2X6NA

Human foamy virus integrase - catalytic core. manganese-bound structure.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
188
structure length
188
Chain Sequence
PQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein
molecule keywords INTEGRASE
total genus 60
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x6nA00
3PO4A 1ASVA 1VSHA 1JKHA 4FZXC 3OYCA 3TABA 4G1QA 4DSKA 1A5VA 1HQEA 1TAQA 3ZT3A 5C25A 1IKXA 3SCXA 3HXMA 4F4KA 1D8YA 1KCFA 4KKOA 4JLHA 3WNEA 3OY9A 3PUFA 3L2VA 4DFKA 4CEEA 2YNGA 2DFEA 1JL1A 4FVMA 4FJNA 3KLIA 1I39A 1RTJA 4CCHA 3K57A 3ISNC 1G15A 4W5QA 4AHCA 3VQ7A 3RTVA 1D9FA 4KHSA 4CFBA 2E6LA 1X9MA 1L3VA 2B5JA 3F73A 4QCLA 1C1AA 4Z4HA 1XHZA 1BIZA 4EZ6A 2DFFA 5J2MA 3CFPA 5HRSA 3SUNA 4FLZA 4FJ9A 3M8SA 3DRRA 3HJFA 4FZYA 2FBYA 4NCGA 3OYAA 3QIOA 4LSLA 2DTUA 4LY7A 2QXFA 4N5SA 1KFSA 4CJ5A 2P1JA 4RW4A 2IC3A 4FLYA 2YHAA 4CJRA 2XY7A 1XC9A 5D3GA 1ZBFA 3NDKA 4DFMA 2HHSA 2Z1GA 1HNIA 4DSLA 3ULDA 1I3AA 2Y1IA 4KREA 1U49A 1YT3A 3SZ2A 4M3UA 4L8RB 1TV6A 4DS4A 3AVBA 4O0IA 4DWIA 3AA2A 3ZT0A 4PA1A 4B08A 4CJPA 1S1UA 2D0BA 4BDYA 3RMDA 1S9EA 3QEPA 1TK0A 4FJ5A 3VQCA 4DMNA 1Q9YA 3OYBA 4GVMA 3ZT1A 4DTUA 3NH0A 1EXQA 2W42A 1KVCA 2G8UA 4DSEA 3CM6A 1VRUA 5KGWA 2HNDA 1HPZA 4H8KA 3TARA 3KJVA 3ZSOA 3HVRA 4CJ3A 3VQPA 3K5MA 3QEIA 3LDSA 3NGYA 1C0MA 4CF9A 4M3XA 1WAFA 1O1WA 3DM2A 4CERA 3KK3A 3NHGA 1YVUA 4MFBA 2HMIA 4HCCA 2KTQA 4FJJA 3DLBA 1S5JA 4K8XA 5JS2A 3MECA 3NCIA 5KTQA 4PUOA 2QK9A 3HM9A 2OPPA 3NF6A 1BCMA 1HYSA 1UWBA 1CXUA 3OYFA 1QSLA 4O55A 4OGEA 4DFJA 2Z1JA 1L3UA 1KLMA 2HHUA 2G8IA 1L3SA 2XY8A 1UOCA 4CHPA 1XI1A 3VQAA 1NKBA 1GOBA 1RBRA 1RTIA 3DLGA 3IRXA 3L3VA 1RBTA 2YNFA 1VSKA 1ZBUA 3OYGA 3ALYA 3JYTA 1NK4A 2OZSA 2X6SA 2F8TA 4CJWA 2F96A 1RT4A 4KHWA 3C94A 1KTQA 1NK0A 1NK8A 1UAXA 4CESA 3QETA 3PX0A 4ID5A 1RT6A 5HRPA 1TK5A 1HYZA 3OVNA 3U3YA 1CZBA 4DTRA 4CEZA 1GOAA 4KHUA 4CJQA 3NGZA 3DRPA 4KTQA 1TKZA 1RBUA 4YNQA 4B9VA 3QNOA 4JS5A 5HLFA 4CJFA 3OYNA 3KLGA 3ZSRA 3EYZA 2RF2A 1IG9A 4F2SA 3P1GA 4DTMA 1TAUA 4Z4FA 3T3FA 4JRQA 1NJYA 2YHBA 2X74A 5HRRA 1WSEA 2IAJA 1BI4A 3OYMA 2ZE2A 4QOZB 2QKKA 4PWDA 3QERA 4F8RA 3PO5A 4FLUA 4DS5A 1RDBA 3ZSWA 4KRFA 2HHTA 5CYMA 4FW1A 4FM1A 2LSNA 3VQ4A 4KB1A 3C95A 4CE9A 1D9DA 3NBPA 3DYAA 2KW4A 4I7FA 4B8AB 3S3NA 4AILC 4CGDA 1U47A 2Z1HA 1NJZA 4DTSA 3B6PA 4DQRA 4CIEA 3S3OA 4I2PA 4CGGA 3CFOA 4C8NA 2Y1JA 3U6FA 4OKKA 1KRPA 3F9KA 1U45A 3KK2A 1FKPA 1RILA 4DU4A 2Z1IA 4ELUA 1W9HA 4CJTA 4CEDA 3IG1A 4BE1A 1J53A 1LWFA 3D0PA 3SPYA 4LH4A 1T8EA 1VSJA 1A5XA 4AHSA 3V81A 2G8FA 3TAFA 2KZZA 3TAGA 3G0ZA 3D45A 3OYHA 3KIOA 1TGOA 5J2QA 4FW2A 1C1CA 3DLKA 4OKJA 4AHTA 3TI0A 4ELVA 1ZBLA 4TSXA 4CF1A 4FXDA 3I0SA 1SL2A 1JL2A 4IG0A 4BE2A 4MQ3A 1RDDA 4CEAA 2BANA 4FJHA 4IBNA 3CYMA 1VK0A 4EZ9A 1TVRA 4RW7A 4E89A 4F3TA 2P5OA 5CY4A 3OYKA 3ZSVA 1R0AA 1JLCA 2E6MA 3CG7A 4KTZA 4KHQA 4CJEA 3E01A 1T7PA 1RT5A 3SYZA 4EP5A 4DU1A 5E41A 3LWLA 3SNNA 4DQIA 3I0RA 5C42A 4LSNA 3RMAA 3SV3A 1QE1A 3RR7A 4HCBA 4FK0A 4OLAA 2ZQBA 1WSGA 2ZD1A 2PZSA 4Q5VA 3KKSA 4B9SA 4N76A 1KVBA 2YKMA 2BGGA 4CJSA 4DTJA 3DI6A 3QINA 3VN5A 3OJSA 4Y1CA 1IKWA 2HHXA 4CK1A 4CF2A 4I2QA 4NYFA 3SQ1A 3S3MA 5DMRA 4FJXA 4K8ZA 3DRSA 4FZZA 1B9DA 3AVGA 3SQ0A 3AO1A 4DQQA 3FFIA 4W5OA 5CZ1A 2XO7A 3QEXA 3SUPA 3KK1A 3K59A 4CFCA 3TAPA 1NJXA 4CEFA 4CIFA 4I9LA 3TWHA 2G8KA 3HSTB 1RBSA 3HP9A 2QKBA 1LW0A 1SUQA 5SWMA 3HK2A 3EY1A 5K14A 2GV9A 3AA5X 5HBMA 4FM2A 5KRTA 4DSFA 1KSPA 1MU2A 1ASWA 1REVA 3SPZA 4M3TA 4B9UA 4N47A 3SJJA 4E3SA 3AVAA 3ZT2A 2HVHA 3CM5A 3VQDA 3AVMA 3AVLA 3AO4A 3OYDA 4NCBA 5FRMA 3ZSQA 4PY5A 1GOCA 3CQ8A 1U04A 2OPSA 4OPKA 3U3GA 2FBVA 4GMJB 4HHTA 3MXIA 3AA3A 4RW9A 5FDLA 4ZTFA 1UA0A 4E1NA 2OPQA 1NKCA 3M8RA 3LPUA 3ASMA 4JRPA 2KQ2A 3VQ6A 3SV4A 3HPOA 2EHGA 1ZBHA 2YNHA 2FBTA 1NJWA 2HHQA 4RW6A 4CK2A 4Z0UA 1IKVA 2EX3A 1LV5A 5T7BA 1S1WA 4BWMA 1WN7A 1RBVA 1VSMA 4BWJA 3WNFA 1JLEA 3VQEA 3NH1A 4FM0A 4ZTJA 3LP1A 3AVJA 3OS0A 1WSJA 1LAVA 1NK7A 1S6QA 2ETJA 2KFZA 2HNYA 1VSEA 1RTHA 3AVFA 3UIQA 4KI6A 4IFYA 4E7IA 1SKWA 3TAMA 5KRSA 3O3FA 1WNSA 4FK2A 1IO2A 2VG5A 1UA1A 3VA0A 1C0TA 3RRHA 4OGCA 3QEWA 2D5RA 2RPIA 1N5YA 2PYLA 3RWUA 3V9ZA 1S1XA 2ATQA 1NK9A 3V1OA 4C8OA 3DMJA 2G8HA 4KAZA 1QSSA 3KD5E 4LH5A 4BACA 4C8MA 3OYIA 3TAEA 4DSJA 4E0DA 4CJKA 1IKYA 1TL1A 2D0CA 3ZT4A 4H4MA 1Y97A 2DFHA 1RT1A 4O44A 3QEVA 1LWEA 4NCAA 4Z4CA 1BHLA 4B3OA 1EP4A 3LZJA 1JLGA 2G8VA 1YTUA 1XWLA 3BGRA 1T03A 2B4JA 3ZSYA 4DFPA 1K6YA 2E4LA 3HVTA 3V1RA 3NGIA 2B6AA 2GBZA 3HYFA 3LP3A 5HROA 4B9MA 2JLEA 4KHYA 1DTQA 1LW2A 1Z26A 4AHRA 3O3GA 2GUIA 3OS1A 3HP6A 3AVIA 3AA4A 3LZIA 3O4QA 3O3HA 2HHWA 1C1BA 4EP4A 3MEGA 4E7JA 5I42A 3LWMA 3LP0A 4CHYA 3WNGA 1WAJA 4CEBA 4XIUA 4KO0A 4CJUA 1CZ9A 1S1VA 2HHVA 2OA8A 4DQSA 3BDPA 3AO2A 1HQUA 1Q8IA 4CJLA 2XHBA 1KLNA 4C8KA 3KLFA 1BGXT 2YNIA 4E7LA 3V9SA 4DLEA 1J54A 4W5TA 3MEDA 1EETA 2YV0X 3H08A 4FLWA 3O4NA 1FK9A 4N41A 1BI4B 1LWCA 1TKXA 3K58A 4OKEA 2RKIA 1TKDA 3KLHA 4Y1DA 5HP1A 1WSIA 1Z25A 3L2RA 4FCYA 3LPTA 3OS2A 4DTNA 4KB0A 1A5WA 4CEOA 3NE6A 4JS4A 1BL3A 3S9HA 1J5OA 1F21A 1SV5A 4NYNA 4B8CA 4J2EA 2VG6A 3LANA 1KFDA 1RNHA 3L2WA 4KHNA 1IH7A 3NFAA 4CF0A 2JGUA 4DTPA 3OYLA 4RG8A 3TANA 3P5JA 3DLEA 5CYQA 1JLQA 4FK4A 3QLHA 3PV8A 5FRNA 4KPYA 3M8PA 4IFVA 5KGXA 3VQ9A 1CLQA 4DQPA 3L2QA 3VA3A 4DTXA 3A2FA 3PX4A 1SL1A 3AO5A 2NUBA 2PYJA 1NOZA 5J1EA 1HMVA 4FJGA 1ZBIA 2PY5A 4DF4A 4KI4A 3DOLA 4B9NA 4M3WA 1RDCA 4PQUA 4QAGA 2RN2A 1B9FA 3VQ8A 4DU3A 3VQBA 4HUFA 4CJ4A 2R7YA 3G10A 4DF8A 3DLRA 4OLBA 4F3OA 1SKRA 3V9XA 4FJKA 4FYDA 5KI6A 1FXXA 2IGIA 5FROA 3DLHA 2KFNA 4CGIA 4FLXA 4W5RA 3C6TA 4HVJA 5J2PA 4E7HA 3SQ2A 1X9SA 3LALA 3L8BA 4CFAA 3OYEA 4M3YA 4LD0A 2A1SA 4W5NA 3AVKA 4O0JA 4N56A 4J2AA 4CHZA 1EX4A 1NK6A 4J2DA 4FJ8A 4HUGA 2G8WA 4Q0BA 1C0UA 3M8QA 3P83D 4O5BA 4F2RA 3T1AA 3ZSZA 1J9AA 1U4BA 4CHOA 2IOCA 3L3UA 2ITGA 3T19A 3VQ5A 1QTMA 3TR8A 3ZSXA 2IS3A 4B9TA 1WSFA 4CGFA 3RMCA 3MXJA 1ASUA 3SI6A 4IDKA 1BCOA 2X6NA 3K5LA 1QS4A 3MAQA 1JXEA 4E7KA 1L5UA 2D0AA 1RTDA 4B9LA 4BE0A 4DSIA 5CZ2A 3HL8A 4FLTA 1BQNA 1TL3A 4KFBA 4Z4EA 2F8SA 2XRIA 4IKFA 3HPGA 3K2PA 4O4GA 3VQQA 2KZMA 2IDOA 3QIPA 4H4OA 4M42A 2WONA 1NKEA 4M3ZA 4BDZA 3MXMA 2WOMA 3AVCA 4UQGA 1BIUA 4AHVA 5HRNA 4CECA 1NK5A 1N6QA 3K5NA 1VSFA 4R5PA 4HTUA 4CGJA 3MEEA 1S6PA 1U48A 1HYVA 4CJVA 2HNZA 3B6OA 2FBXA 5SZTA 3C6UA 4HUEA 3AO3A 4ELTA 1BQMA 3NH2A 4E19A 4CIGA 1VSLA 1WLJA 2BDPA 4J2BA 1DTTA 1QQCA 2HB5A 1DLOA 3AV9A 2BE2A 3JSMA 3V4IA 4FJLA 1S1TA 4Z4IA 4DTOA 1RDAA 3HT3A 4CF8A 3ITHA 1SL0A 3IAYA 1EKEA 1TKTA 1JLBA 1QHTA 3IS9A 3K5OA 3SUQA 1ZYQA 3NF7A 3QO9A 3I8DA 3SUOA 3THVA 2O4IA 4E1MA 4GW6A 1T05A 1WSHA 3AVNA 1L3TA 5EU7A 3ZCMA 2A1RA 1C6VA 5DK5A 1RT2A 3TAQA 5J2NA 4ID1A 5C24A 1VSIA 3KTQA 2XY6A 2OPRA 1JXBA 4CFDA 3LAKA 2Q3SA 4M41A 4FJMA 3NAEA 1Q9XA 2O4GA 2VWJA 3KLEA 1HNVA 1SKSA 4OPJA 4C8LA 3PY8A 1RT7A 4AH9A 1FKOA 4BDPA 2OZMA 3KKRA 1S9GA 3V9UA 3LP2A 3SQ4A 1TK8A 3KD1E 3AVHA 4ZHRA 2OYQA 1LAWA 1YTAA 1XHXA 1ITGA 4KV8A 3V1QA 3NF9A 2HW3A 2X78A 4CHNA 4YFUA 3PX6A 1VRTA 2VWKA 4M45A 1QSYA 3QESA 4ICLA 1X9WA 2FC0A 1B92A 1HJRA 1CXQA 3HPHA 4OJRA 4RW8A 3WNHA 3V9WA 3QNNA 3OJUA 3CFRA 4FJ7A 1JLFA 4I9QA 3RMBA 4CEQA 4FJIA 1BISA 2VG7A 3DOKA 1NOYA 1RCHA 4M3RA 1VSDA 1X1PA 4WE1A 4AHUA 3EZ5A 3V6DA 3OYJA 4KTWA 2HVIA 5JS1A 4CGHA 2I5JA 2P51A 3RR8A 2YKNA 3NF8A 1JLAA 3HO1A 3L2UA 2XY5A 3LAMA 4CK3A 2DY4A 1W0HA 4OVLA 5I3UA 4CHQA 2AJQA 4IG3A 1D5AA 4Z4GA 4DLGA 4FLVA 2P5GA 3RRGA 1RT3A 4DG1A 1KVAA 1HRHA
chains in the Genus database with same CATH superfamily
3WXMB 1VSHA 5I9EB 3OYCA 4XH1A 4G1QA 2FF3B 4DSKA 4OO1J 1HQEA 3SCXA 3DXKB 3GG4A 3LM2A 4F4KA 1D8YA 4JLHA 3WNEA 3SAHA 4FJNA 4BRKA 1I94K 3K57A 4W5QA 4KHSA 4CFBA 2E6LA 4BQLA 1X9MA 3RSEB 3F73A 4QCLA 1C1AA 4WFBL 4FJ9A 4IOCL 4ISFA 2ZGZA 4CJ5A 3G71N 4RW4A 4FWMA 2YHAA 5LMUK 2CGLA 1QQMA 1GLCG 4DFMA 5C2DA 5M1KA 5AFUA 2HHSA 4YOXA 2ZJRL 2Y1IA 4KREA 1YT3A 4M3UA 4L8RB 1TV6A 1DGKN 2KHOA 3UKRB 1VQ6N 4PA1A 5ADXH 1S9EA 4DMNA 1Q9YA 3A0IX 4DTUA 3NH0A 1EXQA 4H5WA 4DR3K 1VRUA 3QMLA 2QWRA 3ZSOA 2Q0UA 3VEOA 1C0MA 4CF9A 3KK3A 4CERA 4MLEA 3NHGA 4MFBA 2WBNA 3JXUA 4YOTA 1S5JA 4BC2A 4BC4A 1KQSM 3NCIA 5KTQA 1U2VA 4PUOA 3HM9A 3VF2A 4U67L 1UWBA 4O55A 4YOWA 2Z1JA 2F9TA 2HHUA 4IEEA 1NMDA 1ATRA 4DCHA 1XI1A 5BRHA 1T44A 3PSFA 4PKGA 1Q18A 2F96A 4BG8A 1KTQA 3C7NB 3PX0A 4KBOA 1YITN 1TK5A 3VGLA 3ATVA 3OVNA 1NGDA 1GOAA 2QI2A 4KTQA 4YNQA 3QNOA 4CJFA 4BGBA 1K8KA 4MDBA 1IG9A 3T3FA 1NJYA 1Z05A 5C10A 3IUCA 4CW7B 3PO5A 1RDBA 2NRTA 5CYMA 4FW1A 3DAWA 5FPNA 2I7NA 3VQ4A 2D0PA 3WXIA 4KB1A 1T6CA 4I7FA 3I55N 2Z1HA 4DTSA 4PHTX 1C0GA 3HOTA 2Y1JA 5EX5A 3KK2A 4CEDA 3IG1A 2IVPA 5BR9A 1LWFA 3D0PA 4LH4A 1VSJA 4BY9C 3WQUA 3O4WA 4FW2A 3TI0A 5AQYA 4FXDA 1QQOA 4IG0A 3BZKA 3CYMA 1VK0A 1XNRK 1NGGA 2P5OA 3OYKA 1R0AA 1E4FT 3CG7A 1G99A 2VWBA 3E01A 3MCAB 1T7PA 2UUBK 1RT5A 4DU1A 3LWLA 4DQIA 3I0RA 3RMAA 4HCBA 3VOVA 1WSGA 2PZSA 4Q5VA 3KKSA 4B9SA 1KVBA 4DV7K 4DTJA 3QINA 1Z6RA 5AQMA 4JI0K 1IKWA 1JCFA 3EL2A 4CK1A 4I2QA 1O13A 4FJXA 4JYAK 3K9JA 3UKUB 3AVGA 3GBTA 3ZYYX 4W5OA 4DQQA 4F8RA 3KK1A 3SK3A 3ZEUB 1GLLO 3B8AX 2QKBA 3HP9A 1R59O 3U4LA 3OTOK 3W0LA 5CE3A 1YJWN 1REVA 1ASWA 2P9LA 3AVAA 3P38A 3CQXA 3GE1A 3OYDA 3AVLA 5FRMA 5DM7L 3ZSQA 4CZFA 4PY5A 1TYQA 2NRHA 1GOCA 2OPSA 4IO8A 4O5FA 3U3GA 3IMXA 3AA3A 1QHAA 3EO3A 3FZMA 4B9QA 2O8CA 3BZCA 3LPUA 2KQ2A 3VQ6A 3CXCM 3KHYA 3UE5A 2YNHA 2FBTA 4Z0UA 2EX3A 2E1ZA 2HSTA 3AGKA 3HI0A 3NH1A 3VQEA 3LP1A 1WSJA 3N4QA 2HNYA 1VSEA 1RTHA 3UIQA 4E7IA 3TAMA 1WNSA 4FK2A 4JI8K 5AQTA 2VG5A 4MO5A 2P9NB 2O8EB 1C0TA 4OGCA 2PYLA 3CJBA 1N5YA 3RWUA 3V1OA 1NGAA 2G8HA 1QSSA 3A8YA 1KAYA 4CJKA 1SAZA 5TKYA 1IKYA 3LDQA 1TL1A 1Y97A 3QEVA 1RT1A 5BPMA 4CJ7A 1LWEA 4NCAA 3FLCO 4JI1K 1E4GT 3BGRA 2Q97A 1K6YA 2E4LA 3WXLA 3F2KA 5GIPA 3J80O 1OH7A 3C0BA 2W40A 3QB0A 1E3MA 1Z26A 4AHRA 3IFRA 3LZIA 3O4QA 4DR7K 4HWIA 3LP0A 2Q36A 2GTDA 3CJ9A 4M7YA 1WAJA 4CEBA 4JKAA 3BDPA 4CJLA 1Q8IA 2ZJPL 3LM9A 2XHBA 5AQJA 3KLFA 1QVFM 2YNIA 1KAZA 2P9SB 1J54A 2A42A 1EETA 3H08A 4FLWA 2ITMA 2UXCK 3O4NA 1LWCA 4OKEA 2RKIA 3CCUN 4MO4A 1NGHA 2QW9A 2P9UB 4CEOA 4B1VA 4NYNA 3LANA 1KFDA 1YJNN 4KHNA 1IH7A 3SLCA 4A5BA 4FK4A 5FRNA 3M8PA 5KGXA 3VQ9A 3OW2M 1OVYA 3P4IA 4FWKA 3BUZB 2O8FA 2NUBA 2PYJA 1NOZA 5J1EA 1HMVA 1ZBIA 4RCHA 4FL9A 3VQ8A 5KPTA 5FLXO 3DLRA 4JHDB 5M1PA 1SKRA 3V9XA 4U7BA 2IGIA 2KFNA 4CGIA 4FLXA 4MDAA 4HVJA 1X9SA 1C0FA 3R6MA 5AQQA 1VQKN 4J2DA 4O8KA 1C0UA 4O5BA 4F2RA 3SAFA 1J9AA 4BROA 1U4BA 5AQPA 3T19A 3VQ5A 1NU0A 4XH4A 3VENA 4CGFA 5KPZA 3RMCA 2RE2A 2VGNA 2X6NA 5EOYA 3K5LA 4PKHA 2D0AA 4H0XB 4OPAA 4V19S 1BQNA 4IXCA 3VF4A 3HPGA 1OH6A 4BRQA 3MXMA 2WOMA 5E84A 4AHVA 1N6QA 3K5NA 4R5PA 1S6PA 5LJWA 5EY4A 2HNZA 3I56N 2FBXA 5SZTA 4HUEA 3AO3A 2ASOA 4X66K 2BDPA 3R3LA 4M7XA 3F9MA 1ZBSA 5ADXA 1TKTA 3O6WA 3K5OA 1U2VB 1ZYQA 3CI5A 3SUOA 2UU9K 2D4WA 2O4IA 3ZCMA 5DK5A 1JXBA 4CFDA 3E9LA 1H1VA 3G25A 2VWJA 1HNVA 3H3OB 2ZJQL 1HNZK 1S9GA 2GWJA 3V9UA 3LP2A 4FWRA 1LAWA 2HMPA 1XHXA 2E88A 3Q7CA 3ID8A 2HW3A 1NGCA 4CHNA 4K42A 2Q2RA 1QSYA 3HPHA 4RW8A 1JLFA 2D1KA 3RMBA 1NWKA 4FJIA 2BH1A 3SBTA 1NOYA 4BREA 2FF6A 4A2AA 3V6DA 3EZ5A 4QS7A 1NM1A 4KTWA 2I5JA 1VQ5N 1MA9B 4FVUA 4LFBK 3HSCA 2AJQA 1T3VA 5AQZA 1K73O 5F0XA 4FLVA 3K5MA 1ASVA 3TABA 5JMVA 2P9KB 5C25A 1IKXA 1TUYA 4DFKA 4WF9L 2HF3A 3I33A 2E5LK 1HUXA 1RTJA 4CCHA 5LMNK 4AHCA 3VQ7A 5AQOA 4Z4HA 4KH5A 4C1NI 4FLZA 3SUNA 3M8SA 3DRRA 3HJFA 4NLCA 2FBYA 4JI7K 4LSLA 2DTUA 3M1FA 4LY7A 1KFSA 4LF9K 3O1BA 3CC2N 3BF3A 5BPNA 1ZBFA 4JD2A 3NDKA 4CBUA 2O8DA 1HNIA 4DSLA 4GVEA 3SZ2A 4BR7A 3O80A 4DS4A 3WT0A 3AVBA 1D4XA 4GV6A 3AA2A 4CJPA 2ZM6K 2KLAA 3RMDA 4FJ5A 4B1ZA 1MWMA 3C6AA 3OYBA 4GVMA 2PFUA 3H3NO 4DSEA 4CZMA 4H8KA 4IJNA 3VQPA 3P31A 4BC5A 5E26A 4M3XA 1WAFA 4HCCA 3RSEA 1YVUA 4ILHA 4B1YB 2F7TA 5GIOA 3DLBA 3MECA 5LY3A 2QEXN 3MDQA 4WFAL 4DR5K 1BUPA 2E2NA 5H1SQ 1NGEA 5HL7L 4OGEA 1VHXA 3PIPL 2G8IA 1L3SA 3E66A 1UOCA 3VQAA 1GOBA 3IRXA 3DLGA 4JD2B 4DQ8A 2O8DB 1NK4A 1RT4A 4KHWA 3O8MA 1UAXA 3OHRA 1DEJA 4CESA 3QETA 1IBLK 4IOAL 5C0YA 2NLXA 1BG3A 1HYZA 4JI2K 3VETA 1KC8O 4CEZA 4CJQA 3DRPA 1TKZA 4B9VA 2QWLA 5HLFA 3O08A 4F2SA 3P1GA 4CD3A 5BRFA 1TAUA 2X74A 2IAJA 1BI4A 4X65K 4QOZB 2ZE2A 4PWDA 3T1YK 2OCEA 2QWQA 3VEVA 2E2OA 2VQFK 3PLAA 1D9DA 4B8AB 2KW4A 4H0OA 3S3NA 4AILC 1NJZA 3B6PA 4CIEA 3H46O 1HJOA 3F9KA 5AQSA 3HZ6A 4ELUA 4C1NK 1W9HA 4CJTA 2O8FB 4BE1A 4YDUC 4JK8A 2NRVA 3V81A 5AR0A 2YJFA 2G8FA 3TAGA 3OYHA 3KIOA 1TGOA 5J2QA 1C1CA 3DLKA 3E9PA 2E2PA 1YAGA 1ZBLA 3ENBA 3H1VX 4BE2A 2UYTA 1RDDA 4DV2K 2BANA 2W6LA 4EZ9A 4E89A 1YVNA 3NVKA 4YY3K 5CY4A 4DUYK 2E6MA 3TSUA 4KTZA 4KHQA 4IOXA 3SYZA 3SNNA 1Y64A 4XH5A 4LSNA 3SV3A 4AQYK 2ZQBA 1GLEG 2YKMA 2BGGA 4CJSA 2JWLA 4AM6A 2FXUA 1XUPO 3LDOA 4NYFA 5DM6L 3AGRA 5DMRA 4BRCA 1GLBG 1JJ2M 4OX9K 4A57A 4K8ZA 5AZJB 1B9DA 3SQ0A 3CPWM 3FFIA 3QEXA 2XO7A 3K59A 4H0VB 4CFCA 4GNIA 4I9LA 4DHYA 4IWVA 1SUQA 5SWMA 4DSFA 5HBMA 2P5GA 1MU2A 2UXDK 3SJJA 3ZT2A 3VQDA 3S41A 2A5XA 3O9UA 3CQ8A 4OPKA 4GMJB 4BR2A 3MXIA 4X64K 1KAXA 1NKCA 2UUCK 2HBLA 3VESA 3ASMA 3HPOA 4C23A 4RW6A 4BQZA 2ZF5O 1IKVA 3UKRA 1RGIA 2HBKA 1RBVA 1VSMA 3KK7A 4BWJA 4BC3A 3OS0A 3CERA 2ETJA 3R8EA 5MLCQ 5KRSA 4YHHK 3HRGA 1NJIO 4NXMK 1IO2A 3RRHA 3QICA 1HKGA 3V9ZA 1S1XA 1Q82O 4FO0A 3DMJA 4KAZA 1WBBA 4CD1A 3OYIA 3TAEA 1XMQK 2D0CA 1NMNA 4O44A 4QS8A 3ZX2A 5AQUA 2VCPA 4Z4CA 4B3OA 1T03A 2A6AA 3ZSYA 1TYQB 4DFPA 3EN9A 3HVTA 3V1RA 4BRHA 5FPMA 2B6AA 1K8AO 2J4RA 1M90O 5AQWA 3AVIA 3O3HA 1OH8A 4EP4A 2YX6A 3AAQA 3LWMA 3WNGA 4WYBA 4O8UA 1HNXK 2WUSA 4XIUA 4RTFD 4JI3K 1VQNN 4CJUA 2HHVA 3ZX0A 2OA8A 1KLNA 4DV0K 4E7LA 1FK9A 3GOIA 4JKEA 1TKXA 1U6ZA 2YHYA 5A2QO 1WSIA 3MX5A 1EWQA 3LPTA 4DTNA 4KB0A 3NE6A 1BL3A 1J5OA 4B8CA 1F21A 3WXJA 2VG6A 3WUHA 3L2WA 4CF0A 2JGUA 1S22A 3OYLA 2JWKA 5CYQA 3DLEA 1JLQA 3PV8A 1CLQA 1W97L 3L2QA 4DTXA 3A2FA 2IVNA 4CZEA 2QWPA 2EWSA 1VAZA 4B3RK 4DF4A 4KI4A 4M3WA 4PQUA 4QAGA 2RN2A 3D2EB 2R7YA 1LOTB 4DF8A 1FXXA 3DLHA 3C6TA 4YOUA 5J2PA 4E7HA 3L8BA 4CFAA 2CGJA 5KQDA 3OYEA 4M3YA 1RFQA 3AARA 4FJ8A 2P9PB 4HUGA 2G8WA 3ZSZA 3CC7N 2IS3A 1ASUA 4YORA 1BCOA 1M1KO 1QS4A 4E7KA 4DSIA 4Z4EA 3D7EO 2XRIA 2OTJN 2NRZA 4EHTA 2WONA 1NKEA 4M3ZA 1VQ8N 4BDZA 3AVCA 1VSFA 2ZGYA 1X3MA 4B1WB 3WQTA 4CJVA 5LL6Z 1XNQK 3BY5A 4L3QA 4H0PA 1VSLA 1WLJA 3ZETB 5TKWA 2DPNA 1QQCA 2HB5A 1DLOA 3AV9A 3I8BA 3JSMA 3M3ZA 1S1TA 3M6GA 4Z94A 1SL0A 3ITHA 3IAYA 4GKKK 1QHTA 3IS9A 1MDUB 3CCVN 3I8DA 3QO9A 2O8CB 4E1MA 1W2BM 4GV3A 1NGJA 3BF1A 4ID1A 4BRDA 1XQSC 3LAKA 2Q3SA 1Q9XA 3CMAN 1SKSA 4OPJA 4BRAA 4C8LA 4A5AA 1RT7A 2GELA 4AH9A 1N36K 1FKOA 2P9IA 3KKRA 4QS9A 4ZHRA 3VEYA 2WTUA 3PX6A 2W6KA 1V4SA 3VMFB 3V9WA 4FJ7A 4I9QA 3KZBA 1X1PA 3OYJA 2HVIA 2WFBA 3CCRN 2P51A 2QWNA 2YKNA 3HO1A 4DKWA 3VPZA 4EIAA 4H0TB 4IG3A 1D5AA 1QZ6A 3RRGA 4DG1A 4K25A 5FPEA 5F2RA 4FZXC 3G4SN 1A5VA 1TAQA 4BR4A 3HXMA 1KCFA 4KKOA 3PUFA 4JI4K 1JL1A 3KLIA 1I39A 3ULEB 3BEXA 3THXA 4H0YB 3ISNC 1D9FA 3RTVA 4BRNA 1L3VA 2B5JA 4DB3A 4IEIA 2DFFA 3CFPA 1XC3A 1HPMA 2HOEA 4FZYA 4KH4A 2NNWA 4N5SA 2QXFA 2P1JA 4JKFA 1WBDA 4R79A 1XC9A 5D3GA 3HTVA 4I6MA 3ULDA 5AQNA 1Q86O 3J81O 3O5BA 4LF4K 4K0KK 4FWLA 3VEWA 3MN9A 3VTIA 3WXKA 4B08A 2CGKA 4G9ZA 2D0BA 4BDYA 1TK0A 4EHUA 4DR2K 3DXKA 3ZT1A 2W42A 1KVCA 2G8UA 3L4QA 5KGWA 1HPZA 3KJVA 4JAXA 3TU5A 3HVRA 3T1HK 3IKMA 3LDSA 4WQ5A 1EWRA 2HMIA 1RDWX 2W41A 4CZJA 4B3SK 2OPPA 1HYSA 2O8BB 4BVPA 3FE1A 4DFJA 1L3UA 2XY8A 4NLBA 4B1UB 4CHPA 5AJ3K 1NKBA 3L3VA 1RBTA 2YNFA 1VSKA 3OYGA 3E1YA 3JYTA 2F8TA 3FZHA 4CJWA 4YDUA 5LJVA 3C94A 3A5MC 5AZIA 1RT6A 1GLFO 4DTRA 4KHUA 4H5NA 3OYNA 4X62K 2RF2A 4DTMA 4Z4FA 1SQKA 4JRQA 2YHBA 2YJEA 2QKKA 4B1XB 2YHXA 4FLUA 3ZSWA 1OKJA 2LSNA 1WB9A 3C95A 2ASMA 3NBPA 4CGDA 1NG9A 2BUPA 1J6ZA 4DQRA 3S3OA 4CGGA 3CFOA 4JKGB 4C8NA 5C12A 4OKKA 1U45A 1RILA 2Z1IA 4JKCA 2NRRA 4AHSA 2GWKA 3G0ZA 4ISEA 3NVMA 4ISGA 3ULEA 4AHTA 4CF1A 1VQPN 3I0SA 1SL2A 3MK6A 1JL2A 3VTHA 1BOTO 4FJHA 4IBNA 1FW6A 3EEQA 3VGKA 4RW7A 4BGAA 4F3TA 4CJEA 2P9PA 1WUAA 2OTLN 3CHWA 3FFKB 4DR1K 2UXBK 5C42A 4JEPA 1QE1A 1ATNA 2ZD1A 4OLAA 2Q31A 3MCPA 4N76A 3TSPA 3NMUA 3VN5A 5JVGL 3LDNA 4Y1CA 2HHXA 4CF2A 1FJGK 3SQ1A 3S3MA 2QA4N 1NGBA 4FZZA 3ENHA 3MN7A 3AO1A 3CJCA 3TAPA 1NJXA 2P9NA 4CIFA 2O8EA 3TWHA 5BRDA 2G8KA 2QXLA 3HSTB 3HK2A 2I7PA 3WEEA 1IV0A 5K14A 3AA5X 4FM2A 5KRTA 1K8KB 4M3TA 4B9UA 4BRLA 1W7AA 2HVHA 1Q7YO 4WCEL 3AVMA 3AO4A 3KVGA 3DJCA 3VERA 4KH6A 4A2BA 5KPRA 3P39A 2QWOA 3W3DA 4ZTFA 1UA0A 4E1NA 3M8RA 3EE8A 4LF6K 1BO5O 3SJHA 3EZWA 4CK2A 1S1WA 3HM8A 1WN7A 3H45C 1JLEA 3AVJA 1S6QA 3C7NA 3AVFA 1DKGD 4IFYA 3O3FA 3R9PA 4BRGA 1N34K 1SZ2A 4LF5K 3SBGA 5CHIA 5AQKA 2ATQA 1NK9A 4C8OA 2ZWHA 3CC4N 4LH5A 4BACA 5AQHA 4C8MA 1GLJO 4FWPA 3ZT4A 4H4MA 2DFHA 1QVGM 3O9TA 3DXMA 5IWAK 1BHLA 1EP4A 2G8VA 5FPDA 4PL8A 4FWOA 3FZFA 2GBZA 3A5OC 2JLEA 1VQ7N 3ATUA 1DTQA 3HP6A 4IFEA 2YCHA 1C1BA 1ILYA 4E7JA 4CHYA 5AQLA 5AQXA 5B8HA 3CCLN 4B3TK 4KO0A 1S1VA 4DQSA 1HQUA 3ID6A 3ZLJA 1N8RO 1BGXT 4LFCK 3V9SA 4DLEA 4W5TA 3MEDA 4DR6K 4N41A 1BI4B 5EVZA 1P8ZA 3KLHA 4Y1DA 1YIJN 4FCYA 3OS2A 3D6RA 3TTDA 4JS4A 3S9HA 1SV5A 3A5NC 1ZXOA 4DTPA 4BRMA 4Y0WA 3TANA 3P5JA 4NXNK 4JKGA 4KPYA 4FOEA 2E1YA 3ZX3A 3MN6A 4FPBA 5CR4A 5BN9A 3DOLA 4B9NA 2FLOA 3DLLL 3MWPA 3QFUA 4CJ4A 1BU6O 4ILGB 4OLBA 4RWTA 4F3OA 4FYDA 4FJKA 4CBXA 5FROA 1HR0K 3LALA 2P9LB 4BRFA 3CJ1A 4LD0A 2A1SA 2E8AA 3QBXA 4CZGA 3AVKA 4W5NA 4YOVA 4J2AA 1EX4A 4Q0BA 1MWKA 3P83D 4M63C 2ASPA 3L3UA 4LC9B 3CJAA 3LDPA 3SI6A 4IDKA 1TUUA 1RDUA 3Q7BA 5BR8K 3MAQA 1L5UA 1RTDA 1ATSA 3HL8A 3T69A 2F9WA 1TL3A 2F8SA 1YF5L 2A41A 2KZMA 5BREA 4WQ5C 3QIPA 3MMVA 4M42A 5JVHL 5GAGP 1BIUA 4CVNE 1NK5A 4CZLA 3VGMA 3MEEA 1U48A 1HYVA 4JKHA 3B6OA 4FWNA 4B3MK 4ELTA 2HF4A 3NH2A 4E19A 1SS6A 1IBKK 4FJLA 2BE2A 1RDAA 3U9DA 3HT3A 4CF8A 3J8AA 3T7ZA 3MX2A 1JLBA 5AQVA 2GX9A 3D2FA 3H6EA 1L3TA 2A1RA 3CIPA 1RT2A 3TAQA 5J2NA 5C24A 1VSIA 3KTQA 2OPRA 1KXPA 3CCSN 4FJMA 3NAEA 2O4GA 1IBMK 1NNEA 4BDPA 3IDHA 3SQ4A 5AQRA 1TK8A 3JS6A 2BTFA 3AVHA 1ESVA 1YTAA 4KV8A 3NF9A 2X78A 4A61A 1VRTA 2VWKA 2GUPA 4M45A 1S72N 3QESA 1X9WA 1B92A 4K8XA 3WNHA 4OJRA 3QNNA 4F9OA 5C2FA 4CEQA 3L6QA 3THWB 1EO1A 1BISA 4BVOA 4H03B 3DOKA 1RCHA 4M3RA 4AHUA 1NLVA 1OH5A 3CCEN 1N33K 5JS1A 4CGHA 3RR8A 4BRPA 4LF8K 5JLHA 3L2UA 5AQFA 3LAMA 3OA9A 4CK3A 4OVLA 4CHQA 4Z4GA 3VF6A 1JCGA 1RT3A 1KVAA 1HRHA 3PO4A 1JKHA 4GY2B 5GAEP 3EKSA 3O9SA 3ZT3A 1EQYA 1QZ5A 3GL1A 4JHDA 3OY9A 3L2VA 4CEEA 2YNGA 2DFEA 4FVMA 1CZAN 3G6EN 1G15A 1YI2N 5M1QA 2KKZA 1HLUA 4DV4K 3FR0A 3RVCA 1XHZA 4JKDA 1BIZA 4EZ6A 5J2MA 3KWGA 5HRSA 2V7YA 2HBMA 4BG9A 4NCGA 3OYAA 3QIOA 1BA0A 4JI5K 2IC3A 2YI1A 4FLYA 4CJRA 2XY7A 4A62A 2E2QA 4WFNL 4FPAA 1VQON 2Z1GA 1I3AA 1U49A 1LCUA 4IZ9A 1J5EK 3C65A 4DV6K 4O0IA 4DWIA 3ZT0A 4CZIA 1S1UA 3QEPA 3VQCA 1NBWA 2PAVA 3CM6A 3TARA 2HNDA 2V7ZA 3HOSA 3WEEB 4CJ3A 3R1XA 2FSNA 3QEIA 3NGYA 3O9QA 1YHQN 1O1WA 3DM2A 2Q0RA 4JV5K 2KTQA 4FJJA 5JS2A 2QK9A 3D2FB 3NF6A 1BCMA 3DXMB 4PKIA 3OYFA 1CXUA 3DWLA 3QFPA 1QSLA 5M1OA 1KLMA 1N32K 5GAHP 4XEIA 2YHWA 3L4IA 1RBRA 1RTIA 1ZBUA 3ALYA 2OZSA 2X6SA 4KHPK 1XMOK 1NK0A 1NK8A 2A3ZA 4DUZK 4ID5A 4LFAK 5HRPA 2AA4A 2NRWA 3U3YA 1CZBA 3NGZA 1RBUA 4JS5A 3KLGA 3ZSRA 4JNEA 3EYZA 4BRIA 5HRRA 3THYB 1WSEA 3LL3A 3OBWA 2FSKA 3OYMA 4DV1K 4BR9A 3QERA 5GADP 4DS5A 4KRFA 5KQ8A 1VQ9N 2HHTA 4FM1A 4CZKA 4FSVA 4CE9A 3O9RA 3DYAA 1U47A 4AF1A 1IJJA 4I2PA 4ILJA 2AP1A 3FZKA 3U6FA 1KRPA 1FKPA 4DU4A 2V51B 1J53A 3CD6N 1NGFA 3SPYA 4CI6A 1T8EA 1A5XA 3ZEUA 4E1JA 2Q1NA 3TAFA 2KZZA 3D2EA 3D45A 4OKJA 3THXB 1VQLN 4ELVA 4TSXA 3H1QA 4MQ3A 4CEAA 5AFUH 1GLDG 1TVRA 4HTLA 3ZSVA 2QWMA 1JLCA 4EP5A 2F4VK 5E41A 3J7YP 4FK0A 5JICA 3RR7A 4NB4A 3DI6A 4JN4A 1HKBA 3OJSA 3CMEN 4FWSA 3CCQN 4IDHA 3PIOL 4DV3K 1BWFO 3DRSA 3TTFA 3CCJN 4J2BA 5CZ1A 2DY4A 3SUPA 3EKUA 4CEFA 2V52B 3KWIA 1RBSA 1LW0A 4JK9A 3EY1A 1YUWA 2GV9A 1KSPA 1ZC6A 3SPZA 4N47A 3AAPA 3MWTA 4E3SA 5AQIA 3CM5A 3OBYA 2IIRA 3J7ZO 4J8FA 4NCBA 2CH5A 1U04A 2FBVA 4HHTA 2O8BA 4RW9A 5FDLA 2OPQA 4UY8O 3SV4A 2EHGA 1ZBHA 1WOQA 3PSIA 1NJWA 2HHQA 1LV5A 5T7BA 4BWMA 3FZLA 4CZHA 3MN5A 4ZTJA 3WNFA 1X3NA 4FM0A 3A5LC 1LAVA 1NK7A 5AQGA 2KFZA 4KI6A 1SKWA 2P9IB 1S3XA 2CH6A 3J7AP 1UA1A 2VGMA 3FGUA 3VA0A 3SMPA 5BPLA 3EE9A 3QEWA 3TSQA 2D5RA 2RPIA 4IJAA 3KD5E 4DSJA 4E0DA 3THWA 3N4PA 3LZJA 1JLGA 1YTUA 1XWLA 2B4JA 3NGIA 1IG8A 3LP3A 3HYFA 5HROA 1VQMN 4B9MA 4KHYA 1LW2A 4BR5A 3O3GA 4DR4K 3OS1A 2GUIA 3QDKA 3AA4A 3QBWA 2HHWA 3BP8A 3MEGA 5I42A 1BDGA 1P90A 1YXQA 4A59A 1NGIA 4BR0A 3F5TA 1CZ9A 2D0OA 3AO2A 2QM1A 4C8KA 2OANA 2HBJA 3E9OA 4JK7A 2NZTA 2QTDA 2YV0X 3THYA 3K58A 1TKDA 3CJ7A 4H5TA 5HP1A 1Z25A 3L2RA 3UB5A 3VEXA 2VQEK 1A5WA 4WQ4C 4K41A 1HX1A 4J2EA 1RNHA 3O1WA 3NFAA 1KD1O 4YOYA 4RG8A 3M5RA 1VQ4N 3QLHA 5EXWA 4IFVA 2RHKA 4DQPA 3VA3A 4CBWA 3PX4A 1SL1A 2H3GX 3AO5A 4FJGA 1Q81O 3K9KA 2PY5A 5F1XA 3LDLA 3UKUA 1RDCA 5AZJA 1B9FA 4DU3A 3VQBA 4HUFA 3G10A 1QQNA 2PBDA 4DV5K 5KI6A 3ENOA 4K43A 3ZETA 3CCMN 4AM7A 4W5RA 4GKJK 3SQ2A 2P9SA 3K0SA 1T6DA 5ELZA 4O0JA 2VYPA 5JLFA 3L0QA 4CHZA 4N56A 1NK6A 4NO7A 3M8QA 3SAGA 3T1AA 3C6HA 4CHOA 2IOCA 1QTMA 2ITGA 1HKCA 3TR8A 3ZSXA 1V4TA 3SMSA 1HNWK 4B9TA 1WSFA 2UUAK 3MXJA 5BN8A 4FWQA 1JXEA 4H5RA 3GDQA 4B9LA 4BE0A 2E20A 5CZ2A 4FLTA 1YJ9N 4KFBA 4MLHA 4IKFA 4O4GA 3K2PA 2P9KA 3VQQA 2IDOA 4H4OA 4UQGA 5HRNA 4CECA 4LF7K 4HTUA 4CGJA 5AZIB 3JAMO 4JI6K 5M1NA 3C6UA 4EAHD 1BQMA 3VEZA 4CIGA 1DTTA 3V4IA 4Z4IA 3HBTA 4DTOA 1EKEA 3TPQA 3CF5L 2P9UA 1GLAG 1X9JA 4EFHA 3SUQA 1OVQA 5IT9O 3NF7A 3AY9A 3CQYA 3THVA 3TTCA 4GW6A 1T05A 1WSHA 3AVNA 5GINA 5M1FA 5EU7A 2NRXA 3U8XA 1C6VA 2WC9A 2XY6A 4M41A 4IO9L 3CETA 3KLEA 1BA1A 5C15A 2GEMA 3PY8A 3U9ZA 2OZMA 3KD1E 4GV9A 1JCEA 2OYQA 2HHHK 1ITGA 3V1QA 2FSJA 4YFUA 4ICLA 2FC0A 1HJRA 4JKBA 1CXQA 2A40A 3OJUA 3CFRA 4WQ4A 2VG7A 3CPEA 1VSDA 4WE1A 4FOIA 2IVOA 4OPHA 5HOOA 3NF8A 1DT9A 1JLAA 4H5VA 4I6MB 4PL7A 2XY5A 1W0HA 5I3UA 1K9MO 4DLGA 4JRPA
chains in the Genus database with same CATH topology
3PO4A 1ASVA 1VSHA 1JKHA 4FZXC 3OYCA 3TABA 4G1QA 4DSKA 1A5VA 1HQEA 1TAQA 3ZT3A 5C25A 1IKXA 3SCXA 3HXMA 4F4KA 1D8YA 1KCFA 4KKOA 4JLHA 3WNEA 3OY9A 3PUFA 3L2VA 4DFKA 4CEEA 2YNGA 2DFEA 1JL1A 4FVMA 4FJNA 3KLIA 1I39A 1RTJA 4CCHA 3K57A 3ISNC 1G15A 4W5QA 4AHCA 3VQ7A 3RTVA 1D9FA 4KHSA 4CFBA 2E6LA 1X9MA 1L3VA 2B5JA 3F73A 4QCLA 1C1AA 4Z4HA 1XHZA 1BIZA 4EZ6A 2DFFA 5J2MA 3CFPA 5HRSA 3SUNA 4FLZA 4FJ9A 3M8SA 3DRRA 3HJFA 4FZYA 2FBYA 4NCGA 3OYAA 3QIOA 4LSLA 2DTUA 4LY7A 2QXFA 4N5SA 1KFSA 4CJ5A 2P1JA 4RW4A 2IC3A 4FLYA 2YHAA 4CJRA 2XY7A 1XC9A 5D3GA 1ZBFA 3NDKA 4DFMA 2HHSA 2Z1GA 1HNIA 4DSLA 3ULDA 1I3AA 2Y1IA 4KREA 1U49A 1YT3A 3SZ2A 4M3UA 4L8RB 1TV6A 4DS4A 3AVBA 4O0IA 4DWIA 3AA2A 3ZT0A 4PA1A 4B08A 4CJPA 1S1UA 2D0BA 4BDYA 3RMDA 1S9EA 3QEPA 1TK0A 4FJ5A 3VQCA 4DMNA 1Q9YA 3OYBA 4GVMA 3ZT1A 4DTUA 3NH0A 1EXQA 2W42A 1KVCA 2G8UA 4DSEA 3CM6A 1VRUA 5KGWA 2HNDA 1HPZA 4H8KA 3TARA 3KJVA 3ZSOA 3HVRA 4CJ3A 3VQPA 3K5MA 3QEIA 3LDSA 3NGYA 1C0MA 4CF9A 4M3XA 1WAFA 1O1WA 3DM2A 4CERA 3KK3A 3NHGA 1YVUA 4MFBA 2HMIA 4HCCA 2KTQA 4FJJA 3DLBA 1S5JA 4K8XA 5JS2A 3MECA 3NCIA 5KTQA 4PUOA 2QK9A 3HM9A 2OPPA 3NF6A 1BCMA 1HYSA 1UWBA 1CXUA 3OYFA 1QSLA 4O55A 4OGEA 4DFJA 2Z1JA 1L3UA 1KLMA 2HHUA 2G8IA 1L3SA 2XY8A 1UOCA 4CHPA 1XI1A 3VQAA 1NKBA 1GOBA 1RBRA 1RTIA 3DLGA 3IRXA 3L3VA 1RBTA 2YNFA 1VSKA 1ZBUA 3OYGA 3ALYA 3JYTA 1NK4A 2OZSA 2X6SA 2F8TA 4CJWA 2F96A 1RT4A 4KHWA 3C94A 1KTQA 1NK0A 1NK8A 1UAXA 4CESA 3QETA 3PX0A 4ID5A 1RT6A 5HRPA 1TK5A 1HYZA 3OVNA 3U3YA 1CZBA 4DTRA 4CEZA 1GOAA 4KHUA 4CJQA 3NGZA 3DRPA 4KTQA 1TKZA 1RBUA 4YNQA 4B9VA 3QNOA 4JS5A 5HLFA 4CJFA 3OYNA 3KLGA 3ZSRA 3EYZA 2RF2A 1IG9A 4F2SA 3P1GA 4DTMA 1TAUA 4Z4FA 3T3FA 4JRQA 1NJYA 2YHBA 2X74A 5HRRA 1WSEA 2IAJA 1BI4A 3OYMA 2ZE2A 4QOZB 2QKKA 4PWDA 3QERA 4F8RA 3PO5A 4FLUA 4DS5A 1RDBA 3ZSWA 4KRFA 2HHTA 5CYMA 4FW1A 4FM1A 2LSNA 3VQ4A 4KB1A 3C95A 4CE9A 1D9DA 3NBPA 3DYAA 2KW4A 4I7FA 4B8AB 3S3NA 4AILC 4CGDA 1U47A 2Z1HA 1NJZA 4DTSA 3B6PA 4DQRA 4CIEA 3S3OA 4I2PA 4CGGA 3CFOA 4C8NA 2Y1JA 3U6FA 4OKKA 1KRPA 3F9KA 1U45A 3KK2A 1FKPA 1RILA 4DU4A 2Z1IA 4ELUA 1W9HA 4CJTA 4CEDA 3IG1A 4BE1A 1J53A 1LWFA 3D0PA 3SPYA 4LH4A 1T8EA 1VSJA 1A5XA 4AHSA 3V81A 2G8FA 3TAFA 2KZZA 3TAGA 3G0ZA 3D45A 3OYHA 3KIOA 1TGOA 5J2QA 4FW2A 1C1CA 3DLKA 4OKJA 4AHTA 3TI0A 4ELVA 1ZBLA 4TSXA 4CF1A 4FXDA 3I0SA 1SL2A 1JL2A 4IG0A 4BE2A 4MQ3A 1RDDA 4CEAA 2BANA 4FJHA 4IBNA 3CYMA 1VK0A 4EZ9A 1TVRA 4RW7A 4E89A 4F3TA 2P5OA 5CY4A 3OYKA 3ZSVA 1R0AA 1JLCA 2E6MA 3CG7A 4KTZA 4KHQA 4CJEA 3E01A 1T7PA 1RT5A 3SYZA 4EP5A 4DU1A 5E41A 3LWLA 3SNNA 4DQIA 3I0RA 5C42A 4LSNA 3RMAA 3SV3A 1QE1A 3RR7A 4HCBA 4FK0A 4OLAA 2ZQBA 1WSGA 2ZD1A 2PZSA 4Q5VA 3KKSA 4B9SA 4N76A 1KVBA 2YKMA 2BGGA 4CJSA 4DTJA 3DI6A 3QINA 3VN5A 3OJSA 4Y1CA 1IKWA 2HHXA 4CK1A 4CF2A 4I2QA 4NYFA 3SQ1A 3S3MA 5DMRA 4FJXA 4K8ZA 3DRSA 4FZZA 1B9DA 3AVGA 3SQ0A 3AO1A 4DQQA 3FFIA 4W5OA 5CZ1A 2XO7A 3QEXA 3SUPA 3KK1A 3K59A 4CFCA 3TAPA 1NJXA 4CEFA 4CIFA 4I9LA 3TWHA 2G8KA 3HSTB 1RBSA 3HP9A 2QKBA 1LW0A 1SUQA 5SWMA 3HK2A 3EY1A 5K14A 2GV9A 3AA5X 5HBMA 4FM2A 5KRTA 4DSFA 1KSPA 1MU2A 1ASWA 1REVA 3SPZA 4M3TA 4B9UA 4N47A 3SJJA 4E3SA 3AVAA 3ZT2A 2HVHA 3CM5A 3VQDA 3AVMA 3AVLA 3AO4A 3OYDA 4NCBA 5FRMA 3ZSQA 4PY5A 1GOCA 3CQ8A 1U04A 2OPSA 4OPKA 3U3GA 2FBVA 4GMJB 4HHTA 3MXIA 3AA3A 4RW9A 5FDLA 4ZTFA 1UA0A 4E1NA 2OPQA 1NKCA 3M8RA 3LPUA 3ASMA 4JRPA 2KQ2A 3VQ6A 3SV4A 3HPOA 2EHGA 1ZBHA 2YNHA 2FBTA 1NJWA 2HHQA 4RW6A 4CK2A 4Z0UA 1IKVA 2EX3A 1LV5A 5T7BA 1S1WA 4BWMA 1WN7A 1RBVA 1VSMA 4BWJA 3WNFA 1JLEA 3VQEA 3NH1A 4FM0A 4ZTJA 3LP1A 3AVJA 3OS0A 1WSJA 1LAVA 1NK7A 1S6QA 2ETJA 2KFZA 2HNYA 1VSEA 1RTHA 3AVFA 3UIQA 4KI6A 4IFYA 4E7IA 1SKWA 3TAMA 5KRSA 3O3FA 1WNSA 4FK2A 1IO2A 2VG5A 1UA1A 3VA0A 1C0TA 3RRHA 4OGCA 3QEWA 2D5RA 2RPIA 1N5YA 2PYLA 3RWUA 3V9ZA 1S1XA 2ATQA 1NK9A 3V1OA 4C8OA 3DMJA 2G8HA 4KAZA 1QSSA 3KD5E 4LH5A 4BACA 4C8MA 3OYIA 3TAEA 4DSJA 4E0DA 4CJKA 1IKYA 1TL1A 2D0CA 3ZT4A 4H4MA 1Y97A 2DFHA 1RT1A 4O44A 3QEVA 1LWEA 4NCAA 4Z4CA 1BHLA 4B3OA 1EP4A 3LZJA 1JLGA 2G8VA 1YTUA 1XWLA 3BGRA 1T03A 2B4JA 3ZSYA 4DFPA 1K6YA 2E4LA 3HVTA 3V1RA 3NGIA 2B6AA 2GBZA 3HYFA 3LP3A 5HROA 4B9MA 2JLEA 4KHYA 1DTQA 1LW2A 1Z26A 4AHRA 3O3GA 2GUIA 3OS1A 3HP6A 3AVIA 3AA4A 3LZIA 3O4QA 3O3HA 2HHWA 1C1BA 4EP4A 3MEGA 4E7JA 5I42A 3LWMA 3LP0A 4CHYA 3WNGA 1WAJA 4CEBA 4XIUA 4KO0A 4CJUA 1CZ9A 1S1VA 2HHVA 2OA8A 4DQSA 3BDPA 3AO2A 1HQUA 1Q8IA 4CJLA 2XHBA 1KLNA 4C8KA 3KLFA 1BGXT 2YNIA 4E7LA 3V9SA 4DLEA 1J54A 4W5TA 3MEDA 1EETA 2YV0X 3H08A 4FLWA 3O4NA 1FK9A 4N41A 1BI4B 1LWCA 1TKXA 3K58A 4OKEA 2RKIA 1TKDA 3KLHA 4Y1DA 5HP1A 1WSIA 1Z25A 3L2RA 4FCYA 3LPTA 3OS2A 4DTNA 4KB0A 1A5WA 4CEOA 3NE6A 4JS4A 1BL3A 3S9HA 1J5OA 1F21A 1SV5A 4NYNA 4B8CA 4J2EA 2VG6A 3LANA 1KFDA 1RNHA 3L2WA 4KHNA 1IH7A 3NFAA 4CF0A 2JGUA 4DTPA 3OYLA 4RG8A 3TANA 3P5JA 3DLEA 5CYQA 1JLQA 4FK4A 3QLHA 3PV8A 5FRNA 4KPYA 3M8PA 4IFVA 5KGXA 3VQ9A 1CLQA 4DQPA 3L2QA 3VA3A 4DTXA 3A2FA 3PX4A 1SL1A 3AO5A 2NUBA 2PYJA 1NOZA 5J1EA 1HMVA 4FJGA 1ZBIA 2PY5A 4DF4A 4KI4A 3DOLA 4B9NA 4M3WA 1RDCA 4PQUA 4QAGA 2RN2A 1B9FA 3VQ8A 4DU3A 3VQBA 4HUFA 4CJ4A 2R7YA 3G10A 4DF8A 3DLRA 4OLBA 4F3OA 1SKRA 3V9XA 4FJKA 4FYDA 5KI6A 1FXXA 2IGIA 5FROA 3DLHA 2KFNA 4CGIA 4FLXA 4W5RA 3C6TA 4HVJA 5J2PA 4E7HA 3SQ2A 1X9SA 3LALA 3L8BA 4CFAA 3OYEA 4M3YA 4LD0A 2A1SA 4W5NA 3AVKA 4O0JA 4N56A 4J2AA 4CHZA 1EX4A 1NK6A 4J2DA 4FJ8A 4HUGA 2G8WA 4Q0BA 1C0UA 3M8QA 3P83D 4O5BA 4F2RA 3T1AA 3ZSZA 1J9AA 1U4BA 4CHOA 2IOCA 3L3UA 2ITGA 3T19A 3VQ5A 1QTMA 3TR8A 3ZSXA 2IS3A 4B9TA 1WSFA 4CGFA 3RMCA 3MXJA 1ASUA 3SI6A 4IDKA 1BCOA 2X6NA 3K5LA 1QS4A 3MAQA 1JXEA 4E7KA 1L5UA 2D0AA 1RTDA 4B9LA 4BE0A 4DSIA 5CZ2A 3HL8A 4FLTA 1BQNA 1TL3A 4KFBA 4Z4EA 2F8SA 2XRIA 4IKFA 3HPGA 3K2PA 4O4GA 3VQQA 2KZMA 2IDOA 3QIPA 4H4OA 4M42A 2WONA 1NKEA 4M3ZA 4BDZA 3MXMA 2WOMA 3AVCA 4UQGA 1BIUA 4AHVA 5HRNA 4CECA 1NK5A 1N6QA 3K5NA 1VSFA 4R5PA 4HTUA 4CGJA 3MEEA 1S6PA 1U48A 1HYVA 4CJVA 2HNZA 3B6OA 2FBXA 5SZTA 3C6UA 4HUEA 3AO3A 4ELTA 1BQMA 3NH2A 4E19A 4CIGA 1VSLA 1WLJA 2BDPA 4J2BA 1DTTA 1QQCA 2HB5A 1DLOA 3AV9A 2BE2A 3JSMA 3V4IA 4FJLA 1S1TA 4Z4IA 4DTOA 1RDAA 3HT3A 4CF8A 3ITHA 1SL0A 3IAYA 1EKEA 1TKTA 1JLBA 1QHTA 3IS9A 3K5OA 3SUQA 1ZYQA 3NF7A 3QO9A 3I8DA 3SUOA 3THVA 2O4IA 4E1MA 4GW6A 1T05A 1WSHA 3AVNA 1L3TA 5EU7A 3ZCMA 2A1RA 1C6VA 5DK5A 1RT2A 3TAQA 5J2NA 4ID1A 5C24A 1VSIA 3KTQA 2XY6A 2OPRA 1JXBA 4CFDA 3LAKA 2Q3SA 4M41A 4FJMA 3NAEA 1Q9XA 2O4GA 2VWJA 3KLEA 1HNVA 1SKSA 4OPJA 4C8LA 3PY8A 1RT7A 4AH9A 1FKOA 4BDPA 2OZMA 3KKRA 1S9GA 3V9UA 3LP2A 3SQ4A 1TK8A 3KD1E 3AVHA 4ZHRA 2OYQA 1LAWA 1YTAA 1XHXA 1ITGA 4KV8A 3V1QA 3NF9A 2HW3A 2X78A 4CHNA 4YFUA 3PX6A 1VRTA 2VWKA 4M45A 1QSYA 3QESA 4ICLA 1X9WA 2FC0A 1B92A 1HJRA 1CXQA 3HPHA 4OJRA 4RW8A 3WNHA 3V9WA 3QNNA 3OJUA 3CFRA 4FJ7A 1JLFA 4I9QA 3RMBA 4CEQA 4FJIA 1BISA 2VG7A 3DOKA 1NOYA 1RCHA 4M3RA 1VSDA 1X1PA 4WE1A 4AHUA 3EZ5A 3V6DA 3OYJA 4KTWA 2HVIA 5JS1A 4CGHA 2I5JA 2P51A 3RR8A 2YKNA 3NF8A 1JLAA 3HO1A 3L2UA 2XY5A 3LAMA 4CK3A 2DY4A 1W0HA 4OVLA 5I3UA 4CHQA 2AJQA 4IG3A 1D5AA 4Z4GA 4DLGA 4FLVA 2P5GA 3RRGA 1RT3A 4DG1A 1KVAA 1HRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO4 A;  1ASV A;  1VSH A;  1JKH A;  4FZX C;  3OYC A;  3TAB A;  4G1Q A;  4DSK A;  1A5V A;  1HQE A;  1TAQ A;  3ZT3 A;  5C25 A;  1IKX A;  3SCX A;  3HXM A;  4F4K A;  1D8Y A;  1KCF A;  4KKO A;  4JLH A;  3WNE A;  3OY9 A;  3PUF A;  3L2V A;  4DFK A;  4CEE A;  2YNG A;  2DFE A;  1JL1 A;  4FVM A;  4FJN A;  3KLI A;  1I39 A;  1RTJ A;  4CCH A;  3K57 A;  3ISN C;  1G15 A;  4W5Q A;  4AHC A;  3VQ7 A;  3RTV A;  1D9F A;  4KHS A;  4CFB A;  2E6L A;  1X9M A;  1L3V A;  2B5J A;  3F73 A;  4QCL A;  1C1A A;  4Z4H A;  1XHZ A;  1BIZ A;  4EZ6 A;  2DFF A;  5J2M A;  3CFP A;  5HRS A;  3SUN A;  4FLZ A;  4FJ9 A;  3M8S A;  3DRR A;  3HJF A;  4FZY A;  2FBY A;  4NCG A;  3OYA A;  3QIO A;  4LSL A;  2DTU A;  4LY7 A;  2QXF A;  4N5S A;  1KFS A;  4CJ5 A;  2P1J A;  4RW4 A;  2IC3 A;  4FLY A;  2YHA A;  4CJR A;  2XY7 A;  1XC9 A;  5D3G A;  1ZBF A;  3NDK A;  4DFM A;  2HHS A;  2Z1G A;  1HNI A;  4DSL A;  3ULD A;  1I3A A;  2Y1I A;  4KRE A;  1U49 A;  1YT3 A;  3SZ2 A;  4M3U A;  4L8R B;  1TV6 A;  4DS4 A;  3AVB A;  4O0I A;  4DWI A;  3AA2 A;  3ZT0 A;  4PA1 A;  4B08 A;  4CJP A;  1S1U A;  2D0B A;  4BDY A;  3RMD A;  1S9E A;  3QEP A;  1TK0 A;  4FJ5 A;  3VQC A;  4DMN A;  1Q9Y A;  3OYB A;  4GVM A;  3ZT1 A;  4DTU A;  3NH0 A;  1EXQ A;  2W42 A;  1KVC A;  2G8U A;  4DSE A;  3CM6 A;  1VRU A;  5KGW A;  2HND A;  1HPZ A;  4H8K A;  3TAR A;  3KJV A;  3ZSO A;  3HVR A;  4CJ3 A;  3VQP A;  3K5M A;  3QEI A;  3LDS A;  3NGY A;  1C0M A;  4CF9 A;  4M3X A;  1WAF A;  1O1W A;  3DM2 A;  4CER A;  3KK3 A;  3NHG A;  1YVU A;  4MFB A;  2HMI A;  4HCC A;  2KTQ A;  4FJJ A;  3DLB A;  1S5J A;  4K8X A;  5JS2 A;  3MEC A;  3NCI A;  5KTQ A;  4PUO A;  2QK9 A;  3HM9 A;  2OPP A;  3NF6 A;  1BCM A;  1HYS A;  1UWB A;  1CXU A;  3OYF A;  1QSL A;  4O55 A;  4OGE A;  4DFJ A;  2Z1J A;  1L3U A;  1KLM A;  2HHU A;  2G8I A;  1L3S A;  2XY8 A;  1UOC A;  4CHP A;  1XI1 A;  3VQA A;  1NKB A;  1GOB A;  1RBR A;  1RTI A;  3DLG A;  3IRX A;  3L3V A;  1RBT A;  2YNF A;  1VSK A;  1ZBU A;  3OYG A;  3ALY A;  3JYT A;  1NK4 A;  2OZS A;  2X6S A;  2F8T A;  4CJW A;  2F96 A;  1RT4 A;  4KHW A;  3C94 A;  1KTQ A;  1NK0 A;  1NK8 A;  1UAX A;  4CES A;  3QET A;  3PX0 A;  4ID5 A;  1RT6 A;  5HRP A;  1TK5 A;  1HYZ A;  3OVN A;  3U3Y A;  1CZB A;  4DTR A;  4CEZ A;  1GOA A;  4KHU A;  4CJQ A;  3NGZ A;  3DRP A;  4KTQ A;  1TKZ A;  1RBU A;  4YNQ A;  4B9V A;  3QNO A;  4JS5 A;  5HLF A;  4CJF A;  3OYN A;  3KLG A;  3ZSR A;  3EYZ A;  2RF2 A;  1IG9 A;  4F2S A;  3P1G A;  4DTM A;  1TAU A;  4Z4F A;  3T3F A;  4JRQ A;  1NJY A;  2YHB A;  2X74 A;  5HRR A;  1WSE A;  2IAJ A;  1BI4 A;  3OYM A;  2ZE2 A;  4QOZ B;  2QKK A;  4PWD A;  3QER A;  4F8R A;  3PO5 A;  4FLU A;  4DS5 A;  1RDB A;  3ZSW A;  4KRF A;  2HHT A;  5CYM A;  4FW1 A;  4FM1 A;  2LSN A;  3VQ4 A;  4KB1 A;  3C95 A;  4CE9 A;  1D9D A;  3NBP A;  3DYA A;  2KW4 A;  4I7F A;  4B8A B;  3S3N A;  4AIL C;  4CGD A;  1U47 A;  2Z1H A;  1NJZ A;  4DTS A;  3B6P A;  4DQR A;  4CIE A;  3S3O A;  4I2P A;  4CGG A;  3CFO A;  4C8N A;  2Y1J A;  3U6F A;  4OKK A;  1KRP A;  3F9K A;  1U45 A;  3KK2 A;  1FKP A;  1RIL A;  4DU4 A;  2Z1I A;  4ELU A;  1W9H A;  4CJT A;  4CED A;  3IG1 A;  4BE1 A;  1J53 A;  1LWF A;  3D0P A;  3SPY A;  4LH4 A;  1T8E A;  1VSJ A;  1A5X A;  4AHS A;  3V81 A;  2G8F A;  3TAF A;  2KZZ A;  3TAG A;  3G0Z A;  3D45 A;  3OYH A;  3KIO A;  1TGO A;  5J2Q A;  4FW2 A;  1C1C A;  3DLK A;  4OKJ A;  4AHT A;  3TI0 A;  4ELV A;  1ZBL A;  4TSX A;  4CF1 A;  4FXD A;  3I0S A;  1SL2 A;  1JL2 A;  4IG0 A;  4BE2 A;  4MQ3 A;  1RDD A;  4CEA A;  2BAN A;  4FJH A;  4IBN A;  3CYM A;  1VK0 A;  4EZ9 A;  1TVR A;  4RW7 A;  4E89 A;  4F3T A;  2P5O A;  5CY4 A;  3OYK A;  3ZSV A;  1R0A A;  1JLC A;  2E6M A;  3CG7 A;  4KTZ A;  4KHQ A;  4CJE A;  3E01 A;  1T7P A;  1RT5 A;  3SYZ A;  4EP5 A;  4DU1 A;  5E41 A;  3LWL A;  3SNN A;  4DQI A;  3I0R A;  5C42 A;  4LSN A;  3RMA A;  3SV3 A;  1QE1 A;  3RR7 A;  4HCB A;  4FK0 A;  4OLA A;  2ZQB A;  1WSG A;  2ZD1 A;  2PZS A;  4Q5V A;  3KKS A;  4B9S A;  4N76 A;  1KVB A;  2YKM A;  2BGG A;  4CJS A;  4DTJ A;  3DI6 A;  3QIN A;  3VN5 A;  3OJS A;  4Y1C A;  1IKW A;  2HHX A;  4CK1 A;  4CF2 A;  4I2Q A;  4NYF A;  3SQ1 A;  3S3M A;  5DMR A;  4FJX A;  4K8Z A;  3DRS A;  4FZZ A;  1B9D A;  3AVG A;  3SQ0 A;  3AO1 A;  4DQQ A;  3FFI A;  4W5O A;  5CZ1 A;  2XO7 A;  3QEX A;  3SUP A;  3KK1 A;  3K59 A;  4CFC A;  3TAP A;  1NJX A;  4CEF A;  4CIF A;  4I9L A;  3TWH A;  2G8K A;  3HST B;  1RBS A;  3HP9 A;  2QKB A;  1LW0 A;  1SUQ A;  5SWM A;  3HK2 A;  3EY1 A;  5K14 A;  2GV9 A;  3AA5 X;  5HBM A;  4FM2 A;  5KRT A;  4DSF A;  1KSP A;  1MU2 A;  1ASW A;  1REV A;  3SPZ A;  4M3T A;  4B9U A;  4N47 A;  3SJJ A;  4E3S A;  3AVA A;  3ZT2 A;  2HVH A;  3CM5 A;  3VQD A;  3AVM A;  3AVL A;  3AO4 A;  3OYD A;  4NCB A;  5FRM A;  3ZSQ A;  4PY5 A;  1GOC A;  3CQ8 A;  1U04 A;  2OPS A;  4OPK A;  3U3G A;  2FBV A;  4GMJ B;  4HHT A;  3MXI A;  3AA3 A;  4RW9 A;  5FDL A;  4ZTF A;  1UA0 A;  4E1N A;  2OPQ A;  1NKC A;  3M8R A;  3LPU A;  3ASM A;  4JRP A;  2KQ2 A;  3VQ6 A;  3SV4 A;  3HPO A;  2EHG A;  1ZBH A;  2YNH A;  2FBT A;  1NJW A;  2HHQ A;  4RW6 A;  4CK2 A;  4Z0U A;  1IKV A;  2EX3 A;  1LV5 A;  5T7B A;  1S1W A;  4BWM A;  1WN7 A;  1RBV A;  1VSM A;  4BWJ A;  3WNF A;  1JLE A;  3VQE A;  3NH1 A;  4FM0 A;  4ZTJ A;  3LP1 A;  3AVJ A;  3OS0 A;  1WSJ A;  1LAV A;  1NK7 A;  1S6Q A;  2ETJ A;  2KFZ A;  2HNY A;  1VSE A;  1RTH A;  3AVF A;  3UIQ A;  4KI6 A;  4IFY A;  4E7I A;  1SKW A;  3TAM A;  5KRS A;  3O3F A;  1WNS A;  4FK2 A;  1IO2 A;  2VG5 A;  1UA1 A;  3VA0 A;  1C0T A;  3RRH A;  4OGC A;  3QEW A;  2D5R A;  2RPI A;  1N5Y A;  2PYL A;  3RWU A;  3V9Z A;  1S1X A;  2ATQ A;  1NK9 A;  3V1O A;  4C8O A;  3DMJ A;  2G8H A;  4KAZ A;  1QSS A;  3KD5 E;  4LH5 A;  4BAC A;  4C8M A;  3OYI A;  3TAE A;  4DSJ A;  4E0D A;  4CJK A;  1IKY A;  1TL1 A;  2D0C A;  3ZT4 A;  4H4M A;  1Y97 A;  2DFH A;  1RT1 A;  4O44 A;  3QEV A;  1LWE A;  4NCA A;  4Z4C A;  1BHL A;  4B3O A;  1EP4 A;  3LZJ A;  1JLG A;  2G8V A;  1YTU A;  1XWL A;  3BGR A;  1T03 A;  2B4J A;  3ZSY A;  4DFP A;  1K6Y A;  2E4L A;  3HVT A;  3V1R A;  3NGI A;  2B6A A;  2GBZ A;  3HYF A;  3LP3 A;  5HRO A;  4B9M A;  2JLE A;  4KHY A;  1DTQ A;  1LW2 A;  1Z26 A;  4AHR A;  3O3G A;  2GUI A;  3OS1 A;  3HP6 A;  3AVI A;  3AA4 A;  3LZI A;  3O4Q A;  3O3H A;  2HHW A;  1C1B A;  4EP4 A;  3MEG A;  4E7J A;  5I42 A;  3LWM A;  3LP0 A;  4CHY A;  3WNG A;  1WAJ A;  4CEB A;  4XIU A;  4KO0 A;  4CJU A;  1CZ9 A;  1S1V A;  2HHV A;  2OA8 A;  4DQS A;  3BDP A;  3AO2 A;  1HQU A;  1Q8I A;  4CJL A;  2XHB A;  1KLN A;  4C8K A;  3KLF A;  1BGX T;  2YNI A;  4E7L A;  3V9S A;  4DLE A;  1J54 A;  4W5T A;  3MED A;  1EET A;  2YV0 X;  3H08 A;  4FLW A;  3O4N A;  1FK9 A;  4N41 A;  1BI4 B;  1LWC A;  1TKX A;  3K58 A;  4OKE A;  2RKI A;  1TKD A;  3KLH A;  4Y1D A;  5HP1 A;  1WSI A;  1Z25 A;  3L2R A;  4FCY A;  3LPT A;  3OS2 A;  4DTN A;  4KB0 A;  1A5W A;  4CEO A;  3NE6 A;  4JS4 A;  1BL3 A;  3S9H A;  1J5O A;  1F21 A;  1SV5 A;  4NYN A;  4B8C A;  4J2E A;  2VG6 A;  3LAN A;  1KFD A;  1RNH A;  3L2W A;  4KHN A;  1IH7 A;  3NFA A;  4CF0 A;  2JGU A;  4DTP A;  3OYL A;  4RG8 A;  3TAN A;  3P5J A;  3DLE A;  5CYQ A;  1JLQ A;  4FK4 A;  3QLH A;  3PV8 A;  5FRN A;  4KPY A;  3M8P A;  4IFV A;  5KGX A;  3VQ9 A;  1CLQ A;  4DQP A;  3L2Q A;  3VA3 A;  4DTX A;  3A2F A;  3PX4 A;  1SL1 A;  3AO5 A;  2NUB A;  2PYJ A;  1NOZ A;  5J1E A;  1HMV A;  4FJG A;  1ZBI A;  2PY5 A;  4DF4 A;  4KI4 A;  3DOL A;  4B9N A;  4M3W A;  1RDC A;  4PQU A;  4QAG A;  2RN2 A;  1B9F A;  3VQ8 A;  4DU3 A;  3VQB A;  4HUF A;  4CJ4 A;  2R7Y A;  3G10 A;  4DF8 A;  3DLR A;  4OLB A;  4F3O A;  1SKR A;  3V9X A;  4FJK A;  4FYD A;  5KI6 A;  1FXX A;  2IGI A;  5FRO A;  3DLH A;  2KFN A;  4CGI A;  4FLX A;  4W5R A;  3C6T A;  4HVJ A;  5J2P A;  4E7H A;  3SQ2 A;  1X9S A;  3LAL A;  3L8B A;  4CFA A;  3OYE A;  4M3Y A;  4LD0 A;  2A1S A;  4W5N A;  3AVK A;  4O0J A;  4N56 A;  4J2A A;  4CHZ A;  1EX4 A;  1NK6 A;  4J2D A;  4FJ8 A;  4HUG A;  2G8W A;  4Q0B A;  1C0U A;  3M8Q A;  3P83 D;  4O5B A;  4F2R A;  3T1A A;  3ZSZ A;  1J9A A;  1U4B A;  4CHO A;  2IOC A;  3L3U A;  2ITG A;  3T19 A;  3VQ5 A;  1QTM A;  3TR8 A;  3ZSX A;  2IS3 A;  4B9T A;  1WSF A;  4CGF A;  3RMC A;  3MXJ A;  1ASU A;  3SI6 A;  4IDK A;  1BCO A;  2X6N A;  3K5L A;  1QS4 A;  3MAQ A;  1JXE A;  4E7K A;  1L5U A;  2D0A A;  1RTD A;  4B9L A;  4BE0 A;  4DSI A;  5CZ2 A;  3HL8 A;  4FLT A;  1BQN A;  1TL3 A;  4KFB A;  4Z4E A;  2F8S A;  2XRI A;  4IKF A;  3HPG A;  3K2P A;  4O4G A;  3VQQ A;  2KZM A;  2IDO A;  3QIP A;  4H4O A;  4M42 A;  2WON A;  1NKE A;  4M3Z A;  4BDZ A;  3MXM A;  2WOM A;  3AVC A;  4UQG A;  1BIU A;  4AHV A;  5HRN A;  4CEC A;  1NK5 A;  1N6Q A;  3K5N A;  1VSF A;  4R5P A;  4HTU A;  4CGJ A;  3MEE A;  1S6P A;  1U48 A;  1HYV A;  4CJV A;  2HNZ A;  3B6O A;  2FBX A;  5SZT A;  3C6U A;  4HUE A;  3AO3 A;  4ELT A;  1BQM A;  3NH2 A;  4E19 A;  4CIG A;  1VSL A;  1WLJ A;  2BDP A;  4J2B A;  1DTT A;  1QQC A;  2HB5 A;  1DLO A;  3AV9 A;  2BE2 A;  3JSM A;  3V4I A;  4FJL A;  1S1T A;  4Z4I A;  4DTO A;  1RDA A;  3HT3 A;  4CF8 A;  3ITH A;  1SL0 A;  3IAY A;  1EKE A;  1TKT A;  1JLB A;  1QHT A;  3IS9 A;  3K5O A;  3SUQ A;  1ZYQ A;  3NF7 A;  3QO9 A;  3I8D A;  3SUO A;  3THV A;  2O4I A;  4E1M A;  4GW6 A;  1T05 A;  1WSH A;  3AVN A;  1L3T A;  5EU7 A;  3ZCM A;  2A1R A;  1C6V A;  5DK5 A;  1RT2 A;  3TAQ A;  5J2N A;  4ID1 A;  5C24 A;  1VSI A;  3KTQ A;  2XY6 A;  2OPR A;  1JXB A;  4CFD A;  3LAK A;  2Q3S A;  4M41 A;  4FJM A;  3NAE A;  1Q9X A;  2O4G A;  2VWJ A;  3KLE A;  1HNV A;  1SKS A;  4OPJ A;  4C8L A;  3PY8 A;  1RT7 A;  4AH9 A;  1FKO A;  4BDP A;  2OZM A;  3KKR A;  1S9G A;  3V9U A;  3LP2 A;  3SQ4 A;  1TK8 A;  3KD1 E;  3AVH A;  4ZHR A;  2OYQ A;  1LAW A;  1YTA A;  1XHX A;  1ITG A;  4KV8 A;  3V1Q A;  3NF9 A;  2HW3 A;  2X78 A;  4CHN A;  4YFU A;  3PX6 A;  1VRT A;  2VWK A;  4M45 A;  1QSY A;  3QES A;  4ICL A;  1X9W A;  2FC0 A;  1B92 A;  1HJR A;  1CXQ A;  3HPH A;  4OJR A;  4RW8 A;  3WNH A;  3V9W A;  3QNN A;  3OJU A;  3CFR A;  4FJ7 A;  1JLF A;  4I9Q A;  3RMB A;  4CEQ A;  4FJI A;  1BIS A;  2VG7 A;  3DOK A;  1NOY A;  1RCH A;  4M3R A;  1VSD A;  1X1P A;  4WE1 A;  4AHU A;  3EZ5 A;  3V6D A;  3OYJ A;  4KTW A;  2HVI A;  5JS1 A;  4CGH A;  2I5J A;  2P51 A;  3RR8 A;  2YKN A;  3NF8 A;  1JLA A;  3HO1 A;  3L2U A;  2XY5 A;  3LAM A;  4CK3 A;  2DY4 A;  1W0H A;  4OVL A;  5I3U A;  4CHQ A;  2AJQ A;  4IG3 A;  1D5A A;  4Z4G A;  4DLG A;  4FLV A;  2P5G A;  3RRG A;  1RT3 A;  4DG1 A;  1KVA A;  1HRH A; 
#chains in the Genus database with same CATH topology
 3WXM B;  1VSH A;  5I9E B;  3OYC A;  4XH1 A;  4G1Q A;  2FF3 B;  4DSK A;  4OO1 J;  1HQE A;  3SCX A;  3DXK B;  3GG4 A;  3LM2 A;  4F4K A;  1D8Y A;  4JLH A;  3WNE A;  3SAH A;  4FJN A;  4BRK A;  1I94 K;  3K57 A;  4W5Q A;  4KHS A;  4CFB A;  2E6L A;  4BQL A;  1X9M A;  3RSE B;  3F73 A;  4QCL A;  1C1A A;  4WFB L;  4FJ9 A;  4IOC L;  4ISF A;  2ZGZ A;  4CJ5 A;  3G71 N;  4RW4 A;  4FWM A;  2YHA A;  5LMU K;  2CGL A;  1QQM A;  1GLC G;  4DFM A;  5C2D A;  5M1K A;  5AFU A;  2HHS A;  4YOX A;  2ZJR L;  2Y1I A;  4KRE A;  1YT3 A;  4M3U A;  4L8R B;  1TV6 A;  1DGK N;  2KHO A;  3UKR B;  1VQ6 N;  4PA1 A;  5ADX H;  1S9E A;  4DMN A;  1Q9Y A;  3A0I X;  4DTU A;  3NH0 A;  1EXQ A;  4H5W A;  4DR3 K;  1VRU A;  3QML A;  2QWR A;  3ZSO A;  2Q0U A;  3VEO A;  1C0M A;  4CF9 A;  3KK3 A;  4CER A;  4MLE A;  3NHG A;  4MFB A;  2WBN A;  3JXU A;  4YOT A;  1S5J A;  4BC2 A;  4BC4 A;  1KQS M;  3NCI A;  5KTQ A;  1U2V A;  4PUO A;  3HM9 A;  3VF2 A;  4U67 L;  1UWB A;  4O55 A;  4YOW A;  2Z1J A;  2F9T A;  2HHU A;  4IEE A;  1NMD A;  1ATR A;  4DCH A;  1XI1 A;  5BRH A;  1T44 A;  3PSF A;  4PKG A;  1Q18 A;  2F96 A;  4BG8 A;  1KTQ A;  3C7N B;  3PX0 A;  4KBO A;  1YIT N;  1TK5 A;  3VGL A;  3ATV A;  3OVN A;  1NGD A;  1GOA A;  2QI2 A;  4KTQ A;  4YNQ A;  3QNO A;  4CJF A;  4BGB A;  1K8K A;  4MDB A;  1IG9 A;  3T3F A;  1NJY A;  1Z05 A;  5C10 A;  3IUC A;  4CW7 B;  3PO5 A;  1RDB A;  2NRT A;  5CYM A;  4FW1 A;  3DAW A;  5FPN A;  2I7N A;  3VQ4 A;  2D0P A;  3WXI A;  4KB1 A;  1T6C A;  4I7F A;  3I55 N;  2Z1H A;  4DTS A;  4PHT X;  1C0G A;  3HOT A;  2Y1J A;  5EX5 A;  3KK2 A;  4CED A;  3IG1 A;  2IVP A;  5BR9 A;  1LWF A;  3D0P A;  4LH4 A;  1VSJ A;  4BY9 C;  3WQU A;  3O4W A;  4FW2 A;  3TI0 A;  5AQY A;  4FXD A;  1QQO A;  4IG0 A;  3BZK A;  3CYM A;  1VK0 A;  1XNR K;  1NGG A;  2P5O A;  3OYK A;  1R0A A;  1E4F T;  3CG7 A;  1G99 A;  2VWB A;  3E01 A;  3MCA B;  1T7P A;  2UUB K;  1RT5 A;  4DU1 A;  3LWL A;  4DQI A;  3I0R A;  3RMA A;  4HCB A;  3VOV A;  1WSG A;  2PZS A;  4Q5V A;  3KKS A;  4B9S A;  1KVB A;  4DV7 K;  4DTJ A;  3QIN A;  1Z6R A;  5AQM A;  4JI0 K;  1IKW A;  1JCF A;  3EL2 A;  4CK1 A;  4I2Q A;  1O13 A;  4FJX A;  4JYA K;  3K9J A;  3UKU B;  3AVG A;  3GBT A;  3ZYY X;  4W5O A;  4DQQ A;  4F8R A;  3KK1 A;  3SK3 A;  3ZEU B;  1GLL O;  3B8A X;  2QKB A;  3HP9 A;  1R59 O;  3U4L A;  3OTO K;  3W0L A;  5CE3 A;  1YJW N;  1REV A;  1ASW A;  2P9L A;  3AVA A;  3P38 A;  3CQX A;  3GE1 A;  3OYD A;  3AVL A;  5FRM A;  5DM7 L;  3ZSQ A;  4CZF A;  4PY5 A;  1TYQ A;  2NRH A;  1GOC A;  2OPS A;  4IO8 A;  4O5F A;  3U3G A;  3IMX A;  3AA3 A;  1QHA A;  3EO3 A;  3FZM A;  4B9Q A;  2O8C A;  3BZC A;  3LPU A;  2KQ2 A;  3VQ6 A;  3CXC M;  3KHY A;  3UE5 A;  2YNH A;  2FBT A;  4Z0U A;  2EX3 A;  2E1Z A;  2HST A;  3AGK A;  3HI0 A;  3NH1 A;  3VQE A;  3LP1 A;  1WSJ A;  3N4Q A;  2HNY A;  1VSE A;  1RTH A;  3UIQ A;  4E7I A;  3TAM A;  1WNS A;  4FK2 A;  4JI8 K;  5AQT A;  2VG5 A;  4MO5 A;  2P9N B;  2O8E B;  1C0T A;  4OGC A;  2PYL A;  3CJB A;  1N5Y A;  3RWU A;  3V1O A;  1NGA A;  2G8H A;  1QSS A;  3A8Y A;  1KAY A;  4CJK A;  1SAZ A;  5TKY A;  1IKY A;  3LDQ A;  1TL1 A;  1Y97 A;  3QEV A;  1RT1 A;  5BPM A;  4CJ7 A;  1LWE A;  4NCA A;  3FLC O;  4JI1 K;  1E4G T;  3BGR A;  2Q97 A;  1K6Y A;  2E4L A;  3WXL A;  3F2K A;  5GIP A;  3J80 O;  1OH7 A;  3C0B A;  2W40 A;  3QB0 A;  1E3M A;  1Z26 A;  4AHR A;  3IFR A;  3LZI A;  3O4Q A;  4DR7 K;  4HWI A;  3LP0 A;  2Q36 A;  2GTD A;  3CJ9 A;  4M7Y A;  1WAJ A;  4CEB A;  4JKA A;  3BDP A;  4CJL A;  1Q8I A;  2ZJP L;  3LM9 A;  2XHB A;  5AQJ A;  3KLF A;  1QVF M;  2YNI A;  1KAZ A;  2P9S B;  1J54 A;  2A42 A;  1EET A;  3H08 A;  4FLW A;  2ITM A;  2UXC K;  3O4N A;  1LWC A;  4OKE A;  2RKI A;  3CCU N;  4MO4 A;  1NGH A;  2QW9 A;  2P9U B;  4CEO A;  4B1V A;  4NYN A;  3LAN A;  1KFD A;  1YJN N;  4KHN A;  1IH7 A;  3SLC A;  4A5B A;  4FK4 A;  5FRN A;  3M8P A;  5KGX A;  3VQ9 A;  3OW2 M;  1OVY A;  3P4I A;  4FWK A;  3BUZ B;  2O8F A;  2NUB A;  2PYJ A;  1NOZ A;  5J1E A;  1HMV A;  1ZBI A;  4RCH A;  4FL9 A;  3VQ8 A;  5KPT A;  5FLX O;  3DLR A;  4JHD B;  5M1P A;  1SKR A;  3V9X A;  4U7B A;  2IGI A;  2KFN A;  4CGI A;  4FLX A;  4MDA A;  4HVJ A;  1X9S A;  1C0F A;  3R6M A;  5AQQ A;  1VQK N;  4J2D A;  4O8K A;  1C0U A;  4O5B A;  4F2R A;  3SAF A;  1J9A A;  4BRO A;  1U4B A;  5AQP A;  3T19 A;  3VQ5 A;  1NU0 A;  4XH4 A;  3VEN A;  4CGF A;  5KPZ A;  3RMC A;  2RE2 A;  2VGN A;  2X6N A;  5EOY A;  3K5L A;  4PKH A;  2D0A A;  4H0X B;  4OPA A;  4V19 S;  1BQN A;  4IXC A;  3VF4 A;  3HPG A;  1OH6 A;  4BRQ A;  3MXM A;  2WOM A;  5E84 A;  4AHV A;  1N6Q A;  3K5N A;  4R5P A;  1S6P A;  5LJW A;  5EY4 A;  2HNZ A;  3I56 N;  2FBX A;  5SZT A;  4HUE A;  3AO3 A;  2ASO A;  4X66 K;  2BDP A;  3R3L A;  4M7X A;  3F9M A;  1ZBS A;  5ADX A;  1TKT A;  3O6W A;  3K5O A;  1U2V B;  1ZYQ A;  3CI5 A;  3SUO A;  2UU9 K;  2D4W A;  2O4I A;  3ZCM A;  5DK5 A;  1JXB A;  4CFD A;  3E9L A;  1H1V A;  3G25 A;  2VWJ A;  1HNV A;  3H3O B;  2ZJQ L;  1HNZ K;  1S9G A;  2GWJ A;  3V9U A;  3LP2 A;  4FWR A;  1LAW A;  2HMP A;  1XHX A;  2E88 A;  3Q7C A;  3ID8 A;  2HW3 A;  1NGC A;  4CHN A;  4K42 A;  2Q2R A;  1QSY A;  3HPH A;  4RW8 A;  1JLF A;  2D1K A;  3RMB A;  1NWK A;  4FJI A;  2BH1 A;  3SBT A;  1NOY A;  4BRE A;  2FF6 A;  4A2A A;  3V6D A;  3EZ5 A;  4QS7 A;  1NM1 A;  4KTW A;  2I5J A;  1VQ5 N;  1MA9 B;  4FVU A;  4LFB K;  3HSC A;  2AJQ A;  1T3V A;  5AQZ A;  1K73 O;  5F0X A;  4FLV A;  3K5M A;  1ASV A;  3TAB A;  5JMV A;  2P9K B;  5C25 A;  1IKX A;  1TUY A;  4DFK A;  4WF9 L;  2HF3 A;  3I33 A;  2E5L K;  1HUX A;  1RTJ A;  4CCH A;  5LMN K;  4AHC A;  3VQ7 A;  5AQO A;  4Z4H A;  4KH5 A;  4C1N I;  4FLZ A;  3SUN A;  3M8S A;  3DRR A;  3HJF A;  4NLC A;  2FBY A;  4JI7 K;  4LSL A;  2DTU A;  3M1F A;  4LY7 A;  1KFS A;  4LF9 K;  3O1B A;  3CC2 N;  3BF3 A;  5BPN A;  1ZBF A;  4JD2 A;  3NDK A;  4CBU A;  2O8D A;  1HNI A;  4DSL A;  4GVE A;  3SZ2 A;  4BR7 A;  3O80 A;  4DS4 A;  3WT0 A;  3AVB A;  1D4X A;  4GV6 A;  3AA2 A;  4CJP A;  2ZM6 K;  2KLA A;  3RMD A;  4FJ5 A;  4B1Z A;  1MWM A;  3C6A A;  3OYB A;  4GVM A;  2PFU A;  3H3N O;  4DSE A;  4CZM A;  4H8K A;  4IJN A;  3VQP A;  3P31 A;  4BC5 A;  5E26 A;  4M3X A;  1WAF A;  4HCC A;  3RSE A;  1YVU A;  4ILH A;  4B1Y B;  2F7T A;  5GIO A;  3DLB A;  3MEC A;  5LY3 A;  2QEX N;  3MDQ A;  4WFA L;  4DR5 K;  1BUP A;  2E2N A;  5H1S Q;  1NGE A;  5HL7 L;  4OGE A;  1VHX A;  3PIP L;  2G8I A;  1L3S A;  3E66 A;  1UOC A;  3VQA A;  1GOB A;  3IRX A;  3DLG A;  4JD2 B;  4DQ8 A;  2O8D B;  1NK4 A;  1RT4 A;  4KHW A;  3O8M A;  1UAX A;  3OHR A;  1DEJ A;  4CES A;  3QET A;  1IBL K;  4IOA L;  5C0Y A;  2NLX A;  1BG3 A;  1HYZ A;  4JI2 K;  3VET A;  1KC8 O;  4CEZ A;  4CJQ A;  3DRP A;  1TKZ A;  4B9V A;  2QWL A;  5HLF A;  3O08 A;  4F2S A;  3P1G A;  4CD3 A;  5BRF A;  1TAU A;  2X74 A;  2IAJ A;  1BI4 A;  4X65 K;  4QOZ B;  2ZE2 A;  4PWD A;  3T1Y K;  2OCE A;  2QWQ A;  3VEV A;  2E2O A;  2VQF K;  3PLA A;  1D9D A;  4B8A B;  2KW4 A;  4H0O A;  3S3N A;  4AIL C;  1NJZ A;  3B6P A;  4CIE A;  3H46 O;  1HJO A;  3F9K A;  5AQS A;  3HZ6 A;  4ELU A;  4C1N K;  1W9H A;  4CJT A;  2O8F B;  4BE1 A;  4YDU C;  4JK8 A;  2NRV A;  3V81 A;  5AR0 A;  2YJF A;  2G8F A;  3TAG A;  3OYH A;  3KIO A;  1TGO A;  5J2Q A;  1C1C A;  3DLK A;  3E9P A;  2E2P A;  1YAG A;  1ZBL A;  3ENB A;  3H1V X;  4BE2 A;  2UYT A;  1RDD A;  4DV2 K;  2BAN A;  2W6L A;  4EZ9 A;  4E89 A;  1YVN A;  3NVK A;  4YY3 K;  5CY4 A;  4DUY K;  2E6M A;  3TSU A;  4KTZ A;  4KHQ A;  4IOX A;  3SYZ A;  3SNN A;  1Y64 A;  4XH5 A;  4LSN A;  3SV3 A;  4AQY K;  2ZQB A;  1GLE G;  2YKM A;  2BGG A;  4CJS A;  2JWL A;  4AM6 A;  2FXU A;  1XUP O;  3LDO A;  4NYF A;  5DM6 L;  3AGR A;  5DMR A;  4BRC A;  1GLB G;  1JJ2 M;  4OX9 K;  4A57 A;  4K8Z A;  5AZJ B;  1B9D A;  3SQ0 A;  3CPW M;  3FFI A;  3QEX A;  2XO7 A;  3K59 A;  4H0V B;  4CFC A;  4GNI A;  4I9L A;  4DHY A;  4IWV A;  1SUQ A;  5SWM A;  4DSF A;  5HBM A;  2P5G A;  1MU2 A;  2UXD K;  3SJJ A;  3ZT2 A;  3VQD A;  3S41 A;  2A5X A;  3O9U A;  3CQ8 A;  4OPK A;  4GMJ B;  4BR2 A;  3MXI A;  4X64 K;  1KAX A;  1NKC A;  2UUC K;  2HBL A;  3VES A;  3ASM A;  3HPO A;  4C23 A;  4RW6 A;  4BQZ A;  2ZF5 O;  1IKV A;  3UKR A;  1RGI A;  2HBK A;  1RBV A;  1VSM A;  3KK7 A;  4BWJ A;  4BC3 A;  3OS0 A;  3CER A;  2ETJ A;  3R8E A;  5MLC Q;  5KRS A;  4YHH K;  3HRG A;  1NJI O;  4NXM K;  1IO2 A;  3RRH A;  3QIC A;  1HKG A;  3V9Z A;  1S1X A;  1Q82 O;  4FO0 A;  3DMJ A;  4KAZ A;  1WBB A;  4CD1 A;  3OYI A;  3TAE A;  1XMQ K;  2D0C A;  1NMN A;  4O44 A;  4QS8 A;  3ZX2 A;  5AQU A;  2VCP A;  4Z4C A;  4B3O A;  1T03 A;  2A6A A;  3ZSY A;  1TYQ B;  4DFP A;  3EN9 A;  3HVT A;  3V1R A;  4BRH A;  5FPM A;  2B6A A;  1K8A O;  2J4R A;  1M90 O;  5AQW A;  3AVI A;  3O3H A;  1OH8 A;  4EP4 A;  2YX6 A;  3AAQ A;  3LWM A;  3WNG A;  4WYB A;  4O8U A;  1HNX K;  2WUS A;  4XIU A;  4RTF D;  4JI3 K;  1VQN N;  4CJU A;  2HHV A;  3ZX0 A;  2OA8 A;  1KLN A;  4DV0 K;  4E7L A;  1FK9 A;  3GOI A;  4JKE A;  1TKX A;  1U6Z A;  2YHY A;  5A2Q O;  1WSI A;  3MX5 A;  1EWQ A;  3LPT A;  4DTN A;  4KB0 A;  3NE6 A;  1BL3 A;  1J5O A;  4B8C A;  1F21 A;  3WXJ A;  2VG6 A;  3WUH A;  3L2W A;  4CF0 A;  2JGU A;  1S22 A;  3OYL A;  2JWK A;  5CYQ A;  3DLE A;  1JLQ A;  3PV8 A;  1CLQ A;  1W97 L;  3L2Q A;  4DTX A;  3A2F A;  2IVN A;  4CZE A;  2QWP A;  2EWS A;  1VAZ A;  4B3R K;  4DF4 A;  4KI4 A;  4M3W A;  4PQU A;  4QAG A;  2RN2 A;  3D2E B;  2R7Y A;  1LOT B;  4DF8 A;  1FXX A;  3DLH A;  3C6T A;  4YOU A;  5J2P A;  4E7H A;  3L8B A;  4CFA A;  2CGJ A;  5KQD A;  3OYE A;  4M3Y A;  1RFQ A;  3AAR A;  4FJ8 A;  2P9P B;  4HUG A;  2G8W A;  3ZSZ A;  3CC7 N;  2IS3 A;  1ASU A;  4YOR A;  1BCO A;  1M1K O;  1QS4 A;  4E7K A;  4DSI A;  4Z4E A;  3D7E O;  2XRI A;  2OTJ N;  2NRZ A;  4EHT A;  2WON A;  1NKE A;  4M3Z A;  1VQ8 N;  4BDZ A;  3AVC A;  1VSF A;  2ZGY A;  1X3M A;  4B1W B;  3WQT A;  4CJV A;  5LL6 Z;  1XNQ K;  3BY5 A;  4L3Q A;  4H0P A;  1VSL A;  1WLJ A;  3ZET B;  5TKW A;  2DPN A;  1QQC A;  2HB5 A;  1DLO A;  3AV9 A;  3I8B A;  3JSM A;  3M3Z A;  1S1T A;  3M6G A;  4Z94 A;  1SL0 A;  3ITH A;  3IAY A;  4GKK K;  1QHT A;  3IS9 A;  1MDU B;  3CCV N;  3I8D A;  3QO9 A;  2O8C B;  4E1M A;  1W2B M;  4GV3 A;  1NGJ A;  3BF1 A;  4ID1 A;  4BRD A;  1XQS C;  3LAK A;  2Q3S A;  1Q9X A;  3CMA N;  1SKS A;  4OPJ A;  4BRA A;  4C8L A;  4A5A A;  1RT7 A;  2GEL A;  4AH9 A;  1N36 K;  1FKO A;  2P9I A;  3KKR A;  4QS9 A;  4ZHR A;  3VEY A;  2WTU A;  3PX6 A;  2W6K A;  1V4S A;  3VMF B;  3V9W A;  4FJ7 A;  4I9Q A;  3KZB A;  1X1P A;  3OYJ A;  2HVI A;  2WFB A;  3CCR N;  2P51 A;  2QWN A;  2YKN A;  3HO1 A;  4DKW A;  3VPZ A;  4EIA A;  4H0T B;  4IG3 A;  1D5A A;  1QZ6 A;  3RRG A;  4DG1 A;  4K25 A;  5FPE A;  5F2R A;  4FZX C;  3G4S N;  1A5V A;  1TAQ A;  4BR4 A;  3HXM A;  1KCF A;  4KKO A;  3PUF A;  4JI4 K;  1JL1 A;  3KLI A;  1I39 A;  3ULE B;  3BEX A;  3THX A;  4H0Y B;  3ISN C;  1D9F A;  3RTV A;  4BRN A;  1L3V A;  2B5J A;  4DB3 A;  4IEI A;  2DFF A;  3CFP A;  1XC3 A;  1HPM A;  2HOE A;  4FZY A;  4KH4 A;  2NNW A;  4N5S A;  2QXF A;  2P1J A;  4JKF A;  1WBD A;  4R79 A;  1XC9 A;  5D3G A;  3HTV A;  4I6M A;  3ULD A;  5AQN A;  1Q86 O;  3J81 O;  3O5B A;  4LF4 K;  4K0K K;  4FWL A;  3VEW A;  3MN9 A;  3VTI A;  3WXK A;  4B08 A;  2CGK A;  4G9Z A;  2D0B A;  4BDY A;  1TK0 A;  4EHU A;  4DR2 K;  3DXK A;  3ZT1 A;  2W42 A;  1KVC A;  2G8U A;  3L4Q A;  5KGW A;  1HPZ A;  3KJV A;  4JAX A;  3TU5 A;  3HVR A;  3T1H K;  3IKM A;  3LDS A;  4WQ5 A;  1EWR A;  2HMI A;  1RDW X;  2W41 A;  4CZJ A;  4B3S K;  2OPP A;  1HYS A;  2O8B B;  4BVP A;  3FE1 A;  4DFJ A;  1L3U A;  2XY8 A;  4NLB A;  4B1U B;  4CHP A;  5AJ3 K;  1NKB A;  3L3V A;  1RBT A;  2YNF A;  1VSK A;  3OYG A;  3E1Y A;  3JYT A;  2F8T A;  3FZH A;  4CJW A;  4YDU A;  5LJV A;  3C94 A;  3A5M C;  5AZI A;  1RT6 A;  1GLF O;  4DTR A;  4KHU A;  4H5N A;  3OYN A;  4X62 K;  2RF2 A;  4DTM A;  4Z4F A;  1SQK A;  4JRQ A;  2YHB A;  2YJE A;  2QKK A;  4B1X B;  2YHX A;  4FLU A;  3ZSW A;  1OKJ A;  2LSN A;  1WB9 A;  3C95 A;  2ASM A;  3NBP A;  4CGD A;  1NG9 A;  2BUP A;  1J6Z A;  4DQR A;  3S3O A;  4CGG A;  3CFO A;  4JKG B;  4C8N A;  5C12 A;  4OKK A;  1U45 A;  1RIL A;  2Z1I A;  4JKC A;  2NRR A;  4AHS A;  2GWK A;  3G0Z A;  4ISE A;  3NVM A;  4ISG A;  3ULE A;  4AHT A;  4CF1 A;  1VQP N;  3I0S A;  1SL2 A;  3MK6 A;  1JL2 A;  3VTH A;  1BOT O;  4FJH A;  4IBN A;  1FW6 A;  3EEQ A;  3VGK A;  4RW7 A;  4BGA A;  4F3T A;  4CJE A;  2P9P A;  1WUA A;  2OTL N;  3CHW A;  3FFK B;  4DR1 K;  2UXB K;  5C42 A;  4JEP A;  1QE1 A;  1ATN A;  2ZD1 A;  4OLA A;  2Q31 A;  3MCP A;  4N76 A;  3TSP A;  3NMU A;  3VN5 A;  5JVG L;  3LDN A;  4Y1C A;  2HHX A;  4CF2 A;  1FJG K;  3SQ1 A;  3S3M A;  2QA4 N;  1NGB A;  4FZZ A;  3ENH A;  3MN7 A;  3AO1 A;  3CJC A;  3TAP A;  1NJX A;  2P9N A;  4CIF A;  2O8E A;  3TWH A;  5BRD A;  2G8K A;  2QXL A;  3HST B;  3HK2 A;  2I7P A;  3WEE A;  1IV0 A;  5K14 A;  3AA5 X;  4FM2 A;  5KRT A;  1K8K B;  4M3T A;  4B9U A;  4BRL A;  1W7A A;  2HVH A;  1Q7Y O;  4WCE L;  3AVM A;  3AO4 A;  3KVG A;  3DJC A;  3VER A;  4KH6 A;  4A2B A;  5KPR A;  3P39 A;  2QWO A;  3W3D A;  4ZTF A;  1UA0 A;  4E1N A;  3M8R A;  3EE8 A;  4LF6 K;  1BO5 O;  3SJH A;  3EZW A;  4CK2 A;  1S1W A;  3HM8 A;  1WN7 A;  3H45 C;  1JLE A;  3AVJ A;  1S6Q A;  3C7N A;  3AVF A;  1DKG D;  4IFY A;  3O3F A;  3R9P A;  4BRG A;  1N34 K;  1SZ2 A;  4LF5 K;  3SBG A;  5CHI A;  5AQK A;  2ATQ A;  1NK9 A;  4C8O A;  2ZWH A;  3CC4 N;  4LH5 A;  4BAC A;  5AQH A;  4C8M A;  1GLJ O;  4FWP A;  3ZT4 A;  4H4M A;  2DFH A;  1QVG M;  3O9T A;  3DXM A;  5IWA K;  1BHL A;  1EP4 A;  2G8V A;  5FPD A;  4PL8 A;  4FWO A;  3FZF A;  2GBZ A;  3A5O C;  2JLE A;  1VQ7 N;  3ATU A;  1DTQ A;  3HP6 A;  4IFE A;  2YCH A;  1C1B A;  1ILY A;  4E7J A;  4CHY A;  5AQL A;  5AQX A;  5B8H A;  3CCL N;  4B3T K;  4KO0 A;  1S1V A;  4DQS A;  1HQU A;  3ID6 A;  3ZLJ A;  1N8R O;  1BGX T;  4LFC K;  3V9S A;  4DLE A;  4W5T A;  3MED A;  4DR6 K;  4N41 A;  1BI4 B;  5EVZ A;  1P8Z A;  3KLH A;  4Y1D A;  1YIJ N;  4FCY A;  3OS2 A;  3D6R A;  3TTD A;  4JS4 A;  3S9H A;  1SV5 A;  3A5N C;  1ZXO A;  4DTP A;  4BRM A;  4Y0W A;  3TAN A;  3P5J A;  4NXN K;  4JKG A;  4KPY A;  4FOE A;  2E1Y A;  3ZX3 A;  3MN6 A;  4FPB A;  5CR4 A;  5BN9 A;  3DOL A;  4B9N A;  2FLO A;  3DLL L;  3MWP A;  3QFU A;  4CJ4 A;  1BU6 O;  4ILG B;  4OLB A;  4RWT A;  4F3O A;  4FYD A;  4FJK A;  4CBX A;  5FRO A;  1HR0 K;  3LAL A;  2P9L B;  4BRF A;  3CJ1 A;  4LD0 A;  2A1S A;  2E8A A;  3QBX A;  4CZG A;  3AVK A;  4W5N A;  4YOV A;  4J2A A;  1EX4 A;  4Q0B A;  1MWK A;  3P83 D;  4M63 C;  2ASP A;  3L3U A;  4LC9 B;  3CJA A;  3LDP A;  3SI6 A;  4IDK A;  1TUU A;  1RDU A;  3Q7B A;  5BR8 K;  3MAQ A;  1L5U A;  1RTD A;  1ATS A;  3HL8 A;  3T69 A;  2F9W A;  1TL3 A;  2F8S A;  1YF5 L;  2A41 A;  2KZM A;  5BRE A;  4WQ5 C;  3QIP A;  3MMV A;  4M42 A;  5JVH L;  5GAG P;  1BIU A;  4CVN E;  1NK5 A;  4CZL A;  3VGM A;  3MEE A;  1U48 A;  1HYV A;  4JKH A;  3B6O A;  4FWN A;  4B3M K;  4ELT A;  2HF4 A;  3NH2 A;  4E19 A;  1SS6 A;  1IBK K;  4FJL A;  2BE2 A;  1RDA A;  3U9D A;  3HT3 A;  4CF8 A;  3J8A A;  3T7Z A;  3MX2 A;  1JLB A;  5AQV A;  2GX9 A;  3D2F A;  3H6E A;  1L3T A;  2A1R A;  3CIP A;  1RT2 A;  3TAQ A;  5J2N A;  5C24 A;  1VSI A;  3KTQ A;  2OPR A;  1KXP A;  3CCS N;  4FJM A;  3NAE A;  2O4G A;  1IBM K;  1NNE A;  4BDP A;  3IDH A;  3SQ4 A;  5AQR A;  1TK8 A;  3JS6 A;  2BTF A;  3AVH A;  1ESV A;  1YTA A;  4KV8 A;  3NF9 A;  2X78 A;  4A61 A;  1VRT A;  2VWK A;  2GUP A;  4M45 A;  1S72 N;  3QES A;  1X9W A;  1B92 A;  4K8X A;  3WNH A;  4OJR A;  3QNN A;  4F9O A;  5C2F A;  4CEQ A;  3L6Q A;  3THW B;  1EO1 A;  1BIS A;  4BVO A;  4H03 B;  3DOK A;  1RCH A;  4M3R A;  4AHU A;  1NLV A;  1OH5 A;  3CCE N;  1N33 K;  5JS1 A;  4CGH A;  3RR8 A;  4BRP A;  4LF8 K;  5JLH A;  3L2U A;  5AQF A;  3LAM A;  3OA9 A;  4CK3 A;  4OVL A;  4CHQ A;  4Z4G A;  3VF6 A;  1JCG A;  1RT3 A;  1KVA A;  1HRH A;  3PO4 A;  1JKH A;  4GY2 B;  5GAE P;  3EKS A;  3O9S A;  3ZT3 A;  1EQY A;  1QZ5 A;  3GL1 A;  4JHD A;  3OY9 A;  3L2V A;  4CEE A;  2YNG A;  2DFE A;  4FVM A;  1CZA N;  3G6E N;  1G15 A;  1YI2 N;  5M1Q A;  2KKZ A;  1HLU A;  4DV4 K;  3FR0 A;  3RVC A;  1XHZ A;  4JKD A;  1BIZ A;  4EZ6 A;  5J2M A;  3KWG A;  5HRS A;  2V7Y A;  2HBM A;  4BG9 A;  4NCG A;  3OYA A;  3QIO A;  1BA0 A;  4JI5 K;  2IC3 A;  2YI1 A;  4FLY A;  4CJR A;  2XY7 A;  4A62 A;  2E2Q A;  4WFN L;  4FPA A;  1VQO N;  2Z1G A;  1I3A A;  1U49 A;  1LCU A;  4IZ9 A;  1J5E K;  3C65 A;  4DV6 K;  4O0I A;  4DWI A;  3ZT0 A;  4CZI A;  1S1U A;  3QEP A;  3VQC A;  1NBW A;  2PAV A;  3CM6 A;  3TAR A;  2HND A;  2V7Z A;  3HOS A;  3WEE B;  4CJ3 A;  3R1X A;  2FSN A;  3QEI A;  3NGY A;  3O9Q A;  1YHQ N;  1O1W A;  3DM2 A;  2Q0R A;  4JV5 K;  2KTQ A;  4FJJ A;  5JS2 A;  2QK9 A;  3D2F B;  3NF6 A;  1BCM A;  3DXM B;  4PKI A;  3OYF A;  1CXU A;  3DWL A;  3QFP A;  1QSL A;  5M1O A;  1KLM A;  1N32 K;  5GAH P;  4XEI A;  2YHW A;  3L4I A;  1RBR A;  1RTI A;  1ZBU A;  3ALY A;  2OZS A;  2X6S A;  4KHP K;  1XMO K;  1NK0 A;  1NK8 A;  2A3Z A;  4DUZ K;  4ID5 A;  4LFA K;  5HRP A;  2AA4 A;  2NRW A;  3U3Y A;  1CZB A;  3NGZ A;  1RBU A;  4JS5 A;  3KLG A;  3ZSR A;  4JNE A;  3EYZ A;  4BRI A;  5HRR A;  3THY B;  1WSE A;  3LL3 A;  3OBW A;  2FSK A;  3OYM A;  4DV1 K;  4BR9 A;  3QER A;  5GAD P;  4DS5 A;  4KRF A;  5KQ8 A;  1VQ9 N;  2HHT A;  4FM1 A;  4CZK A;  4FSV A;  4CE9 A;  3O9R A;  3DYA A;  1U47 A;  4AF1 A;  1IJJ A;  4I2P A;  4ILJ A;  2AP1 A;  3FZK A;  3U6F A;  1KRP A;  1FKP A;  4DU4 A;  2V51 B;  1J53 A;  3CD6 N;  1NGF A;  3SPY A;  4CI6 A;  1T8E A;  1A5X A;  3ZEU A;  4E1J A;  2Q1N A;  3TAF A;  2KZZ A;  3D2E A;  3D45 A;  4OKJ A;  3THX B;  1VQL N;  4ELV A;  4TSX A;  3H1Q A;  4MQ3 A;  4CEA A;  5AFU H;  1GLD G;  1TVR A;  4HTL A;  3ZSV A;  2QWM A;  1JLC A;  4EP5 A;  2F4V K;  5E41 A;  3J7Y P;  4FK0 A;  5JIC A;  3RR7 A;  4NB4 A;  3DI6 A;  4JN4 A;  1HKB A;  3OJS A;  3CME N;  4FWS A;  3CCQ N;  4IDH A;  3PIO L;  4DV3 K;  1BWF O;  3DRS A;  3TTF A;  3CCJ N;  4J2B A;  5CZ1 A;  2DY4 A;  3SUP A;  3EKU A;  4CEF A;  2V52 B;  3KWI A;  1RBS A;  1LW0 A;  4JK9 A;  3EY1 A;  1YUW A;  2GV9 A;  1KSP A;  1ZC6 A;  3SPZ A;  4N47 A;  3AAP A;  3MWT A;  4E3S A;  5AQI A;  3CM5 A;  3OBY A;  2IIR A;  3J7Z O;  4J8F A;  4NCB A;  2CH5 A;  1U04 A;  2FBV A;  4HHT A;  2O8B A;  4RW9 A;  5FDL A;  2OPQ A;  4UY8 O;  3SV4 A;  2EHG A;  1ZBH A;  1WOQ A;  3PSI A;  1NJW A;  2HHQ A;  1LV5 A;  5T7B A;  4BWM A;  3FZL A;  4CZH A;  3MN5 A;  4ZTJ A;  3WNF A;  1X3N A;  4FM0 A;  3A5L C;  1LAV A;  1NK7 A;  5AQG A;  2KFZ A;  4KI6 A;  1SKW A;  2P9I B;  1S3X A;  2CH6 A;  3J7A P;  1UA1 A;  2VGM A;  3FGU A;  3VA0 A;  3SMP A;  5BPL A;  3EE9 A;  3QEW A;  3TSQ A;  2D5R A;  2RPI A;  4IJA A;  3KD5 E;  4DSJ A;  4E0D A;  3THW A;  3N4P A;  3LZJ A;  1JLG A;  1YTU A;  1XWL A;  2B4J A;  3NGI A;  1IG8 A;  3LP3 A;  3HYF A;  5HRO A;  1VQM N;  4B9M A;  4KHY A;  1LW2 A;  4BR5 A;  3O3G A;  4DR4 K;  3OS1 A;  2GUI A;  3QDK A;  3AA4 A;  3QBW A;  2HHW A;  3BP8 A;  3MEG A;  5I42 A;  1BDG A;  1P90 A;  1YXQ A;  4A59 A;  1NGI A;  4BR0 A;  3F5T A;  1CZ9 A;  2D0O A;  3AO2 A;  2QM1 A;  4C8K A;  2OAN A;  2HBJ A;  3E9O A;  4JK7 A;  2NZT A;  2QTD A;  2YV0 X;  3THY A;  3K58 A;  1TKD A;  3CJ7 A;  4H5T A;  5HP1 A;  1Z25 A;  3L2R A;  3UB5 A;  3VEX A;  2VQE K;  1A5W A;  4WQ4 C;  4K41 A;  1HX1 A;  4J2E A;  1RNH A;  3O1W A;  3NFA A;  1KD1 O;  4YOY A;  4RG8 A;  3M5R A;  1VQ4 N;  3QLH A;  5EXW A;  4IFV A;  2RHK A;  4DQP A;  3VA3 A;  4CBW A;  3PX4 A;  1SL1 A;  2H3G X;  3AO5 A;  4FJG A;  1Q81 O;  3K9K A;  2PY5 A;  5F1X A;  3LDL A;  3UKU A;  1RDC A;  5AZJ A;  1B9F A;  4DU3 A;  3VQB A;  4HUF A;  3G10 A;  1QQN A;  2PBD A;  4DV5 K;  5KI6 A;  3ENO A;  4K43 A;  3ZET A;  3CCM N;  4AM7 A;  4W5R A;  4GKJ K;  3SQ2 A;  2P9S A;  3K0S A;  1T6D A;  5ELZ A;  4O0J A;  2VYP A;  5JLF A;  3L0Q A;  4CHZ A;  4N56 A;  1NK6 A;  4NO7 A;  3M8Q A;  3SAG A;  3T1A A;  3C6H A;  4CHO A;  2IOC A;  1QTM A;  2ITG A;  1HKC A;  3TR8 A;  3ZSX A;  1V4T A;  3SMS A;  1HNW K;  4B9T A;  1WSF A;  2UUA K;  3MXJ A;  5BN8 A;  4FWQ A;  1JXE A;  4H5R A;  3GDQ A;  4B9L A;  4BE0 A;  2E20 A;  5CZ2 A;  4FLT A;  1YJ9 N;  4KFB A;  4MLH A;  4IKF A;  4O4G A;  3K2P A;  2P9K A;  3VQQ A;  2IDO A;  4H4O A;  4UQG A;  5HRN A;  4CEC A;  4LF7 K;  4HTU A;  4CGJ A;  5AZI B;  3JAM O;  4JI6 K;  5M1N A;  3C6U A;  4EAH D;  1BQM A;  3VEZ A;  4CIG A;  1DTT A;  3V4I A;  4Z4I A;  3HBT A;  4DTO A;  1EKE A;  3TPQ A;  3CF5 L;  2P9U A;  1GLA G;  1X9J A;  4EFH A;  3SUQ A;  1OVQ A;  5IT9 O;  3NF7 A;  3AY9 A;  3CQY A;  3THV A;  3TTC A;  4GW6 A;  1T05 A;  1WSH A;  3AVN A;  5GIN A;  5M1F A;  5EU7 A;  2NRX A;  3U8X A;  1C6V A;  2WC9 A;  2XY6 A;  4M41 A;  4IO9 L;  3CET A;  3KLE A;  1BA1 A;  5C15 A;  2GEM A;  3PY8 A;  3U9Z A;  2OZM A;  3KD1 E;  4GV9 A;  1JCE A;  2OYQ A;  2HHH K;  1ITG A;  3V1Q A;  2FSJ A;  4YFU A;  4ICL A;  2FC0 A;  1HJR A;  4JKB A;  1CXQ A;  2A40 A;  3OJU A;  3CFR A;  4WQ4 A;  2VG7 A;  3CPE A;  1VSD A;  4WE1 A;  4FOI A;  2IVO A;  4OPH A;  5HOO A;  3NF8 A;  1DT9 A;  1JLA A;  4H5V A;  4I6M B;  4PL7 A;  2XY5 A;  1W0H A;  5I3U A;  1K9M O;  4DLG A;  4JRP A; 
#chains in the Genus database with same CATH homology
 3PO4 A;  1ASV A;  1VSH A;  1JKH A;  4FZX C;  3OYC A;  3TAB A;  4G1Q A;  4DSK A;  1A5V A;  1HQE A;  1TAQ A;  3ZT3 A;  5C25 A;  1IKX A;  3SCX A;  3HXM A;  4F4K A;  1D8Y A;  1KCF A;  4KKO A;  4JLH A;  3WNE A;  3OY9 A;  3PUF A;  3L2V A;  4DFK A;  4CEE A;  2YNG A;  2DFE A;  1JL1 A;  4FVM A;  4FJN A;  3KLI A;  1I39 A;  1RTJ A;  4CCH A;  3K57 A;  3ISN C;  1G15 A;  4W5Q A;  4AHC A;  3VQ7 A;  3RTV A;  1D9F A;  4KHS A;  4CFB A;  2E6L A;  1X9M A;  1L3V A;  2B5J A;  3F73 A;  4QCL A;  1C1A A;  4Z4H A;  1XHZ A;  1BIZ A;  4EZ6 A;  2DFF A;  5J2M A;  3CFP A;  5HRS A;  3SUN A;  4FLZ A;  4FJ9 A;  3M8S A;  3DRR A;  3HJF A;  4FZY A;  2FBY A;  4NCG A;  3OYA A;  3QIO A;  4LSL A;  2DTU A;  4LY7 A;  2QXF A;  4N5S A;  1KFS A;  4CJ5 A;  2P1J A;  4RW4 A;  2IC3 A;  4FLY A;  2YHA A;  4CJR A;  2XY7 A;  1XC9 A;  5D3G A;  1ZBF A;  3NDK A;  4DFM A;  2HHS A;  2Z1G A;  1HNI A;  4DSL A;  3ULD A;  1I3A A;  2Y1I A;  4KRE A;  1U49 A;  1YT3 A;  3SZ2 A;  4M3U A;  4L8R B;  1TV6 A;  4DS4 A;  3AVB A;  4O0I A;  4DWI A;  3AA2 A;  3ZT0 A;  4PA1 A;  4B08 A;  4CJP A;  1S1U A;  2D0B A;  4BDY A;  3RMD A;  1S9E A;  3QEP A;  1TK0 A;  4FJ5 A;  3VQC A;  4DMN A;  1Q9Y A;  3OYB A;  4GVM A;  3ZT1 A;  4DTU A;  3NH0 A;  1EXQ A;  2W42 A;  1KVC A;  2G8U A;  4DSE A;  3CM6 A;  1VRU A;  5KGW A;  2HND A;  1HPZ A;  4H8K A;  3TAR A;  3KJV A;  3ZSO A;  3HVR A;  4CJ3 A;  3VQP A;  3K5M A;  3QEI A;  3LDS A;  3NGY A;  1C0M A;  4CF9 A;  4M3X A;  1WAF A;  1O1W A;  3DM2 A;  4CER A;  3KK3 A;  3NHG A;  1YVU A;  4MFB A;  2HMI A;  4HCC A;  2KTQ A;  4FJJ A;  3DLB A;  1S5J A;  4K8X A;  5JS2 A;  3MEC A;  3NCI A;  5KTQ A;  4PUO A;  2QK9 A;  3HM9 A;  2OPP A;  3NF6 A;  1BCM A;  1HYS A;  1UWB A;  1CXU A;  3OYF A;  1QSL A;  4O55 A;  4OGE A;  4DFJ A;  2Z1J A;  1L3U A;  1KLM A;  2HHU A;  2G8I A;  1L3S A;  2XY8 A;  1UOC A;  4CHP A;  1XI1 A;  3VQA A;  1NKB A;  1GOB A;  1RBR A;  1RTI A;  3DLG A;  3IRX A;  3L3V A;  1RBT A;  2YNF A;  1VSK A;  1ZBU A;  3OYG A;  3ALY A;  3JYT A;  1NK4 A;  2OZS A;  2X6S A;  2F8T A;  4CJW A;  2F96 A;  1RT4 A;  4KHW A;  3C94 A;  1KTQ A;  1NK0 A;  1NK8 A;  1UAX A;  4CES A;  3QET A;  3PX0 A;  4ID5 A;  1RT6 A;  5HRP A;  1TK5 A;  1HYZ A;  3OVN A;  3U3Y A;  1CZB A;  4DTR A;  4CEZ A;  1GOA A;  4KHU A;  4CJQ A;  3NGZ A;  3DRP A;  4KTQ A;  1TKZ A;  1RBU A;  4YNQ A;  4B9V A;  3QNO A;  4JS5 A;  5HLF A;  4CJF A;  3OYN A;  3KLG A;  3ZSR A;  3EYZ A;  2RF2 A;  1IG9 A;  4F2S A;  3P1G A;  4DTM A;  1TAU A;  4Z4F A;  3T3F A;  4JRQ A;  1NJY A;  2YHB A;  2X74 A;  5HRR A;  1WSE A;  2IAJ A;  1BI4 A;  3OYM A;  2ZE2 A;  4QOZ B;  2QKK A;  4PWD A;  3QER A;  4F8R A;  3PO5 A;  4FLU A;  4DS5 A;  1RDB A;  3ZSW A;  4KRF A;  2HHT A;  5CYM A;  4FW1 A;  4FM1 A;  2LSN A;  3VQ4 A;  4KB1 A;  3C95 A;  4CE9 A;  1D9D A;  3NBP A;  3DYA A;  2KW4 A;  4I7F A;  4B8A B;  3S3N A;  4AIL C;  4CGD A;  1U47 A;  2Z1H A;  1NJZ A;  4DTS A;  3B6P A;  4DQR A;  4CIE A;  3S3O A;  4I2P A;  4CGG A;  3CFO A;  4C8N A;  2Y1J A;  3U6F A;  4OKK A;  1KRP A;  3F9K A;  1U45 A;  3KK2 A;  1FKP A;  1RIL A;  4DU4 A;  2Z1I A;  4ELU A;  1W9H A;  4CJT A;  4CED A;  3IG1 A;  4BE1 A;  1J53 A;  1LWF A;  3D0P A;  3SPY A;  4LH4 A;  1T8E A;  1VSJ A;  1A5X A;  4AHS A;  3V81 A;  2G8F A;  3TAF A;  2KZZ A;  3TAG A;  3G0Z A;  3D45 A;  3OYH A;  3KIO A;  1TGO A;  5J2Q A;  4FW2 A;  1C1C A;  3DLK A;  4OKJ A;  4AHT A;  3TI0 A;  4ELV A;  1ZBL A;  4TSX A;  4CF1 A;  4FXD A;  3I0S A;  1SL2 A;  1JL2 A;  4IG0 A;  4BE2 A;  4MQ3 A;  1RDD A;  4CEA A;  2BAN A;  4FJH A;  4IBN A;  3CYM A;  1VK0 A;  4EZ9 A;  1TVR A;  4RW7 A;  4E89 A;  4F3T A;  2P5O A;  5CY4 A;  3OYK A;  3ZSV A;  1R0A A;  1JLC A;  2E6M A;  3CG7 A;  4KTZ A;  4KHQ A;  4CJE A;  3E01 A;  1T7P A;  1RT5 A;  3SYZ A;  4EP5 A;  4DU1 A;  5E41 A;  3LWL A;  3SNN A;  4DQI A;  3I0R A;  5C42 A;  4LSN A;  3RMA A;  3SV3 A;  1QE1 A;  3RR7 A;  4HCB A;  4FK0 A;  4OLA A;  2ZQB A;  1WSG A;  2ZD1 A;  2PZS A;  4Q5V A;  3KKS A;  4B9S A;  4N76 A;  1KVB A;  2YKM A;  2BGG A;  4CJS A;  4DTJ A;  3DI6 A;  3QIN A;  3VN5 A;  3OJS A;  4Y1C A;  1IKW A;  2HHX A;  4CK1 A;  4CF2 A;  4I2Q A;  4NYF A;  3SQ1 A;  3S3M A;  5DMR A;  4FJX A;  4K8Z A;  3DRS A;  4FZZ A;  1B9D A;  3AVG A;  3SQ0 A;  3AO1 A;  4DQQ A;  3FFI A;  4W5O A;  5CZ1 A;  2XO7 A;  3QEX A;  3SUP A;  3KK1 A;  3K59 A;  4CFC A;  3TAP A;  1NJX A;  4CEF A;  4CIF A;  4I9L A;  3TWH A;  2G8K A;  3HST B;  1RBS A;  3HP9 A;  2QKB A;  1LW0 A;  1SUQ A;  5SWM A;  3HK2 A;  3EY1 A;  5K14 A;  2GV9 A;  3AA5 X;  5HBM A;  4FM2 A;  5KRT A;  4DSF A;  1KSP A;  1MU2 A;  1ASW A;  1REV A;  3SPZ A;  4M3T A;  4B9U A;  4N47 A;  3SJJ A;  4E3S A;  3AVA A;  3ZT2 A;  2HVH A;  3CM5 A;  3VQD A;  3AVM A;  3AVL A;  3AO4 A;  3OYD A;  4NCB A;  5FRM A;  3ZSQ A;  4PY5 A;  1GOC A;  3CQ8 A;  1U04 A;  2OPS A;  4OPK A;  3U3G A;  2FBV A;  4GMJ B;  4HHT A;  3MXI A;  3AA3 A;  4RW9 A;  5FDL A;  4ZTF A;  1UA0 A;  4E1N A;  2OPQ A;  1NKC A;  3M8R A;  3LPU A;  3ASM A;  4JRP A;  2KQ2 A;  3VQ6 A;  3SV4 A;  3HPO A;  2EHG A;  1ZBH A;  2YNH A;  2FBT A;  1NJW A;  2HHQ A;  4RW6 A;  4CK2 A;  4Z0U A;  1IKV A;  2EX3 A;  1LV5 A;  5T7B A;  1S1W A;  4BWM A;  1WN7 A;  1RBV A;  1VSM A;  4BWJ A;  3WNF A;  1JLE A;  3VQE A;  3NH1 A;  4FM0 A;  4ZTJ A;  3LP1 A;  3AVJ A;  3OS0 A;  1WSJ A;  1LAV A;  1NK7 A;  1S6Q A;  2ETJ A;  2KFZ A;  2HNY A;  1VSE A;  1RTH A;  3AVF A;  3UIQ A;  4KI6 A;  4IFY A;  4E7I A;  1SKW A;  3TAM A;  5KRS A;  3O3F A;  1WNS A;  4FK2 A;  1IO2 A;  2VG5 A;  1UA1 A;  3VA0 A;  1C0T A;  3RRH A;  4OGC A;  3QEW A;  2D5R A;  2RPI A;  1N5Y A;  2PYL A;  3RWU A;  3V9Z A;  1S1X A;  2ATQ A;  1NK9 A;  3V1O A;  4C8O A;  3DMJ A;  2G8H A;  4KAZ A;  1QSS A;  3KD5 E;  4LH5 A;  4BAC A;  4C8M A;  3OYI A;  3TAE A;  4DSJ A;  4E0D A;  4CJK A;  1IKY A;  1TL1 A;  2D0C A;  3ZT4 A;  4H4M A;  1Y97 A;  2DFH A;  1RT1 A;  4O44 A;  3QEV A;  1LWE A;  4NCA A;  4Z4C A;  1BHL A;  4B3O A;  1EP4 A;  3LZJ A;  1JLG A;  2G8V A;  1YTU A;  1XWL A;  3BGR A;  1T03 A;  2B4J A;  3ZSY A;  4DFP A;  1K6Y A;  2E4L A;  3HVT A;  3V1R A;  3NGI A;  2B6A A;  2GBZ A;  3HYF A;  3LP3 A;  5HRO A;  4B9M A;  2JLE A;  4KHY A;  1DTQ A;  1LW2 A;  1Z26 A;  4AHR A;  3O3G A;  2GUI A;  3OS1 A;  3HP6 A;  3AVI A;  3AA4 A;  3LZI A;  3O4Q A;  3O3H A;  2HHW A;  1C1B A;  4EP4 A;  3MEG A;  4E7J A;  5I42 A;  3LWM A;  3LP0 A;  4CHY A;  3WNG A;  1WAJ A;  4CEB A;  4XIU A;  4KO0 A;  4CJU A;  1CZ9 A;  1S1V A;  2HHV A;  2OA8 A;  4DQS A;  3BDP A;  3AO2 A;  1HQU A;  1Q8I A;  4CJL A;  2XHB A;  1KLN A;  4C8K A;  3KLF A;  1BGX T;  2YNI A;  4E7L A;  3V9S A;  4DLE A;  1J54 A;  4W5T A;  3MED A;  1EET A;  2YV0 X;  3H08 A;  4FLW A;  3O4N A;  1FK9 A;  4N41 A;  1BI4 B;  1LWC A;  1TKX A;  3K58 A;  4OKE A;  2RKI A;  1TKD A;  3KLH A;  4Y1D A;  5HP1 A;  1WSI A;  1Z25 A;  3L2R A;  4FCY A;  3LPT A;  3OS2 A;  4DTN A;  4KB0 A;  1A5W A;  4CEO A;  3NE6 A;  4JS4 A;  1BL3 A;  3S9H A;  1J5O A;  1F21 A;  1SV5 A;  4NYN A;  4B8C A;  4J2E A;  2VG6 A;  3LAN A;  1KFD A;  1RNH A;  3L2W A;  4KHN A;  1IH7 A;  3NFA A;  4CF0 A;  2JGU A;  4DTP A;  3OYL A;  4RG8 A;  3TAN A;  3P5J A;  3DLE A;  5CYQ A;  1JLQ A;  4FK4 A;  3QLH A;  3PV8 A;  5FRN A;  4KPY A;  3M8P A;  4IFV A;  5KGX A;  3VQ9 A;  1CLQ A;  4DQP A;  3L2Q A;  3VA3 A;  4DTX A;  3A2F A;  3PX4 A;  1SL1 A;  3AO5 A;  2NUB A;  2PYJ A;  1NOZ A;  5J1E A;  1HMV A;  4FJG A;  1ZBI A;  2PY5 A;  4DF4 A;  4KI4 A;  3DOL A;  4B9N A;  4M3W A;  1RDC A;  4PQU A;  4QAG A;  2RN2 A;  1B9F A;  3VQ8 A;  4DU3 A;  3VQB A;  4HUF A;  4CJ4 A;  2R7Y A;  3G10 A;  4DF8 A;  3DLR A;  4OLB A;  4F3O A;  1SKR A;  3V9X A;  4FJK A;  4FYD A;  5KI6 A;  1FXX A;  2IGI A;  5FRO A;  3DLH A;  2KFN A;  4CGI A;  4FLX A;  4W5R A;  3C6T A;  4HVJ A;  5J2P A;  4E7H A;  3SQ2 A;  1X9S A;  3LAL A;  3L8B A;  4CFA A;  3OYE A;  4M3Y A;  4LD0 A;  2A1S A;  4W5N A;  3AVK A;  4O0J A;  4N56 A;  4J2A A;  4CHZ A;  1EX4 A;  1NK6 A;  4J2D A;  4FJ8 A;  4HUG A;  2G8W A;  4Q0B A;  1C0U A;  3M8Q A;  3P83 D;  4O5B A;  4F2R A;  3T1A A;  3ZSZ A;  1J9A A;  1U4B A;  4CHO A;  2IOC A;  3L3U A;  2ITG A;  3T19 A;  3VQ5 A;  1QTM A;  3TR8 A;  3ZSX A;  2IS3 A;  4B9T A;  1WSF A;  4CGF A;  3RMC A;  3MXJ A;  1ASU A;  3SI6 A;  4IDK A;  1BCO A;  2X6N A;  3K5L A;  1QS4 A;  3MAQ A;  1JXE A;  4E7K A;  1L5U A;  2D0A A;  1RTD A;  4B9L A;  4BE0 A;  4DSI A;  5CZ2 A;  3HL8 A;  4FLT A;  1BQN A;  1TL3 A;  4KFB A;  4Z4E A;  2F8S A;  2XRI A;  4IKF A;  3HPG A;  3K2P A;  4O4G A;  3VQQ A;  2KZM A;  2IDO A;  3QIP A;  4H4O A;  4M42 A;  2WON A;  1NKE A;  4M3Z A;  4BDZ A;  3MXM A;  2WOM A;  3AVC A;  4UQG A;  1BIU A;  4AHV A;  5HRN A;  4CEC A;  1NK5 A;  1N6Q A;  3K5N A;  1VSF A;  4R5P A;  4HTU A;  4CGJ A;  3MEE A;  1S6P A;  1U48 A;  1HYV A;  4CJV A;  2HNZ A;  3B6O A;  2FBX A;  5SZT A;  3C6U A;  4HUE A;  3AO3 A;  4ELT A;  1BQM A;  3NH2 A;  4E19 A;  4CIG A;  1VSL A;  1WLJ A;  2BDP A;  4J2B A;  1DTT A;  1QQC A;  2HB5 A;  1DLO A;  3AV9 A;  2BE2 A;  3JSM A;  3V4I A;  4FJL A;  1S1T A;  4Z4I A;  4DTO A;  1RDA A;  3HT3 A;  4CF8 A;  3ITH A;  1SL0 A;  3IAY A;  1EKE A;  1TKT A;  1JLB A;  1QHT A;  3IS9 A;  3K5O A;  3SUQ A;  1ZYQ A;  3NF7 A;  3QO9 A;  3I8D A;  3SUO A;  3THV A;  2O4I A;  4E1M A;  4GW6 A;  1T05 A;  1WSH A;  3AVN A;  1L3T A;  5EU7 A;  3ZCM A;  2A1R A;  1C6V A;  5DK5 A;  1RT2 A;  3TAQ A;  5J2N A;  4ID1 A;  5C24 A;  1VSI A;  3KTQ A;  2XY6 A;  2OPR A;  1JXB A;  4CFD A;  3LAK A;  2Q3S A;  4M41 A;  4FJM A;  3NAE A;  1Q9X A;  2O4G A;  2VWJ A;  3KLE A;  1HNV A;  1SKS A;  4OPJ A;  4C8L A;  3PY8 A;  1RT7 A;  4AH9 A;  1FKO A;  4BDP A;  2OZM A;  3KKR A;  1S9G A;  3V9U A;  3LP2 A;  3SQ4 A;  1TK8 A;  3KD1 E;  3AVH A;  4ZHR A;  2OYQ A;  1LAW A;  1YTA A;  1XHX A;  1ITG A;  4KV8 A;  3V1Q A;  3NF9 A;  2HW3 A;  2X78 A;  4CHN A;  4YFU A;  3PX6 A;  1VRT A;  2VWK A;  4M45 A;  1QSY A;  3QES A;  4ICL A;  1X9W A;  2FC0 A;  1B92 A;  1HJR A;  1CXQ A;  3HPH A;  4OJR A;  4RW8 A;  3WNH A;  3V9W A;  3QNN A;  3OJU A;  3CFR A;  4FJ7 A;  1JLF A;  4I9Q A;  3RMB A;  4CEQ A;  4FJI A;  1BIS A;  2VG7 A;  3DOK A;  1NOY A;  1RCH A;  4M3R A;  1VSD A;  1X1P A;  4WE1 A;  4AHU A;  3EZ5 A;  3V6D A;  3OYJ A;  4KTW A;  2HVI A;  5JS1 A;  4CGH A;  2I5J A;  2P51 A;  3RR8 A;  2YKN A;  3NF8 A;  1JLA A;  3HO1 A;  3L2U A;  2XY5 A;  3LAM A;  4CK3 A;  2DY4 A;  1W0H A;  4OVL A;  5I3U A;  4CHQ A;  2AJQ A;  4IG3 A;  1D5A A;  4Z4G A;  4DLG A;  4FLV A;  2P5G A;  3RRG A;  1RT3 A;  4DG1 A;  1KVA A;  1HRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...