4O5BA

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[6-(5-chloro-1h-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/inhibitor
molecule keywords Integrase
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 40
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o5bA00
4CHOA 4CIFA 1RBVA 3CM5A 4FLYA 1KVBA 4BE2A 1TK8A 2HHTA 3AVIA 2RF2A 3C95A 2PZSA 4CGDA 3MEEA 5C25A 4I2PA 4W5NA 5J2NA 4B9LA 5D3GA 5HBMA 5T7BA 3OJSA 3QNNA 3HPGA 4DSJA 2P5OA 3AVNA 3RMBA 1ZYQA 4FJXA 4CF0A 1J9AA 4O5BA 3OYJA 1Y97A 3AA3A 3L2WA 3AVAA 1WSFA 1TKXA 1KVCA 3I0RA 3K5OA 3OS1A 2G8FA 3ZT3A 1FKPA 2ITGA 3HPOA 1RT2A 4DSEA 3TABA 2HMIA 4J2BA 3S3MA 1VK0A 3TARA 4J2EA 2BANA 3LPUA 1T7PA 4HVJA 3SUOA 4E19A 4LD0A 2B4JA 4FW2A 4WE1A 4KHYA 3OYGA 3I8DA 3KK3A 4AHRA 4DQPA 4OKKA 1JXBA 3OYKA 2Q3SA 1HRHA 4E7LA 4NYNA 3HSTB 1WSEA 4F8RA 4DQQA 4C8LA 4J2AA 2IGIA 2WONA 3L2UA 3VQPA 1RT3A 4DU4A 1KLMA 3QO9A 4Q5VA 1FK9A 4FJ5A 3AA2A 1IKXA 3B6PA 1QTMA 3G0ZA 2VG6A 2D0CA 3MEDA 4CIEA 4W5TA 2F8SA 3TAFA 3U3GA 3TR8A 1TK5A 4E0DA 4C8MA 4CF9A 4IG0A 4FJLA 2HW3A 2DY4A 3WNHA 3ULDA 1CXUA 3AVFA 1BGXT 1C0UA 4IFYA 4CFBA 1RT4A 4CJPA 3LWMA 2F96A 3NGZA 3SYZA 3ASMA 4FK0A 3RWUA 4DSIA 3VQEA 3ZSXA 3SV3A 2WOMA 3PX0A 3V9WA 1RTIA 2X6NA 3ZSVA 4CHPA 2W42A 3QEXA 3VQBA 4AH9A 1SL2A 4ID5A 3HP9A 4DS5A 1HYSA 2VWJA 1HYVA 2JGUA 4ZTFA 4DQSA 3U6FA 3THVA 4CHYA 4CIGA 4F3OA 1NJYA 3HJFA 3L2QA 4R5PA 2KW4A 4IDKA 3BDPA 4B9UA 4FJ9A 1ZBHA 4CEQA 1N6QA 4FJIA 1S6QA 3DMJA 4H4MA 3NHGA 3OYHA 4NCBA 2XHBA 4LSLA 3SNNA 4B8CA 3DOLA 3KJVA 2HNDA 3QETA 1Z25A 3S3NA 4I2QA 2XY7A 4QCLA 2HHSA 5KI6A 1RT6A 2XO7A 4F3TA 5HRNA 1HYZA 4KTWA 4DTOA 2Y1JA 1SKSA 3VN5A 4JLHA 3E01A 3LANA 4N41A 3QLHA 4CF1A 2OZMA 5E41A 1BQMA 3OYEA 4BDZA 2HHUA 3QEWA 4FW1A 3PO4A 3AO2A 2DTUA 3QIPA 4FJGA 4W5OA 3MXIA 1JXEA 1QQCA 3P83D 1JLFA 4CEFA 2X74A 4DS4A 1QSSA 4H8KA 4RG8A 3HVRA 2R7YA 1C1AA 4K8ZA 5KGXA 3HM9A 1BI4A 1QE1A 3CM6A 3VQ7A 3KLGA 4FJMA 4CERA 4M3ZA 3AO4A 2IOCA 4OGEA 1D5AA 1QHTA 3OYDA 3VA0A 2G8HA 1RTJA 3L3VA 3VQ5A 3SQ1A 4CJQA 4Z0UA 4B8AB 1JLGA 2YKMA 4NCAA 1ITGA 1S1VA 2Z1GA 3VQQA 4CJWA 4LSNA 4UQGA 4PA1A 3DRRA 2A1SA 4KV8A 1RDCA 3AA5X 1J5OA 3EZ5A 3KK1A 3LDSA 1NJWA 2KFNA 1HJRA 5HRRA 4CGJA 2FBYA 4M42A 4C8OA 1NK4A 4DWIA 1TL1A 2P1JA 3OYFA 3P5JA 3VQAA 4CEDA 5J2MA 1T03A 3KD1E 1F21A 1IKWA 3MAQA 1DTQA 3NF8A 2YHBA 4CFDA 1WSHA 1YTAA 3OYMA 1NKEA 1D8YA 2G8KA 4AHVA 1BCMA 4CJLA 2HNZA 2IDOA 2OPRA 1L5UA 2HHQA 3HYFA 4B9SA 4FZYA 4FK2A 4KHSA 1D9FA 1S9EA 3TI0A 4O0JA 3D45A 3V9ZA 2YNIA 5HROA 3QIOA 1Z26A 1ZBLA 1LW0A 4CEAA 4KRFA 1S1XA 1X1PA 4M3XA 1C1BA 4JS5A 1U47A 3LP1A 1KLNA 1BI4B 4DLEA 3NDKA 2B5JA 3O4QA 3DLEA 1LV5A 4FM0A 1BCOA 4CEEA 3ITHA 4FLTA 3HT3A 4IG3A 5C24A 3CFRA 3QEIA 4ELUA 1RBSA 1S5JA 2D0AA 3LALA 3T1AA 4DTMA 4GVMA 2IC3A 3KLIA 1CZ9A 3OYAA 4KHUA 2KTQA 4G1QA 5FRNA 1I39A 4RW6A 1QSLA 1VSJA 3LP0A 1YT3A 4KTQA 3DI6A 4FCYA 4E3SA 1HQUA 4DSLA 4OPJA 3TAMA 3DRPA 1GOCA 5CZ1A 2DFEA 3LP2A 2X78A 3SJJA 3NE6A 2EHGA 4YFUA 1SUQA 1NK0A 3ZT4A 3LZJA 2KZMA 4CJUA 3DLGA 4IFVA 1U45A 3RRGA 5J1EA 2D5RA 3AVHA 1RILA 5J2QA 1X9SA 1NOYA 5KRTA 4RW4A 1RBRA 4O55A 4E89A 1TKDA 4PWDA 1WSJA 2XY5A 3PY8A 3PO5A 1YVUA 3CYMA 4FLXA 3H08A 1K6YA 3P1GA 2GV9A 1RBUA 4KI6A 5DK5A 4EP4A 4M3UA 5JS2A 1ASWA 2D0BA 3AO5A 4M45A 4CJFA 1WAJA 3EYZA 3SI6A 4JRQA 4C8KA 3SUNA 2YNGA 4EP5A 4Z4IA 1KCFA 1DLOA 1SKRA 4N76A 4EZ6A 3HK2A 3QERA 4ID1A 3AVCA 1FXXA 1C6VA 2P51A 5KTQA 4DTPA 1XHZA 3DLKA 1O1WA 1VSEA 3LZIA 4DMNA 1WAFA 2ETJA 4JRPA 4FM2A 4YNQA 3V1OA 1RDDA 3ZSQA 2YHAA 3M8SA 5HLFA 1JL2A 4CGIA 3IAYA 4EZ9A 3AVGA 1XC9A 2OA8A 1WNSA 4E7JA 4Z4GA 3K2PA 2EX3A 3CFOA 1TV6A 2ZE2A 3AV9A 3AVLA 3OS2A 1U4BA 4FM1A 4CJ4A 3T3FA 3I0SA 2Z1HA 3VQ6A 3V9SA 4K8XA 1TKTA 2ZQBA 3M8QA 2YNHA 5SZTA 4HUGA 4DSFA 3O3GA 2QKBA 4HHTA 4BE0A 3TAEA 1HQEA 3K5LA 1EP4A 4DG1A 5KRSA 3K58A 3A2FA 3RMAA 1KRPA 4CGHA 3HL8A 2VWKA 4IBNA 1UAXA 1IKVA 1C0MA 3AO3A 3OJUA 1BISA 1HNIA 3NF7A 4CFCA 3SZ2A 1EKEA 4HCBA 3SPZA 3ISNC 3MXMA 2HHXA 1RNHA 1TGOA 4CJKA 4Q0BA 1HNVA 4KHNA 4CFAA 1IO2A 3V4IA 1NJXA 1T05A 1WLJA 3HPHA 3K59A 3B6OA 3L8BA 2IAJA 4OLBA 1KFDA 1TK0A 3F9KA 2KZZA 4DU3A 4FJKA 4MQ3A 3OS0A 4KTZA 2JLEA 3NAEA 4Y1CA 2DFFA 2E6MA 4DFMA 3VQ8A 4CCHA 4CK2A 4XIUA 1EX4A 2E4LA 3G10A 4Y1DA 3ZSYA 5EU7A 1NK6A 1NK7A 4HCCA 4M3WA 3TAGA 3MXJA 3HO1A 1VSIA 2Y1IA 2BDPA 1B92A 1JLBA 3LP3A 4CJTA 3O3HA 3RMDA 4FZXC 4MFBA 4DFKA 3IG1A 4N5SA 1A5XA 3OYBA 4PUOA 3RTVA 3HVTA 2LSNA 3VQDA 4B9TA 3O4NA 2BE2A 1RT7A 1XWLA 1BIZA 4OKEA 1SL1A 4CF2A 4DF8A 5JS1A 3SUPA 1RDBA 4TSXA 2FBTA 1RT1A 1VRUA 1ZBUA 3ZT0A 4FLWA 1RCHA 3K5NA 4DFJA 3F73A 2PY5A 1TVRA 3AVMA 3QINA 4RW7A 3JSMA 2HHVA 3OVNA 1IH7A 3WNFA 3ALYA 3NF9A 4Z4HA 4CF8A 4HUEA 3QESA 2E6LA 3SPYA 3T19A 4W5RA 4FJNA 2GBZA 1D9DA 1J54A 4O44A 4OVLA 3ZCMA 3SUQA 1R0AA 3L3UA 1EETA 3AVBA 3KKRA 3JYTA 3SV4A 2P5GA 4OLAA 1Q9XA 3ZSRA 4CHNA 1A5VA 1JLCA 5HRSA 4M3TA 3MEGA 1IKYA 5CYQA 3AO1A 4B08A 4L8RB 2G8WA 4CECA 1ZBFA 3QEVA 4BDPA 1LWFA 1Q8IA 1S1TA 2YV0X 1KTQA 4AHTA 3OYNA 3S9HA 2NUBA 1SV5A 1T8EA 1S1WA 4FLVA 3QNOA 4M41A 3OYLA 2G8UA 1RT5A 1HPZA 3NGIA 3AA4A 3VQ9A 4ELTA 2B6AA 5KGWA 1LAVA 4DF4A 2FC0A 3C94A 1GOAA 1S9GA 5FROA 3ZSZA 2G8VA 3NF6A 3ZT1A 3EY1A 4BE1A 1VSFA 1QS4A 2VG7A 1NK5A 2YKNA 4GW6A 1X9MA 4Z4FA 1TAUA 3K57A 1VRTA 4CESA 4DTSA 2FBVA 4OJRA 3OY9A 4E7HA 1VSDA 2Z1JA 1GOBA 1VSLA 1XI1A 3KLFA 1RBTA 2HB5A 4KPYA 2OYQA 1IG9A 4BWJA 1B9DA 2HNYA 3V1QA 4F4KA 3AVKA 3DYAA 4CEBA 4KREA 1ASVA 3VA3A 3TAQA 3LWLA 3KIOA 3HXMA 2A1RA 1KSPA 4F2SA 2HVHA 5CZ2A 3NCIA 4E7IA 4DQRA 3PX6A 3DLRA 4DTUA 1UA0A 3CQ8A 3NH2A 3PUFA 3WNGA 4HUFA 4DTXA 4ELVA 3V9XA 1WN7A 4N56A 4QAGA 4DTNA 3CG7A 4CGFA 4CK3A 5I3UA 1LW2A 4C8NA 3KTQA 3FFIA 4KI4A 1YTUA 2KQ2A 3V6DA 3C6TA 5SWMA 4NCGA 2Z1IA 2RPIA 2PYLA 2OZSA 4ICLA 3M8PA 3KLEA 2ATQA 4FJJA 4LH5A 1RDAA 4H4OA 3MECA 3DLBA 3ZT2A 3UIQA 3KKSA 4KB1A 2YNFA 2IS3A 4E7KA 3SQ2A 1NK9A 1X9WA 4FK4A 3NGYA 2FBXA 3VQ4A 3M8RA 4PY5A 4OGCA 1ZBIA 2OPPA 5J2PA 1SKWA 1BQNA 2X6SA 4ZTJA 3ZSOA 1UA1A 4I9QA 3OYIA 3NBPA 4Z4EA 1UWBA 3LAKA 3IRXA 4B9NA 1U04A 2OPSA 3RMCA 4CJSA 2HVIA 1RTDA 2PYJA 4FLUA 3U3YA 3PX4A 1C1CA 3KD5E 1UOCA 1CLQA 1W9HA 4W5QA 4CJRA 3VQCA 1NOZA 4KHWA 4AHSA 3DLHA 4B9VA 5K14A 2XY6A 1U48A 3RRHA 3TAPA 4LH4A 1U49A 1SL0A 1N5YA 2F8TA 4FJHA 3V9UA 1CZBA 1KFSA 4GMJB 1EXQA 3SQ0A 1C0TA 1BHLA 4I7FA 1HMVA 4JS4A 1WSGA 1L3SA 3SQ4A 3HP6A 4NYFA 4FYDA 1L3UA 5HP1A 1NJZA 3BGRA 3O3FA 4DTRA 3SCXA 3WNEA 1FKOA 4DLGA 3C6UA 1MU2A 4CEZA 1BL3A 2GUIA 3DRSA 4AHUA 4M3YA 4DTJA 1JL1A 3KK2A 2O4IA 4AILC 4B9MA 4KHQA 4AHCA 3V1RA 4CHZA 4FJ7A 1LAWA 3LPTA 3TWHA 4PQUA 2O4GA 4N47A 1CXQA 1S6PA 4BWMA 3LAMA 4CE9A 4FLZA 1NK8A 1TL3A 1KVAA 2RN2A 2OPQA 1L3VA 3TANA 3RR8A 4J2DA 1LWEA 3L2RA 4E1NA 1W0HA 4O4GA 4RW8A 3NH1A 3OYCA 4DU1A 4DFPA 4KO0A 1J53A 1TAQA 1JLEA 3ZSWA 2G8IA 4RW9A 1Q9YA 4CGGA 3RR7A 1JLAA 1B9FA 1S1UA 1WSIA 5C42A 4BACA 5FDLA 4KAZA 5FRMA 1A5WA 3PV8A 4CJ5A 4F2RA 5DMRA 4HTUA 1I3AA 5CYMA 2QXFA 1NKCA 4DSKA 2HHWA 1ASUA 2KFZA 5HRPA 3DM2A 4BDYA 1JLQA 2I5JA 2XRIA 1NKBA 1XHXA 1L3TA 5I42A 4LY7A 4M3RA 4Z4CA 3NH0A 4IKFA 4B3OA 2ZD1A 4I9LA 4ZHRA 3DOKA 3QEPA 4E1MA 1VSHA 1QSYA 2BGGA 1VSKA 4FXDA 1VSMA 4KKOA 1TKZA 3NFAA 4OPKA 2VG5A 1G15A 2DFHA 1DTTA 4CJEA 4OKJA 4CK1A 3S3OA 4KB0A 4FZZA 1LWCA 5CY4A 1REVA 2RKIA 4KFBA 3IS9A 3V81A 4CJ3A 3D0PA 4O0IA 3KLHA 3L2VA 3K5MA 4FJ8A 1BIUA 3AVJA 4CJVA 1RTHA 4CHQA 4DQIA 2AJQA 4FVMA 2QKKA 3CFPA 4QOZB 2QK9A 1JKHA 4CEOA 2XY8A
chains in the Genus database with same CATH superfamily
3CETA 4CIFA 3HSCA 3CM5A 1OH6A 3VPZA 4B3RK 1NMDA 3MEEA 4I2PA 4B9LA 3HPGA 4CF0A 1V4SA 4NLBA 1VQ8N 1WSFA 3I0RA 3ZT3A 4KHPK 4H5WA 4JK7A 1TYQA 1VK0A 3SMSA 4KHYA 4BC5A 2QM1A 4AHRA 4B1ZA 1BDGA 5HL7L 4J2AA 1KLMA 1IBMK 1LOTB 2YX6A 3B6PA 1QTMA 2F8SA 3DJCA 1TK5A 4IWVA 4C8MA 4E0DA 2FF3B 4FJLA 4DB3A 3ULDA 4AQYK 3LWMA 1RT4A 4CJPA 4WF9L 3RWUA 1JJ2M 3ZSVA 4CHPA 4YOWA 3ID8A 4DKWA 4AH9A 3TU5A 2VWJA 4M63C 4DQSA 3U6FA 3THVA 4F3OA 2NLXA 4R5PA 2KW4A 4H0PA 3TSUA 1S6QA 4H4MA 3G71N 1WBDA 1CZAN 1X3NA 2XHBA 3DOLA 2CH5A 1XMOK 1Z25A 3IKMA 1YXQA 4I2QA 3S3NA 4QCLA 2HHSA 5AR0A 5CR4A 1HYZA 2Y1JA 3VN5A 3E01A 3LANA 4FWSA 3SBTA 3QLHA 3VTIA 5E41A 2HHUA 1E4GT 1ATSA 3PO4A 2DTUA 4FJGA 3MXIA 1JXEA 4H8KA 4IO9L 2D1KA 4K8ZA 3CERA 5KGXA 3HM9A 1HR0K 1T3VA 2ZGYA 3C7NB 1RTJA 3VQ5A 3N4PA 3VQQA 3KZBA 5AQTA 1OH8A 4PA1A 4KV8A 4B1YB 1RDCA 2HSTA 3CJCA 1NJWA 2PAVA 4FWKA 3EE9A 4YDUA 2ASOA 4DWIA 1TL1A 3OYFA 4CEDA 2QWOA 3H3OB 2O8FB 1IKWA 3H3NO 5AZJA 4CFDA 2G8KA 1L5UA 3G25A 1BU6O 4B9SA 4IXCA 1D9FA 4O0JA 3D45A 4LF6K 3C0BA 2YNIA 2V7ZA 4KH5A 4KRFA 3LP1A 5AQXA 3NDKA 1C0GA 2O8BA 1LV5A 1BCOA 4CEEA 3PLAA 3EEQA 3CFRA 1KD1O 5ELZA 3T1AA 4DV5K 3OYAA 1CZ9A 1I39A 4YOVA 5KPTA 1ZBSA 5GIOA 3DRPA 2RE2A 3WQTA 3CCSN 1NK0A 4LF4K 4CJUA 3AY9A 4DR1K 4X66K 5FPMA 4BG9A 1K8KA 1RILA 1X9SA 5AZJB 5KRTA 1OKJA 1RBRA 1XUPO 1TKDA 2XY5A 3ULEA 1YVUA 3CYMA 3FFKB 2Q31A 2OCEA 2GV9A 4A2BA 4M3UA 4EP4A 4M45A 1WAJA 4C8KA 3O1WA 1DLOA 2DPNA 4FWLA 1Q7YO 1SKRA 5EVZA 2O8BB 3M3ZA 1VQLN 1XHZA 1O1WA 1VSEA 3VF2A 1M1KO 5JVGL 2YHAA 3CC2N 1JL2A 4CGIA 4EZ9A 3ID6A 2EX3A 1QQNA 1TV6A 2ZE2A 3OS2A 4FM1A 1GLDG 1VQKN 4CZIA 1JCGA 4HHTA 2HBKA 3OHRA 4PKIA 1N33K 1OVQA 3HL8A 1K8KB 4JK8A 1IKVA 1HNIA 4QS8A 4HCBA 3O6WA 1T44A 1HNVA 3ULEB 1ZXOA 1NJXA 4MO5A 4CVNE 3K59A 4MDAA 3MWTA 3L8BA 4YHHK 3SJHA 4WQ5A 2ZF5O 4DU3A 3OS0A 4KTZA 2JLEA 2E6MA 4H5TA 1EX4A 2E4LA 3G10A 3CCJN 3N4QA 4WQ4C 1NK7A 3TTFA 3PSIA 1B92A 1JLBA 3LP3A 3O3HA 3E9LA 4N5SA 4IEIA 1QZ6A 3O4WA 2LSNA 3O4NA 3GOIA 2QWPA 1XWLA 1N8RO 1BIZA 3KK7A 4OKEA 3QBWA 4DF8A 5JS1A 1HLUA 5KQDA 1ZBUA 1RCHA 3CCUN 2PY5A 2E2PA 1TVRA 3QINA 3OVNA 1IH7A 1SS6A 3ZETA 4FWMA 3NF9A 3QDKA 3SPYA 1XQSC 3QESA 1NLVA 4FJNA 2GBZA 3SV4A 4JI0K 1Q9XA 5E26A 2CH6A 1A5VA 2VQFK 1NGGA 5EX5A 4CECA 1EQYA 5JLFA 4AHTA 2YV0X 1VQ4N 1XNRK 3OYLA 3NGIA 4IDHA 1P8ZA 3D2EB 1S9GA 5FROA 2WFBA 4KH4A 3ZSZA 4DV6K 1HKBA 2VG7A 4BR9A 3CCVN 3K57A 3OY9A 4JKDA 4E7HA 2Z1JA 2A3ZA 2QI2A 1RBTA 2O8CA 4BWJA 1B9DA 1K73O 1WUAA 4IOAL 4LFCK 3ZETB 4LF8K 4DQRA 3DLRA 4ELVA 2P9KB 3AGRA 3VEZA 4CGFA 3QICA 4CK3A 3KTQA 4C8NA 1YTUA 2UXDK 4H5VA 3JAMO 1C0FA 5SWMA 4NCGA 2Z1IA 2RPIA 1U2VA 1HJOA 2ATQA 3KWGA 3ZLJA 1NK9A 5TKYA 2OPPA 3Q7BA 2YHWA 3ZSOA 1UA1A 1NG9A 3CC4N 3IRXA 2OPSA 4CJSA 3OA9A 2AP1A 3VGKA 1C1CA 2QW9A 1W9HA 3SAGA 4KHWA 2HHHK 2KKZA 5CHIA 1SL0A 1U49A 4FJHA 3V9UA 4GMJB 4CD1A 1C0TA 4I7FA 4JEPA 1HMVA 4JS4A 4OO1J 3SQ4A 3WNEA 2A5XA 4CEZA 4F9OA 3GE1A 4XEIA 4DTJA 2O4IA 3MN9A 1U2VB 4B9MA 4KHQA 3A5NC 4FJ7A 1LAWA 1S6PA 1HPMA 2WTUA 1KVAA 2FLOA 3NH1A 3K0SA 3VESA 5DM7L 3CHWA 4XH4A 3LL3A 4E1JA 1N32K 1WSIA 3K9KA 5FRMA 5FDLA 3TTDA 4CJ5A 4F2RA 1GLLO 4HTUA 5AQQA 1WBBA 5BPMA 4DSKA 2HHWA 1ASUA 5B8HA 3HTVA 4FOEA 4IKFA 1FJGK 4FXDA 1TKZA 4OPKA 4IJNA 2VG5A 3LDNA 2DFHA 4CK1A 2P9UB 3V81A 1NGDA 4CJ3A 3CIPA 5AQPA 1XMQK 1NWKA 2O8EA 1BIUA 1RTHA 2QKKA 5EOYA 1JKHA 4CHOA 4K42A 2UUBK 4FLYA 1KVBA 1TK8A 2PZSA 3RVCA 4BRNA 5J2NA 5HBMA 3OJSA 4DCHA 4BR5A 3MCPA 3RMBA 3O9RA 3TTCA 5IT9O 1VQ6N 1Y97A 3HPOA 2NRHA 3S3MA 1KQSM 3LPUA 1T7PA 4ISGA 4WE1A 3J7YP 5AQVA 3CMEN 2Q3SA 1P90A 5GAEP 4A2AA 3BEXA 3PIOL 3CD6N 4MDBA 4F8RA 4C8LA 2IGIA 4CZMA 3L2UA 3VQPA 3THYA 1RT3A 4FPBA 1IV0A 4Q5VA 1FK9A 2IIRA 3G0ZA 2VG6A 2O8EB 4CIEA 1WOQA 3U3GA 4CF9A 4LF9K 1CXUA 3AVFA 1BGXT 1C0UA 4YOXA 2CGKA 4WYBA 4FWRA 3ASMA 3UB5A 5KPRA 3SYZA 4DSIA 4IJAA 3PX0A 3V9WA 1RTIA 2X6NA 2W42A 5AQRA 5LMNK 1BOTO 3ZEUA 4ID5A 3HP9A 4DS5A 1HYVA 2JGUA 4CIGA 3ENBA 3L2QA 3CCLN 4FJ9A 2W41A 1BWFO 4JAXA 3O08A 3T1HK 3OYHA 4DV1K 4CBXA 4B8CA 1GLFO 3ATUA 1VAZA 1S22A 4YDUC 3QETA 3LDLA 5F2RA 2XO7A 4OPHA 1NMNA 3BUZB 4HTLA 5HRNA 4KTWA 4DTOA 1SKSA 5AQSA 1H1VA 4N41A 4X62K 2OZMA 3THYB 1BQMA 4JD2A 4BDZA 3QEWA 4FW1A 4WFAL 4W5OA 4IOXA 4FWNA 1HNZK 1JLFA 4JI3K 1QSSA 4CW7B 1HNWK 1S3XA 1VHXA 3FE1A 4IO8A 5AQJA 5GAHP 3U9ZA 3KLGA 2ZM6K 3AO4A 3M5RA 2J4RA 4JI7K 4OGEA 1D5AA 3OYDA 3VA0A 2FXUA 5C10A 3L3VA 3SQ1A 3ZEUB 3VEXA 4A5BA 1RDUA 4CZEA 4NCAA 1S1VA 2Z1GA 4LSNA 5AFUH 4UQGA 3DRRA 3A0IX 4DR3K 1VQ7N 3AA5X 3LDSA 2KFNA 1HJRA 3P39A 5HRRA 3SMPA 1JCEA 2FBYA 4M42A 3GL1A 5J2MA 1F21A 3R9PA 3BZCA 1NKEA 1YTAA 1SAZA 1XC3A 3AAPA 3MWPA 2HHQA 2CGLA 3HYFA 4JD2B 1S9EA 2E8AA 2E1ZA 1Z26A 2NRWA 1LW0A 1QQMA 2P9IA 2F7TA 2QTDA 4JS5A 4DV0K 2ZJQL 3DLEA 4FM0A 3ITHA 1GLEG 4ELUA 1S5JA 4CZJA 3LALA 4GNIA 2IC3A 3CCRN 2KTQA 1GLBG 1QSLA 3MX2A 1YT3A 4OPJA 2EWSA 2DFEA 3NE6A 1SUQA 3ZT4A 2V51B 3DLGA 5LMUK 3RRGA 4HWIA 4JHDA 5J1EA 3CC7N 3AVHA 3E66A 4E89A 3PY8A 1NGHA 4FLXA 4KI6A 5DK5A 1E3MA 3SAFA 4CJFA 3SI6A 3C7NA 1KCFA 2P9IB 3QMLA 5GIPA 5TKWA 4N76A 3QERA 4ID1A 2NNWA 4DTPA 5BRFA 4DMNA 4CZKA 4FM2A 3PSFA 3U9DA 1RDDA 3ZSQA 4DQ8A 1Q18A 2YJEA 3CJ9A 2NRZA 2QWNA 3VERA 5HOOA 2OA8A 3K2PA 4JKAA 1YITN 2ASMA 2O8FA 4K8XA 1TKTA 2ZQBA 1TUYA 4X65K 4H0TB 3P31A 1HQEA 1NGJA 1KRPA 4JHDB 5AQYA 3NF7A 3SZ2A 3SPZA 3ISNC 3MXMA 1RNHA 4QS9A 3BY5A 4LF5K 1OH5A 3J8AA 4KHNA 4CFAA 3V4IA 3B6OA 2IAJA 3WXJA 1TK0A 4ISFA 5MLCQ 4MQ3A 4FJKA 4M7YA 4FL9A 4CCHA 3VEWA 5EU7A 1NK6A 2WUSA 3MXJA 3HO1A 1HNXK 1VSIA 2Y1IA 1IBKK 4CJTA 3ZX3A 3THXA 1YUWA 2YHYA 4BRGA 3CCMN 1A5XA 4B9TA 1RT7A 4MLEA 5LL6Z 4CF2A 3LM2A 3T69A 2FBTA 4FLWA 3ZT0A 1BG3A 3F73A 3AVMA 3TSPA 3JSMA 3OBWA 3ALYA 4BR7A 4Z4HA 2ZGZA 1K8AO 4BQZA 2E6LA 3FZLA 4JK9A 3P38A 2FSKA 1D9DA 4O8UA 1J54A 4OVLA 1EWRA 3L3UA 1OH7A 1EETA 3KHYA 4LC9B 4CHNA 1JLCA 3MEGA 4LF7K 1IKYA 3E9OA 5CYQA 1ZBFA 3QEVA 1Q8IA 2NUBA 3QNOA 1RT5A 1HPZA 3AA4A 5BR9A 5KGWA 1YJ9N 3THXB 3T1YK 1GOAA 2G8VA 5M1FA 2GX9A 3NF6A 2GWKA 4A59A 3EY1A 4BC3A 4GV9A 1KAZA 4KH6A 1VRTA 4CESA 3GDQA 2FF6A 1XI1A 3KLFA 4K43A 5AQHA 4AM6A 4WFNL 3I56N 1IG9A 4F4KA 3QB0A 4JKGA 4CZLA 4EAHD 4KREA 3VA3A 2QA4N 4U7BA 3NCIA 1UA0A 2PFUA 1WN7A 4QAGA 4A5AA 4U67L 5I3UA 3A8YA 3GBTA 2Q36A 4JNEA 5C2FA 4B1XB 2OZSA 4ICLA 3WEEA 4FJJA 5M1KA 1RGIA 1DT9A 4LH5A 1RDAA 2GELA 4KB1A 3UIQA 1X9WA 4FK4A 2FBXA 4PY5A 2NRVA 1BQNA 1OVYA 4ZTJA 1BA1A 1LCUA 1NGIA 3NBPA 4Z4EA 1DGKN 4H0VB 1RTDA 2PYJA 4FLUA 4XH5A 1UOCA 4BRPA 1CLQA 4W5QA 4CJRA 2KLAA 4CBUA 4JKGB 4B9VA 1U48A 1ILYA 3RRHA 1N5YA 1KFSA 1EXQA 1BHLA 4DR4K 3BGRA 3O3FA 3SCXA 3QFPA 3C6UA 3DRSA 2GUIA 1V4TA 4CZGA 2QWMA 3Q7CA 4AILC 2OTJN 3WEEB 3VEOA 3TWHA 4BY9C 4GVEA 4N47A 4FLZA 2O8DA 4J2DA 3RR8A 3D2EA 3EKUA 2VGNA 4DU1A 4KO0A 4G9ZA 1JLAA 1B9FA 1EWQA 2YJFA 4BRFA 2QXFA 1KC8O 2KFZA 5HRPA 3H1VX 3DM2A 2XRIA 1L3TA 5C2DA 2P9KA 4I9LA 3DOKA 3HRGA 4E1MA 1VSKA 4NXMK 4BRQA 3L0QA 4FZZA 5JLHA 2A40A 1LWCA 5CY4A 4KFBA 3IS9A 1BO5O 3EE8A 2GWJA 3L2VA 3K5MA 4FJ8A 5BPLA 4CHQA 3BZKA 3CFPA 2XY8A 2O8DB 3DWLA 2HHTA 4BE2A 2ASPA 3AVIA 2RF2A 3C95A 5C25A 4H0YB 4DSJA 3AVNA 5AQZA 1ZYQA 4BGBA 2UUAK 3AVAA 1KVCA 3SLCA 2QWQA 1FKPA 2ITGA 2HMIA 3TABA 3TARA 4J2EA 3R6MA 1QZ5A 3MK6A 4E19A 1EO1A 4LD0A 4FW2A 3GG4A 5BN9A 1MWKA 1JXBA 3OYKA 3BP8A 2VWBA 4BROA 4E7LA 3HSTB 4FWQA 1WSEA 2E2QA 4JKFA 3MDQA 2WONA 3IUCA 3QO9A 4BR2A 5GINA 4NLCA 3AA2A 1IKXA 1HKCA 2D0CA 3MEDA 4W5TA 3TAFA 4K25A 3TR8A 4BQLA 2D0PA 4IG0A 3CJAA 2HW3A 2DY4A 1NGFA 1Z6RA 4RTFD 5FPNA 2NRXA 4EHTA 3VQEA 3ZSXA 4I6MB 3W0LA 3CCEN 1SL2A 3QEXA 4DV2K 5JVHL 4ZTFA 4PKGA 4CHYA 5F0XA 5LJVA 1ZC6A 3BDPA 4IDKA 4CEQA 1N6QA 3LDOA 2H3GX 3DMJA 3HM8A 3NHGA 3DXKB 4LSLA 3SNNA 1YAGA 3KJVA 2XY7A 3E1YA 3EKSA 5KI6A 2P9UA 1QQOA 4CF1A 4Z94A 3QIPA 2VQEK 4BR0A 4BRIA 3VTHA 4CEFA 4DS4A 2X74A 4RG8A 3HVRA 2R7YA 1BUPA 1RFQA 4NXNK 1QE1A 4JI5K 4FJMA 2IOCA 2BTFA 1G99A 5JMVA 3KWIA 4JYAK 2HF3A 4CJQA 4Z0UA 2HOEA 4B8AB 1JLGA 1J6ZA 4CJWA 3J7ZO 4BRKA 3EZ5A 3C6AA 5LY3A 3KK1A 1XNQK 3M1FA 4C8OA 1NK4A 2I7NA 3VQAA 2E88A 3WQUA 1DTQA 3R3LA 1WSHA 4CJLA 2HNZA 2IDOA 2OPRA 4FZYA 2P9LA 1SZ2A 3O9SA 5M1QA 4JKBA 3QIOA 1ZBLA 1VQ9N 4B3MK 4CEAA 3RSEA 1KLNA 4DLEA 2B5JA 3CJ1A 4IG3A 4WQ4A 5C24A 3VOVA 3QEIA 1Q86O 1IBLK 1RBSA 2D0AA 3KLIA 3NVKA 5GADP 5FRNA 1VSJA 3L4IA 3LP0A 2HMPA 3DI6A 4FCYA 4E3SA 1HQUA 1N34K 3TAMA 2HBMA 3HZ6A 1GOCA 3A5MC 1X3MA 3D2FA 3LP2A 4CZHA 5GAGP 2KZMA 3OW2M 1U45A 4DR6K 5CE3A 3CPWM 4MO4A 4RW4A 4XH1A 1WSJA 3U8XA 4H0OA 3H08A 2P9LB 3P1GA 1RBUA 4B1VA 1BA0A 5JS2A 3K9JA 1ASWA 2D0BA 2WC9A 4JRQA 4BREA 2YNGA 1NNEA 3RSEB 5H1SQ 4Y0WA 1YJWN 2NRRA 3AVCA 1FXXA 1C6VA 5KTQA 1ATRA 3R1XA 3LZIA 3WUHA 1WAFA 2YHXA 1W97L 2ETJA 3SAHA 4JRPA 4OX9K 3O1BA 3M8SA 5HLFA 3SBGA 3H1QA 3IAYA 3AVGA 1XC9A 4Z4GA 4E7JA 3ZYYX 4AF1A 3CI5A 1U4BA 4CJ4A 3VQ6A 3D2FB 3M8QA 4HUGA 4DSFA 5KPZA 4BE0A 1EP4A 5KRSA 3A2FA 4CGHA 3TSQA 1C0MA 3AO3A 4NO7A 1EKEA 2HBLA 3CCQN 2HHXA 1YVNA 2Q0RA 1IO2A 5IWAK 1NJIO 1WLJA 3HPHA 4M7XA 4OLBA 4RCHA 3DLLL 3F9KA 4PL8A 3NAEA 4DFMA 1GLAG 3VQ8A 1NGCA 4XIUA 4Y1DA 5ADXH 3MN5A 3TAGA 4JKEA 2UU9K 3RMDA 1YHQN 3OYBA 3RTVA 3HVTA 3CJBA 2F4VK 3VQDA 3I55N 2BE2A 4GV3A 1QVFM 1VQMN 4TSXA 1RT1A 1VRUA 3K5NA 2HHVA 3WNFA 4H0XB 4DHYA 5BPNA 5E84A 4K0KK 2E20A 5AQOA 4DV4K 4CBWA 1NGEA 3ZCMA 1R0AA 2OANA 4WCEL 3AVBA 3KKRA 3JYTA 5HRSA 4M3TA 3QBXA 4L8RB 3AO1A 4B08A 2G8WA 3D6RA 4BDPA 2CGJA 1S1TA 4JI4K 1KTQA 3OYNA 4O8KA 3S9HA 4CD3A 2G8UA 4JI8K 5FPEA 2P9PA 4ISEA 3VQ9A 4BRAA 1LAVA 1HX1A 3U4LA 4DF4A 2FC0A 1YIJN 3FZFA 4BE1A 1TAUA 2YKNA 4GW6A 4DTSA 1QVGM 3FZKA 1VSDA 2FSNA 2P9SA 1I94K 4L3QA 2KHOA 4JKHA 3V1QA 3VMFB 3DYAA 4CEBA 1ASVA 3TAQA 3LWLA 3HXMA 5M1PA 3AGKA 2HVHA 5CZ2A 5AQFA 4DTUA 3NH2A 3WNGA 3M6GA 4N56A 3CG7A 4FPAA 4KI4A 1LW2A 4WQ5C 3FFIA 2E2OA 3MN6A 3V6DA 1FW6A 3G4SN 3F5TA 2PYLA 3CF5L 3M8PA 5BREA 3KLEA 2NZTA 2E5LK 4H4OA 5DM6L 3MECA 4A57A 3DLBA 3ZT2A 1RDWX 3KKSA 1VQNN 2P9PB 3M8RA 3H45C 4OGCA 5J2PA 1SKWA 2X6SA 4NB4A 4DV7K 3DXMA 4I9QA 4JKCA 3OYIA 1UWBA 3LAKA 4B9NA 1U04A 3OBYA 2HVIA 2P9SB 4KBOA 3KD5E 3U3YA 2E2NA 1X9JA 4AHSA 4V19S 3TAPA 4LH4A 1VQON 1TYQB 1CZBA 3SQ0A 5C12A 1U6ZA 3HP6A 5HP1A 1NJZA 2GEMA 1MU2A 1YJNN 4M3YA 4GKJK 1JL1A 1N36K 4CHZA 3KVGA 4PQUA 4CE9A 3VF4A 3LAMA 1NK8A 1TL3A 2JWKA 2OPQA 1HUXA 1W0HA 4RW8A 2P9NA 4LFBK 2WBNA 1TAQA 4JI1K 1JLEA 1K9MO 3QFUA 2G8IA 4RW9A 4YY3K 3DXMB 1S1UA 4KAZA 3UKUA 1A5WA 5A2QO 1D4XA 1IJJA 5EY4A 1NKCA 4BDYA 3FZHA 1Q82O 3PIPL 2QEXN 5I42A 4Z4CA 4IFEA 4DUYK 4PKHA 4B3OA 2ZD1A 4ZHRA 3FGUA 1VSHA 3O8MA 1VSMA 2IVPA 3LDQA 1G15A 2A6AA 1DTTA 4CJEA 4OKJA 4KB0A 4LFAK 2RKIA 4O0IA 1MA9B 2VYPA 3KLHA 3EO3A 2AJQA 3AVJA 4DQIA 4FZXC 4CEOA 4M3XA 1RBVA 5AQKA 2P9NB 4CGDA 3VGLA 4W5NA 5D3GA 5T7BA 3QNNA 1E4FT 5KQ8A 2P5OA 3UKUB 4QS7A 3HOSA 4FJXA 5AQWA 1J9AA 4O5BA 3EL2A 3OYJA 1SQKA 3AA3A 3L2WA 3K5OA 1TKXA 3OS1A 2G8FA 1RT2A 4DSEA 4J2BA 2BANA 2W6LA 4HVJA 3SUOA 2B4JA 1MWMA 3OYGA 3I8DA 3KK3A 4EHUA 1J5EK 4DQPA 4OKKA 1HRHA 2D4WA 1VQ5N 4NYNA 5AQUA 4DQQA 4H03B 4GKKK 4DU4A 4BG8A 4FJ5A 4DR2K 3HBTA 5EXWA 2OTLN 3WNHA 4IFYA 3PV8A 4CFBA 2I7PA 4FK0A 2F96A 3NGZA 2GUPA 4IOCL 3SV3A 1NGBA 2WOMA 4YORA 3VQBA 3WXLA 2Q2RA 1HYSA 2AA4A 4DV3K 3HJFA 2D0OA 1NJYA 3P4IA 4B9UA 1ZBHA 4FJIA 3E9PA 5FPDA 2W40A 3J81O 3FLCO 4NCBA 5LJWA 1DKGD 2IVNA 4A61A 2HNDA 3A5OC 5JICA 1GLCG 3JS6A 2ZWHA 1RT6A 4F3TA 2V52B 4JLHA 2NRTA 4CJ7A 4BRDA 5FLXO 3OYEA 3AO2A 4PL7A 1W7AA 3A5LC 1QQCA 3P83D 5BRHA 4BC2A 1C1AA 1BI4A 4FOIA 3CM6A 3VQ7A 4CERA 1QHTA 4K41A 2G8HA 1ESVA 4JV5K 2FSJA 2YKMA 1ITGA 4O5FA 2A1SA 3O9UA 1J5OA 2VGMA 4CGJA 2P1JA 1JCFA 3FZMA 3P5JA 1T03A 3KD1E 2QWRA 4FWOA 3MAQA 3NF8A 4BVPA 2YHBA 2JWLA 1D8YA 3OYMA 4AHVA 3THWA 3L6QA 1BCMA 3WT0A 4B3TK 1VQPN 4FK2A 4KHSA 4YOUA 3TI0A 3V9ZA 4FO0A 4BVOA 5HROA 4JN4A 2BH1A 1KAXA 4I6MA 5AQLA 1S1XA 1X1PA 1C1BA 1U47A 1BI4B 3O4QA 1YI2N 4FLTA 3HT3A 3VETA 4YOYA 4KHUA 4DTMA 3CQXA 4GVMA 4G1QA 4RW6A 3ENOA 3DXKA 4KTQA 4DSLA 1W2BM 5AZIA 3BF1A 2QXLA 5CZ1A 2X78A 3SJJA 2EHGA 5BN8A 3VEYA 4YFUA 3G6EN 1Z05A 3LZJA 4IFVA 2UUCK 2D5RA 5J2QA 1ATNA 1NOYA 2Q0UA 1S72N 4WFBL 3D7EO 4O55A 3IMXA 4PWDA 1NGAA 3THWB 5C15A 3PO5A 4JI2K 1K6YA 5AQGA 3O9TA 2VCPA 3AO5A 3EYZA 4C1NI 3SUNA 3CXCM 4EP5A 4Z4IA 4EZ6A 3HK2A 3WXKA 2P51A 2UYTA 3DLKA 3I8BA 4YNQA 3V1OA 5ADXA 3ATVA 3SK3A 2Q97A 1WNSA 4GV6A 4FWPA 3UKRA 3CFOA 3AV9A 3AVLA 5AZIB 3UE5A 5AFUA 3T3FA 3I0SA 2Z1HA 3V9SA 4B1UB 2YNHA 5SZTA 3O3GA 2QKBA 3TAEA 4H5NA 3K5LA 4JI6K 1IG8A 4DG1A 3K58A 3RMAA 1NBWA 2O8CB 2VWKA 4IBNA 1MDUB 1UAXA 3OJUA 1BISA 4CFCA 3C6HA 4C1NK 1TGOA 4IEEA 4CJKA 4RWTA 2UXBK 4Q0BA 4B1WB 2ITMA 1T05A 1QHAA 1KFDA 3J7AP 5BRDA 3VGMA 3W3DA 2KZZA 3CQYA 4DR7K 4Y1CA 2DFFA 3F2KA 4CK2A 4CI6A 1T6DA 3ZSYA 4M3WA 4HCCA 3HI0A 2ZJPL 3H6EA 2BDPA 5AQMA 4MFBA 4DFKA 3IG1A 5AQIA 4PUOA 2F9TA 2RHKA 5C0YA 3O80A 3ZX2A 3UKRB 1SL1A 3SUPA 1RDBA 3VF6A 4DFJA 5M1NA 4RW7A 4DUZK 4BRCA 4C23A 4CF8A 3WXIA 4HUEA 3T19A 4W5RA 2PBDA 4O44A 3SUQA 2YI1A 4OLAA 2P5GA 3IFRA 3ZSRA 4J8FA 4CZFA 3EN9A 4DR5K 4A62A 1NU0A 2QWLA 3MN7A 1LWFA 3WXMB 1SV5A 1T8EA 1S1WA 4FLVA 1Y64A 4M41A 4AM7A 4ELTA 2B6AA 4UY8O 3C94A 4ILJA 3ZT1A 1VSFA 1QS4A 1NK5A 3JXUA 1X9MA 3O5BA 4Z4FA 2FBVA 4OJRA 1GOBA 1VSLA 2HB5A 5AQNA 4KPYA 2OYQA 2YCHA 3CMAN 4B3SK 1M90O 2HNYA 3EZWA 3AVKA 4BGAA 3KIOA 2A1RA 1KSPA 4F2SA 3PX6A 4E7IA 4BC4A 3CQ8A 3PUFA 4HUFA 4DTXA 3V9XA 2BUPA 4DTNA 3IDHA 2E1YA 2KQ2A 3NMUA 3TPQA 4GY2B 3C6TA 1T6CA 5I9EB 4X64K 4FVUA 4BRHA 2HF4A 4H5RA 3FR0A 3T7ZA 2YNFA 2IS3A 4E7KA 3B8AX 3SQ2A 3H46O 3NGYA 3VQ4A 1TUUA 1ZBIA 4OPAA 3I33A 4ILHA 2A41A 1R59O 1O13A 2W6KA 3RMCA 3F9MA 4BR4A 1KAYA 3O9QA 3PX4A 3ENHA 4IZ9A 3VQCA 1NOZA 2GTDA 3DLHA 5K14A 3VENA 2XY6A 3C65A 2F8TA 5M1OA 1HKGA 2Q1NA 5F1XA 3OTOK 1WSGA 1L3SA 2V7YA 3AARA 4ILGB 3MMVA 4NYFA 4FYDA 4R79A 1L3UA 3MX5A 3J80O 4DTRA 3CJ7A 1FKOA 4DLGA 1BL3A 4AHUA 3KK2A 2IVOA 3CPEA 3V1RA 4AHCA 1GLJO 3LPTA 1Q81O 2O4GA 4BWMA 1CXQA 2RN2A 1L3VA 3TANA 1LWEA 4YOTA 3L2RA 4E1NA 4O4GA 3OYCA 4DFPA 1J53A 3ZSWA 3ZX0A 3BF3A 3LDPA 4CGGA 1WB9A 1Q9YA 3RR7A 5C42A 4BACA 4MLHA 2A42A 4PHTX 5DMRA 4BRLA 1I3AA 5CYMA 3S41A 4EFHA 2ZJRL 3NVMA 3LM9A 1YF5L 1JLQA 2I5JA 3HOTA 1NKBA 3R8EA 1XHXA 1KXPA 5BR8K 4LY7A 4M3RA 3NH0A 1NM1A 1QSYA 3QEPA 2BGGA 3AAQA 4KKOA 1DEJA 3NFAA 2F9WA 4B9QA 4M3ZA 3S3OA 1REVA 3D0PA 5AJ3K 4FSVA 3VEVA 4CJVA 3MCAB 4BRMA 4EIAA 2UXCK 4FVMA 3DAWA 4QOZB 2HBJA 2QK9A 3L4QA
chains in the Genus database with same CATH topology
4CHOA 4CIFA 1RBVA 3CM5A 4FLYA 1KVBA 4BE2A 1TK8A 2HHTA 3AVIA 2RF2A 3C95A 2PZSA 4CGDA 3MEEA 5C25A 4I2PA 4W5NA 5J2NA 4B9LA 5D3GA 5HBMA 5T7BA 3OJSA 3QNNA 3HPGA 4DSJA 2P5OA 3AVNA 3RMBA 1ZYQA 4FJXA 4CF0A 1J9AA 4O5BA 3OYJA 1Y97A 3AA3A 3L2WA 3AVAA 1WSFA 1TKXA 1KVCA 3I0RA 3K5OA 3OS1A 2G8FA 3ZT3A 1FKPA 2ITGA 3HPOA 1RT2A 4DSEA 3TABA 2HMIA 4J2BA 3S3MA 1VK0A 3TARA 4J2EA 2BANA 3LPUA 1T7PA 4HVJA 3SUOA 4E19A 4LD0A 2B4JA 4FW2A 4WE1A 4KHYA 3OYGA 3I8DA 3KK3A 4AHRA 4DQPA 4OKKA 1JXBA 3OYKA 2Q3SA 1HRHA 4E7LA 4NYNA 3HSTB 1WSEA 4F8RA 4DQQA 4C8LA 4J2AA 2IGIA 2WONA 3L2UA 3VQPA 1RT3A 4DU4A 1KLMA 3QO9A 4Q5VA 1FK9A 4FJ5A 3AA2A 1IKXA 3B6PA 1QTMA 3G0ZA 2VG6A 2D0CA 3MEDA 4CIEA 4W5TA 2F8SA 3TAFA 3U3GA 3TR8A 1TK5A 4E0DA 4C8MA 4CF9A 4IG0A 4FJLA 2HW3A 2DY4A 3WNHA 3ULDA 1CXUA 3AVFA 1BGXT 1C0UA 4IFYA 4CFBA 1RT4A 4CJPA 3LWMA 2F96A 3NGZA 3SYZA 3ASMA 4FK0A 3RWUA 4DSIA 3VQEA 3ZSXA 3SV3A 2WOMA 3PX0A 3V9WA 1RTIA 2X6NA 3ZSVA 4CHPA 2W42A 3QEXA 3VQBA 4AH9A 1SL2A 4ID5A 3HP9A 4DS5A 1HYSA 2VWJA 1HYVA 2JGUA 4ZTFA 4DQSA 3U6FA 3THVA 4CHYA 4CIGA 4F3OA 1NJYA 3HJFA 3L2QA 4R5PA 2KW4A 4IDKA 3BDPA 4B9UA 4FJ9A 1ZBHA 4CEQA 1N6QA 4FJIA 1S6QA 3DMJA 4H4MA 3NHGA 3OYHA 4NCBA 2XHBA 4LSLA 3SNNA 4B8CA 3DOLA 3KJVA 2HNDA 3QETA 1Z25A 3S3NA 4I2QA 2XY7A 4QCLA 2HHSA 5KI6A 1RT6A 2XO7A 4F3TA 5HRNA 1HYZA 4KTWA 4DTOA 2Y1JA 1SKSA 3VN5A 4JLHA 3E01A 3LANA 4N41A 3QLHA 4CF1A 2OZMA 5E41A 1BQMA 3OYEA 4BDZA 2HHUA 3QEWA 4FW1A 3PO4A 3AO2A 2DTUA 3QIPA 4FJGA 4W5OA 3MXIA 1JXEA 1QQCA 3P83D 1JLFA 4CEFA 2X74A 4DS4A 1QSSA 4H8KA 4RG8A 3HVRA 2R7YA 1C1AA 4K8ZA 5KGXA 3HM9A 1BI4A 1QE1A 3CM6A 3VQ7A 3KLGA 4FJMA 4CERA 4M3ZA 3AO4A 2IOCA 4OGEA 1D5AA 1QHTA 3OYDA 3VA0A 2G8HA 1RTJA 3L3VA 3VQ5A 3SQ1A 4CJQA 4Z0UA 4B8AB 1JLGA 2YKMA 4NCAA 1ITGA 1S1VA 2Z1GA 3VQQA 4CJWA 4LSNA 4UQGA 4PA1A 3DRRA 2A1SA 4KV8A 1RDCA 3AA5X 1J5OA 3EZ5A 3KK1A 3LDSA 1NJWA 2KFNA 1HJRA 5HRRA 4CGJA 2FBYA 4M42A 4C8OA 1NK4A 4DWIA 1TL1A 2P1JA 3OYFA 3P5JA 3VQAA 4CEDA 5J2MA 1T03A 3KD1E 1F21A 1IKWA 3MAQA 1DTQA 3NF8A 2YHBA 4CFDA 1WSHA 1YTAA 3OYMA 1NKEA 1D8YA 2G8KA 4AHVA 1BCMA 4CJLA 2HNZA 2IDOA 2OPRA 1L5UA 2HHQA 3HYFA 4B9SA 4FZYA 4FK2A 4KHSA 1D9FA 1S9EA 3TI0A 4O0JA 3D45A 3V9ZA 2YNIA 5HROA 3QIOA 1Z26A 1ZBLA 1LW0A 4CEAA 4KRFA 1S1XA 1X1PA 4M3XA 1C1BA 4JS5A 1U47A 3LP1A 1KLNA 1BI4B 4DLEA 3NDKA 2B5JA 3O4QA 3DLEA 1LV5A 4FM0A 1BCOA 4CEEA 3ITHA 4FLTA 3HT3A 4IG3A 5C24A 3CFRA 3QEIA 4ELUA 1RBSA 1S5JA 2D0AA 3LALA 3T1AA 4DTMA 4GVMA 2IC3A 3KLIA 1CZ9A 3OYAA 4KHUA 2KTQA 4G1QA 5FRNA 1I39A 4RW6A 1QSLA 1VSJA 3LP0A 1YT3A 4KTQA 3DI6A 4FCYA 4E3SA 1HQUA 4DSLA 4OPJA 3TAMA 3DRPA 1GOCA 5CZ1A 2DFEA 3LP2A 2X78A 3SJJA 3NE6A 2EHGA 4YFUA 1SUQA 1NK0A 3ZT4A 3LZJA 2KZMA 4CJUA 3DLGA 4IFVA 1U45A 3RRGA 5J1EA 2D5RA 3AVHA 1RILA 5J2QA 1X9SA 1NOYA 5KRTA 4RW4A 1RBRA 4O55A 4E89A 1TKDA 4PWDA 1WSJA 2XY5A 3PY8A 3PO5A 1YVUA 3CYMA 4FLXA 3H08A 1K6YA 3P1GA 2GV9A 1RBUA 4KI6A 5DK5A 4EP4A 4M3UA 5JS2A 1ASWA 2D0BA 3AO5A 4M45A 4CJFA 1WAJA 3EYZA 3SI6A 4JRQA 4C8KA 3SUNA 2YNGA 4EP5A 4Z4IA 1KCFA 1DLOA 1SKRA 4N76A 4EZ6A 3HK2A 3QERA 4ID1A 3AVCA 1FXXA 1C6VA 2P51A 5KTQA 4DTPA 1XHZA 3DLKA 1O1WA 1VSEA 3LZIA 4DMNA 1WAFA 2ETJA 4JRPA 4FM2A 4YNQA 3V1OA 1RDDA 3ZSQA 2YHAA 3M8SA 5HLFA 1JL2A 4CGIA 3IAYA 4EZ9A 3AVGA 1XC9A 2OA8A 1WNSA 4E7JA 4Z4GA 3K2PA 2EX3A 3CFOA 1TV6A 2ZE2A 3AV9A 3AVLA 3OS2A 1U4BA 4FM1A 4CJ4A 3T3FA 3I0SA 2Z1HA 3VQ6A 3V9SA 4K8XA 1TKTA 2ZQBA 3M8QA 2YNHA 5SZTA 4HUGA 4DSFA 3O3GA 2QKBA 4HHTA 4BE0A 3TAEA 1HQEA 3K5LA 1EP4A 4DG1A 5KRSA 3K58A 3A2FA 3RMAA 1KRPA 4CGHA 3HL8A 2VWKA 4IBNA 1UAXA 1IKVA 1C0MA 3AO3A 3OJUA 1BISA 1HNIA 3NF7A 4CFCA 3SZ2A 1EKEA 4HCBA 3SPZA 3ISNC 3MXMA 2HHXA 1RNHA 1TGOA 4CJKA 4Q0BA 1HNVA 4KHNA 4CFAA 1IO2A 3V4IA 1NJXA 1T05A 1WLJA 3HPHA 3K59A 3B6OA 3L8BA 2IAJA 4OLBA 1KFDA 1TK0A 3F9KA 2KZZA 4DU3A 4FJKA 4MQ3A 3OS0A 4KTZA 2JLEA 3NAEA 4Y1CA 2DFFA 2E6MA 4DFMA 3VQ8A 4CCHA 4CK2A 4XIUA 1EX4A 2E4LA 3G10A 4Y1DA 3ZSYA 5EU7A 1NK6A 1NK7A 4HCCA 4M3WA 3TAGA 3MXJA 3HO1A 1VSIA 2Y1IA 2BDPA 1B92A 1JLBA 3LP3A 4CJTA 3O3HA 3RMDA 4FZXC 4MFBA 4DFKA 3IG1A 4N5SA 1A5XA 3OYBA 4PUOA 3RTVA 3HVTA 2LSNA 3VQDA 4B9TA 3O4NA 2BE2A 1RT7A 1XWLA 1BIZA 4OKEA 1SL1A 4CF2A 4DF8A 5JS1A 3SUPA 1RDBA 4TSXA 2FBTA 1RT1A 1VRUA 1ZBUA 3ZT0A 4FLWA 1RCHA 3K5NA 4DFJA 3F73A 2PY5A 1TVRA 3AVMA 3QINA 4RW7A 3JSMA 2HHVA 3OVNA 1IH7A 3WNFA 3ALYA 3NF9A 4Z4HA 4CF8A 4HUEA 3QESA 2E6LA 3SPYA 3T19A 4W5RA 4FJNA 2GBZA 1D9DA 1J54A 4O44A 4OVLA 3ZCMA 3SUQA 1R0AA 3L3UA 1EETA 3AVBA 3KKRA 3JYTA 3SV4A 2P5GA 4OLAA 1Q9XA 3ZSRA 4CHNA 1A5VA 1JLCA 5HRSA 4M3TA 3MEGA 1IKYA 5CYQA 3AO1A 4B08A 4L8RB 2G8WA 4CECA 1ZBFA 3QEVA 4BDPA 1LWFA 1Q8IA 1S1TA 2YV0X 1KTQA 4AHTA 3OYNA 3S9HA 2NUBA 1SV5A 1T8EA 1S1WA 4FLVA 3QNOA 4M41A 3OYLA 2G8UA 1RT5A 1HPZA 3NGIA 3AA4A 3VQ9A 4ELTA 2B6AA 5KGWA 1LAVA 4DF4A 2FC0A 3C94A 1GOAA 1S9GA 5FROA 3ZSZA 2G8VA 3NF6A 3ZT1A 3EY1A 4BE1A 1VSFA 1QS4A 2VG7A 1NK5A 2YKNA 4GW6A 1X9MA 4Z4FA 1TAUA 3K57A 1VRTA 4CESA 4DTSA 2FBVA 4OJRA 3OY9A 4E7HA 1VSDA 2Z1JA 1GOBA 1VSLA 1XI1A 3KLFA 1RBTA 2HB5A 4KPYA 2OYQA 1IG9A 4BWJA 1B9DA 2HNYA 3V1QA 4F4KA 3AVKA 3DYAA 4CEBA 4KREA 1ASVA 3VA3A 3TAQA 3LWLA 3KIOA 3HXMA 2A1RA 1KSPA 4F2SA 2HVHA 5CZ2A 3NCIA 4E7IA 4DQRA 3PX6A 3DLRA 4DTUA 1UA0A 3CQ8A 3NH2A 3PUFA 3WNGA 4HUFA 4DTXA 4ELVA 3V9XA 1WN7A 4N56A 4QAGA 4DTNA 3CG7A 4CGFA 4CK3A 5I3UA 1LW2A 4C8NA 3KTQA 3FFIA 4KI4A 1YTUA 2KQ2A 3V6DA 3C6TA 5SWMA 4NCGA 2Z1IA 2RPIA 2PYLA 2OZSA 4ICLA 3M8PA 3KLEA 2ATQA 4FJJA 4LH5A 1RDAA 4H4OA 3MECA 3DLBA 3ZT2A 3UIQA 3KKSA 4KB1A 2YNFA 2IS3A 4E7KA 3SQ2A 1NK9A 1X9WA 4FK4A 3NGYA 2FBXA 3VQ4A 3M8RA 4PY5A 4OGCA 1ZBIA 2OPPA 5J2PA 1SKWA 1BQNA 2X6SA 4ZTJA 3ZSOA 1UA1A 4I9QA 3OYIA 3NBPA 4Z4EA 1UWBA 3LAKA 3IRXA 4B9NA 1U04A 2OPSA 3RMCA 4CJSA 2HVIA 1RTDA 2PYJA 4FLUA 3U3YA 3PX4A 1C1CA 3KD5E 1UOCA 1CLQA 1W9HA 4W5QA 4CJRA 3VQCA 1NOZA 4KHWA 4AHSA 3DLHA 4B9VA 5K14A 2XY6A 1U48A 3RRHA 3TAPA 4LH4A 1U49A 1SL0A 1N5YA 2F8TA 4FJHA 3V9UA 1CZBA 1KFSA 4GMJB 1EXQA 3SQ0A 1C0TA 1BHLA 4I7FA 1HMVA 4JS4A 1WSGA 1L3SA 3SQ4A 3HP6A 4NYFA 4FYDA 1L3UA 5HP1A 1NJZA 3BGRA 3O3FA 4DTRA 3SCXA 3WNEA 1FKOA 4DLGA 3C6UA 1MU2A 4CEZA 1BL3A 2GUIA 3DRSA 4AHUA 4M3YA 4DTJA 1JL1A 3KK2A 2O4IA 4AILC 4B9MA 4KHQA 4AHCA 3V1RA 4CHZA 4FJ7A 1LAWA 3LPTA 3TWHA 4PQUA 2O4GA 4N47A 1CXQA 1S6PA 4BWMA 3LAMA 4CE9A 4FLZA 1NK8A 1TL3A 1KVAA 2RN2A 2OPQA 1L3VA 3TANA 3RR8A 4J2DA 1LWEA 3L2RA 4E1NA 1W0HA 4O4GA 4RW8A 3NH1A 3OYCA 4DU1A 4DFPA 4KO0A 1J53A 1TAQA 1JLEA 3ZSWA 2G8IA 4RW9A 1Q9YA 4CGGA 3RR7A 1JLAA 1B9FA 1S1UA 1WSIA 5C42A 4BACA 5FDLA 4KAZA 5FRMA 1A5WA 3PV8A 4CJ5A 4F2RA 5DMRA 4HTUA 1I3AA 5CYMA 2QXFA 1NKCA 4DSKA 2HHWA 1ASUA 2KFZA 5HRPA 3DM2A 4BDYA 1JLQA 2I5JA 2XRIA 1NKBA 1XHXA 1L3TA 5I42A 4LY7A 4M3RA 4Z4CA 3NH0A 4IKFA 4B3OA 2ZD1A 4I9LA 4ZHRA 3DOKA 3QEPA 4E1MA 1VSHA 1QSYA 2BGGA 1VSKA 4FXDA 1VSMA 4KKOA 1TKZA 3NFAA 4OPKA 2VG5A 1G15A 2DFHA 1DTTA 4CJEA 4OKJA 4CK1A 3S3OA 4KB0A 4FZZA 1LWCA 5CY4A 1REVA 2RKIA 4KFBA 3IS9A 3V81A 4CJ3A 3D0PA 4O0IA 3KLHA 3L2VA 3K5MA 4FJ8A 1BIUA 3AVJA 4CJVA 1RTHA 4CHQA 4DQIA 2AJQA 4FVMA 2QKKA 3CFPA 4QOZB 2QK9A 1JKHA 4CEOA 2XY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHO A;  4CIF A;  1RBV A;  3CM5 A;  4FLY A;  1KVB A;  4BE2 A;  1TK8 A;  2HHT A;  3AVI A;  2RF2 A;  3C95 A;  2PZS A;  4CGD A;  3MEE A;  5C25 A;  4I2P A;  4W5N A;  5J2N A;  4B9L A;  5D3G A;  5HBM A;  5T7B A;  3OJS A;  3QNN A;  3HPG A;  4DSJ A;  2P5O A;  3AVN A;  3RMB A;  1ZYQ A;  4FJX A;  4CF0 A;  1J9A A;  4O5B A;  3OYJ A;  1Y97 A;  3AA3 A;  3L2W A;  3AVA A;  1WSF A;  1TKX A;  1KVC A;  3I0R A;  3K5O A;  3OS1 A;  2G8F A;  3ZT3 A;  1FKP A;  2ITG A;  3HPO A;  1RT2 A;  4DSE A;  3TAB A;  2HMI A;  4J2B A;  3S3M A;  1VK0 A;  3TAR A;  4J2E A;  2BAN A;  3LPU A;  1T7P A;  4HVJ A;  3SUO A;  4E19 A;  4LD0 A;  2B4J A;  4FW2 A;  4WE1 A;  4KHY A;  3OYG A;  3I8D A;  3KK3 A;  4AHR A;  4DQP A;  4OKK A;  1JXB A;  3OYK A;  2Q3S A;  1HRH A;  4E7L A;  4NYN A;  3HST B;  1WSE A;  4F8R A;  4DQQ A;  4C8L A;  4J2A A;  2IGI A;  2WON A;  3L2U A;  3VQP A;  1RT3 A;  4DU4 A;  1KLM A;  3QO9 A;  4Q5V A;  1FK9 A;  4FJ5 A;  3AA2 A;  1IKX A;  3B6P A;  1QTM A;  3G0Z A;  2VG6 A;  2D0C A;  3MED A;  4CIE A;  4W5T A;  2F8S A;  3TAF A;  3U3G A;  3TR8 A;  1TK5 A;  4E0D A;  4C8M A;  4CF9 A;  4IG0 A;  4FJL A;  2HW3 A;  2DY4 A;  3WNH A;  3ULD A;  1CXU A;  3AVF A;  1BGX T;  1C0U A;  4IFY A;  4CFB A;  1RT4 A;  4CJP A;  3LWM A;  2F96 A;  3NGZ A;  3SYZ A;  3ASM A;  4FK0 A;  3RWU A;  4DSI A;  3VQE A;  3ZSX A;  3SV3 A;  2WOM A;  3PX0 A;  3V9W A;  1RTI A;  2X6N A;  3ZSV A;  4CHP A;  2W42 A;  3QEX A;  3VQB A;  4AH9 A;  1SL2 A;  4ID5 A;  3HP9 A;  4DS5 A;  1HYS A;  2VWJ A;  1HYV A;  2JGU A;  4ZTF A;  4DQS A;  3U6F A;  3THV A;  4CHY A;  4CIG A;  4F3O A;  1NJY A;  3HJF A;  3L2Q A;  4R5P A;  2KW4 A;  4IDK A;  3BDP A;  4B9U A;  4FJ9 A;  1ZBH A;  4CEQ A;  1N6Q A;  4FJI A;  1S6Q A;  3DMJ A;  4H4M A;  3NHG A;  3OYH A;  4NCB A;  2XHB A;  4LSL A;  3SNN A;  4B8C A;  3DOL A;  3KJV A;  2HND A;  3QET A;  1Z25 A;  3S3N A;  4I2Q A;  2XY7 A;  4QCL A;  2HHS A;  5KI6 A;  1RT6 A;  2XO7 A;  4F3T A;  5HRN A;  1HYZ A;  4KTW A;  4DTO A;  2Y1J A;  1SKS A;  3VN5 A;  4JLH A;  3E01 A;  3LAN A;  4N41 A;  3QLH A;  4CF1 A;  2OZM A;  5E41 A;  1BQM A;  3OYE A;  4BDZ A;  2HHU A;  3QEW A;  4FW1 A;  3PO4 A;  3AO2 A;  2DTU A;  3QIP A;  4FJG A;  4W5O A;  3MXI A;  1JXE A;  1QQC A;  3P83 D;  1JLF A;  4CEF A;  2X74 A;  4DS4 A;  1QSS A;  4H8K A;  4RG8 A;  3HVR A;  2R7Y A;  1C1A A;  4K8Z A;  5KGX A;  3HM9 A;  1BI4 A;  1QE1 A;  3CM6 A;  3VQ7 A;  3KLG A;  4FJM A;  4CER A;  4M3Z A;  3AO4 A;  2IOC A;  4OGE A;  1D5A A;  1QHT A;  3OYD A;  3VA0 A;  2G8H A;  1RTJ A;  3L3V A;  3VQ5 A;  3SQ1 A;  4CJQ A;  4Z0U A;  4B8A B;  1JLG A;  2YKM A;  4NCA A;  1ITG A;  1S1V A;  2Z1G A;  3VQQ A;  4CJW A;  4LSN A;  4UQG A;  4PA1 A;  3DRR A;  2A1S A;  4KV8 A;  1RDC A;  3AA5 X;  1J5O A;  3EZ5 A;  3KK1 A;  3LDS A;  1NJW A;  2KFN A;  1HJR A;  5HRR A;  4CGJ A;  2FBY A;  4M42 A;  4C8O A;  1NK4 A;  4DWI A;  1TL1 A;  2P1J A;  3OYF A;  3P5J A;  3VQA A;  4CED A;  5J2M A;  1T03 A;  3KD1 E;  1F21 A;  1IKW A;  3MAQ A;  1DTQ A;  3NF8 A;  2YHB A;  4CFD A;  1WSH A;  1YTA A;  3OYM A;  1NKE A;  1D8Y A;  2G8K A;  4AHV A;  1BCM A;  4CJL A;  2HNZ A;  2IDO A;  2OPR A;  1L5U A;  2HHQ A;  3HYF A;  4B9S A;  4FZY A;  4FK2 A;  4KHS A;  1D9F A;  1S9E A;  3TI0 A;  4O0J A;  3D45 A;  3V9Z A;  2YNI A;  5HRO A;  3QIO A;  1Z26 A;  1ZBL A;  1LW0 A;  4CEA A;  4KRF A;  1S1X A;  1X1P A;  4M3X A;  1C1B A;  4JS5 A;  1U47 A;  3LP1 A;  1KLN A;  1BI4 B;  4DLE A;  3NDK A;  2B5J A;  3O4Q A;  3DLE A;  1LV5 A;  4FM0 A;  1BCO A;  4CEE A;  3ITH A;  4FLT A;  3HT3 A;  4IG3 A;  5C24 A;  3CFR A;  3QEI A;  4ELU A;  1RBS A;  1S5J A;  2D0A A;  3LAL A;  3T1A A;  4DTM A;  4GVM A;  2IC3 A;  3KLI A;  1CZ9 A;  3OYA A;  4KHU A;  2KTQ A;  4G1Q A;  5FRN A;  1I39 A;  4RW6 A;  1QSL A;  1VSJ A;  3LP0 A;  1YT3 A;  4KTQ A;  3DI6 A;  4FCY A;  4E3S A;  1HQU A;  4DSL A;  4OPJ A;  3TAM A;  3DRP A;  1GOC A;  5CZ1 A;  2DFE A;  3LP2 A;  2X78 A;  3SJJ A;  3NE6 A;  2EHG A;  4YFU A;  1SUQ A;  1NK0 A;  3ZT4 A;  3LZJ A;  2KZM A;  4CJU A;  3DLG A;  4IFV A;  1U45 A;  3RRG A;  5J1E A;  2D5R A;  3AVH A;  1RIL A;  5J2Q A;  1X9S A;  1NOY A;  5KRT A;  4RW4 A;  1RBR A;  4O55 A;  4E89 A;  1TKD A;  4PWD A;  1WSJ A;  2XY5 A;  3PY8 A;  3PO5 A;  1YVU A;  3CYM A;  4FLX A;  3H08 A;  1K6Y A;  3P1G A;  2GV9 A;  1RBU A;  4KI6 A;  5DK5 A;  4EP4 A;  4M3U A;  5JS2 A;  1ASW A;  2D0B A;  3AO5 A;  4M45 A;  4CJF A;  1WAJ A;  3EYZ A;  3SI6 A;  4JRQ A;  4C8K A;  3SUN A;  2YNG A;  4EP5 A;  4Z4I A;  1KCF A;  1DLO A;  1SKR A;  4N76 A;  4EZ6 A;  3HK2 A;  3QER A;  4ID1 A;  3AVC A;  1FXX A;  1C6V A;  2P51 A;  5KTQ A;  4DTP A;  1XHZ A;  3DLK A;  1O1W A;  1VSE A;  3LZI A;  4DMN A;  1WAF A;  2ETJ A;  4JRP A;  4FM2 A;  4YNQ A;  3V1O A;  1RDD A;  3ZSQ A;  2YHA A;  3M8S A;  5HLF A;  1JL2 A;  4CGI A;  3IAY A;  4EZ9 A;  3AVG A;  1XC9 A;  2OA8 A;  1WNS A;  4E7J A;  4Z4G A;  3K2P A;  2EX3 A;  3CFO A;  1TV6 A;  2ZE2 A;  3AV9 A;  3AVL A;  3OS2 A;  1U4B A;  4FM1 A;  4CJ4 A;  3T3F A;  3I0S A;  2Z1H A;  3VQ6 A;  3V9S A;  4K8X A;  1TKT A;  2ZQB A;  3M8Q A;  2YNH A;  5SZT A;  4HUG A;  4DSF A;  3O3G A;  2QKB A;  4HHT A;  4BE0 A;  3TAE A;  1HQE A;  3K5L A;  1EP4 A;  4DG1 A;  5KRS A;  3K58 A;  3A2F A;  3RMA A;  1KRP A;  4CGH A;  3HL8 A;  2VWK A;  4IBN A;  1UAX A;  1IKV A;  1C0M A;  3AO3 A;  3OJU A;  1BIS A;  1HNI A;  3NF7 A;  4CFC A;  3SZ2 A;  1EKE A;  4HCB A;  3SPZ A;  3ISN C;  3MXM A;  2HHX A;  1RNH A;  1TGO A;  4CJK A;  4Q0B A;  1HNV A;  4KHN A;  4CFA A;  1IO2 A;  3V4I A;  1NJX A;  1T05 A;  1WLJ A;  3HPH A;  3K59 A;  3B6O A;  3L8B A;  2IAJ A;  4OLB A;  1KFD A;  1TK0 A;  3F9K A;  2KZZ A;  4DU3 A;  4FJK A;  4MQ3 A;  3OS0 A;  4KTZ A;  2JLE A;  3NAE A;  4Y1C A;  2DFF A;  2E6M A;  4DFM A;  3VQ8 A;  4CCH A;  4CK2 A;  4XIU A;  1EX4 A;  2E4L A;  3G10 A;  4Y1D A;  3ZSY A;  5EU7 A;  1NK6 A;  1NK7 A;  4HCC A;  4M3W A;  3TAG A;  3MXJ A;  3HO1 A;  1VSI A;  2Y1I A;  2BDP A;  1B92 A;  1JLB A;  3LP3 A;  4CJT A;  3O3H A;  3RMD A;  4FZX C;  4MFB A;  4DFK A;  3IG1 A;  4N5S A;  1A5X A;  3OYB A;  4PUO A;  3RTV A;  3HVT A;  2LSN A;  3VQD A;  4B9T A;  3O4N A;  2BE2 A;  1RT7 A;  1XWL A;  1BIZ A;  4OKE A;  1SL1 A;  4CF2 A;  4DF8 A;  5JS1 A;  3SUP A;  1RDB A;  4TSX A;  2FBT A;  1RT1 A;  1VRU A;  1ZBU A;  3ZT0 A;  4FLW A;  1RCH A;  3K5N A;  4DFJ A;  3F73 A;  2PY5 A;  1TVR A;  3AVM A;  3QIN A;  4RW7 A;  3JSM A;  2HHV A;  3OVN A;  1IH7 A;  3WNF A;  3ALY A;  3NF9 A;  4Z4H A;  4CF8 A;  4HUE A;  3QES A;  2E6L A;  3SPY A;  3T19 A;  4W5R A;  4FJN A;  2GBZ A;  1D9D A;  1J54 A;  4O44 A;  4OVL A;  3ZCM A;  3SUQ A;  1R0A A;  3L3U A;  1EET A;  3AVB A;  3KKR A;  3JYT A;  3SV4 A;  2P5G A;  4OLA A;  1Q9X A;  3ZSR A;  4CHN A;  1A5V A;  1JLC A;  5HRS A;  4M3T A;  3MEG A;  1IKY A;  5CYQ A;  3AO1 A;  4B08 A;  4L8R B;  2G8W A;  4CEC A;  1ZBF A;  3QEV A;  4BDP A;  1LWF A;  1Q8I A;  1S1T A;  2YV0 X;  1KTQ A;  4AHT A;  3OYN A;  3S9H A;  2NUB A;  1SV5 A;  1T8E A;  1S1W A;  4FLV A;  3QNO A;  4M41 A;  3OYL A;  2G8U A;  1RT5 A;  1HPZ A;  3NGI A;  3AA4 A;  3VQ9 A;  4ELT A;  2B6A A;  5KGW A;  1LAV A;  4DF4 A;  2FC0 A;  3C94 A;  1GOA A;  1S9G A;  5FRO A;  3ZSZ A;  2G8V A;  3NF6 A;  3ZT1 A;  3EY1 A;  4BE1 A;  1VSF A;  1QS4 A;  2VG7 A;  1NK5 A;  2YKN A;  4GW6 A;  1X9M A;  4Z4F A;  1TAU A;  3K57 A;  1VRT A;  4CES A;  4DTS A;  2FBV A;  4OJR A;  3OY9 A;  4E7H A;  1VSD A;  2Z1J A;  1GOB A;  1VSL A;  1XI1 A;  3KLF A;  1RBT A;  2HB5 A;  4KPY A;  2OYQ A;  1IG9 A;  4BWJ A;  1B9D A;  2HNY A;  3V1Q A;  4F4K A;  3AVK A;  3DYA A;  4CEB A;  4KRE A;  1ASV A;  3VA3 A;  3TAQ A;  3LWL A;  3KIO A;  3HXM A;  2A1R A;  1KSP A;  4F2S A;  2HVH A;  5CZ2 A;  3NCI A;  4E7I A;  4DQR A;  3PX6 A;  3DLR A;  4DTU A;  1UA0 A;  3CQ8 A;  3NH2 A;  3PUF A;  3WNG A;  4HUF A;  4DTX A;  4ELV A;  3V9X A;  1WN7 A;  4N56 A;  4QAG A;  4DTN A;  3CG7 A;  4CGF A;  4CK3 A;  5I3U A;  1LW2 A;  4C8N A;  3KTQ A;  3FFI A;  4KI4 A;  1YTU A;  2KQ2 A;  3V6D A;  3C6T A;  5SWM A;  4NCG A;  2Z1I A;  2RPI A;  2PYL A;  2OZS A;  4ICL A;  3M8P A;  3KLE A;  2ATQ A;  4FJJ A;  4LH5 A;  1RDA A;  4H4O A;  3MEC A;  3DLB A;  3ZT2 A;  3UIQ A;  3KKS A;  4KB1 A;  2YNF A;  2IS3 A;  4E7K A;  3SQ2 A;  1NK9 A;  1X9W A;  4FK4 A;  3NGY A;  2FBX A;  3VQ4 A;  3M8R A;  4PY5 A;  4OGC A;  1ZBI A;  2OPP A;  5J2P A;  1SKW A;  1BQN A;  2X6S A;  4ZTJ A;  3ZSO A;  1UA1 A;  4I9Q A;  3OYI A;  3NBP A;  4Z4E A;  1UWB A;  3LAK A;  3IRX A;  4B9N A;  1U04 A;  2OPS A;  3RMC A;  4CJS A;  2HVI A;  1RTD A;  2PYJ A;  4FLU A;  3U3Y A;  3PX4 A;  1C1C A;  3KD5 E;  1UOC A;  1CLQ A;  1W9H A;  4W5Q A;  4CJR A;  3VQC A;  1NOZ A;  4KHW A;  4AHS A;  3DLH A;  4B9V A;  5K14 A;  2XY6 A;  1U48 A;  3RRH A;  3TAP A;  4LH4 A;  1U49 A;  1SL0 A;  1N5Y A;  2F8T A;  4FJH A;  3V9U A;  1CZB A;  1KFS A;  4GMJ B;  1EXQ A;  3SQ0 A;  1C0T A;  1BHL A;  4I7F A;  1HMV A;  4JS4 A;  1WSG A;  1L3S A;  3SQ4 A;  3HP6 A;  4NYF A;  4FYD A;  1L3U A;  5HP1 A;  1NJZ A;  3BGR A;  3O3F A;  4DTR A;  3SCX A;  3WNE A;  1FKO A;  4DLG A;  3C6U A;  1MU2 A;  4CEZ A;  1BL3 A;  2GUI A;  3DRS A;  4AHU A;  4M3Y A;  4DTJ A;  1JL1 A;  3KK2 A;  2O4I A;  4AIL C;  4B9M A;  4KHQ A;  4AHC A;  3V1R A;  4CHZ A;  4FJ7 A;  1LAW A;  3LPT A;  3TWH A;  4PQU A;  2O4G A;  4N47 A;  1CXQ A;  1S6P A;  4BWM A;  3LAM A;  4CE9 A;  4FLZ A;  1NK8 A;  1TL3 A;  1KVA A;  2RN2 A;  2OPQ A;  1L3V A;  3TAN A;  3RR8 A;  4J2D A;  1LWE A;  3L2R A;  4E1N A;  1W0H A;  4O4G A;  4RW8 A;  3NH1 A;  3OYC A;  4DU1 A;  4DFP A;  4KO0 A;  1J53 A;  1TAQ A;  1JLE A;  3ZSW A;  2G8I A;  4RW9 A;  1Q9Y A;  4CGG A;  3RR7 A;  1JLA A;  1B9F A;  1S1U A;  1WSI A;  5C42 A;  4BAC A;  5FDL A;  4KAZ A;  5FRM A;  1A5W A;  3PV8 A;  4CJ5 A;  4F2R A;  5DMR A;  4HTU A;  1I3A A;  5CYM A;  2QXF A;  1NKC A;  4DSK A;  2HHW A;  1ASU A;  2KFZ A;  5HRP A;  3DM2 A;  4BDY A;  1JLQ A;  2I5J A;  2XRI A;  1NKB A;  1XHX A;  1L3T A;  5I42 A;  4LY7 A;  4M3R A;  4Z4C A;  3NH0 A;  4IKF A;  4B3O A;  2ZD1 A;  4I9L A;  4ZHR A;  3DOK A;  3QEP A;  4E1M A;  1VSH A;  1QSY A;  2BGG A;  1VSK A;  4FXD A;  1VSM A;  4KKO A;  1TKZ A;  3NFA A;  4OPK A;  2VG5 A;  1G15 A;  2DFH A;  1DTT A;  4CJE A;  4OKJ A;  4CK1 A;  3S3O A;  4KB0 A;  4FZZ A;  1LWC A;  5CY4 A;  1REV A;  2RKI A;  4KFB A;  3IS9 A;  3V81 A;  4CJ3 A;  3D0P A;  4O0I A;  3KLH A;  3L2V A;  3K5M A;  4FJ8 A;  1BIU A;  3AVJ A;  4CJV A;  1RTH A;  4CHQ A;  4DQI A;  2AJQ A;  4FVM A;  2QKK A;  3CFP A;  4QOZ B;  2QK9 A;  1JKH A;  4CEO A;  2XY8 A; 
#chains in the Genus database with same CATH topology
 3CET A;  4CIF A;  3HSC A;  3CM5 A;  1OH6 A;  3VPZ A;  4B3R K;  1NMD A;  3MEE A;  4I2P A;  4B9L A;  3HPG A;  4CF0 A;  1V4S A;  4NLB A;  1VQ8 N;  1WSF A;  3I0R A;  3ZT3 A;  4KHP K;  4H5W A;  4JK7 A;  1TYQ A;  1VK0 A;  3SMS A;  4KHY A;  4BC5 A;  2QM1 A;  4AHR A;  4B1Z A;  1BDG A;  5HL7 L;  4J2A A;  1KLM A;  1IBM K;  1LOT B;  2YX6 A;  3B6P A;  1QTM A;  2F8S A;  3DJC A;  1TK5 A;  4IWV A;  4C8M A;  4E0D A;  2FF3 B;  4FJL A;  4DB3 A;  3ULD A;  4AQY K;  3LWM A;  1RT4 A;  4CJP A;  4WF9 L;  3RWU A;  1JJ2 M;  3ZSV A;  4CHP A;  4YOW A;  3ID8 A;  4DKW A;  4AH9 A;  3TU5 A;  2VWJ A;  4M63 C;  4DQS A;  3U6F A;  3THV A;  4F3O A;  2NLX A;  4R5P A;  2KW4 A;  4H0P A;  3TSU A;  1S6Q A;  4H4M A;  3G71 N;  1WBD A;  1CZA N;  1X3N A;  2XHB A;  3DOL A;  2CH5 A;  1XMO K;  1Z25 A;  3IKM A;  1YXQ A;  4I2Q A;  3S3N A;  4QCL A;  2HHS A;  5AR0 A;  5CR4 A;  1HYZ A;  2Y1J A;  3VN5 A;  3E01 A;  3LAN A;  4FWS A;  3SBT A;  3QLH A;  3VTI A;  5E41 A;  2HHU A;  1E4G T;  1ATS A;  3PO4 A;  2DTU A;  4FJG A;  3MXI A;  1JXE A;  4H8K A;  4IO9 L;  2D1K A;  4K8Z A;  3CER A;  5KGX A;  3HM9 A;  1HR0 K;  1T3V A;  2ZGY A;  3C7N B;  1RTJ A;  3VQ5 A;  3N4P A;  3VQQ A;  3KZB A;  5AQT A;  1OH8 A;  4PA1 A;  4KV8 A;  4B1Y B;  1RDC A;  2HST A;  3CJC A;  1NJW A;  2PAV A;  4FWK A;  3EE9 A;  4YDU A;  2ASO A;  4DWI A;  1TL1 A;  3OYF A;  4CED A;  2QWO A;  3H3O B;  2O8F B;  1IKW A;  3H3N O;  5AZJ A;  4CFD A;  2G8K A;  1L5U A;  3G25 A;  1BU6 O;  4B9S A;  4IXC A;  1D9F A;  4O0J A;  3D45 A;  4LF6 K;  3C0B A;  2YNI A;  2V7Z A;  4KH5 A;  4KRF A;  3LP1 A;  5AQX A;  3NDK A;  1C0G A;  2O8B A;  1LV5 A;  1BCO A;  4CEE A;  3PLA A;  3EEQ A;  3CFR A;  1KD1 O;  5ELZ A;  3T1A A;  4DV5 K;  3OYA A;  1CZ9 A;  1I39 A;  4YOV A;  5KPT A;  1ZBS A;  5GIO A;  3DRP A;  2RE2 A;  3WQT A;  3CCS N;  1NK0 A;  4LF4 K;  4CJU A;  3AY9 A;  4DR1 K;  4X66 K;  5FPM A;  4BG9 A;  1K8K A;  1RIL A;  1X9S A;  5AZJ B;  5KRT A;  1OKJ A;  1RBR A;  1XUP O;  1TKD A;  2XY5 A;  3ULE A;  1YVU A;  3CYM A;  3FFK B;  2Q31 A;  2OCE A;  2GV9 A;  4A2B A;  4M3U A;  4EP4 A;  4M45 A;  1WAJ A;  4C8K A;  3O1W A;  1DLO A;  2DPN A;  4FWL A;  1Q7Y O;  1SKR A;  5EVZ A;  2O8B B;  3M3Z A;  1VQL N;  1XHZ A;  1O1W A;  1VSE A;  3VF2 A;  1M1K O;  5JVG L;  2YHA A;  3CC2 N;  1JL2 A;  4CGI A;  4EZ9 A;  3ID6 A;  2EX3 A;  1QQN A;  1TV6 A;  2ZE2 A;  3OS2 A;  4FM1 A;  1GLD G;  1VQK N;  4CZI A;  1JCG A;  4HHT A;  2HBK A;  3OHR A;  4PKI A;  1N33 K;  1OVQ A;  3HL8 A;  1K8K B;  4JK8 A;  1IKV A;  1HNI A;  4QS8 A;  4HCB A;  3O6W A;  1T44 A;  1HNV A;  3ULE B;  1ZXO A;  1NJX A;  4MO5 A;  4CVN E;  3K59 A;  4MDA A;  3MWT A;  3L8B A;  4YHH K;  3SJH A;  4WQ5 A;  2ZF5 O;  4DU3 A;  3OS0 A;  4KTZ A;  2JLE A;  2E6M A;  4H5T A;  1EX4 A;  2E4L A;  3G10 A;  3CCJ N;  3N4Q A;  4WQ4 C;  1NK7 A;  3TTF A;  3PSI A;  1B92 A;  1JLB A;  3LP3 A;  3O3H A;  3E9L A;  4N5S A;  4IEI A;  1QZ6 A;  3O4W A;  2LSN A;  3O4N A;  3GOI A;  2QWP A;  1XWL A;  1N8R O;  1BIZ A;  3KK7 A;  4OKE A;  3QBW A;  4DF8 A;  5JS1 A;  1HLU A;  5KQD A;  1ZBU A;  1RCH A;  3CCU N;  2PY5 A;  2E2P A;  1TVR A;  3QIN A;  3OVN A;  1IH7 A;  1SS6 A;  3ZET A;  4FWM A;  3NF9 A;  3QDK A;  3SPY A;  1XQS C;  3QES A;  1NLV A;  4FJN A;  2GBZ A;  3SV4 A;  4JI0 K;  1Q9X A;  5E26 A;  2CH6 A;  1A5V A;  2VQF K;  1NGG A;  5EX5 A;  4CEC A;  1EQY A;  5JLF A;  4AHT A;  2YV0 X;  1VQ4 N;  1XNR K;  3OYL A;  3NGI A;  4IDH A;  1P8Z A;  3D2E B;  1S9G A;  5FRO A;  2WFB A;  4KH4 A;  3ZSZ A;  4DV6 K;  1HKB A;  2VG7 A;  4BR9 A;  3CCV N;  3K57 A;  3OY9 A;  4JKD A;  4E7H A;  2Z1J A;  2A3Z A;  2QI2 A;  1RBT A;  2O8C A;  4BWJ A;  1B9D A;  1K73 O;  1WUA A;  4IOA L;  4LFC K;  3ZET B;  4LF8 K;  4DQR A;  3DLR A;  4ELV A;  2P9K B;  3AGR A;  3VEZ A;  4CGF A;  3QIC A;  4CK3 A;  3KTQ A;  4C8N A;  1YTU A;  2UXD K;  4H5V A;  3JAM O;  1C0F A;  5SWM A;  4NCG A;  2Z1I A;  2RPI A;  1U2V A;  1HJO A;  2ATQ A;  3KWG A;  3ZLJ A;  1NK9 A;  5TKY A;  2OPP A;  3Q7B A;  2YHW A;  3ZSO A;  1UA1 A;  1NG9 A;  3CC4 N;  3IRX A;  2OPS A;  4CJS A;  3OA9 A;  2AP1 A;  3VGK A;  1C1C A;  2QW9 A;  1W9H A;  3SAG A;  4KHW A;  2HHH K;  2KKZ A;  5CHI A;  1SL0 A;  1U49 A;  4FJH A;  3V9U A;  4GMJ B;  4CD1 A;  1C0T A;  4I7F A;  4JEP A;  1HMV A;  4JS4 A;  4OO1 J;  3SQ4 A;  3WNE A;  2A5X A;  4CEZ A;  4F9O A;  3GE1 A;  4XEI A;  4DTJ A;  2O4I A;  3MN9 A;  1U2V B;  4B9M A;  4KHQ A;  3A5N C;  4FJ7 A;  1LAW A;  1S6P A;  1HPM A;  2WTU A;  1KVA A;  2FLO A;  3NH1 A;  3K0S A;  3VES A;  5DM7 L;  3CHW A;  4XH4 A;  3LL3 A;  4E1J A;  1N32 K;  1WSI A;  3K9K A;  5FRM A;  5FDL A;  3TTD A;  4CJ5 A;  4F2R A;  1GLL O;  4HTU A;  5AQQ A;  1WBB A;  5BPM A;  4DSK A;  2HHW A;  1ASU A;  5B8H A;  3HTV A;  4FOE A;  4IKF A;  1FJG K;  4FXD A;  1TKZ A;  4OPK A;  4IJN A;  2VG5 A;  3LDN A;  2DFH A;  4CK1 A;  2P9U B;  3V81 A;  1NGD A;  4CJ3 A;  3CIP A;  5AQP A;  1XMQ K;  1NWK A;  2O8E A;  1BIU A;  1RTH A;  2QKK A;  5EOY A;  1JKH A;  4CHO A;  4K42 A;  2UUB K;  4FLY A;  1KVB A;  1TK8 A;  2PZS A;  3RVC A;  4BRN A;  5J2N A;  5HBM A;  3OJS A;  4DCH A;  4BR5 A;  3MCP A;  3RMB A;  3O9R A;  3TTC A;  5IT9 O;  1VQ6 N;  1Y97 A;  3HPO A;  2NRH A;  3S3M A;  1KQS M;  3LPU A;  1T7P A;  4ISG A;  4WE1 A;  3J7Y P;  5AQV A;  3CME N;  2Q3S A;  1P90 A;  5GAE P;  4A2A A;  3BEX A;  3PIO L;  3CD6 N;  4MDB A;  4F8R A;  4C8L A;  2IGI A;  4CZM A;  3L2U A;  3VQP A;  3THY A;  1RT3 A;  4FPB A;  1IV0 A;  4Q5V A;  1FK9 A;  2IIR A;  3G0Z A;  2VG6 A;  2O8E B;  4CIE A;  1WOQ A;  3U3G A;  4CF9 A;  4LF9 K;  1CXU A;  3AVF A;  1BGX T;  1C0U A;  4YOX A;  2CGK A;  4WYB A;  4FWR A;  3ASM A;  3UB5 A;  5KPR A;  3SYZ A;  4DSI A;  4IJA A;  3PX0 A;  3V9W A;  1RTI A;  2X6N A;  2W42 A;  5AQR A;  5LMN K;  1BOT O;  3ZEU A;  4ID5 A;  3HP9 A;  4DS5 A;  1HYV A;  2JGU A;  4CIG A;  3ENB A;  3L2Q A;  3CCL N;  4FJ9 A;  2W41 A;  1BWF O;  4JAX A;  3O08 A;  3T1H K;  3OYH A;  4DV1 K;  4CBX A;  4B8C A;  1GLF O;  3ATU A;  1VAZ A;  1S22 A;  4YDU C;  3QET A;  3LDL A;  5F2R A;  2XO7 A;  4OPH A;  1NMN A;  3BUZ B;  4HTL A;  5HRN A;  4KTW A;  4DTO A;  1SKS A;  5AQS A;  1H1V A;  4N41 A;  4X62 K;  2OZM A;  3THY B;  1BQM A;  4JD2 A;  4BDZ A;  3QEW A;  4FW1 A;  4WFA L;  4W5O A;  4IOX A;  4FWN A;  1HNZ K;  1JLF A;  4JI3 K;  1QSS A;  4CW7 B;  1HNW K;  1S3X A;  1VHX A;  3FE1 A;  4IO8 A;  5AQJ A;  5GAH P;  3U9Z A;  3KLG A;  2ZM6 K;  3AO4 A;  3M5R A;  2J4R A;  4JI7 K;  4OGE A;  1D5A A;  3OYD A;  3VA0 A;  2FXU A;  5C10 A;  3L3V A;  3SQ1 A;  3ZEU B;  3VEX A;  4A5B A;  1RDU A;  4CZE A;  4NCA A;  1S1V A;  2Z1G A;  4LSN A;  5AFU H;  4UQG A;  3DRR A;  3A0I X;  4DR3 K;  1VQ7 N;  3AA5 X;  3LDS A;  2KFN A;  1HJR A;  3P39 A;  5HRR A;  3SMP A;  1JCE A;  2FBY A;  4M42 A;  3GL1 A;  5J2M A;  1F21 A;  3R9P A;  3BZC A;  1NKE A;  1YTA A;  1SAZ A;  1XC3 A;  3AAP A;  3MWP A;  2HHQ A;  2CGL A;  3HYF A;  4JD2 B;  1S9E A;  2E8A A;  2E1Z A;  1Z26 A;  2NRW A;  1LW0 A;  1QQM A;  2P9I A;  2F7T A;  2QTD A;  4JS5 A;  4DV0 K;  2ZJQ L;  3DLE A;  4FM0 A;  3ITH A;  1GLE G;  4ELU A;  1S5J A;  4CZJ A;  3LAL A;  4GNI A;  2IC3 A;  3CCR N;  2KTQ A;  1GLB G;  1QSL A;  3MX2 A;  1YT3 A;  4OPJ A;  2EWS A;  2DFE A;  3NE6 A;  1SUQ A;  3ZT4 A;  2V51 B;  3DLG A;  5LMU K;  3RRG A;  4HWI A;  4JHD A;  5J1E A;  3CC7 N;  3AVH A;  3E66 A;  4E89 A;  3PY8 A;  1NGH A;  4FLX A;  4KI6 A;  5DK5 A;  1E3M A;  3SAF A;  4CJF A;  3SI6 A;  3C7N A;  1KCF A;  2P9I B;  3QML A;  5GIP A;  5TKW A;  4N76 A;  3QER A;  4ID1 A;  2NNW A;  4DTP A;  5BRF A;  4DMN A;  4CZK A;  4FM2 A;  3PSF A;  3U9D A;  1RDD A;  3ZSQ A;  4DQ8 A;  1Q18 A;  2YJE A;  3CJ9 A;  2NRZ A;  2QWN A;  3VER A;  5HOO A;  2OA8 A;  3K2P A;  4JKA A;  1YIT N;  2ASM A;  2O8F A;  4K8X A;  1TKT A;  2ZQB A;  1TUY A;  4X65 K;  4H0T B;  3P31 A;  1HQE A;  1NGJ A;  1KRP A;  4JHD B;  5AQY A;  3NF7 A;  3SZ2 A;  3SPZ A;  3ISN C;  3MXM A;  1RNH A;  4QS9 A;  3BY5 A;  4LF5 K;  1OH5 A;  3J8A A;  4KHN A;  4CFA A;  3V4I A;  3B6O A;  2IAJ A;  3WXJ A;  1TK0 A;  4ISF A;  5MLC Q;  4MQ3 A;  4FJK A;  4M7Y A;  4FL9 A;  4CCH A;  3VEW A;  5EU7 A;  1NK6 A;  2WUS A;  3MXJ A;  3HO1 A;  1HNX K;  1VSI A;  2Y1I A;  1IBK K;  4CJT A;  3ZX3 A;  3THX A;  1YUW A;  2YHY A;  4BRG A;  3CCM N;  1A5X A;  4B9T A;  1RT7 A;  4MLE A;  5LL6 Z;  4CF2 A;  3LM2 A;  3T69 A;  2FBT A;  4FLW A;  3ZT0 A;  1BG3 A;  3F73 A;  3AVM A;  3TSP A;  3JSM A;  3OBW A;  3ALY A;  4BR7 A;  4Z4H A;  2ZGZ A;  1K8A O;  4BQZ A;  2E6L A;  3FZL A;  4JK9 A;  3P38 A;  2FSK A;  1D9D A;  4O8U A;  1J54 A;  4OVL A;  1EWR A;  3L3U A;  1OH7 A;  1EET A;  3KHY A;  4LC9 B;  4CHN A;  1JLC A;  3MEG A;  4LF7 K;  1IKY A;  3E9O A;  5CYQ A;  1ZBF A;  3QEV A;  1Q8I A;  2NUB A;  3QNO A;  1RT5 A;  1HPZ A;  3AA4 A;  5BR9 A;  5KGW A;  1YJ9 N;  3THX B;  3T1Y K;  1GOA A;  2G8V A;  5M1F A;  2GX9 A;  3NF6 A;  2GWK A;  4A59 A;  3EY1 A;  4BC3 A;  4GV9 A;  1KAZ A;  4KH6 A;  1VRT A;  4CES A;  3GDQ A;  2FF6 A;  1XI1 A;  3KLF A;  4K43 A;  5AQH A;  4AM6 A;  4WFN L;  3I56 N;  1IG9 A;  4F4K A;  3QB0 A;  4JKG A;  4CZL A;  4EAH D;  4KRE A;  3VA3 A;  2QA4 N;  4U7B A;  3NCI A;  1UA0 A;  2PFU A;  1WN7 A;  4QAG A;  4A5A A;  4U67 L;  5I3U A;  3A8Y A;  3GBT A;  2Q36 A;  4JNE A;  5C2F A;  4B1X B;  2OZS A;  4ICL A;  3WEE A;  4FJJ A;  5M1K A;  1RGI A;  1DT9 A;  4LH5 A;  1RDA A;  2GEL A;  4KB1 A;  3UIQ A;  1X9W A;  4FK4 A;  2FBX A;  4PY5 A;  2NRV A;  1BQN A;  1OVY A;  4ZTJ A;  1BA1 A;  1LCU A;  1NGI A;  3NBP A;  4Z4E A;  1DGK N;  4H0V B;  1RTD A;  2PYJ A;  4FLU A;  4XH5 A;  1UOC A;  4BRP A;  1CLQ A;  4W5Q A;  4CJR A;  2KLA A;  4CBU A;  4JKG B;  4B9V A;  1U48 A;  1ILY A;  3RRH A;  1N5Y A;  1KFS A;  1EXQ A;  1BHL A;  4DR4 K;  3BGR A;  3O3F A;  3SCX A;  3QFP A;  3C6U A;  3DRS A;  2GUI A;  1V4T A;  4CZG A;  2QWM A;  3Q7C A;  4AIL C;  2OTJ N;  3WEE B;  3VEO A;  3TWH A;  4BY9 C;  4GVE A;  4N47 A;  4FLZ A;  2O8D A;  4J2D A;  3RR8 A;  3D2E A;  3EKU A;  2VGN A;  4DU1 A;  4KO0 A;  4G9Z A;  1JLA A;  1B9F A;  1EWQ A;  2YJF A;  4BRF A;  2QXF A;  1KC8 O;  2KFZ A;  5HRP A;  3H1V X;  3DM2 A;  2XRI A;  1L3T A;  5C2D A;  2P9K A;  4I9L A;  3DOK A;  3HRG A;  4E1M A;  1VSK A;  4NXM K;  4BRQ A;  3L0Q A;  4FZZ A;  5JLH A;  2A40 A;  1LWC A;  5CY4 A;  4KFB A;  3IS9 A;  1BO5 O;  3EE8 A;  2GWJ A;  3L2V A;  3K5M A;  4FJ8 A;  5BPL A;  4CHQ A;  3BZK A;  3CFP A;  2XY8 A;  2O8D B;  3DWL A;  2HHT A;  4BE2 A;  2ASP A;  3AVI A;  2RF2 A;  3C95 A;  5C25 A;  4H0Y B;  4DSJ A;  3AVN A;  5AQZ A;  1ZYQ A;  4BGB A;  2UUA K;  3AVA A;  1KVC A;  3SLC A;  2QWQ A;  1FKP A;  2ITG A;  2HMI A;  3TAB A;  3TAR A;  4J2E A;  3R6M A;  1QZ5 A;  3MK6 A;  4E19 A;  1EO1 A;  4LD0 A;  4FW2 A;  3GG4 A;  5BN9 A;  1MWK A;  1JXB A;  3OYK A;  3BP8 A;  2VWB A;  4BRO A;  4E7L A;  3HST B;  4FWQ A;  1WSE A;  2E2Q A;  4JKF A;  3MDQ A;  2WON A;  3IUC A;  3QO9 A;  4BR2 A;  5GIN A;  4NLC A;  3AA2 A;  1IKX A;  1HKC A;  2D0C A;  3MED A;  4W5T A;  3TAF A;  4K25 A;  3TR8 A;  4BQL A;  2D0P A;  4IG0 A;  3CJA A;  2HW3 A;  2DY4 A;  1NGF A;  1Z6R A;  4RTF D;  5FPN A;  2NRX A;  4EHT A;  3VQE A;  3ZSX A;  4I6M B;  3W0L A;  3CCE N;  1SL2 A;  3QEX A;  4DV2 K;  5JVH L;  4ZTF A;  4PKG A;  4CHY A;  5F0X A;  5LJV A;  1ZC6 A;  3BDP A;  4IDK A;  4CEQ A;  1N6Q A;  3LDO A;  2H3G X;  3DMJ A;  3HM8 A;  3NHG A;  3DXK B;  4LSL A;  3SNN A;  1YAG A;  3KJV A;  2XY7 A;  3E1Y A;  3EKS A;  5KI6 A;  2P9U A;  1QQO A;  4CF1 A;  4Z94 A;  3QIP A;  2VQE K;  4BR0 A;  4BRI A;  3VTH A;  4CEF A;  4DS4 A;  2X74 A;  4RG8 A;  3HVR A;  2R7Y A;  1BUP A;  1RFQ A;  4NXN K;  1QE1 A;  4JI5 K;  4FJM A;  2IOC A;  2BTF A;  1G99 A;  5JMV A;  3KWI A;  4JYA K;  2HF3 A;  4CJQ A;  4Z0U A;  2HOE A;  4B8A B;  1JLG A;  1J6Z A;  4CJW A;  3J7Z O;  4BRK A;  3EZ5 A;  3C6A A;  5LY3 A;  3KK1 A;  1XNQ K;  3M1F A;  4C8O A;  1NK4 A;  2I7N A;  3VQA A;  2E88 A;  3WQU A;  1DTQ A;  3R3L A;  1WSH A;  4CJL A;  2HNZ A;  2IDO A;  2OPR A;  4FZY A;  2P9L A;  1SZ2 A;  3O9S A;  5M1Q A;  4JKB A;  3QIO A;  1ZBL A;  1VQ9 N;  4B3M K;  4CEA A;  3RSE A;  1KLN A;  4DLE A;  2B5J A;  3CJ1 A;  4IG3 A;  4WQ4 A;  5C24 A;  3VOV A;  3QEI A;  1Q86 O;  1IBL K;  1RBS A;  2D0A A;  3KLI A;  3NVK A;  5GAD P;  5FRN A;  1VSJ A;  3L4I A;  3LP0 A;  2HMP A;  3DI6 A;  4FCY A;  4E3S A;  1HQU A;  1N34 K;  3TAM A;  2HBM A;  3HZ6 A;  1GOC A;  3A5M C;  1X3M A;  3D2F A;  3LP2 A;  4CZH A;  5GAG P;  2KZM A;  3OW2 M;  1U45 A;  4DR6 K;  5CE3 A;  3CPW M;  4MO4 A;  4RW4 A;  4XH1 A;  1WSJ A;  3U8X A;  4H0O A;  3H08 A;  2P9L B;  3P1G A;  1RBU A;  4B1V A;  1BA0 A;  5JS2 A;  3K9J A;  1ASW A;  2D0B A;  2WC9 A;  4JRQ A;  4BRE A;  2YNG A;  1NNE A;  3RSE B;  5H1S Q;  4Y0W A;  1YJW N;  2NRR A;  3AVC A;  1FXX A;  1C6V A;  5KTQ A;  1ATR A;  3R1X A;  3LZI A;  3WUH A;  1WAF A;  2YHX A;  1W97 L;  2ETJ A;  3SAH A;  4JRP A;  4OX9 K;  3O1B A;  3M8S A;  5HLF A;  3SBG A;  3H1Q A;  3IAY A;  3AVG A;  1XC9 A;  4Z4G A;  4E7J A;  3ZYY X;  4AF1 A;  3CI5 A;  1U4B A;  4CJ4 A;  3VQ6 A;  3D2F B;  3M8Q A;  4HUG A;  4DSF A;  5KPZ A;  4BE0 A;  1EP4 A;  5KRS A;  3A2F A;  4CGH A;  3TSQ A;  1C0M A;  3AO3 A;  4NO7 A;  1EKE A;  2HBL A;  3CCQ N;  2HHX A;  1YVN A;  2Q0R A;  1IO2 A;  5IWA K;  1NJI O;  1WLJ A;  3HPH A;  4M7X A;  4OLB A;  4RCH A;  3DLL L;  3F9K A;  4PL8 A;  3NAE A;  4DFM A;  1GLA G;  3VQ8 A;  1NGC A;  4XIU A;  4Y1D A;  5ADX H;  3MN5 A;  3TAG A;  4JKE A;  2UU9 K;  3RMD A;  1YHQ N;  3OYB A;  3RTV A;  3HVT A;  3CJB A;  2F4V K;  3VQD A;  3I55 N;  2BE2 A;  4GV3 A;  1QVF M;  1VQM N;  4TSX A;  1RT1 A;  1VRU A;  3K5N A;  2HHV A;  3WNF A;  4H0X B;  4DHY A;  5BPN A;  5E84 A;  4K0K K;  2E20 A;  5AQO A;  4DV4 K;  4CBW A;  1NGE A;  3ZCM A;  1R0A A;  2OAN A;  4WCE L;  3AVB A;  3KKR A;  3JYT A;  5HRS A;  4M3T A;  3QBX A;  4L8R B;  3AO1 A;  4B08 A;  2G8W A;  3D6R A;  4BDP A;  2CGJ A;  1S1T A;  4JI4 K;  1KTQ A;  3OYN A;  4O8K A;  3S9H A;  4CD3 A;  2G8U A;  4JI8 K;  5FPE A;  2P9P A;  4ISE A;  3VQ9 A;  4BRA A;  1LAV A;  1HX1 A;  3U4L A;  4DF4 A;  2FC0 A;  1YIJ N;  3FZF A;  4BE1 A;  1TAU A;  2YKN A;  4GW6 A;  4DTS A;  1QVG M;  3FZK A;  1VSD A;  2FSN A;  2P9S A;  1I94 K;  4L3Q A;  2KHO A;  4JKH A;  3V1Q A;  3VMF B;  3DYA A;  4CEB A;  1ASV A;  3TAQ A;  3LWL A;  3HXM A;  5M1P A;  3AGK A;  2HVH A;  5CZ2 A;  5AQF A;  4DTU A;  3NH2 A;  3WNG A;  3M6G A;  4N56 A;  3CG7 A;  4FPA A;  4KI4 A;  1LW2 A;  4WQ5 C;  3FFI A;  2E2O A;  3MN6 A;  3V6D A;  1FW6 A;  3G4S N;  3F5T A;  2PYL A;  3CF5 L;  3M8P A;  5BRE A;  3KLE A;  2NZT A;  2E5L K;  4H4O A;  5DM6 L;  3MEC A;  4A57 A;  3DLB A;  3ZT2 A;  1RDW X;  3KKS A;  1VQN N;  2P9P B;  3M8R A;  3H45 C;  4OGC A;  5J2P A;  1SKW A;  2X6S A;  4NB4 A;  4DV7 K;  3DXM A;  4I9Q A;  4JKC A;  3OYI A;  1UWB A;  3LAK A;  4B9N A;  1U04 A;  3OBY A;  2HVI A;  2P9S B;  4KBO A;  3KD5 E;  3U3Y A;  2E2N A;  1X9J A;  4AHS A;  4V19 S;  3TAP A;  4LH4 A;  1VQO N;  1TYQ B;  1CZB A;  3SQ0 A;  5C12 A;  1U6Z A;  3HP6 A;  5HP1 A;  1NJZ A;  2GEM A;  1MU2 A;  1YJN N;  4M3Y A;  4GKJ K;  1JL1 A;  1N36 K;  4CHZ A;  3KVG A;  4PQU A;  4CE9 A;  3VF4 A;  3LAM A;  1NK8 A;  1TL3 A;  2JWK A;  2OPQ A;  1HUX A;  1W0H A;  4RW8 A;  2P9N A;  4LFB K;  2WBN A;  1TAQ A;  4JI1 K;  1JLE A;  1K9M O;  3QFU A;  2G8I A;  4RW9 A;  4YY3 K;  3DXM B;  1S1U A;  4KAZ A;  3UKU A;  1A5W A;  5A2Q O;  1D4X A;  1IJJ A;  5EY4 A;  1NKC A;  4BDY A;  3FZH A;  1Q82 O;  3PIP L;  2QEX N;  5I42 A;  4Z4C A;  4IFE A;  4DUY K;  4PKH A;  4B3O A;  2ZD1 A;  4ZHR A;  3FGU A;  1VSH A;  3O8M A;  1VSM A;  2IVP A;  3LDQ A;  1G15 A;  2A6A A;  1DTT A;  4CJE A;  4OKJ A;  4KB0 A;  4LFA K;  2RKI A;  4O0I A;  1MA9 B;  2VYP A;  3KLH A;  3EO3 A;  2AJQ A;  3AVJ A;  4DQI A;  4FZX C;  4CEO A;  4M3X A;  1RBV A;  5AQK A;  2P9N B;  4CGD A;  3VGL A;  4W5N A;  5D3G A;  5T7B A;  3QNN A;  1E4F T;  5KQ8 A;  2P5O A;  3UKU B;  4QS7 A;  3HOS A;  4FJX A;  5AQW A;  1J9A A;  4O5B A;  3EL2 A;  3OYJ A;  1SQK A;  3AA3 A;  3L2W A;  3K5O A;  1TKX A;  3OS1 A;  2G8F A;  1RT2 A;  4DSE A;  4J2B A;  2BAN A;  2W6L A;  4HVJ A;  3SUO A;  2B4J A;  1MWM A;  3OYG A;  3I8D A;  3KK3 A;  4EHU A;  1J5E K;  4DQP A;  4OKK A;  1HRH A;  2D4W A;  1VQ5 N;  4NYN A;  5AQU A;  4DQQ A;  4H03 B;  4GKK K;  4DU4 A;  4BG8 A;  4FJ5 A;  4DR2 K;  3HBT A;  5EXW A;  2OTL N;  3WNH A;  4IFY A;  3PV8 A;  4CFB A;  2I7P A;  4FK0 A;  2F96 A;  3NGZ A;  2GUP A;  4IOC L;  3SV3 A;  1NGB A;  2WOM A;  4YOR A;  3VQB A;  3WXL A;  2Q2R A;  1HYS A;  2AA4 A;  4DV3 K;  3HJF A;  2D0O A;  1NJY A;  3P4I A;  4B9U A;  1ZBH A;  4FJI A;  3E9P A;  5FPD A;  2W40 A;  3J81 O;  3FLC O;  4NCB A;  5LJW A;  1DKG D;  2IVN A;  4A61 A;  2HND A;  3A5O C;  5JIC A;  1GLC G;  3JS6 A;  2ZWH A;  1RT6 A;  4F3T A;  2V52 B;  4JLH A;  2NRT A;  4CJ7 A;  4BRD A;  5FLX O;  3OYE A;  3AO2 A;  4PL7 A;  1W7A A;  3A5L C;  1QQC A;  3P83 D;  5BRH A;  4BC2 A;  1C1A A;  1BI4 A;  4FOI A;  3CM6 A;  3VQ7 A;  4CER A;  1QHT A;  4K41 A;  2G8H A;  1ESV A;  4JV5 K;  2FSJ A;  2YKM A;  1ITG A;  4O5F A;  2A1S A;  3O9U A;  1J5O A;  2VGM A;  4CGJ A;  2P1J A;  1JCF A;  3FZM A;  3P5J A;  1T03 A;  3KD1 E;  2QWR A;  4FWO A;  3MAQ A;  3NF8 A;  4BVP A;  2YHB A;  2JWL A;  1D8Y A;  3OYM A;  4AHV A;  3THW A;  3L6Q A;  1BCM A;  3WT0 A;  4B3T K;  1VQP N;  4FK2 A;  4KHS A;  4YOU A;  3TI0 A;  3V9Z A;  4FO0 A;  4BVO A;  5HRO A;  4JN4 A;  2BH1 A;  1KAX A;  4I6M A;  5AQL A;  1S1X A;  1X1P A;  1C1B A;  1U47 A;  1BI4 B;  3O4Q A;  1YI2 N;  4FLT A;  3HT3 A;  3VET A;  4YOY A;  4KHU A;  4DTM A;  3CQX A;  4GVM A;  4G1Q A;  4RW6 A;  3ENO A;  3DXK A;  4KTQ A;  4DSL A;  1W2B M;  5AZI A;  3BF1 A;  2QXL A;  5CZ1 A;  2X78 A;  3SJJ A;  2EHG A;  5BN8 A;  3VEY A;  4YFU A;  3G6E N;  1Z05 A;  3LZJ A;  4IFV A;  2UUC K;  2D5R A;  5J2Q A;  1ATN A;  1NOY A;  2Q0U A;  1S72 N;  4WFB L;  3D7E O;  4O55 A;  3IMX A;  4PWD A;  1NGA A;  3THW B;  5C15 A;  3PO5 A;  4JI2 K;  1K6Y A;  5AQG A;  3O9T A;  2VCP A;  3AO5 A;  3EYZ A;  4C1N I;  3SUN A;  3CXC M;  4EP5 A;  4Z4I A;  4EZ6 A;  3HK2 A;  3WXK A;  2P51 A;  2UYT A;  3DLK A;  3I8B A;  4YNQ A;  3V1O A;  5ADX A;  3ATV A;  3SK3 A;  2Q97 A;  1WNS A;  4GV6 A;  4FWP A;  3UKR A;  3CFO A;  3AV9 A;  3AVL A;  5AZI B;  3UE5 A;  5AFU A;  3T3F A;  3I0S A;  2Z1H A;  3V9S A;  4B1U B;  2YNH A;  5SZT A;  3O3G A;  2QKB A;  3TAE A;  4H5N A;  3K5L A;  4JI6 K;  1IG8 A;  4DG1 A;  3K58 A;  3RMA A;  1NBW A;  2O8C B;  2VWK A;  4IBN A;  1MDU B;  1UAX A;  3OJU A;  1BIS A;  4CFC A;  3C6H A;  4C1N K;  1TGO A;  4IEE A;  4CJK A;  4RWT A;  2UXB K;  4Q0B A;  4B1W B;  2ITM A;  1T05 A;  1QHA A;  1KFD A;  3J7A P;  5BRD A;  3VGM A;  3W3D A;  2KZZ A;  3CQY A;  4DR7 K;  4Y1C A;  2DFF A;  3F2K A;  4CK2 A;  4CI6 A;  1T6D A;  3ZSY A;  4M3W A;  4HCC A;  3HI0 A;  2ZJP L;  3H6E A;  2BDP A;  5AQM A;  4MFB A;  4DFK A;  3IG1 A;  5AQI A;  4PUO A;  2F9T A;  2RHK A;  5C0Y A;  3O80 A;  3ZX2 A;  3UKR B;  1SL1 A;  3SUP A;  1RDB A;  3VF6 A;  4DFJ A;  5M1N A;  4RW7 A;  4DUZ K;  4BRC A;  4C23 A;  4CF8 A;  3WXI A;  4HUE A;  3T19 A;  4W5R A;  2PBD A;  4O44 A;  3SUQ A;  2YI1 A;  4OLA A;  2P5G A;  3IFR A;  3ZSR A;  4J8F A;  4CZF A;  3EN9 A;  4DR5 K;  4A62 A;  1NU0 A;  2QWL A;  3MN7 A;  1LWF A;  3WXM B;  1SV5 A;  1T8E A;  1S1W A;  4FLV A;  1Y64 A;  4M41 A;  4AM7 A;  4ELT A;  2B6A A;  4UY8 O;  3C94 A;  4ILJ A;  3ZT1 A;  1VSF A;  1QS4 A;  1NK5 A;  3JXU A;  1X9M A;  3O5B A;  4Z4F A;  2FBV A;  4OJR A;  1GOB A;  1VSL A;  2HB5 A;  5AQN A;  4KPY A;  2OYQ A;  2YCH A;  3CMA N;  4B3S K;  1M90 O;  2HNY A;  3EZW A;  3AVK A;  4BGA A;  3KIO A;  2A1R A;  1KSP A;  4F2S A;  3PX6 A;  4E7I A;  4BC4 A;  3CQ8 A;  3PUF A;  4HUF A;  4DTX A;  3V9X A;  2BUP A;  4DTN A;  3IDH A;  2E1Y A;  2KQ2 A;  3NMU A;  3TPQ A;  4GY2 B;  3C6T A;  1T6C A;  5I9E B;  4X64 K;  4FVU A;  4BRH A;  2HF4 A;  4H5R A;  3FR0 A;  3T7Z A;  2YNF A;  2IS3 A;  4E7K A;  3B8A X;  3SQ2 A;  3H46 O;  3NGY A;  3VQ4 A;  1TUU A;  1ZBI A;  4OPA A;  3I33 A;  4ILH A;  2A41 A;  1R59 O;  1O13 A;  2W6K A;  3RMC A;  3F9M A;  4BR4 A;  1KAY A;  3O9Q A;  3PX4 A;  3ENH A;  4IZ9 A;  3VQC A;  1NOZ A;  2GTD A;  3DLH A;  5K14 A;  3VEN A;  2XY6 A;  3C65 A;  2F8T A;  5M1O A;  1HKG A;  2Q1N A;  5F1X A;  3OTO K;  1WSG A;  1L3S A;  2V7Y A;  3AAR A;  4ILG B;  3MMV A;  4NYF A;  4FYD A;  4R79 A;  1L3U A;  3MX5 A;  3J80 O;  4DTR A;  3CJ7 A;  1FKO A;  4DLG A;  1BL3 A;  4AHU A;  3KK2 A;  2IVO A;  3CPE A;  3V1R A;  4AHC A;  1GLJ O;  3LPT A;  1Q81 O;  2O4G A;  4BWM A;  1CXQ A;  2RN2 A;  1L3V A;  3TAN A;  1LWE A;  4YOT A;  3L2R A;  4E1N A;  4O4G A;  3OYC A;  4DFP A;  1J53 A;  3ZSW A;  3ZX0 A;  3BF3 A;  3LDP A;  4CGG A;  1WB9 A;  1Q9Y A;  3RR7 A;  5C42 A;  4BAC A;  4MLH A;  2A42 A;  4PHT X;  5DMR A;  4BRL A;  1I3A A;  5CYM A;  3S41 A;  4EFH A;  2ZJR L;  3NVM A;  3LM9 A;  1YF5 L;  1JLQ A;  2I5J A;  3HOT A;  1NKB A;  3R8E A;  1XHX A;  1KXP A;  5BR8 K;  4LY7 A;  4M3R A;  3NH0 A;  1NM1 A;  1QSY A;  3QEP A;  2BGG A;  3AAQ A;  4KKO A;  1DEJ A;  3NFA A;  2F9W A;  4B9Q A;  4M3Z A;  3S3O A;  1REV A;  3D0P A;  5AJ3 K;  4FSV A;  3VEV A;  4CJV A;  3MCA B;  4BRM A;  4EIA A;  2UXC K;  4FVM A;  3DAW A;  4QOZ B;  2HBJ A;  2QK9 A;  3L4Q A; 
#chains in the Genus database with same CATH homology
 4CHO A;  4CIF A;  1RBV A;  3CM5 A;  4FLY A;  1KVB A;  4BE2 A;  1TK8 A;  2HHT A;  3AVI A;  2RF2 A;  3C95 A;  2PZS A;  4CGD A;  3MEE A;  5C25 A;  4I2P A;  4W5N A;  5J2N A;  4B9L A;  5D3G A;  5HBM A;  5T7B A;  3OJS A;  3QNN A;  3HPG A;  4DSJ A;  2P5O A;  3AVN A;  3RMB A;  1ZYQ A;  4FJX A;  4CF0 A;  1J9A A;  4O5B A;  3OYJ A;  1Y97 A;  3AA3 A;  3L2W A;  3AVA A;  1WSF A;  1TKX A;  1KVC A;  3I0R A;  3K5O A;  3OS1 A;  2G8F A;  3ZT3 A;  1FKP A;  2ITG A;  3HPO A;  1RT2 A;  4DSE A;  3TAB A;  2HMI A;  4J2B A;  3S3M A;  1VK0 A;  3TAR A;  4J2E A;  2BAN A;  3LPU A;  1T7P A;  4HVJ A;  3SUO A;  4E19 A;  4LD0 A;  2B4J A;  4FW2 A;  4WE1 A;  4KHY A;  3OYG A;  3I8D A;  3KK3 A;  4AHR A;  4DQP A;  4OKK A;  1JXB A;  3OYK A;  2Q3S A;  1HRH A;  4E7L A;  4NYN A;  3HST B;  1WSE A;  4F8R A;  4DQQ A;  4C8L A;  4J2A A;  2IGI A;  2WON A;  3L2U A;  3VQP A;  1RT3 A;  4DU4 A;  1KLM A;  3QO9 A;  4Q5V A;  1FK9 A;  4FJ5 A;  3AA2 A;  1IKX A;  3B6P A;  1QTM A;  3G0Z A;  2VG6 A;  2D0C A;  3MED A;  4CIE A;  4W5T A;  2F8S A;  3TAF A;  3U3G A;  3TR8 A;  1TK5 A;  4E0D A;  4C8M A;  4CF9 A;  4IG0 A;  4FJL A;  2HW3 A;  2DY4 A;  3WNH A;  3ULD A;  1CXU A;  3AVF A;  1BGX T;  1C0U A;  4IFY A;  4CFB A;  1RT4 A;  4CJP A;  3LWM A;  2F96 A;  3NGZ A;  3SYZ A;  3ASM A;  4FK0 A;  3RWU A;  4DSI A;  3VQE A;  3ZSX A;  3SV3 A;  2WOM A;  3PX0 A;  3V9W A;  1RTI A;  2X6N A;  3ZSV A;  4CHP A;  2W42 A;  3QEX A;  3VQB A;  4AH9 A;  1SL2 A;  4ID5 A;  3HP9 A;  4DS5 A;  1HYS A;  2VWJ A;  1HYV A;  2JGU A;  4ZTF A;  4DQS A;  3U6F A;  3THV A;  4CHY A;  4CIG A;  4F3O A;  1NJY A;  3HJF A;  3L2Q A;  4R5P A;  2KW4 A;  4IDK A;  3BDP A;  4B9U A;  4FJ9 A;  1ZBH A;  4CEQ A;  1N6Q A;  4FJI A;  1S6Q A;  3DMJ A;  4H4M A;  3NHG A;  3OYH A;  4NCB A;  2XHB A;  4LSL A;  3SNN A;  4B8C A;  3DOL A;  3KJV A;  2HND A;  3QET A;  1Z25 A;  3S3N A;  4I2Q A;  2XY7 A;  4QCL A;  2HHS A;  5KI6 A;  1RT6 A;  2XO7 A;  4F3T A;  5HRN A;  1HYZ A;  4KTW A;  4DTO A;  2Y1J A;  1SKS A;  3VN5 A;  4JLH A;  3E01 A;  3LAN A;  4N41 A;  3QLH A;  4CF1 A;  2OZM A;  5E41 A;  1BQM A;  3OYE A;  4BDZ A;  2HHU A;  3QEW A;  4FW1 A;  3PO4 A;  3AO2 A;  2DTU A;  3QIP A;  4FJG A;  4W5O A;  3MXI A;  1JXE A;  1QQC A;  3P83 D;  1JLF A;  4CEF A;  2X74 A;  4DS4 A;  1QSS A;  4H8K A;  4RG8 A;  3HVR A;  2R7Y A;  1C1A A;  4K8Z A;  5KGX A;  3HM9 A;  1BI4 A;  1QE1 A;  3CM6 A;  3VQ7 A;  3KLG A;  4FJM A;  4CER A;  4M3Z A;  3AO4 A;  2IOC A;  4OGE A;  1D5A A;  1QHT A;  3OYD A;  3VA0 A;  2G8H A;  1RTJ A;  3L3V A;  3VQ5 A;  3SQ1 A;  4CJQ A;  4Z0U A;  4B8A B;  1JLG A;  2YKM A;  4NCA A;  1ITG A;  1S1V A;  2Z1G A;  3VQQ A;  4CJW A;  4LSN A;  4UQG A;  4PA1 A;  3DRR A;  2A1S A;  4KV8 A;  1RDC A;  3AA5 X;  1J5O A;  3EZ5 A;  3KK1 A;  3LDS A;  1NJW A;  2KFN A;  1HJR A;  5HRR A;  4CGJ A;  2FBY A;  4M42 A;  4C8O A;  1NK4 A;  4DWI A;  1TL1 A;  2P1J A;  3OYF A;  3P5J A;  3VQA A;  4CED A;  5J2M A;  1T03 A;  3KD1 E;  1F21 A;  1IKW A;  3MAQ A;  1DTQ A;  3NF8 A;  2YHB A;  4CFD A;  1WSH A;  1YTA A;  3OYM A;  1NKE A;  1D8Y A;  2G8K A;  4AHV A;  1BCM A;  4CJL A;  2HNZ A;  2IDO A;  2OPR A;  1L5U A;  2HHQ A;  3HYF A;  4B9S A;  4FZY A;  4FK2 A;  4KHS A;  1D9F A;  1S9E A;  3TI0 A;  4O0J A;  3D45 A;  3V9Z A;  2YNI A;  5HRO A;  3QIO A;  1Z26 A;  1ZBL A;  1LW0 A;  4CEA A;  4KRF A;  1S1X A;  1X1P A;  4M3X A;  1C1B A;  4JS5 A;  1U47 A;  3LP1 A;  1KLN A;  1BI4 B;  4DLE A;  3NDK A;  2B5J A;  3O4Q A;  3DLE A;  1LV5 A;  4FM0 A;  1BCO A;  4CEE A;  3ITH A;  4FLT A;  3HT3 A;  4IG3 A;  5C24 A;  3CFR A;  3QEI A;  4ELU A;  1RBS A;  1S5J A;  2D0A A;  3LAL A;  3T1A A;  4DTM A;  4GVM A;  2IC3 A;  3KLI A;  1CZ9 A;  3OYA A;  4KHU A;  2KTQ A;  4G1Q A;  5FRN A;  1I39 A;  4RW6 A;  1QSL A;  1VSJ A;  3LP0 A;  1YT3 A;  4KTQ A;  3DI6 A;  4FCY A;  4E3S A;  1HQU A;  4DSL A;  4OPJ A;  3TAM A;  3DRP A;  1GOC A;  5CZ1 A;  2DFE A;  3LP2 A;  2X78 A;  3SJJ A;  3NE6 A;  2EHG A;  4YFU A;  1SUQ A;  1NK0 A;  3ZT4 A;  3LZJ A;  2KZM A;  4CJU A;  3DLG A;  4IFV A;  1U45 A;  3RRG A;  5J1E A;  2D5R A;  3AVH A;  1RIL A;  5J2Q A;  1X9S A;  1NOY A;  5KRT A;  4RW4 A;  1RBR A;  4O55 A;  4E89 A;  1TKD A;  4PWD A;  1WSJ A;  2XY5 A;  3PY8 A;  3PO5 A;  1YVU A;  3CYM A;  4FLX A;  3H08 A;  1K6Y A;  3P1G A;  2GV9 A;  1RBU A;  4KI6 A;  5DK5 A;  4EP4 A;  4M3U A;  5JS2 A;  1ASW A;  2D0B A;  3AO5 A;  4M45 A;  4CJF A;  1WAJ A;  3EYZ A;  3SI6 A;  4JRQ A;  4C8K A;  3SUN A;  2YNG A;  4EP5 A;  4Z4I A;  1KCF A;  1DLO A;  1SKR A;  4N76 A;  4EZ6 A;  3HK2 A;  3QER A;  4ID1 A;  3AVC A;  1FXX A;  1C6V A;  2P51 A;  5KTQ A;  4DTP A;  1XHZ A;  3DLK A;  1O1W A;  1VSE A;  3LZI A;  4DMN A;  1WAF A;  2ETJ A;  4JRP A;  4FM2 A;  4YNQ A;  3V1O A;  1RDD A;  3ZSQ A;  2YHA A;  3M8S A;  5HLF A;  1JL2 A;  4CGI A;  3IAY A;  4EZ9 A;  3AVG A;  1XC9 A;  2OA8 A;  1WNS A;  4E7J A;  4Z4G A;  3K2P A;  2EX3 A;  3CFO A;  1TV6 A;  2ZE2 A;  3AV9 A;  3AVL A;  3OS2 A;  1U4B A;  4FM1 A;  4CJ4 A;  3T3F A;  3I0S A;  2Z1H A;  3VQ6 A;  3V9S A;  4K8X A;  1TKT A;  2ZQB A;  3M8Q A;  2YNH A;  5SZT A;  4HUG A;  4DSF A;  3O3G A;  2QKB A;  4HHT A;  4BE0 A;  3TAE A;  1HQE A;  3K5L A;  1EP4 A;  4DG1 A;  5KRS A;  3K58 A;  3A2F A;  3RMA A;  1KRP A;  4CGH A;  3HL8 A;  2VWK A;  4IBN A;  1UAX A;  1IKV A;  1C0M A;  3AO3 A;  3OJU A;  1BIS A;  1HNI A;  3NF7 A;  4CFC A;  3SZ2 A;  1EKE A;  4HCB A;  3SPZ A;  3ISN C;  3MXM A;  2HHX A;  1RNH A;  1TGO A;  4CJK A;  4Q0B A;  1HNV A;  4KHN A;  4CFA A;  1IO2 A;  3V4I A;  1NJX A;  1T05 A;  1WLJ A;  3HPH A;  3K59 A;  3B6O A;  3L8B A;  2IAJ A;  4OLB A;  1KFD A;  1TK0 A;  3F9K A;  2KZZ A;  4DU3 A;  4FJK A;  4MQ3 A;  3OS0 A;  4KTZ A;  2JLE A;  3NAE A;  4Y1C A;  2DFF A;  2E6M A;  4DFM A;  3VQ8 A;  4CCH A;  4CK2 A;  4XIU A;  1EX4 A;  2E4L A;  3G10 A;  4Y1D A;  3ZSY A;  5EU7 A;  1NK6 A;  1NK7 A;  4HCC A;  4M3W A;  3TAG A;  3MXJ A;  3HO1 A;  1VSI A;  2Y1I A;  2BDP A;  1B92 A;  1JLB A;  3LP3 A;  4CJT A;  3O3H A;  3RMD A;  4FZX C;  4MFB A;  4DFK A;  3IG1 A;  4N5S A;  1A5X A;  3OYB A;  4PUO A;  3RTV A;  3HVT A;  2LSN A;  3VQD A;  4B9T A;  3O4N A;  2BE2 A;  1RT7 A;  1XWL A;  1BIZ A;  4OKE A;  1SL1 A;  4CF2 A;  4DF8 A;  5JS1 A;  3SUP A;  1RDB A;  4TSX A;  2FBT A;  1RT1 A;  1VRU A;  1ZBU A;  3ZT0 A;  4FLW A;  1RCH A;  3K5N A;  4DFJ A;  3F73 A;  2PY5 A;  1TVR A;  3AVM A;  3QIN A;  4RW7 A;  3JSM A;  2HHV A;  3OVN A;  1IH7 A;  3WNF A;  3ALY A;  3NF9 A;  4Z4H A;  4CF8 A;  4HUE A;  3QES A;  2E6L A;  3SPY A;  3T19 A;  4W5R A;  4FJN A;  2GBZ A;  1D9D A;  1J54 A;  4O44 A;  4OVL A;  3ZCM A;  3SUQ A;  1R0A A;  3L3U A;  1EET A;  3AVB A;  3KKR A;  3JYT A;  3SV4 A;  2P5G A;  4OLA A;  1Q9X A;  3ZSR A;  4CHN A;  1A5V A;  1JLC A;  5HRS A;  4M3T A;  3MEG A;  1IKY A;  5CYQ A;  3AO1 A;  4B08 A;  4L8R B;  2G8W A;  4CEC A;  1ZBF A;  3QEV A;  4BDP A;  1LWF A;  1Q8I A;  1S1T A;  2YV0 X;  1KTQ A;  4AHT A;  3OYN A;  3S9H A;  2NUB A;  1SV5 A;  1T8E A;  1S1W A;  4FLV A;  3QNO A;  4M41 A;  3OYL A;  2G8U A;  1RT5 A;  1HPZ A;  3NGI A;  3AA4 A;  3VQ9 A;  4ELT A;  2B6A A;  5KGW A;  1LAV A;  4DF4 A;  2FC0 A;  3C94 A;  1GOA A;  1S9G A;  5FRO A;  3ZSZ A;  2G8V A;  3NF6 A;  3ZT1 A;  3EY1 A;  4BE1 A;  1VSF A;  1QS4 A;  2VG7 A;  1NK5 A;  2YKN A;  4GW6 A;  1X9M A;  4Z4F A;  1TAU A;  3K57 A;  1VRT A;  4CES A;  4DTS A;  2FBV A;  4OJR A;  3OY9 A;  4E7H A;  1VSD A;  2Z1J A;  1GOB A;  1VSL A;  1XI1 A;  3KLF A;  1RBT A;  2HB5 A;  4KPY A;  2OYQ A;  1IG9 A;  4BWJ A;  1B9D A;  2HNY A;  3V1Q A;  4F4K A;  3AVK A;  3DYA A;  4CEB A;  4KRE A;  1ASV A;  3VA3 A;  3TAQ A;  3LWL A;  3KIO A;  3HXM A;  2A1R A;  1KSP A;  4F2S A;  2HVH A;  5CZ2 A;  3NCI A;  4E7I A;  4DQR A;  3PX6 A;  3DLR A;  4DTU A;  1UA0 A;  3CQ8 A;  3NH2 A;  3PUF A;  3WNG A;  4HUF A;  4DTX A;  4ELV A;  3V9X A;  1WN7 A;  4N56 A;  4QAG A;  4DTN A;  3CG7 A;  4CGF A;  4CK3 A;  5I3U A;  1LW2 A;  4C8N A;  3KTQ A;  3FFI A;  4KI4 A;  1YTU A;  2KQ2 A;  3V6D A;  3C6T A;  5SWM A;  4NCG A;  2Z1I A;  2RPI A;  2PYL A;  2OZS A;  4ICL A;  3M8P A;  3KLE A;  2ATQ A;  4FJJ A;  4LH5 A;  1RDA A;  4H4O A;  3MEC A;  3DLB A;  3ZT2 A;  3UIQ A;  3KKS A;  4KB1 A;  2YNF A;  2IS3 A;  4E7K A;  3SQ2 A;  1NK9 A;  1X9W A;  4FK4 A;  3NGY A;  2FBX A;  3VQ4 A;  3M8R A;  4PY5 A;  4OGC A;  1ZBI A;  2OPP A;  5J2P A;  1SKW A;  1BQN A;  2X6S A;  4ZTJ A;  3ZSO A;  1UA1 A;  4I9Q A;  3OYI A;  3NBP A;  4Z4E A;  1UWB A;  3LAK A;  3IRX A;  4B9N A;  1U04 A;  2OPS A;  3RMC A;  4CJS A;  2HVI A;  1RTD A;  2PYJ A;  4FLU A;  3U3Y A;  3PX4 A;  1C1C A;  3KD5 E;  1UOC A;  1CLQ A;  1W9H A;  4W5Q A;  4CJR A;  3VQC A;  1NOZ A;  4KHW A;  4AHS A;  3DLH A;  4B9V A;  5K14 A;  2XY6 A;  1U48 A;  3RRH A;  3TAP A;  4LH4 A;  1U49 A;  1SL0 A;  1N5Y A;  2F8T A;  4FJH A;  3V9U A;  1CZB A;  1KFS A;  4GMJ B;  1EXQ A;  3SQ0 A;  1C0T A;  1BHL A;  4I7F A;  1HMV A;  4JS4 A;  1WSG A;  1L3S A;  3SQ4 A;  3HP6 A;  4NYF A;  4FYD A;  1L3U A;  5HP1 A;  1NJZ A;  3BGR A;  3O3F A;  4DTR A;  3SCX A;  3WNE A;  1FKO A;  4DLG A;  3C6U A;  1MU2 A;  4CEZ A;  1BL3 A;  2GUI A;  3DRS A;  4AHU A;  4M3Y A;  4DTJ A;  1JL1 A;  3KK2 A;  2O4I A;  4AIL C;  4B9M A;  4KHQ A;  4AHC A;  3V1R A;  4CHZ A;  4FJ7 A;  1LAW A;  3LPT A;  3TWH A;  4PQU A;  2O4G A;  4N47 A;  1CXQ A;  1S6P A;  4BWM A;  3LAM A;  4CE9 A;  4FLZ A;  1NK8 A;  1TL3 A;  1KVA A;  2RN2 A;  2OPQ A;  1L3V A;  3TAN A;  3RR8 A;  4J2D A;  1LWE A;  3L2R A;  4E1N A;  1W0H A;  4O4G A;  4RW8 A;  3NH1 A;  3OYC A;  4DU1 A;  4DFP A;  4KO0 A;  1J53 A;  1TAQ A;  1JLE A;  3ZSW A;  2G8I A;  4RW9 A;  1Q9Y A;  4CGG A;  3RR7 A;  1JLA A;  1B9F A;  1S1U A;  1WSI A;  5C42 A;  4BAC A;  5FDL A;  4KAZ A;  5FRM A;  1A5W A;  3PV8 A;  4CJ5 A;  4F2R A;  5DMR A;  4HTU A;  1I3A A;  5CYM A;  2QXF A;  1NKC A;  4DSK A;  2HHW A;  1ASU A;  2KFZ A;  5HRP A;  3DM2 A;  4BDY A;  1JLQ A;  2I5J A;  2XRI A;  1NKB A;  1XHX A;  1L3T A;  5I42 A;  4LY7 A;  4M3R A;  4Z4C A;  3NH0 A;  4IKF A;  4B3O A;  2ZD1 A;  4I9L A;  4ZHR A;  3DOK A;  3QEP A;  4E1M A;  1VSH A;  1QSY A;  2BGG A;  1VSK A;  4FXD A;  1VSM A;  4KKO A;  1TKZ A;  3NFA A;  4OPK A;  2VG5 A;  1G15 A;  2DFH A;  1DTT A;  4CJE A;  4OKJ A;  4CK1 A;  3S3O A;  4KB0 A;  4FZZ A;  1LWC A;  5CY4 A;  1REV A;  2RKI A;  4KFB A;  3IS9 A;  3V81 A;  4CJ3 A;  3D0P A;  4O0I A;  3KLH A;  3L2V A;  3K5M A;  4FJ8 A;  1BIU A;  3AVJ A;  4CJV A;  1RTH A;  4CHQ A;  4DQI A;  2AJQ A;  4FVM A;  2QKK A;  3CFP A;  4QOZ B;  2QK9 A;  1JKH A;  4CEO A;  2XY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...