1UOCA

X-ray structure of the rnase domain of the yeast pop2 protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
286
structure length
263
Chain Sequence
PPIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIYGIDGDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords POP2
publication title X-Ray Structure and Activity of the Yeast Pop2 Protein: A Nuclease Subunit of the Mrna Deadenylase Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 81
structure length 263
sequence length 286
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uocA00
4O4GA 1J54A 3PV8A 1HNVA 4BWMA 3V9WA 4KI6A 2G8IA 4W5NA 3CYMA 4M3RA 3F73A 3LAKA 3VQCA 3SI6A 3C6UA 2HHQA 1BCOA 3TAPA 3L2WA 1DTQA 1WN7A 3OVNA 1RT6A 3HPHA 4OGEA 2G8UA 2F8TA 4QAGA 4KB0A 2D0AA 4KREA 3P1GA 4CEDA 1GOAA 4FJMA 3M8QA 4Y1CA 4AHRA 3L8BA 3KK1A 4FK0A 3SQ1A 4B8AB 4FYDA 2HVIA 1IO2A 1S9GA 1KVCA 1VRUA 2JGUA 4RG8A 4OGCA 1CLQA 3AVMA 4AHCA 1N6QA 4FJKA 2Z1JA 1JL2A 3LP2A 3KK3A 1XC9A 3KD1E 3S3NA 1ASUA 3C95A 3TAGA 4ZHRA 1RCHA 4F8RA 3K5OA 4DLGA 3NE6A 3VQ6A 4PUOA 4CEFA 1LWEA 4OPJA 3QEIA 4CHQA 1VSDA 1KRPA 3ZCMA 4L8RB 2IS3A 3O3GA 2ZE2A 4FJGA 1VSMA 4B3OA 3HPGA 3K5NA 1XHXA 2HHXA 4B9UA 4M3UA 3HXMA 3SJJA 3SPYA 1QE1A 2Z1HA 3AVCA 4CECA 3AA4A 2B4JA 3ZSWA 4CJVA 4E7KA 3NH0A 3P5JA 1NJZA 1CZ9A 2DFHA 1SL0A 1LWCA 1WSEA 4KV8A 4E3SA 1WLJA 4HTUA 4DFJA 4HHTA 3CM5A 4FK2A 4MFBA 4Q5VA 4DQQA 1WSGA 4AH9A 1HJRA 4CEOA 1Q9YA 3AVGA 3ZT3A 4NCBA 3SUNA 3B6OA 2E4LA 3ZSZA 4AHSA 3DLBA 2GBZA 4KKOA 4AHTA 1WSJA 4O5BA 3ALYA 3NGZA 3ZSRA 3TI0A 1RTJA 3M8PA 1TK8A 1D9DA 3OYNA 1Q9XA 1WSHA 3LP3A 4DTMA 1VSHA 4DQIA 1KCFA 2YNGA 1QSLA 4CHYA 3SPZA 3QEXA 3PY8A 3HJFA 2RN2A 3OS0A 1ITGA 3CG7A 4GMJB 4O0JA 3OYDA 4CFDA 2Y1JA 4BE0A 3SQ4A 1NK0A 1KSPA 2G8HA 2XHBA 3B6PA 4LSNA 2IOCA 3ZT2A 1KLNA 4WE1A 1S9EA 4CJ4A 4YFUA 4F2RA 4E7HA 1RNHA 4KO0A 5KRSA 4CIFA 4IKFA 1KFDA 1CXQA 4B9MA 4Z4CA 3PUFA 3LDSA 1NJYA 5DK5A 1WAJA 4KI4A 2ITGA 4HVJA 2FBVA 2FBTA 3HVTA 2PZSA 1WNSA 1JLCA 3OYKA 3OJSA 1HRHA 4DSEA 3VQ8A 3S9HA 4J2BA 1RBRA 1XHZA 1EX4A 4KTQA 1TL1A 2A1SA 3K58A 3SZ2A 3PO5A 3HP9A 1WSIA 4CEAA 3I0SA 3SUPA 3V1RA 3MEGA 4GW6A 2KW4A 3PO4A 3MXMA 1J53A 4H4OA 1B9FA 1JLEA 1CXUA 1EXQA 3AA5X 4W5RA 4AILC 5J2PA 1NK5A 2YV0X 1NOYA 4KFBA 2W42A 1SV5A 4DG1A 2Y1IA 3ZT1A 1TKZA 4HCCA 4CJLA 1QS4A 1YVUA 1LW2A 4B9LA 3QLHA 4OKJA 2B6AA 2F96A 1C6VA 4DU3A 3QEWA 5C25A 1DLOA 4K8XA 3LWMA 3MAQA 4CK2A 1KFSA 1O1WA 1TV6A 2IDOA 1VSFA 3WNGA 3A2FA 4DTRA 4M3WA 4QOZB 4FW1A 3QNNA 4N41A 4E19A 3AVHA 2XY6A 4ZTFA 1L3TA 2OZMA 4W5OA 3QO9A 3EY1A 5I42A 4NCGA 1LAVA 3ZSVA 4JS4A 1ZYQA 4OLAA 2IAJA 3MXJA 3NF8A 1TKXA 2OYQA 3ZSQA 4CGGA 1D9FA 1NOZA 1UWBA 3VQQA 1BI4A 4JRPA 3AO5A 3DRSA 3HVRA 5FROA 3CFRA 4CERA 2OZSA 4DSLA 4CJ3A 4C8NA 3K5LA 1A5VA 3HM9A 4FLYA 3QNOA 4DS5A 3PX6A 3CQ8A 3RWUA 1SKSA 3P83D 4BDYA 3DRRA 3HYFA 4RW9A 4CF1A 3NF7A 2HNZA 2O4GA 5I3UA 1RDDA 1J5OA 3LP0A 4HUEA 4TSXA 2HNDA 3AVIA 4CHOA 3D0PA 3AVLA 5KI6A 1JLQA 1HYZA 4J2EA 4CJSA 1RT5A 1WSFA 4FJ9A 2GV9A 1BQMA 2XY8A 1HPZA 4FLXA 1QSYA 2HHWA 1RBSA 2HNYA 3V4IA 4FJLA 3THVA 2VG6A 3KK2A 1ASVA 2VG7A 4H8KA 4AHUA 1NK8A 3KD5E 1G15A 4DSIA 2FBXA 2IC3A 1Y97A 3TAFA 1HNIA 1LAWA 4JLHA 2RF2A 4CIGA 1S6QA 2HHTA 2BGGA 5HRNA 1VRTA 4DF8A 2VG5A 1C0UA 4CEEA 3SYZA 5KTQA 1C1CA 4CCHA 3O3FA 1Q8IA 1WAFA 2WOMA 3AVAA 4FLVA 1T8EA 4F3TA 4CFCA 1U04A 1FKOA 1YT3A 4CK3A 4KHWA 3AA3A 1RDAA 1YTAA 2XY7A 5K14A 1BI4B 4PWDA 3ZT4A 1XI1A 4ELTA 3TWHA 3SNNA 2P5OA 1IKYA 1REVA 4J2DA 3IRXA 4B8CA 4CJPA 2G8WA 1QTMA 1UA1A 3OYHA 3O3HA 3L2UA 2E6MA 5FDLA 3OYCA 3K59A 1SKRA 1RBVA 1GOCA 1RT4A 1BGXT 1SUQA 1VSEA 1VSIA 3NAEA 4NCAA 2P1JA 5D3GA 3OJUA 4LH4A 4CF0A 1SKWA 4DF4A 1BIZA 5HRRA 4OKEA 2KQ2A 3KLHA 4CJWA 3ZSXA 3IAYA 1JLFA 1HYSA 4I2PA 4C8MA 3DLHA 3NBPA 4IBNA 1T03A 4OKKA 1K6YA 3MXIA 4EZ6A 1HYVA 2YNIA 4RW4A 1D5AA 4CHNA 3K2PA 4DU1A 2YNFA 3RMCA 1NK7A 4BDPA 4ID5A 1L5UA 3JYTA 1BHLA 3FFIA 3V9ZA 5CYMA 3NDKA 3VQ4A 4CJQA 3S3MA 4I9QA 3DLEA 1ZBIA 1SL1A 2NUBA 5KGWA 1ZBUA 3I0RA 1R0AA 5J2NA 1I3AA 2P51A 3VQPA 1N5YA 2BE2A 3NF6A 2QKKA 3AO3A 2KFZA 3OS1A 4CEBA 1CZBA 3O4QA 4KHSA 4OPKA 3NF9A 1EKEA 1QHTA 4IG3A 3NGYA 5HRSA 3SUOA 4EP4A 3LPTA 4G1QA 4DFPA 1U4BA 4FZYA 3NH1A 3MEDA 4O0IA 1RTDA 4PY5A 5FRNA 1HMVA 3AO4A 3HSTB 4I7FA 1A5XA 4CK1A 4Z4HA 4FJJA 3TABA 3SQ0A 2YNHA 5EU7A 1Z26A 1IKVA 1VSKA 3OY9A 3WNEA 4CJTA 1NJWA 2HVHA 3T1AA 4O55A 5CY4A 1RBUA 4M3TA 1B9DA 4B9VA 1KLMA 4FK4A 1S1VA 3RMBA 3OYMA 3K5MA 3MECA 3BDPA 3ZT0A 1S1XA 4N47A 2PY5A 3L2QA 1TK0A 3NCIA 3S3OA 1IG9A 3AVJA 3ZSOA 1U48A 4KHUA 4DQRA 3OYIA 2D0BA 4C8LA 1RT1A 1IKWA 4RW6A 5C42A 2VWJA 4PA1A 2X74A 2G8KA 1BQNA 2KZZA 4F4KA 4CGIA 4M3ZA 4CJUA 2QK9A 1RBTA 4KTWA 2OPQA 4AHVA 2OPPA 3V6DA 1MU2A 4BE1A 4ZTJA 3LALA 1HQUA 4DQSA 1SL2A 1KVAA 3F9KA 3AVFA 3HT3A 3KKRA 3KTQA 1TL3A 5CYQA 4CFBA 4FM0A 3RRHA 2X6NA 3VA3A 4E89A 3DLGA 5J2MA 3NGIA 1JXBA 3OYGA 2IGIA 3OYBA 3ZSYA 4DTXA 4CGDA 1QQCA 4MQ3A 3C6TA 2YHBA 3RMAA 1BISA 3AV9A 4FJIA 3NHGA 1LV5A 3H08A 4FW2A 3RRGA 4EZ9A 4FXDA 5CZ1A 4FJXA 3CFPA 4KAZA 3E01A 1DTTA 3VQAA 3VQDA 1FKPA 4M45A 1T05A 4CHZA 2G8FA 4JRQA 2KZMA 2DTUA 2QXFA 4FM1A 5HLFA 2ATQA 3CFOA 3V81A 1ASWA 3UIQA 4CHPA 3L3VA 3LAMA 3I8DA 4CFAA 1KVBA 2YHAA 4NYFA 4FLUA 4B9TA 3LPUA 4KHYA 2EX3A 2GUIA 1RTHA 4C8KA 2ETJA 4FJHA 4CJEA 2OPSA 4RW7A 3LZIA 1FXXA 1W9HA 5SWMA 4W5TA 4DTSA 3RR8A 4LY7A 3HO1A 3T3FA 1JXEA 4HCBA 4I9LA 3RTVA 1W0HA 2DY4A 3DOLA 4FLWA 2O4IA 2B5JA 3PX4A 1U47A 4IFYA 1EP4A 1S5JA 4FJ7A 3QERA 4QCLA 1RDCA 3U6FA 3DM2A 4PQUA 4OVLA 4RW8A 2Q3SA 1L3VA 1TAUA 1JLAA 3VQBA 3AVKA 2D5RA 3AA2A 1S6PA 4DU4A 3L3UA 3G10A 4Z4GA 3SQ2A 2KFNA 5HRPA 3DMJA 5KRTA 4K8ZA 3BGRA 1ZBLA 3QINA 3RR7A 2OPRA 3AO2A 3QIOA 1VK0A 4KTZA 4E1NA 2A1RA 4F3OA 3D45A 4BWJA 4FLZA 1RILA 3IS9A 1TKDA 3QEPA 3VA0A 4BACA 1RT3A 1S1UA 4B08A 3O4NA 4CF9A 3VQ5A 1NK6A 4ICLA 5JS2A 4HUGA 4E7LA 3LP1A 2XY5A 1LW0A 4CEQA 2BANA 2P5GA 3U3YA 4BE2A 2PYJA 2DFEA 2XRIA 4KHNA 4Z4IA 4CJRA 4Y1DA 3KLEA 4CEZA 4C8OA 3DLKA 3V9SA 1J9AA 1VSJA 1C0TA 3VQ7A 1X9SA 2E6LA 1I39A 1U49A 4R5PA 1X9MA 4CGFA 3TAQA 3SV4A 4HUFA 3OS2A 3WNFA 3DI6A 1F21A 1X9WA 4DTNA 2PYLA 4XIUA 1NKEA 4DWIA 4DTPA 2HHVA 2EHGA 4OJRA 3U3GA 4J2AA 1TKTA 1BIUA 2HW3A 1QSSA 1D8YA 5T7BA 2YKMA 3DYAA 1UOCA 4E1MA 3NH2A 1JL1A 1C1BA 1JLBA 1HQEA 1RDBA 4M41A 4M3XA 2Z1IA 3TR8A 3ITHA 2BDPA 2ZQBA 2Z1GA 2HB5A 3TARA 5DMRA 1NK4A 2FC0A 3SV3A 3HK2A 4CJKA 1BCMA 1JLGA 4DTJA 4CF2A 2RKIA 3TAMA 4FM2A 4FZZA 3VQEA 1KTQA 2KTQA 1RTIA 4I2QA 4M42A 1T7PA 4KRFA 1L3SA 2X6SA 1C0MA 1TGOA 4CIEA 5E41A 5HROA 5JS1A 3LWLA 3DLRA 5SZTA 3EZ5A 3HP6A 3KLGA 4DFMA 1UA0A 4FLTA 1BL3A 3KJVA 3DRPA 2D0CA 2ZD1A 4DSKA 4LH5A 5J1EA 3OYFA 4GVMA 1S1TA 1UAXA 2DFFA 3LANA 4FJ5A 4LSLA 2LSNA 4ELUA 3CM6A 5HP1A 2JLEA 2RPIA 3M8SA 3PX0A 4KPYA 4LD0A 4N76A 4CGHA 4DMNA 3HPOA 4CJFA 1TAQA 1JKHA 4H4MA 3JSMA 4CE9A 4B9SA 3AO1A 4KB1A 2QKBA 1IKXA 3AVBA 5FRMA 3DOKA 3T19A 4CESA 4UQGA 3SCXA 1TVRA 3OYJA 2X78A 4DTOA 1YTUA 4ID1A 3V1OA 4Z0UA 4DLEA 4OLBA 3MEEA 4IDKA 1IH7A 5KGXA 4FJNA 4CGJA 3M8RA 1ZBHA 1ZBFA 3QIPA 2FBYA 3SUQA 4N56A 4YNQA 1EETA 4NYNA 3V1QA 1NJXA 3QETA 1RT7A 4EP5A 1S1WA 4KHQA 2F8SA 1RT2A 3C94A 3NFAA 4DSFA 1C1AA 4W5QA 1LWFA 4IG0A 4DFKA 3IG1A 4CF8A 5J2QA 3TAEA 2G8VA 3OYAA 3L2VA 3QESA 3L2RA 4FZXC 4O44A 1NKBA 1XWLA 4B9NA 5CZ2A 4Q0BA 1GOBA 1A5WA 3RMDA 3KKSA 4Z4FA 4E7JA 3KLIA 1L3UA 5C24A 2YKNA 4FCYA 4FVMA 2R7YA 4ELVA 4M3YA 3QEVA 2I5JA 1B92A 4Z4EA 3K57A 2VWKA 2XO7A 3HL8A 4DS4A 1NKCA 1NK9A 4E0DA 4DSJA 3KLFA 3ASMA 1U45A 3ISNC 4F2SA 3G0ZA 3WNHA 2HMIA 3V9XA 4N5SA 4FJ8A 2HHUA 2HHSA 1VSLA 4BDZA 4JS5A 3VN5A 3OYLA 3VQ9A 2WONA 3EYZA 4E7IA 4DQPA 1TK5A 2AJQA 3V9UA 4DTUA 2OA8A 4IFVA 1X1PA 4CJ5A 3AVNA 3ULDA 5HBMA 3KIOA 3TANA 1Z25A 3LZJA 3OYEA 1FK9A
chains in the Genus database with same CATH superfamily
1J54A 1NJIO 3CCQN 5I9EB 4IEIA 2YJEA 5LJVA 1DEJA 3CYMA 4M3RA 4F9OA 4B3SK 2UUCK 1WN7A 4OGEA 1RT6A 3HPHA 2G8UA 3WXKA 1OKJA 4KB0A 4KREA 3P1GA 1YJWN 4V19S 3M8QA 4AHRA 2FXUA 2GEMA 2WC9A 4WQ4A 4BG9A 4OGCA 1BA1A 3AVMA 1JL2A 3WEEA 1XC9A 3TTCA 3VPZA 4H5VA 4M63C 2O8DA 4ZHRA 1JJ2M 1RCHA 3K5OA 4DLGA 3NE6A 4CEFA 5JICA 3DXMB 2E2QA 4BRAA 4L8RB 1YVNA 4CZKA 3HPGA 1NLVA 4X66K 1QE1A 3VTIA 4MO5A 3AA4A 2B4JA 2IVOA 2KLAA 1NJZA 2DFHA 3R8EA 2ZGZA 4CD1A 4FK2A 2W6KA 4MFBA 5AQQA 4DQQA 3C7NA 1M1KO 1HJRA 3AVGA 3ZT3A 4NCBA 3SUNA 3WUHA 4DV1K 4JKHA 3VF2A 5AZIB 3TI0A 3ZSRA 4IWVA 1O13A 1Q9XA 5AQJA 3LP3A 3FFKB 2YNGA 4ILGB 1QSLA 3SPZA 3HJFA 3OS0A 1ITGA 3G71N 3OYDA 2CGLA 2XHBA 1VQPN 2UUBK 4LSNA 2IOCA 4GNIA 1S9EA 3R6MA 5KRSA 5M1NA 1KFDA 3VMFB 4Z4CA 3BY5A 1NJYA 4KI4A 4OO1J 3KWGA 3VENA 1WNSA 3OJSA 4DSEA 3CC2N 1IV0A 5JVHL 3SZ2A 1WSIA 4LF4K 4JKGA 3MXMA 1J53A 3CJBA 1HNZK 3A5MC 1IJJA 1XNRK 1EXQA 4W5RA 3CJAA 3TPQA 4KFBA 3O4WA 3FR0A 4IO9L 2Y1IA 1TKZA 4A59A 4HCCA 1QS4A 2B6AA 2F96A 5DM6L 5EX5A 4K8XA 4CK2A 4WCEL 4U67L 4BR9A 2GTDA 4E19A 3LDNA 1VQ7N 4ZTFA 1L3TA 2OZMA 3ZSVA 1ZYQA 5F0XA 3U9ZA 2P9PA 4CERA 2BH1A 3VEWA 3CQ8A 4UY8O 5AQWA 4BC5A 3I56N 1RDDA 1Q18A 3LP0A 3OHRA 4CHOA 5KI6A 1JLQA 1K8AO 5BRHA 1Q81O 1WSFA 5M1OA 4FJ9A 4BVPA 1YJNN 1EWRA 2XY8A 3OW2M 1QSYA 4WFNL 4BRNA 3THVA 3A5LC 4JI2K 4WYBA 1BU6O 5M1QA 2RF2A 2BUPA 1HPMA 3CD6N 3O1WA 4DF8A 1C1CA 3AVAA 3VGMA 2Q0RA 4CFCA 1FKOA 4CK3A 1ZXOA 2VGMA 1RDAA 5K14A 1BI4B 5F1XA 1IKYA 2W40A 4B8CA 2G8WA 1QTMA 1N34K 3AY9A 2W41A 3O3HA 1RBVA 1RT4A 1X3MA 2VYPA 1SKWA 5AQHA 5HRRA 3KLHA 1NGCA 4CJWA 3CPEA 1JLFA 1HYSA 4I2PA 1U6ZA 3RVCA 5AQFA 4IBNA 5EOYA 4CHNA 5FPNA 1D5AA 4DUYK 2D0PA 1BHLA 3V9ZA 3NDKA 1NGDA 4CJQA 3DLEA 4OX9K 4JK8A 1SL1A 2NUBA 1R0AA 5M1FA 3VQPA 1N5YA 2QWPA 3O5BA 3AO3A 5E26A 4O8KA 4JI4K 4WF9L 4CEBA 3IUCA 3O4QA 4KHSA 1X9JA 4WFAL 4K41A 5HRSA 3SUOA 2E20A 4DFPA 1U4BA 2F4VK 3NH1A 5FRNA 3HSTB 3AO4A 4CK1A 4Z4HA 3TABA 3SQ0A 4IOXA 1NJWA 1VSKA 3WNEA 4CJTA 4FOEA 1RBUA 2YI1A 4M3TA 3OYMA 3BDPA 3HI0A 1S1XA 5A2QO 2QA4N 3S3OA 3AVJA 3P39A 4DQRA 2D0BA 2GWJA 1Q86O 4LFBK 2KZZA 1VQ8N 4M3ZA 1RBTA 4DV6K 2ASPA 2OPPA 3QFUA 1FJGK 1HJOA 1NMNA 3LALA 1HQUA 4DQSA 1KVAA 3BUZB 2NRWA 3ATVA 2OCEA 5CYQA 1EWQA 1QZ6A 4R79A 2WBNA 2IGIA 5KPZA 1QZ5A 4NLBA 1QQCA 3WXJA 3RMAA 5AQOA 1C0FA 4DKWA 3ZETB 3H08A 3RRGA 4FXDA 1KAZA 4IFEA 4H5RA 3CCEN 5M1PA 2G8FA 2DTUA 1T6DA 4FM1A 4RWTA 2UXDK 2HMPA 4CFAA 4FLUA 2H3GX 2A5XA 5KQ8A 3WXMB 2CGJA 2OPSA 1YJ9N 3RR8A 5SWMA 3HO1A 2VQFK 1KQSM 1VHXA 1DGKN 1W0HA 1EP4A 3QBWA 4C1NK 2UUAK 1BWFO 1RDCA 3U6FA 3DM2A 3THXB 4OVLA 4QS8A 3SLCA 4JAXA 3VQBA 3ID8A 1W2BM 5HRPA 1YIJN 3D45A 3IS9A 3JXUA 3THYA 4BACA 3W0LA 3EEQA 1RT3A 1S1UA 4B08A 4GKJK 3O4NA 3E9LA 1WBDA 4H5TA 3LP1A 1LW0A 3K9JA 3G6EN 3R1XA 4KHNA 2XRIA 3KLEA 4FJHA 3DLKA 3IFRA 1VSJA 1C0TA 1X9SA 1U49A 1VQMN 4R5PA 4HUFA 4DR7K 3D7EO 1Y64A 2FF3B 4CZJA 1WUAA 4JD2A 2PYLA 1NKEA 3HRGA 4FWPA 4DWIA 4DTPA 2HHVA 3MN9A 2D4WA 4OJRA 1TKTA 2A6AA 1QSSA 1D8YA 5T7BA 4CJ7A 2P9UB 5E84A 1LCUA 1C0GA 4FWOA 3ITHA 4BR7A 2BDPA 2Z1GA 2HB5A 4JHDA 5DMRA 5B8HA 5LJWA 5EVZA 4CJKA 2F7TA 5LMUK 3TAMA 4FM2A 3VQEA 1FW6A 1RTIA 1T7PA 5AQZA 3EZWA 3LWLA 3DLRA 5SZTA 2JWLA 3HP6A 4FLTA 3KJVA 3D2FA 5BREA 3DRPA 3UKUA 2E1YA 4DSKA 3QMLA 1S1TA 3O9SA 2JLEA 1XC3A 4KPYA 5M1KA 3IMXA 1R59O 2QXLA 1TAQA 3AO1A 2Q36A 4JKBA 1XUPO 5FRMA 2FSKA 2YHXA 4UQGA 3SCXA 1YTUA 2X78A 4AF1A 4ID1A 4OLBA 3MEEA 4H0PA 1NJXA 3SUQA 2ZJPL 3F5TA 2HBLA 4DSFA 2O8EA 4W5QA 1LWFA 3IG1A 2O8FA 4JI5K 4FZXC 1NKBA 1XWLA 2NLXA 2YHWA 1GOBA 1E4FT 2OANA 5C24A 1L3UA 4Z4EA 3HL8A 4B1UB 3ASMA 3LL3A 2HHUA 3V9XA 3RSEB 5IWAK 1OVQA 3OYLA 3VQ9A 1S3XA 3EYZA 4E7IA 3J7ZO 4CZIA 5BRFA 3F73A 4O4GA 1NMDA 4DV3K 2V7ZA 3M3ZA 3VQCA 1BA0A 1OVYA 4JK9A 3L2WA 1DTQA 3OVNA 2F8TA 4YDUA 3I55N 4QAGA 1EO1A 2QWQA 1GOAA 3LM9A 4Y1CA 4BVOA 3SQ1A 4B8AB 1S9GA 1VRUA 4RG8A 1QQMA 4FJKA 3ZEUA 4A61A 4PL7A 3T1HK 3PSIA 3KD1E 3C95A 3TAGA 3MWPA 2HBMA 4CHQA 3ZCMA 3O3GA 3ID6A 3W3DA 3HXMA 3SPYA 2Z1HA 2P9LA 4BC4A 5GAEP 3P38A 1NU0A 4CJVA 4E7KA 3VGKA 1CZ9A 1NGGA 1WLJA 1GLEG 4HHTA 4Q5VA 4KKOA 3SMPA 3UKRB 4O5BA 5AQRA 1RTJA 4YHHK 1VQON 4DTMA 1J5EK 2QW9A 4CHYA 4ISEA 3QEXA 4GMJB 3SQ4A 4O0JA 2Y1JA 2G8HA 3VEZA 1NK0A 4XH1A 3SBGA 2OTJN 3ZT2A 1KLNA 1ZBSA 1J6ZA 1BO5O 5C10A 1GLCG 4YFUA 4E7HA 5ADXA 3BEXA 3H6EA 1NGBA 2ITGA 4BR5A 3HVTA 2YJFA 4WQ4C 2PZSA 4IOCL 3SAHA 3VQ8A 1JCEA 3S9HA 1EX4A 4DV0K 3PO5A 3CC4N 1N8RO 4HWIA 2OTLN 4GW6A 2KW4A 1K9MO 3EL2A 3FGUA 3TSPA 1B9FA 1JLEA 1CXUA 3AA5X 3SMSA 2KHOA 2W42A 2AA4A 3ZT1A 1HNXK 3Q7CA 4CJLA 1YVUA 4OKJA 1C6VA 1DLOA 1TV6A 3WNGA 2IDOA 1VSFA 1SS6A 4QOZB 4FW1A 2HHHK 3EY1A 3VF4A 4JS4A 4OLAA 3DXKA 3NF8A 3ZX2A 1OH6A 4CGGA 2OZSA 3DRSA 4DSLA 1TYQB 4CZFA 3HM9A 3L4IA 3RWUA 3P83D 4MO4A 1NGFA 4RW9A 1EQYA 4CW7B 4HUEA 3V9UA 3D0PA 4JN4A 4IJNA 4CJSA 3AARA 1HPZA 5ELZA 2HHWA 4FJLA 3O9TA 3A5OC 4AHUA 3J7YP 3T7ZA 2QTDA 4DSIA 3NMUA 3TAFA 1LAWA 4JLHA 3OBWA 2NRZA 4ISGA 3OA9A 5KTQA 3D2EB 1T8EA 4FLVA 3O9RA 2Q31A 1U04A 3AA3A 4BR0A 2XY7A 3ZT4A 1XI1A 2P5OA 4CJPA 5LY3A 5C15A 1NNEA 3K59A 4NB4A 1K8KA 1SKRA 1BGXT 4K42A 3OJUA 4LH4A 1VAZA 1TUYA 3O80A 4LF6K 4A5BA 1BIZA 2KQ2A 3GOIA 5AQVA 5BPMA 3WXIA 1HKCA 3IAYA 4C8MA 3DLHA 3NBPA 4YY3K 3J7AP 1VQNN 4FL9A 3K2PA 4DU1A 2YNFA 4M7YA 3RMCA 4EFHA 3F9MA 3VEYA 3FFIA 5CYMA 3VQ4A 4O5FA 4I9QA 3CJCA 3PIOL 3SJHA 5KGWA 2P51A 2O8BB 2BE2A 3CIPA 3NF6A 3HZ6A 1CZBA 4BY9C 4OPKA 4K43A 4G1QA 3A0IX 4I7FA 1A5XA 5EU7A 3CPWM 1Z26A 4JKEA 1IKVA 3OY9A 3VF6A 1HNWK 1N36K 4B9VA 1KLMA 5AR0A 4DR4K 3RMBA 4U7BA 3MECA 3K5MA 3BF3A 3K0SA 4BRIA 4FWLA 3L2QA 1G99A 3NCIA 1TK0A 2VQEK 1IG9A 4KHUA 4CBXA 1RT1A 2G8KA 4CGIA 2OPQA 2JWKA 4AHVA 3O8MA 2CGKA 1VQ6N 1RDWX 3CXCM 3V6DA 1MU2A 4BE1A 2HF3A 3F9KA 3I8BA 3KTQA 3KKRA 4BRMA 4CFBA 2RE2A 2X6NA 3VA3A 4E89A 4B3TK 3ZX3A 1JXBA 4DCHA 4GY2B 1GLLO 3OYBA 4DTXA 4CGDA 2J4RA 3C6TA 1BISA 1RDUA 3AV9A 3H3NO 1NM1A 4EZ9A 5CZ1A 5AQUA 3E01A 4B1WB 1GLBG 1DTTA 1T05A 4CHZA 4JRQA 3V81A 3L3VA 3I8DA 4KHYA 4B9TA 3K9KA 3CCVN 1RTHA 3LDLA 3CJ7A 3AGRA 3LM2A 4DTSA 4LY7A 4KH5A 1JXEA 3DOLA 4FLWA 3PX4A 4IFYA 1S5JA 3CETA 4FJ7A 3QERA 4LF9K 2E2OA 1L3VA 1IBKK 3FE1A 4DV4K 4DU4A 2P9IB 2KFNA 2PFUA 4K8ZA 4PKIA 2YHYA 5TKYA 3RR7A 2OPRA 2A1RA 3GBTA 4F3OA 5AZIA 1SZ2A 4BWJA 2FLOA 1GLDG 4CF9A 4X62K 2ZJQL 4E7LA 5AQNA 2XY5A 1VQ4N 3U3YA 4LFAK 2DFEA 3VGLA 2P9NA 3WXLA 4FWMA 4Y1DA 3MMVA 4B1YB 3V9SA 1X9MA 1I39A 3FZHA 4CGFA 2DPNA 3SV4A 3OS2A 4XEIA 3ULEB 4JYAK 4XIUA 4J8FA 2A42A 4RTFD 5GINA 4E1MA 3NH2A 1JL1A 1C1BA 5BN8A 1Q7YO 1KAYA 4I6MB 1E3MA 2IIRA 4CZHA 1NK4A 5C12A 5AFUA 1JLGA 4CF2A 4K0KK 4I2QA 4M42A 1L3SA 1C0MA 3CCMN 1QVGM 4DFMA 1UA0A 1BL3A 2D0CA 4HTLA 4LH5A 4H0XB 5J1EA 4GVMA 1UAXA 4LSLA 5CR4A 2A41A 2RPIA 3PX0A 5ADXH 4CGHA 5AZJB 4CJFA 1YI2N 4B9SA 2HBKA 1GLFO 4KBOA 1W97L 3R9PA 3T19A 2FSJA 3OYJA 4DTOA 4JHDB 4IDKA 5AQMA 5KGXA 4FJNA 1WB9A 5FLXO 1ZBHA 3S41A 3QIPA 4N56A 4H5NA 1LOTB 4FWQA 1RT7A 2NRRA 4EP5A 4KHQA 2F8SA 2P9KB 4IG0A 2G8VA 4LC9B 4Y0WA 4Q0BA 3D2FB 3E9PA 5BPLA 3QEVA 3K57A 5DM7L 2XO7A 4DR1K 4FWSA 1NK9A 4E0DA 4DSJA 3VERA 3G0ZA 3WNHA 2HMIA 1VSLA 1GLAG 4JS5A 3VN5A 2NZTA 4JKDA 3LDOA 4JK7A 4DTUA 2OA8A 3TANA 3TARA 3LZJA 3PV8A 1HNVA 4BWMA 3V9WA 4KI6A 2G8IA 4W5NA 5C2FA 1OH5A 3LAKA 3C6UA 2HHQA 4GKKK 1V4SA 1BCOA 2FSNA 3CCSN 2UXCK 2D0AA 4FK0A 3KK1A 3OTOK 4LF7K 4AHCA 1N6QA 2Z1JA 3LP2A 3MX2A 1GLJO 3ENHA 3S3NA 1ASUA 1WOQA 5LL6Z 4F8RA 3VQ6A 2V51B 1LWEA 4OPJA 1VSDA 1KRPA 1VSMA 1XHXA 4XH4A 4M3UA 3AVCA 4CECA 5GIPA 1SQKA 1XMOK 3NH0A 3P5JA 1WSEA 4KV8A 4E3SA 4DFJA 3CM5A 3B6OA 1VQLN 3DLBA 2GBZA 1YITN 3KVGA 2ZWHA 3M8PA 3H45C 1WSHA 4DQIA 4B3RK 1VSHA 4K25A 1KCFA 4CVNE 3CG7A 4BE0A 3B6PA 3A5NC 2GX9A 4KO0A 4CIFA 3DAWA 4B9MA 1CXQA 4JI1K 3PUFA 3T69A 3LDSA 5DK5A 4HVJA 2FBTA 5GAGP 1HRHA 4OPHA 4J2BA 3HOSA 4KTQA 3E9OA 1T3VA 3ZETA 4CEAA 3I0SA 4IOAL 3V1RA 3MEGA 1KXPA 3J81O 3PO4A 1NGIA 4KHPK 4BR4A 4BQZA 5J2PA 2YV0X 1NOYA 5AQSA 1SV5A 1Z25A 3E1YA 4WQ5A 3QEWA 2QWRA 3MN7A 3LWMA 3MAQA 1O1WA 4M3WA 3A2FA 3QNNA 4N41A 5KPRA 1NBWA 4CZLA 4W5OA 3QO9A 3VOVA 5I42A 4NCGA 1LAVA 2O8CB 2IAJA 3P31A 3JS6A 1NOZA 3VQQA 5H1SQ 3M6GA 4JRPA 2F9TA 3AO5A 3HVRA 3CFRA 4IXCA 1W7AA 2KKZA 3LDQA 4CJ3A 3QNOA 1E4GT 3K5LA 4DS5A 4DV5K 3MDQA 3PX6A 1SKSA 4BDYA 4CF1A 2HNZA 2O4GA 2ASOA 3L0QA 2HNDA 3AVIA 4KH4A 1RT5A 2AP1A 1BQMA 4MDBA 2HNYA 3V4IA 4JI3K 3F2KA 1ASVA 2VG7A 4H8KA 1NGEA 1HX1A 2E2PA 1Z05A 2FBXA 2IC3A 1Y97A 3THWB 1BDGA 1NGAA 4DUZK 2HHTA 2BGGA 1VQ5N 5HRNA 1VRTA 1BOTO 3SYZA 3DJCA 1WAFA 4CD3A 1BG3A 1U2VB 5JVGL 1VQ9N 1YT3A 2P9SB 2QWNA 4ELTA 3TWHA 4J2DA 1REVA 4BREA 5C2DA 3OYHA 2E6MA 3OYCA 4NCAA 1VSEA 4MLEA 1VSIA 2VCPA 3MK6A 1QQOA 5BPNA 4DF4A 1SAZA 5AQKA 1T03A 1K6YA 4JEPA 1HYVA 5IT9O 1MWMA 2BTFA 4X65K 4PKHA 1IG8A 4ID5A 1L5UA 3B8AX 1ZBIA 3WEEB 2ASMA 1ZBUA 4PHTX 2O8DB 3IDHA 2KFZA 5AQXA 1EKEA 1QHTA 2E5LK 4EAHD 3LPTA 4FZYA 1NGHA 5AFUH 3MEDA 1K8KB 4O0IA 4H03B 3GL1A 3LDPA 2YNHA 3ENOA 4BGBA 1MA9B 1YXQA 3T1AA 1B9DA 4X64K 1S1VA 1QHAA 3VEVA 3C7NB 3TTFA 2PY5A 2NRTA 1QQNA 4EHTA 4C8LA 1IKWA 1HKBA 4PA1A 1BQNA 4H0OA 4CBWA 1RFQA 3I33A 3RSEA 4F4KA 4CJUA 4MLHA 4B9QA 4BRQA 4PL8A 2IVNA 4BRGA 4ZTJA 1SL2A 4GV9A 5AQYA 3HT3A 2RHKA 3RRHA 5J2MA 1CZAN 3DLGA 2GWKA 3CERA 4MQ3A 2YHBA 2Q1NA 1LV5A 4H0YB 4FW2A 4AM7A 3ZLJA 4FJXA 3CFPA 4NLCA 2IVPA 4JKGB 3VQDA 3VQAA 3SBTA 2KZMA 2QXFA 5GADP 3CFOA 3UIQA 1ASWA 4CHPA 3LAMA 4BG8A 2YHAA 4NYFA 3LPUA 2GUIA 4C8KA 2ETJA 3BZCA 3BF1A 3LZIA 1W9HA 4W5TA 2WUSA 4FO0A 3T3FA 4HCBA 3RTVA 2E88A 2B5JA 4NXMK 5BRDA 1HKGA 4QCLA 3O08A 4RW8A 2Q3SA 1ESVA 3AVKA 3FLCO 3AA2A 3VEOA 3TSUA 3P4IA 2P9PB 3G10A 3SQ2A 5KRTA 3KHYA 3BGRA 2HOEA 1ZBLA 3H1VX 3AO2A 3EE8A 1K73O 3UKRA 4YOYA 3QEPA 4IJAA 4YOUA 3N4QA 3C65A 4DV7K 1NK6A 4HUGA 3PLAA 3J8AA 3WQTA 2BANA 2P5GA 2PYJA 3PSFA 4Z4IA 4CJRA 4CEZA 3VQ7A 5KPTA 2I7PA 4GV3A 4BC3A 3TAQA 4ILJA 1F21A 2UYTA 1KD1O 1V4TA 3MCPA 1BIUA 2HW3A 3FZFA 3PIPL 2YKMA 4M3XA 1HQEA 1RDBA 4M41A 2ZQBA 4NO7A 4JI6K 2FC0A 3L6QA 5GIOA 1BUPA 2Q97A 1BCMA 2RKIA 4FZZA 1KTQA 2X6SA 5E41A 1TGOA 2V52B 3O1BA 4CIEA 3EO3A 4FWNA 5KQDA 3FZMA 3EZ5A 3DLLL 2QWOA 2P9NB 3OYFA 4B3MK 2DFFA 4FJ5A 4ELUA 2LSNA 4OPAA 1XQSC 3M8SA 2GELA 4N76A 4JKCA 3HPOA 2NRHA 3H1QA 1VQKN 4O8UA 3JSMA 1TYQA 4KB1A 2QKBA 1IKXA 1TVRA 3HTVA 5AQGA 1IH7A 3CCJN 4CGJA 3M8RA 4YNQA 3V1QA 3NVMA 1JCGA 1RT2A 3C94A 3G25A 4DFKA 3NVKA 4MDAA 3L2VA 4DV2K 3L2RA 3QESA 4O44A 5TKWA 4B9NA 3U9DA 1A5WA 3RMDA 3QBXA 4E7JA 4Z4FA 3KLIA 5AJ3K 2YKNA 4FCYA 4FVMA 4ELVA 4M3YA 3D2EA 4DS4A 4YOXA 1ATSA 1NKCA 1OH7A 4NXNK 4BRCA 1U45A 5BR9A 3MCAB 4FJ8A 4N5SA 3H3OB 3O9UA 3DXMA 4BDZA 3TSQA 1OH8A 2YCHA 1TK5A 4IFVA 1N32K 1X1PA 1Q82O 3AVNA 4Z94A 5HBMA 3KIOA 3ULDA 5HROA 2E1ZA 3OYEA 2WTUA 3ZYYX 3WQUA 3HM8A 1YF5L 3EKSA 4LF8K 3UE5A 3SI6A 3CJ9A 2NRXA 3TAPA 4YORA 2CH5A 3VEXA 4CEDA 4KH6A 4DR3K 3L8BA 4FJMA 4BRHA 4FYDA 2HVIA 1IO2A 1NWKA 1KVCA 1CLQA 2JGUA 4B1ZA 3KK3A 2O8BA 2ZJRL 5FPDA 4PUOA 3CC7N 5HL7L 3QEIA 4B3OA 2IS3A 4FJGA 2ZE2A 3GDQA 3K5NA 4DHYA 2HHXA 4B9UA 3SJJA 3KWIA 4CBUA 3ZSWA 1S72N 1SL0A 1LWCA 4CZMA 4HTUA 1WSGA 4AH9A 4CEOA 1Q9YA 4FWKA 2E4LA 3ZSZA 4AHSA 3AAQA 4AHTA 1WSJA 3THYB 3ALYA 3NGZA 1TK8A 1D9DA 1XNQK 2ZM6K 3OYNA 5JLFA 3WT0A 1ATNA 3PY8A 2RN2A 1RGIA 4CFDA 1KSPA 3CCLN 4FVUA 5GAHP 3N4PA 2A3ZA 4WE1A 4CJ4A 4IKFA 4F2RA 1RNHA 4IEEA 1IBMK 2NRVA 4JD2B 3SK3A 1WAJA 1NG9A 2FBVA 2HF4A 1JLCA 3OYKA 5F2RA 1RBRA 1XHZA 1TL1A 2A1SA 2WFBA 3AGKA 2UU9K 1P8ZA 3K58A 3HP9A 4QS7A 3SUPA 3J80O 3O9QA 2PAVA 4H4OA 3CMAN 1NK5A 2E8AA 4AILC 4JKAA 4DG1A 4A62A 2E2NA 3CJ1A 4M7XA 1LW2A 4B9LA 3QLHA 4DU3A 2Q0UA 5C25A 1KFSA 3HOTA 4DTRA 3CHWA 1ZC6A 3AVHA 3UKUB 2XY6A 4WFBL 5C0YA 4RCHA 3MXJA 4FSVA 1TKXA 2OYQA 1KAXA 3ZSQA 3CQXA 3JAMO 3HBTA 1D9FA 4JI8K 1UWBA 2P9IA 1BI4A 4DQ8A 5FROA 2QM1A 4C8NA 4FLYA 1A5VA 4H5WA 4GVEA 3BP8A 3DRRA 3HYFA 3NF7A 3OBYA 5I3UA 3MN6A 1J5OA 2A40A 4TSXA 4J2EA 3L4QA 4IZ9A 3AVLA 1HYZA 2GV9A 4FLXA 1RBSA 2ITMA 2VG6A 3KK2A 3KD5E 1NK8A 2O8EB 1G15A 2QI2A 5MLCQ 2O8FB 5HOOA 1HNIA 3ULEA 4LFCK 4CIGA 1S6QA 3TTDA 2VG5A 1C0UA 4CEEA 4CCHA 3O3FA 1Q8IA 2WOMA 4F3TA 1HLUA 4KHWA 3CI5A 5CHIA 4B1VA 4I6MA 1YTAA 3EE9A 1MDUB 4PWDA 3SNNA 1D4XA 2ZF5O 4WQ5C 3IRXA 1KC8O 1UA1A 2YX6A 3L2UA 5FDLA 4JKFA 1MWKA 1GOCA 1SUQA 3NAEA 2P1JA 5D3GA 2V7YA 4A57A 4CF0A 4CZEA 3M5RA 1HR0K 4OKEA 4A2BA 3ZSXA 4BRLA 4OKKA 3A8YA 4BGAA 3MXIA 4EZ6A 2YNIA 4RW4A 1QVFM 1NGJA 5LMNK 1NK7A 4BDPA 2VWBA 3QFPA 3C0BA 3JYTA 2QWMA 5AZJA 1Z6RA 3S3MA 3ZEUB 5EXWA 1TUUA 4DB3A 3I0RA 2UXBK 5J2NA 1I3AA 1X3NA 3FZKA 4FOIA 3ENBA 2QKKA 3OS1A 4YDUC 4DR2K 4FPBA 2QEXN 3NF9A 4IG3A 4L3QA 3IKMA 3NGYA 3AAPA 4EP4A 3ATUA 4PY5A 1RTDA 2P9LB 1HMVA 4FJJA 2P9KA 5AQLA 2HVHA 3FZLA 4O55A 5CY4A 4PKGA 2GUPA 4FK4A 3ZT0A 3C6HA 3GE1A 4BR2A 4N47A 1N33K 5JLHA 3ZSOA 1U48A 3OYIA 4AQYK 4RW6A 5C42A 4ISFA 2VWJA 2X74A 2QK9A 4KTWA 4B1XB 3DWLA 4C1NI 2ZGYA 3C6AA 4CI6A 3EN9A 3THXA 1M90O 4GV6A 3D6RA 2Q2RA 3AVFA 4C23A 1TL3A 3TU5A 2NNWA 4FM0A 3HSCA 3NGIA 1IBLK 3OYGA 1DT9A 1DKGD 3ZSYA 3GG4A 2W6LA 4BRKA 4BQLA 3R3LA 4FJIA 3NHGA 2D0OA 3MWTA 4XH5A 4YOWA 4KAZA 4AM6A 3CCUN 1FKPA 1P90A 4FWRA 5AQIA 4M45A 5HLFA 2ATQA 4ILHA 1KVBA 2VGNA 2EX3A 3EKUA 4CJEA 4RW7A 4IDHA 1FXXA 4JI0K 2EWSA 3M1FA 4I9LA 2DY4A 4H0TB 2O4IA 1U47A 3E66A 1XMQK 4PQUA 3DXKB 2P9UA 2I7NA 3CF5L 1TAUA 1JLAA 2D5RA 1S6PA 5BN9A 3L3UA 4BRDA 3SAGA 4Z4GA 3ZX0A 3DMJA 4FPAA 3QINA 3QIOA 1I94K 4KTZA 1VK0A 4E1NA 5CE3A 4FLZA 1RILA 1TKDA 1ATRA 1YAGA 3U4LA 4JNEA 3VA0A 5BR8K 3VQ5A 4ICLA 5JS2A 2F9WA 4CEQA 4JV5K 4BE2A 1H1VA 4C8OA 1J9AA 2E6LA 3WNFA 3DI6A 1X9WA 4DTNA 4QS9A 3SAFA 3MX5A 3CMEN 4G9ZA 3O6WA 2EHGA 3U3GA 3T1YK 4J2AA 4DR6K 3DYAA 1UOCA 4BRPA 1JLBA 4JI7K 2Z1IA 3KZBA 1S22A 3TR8A 1ILYA 3SV3A 3HK2A 4DTJA 4DR5K 3Q7BA 4YOTA 4EIAA 2KTQA 4KRFA 5FPMA 5JS1A 4EHUA 5FPEA 3KLGA 2ZD1A 2CH6A 1YUWA 3LANA 2O8CA 3CM6A 5HP1A 3G4SN 4LD0A 4DMNA 2HBJA 1JKHA 4H4MA 3VTHA 4CE9A 1T6CA 1HUXA 3AVBA 3DOKA 4CESA 4LF5K 3CCRN 3H46O 3V1OA 4Z0UA 4DLEA 4IO8A 4CZGA 1T44A 3VETA 4BROA 1ZBFA 3CQYA 2FBYA 1EETA 4NYNA 3QETA 1JCFA 3U8XA 1S1WA 4A5AA 3NFAA 4YOVA 1C1AA 5J2QA 4CF8A 3TAEA 3OYAA 3QB0A 3VESA 5JMVA 3KK7A 3THWA 4H0VB 5CZ2A 4BRFA 5EY4A 4A2AA 4E1JA 3KKSA 2PBDA 3QICA 2R7YA 2I5JA 1B92A 2VWKA 1U2VA 2FF6A 5AQPA 3KLFA 4F2SA 3ISNC 3BZKA 2P9SA 2HHSA 3MN5A 4BC2A 1YHQN 3QDKA 2HSTA 5AQTA 1WBBA 2WONA 4DQPA 2AJQA 2QWLA 4CJ5A 2D1KA 3UB5A 1FK9A
chains in the Genus database with same CATH topology
4O4GA 1J54A 3PV8A 1HNVA 4BWMA 3V9WA 4KI6A 2G8IA 4W5NA 3CYMA 4M3RA 3F73A 3LAKA 3VQCA 3SI6A 3C6UA 2HHQA 1BCOA 3TAPA 3L2WA 1DTQA 1WN7A 3OVNA 1RT6A 3HPHA 4OGEA 2G8UA 2F8TA 4QAGA 4KB0A 2D0AA 4KREA 3P1GA 4CEDA 1GOAA 4FJMA 3M8QA 4Y1CA 4AHRA 3L8BA 3KK1A 4FK0A 3SQ1A 4B8AB 4FYDA 2HVIA 1IO2A 1S9GA 1KVCA 1VRUA 2JGUA 4RG8A 4OGCA 1CLQA 3AVMA 4AHCA 1N6QA 4FJKA 2Z1JA 1JL2A 3LP2A 3KK3A 1XC9A 3KD1E 3S3NA 1ASUA 3C95A 3TAGA 4ZHRA 1RCHA 4F8RA 3K5OA 4DLGA 3NE6A 3VQ6A 4PUOA 4CEFA 1LWEA 4OPJA 3QEIA 4CHQA 1VSDA 1KRPA 3ZCMA 4L8RB 2IS3A 3O3GA 2ZE2A 4FJGA 1VSMA 4B3OA 3HPGA 3K5NA 1XHXA 2HHXA 4B9UA 4M3UA 3HXMA 3SJJA 3SPYA 1QE1A 2Z1HA 3AVCA 4CECA 3AA4A 2B4JA 3ZSWA 4CJVA 4E7KA 3NH0A 3P5JA 1NJZA 1CZ9A 2DFHA 1SL0A 1LWCA 1WSEA 4KV8A 4E3SA 1WLJA 4HTUA 4DFJA 4HHTA 3CM5A 4FK2A 4MFBA 4Q5VA 4DQQA 1WSGA 4AH9A 1HJRA 4CEOA 1Q9YA 3AVGA 3ZT3A 4NCBA 3SUNA 3B6OA 2E4LA 3ZSZA 4AHSA 3DLBA 2GBZA 4KKOA 4AHTA 1WSJA 4O5BA 3ALYA 3NGZA 3ZSRA 3TI0A 1RTJA 3M8PA 1TK8A 1D9DA 3OYNA 1Q9XA 1WSHA 3LP3A 4DTMA 1VSHA 4DQIA 1KCFA 2YNGA 1QSLA 4CHYA 3SPZA 3QEXA 3PY8A 3HJFA 2RN2A 3OS0A 1ITGA 3CG7A 4GMJB 4O0JA 3OYDA 4CFDA 2Y1JA 4BE0A 3SQ4A 1NK0A 1KSPA 2G8HA 2XHBA 3B6PA 4LSNA 2IOCA 3ZT2A 1KLNA 4WE1A 1S9EA 4CJ4A 4YFUA 4F2RA 4E7HA 1RNHA 4KO0A 5KRSA 4CIFA 4IKFA 1KFDA 1CXQA 4B9MA 4Z4CA 3PUFA 3LDSA 1NJYA 5DK5A 1WAJA 4KI4A 2ITGA 4HVJA 2FBVA 2FBTA 3HVTA 2PZSA 1WNSA 1JLCA 3OYKA 3OJSA 1HRHA 4DSEA 3VQ8A 3S9HA 4J2BA 1RBRA 1XHZA 1EX4A 4KTQA 1TL1A 2A1SA 3K58A 3SZ2A 3PO5A 3HP9A 1WSIA 4CEAA 3I0SA 3SUPA 3V1RA 3MEGA 4GW6A 2KW4A 3PO4A 3MXMA 1J53A 4H4OA 1B9FA 1JLEA 1CXUA 1EXQA 3AA5X 4W5RA 4AILC 5J2PA 1NK5A 2YV0X 1NOYA 4KFBA 2W42A 1SV5A 4DG1A 2Y1IA 3ZT1A 1TKZA 4HCCA 4CJLA 1QS4A 1YVUA 1LW2A 4B9LA 3QLHA 4OKJA 2B6AA 2F96A 1C6VA 4DU3A 3QEWA 5C25A 1DLOA 4K8XA 3LWMA 3MAQA 4CK2A 1KFSA 1O1WA 1TV6A 2IDOA 1VSFA 3WNGA 3A2FA 4DTRA 4M3WA 4QOZB 4FW1A 3QNNA 4N41A 4E19A 3AVHA 2XY6A 4ZTFA 1L3TA 2OZMA 4W5OA 3QO9A 3EY1A 5I42A 4NCGA 1LAVA 3ZSVA 4JS4A 1ZYQA 4OLAA 2IAJA 3MXJA 3NF8A 1TKXA 2OYQA 3ZSQA 4CGGA 1D9FA 1NOZA 1UWBA 3VQQA 1BI4A 4JRPA 3AO5A 3DRSA 3HVRA 5FROA 3CFRA 4CERA 2OZSA 4DSLA 4CJ3A 4C8NA 3K5LA 1A5VA 3HM9A 4FLYA 3QNOA 4DS5A 3PX6A 3CQ8A 3RWUA 1SKSA 3P83D 4BDYA 3DRRA 3HYFA 4RW9A 4CF1A 3NF7A 2HNZA 2O4GA 5I3UA 1RDDA 1J5OA 3LP0A 4HUEA 4TSXA 2HNDA 3AVIA 4CHOA 3D0PA 3AVLA 5KI6A 1JLQA 1HYZA 4J2EA 4CJSA 1RT5A 1WSFA 4FJ9A 2GV9A 1BQMA 2XY8A 1HPZA 4FLXA 1QSYA 2HHWA 1RBSA 2HNYA 3V4IA 4FJLA 3THVA 2VG6A 3KK2A 1ASVA 2VG7A 4H8KA 4AHUA 1NK8A 3KD5E 1G15A 4DSIA 2FBXA 2IC3A 1Y97A 3TAFA 1HNIA 1LAWA 4JLHA 2RF2A 4CIGA 1S6QA 2HHTA 2BGGA 5HRNA 1VRTA 4DF8A 2VG5A 1C0UA 4CEEA 3SYZA 5KTQA 1C1CA 4CCHA 3O3FA 1Q8IA 1WAFA 2WOMA 3AVAA 4FLVA 1T8EA 4F3TA 4CFCA 1U04A 1FKOA 1YT3A 4CK3A 4KHWA 3AA3A 1RDAA 1YTAA 2XY7A 5K14A 1BI4B 4PWDA 3ZT4A 1XI1A 4ELTA 3TWHA 3SNNA 2P5OA 1IKYA 1REVA 4J2DA 3IRXA 4B8CA 4CJPA 2G8WA 1QTMA 1UA1A 3OYHA 3O3HA 3L2UA 2E6MA 5FDLA 3OYCA 3K59A 1SKRA 1RBVA 1GOCA 1RT4A 1BGXT 1SUQA 1VSEA 1VSIA 3NAEA 4NCAA 2P1JA 5D3GA 3OJUA 4LH4A 4CF0A 1SKWA 4DF4A 1BIZA 5HRRA 4OKEA 2KQ2A 3KLHA 4CJWA 3ZSXA 3IAYA 1JLFA 1HYSA 4I2PA 4C8MA 3DLHA 3NBPA 4IBNA 1T03A 4OKKA 1K6YA 3MXIA 4EZ6A 1HYVA 2YNIA 4RW4A 1D5AA 4CHNA 3K2PA 4DU1A 2YNFA 3RMCA 1NK7A 4BDPA 4ID5A 1L5UA 3JYTA 1BHLA 3FFIA 3V9ZA 5CYMA 3NDKA 3VQ4A 4CJQA 3S3MA 4I9QA 3DLEA 1ZBIA 1SL1A 2NUBA 5KGWA 1ZBUA 3I0RA 1R0AA 5J2NA 1I3AA 2P51A 3VQPA 1N5YA 2BE2A 3NF6A 2QKKA 3AO3A 2KFZA 3OS1A 4CEBA 1CZBA 3O4QA 4KHSA 4OPKA 3NF9A 1EKEA 1QHTA 4IG3A 3NGYA 5HRSA 3SUOA 4EP4A 3LPTA 4G1QA 4DFPA 1U4BA 4FZYA 3NH1A 3MEDA 4O0IA 1RTDA 4PY5A 5FRNA 1HMVA 3AO4A 3HSTB 4I7FA 1A5XA 4CK1A 4Z4HA 4FJJA 3TABA 3SQ0A 2YNHA 5EU7A 1Z26A 1IKVA 1VSKA 3OY9A 3WNEA 4CJTA 1NJWA 2HVHA 3T1AA 4O55A 5CY4A 1RBUA 4M3TA 1B9DA 4B9VA 1KLMA 4FK4A 1S1VA 3RMBA 3OYMA 3K5MA 3MECA 3BDPA 3ZT0A 1S1XA 4N47A 2PY5A 3L2QA 1TK0A 3NCIA 3S3OA 1IG9A 3AVJA 3ZSOA 1U48A 4KHUA 4DQRA 3OYIA 2D0BA 4C8LA 1RT1A 1IKWA 4RW6A 5C42A 2VWJA 4PA1A 2X74A 2G8KA 1BQNA 2KZZA 4F4KA 4CGIA 4M3ZA 4CJUA 2QK9A 1RBTA 4KTWA 2OPQA 4AHVA 2OPPA 3V6DA 1MU2A 4BE1A 4ZTJA 3LALA 1HQUA 4DQSA 1SL2A 1KVAA 3F9KA 3AVFA 3HT3A 3KKRA 3KTQA 1TL3A 5CYQA 4CFBA 4FM0A 3RRHA 2X6NA 3VA3A 4E89A 3DLGA 5J2MA 3NGIA 1JXBA 3OYGA 2IGIA 3OYBA 3ZSYA 4DTXA 4CGDA 1QQCA 4MQ3A 3C6TA 2YHBA 3RMAA 1BISA 3AV9A 4FJIA 3NHGA 1LV5A 3H08A 4FW2A 3RRGA 4EZ9A 4FXDA 5CZ1A 4FJXA 3CFPA 4KAZA 3E01A 1DTTA 3VQAA 3VQDA 1FKPA 4M45A 1T05A 4CHZA 2G8FA 4JRQA 2KZMA 2DTUA 2QXFA 4FM1A 5HLFA 2ATQA 3CFOA 3V81A 1ASWA 3UIQA 4CHPA 3L3VA 3LAMA 3I8DA 4CFAA 1KVBA 2YHAA 4NYFA 4FLUA 4B9TA 3LPUA 4KHYA 2EX3A 2GUIA 1RTHA 4C8KA 2ETJA 4FJHA 4CJEA 2OPSA 4RW7A 3LZIA 1FXXA 1W9HA 5SWMA 4W5TA 4DTSA 3RR8A 4LY7A 3HO1A 3T3FA 1JXEA 4HCBA 4I9LA 3RTVA 1W0HA 2DY4A 3DOLA 4FLWA 2O4IA 2B5JA 3PX4A 1U47A 4IFYA 1EP4A 1S5JA 4FJ7A 3QERA 4QCLA 1RDCA 3U6FA 3DM2A 4PQUA 4OVLA 4RW8A 2Q3SA 1L3VA 1TAUA 1JLAA 3VQBA 3AVKA 2D5RA 3AA2A 1S6PA 4DU4A 3L3UA 3G10A 4Z4GA 3SQ2A 2KFNA 5HRPA 3DMJA 5KRTA 4K8ZA 3BGRA 1ZBLA 3QINA 3RR7A 2OPRA 3AO2A 3QIOA 1VK0A 4KTZA 4E1NA 2A1RA 4F3OA 3D45A 4BWJA 4FLZA 1RILA 3IS9A 1TKDA 3QEPA 3VA0A 4BACA 1RT3A 1S1UA 4B08A 3O4NA 4CF9A 3VQ5A 1NK6A 4ICLA 5JS2A 4HUGA 4E7LA 3LP1A 2XY5A 1LW0A 4CEQA 2BANA 2P5GA 3U3YA 4BE2A 2PYJA 2DFEA 2XRIA 4KHNA 4Z4IA 4CJRA 4Y1DA 3KLEA 4CEZA 4C8OA 3DLKA 3V9SA 1J9AA 1VSJA 1C0TA 3VQ7A 1X9SA 2E6LA 1I39A 1U49A 4R5PA 1X9MA 4CGFA 3TAQA 3SV4A 4HUFA 3OS2A 3WNFA 3DI6A 1F21A 1X9WA 4DTNA 2PYLA 4XIUA 1NKEA 4DWIA 4DTPA 2HHVA 2EHGA 4OJRA 3U3GA 4J2AA 1TKTA 1BIUA 2HW3A 1QSSA 1D8YA 5T7BA 2YKMA 3DYAA 1UOCA 4E1MA 3NH2A 1JL1A 1C1BA 1JLBA 1HQEA 1RDBA 4M41A 4M3XA 2Z1IA 3TR8A 3ITHA 2BDPA 2ZQBA 2Z1GA 2HB5A 3TARA 5DMRA 1NK4A 2FC0A 3SV3A 3HK2A 4CJKA 1BCMA 1JLGA 4DTJA 4CF2A 2RKIA 3TAMA 4FM2A 4FZZA 3VQEA 1KTQA 2KTQA 1RTIA 4I2QA 4M42A 1T7PA 4KRFA 1L3SA 2X6SA 1C0MA 1TGOA 4CIEA 5E41A 5HROA 5JS1A 3LWLA 3DLRA 5SZTA 3EZ5A 3HP6A 3KLGA 4DFMA 1UA0A 4FLTA 1BL3A 3KJVA 3DRPA 2D0CA 2ZD1A 4DSKA 4LH5A 5J1EA 3OYFA 4GVMA 1S1TA 1UAXA 2DFFA 3LANA 4FJ5A 4LSLA 2LSNA 4ELUA 3CM6A 5HP1A 2JLEA 2RPIA 3M8SA 3PX0A 4KPYA 4LD0A 4N76A 4CGHA 4DMNA 3HPOA 4CJFA 1TAQA 1JKHA 4H4MA 3JSMA 4CE9A 4B9SA 3AO1A 4KB1A 2QKBA 1IKXA 3AVBA 5FRMA 3DOKA 3T19A 4CESA 4UQGA 3SCXA 1TVRA 3OYJA 2X78A 4DTOA 1YTUA 4ID1A 3V1OA 4Z0UA 4DLEA 4OLBA 3MEEA 4IDKA 1IH7A 5KGXA 4FJNA 4CGJA 3M8RA 1ZBHA 1ZBFA 3QIPA 2FBYA 3SUQA 4N56A 4YNQA 1EETA 4NYNA 3V1QA 1NJXA 3QETA 1RT7A 4EP5A 1S1WA 4KHQA 2F8SA 1RT2A 3C94A 3NFAA 4DSFA 1C1AA 4W5QA 1LWFA 4IG0A 4DFKA 3IG1A 4CF8A 5J2QA 3TAEA 2G8VA 3OYAA 3L2VA 3QESA 3L2RA 4FZXC 4O44A 1NKBA 1XWLA 4B9NA 5CZ2A 4Q0BA 1GOBA 1A5WA 3RMDA 3KKSA 4Z4FA 4E7JA 3KLIA 1L3UA 5C24A 2YKNA 4FCYA 4FVMA 2R7YA 4ELVA 4M3YA 3QEVA 2I5JA 1B92A 4Z4EA 3K57A 2VWKA 2XO7A 3HL8A 4DS4A 1NKCA 1NK9A 4E0DA 4DSJA 3KLFA 3ASMA 1U45A 3ISNC 4F2SA 3G0ZA 3WNHA 2HMIA 3V9XA 4N5SA 4FJ8A 2HHUA 2HHSA 1VSLA 4BDZA 4JS5A 3VN5A 3OYLA 3VQ9A 2WONA 3EYZA 4E7IA 4DQPA 1TK5A 2AJQA 3V9UA 4DTUA 2OA8A 4IFVA 1X1PA 4CJ5A 3AVNA 3ULDA 5HBMA 3KIOA 3TANA 1Z25A 3LZJA 3OYEA 1FK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O4G A;  1J54 A;  3PV8 A;  1HNV A;  4BWM A;  3V9W A;  4KI6 A;  2G8I A;  4W5N A;  3CYM A;  4M3R A;  3F73 A;  3LAK A;  3VQC A;  3SI6 A;  3C6U A;  2HHQ A;  1BCO A;  3TAP A;  3L2W A;  1DTQ A;  1WN7 A;  3OVN A;  1RT6 A;  3HPH A;  4OGE A;  2G8U A;  2F8T A;  4QAG A;  4KB0 A;  2D0A A;  4KRE A;  3P1G A;  4CED A;  1GOA A;  4FJM A;  3M8Q A;  4Y1C A;  4AHR A;  3L8B A;  3KK1 A;  4FK0 A;  3SQ1 A;  4B8A B;  4FYD A;  2HVI A;  1IO2 A;  1S9G A;  1KVC A;  1VRU A;  2JGU A;  4RG8 A;  4OGC A;  1CLQ A;  3AVM A;  4AHC A;  1N6Q A;  4FJK A;  2Z1J A;  1JL2 A;  3LP2 A;  3KK3 A;  1XC9 A;  3KD1 E;  3S3N A;  1ASU A;  3C95 A;  3TAG A;  4ZHR A;  1RCH A;  4F8R A;  3K5O A;  4DLG A;  3NE6 A;  3VQ6 A;  4PUO A;  4CEF A;  1LWE A;  4OPJ A;  3QEI A;  4CHQ A;  1VSD A;  1KRP A;  3ZCM A;  4L8R B;  2IS3 A;  3O3G A;  2ZE2 A;  4FJG A;  1VSM A;  4B3O A;  3HPG A;  3K5N A;  1XHX A;  2HHX A;  4B9U A;  4M3U A;  3HXM A;  3SJJ A;  3SPY A;  1QE1 A;  2Z1H A;  3AVC A;  4CEC A;  3AA4 A;  2B4J A;  3ZSW A;  4CJV A;  4E7K A;  3NH0 A;  3P5J A;  1NJZ A;  1CZ9 A;  2DFH A;  1SL0 A;  1LWC A;  1WSE A;  4KV8 A;  4E3S A;  1WLJ A;  4HTU A;  4DFJ A;  4HHT A;  3CM5 A;  4FK2 A;  4MFB A;  4Q5V A;  4DQQ A;  1WSG A;  4AH9 A;  1HJR A;  4CEO A;  1Q9Y A;  3AVG A;  3ZT3 A;  4NCB A;  3SUN A;  3B6O A;  2E4L A;  3ZSZ A;  4AHS A;  3DLB A;  2GBZ A;  4KKO A;  4AHT A;  1WSJ A;  4O5B A;  3ALY A;  3NGZ A;  3ZSR A;  3TI0 A;  1RTJ A;  3M8P A;  1TK8 A;  1D9D A;  3OYN A;  1Q9X A;  1WSH A;  3LP3 A;  4DTM A;  1VSH A;  4DQI A;  1KCF A;  2YNG A;  1QSL A;  4CHY A;  3SPZ A;  3QEX A;  3PY8 A;  3HJF A;  2RN2 A;  3OS0 A;  1ITG A;  3CG7 A;  4GMJ B;  4O0J A;  3OYD A;  4CFD A;  2Y1J A;  4BE0 A;  3SQ4 A;  1NK0 A;  1KSP A;  2G8H A;  2XHB A;  3B6P A;  4LSN A;  2IOC A;  3ZT2 A;  1KLN A;  4WE1 A;  1S9E A;  4CJ4 A;  4YFU A;  4F2R A;  4E7H A;  1RNH A;  4KO0 A;  5KRS A;  4CIF A;  4IKF A;  1KFD A;  1CXQ A;  4B9M A;  4Z4C A;  3PUF A;  3LDS A;  1NJY A;  5DK5 A;  1WAJ A;  4KI4 A;  2ITG A;  4HVJ A;  2FBV A;  2FBT A;  3HVT A;  2PZS A;  1WNS A;  1JLC A;  3OYK A;  3OJS A;  1HRH A;  4DSE A;  3VQ8 A;  3S9H A;  4J2B A;  1RBR A;  1XHZ A;  1EX4 A;  4KTQ A;  1TL1 A;  2A1S A;  3K58 A;  3SZ2 A;  3PO5 A;  3HP9 A;  1WSI A;  4CEA A;  3I0S A;  3SUP A;  3V1R A;  3MEG A;  4GW6 A;  2KW4 A;  3PO4 A;  3MXM A;  1J53 A;  4H4O A;  1B9F A;  1JLE A;  1CXU A;  1EXQ A;  3AA5 X;  4W5R A;  4AIL C;  5J2P A;  1NK5 A;  2YV0 X;  1NOY A;  4KFB A;  2W42 A;  1SV5 A;  4DG1 A;  2Y1I A;  3ZT1 A;  1TKZ A;  4HCC A;  4CJL A;  1QS4 A;  1YVU A;  1LW2 A;  4B9L A;  3QLH A;  4OKJ A;  2B6A A;  2F96 A;  1C6V A;  4DU3 A;  3QEW A;  5C25 A;  1DLO A;  4K8X A;  3LWM A;  3MAQ A;  4CK2 A;  1KFS A;  1O1W A;  1TV6 A;  2IDO A;  1VSF A;  3WNG A;  3A2F A;  4DTR A;  4M3W A;  4QOZ B;  4FW1 A;  3QNN A;  4N41 A;  4E19 A;  3AVH A;  2XY6 A;  4ZTF A;  1L3T A;  2OZM A;  4W5O A;  3QO9 A;  3EY1 A;  5I42 A;  4NCG A;  1LAV A;  3ZSV A;  4JS4 A;  1ZYQ A;  4OLA A;  2IAJ A;  3MXJ A;  3NF8 A;  1TKX A;  2OYQ A;  3ZSQ A;  4CGG A;  1D9F A;  1NOZ A;  1UWB A;  3VQQ A;  1BI4 A;  4JRP A;  3AO5 A;  3DRS A;  3HVR A;  5FRO A;  3CFR A;  4CER A;  2OZS A;  4DSL A;  4CJ3 A;  4C8N A;  3K5L A;  1A5V A;  3HM9 A;  4FLY A;  3QNO A;  4DS5 A;  3PX6 A;  3CQ8 A;  3RWU A;  1SKS A;  3P83 D;  4BDY A;  3DRR A;  3HYF A;  4RW9 A;  4CF1 A;  3NF7 A;  2HNZ A;  2O4G A;  5I3U A;  1RDD A;  1J5O A;  3LP0 A;  4HUE A;  4TSX A;  2HND A;  3AVI A;  4CHO A;  3D0P A;  3AVL A;  5KI6 A;  1JLQ A;  1HYZ A;  4J2E A;  4CJS A;  1RT5 A;  1WSF A;  4FJ9 A;  2GV9 A;  1BQM A;  2XY8 A;  1HPZ A;  4FLX A;  1QSY A;  2HHW A;  1RBS A;  2HNY A;  3V4I A;  4FJL A;  3THV A;  2VG6 A;  3KK2 A;  1ASV A;  2VG7 A;  4H8K A;  4AHU A;  1NK8 A;  3KD5 E;  1G15 A;  4DSI A;  2FBX A;  2IC3 A;  1Y97 A;  3TAF A;  1HNI A;  1LAW A;  4JLH A;  2RF2 A;  4CIG A;  1S6Q A;  2HHT A;  2BGG A;  5HRN A;  1VRT A;  4DF8 A;  2VG5 A;  1C0U A;  4CEE A;  3SYZ A;  5KTQ A;  1C1C A;  4CCH A;  3O3F A;  1Q8I A;  1WAF A;  2WOM A;  3AVA A;  4FLV A;  1T8E A;  4F3T A;  4CFC A;  1U04 A;  1FKO A;  1YT3 A;  4CK3 A;  4KHW A;  3AA3 A;  1RDA A;  1YTA A;  2XY7 A;  5K14 A;  1BI4 B;  4PWD A;  3ZT4 A;  1XI1 A;  4ELT A;  3TWH A;  3SNN A;  2P5O A;  1IKY A;  1REV A;  4J2D A;  3IRX A;  4B8C A;  4CJP A;  2G8W A;  1QTM A;  1UA1 A;  3OYH A;  3O3H A;  3L2U A;  2E6M A;  5FDL A;  3OYC A;  3K59 A;  1SKR A;  1RBV A;  1GOC A;  1RT4 A;  1BGX T;  1SUQ A;  1VSE A;  1VSI A;  3NAE A;  4NCA A;  2P1J A;  5D3G A;  3OJU A;  4LH4 A;  4CF0 A;  1SKW A;  4DF4 A;  1BIZ A;  5HRR A;  4OKE A;  2KQ2 A;  3KLH A;  4CJW A;  3ZSX A;  3IAY A;  1JLF A;  1HYS A;  4I2P A;  4C8M A;  3DLH A;  3NBP A;  4IBN A;  1T03 A;  4OKK A;  1K6Y A;  3MXI A;  4EZ6 A;  1HYV A;  2YNI A;  4RW4 A;  1D5A A;  4CHN A;  3K2P A;  4DU1 A;  2YNF A;  3RMC A;  1NK7 A;  4BDP A;  4ID5 A;  1L5U A;  3JYT A;  1BHL A;  3FFI A;  3V9Z A;  5CYM A;  3NDK A;  3VQ4 A;  4CJQ A;  3S3M A;  4I9Q A;  3DLE A;  1ZBI A;  1SL1 A;  2NUB A;  5KGW A;  1ZBU A;  3I0R A;  1R0A A;  5J2N A;  1I3A A;  2P51 A;  3VQP A;  1N5Y A;  2BE2 A;  3NF6 A;  2QKK A;  3AO3 A;  2KFZ A;  3OS1 A;  4CEB A;  1CZB A;  3O4Q A;  4KHS A;  4OPK A;  3NF9 A;  1EKE A;  1QHT A;  4IG3 A;  3NGY A;  5HRS A;  3SUO A;  4EP4 A;  3LPT A;  4G1Q A;  4DFP A;  1U4B A;  4FZY A;  3NH1 A;  3MED A;  4O0I A;  1RTD A;  4PY5 A;  5FRN A;  1HMV A;  3AO4 A;  3HST B;  4I7F A;  1A5X A;  4CK1 A;  4Z4H A;  4FJJ A;  3TAB A;  3SQ0 A;  2YNH A;  5EU7 A;  1Z26 A;  1IKV A;  1VSK A;  3OY9 A;  3WNE A;  4CJT A;  1NJW A;  2HVH A;  3T1A A;  4O55 A;  5CY4 A;  1RBU A;  4M3T A;  1B9D A;  4B9V A;  1KLM A;  4FK4 A;  1S1V A;  3RMB A;  3OYM A;  3K5M A;  3MEC A;  3BDP A;  3ZT0 A;  1S1X A;  4N47 A;  2PY5 A;  3L2Q A;  1TK0 A;  3NCI A;  3S3O A;  1IG9 A;  3AVJ A;  3ZSO A;  1U48 A;  4KHU A;  4DQR A;  3OYI A;  2D0B A;  4C8L A;  1RT1 A;  1IKW A;  4RW6 A;  5C42 A;  2VWJ A;  4PA1 A;  2X74 A;  2G8K A;  1BQN A;  2KZZ A;  4F4K A;  4CGI A;  4M3Z A;  4CJU A;  2QK9 A;  1RBT A;  4KTW A;  2OPQ A;  4AHV A;  2OPP A;  3V6D A;  1MU2 A;  4BE1 A;  4ZTJ A;  3LAL A;  1HQU A;  4DQS A;  1SL2 A;  1KVA A;  3F9K A;  3AVF A;  3HT3 A;  3KKR A;  3KTQ A;  1TL3 A;  5CYQ A;  4CFB A;  4FM0 A;  3RRH A;  2X6N A;  3VA3 A;  4E89 A;  3DLG A;  5J2M A;  3NGI A;  1JXB A;  3OYG A;  2IGI A;  3OYB A;  3ZSY A;  4DTX A;  4CGD A;  1QQC A;  4MQ3 A;  3C6T A;  2YHB A;  3RMA A;  1BIS A;  3AV9 A;  4FJI A;  3NHG A;  1LV5 A;  3H08 A;  4FW2 A;  3RRG A;  4EZ9 A;  4FXD A;  5CZ1 A;  4FJX A;  3CFP A;  4KAZ A;  3E01 A;  1DTT A;  3VQA A;  3VQD A;  1FKP A;  4M45 A;  1T05 A;  4CHZ A;  2G8F A;  4JRQ A;  2KZM A;  2DTU A;  2QXF A;  4FM1 A;  5HLF A;  2ATQ A;  3CFO A;  3V81 A;  1ASW A;  3UIQ A;  4CHP A;  3L3V A;  3LAM A;  3I8D A;  4CFA A;  1KVB A;  2YHA A;  4NYF A;  4FLU A;  4B9T A;  3LPU A;  4KHY A;  2EX3 A;  2GUI A;  1RTH A;  4C8K A;  2ETJ A;  4FJH A;  4CJE A;  2OPS A;  4RW7 A;  3LZI A;  1FXX A;  1W9H A;  5SWM A;  4W5T A;  4DTS A;  3RR8 A;  4LY7 A;  3HO1 A;  3T3F A;  1JXE A;  4HCB A;  4I9L A;  3RTV A;  1W0H A;  2DY4 A;  3DOL A;  4FLW A;  2O4I A;  2B5J A;  3PX4 A;  1U47 A;  4IFY A;  1EP4 A;  1S5J A;  4FJ7 A;  3QER A;  4QCL A;  1RDC A;  3U6F A;  3DM2 A;  4PQU A;  4OVL A;  4RW8 A;  2Q3S A;  1L3V A;  1TAU A;  1JLA A;  3VQB A;  3AVK A;  2D5R A;  3AA2 A;  1S6P A;  4DU4 A;  3L3U A;  3G10 A;  4Z4G A;  3SQ2 A;  2KFN A;  5HRP A;  3DMJ A;  5KRT A;  4K8Z A;  3BGR A;  1ZBL A;  3QIN A;  3RR7 A;  2OPR A;  3AO2 A;  3QIO A;  1VK0 A;  4KTZ A;  4E1N A;  2A1R A;  4F3O A;  3D45 A;  4BWJ A;  4FLZ A;  1RIL A;  3IS9 A;  1TKD A;  3QEP A;  3VA0 A;  4BAC A;  1RT3 A;  1S1U A;  4B08 A;  3O4N A;  4CF9 A;  3VQ5 A;  1NK6 A;  4ICL A;  5JS2 A;  4HUG A;  4E7L A;  3LP1 A;  2XY5 A;  1LW0 A;  4CEQ A;  2BAN A;  2P5G A;  3U3Y A;  4BE2 A;  2PYJ A;  2DFE A;  2XRI A;  4KHN A;  4Z4I A;  4CJR A;  4Y1D A;  3KLE A;  4CEZ A;  4C8O A;  3DLK A;  3V9S A;  1J9A A;  1VSJ A;  1C0T A;  3VQ7 A;  1X9S A;  2E6L A;  1I39 A;  1U49 A;  4R5P A;  1X9M A;  4CGF A;  3TAQ A;  3SV4 A;  4HUF A;  3OS2 A;  3WNF A;  3DI6 A;  1F21 A;  1X9W A;  4DTN A;  2PYL A;  4XIU A;  1NKE A;  4DWI A;  4DTP A;  2HHV A;  2EHG A;  4OJR A;  3U3G A;  4J2A A;  1TKT A;  1BIU A;  2HW3 A;  1QSS A;  1D8Y A;  5T7B A;  2YKM A;  3DYA A;  1UOC A;  4E1M A;  3NH2 A;  1JL1 A;  1C1B A;  1JLB A;  1HQE A;  1RDB A;  4M41 A;  4M3X A;  2Z1I A;  3TR8 A;  3ITH A;  2BDP A;  2ZQB A;  2Z1G A;  2HB5 A;  3TAR A;  5DMR A;  1NK4 A;  2FC0 A;  3SV3 A;  3HK2 A;  4CJK A;  1BCM A;  1JLG A;  4DTJ A;  4CF2 A;  2RKI A;  3TAM A;  4FM2 A;  4FZZ A;  3VQE A;  1KTQ A;  2KTQ A;  1RTI A;  4I2Q A;  4M42 A;  1T7P A;  4KRF A;  1L3S A;  2X6S A;  1C0M A;  1TGO A;  4CIE A;  5E41 A;  5HRO A;  5JS1 A;  3LWL A;  3DLR A;  5SZT A;  3EZ5 A;  3HP6 A;  3KLG A;  4DFM A;  1UA0 A;  4FLT A;  1BL3 A;  3KJV A;  3DRP A;  2D0C A;  2ZD1 A;  4DSK A;  4LH5 A;  5J1E A;  3OYF A;  4GVM A;  1S1T A;  1UAX A;  2DFF A;  3LAN A;  4FJ5 A;  4LSL A;  2LSN A;  4ELU A;  3CM6 A;  5HP1 A;  2JLE A;  2RPI A;  3M8S A;  3PX0 A;  4KPY A;  4LD0 A;  4N76 A;  4CGH A;  4DMN A;  3HPO A;  4CJF A;  1TAQ A;  1JKH A;  4H4M A;  3JSM A;  4CE9 A;  4B9S A;  3AO1 A;  4KB1 A;  2QKB A;  1IKX A;  3AVB A;  5FRM A;  3DOK A;  3T19 A;  4CES A;  4UQG A;  3SCX A;  1TVR A;  3OYJ A;  2X78 A;  4DTO A;  1YTU A;  4ID1 A;  3V1O A;  4Z0U A;  4DLE A;  4OLB A;  3MEE A;  4IDK A;  1IH7 A;  5KGX A;  4FJN A;  4CGJ A;  3M8R A;  1ZBH A;  1ZBF A;  3QIP A;  2FBY A;  3SUQ A;  4N56 A;  4YNQ A;  1EET A;  4NYN A;  3V1Q A;  1NJX A;  3QET A;  1RT7 A;  4EP5 A;  1S1W A;  4KHQ A;  2F8S A;  1RT2 A;  3C94 A;  3NFA A;  4DSF A;  1C1A A;  4W5Q A;  1LWF A;  4IG0 A;  4DFK A;  3IG1 A;  4CF8 A;  5J2Q A;  3TAE A;  2G8V A;  3OYA A;  3L2V A;  3QES A;  3L2R A;  4FZX C;  4O44 A;  1NKB A;  1XWL A;  4B9N A;  5CZ2 A;  4Q0B A;  1GOB A;  1A5W A;  3RMD A;  3KKS A;  4Z4F A;  4E7J A;  3KLI A;  1L3U A;  5C24 A;  2YKN A;  4FCY A;  4FVM A;  2R7Y A;  4ELV A;  4M3Y A;  3QEV A;  2I5J A;  1B92 A;  4Z4E A;  3K57 A;  2VWK A;  2XO7 A;  3HL8 A;  4DS4 A;  1NKC A;  1NK9 A;  4E0D A;  4DSJ A;  3KLF A;  3ASM A;  1U45 A;  3ISN C;  4F2S A;  3G0Z A;  3WNH A;  2HMI A;  3V9X A;  4N5S A;  4FJ8 A;  2HHU A;  2HHS A;  1VSL A;  4BDZ A;  4JS5 A;  3VN5 A;  3OYL A;  3VQ9 A;  2WON A;  3EYZ A;  4E7I A;  4DQP A;  1TK5 A;  2AJQ A;  3V9U A;  4DTU A;  2OA8 A;  4IFV A;  1X1P A;  4CJ5 A;  3AVN A;  3ULD A;  5HBM A;  3KIO A;  3TAN A;  1Z25 A;  3LZJ A;  3OYE A;  1FK9 A; 
#chains in the Genus database with same CATH topology
 1J54 A;  1NJI O;  3CCQ N;  5I9E B;  4IEI A;  2YJE A;  5LJV A;  1DEJ A;  3CYM A;  4M3R A;  4F9O A;  4B3S K;  2UUC K;  1WN7 A;  4OGE A;  1RT6 A;  3HPH A;  2G8U A;  3WXK A;  1OKJ A;  4KB0 A;  4KRE A;  3P1G A;  1YJW N;  4V19 S;  3M8Q A;  4AHR A;  2FXU A;  2GEM A;  2WC9 A;  4WQ4 A;  4BG9 A;  4OGC A;  1BA1 A;  3AVM A;  1JL2 A;  3WEE A;  1XC9 A;  3TTC A;  3VPZ A;  4H5V A;  4M63 C;  2O8D A;  4ZHR A;  1JJ2 M;  1RCH A;  3K5O A;  4DLG A;  3NE6 A;  4CEF A;  5JIC A;  3DXM B;  2E2Q A;  4BRA A;  4L8R B;  1YVN A;  4CZK A;  3HPG A;  1NLV A;  4X66 K;  1QE1 A;  3VTI A;  4MO5 A;  3AA4 A;  2B4J A;  2IVO A;  2KLA A;  1NJZ A;  2DFH A;  3R8E A;  2ZGZ A;  4CD1 A;  4FK2 A;  2W6K A;  4MFB A;  5AQQ A;  4DQQ A;  3C7N A;  1M1K O;  1HJR A;  3AVG A;  3ZT3 A;  4NCB A;  3SUN A;  3WUH A;  4DV1 K;  4JKH A;  3VF2 A;  5AZI B;  3TI0 A;  3ZSR A;  4IWV A;  1O13 A;  1Q9X A;  5AQJ A;  3LP3 A;  3FFK B;  2YNG A;  4ILG B;  1QSL A;  3SPZ A;  3HJF A;  3OS0 A;  1ITG A;  3G71 N;  3OYD A;  2CGL A;  2XHB A;  1VQP N;  2UUB K;  4LSN A;  2IOC A;  4GNI A;  1S9E A;  3R6M A;  5KRS A;  5M1N A;  1KFD A;  3VMF B;  4Z4C A;  3BY5 A;  1NJY A;  4KI4 A;  4OO1 J;  3KWG A;  3VEN A;  1WNS A;  3OJS A;  4DSE A;  3CC2 N;  1IV0 A;  5JVH L;  3SZ2 A;  1WSI A;  4LF4 K;  4JKG A;  3MXM A;  1J53 A;  3CJB A;  1HNZ K;  3A5M C;  1IJJ A;  1XNR K;  1EXQ A;  4W5R A;  3CJA A;  3TPQ A;  4KFB A;  3O4W A;  3FR0 A;  4IO9 L;  2Y1I A;  1TKZ A;  4A59 A;  4HCC A;  1QS4 A;  2B6A A;  2F96 A;  5DM6 L;  5EX5 A;  4K8X A;  4CK2 A;  4WCE L;  4U67 L;  4BR9 A;  2GTD A;  4E19 A;  3LDN A;  1VQ7 N;  4ZTF A;  1L3T A;  2OZM A;  3ZSV A;  1ZYQ A;  5F0X A;  3U9Z A;  2P9P A;  4CER A;  2BH1 A;  3VEW A;  3CQ8 A;  4UY8 O;  5AQW A;  4BC5 A;  3I56 N;  1RDD A;  1Q18 A;  3LP0 A;  3OHR A;  4CHO A;  5KI6 A;  1JLQ A;  1K8A O;  5BRH A;  1Q81 O;  1WSF A;  5M1O A;  4FJ9 A;  4BVP A;  1YJN N;  1EWR A;  2XY8 A;  3OW2 M;  1QSY A;  4WFN L;  4BRN A;  3THV A;  3A5L C;  4JI2 K;  4WYB A;  1BU6 O;  5M1Q A;  2RF2 A;  2BUP A;  1HPM A;  3CD6 N;  3O1W A;  4DF8 A;  1C1C A;  3AVA A;  3VGM A;  2Q0R A;  4CFC A;  1FKO A;  4CK3 A;  1ZXO A;  2VGM A;  1RDA A;  5K14 A;  1BI4 B;  5F1X A;  1IKY A;  2W40 A;  4B8C A;  2G8W A;  1QTM A;  1N34 K;  3AY9 A;  2W41 A;  3O3H A;  1RBV A;  1RT4 A;  1X3M A;  2VYP A;  1SKW A;  5AQH A;  5HRR A;  3KLH A;  1NGC A;  4CJW A;  3CPE A;  1JLF A;  1HYS A;  4I2P A;  1U6Z A;  3RVC A;  5AQF A;  4IBN A;  5EOY A;  4CHN A;  5FPN A;  1D5A A;  4DUY K;  2D0P A;  1BHL A;  3V9Z A;  3NDK A;  1NGD A;  4CJQ A;  3DLE A;  4OX9 K;  4JK8 A;  1SL1 A;  2NUB A;  1R0A A;  5M1F A;  3VQP A;  1N5Y A;  2QWP A;  3O5B A;  3AO3 A;  5E26 A;  4O8K A;  4JI4 K;  4WF9 L;  4CEB A;  3IUC A;  3O4Q A;  4KHS A;  1X9J A;  4WFA L;  4K41 A;  5HRS A;  3SUO A;  2E20 A;  4DFP A;  1U4B A;  2F4V K;  3NH1 A;  5FRN A;  3HST B;  3AO4 A;  4CK1 A;  4Z4H A;  3TAB A;  3SQ0 A;  4IOX A;  1NJW A;  1VSK A;  3WNE A;  4CJT A;  4FOE A;  1RBU A;  2YI1 A;  4M3T A;  3OYM A;  3BDP A;  3HI0 A;  1S1X A;  5A2Q O;  2QA4 N;  3S3O A;  3AVJ A;  3P39 A;  4DQR A;  2D0B A;  2GWJ A;  1Q86 O;  4LFB K;  2KZZ A;  1VQ8 N;  4M3Z A;  1RBT A;  4DV6 K;  2ASP A;  2OPP A;  3QFU A;  1FJG K;  1HJO A;  1NMN A;  3LAL A;  1HQU A;  4DQS A;  1KVA A;  3BUZ B;  2NRW A;  3ATV A;  2OCE A;  5CYQ A;  1EWQ A;  1QZ6 A;  4R79 A;  2WBN A;  2IGI A;  5KPZ A;  1QZ5 A;  4NLB A;  1QQC A;  3WXJ A;  3RMA A;  5AQO A;  1C0F A;  4DKW A;  3ZET B;  3H08 A;  3RRG A;  4FXD A;  1KAZ A;  4IFE A;  4H5R A;  3CCE N;  5M1P A;  2G8F A;  2DTU A;  1T6D A;  4FM1 A;  4RWT A;  2UXD K;  2HMP A;  4CFA A;  4FLU A;  2H3G X;  2A5X A;  5KQ8 A;  3WXM B;  2CGJ A;  2OPS A;  1YJ9 N;  3RR8 A;  5SWM A;  3HO1 A;  2VQF K;  1KQS M;  1VHX A;  1DGK N;  1W0H A;  1EP4 A;  3QBW A;  4C1N K;  2UUA K;  1BWF O;  1RDC A;  3U6F A;  3DM2 A;  3THX B;  4OVL A;  4QS8 A;  3SLC A;  4JAX A;  3VQB A;  3ID8 A;  1W2B M;  5HRP A;  1YIJ N;  3D45 A;  3IS9 A;  3JXU A;  3THY A;  4BAC A;  3W0L A;  3EEQ A;  1RT3 A;  1S1U A;  4B08 A;  4GKJ K;  3O4N A;  3E9L A;  1WBD A;  4H5T A;  3LP1 A;  1LW0 A;  3K9J A;  3G6E N;  3R1X A;  4KHN A;  2XRI A;  3KLE A;  4FJH A;  3DLK A;  3IFR A;  1VSJ A;  1C0T A;  1X9S A;  1U49 A;  1VQM N;  4R5P A;  4HUF A;  4DR7 K;  3D7E O;  1Y64 A;  2FF3 B;  4CZJ A;  1WUA A;  4JD2 A;  2PYL A;  1NKE A;  3HRG A;  4FWP A;  4DWI A;  4DTP A;  2HHV A;  3MN9 A;  2D4W A;  4OJR A;  1TKT A;  2A6A A;  1QSS A;  1D8Y A;  5T7B A;  4CJ7 A;  2P9U B;  5E84 A;  1LCU A;  1C0G A;  4FWO A;  3ITH A;  4BR7 A;  2BDP A;  2Z1G A;  2HB5 A;  4JHD A;  5DMR A;  5B8H A;  5LJW A;  5EVZ A;  4CJK A;  2F7T A;  5LMU K;  3TAM A;  4FM2 A;  3VQE A;  1FW6 A;  1RTI A;  1T7P A;  5AQZ A;  3EZW A;  3LWL A;  3DLR A;  5SZT A;  2JWL A;  3HP6 A;  4FLT A;  3KJV A;  3D2F A;  5BRE A;  3DRP A;  3UKU A;  2E1Y A;  4DSK A;  3QML A;  1S1T A;  3O9S A;  2JLE A;  1XC3 A;  4KPY A;  5M1K A;  3IMX A;  1R59 O;  2QXL A;  1TAQ A;  3AO1 A;  2Q36 A;  4JKB A;  1XUP O;  5FRM A;  2FSK A;  2YHX A;  4UQG A;  3SCX A;  1YTU A;  2X78 A;  4AF1 A;  4ID1 A;  4OLB A;  3MEE A;  4H0P A;  1NJX A;  3SUQ A;  2ZJP L;  3F5T A;  2HBL A;  4DSF A;  2O8E A;  4W5Q A;  1LWF A;  3IG1 A;  2O8F A;  4JI5 K;  4FZX C;  1NKB A;  1XWL A;  2NLX A;  2YHW A;  1GOB A;  1E4F T;  2OAN A;  5C24 A;  1L3U A;  4Z4E A;  3HL8 A;  4B1U B;  3ASM A;  3LL3 A;  2HHU A;  3V9X A;  3RSE B;  5IWA K;  1OVQ A;  3OYL A;  3VQ9 A;  1S3X A;  3EYZ A;  4E7I A;  3J7Z O;  4CZI A;  5BRF A;  3F73 A;  4O4G A;  1NMD A;  4DV3 K;  2V7Z A;  3M3Z A;  3VQC A;  1BA0 A;  1OVY A;  4JK9 A;  3L2W A;  1DTQ A;  3OVN A;  2F8T A;  4YDU A;  3I55 N;  4QAG A;  1EO1 A;  2QWQ A;  1GOA A;  3LM9 A;  4Y1C A;  4BVO A;  3SQ1 A;  4B8A B;  1S9G A;  1VRU A;  4RG8 A;  1QQM A;  4FJK A;  3ZEU A;  4A61 A;  4PL7 A;  3T1H K;  3PSI A;  3KD1 E;  3C95 A;  3TAG A;  3MWP A;  2HBM A;  4CHQ A;  3ZCM A;  3O3G A;  3ID6 A;  3W3D A;  3HXM A;  3SPY A;  2Z1H A;  2P9L A;  4BC4 A;  5GAE P;  3P38 A;  1NU0 A;  4CJV A;  4E7K A;  3VGK A;  1CZ9 A;  1NGG A;  1WLJ A;  1GLE G;  4HHT A;  4Q5V A;  4KKO A;  3SMP A;  3UKR B;  4O5B A;  5AQR A;  1RTJ A;  4YHH K;  1VQO N;  4DTM A;  1J5E K;  2QW9 A;  4CHY A;  4ISE A;  3QEX A;  4GMJ B;  3SQ4 A;  4O0J A;  2Y1J A;  2G8H A;  3VEZ A;  1NK0 A;  4XH1 A;  3SBG A;  2OTJ N;  3ZT2 A;  1KLN A;  1ZBS A;  1J6Z A;  1BO5 O;  5C10 A;  1GLC G;  4YFU A;  4E7H A;  5ADX A;  3BEX A;  3H6E A;  1NGB A;  2ITG A;  4BR5 A;  3HVT A;  2YJF A;  4WQ4 C;  2PZS A;  4IOC L;  3SAH A;  3VQ8 A;  1JCE A;  3S9H A;  1EX4 A;  4DV0 K;  3PO5 A;  3CC4 N;  1N8R O;  4HWI A;  2OTL N;  4GW6 A;  2KW4 A;  1K9M O;  3EL2 A;  3FGU A;  3TSP A;  1B9F A;  1JLE A;  1CXU A;  3AA5 X;  3SMS A;  2KHO A;  2W42 A;  2AA4 A;  3ZT1 A;  1HNX K;  3Q7C A;  4CJL A;  1YVU A;  4OKJ A;  1C6V A;  1DLO A;  1TV6 A;  3WNG A;  2IDO A;  1VSF A;  1SS6 A;  4QOZ B;  4FW1 A;  2HHH K;  3EY1 A;  3VF4 A;  4JS4 A;  4OLA A;  3DXK A;  3NF8 A;  3ZX2 A;  1OH6 A;  4CGG A;  2OZS A;  3DRS A;  4DSL A;  1TYQ B;  4CZF A;  3HM9 A;  3L4I A;  3RWU A;  3P83 D;  4MO4 A;  1NGF A;  4RW9 A;  1EQY A;  4CW7 B;  4HUE A;  3V9U A;  3D0P A;  4JN4 A;  4IJN A;  4CJS A;  3AAR A;  1HPZ A;  5ELZ A;  2HHW A;  4FJL A;  3O9T A;  3A5O C;  4AHU A;  3J7Y P;  3T7Z A;  2QTD A;  4DSI A;  3NMU A;  3TAF A;  1LAW A;  4JLH A;  3OBW A;  2NRZ A;  4ISG A;  3OA9 A;  5KTQ A;  3D2E B;  1T8E A;  4FLV A;  3O9R A;  2Q31 A;  1U04 A;  3AA3 A;  4BR0 A;  2XY7 A;  3ZT4 A;  1XI1 A;  2P5O A;  4CJP A;  5LY3 A;  5C15 A;  1NNE A;  3K59 A;  4NB4 A;  1K8K A;  1SKR A;  1BGX T;  4K42 A;  3OJU A;  4LH4 A;  1VAZ A;  1TUY A;  3O80 A;  4LF6 K;  4A5B A;  1BIZ A;  2KQ2 A;  3GOI A;  5AQV A;  5BPM A;  3WXI A;  1HKC A;  3IAY A;  4C8M A;  3DLH A;  3NBP A;  4YY3 K;  3J7A P;  1VQN N;  4FL9 A;  3K2P A;  4DU1 A;  2YNF A;  4M7Y A;  3RMC A;  4EFH A;  3F9M A;  3VEY A;  3FFI A;  5CYM A;  3VQ4 A;  4O5F A;  4I9Q A;  3CJC A;  3PIO L;  3SJH A;  5KGW A;  2P51 A;  2O8B B;  2BE2 A;  3CIP A;  3NF6 A;  3HZ6 A;  1CZB A;  4BY9 C;  4OPK A;  4K43 A;  4G1Q A;  3A0I X;  4I7F A;  1A5X A;  5EU7 A;  3CPW M;  1Z26 A;  4JKE A;  1IKV A;  3OY9 A;  3VF6 A;  1HNW K;  1N36 K;  4B9V A;  1KLM A;  5AR0 A;  4DR4 K;  3RMB A;  4U7B A;  3MEC A;  3K5M A;  3BF3 A;  3K0S A;  4BRI A;  4FWL A;  3L2Q A;  1G99 A;  3NCI A;  1TK0 A;  2VQE K;  1IG9 A;  4KHU A;  4CBX A;  1RT1 A;  2G8K A;  4CGI A;  2OPQ A;  2JWK A;  4AHV A;  3O8M A;  2CGK A;  1VQ6 N;  1RDW X;  3CXC M;  3V6D A;  1MU2 A;  4BE1 A;  2HF3 A;  3F9K A;  3I8B A;  3KTQ A;  3KKR A;  4BRM A;  4CFB A;  2RE2 A;  2X6N A;  3VA3 A;  4E89 A;  4B3T K;  3ZX3 A;  1JXB A;  4DCH A;  4GY2 B;  1GLL O;  3OYB A;  4DTX A;  4CGD A;  2J4R A;  3C6T A;  1BIS A;  1RDU A;  3AV9 A;  3H3N O;  1NM1 A;  4EZ9 A;  5CZ1 A;  5AQU A;  3E01 A;  4B1W B;  1GLB G;  1DTT A;  1T05 A;  4CHZ A;  4JRQ A;  3V81 A;  3L3V A;  3I8D A;  4KHY A;  4B9T A;  3K9K A;  3CCV N;  1RTH A;  3LDL A;  3CJ7 A;  3AGR A;  3LM2 A;  4DTS A;  4LY7 A;  4KH5 A;  1JXE A;  3DOL A;  4FLW A;  3PX4 A;  4IFY A;  1S5J A;  3CET A;  4FJ7 A;  3QER A;  4LF9 K;  2E2O A;  1L3V A;  1IBK K;  3FE1 A;  4DV4 K;  4DU4 A;  2P9I B;  2KFN A;  2PFU A;  4K8Z A;  4PKI A;  2YHY A;  5TKY A;  3RR7 A;  2OPR A;  2A1R A;  3GBT A;  4F3O A;  5AZI A;  1SZ2 A;  4BWJ A;  2FLO A;  1GLD G;  4CF9 A;  4X62 K;  2ZJQ L;  4E7L A;  5AQN A;  2XY5 A;  1VQ4 N;  3U3Y A;  4LFA K;  2DFE A;  3VGL A;  2P9N A;  3WXL A;  4FWM A;  4Y1D A;  3MMV A;  4B1Y B;  3V9S A;  1X9M A;  1I39 A;  3FZH A;  4CGF A;  2DPN A;  3SV4 A;  3OS2 A;  4XEI A;  3ULE B;  4JYA K;  4XIU A;  4J8F A;  2A42 A;  4RTF D;  5GIN A;  4E1M A;  3NH2 A;  1JL1 A;  1C1B A;  5BN8 A;  1Q7Y O;  1KAY A;  4I6M B;  1E3M A;  2IIR A;  4CZH A;  1NK4 A;  5C12 A;  5AFU A;  1JLG A;  4CF2 A;  4K0K K;  4I2Q A;  4M42 A;  1L3S A;  1C0M A;  3CCM N;  1QVG M;  4DFM A;  1UA0 A;  1BL3 A;  2D0C A;  4HTL A;  4LH5 A;  4H0X B;  5J1E A;  4GVM A;  1UAX A;  4LSL A;  5CR4 A;  2A41 A;  2RPI A;  3PX0 A;  5ADX H;  4CGH A;  5AZJ B;  4CJF A;  1YI2 N;  4B9S A;  2HBK A;  1GLF O;  4KBO A;  1W97 L;  3R9P A;  3T19 A;  2FSJ A;  3OYJ A;  4DTO A;  4JHD B;  4IDK A;  5AQM A;  5KGX A;  4FJN A;  1WB9 A;  5FLX O;  1ZBH A;  3S41 A;  3QIP A;  4N56 A;  4H5N A;  1LOT B;  4FWQ A;  1RT7 A;  2NRR A;  4EP5 A;  4KHQ A;  2F8S A;  2P9K B;  4IG0 A;  2G8V A;  4LC9 B;  4Y0W A;  4Q0B A;  3D2F B;  3E9P A;  5BPL A;  3QEV A;  3K57 A;  5DM7 L;  2XO7 A;  4DR1 K;  4FWS A;  1NK9 A;  4E0D A;  4DSJ A;  3VER A;  3G0Z A;  3WNH A;  2HMI A;  1VSL A;  1GLA G;  4JS5 A;  3VN5 A;  2NZT A;  4JKD A;  3LDO A;  4JK7 A;  4DTU A;  2OA8 A;  3TAN A;  3TAR A;  3LZJ A;  3PV8 A;  1HNV A;  4BWM A;  3V9W A;  4KI6 A;  2G8I A;  4W5N A;  5C2F A;  1OH5 A;  3LAK A;  3C6U A;  2HHQ A;  4GKK K;  1V4S A;  1BCO A;  2FSN A;  3CCS N;  2UXC K;  2D0A A;  4FK0 A;  3KK1 A;  3OTO K;  4LF7 K;  4AHC A;  1N6Q A;  2Z1J A;  3LP2 A;  3MX2 A;  1GLJ O;  3ENH A;  3S3N A;  1ASU A;  1WOQ A;  5LL6 Z;  4F8R A;  3VQ6 A;  2V51 B;  1LWE A;  4OPJ A;  1VSD A;  1KRP A;  1VSM A;  1XHX A;  4XH4 A;  4M3U A;  3AVC A;  4CEC A;  5GIP A;  1SQK A;  1XMO K;  3NH0 A;  3P5J A;  1WSE A;  4KV8 A;  4E3S A;  4DFJ A;  3CM5 A;  3B6O A;  1VQL N;  3DLB A;  2GBZ A;  1YIT N;  3KVG A;  2ZWH A;  3M8P A;  3H45 C;  1WSH A;  4DQI A;  4B3R K;  1VSH A;  4K25 A;  1KCF A;  4CVN E;  3CG7 A;  4BE0 A;  3B6P A;  3A5N C;  2GX9 A;  4KO0 A;  4CIF A;  3DAW A;  4B9M A;  1CXQ A;  4JI1 K;  3PUF A;  3T69 A;  3LDS A;  5DK5 A;  4HVJ A;  2FBT A;  5GAG P;  1HRH A;  4OPH A;  4J2B A;  3HOS A;  4KTQ A;  3E9O A;  1T3V A;  3ZET A;  4CEA A;  3I0S A;  4IOA L;  3V1R A;  3MEG A;  1KXP A;  3J81 O;  3PO4 A;  1NGI A;  4KHP K;  4BR4 A;  4BQZ A;  5J2P A;  2YV0 X;  1NOY A;  5AQS A;  1SV5 A;  1Z25 A;  3E1Y A;  4WQ5 A;  3QEW A;  2QWR A;  3MN7 A;  3LWM A;  3MAQ A;  1O1W A;  4M3W A;  3A2F A;  3QNN A;  4N41 A;  5KPR A;  1NBW A;  4CZL A;  4W5O A;  3QO9 A;  3VOV A;  5I42 A;  4NCG A;  1LAV A;  2O8C B;  2IAJ A;  3P31 A;  3JS6 A;  1NOZ A;  3VQQ A;  5H1S Q;  3M6G A;  4JRP A;  2F9T A;  3AO5 A;  3HVR A;  3CFR A;  4IXC A;  1W7A A;  2KKZ A;  3LDQ A;  4CJ3 A;  3QNO A;  1E4G T;  3K5L A;  4DS5 A;  4DV5 K;  3MDQ A;  3PX6 A;  1SKS A;  4BDY A;  4CF1 A;  2HNZ A;  2O4G A;  2ASO A;  3L0Q A;  2HND A;  3AVI A;  4KH4 A;  1RT5 A;  2AP1 A;  1BQM A;  4MDB A;  2HNY A;  3V4I A;  4JI3 K;  3F2K A;  1ASV A;  2VG7 A;  4H8K A;  1NGE A;  1HX1 A;  2E2P A;  1Z05 A;  2FBX A;  2IC3 A;  1Y97 A;  3THW B;  1BDG A;  1NGA A;  4DUZ K;  2HHT A;  2BGG A;  1VQ5 N;  5HRN A;  1VRT A;  1BOT O;  3SYZ A;  3DJC A;  1WAF A;  4CD3 A;  1BG3 A;  1U2V B;  5JVG L;  1VQ9 N;  1YT3 A;  2P9S B;  2QWN A;  4ELT A;  3TWH A;  4J2D A;  1REV A;  4BRE A;  5C2D A;  3OYH A;  2E6M A;  3OYC A;  4NCA A;  1VSE A;  4MLE A;  1VSI A;  2VCP A;  3MK6 A;  1QQO A;  5BPN A;  4DF4 A;  1SAZ A;  5AQK A;  1T03 A;  1K6Y A;  4JEP A;  1HYV A;  5IT9 O;  1MWM A;  2BTF A;  4X65 K;  4PKH A;  1IG8 A;  4ID5 A;  1L5U A;  3B8A X;  1ZBI A;  3WEE B;  2ASM A;  1ZBU A;  4PHT X;  2O8D B;  3IDH A;  2KFZ A;  5AQX A;  1EKE A;  1QHT A;  2E5L K;  4EAH D;  3LPT A;  4FZY A;  1NGH A;  5AFU H;  3MED A;  1K8K B;  4O0I A;  4H03 B;  3GL1 A;  3LDP A;  2YNH A;  3ENO A;  4BGB A;  1MA9 B;  1YXQ A;  3T1A A;  1B9D A;  4X64 K;  1S1V A;  1QHA A;  3VEV A;  3C7N B;  3TTF A;  2PY5 A;  2NRT A;  1QQN A;  4EHT A;  4C8L A;  1IKW A;  1HKB A;  4PA1 A;  1BQN A;  4H0O A;  4CBW A;  1RFQ A;  3I33 A;  3RSE A;  4F4K A;  4CJU A;  4MLH A;  4B9Q A;  4BRQ A;  4PL8 A;  2IVN A;  4BRG A;  4ZTJ A;  1SL2 A;  4GV9 A;  5AQY A;  3HT3 A;  2RHK A;  3RRH A;  5J2M A;  1CZA N;  3DLG A;  2GWK A;  3CER A;  4MQ3 A;  2YHB A;  2Q1N A;  1LV5 A;  4H0Y B;  4FW2 A;  4AM7 A;  3ZLJ A;  4FJX A;  3CFP A;  4NLC A;  2IVP A;  4JKG B;  3VQD A;  3VQA A;  3SBT A;  2KZM A;  2QXF A;  5GAD P;  3CFO A;  3UIQ A;  1ASW A;  4CHP A;  3LAM A;  4BG8 A;  2YHA A;  4NYF A;  3LPU A;  2GUI A;  4C8K A;  2ETJ A;  3BZC A;  3BF1 A;  3LZI A;  1W9H A;  4W5T A;  2WUS A;  4FO0 A;  3T3F A;  4HCB A;  3RTV A;  2E88 A;  2B5J A;  4NXM K;  5BRD A;  1HKG A;  4QCL A;  3O08 A;  4RW8 A;  2Q3S A;  1ESV A;  3AVK A;  3FLC O;  3AA2 A;  3VEO A;  3TSU A;  3P4I A;  2P9P B;  3G10 A;  3SQ2 A;  5KRT A;  3KHY A;  3BGR A;  2HOE A;  1ZBL A;  3H1V X;  3AO2 A;  3EE8 A;  1K73 O;  3UKR A;  4YOY A;  3QEP A;  4IJA A;  4YOU A;  3N4Q A;  3C65 A;  4DV7 K;  1NK6 A;  4HUG A;  3PLA A;  3J8A A;  3WQT A;  2BAN A;  2P5G A;  2PYJ A;  3PSF A;  4Z4I A;  4CJR A;  4CEZ A;  3VQ7 A;  5KPT A;  2I7P A;  4GV3 A;  4BC3 A;  3TAQ A;  4ILJ A;  1F21 A;  2UYT A;  1KD1 O;  1V4T A;  3MCP A;  1BIU A;  2HW3 A;  3FZF A;  3PIP L;  2YKM A;  4M3X A;  1HQE A;  1RDB A;  4M41 A;  2ZQB A;  4NO7 A;  4JI6 K;  2FC0 A;  3L6Q A;  5GIO A;  1BUP A;  2Q97 A;  1BCM A;  2RKI A;  4FZZ A;  1KTQ A;  2X6S A;  5E41 A;  1TGO A;  2V52 B;  3O1B A;  4CIE A;  3EO3 A;  4FWN A;  5KQD A;  3FZM A;  3EZ5 A;  3DLL L;  2QWO A;  2P9N B;  3OYF A;  4B3M K;  2DFF A;  4FJ5 A;  4ELU A;  2LSN A;  4OPA A;  1XQS C;  3M8S A;  2GEL A;  4N76 A;  4JKC A;  3HPO A;  2NRH A;  3H1Q A;  1VQK N;  4O8U A;  3JSM A;  1TYQ A;  4KB1 A;  2QKB A;  1IKX A;  1TVR A;  3HTV A;  5AQG A;  1IH7 A;  3CCJ N;  4CGJ A;  3M8R A;  4YNQ A;  3V1Q A;  3NVM A;  1JCG A;  1RT2 A;  3C94 A;  3G25 A;  4DFK A;  3NVK A;  4MDA A;  3L2V A;  4DV2 K;  3L2R A;  3QES A;  4O44 A;  5TKW A;  4B9N A;  3U9D A;  1A5W A;  3RMD A;  3QBX A;  4E7J A;  4Z4F A;  3KLI A;  5AJ3 K;  2YKN A;  4FCY A;  4FVM A;  4ELV A;  4M3Y A;  3D2E A;  4DS4 A;  4YOX A;  1ATS A;  1NKC A;  1OH7 A;  4NXN K;  4BRC A;  1U45 A;  5BR9 A;  3MCA B;  4FJ8 A;  4N5S A;  3H3O B;  3O9U A;  3DXM A;  4BDZ A;  3TSQ A;  1OH8 A;  2YCH A;  1TK5 A;  4IFV A;  1N32 K;  1X1P A;  1Q82 O;  3AVN A;  4Z94 A;  5HBM A;  3KIO A;  3ULD A;  5HRO A;  2E1Z A;  3OYE A;  2WTU A;  3ZYY X;  3WQU A;  3HM8 A;  1YF5 L;  3EKS A;  4LF8 K;  3UE5 A;  3SI6 A;  3CJ9 A;  2NRX A;  3TAP A;  4YOR A;  2CH5 A;  3VEX A;  4CED A;  4KH6 A;  4DR3 K;  3L8B A;  4FJM A;  4BRH A;  4FYD A;  2HVI A;  1IO2 A;  1NWK A;  1KVC A;  1CLQ A;  2JGU A;  4B1Z A;  3KK3 A;  2O8B A;  2ZJR L;  5FPD A;  4PUO A;  3CC7 N;  5HL7 L;  3QEI A;  4B3O A;  2IS3 A;  4FJG A;  2ZE2 A;  3GDQ A;  3K5N A;  4DHY A;  2HHX A;  4B9U A;  3SJJ A;  3KWI A;  4CBU A;  3ZSW A;  1S72 N;  1SL0 A;  1LWC A;  4CZM A;  4HTU A;  1WSG A;  4AH9 A;  4CEO A;  1Q9Y A;  4FWK A;  2E4L A;  3ZSZ A;  4AHS A;  3AAQ A;  4AHT A;  1WSJ A;  3THY B;  3ALY A;  3NGZ A;  1TK8 A;  1D9D A;  1XNQ K;  2ZM6 K;  3OYN A;  5JLF A;  3WT0 A;  1ATN A;  3PY8 A;  2RN2 A;  1RGI A;  4CFD A;  1KSP A;  3CCL N;  4FVU A;  5GAH P;  3N4P A;  2A3Z A;  4WE1 A;  4CJ4 A;  4IKF A;  4F2R A;  1RNH A;  4IEE A;  1IBM K;  2NRV A;  4JD2 B;  3SK3 A;  1WAJ A;  1NG9 A;  2FBV A;  2HF4 A;  1JLC A;  3OYK A;  5F2R A;  1RBR A;  1XHZ A;  1TL1 A;  2A1S A;  2WFB A;  3AGK A;  2UU9 K;  1P8Z A;  3K58 A;  3HP9 A;  4QS7 A;  3SUP A;  3J80 O;  3O9Q A;  2PAV A;  4H4O A;  3CMA N;  1NK5 A;  2E8A A;  4AIL C;  4JKA A;  4DG1 A;  4A62 A;  2E2N A;  3CJ1 A;  4M7X A;  1LW2 A;  4B9L A;  3QLH A;  4DU3 A;  2Q0U A;  5C25 A;  1KFS A;  3HOT A;  4DTR A;  3CHW A;  1ZC6 A;  3AVH A;  3UKU B;  2XY6 A;  4WFB L;  5C0Y A;  4RCH A;  3MXJ A;  4FSV A;  1TKX A;  2OYQ A;  1KAX A;  3ZSQ A;  3CQX A;  3JAM O;  3HBT A;  1D9F A;  4JI8 K;  1UWB A;  2P9I A;  1BI4 A;  4DQ8 A;  5FRO A;  2QM1 A;  4C8N A;  4FLY A;  1A5V A;  4H5W A;  4GVE A;  3BP8 A;  3DRR A;  3HYF A;  3NF7 A;  3OBY A;  5I3U A;  3MN6 A;  1J5O A;  2A40 A;  4TSX A;  4J2E A;  3L4Q A;  4IZ9 A;  3AVL A;  1HYZ A;  2GV9 A;  4FLX A;  1RBS A;  2ITM A;  2VG6 A;  3KK2 A;  3KD5 E;  1NK8 A;  2O8E B;  1G15 A;  2QI2 A;  5MLC Q;  2O8F B;  5HOO A;  1HNI A;  3ULE A;  4LFC K;  4CIG A;  1S6Q A;  3TTD A;  2VG5 A;  1C0U A;  4CEE A;  4CCH A;  3O3F A;  1Q8I A;  2WOM A;  4F3T A;  1HLU A;  4KHW A;  3CI5 A;  5CHI A;  4B1V A;  4I6M A;  1YTA A;  3EE9 A;  1MDU B;  4PWD A;  3SNN A;  1D4X A;  2ZF5 O;  4WQ5 C;  3IRX A;  1KC8 O;  1UA1 A;  2YX6 A;  3L2U A;  5FDL A;  4JKF A;  1MWK A;  1GOC A;  1SUQ A;  3NAE A;  2P1J A;  5D3G A;  2V7Y A;  4A57 A;  4CF0 A;  4CZE A;  3M5R A;  1HR0 K;  4OKE A;  4A2B A;  3ZSX A;  4BRL A;  4OKK A;  3A8Y A;  4BGA A;  3MXI A;  4EZ6 A;  2YNI A;  4RW4 A;  1QVF M;  1NGJ A;  5LMN K;  1NK7 A;  4BDP A;  2VWB A;  3QFP A;  3C0B A;  3JYT A;  2QWM A;  5AZJ A;  1Z6R A;  3S3M A;  3ZEU B;  5EXW A;  1TUU A;  4DB3 A;  3I0R A;  2UXB K;  5J2N A;  1I3A A;  1X3N A;  3FZK A;  4FOI A;  3ENB A;  2QKK A;  3OS1 A;  4YDU C;  4DR2 K;  4FPB A;  2QEX N;  3NF9 A;  4IG3 A;  4L3Q A;  3IKM A;  3NGY A;  3AAP A;  4EP4 A;  3ATU A;  4PY5 A;  1RTD A;  2P9L B;  1HMV A;  4FJJ A;  2P9K A;  5AQL A;  2HVH A;  3FZL A;  4O55 A;  5CY4 A;  4PKG A;  2GUP A;  4FK4 A;  3ZT0 A;  3C6H A;  3GE1 A;  4BR2 A;  4N47 A;  1N33 K;  5JLH A;  3ZSO A;  1U48 A;  3OYI A;  4AQY K;  4RW6 A;  5C42 A;  4ISF A;  2VWJ A;  2X74 A;  2QK9 A;  4KTW A;  4B1X B;  3DWL A;  4C1N I;  2ZGY A;  3C6A A;  4CI6 A;  3EN9 A;  3THX A;  1M90 O;  4GV6 A;  3D6R A;  2Q2R A;  3AVF A;  4C23 A;  1TL3 A;  3TU5 A;  2NNW A;  4FM0 A;  3HSC A;  3NGI A;  1IBL K;  3OYG A;  1DT9 A;  1DKG D;  3ZSY A;  3GG4 A;  2W6L A;  4BRK A;  4BQL A;  3R3L A;  4FJI A;  3NHG A;  2D0O A;  3MWT A;  4XH5 A;  4YOW A;  4KAZ A;  4AM6 A;  3CCU N;  1FKP A;  1P90 A;  4FWR A;  5AQI A;  4M45 A;  5HLF A;  2ATQ A;  4ILH A;  1KVB A;  2VGN A;  2EX3 A;  3EKU A;  4CJE A;  4RW7 A;  4IDH A;  1FXX A;  4JI0 K;  2EWS A;  3M1F A;  4I9L A;  2DY4 A;  4H0T B;  2O4I A;  1U47 A;  3E66 A;  1XMQ K;  4PQU A;  3DXK B;  2P9U A;  2I7N A;  3CF5 L;  1TAU A;  1JLA A;  2D5R A;  1S6P A;  5BN9 A;  3L3U A;  4BRD A;  3SAG A;  4Z4G A;  3ZX0 A;  3DMJ A;  4FPA A;  3QIN A;  3QIO A;  1I94 K;  4KTZ A;  1VK0 A;  4E1N A;  5CE3 A;  4FLZ A;  1RIL A;  1TKD A;  1ATR A;  1YAG A;  3U4L A;  4JNE A;  3VA0 A;  5BR8 K;  3VQ5 A;  4ICL A;  5JS2 A;  2F9W A;  4CEQ A;  4JV5 K;  4BE2 A;  1H1V A;  4C8O A;  1J9A A;  2E6L A;  3WNF A;  3DI6 A;  1X9W A;  4DTN A;  4QS9 A;  3SAF A;  3MX5 A;  3CME N;  4G9Z A;  3O6W A;  2EHG A;  3U3G A;  3T1Y K;  4J2A A;  4DR6 K;  3DYA A;  1UOC A;  4BRP A;  1JLB A;  4JI7 K;  2Z1I A;  3KZB A;  1S22 A;  3TR8 A;  1ILY A;  3SV3 A;  3HK2 A;  4DTJ A;  4DR5 K;  3Q7B A;  4YOT A;  4EIA A;  2KTQ A;  4KRF A;  5FPM A;  5JS1 A;  4EHU A;  5FPE A;  3KLG A;  2ZD1 A;  2CH6 A;  1YUW A;  3LAN A;  2O8C A;  3CM6 A;  5HP1 A;  3G4S N;  4LD0 A;  4DMN A;  2HBJ A;  1JKH A;  4H4M A;  3VTH A;  4CE9 A;  1T6C A;  1HUX A;  3AVB A;  3DOK A;  4CES A;  4LF5 K;  3CCR N;  3H46 O;  3V1O A;  4Z0U A;  4DLE A;  4IO8 A;  4CZG A;  1T44 A;  3VET A;  4BRO A;  1ZBF A;  3CQY A;  2FBY A;  1EET A;  4NYN A;  3QET A;  1JCF A;  3U8X A;  1S1W A;  4A5A A;  3NFA A;  4YOV A;  1C1A A;  5J2Q A;  4CF8 A;  3TAE A;  3OYA A;  3QB0 A;  3VES A;  5JMV A;  3KK7 A;  3THW A;  4H0V B;  5CZ2 A;  4BRF A;  5EY4 A;  4A2A A;  4E1J A;  3KKS A;  2PBD A;  3QIC A;  2R7Y A;  2I5J A;  1B92 A;  2VWK A;  1U2V A;  2FF6 A;  5AQP A;  3KLF A;  4F2S A;  3ISN C;  3BZK A;  2P9S A;  2HHS A;  3MN5 A;  4BC2 A;  1YHQ N;  3QDK A;  2HST A;  5AQT A;  1WBB A;  2WON A;  4DQP A;  2AJQ A;  2QWL A;  4CJ5 A;  2D1K A;  3UB5 A;  1FK9 A; 
#chains in the Genus database with same CATH homology
 4O4G A;  1J54 A;  3PV8 A;  1HNV A;  4BWM A;  3V9W A;  4KI6 A;  2G8I A;  4W5N A;  3CYM A;  4M3R A;  3F73 A;  3LAK A;  3VQC A;  3SI6 A;  3C6U A;  2HHQ A;  1BCO A;  3TAP A;  3L2W A;  1DTQ A;  1WN7 A;  3OVN A;  1RT6 A;  3HPH A;  4OGE A;  2G8U A;  2F8T A;  4QAG A;  4KB0 A;  2D0A A;  4KRE A;  3P1G A;  4CED A;  1GOA A;  4FJM A;  3M8Q A;  4Y1C A;  4AHR A;  3L8B A;  3KK1 A;  4FK0 A;  3SQ1 A;  4B8A B;  4FYD A;  2HVI A;  1IO2 A;  1S9G A;  1KVC A;  1VRU A;  2JGU A;  4RG8 A;  4OGC A;  1CLQ A;  3AVM A;  4AHC A;  1N6Q A;  4FJK A;  2Z1J A;  1JL2 A;  3LP2 A;  3KK3 A;  1XC9 A;  3KD1 E;  3S3N A;  1ASU A;  3C95 A;  3TAG A;  4ZHR A;  1RCH A;  4F8R A;  3K5O A;  4DLG A;  3NE6 A;  3VQ6 A;  4PUO A;  4CEF A;  1LWE A;  4OPJ A;  3QEI A;  4CHQ A;  1VSD A;  1KRP A;  3ZCM A;  4L8R B;  2IS3 A;  3O3G A;  2ZE2 A;  4FJG A;  1VSM A;  4B3O A;  3HPG A;  3K5N A;  1XHX A;  2HHX A;  4B9U A;  4M3U A;  3HXM A;  3SJJ A;  3SPY A;  1QE1 A;  2Z1H A;  3AVC A;  4CEC A;  3AA4 A;  2B4J A;  3ZSW A;  4CJV A;  4E7K A;  3NH0 A;  3P5J A;  1NJZ A;  1CZ9 A;  2DFH A;  1SL0 A;  1LWC A;  1WSE A;  4KV8 A;  4E3S A;  1WLJ A;  4HTU A;  4DFJ A;  4HHT A;  3CM5 A;  4FK2 A;  4MFB A;  4Q5V A;  4DQQ A;  1WSG A;  4AH9 A;  1HJR A;  4CEO A;  1Q9Y A;  3AVG A;  3ZT3 A;  4NCB A;  3SUN A;  3B6O A;  2E4L A;  3ZSZ A;  4AHS A;  3DLB A;  2GBZ A;  4KKO A;  4AHT A;  1WSJ A;  4O5B A;  3ALY A;  3NGZ A;  3ZSR A;  3TI0 A;  1RTJ A;  3M8P A;  1TK8 A;  1D9D A;  3OYN A;  1Q9X A;  1WSH A;  3LP3 A;  4DTM A;  1VSH A;  4DQI A;  1KCF A;  2YNG A;  1QSL A;  4CHY A;  3SPZ A;  3QEX A;  3PY8 A;  3HJF A;  2RN2 A;  3OS0 A;  1ITG A;  3CG7 A;  4GMJ B;  4O0J A;  3OYD A;  4CFD A;  2Y1J A;  4BE0 A;  3SQ4 A;  1NK0 A;  1KSP A;  2G8H A;  2XHB A;  3B6P A;  4LSN A;  2IOC A;  3ZT2 A;  1KLN A;  4WE1 A;  1S9E A;  4CJ4 A;  4YFU A;  4F2R A;  4E7H A;  1RNH A;  4KO0 A;  5KRS A;  4CIF A;  4IKF A;  1KFD A;  1CXQ A;  4B9M A;  4Z4C A;  3PUF A;  3LDS A;  1NJY A;  5DK5 A;  1WAJ A;  4KI4 A;  2ITG A;  4HVJ A;  2FBV A;  2FBT A;  3HVT A;  2PZS A;  1WNS A;  1JLC A;  3OYK A;  3OJS A;  1HRH A;  4DSE A;  3VQ8 A;  3S9H A;  4J2B A;  1RBR A;  1XHZ A;  1EX4 A;  4KTQ A;  1TL1 A;  2A1S A;  3K58 A;  3SZ2 A;  3PO5 A;  3HP9 A;  1WSI A;  4CEA A;  3I0S A;  3SUP A;  3V1R A;  3MEG A;  4GW6 A;  2KW4 A;  3PO4 A;  3MXM A;  1J53 A;  4H4O A;  1B9F A;  1JLE A;  1CXU A;  1EXQ A;  3AA5 X;  4W5R A;  4AIL C;  5J2P A;  1NK5 A;  2YV0 X;  1NOY A;  4KFB A;  2W42 A;  1SV5 A;  4DG1 A;  2Y1I A;  3ZT1 A;  1TKZ A;  4HCC A;  4CJL A;  1QS4 A;  1YVU A;  1LW2 A;  4B9L A;  3QLH A;  4OKJ A;  2B6A A;  2F96 A;  1C6V A;  4DU3 A;  3QEW A;  5C25 A;  1DLO A;  4K8X A;  3LWM A;  3MAQ A;  4CK2 A;  1KFS A;  1O1W A;  1TV6 A;  2IDO A;  1VSF A;  3WNG A;  3A2F A;  4DTR A;  4M3W A;  4QOZ B;  4FW1 A;  3QNN A;  4N41 A;  4E19 A;  3AVH A;  2XY6 A;  4ZTF A;  1L3T A;  2OZM A;  4W5O A;  3QO9 A;  3EY1 A;  5I42 A;  4NCG A;  1LAV A;  3ZSV A;  4JS4 A;  1ZYQ A;  4OLA A;  2IAJ A;  3MXJ A;  3NF8 A;  1TKX A;  2OYQ A;  3ZSQ A;  4CGG A;  1D9F A;  1NOZ A;  1UWB A;  3VQQ A;  1BI4 A;  4JRP A;  3AO5 A;  3DRS A;  3HVR A;  5FRO A;  3CFR A;  4CER A;  2OZS A;  4DSL A;  4CJ3 A;  4C8N A;  3K5L A;  1A5V A;  3HM9 A;  4FLY A;  3QNO A;  4DS5 A;  3PX6 A;  3CQ8 A;  3RWU A;  1SKS A;  3P83 D;  4BDY A;  3DRR A;  3HYF A;  4RW9 A;  4CF1 A;  3NF7 A;  2HNZ A;  2O4G A;  5I3U A;  1RDD A;  1J5O A;  3LP0 A;  4HUE A;  4TSX A;  2HND A;  3AVI A;  4CHO A;  3D0P A;  3AVL A;  5KI6 A;  1JLQ A;  1HYZ A;  4J2E A;  4CJS A;  1RT5 A;  1WSF A;  4FJ9 A;  2GV9 A;  1BQM A;  2XY8 A;  1HPZ A;  4FLX A;  1QSY A;  2HHW A;  1RBS A;  2HNY A;  3V4I A;  4FJL A;  3THV A;  2VG6 A;  3KK2 A;  1ASV A;  2VG7 A;  4H8K A;  4AHU A;  1NK8 A;  3KD5 E;  1G15 A;  4DSI A;  2FBX A;  2IC3 A;  1Y97 A;  3TAF A;  1HNI A;  1LAW A;  4JLH A;  2RF2 A;  4CIG A;  1S6Q A;  2HHT A;  2BGG A;  5HRN A;  1VRT A;  4DF8 A;  2VG5 A;  1C0U A;  4CEE A;  3SYZ A;  5KTQ A;  1C1C A;  4CCH A;  3O3F A;  1Q8I A;  1WAF A;  2WOM A;  3AVA A;  4FLV A;  1T8E A;  4F3T A;  4CFC A;  1U04 A;  1FKO A;  1YT3 A;  4CK3 A;  4KHW A;  3AA3 A;  1RDA A;  1YTA A;  2XY7 A;  5K14 A;  1BI4 B;  4PWD A;  3ZT4 A;  1XI1 A;  4ELT A;  3TWH A;  3SNN A;  2P5O A;  1IKY A;  1REV A;  4J2D A;  3IRX A;  4B8C A;  4CJP A;  2G8W A;  1QTM A;  1UA1 A;  3OYH A;  3O3H A;  3L2U A;  2E6M A;  5FDL A;  3OYC A;  3K59 A;  1SKR A;  1RBV A;  1GOC A;  1RT4 A;  1BGX T;  1SUQ A;  1VSE A;  1VSI A;  3NAE A;  4NCA A;  2P1J A;  5D3G A;  3OJU A;  4LH4 A;  4CF0 A;  1SKW A;  4DF4 A;  1BIZ A;  5HRR A;  4OKE A;  2KQ2 A;  3KLH A;  4CJW A;  3ZSX A;  3IAY A;  1JLF A;  1HYS A;  4I2P A;  4C8M A;  3DLH A;  3NBP A;  4IBN A;  1T03 A;  4OKK A;  1K6Y A;  3MXI A;  4EZ6 A;  1HYV A;  2YNI A;  4RW4 A;  1D5A A;  4CHN A;  3K2P A;  4DU1 A;  2YNF A;  3RMC A;  1NK7 A;  4BDP A;  4ID5 A;  1L5U A;  3JYT A;  1BHL A;  3FFI A;  3V9Z A;  5CYM A;  3NDK A;  3VQ4 A;  4CJQ A;  3S3M A;  4I9Q A;  3DLE A;  1ZBI A;  1SL1 A;  2NUB A;  5KGW A;  1ZBU A;  3I0R A;  1R0A A;  5J2N A;  1I3A A;  2P51 A;  3VQP A;  1N5Y A;  2BE2 A;  3NF6 A;  2QKK A;  3AO3 A;  2KFZ A;  3OS1 A;  4CEB A;  1CZB A;  3O4Q A;  4KHS A;  4OPK A;  3NF9 A;  1EKE A;  1QHT A;  4IG3 A;  3NGY A;  5HRS A;  3SUO A;  4EP4 A;  3LPT A;  4G1Q A;  4DFP A;  1U4B A;  4FZY A;  3NH1 A;  3MED A;  4O0I A;  1RTD A;  4PY5 A;  5FRN A;  1HMV A;  3AO4 A;  3HST B;  4I7F A;  1A5X A;  4CK1 A;  4Z4H A;  4FJJ A;  3TAB A;  3SQ0 A;  2YNH A;  5EU7 A;  1Z26 A;  1IKV A;  1VSK A;  3OY9 A;  3WNE A;  4CJT A;  1NJW A;  2HVH A;  3T1A A;  4O55 A;  5CY4 A;  1RBU A;  4M3T A;  1B9D A;  4B9V A;  1KLM A;  4FK4 A;  1S1V A;  3RMB A;  3OYM A;  3K5M A;  3MEC A;  3BDP A;  3ZT0 A;  1S1X A;  4N47 A;  2PY5 A;  3L2Q A;  1TK0 A;  3NCI A;  3S3O A;  1IG9 A;  3AVJ A;  3ZSO A;  1U48 A;  4KHU A;  4DQR A;  3OYI A;  2D0B A;  4C8L A;  1RT1 A;  1IKW A;  4RW6 A;  5C42 A;  2VWJ A;  4PA1 A;  2X74 A;  2G8K A;  1BQN A;  2KZZ A;  4F4K A;  4CGI A;  4M3Z A;  4CJU A;  2QK9 A;  1RBT A;  4KTW A;  2OPQ A;  4AHV A;  2OPP A;  3V6D A;  1MU2 A;  4BE1 A;  4ZTJ A;  3LAL A;  1HQU A;  4DQS A;  1SL2 A;  1KVA A;  3F9K A;  3AVF A;  3HT3 A;  3KKR A;  3KTQ A;  1TL3 A;  5CYQ A;  4CFB A;  4FM0 A;  3RRH A;  2X6N A;  3VA3 A;  4E89 A;  3DLG A;  5J2M A;  3NGI A;  1JXB A;  3OYG A;  2IGI A;  3OYB A;  3ZSY A;  4DTX A;  4CGD A;  1QQC A;  4MQ3 A;  3C6T A;  2YHB A;  3RMA A;  1BIS A;  3AV9 A;  4FJI A;  3NHG A;  1LV5 A;  3H08 A;  4FW2 A;  3RRG A;  4EZ9 A;  4FXD A;  5CZ1 A;  4FJX A;  3CFP A;  4KAZ A;  3E01 A;  1DTT A;  3VQA A;  3VQD A;  1FKP A;  4M45 A;  1T05 A;  4CHZ A;  2G8F A;  4JRQ A;  2KZM A;  2DTU A;  2QXF A;  4FM1 A;  5HLF A;  2ATQ A;  3CFO A;  3V81 A;  1ASW A;  3UIQ A;  4CHP A;  3L3V A;  3LAM A;  3I8D A;  4CFA A;  1KVB A;  2YHA A;  4NYF A;  4FLU A;  4B9T A;  3LPU A;  4KHY A;  2EX3 A;  2GUI A;  1RTH A;  4C8K A;  2ETJ A;  4FJH A;  4CJE A;  2OPS A;  4RW7 A;  3LZI A;  1FXX A;  1W9H A;  5SWM A;  4W5T A;  4DTS A;  3RR8 A;  4LY7 A;  3HO1 A;  3T3F A;  1JXE A;  4HCB A;  4I9L A;  3RTV A;  1W0H A;  2DY4 A;  3DOL A;  4FLW A;  2O4I A;  2B5J A;  3PX4 A;  1U47 A;  4IFY A;  1EP4 A;  1S5J A;  4FJ7 A;  3QER A;  4QCL A;  1RDC A;  3U6F A;  3DM2 A;  4PQU A;  4OVL A;  4RW8 A;  2Q3S A;  1L3V A;  1TAU A;  1JLA A;  3VQB A;  3AVK A;  2D5R A;  3AA2 A;  1S6P A;  4DU4 A;  3L3U A;  3G10 A;  4Z4G A;  3SQ2 A;  2KFN A;  5HRP A;  3DMJ A;  5KRT A;  4K8Z A;  3BGR A;  1ZBL A;  3QIN A;  3RR7 A;  2OPR A;  3AO2 A;  3QIO A;  1VK0 A;  4KTZ A;  4E1N A;  2A1R A;  4F3O A;  3D45 A;  4BWJ A;  4FLZ A;  1RIL A;  3IS9 A;  1TKD A;  3QEP A;  3VA0 A;  4BAC A;  1RT3 A;  1S1U A;  4B08 A;  3O4N A;  4CF9 A;  3VQ5 A;  1NK6 A;  4ICL A;  5JS2 A;  4HUG A;  4E7L A;  3LP1 A;  2XY5 A;  1LW0 A;  4CEQ A;  2BAN A;  2P5G A;  3U3Y A;  4BE2 A;  2PYJ A;  2DFE A;  2XRI A;  4KHN A;  4Z4I A;  4CJR A;  4Y1D A;  3KLE A;  4CEZ A;  4C8O A;  3DLK A;  3V9S A;  1J9A A;  1VSJ A;  1C0T A;  3VQ7 A;  1X9S A;  2E6L A;  1I39 A;  1U49 A;  4R5P A;  1X9M A;  4CGF A;  3TAQ A;  3SV4 A;  4HUF A;  3OS2 A;  3WNF A;  3DI6 A;  1F21 A;  1X9W A;  4DTN A;  2PYL A;  4XIU A;  1NKE A;  4DWI A;  4DTP A;  2HHV A;  2EHG A;  4OJR A;  3U3G A;  4J2A A;  1TKT A;  1BIU A;  2HW3 A;  1QSS A;  1D8Y A;  5T7B A;  2YKM A;  3DYA A;  1UOC A;  4E1M A;  3NH2 A;  1JL1 A;  1C1B A;  1JLB A;  1HQE A;  1RDB A;  4M41 A;  4M3X A;  2Z1I A;  3TR8 A;  3ITH A;  2BDP A;  2ZQB A;  2Z1G A;  2HB5 A;  3TAR A;  5DMR A;  1NK4 A;  2FC0 A;  3SV3 A;  3HK2 A;  4CJK A;  1BCM A;  1JLG A;  4DTJ A;  4CF2 A;  2RKI A;  3TAM A;  4FM2 A;  4FZZ A;  3VQE A;  1KTQ A;  2KTQ A;  1RTI A;  4I2Q A;  4M42 A;  1T7P A;  4KRF A;  1L3S A;  2X6S A;  1C0M A;  1TGO A;  4CIE A;  5E41 A;  5HRO A;  5JS1 A;  3LWL A;  3DLR A;  5SZT A;  3EZ5 A;  3HP6 A;  3KLG A;  4DFM A;  1UA0 A;  4FLT A;  1BL3 A;  3KJV A;  3DRP A;  2D0C A;  2ZD1 A;  4DSK A;  4LH5 A;  5J1E A;  3OYF A;  4GVM A;  1S1T A;  1UAX A;  2DFF A;  3LAN A;  4FJ5 A;  4LSL A;  2LSN A;  4ELU A;  3CM6 A;  5HP1 A;  2JLE A;  2RPI A;  3M8S A;  3PX0 A;  4KPY A;  4LD0 A;  4N76 A;  4CGH A;  4DMN A;  3HPO A;  4CJF A;  1TAQ A;  1JKH A;  4H4M A;  3JSM A;  4CE9 A;  4B9S A;  3AO1 A;  4KB1 A;  2QKB A;  1IKX A;  3AVB A;  5FRM A;  3DOK A;  3T19 A;  4CES A;  4UQG A;  3SCX A;  1TVR A;  3OYJ A;  2X78 A;  4DTO A;  1YTU A;  4ID1 A;  3V1O A;  4Z0U A;  4DLE A;  4OLB A;  3MEE A;  4IDK A;  1IH7 A;  5KGX A;  4FJN A;  4CGJ A;  3M8R A;  1ZBH A;  1ZBF A;  3QIP A;  2FBY A;  3SUQ A;  4N56 A;  4YNQ A;  1EET A;  4NYN A;  3V1Q A;  1NJX A;  3QET A;  1RT7 A;  4EP5 A;  1S1W A;  4KHQ A;  2F8S A;  1RT2 A;  3C94 A;  3NFA A;  4DSF A;  1C1A A;  4W5Q A;  1LWF A;  4IG0 A;  4DFK A;  3IG1 A;  4CF8 A;  5J2Q A;  3TAE A;  2G8V A;  3OYA A;  3L2V A;  3QES A;  3L2R A;  4FZX C;  4O44 A;  1NKB A;  1XWL A;  4B9N A;  5CZ2 A;  4Q0B A;  1GOB A;  1A5W A;  3RMD A;  3KKS A;  4Z4F A;  4E7J A;  3KLI A;  1L3U A;  5C24 A;  2YKN A;  4FCY A;  4FVM A;  2R7Y A;  4ELV A;  4M3Y A;  3QEV A;  2I5J A;  1B92 A;  4Z4E A;  3K57 A;  2VWK A;  2XO7 A;  3HL8 A;  4DS4 A;  1NKC A;  1NK9 A;  4E0D A;  4DSJ A;  3KLF A;  3ASM A;  1U45 A;  3ISN C;  4F2S A;  3G0Z A;  3WNH A;  2HMI A;  3V9X A;  4N5S A;  4FJ8 A;  2HHU A;  2HHS A;  1VSL A;  4BDZ A;  4JS5 A;  3VN5 A;  3OYL A;  3VQ9 A;  2WON A;  3EYZ A;  4E7I A;  4DQP A;  1TK5 A;  2AJQ A;  3V9U A;  4DTU A;  2OA8 A;  4IFV A;  1X1P A;  4CJ5 A;  3AVN A;  3ULD A;  5HBM A;  3KIO A;  3TAN A;  1Z25 A;  3LZJ A;  3OYE A;  1FK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...