4O5BA

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[6-(5-chloro-1h-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
total genus 40
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o5bA00
4OLBA 4LSLA 4M45A 3PY8A 1WAJA 2YNHA 4EP5A 4KI4A 4KV8A 4PY5A 1QSSA 4M3TA 5HRRA 4ICLA 4FVMA 2P5OA 3DLGA 3PX4A 1UWBA 3L3UA 3TAEA 3LP0A 2XO7A 4FZYA 4EP4A 4H4MA 4KKOA 2VWJA 1X9MA 2DY4A 3OYBA 3ZT3A 1RDAA 4N47A 3OJUA 1FK9A 5CYQA 4FLZA 3VQ7A 3SQ1A 4DTJA 4DS4A 2HB5A 2YHBA 2RPIA 4FW2A 2HHXA 1RT6A 1C1CA 4FLXA 1BHLA 4BE1A 3K5NA 4BE2A 3VQAA 4CIFA 4ZTJA 4CESA 2OZMA 1TKXA 4ELTA 3NF8A 3I0RA 3KLIA 2IS3A 3CG7A 2NUBA 4DU1A 3OYFA 4FK2A 3RR7A 1A5XA 3OYKA 2IAJA 4LH4A 4CEAA 3NE6A 3TARA 3KD1E 4ELUA 1HNIA 1JKHA 1KLMA 3MEDA 3O3GA 3HO1A 2YKNA 3QIPA 1KFSA 2EX3A 1NK0A 4GMJB 4AHTA 1J9AA 4B08A 4KREA 1SL2A 1I3AA 4HTUA 4JLHA 4O55A 1IO2A 1RTJA 5J2MA 3NHGA 4CEOA 3TAPA 3VQDA 3HT3A 3ASMA 2GBZA 3MXMA 4J2EA 2ZQBA 4NCBA 1I39A 1LWCA 1ASWA 3HM9A 2G8UA 3TABA 3HL8A 4FK4A 4B3OA 1IG9A 1JLBA 4O0JA 4F2RA 1TGOA 1GOAA 4CHZA 1U04A 4OGEA 1L3TA 3OYHA 5D3GA 1BIUA 4CJKA 3ZCMA 3VQBA 4E89A 4IG0A 4W5TA 4FLVA 4GW6A 2GUIA 3NCIA 4ID5A 2ZE2A 5HRPA 2B6AA 3HP9A 4W5NA 3ITHA 4CERA 4AHCA 4KB1A 2F8SA 1SL0A 3CQ8A 2YNIA 2F96A 4DFMA 3SCXA 3S9HA 3ZSZA 4C8LA 4OLAA 3DLKA 3NH1A 1NOZA 4LD0A 4I2QA 4Z4HA 3MXIA 4FJLA 1HYSA 1LAVA 2VG5A 3HK2A 4BDYA 3SNNA 2XY7A 3KK3A 4CHQA 4CEBA 3VQ6A 4OVLA 3L8BA 4QCLA 2D5RA 4I7FA 3OVNA 4RG8A 5KRSA 1S1UA 4DLGA 1VSHA 1J54A 4CGGA 5KTQA 1SKWA 2BDPA 3DLRA 4KAZA 4DQIA 4BWMA 4MQ3A 1T8EA 2G8VA 4FJ7A 3ZSWA 5FRMA 1J5OA 3RWUA 1XI1A 1KVBA 2VWKA 3L2WA 3SUOA 4Z4GA 5DK5A 1Q9XA 1DLOA 2HHSA 3D45A 4M3XA 4FLTA 3KK1A 4CK2A 4FYDA 3IRXA 1RT1A 1GOBA 1U49A 3EZ5A 3ALYA 1CXQA 1QQCA 1EP4A 3G10A 4FCYA 1BI4A 3M8SA 3QERA 1R0AA 2OPRA 2DTUA 2X6SA 3OYMA 2YHAA 3VA0A 3OYIA 4CF1A 1LAWA 4CIGA 3IAYA 4KHYA 4FJHA 5HRNA 4DF8A 3VQEA 4M41A 4FM2A 3CYMA 2XY5A 1WN7A 4DTXA 4DTSA 3OY9A 3EY1A 3RMAA 2KQ2A 1RTHA 4IG3A 4M3RA 3TAMA 3SUNA 3LZIA 4OGCA 3AVLA 4FLWA 3QEVA 4I9QA 1W0HA 4OPJA 1FKOA 2Q3SA 4I9LA 2XY6A 1K6YA 4R5PA 3KD5E 3SJJA 1NKCA 1KVCA 2HW3A 2HHVA 1RT2A 4NCAA 3G0ZA 1MU2A 3TAGA 1S1XA 1HQEA 1A5VA 4Z4IA 1JLQA 4QAGA 3C95A 4KHQA 4IDKA 1T03A 5J2PA 3OYDA 4DTOA 4W5RA 1VSDA 3DI6A 1WSFA 2IC3A 3TR8A 3T1AA 3F73A 2BGGA 2KTQA 4JRQA 3AA3A 2OPSA 2KZZA 5J2QA 4DTRA 3I0SA 4RW6A 5JS1A 1TV6A 2D0BA 4HHTA 2HHWA 3LP3A 4CJRA 3NF9A 4N5SA 1ITGA 5C24A 1Y97A 5C25A 3VQQA 3AVAA 5KRTA 1ZBLA 1SKSA 3V9ZA 1Z25A 5KGXA 3P5JA 4RW8A 1IKYA 1C0MA 4YNQA 4JS5A 1ZBUA 4O0IA 4KO0A 4DTUA 4FJIA 1B9FA 1RBTA 3A2FA 3DLHA 1VK0A 3IS9A 1JXEA 3S3NA 4O4GA 1VSLA 1L3SA 4PA1A 3MEEA 3RRGA 3OYJA 1B9DA 3QETA 3OYLA 2JGUA 1U4BA 2P5GA 3LWMA 1KLNA 4BWJA 1IH7A 1NOYA 3ULDA 1S1VA 2ETJA 4CHOA 4F3TA 1WSEA 1NKEA 1XHZA 4AH9A 4CK1A 1Q9YA 2E6MA 3AVBA 1WLJA 4IFYA 2Y1IA 4IBNA 4FM0A 1RT7A 1RBRA 3CFRA 3QEPA 3V1OA 5KGWA 4Z4EA 1XC9A 4KTWA 3S3MA 4F4KA 4HCCA 4CFCA 2JLEA 3AA2A 1VSFA 3B6PA 2FBYA 4E7LA 3KJVA 3SPZA 3SQ0A 1TAQA 2Z1JA 1D8YA 1YTAA 4KHUA 1F21A 4FJXA 4CHYA 1RBVA 3NF7A 3K57A 4DQSA 1BCOA 3OJSA 1SUQA 3JSMA 1XHXA 1JLCA 1CXUA 2ITGA 1SKRA 1HJRA 1WSHA 4Z4CA 3DLEA 3K5LA 1N5YA 4DSLA 3AV9A 4CJFA 2RN2A 3NH2A 5I42A 3MAQA 5HRSA 4B9MA 1S9EA 3OS0A 4CJVA 4E1MA 2KZMA 3DRPA 4CGHA 3V9UA 1U48A 1TAUA 4FJGA 4B8CA 4DWIA 1QS4A 3HVRA 1EX4A 4CJUA 1WSGA 1HPZA 1S6PA 3VQ4A 3VQ8A 1VSEA 3ZSQA 1UOCA 3AA4A 4CF0A 1UA1A 5CYMA 2I5JA 4CJ5A 4WE1A 3VA3A 3S3OA 2O4IA 3M8QA 4ID1A 4CJPA 3KLEA 4M3YA 3M8PA 1Q8IA 3K58A 4DSEA 1RT3A 2R7YA 4N76A 3O3HA 4W5QA 3LPTA 4FJKA 3E01A 2BANA 1S5JA 1FXXA 2X74A 3KK2A 4CEEA 4NCGA 3V1QA 3RMCA 2HNDA 3KKRA 4CGFA 1TKZA 3CFOA 4FW1A 2EHGA 1L3UA 4FXDA 3BGRA 4AHVA 4F2SA 4CFDA 1XWLA 1NJWA 2PY5A 4I2PA 1L5UA 2RKIA 2HVHA 2HHQA 2QXFA 3IG1A 4JRPA 3C94A 4F3OA 1D5AA 3SUPA 2ATQA 5HP1A 3SI6A 3C6TA 4DU3A 1CLQA 3HYFA 4B9SA 3DRSA 3NH0A 4HUFA 3AVHA 1DTQA 1ZBFA 1IKVA 1VSMA 3KIOA 4KTZA 3HVTA 2PZSA 1ASUA 4N41A 3K5OA 3D0PA 4ZHRA 2HHUA 3QEIA 4KHWA 4CEFA 5C42A 3TAFA 3THVA 4E7HA 4N56A 3NGZA 3L3VA 4CE9A 3L2VA 1LW2A 4DQRA 3ZSVA 1Z26A 3O4NA 1NKBA 2OZSA 3PUFA 4OJRA 1N6QA 1SV5A 4KTQA 1TK8A 3DRRA 3V4IA 5FROA 1HYVA 1KFDA 4H8KA 5J1EA 3SZ2A 1L3VA 4B9LA 4L8RB 1B92A 3O4QA 4B8AB 4LH5A 4ELVA 5FRNA 4EZ6A 4CECA 3SPYA 3SYZA 3K59A 3FFIA 1RBSA 2G8FA 3MXJA 3CM6A 4CJ3A 4DSFA 2DFEA 3OYAA 1S6QA 3OS1A 4E7IA 4DS5A 5DMRA 1C1BA 2DFFA 3AO4A 3LALA 1KRPA 4KRFA 2KFNA 2PYLA 1T7PA 1EKEA 3B6OA 3BDPA 1TK5A 4PWDA 4TSXA 2FC0A 2O4GA 4GVMA 1NK5A 5CY4A 1T05A 4E7JA 2QKBA 1ZBIA 3AVFA 4FZXC 3AVCA 1RT4A 4MFBA 2FBVA 3PO4A 4CJ4A 3LAMA 4E0DA 4J2DA 3P1GA 1W9HA 3T3FA 4C8MA 1LV5A 2P51A 4RW4A 3O3FA 3KLGA 2YNFA 4DG1A 4CGIA 3PX0A 4DTMA 4Z0UA 4B9UA 2HVIA 5JS2A 3V9XA 1GOCA 2KFZA 5K14A 3HXMA 3QIOA 4CHPA 3ZSXA 2YV0X 3PX6A 4CEZA 1RCHA 3K2PA 3M8RA 2IOCA 3NFAA 5EU7A 4BACA 2PYJA 4DF4A 1BL3A 3OS2A 1JLAA 1RTDA 3LZJA 1JLGA 2OYQA 2WONA 1YT3A 2E4LA 4NYNA 3ZSRA 4AHUA 1BI4B 4OKJA 4CJTA 4E19A 5SZTA 3KLFA 4HUGA 4BDZA 4Z4FA 4DQQA 3DOLA 2G8IA 4KB0A 1QSLA 4O44A 3L2QA 2XHBA 4DFPA 3QNOA 4Q0BA 2A1SA 3KTQA 2D0AA 2HHTA 1WSIA 1WAFA 4E1NA 1C1AA 1BIZA 4C8NA 3SUQA 1JL1A 4FJ5A 2Z1IA 3SQ2A 3ZT2A 3AVKA 4DFKA 4DQPA 2LSNA 3AA5X 3DLBA 3V9SA 1IKWA 3QEXA 3WNEA 1KVAA 2B5JA 2G8WA 3AO5A 2BE2A 5CZ2A 4B9NA 3HJFA 4B9TA 1C6VA 1UA0A 1NK8A 1BQNA 1LW0A 3HPHA 2HMIA 4FM1A 1BGXT 2IDOA 1JXBA 2B4JA 2DFHA 4YFUA 3LDSA 2OA8A 4B9VA 3UIQA 1VRUA 1ZBHA 5HLFA 4CFBA 1G15A 4KHNA 1UAXA 1TL3A 1X1PA 4XIUA 3PO5A 4OPKA 1D9FA 1NJYA 5CZ1A 1REVA 1VSJA 2YKMA 1RBUA 4CEDA 4G1QA 3NAEA 1C0UA 3TAQA 4CGDA 4OKKA 3TANA 1C0TA 3TI0A 4DU4A 3ZT0A 1CZ9A 4DTPA 3VQCA 1NK4A 4Q5VA 3CM5A 2W42A 5HROA 2VG6A 1U47A 3P83D 1RDCA 4CJLA 1HMVA 1VSIA 3WNHA 3ZSYA 4AHSA 3RTVA 2QKKA 3NGIA 2YNGA 3NGYA 4KFBA 3V1RA 3KKSA 4DSIA 3ZSOA 5I3UA 3QLHA 1NK7A 2E6LA 3K5MA 1IKXA 1QSYA 2OPQA 4DFJA 4Y1CA 4EZ9A 4IFVA 1HNVA 4CF9A 4CEQA 3RMBA 2A1RA 3ISNC 4M3ZA 3OYNA 3V6DA 2AJQA 3HP6A 2VG7A 4FLYA 4KHSA 3T19A 1WSJA 2QK9A 3WNFA 4E7KA 3RRHA 1TK0A 4IKFA 4RW9A 3AVMA 2G8HA 3U3YA 4FLUA 3VN5A 4PQUA 2Y1JA 4NYFA 2Z1GA 4M3WA 3SQ4A 4DSJA 4K8ZA 4M3UA 1LWEA 3VQPA 3NBPA 3TWHA 5T7BA 3LAKA 3EYZA 4CK3A 2WOMA 3ZT1A 1JL2A 1RILA 1S1TA 2HNYA 4CHNA 4M42A 3U6FA 3DYAA 3VQ9A 1NJZA 4W5OA 1J53A 3NF6A 1U45A 2G8KA 3U3GA 4BDPA 4KI6A 1RTIA 2X6NA 4CJQA 3CFPA 1TL1A 4FZZA 4F8RA 4AILC 1KTQA 1QHTA 2OPPA 4OKEA 1HRHA 3V9WA 1BISA 1QTMA 4PUOA 4RW7A 3OYEA 4FJMA 5J2NA 3V81A 3LANA 4H4OA 4CF8A 1KSPA 1TVRA 2Z1HA 2ZD1A 2D0CA 1KCFA 3RR8A 3DM2A 2P1JA 1VRTA 3F9KA 3MECA 2HNZA 3HPGA 4DTNA 3NDKA 1SL1A 4FJNA 4CF2A 1RDDA 4UQGA 1RDBA 4BE0A 3PV8A 4HVJA 1X9SA 1NK9A 1JLFA 3OYGA 3I8DA 3C6UA 5KI6A 3AO1A 4AHRA 2RF2A 4CJSA 3LWLA 4CIEA 3AVNA 1A5WA 4E3SA 1TKDA 1JLEA 4LSNA 3SV3A 1O1WA 3QESA 1ASVA 4CFAA 3QO9A 4CJWA 2KW4A 1VSKA 3AVGA 3H08A 3L2UA 4J2AA 1FKPA 4C8KA 3RMDA 3AO2A 2F8TA 1RNHA 5E41A 4QOZB 4ZTFA 1YVUA 1EETA 1S1WA 3AVJA 3LP2A 4DMNA 4JS4A 4FJJA 4FK0A 3AO3A 3QINA 1ZYQA 4HCBA 1NJXA 2XY8A 4Y1DA 5FDLA 1EXQA 4KPYA 3DMJA 1TKTA 1X9WA 4CCHA 2IGIA 2FBTA 3AVIA 3SV4A 1DTTA 3HPOA 3LPUA 3WNGA 3MEGA 3QEWA 4K8XA 3DOKA 4CJEA 4DLEA 4FJ9A 2FBXA 1HQUA 4HUEA 3QNNA 1CZBA 1YTUA 3ZT4A 1WNSA 5HBMA 1NK6A 4LY7A 1HYZA 1S9GA 1LWFA 1BQMA 3VQ5A 1RT5A 4J2BA 3HSTB 4DSKA 4CGJA 3JYTA 3L2RA 2GV9A 3OYCA 4O5BA 4FJ8A 2XRIA 5SWMA 2X78A 3KLHA 1BCMA 3LP1A 1QE1A 4C8OA 1D9DA
chains in the Genus database with same CATH superfamily
4OLBA 4CBUA 4CZFA 3PY8A 4KI4A 3GL1A 4PY5A 3R6MA 1QSSA 4FVMA 1TUUA 2P5OA 3L3UA 4YOUA 4EP4A 3LM9A 4KKOA 4BR0A 3OJUA 3TSUA 2GX9A 3B8AX 3ZETB 1GLFO 1QVFM 1C1CA 4YOVA 3HBTA 4BE2A 1H1VA 4CESA 4JHDB 4ELTA 4DR4K 3I0RA 4B3RK 3G6EN 4JKHA 3CCUN 2NUBA 4DU1A 3L4IA 1KC8O 4DCHA 4ELUA 2O8CB 1KLMA 3MEDA 2YKNA 3QIPA 4YOWA 2EX3A 4JEPA 1NK0A 5GIOA 4JD2B 1I3AA 1SL2A 2P9IA 1RTJA 3O9QA 3WEEB 4CEOA 3NHGA 3ASMA 4GV6A 2A6AA 4NCBA 4B3OA 3HM9A 3TABA 5F1XA 4FK4A 1JLBA 4O0JA 3CMAN 4OGEA 1L3TA 2WFBA 1YJNN 3LDQA 4IG0A 4FLVA 4ISGA 2IIRA 4A59A 1BO5O 2B6AA 3HP9A 1VQON 3ITHA 5AFUH 4AHCA 4EHUA 1SL0A 3THYB 4BRHA 3DLKA 4GY2B 4Z4HA 4QS7A 1YVNA 3A8YA 3LM2A 4RWTA 4CEBA 5M1FA 3KVGA 3OVNA 4RG8A 3UE5A 1VSHA 5EY4A 5KQ8A 4DB3A 3DLRA 1GLAG 4DQIA 3HOTA 4DV2K 4FJ7A 3G4SN 3EKSA 3L2WA 5DK5A 3CJAA 3CJ1A 4FLTA 3L6QA 1NWKA 1GOBA 1RT1A 3G10A 3O9UA 3CF5L 4FCYA 3J8AA 2OPRA 3T1YK 3SLCA 4CIGA 3IAYA 5HRNA 4YDUC 5E84A 3CYMA 2XY5A 4DTXA 5GINA 2O8DB 3MDQA 3IKMA 2KQ2A 4IG3A 3VEZA 4OGCA 1FKOA 3DXKA 3SJJA 2HW3A 1KVCA 3DAWA 1S1XA 2GEMA 4Z4IA 1JLQA 3IMXA 5GADP 5C0YA 1T03A 2PAVA 1WSFA 3P31A 4IFEA 1GLJO 2KZZA 4ILHA 5AQYA 4HHTA 4CJRA 4NXNK 3EZWA 4BC2A 3AVAA 5KRTA 1ZBLA 5KGXA 4JS5A 4O0IA 4KO0A 4FJIA 3U9ZA 1VK0A 3E9PA 3IS9A 1JXEA 3SJHA 1OVQA 3FZMA 4MLHA 3OYJA 3OYLA 1U4BA 2P9LB 3ULDA 4CHOA 1WSEA 4AH9A 4FM0A 3EEQA 1RBRA 3A0IX 3V1OA 2JLEA 1VSFA 3TU5A 4FJXA 1D4XA 3UKRB 1RBVA 2JWKA 2OANA 1IBKK 3OJSA 4M63C 2VQFK 3MN9A 5BN9A 4B1XB 5ADXA 1YUWA 1CXUA 1WSHA 3K5LA 2P9UB 3AV9A 3NH2A 4DSLA 4LFAK 1O13A 2A3ZA 4FOIA 3V9UA 1TAUA 4OX9K 4BRAA 4CJUA 1WSGA 1S6PA 5BREA 2O8BB 4CF0A 2I5JA 3VA3A 4WE1A 4ID1A 5AQGA 3M8PA 5AQHA 2BH1A 2D0OA 3PIOL 4N76A 4W5QA 3LPTA 3PIPL 4DR6K 3E01A 3O8MA 3ATUA 4NCGA 4NO7A 2AA4A 5HOOA 2EWSA 4WQ5C 4F2SA 1HJOA 3SAGA 1NJWA 4BVPA 4I2PA 1L5UA 2HHQA 2KLAA 3IG1A 4F3OA 1MWMA 4JYAK 1D5AA 4DHYA 1DKGD 3SI6A 3C6TA 3O5BA 4DU3A 4BR2A 2Q36A 1S72N 4B9SA 4LF4K 1Q81O 1DTQA 3KIOA 1IKVA 2PZSA 4KTZA 3HVTA 3K5OA 1NM1A 4ZHRA 2HHUA 3H1QA 3SBGA 3QEIA 4KHWA 4XH5A 3GE1A 4CE9A 3ZSVA 4EHTA 3PUFA 4WQ4C 1N6QA 3V4IA 4LF6K 1KFDA 3SZ2A 5J1EA 1ATRA 2ASMA 2IVNA 3VEVA 4JK7A 1S22A 3K59A 3FFIA 1Y64A 3LDLA 4DSFA 3ZETA 3OYAA 1GLEG 3OS1A 1RGIA 2YHWA 3VF2A 2E2OA 1KRPA 4JHDA 2VCPA 4CVNE 5H1SQ 3G25A 4KH6A 4WCEL 3DLLL 4GVMA 5CY4A 5F2RA 1ZBIA 3AVFA 1XQSC 2O8CA 4FZXC 3PO4A 4CJ4A 3LAMA 3T3FA 4C8MA 3LDNA 2F7TA 4JD2A 2YNFA 3CJ9A 4CGIA 3WEEA 3TPQA 3V9XA 1GOCA 1MA9B 3PX6A 4DR5K 2NRTA 4DF4A 1RTDA 2HHVA 3ZSRA 4OKJA 3JS6A 4CJTA 4E19A 3AAPA 3E9OA 4H5NA 3J7YP 3IDHA 3THYA 4KB0A 4O44A 2UUBK 3C0BA 4BRPA 3Q7BA 4Q0BA 3KTQA 4H03B 1WAFA 3SUQA 3ZT2A 4L3QA 4YDUA 2LSNA 2A42A 5BR9A 1IKWA 5I9EB 4JK9A 1NGGA 1BQNA 3HPHA 4BC3A 1JXBA 4YFUA 4CZIA 2OA8A 2CH5A 5HLFA 1NJYA 5CZ1A 3TANA 1RBUA 1C0UA 5MLCQ 4CGDA 4OKKA 3HOSA 3TAQA 4M7YA 4BRDA 5HROA 4CJLA 1RDCA 3NGYA 2O8DA 3ZSOA 2E5LK 1NK7A 3K5MA 4EZ9A 3H46O 4IFVA 4CF9A 4CEQA 3A5MC 3E9LA 4FLYA 3T19A 3AARA 3WNFA 1YJ9N 4M7XA 4MO4A 4IKFA 3AVMA 2Y1JA 4ILGB 4M3UA 1GLBG 1LWEA 3NBPA 5T7BA 3ZT1A 1Q18A 4BRGA 2F9WA 1P8ZA 3VQ9A 1J53A 3NF6A 4BRKA 1U45A 4CJQA 3CFPA 3THXB 3ENHA 4FZZA 2QK9A 1KTQA 3FE1A 4FJMA 1TUYA 3V81A 3LANA 2E2PA 4DR7K 2W41A 3RR8A 2P1JA 2HNZA 3HPGA 4DTNA 3DXMB 1SL1A 1RDDA 1X9SA 4H0VB 2QXLA 1YF5L 3OYGA 4DV6K 1Q82O 2P9LA 4AHRA 2RF2A 2DPNA 3LWLA 4BRCA 4CD3A 1A5WA 5A2QO 1TKDA 2HF3A 5KPTA 3T69A 3QESA 3CJBA 3AVGA 3OHRA 3L2UA 4BRFA 4J2AA 4C8KA 3KZBA 4OPHA 3RMDA 5CE3A 1V4TA 1RNHA 5E41A 2HBMA 4ZTFA 3O08A 4JS4A 3AVJA 4DMNA 4FJJA 3AO3A 1ZYQA 4BREA 4Y1DA 2YHYA 3DMJA 3ZX2A 3UKRA 4LF7K 2FBTA 1NGFA 2YI1A 3HPOA 2A5XA 4FJ9A 3E66A 3QNNA 1HQUA 4FWQA 1WNSA 4FWNA 1BQMA 1VQLN 3A5OC 3CQYA 3ATVA 2O8BA 1XUPO 2XRIA 3GDQA 1C0GA 1ATSA 2X78A 3KLHA 4C8OA 3TSPA 2YNHA 4FL9A 5HRRA 4FZYA 2XO7A 1HLUA 1N8RO 2PFUA 1RDAA 5CYQA 4FLZA 3O9SA 3VQ7A 2UXBK 3SQ1A 1RDUA 4DV7K 4DTJA 5AQTA 4FLXA 1QZ5A 3VQAA 4CIFA 1TKXA 5JMVA 2E2QA 3NF8A 3G71N 3KLIA 4FWMA 5CHIA 1K73O 3CG7A 1VAZA 2ZWHA 4B1YB 3NE6A 1BA1A 1HNIA 3O3GA 5M1OA 5BPLA 3A5LC 3MK6A 4GMJB 3T1HK 4AHTA 1J9AA 4KREA 4JLHA 1IO2A 5AQXA 5J2MA 4J2EA 1ZC6A 3HL8A 1OH6A 1IG9A 1TGOA 3OYHA 4K43A 4H5VA 1BIUA 1M1KO 3VOVA 3ZCMA 3VQBA 4E89A 1FW6A 2CGLA 3FGUA 2ZE2A 4B3SK 2F8SA 2D4WA 5LMUK 3S9HA 4MO5A 4C8LA 2RE2A 3TSQA 4LD0A 4I2QA 5GIPA 4FJLA 1ESVA 3HK2A 3VF4A 2XY7A 3KK3A 3VQ6A 3L8BA 2D5RA 5IWAK 3VERA 4JKFA 1DGKN 4CGGA 3WXJA 4MQ3A 1YITN 3RWUA 5AJ3K 1XI1A 1KVBA 3VETA 2KKZA 3KK1A 4FYDA 3IRXA 5DM7L 2NRVA 3ALYA 1CXQA 1EP4A 1NBWA 1R0AA 2X6SA 3OYMA 4B1VA 3VA0A 4DV5K 3OYIA 1GLDG 1KQSM 1WBBA 3TTDA 4ISFA 4DF8A 1KAYA 2F4VK 4BROA 2NRXA 3EY1A 3RMAA 3TAMA 1EWRA 4FPAA 3LZIA 4I9QA 1W0HA 4YORA 2Q3SA 4I9LA 1K6YA 1NKCA 5AQQA 4NCAA 3SMPA 1A5VA 1BOTO 3W0LA 4YHHK 5J2PA 3O1BA 3OYDA 4DTOA 4BRMA 1VSDA 3DI6A 4O5FA 4W5RA 1E4GT 3TR8A 2BGGA 2QWPA 3F73A 4DTRA 4BC5A 2D0BA 3L4QA 2HHWA 3LP3A 4H5WA 2VGMA 1Y97A 4JI2K 4CZMA 2V52B 3CCLN 3HTVA 1C0MA 1ZBUA 1ILYA 4DTUA 3M3ZA 1RBTA 3WXMB 2YHXA 2GELA 4X64K 3S3NA 3ZEUB 3I56N 3MEEA 3RRGA 3OBWA 1B9DA 2P5GA 3L0QA 5TKYA 4BWJA 1NOYA 4F3TA 2ETJA 1XHZA 4IOCL 1Q9YA 3AVBA 4IFYA 4FVUA 1RT7A 4KTWA 3S3MA 4HCCA 3THXA 3AA2A 4LF9K 3B6PA 3QMLA 4GKJK 3KJVA 3C6AA 2ZJRL 4CHYA 3NF7A 1OKJA 3DXMA 1BCOA 3JSMA 1XHXA 1JLCA 2ITGA 4Z4CA 3MCAB 1N5YA 4CJFA 5HRSA 3R1XA 3OS0A 1NGBA 2KZMA 2P9PB 3DRPA 4A62A 4IEEA 4DR2K 1EX4A 3VQ8A 3CMEN 1UA1A 3K9JA 4X65K 5FPDA 3TTFA 4DSEA 2R7YA 4FJKA 2V51B 1FXXA 2UXDK 4NB4A 2HNDA 4CGFA 3CFOA 3VEYA 1L3UA 3CC7N 3BGRA 3EKUA 2PY5A 4YOYA 3OA9A 3CCSN 5C15A 3HYFA 4EFHA 3AVHA 4N41A 1ASUA 4R79A 5HL7L 4DQRA 3O4NA 4OJRA 4A2AA 1YHQN 1L3VA 4B9LA 1B92A 1CZAN 4GVEA 4B8AB 2NRHA 4ELVA 4CECA 2D1KA 3WT0A 2G8FA 3P4IA 1S6QA 5M1QA 5DMRA 4KRFA 2PYLA 1T7PA 1TK5A 1NK5A 4E7JA 2QKBA 3AVCA 4AF1A 4JKDA 4B3TK 3O6WA 2P51A 4RTFD 5EVZA 1YIJN 1MDUB 1N34K 2QTDA 4MDBA 3QFUA 3T7ZA 3HXMA 3HZ6A 3K2PA 2PYJA 5EU7A 4PKHA 3O1WA 1BL3A 3OS2A 1JLGA 5FPNA 2WONA 1NMDA 1YT3A 4C1NK 1BI4B 4HUGA 5SZTA 1BG3A 3DOLA 2YCHA 2XHBA 5BRDA 4E1NA 1C1AA 2OTJN 1JL1A 5JLHA 3SQ2A 4DQPA 3DJCA 4PHTX 1VQ9N 4O8KA 5AQFA 3WNEA 1KVAA 2B5JA 1HKBA 3AO5A 5CZ2A 3KHYA 3HJFA 1LW0A 2HMIA 1NU0A 1BGXT 2IDOA 2DFHA 4XH1A 2P9SB 1ZBHA 1XC3A 1G15A 4U67L 3PO5A 3GBTA 1NGHA 1YJWN 1NLVA 3NAEA 1VSJA 4G1QA 1WB9A 1C0TA 1K8KB 2QWOA 1NK4A 1HMVA 1VSIA 3FZLA 2JWLA 3ZSYA 3FZKA 3NGIA 3CCEN 4H5RA 3QLHA 2E6LA 3VENA 5C10A 2OPQA 4HWIA 3J81O 4Y1CA 3RMBA 5LJVA 4DKWA 3ISNC 2FF3B 1QZ6A 1T44A 1U2VB 3M5RA 3RRHA 1TK0A 3WUHA 4PQUA 1G99A 5FLXO 2QWRA 3SQ4A 4DSJA 4PL8A 3VQPA 3TWHA 3HRGA 4M42A 1RILA 1S1TA 3CI5A 3U6FA 3DYAA 4U7BA 4BR4A 4BDPA 4B9QA 4DUYK 1RTIA 3SAHA 2OPPA 3V9WA 1BISA 1QTMA 1W2BM 4FOEA 4BRQA 5J2NA 4CF8A 3I8BA 2Z1HA 2ZD1A 1NJIO 4FWLA 3DM2A 3J7ZO 4CW7B 1VRTA 3F9KA 3IUCA 3UB5A 3CCVN 3PV8A 4HVJA 1QQOA 2QWLA 3I8DA 3ZEUA 3MWTA 4A57A 4CJSA 2VYPA 3Q7CA 2QA4N 4LSNA 3P38A 2KHOA 4KHNA 1ASVA 4CJWA 1VSKA 3CERA 4JKGB 1FKPA 3AO2A 2F8TA 2OCEA 2OTLN 2HSTA 4QOZB 1VQ6N 1EETA 2BTFA 4KH4A 3RSEB 1NJXA 5AQWA 4KPYA 1EXQA 3EN9A 4CCHA 3AVIA 2GWKA 3LPUA 4JI8K 1IG8A 3MEGA 3DOKA 4DLEA 4HUEA 1YTUA 3CCQN 5HBMA 3DWLA 1NK6A 4K25A 1W97L 2P9PA 3M6GA 1LWFA 3H45C 3HSTB 3VTHA 3CCRN 3K9KA 4O5BA 1X9JA 1XNRK 4LF8K 4BR9A 4IOAL 1WAJA 4EP5A 4O8UA 2J4RA 2A40A 4M3TA 4ICLA 4KBOA 1YAGA 3PX4A 1UWBA 4H4MA 2VWJA 2DY4A 5AQKA 3OYBA 4N47A 1FK9A 2CH6A 3CC4N 2QM1A 3FZHA 3QDKA 4FW2A 1RT6A 5GAGP 4WFBL 3K5NA 5AQUA 4JI7K 4KH5A 5AFUA 2VGNA 3MN5A 1SQKA 3OYKA 2IAJA 4CEAA 3BP8A 3TARA 4NXMK 1JKHA 3HO1A 3O9RA 1KFSA 3FZFA 5M1NA 4HTUA 3TAPA 3HT3A 2GBZA 3MXMA 1I39A 2G8UA 4BC4A 4FO0A 4CHZA 2I7NA 1U04A 5D3GA 1XMQK 4GW6A 3NCIA 4IZ9A 5AR0A 3ZLJA 4F9OA 1J5EK 3CQ8A 2YNIA 2F96A 3SCXA 3WXKA 4OLAA 1NOZA 1HYSA 1LAVA 4GV3A 4CHQA 3W3DA 4OVLA 4QCLA 1WBDA 5KRSA 4YY3K 4DLGA 1J54A 5KTQA 4KAZA 2FXUA 4BVOA 5EOYA 3U9DA 3ZSWA 5FRMA 2NRRA 3SUOA 2VWKA 4Z4GA 1DLOA 2FSNA 3D45A 4M3XA 1U49A 1QQCA 1BI4A 3M8SA 1DT9A 2DTUA 2YHAA 1RDWX 3LL3A 4FWOA 3CCMN 1IBMK 4KHYA 4FJHA 2E2NA 4FM2A 1WN7A 4DTSA 3OY9A 2QI2A 4M3RA 3SUNA 3QEVA 3AVLA 1KAZA 2XY6A 4R5PA 3AY9A 2P9SA 4QAGA 2QW9A 3R9PA 3C95A 3EE8A 4IO8A 3VGKA 3T1AA 3F5TA 4JRQA 3BF3A 1K8KA 3I0SA 4RW6A 3UKUA 1TV6A 4XEIA 5C2FA 1LCUA 3NF9A 4N5SA 1ITGA 1JCFA 2Q2RA 1W7AA 3V9ZA 1Z25A 3P5JA 4YNQA 3RVCA 4FPBA 2HOEA 5FPMA 5AZIB 4CBXA 1U2VA 5BR8K 4O4GA 1L3SA 3VPZA 4CZEA 1Z6RA 3QETA 2JGUA 3CXCM 1BWFO 3LWMA 1KLNA 1P90A 4FWRA 1NKEA 4CK1A 2Y1IA 3WXLA 4IBNA 3QB0A 3QEPA 4Z4EA 4WFNL 5AQNA 4CFCA 1I94K 2FBYA 3SPZA 3SQ0A 4AM6A 4OO1J 4CZKA 3K57A 1ATNA 1SUQA 2NNWA 1SKRA 1HJRA 4HTLA 3DLEA 4IXCA 4DV4K 5M1KA 2RN2A 2ASOA 1S9EA 4CJVA 4E1MA 3EE9A 4CGHA 3GG4A 1NGIA 1GLLO 4B8CA 4DWIA 1HPZA 3ZSQA 3CQXA 1KAXA 3I33A 3MMVA 4JKGA 4XH4A 2AP1A 2O4IA 3M8QA 5BPNA 3KLEA 3CIPA 1Q8IA 1QQNA 5AQLA 4FWSA 3HSCA 3BUZB 3RSEA 2X74A 4JI1K 3CJCA 2NRZA 3RMCA 1IV0A 2O8EB 1OH7A 4FXDA 5ADXH 2Q31A 1XWLA 4CFDA 2Q1NA 2QXFA 4JRPA 3C94A 4K41A 1VHXA 3BEXA 1NGDA 5HP1A 2FLOA 1JCGA 3DRSA 4HUFA 1S3XA 4BR5A 1ZBFA 1VSMA 3LDOA 3QFPA 5ELZA 3ENOA 4CEFA 3ENBA 4E7HA 1HKCA 4N56A 1NKBA 3L3VA 1D9FA 1SV5A 4H0XB 4KTQA 1TK8A 3NMUA 5FROA 1HYVA 4NLCA 1HUXA 5FRNA 3MXJA 3CM6A 3I55N 4LC9B 1BU6O 4DV0K 4V19S 2DFEA 4E1JA 5CR4A 4E7IA 4B1ZA 3LALA 1EO1A 2KFNA 3BDPA 1EKEA 3B6OA 4CI6A 4PWDA 1HKGA 2FC0A 5AZJB 2FF6A 4MLEA 1RT4A 1HR0K 3P1GA 1W9HA 5GAEP 4CD1A 4DG1A 4DTMA 4Z0UA 2QEXN 2HVIA 5K14A 3QIOA 4CHPA 3ZSXA 2YV0X 3M8RA 2IOCA 3NFAA 1T6DA 3LZJA 4PKGA 4A61A 1SS6A 3MWPA 4AHUA 4NYNA 4PKIA 4JK8A 3HI0A 2G8IA 4H0TB 4DFPA 2A1SA 2HHTA 3ZX0A 1BIZA 4FJ5A 4DFKA 3AA5X 3V9SA 3VGMA 3J80O 4JNEA 2ZGZA 2G8WA 2GUPA 4B9NA 4B9TA 1C6VA 1NK8A 4FM1A 3PSIA 4CZGA 3UIQA 3EO3A 1UAXA 1ZBSA 3C6HA 2UUAK 3N4PA 4KHPK 2YKMA 4RCHA 2A41A 3TI0A 4BGBA 4DU4A 4Q5VA 3CM5A 2W42A 4BQLA 2W6KA 3P83D 3WNHA 4CZJA 2YNGA 4KFBA 3KKSA 2D0PA 3VEWA 3MN6A 5EXWA 4DFJA 2P9KB 1QQMA 4IJAA 1HNVA 2A1RA 3VGLA 2AJQA 2VG7A 5LMNK 4E7KA 1JJ2M 4FLUA 3VN5A 4EIAA 2Z1GA 5LJWA 4M3WA 2W6LA 4JI5K 3EYZA 4CK3A 4C1NI 3N4QA 4CHNA 4PL7A 3WQUA 1NJZA 4BR7A 2F9TA 1R59O 2X6NA 1OH5A 4AILC 4OKEA 1VQ5N 4PUOA 1T3VA 2E1ZA 4H4OA 1TVRA 1WOQA 2QWMA 5IT9O 5AQRA 3NDKA 4FJNA 5AZIA 4CF2A 4UQGA 4BE0A 3D2FB 3FFKB 3MX5A 1TYQB 1OVYA 1NGAA 2V7ZA 3AVNA 5AQIA 4E3SA 3CJ7A 4JI4K 1JLEA 1BUPA 3SV3A 4X62K 4CFAA 2KFZA 2KW4A 3H08A 2O8FB 2Q97A 3AAQA 4JI0K 4H0YB 1YVUA 4MDAA 3K0SA 1BDGA 1OH8A 4HCBA 3NVKA 1X9WA 2E1YA 2IGIA 3BZKA 4LF5K 3MX2A 1DTTA 1HNWK 5KPRA 4UY8O 3QEWA 4CJEA 3AGKA 1K9MO 2NRWA 2Q0RA 3ZT4A 1YI2N 1N33K 3AGRA 1HYZA 1S9GA 3VQ5A 1RT5A 2V7YA 3F9MA 4CGJA 4A5AA 3JYTA 3L2RA 4CJ7A 3OYCA 4FJ8A 5SWMA 3D2EB 3OW2M 1BCMA 3VEXA 1QE1A 4LSLA 4M45A 4H0OA 2ZF5O 4KV8A 5JVHL 1HPMA 3VF6A 3DLGA 3TAEA 3LP0A 2O8EA 1X9MA 4ISEA 5AQPA 3ZT3A 4AM7A 4DS4A 2HB5A 2YHBA 2RPIA 2NZTA 2HHXA 3WXIA 1VQKN 4LFCK 1BHLA 4BE1A 1QVGM 2OZMA 4ZTJA 4J8FA 4BRIA 2IS3A 3S41A 3MCPA 4DQ8A 2HBJA 2I7PA 3OYFA 4FK2A 3RR7A 1A5XA 4LH4A 3C7NB 3KD1E 4DV3K 1X3MA 3UKUB 3NVMA 3CD6N 1IJJA 4B08A 1BA0A 4O55A 3PSFA 3VQDA 2ZQBA 2UYTA 1LWCA 1ASWA 3O80A 3VTIA 2VQEK 4F2RA 1GOAA 1Q7YO 3SMSA 4BRLA 4CJKA 4W5TA 4IWVA 3R8EA 2GUIA 4ID5A 1E3MA 5HRPA 4I6MB 4W5NA 4CERA 4KB1A 1XNQK 5AZJA 3D6RA 4DFMA 3ZSZA 2FSJA 3NH1A 3MXIA 2VG5A 4BDYA 3SNNA 2ZJPL 1XMOK 4I7FA 1S1UA 5C2DA 2BDPA 1SKWA 3ZYYX 2H3GX 4BWMA 5BPMA 1T8EA 2G8VA 3TTCA 1J5OA 1Q9XA 5KQDA 2HHSA 4FSVA 1T6CA 4JKCA 2HHHK 1ZXOA 4CK2A 1VQ7N 3M1FA 1VQ8N 3EZ5A 4IO9L 3VEOA 3QERA 1SAZA 1EWQA 4CF1A 1LAWA 4GV9A 2UUCK 3VMFB 3WQTA 1KXPA 5BRFA 1HNXK 3VQEA 2GWJA 4M41A 4BQZA 5FPEA 4IEIA 3BY5A 1RTHA 3ULEB 2RHKA 1RFQA 1QHAA 4FLWA 2HBKA 4OPJA 1NGCA 3ID8A 3KD5E 5AQVA 1RT2A 3G0ZA 1MU2A 3TAGA 1HQEA 3CCJN 5M1PA 1GLCG 4KHQA 4IDKA 2HMPA 2IC3A 2KTQA 3AA3A 2OPSA 5KPZA 5J2QA 4G9ZA 5JS1A 5JICA 5C24A 1YXQA 5C25A 4QS8A 3VQQA 4BRNA 5LL6Z 1SKSA 4JKAA 4RW8A 2P9KA 1IKYA 1M90O 3F2KA 1B9FA 3A2FA 3DLHA 3VESA 3IFRA 2CGKA 1VSLA 4PA1A 5B8HA 1U6ZA 4JN4A 5AQMA 1IH7A 4GKKK 1S1VA 3FLCO 4EAHD 2E6MA 1WLJA 4JKBA 3CFRA 2E88A 4FWPA 5KGWA 1XC9A 3THWB 3JAMO 4F4KA 3SBTA 4E7LA 2BUPA 1N36K 1C0FA 1TAQA 2P9NB 2Z1JA 4DR1K 1D8YA 1YTAA 4KHUA 1F21A 1J6ZA 4X66K 4A2BA 1SZ2A 2NLXA 4DQSA 3D2FA 2CGJA 4JV5K 1TYQA 2HF4A 5I42A 5AQZA 3MAQA 4B9MA 4JKEA 4GNIA 1JCEA 1U48A 4IDHA 4FJGA 1QS4A 2Q0UA 3LDPA 3HVRA 1Z05A 2IVPA 3VQ4A 1VSEA 1UOCA 3AA4A 3QBWA 5CYMA 2O8FA 4CJ5A 1NMNA 3MN7A 3S3OA 1MWKA 4CJPA 4M3YA 4K42A 3KWGA 3K58A 3A5NC 1VQMN 1RT3A 3O3HA 2BANA 1S5JA 3HM8A 3KK2A 4CEEA 3V1QA 3KKRA 2HBLA 1TKZA 3QICA 4FW1A 4BG9A 1V4SA 2EHGA 4AHVA 1WUAA 2HVHA 2RKIA 3SUPA 2UU9K 2ATQA 1CLQA 3CC2N 4JI6K 3NH0A 2ZJQL 4K0KK 2E8AA 3D0PA 3P39A 3D2EA 5C42A 3TAFA 3THVA 1KD1O 1N32K 3NGZA 3L2VA 1LW2A 1Z26A 2OZSA 3DRRA 4NLBA 4H8KA 2ASPA 2P9IB 4L8RB 3O4QA 5GAHP 4LH5A 4EZ6A 3SPYA 5AQOA 3SYZA 1RBSA 4CJ3A 4A5BA 3ZX3A 4WYBA 4DS5A 1C1BA 2DFFA 3AO4A 4TSXA 2O4GA 2YX6A 2ZGYA 4OPAA 1T05A 4AQYK 3C7NA 4MFBA 2FBVA 4E0DA 4J2DA 4DUZK 1LV5A 4RW4A 4YOTA 3O3FA 3KLGA 3PX0A 4FWKA 4B9UA 4WQ5A 3CETA 5JS2A 5BN8A 3SK3A 2P9UA 4CZHA 5E26A 4CEZA 1RCHA 4BACA 1EQYA 1JLAA 2ITMA 4H5TA 3QBXA 4I6MA 2OYQA 4DSKA 2E4LA 1X3NA 3KLFA 4BDZA 4Z4FA 2E20A 4DQQA 1QSLA 3L2QA 3QNOA 5JVGL 2D0AA 3J7AP 1WSIA 4WQ4A 1E4FT 5JLFA 3JXUA 5AQJA 3FR0A 4C8NA 2IVOA 2Z1IA 3AVKA 4JI3K 3DLBA 2QWQA 3QEXA 3CPWM 2BE2A 3H3NO 4B1UB 1HX1A 3DXKB 1UA0A 3OTOK 2B4JA 3LDSA 3KK7A 4B9VA 1VRUA 4CFBA 3PLAA 1TL3A 1X1PA 4XIUA 2WBNA 1VQ4N 4BY9C 1VQNN 4OPKA 4QS9A 1REVA 2QWNA 4BG8A 3E1YA 4CEDA 2ZM6K 4WF9L 4BGAA 3O4WA 3ID6A 3BF1A 3ZT0A 1CZ9A 4Y0WA 3D7EO 4DTPA 3VQCA 1U47A 2VG6A 4AHSA 3RTVA 2QKKA 2W40A 3V1RA 4DSIA 3CPEA 5I3UA 3ULEA 1Q86O 2GTDA 1DEJA 1IKXA 1QSYA 5LY3A 4M3ZA 3OYNA 3V6DA 4IOXA 3HP6A 4KHSA 1WSJA 5C12A 4RW9A 2G8HA 3U3YA 4Z94A 4NYFA 3GOIA 4JAXA 3U4LA 4K8ZA 3LAKA 2WOMA 4LFBK 4DR3K 1JL2A 3O9TA 2HNYA 2YJFA 4W5OA 2VWBA 3H6EA 4IJNA 4WFAL 5TKWA 3U3GA 2G8KA 4KI6A 1TL1A 4F8RA 1QHTA 1HRHA 4RW7A 3OYEA 1KSPA 3R3LA 2D0CA 1KCFA 3MECA 4YOXA 5BRHA 3OBYA 1NK9A 1RDBA 1JLFA 3C6UA 2WUSA 2FSKA 4H0PA 5KI6A 5AQSA 3AO1A 4CIEA 1K8AO 2WC9A 1O1WA 3U8XA 3QO9A 1NGJA 3BZCA 4DV1K 3C65A 3THWA 3CHWA 4CZLA 4B3MK 1NNEA 3LP2A 1S1WA 1HNZK 4FK0A 3QINA 4ILJA 2P9NA 2XY8A 5FDLA 1TKTA 4C23A 1IBLK 3SV4A 5DM6L 4B1WB 1FJGK 1LOTB 2YJEA 3H1VX 3KWIA 3WNGA 4CBWA 4K8XA 2FBXA 2UXCK 1CZBA 1NG9A 2PBDA 5F0XA 4LY7A 2WTUA 4J2BA 3SAFA 3H3OB 3EL2A 5EX5A 1NGEA 1VQPN 2GV9A 3LP1A 1D9DA
chains in the Genus database with same CATH topology
4OLBA 4LSLA 4M45A 3PY8A 1WAJA 2YNHA 4EP5A 4KI4A 4KV8A 4PY5A 1QSSA 4M3TA 5HRRA 4ICLA 4FVMA 2P5OA 3DLGA 3PX4A 1UWBA 3L3UA 3TAEA 3LP0A 2XO7A 4FZYA 4EP4A 4H4MA 4KKOA 2VWJA 1X9MA 2DY4A 3OYBA 3ZT3A 1RDAA 4N47A 3OJUA 1FK9A 5CYQA 4FLZA 3VQ7A 3SQ1A 4DTJA 4DS4A 2HB5A 2YHBA 2RPIA 4FW2A 2HHXA 1RT6A 1C1CA 4FLXA 1BHLA 4BE1A 3K5NA 4BE2A 3VQAA 4CIFA 4ZTJA 4CESA 2OZMA 1TKXA 4ELTA 3NF8A 3I0RA 3KLIA 2IS3A 3CG7A 2NUBA 4DU1A 3OYFA 4FK2A 3RR7A 1A5XA 3OYKA 2IAJA 4LH4A 4CEAA 3NE6A 3TARA 3KD1E 4ELUA 1HNIA 1JKHA 1KLMA 3MEDA 3O3GA 3HO1A 2YKNA 3QIPA 1KFSA 2EX3A 1NK0A 4GMJB 4AHTA 1J9AA 4B08A 4KREA 1SL2A 1I3AA 4HTUA 4JLHA 4O55A 1IO2A 1RTJA 5J2MA 3NHGA 4CEOA 3TAPA 3VQDA 3HT3A 3ASMA 2GBZA 3MXMA 4J2EA 2ZQBA 4NCBA 1I39A 1LWCA 1ASWA 3HM9A 2G8UA 3TABA 3HL8A 4FK4A 4B3OA 1IG9A 1JLBA 4O0JA 4F2RA 1TGOA 1GOAA 4CHZA 1U04A 4OGEA 1L3TA 3OYHA 5D3GA 1BIUA 4CJKA 3ZCMA 3VQBA 4E89A 4IG0A 4W5TA 4FLVA 4GW6A 2GUIA 3NCIA 4ID5A 2ZE2A 5HRPA 2B6AA 3HP9A 4W5NA 3ITHA 4CERA 4AHCA 4KB1A 2F8SA 1SL0A 3CQ8A 2YNIA 2F96A 4DFMA 3SCXA 3S9HA 3ZSZA 4C8LA 4OLAA 3DLKA 3NH1A 1NOZA 4LD0A 4I2QA 4Z4HA 3MXIA 4FJLA 1HYSA 1LAVA 2VG5A 3HK2A 4BDYA 3SNNA 2XY7A 3KK3A 4CHQA 4CEBA 3VQ6A 4OVLA 3L8BA 4QCLA 2D5RA 4I7FA 3OVNA 4RG8A 5KRSA 1S1UA 4DLGA 1VSHA 1J54A 4CGGA 5KTQA 1SKWA 2BDPA 3DLRA 4KAZA 4DQIA 4BWMA 4MQ3A 1T8EA 2G8VA 4FJ7A 3ZSWA 5FRMA 1J5OA 3RWUA 1XI1A 1KVBA 2VWKA 3L2WA 3SUOA 4Z4GA 5DK5A 1Q9XA 1DLOA 2HHSA 3D45A 4M3XA 4FLTA 3KK1A 4CK2A 4FYDA 3IRXA 1RT1A 1GOBA 1U49A 3EZ5A 3ALYA 1CXQA 1QQCA 1EP4A 3G10A 4FCYA 1BI4A 3M8SA 3QERA 1R0AA 2OPRA 2DTUA 2X6SA 3OYMA 2YHAA 3VA0A 3OYIA 4CF1A 1LAWA 4CIGA 3IAYA 4KHYA 4FJHA 5HRNA 4DF8A 3VQEA 4M41A 4FM2A 3CYMA 2XY5A 1WN7A 4DTXA 4DTSA 3OY9A 3EY1A 3RMAA 2KQ2A 1RTHA 4IG3A 4M3RA 3TAMA 3SUNA 3LZIA 4OGCA 3AVLA 4FLWA 3QEVA 4I9QA 1W0HA 4OPJA 1FKOA 2Q3SA 4I9LA 2XY6A 1K6YA 4R5PA 3KD5E 3SJJA 1NKCA 1KVCA 2HW3A 2HHVA 1RT2A 4NCAA 3G0ZA 1MU2A 3TAGA 1S1XA 1HQEA 1A5VA 4Z4IA 1JLQA 4QAGA 3C95A 4KHQA 4IDKA 1T03A 5J2PA 3OYDA 4DTOA 4W5RA 1VSDA 3DI6A 1WSFA 2IC3A 3TR8A 3T1AA 3F73A 2BGGA 2KTQA 4JRQA 3AA3A 2OPSA 2KZZA 5J2QA 4DTRA 3I0SA 4RW6A 5JS1A 1TV6A 2D0BA 4HHTA 2HHWA 3LP3A 4CJRA 3NF9A 4N5SA 1ITGA 5C24A 1Y97A 5C25A 3VQQA 3AVAA 5KRTA 1ZBLA 1SKSA 3V9ZA 1Z25A 5KGXA 3P5JA 4RW8A 1IKYA 1C0MA 4YNQA 4JS5A 1ZBUA 4O0IA 4KO0A 4DTUA 4FJIA 1B9FA 1RBTA 3A2FA 3DLHA 1VK0A 3IS9A 1JXEA 3S3NA 4O4GA 1VSLA 1L3SA 4PA1A 3MEEA 3RRGA 3OYJA 1B9DA 3QETA 3OYLA 2JGUA 1U4BA 2P5GA 3LWMA 1KLNA 4BWJA 1IH7A 1NOYA 3ULDA 1S1VA 2ETJA 4CHOA 4F3TA 1WSEA 1NKEA 1XHZA 4AH9A 4CK1A 1Q9YA 2E6MA 3AVBA 1WLJA 4IFYA 2Y1IA 4IBNA 4FM0A 1RT7A 1RBRA 3CFRA 3QEPA 3V1OA 5KGWA 4Z4EA 1XC9A 4KTWA 3S3MA 4F4KA 4HCCA 4CFCA 2JLEA 3AA2A 1VSFA 3B6PA 2FBYA 4E7LA 3KJVA 3SPZA 3SQ0A 1TAQA 2Z1JA 1D8YA 1YTAA 4KHUA 1F21A 4FJXA 4CHYA 1RBVA 3NF7A 3K57A 4DQSA 1BCOA 3OJSA 1SUQA 3JSMA 1XHXA 1JLCA 1CXUA 2ITGA 1SKRA 1HJRA 1WSHA 4Z4CA 3DLEA 3K5LA 1N5YA 4DSLA 3AV9A 4CJFA 2RN2A 3NH2A 5I42A 3MAQA 5HRSA 4B9MA 1S9EA 3OS0A 4CJVA 4E1MA 2KZMA 3DRPA 4CGHA 3V9UA 1U48A 1TAUA 4FJGA 4B8CA 4DWIA 1QS4A 3HVRA 1EX4A 4CJUA 1WSGA 1HPZA 1S6PA 3VQ4A 3VQ8A 1VSEA 3ZSQA 1UOCA 3AA4A 4CF0A 1UA1A 5CYMA 2I5JA 4CJ5A 4WE1A 3VA3A 3S3OA 2O4IA 3M8QA 4ID1A 4CJPA 3KLEA 4M3YA 3M8PA 1Q8IA 3K58A 4DSEA 1RT3A 2R7YA 4N76A 3O3HA 4W5QA 3LPTA 4FJKA 3E01A 2BANA 1S5JA 1FXXA 2X74A 3KK2A 4CEEA 4NCGA 3V1QA 3RMCA 2HNDA 3KKRA 4CGFA 1TKZA 3CFOA 4FW1A 2EHGA 1L3UA 4FXDA 3BGRA 4AHVA 4F2SA 4CFDA 1XWLA 1NJWA 2PY5A 4I2PA 1L5UA 2RKIA 2HVHA 2HHQA 2QXFA 3IG1A 4JRPA 3C94A 4F3OA 1D5AA 3SUPA 2ATQA 5HP1A 3SI6A 3C6TA 4DU3A 1CLQA 3HYFA 4B9SA 3DRSA 3NH0A 4HUFA 3AVHA 1DTQA 1ZBFA 1IKVA 1VSMA 3KIOA 4KTZA 3HVTA 2PZSA 1ASUA 4N41A 3K5OA 3D0PA 4ZHRA 2HHUA 3QEIA 4KHWA 4CEFA 5C42A 3TAFA 3THVA 4E7HA 4N56A 3NGZA 3L3VA 4CE9A 3L2VA 1LW2A 4DQRA 3ZSVA 1Z26A 3O4NA 1NKBA 2OZSA 3PUFA 4OJRA 1N6QA 1SV5A 4KTQA 1TK8A 3DRRA 3V4IA 5FROA 1HYVA 1KFDA 4H8KA 5J1EA 3SZ2A 1L3VA 4B9LA 4L8RB 1B92A 3O4QA 4B8AB 4LH5A 4ELVA 5FRNA 4EZ6A 4CECA 3SPYA 3SYZA 3K59A 3FFIA 1RBSA 2G8FA 3MXJA 3CM6A 4CJ3A 4DSFA 2DFEA 3OYAA 1S6QA 3OS1A 4E7IA 4DS5A 5DMRA 1C1BA 2DFFA 3AO4A 3LALA 1KRPA 4KRFA 2KFNA 2PYLA 1T7PA 1EKEA 3B6OA 3BDPA 1TK5A 4PWDA 4TSXA 2FC0A 2O4GA 4GVMA 1NK5A 5CY4A 1T05A 4E7JA 2QKBA 1ZBIA 3AVFA 4FZXC 3AVCA 1RT4A 4MFBA 2FBVA 3PO4A 4CJ4A 3LAMA 4E0DA 4J2DA 3P1GA 1W9HA 3T3FA 4C8MA 1LV5A 2P51A 4RW4A 3O3FA 3KLGA 2YNFA 4DG1A 4CGIA 3PX0A 4DTMA 4Z0UA 4B9UA 2HVIA 5JS2A 3V9XA 1GOCA 2KFZA 5K14A 3HXMA 3QIOA 4CHPA 3ZSXA 2YV0X 3PX6A 4CEZA 1RCHA 3K2PA 3M8RA 2IOCA 3NFAA 5EU7A 4BACA 2PYJA 4DF4A 1BL3A 3OS2A 1JLAA 1RTDA 3LZJA 1JLGA 2OYQA 2WONA 1YT3A 2E4LA 4NYNA 3ZSRA 4AHUA 1BI4B 4OKJA 4CJTA 4E19A 5SZTA 3KLFA 4HUGA 4BDZA 4Z4FA 4DQQA 3DOLA 2G8IA 4KB0A 1QSLA 4O44A 3L2QA 2XHBA 4DFPA 3QNOA 4Q0BA 2A1SA 3KTQA 2D0AA 2HHTA 1WSIA 1WAFA 4E1NA 1C1AA 1BIZA 4C8NA 3SUQA 1JL1A 4FJ5A 2Z1IA 3SQ2A 3ZT2A 3AVKA 4DFKA 4DQPA 2LSNA 3AA5X 3DLBA 3V9SA 1IKWA 3QEXA 3WNEA 1KVAA 2B5JA 2G8WA 3AO5A 2BE2A 5CZ2A 4B9NA 3HJFA 4B9TA 1C6VA 1UA0A 1NK8A 1BQNA 1LW0A 3HPHA 2HMIA 4FM1A 1BGXT 2IDOA 1JXBA 2B4JA 2DFHA 4YFUA 3LDSA 2OA8A 4B9VA 3UIQA 1VRUA 1ZBHA 5HLFA 4CFBA 1G15A 4KHNA 1UAXA 1TL3A 1X1PA 4XIUA 3PO5A 4OPKA 1D9FA 1NJYA 5CZ1A 1REVA 1VSJA 2YKMA 1RBUA 4CEDA 4G1QA 3NAEA 1C0UA 3TAQA 4CGDA 4OKKA 3TANA 1C0TA 3TI0A 4DU4A 3ZT0A 1CZ9A 4DTPA 3VQCA 1NK4A 4Q5VA 3CM5A 2W42A 5HROA 2VG6A 1U47A 3P83D 1RDCA 4CJLA 1HMVA 1VSIA 3WNHA 3ZSYA 4AHSA 3RTVA 2QKKA 3NGIA 2YNGA 3NGYA 4KFBA 3V1RA 3KKSA 4DSIA 3ZSOA 5I3UA 3QLHA 1NK7A 2E6LA 3K5MA 1IKXA 1QSYA 2OPQA 4DFJA 4Y1CA 4EZ9A 4IFVA 1HNVA 4CF9A 4CEQA 3RMBA 2A1RA 3ISNC 4M3ZA 3OYNA 3V6DA 2AJQA 3HP6A 2VG7A 4FLYA 4KHSA 3T19A 1WSJA 2QK9A 3WNFA 4E7KA 3RRHA 1TK0A 4IKFA 4RW9A 3AVMA 2G8HA 3U3YA 4FLUA 3VN5A 4PQUA 2Y1JA 4NYFA 2Z1GA 4M3WA 3SQ4A 4DSJA 4K8ZA 4M3UA 1LWEA 3VQPA 3NBPA 3TWHA 5T7BA 3LAKA 3EYZA 4CK3A 2WOMA 3ZT1A 1JL2A 1RILA 1S1TA 2HNYA 4CHNA 4M42A 3U6FA 3DYAA 3VQ9A 1NJZA 4W5OA 1J53A 3NF6A 1U45A 2G8KA 3U3GA 4BDPA 4KI6A 1RTIA 2X6NA 4CJQA 3CFPA 1TL1A 4FZZA 4F8RA 4AILC 1KTQA 1QHTA 2OPPA 4OKEA 1HRHA 3V9WA 1BISA 1QTMA 4PUOA 4RW7A 3OYEA 4FJMA 5J2NA 3V81A 3LANA 4H4OA 4CF8A 1KSPA 1TVRA 2Z1HA 2ZD1A 2D0CA 1KCFA 3RR8A 3DM2A 2P1JA 1VRTA 3F9KA 3MECA 2HNZA 3HPGA 4DTNA 3NDKA 1SL1A 4FJNA 4CF2A 1RDDA 4UQGA 1RDBA 4BE0A 3PV8A 4HVJA 1X9SA 1NK9A 1JLFA 3OYGA 3I8DA 3C6UA 5KI6A 3AO1A 4AHRA 2RF2A 4CJSA 3LWLA 4CIEA 3AVNA 1A5WA 4E3SA 1TKDA 1JLEA 4LSNA 3SV3A 1O1WA 3QESA 1ASVA 4CFAA 3QO9A 4CJWA 2KW4A 1VSKA 3AVGA 3H08A 3L2UA 4J2AA 1FKPA 4C8KA 3RMDA 3AO2A 2F8TA 1RNHA 5E41A 4QOZB 4ZTFA 1YVUA 1EETA 1S1WA 3AVJA 3LP2A 4DMNA 4JS4A 4FJJA 4FK0A 3AO3A 3QINA 1ZYQA 4HCBA 1NJXA 2XY8A 4Y1DA 5FDLA 1EXQA 4KPYA 3DMJA 1TKTA 1X9WA 4CCHA 2IGIA 2FBTA 3AVIA 3SV4A 1DTTA 3HPOA 3LPUA 3WNGA 3MEGA 3QEWA 4K8XA 3DOKA 4CJEA 4DLEA 4FJ9A 2FBXA 1HQUA 4HUEA 3QNNA 1CZBA 1YTUA 3ZT4A 1WNSA 5HBMA 1NK6A 4LY7A 1HYZA 1S9GA 1LWFA 1BQMA 3VQ5A 1RT5A 4J2BA 3HSTB 4DSKA 4CGJA 3JYTA 3L2RA 2GV9A 3OYCA 4O5BA 4FJ8A 2XRIA 5SWMA 2X78A 3KLHA 1BCMA 3LP1A 1QE1A 4C8OA 1D9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLB A;  4LSL A;  4M45 A;  3PY8 A;  1WAJ A;  2YNH A;  4EP5 A;  4KI4 A;  4KV8 A;  4PY5 A;  1QSS A;  4M3T A;  5HRR A;  4ICL A;  4FVM A;  2P5O A;  3DLG A;  3PX4 A;  1UWB A;  3L3U A;  3TAE A;  3LP0 A;  2XO7 A;  4FZY A;  4EP4 A;  4H4M A;  4KKO A;  2VWJ A;  1X9M A;  2DY4 A;  3OYB A;  3ZT3 A;  1RDA A;  4N47 A;  3OJU A;  1FK9 A;  5CYQ A;  4FLZ A;  3VQ7 A;  3SQ1 A;  4DTJ A;  4DS4 A;  2HB5 A;  2YHB A;  2RPI A;  4FW2 A;  2HHX A;  1RT6 A;  1C1C A;  4FLX A;  1BHL A;  4BE1 A;  3K5N A;  4BE2 A;  3VQA A;  4CIF A;  4ZTJ A;  4CES A;  2OZM A;  1TKX A;  4ELT A;  3NF8 A;  3I0R A;  3KLI A;  2IS3 A;  3CG7 A;  2NUB A;  4DU1 A;  3OYF A;  4FK2 A;  3RR7 A;  1A5X A;  3OYK A;  2IAJ A;  4LH4 A;  4CEA A;  3NE6 A;  3TAR A;  3KD1 E;  4ELU A;  1HNI A;  1JKH A;  1KLM A;  3MED A;  3O3G A;  3HO1 A;  2YKN A;  3QIP A;  1KFS A;  2EX3 A;  1NK0 A;  4GMJ B;  4AHT A;  1J9A A;  4B08 A;  4KRE A;  1SL2 A;  1I3A A;  4HTU A;  4JLH A;  4O55 A;  1IO2 A;  1RTJ A;  5J2M A;  3NHG A;  4CEO A;  3TAP A;  3VQD A;  3HT3 A;  3ASM A;  2GBZ A;  3MXM A;  4J2E A;  2ZQB A;  4NCB A;  1I39 A;  1LWC A;  1ASW A;  3HM9 A;  2G8U A;  3TAB A;  3HL8 A;  4FK4 A;  4B3O A;  1IG9 A;  1JLB A;  4O0J A;  4F2R A;  1TGO A;  1GOA A;  4CHZ A;  1U04 A;  4OGE A;  1L3T A;  3OYH A;  5D3G A;  1BIU A;  4CJK A;  3ZCM A;  3VQB A;  4E89 A;  4IG0 A;  4W5T A;  4FLV A;  4GW6 A;  2GUI A;  3NCI A;  4ID5 A;  2ZE2 A;  5HRP A;  2B6A A;  3HP9 A;  4W5N A;  3ITH A;  4CER A;  4AHC A;  4KB1 A;  2F8S A;  1SL0 A;  3CQ8 A;  2YNI A;  2F96 A;  4DFM A;  3SCX A;  3S9H A;  3ZSZ A;  4C8L A;  4OLA A;  3DLK A;  3NH1 A;  1NOZ A;  4LD0 A;  4I2Q A;  4Z4H A;  3MXI A;  4FJL A;  1HYS A;  1LAV A;  2VG5 A;  3HK2 A;  4BDY A;  3SNN A;  2XY7 A;  3KK3 A;  4CHQ A;  4CEB A;  3VQ6 A;  4OVL A;  3L8B A;  4QCL A;  2D5R A;  4I7F A;  3OVN A;  4RG8 A;  5KRS A;  1S1U A;  4DLG A;  1VSH A;  1J54 A;  4CGG A;  5KTQ A;  1SKW A;  2BDP A;  3DLR A;  4KAZ A;  4DQI A;  4BWM A;  4MQ3 A;  1T8E A;  2G8V A;  4FJ7 A;  3ZSW A;  5FRM A;  1J5O A;  3RWU A;  1XI1 A;  1KVB A;  2VWK A;  3L2W A;  3SUO A;  4Z4G A;  5DK5 A;  1Q9X A;  1DLO A;  2HHS A;  3D45 A;  4M3X A;  4FLT A;  3KK1 A;  4CK2 A;  4FYD A;  3IRX A;  1RT1 A;  1GOB A;  1U49 A;  3EZ5 A;  3ALY A;  1CXQ A;  1QQC A;  1EP4 A;  3G10 A;  4FCY A;  1BI4 A;  3M8S A;  3QER A;  1R0A A;  2OPR A;  2DTU A;  2X6S A;  3OYM A;  2YHA A;  3VA0 A;  3OYI A;  4CF1 A;  1LAW A;  4CIG A;  3IAY A;  4KHY A;  4FJH A;  5HRN A;  4DF8 A;  3VQE A;  4M41 A;  4FM2 A;  3CYM A;  2XY5 A;  1WN7 A;  4DTX A;  4DTS A;  3OY9 A;  3EY1 A;  3RMA A;  2KQ2 A;  1RTH A;  4IG3 A;  4M3R A;  3TAM A;  3SUN A;  3LZI A;  4OGC A;  3AVL A;  4FLW A;  3QEV A;  4I9Q A;  1W0H A;  4OPJ A;  1FKO A;  2Q3S A;  4I9L A;  2XY6 A;  1K6Y A;  4R5P A;  3KD5 E;  3SJJ A;  1NKC A;  1KVC A;  2HW3 A;  2HHV A;  1RT2 A;  4NCA A;  3G0Z A;  1MU2 A;  3TAG A;  1S1X A;  1HQE A;  1A5V A;  4Z4I A;  1JLQ A;  4QAG A;  3C95 A;  4KHQ A;  4IDK A;  1T03 A;  5J2P A;  3OYD A;  4DTO A;  4W5R A;  1VSD A;  3DI6 A;  1WSF A;  2IC3 A;  3TR8 A;  3T1A A;  3F73 A;  2BGG A;  2KTQ A;  4JRQ A;  3AA3 A;  2OPS A;  2KZZ A;  5J2Q A;  4DTR A;  3I0S A;  4RW6 A;  5JS1 A;  1TV6 A;  2D0B A;  4HHT A;  2HHW A;  3LP3 A;  4CJR A;  3NF9 A;  4N5S A;  1ITG A;  5C24 A;  1Y97 A;  5C25 A;  3VQQ A;  3AVA A;  5KRT A;  1ZBL A;  1SKS A;  3V9Z A;  1Z25 A;  5KGX A;  3P5J A;  4RW8 A;  1IKY A;  1C0M A;  4YNQ A;  4JS5 A;  1ZBU A;  4O0I A;  4KO0 A;  4DTU A;  4FJI A;  1B9F A;  1RBT A;  3A2F A;  3DLH A;  1VK0 A;  3IS9 A;  1JXE A;  3S3N A;  4O4G A;  1VSL A;  1L3S A;  4PA1 A;  3MEE A;  3RRG A;  3OYJ A;  1B9D A;  3QET A;  3OYL A;  2JGU A;  1U4B A;  2P5G A;  3LWM A;  1KLN A;  4BWJ A;  1IH7 A;  1NOY A;  3ULD A;  1S1V A;  2ETJ A;  4CHO A;  4F3T A;  1WSE A;  1NKE A;  1XHZ A;  4AH9 A;  4CK1 A;  1Q9Y A;  2E6M A;  3AVB A;  1WLJ A;  4IFY A;  2Y1I A;  4IBN A;  4FM0 A;  1RT7 A;  1RBR A;  3CFR A;  3QEP A;  3V1O A;  5KGW A;  4Z4E A;  1XC9 A;  4KTW A;  3S3M A;  4F4K A;  4HCC A;  4CFC A;  2JLE A;  3AA2 A;  1VSF A;  3B6P A;  2FBY A;  4E7L A;  3KJV A;  3SPZ A;  3SQ0 A;  1TAQ A;  2Z1J A;  1D8Y A;  1YTA A;  4KHU A;  1F21 A;  4FJX A;  4CHY A;  1RBV A;  3NF7 A;  3K57 A;  4DQS A;  1BCO A;  3OJS A;  1SUQ A;  3JSM A;  1XHX A;  1JLC A;  1CXU A;  2ITG A;  1SKR A;  1HJR A;  1WSH A;  4Z4C A;  3DLE A;  3K5L A;  1N5Y A;  4DSL A;  3AV9 A;  4CJF A;  2RN2 A;  3NH2 A;  5I42 A;  3MAQ A;  5HRS A;  4B9M A;  1S9E A;  3OS0 A;  4CJV A;  4E1M A;  2KZM A;  3DRP A;  4CGH A;  3V9U A;  1U48 A;  1TAU A;  4FJG A;  4B8C A;  4DWI A;  1QS4 A;  3HVR A;  1EX4 A;  4CJU A;  1WSG A;  1HPZ A;  1S6P A;  3VQ4 A;  3VQ8 A;  1VSE A;  3ZSQ A;  1UOC A;  3AA4 A;  4CF0 A;  1UA1 A;  5CYM A;  2I5J A;  4CJ5 A;  4WE1 A;  3VA3 A;  3S3O A;  2O4I A;  3M8Q A;  4ID1 A;  4CJP A;  3KLE A;  4M3Y A;  3M8P A;  1Q8I A;  3K58 A;  4DSE A;  1RT3 A;  2R7Y A;  4N76 A;  3O3H A;  4W5Q A;  3LPT A;  4FJK A;  3E01 A;  2BAN A;  1S5J A;  1FXX A;  2X74 A;  3KK2 A;  4CEE A;  4NCG A;  3V1Q A;  3RMC A;  2HND A;  3KKR A;  4CGF A;  1TKZ A;  3CFO A;  4FW1 A;  2EHG A;  1L3U A;  4FXD A;  3BGR A;  4AHV A;  4F2S A;  4CFD A;  1XWL A;  1NJW A;  2PY5 A;  4I2P A;  1L5U A;  2RKI A;  2HVH A;  2HHQ A;  2QXF A;  3IG1 A;  4JRP A;  3C94 A;  4F3O A;  1D5A A;  3SUP A;  2ATQ A;  5HP1 A;  3SI6 A;  3C6T A;  4DU3 A;  1CLQ A;  3HYF A;  4B9S A;  3DRS A;  3NH0 A;  4HUF A;  3AVH A;  1DTQ A;  1ZBF A;  1IKV A;  1VSM A;  3KIO A;  4KTZ A;  3HVT A;  2PZS A;  1ASU A;  4N41 A;  3K5O A;  3D0P A;  4ZHR A;  2HHU A;  3QEI A;  4KHW A;  4CEF A;  5C42 A;  3TAF A;  3THV A;  4E7H A;  4N56 A;  3NGZ A;  3L3V A;  4CE9 A;  3L2V A;  1LW2 A;  4DQR A;  3ZSV A;  1Z26 A;  3O4N A;  1NKB A;  2OZS A;  3PUF A;  4OJR A;  1N6Q A;  1SV5 A;  4KTQ A;  1TK8 A;  3DRR A;  3V4I A;  5FRO A;  1HYV A;  1KFD A;  4H8K A;  5J1E A;  3SZ2 A;  1L3V A;  4B9L A;  4L8R B;  1B92 A;  3O4Q A;  4B8A B;  4LH5 A;  4ELV A;  5FRN A;  4EZ6 A;  4CEC A;  3SPY A;  3SYZ A;  3K59 A;  3FFI A;  1RBS A;  2G8F A;  3MXJ A;  3CM6 A;  4CJ3 A;  4DSF A;  2DFE A;  3OYA A;  1S6Q A;  3OS1 A;  4E7I A;  4DS5 A;  5DMR A;  1C1B A;  2DFF A;  3AO4 A;  3LAL A;  1KRP A;  4KRF A;  2KFN A;  2PYL A;  1T7P A;  1EKE A;  3B6O A;  3BDP A;  1TK5 A;  4PWD A;  4TSX A;  2FC0 A;  2O4G A;  4GVM A;  1NK5 A;  5CY4 A;  1T05 A;  4E7J A;  2QKB A;  1ZBI A;  3AVF A;  4FZX C;  3AVC A;  1RT4 A;  4MFB A;  2FBV A;  3PO4 A;  4CJ4 A;  3LAM A;  4E0D A;  4J2D A;  3P1G A;  1W9H A;  3T3F A;  4C8M A;  1LV5 A;  2P51 A;  4RW4 A;  3O3F A;  3KLG A;  2YNF A;  4DG1 A;  4CGI A;  3PX0 A;  4DTM A;  4Z0U A;  4B9U A;  2HVI A;  5JS2 A;  3V9X A;  1GOC A;  2KFZ A;  5K14 A;  3HXM A;  3QIO A;  4CHP A;  3ZSX A;  2YV0 X;  3PX6 A;  4CEZ A;  1RCH A;  3K2P A;  3M8R A;  2IOC A;  3NFA A;  5EU7 A;  4BAC A;  2PYJ A;  4DF4 A;  1BL3 A;  3OS2 A;  1JLA A;  1RTD A;  3LZJ A;  1JLG A;  2OYQ A;  2WON A;  1YT3 A;  2E4L A;  4NYN A;  3ZSR A;  4AHU A;  1BI4 B;  4OKJ A;  4CJT A;  4E19 A;  5SZT A;  3KLF A;  4HUG A;  4BDZ A;  4Z4F A;  4DQQ A;  3DOL A;  2G8I A;  4KB0 A;  1QSL A;  4O44 A;  3L2Q A;  2XHB A;  4DFP A;  3QNO A;  4Q0B A;  2A1S A;  3KTQ A;  2D0A A;  2HHT A;  1WSI A;  1WAF A;  4E1N A;  1C1A A;  1BIZ A;  4C8N A;  3SUQ A;  1JL1 A;  4FJ5 A;  2Z1I A;  3SQ2 A;  3ZT2 A;  3AVK A;  4DFK A;  4DQP A;  2LSN A;  3AA5 X;  3DLB A;  3V9S A;  1IKW A;  3QEX A;  3WNE A;  1KVA A;  2B5J A;  2G8W A;  3AO5 A;  2BE2 A;  5CZ2 A;  4B9N A;  3HJF A;  4B9T A;  1C6V A;  1UA0 A;  1NK8 A;  1BQN A;  1LW0 A;  3HPH A;  2HMI A;  4FM1 A;  1BGX T;  2IDO A;  1JXB A;  2B4J A;  2DFH A;  4YFU A;  3LDS A;  2OA8 A;  4B9V A;  3UIQ A;  1VRU A;  1ZBH A;  5HLF A;  4CFB A;  1G15 A;  4KHN A;  1UAX A;  1TL3 A;  1X1P A;  4XIU A;  3PO5 A;  4OPK A;  1D9F A;  1NJY A;  5CZ1 A;  1REV A;  1VSJ A;  2YKM A;  1RBU A;  4CED A;  4G1Q A;  3NAE A;  1C0U A;  3TAQ A;  4CGD A;  4OKK A;  3TAN A;  1C0T A;  3TI0 A;  4DU4 A;  3ZT0 A;  1CZ9 A;  4DTP A;  3VQC A;  1NK4 A;  4Q5V A;  3CM5 A;  2W42 A;  5HRO A;  2VG6 A;  1U47 A;  3P83 D;  1RDC A;  4CJL A;  1HMV A;  1VSI A;  3WNH A;  3ZSY A;  4AHS A;  3RTV A;  2QKK A;  3NGI A;  2YNG A;  3NGY A;  4KFB A;  3V1R A;  3KKS A;  4DSI A;  3ZSO A;  5I3U A;  3QLH A;  1NK7 A;  2E6L A;  3K5M A;  1IKX A;  1QSY A;  2OPQ A;  4DFJ A;  4Y1C A;  4EZ9 A;  4IFV A;  1HNV A;  4CF9 A;  4CEQ A;  3RMB A;  2A1R A;  3ISN C;  4M3Z A;  3OYN A;  3V6D A;  2AJQ A;  3HP6 A;  2VG7 A;  4FLY A;  4KHS A;  3T19 A;  1WSJ A;  2QK9 A;  3WNF A;  4E7K A;  3RRH A;  1TK0 A;  4IKF A;  4RW9 A;  3AVM A;  2G8H A;  3U3Y A;  4FLU A;  3VN5 A;  4PQU A;  2Y1J A;  4NYF A;  2Z1G A;  4M3W A;  3SQ4 A;  4DSJ A;  4K8Z A;  4M3U A;  1LWE A;  3VQP A;  3NBP A;  3TWH A;  5T7B A;  3LAK A;  3EYZ A;  4CK3 A;  2WOM A;  3ZT1 A;  1JL2 A;  1RIL A;  1S1T A;  2HNY A;  4CHN A;  4M42 A;  3U6F A;  3DYA A;  3VQ9 A;  1NJZ A;  4W5O A;  1J53 A;  3NF6 A;  1U45 A;  2G8K A;  3U3G A;  4BDP A;  4KI6 A;  1RTI A;  2X6N A;  4CJQ A;  3CFP A;  1TL1 A;  4FZZ A;  4F8R A;  4AIL C;  1KTQ A;  1QHT A;  2OPP A;  4OKE A;  1HRH A;  3V9W A;  1BIS A;  1QTM A;  4PUO A;  4RW7 A;  3OYE A;  4FJM A;  5J2N A;  3V81 A;  3LAN A;  4H4O A;  4CF8 A;  1KSP A;  1TVR A;  2Z1H A;  2ZD1 A;  2D0C A;  1KCF A;  3RR8 A;  3DM2 A;  2P1J A;  1VRT A;  3F9K A;  3MEC A;  2HNZ A;  3HPG A;  4DTN A;  3NDK A;  1SL1 A;  4FJN A;  4CF2 A;  1RDD A;  4UQG A;  1RDB A;  4BE0 A;  3PV8 A;  4HVJ A;  1X9S A;  1NK9 A;  1JLF A;  3OYG A;  3I8D A;  3C6U A;  5KI6 A;  3AO1 A;  4AHR A;  2RF2 A;  4CJS A;  3LWL A;  4CIE A;  3AVN A;  1A5W A;  4E3S A;  1TKD A;  1JLE A;  4LSN A;  3SV3 A;  1O1W A;  3QES A;  1ASV A;  4CFA A;  3QO9 A;  4CJW A;  2KW4 A;  1VSK A;  3AVG A;  3H08 A;  3L2U A;  4J2A A;  1FKP A;  4C8K A;  3RMD A;  3AO2 A;  2F8T A;  1RNH A;  5E41 A;  4QOZ B;  4ZTF A;  1YVU A;  1EET A;  1S1W A;  3AVJ A;  3LP2 A;  4DMN A;  4JS4 A;  4FJJ A;  4FK0 A;  3AO3 A;  3QIN A;  1ZYQ A;  4HCB A;  1NJX A;  2XY8 A;  4Y1D A;  5FDL A;  1EXQ A;  4KPY A;  3DMJ A;  1TKT A;  1X9W A;  4CCH A;  2IGI A;  2FBT A;  3AVI A;  3SV4 A;  1DTT A;  3HPO A;  3LPU A;  3WNG A;  3MEG A;  3QEW A;  4K8X A;  3DOK A;  4CJE A;  4DLE A;  4FJ9 A;  2FBX A;  1HQU A;  4HUE A;  3QNN A;  1CZB A;  1YTU A;  3ZT4 A;  1WNS A;  5HBM A;  1NK6 A;  4LY7 A;  1HYZ A;  1S9G A;  1LWF A;  1BQM A;  3VQ5 A;  1RT5 A;  4J2B A;  3HST B;  4DSK A;  4CGJ A;  3JYT A;  3L2R A;  2GV9 A;  3OYC A;  4O5B A;  4FJ8 A;  2XRI A;  5SWM A;  2X78 A;  3KLH A;  1BCM A;  3LP1 A;  1QE1 A;  4C8O A;  1D9D A; 
#chains in the Genus database with same CATH topology
 4OLB A;  4CBU A;  4CZF A;  3PY8 A;  4KI4 A;  3GL1 A;  4PY5 A;  3R6M A;  1QSS A;  4FVM A;  1TUU A;  2P5O A;  3L3U A;  4YOU A;  4EP4 A;  3LM9 A;  4KKO A;  4BR0 A;  3OJU A;  3TSU A;  2GX9 A;  3B8A X;  3ZET B;  1GLF O;  1QVF M;  1C1C A;  4YOV A;  3HBT A;  4BE2 A;  1H1V A;  4CES A;  4JHD B;  4ELT A;  4DR4 K;  3I0R A;  4B3R K;  3G6E N;  4JKH A;  3CCU N;  2NUB A;  4DU1 A;  3L4I A;  1KC8 O;  4DCH A;  4ELU A;  2O8C B;  1KLM A;  3MED A;  2YKN A;  3QIP A;  4YOW A;  2EX3 A;  4JEP A;  1NK0 A;  5GIO A;  4JD2 B;  1I3A A;  1SL2 A;  2P9I A;  1RTJ A;  3O9Q A;  3WEE B;  4CEO A;  3NHG A;  3ASM A;  4GV6 A;  2A6A A;  4NCB A;  4B3O A;  3HM9 A;  3TAB A;  5F1X A;  4FK4 A;  1JLB A;  4O0J A;  3CMA N;  4OGE A;  1L3T A;  2WFB A;  1YJN N;  3LDQ A;  4IG0 A;  4FLV A;  4ISG A;  2IIR A;  4A59 A;  1BO5 O;  2B6A A;  3HP9 A;  1VQO N;  3ITH A;  5AFU H;  4AHC A;  4EHU A;  1SL0 A;  3THY B;  4BRH A;  3DLK A;  4GY2 B;  4Z4H A;  4QS7 A;  1YVN A;  3A8Y A;  3LM2 A;  4RWT A;  4CEB A;  5M1F A;  3KVG A;  3OVN A;  4RG8 A;  3UE5 A;  1VSH A;  5EY4 A;  5KQ8 A;  4DB3 A;  3DLR A;  1GLA G;  4DQI A;  3HOT A;  4DV2 K;  4FJ7 A;  3G4S N;  3EKS A;  3L2W A;  5DK5 A;  3CJA A;  3CJ1 A;  4FLT A;  3L6Q A;  1NWK A;  1GOB A;  1RT1 A;  3G10 A;  3O9U A;  3CF5 L;  4FCY A;  3J8A A;  2OPR A;  3T1Y K;  3SLC A;  4CIG A;  3IAY A;  5HRN A;  4YDU C;  5E84 A;  3CYM A;  2XY5 A;  4DTX A;  5GIN A;  2O8D B;  3MDQ A;  3IKM A;  2KQ2 A;  4IG3 A;  3VEZ A;  4OGC A;  1FKO A;  3DXK A;  3SJJ A;  2HW3 A;  1KVC A;  3DAW A;  1S1X A;  2GEM A;  4Z4I A;  1JLQ A;  3IMX A;  5GAD P;  5C0Y A;  1T03 A;  2PAV A;  1WSF A;  3P31 A;  4IFE A;  1GLJ O;  2KZZ A;  4ILH A;  5AQY A;  4HHT A;  4CJR A;  4NXN K;  3EZW A;  4BC2 A;  3AVA A;  5KRT A;  1ZBL A;  5KGX A;  4JS5 A;  4O0I A;  4KO0 A;  4FJI A;  3U9Z A;  1VK0 A;  3E9P A;  3IS9 A;  1JXE A;  3SJH A;  1OVQ A;  3FZM A;  4MLH A;  3OYJ A;  3OYL A;  1U4B A;  2P9L B;  3ULD A;  4CHO A;  1WSE A;  4AH9 A;  4FM0 A;  3EEQ A;  1RBR A;  3A0I X;  3V1O A;  2JLE A;  1VSF A;  3TU5 A;  4FJX A;  1D4X A;  3UKR B;  1RBV A;  2JWK A;  2OAN A;  1IBK K;  3OJS A;  4M63 C;  2VQF K;  3MN9 A;  5BN9 A;  4B1X B;  5ADX A;  1YUW A;  1CXU A;  1WSH A;  3K5L A;  2P9U B;  3AV9 A;  3NH2 A;  4DSL A;  4LFA K;  1O13 A;  2A3Z A;  4FOI A;  3V9U A;  1TAU A;  4OX9 K;  4BRA A;  4CJU A;  1WSG A;  1S6P A;  5BRE A;  2O8B B;  4CF0 A;  2I5J A;  3VA3 A;  4WE1 A;  4ID1 A;  5AQG A;  3M8P A;  5AQH A;  2BH1 A;  2D0O A;  3PIO L;  4N76 A;  4W5Q A;  3LPT A;  3PIP L;  4DR6 K;  3E01 A;  3O8M A;  3ATU A;  4NCG A;  4NO7 A;  2AA4 A;  5HOO A;  2EWS A;  4WQ5 C;  4F2S A;  1HJO A;  3SAG A;  1NJW A;  4BVP A;  4I2P A;  1L5U A;  2HHQ A;  2KLA A;  3IG1 A;  4F3O A;  1MWM A;  4JYA K;  1D5A A;  4DHY A;  1DKG D;  3SI6 A;  3C6T A;  3O5B A;  4DU3 A;  4BR2 A;  2Q36 A;  1S72 N;  4B9S A;  4LF4 K;  1Q81 O;  1DTQ A;  3KIO A;  1IKV A;  2PZS A;  4KTZ A;  3HVT A;  3K5O A;  1NM1 A;  4ZHR A;  2HHU A;  3H1Q A;  3SBG A;  3QEI A;  4KHW A;  4XH5 A;  3GE1 A;  4CE9 A;  3ZSV A;  4EHT A;  3PUF A;  4WQ4 C;  1N6Q A;  3V4I A;  4LF6 K;  1KFD A;  3SZ2 A;  5J1E A;  1ATR A;  2ASM A;  2IVN A;  3VEV A;  4JK7 A;  1S22 A;  3K59 A;  3FFI A;  1Y64 A;  3LDL A;  4DSF A;  3ZET A;  3OYA A;  1GLE G;  3OS1 A;  1RGI A;  2YHW A;  3VF2 A;  2E2O A;  1KRP A;  4JHD A;  2VCP A;  4CVN E;  5H1S Q;  3G25 A;  4KH6 A;  4WCE L;  3DLL L;  4GVM A;  5CY4 A;  5F2R A;  1ZBI A;  3AVF A;  1XQS C;  2O8C A;  4FZX C;  3PO4 A;  4CJ4 A;  3LAM A;  3T3F A;  4C8M A;  3LDN A;  2F7T A;  4JD2 A;  2YNF A;  3CJ9 A;  4CGI A;  3WEE A;  3TPQ A;  3V9X A;  1GOC A;  1MA9 B;  3PX6 A;  4DR5 K;  2NRT A;  4DF4 A;  1RTD A;  2HHV A;  3ZSR A;  4OKJ A;  3JS6 A;  4CJT A;  4E19 A;  3AAP A;  3E9O A;  4H5N A;  3J7Y P;  3IDH A;  3THY A;  4KB0 A;  4O44 A;  2UUB K;  3C0B A;  4BRP A;  3Q7B A;  4Q0B A;  3KTQ A;  4H03 B;  1WAF A;  3SUQ A;  3ZT2 A;  4L3Q A;  4YDU A;  2LSN A;  2A42 A;  5BR9 A;  1IKW A;  5I9E B;  4JK9 A;  1NGG A;  1BQN A;  3HPH A;  4BC3 A;  1JXB A;  4YFU A;  4CZI A;  2OA8 A;  2CH5 A;  5HLF A;  1NJY A;  5CZ1 A;  3TAN A;  1RBU A;  1C0U A;  5MLC Q;  4CGD A;  4OKK A;  3HOS A;  3TAQ A;  4M7Y A;  4BRD A;  5HRO A;  4CJL A;  1RDC A;  3NGY A;  2O8D A;  3ZSO A;  2E5L K;  1NK7 A;  3K5M A;  4EZ9 A;  3H46 O;  4IFV A;  4CF9 A;  4CEQ A;  3A5M C;  3E9L A;  4FLY A;  3T19 A;  3AAR A;  3WNF A;  1YJ9 N;  4M7X A;  4MO4 A;  4IKF A;  3AVM A;  2Y1J A;  4ILG B;  4M3U A;  1GLB G;  1LWE A;  3NBP A;  5T7B A;  3ZT1 A;  1Q18 A;  4BRG A;  2F9W A;  1P8Z A;  3VQ9 A;  1J53 A;  3NF6 A;  4BRK A;  1U45 A;  4CJQ A;  3CFP A;  3THX B;  3ENH A;  4FZZ A;  2QK9 A;  1KTQ A;  3FE1 A;  4FJM A;  1TUY A;  3V81 A;  3LAN A;  2E2P A;  4DR7 K;  2W41 A;  3RR8 A;  2P1J A;  2HNZ A;  3HPG A;  4DTN A;  3DXM B;  1SL1 A;  1RDD A;  1X9S A;  4H0V B;  2QXL A;  1YF5 L;  3OYG A;  4DV6 K;  1Q82 O;  2P9L A;  4AHR A;  2RF2 A;  2DPN A;  3LWL A;  4BRC A;  4CD3 A;  1A5W A;  5A2Q O;  1TKD A;  2HF3 A;  5KPT A;  3T69 A;  3QES A;  3CJB A;  3AVG A;  3OHR A;  3L2U A;  4BRF A;  4J2A A;  4C8K A;  3KZB A;  4OPH A;  3RMD A;  5CE3 A;  1V4T A;  1RNH A;  5E41 A;  2HBM A;  4ZTF A;  3O08 A;  4JS4 A;  3AVJ A;  4DMN A;  4FJJ A;  3AO3 A;  1ZYQ A;  4BRE A;  4Y1D A;  2YHY A;  3DMJ A;  3ZX2 A;  3UKR A;  4LF7 K;  2FBT A;  1NGF A;  2YI1 A;  3HPO A;  2A5X A;  4FJ9 A;  3E66 A;  3QNN A;  1HQU A;  4FWQ A;  1WNS A;  4FWN A;  1BQM A;  1VQL N;  3A5O C;  3CQY A;  3ATV A;  2O8B A;  1XUP O;  2XRI A;  3GDQ A;  1C0G A;  1ATS A;  2X78 A;  3KLH A;  4C8O A;  3TSP A;  2YNH A;  4FL9 A;  5HRR A;  4FZY A;  2XO7 A;  1HLU A;  1N8R O;  2PFU A;  1RDA A;  5CYQ A;  4FLZ A;  3O9S A;  3VQ7 A;  2UXB K;  3SQ1 A;  1RDU A;  4DV7 K;  4DTJ A;  5AQT A;  4FLX A;  1QZ5 A;  3VQA A;  4CIF A;  1TKX A;  5JMV A;  2E2Q A;  3NF8 A;  3G71 N;  3KLI A;  4FWM A;  5CHI A;  1K73 O;  3CG7 A;  1VAZ A;  2ZWH A;  4B1Y B;  3NE6 A;  1BA1 A;  1HNI A;  3O3G A;  5M1O A;  5BPL A;  3A5L C;  3MK6 A;  4GMJ B;  3T1H K;  4AHT A;  1J9A A;  4KRE A;  4JLH A;  1IO2 A;  5AQX A;  5J2M A;  4J2E A;  1ZC6 A;  3HL8 A;  1OH6 A;  1IG9 A;  1TGO A;  3OYH A;  4K43 A;  4H5V A;  1BIU A;  1M1K O;  3VOV A;  3ZCM A;  3VQB A;  4E89 A;  1FW6 A;  2CGL A;  3FGU A;  2ZE2 A;  4B3S K;  2F8S A;  2D4W A;  5LMU K;  3S9H A;  4MO5 A;  4C8L A;  2RE2 A;  3TSQ A;  4LD0 A;  4I2Q A;  5GIP A;  4FJL A;  1ESV A;  3HK2 A;  3VF4 A;  2XY7 A;  3KK3 A;  3VQ6 A;  3L8B A;  2D5R A;  5IWA K;  3VER A;  4JKF A;  1DGK N;  4CGG A;  3WXJ A;  4MQ3 A;  1YIT N;  3RWU A;  5AJ3 K;  1XI1 A;  1KVB A;  3VET A;  2KKZ A;  3KK1 A;  4FYD A;  3IRX A;  5DM7 L;  2NRV A;  3ALY A;  1CXQ A;  1EP4 A;  1NBW A;  1R0A A;  2X6S A;  3OYM A;  4B1V A;  3VA0 A;  4DV5 K;  3OYI A;  1GLD G;  1KQS M;  1WBB A;  3TTD A;  4ISF A;  4DF8 A;  1KAY A;  2F4V K;  4BRO A;  2NRX A;  3EY1 A;  3RMA A;  3TAM A;  1EWR A;  4FPA A;  3LZI A;  4I9Q A;  1W0H A;  4YOR A;  2Q3S A;  4I9L A;  1K6Y A;  1NKC A;  5AQQ A;  4NCA A;  3SMP A;  1A5V A;  1BOT O;  3W0L A;  4YHH K;  5J2P A;  3O1B A;  3OYD A;  4DTO A;  4BRM A;  1VSD A;  3DI6 A;  4O5F A;  4W5R A;  1E4G T;  3TR8 A;  2BGG A;  2QWP A;  3F73 A;  4DTR A;  4BC5 A;  2D0B A;  3L4Q A;  2HHW A;  3LP3 A;  4H5W A;  2VGM A;  1Y97 A;  4JI2 K;  4CZM A;  2V52 B;  3CCL N;  3HTV A;  1C0M A;  1ZBU A;  1ILY A;  4DTU A;  3M3Z A;  1RBT A;  3WXM B;  2YHX A;  2GEL A;  4X64 K;  3S3N A;  3ZEU B;  3I56 N;  3MEE A;  3RRG A;  3OBW A;  1B9D A;  2P5G A;  3L0Q A;  5TKY A;  4BWJ A;  1NOY A;  4F3T A;  2ETJ A;  1XHZ A;  4IOC L;  1Q9Y A;  3AVB A;  4IFY A;  4FVU A;  1RT7 A;  4KTW A;  3S3M A;  4HCC A;  3THX A;  3AA2 A;  4LF9 K;  3B6P A;  3QML A;  4GKJ K;  3KJV A;  3C6A A;  2ZJR L;  4CHY A;  3NF7 A;  1OKJ A;  3DXM A;  1BCO A;  3JSM A;  1XHX A;  1JLC A;  2ITG A;  4Z4C A;  3MCA B;  1N5Y A;  4CJF A;  5HRS A;  3R1X A;  3OS0 A;  1NGB A;  2KZM A;  2P9P B;  3DRP A;  4A62 A;  4IEE A;  4DR2 K;  1EX4 A;  3VQ8 A;  3CME N;  1UA1 A;  3K9J A;  4X65 K;  5FPD A;  3TTF A;  4DSE A;  2R7Y A;  4FJK A;  2V51 B;  1FXX A;  2UXD K;  4NB4 A;  2HND A;  4CGF A;  3CFO A;  3VEY A;  1L3U A;  3CC7 N;  3BGR A;  3EKU A;  2PY5 A;  4YOY A;  3OA9 A;  3CCS N;  5C15 A;  3HYF A;  4EFH A;  3AVH A;  4N41 A;  1ASU A;  4R79 A;  5HL7 L;  4DQR A;  3O4N A;  4OJR A;  4A2A A;  1YHQ N;  1L3V A;  4B9L A;  1B92 A;  1CZA N;  4GVE A;  4B8A B;  2NRH A;  4ELV A;  4CEC A;  2D1K A;  3WT0 A;  2G8F A;  3P4I A;  1S6Q A;  5M1Q A;  5DMR A;  4KRF A;  2PYL A;  1T7P A;  1TK5 A;  1NK5 A;  4E7J A;  2QKB A;  3AVC A;  4AF1 A;  4JKD A;  4B3T K;  3O6W A;  2P51 A;  4RTF D;  5EVZ A;  1YIJ N;  1MDU B;  1N34 K;  2QTD A;  4MDB A;  3QFU A;  3T7Z A;  3HXM A;  3HZ6 A;  3K2P A;  2PYJ A;  5EU7 A;  4PKH A;  3O1W A;  1BL3 A;  3OS2 A;  1JLG A;  5FPN A;  2WON A;  1NMD A;  1YT3 A;  4C1N K;  1BI4 B;  4HUG A;  5SZT A;  1BG3 A;  3DOL A;  2YCH A;  2XHB A;  5BRD A;  4E1N A;  1C1A A;  2OTJ N;  1JL1 A;  5JLH A;  3SQ2 A;  4DQP A;  3DJC A;  4PHT X;  1VQ9 N;  4O8K A;  5AQF A;  3WNE A;  1KVA A;  2B5J A;  1HKB A;  3AO5 A;  5CZ2 A;  3KHY A;  3HJF A;  1LW0 A;  2HMI A;  1NU0 A;  1BGX T;  2IDO A;  2DFH A;  4XH1 A;  2P9S B;  1ZBH A;  1XC3 A;  1G15 A;  4U67 L;  3PO5 A;  3GBT A;  1NGH A;  1YJW N;  1NLV A;  3NAE A;  1VSJ A;  4G1Q A;  1WB9 A;  1C0T A;  1K8K B;  2QWO A;  1NK4 A;  1HMV A;  1VSI A;  3FZL A;  2JWL A;  3ZSY A;  3FZK A;  3NGI A;  3CCE N;  4H5R A;  3QLH A;  2E6L A;  3VEN A;  5C10 A;  2OPQ A;  4HWI A;  3J81 O;  4Y1C A;  3RMB A;  5LJV A;  4DKW A;  3ISN C;  2FF3 B;  1QZ6 A;  1T44 A;  1U2V B;  3M5R A;  3RRH A;  1TK0 A;  3WUH A;  4PQU A;  1G99 A;  5FLX O;  2QWR A;  3SQ4 A;  4DSJ A;  4PL8 A;  3VQP A;  3TWH A;  3HRG A;  4M42 A;  1RIL A;  1S1T A;  3CI5 A;  3U6F A;  3DYA A;  4U7B A;  4BR4 A;  4BDP A;  4B9Q A;  4DUY K;  1RTI A;  3SAH A;  2OPP A;  3V9W A;  1BIS A;  1QTM A;  1W2B M;  4FOE A;  4BRQ A;  5J2N A;  4CF8 A;  3I8B A;  2Z1H A;  2ZD1 A;  1NJI O;  4FWL A;  3DM2 A;  3J7Z O;  4CW7 B;  1VRT A;  3F9K A;  3IUC A;  3UB5 A;  3CCV N;  3PV8 A;  4HVJ A;  1QQO A;  2QWL A;  3I8D A;  3ZEU A;  3MWT A;  4A57 A;  4CJS A;  2VYP A;  3Q7C A;  2QA4 N;  4LSN A;  3P38 A;  2KHO A;  4KHN A;  1ASV A;  4CJW A;  1VSK A;  3CER A;  4JKG B;  1FKP A;  3AO2 A;  2F8T A;  2OCE A;  2OTL N;  2HST A;  4QOZ B;  1VQ6 N;  1EET A;  2BTF A;  4KH4 A;  3RSE B;  1NJX A;  5AQW A;  4KPY A;  1EXQ A;  3EN9 A;  4CCH A;  3AVI A;  2GWK A;  3LPU A;  4JI8 K;  1IG8 A;  3MEG A;  3DOK A;  4DLE A;  4HUE A;  1YTU A;  3CCQ N;  5HBM A;  3DWL A;  1NK6 A;  4K25 A;  1W97 L;  2P9P A;  3M6G A;  1LWF A;  3H45 C;  3HST B;  3VTH A;  3CCR N;  3K9K A;  4O5B A;  1X9J A;  1XNR K;  4LF8 K;  4BR9 A;  4IOA L;  1WAJ A;  4EP5 A;  4O8U A;  2J4R A;  2A40 A;  4M3T A;  4ICL A;  4KBO A;  1YAG A;  3PX4 A;  1UWB A;  4H4M A;  2VWJ A;  2DY4 A;  5AQK A;  3OYB A;  4N47 A;  1FK9 A;  2CH6 A;  3CC4 N;  2QM1 A;  3FZH A;  3QDK A;  4FW2 A;  1RT6 A;  5GAG P;  4WFB L;  3K5N A;  5AQU A;  4JI7 K;  4KH5 A;  5AFU A;  2VGN A;  3MN5 A;  1SQK A;  3OYK A;  2IAJ A;  4CEA A;  3BP8 A;  3TAR A;  4NXM K;  1JKH A;  3HO1 A;  3O9R A;  1KFS A;  3FZF A;  5M1N A;  4HTU A;  3TAP A;  3HT3 A;  2GBZ A;  3MXM A;  1I39 A;  2G8U A;  4BC4 A;  4FO0 A;  4CHZ A;  2I7N A;  1U04 A;  5D3G A;  1XMQ K;  4GW6 A;  3NCI A;  4IZ9 A;  5AR0 A;  3ZLJ A;  4F9O A;  1J5E K;  3CQ8 A;  2YNI A;  2F96 A;  3SCX A;  3WXK A;  4OLA A;  1NOZ A;  1HYS A;  1LAV A;  4GV3 A;  4CHQ A;  3W3D A;  4OVL A;  4QCL A;  1WBD A;  5KRS A;  4YY3 K;  4DLG A;  1J54 A;  5KTQ A;  4KAZ A;  2FXU A;  4BVO A;  5EOY A;  3U9D A;  3ZSW A;  5FRM A;  2NRR A;  3SUO A;  2VWK A;  4Z4G A;  1DLO A;  2FSN A;  3D45 A;  4M3X A;  1U49 A;  1QQC A;  1BI4 A;  3M8S A;  1DT9 A;  2DTU A;  2YHA A;  1RDW X;  3LL3 A;  4FWO A;  3CCM N;  1IBM K;  4KHY A;  4FJH A;  2E2N A;  4FM2 A;  1WN7 A;  4DTS A;  3OY9 A;  2QI2 A;  4M3R A;  3SUN A;  3QEV A;  3AVL A;  1KAZ A;  2XY6 A;  4R5P A;  3AY9 A;  2P9S A;  4QAG A;  2QW9 A;  3R9P A;  3C95 A;  3EE8 A;  4IO8 A;  3VGK A;  3T1A A;  3F5T A;  4JRQ A;  3BF3 A;  1K8K A;  3I0S A;  4RW6 A;  3UKU A;  1TV6 A;  4XEI A;  5C2F A;  1LCU A;  3NF9 A;  4N5S A;  1ITG A;  1JCF A;  2Q2R A;  1W7A A;  3V9Z A;  1Z25 A;  3P5J A;  4YNQ A;  3RVC A;  4FPB A;  2HOE A;  5FPM A;  5AZI B;  4CBX A;  1U2V A;  5BR8 K;  4O4G A;  1L3S A;  3VPZ A;  4CZE A;  1Z6R A;  3QET A;  2JGU A;  3CXC M;  1BWF O;  3LWM A;  1KLN A;  1P90 A;  4FWR A;  1NKE A;  4CK1 A;  2Y1I A;  3WXL A;  4IBN A;  3QB0 A;  3QEP A;  4Z4E A;  4WFN L;  5AQN A;  4CFC A;  1I94 K;  2FBY A;  3SPZ A;  3SQ0 A;  4AM6 A;  4OO1 J;  4CZK A;  3K57 A;  1ATN A;  1SUQ A;  2NNW A;  1SKR A;  1HJR A;  4HTL A;  3DLE A;  4IXC A;  4DV4 K;  5M1K A;  2RN2 A;  2ASO A;  1S9E A;  4CJV A;  4E1M A;  3EE9 A;  4CGH A;  3GG4 A;  1NGI A;  1GLL O;  4B8C A;  4DWI A;  1HPZ A;  3ZSQ A;  3CQX A;  1KAX A;  3I33 A;  3MMV A;  4JKG A;  4XH4 A;  2AP1 A;  2O4I A;  3M8Q A;  5BPN A;  3KLE A;  3CIP A;  1Q8I A;  1QQN A;  5AQL A;  4FWS A;  3HSC A;  3BUZ B;  3RSE A;  2X74 A;  4JI1 K;  3CJC A;  2NRZ A;  3RMC A;  1IV0 A;  2O8E B;  1OH7 A;  4FXD A;  5ADX H;  2Q31 A;  1XWL A;  4CFD A;  2Q1N A;  2QXF A;  4JRP A;  3C94 A;  4K41 A;  1VHX A;  3BEX A;  1NGD A;  5HP1 A;  2FLO A;  1JCG A;  3DRS A;  4HUF A;  1S3X A;  4BR5 A;  1ZBF A;  1VSM A;  3LDO A;  3QFP A;  5ELZ A;  3ENO A;  4CEF A;  3ENB A;  4E7H A;  1HKC A;  4N56 A;  1NKB A;  3L3V A;  1D9F A;  1SV5 A;  4H0X B;  4KTQ A;  1TK8 A;  3NMU A;  5FRO A;  1HYV A;  4NLC A;  1HUX A;  5FRN A;  3MXJ A;  3CM6 A;  3I55 N;  4LC9 B;  1BU6 O;  4DV0 K;  4V19 S;  2DFE A;  4E1J A;  5CR4 A;  4E7I A;  4B1Z A;  3LAL A;  1EO1 A;  2KFN A;  3BDP A;  1EKE A;  3B6O A;  4CI6 A;  4PWD A;  1HKG A;  2FC0 A;  5AZJ B;  2FF6 A;  4MLE A;  1RT4 A;  1HR0 K;  3P1G A;  1W9H A;  5GAE P;  4CD1 A;  4DG1 A;  4DTM A;  4Z0U A;  2QEX N;  2HVI A;  5K14 A;  3QIO A;  4CHP A;  3ZSX A;  2YV0 X;  3M8R A;  2IOC A;  3NFA A;  1T6D A;  3LZJ A;  4PKG A;  4A61 A;  1SS6 A;  3MWP A;  4AHU A;  4NYN A;  4PKI A;  4JK8 A;  3HI0 A;  2G8I A;  4H0T B;  4DFP A;  2A1S A;  2HHT A;  3ZX0 A;  1BIZ A;  4FJ5 A;  4DFK A;  3AA5 X;  3V9S A;  3VGM A;  3J80 O;  4JNE A;  2ZGZ A;  2G8W A;  2GUP A;  4B9N A;  4B9T A;  1C6V A;  1NK8 A;  4FM1 A;  3PSI A;  4CZG A;  3UIQ A;  3EO3 A;  1UAX A;  1ZBS A;  3C6H A;  2UUA K;  3N4P A;  4KHP K;  2YKM A;  4RCH A;  2A41 A;  3TI0 A;  4BGB A;  4DU4 A;  4Q5V A;  3CM5 A;  2W42 A;  4BQL A;  2W6K A;  3P83 D;  3WNH A;  4CZJ A;  2YNG A;  4KFB A;  3KKS A;  2D0P A;  3VEW A;  3MN6 A;  5EXW A;  4DFJ A;  2P9K B;  1QQM A;  4IJA A;  1HNV A;  2A1R A;  3VGL A;  2AJQ A;  2VG7 A;  5LMN K;  4E7K A;  1JJ2 M;  4FLU A;  3VN5 A;  4EIA A;  2Z1G A;  5LJW A;  4M3W A;  2W6L A;  4JI5 K;  3EYZ A;  4CK3 A;  4C1N I;  3N4Q A;  4CHN A;  4PL7 A;  3WQU A;  1NJZ A;  4BR7 A;  2F9T A;  1R59 O;  2X6N A;  1OH5 A;  4AIL C;  4OKE A;  1VQ5 N;  4PUO A;  1T3V A;  2E1Z A;  4H4O A;  1TVR A;  1WOQ A;  2QWM A;  5IT9 O;  5AQR A;  3NDK A;  4FJN A;  5AZI A;  4CF2 A;  4UQG A;  4BE0 A;  3D2F B;  3FFK B;  3MX5 A;  1TYQ B;  1OVY A;  1NGA A;  2V7Z A;  3AVN A;  5AQI A;  4E3S A;  3CJ7 A;  4JI4 K;  1JLE A;  1BUP A;  3SV3 A;  4X62 K;  4CFA A;  2KFZ A;  2KW4 A;  3H08 A;  2O8F B;  2Q97 A;  3AAQ A;  4JI0 K;  4H0Y B;  1YVU A;  4MDA A;  3K0S A;  1BDG A;  1OH8 A;  4HCB A;  3NVK A;  1X9W A;  2E1Y A;  2IGI A;  3BZK A;  4LF5 K;  3MX2 A;  1DTT A;  1HNW K;  5KPR A;  4UY8 O;  3QEW A;  4CJE A;  3AGK A;  1K9M O;  2NRW A;  2Q0R A;  3ZT4 A;  1YI2 N;  1N33 K;  3AGR A;  1HYZ A;  1S9G A;  3VQ5 A;  1RT5 A;  2V7Y A;  3F9M A;  4CGJ A;  4A5A A;  3JYT A;  3L2R A;  4CJ7 A;  3OYC A;  4FJ8 A;  5SWM A;  3D2E B;  3OW2 M;  1BCM A;  3VEX A;  1QE1 A;  4LSL A;  4M45 A;  4H0O A;  2ZF5 O;  4KV8 A;  5JVH L;  1HPM A;  3VF6 A;  3DLG A;  3TAE A;  3LP0 A;  2O8E A;  1X9M A;  4ISE A;  5AQP A;  3ZT3 A;  4AM7 A;  4DS4 A;  2HB5 A;  2YHB A;  2RPI A;  2NZT A;  2HHX A;  3WXI A;  1VQK N;  4LFC K;  1BHL A;  4BE1 A;  1QVG M;  2OZM A;  4ZTJ A;  4J8F A;  4BRI A;  2IS3 A;  3S41 A;  3MCP A;  4DQ8 A;  2HBJ A;  2I7P A;  3OYF A;  4FK2 A;  3RR7 A;  1A5X A;  4LH4 A;  3C7N B;  3KD1 E;  4DV3 K;  1X3M A;  3UKU B;  3NVM A;  3CD6 N;  1IJJ A;  4B08 A;  1BA0 A;  4O55 A;  3PSF A;  3VQD A;  2ZQB A;  2UYT A;  1LWC A;  1ASW A;  3O80 A;  3VTI A;  2VQE K;  4F2R A;  1GOA A;  1Q7Y O;  3SMS A;  4BRL A;  4CJK A;  4W5T A;  4IWV A;  3R8E A;  2GUI A;  4ID5 A;  1E3M A;  5HRP A;  4I6M B;  4W5N A;  4CER A;  4KB1 A;  1XNQ K;  5AZJ A;  3D6R A;  4DFM A;  3ZSZ A;  2FSJ A;  3NH1 A;  3MXI A;  2VG5 A;  4BDY A;  3SNN A;  2ZJP L;  1XMO K;  4I7F A;  1S1U A;  5C2D A;  2BDP A;  1SKW A;  3ZYY X;  2H3G X;  4BWM A;  5BPM A;  1T8E A;  2G8V A;  3TTC A;  1J5O A;  1Q9X A;  5KQD A;  2HHS A;  4FSV A;  1T6C A;  4JKC A;  2HHH K;  1ZXO A;  4CK2 A;  1VQ7 N;  3M1F A;  1VQ8 N;  3EZ5 A;  4IO9 L;  3VEO A;  3QER A;  1SAZ A;  1EWQ A;  4CF1 A;  1LAW A;  4GV9 A;  2UUC K;  3VMF B;  3WQT A;  1KXP A;  5BRF A;  1HNX K;  3VQE A;  2GWJ A;  4M41 A;  4BQZ A;  5FPE A;  4IEI A;  3BY5 A;  1RTH A;  3ULE B;  2RHK A;  1RFQ A;  1QHA A;  4FLW A;  2HBK A;  4OPJ A;  1NGC A;  3ID8 A;  3KD5 E;  5AQV A;  1RT2 A;  3G0Z A;  1MU2 A;  3TAG A;  1HQE A;  3CCJ N;  5M1P A;  1GLC G;  4KHQ A;  4IDK A;  2HMP A;  2IC3 A;  2KTQ A;  3AA3 A;  2OPS A;  5KPZ A;  5J2Q A;  4G9Z A;  5JS1 A;  5JIC A;  5C24 A;  1YXQ A;  5C25 A;  4QS8 A;  3VQQ A;  4BRN A;  5LL6 Z;  1SKS A;  4JKA A;  4RW8 A;  2P9K A;  1IKY A;  1M90 O;  3F2K A;  1B9F A;  3A2F A;  3DLH A;  3VES A;  3IFR A;  2CGK A;  1VSL A;  4PA1 A;  5B8H A;  1U6Z A;  4JN4 A;  5AQM A;  1IH7 A;  4GKK K;  1S1V A;  3FLC O;  4EAH D;  2E6M A;  1WLJ A;  4JKB A;  3CFR A;  2E88 A;  4FWP A;  5KGW A;  1XC9 A;  3THW B;  3JAM O;  4F4K A;  3SBT A;  4E7L A;  2BUP A;  1N36 K;  1C0F A;  1TAQ A;  2P9N B;  2Z1J A;  4DR1 K;  1D8Y A;  1YTA A;  4KHU A;  1F21 A;  1J6Z A;  4X66 K;  4A2B A;  1SZ2 A;  2NLX A;  4DQS A;  3D2F A;  2CGJ A;  4JV5 K;  1TYQ A;  2HF4 A;  5I42 A;  5AQZ A;  3MAQ A;  4B9M A;  4JKE A;  4GNI A;  1JCE A;  1U48 A;  4IDH A;  4FJG A;  1QS4 A;  2Q0U A;  3LDP A;  3HVR A;  1Z05 A;  2IVP A;  3VQ4 A;  1VSE A;  1UOC A;  3AA4 A;  3QBW A;  5CYM A;  2O8F A;  4CJ5 A;  1NMN A;  3MN7 A;  3S3O A;  1MWK A;  4CJP A;  4M3Y A;  4K42 A;  3KWG A;  3K58 A;  3A5N C;  1VQM N;  1RT3 A;  3O3H A;  2BAN A;  1S5J A;  3HM8 A;  3KK2 A;  4CEE A;  3V1Q A;  3KKR A;  2HBL A;  1TKZ A;  3QIC A;  4FW1 A;  4BG9 A;  1V4S A;  2EHG A;  4AHV A;  1WUA A;  2HVH A;  2RKI A;  3SUP A;  2UU9 K;  2ATQ A;  1CLQ A;  3CC2 N;  4JI6 K;  3NH0 A;  2ZJQ L;  4K0K K;  2E8A A;  3D0P A;  3P39 A;  3D2E A;  5C42 A;  3TAF A;  3THV A;  1KD1 O;  1N32 K;  3NGZ A;  3L2V A;  1LW2 A;  1Z26 A;  2OZS A;  3DRR A;  4NLB A;  4H8K A;  2ASP A;  2P9I B;  4L8R B;  3O4Q A;  5GAH P;  4LH5 A;  4EZ6 A;  3SPY A;  5AQO A;  3SYZ A;  1RBS A;  4CJ3 A;  4A5B A;  3ZX3 A;  4WYB A;  4DS5 A;  1C1B A;  2DFF A;  3AO4 A;  4TSX A;  2O4G A;  2YX6 A;  2ZGY A;  4OPA A;  1T05 A;  4AQY K;  3C7N A;  4MFB A;  2FBV A;  4E0D A;  4J2D A;  4DUZ K;  1LV5 A;  4RW4 A;  4YOT A;  3O3F A;  3KLG A;  3PX0 A;  4FWK A;  4B9U A;  4WQ5 A;  3CET A;  5JS2 A;  5BN8 A;  3SK3 A;  2P9U A;  4CZH A;  5E26 A;  4CEZ A;  1RCH A;  4BAC A;  1EQY A;  1JLA A;  2ITM A;  4H5T A;  3QBX A;  4I6M A;  2OYQ A;  4DSK A;  2E4L A;  1X3N A;  3KLF A;  4BDZ A;  4Z4F A;  2E20 A;  4DQQ A;  1QSL A;  3L2Q A;  3QNO A;  5JVG L;  2D0A A;  3J7A P;  1WSI A;  4WQ4 A;  1E4F T;  5JLF A;  3JXU A;  5AQJ A;  3FR0 A;  4C8N A;  2IVO A;  2Z1I A;  3AVK A;  4JI3 K;  3DLB A;  2QWQ A;  3QEX A;  3CPW M;  2BE2 A;  3H3N O;  4B1U B;  1HX1 A;  3DXK B;  1UA0 A;  3OTO K;  2B4J A;  3LDS A;  3KK7 A;  4B9V A;  1VRU A;  4CFB A;  3PLA A;  1TL3 A;  1X1P A;  4XIU A;  2WBN A;  1VQ4 N;  4BY9 C;  1VQN N;  4OPK A;  4QS9 A;  1REV A;  2QWN A;  4BG8 A;  3E1Y A;  4CED A;  2ZM6 K;  4WF9 L;  4BGA A;  3O4W A;  3ID6 A;  3BF1 A;  3ZT0 A;  1CZ9 A;  4Y0W A;  3D7E O;  4DTP A;  3VQC A;  1U47 A;  2VG6 A;  4AHS A;  3RTV A;  2QKK A;  2W40 A;  3V1R A;  4DSI A;  3CPE A;  5I3U A;  3ULE A;  1Q86 O;  2GTD A;  1DEJ A;  1IKX A;  1QSY A;  5LY3 A;  4M3Z A;  3OYN A;  3V6D A;  4IOX A;  3HP6 A;  4KHS A;  1WSJ A;  5C12 A;  4RW9 A;  2G8H A;  3U3Y A;  4Z94 A;  4NYF A;  3GOI A;  4JAX A;  3U4L A;  4K8Z A;  3LAK A;  2WOM A;  4LFB K;  4DR3 K;  1JL2 A;  3O9T A;  2HNY A;  2YJF A;  4W5O A;  2VWB A;  3H6E A;  4IJN A;  4WFA L;  5TKW A;  3U3G A;  2G8K A;  4KI6 A;  1TL1 A;  4F8R A;  1QHT A;  1HRH A;  4RW7 A;  3OYE A;  1KSP A;  3R3L A;  2D0C A;  1KCF A;  3MEC A;  4YOX A;  5BRH A;  3OBY A;  1NK9 A;  1RDB A;  1JLF A;  3C6U A;  2WUS A;  2FSK A;  4H0P A;  5KI6 A;  5AQS A;  3AO1 A;  4CIE A;  1K8A O;  2WC9 A;  1O1W A;  3U8X A;  3QO9 A;  1NGJ A;  3BZC A;  4DV1 K;  3C65 A;  3THW A;  3CHW A;  4CZL A;  4B3M K;  1NNE A;  3LP2 A;  1S1W A;  1HNZ K;  4FK0 A;  3QIN A;  4ILJ A;  2P9N A;  2XY8 A;  5FDL A;  1TKT A;  4C23 A;  1IBL K;  3SV4 A;  5DM6 L;  4B1W B;  1FJG K;  1LOT B;  2YJE A;  3H1V X;  3KWI A;  3WNG A;  4CBW A;  4K8X A;  2FBX A;  2UXC K;  1CZB A;  1NG9 A;  2PBD A;  5F0X A;  4LY7 A;  2WTU A;  4J2B A;  3SAF A;  3H3O B;  3EL2 A;  5EX5 A;  1NGE A;  1VQP N;  2GV9 A;  3LP1 A;  1D9D A; 
#chains in the Genus database with same CATH homology
 4OLB A;  4LSL A;  4M45 A;  3PY8 A;  1WAJ A;  2YNH A;  4EP5 A;  4KI4 A;  4KV8 A;  4PY5 A;  1QSS A;  4M3T A;  5HRR A;  4ICL A;  4FVM A;  2P5O A;  3DLG A;  3PX4 A;  1UWB A;  3L3U A;  3TAE A;  3LP0 A;  2XO7 A;  4FZY A;  4EP4 A;  4H4M A;  4KKO A;  2VWJ A;  1X9M A;  2DY4 A;  3OYB A;  3ZT3 A;  1RDA A;  4N47 A;  3OJU A;  1FK9 A;  5CYQ A;  4FLZ A;  3VQ7 A;  3SQ1 A;  4DTJ A;  4DS4 A;  2HB5 A;  2YHB A;  2RPI A;  4FW2 A;  2HHX A;  1RT6 A;  1C1C A;  4FLX A;  1BHL A;  4BE1 A;  3K5N A;  4BE2 A;  3VQA A;  4CIF A;  4ZTJ A;  4CES A;  2OZM A;  1TKX A;  4ELT A;  3NF8 A;  3I0R A;  3KLI A;  2IS3 A;  3CG7 A;  2NUB A;  4DU1 A;  3OYF A;  4FK2 A;  3RR7 A;  1A5X A;  3OYK A;  2IAJ A;  4LH4 A;  4CEA A;  3NE6 A;  3TAR A;  3KD1 E;  4ELU A;  1HNI A;  1JKH A;  1KLM A;  3MED A;  3O3G A;  3HO1 A;  2YKN A;  3QIP A;  1KFS A;  2EX3 A;  1NK0 A;  4GMJ B;  4AHT A;  1J9A A;  4B08 A;  4KRE A;  1SL2 A;  1I3A A;  4HTU A;  4JLH A;  4O55 A;  1IO2 A;  1RTJ A;  5J2M A;  3NHG A;  4CEO A;  3TAP A;  3VQD A;  3HT3 A;  3ASM A;  2GBZ A;  3MXM A;  4J2E A;  2ZQB A;  4NCB A;  1I39 A;  1LWC A;  1ASW A;  3HM9 A;  2G8U A;  3TAB A;  3HL8 A;  4FK4 A;  4B3O A;  1IG9 A;  1JLB A;  4O0J A;  4F2R A;  1TGO A;  1GOA A;  4CHZ A;  1U04 A;  4OGE A;  1L3T A;  3OYH A;  5D3G A;  1BIU A;  4CJK A;  3ZCM A;  3VQB A;  4E89 A;  4IG0 A;  4W5T A;  4FLV A;  4GW6 A;  2GUI A;  3NCI A;  4ID5 A;  2ZE2 A;  5HRP A;  2B6A A;  3HP9 A;  4W5N A;  3ITH A;  4CER A;  4AHC A;  4KB1 A;  2F8S A;  1SL0 A;  3CQ8 A;  2YNI A;  2F96 A;  4DFM A;  3SCX A;  3S9H A;  3ZSZ A;  4C8L A;  4OLA A;  3DLK A;  3NH1 A;  1NOZ A;  4LD0 A;  4I2Q A;  4Z4H A;  3MXI A;  4FJL A;  1HYS A;  1LAV A;  2VG5 A;  3HK2 A;  4BDY A;  3SNN A;  2XY7 A;  3KK3 A;  4CHQ A;  4CEB A;  3VQ6 A;  4OVL A;  3L8B A;  4QCL A;  2D5R A;  4I7F A;  3OVN A;  4RG8 A;  5KRS A;  1S1U A;  4DLG A;  1VSH A;  1J54 A;  4CGG A;  5KTQ A;  1SKW A;  2BDP A;  3DLR A;  4KAZ A;  4DQI A;  4BWM A;  4MQ3 A;  1T8E A;  2G8V A;  4FJ7 A;  3ZSW A;  5FRM A;  1J5O A;  3RWU A;  1XI1 A;  1KVB A;  2VWK A;  3L2W A;  3SUO A;  4Z4G A;  5DK5 A;  1Q9X A;  1DLO A;  2HHS A;  3D45 A;  4M3X A;  4FLT A;  3KK1 A;  4CK2 A;  4FYD A;  3IRX A;  1RT1 A;  1GOB A;  1U49 A;  3EZ5 A;  3ALY A;  1CXQ A;  1QQC A;  1EP4 A;  3G10 A;  4FCY A;  1BI4 A;  3M8S A;  3QER A;  1R0A A;  2OPR A;  2DTU A;  2X6S A;  3OYM A;  2YHA A;  3VA0 A;  3OYI A;  4CF1 A;  1LAW A;  4CIG A;  3IAY A;  4KHY A;  4FJH A;  5HRN A;  4DF8 A;  3VQE A;  4M41 A;  4FM2 A;  3CYM A;  2XY5 A;  1WN7 A;  4DTX A;  4DTS A;  3OY9 A;  3EY1 A;  3RMA A;  2KQ2 A;  1RTH A;  4IG3 A;  4M3R A;  3TAM A;  3SUN A;  3LZI A;  4OGC A;  3AVL A;  4FLW A;  3QEV A;  4I9Q A;  1W0H A;  4OPJ A;  1FKO A;  2Q3S A;  4I9L A;  2XY6 A;  1K6Y A;  4R5P A;  3KD5 E;  3SJJ A;  1NKC A;  1KVC A;  2HW3 A;  2HHV A;  1RT2 A;  4NCA A;  3G0Z A;  1MU2 A;  3TAG A;  1S1X A;  1HQE A;  1A5V A;  4Z4I A;  1JLQ A;  4QAG A;  3C95 A;  4KHQ A;  4IDK A;  1T03 A;  5J2P A;  3OYD A;  4DTO A;  4W5R A;  1VSD A;  3DI6 A;  1WSF A;  2IC3 A;  3TR8 A;  3T1A A;  3F73 A;  2BGG A;  2KTQ A;  4JRQ A;  3AA3 A;  2OPS A;  2KZZ A;  5J2Q A;  4DTR A;  3I0S A;  4RW6 A;  5JS1 A;  1TV6 A;  2D0B A;  4HHT A;  2HHW A;  3LP3 A;  4CJR A;  3NF9 A;  4N5S A;  1ITG A;  5C24 A;  1Y97 A;  5C25 A;  3VQQ A;  3AVA A;  5KRT A;  1ZBL A;  1SKS A;  3V9Z A;  1Z25 A;  5KGX A;  3P5J A;  4RW8 A;  1IKY A;  1C0M A;  4YNQ A;  4JS5 A;  1ZBU A;  4O0I A;  4KO0 A;  4DTU A;  4FJI A;  1B9F A;  1RBT A;  3A2F A;  3DLH A;  1VK0 A;  3IS9 A;  1JXE A;  3S3N A;  4O4G A;  1VSL A;  1L3S A;  4PA1 A;  3MEE A;  3RRG A;  3OYJ A;  1B9D A;  3QET A;  3OYL A;  2JGU A;  1U4B A;  2P5G A;  3LWM A;  1KLN A;  4BWJ A;  1IH7 A;  1NOY A;  3ULD A;  1S1V A;  2ETJ A;  4CHO A;  4F3T A;  1WSE A;  1NKE A;  1XHZ A;  4AH9 A;  4CK1 A;  1Q9Y A;  2E6M A;  3AVB A;  1WLJ A;  4IFY A;  2Y1I A;  4IBN A;  4FM0 A;  1RT7 A;  1RBR A;  3CFR A;  3QEP A;  3V1O A;  5KGW A;  4Z4E A;  1XC9 A;  4KTW A;  3S3M A;  4F4K A;  4HCC A;  4CFC A;  2JLE A;  3AA2 A;  1VSF A;  3B6P A;  2FBY A;  4E7L A;  3KJV A;  3SPZ A;  3SQ0 A;  1TAQ A;  2Z1J A;  1D8Y A;  1YTA A;  4KHU A;  1F21 A;  4FJX A;  4CHY A;  1RBV A;  3NF7 A;  3K57 A;  4DQS A;  1BCO A;  3OJS A;  1SUQ A;  3JSM A;  1XHX A;  1JLC A;  1CXU A;  2ITG A;  1SKR A;  1HJR A;  1WSH A;  4Z4C A;  3DLE A;  3K5L A;  1N5Y A;  4DSL A;  3AV9 A;  4CJF A;  2RN2 A;  3NH2 A;  5I42 A;  3MAQ A;  5HRS A;  4B9M A;  1S9E A;  3OS0 A;  4CJV A;  4E1M A;  2KZM A;  3DRP A;  4CGH A;  3V9U A;  1U48 A;  1TAU A;  4FJG A;  4B8C A;  4DWI A;  1QS4 A;  3HVR A;  1EX4 A;  4CJU A;  1WSG A;  1HPZ A;  1S6P A;  3VQ4 A;  3VQ8 A;  1VSE A;  3ZSQ A;  1UOC A;  3AA4 A;  4CF0 A;  1UA1 A;  5CYM A;  2I5J A;  4CJ5 A;  4WE1 A;  3VA3 A;  3S3O A;  2O4I A;  3M8Q A;  4ID1 A;  4CJP A;  3KLE A;  4M3Y A;  3M8P A;  1Q8I A;  3K58 A;  4DSE A;  1RT3 A;  2R7Y A;  4N76 A;  3O3H A;  4W5Q A;  3LPT A;  4FJK A;  3E01 A;  2BAN A;  1S5J A;  1FXX A;  2X74 A;  3KK2 A;  4CEE A;  4NCG A;  3V1Q A;  3RMC A;  2HND A;  3KKR A;  4CGF A;  1TKZ A;  3CFO A;  4FW1 A;  2EHG A;  1L3U A;  4FXD A;  3BGR A;  4AHV A;  4F2S A;  4CFD A;  1XWL A;  1NJW A;  2PY5 A;  4I2P A;  1L5U A;  2RKI A;  2HVH A;  2HHQ A;  2QXF A;  3IG1 A;  4JRP A;  3C94 A;  4F3O A;  1D5A A;  3SUP A;  2ATQ A;  5HP1 A;  3SI6 A;  3C6T A;  4DU3 A;  1CLQ A;  3HYF A;  4B9S A;  3DRS A;  3NH0 A;  4HUF A;  3AVH A;  1DTQ A;  1ZBF A;  1IKV A;  1VSM A;  3KIO A;  4KTZ A;  3HVT A;  2PZS A;  1ASU A;  4N41 A;  3K5O A;  3D0P A;  4ZHR A;  2HHU A;  3QEI A;  4KHW A;  4CEF A;  5C42 A;  3TAF A;  3THV A;  4E7H A;  4N56 A;  3NGZ A;  3L3V A;  4CE9 A;  3L2V A;  1LW2 A;  4DQR A;  3ZSV A;  1Z26 A;  3O4N A;  1NKB A;  2OZS A;  3PUF A;  4OJR A;  1N6Q A;  1SV5 A;  4KTQ A;  1TK8 A;  3DRR A;  3V4I A;  5FRO A;  1HYV A;  1KFD A;  4H8K A;  5J1E A;  3SZ2 A;  1L3V A;  4B9L A;  4L8R B;  1B92 A;  3O4Q A;  4B8A B;  4LH5 A;  4ELV A;  5FRN A;  4EZ6 A;  4CEC A;  3SPY A;  3SYZ A;  3K59 A;  3FFI A;  1RBS A;  2G8F A;  3MXJ A;  3CM6 A;  4CJ3 A;  4DSF A;  2DFE A;  3OYA A;  1S6Q A;  3OS1 A;  4E7I A;  4DS5 A;  5DMR A;  1C1B A;  2DFF A;  3AO4 A;  3LAL A;  1KRP A;  4KRF A;  2KFN A;  2PYL A;  1T7P A;  1EKE A;  3B6O A;  3BDP A;  1TK5 A;  4PWD A;  4TSX A;  2FC0 A;  2O4G A;  4GVM A;  1NK5 A;  5CY4 A;  1T05 A;  4E7J A;  2QKB A;  1ZBI A;  3AVF A;  4FZX C;  3AVC A;  1RT4 A;  4MFB A;  2FBV A;  3PO4 A;  4CJ4 A;  3LAM A;  4E0D A;  4J2D A;  3P1G A;  1W9H A;  3T3F A;  4C8M A;  1LV5 A;  2P51 A;  4RW4 A;  3O3F A;  3KLG A;  2YNF A;  4DG1 A;  4CGI A;  3PX0 A;  4DTM A;  4Z0U A;  4B9U A;  2HVI A;  5JS2 A;  3V9X A;  1GOC A;  2KFZ A;  5K14 A;  3HXM A;  3QIO A;  4CHP A;  3ZSX A;  2YV0 X;  3PX6 A;  4CEZ A;  1RCH A;  3K2P A;  3M8R A;  2IOC A;  3NFA A;  5EU7 A;  4BAC A;  2PYJ A;  4DF4 A;  1BL3 A;  3OS2 A;  1JLA A;  1RTD A;  3LZJ A;  1JLG A;  2OYQ A;  2WON A;  1YT3 A;  2E4L A;  4NYN A;  3ZSR A;  4AHU A;  1BI4 B;  4OKJ A;  4CJT A;  4E19 A;  5SZT A;  3KLF A;  4HUG A;  4BDZ A;  4Z4F A;  4DQQ A;  3DOL A;  2G8I A;  4KB0 A;  1QSL A;  4O44 A;  3L2Q A;  2XHB A;  4DFP A;  3QNO A;  4Q0B A;  2A1S A;  3KTQ A;  2D0A A;  2HHT A;  1WSI A;  1WAF A;  4E1N A;  1C1A A;  1BIZ A;  4C8N A;  3SUQ A;  1JL1 A;  4FJ5 A;  2Z1I A;  3SQ2 A;  3ZT2 A;  3AVK A;  4DFK A;  4DQP A;  2LSN A;  3AA5 X;  3DLB A;  3V9S A;  1IKW A;  3QEX A;  3WNE A;  1KVA A;  2B5J A;  2G8W A;  3AO5 A;  2BE2 A;  5CZ2 A;  4B9N A;  3HJF A;  4B9T A;  1C6V A;  1UA0 A;  1NK8 A;  1BQN A;  1LW0 A;  3HPH A;  2HMI A;  4FM1 A;  1BGX T;  2IDO A;  1JXB A;  2B4J A;  2DFH A;  4YFU A;  3LDS A;  2OA8 A;  4B9V A;  3UIQ A;  1VRU A;  1ZBH A;  5HLF A;  4CFB A;  1G15 A;  4KHN A;  1UAX A;  1TL3 A;  1X1P A;  4XIU A;  3PO5 A;  4OPK A;  1D9F A;  1NJY A;  5CZ1 A;  1REV A;  1VSJ A;  2YKM A;  1RBU A;  4CED A;  4G1Q A;  3NAE A;  1C0U A;  3TAQ A;  4CGD A;  4OKK A;  3TAN A;  1C0T A;  3TI0 A;  4DU4 A;  3ZT0 A;  1CZ9 A;  4DTP A;  3VQC A;  1NK4 A;  4Q5V A;  3CM5 A;  2W42 A;  5HRO A;  2VG6 A;  1U47 A;  3P83 D;  1RDC A;  4CJL A;  1HMV A;  1VSI A;  3WNH A;  3ZSY A;  4AHS A;  3RTV A;  2QKK A;  3NGI A;  2YNG A;  3NGY A;  4KFB A;  3V1R A;  3KKS A;  4DSI A;  3ZSO A;  5I3U A;  3QLH A;  1NK7 A;  2E6L A;  3K5M A;  1IKX A;  1QSY A;  2OPQ A;  4DFJ A;  4Y1C A;  4EZ9 A;  4IFV A;  1HNV A;  4CF9 A;  4CEQ A;  3RMB A;  2A1R A;  3ISN C;  4M3Z A;  3OYN A;  3V6D A;  2AJQ A;  3HP6 A;  2VG7 A;  4FLY A;  4KHS A;  3T19 A;  1WSJ A;  2QK9 A;  3WNF A;  4E7K A;  3RRH A;  1TK0 A;  4IKF A;  4RW9 A;  3AVM A;  2G8H A;  3U3Y A;  4FLU A;  3VN5 A;  4PQU A;  2Y1J A;  4NYF A;  2Z1G A;  4M3W A;  3SQ4 A;  4DSJ A;  4K8Z A;  4M3U A;  1LWE A;  3VQP A;  3NBP A;  3TWH A;  5T7B A;  3LAK A;  3EYZ A;  4CK3 A;  2WOM A;  3ZT1 A;  1JL2 A;  1RIL A;  1S1T A;  2HNY A;  4CHN A;  4M42 A;  3U6F A;  3DYA A;  3VQ9 A;  1NJZ A;  4W5O A;  1J53 A;  3NF6 A;  1U45 A;  2G8K A;  3U3G A;  4BDP A;  4KI6 A;  1RTI A;  2X6N A;  4CJQ A;  3CFP A;  1TL1 A;  4FZZ A;  4F8R A;  4AIL C;  1KTQ A;  1QHT A;  2OPP A;  4OKE A;  1HRH A;  3V9W A;  1BIS A;  1QTM A;  4PUO A;  4RW7 A;  3OYE A;  4FJM A;  5J2N A;  3V81 A;  3LAN A;  4H4O A;  4CF8 A;  1KSP A;  1TVR A;  2Z1H A;  2ZD1 A;  2D0C A;  1KCF A;  3RR8 A;  3DM2 A;  2P1J A;  1VRT A;  3F9K A;  3MEC A;  2HNZ A;  3HPG A;  4DTN A;  3NDK A;  1SL1 A;  4FJN A;  4CF2 A;  1RDD A;  4UQG A;  1RDB A;  4BE0 A;  3PV8 A;  4HVJ A;  1X9S A;  1NK9 A;  1JLF A;  3OYG A;  3I8D A;  3C6U A;  5KI6 A;  3AO1 A;  4AHR A;  2RF2 A;  4CJS A;  3LWL A;  4CIE A;  3AVN A;  1A5W A;  4E3S A;  1TKD A;  1JLE A;  4LSN A;  3SV3 A;  1O1W A;  3QES A;  1ASV A;  4CFA A;  3QO9 A;  4CJW A;  2KW4 A;  1VSK A;  3AVG A;  3H08 A;  3L2U A;  4J2A A;  1FKP A;  4C8K A;  3RMD A;  3AO2 A;  2F8T A;  1RNH A;  5E41 A;  4QOZ B;  4ZTF A;  1YVU A;  1EET A;  1S1W A;  3AVJ A;  3LP2 A;  4DMN A;  4JS4 A;  4FJJ A;  4FK0 A;  3AO3 A;  3QIN A;  1ZYQ A;  4HCB A;  1NJX A;  2XY8 A;  4Y1D A;  5FDL A;  1EXQ A;  4KPY A;  3DMJ A;  1TKT A;  1X9W A;  4CCH A;  2IGI A;  2FBT A;  3AVI A;  3SV4 A;  1DTT A;  3HPO A;  3LPU A;  3WNG A;  3MEG A;  3QEW A;  4K8X A;  3DOK A;  4CJE A;  4DLE A;  4FJ9 A;  2FBX A;  1HQU A;  4HUE A;  3QNN A;  1CZB A;  1YTU A;  3ZT4 A;  1WNS A;  5HBM A;  1NK6 A;  4LY7 A;  1HYZ A;  1S9G A;  1LWF A;  1BQM A;  3VQ5 A;  1RT5 A;  4J2B A;  3HST B;  4DSK A;  4CGJ A;  3JYT A;  3L2R A;  2GV9 A;  3OYC A;  4O5B A;  4FJ8 A;  2XRI A;  5SWM A;  2X78 A;  3KLH A;  1BCM A;  3LP1 A;  1QE1 A;  4C8O A;  1D9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...