2X6NA

Human foamy virus integrase - catalytic core. manganese-bound structure.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
188
structure length
188
Chain Sequence
b'PQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein
total genus 60
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x6nA00
3QIPA 3LANA 4FVMA 3ISNC 4RW8A 4RW4A 1NK8A 2OZSA 4KHWA 4NCGA 1D5AA 3ASMA 4CF9A 2A1SA 3TAEA 1NJYA 4DFMA 1L5UA 1Y97A 3NDKA 4FJ5A 1C0TA 1VSMA 3D45A 3SI6A 2QKBA 4B9VA 5T7BA 3NCIA 3K57A 3V4IA 1K6YA 1X1PA 2LSNA 1T8EA 4OVLA 1VSJA 4K8ZA 3JYTA 3WNFA 5KI6A 1VSHA 2GV9A 3P1GA 4M3UA 2DTUA 3HK2A 1XI1A 1DTQA 1WSJA 4FXDA 4I9QA 1QQCA 3LAMA 2G8KA 3DRPA 3AO1A 1WSGA 3L2RA 2VG5A 3NHGA 1JL2A 2F96A 4CFAA 1Z26A 4L8RB 4FK0A 3LZIA 4YFUA 1ZYQA 1U4BA 4BDPA 2Y1IA 4EP4A 3V9ZA 1LAVA 4AHCA 4CHQA 1VSLA 4E7JA 5HP1A 4FW1A 5D3GA 3TAQA 4OKEA 2X74A 4AHRA 4B9TA 2HHWA 1JKHA 1JLEA 1BGXT 3U6FA 4QAGA 3OS1A 3ALYA 1NKCA 2HNZA 1QSYA 4DS4A 5CYMA 3E01A 2RKIA 1BL3A 2PYLA 3VQAA 2B4JA 3SYZA 3ZSWA 1RT6A 1RTDA 4KTQA 4F3TA 4Z4GA 2BANA 1B92A 4O5BA 2YNIA 1BIUA 5HLFA 3OYCA 1NOZA 4AHUA 4M42A 3CM6A 1RT5A 3CFPA 3AVAA 1YTAA 3ZT0A 2HHXA 3K59A 3K58A 4QOZB 4UQGA 3QLHA 4CJ3A 3VQ9A 3DLEA 3L8BA 3LALA 3V9UA 3FFIA 5CY4A 3AA2A 3QNOA 1W0HA 4KI6A 1ZBLA 2G8HA 4F4KA 1JLAA 4KHUA 1DTTA 4GMJB 4H4OA 5KRTA 1I3AA 1SKSA 1TAUA 2F8TA 1VSEA 1HPZA 4B9NA 3V1QA 5E41A 3O3HA 1SL0A 5JS1A 3KK3A 4ELVA 5I42A 1LWCA 1WLJA 4FLYA 3DRRA 4E0DA 1RNHA 4DS5A 3QETA 4CGIA 3OYAA 4BE0A 5KTQA 2GUIA 4CE9A 2OA8A 1Z25A 1NK6A 1IKWA 1CZ9A 2IGIA 3S3MA 3KKRA 2FC0A 1ZBHA 2XRIA 4CF8A 3IAYA 4E19A 4N76A 4BWJA 4O44A 1RBRA 3VQ7A 3THVA 3DOKA 4B3OA 1RT7A 3H08A 1O1WA 1IKYA 4JRQA 3NF7A 1BI4A 5CZ2A 3OYBA 4IFYA 2Z1IA 3KIOA 3PX6A 3V81A 2P1JA 5KRSA 4CCHA 4B08A 4E1NA 4KFBA 3OYFA 3RR8A 3ZSRA 5HRPA 1FKPA 1RDBA 4CJ4A 3HP6A 1LWFA 1KSPA 1IKXA 1J53A 1EP4A 3AV9A 4DQIA 1C1BA 4DQPA 3HL8A 5SWMA 4CJ5A 4I7FA 4KTWA 1DLOA 3LAKA 4CFBA 2KZZA 1ASWA 1YTUA 1S1TA 4CF0A 2KTQA 4DSKA 4C8NA 1FK9A 1QSSA 1KCFA 4CHNA 4DTUA 3HPOA 3ZT4A 2JGUA 4CIFA 4IBNA 4JS4A 1WAJA 4CJVA 2IDOA 3V9SA 1JLCA 4KB1A 4KHSA 2HNYA 1HMVA 3KKSA 4CEOA 4DTOA 1C1AA 1RDCA 3NF6A 4ICLA 5CZ1A 3QEXA 1T05A 1WSHA 3QERA 2KW4A 3U3GA 1NK0A 2OYQA 4LH5A 4CFDA 1NK7A 3QEVA 3NGYA 3AVBA 4DTJA 4DFKA 2FBXA 1ZBFA 3LWMA 2RPIA 4B9UA 3AA4A 4RW9A 4DTPA 2YHBA 3NH0A 4DTNA 1D9FA 1R0AA 1CLQA 3D0PA 1NK9A 5K14A 1HNIA 5CYQA 3SPYA 1B9DA 4AHVA 3QNNA 3SQ1A 4CHOA 4CJTA 1U49A 3T1AA 1RTIA 5C24A 1KVBA 1REVA 3LPUA 2E6MA 4HCCA 2DFFA 4CEEA 2OPSA 3KLFA 3DLRA 3B6OA 3NFAA 3ZSZA 1SL2A 4G1QA 2BGGA 4FYDA 3AVKA 4H4MA 4KI4A 3PO4A 3LP0A 2G8IA 3U3YA 2NUBA 3KTQA 1EXQA 3SNNA 3ZCMA 4ELTA 4HUEA 2X6NA 4Z4CA 2YV0X 1TL3A 3CFOA 4B9LA 3AO5A 4HTUA 3SZ2A 1S9GA 3WNGA 2KFNA 2XY7A 4KHQA 3PUFA 2D0BA 1UA0A 4C8KA 1QE1A 1YT3A 4FM1A 3M8PA 4I9LA 3PO5A 4E7HA 1RBTA 3T19A 4CK3A 1X9WA 3C6TA 4CF1A 2RN2A 4RW6A 4AH9A 3UIQA 2XY5A 1IKVA 1TK5A 2PYJA 3AA3A 3MEEA 3K5NA 3MECA 3EY1A 3RRHA 1U47A 1L3UA 3HO1A 3DRSA 1RCHA 2W42A 4N47A 3HT3A 1IO2A 1UA1A 1N5YA 4FJMA 4Z4IA 5HRSA 2OZMA 5J2NA 3V1RA 3OYJA 4KAZA 4DTSA 4EZ9A 4GW6A 1NJZA 1RBUA 2YNFA 1VRTA 3DMJA 3NF9A 1KVCA 4CHZA 4CJKA 3V9XA 3SUOA 1NK4A 3ULDA 4DSFA 4Q5VA 2VWJA 3SCXA 3VA3A 3BGRA 2EX3A 3K5OA 3QIOA 3HVRA 4F2RA 3ITHA 3AVCA 2P51A 3M8QA 3ZSOA 4N56A 3T3FA 3KLEA 1VRUA 3RMAA 3PY8A 4F8RA 1TL1A 4DSEA 1J9AA 4CJSA 3AVNA 3DLKA 4CIEA 2VG6A 3S3OA 4B9SA 4FJ8A 2RF2A 4Z4EA 3SV4A 2HMIA 3VQ5A 1CXUA 3KD5E 4F3OA 3HJFA 1LWEA 4C8LA 2YKMA 4DU1A 5J2PA 4QCLA 1XWLA 1T7PA 1SV5A 1QS4A 4DG1A 3NGZA 1CZBA 2XY8A 3L3UA 2G8UA 4OKKA 4CFCA 4J2DA 3HVTA 4IG3A 3K5LA 4BDZA 1UAXA 1WNSA 1SKRA 4DSJA 1SKWA 4FK4A 1TAQA 4WE1A 2Y1JA 3OJSA 3LWLA 4FM0A 3ZSYA 1JLGA 1RDAA 4KV8A 5FROA 3MEGA 5HRRA 4FJ7A 3SUNA 1S1VA 2OPPA 3G10A 2PZSA 4KO0A 1Q9YA 4NCBA 3DLBA 3TABA 5FRMA 1WSIA 1JL1A 1ASUA 2HHVA 3IRXA 2HHTA 3NAEA 4KB0A 3C95A 5J1EA 4E7LA 4CEDA 1C0UA 1ZBUA 3NH2A 3KK2A 1BISA 1WAFA 2O4IA 4OPJA 2G8WA 4YNQA 3SJJA 3QESA 2Q3SA 3MXIA 2YKNA 4JLHA 3NF8A 4DLGA 1RDDA 3V1OA 4DU3A 3TR8A 3VQCA 5FDLA 1LV5A 3MAQA 2Z1HA 2BDPA 3NH1A 1ASVA 1TKZA 2FBVA 3O3GA 3IS9A 3QEIA 3LP2A 4MFBA 2XHBA 4FJKA 1YVUA 2VWKA 4CHYA 3AO4A 1VSDA 1HQEA 4O4GA 1F21A 3QINA 4NYNA 4LD0A 1KFDA 1RTJA 3OVNA 4M3RA 4CJEA 3S9HA 5HBMA 1LW2A 4FJGA 3C94A 3RRGA 4Z0UA 2YNGA 3G0ZA 3VQPA 5FRNA 4TSXA 4DTMA 4J2EA 3ZSQA 4AHSA 1WN7A 4H8KA 4DFPA 2ZD1A 1BI4B 4DWIA 3NGIA 4CESA 1SL1A 4FZZA 3TAFA 2VG7A 3B6PA 4DQQA 4ID1A 4I2PA 3JSMA 2G8FA 4NYFA 4CEFA 2IS3A 3IG1A 3ZT2A 4HVJA 3AO2A 3AVGA 1GOCA 4FJHA 4B8CA 2P5GA 3SUPA 3MXMA 3OJUA 4FJ9A 4KRFA 2WONA 3EZ5A 1JLBA 2OPRA 3O3FA 3DOLA 3KK1A 1NJXA 4B9MA 4IKFA 3RMCA 4DTXA 5KGXA 3M8RA 1RBSA 3TANA 5C25A 4RG8A 4CEAA 1D8YA 4BACA 3F73A 3ZT1A 3BDPA 1TK8A 1Q9XA 4J2AA 1UWBA 1RTHA 4KKOA 4M3XA 4CJLA 2QKKA 4J2BA 1C6VA 4O0IA 3OY9A 4M3YA 2R7YA 4FCYA 4CEQA 4FJLA 4Y1DA 1RILA 5C42A 4M3ZA 4OKJA 4KTZA 3RTVA 3VA0A 4W5RA 4FLTA 1BCOA 5HROA 3L3VA 5JS2A 3SQ0A 1U45A 1GOBA 2HW3A 4CEBA 4HUFA 1TKTA 1S9EA 4E7KA 4ZTFA 4K8XA 4CERA 1XHXA 3AVMA 1NKBA 1HNVA 3AVLA 1D9DA 1A5WA 4C8MA 3L2UA 3V9WA 4IG0A 4DFJA 1TVRA 4LSLA 4O0JA 3OYGA 1TKDA 4OPKA 1N6QA 2F8SA 3KJVA 3I8DA 3P83D 4OGEA 4JS5A 3KLHA 3DLHA 4FLUA 1S1XA 1BQNA 4OGCA 4M45A 4ZTJA 3SUQA 4W5OA 2KQ2A 4C8OA 3A2FA 1NJWA 3WNEA 4CECA 3ZSXA 4Z4FA 1S6QA 1TKXA 1QSLA 3SQ2A 4N5SA 4PWDA 4CJQA 4CJRA 3SV3A 2I5JA 3SQ4A 3QO9A 3RR7A 3V6DA 1FKOA 2B6AA 1BIZA 1C0MA 3L2VA 3TARA 2BE2A 4CJFA 5DMRA 3VQEA 4BWMA 1NOYA 4CK2A 2ITGA 3RWUA 2AJQA 1GOAA 3PX4A 1NK5A 3LDSA 2HNDA 2HHUA 1HRHA 1RT1A 2D5RA 3C6UA 4DF4A 3ZSVA 3SPZA 3AVHA 3QEPA 3HPGA 4IFVA 3KLIA 5J2QA 4FJXA 4KREA 1RT3A 1VK0A 4CEZA 5DK5A 3AVIA 1HYZA 1S1WA 4Q0BA 1A5XA 4KPYA 3HPHA 3OYEA 2DY4A 2ETJA 1ZBIA 1KRPA 3CG7A 2IC3A 3HSTB 3CFRA 2YNHA 4PUOA 3VN5A 3OYMA 3OYIA 5I3UA 4FK2A 2GBZA 1BCMA 4GVMA 4R5PA 5HRNA 1A5VA 1WSFA 4FLZA 4EZ6A 4PQUA 3K2PA 1XC9A 1Q8IA 1KLNA 1QTMA 1U04A 5SZTA 1TV6A 4FLVA 2HHSA 1X9MA 1VSFA 1HQUA 1JLQA 5EU7A 4E89A 2WOMA 4ZHRA 4LSNA 4FLXA 1BHLA 4LH4A 4CF2A 1JXEA 3OS0A 2ZQBA 3VQDA 3DLGA 1WSEA 3NBPA 3M8SA 4CJWA 4FM2A 2Z1GA 1KTQA 1MU2A 1S6PA 4RW7A 4HCBA 1EX4A 1LW0A 2X78A 4DF8A 3RMDA 3CYMA 3TAMA 4DTRA 4W5NA 3OYDA 4DQSA 2HVIA 2X6SA 3OS2A 2ATQA 3AO3A 4CGJA 2P5OA 3LPTA 4ELUA 4PA1A 4FZXC 2YHAA 3RMBA 2E6LA 5J2MA 4HHTA 4DLEA 4CIGA 1EKEA 2HB5A 4W5QA 4FJIA 2QK9A 1VSIA 2DFHA 3TWHA 2JLEA 4DMNA 3L2QA 4HUGA 3I0SA 4B8AB 4DQRA 1L3VA 4FJNA 1B9FA 2B5JA 3I0RA 1KFSA 4N41A 1RBVA 2IAJA 3VQ8A 3PV8A 3F9KA 3CM5A 4CGHA 1JLFA 3VQQA 3HM9A 2HVHA 4DSIA 1C1CA 4CK1A 2KFZA 1X9SA 3QEWA 3OYHA 3HYFA 1RT2A 1L3SA 3LZJA 4CJPA 4BDYA 2G8VA 3L2WA 5KGWA 1QHTA 4CGGA 1JXBA 3AVFA 1G15A 2KZMA 3WNHA 4M3TA 4I2QA 3VQ4A 1FXXA 4FJJA 2XY6A 3VQBA 1XHZA 3EYZA 1EETA 4M41A 4AHTA 2QXFA 3OYLA 1KVAA 2ZE2A 1L3TA 3DM2A 4OLBA 1BQMA 1KLMA 1HYVA 4FW2A 4ID5A 3HP9A 1J5OA 1J54A 2XO7A 4DSLA 3OYNA 4DU4A 3LP1A 2IOCA 3ZT3A 4XIUA 1HJRA 1IH7A 3NE6A 1W9HA 3MXJA 4E3SA 1U48A 4CGFA 1UOCA 1CXQA 2D0AA 2FBTA 3DI6A 3DYAA 3K5MA 4NCAA 4M3WA 2D0CA 1HYSA 1S5JA 4FLWA 3S3NA 3CQ8A 2O4GA 3OYKA 4EP5A 4Y1CA 4OJRA 3TI0A 1IG9A 2HHQA 3VQ6A 1I39A 4PY5A 2FBYA 3AVJA 1RT4A 3O4QA 3KD1E 3LP3A 4LY7A 1SUQA 3AA5X 4E1MA 2Z1JA 3TAPA 1S1UA 4F2SA 4BE1A 3P5JA 2EHGA 3HXMA 4AILC 3TAGA 4O55A 4E7IA 4KHYA 2DFEA 1LAWA 4MQ3A 4BE2A 1TGOA 4CHPA 1ITGA 4JRPA 4FZYA 2PY5A 3KLGA 4OLAA 1T03A 4IDKA 3MEDA 4CGDA 1VSKA 3PX0A 3O4NA 2E4LA 4KHNA 2OPQA 1NKEA 4CJUA 4W5TA 1TK0A 4Z4HA 2A1RA
chains in the Genus database with same CATH superfamily
1YF5L 3QIPA 4RW8A 1D5AA 3ASMA 2A1SA 1NJYA 4DFMA 1WUAA 3FZMA 3SAGA 1YUWA 3CHWA 1NGBA 4K41A 5C2FA 3JYTA 2QWRA 5KI6A 2HHHK 4M3UA 3HK2A 1WSJA 4X65K 2NNWA 4FSVA 4IDHA 2HMPA 4CFAA 1Z26A 4C1NK 3LZIA 4YFUA 4BDPA 2Y1IA 4DR4K 1NLVA 2A41A 4OKEA 2X74A 5BN8A 4LFBK 4BRLA 4QAGA 1NKCA 4DV0K 4NXMK 5ADXH 4DKWA 3VQAA 4EAHD 2KZMA 4JKGB 3CD6N 3HSCA 3OYCA 3CFPA 3AVAA 3VF6A 4CJ3A 3DLEA 3V9UA 4B1YB 3AA2A 1QHAA 1W0HA 1ZBLA 1BO5O 3E9PA 2QWPA 5AQFA 4X66K 2F8TA 1VSEA 4LF8K 5JS1A 4ELVA 4CZHA 3WEEB 3OYAA 1IKWA 2FC0A 3H6EA 4BRFA 3OTOK 3THYA 3IAYA 1ZC6A 4N76A 1RBRA 4BR4A 1W97L 4FPAA 1IKYA 3NF7A 2Z1IA 2WC9A 5AQYA 1Z6RA 4C1NI 4LF6K 1RGIA 5KRSA 1NGAA 2QWLA 4A62A 4E1NA 3RR8A 1FKPA 1LWFA 5AQSA 1IKXA 3AV9A 3HL8A 2O8DB 4JKDA 1NWKA 1S1TA 2F9WA 1NGIA 2CH5A 3Q7CA 4CJVA 3O9QA 2IDOA 4KHSA 2HNYA 4DTOA 4ICLA 3DXKB 1WSHA 2KW4A 3U3GA 4CBXA 4YOXA 4NB4A 4DTJA 4DFKA 4JEPA 4B9UA 1D9FA 3KWIA 2QM1A 3SPYA 3ATUA 2H3GX 4DR5K 1U49A 1Z05A 2WFBA 5C24A 5AZIB 4IJAA 3VTHA 2OPSA 3T1HK 1SL2A 3ID8A 4FYDA 3M6GA 3AVKA 2P9UA 3LP0A 3ZX3A 4ISEA 3U3YA 3KTQA 3ZCMA 1NJIO 5AQXA 4ELTA 3SZ2A 4LF7K 5IWAK 4KHQA 4C8KA 5GIOA 1W2BM 4I9LA 4E7HA 3T19A 3G71N 1WBBA 3K9JA 4AH9A 3UIQA 5M1QA 1RCHA 4DR3K 1IO2A 1E4GT 2P9LB 2IIRA 3J7AP 3LM2A 4DHYA 1ATRA 1YVNA 3EL2A 1NJZA 2E2OA 3QICA 3NF9A 2VWBA 4GV9A 5JLFA 3ULDA 3CCVN 1OKJA 3SCXA 3DAWA 4JK7A 3K5OA 2EX3A 3P38A 3QIOA 1DKGD 4F2RA 2ZJQL 3AVCA 3ZSOA 4F8RA 3T3FA 3RMAA 3KLEA 3KWGA 3AVNA 2VG6A 4Z4EA 2RF2A 4FWKA 3VQ5A 1CXUA 1R59O 3WXIA 1NNEA 3QBXA 4QCLA 1T7PA 2XY8A 2PBDA 3K5LA 4DSJA 1UAXA 4FK4A 1SKWA 1QVFM 3MEGA 5LL6Z 4B3MK 2P9IA 4KO0A 3LL3A 5LJWA 4BR7A 5H1SQ 1OVYA 5BPNA 2VQFK 4E7LA 1C0UA 2O4IA 1ATNA 3WUHA 2YKNA 4JLHA 4XH5A 3NF8A 4JKEA 3VQCA 1LV5A 3N4PA 3G4SN 3IS9A 3QEIA 2VWKA 3C65A 4O4GA 1P8ZA 4LF4K 2HBJA 3VQPA 5FRNA 4TSXA 1N34K 4J2EA 4WF9L 1BI4B 4DWIA 4CESA 4NYFA 2NRVA 4HVJA 4JKFA 4DCHA 4BR2A 2P5GA 5BPLA 2OPRA 3FZHA 3UKUB 3RMCA 4DTXA 3M8RA 4H5RA 1ATSA 3CC4N 2F9TA 3J7YP 3BDPA 4J2AA 1RTHA 4CJLA 4IO8A 4J2BA 4WQ5C 4O0IA 4FCYA 4CEQA 4JKBA 4Y1DA 4FLTA 2FSJA 4CVNE 3L3VA 5JS2A 2HW3A 4ZTFA 4K8XA 3C6AA 3O9RA 4KH4A 1YITN 1XHXA 2YHXA 3AVMA 2HBKA 3L2UA 3VGMA 1O13A 1RDWX 4DFJA 2YJFA 5KQDA 3SAFA 4IEEA 2F8SA 3P83D 4JS5A 3DLHA 4M45A 4ZTJA 3SUQA 3A2FA 4ILJA 3ZSXA 2HOEA 3ID6A 3TTCA 1TKXA 4DUYK 5AQPA 4CJQA 4B9QA 3RR7A 4YHHK 2ZF5O 2ZGYA 2GWKA 5GAEP 2O8CA 1C0MA 3TARA 4K25A 4B1UB 3DXMA 4H03B 2IVNA 4NO7A 1GOAA 3PX4A 2AJQA 3ZEUA 5M1OA 4JI5K 4IFVA 3D2FB 3KLIA 5J2QA 4FJXA 1VK0A 4BROA 3AVIA 3WXMB 1HYZA 1VQMN 4Q0BA 1A5XA 3OYEA 4XH4A 4GKJK 2ETJA 5AQUA 4PUOA 3CFRA 2YNHA 2VCPA 1EQYA 2QWQA 4FWSA 1BCMA 2VQEK 3A8YA 1WSFA 4WFBL 4PQUA 3J80O 4GNIA 1Q8IA 1U04A 5SZTA 4JI0K 1HQUA 4HWIA 4E89A 2E1YA 2FLOA 4JKHA 3EO3A 1YAGA 4LH4A 4CF2A 5EVZA 2ZQBA 3OS0A 3DLGA 3J81O 3NBPA 4FM2A 1EX4A 4DF8A 2Q1NA 1XNQK 2HF3A 2V7ZA 2VGNA 2HVIA 2X6SA 2ATQA 3AO3A 2YHAA 2A5XA 3MCAB 4FJIA 2DFHA 5M1PA 5AQLA 4FJNA 1NM1A 1JCGA 2IVOA 1N33K 4N41A 3E9OA 3CM5A 1JLFA 3VQQA 1YJWN 1X9SA 2UUAK 4IEIA 5KGWA 1QHTA 2D1KA 3AVFA 3WNHA 4BREA 4I2QA 4GV6A 3VQ4A 4FJJA 2XY6A 3EYZA 4EFHA 2QXFA 3OYLA 2ZE2A 4HTLA 4FW2A 5EXWA 3CC7N 3W0LA 1CZAN 1HJRA 3BZKA 4E3SA 4CD3A 3FZKA 3O4WA 3DI6A 1S5JA 4JI8K 2Q0UA 3SLCA 2ASOA 4OJRA 2A42A 4BGBA 3AVJA 1RT4A 2ASMA 4DV3K 3LP3A 1SUQA 4E1MA 5LY3A 3T7ZA 1YJNN 1OH5A 1S1UA 3T69A 4CBWA 4BE1A 4F2SA 4KHYA 4BE2A 5HL7L 1J5EK 5LMUK 4OLAA 3R1XA 4IDKA 4CGDA 1VSKA 3R3LA 1NGJA 3K9KA 4CZJA 4CJUA 1TK0A 4Z4HA 3THXA 1JJ2M 2OZMA 2HBMA 3LANA 4FVMA 4RW4A 4RCHA 2W41A 2QWMA 2WUSA 1SQKA 1C0TA 3D45A 1HX1A 2P9PB 5C10A 4B9VA 2Q31A 2P9KB 3NCIA 2LSNA 3CPWM 1T8EA 4OVLA 4OPHA 1GLCG 1NGDA 2DTUA 1H1VA 1BDGA 4IZ9A 4I9QA 1QQCA 3LAMA 4QS9A 3AO1A 1WSGA 2F96A 4Y0WA 3VEOA 4EP4A 3E66A 1LAVA 4CZGA 1VSLA 3D2FA 5HP1A 4FW1A 5D3GA 1YJ9N 5EY4A 1XQSC 4B9TA 1JKHA 4EIAA 3IFRA 3ALYA 2D4WA 3GOIA 2PYLA 1BL3A 3ZX2A 1RT6A 1HKBA 4Z4GA 3H1QA 4IOAL 1BIUA 4JI2K 4M42A 1MDUB 3CM6A 5AZJA 3K59A 2JWLA 2BH1A 3K58A 1T44A 3QLHA 3TTFA 1BA1A 2CGKA 4KI6A 2G8HA 4F4KA 4KHUA 1DTTA 4H4OA 4E1JA 1I3AA 3V1QA 4FWRA 3F2KA 3KK3A 5TKWA 3TSUA 3UB5A 1LWCA 5A2QO 3MN9A 4NLBA 2OA8A 2IGIA 1CZ9A 3BF1A 1ZBHA 2V7YA 2XRIA 2FF3B 4O44A 3THVA 2E2PA 3DOKA 4JRQA 5CZ2A 1BOTO 4BQZA 3ZSRA 2CGJA 4DQIA 4CZEA 5SWMA 2W6LA 4KTWA 3CI5A 2KZZA 4CFBA 3SAHA 1ASWA 1V4SA 1HNZK 4O8UA 4B1VA 4DSKA 1KCFA 4A61A 1WAJA 5AQOA 1JLCA 1HMVA 1C1AA 1RDCA 3QEXA 1S72N 2UXDK 1ZBFA 2RPIA 3NH0A 4DTNA 4YDUA 4KBOA 3D0PA 4BVOA 4CBUA 5FPDA 1SS6A 3SQ1A 2E20A 3TPQA 1QVGM 3LPUA 2E6MA 4HCCA 1QQMA 4CEEA 4KHPK 3B6OA 3ZSZA 4G1QA 3ULEB 4H4MA 4KI4A 2QXLA 2HF4A 4MLEA 2WTUA 2KFNA 2XY7A 3C7NA 2D0BA 2P9KA 1UA0A 1P90A 4FM1A 3M8PA 4JK8A 4CF1A 4YOVA 2XY5A 2P9NB 2PYJA 2QWNA 1L3UA 3MECA 3RRHA 1FW6A 4K0KK 4FJMA 2BTFA 4Z4IA 5HRSA 1RFQA 3V1RA 3OYJA 3A5LC 4DTSA 4EZ9A 2YX6A 3DMJA 3SUOA 3CETA 3CXCM 4DSFA 1NU0A 3HVRA 3BZCA 1VRUA 2Q2RA 4JHDA 1OH8A 1TL1A 1K73O 4DSEA 4BGAA 3S3OA 4FJ8A 2KHOA 3UKRA 1E3MA 5GIPA 5EOYA 5AQZA 3TU5A 3HJFA 1KD1O 5BRFA 3OW2M 5KPTA 1VQ5N 1GLDG 2Q0RA 3VPZA 5J2PA 1XWLA 1QS4A 4DG1A 4CFCA 3PLAA 2Q36A 4BDZA 5DM6L 5KPRA 1TAQA 4WE1A 3N4QA 3BEXA 2Y1JA 3LWLA 3MX5A 3ZSYA 3TTDA 5FROA 4RTFD 2QTDA 1S1VA 5BREA 3DLBA 5FRMA 1G99A 1JL1A 1NGEA 1WSIA 2GELA 4BRKA 3IRXA 3I8BA 3C95A 4CEDA 5IT9O 1ZBUA 3QB0A 4MO4A 4YOUA 3SJJA 2Q3SA 1V4TA 4DU3A 3ZETA 4BG9A 2E2QA 3VEWA 2Z1HA 4BR0A 1KC8O 2FBVA 4MDBA 3D6RA 4FJKA 4LD0A 2O8BB 4NYNA 1RTJA 4M3RA 4FJGA 1LW2A 4WQ4C 1OVQA 4Z0UA 2YNGA 3G0ZA 3P4IA 3CERA 1EWRA 1NGGA 3NGIA 3BP8A 3G6EN 4FZZA 3VESA 4CZKA 4ID1A 1HJOA 4JI6K 4CEFA 4JKAA 1QQOA 4YY3K 3AVGA 4A57A 5BR9A 2UXBK 3SUPA 2PAVA 1QZ6A 2WONA 4FO0A 4JI1K 3DOLA 3KK1A 4DQ8A 1NJXA 1T6CA 5C25A 3UE5A 3WXKA 4CD1A 2NRTA 2OANA 1Q9XA 1FJGK 1UWBA 4KKOA 3THWB 2QKKA 1C6VA 5ADXA 4M3YA 4YORA 1RILA 4M3ZA 4KTZA 3QFPA 4W5RA 3JS6A 3SQ0A 4HUFA 4E7KA 1S9EA 4CERA 3CJCA 3LDQA 1HNVA 4C8MA 2E5LK 4IG0A 1TVRA 3HTVA 5AQJA 1N6QA 3KJVA 3I8DA 1S1XA 3BY5A 4W5OA 1VQ7N 1N8RO 4JD2B 3P31A 4N5SA 5MLCQ 4CJRA 2VYPA 2I5JA 2E1ZA 1U6ZA 3V6DA 1FKOA 2B6AA 3R6MA 2BE2A 4EHUA 2I7NA 3EE9A 5TKYA 4WCEL 1SZ2A 3LDSA 3CMAN 1YIJN 1HRHA 1RT1A 5JVGL 3FLCO 5BR8K 1Q18A 1IG8A 4JKGA 2BUPA 1HUXA 3VERA 4BRGA 1KXPA 3VN5A 5I3UA 4GVMA 4R5PA 3TSQA 5HRNA 1A5VA 4FLZA 4EZ6A 3K2PA 3IMXA 3WXJA 5BN9A 4FLVA 3OA9A 1JLQA 5EU7A 4H0VB 4ZHRA 3CJ9A 3WEEA 1ZBSA 3NVKA 3H3OB 3VQDA 2QI2A 1DGKN 2X78A 1LW0A 3VENA 3RMDA 3MN6A 1MWMA 3CF5L 3ENBA 3CJ7A 3OYDA 4DQSA 3OS2A 4CGJA 2E88A 1IJJA 4ELUA 3GBTA 4PA1A 2ASPA 3RMBA 4GVEA 1OH7A 4DLEA 4W5QA 1EKEA 2HB5A 3TWHA 1BWFO 4HUGA 1B9FA 3M1FA 2O8DA 3PV8A 1XNRK 4BC4A 2KLAA 4CK1A 1L3SA 3LZJA 3SBTA 1HR0K 3PIPL 3L2WA 4CGGA 2NRHA 4M3TA 3DXKA 1FXXA 4IJNA 2NZTA 1XHZA 3VQBA 4DUZK 1L3TA 3DM2A 4OLBA 4NLCA 1BQMA 1KLMA 4BY9C 1HYVA 4GKKK 3AY9A 3QDKA 2DPNA 2XO7A 3VGKA 2IOCA 3ZT3A 4XIUA 3NE6A 3MXJA 2HSTA 4M63C 5AZIA 1HYSA 2O4GA 1XUPO 3S41A 4U67L 3THWA 4C23A 4PY5A 1QZ5A 3O4QA 3KD1E 3EZWA 4BRMA 2EHGA 4FOIA 4MQ3A 4B3RK 1SAZA 3JAMO 2PY5A 3KZBA 3DJCA 3O4NA 4KHNA 1NKEA 1D4XA 4DR2K 4W5TA 3OYNA 2OZSA 4IWVA 2FXUA 1NK8A 1W7AA 3TAEA 1U2VB 5M1NA 3NDKA 4WYBA 5E26A 3O6WA 1XMOK 4JD2A 5AQMA 2P9LA 3LDNA 1KAZA 1X1PA 1ZXOA 4B3SK 4K8ZA 4JNEA 3P1GA 1BG3A 1DTQA 1VQNN 4BRAA 2G8KA 3NHGA 3L2RA 1JL2A 4L8RB 3MWPA 1ZYQA 4A2BA 4E7JA 4CHQA 3O08A 2FF6A 4AHRA 1BGXT 3PSIA 3U6FA 3OS1A 4DS4A 2GTDA 5CYMA 3E01A 3ZLJA 5JVHL 5C0YA 3AAPA 3D7EO 3SYZA 3ZSWA 1RTDA 4FWOA 1B92A 5AFUH 5HLFA 1N32K 2HHXA 4QOZB 4UQGA 1HKGA 4BRQA 2P9SB 3LALA 1TYQB 3QNOA 5AQNA 1N36K 1JLAA 1M1KO 1TAUA 5GADP 2ZM6K 2W40A 1HPZA 4B9NA 1Q7YO 1K8KB 1HNWK 5I42A 3D2EB 4PKGA 4CGIA 4J8FA 5KTQA 4BE0A 4QS7A 1LOTB 4CE9A 1Z25A 4JAXA 4I6MB 4ISGA 3KKRA 4CF8A 5AQQA 5BRDA 1ILYA 4BRIA 1RT7A 1VHXA 3F9MA 1BI4A 3F5TA 4AM7A 3ENOA 4O5FA 4CCHA 3OYFA 2HHUA 4RWTA 1S3XA 3HP6A 1KSPA 1J53A 4DR7K 4DQPA 4CJ5A 4I7FA 4B3TK 3MMVA 1YTUA 4IO9L 4C8NA 1FK9A 1QSSA 4CHNA 3HPOA 3ZT4A 4DV6K 4JS4A 3V9SA 4G9ZA 3KKSA 3UKUA 3NF6A 5CZ1A 1VQPN 1VQ8N 1GLLO 2OYQA 3QMLA 3U9DA 4CFDA 2J4RA 3O80A 1NK7A 4BRCA 4MO5A 4JI7K 2FBXA 4RW9A 1CLQA 1R0AA 5K14A 5CYQA 1VAZA 1B9DA 2YHYA 1NMDA 4DV5K 4CHOA 1RTIA 2YI1A 3R9PA 1KVBA 5C12A 3FFKB 3DLRA 3NFAA 3CIPA 3PSFA 5JMVA 3A5OC 4BRNA 1EXQA 1QQNA 3TSPA 2X6NA 5AFUA 4HUEA 1VQON 3CPEA 1TL3A 3CFOA 4B9LA 2V52B 3ENHA 4K43A 3AO5A 4FVUA 1S9GA 4XH1A 3R8EA 5FPMA 3PUFA 3C0BA 1JCEA 5AQWA 4B1ZA 3PO5A 1RBTA 3LM9A 4CK3A 3JXUA 3P39A 4M7YA 3CCLN 2RN2A 1TUUA 1IKVA 3AA3A 3K5NA 4FOEA 3EY1A 3DRSA 2OCEA 3I55N 1N5YA 2O8FB 4MDAA 3WXLA 4GW6A 4B1WB 1X9JA 1VRTA 4CJKA 3O9SA 1RDUA 2KKZA 3M8QA 3PY8A 4CJSA 3DLKA 4IOXA 4YOYA 3SMPA 3KD5E 4F3OA 3O1BA 2G8UA 5GAHP 4OKKA 3CJBA 3EEQA 3OJSA 3HM8A 3U8XA 4AF1A 4FM0A 2QEXN 2WBNA 1JLGA 1GLJO 1RDAA 3M3ZA 4KV8A 1K8KA 4FJ7A 3SUNA 2OPPA 3I33A 3G10A 2OTJN 3TABA 2HHTA 5CHIA 3GDQA 5LJVA 3NH2A 1BISA 4OPJA 3RSEB 3QESA 3MXIA 1IBMK 4DLGA 3V1OA 3TR8A 3MAQA 4KH5A 1ASVA 1TKZA 5JICA 3LP2A 4PL7A 4CHYA 3AO4A 3EKUA 1VSDA 1F21A 1KFDA 5AQKA 3LDLA 3THYB 3C94A 3RRGA 2FSNA 3ZSQA 4AHSA 4H8KA 4CZLA 4DFPA 2ZD1A 3KK7A 2A3ZA 2RHKA 5C15A 5AQTA 4DQQA 1KQSM 4I2PA 5AJ3K 3JSMA 2G8FA 3IG1A 3ZT2A 3CCQN 4OX9K 3J8AA 4JKCA 4FJ9A 4KRFA 4MLHA 3WQUA 4EHTA 4B9MA 4IKFA 4A5BA 3HRGA 1D8YA 4RG8A 4CEAA 3ATVA 4BACA 1TK8A 2VGMA 4M3XA 3OY9A 4FJLA 4OKJA 3RTVA 5M1KA 1BCOA 5HROA 1U45A 4CEBA 5BRHA 2UU9K 1GLBG 2P9PA 2Q97A 1NKBA 3AVLA 1D9DA 1A5WA 5FPNA 2YJEA 2UYTA 2P9UB 4LSLA 3MDQA 4OPKA 3ZYYX 3KLHA 1BQNA 2KQ2A 1NJWA 3FGUA 3WNEA 4CECA 1JCFA 3IUCA 4Z4FA 4PWDA 1QSLA 3SQ2A 3EKSA 5AR0A 3SQ4A 3QO9A 4BG8A 4DR6K 3L2VA 2O8FA 4CJFA 1NOYA 4BWMA 4CK2A 3RWUA 5LMNK 2CH6A 2HNDA 5KQ8A 2D5RA 3SPZA 3B8AX 3HPGA 1S22A 4CEZA 1NG9A 3U4LA 1S1WA 3VETA 3HPHA 4GV3A 3VMFB 1ZBIA 1BA0A 3OHRA 2IC3A 3HSTB 1M90O 3OYIA 4FK2A 1XMQK 1KAXA 1XC9A 4BR9A 5FLXO 4LFAK 1TV6A 2HHSA 1VSFA 3J7ZO 2WOMA 4LSNA 3U9ZA 4Z94A 1JXEA 3KVGA 2Z1GA 1KTQA 1MU2A 3FZFA 1S6PA 4RW7A 3E9LA 4BC3A 1YI2N 3RSEA 2P5OA 3LPTA 4FZXC 4UY8O 2E6LA 2P9IB 4JYAK 4JV5K 1VSIA 1J6ZA 3I0SA 1L3VA 2B5JA 3I0RA 1KFSA 3VQ8A 3F9KA 1K8AO 3HOSA 4CGHA 2HVHA 2KFZA 1XC3A 3VF2A 3OYHA 3SK3A 4BDYA 4IOCL 3H1VX 4DV7K 1G15A 4JI3K 4B1XB 4IFEA 1EETA 4M41A 3WT0A 1VQKN 1KVAA 4DV2K 4WQ4A 4ID5A 4DSLA 4DU4A 3LP1A 4WFAL 1U48A 5I9EB 1T6DA 1CXQA 1UOCA 2FBTA 1YHQN 4NCAA 2O8EB 4FWPA 4M3WA 3ZX0A 3OYKA 1IG9A 4Y1CA 2HHQA 3ULEA 4F9OA 2FBYA 1C0FA 4LY7A 3TAPA 4LF9K 3VEZA 4OPAA 3OBWA 3HXMA 3TAGA 4O55A 3K0SA 4E7IA 1LAWA 1TGOA 4JRPA 4FZYA 4BQLA 3KLGA 3SBGA 3MEDA 4LC9B 3PX0A 2E4LA 2GEMA 4U7BA 4FJHA 5HOOA 3ISNC 3NVMA 4KHWA 1ESVA 4NCGA 4CF9A 2P9NA 1L5UA 1Y97A 4QS8A 3A5MC 1VSMA 3SI6A 4X62K 4FJ5A 2QKBA 5T7BA 3VF4A 1NGHA 3VEXA 3K57A 3V4IA 1K6YA 1VSJA 3BUZB 3WNFA 1VSHA 2GV9A 3KHYA 1XI1A 2QW9A 4FXDA 3DRPA 3AARA 2VG5A 4FK0A 1NBWA 1U4BA 3V9ZA 4AHCA 3TAQA 2O8CB 3CCJN 2FSKA 2HHWA 5EX5A 1JLEA 2GUPA 3DXMB 2HNZA 1QSYA 3ZEUB 4H5NA 3CCMN 4OO1J 2RKIA 2B4JA 2RE2A 3O9UA 4KTQA 4F3TA 2BANA 3EN9A 5AQVA 2YNIA 4O5BA 1NOZA 3H45C 4AHUA 4FWMA 1RT5A 4BVPA 1YTAA 3ZT0A 4GY2B 5F1XA 1VQ4N 4A5AA 2JWKA 3I56N 3LDOA 3FE1A 2A6AA 3MWTA 3VQ9A 3L8BA 5GINA 1I94K 3FFIA 5CY4A 3HOTA 1TUYA 1KAYA 3CJ1A 3H46O 3O1WA 4GMJB 5KRTA 1SKSA 2UXCK 2AA4A 5E41A 3O3HA 1SL0A 1BUPA 4CZFA 3CCRN 1WLJA 4FLYA 1X3MA 3DRRA 4E0DA 1RNHA 4DS5A 3QETA 3MN7A 2GUIA 3NMUA 1NK6A 3DLLL 2O8BA 2YCHA 4CJ7A 3S3MA 4H0XB 4E19A 2F7TA 4BWJA 3VQ7A 4DB3A 1X3NA 2NLXA 4B3OA 3H08A 1O1WA 3OYBA 1IBKK 4IFYA 4YOTA 3KIOA 3PX6A 5BPMA 3V81A 2P1JA 4B08A 2HBLA 4KFBA 5HRPA 1RDBA 4CJ4A 4PHTX 3L4IA 1Q81O 1EP4A 4FWNA 1C1BA 1IV0A 1DLOA 3LAKA 1OH6A 4CF0A 5ELZA 2KTQA 3CMEN 4DTUA 4CIFA 2JGUA 4DV4K 4IBNA 4KB1A 4CEOA 2CGLA 1T05A 3QERA 1NK0A 4LH5A 3QEVA 3NGYA 2O8EA 3AVBA 3RVCA 3LWMA 3CQYA 3AA4A 4DTPA 2YHBA 2NRRA 5AQRA 2UUBK 1NK9A 1HNIA 4JI4K 4AHVA 3QNNA 4CJTA 3T1AA 4PKIA 3VTIA 1REVA 4R79A 4FWLA 2DFFA 3EE8A 3KLFA 4BRDA 2BGGA 2NRWA 4WQ5A 3BF3A 3PO4A 1WOQA 2A40A 2G8IA 2NUBA 3HI0A 3SNNA 3OBYA 4Z4CA 2YV0X 4KH6A 4HTUA 4WFNL 3WNGA 4CZMA 3HBTA 1QE1A 1YT3A 4X64K 4PL8A 3THXB 3O9TA 1X9WA 3C6TA 3L0QA 4H5TA 4RW6A 5CR4A 1TK5A 3MEEA 5E84A 2W6KA 1U47A 4CI6A 3HO1A 2W42A 3T1YK 4N47A 3HT3A 4L3QA 1UA1A 4CW7B 5J2NA 1HLUA 3MK6A 4KAZA 4DR1K 1RBUA 2YNFA 3A0IX 1KVCA 4CHZA 3V9XA 1NK4A 4Q5VA 2VWJA 3FZLA 3VA3A 3BGRA 3CJAA 3ITHA 4BC5A 4DV1K 2P51A 1K9MO 4N56A 1J9AA 4CIEA 4B9SA 2NRZA 3SV4A 2HMIA 1GLFO 1LWEA 4C8LA 2YKMA 4DU1A 5DM7L 1SV5A 3NGZA 1CZBA 3L3UA 4J2DA 4H0OA 1T3VA 3HVTA 4IG3A 1WBDA 1EWQA 1WNSA 1SKRA 2EWSA 2D0OA 1E4FT 4AQYK 5AZJB 5HRRA 3DWLA 2PZSA 3CC2N 3WQTA 3SJHA 1Q9YA 4NCBA 1NGFA 2HHVA 1ASUA 3NAEA 4KB0A 5J1EA 3A5NC 1YXQA 3MCPA 3KK2A 1WAFA 2G8WA 4YNQA 1WB9A 4O8KA 3W3DA 1NMNA 1RDDA 5B8HA 1Q82O 4YOWA 5FDLA 2BDPA 3NH1A 3O3GA 4JN4A 4MFBA 2XHBA 3SMSA 1DT9A 1YVUA 4BRPA 1HQEA 4CJEA 3QINA 3G25A 3S9HA 3OVNA 5HBMA 4DTMA 1WN7A 3VEVA 2ZJPL 5AQGA 1SL1A 1VQ9N 3AAQA 3TAFA 2VG7A 3B6PA 2GX9A 1Y64A 3GG4A 2IS3A 1MWKA 5M1FA 3C6HA 4LF5K 3AO2A 1VQLN 2YHWA 1GOCA 4B8CA 3MXMA 3OJUA 4CZIA 3CCEN 3EZ5A 1JLBA 3FR0A 3O3FA 5F0XA 2ZJRL 3QBWA 4JK9A 3TANA 5KGXA 1RBSA 1C0GA 4IXCA 3ZT1A 3F73A 4AM6A 3PIOL 2R7YA 5C42A 4K42A 3CCUN 2V51B 2I7PA 3VA0A 3GE1A 3IDHA 1GOBA 1U2VA 1TKTA 4H0TB 5FPEA 2QA4N 3V9WA 4NXNK 4O0JA 3OYGA 5F2RA 1TKDA 1GLAG 4H0PA 3AGKA 5C2DA 1VQ6N 4OGEA 4FLUA 4OGCA 4C8OA 2E8AA 1S6QA 4FWQA 3C7NB 3SV3A 3CCSN 1BIZA 4BRHA 5DMRA 3VQEA 2ITGA 3E1YA 1NK5A 2AP1A 4DF4A 3C6UA 3ZSVA 4A59A 3AVHA 4H5WA 3QEPA 4KREA 2OTLN 1RT3A 1HKCA 5DK5A 4XEIA 4KPYA 2ZWHA 2DY4A 4H5VA 1KRPA 3CG7A 2P9SA 3CQXA 1TYQA 3OYMA 2GBZA 3Q7BA 2UUCK 2IVPA 1HPMA 4JHDB 1KLNA 1QTMA 2GWJA 3O5BA 3O8MA 3UKRB 4H0YB 3VGLA 5JLHA 1X9MA 4FLXA 3D2EA 1BHLA 3M8SA 1WSEA 4CJWA 4FPBA 3AGRA 4ISFA 4HCBA 4I6MA 3CYMA 3TAMA 4DTRA 2PFUA 3HZ6A 4W5NA 3IKMA 4BR5A 5J2MA 4HHTA 4ILGB 4CIGA 2QK9A 3QFUA 3VOVA 2JLEA 4DMNA 3L2QA 4DQRA 2ITMA 4B8AB 2NRXA 3VEYA 1RBVA 2IAJA 3ZETB 1Q86O 3HM9A 4DSIA 1C1CA 3QEWA 3HYFA 1RT2A 4M7XA 4CJPA 2G8VA 2QWOA 2ZGZA 1JXBA 3LDPA 3M5RA 3GL1A 5CE3A 2E2NA 4AHTA 3MN5A 4BC2A 4YDUC 1GLEG 3HP9A 4LFCK 1J5OA 1J54A 1IH7A 1LCUA 1W9HA 4FL9A 4A2AA 1MA9B 4V19S 1EO1A 4CGFA 2D0AA 3DYAA 3K5MA 3MX2A 2D0CA 4FLWA 3S3NA 3CQ8A 5GAGP 4EP5A 3TI0A 3VQ6A 1I39A 3H3NO 5AQIA 4ILHA 3L4QA 3AA5X 4PKHA 1BU6O 2Z1JA 2D0PA 1DEJA 3P5JA 2F4VK 4AILC 2DFEA 4CHPA 1HNXK 1ITGA 1T03A 5AQHA 1IBLK 3L6QA 2OPQA 5KPZA 1NGCA 2A1RA
chains in the Genus database with same CATH topology
3QIPA 3LANA 4FVMA 3ISNC 4RW8A 4RW4A 1NK8A 2OZSA 4KHWA 4NCGA 1D5AA 3ASMA 4CF9A 2A1SA 3TAEA 1NJYA 4DFMA 1L5UA 1Y97A 3NDKA 4FJ5A 1C0TA 1VSMA 3D45A 3SI6A 2QKBA 4B9VA 5T7BA 3NCIA 3K57A 3V4IA 1K6YA 1X1PA 2LSNA 1T8EA 4OVLA 1VSJA 4K8ZA 3JYTA 3WNFA 5KI6A 1VSHA 2GV9A 3P1GA 4M3UA 2DTUA 3HK2A 1XI1A 1DTQA 1WSJA 4FXDA 4I9QA 1QQCA 3LAMA 2G8KA 3DRPA 3AO1A 1WSGA 3L2RA 2VG5A 3NHGA 1JL2A 2F96A 4CFAA 1Z26A 4L8RB 4FK0A 3LZIA 4YFUA 1ZYQA 1U4BA 4BDPA 2Y1IA 4EP4A 3V9ZA 1LAVA 4AHCA 4CHQA 1VSLA 4E7JA 5HP1A 4FW1A 5D3GA 3TAQA 4OKEA 2X74A 4AHRA 4B9TA 2HHWA 1JKHA 1JLEA 1BGXT 3U6FA 4QAGA 3OS1A 3ALYA 1NKCA 2HNZA 1QSYA 4DS4A 5CYMA 3E01A 2RKIA 1BL3A 2PYLA 3VQAA 2B4JA 3SYZA 3ZSWA 1RT6A 1RTDA 4KTQA 4F3TA 4Z4GA 2BANA 1B92A 4O5BA 2YNIA 1BIUA 5HLFA 3OYCA 1NOZA 4AHUA 4M42A 3CM6A 1RT5A 3CFPA 3AVAA 1YTAA 3ZT0A 2HHXA 3K59A 3K58A 4QOZB 4UQGA 3QLHA 4CJ3A 3VQ9A 3DLEA 3L8BA 3LALA 3V9UA 3FFIA 5CY4A 3AA2A 3QNOA 1W0HA 4KI6A 1ZBLA 2G8HA 4F4KA 1JLAA 4KHUA 1DTTA 4GMJB 4H4OA 5KRTA 1I3AA 1SKSA 1TAUA 2F8TA 1VSEA 1HPZA 4B9NA 3V1QA 5E41A 3O3HA 1SL0A 5JS1A 3KK3A 4ELVA 5I42A 1LWCA 1WLJA 4FLYA 3DRRA 4E0DA 1RNHA 4DS5A 3QETA 4CGIA 3OYAA 4BE0A 5KTQA 2GUIA 4CE9A 2OA8A 1Z25A 1NK6A 1IKWA 1CZ9A 2IGIA 3S3MA 3KKRA 2FC0A 1ZBHA 2XRIA 4CF8A 3IAYA 4E19A 4N76A 4BWJA 4O44A 1RBRA 3VQ7A 3THVA 3DOKA 4B3OA 1RT7A 3H08A 1O1WA 1IKYA 4JRQA 3NF7A 1BI4A 5CZ2A 3OYBA 4IFYA 2Z1IA 3KIOA 3PX6A 3V81A 2P1JA 5KRSA 4CCHA 4B08A 4E1NA 4KFBA 3OYFA 3RR8A 3ZSRA 5HRPA 1FKPA 1RDBA 4CJ4A 3HP6A 1LWFA 1KSPA 1IKXA 1J53A 1EP4A 3AV9A 4DQIA 1C1BA 4DQPA 3HL8A 5SWMA 4CJ5A 4I7FA 4KTWA 1DLOA 3LAKA 4CFBA 2KZZA 1ASWA 1YTUA 1S1TA 4CF0A 2KTQA 4DSKA 4C8NA 1FK9A 1QSSA 1KCFA 4CHNA 4DTUA 3HPOA 3ZT4A 2JGUA 4CIFA 4IBNA 4JS4A 1WAJA 4CJVA 2IDOA 3V9SA 1JLCA 4KB1A 4KHSA 2HNYA 1HMVA 3KKSA 4CEOA 4DTOA 1C1AA 1RDCA 3NF6A 4ICLA 5CZ1A 3QEXA 1T05A 1WSHA 3QERA 2KW4A 3U3GA 1NK0A 2OYQA 4LH5A 4CFDA 1NK7A 3QEVA 3NGYA 3AVBA 4DTJA 4DFKA 2FBXA 1ZBFA 3LWMA 2RPIA 4B9UA 3AA4A 4RW9A 4DTPA 2YHBA 3NH0A 4DTNA 1D9FA 1R0AA 1CLQA 3D0PA 1NK9A 5K14A 1HNIA 5CYQA 3SPYA 1B9DA 4AHVA 3QNNA 3SQ1A 4CHOA 4CJTA 1U49A 3T1AA 1RTIA 5C24A 1KVBA 1REVA 3LPUA 2E6MA 4HCCA 2DFFA 4CEEA 2OPSA 3KLFA 3DLRA 3B6OA 3NFAA 3ZSZA 1SL2A 4G1QA 2BGGA 4FYDA 3AVKA 4H4MA 4KI4A 3PO4A 3LP0A 2G8IA 3U3YA 2NUBA 3KTQA 1EXQA 3SNNA 3ZCMA 4ELTA 4HUEA 2X6NA 4Z4CA 2YV0X 1TL3A 3CFOA 4B9LA 3AO5A 4HTUA 3SZ2A 1S9GA 3WNGA 2KFNA 2XY7A 4KHQA 3PUFA 2D0BA 1UA0A 4C8KA 1QE1A 1YT3A 4FM1A 3M8PA 4I9LA 3PO5A 4E7HA 1RBTA 3T19A 4CK3A 1X9WA 3C6TA 4CF1A 2RN2A 4RW6A 4AH9A 3UIQA 2XY5A 1IKVA 1TK5A 2PYJA 3AA3A 3MEEA 3K5NA 3MECA 3EY1A 3RRHA 1U47A 1L3UA 3HO1A 3DRSA 1RCHA 2W42A 4N47A 3HT3A 1IO2A 1UA1A 1N5YA 4FJMA 4Z4IA 5HRSA 2OZMA 5J2NA 3V1RA 3OYJA 4KAZA 4DTSA 4EZ9A 4GW6A 1NJZA 1RBUA 2YNFA 1VRTA 3DMJA 3NF9A 1KVCA 4CHZA 4CJKA 3V9XA 3SUOA 1NK4A 3ULDA 4DSFA 4Q5VA 2VWJA 3SCXA 3VA3A 3BGRA 2EX3A 3K5OA 3QIOA 3HVRA 4F2RA 3ITHA 3AVCA 2P51A 3M8QA 3ZSOA 4N56A 3T3FA 3KLEA 1VRUA 3RMAA 3PY8A 4F8RA 1TL1A 4DSEA 1J9AA 4CJSA 3AVNA 3DLKA 4CIEA 2VG6A 3S3OA 4B9SA 4FJ8A 2RF2A 4Z4EA 3SV4A 2HMIA 3VQ5A 1CXUA 3KD5E 4F3OA 3HJFA 1LWEA 4C8LA 2YKMA 4DU1A 5J2PA 4QCLA 1XWLA 1T7PA 1SV5A 1QS4A 4DG1A 3NGZA 1CZBA 2XY8A 3L3UA 2G8UA 4OKKA 4CFCA 4J2DA 3HVTA 4IG3A 3K5LA 4BDZA 1UAXA 1WNSA 1SKRA 4DSJA 1SKWA 4FK4A 1TAQA 4WE1A 2Y1JA 3OJSA 3LWLA 4FM0A 3ZSYA 1JLGA 1RDAA 4KV8A 5FROA 3MEGA 5HRRA 4FJ7A 3SUNA 1S1VA 2OPPA 3G10A 2PZSA 4KO0A 1Q9YA 4NCBA 3DLBA 3TABA 5FRMA 1WSIA 1JL1A 1ASUA 2HHVA 3IRXA 2HHTA 3NAEA 4KB0A 3C95A 5J1EA 4E7LA 4CEDA 1C0UA 1ZBUA 3NH2A 3KK2A 1BISA 1WAFA 2O4IA 4OPJA 2G8WA 4YNQA 3SJJA 3QESA 2Q3SA 3MXIA 2YKNA 4JLHA 3NF8A 4DLGA 1RDDA 3V1OA 4DU3A 3TR8A 3VQCA 5FDLA 1LV5A 3MAQA 2Z1HA 2BDPA 3NH1A 1ASVA 1TKZA 2FBVA 3O3GA 3IS9A 3QEIA 3LP2A 4MFBA 2XHBA 4FJKA 1YVUA 2VWKA 4CHYA 3AO4A 1VSDA 1HQEA 4O4GA 1F21A 3QINA 4NYNA 4LD0A 1KFDA 1RTJA 3OVNA 4M3RA 4CJEA 3S9HA 5HBMA 1LW2A 4FJGA 3C94A 3RRGA 4Z0UA 2YNGA 3G0ZA 3VQPA 5FRNA 4TSXA 4DTMA 4J2EA 3ZSQA 4AHSA 1WN7A 4H8KA 4DFPA 2ZD1A 1BI4B 4DWIA 3NGIA 4CESA 1SL1A 4FZZA 3TAFA 2VG7A 3B6PA 4DQQA 4ID1A 4I2PA 3JSMA 2G8FA 4NYFA 4CEFA 2IS3A 3IG1A 3ZT2A 4HVJA 3AO2A 3AVGA 1GOCA 4FJHA 4B8CA 2P5GA 3SUPA 3MXMA 3OJUA 4FJ9A 4KRFA 2WONA 3EZ5A 1JLBA 2OPRA 3O3FA 3DOLA 3KK1A 1NJXA 4B9MA 4IKFA 3RMCA 4DTXA 5KGXA 3M8RA 1RBSA 3TANA 5C25A 4RG8A 4CEAA 1D8YA 4BACA 3F73A 3ZT1A 3BDPA 1TK8A 1Q9XA 4J2AA 1UWBA 1RTHA 4KKOA 4M3XA 4CJLA 2QKKA 4J2BA 1C6VA 4O0IA 3OY9A 4M3YA 2R7YA 4FCYA 4CEQA 4FJLA 4Y1DA 1RILA 5C42A 4M3ZA 4OKJA 4KTZA 3RTVA 3VA0A 4W5RA 4FLTA 1BCOA 5HROA 3L3VA 5JS2A 3SQ0A 1U45A 1GOBA 2HW3A 4CEBA 4HUFA 1TKTA 1S9EA 4E7KA 4ZTFA 4K8XA 4CERA 1XHXA 3AVMA 1NKBA 1HNVA 3AVLA 1D9DA 1A5WA 4C8MA 3L2UA 3V9WA 4IG0A 4DFJA 1TVRA 4LSLA 4O0JA 3OYGA 1TKDA 4OPKA 1N6QA 2F8SA 3KJVA 3I8DA 3P83D 4OGEA 4JS5A 3KLHA 3DLHA 4FLUA 1S1XA 1BQNA 4OGCA 4M45A 4ZTJA 3SUQA 4W5OA 2KQ2A 4C8OA 3A2FA 1NJWA 3WNEA 4CECA 3ZSXA 4Z4FA 1S6QA 1TKXA 1QSLA 3SQ2A 4N5SA 4PWDA 4CJQA 4CJRA 3SV3A 2I5JA 3SQ4A 3QO9A 3RR7A 3V6DA 1FKOA 2B6AA 1BIZA 1C0MA 3L2VA 3TARA 2BE2A 4CJFA 5DMRA 3VQEA 4BWMA 1NOYA 4CK2A 2ITGA 3RWUA 2AJQA 1GOAA 3PX4A 1NK5A 3LDSA 2HNDA 2HHUA 1HRHA 1RT1A 2D5RA 3C6UA 4DF4A 3ZSVA 3SPZA 3AVHA 3QEPA 3HPGA 4IFVA 3KLIA 5J2QA 4FJXA 4KREA 1RT3A 1VK0A 4CEZA 5DK5A 3AVIA 1HYZA 1S1WA 4Q0BA 1A5XA 4KPYA 3HPHA 3OYEA 2DY4A 2ETJA 1ZBIA 1KRPA 3CG7A 2IC3A 3HSTB 3CFRA 2YNHA 4PUOA 3VN5A 3OYMA 3OYIA 5I3UA 4FK2A 2GBZA 1BCMA 4GVMA 4R5PA 5HRNA 1A5VA 1WSFA 4FLZA 4EZ6A 4PQUA 3K2PA 1XC9A 1Q8IA 1KLNA 1QTMA 1U04A 5SZTA 1TV6A 4FLVA 2HHSA 1X9MA 1VSFA 1HQUA 1JLQA 5EU7A 4E89A 2WOMA 4ZHRA 4LSNA 4FLXA 1BHLA 4LH4A 4CF2A 1JXEA 3OS0A 2ZQBA 3VQDA 3DLGA 1WSEA 3NBPA 3M8SA 4CJWA 4FM2A 2Z1GA 1KTQA 1MU2A 1S6PA 4RW7A 4HCBA 1EX4A 1LW0A 2X78A 4DF8A 3RMDA 3CYMA 3TAMA 4DTRA 4W5NA 3OYDA 4DQSA 2HVIA 2X6SA 3OS2A 2ATQA 3AO3A 4CGJA 2P5OA 3LPTA 4ELUA 4PA1A 4FZXC 2YHAA 3RMBA 2E6LA 5J2MA 4HHTA 4DLEA 4CIGA 1EKEA 2HB5A 4W5QA 4FJIA 2QK9A 1VSIA 2DFHA 3TWHA 2JLEA 4DMNA 3L2QA 4HUGA 3I0SA 4B8AB 4DQRA 1L3VA 4FJNA 1B9FA 2B5JA 3I0RA 1KFSA 4N41A 1RBVA 2IAJA 3VQ8A 3PV8A 3F9KA 3CM5A 4CGHA 1JLFA 3VQQA 3HM9A 2HVHA 4DSIA 1C1CA 4CK1A 2KFZA 1X9SA 3QEWA 3OYHA 3HYFA 1RT2A 1L3SA 3LZJA 4CJPA 4BDYA 2G8VA 3L2WA 5KGWA 1QHTA 4CGGA 1JXBA 3AVFA 1G15A 2KZMA 3WNHA 4M3TA 4I2QA 3VQ4A 1FXXA 4FJJA 2XY6A 3VQBA 1XHZA 3EYZA 1EETA 4M41A 4AHTA 2QXFA 3OYLA 1KVAA 2ZE2A 1L3TA 3DM2A 4OLBA 1BQMA 1KLMA 1HYVA 4FW2A 4ID5A 3HP9A 1J5OA 1J54A 2XO7A 4DSLA 3OYNA 4DU4A 3LP1A 2IOCA 3ZT3A 4XIUA 1HJRA 1IH7A 3NE6A 1W9HA 3MXJA 4E3SA 1U48A 4CGFA 1UOCA 1CXQA 2D0AA 2FBTA 3DI6A 3DYAA 3K5MA 4NCAA 4M3WA 2D0CA 1HYSA 1S5JA 4FLWA 3S3NA 3CQ8A 2O4GA 3OYKA 4EP5A 4Y1CA 4OJRA 3TI0A 1IG9A 2HHQA 3VQ6A 1I39A 4PY5A 2FBYA 3AVJA 1RT4A 3O4QA 3KD1E 3LP3A 4LY7A 1SUQA 3AA5X 4E1MA 2Z1JA 3TAPA 1S1UA 4F2SA 4BE1A 3P5JA 2EHGA 3HXMA 4AILC 3TAGA 4O55A 4E7IA 4KHYA 2DFEA 1LAWA 4MQ3A 4BE2A 1TGOA 4CHPA 1ITGA 4JRPA 4FZYA 2PY5A 3KLGA 4OLAA 1T03A 4IDKA 3MEDA 4CGDA 1VSKA 3PX0A 3O4NA 2E4LA 4KHNA 2OPQA 1NKEA 4CJUA 4W5TA 1TK0A 4Z4HA 2A1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIP A;  3LAN A;  4FVM A;  3ISN C;  4RW8 A;  4RW4 A;  1NK8 A;  2OZS A;  4KHW A;  4NCG A;  1D5A A;  3ASM A;  4CF9 A;  2A1S A;  3TAE A;  1NJY A;  4DFM A;  1L5U A;  1Y97 A;  3NDK A;  4FJ5 A;  1C0T A;  1VSM A;  3D45 A;  3SI6 A;  2QKB A;  4B9V A;  5T7B A;  3NCI A;  3K57 A;  3V4I A;  1K6Y A;  1X1P A;  2LSN A;  1T8E A;  4OVL A;  1VSJ A;  4K8Z A;  3JYT A;  3WNF A;  5KI6 A;  1VSH A;  2GV9 A;  3P1G A;  4M3U A;  2DTU A;  3HK2 A;  1XI1 A;  1DTQ A;  1WSJ A;  4FXD A;  4I9Q A;  1QQC A;  3LAM A;  2G8K A;  3DRP A;  3AO1 A;  1WSG A;  3L2R A;  2VG5 A;  3NHG A;  1JL2 A;  2F96 A;  4CFA A;  1Z26 A;  4L8R B;  4FK0 A;  3LZI A;  4YFU A;  1ZYQ A;  1U4B A;  4BDP A;  2Y1I A;  4EP4 A;  3V9Z A;  1LAV A;  4AHC A;  4CHQ A;  1VSL A;  4E7J A;  5HP1 A;  4FW1 A;  5D3G A;  3TAQ A;  4OKE A;  2X74 A;  4AHR A;  4B9T A;  2HHW A;  1JKH A;  1JLE A;  1BGX T;  3U6F A;  4QAG A;  3OS1 A;  3ALY A;  1NKC A;  2HNZ A;  1QSY A;  4DS4 A;  5CYM A;  3E01 A;  2RKI A;  1BL3 A;  2PYL A;  3VQA A;  2B4J A;  3SYZ A;  3ZSW A;  1RT6 A;  1RTD A;  4KTQ A;  4F3T A;  4Z4G A;  2BAN A;  1B92 A;  4O5B A;  2YNI A;  1BIU A;  5HLF A;  3OYC A;  1NOZ A;  4AHU A;  4M42 A;  3CM6 A;  1RT5 A;  3CFP A;  3AVA A;  1YTA A;  3ZT0 A;  2HHX A;  3K59 A;  3K58 A;  4QOZ B;  4UQG A;  3QLH A;  4CJ3 A;  3VQ9 A;  3DLE A;  3L8B A;  3LAL A;  3V9U A;  3FFI A;  5CY4 A;  3AA2 A;  3QNO A;  1W0H A;  4KI6 A;  1ZBL A;  2G8H A;  4F4K A;  1JLA A;  4KHU A;  1DTT A;  4GMJ B;  4H4O A;  5KRT A;  1I3A A;  1SKS A;  1TAU A;  2F8T A;  1VSE A;  1HPZ A;  4B9N A;  3V1Q A;  5E41 A;  3O3H A;  1SL0 A;  5JS1 A;  3KK3 A;  4ELV A;  5I42 A;  1LWC A;  1WLJ A;  4FLY A;  3DRR A;  4E0D A;  1RNH A;  4DS5 A;  3QET A;  4CGI A;  3OYA A;  4BE0 A;  5KTQ A;  2GUI A;  4CE9 A;  2OA8 A;  1Z25 A;  1NK6 A;  1IKW A;  1CZ9 A;  2IGI A;  3S3M A;  3KKR A;  2FC0 A;  1ZBH A;  2XRI A;  4CF8 A;  3IAY A;  4E19 A;  4N76 A;  4BWJ A;  4O44 A;  1RBR A;  3VQ7 A;  3THV A;  3DOK A;  4B3O A;  1RT7 A;  3H08 A;  1O1W A;  1IKY A;  4JRQ A;  3NF7 A;  1BI4 A;  5CZ2 A;  3OYB A;  4IFY A;  2Z1I A;  3KIO A;  3PX6 A;  3V81 A;  2P1J A;  5KRS A;  4CCH A;  4B08 A;  4E1N A;  4KFB A;  3OYF A;  3RR8 A;  3ZSR A;  5HRP A;  1FKP A;  1RDB A;  4CJ4 A;  3HP6 A;  1LWF A;  1KSP A;  1IKX A;  1J53 A;  1EP4 A;  3AV9 A;  4DQI A;  1C1B A;  4DQP A;  3HL8 A;  5SWM A;  4CJ5 A;  4I7F A;  4KTW A;  1DLO A;  3LAK A;  4CFB A;  2KZZ A;  1ASW A;  1YTU A;  1S1T A;  4CF0 A;  2KTQ A;  4DSK A;  4C8N A;  1FK9 A;  1QSS A;  1KCF A;  4CHN A;  4DTU A;  3HPO A;  3ZT4 A;  2JGU A;  4CIF A;  4IBN A;  4JS4 A;  1WAJ A;  4CJV A;  2IDO A;  3V9S A;  1JLC A;  4KB1 A;  4KHS A;  2HNY A;  1HMV A;  3KKS A;  4CEO A;  4DTO A;  1C1A A;  1RDC A;  3NF6 A;  4ICL A;  5CZ1 A;  3QEX A;  1T05 A;  1WSH A;  3QER A;  2KW4 A;  3U3G A;  1NK0 A;  2OYQ A;  4LH5 A;  4CFD A;  1NK7 A;  3QEV A;  3NGY A;  3AVB A;  4DTJ A;  4DFK A;  2FBX A;  1ZBF A;  3LWM A;  2RPI A;  4B9U A;  3AA4 A;  4RW9 A;  4DTP A;  2YHB A;  3NH0 A;  4DTN A;  1D9F A;  1R0A A;  1CLQ A;  3D0P A;  1NK9 A;  5K14 A;  1HNI A;  5CYQ A;  3SPY A;  1B9D A;  4AHV A;  3QNN A;  3SQ1 A;  4CHO A;  4CJT A;  1U49 A;  3T1A A;  1RTI A;  5C24 A;  1KVB A;  1REV A;  3LPU A;  2E6M A;  4HCC A;  2DFF A;  4CEE A;  2OPS A;  3KLF A;  3DLR A;  3B6O A;  3NFA A;  3ZSZ A;  1SL2 A;  4G1Q A;  2BGG A;  4FYD A;  3AVK A;  4H4M A;  4KI4 A;  3PO4 A;  3LP0 A;  2G8I A;  3U3Y A;  2NUB A;  3KTQ A;  1EXQ A;  3SNN A;  3ZCM A;  4ELT A;  4HUE A;  2X6N A;  4Z4C A;  2YV0 X;  1TL3 A;  3CFO A;  4B9L A;  3AO5 A;  4HTU A;  3SZ2 A;  1S9G A;  3WNG A;  2KFN A;  2XY7 A;  4KHQ A;  3PUF A;  2D0B A;  1UA0 A;  4C8K A;  1QE1 A;  1YT3 A;  4FM1 A;  3M8P A;  4I9L A;  3PO5 A;  4E7H A;  1RBT A;  3T19 A;  4CK3 A;  1X9W A;  3C6T A;  4CF1 A;  2RN2 A;  4RW6 A;  4AH9 A;  3UIQ A;  2XY5 A;  1IKV A;  1TK5 A;  2PYJ A;  3AA3 A;  3MEE A;  3K5N A;  3MEC A;  3EY1 A;  3RRH A;  1U47 A;  1L3U A;  3HO1 A;  3DRS A;  1RCH A;  2W42 A;  4N47 A;  3HT3 A;  1IO2 A;  1UA1 A;  1N5Y A;  4FJM A;  4Z4I A;  5HRS A;  2OZM A;  5J2N A;  3V1R A;  3OYJ A;  4KAZ A;  4DTS A;  4EZ9 A;  4GW6 A;  1NJZ A;  1RBU A;  2YNF A;  1VRT A;  3DMJ A;  3NF9 A;  1KVC A;  4CHZ A;  4CJK A;  3V9X A;  3SUO A;  1NK4 A;  3ULD A;  4DSF A;  4Q5V A;  2VWJ A;  3SCX A;  3VA3 A;  3BGR A;  2EX3 A;  3K5O A;  3QIO A;  3HVR A;  4F2R A;  3ITH A;  3AVC A;  2P51 A;  3M8Q A;  3ZSO A;  4N56 A;  3T3F A;  3KLE A;  1VRU A;  3RMA A;  3PY8 A;  4F8R A;  1TL1 A;  4DSE A;  1J9A A;  4CJS A;  3AVN A;  3DLK A;  4CIE A;  2VG6 A;  3S3O A;  4B9S A;  4FJ8 A;  2RF2 A;  4Z4E A;  3SV4 A;  2HMI A;  3VQ5 A;  1CXU A;  3KD5 E;  4F3O A;  3HJF A;  1LWE A;  4C8L A;  2YKM A;  4DU1 A;  5J2P A;  4QCL A;  1XWL A;  1T7P A;  1SV5 A;  1QS4 A;  4DG1 A;  3NGZ A;  1CZB A;  2XY8 A;  3L3U A;  2G8U A;  4OKK A;  4CFC A;  4J2D A;  3HVT A;  4IG3 A;  3K5L A;  4BDZ A;  1UAX A;  1WNS A;  1SKR A;  4DSJ A;  1SKW A;  4FK4 A;  1TAQ A;  4WE1 A;  2Y1J A;  3OJS A;  3LWL A;  4FM0 A;  3ZSY A;  1JLG A;  1RDA A;  4KV8 A;  5FRO A;  3MEG A;  5HRR A;  4FJ7 A;  3SUN A;  1S1V A;  2OPP A;  3G10 A;  2PZS A;  4KO0 A;  1Q9Y A;  4NCB A;  3DLB A;  3TAB A;  5FRM A;  1WSI A;  1JL1 A;  1ASU A;  2HHV A;  3IRX A;  2HHT A;  3NAE A;  4KB0 A;  3C95 A;  5J1E A;  4E7L A;  4CED A;  1C0U A;  1ZBU A;  3NH2 A;  3KK2 A;  1BIS A;  1WAF A;  2O4I A;  4OPJ A;  2G8W A;  4YNQ A;  3SJJ A;  3QES A;  2Q3S A;  3MXI A;  2YKN A;  4JLH A;  3NF8 A;  4DLG A;  1RDD A;  3V1O A;  4DU3 A;  3TR8 A;  3VQC A;  5FDL A;  1LV5 A;  3MAQ A;  2Z1H A;  2BDP A;  3NH1 A;  1ASV A;  1TKZ A;  2FBV A;  3O3G A;  3IS9 A;  3QEI A;  3LP2 A;  4MFB A;  2XHB A;  4FJK A;  1YVU A;  2VWK A;  4CHY A;  3AO4 A;  1VSD A;  1HQE A;  4O4G A;  1F21 A;  3QIN A;  4NYN A;  4LD0 A;  1KFD A;  1RTJ A;  3OVN A;  4M3R A;  4CJE A;  3S9H A;  5HBM A;  1LW2 A;  4FJG A;  3C94 A;  3RRG A;  4Z0U A;  2YNG A;  3G0Z A;  3VQP A;  5FRN A;  4TSX A;  4DTM A;  4J2E A;  3ZSQ A;  4AHS A;  1WN7 A;  4H8K A;  4DFP A;  2ZD1 A;  1BI4 B;  4DWI A;  3NGI A;  4CES A;  1SL1 A;  4FZZ A;  3TAF A;  2VG7 A;  3B6P A;  4DQQ A;  4ID1 A;  4I2P A;  3JSM A;  2G8F A;  4NYF A;  4CEF A;  2IS3 A;  3IG1 A;  3ZT2 A;  4HVJ A;  3AO2 A;  3AVG A;  1GOC A;  4FJH A;  4B8C A;  2P5G A;  3SUP A;  3MXM A;  3OJU A;  4FJ9 A;  4KRF A;  2WON A;  3EZ5 A;  1JLB A;  2OPR A;  3O3F A;  3DOL A;  3KK1 A;  1NJX A;  4B9M A;  4IKF A;  3RMC A;  4DTX A;  5KGX A;  3M8R A;  1RBS A;  3TAN A;  5C25 A;  4RG8 A;  4CEA A;  1D8Y A;  4BAC A;  3F73 A;  3ZT1 A;  3BDP A;  1TK8 A;  1Q9X A;  4J2A A;  1UWB A;  1RTH A;  4KKO A;  4M3X A;  4CJL A;  2QKK A;  4J2B A;  1C6V A;  4O0I A;  3OY9 A;  4M3Y A;  2R7Y A;  4FCY A;  4CEQ A;  4FJL A;  4Y1D A;  1RIL A;  5C42 A;  4M3Z A;  4OKJ A;  4KTZ A;  3RTV A;  3VA0 A;  4W5R A;  4FLT A;  1BCO A;  5HRO A;  3L3V A;  5JS2 A;  3SQ0 A;  1U45 A;  1GOB A;  2HW3 A;  4CEB A;  4HUF A;  1TKT A;  1S9E A;  4E7K A;  4ZTF A;  4K8X A;  4CER A;  1XHX A;  3AVM A;  1NKB A;  1HNV A;  3AVL A;  1D9D A;  1A5W A;  4C8M A;  3L2U A;  3V9W A;  4IG0 A;  4DFJ A;  1TVR A;  4LSL A;  4O0J A;  3OYG A;  1TKD A;  4OPK A;  1N6Q A;  2F8S A;  3KJV A;  3I8D A;  3P83 D;  4OGE A;  4JS5 A;  3KLH A;  3DLH A;  4FLU A;  1S1X A;  1BQN A;  4OGC A;  4M45 A;  4ZTJ A;  3SUQ A;  4W5O A;  2KQ2 A;  4C8O A;  3A2F A;  1NJW A;  3WNE A;  4CEC A;  3ZSX A;  4Z4F A;  1S6Q A;  1TKX A;  1QSL A;  3SQ2 A;  4N5S A;  4PWD A;  4CJQ A;  4CJR A;  3SV3 A;  2I5J A;  3SQ4 A;  3QO9 A;  3RR7 A;  3V6D A;  1FKO A;  2B6A A;  1BIZ A;  1C0M A;  3L2V A;  3TAR A;  2BE2 A;  4CJF A;  5DMR A;  3VQE A;  4BWM A;  1NOY A;  4CK2 A;  2ITG A;  3RWU A;  2AJQ A;  1GOA A;  3PX4 A;  1NK5 A;  3LDS A;  2HND A;  2HHU A;  1HRH A;  1RT1 A;  2D5R A;  3C6U A;  4DF4 A;  3ZSV A;  3SPZ A;  3AVH A;  3QEP A;  3HPG A;  4IFV A;  3KLI A;  5J2Q A;  4FJX A;  4KRE A;  1RT3 A;  1VK0 A;  4CEZ A;  5DK5 A;  3AVI A;  1HYZ A;  1S1W A;  4Q0B A;  1A5X A;  4KPY A;  3HPH A;  3OYE A;  2DY4 A;  2ETJ A;  1ZBI A;  1KRP A;  3CG7 A;  2IC3 A;  3HST B;  3CFR A;  2YNH A;  4PUO A;  3VN5 A;  3OYM A;  3OYI A;  5I3U A;  4FK2 A;  2GBZ A;  1BCM A;  4GVM A;  4R5P A;  5HRN A;  1A5V A;  1WSF A;  4FLZ A;  4EZ6 A;  4PQU A;  3K2P A;  1XC9 A;  1Q8I A;  1KLN A;  1QTM A;  1U04 A;  5SZT A;  1TV6 A;  4FLV A;  2HHS A;  1X9M A;  1VSF A;  1HQU A;  1JLQ A;  5EU7 A;  4E89 A;  2WOM A;  4ZHR A;  4LSN A;  4FLX A;  1BHL A;  4LH4 A;  4CF2 A;  1JXE A;  3OS0 A;  2ZQB A;  3VQD A;  3DLG A;  1WSE A;  3NBP A;  3M8S A;  4CJW A;  4FM2 A;  2Z1G A;  1KTQ A;  1MU2 A;  1S6P A;  4RW7 A;  4HCB A;  1EX4 A;  1LW0 A;  2X78 A;  4DF8 A;  3RMD A;  3CYM A;  3TAM A;  4DTR A;  4W5N A;  3OYD A;  4DQS A;  2HVI A;  2X6S A;  3OS2 A;  2ATQ A;  3AO3 A;  4CGJ A;  2P5O A;  3LPT A;  4ELU A;  4PA1 A;  4FZX C;  2YHA A;  3RMB A;  2E6L A;  5J2M A;  4HHT A;  4DLE A;  4CIG A;  1EKE A;  2HB5 A;  4W5Q A;  4FJI A;  2QK9 A;  1VSI A;  2DFH A;  3TWH A;  2JLE A;  4DMN A;  3L2Q A;  4HUG A;  3I0S A;  4B8A B;  4DQR A;  1L3V A;  4FJN A;  1B9F A;  2B5J A;  3I0R A;  1KFS A;  4N41 A;  1RBV A;  2IAJ A;  3VQ8 A;  3PV8 A;  3F9K A;  3CM5 A;  4CGH A;  1JLF A;  3VQQ A;  3HM9 A;  2HVH A;  4DSI A;  1C1C A;  4CK1 A;  2KFZ A;  1X9S A;  3QEW A;  3OYH A;  3HYF A;  1RT2 A;  1L3S A;  3LZJ A;  4CJP A;  4BDY A;  2G8V A;  3L2W A;  5KGW A;  1QHT A;  4CGG A;  1JXB A;  3AVF A;  1G15 A;  2KZM A;  3WNH A;  4M3T A;  4I2Q A;  3VQ4 A;  1FXX A;  4FJJ A;  2XY6 A;  3VQB A;  1XHZ A;  3EYZ A;  1EET A;  4M41 A;  4AHT A;  2QXF A;  3OYL A;  1KVA A;  2ZE2 A;  1L3T A;  3DM2 A;  4OLB A;  1BQM A;  1KLM A;  1HYV A;  4FW2 A;  4ID5 A;  3HP9 A;  1J5O A;  1J54 A;  2XO7 A;  4DSL A;  3OYN A;  4DU4 A;  3LP1 A;  2IOC A;  3ZT3 A;  4XIU A;  1HJR A;  1IH7 A;  3NE6 A;  1W9H A;  3MXJ A;  4E3S A;  1U48 A;  4CGF A;  1UOC A;  1CXQ A;  2D0A A;  2FBT A;  3DI6 A;  3DYA A;  3K5M A;  4NCA A;  4M3W A;  2D0C A;  1HYS A;  1S5J A;  4FLW A;  3S3N A;  3CQ8 A;  2O4G A;  3OYK A;  4EP5 A;  4Y1C A;  4OJR A;  3TI0 A;  1IG9 A;  2HHQ A;  3VQ6 A;  1I39 A;  4PY5 A;  2FBY A;  3AVJ A;  1RT4 A;  3O4Q A;  3KD1 E;  3LP3 A;  4LY7 A;  1SUQ A;  3AA5 X;  4E1M A;  2Z1J A;  3TAP A;  1S1U A;  4F2S A;  4BE1 A;  3P5J A;  2EHG A;  3HXM A;  4AIL C;  3TAG A;  4O55 A;  4E7I A;  4KHY A;  2DFE A;  1LAW A;  4MQ3 A;  4BE2 A;  1TGO A;  4CHP A;  1ITG A;  4JRP A;  4FZY A;  2PY5 A;  3KLG A;  4OLA A;  1T03 A;  4IDK A;  3MED A;  4CGD A;  1VSK A;  3PX0 A;  3O4N A;  2E4L A;  4KHN A;  2OPQ A;  1NKE A;  4CJU A;  4W5T A;  1TK0 A;  4Z4H A;  2A1R A; 
#chains in the Genus database with same CATH topology
 1YF5 L;  3QIP A;  4RW8 A;  1D5A A;  3ASM A;  2A1S A;  1NJY A;  4DFM A;  1WUA A;  3FZM A;  3SAG A;  1YUW A;  3CHW A;  1NGB A;  4K41 A;  5C2F A;  3JYT A;  2QWR A;  5KI6 A;  2HHH K;  4M3U A;  3HK2 A;  1WSJ A;  4X65 K;  2NNW A;  4FSV A;  4IDH A;  2HMP A;  4CFA A;  1Z26 A;  4C1N K;  3LZI A;  4YFU A;  4BDP A;  2Y1I A;  4DR4 K;  1NLV A;  2A41 A;  4OKE A;  2X74 A;  5BN8 A;  4LFB K;  4BRL A;  4QAG A;  1NKC A;  4DV0 K;  4NXM K;  5ADX H;  4DKW A;  3VQA A;  4EAH D;  2KZM A;  4JKG B;  3CD6 N;  3HSC A;  3OYC A;  3CFP A;  3AVA A;  3VF6 A;  4CJ3 A;  3DLE A;  3V9U A;  4B1Y B;  3AA2 A;  1QHA A;  1W0H A;  1ZBL A;  1BO5 O;  3E9P A;  2QWP A;  5AQF A;  4X66 K;  2F8T A;  1VSE A;  4LF8 K;  5JS1 A;  4ELV A;  4CZH A;  3WEE B;  3OYA A;  1IKW A;  2FC0 A;  3H6E A;  4BRF A;  3OTO K;  3THY A;  3IAY A;  1ZC6 A;  4N76 A;  1RBR A;  4BR4 A;  1W97 L;  4FPA A;  1IKY A;  3NF7 A;  2Z1I A;  2WC9 A;  5AQY A;  1Z6R A;  4C1N I;  4LF6 K;  1RGI A;  5KRS A;  1NGA A;  2QWL A;  4A62 A;  4E1N A;  3RR8 A;  1FKP A;  1LWF A;  5AQS A;  1IKX A;  3AV9 A;  3HL8 A;  2O8D B;  4JKD A;  1NWK A;  1S1T A;  2F9W A;  1NGI A;  2CH5 A;  3Q7C A;  4CJV A;  3O9Q A;  2IDO A;  4KHS A;  2HNY A;  4DTO A;  4ICL A;  3DXK B;  1WSH A;  2KW4 A;  3U3G A;  4CBX A;  4YOX A;  4NB4 A;  4DTJ A;  4DFK A;  4JEP A;  4B9U A;  1D9F A;  3KWI A;  2QM1 A;  3SPY A;  3ATU A;  2H3G X;  4DR5 K;  1U49 A;  1Z05 A;  2WFB A;  5C24 A;  5AZI B;  4IJA A;  3VTH A;  2OPS A;  3T1H K;  1SL2 A;  3ID8 A;  4FYD A;  3M6G A;  3AVK A;  2P9U A;  3LP0 A;  3ZX3 A;  4ISE A;  3U3Y A;  3KTQ A;  3ZCM A;  1NJI O;  5AQX A;  4ELT A;  3SZ2 A;  4LF7 K;  5IWA K;  4KHQ A;  4C8K A;  5GIO A;  1W2B M;  4I9L A;  4E7H A;  3T19 A;  3G71 N;  1WBB A;  3K9J A;  4AH9 A;  3UIQ A;  5M1Q A;  1RCH A;  4DR3 K;  1IO2 A;  1E4G T;  2P9L B;  2IIR A;  3J7A P;  3LM2 A;  4DHY A;  1ATR A;  1YVN A;  3EL2 A;  1NJZ A;  2E2O A;  3QIC A;  3NF9 A;  2VWB A;  4GV9 A;  5JLF A;  3ULD A;  3CCV N;  1OKJ A;  3SCX A;  3DAW A;  4JK7 A;  3K5O A;  2EX3 A;  3P38 A;  3QIO A;  1DKG D;  4F2R A;  2ZJQ L;  3AVC A;  3ZSO A;  4F8R A;  3T3F A;  3RMA A;  3KLE A;  3KWG A;  3AVN A;  2VG6 A;  4Z4E A;  2RF2 A;  4FWK A;  3VQ5 A;  1CXU A;  1R59 O;  3WXI A;  1NNE A;  3QBX A;  4QCL A;  1T7P A;  2XY8 A;  2PBD A;  3K5L A;  4DSJ A;  1UAX A;  4FK4 A;  1SKW A;  1QVF M;  3MEG A;  5LL6 Z;  4B3M K;  2P9I A;  4KO0 A;  3LL3 A;  5LJW A;  4BR7 A;  5H1S Q;  1OVY A;  5BPN A;  2VQF K;  4E7L A;  1C0U A;  2O4I A;  1ATN A;  3WUH A;  2YKN A;  4JLH A;  4XH5 A;  3NF8 A;  4JKE A;  3VQC A;  1LV5 A;  3N4P A;  3G4S N;  3IS9 A;  3QEI A;  2VWK A;  3C65 A;  4O4G A;  1P8Z A;  4LF4 K;  2HBJ A;  3VQP A;  5FRN A;  4TSX A;  1N34 K;  4J2E A;  4WF9 L;  1BI4 B;  4DWI A;  4CES A;  4NYF A;  2NRV A;  4HVJ A;  4JKF A;  4DCH A;  4BR2 A;  2P5G A;  5BPL A;  2OPR A;  3FZH A;  3UKU B;  3RMC A;  4DTX A;  3M8R A;  4H5R A;  1ATS A;  3CC4 N;  2F9T A;  3J7Y P;  3BDP A;  4J2A A;  1RTH A;  4CJL A;  4IO8 A;  4J2B A;  4WQ5 C;  4O0I A;  4FCY A;  4CEQ A;  4JKB A;  4Y1D A;  4FLT A;  2FSJ A;  4CVN E;  3L3V A;  5JS2 A;  2HW3 A;  4ZTF A;  4K8X A;  3C6A A;  3O9R A;  4KH4 A;  1YIT N;  1XHX A;  2YHX A;  3AVM A;  2HBK A;  3L2U A;  3VGM A;  1O13 A;  1RDW X;  4DFJ A;  2YJF A;  5KQD A;  3SAF A;  4IEE A;  2F8S A;  3P83 D;  4JS5 A;  3DLH A;  4M45 A;  4ZTJ A;  3SUQ A;  3A2F A;  4ILJ A;  3ZSX A;  2HOE A;  3ID6 A;  3TTC A;  1TKX A;  4DUY K;  5AQP A;  4CJQ A;  4B9Q A;  3RR7 A;  4YHH K;  2ZF5 O;  2ZGY A;  2GWK A;  5GAE P;  2O8C A;  1C0M A;  3TAR A;  4K25 A;  4B1U B;  3DXM A;  4H03 B;  2IVN A;  4NO7 A;  1GOA A;  3PX4 A;  2AJQ A;  3ZEU A;  5M1O A;  4JI5 K;  4IFV A;  3D2F B;  3KLI A;  5J2Q A;  4FJX A;  1VK0 A;  4BRO A;  3AVI A;  3WXM B;  1HYZ A;  1VQM N;  4Q0B A;  1A5X A;  3OYE A;  4XH4 A;  4GKJ K;  2ETJ A;  5AQU A;  4PUO A;  3CFR A;  2YNH A;  2VCP A;  1EQY A;  2QWQ A;  4FWS A;  1BCM A;  2VQE K;  3A8Y A;  1WSF A;  4WFB L;  4PQU A;  3J80 O;  4GNI A;  1Q8I A;  1U04 A;  5SZT A;  4JI0 K;  1HQU A;  4HWI A;  4E89 A;  2E1Y A;  2FLO A;  4JKH A;  3EO3 A;  1YAG A;  4LH4 A;  4CF2 A;  5EVZ A;  2ZQB A;  3OS0 A;  3DLG A;  3J81 O;  3NBP A;  4FM2 A;  1EX4 A;  4DF8 A;  2Q1N A;  1XNQ K;  2HF3 A;  2V7Z A;  2VGN A;  2HVI A;  2X6S A;  2ATQ A;  3AO3 A;  2YHA A;  2A5X A;  3MCA B;  4FJI A;  2DFH A;  5M1P A;  5AQL A;  4FJN A;  1NM1 A;  1JCG A;  2IVO A;  1N33 K;  4N41 A;  3E9O A;  3CM5 A;  1JLF A;  3VQQ A;  1YJW N;  1X9S A;  2UUA K;  4IEI A;  5KGW A;  1QHT A;  2D1K A;  3AVF A;  3WNH A;  4BRE A;  4I2Q A;  4GV6 A;  3VQ4 A;  4FJJ A;  2XY6 A;  3EYZ A;  4EFH A;  2QXF A;  3OYL A;  2ZE2 A;  4HTL A;  4FW2 A;  5EXW A;  3CC7 N;  3W0L A;  1CZA N;  1HJR A;  3BZK A;  4E3S A;  4CD3 A;  3FZK A;  3O4W A;  3DI6 A;  1S5J A;  4JI8 K;  2Q0U A;  3SLC A;  2ASO A;  4OJR A;  2A42 A;  4BGB A;  3AVJ A;  1RT4 A;  2ASM A;  4DV3 K;  3LP3 A;  1SUQ A;  4E1M A;  5LY3 A;  3T7Z A;  1YJN N;  1OH5 A;  1S1U A;  3T69 A;  4CBW A;  4BE1 A;  4F2S A;  4KHY A;  4BE2 A;  5HL7 L;  1J5E K;  5LMU K;  4OLA A;  3R1X A;  4IDK A;  4CGD A;  1VSK A;  3R3L A;  1NGJ A;  3K9K A;  4CZJ A;  4CJU A;  1TK0 A;  4Z4H A;  3THX A;  1JJ2 M;  2OZM A;  2HBM A;  3LAN A;  4FVM A;  4RW4 A;  4RCH A;  2W41 A;  2QWM A;  2WUS A;  1SQK A;  1C0T A;  3D45 A;  1HX1 A;  2P9P B;  5C10 A;  4B9V A;  2Q31 A;  2P9K B;  3NCI A;  2LSN A;  3CPW M;  1T8E A;  4OVL A;  4OPH A;  1GLC G;  1NGD A;  2DTU A;  1H1V A;  1BDG A;  4IZ9 A;  4I9Q A;  1QQC A;  3LAM A;  4QS9 A;  3AO1 A;  1WSG A;  2F96 A;  4Y0W A;  3VEO A;  4EP4 A;  3E66 A;  1LAV A;  4CZG A;  1VSL A;  3D2F A;  5HP1 A;  4FW1 A;  5D3G A;  1YJ9 N;  5EY4 A;  1XQS C;  4B9T A;  1JKH A;  4EIA A;  3IFR A;  3ALY A;  2D4W A;  3GOI A;  2PYL A;  1BL3 A;  3ZX2 A;  1RT6 A;  1HKB A;  4Z4G A;  3H1Q A;  4IOA L;  1BIU A;  4JI2 K;  4M42 A;  1MDU B;  3CM6 A;  5AZJ A;  3K59 A;  2JWL A;  2BH1 A;  3K58 A;  1T44 A;  3QLH A;  3TTF A;  1BA1 A;  2CGK A;  4KI6 A;  2G8H A;  4F4K A;  4KHU A;  1DTT A;  4H4O A;  4E1J A;  1I3A A;  3V1Q A;  4FWR A;  3F2K A;  3KK3 A;  5TKW A;  3TSU A;  3UB5 A;  1LWC A;  5A2Q O;  3MN9 A;  4NLB A;  2OA8 A;  2IGI A;  1CZ9 A;  3BF1 A;  1ZBH A;  2V7Y A;  2XRI A;  2FF3 B;  4O44 A;  3THV A;  2E2P A;  3DOK A;  4JRQ A;  5CZ2 A;  1BOT O;  4BQZ A;  3ZSR A;  2CGJ A;  4DQI A;  4CZE A;  5SWM A;  2W6L A;  4KTW A;  3CI5 A;  2KZZ A;  4CFB A;  3SAH A;  1ASW A;  1V4S A;  1HNZ K;  4O8U A;  4B1V A;  4DSK A;  1KCF A;  4A61 A;  1WAJ A;  5AQO A;  1JLC A;  1HMV A;  1C1A A;  1RDC A;  3QEX A;  1S72 N;  2UXD K;  1ZBF A;  2RPI A;  3NH0 A;  4DTN A;  4YDU A;  4KBO A;  3D0P A;  4BVO A;  4CBU A;  5FPD A;  1SS6 A;  3SQ1 A;  2E20 A;  3TPQ A;  1QVG M;  3LPU A;  2E6M A;  4HCC A;  1QQM A;  4CEE A;  4KHP K;  3B6O A;  3ZSZ A;  4G1Q A;  3ULE B;  4H4M A;  4KI4 A;  2QXL A;  2HF4 A;  4MLE A;  2WTU A;  2KFN A;  2XY7 A;  3C7N A;  2D0B A;  2P9K A;  1UA0 A;  1P90 A;  4FM1 A;  3M8P A;  4JK8 A;  4CF1 A;  4YOV A;  2XY5 A;  2P9N B;  2PYJ A;  2QWN A;  1L3U A;  3MEC A;  3RRH A;  1FW6 A;  4K0K K;  4FJM A;  2BTF A;  4Z4I A;  5HRS A;  1RFQ A;  3V1R A;  3OYJ A;  3A5L C;  4DTS A;  4EZ9 A;  2YX6 A;  3DMJ A;  3SUO A;  3CET A;  3CXC M;  4DSF A;  1NU0 A;  3HVR A;  3BZC A;  1VRU A;  2Q2R A;  4JHD A;  1OH8 A;  1TL1 A;  1K73 O;  4DSE A;  4BGA A;  3S3O A;  4FJ8 A;  2KHO A;  3UKR A;  1E3M A;  5GIP A;  5EOY A;  5AQZ A;  3TU5 A;  3HJF A;  1KD1 O;  5BRF A;  3OW2 M;  5KPT A;  1VQ5 N;  1GLD G;  2Q0R A;  3VPZ A;  5J2P A;  1XWL A;  1QS4 A;  4DG1 A;  4CFC A;  3PLA A;  2Q36 A;  4BDZ A;  5DM6 L;  5KPR A;  1TAQ A;  4WE1 A;  3N4Q A;  3BEX A;  2Y1J A;  3LWL A;  3MX5 A;  3ZSY A;  3TTD A;  5FRO A;  4RTF D;  2QTD A;  1S1V A;  5BRE A;  3DLB A;  5FRM A;  1G99 A;  1JL1 A;  1NGE A;  1WSI A;  2GEL A;  4BRK A;  3IRX A;  3I8B A;  3C95 A;  4CED A;  5IT9 O;  1ZBU A;  3QB0 A;  4MO4 A;  4YOU A;  3SJJ A;  2Q3S A;  1V4T A;  4DU3 A;  3ZET A;  4BG9 A;  2E2Q A;  3VEW A;  2Z1H A;  4BR0 A;  1KC8 O;  2FBV A;  4MDB A;  3D6R A;  4FJK A;  4LD0 A;  2O8B B;  4NYN A;  1RTJ A;  4M3R A;  4FJG A;  1LW2 A;  4WQ4 C;  1OVQ A;  4Z0U A;  2YNG A;  3G0Z A;  3P4I A;  3CER A;  1EWR A;  1NGG A;  3NGI A;  3BP8 A;  3G6E N;  4FZZ A;  3VES A;  4CZK A;  4ID1 A;  1HJO A;  4JI6 K;  4CEF A;  4JKA A;  1QQO A;  4YY3 K;  3AVG A;  4A57 A;  5BR9 A;  2UXB K;  3SUP A;  2PAV A;  1QZ6 A;  2WON A;  4FO0 A;  4JI1 K;  3DOL A;  3KK1 A;  4DQ8 A;  1NJX A;  1T6C A;  5C25 A;  3UE5 A;  3WXK A;  4CD1 A;  2NRT A;  2OAN A;  1Q9X A;  1FJG K;  1UWB A;  4KKO A;  3THW B;  2QKK A;  1C6V A;  5ADX A;  4M3Y A;  4YOR A;  1RIL A;  4M3Z A;  4KTZ A;  3QFP A;  4W5R A;  3JS6 A;  3SQ0 A;  4HUF A;  4E7K A;  1S9E A;  4CER A;  3CJC A;  3LDQ A;  1HNV A;  4C8M A;  2E5L K;  4IG0 A;  1TVR A;  3HTV A;  5AQJ A;  1N6Q A;  3KJV A;  3I8D A;  1S1X A;  3BY5 A;  4W5O A;  1VQ7 N;  1N8R O;  4JD2 B;  3P31 A;  4N5S A;  5MLC Q;  4CJR A;  2VYP A;  2I5J A;  2E1Z A;  1U6Z A;  3V6D A;  1FKO A;  2B6A A;  3R6M A;  2BE2 A;  4EHU A;  2I7N A;  3EE9 A;  5TKY A;  4WCE L;  1SZ2 A;  3LDS A;  3CMA N;  1YIJ N;  1HRH A;  1RT1 A;  5JVG L;  3FLC O;  5BR8 K;  1Q18 A;  1IG8 A;  4JKG A;  2BUP A;  1HUX A;  3VER A;  4BRG A;  1KXP A;  3VN5 A;  5I3U A;  4GVM A;  4R5P A;  3TSQ A;  5HRN A;  1A5V A;  4FLZ A;  4EZ6 A;  3K2P A;  3IMX A;  3WXJ A;  5BN9 A;  4FLV A;  3OA9 A;  1JLQ A;  5EU7 A;  4H0V B;  4ZHR A;  3CJ9 A;  3WEE A;  1ZBS A;  3NVK A;  3H3O B;  3VQD A;  2QI2 A;  1DGK N;  2X78 A;  1LW0 A;  3VEN A;  3RMD A;  3MN6 A;  1MWM A;  3CF5 L;  3ENB A;  3CJ7 A;  3OYD A;  4DQS A;  3OS2 A;  4CGJ A;  2E88 A;  1IJJ A;  4ELU A;  3GBT A;  4PA1 A;  2ASP A;  3RMB A;  4GVE A;  1OH7 A;  4DLE A;  4W5Q A;  1EKE A;  2HB5 A;  3TWH A;  1BWF O;  4HUG A;  1B9F A;  3M1F A;  2O8D A;  3PV8 A;  1XNR K;  4BC4 A;  2KLA A;  4CK1 A;  1L3S A;  3LZJ A;  3SBT A;  1HR0 K;  3PIP L;  3L2W A;  4CGG A;  2NRH A;  4M3T A;  3DXK A;  1FXX A;  4IJN A;  2NZT A;  1XHZ A;  3VQB A;  4DUZ K;  1L3T A;  3DM2 A;  4OLB A;  4NLC A;  1BQM A;  1KLM A;  4BY9 C;  1HYV A;  4GKK K;  3AY9 A;  3QDK A;  2DPN A;  2XO7 A;  3VGK A;  2IOC A;  3ZT3 A;  4XIU A;  3NE6 A;  3MXJ A;  2HST A;  4M63 C;  5AZI A;  1HYS A;  2O4G A;  1XUP O;  3S41 A;  4U67 L;  3THW A;  4C23 A;  4PY5 A;  1QZ5 A;  3O4Q A;  3KD1 E;  3EZW A;  4BRM A;  2EHG A;  4FOI A;  4MQ3 A;  4B3R K;  1SAZ A;  3JAM O;  2PY5 A;  3KZB A;  3DJC A;  3O4N A;  4KHN A;  1NKE A;  1D4X A;  4DR2 K;  4W5T A;  3OYN A;  2OZS A;  4IWV A;  2FXU A;  1NK8 A;  1W7A A;  3TAE A;  1U2V B;  5M1N A;  3NDK A;  4WYB A;  5E26 A;  3O6W A;  1XMO K;  4JD2 A;  5AQM A;  2P9L A;  3LDN A;  1KAZ A;  1X1P A;  1ZXO A;  4B3S K;  4K8Z A;  4JNE A;  3P1G A;  1BG3 A;  1DTQ A;  1VQN N;  4BRA A;  2G8K A;  3NHG A;  3L2R A;  1JL2 A;  4L8R B;  3MWP A;  1ZYQ A;  4A2B A;  4E7J A;  4CHQ A;  3O08 A;  2FF6 A;  4AHR A;  1BGX T;  3PSI A;  3U6F A;  3OS1 A;  4DS4 A;  2GTD A;  5CYM A;  3E01 A;  3ZLJ A;  5JVH L;  5C0Y A;  3AAP A;  3D7E O;  3SYZ A;  3ZSW A;  1RTD A;  4FWO A;  1B92 A;  5AFU H;  5HLF A;  1N32 K;  2HHX A;  4QOZ B;  4UQG A;  1HKG A;  4BRQ A;  2P9S B;  3LAL A;  1TYQ B;  3QNO A;  5AQN A;  1N36 K;  1JLA A;  1M1K O;  1TAU A;  5GAD P;  2ZM6 K;  2W40 A;  1HPZ A;  4B9N A;  1Q7Y O;  1K8K B;  1HNW K;  5I42 A;  3D2E B;  4PKG A;  4CGI A;  4J8F A;  5KTQ A;  4BE0 A;  4QS7 A;  1LOT B;  4CE9 A;  1Z25 A;  4JAX A;  4I6M B;  4ISG A;  3KKR A;  4CF8 A;  5AQQ A;  5BRD A;  1ILY A;  4BRI A;  1RT7 A;  1VHX A;  3F9M A;  1BI4 A;  3F5T A;  4AM7 A;  3ENO A;  4O5F A;  4CCH A;  3OYF A;  2HHU A;  4RWT A;  1S3X A;  3HP6 A;  1KSP A;  1J53 A;  4DR7 K;  4DQP A;  4CJ5 A;  4I7F A;  4B3T K;  3MMV A;  1YTU A;  4IO9 L;  4C8N A;  1FK9 A;  1QSS A;  4CHN A;  3HPO A;  3ZT4 A;  4DV6 K;  4JS4 A;  3V9S A;  4G9Z A;  3KKS A;  3UKU A;  3NF6 A;  5CZ1 A;  1VQP N;  1VQ8 N;  1GLL O;  2OYQ A;  3QML A;  3U9D A;  4CFD A;  2J4R A;  3O80 A;  1NK7 A;  4BRC A;  4MO5 A;  4JI7 K;  2FBX A;  4RW9 A;  1CLQ A;  1R0A A;  5K14 A;  5CYQ A;  1VAZ A;  1B9D A;  2YHY A;  1NMD A;  4DV5 K;  4CHO A;  1RTI A;  2YI1 A;  3R9P A;  1KVB A;  5C12 A;  3FFK B;  3DLR A;  3NFA A;  3CIP A;  3PSF A;  5JMV A;  3A5O C;  4BRN A;  1EXQ A;  1QQN A;  3TSP A;  2X6N A;  5AFU A;  4HUE A;  1VQO N;  3CPE A;  1TL3 A;  3CFO A;  4B9L A;  2V52 B;  3ENH A;  4K43 A;  3AO5 A;  4FVU A;  1S9G A;  4XH1 A;  3R8E A;  5FPM A;  3PUF A;  3C0B A;  1JCE A;  5AQW A;  4B1Z A;  3PO5 A;  1RBT A;  3LM9 A;  4CK3 A;  3JXU A;  3P39 A;  4M7Y A;  3CCL N;  2RN2 A;  1TUU A;  1IKV A;  3AA3 A;  3K5N A;  4FOE A;  3EY1 A;  3DRS A;  2OCE A;  3I55 N;  1N5Y A;  2O8F B;  4MDA A;  3WXL A;  4GW6 A;  4B1W B;  1X9J A;  1VRT A;  4CJK A;  3O9S A;  1RDU A;  2KKZ A;  3M8Q A;  3PY8 A;  4CJS A;  3DLK A;  4IOX A;  4YOY A;  3SMP A;  3KD5 E;  4F3O A;  3O1B A;  2G8U A;  5GAH P;  4OKK A;  3CJB A;  3EEQ A;  3OJS A;  3HM8 A;  3U8X A;  4AF1 A;  4FM0 A;  2QEX N;  2WBN A;  1JLG A;  1GLJ O;  1RDA A;  3M3Z A;  4KV8 A;  1K8K A;  4FJ7 A;  3SUN A;  2OPP A;  3I33 A;  3G10 A;  2OTJ N;  3TAB A;  2HHT A;  5CHI A;  3GDQ A;  5LJV A;  3NH2 A;  1BIS A;  4OPJ A;  3RSE B;  3QES A;  3MXI A;  1IBM K;  4DLG A;  3V1O A;  3TR8 A;  3MAQ A;  4KH5 A;  1ASV A;  1TKZ A;  5JIC A;  3LP2 A;  4PL7 A;  4CHY A;  3AO4 A;  3EKU A;  1VSD A;  1F21 A;  1KFD A;  5AQK A;  3LDL A;  3THY B;  3C94 A;  3RRG A;  2FSN A;  3ZSQ A;  4AHS A;  4H8K A;  4CZL A;  4DFP A;  2ZD1 A;  3KK7 A;  2A3Z A;  2RHK A;  5C15 A;  5AQT A;  4DQQ A;  1KQS M;  4I2P A;  5AJ3 K;  3JSM A;  2G8F A;  3IG1 A;  3ZT2 A;  3CCQ N;  4OX9 K;  3J8A A;  4JKC A;  4FJ9 A;  4KRF A;  4MLH A;  3WQU A;  4EHT A;  4B9M A;  4IKF A;  4A5B A;  3HRG A;  1D8Y A;  4RG8 A;  4CEA A;  3ATV A;  4BAC A;  1TK8 A;  2VGM A;  4M3X A;  3OY9 A;  4FJL A;  4OKJ A;  3RTV A;  5M1K A;  1BCO A;  5HRO A;  1U45 A;  4CEB A;  5BRH A;  2UU9 K;  1GLB G;  2P9P A;  2Q97 A;  1NKB A;  3AVL A;  1D9D A;  1A5W A;  5FPN A;  2YJE A;  2UYT A;  2P9U B;  4LSL A;  3MDQ A;  4OPK A;  3ZYY X;  3KLH A;  1BQN A;  2KQ2 A;  1NJW A;  3FGU A;  3WNE A;  4CEC A;  1JCF A;  3IUC A;  4Z4F A;  4PWD A;  1QSL A;  3SQ2 A;  3EKS A;  5AR0 A;  3SQ4 A;  3QO9 A;  4BG8 A;  4DR6 K;  3L2V A;  2O8F A;  4CJF A;  1NOY A;  4BWM A;  4CK2 A;  3RWU A;  5LMN K;  2CH6 A;  2HND A;  5KQ8 A;  2D5R A;  3SPZ A;  3B8A X;  3HPG A;  1S22 A;  4CEZ A;  1NG9 A;  3U4L A;  1S1W A;  3VET A;  3HPH A;  4GV3 A;  3VMF B;  1ZBI A;  1BA0 A;  3OHR A;  2IC3 A;  3HST B;  1M90 O;  3OYI A;  4FK2 A;  1XMQ K;  1KAX A;  1XC9 A;  4BR9 A;  5FLX O;  4LFA K;  1TV6 A;  2HHS A;  1VSF A;  3J7Z O;  2WOM A;  4LSN A;  3U9Z A;  4Z94 A;  1JXE A;  3KVG A;  2Z1G A;  1KTQ A;  1MU2 A;  3FZF A;  1S6P A;  4RW7 A;  3E9L A;  4BC3 A;  1YI2 N;  3RSE A;  2P5O A;  3LPT A;  4FZX C;  4UY8 O;  2E6L A;  2P9I B;  4JYA K;  4JV5 K;  1VSI A;  1J6Z A;  3I0S A;  1L3V A;  2B5J A;  3I0R A;  1KFS A;  3VQ8 A;  3F9K A;  1K8A O;  3HOS A;  4CGH A;  2HVH A;  2KFZ A;  1XC3 A;  3VF2 A;  3OYH A;  3SK3 A;  4BDY A;  4IOC L;  3H1V X;  4DV7 K;  1G15 A;  4JI3 K;  4B1X B;  4IFE A;  1EET A;  4M41 A;  3WT0 A;  1VQK N;  1KVA A;  4DV2 K;  4WQ4 A;  4ID5 A;  4DSL A;  4DU4 A;  3LP1 A;  4WFA L;  1U48 A;  5I9E B;  1T6D A;  1CXQ A;  1UOC A;  2FBT A;  1YHQ N;  4NCA A;  2O8E B;  4FWP A;  4M3W A;  3ZX0 A;  3OYK A;  1IG9 A;  4Y1C A;  2HHQ A;  3ULE A;  4F9O A;  2FBY A;  1C0F A;  4LY7 A;  3TAP A;  4LF9 K;  3VEZ A;  4OPA A;  3OBW A;  3HXM A;  3TAG A;  4O55 A;  3K0S A;  4E7I A;  1LAW A;  1TGO A;  4JRP A;  4FZY A;  4BQL A;  3KLG A;  3SBG A;  3MED A;  4LC9 B;  3PX0 A;  2E4L A;  2GEM A;  4U7B A;  4FJH A;  5HOO A;  3ISN C;  3NVM A;  4KHW A;  1ESV A;  4NCG A;  4CF9 A;  2P9N A;  1L5U A;  1Y97 A;  4QS8 A;  3A5M C;  1VSM A;  3SI6 A;  4X62 K;  4FJ5 A;  2QKB A;  5T7B A;  3VF4 A;  1NGH A;  3VEX A;  3K57 A;  3V4I A;  1K6Y A;  1VSJ A;  3BUZ B;  3WNF A;  1VSH A;  2GV9 A;  3KHY A;  1XI1 A;  2QW9 A;  4FXD A;  3DRP A;  3AAR A;  2VG5 A;  4FK0 A;  1NBW A;  1U4B A;  3V9Z A;  4AHC A;  3TAQ A;  2O8C B;  3CCJ N;  2FSK A;  2HHW A;  5EX5 A;  1JLE A;  2GUP A;  3DXM B;  2HNZ A;  1QSY A;  3ZEU B;  4H5N A;  3CCM N;  4OO1 J;  2RKI A;  2B4J A;  2RE2 A;  3O9U A;  4KTQ A;  4F3T A;  2BAN A;  3EN9 A;  5AQV A;  2YNI A;  4O5B A;  1NOZ A;  3H45 C;  4AHU A;  4FWM A;  1RT5 A;  4BVP A;  1YTA A;  3ZT0 A;  4GY2 B;  5F1X A;  1VQ4 N;  4A5A A;  2JWK A;  3I56 N;  3LDO A;  3FE1 A;  2A6A A;  3MWT A;  3VQ9 A;  3L8B A;  5GIN A;  1I94 K;  3FFI A;  5CY4 A;  3HOT A;  1TUY A;  1KAY A;  3CJ1 A;  3H46 O;  3O1W A;  4GMJ B;  5KRT A;  1SKS A;  2UXC K;  2AA4 A;  5E41 A;  3O3H A;  1SL0 A;  1BUP A;  4CZF A;  3CCR N;  1WLJ A;  4FLY A;  1X3M A;  3DRR A;  4E0D A;  1RNH A;  4DS5 A;  3QET A;  3MN7 A;  2GUI A;  3NMU A;  1NK6 A;  3DLL L;  2O8B A;  2YCH A;  4CJ7 A;  3S3M A;  4H0X B;  4E19 A;  2F7T A;  4BWJ A;  3VQ7 A;  4DB3 A;  1X3N A;  2NLX A;  4B3O A;  3H08 A;  1O1W A;  3OYB A;  1IBK K;  4IFY A;  4YOT A;  3KIO A;  3PX6 A;  5BPM A;  3V81 A;  2P1J A;  4B08 A;  2HBL A;  4KFB A;  5HRP A;  1RDB A;  4CJ4 A;  4PHT X;  3L4I A;  1Q81 O;  1EP4 A;  4FWN A;  1C1B A;  1IV0 A;  1DLO A;  3LAK A;  1OH6 A;  4CF0 A;  5ELZ A;  2KTQ A;  3CME N;  4DTU A;  4CIF A;  2JGU A;  4DV4 K;  4IBN A;  4KB1 A;  4CEO A;  2CGL A;  1T05 A;  3QER A;  1NK0 A;  4LH5 A;  3QEV A;  3NGY A;  2O8E A;  3AVB A;  3RVC A;  3LWM A;  3CQY A;  3AA4 A;  4DTP A;  2YHB A;  2NRR A;  5AQR A;  2UUB K;  1NK9 A;  1HNI A;  4JI4 K;  4AHV A;  3QNN A;  4CJT A;  3T1A A;  4PKI A;  3VTI A;  1REV A;  4R79 A;  4FWL A;  2DFF A;  3EE8 A;  3KLF A;  4BRD A;  2BGG A;  2NRW A;  4WQ5 A;  3BF3 A;  3PO4 A;  1WOQ A;  2A40 A;  2G8I A;  2NUB A;  3HI0 A;  3SNN A;  3OBY A;  4Z4C A;  2YV0 X;  4KH6 A;  4HTU A;  4WFN L;  3WNG A;  4CZM A;  3HBT A;  1QE1 A;  1YT3 A;  4X64 K;  4PL8 A;  3THX B;  3O9T A;  1X9W A;  3C6T A;  3L0Q A;  4H5T A;  4RW6 A;  5CR4 A;  1TK5 A;  3MEE A;  5E84 A;  2W6K A;  1U47 A;  4CI6 A;  3HO1 A;  2W42 A;  3T1Y K;  4N47 A;  3HT3 A;  4L3Q A;  1UA1 A;  4CW7 B;  5J2N A;  1HLU A;  3MK6 A;  4KAZ A;  4DR1 K;  1RBU A;  2YNF A;  3A0I X;  1KVC A;  4CHZ A;  3V9X A;  1NK4 A;  4Q5V A;  2VWJ A;  3FZL A;  3VA3 A;  3BGR A;  3CJA A;  3ITH A;  4BC5 A;  4DV1 K;  2P51 A;  1K9M O;  4N56 A;  1J9A A;  4CIE A;  4B9S A;  2NRZ A;  3SV4 A;  2HMI A;  1GLF O;  1LWE A;  4C8L A;  2YKM A;  4DU1 A;  5DM7 L;  1SV5 A;  3NGZ A;  1CZB A;  3L3U A;  4J2D A;  4H0O A;  1T3V A;  3HVT A;  4IG3 A;  1WBD A;  1EWQ A;  1WNS A;  1SKR A;  2EWS A;  2D0O A;  1E4F T;  4AQY K;  5AZJ B;  5HRR A;  3DWL A;  2PZS A;  3CC2 N;  3WQT A;  3SJH A;  1Q9Y A;  4NCB A;  1NGF A;  2HHV A;  1ASU A;  3NAE A;  4KB0 A;  5J1E A;  3A5N C;  1YXQ A;  3MCP A;  3KK2 A;  1WAF A;  2G8W A;  4YNQ A;  1WB9 A;  4O8K A;  3W3D A;  1NMN A;  1RDD A;  5B8H A;  1Q82 O;  4YOW A;  5FDL A;  2BDP A;  3NH1 A;  3O3G A;  4JN4 A;  4MFB A;  2XHB A;  3SMS A;  1DT9 A;  1YVU A;  4BRP A;  1HQE A;  4CJE A;  3QIN A;  3G25 A;  3S9H A;  3OVN A;  5HBM A;  4DTM A;  1WN7 A;  3VEV A;  2ZJP L;  5AQG A;  1SL1 A;  1VQ9 N;  3AAQ A;  3TAF A;  2VG7 A;  3B6P A;  2GX9 A;  1Y64 A;  3GG4 A;  2IS3 A;  1MWK A;  5M1F A;  3C6H A;  4LF5 K;  3AO2 A;  1VQL N;  2YHW A;  1GOC A;  4B8C A;  3MXM A;  3OJU A;  4CZI A;  3CCE N;  3EZ5 A;  1JLB A;  3FR0 A;  3O3F A;  5F0X A;  2ZJR L;  3QBW A;  4JK9 A;  3TAN A;  5KGX A;  1RBS A;  1C0G A;  4IXC A;  3ZT1 A;  3F73 A;  4AM6 A;  3PIO L;  2R7Y A;  5C42 A;  4K42 A;  3CCU N;  2V51 B;  2I7P A;  3VA0 A;  3GE1 A;  3IDH A;  1GOB A;  1U2V A;  1TKT A;  4H0T B;  5FPE A;  2QA4 N;  3V9W A;  4NXN K;  4O0J A;  3OYG A;  5F2R A;  1TKD A;  1GLA G;  4H0P A;  3AGK A;  5C2D A;  1VQ6 N;  4OGE A;  4FLU A;  4OGC A;  4C8O A;  2E8A A;  1S6Q A;  4FWQ A;  3C7N B;  3SV3 A;  3CCS N;  1BIZ A;  4BRH A;  5DMR A;  3VQE A;  2ITG A;  3E1Y A;  1NK5 A;  2AP1 A;  4DF4 A;  3C6U A;  3ZSV A;  4A59 A;  3AVH A;  4H5W A;  3QEP A;  4KRE A;  2OTL N;  1RT3 A;  1HKC A;  5DK5 A;  4XEI A;  4KPY A;  2ZWH A;  2DY4 A;  4H5V A;  1KRP A;  3CG7 A;  2P9S A;  3CQX A;  1TYQ A;  3OYM A;  2GBZ A;  3Q7B A;  2UUC K;  2IVP A;  1HPM A;  4JHD B;  1KLN A;  1QTM A;  2GWJ A;  3O5B A;  3O8M A;  3UKR B;  4H0Y B;  3VGL A;  5JLH A;  1X9M A;  4FLX A;  3D2E A;  1BHL A;  3M8S A;  1WSE A;  4CJW A;  4FPB A;  3AGR A;  4ISF A;  4HCB A;  4I6M A;  3CYM A;  3TAM A;  4DTR A;  2PFU A;  3HZ6 A;  4W5N A;  3IKM A;  4BR5 A;  5J2M A;  4HHT A;  4ILG B;  4CIG A;  2QK9 A;  3QFU A;  3VOV A;  2JLE A;  4DMN A;  3L2Q A;  4DQR A;  2ITM A;  4B8A B;  2NRX A;  3VEY A;  1RBV A;  2IAJ A;  3ZET B;  1Q86 O;  3HM9 A;  4DSI A;  1C1C A;  3QEW A;  3HYF A;  1RT2 A;  4M7X A;  4CJP A;  2G8V A;  2QWO A;  2ZGZ A;  1JXB A;  3LDP A;  3M5R A;  3GL1 A;  5CE3 A;  2E2N A;  4AHT A;  3MN5 A;  4BC2 A;  4YDU C;  1GLE G;  3HP9 A;  4LFC K;  1J5O A;  1J54 A;  1IH7 A;  1LCU A;  1W9H A;  4FL9 A;  4A2A A;  1MA9 B;  4V19 S;  1EO1 A;  4CGF A;  2D0A A;  3DYA A;  3K5M A;  3MX2 A;  2D0C A;  4FLW A;  3S3N A;  3CQ8 A;  5GAG P;  4EP5 A;  3TI0 A;  3VQ6 A;  1I39 A;  3H3N O;  5AQI A;  4ILH A;  3L4Q A;  3AA5 X;  4PKH A;  1BU6 O;  2Z1J A;  2D0P A;  1DEJ A;  3P5J A;  2F4V K;  4AIL C;  2DFE A;  4CHP A;  1HNX K;  1ITG A;  1T03 A;  5AQH A;  1IBL K;  3L6Q A;  2OPQ A;  5KPZ A;  1NGC A;  2A1R A; 
#chains in the Genus database with same CATH homology
 3QIP A;  3LAN A;  4FVM A;  3ISN C;  4RW8 A;  4RW4 A;  1NK8 A;  2OZS A;  4KHW A;  4NCG A;  1D5A A;  3ASM A;  4CF9 A;  2A1S A;  3TAE A;  1NJY A;  4DFM A;  1L5U A;  1Y97 A;  3NDK A;  4FJ5 A;  1C0T A;  1VSM A;  3D45 A;  3SI6 A;  2QKB A;  4B9V A;  5T7B A;  3NCI A;  3K57 A;  3V4I A;  1K6Y A;  1X1P A;  2LSN A;  1T8E A;  4OVL A;  1VSJ A;  4K8Z A;  3JYT A;  3WNF A;  5KI6 A;  1VSH A;  2GV9 A;  3P1G A;  4M3U A;  2DTU A;  3HK2 A;  1XI1 A;  1DTQ A;  1WSJ A;  4FXD A;  4I9Q A;  1QQC A;  3LAM A;  2G8K A;  3DRP A;  3AO1 A;  1WSG A;  3L2R A;  2VG5 A;  3NHG A;  1JL2 A;  2F96 A;  4CFA A;  1Z26 A;  4L8R B;  4FK0 A;  3LZI A;  4YFU A;  1ZYQ A;  1U4B A;  4BDP A;  2Y1I A;  4EP4 A;  3V9Z A;  1LAV A;  4AHC A;  4CHQ A;  1VSL A;  4E7J A;  5HP1 A;  4FW1 A;  5D3G A;  3TAQ A;  4OKE A;  2X74 A;  4AHR A;  4B9T A;  2HHW A;  1JKH A;  1JLE A;  1BGX T;  3U6F A;  4QAG A;  3OS1 A;  3ALY A;  1NKC A;  2HNZ A;  1QSY A;  4DS4 A;  5CYM A;  3E01 A;  2RKI A;  1BL3 A;  2PYL A;  3VQA A;  2B4J A;  3SYZ A;  3ZSW A;  1RT6 A;  1RTD A;  4KTQ A;  4F3T A;  4Z4G A;  2BAN A;  1B92 A;  4O5B A;  2YNI A;  1BIU A;  5HLF A;  3OYC A;  1NOZ A;  4AHU A;  4M42 A;  3CM6 A;  1RT5 A;  3CFP A;  3AVA A;  1YTA A;  3ZT0 A;  2HHX A;  3K59 A;  3K58 A;  4QOZ B;  4UQG A;  3QLH A;  4CJ3 A;  3VQ9 A;  3DLE A;  3L8B A;  3LAL A;  3V9U A;  3FFI A;  5CY4 A;  3AA2 A;  3QNO A;  1W0H A;  4KI6 A;  1ZBL A;  2G8H A;  4F4K A;  1JLA A;  4KHU A;  1DTT A;  4GMJ B;  4H4O A;  5KRT A;  1I3A A;  1SKS A;  1TAU A;  2F8T A;  1VSE A;  1HPZ A;  4B9N A;  3V1Q A;  5E41 A;  3O3H A;  1SL0 A;  5JS1 A;  3KK3 A;  4ELV A;  5I42 A;  1LWC A;  1WLJ A;  4FLY A;  3DRR A;  4E0D A;  1RNH A;  4DS5 A;  3QET A;  4CGI A;  3OYA A;  4BE0 A;  5KTQ A;  2GUI A;  4CE9 A;  2OA8 A;  1Z25 A;  1NK6 A;  1IKW A;  1CZ9 A;  2IGI A;  3S3M A;  3KKR A;  2FC0 A;  1ZBH A;  2XRI A;  4CF8 A;  3IAY A;  4E19 A;  4N76 A;  4BWJ A;  4O44 A;  1RBR A;  3VQ7 A;  3THV A;  3DOK A;  4B3O A;  1RT7 A;  3H08 A;  1O1W A;  1IKY A;  4JRQ A;  3NF7 A;  1BI4 A;  5CZ2 A;  3OYB A;  4IFY A;  2Z1I A;  3KIO A;  3PX6 A;  3V81 A;  2P1J A;  5KRS A;  4CCH A;  4B08 A;  4E1N A;  4KFB A;  3OYF A;  3RR8 A;  3ZSR A;  5HRP A;  1FKP A;  1RDB A;  4CJ4 A;  3HP6 A;  1LWF A;  1KSP A;  1IKX A;  1J53 A;  1EP4 A;  3AV9 A;  4DQI A;  1C1B A;  4DQP A;  3HL8 A;  5SWM A;  4CJ5 A;  4I7F A;  4KTW A;  1DLO A;  3LAK A;  4CFB A;  2KZZ A;  1ASW A;  1YTU A;  1S1T A;  4CF0 A;  2KTQ A;  4DSK A;  4C8N A;  1FK9 A;  1QSS A;  1KCF A;  4CHN A;  4DTU A;  3HPO A;  3ZT4 A;  2JGU A;  4CIF A;  4IBN A;  4JS4 A;  1WAJ A;  4CJV A;  2IDO A;  3V9S A;  1JLC A;  4KB1 A;  4KHS A;  2HNY A;  1HMV A;  3KKS A;  4CEO A;  4DTO A;  1C1A A;  1RDC A;  3NF6 A;  4ICL A;  5CZ1 A;  3QEX A;  1T05 A;  1WSH A;  3QER A;  2KW4 A;  3U3G A;  1NK0 A;  2OYQ A;  4LH5 A;  4CFD A;  1NK7 A;  3QEV A;  3NGY A;  3AVB A;  4DTJ A;  4DFK A;  2FBX A;  1ZBF A;  3LWM A;  2RPI A;  4B9U A;  3AA4 A;  4RW9 A;  4DTP A;  2YHB A;  3NH0 A;  4DTN A;  1D9F A;  1R0A A;  1CLQ A;  3D0P A;  1NK9 A;  5K14 A;  1HNI A;  5CYQ A;  3SPY A;  1B9D A;  4AHV A;  3QNN A;  3SQ1 A;  4CHO A;  4CJT A;  1U49 A;  3T1A A;  1RTI A;  5C24 A;  1KVB A;  1REV A;  3LPU A;  2E6M A;  4HCC A;  2DFF A;  4CEE A;  2OPS A;  3KLF A;  3DLR A;  3B6O A;  3NFA A;  3ZSZ A;  1SL2 A;  4G1Q A;  2BGG A;  4FYD A;  3AVK A;  4H4M A;  4KI4 A;  3PO4 A;  3LP0 A;  2G8I A;  3U3Y A;  2NUB A;  3KTQ A;  1EXQ A;  3SNN A;  3ZCM A;  4ELT A;  4HUE A;  2X6N A;  4Z4C A;  2YV0 X;  1TL3 A;  3CFO A;  4B9L A;  3AO5 A;  4HTU A;  3SZ2 A;  1S9G A;  3WNG A;  2KFN A;  2XY7 A;  4KHQ A;  3PUF A;  2D0B A;  1UA0 A;  4C8K A;  1QE1 A;  1YT3 A;  4FM1 A;  3M8P A;  4I9L A;  3PO5 A;  4E7H A;  1RBT A;  3T19 A;  4CK3 A;  1X9W A;  3C6T A;  4CF1 A;  2RN2 A;  4RW6 A;  4AH9 A;  3UIQ A;  2XY5 A;  1IKV A;  1TK5 A;  2PYJ A;  3AA3 A;  3MEE A;  3K5N A;  3MEC A;  3EY1 A;  3RRH A;  1U47 A;  1L3U A;  3HO1 A;  3DRS A;  1RCH A;  2W42 A;  4N47 A;  3HT3 A;  1IO2 A;  1UA1 A;  1N5Y A;  4FJM A;  4Z4I A;  5HRS A;  2OZM A;  5J2N A;  3V1R A;  3OYJ A;  4KAZ A;  4DTS A;  4EZ9 A;  4GW6 A;  1NJZ A;  1RBU A;  2YNF A;  1VRT A;  3DMJ A;  3NF9 A;  1KVC A;  4CHZ A;  4CJK A;  3V9X A;  3SUO A;  1NK4 A;  3ULD A;  4DSF A;  4Q5V A;  2VWJ A;  3SCX A;  3VA3 A;  3BGR A;  2EX3 A;  3K5O A;  3QIO A;  3HVR A;  4F2R A;  3ITH A;  3AVC A;  2P51 A;  3M8Q A;  3ZSO A;  4N56 A;  3T3F A;  3KLE A;  1VRU A;  3RMA A;  3PY8 A;  4F8R A;  1TL1 A;  4DSE A;  1J9A A;  4CJS A;  3AVN A;  3DLK A;  4CIE A;  2VG6 A;  3S3O A;  4B9S A;  4FJ8 A;  2RF2 A;  4Z4E A;  3SV4 A;  2HMI A;  3VQ5 A;  1CXU A;  3KD5 E;  4F3O A;  3HJF A;  1LWE A;  4C8L A;  2YKM A;  4DU1 A;  5J2P A;  4QCL A;  1XWL A;  1T7P A;  1SV5 A;  1QS4 A;  4DG1 A;  3NGZ A;  1CZB A;  2XY8 A;  3L3U A;  2G8U A;  4OKK A;  4CFC A;  4J2D A;  3HVT A;  4IG3 A;  3K5L A;  4BDZ A;  1UAX A;  1WNS A;  1SKR A;  4DSJ A;  1SKW A;  4FK4 A;  1TAQ A;  4WE1 A;  2Y1J A;  3OJS A;  3LWL A;  4FM0 A;  3ZSY A;  1JLG A;  1RDA A;  4KV8 A;  5FRO A;  3MEG A;  5HRR A;  4FJ7 A;  3SUN A;  1S1V A;  2OPP A;  3G10 A;  2PZS A;  4KO0 A;  1Q9Y A;  4NCB A;  3DLB A;  3TAB A;  5FRM A;  1WSI A;  1JL1 A;  1ASU A;  2HHV A;  3IRX A;  2HHT A;  3NAE A;  4KB0 A;  3C95 A;  5J1E A;  4E7L A;  4CED A;  1C0U A;  1ZBU A;  3NH2 A;  3KK2 A;  1BIS A;  1WAF A;  2O4I A;  4OPJ A;  2G8W A;  4YNQ A;  3SJJ A;  3QES A;  2Q3S A;  3MXI A;  2YKN A;  4JLH A;  3NF8 A;  4DLG A;  1RDD A;  3V1O A;  4DU3 A;  3TR8 A;  3VQC A;  5FDL A;  1LV5 A;  3MAQ A;  2Z1H A;  2BDP A;  3NH1 A;  1ASV A;  1TKZ A;  2FBV A;  3O3G A;  3IS9 A;  3QEI A;  3LP2 A;  4MFB A;  2XHB A;  4FJK A;  1YVU A;  2VWK A;  4CHY A;  3AO4 A;  1VSD A;  1HQE A;  4O4G A;  1F21 A;  3QIN A;  4NYN A;  4LD0 A;  1KFD A;  1RTJ A;  3OVN A;  4M3R A;  4CJE A;  3S9H A;  5HBM A;  1LW2 A;  4FJG A;  3C94 A;  3RRG A;  4Z0U A;  2YNG A;  3G0Z A;  3VQP A;  5FRN A;  4TSX A;  4DTM A;  4J2E A;  3ZSQ A;  4AHS A;  1WN7 A;  4H8K A;  4DFP A;  2ZD1 A;  1BI4 B;  4DWI A;  3NGI A;  4CES A;  1SL1 A;  4FZZ A;  3TAF A;  2VG7 A;  3B6P A;  4DQQ A;  4ID1 A;  4I2P A;  3JSM A;  2G8F A;  4NYF A;  4CEF A;  2IS3 A;  3IG1 A;  3ZT2 A;  4HVJ A;  3AO2 A;  3AVG A;  1GOC A;  4FJH A;  4B8C A;  2P5G A;  3SUP A;  3MXM A;  3OJU A;  4FJ9 A;  4KRF A;  2WON A;  3EZ5 A;  1JLB A;  2OPR A;  3O3F A;  3DOL A;  3KK1 A;  1NJX A;  4B9M A;  4IKF A;  3RMC A;  4DTX A;  5KGX A;  3M8R A;  1RBS A;  3TAN A;  5C25 A;  4RG8 A;  4CEA A;  1D8Y A;  4BAC A;  3F73 A;  3ZT1 A;  3BDP A;  1TK8 A;  1Q9X A;  4J2A A;  1UWB A;  1RTH A;  4KKO A;  4M3X A;  4CJL A;  2QKK A;  4J2B A;  1C6V A;  4O0I A;  3OY9 A;  4M3Y A;  2R7Y A;  4FCY A;  4CEQ A;  4FJL A;  4Y1D A;  1RIL A;  5C42 A;  4M3Z A;  4OKJ A;  4KTZ A;  3RTV A;  3VA0 A;  4W5R A;  4FLT A;  1BCO A;  5HRO A;  3L3V A;  5JS2 A;  3SQ0 A;  1U45 A;  1GOB A;  2HW3 A;  4CEB A;  4HUF A;  1TKT A;  1S9E A;  4E7K A;  4ZTF A;  4K8X A;  4CER A;  1XHX A;  3AVM A;  1NKB A;  1HNV A;  3AVL A;  1D9D A;  1A5W A;  4C8M A;  3L2U A;  3V9W A;  4IG0 A;  4DFJ A;  1TVR A;  4LSL A;  4O0J A;  3OYG A;  1TKD A;  4OPK A;  1N6Q A;  2F8S A;  3KJV A;  3I8D A;  3P83 D;  4OGE A;  4JS5 A;  3KLH A;  3DLH A;  4FLU A;  1S1X A;  1BQN A;  4OGC A;  4M45 A;  4ZTJ A;  3SUQ A;  4W5O A;  2KQ2 A;  4C8O A;  3A2F A;  1NJW A;  3WNE A;  4CEC A;  3ZSX A;  4Z4F A;  1S6Q A;  1TKX A;  1QSL A;  3SQ2 A;  4N5S A;  4PWD A;  4CJQ A;  4CJR A;  3SV3 A;  2I5J A;  3SQ4 A;  3QO9 A;  3RR7 A;  3V6D A;  1FKO A;  2B6A A;  1BIZ A;  1C0M A;  3L2V A;  3TAR A;  2BE2 A;  4CJF A;  5DMR A;  3VQE A;  4BWM A;  1NOY A;  4CK2 A;  2ITG A;  3RWU A;  2AJQ A;  1GOA A;  3PX4 A;  1NK5 A;  3LDS A;  2HND A;  2HHU A;  1HRH A;  1RT1 A;  2D5R A;  3C6U A;  4DF4 A;  3ZSV A;  3SPZ A;  3AVH A;  3QEP A;  3HPG A;  4IFV A;  3KLI A;  5J2Q A;  4FJX A;  4KRE A;  1RT3 A;  1VK0 A;  4CEZ A;  5DK5 A;  3AVI A;  1HYZ A;  1S1W A;  4Q0B A;  1A5X A;  4KPY A;  3HPH A;  3OYE A;  2DY4 A;  2ETJ A;  1ZBI A;  1KRP A;  3CG7 A;  2IC3 A;  3HST B;  3CFR A;  2YNH A;  4PUO A;  3VN5 A;  3OYM A;  3OYI A;  5I3U A;  4FK2 A;  2GBZ A;  1BCM A;  4GVM A;  4R5P A;  5HRN A;  1A5V A;  1WSF A;  4FLZ A;  4EZ6 A;  4PQU A;  3K2P A;  1XC9 A;  1Q8I A;  1KLN A;  1QTM A;  1U04 A;  5SZT A;  1TV6 A;  4FLV A;  2HHS A;  1X9M A;  1VSF A;  1HQU A;  1JLQ A;  5EU7 A;  4E89 A;  2WOM A;  4ZHR A;  4LSN A;  4FLX A;  1BHL A;  4LH4 A;  4CF2 A;  1JXE A;  3OS0 A;  2ZQB A;  3VQD A;  3DLG A;  1WSE A;  3NBP A;  3M8S A;  4CJW A;  4FM2 A;  2Z1G A;  1KTQ A;  1MU2 A;  1S6P A;  4RW7 A;  4HCB A;  1EX4 A;  1LW0 A;  2X78 A;  4DF8 A;  3RMD A;  3CYM A;  3TAM A;  4DTR A;  4W5N A;  3OYD A;  4DQS A;  2HVI A;  2X6S A;  3OS2 A;  2ATQ A;  3AO3 A;  4CGJ A;  2P5O A;  3LPT A;  4ELU A;  4PA1 A;  4FZX C;  2YHA A;  3RMB A;  2E6L A;  5J2M A;  4HHT A;  4DLE A;  4CIG A;  1EKE A;  2HB5 A;  4W5Q A;  4FJI A;  2QK9 A;  1VSI A;  2DFH A;  3TWH A;  2JLE A;  4DMN A;  3L2Q A;  4HUG A;  3I0S A;  4B8A B;  4DQR A;  1L3V A;  4FJN A;  1B9F A;  2B5J A;  3I0R A;  1KFS A;  4N41 A;  1RBV A;  2IAJ A;  3VQ8 A;  3PV8 A;  3F9K A;  3CM5 A;  4CGH A;  1JLF A;  3VQQ A;  3HM9 A;  2HVH A;  4DSI A;  1C1C A;  4CK1 A;  2KFZ A;  1X9S A;  3QEW A;  3OYH A;  3HYF A;  1RT2 A;  1L3S A;  3LZJ A;  4CJP A;  4BDY A;  2G8V A;  3L2W A;  5KGW A;  1QHT A;  4CGG A;  1JXB A;  3AVF A;  1G15 A;  2KZM A;  3WNH A;  4M3T A;  4I2Q A;  3VQ4 A;  1FXX A;  4FJJ A;  2XY6 A;  3VQB A;  1XHZ A;  3EYZ A;  1EET A;  4M41 A;  4AHT A;  2QXF A;  3OYL A;  1KVA A;  2ZE2 A;  1L3T A;  3DM2 A;  4OLB A;  1BQM A;  1KLM A;  1HYV A;  4FW2 A;  4ID5 A;  3HP9 A;  1J5O A;  1J54 A;  2XO7 A;  4DSL A;  3OYN A;  4DU4 A;  3LP1 A;  2IOC A;  3ZT3 A;  4XIU A;  1HJR A;  1IH7 A;  3NE6 A;  1W9H A;  3MXJ A;  4E3S A;  1U48 A;  4CGF A;  1UOC A;  1CXQ A;  2D0A A;  2FBT A;  3DI6 A;  3DYA A;  3K5M A;  4NCA A;  4M3W A;  2D0C A;  1HYS A;  1S5J A;  4FLW A;  3S3N A;  3CQ8 A;  2O4G A;  3OYK A;  4EP5 A;  4Y1C A;  4OJR A;  3TI0 A;  1IG9 A;  2HHQ A;  3VQ6 A;  1I39 A;  4PY5 A;  2FBY A;  3AVJ A;  1RT4 A;  3O4Q A;  3KD1 E;  3LP3 A;  4LY7 A;  1SUQ A;  3AA5 X;  4E1M A;  2Z1J A;  3TAP A;  1S1U A;  4F2S A;  4BE1 A;  3P5J A;  2EHG A;  3HXM A;  4AIL C;  3TAG A;  4O55 A;  4E7I A;  4KHY A;  2DFE A;  1LAW A;  4MQ3 A;  4BE2 A;  1TGO A;  4CHP A;  1ITG A;  4JRP A;  4FZY A;  2PY5 A;  3KLG A;  4OLA A;  1T03 A;  4IDK A;  3MED A;  4CGD A;  1VSK A;  3PX0 A;  3O4N A;  2E4L A;  4KHN A;  2OPQ A;  1NKE A;  4CJU A;  4W5T A;  1TK0 A;  4Z4H A;  2A1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...