2X6NA

Human foamy virus integrase - catalytic core. manganese-bound structure.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
188
structure length
188
Chain Sequence
b'PQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Viral protein
source organism Human spumaretrovirus
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
total genus 60
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x6nA00
4CEZA 5J2NA 5CYQA 3NF6A 4CGGA 2P5GA 3DRRA 1JXBA 3IG1A 4CGIA 4M3YA 2B5JA 4E3SA 4O0JA 3K59A 4KO0A 1RDBA 3MXJA 5HP1A 4FLYA 4BWJA 3OYGA 1NK4A 2IAJA 3L3VA 1CLQA 4RW4A 3ZSZA 4HUFA 5DMRA 4E1NA 4NCAA 3DOKA 4NYNA 3AVAA 1L3TA 1L3UA 1YVUA 2GBZA 3NF9A 3TAEA 4FK0A 1TKDA 4CF8A 4CFBA 1Q9YA 3OJUA 2F96A 3SPZA 3O3GA 5CYMA 2VG7A 1JKHA 3HT3A 3EZ5A 3OYKA 3V9SA 1X9MA 3DLBA 4OVLA 4W5QA 4UQGA 1NK7A 3DRSA 4AHTA 5D3GA 1TL3A 1VSMA 4OPJA 3DI6A 1B9DA 3OVNA 5C25A 4O0IA 1GOAA 1SKWA 4FJKA 4DWIA 3V1QA 3K5OA 3WNGA 2G8HA 1QS4A 1WAJA 2HW3A 1K6YA 3S9HA 1ZBLA 4AH9A 3OYMA 2Y1JA 1L3VA 3HVTA 3QETA 1RBVA 2E4LA 4IFYA 4B9NA 4C8LA 2XY6A 3KLHA 3OY9A 1RDDA 4DG1A 1X1PA 2QXFA 3V9XA 3K58A 1RTDA 4QOZB 3NH0A 1YTAA 3I0SA 4FLVA 1ZYQA 2HHXA 2YKNA 4RW6A 4DTRA 1VSDA 4MQ3A 1I3AA 2DFHA 3AO4A 2IGIA 1TKZA 4FJMA 1D5AA 3DYAA 2ITGA 2F8TA 5SZTA 1A5XA 1J9AA 4J2BA 4CHZA 4B9TA 3ZSOA 1B9FA 4N5SA 4FLTA 3KK3A 1KRPA 4F2RA 1LWFA 1LW2A 2WONA 1WSGA 3E01A 3KIOA 3OYIA 3S3OA 4EZ6A 4DTNA 4CJPA 4DF8A 3OS0A 1ZBUA 4AHUA 3T3FA 5I42A 3O3FA 3HL8A 4E1MA 3DM2A 4FM1A 3DLRA 4CEOA 1ZBHA 4DTUA 3AO2A 3ASMA 3AVMA 3QEWA 4CJWA 1S1TA 3MAQA 1RDCA 3ISNC 1HQUA 4OKKA 3NHGA 3LPTA 2YNIA 4N41A 1SL1A 2E6MA 3LP2A 5KTQA 5I3UA 1ITGA 1JLFA 4B8AB 4CJEA 4ELVA 4FJXA 4F2SA 3ZT3A 1TK0A 4B9LA 4F8RA 4AHVA 3RMAA 2OZMA 4CFCA 4XIUA 3QEVA 1RT2A 4MFBA 3NF7A 1W9HA 3JYTA 3LAMA 4DTPA 2YKMA 4CJSA 1VRTA 1EX4A 4DTMA 4F3TA 1JLCA 4DQIA 4IFVA 1L3SA 3B6PA 4O44A 1VSJA 4CJQA 3ZSWA 4CEBA 4OGEA 3TAFA 2OZSA 3NF8A 1R0AA 4E7KA 2OA8A 1CZBA 1A5VA 1DTQA 2ATQA 4YNQA 3QNOA 1XHZA 1NJWA 4OJRA 4W5OA 2KQ2A 1RTIA 5EU7A 5J2PA 1HYVA 4DFJA 1IG9A 1EXQA 4OLBA 1VSHA 5HRNA 1LV5A 3EY1A 1VSFA 4B9MA 1NOZA 2XY7A 5C42A 1S1XA 3PX4A 3TABA 5FRMA 4Z4FA 4DU1A 3C95A 4DLEA 4DQPA 2QKBA 2HHVA 2Y1IA 3BDPA 4Q5VA 1U4BA 1TGOA 1VSKA 4PUOA 5CY4A 3ZSXA 1F21A 1VSIA 4M3TA 2D0BA 1EP4A 3MEEA 4Y1DA 1SKRA 3UIQA 1JLAA 2Z1JA 4FJGA 3VQ9A 4KREA 3PY8A 4IG0A 1UOCA 3V81A 4KHNA 3CYMA 4FK2A 1RT4A 3LP1A 3QINA 1QTMA 3I0RA 1XC9A 4IG3A 2X74A 4FJ9A 4CJVA 1S6PA 3VQPA 1Y97A 1SV5A 1XWLA 1L5UA 1JLEA 3TWHA 5HROA 3TAPA 1WSJA 1T8EA 3MXIA 2FBYA 1KCFA 3G10A 4DSJA 3NDKA 3ZCMA 3VN5A 1RBSA 4RW9A 3QIOA 4CEAA 1REVA 3OYFA 3AA3A 2DFFA 5FROA 3AO5A 3VQAA 4EP4A 5KGXA 3SQ0A 1EKEA 4W5RA 3AVLA 4GVMA 2P1JA 2IOCA 1D8YA 4KV8A 4B3OA 2LSNA 1RT6A 4DTOA 1KLMA 4JLHA 1NKCA 3K2PA 4L8RB 1XHXA 2EX3A 2NUBA 3NBPA 4FLWA 3TANA 1FKOA 1FKPA 4I2QA 2BANA 3NFAA 3CFOA 4KTZA 3L2RA 1QSLA 4B9SA 2KFNA 3VQ4A 2HNZA 1IO2A 2RF2A 4E7LA 4BACA 4O4GA 1BQNA 2JGUA 2RN2A 4FJIA 4CHPA 2G8IA 2XO7A 2FC0A 1BI4B 2GV9A 3VQ6A 3C6UA 5T7BA 3G0ZA 3LWLA 4RW7A 4BDZA 4DS4A 4DSKA 4FZXC 4LH5A 3HJFA 4W5TA 3SUPA 4ID5A 3OYEA 3TAGA 3ZSYA 3P1GA 3B6OA 3AV9A 3NH1A 4HUGA 1S1UA 4QAGA 3ZSQA 3NE6A 3AA4A 1DTTA 1S9EA 4N56A 1A5WA 1KVAA 3ZT1A 3A2FA 1GOCA 1N6QA 4FJ8A 3SUOA 2B4JA 5CZ2A 4Z4IA 3QIPA 4N47A 3M8SA 1U45A 4KHSA 3LWMA 3SYZA 4DLGA 4OKEA 1J5OA 4I9QA 1QSSA 1HNIA 3LALA 4KHQA 3ULDA 4CJUA 1IKWA 4CEEA 3OYLA 2WOMA 4R5PA 1RT1A 3V9WA 4KHWA 1RT7A 3QESA 1NJYA 3RRHA 4B08A 3L3UA 4H4MA 1IH7A 5SWMA 4FLUA 2W42A 2Z1IA 3H08A 4Z4HA 1KLNA 2OPSA 2VWJA 3CM6A 2P51A 3QEPA 3THVA 4E7JA 1JL1A 1ZBFA 3L8BA 1WNSA 4FJJA 4W5NA 3AO3A 5HBMA 3C6TA 3OYBA 1Q8IA 4CESA 4YFUA 4BDPA 4I9LA 2PZSA 2IDOA 1HPZA 1C0MA 4CHQA 1JLGA 2X78A 5J2MA 3SQ1A 1WSIA 1RNHA 3LAKA 3NGZA 4FLXA 4DTXA 1S1VA 3PO4A 4HCBA 4KHYA 5C24A 1NK9A 1SL2A 4PQUA 4KB0A 4FJHA 4KB1A 4KHUA 1BL3A 4DU4A 4BE1A 4M45A 3DLHA 2ETJA 1RCHA 2XY5A 4OKJA 1HYSA 4FK4A 1O1WA 1NJXA 1KFDA 3HXMA 3DOLA 4BE2A 2FBXA 1NK8A 2VG5A 3HPHA 2BE2A 3VA0A 2G8FA 1YTUA 4HVJA 3QERA 3QO9A 3DRPA 1WN7A 3U3GA 4E0DA 3RR7A 2YNGA 4CF1A 4DF4A 1I39A 3SPYA 4CHNA 4DTJA 1SUQA 1BCOA 1RBUA 4N76A 4LH4A 1T7PA 3MECA 5HRPA 5HLFA 1T03A 4AHRA 4CGHA 4IKFA 3SUQA 1U49A 2G8WA 3S3MA 4FJ5A 4CJKA 4HTUA 4RW8A 4CFAA 3V9UA 3SV3A 1WSEA 4J2DA 3VQ7A 1C6VA 3AVFA 1KFSA 3LP0A 3HPOA 4CFDA 3RMBA 1NK6A 1QE1A 4CEFA 3D0PA 4DU3A 4DFKA 3TARA 3KTQA 2IC3A 2HHWA 4QCLA 2VWKA 3KKSA 3PO5A 4CJRA 2HHQA 5FRNA 2XY8A 4FW2A 1JL2A 1NJZA 4CJ4A 4KTWA 1NKEA 1TKTA 1DLOA 1HJRA 3OS1A 3AVBA 4KI6A 1CZ9A 2XHBA 3K5LA 1S5JA 2XRIA 3OYCA 1RT5A 1U48A 3ZSRA 3VQBA 1U04A 4NCGA 1HYZA 2D0AA 4LD0A 4CECA 3U3YA 4Z4CA 1TVRA 3DLGA 2PY5A 3PX0A 1HQEA 4FW1A 4CCHA 4J2AA 4OLAA 3AO1A 4E19A 3KLFA 4AILC 2HHSA 4CHYA 3NGIA 4LY7A 1TV6A 3VQEA 2HVHA 1JXEA 4IDKA 2KTQA 3KKRA 2HNDA 2DFEA 4DFPA 1WAFA 3OJSA 3I8DA 4DQRA 3TI0A 1NOYA 1UA0A 3KK2A 4ID1A 3WNEA 1VSLA 4KTQA 4KPYA 5J2QA 1ASWA 4RG8A 1Z25A 5JS1A 2QKKA 4ZHRA 1RBRA 1WLJA 1NK5A 4GMJB 3L2UA 3RMCA 2A1RA 2QK9A 2KW4A 3OYNA 4FM0A 2Z1HA 4CEDA 4DSEA 3SQ4A 3PUFA 5HRRA 1TK8A 3AVJA 4I7FA 4CF2A 1QSYA 4FCYA 4KRFA 1BGXT 4CK1A 4C8NA 3HPGA 2RPIA 2VG6A 4EP5A 4K8XA 3QLHA 4E7HA 1U47A 4FJ7A 3V9ZA 1FXXA 2RKIA 4LSLA 1BCMA 2OPRA 3CFRA 2HVIA 2OPQA 1TL1A 2R7YA 3IS9A 1WSFA 5J1EA 3KK1A 4DS5A 3SNNA 1C1BA 3NH2A 1T05A 1SL0A 2G8KA 1QQCA 4H8KA 4PY5A 3ZT0A 3M8QA 1J53A 4DSIA 2EHGA 3D45A 1S6QA 4Y1CA 4KKOA 4AHCA 3CM5A 4B9VA 3QEIA 1HNVA 1S1WA 4BE0A 5KRTA 3V1OA 1HRHA 4Z4GA 4H4OA 5E41A 3CFPA 3ZT4A 4J2EA 3OYHA 3DMJA 1LWEA 1VRUA 3AVNA 5KRSA 4M3ZA 4CGDA 1BQMA 2BGGA 3U6FA 2HB5A 3RR8A 1LAVA 2Q3SA 3TAQA 4CJLA 3OS2A 2YV0X 3AVGA 1JLBA 4E89A 1C0TA 3F9KA 3M8RA 1FK9A 3KJVA 4JRPA 3O4QA 3SUNA 3OYDA 1X9WA 4FZYA 3IRXA 3HVRA 3LZIA 1Q9XA 3VA3A 1IKYA 3F73A 2Z1GA 4Z0UA 5JS2A 2A1SA 1NKBA 1C1AA 3AVCA 1ASVA 3KLIA 4CJ3A 2I5JA 2KFZA 3AVIA 3RTVA 4B8CA 4ZTFA 2OYQA 2X6SA 1LW0A 3OYAA 1ZBIA 3SZ2A 5KI6A 4M3WA 1VK0A 1RBTA 3SJJA 4IBNA 4TSXA 2ZQBA 4NYFA 4ELTA 1D9FA 3L2WA 2HMIA 3RWUA 5K14A 1LWCA 1TKXA 1BIUA 2ZE2A 3HP9A 1BI4A 3VQDA 4C8MA 4CERA 3NCIA 4C8KA 3VQ5A 2AJQA 2DY4A 1B92A 4ZTJA 3KLGA 4FJNA 2G8UA 2ZD1A 3PV8A 4ELUA 1G15A 4CEQA 1KSPA 4GW6A 3SV4A 3HYFA 4PA1A 3MXMA 4DQSA 3T1AA 3HO1A 2HHTA 1BISA 5CZ1A 4I2PA 4CE9A 4JS5A 3V4IA 3V6DA 4CK2A 2E6LA 4BDYA 2PYJA 5FDLA 2PYLA 4PWDA 2DTUA 3WNHA 1SKSA 3TR8A 4Z4EA 4WE1A 3VQCA 3KD5E 2O4IA 2KZZA 4FZZA 3ZSVA 1C0UA 1WSHA 2IS3A 2JLEA 4F3OA 2OPPA 3O3HA 2HNYA 3C94A 3T19A 4FYDA 2YHBA 2FBVA 3VQQA 1UAXA 4O55A 4FJLA 1VSEA 4JRQA 3HK2A 4Q0BA 1GOBA 1UWBA 3KD1E 4DSLA 3MEGA 1TK5A 4FM2A 2X6NA 4HCCA 3BGRA 4M3RA 3CQ8A 4CJ5A 4OPKA 3SQ2A 3DLKA 1S9GA 3LPUA 3VQ8A 4CIFA 1KVBA 2YNFA 3ALYA 1LAWA 3TAMA 3S3NA 1D9DA 4NCBA 3V1RA 4CGJA 5HRSA 3K5MA 4DFMA 3P83D 4ICLA 3O4NA 3AVKA 2YNHA 4E7IA 4DSFA 4HHTA 4AHSA 1TAQA 5DK5A 3LANA 4M41A 4B9UA 4C8OA 1RT3A 1UA1A 4CK3A 3L2QA 4KAZA 1RTHA 1J54A 4FVMA 3RMDA 4FXDA 3M8PA 3EYZA 1YT3A 3IAYA 1MU2A 4HUEA 2KZMA 3L2VA 3AA2A 4DQQA 3AVHA 3JSMA 3HP6A 3K57A 4KFBA 1BIZA 4CIEA 2P5OA 3SCXA 4CIGA 1XI1A 1Z26A 4DMNA 3OYJA 3WNFA 2F8SA 2O4GA 3RRGA 1CXUA 3HSTB 3LP3A 4CJFA 4JS4A 4CF0A 3NAEA 1W0HA 4K8ZA 4CF9A 4O5BA 3PX6A 4EZ9A 1C1CA 1KVCA 4OGCA 3FFIA 3P5JA 3K5NA 3LZJA 1CXQA 3ITHA 3QEXA 4M3XA 4CHOA 3QNNA 5KGWA 4M42A 1BHLA 3LDSA 4KI4A 1RILA 1TAUA 3HM9A 1JLQA 1ASUA 1EETA 1RTJA 4DTSA 3DLEA 1X9SA 4F4KA 2B6AA 4CGFA 4M3UA 2FBTA 2GUIA 4BWMA 4CJTA 3MEDA 4FLZA 3NGYA 1KTQA 1IKVA 1HMVA 1IKXA 1RDAA 2G8VA 2YHAA 3AA5X 2D0CA 3SI6A 2D5RA 4LSNA 1NK0A 2BDPA 1N5YA 4G1QA 3ZT2A 3KLEA 1QHTA 3CG7A 2HHUA
chains in the Genus database with same CATH superfamily
5J2NA 3NF6A 4CGGA 3SBGA 4CGIA 4KO0A 1CZAN 4BWJA 1NK4A 4DHYA 4C1NK 4GY2B 3ZSZA 4NLCA 4HUFA 3UE5A 1W2BM 3AVAA 4X64K 2GBZA 1BOTO 4FK0A 1Q81O 4CFBA 3SPZA 5GAGP 5CYMA 3EZ5A 2GX9A 4JHDB 3UKUA 1NK7A 3QDKA 4H03B 3OVNA 3DWLA 2G8HA 4KH5A 4PL7A 1ZBLA 5F1XA 4CD1A 3SBTA 5B8HA 5JLFA 4IFYA 3T69A 3QETA 4C8LA 2RHKA 3A5MC 1RTDA 4LFCK 1YTAA 1BDGA 4FLVA 2HHXA 1IBMK 3I8BA 3QBXA 2YKNA 4RCHA 4MQ3A 3FGUA 1I3AA 4OPAA 3SK3A 1TKZA 3LDOA 3ULEB 1A5XA 4CHZA 4OPHA 4A2BA 4BRPA 3MN5A 4FLTA 1KRPA 1LWFA 3RVCA 4EZ6A 3VGKA 1VQ7N 3ENOA 3T3FA 2VYPA 3DLRA 1ZBHA 4DTUA 2E1YA 4XH5A 3E9LA 1TUUA 4JD2A 3NHGA 4CBWA 4KH4A 4EIAA 4EHTA 1JLFA 3DJCA 3CERA 3O4WA 4F2SA 3ZT3A 1GLDG 2ASOA 3TU5A 3RMAA 1XC3A 2OZMA 4CFCA 4MFBA 4DTMA 4ILJA 2FSJA 1XQSC 1VSJA 5M1PA 4FOEA 1R0AA 4E7KA 1OH8A 1U2VA 4W5OA 5EU7A 4KBOA 1HYVA 1OVQA 5HRNA 1LV5A 3HOTA 1VSFA 3EY1A 4Z4FA 5C42A 2W40A 3PX4A 4DU1A 4DQPA 2Y1IA 1K9MO 5C2FA 4X66K 3ZSXA 1F21A 1VSIA 3R3LA 3MEEA 4IG0A 1VQMN 4AM6A 3P4IA 3TTCA 4WQ5C 1XWLA 5HROA 3TAPA 1WSJA 2O8BA 3H1QA 4FWNA 3VN5A 4RW9A 1WBBA 3AA3A 4KH6A 5IT9O 4GVMA 3LDPA 1NKCA 1RT6A 4DTOA 2EX3A 3NBPA 2CGKA 1FKPA 5JICA 4B9SA 1LOTB 3WXKA 1IO2A 5C15A 4E7LA 1X3NA 3WEEA 1C0GA 4FJIA 4H0VB 2YI1A 3LWLA 3G0ZA 4DS4A 4FZXC 4LH5A 4W5TA 4ID5A 1VQLN 4LF5K 4DV6K 3P1GA 3B6OA 1NLVA 3LL3A 5LMUK 4QAGA 3NE6A 3AA4A 3MK6A 3ZETB 1A5WA 1GOCA 2B4JA 2QWMA 2NRWA 1EQYA 3SYZA 4I9QA 4B3MK 3EKSA 3E66A 2ZM6K 1HX1A 2WOMA 4CZEA 4R5PA 4ILHA 2ZJPL 4X62K 5SWMA 2W42A 3H08A 4Z4HA 2VWJA 2P51A 5AQRA 5AFUH 1NM1A 3EO3A 2PZSA 4JV5K 2IDOA 1HPZA 2FLOA 4PKIA 2X78A 5J2MA 3FZFA 3C6HA 3BP8A 4FOIA 4KHUA 4KB1A 1BL3A 4A57A 4BE1A 4DV1K 1HYSA 1NJXA 4HTLA 3ZETA 4BE2A 2VG5A 2BE2A 2IVPA 4HVJA 3JS6A 2F7TA 1WN7A 2YNGA 4H0TB 3SMSA 1I39A 4CHNA 4YHHK 4DTJA 2V51B 5AQLA 1SUQA 4LF7K 1T7PA 3MECA 5HRPA 4AHRA 2E20A 1U49A 2G8WA 5E84A 3S3MA 4CJKA 3VEOA 4BRLA 3ULEA 1ATRA 3LP0A 2ZJRL 3I33A 1JCEA 4DU3A 4DFKA 2P9UA 4JI6K 4JKCA 2HF4A 4K43A 4QCLA 3PO5A 4CJRA 4OO1J 1JCFA 2XY8A 1NJZA 4CJ4A 1TKTA 3AVBA 4GV6A 1CZ9A 2XHBA 3K5LA 1S5JA 3P39A 3ZSRA 2PY5A 1T3VA 1NU0A 5AQKA 4E19A 3VTIA 4CHYA 1KXPA 4LY7A 1TV6A 2HVHA 5BN8A 4IDKA 4WFNL 4DFPA 3OJSA 5A2QO 4DQRA 1X9JA 3E9PA 4NXMK 3CMAN 3ZX2A 4ID1A 3IFRA 4F9OA 5J2QA 4RG8A 1NK5A 3RMCA 1NGIA 4DV5K 2Z1HA 4XH1A 4I7FA 3CPEA 1QSYA 4KRFA 2VGMA 2P9SA 2CGJA 1WUAA 4E7HA 1U47A 5C12A 3V9ZA 2RKIA 5DM7L 4IOCL 2HVIA 3RSEB 2R7YA 5C0YA 2QXLA 3NH2A 1IBKK 3EE9A 4BRIA 3SLCA 3ZT0A 5AQTA 2EHGA 3D45A 4Y1CA 4AHCA 4JYAK 1HNVA 3TSUA 4JI3K 4Z4GA 1HKCA 4H4OA 5E41A 3VGLA 3AVNA 1RFQA 4JKAA 2HB5A 4JN4A 3OS2A 1C0TA 4B3RK 2E2NA 4FZYA 4JRPA 1NGCA 1X9WA 1NGEA 3O8MA 3HVRA 1OH5A 3LZIA 4U7BA 2Z1GA 5JS2A 1ZC6A 5GIPA 1NKBA 3AVCA 3KLIA 1ASVA 2A40A 4B8CA 3O9QA 2P9KA 3SZ2A 4JI8K 4BG9A 1MDUB 3RWUA 2NRTA 5K14A 3HP9A 1NMNA 3DXMB 4DR7K 1NGDA 2ZJQL 4FJNA 1KSPA 1Q7YO 3LM9A 1HR0K 3HYFA 3T1AA 1BISA 1VQ6N 4I2PA 1QVGM 4PWDA 1P8ZA 1SKSA 1GLAG 4BR5A 2KZZA 1HUXA 1QQNA 3A8YA 4F3OA 3QFPA 3C94A 4DR5K 2YHBA 2WUSA 1VSEA 4LC9B 1BO5O 3HK2A 3MEGA 2UXCK 3BGRA 1DT9A 4M3RA 1RGIA 4CJ5A 4YORA 1BU6O 2QWNA 4CIFA 1D9DA 1JCGA 3V1RA 3K5MA 3C6AA 3P83D 1W7AA 1W97L 4DSFA 3AVKA 2YNHA 3DXKA 1TAQA 4AHSA 3LANA 4M41A 3VEZA 1SQKA 4CK3A 4DV0K 3EYZA 1MU2A 4A2AA 5BRFA 3AA2A 3G6EN 2P9PA 3N4PA 3K57A 4KFBA 4BRDA 3SCXA 4CIGA 5M1NA 1Z26A 4DMNA 1TYQB 1Z6RA 3WXMB 3A5LC 2UYTA 4O5BA 5EY4A 4BGBA 3NMUA 1KVCA 3LZJA 3CC2N 3QEXA 4X65K 4A59A 1H1VA 5KGWA 1BHLA 4GV3A 3HM9A 1JLQA 1X9SA 3DLEA 4F4KA 4CGFA 5FLXO 1N34K 4M3UA 2FBTA 4FVUA 2E8AA 2GUIA 5AQFA 3H45C 4XEIA 1RDAA 2G8VA 3J7YP 2YHAA 2QWPA 2D0CA 3SI6A 2D5RA 5AQJA 3M3ZA 5BPLA 4JI4K 3FR0A 4IJAA 1QHTA 3CG7A 4FLYA 3CJCA 3THWB 4B1YB 4CEZA 3PSIA 3F2KA 2P5GA 2D0OA 3IG1A 1M1KO 4E3SA 4BRFA 3EEQA 3MXJA 4LF6K 2IAJA 1CLQA 3Q7CA 4CZIA 3DOKA 3WXJA 4NYNA 1BUPA 4CF8A 1Q9YA 3FZKA 2F96A 3OHRA 1X9MA 4OVLA 3DRSA 3DI6A 1GOAA 3V1QA 1QZ6A 1WAJA 2HW3A 1L3VA 3HVTA 3AAQA 2OANA 3FFKB 3BZKA 3KLHA 2OTLN 1RDDA 3THYB 2UUBK 2ZF5O 3I0SA 1ZYQA 4MLEA 4BRMA 4DTRA 3I56N 2ZWHA 5JVGL 1YIJN 2F8TA 1Q18A 1XMOK 3ZSOA 3D2EA 4H0XB 3R6MA 2WONA 4CBXA 4DTNA 4AHUA 3HL8A 1BA0A 3WXLA 3ZX3A 3K9KA 4ISFA 4CZLA 3QEWA 1S1TA 3SMPA 1RDCA 3ISNC 1HQUA 4BRCA 3J7ZO 3LPTA 2YNIA 1VQKN 4CZKA 2E6MA 2QWRA 5LMNK 4ELVA 1HNXK 3CI5A 3VEYA 3DXMA 1E4GT 3NF7A 3LAMA 4B3TK 4F3TA 1JLCA 3WQUA 3BUZB 4FWKA 3B6PA 4O44A 3AAPA 3F5TA 3TAFA 4OGEA 2QWLA 1I94K 2P9SB 2OA8A 1XHZA 1A5VA 3QNOA 2IVOA 4OJRA 2KQ2A 1RTIA 5J2PA 3G25A 3TABA 1S1XA 5FRMA 5FPMA 3BDPA 5DM6L 1U4BA 4DV3K 3BY5A 4FPBA 2PFUA 1SKRA 4KREA 3VQ9A 4BG8A 1YF5L 4KHNA 3LP1A 3QINA 2P9PB 1XC9A 4IG3A 3UB5A 4CJVA 1S6PA 3FZMA 3VQPA 1Y97A 1JLEA 4ILGB 3MXIA 4DSJA 4FWPA 3ZEUA 3QIOA 1REVA 3OYFA 1MWMA 3AO5A 3VQAA 3CXCM 2GWKA 1VQ8N 3U4LA 1D4XA 4KHPK 4IOXA 5TKYA 3CF5L 2IOCA 3CC4N 3PSFA 4B3OA 2LSNA 4IWVA 2NUBA 4FLWA 2UXBK 5F0XA 3QFUA 2BANA 3J80O 3CFOA 1QSLA 5F2RA 4BRKA 1C0FA 2VGNA 2E88A 5JMVA 2ASPA 1GLBG 2JGUA 2RN2A 4CHPA 2FC0A 2GV9A 3VQ6A 4BC3A 3O9UA 4RW7A 4DSKA 3HJFA 2CH6A 2FXUA 4GKKK 3OYEA 1GLEG 1S1UA 4YDUA 3ZSQA 1S9EA 3ZT1A 1KVAA 3CJ9A 3A2FA 3MN7A 1NGGA 3THWA 4Z4IA 4JKGA 5CZ2A 3M8SA 1U45A 4U67L 3J7AP 4DLGA 3LALA 3O08A 3EKUA 1IKWA 5GAEP 3R9PA 4A61A 4KHWA 1RT7A 3QESA 4B08A 1IH7A 4FLUA 3VOVA 1KC8O 4NO7A 3QEPA 3NVMA 1ZBFA 3L8BA 3C6TA 1Q8IA 1N8RO 5M1FA 2P9UB 3WEEB 1RNHA 3LAKA 3FE1A 3PO4A 4PQUA 1SS6A 4UY8O 4M45A 3T1YK 2Q0RA 4BROA 4CI6A 1S3XA 2G8FA 1YTUA 3QERA 2HSTA 4DUYK 1Y64A 1BCOA 4O8KA 4LH4A 3BEXA 3ZYYX 4BC2A 3G4SN 4GKJK 4IKFA 3SUQA 3KWGA 4JI7K 4HTUA 4FJ5A 4RW8A 3V9UA 3SV3A 3VQ7A 5H1SQ 1YI2N 1KFSA 3RMBA 3O80A 1NK6A 4CEFA 3D0PA 4ISGA 4HWIA 2YJFA 5CR4A 3KTQA 3SAHA 2IC3A 1NGFA 1WOQA 2VWKA 5AFUA 3N4QA 4V19S 5FRNA 4FW2A 1JL2A 4KTWA 2XRIA 3OYCA 4BRNA 1RT5A 4FO0A 3GBTA 1U48A 5KPTA 4J2AA 4FW1A 3AO1A 3KLFA 4YY3K 1ZXOA 2NNWA 1WAFA 3I8DA 4IJNA 1NOYA 2F9WA 1VQNN 4KPYA 1Z25A 5KQ8A 2QKKA 3L2UA 5GINA 3OYNA 4FM0A 3IUCA 3PUFA 3AVJA 4CF2A 2IVNA 2D1KA 5C10A 2RPIA 4EP5A 2GEMA 3QLHA 2HF3A 4H5TA 2O8FB 3VEVA 4WCEL 3CFRA 1TL1A 3EN9A 1WSFA 3KK1A 4B9QA 1T05A 1SL0A 1QQCA 4WQ4C 3KHYA 4PY5A 1XUPO 2YHWA 2QI2A 2Q1NA 4DSIA 1S6QA 4H5NA 3CM5A 4NLBA 4B9VA 4NB4A 5KRTA 4IEEA 1SZ2A 3BF3A 4JKHA 3CFPA 4MO4A 3ZT4A 4B1ZA 1VRUA 1XNQK 4M3ZA 1ESVA 1BQMA 4WFAL 1LAVA 2Q3SA 1NGAA 3TTDA 4RTFD 4CJLA 2V52B 3M8RA 3F9KA 3O4QA 1GLFO 3D7EO 1ILYA 2OYQA 3OYAA 3O5BA 3UKRA 1VK0A 4R79A 4NYFA 2HMIA 3CCMN 3DLLL 3VQDA 2NRVA 3VQ5A 3SAGA 2UUAK 1B92A 4ZTJA 2ZD1A 3PV8A 3IKMA 2VWBA 4H5VA 3SV4A 1QVFM 3MXMA 4BR0A 3HO1A 2HHTA 4JS5A 4CE9A 3V6DA 2DTUA 2PYJA 5AQWA 2PYLA 3QICA 1HPMA 3TR8A 2O4IA 4FZZA 2JLEA 3A0IX 3O3HA 2HNYA 1Q86O 4CZFA 3ID8A 3VQQA 1UAXA 4JRQA 1E4FT 2W41A 1GOBA 2A5XA 1UWBA 3HOSA 1T44A 5IWAK 3CQ8A 4OPKA 3SQ2A 1S9GA 3LPUA 3MDQA 1KVBA 2YNFA 3ALYA 1LAWA 3M5RA 1M90O 4NCBA 4DFMA 4CGJA 4DR4K 5GAHP 3PLAA 1N32K 1UA1A 3ENBA 4KAZA 3WXIA 3RMDA 3A5NC 4H0OA 3D2FB 2VCPA 2JWKA 4B1UB 2GWJA 2P9IA 3JSMA 3HP6A 1R59O 3OYJA 2W6LA 3WNFA 2O8EB 3RRGA 4JS4A 3HSTB 3LP3A 3VENA 2O8BB 1T6DA 1NWKA 4OGCA 3K5NA 3ATVA 3P5JA 4CHOA 1EETA 4DTSA 3BZCA 2QWQA 1YVNA 2QWOA 2Q0UA 4BWMA 4CJTA 4DR2K 4FLZA 2NRXA 5M1QA 5AQHA 3AA5X 3MX5A 4YOUA 2HHUA 5CYQA 4B1XB 4BR7A 1KAYA 1JXBA 3FLCO 4O0JA 1RDBA 4A62A 2E5LK 4DUZK 3WUHA 3AY9A 2HMPA 4E1NA 4NCAA 3VGMA 1L3UA 1YVUA 2ITMA 4A5AA 4L3QA 2A41A 4FL9A 1X3MA 5AQMA 3OYKA 2QTDA 4W5QA 4OPJA 4O0IA 1B9DA 5C25A 4K41A 2O8FA 4FWLA 1FJGK 3KWIA 3CJ1A 4M7XA 1K6YA 4AH9A 1EWQA 3LDNA 2E4LA 4B9NA 2XY6A 3OY9A 4FWQA 4H0YB 1X1PA 4DG1A 3V9XA 4QOZB 1NMDA 4Z94A 5FPDA 3R8EA 3KZBA 1NGHA 3AARA 4RW6A 3HBTA 3K0SA 2DFHA 4I6MA 4WQ4A 2IGIA 3DYAA 2ITGA 5ADXA 1GLLO 1YAGA 3KK7A 5SZTA 1J9AA 4J2BA 2WBNA 4YOVA 4N5SA 2NRRA 1LW2A 3E01A 3KIOA 3OYIA 4DF8A 2P9LB 4RWTA 3OS0A 5I42A 3O3FA 4E1MA 2FF6A 3DM2A 4DR3K 4FM1A 4CEOA 5AR0A 4CJWA 5LJWA 2BH1A 4OKKA 3PIOL 2AP1A 4N41A 4PHTX 5I3UA 1U6ZA 4CJEA 1NGJA 4B9LA 1TK0A 4F8RA 2JWLA 3QEVA 3GG4A 3FZLA 3SAFA 1W9HA 4CJSA 1VRTA 1EX4A 2EWSA 4DQIA 4IFVA 3TSQA 4PKHA 4CJQA 4BRQA 4CEBA 2VQFK 2OZSA 3NF8A 4CVNE 3MN9A 1CZBA 4MO5A 3AGRA 1NJWA 1IG9A 4DFJA 3P38A 3TPQA 1T6CA 3MWTA 2XY7A 1YITN 3TSPA 4DLEA 4JI0K 4Q5VA 4PUOA 1N33K 4M3TA 2D0BA 1EP4A 5AQSA 4Y1DA 3MCPA 4FJGA 3PY8A 4YOTA 4FK2A 1RT4A 5AQXA 2X74A 4FJ9A 1K8KA 5BN9A 2PAVA 1L5UA 1T8EA 2FBYA 3G10A 1MA9B 3ZCMA 4CEAA 5FROA 4EP4A 5KGXA 4Y0WA 3A5OC 3HSCA 3C7NA 1D8YA 4KV8A 3DAWA 3W0LA 4L8RB 3K2PA 3TANA 4I2QA 2H3GX 4KTZA 5MLCQ 3L2RA 1OH7A 2KFNA 4MLHA 2FSKA 3ID6A 1BQNA 4DKWA 3EL2A 2G8IA 4BDZA 3WQTA 2CH5A 3H6EA 2A6AA 3ZSYA 3NH1A 4HUGA 3P31A 3S41A 1N6QA 4FJ8A 3CCVN 3SUOA 4DV4K 3L4IA 3THYA 4OKEA 1J5OA 4OX9K 4B1VA 1JJ2M 4IO8A 1HNIA 1QSSA 3QMLA 4CEEA 1V4TA 1RT1A 3V9WA 4YOXA 1NJYA 5TKWA 3L3UA 4H4MA 3U9DA 4E1JA 2Q36A 3CM6A 3THVA 1JL1A 3AO3A 3VF2A 5I9EB 4CESA 4YFUA 4I9LA 3O6WA 1WBDA 3THXB 4DB3A 3SQ1A 1WSIA 1OH6A 4FLXA 4DTXA 4HCBA 4IO9L 3AGKA 4IZ9A 5C24A 1NK9A 4BR9A 4KB0A 4FJHA 2E2PA 5JVHL 5EXWA 4DU4A 4K42A 4FWOA 3DXKB 4OKJA 1KFDA 4J8FA 3DOLA 1NK8A 2UUCK 3QO9A 3DRPA 3U3GA 2HHHK 4E0DA 3RR7A 5EOYA 4CF1A 4DF4A 1VQON 4ISEA 4CZGA 4CZMA 2WTUA 4N76A 2F9TA 4CGHA 5M1OA 4BR2A 1WSEA 1C6VA 3AVFA 4BQZA 1WB9A 2YX6A 4M7YA 5HL7L 3R1XA 2ZGYA 1VHXA 2HHWA 2W6KA 3KKSA 5C2DA 4FWRA 1DLOA 1HJRA 1OKJA 3OBYA 3OS1A 4KI6A 3CCQN 4CECA 4LD0A 2D0AA 5AQGA 4Z4CA 2HHSA 3NGIA 2Q97A 3VEWA 3D6RA 3H3NO 1TYQA 2YCHA 5BRDA 3TI0A 4AM7A 5JS1A 4ZHRA 1WLJA 2QK9A 2KW4A 4LF8K 4CEDA 4DSEA 3CCSN 3SQ4A 1TK8A 1Z05A 4CK1A 1BWFO 3VF6A 2VG6A 4NXNK 4K8XA 2HBMA 5ELZA 1FXXA 4LSLA 3CCEN 1BCMA 4K25A 4DS5A 3EE8A 1S72N 3MN6A 4BVPA 1NNEA 3TTFA 1J53A 4WYBA 4BRGA 4BE0A 5LL6Z 2QM1A 4JKBA 4DV7K 1IV0A 3C7NB 1LWEA 3U6FA 3RR8A 2E2OA 4BR4A 1SAZA 3AVGA 4E89A 5KQDA 3WT0A 3HTVA 3HM8A 5AQPA 4IEIA 1YJWN 1IKYA 3F73A 4Z0UA 5BR9A 2A1SA 4CJ3A 4JAXA 2I5JA 2KFZA 2D4WA 3RTVA 3MCAB 4FWMA 4JKDA 3CQYA 1LW0A 1ZBIA 5LY3A 5KI6A 4CD3A 1EWRA 1RBTA 4IBNA 2D0PA 1D9FA 4BVOA 1LWCA 1TKXA 1BIUA 2ZE2A 4CERA 5BRHA 4CEQA 4GW6A 5ADXH 4PA1A 3QB0A 3V4IA 4BDYA 3O1BA 5FDLA 5BREA 3WNHA 5JLHA 4WE1A 3VQCA 3KD5E 3LDLA 1C0UA 3OBWA 5EX5A 4FJLA 1S22A 4BGAA 4BC4A 3OA9A 3C65A 3KD1E 4DSLA 4JD2B 4LFBK 2GTDA 3DLKA 1DEJA 2IIRA 2V7ZA 3LDQA 4QS8A 3TAMA 3CJ7A 4ICLA 4E7IA 3NVKA 4HHTA 4C8OA 4B9UA 1NBWA 3L6QA 1RT3A 1J54A 4DR1K 3IAYA 2BTFA 2KZMA 1K73O 5BPMA 3L2VA 1J5EK 3CC7N 3AVHA 5AZJB 3JAMO 1K8KB 3MX2A 2P5OA 1XI1A 2O4GA 4CJFA 4CF0A 3NAEA 1HKBA 5KPZA 4EZ9A 1C1CA 4AQYK 2P9KB 1CXQA 3ITHA 4M3XA 2HBKA 3VETA 3LDSA 4KI4A 3OW2M 1RILA 1FW6A 2B6AA 4O5FA 3CPWM 1IKVA 1EO1A 3GE1A 1IKXA 3VTHA 5GIOA 2BDPA 1NK0A 3QBWA 1N5YA 4G1QA 3KLEA 3K9JA 2P9NA 3DRRA 4M3YA 2B5JA 3K59A 2YJEA 3KVGA 5HP1A 4IOAL 3H46O 3E1YA 3OYGA 3L3VA 4RW4A 2BUPA 5DMRA 4PL8A 4JKFA 1L3TA 3MMVA 1VAZA 3NF9A 3TAEA 1TKDA 1HNWK 3OJUA 5AQOA 3O3GA 3HT3A 2VG7A 1JKHA 4CZJA 5AZIB 4WF9L 3V9SA 3T1HK 2O8DB 3DLBA 5CHIA 3RSEA 4AHTA 4UQGA 5D3GA 1TL3A 1VSMA 2A42A 4BRAA 4FJKA 1SKWA 4DWIA 2I7NA 3K5OA 3WNGA 1QS4A 1KD1O 4GVEA 3S9HA 3OYMA 2Y1JA 3GL1A 1RBVA 4JKGB 2QXFA 3K58A 1HJOA 3NH0A 5FPEA 3SJHA 4H5RA 4DR6K 1VSDA 4JK8A 3OTOK 4IFEA 3W3DA 3AO4A 4JEPA 3B8AX 4FJMA 1D5AA 1TUYA 1N36K 4B9TA 1RDWX 3H3OB 1B9FA 2KKZA 3KK3A 2A3ZA 4F2RA 1WSGA 3S3OA 4XH4A 4CJPA 1ZBUA 3EZWA 4FWSA 3IMXA 1VQPN 3AO2A 3ASMA 3AVMA 2O8CB 2WFBA 5BPNA 2QA4N 3MAQA 2E2QA 3M1FA 1E3MA 1SL1A 3LP2A 5KTQA 1ITGA 4B8AB 4FJXA 1J6ZA 4AHVA 4BREA 4XIUA 1RT2A 2DPNA 4H0PA 3JYTA 3MWPA 2YKMA 4DTPA 2F4VK 1G99A 2WC9A 1L3SA 3VERA 1XMQK 4LFAK 3ZSWA 1DTQA 2ATQA 4YNQA 4OLBA 1EXQA 3CJBA 1VSHA 4B9MA 1NOZA 1ATNA 4M63C 1K8AO 3C95A 2HHVA 2QKBA 1TGOA 1VSKA 5CY4A 4B1WB 3IDHA 5CE3A 3UIQA 3UKRB 1JLAA 2Z1JA 4JKEA 1UOCA 3V81A 2ZGZA 3CYMA 1QTMA 3CHWA 3I0RA 4CW7B 1SV5A 3TWHA 1KCFA 2V7YA 3NDKA 3E9OA 1RBSA 5AQIA 3CJAA 3L4QA 2DFFA 1LCUA 3U8XA 3SQ0A 1EKEA 4W5RA 3AVLA 3ZLJA 2P1JA 5M1KA 2I7PA 1XNRK 1KLMA 4JLHA 4MDAA 1NGBA 1XHXA 3O1WA 1FKOA 3JXUA 3NFAA 3CQXA 3U9ZA 4YDUC 4BQLA 3VQ4A 2HNZA 4MDBA 2RF2A 1HLUA 3ATUA 4BACA 4O4GA 3CCLN 2XO7A 3T7ZA 1BI4B 5T7BA 3C6UA 3CMEN 4JI1K 1YJ9N 3SUPA 3CIPA 3TAGA 4QS9A 3AV9A 1BG3A 3ZX0A 1YHQN 4IXCA 4CCHA 1DTTA 2QW9A 4N56A 2P9NB 2OTJN 3QIPA 4N47A 3CCRN 4KHSA 3LWMA 4O8UA 2FF3B 1KAZA 1HKGA 2NRZA 4KHQA 3ULDA 4CJUA 3OYLA 5E26A 4C23A 3RRHA 4JHDA 1IJJA 3BF1A 4QS7A 2Z1IA 3VF4A 3H1VX 1KLNA 2YHYA 4BY9C 2UU9K 2OPSA 3L0QA 4E7JA 2GUPA 1KQSM 4W5NA 1WNSA 3FZHA 4FJJA 5LJVA 5HBMA 3OYBA 3HZ6A 4BDPA 3CCJN 1C0MA 4CHQA 1JLGA 3NGZA 5BR8K 1S1VA 4KHYA 3O9SA 1SL2A 3UKUB 1GLJO 4DV2K 3C0BA 1YXQA 3DLHA 1QZ5A 1RCHA 2ETJA 2XY5A 4FK4A 1O1WA 4JI5K 3HXMA 4LF4K 2FBXA 3VA0A 3HPHA 3I55N 1U2VB 2KHOA 3SPYA 2FSNA 1RBUA 1T03A 5HLFA 3D2EB 4I6MB 3CETA 1VQ4N 4CFAA 2NZTA 4J2DA 5EVZA 3CD6N 3HPOA 4CFDA 1QE1A 2GELA 3TARA 2O8EA 5AQNA 4B3SK 3ENHA 2HHQA 1NKEA 2J4RA 1V4SA 3VQBA 1U04A 4JNEA 1HYZA 4NCGA 4BC5A 3U3YA 1TVRA 3DLGA 3PX0A 1HQEA 4OLAA 4AILC 4DQ8A 3VQEA 1JXEA 2KTQA 3KKRA 2HNDA 4CBUA 2DFEA 1UA0A 3KK2A 3WNEA 1VSLA 4KTQA 1ASWA 4PKGA 2NLXA 5GADP 4K0KK 1RBRA 1YUWA 4GMJB 2A1RA 1OVYA 5HRRA 4WFBL 4FCYA 1P90A 5FPNA 3VPZA 1BGXT 4C8NA 3HPGA 4FJ7A 3J8AA 2HBLA 2OPRA 2OPQA 1BA1A 2Q2RA 3CCUN 1NJIO 3IS9A 3HRGA 5J1EA 3SNNA 2G8KA 1IG8A 1C1BA 4H5WA 4H8KA 1DGKN 2AA4A 3M8QA 2QEXN 4KKOA 3QEIA 1RDUA 1S1WA 3V1OA 3LM2A 1HRHA 4EFHA 4J2EA 3OYHA 3DMJA 3D2FA 5KRSA 4GNIA 4CGDA 2BGGA 2UXDK 1DKGD 3TAQA 4JK9A 2P9IB 2YV0X 1JLBA 4C1NI 4G9ZA 1FK9A 5HOOA 3KJVA 3SUNA 3OYDA 3IRXA 1Q9XA 3VA3A 1C1AA 2HOEA 4JK7A 3F9MA 3AVIA 2E1ZA 1QQMA 4ZTFA 2Q31A 2X6SA 3PIPL 1NG9A 1YJNN 4M3WA 1Q82O 3SJJA 4TSXA 2ZQBA 3VMFB 4ELTA 3L2WA 3J81O 1HNZK 1BI4A 5AQUA 3VEXA 2ASMA 4DCHA 2O8CA 4C8MA 3NCIA 4EAHD 4C8KA 2AJQA 2DY4A 3GDQA 3KLGA 2G8UA 4ELUA 1G15A 4YOYA 4FSVA 4DQSA 5CZ1A 1ATSA 4CK2A 2E6LA 4Z4EA 5AZJA 1IBLK 3G71N 3Q7BA 3ZSVA 1WSHA 2IS3A 2OPPA 2CGLA 3T19A 4FYDA 2FBVA 2NRHA 4O55A 1ZBSA 5AQQA 4Q0BA 1TK5A 4HCCA 4FM2A 2X6NA 5KPRA 2P9LA 3VQ8A 3M6GA 3S3NA 5HRSA 3THXA 3O4NA 5DK5A 3HI0A 3L2QA 2OCEA 4JI2K 1RTHA 4FVMA 4FXDA 4YOWA 3M8PA 1YT3A 1QHAA 4HUEA 4FPAA 1VQ5N 2VQEK 4DQQA 5AQYA 3VESA 1BIZA 4CIEA 4LF9K 2F8SA 1CXUA 1MWKA 1O13A 1W0HA 4K8ZA 4CF9A 1VQ9N 3PX6A 3ZEUB 3FFIA 3GOIA 4GV9A 2HBJA 2KLAA 3QNNA 4EHUA 4WQ5A 4M42A 1TAUA 1RTJA 1ASUA 2RE2A 5AZIA 4BRHA 2O8DA 5AQZA 1KAXA 4IDHA 3O9RA 5AJ3K 4A5BA 1GLCG 3MEDA 1QQOA 3NGYA 1KTQA 5AQVA 1HMVA 4CZHA 3O9TA 2PBDA 4CJ7A 4LSNA 4AF1A 3ZT2A 2YHXA
chains in the Genus database with same CATH topology
4CEZA 5J2NA 5CYQA 3NF6A 4CGGA 2P5GA 3DRRA 1JXBA 3IG1A 4CGIA 4M3YA 2B5JA 4E3SA 4O0JA 3K59A 4KO0A 1RDBA 3MXJA 5HP1A 4FLYA 4BWJA 3OYGA 1NK4A 2IAJA 3L3VA 1CLQA 4RW4A 3ZSZA 4HUFA 5DMRA 4E1NA 4NCAA 3DOKA 4NYNA 3AVAA 1L3TA 1L3UA 1YVUA 2GBZA 3NF9A 3TAEA 4FK0A 1TKDA 4CF8A 4CFBA 1Q9YA 3OJUA 2F96A 3SPZA 3O3GA 5CYMA 2VG7A 1JKHA 3HT3A 3EZ5A 3OYKA 3V9SA 1X9MA 3DLBA 4OVLA 4W5QA 4UQGA 1NK7A 3DRSA 4AHTA 5D3GA 1TL3A 1VSMA 4OPJA 3DI6A 1B9DA 3OVNA 5C25A 4O0IA 1GOAA 1SKWA 4FJKA 4DWIA 3V1QA 3K5OA 3WNGA 2G8HA 1QS4A 1WAJA 2HW3A 1K6YA 3S9HA 1ZBLA 4AH9A 3OYMA 2Y1JA 1L3VA 3HVTA 3QETA 1RBVA 2E4LA 4IFYA 4B9NA 4C8LA 2XY6A 3KLHA 3OY9A 1RDDA 4DG1A 1X1PA 2QXFA 3V9XA 3K58A 1RTDA 4QOZB 3NH0A 1YTAA 3I0SA 4FLVA 1ZYQA 2HHXA 2YKNA 4RW6A 4DTRA 1VSDA 4MQ3A 1I3AA 2DFHA 3AO4A 2IGIA 1TKZA 4FJMA 1D5AA 3DYAA 2ITGA 2F8TA 5SZTA 1A5XA 1J9AA 4J2BA 4CHZA 4B9TA 3ZSOA 1B9FA 4N5SA 4FLTA 3KK3A 1KRPA 4F2RA 1LWFA 1LW2A 2WONA 1WSGA 3E01A 3KIOA 3OYIA 3S3OA 4EZ6A 4DTNA 4CJPA 4DF8A 3OS0A 1ZBUA 4AHUA 3T3FA 5I42A 3O3FA 3HL8A 4E1MA 3DM2A 4FM1A 3DLRA 4CEOA 1ZBHA 4DTUA 3AO2A 3ASMA 3AVMA 3QEWA 4CJWA 1S1TA 3MAQA 1RDCA 3ISNC 1HQUA 4OKKA 3NHGA 3LPTA 2YNIA 4N41A 1SL1A 2E6MA 3LP2A 5KTQA 5I3UA 1ITGA 1JLFA 4B8AB 4CJEA 4ELVA 4FJXA 4F2SA 3ZT3A 1TK0A 4B9LA 4F8RA 4AHVA 3RMAA 2OZMA 4CFCA 4XIUA 3QEVA 1RT2A 4MFBA 3NF7A 1W9HA 3JYTA 3LAMA 4DTPA 2YKMA 4CJSA 1VRTA 1EX4A 4DTMA 4F3TA 1JLCA 4DQIA 4IFVA 1L3SA 3B6PA 4O44A 1VSJA 4CJQA 3ZSWA 4CEBA 4OGEA 3TAFA 2OZSA 3NF8A 1R0AA 4E7KA 2OA8A 1CZBA 1A5VA 1DTQA 2ATQA 4YNQA 3QNOA 1XHZA 1NJWA 4OJRA 4W5OA 2KQ2A 1RTIA 5EU7A 5J2PA 1HYVA 4DFJA 1IG9A 1EXQA 4OLBA 1VSHA 5HRNA 1LV5A 3EY1A 1VSFA 4B9MA 1NOZA 2XY7A 5C42A 1S1XA 3PX4A 3TABA 5FRMA 4Z4FA 4DU1A 3C95A 4DLEA 4DQPA 2QKBA 2HHVA 2Y1IA 3BDPA 4Q5VA 1U4BA 1TGOA 1VSKA 4PUOA 5CY4A 3ZSXA 1F21A 1VSIA 4M3TA 2D0BA 1EP4A 3MEEA 4Y1DA 1SKRA 3UIQA 1JLAA 2Z1JA 4FJGA 3VQ9A 4KREA 3PY8A 4IG0A 1UOCA 3V81A 4KHNA 3CYMA 4FK2A 1RT4A 3LP1A 3QINA 1QTMA 3I0RA 1XC9A 4IG3A 2X74A 4FJ9A 4CJVA 1S6PA 3VQPA 1Y97A 1SV5A 1XWLA 1L5UA 1JLEA 3TWHA 5HROA 3TAPA 1WSJA 1T8EA 3MXIA 2FBYA 1KCFA 3G10A 4DSJA 3NDKA 3ZCMA 3VN5A 1RBSA 4RW9A 3QIOA 4CEAA 1REVA 3OYFA 3AA3A 2DFFA 5FROA 3AO5A 3VQAA 4EP4A 5KGXA 3SQ0A 1EKEA 4W5RA 3AVLA 4GVMA 2P1JA 2IOCA 1D8YA 4KV8A 4B3OA 2LSNA 1RT6A 4DTOA 1KLMA 4JLHA 1NKCA 3K2PA 4L8RB 1XHXA 2EX3A 2NUBA 3NBPA 4FLWA 3TANA 1FKOA 1FKPA 4I2QA 2BANA 3NFAA 3CFOA 4KTZA 3L2RA 1QSLA 4B9SA 2KFNA 3VQ4A 2HNZA 1IO2A 2RF2A 4E7LA 4BACA 4O4GA 1BQNA 2JGUA 2RN2A 4FJIA 4CHPA 2G8IA 2XO7A 2FC0A 1BI4B 2GV9A 3VQ6A 3C6UA 5T7BA 3G0ZA 3LWLA 4RW7A 4BDZA 4DS4A 4DSKA 4FZXC 4LH5A 3HJFA 4W5TA 3SUPA 4ID5A 3OYEA 3TAGA 3ZSYA 3P1GA 3B6OA 3AV9A 3NH1A 4HUGA 1S1UA 4QAGA 3ZSQA 3NE6A 3AA4A 1DTTA 1S9EA 4N56A 1A5WA 1KVAA 3ZT1A 3A2FA 1GOCA 1N6QA 4FJ8A 3SUOA 2B4JA 5CZ2A 4Z4IA 3QIPA 4N47A 3M8SA 1U45A 4KHSA 3LWMA 3SYZA 4DLGA 4OKEA 1J5OA 4I9QA 1QSSA 1HNIA 3LALA 4KHQA 3ULDA 4CJUA 1IKWA 4CEEA 3OYLA 2WOMA 4R5PA 1RT1A 3V9WA 4KHWA 1RT7A 3QESA 1NJYA 3RRHA 4B08A 3L3UA 4H4MA 1IH7A 5SWMA 4FLUA 2W42A 2Z1IA 3H08A 4Z4HA 1KLNA 2OPSA 2VWJA 3CM6A 2P51A 3QEPA 3THVA 4E7JA 1JL1A 1ZBFA 3L8BA 1WNSA 4FJJA 4W5NA 3AO3A 5HBMA 3C6TA 3OYBA 1Q8IA 4CESA 4YFUA 4BDPA 4I9LA 2PZSA 2IDOA 1HPZA 1C0MA 4CHQA 1JLGA 2X78A 5J2MA 3SQ1A 1WSIA 1RNHA 3LAKA 3NGZA 4FLXA 4DTXA 1S1VA 3PO4A 4HCBA 4KHYA 5C24A 1NK9A 1SL2A 4PQUA 4KB0A 4FJHA 4KB1A 4KHUA 1BL3A 4DU4A 4BE1A 4M45A 3DLHA 2ETJA 1RCHA 2XY5A 4OKJA 1HYSA 4FK4A 1O1WA 1NJXA 1KFDA 3HXMA 3DOLA 4BE2A 2FBXA 1NK8A 2VG5A 3HPHA 2BE2A 3VA0A 2G8FA 1YTUA 4HVJA 3QERA 3QO9A 3DRPA 1WN7A 3U3GA 4E0DA 3RR7A 2YNGA 4CF1A 4DF4A 1I39A 3SPYA 4CHNA 4DTJA 1SUQA 1BCOA 1RBUA 4N76A 4LH4A 1T7PA 3MECA 5HRPA 5HLFA 1T03A 4AHRA 4CGHA 4IKFA 3SUQA 1U49A 2G8WA 3S3MA 4FJ5A 4CJKA 4HTUA 4RW8A 4CFAA 3V9UA 3SV3A 1WSEA 4J2DA 3VQ7A 1C6VA 3AVFA 1KFSA 3LP0A 3HPOA 4CFDA 3RMBA 1NK6A 1QE1A 4CEFA 3D0PA 4DU3A 4DFKA 3TARA 3KTQA 2IC3A 2HHWA 4QCLA 2VWKA 3KKSA 3PO5A 4CJRA 2HHQA 5FRNA 2XY8A 4FW2A 1JL2A 1NJZA 4CJ4A 4KTWA 1NKEA 1TKTA 1DLOA 1HJRA 3OS1A 3AVBA 4KI6A 1CZ9A 2XHBA 3K5LA 1S5JA 2XRIA 3OYCA 1RT5A 1U48A 3ZSRA 3VQBA 1U04A 4NCGA 1HYZA 2D0AA 4LD0A 4CECA 3U3YA 4Z4CA 1TVRA 3DLGA 2PY5A 3PX0A 1HQEA 4FW1A 4CCHA 4J2AA 4OLAA 3AO1A 4E19A 3KLFA 4AILC 2HHSA 4CHYA 3NGIA 4LY7A 1TV6A 3VQEA 2HVHA 1JXEA 4IDKA 2KTQA 3KKRA 2HNDA 2DFEA 4DFPA 1WAFA 3OJSA 3I8DA 4DQRA 3TI0A 1NOYA 1UA0A 3KK2A 4ID1A 3WNEA 1VSLA 4KTQA 4KPYA 5J2QA 1ASWA 4RG8A 1Z25A 5JS1A 2QKKA 4ZHRA 1RBRA 1WLJA 1NK5A 4GMJB 3L2UA 3RMCA 2A1RA 2QK9A 2KW4A 3OYNA 4FM0A 2Z1HA 4CEDA 4DSEA 3SQ4A 3PUFA 5HRRA 1TK8A 3AVJA 4I7FA 4CF2A 1QSYA 4FCYA 4KRFA 1BGXT 4CK1A 4C8NA 3HPGA 2RPIA 2VG6A 4EP5A 4K8XA 3QLHA 4E7HA 1U47A 4FJ7A 3V9ZA 1FXXA 2RKIA 4LSLA 1BCMA 2OPRA 3CFRA 2HVIA 2OPQA 1TL1A 2R7YA 3IS9A 1WSFA 5J1EA 3KK1A 4DS5A 3SNNA 1C1BA 3NH2A 1T05A 1SL0A 2G8KA 1QQCA 4H8KA 4PY5A 3ZT0A 3M8QA 1J53A 4DSIA 2EHGA 3D45A 1S6QA 4Y1CA 4KKOA 4AHCA 3CM5A 4B9VA 3QEIA 1HNVA 1S1WA 4BE0A 5KRTA 3V1OA 1HRHA 4Z4GA 4H4OA 5E41A 3CFPA 3ZT4A 4J2EA 3OYHA 3DMJA 1LWEA 1VRUA 3AVNA 5KRSA 4M3ZA 4CGDA 1BQMA 2BGGA 3U6FA 2HB5A 3RR8A 1LAVA 2Q3SA 3TAQA 4CJLA 3OS2A 2YV0X 3AVGA 1JLBA 4E89A 1C0TA 3F9KA 3M8RA 1FK9A 3KJVA 4JRPA 3O4QA 3SUNA 3OYDA 1X9WA 4FZYA 3IRXA 3HVRA 3LZIA 1Q9XA 3VA3A 1IKYA 3F73A 2Z1GA 4Z0UA 5JS2A 2A1SA 1NKBA 1C1AA 3AVCA 1ASVA 3KLIA 4CJ3A 2I5JA 2KFZA 3AVIA 3RTVA 4B8CA 4ZTFA 2OYQA 2X6SA 1LW0A 3OYAA 1ZBIA 3SZ2A 5KI6A 4M3WA 1VK0A 1RBTA 3SJJA 4IBNA 4TSXA 2ZQBA 4NYFA 4ELTA 1D9FA 3L2WA 2HMIA 3RWUA 5K14A 1LWCA 1TKXA 1BIUA 2ZE2A 3HP9A 1BI4A 3VQDA 4C8MA 4CERA 3NCIA 4C8KA 3VQ5A 2AJQA 2DY4A 1B92A 4ZTJA 3KLGA 4FJNA 2G8UA 2ZD1A 3PV8A 4ELUA 1G15A 4CEQA 1KSPA 4GW6A 3SV4A 3HYFA 4PA1A 3MXMA 4DQSA 3T1AA 3HO1A 2HHTA 1BISA 5CZ1A 4I2PA 4CE9A 4JS5A 3V4IA 3V6DA 4CK2A 2E6LA 4BDYA 2PYJA 5FDLA 2PYLA 4PWDA 2DTUA 3WNHA 1SKSA 3TR8A 4Z4EA 4WE1A 3VQCA 3KD5E 2O4IA 2KZZA 4FZZA 3ZSVA 1C0UA 1WSHA 2IS3A 2JLEA 4F3OA 2OPPA 3O3HA 2HNYA 3C94A 3T19A 4FYDA 2YHBA 2FBVA 3VQQA 1UAXA 4O55A 4FJLA 1VSEA 4JRQA 3HK2A 4Q0BA 1GOBA 1UWBA 3KD1E 4DSLA 3MEGA 1TK5A 4FM2A 2X6NA 4HCCA 3BGRA 4M3RA 3CQ8A 4CJ5A 4OPKA 3SQ2A 3DLKA 1S9GA 3LPUA 3VQ8A 4CIFA 1KVBA 2YNFA 3ALYA 1LAWA 3TAMA 3S3NA 1D9DA 4NCBA 3V1RA 4CGJA 5HRSA 3K5MA 4DFMA 3P83D 4ICLA 3O4NA 3AVKA 2YNHA 4E7IA 4DSFA 4HHTA 4AHSA 1TAQA 5DK5A 3LANA 4M41A 4B9UA 4C8OA 1RT3A 1UA1A 4CK3A 3L2QA 4KAZA 1RTHA 1J54A 4FVMA 3RMDA 4FXDA 3M8PA 3EYZA 1YT3A 3IAYA 1MU2A 4HUEA 2KZMA 3L2VA 3AA2A 4DQQA 3AVHA 3JSMA 3HP6A 3K57A 4KFBA 1BIZA 4CIEA 2P5OA 3SCXA 4CIGA 1XI1A 1Z26A 4DMNA 3OYJA 3WNFA 2F8SA 2O4GA 3RRGA 1CXUA 3HSTB 3LP3A 4CJFA 4JS4A 4CF0A 3NAEA 1W0HA 4K8ZA 4CF9A 4O5BA 3PX6A 4EZ9A 1C1CA 1KVCA 4OGCA 3FFIA 3P5JA 3K5NA 3LZJA 1CXQA 3ITHA 3QEXA 4M3XA 4CHOA 3QNNA 5KGWA 4M42A 1BHLA 3LDSA 4KI4A 1RILA 1TAUA 3HM9A 1JLQA 1ASUA 1EETA 1RTJA 4DTSA 3DLEA 1X9SA 4F4KA 2B6AA 4CGFA 4M3UA 2FBTA 2GUIA 4BWMA 4CJTA 3MEDA 4FLZA 3NGYA 1KTQA 1IKVA 1HMVA 1IKXA 1RDAA 2G8VA 2YHAA 3AA5X 2D0CA 3SI6A 2D5RA 4LSNA 1NK0A 2BDPA 1N5YA 4G1QA 3ZT2A 3KLEA 1QHTA 3CG7A 2HHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CEZ A;  5J2N A;  5CYQ A;  3NF6 A;  4CGG A;  2P5G A;  3DRR A;  1JXB A;  3IG1 A;  4CGI A;  4M3Y A;  2B5J A;  4E3S A;  4O0J A;  3K59 A;  4KO0 A;  1RDB A;  3MXJ A;  5HP1 A;  4FLY A;  4BWJ A;  3OYG A;  1NK4 A;  2IAJ A;  3L3V A;  1CLQ A;  4RW4 A;  3ZSZ A;  4HUF A;  5DMR A;  4E1N A;  4NCA A;  3DOK A;  4NYN A;  3AVA A;  1L3T A;  1L3U A;  1YVU A;  2GBZ A;  3NF9 A;  3TAE A;  4FK0 A;  1TKD A;  4CF8 A;  4CFB A;  1Q9Y A;  3OJU A;  2F96 A;  3SPZ A;  3O3G A;  5CYM A;  2VG7 A;  1JKH A;  3HT3 A;  3EZ5 A;  3OYK A;  3V9S A;  1X9M A;  3DLB A;  4OVL A;  4W5Q A;  4UQG A;  1NK7 A;  3DRS A;  4AHT A;  5D3G A;  1TL3 A;  1VSM A;  4OPJ A;  3DI6 A;  1B9D A;  3OVN A;  5C25 A;  4O0I A;  1GOA A;  1SKW A;  4FJK A;  4DWI A;  3V1Q A;  3K5O A;  3WNG A;  2G8H A;  1QS4 A;  1WAJ A;  2HW3 A;  1K6Y A;  3S9H A;  1ZBL A;  4AH9 A;  3OYM A;  2Y1J A;  1L3V A;  3HVT A;  3QET A;  1RBV A;  2E4L A;  4IFY A;  4B9N A;  4C8L A;  2XY6 A;  3KLH A;  3OY9 A;  1RDD A;  4DG1 A;  1X1P A;  2QXF A;  3V9X A;  3K58 A;  1RTD A;  4QOZ B;  3NH0 A;  1YTA A;  3I0S A;  4FLV A;  1ZYQ A;  2HHX A;  2YKN A;  4RW6 A;  4DTR A;  1VSD A;  4MQ3 A;  1I3A A;  2DFH A;  3AO4 A;  2IGI A;  1TKZ A;  4FJM A;  1D5A A;  3DYA A;  2ITG A;  2F8T A;  5SZT A;  1A5X A;  1J9A A;  4J2B A;  4CHZ A;  4B9T A;  3ZSO A;  1B9F A;  4N5S A;  4FLT A;  3KK3 A;  1KRP A;  4F2R A;  1LWF A;  1LW2 A;  2WON A;  1WSG A;  3E01 A;  3KIO A;  3OYI A;  3S3O A;  4EZ6 A;  4DTN A;  4CJP A;  4DF8 A;  3OS0 A;  1ZBU A;  4AHU A;  3T3F A;  5I42 A;  3O3F A;  3HL8 A;  4E1M A;  3DM2 A;  4FM1 A;  3DLR A;  4CEO A;  1ZBH A;  4DTU A;  3AO2 A;  3ASM A;  3AVM A;  3QEW A;  4CJW A;  1S1T A;  3MAQ A;  1RDC A;  3ISN C;  1HQU A;  4OKK A;  3NHG A;  3LPT A;  2YNI A;  4N41 A;  1SL1 A;  2E6M A;  3LP2 A;  5KTQ A;  5I3U A;  1ITG A;  1JLF A;  4B8A B;  4CJE A;  4ELV A;  4FJX A;  4F2S A;  3ZT3 A;  1TK0 A;  4B9L A;  4F8R A;  4AHV A;  3RMA A;  2OZM A;  4CFC A;  4XIU A;  3QEV A;  1RT2 A;  4MFB A;  3NF7 A;  1W9H A;  3JYT A;  3LAM A;  4DTP A;  2YKM A;  4CJS A;  1VRT A;  1EX4 A;  4DTM A;  4F3T A;  1JLC A;  4DQI A;  4IFV A;  1L3S A;  3B6P A;  4O44 A;  1VSJ A;  4CJQ A;  3ZSW A;  4CEB A;  4OGE A;  3TAF A;  2OZS A;  3NF8 A;  1R0A A;  4E7K A;  2OA8 A;  1CZB A;  1A5V A;  1DTQ A;  2ATQ A;  4YNQ A;  3QNO A;  1XHZ A;  1NJW A;  4OJR A;  4W5O A;  2KQ2 A;  1RTI A;  5EU7 A;  5J2P A;  1HYV A;  4DFJ A;  1IG9 A;  1EXQ A;  4OLB A;  1VSH A;  5HRN A;  1LV5 A;  3EY1 A;  1VSF A;  4B9M A;  1NOZ A;  2XY7 A;  5C42 A;  1S1X A;  3PX4 A;  3TAB A;  5FRM A;  4Z4F A;  4DU1 A;  3C95 A;  4DLE A;  4DQP A;  2QKB A;  2HHV A;  2Y1I A;  3BDP A;  4Q5V A;  1U4B A;  1TGO A;  1VSK A;  4PUO A;  5CY4 A;  3ZSX A;  1F21 A;  1VSI A;  4M3T A;  2D0B A;  1EP4 A;  3MEE A;  4Y1D A;  1SKR A;  3UIQ A;  1JLA A;  2Z1J A;  4FJG A;  3VQ9 A;  4KRE A;  3PY8 A;  4IG0 A;  1UOC A;  3V81 A;  4KHN A;  3CYM A;  4FK2 A;  1RT4 A;  3LP1 A;  3QIN A;  1QTM A;  3I0R A;  1XC9 A;  4IG3 A;  2X74 A;  4FJ9 A;  4CJV A;  1S6P A;  3VQP A;  1Y97 A;  1SV5 A;  1XWL A;  1L5U A;  1JLE A;  3TWH A;  5HRO A;  3TAP A;  1WSJ A;  1T8E A;  3MXI A;  2FBY A;  1KCF A;  3G10 A;  4DSJ A;  3NDK A;  3ZCM A;  3VN5 A;  1RBS A;  4RW9 A;  3QIO A;  4CEA A;  1REV A;  3OYF A;  3AA3 A;  2DFF A;  5FRO A;  3AO5 A;  3VQA A;  4EP4 A;  5KGX A;  3SQ0 A;  1EKE A;  4W5R A;  3AVL A;  4GVM A;  2P1J A;  2IOC A;  1D8Y A;  4KV8 A;  4B3O A;  2LSN A;  1RT6 A;  4DTO A;  1KLM A;  4JLH A;  1NKC A;  3K2P A;  4L8R B;  1XHX A;  2EX3 A;  2NUB A;  3NBP A;  4FLW A;  3TAN A;  1FKO A;  1FKP A;  4I2Q A;  2BAN A;  3NFA A;  3CFO A;  4KTZ A;  3L2R A;  1QSL A;  4B9S A;  2KFN A;  3VQ4 A;  2HNZ A;  1IO2 A;  2RF2 A;  4E7L A;  4BAC A;  4O4G A;  1BQN A;  2JGU A;  2RN2 A;  4FJI A;  4CHP A;  2G8I A;  2XO7 A;  2FC0 A;  1BI4 B;  2GV9 A;  3VQ6 A;  3C6U A;  5T7B A;  3G0Z A;  3LWL A;  4RW7 A;  4BDZ A;  4DS4 A;  4DSK A;  4FZX C;  4LH5 A;  3HJF A;  4W5T A;  3SUP A;  4ID5 A;  3OYE A;  3TAG A;  3ZSY A;  3P1G A;  3B6O A;  3AV9 A;  3NH1 A;  4HUG A;  1S1U A;  4QAG A;  3ZSQ A;  3NE6 A;  3AA4 A;  1DTT A;  1S9E A;  4N56 A;  1A5W A;  1KVA A;  3ZT1 A;  3A2F A;  1GOC A;  1N6Q A;  4FJ8 A;  3SUO A;  2B4J A;  5CZ2 A;  4Z4I A;  3QIP A;  4N47 A;  3M8S A;  1U45 A;  4KHS A;  3LWM A;  3SYZ A;  4DLG A;  4OKE A;  1J5O A;  4I9Q A;  1QSS A;  1HNI A;  3LAL A;  4KHQ A;  3ULD A;  4CJU A;  1IKW A;  4CEE A;  3OYL A;  2WOM A;  4R5P A;  1RT1 A;  3V9W A;  4KHW A;  1RT7 A;  3QES A;  1NJY A;  3RRH A;  4B08 A;  3L3U A;  4H4M A;  1IH7 A;  5SWM A;  4FLU A;  2W42 A;  2Z1I A;  3H08 A;  4Z4H A;  1KLN A;  2OPS A;  2VWJ A;  3CM6 A;  2P51 A;  3QEP A;  3THV A;  4E7J A;  1JL1 A;  1ZBF A;  3L8B A;  1WNS A;  4FJJ A;  4W5N A;  3AO3 A;  5HBM A;  3C6T A;  3OYB A;  1Q8I A;  4CES A;  4YFU A;  4BDP A;  4I9L A;  2PZS A;  2IDO A;  1HPZ A;  1C0M A;  4CHQ A;  1JLG A;  2X78 A;  5J2M A;  3SQ1 A;  1WSI A;  1RNH A;  3LAK A;  3NGZ A;  4FLX A;  4DTX A;  1S1V A;  3PO4 A;  4HCB A;  4KHY A;  5C24 A;  1NK9 A;  1SL2 A;  4PQU A;  4KB0 A;  4FJH A;  4KB1 A;  4KHU A;  1BL3 A;  4DU4 A;  4BE1 A;  4M45 A;  3DLH A;  2ETJ A;  1RCH A;  2XY5 A;  4OKJ A;  1HYS A;  4FK4 A;  1O1W A;  1NJX A;  1KFD A;  3HXM A;  3DOL A;  4BE2 A;  2FBX A;  1NK8 A;  2VG5 A;  3HPH A;  2BE2 A;  3VA0 A;  2G8F A;  1YTU A;  4HVJ A;  3QER A;  3QO9 A;  3DRP A;  1WN7 A;  3U3G A;  4E0D A;  3RR7 A;  2YNG A;  4CF1 A;  4DF4 A;  1I39 A;  3SPY A;  4CHN A;  4DTJ A;  1SUQ A;  1BCO A;  1RBU A;  4N76 A;  4LH4 A;  1T7P A;  3MEC A;  5HRP A;  5HLF A;  1T03 A;  4AHR A;  4CGH A;  4IKF A;  3SUQ A;  1U49 A;  2G8W A;  3S3M A;  4FJ5 A;  4CJK A;  4HTU A;  4RW8 A;  4CFA A;  3V9U A;  3SV3 A;  1WSE A;  4J2D A;  3VQ7 A;  1C6V A;  3AVF A;  1KFS A;  3LP0 A;  3HPO A;  4CFD A;  3RMB A;  1NK6 A;  1QE1 A;  4CEF A;  3D0P A;  4DU3 A;  4DFK A;  3TAR A;  3KTQ A;  2IC3 A;  2HHW A;  4QCL A;  2VWK A;  3KKS A;  3PO5 A;  4CJR A;  2HHQ A;  5FRN A;  2XY8 A;  4FW2 A;  1JL2 A;  1NJZ A;  4CJ4 A;  4KTW A;  1NKE A;  1TKT A;  1DLO A;  1HJR A;  3OS1 A;  3AVB A;  4KI6 A;  1CZ9 A;  2XHB A;  3K5L A;  1S5J A;  2XRI A;  3OYC A;  1RT5 A;  1U48 A;  3ZSR A;  3VQB A;  1U04 A;  4NCG A;  1HYZ A;  2D0A A;  4LD0 A;  4CEC A;  3U3Y A;  4Z4C A;  1TVR A;  3DLG A;  2PY5 A;  3PX0 A;  1HQE A;  4FW1 A;  4CCH A;  4J2A A;  4OLA A;  3AO1 A;  4E19 A;  3KLF A;  4AIL C;  2HHS A;  4CHY A;  3NGI A;  4LY7 A;  1TV6 A;  3VQE A;  2HVH A;  1JXE A;  4IDK A;  2KTQ A;  3KKR A;  2HND A;  2DFE A;  4DFP A;  1WAF A;  3OJS A;  3I8D A;  4DQR A;  3TI0 A;  1NOY A;  1UA0 A;  3KK2 A;  4ID1 A;  3WNE A;  1VSL A;  4KTQ A;  4KPY A;  5J2Q A;  1ASW A;  4RG8 A;  1Z25 A;  5JS1 A;  2QKK A;  4ZHR A;  1RBR A;  1WLJ A;  1NK5 A;  4GMJ B;  3L2U A;  3RMC A;  2A1R A;  2QK9 A;  2KW4 A;  3OYN A;  4FM0 A;  2Z1H A;  4CED A;  4DSE A;  3SQ4 A;  3PUF A;  5HRR A;  1TK8 A;  3AVJ A;  4I7F A;  4CF2 A;  1QSY A;  4FCY A;  4KRF A;  1BGX T;  4CK1 A;  4C8N A;  3HPG A;  2RPI A;  2VG6 A;  4EP5 A;  4K8X A;  3QLH A;  4E7H A;  1U47 A;  4FJ7 A;  3V9Z A;  1FXX A;  2RKI A;  4LSL A;  1BCM A;  2OPR A;  3CFR A;  2HVI A;  2OPQ A;  1TL1 A;  2R7Y A;  3IS9 A;  1WSF A;  5J1E A;  3KK1 A;  4DS5 A;  3SNN A;  1C1B A;  3NH2 A;  1T05 A;  1SL0 A;  2G8K A;  1QQC A;  4H8K A;  4PY5 A;  3ZT0 A;  3M8Q A;  1J53 A;  4DSI A;  2EHG A;  3D45 A;  1S6Q A;  4Y1C A;  4KKO A;  4AHC A;  3CM5 A;  4B9V A;  3QEI A;  1HNV A;  1S1W A;  4BE0 A;  5KRT A;  3V1O A;  1HRH A;  4Z4G A;  4H4O A;  5E41 A;  3CFP A;  3ZT4 A;  4J2E A;  3OYH A;  3DMJ A;  1LWE A;  1VRU A;  3AVN A;  5KRS A;  4M3Z A;  4CGD A;  1BQM A;  2BGG A;  3U6F A;  2HB5 A;  3RR8 A;  1LAV A;  2Q3S A;  3TAQ A;  4CJL A;  3OS2 A;  2YV0 X;  3AVG A;  1JLB A;  4E89 A;  1C0T A;  3F9K A;  3M8R A;  1FK9 A;  3KJV A;  4JRP A;  3O4Q A;  3SUN A;  3OYD A;  1X9W A;  4FZY A;  3IRX A;  3HVR A;  3LZI A;  1Q9X A;  3VA3 A;  1IKY A;  3F73 A;  2Z1G A;  4Z0U A;  5JS2 A;  2A1S A;  1NKB A;  1C1A A;  3AVC A;  1ASV A;  3KLI A;  4CJ3 A;  2I5J A;  2KFZ A;  3AVI A;  3RTV A;  4B8C A;  4ZTF A;  2OYQ A;  2X6S A;  1LW0 A;  3OYA A;  1ZBI A;  3SZ2 A;  5KI6 A;  4M3W A;  1VK0 A;  1RBT A;  3SJJ A;  4IBN A;  4TSX A;  2ZQB A;  4NYF A;  4ELT A;  1D9F A;  3L2W A;  2HMI A;  3RWU A;  5K14 A;  1LWC A;  1TKX A;  1BIU A;  2ZE2 A;  3HP9 A;  1BI4 A;  3VQD A;  4C8M A;  4CER A;  3NCI A;  4C8K A;  3VQ5 A;  2AJQ A;  2DY4 A;  1B92 A;  4ZTJ A;  3KLG A;  4FJN A;  2G8U A;  2ZD1 A;  3PV8 A;  4ELU A;  1G15 A;  4CEQ A;  1KSP A;  4GW6 A;  3SV4 A;  3HYF A;  4PA1 A;  3MXM A;  4DQS A;  3T1A A;  3HO1 A;  2HHT A;  1BIS A;  5CZ1 A;  4I2P A;  4CE9 A;  4JS5 A;  3V4I A;  3V6D A;  4CK2 A;  2E6L A;  4BDY A;  2PYJ A;  5FDL A;  2PYL A;  4PWD A;  2DTU A;  3WNH A;  1SKS A;  3TR8 A;  4Z4E A;  4WE1 A;  3VQC A;  3KD5 E;  2O4I A;  2KZZ A;  4FZZ A;  3ZSV A;  1C0U A;  1WSH A;  2IS3 A;  2JLE A;  4F3O A;  2OPP A;  3O3H A;  2HNY A;  3C94 A;  3T19 A;  4FYD A;  2YHB A;  2FBV A;  3VQQ A;  1UAX A;  4O55 A;  4FJL A;  1VSE A;  4JRQ A;  3HK2 A;  4Q0B A;  1GOB A;  1UWB A;  3KD1 E;  4DSL A;  3MEG A;  1TK5 A;  4FM2 A;  2X6N A;  4HCC A;  3BGR A;  4M3R A;  3CQ8 A;  4CJ5 A;  4OPK A;  3SQ2 A;  3DLK A;  1S9G A;  3LPU A;  3VQ8 A;  4CIF A;  1KVB A;  2YNF A;  3ALY A;  1LAW A;  3TAM A;  3S3N A;  1D9D A;  4NCB A;  3V1R A;  4CGJ A;  5HRS A;  3K5M A;  4DFM A;  3P83 D;  4ICL A;  3O4N A;  3AVK A;  2YNH A;  4E7I A;  4DSF A;  4HHT A;  4AHS A;  1TAQ A;  5DK5 A;  3LAN A;  4M41 A;  4B9U A;  4C8O A;  1RT3 A;  1UA1 A;  4CK3 A;  3L2Q A;  4KAZ A;  1RTH A;  1J54 A;  4FVM A;  3RMD A;  4FXD A;  3M8P A;  3EYZ A;  1YT3 A;  3IAY A;  1MU2 A;  4HUE A;  2KZM A;  3L2V A;  3AA2 A;  4DQQ A;  3AVH A;  3JSM A;  3HP6 A;  3K57 A;  4KFB A;  1BIZ A;  4CIE A;  2P5O A;  3SCX A;  4CIG A;  1XI1 A;  1Z26 A;  4DMN A;  3OYJ A;  3WNF A;  2F8S A;  2O4G A;  3RRG A;  1CXU A;  3HST B;  3LP3 A;  4CJF A;  4JS4 A;  4CF0 A;  3NAE A;  1W0H A;  4K8Z A;  4CF9 A;  4O5B A;  3PX6 A;  4EZ9 A;  1C1C A;  1KVC A;  4OGC A;  3FFI A;  3P5J A;  3K5N A;  3LZJ A;  1CXQ A;  3ITH A;  3QEX A;  4M3X A;  4CHO A;  3QNN A;  5KGW A;  4M42 A;  1BHL A;  3LDS A;  4KI4 A;  1RIL A;  1TAU A;  3HM9 A;  1JLQ A;  1ASU A;  1EET A;  1RTJ A;  4DTS A;  3DLE A;  1X9S A;  4F4K A;  2B6A A;  4CGF A;  4M3U A;  2FBT A;  2GUI A;  4BWM A;  4CJT A;  3MED A;  4FLZ A;  3NGY A;  1KTQ A;  1IKV A;  1HMV A;  1IKX A;  1RDA A;  2G8V A;  2YHA A;  3AA5 X;  2D0C A;  3SI6 A;  2D5R A;  4LSN A;  1NK0 A;  2BDP A;  1N5Y A;  4G1Q A;  3ZT2 A;  3KLE A;  1QHT A;  3CG7 A;  2HHU A; 
#chains in the Genus database with same CATH topology
 5J2N A;  3NF6 A;  4CGG A;  3SBG A;  4CGI A;  4KO0 A;  1CZA N;  4BWJ A;  1NK4 A;  4DHY A;  4C1N K;  4GY2 B;  3ZSZ A;  4NLC A;  4HUF A;  3UE5 A;  1W2B M;  3AVA A;  4X64 K;  2GBZ A;  1BOT O;  4FK0 A;  1Q81 O;  4CFB A;  3SPZ A;  5GAG P;  5CYM A;  3EZ5 A;  2GX9 A;  4JHD B;  3UKU A;  1NK7 A;  3QDK A;  4H03 B;  3OVN A;  3DWL A;  2G8H A;  4KH5 A;  4PL7 A;  1ZBL A;  5F1X A;  4CD1 A;  3SBT A;  5B8H A;  5JLF A;  4IFY A;  3T69 A;  3QET A;  4C8L A;  2RHK A;  3A5M C;  1RTD A;  4LFC K;  1YTA A;  1BDG A;  4FLV A;  2HHX A;  1IBM K;  3I8B A;  3QBX A;  2YKN A;  4RCH A;  4MQ3 A;  3FGU A;  1I3A A;  4OPA A;  3SK3 A;  1TKZ A;  3LDO A;  3ULE B;  1A5X A;  4CHZ A;  4OPH A;  4A2B A;  4BRP A;  3MN5 A;  4FLT A;  1KRP A;  1LWF A;  3RVC A;  4EZ6 A;  3VGK A;  1VQ7 N;  3ENO A;  3T3F A;  2VYP A;  3DLR A;  1ZBH A;  4DTU A;  2E1Y A;  4XH5 A;  3E9L A;  1TUU A;  4JD2 A;  3NHG A;  4CBW A;  4KH4 A;  4EIA A;  4EHT A;  1JLF A;  3DJC A;  3CER A;  3O4W A;  4F2S A;  3ZT3 A;  1GLD G;  2ASO A;  3TU5 A;  3RMA A;  1XC3 A;  2OZM A;  4CFC A;  4MFB A;  4DTM A;  4ILJ A;  2FSJ A;  1XQS C;  1VSJ A;  5M1P A;  4FOE A;  1R0A A;  4E7K A;  1OH8 A;  1U2V A;  4W5O A;  5EU7 A;  4KBO A;  1HYV A;  1OVQ A;  5HRN A;  1LV5 A;  3HOT A;  1VSF A;  3EY1 A;  4Z4F A;  5C42 A;  2W40 A;  3PX4 A;  4DU1 A;  4DQP A;  2Y1I A;  1K9M O;  5C2F A;  4X66 K;  3ZSX A;  1F21 A;  1VSI A;  3R3L A;  3MEE A;  4IG0 A;  1VQM N;  4AM6 A;  3P4I A;  3TTC A;  4WQ5 C;  1XWL A;  5HRO A;  3TAP A;  1WSJ A;  2O8B A;  3H1Q A;  4FWN A;  3VN5 A;  4RW9 A;  1WBB A;  3AA3 A;  4KH6 A;  5IT9 O;  4GVM A;  3LDP A;  1NKC A;  1RT6 A;  4DTO A;  2EX3 A;  3NBP A;  2CGK A;  1FKP A;  5JIC A;  4B9S A;  1LOT B;  3WXK A;  1IO2 A;  5C15 A;  4E7L A;  1X3N A;  3WEE A;  1C0G A;  4FJI A;  4H0V B;  2YI1 A;  3LWL A;  3G0Z A;  4DS4 A;  4FZX C;  4LH5 A;  4W5T A;  4ID5 A;  1VQL N;  4LF5 K;  4DV6 K;  3P1G A;  3B6O A;  1NLV A;  3LL3 A;  5LMU K;  4QAG A;  3NE6 A;  3AA4 A;  3MK6 A;  3ZET B;  1A5W A;  1GOC A;  2B4J A;  2QWM A;  2NRW A;  1EQY A;  3SYZ A;  4I9Q A;  4B3M K;  3EKS A;  3E66 A;  2ZM6 K;  1HX1 A;  2WOM A;  4CZE A;  4R5P A;  4ILH A;  2ZJP L;  4X62 K;  5SWM A;  2W42 A;  3H08 A;  4Z4H A;  2VWJ A;  2P51 A;  5AQR A;  5AFU H;  1NM1 A;  3EO3 A;  2PZS A;  4JV5 K;  2IDO A;  1HPZ A;  2FLO A;  4PKI A;  2X78 A;  5J2M A;  3FZF A;  3C6H A;  3BP8 A;  4FOI A;  4KHU A;  4KB1 A;  1BL3 A;  4A57 A;  4BE1 A;  4DV1 K;  1HYS A;  1NJX A;  4HTL A;  3ZET A;  4BE2 A;  2VG5 A;  2BE2 A;  2IVP A;  4HVJ A;  3JS6 A;  2F7T A;  1WN7 A;  2YNG A;  4H0T B;  3SMS A;  1I39 A;  4CHN A;  4YHH K;  4DTJ A;  2V51 B;  5AQL A;  1SUQ A;  4LF7 K;  1T7P A;  3MEC A;  5HRP A;  4AHR A;  2E20 A;  1U49 A;  2G8W A;  5E84 A;  3S3M A;  4CJK A;  3VEO A;  4BRL A;  3ULE A;  1ATR A;  3LP0 A;  2ZJR L;  3I33 A;  1JCE A;  4DU3 A;  4DFK A;  2P9U A;  4JI6 K;  4JKC A;  2HF4 A;  4K43 A;  4QCL A;  3PO5 A;  4CJR A;  4OO1 J;  1JCF A;  2XY8 A;  1NJZ A;  4CJ4 A;  1TKT A;  3AVB A;  4GV6 A;  1CZ9 A;  2XHB A;  3K5L A;  1S5J A;  3P39 A;  3ZSR A;  2PY5 A;  1T3V A;  1NU0 A;  5AQK A;  4E19 A;  3VTI A;  4CHY A;  1KXP A;  4LY7 A;  1TV6 A;  2HVH A;  5BN8 A;  4IDK A;  4WFN L;  4DFP A;  3OJS A;  5A2Q O;  4DQR A;  1X9J A;  3E9P A;  4NXM K;  3CMA N;  3ZX2 A;  4ID1 A;  3IFR A;  4F9O A;  5J2Q A;  4RG8 A;  1NK5 A;  3RMC A;  1NGI A;  4DV5 K;  2Z1H A;  4XH1 A;  4I7F A;  3CPE A;  1QSY A;  4KRF A;  2VGM A;  2P9S A;  2CGJ A;  1WUA A;  4E7H A;  1U47 A;  5C12 A;  3V9Z A;  2RKI A;  5DM7 L;  4IOC L;  2HVI A;  3RSE B;  2R7Y A;  5C0Y A;  2QXL A;  3NH2 A;  1IBK K;  3EE9 A;  4BRI A;  3SLC A;  3ZT0 A;  5AQT A;  2EHG A;  3D45 A;  4Y1C A;  4AHC A;  4JYA K;  1HNV A;  3TSU A;  4JI3 K;  4Z4G A;  1HKC A;  4H4O A;  5E41 A;  3VGL A;  3AVN A;  1RFQ A;  4JKA A;  2HB5 A;  4JN4 A;  3OS2 A;  1C0T A;  4B3R K;  2E2N A;  4FZY A;  4JRP A;  1NGC A;  1X9W A;  1NGE A;  3O8M A;  3HVR A;  1OH5 A;  3LZI A;  4U7B A;  2Z1G A;  5JS2 A;  1ZC6 A;  5GIP A;  1NKB A;  3AVC A;  3KLI A;  1ASV A;  2A40 A;  4B8C A;  3O9Q A;  2P9K A;  3SZ2 A;  4JI8 K;  4BG9 A;  1MDU B;  3RWU A;  2NRT A;  5K14 A;  3HP9 A;  1NMN A;  3DXM B;  4DR7 K;  1NGD A;  2ZJQ L;  4FJN A;  1KSP A;  1Q7Y O;  3LM9 A;  1HR0 K;  3HYF A;  3T1A A;  1BIS A;  1VQ6 N;  4I2P A;  1QVG M;  4PWD A;  1P8Z A;  1SKS A;  1GLA G;  4BR5 A;  2KZZ A;  1HUX A;  1QQN A;  3A8Y A;  4F3O A;  3QFP A;  3C94 A;  4DR5 K;  2YHB A;  2WUS A;  1VSE A;  4LC9 B;  1BO5 O;  3HK2 A;  3MEG A;  2UXC K;  3BGR A;  1DT9 A;  4M3R A;  1RGI A;  4CJ5 A;  4YOR A;  1BU6 O;  2QWN A;  4CIF A;  1D9D A;  1JCG A;  3V1R A;  3K5M A;  3C6A A;  3P83 D;  1W7A A;  1W97 L;  4DSF A;  3AVK A;  2YNH A;  3DXK A;  1TAQ A;  4AHS A;  3LAN A;  4M41 A;  3VEZ A;  1SQK A;  4CK3 A;  4DV0 K;  3EYZ A;  1MU2 A;  4A2A A;  5BRF A;  3AA2 A;  3G6E N;  2P9P A;  3N4P A;  3K57 A;  4KFB A;  4BRD A;  3SCX A;  4CIG A;  5M1N A;  1Z26 A;  4DMN A;  1TYQ B;  1Z6R A;  3WXM B;  3A5L C;  2UYT A;  4O5B A;  5EY4 A;  4BGB A;  3NMU A;  1KVC A;  3LZJ A;  3CC2 N;  3QEX A;  4X65 K;  4A59 A;  1H1V A;  5KGW A;  1BHL A;  4GV3 A;  3HM9 A;  1JLQ A;  1X9S A;  3DLE A;  4F4K A;  4CGF A;  5FLX O;  1N34 K;  4M3U A;  2FBT A;  4FVU A;  2E8A A;  2GUI A;  5AQF A;  3H45 C;  4XEI A;  1RDA A;  2G8V A;  3J7Y P;  2YHA A;  2QWP A;  2D0C A;  3SI6 A;  2D5R A;  5AQJ A;  3M3Z A;  5BPL A;  4JI4 K;  3FR0 A;  4IJA A;  1QHT A;  3CG7 A;  4FLY A;  3CJC A;  3THW B;  4B1Y B;  4CEZ A;  3PSI A;  3F2K A;  2P5G A;  2D0O A;  3IG1 A;  1M1K O;  4E3S A;  4BRF A;  3EEQ A;  3MXJ A;  4LF6 K;  2IAJ A;  1CLQ A;  3Q7C A;  4CZI A;  3DOK A;  3WXJ A;  4NYN A;  1BUP A;  4CF8 A;  1Q9Y A;  3FZK A;  2F96 A;  3OHR A;  1X9M A;  4OVL A;  3DRS A;  3DI6 A;  1GOA A;  3V1Q A;  1QZ6 A;  1WAJ A;  2HW3 A;  1L3V A;  3HVT A;  3AAQ A;  2OAN A;  3FFK B;  3BZK A;  3KLH A;  2OTL N;  1RDD A;  3THY B;  2UUB K;  2ZF5 O;  3I0S A;  1ZYQ A;  4MLE A;  4BRM A;  4DTR A;  3I56 N;  2ZWH A;  5JVG L;  1YIJ N;  2F8T A;  1Q18 A;  1XMO K;  3ZSO A;  3D2E A;  4H0X B;  3R6M A;  2WON A;  4CBX A;  4DTN A;  4AHU A;  3HL8 A;  1BA0 A;  3WXL A;  3ZX3 A;  3K9K A;  4ISF A;  4CZL A;  3QEW A;  1S1T A;  3SMP A;  1RDC A;  3ISN C;  1HQU A;  4BRC A;  3J7Z O;  3LPT A;  2YNI A;  1VQK N;  4CZK A;  2E6M A;  2QWR A;  5LMN K;  4ELV A;  1HNX K;  3CI5 A;  3VEY A;  3DXM A;  1E4G T;  3NF7 A;  3LAM A;  4B3T K;  4F3T A;  1JLC A;  3WQU A;  3BUZ B;  4FWK A;  3B6P A;  4O44 A;  3AAP A;  3F5T A;  3TAF A;  4OGE A;  2QWL A;  1I94 K;  2P9S B;  2OA8 A;  1XHZ A;  1A5V A;  3QNO A;  2IVO A;  4OJR A;  2KQ2 A;  1RTI A;  5J2P A;  3G25 A;  3TAB A;  1S1X A;  5FRM A;  5FPM A;  3BDP A;  5DM6 L;  1U4B A;  4DV3 K;  3BY5 A;  4FPB A;  2PFU A;  1SKR A;  4KRE A;  3VQ9 A;  4BG8 A;  1YF5 L;  4KHN A;  3LP1 A;  3QIN A;  2P9P B;  1XC9 A;  4IG3 A;  3UB5 A;  4CJV A;  1S6P A;  3FZM A;  3VQP A;  1Y97 A;  1JLE A;  4ILG B;  3MXI A;  4DSJ A;  4FWP A;  3ZEU A;  3QIO A;  1REV A;  3OYF A;  1MWM A;  3AO5 A;  3VQA A;  3CXC M;  2GWK A;  1VQ8 N;  3U4L A;  1D4X A;  4KHP K;  4IOX A;  5TKY A;  3CF5 L;  2IOC A;  3CC4 N;  3PSF A;  4B3O A;  2LSN A;  4IWV A;  2NUB A;  4FLW A;  2UXB K;  5F0X A;  3QFU A;  2BAN A;  3J80 O;  3CFO A;  1QSL A;  5F2R A;  4BRK A;  1C0F A;  2VGN A;  2E88 A;  5JMV A;  2ASP A;  1GLB G;  2JGU A;  2RN2 A;  4CHP A;  2FC0 A;  2GV9 A;  3VQ6 A;  4BC3 A;  3O9U A;  4RW7 A;  4DSK A;  3HJF A;  2CH6 A;  2FXU A;  4GKK K;  3OYE A;  1GLE G;  1S1U A;  4YDU A;  3ZSQ A;  1S9E A;  3ZT1 A;  1KVA A;  3CJ9 A;  3A2F A;  3MN7 A;  1NGG A;  3THW A;  4Z4I A;  4JKG A;  5CZ2 A;  3M8S A;  1U45 A;  4U67 L;  3J7A P;  4DLG A;  3LAL A;  3O08 A;  3EKU A;  1IKW A;  5GAE P;  3R9P A;  4A61 A;  4KHW A;  1RT7 A;  3QES A;  4B08 A;  1IH7 A;  4FLU A;  3VOV A;  1KC8 O;  4NO7 A;  3QEP A;  3NVM A;  1ZBF A;  3L8B A;  3C6T A;  1Q8I A;  1N8R O;  5M1F A;  2P9U B;  3WEE B;  1RNH A;  3LAK A;  3FE1 A;  3PO4 A;  4PQU A;  1SS6 A;  4UY8 O;  4M45 A;  3T1Y K;  2Q0R A;  4BRO A;  4CI6 A;  1S3X A;  2G8F A;  1YTU A;  3QER A;  2HST A;  4DUY K;  1Y64 A;  1BCO A;  4O8K A;  4LH4 A;  3BEX A;  3ZYY X;  4BC2 A;  3G4S N;  4GKJ K;  4IKF A;  3SUQ A;  3KWG A;  4JI7 K;  4HTU A;  4FJ5 A;  4RW8 A;  3V9U A;  3SV3 A;  3VQ7 A;  5H1S Q;  1YI2 N;  1KFS A;  3RMB A;  3O80 A;  1NK6 A;  4CEF A;  3D0P A;  4ISG A;  4HWI A;  2YJF A;  5CR4 A;  3KTQ A;  3SAH A;  2IC3 A;  1NGF A;  1WOQ A;  2VWK A;  5AFU A;  3N4Q A;  4V19 S;  5FRN A;  4FW2 A;  1JL2 A;  4KTW A;  2XRI A;  3OYC A;  4BRN A;  1RT5 A;  4FO0 A;  3GBT A;  1U48 A;  5KPT A;  4J2A A;  4FW1 A;  3AO1 A;  3KLF A;  4YY3 K;  1ZXO A;  2NNW A;  1WAF A;  3I8D A;  4IJN A;  1NOY A;  2F9W A;  1VQN N;  4KPY A;  1Z25 A;  5KQ8 A;  2QKK A;  3L2U A;  5GIN A;  3OYN A;  4FM0 A;  3IUC A;  3PUF A;  3AVJ A;  4CF2 A;  2IVN A;  2D1K A;  5C10 A;  2RPI A;  4EP5 A;  2GEM A;  3QLH A;  2HF3 A;  4H5T A;  2O8F B;  3VEV A;  4WCE L;  3CFR A;  1TL1 A;  3EN9 A;  1WSF A;  3KK1 A;  4B9Q A;  1T05 A;  1SL0 A;  1QQC A;  4WQ4 C;  3KHY A;  4PY5 A;  1XUP O;  2YHW A;  2QI2 A;  2Q1N A;  4DSI A;  1S6Q A;  4H5N A;  3CM5 A;  4NLB A;  4B9V A;  4NB4 A;  5KRT A;  4IEE A;  1SZ2 A;  3BF3 A;  4JKH A;  3CFP A;  4MO4 A;  3ZT4 A;  4B1Z A;  1VRU A;  1XNQ K;  4M3Z A;  1ESV A;  1BQM A;  4WFA L;  1LAV A;  2Q3S A;  1NGA A;  3TTD A;  4RTF D;  4CJL A;  2V52 B;  3M8R A;  3F9K A;  3O4Q A;  1GLF O;  3D7E O;  1ILY A;  2OYQ A;  3OYA A;  3O5B A;  3UKR A;  1VK0 A;  4R79 A;  4NYF A;  2HMI A;  3CCM N;  3DLL L;  3VQD A;  2NRV A;  3VQ5 A;  3SAG A;  2UUA K;  1B92 A;  4ZTJ A;  2ZD1 A;  3PV8 A;  3IKM A;  2VWB A;  4H5V A;  3SV4 A;  1QVF M;  3MXM A;  4BR0 A;  3HO1 A;  2HHT A;  4JS5 A;  4CE9 A;  3V6D A;  2DTU A;  2PYJ A;  5AQW A;  2PYL A;  3QIC A;  1HPM A;  3TR8 A;  2O4I A;  4FZZ A;  2JLE A;  3A0I X;  3O3H A;  2HNY A;  1Q86 O;  4CZF A;  3ID8 A;  3VQQ A;  1UAX A;  4JRQ A;  1E4F T;  2W41 A;  1GOB A;  2A5X A;  1UWB A;  3HOS A;  1T44 A;  5IWA K;  3CQ8 A;  4OPK A;  3SQ2 A;  1S9G A;  3LPU A;  3MDQ A;  1KVB A;  2YNF A;  3ALY A;  1LAW A;  3M5R A;  1M90 O;  4NCB A;  4DFM A;  4CGJ A;  4DR4 K;  5GAH P;  3PLA A;  1N32 K;  1UA1 A;  3ENB A;  4KAZ A;  3WXI A;  3RMD A;  3A5N C;  4H0O A;  3D2F B;  2VCP A;  2JWK A;  4B1U B;  2GWJ A;  2P9I A;  3JSM A;  3HP6 A;  1R59 O;  3OYJ A;  2W6L A;  3WNF A;  2O8E B;  3RRG A;  4JS4 A;  3HST B;  3LP3 A;  3VEN A;  2O8B B;  1T6D A;  1NWK A;  4OGC A;  3K5N A;  3ATV A;  3P5J A;  4CHO A;  1EET A;  4DTS A;  3BZC A;  2QWQ A;  1YVN A;  2QWO A;  2Q0U A;  4BWM A;  4CJT A;  4DR2 K;  4FLZ A;  2NRX A;  5M1Q A;  5AQH A;  3AA5 X;  3MX5 A;  4YOU A;  2HHU A;  5CYQ A;  4B1X B;  4BR7 A;  1KAY A;  1JXB A;  3FLC O;  4O0J A;  1RDB A;  4A62 A;  2E5L K;  4DUZ K;  3WUH A;  3AY9 A;  2HMP A;  4E1N A;  4NCA A;  3VGM A;  1L3U A;  1YVU A;  2ITM A;  4A5A A;  4L3Q A;  2A41 A;  4FL9 A;  1X3M A;  5AQM A;  3OYK A;  2QTD A;  4W5Q A;  4OPJ A;  4O0I A;  1B9D A;  5C25 A;  4K41 A;  2O8F A;  4FWL A;  1FJG K;  3KWI A;  3CJ1 A;  4M7X A;  1K6Y A;  4AH9 A;  1EWQ A;  3LDN A;  2E4L A;  4B9N A;  2XY6 A;  3OY9 A;  4FWQ A;  4H0Y B;  1X1P A;  4DG1 A;  3V9X A;  4QOZ B;  1NMD A;  4Z94 A;  5FPD A;  3R8E A;  3KZB A;  1NGH A;  3AAR A;  4RW6 A;  3HBT A;  3K0S A;  2DFH A;  4I6M A;  4WQ4 A;  2IGI A;  3DYA A;  2ITG A;  5ADX A;  1GLL O;  1YAG A;  3KK7 A;  5SZT A;  1J9A A;  4J2B A;  2WBN A;  4YOV A;  4N5S A;  2NRR A;  1LW2 A;  3E01 A;  3KIO A;  3OYI A;  4DF8 A;  2P9L B;  4RWT A;  3OS0 A;  5I42 A;  3O3F A;  4E1M A;  2FF6 A;  3DM2 A;  4DR3 K;  4FM1 A;  4CEO A;  5AR0 A;  4CJW A;  5LJW A;  2BH1 A;  4OKK A;  3PIO L;  2AP1 A;  4N41 A;  4PHT X;  5I3U A;  1U6Z A;  4CJE A;  1NGJ A;  4B9L A;  1TK0 A;  4F8R A;  2JWL A;  3QEV A;  3GG4 A;  3FZL A;  3SAF A;  1W9H A;  4CJS A;  1VRT A;  1EX4 A;  2EWS A;  4DQI A;  4IFV A;  3TSQ A;  4PKH A;  4CJQ A;  4BRQ A;  4CEB A;  2VQF K;  2OZS A;  3NF8 A;  4CVN E;  3MN9 A;  1CZB A;  4MO5 A;  3AGR A;  1NJW A;  1IG9 A;  4DFJ A;  3P38 A;  3TPQ A;  1T6C A;  3MWT A;  2XY7 A;  1YIT N;  3TSP A;  4DLE A;  4JI0 K;  4Q5V A;  4PUO A;  1N33 K;  4M3T A;  2D0B A;  1EP4 A;  5AQS A;  4Y1D A;  3MCP A;  4FJG A;  3PY8 A;  4YOT A;  4FK2 A;  1RT4 A;  5AQX A;  2X74 A;  4FJ9 A;  1K8K A;  5BN9 A;  2PAV A;  1L5U A;  1T8E A;  2FBY A;  3G10 A;  1MA9 B;  3ZCM A;  4CEA A;  5FRO A;  4EP4 A;  5KGX A;  4Y0W A;  3A5O C;  3HSC A;  3C7N A;  1D8Y A;  4KV8 A;  3DAW A;  3W0L A;  4L8R B;  3K2P A;  3TAN A;  4I2Q A;  2H3G X;  4KTZ A;  5MLC Q;  3L2R A;  1OH7 A;  2KFN A;  4MLH A;  2FSK A;  3ID6 A;  1BQN A;  4DKW A;  3EL2 A;  2G8I A;  4BDZ A;  3WQT A;  2CH5 A;  3H6E A;  2A6A A;  3ZSY A;  3NH1 A;  4HUG A;  3P31 A;  3S41 A;  1N6Q A;  4FJ8 A;  3CCV N;  3SUO A;  4DV4 K;  3L4I A;  3THY A;  4OKE A;  1J5O A;  4OX9 K;  4B1V A;  1JJ2 M;  4IO8 A;  1HNI A;  1QSS A;  3QML A;  4CEE A;  1V4T A;  1RT1 A;  3V9W A;  4YOX A;  1NJY A;  5TKW A;  3L3U A;  4H4M A;  3U9D A;  4E1J A;  2Q36 A;  3CM6 A;  3THV A;  1JL1 A;  3AO3 A;  3VF2 A;  5I9E B;  4CES A;  4YFU A;  4I9L A;  3O6W A;  1WBD A;  3THX B;  4DB3 A;  3SQ1 A;  1WSI A;  1OH6 A;  4FLX A;  4DTX A;  4HCB A;  4IO9 L;  3AGK A;  4IZ9 A;  5C24 A;  1NK9 A;  4BR9 A;  4KB0 A;  4FJH A;  2E2P A;  5JVH L;  5EXW A;  4DU4 A;  4K42 A;  4FWO A;  3DXK B;  4OKJ A;  1KFD A;  4J8F A;  3DOL A;  1NK8 A;  2UUC K;  3QO9 A;  3DRP A;  3U3G A;  2HHH K;  4E0D A;  3RR7 A;  5EOY A;  4CF1 A;  4DF4 A;  1VQO N;  4ISE A;  4CZG A;  4CZM A;  2WTU A;  4N76 A;  2F9T A;  4CGH A;  5M1O A;  4BR2 A;  1WSE A;  1C6V A;  3AVF A;  4BQZ A;  1WB9 A;  2YX6 A;  4M7Y A;  5HL7 L;  3R1X A;  2ZGY A;  1VHX A;  2HHW A;  2W6K A;  3KKS A;  5C2D A;  4FWR A;  1DLO A;  1HJR A;  1OKJ A;  3OBY A;  3OS1 A;  4KI6 A;  3CCQ N;  4CEC A;  4LD0 A;  2D0A A;  5AQG A;  4Z4C A;  2HHS A;  3NGI A;  2Q97 A;  3VEW A;  3D6R A;  3H3N O;  1TYQ A;  2YCH A;  5BRD A;  3TI0 A;  4AM7 A;  5JS1 A;  4ZHR A;  1WLJ A;  2QK9 A;  2KW4 A;  4LF8 K;  4CED A;  4DSE A;  3CCS N;  3SQ4 A;  1TK8 A;  1Z05 A;  4CK1 A;  1BWF O;  3VF6 A;  2VG6 A;  4NXN K;  4K8X A;  2HBM A;  5ELZ A;  1FXX A;  4LSL A;  3CCE N;  1BCM A;  4K25 A;  4DS5 A;  3EE8 A;  1S72 N;  3MN6 A;  4BVP A;  1NNE A;  3TTF A;  1J53 A;  4WYB A;  4BRG A;  4BE0 A;  5LL6 Z;  2QM1 A;  4JKB A;  4DV7 K;  1IV0 A;  3C7N B;  1LWE A;  3U6F A;  3RR8 A;  2E2O A;  4BR4 A;  1SAZ A;  3AVG A;  4E89 A;  5KQD A;  3WT0 A;  3HTV A;  3HM8 A;  5AQP A;  4IEI A;  1YJW N;  1IKY A;  3F73 A;  4Z0U A;  5BR9 A;  2A1S A;  4CJ3 A;  4JAX A;  2I5J A;  2KFZ A;  2D4W A;  3RTV A;  3MCA B;  4FWM A;  4JKD A;  3CQY A;  1LW0 A;  1ZBI A;  5LY3 A;  5KI6 A;  4CD3 A;  1EWR A;  1RBT A;  4IBN A;  2D0P A;  1D9F A;  4BVO A;  1LWC A;  1TKX A;  1BIU A;  2ZE2 A;  4CER A;  5BRH A;  4CEQ A;  4GW6 A;  5ADX H;  4PA1 A;  3QB0 A;  3V4I A;  4BDY A;  3O1B A;  5FDL A;  5BRE A;  3WNH A;  5JLH A;  4WE1 A;  3VQC A;  3KD5 E;  3LDL A;  1C0U A;  3OBW A;  5EX5 A;  4FJL A;  1S22 A;  4BGA A;  4BC4 A;  3OA9 A;  3C65 A;  3KD1 E;  4DSL A;  4JD2 B;  4LFB K;  2GTD A;  3DLK A;  1DEJ A;  2IIR A;  2V7Z A;  3LDQ A;  4QS8 A;  3TAM A;  3CJ7 A;  4ICL A;  4E7I A;  3NVK A;  4HHT A;  4C8O A;  4B9U A;  1NBW A;  3L6Q A;  1RT3 A;  1J54 A;  4DR1 K;  3IAY A;  2BTF A;  2KZM A;  1K73 O;  5BPM A;  3L2V A;  1J5E K;  3CC7 N;  3AVH A;  5AZJ B;  3JAM O;  1K8K B;  3MX2 A;  2P5O A;  1XI1 A;  2O4G A;  4CJF A;  4CF0 A;  3NAE A;  1HKB A;  5KPZ A;  4EZ9 A;  1C1C A;  4AQY K;  2P9K B;  1CXQ A;  3ITH A;  4M3X A;  2HBK A;  3VET A;  3LDS A;  4KI4 A;  3OW2 M;  1RIL A;  1FW6 A;  2B6A A;  4O5F A;  3CPW M;  1IKV A;  1EO1 A;  3GE1 A;  1IKX A;  3VTH A;  5GIO A;  2BDP A;  1NK0 A;  3QBW A;  1N5Y A;  4G1Q A;  3KLE A;  3K9J A;  2P9N A;  3DRR A;  4M3Y A;  2B5J A;  3K59 A;  2YJE A;  3KVG A;  5HP1 A;  4IOA L;  3H46 O;  3E1Y A;  3OYG A;  3L3V A;  4RW4 A;  2BUP A;  5DMR A;  4PL8 A;  4JKF A;  1L3T A;  3MMV A;  1VAZ A;  3NF9 A;  3TAE A;  1TKD A;  1HNW K;  3OJU A;  5AQO A;  3O3G A;  3HT3 A;  2VG7 A;  1JKH A;  4CZJ A;  5AZI B;  4WF9 L;  3V9S A;  3T1H K;  2O8D B;  3DLB A;  5CHI A;  3RSE A;  4AHT A;  4UQG A;  5D3G A;  1TL3 A;  1VSM A;  2A42 A;  4BRA A;  4FJK A;  1SKW A;  4DWI A;  2I7N A;  3K5O A;  3WNG A;  1QS4 A;  1KD1 O;  4GVE A;  3S9H A;  3OYM A;  2Y1J A;  3GL1 A;  1RBV A;  4JKG B;  2QXF A;  3K58 A;  1HJO A;  3NH0 A;  5FPE A;  3SJH A;  4H5R A;  4DR6 K;  1VSD A;  4JK8 A;  3OTO K;  4IFE A;  3W3D A;  3AO4 A;  4JEP A;  3B8A X;  4FJM A;  1D5A A;  1TUY A;  1N36 K;  4B9T A;  1RDW X;  3H3O B;  1B9F A;  2KKZ A;  3KK3 A;  2A3Z A;  4F2R A;  1WSG A;  3S3O A;  4XH4 A;  4CJP A;  1ZBU A;  3EZW A;  4FWS A;  3IMX A;  1VQP N;  3AO2 A;  3ASM A;  3AVM A;  2O8C B;  2WFB A;  5BPN A;  2QA4 N;  3MAQ A;  2E2Q A;  3M1F A;  1E3M A;  1SL1 A;  3LP2 A;  5KTQ A;  1ITG A;  4B8A B;  4FJX A;  1J6Z A;  4AHV A;  4BRE A;  4XIU A;  1RT2 A;  2DPN A;  4H0P A;  3JYT A;  3MWP A;  2YKM A;  4DTP A;  2F4V K;  1G99 A;  2WC9 A;  1L3S A;  3VER A;  1XMQ K;  4LFA K;  3ZSW A;  1DTQ A;  2ATQ A;  4YNQ A;  4OLB A;  1EXQ A;  3CJB A;  1VSH A;  4B9M A;  1NOZ A;  1ATN A;  4M63 C;  1K8A O;  3C95 A;  2HHV A;  2QKB A;  1TGO A;  1VSK A;  5CY4 A;  4B1W B;  3IDH A;  5CE3 A;  3UIQ A;  3UKR B;  1JLA A;  2Z1J A;  4JKE A;  1UOC A;  3V81 A;  2ZGZ A;  3CYM A;  1QTM A;  3CHW A;  3I0R A;  4CW7 B;  1SV5 A;  3TWH A;  1KCF A;  2V7Y A;  3NDK A;  3E9O A;  1RBS A;  5AQI A;  3CJA A;  3L4Q A;  2DFF A;  1LCU A;  3U8X A;  3SQ0 A;  1EKE A;  4W5R A;  3AVL A;  3ZLJ A;  2P1J A;  5M1K A;  2I7P A;  1XNR K;  1KLM A;  4JLH A;  4MDA A;  1NGB A;  1XHX A;  3O1W A;  1FKO A;  3JXU A;  3NFA A;  3CQX A;  3U9Z A;  4YDU C;  4BQL A;  3VQ4 A;  2HNZ A;  4MDB A;  2RF2 A;  1HLU A;  3ATU A;  4BAC A;  4O4G A;  3CCL N;  2XO7 A;  3T7Z A;  1BI4 B;  5T7B A;  3C6U A;  3CME N;  4JI1 K;  1YJ9 N;  3SUP A;  3CIP A;  3TAG A;  4QS9 A;  3AV9 A;  1BG3 A;  3ZX0 A;  1YHQ N;  4IXC A;  4CCH A;  1DTT A;  2QW9 A;  4N56 A;  2P9N B;  2OTJ N;  3QIP A;  4N47 A;  3CCR N;  4KHS A;  3LWM A;  4O8U A;  2FF3 B;  1KAZ A;  1HKG A;  2NRZ A;  4KHQ A;  3ULD A;  4CJU A;  3OYL A;  5E26 A;  4C23 A;  3RRH A;  4JHD A;  1IJJ A;  3BF1 A;  4QS7 A;  2Z1I A;  3VF4 A;  3H1V X;  1KLN A;  2YHY A;  4BY9 C;  2UU9 K;  2OPS A;  3L0Q A;  4E7J A;  2GUP A;  1KQS M;  4W5N A;  1WNS A;  3FZH A;  4FJJ A;  5LJV A;  5HBM A;  3OYB A;  3HZ6 A;  4BDP A;  3CCJ N;  1C0M A;  4CHQ A;  1JLG A;  3NGZ A;  5BR8 K;  1S1V A;  4KHY A;  3O9S A;  1SL2 A;  3UKU B;  1GLJ O;  4DV2 K;  3C0B A;  1YXQ A;  3DLH A;  1QZ5 A;  1RCH A;  2ETJ A;  2XY5 A;  4FK4 A;  1O1W A;  4JI5 K;  3HXM A;  4LF4 K;  2FBX A;  3VA0 A;  3HPH A;  3I55 N;  1U2V B;  2KHO A;  3SPY A;  2FSN A;  1RBU A;  1T03 A;  5HLF A;  3D2E B;  4I6M B;  3CET A;  1VQ4 N;  4CFA A;  2NZT A;  4J2D A;  5EVZ A;  3CD6 N;  3HPO A;  4CFD A;  1QE1 A;  2GEL A;  3TAR A;  2O8E A;  5AQN A;  4B3S K;  3ENH A;  2HHQ A;  1NKE A;  2J4R A;  1V4S A;  3VQB A;  1U04 A;  4JNE A;  1HYZ A;  4NCG A;  4BC5 A;  3U3Y A;  1TVR A;  3DLG A;  3PX0 A;  1HQE A;  4OLA A;  4AIL C;  4DQ8 A;  3VQE A;  1JXE A;  2KTQ A;  3KKR A;  2HND A;  4CBU A;  2DFE A;  1UA0 A;  3KK2 A;  3WNE A;  1VSL A;  4KTQ A;  1ASW A;  4PKG A;  2NLX A;  5GAD P;  4K0K K;  1RBR A;  1YUW A;  4GMJ B;  2A1R A;  1OVY A;  5HRR A;  4WFB L;  4FCY A;  1P90 A;  5FPN A;  3VPZ A;  1BGX T;  4C8N A;  3HPG A;  4FJ7 A;  3J8A A;  2HBL A;  2OPR A;  2OPQ A;  1BA1 A;  2Q2R A;  3CCU N;  1NJI O;  3IS9 A;  3HRG A;  5J1E A;  3SNN A;  2G8K A;  1IG8 A;  1C1B A;  4H5W A;  4H8K A;  1DGK N;  2AA4 A;  3M8Q A;  2QEX N;  4KKO A;  3QEI A;  1RDU A;  1S1W A;  3V1O A;  3LM2 A;  1HRH A;  4EFH A;  4J2E A;  3OYH A;  3DMJ A;  3D2F A;  5KRS A;  4GNI A;  4CGD A;  2BGG A;  2UXD K;  1DKG D;  3TAQ A;  4JK9 A;  2P9I B;  2YV0 X;  1JLB A;  4C1N I;  4G9Z A;  1FK9 A;  5HOO A;  3KJV A;  3SUN A;  3OYD A;  3IRX A;  1Q9X A;  3VA3 A;  1C1A A;  2HOE A;  4JK7 A;  3F9M A;  3AVI A;  2E1Z A;  1QQM A;  4ZTF A;  2Q31 A;  2X6S A;  3PIP L;  1NG9 A;  1YJN N;  4M3W A;  1Q82 O;  3SJJ A;  4TSX A;  2ZQB A;  3VMF B;  4ELT A;  3L2W A;  3J81 O;  1HNZ K;  1BI4 A;  5AQU A;  3VEX A;  2ASM A;  4DCH A;  2O8C A;  4C8M A;  3NCI A;  4EAH D;  4C8K A;  2AJQ A;  2DY4 A;  3GDQ A;  3KLG A;  2G8U A;  4ELU A;  1G15 A;  4YOY A;  4FSV A;  4DQS A;  5CZ1 A;  1ATS A;  4CK2 A;  2E6L A;  4Z4E A;  5AZJ A;  1IBL K;  3G71 N;  3Q7B A;  3ZSV A;  1WSH A;  2IS3 A;  2OPP A;  2CGL A;  3T19 A;  4FYD A;  2FBV A;  2NRH A;  4O55 A;  1ZBS A;  5AQQ A;  4Q0B A;  1TK5 A;  4HCC A;  4FM2 A;  2X6N A;  5KPR A;  2P9L A;  3VQ8 A;  3M6G A;  3S3N A;  5HRS A;  3THX A;  3O4N A;  5DK5 A;  3HI0 A;  3L2Q A;  2OCE A;  4JI2 K;  1RTH A;  4FVM A;  4FXD A;  4YOW A;  3M8P A;  1YT3 A;  1QHA A;  4HUE A;  4FPA A;  1VQ5 N;  2VQE K;  4DQQ A;  5AQY A;  3VES A;  1BIZ A;  4CIE A;  4LF9 K;  2F8S A;  1CXU A;  1MWK A;  1O13 A;  1W0H A;  4K8Z A;  4CF9 A;  1VQ9 N;  3PX6 A;  3ZEU B;  3FFI A;  3GOI A;  4GV9 A;  2HBJ A;  2KLA A;  3QNN A;  4EHU A;  4WQ5 A;  4M42 A;  1TAU A;  1RTJ A;  1ASU A;  2RE2 A;  5AZI A;  4BRH A;  2O8D A;  5AQZ A;  1KAX A;  4IDH A;  3O9R A;  5AJ3 K;  4A5B A;  1GLC G;  3MED A;  1QQO A;  3NGY A;  1KTQ A;  5AQV A;  1HMV A;  4CZH A;  3O9T A;  2PBD A;  4CJ7 A;  4LSN A;  4AF1 A;  3ZT2 A;  2YHX A; 
#chains in the Genus database with same CATH homology
 4CEZ A;  5J2N A;  5CYQ A;  3NF6 A;  4CGG A;  2P5G A;  3DRR A;  1JXB A;  3IG1 A;  4CGI A;  4M3Y A;  2B5J A;  4E3S A;  4O0J A;  3K59 A;  4KO0 A;  1RDB A;  3MXJ A;  5HP1 A;  4FLY A;  4BWJ A;  3OYG A;  1NK4 A;  2IAJ A;  3L3V A;  1CLQ A;  4RW4 A;  3ZSZ A;  4HUF A;  5DMR A;  4E1N A;  4NCA A;  3DOK A;  4NYN A;  3AVA A;  1L3T A;  1L3U A;  1YVU A;  2GBZ A;  3NF9 A;  3TAE A;  4FK0 A;  1TKD A;  4CF8 A;  4CFB A;  1Q9Y A;  3OJU A;  2F96 A;  3SPZ A;  3O3G A;  5CYM A;  2VG7 A;  1JKH A;  3HT3 A;  3EZ5 A;  3OYK A;  3V9S A;  1X9M A;  3DLB A;  4OVL A;  4W5Q A;  4UQG A;  1NK7 A;  3DRS A;  4AHT A;  5D3G A;  1TL3 A;  1VSM A;  4OPJ A;  3DI6 A;  1B9D A;  3OVN A;  5C25 A;  4O0I A;  1GOA A;  1SKW A;  4FJK A;  4DWI A;  3V1Q A;  3K5O A;  3WNG A;  2G8H A;  1QS4 A;  1WAJ A;  2HW3 A;  1K6Y A;  3S9H A;  1ZBL A;  4AH9 A;  3OYM A;  2Y1J A;  1L3V A;  3HVT A;  3QET A;  1RBV A;  2E4L A;  4IFY A;  4B9N A;  4C8L A;  2XY6 A;  3KLH A;  3OY9 A;  1RDD A;  4DG1 A;  1X1P A;  2QXF A;  3V9X A;  3K58 A;  1RTD A;  4QOZ B;  3NH0 A;  1YTA A;  3I0S A;  4FLV A;  1ZYQ A;  2HHX A;  2YKN A;  4RW6 A;  4DTR A;  1VSD A;  4MQ3 A;  1I3A A;  2DFH A;  3AO4 A;  2IGI A;  1TKZ A;  4FJM A;  1D5A A;  3DYA A;  2ITG A;  2F8T A;  5SZT A;  1A5X A;  1J9A A;  4J2B A;  4CHZ A;  4B9T A;  3ZSO A;  1B9F A;  4N5S A;  4FLT A;  3KK3 A;  1KRP A;  4F2R A;  1LWF A;  1LW2 A;  2WON A;  1WSG A;  3E01 A;  3KIO A;  3OYI A;  3S3O A;  4EZ6 A;  4DTN A;  4CJP A;  4DF8 A;  3OS0 A;  1ZBU A;  4AHU A;  3T3F A;  5I42 A;  3O3F A;  3HL8 A;  4E1M A;  3DM2 A;  4FM1 A;  3DLR A;  4CEO A;  1ZBH A;  4DTU A;  3AO2 A;  3ASM A;  3AVM A;  3QEW A;  4CJW A;  1S1T A;  3MAQ A;  1RDC A;  3ISN C;  1HQU A;  4OKK A;  3NHG A;  3LPT A;  2YNI A;  4N41 A;  1SL1 A;  2E6M A;  3LP2 A;  5KTQ A;  5I3U A;  1ITG A;  1JLF A;  4B8A B;  4CJE A;  4ELV A;  4FJX A;  4F2S A;  3ZT3 A;  1TK0 A;  4B9L A;  4F8R A;  4AHV A;  3RMA A;  2OZM A;  4CFC A;  4XIU A;  3QEV A;  1RT2 A;  4MFB A;  3NF7 A;  1W9H A;  3JYT A;  3LAM A;  4DTP A;  2YKM A;  4CJS A;  1VRT A;  1EX4 A;  4DTM A;  4F3T A;  1JLC A;  4DQI A;  4IFV A;  1L3S A;  3B6P A;  4O44 A;  1VSJ A;  4CJQ A;  3ZSW A;  4CEB A;  4OGE A;  3TAF A;  2OZS A;  3NF8 A;  1R0A A;  4E7K A;  2OA8 A;  1CZB A;  1A5V A;  1DTQ A;  2ATQ A;  4YNQ A;  3QNO A;  1XHZ A;  1NJW A;  4OJR A;  4W5O A;  2KQ2 A;  1RTI A;  5EU7 A;  5J2P A;  1HYV A;  4DFJ A;  1IG9 A;  1EXQ A;  4OLB A;  1VSH A;  5HRN A;  1LV5 A;  3EY1 A;  1VSF A;  4B9M A;  1NOZ A;  2XY7 A;  5C42 A;  1S1X A;  3PX4 A;  3TAB A;  5FRM A;  4Z4F A;  4DU1 A;  3C95 A;  4DLE A;  4DQP A;  2QKB A;  2HHV A;  2Y1I A;  3BDP A;  4Q5V A;  1U4B A;  1TGO A;  1VSK A;  4PUO A;  5CY4 A;  3ZSX A;  1F21 A;  1VSI A;  4M3T A;  2D0B A;  1EP4 A;  3MEE A;  4Y1D A;  1SKR A;  3UIQ A;  1JLA A;  2Z1J A;  4FJG A;  3VQ9 A;  4KRE A;  3PY8 A;  4IG0 A;  1UOC A;  3V81 A;  4KHN A;  3CYM A;  4FK2 A;  1RT4 A;  3LP1 A;  3QIN A;  1QTM A;  3I0R A;  1XC9 A;  4IG3 A;  2X74 A;  4FJ9 A;  4CJV A;  1S6P A;  3VQP A;  1Y97 A;  1SV5 A;  1XWL A;  1L5U A;  1JLE A;  3TWH A;  5HRO A;  3TAP A;  1WSJ A;  1T8E A;  3MXI A;  2FBY A;  1KCF A;  3G10 A;  4DSJ A;  3NDK A;  3ZCM A;  3VN5 A;  1RBS A;  4RW9 A;  3QIO A;  4CEA A;  1REV A;  3OYF A;  3AA3 A;  2DFF A;  5FRO A;  3AO5 A;  3VQA A;  4EP4 A;  5KGX A;  3SQ0 A;  1EKE A;  4W5R A;  3AVL A;  4GVM A;  2P1J A;  2IOC A;  1D8Y A;  4KV8 A;  4B3O A;  2LSN A;  1RT6 A;  4DTO A;  1KLM A;  4JLH A;  1NKC A;  3K2P A;  4L8R B;  1XHX A;  2EX3 A;  2NUB A;  3NBP A;  4FLW A;  3TAN A;  1FKO A;  1FKP A;  4I2Q A;  2BAN A;  3NFA A;  3CFO A;  4KTZ A;  3L2R A;  1QSL A;  4B9S A;  2KFN A;  3VQ4 A;  2HNZ A;  1IO2 A;  2RF2 A;  4E7L A;  4BAC A;  4O4G A;  1BQN A;  2JGU A;  2RN2 A;  4FJI A;  4CHP A;  2G8I A;  2XO7 A;  2FC0 A;  1BI4 B;  2GV9 A;  3VQ6 A;  3C6U A;  5T7B A;  3G0Z A;  3LWL A;  4RW7 A;  4BDZ A;  4DS4 A;  4DSK A;  4FZX C;  4LH5 A;  3HJF A;  4W5T A;  3SUP A;  4ID5 A;  3OYE A;  3TAG A;  3ZSY A;  3P1G A;  3B6O A;  3AV9 A;  3NH1 A;  4HUG A;  1S1U A;  4QAG A;  3ZSQ A;  3NE6 A;  3AA4 A;  1DTT A;  1S9E A;  4N56 A;  1A5W A;  1KVA A;  3ZT1 A;  3A2F A;  1GOC A;  1N6Q A;  4FJ8 A;  3SUO A;  2B4J A;  5CZ2 A;  4Z4I A;  3QIP A;  4N47 A;  3M8S A;  1U45 A;  4KHS A;  3LWM A;  3SYZ A;  4DLG A;  4OKE A;  1J5O A;  4I9Q A;  1QSS A;  1HNI A;  3LAL A;  4KHQ A;  3ULD A;  4CJU A;  1IKW A;  4CEE A;  3OYL A;  2WOM A;  4R5P A;  1RT1 A;  3V9W A;  4KHW A;  1RT7 A;  3QES A;  1NJY A;  3RRH A;  4B08 A;  3L3U A;  4H4M A;  1IH7 A;  5SWM A;  4FLU A;  2W42 A;  2Z1I A;  3H08 A;  4Z4H A;  1KLN A;  2OPS A;  2VWJ A;  3CM6 A;  2P51 A;  3QEP A;  3THV A;  4E7J A;  1JL1 A;  1ZBF A;  3L8B A;  1WNS A;  4FJJ A;  4W5N A;  3AO3 A;  5HBM A;  3C6T A;  3OYB A;  1Q8I A;  4CES A;  4YFU A;  4BDP A;  4I9L A;  2PZS A;  2IDO A;  1HPZ A;  1C0M A;  4CHQ A;  1JLG A;  2X78 A;  5J2M A;  3SQ1 A;  1WSI A;  1RNH A;  3LAK A;  3NGZ A;  4FLX A;  4DTX A;  1S1V A;  3PO4 A;  4HCB A;  4KHY A;  5C24 A;  1NK9 A;  1SL2 A;  4PQU A;  4KB0 A;  4FJH A;  4KB1 A;  4KHU A;  1BL3 A;  4DU4 A;  4BE1 A;  4M45 A;  3DLH A;  2ETJ A;  1RCH A;  2XY5 A;  4OKJ A;  1HYS A;  4FK4 A;  1O1W A;  1NJX A;  1KFD A;  3HXM A;  3DOL A;  4BE2 A;  2FBX A;  1NK8 A;  2VG5 A;  3HPH A;  2BE2 A;  3VA0 A;  2G8F A;  1YTU A;  4HVJ A;  3QER A;  3QO9 A;  3DRP A;  1WN7 A;  3U3G A;  4E0D A;  3RR7 A;  2YNG A;  4CF1 A;  4DF4 A;  1I39 A;  3SPY A;  4CHN A;  4DTJ A;  1SUQ A;  1BCO A;  1RBU A;  4N76 A;  4LH4 A;  1T7P A;  3MEC A;  5HRP A;  5HLF A;  1T03 A;  4AHR A;  4CGH A;  4IKF A;  3SUQ A;  1U49 A;  2G8W A;  3S3M A;  4FJ5 A;  4CJK A;  4HTU A;  4RW8 A;  4CFA A;  3V9U A;  3SV3 A;  1WSE A;  4J2D A;  3VQ7 A;  1C6V A;  3AVF A;  1KFS A;  3LP0 A;  3HPO A;  4CFD A;  3RMB A;  1NK6 A;  1QE1 A;  4CEF A;  3D0P A;  4DU3 A;  4DFK A;  3TAR A;  3KTQ A;  2IC3 A;  2HHW A;  4QCL A;  2VWK A;  3KKS A;  3PO5 A;  4CJR A;  2HHQ A;  5FRN A;  2XY8 A;  4FW2 A;  1JL2 A;  1NJZ A;  4CJ4 A;  4KTW A;  1NKE A;  1TKT A;  1DLO A;  1HJR A;  3OS1 A;  3AVB A;  4KI6 A;  1CZ9 A;  2XHB A;  3K5L A;  1S5J A;  2XRI A;  3OYC A;  1RT5 A;  1U48 A;  3ZSR A;  3VQB A;  1U04 A;  4NCG A;  1HYZ A;  2D0A A;  4LD0 A;  4CEC A;  3U3Y A;  4Z4C A;  1TVR A;  3DLG A;  2PY5 A;  3PX0 A;  1HQE A;  4FW1 A;  4CCH A;  4J2A A;  4OLA A;  3AO1 A;  4E19 A;  3KLF A;  4AIL C;  2HHS A;  4CHY A;  3NGI A;  4LY7 A;  1TV6 A;  3VQE A;  2HVH A;  1JXE A;  4IDK A;  2KTQ A;  3KKR A;  2HND A;  2DFE A;  4DFP A;  1WAF A;  3OJS A;  3I8D A;  4DQR A;  3TI0 A;  1NOY A;  1UA0 A;  3KK2 A;  4ID1 A;  3WNE A;  1VSL A;  4KTQ A;  4KPY A;  5J2Q A;  1ASW A;  4RG8 A;  1Z25 A;  5JS1 A;  2QKK A;  4ZHR A;  1RBR A;  1WLJ A;  1NK5 A;  4GMJ B;  3L2U A;  3RMC A;  2A1R A;  2QK9 A;  2KW4 A;  3OYN A;  4FM0 A;  2Z1H A;  4CED A;  4DSE A;  3SQ4 A;  3PUF A;  5HRR A;  1TK8 A;  3AVJ A;  4I7F A;  4CF2 A;  1QSY A;  4FCY A;  4KRF A;  1BGX T;  4CK1 A;  4C8N A;  3HPG A;  2RPI A;  2VG6 A;  4EP5 A;  4K8X A;  3QLH A;  4E7H A;  1U47 A;  4FJ7 A;  3V9Z A;  1FXX A;  2RKI A;  4LSL A;  1BCM A;  2OPR A;  3CFR A;  2HVI A;  2OPQ A;  1TL1 A;  2R7Y A;  3IS9 A;  1WSF A;  5J1E A;  3KK1 A;  4DS5 A;  3SNN A;  1C1B A;  3NH2 A;  1T05 A;  1SL0 A;  2G8K A;  1QQC A;  4H8K A;  4PY5 A;  3ZT0 A;  3M8Q A;  1J53 A;  4DSI A;  2EHG A;  3D45 A;  1S6Q A;  4Y1C A;  4KKO A;  4AHC A;  3CM5 A;  4B9V A;  3QEI A;  1HNV A;  1S1W A;  4BE0 A;  5KRT A;  3V1O A;  1HRH A;  4Z4G A;  4H4O A;  5E41 A;  3CFP A;  3ZT4 A;  4J2E A;  3OYH A;  3DMJ A;  1LWE A;  1VRU A;  3AVN A;  5KRS A;  4M3Z A;  4CGD A;  1BQM A;  2BGG A;  3U6F A;  2HB5 A;  3RR8 A;  1LAV A;  2Q3S A;  3TAQ A;  4CJL A;  3OS2 A;  2YV0 X;  3AVG A;  1JLB A;  4E89 A;  1C0T A;  3F9K A;  3M8R A;  1FK9 A;  3KJV A;  4JRP A;  3O4Q A;  3SUN A;  3OYD A;  1X9W A;  4FZY A;  3IRX A;  3HVR A;  3LZI A;  1Q9X A;  3VA3 A;  1IKY A;  3F73 A;  2Z1G A;  4Z0U A;  5JS2 A;  2A1S A;  1NKB A;  1C1A A;  3AVC A;  1ASV A;  3KLI A;  4CJ3 A;  2I5J A;  2KFZ A;  3AVI A;  3RTV A;  4B8C A;  4ZTF A;  2OYQ A;  2X6S A;  1LW0 A;  3OYA A;  1ZBI A;  3SZ2 A;  5KI6 A;  4M3W A;  1VK0 A;  1RBT A;  3SJJ A;  4IBN A;  4TSX A;  2ZQB A;  4NYF A;  4ELT A;  1D9F A;  3L2W A;  2HMI A;  3RWU A;  5K14 A;  1LWC A;  1TKX A;  1BIU A;  2ZE2 A;  3HP9 A;  1BI4 A;  3VQD A;  4C8M A;  4CER A;  3NCI A;  4C8K A;  3VQ5 A;  2AJQ A;  2DY4 A;  1B92 A;  4ZTJ A;  3KLG A;  4FJN A;  2G8U A;  2ZD1 A;  3PV8 A;  4ELU A;  1G15 A;  4CEQ A;  1KSP A;  4GW6 A;  3SV4 A;  3HYF A;  4PA1 A;  3MXM A;  4DQS A;  3T1A A;  3HO1 A;  2HHT A;  1BIS A;  5CZ1 A;  4I2P A;  4CE9 A;  4JS5 A;  3V4I A;  3V6D A;  4CK2 A;  2E6L A;  4BDY A;  2PYJ A;  5FDL A;  2PYL A;  4PWD A;  2DTU A;  3WNH A;  1SKS A;  3TR8 A;  4Z4E A;  4WE1 A;  3VQC A;  3KD5 E;  2O4I A;  2KZZ A;  4FZZ A;  3ZSV A;  1C0U A;  1WSH A;  2IS3 A;  2JLE A;  4F3O A;  2OPP A;  3O3H A;  2HNY A;  3C94 A;  3T19 A;  4FYD A;  2YHB A;  2FBV A;  3VQQ A;  1UAX A;  4O55 A;  4FJL A;  1VSE A;  4JRQ A;  3HK2 A;  4Q0B A;  1GOB A;  1UWB A;  3KD1 E;  4DSL A;  3MEG A;  1TK5 A;  4FM2 A;  2X6N A;  4HCC A;  3BGR A;  4M3R A;  3CQ8 A;  4CJ5 A;  4OPK A;  3SQ2 A;  3DLK A;  1S9G A;  3LPU A;  3VQ8 A;  4CIF A;  1KVB A;  2YNF A;  3ALY A;  1LAW A;  3TAM A;  3S3N A;  1D9D A;  4NCB A;  3V1R A;  4CGJ A;  5HRS A;  3K5M A;  4DFM A;  3P83 D;  4ICL A;  3O4N A;  3AVK A;  2YNH A;  4E7I A;  4DSF A;  4HHT A;  4AHS A;  1TAQ A;  5DK5 A;  3LAN A;  4M41 A;  4B9U A;  4C8O A;  1RT3 A;  1UA1 A;  4CK3 A;  3L2Q A;  4KAZ A;  1RTH A;  1J54 A;  4FVM A;  3RMD A;  4FXD A;  3M8P A;  3EYZ A;  1YT3 A;  3IAY A;  1MU2 A;  4HUE A;  2KZM A;  3L2V A;  3AA2 A;  4DQQ A;  3AVH A;  3JSM A;  3HP6 A;  3K57 A;  4KFB A;  1BIZ A;  4CIE A;  2P5O A;  3SCX A;  4CIG A;  1XI1 A;  1Z26 A;  4DMN A;  3OYJ A;  3WNF A;  2F8S A;  2O4G A;  3RRG A;  1CXU A;  3HST B;  3LP3 A;  4CJF A;  4JS4 A;  4CF0 A;  3NAE A;  1W0H A;  4K8Z A;  4CF9 A;  4O5B A;  3PX6 A;  4EZ9 A;  1C1C A;  1KVC A;  4OGC A;  3FFI A;  3P5J A;  3K5N A;  3LZJ A;  1CXQ A;  3ITH A;  3QEX A;  4M3X A;  4CHO A;  3QNN A;  5KGW A;  4M42 A;  1BHL A;  3LDS A;  4KI4 A;  1RIL A;  1TAU A;  3HM9 A;  1JLQ A;  1ASU A;  1EET A;  1RTJ A;  4DTS A;  3DLE A;  1X9S A;  4F4K A;  2B6A A;  4CGF A;  4M3U A;  2FBT A;  2GUI A;  4BWM A;  4CJT A;  3MED A;  4FLZ A;  3NGY A;  1KTQ A;  1IKV A;  1HMV A;  1IKX A;  1RDA A;  2G8V A;  2YHA A;  3AA5 X;  2D0C A;  3SI6 A;  2D5R A;  4LSN A;  1NK0 A;  2BDP A;  1N5Y A;  4G1Q A;  3ZT2 A;  3KLE A;  1QHT A;  3CG7 A;  2HHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...