1UOCA

X-ray structure of the rnase domain of the yeast pop2 protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
286
structure length
263
Chain Sequence
PPIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIYGIDGDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure and Activity of the Yeast Pop2 Protein: A Nuclease Subunit of the Mrna Deadenylase Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords POP2
total genus 81
structure length 263
sequence length 286
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uocA00
3OY9A 3OYEA 4KRFA 4CK2A 5C42A 1TL1A 2VWKA 3L2RA 3TAMA 3QINA 1Z26A 5EU7A 4CFDA 5K14A 3QLHA 3QNNA 3LAKA 1VSEA 4DTNA 1CZ9A 3PY8A 5FRNA 1LWCA 4HCBA 5T7BA 2ITGA 3DOLA 3K59A 1YTUA 4JS4A 4B3OA 1S1UA 3A2FA 1N5YA 2Q3SA 4AH9A 3OYIA 4M42A 4CEQA 3SI6A 4CIGA 4W5OA 3CFRA 3AVJA 4PWDA 4DU1A 4DU4A 2QK9A 1J54A 2YKMA 4CJWA 4E1MA 1D5AA 3PO5A 3V81A 3PX0A 4TSXA 3QNOA 3AO3A 1Q8IA 3LP2A 4RW9A 4IFVA 5CYMA 1RDBA 5CY4A 4W5RA 1XC9A 2D0AA 1S9GA 4DFJA 2IOCA 1JLQA 1FXXA 3MXMA 5HRSA 2OA8A 3IG1A 3IRXA 3TAGA 4M3WA 1LAVA 3KLEA 1WNSA 4DG1A 1Y97A 1U47A 4CK3A 3AVCA 3HVRA 3G10A 3OYCA 4E7KA 1BIZA 4KHQA 4OGEA 3WNHA 4ZHRA 4KO0A 2FBYA 1KTQA 3MEEA 3V4IA 3OYHA 4FK4A 3PUFA 4GVMA 1EX4A 1TKTA 2X6NA 3V9UA 1VSJA 4OKJA 1SL0A 1NK0A 3VQBA 4DFPA 1SL1A 3RR7A 3OVNA 3CQ8A 4K8XA 3AO5A 5HP1A 2R7YA 3LP0A 1NK9A 4MQ3A 4XIUA 3ASMA 1X9SA 1JLBA 4C8OA 3LANA 1TKZA 4L8RB 2XHBA 5SZTA 1HQEA 1SKRA 4Y1CA 4CJSA 2BE2A 4HHTA 1Q9XA 4I9LA 1NOYA 2F8TA 1X1PA 2P1JA 3DRSA 3T19A 1RTIA 4FLXA 3SUOA 4FJIA 3HK2A 2GUIA 2YNGA 5FROA 4CJPA 4O44A 4N76A 3V1RA 2F8SA 3KLFA 3L8BA 4RW4A 4NCAA 1QQCA 2D0BA 4CFBA 1ZBHA 1A5XA 1JXBA 1C6VA 4B9NA 4AHSA 3PX4A 5E41A 3S9HA 4B9MA 4OLAA 2O4IA 1KVBA 5DK5A 4MFBA 1LW2A 2O4GA 1JKHA 3ZSOA 4LH4A 3TABA 1JLFA 1RTJA 2GBZA 4H8KA 3KJVA 4CESA 3SV4A 3AO1A 1DLOA 2PY5A 1O1WA 4OVLA 3MXJA 1QS4A 4DFMA 4KB0A 3OYKA 4DQQA 3P1GA 3MEGA 3SCXA 2XO7A 3ZSRA 4BE0A 1XWLA 2IGIA 1YVUA 5HRNA 2VG5A 4FM0A 3O3FA 5I42A 4DQIA 2OZSA 5KI6A 3KD1E 2OPPA 3QO9A 1NK5A 4M3RA 4FLUA 3C95A 3V9ZA 4E7HA 4AHRA 4OLBA 1NK7A 1VSIA 4B8AB 1KRPA 1IKWA 3MEDA 3MAQA 1FK9A 4G1QA 4JRPA 4FW2A 1KFDA 4FJ5A 4O5BA 1C1BA 3K2PA 3QIPA 4RG8A 3DRPA 4RW8A 4DU3A 1XI1A 3L3VA 1ZYQA 3C6TA 4F8RA 3EZ5A 1RBUA 2YHBA 3L2UA 3TAEA 1T03A 1NJZA 4UQGA 3LP3A 1U04A 1RT4A 1F21A 4CEEA 3WNEA 4I2QA 3RWUA 1JLCA 3OYLA 1S5JA 3P5JA 3B6PA 2AJQA 1SUQA 2VG6A 3DM2A 3LZIA 1K6YA 1RT3A 3QESA 1KSPA 4FJ7A 2KQ2A 3O4NA 3RRGA 4CCHA 2ETJA 4F2RA 3IAYA 3KTQA 1RDCA 2HMIA 1U49A 1BIUA 4CGHA 3CYMA 1UAXA 4HUGA 2Z1IA 3CFOA 2OPRA 4FJ8A 3HYFA 1QHTA 4CGJA 4E1NA 4DQRA 4EZ9A 4DTRA 2P5GA 4F4KA 3OYMA 1NKCA 2Y1IA 4AHUA 2FBVA 4BE2A 1NJYA 1LV5A 3SJJA 3VQCA 4FJLA 4B9TA 3DYAA 4DWIA 1RCHA 3KKSA 5D3GA 4DSLA 5KGXA 2XY7A 1S1TA 1DTQA 1IKXA 3DLGA 4KV8A 1W9HA 1BCOA 4CHPA 2A1SA 4NCBA 2G8FA 3AVIA 3ZSQA 2YKNA 3WNGA 5KTQA 1WAJA 3AVBA 4OGCA 3M8QA 4CJLA 3O3HA 4CIEA 4IG0A 1X9MA 3HPHA 4FW1A 3DMJA 4JLHA 2E6MA 4QAGA 2Z1HA 3FFIA 5C25A 4FLTA 3PO4A 4AHTA 4KFBA 4I2PA 3T3FA 3VQ5A 3KKRA 1J5OA 3ZCMA 3QEIA 2G8KA 5SWMA 1SV5A 3D45A 4CJ4A 4I7FA 1NKEA 1KLNA 4B9LA 4CJEA 3OYAA 1TK0A 2DFEA 3HPOA 4KTWA 2B5JA 4FM2A 4ID1A 3ZSWA 3HP6A 4AHCA 3TAFA 4PUOA 4OKEA 3CFPA 1C1CA 3M8RA 3L2QA 3LALA 3V9SA 4J2EA 4CHQA 1C1AA 4PQUA 4ELVA 3VQ6A 3U3YA 3IS9A 3AVFA 4CHYA 3AVGA 4KPYA 4LSLA 1QE1A 2B4JA 2E6LA 3DLRA 3TI0A 1NK6A 2G8HA 2ZQBA 4QCLA 4DTMA 4KI6A 3C94A 4Z4GA 5HBMA 3NAEA 3V1QA 4NCGA 1ITGA 4NYNA 3ZT0A 3QEXA 4CERA 2BDPA 4CJRA 4B8CA 4DTSA 4E89A 4JS5A 4FJHA 3HPGA 2Z1JA 4CJUA 4KTQA 4N41A 3NF9A 2XY6A 1CXUA 4EP5A 2OZMA 2G8VA 1W0HA 2EHGA 4W5QA 3HSTB 3ZT3A 4FJKA 3HL8A 1L5UA 1UOCA 3UIQA 4FK0A 4DTXA 4DSKA 4YNQA 4J2BA 1SKSA 2QKKA 3ZT1A 4JRQA 4CGFA 3NFAA 2YV0X 3AV9A 1NK4A 4FJNA 4M45A 3F73A 2E4LA 4C8KA 1T05A 4B08A 1HYZA 1VK0A 1B92A 1T8EA 3KK1A 3NDKA 1JLEA 4HUFA 1JLAA 2KZMA 3U3GA 4F3OA 1D8YA 3QEVA 4KB1A 4IG3A 4WE1A 4BWJA 3OYBA 4CFAA 3OYDA 3TANA 3F9KA 2QKBA 2HVHA 1RT1A 3ITHA 3HVTA 3NGZA 3NGYA 4HCCA 4CEZA 4Z4IA 4EZ6A 1KVCA 3RR8A 3QEPA 4DS4A 1HYVA 4M3YA 3S3MA 1EKEA 3KIOA 4BWMA 3RTVA 1HRHA 4CF1A 4E0DA 2ZD1A 1QSYA 2HB5A 1B9DA 3I0RA 4CJ3A 1C0MA 2HHQA 1KVAA 3OS1A 1HNIA 2G8UA 2PZSA 3LP1A 2LSNA 4CECA 4KI4A 2EX3A 4CJTA 4HTUA 1UA1A 3VN5A 1CLQA 3CM5A 4KHSA 2VWJA 2RF2A 3HXMA 1HYSA 3AA5X 2FBTA 4DTUA 4CEDA 3HT3A 2RN2A 4O0JA 2IC3A 3V9XA 1R0AA 2P5OA 4KHYA 3TARA 2XY8A 4CE9A 3QERA 2DY4A 4FVMA 2OPQA 4QOZB 4DF4A 4DSJA 4B9UA 1QTMA 1B9FA 2OPSA 4DQSA 2KTQA 3LWLA 1NJWA 4IBNA 5C24A 4O55A 1FKOA 3KLGA 4DTPA 2Z1GA 4CF0A 1TAUA 4CJVA 3M8SA 3SQ2A 3L3UA 3SQ0A 1UWBA 4BACA 1L3UA 3NE6A 3MECA 1TK5A 3C6UA 1KLMA 1VSMA 3EYZA 4ZTJA 1NKBA 1QSSA 3ZSZA 1J53A 3AVLA 4CF9A 3KD5E 4K8ZA 4KHUA 1RT6A 4FYDA 2QXFA 1BQMA 4Z4FA 1JXEA 3NCIA 2HHUA 3QETA 3OJUA 4FJXA 4KKOA 1J9AA 3V6DA 1RILA 1MU2A 3AVMA 5CZ1A 3ZT4A 1WSIA 3E01A 1JLGA 3NHGA 1EP4A 4CJ5A 4FM1A 1BI4A 4O4GA 1WN7A 1RT2A 4AILC 3L2VA 1TKXA 2YNFA 3HP9A 1L3TA 1BHLA 4YFUA 4FJGA 3VQ7A 1GOCA 1S1XA 3LDSA 1QSLA 2HNYA 2ATQA 2D0CA 1CZBA 1VSDA 3CM6A 3QIOA 5J2MA 1U4BA 4BDYA 1T7PA 4M3ZA 2BGGA 4OJRA 1YT3A 1BISA 1RTHA 4CK1A 3KK2A 3K57A 3SUPA 5FRMA 5FDLA 1JL2A 4ID5A 3NGIA 3SQ4A 1VRTA 1Q9YA 1ASVA 4M3XA 3OYNA 1G15A 4CJFA 4E7LA 1I3AA 1D9FA 4OPKA 2G8IA 1C0UA 4RW7A 3TAQA 2ZE2A 3ZSYA 4N56A 1HPZA 1TK8A 3PX6A 1I39A 5JS2A 5DMRA 3OS2A 4FLWA 3KLIA 4IKFA 2B6AA 4CJQA 3S3NA 3MXIA 4M3UA 4CIFA 3V9WA 1RBVA 2HHVA 3SPYA 2KFZA 2WOMA 1XHXA 2D5RA 3DLBA 1LWFA 4M41A 2YNHA 3SYZA 2HHWA 4J2DA 3K5MA 4DSFA 1RDAA 4KHNA 4O0IA 4CEOA 1XHZA 3NH1A 3PV8A 1WSEA 1ZBLA 3BDPA 4H4OA 2FC0A 1BGXT 4DFKA 4FK2A 1HMVA 4N47A 5J2PA 3K5LA 1DTTA 2YNIA 4FCYA 1BL3A 1YTAA 3G0ZA 4FXDA 4DSEA 4DS5A 2IS3A 4LH5A 3HO1A 1FKPA 3NH0A 3VA3A 2PYLA 3O4QA 1WSJA 1ASWA 5HRRA 4CEBA 4FJMA 4C8MA 4FJ9A 3LAMA 3DLEA 3NF8A 3KK3A 3VA0A 3SNNA 3S3OA 4M3TA 1VRUA 3K5NA 2HHTA 4KHWA 1S1WA 3OJSA 3DI6A 5HLFA 3JYTA 2RPIA 2BANA 3RMBA 1U48A 4FZXC 4ELTA 1NJXA 1HQUA 2XY5A 2A1RA 3AVKA 3VQDA 4B9SA 4EP4A 3K5OA 4CGDA 3BGRA 1GOBA 1NOZA 4AHVA 1REVA 1IKVA 3NBPA 3SZ2A 3TAPA 4W5NA 3VQPA 2DFHA 3QEWA 2RKIA 2GV9A 3H08A 1TL3A 4LY7A 1TV6A 3OYFA 1HNVA 3ZSVA 4Q5VA 3AVAA 3OYGA 1Z25A 3AO4A 1SKWA 3U6FA 1IKYA 2DFFA 3RMAA 2HVIA 3M8PA 3T1AA 3CG7A 3I8DA 4NYFA 1WSHA 2P51A 3DRRA 1HJRA 3AO2A 1EETA 1S6QA 3L2WA 5KGWA 1RDDA 2KFNA 1IO2A 2G8WA 2KW4A 4ELUA 4Y1DA 4OKKA 2FBXA 2IDOA 1RNHA 3AA3A 2WONA 3LPUA 3V1OA 3LWMA 4OPJA 1BQNA 2YHAA 1BCMA 4CHNA 1WSFA 1WAFA 5JS1A 1LWEA 3AA2A 3OYJA 4RW6A 4HVJA 3EY1A 4F2SA 4E7IA 3TWHA 4IFYA 5CYQA 1JL1A 1D9DA 5J2NA 3RMCA 1X9WA 1IG9A 2HHSA 1TGOA 4ZTFA 1NK8A 1VSKA 2HW3A 2HNZA 3AVNA 1WLJA 1WSGA 2VG7A 5HRPA 3KLHA 4HUEA 3JSMA 1U45A 3ZSXA 3SQ1A 5J1EA 4Z4HA 3P83D 4FJJA 4KREA 4FLZA 3THVA 3ALYA 1KFSA 1A5VA 2JGUA 4CHOA 4DTOA 4C8LA 2JLEA 4CJKA 1ZBFA 1S1VA 4I9QA 3VQ8A 4CFCA 4ICLA 4CEFA 3DLHA 4KAZA 4CGIA 1RT7A 4E7JA 5J2QA 3SUQA 4B9VA 4KTZA 3ZT2A 1RBTA 1SL2A 4Z4CA 4BDPA 4Z4EA 3LZJA 1ZBUA 4N5SA 3O3GA 5KRTA 4CF8A 1VSFA 1A5WA 4F3TA 4BDZA 2PYJA 3D0PA 3HJFA 3VQEA 2IAJA 5CZ2A 4GW6A 1ASUA 2I5JA 3AA4A 1RT5A 2X6SA 4CEAA 1L3SA 4Z0UA 1KCFA 3AVHA 4Q0BA 4DTJA 2HHXA 1TKDA 4W5TA 4FLVA 2X74A 2OYQA 4BE1A 3K58A 4H4MA 1N6QA 3DLKA 3NH2A 1VSHA 4FZZA 1S6PA 4PA1A 4CGGA 2F96A 2XRIA 3WNFA 4DSIA 3SUNA 2HNDA 2W42A 1RTDA 1RBSA 1TVRA 5I3UA 3DOKA 3SPZA 1IH7A 3VQQA 1S9EA 4E19A 5KRSA 4DLGA 1UA0A 4FZYA 5HROA 3OS0A 2Y1JA 1BI4B 4FLYA 4DF8A 1LAWA 4C8NA 1CXQA 4R5PA 2NUBA 3ISNC 4DLEA 2DTUA 3VQAA 3VQ9A 3RMDA 1LW0A 3I0SA 4DMNA 3ULDA 3B6OA 1C0TA 4CHZA 4E3SA 1RBRA 1VSLA 1EXQA 2X78A 4LD0A 4J2AA 4CF2A 4DQPA 4PY5A 3NF7A 2KZZA 3LPTA 3RRHA 4IDKA 1L3VA 4LSNA 1GOAA 1TAQA 3NF6A 3SV3A 1ZBIA 4GMJB 3TR8A 3HM9A 3VQ4A
chains in the Genus database with same CATH superfamily
4KRFA 5C42A 1TL1A 2NRTA 3QINA 1Z26A 5ELZA 5EU7A 3FGUA 2ZJQL 5AZJA 3QNNA 5FRNA 1VSEA 3NVMA 4DTNA 1VQPN 4B3OA 1EWRA 2D0OA 3A2FA 1N5YA 3WXKA 3SI6A 1WBBA 3AVJA 4DU1A 4O5FA 4E1MA 5AR0A 3V81A 4TSXA 4EAHD 3CETA 1X9JA 3DXKA 3NMUA 2D0AA 1S9GA 4DFJA 3MN5A 3IRXA 3TAGA 3ZEUB 5AQUA 2HBKA 3ZETA 4M3WA 2F4VK 1Y97A 1U47A 4Y0WA 4E7KA 4KHQA 2E2NA 2F9WA 1YF5L 3MEEA 3SLCA 3OYHA 4FK4A 2QTDA 3N4QA 3TU5A 3EEQA 1NK0A 3V9UA 1VSJA 3O9TA 1SL0A 4DFPA 1SL1A 4BC2A 5HP1A 1OH8A 3LP0A 2P9PB 4BR0A 4MQ3A 1JLBA 1YI2N 4OPAA 1LCUA 1HQEA 4CJSA 1NOYA 4GV9A 2F8TA 2HBJA 2P1JA 3HK2A 3T19A 1RTIA 2VGMA 1VQON 2D0PA 4H5RA 3VENA 3TTFA 4JI4K 4CFBA 4IO8A 1HNWK 1MWKA 5C15A 4NLBA 1Q86O 4YOTA 3ID6A 3J7ZO 2GBZA 3KJVA 3AO1A 3SK3A 1XMQK 3MDQA 4B9QA 3A5MC 4FWRA 2QWQA 3P1GA 2NRVA 4BE0A 2IGIA 4FM0A 3ATVA 4DQIA 4KHPK 5KI6A 3WQUA 3THWA 4OLBA 1VSIA 4B8AB 4JRPA 2D1KA 4FSVA 1C1BA 3QIPA 4DUZK 3R8EA 4RW8A 2NLXA 5CE3A 1XMOK 1TYQB 4F9OA 4FPAA 4CZIA 1RBUA 5C10A 2QM1A 3RWUA 2AJQA 3OYLA 2AP1A 3LZIA 2O8FA 1RT3A 1KSPA 2Q2RA 1GLDG 4M7YA 4FJ7A 3RRGA 1RFQA 4CCHA 1QQNA 4BREA 4F2RA 4GV6A 3E9PA 3L0QA 2V7YA 3CFOA 4FJ8A 2V52B 1QHTA 3J8AA 2AA4A 3OYMA 1MWMA 4AHUA 1LV5A 3DYAA 3GOIA 4LFBK 3KKSA 1YJ9N 5D3GA 5KGXA 3DLGA 4U67L 2A1SA 5FPDA 5KTQA 5LL6Z 4JEPA 1WAJA 3M8QA 4BRMA 3HPHA 3VESA 5C25A 2E6MA 4QAGA 2Z1HA 4AHTA 4KFBA 2W6LA 3EKSA 3T3FA 2HF3A 3FLCO 1JCEA 3ZCMA 2G8KA 5C2FA 1GLAG 1SV5A 4B1YB 1NKEA 1KLNA 2DFEA 2B5JA 4BC3A 4FO0A 3CFPA 1C1CA 1GLFO 3M8RA 3LDQA 4JI6K 4CHQA 1C1AA 4YOXA 3U3YA 1BA0A 2IIRA 4EHTA 2B4JA 2E6LA 3DLRA 3SBTA 4CD3A 4IEIA 3AGRA 5HBMA 1ITGA 3ZT0A 2YJFA 2KLAA 4BGAA 4CERA 5IWAK 4DTSA 4DKWA 3HPGA 1QHAA 4N41A 5AQTA 1IBMK 1CXUA 2OZMA 3HL8A 1L5UA 1UOCA 2F7TA 4FK0A 1SKSA 3ZT1A 2F9TA 1NK4A 3AV9A 3GBTA 2E4LA 4C8KA 3MN6A 4BQZA 1T3VA 1JLAA 3U3GA 3QEVA 4BRHA 3OYBA 4WE1A 4BWJA 3EE8A 3OYDA 3TANA 4K43A 3CJCA 5DM7L 2HVHA 1RT1A 4FWSA 4Z4IA 5CR4A 1HYVA 4M3YA 1Q81O 1HRHA 2HB5A 3GDQA 4CBXA 1C0MA 2ASOA 3OS1A 4JKCA 2HBLA 3GE1A 5KQDA 2PZSA 4V19S 2LSNA 3VN5A 1T6CA 2RF2A 1M90O 1HYSA 4CEDA 2P5OA 2RN2A 3V9XA 2XY8A 2DY4A 4FVMA 4DR6K 1NGDA 4QOZB 1GLEG 3FZKA 1NJWA 4DTPA 5C24A 3IKMA 2YHYA 5E84A 3NE6A 3MECA 4MO4A 4YORA 4FYDA 3KD5E 1BQMA 4X62K 4DV6K 2HHUA 3V6DA 1RILA 3MN9A 3ZT4A 5BRDA 2VCPA 3E01A 3QFPA 3J80O 1J6ZA 4CJ5A 4O4GA 3H1VX 1RT2A 1BA1A 5GADP 2P9PA 3OTOK 1NJIO 1L3TA 4YFUA 1GOCA 2ZWHA 1QSLA 2HNYA 2ATQA 2D0CA 1U4BA 3Q7BA 1RTHA 3KK2A 3SUPA 5C12A 5FPEA 4FVUA 1D9FA 2G8IA 1C0UA 4CJ7A 2ZE2A 3LDPA 1TK8A 5JS2A 5DMRA 3OS2A 3ZETB 2B6AA 3V9WA 1ZXOA 1K8KA 3DLBA 3SYZA 1VQ9N 3DXKB 3HM8A 4LFAK 2CH6A 3O4WA 3BDPA 3FZLA 1BGXT 4DFKA 4N47A 3K5LA 2YNIA 4XH5A 1BL3A 3G0ZA 3FR0A 1NGEA 1ATNA 4U7BA 1WSJA 1ASWA 3ENBA 4CEBA 2PYLA 2YHXA 4C8MA 3DLEA 3VA0A 3MK6A 1VQLN 4OPHA 3DI6A 2RPIA 1U48A 3T1YK 3RMBA 4FZXC 2XY5A 5F1XA 3AVKA 2A1RA 4B9SA 3A5NC 4EP4A 3K5OA 4CGDA 1OVQA 2VYPA 3TAPA 3SZ2A 4W5NA 2DFHA 3QEWA 4JHDB 3ZSVA 3OYGA 3AO4A 1SKWA 3U6FA 2E1ZA 1BOTO 5ADXA 5FPNA 3T1AA 3CG7A 4BVOA 3I8DA 1WSHA 3AO2A 2WTUA 1S6QA 5KGWA 2QEXN 2KFNA 1IO2A 2G8WA 3CPEA 2QWMA 1EO1A 4X65K 2FBXA 1BQNA 5BPNA 3EY1A 2JWKA 2QWPA 1VQMN 4MLEA 1D9DA 1JL1A 1NK8A 2HW3A 2HNZA 1XC3A 3K0SA 1ESVA 2P9NB 4WFAL 3P83D 4FJJA 1MA9B 1H1VA 4FLZA 3ALYA 2JGUA 4QS8A 4KH4A 1S1VA 4JHDA 1Z6RA 1YUWA 3DLHA 1LOTB 1RT7A 2D4WA 4E7JA 3ZT2A 1RBTA 1SL2A 3CC4N 4JD2A 5KRTA 4CF8A 2IAJA 2PAVA 1TUYA 4C23A 4DTJA 3VERA 2HHXA 4W5TA 3DAWA 1N6QA 3NH2A 2F96A 3D6RA 4GKKK 3DOKA 3CQXA 4DLGA 4H03B 3O8MA 1LAWA 4R5PA 3CIPA 4H5WA 3MWPA 3ISNC 3F2KA 1W97L 1LW0A 4GY2B 1EXQA 2X78A 3DXMA 4PY5A 2OCEA 4IDKA 3OHRA 5AQZA 3DJCA 1GOAA 3OW2M 3I56N 3NF6A 5AQSA 1ZBIA 3TR8A 3HM9A 3PY8A 4KH5A 2WFBA 5ADXH 2P9LB 4FOIA 1IV0A 2VWKA 4JN4A 1NGJA 2GUPA 4HCBA 1VQ5N 2GELA 1YTUA 3VGLA 2ZJRL 4JKHA 4CIGA 3CFRA 3CHWA 5BN8A 1HR0K 3LL3A 1D5AA 3PO5A 3H3NO 3QNOA 4PKGA 4DR4K 3QFUA 4RW9A 5CY4A 4BR5A 1XC9A 2HMPA 1YVNA 2JWLA 3CMAN 4DV3K 3O1BA 3MXMA 1LAVA 4NLCA 2O8DB 3MX2A 4H0YB 4ZHRA 1NGHA 4HWIA 4H5TA 3AARA 5JVGL 3PUFA 3KWIA 1VHXA 1G99A 1TKTA 2X6NA 4OKJA 2UUAK 5M1PA 3ASMA 1X9SA 2XHBA 4Y1CA 2BE2A 1X1PA 4FLXA 3DRSA 4FWKA 4B1VA 3MWTA 3SUOA 4FJIA 4YOWA 4CJPA 3L8BA 1C0GA 1JXBA 3CJAA 4OLAA 3EO3A 1KVBA 5DK5A 5BPLA 4H0OA 2O4GA 1ILYA 2O8BA 1NNEA 3M6GA 2PY5A 1O1WA 3MXJA 4KB0A 4DQQA 3HZ6A 4YOUA 2XO7A 5HRNA 2UXCK 5TKYA 3O3FA 4H5VA 3C7NB 1KQSM 4M3RA 4CVNE 1SS6A 1SAZA 2FLOA 1HKBA 3C95A 3EKUA 5FPMA 4AHRA 3MAQA 4BG9A 1KFDA 4DU3A 1XI1A 3HOSA 3C6TA 4F8RA 2YHBA 3L2UA 3VF4A 1IG8A 4UQGA 1RT4A 1OVYA 1JLCA 1S5JA 3P5JA 3B6PA 3TSPA 1U6ZA 5JICA 1RDUA 1SZ2A 3LDLA 3KTQA 1RDCA 2HMIA 1IBLK 1BIUA 3CERA 4CGHA 1UAXA 2OPRA 4DTRA 3VTHA 3WXIA 3L4QA 3LDNA 1RCHA 4CZGA 4IDHA 2XY7A 1S1TA 3AVIA 5EVZA 1NU0A 3AVBA 3LDOA 3P4IA 3O3HA 1X9MA 4IG0A 2OTLN 3I8BA 3PO4A 4MLHA 5H1SQ 3QEIA 3HI0A 5SWMA 3D45A 4CJ4A 3OYAA 2KKZA 4B1ZA 3TAFA 4OKEA 4WFNL 2O8FB 3V9SA 3D2EB 4PQUA 2ZGYA 5KPZA 1W7AA 4CZHA 3TSQA 3TI0A 5TKWA 3HTVA 4Z4GA 1VQKN 3CCSN 4IJNA 2WBNA 3V1QA 4WYBA 4CJRA 5AFUH 5LMUK 1Y64A 4JS5A 3E9LA 3E1YA 4CJUA 4DR2K 4KTQA 1ZC6A 1Q18A 2VQEK 1E4GT 4B1XB 2GEMA 1W0HA 4FJKA 3L6QA 3VOVA 4DSKA 4IWVA 2IVOA 4JRQA 4CGFA 2P9KB 4M45A 3ZX0A 4BRNA 4B08A 3CJ1A 4BR2A 4KB1A 2QKBA 4IG3A 3QBWA 4IXCA 3BP8A 3QDKA 2IVPA 2FSNA 3QICA 1ATSA 1KVCA 4DR1K 3QEPA 3VETA 3S3MA 3VGKA 1EKEA 4E0DA 4CF1A 5AJ3K 1QSYA 4PKHA 3ZX2A 3SAFA 3I0RA 4CJ3A 2P9SB 1HNIA 3LM9A 3LP1A 4K42A 4CECA 2EX3A 5EOYA 2HOEA 1VQ4N 3AA5X 4JD2B 1R0AA 4O0JA 2PFUA 3TARA 4DB3A 3O1WA 3O08A 2OPQA 2OANA 4DSJA 1QTMA 3MX5A 4MDAA 3O6WA 1FKOA 2KHOA 4CF0A 2A3ZA 3L3UA 3SQ0A 5GINA 3ZEUA 4RWTA 4BACA 1EQYA 4JNEA 5AFUA 4ZTJA 4DV4K 1QVFM 2E5LK 4K8ZA 4GVEA 5AQWA 2NRXA 4FJXA 3IDHA 1WSIA 5I9EB 1S22A 1JLGA 1HPMA 3NHGA 3CCLN 1BI4A 1WN7A 2ASMA 3U9ZA 3HP9A 4FJGA 1BHLA 1M1KO 3E9OA 1E3MA 3LDSA 3CM6A 3QIOA 1CZBA 1VSDA 3CMEN 4BDYA 2ZM6K 4M3ZA 4H0XB 2NRWA 1J5EK 2VQFK 4OJRA 5AQFA 1BISA 2W41A 4CK1A 5FDLA 5EX5A 4M3XA 3NGIA 1Q9YA 1VRTA 4XH4A 1ASVA 4CJFA 4E7LA 1I3AA 4ISFA 5MLCQ 3T7ZA 2A5XA 3PX6A 4FLWA 3KLIA 4IKFA 1HLUA 4FOEA 4CJQA 3S3NA 3MXIA 4CIFA 1RBVA 4JI5K 2HHVA 2KFZA 2WOMA 2YNHA 2IVNA 3ZLJA 4J2DA 4DSFA 3VPZA 3PIPL 4KHNA 4CEOA 3CD6N 4H4OA 3WEEA 2FC0A 4H5NA 1GLJO 4FCYA 3LM2A 4FXDA 3CCVN 4DSEA 4DS5A 3TTDA 1RGIA 1FKPA 3VA3A 5M1FA 3VGMA 3NF8A 3KK3A 1S1WA 1BU6O 5HLFA 2VWBA 4JKBA 4CZKA 2VGNA 3EL2A 3BGRA 4X66K 1GOBA 3SBGA 3VQPA 3H08A 5F0XA 3HOTA 2Q0RA 4LY7A 3OYFA 4ILJA 4Q5VA 3AVAA 1Z25A 4NXMK 3RMAA 4BROA 5C2DA 2YJEA 2P51A 3DRRA 2J4RA 4EHUA 2YI1A 3L2WA 4DV0K 1WBDA 2KW4A 1DEJA 4FWOA 4Y1DA 5AQIA 3O80A 1RNHA 3V1OA 3LWMA 2RHKA 4BC5A 1SQKA 1BCMA 3H46O 1WSFA 1WAFA 3OYJA 4BY9C 3O9SA 4IFYA 1X9WA 1TGOA 1WOQA 4EIAA 4PL7A 1WSGA 5HRPA 1NMDA 1NLVA 3CJ9A 3ZSXA 1HNXK 3U9DA 5J1EA 4Z4HA 4KREA 4CJKA 4CEFA 5EY4A 4R79A 3BY5A 4KAZA 5M1KA 4OX9K 1QZ6A 3S41A 2Q1NA 4KTZA 4Z4EA 3CXCM 1VSFA 4JKAA 4F3TA 2PYJA 3VQEA 5CZ2A 3CCEN 3AA4A 3DXMB 2HHHK 1RT5A 4QS7A 1L3SA 2UXDK 1KCFA 3AVHA 4Q0BA 4FLVA 3KWGA 4BE1A 3HRGA 4JI1K 1S6PA 3VMFB 4CGGA 3THXA 4DSIA 3SUNA 2W42A 5AQNA 3QB0A 1IH7A 1UA0A 4FZYA 1N8RO 5HROA 4JK7A 4B3SK 3W3DA 4WF9L 3I0SA 4DMNA 4CHZA 4E3SA 4M63C 1RBRA 4LD0A 4J2AA 4CF2A 2DPNA 4FPBA 2O8EA 3KHYA 3UKUA 1L3VA 5LJWA 3AGKA 4GMJB 1N36K 4IZ9A 4M7XA 3L2RA 3TAMA 5K14A 3LAKA 1NG9A 4JS4A 3A5LC 1S1UA 2I7PA 2Q3SA 4AH9A 3OYIA 4CEQA 4W5OA 3A8YA 4DU4A 2QK9A 4DQ8A 4CJWA 3U4LA 3PX0A 3AAQA 3IUCA 4IFVA 3J7AP 1RDBA 4W5RA 4PKIA 2NRRA 1OH6A 2V7ZA 2IOCA 1JLQA 4DHYA 4BG8A 2OA8A 3IG1A 5KQ8A 3HVRA 3G10A 1BIZA 2Q97A 4KO0A 5AQOA 1NBWA 2CGKA 5LY3A 1NGBA 1EX4A 3D2FA 3VQBA 3W0LA 3OVNA 4K8XA 3AO5A 2R7YA 1NK9A 4XIUA 3H1QA 4C8OA 3LANA 4NXNK 3CI5A 5SZTA 4IJAA 1SKRA 4HHTA 4B1WB 1Q9XA 4I9LA 3C7NA 3T69A 2GUIA 4O44A 1N33K 2F8SA 1E4FT 1QQCA 3DLLL 1A5XA 1C6VA 4CW7B 3S9HA 4B9MA 4MFBA 4KH6A 1JKHA 3TABA 1ZBSA 2UXBK 4H8KA 1Q82O 4CESA 5LMNK 3SV4A 1YIJN 4DFMA 4OVLA 1QS4A 3OYKA 4ILGB 4DR3K 2OTJN 3MEGA 3SCXA 1XWLA 3KZBA 2VG5A 3VEVA 5I42A 2OZSA 3C6AA 3KD1E 3J7YP 1XUPO 1NK5A 3THWB 4FLUA 1NK7A 1KRPA 3MEDA 1FK9A 2HSTA 4A59A 4H0PA 4DR7K 2E8AA 4A5AA 4FJ5A 4O5BA 1ZBHA 1ZYQA 2YCHA 3TAEA 1NJZA 1U04A 2P9IA 2NZTA 3M3ZA 4I2QA 5AQYA 3PSIA 1KC8O 3TPQA 3EE9A 3QESA 4YHHK 2KQ2A 3O4NA 4BRFA 1DGKN 5AZIB 5F2RA 5JLHA 5BREA 4YDUA 3HYFA 4E1NA 4DQRA 4EZ9A 2P5GA 4F4KA 1NKCA 3KVGA 4YDUC 5AQHA 4FJLA 4B9TA 2P9IB 4C1NK 4BRIA 4GV3A 1XNRK 4CHPA 1DTQA 4NCBA 2NNWA 1W9HA 1BCOA 3ID8A 2YKNA 3WNGA 3SAHA 3G6EN 4CJLA 4OGCA 4CIEA 3EN9A 4FLTA 4JKEA 2QXLA 1VQ8N 1HKGA 1IBKK 3VQ5A 3KKRA 1J5OA 4LF6K 3C6HA 1NGFA 5KPRA 3CCUN 3HPOA 4LF9K 4ID1A 3ZSWA 4AHCA 4J2EA 4YOVA 4CHYA 2E20A 3WXJA 3AVGA 4KPYA 1QE1A 4FWMA 1NK6A 2G8HA 4ISEA 4KI6A 5CHIA 4ISGA 3UB5A 1VQ7N 5GIOA 1DT9A 4NCGA 4B8CA 4E89A 2GWKA 4FJHA 1IJJA 2Z1JA 3PLAA 3NF9A 2XY6A 2G8VA 2EHGA 3ENOA 4W5QA 3ZT3A 3CJ7A 2GWJA 4DTXA 4J2BA 2E88A 2QWRA 3AY9A 5DM6L 2FF6A 1HUXA 4NO7A 1KAYA 4IOCL 1VK0A 1V4TA 5AQQA 2ITMA 1JLEA 2KZMA 4B3RK 1TUUA 2QW9A 3VEYA 3MMVA 4CFAA 2O8BB 1XQSC 2P9NA 5E26A 3HVTA 3NGZA 1MDUB 3NGYA 3SMSA 4HCCA 4CEZA 3RR8A 3RVCA 4DS4A 4YY3K 3MN7A 4JKGA 4DV5K 4BWMA 2ZD1A 1B9DA 5A2QO 2HHQA 1KVAA 2G8UA 4XEIA 1W2BM 3CM5A 5HOOA 4KHSA 3HXMA 1CZAN 2YX6A 3HT3A 4BRPA 3F5TA 4CE9A 1WUAA 1GLLO 1T6DA 5AQXA 1B9FA 2OPSA 3K9JA 3LWLA 3THYB 4IBNA 4O55A 1TAUA 1KAZA 3BUZB 3M8SA 1L3UA 1KLMA 1VSMA 2UUBK 1QSSA 3ZSZA 4CF9A 5GAEP 1QQMA 4Z4FA 3OJUA 4RTFD 4KKOA 5CZ1A 3AVMA 5BR9A 3CC7N 1KXPA 4FM1A 4E1JA 3CQYA 3L2VA 4AILC 2E2OA 3VQ7A 3P31A 5B8HA 1S1XA 4LF8K 4PHTX 2BGGA 3H45C 3VEOA 5FRMA 3K57A 3SQ4A 3OYNA 1G15A 4OPKA 3ZSYA 4N56A 1HPZA 3OBYA 3BF3A 4AF1A 1NGGA 4J8FA 1RDAA 4O0IA 4DV1K 1XHZA 3NH1A 3PV8A 4LF5K 5HL7L 4FK2A 1DTTA 2BTFA 3CCRN 4ILHA 2IS3A 3HO1A 2YHWA 5JLFA 1X3NA 5HRRA 1YJNN 2P9UA 2QWOA 4FJMA 3LAMA 3S3OA 3FE1A 3R1XA 4LF4K 1VRUA 3K5NA 2HHTA 4KHWA 3OJSA 2O8CA 2H3GX 3JYTA 2PBDA 4ELTA 1NJXA 3ZX3A 4MDBA 3E66A 3WQTA 3VQDA 4B3MK 3MCAB 4CI6A 1NOZA 4AHVA 1REVA 1YJWN 2EWSA 3I33A 2RKIA 2GV9A 4FL9A 1K8AO 1TL3A 1TV6A 2GX9A 1HNVA 1WB9A 1VAZA 3A5OC 3M8PA 3J81O 4NYFA 3ULEB 1NWKA 1HJRA 3BEXA 1EETA 3R9PA 3CJBA 4I6MA 4EFHA 4ELUA 2FSJA 3AA3A 3LPUA 3THXB 1U2VB 4CHNA 4WCEL 3AA2A 4RW6A 3DWLA 1JCGA 4JI8K 3SMPA 4BVPA 4E7IA 4YOYA 5CYQA 5J2NA 1IG9A 2HHSA 4I6MB 1VSKA 3AVNA 1WLJA 2VG7A 4HUEA 3SQ1A 3JS6A 1D4XA 4BC4A 3R3LA 1KFSA 4CHOA 4C8LA 3QBXA 5AZJB 2UUCK 1ZBFA 3VQ8A 4ICLA 4WQ5C 4CGIA 3SUQA 4A2BA 4Z4CA 4IOAL 4BRCA 1A5WA 3N4PA 3UE5A 2I5JA 1NGCA 4G9ZA 2X6SA 5AQRA 4CEAA 4H0TB 4AM7A 1TKDA 4PL8A 3OA9A 2OYQA 5AQMA 3K58A 4H4MA 3DLKA 1VSHA 2P9UB 3F9MA 4LFCK 4PA1A 2BUPA 3VTIA 1RTDA 3AAPA 1RBSA 1GLCG 1TVRA 5I3UA 1S9EA 5KRSA 3ATUA 2Y1JA 4CBUA 1BI4B 3L4IA 4DF8A 3O5BA 4B3TK 1KD1O 2NUBA 4DLEA 3VQAA 3VQ9A 3RMDA 3B6OA 1C0TA 4DCHA 4JK8A 1K9MO 1VSLA 3CC2N 2KZZA 1P8ZA 1T44A 3LPTA 4LSNA 1JJ2M 4BRQA 3SV3A 4K41A 2ZF5O 1YAGA 2Q36A 3OY9A 3OYEA 3SJHA 1OKJA 4CK2A 3RSEA 4CFDA 4BRKA 3QLHA 1CZ9A 1LWCA 2A6AA 5T7BA 2ITGA 3DOLA 2HBMA 4A5BA 3K59A 3T1HK 4NB4A 2WC9A 5JMVA 3WT0A 4CBWA 4M42A 3FZHA 4PWDA 4CZJA 1X3MA 4WQ4C 1FJGK 3PSFA 1J54A 2YKMA 3SAGA 4A2AA 3AO3A 1Q8IA 4JI7K 2BH1A 3LP2A 2P9SA 5CYMA 1GLBG 1FXXA 5HRSA 3KLEA 4IO9L 1WNSA 2CGLA 4IFEA 3VF2A 4DG1A 4CK3A 3AVCA 3OYCA 4OGEA 3WNHA 3M1FA 3H3OB 2FBYA 1KTQA 2WUSA 3V4IA 5AQPA 4GVMA 1TYQA 3VEZA 2W6KA 3RR7A 1V4SA 3CQ8A 2Q31A 2P9KA 3OBWA 1YITN 1TKZA 3FZFA 4L8RB 4KBOA 4OO1J 1BWFO 2Q0UA 3UKRA 2YNGA 4JKGB 5FROA 4N76A 3V1RA 3KLFA 4RW4A 4NCAA 2D0BA 4C1NI 4B9NA 4AHSA 3PX4A 5E41A 2O4IA 4A62A 1LW2A 3ZSOA 4LH4A 3ULEA 4FWPA 1JLFA 4L3QA 1RTJA 3WXLA 1DLOA 4RCHA 3D2EA 2ASPA 1OH7A 4JV5K 3H6EA 3TSUA 3ZSRA 1YVUA 2A41A 1P90A 1HJOA 2OPPA 3QO9A 2GTDA 3V9ZA 4E7HA 2O8CB 1IKWA 4G1QA 3A0IX 4FW2A 1EWQA 4LC9B 4RG8A 3K2PA 3DRPA 3L3VA 3EZ5A 1T03A 3FZMA 4FWNA 3LP3A 1HNZK 1F21A 4CEEA 3WNEA 3JXUA 3KK7A 4CZLA 1SUQA 2VG6A 2QI2A 3GG4A 3DM2A 1K6YA 3O9UA 4A61A 1DKGD 1HX1A 2ETJA 3IAYA 4JKDA 1U49A 3CYMA 2HF4A 3UKRB 4HUGA 2Z1IA 4IEEA 4MO5A 4CGJA 5M1OA 3EZWA 1RDWX 2Y1IA 3C0BA 2FBVA 4BE2A 1NJYA 3SJJA 3VQCA 4O8KA 4DWIA 4Z94A 1QVGM 4DSLA 1IKXA 4KV8A 2G8FA 3ZSQA 4FW1A 3DMJA 4JLHA 3FFIA 2E2QA 4I2PA 5M1QA 5AZIA 4I7FA 4B9LA 4CJEA 1QZ5A 1TK0A 4KTWA 4FM2A 3HP6A 1N32K 5GAHP 4PUOA 3L2QA 3LALA 1HKCA 3K9KA 4ELVA 3VQ6A 4UY8O 2QWNA 3IS9A 3AVFA 4WQ4A 5FLXO 4LSLA 2ZQBA 4QCLA 4DTMA 5AQGA 3C94A 3NAEA 4NYNA 3QEXA 4FWQA 2BDPA 3WXMB 4EP5A 3HSTB 3UIQA 4JK9A 4YNQA 3VEWA 2QKKA 3BF1A 5GAGP 3P39A 3NFAA 3CCQN 2YV0X 5AQVA 4FJNA 3F73A 1S3XA 4BR4A 3PIOL 1BG3A 1T05A 1HYZA 1B92A 1T8EA 3GL1A 3KK1A 3NDKA 4HUFA 4F3OA 1D8YA 3F9KA 5BRFA 4DV2K 3IFRA 3ITHA 2V51B 2O8DA 4EZ6A 3G4SN 3KIOA 3RTVA 3ENHA 4BRLA 1NGAA 3CCJN 3CF5L 4KI4A 3B8AX 3O9QA 3QMLA 3G71N 4CJTA 4LF7K 4HTUA 1UA1A 1Q7YO 1CLQA 2VWJA 3D2FB 2FBTA 3O9RA 4DTUA 2IC3A 4JI2K 4KHYA 3BZCA 3QERA 4JYAK 4CZMA 5C0YA 4JI3K 4K0KK 4DF4A 4AQYK 4B9UA 2KTQA 4DQSA 4WFBL 3KLGA 2Z1GA 4CJVA 3SQ2A 5LJVA 1UWBA 2FF3B 2E2PA 4HTLA 1TK5A 3C6UA 3EYZA 1NKBA 1R59O 3P38A 1J53A 3AVLA 4KHUA 1RT6A 1C0FA 2QXFA 4GKJK 1JXEA 3NCIA 3QETA 1J9AA 4K25A 2QWLA 1MU2A 1U2VA 4BR7A 3U8XA 1EP4A 4BRGA 3VEXA 4XH1A 1TKXA 2YNFA 2I7NA 1BDGA 1N34K 1QQOA 4JKFA 1T7PA 5J2MA 1YT3A 5BR8K 1JL2A 4ID5A 5IT9O 4QS9A 5BRHA 1VQNN 4RW7A 3TAQA 5BPMA 3C65A 2FXUA 1I39A 3CCMN 2O8EB 5GIPA 1NM1A 4M3UA 3SPYA 4JI0K 1XHXA 2D5RA 1LWFA 4M41A 2HHWA 3K5MA 3BZKA 1WSEA 1ZBLA 3VF6A 1HMVA 5J2PA 4B1UB 1YTAA 2CGJA 3IMXA 3Q7CA 4BGBA 4IOXA 4LH5A 3NH0A 3O4QA 4H0VB 1VQ6N 4FJ9A 3SNNA 4M3TA 3R6MA 3CPWM 2P9LA 4X64K 4BRAA 1OH5A 2BANA 1HQUA 1BUPA 1NMNA 4FWLA 3NBPA 1IKVA 1XNQK 4DV7K 4O8UA 4CZFA 1I94K 1IKYA 2DFFA 2HVIA 2ZJPL 1YXQA 1RDDA 4OKKA 2IDOA 3ZYYX 2WONA 4OPJA 2CH5A 5AQLA 2YHAA 3MCPA 1O13A 3HBTA 5JS1A 1LWEA 2W40A 4HVJA 4F2SA 3TWHA 3RMCA 4ZTFA 3M5RA 1K73O 1U45A 3KLHA 5AQJA 3JSMA 1BO5O 5BN9A 3TTCA 5AQKA 1FW6A 3THVA 2UYTA 1A5VA 4DTOA 3I55N 3THYA 2JLEA 4I9QA 4CFCA 3RSEB 1JCFA 4BR9A 5J2QA 1NGIA 2ZGZA 4DR5K 4B9VA 2RE2A 1K8KB 5KPTA 2FSKA 1S72N 2QA4N 4BDPA 3NVKA 2A40A 3LZJA 1ZBUA 3G25A 4N5SA 3O3GA 1Z05A 4BDZA 3HJFA 3D0PA 2A42A 4GW6A 1ASUA 3FFKB 1YHQN 2NRZA 4Z0UA 2X74A 4A57A 4JAXA 4FZZA 4CZEA 2XRIA 3JAMO 3WNFA 2HNDA 3WUHA 4CD1A 3SPZA 3VQQA 2E1YA 4E19A 3OS0A 4FLYA 4AM6A 5M1NA 4C8NA 3WEEB 1CXQA 2UU9K 3D7EO 2DTUA 3ULDA 1KAXA 3HSCA 5JVHL 1ATRA 2NRHA 4BRDA 4DQPA 3NF7A 5EXWA 3RRHA 4GNIA 4DUYK 1TAQA 4WQ5A 4BQLA 3UKUB 3VQ4A
chains in the Genus database with same CATH topology
3OY9A 3OYEA 4KRFA 4CK2A 5C42A 1TL1A 2VWKA 3L2RA 3TAMA 3QINA 1Z26A 5EU7A 4CFDA 5K14A 3QLHA 3QNNA 3LAKA 1VSEA 4DTNA 1CZ9A 3PY8A 5FRNA 1LWCA 4HCBA 5T7BA 2ITGA 3DOLA 3K59A 1YTUA 4JS4A 4B3OA 1S1UA 3A2FA 1N5YA 2Q3SA 4AH9A 3OYIA 4M42A 4CEQA 3SI6A 4CIGA 4W5OA 3CFRA 3AVJA 4PWDA 4DU1A 4DU4A 2QK9A 1J54A 2YKMA 4CJWA 4E1MA 1D5AA 3PO5A 3V81A 3PX0A 4TSXA 3QNOA 3AO3A 1Q8IA 3LP2A 4RW9A 4IFVA 5CYMA 1RDBA 5CY4A 4W5RA 1XC9A 2D0AA 1S9GA 4DFJA 2IOCA 1JLQA 1FXXA 3MXMA 5HRSA 2OA8A 3IG1A 3IRXA 3TAGA 4M3WA 1LAVA 3KLEA 1WNSA 4DG1A 1Y97A 1U47A 4CK3A 3AVCA 3HVRA 3G10A 3OYCA 4E7KA 1BIZA 4KHQA 4OGEA 3WNHA 4ZHRA 4KO0A 2FBYA 1KTQA 3MEEA 3V4IA 3OYHA 4FK4A 3PUFA 4GVMA 1EX4A 1TKTA 2X6NA 3V9UA 1VSJA 4OKJA 1SL0A 1NK0A 3VQBA 4DFPA 1SL1A 3RR7A 3OVNA 3CQ8A 4K8XA 3AO5A 5HP1A 2R7YA 3LP0A 1NK9A 4MQ3A 4XIUA 3ASMA 1X9SA 1JLBA 4C8OA 3LANA 1TKZA 4L8RB 2XHBA 5SZTA 1HQEA 1SKRA 4Y1CA 4CJSA 2BE2A 4HHTA 1Q9XA 4I9LA 1NOYA 2F8TA 1X1PA 2P1JA 3DRSA 3T19A 1RTIA 4FLXA 3SUOA 4FJIA 3HK2A 2GUIA 2YNGA 5FROA 4CJPA 4O44A 4N76A 3V1RA 2F8SA 3KLFA 3L8BA 4RW4A 4NCAA 1QQCA 2D0BA 4CFBA 1ZBHA 1A5XA 1JXBA 1C6VA 4B9NA 4AHSA 3PX4A 5E41A 3S9HA 4B9MA 4OLAA 2O4IA 1KVBA 5DK5A 4MFBA 1LW2A 2O4GA 1JKHA 3ZSOA 4LH4A 3TABA 1JLFA 1RTJA 2GBZA 4H8KA 3KJVA 4CESA 3SV4A 3AO1A 1DLOA 2PY5A 1O1WA 4OVLA 3MXJA 1QS4A 4DFMA 4KB0A 3OYKA 4DQQA 3P1GA 3MEGA 3SCXA 2XO7A 3ZSRA 4BE0A 1XWLA 2IGIA 1YVUA 5HRNA 2VG5A 4FM0A 3O3FA 5I42A 4DQIA 2OZSA 5KI6A 3KD1E 2OPPA 3QO9A 1NK5A 4M3RA 4FLUA 3C95A 3V9ZA 4E7HA 4AHRA 4OLBA 1NK7A 1VSIA 4B8AB 1KRPA 1IKWA 3MEDA 3MAQA 1FK9A 4G1QA 4JRPA 4FW2A 1KFDA 4FJ5A 4O5BA 1C1BA 3K2PA 3QIPA 4RG8A 3DRPA 4RW8A 4DU3A 1XI1A 3L3VA 1ZYQA 3C6TA 4F8RA 3EZ5A 1RBUA 2YHBA 3L2UA 3TAEA 1T03A 1NJZA 4UQGA 3LP3A 1U04A 1RT4A 1F21A 4CEEA 3WNEA 4I2QA 3RWUA 1JLCA 3OYLA 1S5JA 3P5JA 3B6PA 2AJQA 1SUQA 2VG6A 3DM2A 3LZIA 1K6YA 1RT3A 3QESA 1KSPA 4FJ7A 2KQ2A 3O4NA 3RRGA 4CCHA 2ETJA 4F2RA 3IAYA 3KTQA 1RDCA 2HMIA 1U49A 1BIUA 4CGHA 3CYMA 1UAXA 4HUGA 2Z1IA 3CFOA 2OPRA 4FJ8A 3HYFA 1QHTA 4CGJA 4E1NA 4DQRA 4EZ9A 4DTRA 2P5GA 4F4KA 3OYMA 1NKCA 2Y1IA 4AHUA 2FBVA 4BE2A 1NJYA 1LV5A 3SJJA 3VQCA 4FJLA 4B9TA 3DYAA 4DWIA 1RCHA 3KKSA 5D3GA 4DSLA 5KGXA 2XY7A 1S1TA 1DTQA 1IKXA 3DLGA 4KV8A 1W9HA 1BCOA 4CHPA 2A1SA 4NCBA 2G8FA 3AVIA 3ZSQA 2YKNA 3WNGA 5KTQA 1WAJA 3AVBA 4OGCA 3M8QA 4CJLA 3O3HA 4CIEA 4IG0A 1X9MA 3HPHA 4FW1A 3DMJA 4JLHA 2E6MA 4QAGA 2Z1HA 3FFIA 5C25A 4FLTA 3PO4A 4AHTA 4KFBA 4I2PA 3T3FA 3VQ5A 3KKRA 1J5OA 3ZCMA 3QEIA 2G8KA 5SWMA 1SV5A 3D45A 4CJ4A 4I7FA 1NKEA 1KLNA 4B9LA 4CJEA 3OYAA 1TK0A 2DFEA 3HPOA 4KTWA 2B5JA 4FM2A 4ID1A 3ZSWA 3HP6A 4AHCA 3TAFA 4PUOA 4OKEA 3CFPA 1C1CA 3M8RA 3L2QA 3LALA 3V9SA 4J2EA 4CHQA 1C1AA 4PQUA 4ELVA 3VQ6A 3U3YA 3IS9A 3AVFA 4CHYA 3AVGA 4KPYA 4LSLA 1QE1A 2B4JA 2E6LA 3DLRA 3TI0A 1NK6A 2G8HA 2ZQBA 4QCLA 4DTMA 4KI6A 3C94A 4Z4GA 5HBMA 3NAEA 3V1QA 4NCGA 1ITGA 4NYNA 3ZT0A 3QEXA 4CERA 2BDPA 4CJRA 4B8CA 4DTSA 4E89A 4JS5A 4FJHA 3HPGA 2Z1JA 4CJUA 4KTQA 4N41A 3NF9A 2XY6A 1CXUA 4EP5A 2OZMA 2G8VA 1W0HA 2EHGA 4W5QA 3HSTB 3ZT3A 4FJKA 3HL8A 1L5UA 1UOCA 3UIQA 4FK0A 4DTXA 4DSKA 4YNQA 4J2BA 1SKSA 2QKKA 3ZT1A 4JRQA 4CGFA 3NFAA 2YV0X 3AV9A 1NK4A 4FJNA 4M45A 3F73A 2E4LA 4C8KA 1T05A 4B08A 1HYZA 1VK0A 1B92A 1T8EA 3KK1A 3NDKA 1JLEA 4HUFA 1JLAA 2KZMA 3U3GA 4F3OA 1D8YA 3QEVA 4KB1A 4IG3A 4WE1A 4BWJA 3OYBA 4CFAA 3OYDA 3TANA 3F9KA 2QKBA 2HVHA 1RT1A 3ITHA 3HVTA 3NGZA 3NGYA 4HCCA 4CEZA 4Z4IA 4EZ6A 1KVCA 3RR8A 3QEPA 4DS4A 1HYVA 4M3YA 3S3MA 1EKEA 3KIOA 4BWMA 3RTVA 1HRHA 4CF1A 4E0DA 2ZD1A 1QSYA 2HB5A 1B9DA 3I0RA 4CJ3A 1C0MA 2HHQA 1KVAA 3OS1A 1HNIA 2G8UA 2PZSA 3LP1A 2LSNA 4CECA 4KI4A 2EX3A 4CJTA 4HTUA 1UA1A 3VN5A 1CLQA 3CM5A 4KHSA 2VWJA 2RF2A 3HXMA 1HYSA 3AA5X 2FBTA 4DTUA 4CEDA 3HT3A 2RN2A 4O0JA 2IC3A 3V9XA 1R0AA 2P5OA 4KHYA 3TARA 2XY8A 4CE9A 3QERA 2DY4A 4FVMA 2OPQA 4QOZB 4DF4A 4DSJA 4B9UA 1QTMA 1B9FA 2OPSA 4DQSA 2KTQA 3LWLA 1NJWA 4IBNA 5C24A 4O55A 1FKOA 3KLGA 4DTPA 2Z1GA 4CF0A 1TAUA 4CJVA 3M8SA 3SQ2A 3L3UA 3SQ0A 1UWBA 4BACA 1L3UA 3NE6A 3MECA 1TK5A 3C6UA 1KLMA 1VSMA 3EYZA 4ZTJA 1NKBA 1QSSA 3ZSZA 1J53A 3AVLA 4CF9A 3KD5E 4K8ZA 4KHUA 1RT6A 4FYDA 2QXFA 1BQMA 4Z4FA 1JXEA 3NCIA 2HHUA 3QETA 3OJUA 4FJXA 4KKOA 1J9AA 3V6DA 1RILA 1MU2A 3AVMA 5CZ1A 3ZT4A 1WSIA 3E01A 1JLGA 3NHGA 1EP4A 4CJ5A 4FM1A 1BI4A 4O4GA 1WN7A 1RT2A 4AILC 3L2VA 1TKXA 2YNFA 3HP9A 1L3TA 1BHLA 4YFUA 4FJGA 3VQ7A 1GOCA 1S1XA 3LDSA 1QSLA 2HNYA 2ATQA 2D0CA 1CZBA 1VSDA 3CM6A 3QIOA 5J2MA 1U4BA 4BDYA 1T7PA 4M3ZA 2BGGA 4OJRA 1YT3A 1BISA 1RTHA 4CK1A 3KK2A 3K57A 3SUPA 5FRMA 5FDLA 1JL2A 4ID5A 3NGIA 3SQ4A 1VRTA 1Q9YA 1ASVA 4M3XA 3OYNA 1G15A 4CJFA 4E7LA 1I3AA 1D9FA 4OPKA 2G8IA 1C0UA 4RW7A 3TAQA 2ZE2A 3ZSYA 4N56A 1HPZA 1TK8A 3PX6A 1I39A 5JS2A 5DMRA 3OS2A 4FLWA 3KLIA 4IKFA 2B6AA 4CJQA 3S3NA 3MXIA 4M3UA 4CIFA 3V9WA 1RBVA 2HHVA 3SPYA 2KFZA 2WOMA 1XHXA 2D5RA 3DLBA 1LWFA 4M41A 2YNHA 3SYZA 2HHWA 4J2DA 3K5MA 4DSFA 1RDAA 4KHNA 4O0IA 4CEOA 1XHZA 3NH1A 3PV8A 1WSEA 1ZBLA 3BDPA 4H4OA 2FC0A 1BGXT 4DFKA 4FK2A 1HMVA 4N47A 5J2PA 3K5LA 1DTTA 2YNIA 4FCYA 1BL3A 1YTAA 3G0ZA 4FXDA 4DSEA 4DS5A 2IS3A 4LH5A 3HO1A 1FKPA 3NH0A 3VA3A 2PYLA 3O4QA 1WSJA 1ASWA 5HRRA 4CEBA 4FJMA 4C8MA 4FJ9A 3LAMA 3DLEA 3NF8A 3KK3A 3VA0A 3SNNA 3S3OA 4M3TA 1VRUA 3K5NA 2HHTA 4KHWA 1S1WA 3OJSA 3DI6A 5HLFA 3JYTA 2RPIA 2BANA 3RMBA 1U48A 4FZXC 4ELTA 1NJXA 1HQUA 2XY5A 2A1RA 3AVKA 3VQDA 4B9SA 4EP4A 3K5OA 4CGDA 3BGRA 1GOBA 1NOZA 4AHVA 1REVA 1IKVA 3NBPA 3SZ2A 3TAPA 4W5NA 3VQPA 2DFHA 3QEWA 2RKIA 2GV9A 3H08A 1TL3A 4LY7A 1TV6A 3OYFA 1HNVA 3ZSVA 4Q5VA 3AVAA 3OYGA 1Z25A 3AO4A 1SKWA 3U6FA 1IKYA 2DFFA 3RMAA 2HVIA 3M8PA 3T1AA 3CG7A 3I8DA 4NYFA 1WSHA 2P51A 3DRRA 1HJRA 3AO2A 1EETA 1S6QA 3L2WA 5KGWA 1RDDA 2KFNA 1IO2A 2G8WA 2KW4A 4ELUA 4Y1DA 4OKKA 2FBXA 2IDOA 1RNHA 3AA3A 2WONA 3LPUA 3V1OA 3LWMA 4OPJA 1BQNA 2YHAA 1BCMA 4CHNA 1WSFA 1WAFA 5JS1A 1LWEA 3AA2A 3OYJA 4RW6A 4HVJA 3EY1A 4F2SA 4E7IA 3TWHA 4IFYA 5CYQA 1JL1A 1D9DA 5J2NA 3RMCA 1X9WA 1IG9A 2HHSA 1TGOA 4ZTFA 1NK8A 1VSKA 2HW3A 2HNZA 3AVNA 1WLJA 1WSGA 2VG7A 5HRPA 3KLHA 4HUEA 3JSMA 1U45A 3ZSXA 3SQ1A 5J1EA 4Z4HA 3P83D 4FJJA 4KREA 4FLZA 3THVA 3ALYA 1KFSA 1A5VA 2JGUA 4CHOA 4DTOA 4C8LA 2JLEA 4CJKA 1ZBFA 1S1VA 4I9QA 3VQ8A 4CFCA 4ICLA 4CEFA 3DLHA 4KAZA 4CGIA 1RT7A 4E7JA 5J2QA 3SUQA 4B9VA 4KTZA 3ZT2A 1RBTA 1SL2A 4Z4CA 4BDPA 4Z4EA 3LZJA 1ZBUA 4N5SA 3O3GA 5KRTA 4CF8A 1VSFA 1A5WA 4F3TA 4BDZA 2PYJA 3D0PA 3HJFA 3VQEA 2IAJA 5CZ2A 4GW6A 1ASUA 2I5JA 3AA4A 1RT5A 2X6SA 4CEAA 1L3SA 4Z0UA 1KCFA 3AVHA 4Q0BA 4DTJA 2HHXA 1TKDA 4W5TA 4FLVA 2X74A 2OYQA 4BE1A 3K58A 4H4MA 1N6QA 3DLKA 3NH2A 1VSHA 4FZZA 1S6PA 4PA1A 4CGGA 2F96A 2XRIA 3WNFA 4DSIA 3SUNA 2HNDA 2W42A 1RTDA 1RBSA 1TVRA 5I3UA 3DOKA 3SPZA 1IH7A 3VQQA 1S9EA 4E19A 5KRSA 4DLGA 1UA0A 4FZYA 5HROA 3OS0A 2Y1JA 1BI4B 4FLYA 4DF8A 1LAWA 4C8NA 1CXQA 4R5PA 2NUBA 3ISNC 4DLEA 2DTUA 3VQAA 3VQ9A 3RMDA 1LW0A 3I0SA 4DMNA 3ULDA 3B6OA 1C0TA 4CHZA 4E3SA 1RBRA 1VSLA 1EXQA 2X78A 4LD0A 4J2AA 4CF2A 4DQPA 4PY5A 3NF7A 2KZZA 3LPTA 3RRHA 4IDKA 1L3VA 4LSNA 1GOAA 1TAQA 3NF6A 3SV3A 1ZBIA 4GMJB 3TR8A 3HM9A 3VQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OY9 A;  3OYE A;  4KRF A;  4CK2 A;  5C42 A;  1TL1 A;  2VWK A;  3L2R A;  3TAM A;  3QIN A;  1Z26 A;  5EU7 A;  4CFD A;  5K14 A;  3QLH A;  3QNN A;  3LAK A;  1VSE A;  4DTN A;  1CZ9 A;  3PY8 A;  5FRN A;  1LWC A;  4HCB A;  5T7B A;  2ITG A;  3DOL A;  3K59 A;  1YTU A;  4JS4 A;  4B3O A;  1S1U A;  3A2F A;  1N5Y A;  2Q3S A;  4AH9 A;  3OYI A;  4M42 A;  4CEQ A;  3SI6 A;  4CIG A;  4W5O A;  3CFR A;  3AVJ A;  4PWD A;  4DU1 A;  4DU4 A;  2QK9 A;  1J54 A;  2YKM A;  4CJW A;  4E1M A;  1D5A A;  3PO5 A;  3V81 A;  3PX0 A;  4TSX A;  3QNO A;  3AO3 A;  1Q8I A;  3LP2 A;  4RW9 A;  4IFV A;  5CYM A;  1RDB A;  5CY4 A;  4W5R A;  1XC9 A;  2D0A A;  1S9G A;  4DFJ A;  2IOC A;  1JLQ A;  1FXX A;  3MXM A;  5HRS A;  2OA8 A;  3IG1 A;  3IRX A;  3TAG A;  4M3W A;  1LAV A;  3KLE A;  1WNS A;  4DG1 A;  1Y97 A;  1U47 A;  4CK3 A;  3AVC A;  3HVR A;  3G10 A;  3OYC A;  4E7K A;  1BIZ A;  4KHQ A;  4OGE A;  3WNH A;  4ZHR A;  4KO0 A;  2FBY A;  1KTQ A;  3MEE A;  3V4I A;  3OYH A;  4FK4 A;  3PUF A;  4GVM A;  1EX4 A;  1TKT A;  2X6N A;  3V9U A;  1VSJ A;  4OKJ A;  1SL0 A;  1NK0 A;  3VQB A;  4DFP A;  1SL1 A;  3RR7 A;  3OVN A;  3CQ8 A;  4K8X A;  3AO5 A;  5HP1 A;  2R7Y A;  3LP0 A;  1NK9 A;  4MQ3 A;  4XIU A;  3ASM A;  1X9S A;  1JLB A;  4C8O A;  3LAN A;  1TKZ A;  4L8R B;  2XHB A;  5SZT A;  1HQE A;  1SKR A;  4Y1C A;  4CJS A;  2BE2 A;  4HHT A;  1Q9X A;  4I9L A;  1NOY A;  2F8T A;  1X1P A;  2P1J A;  3DRS A;  3T19 A;  1RTI A;  4FLX A;  3SUO A;  4FJI A;  3HK2 A;  2GUI A;  2YNG A;  5FRO A;  4CJP A;  4O44 A;  4N76 A;  3V1R A;  2F8S A;  3KLF A;  3L8B A;  4RW4 A;  4NCA A;  1QQC A;  2D0B A;  4CFB A;  1ZBH A;  1A5X A;  1JXB A;  1C6V A;  4B9N A;  4AHS A;  3PX4 A;  5E41 A;  3S9H A;  4B9M A;  4OLA A;  2O4I A;  1KVB A;  5DK5 A;  4MFB A;  1LW2 A;  2O4G A;  1JKH A;  3ZSO A;  4LH4 A;  3TAB A;  1JLF A;  1RTJ A;  2GBZ A;  4H8K A;  3KJV A;  4CES A;  3SV4 A;  3AO1 A;  1DLO A;  2PY5 A;  1O1W A;  4OVL A;  3MXJ A;  1QS4 A;  4DFM A;  4KB0 A;  3OYK A;  4DQQ A;  3P1G A;  3MEG A;  3SCX A;  2XO7 A;  3ZSR A;  4BE0 A;  1XWL A;  2IGI A;  1YVU A;  5HRN A;  2VG5 A;  4FM0 A;  3O3F A;  5I42 A;  4DQI A;  2OZS A;  5KI6 A;  3KD1 E;  2OPP A;  3QO9 A;  1NK5 A;  4M3R A;  4FLU A;  3C95 A;  3V9Z A;  4E7H A;  4AHR A;  4OLB A;  1NK7 A;  1VSI A;  4B8A B;  1KRP A;  1IKW A;  3MED A;  3MAQ A;  1FK9 A;  4G1Q A;  4JRP A;  4FW2 A;  1KFD A;  4FJ5 A;  4O5B A;  1C1B A;  3K2P A;  3QIP A;  4RG8 A;  3DRP A;  4RW8 A;  4DU3 A;  1XI1 A;  3L3V A;  1ZYQ A;  3C6T A;  4F8R A;  3EZ5 A;  1RBU A;  2YHB A;  3L2U A;  3TAE A;  1T03 A;  1NJZ A;  4UQG A;  3LP3 A;  1U04 A;  1RT4 A;  1F21 A;  4CEE A;  3WNE A;  4I2Q A;  3RWU A;  1JLC A;  3OYL A;  1S5J A;  3P5J A;  3B6P A;  2AJQ A;  1SUQ A;  2VG6 A;  3DM2 A;  3LZI A;  1K6Y A;  1RT3 A;  3QES A;  1KSP A;  4FJ7 A;  2KQ2 A;  3O4N A;  3RRG A;  4CCH A;  2ETJ A;  4F2R A;  3IAY A;  3KTQ A;  1RDC A;  2HMI A;  1U49 A;  1BIU A;  4CGH A;  3CYM A;  1UAX A;  4HUG A;  2Z1I A;  3CFO A;  2OPR A;  4FJ8 A;  3HYF A;  1QHT A;  4CGJ A;  4E1N A;  4DQR A;  4EZ9 A;  4DTR A;  2P5G A;  4F4K A;  3OYM A;  1NKC A;  2Y1I A;  4AHU A;  2FBV A;  4BE2 A;  1NJY A;  1LV5 A;  3SJJ A;  3VQC A;  4FJL A;  4B9T A;  3DYA A;  4DWI A;  1RCH A;  3KKS A;  5D3G A;  4DSL A;  5KGX A;  2XY7 A;  1S1T A;  1DTQ A;  1IKX A;  3DLG A;  4KV8 A;  1W9H A;  1BCO A;  4CHP A;  2A1S A;  4NCB A;  2G8F A;  3AVI A;  3ZSQ A;  2YKN A;  3WNG A;  5KTQ A;  1WAJ A;  3AVB A;  4OGC A;  3M8Q A;  4CJL A;  3O3H A;  4CIE A;  4IG0 A;  1X9M A;  3HPH A;  4FW1 A;  3DMJ A;  4JLH A;  2E6M A;  4QAG A;  2Z1H A;  3FFI A;  5C25 A;  4FLT A;  3PO4 A;  4AHT A;  4KFB A;  4I2P A;  3T3F A;  3VQ5 A;  3KKR A;  1J5O A;  3ZCM A;  3QEI A;  2G8K A;  5SWM A;  1SV5 A;  3D45 A;  4CJ4 A;  4I7F A;  1NKE A;  1KLN A;  4B9L A;  4CJE A;  3OYA A;  1TK0 A;  2DFE A;  3HPO A;  4KTW A;  2B5J A;  4FM2 A;  4ID1 A;  3ZSW A;  3HP6 A;  4AHC A;  3TAF A;  4PUO A;  4OKE A;  3CFP A;  1C1C A;  3M8R A;  3L2Q A;  3LAL A;  3V9S A;  4J2E A;  4CHQ A;  1C1A A;  4PQU A;  4ELV A;  3VQ6 A;  3U3Y A;  3IS9 A;  3AVF A;  4CHY A;  3AVG A;  4KPY A;  4LSL A;  1QE1 A;  2B4J A;  2E6L A;  3DLR A;  3TI0 A;  1NK6 A;  2G8H A;  2ZQB A;  4QCL A;  4DTM A;  4KI6 A;  3C94 A;  4Z4G A;  5HBM A;  3NAE A;  3V1Q A;  4NCG A;  1ITG A;  4NYN A;  3ZT0 A;  3QEX A;  4CER A;  2BDP A;  4CJR A;  4B8C A;  4DTS A;  4E89 A;  4JS5 A;  4FJH A;  3HPG A;  2Z1J A;  4CJU A;  4KTQ A;  4N41 A;  3NF9 A;  2XY6 A;  1CXU A;  4EP5 A;  2OZM A;  2G8V A;  1W0H A;  2EHG A;  4W5Q A;  3HST B;  3ZT3 A;  4FJK A;  3HL8 A;  1L5U A;  1UOC A;  3UIQ A;  4FK0 A;  4DTX A;  4DSK A;  4YNQ A;  4J2B A;  1SKS A;  2QKK A;  3ZT1 A;  4JRQ A;  4CGF A;  3NFA A;  2YV0 X;  3AV9 A;  1NK4 A;  4FJN A;  4M45 A;  3F73 A;  2E4L A;  4C8K A;  1T05 A;  4B08 A;  1HYZ A;  1VK0 A;  1B92 A;  1T8E A;  3KK1 A;  3NDK A;  1JLE A;  4HUF A;  1JLA A;  2KZM A;  3U3G A;  4F3O A;  1D8Y A;  3QEV A;  4KB1 A;  4IG3 A;  4WE1 A;  4BWJ A;  3OYB A;  4CFA A;  3OYD A;  3TAN A;  3F9K A;  2QKB A;  2HVH A;  1RT1 A;  3ITH A;  3HVT A;  3NGZ A;  3NGY A;  4HCC A;  4CEZ A;  4Z4I A;  4EZ6 A;  1KVC A;  3RR8 A;  3QEP A;  4DS4 A;  1HYV A;  4M3Y A;  3S3M A;  1EKE A;  3KIO A;  4BWM A;  3RTV A;  1HRH A;  4CF1 A;  4E0D A;  2ZD1 A;  1QSY A;  2HB5 A;  1B9D A;  3I0R A;  4CJ3 A;  1C0M A;  2HHQ A;  1KVA A;  3OS1 A;  1HNI A;  2G8U A;  2PZS A;  3LP1 A;  2LSN A;  4CEC A;  4KI4 A;  2EX3 A;  4CJT A;  4HTU A;  1UA1 A;  3VN5 A;  1CLQ A;  3CM5 A;  4KHS A;  2VWJ A;  2RF2 A;  3HXM A;  1HYS A;  3AA5 X;  2FBT A;  4DTU A;  4CED A;  3HT3 A;  2RN2 A;  4O0J A;  2IC3 A;  3V9X A;  1R0A A;  2P5O A;  4KHY A;  3TAR A;  2XY8 A;  4CE9 A;  3QER A;  2DY4 A;  4FVM A;  2OPQ A;  4QOZ B;  4DF4 A;  4DSJ A;  4B9U A;  1QTM A;  1B9F A;  2OPS A;  4DQS A;  2KTQ A;  3LWL A;  1NJW A;  4IBN A;  5C24 A;  4O55 A;  1FKO A;  3KLG A;  4DTP A;  2Z1G A;  4CF0 A;  1TAU A;  4CJV A;  3M8S A;  3SQ2 A;  3L3U A;  3SQ0 A;  1UWB A;  4BAC A;  1L3U A;  3NE6 A;  3MEC A;  1TK5 A;  3C6U A;  1KLM A;  1VSM A;  3EYZ A;  4ZTJ A;  1NKB A;  1QSS A;  3ZSZ A;  1J53 A;  3AVL A;  4CF9 A;  3KD5 E;  4K8Z A;  4KHU A;  1RT6 A;  4FYD A;  2QXF A;  1BQM A;  4Z4F A;  1JXE A;  3NCI A;  2HHU A;  3QET A;  3OJU A;  4FJX A;  4KKO A;  1J9A A;  3V6D A;  1RIL A;  1MU2 A;  3AVM A;  5CZ1 A;  3ZT4 A;  1WSI A;  3E01 A;  1JLG A;  3NHG A;  1EP4 A;  4CJ5 A;  4FM1 A;  1BI4 A;  4O4G A;  1WN7 A;  1RT2 A;  4AIL C;  3L2V A;  1TKX A;  2YNF A;  3HP9 A;  1L3T A;  1BHL A;  4YFU A;  4FJG A;  3VQ7 A;  1GOC A;  1S1X A;  3LDS A;  1QSL A;  2HNY A;  2ATQ A;  2D0C A;  1CZB A;  1VSD A;  3CM6 A;  3QIO A;  5J2M A;  1U4B A;  4BDY A;  1T7P A;  4M3Z A;  2BGG A;  4OJR A;  1YT3 A;  1BIS A;  1RTH A;  4CK1 A;  3KK2 A;  3K57 A;  3SUP A;  5FRM A;  5FDL A;  1JL2 A;  4ID5 A;  3NGI A;  3SQ4 A;  1VRT A;  1Q9Y A;  1ASV A;  4M3X A;  3OYN A;  1G15 A;  4CJF A;  4E7L A;  1I3A A;  1D9F A;  4OPK A;  2G8I A;  1C0U A;  4RW7 A;  3TAQ A;  2ZE2 A;  3ZSY A;  4N56 A;  1HPZ A;  1TK8 A;  3PX6 A;  1I39 A;  5JS2 A;  5DMR A;  3OS2 A;  4FLW A;  3KLI A;  4IKF A;  2B6A A;  4CJQ A;  3S3N A;  3MXI A;  4M3U A;  4CIF A;  3V9W A;  1RBV A;  2HHV A;  3SPY A;  2KFZ A;  2WOM A;  1XHX A;  2D5R A;  3DLB A;  1LWF A;  4M41 A;  2YNH A;  3SYZ A;  2HHW A;  4J2D A;  3K5M A;  4DSF A;  1RDA A;  4KHN A;  4O0I A;  4CEO A;  1XHZ A;  3NH1 A;  3PV8 A;  1WSE A;  1ZBL A;  3BDP A;  4H4O A;  2FC0 A;  1BGX T;  4DFK A;  4FK2 A;  1HMV A;  4N47 A;  5J2P A;  3K5L A;  1DTT A;  2YNI A;  4FCY A;  1BL3 A;  1YTA A;  3G0Z A;  4FXD A;  4DSE A;  4DS5 A;  2IS3 A;  4LH5 A;  3HO1 A;  1FKP A;  3NH0 A;  3VA3 A;  2PYL A;  3O4Q A;  1WSJ A;  1ASW A;  5HRR A;  4CEB A;  4FJM A;  4C8M A;  4FJ9 A;  3LAM A;  3DLE A;  3NF8 A;  3KK3 A;  3VA0 A;  3SNN A;  3S3O A;  4M3T A;  1VRU A;  3K5N A;  2HHT A;  4KHW A;  1S1W A;  3OJS A;  3DI6 A;  5HLF A;  3JYT A;  2RPI A;  2BAN A;  3RMB A;  1U48 A;  4FZX C;  4ELT A;  1NJX A;  1HQU A;  2XY5 A;  2A1R A;  3AVK A;  3VQD A;  4B9S A;  4EP4 A;  3K5O A;  4CGD A;  3BGR A;  1GOB A;  1NOZ A;  4AHV A;  1REV A;  1IKV A;  3NBP A;  3SZ2 A;  3TAP A;  4W5N A;  3VQP A;  2DFH A;  3QEW A;  2RKI A;  2GV9 A;  3H08 A;  1TL3 A;  4LY7 A;  1TV6 A;  3OYF A;  1HNV A;  3ZSV A;  4Q5V A;  3AVA A;  3OYG A;  1Z25 A;  3AO4 A;  1SKW A;  3U6F A;  1IKY A;  2DFF A;  3RMA A;  2HVI A;  3M8P A;  3T1A A;  3CG7 A;  3I8D A;  4NYF A;  1WSH A;  2P51 A;  3DRR A;  1HJR A;  3AO2 A;  1EET A;  1S6Q A;  3L2W A;  5KGW A;  1RDD A;  2KFN A;  1IO2 A;  2G8W A;  2KW4 A;  4ELU A;  4Y1D A;  4OKK A;  2FBX A;  2IDO A;  1RNH A;  3AA3 A;  2WON A;  3LPU A;  3V1O A;  3LWM A;  4OPJ A;  1BQN A;  2YHA A;  1BCM A;  4CHN A;  1WSF A;  1WAF A;  5JS1 A;  1LWE A;  3AA2 A;  3OYJ A;  4RW6 A;  4HVJ A;  3EY1 A;  4F2S A;  4E7I A;  3TWH A;  4IFY A;  5CYQ A;  1JL1 A;  1D9D A;  5J2N A;  3RMC A;  1X9W A;  1IG9 A;  2HHS A;  1TGO A;  4ZTF A;  1NK8 A;  1VSK A;  2HW3 A;  2HNZ A;  3AVN A;  1WLJ A;  1WSG A;  2VG7 A;  5HRP A;  3KLH A;  4HUE A;  3JSM A;  1U45 A;  3ZSX A;  3SQ1 A;  5J1E A;  4Z4H A;  3P83 D;  4FJJ A;  4KRE A;  4FLZ A;  3THV A;  3ALY A;  1KFS A;  1A5V A;  2JGU A;  4CHO A;  4DTO A;  4C8L A;  2JLE A;  4CJK A;  1ZBF A;  1S1V A;  4I9Q A;  3VQ8 A;  4CFC A;  4ICL A;  4CEF A;  3DLH A;  4KAZ A;  4CGI A;  1RT7 A;  4E7J A;  5J2Q A;  3SUQ A;  4B9V A;  4KTZ A;  3ZT2 A;  1RBT A;  1SL2 A;  4Z4C A;  4BDP A;  4Z4E A;  3LZJ A;  1ZBU A;  4N5S A;  3O3G A;  5KRT A;  4CF8 A;  1VSF A;  1A5W A;  4F3T A;  4BDZ A;  2PYJ A;  3D0P A;  3HJF A;  3VQE A;  2IAJ A;  5CZ2 A;  4GW6 A;  1ASU A;  2I5J A;  3AA4 A;  1RT5 A;  2X6S A;  4CEA A;  1L3S A;  4Z0U A;  1KCF A;  3AVH A;  4Q0B A;  4DTJ A;  2HHX A;  1TKD A;  4W5T A;  4FLV A;  2X74 A;  2OYQ A;  4BE1 A;  3K58 A;  4H4M A;  1N6Q A;  3DLK A;  3NH2 A;  1VSH A;  4FZZ A;  1S6P A;  4PA1 A;  4CGG A;  2F96 A;  2XRI A;  3WNF A;  4DSI A;  3SUN A;  2HND A;  2W42 A;  1RTD A;  1RBS A;  1TVR A;  5I3U A;  3DOK A;  3SPZ A;  1IH7 A;  3VQQ A;  1S9E A;  4E19 A;  5KRS A;  4DLG A;  1UA0 A;  4FZY A;  5HRO A;  3OS0 A;  2Y1J A;  1BI4 B;  4FLY A;  4DF8 A;  1LAW A;  4C8N A;  1CXQ A;  4R5P A;  2NUB A;  3ISN C;  4DLE A;  2DTU A;  3VQA A;  3VQ9 A;  3RMD A;  1LW0 A;  3I0S A;  4DMN A;  3ULD A;  3B6O A;  1C0T A;  4CHZ A;  4E3S A;  1RBR A;  1VSL A;  1EXQ A;  2X78 A;  4LD0 A;  4J2A A;  4CF2 A;  4DQP A;  4PY5 A;  3NF7 A;  2KZZ A;  3LPT A;  3RRH A;  4IDK A;  1L3V A;  4LSN A;  1GOA A;  1TAQ A;  3NF6 A;  3SV3 A;  1ZBI A;  4GMJ B;  3TR8 A;  3HM9 A;  3VQ4 A; 
#chains in the Genus database with same CATH topology
 4KRF A;  5C42 A;  1TL1 A;  2NRT A;  3QIN A;  1Z26 A;  5ELZ A;  5EU7 A;  3FGU A;  2ZJQ L;  5AZJ A;  3QNN A;  5FRN A;  1VSE A;  3NVM A;  4DTN A;  1VQP N;  4B3O A;  1EWR A;  2D0O A;  3A2F A;  1N5Y A;  3WXK A;  3SI6 A;  1WBB A;  3AVJ A;  4DU1 A;  4O5F A;  4E1M A;  5AR0 A;  3V81 A;  4TSX A;  4EAH D;  3CET A;  1X9J A;  3DXK A;  3NMU A;  2D0A A;  1S9G A;  4DFJ A;  3MN5 A;  3IRX A;  3TAG A;  3ZEU B;  5AQU A;  2HBK A;  3ZET A;  4M3W A;  2F4V K;  1Y97 A;  1U47 A;  4Y0W A;  4E7K A;  4KHQ A;  2E2N A;  2F9W A;  1YF5 L;  3MEE A;  3SLC A;  3OYH A;  4FK4 A;  2QTD A;  3N4Q A;  3TU5 A;  3EEQ A;  1NK0 A;  3V9U A;  1VSJ A;  3O9T A;  1SL0 A;  4DFP A;  1SL1 A;  4BC2 A;  5HP1 A;  1OH8 A;  3LP0 A;  2P9P B;  4BR0 A;  4MQ3 A;  1JLB A;  1YI2 N;  4OPA A;  1LCU A;  1HQE A;  4CJS A;  1NOY A;  4GV9 A;  2F8T A;  2HBJ A;  2P1J A;  3HK2 A;  3T19 A;  1RTI A;  2VGM A;  1VQO N;  2D0P A;  4H5R A;  3VEN A;  3TTF A;  4JI4 K;  4CFB A;  4IO8 A;  1HNW K;  1MWK A;  5C15 A;  4NLB A;  1Q86 O;  4YOT A;  3ID6 A;  3J7Z O;  2GBZ A;  3KJV A;  3AO1 A;  3SK3 A;  1XMQ K;  3MDQ A;  4B9Q A;  3A5M C;  4FWR A;  2QWQ A;  3P1G A;  2NRV A;  4BE0 A;  2IGI A;  4FM0 A;  3ATV A;  4DQI A;  4KHP K;  5KI6 A;  3WQU A;  3THW A;  4OLB A;  1VSI A;  4B8A B;  4JRP A;  2D1K A;  4FSV A;  1C1B A;  3QIP A;  4DUZ K;  3R8E A;  4RW8 A;  2NLX A;  5CE3 A;  1XMO K;  1TYQ B;  4F9O A;  4FPA A;  4CZI A;  1RBU A;  5C10 A;  2QM1 A;  3RWU A;  2AJQ A;  3OYL A;  2AP1 A;  3LZI A;  2O8F A;  1RT3 A;  1KSP A;  2Q2R A;  1GLD G;  4M7Y A;  4FJ7 A;  3RRG A;  1RFQ A;  4CCH A;  1QQN A;  4BRE A;  4F2R A;  4GV6 A;  3E9P A;  3L0Q A;  2V7Y A;  3CFO A;  4FJ8 A;  2V52 B;  1QHT A;  3J8A A;  2AA4 A;  3OYM A;  1MWM A;  4AHU A;  1LV5 A;  3DYA A;  3GOI A;  4LFB K;  3KKS A;  1YJ9 N;  5D3G A;  5KGX A;  3DLG A;  4U67 L;  2A1S A;  5FPD A;  5KTQ A;  5LL6 Z;  4JEP A;  1WAJ A;  3M8Q A;  4BRM A;  3HPH A;  3VES A;  5C25 A;  2E6M A;  4QAG A;  2Z1H A;  4AHT A;  4KFB A;  2W6L A;  3EKS A;  3T3F A;  2HF3 A;  3FLC O;  1JCE A;  3ZCM A;  2G8K A;  5C2F A;  1GLA G;  1SV5 A;  4B1Y B;  1NKE A;  1KLN A;  2DFE A;  2B5J A;  4BC3 A;  4FO0 A;  3CFP A;  1C1C A;  1GLF O;  3M8R A;  3LDQ A;  4JI6 K;  4CHQ A;  1C1A A;  4YOX A;  3U3Y A;  1BA0 A;  2IIR A;  4EHT A;  2B4J A;  2E6L A;  3DLR A;  3SBT A;  4CD3 A;  4IEI A;  3AGR A;  5HBM A;  1ITG A;  3ZT0 A;  2YJF A;  2KLA A;  4BGA A;  4CER A;  5IWA K;  4DTS A;  4DKW A;  3HPG A;  1QHA A;  4N41 A;  5AQT A;  1IBM K;  1CXU A;  2OZM A;  3HL8 A;  1L5U A;  1UOC A;  2F7T A;  4FK0 A;  1SKS A;  3ZT1 A;  2F9T A;  1NK4 A;  3AV9 A;  3GBT A;  2E4L A;  4C8K A;  3MN6 A;  4BQZ A;  1T3V A;  1JLA A;  3U3G A;  3QEV A;  4BRH A;  3OYB A;  4WE1 A;  4BWJ A;  3EE8 A;  3OYD A;  3TAN A;  4K43 A;  3CJC A;  5DM7 L;  2HVH A;  1RT1 A;  4FWS A;  4Z4I A;  5CR4 A;  1HYV A;  4M3Y A;  1Q81 O;  1HRH A;  2HB5 A;  3GDQ A;  4CBX A;  1C0M A;  2ASO A;  3OS1 A;  4JKC A;  2HBL A;  3GE1 A;  5KQD A;  2PZS A;  4V19 S;  2LSN A;  3VN5 A;  1T6C A;  2RF2 A;  1M90 O;  1HYS A;  4CED A;  2P5O A;  2RN2 A;  3V9X A;  2XY8 A;  2DY4 A;  4FVM A;  4DR6 K;  1NGD A;  4QOZ B;  1GLE G;  3FZK A;  1NJW A;  4DTP A;  5C24 A;  3IKM A;  2YHY A;  5E84 A;  3NE6 A;  3MEC A;  4MO4 A;  4YOR A;  4FYD A;  3KD5 E;  1BQM A;  4X62 K;  4DV6 K;  2HHU A;  3V6D A;  1RIL A;  3MN9 A;  3ZT4 A;  5BRD A;  2VCP A;  3E01 A;  3QFP A;  3J80 O;  1J6Z A;  4CJ5 A;  4O4G A;  3H1V X;  1RT2 A;  1BA1 A;  5GAD P;  2P9P A;  3OTO K;  1NJI O;  1L3T A;  4YFU A;  1GOC A;  2ZWH A;  1QSL A;  2HNY A;  2ATQ A;  2D0C A;  1U4B A;  3Q7B A;  1RTH A;  3KK2 A;  3SUP A;  5C12 A;  5FPE A;  4FVU A;  1D9F A;  2G8I A;  1C0U A;  4CJ7 A;  2ZE2 A;  3LDP A;  1TK8 A;  5JS2 A;  5DMR A;  3OS2 A;  3ZET B;  2B6A A;  3V9W A;  1ZXO A;  1K8K A;  3DLB A;  3SYZ A;  1VQ9 N;  3DXK B;  3HM8 A;  4LFA K;  2CH6 A;  3O4W A;  3BDP A;  3FZL A;  1BGX T;  4DFK A;  4N47 A;  3K5L A;  2YNI A;  4XH5 A;  1BL3 A;  3G0Z A;  3FR0 A;  1NGE A;  1ATN A;  4U7B A;  1WSJ A;  1ASW A;  3ENB A;  4CEB A;  2PYL A;  2YHX A;  4C8M A;  3DLE A;  3VA0 A;  3MK6 A;  1VQL N;  4OPH A;  3DI6 A;  2RPI A;  1U48 A;  3T1Y K;  3RMB A;  4FZX C;  2XY5 A;  5F1X A;  3AVK A;  2A1R A;  4B9S A;  3A5N C;  4EP4 A;  3K5O A;  4CGD A;  1OVQ A;  2VYP A;  3TAP A;  3SZ2 A;  4W5N A;  2DFH A;  3QEW A;  4JHD B;  3ZSV A;  3OYG A;  3AO4 A;  1SKW A;  3U6F A;  2E1Z A;  1BOT O;  5ADX A;  5FPN A;  3T1A A;  3CG7 A;  4BVO A;  3I8D A;  1WSH A;  3AO2 A;  2WTU A;  1S6Q A;  5KGW A;  2QEX N;  2KFN A;  1IO2 A;  2G8W A;  3CPE A;  2QWM A;  1EO1 A;  4X65 K;  2FBX A;  1BQN A;  5BPN A;  3EY1 A;  2JWK A;  2QWP A;  1VQM N;  4MLE A;  1D9D A;  1JL1 A;  1NK8 A;  2HW3 A;  2HNZ A;  1XC3 A;  3K0S A;  1ESV A;  2P9N B;  4WFA L;  3P83 D;  4FJJ A;  1MA9 B;  1H1V A;  4FLZ A;  3ALY A;  2JGU A;  4QS8 A;  4KH4 A;  1S1V A;  4JHD A;  1Z6R A;  1YUW A;  3DLH A;  1LOT B;  1RT7 A;  2D4W A;  4E7J A;  3ZT2 A;  1RBT A;  1SL2 A;  3CC4 N;  4JD2 A;  5KRT A;  4CF8 A;  2IAJ A;  2PAV A;  1TUY A;  4C23 A;  4DTJ A;  3VER A;  2HHX A;  4W5T A;  3DAW A;  1N6Q A;  3NH2 A;  2F96 A;  3D6R A;  4GKK K;  3DOK A;  3CQX A;  4DLG A;  4H03 B;  3O8M A;  1LAW A;  4R5P A;  3CIP A;  4H5W A;  3MWP A;  3ISN C;  3F2K A;  1W97 L;  1LW0 A;  4GY2 B;  1EXQ A;  2X78 A;  3DXM A;  4PY5 A;  2OCE A;  4IDK A;  3OHR A;  5AQZ A;  3DJC A;  1GOA A;  3OW2 M;  3I56 N;  3NF6 A;  5AQS A;  1ZBI A;  3TR8 A;  3HM9 A;  3PY8 A;  4KH5 A;  2WFB A;  5ADX H;  2P9L B;  4FOI A;  1IV0 A;  2VWK A;  4JN4 A;  1NGJ A;  2GUP A;  4HCB A;  1VQ5 N;  2GEL A;  1YTU A;  3VGL A;  2ZJR L;  4JKH A;  4CIG A;  3CFR A;  3CHW A;  5BN8 A;  1HR0 K;  3LL3 A;  1D5A A;  3PO5 A;  3H3N O;  3QNO A;  4PKG A;  4DR4 K;  3QFU A;  4RW9 A;  5CY4 A;  4BR5 A;  1XC9 A;  2HMP A;  1YVN A;  2JWL A;  3CMA N;  4DV3 K;  3O1B A;  3MXM A;  1LAV A;  4NLC A;  2O8D B;  3MX2 A;  4H0Y B;  4ZHR A;  1NGH A;  4HWI A;  4H5T A;  3AAR A;  5JVG L;  3PUF A;  3KWI A;  1VHX A;  1G99 A;  1TKT A;  2X6N A;  4OKJ A;  2UUA K;  5M1P A;  3ASM A;  1X9S A;  2XHB A;  4Y1C A;  2BE2 A;  1X1P A;  4FLX A;  3DRS A;  4FWK A;  4B1V A;  3MWT A;  3SUO A;  4FJI A;  4YOW A;  4CJP A;  3L8B A;  1C0G A;  1JXB A;  3CJA A;  4OLA A;  3EO3 A;  1KVB A;  5DK5 A;  5BPL A;  4H0O A;  2O4G A;  1ILY A;  2O8B A;  1NNE A;  3M6G A;  2PY5 A;  1O1W A;  3MXJ A;  4KB0 A;  4DQQ A;  3HZ6 A;  4YOU A;  2XO7 A;  5HRN A;  2UXC K;  5TKY A;  3O3F A;  4H5V A;  3C7N B;  1KQS M;  4M3R A;  4CVN E;  1SS6 A;  1SAZ A;  2FLO A;  1HKB A;  3C95 A;  3EKU A;  5FPM A;  4AHR A;  3MAQ A;  4BG9 A;  1KFD A;  4DU3 A;  1XI1 A;  3HOS A;  3C6T A;  4F8R A;  2YHB A;  3L2U A;  3VF4 A;  1IG8 A;  4UQG A;  1RT4 A;  1OVY A;  1JLC A;  1S5J A;  3P5J A;  3B6P A;  3TSP A;  1U6Z A;  5JIC A;  1RDU A;  1SZ2 A;  3LDL A;  3KTQ A;  1RDC A;  2HMI A;  1IBL K;  1BIU A;  3CER A;  4CGH A;  1UAX A;  2OPR A;  4DTR A;  3VTH A;  3WXI A;  3L4Q A;  3LDN A;  1RCH A;  4CZG A;  4IDH A;  2XY7 A;  1S1T A;  3AVI A;  5EVZ A;  1NU0 A;  3AVB A;  3LDO A;  3P4I A;  3O3H A;  1X9M A;  4IG0 A;  2OTL N;  3I8B A;  3PO4 A;  4MLH A;  5H1S Q;  3QEI A;  3HI0 A;  5SWM A;  3D45 A;  4CJ4 A;  3OYA A;  2KKZ A;  4B1Z A;  3TAF A;  4OKE A;  4WFN L;  2O8F B;  3V9S A;  3D2E B;  4PQU A;  2ZGY A;  5KPZ A;  1W7A A;  4CZH A;  3TSQ A;  3TI0 A;  5TKW A;  3HTV A;  4Z4G A;  1VQK N;  3CCS N;  4IJN A;  2WBN A;  3V1Q A;  4WYB A;  4CJR A;  5AFU H;  5LMU K;  1Y64 A;  4JS5 A;  3E9L A;  3E1Y A;  4CJU A;  4DR2 K;  4KTQ A;  1ZC6 A;  1Q18 A;  2VQE K;  1E4G T;  4B1X B;  2GEM A;  1W0H A;  4FJK A;  3L6Q A;  3VOV A;  4DSK A;  4IWV A;  2IVO A;  4JRQ A;  4CGF A;  2P9K B;  4M45 A;  3ZX0 A;  4BRN A;  4B08 A;  3CJ1 A;  4BR2 A;  4KB1 A;  2QKB A;  4IG3 A;  3QBW A;  4IXC A;  3BP8 A;  3QDK A;  2IVP A;  2FSN A;  3QIC A;  1ATS A;  1KVC A;  4DR1 K;  3QEP A;  3VET A;  3S3M A;  3VGK A;  1EKE A;  4E0D A;  4CF1 A;  5AJ3 K;  1QSY A;  4PKH A;  3ZX2 A;  3SAF A;  3I0R A;  4CJ3 A;  2P9S B;  1HNI A;  3LM9 A;  3LP1 A;  4K42 A;  4CEC A;  2EX3 A;  5EOY A;  2HOE A;  1VQ4 N;  3AA5 X;  4JD2 B;  1R0A A;  4O0J A;  2PFU A;  3TAR A;  4DB3 A;  3O1W A;  3O08 A;  2OPQ A;  2OAN A;  4DSJ A;  1QTM A;  3MX5 A;  4MDA A;  3O6W A;  1FKO A;  2KHO A;  4CF0 A;  2A3Z A;  3L3U A;  3SQ0 A;  5GIN A;  3ZEU A;  4RWT A;  4BAC A;  1EQY A;  4JNE A;  5AFU A;  4ZTJ A;  4DV4 K;  1QVF M;  2E5L K;  4K8Z A;  4GVE A;  5AQW A;  2NRX A;  4FJX A;  3IDH A;  1WSI A;  5I9E B;  1S22 A;  1JLG A;  1HPM A;  3NHG A;  3CCL N;  1BI4 A;  1WN7 A;  2ASM A;  3U9Z A;  3HP9 A;  4FJG A;  1BHL A;  1M1K O;  3E9O A;  1E3M A;  3LDS A;  3CM6 A;  3QIO A;  1CZB A;  1VSD A;  3CME N;  4BDY A;  2ZM6 K;  4M3Z A;  4H0X B;  2NRW A;  1J5E K;  2VQF K;  4OJR A;  5AQF A;  1BIS A;  2W41 A;  4CK1 A;  5FDL A;  5EX5 A;  4M3X A;  3NGI A;  1Q9Y A;  1VRT A;  4XH4 A;  1ASV A;  4CJF A;  4E7L A;  1I3A A;  4ISF A;  5MLC Q;  3T7Z A;  2A5X A;  3PX6 A;  4FLW A;  3KLI A;  4IKF A;  1HLU A;  4FOE A;  4CJQ A;  3S3N A;  3MXI A;  4CIF A;  1RBV A;  4JI5 K;  2HHV A;  2KFZ A;  2WOM A;  2YNH A;  2IVN A;  3ZLJ A;  4J2D A;  4DSF A;  3VPZ A;  3PIP L;  4KHN A;  4CEO A;  3CD6 N;  4H4O A;  3WEE A;  2FC0 A;  4H5N A;  1GLJ O;  4FCY A;  3LM2 A;  4FXD A;  3CCV N;  4DSE A;  4DS5 A;  3TTD A;  1RGI A;  1FKP A;  3VA3 A;  5M1F A;  3VGM A;  3NF8 A;  3KK3 A;  1S1W A;  1BU6 O;  5HLF A;  2VWB A;  4JKB A;  4CZK A;  2VGN A;  3EL2 A;  3BGR A;  4X66 K;  1GOB A;  3SBG A;  3VQP A;  3H08 A;  5F0X A;  3HOT A;  2Q0R A;  4LY7 A;  3OYF A;  4ILJ A;  4Q5V A;  3AVA A;  1Z25 A;  4NXM K;  3RMA A;  4BRO A;  5C2D A;  2YJE A;  2P51 A;  3DRR A;  2J4R A;  4EHU A;  2YI1 A;  3L2W A;  4DV0 K;  1WBD A;  2KW4 A;  1DEJ A;  4FWO A;  4Y1D A;  5AQI A;  3O80 A;  1RNH A;  3V1O A;  3LWM A;  2RHK A;  4BC5 A;  1SQK A;  1BCM A;  3H46 O;  1WSF A;  1WAF A;  3OYJ A;  4BY9 C;  3O9S A;  4IFY A;  1X9W A;  1TGO A;  1WOQ A;  4EIA A;  4PL7 A;  1WSG A;  5HRP A;  1NMD A;  1NLV A;  3CJ9 A;  3ZSX A;  1HNX K;  3U9D A;  5J1E A;  4Z4H A;  4KRE A;  4CJK A;  4CEF A;  5EY4 A;  4R79 A;  3BY5 A;  4KAZ A;  5M1K A;  4OX9 K;  1QZ6 A;  3S41 A;  2Q1N A;  4KTZ A;  4Z4E A;  3CXC M;  1VSF A;  4JKA A;  4F3T A;  2PYJ A;  3VQE A;  5CZ2 A;  3CCE N;  3AA4 A;  3DXM B;  2HHH K;  1RT5 A;  4QS7 A;  1L3S A;  2UXD K;  1KCF A;  3AVH A;  4Q0B A;  4FLV A;  3KWG A;  4BE1 A;  3HRG A;  4JI1 K;  1S6P A;  3VMF B;  4CGG A;  3THX A;  4DSI A;  3SUN A;  2W42 A;  5AQN A;  3QB0 A;  1IH7 A;  1UA0 A;  4FZY A;  1N8R O;  5HRO A;  4JK7 A;  4B3S K;  3W3D A;  4WF9 L;  3I0S A;  4DMN A;  4CHZ A;  4E3S A;  4M63 C;  1RBR A;  4LD0 A;  4J2A A;  4CF2 A;  2DPN A;  4FPB A;  2O8E A;  3KHY A;  3UKU A;  1L3V A;  5LJW A;  3AGK A;  4GMJ B;  1N36 K;  4IZ9 A;  4M7X A;  3L2R A;  3TAM A;  5K14 A;  3LAK A;  1NG9 A;  4JS4 A;  3A5L C;  1S1U A;  2I7P A;  2Q3S A;  4AH9 A;  3OYI A;  4CEQ A;  4W5O A;  3A8Y A;  4DU4 A;  2QK9 A;  4DQ8 A;  4CJW A;  3U4L A;  3PX0 A;  3AAQ A;  3IUC A;  4IFV A;  3J7A P;  1RDB A;  4W5R A;  4PKI A;  2NRR A;  1OH6 A;  2V7Z A;  2IOC A;  1JLQ A;  4DHY A;  4BG8 A;  2OA8 A;  3IG1 A;  5KQ8 A;  3HVR A;  3G10 A;  1BIZ A;  2Q97 A;  4KO0 A;  5AQO A;  1NBW A;  2CGK A;  5LY3 A;  1NGB A;  1EX4 A;  3D2F A;  3VQB A;  3W0L A;  3OVN A;  4K8X A;  3AO5 A;  2R7Y A;  1NK9 A;  4XIU A;  3H1Q A;  4C8O A;  3LAN A;  4NXN K;  3CI5 A;  5SZT A;  4IJA A;  1SKR A;  4HHT A;  4B1W B;  1Q9X A;  4I9L A;  3C7N A;  3T69 A;  2GUI A;  4O44 A;  1N33 K;  2F8S A;  1E4F T;  1QQC A;  3DLL L;  1A5X A;  1C6V A;  4CW7 B;  3S9H A;  4B9M A;  4MFB A;  4KH6 A;  1JKH A;  3TAB A;  1ZBS A;  2UXB K;  4H8K A;  1Q82 O;  4CES A;  5LMN K;  3SV4 A;  1YIJ N;  4DFM A;  4OVL A;  1QS4 A;  3OYK A;  4ILG B;  4DR3 K;  2OTJ N;  3MEG A;  3SCX A;  1XWL A;  3KZB A;  2VG5 A;  3VEV A;  5I42 A;  2OZS A;  3C6A A;  3KD1 E;  3J7Y P;  1XUP O;  1NK5 A;  3THW B;  4FLU A;  1NK7 A;  1KRP A;  3MED A;  1FK9 A;  2HST A;  4A59 A;  4H0P A;  4DR7 K;  2E8A A;  4A5A A;  4FJ5 A;  4O5B A;  1ZBH A;  1ZYQ A;  2YCH A;  3TAE A;  1NJZ A;  1U04 A;  2P9I A;  2NZT A;  3M3Z A;  4I2Q A;  5AQY A;  3PSI A;  1KC8 O;  3TPQ A;  3EE9 A;  3QES A;  4YHH K;  2KQ2 A;  3O4N A;  4BRF A;  1DGK N;  5AZI B;  5F2R A;  5JLH A;  5BRE A;  4YDU A;  3HYF A;  4E1N A;  4DQR A;  4EZ9 A;  2P5G A;  4F4K A;  1NKC A;  3KVG A;  4YDU C;  5AQH A;  4FJL A;  4B9T A;  2P9I B;  4C1N K;  4BRI A;  4GV3 A;  1XNR K;  4CHP A;  1DTQ A;  4NCB A;  2NNW A;  1W9H A;  1BCO A;  3ID8 A;  2YKN A;  3WNG A;  3SAH A;  3G6E N;  4CJL A;  4OGC A;  4CIE A;  3EN9 A;  4FLT A;  4JKE A;  2QXL A;  1VQ8 N;  1HKG A;  1IBK K;  3VQ5 A;  3KKR A;  1J5O A;  4LF6 K;  3C6H A;  1NGF A;  5KPR A;  3CCU N;  3HPO A;  4LF9 K;  4ID1 A;  3ZSW A;  4AHC A;  4J2E A;  4YOV A;  4CHY A;  2E20 A;  3WXJ A;  3AVG A;  4KPY A;  1QE1 A;  4FWM A;  1NK6 A;  2G8H A;  4ISE A;  4KI6 A;  5CHI A;  4ISG A;  3UB5 A;  1VQ7 N;  5GIO A;  1DT9 A;  4NCG A;  4B8C A;  4E89 A;  2GWK A;  4FJH A;  1IJJ A;  2Z1J A;  3PLA A;  3NF9 A;  2XY6 A;  2G8V A;  2EHG A;  3ENO A;  4W5Q A;  3ZT3 A;  3CJ7 A;  2GWJ A;  4DTX A;  4J2B A;  2E88 A;  2QWR A;  3AY9 A;  5DM6 L;  2FF6 A;  1HUX A;  4NO7 A;  1KAY A;  4IOC L;  1VK0 A;  1V4T A;  5AQQ A;  2ITM A;  1JLE A;  2KZM A;  4B3R K;  1TUU A;  2QW9 A;  3VEY A;  3MMV A;  4CFA A;  2O8B B;  1XQS C;  2P9N A;  5E26 A;  3HVT A;  3NGZ A;  1MDU B;  3NGY A;  3SMS A;  4HCC A;  4CEZ A;  3RR8 A;  3RVC A;  4DS4 A;  4YY3 K;  3MN7 A;  4JKG A;  4DV5 K;  4BWM A;  2ZD1 A;  1B9D A;  5A2Q O;  2HHQ A;  1KVA A;  2G8U A;  4XEI A;  1W2B M;  3CM5 A;  5HOO A;  4KHS A;  3HXM A;  1CZA N;  2YX6 A;  3HT3 A;  4BRP A;  3F5T A;  4CE9 A;  1WUA A;  1GLL O;  1T6D A;  5AQX A;  1B9F A;  2OPS A;  3K9J A;  3LWL A;  3THY B;  4IBN A;  4O55 A;  1TAU A;  1KAZ A;  3BUZ B;  3M8S A;  1L3U A;  1KLM A;  1VSM A;  2UUB K;  1QSS A;  3ZSZ A;  4CF9 A;  5GAE P;  1QQM A;  4Z4F A;  3OJU A;  4RTF D;  4KKO A;  5CZ1 A;  3AVM A;  5BR9 A;  3CC7 N;  1KXP A;  4FM1 A;  4E1J A;  3CQY A;  3L2V A;  4AIL C;  2E2O A;  3VQ7 A;  3P31 A;  5B8H A;  1S1X A;  4LF8 K;  4PHT X;  2BGG A;  3H45 C;  3VEO A;  5FRM A;  3K57 A;  3SQ4 A;  3OYN A;  1G15 A;  4OPK A;  3ZSY A;  4N56 A;  1HPZ A;  3OBY A;  3BF3 A;  4AF1 A;  1NGG A;  4J8F A;  1RDA A;  4O0I A;  4DV1 K;  1XHZ A;  3NH1 A;  3PV8 A;  4LF5 K;  5HL7 L;  4FK2 A;  1DTT A;  2BTF A;  3CCR N;  4ILH A;  2IS3 A;  3HO1 A;  2YHW A;  5JLF A;  1X3N A;  5HRR A;  1YJN N;  2P9U A;  2QWO A;  4FJM A;  3LAM A;  3S3O A;  3FE1 A;  3R1X A;  4LF4 K;  1VRU A;  3K5N A;  2HHT A;  4KHW A;  3OJS A;  2O8C A;  2H3G X;  3JYT A;  2PBD A;  4ELT A;  1NJX A;  3ZX3 A;  4MDB A;  3E66 A;  3WQT A;  3VQD A;  4B3M K;  3MCA B;  4CI6 A;  1NOZ A;  4AHV A;  1REV A;  1YJW N;  2EWS A;  3I33 A;  2RKI A;  2GV9 A;  4FL9 A;  1K8A O;  1TL3 A;  1TV6 A;  2GX9 A;  1HNV A;  1WB9 A;  1VAZ A;  3A5O C;  3M8P A;  3J81 O;  4NYF A;  3ULE B;  1NWK A;  1HJR A;  3BEX A;  1EET A;  3R9P A;  3CJB A;  4I6M A;  4EFH A;  4ELU A;  2FSJ A;  3AA3 A;  3LPU A;  3THX B;  1U2V B;  4CHN A;  4WCE L;  3AA2 A;  4RW6 A;  3DWL A;  1JCG A;  4JI8 K;  3SMP A;  4BVP A;  4E7I A;  4YOY A;  5CYQ A;  5J2N A;  1IG9 A;  2HHS A;  4I6M B;  1VSK A;  3AVN A;  1WLJ A;  2VG7 A;  4HUE A;  3SQ1 A;  3JS6 A;  1D4X A;  4BC4 A;  3R3L A;  1KFS A;  4CHO A;  4C8L A;  3QBX A;  5AZJ B;  2UUC K;  1ZBF A;  3VQ8 A;  4ICL A;  4WQ5 C;  4CGI A;  3SUQ A;  4A2B A;  4Z4C A;  4IOA L;  4BRC A;  1A5W A;  3N4P A;  3UE5 A;  2I5J A;  1NGC A;  4G9Z A;  2X6S A;  5AQR A;  4CEA A;  4H0T B;  4AM7 A;  1TKD A;  4PL8 A;  3OA9 A;  2OYQ A;  5AQM A;  3K58 A;  4H4M A;  3DLK A;  1VSH A;  2P9U B;  3F9M A;  4LFC K;  4PA1 A;  2BUP A;  3VTI A;  1RTD A;  3AAP A;  1RBS A;  1GLC G;  1TVR A;  5I3U A;  1S9E A;  5KRS A;  3ATU A;  2Y1J A;  4CBU A;  1BI4 B;  3L4I A;  4DF8 A;  3O5B A;  4B3T K;  1KD1 O;  2NUB A;  4DLE A;  3VQA A;  3VQ9 A;  3RMD A;  3B6O A;  1C0T A;  4DCH A;  4JK8 A;  1K9M O;  1VSL A;  3CC2 N;  2KZZ A;  1P8Z A;  1T44 A;  3LPT A;  4LSN A;  1JJ2 M;  4BRQ A;  3SV3 A;  4K41 A;  2ZF5 O;  1YAG A;  2Q36 A;  3OY9 A;  3OYE A;  3SJH A;  1OKJ A;  4CK2 A;  3RSE A;  4CFD A;  4BRK A;  3QLH A;  1CZ9 A;  1LWC A;  2A6A A;  5T7B A;  2ITG A;  3DOL A;  2HBM A;  4A5B A;  3K59 A;  3T1H K;  4NB4 A;  2WC9 A;  5JMV A;  3WT0 A;  4CBW A;  4M42 A;  3FZH A;  4PWD A;  4CZJ A;  1X3M A;  4WQ4 C;  1FJG K;  3PSF A;  1J54 A;  2YKM A;  3SAG A;  4A2A A;  3AO3 A;  1Q8I A;  4JI7 K;  2BH1 A;  3LP2 A;  2P9S A;  5CYM A;  1GLB G;  1FXX A;  5HRS A;  3KLE A;  4IO9 L;  1WNS A;  2CGL A;  4IFE A;  3VF2 A;  4DG1 A;  4CK3 A;  3AVC A;  3OYC A;  4OGE A;  3WNH A;  3M1F A;  3H3O B;  2FBY A;  1KTQ A;  2WUS A;  3V4I A;  5AQP A;  4GVM A;  1TYQ A;  3VEZ A;  2W6K A;  3RR7 A;  1V4S A;  3CQ8 A;  2Q31 A;  2P9K A;  3OBW A;  1YIT N;  1TKZ A;  3FZF A;  4L8R B;  4KBO A;  4OO1 J;  1BWF O;  2Q0U A;  3UKR A;  2YNG A;  4JKG B;  5FRO A;  4N76 A;  3V1R A;  3KLF A;  4RW4 A;  4NCA A;  2D0B A;  4C1N I;  4B9N A;  4AHS A;  3PX4 A;  5E41 A;  2O4I A;  4A62 A;  1LW2 A;  3ZSO A;  4LH4 A;  3ULE A;  4FWP A;  1JLF A;  4L3Q A;  1RTJ A;  3WXL A;  1DLO A;  4RCH A;  3D2E A;  2ASP A;  1OH7 A;  4JV5 K;  3H6E A;  3TSU A;  3ZSR A;  1YVU A;  2A41 A;  1P90 A;  1HJO A;  2OPP A;  3QO9 A;  2GTD A;  3V9Z A;  4E7H A;  2O8C B;  1IKW A;  4G1Q A;  3A0I X;  4FW2 A;  1EWQ A;  4LC9 B;  4RG8 A;  3K2P A;  3DRP A;  3L3V A;  3EZ5 A;  1T03 A;  3FZM A;  4FWN A;  3LP3 A;  1HNZ K;  1F21 A;  4CEE A;  3WNE A;  3JXU A;  3KK7 A;  4CZL A;  1SUQ A;  2VG6 A;  2QI2 A;  3GG4 A;  3DM2 A;  1K6Y A;  3O9U A;  4A61 A;  1DKG D;  1HX1 A;  2ETJ A;  3IAY A;  4JKD A;  1U49 A;  3CYM A;  2HF4 A;  3UKR B;  4HUG A;  2Z1I A;  4IEE A;  4MO5 A;  4CGJ A;  5M1O A;  3EZW A;  1RDW X;  2Y1I A;  3C0B A;  2FBV A;  4BE2 A;  1NJY A;  3SJJ A;  3VQC A;  4O8K A;  4DWI A;  4Z94 A;  1QVG M;  4DSL A;  1IKX A;  4KV8 A;  2G8F A;  3ZSQ A;  4FW1 A;  3DMJ A;  4JLH A;  3FFI A;  2E2Q A;  4I2P A;  5M1Q A;  5AZI A;  4I7F A;  4B9L A;  4CJE A;  1QZ5 A;  1TK0 A;  4KTW A;  4FM2 A;  3HP6 A;  1N32 K;  5GAH P;  4PUO A;  3L2Q A;  3LAL A;  1HKC A;  3K9K A;  4ELV A;  3VQ6 A;  4UY8 O;  2QWN A;  3IS9 A;  3AVF A;  4WQ4 A;  5FLX O;  4LSL A;  2ZQB A;  4QCL A;  4DTM A;  5AQG A;  3C94 A;  3NAE A;  4NYN A;  3QEX A;  4FWQ A;  2BDP A;  3WXM B;  4EP5 A;  3HST B;  3UIQ A;  4JK9 A;  4YNQ A;  3VEW A;  2QKK A;  3BF1 A;  5GAG P;  3P39 A;  3NFA A;  3CCQ N;  2YV0 X;  5AQV A;  4FJN A;  3F73 A;  1S3X A;  4BR4 A;  3PIO L;  1BG3 A;  1T05 A;  1HYZ A;  1B92 A;  1T8E A;  3GL1 A;  3KK1 A;  3NDK A;  4HUF A;  4F3O A;  1D8Y A;  3F9K A;  5BRF A;  4DV2 K;  3IFR A;  3ITH A;  2V51 B;  2O8D A;  4EZ6 A;  3G4S N;  3KIO A;  3RTV A;  3ENH A;  4BRL A;  1NGA A;  3CCJ N;  3CF5 L;  4KI4 A;  3B8A X;  3O9Q A;  3QML A;  3G71 N;  4CJT A;  4LF7 K;  4HTU A;  1UA1 A;  1Q7Y O;  1CLQ A;  2VWJ A;  3D2F B;  2FBT A;  3O9R A;  4DTU A;  2IC3 A;  4JI2 K;  4KHY A;  3BZC A;  3QER A;  4JYA K;  4CZM A;  5C0Y A;  4JI3 K;  4K0K K;  4DF4 A;  4AQY K;  4B9U A;  2KTQ A;  4DQS A;  4WFB L;  3KLG A;  2Z1G A;  4CJV A;  3SQ2 A;  5LJV A;  1UWB A;  2FF3 B;  2E2P A;  4HTL A;  1TK5 A;  3C6U A;  3EYZ A;  1NKB A;  1R59 O;  3P38 A;  1J53 A;  3AVL A;  4KHU A;  1RT6 A;  1C0F A;  2QXF A;  4GKJ K;  1JXE A;  3NCI A;  3QET A;  1J9A A;  4K25 A;  2QWL A;  1MU2 A;  1U2V A;  4BR7 A;  3U8X A;  1EP4 A;  4BRG A;  3VEX A;  4XH1 A;  1TKX A;  2YNF A;  2I7N A;  1BDG A;  1N34 K;  1QQO A;  4JKF A;  1T7P A;  5J2M A;  1YT3 A;  5BR8 K;  1JL2 A;  4ID5 A;  5IT9 O;  4QS9 A;  5BRH A;  1VQN N;  4RW7 A;  3TAQ A;  5BPM A;  3C65 A;  2FXU A;  1I39 A;  3CCM N;  2O8E B;  5GIP A;  1NM1 A;  4M3U A;  3SPY A;  4JI0 K;  1XHX A;  2D5R A;  1LWF A;  4M41 A;  2HHW A;  3K5M A;  3BZK A;  1WSE A;  1ZBL A;  3VF6 A;  1HMV A;  5J2P A;  4B1U B;  1YTA A;  2CGJ A;  3IMX A;  3Q7C A;  4BGB A;  4IOX A;  4LH5 A;  3NH0 A;  3O4Q A;  4H0V B;  1VQ6 N;  4FJ9 A;  3SNN A;  4M3T A;  3R6M A;  3CPW M;  2P9L A;  4X64 K;  4BRA A;  1OH5 A;  2BAN A;  1HQU A;  1BUP A;  1NMN A;  4FWL A;  3NBP A;  1IKV A;  1XNQ K;  4DV7 K;  4O8U A;  4CZF A;  1I94 K;  1IKY A;  2DFF A;  2HVI A;  2ZJP L;  1YXQ A;  1RDD A;  4OKK A;  2IDO A;  3ZYY X;  2WON A;  4OPJ A;  2CH5 A;  5AQL A;  2YHA A;  3MCP A;  1O13 A;  3HBT A;  5JS1 A;  1LWE A;  2W40 A;  4HVJ A;  4F2S A;  3TWH A;  3RMC A;  4ZTF A;  3M5R A;  1K73 O;  1U45 A;  3KLH A;  5AQJ A;  3JSM A;  1BO5 O;  5BN9 A;  3TTC A;  5AQK A;  1FW6 A;  3THV A;  2UYT A;  1A5V A;  4DTO A;  3I55 N;  3THY A;  2JLE A;  4I9Q A;  4CFC A;  3RSE B;  1JCF A;  4BR9 A;  5J2Q A;  1NGI A;  2ZGZ A;  4DR5 K;  4B9V A;  2RE2 A;  1K8K B;  5KPT A;  2FSK A;  1S72 N;  2QA4 N;  4BDP A;  3NVK A;  2A40 A;  3LZJ A;  1ZBU A;  3G25 A;  4N5S A;  3O3G A;  1Z05 A;  4BDZ A;  3HJF A;  3D0P A;  2A42 A;  4GW6 A;  1ASU A;  3FFK B;  1YHQ N;  2NRZ A;  4Z0U A;  2X74 A;  4A57 A;  4JAX A;  4FZZ A;  4CZE A;  2XRI A;  3JAM O;  3WNF A;  2HND A;  3WUH A;  4CD1 A;  3SPZ A;  3VQQ A;  2E1Y A;  4E19 A;  3OS0 A;  4FLY A;  4AM6 A;  5M1N A;  4C8N A;  3WEE B;  1CXQ A;  2UU9 K;  3D7E O;  2DTU A;  3ULD A;  1KAX A;  3HSC A;  5JVH L;  1ATR A;  2NRH A;  4BRD A;  4DQP A;  3NF7 A;  5EXW A;  3RRH A;  4GNI A;  4DUY K;  1TAQ A;  4WQ5 A;  4BQL A;  3UKU B;  3VQ4 A; 
#chains in the Genus database with same CATH homology
 3OY9 A;  3OYE A;  4KRF A;  4CK2 A;  5C42 A;  1TL1 A;  2VWK A;  3L2R A;  3TAM A;  3QIN A;  1Z26 A;  5EU7 A;  4CFD A;  5K14 A;  3QLH A;  3QNN A;  3LAK A;  1VSE A;  4DTN A;  1CZ9 A;  3PY8 A;  5FRN A;  1LWC A;  4HCB A;  5T7B A;  2ITG A;  3DOL A;  3K59 A;  1YTU A;  4JS4 A;  4B3O A;  1S1U A;  3A2F A;  1N5Y A;  2Q3S A;  4AH9 A;  3OYI A;  4M42 A;  4CEQ A;  3SI6 A;  4CIG A;  4W5O A;  3CFR A;  3AVJ A;  4PWD A;  4DU1 A;  4DU4 A;  2QK9 A;  1J54 A;  2YKM A;  4CJW A;  4E1M A;  1D5A A;  3PO5 A;  3V81 A;  3PX0 A;  4TSX A;  3QNO A;  3AO3 A;  1Q8I A;  3LP2 A;  4RW9 A;  4IFV A;  5CYM A;  1RDB A;  5CY4 A;  4W5R A;  1XC9 A;  2D0A A;  1S9G A;  4DFJ A;  2IOC A;  1JLQ A;  1FXX A;  3MXM A;  5HRS A;  2OA8 A;  3IG1 A;  3IRX A;  3TAG A;  4M3W A;  1LAV A;  3KLE A;  1WNS A;  4DG1 A;  1Y97 A;  1U47 A;  4CK3 A;  3AVC A;  3HVR A;  3G10 A;  3OYC A;  4E7K A;  1BIZ A;  4KHQ A;  4OGE A;  3WNH A;  4ZHR A;  4KO0 A;  2FBY A;  1KTQ A;  3MEE A;  3V4I A;  3OYH A;  4FK4 A;  3PUF A;  4GVM A;  1EX4 A;  1TKT A;  2X6N A;  3V9U A;  1VSJ A;  4OKJ A;  1SL0 A;  1NK0 A;  3VQB A;  4DFP A;  1SL1 A;  3RR7 A;  3OVN A;  3CQ8 A;  4K8X A;  3AO5 A;  5HP1 A;  2R7Y A;  3LP0 A;  1NK9 A;  4MQ3 A;  4XIU A;  3ASM A;  1X9S A;  1JLB A;  4C8O A;  3LAN A;  1TKZ A;  4L8R B;  2XHB A;  5SZT A;  1HQE A;  1SKR A;  4Y1C A;  4CJS A;  2BE2 A;  4HHT A;  1Q9X A;  4I9L A;  1NOY A;  2F8T A;  1X1P A;  2P1J A;  3DRS A;  3T19 A;  1RTI A;  4FLX A;  3SUO A;  4FJI A;  3HK2 A;  2GUI A;  2YNG A;  5FRO A;  4CJP A;  4O44 A;  4N76 A;  3V1R A;  2F8S A;  3KLF A;  3L8B A;  4RW4 A;  4NCA A;  1QQC A;  2D0B A;  4CFB A;  1ZBH A;  1A5X A;  1JXB A;  1C6V A;  4B9N A;  4AHS A;  3PX4 A;  5E41 A;  3S9H A;  4B9M A;  4OLA A;  2O4I A;  1KVB A;  5DK5 A;  4MFB A;  1LW2 A;  2O4G A;  1JKH A;  3ZSO A;  4LH4 A;  3TAB A;  1JLF A;  1RTJ A;  2GBZ A;  4H8K A;  3KJV A;  4CES A;  3SV4 A;  3AO1 A;  1DLO A;  2PY5 A;  1O1W A;  4OVL A;  3MXJ A;  1QS4 A;  4DFM A;  4KB0 A;  3OYK A;  4DQQ A;  3P1G A;  3MEG A;  3SCX A;  2XO7 A;  3ZSR A;  4BE0 A;  1XWL A;  2IGI A;  1YVU A;  5HRN A;  2VG5 A;  4FM0 A;  3O3F A;  5I42 A;  4DQI A;  2OZS A;  5KI6 A;  3KD1 E;  2OPP A;  3QO9 A;  1NK5 A;  4M3R A;  4FLU A;  3C95 A;  3V9Z A;  4E7H A;  4AHR A;  4OLB A;  1NK7 A;  1VSI A;  4B8A B;  1KRP A;  1IKW A;  3MED A;  3MAQ A;  1FK9 A;  4G1Q A;  4JRP A;  4FW2 A;  1KFD A;  4FJ5 A;  4O5B A;  1C1B A;  3K2P A;  3QIP A;  4RG8 A;  3DRP A;  4RW8 A;  4DU3 A;  1XI1 A;  3L3V A;  1ZYQ A;  3C6T A;  4F8R A;  3EZ5 A;  1RBU A;  2YHB A;  3L2U A;  3TAE A;  1T03 A;  1NJZ A;  4UQG A;  3LP3 A;  1U04 A;  1RT4 A;  1F21 A;  4CEE A;  3WNE A;  4I2Q A;  3RWU A;  1JLC A;  3OYL A;  1S5J A;  3P5J A;  3B6P A;  2AJQ A;  1SUQ A;  2VG6 A;  3DM2 A;  3LZI A;  1K6Y A;  1RT3 A;  3QES A;  1KSP A;  4FJ7 A;  2KQ2 A;  3O4N A;  3RRG A;  4CCH A;  2ETJ A;  4F2R A;  3IAY A;  3KTQ A;  1RDC A;  2HMI A;  1U49 A;  1BIU A;  4CGH A;  3CYM A;  1UAX A;  4HUG A;  2Z1I A;  3CFO A;  2OPR A;  4FJ8 A;  3HYF A;  1QHT A;  4CGJ A;  4E1N A;  4DQR A;  4EZ9 A;  4DTR A;  2P5G A;  4F4K A;  3OYM A;  1NKC A;  2Y1I A;  4AHU A;  2FBV A;  4BE2 A;  1NJY A;  1LV5 A;  3SJJ A;  3VQC A;  4FJL A;  4B9T A;  3DYA A;  4DWI A;  1RCH A;  3KKS A;  5D3G A;  4DSL A;  5KGX A;  2XY7 A;  1S1T A;  1DTQ A;  1IKX A;  3DLG A;  4KV8 A;  1W9H A;  1BCO A;  4CHP A;  2A1S A;  4NCB A;  2G8F A;  3AVI A;  3ZSQ A;  2YKN A;  3WNG A;  5KTQ A;  1WAJ A;  3AVB A;  4OGC A;  3M8Q A;  4CJL A;  3O3H A;  4CIE A;  4IG0 A;  1X9M A;  3HPH A;  4FW1 A;  3DMJ A;  4JLH A;  2E6M A;  4QAG A;  2Z1H A;  3FFI A;  5C25 A;  4FLT A;  3PO4 A;  4AHT A;  4KFB A;  4I2P A;  3T3F A;  3VQ5 A;  3KKR A;  1J5O A;  3ZCM A;  3QEI A;  2G8K A;  5SWM A;  1SV5 A;  3D45 A;  4CJ4 A;  4I7F A;  1NKE A;  1KLN A;  4B9L A;  4CJE A;  3OYA A;  1TK0 A;  2DFE A;  3HPO A;  4KTW A;  2B5J A;  4FM2 A;  4ID1 A;  3ZSW A;  3HP6 A;  4AHC A;  3TAF A;  4PUO A;  4OKE A;  3CFP A;  1C1C A;  3M8R A;  3L2Q A;  3LAL A;  3V9S A;  4J2E A;  4CHQ A;  1C1A A;  4PQU A;  4ELV A;  3VQ6 A;  3U3Y A;  3IS9 A;  3AVF A;  4CHY A;  3AVG A;  4KPY A;  4LSL A;  1QE1 A;  2B4J A;  2E6L A;  3DLR A;  3TI0 A;  1NK6 A;  2G8H A;  2ZQB A;  4QCL A;  4DTM A;  4KI6 A;  3C94 A;  4Z4G A;  5HBM A;  3NAE A;  3V1Q A;  4NCG A;  1ITG A;  4NYN A;  3ZT0 A;  3QEX A;  4CER A;  2BDP A;  4CJR A;  4B8C A;  4DTS A;  4E89 A;  4JS5 A;  4FJH A;  3HPG A;  2Z1J A;  4CJU A;  4KTQ A;  4N41 A;  3NF9 A;  2XY6 A;  1CXU A;  4EP5 A;  2OZM A;  2G8V A;  1W0H A;  2EHG A;  4W5Q A;  3HST B;  3ZT3 A;  4FJK A;  3HL8 A;  1L5U A;  1UOC A;  3UIQ A;  4FK0 A;  4DTX A;  4DSK A;  4YNQ A;  4J2B A;  1SKS A;  2QKK A;  3ZT1 A;  4JRQ A;  4CGF A;  3NFA A;  2YV0 X;  3AV9 A;  1NK4 A;  4FJN A;  4M45 A;  3F73 A;  2E4L A;  4C8K A;  1T05 A;  4B08 A;  1HYZ A;  1VK0 A;  1B92 A;  1T8E A;  3KK1 A;  3NDK A;  1JLE A;  4HUF A;  1JLA A;  2KZM A;  3U3G A;  4F3O A;  1D8Y A;  3QEV A;  4KB1 A;  4IG3 A;  4WE1 A;  4BWJ A;  3OYB A;  4CFA A;  3OYD A;  3TAN A;  3F9K A;  2QKB A;  2HVH A;  1RT1 A;  3ITH A;  3HVT A;  3NGZ A;  3NGY A;  4HCC A;  4CEZ A;  4Z4I A;  4EZ6 A;  1KVC A;  3RR8 A;  3QEP A;  4DS4 A;  1HYV A;  4M3Y A;  3S3M A;  1EKE A;  3KIO A;  4BWM A;  3RTV A;  1HRH A;  4CF1 A;  4E0D A;  2ZD1 A;  1QSY A;  2HB5 A;  1B9D A;  3I0R A;  4CJ3 A;  1C0M A;  2HHQ A;  1KVA A;  3OS1 A;  1HNI A;  2G8U A;  2PZS A;  3LP1 A;  2LSN A;  4CEC A;  4KI4 A;  2EX3 A;  4CJT A;  4HTU A;  1UA1 A;  3VN5 A;  1CLQ A;  3CM5 A;  4KHS A;  2VWJ A;  2RF2 A;  3HXM A;  1HYS A;  3AA5 X;  2FBT A;  4DTU A;  4CED A;  3HT3 A;  2RN2 A;  4O0J A;  2IC3 A;  3V9X A;  1R0A A;  2P5O A;  4KHY A;  3TAR A;  2XY8 A;  4CE9 A;  3QER A;  2DY4 A;  4FVM A;  2OPQ A;  4QOZ B;  4DF4 A;  4DSJ A;  4B9U A;  1QTM A;  1B9F A;  2OPS A;  4DQS A;  2KTQ A;  3LWL A;  1NJW A;  4IBN A;  5C24 A;  4O55 A;  1FKO A;  3KLG A;  4DTP A;  2Z1G A;  4CF0 A;  1TAU A;  4CJV A;  3M8S A;  3SQ2 A;  3L3U A;  3SQ0 A;  1UWB A;  4BAC A;  1L3U A;  3NE6 A;  3MEC A;  1TK5 A;  3C6U A;  1KLM A;  1VSM A;  3EYZ A;  4ZTJ A;  1NKB A;  1QSS A;  3ZSZ A;  1J53 A;  3AVL A;  4CF9 A;  3KD5 E;  4K8Z A;  4KHU A;  1RT6 A;  4FYD A;  2QXF A;  1BQM A;  4Z4F A;  1JXE A;  3NCI A;  2HHU A;  3QET A;  3OJU A;  4FJX A;  4KKO A;  1J9A A;  3V6D A;  1RIL A;  1MU2 A;  3AVM A;  5CZ1 A;  3ZT4 A;  1WSI A;  3E01 A;  1JLG A;  3NHG A;  1EP4 A;  4CJ5 A;  4FM1 A;  1BI4 A;  4O4G A;  1WN7 A;  1RT2 A;  4AIL C;  3L2V A;  1TKX A;  2YNF A;  3HP9 A;  1L3T A;  1BHL A;  4YFU A;  4FJG A;  3VQ7 A;  1GOC A;  1S1X A;  3LDS A;  1QSL A;  2HNY A;  2ATQ A;  2D0C A;  1CZB A;  1VSD A;  3CM6 A;  3QIO A;  5J2M A;  1U4B A;  4BDY A;  1T7P A;  4M3Z A;  2BGG A;  4OJR A;  1YT3 A;  1BIS A;  1RTH A;  4CK1 A;  3KK2 A;  3K57 A;  3SUP A;  5FRM A;  5FDL A;  1JL2 A;  4ID5 A;  3NGI A;  3SQ4 A;  1VRT A;  1Q9Y A;  1ASV A;  4M3X A;  3OYN A;  1G15 A;  4CJF A;  4E7L A;  1I3A A;  1D9F A;  4OPK A;  2G8I A;  1C0U A;  4RW7 A;  3TAQ A;  2ZE2 A;  3ZSY A;  4N56 A;  1HPZ A;  1TK8 A;  3PX6 A;  1I39 A;  5JS2 A;  5DMR A;  3OS2 A;  4FLW A;  3KLI A;  4IKF A;  2B6A A;  4CJQ A;  3S3N A;  3MXI A;  4M3U A;  4CIF A;  3V9W A;  1RBV A;  2HHV A;  3SPY A;  2KFZ A;  2WOM A;  1XHX A;  2D5R A;  3DLB A;  1LWF A;  4M41 A;  2YNH A;  3SYZ A;  2HHW A;  4J2D A;  3K5M A;  4DSF A;  1RDA A;  4KHN A;  4O0I A;  4CEO A;  1XHZ A;  3NH1 A;  3PV8 A;  1WSE A;  1ZBL A;  3BDP A;  4H4O A;  2FC0 A;  1BGX T;  4DFK A;  4FK2 A;  1HMV A;  4N47 A;  5J2P A;  3K5L A;  1DTT A;  2YNI A;  4FCY A;  1BL3 A;  1YTA A;  3G0Z A;  4FXD A;  4DSE A;  4DS5 A;  2IS3 A;  4LH5 A;  3HO1 A;  1FKP A;  3NH0 A;  3VA3 A;  2PYL A;  3O4Q A;  1WSJ A;  1ASW A;  5HRR A;  4CEB A;  4FJM A;  4C8M A;  4FJ9 A;  3LAM A;  3DLE A;  3NF8 A;  3KK3 A;  3VA0 A;  3SNN A;  3S3O A;  4M3T A;  1VRU A;  3K5N A;  2HHT A;  4KHW A;  1S1W A;  3OJS A;  3DI6 A;  5HLF A;  3JYT A;  2RPI A;  2BAN A;  3RMB A;  1U48 A;  4FZX C;  4ELT A;  1NJX A;  1HQU A;  2XY5 A;  2A1R A;  3AVK A;  3VQD A;  4B9S A;  4EP4 A;  3K5O A;  4CGD A;  3BGR A;  1GOB A;  1NOZ A;  4AHV A;  1REV A;  1IKV A;  3NBP A;  3SZ2 A;  3TAP A;  4W5N A;  3VQP A;  2DFH A;  3QEW A;  2RKI A;  2GV9 A;  3H08 A;  1TL3 A;  4LY7 A;  1TV6 A;  3OYF A;  1HNV A;  3ZSV A;  4Q5V A;  3AVA A;  3OYG A;  1Z25 A;  3AO4 A;  1SKW A;  3U6F A;  1IKY A;  2DFF A;  3RMA A;  2HVI A;  3M8P A;  3T1A A;  3CG7 A;  3I8D A;  4NYF A;  1WSH A;  2P51 A;  3DRR A;  1HJR A;  3AO2 A;  1EET A;  1S6Q A;  3L2W A;  5KGW A;  1RDD A;  2KFN A;  1IO2 A;  2G8W A;  2KW4 A;  4ELU A;  4Y1D A;  4OKK A;  2FBX A;  2IDO A;  1RNH A;  3AA3 A;  2WON A;  3LPU A;  3V1O A;  3LWM A;  4OPJ A;  1BQN A;  2YHA A;  1BCM A;  4CHN A;  1WSF A;  1WAF A;  5JS1 A;  1LWE A;  3AA2 A;  3OYJ A;  4RW6 A;  4HVJ A;  3EY1 A;  4F2S A;  4E7I A;  3TWH A;  4IFY A;  5CYQ A;  1JL1 A;  1D9D A;  5J2N A;  3RMC A;  1X9W A;  1IG9 A;  2HHS A;  1TGO A;  4ZTF A;  1NK8 A;  1VSK A;  2HW3 A;  2HNZ A;  3AVN A;  1WLJ A;  1WSG A;  2VG7 A;  5HRP A;  3KLH A;  4HUE A;  3JSM A;  1U45 A;  3ZSX A;  3SQ1 A;  5J1E A;  4Z4H A;  3P83 D;  4FJJ A;  4KRE A;  4FLZ A;  3THV A;  3ALY A;  1KFS A;  1A5V A;  2JGU A;  4CHO A;  4DTO A;  4C8L A;  2JLE A;  4CJK A;  1ZBF A;  1S1V A;  4I9Q A;  3VQ8 A;  4CFC A;  4ICL A;  4CEF A;  3DLH A;  4KAZ A;  4CGI A;  1RT7 A;  4E7J A;  5J2Q A;  3SUQ A;  4B9V A;  4KTZ A;  3ZT2 A;  1RBT A;  1SL2 A;  4Z4C A;  4BDP A;  4Z4E A;  3LZJ A;  1ZBU A;  4N5S A;  3O3G A;  5KRT A;  4CF8 A;  1VSF A;  1A5W A;  4F3T A;  4BDZ A;  2PYJ A;  3D0P A;  3HJF A;  3VQE A;  2IAJ A;  5CZ2 A;  4GW6 A;  1ASU A;  2I5J A;  3AA4 A;  1RT5 A;  2X6S A;  4CEA A;  1L3S A;  4Z0U A;  1KCF A;  3AVH A;  4Q0B A;  4DTJ A;  2HHX A;  1TKD A;  4W5T A;  4FLV A;  2X74 A;  2OYQ A;  4BE1 A;  3K58 A;  4H4M A;  1N6Q A;  3DLK A;  3NH2 A;  1VSH A;  4FZZ A;  1S6P A;  4PA1 A;  4CGG A;  2F96 A;  2XRI A;  3WNF A;  4DSI A;  3SUN A;  2HND A;  2W42 A;  1RTD A;  1RBS A;  1TVR A;  5I3U A;  3DOK A;  3SPZ A;  1IH7 A;  3VQQ A;  1S9E A;  4E19 A;  5KRS A;  4DLG A;  1UA0 A;  4FZY A;  5HRO A;  3OS0 A;  2Y1J A;  1BI4 B;  4FLY A;  4DF8 A;  1LAW A;  4C8N A;  1CXQ A;  4R5P A;  2NUB A;  3ISN C;  4DLE A;  2DTU A;  3VQA A;  3VQ9 A;  3RMD A;  1LW0 A;  3I0S A;  4DMN A;  3ULD A;  3B6O A;  1C0T A;  4CHZ A;  4E3S A;  1RBR A;  1VSL A;  1EXQ A;  2X78 A;  4LD0 A;  4J2A A;  4CF2 A;  4DQP A;  4PY5 A;  3NF7 A;  2KZZ A;  3LPT A;  3RRH A;  4IDK A;  1L3V A;  4LSN A;  1GOA A;  1TAQ A;  3NF6 A;  3SV3 A;  1ZBI A;  4GMJ B;  3TR8 A;  3HM9 A;  3VQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...