB A;  1ZBF A;  3PX6 A;  1NK0 A;  4FLZ A;  1ZBU A;  1BCO A;  4FZY A;  2X74 A;  4MFB A;  2A1S A;  3C6T A;  1CZ9 A;  3LZJ A;  3RR8 A;  1RT7 A;  3RR7 A;  1VSF A;  1FXX A;  1QS4 A;  2VG6 A;  2HHW A;  3ZT3 A;  4FLX A;  4IG0 A;  3L2Q A;  4DF8 A;  1RBR A;  1TKX A;  4FZZ A;  3LP0 A;  3VQA A;  3HPO A;  4FLV A;  3VQB A;  4LH4 A;  2KW4 A;  3AVA A;  1SKS A;  3AA4 A;  4FJM A;  1RT4 A;  2HND A;  3RRG A;  4HUG A;  1TAQ A;  2HVI A;  4DTX A;  4FJ5 A;  2G8F A;  4M3W A;  3OJU A;  4FW2 A;  4OLA A;  1NK7 A;  1IKX A;  1U04 A;  1Q9Y A;  4DU1 A;  3WNG A;  4KO0 A;  2ZE2 A;  3MED A;  2G8H A;  2HVH A;  4CEA A;  3SQ4 A;  4BDY A;  2OZS A;  1VRU A;  4KRF A;  1J53 A;  4CJE A;  3VQ5 A;  2B6A A;  4CGF A;  4XIU A;  1TL3 A;  2B5J A;  3AO1 A;  3FFI A;  5CZ2 A;  4FZX C;  4KB0 A;  4FJX A;  4R5P A;  4M3X A;  4FJK A;  1RT6 A;  2XY7 A;  4CF1 A;  4FK2 A;  2P5G A;  3C6U A;  2P5O A;  3O3G A;  3EZ5 A;  1CXU A;  1HPZ A;  1S1T A;  1S9E A;  3PO4 A;  3OYF A;  4FM0 A;  3NGI A;  3L3V A;  4EP5 A;  4RW4 A;  4CHY A;  4Z4G A;  3SUP A;  1VSD A;  3P83 D;  1BIU A;  2A1R A;  1BI4 B;  2D5R A;  3B6O A;  2O4I A;  4EP4 A;  2GBZ A;  1RTH A;  3LWM A;  4BDP A;  2YNF A;  4CIG A;  3AVN A;  2HW3 A;  1KLN A;  1NK9 A;  1RDA A;  2XY5 A;  4OKE A;  4DQQ A;  2YHA A;  3AO5 A;  3RMB A;  4EZ6 A;  5EU7 A;  5SWM A;  2OA8 A;  4KKO A;  4MQ3 A;  4CER A;  4F4K A;  2HHS A;  1ZBH A;  2FBY A;  1L5U A;  4WE1 A;  4PY5 A;  4CEC A;  4KHW A;  4N47 A;  2PYL A;  1QQC A;  2G8I A;  4I2P A;  2JLE A;  4DU4 A;  2PYJ A;  1RBT A;  4DFJ A;  1UA1 A;  2KTQ A;  3K57 A;  4KHQ A;  4J2E A;  4CJR A;  3DRR A;  3HT3 A;  1XI1 A;  2D0A A;  1WSI A;  4CJ3 A;  3MXI A;  1G15 A;  1RBU A;  5JS2 A;  3AO3 A;  3L3U A;  1HNV A;  1IKW A;  4FJI A;  2QXF A;  1NJW A;  2QKK A;  2HHV A;  4Z4C A;  2KZM A;  3KLF A;  2BDP A;  3U3Y A;  1IKY A;  3DLG A;  4FXD A;  4AHU A;  4YNQ A;  3ZSR A;  5E41 A;  3LP1 A;  4LY7 A;  3NAE A;  4B9V A;  1NOY A;  1VSE A;  1BQN A;  1EXQ A;  1WNS A;  5CYM A;  4FJ9 A;  2EHG A;  3QLH A;  4KI4 A;  4Q0B A;  3PY8 A;  1NK8 A;  3KLI A;  2IGI A;  3AVF A;  4W5R A;  4PA1 A;  4N76 A;  5KTQ A;  2Y1I A;  3ZSZ A;  2G8V A;  4KI6 A;  1U4B A;  1S1X A;  5KRS A;  2D0B A;  4B9L A;  2XHB A;  1GOA A;  3OYJ A;  3QNN A;  3VQ6 A;  3KK1 A;  2R7Y A;  3OYN A;  2IS3 A;  5HRO A;  4B9S A;  4FYD A;  3M8P A;  3DYA A;  3LP2 A;  4DTN A;  4H4O A;  3LZI A;  4M45 A;  1DTQ A;  5CYQ A;  5HRN A;  3MEE A;  3HST B;  4CIE A;  3OJS A;  4CFC A;  3OYD A;  3HM9 A;  3V6D A;  4KHU A;  2KZZ A;  4DQR A;  4HVJ A;  1ZYQ A;  1RBV A;  1VSI A;  3L8B A;  3S3O A;  4HTU A;  4F3O A;  4UQG A;  4BE2 A;  1YTA A;  4DWI A;  1IKV A;  1SKW A;  3DLK A;  3KD5 E;  3T1A A;  3HL8 A;  4H8K A;  3ZSV A;  5C25 A;  1HQE A;  4RW7 A;  1NK6 A;  3BDP A;  3BGR A;  4AHS A;  3LPU A;  1RBS A;  2F8T A;  3DI6 A;  3O4Q A;  3KK3 A;  3AO2 A;  3PV8 A;  3U6F A;  1RDC A;  2RN2 A;  1VSM A;  4CJU A;  1NJY A;  1TK8 A;  1DLO A;  3MXM A;  2IAJ A;  4CK3 A;  4W5O A;  4DSF A;  3KIO A;  3HPG A;  3M8R A;  4CEE A;  4CK1 A;  2Z1I A;  1QSY A;  3LDS A;  3QEI A;  1UAX A;  1TK0 A;  2E6L A;  1U47 A;  3LAM A;  4ZTF A;  2DTU A;  1YVU A;  4OKJ A;  4CJ5 A;  4DMN A;  3KK2 A;  2G8K A;  1LWE A;  2IOC A;  5KI6 A;  3V1R A;  3P5J A;  3CFP A;  3TWH A;  1CLQ A;  3NH2 A;  1J54 A;  1J9A A;  3ZT0 A;  4DQP A;  2QKB A;  1S5J A;  3RMA A;  3QEP A;  4HCB A;  3NE6 A;  3PX0 A;  4CE9 A;  1J5O A;  1S6P A;  4CED A;  4CHP A;  3I8D A;  1F21 A;  1WAJ A;  3QO9 A;  4NCA A;  1KVA A;  1JLF A;  1KCF A;  3SPZ A;  4CJF A;  3K5O A;  4AHT A;  1YT3 A;  2RF2 A;  4L8R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...