1UOCA

X-ray structure of the rnase domain of the yeast pop2 protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
286
structure length
263
Chain Sequence
PPIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIYGIDGDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure and Activity of the Yeast Pop2 Protein: A Nuclease Subunit of the Mrna Deadenylase Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords POP2
total genus 81
structure length 263
sequence length 286
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uocA00
3A2FA 3NDKA 2ZE2A 3L2UA 4E7LA 4W5RA 1A5VA 4E1NA 1VSMA 3HL8A 3OYBA 2Z1HA 2XHBA 4ELUA 4CJKA 4FJGA 4FJ5A 5C42A 3RR8A 3OS2A 1NJWA 4FLYA 1T03A 4DFMA 3DI6A 4IG3A 3MXIA 3OYMA 1HYVA 3SUPA 2ITGA 4CJRA 4FLUA 4OKEA 4BDZA 3ZSWA 3DM2A 3P5JA 3RMDA 4M3TA 4DF8A 1S6QA 4CJPA 5SZTA 1S9EA 5J1EA 1QQCA 3SUNA 1QSSA 1YT3A 3MAQA 4E7JA 2DFFA 3VQPA 3NFAA 1QE1A 3WNFA 3CM6A 4YFUA 3LP3A 1Q8IA 5I42A 4H4MA 3SJJA 4DSIA 3PV8A 3TABA 1RDCA 2Z1GA 4E0DA 3LP1A 4CF8A 1BISA 3HK2A 1LWCA 4ZHRA 4KTWA 1IH7A 1T7PA 2A1SA 1BIUA 3RTVA 2RPIA 3T3FA 3SQ0A 2HHQA 4DFPA 2PYLA 3I8DA 4E7KA 4IG0A 3NHGA 1IKVA 4FJNA 3VQ4A 3ZT0A 4DMNA 4M41A 3SQ4A 1T05A 1L3VA 1WNSA 3AVMA 4O44A 3OYEA 4DSFA 4NYFA 3VA3A 4N5SA 1HYZA 2YKNA 4KAZA 4CJVA 3ZCMA 4CEBA 4DFJA 1BGXT 4CHPA 3OYGA 4CGHA 4DTRA 3NF7A 1BIZA 2R7YA 5E41A 1JLFA 3V9WA 1KCFA 1L3SA 2KTQA 1NK0A 3AVNA 4CJLA 3L3UA 3CFOA 3V9XA 4FJJA 1QSLA 4M3YA 1RDAA 1F21A 5HRNA 3KK2A 1EX4A 3AVIA 1BCMA 2WOMA 4WE1A 2XY7A 1SKRA 4J2AA 1BCOA 4DG1A 3OVNA 1U4BA 4FJ8A 4CJSA 4DLEA 3ZSYA 3SCXA 3NGZA 1GOBA 4M3UA 1GOCA 3DLHA 3LP0A 4OGCA 1RT3A 3OS0A 3OYDA 1LWEA 3OYJA 3IG1A 1ASUA 4DSJA 1SL0A 4JRPA 4CFBA 1D9FA 2XRIA 1RT7A 1U04A 4RG8A 4BWJA 4BDPA 1NK8A 1S1TA 1LW2A 3OYHA 4CHQA 1HRHA 3QLHA 3DLGA 4KTZA 3S3NA 1XHZA 1R0AA 1VSLA 3O4NA 3KKRA 3VQAA 3V81A 1DLOA 4FJKA 1ZBIA 1TKTA 2HHUA 4HUFA 2X74A 3AVLA 4G1QA 2FC0A 4OKJA 2OZSA 3KIOA 4C8KA 4CGGA 4CE9A 4DU4A 4FJMA 3MEGA 2HHWA 1KFDA 4DTPA 5HRRA 3S3OA 1BL3A 1CXUA 2O4GA 1NK5A 4CF2A 1LWFA 4LH4A 4W5OA 2Z1IA 2Y1JA 3K5LA 4KHYA 1XHXA 3M8QA 4ZTJA 4EZ6A 1VRTA 1RTJA 3T1AA 4CEDA 3HT3A 2HHXA 4FW1A 1WSGA 1RILA 2X78A 1WSJA 1JL2A 4LH5A 4Z4HA 3BDPA 1CXQA 4C8LA 5FROA 4AHUA 1Q9XA 2BDPA 5KI6A 1K6YA 4CK1A 3V9ZA 4CJTA 5HP1A 1G15A 2IAJA 3D0PA 1IG9A 3IRXA 4O0JA 5J2PA 4FZXC 4FJHA 3ZSVA 4RW7A 2FBVA 4CJ5A 4IKFA 1ZYQA 4CEEA 1W9HA 4FK4A 4BE0A 3DRPA 4EP5A 1Q9YA 2D0AA 1KLMA 4KKOA 1NOYA 1U47A 1ZBFA 4E7IA 3B6OA 4DTUA 3K2PA 1Z25A 1IKXA 4CHZA 4KO0A 4OVLA 3AVCA 3B6PA 2GUIA 3MEEA 4Z4FA 4AHVA 2W42A 1J5OA 3OY9A 1TL1A 4HUEA 1NJZA 2GV9A 3TAMA 4ICLA 1KRPA 4KTQA 2Y1IA 4CCHA 4FZZA 3HSTB 5CYQA 1D9DA 4HTUA 4KHSA 1HJRA 3MECA 3NE6A 3TI0A 1KLNA 4HUGA 3QINA 3SUQA 4B8CA 5CZ2A 5HLFA 5FRNA 1RT1A 2PYJA 3QEXA 3L2VA 1KSPA 3E01A 3HJFA 3KLFA 2RKIA 4DTSA 3QIPA 1S6PA 4XIUA 2IDOA 1EETA 1Z26A 4FM0A 1CZBA 1SUQA 3TANA 3VQ8A 5HRPA 1SKSA 1KTQA 2G8IA 3O3GA 2KQ2A 3VQCA 1I39A 1VK0A 3ZT4A 3NH1A 1JLQA 5HROA 3P1GA 3OYAA 4IFYA 4PQUA 4W5NA 4I7FA 4Z4IA 3CFPA 4ID1A 1RT2A 5I3UA 4LY7A 4CEOA 2Q3SA 2OPQA 4PA1A 4CK2A 4I9LA 3CYMA 4UQGA 4B9NA 4KPYA 4DTOA 4Z4EA 4IDKA 5HRSA 3L2WA 1C0TA 2HNYA 1Y97A 1VSJA 3PO5A 2ZD1A 4CESA 5J2MA 3THVA 3SZ2A 4FJLA 1J53A 1LAVA 3BGRA 3TAEA 4JRQA 4CF9A 3CQ8A 2NUBA 1JXEA 2A1RA 5K14A 2XY5A 4F4KA 3SQ2A 1I3AA 3ISNC 3KTQA 3OS1A 1BQNA 3ULDA 1XI1A 3AO5A 4M3XA 2FBTA 2HNZA 3F73A 3LAKA 3AO3A 3VQBA 1MU2A 3AVHA 3SI6A 4J2DA 1JLCA 1FXXA 2ATQA 3FFIA 3WNHA 4DSLA 3K57A 4FXDA 3NH0A 1LAWA 4IFVA 2IGIA 2VWKA 3ASMA 3SYZA 3RMAA 3VQ6A 3G0ZA 4M45A 1RBRA 3HPGA 3OYIA 5J2QA 4KV8A 4CJFA 1QTMA 4KHNA 1CZ9A 3KLIA 5KGWA 3I0SA 4Q5VA 3NGIA 1U45A 4L8RB 4M42A 3EYZA 3F9KA 3I0RA 1TV6A 1RTIA 3ALYA 4LD0A 4RW9A 4KFBA 4OPKA 4B9TA 1J54A 4NCAA 3OYCA 4CJWA 4K8XA 4FZYA 4RW4A 4DQQA 4FLTA 4Z4CA 4B08A 2G8UA 1ZBHA 4CIGA 4ELVA 2YNIA 4Y1CA 3DOLA 1ZBUA 2E6LA 3LZJA 2QKBA 5J2NA 3AO4A 4CFAA 1T8EA 3H08A 2PZSA 2HNDA 3TAFA 4QOZB 4CEFA 3AA5X 5JS2A 3RMCA 1LV5A 4F2RA 4Q0BA 3KK1A 1QHTA 1RBTA 5KRTA 3KD5E 1UA1A 4I2PA 1W0HA 4CF1A 4CIEA 2KFNA 1C0UA 1JXBA 1JLBA 1FKOA 2GBZA 1X9SA 1NOZA 2YHAA 2I5JA 3NBPA 1UAXA 1S1UA 3LANA 3RMBA 1C6VA 3SV3A 4DF4A 4F3OA 3MEDA 4HCBA 2O4IA 3HPOA 4CGDA 3K58A 1WSFA 4CF0A 4R5PA 3AA4A 1B9FA 3LALA 4JLHA 1IKWA 3TAPA 2VWJA 4QCLA 2HVHA 1C0MA 3NGYA 4DS4A 1KFSA 1X9MA 2Z1JA 3D45A 4KI6A 2OZMA 4O0IA 4FLZA 4DTNA 2G8VA 1IKYA 3QEIA 1TAQA 3C94A 3QERA 1RTDA 3QO9A 3LWLA 2VG5A 3AA3A 4HVJA 3PX0A 1FKPA 1YTUA 1YVUA 3AVKA 3P83D 1N6QA 1BI4B 2FBXA 3OYKA 5EU7A 3QIOA 4FJXA 1RDDA 3T19A 3CG7A 1XWLA 4HHTA 2LSNA 1CLQA 5CZ1A 1ZBLA 5KGXA 4FJ7A 4OKKA 4KB1A 4FCYA 4N47A 1SL1A 1S1VA 2JLEA 1S1XA 1VSIA 3ZSXA 3CFRA 1U49A 4FJIA 4FM1A 1ITGA 4EZ9A 5FRMA 3L3VA 2YV0X 3LP2A 3TR8A 1A5WA 4AHRA 4CEAA 1QSYA 2KZMA 2AJQA 2X6NA 2VG6A 1RBSA 1JKHA 1HNIA 1VSEA 2BANA 2YKMA 3C6TA 4FLVA 1LW0A 3TAGA 4LSNA 1NJYA 4KRFA 1L5UA 5C24A 1KVAA 3SPZA 3VQQA 4GVMA 3RWUA 4C8OA 4C8NA 1TK8A 4F3TA 4PUOA 4N76A 4IBNA 3LWMA 4DU3A 1WSHA 3DOKA 3KJVA 2HB5A 3SNNA 2RN2A 4J2BA 1U48A 3ZT3A 1RCHA 1RTHA 1HPZA 4OLBA 3M8PA 3V9SA 3VQEA 1UOCA 2VG7A 3K5OA 4NCGA 4FM2A 4FK0A 1L3TA 2D0CA 2D5RA 2OPSA 4CHNA 1NKBA 3LDSA 1VSFA 3ITHA 2QK9A 3L2QA 3TWHA 3HP6A 2P5GA 1NK6A 1WAFA 4K8ZA 2HMIA 1WAJA 4RW6A 4CFDA 1HNVA 4DQIA 4CJEA 3S9HA 5CY4A 4KHQA 2BGGA 2ZQBA 3OYLA 4B9MA 1KVBA 1TAUA 1JL1A 3AVBA 1B9DA 3ZSZA 4CEQA 4CJ4A 1D8YA 4B8AB 2HHTA 1C1BA 1BQMA 4MQ3A 2B4JA 2QXFA 2ETJA 2YHBA 2G8HA 2F8SA 4B9VA 2DFHA 3LPUA 2BE2A 3K59A 1S5JA 2FBYA 3DYAA 3MXJA 3SPYA 4B3OA 3QEVA 4QAGA 3CM5A 1DTTA 4DFKA 2IOCA 3HVTA 3LPTA 4I2QA 4GMJB 1TKZA 2PY5A 4DS5A 3AV9A 3UIQA 1EKEA 4H8KA 3NF8A 1JLGA 3AA2A 3L2RA 3V4IA 4OJRA 5CYMA 3OJUA 3LAMA 4M3RA 3PX4A 4BDYA 4DLGA 4ID5A 4PY5A 4FW2A 3OYFA 1NK4A 1QS4A 4E7HA 1BI4A 1RDBA 3AVFA 5KTQA 4CK3A 3EY1A 4DQSA 3AO1A 4CGIA 2JGUA 1VSKA 3QNOA 2XY6A 1HMVA 5DMRA 3TARA 4KB0A 1J9AA 4NYNA 5JS1A 1TK5A 4RW8A 2RF2A 4FLWA 3U3GA 1A5XA 1KVCA 3K5MA 4DU1A 4F2SA 4KREA 1JLAA 4BE2A 1X1PA 3V9UA 4M3ZA 3U3YA 4FYDA 3RR7A 3VQ7A 4DSEA 1GOAA 3DLKA 4OPJA 3QETA 3AVAA 2YNHA 5DK5A 2OPRA 3DLRA 4OGEA 3ZSRA 2HHVA 3QESA 1ASWA 3MXMA 3RRGA 3DLEA 2XO7A 2EHGA 3LZIA 3K5NA 4YNQA 4AHTA 4AHCA 2F8TA 1NKCA 2EX3A 3NH2A 4DQRA 2OA8A 1TGOA 3DRSA 4O55A 2P51A 3NF9A 1VSHA 1S1WA 1NKEA 4CJUA 2G8KA 4CHOA 2YNFA 1VRUA 4O4GA 3VQ9A 4CGJA 4JS4A 5HBMA 3PX6A 1RT6A 2WONA 2F96A 3G10A 4BACA 4CIFA 4CJQA 3JYTA 1FK9A 3WNEA 3IAYA 1EP4A 4DTJA 3U6FA 2G8WA 2KZZA 3HYFA 2B6AA 4O5BA 2KFZA 3DRRA 2IS3A 3C6UA 4CJ3A 4DTMA 3HP9A 3PUFA 4FLXA 3VQDA 3S3MA 3NCIA 3KKSA 1BHLA 1C1AA 1SV5A 1L3UA 2B5JA 3PO4A 1HQUA 1UWBA 3O4QA 4E1MA 3HM9A 4TSXA 4CEZA 3EZ5A 3RRHA 4DQPA 4Z0UA 3QEPA 5KRSA 3AVGA 1XC9A 2DFEA 3HO1A 4FJ9A 1RT5A 5FDLA 4CERA 1TK0A 1WN7A 2P5OA 2OYQA 3QNNA 1HYSA 3HVRA 1UA0A 3KK3A 1DTQA 3V1OA 4GW6A 2D0BA 4JS5A 4E3SA 4AILC 4W5TA 2E4LA 1N5YA 3KD1E 4H4OA 3KLGA 1O1WA 4DTXA 4HCCA 3VQ5A 1IO2A 1EXQA 2X6SA 4Y1DA 4F8RA 3IS9A 4LSLA 4NCBA 4KHUA 3OYNA 3ZSOA 2DTUA 2HW3A 4E89A 4W5QA 5D3GA 4CFCA 5C25A 1TVRA 3DLBA 1RNHA 4AH9A 4E19A 4BE1A 1RT4A 2HVIA 1D5AA 1NJXA 4M3WA 1WLJA 5SWMA 2DY4A 2YNGA 3OJSA 3M8RA 4MFBA 3WNGA 2HHSA 1NK7A 4Z4GA 1TKDA 4N41A 3HXMA 3V1QA 4CECA 2KW4A 1S9GA 3PY8A 4KHWA 1REVA 4C8MA 3VA0A 5T7BA 1C1CA 4BWMA 1SKWA 3NF6A 3O3HA 3KLHA 3SV4A 1JLEA 1RBUA 1NK9A 3ZSQA 3ZT2A 3SQ1A 2XY8A 3VN5A 1TL3A 1WSIA 4N56A 1TKXA 3SUOA 3L8BA 1RBVA 4B9SA 4DWIA 4FVMA 1HQEA 3M8SA 4B9LA 1WSEA 3AO2A 3NAEA 4PWDA 3C95A 4OLAA 3O3FA 4DSKA 3V1RA 3ZT1A 2OPPA 4CHYA 4FK2A 4EP4A 1YTAA 3JSMA 2IC3A 3QEWA 2QKKA 3HPHA 1ASVA 1VSDA 3DMJA 2G8FA 1X9WA 1B92A 3V6DA 1SL2A 4B9UA 3AVJA 4J2EA 3KLEA 4ELTA 2P1JA 3TAQA 4AHSA 4CGFA 2E6MA 4KI4A 4ZTFA 4I9QA
chains in the Genus database with same CATH superfamily
3NDKA 1A5VA 2XHBA 4FJGA 4ILHA 3RR8A 3MXIA 2CH6A 2ITGA 1IG8A 4CJRA 4FLUA 4JNEA 5GAEP 3E66A 1S9EA 4H5TA 1YT3A 3MAQA 3SBGA 3VQPA 4YFUA 4FWPA 4JD2B 1Q8IA 5AQGA 4H4MA 2OANA 5M1QA 4X66K 3LP1A 4E0DA 4MDAA 4CF8A 3HK2A 4IO8A 4ZHRA 3CCLN 2NRRA 1OH6A 5LMUK 3RTVA 3KK7A 3SQ0A 5FPEA 4DR1K 4DFPA 2PYLA 3BZKA 4BRNA 3IKMA 4O44A 4NYFA 3O9SA 4N5SA 1HYZA 4YOTA 3N4QA 4IXCA 4CJVA 4JKFA 4O8KA 4IWVA 5AQFA 4CEBA 4DFJA 3OYGA 3VF6A 1KCFA 3R6MA 1L3SA 1JCFA 4CJLA 3MN5A 5GAGP 3CFOA 3VGKA 3V9XA 1Q18A 4QCLA 3KK2A 1EX4A 2XY7A 4WE1A 3J7ZO 4J2AA 4DG1A 4CJSA 3ULEA 4DLEA 4JEPA 2UUBK 3VEVA 1GOCA 4OPHA 3LP0A 1NWKA 4OGCA 3IG1A 4FWKA 1OVYA 4JRPA 2V7ZA 2XRIA 4BWJA 4C1NK 1NK8A 1S1TA 3OYHA 3QLHA 3DLGA 4KTZA 3KKRA 4FJKA 2WFBA 4OKJA 4JI2K 5F1XA 1BL3A 1NK5A 1TUYA 3WXMB 4A61A 2ZF5O 1NMNA 3RVCA 2Y1JA 5MLCQ 3M8QA 1MWMA 1VRTA 1RTJA 3VOVA 5C2FA 1WSGA 3LM2A 2X78A 1WSJA 4C8LA 5FROA 2WBNA 1K6YA 3V9ZA 3T1YK 5HP1A 1G15A 2IAJA 3SMPA 3IRXA 4KH6A 4RW7A 4IKFA 4CEEA 2ZJQL 1W9HA 2VQEK 4YOWA 1KLMA 1NOYA 1ZBFA 3DWLA 4E7IA 3B6OA 5IWAK 1IKXA 4CHZA 1YJWN 4KH4A 2FXUA 2W42A 1WB9A 3OY9A 4HUEA 1NJZA 1QQOA 3R8EA 5AQRA 2Y1IA 4CCHA 3HSTB 1LCUA 1D9DA 4KHSA 1Z05A 3MECA 3TI0A 2GTDA 3SUQA 4NLCA 4CD3A 3E01A 5JICA 3KLFA 2RKIA 4AF1A 2E2NA 1Z26A 1CZBA 3TANA 1N33K 3NVKA 3G25A 4LF6K 2G8IA 1BWFO 4R79A 1ESVA 4FO0A 3ZT4A 1JLQA 5KPTA 5HROA 3I55N 4AM7A 4PQUA 4Z4IA 3CFPA 1RT2A 4LY7A 4UQGA 4I9LA 3OBYA 4Z4EA 4BG9A 4IDKA 1C0TA 2HNYA 1Y97A 1VSJA 5J2MA 3O1BA 4RTFD 1XUPO 3SZ2A 3ZETA 4U67L 5CHIA 3CQXA 2FF6A 1JCEA 1BA0A 3KTQA 3NVMA 2V7YA 2FBTA 2HNZA 3F73A 4Z94A 3PLAA 1MU2A 3AVHA 1JLCA 4FXDA 3FFIA 3THXB 4YOYA 3QFUA 5J2QA 1QTMA 5C0YA 1CZ9A 3A5MC 3FGUA 3I0SA 3KLIA 3EYZA 3F9KA 3DLLL 5M1NA 3C65A 1VQNN 3MWTA 4WYBA 2W6KA 1T44A 4FLTA 3ENHA 3EL2A 4CIGA 3DOLA 4DR3K 3T1HK 1T8EA 1VQ5N 1HNZK 3AA5X 1QHTA 4DR4K 5AQMA 4CZEA 1W0HA 3SAHA 4CF1A 2QWNA 2IIRA 1X9SA 4B9QA 4I6MB 5AQLA 3IDHA 3LANA 4PL8A 2V51B 1NM1A 5M1FA 4HCBA 4CGDA 2FSNA 4CF0A 3AA4A 4JLHA 4GVEA 3TAPA 1C0MA 2Q2RA 1FJGK 2OZMA 4DTNA 1ZXOA 3QEIA 3NMUA 3QERA 3QO9A 4QS9A 1OH5A 5AFUH 1YJ9N 4QS8A 3KHYA 2VWBA 2FBXA 3QIOA 1RDDA 3GBTA 3J81O 1YJNN 1ZBLA 4BQLA 4FCYA 4N47A 2YJFA 3CFRA 1VSIA 1U49A 4CEAA 1QQMA 2BANA 1LW0A 1WBBA 1KVAA 3WXIA 3SPZA 3VQQA 4Y0WA 3RWUA 4C8OA 1BG3A 1TK8A 4PUOA 4IBNA 2PFUA 4AM6A 3MX2A 1RCHA 4B1ZA 1P90A 3K5OA 4FK0A 3PSIA 1L3TA 1NLVA 2YJEA 1VSFA 3ITHA 2QK9A 4IOAL 4H0YB 2P5GA 2O8EA 1WAFA 4JI7K 2NRWA 2Q1NA 4CFDA 3S9HA 2ZM6K 1JL1A 3AVBA 1B9DA 4B8AB 5CR4A 2G8HA 4JKEA 4WQ4A 4FWNA 3QEVA 3CJBA 3PIOL 2P9PB 1DTTA 3WEEA 3HVTA 4GMJB 4JI1K 4DS5A 3UIQA 1JLGA 1W97L 3PX4A 5AR0A 3OYFA 3P39A 4DQSA 1VSKA 1HMVA 3OBWA 4M7YA 4DU1A 1JLAA 4BE2A 1X1PA 3V9UA 2UXDK 4M3ZA 3U3YA 4FYDA 3CPWM 3RR7A 4OPJA 3AVAA 2YNHA 3VENA 2E1YA 3QICA 5DK5A 2WTUA 1OH7A 2QI2A 3QESA 3MXMA 2O8DA 3WXJA 3K5NA 1NKCA 3ZLJA 2OA8A 5KQ8A 1GLCG 3M5RA 3NF9A 4DR7K 4GV9A 1VSHA 2P9UA 4CJUA 4CHOA 4WF9L 5CE3A 3VQ9A 1RT6A 3JYTA 3WXLA 3HYFA 2KFZA 4LFAK 3C6UA 4DTMA 3HP9A 3VQDA 3KKSA 1BHLA 1C1AA 1QQNA 1L3UA 2B5JA 5GIOA 3EZ5A 3DAWA 4E1MA 4TSXA 3DXKA 3H45C 3QEPA 5KRSA 1NGDA 4FJ9A 5FDLA 2P5OA 5EY4A 1Z6RA 3QDKA 1UA0A 1BUPA 1DTQA 3V1OA 2D0BA 4JS5A 4E3SA 1C0FA 4H4OA 1EXQA 4NCBA 1HKCA 3AAPA 2HW3A 3EKUA 2V52B 4E89A 3F9MA 4CFCA 5D3GA 1TVRA 2P9SA 4AH9A 1D5AA 2O8EB 3OJSA 2P9SB 4XH5A 1NK7A 1SAZA 3MMVA 3R3LA 3AARA 5FPNA 1C1CA 1K9MO 3EZWA 4FWMA 1JLEA 2HF4A 1RBUA 3BY5A 3SQ1A 2XY8A 4J8FA 4N56A 2HBJA 3P38A 1RBVA 4OX9K 2O8CA 3NAEA 1HJOA 1K8KA 5JLFA 4WQ4C 1K8KB 3JS6A 3QBXA 3VGLA 3JSMA 2IC3A 3QEWA 3HPHA 1X9WA 1YVNA 4G9ZA 4J2EA 2VYPA 4CGFA 2E6MA 4E1JA 4I9QA 1HR0K 3A2FA 1YHQN 1DEJA 3CD6N 2NRXA 3HL8A 2Z1HA 5BREA 3CCJN 3CCQN 3WUHA 3KVGA 3SUPA 3P5JA 4CJPA 3SUNA 3LDQA 4E7JA 3TAFA 1V4SA 2P9IA 3SJJA 4FL9A 3THXA 2Z1GA 1BISA 1LWCA 4M7XA 4KTWA 1T7PA 2A1SA 4K42A 2RPIA 5TKWA 1IV0A 1MDUB 2UXCK 1W2BM 4E7KA 3FZLA 2A40A 4FJNA 4M41A 5B8HA 3SQ4A 1W7AA 3OYEA 3VA3A 4HWIA 3MN6A 4H5RA 3Q7CA 2ZGYA 3NF7A 1BIZA 5GINA 5E41A 2R7YA 1GLAG 1NK0A 1QVFM 3CIPA 4M3YA 2P9NA 1NBWA 1RDAA 2WOMA 2CGJA 1BCOA 4I6MA 3SCXA 2ZWHA 3ZX2A 3OYJA 3H3NO 4IOXA 4ILGB 4CZIA 1QZ6A 2E5LK 4CFBA 3MDQA 1D9FA 1U04A 1RT7A 4BDPA 3FZKA 3CCVN 1IBLK 1VHXA 3V81A 4CVNE 2P9KA 4XH4A 1TKTA 2A42A 3O8MA 3AVLA 3VTHA 4CE9A 4DU4A 3MEGA 2HHWA 1KFDA 4DTPA 2QW9A 3S3OA 1CXUA 1GLJO 1BO5O 4CF2A 3CC2N 4CZMA 2A41A 4X62K 3K5LA 4CBWA 4RWTA 3HOTA 1VQ9N 4EZ6A 1HNWK 2HHXA 4WFBL 3BDPA 4Z4HA 2PBDA 2BDPA 4CK1A 4CZFA 3DJCA 5LY3A 1XC3A 3C6AA 2IVOA 5J2PA 4FJHA 2KLAA 3SMSA 4BE0A 4GV6A 1Q9YA 2D0AA 5C2DA 2CGLA 1U47A 3TTFA 2H3GX 1YAGA 4DTUA 3K2PA 3AAQA 3O5BA 1MA9B 3H1QA 3W0LA 3AY9A 1GLEG 1LOTB 4BRHA 4Z4FA 4BVPA 3UE5A 4ICLA 4KTQA 5CYQA 3WT0A 1HJRA 3NE6A 4HUGA 3M6GA 4BG8A 4B8CA 5CZ2A 2PYJA 3QMLA 1KSPA 4KBOA 4H5VA 4OPAA 2F4VK 3FZFA 1EETA 4FM0A 5HRPA 1SKSA 1Y64A 4JK7A 4GV3A 1I39A 4A59A 1VK0A 4I7FA 3WEEB 5C15A 4PA1A 4B9NA 4KPYA 3CYMA 4BRAA 3M3ZA 3L2WA 3U9DA 3ENBA 3BGRA 3A0IX 3TAEA 4NO7A 3UKRB 4CF9A 1JXEA 2XY5A 4F4KA 1R59O 3CQYA 4CI6A 3ISNC 3OS1A 3ULDA 2RHKA 3N4PA 1HKBA 3WNHA 4DSLA 1NJIO 2VWKA 3SYZA 3VQ6A 3FZMA 4Q5VA 3MX5A 4M42A 5AQPA 4IFEA 3R9PA 4YDUA 3ALYA 1Q82O 4RW9A 4OPKA 1ZBHA 2G8UA 1KC8O 4Y1CA 3AO4A 3FR0A 4WCEL 4BR4A 4H0VB 3TTDA 4B1YB 1LV5A 4DR2K 3VEWA 1RBTA 5KRTA 3KD5E 3K0SA 1NGAA 4CIEA 1JXBA 5GIPA 4O8UA 2I5JA 3VMFB 1S1UA 2GUPA 3RMBA 3ENOA 4F3OA 4DF4A 1J6ZA 1WSFA 2ASMA 5LJWA 3NGYA 4DS4A 3BP8A 2HBKA 2Z1JA 1H1VA 3D45A 5KPZA 4O0IA 2G8VA 1IKYA 3PX0A 4JYAK 1YTUA 3P83D 1BI4B 1WUAA 3A5LC 3LDNA 5EU7A 3T19A 3VEXA 3CG7A 5FLXO 1XWLA 3HI0A 1CLQA 1SL1A 2JLEA 1TYQA 1SZ2A 4FM1A 5FRMA 2YCHA 2YV0X 3LP2A 2KZMA 1A5WA 1TYQB 4JD2A 2X6NA 4K41A 1HNIA 1VSEA 4KRFA 2D1KA 4PHTX 1XNRK 4AQYK 1L5UA 3CCRN 1Q86O 3GE1A 4C8NA 2FSKA 4DU3A 2W40A 3DOKA 4GKJK 2RN2A 4J2BA 1U48A 3ZT3A 1RTHA 1HPZA 3UKRA 4OLBA 3R1XA 3WQUA 3VQEA 1UOCA 2IVNA 2VG7A 3THYA 4M63C 4CHNA 2OPSA 1NKBA 3L2QA 1NGFA 3O80A 3HP6A 1NK6A 1WAJA 3ZX3A 4DQIA 4CJEA 5CY4A 4KHQA 3AGRA 5AQNA 2ZQBA 2BGGA 3OYLA 3BF1A 4CEQA 1D8YA 2HHTA 1C1BA 2YHBA 2ASPA 3HRGA 4H03B 1S5JA 2FBYA 5F0XA 5FPMA 3VGMA 4QAGA 4DFKA 5E26A 3CF5L 2PY5A 3VESA 1NU0A 3AA2A 3M1FA 3OJUA 3C0BA 3LAMA 1NK4A 3EY1A 3AO1A 5AQXA 1J9AA 3FFKB 2QWRA 4LC9B 4NYNA 5JS1A 1TK5A 3ATVA 4RW8A 4BROA 4FLWA 3U3GA 5IT9O 1KVCA 2GWJA 3O9UA 3H1VX 3DLKA 3OA9A 1GLLO 2OPRA 3DLRA 4JKGA 2XO7A 2EHGA 5EXWA 1T6DA 3VF4A 3NH2A 4DQRA 3SK3A 3CHWA 4B1WB 2VGMA 1S1WA 5M1KA 3PX6A 4CGJA 4CJQA 1FK9A 3WNEA 2G8WA 3EE9A 4O5BA 3PUFA 1BU6O 3TSUA 2E20A 1S22A 5TKYA 4CD1A 3RRHA 4FWOA 1VQPN 1SS6A 3HO1A 1RT5A 4CERA 4EFHA 5AQZA 3P31A 3KK3A 2HBMA 1N5YA 4W5TA 2JWLA 3CMEN 1BOTO 3KLGA 1O1WA 4DTXA 4HCCA 4BR9A 4V19S 3VQ5A 4CW7B 1DT9A 2DTUA 4B3MK 3DLBA 5BPMA 1SQKA 4E19A 3CCUN 5AQQA 1WLJA 2DY4A 4B3SK 4IEEA 3M8RA 1N34K 2KW4A 1S9GA 3FZHA 1REVA 5T7BA 3KLHA 4IO9L 4DV6K 3J7AP 4LFCK 1TL3A 5ADXA 2ZGZA 1TKXA 4B9SA 4JK8A 1HQEA 2UUAK 4GNIA 3O3FA 3V1RA 2OPPA 1VAZA 3FE1A 3I8BA 1ASVA 1VSDA 3A5NC 4BR5A 2P9PA 2P1JA 3TU5A 1E4FT 1RFQA 1QVGM 2ZE2A 1U2VA 3L2UA 4W5RA 3HM8A 3OYBA 5C10A 4CJKA 4ELUA 5C42A 3OS2A 1NJWA 4CZJA 4FLYA 1T03A 3DXKB 4IG3A 3OYMA 1HYVA 3U8XA 3ZSWA 3DM2A 4M3TA 5SZTA 3E1YA 3NFAA 1QE1A 3CM6A 1U6ZA 1RDCA 3A5OC 4BRPA 2AP1A 4ISGA 1IH7A 2NNWA 3D2EA 4JI3K 3T3FA 4BRGA 1IBKK 2HHQA 3I8DA 4IG0A 2VGNA 3ZT0A 4DMNA 3IUCA 1T05A 4NXNK 4PKHA 4DSFA 4KAZA 3ZCMA 1NGGA 1BGXT 3HBTA 1JLFA 4BREA 2NRTA 2KTQA 2O8CB 1QSLA 5HRNA 1SKRA 3G6EN 4M3XA 1U4BA 2NRHA 4FJ8A 4M3UA 3ZSYA 2DPNA 3DLHA 3OYDA 3OS0A 4DSJA 1ASUA 1SL0A 5EVZA 2FF3B 2QEXN 1HYSA 4NLBA 1LW2A 4CHQA 4IDHA 5LMNK 1R0AA 1VSLA 4BGAA 1N8RO 4HUFA 2X74A 1RGIA 3GL1A 2FC0A 4G1QA 2OZSA 3KIOA 2JWKA 4CGGA 4FJMA 5HRRA 4IOCL 4BGBA 1LWFA 4LH4A 4W5OA 2Z1IA 4WQ5C 3U4LA 4KHYA 4BR0A 3MN9A 4JKDA 2NZTA 4ZTJA 3HT3A 5BRHA 1YF5L 4FW1A 4H0OA 4K0KK 1RILA 2YHXA 3LDOA 1JL2A 1CXQA 4ISFA 1Q9XA 1HLUA 1IJJA 4CJTA 3CCEN 3BF3A 1IG9A 4K43A 4FZXC 5M1PA 4CJ5A 4FK4A 4EP5A 3G4SN 1NGBA 4KKOA 1NMDA 1M1KO 3HOSA 4KO0A 4OVLA 1XMQK 2GUIA 3UB5A 4AHVA 1J5OA 3C6HA 5GADP 5I9EB 2UXBK 1C0GA 3THYB 3TAMA 1KRPA 2Q31A 3CJ1A 1KQSM 4XH1A 4HTUA 2Q0UA 1KLNA 3T7ZA 4BC4A 3VERA 5HLFA 5FRNA 1NGJA 3L2VA 1XMOK 4JKAA 4DTSA 3EN9A 3TTCA 2ZJPL 3QIPA 2IDOA 4DUYK 1K73O 1KTQA 4MLEA 3E9OA 3VQCA 1ZBSA 3P1GA 3CETA 4KHPK 4EHTA 1O13A 1GLDG 4CEOA 2OPQA 4DQ8A 1J5EK 1OKJA 1YITN 1Q81O 3VTIA 3PO5A 2ZD1A 1LAVA 3O1WA 3CQ8A 5JMVA 2A1RA 3SQ2A 3E9PA 5KPRA 1XI1A 1ZC6A 1NG9A 4J2DA 3LAKA 3VQBA 3CC4N 2ATQA 3K57A 2IGIA 3ASMA 3CJ9A 3RMAA 3G0ZA 4M45A 1RBRA 4KHNA 3NGIA 3I0RA 1RTIA 4XEIA 1N32K 4MLHA 2UYTA 4BRQA 4B9TA 1J54A 4NCAA 3OYCA 4Z4CA 4B08A 4ELVA 3SAFA 1ZBUA 2E6LA 3LZJA 4BR2A 2QKBA 5J2NA 4GKKK 4CFAA 1E3MA 4QOZB 4CEFA 3RMCA 4K25A 1G99A 2HBLA 2FSJA 4I2PA 1RDUA 3THWB 2KFNA 1FKOA 2UUCK 2GBZA 4BQZA 2YHAA 4PKIA 5AJ3K 1T3VA 3CI5A 4DHYA 5AQJA 4FOEA 3Q7BA 5BPLA 4JHDA 3SV3A 1VQON 4KH5A 1S3XA 4U7BA 2O4IA 4JN4A 3HPOA 3K58A 3C7NB 4DV3K 2QWPA 4H5WA 3L4QA 1X3NA 1IKWA 3EE8A 2VWJA 2HVHA 4FWQA 4NXMK 1DGKN 1KFSA 4JKBA 2QA4N 4KI6A 3C94A 1RTDA 3EKSA 3LWLA 2VG5A 3AA3A 4HVJA 1FKPA 2HHHK 1NGHA 3AVKA 2J4RA 5BPNA 3OYKA 5GAHP 2LSNA 4A5AA 4FJ7A 5KGXA 4OKKA 4CBXA 2HMPA 5BN9A 3ZSXA 2E2OA 1ITGA 4EZ9A 3TR8A 4AHRA 4DV0K 2P9IB 3ID8A 2VG6A 2YKMA 4FLVA 3TAGA 1NJYA 3WXKA 3I33A 3J8AA 5C24A 3RSEB 4JKCA 4EAHD 4F3TA 3LWMA 1WSHA 4DV2K 4NCGA 4CZHA 4FM2A 5A2QO 5BR9A 2D0CA 4BRIA 3LDSA 2CH5A 1U2VB 3TWHA 1BA1A 3I56N 4RW6A 5AQUA 4JKGB 2YHYA 2F9WA 2B4JA 2F8SA 3JXUA 2W41A 4B9VA 2DFHA 3LPUA 2BE2A 2E2PA 5AQSA 4B3OA 2GELA 3VF2A 3CM5A 3ID6A 3L4IA 2IOCA 1KXPA 4B1UB 5JVHL 3PIPL 4NB4A 2HSTA 4H8KA 3NF8A 4H0XB 3AGKA 5CYMA 4DLGA 4ID5A 4PY5A 4FW2A 5BRFA 1QS4A 5FPDA 2P9KB 1BI4A 3O9RA 2XY6A 3QNOA 1XNQK 3D6RA 4FWLA 3TARA 4JI5K 1QHAA 4JV5K 1OH8A 3K5MA 1A5XA 4F2SA 5AQHA 4O5FA 4LF5K 1VQLN 2ASOA 4JHDB 3LL3A 4H0TB 3VQ7A 1GOAA 4DSEA 4OGEA 3DXMA 3ZSRA 2HHVA 1ASWA 3RRGA 3DLEA 3D2FA 2I7PA 4OO1J 1VQ8N 3MCPA 4YNQA 4AHCA 2F8TA 1HX1A 1TUUA 3K9KA 3DRSA 5E84A 2GX9A 1NKEA 2WC9A 2G8KA 1VRUA 2O8FA 2WONA 2F96A 4YORA 4BACA 3IAYA 4K8ZA 3ZETB 3GDQA 4IEIA 3GG4A 4DTJA 3U6FA 1MWKA 2KZZA 2WUSA 3S41A 4WQ5A 2IS3A 1Q7YO 3U9ZA 3NCIA 1SV5A 2UU9K 1UWBA 1YIJN 4CEZA 3TPQA 3SBTA 4YDUC 4YOVA 2RE2A 4BRFA 3AVGA 2DFEA 2EWSA 3QNNA 4LF7K 3HVRA 3KWIA 3WQTA 3SAGA 4GW6A 4AILC 1VQ7N 4F9OA 1I94K 4C1NI 4Y1DA 4F8RA 3IS9A 4LSLA 4KHUA 2YX6A 2YI1A 3OYNA 3VEOA 3ZSOA 1KD1O 1P8ZA 5C25A 1RNHA 4BE1A 1RT4A 2HVIA 1NJXA 4M3WA 3MWPA 2YNGA 4MFBA 3WNGA 4CZKA 1S72N 2HHSA 1TKDA 4N41A 3V1QA 4CECA 4CZGA 1VQ4N 3PY8A 4DV5K 4C8MA 4BWMA 2QWOA 3NF6A 2A5XA 3SV4A 2D0PA 1NK9A 3ZSQA 3VN5A 3SUOA 1ILYA 2PAVA 4LF8K 3L8BA 4FVMA 4B9LA 3M8SA 3OW2M 1WSEA 3AO2A 1HNXK 4JI0K 4BC5A 3ZT1A 4BRDA 2O8BB 2OCEA 4FK2A 4EP4A 1YTAA 3HTVA 3IMXA 2QKKA 2GEMA 3HZ6A 1VQKN 5AQIA 1B92A 4B9UA 3ATUA 5M1OA 4AHSA 4KI4A 4A62A 4RCHA 4E7LA 4DTOA 4E1NA 1VSMA 4FJ5A 3H3OB 2ITMA 4JKHA 4DFMA 3DI6A 3QFPA 4OKEA 1YXQA 4BDZA 3RMDA 4DF8A 1S6QA 4FWSA 1QSSA 5J1EA 1YUWA 1QQCA 2HOEA 1GLBG 4JAXA 2DFFA 3WNFA 3LP3A 2I7NA 5I42A 4DSIA 5DM6L 3PV8A 3TABA 4BC2A 3BEXA 4IJAA 1NGCA 2F7TA 1BIUA 3CPEA 4WFNL 4L3QA 2O8FB 4DKWA 4DV4K 3B8AX 1IBMK 3NHGA 1IKVA 4ISEA 3OTOK 3VQ4A 3CCMN 1L3VA 1WNSA 3AVMA 3CCSN 2QWMA 5BR8K 2HF3A 2YKNA 4BR7A 4CHPA 5HL7L 3FLCO 4CGHA 4DTRA 5F2RA 4BRMA 3V9WA 1YI2N 3AVNA 3L3UA 4FJJA 3O9QA 1F21A 3AVIA 1BCMA 2YHWA 4CJ7A 4FWRA 3OVNA 3NGZA 1GOBA 1RT3A 1LWEA 2E2QA 2NRZA 1KAYA 5BN8A 4RG8A 3VETA 1XHZA 1HRHA 3S3NA 5AZIB 3P4IA 3C7NA 3O4NA 3VQAA 3QBWA 1DLOA 1ZBIA 2HHUA 4JI6K 4MO5A 3VEZA 4C8KA 2O4GA 5AQKA 1XHXA 3MN7A 5AFUA 4CEDA 3T1AA 2KKZA 2GWKA 2NRVA 4LH5A 4AHUA 5KI6A 2QWLA 1D4XA 2QTDA 3D0PA 4O0JA 3ZSVA 2FBVA 5AQTA 1ZYQA 2P9UB 2ZJRL 4FVUA 3DRPA 1T6CA 1CZAN 1JJ2M 3H6EA 3MCAB 3LM9A 1Z25A 2E1ZA 3AVCA 4EIAA 3B6PA 1HPMA 3MEEA 1EWQA 5AQWA 4A2AA 1TL1A 2GV9A 4YOUA 4IJNA 4PKGA 5JVGL 4FZZA 3TSPA 3QINA 1RT1A 3QB0A 3QEXA 3EEQA 4HTLA 3HJFA 1S6PA 3ZEUB 4XIUA 3L6QA 2P9NB 1SUQA 3VQ8A 3O3GA 3SLCA 2KQ2A 1V4TA 3LDPA 3BZCA 3NH1A 4DCHA 3OYAA 3TSQA 4IFYA 4W5NA 4ID1A 5I3UA 1ATNA 2Q3SA 4CK2A 3CJCA 1HKGA 5HRSA 1E4GT 4CESA 3THVA 4FJLA 3HSCA 1J53A 4JRQA 2NUBA 3OHRA 4DUZK 5K14A 1I3AA 2BH1A 1BQNA 3AO5A 3SI6A 2D4WA 4CZLA 3AO3A 2VQFK 3CMAN 4CBUA 1FXXA 3NH0A 1LAWA 2D0OA 4IFVA 1FW6A 3HPGA 3OYIA 4KV8A 4CJFA 5EOYA 5KGWA 1U45A 4L8RB 5AZIA 1X3MA 1TV6A 4LD0A 4A57A 3H46O 4KFBA 3L0QA 3F5TA 4CJWA 4K8XA 4FZYA 3PSFA 4RW4A 4DQQA 4BRLA 4LF4K 4LF9K 1EWRA 2QXLA 2YNIA 5LL6Z 3H08A 2PZSA 2HNDA 3O08A 5JS2A 4F2RA 4Q0BA 3KK1A 3CJAA 5BRDA 1UA1A 4FOIA 5ELZA 1C0UA 1JLBA 3T69A 2O8DB 1NOZA 3ULEB 3NBPA 1UAXA 4MDBA 1K8AO 1C6VA 4JI8K 4JI4K 3MEDA 3O6WA 4FPAA 4YOXA 5AQVA 1KAZA 4R5PA 1B9FA 3LALA 4JK9A 1EQYA 1BDGA 2P9LB 1NGEA 1X9MA 3UKUA 4BC3A 2P9LA 4FLZA 1TAQA 4GY2B 4WFAL 3CJ7A 2OTLN 1YVUA 2Q97A 3LDLA 3IFRA 1N6QA 4FJXA 3ZEUA 4HHTA 5CZ1A 1WOQA 3KZBA 4KB1A 1S1VA 1S1XA 3G71N 4FJIA 3L3VA 1QSYA 3CXCM 2AJQA 1KAXA 3GOIA 3W3DA 3CERA 1RBSA 1JKHA 2A3ZA 3C6TA 4H0PA 4LSNA 5C12A 1WBDA 5KQDA 4GVMA 2E88A 1JCGA 5ADXH 4N76A 2O8BA 3EO3A 3D2EB 3KJVA 2HB5A 3SNNA 5LJVA 5EX5A 2OTJN 3M8PA 3V9SA 4QS7A 4A5BA 3BUZB 1ATRA 2D5RA 1M90O 1OVQA 5AQOA 2HMIA 3J7YP 1HNVA 1X9JA 2BTFA 4B9MA 1KVBA 1TAUA 3ZSZA 3ZYYX 4CJ4A 3D2FB 4MQ3A 1BQMA 2QXFA 4DV1K 2ETJA 3SPYA 3K59A 3DYAA 3MXJA 4BY9C 3J80O 4X64K 1VQ6N 3LPTA 4I2QA 1TKZA 1ATSA 3AV9A 4BRKA 1EKEA 4MO4A 3L2RA 3V4IA 4OJRA 1DKGD 4M3RA 4BDYA 4E7HA 1RDBA 3AVFA 3O4WA 4CK3A 5KTQA 4LFBK 4CGIA 2JGUA 1HUXA 2QM1A 5DMRA 4KB0A 1GLFO 2KHOA 3ZX0A 2F9TA 2RF2A 3A8YA 4KREA 4YY3K 4ILJA 3VEYA 5H1SQ 5DM7L 2QWQA 3F2KA 3QETA 4PL7A 1RDWX 3RSEA 3THWA 3LZIA 4BVOA 2Q36A 3O9TA 4AHTA 4B1XB 2EX3A 4X65K 1TGOA 4EHUA 4O55A 2P51A 3UKUB 3KWGA 2AA4A 2YNFA 4O4GA 4JS4A 5HBMA 3G10A 4CIFA 1EP4A 4DV7K 4B3TK 2B6AA 3DRRA 4CJ3A 4FLXA 3S3MA 3JAMO 5AZJB 4UY8O 4B3RK 2CGKA 3PO4A 1HQUA 5AZJA 3O4QA 3HM9A 4DQPA 2W6LA 4Z0UA 4A2BA 1XC9A 4FSVA 1TK0A 1WN7A 2OYQA 2E8AA 3CC7N 3KD1E 2E4LA 3K9JA 1IO2A 2X6SA 1NNEA 3SJHA 2BUPA 4DB3A 4IZ9A 1VQMN 4W5QA 5AQYA 2VCPA 5SWMA 4DR5K 2FLOA 4Z4GA 4KHWA 3HXMA 3VA0A 1SKWA 1XQSC 3O3HA 2IVPA 1NGIA 3DXMB 1EO1A 3ZT2A 1WSIA 2A6AA 1N36K 5JLHA 4BRCA 3VPZA 4DWIA 4PWDA 5HOOA 3C95A 4OLAA 4DSKA 4C23A 4CHYA 1QZ5A 3DMJA 2G8FA 4DR6K 3V6DA 1SL2A 4H5NA 3AVJA 2Q0RA 3E9LA 3MK6A 3KLEA 2NLXA 4ELTA 4YHHK 3TAQA 4FPBA 3D7EO 4B1VA 4ZTFA
chains in the Genus database with same CATH topology
3A2FA 3NDKA 2ZE2A 3L2UA 4E7LA 4W5RA 1A5VA 4E1NA 1VSMA 3HL8A 3OYBA 2Z1HA 2XHBA 4ELUA 4CJKA 4FJGA 4FJ5A 5C42A 3RR8A 3OS2A 1NJWA 4FLYA 1T03A 4DFMA 3DI6A 4IG3A 3MXIA 3OYMA 1HYVA 3SUPA 2ITGA 4CJRA 4FLUA 4OKEA 4BDZA 3ZSWA 3DM2A 3P5JA 3RMDA 4M3TA 4DF8A 1S6QA 4CJPA 5SZTA 1S9EA 5J1EA 1QQCA 3SUNA 1QSSA 1YT3A 3MAQA 4E7JA 2DFFA 3VQPA 3NFAA 1QE1A 3WNFA 3CM6A 4YFUA 3LP3A 1Q8IA 5I42A 4H4MA 3SJJA 4DSIA 3PV8A 3TABA 1RDCA 2Z1GA 4E0DA 3LP1A 4CF8A 1BISA 3HK2A 1LWCA 4ZHRA 4KTWA 1IH7A 1T7PA 2A1SA 1BIUA 3RTVA 2RPIA 3T3FA 3SQ0A 2HHQA 4DFPA 2PYLA 3I8DA 4E7KA 4IG0A 3NHGA 1IKVA 4FJNA 3VQ4A 3ZT0A 4DMNA 4M41A 3SQ4A 1T05A 1L3VA 1WNSA 3AVMA 4O44A 3OYEA 4DSFA 4NYFA 3VA3A 4N5SA 1HYZA 2YKNA 4KAZA 4CJVA 3ZCMA 4CEBA 4DFJA 1BGXT 4CHPA 3OYGA 4CGHA 4DTRA 3NF7A 1BIZA 2R7YA 5E41A 1JLFA 3V9WA 1KCFA 1L3SA 2KTQA 1NK0A 3AVNA 4CJLA 3L3UA 3CFOA 3V9XA 4FJJA 1QSLA 4M3YA 1RDAA 1F21A 5HRNA 3KK2A 1EX4A 3AVIA 1BCMA 2WOMA 4WE1A 2XY7A 1SKRA 4J2AA 1BCOA 4DG1A 3OVNA 1U4BA 4FJ8A 4CJSA 4DLEA 3ZSYA 3SCXA 3NGZA 1GOBA 4M3UA 1GOCA 3DLHA 3LP0A 4OGCA 1RT3A 3OS0A 3OYDA 1LWEA 3OYJA 3IG1A 1ASUA 4DSJA 1SL0A 4JRPA 4CFBA 1D9FA 2XRIA 1RT7A 1U04A 4RG8A 4BWJA 4BDPA 1NK8A 1S1TA 1LW2A 3OYHA 4CHQA 1HRHA 3QLHA 3DLGA 4KTZA 3S3NA 1XHZA 1R0AA 1VSLA 3O4NA 3KKRA 3VQAA 3V81A 1DLOA 4FJKA 1ZBIA 1TKTA 2HHUA 4HUFA 2X74A 3AVLA 4G1QA 2FC0A 4OKJA 2OZSA 3KIOA 4C8KA 4CGGA 4CE9A 4DU4A 4FJMA 3MEGA 2HHWA 1KFDA 4DTPA 5HRRA 3S3OA 1BL3A 1CXUA 2O4GA 1NK5A 4CF2A 1LWFA 4LH4A 4W5OA 2Z1IA 2Y1JA 3K5LA 4KHYA 1XHXA 3M8QA 4ZTJA 4EZ6A 1VRTA 1RTJA 3T1AA 4CEDA 3HT3A 2HHXA 4FW1A 1WSGA 1RILA 2X78A 1WSJA 1JL2A 4LH5A 4Z4HA 3BDPA 1CXQA 4C8LA 5FROA 4AHUA 1Q9XA 2BDPA 5KI6A 1K6YA 4CK1A 3V9ZA 4CJTA 5HP1A 1G15A 2IAJA 3D0PA 1IG9A 3IRXA 4O0JA 5J2PA 4FZXC 4FJHA 3ZSVA 4RW7A 2FBVA 4CJ5A 4IKFA 1ZYQA 4CEEA 1W9HA 4FK4A 4BE0A 3DRPA 4EP5A 1Q9YA 2D0AA 1KLMA 4KKOA 1NOYA 1U47A 1ZBFA 4E7IA 3B6OA 4DTUA 3K2PA 1Z25A 1IKXA 4CHZA 4KO0A 4OVLA 3AVCA 3B6PA 2GUIA 3MEEA 4Z4FA 4AHVA 2W42A 1J5OA 3OY9A 1TL1A 4HUEA 1NJZA 2GV9A 3TAMA 4ICLA 1KRPA 4KTQA 2Y1IA 4CCHA 4FZZA 3HSTB 5CYQA 1D9DA 4HTUA 4KHSA 1HJRA 3MECA 3NE6A 3TI0A 1KLNA 4HUGA 3QINA 3SUQA 4B8CA 5CZ2A 5HLFA 5FRNA 1RT1A 2PYJA 3QEXA 3L2VA 1KSPA 3E01A 3HJFA 3KLFA 2RKIA 4DTSA 3QIPA 1S6PA 4XIUA 2IDOA 1EETA 1Z26A 4FM0A 1CZBA 1SUQA 3TANA 3VQ8A 5HRPA 1SKSA 1KTQA 2G8IA 3O3GA 2KQ2A 3VQCA 1I39A 1VK0A 3ZT4A 3NH1A 1JLQA 5HROA 3P1GA 3OYAA 4IFYA 4PQUA 4W5NA 4I7FA 4Z4IA 3CFPA 4ID1A 1RT2A 5I3UA 4LY7A 4CEOA 2Q3SA 2OPQA 4PA1A 4CK2A 4I9LA 3CYMA 4UQGA 4B9NA 4KPYA 4DTOA 4Z4EA 4IDKA 5HRSA 3L2WA 1C0TA 2HNYA 1Y97A 1VSJA 3PO5A 2ZD1A 4CESA 5J2MA 3THVA 3SZ2A 4FJLA 1J53A 1LAVA 3BGRA 3TAEA 4JRQA 4CF9A 3CQ8A 2NUBA 1JXEA 2A1RA 5K14A 2XY5A 4F4KA 3SQ2A 1I3AA 3ISNC 3KTQA 3OS1A 1BQNA 3ULDA 1XI1A 3AO5A 4M3XA 2FBTA 2HNZA 3F73A 3LAKA 3AO3A 3VQBA 1MU2A 3AVHA 3SI6A 4J2DA 1JLCA 1FXXA 2ATQA 3FFIA 3WNHA 4DSLA 3K57A 4FXDA 3NH0A 1LAWA 4IFVA 2IGIA 2VWKA 3ASMA 3SYZA 3RMAA 3VQ6A 3G0ZA 4M45A 1RBRA 3HPGA 3OYIA 5J2QA 4KV8A 4CJFA 1QTMA 4KHNA 1CZ9A 3KLIA 5KGWA 3I0SA 4Q5VA 3NGIA 1U45A 4L8RB 4M42A 3EYZA 3F9KA 3I0RA 1TV6A 1RTIA 3ALYA 4LD0A 4RW9A 4KFBA 4OPKA 4B9TA 1J54A 4NCAA 3OYCA 4CJWA 4K8XA 4FZYA 4RW4A 4DQQA 4FLTA 4Z4CA 4B08A 2G8UA 1ZBHA 4CIGA 4ELVA 2YNIA 4Y1CA 3DOLA 1ZBUA 2E6LA 3LZJA 2QKBA 5J2NA 3AO4A 4CFAA 1T8EA 3H08A 2PZSA 2HNDA 3TAFA 4QOZB 4CEFA 3AA5X 5JS2A 3RMCA 1LV5A 4F2RA 4Q0BA 3KK1A 1QHTA 1RBTA 5KRTA 3KD5E 1UA1A 4I2PA 1W0HA 4CF1A 4CIEA 2KFNA 1C0UA 1JXBA 1JLBA 1FKOA 2GBZA 1X9SA 1NOZA 2YHAA 2I5JA 3NBPA 1UAXA 1S1UA 3LANA 3RMBA 1C6VA 3SV3A 4DF4A 4F3OA 3MEDA 4HCBA 2O4IA 3HPOA 4CGDA 3K58A 1WSFA 4CF0A 4R5PA 3AA4A 1B9FA 3LALA 4JLHA 1IKWA 3TAPA 2VWJA 4QCLA 2HVHA 1C0MA 3NGYA 4DS4A 1KFSA 1X9MA 2Z1JA 3D45A 4KI6A 2OZMA 4O0IA 4FLZA 4DTNA 2G8VA 1IKYA 3QEIA 1TAQA 3C94A 3QERA 1RTDA 3QO9A 3LWLA 2VG5A 3AA3A 4HVJA 3PX0A 1FKPA 1YTUA 1YVUA 3AVKA 3P83D 1N6QA 1BI4B 2FBXA 3OYKA 5EU7A 3QIOA 4FJXA 1RDDA 3T19A 3CG7A 1XWLA 4HHTA 2LSNA 1CLQA 5CZ1A 1ZBLA 5KGXA 4FJ7A 4OKKA 4KB1A 4FCYA 4N47A 1SL1A 1S1VA 2JLEA 1S1XA 1VSIA 3ZSXA 3CFRA 1U49A 4FJIA 4FM1A 1ITGA 4EZ9A 5FRMA 3L3VA 2YV0X 3LP2A 3TR8A 1A5WA 4AHRA 4CEAA 1QSYA 2KZMA 2AJQA 2X6NA 2VG6A 1RBSA 1JKHA 1HNIA 1VSEA 2BANA 2YKMA 3C6TA 4FLVA 1LW0A 3TAGA 4LSNA 1NJYA 4KRFA 1L5UA 5C24A 1KVAA 3SPZA 3VQQA 4GVMA 3RWUA 4C8OA 4C8NA 1TK8A 4F3TA 4PUOA 4N76A 4IBNA 3LWMA 4DU3A 1WSHA 3DOKA 3KJVA 2HB5A 3SNNA 2RN2A 4J2BA 1U48A 3ZT3A 1RCHA 1RTHA 1HPZA 4OLBA 3M8PA 3V9SA 3VQEA 1UOCA 2VG7A 3K5OA 4NCGA 4FM2A 4FK0A 1L3TA 2D0CA 2D5RA 2OPSA 4CHNA 1NKBA 3LDSA 1VSFA 3ITHA 2QK9A 3L2QA 3TWHA 3HP6A 2P5GA 1NK6A 1WAFA 4K8ZA 2HMIA 1WAJA 4RW6A 4CFDA 1HNVA 4DQIA 4CJEA 3S9HA 5CY4A 4KHQA 2BGGA 2ZQBA 3OYLA 4B9MA 1KVBA 1TAUA 1JL1A 3AVBA 1B9DA 3ZSZA 4CEQA 4CJ4A 1D8YA 4B8AB 2HHTA 1C1BA 1BQMA 4MQ3A 2B4JA 2QXFA 2ETJA 2YHBA 2G8HA 2F8SA 4B9VA 2DFHA 3LPUA 2BE2A 3K59A 1S5JA 2FBYA 3DYAA 3MXJA 3SPYA 4B3OA 3QEVA 4QAGA 3CM5A 1DTTA 4DFKA 2IOCA 3HVTA 3LPTA 4I2QA 4GMJB 1TKZA 2PY5A 4DS5A 3AV9A 3UIQA 1EKEA 4H8KA 3NF8A 1JLGA 3AA2A 3L2RA 3V4IA 4OJRA 5CYMA 3OJUA 3LAMA 4M3RA 3PX4A 4BDYA 4DLGA 4ID5A 4PY5A 4FW2A 3OYFA 1NK4A 1QS4A 4E7HA 1BI4A 1RDBA 3AVFA 5KTQA 4CK3A 3EY1A 4DQSA 3AO1A 4CGIA 2JGUA 1VSKA 3QNOA 2XY6A 1HMVA 5DMRA 3TARA 4KB0A 1J9AA 4NYNA 5JS1A 1TK5A 4RW8A 2RF2A 4FLWA 3U3GA 1A5XA 1KVCA 3K5MA 4DU1A 4F2SA 4KREA 1JLAA 4BE2A 1X1PA 3V9UA 4M3ZA 3U3YA 4FYDA 3RR7A 3VQ7A 4DSEA 1GOAA 3DLKA 4OPJA 3QETA 3AVAA 2YNHA 5DK5A 2OPRA 3DLRA 4OGEA 3ZSRA 2HHVA 3QESA 1ASWA 3MXMA 3RRGA 3DLEA 2XO7A 2EHGA 3LZIA 3K5NA 4YNQA 4AHTA 4AHCA 2F8TA 1NKCA 2EX3A 3NH2A 4DQRA 2OA8A 1TGOA 3DRSA 4O55A 2P51A 3NF9A 1VSHA 1S1WA 1NKEA 4CJUA 2G8KA 4CHOA 2YNFA 1VRUA 4O4GA 3VQ9A 4CGJA 4JS4A 5HBMA 3PX6A 1RT6A 2WONA 2F96A 3G10A 4BACA 4CIFA 4CJQA 3JYTA 1FK9A 3WNEA 3IAYA 1EP4A 4DTJA 3U6FA 2G8WA 2KZZA 3HYFA 2B6AA 4O5BA 2KFZA 3DRRA 2IS3A 3C6UA 4CJ3A 4DTMA 3HP9A 3PUFA 4FLXA 3VQDA 3S3MA 3NCIA 3KKSA 1BHLA 1C1AA 1SV5A 1L3UA 2B5JA 3PO4A 1HQUA 1UWBA 3O4QA 4E1MA 3HM9A 4TSXA 4CEZA 3EZ5A 3RRHA 4DQPA 4Z0UA 3QEPA 5KRSA 3AVGA 1XC9A 2DFEA 3HO1A 4FJ9A 1RT5A 5FDLA 4CERA 1TK0A 1WN7A 2P5OA 2OYQA 3QNNA 1HYSA 3HVRA 1UA0A 3KK3A 1DTQA 3V1OA 4GW6A 2D0BA 4JS5A 4E3SA 4AILC 4W5TA 2E4LA 1N5YA 3KD1E 4H4OA 3KLGA 1O1WA 4DTXA 4HCCA 3VQ5A 1IO2A 1EXQA 2X6SA 4Y1DA 4F8RA 3IS9A 4LSLA 4NCBA 4KHUA 3OYNA 3ZSOA 2DTUA 2HW3A 4E89A 4W5QA 5D3GA 4CFCA 5C25A 1TVRA 3DLBA 1RNHA 4AH9A 4E19A 4BE1A 1RT4A 2HVIA 1D5AA 1NJXA 4M3WA 1WLJA 5SWMA 2DY4A 2YNGA 3OJSA 3M8RA 4MFBA 3WNGA 2HHSA 1NK7A 4Z4GA 1TKDA 4N41A 3HXMA 3V1QA 4CECA 2KW4A 1S9GA 3PY8A 4KHWA 1REVA 4C8MA 3VA0A 5T7BA 1C1CA 4BWMA 1SKWA 3NF6A 3O3HA 3KLHA 3SV4A 1JLEA 1RBUA 1NK9A 3ZSQA 3ZT2A 3SQ1A 2XY8A 3VN5A 1TL3A 1WSIA 4N56A 1TKXA 3SUOA 3L8BA 1RBVA 4B9SA 4DWIA 4FVMA 1HQEA 3M8SA 4B9LA 1WSEA 3AO2A 3NAEA 4PWDA 3C95A 4OLAA 3O3FA 4DSKA 3V1RA 3ZT1A 2OPPA 4CHYA 4FK2A 4EP4A 1YTAA 3JSMA 2IC3A 3QEWA 2QKKA 3HPHA 1ASVA 1VSDA 3DMJA 2G8FA 1X9WA 1B92A 3V6DA 1SL2A 4B9UA 3AVJA 4J2EA 3KLEA 4ELTA 2P1JA 3TAQA 4AHSA 4CGFA 2E6MA 4KI4A 4ZTFA 4I9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A2F A;  3NDK A;  2ZE2 A;  3L2U A;  4E7L A;  4W5R A;  1A5V A;  4E1N A;  1VSM A;  3HL8 A;  3OYB A;  2Z1H A;  2XHB A;  4ELU A;  4CJK A;  4FJG A;  4FJ5 A;  5C42 A;  3RR8 A;  3OS2 A;  1NJW A;  4FLY A;  1T03 A;  4DFM A;  3DI6 A;  4IG3 A;  3MXI A;  3OYM A;  1HYV A;  3SUP A;  2ITG A;  4CJR A;  4FLU A;  4OKE A;  4BDZ A;  3ZSW A;  3DM2 A;  3P5J A;  3RMD A;  4M3T A;  4DF8 A;  1S6Q A;  4CJP A;  5SZT A;  1S9E A;  5J1E A;  1QQC A;  3SUN A;  1QSS A;  1YT3 A;  3MAQ A;  4E7J A;  2DFF A;  3VQP A;  3NFA A;  1QE1 A;  3WNF A;  3CM6 A;  4YFU A;  3LP3 A;  1Q8I A;  5I42 A;  4H4M A;  3SJJ A;  4DSI A;  3PV8 A;  3TAB A;  1RDC A;  2Z1G A;  4E0D A;  3LP1 A;  4CF8 A;  1BIS A;  3HK2 A;  1LWC A;  4ZHR A;  4KTW A;  1IH7 A;  1T7P A;  2A1S A;  1BIU A;  3RTV A;  2RPI A;  3T3F A;  3SQ0 A;  2HHQ A;  4DFP A;  2PYL A;  3I8D A;  4E7K A;  4IG0 A;  3NHG A;  1IKV A;  4FJN A;  3VQ4 A;  3ZT0 A;  4DMN A;  4M41 A;  3SQ4 A;  1T05 A;  1L3V A;  1WNS A;  3AVM A;  4O44 A;  3OYE A;  4DSF A;  4NYF A;  3VA3 A;  4N5S A;  1HYZ A;  2YKN A;  4KAZ A;  4CJV A;  3ZCM A;  4CEB A;  4DFJ A;  1BGX T;  4CHP A;  3OYG A;  4CGH A;  4DTR A;  3NF7 A;  1BIZ A;  2R7Y A;  5E41 A;  1JLF A;  3V9W A;  1KCF A;  1L3S A;  2KTQ A;  1NK0 A;  3AVN A;  4CJL A;  3L3U A;  3CFO A;  3V9X A;  4FJJ A;  1QSL A;  4M3Y A;  1RDA A;  1F21 A;  5HRN A;  3KK2 A;  1EX4 A;  3AVI A;  1BCM A;  2WOM A;  4WE1 A;  2XY7 A;  1SKR A;  4J2A A;  1BCO A;  4DG1 A;  3OVN A;  1U4B A;  4FJ8 A;  4CJS A;  4DLE A;  3ZSY A;  3SCX A;  3NGZ A;  1GOB A;  4M3U A;  1GOC A;  3DLH A;  3LP0 A;  4OGC A;  1RT3 A;  3OS0 A;  3OYD A;  1LWE A;  3OYJ A;  3IG1 A;  1ASU A;  4DSJ A;  1SL0 A;  4JRP A;  4CFB A;  1D9F A;  2XRI A;  1RT7 A;  1U04 A;  4RG8 A;  4BWJ A;  4BDP A;  1NK8 A;  1S1T A;  1LW2 A;  3OYH A;  4CHQ A;  1HRH A;  3QLH A;  3DLG A;  4KTZ A;  3S3N A;  1XHZ A;  1R0A A;  1VSL A;  3O4N A;  3KKR A;  3VQA A;  3V81 A;  1DLO A;  4FJK A;  1ZBI A;  1TKT A;  2HHU A;  4HUF A;  2X74 A;  3AVL A;  4G1Q A;  2FC0 A;  4OKJ A;  2OZS A;  3KIO A;  4C8K A;  4CGG A;  4CE9 A;  4DU4 A;  4FJM A;  3MEG A;  2HHW A;  1KFD A;  4DTP A;  5HRR A;  3S3O A;  1BL3 A;  1CXU A;  2O4G A;  1NK5 A;  4CF2 A;  1LWF A;  4LH4 A;  4W5O A;  2Z1I A;  2Y1J A;  3K5L A;  4KHY A;  1XHX A;  3M8Q A;  4ZTJ A;  4EZ6 A;  1VRT A;  1RTJ A;  3T1A A;  4CED A;  3HT3 A;  2HHX A;  4FW1 A;  1WSG A;  1RIL A;  2X78 A;  1WSJ A;  1JL2 A;  4LH5 A;  4Z4H A;  3BDP A;  1CXQ A;  4C8L A;  5FRO A;  4AHU A;  1Q9X A;  2BDP A;  5KI6 A;  1K6Y A;  4CK1 A;  3V9Z A;  4CJT A;  5HP1 A;  1G15 A;  2IAJ A;  3D0P A;  1IG9 A;  3IRX A;  4O0J A;  5J2P A;  4FZX C;  4FJH A;  3ZSV A;  4RW7 A;  2FBV A;  4CJ5 A;  4IKF A;  1ZYQ A;  4CEE A;  1W9H A;  4FK4 A;  4BE0 A;  3DRP A;  4EP5 A;  1Q9Y A;  2D0A A;  1KLM A;  4KKO A;  1NOY A;  1U47 A;  1ZBF A;  4E7I A;  3B6O A;  4DTU A;  3K2P A;  1Z25 A;  1IKX A;  4CHZ A;  4KO0 A;  4OVL A;  3AVC A;  3B6P A;  2GUI A;  3MEE A;  4Z4F A;  4AHV A;  2W42 A;  1J5O A;  3OY9 A;  1TL1 A;  4HUE A;  1NJZ A;  2GV9 A;  3TAM A;  4ICL A;  1KRP A;  4KTQ A;  2Y1I A;  4CCH A;  4FZZ A;  3HST B;  5CYQ A;  1D9D A;  4HTU A;  4KHS A;  1HJR A;  3MEC A;  3NE6 A;  3TI0 A;  1KLN A;  4HUG A;  3QIN A;  3SUQ A;  4B8C A;  5CZ2 A;  5HLF A;  5FRN A;  1RT1 A;  2PYJ A;  3QEX A;  3L2V A;  1KSP A;  3E01 A;  3HJF A;  3KLF A;  2RKI A;  4DTS A;  3QIP A;  1S6P A;  4XIU A;  2IDO A;  1EET A;  1Z26 A;  4FM0 A;  1CZB A;  1SUQ A;  3TAN A;  3VQ8 A;  5HRP A;  1SKS A;  1KTQ A;  2G8I A;  3O3G A;  2KQ2 A;  3VQC A;  1I39 A;  1VK0 A;  3ZT4 A;  3NH1 A;  1JLQ A;  5HRO A;  3P1G A;  3OYA A;  4IFY A;  4PQU A;  4W5N A;  4I7F A;  4Z4I A;  3CFP A;  4ID1 A;  1RT2 A;  5I3U A;  4LY7 A;  4CEO A;  2Q3S A;  2OPQ A;  4PA1 A;  4CK2 A;  4I9L A;  3CYM A;  4UQG A;  4B9N A;  4KPY A;  4DTO A;  4Z4E A;  4IDK A;  5HRS A;  3L2W A;  1C0T A;  2HNY A;  1Y97 A;  1VSJ A;  3PO5 A;  2ZD1 A;  4CES A;  5J2M A;  3THV A;  3SZ2 A;  4FJL A;  1J53 A;  1LAV A;  3BGR A;  3TAE A;  4JRQ A;  4CF9 A;  3CQ8 A;  2NUB A;  1JXE A;  2A1R A;  5K14 A;  2XY5 A;  4F4K A;  3SQ2 A;  1I3A A;  3ISN C;  3KTQ A;  3OS1 A;  1BQN A;  3ULD A;  1XI1 A;  3AO5 A;  4M3X A;  2FBT A;  2HNZ A;  3F73 A;  3LAK A;  3AO3 A;  3VQB A;  1MU2 A;  3AVH A;  3SI6 A;  4J2D A;  1JLC A;  1FXX A;  2ATQ A;  3FFI A;  3WNH A;  4DSL A;  3K57 A;  4FXD A;  3NH0 A;  1LAW A;  4IFV A;  2IGI A;  2VWK A;  3ASM A;  3SYZ A;  3RMA A;  3VQ6 A;  3G0Z A;  4M45 A;  1RBR A;  3HPG A;  3OYI A;  5J2Q A;  4KV8 A;  4CJF A;  1QTM A;  4KHN A;  1CZ9 A;  3KLI A;  5KGW A;  3I0S A;  4Q5V A;  3NGI A;  1U45 A;  4L8R B;  4M42 A;  3EYZ A;  3F9K A;  3I0R A;  1TV6 A;  1RTI A;  3ALY A;  4LD0 A;  4RW9 A;  4KFB A;  4OPK A;  4B9T A;  1J54 A;  4NCA A;  3OYC A;  4CJW A;  4K8X A;  4FZY A;  4RW4 A;  4DQQ A;  4FLT A;  4Z4C A;  4B08 A;  2G8U A;  1ZBH A;  4CIG A;  4ELV A;  2YNI A;  4Y1C A;  3DOL A;  1ZBU A;  2E6L A;  3LZJ A;  2QKB A;  5J2N A;  3AO4 A;  4CFA A;  1T8E A;  3H08 A;  2PZS A;  2HND A;  3TAF A;  4QOZ B;  4CEF A;  3AA5 X;  5JS2 A;  3RMC A;  1LV5 A;  4F2R A;  4Q0B A;  3KK1 A;  1QHT A;  1RBT A;  5KRT A;  3KD5 E;  1UA1 A;  4I2P A;  1W0H A;  4CF1 A;  4CIE A;  2KFN A;  1C0U A;  1JXB A;  1JLB A;  1FKO A;  2GBZ A;  1X9S A;  1NOZ A;  2YHA A;  2I5J A;  3NBP A;  1UAX A;  1S1U A;  3LAN A;  3RMB A;  1C6V A;  3SV3 A;  4DF4 A;  4F3O A;  3MED A;  4HCB A;  2O4I A;  3HPO A;  4CGD A;  3K58 A;  1WSF A;  4CF0 A;  4R5P A;  3AA4 A;  1B9F A;  3LAL A;  4JLH A;  1IKW A;  3TAP A;  2VWJ A;  4QCL A;  2HVH A;  1C0M A;  3NGY A;  4DS4 A;  1KFS A;  1X9M A;  2Z1J A;  3D45 A;  4KI6 A;  2OZM A;  4O0I A;  4FLZ A;  4DTN A;  2G8V A;  1IKY A;  3QEI A;  1TAQ A;  3C94 A;  3QER A;  1RTD A;  3QO9 A;  3LWL A;  2VG5 A;  3AA3 A;  4HVJ A;  3PX0 A;  1FKP A;  1YTU A;  1YVU A;  3AVK A;  3P83 D;  1N6Q A;  1BI4 B;  2FBX A;  3OYK A;  5EU7 A;  3QIO A;  4FJX A;  1RDD A;  3T19 A;  3CG7 A;  1XWL A;  4HHT A;  2LSN A;  1CLQ A;  5CZ1 A;  1ZBL A;  5KGX A;  4FJ7 A;  4OKK A;  4KB1 A;  4FCY A;  4N47 A;  1SL1 A;  1S1V A;  2JLE A;  1S1X A;  1VSI A;  3ZSX A;  3CFR A;  1U49 A;  4FJI A;  4FM1 A;  1ITG A;  4EZ9 A;  5FRM A;  3L3V A;  2YV0 X;  3LP2 A;  3TR8 A;  1A5W A;  4AHR A;  4CEA A;  1QSY A;  2KZM A;  2AJQ A;  2X6N A;  2VG6 A;  1RBS A;  1JKH A;  1HNI A;  1VSE A;  2BAN A;  2YKM A;  3C6T A;  4FLV A;  1LW0 A;  3TAG A;  4LSN A;  1NJY A;  4KRF A;  1L5U A;  5C24 A;  1KVA A;  3SPZ A;  3VQQ A;  4GVM A;  3RWU A;  4C8O A;  4C8N A;  1TK8 A;  4F3T A;  4PUO A;  4N76 A;  4IBN A;  3LWM A;  4DU3 A;  1WSH A;  3DOK A;  3KJV A;  2HB5 A;  3SNN A;  2RN2 A;  4J2B A;  1U48 A;  3ZT3 A;  1RCH A;  1RTH A;  1HPZ A;  4OLB A;  3M8P A;  3V9S A;  3VQE A;  1UOC A;  2VG7 A;  3K5O A;  4NCG A;  4FM2 A;  4FK0 A;  1L3T A;  2D0C A;  2D5R A;  2OPS A;  4CHN A;  1NKB A;  3LDS A;  1VSF A;  3ITH A;  2QK9 A;  3L2Q A;  3TWH A;  3HP6 A;  2P5G A;  1NK6 A;  1WAF A;  4K8Z A;  2HMI A;  1WAJ A;  4RW6 A;  4CFD A;  1HNV A;  4DQI A;  4CJE A;  3S9H A;  5CY4 A;  4KHQ A;  2BGG A;  2ZQB A;  3OYL A;  4B9M A;  1KVB A;  1TAU A;  1JL1 A;  3AVB A;  1B9D A;  3ZSZ A;  4CEQ A;  4CJ4 A;  1D8Y A;  4B8A B;  2HHT A;  1C1B A;  1BQM A;  4MQ3 A;  2B4J A;  2QXF A;  2ETJ A;  2YHB A;  2G8H A;  2F8S A;  4B9V A;  2DFH A;  3LPU A;  2BE2 A;  3K59 A;  1S5J A;  2FBY A;  3DYA A;  3MXJ A;  3SPY A;  4B3O A;  3QEV A;  4QAG A;  3CM5 A;  1DTT A;  4DFK A;  2IOC A;  3HVT A;  3LPT A;  4I2Q A;  4GMJ B;  1TKZ A;  2PY5 A;  4DS5 A;  3AV9 A;  3UIQ A;  1EKE A;  4H8K A;  3NF8 A;  1JLG A;  3AA2 A;  3L2R A;  3V4I A;  4OJR A;  5CYM A;  3OJU A;  3LAM A;  4M3R A;  3PX4 A;  4BDY A;  4DLG A;  4ID5 A;  4PY5 A;  4FW2 A;  3OYF A;  1NK4 A;  1QS4 A;  4E7H A;  1BI4 A;  1RDB A;  3AVF A;  5KTQ A;  4CK3 A;  3EY1 A;  4DQS A;  3AO1 A;  4CGI A;  2JGU A;  1VSK A;  3QNO A;  2XY6 A;  1HMV A;  5DMR A;  3TAR A;  4KB0 A;  1J9A A;  4NYN A;  5JS1 A;  1TK5 A;  4RW8 A;  2RF2 A;  4FLW A;  3U3G A;  1A5X A;  1KVC A;  3K5M A;  4DU1 A;  4F2S A;  4KRE A;  1JLA A;  4BE2 A;  1X1P A;  3V9U A;  4M3Z A;  3U3Y A;  4FYD A;  3RR7 A;  3VQ7 A;  4DSE A;  1GOA A;  3DLK A;  4OPJ A;  3QET A;  3AVA A;  2YNH A;  5DK5 A;  2OPR A;  3DLR A;  4OGE A;  3ZSR A;  2HHV A;  3QES A;  1ASW A;  3MXM A;  3RRG A;  3DLE A;  2XO7 A;  2EHG A;  3LZI A;  3K5N A;  4YNQ A;  4AHT A;  4AHC A;  2F8T A;  1NKC A;  2EX3 A;  3NH2 A;  4DQR A;  2OA8 A;  1TGO A;  3DRS A;  4O55 A;  2P51 A;  3NF9 A;  1VSH A;  1S1W A;  1NKE A;  4CJU A;  2G8K A;  4CHO A;  2YNF A;  1VRU A;  4O4G A;  3VQ9 A;  4CGJ A;  4JS4 A;  5HBM A;  3PX6 A;  1RT6 A;  2WON A;  2F96 A;  3G10 A;  4BAC A;  4CIF A;  4CJQ A;  3JYT A;  1FK9 A;  3WNE A;  3IAY A;  1EP4 A;  4DTJ A;  3U6F A;  2G8W A;  2KZZ A;  3HYF A;  2B6A A;  4O5B A;  2KFZ A;  3DRR A;  2IS3 A;  3C6U A;  4CJ3 A;  4DTM A;  3HP9 A;  3PUF A;  4FLX A;  3VQD A;  3S3M A;  3NCI A;  3KKS A;  1BHL A;  1C1A A;  1SV5 A;  1L3U A;  2B5J A;  3PO4 A;  1HQU A;  1UWB A;  3O4Q A;  4E1M A;  3HM9 A;  4TSX A;  4CEZ A;  3EZ5 A;  3RRH A;  4DQP A;  4Z0U A;  3QEP A;  5KRS A;  3AVG A;  1XC9 A;  2DFE A;  3HO1 A;  4FJ9 A;  1RT5 A;  5FDL A;  4CER A;  1TK0 A;  1WN7 A;  2P5O A;  2OYQ A;  3QNN A;  1HYS A;  3HVR A;  1UA0 A;  3KK3 A;  1DTQ A;  3V1O A;  4GW6 A;  2D0B A;  4JS5 A;  4E3S A;  4AIL C;  4W5T A;  2E4L A;  1N5Y A;  3KD1 E;  4H4O A;  3KLG A;  1O1W A;  4DTX A;  4HCC A;  3VQ5 A;  1IO2 A;  1EXQ A;  2X6S A;  4Y1D A;  4F8R A;  3IS9 A;  4LSL A;  4NCB A;  4KHU A;  3OYN A;  3ZSO A;  2DTU A;  2HW3 A;  4E89 A;  4W5Q A;  5D3G A;  4CFC A;  5C25 A;  1TVR A;  3DLB A;  1RNH A;  4AH9 A;  4E19 A;  4BE1 A;  1RT4 A;  2HVI A;  1D5A A;  1NJX A;  4M3W A;  1WLJ A;  5SWM A;  2DY4 A;  2YNG A;  3OJS A;  3M8R A;  4MFB A;  3WNG A;  2HHS A;  1NK7 A;  4Z4G A;  1TKD A;  4N41 A;  3HXM A;  3V1Q A;  4CEC A;  2KW4 A;  1S9G A;  3PY8 A;  4KHW A;  1REV A;  4C8M A;  3VA0 A;  5T7B A;  1C1C A;  4BWM A;  1SKW A;  3NF6 A;  3O3H A;  3KLH A;  3SV4 A;  1JLE A;  1RBU A;  1NK9 A;  3ZSQ A;  3ZT2 A;  3SQ1 A;  2XY8 A;  3VN5 A;  1TL3 A;  1WSI A;  4N56 A;  1TKX A;  3SUO A;  3L8B A;  1RBV A;  4B9S A;  4DWI A;  4FVM A;  1HQE A;  3M8S A;  4B9L A;  1WSE A;  3AO2 A;  3NAE A;  4PWD A;  3C95 A;  4OLA A;  3O3F A;  4DSK A;  3V1R A;  3ZT1 A;  2OPP A;  4CHY A;  4FK2 A;  4EP4 A;  1YTA A;  3JSM A;  2IC3 A;  3QEW A;  2QKK A;  3HPH A;  1ASV A;  1VSD A;  3DMJ A;  2G8F A;  1X9W A;  1B92 A;  3V6D A;  1SL2 A;  4B9U A;  3AVJ A;  4J2E A;  3KLE A;  4ELT A;  2P1J A;  3TAQ A;  4AHS A;  4CGF A;  2E6M A;  4KI4 A;  4ZTF A;  4I9Q A; 
#chains in the Genus database with same CATH topology
 3NDK A;  1A5V A;  2XHB A;  4FJG A;  4ILH A;  3RR8 A;  3MXI A;  2CH6 A;  2ITG A;  1IG8 A;  4CJR A;  4FLU A;  4JNE A;  5GAE P;  3E66 A;  1S9E A;  4H5T A;  1YT3 A;  3MAQ A;  3SBG A;  3VQP A;  4YFU A;  4FWP A;  4JD2 B;  1Q8I A;  5AQG A;  4H4M A;  2OAN A;  5M1Q A;  4X66 K;  3LP1 A;  4E0D A;  4MDA A;  4CF8 A;  3HK2 A;  4IO8 A;  4ZHR A;  3CCL N;  2NRR A;  1OH6 A;  5LMU K;  3RTV A;  3KK7 A;  3SQ0 A;  5FPE A;  4DR1 K;  4DFP A;  2PYL A;  3BZK A;  4BRN A;  3IKM A;  4O44 A;  4NYF A;  3O9S A;  4N5S A;  1HYZ A;  4YOT A;  3N4Q A;  4IXC A;  4CJV A;  4JKF A;  4O8K A;  4IWV A;  5AQF A;  4CEB A;  4DFJ A;  3OYG A;  3VF6 A;  1KCF A;  3R6M A;  1L3S A;  1JCF A;  4CJL A;  3MN5 A;  5GAG P;  3CFO A;  3VGK A;  3V9X A;  1Q18 A;  4QCL A;  3KK2 A;  1EX4 A;  2XY7 A;  4WE1 A;  3J7Z O;  4J2A A;  4DG1 A;  4CJS A;  3ULE A;  4DLE A;  4JEP A;  2UUB K;  3VEV A;  1GOC A;  4OPH A;  3LP0 A;  1NWK A;  4OGC A;  3IG1 A;  4FWK A;  1OVY A;  4JRP A;  2V7Z A;  2XRI A;  4BWJ A;  4C1N K;  1NK8 A;  1S1T A;  3OYH A;  3QLH A;  3DLG A;  4KTZ A;  3KKR A;  4FJK A;  2WFB A;  4OKJ A;  4JI2 K;  5F1X A;  1BL3 A;  1NK5 A;  1TUY A;  3WXM B;  4A61 A;  2ZF5 O;  1NMN A;  3RVC A;  2Y1J A;  5MLC Q;  3M8Q A;  1MWM A;  1VRT A;  1RTJ A;  3VOV A;  5C2F A;  1WSG A;  3LM2 A;  2X78 A;  1WSJ A;  4C8L A;  5FRO A;  2WBN A;  1K6Y A;  3V9Z A;  3T1Y K;  5HP1 A;  1G15 A;  2IAJ A;  3SMP A;  3IRX A;  4KH6 A;  4RW7 A;  4IKF A;  4CEE A;  2ZJQ L;  1W9H A;  2VQE K;  4YOW A;  1KLM A;  1NOY A;  1ZBF A;  3DWL A;  4E7I A;  3B6O A;  5IWA K;  1IKX A;  4CHZ A;  1YJW N;  4KH4 A;  2FXU A;  2W42 A;  1WB9 A;  3OY9 A;  4HUE A;  1NJZ A;  1QQO A;  3R8E A;  5AQR A;  2Y1I A;  4CCH A;  3HST B;  1LCU A;  1D9D A;  4KHS A;  1Z05 A;  3MEC A;  3TI0 A;  2GTD A;  3SUQ A;  4NLC A;  4CD3 A;  3E01 A;  5JIC A;  3KLF A;  2RKI A;  4AF1 A;  2E2N A;  1Z26 A;  1CZB A;  3TAN A;  1N33 K;  3NVK A;  3G25 A;  4LF6 K;  2G8I A;  1BWF O;  4R79 A;  1ESV A;  4FO0 A;  3ZT4 A;  1JLQ A;  5KPT A;  5HRO A;  3I55 N;  4AM7 A;  4PQU A;  4Z4I A;  3CFP A;  1RT2 A;  4LY7 A;  4UQG A;  4I9L A;  3OBY A;  4Z4E A;  4BG9 A;  4IDK A;  1C0T A;  2HNY A;  1Y97 A;  1VSJ A;  5J2M A;  3O1B A;  4RTF D;  1XUP O;  3SZ2 A;  3ZET A;  4U67 L;  5CHI A;  3CQX A;  2FF6 A;  1JCE A;  1BA0 A;  3KTQ A;  3NVM A;  2V7Y A;  2FBT A;  2HNZ A;  3F73 A;  4Z94 A;  3PLA A;  1MU2 A;  3AVH A;  1JLC A;  4FXD A;  3FFI A;  3THX B;  4YOY A;  3QFU A;  5J2Q A;  1QTM A;  5C0Y A;  1CZ9 A;  3A5M C;  3FGU A;  3I0S A;  3KLI A;  3EYZ A;  3F9K A;  3DLL L;  5M1N A;  3C65 A;  1VQN N;  3MWT A;  4WYB A;  2W6K A;  1T44 A;  4FLT A;  3ENH A;  3EL2 A;  4CIG A;  3DOL A;  4DR3 K;  3T1H K;  1T8E A;  1VQ5 N;  1HNZ K;  3AA5 X;  1QHT A;  4DR4 K;  5AQM A;  4CZE A;  1W0H A;  3SAH A;  4CF1 A;  2QWN A;  2IIR A;  1X9S A;  4B9Q A;  4I6M B;  5AQL A;  3IDH A;  3LAN A;  4PL8 A;  2V51 B;  1NM1 A;  5M1F A;  4HCB A;  4CGD A;  2FSN A;  4CF0 A;  3AA4 A;  4JLH A;  4GVE A;  3TAP A;  1C0M A;  2Q2R A;  1FJG K;  2OZM A;  4DTN A;  1ZXO A;  3QEI A;  3NMU A;  3QER A;  3QO9 A;  4QS9 A;  1OH5 A;  5AFU H;  1YJ9 N;  4QS8 A;  3KHY A;  2VWB A;  2FBX A;  3QIO A;  1RDD A;  3GBT A;  3J81 O;  1YJN N;  1ZBL A;  4BQL A;  4FCY A;  4N47 A;  2YJF A;  3CFR A;  1VSI A;  1U49 A;  4CEA A;  1QQM A;  2BAN A;  1LW0 A;  1WBB A;  1KVA A;  3WXI A;  3SPZ A;  3VQQ A;  4Y0W A;  3RWU A;  4C8O A;  1BG3 A;  1TK8 A;  4PUO A;  4IBN A;  2PFU A;  4AM6 A;  3MX2 A;  1RCH A;  4B1Z A;  1P90 A;  3K5O A;  4FK0 A;  3PSI A;  1L3T A;  1NLV A;  2YJE A;  1VSF A;  3ITH A;  2QK9 A;  4IOA L;  4H0Y B;  2P5G A;  2O8E A;  1WAF A;  4JI7 K;  2NRW A;  2Q1N A;  4CFD A;  3S9H A;  2ZM6 K;  1JL1 A;  3AVB A;  1B9D A;  4B8A B;  5CR4 A;  2G8H A;  4JKE A;  4WQ4 A;  4FWN A;  3QEV A;  3CJB A;  3PIO L;  2P9P B;  1DTT A;  3WEE A;  3HVT A;  4GMJ B;  4JI1 K;  4DS5 A;  3UIQ A;  1JLG A;  1W97 L;  3PX4 A;  5AR0 A;  3OYF A;  3P39 A;  4DQS A;  1VSK A;  1HMV A;  3OBW A;  4M7Y A;  4DU1 A;  1JLA A;  4BE2 A;  1X1P A;  3V9U A;  2UXD K;  4M3Z A;  3U3Y A;  4FYD A;  3CPW M;  3RR7 A;  4OPJ A;  3AVA A;  2YNH A;  3VEN A;  2E1Y A;  3QIC A;  5DK5 A;  2WTU A;  1OH7 A;  2QI2 A;  3QES A;  3MXM A;  2O8D A;  3WXJ A;  3K5N A;  1NKC A;  3ZLJ A;  2OA8 A;  5KQ8 A;  1GLC G;  3M5R A;  3NF9 A;  4DR7 K;  4GV9 A;  1VSH A;  2P9U A;  4CJU A;  4CHO A;  4WF9 L;  5CE3 A;  3VQ9 A;  1RT6 A;  3JYT A;  3WXL A;  3HYF A;  2KFZ A;  4LFA K;  3C6U A;  4DTM A;  3HP9 A;  3VQD A;  3KKS A;  1BHL A;  1C1A A;  1QQN A;  1L3U A;  2B5J A;  5GIO A;  3EZ5 A;  3DAW A;  4E1M A;  4TSX A;  3DXK A;  3H45 C;  3QEP A;  5KRS A;  1NGD A;  4FJ9 A;  5FDL A;  2P5O A;  5EY4 A;  1Z6R A;  3QDK A;  1UA0 A;  1BUP A;  1DTQ A;  3V1O A;  2D0B A;  4JS5 A;  4E3S A;  1C0F A;  4H4O A;  1EXQ A;  4NCB A;  1HKC A;  3AAP A;  2HW3 A;  3EKU A;  2V52 B;  4E89 A;  3F9M A;  4CFC A;  5D3G A;  1TVR A;  2P9S A;  4AH9 A;  1D5A A;  2O8E B;  3OJS A;  2P9S B;  4XH5 A;  1NK7 A;  1SAZ A;  3MMV A;  3R3L A;  3AAR A;  5FPN A;  1C1C A;  1K9M O;  3EZW A;  4FWM A;  1JLE A;  2HF4 A;  1RBU A;  3BY5 A;  3SQ1 A;  2XY8 A;  4J8F A;  4N56 A;  2HBJ A;  3P38 A;  1RBV A;  4OX9 K;  2O8C A;  3NAE A;  1HJO A;  1K8K A;  5JLF A;  4WQ4 C;  1K8K B;  3JS6 A;  3QBX A;  3VGL A;  3JSM A;  2IC3 A;  3QEW A;  3HPH A;  1X9W A;  1YVN A;  4G9Z A;  4J2E A;  2VYP A;  4CGF A;  2E6M A;  4E1J A;  4I9Q A;  1HR0 K;  3A2F A;  1YHQ N;  1DEJ A;  3CD6 N;  2NRX A;  3HL8 A;  2Z1H A;  5BRE A;  3CCJ N;  3CCQ N;  3WUH A;  3KVG A;  3SUP A;  3P5J A;  4CJP A;  3SUN A;  3LDQ A;  4E7J A;  3TAF A;  1V4S A;  2P9I A;  3SJJ A;  4FL9 A;  3THX A;  2Z1G A;  1BIS A;  1LWC A;  4M7X A;  4KTW A;  1T7P A;  2A1S A;  4K42 A;  2RPI A;  5TKW A;  1IV0 A;  1MDU B;  2UXC K;  1W2B M;  4E7K A;  3FZL A;  2A40 A;  4FJN A;  4M41 A;  5B8H A;  3SQ4 A;  1W7A A;  3OYE A;  3VA3 A;  4HWI A;  3MN6 A;  4H5R A;  3Q7C A;  2ZGY A;  3NF7 A;  1BIZ A;  5GIN A;  5E41 A;  2R7Y A;  1GLA G;  1NK0 A;  1QVF M;  3CIP A;  4M3Y A;  2P9N A;  1NBW A;  1RDA A;  2WOM A;  2CGJ A;  1BCO A;  4I6M A;  3SCX A;  2ZWH A;  3ZX2 A;  3OYJ A;  3H3N O;  4IOX A;  4ILG B;  4CZI A;  1QZ6 A;  2E5L K;  4CFB A;  3MDQ A;  1D9F A;  1U04 A;  1RT7 A;  4BDP A;  3FZK A;  3CCV N;  1IBL K;  1VHX A;  3V81 A;  4CVN E;  2P9K A;  4XH4 A;  1TKT A;  2A42 A;  3O8M A;  3AVL A;  3VTH A;  4CE9 A;  4DU4 A;  3MEG A;  2HHW A;  1KFD A;  4DTP A;  2QW9 A;  3S3O A;  1CXU A;  1GLJ O;  1BO5 O;  4CF2 A;  3CC2 N;  4CZM A;  2A41 A;  4X62 K;  3K5L A;  4CBW A;  4RWT A;  3HOT A;  1VQ9 N;  4EZ6 A;  1HNW K;  2HHX A;  4WFB L;  3BDP A;  4Z4H A;  2PBD A;  2BDP A;  4CK1 A;  4CZF A;  3DJC A;  5LY3 A;  1XC3 A;  3C6A A;  2IVO A;  5J2P A;  4FJH A;  2KLA A;  3SMS A;  4BE0 A;  4GV6 A;  1Q9Y A;  2D0A A;  5C2D A;  2CGL A;  1U47 A;  3TTF A;  2H3G X;  1YAG A;  4DTU A;  3K2P A;  3AAQ A;  3O5B A;  1MA9 B;  3H1Q A;  3W0L A;  3AY9 A;  1GLE G;  1LOT B;  4BRH A;  4Z4F A;  4BVP A;  3UE5 A;  4ICL A;  4KTQ A;  5CYQ A;  3WT0 A;  1HJR A;  3NE6 A;  4HUG A;  3M6G A;  4BG8 A;  4B8C A;  5CZ2 A;  2PYJ A;  3QML A;  1KSP A;  4KBO A;  4H5V A;  4OPA A;  2F4V K;  3FZF A;  1EET A;  4FM0 A;  5HRP A;  1SKS A;  1Y64 A;  4JK7 A;  4GV3 A;  1I39 A;  4A59 A;  1VK0 A;  4I7F A;  3WEE B;  5C15 A;  4PA1 A;  4B9N A;  4KPY A;  3CYM A;  4BRA A;  3M3Z A;  3L2W A;  3U9D A;  3ENB A;  3BGR A;  3A0I X;  3TAE A;  4NO7 A;  3UKR B;  4CF9 A;  1JXE A;  2XY5 A;  4F4K A;  1R59 O;  3CQY A;  4CI6 A;  3ISN C;  3OS1 A;  3ULD A;  2RHK A;  3N4P A;  1HKB A;  3WNH A;  4DSL A;  1NJI O;  2VWK A;  3SYZ A;  3VQ6 A;  3FZM A;  4Q5V A;  3MX5 A;  4M42 A;  5AQP A;  4IFE A;  3R9P A;  4YDU A;  3ALY A;  1Q82 O;  4RW9 A;  4OPK A;  1ZBH A;  2G8U A;  1KC8 O;  4Y1C A;  3AO4 A;  3FR0 A;  4WCE L;  4BR4 A;  4H0V B;  3TTD A;  4B1Y B;  1LV5 A;  4DR2 K;  3VEW A;  1RBT A;  5KRT A;  3KD5 E;  3K0S A;  1NGA A;  4CIE A;  1JXB A;  5GIP A;  4O8U A;  2I5J A;  3VMF B;  1S1U A;  2GUP A;  3RMB A;  3ENO A;  4F3O A;  4DF4 A;  1J6Z A;  1WSF A;  2ASM A;  5LJW A;  3NGY A;  4DS4 A;  3BP8 A;  2HBK A;  2Z1J A;  1H1V A;  3D45 A;  5KPZ A;  4O0I A;  2G8V A;  1IKY A;  3PX0 A;  4JYA K;  1YTU A;  3P83 D;  1BI4 B;  1WUA A;  3A5L C;  3LDN A;  5EU7 A;  3T19 A;  3VEX A;  3CG7 A;  5FLX O;  1XWL A;  3HI0 A;  1CLQ A;  1SL1 A;  2JLE A;  1TYQ A;  1SZ2 A;  4FM1 A;  5FRM A;  2YCH A;  2YV0 X;  3LP2 A;  2KZM A;  1A5W A;  1TYQ B;  4JD2 A;  2X6N A;  4K41 A;  1HNI A;  1VSE A;  4KRF A;  2D1K A;  4PHT X;  1XNR K;  4AQY K;  1L5U A;  3CCR N;  1Q86 O;  3GE1 A;  4C8N A;  2FSK A;  4DU3 A;  2W40 A;  3DOK A;  4GKJ K;  2RN2 A;  4J2B A;  1U48 A;  3ZT3 A;  1RTH A;  1HPZ A;  3UKR A;  4OLB A;  3R1X A;  3WQU A;  3VQE A;  1UOC A;  2IVN A;  2VG7 A;  3THY A;  4M63 C;  4CHN A;  2OPS A;  1NKB A;  3L2Q A;  1NGF A;  3O80 A;  3HP6 A;  1NK6 A;  1WAJ A;  3ZX3 A;  4DQI A;  4CJE A;  5CY4 A;  4KHQ A;  3AGR A;  5AQN A;  2ZQB A;  2BGG A;  3OYL A;  3BF1 A;  4CEQ A;  1D8Y A;  2HHT A;  1C1B A;  2YHB A;  2ASP A;  3HRG A;  4H03 B;  1S5J A;  2FBY A;  5F0X A;  5FPM A;  3VGM A;  4QAG A;  4DFK A;  5E26 A;  3CF5 L;  2PY5 A;  3VES A;  1NU0 A;  3AA2 A;  3M1F A;  3OJU A;  3C0B A;  3LAM A;  1NK4 A;  3EY1 A;  3AO1 A;  5AQX A;  1J9A A;  3FFK B;  2QWR A;  4LC9 B;  4NYN A;  5JS1 A;  1TK5 A;  3ATV A;  4RW8 A;  4BRO A;  4FLW A;  3U3G A;  5IT9 O;  1KVC A;  2GWJ A;  3O9U A;  3H1V X;  3DLK A;  3OA9 A;  1GLL O;  2OPR A;  3DLR A;  4JKG A;  2XO7 A;  2EHG A;  5EXW A;  1T6D A;  3VF4 A;  3NH2 A;  4DQR A;  3SK3 A;  3CHW A;  4B1W B;  2VGM A;  1S1W A;  5M1K A;  3PX6 A;  4CGJ A;  4CJQ A;  1FK9 A;  3WNE A;  2G8W A;  3EE9 A;  4O5B A;  3PUF A;  1BU6 O;  3TSU A;  2E20 A;  1S22 A;  5TKY A;  4CD1 A;  3RRH A;  4FWO A;  1VQP N;  1SS6 A;  3HO1 A;  1RT5 A;  4CER A;  4EFH A;  5AQZ A;  3P31 A;  3KK3 A;  2HBM A;  1N5Y A;  4W5T A;  2JWL A;  3CME N;  1BOT O;  3KLG A;  1O1W A;  4DTX A;  4HCC A;  4BR9 A;  4V19 S;  3VQ5 A;  4CW7 B;  1DT9 A;  2DTU A;  4B3M K;  3DLB A;  5BPM A;  1SQK A;  4E19 A;  3CCU N;  5AQQ A;  1WLJ A;  2DY4 A;  4B3S K;  4IEE A;  3M8R A;  1N34 K;  2KW4 A;  1S9G A;  3FZH A;  1REV A;  5T7B A;  3KLH A;  4IO9 L;  4DV6 K;  3J7A P;  4LFC K;  1TL3 A;  5ADX A;  2ZGZ A;  1TKX A;  4B9S A;  4JK8 A;  1HQE A;  2UUA K;  4GNI A;  3O3F A;  3V1R A;  2OPP A;  1VAZ A;  3FE1 A;  3I8B A;  1ASV A;  1VSD A;  3A5N C;  4BR5 A;  2P9P A;  2P1J A;  3TU5 A;  1E4F T;  1RFQ A;  1QVG M;  2ZE2 A;  1U2V A;  3L2U A;  4W5R A;  3HM8 A;  3OYB A;  5C10 A;  4CJK A;  4ELU A;  5C42 A;  3OS2 A;  1NJW A;  4CZJ A;  4FLY A;  1T03 A;  3DXK B;  4IG3 A;  3OYM A;  1HYV A;  3U8X A;  3ZSW A;  3DM2 A;  4M3T A;  5SZT A;  3E1Y A;  3NFA A;  1QE1 A;  3CM6 A;  1U6Z A;  1RDC A;  3A5O C;  4BRP A;  2AP1 A;  4ISG A;  1IH7 A;  2NNW A;  3D2E A;  4JI3 K;  3T3F A;  4BRG A;  1IBK K;  2HHQ A;  3I8D A;  4IG0 A;  2VGN A;  3ZT0 A;  4DMN A;  3IUC A;  1T05 A;  4NXN K;  4PKH A;  4DSF A;  4KAZ A;  3ZCM A;  1NGG A;  1BGX T;  3HBT A;  1JLF A;  4BRE A;  2NRT A;  2KTQ A;  2O8C B;  1QSL A;  5HRN A;  1SKR A;  3G6E N;  4M3X A;  1U4B A;  2NRH A;  4FJ8 A;  4M3U A;  3ZSY A;  2DPN A;  3DLH A;  3OYD A;  3OS0 A;  4DSJ A;  1ASU A;  1SL0 A;  5EVZ A;  2FF3 B;  2QEX N;  1HYS A;  4NLB A;  1LW2 A;  4CHQ A;  4IDH A;  5LMN K;  1R0A A;  1VSL A;  4BGA A;  1N8R O;  4HUF A;  2X74 A;  1RGI A;  3GL1 A;  2FC0 A;  4G1Q A;  2OZS A;  3KIO A;  2JWK A;  4CGG A;  4FJM A;  5HRR A;  4IOC L;  4BGB A;  1LWF A;  4LH4 A;  4W5O A;  2Z1I A;  4WQ5 C;  3U4L A;  4KHY A;  4BR0 A;  3MN9 A;  4JKD A;  2NZT A;  4ZTJ A;  3HT3 A;  5BRH A;  1YF5 L;  4FW1 A;  4H0O A;  4K0K K;  1RIL A;  2YHX A;  3LDO A;  1JL2 A;  1CXQ A;  4ISF A;  1Q9X A;  1HLU A;  1IJJ A;  4CJT A;  3CCE N;  3BF3 A;  1IG9 A;  4K43 A;  4FZX C;  5M1P A;  4CJ5 A;  4FK4 A;  4EP5 A;  3G4S N;  1NGB A;  4KKO A;  1NMD A;  1M1K O;  3HOS A;  4KO0 A;  4OVL A;  1XMQ K;  2GUI A;  3UB5 A;  4AHV A;  1J5O A;  3C6H A;  5GAD P;  5I9E B;  2UXB K;  1C0G A;  3THY B;  3TAM A;  1KRP A;  2Q31 A;  3CJ1 A;  1KQS M;  4XH1 A;  4HTU A;  2Q0U A;  1KLN A;  3T7Z A;  4BC4 A;  3VER A;  5HLF A;  5FRN A;  1NGJ A;  3L2V A;  1XMO K;  4JKA A;  4DTS A;  3EN9 A;  3TTC A;  2ZJP L;  3QIP A;  2IDO A;  4DUY K;  1K73 O;  1KTQ A;  4MLE A;  3E9O A;  3VQC A;  1ZBS A;  3P1G A;  3CET A;  4KHP K;  4EHT A;  1O13 A;  1GLD G;  4CEO A;  2OPQ A;  4DQ8 A;  1J5E K;  1OKJ A;  1YIT N;  1Q81 O;  3VTI A;  3PO5 A;  2ZD1 A;  1LAV A;  3O1W A;  3CQ8 A;  5JMV A;  2A1R A;  3SQ2 A;  3E9P A;  5KPR A;  1XI1 A;  1ZC6 A;  1NG9 A;  4J2D A;  3LAK A;  3VQB A;  3CC4 N;  2ATQ A;  3K57 A;  2IGI A;  3ASM A;  3CJ9 A;  3RMA A;  3G0Z A;  4M45 A;  1RBR A;  4KHN A;  3NGI A;  3I0R A;  1RTI A;  4XEI A;  1N32 K;  4MLH A;  2UYT A;  4BRQ A;  4B9T A;  1J54 A;  4NCA A;  3OYC A;  4Z4C A;  4B08 A;  4ELV A;  3SAF A;  1ZBU A;  2E6L A;  3LZJ A;  4BR2 A;  2QKB A;  5J2N A;  4GKK K;  4CFA A;  1E3M A;  4QOZ B;  4CEF A;  3RMC A;  4K25 A;  1G99 A;  2HBL A;  2FSJ A;  4I2P A;  1RDU A;  3THW B;  2KFN A;  1FKO A;  2UUC K;  2GBZ A;  4BQZ A;  2YHA A;  4PKI A;  5AJ3 K;  1T3V A;  3CI5 A;  4DHY A;  5AQJ A;  4FOE A;  3Q7B A;  5BPL A;  4JHD A;  3SV3 A;  1VQO N;  4KH5 A;  1S3X A;  4U7B A;  2O4I A;  4JN4 A;  3HPO A;  3K58 A;  3C7N B;  4DV3 K;  2QWP A;  4H5W A;  3L4Q A;  1X3N A;  1IKW A;  3EE8 A;  2VWJ A;  2HVH A;  4FWQ A;  4NXM K;  1DGK N;  1KFS A;  4JKB A;  2QA4 N;  4KI6 A;  3C94 A;  1RTD A;  3EKS A;  3LWL A;  2VG5 A;  3AA3 A;  4HVJ A;  1FKP A;  2HHH K;  1NGH A;  3AVK A;  2J4R A;  5BPN A;  3OYK A;  5GAH P;  2LSN A;  4A5A A;  4FJ7 A;  5KGX A;  4OKK A;  4CBX A;  2HMP A;  5BN9 A;  3ZSX A;  2E2O A;  1ITG A;  4EZ9 A;  3TR8 A;  4AHR A;  4DV0 K;  2P9I B;  3ID8 A;  2VG6 A;  2YKM A;  4FLV A;  3TAG A;  1NJY A;  3WXK A;  3I33 A;  3J8A A;  5C24 A;  3RSE B;  4JKC A;  4EAH D;  4F3T A;  3LWM A;  1WSH A;  4DV2 K;  4NCG A;  4CZH A;  4FM2 A;  5A2Q O;  5BR9 A;  2D0C A;  4BRI A;  3LDS A;  2CH5 A;  1U2V B;  3TWH A;  1BA1 A;  3I56 N;  4RW6 A;  5AQU A;  4JKG B;  2YHY A;  2F9W A;  2B4J A;  2F8S A;  3JXU A;  2W41 A;  4B9V A;  2DFH A;  3LPU A;  2BE2 A;  2E2P A;  5AQS A;  4B3O A;  2GEL A;  3VF2 A;  3CM5 A;  3ID6 A;  3L4I A;  2IOC A;  1KXP A;  4B1U B;  5JVH L;  3PIP L;  4NB4 A;  2HST A;  4H8K A;  3NF8 A;  4H0X B;  3AGK A;  5CYM A;  4DLG A;  4ID5 A;  4PY5 A;  4FW2 A;  5BRF A;  1QS4 A;  5FPD A;  2P9K B;  1BI4 A;  3O9R A;  2XY6 A;  3QNO A;  1XNQ K;  3D6R A;  4FWL A;  3TAR A;  4JI5 K;  1QHA A;  4JV5 K;  1OH8 A;  3K5M A;  1A5X A;  4F2S A;  5AQH A;  4O5F A;  4LF5 K;  1VQL N;  2ASO A;  4JHD B;  3LL3 A;  4H0T B;  3VQ7 A;  1GOA A;  4DSE A;  4OGE A;  3DXM A;  3ZSR A;  2HHV A;  1ASW A;  3RRG A;  3DLE A;  3D2F A;  2I7P A;  4OO1 J;  1VQ8 N;  3MCP A;  4YNQ A;  4AHC A;  2F8T A;  1HX1 A;  1TUU A;  3K9K A;  3DRS A;  5E84 A;  2GX9 A;  1NKE A;  2WC9 A;  2G8K A;  1VRU A;  2O8F A;  2WON A;  2F96 A;  4YOR A;  4BAC A;  3IAY A;  4K8Z A;  3ZET B;  3GDQ A;  4IEI A;  3GG4 A;  4DTJ A;  3U6F A;  1MWK A;  2KZZ A;  2WUS A;  3S41 A;  4WQ5 A;  2IS3 A;  1Q7Y O;  3U9Z A;  3NCI A;  1SV5 A;  2UU9 K;  1UWB A;  1YIJ N;  4CEZ A;  3TPQ A;  3SBT A;  4YDU C;  4YOV A;  2RE2 A;  4BRF A;  3AVG A;  2DFE A;  2EWS A;  3QNN A;  4LF7 K;  3HVR A;  3KWI A;  3WQT A;  3SAG A;  4GW6 A;  4AIL C;  1VQ7 N;  4F9O A;  1I94 K;  4C1N I;  4Y1D A;  4F8R A;  3IS9 A;  4LSL A;  4KHU A;  2YX6 A;  2YI1 A;  3OYN A;  3VEO A;  3ZSO A;  1KD1 O;  1P8Z A;  5C25 A;  1RNH A;  4BE1 A;  1RT4 A;  2HVI A;  1NJX A;  4M3W A;  3MWP A;  2YNG A;  4MFB A;  3WNG A;  4CZK A;  1S72 N;  2HHS A;  1TKD A;  4N41 A;  3V1Q A;  4CEC A;  4CZG A;  1VQ4 N;  3PY8 A;  4DV5 K;  4C8M A;  4BWM A;  2QWO A;  3NF6 A;  2A5X A;  3SV4 A;  2D0P A;  1NK9 A;  3ZSQ A;  3VN5 A;  3SUO A;  1ILY A;  2PAV A;  4LF8 K;  3L8B A;  4FVM A;  4B9L A;  3M8S A;  3OW2 M;  1WSE A;  3AO2 A;  1HNX K;  4JI0 K;  4BC5 A;  3ZT1 A;  4BRD A;  2O8B B;  2OCE A;  4FK2 A;  4EP4 A;  1YTA A;  3HTV A;  3IMX A;  2QKK A;  2GEM A;  3HZ6 A;  1VQK N;  5AQI A;  1B92 A;  4B9U A;  3ATU A;  5M1O A;  4AHS A;  4KI4 A;  4A62 A;  4RCH A;  4E7L A;  4DTO A;  4E1N A;  1VSM A;  4FJ5 A;  3H3O B;  2ITM A;  4JKH A;  4DFM A;  3DI6 A;  3QFP A;  4OKE A;  1YXQ A;  4BDZ A;  3RMD A;  4DF8 A;  1S6Q A;  4FWS A;  1QSS A;  5J1E A;  1YUW A;  1QQC A;  2HOE A;  1GLB G;  4JAX A;  2DFF A;  3WNF A;  3LP3 A;  2I7N A;  5I42 A;  4DSI A;  5DM6 L;  3PV8 A;  3TAB A;  4BC2 A;  3BEX A;  4IJA A;  1NGC A;  2F7T A;  1BIU A;  3CPE A;  4WFN L;  4L3Q A;  2O8F B;  4DKW A;  4DV4 K;  3B8A X;  1IBM K;  3NHG A;  1IKV A;  4ISE A;  3OTO K;  3VQ4 A;  3CCM N;  1L3V A;  1WNS A;  3AVM A;  3CCS N;  2QWM A;  5BR8 K;  2HF3 A;  2YKN A;  4BR7 A;  4CHP A;  5HL7 L;  3FLC O;  4CGH A;  4DTR A;  5F2R A;  4BRM A;  3V9W A;  1YI2 N;  3AVN A;  3L3U A;  4FJJ A;  3O9Q A;  1F21 A;  3AVI A;  1BCM A;  2YHW A;  4CJ7 A;  4FWR A;  3OVN A;  3NGZ A;  1GOB A;  1RT3 A;  1LWE A;  2E2Q A;  2NRZ A;  1KAY A;  5BN8 A;  4RG8 A;  3VET A;  1XHZ A;  1HRH A;  3S3N A;  5AZI B;  3P4I A;  3C7N A;  3O4N A;  3VQA A;  3QBW A;  1DLO A;  1ZBI A;  2HHU A;  4JI6 K;  4MO5 A;  3VEZ A;  4C8K A;  2O4G A;  5AQK A;  1XHX A;  3MN7 A;  5AFU A;  4CED A;  3T1A A;  2KKZ A;  2GWK A;  2NRV A;  4LH5 A;  4AHU A;  5KI6 A;  2QWL A;  1D4X A;  2QTD A;  3D0P A;  4O0J A;  3ZSV A;  2FBV A;  5AQT A;  1ZYQ A;  2P9U B;  2ZJR L;  4FVU A;  3DRP A;  1T6C A;  1CZA N;  1JJ2 M;  3H6E A;  3MCA B;  3LM9 A;  1Z25 A;  2E1Z A;  3AVC A;  4EIA A;  3B6P A;  1HPM A;  3MEE A;  1EWQ A;  5AQW A;  4A2A A;  1TL1 A;  2GV9 A;  4YOU A;  4IJN A;  4PKG A;  5JVG L;  4FZZ A;  3TSP A;  3QIN A;  1RT1 A;  3QB0 A;  3QEX A;  3EEQ A;  4HTL A;  3HJF A;  1S6P A;  3ZEU B;  4XIU A;  3L6Q A;  2P9N B;  1SUQ A;  3VQ8 A;  3O3G A;  3SLC A;  2KQ2 A;  1V4T A;  3LDP A;  3BZC A;  3NH1 A;  4DCH A;  3OYA A;  3TSQ A;  4IFY A;  4W5N A;  4ID1 A;  5I3U A;  1ATN A;  2Q3S A;  4CK2 A;  3CJC A;  1HKG A;  5HRS A;  1E4G T;  4CES A;  3THV A;  4FJL A;  3HSC A;  1J53 A;  4JRQ A;  2NUB A;  3OHR A;  4DUZ K;  5K14 A;  1I3A A;  2BH1 A;  1BQN A;  3AO5 A;  3SI6 A;  2D4W A;  4CZL A;  3AO3 A;  2VQF K;  3CMA N;  4CBU A;  1FXX A;  3NH0 A;  1LAW A;  2D0O A;  4IFV A;  1FW6 A;  3HPG A;  3OYI A;  4KV8 A;  4CJF A;  5EOY A;  5KGW A;  1U45 A;  4L8R B;  5AZI A;  1X3M A;  1TV6 A;  4LD0 A;  4A57 A;  3H46 O;  4KFB A;  3L0Q A;  3F5T A;  4CJW A;  4K8X A;  4FZY A;  3PSF A;  4RW4 A;  4DQQ A;  4BRL A;  4LF4 K;  4LF9 K;  1EWR A;  2QXL A;  2YNI A;  5LL6 Z;  3H08 A;  2PZS A;  2HND A;  3O08 A;  5JS2 A;  4F2R A;  4Q0B A;  3KK1 A;  3CJA A;  5BRD A;  1UA1 A;  4FOI A;  5ELZ A;  1C0U A;  1JLB A;  3T69 A;  2O8D B;  1NOZ A;  3ULE B;  3NBP A;  1UAX A;  4MDB A;  1K8A O;  1C6V A;  4JI8 K;  4JI4 K;  3MED A;  3O6W A;  4FPA A;  4YOX A;  5AQV A;  1KAZ A;  4R5P A;  1B9F A;  3LAL A;  4JK9 A;  1EQY A;  1BDG A;  2P9L B;  1NGE A;  1X9M A;  3UKU A;  4BC3 A;  2P9L A;  4FLZ A;  1TAQ A;  4GY2 B;  4WFA L;  3CJ7 A;  2OTL N;  1YVU A;  2Q97 A;  3LDL A;  3IFR A;  1N6Q A;  4FJX A;  3ZEU A;  4HHT A;  5CZ1 A;  1WOQ A;  3KZB A;  4KB1 A;  1S1V A;  1S1X A;  3G71 N;  4FJI A;  3L3V A;  1QSY A;  3CXC M;  2AJQ A;  1KAX A;  3GOI A;  3W3D A;  3CER A;  1RBS A;  1JKH A;  2A3Z A;  3C6T A;  4H0P A;  4LSN A;  5C12 A;  1WBD A;  5KQD A;  4GVM A;  2E88 A;  1JCG A;  5ADX H;  4N76 A;  2O8B A;  3EO3 A;  3D2E B;  3KJV A;  2HB5 A;  3SNN A;  5LJV A;  5EX5 A;  2OTJ N;  3M8P A;  3V9S A;  4QS7 A;  4A5B A;  3BUZ B;  1ATR A;  2D5R A;  1M90 O;  1OVQ A;  5AQO A;  2HMI A;  3J7Y P;  1HNV A;  1X9J A;  2BTF A;  4B9M A;  1KVB A;  1TAU A;  3ZSZ A;  3ZYY X;  4CJ4 A;  3D2F B;  4MQ3 A;  1BQM A;  2QXF A;  4DV1 K;  2ETJ A;  3SPY A;  3K59 A;  3DYA A;  3MXJ A;  4BY9 C;  3J80 O;  4X64 K;  1VQ6 N;  3LPT A;  4I2Q A;  1TKZ A;  1ATS A;  3AV9 A;  4BRK A;  1EKE A;  4MO4 A;  3L2R A;  3V4I A;  4OJR A;  1DKG D;  4M3R A;  4BDY A;  4E7H A;  1RDB A;  3AVF A;  3O4W A;  4CK3 A;  5KTQ A;  4LFB K;  4CGI A;  2JGU A;  1HUX A;  2QM1 A;  5DMR A;  4KB0 A;  1GLF O;  2KHO A;  3ZX0 A;  2F9T A;  2RF2 A;  3A8Y A;  4KRE A;  4YY3 K;  4ILJ A;  3VEY A;  5H1S Q;  5DM7 L;  2QWQ A;  3F2K A;  3QET A;  4PL7 A;  1RDW X;  3RSE A;  3THW A;  3LZI A;  4BVO A;  2Q36 A;  3O9T A;  4AHT A;  4B1X B;  2EX3 A;  4X65 K;  1TGO A;  4EHU A;  4O55 A;  2P51 A;  3UKU B;  3KWG A;  2AA4 A;  2YNF A;  4O4G A;  4JS4 A;  5HBM A;  3G10 A;  4CIF A;  1EP4 A;  4DV7 K;  4B3T K;  2B6A A;  3DRR A;  4CJ3 A;  4FLX A;  3S3M A;  3JAM O;  5AZJ B;  4UY8 O;  4B3R K;  2CGK A;  3PO4 A;  1HQU A;  5AZJ A;  3O4Q A;  3HM9 A;  4DQP A;  2W6L A;  4Z0U A;  4A2B A;  1XC9 A;  4FSV A;  1TK0 A;  1WN7 A;  2OYQ A;  2E8A A;  3CC7 N;  3KD1 E;  2E4L A;  3K9J A;  1IO2 A;  2X6S A;  1NNE A;  3SJH A;  2BUP A;  4DB3 A;  4IZ9 A;  1VQM N;  4W5Q A;  5AQY A;  2VCP A;  5SWM A;  4DR5 K;  2FLO A;  4Z4G A;  4KHW A;  3HXM A;  3VA0 A;  1SKW A;  1XQS C;  3O3H A;  2IVP A;  1NGI A;  3DXM B;  1EO1 A;  3ZT2 A;  1WSI A;  2A6A A;  1N36 K;  5JLH A;  4BRC A;  3VPZ A;  4DWI A;  4PWD A;  5HOO A;  3C95 A;  4OLA A;  4DSK A;  4C23 A;  4CHY A;  1QZ5 A;  3DMJ A;  2G8F A;  4DR6 K;  3V6D A;  1SL2 A;  4H5N A;  3AVJ A;  2Q0R A;  3E9L A;  3MK6 A;  3KLE A;  2NLX A;  4ELT A;  4YHH K;  3TAQ A;  4FPB A;  3D7E O;  4B1V A;  4ZTF A; 
#chains in the Genus database with same CATH homology
 3A2F A;  3NDK A;  2ZE2 A;  3L2U A;  4E7L A;  4W5R A;  1A5V A;  4E1N A;  1VSM A;  3HL8 A;  3OYB A;  2Z1H A;  2XHB A;  4ELU A;  4CJK A;  4FJG A;  4FJ5 A;  5C42 A;  3RR8 A;  3OS2 A;  1NJW A;  4FLY A;  1T03 A;  4DFM A;  3DI6 A;  4IG3 A;  3MXI A;  3OYM A;  1HYV A;  3SUP A;  2ITG A;  4CJR A;  4FLU A;  4OKE A;  4BDZ A;  3ZSW A;  3DM2 A;  3P5J A;  3RMD A;  4M3T A;  4DF8 A;  1S6Q A;  4CJP A;  5SZT A;  1S9E A;  5J1E A;  1QQC A;  3SUN A;  1QSS A;  1YT3 A;  3MAQ A;  4E7J A;  2DFF A;  3VQP A;  3NFA A;  1QE1 A;  3WNF A;  3CM6 A;  4YFU A;  3LP3 A;  1Q8I A;  5I42 A;  4H4M A;  3SJJ A;  4DSI A;  3PV8 A;  3TAB A;  1RDC A;  2Z1G A;  4E0D A;  3LP1 A;  4CF8 A;  1BIS A;  3HK2 A;  1LWC A;  4ZHR A;  4KTW A;  1IH7 A;  1T7P A;  2A1S A;  1BIU A;  3RTV A;  2RPI A;  3T3F A;  3SQ0 A;  2HHQ A;  4DFP A;  2PYL A;  3I8D A;  4E7K A;  4IG0 A;  3NHG A;  1IKV A;  4FJN A;  3VQ4 A;  3ZT0 A;  4DMN A;  4M41 A;  3SQ4 A;  1T05 A;  1L3V A;  1WNS A;  3AVM A;  4O44 A;  3OYE A;  4DSF A;  4NYF A;  3VA3 A;  4N5S A;  1HYZ A;  2YKN A;  4KAZ A;  4CJV A;  3ZCM A;  4CEB A;  4DFJ A;  1BGX T;  4CHP A;  3OYG A;  4CGH A;  4DTR A;  3NF7 A;  1BIZ A;  2R7Y A;  5E41 A;  1JLF A;  3V9W A;  1KCF A;  1L3S A;  2KTQ A;  1NK0 A;  3AVN A;  4CJL A;  3L3U A;  3CFO A;  3V9X A;  4FJJ A;  1QSL A;  4M3Y A;  1RDA A;  1F21 A;  5HRN A;  3KK2 A;  1EX4 A;  3AVI A;  1BCM A;  2WOM A;  4WE1 A;  2XY7 A;  1SKR A;  4J2A A;  1BCO A;  4DG1 A;  3OVN A;  1U4B A;  4FJ8 A;  4CJS A;  4DLE A;  3ZSY A;  3SCX A;  3NGZ A;  1GOB A;  4M3U A;  1GOC A;  3DLH A;  3LP0 A;  4OGC A;  1RT3 A;  3OS0 A;  3OYD A;  1LWE A;  3OYJ A;  3IG1 A;  1ASU A;  4DSJ A;  1SL0 A;  4JRP A;  4CFB A;  1D9F A;  2XRI A;  1RT7 A;  1U04 A;  4RG8 A;  4BWJ A;  4BDP A;  1NK8 A;  1S1T A;  1LW2 A;  3OYH A;  4CHQ A;  1HRH A;  3QLH A;  3DLG A;  4KTZ A;  3S3N A;  1XHZ A;  1R0A A;  1VSL A;  3O4N A;  3KKR A;  3VQA A;  3V81 A;  1DLO A;  4FJK A;  1ZBI A;  1TKT A;  2HHU A;  4HUF A;  2X74 A;  3AVL A;  4G1Q A;  2FC0 A;  4OKJ A;  2OZS A;  3KIO A;  4C8K A;  4CGG A;  4CE9 A;  4DU4 A;  4FJM A;  3MEG A;  2HHW A;  1KFD A;  4DTP A;  5HRR A;  3S3O A;  1BL3 A;  1CXU A;  2O4G A;  1NK5 A;  4CF2 A;  1LWF A;  4LH4 A;  4W5O A;  2Z1I A;  2Y1J A;  3K5L A;  4KHY A;  1XHX A;  3M8Q A;  4ZTJ A;  4EZ6 A;  1VRT A;  1RTJ A;  3T1A A;  4CED A;  3HT3 A;  2HHX A;  4FW1 A;  1WSG A;  1RIL A;  2X78 A;  1WSJ A;  1JL2 A;  4LH5 A;  4Z4H A;  3BDP A;  1CXQ A;  4C8L A;  5FRO A;  4AHU A;  1Q9X A;  2BDP A;  5KI6 A;  1K6Y A;  4CK1 A;  3V9Z A;  4CJT A;  5HP1 A;  1G15 A;  2IAJ A;  3D0P A;  1IG9 A;  3IRX A;  4O0J A;  5J2P A;  4FZX C;  4FJH A;  3ZSV A;  4RW7 A;  2FBV A;  4CJ5 A;  4IKF A;  1ZYQ A;  4CEE A;  1W9H A;  4FK4 A;  4BE0 A;  3DRP A;  4EP5 A;  1Q9Y A;  2D0A A;  1KLM A;  4KKO A;  1NOY A;  1U47 A;  1ZBF A;  4E7I A;  3B6O A;  4DTU A;  3K2P A;  1Z25 A;  1IKX A;  4CHZ A;  4KO0 A;  4OVL A;  3AVC A;  3B6P A;  2GUI A;  3MEE A;  4Z4F A;  4AHV A;  2W42 A;  1J5O A;  3OY9 A;  1TL1 A;  4HUE A;  1NJZ A;  2GV9 A;  3TAM A;  4ICL A;  1KRP A;  4KTQ A;  2Y1I A;  4CCH A;  4FZZ A;  3HST B;  5CYQ A;  1D9D A;  4HTU A;  4KHS A;  1HJR A;  3MEC A;  3NE6 A;  3TI0 A;  1KLN A;  4HUG A;  3QIN A;  3SUQ A;  4B8C A;  5CZ2 A;  5HLF A;  5FRN A;  1RT1 A;  2PYJ A;  3QEX A;  3L2V A;  1KSP A;  3E01 A;  3HJF A;  3KLF A;  2RKI A;  4DTS A;  3QIP A;  1S6P A;  4XIU A;  2IDO A;  1EET A;  1Z26 A;  4FM0 A;  1CZB A;  1SUQ A;  3TAN A;  3VQ8 A;  5HRP A;  1SKS A;  1KTQ A;  2G8I A;  3O3G A;  2KQ2 A;  3VQC A;  1I39 A;  1VK0 A;  3ZT4 A;  3NH1 A;  1JLQ A;  5HRO A;  3P1G A;  3OYA A;  4IFY A;  4PQU A;  4W5N A;  4I7F A;  4Z4I A;  3CFP A;  4ID1 A;  1RT2 A;  5I3U A;  4LY7 A;  4CEO A;  2Q3S A;  2OPQ A;  4PA1 A;  4CK2 A;  4I9L A;  3CYM A;  4UQG A;  4B9N A;  4KPY A;  4DTO A;  4Z4E A;  4IDK A;  5HRS A;  3L2W A;  1C0T A;  2HNY A;  1Y97 A;  1VSJ A;  3PO5 A;  2ZD1 A;  4CES A;  5J2M A;  3THV A;  3SZ2 A;  4FJL A;  1J53 A;  1LAV A;  3BGR A;  3TAE A;  4JRQ A;  4CF9 A;  3CQ8 A;  2NUB A;  1JXE A;  2A1R A;  5K14 A;  2XY5 A;  4F4K A;  3SQ2 A;  1I3A A;  3ISN C;  3KTQ A;  3OS1 A;  1BQN A;  3ULD A;  1XI1 A;  3AO5 A;  4M3X A;  2FBT A;  2HNZ A;  3F73 A;  3LAK A;  3AO3 A;  3VQB A;  1MU2 A;  3AVH A;  3SI6 A;  4J2D A;  1JLC A;  1FXX A;  2ATQ A;  3FFI A;  3WNH A;  4DSL A;  3K57 A;  4FXD A;  3NH0 A;  1LAW A;  4IFV A;  2IGI A;  2VWK A;  3ASM A;  3SYZ A;  3RMA A;  3VQ6 A;  3G0Z A;  4M45 A;  1RBR A;  3HPG A;  3OYI A;  5J2Q A;  4KV8 A;  4CJF A;  1QTM A;  4KHN A;  1CZ9 A;  3KLI A;  5KGW A;  3I0S A;  4Q5V A;  3NGI A;  1U45 A;  4L8R B;  4M42 A;  3EYZ A;  3F9K A;  3I0R A;  1TV6 A;  1RTI A;  3ALY A;  4LD0 A;  4RW9 A;  4KFB A;  4OPK A;  4B9T A;  1J54 A;  4NCA A;  3OYC A;  4CJW A;  4K8X A;  4FZY A;  4RW4 A;  4DQQ A;  4FLT A;  4Z4C A;  4B08 A;  2G8U A;  1ZBH A;  4CIG A;  4ELV A;  2YNI A;  4Y1C A;  3DOL A;  1ZBU A;  2E6L A;  3LZJ A;  2QKB A;  5J2N A;  3AO4 A;  4CFA A;  1T8E A;  3H08 A;  2PZS A;  2HND A;  3TAF A;  4QOZ B;  4CEF A;  3AA5 X;  5JS2 A;  3RMC A;  1LV5 A;  4F2R A;  4Q0B A;  3KK1 A;  1QHT A;  1RBT A;  5KRT A;  3KD5 E;  1UA1 A;  4I2P A;  1W0H A;  4CF1 A;  4CIE A;  2KFN A;  1C0U A;  1JXB A;  1JLB A;  1FKO A;  2GBZ A;  1X9S A;  1NOZ A;  2YHA A;  2I5J A;  3NBP A;  1UAX A;  1S1U A;  3LAN A;  3RMB A;  1C6V A;  3SV3 A;  4DF4 A;  4F3O A;  3MED A;  4HCB A;  2O4I A;  3HPO A;  4CGD A;  3K58 A;  1WSF A;  4CF0 A;  4R5P A;  3AA4 A;  1B9F A;  3LAL A;  4JLH A;  1IKW A;  3TAP A;  2VWJ A;  4QCL A;  2HVH A;  1C0M A;  3NGY A;  4DS4 A;  1KFS A;  1X9M A;  2Z1J A;  3D45 A;  4KI6 A;  2OZM A;  4O0I A;  4FLZ A;  4DTN A;  2G8V A;  1IKY A;  3QEI A;  1TAQ A;  3C94 A;  3QER A;  1RTD A;  3QO9 A;  3LWL A;  2VG5 A;  3AA3 A;  4HVJ A;  3PX0 A;  1FKP A;  1YTU A;  1YVU A;  3AVK A;  3P83 D;  1N6Q A;  1BI4 B;  2FBX A;  3OYK A;  5EU7 A;  3QIO A;  4FJX A;  1RDD A;  3T19 A;  3CG7 A;  1XWL A;  4HHT A;  2LSN A;  1CLQ A;  5CZ1 A;  1ZBL A;  5KGX A;  4FJ7 A;  4OKK A;  4KB1 A;  4FCY A;  4N47 A;  1SL1 A;  1S1V A;  2JLE A;  1S1X A;  1VSI A;  3ZSX A;  3CFR A;  1U49 A;  4FJI A;  4FM1 A;  1ITG A;  4EZ9 A;  5FRM A;  3L3V A;  2YV0 X;  3LP2 A;  3TR8 A;  1A5W A;  4AHR A;  4CEA A;  1QSY A;  2KZM A;  2AJQ A;  2X6N A;  2VG6 A;  1RBS A;  1JKH A;  1HNI A;  1VSE A;  2BAN A;  2YKM A;  3C6T A;  4FLV A;  1LW0 A;  3TAG A;  4LSN A;  1NJY A;  4KRF A;  1L5U A;  5C24 A;  1KVA A;  3SPZ A;  3VQQ A;  4GVM A;  3RWU A;  4C8O A;  4C8N A;  1TK8 A;  4F3T A;  4PUO A;  4N76 A;  4IBN A;  3LWM A;  4DU3 A;  1WSH A;  3DOK A;  3KJV A;  2HB5 A;  3SNN A;  2RN2 A;  4J2B A;  1U48 A;  3ZT3 A;  1RCH A;  1RTH A;  1HPZ A;  4OLB A;  3M8P A;  3V9S A;  3VQE A;  1UOC A;  2VG7 A;  3K5O A;  4NCG A;  4FM2 A;  4FK0 A;  1L3T A;  2D0C A;  2D5R A;  2OPS A;  4CHN A;  1NKB A;  3LDS A;  1VSF A;  3ITH A;  2QK9 A;  3L2Q A;  3TWH A;  3HP6 A;  2P5G A;  1NK6 A;  1WAF A;  4K8Z A;  2HMI A;  1WAJ A;  4RW6 A;  4CFD A;  1HNV A;  4DQI A;  4CJE A;  3S9H A;  5CY4 A;  4KHQ A;  2BGG A;  2ZQB A;  3OYL A;  4B9M A;  1KVB A;  1TAU A;  1JL1 A;  3AVB A;  1B9D A;  3ZSZ A;  4CEQ A;  4CJ4 A;  1D8Y A;  4B8A B;  2HHT A;  1C1B A;  1BQM A;  4MQ3 A;  2B4J A;  2QXF A;  2ETJ A;  2YHB A;  2G8H A;  2F8S A;  4B9V A;  2DFH A;  3LPU A;  2BE2 A;  3K59 A;  1S5J A;  2FBY A;  3DYA A;  3MXJ A;  3SPY A;  4B3O A;  3QEV A;  4QAG A;  3CM5 A;  1DTT A;  4DFK A;  2IOC A;  3HVT A;  3LPT A;  4I2Q A;  4GMJ B;  1TKZ A;  2PY5 A;  4DS5 A;  3AV9 A;  3UIQ A;  1EKE A;  4H8K A;  3NF8 A;  1JLG A;  3AA2 A;  3L2R A;  3V4I A;  4OJR A;  5CYM A;  3OJU A;  3LAM A;  4M3R A;  3PX4 A;  4BDY A;  4DLG A;  4ID5 A;  4PY5 A;  4FW2 A;  3OYF A;  1NK4 A;  1QS4 A;  4E7H A;  1BI4 A;  1RDB A;  3AVF A;  5KTQ A;  4CK3 A;  3EY1 A;  4DQS A;  3AO1 A;  4CGI A;  2JGU A;  1VSK A;  3QNO A;  2XY6 A;  1HMV A;  5DMR A;  3TAR A;  4KB0 A;  1J9A A;  4NYN A;  5JS1 A;  1TK5 A;  4RW8 A;  2RF2 A;  4FLW A;  3U3G A;  1A5X A;  1KVC A;  3K5M A;  4DU1 A;  4F2S A;  4KRE A;  1JLA A;  4BE2 A;  1X1P A;  3V9U A;  4M3Z A;  3U3Y A;  4FYD A;  3RR7 A;  3VQ7 A;  4DSE A;  1GOA A;  3DLK A;  4OPJ A;  3QET A;  3AVA A;  2YNH A;  5DK5 A;  2OPR A;  3DLR A;  4OGE A;  3ZSR A;  2HHV A;  3QES A;  1ASW A;  3MXM A;  3RRG A;  3DLE A;  2XO7 A;  2EHG A;  3LZI A;  3K5N A;  4YNQ A;  4AHT A;  4AHC A;  2F8T A;  1NKC A;  2EX3 A;  3NH2 A;  4DQR A;  2OA8 A;  1TGO A;  3DRS A;  4O55 A;  2P51 A;  3NF9 A;  1VSH A;  1S1W A;  1NKE A;  4CJU A;  2G8K A;  4CHO A;  2YNF A;  1VRU A;  4O4G A;  3VQ9 A;  4CGJ A;  4JS4 A;  5HBM A;  3PX6 A;  1RT6 A;  2WON A;  2F96 A;  3G10 A;  4BAC A;  4CIF A;  4CJQ A;  3JYT A;  1FK9 A;  3WNE A;  3IAY A;  1EP4 A;  4DTJ A;  3U6F A;  2G8W A;  2KZZ A;  3HYF A;  2B6A A;  4O5B A;  2KFZ A;  3DRR A;  2IS3 A;  3C6U A;  4CJ3 A;  4DTM A;  3HP9 A;  3PUF A;  4FLX A;  3VQD A;  3S3M A;  3NCI A;  3KKS A;  1BHL A;  1C1A A;  1SV5 A;  1L3U A;  2B5J A;  3PO4 A;  1HQU A;  1UWB A;  3O4Q A;  4E1M A;  3HM9 A;  4TSX A;  4CEZ A;  3EZ5 A;  3RRH A;  4DQP A;  4Z0U A;  3QEP A;  5KRS A;  3AVG A;  1XC9 A;  2DFE A;  3HO1 A;  4FJ9 A;  1RT5 A;  5FDL A;  4CER A;  1TK0 A;  1WN7 A;  2P5O A;  2OYQ A;  3QNN A;  1HYS A;  3HVR A;  1UA0 A;  3KK3 A;  1DTQ A;  3V1O A;  4GW6 A;  2D0B A;  4JS5 A;  4E3S A;  4AIL C;  4W5T A;  2E4L A;  1N5Y A;  3KD1 E;  4H4O A;  3KLG A;  1O1W A;  4DTX A;  4HCC A;  3VQ5 A;  1IO2 A;  1EXQ A;  2X6S A;  4Y1D A;  4F8R A;  3IS9 A;  4LSL A;  4NCB A;  4KHU A;  3OYN A;  3ZSO A;  2DTU A;  2HW3 A;  4E89 A;  4W5Q A;  5D3G A;  4CFC A;  5C25 A;  1TVR A;  3DLB A;  1RNH A;  4AH9 A;  4E19 A;  4BE1 A;  1RT4 A;  2HVI A;  1D5A A;  1NJX A;  4M3W A;  1WLJ A;  5SWM A;  2DY4 A;  2YNG A;  3OJS A;  3M8R A;  4MFB A;  3WNG A;  2HHS A;  1NK7 A;  4Z4G A;  1TKD A;  4N41 A;  3HXM A;  3V1Q A;  4CEC A;  2KW4 A;  1S9G A;  3PY8 A;  4KHW A;  1REV A;  4C8M A;  3VA0 A;  5T7B A;  1C1C A;  4BWM A;  1SKW A;  3NF6 A;  3O3H A;  3KLH A;  3SV4 A;  1JLE A;  1RBU A;  1NK9 A;  3ZSQ A;  3ZT2 A;  3SQ1 A;  2XY8 A;  3VN5 A;  1TL3 A;  1WSI A;  4N56 A;  1TKX A;  3SUO A;  3L8B A;  1RBV A;  4B9S A;  4DWI A;  4FVM A;  1HQE A;  3M8S A;  4B9L A;  1WSE A;  3AO2 A;  3NAE A;  4PWD A;  3C95 A;  4OLA A;  3O3F A;  4DSK A;  3V1R A;  3ZT1 A;  2OPP A;  4CHY A;  4FK2 A;  4EP4 A;  1YTA A;  3JSM A;  2IC3 A;  3QEW A;  2QKK A;  3HPH A;  1ASV A;  1VSD A;  3DMJ A;  2G8F A;  1X9W A;  1B92 A;  3V6D A;  1SL2 A;  4B9U A;  3AVJ A;  4J2E A;  3KLE A;  4ELT A;  2P1J A;  3TAQ A;  4AHS A;  4CGF A;  2E6M A;  4KI4 A;  4ZTF A;  4I9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...