4O5BA

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[6-(5-chloro-1h-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
molecule keywords Integrase
total genus 40
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o5bA00
4BDYA 4HUEA 3AVNA 4N76A 4N41A 4TSXA 3C95A 2DY4A 1RT7A 1GOCA 4B3OA 2I5JA 1NOZA 5HRPA 3O4NA 2GUIA 3SV4A 2WOMA 1CZ9A 4R5PA 3K5NA 1CLQA 3QESA 3OYNA 4C8OA 4OKJA 2LSNA 3VA3A 4FZZA 2D5RA 3TARA 4GW6A 2E6MA 2D0CA 3HP9A 4MFBA 1T03A 4BE2A 1NJXA 1VSFA 1NOYA 3PX6A 2HB5A 1C6VA 3HK2A 1T7PA 2KZZA 3PV8A 3DI6A 5J2PA 3ALYA 4DFPA 1ZYQA 2VG7A 2QXFA 1JKHA 1BL3A 4PQUA 1VSHA 3KK2A 1JLEA 1RDCA 1RT1A 1WSFA 3ZT1A 3O3HA 4H4MA 4AHTA 3S3OA 1N6QA 4FJGA 3SYZA 2OPQA 3PX4A 1SV5A 2HVIA 3KK1A 3ZSYA 2XY8A 3NF6A 2OPPA 3QO9A 4RW7A 1TK0A 1ZBFA 2B5JA 4F2RA 3RMAA 4LH5A 1RCHA 4EZ9A 2DTUA 3SI6A 2G8KA 4KPYA 4B9TA 1BGXT 2YNIA 3NBPA 3OYFA 3L2WA 1S1VA 4OKEA 4RW6A 4DQIA 4NCGA 3VQAA 3HP6A 3K57A 4RW4A 2RN2A 2YHAA 4KTQA 3NH0A 3I0RA 3NFAA 3ZSOA 3IAYA 4BWMA 1YVUA 3K59A 1RT5A 2JLEA 2P5GA 3M8QA 4CESA 4E3SA 1GOAA 2PYJA 4DQSA 4FXDA 1S6QA 3C94A 2R7YA 3VQBA 4J2EA 2X6NA 4W5NA 1J53A 4CHQA 3O3FA 2ZQBA 3KTQA 1CZBA 4IFVA 4FJNA 4CEAA 1CXQA 4CJQA 3KLFA 3K5LA 4DQQA 4CEQA 4DTOA 1KFDA 3K58A 4LD0A 5J2QA 4DU1A 4DQRA 4H8KA 3NGZA 1REVA 2IGIA 2FC0A 4FLUA 1TL3A 1SL2A 4FJKA 2O4IA 5D3GA 4N47A 4HHTA 2VG6A 4RW9A 4CJPA 4DTPA 4CEZA 1RDBA 3TAPA 4N56A 1SKWA 3WNHA 1ASVA 1UWBA 2BE2A 2VG5A 1JLFA 4IG3A 4Z4CA 3P83D 3SQ0A 2HMIA 3OYAA 4KHQA 3DLRA 2HNDA 3DRRA 1VSEA 3LANA 4AHSA 3IS9A 1A5VA 4B08A 1SKRA 2OPSA 2F96A 3IRXA 3NF8A 4CJ3A 3V81A 2ZD1A 5HRNA 4CHNA 4JRQA 2Z1IA 3L3VA 4DS5A 3NH2A 4KREA 3DLKA 1DTQA 1ITGA 4B8AB 4I2PA 1XHXA 3VQDA 1BI4B 3T3FA 4CJLA 1VK0A 3L2VA 4DTXA 2OPRA 4KTWA 1X9WA 1VSDA 4KAZA 4CFBA 3LZJA 4FK4A 2ATQA 1ASUA 3A2FA 4KHUA 3HYFA 3RR7A 4AHCA 2HHUA 3ASMA 3AVBA 2YNHA 3V9ZA 1TL1A 4FJJA 1YTUA 3C6TA 2QK9A 3ZSVA 3LWMA 4DU4A 5J2MA 1XC9A 2HW3A 3DOKA 3KD1E 5FDLA 4CIEA 4Z4HA 1DLOA 4CIGA 2GBZA 4CJUA 4CK2A 1BCMA 4FW2A 1QSYA 1BQNA 5I42A 3CQ8A 1UAXA 4KB0A 3QNNA 1KCFA 3BGRA 3AVLA 3QIPA 3OYIA 3SUQA 4M3ZA 1RBSA 4FLTA 4ICLA 1VSJA 3HPGA 4PUOA 2NUBA 3V6DA 4YNQA 3OYHA 3LZIA 4DTJA 4F4KA 3DYAA 3EY1A 2HHXA 3SQ4A 3C6UA 4CERA 4BDPA 4J2BA 1LAVA 1I3AA 4IDKA 4CGJA 4QCLA 1ZBUA 3VQ9A 4MQ3A 3V1RA 1TKTA 4CEDA 3SUPA 1NJZA 3AVCA 3DLEA 1WN7A 2G8UA 1HQEA 4CHZA 3PO5A 4DQPA 1C1BA 4NYFA 2DFFA 4HUFA 5DK5A 3QNOA 3HO1A 4DFKA 4Z4IA 4DSKA 1RDDA 2QKBA 4ELVA 4CHPA 4ID5A 4EZ6A 3OYCA 1C1AA 1VRTA 1RTDA 4AHVA 2OA8A 4ELTA 4DSLA 4I2QA 1S9EA 3CFPA 4K8XA 3TANA 1W9HA 4FZYA 2ZE2A 1RBUA 2HHSA 3B6PA 1T05A 3RMDA 2HHVA 5SWMA 3DLBA 3ZSQA 4E7LA 4ID1A 3ZCMA 2YHBA 4DS4A 3B6OA 4AILC 1HMVA 3QIOA 2Y1IA 2G8VA 3V1OA 1KLMA 3SCXA 1JL1A 3MECA 4IKFA 3VQ8A 4KTZA 1UA1A 1LAWA 1WSHA 4FLZA 4FLYA 2XRIA 3ISNC 1EKEA 4E7IA 4FZXC 4CEBA 1HYSA 2G8HA 4LSNA 3RTVA 1QE1A 2Z1JA 4CJEA 4DSEA 4M3UA 5I3UA 1FXXA 1QHTA 4LY7A 3O3GA 3LAKA 3HPHA 3S9HA 4C8NA 4HUGA 1RNHA 2VWJA 2B6AA 3M8RA 3SQ2A 1LWFA 4BE0A 1Z26A 5KGXA 3I8DA 1S1UA 3OYMA 1Z25A 2XY5A 4E7KA 5KTQA 3CYMA 3SV3A 1YTAA 3QINA 1RT4A 3F73A 1JLBA 3KIOA 2HNYA 4RG8A 1U47A 1JLQA 3ZSXA 3ZT2A 1KVBA 2RF2A 4OGEA 2PZSA 3OYBA 4F8RA 4FJLA 3SPYA 1S9GA 1BCOA 2KW4A 3VN5A 3LPUA 1NKBA 1XWLA 2G8WA 4ZTFA 5CYQA 4DU3A 1RTIA 1KVAA 1NK4A 3P5JA 1J5OA 1BI4A 2YNGA 4CF9A 3MXMA 1X9MA 3DLHA 4DSJA 4NCAA 3DRSA 3LP2A 5CZ2A 1L3UA 3HJFA 1B9FA 4M3XA 1VSLA 2HHWA 4FJIA 3HPOA 2IS3A 4W5QA 2EHGA 5JS2A 4CIFA 2XY6A 4DWIA 3OYJA 1JLAA 4H4OA 1HYVA 4CJWA 3M8SA 4KKOA 4ELUA 5J1EA 2W42A 3NF9A 5C24A 1D5AA 3DRPA 3WNGA 3BDPA 4FLWA 4FM0A 4GVMA 5HRRA 1VRUA 4CF0A 3OYGA 1TK5A 4OLAA 3HT3A 2JGUA 3S3NA 2P51A 1NK5A 5K14A 4NCBA 3NAEA 4OPJA 1TK8A 4FJ8A 3MEDA 4I9QA 3UIQA 1K6YA 4M41A 2ETJA 1NK6A 3OY9A 4DTNA 3DOLA 4CK1A 1RBVA 1NJYA 1HRHA 5DMRA 4O4GA 4Z4FA 1TAQA 3AA3A 4OPKA 3HL8A 4CGIA 4M3WA 3RRGA 2KFNA 2OYQA 1TKXA 4C8MA 3ITHA 4UQGA 2D0AA 1D9FA 3V9SA 5EU7A 4FLXA 4OVLA 1HQUA 3TAFA 1RTHA 2DFEA 3DLGA 3ZT4A 1Q9YA 4FJ5A 3LDSA 4FCYA 4CJVA 4CHYA 4W5TA 3TABA 5HRSA 1JL2A 5SZTA 3OYDA 2XO7A 5KGWA 3SPZA 2P5OA 2BGGA 4CGFA 4FYDA 1NK7A 3D45A 3MXJA 3AV9A 3VQEA 1KTQA 4DFMA 4DF8A 2YKNA 3M8PA 1BIZA 3LAMA 3ZSZA 1FKOA 1U49A 1D9DA 5FROA 3TR8A 4CCHA 1DTTA 2XY7A 1ZBHA 1IKXA 4J2DA 3NF7A 4CGDA 1B92A 1LV5A 1Y97A 4LSLA 4E19A 5HLFA 3L3UA 1J54A 4F2SA 4E7JA 3OS0A 1UA0A 4OGCA 3CFRA 3LPTA 1C0MA 4FJ7A 2KQ2A 3PUFA 1RDAA 2IC3A 2BANA 3NE6A 3OYKA 3LP1A 3VQPA 3V9XA 1SL1A 2VWKA 3AA5X 4W5OA 1BQMA 5FRNA 1IO2A 3F9KA 3PX0A 3KD5E 2EX3A 2HNZA 4Y1CA 1WSGA 2A1RA 1NJWA 4DMNA 5KRTA 3HM9A 1EXQA 3CM5A 1NK0A 1G15A 3THVA 1RT6A 1Q9XA 5J2NA 4K8ZA 2F8SA 5HROA 1HPZA 2KFZA 1VSKA 2FBXA 4I9LA 4FM1A 3NCIA 4Z0UA 2FBYA 3LP0A 3HXMA 1SUQA 1XI1A 1KLNA 3DM2A 4CK3A 5C42A 3NH1A 3QETA 1QQCA 1JLGA 3CM6A 1U48A 4NYNA 1NK8A 5JS1A 2Q3SA 1FKPA 4E7HA 3V4IA 4QOZB 4CFDA 3U6FA 4DFJA 1S1XA 2FBVA 3KLIA 3QEXA 1HYZA 5CYMA 4FK0A 4Z4EA 1UOCA 4C8LA 3VQQA 2AJQA 1CXUA 2A1SA 5CZ1A 1NKEA 1WSJA 1HNIA 3KLHA 5HP1A 2P1JA 1XHZA 1IKVA 3VQCA 2KZMA 3JSMA 4AHUA 1HJRA 1QS4A 2GV9A 1KRPA 3T1AA 3L2UA 3RMCA 3SNNA 1S5JA 1QTMA 3OJUA 3L8BA 3VQ6A 3L2RA 3MEEA 3LALA 3AO2A 4CECA 4DTUA 1HNVA 1KSPA 1D8YA 4F3TA 4E1NA 3RR8A 4EP4A 1U04A 4DTSA 1TKDA 2IOCA 4E1MA 3IG1A 1S1TA 4KO0A 3WNFA 3P1GA 3KJVA 1LWCA 2Z1GA 4W5RA 4DLGA 4Q0BA 4FLVA 1IKYA 1B9DA 3K2PA 2ITGA 2HVHA 4BE1A 1I39A 3HVTA 3KLGA 3TAEA 2E6LA 3HVRA 4CJ4A 4DTMA 4KFBA 1KFSA 3QERA 4CHOA 3KKSA 2PY5A 4CE9A 4O0IA 4G1QA 3QEIA 4KHNA 4E89A 3AVGA 1WAJA 3SUOA 3SJJA 4CFAA 1L3VA 1IG9A 3PY8A 3AVIA 2WONA 3K5MA 1SKSA 3KLEA 4FJMA 4CGGA 2DFHA 1EETA 4KHSA 2O4GA 4CJRA 1YT3A 1S6PA 4O44A 1RT2A 4BWJA 2OZMA 4AHRA 4QAGA 5KI6A 3AA4A 4CJTA 1J9AA 3ZT3A 4B9UA 1WSIA 3LP3A 3TI0A 3AVAA 1TGOA 3I0SA 5CY4A 4KI4A 1A5XA 2RPIA 3JYTA 1WNSA 3RRHA 1A5WA 3AO1A 1EP4A 4RW8A 3RMBA 4FW1A 4CJFA 2PYLA 2OZSA 1NKCA 4DSIA 2X74A 4CEEA 2X78A 4E0DA 3U3GA 4JS5A 2QKKA 3EYZA 3NGYA 1WLJA 1WSEA 3ZT0A 2IDOA 1VSMA 3AO3A 3O4QA 2BDPA 4KI6A 4JS4A 1C0UA 1VSIA 2Z1HA 1T8EA 1LW0A 4F3OA 2YNFA 2X6SA 4OKKA 4CJKA 3AVKA 2HHTA 3CG7A 1L3SA 3TAMA 3G10A 4CEFA 3K5OA 3OS1A 3ZSWA 4BACA 1BHLA 1O1WA 4O0JA 4CJ5A 3L2QA 3VA0A 1RBTA 4N5SA 1N5YA 3AVMA 1RBRA 4M3RA 4CGHA 2YKMA 4KHYA 4IBNA 3EZ5A 1NK9A 2KTQA 4ZTJA 4FVMA 4B8CA 4LH4A 1EX4A 2IAJA 4HVJA 1L5UA 1QSSA 4HTUA 3AO4A 4YFUA 1QSLA 4C8KA 4B9LA 4OLBA 4CJSA 5KRSA 1TAUA 3NHGA 3D0PA 3DMJA 4AH9A 4KRFA 1ASWA 3TWHA 4FJ9A 3QLHA 4B9VA 3HSTB 2FBTA 2YV0X 3SZ2A 3TAGA 4M45A 4DF4A 1GOBA 4B9MA 2F8TA 4DG1A 1IH7A 3VQ4A 1R0AA 4HCBA 4Z4GA 4J2AA 1WAFA 1IKWA 1TKZA 4Y1DA 5HBMA 4DSFA 4ZHRA 1Q8IA 4CF8A 4DTRA 4PWDA 4WE1A 3SQ1A 4FJHA 4Q5VA 3H08A 3FFIA 3KKRA 1BIUA 1JXEA 4I7FA 4PA1A 3V1QA 3S3MA 4M3TA 2E4LA 3V9WA 1L3TA 4EP5A 2G8IA 2HHQA 4IFYA 1JLCA 3AA2A 1KVCA 4M3YA 4JRPA 4M42A 1C1CA 1RT3A 3CFOA 3KK3A 1JXBA 1RTJA 1X9SA 3MAQA 3MXIA 3WNEA 5E41A 3V9UA 1LWEA 1X1PA 4PY5A 4DLEA 4BDZA 4KV8A 1TV6A 3U3YA 2D0BA 1U4BA 4CFCA 1S1WA 1W0HA 3OJSA 1ZBLA 3NDKA 4KHWA 1ZBIA 2RKIA 3E01A 4CF2A 4L8RB 5T7BA 2G8FA 1MU2A 5FRMA 1U45A 4HCCA 3QEVA 4XIUA 4B9SA 3RWUA 1LW2A 4FJXA 3AO5A 3AVHA 4FM2A 3OVNA 3T19A 1TVRA 1F21A 4CF1A 3OYEA 3VQ7A 1C0TA 4GMJB 3SUNA 4CEOA 3G0ZA 4OJRA 3LWLA 2XHBA 1SL0A 4FK2A 3AVFA 1BISA 4O5BA 3ZSRA 4IG0A 3QEWA 4JLHA 3PO4A 1FK9A 4O55A 3OS2A 3NGIA 1RILA 5C25A 3AVJA 3MEGA 3OYLA 3QEPA 3TAQA 4B9NA 3ULDA 3VQ5A 4KB1A 2Y1JA 2B4JA
chains in the Genus database with same CATH superfamily
4JKGB 4BY9C 1GOCA 3IMXA 5HRPA 3O4NA 2GUIA 3SV4A 2P9SB 1VQ8N 1IBMK 3HP9A 5KQDA 1NOYA 5JVHL 2Q0RA 4PKIA 4FWKA 5J2PA 3ALYA 3C6HA 2QXFA 3EE8A 4BQZA 3DXKB 3VTIA 3ZT1A 1N6QA 3SYZA 1J5EK 5B8HA 3U9DA 3ZSYA 2XY8A 3FGUA 4DR6K 4F2RA 1EO1A 4ILHA 4Z94A 1YJNN 4EZ9A 1KD1O 3SI6A 2G8KA 1BGXT 3OYFA 2E1YA 4KH6A 4I6MA 3IKMA 3NFAA 5BPLA 2YHYA 2JLEA 1GOAA 3MN5A 3CCRN 3VGKA 1CZBA 4IFVA 4CEQA 1KFDA 5JVGL 4DQRA 4H8KA 3P39A 1SL2A 2FC0A 1HR0K 1TL3A 2A5XA 2VG6A 3BZCA 1RDBA 1UWBA 4BC3A 2FSNA 4ISGA 4AHSA 3IS9A 1A5VA 4CZHA 3NF8A 3VF4A 4JRQA 3PIOL 1XHXA 3VQDA 3T3FA 1NNEA 3L2VA 2QWPA 4DV5K 1EQYA 3A2FA 2F4VK 4JI3K 4AHCA 3AVBA 2YNHA 4AQYK 1TL1A 4GV9A 4CZKA 1YTUA 5J2MA 1QQNA 5AQSA 3D6RA 3VEZA 4BGAA 1QZ6A 2UUCK 1NGJA 1Q18A 2ZGYA 3TPQA 2NRVA 5LMNK 5I42A 2D4WA 4KB0A 3QNNA 3O1BA 4AM6A 2KLAA 4ICLA 5AQLA 2W40A 4EHUA 5JLFA 1LAVA 4CGJA 4IDKA 1XNQK 3TTDA 3ENOA 1TKTA 4CEDA 1FW6A 4HUFA 2OANA 5BPNA 1RDDA 4JI0K 3TTFA 1VQ4N 2PFUA 4CHPA 3OYCA 4JKAA 1VRTA 4AHVA 4ELTA 4DSLA 4I2QA 4DR7K 4JKGA 1W9HA 2EWSA 1N32K 2HHSA 3AGKA 3DLBA 3ZSQA 4E7LA 1EWQA 4CZGA 2IVOA 3QIOA 4IEIA 3V1OA 1KLMA 4IKFA 1UA1A 1LAWA 3WT0A 1BWFO 3ISNC 1EKEA 4FZXC 4C23A 4CEBA 1HYSA 2G8HA 5AR0A 3O9QA 4CD1A 1FXXA 3C7NA 3ULEA 1K8AO 1P90A 3E66A 4C8NA 4HUGA 1LWFA 3I8DA 2XY5A 3LDOA 1BA0A 2O8BA 2V7ZA 4GV3A 3QINA 1RT4A 3F73A 1JLBA 3SAHA 2RF2A 2I7NA 5I9EB 3SPYA 2KW4A 4A5BA 4CI6A 4H0OA 1NK4A 1J5OA 1N36K 3MXMA 3DLHA 3HJFA 1B9FA 4M3XA 1OH5A 1TUUA 3HPOA 4K0KK 2EHGA 5JS2A 4CIFA 3OYJA 3F9MA 3THYB 3M8SA 4ELUA 5J1EA 2HBLA 1XNRK 4FVUA 3BDPA 4FLWA 1QVFM 1VRUA 4DR3K 4DR4K 3VENA 2JGUA 1NK5A 3UKUA 3FZMA 4WFBL 3NAEA 2ETJA 3OY9A 2V52B 4CK1A 1MWMA 4Z4FA 1NLVA 1Q86O 1TAQA 4Y0WA 1S72N 2O8FB 4OVLA 3THXB 4WCEL 3TSQA 3ZT4A 3H6EA 4DR1K 2WUSA 3TABA 2XO7A 4FYDA 3SPZA 2P5OA 1GLFO 1HNXK 3D45A 4U67L 3MXJA 4KHPK 5TKYA 1KTQA 2W6LA 4DFMA 2YKNA 4DF8A 3LAMA 3ZSZA 1FKOA 4MO5A 1IKXA 1HPMA 1B92A 1HX1A 2QI2A 1UA0A 4BRAA 2Q1NA 5F0XA 4H0XB 1C0FA 1RDAA 4V19S 1QQMA 3T69A 1SL1A 2VWKA 3R1XA 1NGHA 5FRNA 3W3DA 3SBGA 2EX3A 4HWIA 5AQUA 3DWLA 1NJWA 4DMNA 5KRTA 1EXQA 4H0VB 1Q9XA 5BRHA 4KB1A 3FFKB 1M1KO 4LF6K 3CPEA 3LP0A 3NH1A 4NYNA 3H46O 4E7HA 4QOZB 4DCHA 3C65A 1S1XA 3SAGA 1HYZA 5CYMA 5AZJB 3J7ZO 4Z4EA 4BRCA 1YJ9N 4JI5K 2A1SA 1WSJA 1HNIA 3KLHA 5HP1A 1IKVA 3VQCA 2KZMA 2KHOA 3JSMA 5AQGA 3T1AA 4LFAK 3WXIA 2UUBK 1S5JA 3L8BA 4OX9K 3VQ6A 3L2RA 3LALA 3AO2A 3VGMA 1ZBSA 3RR8A 5AQQA 4EP4A 1U04A 3ULEB 3NMUA 3IFRA 3Q7CA 1OH8A 2D1KA 2Z1GA 4W5RA 4FLVA 1B9DA 4RTFD 2ITGA 2HVHA 1NM1A 1I39A 3D2EA 3KLGA 1YAGA 3KZBA 4CJ4A 3CCUN 4DTMA 3QERA 4BRHA 4O0IA 4DV1K 2HHHK 1WAJA 3CCJN 2VGMA 3AAQA 3SAFA 1NGCA 1YHQN 4KHSA 2O4GA 1JCFA 1S6PA 5AQXA 3R8EA 2OZMA 4FWLA 3ZT3A 3UKUB 2YHXA 3JYTA 2HMPA 4UY8O 4RW8A 4B3MK 1V4TA 3U3GA 4GY2B 5BR8K 3EO3A 1C0UA 2Z1HA 3A5NC 3P31A 2YJFA 4DR5K 2P9NA 3CG7A 1L3SA 3G10A 2P9LB 4CZEA 3HTVA 3VA0A 4M3UA 4CGHA 4DV4K 3SBTA 2KTQA 4ZTJA 1EX4A 4B9LA 4C8KA 4K43A 4H5WA 2BTFA 5EOYA 3DMJA 2V7YA 3TWHA 1WUAA 4B9VA 4BR7A 2YV0X 3SZ2A 1ZC6A 3IDHA 2Q97A 3E9LA 5AFUA 3DJCA 3VQ4A 1SS6A 4A57A 1IKWA 1TKZA 4Y1DA 3MWPA 4DSFA 4ZHRA 4JAXA 3V1QA 3H08A 4PA1A 4L3QA 3ZX3A 3A8YA 1IBKK 2E4LA 1L3TA 2HHQA 2P9KA 3AA2A 1KVCA 4BRQA 3CFOA 3G4SN 1X9SA 3CJ9A 3U3YA 2QWOA 3O9SA 4KHWA 4BC2A 1ZBIA 4O5FA 5T7BA 1BDGA 5FRMA 1U45A 4WQ4A 4XIUA 3RWUA 1LW2A 3AAPA 1TVRA 3GL1A 5TKWA 4CF1A 3G0ZA 3AVFA 4O5BA 4IG0A 4JLHA 2P9SA 4O8UA 4B3TK 3TAQA 4B9NA 5HL7L 1BG3A 3ULDA 3LDLA 1N34K 2B4JA 4N41A 2UU9K 2DY4A 5M1NA 4B3OA 2I5JA 1CLQA 2WOMA 1CZ9A 1ATSA 5AQVA 4OKJA 2LSNA 3VA3A 4CBWA 3VGLA 3TARA 4GW6A 3SK3A 3C0BA 3JAMO 4BE2A 1NJXA 4XH4A 2UXCK 3PX6A 2HB5A 3L4IA 3D2FB 2E2QA 3HK2A 4JK8A 3PV8A 3KK2A 1WSFA 1RT1A 1C0GA 3SJHA 3PX4A 3GBTA 1VHXA 2HVIA 2CGLA 4RW7A 2NZTA 3EEQA 5AQWA 4JI4K 2ZGZA 4FWNA 3ENBA 4KPYA 1Z6RA 2CGJA 1S1VA 2E20A 3I0RA 3ZSOA 3E9OA 2NRRA 3K59A 4K25A 3UKRA 2P5GA 3M8QA 4E3SA 2PYJA 4FXDA 4DQSA 1Q7YO 1S6QA 3QBXA 3SMPA 4W5NA 4X64K 1J53A 4BROA 2ZF5O 3FE1A 3KTQA 4CEAA 3K58A 4FJKA 5LY3A 1K73O 5D3GA 4HHTA 4RW9A 3H45C 4CJPA 4CEZA 3OA9A 4N56A 4A61A 3CD6N 5C10A 1DEJA 1VSEA 3LANA 5AQYA 1D8YA 1SKRA 2F96A 2ZD1A 4DS5A 4NXNK 4JI2K 1DTQA 1ITGA 2FLOA 4AF1A 2D0PA 1D4XA 1VK0A 3ZX2A 2OPRA 4KTWA 3H3OB 4CFBA 5GIOA 3LZJA 1NGEA 2ATQA 2PAVA 3HYFA 5GAHP 4IZ9A 4H5NA 3V9ZA 2VCPA 4BC4A 1T6CA 1RDWX 3OHRA 3LWMA 3MK6A 1XC9A 3KD1E 3LL3A 4Z4HA 4U7BA 4CJUA 2VQEK 1BQNA 3CQ8A 1UAXA 4BRLA 4LF5K 3QIPA 3ZYYX 4M3ZA 4FLTA 3HPGA 3DAWA 3V6DA 4YNQA 1NGDA 4DTJA 1WOQA 1NG9A 5JMVA 3SQ4A 4BVOA 4QCLA 3R6MA 1ZBUA 3PSFA 4MQ3A 3V1RA 2G8UA 1E3MA 1W97L 3AVCA 3PO5A 1WN7A 1C1BA 4NYFA 2DFFA 3AY9A 5DK5A 4X66K 3QNOA 4DSKA 1E4FT 5LMUK 4ELVA 4EZ6A 1C1AA 3QFPA 3S41A 3CFPA 2NRWA 1RBUA 2A41A 5DM6L 3RMDA 2G8VA 3ZCMA 1HMVA 3SCXA 1JL1A 2P9IA 3VQ8A 2E1ZA 4KTZA 4FLZA 1GLDG 2ZM6K 3I33A 4CD3A 3C6AA 4WF9L 3RTVA 1VQ5N 5I3UA 1QHTA 3J81O 3LAKA 1RNHA 2HF3A 1S1UA 1Z25A 4IOAL 4BRNA 3SV3A 2FXUA 4PL7A 1U47A 2CGKA 3KIOA 2HNYA 3RSEA 3ZSXA 3ZT2A 4OGEA 4EAHD 3AGRA 3OYBA 1BO5O 2PZSA 3EKUA 4FJLA 1BCOA 1SQKA 1XWLA 2G8WA 4ZTFA 1OVYA 3HOSA 1FJGK 4FL9A 4CF9A 5IT9O 4NCAA 5CZ2A 1L3UA 1VSLA 3WXMB 2IS3A 2XY6A 4QS8A 3CQYA 1HYVA 3A0IX 4CJWA 2WC9A 4A59A 2W42A 3NF9A 3DRPA 4FM0A 3OW2M 4B1UB 3CC4N 4GVMA 4IDHA 4CF0A 3OYGA 4WFNL 1VQLN 2NRXA 3MEDA 3PLAA 1K6YA 4C1NI 1NK6A 1YVNA 4OPAA 1RBVA 1NJYA 3MX5A 5LJVA 4OPKA 3VERA 4M3WA 5M1PA 1TKXA 1Q9YA 4FJ5A 1I94K 4FCYA 4CJVA 1NU0A 3CJBA 1JL2A 3ID8A 3OYDA 2BGGA 1NK7A 3OBWA 1D9DA 3MDQA 3TR8A 3M3ZA 4DV7K 2QWQA 3AARA 1G99A 3WXKA 4PHTX 1J54A 4F2SA 4E7JA 3OS0A 3O6WA 3PUFA 3O9TA 2IC3A 3NE6A 4CZMA 3CERA 3LP1A 3OYKA 2ASPA 4W5OA 3AA5X 1KAZA 3PX0A 3D7EO 4I6MB 3UE5A 5C2DA 3HM9A 5KPZA 4K8ZA 5J2NA 2KFZA 1HPZA 5AQIA 3KWIA 3CIPA 4I9LA 4FM1A 3NCIA 3FLCO 4Z0UA 1KLNA 5FPDA 3DM2A 3QETA 5C42A 1QQCA 1JLGA 3VEXA 4OO1J 3WEEA 1JCGA 3V4IA 4CFDA 3QEXA 1UOCA 1ZXOA 4JI6K 3GE1A 4AHUA 1KRPA 1QTMA 3MEEA 4B1WB 4CECA 1HNVA 1KSPA 3KK7A 4BR5A 3O4WA 4FOEA 2IOCA 2JWKA 4KO0A 1YF5L 1KC8O 1HKGA 4Q0BA 1IKYA 3SMSA 1XC3A 4BE1A 4BR0A 3SLCA 3HVRA 1KFSA 2PY5A 3MMVA 5FLXO 4CE9A 4G1QA 1RGIA 3SJJA 1X3MA 2P9UB 3AVIA 3K5MA 1SKSA 4FJMA 1MDUB 4CGGA 4CJRA 3CQXA 4AHRA 3QFUA 2GWKA 5CY4A 3HOTA 3AO1A 4FW1A 1NKCA 2X74A 3CCQN 2X78A 3R3LA 5A2QO 2QKKA 3OTOK 3L4QA 1Q81O 5GAGP 1VSMA 4IXCA 3O4QA 4KI6A 3TTCA 3CCVN 3ENHA 3TAMA 1YXQA 4CEFA 3HI0A 3O80A 3OS1A 1BU6O 1BHLA 3MN9A 4CJ5A 1RBTA 4N5SA 2GTDA 1RBRA 4M3RA 4YOXA 4BREA 3EZ5A 2AA4A 1W2BM 3R9PA 3MN7A 4LH4A 4B8CA 4HVJA 1YJWN 1QSLA 5C15A 4NLBA 1TAUA 4FOIA 4YOUA 4AH9A 3HSTB 4RCHA 3TAGA 2VQFK 4DF4A 2H3GX 4BR4A 4BRKA 3C7NB 3TSUA 2F8TA 3P38A 4DG1A 1IH7A 1WAFA 5HBMA 4GVEA 4DTRA 4PWDA 4WE1A 4FJHA 4Q5VA 3FFIA 3KKRA 4CZLA 4MLHA 4CBXA 1JLCA 4JRPA 4M42A 1RT3A 3ATUA 2GEMA 3E9PA 1RTJA 3KK3A 3MAQA 3V9UA 3K9KA 1LWEA 2UYTA 4NO7A 4DLEA 1EWRA 4CFCA 3G6EN 3NDKA 2RKIA 4L8RB 2O8BB 2G8FA 4HCCA 4B9SA 3WXJA 4FWPA 5C12A 3ZETB 3AVHA 1F21A 4YOTA 2ZJPL 3SUNA 4MO4A 2F7TA 5EY4A 3BF1A 1FK9A 3AVJA 3OYLA 3QEPA 1WBBA 4KHQA 3THYA 2Y1JA 4BDYA 4N76A 3J8AA 1RT7A 2WBNA 4A2BA 1NOZA 2HSTA 4PKGA 4ILJA 2QM1A 3O9UA 5AQNA 4R5PA 3QESA 4C8OA 1OH7A 3EE9A 4IJAA 2E6MA 4LF9K 1TUYA 1NMNA 3ZEUB 1C6VA 2KZZA 3DI6A 3O1WA 5AZIB 4DFPA 1ZYQA 1JKHA 1BL3A 1TYQB 2QWLA 4JHDA 1RDCA 5GADP 3O3HA 4FJGA 1NMDA 4AHTA 3CCLN 1SV5A 5M1OA 3QO9A 1TK0A 2B5JA 4DKWA 1U2VA 3RMAA 2JWLA 4LH5A 1U2VB 2DTUA 4B9TA 2YNIA 2QW9A 1Q82O 3NBPA 4OKEA 4NCGA 3HP6A 4LF7K 4RW4A 4DQ8A 2YHAA 5KQ8A 4KTQA 1KAYA 1RT5A 3CJCA 4CESA 3P4IA 4KH5A 3VQBA 4J2EA 2X6NA 5BPMA 4CHQA 3O3FA 2ZQBA 4FJNA 4EIAA 1CXQA 4CJQA 4DQQA 3K5LA 4JI7K 4DTOA 5J2QA 4DU1A 2A6AA 3NGZA 2IGIA 4IFEA 3BZKA 2O4IA 3WNHA 1ASVA 2BE2A 2VG5A 1JLFA 4A5AA 4Z4CA 4GKKK 3OYAA 3DRRA 4C1NK 4B08A 2OPSA 3IRXA 4B1XB 5HRNA 4CHNA 2ZJQL 2E2OA 3O8MA 3NH2A 3QB0A 3DLKA 4KREA 4B8AB 3CJ1A 1T3VA 1BI4B 1X9WA 4DTXA 3D2EB 1ASUA 3DXMB 3ZETA 3HM8A 2OTLN 1JJ2M 2YI1A 3RVCA 1KXPA 4B3RK 1ESVA 4CIEA 4CIGA 2WTUA 1BCMA 5BRFA 4XH5A 1KCFA 3BGRA 3AVLA 3SUQA 2NRZA 4PUOA 3OYHA 1NBWA 4F4KA 2HHXA 4BDPA 1I3AA 3VQ9A 3SUPA 2YHWA 2UXBK 4E0DA 3DLEA 4DQPA 1HQEA 3OBYA 3QMLA 2P9IB 2O8EB 3HO1A 5AFUH 3H1VX 3U4LA 2GELA 4ID5A 1R59O 4X65K 1RTDA 1S9EA 4CJ7A 2ZE2A 1NGIA 1GLJO 5AZIA 3B6PA 5SWMA 1NGGA 4DS4A 1VQ9N 2Y1IA 3B6OA 3MECA 3BF3A 4H0TB 3U8XA 4E7IA 3CXCM 1T44A 4HTLA 1QE1A 2CH5A 3KVGA 4FWQA 4DSEA 3H3NO 2ITMA 4NB4A 3O3GA 3HPHA 1XMQK 2BH1A 4IO9L 2VWJA 2B6AA 2E2PA 3SQ2A 4BE0A 4B3SK 5KGXA 4A62A 3K9JA 5EVZA 5KTQA 4FO0A 3CYMA 2P9KB 2GUPA 5C2FA 4RG8A 1YIJN 1JLQA 1KVBA 3VETA 3THWA 1S9GA 5AQTA 3VN5A 3LPUA 1NKBA 1MWKA 5CYQA 3QBWA 1RTIA 2E8AA 2YNGA 2Q2RA 4DSJA 1BOTO 3LP2A 5IWAK 4FJIA 5BN8A 4DWIA 5CHIA 3WXLA 1T6DA 4JYAK 2YJEA 1RFQA 1TK5A 4OLAA 3S3NA 2P51A 1J6ZA 4NCBA 4OPJA 1TK8A 1P8ZA 3UIQA 2J4RA 4CGIA 3RRGA 4C8MA 4UQGA 3V9SA 5EU7A 5JLHA 1NGAA 3VMFB 1X3NA 2DFEA 3LDSA 1V4SA 4A2AA 2AP1A 5HRSA 4JD2A 5KGWA 4CGFA 1YITN 3AV9A 3VQEA 3M8PA 3T7ZA 2FF3B 1HJOA 2XY7A 1ZBHA 3N4PA 3NF7A 1LV5A 1Y97A 4LSLA 1GLCG 3DXKA 3L3UA 4CVNE 4YOWA 1U6ZA 1SAZA 3J7AP 4OGCA 3CFRA 1DT9A 1O13A 4XH1A 5BN9A 2BANA 3VQPA 3V9XA 1BQMA 2O8DA 1IO2A 3F9KA 3WEEB 3KD5E 2O8DB 2NRTA 3FZFA 2HNZA 2A1RA 3MCAB 1NK0A 3THVA 1RT6A 3LDPA 1VSKA 3CI5A 1N8RO 2FF6A 2FBYA 3HXMA 1SUQA 5GAEP 1MA9B 3A5MC 3CM6A 5AQHA 3RSEB 1U48A 1NK8A 3MWTA 1VQ7N 2Q3SA 1FKPA 2WFBA 3U6FA 4DFJA 5KPTA 2FBVA 3KLIA 4JKEA 1N33K 1OVQA 4K42A 1CXUA 4NLCA 5CZ1A 1GLLO 2P1JA 1XHZA 2GX9A 3CC7N 4JKCA 3RMCA 3L2UA 4B9QA 2YX6A 3OJUA 3CJAA 3CC2N 3WUHA 2V51B 4F3TA 4JKFA 4LF4K 3EN9A 3NVMA 3JS6A 4DTSA 5AQPA 4E1MA 3IG1A 1S1TA 3KJVA 3P1GA 3L6QA 1LWCA 3K2PA 4H0YB 3HVTA 2E6LA 2IIRA 4FWRA 4CHOA 2W6KA 3KKSA 3QICA 4JN4A 3QEIA 3PY8A 1YUWA 1L3VA 2Q36A 3KLEA 3JXUA 2DFHA 3LM9A 1YT3A 4O44A 4BWJA 4QAGA 3HSCA 3AA4A 1J9AA 3CCMN 4B9UA 1WSIA 3LP3A 1X9JA 1GLEG 3TI0A 4KI4A 2RPIA 4BC5A 1WNSA 1EP4A 1XQSC 4IO8A 4DSIA 3E1YA 4JS5A 5AQJA 3EYZA 3NGYA 1WLJA 4J8FA 4H03B 2IDOA 4JS4A 4JK7A 4B1YB 1T8EA 4K41A 2X6SA 5AQRA 4OKKA 4CJKA 3AVKA 2HHTA 3M1FA 3HRGA 4DV6K 4DHYA 3ZSWA 4BACA 4O0JA 1N5YA 2A40A 3AVMA 5DM7L 4LFCK 4IBNA 3ZLJA 4BR9A 1IV0A 4ISFA 3NVKA 4FVMA 5AZJA 2IAJA 1QSSA 3AO4A 4YFUA 4LF8K 4OLBA 1DGKN 4CJSA 5KRSA 4YHHK 4FWSA 2VYPA 4JD2B 1QZ5A 1IBLK 4FJ9A 2VGNA 4BRIA 3PSIA 4BVPA 4M45A 2Q0UA 1GOBA 3MN6A 1W7AA 4BR2A 1R0AA 4HCBA 2ZWHA 2RE2A 2UUAK 5BRDA 3WQTA 4LC9B 3V9WA 3VTHA 2O8CB 2G8IA 3A5LC 1OKJA 4IFYA 1VQPN 4M3YA 1C1CA 2QWMA 4BRPA 3VOVA 3WNEA 5E41A 1BUPA 4PY5A 2OTJN 4KV8A 1TV6A 2D0BA 1U4BA 1S22A 2FSJA 3FZKA 1S1WA 1W0HA 4KH4A 3OJSA 3G25A 1ZBLA 1VQ6N 4CF2A 3E01A 5E84A 3CF5L 4XEIA 2I7PA 1MU2A 3QEVA 4FJXA 1HKCA 3AO5A 4JKBA 1K9MO 1HUXA 3T19A 4BRFA 4JKDA 3VQ7A 4GMJB 1VQMN 4CEOA 4OJRA 1SL0A 4FK2A 4H5TA 3ZSRA 4WQ5A 4CBUA 5HOOA 1LCUA 4O55A 3OS2A 3N4QA 2P9NB 3CHWA 3MEGA 1DKGD 3VQ5A 4HUEA 1Y64A 3AVNA 4TSXA 3C95A 4NXMK 5LL6Z 2OCEA 3K5NA 3I56N 3OYNA 3T1YK 1M90O 4FZZA 2D5RA 2D0CA 4MFBA 3H1QA 1T03A 4YDUC 1VSFA 4H0PA 4PKHA 4M63C 1VAZA 2E88A 1T7PA 3TU5A 2VG7A 4PQUA 3MCPA 3VESA 1VSHA 1JLEA 3S3OA 3MX2A 4H4MA 2D0OA 3ATVA 4EHTA 2P9PB 2OPQA 3CMAN 3FR0A 3KK1A 3NF6A 3FZLA 2OPPA 1ZBFA 3IUCA 5M1FA 1RCHA 2QEXN 4BRDA 3L2WA 4RW6A 4DQIA 1QQOA 5FPEA 3VQAA 2E5LK 3K57A 2RN2A 3LDQA 4JV5K 3NH0A 3VPZA 1GLBG 3IAYA 4BWMA 4B1ZA 1YVUA 5GINA 5ELZA 2Q31A 3CMEN 3C94A 2R7YA 4GNIA 3KLFA 1IJJA 4LD0A 1GLAG 1REVA 4FLUA 5FPMA 4N47A 1IG8A 3BP8A 4DTPA 3TAPA 1SKWA 2O8CA 3SQ0A 1YI2N 4IG3A 5FPNA 3P83D 2HMIA 4PL8A 3DXMA 3DLRA 2HNDA 3V81A 4CJ3A 2Z1IA 3L3VA 5MLCQ 4I2PA 2KKZA 4CJLA 1VSDA 4KAZA 4QS9A 1LOTB 5BR9A 4FK4A 4KHUA 3RR7A 2HHUA 3ASMA 4WQ5C 3GDQA 5EXWA 4FJJA 4G9ZA 3C6TA 2QK9A 5C0YA 3ZSVA 4DU4A 2HW3A 3DOKA 2IVNA 5FDLA 1DLOA 2GBZA 2NNWA 4CK2A 3I55N 4FW2A 4OPHA 3VF2A 1QSYA 4YY3K 4R79A 4FPBA 1XMOK 3OYIA 4BQLA 1RBSA 2W41A 3KHYA 1VSJA 4O8KA 2NUBA 2P9UA 4BRGA 5BREA 3LZIA 3DYAA 3EY1A 2O8FA 3C6UA 4CERA 4J2BA 1NJZA 4CHZA 4DFKA 4Z4IA 5GIPA 4ILGB 1KQSM 2QKBA 2OA8A 4K8XA 3VEYA 3HZ6A 3TANA 1NGFA 4FZYA 3J80O 4DV3K 1T05A 2HHVA 3VEVA 4ID1A 2YHBA 4AILC 2ASOA 1QVGM 5CR4A 2P9PA 5ADXA 1HKBA 5E26A 3K0SA 2YCHA 4BG9A 1WSHA 4FLYA 2XRIA 3O08A 2QWNA 5ADXH 4LSNA 1HLUA 2Z1JA 2ZJRL 4CJEA 3THWB 3CCSN 4M7YA 4LY7A 3S9HA 3M8RA 4JNEA 3WQUA 1Z26A 3OYMA 4IOCL 4DUZK 1HNZK 4IOXA 3U9ZA 4E7KA 3L0QA 4RWTA 1YTAA 1HNWK 3LM2A 5F1XA 5F2RA 5AQOA 4F8RA 4YOVA 2QXLA 3O5BA 1ATRA 4DU3A 1H1VA 1KVAA 3P5JA 1BI4A 1X9MA 4IJNA 2CH6A 3DRSA 4BRMA 4LFBK 3BEXA 2HHWA 2A3ZA 4W5QA 1E4GT 4X62K 1JLAA 4H4OA 3VF6A 4KKOA 5AQZA 5C24A 3WNGA 1D5AA 1VQKN 4DV0K 3O9RA 1XUPO 5HRRA 4MLEA 3HT3A 1JCEA 5AQKA 4CZJA 4JEPA 5K14A 3VEWA 4F9OA 3BY5A 4FJ8A 4I9QA 4M41A 4CW7B 3DLLL 4CZIA 4DTNA 3DOLA 5H1SQ 4WFAL 1VQNN 1HRHA 5DMRA 4O4GA 3AA3A 3T1HK 3HL8A 4DV2K 2KFNA 2OYQA 3ITHA 2QWRA 2D0AA 3ID6A 1D9FA 4FLXA 1HQUA 3TAFA 1RTHA 3DLGA 4YDUA 4CHYA 4W5TA 2UXDK 5SZTA 2NLXA 5KPRA 3J7YP 5LJWA 5AQMA 3UB5A 2VWBA 1BIZA 1U49A 3LDNA 5FROA 4CCHA 1DTTA 3D2FA 4J2DA 3THXA 4CGDA 3B8AX 3F2KA 5HLFA 4E19A 1WB9A 3GOIA 4FJ7A 3LPTA 1C0MA 1K8KA 2HBMA 2KQ2A 2P9LA 4FWMA 4IEEA 3I8BA 3ZEUA 1KAXA 3M5RA 4Y1CA 1WSGA 3GG4A 3CM5A 3HBTA 1G15A 2F8SA 5HROA 1CZAN 3A5OC 3EZWA 2FBXA 5M1KA 3CCEN 4M7XA 1XI1A 5M1QA 4CK3A 5JS1A 2NRHA 2HBJA 4DUYK 4FK0A 2A42A 4JI1K 4C8LA 1SZ2A 3VQQA 2AJQA 4JI8K 1NKEA 2F9TA 3EL2A 1QHAA 2QTDA 1HJRA 1QS4A 2GV9A 3QDKA 3SNNA 4GV6A 4AM7A 4DTUA 4KBOA 4BGBA 4E1NA 3M6GA 4JK9A 3FZHA 1TKDA 3WNFA 3CPWM 3W0LA 2FSKA 4DLGA 2ASMA 4GKJK 3CETA 3VEOA 2IVPA 4B1VA 3TAEA 4KFBA 2PBDA 4DR2K 4KHNA 4E89A 3AVGA 3SUOA 4YORA 4CFAA 2QA4N 1WBDA 1IG9A 2WONA 1NGBA 1EETA 1RT2A 5KI6A 4CJTA 3EKSA 3AVAA 1TGOA 3I0SA 4MDBA 1A5XA 3BUZB 3RRHA 1A5WA 4ISEA 3RMBA 2PYLA 4CJFA 2OZSA 4CEEA 1OH6A 2GWJA 1WSEA 4H5VA 4JKHA 3ZT0A 1ILYA 3AO3A 2BDPA 1NWKA 1VSIA 1LW0A 5CE3A 2YNFA 4F3OA 1RDUA 4FWOA 3K5OA 2HBKA 1O1WA 3L2QA 4KHYA 2YKMA 1NK9A 5EX5A 1VQON 1L5UA 4HTUA 4FSVA 4EFHA 4CZFA 2O8EA 3NHGA 3D0PA 2BUPA 4WQ4C 4KRFA 1ASWA 4YOYA 3QLHA 5JICA 2FBTA 4H5RA 5AQFA 1ATNA 4B9MA 2HF4A 4Z4GA 4J2AA 1TYQA 4JHDB 1Z05A 1Q8IA 4CF8A 3SQ1A 3UKRB 4I7FA 1BIUA 1JXEA 1K8KB 4M3TA 3S3MA 4EP5A 4FPAA 3TSPA 5AJ3K 1JXBA 2E2NA 3F5TA 3PIPL 3MXIA 1X1PA 2F9WA 2DPNA 4BDZA 2HOEA 4MDAA 3CJ7A 3G71N 4QS7A 4BG8A 2RHKA 3Q7BA 4E1JA 4DB3A 4FM2A 3OVNA 3OYEA 3KWGA 4IWVA 1C0TA 1BA1A 3LWLA 2XHBA 1S3XA 1BISA 3ZX0A 3QEWA 3PO4A 3NGIA 1RILA 5C25A 4WYBA 1NJIO
chains in the Genus database with same CATH topology
4BDYA 4HUEA 3AVNA 4N76A 4N41A 4TSXA 3C95A 2DY4A 1RT7A 1GOCA 4B3OA 2I5JA 1NOZA 5HRPA 3O4NA 2GUIA 3SV4A 2WOMA 1CZ9A 4R5PA 3K5NA 1CLQA 3QESA 3OYNA 4C8OA 4OKJA 2LSNA 3VA3A 4FZZA 2D5RA 3TARA 4GW6A 2E6MA 2D0CA 3HP9A 4MFBA 1T03A 4BE2A 1NJXA 1VSFA 1NOYA 3PX6A 2HB5A 1C6VA 3HK2A 1T7PA 2KZZA 3PV8A 3DI6A 5J2PA 3ALYA 4DFPA 1ZYQA 2VG7A 2QXFA 1JKHA 1BL3A 4PQUA 1VSHA 3KK2A 1JLEA 1RDCA 1RT1A 1WSFA 3ZT1A 3O3HA 4H4MA 4AHTA 3S3OA 1N6QA 4FJGA 3SYZA 2OPQA 3PX4A 1SV5A 2HVIA 3KK1A 3ZSYA 2XY8A 3NF6A 2OPPA 3QO9A 4RW7A 1TK0A 1ZBFA 2B5JA 4F2RA 3RMAA 4LH5A 1RCHA 4EZ9A 2DTUA 3SI6A 2G8KA 4KPYA 4B9TA 1BGXT 2YNIA 3NBPA 3OYFA 3L2WA 1S1VA 4OKEA 4RW6A 4DQIA 4NCGA 3VQAA 3HP6A 3K57A 4RW4A 2RN2A 2YHAA 4KTQA 3NH0A 3I0RA 3NFAA 3ZSOA 3IAYA 4BWMA 1YVUA 3K59A 1RT5A 2JLEA 2P5GA 3M8QA 4CESA 4E3SA 1GOAA 2PYJA 4DQSA 4FXDA 1S6QA 3C94A 2R7YA 3VQBA 4J2EA 2X6NA 4W5NA 1J53A 4CHQA 3O3FA 2ZQBA 3KTQA 1CZBA 4IFVA 4FJNA 4CEAA 1CXQA 4CJQA 3KLFA 3K5LA 4DQQA 4CEQA 4DTOA 1KFDA 3K58A 4LD0A 5J2QA 4DU1A 4DQRA 4H8KA 3NGZA 1REVA 2IGIA 2FC0A 4FLUA 1TL3A 1SL2A 4FJKA 2O4IA 5D3GA 4N47A 4HHTA 2VG6A 4RW9A 4CJPA 4DTPA 4CEZA 1RDBA 3TAPA 4N56A 1SKWA 3WNHA 1ASVA 1UWBA 2BE2A 2VG5A 1JLFA 4IG3A 4Z4CA 3P83D 3SQ0A 2HMIA 3OYAA 4KHQA 3DLRA 2HNDA 3DRRA 1VSEA 3LANA 4AHSA 3IS9A 1A5VA 4B08A 1SKRA 2OPSA 2F96A 3IRXA 3NF8A 4CJ3A 3V81A 2ZD1A 5HRNA 4CHNA 4JRQA 2Z1IA 3L3VA 4DS5A 3NH2A 4KREA 3DLKA 1DTQA 1ITGA 4B8AB 4I2PA 1XHXA 3VQDA 1BI4B 3T3FA 4CJLA 1VK0A 3L2VA 4DTXA 2OPRA 4KTWA 1X9WA 1VSDA 4KAZA 4CFBA 3LZJA 4FK4A 2ATQA 1ASUA 3A2FA 4KHUA 3HYFA 3RR7A 4AHCA 2HHUA 3ASMA 3AVBA 2YNHA 3V9ZA 1TL1A 4FJJA 1YTUA 3C6TA 2QK9A 3ZSVA 3LWMA 4DU4A 5J2MA 1XC9A 2HW3A 3DOKA 3KD1E 5FDLA 4CIEA 4Z4HA 1DLOA 4CIGA 2GBZA 4CJUA 4CK2A 1BCMA 4FW2A 1QSYA 1BQNA 5I42A 3CQ8A 1UAXA 4KB0A 3QNNA 1KCFA 3BGRA 3AVLA 3QIPA 3OYIA 3SUQA 4M3ZA 1RBSA 4FLTA 4ICLA 1VSJA 3HPGA 4PUOA 2NUBA 3V6DA 4YNQA 3OYHA 3LZIA 4DTJA 4F4KA 3DYAA 3EY1A 2HHXA 3SQ4A 3C6UA 4CERA 4BDPA 4J2BA 1LAVA 1I3AA 4IDKA 4CGJA 4QCLA 1ZBUA 3VQ9A 4MQ3A 3V1RA 1TKTA 4CEDA 3SUPA 1NJZA 3AVCA 3DLEA 1WN7A 2G8UA 1HQEA 4CHZA 3PO5A 4DQPA 1C1BA 4NYFA 2DFFA 4HUFA 5DK5A 3QNOA 3HO1A 4DFKA 4Z4IA 4DSKA 1RDDA 2QKBA 4ELVA 4CHPA 4ID5A 4EZ6A 3OYCA 1C1AA 1VRTA 1RTDA 4AHVA 2OA8A 4ELTA 4DSLA 4I2QA 1S9EA 3CFPA 4K8XA 3TANA 1W9HA 4FZYA 2ZE2A 1RBUA 2HHSA 3B6PA 1T05A 3RMDA 2HHVA 5SWMA 3DLBA 3ZSQA 4E7LA 4ID1A 3ZCMA 2YHBA 4DS4A 3B6OA 4AILC 1HMVA 3QIOA 2Y1IA 2G8VA 3V1OA 1KLMA 3SCXA 1JL1A 3MECA 4IKFA 3VQ8A 4KTZA 1UA1A 1LAWA 1WSHA 4FLZA 4FLYA 2XRIA 3ISNC 1EKEA 4E7IA 4FZXC 4CEBA 1HYSA 2G8HA 4LSNA 3RTVA 1QE1A 2Z1JA 4CJEA 4DSEA 4M3UA 5I3UA 1FXXA 1QHTA 4LY7A 3O3GA 3LAKA 3HPHA 3S9HA 4C8NA 4HUGA 1RNHA 2VWJA 2B6AA 3M8RA 3SQ2A 1LWFA 4BE0A 1Z26A 5KGXA 3I8DA 1S1UA 3OYMA 1Z25A 2XY5A 4E7KA 5KTQA 3CYMA 3SV3A 1YTAA 3QINA 1RT4A 3F73A 1JLBA 3KIOA 2HNYA 4RG8A 1U47A 1JLQA 3ZSXA 3ZT2A 1KVBA 2RF2A 4OGEA 2PZSA 3OYBA 4F8RA 4FJLA 3SPYA 1S9GA 1BCOA 2KW4A 3VN5A 3LPUA 1NKBA 1XWLA 2G8WA 4ZTFA 5CYQA 4DU3A 1RTIA 1KVAA 1NK4A 3P5JA 1J5OA 1BI4A 2YNGA 4CF9A 3MXMA 1X9MA 3DLHA 4DSJA 4NCAA 3DRSA 3LP2A 5CZ2A 1L3UA 3HJFA 1B9FA 4M3XA 1VSLA 2HHWA 4FJIA 3HPOA 2IS3A 4W5QA 2EHGA 5JS2A 4CIFA 2XY6A 4DWIA 3OYJA 1JLAA 4H4OA 1HYVA 4CJWA 3M8SA 4KKOA 4ELUA 5J1EA 2W42A 3NF9A 5C24A 1D5AA 3DRPA 3WNGA 3BDPA 4FLWA 4FM0A 4GVMA 5HRRA 1VRUA 4CF0A 3OYGA 1TK5A 4OLAA 3HT3A 2JGUA 3S3NA 2P51A 1NK5A 5K14A 4NCBA 3NAEA 4OPJA 1TK8A 4FJ8A 3MEDA 4I9QA 3UIQA 1K6YA 4M41A 2ETJA 1NK6A 3OY9A 4DTNA 3DOLA 4CK1A 1RBVA 1NJYA 1HRHA 5DMRA 4O4GA 4Z4FA 1TAQA 3AA3A 4OPKA 3HL8A 4CGIA 4M3WA 3RRGA 2KFNA 2OYQA 1TKXA 4C8MA 3ITHA 4UQGA 2D0AA 1D9FA 3V9SA 5EU7A 4FLXA 4OVLA 1HQUA 3TAFA 1RTHA 2DFEA 3DLGA 3ZT4A 1Q9YA 4FJ5A 3LDSA 4FCYA 4CJVA 4CHYA 4W5TA 3TABA 5HRSA 1JL2A 5SZTA 3OYDA 2XO7A 5KGWA 3SPZA 2P5OA 2BGGA 4CGFA 4FYDA 1NK7A 3D45A 3MXJA 3AV9A 3VQEA 1KTQA 4DFMA 4DF8A 2YKNA 3M8PA 1BIZA 3LAMA 3ZSZA 1FKOA 1U49A 1D9DA 5FROA 3TR8A 4CCHA 1DTTA 2XY7A 1ZBHA 1IKXA 4J2DA 3NF7A 4CGDA 1B92A 1LV5A 1Y97A 4LSLA 4E19A 5HLFA 3L3UA 1J54A 4F2SA 4E7JA 3OS0A 1UA0A 4OGCA 3CFRA 3LPTA 1C0MA 4FJ7A 2KQ2A 3PUFA 1RDAA 2IC3A 2BANA 3NE6A 3OYKA 3LP1A 3VQPA 3V9XA 1SL1A 2VWKA 3AA5X 4W5OA 1BQMA 5FRNA 1IO2A 3F9KA 3PX0A 3KD5E 2EX3A 2HNZA 4Y1CA 1WSGA 2A1RA 1NJWA 4DMNA 5KRTA 3HM9A 1EXQA 3CM5A 1NK0A 1G15A 3THVA 1RT6A 1Q9XA 5J2NA 4K8ZA 2F8SA 5HROA 1HPZA 2KFZA 1VSKA 2FBXA 4I9LA 4FM1A 3NCIA 4Z0UA 2FBYA 3LP0A 3HXMA 1SUQA 1XI1A 1KLNA 3DM2A 4CK3A 5C42A 3NH1A 3QETA 1QQCA 1JLGA 3CM6A 1U48A 4NYNA 1NK8A 5JS1A 2Q3SA 1FKPA 4E7HA 3V4IA 4QOZB 4CFDA 3U6FA 4DFJA 1S1XA 2FBVA 3KLIA 3QEXA 1HYZA 5CYMA 4FK0A 4Z4EA 1UOCA 4C8LA 3VQQA 2AJQA 1CXUA 2A1SA 5CZ1A 1NKEA 1WSJA 1HNIA 3KLHA 5HP1A 2P1JA 1XHZA 1IKVA 3VQCA 2KZMA 3JSMA 4AHUA 1HJRA 1QS4A 2GV9A 1KRPA 3T1AA 3L2UA 3RMCA 3SNNA 1S5JA 1QTMA 3OJUA 3L8BA 3VQ6A 3L2RA 3MEEA 3LALA 3AO2A 4CECA 4DTUA 1HNVA 1KSPA 1D8YA 4F3TA 4E1NA 3RR8A 4EP4A 1U04A 4DTSA 1TKDA 2IOCA 4E1MA 3IG1A 1S1TA 4KO0A 3WNFA 3P1GA 3KJVA 1LWCA 2Z1GA 4W5RA 4DLGA 4Q0BA 4FLVA 1IKYA 1B9DA 3K2PA 2ITGA 2HVHA 4BE1A 1I39A 3HVTA 3KLGA 3TAEA 2E6LA 3HVRA 4CJ4A 4DTMA 4KFBA 1KFSA 3QERA 4CHOA 3KKSA 2PY5A 4CE9A 4O0IA 4G1QA 3QEIA 4KHNA 4E89A 3AVGA 1WAJA 3SUOA 3SJJA 4CFAA 1L3VA 1IG9A 3PY8A 3AVIA 2WONA 3K5MA 1SKSA 3KLEA 4FJMA 4CGGA 2DFHA 1EETA 4KHSA 2O4GA 4CJRA 1YT3A 1S6PA 4O44A 1RT2A 4BWJA 2OZMA 4AHRA 4QAGA 5KI6A 3AA4A 4CJTA 1J9AA 3ZT3A 4B9UA 1WSIA 3LP3A 3TI0A 3AVAA 1TGOA 3I0SA 5CY4A 4KI4A 1A5XA 2RPIA 3JYTA 1WNSA 3RRHA 1A5WA 3AO1A 1EP4A 4RW8A 3RMBA 4FW1A 4CJFA 2PYLA 2OZSA 1NKCA 4DSIA 2X74A 4CEEA 2X78A 4E0DA 3U3GA 4JS5A 2QKKA 3EYZA 3NGYA 1WLJA 1WSEA 3ZT0A 2IDOA 1VSMA 3AO3A 3O4QA 2BDPA 4KI6A 4JS4A 1C0UA 1VSIA 2Z1HA 1T8EA 1LW0A 4F3OA 2YNFA 2X6SA 4OKKA 4CJKA 3AVKA 2HHTA 3CG7A 1L3SA 3TAMA 3G10A 4CEFA 3K5OA 3OS1A 3ZSWA 4BACA 1BHLA 1O1WA 4O0JA 4CJ5A 3L2QA 3VA0A 1RBTA 4N5SA 1N5YA 3AVMA 1RBRA 4M3RA 4CGHA 2YKMA 4KHYA 4IBNA 3EZ5A 1NK9A 2KTQA 4ZTJA 4FVMA 4B8CA 4LH4A 1EX4A 2IAJA 4HVJA 1L5UA 1QSSA 4HTUA 3AO4A 4YFUA 1QSLA 4C8KA 4B9LA 4OLBA 4CJSA 5KRSA 1TAUA 3NHGA 3D0PA 3DMJA 4AH9A 4KRFA 1ASWA 3TWHA 4FJ9A 3QLHA 4B9VA 3HSTB 2FBTA 2YV0X 3SZ2A 3TAGA 4M45A 4DF4A 1GOBA 4B9MA 2F8TA 4DG1A 1IH7A 3VQ4A 1R0AA 4HCBA 4Z4GA 4J2AA 1WAFA 1IKWA 1TKZA 4Y1DA 5HBMA 4DSFA 4ZHRA 1Q8IA 4CF8A 4DTRA 4PWDA 4WE1A 3SQ1A 4FJHA 4Q5VA 3H08A 3FFIA 3KKRA 1BIUA 1JXEA 4I7FA 4PA1A 3V1QA 3S3MA 4M3TA 2E4LA 3V9WA 1L3TA 4EP5A 2G8IA 2HHQA 4IFYA 1JLCA 3AA2A 1KVCA 4M3YA 4JRPA 4M42A 1C1CA 1RT3A 3CFOA 3KK3A 1JXBA 1RTJA 1X9SA 3MAQA 3MXIA 3WNEA 5E41A 3V9UA 1LWEA 1X1PA 4PY5A 4DLEA 4BDZA 4KV8A 1TV6A 3U3YA 2D0BA 1U4BA 4CFCA 1S1WA 1W0HA 3OJSA 1ZBLA 3NDKA 4KHWA 1ZBIA 2RKIA 3E01A 4CF2A 4L8RB 5T7BA 2G8FA 1MU2A 5FRMA 1U45A 4HCCA 3QEVA 4XIUA 4B9SA 3RWUA 1LW2A 4FJXA 3AO5A 3AVHA 4FM2A 3OVNA 3T19A 1TVRA 1F21A 4CF1A 3OYEA 3VQ7A 1C0TA 4GMJB 3SUNA 4CEOA 3G0ZA 4OJRA 3LWLA 2XHBA 1SL0A 4FK2A 3AVFA 1BISA 4O5BA 3ZSRA 4IG0A 3QEWA 4JLHA 3PO4A 1FK9A 4O55A 3OS2A 3NGIA 1RILA 5C25A 3AVJA 3MEGA 3OYLA 3QEPA 3TAQA 4B9NA 3ULDA 3VQ5A 4KB1A 2Y1JA 2B4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDY A;  4HUE A;  3AVN A;  4N76 A;  4N41 A;  4TSX A;  3C95 A;  2DY4 A;  1RT7 A;  1GOC A;  4B3O A;  2I5J A;  1NOZ A;  5HRP A;  3O4N A;  2GUI A;  3SV4 A;  2WOM A;  1CZ9 A;  4R5P A;  3K5N A;  1CLQ A;  3QES A;  3OYN A;  4C8O A;  4OKJ A;  2LSN A;  3VA3 A;  4FZZ A;  2D5R A;  3TAR A;  4GW6 A;  2E6M A;  2D0C A;  3HP9 A;  4MFB A;  1T03 A;  4BE2 A;  1NJX A;  1VSF A;  1NOY A;  3PX6 A;  2HB5 A;  1C6V A;  3HK2 A;  1T7P A;  2KZZ A;  3PV8 A;  3DI6 A;  5J2P A;  3ALY A;  4DFP A;  1ZYQ A;  2VG7 A;  2QXF A;  1JKH A;  1BL3 A;  4PQU A;  1VSH A;  3KK2 A;  1JLE A;  1RDC A;  1RT1 A;  1WSF A;  3ZT1 A;  3O3H A;  4H4M A;  4AHT A;  3S3O A;  1N6Q A;  4FJG A;  3SYZ A;  2OPQ A;  3PX4 A;  1SV5 A;  2HVI A;  3KK1 A;  3ZSY A;  2XY8 A;  3NF6 A;  2OPP A;  3QO9 A;  4RW7 A;  1TK0 A;  1ZBF A;  2B5J A;  4F2R A;  3RMA A;  4LH5 A;  1RCH A;  4EZ9 A;  2DTU A;  3SI6 A;  2G8K A;  4KPY A;  4B9T A;  1BGX T;  2YNI A;  3NBP A;  3OYF A;  3L2W A;  1S1V A;  4OKE A;  4RW6 A;  4DQI A;  4NCG A;  3VQA A;  3HP6 A;  3K57 A;  4RW4 A;  2RN2 A;  2YHA A;  4KTQ A;  3NH0 A;  3I0R A;  3NFA A;  3ZSO A;  3IAY A;  4BWM A;  1YVU A;  3K59 A;  1RT5 A;  2JLE A;  2P5G A;  3M8Q A;  4CES A;  4E3S A;  1GOA A;  2PYJ A;  4DQS A;  4FXD A;  1S6Q A;  3C94 A;  2R7Y A;  3VQB A;  4J2E A;  2X6N A;  4W5N A;  1J53 A;  4CHQ A;  3O3F A;  2ZQB A;  3KTQ A;  1CZB A;  4IFV A;  4FJN A;  4CEA A;  1CXQ A;  4CJQ A;  3KLF A;  3K5L A;  4DQQ A;  4CEQ A;  4DTO A;  1KFD A;  3K58 A;  4LD0 A;  5J2Q A;  4DU1 A;  4DQR A;  4H8K A;  3NGZ A;  1REV A;  2IGI A;  2FC0 A;  4FLU A;  1TL3 A;  1SL2 A;  4FJK A;  2O4I A;  5D3G A;  4N47 A;  4HHT A;  2VG6 A;  4RW9 A;  4CJP A;  4DTP A;  4CEZ A;  1RDB A;  3TAP A;  4N56 A;  1SKW A;  3WNH A;  1ASV A;  1UWB A;  2BE2 A;  2VG5 A;  1JLF A;  4IG3 A;  4Z4C A;  3P83 D;  3SQ0 A;  2HMI A;  3OYA A;  4KHQ A;  3DLR A;  2HND A;  3DRR A;  1VSE A;  3LAN A;  4AHS A;  3IS9 A;  1A5V A;  4B08 A;  1SKR A;  2OPS A;  2F96 A;  3IRX A;  3NF8 A;  4CJ3 A;  3V81 A;  2ZD1 A;  5HRN A;  4CHN A;  4JRQ A;  2Z1I A;  3L3V A;  4DS5 A;  3NH2 A;  4KRE A;  3DLK A;  1DTQ A;  1ITG A;  4B8A B;  4I2P A;  1XHX A;  3VQD A;  1BI4 B;  3T3F A;  4CJL A;  1VK0 A;  3L2V A;  4DTX A;  2OPR A;  4KTW A;  1X9W A;  1VSD A;  4KAZ A;  4CFB A;  3LZJ A;  4FK4 A;  2ATQ A;  1ASU A;  3A2F A;  4KHU A;  3HYF A;  3RR7 A;  4AHC A;  2HHU A;  3ASM A;  3AVB A;  2YNH A;  3V9Z A;  1TL1 A;  4FJJ A;  1YTU A;  3C6T A;  2QK9 A;  3ZSV A;  3LWM A;  4DU4 A;  5J2M A;  1XC9 A;  2HW3 A;  3DOK A;  3KD1 E;  5FDL A;  4CIE A;  4Z4H A;  1DLO A;  4CIG A;  2GBZ A;  4CJU A;  4CK2 A;  1BCM A;  4FW2 A;  1QSY A;  1BQN A;  5I42 A;  3CQ8 A;  1UAX A;  4KB0 A;  3QNN A;  1KCF A;  3BGR A;  3AVL A;  3QIP A;  3OYI A;  3SUQ A;  4M3Z A;  1RBS A;  4FLT A;  4ICL A;  1VSJ A;  3HPG A;  4PUO A;  2NUB A;  3V6D A;  4YNQ A;  3OYH A;  3LZI A;  4DTJ A;  4F4K A;  3DYA A;  3EY1 A;  2HHX A;  3SQ4 A;  3C6U A;  4CER A;  4BDP A;  4J2B A;  1LAV A;  1I3A A;  4IDK A;  4CGJ A;  4QCL A;  1ZBU A;  3VQ9 A;  4MQ3 A;  3V1R A;  1TKT A;  4CED A;  3SUP A;  1NJZ A;  3AVC A;  3DLE A;  1WN7 A;  2G8U A;  1HQE A;  4CHZ A;  3PO5 A;  4DQP A;  1C1B A;  4NYF A;  2DFF A;  4HUF A;  5DK5 A;  3QNO A;  3HO1 A;  4DFK A;  4Z4I A;  4DSK A;  1RDD A;  2QKB A;  4ELV A;  4CHP A;  4ID5 A;  4EZ6 A;  3OYC A;  1C1A A;  1VRT A;  1RTD A;  4AHV A;  2OA8 A;  4ELT A;  4DSL A;  4I2Q A;  1S9E A;  3CFP A;  4K8X A;  3TAN A;  1W9H A;  4FZY A;  2ZE2 A;  1RBU A;  2HHS A;  3B6P A;  1T05 A;  3RMD A;  2HHV A;  5SWM A;  3DLB A;  3ZSQ A;  4E7L A;  4ID1 A;  3ZCM A;  2YHB A;  4DS4 A;  3B6O A;  4AIL C;  1HMV A;  3QIO A;  2Y1I A;  2G8V A;  3V1O A;  1KLM A;  3SCX A;  1JL1 A;  3MEC A;  4IKF A;  3VQ8 A;  4KTZ A;  1UA1 A;  1LAW A;  1WSH A;  4FLZ A;  4FLY A;  2XRI A;  3ISN C;  1EKE A;  4E7I A;  4FZX C;  4CEB A;  1HYS A;  2G8H A;  4LSN A;  3RTV A;  1QE1 A;  2Z1J A;  4CJE A;  4DSE A;  4M3U A;  5I3U A;  1FXX A;  1QHT A;  4LY7 A;  3O3G A;  3LAK A;  3HPH A;  3S9H A;  4C8N A;  4HUG A;  1RNH A;  2VWJ A;  2B6A A;  3M8R A;  3SQ2 A;  1LWF A;  4BE0 A;  1Z26 A;  5KGX A;  3I8D A;  1S1U A;  3OYM A;  1Z25 A;  2XY5 A;  4E7K A;  5KTQ A;  3CYM A;  3SV3 A;  1YTA A;  3QIN A;  1RT4 A;  3F73 A;  1JLB A;  3KIO A;  2HNY A;  4RG8 A;  1U47 A;  1JLQ A;  3ZSX A;  3ZT2 A;  1KVB A;  2RF2 A;  4OGE A;  2PZS A;  3OYB A;  4F8R A;  4FJL A;  3SPY A;  1S9G A;  1BCO A;  2KW4 A;  3VN5 A;  3LPU A;  1NKB A;  1XWL A;  2G8W A;  4ZTF A;  5CYQ A;  4DU3 A;  1RTI A;  1KVA A;  1NK4 A;  3P5J A;  1J5O A;  1BI4 A;  2YNG A;  4CF9 A;  3MXM A;  1X9M A;  3DLH A;  4DSJ A;  4NCA A;  3DRS A;  3LP2 A;  5CZ2 A;  1L3U A;  3HJF A;  1B9F A;  4M3X A;  1VSL A;  2HHW A;  4FJI A;  3HPO A;  2IS3 A;  4W5Q A;  2EHG A;  5JS2 A;  4CIF A;  2XY6 A;  4DWI A;  3OYJ A;  1JLA A;  4H4O A;  1HYV A;  4CJW A;  3M8S A;  4KKO A;  4ELU A;  5J1E A;  2W42 A;  3NF9 A;  5C24 A;  1D5A A;  3DRP A;  3WNG A;  3BDP A;  4FLW A;  4FM0 A;  4GVM A;  5HRR A;  1VRU A;  4CF0 A;  3OYG A;  1TK5 A;  4OLA A;  3HT3 A;  2JGU A;  3S3N A;  2P51 A;  1NK5 A;  5K14 A;  4NCB A;  3NAE A;  4OPJ A;  1TK8 A;  4FJ8 A;  3MED A;  4I9Q A;  3UIQ A;  1K6Y A;  4M41 A;  2ETJ A;  1NK6 A;  3OY9 A;  4DTN A;  3DOL A;  4CK1 A;  1RBV A;  1NJY A;  1HRH A;  5DMR A;  4O4G A;  4Z4F A;  1TAQ A;  3AA3 A;  4OPK A;  3HL8 A;  4CGI A;  4M3W A;  3RRG A;  2KFN A;  2OYQ A;  1TKX A;  4C8M A;  3ITH A;  4UQG A;  2D0A A;  1D9F A;  3V9S A;  5EU7 A;  4FLX A;  4OVL A;  1HQU A;  3TAF A;  1RTH A;  2DFE A;  3DLG A;  3ZT4 A;  1Q9Y A;  4FJ5 A;  3LDS A;  4FCY A;  4CJV A;  4CHY A;  4W5T A;  3TAB A;  5HRS A;  1JL2 A;  5SZT A;  3OYD A;  2XO7 A;  5KGW A;  3SPZ A;  2P5O A;  2BGG A;  4CGF A;  4FYD A;  1NK7 A;  3D45 A;  3MXJ A;  3AV9 A;  3VQE A;  1KTQ A;  4DFM A;  4DF8 A;  2YKN A;  3M8P A;  1BIZ A;  3LAM A;  3ZSZ A;  1FKO A;  1U49 A;  1D9D A;  5FRO A;  3TR8 A;  4CCH A;  1DTT A;  2XY7 A;  1ZBH A;  1IKX A;  4J2D A;  3NF7 A;  4CGD A;  1B92 A;  1LV5 A;  1Y97 A;  4LSL A;  4E19 A;  5HLF A;  3L3U A;  1J54 A;  4F2S A;  4E7J A;  3OS0 A;  1UA0 A;  4OGC A;  3CFR A;  3LPT A;  1C0M A;  4FJ7 A;  2KQ2 A;  3PUF A;  1RDA A;  2IC3 A;  2BAN A;  3NE6 A;  3OYK A;  3LP1 A;  3VQP A;  3V9X A;  1SL1 A;  2VWK A;  3AA5 X;  4W5O A;  1BQM A;  5FRN A;  1IO2 A;  3F9K A;  3PX0 A;  3KD5 E;  2EX3 A;  2HNZ A;  4Y1C A;  1WSG A;  2A1R A;  1NJW A;  4DMN A;  5KRT A;  3HM9 A;  1EXQ A;  3CM5 A;  1NK0 A;  1G15 A;  3THV A;  1RT6 A;  1Q9X A;  5J2N A;  4K8Z A;  2F8S A;  5HRO A;  1HPZ A;  2KFZ A;  1VSK A;  2FBX A;  4I9L A;  4FM1 A;  3NCI A;  4Z0U A;  2FBY A;  3LP0 A;  3HXM A;  1SUQ A;  1XI1 A;  1KLN A;  3DM2 A;  4CK3 A;  5C42 A;  3NH1 A;  3QET A;  1QQC A;  1JLG A;  3CM6 A;  1U48 A;  4NYN A;  1NK8 A;  5JS1 A;  2Q3S A;  1FKP A;  4E7H A;  3V4I A;  4QOZ B;  4CFD A;  3U6F A;  4DFJ A;  1S1X A;  2FBV A;  3KLI A;  3QEX A;  1HYZ A;  5CYM A;  4FK0 A;  4Z4E A;  1UOC A;  4C8L A;  3VQQ A;  2AJQ A;  1CXU A;  2A1S A;  5CZ1 A;  1NKE A;  1WSJ A;  1HNI A;  3KLH A;  5HP1 A;  2P1J A;  1XHZ A;  1IKV A;  3VQC A;  2KZM A;  3JSM A;  4AHU A;  1HJR A;  1QS4 A;  2GV9 A;  1KRP A;  3T1A A;  3L2U A;  3RMC A;  3SNN A;  1S5J A;  1QTM A;  3OJU A;  3L8B A;  3VQ6 A;  3L2R A;  3MEE A;  3LAL A;  3AO2 A;  4CEC A;  4DTU A;  1HNV A;  1KSP A;  1D8Y A;  4F3T A;  4E1N A;  3RR8 A;  4EP4 A;  1U04 A;  4DTS A;  1TKD A;  2IOC A;  4E1M A;  3IG1 A;  1S1T A;  4KO0 A;  3WNF A;  3P1G A;  3KJV A;  1LWC A;  2Z1G A;  4W5R A;  4DLG A;  4Q0B A;  4FLV A;  1IKY A;  1B9D A;  3K2P A;  2ITG A;  2HVH A;  4BE1 A;  1I39 A;  3HVT A;  3KLG A;  3TAE A;  2E6L A;  3HVR A;  4CJ4 A;  4DTM A;  4KFB A;  1KFS A;  3QER A;  4CHO A;  3KKS A;  2PY5 A;  4CE9 A;  4O0I A;  4G1Q A;  3QEI A;  4KHN A;  4E89 A;  3AVG A;  1WAJ A;  3SUO A;  3SJJ A;  4CFA A;  1L3V A;  1IG9 A;  3PY8 A;  3AVI A;  2WON A;  3K5M A;  1SKS A;  3KLE A;  4FJM A;  4CGG A;  2DFH A;  1EET A;  4KHS A;  2O4G A;  4CJR A;  1YT3 A;  1S6P A;  4O44 A;  1RT2 A;  4BWJ A;  2OZM A;  4AHR A;  4QAG A;  5KI6 A;  3AA4 A;  4CJT A;  1J9A A;  3ZT3 A;  4B9U A;  1WSI A;  3LP3 A;  3TI0 A;  3AVA A;  1TGO A;  3I0S A;  5CY4 A;  4KI4 A;  1A5X A;  2RPI A;  3JYT A;  1WNS A;  3RRH A;  1A5W A;  3AO1 A;  1EP4 A;  4RW8 A;  3RMB A;  4FW1 A;  4CJF A;  2PYL A;  2OZS A;  1NKC A;  4DSI A;  2X74 A;  4CEE A;  2X78 A;  4E0D A;  3U3G A;  4JS5 A;  2QKK A;  3EYZ A;  3NGY A;  1WLJ A;  1WSE A;  3ZT0 A;  2IDO A;  1VSM A;  3AO3 A;  3O4Q A;  2BDP A;  4KI6 A;  4JS4 A;  1C0U A;  1VSI A;  2Z1H A;  1T8E A;  1LW0 A;  4F3O A;  2YNF A;  2X6S A;  4OKK A;  4CJK A;  3AVK A;  2HHT A;  3CG7 A;  1L3S A;  3TAM A;  3G10 A;  4CEF A;  3K5O A;  3OS1 A;  3ZSW A;  4BAC A;  1BHL A;  1O1W A;  4O0J A;  4CJ5 A;  3L2Q A;  3VA0 A;  1RBT A;  4N5S A;  1N5Y A;  3AVM A;  1RBR A;  4M3R A;  4CGH A;  2YKM A;  4KHY A;  4IBN A;  3EZ5 A;  1NK9 A;  2KTQ A;  4ZTJ A;  4FVM A;  4B8C A;  4LH4 A;  1EX4 A;  2IAJ A;  4HVJ A;  1L5U A;  1QSS A;  4HTU A;  3AO4 A;  4YFU A;  1QSL A;  4C8K A;  4B9L A;  4OLB A;  4CJS A;  5KRS A;  1TAU A;  3NHG A;  3D0P A;  3DMJ A;  4AH9 A;  4KRF A;  1ASW A;  3TWH A;  4FJ9 A;  3QLH A;  4B9V A;  3HST B;  2FBT A;  2YV0 X;  3SZ2 A;  3TAG A;  4M45 A;  4DF4 A;  1GOB A;  4B9M A;  2F8T A;  4DG1 A;  1IH7 A;  3VQ4 A;  1R0A A;  4HCB A;  4Z4G A;  4J2A A;  1WAF A;  1IKW A;  1TKZ A;  4Y1D A;  5HBM A;  4DSF A;  4ZHR A;  1Q8I A;  4CF8 A;  4DTR A;  4PWD A;  4WE1 A;  3SQ1 A;  4FJH A;  4Q5V A;  3H08 A;  3FFI A;  3KKR A;  1BIU A;  1JXE A;  4I7F A;  4PA1 A;  3V1Q A;  3S3M A;  4M3T A;  2E4L A;  3V9W A;  1L3T A;  4EP5 A;  2G8I A;  2HHQ A;  4IFY A;  1JLC A;  3AA2 A;  1KVC A;  4M3Y A;  4JRP A;  4M42 A;  1C1C A;  1RT3 A;  3CFO A;  3KK3 A;  1JXB A;  1RTJ A;  1X9S A;  3MAQ A;  3MXI A;  3WNE A;  5E41 A;  3V9U A;  1LWE A;  1X1P A;  4PY5 A;  4DLE A;  4BDZ A;  4KV8 A;  1TV6 A;  3U3Y A;  2D0B A;  1U4B A;  4CFC A;  1S1W A;  1W0H A;  3OJS A;  1ZBL A;  3NDK A;  4KHW A;  1ZBI A;  2RKI A;  3E01 A;  4CF2 A;  4L8R B;  5T7B A;  2G8F A;  1MU2 A;  5FRM A;  1U45 A;  4HCC A;  3QEV A;  4XIU A;  4B9S A;  3RWU A;  1LW2 A;  4FJX A;  3AO5 A;  3AVH A;  4FM2 A;  3OVN A;  3T19 A;  1TVR A;  1F21 A;  4CF1 A;  3OYE A;  3VQ7 A;  1C0T A;  4GMJ B;  3SUN A;  4CEO A;  3G0Z A;  4OJR A;  3LWL A;  2XHB A;  1SL0 A;  4FK2 A;  3AVF A;  1BIS A;  4O5B A;  3ZSR A;  4IG0 A;  3QEW A;  4JLH A;  3PO4 A;  1FK9 A;  4O55 A;  3OS2 A;  3NGI A;  1RIL A;  5C25 A;  3AVJ A;  3MEG A;  3OYL A;  3QEP A;  3TAQ A;  4B9N A;  3ULD A;  3VQ5 A;  4KB1 A;  2Y1J A;  2B4J A; 
#chains in the Genus database with same CATH topology
 4JKG B;  4BY9 C;  1GOC A;  3IMX A;  5HRP A;  3O4N A;  2GUI A;  3SV4 A;  2P9S B;  1VQ8 N;  1IBM K;  3HP9 A;  5KQD A;  1NOY A;  5JVH L;  2Q0R A;  4PKI A;  4FWK A;  5J2P A;  3ALY A;  3C6H A;  2QXF A;  3EE8 A;  4BQZ A;  3DXK B;  3VTI A;  3ZT1 A;  1N6Q A;  3SYZ A;  1J5E K;  5B8H A;  3U9D A;  3ZSY A;  2XY8 A;  3FGU A;  4DR6 K;  4F2R A;  1EO1 A;  4ILH A;  4Z94 A;  1YJN N;  4EZ9 A;  1KD1 O;  3SI6 A;  2G8K A;  1BGX T;  3OYF A;  2E1Y A;  4KH6 A;  4I6M A;  3IKM A;  3NFA A;  5BPL A;  2YHY A;  2JLE A;  1GOA A;  3MN5 A;  3CCR N;  3VGK A;  1CZB A;  4IFV A;  4CEQ A;  1KFD A;  5JVG L;  4DQR A;  4H8K A;  3P39 A;  1SL2 A;  2FC0 A;  1HR0 K;  1TL3 A;  2A5X A;  2VG6 A;  3BZC A;  1RDB A;  1UWB A;  4BC3 A;  2FSN A;  4ISG A;  4AHS A;  3IS9 A;  1A5V A;  4CZH A;  3NF8 A;  3VF4 A;  4JRQ A;  3PIO L;  1XHX A;  3VQD A;  3T3F A;  1NNE A;  3L2V A;  2QWP A;  4DV5 K;  1EQY A;  3A2F A;  2F4V K;  4JI3 K;  4AHC A;  3AVB A;  2YNH A;  4AQY K;  1TL1 A;  4GV9 A;  4CZK A;  1YTU A;  5J2M A;  1QQN A;  5AQS A;  3D6R A;  3VEZ A;  4BGA A;  1QZ6 A;  2UUC K;  1NGJ A;  1Q18 A;  2ZGY A;  3TPQ A;  2NRV A;  5LMN K;  5I42 A;  2D4W A;  4KB0 A;  3QNN A;  3O1B A;  4AM6 A;  2KLA A;  4ICL A;  5AQL A;  2W40 A;  4EHU A;  5JLF A;  1LAV A;  4CGJ A;  4IDK A;  1XNQ K;  3TTD A;  3ENO A;  1TKT A;  4CED A;  1FW6 A;  4HUF A;  2OAN A;  5BPN A;  1RDD A;  4JI0 K;  3TTF A;  1VQ4 N;  2PFU A;  4CHP A;  3OYC A;  4JKA A;  1VRT A;  4AHV A;  4ELT A;  4DSL A;  4I2Q A;  4DR7 K;  4JKG A;  1W9H A;  2EWS A;  1N32 K;  2HHS A;  3AGK A;  3DLB A;  3ZSQ A;  4E7L A;  1EWQ A;  4CZG A;  2IVO A;  3QIO A;  4IEI A;  3V1O A;  1KLM A;  4IKF A;  1UA1 A;  1LAW A;  3WT0 A;  1BWF O;  3ISN C;  1EKE A;  4FZX C;  4C23 A;  4CEB A;  1HYS A;  2G8H A;  5AR0 A;  3O9Q A;  4CD1 A;  1FXX A;  3C7N A;  3ULE A;  1K8A O;  1P90 A;  3E66 A;  4C8N A;  4HUG A;  1LWF A;  3I8D A;  2XY5 A;  3LDO A;  1BA0 A;  2O8B A;  2V7Z A;  4GV3 A;  3QIN A;  1RT4 A;  3F73 A;  1JLB A;  3SAH A;  2RF2 A;  2I7N A;  5I9E B;  3SPY A;  2KW4 A;  4A5B A;  4CI6 A;  4H0O A;  1NK4 A;  1J5O A;  1N36 K;  3MXM A;  3DLH A;  3HJF A;  1B9F A;  4M3X A;  1OH5 A;  1TUU A;  3HPO A;  4K0K K;  2EHG A;  5JS2 A;  4CIF A;  3OYJ A;  3F9M A;  3THY B;  3M8S A;  4ELU A;  5J1E A;  2HBL A;  1XNR K;  4FVU A;  3BDP A;  4FLW A;  1QVF M;  1VRU A;  4DR3 K;  4DR4 K;  3VEN A;  2JGU A;  1NK5 A;  3UKU A;  3FZM A;  4WFB L;  3NAE A;  2ETJ A;  3OY9 A;  2V52 B;  4CK1 A;  1MWM A;  4Z4F A;  1NLV A;  1Q86 O;  1TAQ A;  4Y0W A;  1S72 N;  2O8F B;  4OVL A;  3THX B;  4WCE L;  3TSQ A;  3ZT4 A;  3H6E A;  4DR1 K;  2WUS A;  3TAB A;  2XO7 A;  4FYD A;  3SPZ A;  2P5O A;  1GLF O;  1HNX K;  3D45 A;  4U67 L;  3MXJ A;  4KHP K;  5TKY A;  1KTQ A;  2W6L A;  4DFM A;  2YKN A;  4DF8 A;  3LAM A;  3ZSZ A;  1FKO A;  4MO5 A;  1IKX A;  1HPM A;  1B92 A;  1HX1 A;  2QI2 A;  1UA0 A;  4BRA A;  2Q1N A;  5F0X A;  4H0X B;  1C0F A;  1RDA A;  4V19 S;  1QQM A;  3T69 A;  1SL1 A;  2VWK A;  3R1X A;  1NGH A;  5FRN A;  3W3D A;  3SBG A;  2EX3 A;  4HWI A;  5AQU A;  3DWL A;  1NJW A;  4DMN A;  5KRT A;  1EXQ A;  4H0V B;  1Q9X A;  5BRH A;  4KB1 A;  3FFK B;  1M1K O;  4LF6 K;  3CPE A;  3LP0 A;  3NH1 A;  4NYN A;  3H46 O;  4E7H A;  4QOZ B;  4DCH A;  3C65 A;  1S1X A;  3SAG A;  1HYZ A;  5CYM A;  5AZJ B;  3J7Z O;  4Z4E A;  4BRC A;  1YJ9 N;  4JI5 K;  2A1S A;  1WSJ A;  1HNI A;  3KLH A;  5HP1 A;  1IKV A;  3VQC A;  2KZM A;  2KHO A;  3JSM A;  5AQG A;  3T1A A;  4LFA K;  3WXI A;  2UUB K;  1S5J A;  3L8B A;  4OX9 K;  3VQ6 A;  3L2R A;  3LAL A;  3AO2 A;  3VGM A;  1ZBS A;  3RR8 A;  5AQQ A;  4EP4 A;  1U04 A;  3ULE B;  3NMU A;  3IFR A;  3Q7C A;  1OH8 A;  2D1K A;  2Z1G A;  4W5R A;  4FLV A;  1B9D A;  4RTF D;  2ITG A;  2HVH A;  1NM1 A;  1I39 A;  3D2E A;  3KLG A;  1YAG A;  3KZB A;  4CJ4 A;  3CCU N;  4DTM A;  3QER A;  4BRH A;  4O0I A;  4DV1 K;  2HHH K;  1WAJ A;  3CCJ N;  2VGM A;  3AAQ A;  3SAF A;  1NGC A;  1YHQ N;  4KHS A;  2O4G A;  1JCF A;  1S6P A;  5AQX A;  3R8E A;  2OZM A;  4FWL A;  3ZT3 A;  3UKU B;  2YHX A;  3JYT A;  2HMP A;  4UY8 O;  4RW8 A;  4B3M K;  1V4T A;  3U3G A;  4GY2 B;  5BR8 K;  3EO3 A;  1C0U A;  2Z1H A;  3A5N C;  3P31 A;  2YJF A;  4DR5 K;  2P9N A;  3CG7 A;  1L3S A;  3G10 A;  2P9L B;  4CZE A;  3HTV A;  3VA0 A;  4M3U A;  4CGH A;  4DV4 K;  3SBT A;  2KTQ A;  4ZTJ A;  1EX4 A;  4B9L A;  4C8K A;  4K43 A;  4H5W A;  2BTF A;  5EOY A;  3DMJ A;  2V7Y A;  3TWH A;  1WUA A;  4B9V A;  4BR7 A;  2YV0 X;  3SZ2 A;  1ZC6 A;  3IDH A;  2Q97 A;  3E9L A;  5AFU A;  3DJC A;  3VQ4 A;  1SS6 A;  4A57 A;  1IKW A;  1TKZ A;  4Y1D A;  3MWP A;  4DSF A;  4ZHR A;  4JAX A;  3V1Q A;  3H08 A;  4PA1 A;  4L3Q A;  3ZX3 A;  3A8Y A;  1IBK K;  2E4L A;  1L3T A;  2HHQ A;  2P9K A;  3AA2 A;  1KVC A;  4BRQ A;  3CFO A;  3G4S N;  1X9S A;  3CJ9 A;  3U3Y A;  2QWO A;  3O9S A;  4KHW A;  4BC2 A;  1ZBI A;  4O5F A;  5T7B A;  1BDG A;  5FRM A;  1U45 A;  4WQ4 A;  4XIU A;  3RWU A;  1LW2 A;  3AAP A;  1TVR A;  3GL1 A;  5TKW A;  4CF1 A;  3G0Z A;  3AVF A;  4O5B A;  4IG0 A;  4JLH A;  2P9S A;  4O8U A;  4B3T K;  3TAQ A;  4B9N A;  5HL7 L;  1BG3 A;  3ULD A;  3LDL A;  1N34 K;  2B4J A;  4N41 A;  2UU9 K;  2DY4 A;  5M1N A;  4B3O A;  2I5J A;  1CLQ A;  2WOM A;  1CZ9 A;  1ATS A;  5AQV A;  4OKJ A;  2LSN A;  3VA3 A;  4CBW A;  3VGL A;  3TAR A;  4GW6 A;  3SK3 A;  3C0B A;  3JAM O;  4BE2 A;  1NJX A;  4XH4 A;  2UXC K;  3PX6 A;  2HB5 A;  3L4I A;  3D2F B;  2E2Q A;  3HK2 A;  4JK8 A;  3PV8 A;  3KK2 A;  1WSF A;  1RT1 A;  1C0G A;  3SJH A;  3PX4 A;  3GBT A;  1VHX A;  2HVI A;  2CGL A;  4RW7 A;  2NZT A;  3EEQ A;  5AQW A;  4JI4 K;  2ZGZ A;  4FWN A;  3ENB A;  4KPY A;  1Z6R A;  2CGJ A;  1S1V A;  2E20 A;  3I0R A;  3ZSO A;  3E9O A;  2NRR A;  3K59 A;  4K25 A;  3UKR A;  2P5G A;  3M8Q A;  4E3S A;  2PYJ A;  4FXD A;  4DQS A;  1Q7Y O;  1S6Q A;  3QBX A;  3SMP A;  4W5N A;  4X64 K;  1J53 A;  4BRO A;  2ZF5 O;  3FE1 A;  3KTQ A;  4CEA A;  3K58 A;  4FJK A;  5LY3 A;  1K73 O;  5D3G A;  4HHT A;  4RW9 A;  3H45 C;  4CJP A;  4CEZ A;  3OA9 A;  4N56 A;  4A61 A;  3CD6 N;  5C10 A;  1DEJ A;  1VSE A;  3LAN A;  5AQY A;  1D8Y A;  1SKR A;  2F96 A;  2ZD1 A;  4DS5 A;  4NXN K;  4JI2 K;  1DTQ A;  1ITG A;  2FLO A;  4AF1 A;  2D0P A;  1D4X A;  1VK0 A;  3ZX2 A;  2OPR A;  4KTW A;  3H3O B;  4CFB A;  5GIO A;  3LZJ A;  1NGE A;  2ATQ A;  2PAV A;  3HYF A;  5GAH P;  4IZ9 A;  4H5N A;  3V9Z A;  2VCP A;  4BC4 A;  1T6C A;  1RDW X;  3OHR A;  3LWM A;  3MK6 A;  1XC9 A;  3KD1 E;  3LL3 A;  4Z4H A;  4U7B A;  4CJU A;  2VQE K;  1BQN A;  3CQ8 A;  1UAX A;  4BRL A;  4LF5 K;  3QIP A;  3ZYY X;  4M3Z A;  4FLT A;  3HPG A;  3DAW A;  3V6D A;  4YNQ A;  1NGD A;  4DTJ A;  1WOQ A;  1NG9 A;  5JMV A;  3SQ4 A;  4BVO A;  4QCL A;  3R6M A;  1ZBU A;  3PSF A;  4MQ3 A;  3V1R A;  2G8U A;  1E3M A;  1W97 L;  3AVC A;  3PO5 A;  1WN7 A;  1C1B A;  4NYF A;  2DFF A;  3AY9 A;  5DK5 A;  4X66 K;  3QNO A;  4DSK A;  1E4F T;  5LMU K;  4ELV A;  4EZ6 A;  1C1A A;  3QFP A;  3S41 A;  3CFP A;  2NRW A;  1RBU A;  2A41 A;  5DM6 L;  3RMD A;  2G8V A;  3ZCM A;  1HMV A;  3SCX A;  1JL1 A;  2P9I A;  3VQ8 A;  2E1Z A;  4KTZ A;  4FLZ A;  1GLD G;  2ZM6 K;  3I33 A;  4CD3 A;  3C6A A;  4WF9 L;  3RTV A;  1VQ5 N;  5I3U A;  1QHT A;  3J81 O;  3LAK A;  1RNH A;  2HF3 A;  1S1U A;  1Z25 A;  4IOA L;  4BRN A;  3SV3 A;  2FXU A;  4PL7 A;  1U47 A;  2CGK A;  3KIO A;  2HNY A;  3RSE A;  3ZSX A;  3ZT2 A;  4OGE A;  4EAH D;  3AGR A;  3OYB A;  1BO5 O;  2PZS A;  3EKU A;  4FJL A;  1BCO A;  1SQK A;  1XWL A;  2G8W A;  4ZTF A;  1OVY A;  3HOS A;  1FJG K;  4FL9 A;  4CF9 A;  5IT9 O;  4NCA A;  5CZ2 A;  1L3U A;  1VSL A;  3WXM B;  2IS3 A;  2XY6 A;  4QS8 A;  3CQY A;  1HYV A;  3A0I X;  4CJW A;  2WC9 A;  4A59 A;  2W42 A;  3NF9 A;  3DRP A;  4FM0 A;  3OW2 M;  4B1U B;  3CC4 N;  4GVM A;  4IDH A;  4CF0 A;  3OYG A;  4WFN L;  1VQL N;  2NRX A;  3MED A;  3PLA A;  1K6Y A;  4C1N I;  1NK6 A;  1YVN A;  4OPA A;  1RBV A;  1NJY A;  3MX5 A;  5LJV A;  4OPK A;  3VER A;  4M3W A;  5M1P A;  1TKX A;  1Q9Y A;  4FJ5 A;  1I94 K;  4FCY A;  4CJV A;  1NU0 A;  3CJB A;  1JL2 A;  3ID8 A;  3OYD A;  2BGG A;  1NK7 A;  3OBW A;  1D9D A;  3MDQ A;  3TR8 A;  3M3Z A;  4DV7 K;  2QWQ A;  3AAR A;  1G99 A;  3WXK A;  4PHT X;  1J54 A;  4F2S A;  4E7J A;  3OS0 A;  3O6W A;  3PUF A;  3O9T A;  2IC3 A;  3NE6 A;  4CZM A;  3CER A;  3LP1 A;  3OYK A;  2ASP A;  4W5O A;  3AA5 X;  1KAZ A;  3PX0 A;  3D7E O;  4I6M B;  3UE5 A;  5C2D A;  3HM9 A;  5KPZ A;  4K8Z A;  5J2N A;  2KFZ A;  1HPZ A;  5AQI A;  3KWI A;  3CIP A;  4I9L A;  4FM1 A;  3NCI A;  3FLC O;  4Z0U A;  1KLN A;  5FPD A;  3DM2 A;  3QET A;  5C42 A;  1QQC A;  1JLG A;  3VEX A;  4OO1 J;  3WEE A;  1JCG A;  3V4I A;  4CFD A;  3QEX A;  1UOC A;  1ZXO A;  4JI6 K;  3GE1 A;  4AHU A;  1KRP A;  1QTM A;  3MEE A;  4B1W B;  4CEC A;  1HNV A;  1KSP A;  3KK7 A;  4BR5 A;  3O4W A;  4FOE A;  2IOC A;  2JWK A;  4KO0 A;  1YF5 L;  1KC8 O;  1HKG A;  4Q0B A;  1IKY A;  3SMS A;  1XC3 A;  4BE1 A;  4BR0 A;  3SLC A;  3HVR A;  1KFS A;  2PY5 A;  3MMV A;  5FLX O;  4CE9 A;  4G1Q A;  1RGI A;  3SJJ A;  1X3M A;  2P9U B;  3AVI A;  3K5M A;  1SKS A;  4FJM A;  1MDU B;  4CGG A;  4CJR A;  3CQX A;  4AHR A;  3QFU A;  2GWK A;  5CY4 A;  3HOT A;  3AO1 A;  4FW1 A;  1NKC A;  2X74 A;  3CCQ N;  2X78 A;  3R3L A;  5A2Q O;  2QKK A;  3OTO K;  3L4Q A;  1Q81 O;  5GAG P;  1VSM A;  4IXC A;  3O4Q A;  4KI6 A;  3TTC A;  3CCV N;  3ENH A;  3TAM A;  1YXQ A;  4CEF A;  3HI0 A;  3O80 A;  3OS1 A;  1BU6 O;  1BHL A;  3MN9 A;  4CJ5 A;  1RBT A;  4N5S A;  2GTD A;  1RBR A;  4M3R A;  4YOX A;  4BRE A;  3EZ5 A;  2AA4 A;  1W2B M;  3R9P A;  3MN7 A;  4LH4 A;  4B8C A;  4HVJ A;  1YJW N;  1QSL A;  5C15 A;  4NLB A;  1TAU A;  4FOI A;  4YOU A;  4AH9 A;  3HST B;  4RCH A;  3TAG A;  2VQF K;  4DF4 A;  2H3G X;  4BR4 A;  4BRK A;  3C7N B;  3TSU A;  2F8T A;  3P38 A;  4DG1 A;  1IH7 A;  1WAF A;  5HBM A;  4GVE A;  4DTR A;  4PWD A;  4WE1 A;  4FJH A;  4Q5V A;  3FFI A;  3KKR A;  4CZL A;  4MLH A;  4CBX A;  1JLC A;  4JRP A;  4M42 A;  1RT3 A;  3ATU A;  2GEM A;  3E9P A;  1RTJ A;  3KK3 A;  3MAQ A;  3V9U A;  3K9K A;  1LWE A;  2UYT A;  4NO7 A;  4DLE A;  1EWR A;  4CFC A;  3G6E N;  3NDK A;  2RKI A;  4L8R B;  2O8B B;  2G8F A;  4HCC A;  4B9S A;  3WXJ A;  4FWP A;  5C12 A;  3ZET B;  3AVH A;  1F21 A;  4YOT A;  2ZJP L;  3SUN A;  4MO4 A;  2F7T A;  5EY4 A;  3BF1 A;  1FK9 A;  3AVJ A;  3OYL A;  3QEP A;  1WBB A;  4KHQ A;  3THY A;  2Y1J A;  4BDY A;  4N76 A;  3J8A A;  1RT7 A;  2WBN A;  4A2B A;  1NOZ A;  2HST A;  4PKG A;  4ILJ A;  2QM1 A;  3O9U A;  5AQN A;  4R5P A;  3QES A;  4C8O A;  1OH7 A;  3EE9 A;  4IJA A;  2E6M A;  4LF9 K;  1TUY A;  1NMN A;  3ZEU B;  1C6V A;  2KZZ A;  3DI6 A;  3O1W A;  5AZI B;  4DFP A;  1ZYQ A;  1JKH A;  1BL3 A;  1TYQ B;  2QWL A;  4JHD A;  1RDC A;  5GAD P;  3O3H A;  4FJG A;  1NMD A;  4AHT A;  3CCL N;  1SV5 A;  5M1O A;  3QO9 A;  1TK0 A;  2B5J A;  4DKW A;  1U2V A;  3RMA A;  2JWL A;  4LH5 A;  1U2V B;  2DTU A;  4B9T A;  2YNI A;  2QW9 A;  1Q82 O;  3NBP A;  4OKE A;  4NCG A;  3HP6 A;  4LF7 K;  4RW4 A;  4DQ8 A;  2YHA A;  5KQ8 A;  4KTQ A;  1KAY A;  1RT5 A;  3CJC A;  4CES A;  3P4I A;  4KH5 A;  3VQB A;  4J2E A;  2X6N A;  5BPM A;  4CHQ A;  3O3F A;  2ZQB A;  4FJN A;  4EIA A;  1CXQ A;  4CJQ A;  4DQQ A;  3K5L A;  4JI7 K;  4DTO A;  5J2Q A;  4DU1 A;  2A6A A;  3NGZ A;  2IGI A;  4IFE A;  3BZK A;  2O4I A;  3WNH A;  1ASV A;  2BE2 A;  2VG5 A;  1JLF A;  4A5A A;  4Z4C A;  4GKK K;  3OYA A;  3DRR A;  4C1N K;  4B08 A;  2OPS A;  3IRX A;  4B1X B;  5HRN A;  4CHN A;  2ZJQ L;  2E2O A;  3O8M A;  3NH2 A;  3QB0 A;  3DLK A;  4KRE A;  4B8A B;  3CJ1 A;  1T3V A;  1BI4 B;  1X9W A;  4DTX A;  3D2E B;  1ASU A;  3DXM B;  3ZET A;  3HM8 A;  2OTL N;  1JJ2 M;  2YI1 A;  3RVC A;  1KXP A;  4B3R K;  1ESV A;  4CIE A;  4CIG A;  2WTU A;  1BCM A;  5BRF A;  4XH5 A;  1KCF A;  3BGR A;  3AVL A;  3SUQ A;  2NRZ A;  4PUO A;  3OYH A;  1NBW A;  4F4K A;  2HHX A;  4BDP A;  1I3A A;  3VQ9 A;  3SUP A;  2YHW A;  2UXB K;  4E0D A;  3DLE A;  4DQP A;  1HQE A;  3OBY A;  3QML A;  2P9I B;  2O8E B;  3HO1 A;  5AFU H;  3H1V X;  3U4L A;  2GEL A;  4ID5 A;  1R59 O;  4X65 K;  1RTD A;  1S9E A;  4CJ7 A;  2ZE2 A;  1NGI A;  1GLJ O;  5AZI A;  3B6P A;  5SWM A;  1NGG A;  4DS4 A;  1VQ9 N;  2Y1I A;  3B6O A;  3MEC A;  3BF3 A;  4H0T B;  3U8X A;  4E7I A;  3CXC M;  1T44 A;  4HTL A;  1QE1 A;  2CH5 A;  3KVG A;  4FWQ A;  4DSE A;  3H3N O;  2ITM A;  4NB4 A;  3O3G A;  3HPH A;  1XMQ K;  2BH1 A;  4IO9 L;  2VWJ A;  2B6A A;  2E2P A;  3SQ2 A;  4BE0 A;  4B3S K;  5KGX A;  4A62 A;  3K9J A;  5EVZ A;  5KTQ A;  4FO0 A;  3CYM A;  2P9K B;  2GUP A;  5C2F A;  4RG8 A;  1YIJ N;  1JLQ A;  1KVB A;  3VET A;  3THW A;  1S9G A;  5AQT A;  3VN5 A;  3LPU A;  1NKB A;  1MWK A;  5CYQ A;  3QBW A;  1RTI A;  2E8A A;  2YNG A;  2Q2R A;  4DSJ A;  1BOT O;  3LP2 A;  5IWA K;  4FJI A;  5BN8 A;  4DWI A;  5CHI A;  3WXL A;  1T6D A;  4JYA K;  2YJE A;  1RFQ A;  1TK5 A;  4OLA A;  3S3N A;  2P51 A;  1J6Z A;  4NCB A;  4OPJ A;  1TK8 A;  1P8Z A;  3UIQ A;  2J4R A;  4CGI A;  3RRG A;  4C8M A;  4UQG A;  3V9S A;  5EU7 A;  5JLH A;  1NGA A;  3VMF B;  1X3N A;  2DFE A;  3LDS A;  1V4S A;  4A2A A;  2AP1 A;  5HRS A;  4JD2 A;  5KGW A;  4CGF A;  1YIT N;  3AV9 A;  3VQE A;  3M8P A;  3T7Z A;  2FF3 B;  1HJO A;  2XY7 A;  1ZBH A;  3N4P A;  3NF7 A;  1LV5 A;  1Y97 A;  4LSL A;  1GLC G;  3DXK A;  3L3U A;  4CVN E;  4YOW A;  1U6Z A;  1SAZ A;  3J7A P;  4OGC A;  3CFR A;  1DT9 A;  1O13 A;  4XH1 A;  5BN9 A;  2BAN A;  3VQP A;  3V9X A;  1BQM A;  2O8D A;  1IO2 A;  3F9K A;  3WEE B;  3KD5 E;  2O8D B;  2NRT A;  3FZF A;  2HNZ A;  2A1R A;  3MCA B;  1NK0 A;  3THV A;  1RT6 A;  3LDP A;  1VSK A;  3CI5 A;  1N8R O;  2FF6 A;  2FBY A;  3HXM A;  1SUQ A;  5GAE P;  1MA9 B;  3A5M C;  3CM6 A;  5AQH A;  3RSE B;  1U48 A;  1NK8 A;  3MWT A;  1VQ7 N;  2Q3S A;  1FKP A;  2WFB A;  3U6F A;  4DFJ A;  5KPT A;  2FBV A;  3KLI A;  4JKE A;  1N33 K;  1OVQ A;  4K42 A;  1CXU A;  4NLC A;  5CZ1 A;  1GLL O;  2P1J A;  1XHZ A;  2GX9 A;  3CC7 N;  4JKC A;  3RMC A;  3L2U A;  4B9Q A;  2YX6 A;  3OJU A;  3CJA A;  3CC2 N;  3WUH A;  2V51 B;  4F3T A;  4JKF A;  4LF4 K;  3EN9 A;  3NVM A;  3JS6 A;  4DTS A;  5AQP A;  4E1M A;  3IG1 A;  1S1T A;  3KJV A;  3P1G A;  3L6Q A;  1LWC A;  3K2P A;  4H0Y B;  3HVT A;  2E6L A;  2IIR A;  4FWR A;  4CHO A;  2W6K A;  3KKS A;  3QIC A;  4JN4 A;  3QEI A;  3PY8 A;  1YUW A;  1L3V A;  2Q36 A;  3KLE A;  3JXU A;  2DFH A;  3LM9 A;  1YT3 A;  4O44 A;  4BWJ A;  4QAG A;  3HSC A;  3AA4 A;  1J9A A;  3CCM N;  4B9U A;  1WSI A;  3LP3 A;  1X9J A;  1GLE G;  3TI0 A;  4KI4 A;  2RPI A;  4BC5 A;  1WNS A;  1EP4 A;  1XQS C;  4IO8 A;  4DSI A;  3E1Y A;  4JS5 A;  5AQJ A;  3EYZ A;  3NGY A;  1WLJ A;  4J8F A;  4H03 B;  2IDO A;  4JS4 A;  4JK7 A;  4B1Y B;  1T8E A;  4K41 A;  2X6S A;  5AQR A;  4OKK A;  4CJK A;  3AVK A;  2HHT A;  3M1F A;  3HRG A;  4DV6 K;  4DHY A;  3ZSW A;  4BAC A;  4O0J A;  1N5Y A;  2A40 A;  3AVM A;  5DM7 L;  4LFC K;  4IBN A;  3ZLJ A;  4BR9 A;  1IV0 A;  4ISF A;  3NVK A;  4FVM A;  5AZJ A;  2IAJ A;  1QSS A;  3AO4 A;  4YFU A;  4LF8 K;  4OLB A;  1DGK N;  4CJS A;  5KRS A;  4YHH K;  4FWS A;  2VYP A;  4JD2 B;  1QZ5 A;  1IBL K;  4FJ9 A;  2VGN A;  4BRI A;  3PSI A;  4BVP A;  4M45 A;  2Q0U A;  1GOB A;  3MN6 A;  1W7A A;  4BR2 A;  1R0A A;  4HCB A;  2ZWH A;  2RE2 A;  2UUA K;  5BRD A;  3WQT A;  4LC9 B;  3V9W A;  3VTH A;  2O8C B;  2G8I A;  3A5L C;  1OKJ A;  4IFY A;  1VQP N;  4M3Y A;  1C1C A;  2QWM A;  4BRP A;  3VOV A;  3WNE A;  5E41 A;  1BUP A;  4PY5 A;  2OTJ N;  4KV8 A;  1TV6 A;  2D0B A;  1U4B A;  1S22 A;  2FSJ A;  3FZK A;  1S1W A;  1W0H A;  4KH4 A;  3OJS A;  3G25 A;  1ZBL A;  1VQ6 N;  4CF2 A;  3E01 A;  5E84 A;  3CF5 L;  4XEI A;  2I7P A;  1MU2 A;  3QEV A;  4FJX A;  1HKC A;  3AO5 A;  4JKB A;  1K9M O;  1HUX A;  3T19 A;  4BRF A;  4JKD A;  3VQ7 A;  4GMJ B;  1VQM N;  4CEO A;  4OJR A;  1SL0 A;  4FK2 A;  4H5T A;  3ZSR A;  4WQ5 A;  4CBU A;  5HOO A;  1LCU A;  4O55 A;  3OS2 A;  3N4Q A;  2P9N B;  3CHW A;  3MEG A;  1DKG D;  3VQ5 A;  4HUE A;  1Y64 A;  3AVN A;  4TSX A;  3C95 A;  4NXM K;  5LL6 Z;  2OCE A;  3K5N A;  3I56 N;  3OYN A;  3T1Y K;  1M90 O;  4FZZ A;  2D5R A;  2D0C A;  4MFB A;  3H1Q A;  1T03 A;  4YDU C;  1VSF A;  4H0P A;  4PKH A;  4M63 C;  1VAZ A;  2E88 A;  1T7P A;  3TU5 A;  2VG7 A;  4PQU A;  3MCP A;  3VES A;  1VSH A;  1JLE A;  3S3O A;  3MX2 A;  4H4M A;  2D0O A;  3ATV A;  4EHT A;  2P9P B;  2OPQ A;  3CMA N;  3FR0 A;  3KK1 A;  3NF6 A;  3FZL A;  2OPP A;  1ZBF A;  3IUC A;  5M1F A;  1RCH A;  2QEX N;  4BRD A;  3L2W A;  4RW6 A;  4DQI A;  1QQO A;  5FPE A;  3VQA A;  2E5L K;  3K57 A;  2RN2 A;  3LDQ A;  4JV5 K;  3NH0 A;  3VPZ A;  1GLB G;  3IAY A;  4BWM A;  4B1Z A;  1YVU A;  5GIN A;  5ELZ A;  2Q31 A;  3CME N;  3C94 A;  2R7Y A;  4GNI A;  3KLF A;  1IJJ A;  4LD0 A;  1GLA G;  1REV A;  4FLU A;  5FPM A;  4N47 A;  1IG8 A;  3BP8 A;  4DTP A;  3TAP A;  1SKW A;  2O8C A;  3SQ0 A;  1YI2 N;  4IG3 A;  5FPN A;  3P83 D;  2HMI A;  4PL8 A;  3DXM A;  3DLR A;  2HND A;  3V81 A;  4CJ3 A;  2Z1I A;  3L3V A;  5MLC Q;  4I2P A;  2KKZ A;  4CJL A;  1VSD A;  4KAZ A;  4QS9 A;  1LOT B;  5BR9 A;  4FK4 A;  4KHU A;  3RR7 A;  2HHU A;  3ASM A;  4WQ5 C;  3GDQ A;  5EXW A;  4FJJ A;  4G9Z A;  3C6T A;  2QK9 A;  5C0Y A;  3ZSV A;  4DU4 A;  2HW3 A;  3DOK A;  2IVN A;  5FDL A;  1DLO A;  2GBZ A;  2NNW A;  4CK2 A;  3I55 N;  4FW2 A;  4OPH A;  3VF2 A;  1QSY A;  4YY3 K;  4R79 A;  4FPB A;  1XMO K;  3OYI A;  4BQL A;  1RBS A;  2W41 A;  3KHY A;  1VSJ A;  4O8K A;  2NUB A;  2P9U A;  4BRG A;  5BRE A;  3LZI A;  3DYA A;  3EY1 A;  2O8F A;  3C6U A;  4CER A;  4J2B A;  1NJZ A;  4CHZ A;  4DFK A;  4Z4I A;  5GIP A;  4ILG B;  1KQS M;  2QKB A;  2OA8 A;  4K8X A;  3VEY A;  3HZ6 A;  3TAN A;  1NGF A;  4FZY A;  3J80 O;  4DV3 K;  1T05 A;  2HHV A;  3VEV A;  4ID1 A;  2YHB A;  4AIL C;  2ASO A;  1QVG M;  5CR4 A;  2P9P A;  5ADX A;  1HKB A;  5E26 A;  3K0S A;  2YCH A;  4BG9 A;  1WSH A;  4FLY A;  2XRI A;  3O08 A;  2QWN A;  5ADX H;  4LSN A;  1HLU A;  2Z1J A;  2ZJR L;  4CJE A;  3THW B;  3CCS N;  4M7Y A;  4LY7 A;  3S9H A;  3M8R A;  4JNE A;  3WQU A;  1Z26 A;  3OYM A;  4IOC L;  4DUZ K;  1HNZ K;  4IOX A;  3U9Z A;  4E7K A;  3L0Q A;  4RWT A;  1YTA A;  1HNW K;  3LM2 A;  5F1X A;  5F2R A;  5AQO A;  4F8R A;  4YOV A;  2QXL A;  3O5B A;  1ATR A;  4DU3 A;  1H1V A;  1KVA A;  3P5J A;  1BI4 A;  1X9M A;  4IJN A;  2CH6 A;  3DRS A;  4BRM A;  4LFB K;  3BEX A;  2HHW A;  2A3Z A;  4W5Q A;  1E4G T;  4X62 K;  1JLA A;  4H4O A;  3VF6 A;  4KKO A;  5AQZ A;  5C24 A;  3WNG A;  1D5A A;  1VQK N;  4DV0 K;  3O9R A;  1XUP O;  5HRR A;  4MLE A;  3HT3 A;  1JCE A;  5AQK A;  4CZJ A;  4JEP A;  5K14 A;  3VEW A;  4F9O A;  3BY5 A;  4FJ8 A;  4I9Q A;  4M41 A;  4CW7 B;  3DLL L;  4CZI A;  4DTN A;  3DOL A;  5H1S Q;  4WFA L;  1VQN N;  1HRH A;  5DMR A;  4O4G A;  3AA3 A;  3T1H K;  3HL8 A;  4DV2 K;  2KFN A;  2OYQ A;  3ITH A;  2QWR A;  2D0A A;  3ID6 A;  1D9F A;  4FLX A;  1HQU A;  3TAF A;  1RTH A;  3DLG A;  4YDU A;  4CHY A;  4W5T A;  2UXD K;  5SZT A;  2NLX A;  5KPR A;  3J7Y P;  5LJW A;  5AQM A;  3UB5 A;  2VWB A;  1BIZ A;  1U49 A;  3LDN A;  5FRO A;  4CCH A;  1DTT A;  3D2F A;  4J2D A;  3THX A;  4CGD A;  3B8A X;  3F2K A;  5HLF A;  4E19 A;  1WB9 A;  3GOI A;  4FJ7 A;  3LPT A;  1C0M A;  1K8K A;  2HBM A;  2KQ2 A;  2P9L A;  4FWM A;  4IEE A;  3I8B A;  3ZEU A;  1KAX A;  3M5R A;  4Y1C A;  1WSG A;  3GG4 A;  3CM5 A;  3HBT A;  1G15 A;  2F8S A;  5HRO A;  1CZA N;  3A5O C;  3EZW A;  2FBX A;  5M1K A;  3CCE N;  4M7X A;  1XI1 A;  5M1Q A;  4CK3 A;  5JS1 A;  2NRH A;  2HBJ A;  4DUY K;  4FK0 A;  2A42 A;  4JI1 K;  4C8L A;  1SZ2 A;  3VQQ A;  2AJQ A;  4JI8 K;  1NKE A;  2F9T A;  3EL2 A;  1QHA A;  2QTD A;  1HJR A;  1QS4 A;  2GV9 A;  3QDK A;  3SNN A;  4GV6 A;  4AM7 A;  4DTU A;  4KBO A;  4BGB A;  4E1N A;  3M6G A;  4JK9 A;  3FZH A;  1TKD A;  3WNF A;  3CPW M;  3W0L A;  2FSK A;  4DLG A;  2ASM A;  4GKJ K;  3CET A;  3VEO A;  2IVP A;  4B1V A;  3TAE A;  4KFB A;  2PBD A;  4DR2 K;  4KHN A;  4E89 A;  3AVG A;  3SUO A;  4YOR A;  4CFA A;  2QA4 N;  1WBD A;  1IG9 A;  2WON A;  1NGB A;  1EET A;  1RT2 A;  5KI6 A;  4CJT A;  3EKS A;  3AVA A;  1TGO A;  3I0S A;  4MDB A;  1A5X A;  3BUZ B;  3RRH A;  1A5W A;  4ISE A;  3RMB A;  2PYL A;  4CJF A;  2OZS A;  4CEE A;  1OH6 A;  2GWJ A;  1WSE A;  4H5V A;  4JKH A;  3ZT0 A;  1ILY A;  3AO3 A;  2BDP A;  1NWK A;  1VSI A;  1LW0 A;  5CE3 A;  2YNF A;  4F3O A;  1RDU A;  4FWO A;  3K5O A;  2HBK A;  1O1W A;  3L2Q A;  4KHY A;  2YKM A;  1NK9 A;  5EX5 A;  1VQO N;  1L5U A;  4HTU A;  4FSV A;  4EFH A;  4CZF A;  2O8E A;  3NHG A;  3D0P A;  2BUP A;  4WQ4 C;  4KRF A;  1ASW A;  4YOY A;  3QLH A;  5JIC A;  2FBT A;  4H5R A;  5AQF A;  1ATN A;  4B9M A;  2HF4 A;  4Z4G A;  4J2A A;  1TYQ A;  4JHD B;  1Z05 A;  1Q8I A;  4CF8 A;  3SQ1 A;  3UKR B;  4I7F A;  1BIU A;  1JXE A;  1K8K B;  4M3T A;  3S3M A;  4EP5 A;  4FPA A;  3TSP A;  5AJ3 K;  1JXB A;  2E2N A;  3F5T A;  3PIP L;  3MXI A;  1X1P A;  2F9W A;  2DPN A;  4BDZ A;  2HOE A;  4MDA A;  3CJ7 A;  3G71 N;  4QS7 A;  4BG8 A;  2RHK A;  3Q7B A;  4E1J A;  4DB3 A;  4FM2 A;  3OVN A;  3OYE A;  3KWG A;  4IWV A;  1C0T A;  1BA1 A;  3LWL A;  2XHB A;  1S3X A;  1BIS A;  3ZX0 A;  3QEW A;  3PO4 A;  3NGI A;  1RIL A;  5C25 A;  4WYB A;  1NJI O; 
#chains in the Genus database with same CATH homology
 4BDY A;  4HUE A;  3AVN A;  4N76 A;  4N41 A;  4TSX A;  3C95 A;  2DY4 A;  1RT7 A;  1GOC A;  4B3O A;  2I5J A;  1NOZ A;  5HRP A;  3O4N A;  2GUI A;  3SV4 A;  2WOM A;  1CZ9 A;  4R5P A;  3K5N A;  1CLQ A;  3QES A;  3OYN A;  4C8O A;  4OKJ A;  2LSN A;  3VA3 A;  4FZZ A;  2D5R A;  3TAR A;  4GW6 A;  2E6M A;  2D0C A;  3HP9 A;  4MFB A;  1T03 A;  4BE2 A;  1NJX A;  1VSF A;  1NOY A;  3PX6 A;  2HB5 A;  1C6V A;  3HK2 A;  1T7P A;  2KZZ A;  3PV8 A;  3DI6 A;  5J2P A;  3ALY A;  4DFP A;  1ZYQ A;  2VG7 A;  2QXF A;  1JKH A;  1BL3 A;  4PQU A;  1VSH A;  3KK2 A;  1JLE A;  1RDC A;  1RT1 A;  1WSF A;  3ZT1 A;  3O3H A;  4H4M A;  4AHT A;  3S3O A;  1N6Q A;  4FJG A;  3SYZ A;  2OPQ A;  3PX4 A;  1SV5 A;  2HVI A;  3KK1 A;  3ZSY A;  2XY8 A;  3NF6 A;  2OPP A;  3QO9 A;  4RW7 A;  1TK0 A;  1ZBF A;  2B5J A;  4F2R A;  3RMA A;  4LH5 A;  1RCH A;  4EZ9 A;  2DTU A;  3SI6 A;  2G8K A;  4KPY A;  4B9T A;  1BGX T;  2YNI A;  3NBP A;  3OYF A;  3L2W A;  1S1V A;  4OKE A;  4RW6 A;  4DQI A;  4NCG A;  3VQA A;  3HP6 A;  3K57 A;  4RW4 A;  2RN2 A;  2YHA A;  4KTQ A;  3NH0 A;  3I0R A;  3NFA A;  3ZSO A;  3IAY A;  4BWM A;  1YVU A;  3K59 A;  1RT5 A;  2JLE A;  2P5G A;  3M8Q A;  4CES A;  4E3S A;  1GOA A;  2PYJ A;  4DQS A;  4FXD A;  1S6Q A;  3C94 A;  2R7Y A;  3VQB A;  4J2E A;  2X6N A;  4W5N A;  1J53 A;  4CHQ A;  3O3F A;  2ZQB A;  3KTQ A;  1CZB A;  4IFV A;  4FJN A;  4CEA A;  1CXQ A;  4CJQ A;  3KLF A;  3K5L A;  4DQQ A;  4CEQ A;  4DTO A;  1KFD A;  3K58 A;  4LD0 A;  5J2Q A;  4DU1 A;  4DQR A;  4H8K A;  3NGZ A;  1REV A;  2IGI A;  2FC0 A;  4FLU A;  1TL3 A;  1SL2 A;  4FJK A;  2O4I A;  5D3G A;  4N47 A;  4HHT A;  2VG6 A;  4RW9 A;  4CJP A;  4DTP A;  4CEZ A;  1RDB A;  3TAP A;  4N56 A;  1SKW A;  3WNH A;  1ASV A;  1UWB A;  2BE2 A;  2VG5 A;  1JLF A;  4IG3 A;  4Z4C A;  3P83 D;  3SQ0 A;  2HMI A;  3OYA A;  4KHQ A;  3DLR A;  2HND A;  3DRR A;  1VSE A;  3LAN A;  4AHS A;  3IS9 A;  1A5V A;  4B08 A;  1SKR A;  2OPS A;  2F96 A;  3IRX A;  3NF8 A;  4CJ3 A;  3V81 A;  2ZD1 A;  5HRN A;  4CHN A;  4JRQ A;  2Z1I A;  3L3V A;  4DS5 A;  3NH2 A;  4KRE A;  3DLK A;  1DTQ A;  1ITG A;  4B8A B;  4I2P A;  1XHX A;  3VQD A;  1BI4 B;  3T3F A;  4CJL A;  1VK0 A;  3L2V A;  4DTX A;  2OPR A;  4KTW A;  1X9W A;  1VSD A;  4KAZ A;  4CFB A;  3LZJ A;  4FK4 A;  2ATQ A;  1ASU A;  3A2F A;  4KHU A;  3HYF A;  3RR7 A;  4AHC A;  2HHU A;  3ASM A;  3AVB A;  2YNH A;  3V9Z A;  1TL1 A;  4FJJ A;  1YTU A;  3C6T A;  2QK9 A;  3ZSV A;  3LWM A;  4DU4 A;  5J2M A;  1XC9 A;  2HW3 A;  3DOK A;  3KD1 E;  5FDL A;  4CIE A;  4Z4H A;  1DLO A;  4CIG A;  2GBZ A;  4CJU A;  4CK2 A;  1BCM A;  4FW2 A;  1QSY A;  1BQN A;  5I42 A;  3CQ8 A;  1UAX A;  4KB0 A;  3QNN A;  1KCF A;  3BGR A;  3AVL A;  3QIP A;  3OYI A;  3SUQ A;  4M3Z A;  1RBS A;  4FLT A;  4ICL A;  1VSJ A;  3HPG A;  4PUO A;  2NUB A;  3V6D A;  4YNQ A;  3OYH A;  3LZI A;  4DTJ A;  4F4K A;  3DYA A;  3EY1 A;  2HHX A;  3SQ4 A;  3C6U A;  4CER A;  4BDP A;  4J2B A;  1LAV A;  1I3A A;  4IDK A;  4CGJ A;  4QCL A;  1ZBU A;  3VQ9 A;  4MQ3 A;  3V1R A;  1TKT A;  4CED A;  3SUP A;  1NJZ A;  3AVC A;  3DLE A;  1WN7 A;  2G8U A;  1HQE A;  4CHZ A;  3PO5 A;  4DQP A;  1C1B A;  4NYF A;  2DFF A;  4HUF A;  5DK5 A;  3QNO A;  3HO1 A;  4DFK A;  4Z4I A;  4DSK A;  1RDD A;  2QKB A;  4ELV A;  4CHP A;  4ID5 A;  4EZ6 A;  3OYC A;  1C1A A;  1VRT A;  1RTD A;  4AHV A;  2OA8 A;  4ELT A;  4DSL A;  4I2Q A;  1S9E A;  3CFP A;  4K8X A;  3TAN A;  1W9H A;  4FZY A;  2ZE2 A;  1RBU A;  2HHS A;  3B6P A;  1T05 A;  3RMD A;  2HHV A;  5SWM A;  3DLB A;  3ZSQ A;  4E7L A;  4ID1 A;  3ZCM A;  2YHB A;  4DS4 A;  3B6O A;  4AIL C;  1HMV A;  3QIO A;  2Y1I A;  2G8V A;  3V1O A;  1KLM A;  3SCX A;  1JL1 A;  3MEC A;  4IKF A;  3VQ8 A;  4KTZ A;  1UA1 A;  1LAW A;  1WSH A;  4FLZ A;  4FLY A;  2XRI A;  3ISN C;  1EKE A;  4E7I A;  4FZX C;  4CEB A;  1HYS A;  2G8H A;  4LSN A;  3RTV A;  1QE1 A;  2Z1J A;  4CJE A;  4DSE A;  4M3U A;  5I3U A;  1FXX A;  1QHT A;  4LY7 A;  3O3G A;  3LAK A;  3HPH A;  3S9H A;  4C8N A;  4HUG A;  1RNH A;  2VWJ A;  2B6A A;  3M8R A;  3SQ2 A;  1LWF A;  4BE0 A;  1Z26 A;  5KGX A;  3I8D A;  1S1U A;  3OYM A;  1Z25 A;  2XY5 A;  4E7K A;  5KTQ A;  3CYM A;  3SV3 A;  1YTA A;  3QIN A;  1RT4 A;  3F73 A;  1JLB A;  3KIO A;  2HNY A;  4RG8 A;  1U47 A;  1JLQ A;  3ZSX A;  3ZT2 A;  1KVB A;  2RF2 A;  4OGE A;  2PZS A;  3OYB A;  4F8R A;  4FJL A;  3SPY A;  1S9G A;  1BCO A;  2KW4 A;  3VN5 A;  3LPU A;  1NKB A;  1XWL A;  2G8W A;  4ZTF A;  5CYQ A;  4DU3 A;  1RTI A;  1KVA A;  1NK4 A;  3P5J A;  1J5O A;  1BI4 A;  2YNG A;  4CF9 A;  3MXM A;  1X9M A;  3DLH A;  4DSJ A;  4NCA A;  3DRS A;  3LP2 A;  5CZ2 A;  1L3U A;  3HJF A;  1B9F A;  4M3X A;  1VSL A;  2HHW A;  4FJI A;  3HPO A;  2IS3 A;  4W5Q A;  2EHG A;  5JS2 A;  4CIF A;  2XY6 A;  4DWI A;  3OYJ A;  1JLA A;  4H4O A;  1HYV A;  4CJW A;  3M8S A;  4KKO A;  4ELU A;  5J1E A;  2W42 A;  3NF9 A;  5C24 A;  1D5A A;  3DRP A;  3WNG A;  3BDP A;  4FLW A;  4FM0 A;  4GVM A;  5HRR A;  1VRU A;  4CF0 A;  3OYG A;  1TK5 A;  4OLA A;  3HT3 A;  2JGU A;  3S3N A;  2P51 A;  1NK5 A;  5K14 A;  4NCB A;  3NAE A;  4OPJ A;  1TK8 A;  4FJ8 A;  3MED A;  4I9Q A;  3UIQ A;  1K6Y A;  4M41 A;  2ETJ A;  1NK6 A;  3OY9 A;  4DTN A;  3DOL A;  4CK1 A;  1RBV A;  1NJY A;  1HRH A;  5DMR A;  4O4G A;  4Z4F A;  1TAQ A;  3AA3 A;  4OPK A;  3HL8 A;  4CGI A;  4M3W A;  3RRG A;  2KFN A;  2OYQ A;  1TKX A;  4C8M A;  3ITH A;  4UQG A;  2D0A A;  1D9F A;  3V9S A;  5EU7 A;  4FLX A;  4OVL A;  1HQU A;  3TAF A;  1RTH A;  2DFE A;  3DLG A;  3ZT4 A;  1Q9Y A;  4FJ5 A;  3LDS A;  4FCY A;  4CJV A;  4CHY A;  4W5T A;  3TAB A;  5HRS A;  1JL2 A;  5SZT A;  3OYD A;  2XO7 A;  5KGW A;  3SPZ A;  2P5O A;  2BGG A;  4CGF A;  4FYD A;  1NK7 A;  3D45 A;  3MXJ A;  3AV9 A;  3VQE A;  1KTQ A;  4DFM A;  4DF8 A;  2YKN A;  3M8P A;  1BIZ A;  3LAM A;  3ZSZ A;  1FKO A;  1U49 A;  1D9D A;  5FRO A;  3TR8 A;  4CCH A;  1DTT A;  2XY7 A;  1ZBH A;  1IKX A;  4J2D A;  3NF7 A;  4CGD A;  1B92 A;  1LV5 A;  1Y97 A;  4LSL A;  4E19 A;  5HLF A;  3L3U A;  1J54 A;  4F2S A;  4E7J A;  3OS0 A;  1UA0 A;  4OGC A;  3CFR A;  3LPT A;  1C0M A;  4FJ7 A;  2KQ2 A;  3PUF A;  1RDA A;  2IC3 A;  2BAN A;  3NE6 A;  3OYK A;  3LP1 A;  3VQP A;  3V9X A;  1SL1 A;  2VWK A;  3AA5 X;  4W5O A;  1BQM A;  5FRN A;  1IO2 A;  3F9K A;  3PX0 A;  3KD5 E;  2EX3 A;  2HNZ A;  4Y1C A;  1WSG A;  2A1R A;  1NJW A;  4DMN A;  5KRT A;  3HM9 A;  1EXQ A;  3CM5 A;  1NK0 A;  1G15 A;  3THV A;  1RT6 A;  1Q9X A;  5J2N A;  4K8Z A;  2F8S A;  5HRO A;  1HPZ A;  2KFZ A;  1VSK A;  2FBX A;  4I9L A;  4FM1 A;  3NCI A;  4Z0U A;  2FBY A;  3LP0 A;  3HXM A;  1SUQ A;  1XI1 A;  1KLN A;  3DM2 A;  4CK3 A;  5C42 A;  3NH1 A;  3QET A;  1QQC A;  1JLG A;  3CM6 A;  1U48 A;  4NYN A;  1NK8 A;  5JS1 A;  2Q3S A;  1FKP A;  4E7H A;  3V4I A;  4QOZ B;  4CFD A;  3U6F A;  4DFJ A;  1S1X A;  2FBV A;  3KLI A;  3QEX A;  1HYZ A;  5CYM A;  4FK0 A;  4Z4E A;  1UOC A;  4C8L A;  3VQQ A;  2AJQ A;  1CXU A;  2A1S A;  5CZ1 A;  1NKE A;  1WSJ A;  1HNI A;  3KLH A;  5HP1 A;  2P1J A;  1XHZ A;  1IKV A;  3VQC A;  2KZM A;  3JSM A;  4AHU A;  1HJR A;  1QS4 A;  2GV9 A;  1KRP A;  3T1A A;  3L2U A;  3RMC A;  3SNN A;  1S5J A;  1QTM A;  3OJU A;  3L8B A;  3VQ6 A;  3L2R A;  3MEE A;  3LAL A;  3AO2 A;  4CEC A;  4DTU A;  1HNV A;  1KSP A;  1D8Y A;  4F3T A;  4E1N A;  3RR8 A;  4EP4 A;  1U04 A;  4DTS A;  1TKD A;  2IOC A;  4E1M A;  3IG1 A;  1S1T A;  4KO0 A;  3WNF A;  3P1G A;  3KJV A;  1LWC A;  2Z1G A;  4W5R A;  4DLG A;  4Q0B A;  4FLV A;  1IKY A;  1B9D A;  3K2P A;  2ITG A;  2HVH A;  4BE1 A;  1I39 A;  3HVT A;  3KLG A;  3TAE A;  2E6L A;  3HVR A;  4CJ4 A;  4DTM A;  4KFB A;  1KFS A;  3QER A;  4CHO A;  3KKS A;  2PY5 A;  4CE9 A;  4O0I A;  4G1Q A;  3QEI A;  4KHN A;  4E89 A;  3AVG A;  1WAJ A;  3SUO A;  3SJJ A;  4CFA A;  1L3V A;  1IG9 A;  3PY8 A;  3AVI A;  2WON A;  3K5M A;  1SKS A;  3KLE A;  4FJM A;  4CGG A;  2DFH A;  1EET A;  4KHS A;  2O4G A;  4CJR A;  1YT3 A;  1S6P A;  4O44 A;  1RT2 A;  4BWJ A;  2OZM A;  4AHR A;  4QAG A;  5KI6 A;  3AA4 A;  4CJT A;  1J9A A;  3ZT3 A;  4B9U A;  1WSI A;  3LP3 A;  3TI0 A;  3AVA A;  1TGO A;  3I0S A;  5CY4 A;  4KI4 A;  1A5X A;  2RPI A;  3JYT A;  1WNS A;  3RRH A;  1A5W A;  3AO1 A;  1EP4 A;  4RW8 A;  3RMB A;  4FW1 A;  4CJF A;  2PYL A;  2OZS A;  1NKC A;  4DSI A;  2X74 A;  4CEE A;  2X78 A;  4E0D A;  3U3G A;  4JS5 A;  2QKK A;  3EYZ A;  3NGY A;  1WLJ A;  1WSE A;  3ZT0 A;  2IDO A;  1VSM A;  3AO3 A;  3O4Q A;  2BDP A;  4KI6 A;  4JS4 A;  1C0U A;  1VSI A;  2Z1H A;  1T8E A;  1LW0 A;  4F3O A;  2YNF A;  2X6S A;  4OKK A;  4CJK A;  3AVK A;  2HHT A;  3CG7 A;  1L3S A;  3TAM A;  3G10 A;  4CEF A;  3K5O A;  3OS1 A;  3ZSW A;  4BAC A;  1BHL A;  1O1W A;  4O0J A;  4CJ5 A;  3L2Q A;  3VA0 A;  1RBT A;  4N5S A;  1N5Y A;  3AVM A;  1RBR A;  4M3R A;  4CGH A;  2YKM A;  4KHY A;  4IBN A;  3EZ5 A;  1NK9 A;  2KTQ A;  4ZTJ A;  4FVM A;  4B8C A;  4LH4 A;  1EX4 A;  2IAJ A;  4HVJ A;  1L5U A;  1QSS A;  4HTU A;  3AO4 A;  4YFU A;  1QSL A;  4C8K A;  4B9L A;  4OLB A;  4CJS A;  5KRS A;  1TAU A;  3NHG A;  3D0P A;  3DMJ A;  4AH9 A;  4KRF A;  1ASW A;  3TWH A;  4FJ9 A;  3QLH A;  4B9V A;  3HST B;  2FBT A;  2YV0 X;  3SZ2 A;  3TAG A;  4M45 A;  4DF4 A;  1GOB A;  4B9M A;  2F8T A;  4DG1 A;  1IH7 A;  3VQ4 A;  1R0A A;  4HCB A;  4Z4G A;  4J2A A;  1WAF A;  1IKW A;  1TKZ A;  4Y1D A;  5HBM A;  4DSF A;  4ZHR A;  1Q8I A;  4CF8 A;  4DTR A;  4PWD A;  4WE1 A;  3SQ1 A;  4FJH A;  4Q5V A;  3H08 A;  3FFI A;  3KKR A;  1BIU A;  1JXE A;  4I7F A;  4PA1 A;  3V1Q A;  3S3M A;  4M3T A;  2E4L A;  3V9W A;  1L3T A;  4EP5 A;  2G8I A;  2HHQ A;  4IFY A;  1JLC A;  3AA2 A;  1KVC A;  4M3Y A;  4JRP A;  4M42 A;  1C1C A;  1RT3 A;  3CFO A;  3KK3 A;  1JXB A;  1RTJ A;  1X9S A;  3MAQ A;  3MXI A;  3WNE A;  5E41 A;  3V9U A;  1LWE A;  1X1P A;  4PY5 A;  4DLE A;  4BDZ A;  4KV8 A;  1TV6 A;  3U3Y A;  2D0B A;  1U4B A;  4CFC A;  1S1W A;  1W0H A;  3OJS A;  1ZBL A;  3NDK A;  4KHW A;  1ZBI A;  2RKI A;  3E01 A;  4CF2 A;  4L8R B;  5T7B A;  2G8F A;  1MU2 A;  5FRM A;  1U45 A;  4HCC A;  3QEV A;  4XIU A;  4B9S A;  3RWU A;  1LW2 A;  4FJX A;  3AO5 A;  3AVH A;  4FM2 A;  3OVN A;  3T19 A;  1TVR A;  1F21 A;  4CF1 A;  3OYE A;  3VQ7 A;  1C0T A;  4GMJ B;  3SUN A;  4CEO A;  3G0Z A;  4OJR A;  3LWL A;  2XHB A;  1SL0 A;  4FK2 A;  3AVF A;  1BIS A;  4O5B A;  3ZSR A;  4IG0 A;  3QEW A;  4JLH A;  3PO4 A;  1FK9 A;  4O55 A;  3OS2 A;  3NGI A;  1RIL A;  5C25 A;  3AVJ A;  3MEG A;  3OYL A;  3QEP A;  3TAQ A;  4B9N A;  3ULD A;  3VQ5 A;  4KB1 A;  2Y1J A;  2B4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...