4CIGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cigA00
3WNGA 4CEDA 1HYVA 2XY5A 1HQUA 1X9MA 1I3AA 2KQ2A 5FDLA 3EZ5A 3QIPA 1VSFA 4FW2A 3C94A 1UOCA 3O3FA 1VSJA 4CFBA 3LPUA 4FJNA 4JRQA 2E4LA 4DSJA 3K57A 3UIQA 4NCAA 4CFAA 1VSLA 1HQEA 3OYNA 3KD5E 3RMBA 3V1RA 5HLFA 4OKEA 1RDCA 3TAFA 4C8LA 3ZT4A 1WLJA 3M8PA 3TAMA 4HVJA 4B8AB 4M3UA 2XY6A 4W5OA 1Z26A 1RTJA 4JRPA 4DMNA 5J2PA 4J2DA 4M3YA 3HYFA 1JLFA 3DOLA 1ASVA 3AA5X 3ISNC 2Y1JA 1RBRA 4W5TA 2GBZA 3HP6A 3AV9A 3L3VA 4NYNA 4KHNA 1D8YA 4AHRA 4E7KA 4AHCA 4CECA 4E19A 1LAVA 4OPKA 4EZ6A 3EYZA 4Z4CA 1LWEA 4CJPA 1NJZA 3DLHA 1TKZA 2YNGA 1QE1A 3VQ6A 3F9KA 1BHLA 1UA1A 4CGFA 1SL2A 4FJ5A 1L3VA 1G15A 3V9UA 4LH4A 1TK5A 2A1RA 1RTDA 1S1VA 2VG7A 3V6DA 2R7YA 3VQ5A 4F4KA 1A5VA 4B9VA 4Z4GA 3RMDA 4CFDA 4FZZA 3IG1A 3HK2A 2OZMA 4CGGA 1ZBUA 2I5JA 1QSSA 1GOCA 3OS1A 3AO2A 1NK9A 1ITGA 3LZJA 3L2UA 1IH7A 1RT3A 5HRPA 4IFVA 3LZIA 4ELVA 3QERA 1SL1A 5K14A 4CJ3A 1B9FA 3M8RA 3F73A 4FK2A 4CJRA 3MEEA 4FJMA 3CM5A 4AH9A 3SYZA 3S3MA 4FK4A 3TABA 2FBXA 1QSYA 4BE0A 3KIOA 4IBNA 4KV8A 3NF9A 4YFUA 1U48A 1BGXT 1S6QA 2RF2A 1S5JA 4CESA 4M3WA 2GV9A 4KFBA 2Z1GA 4DLEA 4W5QA 2AJQA 1IKXA 1HNVA 3EY1A 3LANA 3V4IA 1RT2A 3QEXA 1LV5A 3OVNA 4UQGA 4IKFA 1WSGA 4KO0A 4EP5A 2X78A 4IG3A 4RW6A 4BACA 1NKCA 1FKPA 4Q0BA 4CJ5A 3U3YA 4J2AA 2JLEA 3DYAA 1RBVA 4BE2A 3LP2A 3P83D 3TAGA 3IAYA 2HHWA 5E41A 2HVHA 3HP9A 4E3SA 1RBSA 3NGZA 4F3OA 2E6LA 4M3ZA 3NH0A 3VQ4A 3OY9A 2X6SA 4CF2A 3C6TA 3LP1A 3TAQA 2KTQA 1A5XA 2XHBA 1BL3A 3ALYA 1BIUA 1J53A 1WSFA 4C8KA 4I9QA 1ZBHA 3NH1A 3MECA 4N56A 1B9DA 1C1CA 3C95A 4O0IA 4LY7A 5C42A 3TARA 2O4GA 1HRHA 1UAXA 3D0PA 1WAFA 3THVA 4RW4A 4CF9A 1ZBIA 1WAJA 1TV6A 4CF0A 4YNQA 1IKWA 2HB5A 3MAQA 5FROA 1XI1A 4FXDA 3HPGA 4CGIA 1U4BA 1KCFA 3K2PA 4CJFA 4I7FA 3OYAA 2PZSA 5HP1A 1A5WA 2RPIA 4DTJA 3CFPA 4BE1A 4DFKA 1R0AA 4JS5A 1J5OA 2P5GA 4FW1A 3IRXA 3OYCA 3AVCA 1VSHA 1TKXA 4Z0UA 4DU4A 2OYQA 1YVUA 2D5RA 1REVA 1C0MA 1DLOA 1VSMA 2ETJA 3SJJA 4RW7A 4H4OA 1XHZA 1C0TA 4F3TA 3BDPA 2IS3A 4DWIA 4LD0A 3DLGA 2XRIA 4FK0A 2YNFA 1KVBA 3ZSRA 4O44A 5CZ1A 3AVLA 3AVMA 4CGHA 4CHZA 3OS0A 3QNNA 1KTQA 2HHQA 3LP3A 4I2PA 5DK5A 3KLIA 4E7LA 4KHYA 2G8UA 2F96A 2IOCA 3ZSXA 3SQ1A 3VA0A 1L3TA 4FLYA 1SV5A 3OYEA 4CK1A 3L2RA 4Y1DA 3ITHA 4OGEA 3H08A 1NJWA 1GOAA 1BI4B 1LAWA 5KI6A 3RRGA 3ZSWA 4FLWA 3PY8A 3TAEA 4ICLA 4O5BA 1RT7A 4CHQA 3L3UA 3C6UA 3VQAA 3CFRA 3DLRA 4FJKA 2EX3A 3I0SA 1HNIA 4CK3A 3OYKA 3OYJA 1TL1A 1L5UA 1U47A 4FJ8A 3RTVA 3OYDA 3KK3A 2HNZA 4CHNA 1KLNA 4R5PA 4KRFA 1K6YA 3HVTA 3I0RA 4MFBA 5C25A 3TR8A 3NE6A 3K5MA 1BIZA 2YKNA 2HMIA 3SUNA 3DLEA 3ZT0A 4KAZA 2BGGA 1CZ9A 2ZE2A 4DF8A 1LW2A 1C1BA 4E1NA 2PYLA 3SQ0A 4OKKA 4I2QA 2E6MA 5JS2A 1XC9A 1RBUA 2QXFA 3P1GA 1S6PA 5J1EA 3T3FA 4FJLA 1VSDA 4J2EA 4B08A 5FRMA 3G0ZA 4FLXA 1QS4A 3B6OA 3TANA 4B3OA 3VQ7A 3AVFA 1X9SA 1TAUA 2DFEA 3NF6A 3ZSZA 2RN2A 4FVMA 1IKVA 5HRRA 1NKBA 4N76A 3HO1A 4DTSA 2VWKA 2YKMA 4QCLA 4E89A 4EZ9A 1WNSA 2OPSA 1QSLA 4J2BA 3ZCMA 4E0DA 3HJFA 4OGCA 1DTQA 1Z25A 4DU1A 4CJLA 3VQCA 3NF8A 1JKHA 4OJRA 3K5NA 4ZTJA 1B92A 4CHOA 2OPRA 4DQIA 4E7JA 1DTTA 5T7BA 1SUQA 3NGYA 3O3HA 3AO1A 2P5OA 4KB1A 3TI0A 2B4JA 4DS4A 1RTIA 1CZBA 4KTWA 3K59A 3LDSA 4DLGA 3JYTA 3MXMA 1HYZA 4FJIA 3HL8A 3LAMA 4DTNA 1UWBA 1TL3A 4CJSA 3HM9A 2XY7A 5I42A 3LWLA 1TKTA 1NK6A 2P51A 3AVNA 3M8QA 5SZTA 4M3XA 2WOMA 1J54A 2HW3A 1QTMA 2G8HA 1D5AA 1JL2A 1HPZA 1UA0A 3PO5A 2IGIA 4K8XA 3V1QA 3LWMA 4Z4FA 3AA3A 4HUEA 1N6QA 3TWHA 1QHTA 4DSIA 3AA2A 4AHTA 4PY5A 4CJ4A 3QETA 2DFHA 4I9LA 3L8BA 2Q3SA 1KFDA 3OJSA 2HVIA 1WSIA 1IG9A 3SNNA 4FM0A 4BDYA 2IDOA 2G8WA 4NCBA 3NBPA 1D9FA 1U49A 4EP4A 4CJKA 4HTUA 3SI6A 3IS9A 3LALA 1RDDA 3SUPA 2D0CA 4DTOA 3PX6A 3NFAA 4AILC 1KFSA 3MXJA 2YHBA 3K5OA 3DI6A 1NK7A 3SPYA 4CEFA 3CYMA 2OA8A 3FFIA 2P1JA 1HJRA 3AVKA 1Q9YA 2HNDA 3PUFA 3HSTB 4DS5A 1YT3A 1KRPA 5KGXA 5FRNA 4CHPA 4CJEA 2VG6A 4OLBA 1FKOA 3OYFA 3HXMA 4DU3A 1HMVA 5JS1A 4FLTA 2GUIA 4CJUA 4CJTA 4Q5VA 3V81A 1VRUA 1W9HA 1RT4A 2OPQA 2HHUA 1WSHA 4F8RA 4HUGA 3A2FA 3KKSA 4DFMA 1RCHA 5HBMA 3T19A 4CJVA 3WNFA 3QIOA 4B8CA 4CK2A 4DTRA 1X9WA 4CEQA 2RKIA 2KW4A 3V1OA 3V9SA 4KI6A 3WNEA 3RR7A 2ITGA 3K58A 3VN5A 1RNHA 4O55A 2DFFA 1JL1A 1EKEA 4CIEA 3L2QA 1YTAA 1LWCA 3AVIA 4DG1A 1EETA 1S1WA 3SUQA 3S3OA 3RWUA 4KHWA 2LSNA 3KTQA 4OKJA 2B5JA 4PA1A 5CY4A 5KRSA 3P5JA 4Z4HA 2QK9A 4CERA 3SQ4A 4DTUA 4FLUA 3U3GA 3KLEA 3AO4A 4NCGA 4CGJA 3RR8A 4Z4IA 2HHXA 2X74A 3ZSQA 5D3GA 3OYMA 4CJWA 3AO5A 4N47A 4FCYA 3RMCA 4ELUA 3K5LA 4DF4A 1L3SA 4GMJB 1F21A 1RBTA 3DRSA 4IG0A 3DLKA 3KK2A 5HRNA 4DSEA 4DTPA 3ZT2A 4LSLA 1TAQA 2F8SA 2KFZA 4KTZA 4RW9A 1TVRA 4B9TA 3SQ2A 3SV3A 1KVCA 3U6FA 3KLFA 4FJGA 1BQNA 2HHSA 4HUFA 1W0HA 1NK0A 1JLBA 5C24A 4FJHA 2Z1HA 1JLGA 1O1WA 1VSIA 4LH5A 1XHXA 1NJXA 1KSPA 4KI4A 1VK0A 3VQ9A 4DSKA 4CEEA 4KHUA 3OJUA 5DMRA 4B9NA 1ZBFA 4N41A 1EP4A 5SWMA 1S9GA 3SCXA 3ZT3A 4DQQA 1BCMA 3AVJA 1RT6A 3AVBA 3DRPA 3S9HA 1TK8A 4KB0A 2Y1IA 3OYBA 4HCCA 1SL0A 1LW0A 1C0UA 3NAEA 1NJYA 1QQCA 1XWLA 2YHAA 3QEIA 3LPTA 5HRSA 3SZ2A 4OVLA 1JXBA 3VA3A 1RT1A 3OYGA 3V9XA 3AVHA 5CYMA 3OS2A 3AVGA 2FBVA 1JLEA 4B9SA 1RDBA 3B6PA 1C6VA 1RT5A 2IC3A 1BISA 1Q8IA 3G10A 3WNHA 3VQDA 3KLHA 4E7HA 3QNOA 3DM2A 1D9DA 1LWFA 4GW6A 4B9MA 4JS4A 2G8IA 5EU7A 1NK8A 4M41A 1RTHA 3ULDA 3AO3A 3SV4A 2PY5A 1T05A 4FLZA 4IDKA 1I39A 3KK1A 4RW8A 2FBTA 4DQRA 1NK5A 4F2SA 3O4NA 1SKRA 4FYDA 2YNHA 3JSMA 4G1QA 3ZT1A 1MU2A 3DRRA 3TAPA 4DFPA 2FC0A 1VSKA 1JLQA 1KLMA 4C8NA 2BDPA 4C8OA 3HPHA 4CGDA 4FJ7A 2O4IA 1CXUA 2X6NA 5CYQA 4F2RA 4ELTA 4LSNA 5CZ2A 4DSLA 3RMAA 2B6AA 4CIFA 4HCBA 1J9AA 4CEZA 3AVAA 4M42A 2F8TA 4H4MA 4L8RB 4M3RA 4DQPA 3HVRA 4TSXA 2XO7A 3VQBA 2Z1JA 1S1UA 2HNYA 2QKKA 2XY8A 5HROA 2ATQA 2HHTA 1X1PA 4BWJA 3NHGA 4IFYA 4KKOA 3MEDA 1BCOA 3L2VA 3HT3A 4W5RA 3OYLA 3S3NA 3PX0A 3L2WA 5KRTA 1S1TA 1Q9XA 4KHSA 1VSEA 2HHVA 4CEOA 2KFNA 3NCIA 3I8DA 4CJQA 4DTMA 4KHQA 4ID5A 4OPJA 2QKBA 4O0JA 2G8FA 4CCHA 4ZTFA 4KTQA 1JLCA 3KD1E 1S9EA 4AHSA 1JXEA 3AA4A 4CHYA 4N5SA 1BQMA 3KLGA 4Y1CA 4KREA 3V9WA 2YNIA 4DTXA 2OZSA 1RDAA 4FJ9A 3QO9A 2KZZA 1EXQA 3DOKA 2D0AA 1NOZA 2D0BA 3SUOA 4JLHA 3LP0A 1VRTA 4CF1A 2VG5A 4O4GA 4K8ZA 4ID1A 1TGOA 4HHTA 2FBYA 3O3GA 1TK0A 3PO4A 2NUBA 4H8KA 1GOBA 4GVMA 2ZQBA 1HYSA 4BDZA 1NKEA 4M3TA 4FLVA 1RILA 3NH2A 5J2MA 4Z4EA 1ZBLA 4NYFA 4FZYA 4WE1A 4CE9A 4QOZB 2BE2A 3OYIA 3QEPA 3SPZA 2G8VA 1WN7A 3NDKA 1YTUA 4QAGA 1T8EA 1WSJA 2G8KA 3QLHA 4KPYA 5KGWA 4B9LA 4FZXC 3DMJA 3CG7A 1CLQA 3MEGA 3VQQA 2W42A 3CQ8A 4PWDA 3BGRA 3OYHA 4FM2A 4CEBA 4FJJA 3D45A 4ZHRA 3ZSVA 5J2NA 3NGIA 3VQPA 2A1SA 3VQ8A 4BWMA 3QEVA 1IKYA 2DY4A 1ZYQA 3NF7A 1T7PA 3CFOA 3PV8A 4FM1A 1NOYA 3QINA 1BI4A 4CIGA 1SKWA 3VQEA 2VWJA 4M45A 1CXQA 4B9UA 4AHVA 2DTUA 1FK9A 1ASUA 3M8SA 5KTQA 4RG8A 4E1MA 1T03A 1KVAA 1ASWA 4AHUA 3ASMA 1TKDA 4PQUA 2ZD1A 5I3UA 3QEWA 1C1AA 1FXXA 1JLAA 1EX4A 4DQSA 1IO2A 4C8MA 4FJXA 2BANA 3ZSYA 4DSFA 2PYJA 3O4QA 1NK4A 2IAJA 2JGUA 3KKRA 3V9ZA 4BDPA 3T1AA 1WSEA 1U04A 1N5YA 3PX4A 4DFJA 2YV0X 2WONA 4MQ3A 4CFCA 1U45A 4OLAA 4W5NA 3CM6A 4CEAA 3MXIA 4XIUA 1L3UA 3ZSOA 2OPPA 3KJVA 1S1XA 4CF8A 3E01A 4E7IA 1Y97A 5J2QA 2Z1IA 3HPOA 3LAKA 2KZMA 3DLBA 1SKSA 2EHGA 3QESA 4PUOA 3RRHA
chains in the Genus database with same CATH superfamily
2QWLA 1HYVA 2HF3A 1X9MA 2KQ2A 5FDLA 2E20A 3QIPA 1BA1A 4JI8K 3C94A 2NLXA 4BRGA 2VGMA 2E8AA 3UIQA 5I9EB 3KD5E 1WB9A 2WTUA 4W5OA 1Z26A 1E3MA 2NRZA 1JLFA 3DOLA 3AA5X 4GKKK 2GBZA 2ASOA 1D8YA 4E7KA 4OPKA 3CPWM 1T44A 3MN7A 1NJZA 3DLHA 3F9KA 4FJ5A 4FVUA 4FO0A 4FPBA 4LH4A 1TK5A 2A1RA 2Q36A 4B9VA 3HK2A 3IG1A 1LOTB 1GOCA 3OS1A 1NK9A 4GV9A 3DXKB 3R1XA 4IFVA 4MDBA 3LZIA 1SL1A 3MEEA 2WFBA 3CM5A 1N8RO 4BQLA 2YHYA 5B8HA 4Y0WA 1VQNN 1U48A 1QHAA 1S6QA 4KFBA 4A57A 2AJQA 4C23A 1IKXA 1ATNA 3OVNA 4WFAL 4IG3A 4RW6A 1NGAA 4Q0BA 3C0BA 1IG8A 2JLEA 5F1XA 3LP2A 3GOIA 3P83D 5KQDA 2HHWA 1QQNA 3NGZA 3SMSA 3VQ4A 4CF2A 3C6TA 3TAQA 2KTQA 1J53A 3TSUA 1C1CA 4B3RK 4H5NA 3SBGA 4LY7A 1WAFA 5AQIA 1WAJA 1U2VA 1IKWA 3QFUA 1S3XA 3AAQA 3FZHA 2QWOA 3WEEB 3W3DA 4B1VA 3CCRN 3CPEA 2QWRA 3U4LA 3AVCA 3O8MA 1VSHA 1TKXA 1DLOA 2Q1NA 4H4OA 1XMQK 1C0TA 4F3TA 3E66A 4CJ7A 1NBWA 3O4WA 3J8AA 3BDPA 4FK0A 3CCSN 3H3OB 1VQKN 3AVMA 3OS0A 2PFUA 1QVFM 5DK5A 3CCUN 3PSFA 3BZKA 3LDQA 2IOCA 3SQ1A 1RFQA 1SV5A 4M7XA 4IEIA 4OGEA 5KI6A 4JKHA 3ZSWA 1GLAG 4FWLA 4JI5K 4A2BA 3C6UA 1K8KB 1QZ5A 2QM1A 4CK3A 3C65A 1L5UA 1U47A 4R5PA 4BREA 3I0RA 3IDHA 4B9NA 4IKFA 1BIZA 1YXQA 4DF8A 3GBTA 1X3MA 3BF3A 5JS2A 1RBUA 3P1GA 1S6PA 3M6GA 1MWKA 4E1JA 4J2EA 4B08A 1QS4A 4IFEA 5AQQA 3VQ7A 3AVFA 1X9SA 3DJCA 3NF6A 3HO1A 5AZIA 1QVGM 4QCLA 5AQZA 3UE5A 4E89A 4EZ9A 3Q7BA 1WNSA 1QSLA 3ZCMA 3VQCA 1JKHA 4ZTJA 1B92A 2QI2A 2EWSA 2P5OA 4U7BA 1VQ5N 1KAXA 5FPNA 2B4JA 1RTIA 1CZBA 4KTWA 3VGMA 4AM6A 3K59A 3JYTA 4DTNA 4CJSA 1Q86O 5I42A 4YOUA 3LWLA 1TKTA 3TTFA 5SZTA 1C0GA 1D5AA 1UA0A 3LWMA 3AA3A 3TWHA 1QHTA 4CJ4A 3THXA 4M7YA 2DFHA 4DR3K 2GX9A 1GLLO 1WSIA 4X64K 3U9ZA 3BUZB 1U49A 5HL7L 3SI6A 1RDDA 2D0CA 4DTOA 1YJ9N 3FGUA 4DR6K 4RTFD 1VQ4N 2P9SB 1Q9YA 2HNDA 3PUFA 1KRPA 4JI3K 5FRNA 1FKOA 3HXMA 4K0KK 1Y64A 1MDUB 5EXWA 2GUIA 4CJTA 4CZIA 1RT4A 2A40A 3CC4N 3QFPA 4B1UB 4XH1A 3WNFA 4DTRA 1XNQK 2P9IB 1DGKN 3V1OA 4DV4K 4KI6A 3WNEA 4BC5A 3RWUA 4DG1A 1S1WA 2LSNA 2QWQA 5CY4A 1P8ZA 3MX2A 3U3GA 3BZCA 2E2OA 3LM2A 4CGJA 3RR8A 4Z4IA 2HHXA 4CZGA 4ELUA 1BG3A 3HBTA 4GMJB 1RBTA 1WBBA 3UKRA 1GLEG 2W41A 2F8SA 2HBJA 3CQXA 3ZX0A 2QA4N 4RW9A 3HOTA 2E2PA 3SQ2A 1K73O 5GIPA 1JLBA 5C24A 4DV6K 2Z1HA 1VSIA 1XHXA 4DSKA 4CEEA 4YOXA 4KHUA 1EP4A 4BRPA 3ZT3A 3S9HA 4LF6K 1RT6A 4KB0A 1ILYA 3NAEA 1C0UA 1QQCA 1XWLA 3H6EA 3DLLL 1JXBA 3AVHA 1BISA 1Q8IA 1ZBSA 4MO4A 4NXMK 3BEXA 2GUPA 3VTHA 1QZ6A 5LJWA 4JKEA 3DM2A 4B9MA 4EHUA 5KPTA 4JS4A 2E5LK 2WUSA 5LY3A 1I39A 3KK1A 4F2SA 1YF5L 2FBTA 1MU2A 4AQYK 4DFPA 2E2NA 4FJ7A 2X6NA 4F2RA 3KWGA 2ASPA 3UB5A 3CC7N 3PSIA 5JLHA 4HCBA 1T6DA 5BPMA 4M3RA 3VMFB 5JVGL 3MCAB 2Z1JA 2QKKA 2XY8A 3ID6A 2PAVA 4KKOA 3MEDA 3GDQA 2VQEK 3P39A 3PX0A 4NO7A 3L2WA 1YI2N 3P4IA 4JK9A 1Q9XA 5M1PA 4DTMA 4KHQA 2QKBA 1GLJO 4CCHA 3E1YA 4JI6K 2ASMA 3D7EO 1JLCA 3ZETB 1S9EA 1JXEA 4CHYA 4N5SA 1RDWX 4IEEA 4B3SK 1DKGD 4QS8A 5F2RA 5AQRA 3DOKA 2QWMA 1FJGK 2VG5A 1TGOA 4JI4K 4HHTA 4BG9A 3WEEA 1TK0A 4BDZA 4M3TA 4FLVA 3EL2A 5J2MA 4Z4EA 3TU5A 3WXKA 4FZYA 1HKGA 1J5EK 3SPZA 1QQOA 1WN7A 3NDKA 1YTUA 4BRAA 1T8EA 2UXBK 4KPYA 3DMJA 3CG7A 3MEGA 3CMAN 4CEBA 3HI0A 5J2NA 5CHIA 1QQMA 3VQPA 3VQ8A 2DY4A 3PV8A 3QINA 4B9UA 4M45A 4AHVA 4FWRA 3ZYYX 4C1NK 4AHUA 2FF6A 4IZ9A 4PQUA 1IV0A 3T1YK 1U2VB 4B1ZA 1BU6O 1IO2A 2D1KA 4C8MA 2BANA 4DSFA 3LDLA 4K42A 5C2FA 2NRTA 5AQGA 2HBMA 3H46O 2WONA 4A62A 1L3UA 3ZSOA 2HF4A 4GVEA 3VEVA 3EE9A 4PUOA 4YOVA 4CEDA 3CI5A 1HQUA 4A61A 4CZMA 4DHYA 4FW2A 1UOCA 4FWQA 3VOVA 1HPMA 2E4LA 3OYNA 4CBWA 3RMBA 3V1RA 3ZT4A 4HVJA 3TAMA 1HUXA 2XY6A 4JRPA 2BTFA 5MLCQ 3HYFA 5ELZA 4BR2A 3AV9A 4NYNA 4H03B 4AHCA 4CECA 4E19A 1XMOK 1LWEA 4JKDA 4CJPA 1TKZA 2YNGA 1BHLA 1L3VA 1G15A 3V9UA 3VESA 1S1VA 5AQJA 2R7YA 4YOYA 3EE8A 3VQ5A 1A5VA 3RMDA 2YCHA 5AZIB 2JWKA 1FW6A 4BVOA 4HWIA 1W97L 1YITN 4LF8K 4CBXA 4WF9L 1NMNA 2IVNA 4J8FA 3M8RA 1B9FA 3HOSA 3F73A 2P9SA 1S22A 4Z94A 4FK4A 3CJ7A 2V7ZA 5AQUA 5AJ3K 4X62K 1QSYA 4KH5A 3CCVN 2YHWA 2HBLA 4FWSA 4M3WA 2RF2A 5AQFA 4CESA 2GV9A 2O8CA 5AQMA 2HMPA 3G6EN 3V4IA 4UQGA 4IOAL 3BP8A 5GIOA 2X78A 4A5AA 2IIRA 3U3YA 2A41A 2P9IA 1ATSA 3DYAA 3IAYA 3SAGA 3TTCA 1NU0A 3MDQA 3EN9A 1RBSA 5JLFA 1WUAA 3HTVA 3RVCA 2V51B 3NH0A 4JK8A 1A5XA 1XNRK 3IKMA 2XHBA 1BL3A 1BIUA 3VGKA 1WSFA 4C8KA 4CZLA 4I9QA 1ZBHA 3NH1A 3PIPL 3C95A 5C42A 3ZLJA 1UAXA 1VAZA 1ZBIA 1NGCA 5BPNA 4YNQA 3HPGA 1K8AO 3OYAA 4I7FA 4CD1A 4FW1A 1OH7A 4DR1K 1YVUA 4FWKA 3THYA 3CJCA 2IS3A 3ENHA 4EFHA 2XRIA 3SAHA 2YNFA 4L3QA 4JEPA 1YJNN 4NLBA 3LP3A 4I2PA 4KHYA 3KLIA 5A2QO 2G8UA 1R59O 4BRLA 4FLYA 3K9KA 3L2RA 1GOAA 1BI4B 3KZBA 4FLWA 5GAEP 3T69A 4V19S 5GADP 3CFRA 3UKRB 2A42A 2GWJA 1HNIA 1W2BM 1TL1A 3RTVA 3OYDA 3PIOL 4CZKA 3KK3A 1VQ6N 1KLNA 4KRFA 3VEYA 2E2QA 4MFBA 3K5MA 3ZX3A 4WCEL 5TKYA 1XC9A 1V4SA 3T3FA 4B3OA 2ZM6K 5M1OA 3OHRA 3K9JA 4HTLA 2RN2A 1S72N 1ZXOA 2VWKA 2YKMA 3KVGA 4J2BA 4E0DA 1NJIO 4OGCA 1DTQA 3LL3A 4DU1A 3NF8A 2I7PA 3HSCA 5T7BA 1SUQA 5AFUH 3AO1A 3H3NO 4BROA 3E9LA 2E88A 3TI0A 4DS4A 1OH5A 3LDSA 1JCGA 3K0SA 1HYZA 4FJIA 3ZETA 3LAMA 4H5RA 5C12A 4PL7A 3HM9A 3L0QA 5BRHA 1NK6A 3AVNA 4FSVA 2HW3A 4X66K 3F2KA 1J54A 4JV5K 1JL2A 1HPZA 2O8EA 4HUEA 4AHTA 4I9LA 5EY4A 3L8BA 2Q3SA 3OJSA 3TPQA 5BN8A 2UXCK 4WQ4A 3O9TA 1D9FA 4EP4A 3LALA 5BRDA 4EHTA 2Q97A 2YHBA 5AQWA 1VQMN 4DQ8A 4CEFA 1I94K 2P1JA 3AVKA 3HSTB 2VG6A 3EZWA 3OYFA 5JS1A 1HMVA 4RCHA 4FLTA 1HLUA 3VENA 2J4RA 4WYBA 2OCEA 2ZF5O 3OBWA 1RCHA 5HBMA 4CK2A 4B8CA 1SQKA 4CEQA 3CJBA 3V9SA 3RR7A 4GV6A 1RNHA 1M1KO 4CZFA 1EKEA 3L2QA 1LWCA 3S3OA 3SUQA 1EETA 4H0OA 4BRKA 1SZ2A 5AQOA 2D4WA 2FXUA 3ZSQA 2AA4A 3OYMA 3RMCA 3AAPA 4DF4A 1HX1A 1VQON 3DLKA 4ISFA 4LSLA 3ATUA 3CQYA 2KFZA 1OH6A 4JKBA 2E1ZA 3MWPA 3SV3A 1KVCA 1BQNA 1HKCA 4FJHA 4BGBA 1JLGA 1NJXA 1KSPA 5AQSA 1VK0A 4A5BA 1ZBFA 4N41A 5SWMA 5EOYA 3AVBA 3DRPA 3CC2N 4HCCA 2ZJRL 4JI2K 1SL0A 5AQKA 1LW0A 1X3NA 3O80A 1NJYA 4WFNL 3QEIA 1VQ8N 3SZ2A 1G99A 3HZ6A 3OTOK 4OVLA 3TTDA 3CIPA 3QBWA 3VA3A 5CYMA 1RDBA 3WNHA 3VQDA 5C2DA 3KLHA 4BC3A 4IOCL 2G8IA 4EIAA 4M41A 1M90O 2V52B 2O8FB 3SV4A 2PY5A 4FLZA 4IDKA 1HJOA 1SKRA 4B9QA 4G1QA 3TAPA 3JAMO 3CD6N 5FPDA 4KHPK 1LCUA 2O4IA 3VTIA 5CZ2A 4DSLA 2Q0UA 4CIFA 1JCEA 4CEZA 3AVAA 2F8TA 4L8RB 3WQTA 4TSXA 3VQBA 2HNYA 1NLVA 5HROA 2ATQA 4GNIA 2HHTA 4BWJA 2UUAK 3VEZA 1IBMK 1BWFO 1BCOA 4H0TB 3DXMA 4KHSA 5KRTA 1S1TA 4B1XB 2HHVA 4I6MB 3H1VX 3I8DA 4CJQA 4O0JA 2G8FA 4ZTFA 4PKGA 4QS9A 4MO5A 4MDAA 4Y1CA 2OZSA 2O8DA 2YX6A 3QO9A 3D2FA 4LF7K 1NGEA 1YAGA 2D0AA 1NOZA 5AZJA 1EQYA 3SUOA 1BOTO 2Q31A 3LP0A 3TSQA 1VRTA 2JWLA 2O8CB 1BA0A 2RHKA 3O9SA 1J6ZA 3PO4A 4H8KA 1GOBA 1NKEA 2HSTA 2OTLN 4JN4A 3NH2A 3AGRA 4NYFA 3P38A 3CCEN 3J7YP 4QAGA 1WSJA 2G8KA 4FZXC 5FLXO 3CQ8A 4PWDA 5HOOA 4FM2A 3D45A 4ZHRA 2A1SA 5JVHL 2WBNA 3R3LA 3NF7A 1EWQA 3CFOA 4FM1A 1NOYA 4JK7A 1BI4A 1SKWA 3VQEA 3CCJN 2DTUA 3M8SA 4RG8A 3L4IA 4WQ4C 1TKDA 4IJAA 1HNWK 3QEWA 1N34K 1FXXA 2V7YA 1JLAA 2NRRA 1NK4A 3O9QA 2JGUA 5GINA 4JI0K 3PX4A 4DFJA 4BR4A 3MXIA 4XIUA 3KJVA 1S1XA 4BRIA 3THYB 4E7IA 4BRDA 3HPOA 3LAKA 2EHGA 4BRHA 4CZEA 4GY2B 3WNGA 3UKUA 2XY5A 4JHDA 2NRVA 5KPRA 3O3FA 4CFBA 3LPUA 4FJNA 4JRQA 4FOIA 3LDNA 3K57A 3EO3A 5C10A 4NCAA 2W40A 3CJ9A 4AM7A 2WC9A 5HLFA 3TAFA 1WLJA 3M8PA 3CJAA 2CGKA 2UXDK 5JMVA 4J2DA 4M3YA 3ISNC 1MWMA 3ZEUB 4W5TA 3FZKA 3HP6A 3L3VA 4EZ6A 3VF2A 3EYZA 4Z4CA 1SL2A 2KHOA 3CCQN 1RTDA 1OVQA 4EAHD 3V6DA 4CFDA 4FZZA 1TUYA 1ZBUA 2I5JA 3G25A 1QSSA 4LF4K 3LZJA 1IH7A 1RT3A 5HRPA 4ELVA 3N4QA 2Q2RA 5K14A 4CJ3A 3RSEB 3VETA 4CJRA 5AQXA 4FJMA 3SYZA 3MN5A 4O5FA 4K43A 2FLOA 4KV8A 1BGXT 1S5JA 1OVYA 1Z6RA 4DLEA 1HNVA 3D2EA 3LANA 1RT2A 5ADXH 3QEXA 1LV5A 2AP1A 2CGJA 1WSGA 2O8EB 4KO0A 4EP5A 4MLEA 1H1VA 3DAWA 4OPAA 4BACA 1FKPA 3CJ1A 5AQPA 3CXCM 4BE2A 1RBVA 3OW2M 3OA9A 4E3SA 1YHQN 3KHYA 4F3OA 4M3ZA 4IJNA 3W0LA 4LF5K 1NWKA 3WXIA 3GE1A 1U6ZA 4FPAA 3MX5A 3QMLA 3MECA 4N56A 1B9DA 3C7NB 3O6WA 3CCLN 3TARA 2O4GA 3SK3A 4O8KA 4CF9A 3VERA 4CF0A 3R6MA 3MAQA 5FROA 4CGIA 1U4BA 4CJFA 4IWVA 5HP1A 4DTJA 4BE1A 3OYCA 1V4TA 4DUYK 1CZAN 2OYQA 2D5RA 2ETJA 3NVMA 1C0MA 1VSMA 3SJJA 1XHZA 5AQNA 4DWIA 3DLGA 4GKJK 1KVBA 3ZSRA 5CZ1A 3AVLA 4CD3A 4NLCA 2P9LA 1KTQA 4E7LA 3ENBA 1NMDA 4IO8A 3VA0A 1L3TA 3OYEA 4CK1A 4C8LA 4Y1DA 3RRGA 3H08A 4U67L 5M1KA 3PY8A 1RT7A 5C15A 3L3UA 3VQAA 2EX3A 3O9RA 2O8FA 2F9TA 1VQPN 2HNZA 4CHNA 4PKHA 3WUHA 3TR8A 2BGGA 3ZT0A 4BC2A 1CZ9A 3HRGA 1LW2A 4E1NA 3SQ0A 3L6QA 4I2QA 2E6MA 3I8BA 2QXFA 4CBUA 3SMPA 2PBDA 4JKFA 3TSPA 4FLXA 3MWTA 4JD2A 1TAUA 2DFEA 3U8XA 3O1WA 4FVMA 1GLCG 1IKVA 5HRRA 1NKBA 4N76A 4DTSA 3FE1A 1O13A 2OPSA 3HJFA 2D0PA 4H5WA 4CHOA 2OPRA 3QB0A 4KB1A 3O3HA 4I6MA 3ULEB 2QWPA 1RGIA 1NGJA 4H5VA 5BN9A 3CCMN 2QW9A 3VGLA 1ESVA 4B3MK 1UWBA 1TL3A 2XY7A 4F9OA 4DB3A 2A5XA 3M8QA 2WOMA 1QTMA 2G8HA 3PO5A 4K8XA 2IGIA 3V1QA 4Z4FA 1N6QA 1NM1A 5AFUA 4DSIA 4G9ZA 1YIJN 1KFDA 4DR7K 3AY9A 2HVIA 4CZJA 3SNNA 1TYQA 4FWMA 3VF4A 4FM0A 1OH8A 4KBOA 4RWTA 3SUPA 5TKWA 3PX6A 3NFAA 2HHHK 4JKCA 4AILC 5AQTA 5AQVA 1KFSA 3K5OA 2NRHA 2P9NB 5DM7L 3DXMB 3FFIA 3IMXA 1YT3A 4CHPA 4OLBA 2FSJA 4AF1A 4DKWA 4B1WB 5M1NA 1VRUA 2O8DB 2OPQA 2HHUA 1WSHA 3D2FB 4F8RA 3CMEN 3A2FA 5AZJB 1OKJA 4CJVA 1GLBG 1T6CA 2RKIA 3VEXA 3VN5A 4O55A 4A2AA 2DFFA 4FWPA 1E4GT 1YTAA 1HNZK 3KTQA 4OKJA 2B5JA 4PA1A 3P5JA 4Z4HA 3BY5A 1NGGA 4C1NI 3AO4A 2X74A 3FLCO 5D3GA 4CJWA 4N47A 4FCYA 3M5RA 1EWRA 2I7NA 3KK2A 5HRNA 3M3ZA 3ZT2A 1ATRA 4H0YB 4KTZA 1XQSC 4BRFA 1TVRA 5BR8K 3U6FA 4ILJA 4FJGA 2HHSA 4QS7A 4HUFA 2RE2A 1NK0A 3ID8A 1O1WA 4LH5A 5FPEA 4KI4A 2ZWHA 3VQ9A 1YVNA 5DMRA 1P90A 3MN6A 3ZEUA 3A5OC 1S9GA 4FWNA 4DQQA 1BCMA 3CETA 3I55N 3CF5L 2H3GX 1HNXK 1NG9A 5HRSA 3A8YA 5LMUK 1RT1A 3OYGA 4B9SA 3AVGA 2FBVA 2P9PB 2IC3A 1NGIA 2GWKA 3UKUB 3A5MC 4JHDB 1ZC6A 4GW6A 1HR0K 5EU7A 3ULDA 3DWLA 1N33K 4DQRA 4RW8A 3RSEA 3A0IX 5EX5A 5GAGP 4BY9C 2YNHA 3ZT1A 3DRRA 5LJVA 3QBXA 2FC0A 1JLQA 4C8OA 4H0XB 2ITMA 3HPHA 1Q18A 1CXUA 5CYQA 4LSNA 3EKSA 2B6AA 3CERA 1J9AA 4M42A 3CHWA 1X1PA 3NHGA 5JICA 4IFYA 3WXLA 3L2VA 4KH6A 5E84A 4W5RA 3OYLA 1VSEA 2KFNA 3NCIA 4ID5A 4OPJA 2P9UB 4KTQA 3BF1A 4YOTA 3KD1E 4AHSA 3C7NA 3KLGA 4KREA 1RDAA 4YOWA 2OANA 1E4FT 5KQ8A 4IDHA 3R8EA 1K9MO 4WFBL 4O4GA 4K8ZA 2CH5A 4ID1A 4XEIA 2FBYA 3D2EB 3O3GA 4H0PA 4WQ5A 4GVMA 2ZQBA 1RILA 3N4PA 5FPMA 4CE9A 3OYIA 1W7AA 3T1HK 1Q7YO 5KGWA 3NVKA 3G71N 4YHHK 3BGRA 5AQLA 4FJJA 1T3VA 3ZSVA 2GTDA 3GG4A 3QEVA 3D6RA 2YHXA 4OO1J 2ZGYA 4B1YB 2W6LA 1GLFO 1FK9A 1ASUA 5KTQA 3SJHA 4E1MA 1T03A 1KVAA 1ASWA 3LDPA 4JNEA 3ASMA 4XH5A 3G4SN 4JKGB 5E26A 4PKIA 1C1AA 3LM9A 4B3TK 1EX4A 4FJXA 3AGKA 3SLCA 3ZSYA 2PYJA 2IAJA 2YJEA 4BDPA 1U04A 4BRQA 1C0FA 5KPZA 2E1YA 4CF8A 1Y97A 5J2QA 2VGNA 4YDUC 2KZMA 3DLBA 3MK6A 4BR0A 5AQYA 2P9LB 1I3AA 4H5TA 2CH6A 3EZ5A 4BQZA 1VSFA 1VSJA 4DSJA 4CFAA 1VSLA 1HQEA 4OKEA 1RDCA 4OPHA 1NGDA 4BRMA 4B8AB 4M3UA 3ULEA 1RTJA 4DMNA 5J2PA 2FSNA 4ISEA 4CVNE 4CZHA 3J81O 1ASVA 2Y1JA 2O8BB 1RBRA 1KC8O 4KHNA 5AQHA 4AHRA 1LAVA 1QE1A 3VQ6A 1UA1A 4CGFA 1N32K 1BO5O 1KQSM 2VG7A 4F4KA 4Z4GA 4JD2B 1IJJA 2OZMA 2A3ZA 2Q0RA 5IT9O 2VWBA 4CGGA 2W6KA 1KD1O 1IBKK 3AO2A 1YUWA 2VQFK 4DR2K 1ITGA 3L2UA 4BR5A 4O8UA 2ZGZA 4DV0K 3QERA 4FK2A 2P9NA 4AH9A 3S3MA 3TABA 2FBXA 3ENOA 4OX9K 4BE0A 1HKBA 5GAHP 3KIOA 4IBNA 4YFUA 3NF9A 1JCFA 2Z1GA 2NRWA 4W5QA 4GV3A 3EY1A 3A5NC 1SAZA 3FZMA 1Q81O 1X9JA 3FZLA 1NKCA 4CJ5A 4DV1K 4J2AA 3TAGA 4PL8A 3OBYA 2BH1A 5M1FA 5E41A 2HVHA 3HP9A 2FSKA 2F4VK 4FWOA 2QEXN 1TYQB 2NZTA 1NGFA 5ADXA 2E6LA 3MN9A 3OY9A 2X6SA 3LP1A 4LC9B 3ALYA 4K41A 4DCHA 5BREA 2F7TA 4ILHA 4MLHA 3ZX2A 4DR4K 2UYTA 2P9KA 3VEWA 3Q7CA 4O0IA 4JI7K 1HRHA 3D0PA 3THVA 4RW4A 3B8AX 1TV6A 5LMNK 2HB5A 2QWNA 1XI1A 3J7AP 4FXDA 4DUZK 1KCFA 3K2PA 2PZSA 1A5WA 2RPIA 3CFPA 4DFKA 1J5OA 1R0AA 4JS5A 1VQLN 2P5GA 3IRXA 4IO9L 3T7ZA 4Z0UA 4DU4A 1REVA 4KH4A 4RW7A 4K25A 2QTDA 4LD0A 3THWB 4O44A 4CGHA 4CHZA 3QNNA 2HHQA 3H1QA 2F96A 3ZSXA 3FZFA 3VF6A 3F5TA 4YY3K 1XC3A 2P9PA 3U9DA 3M1FA 3C6AA 3ITHA 4WQ5C 1NJWA 1LAWA 3GL1A 3TAEA 4ICLA 3WXJA 4O5BA 4CHQA 2D0OA 4FJKA 3DLRA 1VHXA 5DM6L 1WBDA 3I0SA 3OYKA 3OYJA 4FJ8A 3HM8A 1K6YA 3HVTA 4JAXA 5C25A 4DV7K 3NE6A 2YKNA 2HMIA 3SUNA 3DLEA 4KAZA 4LFBK 2ZE2A 1C1BA 2PYLA 4M63C 4OKKA 1DEJA 5J1EA 4FJLA 5AR0A 1VSDA 5FRMA 3G0ZA 3B6OA 3TANA 4LFAK 4BR9A 3E9OA 3ZSZA 5CE3A 4R79A 4LFCK 2UUCK 4BGAA 1IBLK 2VYPA 3O08A 3DXKA 2CGLA 1Z25A 4CJLA 4OJRA 3K5NA 4DQIA 3KK7A 4E7JA 1DTTA 3NGYA 3S41A 1VQ9N 2P9UA 4DLGA 4BRCA 1WOQA 3MXMA 3EEQA 3HL8A 4X65K 4BC4A 2P51A 4M3XA 3IUCA 2GEMA 4PY5A 3AA2A 3QETA 2VCPA 5M1QA 3MMVA 1NNEA 1IG9A 4PHTX 4BDYA 2IDOA 2G8WA 4NCBA 3NBPA 4XH4A 4NB4A 4CJKA 4HTUA 3IS9A 1JJ2M 4FOEA 3R9PA 4NXNK 3MXJA 3DI6A 1NK7A 3SPYA 3CYMA 2OA8A 3PLAA 1HJRA 4DS5A 2OTJN 5KGXA 3VPZA 4CJEA 4DU3A 4CJUA 4Q5VA 3F9MA 3V81A 1W9HA 4YORA 4JKGA 4HUGA 5LL6Z 3WXMB 3KKSA 4DFMA 3O1BA 3T19A 3QIOA 2YI1A 1X9WA 2DPNA 2KW4A 4JI1K 2UU9K 2ITGA 3K58A 1D4XA 4BVPA 1EO1A 1JL1A 4CIEA 3AVIA 3FR0A 4KHWA 1RDUA 3SBTA 2ZJPL 5KRSA 2GELA 5CR4A 2QK9A 4CERA 3SQ4A 4DTUA 4FLUA 3KLEA 4NCGA 5H1SQ 5IWAK 2F9WA 3WT0A 3AO5A 1DT9A 5BRFA 3K5LA 1L3SA 3LDOA 3QICA 1F21A 3DRSA 1K8KA 3FFKB 4IG0A 4DSEA 4DTPA 1TAQA 2YJFA 4B9TA 1GLDG 2QXLA 3KLFA 1W0HA 1YJWN 3AARA 1KAYA 3OJUA 2O8BA 3SCXA 3J7ZO 3AVJA 1TK8A 1Q82O 1VQ7N 2Y1IA 3OYBA 3VEOA 4LF9K 2IVOA 2YHAA 5C0YA 3LPTA 5BR9A 3V9XA 4DR5K 5BPLA 3OS2A 2KKZA 1JLEA 3B6PA 1C6VA 1RT5A 2NRXA 3G10A 3L4QA 1N36K 4E7HA 3QNOA 1D9DA 1LWFA 3EKUA 1NK8A 1RTHA 3AO3A 1NGBA 2UUBK 1T05A 1NK5A 3I56N 3ATVA 3O4NA 4FYDA 3JSMA 4DV2K 4IXCA 3JS6A 1VSKA 1KLMA 4C8NA 2BDPA 4CGDA 1KXPA 4ELTA 3RMAA 1SS6A 4BR7A 4H4MA 1MA9B 2NNWA 4DQPA 5F0XA 3HVRA 2XO7A 1TUUA 1S1UA 4JKAA 3JXUA 3O5BA 3HT3A 2KLAA 3S3NA 2IVPA 4CEOA 4JYAK 1XUPO 3QDKA 4CI6A 2HBKA 3AA4A 1BQMA 3A5LC 3V9WA 2YNIA 3H45C 4DTXA 4FJ9A 2KZZA 1EXQA 2D0BA 4JLHA 3I33A 4CF1A 4YDUA 2BUPA 3THXB 2NUBA 1BUPA 4ILGB 1Z05A 1HYSA 3C6HA 4CW7B 3SAFA 4ISGA 3E9PA 1ZBLA 4QOZB 4WE1A 2BE2A 2G8VA 4IOXA 3QEPA 3KWIA 3QLHA 2HOEA 4B9LA 5EVZA 1NGHA 1BDGA 3VQQA 2W42A 3THWA 1CLQA 3NMUA 3OYHA 1KAZA 4H0VB 2ZJQL 3MCPA 4DV5K 3NGIA 4BWMA 1IKYA 1ZYQA 1T7PA 3J80O 4CIGA 2VWJA 4DV3K 1CXQA 2P9KB 2A6AA 4UY8O 4FL9A 2ZD1A 5I3UA 4BRNA 4BG8A 3O9UA 4DQSA 4A59A 2FF3B 3O4QA 3KKRA 3V9ZA 3T1AA 1WSEA 1N5YA 3P31A 2YV0X 4MQ3A 1U45A 4CFCA 4OLAA 4W5NA 3CM6A 4CEAA 2OPPA 3WQUA 3E01A 2Z1IA 1SKSA 3QESA 3IFRA 3RRHA
chains in the Genus database with same CATH topology
3WNGA 4CEDA 1HYVA 2XY5A 1HQUA 1X9MA 1I3AA 2KQ2A 5FDLA 3EZ5A 3QIPA 1VSFA 4FW2A 3C94A 1UOCA 3O3FA 1VSJA 4CFBA 3LPUA 4FJNA 4JRQA 2E4LA 4DSJA 3K57A 3UIQA 4NCAA 4CFAA 1VSLA 1HQEA 3OYNA 3KD5E 3RMBA 3V1RA 5HLFA 4OKEA 1RDCA 3TAFA 4C8LA 3ZT4A 1WLJA 3M8PA 3TAMA 4HVJA 4B8AB 4M3UA 2XY6A 4W5OA 1Z26A 1RTJA 4JRPA 4DMNA 5J2PA 4J2DA 4M3YA 3HYFA 1JLFA 3DOLA 1ASVA 3AA5X 3ISNC 2Y1JA 1RBRA 4W5TA 2GBZA 3HP6A 3AV9A 3L3VA 4NYNA 4KHNA 1D8YA 4AHRA 4E7KA 4AHCA 4CECA 4E19A 1LAVA 4OPKA 4EZ6A 3EYZA 4Z4CA 1LWEA 4CJPA 1NJZA 3DLHA 1TKZA 2YNGA 1QE1A 3VQ6A 3F9KA 1BHLA 1UA1A 4CGFA 1SL2A 4FJ5A 1L3VA 1G15A 3V9UA 4LH4A 1TK5A 2A1RA 1RTDA 1S1VA 2VG7A 3V6DA 2R7YA 3VQ5A 4F4KA 1A5VA 4B9VA 4Z4GA 3RMDA 4CFDA 4FZZA 3IG1A 3HK2A 2OZMA 4CGGA 1ZBUA 2I5JA 1QSSA 1GOCA 3OS1A 3AO2A 1NK9A 1ITGA 3LZJA 3L2UA 1IH7A 1RT3A 5HRPA 4IFVA 3LZIA 4ELVA 3QERA 1SL1A 5K14A 4CJ3A 1B9FA 3M8RA 3F73A 4FK2A 4CJRA 3MEEA 4FJMA 3CM5A 4AH9A 3SYZA 3S3MA 4FK4A 3TABA 2FBXA 1QSYA 4BE0A 3KIOA 4IBNA 4KV8A 3NF9A 4YFUA 1U48A 1BGXT 1S6QA 2RF2A 1S5JA 4CESA 4M3WA 2GV9A 4KFBA 2Z1GA 4DLEA 4W5QA 2AJQA 1IKXA 1HNVA 3EY1A 3LANA 3V4IA 1RT2A 3QEXA 1LV5A 3OVNA 4UQGA 4IKFA 1WSGA 4KO0A 4EP5A 2X78A 4IG3A 4RW6A 4BACA 1NKCA 1FKPA 4Q0BA 4CJ5A 3U3YA 4J2AA 2JLEA 3DYAA 1RBVA 4BE2A 3LP2A 3P83D 3TAGA 3IAYA 2HHWA 5E41A 2HVHA 3HP9A 4E3SA 1RBSA 3NGZA 4F3OA 2E6LA 4M3ZA 3NH0A 3VQ4A 3OY9A 2X6SA 4CF2A 3C6TA 3LP1A 3TAQA 2KTQA 1A5XA 2XHBA 1BL3A 3ALYA 1BIUA 1J53A 1WSFA 4C8KA 4I9QA 1ZBHA 3NH1A 3MECA 4N56A 1B9DA 1C1CA 3C95A 4O0IA 4LY7A 5C42A 3TARA 2O4GA 1HRHA 1UAXA 3D0PA 1WAFA 3THVA 4RW4A 4CF9A 1ZBIA 1WAJA 1TV6A 4CF0A 4YNQA 1IKWA 2HB5A 3MAQA 5FROA 1XI1A 4FXDA 3HPGA 4CGIA 1U4BA 1KCFA 3K2PA 4CJFA 4I7FA 3OYAA 2PZSA 5HP1A 1A5WA 2RPIA 4DTJA 3CFPA 4BE1A 4DFKA 1R0AA 4JS5A 1J5OA 2P5GA 4FW1A 3IRXA 3OYCA 3AVCA 1VSHA 1TKXA 4Z0UA 4DU4A 2OYQA 1YVUA 2D5RA 1REVA 1C0MA 1DLOA 1VSMA 2ETJA 3SJJA 4RW7A 4H4OA 1XHZA 1C0TA 4F3TA 3BDPA 2IS3A 4DWIA 4LD0A 3DLGA 2XRIA 4FK0A 2YNFA 1KVBA 3ZSRA 4O44A 5CZ1A 3AVLA 3AVMA 4CGHA 4CHZA 3OS0A 3QNNA 1KTQA 2HHQA 3LP3A 4I2PA 5DK5A 3KLIA 4E7LA 4KHYA 2G8UA 2F96A 2IOCA 3ZSXA 3SQ1A 3VA0A 1L3TA 4FLYA 1SV5A 3OYEA 4CK1A 3L2RA 4Y1DA 3ITHA 4OGEA 3H08A 1NJWA 1GOAA 1BI4B 1LAWA 5KI6A 3RRGA 3ZSWA 4FLWA 3PY8A 3TAEA 4ICLA 4O5BA 1RT7A 4CHQA 3L3UA 3C6UA 3VQAA 3CFRA 3DLRA 4FJKA 2EX3A 3I0SA 1HNIA 4CK3A 3OYKA 3OYJA 1TL1A 1L5UA 1U47A 4FJ8A 3RTVA 3OYDA 3KK3A 2HNZA 4CHNA 1KLNA 4R5PA 4KRFA 1K6YA 3HVTA 3I0RA 4MFBA 5C25A 3TR8A 3NE6A 3K5MA 1BIZA 2YKNA 2HMIA 3SUNA 3DLEA 3ZT0A 4KAZA 2BGGA 1CZ9A 2ZE2A 4DF8A 1LW2A 1C1BA 4E1NA 2PYLA 3SQ0A 4OKKA 4I2QA 2E6MA 5JS2A 1XC9A 1RBUA 2QXFA 3P1GA 1S6PA 5J1EA 3T3FA 4FJLA 1VSDA 4J2EA 4B08A 5FRMA 3G0ZA 4FLXA 1QS4A 3B6OA 3TANA 4B3OA 3VQ7A 3AVFA 1X9SA 1TAUA 2DFEA 3NF6A 3ZSZA 2RN2A 4FVMA 1IKVA 5HRRA 1NKBA 4N76A 3HO1A 4DTSA 2VWKA 2YKMA 4QCLA 4E89A 4EZ9A 1WNSA 2OPSA 1QSLA 4J2BA 3ZCMA 4E0DA 3HJFA 4OGCA 1DTQA 1Z25A 4DU1A 4CJLA 3VQCA 3NF8A 1JKHA 4OJRA 3K5NA 4ZTJA 1B92A 4CHOA 2OPRA 4DQIA 4E7JA 1DTTA 5T7BA 1SUQA 3NGYA 3O3HA 3AO1A 2P5OA 4KB1A 3TI0A 2B4JA 4DS4A 1RTIA 1CZBA 4KTWA 3K59A 3LDSA 4DLGA 3JYTA 3MXMA 1HYZA 4FJIA 3HL8A 3LAMA 4DTNA 1UWBA 1TL3A 4CJSA 3HM9A 2XY7A 5I42A 3LWLA 1TKTA 1NK6A 2P51A 3AVNA 3M8QA 5SZTA 4M3XA 2WOMA 1J54A 2HW3A 1QTMA 2G8HA 1D5AA 1JL2A 1HPZA 1UA0A 3PO5A 2IGIA 4K8XA 3V1QA 3LWMA 4Z4FA 3AA3A 4HUEA 1N6QA 3TWHA 1QHTA 4DSIA 3AA2A 4AHTA 4PY5A 4CJ4A 3QETA 2DFHA 4I9LA 3L8BA 2Q3SA 1KFDA 3OJSA 2HVIA 1WSIA 1IG9A 3SNNA 4FM0A 4BDYA 2IDOA 2G8WA 4NCBA 3NBPA 1D9FA 1U49A 4EP4A 4CJKA 4HTUA 3SI6A 3IS9A 3LALA 1RDDA 3SUPA 2D0CA 4DTOA 3PX6A 3NFAA 4AILC 1KFSA 3MXJA 2YHBA 3K5OA 3DI6A 1NK7A 3SPYA 4CEFA 3CYMA 2OA8A 3FFIA 2P1JA 1HJRA 3AVKA 1Q9YA 2HNDA 3PUFA 3HSTB 4DS5A 1YT3A 1KRPA 5KGXA 5FRNA 4CHPA 4CJEA 2VG6A 4OLBA 1FKOA 3OYFA 3HXMA 4DU3A 1HMVA 5JS1A 4FLTA 2GUIA 4CJUA 4CJTA 4Q5VA 3V81A 1VRUA 1W9HA 1RT4A 2OPQA 2HHUA 1WSHA 4F8RA 4HUGA 3A2FA 3KKSA 4DFMA 1RCHA 5HBMA 3T19A 4CJVA 3WNFA 3QIOA 4B8CA 4CK2A 4DTRA 1X9WA 4CEQA 2RKIA 2KW4A 3V1OA 3V9SA 4KI6A 3WNEA 3RR7A 2ITGA 3K58A 3VN5A 1RNHA 4O55A 2DFFA 1JL1A 1EKEA 4CIEA 3L2QA 1YTAA 1LWCA 3AVIA 4DG1A 1EETA 1S1WA 3SUQA 3S3OA 3RWUA 4KHWA 2LSNA 3KTQA 4OKJA 2B5JA 4PA1A 5CY4A 5KRSA 3P5JA 4Z4HA 2QK9A 4CERA 3SQ4A 4DTUA 4FLUA 3U3GA 3KLEA 3AO4A 4NCGA 4CGJA 3RR8A 4Z4IA 2HHXA 2X74A 3ZSQA 5D3GA 3OYMA 4CJWA 3AO5A 4N47A 4FCYA 3RMCA 4ELUA 3K5LA 4DF4A 1L3SA 4GMJB 1F21A 1RBTA 3DRSA 4IG0A 3DLKA 3KK2A 5HRNA 4DSEA 4DTPA 3ZT2A 4LSLA 1TAQA 2F8SA 2KFZA 4KTZA 4RW9A 1TVRA 4B9TA 3SQ2A 3SV3A 1KVCA 3U6FA 3KLFA 4FJGA 1BQNA 2HHSA 4HUFA 1W0HA 1NK0A 1JLBA 5C24A 4FJHA 2Z1HA 1JLGA 1O1WA 1VSIA 4LH5A 1XHXA 1NJXA 1KSPA 4KI4A 1VK0A 3VQ9A 4DSKA 4CEEA 4KHUA 3OJUA 5DMRA 4B9NA 1ZBFA 4N41A 1EP4A 5SWMA 1S9GA 3SCXA 3ZT3A 4DQQA 1BCMA 3AVJA 1RT6A 3AVBA 3DRPA 3S9HA 1TK8A 4KB0A 2Y1IA 3OYBA 4HCCA 1SL0A 1LW0A 1C0UA 3NAEA 1NJYA 1QQCA 1XWLA 2YHAA 3QEIA 3LPTA 5HRSA 3SZ2A 4OVLA 1JXBA 3VA3A 1RT1A 3OYGA 3V9XA 3AVHA 5CYMA 3OS2A 3AVGA 2FBVA 1JLEA 4B9SA 1RDBA 3B6PA 1C6VA 1RT5A 2IC3A 1BISA 1Q8IA 3G10A 3WNHA 3VQDA 3KLHA 4E7HA 3QNOA 3DM2A 1D9DA 1LWFA 4GW6A 4B9MA 4JS4A 2G8IA 5EU7A 1NK8A 4M41A 1RTHA 3ULDA 3AO3A 3SV4A 2PY5A 1T05A 4FLZA 4IDKA 1I39A 3KK1A 4RW8A 2FBTA 4DQRA 1NK5A 4F2SA 3O4NA 1SKRA 4FYDA 2YNHA 3JSMA 4G1QA 3ZT1A 1MU2A 3DRRA 3TAPA 4DFPA 2FC0A 1VSKA 1JLQA 1KLMA 4C8NA 2BDPA 4C8OA 3HPHA 4CGDA 4FJ7A 2O4IA 1CXUA 2X6NA 5CYQA 4F2RA 4ELTA 4LSNA 5CZ2A 4DSLA 3RMAA 2B6AA 4CIFA 4HCBA 1J9AA 4CEZA 3AVAA 4M42A 2F8TA 4H4MA 4L8RB 4M3RA 4DQPA 3HVRA 4TSXA 2XO7A 3VQBA 2Z1JA 1S1UA 2HNYA 2QKKA 2XY8A 5HROA 2ATQA 2HHTA 1X1PA 4BWJA 3NHGA 4IFYA 4KKOA 3MEDA 1BCOA 3L2VA 3HT3A 4W5RA 3OYLA 3S3NA 3PX0A 3L2WA 5KRTA 1S1TA 1Q9XA 4KHSA 1VSEA 2HHVA 4CEOA 2KFNA 3NCIA 3I8DA 4CJQA 4DTMA 4KHQA 4ID5A 4OPJA 2QKBA 4O0JA 2G8FA 4CCHA 4ZTFA 4KTQA 1JLCA 3KD1E 1S9EA 4AHSA 1JXEA 3AA4A 4CHYA 4N5SA 1BQMA 3KLGA 4Y1CA 4KREA 3V9WA 2YNIA 4DTXA 2OZSA 1RDAA 4FJ9A 3QO9A 2KZZA 1EXQA 3DOKA 2D0AA 1NOZA 2D0BA 3SUOA 4JLHA 3LP0A 1VRTA 4CF1A 2VG5A 4O4GA 4K8ZA 4ID1A 1TGOA 4HHTA 2FBYA 3O3GA 1TK0A 3PO4A 2NUBA 4H8KA 1GOBA 4GVMA 2ZQBA 1HYSA 4BDZA 1NKEA 4M3TA 4FLVA 1RILA 3NH2A 5J2MA 4Z4EA 1ZBLA 4NYFA 4FZYA 4WE1A 4CE9A 4QOZB 2BE2A 3OYIA 3QEPA 3SPZA 2G8VA 1WN7A 3NDKA 1YTUA 4QAGA 1T8EA 1WSJA 2G8KA 3QLHA 4KPYA 5KGWA 4B9LA 4FZXC 3DMJA 3CG7A 1CLQA 3MEGA 3VQQA 2W42A 3CQ8A 4PWDA 3BGRA 3OYHA 4FM2A 4CEBA 4FJJA 3D45A 4ZHRA 3ZSVA 5J2NA 3NGIA 3VQPA 2A1SA 3VQ8A 4BWMA 3QEVA 1IKYA 2DY4A 1ZYQA 3NF7A 1T7PA 3CFOA 3PV8A 4FM1A 1NOYA 3QINA 1BI4A 4CIGA 1SKWA 3VQEA 2VWJA 4M45A 1CXQA 4B9UA 4AHVA 2DTUA 1FK9A 1ASUA 3M8SA 5KTQA 4RG8A 4E1MA 1T03A 1KVAA 1ASWA 4AHUA 3ASMA 1TKDA 4PQUA 2ZD1A 5I3UA 3QEWA 1C1AA 1FXXA 1JLAA 1EX4A 4DQSA 1IO2A 4C8MA 4FJXA 2BANA 3ZSYA 4DSFA 2PYJA 3O4QA 1NK4A 2IAJA 2JGUA 3KKRA 3V9ZA 4BDPA 3T1AA 1WSEA 1U04A 1N5YA 3PX4A 4DFJA 2YV0X 2WONA 4MQ3A 4CFCA 1U45A 4OLAA 4W5NA 3CM6A 4CEAA 3MXIA 4XIUA 1L3UA 3ZSOA 2OPPA 3KJVA 1S1XA 4CF8A 3E01A 4E7IA 1Y97A 5J2QA 2Z1IA 3HPOA 3LAKA 2KZMA 3DLBA 1SKSA 2EHGA 3QESA 4PUOA 3RRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNG A;  4CED A;  1HYV A;  2XY5 A;  1HQU A;  1X9M A;  1I3A A;  2KQ2 A;  5FDL A;  3EZ5 A;  3QIP A;  1VSF A;  4FW2 A;  3C94 A;  1UOC A;  3O3F A;  1VSJ A;  4CFB A;  3LPU A;  4FJN A;  4JRQ A;  2E4L A;  4DSJ A;  3K57 A;  3UIQ A;  4NCA A;  4CFA A;  1VSL A;  1HQE A;  3OYN A;  3KD5 E;  3RMB A;  3V1R A;  5HLF A;  4OKE A;  1RDC A;  3TAF A;  4C8L A;  3ZT4 A;  1WLJ A;  3M8P A;  3TAM A;  4HVJ A;  4B8A B;  4M3U A;  2XY6 A;  4W5O A;  1Z26 A;  1RTJ A;  4JRP A;  4DMN A;  5J2P A;  4J2D A;  4M3Y A;  3HYF A;  1JLF A;  3DOL A;  1ASV A;  3AA5 X;  3ISN C;  2Y1J A;  1RBR A;  4W5T A;  2GBZ A;  3HP6 A;  3AV9 A;  3L3V A;  4NYN A;  4KHN A;  1D8Y A;  4AHR A;  4E7K A;  4AHC A;  4CEC A;  4E19 A;  1LAV A;  4OPK A;  4EZ6 A;  3EYZ A;  4Z4C A;  1LWE A;  4CJP A;  1NJZ A;  3DLH A;  1TKZ A;  2YNG A;  1QE1 A;  3VQ6 A;  3F9K A;  1BHL A;  1UA1 A;  4CGF A;  1SL2 A;  4FJ5 A;  1L3V A;  1G15 A;  3V9U A;  4LH4 A;  1TK5 A;  2A1R A;  1RTD A;  1S1V A;  2VG7 A;  3V6D A;  2R7Y A;  3VQ5 A;  4F4K A;  1A5V A;  4B9V A;  4Z4G A;  3RMD A;  4CFD A;  4FZZ A;  3IG1 A;  3HK2 A;  2OZM A;  4CGG A;  1ZBU A;  2I5J A;  1QSS A;  1GOC A;  3OS1 A;  3AO2 A;  1NK9 A;  1ITG A;  3LZJ A;  3L2U A;  1IH7 A;  1RT3 A;  5HRP A;  4IFV A;  3LZI A;  4ELV A;  3QER A;  1SL1 A;  5K14 A;  4CJ3 A;  1B9F A;  3M8R A;  3F73 A;  4FK2 A;  4CJR A;  3MEE A;  4FJM A;  3CM5 A;  4AH9 A;  3SYZ A;  3S3M A;  4FK4 A;  3TAB A;  2FBX A;  1QSY A;  4BE0 A;  3KIO A;  4IBN A;  4KV8 A;  3NF9 A;  4YFU A;  1U48 A;  1BGX T;  1S6Q A;  2RF2 A;  1S5J A;  4CES A;  4M3W A;  2GV9 A;  4KFB A;  2Z1G A;  4DLE A;  4W5Q A;  2AJQ A;  1IKX A;  1HNV A;  3EY1 A;  3LAN A;  3V4I A;  1RT2 A;  3QEX A;  1LV5 A;  3OVN A;  4UQG A;  4IKF A;  1WSG A;  4KO0 A;  4EP5 A;  2X78 A;  4IG3 A;  4RW6 A;  4BAC A;  1NKC A;  1FKP A;  4Q0B A;  4CJ5 A;  3U3Y A;  4J2A A;  2JLE A;  3DYA A;  1RBV A;  4BE2 A;  3LP2 A;  3P83 D;  3TAG A;  3IAY A;  2HHW A;  5E41 A;  2HVH A;  3HP9 A;  4E3S A;  1RBS A;  3NGZ A;  4F3O A;  2E6L A;  4M3Z A;  3NH0 A;  3VQ4 A;  3OY9 A;  2X6S A;  4CF2 A;  3C6T A;  3LP1 A;  3TAQ A;  2KTQ A;  1A5X A;  2XHB A;  1BL3 A;  3ALY A;  1BIU A;  1J53 A;  1WSF A;  4C8K A;  4I9Q A;  1ZBH A;  3NH1 A;  3MEC A;  4N56 A;  1B9D A;  1C1C A;  3C95 A;  4O0I A;  4LY7 A;  5C42 A;  3TAR A;  2O4G A;  1HRH A;  1UAX A;  3D0P A;  1WAF A;  3THV A;  4RW4 A;  4CF9 A;  1ZBI A;  1WAJ A;  1TV6 A;  4CF0 A;  4YNQ A;  1IKW A;  2HB5 A;  3MAQ A;  5FRO A;  1XI1 A;  4FXD A;  3HPG A;  4CGI A;  1U4B A;  1KCF A;  3K2P A;  4CJF A;  4I7F A;  3OYA A;  2PZS A;  5HP1 A;  1A5W A;  2RPI A;  4DTJ A;  3CFP A;  4BE1 A;  4DFK A;  1R0A A;  4JS5 A;  1J5O A;  2P5G A;  4FW1 A;  3IRX A;  3OYC A;  3AVC A;  1VSH A;  1TKX A;  4Z0U A;  4DU4 A;  2OYQ A;  1YVU A;  2D5R A;  1REV A;  1C0M A;  1DLO A;  1VSM A;  2ETJ A;  3SJJ A;  4RW7 A;  4H4O A;  1XHZ A;  1C0T A;  4F3T A;  3BDP A;  2IS3 A;  4DWI A;  4LD0 A;  3DLG A;  2XRI A;  4FK0 A;  2YNF A;  1KVB A;  3ZSR A;  4O44 A;  5CZ1 A;  3AVL A;  3AVM A;  4CGH A;  4CHZ A;  3OS0 A;  3QNN A;  1KTQ A;  2HHQ A;  3LP3 A;  4I2P A;  5DK5 A;  3KLI A;  4E7L A;  4KHY A;  2G8U A;  2F96 A;  2IOC A;  3ZSX A;  3SQ1 A;  3VA0 A;  1L3T A;  4FLY A;  1SV5 A;  3OYE A;  4CK1 A;  3L2R A;  4Y1D A;  3ITH A;  4OGE A;  3H08 A;  1NJW A;  1GOA A;  1BI4 B;  1LAW A;  5KI6 A;  3RRG A;  3ZSW A;  4FLW A;  3PY8 A;  3TAE A;  4ICL A;  4O5B A;  1RT7 A;  4CHQ A;  3L3U A;  3C6U A;  3VQA A;  3CFR A;  3DLR A;  4FJK A;  2EX3 A;  3I0S A;  1HNI A;  4CK3 A;  3OYK A;  3OYJ A;  1TL1 A;  1L5U A;  1U47 A;  4FJ8 A;  3RTV A;  3OYD A;  3KK3 A;  2HNZ A;  4CHN A;  1KLN A;  4R5P A;  4KRF A;  1K6Y A;  3HVT A;  3I0R A;  4MFB A;  5C25 A;  3TR8 A;  3NE6 A;  3K5M A;  1BIZ A;  2YKN A;  2HMI A;  3SUN A;  3DLE A;  3ZT0 A;  4KAZ A;  2BGG A;  1CZ9 A;  2ZE2 A;  4DF8 A;  1LW2 A;  1C1B A;  4E1N A;  2PYL A;  3SQ0 A;  4OKK A;  4I2Q A;  2E6M A;  5JS2 A;  1XC9 A;  1RBU A;  2QXF A;  3P1G A;  1S6P A;  5J1E A;  3T3F A;  4FJL A;  1VSD A;  4J2E A;  4B08 A;  5FRM A;  3G0Z A;  4FLX A;  1QS4 A;  3B6O A;  3TAN A;  4B3O A;  3VQ7 A;  3AVF A;  1X9S A;  1TAU A;  2DFE A;  3NF6 A;  3ZSZ A;  2RN2 A;  4FVM A;  1IKV A;  5HRR A;  1NKB A;  4N76 A;  3HO1 A;  4DTS A;  2VWK A;  2YKM A;  4QCL A;  4E89 A;  4EZ9 A;  1WNS A;  2OPS A;  1QSL A;  4J2B A;  3ZCM A;  4E0D A;  3HJF A;  4OGC A;  1DTQ A;  1Z25 A;  4DU1 A;  4CJL A;  3VQC A;  3NF8 A;  1JKH A;  4OJR A;  3K5N A;  4ZTJ A;  1B92 A;  4CHO A;  2OPR A;  4DQI A;  4E7J A;  1DTT A;  5T7B A;  1SUQ A;  3NGY A;  3O3H A;  3AO1 A;  2P5O A;  4KB1 A;  3TI0 A;  2B4J A;  4DS4 A;  1RTI A;  1CZB A;  4KTW A;  3K59 A;  3LDS A;  4DLG A;  3JYT A;  3MXM A;  1HYZ A;  4FJI A;  3HL8 A;  3LAM A;  4DTN A;  1UWB A;  1TL3 A;  4CJS A;  3HM9 A;  2XY7 A;  5I42 A;  3LWL A;  1TKT A;  1NK6 A;  2P51 A;  3AVN A;  3M8Q A;  5SZT A;  4M3X A;  2WOM A;  1J54 A;  2HW3 A;  1QTM A;  2G8H A;  1D5A A;  1JL2 A;  1HPZ A;  1UA0 A;  3PO5 A;  2IGI A;  4K8X A;  3V1Q A;  3LWM A;  4Z4F A;  3AA3 A;  4HUE A;  1N6Q A;  3TWH A;  1QHT A;  4DSI A;  3AA2 A;  4AHT A;  4PY5 A;  4CJ4 A;  3QET A;  2DFH A;  4I9L A;  3L8B A;  2Q3S A;  1KFD A;  3OJS A;  2HVI A;  1WSI A;  1IG9 A;  3SNN A;  4FM0 A;  4BDY A;  2IDO A;  2G8W A;  4NCB A;  3NBP A;  1D9F A;  1U49 A;  4EP4 A;  4CJK A;  4HTU A;  3SI6 A;  3IS9 A;  3LAL A;  1RDD A;  3SUP A;  2D0C A;  4DTO A;  3PX6 A;  3NFA A;  4AIL C;  1KFS A;  3MXJ A;  2YHB A;  3K5O A;  3DI6 A;  1NK7 A;  3SPY A;  4CEF A;  3CYM A;  2OA8 A;  3FFI A;  2P1J A;  1HJR A;  3AVK A;  1Q9Y A;  2HND A;  3PUF A;  3HST B;  4DS5 A;  1YT3 A;  1KRP A;  5KGX A;  5FRN A;  4CHP A;  4CJE A;  2VG6 A;  4OLB A;  1FKO A;  3OYF A;  3HXM A;  4DU3 A;  1HMV A;  5JS1 A;  4FLT A;  2GUI A;  4CJU A;  4CJT A;  4Q5V A;  3V81 A;  1VRU A;  1W9H A;  1RT4 A;  2OPQ A;  2HHU A;  1WSH A;  4F8R A;  4HUG A;  3A2F A;  3KKS A;  4DFM A;  1RCH A;  5HBM A;  3T19 A;  4CJV A;  3WNF A;  3QIO A;  4B8C A;  4CK2 A;  4DTR A;  1X9W A;  4CEQ A;  2RKI A;  2KW4 A;  3V1O A;  3V9S A;  4KI6 A;  3WNE A;  3RR7 A;  2ITG A;  3K58 A;  3VN5 A;  1RNH A;  4O55 A;  2DFF A;  1JL1 A;  1EKE A;  4CIE A;  3L2Q A;  1YTA A;  1LWC A;  3AVI A;  4DG1 A;  1EET A;  1S1W A;  3SUQ A;  3S3O A;  3RWU A;  4KHW A;  2LSN A;  3KTQ A;  4OKJ A;  2B5J A;  4PA1 A;  5CY4 A;  5KRS A;  3P5J A;  4Z4H A;  2QK9 A;  4CER A;  3SQ4 A;  4DTU A;  4FLU A;  3U3G A;  3KLE A;  3AO4 A;  4NCG A;  4CGJ A;  3RR8 A;  4Z4I A;  2HHX A;  2X74 A;  3ZSQ A;  5D3G A;  3OYM A;  4CJW A;  3AO5 A;  4N47 A;  4FCY A;  3RMC A;  4ELU A;  3K5L A;  4DF4 A;  1L3S A;  4GMJ B;  1F21 A;  1RBT A;  3DRS A;  4IG0 A;  3DLK A;  3KK2 A;  5HRN A;  4DSE A;  4DTP A;  3ZT2 A;  4LSL A;  1TAQ A;  2F8S A;  2KFZ A;  4KTZ A;  4RW9 A;  1TVR A;  4B9T A;  3SQ2 A;  3SV3 A;  1KVC A;  3U6F A;  3KLF A;  4FJG A;  1BQN A;  2HHS A;  4HUF A;  1W0H A;  1NK0 A;  1JLB A;  5C24 A;  4FJH A;  2Z1H A;  1JLG A;  1O1W A;  1VSI A;  4LH5 A;  1XHX A;  1NJX A;  1KSP A;  4KI4 A;  1VK0 A;  3VQ9 A;  4DSK A;  4CEE A;  4KHU A;  3OJU A;  5DMR A;  4B9N A;  1ZBF A;  4N41 A;  1EP4 A;  5SWM A;  1S9G A;  3SCX A;  3ZT3 A;  4DQQ A;  1BCM A;  3AVJ A;  1RT6 A;  3AVB A;  3DRP A;  3S9H A;  1TK8 A;  4KB0 A;  2Y1I A;  3OYB A;  4HCC A;  1SL0 A;  1LW0 A;  1C0U A;  3NAE A;  1NJY A;  1QQC A;  1XWL A;  2YHA A;  3QEI A;  3LPT A;  5HRS A;  3SZ2 A;  4OVL A;  1JXB A;  3VA3 A;  1RT1 A;  3OYG A;  3V9X A;  3AVH A;  5CYM A;  3OS2 A;  3AVG A;  2FBV A;  1JLE A;  4B9S A;  1RDB A;  3B6P A;  1C6V A;  1RT5 A;  2IC3 A;  1BIS A;  1Q8I A;  3G10 A;  3WNH A;  3VQD A;  3KLH A;  4E7H A;  3QNO A;  3DM2 A;  1D9D A;  1LWF A;  4GW6 A;  4B9M A;  4JS4 A;  2G8I A;  5EU7 A;  1NK8 A;  4M41 A;  1RTH A;  3ULD A;  3AO3 A;  3SV4 A;  2PY5 A;  1T05 A;  4FLZ A;  4IDK A;  1I39 A;  3KK1 A;  4RW8 A;  2FBT A;  4DQR A;  1NK5 A;  4F2S A;  3O4N A;  1SKR A;  4FYD A;  2YNH A;  3JSM A;  4G1Q A;  3ZT1 A;  1MU2 A;  3DRR A;  3TAP A;  4DFP A;  2FC0 A;  1VSK A;  1JLQ A;  1KLM A;  4C8N A;  2BDP A;  4C8O A;  3HPH A;  4CGD A;  4FJ7 A;  2O4I A;  1CXU A;  2X6N A;  5CYQ A;  4F2R A;  4ELT A;  4LSN A;  5CZ2 A;  4DSL A;  3RMA A;  2B6A A;  4CIF A;  4HCB A;  1J9A A;  4CEZ A;  3AVA A;  4M42 A;  2F8T A;  4H4M A;  4L8R B;  4M3R A;  4DQP A;  3HVR A;  4TSX A;  2XO7 A;  3VQB A;  2Z1J A;  1S1U A;  2HNY A;  2QKK A;  2XY8 A;  5HRO A;  2ATQ A;  2HHT A;  1X1P A;  4BWJ A;  3NHG A;  4IFY A;  4KKO A;  3MED A;  1BCO A;  3L2V A;  3HT3 A;  4W5R A;  3OYL A;  3S3N A;  3PX0 A;  3L2W A;  5KRT A;  1S1T A;  1Q9X A;  4KHS A;  1VSE A;  2HHV A;  4CEO A;  2KFN A;  3NCI A;  3I8D A;  4CJQ A;  4DTM A;  4KHQ A;  4ID5 A;  4OPJ A;  2QKB A;  4O0J A;  2G8F A;  4CCH A;  4ZTF A;  4KTQ A;  1JLC A;  3KD1 E;  1S9E A;  4AHS A;  1JXE A;  3AA4 A;  4CHY A;  4N5S A;  1BQM A;  3KLG A;  4Y1C A;  4KRE A;  3V9W A;  2YNI A;  4DTX A;  2OZS A;  1RDA A;  4FJ9 A;  3QO9 A;  2KZZ A;  1EXQ A;  3DOK A;  2D0A A;  1NOZ A;  2D0B A;  3SUO A;  4JLH A;  3LP0 A;  1VRT A;  4CF1 A;  2VG5 A;  4O4G A;  4K8Z A;  4ID1 A;  1TGO A;  4HHT A;  2FBY A;  3O3G A;  1TK0 A;  3PO4 A;  2NUB A;  4H8K A;  1GOB A;  4GVM A;  2ZQB A;  1HYS A;  4BDZ A;  1NKE A;  4M3T A;  4FLV A;  1RIL A;  3NH2 A;  5J2M A;  4Z4E A;  1ZBL A;  4NYF A;  4FZY A;  4WE1 A;  4CE9 A;  4QOZ B;  2BE2 A;  3OYI A;  3QEP A;  3SPZ A;  2G8V A;  1WN7 A;  3NDK A;  1YTU A;  4QAG A;  1T8E A;  1WSJ A;  2G8K A;  3QLH A;  4KPY A;  5KGW A;  4B9L A;  4FZX C;  3DMJ A;  3CG7 A;  1CLQ A;  3MEG A;  3VQQ A;  2W42 A;  3CQ8 A;  4PWD A;  3BGR A;  3OYH A;  4FM2 A;  4CEB A;  4FJJ A;  3D45 A;  4ZHR A;  3ZSV A;  5J2N A;  3NGI A;  3VQP A;  2A1S A;  3VQ8 A;  4BWM A;  3QEV A;  1IKY A;  2DY4 A;  1ZYQ A;  3NF7 A;  1T7P A;  3CFO A;  3PV8 A;  4FM1 A;  1NOY A;  3QIN A;  1BI4 A;  4CIG A;  1SKW A;  3VQE A;  2VWJ A;  4M45 A;  1CXQ A;  4B9U A;  4AHV A;  2DTU A;  1FK9 A;  1ASU A;  3M8S A;  5KTQ A;  4RG8 A;  4E1M A;  1T03 A;  1KVA A;  1ASW A;  4AHU A;  3ASM A;  1TKD A;  4PQU A;  2ZD1 A;  5I3U A;  3QEW A;  1C1A A;  1FXX A;  1JLA A;  1EX4 A;  4DQS A;  1IO2 A;  4C8M A;  4FJX A;  2BAN A;  3ZSY A;  4DSF A;  2PYJ A;  3O4Q A;  1NK4 A;  2IAJ A;  2JGU A;  3KKR A;  3V9Z A;  4BDP A;  3T1A A;  1WSE A;  1U04 A;  1N5Y A;  3PX4 A;  4DFJ A;  2YV0 X;  2WON A;  4MQ3 A;  4CFC A;  1U45 A;  4OLA A;  4W5N A;  3CM6 A;  4CEA A;  3MXI A;  4XIU A;  1L3U A;  3ZSO A;  2OPP A;  3KJV A;  1S1X A;  4CF8 A;  3E01 A;  4E7I A;  1Y97 A;  5J2Q A;  2Z1I A;  3HPO A;  3LAK A;  2KZM A;  3DLB A;  1SKS A;  2EHG A;  3QES A;  4PUO A;  3RRH A; 
#chains in the Genus database with same CATH topology
 2QWL A;  1HYV A;  2HF3 A;  1X9M A;  2KQ2 A;  5FDL A;  2E20 A;  3QIP A;  1BA1 A;  4JI8 K;  3C94 A;  2NLX A;  4BRG A;  2VGM A;  2E8A A;  3UIQ A;  5I9E B;  3KD5 E;  1WB9 A;  2WTU A;  4W5O A;  1Z26 A;  1E3M A;  2NRZ A;  1JLF A;  3DOL A;  3AA5 X;  4GKK K;  2GBZ A;  2ASO A;  1D8Y A;  4E7K A;  4OPK A;  3CPW M;  1T44 A;  3MN7 A;  1NJZ A;  3DLH A;  3F9K A;  4FJ5 A;  4FVU A;  4FO0 A;  4FPB A;  4LH4 A;  1TK5 A;  2A1R A;  2Q36 A;  4B9V A;  3HK2 A;  3IG1 A;  1LOT B;  1GOC A;  3OS1 A;  1NK9 A;  4GV9 A;  3DXK B;  3R1X A;  4IFV A;  4MDB A;  3LZI A;  1SL1 A;  3MEE A;  2WFB A;  3CM5 A;  1N8R O;  4BQL A;  2YHY A;  5B8H A;  4Y0W A;  1VQN N;  1U48 A;  1QHA A;  1S6Q A;  4KFB A;  4A57 A;  2AJQ A;  4C23 A;  1IKX A;  1ATN A;  3OVN A;  4WFA L;  4IG3 A;  4RW6 A;  1NGA A;  4Q0B A;  3C0B A;  1IG8 A;  2JLE A;  5F1X A;  3LP2 A;  3GOI A;  3P83 D;  5KQD A;  2HHW A;  1QQN A;  3NGZ A;  3SMS A;  3VQ4 A;  4CF2 A;  3C6T A;  3TAQ A;  2KTQ A;  1J53 A;  3TSU A;  1C1C A;  4B3R K;  4H5N A;  3SBG A;  4LY7 A;  1WAF A;  5AQI A;  1WAJ A;  1U2V A;  1IKW A;  3QFU A;  1S3X A;  3AAQ A;  3FZH A;  2QWO A;  3WEE B;  3W3D A;  4B1V A;  3CCR N;  3CPE A;  2QWR A;  3U4L A;  3AVC A;  3O8M A;  1VSH A;  1TKX A;  1DLO A;  2Q1N A;  4H4O A;  1XMQ K;  1C0T A;  4F3T A;  3E66 A;  4CJ7 A;  1NBW A;  3O4W A;  3J8A A;  3BDP A;  4FK0 A;  3CCS N;  3H3O B;  1VQK N;  3AVM A;  3OS0 A;  2PFU A;  1QVF M;  5DK5 A;  3CCU N;  3PSF A;  3BZK A;  3LDQ A;  2IOC A;  3SQ1 A;  1RFQ A;  1SV5 A;  4M7X A;  4IEI A;  4OGE A;  5KI6 A;  4JKH A;  3ZSW A;  1GLA G;  4FWL A;  4JI5 K;  4A2B A;  3C6U A;  1K8K B;  1QZ5 A;  2QM1 A;  4CK3 A;  3C65 A;  1L5U A;  1U47 A;  4R5P A;  4BRE A;  3I0R A;  3IDH A;  4B9N A;  4IKF A;  1BIZ A;  1YXQ A;  4DF8 A;  3GBT A;  1X3M A;  3BF3 A;  5JS2 A;  1RBU A;  3P1G A;  1S6P A;  3M6G A;  1MWK A;  4E1J A;  4J2E A;  4B08 A;  1QS4 A;  4IFE A;  5AQQ A;  3VQ7 A;  3AVF A;  1X9S A;  3DJC A;  3NF6 A;  3HO1 A;  5AZI A;  1QVG M;  4QCL A;  5AQZ A;  3UE5 A;  4E89 A;  4EZ9 A;  3Q7B A;  1WNS A;  1QSL A;  3ZCM A;  3VQC A;  1JKH A;  4ZTJ A;  1B92 A;  2QI2 A;  2EWS A;  2P5O A;  4U7B A;  1VQ5 N;  1KAX A;  5FPN A;  2B4J A;  1RTI A;  1CZB A;  4KTW A;  3VGM A;  4AM6 A;  3K59 A;  3JYT A;  4DTN A;  4CJS A;  1Q86 O;  5I42 A;  4YOU A;  3LWL A;  1TKT A;  3TTF A;  5SZT A;  1C0G A;  1D5A A;  1UA0 A;  3LWM A;  3AA3 A;  3TWH A;  1QHT A;  4CJ4 A;  3THX A;  4M7Y A;  2DFH A;  4DR3 K;  2GX9 A;  1GLL O;  1WSI A;  4X64 K;  3U9Z A;  3BUZ B;  1U49 A;  5HL7 L;  3SI6 A;  1RDD A;  2D0C A;  4DTO A;  1YJ9 N;  3FGU A;  4DR6 K;  4RTF D;  1VQ4 N;  2P9S B;  1Q9Y A;  2HND A;  3PUF A;  1KRP A;  4JI3 K;  5FRN A;  1FKO A;  3HXM A;  4K0K K;  1Y64 A;  1MDU B;  5EXW A;  2GUI A;  4CJT A;  4CZI A;  1RT4 A;  2A40 A;  3CC4 N;  3QFP A;  4B1U B;  4XH1 A;  3WNF A;  4DTR A;  1XNQ K;  2P9I B;  1DGK N;  3V1O A;  4DV4 K;  4KI6 A;  3WNE A;  4BC5 A;  3RWU A;  4DG1 A;  1S1W A;  2LSN A;  2QWQ A;  5CY4 A;  1P8Z A;  3MX2 A;  3U3G A;  3BZC A;  2E2O A;  3LM2 A;  4CGJ A;  3RR8 A;  4Z4I A;  2HHX A;  4CZG A;  4ELU A;  1BG3 A;  3HBT A;  4GMJ B;  1RBT A;  1WBB A;  3UKR A;  1GLE G;  2W41 A;  2F8S A;  2HBJ A;  3CQX A;  3ZX0 A;  2QA4 N;  4RW9 A;  3HOT A;  2E2P A;  3SQ2 A;  1K73 O;  5GIP A;  1JLB A;  5C24 A;  4DV6 K;  2Z1H A;  1VSI A;  1XHX A;  4DSK A;  4CEE A;  4YOX A;  4KHU A;  1EP4 A;  4BRP A;  3ZT3 A;  3S9H A;  4LF6 K;  1RT6 A;  4KB0 A;  1ILY A;  3NAE A;  1C0U A;  1QQC A;  1XWL A;  3H6E A;  3DLL L;  1JXB A;  3AVH A;  1BIS A;  1Q8I A;  1ZBS A;  4MO4 A;  4NXM K;  3BEX A;  2GUP A;  3VTH A;  1QZ6 A;  5LJW A;  4JKE A;  3DM2 A;  4B9M A;  4EHU A;  5KPT A;  4JS4 A;  2E5L K;  2WUS A;  5LY3 A;  1I39 A;  3KK1 A;  4F2S A;  1YF5 L;  2FBT A;  1MU2 A;  4AQY K;  4DFP A;  2E2N A;  4FJ7 A;  2X6N A;  4F2R A;  3KWG A;  2ASP A;  3UB5 A;  3CC7 N;  3PSI A;  5JLH A;  4HCB A;  1T6D A;  5BPM A;  4M3R A;  3VMF B;  5JVG L;  3MCA B;  2Z1J A;  2QKK A;  2XY8 A;  3ID6 A;  2PAV A;  4KKO A;  3MED A;  3GDQ A;  2VQE K;  3P39 A;  3PX0 A;  4NO7 A;  3L2W A;  1YI2 N;  3P4I A;  4JK9 A;  1Q9X A;  5M1P A;  4DTM A;  4KHQ A;  2QKB A;  1GLJ O;  4CCH A;  3E1Y A;  4JI6 K;  2ASM A;  3D7E O;  1JLC A;  3ZET B;  1S9E A;  1JXE A;  4CHY A;  4N5S A;  1RDW X;  4IEE A;  4B3S K;  1DKG D;  4QS8 A;  5F2R A;  5AQR A;  3DOK A;  2QWM A;  1FJG K;  2VG5 A;  1TGO A;  4JI4 K;  4HHT A;  4BG9 A;  3WEE A;  1TK0 A;  4BDZ A;  4M3T A;  4FLV A;  3EL2 A;  5J2M A;  4Z4E A;  3TU5 A;  3WXK A;  4FZY A;  1HKG A;  1J5E K;  3SPZ A;  1QQO A;  1WN7 A;  3NDK A;  1YTU A;  4BRA A;  1T8E A;  2UXB K;  4KPY A;  3DMJ A;  3CG7 A;  3MEG A;  3CMA N;  4CEB A;  3HI0 A;  5J2N A;  5CHI A;  1QQM A;  3VQP A;  3VQ8 A;  2DY4 A;  3PV8 A;  3QIN A;  4B9U A;  4M45 A;  4AHV A;  4FWR A;  3ZYY X;  4C1N K;  4AHU A;  2FF6 A;  4IZ9 A;  4PQU A;  1IV0 A;  3T1Y K;  1U2V B;  4B1Z A;  1BU6 O;  1IO2 A;  2D1K A;  4C8M A;  2BAN A;  4DSF A;  3LDL A;  4K42 A;  5C2F A;  2NRT A;  5AQG A;  2HBM A;  3H46 O;  2WON A;  4A62 A;  1L3U A;  3ZSO A;  2HF4 A;  4GVE A;  3VEV A;  3EE9 A;  4PUO A;  4YOV A;  4CED A;  3CI5 A;  1HQU A;  4A61 A;  4CZM A;  4DHY A;  4FW2 A;  1UOC A;  4FWQ A;  3VOV A;  1HPM A;  2E4L A;  3OYN A;  4CBW A;  3RMB A;  3V1R A;  3ZT4 A;  4HVJ A;  3TAM A;  1HUX A;  2XY6 A;  4JRP A;  2BTF A;  5MLC Q;  3HYF A;  5ELZ A;  4BR2 A;  3AV9 A;  4NYN A;  4H03 B;  4AHC A;  4CEC A;  4E19 A;  1XMO K;  1LWE A;  4JKD A;  4CJP A;  1TKZ A;  2YNG A;  1BHL A;  1L3V A;  1G15 A;  3V9U A;  3VES A;  1S1V A;  5AQJ A;  2R7Y A;  4YOY A;  3EE8 A;  3VQ5 A;  1A5V A;  3RMD A;  2YCH A;  5AZI B;  2JWK A;  1FW6 A;  4BVO A;  4HWI A;  1W97 L;  1YIT N;  4LF8 K;  4CBX A;  4WF9 L;  1NMN A;  2IVN A;  4J8F A;  3M8R A;  1B9F A;  3HOS A;  3F73 A;  2P9S A;  1S22 A;  4Z94 A;  4FK4 A;  3CJ7 A;  2V7Z A;  5AQU A;  5AJ3 K;  4X62 K;  1QSY A;  4KH5 A;  3CCV N;  2YHW A;  2HBL A;  4FWS A;  4M3W A;  2RF2 A;  5AQF A;  4CES A;  2GV9 A;  2O8C A;  5AQM A;  2HMP A;  3G6E N;  3V4I A;  4UQG A;  4IOA L;  3BP8 A;  5GIO A;  2X78 A;  4A5A A;  2IIR A;  3U3Y A;  2A41 A;  2P9I A;  1ATS A;  3DYA A;  3IAY A;  3SAG A;  3TTC A;  1NU0 A;  3MDQ A;  3EN9 A;  1RBS A;  5JLF A;  1WUA A;  3HTV A;  3RVC A;  2V51 B;  3NH0 A;  4JK8 A;  1A5X A;  1XNR K;  3IKM A;  2XHB A;  1BL3 A;  1BIU A;  3VGK A;  1WSF A;  4C8K A;  4CZL A;  4I9Q A;  1ZBH A;  3NH1 A;  3PIP L;  3C95 A;  5C42 A;  3ZLJ A;  1UAX A;  1VAZ A;  1ZBI A;  1NGC A;  5BPN A;  4YNQ A;  3HPG A;  1K8A O;  3OYA A;  4I7F A;  4CD1 A;  4FW1 A;  1OH7 A;  4DR1 K;  1YVU A;  4FWK A;  3THY A;  3CJC A;  2IS3 A;  3ENH A;  4EFH A;  2XRI A;  3SAH A;  2YNF A;  4L3Q A;  4JEP A;  1YJN N;  4NLB A;  3LP3 A;  4I2P A;  4KHY A;  3KLI A;  5A2Q O;  2G8U A;  1R59 O;  4BRL A;  4FLY A;  3K9K A;  3L2R A;  1GOA A;  1BI4 B;  3KZB A;  4FLW A;  5GAE P;  3T69 A;  4V19 S;  5GAD P;  3CFR A;  3UKR B;  2A42 A;  2GWJ A;  1HNI A;  1W2B M;  1TL1 A;  3RTV A;  3OYD A;  3PIO L;  4CZK A;  3KK3 A;  1VQ6 N;  1KLN A;  4KRF A;  3VEY A;  2E2Q A;  4MFB A;  3K5M A;  3ZX3 A;  4WCE L;  5TKY A;  1XC9 A;  1V4S A;  3T3F A;  4B3O A;  2ZM6 K;  5M1O A;  3OHR A;  3K9J A;  4HTL A;  2RN2 A;  1S72 N;  1ZXO A;  2VWK A;  2YKM A;  3KVG A;  4J2B A;  4E0D A;  1NJI O;  4OGC A;  1DTQ A;  3LL3 A;  4DU1 A;  3NF8 A;  2I7P A;  3HSC A;  5T7B A;  1SUQ A;  5AFU H;  3AO1 A;  3H3N O;  4BRO A;  3E9L A;  2E88 A;  3TI0 A;  4DS4 A;  1OH5 A;  3LDS A;  1JCG A;  3K0S A;  1HYZ A;  4FJI A;  3ZET A;  3LAM A;  4H5R A;  5C12 A;  4PL7 A;  3HM9 A;  3L0Q A;  5BRH A;  1NK6 A;  3AVN A;  4FSV A;  2HW3 A;  4X66 K;  3F2K A;  1J54 A;  4JV5 K;  1JL2 A;  1HPZ A;  2O8E A;  4HUE A;  4AHT A;  4I9L A;  5EY4 A;  3L8B A;  2Q3S A;  3OJS A;  3TPQ A;  5BN8 A;  2UXC K;  4WQ4 A;  3O9T A;  1D9F A;  4EP4 A;  3LAL A;  5BRD A;  4EHT A;  2Q97 A;  2YHB A;  5AQW A;  1VQM N;  4DQ8 A;  4CEF A;  1I94 K;  2P1J A;  3AVK A;  3HST B;  2VG6 A;  3EZW A;  3OYF A;  5JS1 A;  1HMV A;  4RCH A;  4FLT A;  1HLU A;  3VEN A;  2J4R A;  4WYB A;  2OCE A;  2ZF5 O;  3OBW A;  1RCH A;  5HBM A;  4CK2 A;  4B8C A;  1SQK A;  4CEQ A;  3CJB A;  3V9S A;  3RR7 A;  4GV6 A;  1RNH A;  1M1K O;  4CZF A;  1EKE A;  3L2Q A;  1LWC A;  3S3O A;  3SUQ A;  1EET A;  4H0O A;  4BRK A;  1SZ2 A;  5AQO A;  2D4W A;  2FXU A;  3ZSQ A;  2AA4 A;  3OYM A;  3RMC A;  3AAP A;  4DF4 A;  1HX1 A;  1VQO N;  3DLK A;  4ISF A;  4LSL A;  3ATU A;  3CQY A;  2KFZ A;  1OH6 A;  4JKB A;  2E1Z A;  3MWP A;  3SV3 A;  1KVC A;  1BQN A;  1HKC A;  4FJH A;  4BGB A;  1JLG A;  1NJX A;  1KSP A;  5AQS A;  1VK0 A;  4A5B A;  1ZBF A;  4N41 A;  5SWM A;  5EOY A;  3AVB A;  3DRP A;  3CC2 N;  4HCC A;  2ZJR L;  4JI2 K;  1SL0 A;  5AQK A;  1LW0 A;  1X3N A;  3O80 A;  1NJY A;  4WFN L;  3QEI A;  1VQ8 N;  3SZ2 A;  1G99 A;  3HZ6 A;  3OTO K;  4OVL A;  3TTD A;  3CIP A;  3QBW A;  3VA3 A;  5CYM A;  1RDB A;  3WNH A;  3VQD A;  5C2D A;  3KLH A;  4BC3 A;  4IOC L;  2G8I A;  4EIA A;  4M41 A;  1M90 O;  2V52 B;  2O8F B;  3SV4 A;  2PY5 A;  4FLZ A;  4IDK A;  1HJO A;  1SKR A;  4B9Q A;  4G1Q A;  3TAP A;  3JAM O;  3CD6 N;  5FPD A;  4KHP K;  1LCU A;  2O4I A;  3VTI A;  5CZ2 A;  4DSL A;  2Q0U A;  4CIF A;  1JCE A;  4CEZ A;  3AVA A;  2F8T A;  4L8R B;  3WQT A;  4TSX A;  3VQB A;  2HNY A;  1NLV A;  5HRO A;  2ATQ A;  4GNI A;  2HHT A;  4BWJ A;  2UUA K;  3VEZ A;  1IBM K;  1BWF O;  1BCO A;  4H0T B;  3DXM A;  4KHS A;  5KRT A;  1S1T A;  4B1X B;  2HHV A;  4I6M B;  3H1V X;  3I8D A;  4CJQ A;  4O0J A;  2G8F A;  4ZTF A;  4PKG A;  4QS9 A;  4MO5 A;  4MDA A;  4Y1C A;  2OZS A;  2O8D A;  2YX6 A;  3QO9 A;  3D2F A;  4LF7 K;  1NGE A;  1YAG A;  2D0A A;  1NOZ A;  5AZJ A;  1EQY A;  3SUO A;  1BOT O;  2Q31 A;  3LP0 A;  3TSQ A;  1VRT A;  2JWL A;  2O8C B;  1BA0 A;  2RHK A;  3O9S A;  1J6Z A;  3PO4 A;  4H8K A;  1GOB A;  1NKE A;  2HST A;  2OTL N;  4JN4 A;  3NH2 A;  3AGR A;  4NYF A;  3P38 A;  3CCE N;  3J7Y P;  4QAG A;  1WSJ A;  2G8K A;  4FZX C;  5FLX O;  3CQ8 A;  4PWD A;  5HOO A;  4FM2 A;  3D45 A;  4ZHR A;  2A1S A;  5JVH L;  2WBN A;  3R3L A;  3NF7 A;  1EWQ A;  3CFO A;  4FM1 A;  1NOY A;  4JK7 A;  1BI4 A;  1SKW A;  3VQE A;  3CCJ N;  2DTU A;  3M8S A;  4RG8 A;  3L4I A;  4WQ4 C;  1TKD A;  4IJA A;  1HNW K;  3QEW A;  1N34 K;  1FXX A;  2V7Y A;  1JLA A;  2NRR A;  1NK4 A;  3O9Q A;  2JGU A;  5GIN A;  4JI0 K;  3PX4 A;  4DFJ A;  4BR4 A;  3MXI A;  4XIU A;  3KJV A;  1S1X A;  4BRI A;  3THY B;  4E7I A;  4BRD A;  3HPO A;  3LAK A;  2EHG A;  4BRH A;  4CZE A;  4GY2 B;  3WNG A;  3UKU A;  2XY5 A;  4JHD A;  2NRV A;  5KPR A;  3O3F A;  4CFB A;  3LPU A;  4FJN A;  4JRQ A;  4FOI A;  3LDN A;  3K57 A;  3EO3 A;  5C10 A;  4NCA A;  2W40 A;  3CJ9 A;  4AM7 A;  2WC9 A;  5HLF A;  3TAF A;  1WLJ A;  3M8P A;  3CJA A;  2CGK A;  2UXD K;  5JMV A;  4J2D A;  4M3Y A;  3ISN C;  1MWM A;  3ZEU B;  4W5T A;  3FZK A;  3HP6 A;  3L3V A;  4EZ6 A;  3VF2 A;  3EYZ A;  4Z4C A;  1SL2 A;  2KHO A;  3CCQ N;  1RTD A;  1OVQ A;  4EAH D;  3V6D A;  4CFD A;  4FZZ A;  1TUY A;  1ZBU A;  2I5J A;  3G25 A;  1QSS A;  4LF4 K;  3LZJ A;  1IH7 A;  1RT3 A;  5HRP A;  4ELV A;  3N4Q A;  2Q2R A;  5K14 A;  4CJ3 A;  3RSE B;  3VET A;  4CJR A;  5AQX A;  4FJM A;  3SYZ A;  3MN5 A;  4O5F A;  4K43 A;  2FLO A;  4KV8 A;  1BGX T;  1S5J A;  1OVY A;  1Z6R A;  4DLE A;  1HNV A;  3D2E A;  3LAN A;  1RT2 A;  5ADX H;  3QEX A;  1LV5 A;  2AP1 A;  2CGJ A;  1WSG A;  2O8E B;  4KO0 A;  4EP5 A;  4MLE A;  1H1V A;  3DAW A;  4OPA A;  4BAC A;  1FKP A;  3CJ1 A;  5AQP A;  3CXC M;  4BE2 A;  1RBV A;  3OW2 M;  3OA9 A;  4E3S A;  1YHQ N;  3KHY A;  4F3O A;  4M3Z A;  4IJN A;  3W0L A;  4LF5 K;  1NWK A;  3WXI A;  3GE1 A;  1U6Z A;  4FPA A;  3MX5 A;  3QML A;  3MEC A;  4N56 A;  1B9D A;  3C7N B;  3O6W A;  3CCL N;  3TAR A;  2O4G A;  3SK3 A;  4O8K A;  4CF9 A;  3VER A;  4CF0 A;  3R6M A;  3MAQ A;  5FRO A;  4CGI A;  1U4B A;  4CJF A;  4IWV A;  5HP1 A;  4DTJ A;  4BE1 A;  3OYC A;  1V4T A;  4DUY K;  1CZA N;  2OYQ A;  2D5R A;  2ETJ A;  3NVM A;  1C0M A;  1VSM A;  3SJJ A;  1XHZ A;  5AQN A;  4DWI A;  3DLG A;  4GKJ K;  1KVB A;  3ZSR A;  5CZ1 A;  3AVL A;  4CD3 A;  4NLC A;  2P9L A;  1KTQ A;  4E7L A;  3ENB A;  1NMD A;  4IO8 A;  3VA0 A;  1L3T A;  3OYE A;  4CK1 A;  4C8L A;  4Y1D A;  3RRG A;  3H08 A;  4U67 L;  5M1K A;  3PY8 A;  1RT7 A;  5C15 A;  3L3U A;  3VQA A;  2EX3 A;  3O9R A;  2O8F A;  2F9T A;  1VQP N;  2HNZ A;  4CHN A;  4PKH A;  3WUH A;  3TR8 A;  2BGG A;  3ZT0 A;  4BC2 A;  1CZ9 A;  3HRG A;  1LW2 A;  4E1N A;  3SQ0 A;  3L6Q A;  4I2Q A;  2E6M A;  3I8B A;  2QXF A;  4CBU A;  3SMP A;  2PBD A;  4JKF A;  3TSP A;  4FLX A;  3MWT A;  4JD2 A;  1TAU A;  2DFE A;  3U8X A;  3O1W A;  4FVM A;  1GLC G;  1IKV A;  5HRR A;  1NKB A;  4N76 A;  4DTS A;  3FE1 A;  1O13 A;  2OPS A;  3HJF A;  2D0P A;  4H5W A;  4CHO A;  2OPR A;  3QB0 A;  4KB1 A;  3O3H A;  4I6M A;  3ULE B;  2QWP A;  1RGI A;  1NGJ A;  4H5V A;  5BN9 A;  3CCM N;  2QW9 A;  3VGL A;  1ESV A;  4B3M K;  1UWB A;  1TL3 A;  2XY7 A;  4F9O A;  4DB3 A;  2A5X A;  3M8Q A;  2WOM A;  1QTM A;  2G8H A;  3PO5 A;  4K8X A;  2IGI A;  3V1Q A;  4Z4F A;  1N6Q A;  1NM1 A;  5AFU A;  4DSI A;  4G9Z A;  1YIJ N;  1KFD A;  4DR7 K;  3AY9 A;  2HVI A;  4CZJ A;  3SNN A;  1TYQ A;  4FWM A;  3VF4 A;  4FM0 A;  1OH8 A;  4KBO A;  4RWT A;  3SUP A;  5TKW A;  3PX6 A;  3NFA A;  2HHH K;  4JKC A;  4AIL C;  5AQT A;  5AQV A;  1KFS A;  3K5O A;  2NRH A;  2P9N B;  5DM7 L;  3DXM B;  3FFI A;  3IMX A;  1YT3 A;  4CHP A;  4OLB A;  2FSJ A;  4AF1 A;  4DKW A;  4B1W B;  5M1N A;  1VRU A;  2O8D B;  2OPQ A;  2HHU A;  1WSH A;  3D2F B;  4F8R A;  3CME N;  3A2F A;  5AZJ B;  1OKJ A;  4CJV A;  1GLB G;  1T6C A;  2RKI A;  3VEX A;  3VN5 A;  4O55 A;  4A2A A;  2DFF A;  4FWP A;  1E4G T;  1YTA A;  1HNZ K;  3KTQ A;  4OKJ A;  2B5J A;  4PA1 A;  3P5J A;  4Z4H A;  3BY5 A;  1NGG A;  4C1N I;  3AO4 A;  2X74 A;  3FLC O;  5D3G A;  4CJW A;  4N47 A;  4FCY A;  3M5R A;  1EWR A;  2I7N A;  3KK2 A;  5HRN A;  3M3Z A;  3ZT2 A;  1ATR A;  4H0Y B;  4KTZ A;  1XQS C;  4BRF A;  1TVR A;  5BR8 K;  3U6F A;  4ILJ A;  4FJG A;  2HHS A;  4QS7 A;  4HUF A;  2RE2 A;  1NK0 A;  3ID8 A;  1O1W A;  4LH5 A;  5FPE A;  4KI4 A;  2ZWH A;  3VQ9 A;  1YVN A;  5DMR A;  1P90 A;  3MN6 A;  3ZEU A;  3A5O C;  1S9G A;  4FWN A;  4DQQ A;  1BCM A;  3CET A;  3I55 N;  3CF5 L;  2H3G X;  1HNX K;  1NG9 A;  5HRS A;  3A8Y A;  5LMU K;  1RT1 A;  3OYG A;  4B9S A;  3AVG A;  2FBV A;  2P9P B;  2IC3 A;  1NGI A;  2GWK A;  3UKU B;  3A5M C;  4JHD B;  1ZC6 A;  4GW6 A;  1HR0 K;  5EU7 A;  3ULD A;  3DWL A;  1N33 K;  4DQR A;  4RW8 A;  3RSE A;  3A0I X;  5EX5 A;  5GAG P;  4BY9 C;  2YNH A;  3ZT1 A;  3DRR A;  5LJV A;  3QBX A;  2FC0 A;  1JLQ A;  4C8O A;  4H0X B;  2ITM A;  3HPH A;  1Q18 A;  1CXU A;  5CYQ A;  4LSN A;  3EKS A;  2B6A A;  3CER A;  1J9A A;  4M42 A;  3CHW A;  1X1P A;  3NHG A;  5JIC A;  4IFY A;  3WXL A;  3L2V A;  4KH6 A;  5E84 A;  4W5R A;  3OYL A;  1VSE A;  2KFN A;  3NCI A;  4ID5 A;  4OPJ A;  2P9U B;  4KTQ A;  3BF1 A;  4YOT A;  3KD1 E;  4AHS A;  3C7N A;  3KLG A;  4KRE A;  1RDA A;  4YOW A;  2OAN A;  1E4F T;  5KQ8 A;  4IDH A;  3R8E A;  1K9M O;  4WFB L;  4O4G A;  4K8Z A;  2CH5 A;  4ID1 A;  4XEI A;  2FBY A;  3D2E B;  3O3G A;  4H0P A;  4WQ5 A;  4GVM A;  2ZQB A;  1RIL A;  3N4P A;  5FPM A;  4CE9 A;  3OYI A;  1W7A A;  3T1H K;  1Q7Y O;  5KGW A;  3NVK A;  3G71 N;  4YHH K;  3BGR A;  5AQL A;  4FJJ A;  1T3V A;  3ZSV A;  2GTD A;  3GG4 A;  3QEV A;  3D6R A;  2YHX A;  4OO1 J;  2ZGY A;  4B1Y B;  2W6L A;  1GLF O;  1FK9 A;  1ASU A;  5KTQ A;  3SJH A;  4E1M A;  1T03 A;  1KVA A;  1ASW A;  3LDP A;  4JNE A;  3ASM A;  4XH5 A;  3G4S N;  4JKG B;  5E26 A;  4PKI A;  1C1A A;  3LM9 A;  4B3T K;  1EX4 A;  4FJX A;  3AGK A;  3SLC A;  3ZSY A;  2PYJ A;  2IAJ A;  2YJE A;  4BDP A;  1U04 A;  4BRQ A;  1C0F A;  5KPZ A;  2E1Y A;  4CF8 A;  1Y97 A;  5J2Q A;  2VGN A;  4YDU C;  2KZM A;  3DLB A;  3MK6 A;  4BR0 A;  5AQY A;  2P9L B;  1I3A A;  4H5T A;  2CH6 A;  3EZ5 A;  4BQZ A;  1VSF A;  1VSJ A;  4DSJ A;  4CFA A;  1VSL A;  1HQE A;  4OKE A;  1RDC A;  4OPH A;  1NGD A;  4BRM A;  4B8A B;  4M3U A;  3ULE A;  1RTJ A;  4DMN A;  5J2P A;  2FSN A;  4ISE A;  4CVN E;  4CZH A;  3J81 O;  1ASV A;  2Y1J A;  2O8B B;  1RBR A;  1KC8 O;  4KHN A;  5AQH A;  4AHR A;  1LAV A;  1QE1 A;  3VQ6 A;  1UA1 A;  4CGF A;  1N32 K;  1BO5 O;  1KQS M;  2VG7 A;  4F4K A;  4Z4G A;  4JD2 B;  1IJJ A;  2OZM A;  2A3Z A;  2Q0R A;  5IT9 O;  2VWB A;  4CGG A;  2W6K A;  1KD1 O;  1IBK K;  3AO2 A;  1YUW A;  2VQF K;  4DR2 K;  1ITG A;  3L2U A;  4BR5 A;  4O8U A;  2ZGZ A;  4DV0 K;  3QER A;  4FK2 A;  2P9N A;  4AH9 A;  3S3M A;  3TAB A;  2FBX A;  3ENO A;  4OX9 K;  4BE0 A;  1HKB A;  5GAH P;  3KIO A;  4IBN A;  4YFU A;  3NF9 A;  1JCF A;  2Z1G A;  2NRW A;  4W5Q A;  4GV3 A;  3EY1 A;  3A5N C;  1SAZ A;  3FZM A;  1Q81 O;  1X9J A;  3FZL A;  1NKC A;  4CJ5 A;  4DV1 K;  4J2A A;  3TAG A;  4PL8 A;  3OBY A;  2BH1 A;  5M1F A;  5E41 A;  2HVH A;  3HP9 A;  2FSK A;  2F4V K;  4FWO A;  2QEX N;  1TYQ B;  2NZT A;  1NGF A;  5ADX A;  2E6L A;  3MN9 A;  3OY9 A;  2X6S A;  3LP1 A;  4LC9 B;  3ALY A;  4K41 A;  4DCH A;  5BRE A;  2F7T A;  4ILH A;  4MLH A;  3ZX2 A;  4DR4 K;  2UYT A;  2P9K A;  3VEW A;  3Q7C A;  4O0I A;  4JI7 K;  1HRH A;  3D0P A;  3THV A;  4RW4 A;  3B8A X;  1TV6 A;  5LMN K;  2HB5 A;  2QWN A;  1XI1 A;  3J7A P;  4FXD A;  4DUZ K;  1KCF A;  3K2P A;  2PZS A;  1A5W A;  2RPI A;  3CFP A;  4DFK A;  1J5O A;  1R0A A;  4JS5 A;  1VQL N;  2P5G A;  3IRX A;  4IO9 L;  3T7Z A;  4Z0U A;  4DU4 A;  1REV A;  4KH4 A;  4RW7 A;  4K25 A;  2QTD A;  4LD0 A;  3THW B;  4O44 A;  4CGH A;  4CHZ A;  3QNN A;  2HHQ A;  3H1Q A;  2F96 A;  3ZSX A;  3FZF A;  3VF6 A;  3F5T A;  4YY3 K;  1XC3 A;  2P9P A;  3U9D A;  3M1F A;  3C6A A;  3ITH A;  4WQ5 C;  1NJW A;  1LAW A;  3GL1 A;  3TAE A;  4ICL A;  3WXJ A;  4O5B A;  4CHQ A;  2D0O A;  4FJK A;  3DLR A;  1VHX A;  5DM6 L;  1WBD A;  3I0S A;  3OYK A;  3OYJ A;  4FJ8 A;  3HM8 A;  1K6Y A;  3HVT A;  4JAX A;  5C25 A;  4DV7 K;  3NE6 A;  2YKN A;  2HMI A;  3SUN A;  3DLE A;  4KAZ A;  4LFB K;  2ZE2 A;  1C1B A;  2PYL A;  4M63 C;  4OKK A;  1DEJ A;  5J1E A;  4FJL A;  5AR0 A;  1VSD A;  5FRM A;  3G0Z A;  3B6O A;  3TAN A;  4LFA K;  4BR9 A;  3E9O A;  3ZSZ A;  5CE3 A;  4R79 A;  4LFC K;  2UUC K;  4BGA A;  1IBL K;  2VYP A;  3O08 A;  3DXK A;  2CGL A;  1Z25 A;  4CJL A;  4OJR A;  3K5N A;  4DQI A;  3KK7 A;  4E7J A;  1DTT A;  3NGY A;  3S41 A;  1VQ9 N;  2P9U A;  4DLG A;  4BRC A;  1WOQ A;  3MXM A;  3EEQ A;  3HL8 A;  4X65 K;  4BC4 A;  2P51 A;  4M3X A;  3IUC A;  2GEM A;  4PY5 A;  3AA2 A;  3QET A;  2VCP A;  5M1Q A;  3MMV A;  1NNE A;  1IG9 A;  4PHT X;  4BDY A;  2IDO A;  2G8W A;  4NCB A;  3NBP A;  4XH4 A;  4NB4 A;  4CJK A;  4HTU A;  3IS9 A;  1JJ2 M;  4FOE A;  3R9P A;  4NXN K;  3MXJ A;  3DI6 A;  1NK7 A;  3SPY A;  3CYM A;  2OA8 A;  3PLA A;  1HJR A;  4DS5 A;  2OTJ N;  5KGX A;  3VPZ A;  4CJE A;  4DU3 A;  4CJU A;  4Q5V A;  3F9M A;  3V81 A;  1W9H A;  4YOR A;  4JKG A;  4HUG A;  5LL6 Z;  3WXM B;  3KKS A;  4DFM A;  3O1B A;  3T19 A;  3QIO A;  2YI1 A;  1X9W A;  2DPN A;  2KW4 A;  4JI1 K;  2UU9 K;  2ITG A;  3K58 A;  1D4X A;  4BVP A;  1EO1 A;  1JL1 A;  4CIE A;  3AVI A;  3FR0 A;  4KHW A;  1RDU A;  3SBT A;  2ZJP L;  5KRS A;  2GEL A;  5CR4 A;  2QK9 A;  4CER A;  3SQ4 A;  4DTU A;  4FLU A;  3KLE A;  4NCG A;  5H1S Q;  5IWA K;  2F9W A;  3WT0 A;  3AO5 A;  1DT9 A;  5BRF A;  3K5L A;  1L3S A;  3LDO A;  3QIC A;  1F21 A;  3DRS A;  1K8K A;  3FFK B;  4IG0 A;  4DSE A;  4DTP A;  1TAQ A;  2YJF A;  4B9T A;  1GLD G;  2QXL A;  3KLF A;  1W0H A;  1YJW N;  3AAR A;  1KAY A;  3OJU A;  2O8B A;  3SCX A;  3J7Z O;  3AVJ A;  1TK8 A;  1Q82 O;  1VQ7 N;  2Y1I A;  3OYB A;  3VEO A;  4LF9 K;  2IVO A;  2YHA A;  5C0Y A;  3LPT A;  5BR9 A;  3V9X A;  4DR5 K;  5BPL A;  3OS2 A;  2KKZ A;  1JLE A;  3B6P A;  1C6V A;  1RT5 A;  2NRX A;  3G10 A;  3L4Q A;  1N36 K;  4E7H A;  3QNO A;  1D9D A;  1LWF A;  3EKU A;  1NK8 A;  1RTH A;  3AO3 A;  1NGB A;  2UUB K;  1T05 A;  1NK5 A;  3I56 N;  3ATV A;  3O4N A;  4FYD A;  3JSM A;  4DV2 K;  4IXC A;  3JS6 A;  1VSK A;  1KLM A;  4C8N A;  2BDP A;  4CGD A;  1KXP A;  4ELT A;  3RMA A;  1SS6 A;  4BR7 A;  4H4M A;  1MA9 B;  2NNW A;  4DQP A;  5F0X A;  3HVR A;  2XO7 A;  1TUU A;  1S1U A;  4JKA A;  3JXU A;  3O5B A;  3HT3 A;  2KLA A;  3S3N A;  2IVP A;  4CEO A;  4JYA K;  1XUP O;  3QDK A;  4CI6 A;  2HBK A;  3AA4 A;  1BQM A;  3A5L C;  3V9W A;  2YNI A;  3H45 C;  4DTX A;  4FJ9 A;  2KZZ A;  1EXQ A;  2D0B A;  4JLH A;  3I33 A;  4CF1 A;  4YDU A;  2BUP A;  3THX B;  2NUB A;  1BUP A;  4ILG B;  1Z05 A;  1HYS A;  3C6H A;  4CW7 B;  3SAF A;  4ISG A;  3E9P A;  1ZBL A;  4QOZ B;  4WE1 A;  2BE2 A;  2G8V A;  4IOX A;  3QEP A;  3KWI A;  3QLH A;  2HOE A;  4B9L A;  5EVZ A;  1NGH A;  1BDG A;  3VQQ A;  2W42 A;  3THW A;  1CLQ A;  3NMU A;  3OYH A;  1KAZ A;  4H0V B;  2ZJQ L;  3MCP A;  4DV5 K;  3NGI A;  4BWM A;  1IKY A;  1ZYQ A;  1T7P A;  3J80 O;  4CIG A;  2VWJ A;  4DV3 K;  1CXQ A;  2P9K B;  2A6A A;  4UY8 O;  4FL9 A;  2ZD1 A;  5I3U A;  4BRN A;  4BG8 A;  3O9U A;  4DQS A;  4A59 A;  2FF3 B;  3O4Q A;  3KKR A;  3V9Z A;  3T1A A;  1WSE A;  1N5Y A;  3P31 A;  2YV0 X;  4MQ3 A;  1U45 A;  4CFC A;  4OLA A;  4W5N A;  3CM6 A;  4CEA A;  2OPP A;  3WQU A;  3E01 A;  2Z1I A;  1SKS A;  3QES A;  3IFR A;  3RRH A; 
#chains in the Genus database with same CATH homology
 3WNG A;  4CED A;  1HYV A;  2XY5 A;  1HQU A;  1X9M A;  1I3A A;  2KQ2 A;  5FDL A;  3EZ5 A;  3QIP A;  1VSF A;  4FW2 A;  3C94 A;  1UOC A;  3O3F A;  1VSJ A;  4CFB A;  3LPU A;  4FJN A;  4JRQ A;  2E4L A;  4DSJ A;  3K57 A;  3UIQ A;  4NCA A;  4CFA A;  1VSL A;  1HQE A;  3OYN A;  3KD5 E;  3RMB A;  3V1R A;  5HLF A;  4OKE A;  1RDC A;  3TAF A;  4C8L A;  3ZT4 A;  1WLJ A;  3M8P A;  3TAM A;  4HVJ A;  4B8A B;  4M3U A;  2XY6 A;  4W5O A;  1Z26 A;  1RTJ A;  4JRP A;  4DMN A;  5J2P A;  4J2D A;  4M3Y A;  3HYF A;  1JLF A;  3DOL A;  1ASV A;  3AA5 X;  3ISN C;  2Y1J A;  1RBR A;  4W5T A;  2GBZ A;  3HP6 A;  3AV9 A;  3L3V A;  4NYN A;  4KHN A;  1D8Y A;  4AHR A;  4E7K A;  4AHC A;  4CEC A;  4E19 A;  1LAV A;  4OPK A;  4EZ6 A;  3EYZ A;  4Z4C A;  1LWE A;  4CJP A;  1NJZ A;  3DLH A;  1TKZ A;  2YNG A;  1QE1 A;  3VQ6 A;  3F9K A;  1BHL A;  1UA1 A;  4CGF A;  1SL2 A;  4FJ5 A;  1L3V A;  1G15 A;  3V9U A;  4LH4 A;  1TK5 A;  2A1R A;  1RTD A;  1S1V A;  2VG7 A;  3V6D A;  2R7Y A;  3VQ5 A;  4F4K A;  1A5V A;  4B9V A;  4Z4G A;  3RMD A;  4CFD A;  4FZZ A;  3IG1 A;  3HK2 A;  2OZM A;  4CGG A;  1ZBU A;  2I5J A;  1QSS A;  1GOC A;  3OS1 A;  3AO2 A;  1NK9 A;  1ITG A;  3LZJ A;  3L2U A;  1IH7 A;  1RT3 A;  5HRP A;  4IFV A;  3LZI A;  4ELV A;  3QER A;  1SL1 A;  5K14 A;  4CJ3 A;  1B9F A;  3M8R A;  3F73 A;  4FK2 A;  4CJR A;  3MEE A;  4FJM A;  3CM5 A;  4AH9 A;  3SYZ A;  3S3M A;  4FK4 A;  3TAB A;  2FBX A;  1QSY A;  4BE0 A;  3KIO A;  4IBN A;  4KV8 A;  3NF9 A;  4YFU A;  1U48 A;  1BGX T;  1S6Q A;  2RF2 A;  1S5J A;  4CES A;  4M3W A;  2GV9 A;  4KFB A;  2Z1G A;  4DLE A;  4W5Q A;  2AJQ A;  1IKX A;  1HNV A;  3EY1 A;  3LAN A;  3V4I A;  1RT2 A;  3QEX A;  1LV5 A;  3OVN A;  4UQG A;  4IKF A;  1WSG A;  4KO0 A;  4EP5 A;  2X78 A;  4IG3 A;  4RW6 A;  4BAC A;  1NKC A;  1FKP A;  4Q0B A;  4CJ5 A;  3U3Y A;  4J2A A;  2JLE A;  3DYA A;  1RBV A;  4BE2 A;  3LP2 A;  3P83 D;  3TAG A;  3IAY A;  2HHW A;  5E41 A;  2HVH A;  3HP9 A;  4E3S A;  1RBS A;  3NGZ A;  4F3O A;  2E6L A;  4M3Z A;  3NH0 A;  3VQ4 A;  3OY9 A;  2X6S A;  4CF2 A;  3C6T A;  3LP1 A;  3TAQ A;  2KTQ A;  1A5X A;  2XHB A;  1BL3 A;  3ALY A;  1BIU A;  1J53 A;  1WSF A;  4C8K A;  4I9Q A;  1ZBH A;  3NH1 A;  3MEC A;  4N56 A;  1B9D A;  1C1C A;  3C95 A;  4O0I A;  4LY7 A;  5C42 A;  3TAR A;  2O4G A;  1HRH A;  1UAX A;  3D0P A;  1WAF A;  3THV A;  4RW4 A;  4CF9 A;  1ZBI A;  1WAJ A;  1TV6 A;  4CF0 A;  4YNQ A;  1IKW A;  2HB5 A;  3MAQ A;  5FRO A;  1XI1 A;  4FXD A;  3HPG A;  4CGI A;  1U4B A;  1KCF A;  3K2P A;  4CJF A;  4I7F A;  3OYA A;  2PZS A;  5HP1 A;  1A5W A;  2RPI A;  4DTJ A;  3CFP A;  4BE1 A;  4DFK A;  1R0A A;  4JS5 A;  1J5O A;  2P5G A;  4FW1 A;  3IRX A;  3OYC A;  3AVC A;  1VSH A;  1TKX A;  4Z0U A;  4DU4 A;  2OYQ A;  1YVU A;  2D5R A;  1REV A;  1C0M A;  1DLO A;  1VSM A;  2ETJ A;  3SJJ A;  4RW7 A;  4H4O A;  1XHZ A;  1C0T A;  4F3T A;  3BDP A;  2IS3 A;  4DWI A;  4LD0 A;  3DLG A;  2XRI A;  4FK0 A;  2YNF A;  1KVB A;  3ZSR A;  4O44 A;  5CZ1 A;  3AVL A;  3AVM A;  4CGH A;  4CHZ A;  3OS0 A;  3QNN A;  1KTQ A;  2HHQ A;  3LP3 A;  4I2P A;  5DK5 A;  3KLI A;  4E7L A;  4KHY A;  2G8U A;  2F96 A;  2IOC A;  3ZSX A;  3SQ1 A;  3VA0 A;  1L3T A;  4FLY A;  1SV5 A;  3OYE A;  4CK1 A;  3L2R A;  4Y1D A;  3ITH A;  4OGE A;  3H08 A;  1NJW A;  1GOA A;  1BI4 B;  1LAW A;  5KI6 A;  3RRG A;  3ZSW A;  4FLW A;  3PY8 A;  3TAE A;  4ICL A;  4O5B A;  1RT7 A;  4CHQ A;  3L3U A;  3C6U A;  3VQA A;  3CFR A;  3DLR A;  4FJK A;  2EX3 A;  3I0S A;  1HNI A;  4CK3 A;  3OYK A;  3OYJ A;  1TL1 A;  1L5U A;  1U47 A;  4FJ8 A;  3RTV A;  3OYD A;  3KK3 A;  2HNZ A;  4CHN A;  1KLN A;  4R5P A;  4KRF A;  1K6Y A;  3HVT A;  3I0R A;  4MFB A;  5C25 A;  3TR8 A;  3NE6 A;  3K5M A;  1BIZ A;  2YKN A;  2HMI A;  3SUN A;  3DLE A;  3ZT0 A;  4KAZ A;  2BGG A;  1CZ9 A;  2ZE2 A;  4DF8 A;  1LW2 A;  1C1B A;  4E1N A;  2PYL A;  3SQ0 A;  4OKK A;  4I2Q A;  2E6M A;  5JS2 A;  1XC9 A;  1RBU A;  2QXF A;  3P1G A;  1S6P A;  5J1E A;  3T3F A;  4FJL A;  1VSD A;  4J2E A;  4B08 A;  5FRM A;  3G0Z A;  4FLX A;  1QS4 A;  3B6O A;  3TAN A;  4B3O A;  3VQ7 A;  3AVF A;  1X9S A;  1TAU A;  2DFE A;  3NF6 A;  3ZSZ A;  2RN2 A;  4FVM A;  1IKV A;  5HRR A;  1NKB A;  4N76 A;  3HO1 A;  4DTS A;  2VWK A;  2YKM A;  4QCL A;  4E89 A;  4EZ9 A;  1WNS A;  2OPS A;  1QSL A;  4J2B A;  3ZCM A;  4E0D A;  3HJF A;  4OGC A;  1DTQ A;  1Z25 A;  4DU1 A;  4CJL A;  3VQC A;  3NF8 A;  1JKH A;  4OJR A;  3K5N A;  4ZTJ A;  1B92 A;  4CHO A;  2OPR A;  4DQI A;  4E7J A;  1DTT A;  5T7B A;  1SUQ A;  3NGY A;  3O3H A;  3AO1 A;  2P5O A;  4KB1 A;  3TI0 A;  2B4J A;  4DS4 A;  1RTI A;  1CZB A;  4KTW A;  3K59 A;  3LDS A;  4DLG A;  3JYT A;  3MXM A;  1HYZ A;  4FJI A;  3HL8 A;  3LAM A;  4DTN A;  1UWB A;  1TL3 A;  4CJS A;  3HM9 A;  2XY7 A;  5I42 A;  3LWL A;  1TKT A;  1NK6 A;  2P51 A;  3AVN A;  3M8Q A;  5SZT A;  4M3X A;  2WOM A;  1J54 A;  2HW3 A;  1QTM A;  2G8H A;  1D5A A;  1JL2 A;  1HPZ A;  1UA0 A;  3PO5 A;  2IGI A;  4K8X A;  3V1Q A;  3LWM A;  4Z4F A;  3AA3 A;  4HUE A;  1N6Q A;  3TWH A;  1QHT A;  4DSI A;  3AA2 A;  4AHT A;  4PY5 A;  4CJ4 A;  3QET A;  2DFH A;  4I9L A;  3L8B A;  2Q3S A;  1KFD A;  3OJS A;  2HVI A;  1WSI A;  1IG9 A;  3SNN A;  4FM0 A;  4BDY A;  2IDO A;  2G8W A;  4NCB A;  3NBP A;  1D9F A;  1U49 A;  4EP4 A;  4CJK A;  4HTU A;  3SI6 A;  3IS9 A;  3LAL A;  1RDD A;  3SUP A;  2D0C A;  4DTO A;  3PX6 A;  3NFA A;  4AIL C;  1KFS A;  3MXJ A;  2YHB A;  3K5O A;  3DI6 A;  1NK7 A;  3SPY A;  4CEF A;  3CYM A;  2OA8 A;  3FFI A;  2P1J A;  1HJR A;  3AVK A;  1Q9Y A;  2HND A;  3PUF A;  3HST B;  4DS5 A;  1YT3 A;  1KRP A;  5KGX A;  5FRN A;  4CHP A;  4CJE A;  2VG6 A;  4OLB A;  1FKO A;  3OYF A;  3HXM A;  4DU3 A;  1HMV A;  5JS1 A;  4FLT A;  2GUI A;  4CJU A;  4CJT A;  4Q5V A;  3V81 A;  1VRU A;  1W9H A;  1RT4 A;  2OPQ A;  2HHU A;  1WSH A;  4F8R A;  4HUG A;  3A2F A;  3KKS A;  4DFM A;  1RCH A;  5HBM A;  3T19 A;  4CJV A;  3WNF A;  3QIO A;  4B8C A;  4CK2 A;  4DTR A;  1X9W A;  4CEQ A;  2RKI A;  2KW4 A;  3V1O A;  3V9S A;  4KI6 A;  3WNE A;  3RR7 A;  2ITG A;  3K58 A;  3VN5 A;  1RNH A;  4O55 A;  2DFF A;  1JL1 A;  1EKE A;  4CIE A;  3L2Q A;  1YTA A;  1LWC A;  3AVI A;  4DG1 A;  1EET A;  1S1W A;  3SUQ A;  3S3O A;  3RWU A;  4KHW A;  2LSN A;  3KTQ A;  4OKJ A;  2B5J A;  4PA1 A;  5CY4 A;  5KRS A;  3P5J A;  4Z4H A;  2QK9 A;  4CER A;  3SQ4 A;  4DTU A;  4FLU A;  3U3G A;  3KLE A;  3AO4 A;  4NCG A;  4CGJ A;  3RR8 A;  4Z4I A;  2HHX A;  2X74 A;  3ZSQ A;  5D3G A;  3OYM A;  4CJW A;  3AO5 A;  4N47 A;  4FCY A;  3RMC A;  4ELU A;  3K5L A;  4DF4 A;  1L3S A;  4GMJ B;  1F21 A;  1RBT A;  3DRS A;  4IG0 A;  3DLK A;  3KK2 A;  5HRN A;  4DSE A;  4DTP A;  3ZT2 A;  4LSL A;  1TAQ A;  2F8S A;  2KFZ A;  4KTZ A;  4RW9 A;  1TVR A;  4B9T A;  3SQ2 A;  3SV3 A;  1KVC A;  3U6F A;  3KLF A;  4FJG A;  1BQN A;  2HHS A;  4HUF A;  1W0H A;  1NK0 A;  1JLB A;  5C24 A;  4FJH A;  2Z1H A;  1JLG A;  1O1W A;  1VSI A;  4LH5 A;  1XHX A;  1NJX A;  1KSP A;  4KI4 A;  1VK0 A;  3VQ9 A;  4DSK A;  4CEE A;  4KHU A;  3OJU A;  5DMR A;  4B9N A;  1ZBF A;  4N41 A;  1EP4 A;  5SWM A;  1S9G A;  3SCX A;  3ZT3 A;  4DQQ A;  1BCM A;  3AVJ A;  1RT6 A;  3AVB A;  3DRP A;  3S9H A;  1TK8 A;  4KB0 A;  2Y1I A;  3OYB A;  4HCC A;  1SL0 A;  1LW0 A;  1C0U A;  3NAE A;  1NJY A;  1QQC A;  1XWL A;  2YHA A;  3QEI A;  3LPT A;  5HRS A;  3SZ2 A;  4OVL A;  1JXB A;  3VA3 A;  1RT1 A;  3OYG A;  3V9X A;  3AVH A;  5CYM A;  3OS2 A;  3AVG A;  2FBV A;  1JLE A;  4B9S A;  1RDB A;  3B6P A;  1C6V A;  1RT5 A;  2IC3 A;  1BIS A;  1Q8I A;  3G10 A;  3WNH A;  3VQD A;  3KLH A;  4E7H A;  3QNO A;  3DM2 A;  1D9D A;  1LWF A;  4GW6 A;  4B9M A;  4JS4 A;  2G8I A;  5EU7 A;  1NK8 A;  4M41 A;  1RTH A;  3ULD A;  3AO3 A;  3SV4 A;  2PY5 A;  1T05 A;  4FLZ A;  4IDK A;  1I39 A;  3KK1 A;  4RW8 A;  2FBT A;  4DQR A;  1NK5 A;  4F2S A;  3O4N A;  1SKR A;  4FYD A;  2YNH A;  3JSM A;  4G1Q A;  3ZT1 A;  1MU2 A;  3DRR A;  3TAP A;  4DFP A;  2FC0 A;  1VSK A;  1JLQ A;  1KLM A;  4C8N A;  2BDP A;  4C8O A;  3HPH A;  4CGD A;  4FJ7 A;  2O4I A;  1CXU A;  2X6N A;  5CYQ A;  4F2R A;  4ELT A;  4LSN A;  5CZ2 A;  4DSL A;  3RMA A;  2B6A A;  4CIF A;  4HCB A;  1J9A A;  4CEZ A;  3AVA A;  4M42 A;  2F8T A;  4H4M A;  4L8R B;  4M3R A;  4DQP A;  3HVR A;  4TSX A;  2XO7 A;  3VQB A;  2Z1J A;  1S1U A;  2HNY A;  2QKK A;  2XY8 A;  5HRO A;  2ATQ A;  2HHT A;  1X1P A;  4BWJ A;  3NHG A;  4IFY A;  4KKO A;  3MED A;  1BCO A;  3L2V A;  3HT3 A;  4W5R A;  3OYL A;  3S3N A;  3PX0 A;  3L2W A;  5KRT A;  1S1T A;  1Q9X A;  4KHS A;  1VSE A;  2HHV A;  4CEO A;  2KFN A;  3NCI A;  3I8D A;  4CJQ A;  4DTM A;  4KHQ A;  4ID5 A;  4OPJ A;  2QKB A;  4O0J A;  2G8F A;  4CCH A;  4ZTF A;  4KTQ A;  1JLC A;  3KD1 E;  1S9E A;  4AHS A;  1JXE A;  3AA4 A;  4CHY A;  4N5S A;  1BQM A;  3KLG A;  4Y1C A;  4KRE A;  3V9W A;  2YNI A;  4DTX A;  2OZS A;  1RDA A;  4FJ9 A;  3QO9 A;  2KZZ A;  1EXQ A;  3DOK A;  2D0A A;  1NOZ A;  2D0B A;  3SUO A;  4JLH A;  3LP0 A;  1VRT A;  4CF1 A;  2VG5 A;  4O4G A;  4K8Z A;  4ID1 A;  1TGO A;  4HHT A;  2FBY A;  3O3G A;  1TK0 A;  3PO4 A;  2NUB A;  4H8K A;  1GOB A;  4GVM A;  2ZQB A;  1HYS A;  4BDZ A;  1NKE A;  4M3T A;  4FLV A;  1RIL A;  3NH2 A;  5J2M A;  4Z4E A;  1ZBL A;  4NYF A;  4FZY A;  4WE1 A;  4CE9 A;  4QOZ B;  2BE2 A;  3OYI A;  3QEP A;  3SPZ A;  2G8V A;  1WN7 A;  3NDK A;  1YTU A;  4QAG A;  1T8E A;  1WSJ A;  2G8K A;  3QLH A;  4KPY A;  5KGW A;  4B9L A;  4FZX C;  3DMJ A;  3CG7 A;  1CLQ A;  3MEG A;  3VQQ A;  2W42 A;  3CQ8 A;  4PWD A;  3BGR A;  3OYH A;  4FM2 A;  4CEB A;  4FJJ A;  3D45 A;  4ZHR A;  3ZSV A;  5J2N A;  3NGI A;  3VQP A;  2A1S A;  3VQ8 A;  4BWM A;  3QEV A;  1IKY A;  2DY4 A;  1ZYQ A;  3NF7 A;  1T7P A;  3CFO A;  3PV8 A;  4FM1 A;  1NOY A;  3QIN A;  1BI4 A;  4CIG A;  1SKW A;  3VQE A;  2VWJ A;  4M45 A;  1CXQ A;  4B9U A;  4AHV A;  2DTU A;  1FK9 A;  1ASU A;  3M8S A;  5KTQ A;  4RG8 A;  4E1M A;  1T03 A;  1KVA A;  1ASW A;  4AHU A;  3ASM A;  1TKD A;  4PQU A;  2ZD1 A;  5I3U A;  3QEW A;  1C1A A;  1FXX A;  1JLA A;  1EX4 A;  4DQS A;  1IO2 A;  4C8M A;  4FJX A;  2BAN A;  3ZSY A;  4DSF A;  2PYJ A;  3O4Q A;  1NK4 A;  2IAJ A;  2JGU A;  3KKR A;  3V9Z A;  4BDP A;  3T1A A;  1WSE A;  1U04 A;  1N5Y A;  3PX4 A;  4DFJ A;  2YV0 X;  2WON A;  4MQ3 A;  4CFC A;  1U45 A;  4OLA A;  4W5N A;  3CM6 A;  4CEA A;  3MXI A;  4XIU A;  1L3U A;  3ZSO A;  2OPP A;  3KJV A;  1S1X A;  4CF8 A;  3E01 A;  4E7I A;  1Y97 A;  5J2Q A;  2Z1I A;  3HPO A;  3LAK A;  2KZM A;  3DLB A;  1SKS A;  2EHG A;  3QES A;  4PUO A;  3RRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...