1UOCA

X-ray structure of the rnase domain of the yeast pop2 protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
286
structure length
263
Chain Sequence
PPIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIYGIDGDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POP2
publication title X-Ray Structure and Activity of the Yeast Pop2 Protein: A Nuclease Subunit of the Mrna Deadenylase Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 81
structure length 263
sequence length 286
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uocA00
1I39A 2RF2A 3ZT2A 4CEBA 3ULDA 1A5VA 5HRPA 4CJSA 2Y1IA 4PY5A 4I2PA 3F9KA 4HUFA 4CEAA 4B8CA 4E7HA 1SKRA 1EKEA 2HVIA 1KVAA 2FBTA 2HW3A 1SL0A 2ETJA 1TK0A 2VG7A 2G8HA 1J53A 3QEXA 5JS1A 2OZMA 2XY8A 2HHXA 3ZSZA 1X9WA 3TAQA 3QO9A 3WNHA 4CEFA 4O4GA 2HHQA 3KKRA 1J5OA 2X6NA 1KFSA 3S3MA 3D0PA 1Z25A 3HM9A 3SUNA 3L2VA 3V1QA 3CQ8A 2D0AA 1R0AA 1S6QA 4CGGA 1NK9A 4CGHA 3ZT0A 3OYNA 1RT4A 1NK0A 1W9HA 4KB0A 4FJJA 4KTZA 4QOZB 3AVHA 3M8SA 4Z4CA 2FBYA 1NJYA 2OPRA 4MFBA 2GV9A 3NH0A 1UWBA 4G1QA 1CXUA 3S3OA 3DLGA 2KTQA 3LALA 3AVFA 1QQCA 4OJRA 3DRRA 4M3TA 2DFEA 4QAGA 3SV4A 3OYAA 3ZT4A 4FJKA 1EX4A 1YTUA 5FRNA 4UQGA 3V9SA 4DS5A 3KTQA 4OLAA 3MXMA 4IFYA 4AHUA 3LANA 1KLNA 3I0RA 4HUEA 1XHXA 3U3GA 1L3TA 2OA8A 1LWFA 4FJMA 4HUGA 3VQ6A 1EP4A 1T03A 4FCYA 4W5NA 4C8NA 1BIZA 4F2SA 5KGXA 4LD0A 1U48A 4KHUA 1NKBA 3CFOA 2KFNA 4PWDA 4F2RA 4JS5A 2RN2A 3ZT1A 3K5LA 3SQ4A 3NGZA 4BDYA 4DSJA 4M3UA 4ZTFA 1SL1A 3LWMA 4FXDA 1BHLA 3PO4A 1TKTA 1WAJA 4J2BA 3KLEA 3DLRA 4M3WA 1KCFA 4CJUA 2ZD1A 4FK4A 2HVHA 3C6TA 4FZYA 4ID5A 3QESA 3RMCA 1SKWA 3RR7A 3IG1A 1FXXA 4FW1A 2PZSA 1C0TA 1RCHA 1VSKA 3OVNA 2HB5A 3AV9A 2VWJA 4I9QA 3HSTB 1RBRA 5HBMA 4DTUA 4IBNA 3TARA 2WONA 1S1UA 1REVA 3AO2A 4DTOA 4C8LA 4FVMA 1QSLA 3QIOA 3HPHA 3HYFA 4CF9A 4DLEA 2P5OA 2XRIA 4O5BA 3MAQA 4M3XA 3THVA 2G8FA 1NJWA 4I7FA 1RT7A 4NCAA 4FLYA 3BDPA 4ELUA 3TABA 3B6OA 2I5JA 4GVMA 3VQQA 3PO5A 3VQBA 3QINA 1QSYA 1WN7A 2NUBA 3VQ8A 5K14A 3RMDA 2B5JA 3SJJA 4FJ7A 1X9SA 1HYVA 3L2QA 3PX4A 4CJVA 1N5YA 5E41A 3AVBA 2VWKA 2BE2A 1LAWA 1EXQA 4DF8A 4Q0BA 3HP9A 4Z0UA 2FBVA 4JS4A 3LP1A 1UA1A 1KRPA 4PUOA 3OY9A 4CJQA 3SCXA 1S1VA 4CEQA 2F96A 2X78A 4RW7A 3O3FA 2BGGA 2YNFA 3OYCA 5C25A 3AA5X 4DF4A 2ZE2A 1F21A 3T1AA 3NH2A 4HCCA 3LWLA 4EP4A 1SL2A 4KPYA 2DTUA 2OPPA 4I9LA 3K2PA 3AVKA 4RW8A 4B8AB 3KLIA 3RRHA 4CGIA 3NF9A 3AVCA 4DFPA 1IO2A 5J2NA 2X6SA 3CFPA 4B9NA 1T05A 3VQ7A 4AHCA 4BE2A 3QEVA 1RBSA 1ASUA 1KLMA 4XIUA 1BQNA 4FJIA 5T7BA 1SUQA 1D9FA 1FKPA 1ITGA 3OYLA 3NGIA 4HTUA 3OS0A 3DLBA 4FM2A 3AVAA 2RPIA 3O3GA 4CK1A 3LDSA 1TGOA 5DMRA 3RR8A 2E4LA 5FRMA 3PY8A 4FLZA 5KGWA 1WNSA 3KLHA 4ELTA 4FZZA 4CHZA 3HT3A 3VQPA 3L2RA 1WSFA 3SYZA 4FK0A 3VQEA 3HK2A 1C0UA 2OZSA 1QE1A 3ZSVA 3NH1A 4NCBA 3LP3A 1BIUA 1U04A 3EYZA 2D5RA 2HMIA 1NKEA 3I8DA 2R7YA 2QK9A 3RTVA 4DMNA 5CZ2A 4C8OA 2HHTA 1I3AA 2OPQA 4DTPA 4GW6A 3NF8A 4CHYA 4QCLA 3TAPA 1TAQA 1VSJA 2YNGA 4CEOA 1RILA 4CCHA 2DFFA 4CIFA 4E7IA 4M42A 1JLFA 1VK0A 1KFDA 1T8EA 3DRSA 4C8MA 3BGRA 5EU7A 4AHRA 3A2FA 1SKSA 3OJSA 3SNNA 3HVRA 3AA2A 4BE1A 1RBUA 3CM5A 3OYMA 3O4QA 4DFJA 2F8SA 1YTAA 1UA0A 3P1GA 1LAVA 1G15A 4KFBA 2AJQA 3OYJA 3PV8A 3ZSRA 3K5MA 5CYQA 3ITHA 1GOAA 1VSDA 1WLJA 4DQQA 1DTTA 1HYZA 1VSHA 4KV8A 3LPTA 1FKOA 5J2MA 4M41A 5JS2A 3DLHA 1JLQA 4CEDA 3AO4A 3NAEA 4FLTA 4DSEA 3HP6A 1C6VA 1TVRA 3U3YA 2RKIA 2IGIA 4H4MA 1HNIA 4E7LA 1JLAA 1S9EA 1IKXA 1YVUA 3HPOA 4BACA 4DTNA 2XHBA 1EETA 2B4JA 1NJZA 3RWUA 2O4GA 1ASWA 4LY7A 1RDBA 3VN5A 1JL2A 2HHWA 4J2DA 3LZIA 2Z1HA 1WSJA 2D0BA 1C0MA 5FDLA 3P83D 3NF7A 4AH9A 3SZ2A 4K8ZA 1BI4A 1HQEA 1RTIA 2IAJA 4OVLA 4CJ5A 4KI4A 3MEDA 3SI6A 3TAFA 1RTDA 4F3OA 4YNQA 3DLEA 2F8TA 2HNYA 3AO1A 3QEIA 3SQ0A 1VSFA 5J2PA 1JLBA 3UIQA 2KFZA 1HRHA 3DOLA 4IFVA 3ZSYA 4ZHRA 1JLCA 3OYBA 1QSSA 3KIOA 1KTQA 3CM6A 3VQAA 1KSPA 2FC0A 3IS9A 1NK8A 2HHUA 4M3RA 4YFUA 5C24A 3M8QA 1VRUA 5KRSA 3C95A 1SV5A 2E6MA 4IG3A 4CE9A 4E1MA 3K5NA 2EHGA 3OS2A 1DTQA 3TAMA 2G8WA 1NK5A 4FJGA 4O0IA 3T19A 2JLEA 1X1PA 4CHQA 4CF8A 4IDKA 1JKHA 3DOKA 4CJTA 4OPJA 2IOCA 4DS4A 4W5QA 1U4BA 3OYKA 1D9DA 4DSKA 5KRTA 3F73A 5HLFA 3AO3A 2OYQA 2Y1JA 3IRXA 4AILC 4LSNA 4BDPA 4FJ9A 1VRTA 4CIGA 1NK7A 4CF0A 2GUIA 2QXFA 3K58A 4BDZA 1WSIA 4KHSA 1JL1A 1RDAA 1ZBFA 4FJNA 4N41A 2LSNA 1C1CA 4C8KA 4NYNA 1RT6A 1DLOA 3TR8A 4CJLA 1J9AA 1HJRA 3FFIA 3V81A 3AVLA 5SZTA 1HQUA 1S9GA 3RRGA 2XY7A 3S3NA 3KD1E 2VG5A 1IH7A 3E01A 4CJKA 4CECA 3V9UA 4DTRA 4Z4EA 2JGUA 4DTXA 4N5SA 4W5RA 2KW4A 3HVTA 1XC9A 4AHVA 2IC3A 2KZZA 4HVJA 3NCIA 3LAMA 4K8XA 2WOMA 3ASMA 4Z4HA 1FK9A 3SUPA 1ZYQA 3AVMA 3QIPA 4KHNA 2P1JA 4H8KA 3MXJA 3OYHA 3EY1A 1BL3A 1HPZA 3QEPA 3ALYA 3DI6A 4RW9A 4DTMA 4DU4A 2IS3A 4FW2A 1L5UA 4CGJA 5HRNA 4DFMA 2YKNA 1JLEA 1UOCA 3PUFA 3MXIA 3KK3A 4OGEA 4TSXA 4CJFA 5KTQA 1L3UA 1IKYA 1GOBA 4DQIA 4DSIA 4BE0A 2X74A 3TI0A 1Q8IA 4CJPA 4Z4GA 4CHNA 3K5OA 3HPGA 1KVCA 4NCGA 4B3OA 1J54A 4CJWA 4CERA 3HO1A 3V9WA 2VG6A 3LP2A 4CEEA 3AVJA 4CIEA 3T3FA 3CG7A 3QNNA 3SUOA 5HROA 3I0SA 3L2WA 4KHWA 3V4IA 2YHBA 2W42A 1RDDA 2Q3SA 1VSIA 4J2EA 2DY4A 1LWEA 4CJEA 4E7KA 2G8KA 1BCOA 4KTWA 4CF1A 3O3HA 2GBZA 4RG8A 4BWMA 3VQ4A 4CGFA 4HHTA 3SV3A 3AVIA 1U47A 1S1TA 3DLKA 4GMJB 2YNIA 3OS1A 4F4KA 5C42A 1S1WA 4DQPA 3OJUA 3WNEA 4Y1DA 1NJXA 3AVNA 1IG9A 4JRQA 4WE1A 1BISA 4LSLA 2FBXA 1JXBA 3O4NA 4RW6A 2PYJA 3NFAA 4FLVA 3KLGA 4KO0A 4B9VA 4HCBA 3ZSXA 3VA3A 1ZBHA 5CZ1A 4OKKA 4N47A 3L3UA 1JXEA 4FM0A 4CJ4A 3KK2A 2XY5A 1TL3A 3QETA 3HJFA 4NYFA 2E6LA 3NBPA 3LPUA 3NDKA 1W0HA 4AHTA 3M8PA 4ID1A 4FJHA 1XI1A 4KTQA 4CESA 1VSMA 5J2QA 3OYEA 2P51A 5I42A 1U49A 4FLWA 2KQ2A 3V1OA 3LAKA 5FROA 3KD5E 1L3VA 2YKMA 3NHGA 1IKWA 4F8RA 1O1WA 2BANA 2XO7A 1K6YA 1TK5A 3CFRA 4R5PA 2YHAA 3WNFA 4E1NA 3ZSQA 3L8BA 3OYFA 1Q9XA 2YNHA 1XWLA 4IG0A 3SPYA 4B9SA 4H4OA 3VQ5A 5I3UA 3DRPA 4E19A 3ISNC 1RTJA 4CK2A 5J1EA 3KJVA 3V1RA 4B9MA 4LH5A 1TAUA 1RNHA 4M3YA 4IKFA 2P5GA 4M3ZA 1CZBA 1RT1A 1LWCA 1RTHA 4KB1A 1S5JA 3QEWA 1MU2A 1S1XA 1LW2A 1B92A 3ZT3A 1TKXA 5SWMA 3SPZA 1L3SA 1Q9YA 3M8RA 4CFDA 1C1BA 4N56A 4B9TA 1ASVA 4E7JA 1WSEA 3V9XA 2HNDA 4F3TA 1A5XA 3K57A 1TKDA 4L8RB 4FJLA 1D8YA 4FJ5A 3KK1A 4CHPA 4N76A 4CJRA 3RMAA 4DG1A 1CZ9A 5HP1A 1CXQA 2IDOA 1BI4B 4Z4FA 3TWHA 4CEZA 4OPKA 1ZBUA 3L2UA 2G8VA 4KREA 1BCMA 4OKEA 1A5WA 3IAYA 4EZ9A 2HHSA 3ZCMA 4M45A 4ICLA 2ZQBA 4CFCA 3V6DA 4DSFA 1JLGA 4Q5VA 2QKBA 4MQ3A 2DFHA 1N6QA 2A1SA 4W5TA 2Z1IA 4Z4IA 5KI6A 4EP5A 1NKCA 4B08A 1RBTA 3VQDA 4FK2A 4OLBA 4O44A 4FM1A 4AHSA 2YV0X 1NOYA 1C1AA 3VQCA 1XHZA 5CYMA 4DLGA 1HMVA 1NK4A 3OYIA 2QKKA 1WAFA 3CYMA 4BWJA 3S9HA 4DWIA 2D0CA 4O55A 1HNVA 4PA1A 4RW4A 1IKVA 4B9LA 1TV6A 1NOZA 2BDPA 5HRSA 2G8IA 4EZ6A 3EZ5A 1BGXT 4KI6A 3DMJA 3DM2A 3JSMA 3PX0A 3HL8A 3K59A 4CFBA 3JYTA 3G0ZA 4DFKA 3NE6A 3ZSWA 1BQMA 5HRRA 1CLQA 3NGYA 4O0JA 3DYAA 4KAZA 1HYSA 1S6PA 4DTSA 3KKSA 1X9MA 3U6FA 3PX6A 4OKJA 1VSEA 3SQ2A 2A1RA 1B9FA 2HHVA 3MEEA 3ZSOA 4E0DA 3TANA 3P5JA 3QNOA 3HXMA 3NF6A 2B6AA 4J2AA 3AVGA 3VQ9A 3MECA 1Z26A 3G10A 3LP0A 4OGCA 4CK3A 3V9ZA 4LH4A 1QTMA 4DTJA 3D45A 4FJXA 4B9UA 4ELVA 4FLXA 1QS4A 4FJ8A 3C6UA 1VSLA 3MEGA 3AA3A 4JLHA 4DU3A 1T7PA 1GOCA 1RT3A 1ZBIA 1RDCA 1RT2A 3C94A 4DQRA 1WSHA 3TAEA 3H08A 4CJ3A 2OPSA 4KKOA 4W5OA 1RBVA 3B6PA 4E3SA 2KZMA 4FZXC 1TL1A 2ITGA 4DQSA 2Z1GA 5DK5A 4E89A 3OYGA 1TK8A 4KHQA 3L3VA 4Y1CA 2EX3A 4CF2A 1B9DA 2Z1JA 1RT5A 4JRPA 3SQ1A 2PY5A 2O4IA 1KVBA 3TAGA 2G8UA 3KLFA 5D3GA 1ZBLA 3OYDA 4KHYA 1UAXA 2ATQA 1Y97A 1YT3A 2HNZA 3LZJA 4DU1A 2XY6A 3AO5A 1LW0A 3QERA 4CGDA 1WSGA 4DSLA 3QLHA 2PYLA 1D5AA 1LV5A 4I2QA 1U45A 4FYDA 4CHOA 3RMBA 4KRFA 3SUQA 4PQUA 4ZTJA 3VA0A 4CFAA 4FLUA 5CY4A 1NK6A 1TKZA 1QHTA 3AA4A 3WNGA
chains in the Genus database with same CATH superfamily
3ZT2A 5HRPA 1OKJA 4E7HA 1KVAA 1SL0A 1QZ5A 3LL3A 4QS9A 3ZSZA 1X9WA 4R79A 4CEFA 2VQEK 4JI2K 4DR7K 1GLDG 1KFSA 3SUNA 1YIJN 3L2VA 1S6QA 3T1YK 4B1UB 4MFBA 2GV9A 4BC2A 1VQPN 2P9NA 3K0SA 4JI3K 3I55N 4DR3K 1NGEA 2FXUA 3LALA 3WXIA 1QQCA 3SV4A 3ZT4A 1YTUA 4DS5A 2QXLA 3KTQA 3MXMA 3I0RA 3U3GA 1EP4A 1T03A 1VQ4N 4W5NA 4C8NA 4MLHA 5B8HA 5C0YA 1NKBA 2RN2A 1GLFO 4NXMK 1EO1A 1SAZA 3LWMA 4DV6K 4BRGA 4M3WA 1KCFA 4CJUA 2ZD1A 4FK4A 3C6TA 3QESA 3RMCA 3IG1A 1FXXA 2NRWA 3QDKA 3AV9A 4CBWA 4IBNA 2WONA 3AO2A 3GOIA 3E9OA 5GAHP 2XRIA 1NJWA 4I7FA 1RT7A 4NCAA 1FJGK 4BRFA 3PO5A 4AM6A 3UKRA 1Z6RA 3G71N 4CJVA 2BE2A 1LAWA 4Q0BA 3HP9A 1UA1A 1V4SA 3LP1A 3L6QA 3C6AA 4CJQA 3SCXA 4RW7A 1F21A 3NH2A 4GKJK 3G6EN 5M1OA 4EP4A 1OH5A 1N33K 4KPYA 2DTUA 3CJ9A 3AVKA 4CGIA 5J2NA 3AVCA 1IO2A 2X6SA 1T05A 2AP1A 4XEIA 4GY2B 3KWIA 4B3MK 3QEVA 1RBSA 1EWRA 4X65K 1FKPA 5I9EB 5AR0A 2P9LB 2RPIA 4WFAL 1GLJO 4FLZA 1T6DA 5KGWA 5AZIA 1C0UA 3SAGA 3ZSVA 4NCBA 3LP3A 2ZM6K 2R7YA 4DMNA 5CZ2A 1I3AA 3QB0A 5F1XA 2BUPA 2VWBA 2GWKA 4QCLA 3SLCA 2HBKA 1VSJA 4DQ8A 4DV0K 3DRSA 4C8MA 4KH4A 4AHRA 1SKSA 5GINA 3EKSA 4BE1A 4DFJA 3OYMA 5EVZA 3O4QA 4DUZK 4KFBA 1OH8A 2AJQA 2NRRA 4AM7A 2F9WA 3ZSRA 3K5MA 2V7YA 3ENBA 3ITHA 5AQXA 1GOAA 1VSDA 2QWRA 4A62A 3J7YP 3LPTA 2E1ZA 1JLQA 1OH6A 5GAGP 4JI4K 4FLTA 4DSEA 2O8BB 1C6VA 1TVRA 4H4MA 4E7LA 1JLAA 3KVGA 4JI8K 3I33A 2WFBA 1ASWA 5M1NA 3SAFA 3O4WA 3CMAN 3D7EO 3LZIA 5AQPA 4MDBA 1QZ6A 4K8ZA 1BI4A 3P39A 4CJ5A 1RTDA 3O6WA 3ZETB 4WQ4C 4BR0A 3WEEA 1VSFA 3CD6N 3UIQA 5EXWA 1JLCA 2VYPA 4B1YB 1KSPA 2Q1NA 2ZJPL 5C24A 4B1WB 4IG3A 1DEJA 3AY9A 4CE9A 1YJNN 3ATUA 4H03B 2EHGA 3ZX3A 5AQKA 1KAZA 4CHQA 3DOKA 2IOCA 4RWTA 2QWOA 3FZLA 4MO5A 4DSKA 3AO3A 1E3MA 3IRXA 4AILC 2YCHA 4LSNA 1NK7A 3TU5A 1J6ZA 2GUIA 2QXFA 1ZBFA 1MDUB 2LSNA 3G4SN 4NYNA 3EE8A 2I7NA 2NRTA 3AVLA 1HQUA 1S9GA 3ZEUA 4ILHA 4X66K 2KZZA 3LAMA 1RDUA 3OBYA 3OYHA 3RVCA 1HPZA 3ALYA 1K8AO 3DI6A 4RW9A 4DTMA 3CJCA 3UKUA 3AGRA 2YKNA 1JLEA 3VGLA 5KTQA 4DQIA 1ATRA 4DSIA 1Q8IA 4CHNA 3HPGA 4H0VB 2GX9A 4FSVA 3HO1A 4DV5K 3VGKA 4CEEA 3AVJA 3I0SA 1N8RO 3V4IA 4KHWA 2YHBA 1U2VB 3CETA 5E26A 4YOXA 3R1XA 4J2EA 4CJEA 4JKAA 4CF1A 4HHTA 3AVIA 3R9PA 4WQ4A 5C42A 1NJXA 1IG9A 1X9JA 4JRQA 4WE1A 3T1HK 1BISA 4LSLA 2FBXA 3BY5A 3OTOK 3CCUN 4YOYA 1RGIA 4KO0A 3IUCA 3ULEA 3OBWA 3QETA 2GWJA 1W0HA 3CCMN 1VSMA 5I42A 4IFEA 3MMVA 2KQ2A 5FROA 2HF3A 3BP8A 1GLEG 1O1WA 2BANA 4U67L 3CCSN 4FWSA 4E1NA 3OYFA 1Q9XA 2YNHA 4H4OA 5AQFA 4E19A 3CJBA 3ZX2A 4LH5A 2P5GA 4WFNL 4M3ZA 3A5MC 1LWCA 3ENHA 1L3SA 3SPZA 4BR7A 3NVKA 1JJ2M 3CCJN 4HWIA 1ASVA 4RTFD 4E7JA 3V9XA 1A5XA 4FJLA 5TKYA 1D8YA 5BPLA 4CHPA 1NMNA 1CXQA 2IDOA 1BI4B 3R3LA 4CEZA 1ZBUA 3VENA 2HHSA 3NMUA 4EZ9A 3ZCMA 1E4FT 4M45A 3DLLL 2CH6A 4MQ3A 2DFHA 5KQ8A 4Z4IA 1X3MA 4BC4A 4EP5A 1NKCA 3U9DA 3BUZB 1VQNN 4FM1A 1NOYA 1HLUA 3HSCA 4H5RA 3KZBA 2QKKA 1W7AA 1TYQA 3H3NO 4DWIA 1HNVA 1IKVA 4B9LA 1BGXT 4JYAK 2RE2A 3DM2A 3JSMA 3PX0A 4B9QA 3G0ZA 3ZSWA 3BF3A 4O0JA 2P9SA 1JCEA 1X9MA 4MLEA 3O1BA 3C7NB 3SQ2A 1YHQN 2HHVA 4CZLA 3ZSOA 2Q36A 3QFPA 1SZ2A 1ZBSA 1V4TA 4M7XA 3MECA 2OANA 4H5TA 4JI7K 2W41A 3C6UA 3FE1A 1T7PA 4DU3A 1GOCA 4YOUA 1ZBIA 4YDUA 1RT2A 1HX1A 1G99A 4DQRA 2P9UA 5AQOA 2OPSA 2E1YA 1RBVA 3B6PA 2E5LK 4FZXC 1YUWA 3OYGA 2EX3A 4EIAA 4BRKA 4FWPA 1KC8O 1KVBA 1IJJA 4XH5A 3H46O 3L4QA 1ZBLA 5D3GA 2YHWA 1UAXA 3KK7A 1Y97A 1YT3A 4JKCA 5IWAK 4KHYA 2O8CB 3VPZA 2YHYA 3QBWA 2PYLA 1LV5A 4B3RK 3CPEA 4JD2A 3H6EA 3RMBA 3CERA 1GLBG 3ZX0A 1QHTA 1NLVA 4N56A 2RF2A 4H0PA 4JKGB 4CEBA 3ULDA 4CJSA 2VGMA 3ID6A 2ETJA 2G8HA 3QEXA 5JS1A 3WT0A 3IKMA 3TAQA 3WNHA 2X6NA 1R0AA 3V1QA 4CGGA 1RT4A 1NK0A 4JI0K 4KB0A 4QOZB 4BVPA 4Z4CA 2OPRA 2NNWA 5BPNA 5LMUK 3NH0A 1VQ6N 4OPHA 2P9KB 4OJRA 4M3TA 2DFEA 4QAGA 1XMOK 4FJKA 1EX4A 3CC2N 5FRNA 4OLAA 5AQGA 3LANA 4QS8A 2OA8A 2ZWHA 3NVMA 3VQ6A 1U48A 3VEYA 4KHUA 2YHXA 4PWDA 4F2RA 4LF5K 4GV3A 4FXDA 3J7AP 1TKTA 3L0QA 3VF6A 4GV9A 2HVHA 3T69A 2PBDA 3G25A 4FW1A 1RCHA 2HB5A 4EHUA 3HSTB 1RBRA 4DTUA 3TARA 4O5FA 1U6ZA 4DTOA 3J8AA 4FVMA 4WCEL 3EZWA 4CF9A 2ASPA 2P5OA 3MAQA 2VCPA 1VQ8N 3MN5A 4CZKA 3BDPA 4ELUA 3TABA 2I5JA 3LDNA 3LDPA 4GVMA 3VQQA 3MN6A 3OHRA 1ILYA 3HBTA 3VQ8A 2QWPA 1I94K 2O8DA 3RMDA 5JVGL 4ILGB 3SJJA 3M3ZA 3GL1A 5C2FA 3FZFA 5E41A 2VWKA 4DF8A 4NB4A 4DR2K 2EWSA 3OY9A 2W6KA 3THYA 4CEQA 4FWKA 3O3FA 2BGGA 2YNFA 3OYCA 5C25A 3JXUA 3T1AA 4X62K 1SL2A 5FPEA 2OPPA 2GUPA 4B8AB 4DFPA 3KLIA 4FPBA 2UUAK 2IIRA 3CFPA 3THXA 4B9NA 2GTDA 2QI2A 1ASUA 1BQNA 3E1YA 1ITGA 2UXBK 3NGIA 3O3GA 4IOCL 3LDSA 3PLAA 1TGOA 5DMRA 3KLHA 1YI2N 4CHZA 2D1KA 3VQPA 3SYZA 4FK0A 3VMFB 2HMPA 3RSEA 1QQMA 2PAVA 1BIUA 5BRDA 3EYZA 2D5RA 2HMIA 4C8OA 4C1NI 4ISGA 3ID8A 3D2EB 1DGKN 4CHYA 2YNGA 1RILA 2DFFA 3UE5A 1VK0A 2HOEA 3BGRA 5EU7A 3A2FA 3D2FA 3CM5A 1LAVA 1YJ9N 2CGJA 3O9UA 3CF5L 1M1KO 1P8ZA 1WLJA 1T3VA 4DQQA 1DTTA 1HYZA 3PIOL 4KV8A 4M41A 4CEDA 1SQKA 3AO4A 3NAEA 2RKIA 3K9KA 4JK8A 4DV7K 1S9EA 1IKXA 1YVUA 1EETA 3THWA 2QWMA 4XH4A 4CBUA 2O4GA 1RDBA 2HHWA 4J2DA 3FR0A 4QS7A 4C23A 3I56N 3P83D 3NF7A 1HQEA 1NBWA 3L4IA 5FPNA 4YNQA 5J2PA 1HRHA 4IFVA 2WTUA 1KTQA 3CM6A 3VQAA 3IS9A 3R8EA 2HHUA 3M8QA 5AQUA 3C95A 4K42A 3T7ZA 2E6MA 1NJIO 3J80O 4E1MA 2FF3B 1XNQK 3TAMA 2G8WA 4O0IA 4KBOA 4DB3A 4CF8A 1JKHA 4CJTA 4DS4A 1U4BA 4IJNA 5KRTA 3F73A 3EN9A 3GBTA 4BDPA 4FJ9A 5A2QO 1D4XA 4CF0A 5LY3A 1JL1A 1RDAA 3TSUA 2UUCK 4LC9B 3TTFA 4FJNA 4C8KA 5LJVA 1J9AA 4FOEA 4JK9A 3RRGA 2WUSA 2XY7A 3S3NA 4DUYK 1IH7A 1O13A 4DTXA 4N5SA 4DV3K 2KW4A 4DKWA 3TSQA 5KPTA 2WOMA 3FZMA 3LM2A 4Z4HA 4KHNA 5BN9A 3AVMA 2E88A 4FWLA 4FW2A 1L5UA 2E2NA 5HRNA 4DFMA 4I6MA 2W40A 3PUFA 5JMVA 5H1SQ 2CH5A 3DXKA 3DXMA 4JI6K 2X74A 4EHTA 4BE0A 3TI0A 1NNEA 4GKKK 3K5OA 1KVCA 4NCGA 4B3OA 3F2KA 4CJWA 2DPNA 2VG6A 2CGKA 3LP2A 1QVFM 3QNNA 1QVGM 2O8EB 4IO8A 1RDDA 5F2RA 1NGCA 4L3QA 4BR4A 4BGBA 1VSIA 5M1FA 3O08A 2A3ZA 4CI6A 2DY4A 1CLQA 3WXJA 3O3HA 5AZJB 2FSJA 1S1TA 4GMJB 5TKWA 3OS1A 4F4KA 3OJUA 3WNEA 2NRZA 1FW6A 4RW6A 4AF1A 3QICA 2Q2RA 4IWVA 4ISEA 3ZSXA 3VA3A 3HM8A 1XQSC 1T44A 5LMNK 1VQ7N 3NBPA 3LPUA 4BRMA 5JLFA 4FJHA 3KWGA 4O8UA 1XI1A 4CESA 4DR4K 1U49A 3KD5E 2YKMA 3NHGA 4BQLA 1IBLK 3BZKA 4CVNE 4BY9C 1TK5A 2V51B 2YHAA 1EWQA 4A5BA 5J1EA 3ISNC 1RTJA 4CK2A 2P9NB 1RNHA 4M3YA 3CCEN 5LJWA 3PIPL 3VEWA 1CZBA 1RT1A 5KPZA 1X3NA 4KB1A 1S5JA 1S1XA 1LW2A 1K8KA 4CFDA 1C1BA 2QEXN 4F3TA 2BH1A 2IVOA 1TKDA 4CJRA 3R6MA 4DG1A 3RMAA 5HP1A 2G8VA 4KREA 1BCMA 4OKEA 1A5WA 2P9PA 3WXLA 2ZQBA 3VEZA 4NO7A 4Q5VA 1N6QA 2KKZA 3SBTA 4FK2A 4BRAA 3CQYA 2E2OA 5CYMA 1HMVA 3VGMA 1WAFA 5ADXH 5C2DA 5C15A 3S9HA 3H45C 4IDHA 2D0CA 5C12A 1ZXOA 1S22A 4RW4A 1TV6A 4CZJA 2KHOA 3H1VX 4DCHA 3NE6A 4DFKA 3NGYA 2QTDA 4GV6A 3UKRB 1NWKA 3U6FA 3PX6A 4IOAL 5HOOA 3FFKB 2A1RA 1B9FA 4E0DA 4A2AA 4CZFA 3HXMA 3OW2M 1Z26A 3LP0A 5M1PA 1QTMA 4LH4A 2OTLN 1T6CA 2GEMA 2Q31A 4FJXA 3MN7A 4FJ8A 1K9MO 4G9ZA 1RDCA 1JCGA 3TAEA 3H08A 4JHDA 4W5OA 4A5AA 4BG8A 3C6HA 4DQSA 2Z1GA 5DK5A 1RFQA 1NGBA 5JICA 1E4GT 4Y1CA 4CF2A 1TK8A 3TAGA 3OYDA 3DXMB 2ATQA 2XY6A 4ILJA 3AO5A 1LW0A 1WSGA 1IBMK 4DSLA 3QLHA 1D5AA 1YF5L 3AAQA 4I2QA 4FYDA 5AZIB 4KRFA 4ZTJA 1VAZA 4DV2K 3D45A 4CZIA 3WNGA 4DSFA 1I39A 2F8TA 2Y1IA 1A5VA 1VQKN 4I2PA 4HUFA 1BOTO 2HSTA 1YXQA 4B8CA 1EKEA 3WXMB 4AQYK 2VG7A 1J53A 3O9SA 3VEXA 4O4GA 1Z25A 3HM9A 5HL7L 3CQ8A 1NK9A 1DT9A 4OO1J 2F7TA 4KTZA 3MWTA 1J5EK 2UXDK 3SAHA 3M8SA 2FBYA 3VEVA 2P9IA 3AARA 1LCUA 4G1QA 1CXUA 4BQZA 3DLGA 4DHYA 3DRRA 3CC4N 3OYAA 4MO4A 5AQJA 4UQGA 3V9SA 4IFYA 4AHUA 1KLNA 1MA9B 1XHXA 4FJMA 1GLLO 4FCYA 3W0LA 4F2SA 1Y64A 3O9QA 5KGXA 4LD0A 1GLCG 3IDHA 4DV1K 4FWNA 3GE1A 3ZT1A 2ZF5O 3SQ4A 4BDYA 4ZTFA 1BHLA 2CGLA 1WAJA 1IG8A 3WEEB 3KLEA 3EE9A 2A42A 1SKWA 3RR7A 1MWMA 4C1NK 1VSKA 5LL6Z 2VWJA 3LM9A 1VHXA 1ZC6A 2GELA 1QSLA 3QIOA 3HPHA 4O5BA 3IMXA 1N36K 4Z94A 2G8FA 4M3XA 3QBXA 4CJ7A 3VQBA 3TTDA 3BF1A 1W2BM 1OVQA 2QWQA 1NGGA 2NLXA 5GIOA 1QSYA 2NUBA 2A6AA 4BROA 2B5JA 3U8XA 2Q0UA 1HYVA 4F9OA 1N5YA 3AVBA 4YORA 3H3OB 1EXQA 4ISFA 4J8FA 2FBVA 4JS4A 3C0BA 3ZEUB 1S1VA 2F96A 3AA5X 4OPAA 2ZE2A 3CHWA 2PFUA 4B3SK 3KHYA 3K2PA 3NF9A 3HOTA 2E2QA 5FPDA 4AHCA 1YJWN 3UKUB 1KLMA 1SUQA 4HTUA 3DLBA 2O8FA 1BO5O 4FM2A 3DWLA 3PSIA 1Q18A 4BGAA 3RR8A 3QFUA 2E4LA 2QM1A 4FVUA 1WNSA 1VQ9N 4A61A 4ELTA 5ADXA 3L2RA 1WSFA 4CBXA 3HK2A 4DR1K 3CJAA 3NH1A 4FOIA 1NKEA 3I8DA 2HHTA 4DTPA 2OPQA 3LDOA 2NZTA 4EAHD 1TAQA 3Q7CA 4CCHA 4E7IA 4CIFA 3M6GA 3FGUA 1QQNA 3HZ6A 4IXCA 2E2PA 2WBNA 3HVRA 5MLCQ 1IBKK 4OX9K 3U9ZA 2F8SA 5AFUH 1UA0A 3P1GA 3O1WA 1JCFA 1G15A 1WBBA 3VF4A 3OYJA 1C0GA 5CYQA 3CPWM 1VSHA 4CZGA 4JN4A 3DLHA 3ULEB 4PKHA 3TTCA 3HP6A 1HNIA 3SBGA 3HPOA 4BACA 3CJ1A 2XHBA 4CD1A 3Q7BA 3O9TA 4DV4K 1NJZA 4JI5K 3GDQA 3LDQA 4LY7A 3SMPA 2KLAA 2Z1HA 3UB5A 3N4PA 2D0BA 3P31A 4AH9A 3SZ2A 1RTIA 2IAJA 3MEDA 5BR8K 4F3OA 1NGDA 2HNYA 4WF9L 3AO1A 3QEIA 3EL2A 2W6LA 1JLBA 3ZSYA 4ZHRA 2NRHA 1QSSA 4DR5K 3VTHA 1NK8A 1BWFO 4M3RA 1VRUA 5KRSA 4X64K 3EKUA 1N32K 3K5NA 4K0KK 2V52B 3OS2A 4FJGA 1NGJA 3FZHA 2JLEA 1X1PA 2HHHK 2VGNA 1Q86O 4OPJA 4BRPA 5CE3A 1NGHA 4NLCA 5HLFA 2Y1JA 4CIGA 4WYBA 3K58A 4BDZA 1WSIA 4KHSA 4LFBK 3TR8A 5C10A 4CJLA 3FFIA 4RCHA 3TSPA 3V81A 3HOSA 4Z4EA 4CJKA 1TYQB 4CECA 3O9RA 4H5NA 5AQQA 3I8BA 3PSFA 4AHVA 4HVJA 3NCIA 4K8XA 1ZYQA 3QIPA 4H8KA 4GVEA 3EY1A 2D0PA 2P9SB 3GG4A 2IS3A 1HNZK 3MN9A 1NG9A 1UOCA 3MXIA 4BVOA 2P9LA 3KK3A 3AAPA 4CJFA 2IVPA 1L3UA 1KQSM 1IKYA 1GOBA 4CZEA 5BN8A 3C65A 4UY8O 4LF6K 4JNEA 4DR6K 3V9WA 4BRLA 3T3FA 5DM6L 4NXNK 3CI5A 2W42A 3BEXA 2P9UB 1K73O 2Q3SA 2OCEA 1LWEA 3HRGA 4E7KA 3MWPA 1BCOA 3SV3A 4J2AA 4IEIA 2GBZA 4CGFA 4BWMA 2Q97A 1U47A 1OH7A 3DLKA 4DQPA 4Y1DA 1RDWX 3AVNA 4K43A 1JXBA 3O4NA 1YITN 3W3DA 2PYJA 4FLVA 3KLGA 2YJEA 4B9VA 4JD2B 3L3UA 4CJ4A 2O8BA 3HJFA 4JK7A 2E6LA 4AHTA 5IT9O 4BRDA 5J2QA 3OYEA 1BA0A 4PL7A 3LAKA 2QWLA 2XO7A 5JVHL 1N34K 3CFRA 3SJHA 5FPMA 2A41A 3WNFA 3ZETA 3SPYA 1XWLA 4IG0A 1WB9A 2FLOA 5AQVA 3F9MA 3DRPA 1TAUA 1KAXA 1VQ5N 3QMLA 1MU2A 3ZT3A 5SWMA 1TKXA 1Q9YA 1VQMN 3HI0A 4JKDA 3VOVA 1R59O 4L8RB 3KK1A 1CZ9A 4BR2A 3TWHA 4OPKA 2ZGYA 4ICLA 4CFCA 5AFUA 1HKBA 4O8KA 4W5TA 2Z1IA 5AQZA 5KI6A 4B08A 1RBTA 3VQDA 4KHPK 3P4IA 4OLBA 5AQWA 1LOTB 2YV0X 4H0XB 1NK4A 3M5RA 1C0FA 3CYMA 4BWJA 1ESVA 3VERA 1NMDA 4PA1A 1NOZA 2BDPA 5HRSA 4EZ6A 3EZ5A 2JWKA 4PKIA 4KH5A 3K59A 3VEOA 2I7PA 5M1QA 5BPMA 3J81O 1BQMA 5HRRA 3WQUA 3DYAA 4LF8K 4KAZA 4A2BA 2O8DB 3KKSA 3A8YA 4OKJA 3VETA 1VSEA 4GNIA 3MEEA 3CMEN 3TANA 3QNOA 3NF6A 3VQ9A 1HPMA 3CQXA 3V9ZA 3THYB 4DTJA 3LDLA 4B1VA 4B9UA 4LFAK 1VSLA 3MEGA 3AA3A 1U2VA 4CJ3A 3THXB 4B1ZA 1NU0A 3M1FA 1S3XA 4FWQA 3SK3A 4KHQA 3L3VA 2Z1JA 1RT5A 1BDGA 3EO3A 2IVNA 2HBMA 4BR9A 1WOQA 3KLFA 2HNZA 3LZJA 4DU1A 4A59A 1HNXK 4CGDA 4JKEA 1U45A 2UXCK 5AQSA 4FLUA 1XNRK 3RSEB 1TKZA 1SV5A 5CHIA 3TPQA 4PY5A 4H5VA 4H0TB 3F9KA 4LF9K 4CEAA 5AQNA 1SKRA 1QQOA 2HVIA 2FBTA 2HW3A 3O5BA 1TK0A 3MX5A 5KQDA 2OZMA 2XY8A 2HHXA 3EEQA 2UYTA 3QO9A 2HHQA 3KKRA 1J5OA 4V19S 3S3MA 2D4WA 4B3TK 3D0PA 3D2FB 2D0AA 4CGHA 3ZT0A 3OYNA 3O8MA 4PKGA 1W9HA 3FLCO 4BRHA 4FJJA 3D6RA 3AVHA 5JLHA 1NJYA 5CR4A 1UWBA 1HUXA 2QWNA 2VQFK 3S3OA 2KTQA 3AVFA 3VESA 1WBDA 3A5LC 4H5WA 3THWB 4HUEA 1L3TA 1LWFA 4HUGA 3JS6A 1BIZA 5M1KA 4YHHK 3CFOA 3MX2A 2KFNA 4BREA 4JS5A 3K5LA 4DSJA 3NGZA 4M3UA 1SL1A 1HKCA 3PO4A 1OVYA 2FF6A 4J2BA 3DLRA 1VQLN 1BG3A 3ENOA 4FZYA 4ID5A 1YVNA 2PZSA 1C0TA 3OVNA 4I9QA 4LFCK 5HBMA 2NRVA 1S1UA 1REVA 4JEPA 4C8LA 3HYFA 4DLEA 3THVA 1KD1O 4FO0A 3DJCA 1XUPO 2UU9K 4FLYA 3JAMO 3B6OA 5DM7L 5ELZA 3QINA 1MWKA 1WN7A 5K14A 2Q0RA 3C7NA 4FJ7A 5AQTA 1X9SA 3L2QA 3PX4A 4FL9A 2V7ZA 4Z0UA 4WFBL 1KRPA 4PUOA 3WQTA 3FZKA 2X78A 4HTLA 4DF4A 5AQIA 3LWLA 1Q82O 5E84A 4I9LA 4RW8A 3RRHA 2HF4A 3VQ7A 4BE2A 3SMSA 1KXPA 4XIUA 4IO9L 4FJIA 5T7BA 1D9FA 5BRHA 4I6MB 3OYLA 3OS0A 4YY3K 1HKGA 3AVAA 4CK1A 1W97L 3DXKB 2O8CA 4YOVA 1NGIA 5FRMA 3PY8A 4FZZA 3HT3A 3HTVA 2FSKA 1Q7YO 3VQEA 2OZSA 1QE1A 2YI1A 2H3GX 1U04A 1SS6A 4Y0WA 4JKGA 4BRQA 4LF7K 2QK9A 3RTVA 3CCQN 4GW6A 3VF2A 3NF8A 2J4RA 3TAPA 3BZCA 3E66A 4M7YA 4CEOA 4M42A 1JLFA 2WC9A 1KFDA 1T8EA 1TUYA 3OJSA 3SNNA 1HR0K 1QHAA 3AA2A 1RBUA 1YTAA 3PV8A 1EQYA 3U4LA 1KAYA 4M63C 3N4QA 5AQLA 5J2MA 1FKOA 2HBLA 4BRCA 5JS2A 3B8AX 2P9KA 3U3YA 2IGIA 5BREA 4DTNA 1BU6O 5F0XA 1XC3A 2B4JA 4YDUC 3RWUA 1P90A 2UUBK 3VN5A 1JL2A 1DKGD 1WSJA 1C0MA 5FDLA 4OVLA 4KI4A 5GADP 5BRFA 3SI6A 3TAFA 3MCAB 3DLEA 4K25A 2YJFA 4CZHA 3SQ0A 2KFZA 2JWLA 3DOLA 5EY4A 2HBJA 5EX5A 3OYBA 5GIPA 3KIOA 2FC0A 4BC3A 4YFUA 4FPAA 1K8KB 1ATSA 2ZJRL 3K9JA 4JV5K 1DTQA 4YOTA 2F4VK 1NK5A 3A5OC 3T19A 4IDKA 4W5QA 2QA4N 3OYKA 1D9DA 4BC5A 2P9PB 2OYQA 5KPRA 1VRTA 4H0OA 2QW9A 4N41A 1C1CA 1RT6A 1DLOA 1HJRA 4EFHA 5SZTA 3MCPA 2VG5A 3E01A 2D0OA 3V9UA 4U7BA 4DTRA 3KD1E 2JGUA 2E8AA 4W5RA 4CZMA 3HVTA 1XC9A 2IC3A 3CIPA 3ZYYX 4JKHA 3F5TA 3SUPA 1GLAG 3ASMA 1FK9A 3WUHA 4CW7B 2P1JA 5AQRA 3MXJA 2NRXA 3QEPA 1BL3A 3H1QA 1BUPA 4DU4A 3IFRA 3OA9A 4FWOA 4CGJA 4FWMA 4NLBA 4OGEA 3A0IX 4TSXA 4LF4K 2YX6A 4CJPA 4Z4GA 1J54A 4IEEA 4CERA 1Q81O 1H1VA 4CIEA 5HROA 3CG7A 3SUOA 3DAWA 3L2WA 3WXKA 2ASMA 4JHDB 4A57A 3ATVA 3D2EA 2G8KA 4KTWA 4RG8A 3VQ4A 5FLXO 2ITMA 3S41A 3P38A 2YNIA 1S1WA 4K41A 3NFAA 3CCVN 5BR9A 4HCBA 5GAEP 1ZBHA 5CZ1A 4OKKA 4N47A 1JXEA 4FM0A 3KK2A 2XY5A 1TL3A 4NYFA 1BA1A 3J7ZO 3NDKA 4IZ9A 3M8PA 4ID1A 4KTQA 2P51A 4BRNA 4FLWA 3E9LA 3V1OA 4MDAA 1L3VA 1IKWA 4B1XB 4F8RA 2A40A 1K6YA 3E9PA 4R5PA 4YOWA 3ZSQA 3L8BA 4IOXA 4H0YB 4B9SA 3VQ5A 4WQ5C 4BR5A 5I3UA 4HCCA 3CCLN 3KJVA 4B9MA 3V1RA 2P9IB 4IKFA 4KH6A 2OTJN 1RTHA 3QEWA 1HJOA 5AQHA 1B92A 3MK6A 3M8RA 4B9TA 1WSEA 3CXCM 2HNDA 1M90O 2A5XA 3K57A 4FJ5A 2ZGZA 3MDQA 1TUUA 1YAGA 5AJ3K 3CC7N 4N76A 4Z4FA 3ZLJA 3L2UA 4JKFA 4PL8A 3IAYA 3V6DA 1JLGA 2QKBA 2BTFA 2A1SA 1S72N 1VQON 4E1JA 5EOYA 4O44A 4AHSA 1C1AA 3VQCA 2RHKA 1XHZA 4DLGA 3OYIA 2F9TA 3AGKA 4O55A 2G8IA 4KI6A 3DMJA 4JKBA 3HL8A 2E20A 4CFBA 3JYTA 1NGFA 4PHTX 3VTIA 1HYSA 1S6PA 2ZJQL 4DTSA 1NGAA 1WUAA 4JI1K 3P5JA 4IJAA 2B6AA 3AVGA 3G10A 4OGCA 3A5NC 1HNWK 4CK3A 4JAXA 2FSNA 4XH1A 4ELVA 2ASOA 4FLXA 1QS4A 4JLHA 4CD3A 1RT3A 5AQYA 4BRIA 3CJ7A 3CCRN 2O8EA 1ATNA 5AQMA 3C94A 1WSHA 4KKOA 2KZMA 4E3SA 1TL1A 2ITGA 4E89A 5AZJA 1XMQK 1CZAN 3SQ1A 2AA4A 1B9DA 2PY5A 4FWRA 4JRPA 2O4IA 4BG9A 2O8FB 2G8UA 1NM1A 4WQ5A 3QERA 3O80A 1Z05A 4CHOA 3SUQA 4PQUA 3VA0A 4CFAA 5CY4A 1NK6A 1IV0A 3AA4A
chains in the Genus database with same CATH topology
1I39A 2RF2A 3ZT2A 4CEBA 3ULDA 1A5VA 5HRPA 4CJSA 2Y1IA 4PY5A 4I2PA 3F9KA 4HUFA 4CEAA 4B8CA 4E7HA 1SKRA 1EKEA 2HVIA 1KVAA 2FBTA 2HW3A 1SL0A 2ETJA 1TK0A 2VG7A 2G8HA 1J53A 3QEXA 5JS1A 2OZMA 2XY8A 2HHXA 3ZSZA 1X9WA 3TAQA 3QO9A 3WNHA 4CEFA 4O4GA 2HHQA 3KKRA 1J5OA 2X6NA 1KFSA 3S3MA 3D0PA 1Z25A 3HM9A 3SUNA 3L2VA 3V1QA 3CQ8A 2D0AA 1R0AA 1S6QA 4CGGA 1NK9A 4CGHA 3ZT0A 3OYNA 1RT4A 1NK0A 1W9HA 4KB0A 4FJJA 4KTZA 4QOZB 3AVHA 3M8SA 4Z4CA 2FBYA 1NJYA 2OPRA 4MFBA 2GV9A 3NH0A 1UWBA 4G1QA 1CXUA 3S3OA 3DLGA 2KTQA 3LALA 3AVFA 1QQCA 4OJRA 3DRRA 4M3TA 2DFEA 4QAGA 3SV4A 3OYAA 3ZT4A 4FJKA 1EX4A 1YTUA 5FRNA 4UQGA 3V9SA 4DS5A 3KTQA 4OLAA 3MXMA 4IFYA 4AHUA 3LANA 1KLNA 3I0RA 4HUEA 1XHXA 3U3GA 1L3TA 2OA8A 1LWFA 4FJMA 4HUGA 3VQ6A 1EP4A 1T03A 4FCYA 4W5NA 4C8NA 1BIZA 4F2SA 5KGXA 4LD0A 1U48A 4KHUA 1NKBA 3CFOA 2KFNA 4PWDA 4F2RA 4JS5A 2RN2A 3ZT1A 3K5LA 3SQ4A 3NGZA 4BDYA 4DSJA 4M3UA 4ZTFA 1SL1A 3LWMA 4FXDA 1BHLA 3PO4A 1TKTA 1WAJA 4J2BA 3KLEA 3DLRA 4M3WA 1KCFA 4CJUA 2ZD1A 4FK4A 2HVHA 3C6TA 4FZYA 4ID5A 3QESA 3RMCA 1SKWA 3RR7A 3IG1A 1FXXA 4FW1A 2PZSA 1C0TA 1RCHA 1VSKA 3OVNA 2HB5A 3AV9A 2VWJA 4I9QA 3HSTB 1RBRA 5HBMA 4DTUA 4IBNA 3TARA 2WONA 1S1UA 1REVA 3AO2A 4DTOA 4C8LA 4FVMA 1QSLA 3QIOA 3HPHA 3HYFA 4CF9A 4DLEA 2P5OA 2XRIA 4O5BA 3MAQA 4M3XA 3THVA 2G8FA 1NJWA 4I7FA 1RT7A 4NCAA 4FLYA 3BDPA 4ELUA 3TABA 3B6OA 2I5JA 4GVMA 3VQQA 3PO5A 3VQBA 3QINA 1QSYA 1WN7A 2NUBA 3VQ8A 5K14A 3RMDA 2B5JA 3SJJA 4FJ7A 1X9SA 1HYVA 3L2QA 3PX4A 4CJVA 1N5YA 5E41A 3AVBA 2VWKA 2BE2A 1LAWA 1EXQA 4DF8A 4Q0BA 3HP9A 4Z0UA 2FBVA 4JS4A 3LP1A 1UA1A 1KRPA 4PUOA 3OY9A 4CJQA 3SCXA 1S1VA 4CEQA 2F96A 2X78A 4RW7A 3O3FA 2BGGA 2YNFA 3OYCA 5C25A 3AA5X 4DF4A 2ZE2A 1F21A 3T1AA 3NH2A 4HCCA 3LWLA 4EP4A 1SL2A 4KPYA 2DTUA 2OPPA 4I9LA 3K2PA 3AVKA 4RW8A 4B8AB 3KLIA 3RRHA 4CGIA 3NF9A 3AVCA 4DFPA 1IO2A 5J2NA 2X6SA 3CFPA 4B9NA 1T05A 3VQ7A 4AHCA 4BE2A 3QEVA 1RBSA 1ASUA 1KLMA 4XIUA 1BQNA 4FJIA 5T7BA 1SUQA 1D9FA 1FKPA 1ITGA 3OYLA 3NGIA 4HTUA 3OS0A 3DLBA 4FM2A 3AVAA 2RPIA 3O3GA 4CK1A 3LDSA 1TGOA 5DMRA 3RR8A 2E4LA 5FRMA 3PY8A 4FLZA 5KGWA 1WNSA 3KLHA 4ELTA 4FZZA 4CHZA 3HT3A 3VQPA 3L2RA 1WSFA 3SYZA 4FK0A 3VQEA 3HK2A 1C0UA 2OZSA 1QE1A 3ZSVA 3NH1A 4NCBA 3LP3A 1BIUA 1U04A 3EYZA 2D5RA 2HMIA 1NKEA 3I8DA 2R7YA 2QK9A 3RTVA 4DMNA 5CZ2A 4C8OA 2HHTA 1I3AA 2OPQA 4DTPA 4GW6A 3NF8A 4CHYA 4QCLA 3TAPA 1TAQA 1VSJA 2YNGA 4CEOA 1RILA 4CCHA 2DFFA 4CIFA 4E7IA 4M42A 1JLFA 1VK0A 1KFDA 1T8EA 3DRSA 4C8MA 3BGRA 5EU7A 4AHRA 3A2FA 1SKSA 3OJSA 3SNNA 3HVRA 3AA2A 4BE1A 1RBUA 3CM5A 3OYMA 3O4QA 4DFJA 2F8SA 1YTAA 1UA0A 3P1GA 1LAVA 1G15A 4KFBA 2AJQA 3OYJA 3PV8A 3ZSRA 3K5MA 5CYQA 3ITHA 1GOAA 1VSDA 1WLJA 4DQQA 1DTTA 1HYZA 1VSHA 4KV8A 3LPTA 1FKOA 5J2MA 4M41A 5JS2A 3DLHA 1JLQA 4CEDA 3AO4A 3NAEA 4FLTA 4DSEA 3HP6A 1C6VA 1TVRA 3U3YA 2RKIA 2IGIA 4H4MA 1HNIA 4E7LA 1JLAA 1S9EA 1IKXA 1YVUA 3HPOA 4BACA 4DTNA 2XHBA 1EETA 2B4JA 1NJZA 3RWUA 2O4GA 1ASWA 4LY7A 1RDBA 3VN5A 1JL2A 2HHWA 4J2DA 3LZIA 2Z1HA 1WSJA 2D0BA 1C0MA 5FDLA 3P83D 3NF7A 4AH9A 3SZ2A 4K8ZA 1BI4A 1HQEA 1RTIA 2IAJA 4OVLA 4CJ5A 4KI4A 3MEDA 3SI6A 3TAFA 1RTDA 4F3OA 4YNQA 3DLEA 2F8TA 2HNYA 3AO1A 3QEIA 3SQ0A 1VSFA 5J2PA 1JLBA 3UIQA 2KFZA 1HRHA 3DOLA 4IFVA 3ZSYA 4ZHRA 1JLCA 3OYBA 1QSSA 3KIOA 1KTQA 3CM6A 3VQAA 1KSPA 2FC0A 3IS9A 1NK8A 2HHUA 4M3RA 4YFUA 5C24A 3M8QA 1VRUA 5KRSA 3C95A 1SV5A 2E6MA 4IG3A 4CE9A 4E1MA 3K5NA 2EHGA 3OS2A 1DTQA 3TAMA 2G8WA 1NK5A 4FJGA 4O0IA 3T19A 2JLEA 1X1PA 4CHQA 4CF8A 4IDKA 1JKHA 3DOKA 4CJTA 4OPJA 2IOCA 4DS4A 4W5QA 1U4BA 3OYKA 1D9DA 4DSKA 5KRTA 3F73A 5HLFA 3AO3A 2OYQA 2Y1JA 3IRXA 4AILC 4LSNA 4BDPA 4FJ9A 1VRTA 4CIGA 1NK7A 4CF0A 2GUIA 2QXFA 3K58A 4BDZA 1WSIA 4KHSA 1JL1A 1RDAA 1ZBFA 4FJNA 4N41A 2LSNA 1C1CA 4C8KA 4NYNA 1RT6A 1DLOA 3TR8A 4CJLA 1J9AA 1HJRA 3FFIA 3V81A 3AVLA 5SZTA 1HQUA 1S9GA 3RRGA 2XY7A 3S3NA 3KD1E 2VG5A 1IH7A 3E01A 4CJKA 4CECA 3V9UA 4DTRA 4Z4EA 2JGUA 4DTXA 4N5SA 4W5RA 2KW4A 3HVTA 1XC9A 4AHVA 2IC3A 2KZZA 4HVJA 3NCIA 3LAMA 4K8XA 2WOMA 3ASMA 4Z4HA 1FK9A 3SUPA 1ZYQA 3AVMA 3QIPA 4KHNA 2P1JA 4H8KA 3MXJA 3OYHA 3EY1A 1BL3A 1HPZA 3QEPA 3ALYA 3DI6A 4RW9A 4DTMA 4DU4A 2IS3A 4FW2A 1L5UA 4CGJA 5HRNA 4DFMA 2YKNA 1JLEA 1UOCA 3PUFA 3MXIA 3KK3A 4OGEA 4TSXA 4CJFA 5KTQA 1L3UA 1IKYA 1GOBA 4DQIA 4DSIA 4BE0A 2X74A 3TI0A 1Q8IA 4CJPA 4Z4GA 4CHNA 3K5OA 3HPGA 1KVCA 4NCGA 4B3OA 1J54A 4CJWA 4CERA 3HO1A 3V9WA 2VG6A 3LP2A 4CEEA 3AVJA 4CIEA 3T3FA 3CG7A 3QNNA 3SUOA 5HROA 3I0SA 3L2WA 4KHWA 3V4IA 2YHBA 2W42A 1RDDA 2Q3SA 1VSIA 4J2EA 2DY4A 1LWEA 4CJEA 4E7KA 2G8KA 1BCOA 4KTWA 4CF1A 3O3HA 2GBZA 4RG8A 4BWMA 3VQ4A 4CGFA 4HHTA 3SV3A 3AVIA 1U47A 1S1TA 3DLKA 4GMJB 2YNIA 3OS1A 4F4KA 5C42A 1S1WA 4DQPA 3OJUA 3WNEA 4Y1DA 1NJXA 3AVNA 1IG9A 4JRQA 4WE1A 1BISA 4LSLA 2FBXA 1JXBA 3O4NA 4RW6A 2PYJA 3NFAA 4FLVA 3KLGA 4KO0A 4B9VA 4HCBA 3ZSXA 3VA3A 1ZBHA 5CZ1A 4OKKA 4N47A 3L3UA 1JXEA 4FM0A 4CJ4A 3KK2A 2XY5A 1TL3A 3QETA 3HJFA 4NYFA 2E6LA 3NBPA 3LPUA 3NDKA 1W0HA 4AHTA 3M8PA 4ID1A 4FJHA 1XI1A 4KTQA 4CESA 1VSMA 5J2QA 3OYEA 2P51A 5I42A 1U49A 4FLWA 2KQ2A 3V1OA 3LAKA 5FROA 3KD5E 1L3VA 2YKMA 3NHGA 1IKWA 4F8RA 1O1WA 2BANA 2XO7A 1K6YA 1TK5A 3CFRA 4R5PA 2YHAA 3WNFA 4E1NA 3ZSQA 3L8BA 3OYFA 1Q9XA 2YNHA 1XWLA 4IG0A 3SPYA 4B9SA 4H4OA 3VQ5A 5I3UA 3DRPA 4E19A 3ISNC 1RTJA 4CK2A 5J1EA 3KJVA 3V1RA 4B9MA 4LH5A 1TAUA 1RNHA 4M3YA 4IKFA 2P5GA 4M3ZA 1CZBA 1RT1A 1LWCA 1RTHA 4KB1A 1S5JA 3QEWA 1MU2A 1S1XA 1LW2A 1B92A 3ZT3A 1TKXA 5SWMA 3SPZA 1L3SA 1Q9YA 3M8RA 4CFDA 1C1BA 4N56A 4B9TA 1ASVA 4E7JA 1WSEA 3V9XA 2HNDA 4F3TA 1A5XA 3K57A 1TKDA 4L8RB 4FJLA 1D8YA 4FJ5A 3KK1A 4CHPA 4N76A 4CJRA 3RMAA 4DG1A 1CZ9A 5HP1A 1CXQA 2IDOA 1BI4B 4Z4FA 3TWHA 4CEZA 4OPKA 1ZBUA 3L2UA 2G8VA 4KREA 1BCMA 4OKEA 1A5WA 3IAYA 4EZ9A 2HHSA 3ZCMA 4M45A 4ICLA 2ZQBA 4CFCA 3V6DA 4DSFA 1JLGA 4Q5VA 2QKBA 4MQ3A 2DFHA 1N6QA 2A1SA 4W5TA 2Z1IA 4Z4IA 5KI6A 4EP5A 1NKCA 4B08A 1RBTA 3VQDA 4FK2A 4OLBA 4O44A 4FM1A 4AHSA 2YV0X 1NOYA 1C1AA 3VQCA 1XHZA 5CYMA 4DLGA 1HMVA 1NK4A 3OYIA 2QKKA 1WAFA 3CYMA 4BWJA 3S9HA 4DWIA 2D0CA 4O55A 1HNVA 4PA1A 4RW4A 1IKVA 4B9LA 1TV6A 1NOZA 2BDPA 5HRSA 2G8IA 4EZ6A 3EZ5A 1BGXT 4KI6A 3DMJA 3DM2A 3JSMA 3PX0A 3HL8A 3K59A 4CFBA 3JYTA 3G0ZA 4DFKA 3NE6A 3ZSWA 1BQMA 5HRRA 1CLQA 3NGYA 4O0JA 3DYAA 4KAZA 1HYSA 1S6PA 4DTSA 3KKSA 1X9MA 3U6FA 3PX6A 4OKJA 1VSEA 3SQ2A 2A1RA 1B9FA 2HHVA 3MEEA 3ZSOA 4E0DA 3TANA 3P5JA 3QNOA 3HXMA 3NF6A 2B6AA 4J2AA 3AVGA 3VQ9A 3MECA 1Z26A 3G10A 3LP0A 4OGCA 4CK3A 3V9ZA 4LH4A 1QTMA 4DTJA 3D45A 4FJXA 4B9UA 4ELVA 4FLXA 1QS4A 4FJ8A 3C6UA 1VSLA 3MEGA 3AA3A 4JLHA 4DU3A 1T7PA 1GOCA 1RT3A 1ZBIA 1RDCA 1RT2A 3C94A 4DQRA 1WSHA 3TAEA 3H08A 4CJ3A 2OPSA 4KKOA 4W5OA 1RBVA 3B6PA 4E3SA 2KZMA 4FZXC 1TL1A 2ITGA 4DQSA 2Z1GA 5DK5A 4E89A 3OYGA 1TK8A 4KHQA 3L3VA 4Y1CA 2EX3A 4CF2A 1B9DA 2Z1JA 1RT5A 4JRPA 3SQ1A 2PY5A 2O4IA 1KVBA 3TAGA 2G8UA 3KLFA 5D3GA 1ZBLA 3OYDA 4KHYA 1UAXA 2ATQA 1Y97A 1YT3A 2HNZA 3LZJA 4DU1A 2XY6A 3AO5A 1LW0A 3QERA 4CGDA 1WSGA 4DSLA 3QLHA 2PYLA 1D5AA 1LV5A 4I2QA 1U45A 4FYDA 4CHOA 3RMBA 4KRFA 3SUQA 4PQUA 4ZTJA 3VA0A 4CFAA 4FLUA 5CY4A 1NK6A 1TKZA 1QHTA 3AA4A 3WNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I39 A;  2RF2 A;  3ZT2 A;  4CEB A;  3ULD A;  1A5V A;  5HRP A;  4CJS A;  2Y1I A;  4PY5 A;  4I2P A;  3F9K A;  4HUF A;  4CEA A;  4B8C A;  4E7H A;  1SKR A;  1EKE A;  2HVI A;  1KVA A;  2FBT A;  2HW3 A;  1SL0 A;  2ETJ A;  1TK0 A;  2VG7 A;  2G8H A;  1J53 A;  3QEX A;  5JS1 A;  2OZM A;  2XY8 A;  2HHX A;  3ZSZ A;  1X9W A;  3TAQ A;  3QO9 A;  3WNH A;  4CEF A;  4O4G A;  2HHQ A;  3KKR A;  1J5O A;  2X6N A;  1KFS A;  3S3M A;  3D0P A;  1Z25 A;  3HM9 A;  3SUN A;  3L2V A;  3V1Q A;  3CQ8 A;  2D0A A;  1R0A A;  1S6Q A;  4CGG A;  1NK9 A;  4CGH A;  3ZT0 A;  3OYN A;  1RT4 A;  1NK0 A;  1W9H A;  4KB0 A;  4FJJ A;  4KTZ A;  4QOZ B;  3AVH A;  3M8S A;  4Z4C A;  2FBY A;  1NJY A;  2OPR A;  4MFB A;  2GV9 A;  3NH0 A;  1UWB A;  4G1Q A;  1CXU A;  3S3O A;  3DLG A;  2KTQ A;  3LAL A;  3AVF A;  1QQC A;  4OJR A;  3DRR A;  4M3T A;  2DFE A;  4QAG A;  3SV4 A;  3OYA A;  3ZT4 A;  4FJK A;  1EX4 A;  1YTU A;  5FRN A;  4UQG A;  3V9S A;  4DS5 A;  3KTQ A;  4OLA A;  3MXM A;  4IFY A;  4AHU A;  3LAN A;  1KLN A;  3I0R A;  4HUE A;  1XHX A;  3U3G A;  1L3T A;  2OA8 A;  1LWF A;  4FJM A;  4HUG A;  3VQ6 A;  1EP4 A;  1T03 A;  4FCY A;  4W5N A;  4C8N A;  1BIZ A;  4F2S A;  5KGX A;  4LD0 A;  1U48 A;  4KHU A;  1NKB A;  3CFO A;  2KFN A;  4PWD A;  4F2R A;  4JS5 A;  2RN2 A;  3ZT1 A;  3K5L A;  3SQ4 A;  3NGZ A;  4BDY A;  4DSJ A;  4M3U A;  4ZTF A;  1SL1 A;  3LWM A;  4FXD A;  1BHL A;  3PO4 A;  1TKT A;  1WAJ A;  4J2B A;  3KLE A;  3DLR A;  4M3W A;  1KCF A;  4CJU A;  2ZD1 A;  4FK4 A;  2HVH A;  3C6T A;  4FZY A;  4ID5 A;  3QES A;  3RMC A;  1SKW A;  3RR7 A;  3IG1 A;  1FXX A;  4FW1 A;  2PZS A;  1C0T A;  1RCH A;  1VSK A;  3OVN A;  2HB5 A;  3AV9 A;  2VWJ A;  4I9Q A;  3HST B;  1RBR A;  5HBM A;  4DTU A;  4IBN A;  3TAR A;  2WON A;  1S1U A;  1REV A;  3AO2 A;  4DTO A;  4C8L A;  4FVM A;  1QSL A;  3QIO A;  3HPH A;  3HYF A;  4CF9 A;  4DLE A;  2P5O A;  2XRI A;  4O5B A;  3MAQ A;  4M3X A;  3THV A;  2G8F A;  1NJW A;  4I7F A;  1RT7 A;  4NCA A;  4FLY A;  3BDP A;  4ELU A;  3TAB A;  3B6O A;  2I5J A;  4GVM A;  3VQQ A;  3PO5 A;  3VQB A;  3QIN A;  1QSY A;  1WN7 A;  2NUB A;  3VQ8 A;  5K14 A;  3RMD A;  2B5J A;  3SJJ A;  4FJ7 A;  1X9S A;  1HYV A;  3L2Q A;  3PX4 A;  4CJV A;  1N5Y A;  5E41 A;  3AVB A;  2VWK A;  2BE2 A;  1LAW A;  1EXQ A;  4DF8 A;  4Q0B A;  3HP9 A;  4Z0U A;  2FBV A;  4JS4 A;  3LP1 A;  1UA1 A;  1KRP A;  4PUO A;  3OY9 A;  4CJQ A;  3SCX A;  1S1V A;  4CEQ A;  2F96 A;  2X78 A;  4RW7 A;  3O3F A;  2BGG A;  2YNF A;  3OYC A;  5C25 A;  3AA5 X;  4DF4 A;  2ZE2 A;  1F21 A;  3T1A A;  3NH2 A;  4HCC A;  3LWL A;  4EP4 A;  1SL2 A;  4KPY A;  2DTU A;  2OPP A;  4I9L A;  3K2P A;  3AVK A;  4RW8 A;  4B8A B;  3KLI A;  3RRH A;  4CGI A;  3NF9 A;  3AVC A;  4DFP A;  1IO2 A;  5J2N A;  2X6S A;  3CFP A;  4B9N A;  1T05 A;  3VQ7 A;  4AHC A;  4BE2 A;  3QEV A;  1RBS A;  1ASU A;  1KLM A;  4XIU A;  1BQN A;  4FJI A;  5T7B A;  1SUQ A;  1D9F A;  1FKP A;  1ITG A;  3OYL A;  3NGI A;  4HTU A;  3OS0 A;  3DLB A;  4FM2 A;  3AVA A;  2RPI A;  3O3G A;  4CK1 A;  3LDS A;  1TGO A;  5DMR A;  3RR8 A;  2E4L A;  5FRM A;  3PY8 A;  4FLZ A;  5KGW A;  1WNS A;  3KLH A;  4ELT A;  4FZZ A;  4CHZ A;  3HT3 A;  3VQP A;  3L2R A;  1WSF A;  3SYZ A;  4FK0 A;  3VQE A;  3HK2 A;  1C0U A;  2OZS A;  1QE1 A;  3ZSV A;  3NH1 A;  4NCB A;  3LP3 A;  1BIU A;  1U04 A;  3EYZ A;  2D5R A;  2HMI A;  1NKE A;  3I8D A;  2R7Y A;  2QK9 A;  3RTV A;  4DMN A;  5CZ2 A;  4C8O A;  2HHT A;  1I3A A;  2OPQ A;  4DTP A;  4GW6 A;  3NF8 A;  4CHY A;  4QCL A;  3TAP A;  1TAQ A;  1VSJ A;  2YNG A;  4CEO A;  1RIL A;  4CCH A;  2DFF A;  4CIF A;  4E7I A;  4M42 A;  1JLF A;  1VK0 A;  1KFD A;  1T8E A;  3DRS A;  4C8M A;  3BGR A;  5EU7 A;  4AHR A;  3A2F A;  1SKS A;  3OJS A;  3SNN A;  3HVR A;  3AA2 A;  4BE1 A;  1RBU A;  3CM5 A;  3OYM A;  3O4Q A;  4DFJ A;  2F8S A;  1YTA A;  1UA0 A;  3P1G A;  1LAV A;  1G15 A;  4KFB A;  2AJQ A;  3OYJ A;  3PV8 A;  3ZSR A;  3K5M A;  5CYQ A;  3ITH A;  1GOA A;  1VSD A;  1WLJ A;  4DQQ A;  1DTT A;  1HYZ A;  1VSH A;  4KV8 A;  3LPT A;  1FKO A;  5J2M A;  4M41 A;  5JS2 A;  3DLH A;  1JLQ A;  4CED A;  3AO4 A;  3NAE A;  4FLT A;  4DSE A;  3HP6 A;  1C6V A;  1TVR A;  3U3Y A;  2RKI A;  2IGI A;  4H4M A;  1HNI A;  4E7L A;  1JLA A;  1S9E A;  1IKX A;  1YVU A;  3HPO A;  4BAC A;  4DTN A;  2XHB A;  1EET A;  2B4J A;  1NJZ A;  3RWU A;  2O4G A;  1ASW A;  4LY7 A;  1RDB A;  3VN5 A;  1JL2 A;  2HHW A;  4J2D A;  3LZI A;  2Z1H A;  1WSJ A;  2D0B A;  1C0M A;  5FDL A;  3P83 D;  3NF7 A;  4AH9 A;  3SZ2 A;  4K8Z A;  1BI4 A;  1HQE A;  1RTI A;  2IAJ A;  4OVL A;  4CJ5 A;  4KI4 A;  3MED A;  3SI6 A;  3TAF A;  1RTD A;  4F3O A;  4YNQ A;  3DLE A;  2F8T A;  2HNY A;  3AO1 A;  3QEI A;  3SQ0 A;  1VSF A;  5J2P A;  1JLB A;  3UIQ A;  2KFZ A;  1HRH A;  3DOL A;  4IFV A;  3ZSY A;  4ZHR A;  1JLC A;  3OYB A;  1QSS A;  3KIO A;  1KTQ A;  3CM6 A;  3VQA A;  1KSP A;  2FC0 A;  3IS9 A;  1NK8 A;  2HHU A;  4M3R A;  4YFU A;  5C24 A;  3M8Q A;  1VRU A;  5KRS A;  3C95 A;  1SV5 A;  2E6M A;  4IG3 A;  4CE9 A;  4E1M A;  3K5N A;  2EHG A;  3OS2 A;  1DTQ A;  3TAM A;  2G8W A;  1NK5 A;  4FJG A;  4O0I A;  3T19 A;  2JLE A;  1X1P A;  4CHQ A;  4CF8 A;  4IDK A;  1JKH A;  3DOK A;  4CJT A;  4OPJ A;  2IOC A;  4DS4 A;  4W5Q A;  1U4B A;  3OYK A;  1D9D A;  4DSK A;  5KRT A;  3F73 A;  5HLF A;  3AO3 A;  2OYQ A;  2Y1J A;  3IRX A;  4AIL C;  4LSN A;  4BDP A;  4FJ9 A;  1VRT A;  4CIG A;  1NK7 A;  4CF0 A;  2GUI A;  2QXF A;  3K58 A;  4BDZ A;  1WSI A;  4KHS A;  1JL1 A;  1RDA A;  1ZBF A;  4FJN A;  4N41 A;  2LSN A;  1C1C A;  4C8K A;  4NYN A;  1RT6 A;  1DLO A;  3TR8 A;  4CJL A;  1J9A A;  1HJR A;  3FFI A;  3V81 A;  3AVL A;  5SZT A;  1HQU A;  1S9G A;  3RRG A;  2XY7 A;  3S3N A;  3KD1 E;  2VG5 A;  1IH7 A;  3E01 A;  4CJK A;  4CEC A;  3V9U A;  4DTR A;  4Z4E A;  2JGU A;  4DTX A;  4N5S A;  4W5R A;  2KW4 A;  3HVT A;  1XC9 A;  4AHV A;  2IC3 A;  2KZZ A;  4HVJ A;  3NCI A;  3LAM A;  4K8X A;  2WOM A;  3ASM A;  4Z4H A;  1FK9 A;  3SUP A;  1ZYQ A;  3AVM A;  3QIP A;  4KHN A;  2P1J A;  4H8K A;  3MXJ A;  3OYH A;  3EY1 A;  1BL3 A;  1HPZ A;  3QEP A;  3ALY A;  3DI6 A;  4RW9 A;  4DTM A;  4DU4 A;  2IS3 A;  4FW2 A;  1L5U A;  4CGJ A;  5HRN A;  4DFM A;  2YKN A;  1JLE A;  1UOC A;  3PUF A;  3MXI A;  3KK3 A;  4OGE A;  4TSX A;  4CJF A;  5KTQ A;  1L3U A;  1IKY A;  1GOB A;  4DQI A;  4DSI A;  4BE0 A;  2X74 A;  3TI0 A;  1Q8I A;  4CJP A;  4Z4G A;  4CHN A;  3K5O A;  3HPG A;  1KVC A;  4NCG A;  4B3O A;  1J54 A;  4CJW A;  4CER A;  3HO1 A;  3V9W A;  2VG6 A;  3LP2 A;  4CEE A;  3AVJ A;  4CIE A;  3T3F A;  3CG7 A;  3QNN A;  3SUO A;  5HRO A;  3I0S A;  3L2W A;  4KHW A;  3V4I A;  2YHB A;  2W42 A;  1RDD A;  2Q3S A;  1VSI A;  4J2E A;  2DY4 A;  1LWE A;  4CJE A;  4E7K A;  2G8K A;  1BCO A;  4KTW A;  4CF1 A;  3O3H A;  2GBZ A;  4RG8 A;  4BWM A;  3VQ4 A;  4CGF A;  4HHT A;  3SV3 A;  3AVI A;  1U47 A;  1S1T A;  3DLK A;  4GMJ B;  2YNI A;  3OS1 A;  4F4K A;  5C42 A;  1S1W A;  4DQP A;  3OJU A;  3WNE A;  4Y1D A;  1NJX A;  3AVN A;  1IG9 A;  4JRQ A;  4WE1 A;  1BIS A;  4LSL A;  2FBX A;  1JXB A;  3O4N A;  4RW6 A;  2PYJ A;  3NFA A;  4FLV A;  3KLG A;  4KO0 A;  4B9V A;  4HCB A;  3ZSX A;  3VA3 A;  1ZBH A;  5CZ1 A;  4OKK A;  4N47 A;  3L3U A;  1JXE A;  4FM0 A;  4CJ4 A;  3KK2 A;  2XY5 A;  1TL3 A;  3QET A;  3HJF A;  4NYF A;  2E6L A;  3NBP A;  3LPU A;  3NDK A;  1W0H A;  4AHT A;  3M8P A;  4ID1 A;  4FJH A;  1XI1 A;  4KTQ A;  4CES A;  1VSM A;  5J2Q A;  3OYE A;  2P51 A;  5I42 A;  1U49 A;  4FLW A;  2KQ2 A;  3V1O A;  3LAK A;  5FRO A;  3KD5 E;  1L3V A;  2YKM A;  3NHG A;  1IKW A;  4F8R A;  1O1W A;  2BAN A;  2XO7 A;  1K6Y A;  1TK5 A;  3CFR A;  4R5P A;  2YHA A;  3WNF A;  4E1N A;  3ZSQ A;  3L8B A;  3OYF A;  1Q9X A;  2YNH A;  1XWL A;  4IG0 A;  3SPY A;  4B9S A;  4H4O A;  3VQ5 A;  5I3U A;  3DRP A;  4E19 A;  3ISN C;  1RTJ A;  4CK2 A;  5J1E A;  3KJV A;  3V1R A;  4B9M A;  4LH5 A;  1TAU A;  1RNH A;  4M3Y A;  4IKF A;  2P5G A;  4M3Z A;  1CZB A;  1RT1 A;  1LWC A;  1RTH A;  4KB1 A;  1S5J A;  3QEW A;  1MU2 A;  1S1X A;  1LW2 A;  1B92 A;  3ZT3 A;  1TKX A;  5SWM A;  3SPZ A;  1L3S A;  1Q9Y A;  3M8R A;  4CFD A;  1C1B A;  4N56 A;  4B9T A;  1ASV A;  4E7J A;  1WSE A;  3V9X A;  2HND A;  4F3T A;  1A5X A;  3K57 A;  1TKD A;  4L8R B;  4FJL A;  1D8Y A;  4FJ5 A;  3KK1 A;  4CHP A;  4N76 A;  4CJR A;  3RMA A;  4DG1 A;  1CZ9 A;  5HP1 A;  1CXQ A;  2IDO A;  1BI4 B;  4Z4F A;  3TWH A;  4CEZ A;  4OPK A;  1ZBU A;  3L2U A;  2G8V A;  4KRE A;  1BCM A;  4OKE A;  1A5W A;  3IAY A;  4EZ9 A;  2HHS A;  3ZCM A;  4M45 A;  4ICL A;  2ZQB A;  4CFC A;  3V6D A;  4DSF A;  1JLG A;  4Q5V A;  2QKB A;  4MQ3 A;  2DFH A;  1N6Q A;  2A1S A;  4W5T A;  2Z1I A;  4Z4I A;  5KI6 A;  4EP5 A;  1NKC A;  4B08 A;  1RBT A;  3VQD A;  4FK2 A;  4OLB A;  4O44 A;  4FM1 A;  4AHS A;  2YV0 X;  1NOY A;  1C1A A;  3VQC A;  1XHZ A;  5CYM A;  4DLG A;  1HMV A;  1NK4 A;  3OYI A;  2QKK A;  1WAF A;  3CYM A;  4BWJ A;  3S9H A;  4DWI A;  2D0C A;  4O55 A;  1HNV A;  4PA1 A;  4RW4 A;  1IKV A;  4B9L A;  1TV6 A;  1NOZ A;  2BDP A;  5HRS A;  2G8I A;  4EZ6 A;  3EZ5 A;  1BGX T;  4KI6 A;  3DMJ A;  3DM2 A;  3JSM A;  3PX0 A;  3HL8 A;  3K59 A;  4CFB A;  3JYT A;  3G0Z A;  4DFK A;  3NE6 A;  3ZSW A;  1BQM A;  5HRR A;  1CLQ A;  3NGY A;  4O0J A;  3DYA A;  4KAZ A;  1HYS A;  1S6P A;  4DTS A;  3KKS A;  1X9M A;  3U6F A;  3PX6 A;  4OKJ A;  1VSE A;  3SQ2 A;  2A1R A;  1B9F A;  2HHV A;  3MEE A;  3ZSO A;  4E0D A;  3TAN A;  3P5J A;  3QNO A;  3HXM A;  3NF6 A;  2B6A A;  4J2A A;  3AVG A;  3VQ9 A;  3MEC A;  1Z26 A;  3G10 A;  3LP0 A;  4OGC A;  4CK3 A;  3V9Z A;  4LH4 A;  1QTM A;  4DTJ A;  3D45 A;  4FJX A;  4B9U A;  4ELV A;  4FLX A;  1QS4 A;  4FJ8 A;  3C6U A;  1VSL A;  3MEG A;  3AA3 A;  4JLH A;  4DU3 A;  1T7P A;  1GOC A;  1RT3 A;  1ZBI A;  1RDC A;  1RT2 A;  3C94 A;  4DQR A;  1WSH A;  3TAE A;  3H08 A;  4CJ3 A;  2OPS A;  4KKO A;  4W5O A;  1RBV A;  3B6P A;  4E3S A;  2KZM A;  4FZX C;  1TL1 A;  2ITG A;  4DQS A;  2Z1G A;  5DK5 A;  4E89 A;  3OYG A;  1TK8 A;  4KHQ A;  3L3V A;  4Y1C A;  2EX3 A;  4CF2 A;  1B9D A;  2Z1J A;  1RT5 A;  4JRP A;  3SQ1 A;  2PY5 A;  2O4I A;  1KVB A;  3TAG A;  2G8U A;  3KLF A;  5D3G A;  1ZBL A;  3OYD A;  4KHY A;  1UAX A;  2ATQ A;  1Y97 A;  1YT3 A;  2HNZ A;  3LZJ A;  4DU1 A;  2XY6 A;  3AO5 A;  1LW0 A;  3QER A;  4CGD A;  1WSG A;  4DSL A;  3QLH A;  2PYL A;  1D5A A;  1LV5 A;  4I2Q A;  1U45 A;  4FYD A;  4CHO A;  3RMB A;  4KRF A;  3SUQ A;  4PQU A;  4ZTJ A;  3VA0 A;  4CFA A;  4FLU A;  5CY4 A;  1NK6 A;  1TKZ A;  1QHT A;  3AA4 A;  3WNG A; 
#chains in the Genus database with same CATH topology
 3ZT2 A;  5HRP A;  1OKJ A;  4E7H A;  1KVA A;  1SL0 A;  1QZ5 A;  3LL3 A;  4QS9 A;  3ZSZ A;  1X9W A;  4R79 A;  4CEF A;  2VQE K;  4JI2 K;  4DR7 K;  1GLD G;  1KFS A;  3SUN A;  1YIJ N;  3L2V A;  1S6Q A;  3T1Y K;  4B1U B;  4MFB A;  2GV9 A;  4BC2 A;  1VQP N;  2P9N A;  3K0S A;  4JI3 K;  3I55 N;  4DR3 K;  1NGE A;  2FXU A;  3LAL A;  3WXI A;  1QQC A;  3SV4 A;  3ZT4 A;  1YTU A;  4DS5 A;  2QXL A;  3KTQ A;  3MXM A;  3I0R A;  3U3G A;  1EP4 A;  1T03 A;  1VQ4 N;  4W5N A;  4C8N A;  4MLH A;  5B8H A;  5C0Y A;  1NKB A;  2RN2 A;  1GLF O;  4NXM K;  1EO1 A;  1SAZ A;  3LWM A;  4DV6 K;  4BRG A;  4M3W A;  1KCF A;  4CJU A;  2ZD1 A;  4FK4 A;  3C6T A;  3QES A;  3RMC A;  3IG1 A;  1FXX A;  2NRW A;  3QDK A;  3AV9 A;  4CBW A;  4IBN A;  2WON A;  3AO2 A;  3GOI A;  3E9O A;  5GAH P;  2XRI A;  1NJW A;  4I7F A;  1RT7 A;  4NCA A;  1FJG K;  4BRF A;  3PO5 A;  4AM6 A;  3UKR A;  1Z6R A;  3G71 N;  4CJV A;  2BE2 A;  1LAW A;  4Q0B A;  3HP9 A;  1UA1 A;  1V4S A;  3LP1 A;  3L6Q A;  3C6A A;  4CJQ A;  3SCX A;  4RW7 A;  1F21 A;  3NH2 A;  4GKJ K;  3G6E N;  5M1O A;  4EP4 A;  1OH5 A;  1N33 K;  4KPY A;  2DTU A;  3CJ9 A;  3AVK A;  4CGI A;  5J2N A;  3AVC A;  1IO2 A;  2X6S A;  1T05 A;  2AP1 A;  4XEI A;  4GY2 B;  3KWI A;  4B3M K;  3QEV A;  1RBS A;  1EWR A;  4X65 K;  1FKP A;  5I9E B;  5AR0 A;  2P9L B;  2RPI A;  4WFA L;  1GLJ O;  4FLZ A;  1T6D A;  5KGW A;  5AZI A;  1C0U A;  3SAG A;  3ZSV A;  4NCB A;  3LP3 A;  2ZM6 K;  2R7Y A;  4DMN A;  5CZ2 A;  1I3A A;  3QB0 A;  5F1X A;  2BUP A;  2VWB A;  2GWK A;  4QCL A;  3SLC A;  2HBK A;  1VSJ A;  4DQ8 A;  4DV0 K;  3DRS A;  4C8M A;  4KH4 A;  4AHR A;  1SKS A;  5GIN A;  3EKS A;  4BE1 A;  4DFJ A;  3OYM A;  5EVZ A;  3O4Q A;  4DUZ K;  4KFB A;  1OH8 A;  2AJQ A;  2NRR A;  4AM7 A;  2F9W A;  3ZSR A;  3K5M A;  2V7Y A;  3ENB A;  3ITH A;  5AQX A;  1GOA A;  1VSD A;  2QWR A;  4A62 A;  3J7Y P;  3LPT A;  2E1Z A;  1JLQ A;  1OH6 A;  5GAG P;  4JI4 K;  4FLT A;  4DSE A;  2O8B B;  1C6V A;  1TVR A;  4H4M A;  4E7L A;  1JLA A;  3KVG A;  4JI8 K;  3I33 A;  2WFB A;  1ASW A;  5M1N A;  3SAF A;  3O4W A;  3CMA N;  3D7E O;  3LZI A;  5AQP A;  4MDB A;  1QZ6 A;  4K8Z A;  1BI4 A;  3P39 A;  4CJ5 A;  1RTD A;  3O6W A;  3ZET B;  4WQ4 C;  4BR0 A;  3WEE A;  1VSF A;  3CD6 N;  3UIQ A;  5EXW A;  1JLC A;  2VYP A;  4B1Y B;  1KSP A;  2Q1N A;  2ZJP L;  5C24 A;  4B1W B;  4IG3 A;  1DEJ A;  3AY9 A;  4CE9 A;  1YJN N;  3ATU A;  4H03 B;  2EHG A;  3ZX3 A;  5AQK A;  1KAZ A;  4CHQ A;  3DOK A;  2IOC A;  4RWT A;  2QWO A;  3FZL A;  4MO5 A;  4DSK A;  3AO3 A;  1E3M A;  3IRX A;  4AIL C;  2YCH A;  4LSN A;  1NK7 A;  3TU5 A;  1J6Z A;  2GUI A;  2QXF A;  1ZBF A;  1MDU B;  2LSN A;  3G4S N;  4NYN A;  3EE8 A;  2I7N A;  2NRT A;  3AVL A;  1HQU A;  1S9G A;  3ZEU A;  4ILH A;  4X66 K;  2KZZ A;  3LAM A;  1RDU A;  3OBY A;  3OYH A;  3RVC A;  1HPZ A;  3ALY A;  1K8A O;  3DI6 A;  4RW9 A;  4DTM A;  3CJC A;  3UKU A;  3AGR A;  2YKN A;  1JLE A;  3VGL A;  5KTQ A;  4DQI A;  1ATR A;  4DSI A;  1Q8I A;  4CHN A;  3HPG A;  4H0V B;  2GX9 A;  4FSV A;  3HO1 A;  4DV5 K;  3VGK A;  4CEE A;  3AVJ A;  3I0S A;  1N8R O;  3V4I A;  4KHW A;  2YHB A;  1U2V B;  3CET A;  5E26 A;  4YOX A;  3R1X A;  4J2E A;  4CJE A;  4JKA A;  4CF1 A;  4HHT A;  3AVI A;  3R9P A;  4WQ4 A;  5C42 A;  1NJX A;  1IG9 A;  1X9J A;  4JRQ A;  4WE1 A;  3T1H K;  1BIS A;  4LSL A;  2FBX A;  3BY5 A;  3OTO K;  3CCU N;  4YOY A;  1RGI A;  4KO0 A;  3IUC A;  3ULE A;  3OBW A;  3QET A;  2GWJ A;  1W0H A;  3CCM N;  1VSM A;  5I42 A;  4IFE A;  3MMV A;  2KQ2 A;  5FRO A;  2HF3 A;  3BP8 A;  1GLE G;  1O1W A;  2BAN A;  4U67 L;  3CCS N;  4FWS A;  4E1N A;  3OYF A;  1Q9X A;  2YNH A;  4H4O A;  5AQF A;  4E19 A;  3CJB A;  3ZX2 A;  4LH5 A;  2P5G A;  4WFN L;  4M3Z A;  3A5M C;  1LWC A;  3ENH A;  1L3S A;  3SPZ A;  4BR7 A;  3NVK A;  1JJ2 M;  3CCJ N;  4HWI A;  1ASV A;  4RTF D;  4E7J A;  3V9X A;  1A5X A;  4FJL A;  5TKY A;  1D8Y A;  5BPL A;  4CHP A;  1NMN A;  1CXQ A;  2IDO A;  1BI4 B;  3R3L A;  4CEZ A;  1ZBU A;  3VEN A;  2HHS A;  3NMU A;  4EZ9 A;  3ZCM A;  1E4F T;  4M45 A;  3DLL L;  2CH6 A;  4MQ3 A;  2DFH A;  5KQ8 A;  4Z4I A;  1X3M A;  4BC4 A;  4EP5 A;  1NKC A;  3U9D A;  3BUZ B;  1VQN N;  4FM1 A;  1NOY A;  1HLU A;  3HSC A;  4H5R A;  3KZB A;  2QKK A;  1W7A A;  1TYQ A;  3H3N O;  4DWI A;  1HNV A;  1IKV A;  4B9L A;  1BGX T;  4JYA K;  2RE2 A;  3DM2 A;  3JSM A;  3PX0 A;  4B9Q A;  3G0Z A;  3ZSW A;  3BF3 A;  4O0J A;  2P9S A;  1JCE A;  1X9M A;  4MLE A;  3O1B A;  3C7N B;  3SQ2 A;  1YHQ N;  2HHV A;  4CZL A;  3ZSO A;  2Q36 A;  3QFP A;  1SZ2 A;  1ZBS A;  1V4T A;  4M7X A;  3MEC A;  2OAN A;  4H5T A;  4JI7 K;  2W41 A;  3C6U A;  3FE1 A;  1T7P A;  4DU3 A;  1GOC A;  4YOU A;  1ZBI A;  4YDU A;  1RT2 A;  1HX1 A;  1G99 A;  4DQR A;  2P9U A;  5AQO A;  2OPS A;  2E1Y A;  1RBV A;  3B6P A;  2E5L K;  4FZX C;  1YUW A;  3OYG A;  2EX3 A;  4EIA A;  4BRK A;  4FWP A;  1KC8 O;  1KVB A;  1IJJ A;  4XH5 A;  3H46 O;  3L4Q A;  1ZBL A;  5D3G A;  2YHW A;  1UAX A;  3KK7 A;  1Y97 A;  1YT3 A;  4JKC A;  5IWA K;  4KHY A;  2O8C B;  3VPZ A;  2YHY A;  3QBW A;  2PYL A;  1LV5 A;  4B3R K;  3CPE A;  4JD2 A;  3H6E A;  3RMB A;  3CER A;  1GLB G;  3ZX0 A;  1QHT A;  1NLV A;  4N56 A;  2RF2 A;  4H0P A;  4JKG B;  4CEB A;  3ULD A;  4CJS A;  2VGM A;  3ID6 A;  2ETJ A;  2G8H A;  3QEX A;  5JS1 A;  3WT0 A;  3IKM A;  3TAQ A;  3WNH A;  2X6N A;  1R0A A;  3V1Q A;  4CGG A;  1RT4 A;  1NK0 A;  4JI0 K;  4KB0 A;  4QOZ B;  4BVP A;  4Z4C A;  2OPR A;  2NNW A;  5BPN A;  5LMU K;  3NH0 A;  1VQ6 N;  4OPH A;  2P9K B;  4OJR A;  4M3T A;  2DFE A;  4QAG A;  1XMO K;  4FJK A;  1EX4 A;  3CC2 N;  5FRN A;  4OLA A;  5AQG A;  3LAN A;  4QS8 A;  2OA8 A;  2ZWH A;  3NVM A;  3VQ6 A;  1U48 A;  3VEY A;  4KHU A;  2YHX A;  4PWD A;  4F2R A;  4LF5 K;  4GV3 A;  4FXD A;  3J7A P;  1TKT A;  3L0Q A;  3VF6 A;  4GV9 A;  2HVH A;  3T69 A;  2PBD A;  3G25 A;  4FW1 A;  1RCH A;  2HB5 A;  4EHU A;  3HST B;  1RBR A;  4DTU A;  3TAR A;  4O5F A;  1U6Z A;  4DTO A;  3J8A A;  4FVM A;  4WCE L;  3EZW A;  4CF9 A;  2ASP A;  2P5O A;  3MAQ A;  2VCP A;  1VQ8 N;  3MN5 A;  4CZK A;  3BDP A;  4ELU A;  3TAB A;  2I5J A;  3LDN A;  3LDP A;  4GVM A;  3VQQ A;  3MN6 A;  3OHR A;  1ILY A;  3HBT A;  3VQ8 A;  2QWP A;  1I94 K;  2O8D A;  3RMD A;  5JVG L;  4ILG B;  3SJJ A;  3M3Z A;  3GL1 A;  5C2F A;  3FZF A;  5E41 A;  2VWK A;  4DF8 A;  4NB4 A;  4DR2 K;  2EWS A;  3OY9 A;  2W6K A;  3THY A;  4CEQ A;  4FWK A;  3O3F A;  2BGG A;  2YNF A;  3OYC A;  5C25 A;  3JXU A;  3T1A A;  4X62 K;  1SL2 A;  5FPE A;  2OPP A;  2GUP A;  4B8A B;  4DFP A;  3KLI A;  4FPB A;  2UUA K;  2IIR A;  3CFP A;  3THX A;  4B9N A;  2GTD A;  2QI2 A;  1ASU A;  1BQN A;  3E1Y A;  1ITG A;  2UXB K;  3NGI A;  3O3G A;  4IOC L;  3LDS A;  3PLA A;  1TGO A;  5DMR A;  3KLH A;  1YI2 N;  4CHZ A;  2D1K A;  3VQP A;  3SYZ A;  4FK0 A;  3VMF B;  2HMP A;  3RSE A;  1QQM A;  2PAV A;  1BIU A;  5BRD A;  3EYZ A;  2D5R A;  2HMI A;  4C8O A;  4C1N I;  4ISG A;  3ID8 A;  3D2E B;  1DGK N;  4CHY A;  2YNG A;  1RIL A;  2DFF A;  3UE5 A;  1VK0 A;  2HOE A;  3BGR A;  5EU7 A;  3A2F A;  3D2F A;  3CM5 A;  1LAV A;  1YJ9 N;  2CGJ A;  3O9U A;  3CF5 L;  1M1K O;  1P8Z A;  1WLJ A;  1T3V A;  4DQQ A;  1DTT A;  1HYZ A;  3PIO L;  4KV8 A;  4M41 A;  4CED A;  1SQK A;  3AO4 A;  3NAE A;  2RKI A;  3K9K A;  4JK8 A;  4DV7 K;  1S9E A;  1IKX A;  1YVU A;  1EET A;  3THW A;  2QWM A;  4XH4 A;  4CBU A;  2O4G A;  1RDB A;  2HHW A;  4J2D A;  3FR0 A;  4QS7 A;  4C23 A;  3I56 N;  3P83 D;  3NF7 A;  1HQE A;  1NBW A;  3L4I A;  5FPN A;  4YNQ A;  5J2P A;  1HRH A;  4IFV A;  2WTU A;  1KTQ A;  3CM6 A;  3VQA A;  3IS9 A;  3R8E A;  2HHU A;  3M8Q A;  5AQU A;  3C95 A;  4K42 A;  3T7Z A;  2E6M A;  1NJI O;  3J80 O;  4E1M A;  2FF3 B;  1XNQ K;  3TAM A;  2G8W A;  4O0I A;  4KBO A;  4DB3 A;  4CF8 A;  1JKH A;  4CJT A;  4DS4 A;  1U4B A;  4IJN A;  5KRT A;  3F73 A;  3EN9 A;  3GBT A;  4BDP A;  4FJ9 A;  5A2Q O;  1D4X A;  4CF0 A;  5LY3 A;  1JL1 A;  1RDA A;  3TSU A;  2UUC K;  4LC9 B;  3TTF A;  4FJN A;  4C8K A;  5LJV A;  1J9A A;  4FOE A;  4JK9 A;  3RRG A;  2WUS A;  2XY7 A;  3S3N A;  4DUY K;  1IH7 A;  1O13 A;  4DTX A;  4N5S A;  4DV3 K;  2KW4 A;  4DKW A;  3TSQ A;  5KPT A;  2WOM A;  3FZM A;  3LM2 A;  4Z4H A;  4KHN A;  5BN9 A;  3AVM A;  2E88 A;  4FWL A;  4FW2 A;  1L5U A;  2E2N A;  5HRN A;  4DFM A;  4I6M A;  2W40 A;  3PUF A;  5JMV A;  5H1S Q;  2CH5 A;  3DXK A;  3DXM A;  4JI6 K;  2X74 A;  4EHT A;  4BE0 A;  3TI0 A;  1NNE A;  4GKK K;  3K5O A;  1KVC A;  4NCG A;  4B3O A;  3F2K A;  4CJW A;  2DPN A;  2VG6 A;  2CGK A;  3LP2 A;  1QVF M;  3QNN A;  1QVG M;  2O8E B;  4IO8 A;  1RDD A;  5F2R A;  1NGC A;  4L3Q A;  4BR4 A;  4BGB A;  1VSI A;  5M1F A;  3O08 A;  2A3Z A;  4CI6 A;  2DY4 A;  1CLQ A;  3WXJ A;  3O3H A;  5AZJ B;  2FSJ A;  1S1T A;  4GMJ B;  5TKW A;  3OS1 A;  4F4K A;  3OJU A;  3WNE A;  2NRZ A;  1FW6 A;  4RW6 A;  4AF1 A;  3QIC A;  2Q2R A;  4IWV A;  4ISE A;  3ZSX A;  3VA3 A;  3HM8 A;  1XQS C;  1T44 A;  5LMN K;  1VQ7 N;  3NBP A;  3LPU A;  4BRM A;  5JLF A;  4FJH A;  3KWG A;  4O8U A;  1XI1 A;  4CES A;  4DR4 K;  1U49 A;  3KD5 E;  2YKM A;  3NHG A;  4BQL A;  1IBL K;  3BZK A;  4CVN E;  4BY9 C;  1TK5 A;  2V51 B;  2YHA A;  1EWQ A;  4A5B A;  5J1E A;  3ISN C;  1RTJ A;  4CK2 A;  2P9N B;  1RNH A;  4M3Y A;  3CCE N;  5LJW A;  3PIP L;  3VEW A;  1CZB A;  1RT1 A;  5KPZ A;  1X3N A;  4KB1 A;  1S5J A;  1S1X A;  1LW2 A;  1K8K A;  4CFD A;  1C1B A;  2QEX N;  4F3T A;  2BH1 A;  2IVO A;  1TKD A;  4CJR A;  3R6M A;  4DG1 A;  3RMA A;  5HP1 A;  2G8V A;  4KRE A;  1BCM A;  4OKE A;  1A5W A;  2P9P A;  3WXL A;  2ZQB A;  3VEZ A;  4NO7 A;  4Q5V A;  1N6Q A;  2KKZ A;  3SBT A;  4FK2 A;  4BRA A;  3CQY A;  2E2O A;  5CYM A;  1HMV A;  3VGM A;  1WAF A;  5ADX H;  5C2D A;  5C15 A;  3S9H A;  3H45 C;  4IDH A;  2D0C A;  5C12 A;  1ZXO A;  1S22 A;  4RW4 A;  1TV6 A;  4CZJ A;  2KHO A;  3H1V X;  4DCH A;  3NE6 A;  4DFK A;  3NGY A;  2QTD A;  4GV6 A;  3UKR B;  1NWK A;  3U6F A;  3PX6 A;  4IOA L;  5HOO A;  3FFK B;  2A1R A;  1B9F A;  4E0D A;  4A2A A;  4CZF A;  3HXM A;  3OW2 M;  1Z26 A;  3LP0 A;  5M1P A;  1QTM A;  4LH4 A;  2OTL N;  1T6C A;  2GEM A;  2Q31 A;  4FJX A;  3MN7 A;  4FJ8 A;  1K9M O;  4G9Z A;  1RDC A;  1JCG A;  3TAE A;  3H08 A;  4JHD A;  4W5O A;  4A5A A;  4BG8 A;  3C6H A;  4DQS A;  2Z1G A;  5DK5 A;  1RFQ A;  1NGB A;  5JIC A;  1E4G T;  4Y1C A;  4CF2 A;  1TK8 A;  3TAG A;  3OYD A;  3DXM B;  2ATQ A;  2XY6 A;  4ILJ A;  3AO5 A;  1LW0 A;  1WSG A;  1IBM K;  4DSL A;  3QLH A;  1D5A A;  1YF5 L;  3AAQ A;  4I2Q A;  4FYD A;  5AZI B;  4KRF A;  4ZTJ A;  1VAZ A;  4DV2 K;  3D45 A;  4CZI A;  3WNG A;  4DSF A;  1I39 A;  2F8T A;  2Y1I A;  1A5V A;  1VQK N;  4I2P A;  4HUF A;  1BOT O;  2HST A;  1YXQ A;  4B8C A;  1EKE A;  3WXM B;  4AQY K;  2VG7 A;  1J53 A;  3O9S A;  3VEX A;  4O4G A;  1Z25 A;  3HM9 A;  5HL7 L;  3CQ8 A;  1NK9 A;  1DT9 A;  4OO1 J;  2F7T A;  4KTZ A;  3MWT A;  1J5E K;  2UXD K;  3SAH A;  3M8S A;  2FBY A;  3VEV A;  2P9I A;  3AAR A;  1LCU A;  4G1Q A;  1CXU A;  4BQZ A;  3DLG A;  4DHY A;  3DRR A;  3CC4 N;  3OYA A;  4MO4 A;  5AQJ A;  4UQG A;  3V9S A;  4IFY A;  4AHU A;  1KLN A;  1MA9 B;  1XHX A;  4FJM A;  1GLL O;  4FCY A;  3W0L A;  4F2S A;  1Y64 A;  3O9Q A;  5KGX A;  4LD0 A;  1GLC G;  3IDH A;  4DV1 K;  4FWN A;  3GE1 A;  3ZT1 A;  2ZF5 O;  3SQ4 A;  4BDY A;  4ZTF A;  1BHL A;  2CGL A;  1WAJ A;  1IG8 A;  3WEE B;  3KLE A;  3EE9 A;  2A42 A;  1SKW A;  3RR7 A;  1MWM A;  4C1N K;  1VSK A;  5LL6 Z;  2VWJ A;  3LM9 A;  1VHX A;  1ZC6 A;  2GEL A;  1QSL A;  3QIO A;  3HPH A;  4O5B A;  3IMX A;  1N36 K;  4Z94 A;  2G8F A;  4M3X A;  3QBX A;  4CJ7 A;  3VQB A;  3TTD A;  3BF1 A;  1W2B M;  1OVQ A;  2QWQ A;  1NGG A;  2NLX A;  5GIO A;  1QSY A;  2NUB A;  2A6A A;  4BRO A;  2B5J A;  3U8X A;  2Q0U A;  1HYV A;  4F9O A;  1N5Y A;  3AVB A;  4YOR A;  3H3O B;  1EXQ A;  4ISF A;  4J8F A;  2FBV A;  4JS4 A;  3C0B A;  3ZEU B;  1S1V A;  2F96 A;  3AA5 X;  4OPA A;  2ZE2 A;  3CHW A;  2PFU A;  4B3S K;  3KHY A;  3K2P A;  3NF9 A;  3HOT A;  2E2Q A;  5FPD A;  4AHC A;  1YJW N;  3UKU B;  1KLM A;  1SUQ A;  4HTU A;  3DLB A;  2O8F A;  1BO5 O;  4FM2 A;  3DWL A;  3PSI A;  1Q18 A;  4BGA A;  3RR8 A;  3QFU A;  2E4L A;  2QM1 A;  4FVU A;  1WNS A;  1VQ9 N;  4A61 A;  4ELT A;  5ADX A;  3L2R A;  1WSF A;  4CBX A;  3HK2 A;  4DR1 K;  3CJA A;  3NH1 A;  4FOI A;  1NKE A;  3I8D A;  2HHT A;  4DTP A;  2OPQ A;  3LDO A;  2NZT A;  4EAH D;  1TAQ A;  3Q7C A;  4CCH A;  4E7I A;  4CIF A;  3M6G A;  3FGU A;  1QQN A;  3HZ6 A;  4IXC A;  2E2P A;  2WBN A;  3HVR A;  5MLC Q;  1IBK K;  4OX9 K;  3U9Z A;  2F8S A;  5AFU H;  1UA0 A;  3P1G A;  3O1W A;  1JCF A;  1G15 A;  1WBB A;  3VF4 A;  3OYJ A;  1C0G A;  5CYQ A;  3CPW M;  1VSH A;  4CZG A;  4JN4 A;  3DLH A;  3ULE B;  4PKH A;  3TTC A;  3HP6 A;  1HNI A;  3SBG A;  3HPO A;  4BAC A;  3CJ1 A;  2XHB A;  4CD1 A;  3Q7B A;  3O9T A;  4DV4 K;  1NJZ A;  4JI5 K;  3GDQ A;  3LDQ A;  4LY7 A;  3SMP A;  2KLA A;  2Z1H A;  3UB5 A;  3N4P A;  2D0B A;  3P31 A;  4AH9 A;  3SZ2 A;  1RTI A;  2IAJ A;  3MED A;  5BR8 K;  4F3O A;  1NGD A;  2HNY A;  4WF9 L;  3AO1 A;  3QEI A;  3EL2 A;  2W6L A;  1JLB A;  3ZSY A;  4ZHR A;  2NRH A;  1QSS A;  4DR5 K;  3VTH A;  1NK8 A;  1BWF O;  4M3R A;  1VRU A;  5KRS A;  4X64 K;  3EKU A;  1N32 K;  3K5N A;  4K0K K;  2V52 B;  3OS2 A;  4FJG A;  1NGJ A;  3FZH A;  2JLE A;  1X1P A;  2HHH K;  2VGN A;  1Q86 O;  4OPJ A;  4BRP A;  5CE3 A;  1NGH A;  4NLC A;  5HLF A;  2Y1J A;  4CIG A;  4WYB A;  3K58 A;  4BDZ A;  1WSI A;  4KHS A;  4LFB K;  3TR8 A;  5C10 A;  4CJL A;  3FFI A;  4RCH A;  3TSP A;  3V81 A;  3HOS A;  4Z4E A;  4CJK A;  1TYQ B;  4CEC A;  3O9R A;  4H5N A;  5AQQ A;  3I8B A;  3PSF A;  4AHV A;  4HVJ A;  3NCI A;  4K8X A;  1ZYQ A;  3QIP A;  4H8K A;  4GVE A;  3EY1 A;  2D0P A;  2P9S B;  3GG4 A;  2IS3 A;  1HNZ K;  3MN9 A;  1NG9 A;  1UOC A;  3MXI A;  4BVO A;  2P9L A;  3KK3 A;  3AAP A;  4CJF A;  2IVP A;  1L3U A;  1KQS M;  1IKY A;  1GOB A;  4CZE A;  5BN8 A;  3C65 A;  4UY8 O;  4LF6 K;  4JNE A;  4DR6 K;  3V9W A;  4BRL A;  3T3F A;  5DM6 L;  4NXN K;  3CI5 A;  2W42 A;  3BEX A;  2P9U B;  1K73 O;  2Q3S A;  2OCE A;  1LWE A;  3HRG A;  4E7K A;  3MWP A;  1BCO A;  3SV3 A;  4J2A A;  4IEI A;  2GBZ A;  4CGF A;  4BWM A;  2Q97 A;  1U47 A;  1OH7 A;  3DLK A;  4DQP A;  4Y1D A;  1RDW X;  3AVN A;  4K43 A;  1JXB A;  3O4N A;  1YIT N;  3W3D A;  2PYJ A;  4FLV A;  3KLG A;  2YJE A;  4B9V A;  4JD2 B;  3L3U A;  4CJ4 A;  2O8B A;  3HJF A;  4JK7 A;  2E6L A;  4AHT A;  5IT9 O;  4BRD A;  5J2Q A;  3OYE A;  1BA0 A;  4PL7 A;  3LAK A;  2QWL A;  2XO7 A;  5JVH L;  1N34 K;  3CFR A;  3SJH A;  5FPM A;  2A41 A;  3WNF A;  3ZET A;  3SPY A;  1XWL A;  4IG0 A;  1WB9 A;  2FLO A;  5AQV A;  3F9M A;  3DRP A;  1TAU A;  1KAX A;  1VQ5 N;  3QML A;  1MU2 A;  3ZT3 A;  5SWM A;  1TKX A;  1Q9Y A;  1VQM N;  3HI0 A;  4JKD A;  3VOV A;  1R59 O;  4L8R B;  3KK1 A;  1CZ9 A;  4BR2 A;  3TWH A;  4OPK A;  2ZGY A;  4ICL A;  4CFC A;  5AFU A;  1HKB A;  4O8K A;  4W5T A;  2Z1I A;  5AQZ A;  5KI6 A;  4B08 A;  1RBT A;  3VQD A;  4KHP K;  3P4I A;  4OLB A;  5AQW A;  1LOT B;  2YV0 X;  4H0X B;  1NK4 A;  3M5R A;  1C0F A;  3CYM A;  4BWJ A;  1ESV A;  3VER A;  1NMD A;  4PA1 A;  1NOZ A;  2BDP A;  5HRS A;  4EZ6 A;  3EZ5 A;  2JWK A;  4PKI A;  4KH5 A;  3K59 A;  3VEO A;  2I7P A;  5M1Q A;  5BPM A;  3J81 O;  1BQM A;  5HRR A;  3WQU A;  3DYA A;  4LF8 K;  4KAZ A;  4A2B A;  2O8D B;  3KKS A;  3A8Y A;  4OKJ A;  3VET A;  1VSE A;  4GNI A;  3MEE A;  3CME N;  3TAN A;  3QNO A;  3NF6 A;  3VQ9 A;  1HPM A;  3CQX A;  3V9Z A;  3THY B;  4DTJ A;  3LDL A;  4B1V A;  4B9U A;  4LFA K;  1VSL A;  3MEG A;  3AA3 A;  1U2V A;  4CJ3 A;  3THX B;  4B1Z A;  1NU0 A;  3M1F A;  1S3X A;  4FWQ A;  3SK3 A;  4KHQ A;  3L3V A;  2Z1J A;  1RT5 A;  1BDG A;  3EO3 A;  2IVN A;  2HBM A;  4BR9 A;  1WOQ A;  3KLF A;  2HNZ A;  3LZJ A;  4DU1 A;  4A59 A;  1HNX K;  4CGD A;  4JKE A;  1U45 A;  2UXC K;  5AQS A;  4FLU A;  1XNR K;  3RSE B;  1TKZ A;  1SV5 A;  5CHI A;  3TPQ A;  4PY5 A;  4H5V A;  4H0T B;  3F9K A;  4LF9 K;  4CEA A;  5AQN A;  1SKR A;  1QQO A;  2HVI A;  2FBT A;  2HW3 A;  3O5B A;  1TK0 A;  3MX5 A;  5KQD A;  2OZM A;  2XY8 A;  2HHX A;  3EEQ A;  2UYT A;  3QO9 A;  2HHQ A;  3KKR A;  1J5O A;  4V19 S;  3S3M A;  2D4W A;  4B3T K;  3D0P A;  3D2F B;  2D0A A;  4CGH A;  3ZT0 A;  3OYN A;  3O8M A;  4PKG A;  1W9H A;  3FLC O;  4BRH A;  4FJJ A;  3D6R A;  3AVH A;  5JLH A;  1NJY A;  5CR4 A;  1UWB A;  1HUX A;  2QWN A;  2VQF K;  3S3O A;  2KTQ A;  3AVF A;  3VES A;  1WBD A;  3A5L C;  4H5W A;  3THW B;  4HUE A;  1L3T A;  1LWF A;  4HUG A;  3JS6 A;  1BIZ A;  5M1K A;  4YHH K;  3CFO A;  3MX2 A;  2KFN A;  4BRE A;  4JS5 A;  3K5L A;  4DSJ A;  3NGZ A;  4M3U A;  1SL1 A;  1HKC A;  3PO4 A;  1OVY A;  2FF6 A;  4J2B A;  3DLR A;  1VQL N;  1BG3 A;  3ENO A;  4FZY A;  4ID5 A;  1YVN A;  2PZS A;  1C0T A;  3OVN A;  4I9Q A;  4LFC K;  5HBM A;  2NRV A;  1S1U A;  1REV A;  4JEP A;  4C8L A;  3HYF A;  4DLE A;  3THV A;  1KD1 O;  4FO0 A;  3DJC A;  1XUP O;  2UU9 K;  4FLY A;  3JAM O;  3B6O A;  5DM7 L;  5ELZ A;  3QIN A;  1MWK A;  1WN7 A;  5K14 A;  2Q0R A;  3C7N A;  4FJ7 A;  5AQT A;  1X9S A;  3L2Q A;  3PX4 A;  4FL9 A;  2V7Z A;  4Z0U A;  4WFB L;  1KRP A;  4PUO A;  3WQT A;  3FZK A;  2X78 A;  4HTL A;  4DF4 A;  5AQI A;  3LWL A;  1Q82 O;  5E84 A;  4I9L A;  4RW8 A;  3RRH A;  2HF4 A;  3VQ7 A;  4BE2 A;  3SMS A;  1KXP A;  4XIU A;  4IO9 L;  4FJI A;  5T7B A;  1D9F A;  5BRH A;  4I6M B;  3OYL A;  3OS0 A;  4YY3 K;  1HKG A;  3AVA A;  4CK1 A;  1W97 L;  3DXK B;  2O8C A;  4YOV A;  1NGI A;  5FRM A;  3PY8 A;  4FZZ A;  3HT3 A;  3HTV A;  2FSK A;  1Q7Y O;  3VQE A;  2OZS A;  1QE1 A;  2YI1 A;  2H3G X;  1U04 A;  1SS6 A;  4Y0W A;  4JKG A;  4BRQ A;  4LF7 K;  2QK9 A;  3RTV A;  3CCQ N;  4GW6 A;  3VF2 A;  3NF8 A;  2J4R A;  3TAP A;  3BZC A;  3E66 A;  4M7Y A;  4CEO A;  4M42 A;  1JLF A;  2WC9 A;  1KFD A;  1T8E A;  1TUY A;  3OJS A;  3SNN A;  1HR0 K;  1QHA A;  3AA2 A;  1RBU A;  1YTA A;  3PV8 A;  1EQY A;  3U4L A;  1KAY A;  4M63 C;  3N4Q A;  5AQL A;  5J2M A;  1FKO A;  2HBL A;  4BRC A;  5JS2 A;  3B8A X;  2P9K A;  3U3Y A;  2IGI A;  5BRE A;  4DTN A;  1BU6 O;  5F0X A;  1XC3 A;  2B4J A;  4YDU C;  3RWU A;  1P90 A;  2UUB K;  3VN5 A;  1JL2 A;  1DKG D;  1WSJ A;  1C0M A;  5FDL A;  4OVL A;  4KI4 A;  5GAD P;  5BRF A;  3SI6 A;  3TAF A;  3MCA B;  3DLE A;  4K25 A;  2YJF A;  4CZH A;  3SQ0 A;  2KFZ A;  2JWL A;  3DOL A;  5EY4 A;  2HBJ A;  5EX5 A;  3OYB A;  5GIP A;  3KIO A;  2FC0 A;  4BC3 A;  4YFU A;  4FPA A;  1K8K B;  1ATS A;  2ZJR L;  3K9J A;  4JV5 K;  1DTQ A;  4YOT A;  2F4V K;  1NK5 A;  3A5O C;  3T19 A;  4IDK A;  4W5Q A;  2QA4 N;  3OYK A;  1D9D A;  4BC5 A;  2P9P B;  2OYQ A;  5KPR A;  1VRT A;  4H0O A;  2QW9 A;  4N41 A;  1C1C A;  1RT6 A;  1DLO A;  1HJR A;  4EFH A;  5SZT A;  3MCP A;  2VG5 A;  3E01 A;  2D0O A;  3V9U A;  4U7B A;  4DTR A;  3KD1 E;  2JGU A;  2E8A A;  4W5R A;  4CZM A;  3HVT A;  1XC9 A;  2IC3 A;  3CIP A;  3ZYY X;  4JKH A;  3F5T A;  3SUP A;  1GLA G;  3ASM A;  1FK9 A;  3WUH A;  4CW7 B;  2P1J A;  5AQR A;  3MXJ A;  2NRX A;  3QEP A;  1BL3 A;  3H1Q A;  1BUP A;  4DU4 A;  3IFR A;  3OA9 A;  4FWO A;  4CGJ A;  4FWM A;  4NLB A;  4OGE A;  3A0I X;  4TSX A;  4LF4 K;  2YX6 A;  4CJP A;  4Z4G A;  1J54 A;  4IEE A;  4CER A;  1Q81 O;  1H1V A;  4CIE A;  5HRO A;  3CG7 A;  3SUO A;  3DAW A;  3L2W A;  3WXK A;  2ASM A;  4JHD B;  4A57 A;  3ATV A;  3D2E A;  2G8K A;  4KTW A;  4RG8 A;  3VQ4 A;  5FLX O;  2ITM A;  3S41 A;  3P38 A;  2YNI A;  1S1W A;  4K41 A;  3NFA A;  3CCV N;  5BR9 A;  4HCB A;  5GAE P;  1ZBH A;  5CZ1 A;  4OKK A;  4N47 A;  1JXE A;  4FM0 A;  3KK2 A;  2XY5 A;  1TL3 A;  4NYF A;  1BA1 A;  3J7Z O;  3NDK A;  4IZ9 A;  3M8P A;  4ID1 A;  4KTQ A;  2P51 A;  4BRN A;  4FLW A;  3E9L A;  3V1O A;  4MDA A;  1L3V A;  1IKW A;  4B1X B;  4F8R A;  2A40 A;  1K6Y A;  3E9P A;  4R5P A;  4YOW A;  3ZSQ A;  3L8B A;  4IOX A;  4H0Y B;  4B9S A;  3VQ5 A;  4WQ5 C;  4BR5 A;  5I3U A;  4HCC A;  3CCL N;  3KJV A;  4B9M A;  3V1R A;  2P9I B;  4IKF A;  4KH6 A;  2OTJ N;  1RTH A;  3QEW A;  1HJO A;  5AQH A;  1B92 A;  3MK6 A;  3M8R A;  4B9T A;  1WSE A;  3CXC M;  2HND A;  1M90 O;  2A5X A;  3K57 A;  4FJ5 A;  2ZGZ A;  3MDQ A;  1TUU A;  1YAG A;  5AJ3 K;  3CC7 N;  4N76 A;  4Z4F A;  3ZLJ A;  3L2U A;  4JKF A;  4PL8 A;  3IAY A;  3V6D A;  1JLG A;  2QKB A;  2BTF A;  2A1S A;  1S72 N;  1VQO N;  4E1J A;  5EOY A;  4O44 A;  4AHS A;  1C1A A;  3VQC A;  2RHK A;  1XHZ A;  4DLG A;  3OYI A;  2F9T A;  3AGK A;  4O55 A;  2G8I A;  4KI6 A;  3DMJ A;  4JKB A;  3HL8 A;  2E20 A;  4CFB A;  3JYT A;  1NGF A;  4PHT X;  3VTI A;  1HYS A;  1S6P A;  2ZJQ L;  4DTS A;  1NGA A;  1WUA A;  4JI1 K;  3P5J A;  4IJA A;  2B6A A;  3AVG A;  3G10 A;  4OGC A;  3A5N C;  1HNW K;  4CK3 A;  4JAX A;  2FSN A;  4XH1 A;  4ELV A;  2ASO A;  4FLX A;  1QS4 A;  4JLH A;  4CD3 A;  1RT3 A;  5AQY A;  4BRI A;  3CJ7 A;  3CCR N;  2O8E A;  1ATN A;  5AQM A;  3C94 A;  1WSH A;  4KKO A;  2KZM A;  4E3S A;  1TL1 A;  2ITG A;  4E89 A;  5AZJ A;  1XMQ K;  1CZA N;  3SQ1 A;  2AA4 A;  1B9D A;  2PY5 A;  4FWR A;  4JRP A;  2O4I A;  4BG9 A;  2O8F B;  2G8U A;  1NM1 A;  4WQ5 A;  3QER A;  3O80 A;  1Z05 A;  4CHO A;  3SUQ A;  4PQU A;  3VA0 A;  4CFA A;  5CY4 A;  1NK6 A;  1IV0 A;  3AA4 A; 
#chains in the Genus database with same CATH homology
 1I39 A;  2RF2 A;  3ZT2 A;  4CEB A;  3ULD A;  1A5V A;  5HRP A;  4CJS A;  2Y1I A;  4PY5 A;  4I2P A;  3F9K A;  4HUF A;  4CEA A;  4B8C A;  4E7H A;  1SKR A;  1EKE A;  2HVI A;  1KVA A;  2FBT A;  2HW3 A;  1SL0 A;  2ETJ A;  1TK0 A;  2VG7 A;  2G8H A;  1J53 A;  3QEX A;  5JS1 A;  2OZM A;  2XY8 A;  2HHX A;  3ZSZ A;  1X9W A;  3TAQ A;  3QO9 A;  3WNH A;  4CEF A;  4O4G A;  2HHQ A;  3KKR A;  1J5O A;  2X6N A;  1KFS A;  3S3M A;  3D0P A;  1Z25 A;  3HM9 A;  3SUN A;  3L2V A;  3V1Q A;  3CQ8 A;  2D0A A;  1R0A A;  1S6Q A;  4CGG A;  1NK9 A;  4CGH A;  3ZT0 A;  3OYN A;  1RT4 A;  1NK0 A;  1W9H A;  4KB0 A;  4FJJ A;  4KTZ A;  4QOZ B;  3AVH A;  3M8S A;  4Z4C A;  2FBY A;  1NJY A;  2OPR A;  4MFB A;  2GV9 A;  3NH0 A;  1UWB A;  4G1Q A;  1CXU A;  3S3O A;  3DLG A;  2KTQ A;  3LAL A;  3AVF A;  1QQC A;  4OJR A;  3DRR A;  4M3T A;  2DFE A;  4QAG A;  3SV4 A;  3OYA A;  3ZT4 A;  4FJK A;  1EX4 A;  1YTU A;  5FRN A;  4UQG A;  3V9S A;  4DS5 A;  3KTQ A;  4OLA A;  3MXM A;  4IFY A;  4AHU A;  3LAN A;  1KLN A;  3I0R A;  4HUE A;  1XHX A;  3U3G A;  1L3T A;  2OA8 A;  1LWF A;  4FJM A;  4HUG A;  3VQ6 A;  1EP4 A;  1T03 A;  4FCY A;  4W5N A;  4C8N A;  1BIZ A;  4F2S A;  5KGX A;  4LD0 A;  1U48 A;  4KHU A;  1NKB A;  3CFO A;  2KFN A;  4PWD A;  4F2R A;  4JS5 A;  2RN2 A;  3ZT1 A;  3K5L A;  3SQ4 A;  3NGZ A;  4BDY A;  4DSJ A;  4M3U A;  4ZTF A;  1SL1 A;  3LWM A;  4FXD A;  1BHL A;  3PO4 A;  1TKT A;  1WAJ A;  4J2B A;  3KLE A;  3DLR A;  4M3W A;  1KCF A;  4CJU A;  2ZD1 A;  4FK4 A;  2HVH A;  3C6T A;  4FZY A;  4ID5 A;  3QES A;  3RMC A;  1SKW A;  3RR7 A;  3IG1 A;  1FXX A;  4FW1 A;  2PZS A;  1C0T A;  1RCH A;  1VSK A;  3OVN A;  2HB5 A;  3AV9 A;  2VWJ A;  4I9Q A;  3HST B;  1RBR A;  5HBM A;  4DTU A;  4IBN A;  3TAR A;  2WON A;  1S1U A;  1REV A;  3AO2 A;  4DTO A;  4C8L A;  4FVM A;  1QSL A;  3QIO A;  3HPH A;  3HYF A;  4CF9 A;  4DLE A;  2P5O A;  2XRI A;  4O5B A;  3MAQ A;  4M3X A;  3THV A;  2G8F A;  1NJW A;  4I7F A;  1RT7 A;  4NCA A;  4FLY A;  3BDP A;  4ELU A;  3TAB A;  3B6O A;  2I5J A;  4GVM A;  3VQQ A;  3PO5 A;  3VQB A;  3QIN A;  1QSY A;  1WN7 A;  2NUB A;  3VQ8 A;  5K14 A;  3RMD A;  2B5J A;  3SJJ A;  4FJ7 A;  1X9S A;  1HYV A;  3L2Q A;  3PX4 A;  4CJV A;  1N5Y A;  5E41 A;  3AVB A;  2VWK A;  2BE2 A;  1LAW A;  1EXQ A;  4DF8 A;  4Q0B A;  3HP9 A;  4Z0U A;  2FBV A;  4JS4 A;  3LP1 A;  1UA1 A;  1KRP A;  4PUO A;  3OY9 A;  4CJQ A;  3SCX A;  1S1V A;  4CEQ A;  2F96 A;  2X78 A;  4RW7 A;  3O3F A;  2BGG A;  2YNF A;  3OYC A;  5C25 A;  3AA5 X;  4DF4 A;  2ZE2 A;  1F21 A;  3T1A A;  3NH2 A;  4HCC A;  3LWL A;  4EP4 A;  1SL2 A;  4KPY A;  2DTU A;  2OPP A;  4I9L A;  3K2P A;  3AVK A;  4RW8 A;  4B8A B;  3KLI A;  3RRH A;  4CGI A;  3NF9 A;  3AVC A;  4DFP A;  1IO2 A;  5J2N A;  2X6S A;  3CFP A;  4B9N A;  1T05 A;  3VQ7 A;  4AHC A;  4BE2 A;  3QEV A;  1RBS A;  1ASU A;  1KLM A;  4XIU A;  1BQN A;  4FJI A;  5T7B A;  1SUQ A;  1D9F A;  1FKP A;  1ITG A;  3OYL A;  3NGI A;  4HTU A;  3OS0 A;  3DLB A;  4FM2 A;  3AVA A;  2RPI A;  3O3G A;  4CK1 A;  3LDS A;  1TGO A;  5DMR A;  3RR8 A;  2E4L A;  5FRM A;  3PY8 A;  4FLZ A;  5KGW A;  1WNS A;  3KLH A;  4ELT A;  4FZZ A;  4CHZ A;  3HT3 A;  3VQP A;  3L2R A;  1WSF A;  3SYZ A;  4FK0 A;  3VQE A;  3HK2 A;  1C0U A;  2OZS A;  1QE1 A;  3ZSV A;  3NH1 A;  4NCB A;  3LP3 A;  1BIU A;  1U04 A;  3EYZ A;  2D5R A;  2HMI A;  1NKE A;  3I8D A;  2R7Y A;  2QK9 A;  3RTV A;  4DMN A;  5CZ2 A;  4C8O A;  2HHT A;  1I3A A;  2OPQ A;  4DTP A;  4GW6 A;  3NF8 A;  4CHY A;  4QCL A;  3TAP A;  1TAQ A;  1VSJ A;  2YNG A;  4CEO A;  1RIL A;  4CCH A;  2DFF A;  4CIF A;  4E7I A;  4M42 A;  1JLF A;  1VK0 A;  1KFD A;  1T8E A;  3DRS A;  4C8M A;  3BGR A;  5EU7 A;  4AHR A;  3A2F A;  1SKS A;  3OJS A;  3SNN A;  3HVR A;  3AA2 A;  4BE1 A;  1RBU A;  3CM5 A;  3OYM A;  3O4Q A;  4DFJ A;  2F8S A;  1YTA A;  1UA0 A;  3P1G A;  1LAV A;  1G15 A;  4KFB A;  2AJQ A;  3OYJ A;  3PV8 A;  3ZSR A;  3K5M A;  5CYQ A;  3ITH A;  1GOA A;  1VSD A;  1WLJ A;  4DQQ A;  1DTT A;  1HYZ A;  1VSH A;  4KV8 A;  3LPT A;  1FKO A;  5J2M A;  4M41 A;  5JS2 A;  3DLH A;  1JLQ A;  4CED A;  3AO4 A;  3NAE A;  4FLT A;  4DSE A;  3HP6 A;  1C6V A;  1TVR A;  3U3Y A;  2RKI A;  2IGI A;  4H4M A;  1HNI A;  4E7L A;  1JLA A;  1S9E A;  1IKX A;  1YVU A;  3HPO A;  4BAC A;  4DTN A;  2XHB A;  1EET A;  2B4J A;  1NJZ A;  3RWU A;  2O4G A;  1ASW A;  4LY7 A;  1RDB A;  3VN5 A;  1JL2 A;  2HHW A;  4J2D A;  3LZI A;  2Z1H A;  1WSJ A;  2D0B A;  1C0M A;  5FDL A;  3P83 D;  3NF7 A;  4AH9 A;  3SZ2 A;  4K8Z A;  1BI4 A;  1HQE A;  1RTI A;  2IAJ A;  4OVL A;  4CJ5 A;  4KI4 A;  3MED A;  3SI6 A;  3TAF A;  1RTD A;  4F3O A;  4YNQ A;  3DLE A;  2F8T A;  2HNY A;  3AO1 A;  3QEI A;  3SQ0 A;  1VSF A;  5J2P A;  1JLB A;  3UIQ A;  2KFZ A;  1HRH A;  3DOL A;  4IFV A;  3ZSY A;  4ZHR A;  1JLC A;  3OYB A;  1QSS A;  3KIO A;  1KTQ A;  3CM6 A;  3VQA A;  1KSP A;  2FC0 A;  3IS9 A;  1NK8 A;  2HHU A;  4M3R A;  4YFU A;  5C24 A;  3M8Q A;  1VRU A;  5KRS A;  3C95 A;  1SV5 A;  2E6M A;  4IG3 A;  4CE9 A;  4E1M A;  3K5N A;  2EHG A;  3OS2 A;  1DTQ A;  3TAM A;  2G8W A;  1NK5 A;  4FJG A;  4O0I A;  3T19 A;  2JLE A;  1X1P A;  4CHQ A;  4CF8 A;  4IDK A;  1JKH A;  3DOK A;  4CJT A;  4OPJ A;  2IOC A;  4DS4 A;  4W5Q A;  1U4B A;  3OYK A;  1D9D A;  4DSK A;  5KRT A;  3F73 A;  5HLF A;  3AO3 A;  2OYQ A;  2Y1J A;  3IRX A;  4AIL C;  4LSN A;  4BDP A;  4FJ9 A;  1VRT A;  4CIG A;  1NK7 A;  4CF0 A;  2GUI A;  2QXF A;  3K58 A;  4BDZ A;  1WSI A;  4KHS A;  1JL1 A;  1RDA A;  1ZBF A;  4FJN A;  4N41 A;  2LSN A;  1C1C A;  4C8K A;  4NYN A;  1RT6 A;  1DLO A;  3TR8 A;  4CJL A;  1J9A A;  1HJR A;  3FFI A;  3V81 A;  3AVL A;  5SZT A;  1HQU A;  1S9G A;  3RRG A;  2XY7 A;  3S3N A;  3KD1 E;  2VG5 A;  1IH7 A;  3E01 A;  4CJK A;  4CEC A;  3V9U A;  4DTR A;  4Z4E A;  2JGU A;  4DTX A;  4N5S A;  4W5R A;  2KW4 A;  3HVT A;  1XC9 A;  4AHV A;  2IC3 A;  2KZZ A;  4HVJ A;  3NCI A;  3LAM A;  4K8X A;  2WOM A;  3ASM A;  4Z4H A;  1FK9 A;  3SUP A;  1ZYQ A;  3AVM A;  3QIP A;  4KHN A;  2P1J A;  4H8K A;  3MXJ A;  3OYH A;  3EY1 A;  1BL3 A;  1HPZ A;  3QEP A;  3ALY A;  3DI6 A;  4RW9 A;  4DTM A;  4DU4 A;  2IS3 A;  4FW2 A;  1L5U A;  4CGJ A;  5HRN A;  4DFM A;  2YKN A;  1JLE A;  1UOC A;  3PUF A;  3MXI A;  3KK3 A;  4OGE A;  4TSX A;  4CJF A;  5KTQ A;  1L3U A;  1IKY A;  1GOB A;  4DQI A;  4DSI A;  4BE0 A;  2X74 A;  3TI0 A;  1Q8I A;  4CJP A;  4Z4G A;  4CHN A;  3K5O A;  3HPG A;  1KVC A;  4NCG A;  4B3O A;  1J54 A;  4CJW A;  4CER A;  3HO1 A;  3V9W A;  2VG6 A;  3LP2 A;  4CEE A;  3AVJ A;  4CIE A;  3T3F A;  3CG7 A;  3QNN A;  3SUO A;  5HRO A;  3I0S A;  3L2W A;  4KHW A;  3V4I A;  2YHB A;  2W42 A;  1RDD A;  2Q3S A;  1VSI A;  4J2E A;  2DY4 A;  1LWE A;  4CJE A;  4E7K A;  2G8K A;  1BCO A;  4KTW A;  4CF1 A;  3O3H A;  2GBZ A;  4RG8 A;  4BWM A;  3VQ4 A;  4CGF A;  4HHT A;  3SV3 A;  3AVI A;  1U47 A;  1S1T A;  3DLK A;  4GMJ B;  2YNI A;  3OS1 A;  4F4K A;  5C42 A;  1S1W A;  4DQP A;  3OJU A;  3WNE A;  4Y1D A;  1NJX A;  3AVN A;  1IG9 A;  4JRQ A;  4WE1 A;  1BIS A;  4LSL A;  2FBX A;  1JXB A;  3O4N A;  4RW6 A;  2PYJ A;  3NFA A;  4FLV A;  3KLG A;  4KO0 A;  4B9V A;  4HCB A;  3ZSX A;  3VA3 A;  1ZBH A;  5CZ1 A;  4OKK A;  4N47 A;  3L3U A;  1JXE A;  4FM0 A;  4CJ4 A;  3KK2 A;  2XY5 A;  1TL3 A;  3QET A;  3HJF A;  4NYF A;  2E6L A;  3NBP A;  3LPU A;  3NDK A;  1W0H A;  4AHT A;  3M8P A;  4ID1 A;  4FJH A;  1XI1 A;  4KTQ A;  4CES A;  1VSM A;  5J2Q A;  3OYE A;  2P51 A;  5I42 A;  1U49 A;  4FLW A;  2KQ2 A;  3V1O A;  3LAK A;  5FRO A;  3KD5 E;  1L3V A;  2YKM A;  3NHG A;  1IKW A;  4F8R A;  1O1W A;  2BAN A;  2XO7 A;  1K6Y A;  1TK5 A;  3CFR A;  4R5P A;  2YHA A;  3WNF A;  4E1N A;  3ZSQ A;  3L8B A;  3OYF A;  1Q9X A;  2YNH A;  1XWL A;  4IG0 A;  3SPY A;  4B9S A;  4H4O A;  3VQ5 A;  5I3U A;  3DRP A;  4E19 A;  3ISN C;  1RTJ A;  4CK2 A;  5J1E A;  3KJV A;  3V1R A;  4B9M A;  4LH5 A;  1TAU A;  1RNH A;  4M3Y A;  4IKF A;  2P5G A;  4M3Z A;  1CZB A;  1RT1 A;  1LWC A;  1RTH A;  4KB1 A;  1S5J A;  3QEW A;  1MU2 A;  1S1X A;  1LW2 A;  1B92 A;  3ZT3 A;  1TKX A;  5SWM A;  3SPZ A;  1L3S A;  1Q9Y A;  3M8R A;  4CFD A;  1C1B A;  4N56 A;  4B9T A;  1ASV A;  4E7J A;  1WSE A;  3V9X A;  2HND A;  4F3T A;  1A5X A;  3K57 A;  1TKD A;  4L8R B;  4FJL A;  1D8Y A;  4FJ5 A;  3KK1 A;  4CHP A;  4N76 A;  4CJR A;  3RMA A;  4DG1 A;  1CZ9 A;  5HP1 A;  1CXQ A;  2IDO A;  1BI4 B;  4Z4F A;  3TWH A;  4CEZ A;  4OPK A;  1ZBU A;  3L2U A;  2G8V A;  4KRE A;  1BCM A;  4OKE A;  1A5W A;  3IAY A;  4EZ9 A;  2HHS A;  3ZCM A;  4M45 A;  4ICL A;  2ZQB A;  4CFC A;  3V6D A;  4DSF A;  1JLG A;  4Q5V A;  2QKB A;  4MQ3 A;  2DFH A;  1N6Q A;  2A1S A;  4W5T A;  2Z1I A;  4Z4I A;  5KI6 A;  4EP5 A;  1NKC A;  4B08 A;  1RBT A;  3VQD A;  4FK2 A;  4OLB A;  4O44 A;  4FM1 A;  4AHS A;  2YV0 X;  1NOY A;  1C1A A;  3VQC A;  1XHZ A;  5CYM A;  4DLG A;  1HMV A;  1NK4 A;  3OYI A;  2QKK A;  1WAF A;  3CYM A;  4BWJ A;  3S9H A;  4DWI A;  2D0C A;  4O55 A;  1HNV A;  4PA1 A;  4RW4 A;  1IKV A;  4B9L A;  1TV6 A;  1NOZ A;  2BDP A;  5HRS A;  2G8I A;  4EZ6 A;  3EZ5 A;  1BGX T;  4KI6 A;  3DMJ A;  3DM2 A;  3JSM A;  3PX0 A;  3HL8 A;  3K59 A;  4CFB A;  3JYT A;  3G0Z A;  4DFK A;  3NE6 A;  3ZSW A;  1BQM A;  5HRR A;  1CLQ A;  3NGY A;  4O0J A;  3DYA A;  4KAZ A;  1HYS A;  1S6P A;  4DTS A;  3KKS A;  1X9M A;  3U6F A;  3PX6 A;  4OKJ A;  1VSE A;  3SQ2 A;  2A1R A;  1B9F A;  2HHV A;  3MEE A;  3ZSO A;  4E0D A;  3TAN A;  3P5J A;  3QNO A;  3HXM A;  3NF6 A;  2B6A A;  4J2A A;  3AVG A;  3VQ9 A;  3MEC A;  1Z26 A;  3G10 A;  3LP0 A;  4OGC A;  4CK3 A;  3V9Z A;  4LH4 A;  1QTM A;  4DTJ A;  3D45 A;  4FJX A;  4B9U A;  4ELV A;  4FLX A;  1QS4 A;  4FJ8 A;  3C6U A;  1VSL A;  3MEG A;  3AA3 A;  4JLH A;  4DU3 A;  1T7P A;  1GOC A;  1RT3 A;  1ZBI A;  1RDC A;  1RT2 A;  3C94 A;  4DQR A;  1WSH A;  3TAE A;  3H08 A;  4CJ3 A;  2OPS A;  4KKO A;  4W5O A;  1RBV A;  3B6P A;  4E3S A;  2KZM A;  4FZX C;  1TL1 A;  2ITG A;  4DQS A;  2Z1G A;  5DK5 A;  4E89 A;  3OYG A;  1TK8 A;  4KHQ A;  3L3V A;  4Y1C A;  2EX3 A;  4CF2 A;  1B9D A;  2Z1J A;  1RT5 A;  4JRP A;  3SQ1 A;  2PY5 A;  2O4I A;  1KVB A;  3TAG A;  2G8U A;  3KLF A;  5D3G A;  1ZBL A;  3OYD A;  4KHY A;  1UAX A;  2ATQ A;  1Y97 A;  1YT3 A;  2HNZ A;  3LZJ A;  4DU1 A;  2XY6 A;  3AO5 A;  1LW0 A;  3QER A;  4CGD A;  1WSG A;  4DSL A;  3QLH A;  2PYL A;  1D5A A;  1LV5 A;  4I2Q A;  1U45 A;  4FYD A;  4CHO A;  3RMB A;  4KRF A;  3SUQ A;  4PQU A;  4ZTJ A;  3VA0 A;  4CFA A;  4FLU A;  5CY4 A;  1NK6 A;  1TKZ A;  1QHT A;  3AA4 A;  3WNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...