4O5BA

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[6-(5-chloro-1h-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
154
structure length
139
Chain Sequence
b'CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
total genus 40
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o5bA00
4FLWA 3D0PA 4DSEA 2HMIA 2Y1IA 2E6LA 4CF0A 3KTQA 4G1QA 4RW7A 4CHNA 3OYGA 4RW9A 4CEQA 3KK3A 1D9FA 3QETA 4I9LA 1JKHA 1JXEA 1IG9A 3NGIA 1BGXT 3SPYA 2Z1JA 4CJTA 3K5NA 4B9VA 4NCBA 3IS9A 4CJFA 3HL8A 4E3SA 3TI0A 4FJIA 1YTAA 2KZZA 1W9HA 4DSKA 4RG8A 3RWUA 4BE0A 3TAPA 4DSLA 1GOBA 1QSLA 1S1WA 3RMDA 1BL3A 4C8MA 4YFUA 4MQ3A 2LSNA 2YNFA 2ZD1A 5J2MA 1WSGA 3CM5A 2IAJA 4XIUA 1NK5A 4R5PA 1ASWA 3LAKA 3LP1A 5JS2A 4DTMA 2JGUA 3NF7A 1WN7A 1UA0A 3DYAA 4OPKA 4M3UA 3V1RA 1A5XA 1J54A 4CF2A 5KGXA 3PX4A 3E01A 3OYFA 1SKSA 5HRSA 3HT3A 2QKBA 4LSNA 1EP4A 3DM2A 3KIOA 3O4NA 4RW8A 4CHYA 1O1WA 3UIQA 4JLHA 4NCAA 3VQBA 1I39A 5EU7A 1S6PA 4DSJA 1B9FA 2P5GA 4N41A 4M3XA 1TKXA 4DTSA 4B9TA 3ZT4A 2A1RA 3AO4A 1B92A 1JLGA 5I42A 2ZE2A 4N47A 1RT4A 1RNHA 3SNNA 4W5QA 1Z26A 3V1QA 1Y97A 3MEEA 1JLBA 3VQ6A 5CY4A 1QS4A 3VQAA 3OS0A 3V6DA 1IO2A 2G8WA 2OPQA 1K6YA 1SUQA 3VQ9A 2OPSA 1RT2A 1VSHA 2AJQA 3DMJA 4DQQA 1IKYA 1RBSA 3KKRA 5KTQA 3OYCA 1DLOA 3F73A 4F8RA 4FZZA 1YVUA 1LWFA 4CEDA 5DMRA 5HROA 2A1SA 3KLHA 2HHXA 1RT5A 5J2NA 3WNEA 1XI1A 4IFVA 3K2PA 3L3VA 4BACA 2E6MA 4K8XA 3ZCMA 2G8UA 2ETJA 3AA2A 1ZBFA 2Q3SA 3AVHA 4DFKA 3SPZA 3KK2A 1D8YA 4M3YA 1WSHA 1HNIA 3OS2A 3QEPA 4CJKA 3MEDA 4C8NA 4LSLA 3QNOA 4KRFA 1TGOA 5SWMA 3NBPA 1BCMA 4OKEA 3K5LA 4FLVA 3QESA 3ZSOA 4M3ZA 5D3GA 1NJXA 2HHWA 3MXIA 1GOAA 3AVJA 3ISNC 3NFAA 1VSMA 2VWJA 2YNIA 1CXUA 1FK9A 3ZT3A 4CEBA 2D0BA 4OGEA 1HQUA 1TL1A 1X1PA 3VQDA 3RTVA 1U49A 4L8RB 2X74A 1EX4A 1KLNA 4FJKA 3VA0A 4EP4A 3NE6A 1ZBUA 3AVCA 1WSEA 4CIFA 4KHSA 4KREA 2PYLA 4DLGA 4J2BA 4FXDA 5J2PA 4RW6A 3OYNA 3OYJA 3AVBA 2YKNA 1S1TA 1U4BA 1T05A 5HLFA 3CM6A 1NKEA 3F9KA 4BWJA 3OYMA 3RR8A 5CYQA 3AO3A 3VQEA 1HYZA 1CZ9A 2WONA 3C94A 3AA5X 4AHCA 3QIPA 4Z4IA 1RILA 3ASMA 4E7JA 2ITGA 4IG3A 3VQQA 2DFEA 3ZSYA 3TABA 4PWDA 2KTQA 4CERA 3VN5A 1BI4A 4ID1A 3AVFA 1DTQA 3NH2A 3OYDA 3KLIA 4KB1A 1WSFA 2X78A 4CFAA 3K5OA 1TL3A 3M8SA 1TAQA 4ZTJA 4PUOA 4FZXC 2BANA 3SQ1A 4BDPA 4M45A 1J53A 3S3OA 3T1AA 4CK2A 2XY7A 4KKOA 4FJ5A 1C0UA 2IDOA 5CZ2A 4FJHA 3P1GA 4CJRA 3KK1A 2X6SA 4CEAA 4E0DA 4FJGA 4CEOA 1KTQA 2YHAA 4FM0A 4DG1A 1RBTA 3JYTA 4LH5A 3PX6A 4CFBA 4CGGA 3HVTA 1VRTA 3SUNA 1WAFA 3HK2A 4FK4A 3CYMA 3VQCA 3OYBA 3L2RA 3S3NA 4M42A 4IBNA 3QEVA 2QXFA 3WNHA 1RBRA 5HRNA 3V9WA 1MU2A 5KRTA 1C0MA 3LANA 4AHSA 3SCXA 2OYQA 1QSSA 1RDAA 3L3UA 3NF6A 5C24A 3C95A 4B08A 1QHTA 1UWBA 3V4IA 1TK5A 4CJQA 4W5TA 3SZ2A 3DLRA 3QEXA 4W5OA 2GV9A 4CJSA 4DTXA 4QOZB 1C6VA 3OYAA 3DLKA 3OS1A 4B8CA 3OY9A 1NJWA 1EKEA 4CF8A 4BDYA 1FXXA 4FVMA 1SL2A 4J2DA 2XY5A 5E41A 3ZT1A 4DFMA 4C8LA 2OA8A 4CJVA 3HO1A 1BHLA 2HHSA 3H08A 3AV9A 4W5RA 1KFDA 4EP5A 3LPUA 1UAXA 4AHTA 4F2SA 4OVLA 4CF9A 1BQNA 1C1AA 4CHPA 4E19A 3VA3A 4DQPA 2VG7A 1T03A 1VSJA 4HCBA 1ZBIA 4KO0A 4I7FA 5FROA 3JSMA 3PO4A 1HRHA 1IKWA 1C1CA 1WLJA 5KI6A 2O4IA 3TR8A 1XHXA 1TK0A 4HUGA 4CJUA 3BDPA 3I8DA 1RDCA 1S1XA 4I9QA 3D45A 4OLBA 4EZ6A 3AVGA 2YKMA 4CEEA 2G8FA 3RRGA 3AVAA 4CHZA 3LDSA 1VSLA 3T3FA 3U3GA 3SV3A 1RDDA 2KFNA 4Y1CA 4QCLA 4E7HA 1S5JA 5HRRA 3OYEA 4LD0A 1S6QA 2IC3A 3L8BA 2OZSA 4F3OA 1JLCA 5CZ1A 1RTDA 4CJPA 4H4OA 3QIOA 3B6PA 2IOCA 3IRXA 3AA3A 3CFOA 4DQSA 1NK9A 1NK7A 2QKKA 1LAWA 2OPRA 3C6TA 3DLBA 4KI6A 4E7IA 2Y1JA 3A2FA 1U04A 3VQ4A 4E89A 1B9DA 3HPOA 3ZT2A 3S3MA 1NKBA 2PZSA 2G8IA 3VQPA 1QE1A 1T8EA 3O4QA 3DOKA 4KHYA 4CJEA 1JXBA 3AO1A 3O3GA 4LH4A 5HP1A 3OYKA 4JS4A 2YNHA 4O0JA 4E7KA 3NH1A 3HPHA 3ZSQA 4C8KA 1RTIA 4I2PA 4B9UA 4ZTFA 3SUPA 1WSJA 3OYIA 1LAVA 2BE2A 2FBXA 4CK1A 3V9SA 4NYFA 4FLZA 4N76A 2HHVA 3FFIA 3PY8A 3TAGA 2PYJA 4ELVA 2XY8A 2HVHA 1BCOA 4HVJA 2HHUA 3ULDA 1UOCA 2O4GA 2RF2A 3KJVA 4FW1A 1HNVA 4KTZA 3ZSZA 4DLEA 3KD5E 4HCCA 2DFFA 4DS4A 1SL0A 4FJNA 1LW0A 1KSPA 3LWLA 4HUEA 4DFJA 3V1OA 1LWEA 4AILC 3ZSRA 1VSKA 4I2QA 5DK5A 3K59A 3L2VA 3O3FA 1ITGA 1NK4A 3LZIA 1J5OA 2DFHA 2IS3A 4CGJA 3OYLA 2BGGA 2XY6A 3LPTA 1KFSA 3L2UA 2F96A 3NCIA 3HPGA 1BIZA 4WE1A 4CJLA 3CG7A 3K5MA 3V9UA 2JLEA 3ZT0A 4FK0A 2KFZA 3DRSA 2HNYA 3AVKA 4N56A 1XC9A 3WNFA 3DRPA 4CGFA 3KLFA 4CJ3A 3EYZA 3NF9A 4DTJA 3OJSA 3PV8A 4ICLA 4FJJA 4H4MA 4FLXA 3ALYA 4DQRA 4Z4HA 3G0ZA 3SUQA 1NK8A 2HNZA 5KGWA 1GOCA 2GBZA 3V9ZA 1L3SA 3M8RA 1CLQA 1NJYA 1C0TA 5K14A 4B3OA 1BI4B 4DF4A 4HHTA 4ID5A 4JRQA 1ZYQA 1Z25A 3ZSXA 2HHQA 1QTMA 3IG1A 2FBYA 3KKSA 4O4GA 1L3UA 1KRPA 4MFBA 1S9EA 3BGRA 2F8TA 3K58A 4DF8A 1TV6A 4PQUA 3ITHA 1U48A 1VSIA 1HYSA 1YT3A 5J2QA 3DRRA 4KHWA 3AVIA 4IFYA 3NHGA 3IAYA 2ATQA 4KV8A 1TK8A 4BE2A 4FJXA 2KW4A 4PA1A 1LW2A 1BISA 3V9XA 3U6FA 4RW4A 3EZ5A 3DOLA 1A5WA 3NF8A 3ZSWA 1EETA 3QEWA 1RBVA 1RBUA 3B6OA 4KTWA 4FJMA 4F3TA 1BQMA 3LP3A 1KVAA 3MECA 3VQ8A 3HSTB 5HBMA 3LP2A 3SJJA 1HJRA 2E4LA 4QAGA 3CFRA 1L3TA 4OLAA 4FLUA 1KVBA 4CIGA 4CF1A 4DQIA 4CFCA 5J1EA 4HUFA 4DWIA 3HVRA 4FLYA 2HW3A 1X9SA 3LAMA 3AO5A 4M3RA 3O3HA 2HVIA 1FKPA 3SYZA 4DFPA 1U45A 3SV4A 3HP9A 2BDPA 1QQCA 1HQEA 4DTRA 1RT6A 4AHRA 3HJFA 4UQGA 3RRHA 1S1UA 4CJ5A 3TARA 4FJLA 4CK3A 4KI4A 1TKTA 3RMAA 3WNGA 4AHVA 1I3AA 4DTOA 1HMVA 3I0RA 4KB0A 1JLEA 4KPYA 4CFDA 4IDKA 3AVMA 1TAUA 4K8ZA 5FRMA 4F2RA 3SUOA 2HNDA 4DSIA 4FZYA 5HRPA 4B8AB 3KLGA 2NUBA 3OVNA 4N5SA 2XHBA 3DLGA 4KHNA 2KZMA 1S1VA 2I5JA 4CEFA 4GMJB 4O0IA 4FK2A 1C1BA 1KVCA 1RTJA 1SL1A 2YHBA 3M8PA 4OJRA 5C42A 3VQ7A 3TAMA 1D5AA 3OJUA 3LWMA 1WNSA 4DTNA 2HB5A 3MEGA 1Q9YA 4AHUA 5C25A 4CHQA 4HTUA 1JL1A 4BDZA 1T7PA 3MXMA 1RT1A 1XWLA 3AO2A 2B4JA 3LZJA 4FJ9A 1CXQA 3U3YA 1LV5A 2WOMA 1XHZA 3MAQA 3TAFA 3NGYA 1F21A 3TAQA 4TSXA 4FCYA 4CGHA 4B9LA 3SQ0A 2FC0A 4KHUA 4OGCA 1REVA 3T19A 4Q0BA 1G15A 3CFPA 2PY5A 2QK9A 4E1NA 4EZ9A 1ZBHA 3PX0A 1W0HA 1Q8IA 4KAZA 3DI6A 3HYFA 4CESA 4CGIA 3THVA 3AA4A 2YV0X 4W5NA 3K57A 2P5OA 4B9MA 4DS5A 2DTUA 4Z4FA 1FKOA 1SKRA 3AVNA 3VQ5A 4FJ7A 2KQ2A 3QNNA 3RR7A 4PY5A 4FYDA 4IG0A 4KFBA 2Z1GA 4Y1DA 3OYHA 3HM9A 1N5YA 1IKVA 1WAJA 2R7YA 2Z1HA 4FLTA 4OKKA 4FW2A 3CQ8A 3KLEA 1NKCA 3QERA 4B9SA 2D0CA 2VG5A 2XO7A 1IH7A 3QEIA 1RDBA 1KCFA 4KHQA 2B6AA 2FBVA 2VWKA 3P83D 4M41A 4DTPA 5T7BA 4YNQA 4F4KA 5SZTA 1VK0A 4CJ4A 3S9HA 1S9GA 4NCGA 4JS5A 4JRPA 5JS1A 1IKXA 1KLMA 2RPIA 3L2WA 3NDKA 4ELUA 1DTTA 4M3TA 4CHOA 3P5JA 4J2AA 4IKFA 1RTHA 1WSIA 2EX3A 4CJWA 1N6QA 1Q9XA 1JL2A 4C8OA 3NH0A 1EXQA 1VSEA 2P51A 2YNGA 4Z0UA 3SQ2A 3RMBA 1X9MA 1NOYA 2G8HA 2D5RA 4AH9A 5KRSA 3DLHA 3QLHA 3PO5A 3G10A 4Z4EA 3C6UA 4GVMA 1A5VA 4CEZA 1NK6A 1HPZA 4BE1A 2F8SA 1HYVA 2IGIA 3I0SA 3TANA 2G8VA 3TWHA 4LY7A 4E7LA 4J2EA 5I3UA 4DU1A 2W42A 2DY4A 1ZBLA 4GW6A 2B5JA 1JLQA 1RT3A 1NJZA 1SKWA 4CE9A 4NYNA 1TVRA 4DMNA 1L5UA 2ZQBA 4CCHA 1LWCA 4E1MA 4FM2A 5FRNA 1CZBA 4BWMA 3NGZA 1VRUA 3AVLA 4DSFA 1X9WA 4O5BA 4ELTA 2EHGA 3DLEA 3QO9A 1NK0A 2OZMA 3PUFA 1J9AA 1R0AA 1SV5A 4DTUA 4Q5VA 1RCHA 1TKZA 1JLAA 1VSDA 2GUIA 3LP0A 3L2QA 2XRIA 4OPJA 3KD1E 4FM1A 3EY1A 2OPPA 3TAEA 4Z4GA 4CECA 3M8QA 2G8KA 2HHTA 4Z4CA 5FDLA 1TKDA 4KTQA 3HP6A 1ASUA 1BIUA 4OKJA 2FBTA 4CGDA 2P1JA 3NAEA 1L3VA 1YTUA 2VG6A 3ZSVA 2X6NA 1JLFA 4DU3A 2RKIA 3SQ4A 1U47A 1D9DA 1VSFA 3MXJA 3QINA 4O44A 2RN2A 3V81A 4M3WA 2D0AA 2Z1IA 3HXMA 1ASVA 4O55A 3SI6A 1NOZA 3LALA 5CYMA 1RT7A 4ZHRA 4DU4A 4FJ8A 4H8KA 3RMCA 1UA1A 4CIEA 4B9NA 1QSYA
chains in the Genus database with same CATH superfamily
5BREA 4FLWA 1XMOK 3D0PA 2Y1IA 2O8CA 4CF0A 1D9FA 1QQNA 1JKHA 3NGIA 1BGXT 3SPYA 3K5NA 4YY3K 4B9VA 4JKAA 3TI0A 4DSKA 3TAPA 3R1XA 4JD2A 5BPLA 4DR7K 2NRWA 4MQ3A 1R59O 4WFAL 2ZGZA 4JK7A 3O9RA 3NF7A 1N32K 2WC9A 3V1RA 1A5XA 2J4RA 4OX9K 3L4QA 3U9DA 1SKSA 4EHUA 3SBGA 5HRSA 4LSNA 3L6QA 3DM2A 3ZX2A 1O1WA 4NCAA 4N41A 1I39A 4DSJA 4WQ4C 4IDHA 1B92A 2O8BB 1RDWX 3WXLA 4DR1K 5JLHA 3V1QA 1JLBA 3VQ6A 2OPQA 2OPSA 5C10A 1RBSA 5AJ3K 3KKRA 4F8RA 4X62K 5EX5A 5TKYA 4XEIA 3CJAA 3J7ZO 3K2PA 1XI1A 3B8AX 3ZCMA 2P9PB 4M63C 2QWOA 1ZBFA 3AVHA 3KK2A 1HNIA 5AZJB 3MEDA 5DM6L 3O1BA 1EO1A 3QESA 3K5LA 4ILJA 4M3ZA 2HHWA 3ISNC 3NFAA 2VWJA 4BRMA 4UY8O 1FK9A 3ZT3A 4CEBA 3RTVA 4L8RB 1TL1A 1X1PA 1U49A 1EX4A 4EP4A 5FPDA 4H0VB 4KHSA 2PYLA 4FXDA 1HLUA 2E8AA 1K8KA 2IVPA 5BRHA 3A0IX 3CM6A 1U4BA 3AO3A 1FW6A 1JCEA 2I7NA 3KVGA 2UXCK 3ASMA 4E7JA 3CCUN 4PWDA 2KTQA 2P9KB 4CERA 3VN5A 3AAQA 4FWLA 1XNQK 2HMPA 4CI6A 1M90O 1CZAN 3NH2A 3UE5A 3K5OA 2A3ZA 1IJJA 3M8SA 4JAXA 4ZTJA 3J7AP 4FZXC 4BDPA 5AQFA 4DR4K 1BA1A 4FJ5A 1C0UA 5CZ2A 3P1GA 5GAGP 4ISFA 2YHAA 4DG1A 1RBTA 1YHQN 4LH5A 3TU5A 4CFBA 4CGGA 4JK8A 4B1UB 3VF2A 4IBNA 2ZGYA 1RBRA 2FSNA 4WQ4A 3NMUA 1X3MA 4W5TA 3CCVN 4NLBA 4JNEA 1GLJO 2GV9A 4QOZB 1C6VA 4BDYA 4J2DA 1FXXA 4DR6K 1KFDA 4EP5A 3LPUA 1UAXA 4AHTA 4OVLA 1BQNA 1C1AA 5AQLA 3VA3A 1OH8A 4H0YB 2O4IA 1IKWA 3P31A 4IWVA 3THWB 1XHXA 1TK0A 4HUGA 4CZLA 3E9LA 4QS9A 2G8FA 3SV3A 4Y1CA 4QCLA 4E7HA 4FOIA 5HRRA 2NRTA 1RTDA 4GVEA 3ID6A 2PAVA 3QIOA 1DEJA 2IOCA 4O5FA 2QKKA 3E66A 1LAWA 3BUZB 5AQIA 3VEZA 1Q7YO 1MDUB 4E7IA 4E89A 3IFRA 1B9DA 3HPOA 3ZT2A 1NKBA 1S3XA 2D0PA 1T8EA 1IBMK 4KHYA 4JKHA 3OYKA 2YNHA 3NH1A 4C8KA 4QS8A 3MMVA 4NYFA 3PY8A 4ELVA 2XY8A 2HVHA 1BCOA 5AQSA 5AQJA 2ASPA 3LDLA 2RF2A 1NGHA 4DV4K 1HNVA 4DLEA 3KD5E 1SL0A 2QWNA 3VERA 3LWLA 4HUEA 5C15A 4IEEA 4JHDB 4DR2K 3K59A 1VSKA 2F9WA 3O3FA 3VETA 3P39A 2DFHA 4GKKK 1TUUA 3LPTA 2F96A 4FK0A 4WE1A 3ZT0A 3AVKA 1K8KB 1XUPO 3KLFA 3DRPA 3CC2N 1QHAA 4ICLA 4FJJA 5KGWA 1MA9B 1ZXOA 1C0TA 5K14A 5FLXO 2OANA 3FZHA 3MN5A 5MLCQ 4KH5A 1ZYQA 1Z25A 3D2FA 3ZSXA 2O8FA 1QTMA 4O4GA 2FBYA 4B1XB 4O8KA 3BGRA 2F8TA 4FO0A 1TV6A 4PQUA 3DRRA 4KV8A 3F9MA 2I7PA 4BRAA 4JI6K 3BZKA 3O9QA 2GX9A 3NVKA 1NBWA 5EXWA 3JAMO 3QEWA 3AY9A 1RBUA 4I6MA 4BGAA 4LF6K 3HSTB 2HSTA 3CCQN 4QAGA 1L3TA 1BWFO 4CIGA 4CF1A 4HUFA 3UKRA 2BTFA 1FKPA 2HVIA 1IG8A 1E4GT 1KAZA 3SV4A 2WBNA 1QQMA 3J8AA 2NRXA 1QZ5A 3I0RA 3ZX3A 4KB0A 4JI8K 1NGAA 4CFDA 3AVMA 3O08A 1TAUA 4G9ZA 3SUOA 2NUBA 3OVNA 4CD3A 1XQSC 3NVMA 3JXUA 1OH7A 4BG9A 3M8PA 2IVNA 3TAMA 4DTNA 4BQLA 2KHOA 1Q9YA 3W0LA 5C25A 3IDHA 1HNZK 1CXQA 2WOMA 3TAFA 3I33A 5BPNA 4FCYA 1K8AO 3SQ0A 1VQPN 4OGCA 2QK9A 4E1NA 4EZ9A 4FOEA 4KAZA 3HYFA 5EY4A 4CGIA 4W5NA 3K57A 2DTUA 2WTUA 2E2PA 3VQ5A 3QNNA 2KLAA 3QBWA 4IG0A 5AFUA 5BN8A 5LJWA 2Z1GA 4KH4A 1Z05A 3GBTA 3CQ8A 3QERA 5JVHL 2D0CA 4RCHA 3VMFB 4DTPA 4MO4A 1ATNA 1S9GA 4NCGA 4M7XA 5AQQA 1J5EK 1KLMA 2E2QA 1HNXK 4CHOA 3G4SN 1RTHA 3AGKA 2EX3A 3O1WA 1N6QA 2P9IB 2QTDA 2UUBK 2ZJRL 3SQ2A 2P51A 1X9MA 4FWQA 5KRSA 3QLHA 4H5TA 2FF3B 1W7AA 1DGKN 3LL3A 3MN9A 4CEZA 2IGIA 3I0SA 3TANA 3TWHA 4YDUA 4E7LA 1NJZA 4GW6A 2B5JA 1JLQA 2E88A 4NYNA 1IV0A 4IFEA 4XH1A 4DMNA 2ZQBA 4JKFA 1LWCA 4FM2A 4H0OA 3CCLN 2FSKA 1U2VB 4H03B 3AVLA 4BC2A 2A41A 1MWMA 4O5BA 4ELTA 3QO9A 2A42A 3I56N 3D2FB 3FLCO 2O8FB 3LP0A 2BUPA 1WBDA 4OPJA 4FM1A 3C6AA 2ITMA 5C2FA 5FDLA 2V52B 1TKDA 4CZGA 3HP6A 4JI5K 2FBTA 3NAEA 2VG6A 3ZSVA 1U47A 4JKGA 1ATRA 4K0KK 4O44A 2RN2A 1KQSM 2Z1IA 3CERA 1NJIO 1NOZA 4DU4A 5I9EB 3DJCA 4B9NA 3FZLA 4DSEA 4DV5K 4EIAA 4LFAK 1NWKA 4RW7A 3OYGA 3ZLJA 4NCBA 2Z1JA 3UKRB 4YOWA 4E3SA 4BR4A 4FJIA 2VWBA 2KZZA 3G25A 4BE0A 4DSLA 1NGDA 1GOBA 1QSLA 3RMDA 1BL3A 2QWMA 3MX5A 2LSNA 1NG9A 1NGJA 3THYA 1M1KO 1WSGA 1EWRA 1I94K 4JI1K 4R5PA 1ASWA 5JS2A 4BRCA 3DYAA 2Q0UA 4OPKA 3PIOL 3PLAA 2W6LA 4CHYA 1YVNA 1Q86O 1S6PA 4WQ5A 3SMSA 4B9TA 3ZT4A 1JLGA 4N47A 1WUAA 1Z26A 1Y97A 5CY4A 1QS4A 4Y0WA 3ULEA 3OS0A 2G8WA 4FWSA 2AJQA 3VQ9A 1RT2A 3DMJA 3KWIA 2NLXA 1DLOA 2YCHA 3U8XA 4FZZA 5DMRA 3KLHA 1RT5A 3CQXA 5BRFA 5J2NA 3IMXA 1Z6RA 4IFVA 4BACA 2FSJA 5KQ8A 5DM7L 1LCUA 3DWLA 3M5RA 4DFKA 3H3NO 1D8YA 4M3YA 2V7ZA 4YOUA 3OS2A 4LSLA 4KRFA 1TGOA 3NBPA 4FLVA 3DLLL 3ZSOA 5D3GA 4CZIA 1GOAA 2IVOA 1VSMA 4LC9B 1NGIA 3BZCA 4OGEA 1HQUA 4MLHA 4BRGA 1ZBUA 4CIFA 1WSEA 4DLGA 4J2BA 3OYNA 3OYJA 4JI2K 4XH4A 1VQON 3F9KA 4BWJA 4A62A 3VQEA 1HYZA 3WT0A 2FXUA 2WONA 3AA5X 4AHCA 3QIPA 5M1OA 3VEXA 4DR3K 3ZSYA 1VQ5N 3VQQA 4PKHA 4ID1A 4JK9A 4KH6A 1DTQA 4KB1A 3VESA 2X78A 4PUOA 2Q1NA 1JCFA 2IDOA 3D2EA 1HPMA 4CJRA 4CEAA 4FJGA 1VQ4N 5EVZA 3PX6A 1VRTA 1WAFA 3J80O 3HK2A 4FK4A 3VQCA 3L2RA 4M42A 5AQPA 3EEQA 4NXMK 3WNHA 5FPNA 2QI2A 5HRNA 3P38A 3K9KA 3LANA 4JKGB 1RDAA 3L3UA 1Q81O 5EOYA 1QHTA 3ZEUA 3V4IA 3DLRA 2NZTA 3HTVA 2QWRA 3BF3A 4CD1A 4B8CA 3OS1A 1VQ6N 2WUSA 2XY5A 5AQUA 3ZT1A 3C0BA 3MN6A 3DXKA 4CF9A 5E84A 4DV7K 2VG7A 4CZEA 1T03A 3EE9A 3PO4A 1HRHA 3TR8A 4BY9C 1VQ9N 4I9QA 2GUPA 4JKBA 4A2BA 3N4QA 4XH5A 4EZ6A 4OLBA 2YKMA 3EKUA 4CEEA 3RRGA 2VCPA 4CHZA 3LDSA 3FZMA 3CPWM 5FPMA 5F2RA 1S5JA 3OYEA 2IC3A 1QZ6A 5ADXH 1BG3A 5CZ1A 3IRXA 5B8HA 3AA3A 4GKJK 4K41A 1NK7A 3WUHA 2OPRA 3C6TA 1HUXA 2YJEA 5C12A 1U04A 2PZSA 3VQPA 1QE1A 1QQOA 3DOKA 4MDBA 5HP1A 1HKBA 4CZKA 3HSCA 4JS4A 3ZX0A 4WFNL 1RTIA 3C7NA 4B9UA 1DKGD 2ZM6K 1LAVA 2FBXA 4CK1A 1N8RO 2D0OA 4N76A 3CETA 2HHVA 3TAGA 4HVJA 3WXMB 3ULDA 2NRHA 3ATVA 1UOCA 2NRVA 2O4GA 4FW1A 3SAGA 2QEXN 2DFFA 3LM9A 4X66K 2CH5A 1KSPA 4DB3A 4DFJA 4E1JA 2V51B 4AILC 4B3MK 3L2VA 3P4IA 4CGJA 2UUAK 4NXNK 3O80A 4GY2B 2XY6A 4DQ8A 1KFSA 3L2UA 1BIZA 4JKEA 3MN7A 5CR4A 3HI0A 1XC9A 2UXDK 3WNFA 4CGFA 3CC4N 1N36K 3EYZA 3TSUA 3DXMA 3PV8A 4IZ9A 4JV5K 3VENA 4ISGA 4FLXA 4DQRA 3MX2A 5AQGA 4K25A 1GOCA 1L3SA 1CLQA 4FWRA 3FFKB 3MWTA 1OKJA 4B3OA 4HHTA 4ID5A 4JRQA 2VQFK 3KKSA 1L3UA 4WCEL 3S41A 3K58A 4DF8A 3ITHA 1U48A 1HYSA 2D1KA 1EQYA 2ATQA 2P9SB 3A5NC 3CQYA 1TK8A 3D2EB 5F1XA 4FJXA 4C1NI 4CZMA 3DOLA 3K9JA 3NF8A 1T6CA 3ZSWA 2PBDA 2YHWA 2FLOA 3B6OA 1E3MA 4F3TA 3MECA 1ZBSA 3H46O 3TSPA 3LP2A 4J8FA 4LFBK 1X9JA 1G99A 3LM2A 4FLUA 1NGGA 1NMDA 1MWKA 2Q36A 4DWIA 2YHXA 1KXPA 4YOVA 2O8CB 3E9PA 3HP9A 2BDPA 1QQCA 4BR9A 2F7TA 2O8DA 4BREA 3J81O 1BOTO 3CJ7A 1BU6O 4AHRA 5AR0A 4KI4A 3TPQA 3TARA 3VTHA 4BC4A 4DTOA 4JD2B 1C0GA 2DPNA 2YI1A 5BR8K 1NGEA 1JLEA 4BRKA 1HX1A 4IDKA 3HBTA 2HNDA 3WXKA 4FZYA 3DLGA 1EWQA 4O0IA 4IEIA 4MDAA 1Y64A 1KVCA 4AM7A 1IBKK 2YHBA 2YJFA 3OJUA 5C42A 1D5AA 4HTUA 4AQYK 2Q31A 2B4JA 5BPMA 1NGCA 3U3YA 2W40A 4OPAA 3NGYA 1YJNN 4JI3K 4PL8A 2FC0A 3M3ZA 1G15A 3PX0A 1W0HA 2UXBK 1SAZA 4IJNA 3THVA 4L3QA 2P9NA 4DS5A 4FJ7A 2KQ2A 3RR7A 4PY5A 4KFBA 4BC3A 3OYHA 1TYQA 1N5YA 1IKVA 4FWKA 5A2QO 2R7YA 2Z1HA 4YOYA 4B9SA 1IH7A 1RDBA 1NLVA 5CHIA 2B6AA 2FBVA 5KPTA 4M41A 5SZTA 2A6AA 4DV3K 1VK0A 4CJ4A 3S9HA 4LFCK 4BRLA 4JRPA 2ZJPL 3NDKA 2RPIA 4ELUA 1DTTA 3LDNA 5AQRA 1ESVA 4IKFA 3QBXA 3THXA 3LDOA 1JL2A 4A57A 3MCPA 3CCMN 1VSEA 1NOYA 2VGMA 5BRDA 3DLHA 1A5VA 4GNIA 4BR5A 5GAHP 1HPZA 1HYVA 3G6EN 2G8VA 4J2EA 5I3UA 2H3GX 2DY4A 1SKWA 4JI4K 3E9OA 3FE1A 2JWLA 1L5UA 4CCHA 4JKDA 4BWMA 3ATUA 1X9WA 2HBLA 1SV5A 4Q5VA 1TKZA 1VQ7N 2XRIA 1HKGA 3BY5A 1HNWK 3I8BA 2G8KA 4Z4CA 1ASUA 4OKJA 1L3VA 4DU3A 3SQ4A 3MXJA 4YHHK 4MO5A 3HXMA 4O55A 1RT7A 3CXCM 3RMCA 1SS6A 3A5OC 3JS6A 1U6ZA 1J6ZA 2E6LA 3KTQA 4G1QA 4CEQA 2VYPA 3O9SA 4I9LA 4YORA 3QETA 1IG9A 1VQMN 2HF4A 4JI0K 3DAWA 3IS9A 1HJOA 4B1WB 1YF5L 3O8MA 3QDKA 1K73O 1W9HA 3I55N 4YFUA 1T3VA 2YNFA 5J2MA 3EO3A 3ZETA 1FJGK 3CM5A 2IAJA 4XIUA 3O5BA 3LAKA 4DTMA 2JGUA 4DV1K 3LDQA 1J54A 4CF2A 3OYFA 3HT3A 2QKBA 2HHHK 1EP4A 3O4NA 3KIOA 4RW8A 3VF6A 5EU7A 1B9FA 2P5GA 4M3XA 5LMUK 3AO4A 2Q97A 5I42A 2ZE2A 5AQWA 1RT4A 4W5QA 2F4VK 5JLFA 3O6WA 3V6DA 1IO2A 4BQZA 1K6YA 3Q7CA 2P9UA 4DQQA 5KTQA 3SK3A 3F73A 1YVUA 4OO1J 3FZFA 5HROA 2A1SA 4CZHA 3PSFA 5AQKA 3L3VA 2E6MA 1GLAG 4BGBA 3AA2A 2P9NB 2Q0RA 2Q3SA 3OW2M 4CJKA 4C8NA 4C1NK 4YOTA 5GIOA 3QNOA 3F5TA 5SWMA 1BCMA 1T44A 1TYQB 3RSEA 3MXIA 3AVJA 5LL6Z 2D0BA 1QVFM 2X74A 4FJKA 3VA0A 1XNRK 4H0PA 3QMLA 5J2PA 5C2DA 5LJVA 2YKNA 4DV2K 4KHPK 3THXB 5M1KA 5IWAK 1CZ9A 3PIPL 1VAZA 4ILGB 3C94A 3OHRA 1RILA 2ITGA 2RE2A 1BI4A 3AVFA 4U67L 4LF5K 3KLIA 1WSFA 1NNEA 4CFAA 2WFBA 1TL3A 2QW9A 4BR2A 1J53A 3S3OA 3T1AA 3CJCA 4KKOA 3MCAB 4FJHA 2X6SA 1OH5A 4CEOA 1KTQA 4A59A 3JYTA 4FM0A 5KPZA 5AZIA 3SUNA 3L4IA 3Q7BA 3EE8A 2VQEK 3OYBA 3S3NA 2FF6A 1K9MO 3T7ZA 4I6MB 4PHTX 3V9WA 1MU2A 3VPZA 5KRTA 4AHSA 3BP8A 5C24A 4B08A 1UWBA 2GELA 1TK5A 4CJQA 3SZ2A 1WBBA 2AA4A 2OCEA 5ADXA 4AF1A 4CJSA 3OYAA 4DUYK 5C0YA 1EKEA 3R3LA 4FVMA 1LOTB 4DFMA 3CJ1A 4C8LA 2OA8A 3CIPA 3HO1A 2HHSA 4DHYA 1WOQA 5H1SQ 4F2SA 4JN4A 1Q82O 4CHPA 4E19A 4DQPA 3CJ9A 4HCBA 3AAPA 4I7FA 4KO0A 4BVPA 4WFBL 5JVGL 1WLJA 5KI6A 4BRQA 3I8DA 1RDCA 1S1XA 5GINA 3AVAA 3EKSA 1VSLA 4BC5A 1RDDA 2KFNA 5M1PA 2OZSA 4F3OA 5KPRA 4JYAK 4H0XB 2E1ZA 3H45C 2UU9K 3CFOA 3CF5L 3DLBA 3VTIA 2Y1JA 3A2FA 3VQ4A 3C6HA 3T69A 3O3GA 4A5BA 4I2PA 3GOIA 4BRPA 3SUPA 3V9SA 1SQKA 2BE2A 2P9PA 4JI7K 3FFIA 2HHUA 4CZJA 3ENHA 4KTZA 4HCCA 4DS4A 1LW0A 3VEVA 3GE1A 5KQDA 3ZSRA 4I2QA 1ITGA 3HZ6A 3OYLA 4MLEA 5M1QA 3KK7A 3NCIA 3K5MA 3V9UA 3HPGA 3CG7A 4PKIA 1BUPA 4IXCA 4K42A 1KD1O 2HNYA 4CJ3A 4DTJA 3EZWA 2P9LA 3T1HK 4Z4HA 3G0ZA 2P9KA 1W2BM 2NNWA 3WXJA 3M8RA 3V9ZA 5AFUH 4IO9L 1BI4B 2HHQA 2F9TA 3IG1A 1KRPA 4A5AA 5HL7L 1VSIA 4RTFD 1GLLO 4IFYA 3IAYA 2KW4A 3V9XA 1RBVA 4BVOA 4KTWA 1N33K 2W41A 1YXQA 1KVAA 2GWKA 3IKMA 3LP3A 3MWPA 3SJJA 1HJRA 2E4LA 3UKUA 1YJ9N 1V4TA 4BROA 4DQIA 4CFCA 5J1EA 3CCEN 3FZKA 1JJ2M 3D6RA 4BRIA 3AO5A 2QXLA 2V7YA 5M1FA 4DFPA 4GV3A 3A8YA 3HJFA 4PKGA 4UQGA 3RRHA 1S1UA 4CK3A 1TKTA 2ZWHA 3VEOA 1I3AA 4BRFA 4B3SK 4WYBA 3A5MC 1HMVA 4KPYA 3THYB 4B8AB 3KLGA 3THWA 4BR0A 4IO8A 2KZMA 1S1VA 4FK2A 1RTJA 1SL1A 4JEPA 3VQ7A 3LWMA 2GTDA 2HB5A 5AQYA 3M6GA 5AQVA 4CHQA 1T7PA 3MXMA 1RT1A 4U7BA 1LV5A 4HTLA 3MAQA 1XHZA 4CGHA 4BG8A 1REVA 3ULEB 3CFPA 2PY5A 3SAHA 1GLDG 2O8EA 1ZBHA 1Q8IA 4B9QA 3DI6A 4CESA 1Q18A 3AA4A 1RFQA 4WF9L 4LF7K 1NGBA 2P5OA 4B9MA 4F9OA 1SKRA 3HM9A 4OKKA 4FW2A 1NKCA 3QEIA 2XO7A 3R9PA 2CGLA 2VWKA 3P83D 3WEEA 5T7BA 3CPEA 4YNQA 2YX6A 1VQ8N 1IKXA 4X64K 3L2WA 4JHDA 3P5JA 4J2AA 4CJWA 4C8OA 1YI2N 1Q9XA 2HBJA 1QSYA 3CI5A 3GL1A 4RWTA 4JKCA 4CZFA 3RMBA 2D5RA 3MDQA 3CCJN 3D7EO 4GVMA 4YOXA 3OBYA 1VQKN 1NK6A 4EHTA 1H1VA 4BE1A 2F8SA 3F2KA 1OVYA 4DU1A 3C65A 1TUYA 1GLEG 5AQOA 1ZBLA 1RT3A 4CVNE 4CE9A 4C23A 2P9LB 1P8ZA 1TVRA 1IBLK 3N4PA 5FRNA 1CZBA 1YITN 3NGZA 1VRUA 4DSFA 2EHGA 3DLEA 2OZMA 3ENBA 1R0AA 1RCHA 5TKWA 3KD1E 3EY1A 2OPPA 3TAEA 4Z4GA 1NMNA 4FWPA 3TSQA 4OLAA 4KTQA 1BIUA 1X3NA 2P1JA 4CGDA 2QA4N 2X6NA 1D9DA 2RKIA 4HWIA 1VSFA 3QINA 3V81A 3O4WA 2D0AA 1ASVA 3LALA 4ZHRA 4FPBA 3M1FA 1UA1A 3ZYYX 3ZEUB 2JWKA 1ILYA 2HMIA 3UKUB 4CHNA 4RW9A 3KK3A 1JXEA 4M3UA 4CJTA 1OVQA 4LF4K 4CJFA 3HL8A 4NLCA 3SAFA 4H5VA 5IT9O 1ATSA 3UB5A 1YTAA 3RWUA 4RG8A 3DXKB 1NM1A 1S1WA 3VEWA 4GV9A 4C8MA 2ZD1A 4BR7A 3VGMA 1NK5A 3LP1A 3VGKA 5AQZA 1WN7A 1UA0A 2IIRA 5KGXA 1OH6A 3PX4A 4IOAL 3E01A 3HM8A 3UIQA 3CD6N 4JLHA 3VQBA 3QFPA 2OTLN 2CH6A 1TKXA 4DTSA 2A1RA 3CMEN 1E4FT 1C0FA 4DUZK 3SNNA 1RNHA 3MEEA 2ZJQL 3VQAA 4FWMA 1SUQA 1VSHA 1IKYA 3OYCA 1S22A 4H0TB 1LWFA 4CEDA 4FWNA 2O8EB 4FPAA 2HHXA 2E2NA 3WNEA 3C7NB 4K8XA 2G8UA 2ETJA 3H1QA 5E26A 3SPZA 1WSHA 3U4LA 3QEPA 1WB9A 4OPHA 4B1VA 4OKEA 1NJXA 5GAEP 2YNIA 1CXUA 3VQDA 1NU0A 1KLNA 3WEEB 3NE6A 3AVCA 5JMVA 4KREA 4RW6A 2HBMA 3AVBA 2P9IA 4LF9K 1S1TA 1T05A 1NKEA 5HLFA 3OYMA 3RR8A 5CYQA 4CBWA 2E5LK 4DR5K 4B3TK 3LDPA 5GIPA 4Z4IA 3DXMB 3H6EA 4IG3A 2DFEA 3SLCA 3TABA 1S72N 1SZ2A 4CJ7A 4EAHD 3OYDA 1TAQA 3VGLA 3PSIA 2BANA 3SQ1A 4M45A 1U2VA 3OTOK 4CK2A 2XY7A 1YUWA 3HOTA 3KK1A 4CW7B 4E0DA 1BO5O 5GADP 4BRDA 3HVTA 3MK6A 3CYMA 1T6DA 2W6KA 3QEVA 3CMAN 2QXFA 4LF8K 4DCHA 3BEXA 1C0MA 1DT9A 3SCXA 2OYQA 2D4WA 1QSSA 3NF6A 3C95A 1O13A 3IUCA 4IOXA 1NGFA 3QEXA 4W5OA 4A61A 4DTXA 2E1YA 5AQXA 3DLKA 4ISEA 1NJWA 3OY9A 4CF8A 1SL2A 3WQUA 5LY3A 2O8DB 3EL2A 5E41A 4YDUC 4CJVA 4KBOA 1BHLA 3H08A 3AV9A 4W5RA 3RVCA 3GDQA 3QFUA 3WXIA 4R79A 2UYTA 1VSJA 1ZBIA 5FROA 3JSMA 1C1CA 4CJUA 3BDPA 4O8UA 3D45A 3K0SA 3AVGA 1D4XA 2CGKA 3T3FA 3U3GA 5AQTA 4CBXA 4M7YA 3TTDA 4LD0A 1S6QA 5AQHA 3L8BA 1JLCA 3ENOA 4CJPA 4H4OA 3B6PA 1KAYA 1NK9A 4DQSA 4KI6A 4ILHA 3R6MA 2PYJA 3S3MA 2G8IA 3HRGA 3O4QA 4CJEA 5LMNK 1JXBA 3AO1A 3EN9A 4LH4A 2YHYA 4O0JA 1HKCA 4E7KA 3HPHA 2ASOA 3ZSQA 4ZTFA 1WSJA 4NB4A 2QWPA 3OYIA 1HR0K 4FLZA 4AM6A 3KJVA 3ZSZA 3CJBA 4FJNA 3O9UA 3KHYA 2EWSA 2ZF5O 1LWEA 3V1OA 5FPEA 1NK4A 5DK5A 3LZIA 1J5OA 2IS3A 1RDUA 2BGGA 1VQNN 3O9TA 4CJLA 4EFHA 2KFZA 2JLEA 3DRSA 4WQ5C 4N56A 5ELZA 3NF9A 3GG4A 5CE3A 4NO7A 3OJSA 4H4MA 3ALYA 2ASMA 2HOEA 3SUQA 1NK8A 2HNZA 1W97L 2GBZA 4FWOA 3SJHA 3QB0A 1NJYA 3HOSA 4DF4A 1YIJN 4X65K 4MFBA 3SBTA 1S9EA 1YT3A 5J2QA 4KHWA 3AVIA 3G71N 3NHGA 3CC7N 4BE2A 5JICA 4B1YB 4PA1A 1LW2A 1BISA 3U6FA 4RW4A 3EZ5A 1A5WA 3CHWA 4H5RA 1EETA 2HBKA 4H5NA 5F0XA 4FJMA 2QM1A 1BQMA 3VQ8A 3R8EA 3SMPA 4BRNA 5HBMA 4H5WA 3CFRA 1KVBA 3W3DA 4QS7A 3VF4A 1KC8O 4IOCL 3AGRA 4FVUA 3HVRA 4FLYA 2HW3A 1X9SA 3A5LC 3LAMA 3O3HA 4M3RA 3SYZA 1U45A 3KWGA 2CGJA 2QWLA 1HQEA 4DTRA 1RT6A 1XC3A 4CJ5A 4FSVA 1XMQK 4FJLA 4B1ZA 3RMAA 3WNGA 4AHVA 3U9ZA 1GLFO 3QICA 2BH1A 3L0QA 4K8ZA 5FRMA 4F2RA 3ZETB 1V4SA 2VGNA 4DSIA 5HRPA 2XHBA 4N5SA 4KHNA 2I5JA 4CEFA 4GMJB 1C1BA 3TTFA 5BN9A 4OJRA 3H1VX 1WNSA 1BDGA 3MEGA 5AQMA 4AHUA 4GV6A 2O8BA 1JL1A 2NRZA 4BDZA 1XWLA 3AO2A 4FL9A 3LZJA 4FJ9A 2UUCK 3TAQA 4IJAA 1F21A 4TSXA 4B9LA 2KKZA 4KHUA 4V19S 4Q0BA 3T19A 4K43A 2P9UB 1P90A 1VQLN 2YV0X 2PFUA 1YAGA 4PL7A 3J7YP 4Z4FA 1FKOA 5BR9A 3AVNA 5AZJA 4FYDA 3T1YK 3FR0A 4Y1DA 2NRRA 3H3OB 2AP1A 2HF3A 3AARA 1GLBG 1WAJA 3OBWA 4FLTA 3KLEA 1KAXA 2VG5A 4KHQA 1KCFA 2A5XA 2GWJA 3VOVA 3RSEB 1YJWN 4DV6K 4Z94A 4F4KA 2Q2RA 4DKWA 5HOOA 3WQTA 4JS5A 4A2AA 5JS1A 1JCGA 4M3TA 1WSIA 3NH0A 1EXQA 2RHKA 2G8HA 2YNGA 3BF1A 4Z0UA 4AH9A 1BA0A 4Z4EA 3PO5A 3G10A 3C6UA 1ZC6A 3OA9A 5AQNA 4BRHA 4CBUA 2OTJN 4LY7A 3E1YA 3TTCA 2W42A 3CCRN 4E1MA 3KZBA 5M1NA 1QVGM 1NK0A 3PUFA 1J9AA 4B3RK 4DTUA 3L2QA 1JLAA 1VSDA 2GUIA 2P9SA 5AZIB 3CCSN 2A40A 2GEMA 3VEYA 4CECA 3M8QA 2HHTA 1GLCG 1YTUA 1JLFA 1RGIA 3FGUA 2E2OA 4M3WA 1N34K 3SI6A 4DV0K 5CYMA 4FJ8A 2E20A 2QWQA 4H8KA 4CIEA 1VHXA 3ID8A
chains in the Genus database with same CATH topology
4FLWA 3D0PA 4DSEA 2HMIA 2Y1IA 2E6LA 4CF0A 3KTQA 4G1QA 4RW7A 4CHNA 3OYGA 4RW9A 4CEQA 3KK3A 1D9FA 3QETA 4I9LA 1JKHA 1JXEA 1IG9A 3NGIA 1BGXT 3SPYA 2Z1JA 4CJTA 3K5NA 4B9VA 4NCBA 3IS9A 4CJFA 3HL8A 4E3SA 3TI0A 4FJIA 1YTAA 2KZZA 1W9HA 4DSKA 4RG8A 3RWUA 4BE0A 3TAPA 4DSLA 1GOBA 1QSLA 1S1WA 3RMDA 1BL3A 4C8MA 4YFUA 4MQ3A 2LSNA 2YNFA 2ZD1A 5J2MA 1WSGA 3CM5A 2IAJA 4XIUA 1NK5A 4R5PA 1ASWA 3LAKA 3LP1A 5JS2A 4DTMA 2JGUA 3NF7A 1WN7A 1UA0A 3DYAA 4OPKA 4M3UA 3V1RA 1A5XA 1J54A 4CF2A 5KGXA 3PX4A 3E01A 3OYFA 1SKSA 5HRSA 3HT3A 2QKBA 4LSNA 1EP4A 3DM2A 3KIOA 3O4NA 4RW8A 4CHYA 1O1WA 3UIQA 4JLHA 4NCAA 3VQBA 1I39A 5EU7A 1S6PA 4DSJA 1B9FA 2P5GA 4N41A 4M3XA 1TKXA 4DTSA 4B9TA 3ZT4A 2A1RA 3AO4A 1B92A 1JLGA 5I42A 2ZE2A 4N47A 1RT4A 1RNHA 3SNNA 4W5QA 1Z26A 3V1QA 1Y97A 3MEEA 1JLBA 3VQ6A 5CY4A 1QS4A 3VQAA 3OS0A 3V6DA 1IO2A 2G8WA 2OPQA 1K6YA 1SUQA 3VQ9A 2OPSA 1RT2A 1VSHA 2AJQA 3DMJA 4DQQA 1IKYA 1RBSA 3KKRA 5KTQA 3OYCA 1DLOA 3F73A 4F8RA 4FZZA 1YVUA 1LWFA 4CEDA 5DMRA 5HROA 2A1SA 3KLHA 2HHXA 1RT5A 5J2NA 3WNEA 1XI1A 4IFVA 3K2PA 3L3VA 4BACA 2E6MA 4K8XA 3ZCMA 2G8UA 2ETJA 3AA2A 1ZBFA 2Q3SA 3AVHA 4DFKA 3SPZA 3KK2A 1D8YA 4M3YA 1WSHA 1HNIA 3OS2A 3QEPA 4CJKA 3MEDA 4C8NA 4LSLA 3QNOA 4KRFA 1TGOA 5SWMA 3NBPA 1BCMA 4OKEA 3K5LA 4FLVA 3QESA 3ZSOA 4M3ZA 5D3GA 1NJXA 2HHWA 3MXIA 1GOAA 3AVJA 3ISNC 3NFAA 1VSMA 2VWJA 2YNIA 1CXUA 1FK9A 3ZT3A 4CEBA 2D0BA 4OGEA 1HQUA 1TL1A 1X1PA 3VQDA 3RTVA 1U49A 4L8RB 2X74A 1EX4A 1KLNA 4FJKA 3VA0A 4EP4A 3NE6A 1ZBUA 3AVCA 1WSEA 4CIFA 4KHSA 4KREA 2PYLA 4DLGA 4J2BA 4FXDA 5J2PA 4RW6A 3OYNA 3OYJA 3AVBA 2YKNA 1S1TA 1U4BA 1T05A 5HLFA 3CM6A 1NKEA 3F9KA 4BWJA 3OYMA 3RR8A 5CYQA 3AO3A 3VQEA 1HYZA 1CZ9A 2WONA 3C94A 3AA5X 4AHCA 3QIPA 4Z4IA 1RILA 3ASMA 4E7JA 2ITGA 4IG3A 3VQQA 2DFEA 3ZSYA 3TABA 4PWDA 2KTQA 4CERA 3VN5A 1BI4A 4ID1A 3AVFA 1DTQA 3NH2A 3OYDA 3KLIA 4KB1A 1WSFA 2X78A 4CFAA 3K5OA 1TL3A 3M8SA 1TAQA 4ZTJA 4PUOA 4FZXC 2BANA 3SQ1A 4BDPA 4M45A 1J53A 3S3OA 3T1AA 4CK2A 2XY7A 4KKOA 4FJ5A 1C0UA 2IDOA 5CZ2A 4FJHA 3P1GA 4CJRA 3KK1A 2X6SA 4CEAA 4E0DA 4FJGA 4CEOA 1KTQA 2YHAA 4FM0A 4DG1A 1RBTA 3JYTA 4LH5A 3PX6A 4CFBA 4CGGA 3HVTA 1VRTA 3SUNA 1WAFA 3HK2A 4FK4A 3CYMA 3VQCA 3OYBA 3L2RA 3S3NA 4M42A 4IBNA 3QEVA 2QXFA 3WNHA 1RBRA 5HRNA 3V9WA 1MU2A 5KRTA 1C0MA 3LANA 4AHSA 3SCXA 2OYQA 1QSSA 1RDAA 3L3UA 3NF6A 5C24A 3C95A 4B08A 1QHTA 1UWBA 3V4IA 1TK5A 4CJQA 4W5TA 3SZ2A 3DLRA 3QEXA 4W5OA 2GV9A 4CJSA 4DTXA 4QOZB 1C6VA 3OYAA 3DLKA 3OS1A 4B8CA 3OY9A 1NJWA 1EKEA 4CF8A 4BDYA 1FXXA 4FVMA 1SL2A 4J2DA 2XY5A 5E41A 3ZT1A 4DFMA 4C8LA 2OA8A 4CJVA 3HO1A 1BHLA 2HHSA 3H08A 3AV9A 4W5RA 1KFDA 4EP5A 3LPUA 1UAXA 4AHTA 4F2SA 4OVLA 4CF9A 1BQNA 1C1AA 4CHPA 4E19A 3VA3A 4DQPA 2VG7A 1T03A 1VSJA 4HCBA 1ZBIA 4KO0A 4I7FA 5FROA 3JSMA 3PO4A 1HRHA 1IKWA 1C1CA 1WLJA 5KI6A 2O4IA 3TR8A 1XHXA 1TK0A 4HUGA 4CJUA 3BDPA 3I8DA 1RDCA 1S1XA 4I9QA 3D45A 4OLBA 4EZ6A 3AVGA 2YKMA 4CEEA 2G8FA 3RRGA 3AVAA 4CHZA 3LDSA 1VSLA 3T3FA 3U3GA 3SV3A 1RDDA 2KFNA 4Y1CA 4QCLA 4E7HA 1S5JA 5HRRA 3OYEA 4LD0A 1S6QA 2IC3A 3L8BA 2OZSA 4F3OA 1JLCA 5CZ1A 1RTDA 4CJPA 4H4OA 3QIOA 3B6PA 2IOCA 3IRXA 3AA3A 3CFOA 4DQSA 1NK9A 1NK7A 2QKKA 1LAWA 2OPRA 3C6TA 3DLBA 4KI6A 4E7IA 2Y1JA 3A2FA 1U04A 3VQ4A 4E89A 1B9DA 3HPOA 3ZT2A 3S3MA 1NKBA 2PZSA 2G8IA 3VQPA 1QE1A 1T8EA 3O4QA 3DOKA 4KHYA 4CJEA 1JXBA 3AO1A 3O3GA 4LH4A 5HP1A 3OYKA 4JS4A 2YNHA 4O0JA 4E7KA 3NH1A 3HPHA 3ZSQA 4C8KA 1RTIA 4I2PA 4B9UA 4ZTFA 3SUPA 1WSJA 3OYIA 1LAVA 2BE2A 2FBXA 4CK1A 3V9SA 4NYFA 4FLZA 4N76A 2HHVA 3FFIA 3PY8A 3TAGA 2PYJA 4ELVA 2XY8A 2HVHA 1BCOA 4HVJA 2HHUA 3ULDA 1UOCA 2O4GA 2RF2A 3KJVA 4FW1A 1HNVA 4KTZA 3ZSZA 4DLEA 3KD5E 4HCCA 2DFFA 4DS4A 1SL0A 4FJNA 1LW0A 1KSPA 3LWLA 4HUEA 4DFJA 3V1OA 1LWEA 4AILC 3ZSRA 1VSKA 4I2QA 5DK5A 3K59A 3L2VA 3O3FA 1ITGA 1NK4A 3LZIA 1J5OA 2DFHA 2IS3A 4CGJA 3OYLA 2BGGA 2XY6A 3LPTA 1KFSA 3L2UA 2F96A 3NCIA 3HPGA 1BIZA 4WE1A 4CJLA 3CG7A 3K5MA 3V9UA 2JLEA 3ZT0A 4FK0A 2KFZA 3DRSA 2HNYA 3AVKA 4N56A 1XC9A 3WNFA 3DRPA 4CGFA 3KLFA 4CJ3A 3EYZA 3NF9A 4DTJA 3OJSA 3PV8A 4ICLA 4FJJA 4H4MA 4FLXA 3ALYA 4DQRA 4Z4HA 3G0ZA 3SUQA 1NK8A 2HNZA 5KGWA 1GOCA 2GBZA 3V9ZA 1L3SA 3M8RA 1CLQA 1NJYA 1C0TA 5K14A 4B3OA 1BI4B 4DF4A 4HHTA 4ID5A 4JRQA 1ZYQA 1Z25A 3ZSXA 2HHQA 1QTMA 3IG1A 2FBYA 3KKSA 4O4GA 1L3UA 1KRPA 4MFBA 1S9EA 3BGRA 2F8TA 3K58A 4DF8A 1TV6A 4PQUA 3ITHA 1U48A 1VSIA 1HYSA 1YT3A 5J2QA 3DRRA 4KHWA 3AVIA 4IFYA 3NHGA 3IAYA 2ATQA 4KV8A 1TK8A 4BE2A 4FJXA 2KW4A 4PA1A 1LW2A 1BISA 3V9XA 3U6FA 4RW4A 3EZ5A 3DOLA 1A5WA 3NF8A 3ZSWA 1EETA 3QEWA 1RBVA 1RBUA 3B6OA 4KTWA 4FJMA 4F3TA 1BQMA 3LP3A 1KVAA 3MECA 3VQ8A 3HSTB 5HBMA 3LP2A 3SJJA 1HJRA 2E4LA 4QAGA 3CFRA 1L3TA 4OLAA 4FLUA 1KVBA 4CIGA 4CF1A 4DQIA 4CFCA 5J1EA 4HUFA 4DWIA 3HVRA 4FLYA 2HW3A 1X9SA 3LAMA 3AO5A 4M3RA 3O3HA 2HVIA 1FKPA 3SYZA 4DFPA 1U45A 3SV4A 3HP9A 2BDPA 1QQCA 1HQEA 4DTRA 1RT6A 4AHRA 3HJFA 4UQGA 3RRHA 1S1UA 4CJ5A 3TARA 4FJLA 4CK3A 4KI4A 1TKTA 3RMAA 3WNGA 4AHVA 1I3AA 4DTOA 1HMVA 3I0RA 4KB0A 1JLEA 4KPYA 4CFDA 4IDKA 3AVMA 1TAUA 4K8ZA 5FRMA 4F2RA 3SUOA 2HNDA 4DSIA 4FZYA 5HRPA 4B8AB 3KLGA 2NUBA 3OVNA 4N5SA 2XHBA 3DLGA 4KHNA 2KZMA 1S1VA 2I5JA 4CEFA 4GMJB 4O0IA 4FK2A 1C1BA 1KVCA 1RTJA 1SL1A 2YHBA 3M8PA 4OJRA 5C42A 3VQ7A 3TAMA 1D5AA 3OJUA 3LWMA 1WNSA 4DTNA 2HB5A 3MEGA 1Q9YA 4AHUA 5C25A 4CHQA 4HTUA 1JL1A 4BDZA 1T7PA 3MXMA 1RT1A 1XWLA 3AO2A 2B4JA 3LZJA 4FJ9A 1CXQA 3U3YA 1LV5A 2WOMA 1XHZA 3MAQA 3TAFA 3NGYA 1F21A 3TAQA 4TSXA 4FCYA 4CGHA 4B9LA 3SQ0A 2FC0A 4KHUA 4OGCA 1REVA 3T19A 4Q0BA 1G15A 3CFPA 2PY5A 2QK9A 4E1NA 4EZ9A 1ZBHA 3PX0A 1W0HA 1Q8IA 4KAZA 3DI6A 3HYFA 4CESA 4CGIA 3THVA 3AA4A 2YV0X 4W5NA 3K57A 2P5OA 4B9MA 4DS5A 2DTUA 4Z4FA 1FKOA 1SKRA 3AVNA 3VQ5A 4FJ7A 2KQ2A 3QNNA 3RR7A 4PY5A 4FYDA 4IG0A 4KFBA 2Z1GA 4Y1DA 3OYHA 3HM9A 1N5YA 1IKVA 1WAJA 2R7YA 2Z1HA 4FLTA 4OKKA 4FW2A 3CQ8A 3KLEA 1NKCA 3QERA 4B9SA 2D0CA 2VG5A 2XO7A 1IH7A 3QEIA 1RDBA 1KCFA 4KHQA 2B6AA 2FBVA 2VWKA 3P83D 4M41A 4DTPA 5T7BA 4YNQA 4F4KA 5SZTA 1VK0A 4CJ4A 3S9HA 1S9GA 4NCGA 4JS5A 4JRPA 5JS1A 1IKXA 1KLMA 2RPIA 3L2WA 3NDKA 4ELUA 1DTTA 4M3TA 4CHOA 3P5JA 4J2AA 4IKFA 1RTHA 1WSIA 2EX3A 4CJWA 1N6QA 1Q9XA 1JL2A 4C8OA 3NH0A 1EXQA 1VSEA 2P51A 2YNGA 4Z0UA 3SQ2A 3RMBA 1X9MA 1NOYA 2G8HA 2D5RA 4AH9A 5KRSA 3DLHA 3QLHA 3PO5A 3G10A 4Z4EA 3C6UA 4GVMA 1A5VA 4CEZA 1NK6A 1HPZA 4BE1A 2F8SA 1HYVA 2IGIA 3I0SA 3TANA 2G8VA 3TWHA 4LY7A 4E7LA 4J2EA 5I3UA 4DU1A 2W42A 2DY4A 1ZBLA 4GW6A 2B5JA 1JLQA 1RT3A 1NJZA 1SKWA 4CE9A 4NYNA 1TVRA 4DMNA 1L5UA 2ZQBA 4CCHA 1LWCA 4E1MA 4FM2A 5FRNA 1CZBA 4BWMA 3NGZA 1VRUA 3AVLA 4DSFA 1X9WA 4O5BA 4ELTA 2EHGA 3DLEA 3QO9A 1NK0A 2OZMA 3PUFA 1J9AA 1R0AA 1SV5A 4DTUA 4Q5VA 1RCHA 1TKZA 1JLAA 1VSDA 2GUIA 3LP0A 3L2QA 2XRIA 4OPJA 3KD1E 4FM1A 3EY1A 2OPPA 3TAEA 4Z4GA 4CECA 3M8QA 2G8KA 2HHTA 4Z4CA 5FDLA 1TKDA 4KTQA 3HP6A 1ASUA 1BIUA 4OKJA 2FBTA 4CGDA 2P1JA 3NAEA 1L3VA 1YTUA 2VG6A 3ZSVA 2X6NA 1JLFA 4DU3A 2RKIA 3SQ4A 1U47A 1D9DA 1VSFA 3MXJA 3QINA 4O44A 2RN2A 3V81A 4M3WA 2D0AA 2Z1IA 3HXMA 1ASVA 4O55A 3SI6A 1NOZA 3LALA 5CYMA 1RT7A 4ZHRA 4DU4A 4FJ8A 4H8KA 3RMCA 1UA1A 4CIEA 4B9NA 1QSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLW A;  3D0P A;  4DSE A;  2HMI A;  2Y1I A;  2E6L A;  4CF0 A;  3KTQ A;  4G1Q A;  4RW7 A;  4CHN A;  3OYG A;  4RW9 A;  4CEQ A;  3KK3 A;  1D9F A;  3QET A;  4I9L A;  1JKH A;  1JXE A;  1IG9 A;  3NGI A;  1BGX T;  3SPY A;  2Z1J A;  4CJT A;  3K5N A;  4B9V A;  4NCB A;  3IS9 A;  4CJF A;  3HL8 A;  4E3S A;  3TI0 A;  4FJI A;  1YTA A;  2KZZ A;  1W9H A;  4DSK A;  4RG8 A;  3RWU A;  4BE0 A;  3TAP A;  4DSL A;  1GOB A;  1QSL A;  1S1W A;  3RMD A;  1BL3 A;  4C8M A;  4YFU A;  4MQ3 A;  2LSN A;  2YNF A;  2ZD1 A;  5J2M A;  1WSG A;  3CM5 A;  2IAJ A;  4XIU A;  1NK5 A;  4R5P A;  1ASW A;  3LAK A;  3LP1 A;  5JS2 A;  4DTM A;  2JGU A;  3NF7 A;  1WN7 A;  1UA0 A;  3DYA A;  4OPK A;  4M3U A;  3V1R A;  1A5X A;  1J54 A;  4CF2 A;  5KGX A;  3PX4 A;  3E01 A;  3OYF A;  1SKS A;  5HRS A;  3HT3 A;  2QKB A;  4LSN A;  1EP4 A;  3DM2 A;  3KIO A;  3O4N A;  4RW8 A;  4CHY A;  1O1W A;  3UIQ A;  4JLH A;  4NCA A;  3VQB A;  1I39 A;  5EU7 A;  1S6P A;  4DSJ A;  1B9F A;  2P5G A;  4N41 A;  4M3X A;  1TKX A;  4DTS A;  4B9T A;  3ZT4 A;  2A1R A;  3AO4 A;  1B92 A;  1JLG A;  5I42 A;  2ZE2 A;  4N47 A;  1RT4 A;  1RNH A;  3SNN A;  4W5Q A;  1Z26 A;  3V1Q A;  1Y97 A;  3MEE A;  1JLB A;  3VQ6 A;  5CY4 A;  1QS4 A;  3VQA A;  3OS0 A;  3V6D A;  1IO2 A;  2G8W A;  2OPQ A;  1K6Y A;  1SUQ A;  3VQ9 A;  2OPS A;  1RT2 A;  1VSH A;  2AJQ A;  3DMJ A;  4DQQ A;  1IKY A;  1RBS A;  3KKR A;  5KTQ A;  3OYC A;  1DLO A;  3F73 A;  4F8R A;  4FZZ A;  1YVU A;  1LWF A;  4CED A;  5DMR A;  5HRO A;  2A1S A;  3KLH A;  2HHX A;  1RT5 A;  5J2N A;  3WNE A;  1XI1 A;  4IFV A;  3K2P A;  3L3V A;  4BAC A;  2E6M A;  4K8X A;  3ZCM A;  2G8U A;  2ETJ A;  3AA2 A;  1ZBF A;  2Q3S A;  3AVH A;  4DFK A;  3SPZ A;  3KK2 A;  1D8Y A;  4M3Y A;  1WSH A;  1HNI A;  3OS2 A;  3QEP A;  4CJK A;  3MED A;  4C8N A;  4LSL A;  3QNO A;  4KRF A;  1TGO A;  5SWM A;  3NBP A;  1BCM A;  4OKE A;  3K5L A;  4FLV A;  3QES A;  3ZSO A;  4M3Z A;  5D3G A;  1NJX A;  2HHW A;  3MXI A;  1GOA A;  3AVJ A;  3ISN C;  3NFA A;  1VSM A;  2VWJ A;  2YNI A;  1CXU A;  1FK9 A;  3ZT3 A;  4CEB A;  2D0B A;  4OGE A;  1HQU A;  1TL1 A;  1X1P A;  3VQD A;  3RTV A;  1U49 A;  4L8R B;  2X74 A;  1EX4 A;  1KLN A;  4FJK A;  3VA0 A;  4EP4 A;  3NE6 A;  1ZBU A;  3AVC A;  1WSE A;  4CIF A;  4KHS A;  4KRE A;  2PYL A;  4DLG A;  4J2B A;  4FXD A;  5J2P A;  4RW6 A;  3OYN A;  3OYJ A;  3AVB A;  2YKN A;  1S1T A;  1U4B A;  1T05 A;  5HLF A;  3CM6 A;  1NKE A;  3F9K A;  4BWJ A;  3OYM A;  3RR8 A;  5CYQ A;  3AO3 A;  3VQE A;  1HYZ A;  1CZ9 A;  2WON A;  3C94 A;  3AA5 X;  4AHC A;  3QIP A;  4Z4I A;  1RIL A;  3ASM A;  4E7J A;  2ITG A;  4IG3 A;  3VQQ A;  2DFE A;  3ZSY A;  3TAB A;  4PWD A;  2KTQ A;  4CER A;  3VN5 A;  1BI4 A;  4ID1 A;  3AVF A;  1DTQ A;  3NH2 A;  3OYD A;  3KLI A;  4KB1 A;  1WSF A;  2X78 A;  4CFA A;  3K5O A;  1TL3 A;  3M8S A;  1TAQ A;  4ZTJ A;  4PUO A;  4FZX C;  2BAN A;  3SQ1 A;  4BDP A;  4M45 A;  1J53 A;  3S3O A;  3T1A A;  4CK2 A;  2XY7 A;  4KKO A;  4FJ5 A;  1C0U A;  2IDO A;  5CZ2 A;  4FJH A;  3P1G A;  4CJR A;  3KK1 A;  2X6S A;  4CEA A;  4E0D A;  4FJG A;  4CEO A;  1KTQ A;  2YHA A;  4FM0 A;  4DG1 A;  1RBT A;  3JYT A;  4LH5 A;  3PX6 A;  4CFB A;  4CGG A;  3HVT A;  1VRT A;  3SUN A;  1WAF A;  3HK2 A;  4FK4 A;  3CYM A;  3VQC A;  3OYB A;  3L2R A;  3S3N A;  4M42 A;  4IBN A;  3QEV A;  2QXF A;  3WNH A;  1RBR A;  5HRN A;  3V9W A;  1MU2 A;  5KRT A;  1C0M A;  3LAN A;  4AHS A;  3SCX A;  2OYQ A;  1QSS A;  1RDA A;  3L3U A;  3NF6 A;  5C24 A;  3C95 A;  4B08 A;  1QHT A;  1UWB A;  3V4I A;  1TK5 A;  4CJQ A;  4W5T A;  3SZ2 A;  3DLR A;  3QEX A;  4W5O A;  2GV9 A;  4CJS A;  4DTX A;  4QOZ B;  1C6V A;  3OYA A;  3DLK A;  3OS1 A;  4B8C A;  3OY9 A;  1NJW A;  1EKE A;  4CF8 A;  4BDY A;  1FXX A;  4FVM A;  1SL2 A;  4J2D A;  2XY5 A;  5E41 A;  3ZT1 A;  4DFM A;  4C8L A;  2OA8 A;  4CJV A;  3HO1 A;  1BHL A;  2HHS A;  3H08 A;  3AV9 A;  4W5R A;  1KFD A;  4EP5 A;  3LPU A;  1UAX A;  4AHT A;  4F2S A;  4OVL A;  4CF9 A;  1BQN A;  1C1A A;  4CHP A;  4E19 A;  3VA3 A;  4DQP A;  2VG7 A;  1T03 A;  1VSJ A;  4HCB A;  1ZBI A;  4KO0 A;  4I7F A;  5FRO A;  3JSM A;  3PO4 A;  1HRH A;  1IKW A;  1C1C A;  1WLJ A;  5KI6 A;  2O4I A;  3TR8 A;  1XHX A;  1TK0 A;  4HUG A;  4CJU A;  3BDP A;  3I8D A;  1RDC A;  1S1X A;  4I9Q A;  3D45 A;  4OLB A;  4EZ6 A;  3AVG A;  2YKM A;  4CEE A;  2G8F A;  3RRG A;  3AVA A;  4CHZ A;  3LDS A;  1VSL A;  3T3F A;  3U3G A;  3SV3 A;  1RDD A;  2KFN A;  4Y1C A;  4QCL A;  4E7H A;  1S5J A;  5HRR A;  3OYE A;  4LD0 A;  1S6Q A;  2IC3 A;  3L8B A;  2OZS A;  4F3O A;  1JLC A;  5CZ1 A;  1RTD A;  4CJP A;  4H4O A;  3QIO A;  3B6P A;  2IOC A;  3IRX A;  3AA3 A;  3CFO A;  4DQS A;  1NK9 A;  1NK7 A;  2QKK A;  1LAW A;  2OPR A;  3C6T A;  3DLB A;  4KI6 A;  4E7I A;  2Y1J A;  3A2F A;  1U04 A;  3VQ4 A;  4E89 A;  1B9D A;  3HPO A;  3ZT2 A;  3S3M A;  1NKB A;  2PZS A;  2G8I A;  3VQP A;  1QE1 A;  1T8E A;  3O4Q A;  3DOK A;  4KHY A;  4CJE A;  1JXB A;  3AO1 A;  3O3G A;  4LH4 A;  5HP1 A;  3OYK A;  4JS4 A;  2YNH A;  4O0J A;  4E7K A;  3NH1 A;  3HPH A;  3ZSQ A;  4C8K A;  1RTI A;  4I2P A;  4B9U A;  4ZTF A;  3SUP A;  1WSJ A;  3OYI A;  1LAV A;  2BE2 A;  2FBX A;  4CK1 A;  3V9S A;  4NYF A;  4FLZ A;  4N76 A;  2HHV A;  3FFI A;  3PY8 A;  3TAG A;  2PYJ A;  4ELV A;  2XY8 A;  2HVH A;  1BCO A;  4HVJ A;  2HHU A;  3ULD A;  1UOC A;  2O4G A;  2RF2 A;  3KJV A;  4FW1 A;  1HNV A;  4KTZ A;  3ZSZ A;  4DLE A;  3KD5 E;  4HCC A;  2DFF A;  4DS4 A;  1SL0 A;  4FJN A;  1LW0 A;  1KSP A;  3LWL A;  4HUE A;  4DFJ A;  3V1O A;  1LWE A;  4AIL C;  3ZSR A;  1VSK A;  4I2Q A;  5DK5 A;  3K59 A;  3L2V A;  3O3F A;  1ITG A;  1NK4 A;  3LZI A;  1J5O A;  2DFH A;  2IS3 A;  4CGJ A;  3OYL A;  2BGG A;  2XY6 A;  3LPT A;  1KFS A;  3L2U A;  2F96 A;  3NCI A;  3HPG A;  1BIZ A;  4WE1 A;  4CJL A;  3CG7 A;  3K5M A;  3V9U A;  2JLE A;  3ZT0 A;  4FK0 A;  2KFZ A;  3DRS A;  2HNY A;  3AVK A;  4N56 A;  1XC9 A;  3WNF A;  3DRP A;  4CGF A;  3KLF A;  4CJ3 A;  3EYZ A;  3NF9 A;  4DTJ A;  3OJS A;  3PV8 A;  4ICL A;  4FJJ A;  4H4M A;  4FLX A;  3ALY A;  4DQR A;  4Z4H A;  3G0Z A;  3SUQ A;  1NK8 A;  2HNZ A;  5KGW A;  1GOC A;  2GBZ A;  3V9Z A;  1L3S A;  3M8R A;  1CLQ A;  1NJY A;  1C0T A;  5K14 A;  4B3O A;  1BI4 B;  4DF4 A;  4HHT A;  4ID5 A;  4JRQ A;  1ZYQ A;  1Z25 A;  3ZSX A;  2HHQ A;  1QTM A;  3IG1 A;  2FBY A;  3KKS A;  4O4G A;  1L3U A;  1KRP A;  4MFB A;  1S9E A;  3BGR A;  2F8T A;  3K58 A;  4DF8 A;  1TV6 A;  4PQU A;  3ITH A;  1U48 A;  1VSI A;  1HYS A;  1YT3 A;  5J2Q A;  3DRR A;  4KHW A;  3AVI A;  4IFY A;  3NHG A;  3IAY A;  2ATQ A;  4KV8 A;  1TK8 A;  4BE2 A;  4FJX A;  2KW4 A;  4PA1 A;  1LW2 A;  1BIS A;  3V9X A;  3U6F A;  4RW4 A;  3EZ5 A;  3DOL A;  1A5W A;  3NF8 A;  3ZSW A;  1EET A;  3QEW A;  1RBV A;  1RBU A;  3B6O A;  4KTW A;  4FJM A;  4F3T A;  1BQM A;  3LP3 A;  1KVA A;  3MEC A;  3VQ8 A;  3HST B;  5HBM A;  3LP2 A;  3SJJ A;  1HJR A;  2E4L A;  4QAG A;  3CFR A;  1L3T A;  4OLA A;  4FLU A;  1KVB A;  4CIG A;  4CF1 A;  4DQI A;  4CFC A;  5J1E A;  4HUF A;  4DWI A;  3HVR A;  4FLY A;  2HW3 A;  1X9S A;  3LAM A;  3AO5 A;  4M3R A;  3O3H A;  2HVI A;  1FKP A;  3SYZ A;  4DFP A;  1U45 A;  3SV4 A;  3HP9 A;  2BDP A;  1QQC A;  1HQE A;  4DTR A;  1RT6 A;  4AHR A;  3HJF A;  4UQG A;  3RRH A;  1S1U A;  4CJ5 A;  3TAR A;  4FJL A;  4CK3 A;  4KI4 A;  1TKT A;  3RMA A;  3WNG A;  4AHV A;  1I3A A;  4DTO A;  1HMV A;  3I0R A;  4KB0 A;  1JLE A;  4KPY A;  4CFD A;  4IDK A;  3AVM A;  1TAU A;  4K8Z A;  5FRM A;  4F2R A;  3SUO A;  2HND A;  4DSI A;  4FZY A;  5HRP A;  4B8A B;  3KLG A;  2NUB A;  3OVN A;  4N5S A;  2XHB A;  3DLG A;  4KHN A;  2KZM A;  1S1V A;  2I5J A;  4CEF A;  4GMJ B;  4O0I A;  4FK2 A;  1C1B A;  1KVC A;  1RTJ A;  1SL1 A;  2YHB A;  3M8P A;  4OJR A;  5C42 A;  3VQ7 A;  3TAM A;  1D5A A;  3OJU A;  3LWM A;  1WNS A;  4DTN A;  2HB5 A;  3MEG A;  1Q9Y A;  4AHU A;  5C25 A;  4CHQ A;  4HTU A;  1JL1 A;  4BDZ A;  1T7P A;  3MXM A;  1RT1 A;  1XWL A;  3AO2 A;  2B4J A;  3LZJ A;  4FJ9 A;  1CXQ A;  3U3Y A;  1LV5 A;  2WOM A;  1XHZ A;  3MAQ A;  3TAF A;  3NGY A;  1F21 A;  3TAQ A;  4TSX A;  4FCY A;  4CGH A;  4B9L A;  3SQ0 A;  2FC0 A;  4KHU A;  4OGC A;  1REV A;  3T19 A;  4Q0B A;  1G15 A;  3CFP A;  2PY5 A;  2QK9 A;  4E1N A;  4EZ9 A;  1ZBH A;  3PX0 A;  1W0H A;  1Q8I A;  4KAZ A;  3DI6 A;  3HYF A;  4CES A;  4CGI A;  3THV A;  3AA4 A;  2YV0 X;  4W5N A;  3K57 A;  2P5O A;  4B9M A;  4DS5 A;  2DTU A;  4Z4F A;  1FKO A;  1SKR A;  3AVN A;  3VQ5 A;  4FJ7 A;  2KQ2 A;  3QNN A;  3RR7 A;  4PY5 A;  4FYD A;  4IG0 A;  4KFB A;  2Z1G A;  4Y1D A;  3OYH A;  3HM9 A;  1N5Y A;  1IKV A;  1WAJ A;  2R7Y A;  2Z1H A;  4FLT A;  4OKK A;  4FW2 A;  3CQ8 A;  3KLE A;  1NKC A;  3QER A;  4B9S A;  2D0C A;  2VG5 A;  2XO7 A;  1IH7 A;  3QEI A;  1RDB A;  1KCF A;  4KHQ A;  2B6A A;  2FBV A;  2VWK A;  3P83 D;  4M41 A;  4DTP A;  5T7B A;  4YNQ A;  4F4K A;  5SZT A;  1VK0 A;  4CJ4 A;  3S9H A;  1S9G A;  4NCG A;  4JS5 A;  4JRP A;  5JS1 A;  1IKX A;  1KLM A;  2RPI A;  3L2W A;  3NDK A;  4ELU A;  1DTT A;  4M3T A;  4CHO A;  3P5J A;  4J2A A;  4IKF A;  1RTH A;  1WSI A;  2EX3 A;  4CJW A;  1N6Q A;  1Q9X A;  1JL2 A;  4C8O A;  3NH0 A;  1EXQ A;  1VSE A;  2P51 A;  2YNG A;  4Z0U A;  3SQ2 A;  3RMB A;  1X9M A;  1NOY A;  2G8H A;  2D5R A;  4AH9 A;  5KRS A;  3DLH A;  3QLH A;  3PO5 A;  3G10 A;  4Z4E A;  3C6U A;  4GVM A;  1A5V A;  4CEZ A;  1NK6 A;  1HPZ A;  4BE1 A;  2F8S A;  1HYV A;  2IGI A;  3I0S A;  3TAN A;  2G8V A;  3TWH A;  4LY7 A;  4E7L A;  4J2E A;  5I3U A;  4DU1 A;  2W42 A;  2DY4 A;  1ZBL A;  4GW6 A;  2B5J A;  1JLQ A;  1RT3 A;  1NJZ A;  1SKW A;  4CE9 A;  4NYN A;  1TVR A;  4DMN A;  1L5U A;  2ZQB A;  4CCH A;  1LWC A;  4E1M A;  4FM2 A;  5FRN A;  1CZB A;  4BWM A;  3NGZ A;  1VRU A;  3AVL A;  4DSF A;  1X9W A;  4O5B A;  4ELT A;  2EHG A;  3DLE A;  3QO9 A;  1NK0 A;  2OZM A;  3PUF A;  1J9A A;  1R0A A;  1SV5 A;  4DTU A;  4Q5V A;  1RCH A;  1TKZ A;  1JLA A;  1VSD A;  2GUI A;  3LP0 A;  3L2Q A;  2XRI A;  4OPJ A;  3KD1 E;  4FM1 A;  3EY1 A;  2OPP A;  3TAE A;  4Z4G A;  4CEC A;  3M8Q A;  2G8K A;  2HHT A;  4Z4C A;  5FDL A;  1TKD A;  4KTQ A;  3HP6 A;  1ASU A;  1BIU A;  4OKJ A;  2FBT A;  4CGD A;  2P1J A;  3NAE A;  1L3V A;  1YTU A;  2VG6 A;  3ZSV A;  2X6N A;  1JLF A;  4DU3 A;  2RKI A;  3SQ4 A;  1U47 A;  1D9D A;  1VSF A;  3MXJ A;  3QIN A;  4O44 A;  2RN2 A;  3V81 A;  4M3W A;  2D0A A;  2Z1I A;  3HXM A;  1ASV A;  4O55 A;  3SI6 A;  1NOZ A;  3LAL A;  5CYM A;  1RT7 A;  4ZHR A;  4DU4 A;  4FJ8 A;  4H8K A;  3RMC A;  1UA1 A;  4CIE A;  4B9N A;  1QSY A; 
#chains in the Genus database with same CATH topology
 5BRE A;  4FLW A;  1XMO K;  3D0P A;  2Y1I A;  2O8C A;  4CF0 A;  1D9F A;  1QQN A;  1JKH A;  3NGI A;  1BGX T;  3SPY A;  3K5N A;  4YY3 K;  4B9V A;  4JKA A;  3TI0 A;  4DSK A;  3TAP A;  3R1X A;  4JD2 A;  5BPL A;  4DR7 K;  2NRW A;  4MQ3 A;  1R59 O;  4WFA L;  2ZGZ A;  4JK7 A;  3O9R A;  3NF7 A;  1N32 K;  2WC9 A;  3V1R A;  1A5X A;  2J4R A;  4OX9 K;  3L4Q A;  3U9D A;  1SKS A;  4EHU A;  3SBG A;  5HRS A;  4LSN A;  3L6Q A;  3DM2 A;  3ZX2 A;  1O1W A;  4NCA A;  4N41 A;  1I39 A;  4DSJ A;  4WQ4 C;  4IDH A;  1B92 A;  2O8B B;  1RDW X;  3WXL A;  4DR1 K;  5JLH A;  3V1Q A;  1JLB A;  3VQ6 A;  2OPQ A;  2OPS A;  5C10 A;  1RBS A;  5AJ3 K;  3KKR A;  4F8R A;  4X62 K;  5EX5 A;  5TKY A;  4XEI A;  3CJA A;  3J7Z O;  3K2P A;  1XI1 A;  3B8A X;  3ZCM A;  2P9P B;  4M63 C;  2QWO A;  1ZBF A;  3AVH A;  3KK2 A;  1HNI A;  5AZJ B;  3MED A;  5DM6 L;  3O1B A;  1EO1 A;  3QES A;  3K5L A;  4ILJ A;  4M3Z A;  2HHW A;  3ISN C;  3NFA A;  2VWJ A;  4BRM A;  4UY8 O;  1FK9 A;  3ZT3 A;  4CEB A;  3RTV A;  4L8R B;  1TL1 A;  1X1P A;  1U49 A;  1EX4 A;  4EP4 A;  5FPD A;  4H0V B;  4KHS A;  2PYL A;  4FXD A;  1HLU A;  2E8A A;  1K8K A;  2IVP A;  5BRH A;  3A0I X;  3CM6 A;  1U4B A;  3AO3 A;  1FW6 A;  1JCE A;  2I7N A;  3KVG A;  2UXC K;  3ASM A;  4E7J A;  3CCU N;  4PWD A;  2KTQ A;  2P9K B;  4CER A;  3VN5 A;  3AAQ A;  4FWL A;  1XNQ K;  2HMP A;  4CI6 A;  1M90 O;  1CZA N;  3NH2 A;  3UE5 A;  3K5O A;  2A3Z A;  1IJJ A;  3M8S A;  4JAX A;  4ZTJ A;  3J7A P;  4FZX C;  4BDP A;  5AQF A;  4DR4 K;  1BA1 A;  4FJ5 A;  1C0U A;  5CZ2 A;  3P1G A;  5GAG P;  4ISF A;  2YHA A;  4DG1 A;  1RBT A;  1YHQ N;  4LH5 A;  3TU5 A;  4CFB A;  4CGG A;  4JK8 A;  4B1U B;  3VF2 A;  4IBN A;  2ZGY A;  1RBR A;  2FSN A;  4WQ4 A;  3NMU A;  1X3M A;  4W5T A;  3CCV N;  4NLB A;  4JNE A;  1GLJ O;  2GV9 A;  4QOZ B;  1C6V A;  4BDY A;  4J2D A;  1FXX A;  4DR6 K;  1KFD A;  4EP5 A;  3LPU A;  1UAX A;  4AHT A;  4OVL A;  1BQN A;  1C1A A;  5AQL A;  3VA3 A;  1OH8 A;  4H0Y B;  2O4I A;  1IKW A;  3P31 A;  4IWV A;  3THW B;  1XHX A;  1TK0 A;  4HUG A;  4CZL A;  3E9L A;  4QS9 A;  2G8F A;  3SV3 A;  4Y1C A;  4QCL A;  4E7H A;  4FOI A;  5HRR A;  2NRT A;  1RTD A;  4GVE A;  3ID6 A;  2PAV A;  3QIO A;  1DEJ A;  2IOC A;  4O5F A;  2QKK A;  3E66 A;  1LAW A;  3BUZ B;  5AQI A;  3VEZ A;  1Q7Y O;  1MDU B;  4E7I A;  4E89 A;  3IFR A;  1B9D A;  3HPO A;  3ZT2 A;  1NKB A;  1S3X A;  2D0P A;  1T8E A;  1IBM K;  4KHY A;  4JKH A;  3OYK A;  2YNH A;  3NH1 A;  4C8K A;  4QS8 A;  3MMV A;  4NYF A;  3PY8 A;  4ELV A;  2XY8 A;  2HVH A;  1BCO A;  5AQS A;  5AQJ A;  2ASP A;  3LDL A;  2RF2 A;  1NGH A;  4DV4 K;  1HNV A;  4DLE A;  3KD5 E;  1SL0 A;  2QWN A;  3VER A;  3LWL A;  4HUE A;  5C15 A;  4IEE A;  4JHD B;  4DR2 K;  3K59 A;  1VSK A;  2F9W A;  3O3F A;  3VET A;  3P39 A;  2DFH A;  4GKK K;  1TUU A;  3LPT A;  2F96 A;  4FK0 A;  4WE1 A;  3ZT0 A;  3AVK A;  1K8K B;  1XUP O;  3KLF A;  3DRP A;  3CC2 N;  1QHA A;  4ICL A;  4FJJ A;  5KGW A;  1MA9 B;  1ZXO A;  1C0T A;  5K14 A;  5FLX O;  2OAN A;  3FZH A;  3MN5 A;  5MLC Q;  4KH5 A;  1ZYQ A;  1Z25 A;  3D2F A;  3ZSX A;  2O8F A;  1QTM A;  4O4G A;  2FBY A;  4B1X B;  4O8K A;  3BGR A;  2F8T A;  4FO0 A;  1TV6 A;  4PQU A;  3DRR A;  4KV8 A;  3F9M A;  2I7P A;  4BRA A;  4JI6 K;  3BZK A;  3O9Q A;  2GX9 A;  3NVK A;  1NBW A;  5EXW A;  3JAM O;  3QEW A;  3AY9 A;  1RBU A;  4I6M A;  4BGA A;  4LF6 K;  3HST B;  2HST A;  3CCQ N;  4QAG A;  1L3T A;  1BWF O;  4CIG A;  4CF1 A;  4HUF A;  3UKR A;  2BTF A;  1FKP A;  2HVI A;  1IG8 A;  1E4G T;  1KAZ A;  3SV4 A;  2WBN A;  1QQM A;  3J8A A;  2NRX A;  1QZ5 A;  3I0R A;  3ZX3 A;  4KB0 A;  4JI8 K;  1NGA A;  4CFD A;  3AVM A;  3O08 A;  1TAU A;  4G9Z A;  3SUO A;  2NUB A;  3OVN A;  4CD3 A;  1XQS C;  3NVM A;  3JXU A;  1OH7 A;  4BG9 A;  3M8P A;  2IVN A;  3TAM A;  4DTN A;  4BQL A;  2KHO A;  1Q9Y A;  3W0L A;  5C25 A;  3IDH A;  1HNZ K;  1CXQ A;  2WOM A;  3TAF A;  3I33 A;  5BPN A;  4FCY A;  1K8A O;  3SQ0 A;  1VQP N;  4OGC A;  2QK9 A;  4E1N A;  4EZ9 A;  4FOE A;  4KAZ A;  3HYF A;  5EY4 A;  4CGI A;  4W5N A;  3K57 A;  2DTU A;  2WTU A;  2E2P A;  3VQ5 A;  3QNN A;  2KLA A;  3QBW A;  4IG0 A;  5AFU A;  5BN8 A;  5LJW A;  2Z1G A;  4KH4 A;  1Z05 A;  3GBT A;  3CQ8 A;  3QER A;  5JVH L;  2D0C A;  4RCH A;  3VMF B;  4DTP A;  4MO4 A;  1ATN A;  1S9G A;  4NCG A;  4M7X A;  5AQQ A;  1J5E K;  1KLM A;  2E2Q A;  1HNX K;  4CHO A;  3G4S N;  1RTH A;  3AGK A;  2EX3 A;  3O1W A;  1N6Q A;  2P9I B;  2QTD A;  2UUB K;  2ZJR L;  3SQ2 A;  2P51 A;  1X9M A;  4FWQ A;  5KRS A;  3QLH A;  4H5T A;  2FF3 B;  1W7A A;  1DGK N;  3LL3 A;  3MN9 A;  4CEZ A;  2IGI A;  3I0S A;  3TAN A;  3TWH A;  4YDU A;  4E7L A;  1NJZ A;  4GW6 A;  2B5J A;  1JLQ A;  2E88 A;  4NYN A;  1IV0 A;  4IFE A;  4XH1 A;  4DMN A;  2ZQB A;  4JKF A;  1LWC A;  4FM2 A;  4H0O A;  3CCL N;  2FSK A;  1U2V B;  4H03 B;  3AVL A;  4BC2 A;  2A41 A;  1MWM A;  4O5B A;  4ELT A;  3QO9 A;  2A42 A;  3I56 N;  3D2F B;  3FLC O;  2O8F B;  3LP0 A;  2BUP A;  1WBD A;  4OPJ A;  4FM1 A;  3C6A A;  2ITM A;  5C2F A;  5FDL A;  2V52 B;  1TKD A;  4CZG A;  3HP6 A;  4JI5 K;  2FBT A;  3NAE A;  2VG6 A;  3ZSV A;  1U47 A;  4JKG A;  1ATR A;  4K0K K;  4O44 A;  2RN2 A;  1KQS M;  2Z1I A;  3CER A;  1NJI O;  1NOZ A;  4DU4 A;  5I9E B;  3DJC A;  4B9N A;  3FZL A;  4DSE A;  4DV5 K;  4EIA A;  4LFA K;  1NWK A;  4RW7 A;  3OYG A;  3ZLJ A;  4NCB A;  2Z1J A;  3UKR B;  4YOW A;  4E3S A;  4BR4 A;  4FJI A;  2VWB A;  2KZZ A;  3G25 A;  4BE0 A;  4DSL A;  1NGD A;  1GOB A;  1QSL A;  3RMD A;  1BL3 A;  2QWM A;  3MX5 A;  2LSN A;  1NG9 A;  1NGJ A;  3THY A;  1M1K O;  1WSG A;  1EWR A;  1I94 K;  4JI1 K;  4R5P A;  1ASW A;  5JS2 A;  4BRC A;  3DYA A;  2Q0U A;  4OPK A;  3PIO L;  3PLA A;  2W6L A;  4CHY A;  1YVN A;  1Q86 O;  1S6P A;  4WQ5 A;  3SMS A;  4B9T A;  3ZT4 A;  1JLG A;  4N47 A;  1WUA A;  1Z26 A;  1Y97 A;  5CY4 A;  1QS4 A;  4Y0W A;  3ULE A;  3OS0 A;  2G8W A;  4FWS A;  2AJQ A;  3VQ9 A;  1RT2 A;  3DMJ A;  3KWI A;  2NLX A;  1DLO A;  2YCH A;  3U8X A;  4FZZ A;  5DMR A;  3KLH A;  1RT5 A;  3CQX A;  5BRF A;  5J2N A;  3IMX A;  1Z6R A;  4IFV A;  4BAC A;  2FSJ A;  5KQ8 A;  5DM7 L;  1LCU A;  3DWL A;  3M5R A;  4DFK A;  3H3N O;  1D8Y A;  4M3Y A;  2V7Z A;  4YOU A;  3OS2 A;  4LSL A;  4KRF A;  1TGO A;  3NBP A;  4FLV A;  3DLL L;  3ZSO A;  5D3G A;  4CZI A;  1GOA A;  2IVO A;  1VSM A;  4LC9 B;  1NGI A;  3BZC A;  4OGE A;  1HQU A;  4MLH A;  4BRG A;  1ZBU A;  4CIF A;  1WSE A;  4DLG A;  4J2B A;  3OYN A;  3OYJ A;  4JI2 K;  4XH4 A;  1VQO N;  3F9K A;  4BWJ A;  4A62 A;  3VQE A;  1HYZ A;  3WT0 A;  2FXU A;  2WON A;  3AA5 X;  4AHC A;  3QIP A;  5M1O A;  3VEX A;  4DR3 K;  3ZSY A;  1VQ5 N;  3VQQ A;  4PKH A;  4ID1 A;  4JK9 A;  4KH6 A;  1DTQ A;  4KB1 A;  3VES A;  2X78 A;  4PUO A;  2Q1N A;  1JCF A;  2IDO A;  3D2E A;  1HPM A;  4CJR A;  4CEA A;  4FJG A;  1VQ4 N;  5EVZ A;  3PX6 A;  1VRT A;  1WAF A;  3J80 O;  3HK2 A;  4FK4 A;  3VQC A;  3L2R A;  4M42 A;  5AQP A;  3EEQ A;  4NXM K;  3WNH A;  5FPN A;  2QI2 A;  5HRN A;  3P38 A;  3K9K A;  3LAN A;  4JKG B;  1RDA A;  3L3U A;  1Q81 O;  5EOY A;  1QHT A;  3ZEU A;  3V4I A;  3DLR A;  2NZT A;  3HTV A;  2QWR A;  3BF3 A;  4CD1 A;  4B8C A;  3OS1 A;  1VQ6 N;  2WUS A;  2XY5 A;  5AQU A;  3ZT1 A;  3C0B A;  3MN6 A;  3DXK A;  4CF9 A;  5E84 A;  4DV7 K;  2VG7 A;  4CZE A;  1T03 A;  3EE9 A;  3PO4 A;  1HRH A;  3TR8 A;  4BY9 C;  1VQ9 N;  4I9Q A;  2GUP A;  4JKB A;  4A2B A;  3N4Q A;  4XH5 A;  4EZ6 A;  4OLB A;  2YKM A;  3EKU A;  4CEE A;  3RRG A;  2VCP A;  4CHZ A;  3LDS A;  3FZM A;  3CPW M;  5FPM A;  5F2R A;  1S5J A;  3OYE A;  2IC3 A;  1QZ6 A;  5ADX H;  1BG3 A;  5CZ1 A;  3IRX A;  5B8H A;  3AA3 A;  4GKJ K;  4K41 A;  1NK7 A;  3WUH A;  2OPR A;  3C6T A;  1HUX A;  2YJE A;  5C12 A;  1U04 A;  2PZS A;  3VQP A;  1QE1 A;  1QQO A;  3DOK A;  4MDB A;  5HP1 A;  1HKB A;  4CZK A;  3HSC A;  4JS4 A;  3ZX0 A;  4WFN L;  1RTI A;  3C7N A;  4B9U A;  1DKG D;  2ZM6 K;  1LAV A;  2FBX A;  4CK1 A;  1N8R O;  2D0O A;  4N76 A;  3CET A;  2HHV A;  3TAG A;  4HVJ A;  3WXM B;  3ULD A;  2NRH A;  3ATV A;  1UOC A;  2NRV A;  2O4G A;  4FW1 A;  3SAG A;  2QEX N;  2DFF A;  3LM9 A;  4X66 K;  2CH5 A;  1KSP A;  4DB3 A;  4DFJ A;  4E1J A;  2V51 B;  4AIL C;  4B3M K;  3L2V A;  3P4I A;  4CGJ A;  2UUA K;  4NXN K;  3O80 A;  4GY2 B;  2XY6 A;  4DQ8 A;  1KFS A;  3L2U A;  1BIZ A;  4JKE A;  3MN7 A;  5CR4 A;  3HI0 A;  1XC9 A;  2UXD K;  3WNF A;  4CGF A;  3CC4 N;  1N36 K;  3EYZ A;  3TSU A;  3DXM A;  3PV8 A;  4IZ9 A;  4JV5 K;  3VEN A;  4ISG A;  4FLX A;  4DQR A;  3MX2 A;  5AQG A;  4K25 A;  1GOC A;  1L3S A;  1CLQ A;  4FWR A;  3FFK B;  3MWT A;  1OKJ A;  4B3O A;  4HHT A;  4ID5 A;  4JRQ A;  2VQF K;  3KKS A;  1L3U A;  4WCE L;  3S41 A;  3K58 A;  4DF8 A;  3ITH A;  1U48 A;  1HYS A;  2D1K A;  1EQY A;  2ATQ A;  2P9S B;  3A5N C;  3CQY A;  1TK8 A;  3D2E B;  5F1X A;  4FJX A;  4C1N I;  4CZM A;  3DOL A;  3K9J A;  3NF8 A;  1T6C A;  3ZSW A;  2PBD A;  2YHW A;  2FLO A;  3B6O A;  1E3M A;  4F3T A;  3MEC A;  1ZBS A;  3H46 O;  3TSP A;  3LP2 A;  4J8F A;  4LFB K;  1X9J A;  1G99 A;  3LM2 A;  4FLU A;  1NGG A;  1NMD A;  1MWK A;  2Q36 A;  4DWI A;  2YHX A;  1KXP A;  4YOV A;  2O8C B;  3E9P A;  3HP9 A;  2BDP A;  1QQC A;  4BR9 A;  2F7T A;  2O8D A;  4BRE A;  3J81 O;  1BOT O;  3CJ7 A;  1BU6 O;  4AHR A;  5AR0 A;  4KI4 A;  3TPQ A;  3TAR A;  3VTH A;  4BC4 A;  4DTO A;  4JD2 B;  1C0G A;  2DPN A;  2YI1 A;  5BR8 K;  1NGE A;  1JLE A;  4BRK A;  1HX1 A;  4IDK A;  3HBT A;  2HND A;  3WXK A;  4FZY A;  3DLG A;  1EWQ A;  4O0I A;  4IEI A;  4MDA A;  1Y64 A;  1KVC A;  4AM7 A;  1IBK K;  2YHB A;  2YJF A;  3OJU A;  5C42 A;  1D5A A;  4HTU A;  4AQY K;  2Q31 A;  2B4J A;  5BPM A;  1NGC A;  3U3Y A;  2W40 A;  4OPA A;  3NGY A;  1YJN N;  4JI3 K;  4PL8 A;  2FC0 A;  3M3Z A;  1G15 A;  3PX0 A;  1W0H A;  2UXB K;  1SAZ A;  4IJN A;  3THV A;  4L3Q A;  2P9N A;  4DS5 A;  4FJ7 A;  2KQ2 A;  3RR7 A;  4PY5 A;  4KFB A;  4BC3 A;  3OYH A;  1TYQ A;  1N5Y A;  1IKV A;  4FWK A;  5A2Q O;  2R7Y A;  2Z1H A;  4YOY A;  4B9S A;  1IH7 A;  1RDB A;  1NLV A;  5CHI A;  2B6A A;  2FBV A;  5KPT A;  4M41 A;  5SZT A;  2A6A A;  4DV3 K;  1VK0 A;  4CJ4 A;  3S9H A;  4LFC K;  4BRL A;  4JRP A;  2ZJP L;  3NDK A;  2RPI A;  4ELU A;  1DTT A;  3LDN A;  5AQR A;  1ESV A;  4IKF A;  3QBX A;  3THX A;  3LDO A;  1JL2 A;  4A57 A;  3MCP A;  3CCM N;  1VSE A;  1NOY A;  2VGM A;  5BRD A;  3DLH A;  1A5V A;  4GNI A;  4BR5 A;  5GAH P;  1HPZ A;  1HYV A;  3G6E N;  2G8V A;  4J2E A;  5I3U A;  2H3G X;  2DY4 A;  1SKW A;  4JI4 K;  3E9O A;  3FE1 A;  2JWL A;  1L5U A;  4CCH A;  4JKD A;  4BWM A;  3ATU A;  1X9W A;  2HBL A;  1SV5 A;  4Q5V A;  1TKZ A;  1VQ7 N;  2XRI A;  1HKG A;  3BY5 A;  1HNW K;  3I8B A;  2G8K A;  4Z4C A;  1ASU A;  4OKJ A;  1L3V A;  4DU3 A;  3SQ4 A;  3MXJ A;  4YHH K;  4MO5 A;  3HXM A;  4O55 A;  1RT7 A;  3CXC M;  3RMC A;  1SS6 A;  3A5O C;  3JS6 A;  1U6Z A;  1J6Z A;  2E6L A;  3KTQ A;  4G1Q A;  4CEQ A;  2VYP A;  3O9S A;  4I9L A;  4YOR A;  3QET A;  1IG9 A;  1VQM N;  2HF4 A;  4JI0 K;  3DAW A;  3IS9 A;  1HJO A;  4B1W B;  1YF5 L;  3O8M A;  3QDK A;  1K73 O;  1W9H A;  3I55 N;  4YFU A;  1T3V A;  2YNF A;  5J2M A;  3EO3 A;  3ZET A;  1FJG K;  3CM5 A;  2IAJ A;  4XIU A;  3O5B A;  3LAK A;  4DTM A;  2JGU A;  4DV1 K;  3LDQ A;  1J54 A;  4CF2 A;  3OYF A;  3HT3 A;  2QKB A;  2HHH K;  1EP4 A;  3O4N A;  3KIO A;  4RW8 A;  3VF6 A;  5EU7 A;  1B9F A;  2P5G A;  4M3X A;  5LMU K;  3AO4 A;  2Q97 A;  5I42 A;  2ZE2 A;  5AQW A;  1RT4 A;  4W5Q A;  2F4V K;  5JLF A;  3O6W A;  3V6D A;  1IO2 A;  4BQZ A;  1K6Y A;  3Q7C A;  2P9U A;  4DQQ A;  5KTQ A;  3SK3 A;  3F73 A;  1YVU A;  4OO1 J;  3FZF A;  5HRO A;  2A1S A;  4CZH A;  3PSF A;  5AQK A;  3L3V A;  2E6M A;  1GLA G;  4BGB A;  3AA2 A;  2P9N B;  2Q0R A;  2Q3S A;  3OW2 M;  4CJK A;  4C8N A;  4C1N K;  4YOT A;  5GIO A;  3QNO A;  3F5T A;  5SWM A;  1BCM A;  1T44 A;  1TYQ B;  3RSE A;  3MXI A;  3AVJ A;  5LL6 Z;  2D0B A;  1QVF M;  2X74 A;  4FJK A;  3VA0 A;  1XNR K;  4H0P A;  3QML A;  5J2P A;  5C2D A;  5LJV A;  2YKN A;  4DV2 K;  4KHP K;  3THX B;  5M1K A;  5IWA K;  1CZ9 A;  3PIP L;  1VAZ A;  4ILG B;  3C94 A;  3OHR A;  1RIL A;  2ITG A;  2RE2 A;  1BI4 A;  3AVF A;  4U67 L;  4LF5 K;  3KLI A;  1WSF A;  1NNE A;  4CFA A;  2WFB A;  1TL3 A;  2QW9 A;  4BR2 A;  1J53 A;  3S3O A;  3T1A A;  3CJC A;  4KKO A;  3MCA B;  4FJH A;  2X6S A;  1OH5 A;  4CEO A;  1KTQ A;  4A59 A;  3JYT A;  4FM0 A;  5KPZ A;  5AZI A;  3SUN A;  3L4I A;  3Q7B A;  3EE8 A;  2VQE K;  3OYB A;  3S3N A;  2FF6 A;  1K9M O;  3T7Z A;  4I6M B;  4PHT X;  3V9W A;  1MU2 A;  3VPZ A;  5KRT A;  4AHS A;  3BP8 A;  5C24 A;  4B08 A;  1UWB A;  2GEL A;  1TK5 A;  4CJQ A;  3SZ2 A;  1WBB A;  2AA4 A;  2OCE A;  5ADX A;  4AF1 A;  4CJS A;  3OYA A;  4DUY K;  5C0Y A;  1EKE A;  3R3L A;  4FVM A;  1LOT B;  4DFM A;  3CJ1 A;  4C8L A;  2OA8 A;  3CIP A;  3HO1 A;  2HHS A;  4DHY A;  1WOQ A;  5H1S Q;  4F2S A;  4JN4 A;  1Q82 O;  4CHP A;  4E19 A;  4DQP A;  3CJ9 A;  4HCB A;  3AAP A;  4I7F A;  4KO0 A;  4BVP A;  4WFB L;  5JVG L;  1WLJ A;  5KI6 A;  4BRQ A;  3I8D A;  1RDC A;  1S1X A;  5GIN A;  3AVA A;  3EKS A;  1VSL A;  4BC5 A;  1RDD A;  2KFN A;  5M1P A;  2OZS A;  4F3O A;  5KPR A;  4JYA K;  4H0X B;  2E1Z A;  3H45 C;  2UU9 K;  3CFO A;  3CF5 L;  3DLB A;  3VTI A;  2Y1J A;  3A2F A;  3VQ4 A;  3C6H A;  3T69 A;  3O3G A;  4A5B A;  4I2P A;  3GOI A;  4BRP A;  3SUP A;  3V9S A;  1SQK A;  2BE2 A;  2P9P A;  4JI7 K;  3FFI A;  2HHU A;  4CZJ A;  3ENH A;  4KTZ A;  4HCC A;  4DS4 A;  1LW0 A;  3VEV A;  3GE1 A;  5KQD A;  3ZSR A;  4I2Q A;  1ITG A;  3HZ6 A;  3OYL A;  4MLE A;  5M1Q A;  3KK7 A;  3NCI A;  3K5M A;  3V9U A;  3HPG A;  3CG7 A;  4PKI A;  1BUP A;  4IXC A;  4K42 A;  1KD1 O;  2HNY A;  4CJ3 A;  4DTJ A;  3EZW A;  2P9L A;  3T1H K;  4Z4H A;  3G0Z A;  2P9K A;  1W2B M;  2NNW A;  3WXJ A;  3M8R A;  3V9Z A;  5AFU H;  4IO9 L;  1BI4 B;  2HHQ A;  2F9T A;  3IG1 A;  1KRP A;  4A5A A;  5HL7 L;  1VSI A;  4RTF D;  1GLL O;  4IFY A;  3IAY A;  2KW4 A;  3V9X A;  1RBV A;  4BVO A;  4KTW A;  1N33 K;  2W41 A;  1YXQ A;  1KVA A;  2GWK A;  3IKM A;  3LP3 A;  3MWP A;  3SJJ A;  1HJR A;  2E4L A;  3UKU A;  1YJ9 N;  1V4T A;  4BRO A;  4DQI A;  4CFC A;  5J1E A;  3CCE N;  3FZK A;  1JJ2 M;  3D6R A;  4BRI A;  3AO5 A;  2QXL A;  2V7Y A;  5M1F A;  4DFP A;  4GV3 A;  3A8Y A;  3HJF A;  4PKG A;  4UQG A;  3RRH A;  1S1U A;  4CK3 A;  1TKT A;  2ZWH A;  3VEO A;  1I3A A;  4BRF A;  4B3S K;  4WYB A;  3A5M C;  1HMV A;  4KPY A;  3THY B;  4B8A B;  3KLG A;  3THW A;  4BR0 A;  4IO8 A;  2KZM A;  1S1V A;  4FK2 A;  1RTJ A;  1SL1 A;  4JEP A;  3VQ7 A;  3LWM A;  2GTD A;  2HB5 A;  5AQY A;  3M6G A;  5AQV A;  4CHQ A;  1T7P A;  3MXM A;  1RT1 A;  4U7B A;  1LV5 A;  4HTL A;  3MAQ A;  1XHZ A;  4CGH A;  4BG8 A;  1REV A;  3ULE B;  3CFP A;  2PY5 A;  3SAH A;  1GLD G;  2O8E A;  1ZBH A;  1Q8I A;  4B9Q A;  3DI6 A;  4CES A;  1Q18 A;  3AA4 A;  1RFQ A;  4WF9 L;  4LF7 K;  1NGB A;  2P5O A;  4B9M A;  4F9O A;  1SKR A;  3HM9 A;  4OKK A;  4FW2 A;  1NKC A;  3QEI A;  2XO7 A;  3R9P A;  2CGL A;  2VWK A;  3P83 D;  3WEE A;  5T7B A;  3CPE A;  4YNQ A;  2YX6 A;  1VQ8 N;  1IKX A;  4X64 K;  3L2W A;  4JHD A;  3P5J A;  4J2A A;  4CJW A;  4C8O A;  1YI2 N;  1Q9X A;  2HBJ A;  1QSY A;  3CI5 A;  3GL1 A;  4RWT A;  4JKC A;  4CZF A;  3RMB A;  2D5R A;  3MDQ A;  3CCJ N;  3D7E O;  4GVM A;  4YOX A;  3OBY A;  1VQK N;  1NK6 A;  4EHT A;  1H1V A;  4BE1 A;  2F8S A;  3F2K A;  1OVY A;  4DU1 A;  3C65 A;  1TUY A;  1GLE G;  5AQO A;  1ZBL A;  1RT3 A;  4CVN E;  4CE9 A;  4C23 A;  2P9L B;  1P8Z A;  1TVR A;  1IBL K;  3N4P A;  5FRN A;  1CZB A;  1YIT N;  3NGZ A;  1VRU A;  4DSF A;  2EHG A;  3DLE A;  2OZM A;  3ENB A;  1R0A A;  1RCH A;  5TKW A;  3KD1 E;  3EY1 A;  2OPP A;  3TAE A;  4Z4G A;  1NMN A;  4FWP A;  3TSQ A;  4OLA A;  4KTQ A;  1BIU A;  1X3N A;  2P1J A;  4CGD A;  2QA4 N;  2X6N A;  1D9D A;  2RKI A;  4HWI A;  1VSF A;  3QIN A;  3V81 A;  3O4W A;  2D0A A;  1ASV A;  3LAL A;  4ZHR A;  4FPB A;  3M1F A;  1UA1 A;  3ZYY X;  3ZEU B;  2JWK A;  1ILY A;  2HMI A;  3UKU B;  4CHN A;  4RW9 A;  3KK3 A;  1JXE A;  4M3U A;  4CJT A;  1OVQ A;  4LF4 K;  4CJF A;  3HL8 A;  4NLC A;  3SAF A;  4H5V A;  5IT9 O;  1ATS A;  3UB5 A;  1YTA A;  3RWU A;  4RG8 A;  3DXK B;  1NM1 A;  1S1W A;  3VEW A;  4GV9 A;  4C8M A;  2ZD1 A;  4BR7 A;  3VGM A;  1NK5 A;  3LP1 A;  3VGK A;  5AQZ A;  1WN7 A;  1UA0 A;  2IIR A;  5KGX A;  1OH6 A;  3PX4 A;  4IOA L;  3E01 A;  3HM8 A;  3UIQ A;  3CD6 N;  4JLH A;  3VQB A;  3QFP A;  2OTL N;  2CH6 A;  1TKX A;  4DTS A;  2A1R A;  3CME N;  1E4F T;  1C0F A;  4DUZ K;  3SNN A;  1RNH A;  3MEE A;  2ZJQ L;  3VQA A;  4FWM A;  1SUQ A;  1VSH A;  1IKY A;  3OYC A;  1S22 A;  4H0T B;  1LWF A;  4CED A;  4FWN A;  2O8E B;  4FPA A;  2HHX A;  2E2N A;  3WNE A;  3C7N B;  4K8X A;  2G8U A;  2ETJ A;  3H1Q A;  5E26 A;  3SPZ A;  1WSH A;  3U4L A;  3QEP A;  1WB9 A;  4OPH A;  4B1V A;  4OKE A;  1NJX A;  5GAE P;  2YNI A;  1CXU A;  3VQD A;  1NU0 A;  1KLN A;  3WEE B;  3NE6 A;  3AVC A;  5JMV A;  4KRE A;  4RW6 A;  2HBM A;  3AVB A;  2P9I A;  4LF9 K;  1S1T A;  1T05 A;  1NKE A;  5HLF A;  3OYM A;  3RR8 A;  5CYQ A;  4CBW A;  2E5L K;  4DR5 K;  4B3T K;  3LDP A;  5GIP A;  4Z4I A;  3DXM B;  3H6E A;  4IG3 A;  2DFE A;  3SLC A;  3TAB A;  1S72 N;  1SZ2 A;  4CJ7 A;  4EAH D;  3OYD A;  1TAQ A;  3VGL A;  3PSI A;  2BAN A;  3SQ1 A;  4M45 A;  1U2V A;  3OTO K;  4CK2 A;  2XY7 A;  1YUW A;  3HOT A;  3KK1 A;  4CW7 B;  4E0D A;  1BO5 O;  5GAD P;  4BRD A;  3HVT A;  3MK6 A;  3CYM A;  1T6D A;  2W6K A;  3QEV A;  3CMA N;  2QXF A;  4LF8 K;  4DCH A;  3BEX A;  1C0M A;  1DT9 A;  3SCX A;  2OYQ A;  2D4W A;  1QSS A;  3NF6 A;  3C95 A;  1O13 A;  3IUC A;  4IOX A;  1NGF A;  3QEX A;  4W5O A;  4A61 A;  4DTX A;  2E1Y A;  5AQX A;  3DLK A;  4ISE A;  1NJW A;  3OY9 A;  4CF8 A;  1SL2 A;  3WQU A;  5LY3 A;  2O8D B;  3EL2 A;  5E41 A;  4YDU C;  4CJV A;  4KBO A;  1BHL A;  3H08 A;  3AV9 A;  4W5R A;  3RVC A;  3GDQ A;  3QFU A;  3WXI A;  4R79 A;  2UYT A;  1VSJ A;  1ZBI A;  5FRO A;  3JSM A;  1C1C A;  4CJU A;  3BDP A;  4O8U A;  3D45 A;  3K0S A;  3AVG A;  1D4X A;  2CGK A;  3T3F A;  3U3G A;  5AQT A;  4CBX A;  4M7Y A;  3TTD A;  4LD0 A;  1S6Q A;  5AQH A;  3L8B A;  1JLC A;  3ENO A;  4CJP A;  4H4O A;  3B6P A;  1KAY A;  1NK9 A;  4DQS A;  4KI6 A;  4ILH A;  3R6M A;  2PYJ A;  3S3M A;  2G8I A;  3HRG A;  3O4Q A;  4CJE A;  5LMN K;  1JXB A;  3AO1 A;  3EN9 A;  4LH4 A;  2YHY A;  4O0J A;  1HKC A;  4E7K A;  3HPH A;  2ASO A;  3ZSQ A;  4ZTF A;  1WSJ A;  4NB4 A;  2QWP A;  3OYI A;  1HR0 K;  4FLZ A;  4AM6 A;  3KJV A;  3ZSZ A;  3CJB A;  4FJN A;  3O9U A;  3KHY A;  2EWS A;  2ZF5 O;  1LWE A;  3V1O A;  5FPE A;  1NK4 A;  5DK5 A;  3LZI A;  1J5O A;  2IS3 A;  1RDU A;  2BGG A;  1VQN N;  3O9T A;  4CJL A;  4EFH A;  2KFZ A;  2JLE A;  3DRS A;  4WQ5 C;  4N56 A;  5ELZ A;  3NF9 A;  3GG4 A;  5CE3 A;  4NO7 A;  3OJS A;  4H4M A;  3ALY A;  2ASM A;  2HOE A;  3SUQ A;  1NK8 A;  2HNZ A;  1W97 L;  2GBZ A;  4FWO A;  3SJH A;  3QB0 A;  1NJY A;  3HOS A;  4DF4 A;  1YIJ N;  4X65 K;  4MFB A;  3SBT A;  1S9E A;  1YT3 A;  5J2Q A;  4KHW A;  3AVI A;  3G71 N;  3NHG A;  3CC7 N;  4BE2 A;  5JIC A;  4B1Y B;  4PA1 A;  1LW2 A;  1BIS A;  3U6F A;  4RW4 A;  3EZ5 A;  1A5W A;  3CHW A;  4H5R A;  1EET A;  2HBK A;  4H5N A;  5F0X A;  4FJM A;  2QM1 A;  1BQM A;  3VQ8 A;  3R8E A;  3SMP A;  4BRN A;  5HBM A;  4H5W A;  3CFR A;  1KVB A;  3W3D A;  4QS7 A;  3VF4 A;  1KC8 O;  4IOC L;  3AGR A;  4FVU A;  3HVR A;  4FLY A;  2HW3 A;  1X9S A;  3A5L C;  3LAM A;  3O3H A;  4M3R A;  3SYZ A;  1U45 A;  3KWG A;  2CGJ A;  2QWL A;  1HQE A;  4DTR A;  1RT6 A;  1XC3 A;  4CJ5 A;  4FSV A;  1XMQ K;  4FJL A;  4B1Z A;  3RMA A;  3WNG A;  4AHV A;  3U9Z A;  1GLF O;  3QIC A;  2BH1 A;  3L0Q A;  4K8Z A;  5FRM A;  4F2R A;  3ZET B;  1V4S A;  2VGN A;  4DSI A;  5HRP A;  2XHB A;  4N5S A;  4KHN A;  2I5J A;  4CEF A;  4GMJ B;  1C1B A;  3TTF A;  5BN9 A;  4OJR A;  3H1V X;  1WNS A;  1BDG A;  3MEG A;  5AQM A;  4AHU A;  4GV6 A;  2O8B A;  1JL1 A;  2NRZ A;  4BDZ A;  1XWL A;  3AO2 A;  4FL9 A;  3LZJ A;  4FJ9 A;  2UUC K;  3TAQ A;  4IJA A;  1F21 A;  4TSX A;  4B9L A;  2KKZ A;  4KHU A;  4V19 S;  4Q0B A;  3T19 A;  4K43 A;  2P9U B;  1P90 A;  1VQL N;  2YV0 X;  2PFU A;  1YAG A;  4PL7 A;  3J7Y P;  4Z4F A;  1FKO A;  5BR9 A;  3AVN A;  5AZJ A;  4FYD A;  3T1Y K;  3FR0 A;  4Y1D A;  2NRR A;  3H3O B;  2AP1 A;  2HF3 A;  3AAR A;  1GLB G;  1WAJ A;  3OBW A;  4FLT A;  3KLE A;  1KAX A;  2VG5 A;  4KHQ A;  1KCF A;  2A5X A;  2GWJ A;  3VOV A;  3RSE B;  1YJW N;  4DV6 K;  4Z94 A;  4F4K A;  2Q2R A;  4DKW A;  5HOO A;  3WQT A;  4JS5 A;  4A2A A;  5JS1 A;  1JCG A;  4M3T A;  1WSI A;  3NH0 A;  1EXQ A;  2RHK A;  2G8H A;  2YNG A;  3BF1 A;  4Z0U A;  4AH9 A;  1BA0 A;  4Z4E A;  3PO5 A;  3G10 A;  3C6U A;  1ZC6 A;  3OA9 A;  5AQN A;  4BRH A;  4CBU A;  2OTJ N;  4LY7 A;  3E1Y A;  3TTC A;  2W42 A;  3CCR N;  4E1M A;  3KZB A;  5M1N A;  1QVG M;  1NK0 A;  3PUF A;  1J9A A;  4B3R K;  4DTU A;  3L2Q A;  1JLA A;  1VSD A;  2GUI A;  2P9S A;  5AZI B;  3CCS N;  2A40 A;  2GEM A;  3VEY A;  4CEC A;  3M8Q A;  2HHT A;  1GLC G;  1YTU A;  1JLF A;  1RGI A;  3FGU A;  2E2O A;  4M3W A;  1N34 K;  3SI6 A;  4DV0 K;  5CYM A;  4FJ8 A;  2E20 A;  2QWQ A;  4H8K A;  4CIE A;  1VHX A;  3ID8 A; 
#chains in the Genus database with same CATH homology
 4FLW A;  3D0P A;  4DSE A;  2HMI A;  2Y1I A;  2E6L A;  4CF0 A;  3KTQ A;  4G1Q A;  4RW7 A;  4CHN A;  3OYG A;  4RW9 A;  4CEQ A;  3KK3 A;  1D9F A;  3QET A;  4I9L A;  1JKH A;  1JXE A;  1IG9 A;  3NGI A;  1BGX T;  3SPY A;  2Z1J A;  4CJT A;  3K5N A;  4B9V A;  4NCB A;  3IS9 A;  4CJF A;  3HL8 A;  4E3S A;  3TI0 A;  4FJI A;  1YTA A;  2KZZ A;  1W9H A;  4DSK A;  4RG8 A;  3RWU A;  4BE0 A;  3TAP A;  4DSL A;  1GOB A;  1QSL A;  1S1W A;  3RMD A;  1BL3 A;  4C8M A;  4YFU A;  4MQ3 A;  2LSN A;  2YNF A;  2ZD1 A;  5J2M A;  1WSG A;  3CM5 A;  2IAJ A;  4XIU A;  1NK5 A;  4R5P A;  1ASW A;  3LAK A;  3LP1 A;  5JS2 A;  4DTM A;  2JGU A;  3NF7 A;  1WN7 A;  1UA0 A;  3DYA A;  4OPK A;  4M3U A;  3V1R A;  1A5X A;  1J54 A;  4CF2 A;  5KGX A;  3PX4 A;  3E01 A;  3OYF A;  1SKS A;  5HRS A;  3HT3 A;  2QKB A;  4LSN A;  1EP4 A;  3DM2 A;  3KIO A;  3O4N A;  4RW8 A;  4CHY A;  1O1W A;  3UIQ A;  4JLH A;  4NCA A;  3VQB A;  1I39 A;  5EU7 A;  1S6P A;  4DSJ A;  1B9F A;  2P5G A;  4N41 A;  4M3X A;  1TKX A;  4DTS A;  4B9T A;  3ZT4 A;  2A1R A;  3AO4 A;  1B92 A;  1JLG A;  5I42 A;  2ZE2 A;  4N47 A;  1RT4 A;  1RNH A;  3SNN A;  4W5Q A;  1Z26 A;  3V1Q A;  1Y97 A;  3MEE A;  1JLB A;  3VQ6 A;  5CY4 A;  1QS4 A;  3VQA A;  3OS0 A;  3V6D A;  1IO2 A;  2G8W A;  2OPQ A;  1K6Y A;  1SUQ A;  3VQ9 A;  2OPS A;  1RT2 A;  1VSH A;  2AJQ A;  3DMJ A;  4DQQ A;  1IKY A;  1RBS A;  3KKR A;  5KTQ A;  3OYC A;  1DLO A;  3F73 A;  4F8R A;  4FZZ A;  1YVU A;  1LWF A;  4CED A;  5DMR A;  5HRO A;  2A1S A;  3KLH A;  2HHX A;  1RT5 A;  5J2N A;  3WNE A;  1XI1 A;  4IFV A;  3K2P A;  3L3V A;  4BAC A;  2E6M A;  4K8X A;  3ZCM A;  2G8U A;  2ETJ A;  3AA2 A;  1ZBF A;  2Q3S A;  3AVH A;  4DFK A;  3SPZ A;  3KK2 A;  1D8Y A;  4M3Y A;  1WSH A;  1HNI A;  3OS2 A;  3QEP A;  4CJK A;  3MED A;  4C8N A;  4LSL A;  3QNO A;  4KRF A;  1TGO A;  5SWM A;  3NBP A;  1BCM A;  4OKE A;  3K5L A;  4FLV A;  3QES A;  3ZSO A;  4M3Z A;  5D3G A;  1NJX A;  2HHW A;  3MXI A;  1GOA A;  3AVJ A;  3ISN C;  3NFA A;  1VSM A;  2VWJ A;  2YNI A;  1CXU A;  1FK9 A;  3ZT3 A;  4CEB A;  2D0B A;  4OGE A;  1HQU A;  1TL1 A;  1X1P A;  3VQD A;  3RTV A;  1U49 A;  4L8R B;  2X74 A;  1EX4 A;  1KLN A;  4FJK A;  3VA0 A;  4EP4 A;  3NE6 A;  1ZBU A;  3AVC A;  1WSE A;  4CIF A;  4KHS A;  4KRE A;  2PYL A;  4DLG A;  4J2B A;  4FXD A;  5J2P A;  4RW6 A;  3OYN A;  3OYJ A;  3AVB A;  2YKN A;  1S1T A;  1U4B A;  1T05 A;  5HLF A;  3CM6 A;  1NKE A;  3F9K A;  4BWJ A;  3OYM A;  3RR8 A;  5CYQ A;  3AO3 A;  3VQE A;  1HYZ A;  1CZ9 A;  2WON A;  3C94 A;  3AA5 X;  4AHC A;  3QIP A;  4Z4I A;  1RIL A;  3ASM A;  4E7J A;  2ITG A;  4IG3 A;  3VQQ A;  2DFE A;  3ZSY A;  3TAB A;  4PWD A;  2KTQ A;  4CER A;  3VN5 A;  1BI4 A;  4ID1 A;  3AVF A;  1DTQ A;  3NH2 A;  3OYD A;  3KLI A;  4KB1 A;  1WSF A;  2X78 A;  4CFA A;  3K5O A;  1TL3 A;  3M8S A;  1TAQ A;  4ZTJ A;  4PUO A;  4FZX C;  2BAN A;  3SQ1 A;  4BDP A;  4M45 A;  1J53 A;  3S3O A;  3T1A A;  4CK2 A;  2XY7 A;  4KKO A;  4FJ5 A;  1C0U A;  2IDO A;  5CZ2 A;  4FJH A;  3P1G A;  4CJR A;  3KK1 A;  2X6S A;  4CEA A;  4E0D A;  4FJG A;  4CEO A;  1KTQ A;  2YHA A;  4FM0 A;  4DG1 A;  1RBT A;  3JYT A;  4LH5 A;  3PX6 A;  4CFB A;  4CGG A;  3HVT A;  1VRT A;  3SUN A;  1WAF A;  3HK2 A;  4FK4 A;  3CYM A;  3VQC A;  3OYB A;  3L2R A;  3S3N A;  4M42 A;  4IBN A;  3QEV A;  2QXF A;  3WNH A;  1RBR A;  5HRN A;  3V9W A;  1MU2 A;  5KRT A;  1C0M A;  3LAN A;  4AHS A;  3SCX A;  2OYQ A;  1QSS A;  1RDA A;  3L3U A;  3NF6 A;  5C24 A;  3C95 A;  4B08 A;  1QHT A;  1UWB A;  3V4I A;  1TK5 A;  4CJQ A;  4W5T A;  3SZ2 A;  3DLR A;  3QEX A;  4W5O A;  2GV9 A;  4CJS A;  4DTX A;  4QOZ B;  1C6V A;  3OYA A;  3DLK A;  3OS1 A;  4B8C A;  3OY9 A;  1NJW A;  1EKE A;  4CF8 A;  4BDY A;  1FXX A;  4FVM A;  1SL2 A;  4J2D A;  2XY5 A;  5E41 A;  3ZT1 A;  4DFM A;  4C8L A;  2OA8 A;  4CJV A;  3HO1 A;  1BHL A;  2HHS A;  3H08 A;  3AV9 A;  4W5R A;  1KFD A;  4EP5 A;  3LPU A;  1UAX A;  4AHT A;  4F2S A;  4OVL A;  4CF9 A;  1BQN A;  1C1A A;  4CHP A;  4E19 A;  3VA3 A;  4DQP A;  2VG7 A;  1T03 A;  1VSJ A;  4HCB A;  1ZBI A;  4KO0 A;  4I7F A;  5FRO A;  3JSM A;  3PO4 A;  1HRH A;  1IKW A;  1C1C A;  1WLJ A;  5KI6 A;  2O4I A;  3TR8 A;  1XHX A;  1TK0 A;  4HUG A;  4CJU A;  3BDP A;  3I8D A;  1RDC A;  1S1X A;  4I9Q A;  3D45 A;  4OLB A;  4EZ6 A;  3AVG A;  2YKM A;  4CEE A;  2G8F A;  3RRG A;  3AVA A;  4CHZ A;  3LDS A;  1VSL A;  3T3F A;  3U3G A;  3SV3 A;  1RDD A;  2KFN A;  4Y1C A;  4QCL A;  4E7H A;  1S5J A;  5HRR A;  3OYE A;  4LD0 A;  1S6Q A;  2IC3 A;  3L8B A;  2OZS A;  4F3O A;  1JLC A;  5CZ1 A;  1RTD A;  4CJP A;  4H4O A;  3QIO A;  3B6P A;  2IOC A;  3IRX A;  3AA3 A;  3CFO A;  4DQS A;  1NK9 A;  1NK7 A;  2QKK A;  1LAW A;  2OPR A;  3C6T A;  3DLB A;  4KI6 A;  4E7I A;  2Y1J A;  3A2F A;  1U04 A;  3VQ4 A;  4E89 A;  1B9D A;  3HPO A;  3ZT2 A;  3S3M A;  1NKB A;  2PZS A;  2G8I A;  3VQP A;  1QE1 A;  1T8E A;  3O4Q A;  3DOK A;  4KHY A;  4CJE A;  1JXB A;  3AO1 A;  3O3G A;  4LH4 A;  5HP1 A;  3OYK A;  4JS4 A;  2YNH A;  4O0J A;  4E7K A;  3NH1 A;  3HPH A;  3ZSQ A;  4C8K A;  1RTI A;  4I2P A;  4B9U A;  4ZTF A;  3SUP A;  1WSJ A;  3OYI A;  1LAV A;  2BE2 A;  2FBX A;  4CK1 A;  3V9S A;  4NYF A;  4FLZ A;  4N76 A;  2HHV A;  3FFI A;  3PY8 A;  3TAG A;  2PYJ A;  4ELV A;  2XY8 A;  2HVH A;  1BCO A;  4HVJ A;  2HHU A;  3ULD A;  1UOC A;  2O4G A;  2RF2 A;  3KJV A;  4FW1 A;  1HNV A;  4KTZ A;  3ZSZ A;  4DLE A;  3KD5 E;  4HCC A;  2DFF A;  4DS4 A;  1SL0 A;  4FJN A;  1LW0 A;  1KSP A;  3LWL A;  4HUE A;  4DFJ A;  3V1O A;  1LWE A;  4AIL C;  3ZSR A;  1VSK A;  4I2Q A;  5DK5 A;  3K59 A;  3L2V A;  3O3F A;  1ITG A;  1NK4 A;  3LZI A;  1J5O A;  2DFH A;  2IS3 A;  4CGJ A;  3OYL A;  2BGG A;  2XY6 A;  3LPT A;  1KFS A;  3L2U A;  2F96 A;  3NCI A;  3HPG A;  1BIZ A;  4WE1 A;  4CJL A;  3CG7 A;  3K5M A;  3V9U A;  2JLE A;  3ZT0 A;  4FK0 A;  2KFZ A;  3DRS A;  2HNY A;  3AVK A;  4N56 A;  1XC9 A;  3WNF A;  3DRP A;  4CGF A;  3KLF A;  4CJ3 A;  3EYZ A;  3NF9 A;  4DTJ A;  3OJS A;  3PV8 A;  4ICL A;  4FJJ A;  4H4M A;  4FLX A;  3ALY A;  4DQR A;  4Z4H A;  3G0Z A;  3SUQ A;  1NK8 A;  2HNZ A;  5KGW A;  1GOC A;  2GBZ A;  3V9Z A;  1L3S A;  3M8R A;  1CLQ A;  1NJY A;  1C0T A;  5K14 A;  4B3O A;  1BI4 B;  4DF4 A;  4HHT A;  4ID5 A;  4JRQ A;  1ZYQ A;  1Z25 A;  3ZSX A;  2HHQ A;  1QTM A;  3IG1 A;  2FBY A;  3KKS A;  4O4G A;  1L3U A;  1KRP A;  4MFB A;  1S9E A;  3BGR A;  2F8T A;  3K58 A;  4DF8 A;  1TV6 A;  4PQU A;  3ITH A;  1U48 A;  1VSI A;  1HYS A;  1YT3 A;  5J2Q A;  3DRR A;  4KHW A;  3AVI A;  4IFY A;  3NHG A;  3IAY A;  2ATQ A;  4KV8 A;  1TK8 A;  4BE2 A;  4FJX A;  2KW4 A;  4PA1 A;  1LW2 A;  1BIS A;  3V9X A;  3U6F A;  4RW4 A;  3EZ5 A;  3DOL A;  1A5W A;  3NF8 A;  3ZSW A;  1EET A;  3QEW A;  1RBV A;  1RBU A;  3B6O A;  4KTW A;  4FJM A;  4F3T A;  1BQM A;  3LP3 A;  1KVA A;  3MEC A;  3VQ8 A;  3HST B;  5HBM A;  3LP2 A;  3SJJ A;  1HJR A;  2E4L A;  4QAG A;  3CFR A;  1L3T A;  4OLA A;  4FLU A;  1KVB A;  4CIG A;  4CF1 A;  4DQI A;  4CFC A;  5J1E A;  4HUF A;  4DWI A;  3HVR A;  4FLY A;  2HW3 A;  1X9S A;  3LAM A;  3AO5 A;  4M3R A;  3O3H A;  2HVI A;  1FKP A;  3SYZ A;  4DFP A;  1U45 A;  3SV4 A;  3HP9 A;  2BDP A;  1QQC A;  1HQE A;  4DTR A;  1RT6 A;  4AHR A;  3HJF A;  4UQG A;  3RRH A;  1S1U A;  4CJ5 A;  3TAR A;  4FJL A;  4CK3 A;  4KI4 A;  1TKT A;  3RMA A;  3WNG A;  4AHV A;  1I3A A;  4DTO A;  1HMV A;  3I0R A;  4KB0 A;  1JLE A;  4KPY A;  4CFD A;  4IDK A;  3AVM A;  1TAU A;  4K8Z A;  5FRM A;  4F2R A;  3SUO A;  2HND A;  4DSI A;  4FZY A;  5HRP A;  4B8A B;  3KLG A;  2NUB A;  3OVN A;  4N5S A;  2XHB A;  3DLG A;  4KHN A;  2KZM A;  1S1V A;  2I5J A;  4CEF A;  4GMJ B;  4O0I A;  4FK2 A;  1C1B A;  1KVC A;  1RTJ A;  1SL1 A;  2YHB A;  3M8P A;  4OJR A;  5C42 A;  3VQ7 A;  3TAM A;  1D5A A;  3OJU A;  3LWM A;  1WNS A;  4DTN A;  2HB5 A;  3MEG A;  1Q9Y A;  4AHU A;  5C25 A;  4CHQ A;  4HTU A;  1JL1 A;  4BDZ A;  1T7P A;  3MXM A;  1RT1 A;  1XWL A;  3AO2 A;  2B4J A;  3LZJ A;  4FJ9 A;  1CXQ A;  3U3Y A;  1LV5 A;  2WOM A;  1XHZ A;  3MAQ A;  3TAF A;  3NGY A;  1F21 A;  3TAQ A;  4TSX A;  4FCY A;  4CGH A;  4B9L A;  3SQ0 A;  2FC0 A;  4KHU A;  4OGC A;  1REV A;  3T19 A;  4Q0B A;  1G15 A;  3CFP A;  2PY5 A;  2QK9 A;  4E1N A;  4EZ9 A;  1ZBH A;  3PX0 A;  1W0H A;  1Q8I A;  4KAZ A;  3DI6 A;  3HYF A;  4CES A;  4CGI A;  3THV A;  3AA4 A;  2YV0 X;  4W5N A;  3K57 A;  2P5O A;  4B9M A;  4DS5 A;  2DTU A;  4Z4F A;  1FKO A;  1SKR A;  3AVN A;  3VQ5 A;  4FJ7 A;  2KQ2 A;  3QNN A;  3RR7 A;  4PY5 A;  4FYD A;  4IG0 A;  4KFB A;  2Z1G A;  4Y1D A;  3OYH A;  3HM9 A;  1N5Y A;  1IKV A;  1WAJ A;  2R7Y A;  2Z1H A;  4FLT A;  4OKK A;  4FW2 A;  3CQ8 A;  3KLE A;  1NKC A;  3QER A;  4B9S A;  2D0C A;  2VG5 A;  2XO7 A;  1IH7 A;  3QEI A;  1RDB A;  1KCF A;  4KHQ A;  2B6A A;  2FBV A;  2VWK A;  3P83 D;  4M41 A;  4DTP A;  5T7B A;  4YNQ A;  4F4K A;  5SZT A;  1VK0 A;  4CJ4 A;  3S9H A;  1S9G A;  4NCG A;  4JS5 A;  4JRP A;  5JS1 A;  1IKX A;  1KLM A;  2RPI A;  3L2W A;  3NDK A;  4ELU A;  1DTT A;  4M3T A;  4CHO A;  3P5J A;  4J2A A;  4IKF A;  1RTH A;  1WSI A;  2EX3 A;  4CJW A;  1N6Q A;  1Q9X A;  1JL2 A;  4C8O A;  3NH0 A;  1EXQ A;  1VSE A;  2P51 A;  2YNG A;  4Z0U A;  3SQ2 A;  3RMB A;  1X9M A;  1NOY A;  2G8H A;  2D5R A;  4AH9 A;  5KRS A;  3DLH A;  3QLH A;  3PO5 A;  3G10 A;  4Z4E A;  3C6U A;  4GVM A;  1A5V A;  4CEZ A;  1NK6 A;  1HPZ A;  4BE1 A;  2F8S A;  1HYV A;  2IGI A;  3I0S A;  3TAN A;  2G8V A;  3TWH A;  4LY7 A;  4E7L A;  4J2E A;  5I3U A;  4DU1 A;  2W42 A;  2DY4 A;  1ZBL A;  4GW6 A;  2B5J A;  1JLQ A;  1RT3 A;  1NJZ A;  1SKW A;  4CE9 A;  4NYN A;  1TVR A;  4DMN A;  1L5U A;  2ZQB A;  4CCH A;  1LWC A;  4E1M A;  4FM2 A;  5FRN A;  1CZB A;  4BWM A;  3NGZ A;  1VRU A;  3AVL A;  4DSF A;  1X9W A;  4O5B A;  4ELT A;  2EHG A;  3DLE A;  3QO9 A;  1NK0 A;  2OZM A;  3PUF A;  1J9A A;  1R0A A;  1SV5 A;  4DTU A;  4Q5V A;  1RCH A;  1TKZ A;  1JLA A;  1VSD A;  2GUI A;  3LP0 A;  3L2Q A;  2XRI A;  4OPJ A;  3KD1 E;  4FM1 A;  3EY1 A;  2OPP A;  3TAE A;  4Z4G A;  4CEC A;  3M8Q A;  2G8K A;  2HHT A;  4Z4C A;  5FDL A;  1TKD A;  4KTQ A;  3HP6 A;  1ASU A;  1BIU A;  4OKJ A;  2FBT A;  4CGD A;  2P1J A;  3NAE A;  1L3V A;  1YTU A;  2VG6 A;  3ZSV A;  2X6N A;  1JLF A;  4DU3 A;  2RKI A;  3SQ4 A;  1U47 A;  1D9D A;  1VSF A;  3MXJ A;  3QIN A;  4O44 A;  2RN2 A;  3V81 A;  4M3W A;  2D0A A;  2Z1I A;  3HXM A;  1ASV A;  4O55 A;  3SI6 A;  1NOZ A;  3LAL A;  5CYM A;  1RT7 A;  4ZHR A;  4DU4 A;  4FJ8 A;  4H8K A;  3RMC A;  1UA1 A;  4CIE A;  4B9N A;  1QSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...