4CIGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cigA00
1KVBA 1RBVA 4CGIA 4JRQA 1KCFA 4DTUA 3S3NA 1D9FA 2HHXA 1KSPA 5FRMA 4KTZA 1G15A 1TKTA 1SKSA 2HW3A 2VG5A 4CESA 4HTUA 3NF8A 2YNHA 4AHRA 1NK5A 1A5VA 3CM5A 4O0JA 2RKIA 1REVA 3OYMA 1J5OA 3AVBA 3CFPA 3CG7A 4G1QA 4B9VA 1A5XA 3I0RA 4CJTA 4E89A 4UQGA 1IO2A 3S3OA 1JXEA 1RTJA 4E1NA 4ZTJA 4M3UA 3DMJA 3RMDA 4M3ZA 4DLGA 3AA4A 3ZSRA 1X9WA 1RNHA 4M3YA 1TL3A 1T8EA 3HP9A 4Q5VA 1L3TA 3AVGA 4CF9A 1WSJA 3NBPA 3PX0A 4KRFA 4KPYA 2KQ2A 1KVCA 4FJ9A 4IG0A 1CLQA 4DTOA 2R7YA 1RBUA 4FLXA 4CJ4A 1RDBA 2XY6A 5DK5A 3G0ZA 4KO0A 1BIUA 1C1CA 3ITHA 4CEQA 4DU3A 3ZSYA 4IKFA 3LAMA 3NE6A 3LALA 5J2PA 1X9SA 3RMBA 1NK6A 3OS2A 3V9SA 1HPZA 3BGRA 1JL1A 3L8BA 4DFJA 3TAEA 1NJXA 4F4KA 1NJWA 1VRUA 2FBTA 4N47A 1KTQA 4FCYA 1VSKA 3AVKA 4FLZA 3AVIA 4I9LA 4CGHA 3OJUA 1ZBFA 4FLWA 1IKYA 4KHQA 4Z0UA 1QHTA 1C0MA 3KLHA 5J2MA 2HHWA 3L2WA 3LANA 4M3WA 1I3AA 3QIOA 3ULDA 3TAFA 3S9HA 3TR8A 3OYEA 4LH5A 3K5MA 3NAEA 3I0SA 3BDPA 4C8LA 1I39A 4FJGA 2Y1IA 1VSLA 5CY4A 5EU7A 3LZJA 4ELVA 4M3XA 1SL0A 5HBMA 4E19A 1C1BA 3NF9A 4BE2A 1YT3A 2E6MA 2P51A 2YKNA 5T7BA 3EYZA 1RDAA 3SUNA 2G8UA 3DLRA 3FFIA 3OVNA 3VQ8A 3K5LA 5KGWA 4DSFA 4FK0A 3NF7A 3HT3A 3VQ5A 1C6VA 4EZ9A 3OYBA 1CXQA 2A1SA 4CK1A 1RT1A 3O4NA 2EHGA 4B9MA 2D0AA 3EY1A 3AVCA 2IOCA 3V4IA 1JLFA 3CYMA 4BWJA 4E1MA 4DSEA 1XHZA 5D3GA 4B3OA 4L8RB 3QINA 4QAGA 1UOCA 3V1OA 1ZYQA 1F21A 3VA3A 2P5GA 2D0BA 4E7LA 3PV8A 4CERA 2BDPA 3AVJA 4C8NA 5JS2A 3NGIA 3HSTB 3WNGA 1SKWA 1A5WA 1RTIA 1KRPA 2G8FA 3OS0A 2DFHA 4N56A 1TK8A 4PQUA 3LAKA 1JLGA 4FYDA 1KFDA 3MEEA 4DTXA 2W42A 4FLTA 4CJEA 4CEZA 4FZYA 3OYKA 3VQ9A 3C94A 1BQNA 3DOLA 1RCHA 4CEBA 4CHPA 5KTQA 1GOBA 3KLEA 4DTRA 4CGJA 3HL8A 1NKBA 3MEGA 1QSLA 4DSLA 1TAQA 1QQCA 3ZT2A 3SQ0A 1N6QA 1WAJA 3KKSA 3KK2A 4DFKA 2XO7A 4ZHRA 2QKKA 4DS5A 2F96A 4B8AB 1L3VA 5J2NA 1RTDA 4E7KA 1IKVA 3VQ4A 5HROA 3OYAA 1LW2A 5HLFA 1U4BA 1SKRA 1WNSA 4CFAA 4C8KA 4B9UA 4DS4A 3HPHA 3HXMA 4CEFA 3ZT4A 1X1PA 4LY7A 4RW7A 4IFVA 2Z1GA 3F73A 1J9AA 1TK0A 3T3FA 3RR8A 1ASWA 4KI6A 4CF2A 3P1GA 4CJKA 3C6TA 3O3HA 1D5AA 1B92A 4KHWA 2D0CA 4IG3A 1U04A 1ITGA 2FC0A 3V9XA 1BQMA 1WSGA 2XY8A 3NH1A 1KLNA 4ID5A 4LH4A 4RW9A 2FBXA 4YNQA 2YHAA 4DFMA 3V6DA 5KGXA 4N76A 1VRTA 4FJXA 3M8SA 3QLHA 4PA1A 3U3GA 3WNFA 1RT6A 5SZTA 3KK1A 4Z4GA 4HCBA 3NDKA 3QIPA 4JS5A 2XY5A 2ETJA 3V1RA 5I42A 1QS4A 3HM9A 2XRIA 3RRHA 1TKDA 4NYNA 4W5OA 1RTHA 2HVHA 3SZ2A 3NH2A 2OPPA 3TAGA 1VSIA 4ELUA 4OPJA 1ZBUA 4KHYA 1WLJA 2HHSA 3ZSVA 1VSDA 1VSEA 4NYFA 3L2UA 3AA3A 4DMNA 3NHGA 1QTMA 2GBZA 3DM2A 3HJFA 4CF0A 3ZT3A 3LPTA 3ZT0A 4NCAA 1RBSA 3CM6A 4DTJA 3V9UA 2BGGA 1VK0A 3V9ZA 5CZ1A 4DWIA 1B9DA 4W5QA 2KZMA 3VQPA 3VQDA 3TAMA 4AHSA 1RT7A 4NCGA 3V81A 3L3UA 3HK2A 4CJRA 1Q9YA 2KTQA 3C95A 1RILA 2G8HA 5C24A 1VSHA 3OYJA 1NK7A 2YNGA 3SQ4A 4DQRA 1JXBA 2BANA 5HRRA 3A2FA 3AO2A 4CJVA 5HRPA 1NK8A 4CF8A 4F2RA 2HHTA 2GV9A 1U48A 4BWMA 4DF4A 3PO5A 1S6PA 2RF2A 4EP4A 1S1XA 4EP5A 3OYFA 4Y1DA 3IG1A 1ZBLA 5I3UA 2GUIA 2KFZA 2G8KA 4N41A 3VA0A 5FRNA 4CIFA 2JGUA 2ZQBA 4B9TA 1WAFA 1S9EA 2XHBA 3KKRA 3NGYA 4GW6A 1XWLA 2P1JA 3AVNA 4B08A 4PUOA 3AVFA 3VQ6A 1VSJA 3O3GA 3EZ5A 2OZMA 4FJ7A 4CEDA 1W9HA 4LSNA 3DLHA 1DLOA 1NOZA 1JLAA 1HQUA 3DLEA 3LP3A 3OYNA 4CJWA 2Z1JA 1JKHA 3DOKA 4DTSA 1FKOA 1LV5A 4FJHA 4CJSA 3KJVA 1UWBA 4FM1A 3TAPA 4M45A 1ZBHA 3LWLA 3HVRA 1EX4A 4O5BA 1DTQA 2Z1IA 1D9DA 3VQ7A 1ASUA 1XHXA 4CFBA 5SWMA 4DLEA 1NOYA 1NJYA 1HJRA 4BE0A 1NK4A 2O4IA 5DMRA 1R0AA 2G8VA 4QCLA 2FBVA 4RW6A 1HNIA 5FROA 1SUQA 2X6SA 3OS1A 4OLBA 4FK4A 3ZSOA 1U47A 5KRSA 2HVIA 3TARA 3D45A 4ID1A 3MXMA 1TK5A 2OA8A 3QERA 3AVAA 3PX6A 4OGEA 3SYZA 3DLBA 3QNNA 3RWUA 1QSSA 2BE2A 4CEEA 4GMJB 1S6QA 3ISNC 3VN5A 4CEAA 1BHLA 4DTMA 1B9FA 4CJPA 3RMCA 2YKMA 4DU4A 1WSHA 2WONA 3WNHA 1NK9A 2HHQA 1U45A 4JLHA 2B6AA 4CIEA 3TWHA 2X6NA 1QSYA 3ZCMA 1C0UA 4R5PA 4J2EA 4F8RA 3IS9A 4IBNA 3AVMA 1WSIA 4B9LA 1RDDA 1BI4B 1HRHA 1VSMA 4DG1A 1SV5A 1FKPA 1D8YA 1YTAA 2YNFA 2OPSA 3VQQA 4FJ5A 4J2DA 2B4JA 4IFYA 3SI6A 4OGCA 4AHTA 3VQAA 4M42A 2DFEA 4HUEA 2HB5A 3AO5A 3KK3A 3KLFA 4CEOA 3PX4A 2F8TA 3DLKA 3NGZA 3AV9A 3SPYA 4RG8A 3ZSQA 3NCIA 4H8KA 3C6UA 3OYIA 4E7JA 2KZZA 4FJ8A 3SUPA 4MFBA 3RRGA 4OLAA 3NH0A 3QEXA 4OKEA 3P5JA 4CHZA 1QE1A 3OYLA 3SV3A 4O55A 3U3YA 1XI1A 3SUOA 4DTNA 4FZXC 3LWMA 1WSEA 1Y97A 1ZBIA 3RMAA 1HQEA 3JSMA 4PY5A 4KKOA 3L2VA 2Q3SA 4CECA 4M3TA 1NK0A 2QXFA 1Z26A 3QEWA 3AO3A 3PY8A 1LWEA 1S5JA 3MXJA 5KRTA 4CJUA 1S1TA 1U49A 1HNVA 4RW8A 4FLVA 3K5NA 4KHUA 3DYAA 3T1AA 3SPZA 5KI6A 4CHOA 1L3UA 3SUQA 4K8XA 1BCOA 4O4GA 4OPKA 2LSNA 3E01A 3AO4A 2OZSA 4KB1A 4CGGA 4YFUA 3TABA 4W5TA 3LZIA 5C42A 3K57A 2P5OA 2VG7A 3KIOA 3K2PA 3QNOA 4AHVA 4CCHA 2ATQA 5JS1A 3SCXA 1J53A 3JYTA 1HYZA 4LSLA 4DFPA 4I7FA 1VSFA 2KW4A 3TANA 4HUGA 3L2QA 3CQ8A 3NF6A 3KD5E 3K5OA 3MXIA 4H4OA 4DSKA 1JLBA 1LAVA 1TKZA 1WSFA 2YHBA 4C8OA 3AA2A 4J2BA 4CIGA 1BCMA 1L5UA 3DI6A 3OY9A 1RDCA 1GOAA 2FBYA 2IAJA 4FK2A 5C25A 4CFCA 3HYFA 1W0HA 2ZD1A 1LWCA 3ZSXA 2RPIA 1MU2A 1RT3A 2Z1HA 4H4MA 4KV8A 4MQ3A 5CYMA 4CHYA 4CHNA 3K58A 4I2QA 4E7HA 3QO9A 3KD1E 3D0PA 3OYCA 4OVLA 1KFSA 2A1RA 3O3FA 3V9WA 3P83D 2WOMA 1JLCA 2XY7A 4CJ5A 1RT4A 1S1UA 2YV0X 3S3MA 4BDZA 1S9GA 4AILC 1C1AA 1RBRA 3LP1A 5K14A 1XC9A 4B9SA 1TKXA 1LWFA 3B6PA 3OYHA 3AVHA 3RR7A 1KVAA 4FJLA 5FDLA 3PO4A 1HYVA 2VG6A 4DSIA 2HMIA 4KB0A 3O4QA 4FM2A 4Z4HA 1IG9A 4OKJA 3DRSA 4F2SA 4NCBA 4Z4FA 4O44A 4B9NA 1IKXA 2PY5A 4CF1A 4FVMA 2ZE2A 1Q8IA 1CZBA 1T7PA 3F9KA 3U6FA 4AHCA 4HUFA 1EETA 5CZ2A 4O0IA 2IDOA 3MAQA 4E7IA 4EZ6A 1DTTA 1TV6A 3HVTA 4CE9A 4DQSA 4FJMA 4GVMA 4K8ZA 3SNNA 3THVA 4CJLA 2QKBA 2AJQA 4HCCA 2JLEA 3QEPA 4WE1A 4Z4CA 4CJQA 2X78A 4N5SA 2OPQA 3TAQA 4CK2A 3KLGA 1BI4A 5HRSA 1Q9XA 3H08A 4AHUA 1IH7A 3ALYA 4LD0A 4CJ3A 4KTQA 1YTUA 1FXXA 2D5RA 1BGXT 2IC3A 1LW0A 3VQEA 4DTPA 2HNYA 4BACA 2G8WA 1CZ9A 2PYJA 1UAXA 3ZT1A 4B8CA 4CFDA 1ASVA 4Y1CA 3VQBA 4J2AA 5HRNA 2HNDA 1SL1A 4BE1A 4IDKA 2F8SA 4ICLA 1TGOA 4XIUA 1FK9A 3B6OA 1RT2A 1S1WA 1EXQA 2RN2A 2VWJA 4BDYA 2NUBA 3WNEA 4PWDA 4FLUA 1JL2A 1JLQA 3LP0A 4KHNA 2Y1JA 4DQPA 2I5JA 4DU1A 1EKEA 1K6YA 2OPRA 3MECA 4C8MA 4FZZA 4ZTFA 2DTUA 4JRPA 3ASMA 4F3OA 1X9MA 3L3VA 1GOCA 3L2RA 4W5NA 2YNIA 3HPOA 1BIZA 3OJSA 1T05A 5J2QA 2G8IA 2E4LA 4JS4A 4M3RA 1BL3A 3LDSA 3AO1A 4DQQA 1BISA 2IS3A 1JLEA 4Q0BA 4FW1A 2HNZA 1TVRA 3SJJA 1RBTA 3V1QA 3I8DA 4KFBA 3M8PA 1CXUA 4KHSA 3G10A 1NKEA 4M41A 1S1VA 3QESA 4FW2A 3LP2A 3K59A 3KTQA 4FJNA 1TAUA 3HP6A 4FJIA 1J54A 2ITGA 3T19A 3NFAA 4AH9A 5E41A 4KREA 5CYQA 3QETA 3DLGA 1C0TA 1UA0A 1N5YA 2EX3A 4CK3A 1SL2A 2HHUA 3SQ2A 4FLYA 3DRRA 1HYSA 3M8RA 1HMVA 4HVJA 4KAZA 3ZSWA 3CFOA 3SQ1A 2B5JA 1RT5A 4OJRA 4OKKA 3QEVA 4E3SA 1T03A 3HPGA 4FM0A 3TI0A 1NKCA 4BDPA 4Z4IA 4DQIA 2HHVA 4W5RA 3LPUA 3SV4A 4KTWA 4I9QA 3CFRA 3AVLA 3UIQA 3ZSZA 4FXDA 3IAYA 4CJFA 3PUFA 3AA5X 2OYQA 2IGIA 4QOZB 4DSJA 1L3SA 3IRXA 3OYGA 4TSXA 1IKWA 3QEIA 4Z4EA 3MEDA 4KI4A 4F3TA 1O1WA 2E6LA 2O4GA 3M8QA 4CGDA 4CGFA 5J1EA 3OYDA 2PYLA 2PZSA 3DRPA 1TL1A 1Z25A 1NJZA 2QK9A 3VQCA 2DY4A 1EP4A 2VWKA 1KLMA 4DF8A 3HO1A 4FJKA 4ELTA 4E0DA 5HP1A 4FJJA 3RTVA 4RW4A 1LAWA 3KLIA 4CHQA 1WN7A 4HHTA 2KFNA 1UA1A 2X74A 1YVUA 4I2PA 2DFFA
chains in the Genus database with same CATH superfamily
1RBVA 3NVKA 1KCFA 4BG9A 4HTUA 3NF8A 4AHRA 4BRHA 2RKIA 5C0YA 1J5OA 4UY8O 3AVBA 1R59O 4BRGA 4CJTA 5AQNA 4E89A 5KQ8A 4UQGA 1RTJA 4DLGA 3ZSRA 1TL3A 1W7AA 1QHAA 4IDHA 4DV6K 5KQDA 4PKIA 5BR8K 4FWOA 1CLQA 2R7YA 4FLXA 4WFNL 2XY6A 3G0ZA 4KO0A 3ITHA 1MWMA 2P9UA 1NGCA 5AZJB 3CJ9A 4DFJA 1VRUA 3IKMA 2V52B 1VSKA 3AVKA 4FLWA 1HNZK 1YXQA 3S9HA 4YHHK 5AFUA 2FSJA 3J8AA 4FJGA 1VSLA 4RWTA 3LZJA 4ELVA 1NGBA 5HBMA 4A61A 4E19A 3BUZB 2P51A 4B1XB 4GKJK 3OVNA 3MN7A 3NF7A 1BG3A 1CXQA 3J81O 1RT1A 2NRZA 2EHGA 3O4NA 4RTFD 2D0AA 5MLCQ 1XQSC 3O8MA 3EY1A 3AVCA 2IOCA 1XHZA 4E1MA 2CH6A 4L8RB 3V1OA 3PV8A 1Z05A 3AVJA 4C8NA 5JS2A 3NGIA 4EFHA 1SKWA 1A5WA 2IIRA 4H0OA 3OS0A 3LAKA 4JAXA 4PKGA 4H5VA 1RCHA 1GOBA 3KLEA 1N6QA 3KKSA 4FWMA 2IVNA 1YI2N 3MN6A 3OHRA 2QKKA 4BRMA 2O8DA 2F96A 4B8AB 1L3VA 4E7KA 5HROA 3OYAA 1LW2A 3IFRA 4JHDB 3HPHA 1KC8O 3TPQA 3CERA 1J9AA 3T3FA 3O3HA 4CJKA 3IDHA 4KHWA 2FC0A 4GV3A 4O5FA 1KLNA 2CGJA 2KLAA 4N76A 4FJXA 2QEXN 4M7XA 4XH5A 5SZTA 2WTUA 1K9MO 1K73O 4JS5A 1HNWK 5AZIA 2Q0UA 4IO8A 2XRIA 4YOXA 4W5OA 2A42A 1RTHA 3U9ZA 4ELUA 1VSIA 3O4WA 4DR2K 4DMNA 2OTLN 2GBZA 2P9PA 2E1YA 1NBWA 3TSUA 3VQDA 1MA9B 5AQPA 1RT7A 4JK7A 3HK2A 1Q9YA 2KTQA 2G8HA 1VQ8N 3OYJA 1VSHA 2YNGA 3WXLA 4B1UB 5AFUH 2W6KA 2ITMA 4BWMA 1S6PA 2RF2A 1GLBG 4EP4A 5IWAK 3A5NC 2E2OA 1ZBLA 1ATNA 2A41A 2ZQBA 2P9IA 2O8CA 3KKRA 3NGYA 1XWLA 2P1JA 2OANA 3AVNA 4LF4K 3SK3A 5BN8A 1W9HA 1HQUA 2Z1JA 1HUXA 3CI5A 1FKOA 3TAPA 3HVRA 4O5BA 5TKWA 3FZHA 4XH4A 1D9DA 1VQ6N 2O8FA 5SWMA 3E1YA 1IG8A 3SLCA 1WB9A 3CCVN 1K8KB 2VGMA 1JJ2M 2NRTA 3TTDA 3TARA 1K8AO 3D45A 3MXMA 1TK5A 1KAYA 4A5BA 3SYZA 3DLBA 4CEEA 3I56N 3ISNC 3VN5A 4CI6A 4DU4A 2HHQA 4JLHA 1C0UA 4R5PA 4F8RA 4JI3K 2ASPA 2GUPA 3ZETA 4DV0K 1NM1A 4IFYA 3SI6A 4OGCA 4JK9A 3AO5A 5BPNA 3KLFA 4CEOA 3PX4A 3NGZA 3AV9A 1Y64A 4RG8A 3ZSQA 3NCIA 4H8KA 2P9NA 3C6UA 4ISGA 4LFAK 4JKAA 2HBKA 3RRGA 4JKFA 5M1PA 3NH0A 4OLAA 3SV3A 1XI1A 3CCEN 1Y97A 1ZBIA 3E66A 1HQEA 2PFUA 3JSMA 3FZLA 4KKOA 2Q3SA 1NK0A 3EEQA 4A57A 3O1BA 3PY8A 3MXJA 5KRTA 1IBMK 3AY9A 4FLVA 3DYAA 3T1AA 4CHOA 3SUQA 1BCOA 2YHYA 2E2QA 3E01A 1Z6RA 4KB1A 5LL6Z 4CGGA 4BRCA 4W5TA 3LZIA 2A5XA 2VG7A 4AHVA 1S72N 5JS1A 1N36K 5EX5A 2HBJA 4LSLA 2QWRA 4DFPA 4I7FA 3U9DA 4IWVA 1HKBA 4HUGA 3L2QA 3K5OA 3RSEA 1JLBA 5LJVA 4J2BA 4CIGA 3DI6A 1KAXA 2BH1A 5M1QA 2IAJA 3M6GA 4CJ7A 3R9PA 1BA1A 2ZD1A 3CJBA 4CZKA 5CYMA 3DJCA 4JD2A 4CHYA 4I2QA 3CMAN 2A1RA 2P9SA 2XY7A 1QQOA 5JMVA 5K14A 3U4LA 4IXCA 3RR7A 3OYHA 4FJLA 5FDLA 4KB0A 2HMIA 4NCBA 4Z4HA 1VQON 4OKJA 1IG9A 4O44A 1IKXA 2PY5A 4CF1A 3K9JA 5HL7L 1HR0K 5C12A 2E1ZA 3A5OC 4BREA 1NGGA 4EZ6A 1DTTA 1W97L 1XMQK 2P9KA 2AJQA 2JLEA 4WE1A 4Z4CA 4V19S 4N5SA 2OPQA 4AHUA 1IH7A 5DM6L 4FWNA 1YTUA 2D5RA 2IC3A 4XEIA 4BACA 2G8WA 1ZXOA 3ZT1A 3ENBA 3VQBA 4J2AA 1SL1A 5BREA 5FLXO 4K25A 4K8XA 2CH5A 2NUBA 3WNEA 3MWTA 3VEVA 3TSQA 4KHNA 3FGUA 3LP0A 4YORA 1EKEA 1YITN 3CJCA 4ZTFA 2DTUA 5JICA 1OKJA 1GOCA 5J2QA 2E4LA 2NLXA 1BL3A 4DQQA 2IS3A 4YOTA 4Q0BA 4JEPA 2HNZA 1TVRA 3SJJA 5F1XA 3OBWA 3V1QA 2E5LK 3M8PA 4BGBA 1CXUA 1O13A 2ASOA 3NFAA 4KREA 3VESA 3DLGA 1C0TA 3QETA 2HHUA 3SQ2A 2ZF5O 4FLYA 1HYSA 1HMVA 3GG4A 3T69A 4CZHA 3ZSWA 2QW9A 4BR0A 3SQ1A 4DV3K 2B5JA 4OKKA 4B3RK 2W41A 3HPGA 3TI0A 3DXKB 3LPUA 3SV4A 4FXDA 4PL8A 2IGIA 5KPZA 4DSJA 2VGNA 1L3SA 3OYGA 3P4IA 2O4GA 4JKGA 4CGFA 4IO9L 1NJZA 3L4QA 1EP4A 3EE9A 3HO1A 4FJKA 1WN7A 5EXWA 3J80O 2DFFA 2UXDK 3VF2A 4JRQA 3E9LA 4CZFA 4DTUA 3S3NA 3PIPL 1KSPA 4KTZA 1G15A 1TKTA 2E2PA 3UKUB 1SKSA 5LMUK 2VG5A 4CESA 1A5VA 5BRHA 1REVA 3OYMA 3CFPA 3CG7A 1LCUA 4G1QA 3I0RA 2YX6A 4B3TK 4K42A 3FZFA 1JXEA 3M3ZA 3S3OA 4YDUC 4M3UA 3D2FB 1JCGA 1V4TA 2OCEA 1RNHA 4M3YA 3ENOA 4IEEA 3HP9A 1L3TA 3AVGA 1WSJA 1KVCA 1D4XA 3G4SN 1NGAA 3K9KA 3HSCA 3IUCA 4CJ4A 3HOTA 1RDBA 5DK5A 4DU3A 4CEQA 3MDQA 1Q81O 4IKFA 3T1HK 3RMBA 4KH5A 3L8BA 4DV2K 3TAEA 4EHUA 5LMNK 1GLAG 2FBTA 4N47A 4I9LA 4CGHA 4BY9C 4Z0UA 1C0MA 4C1NK 2HHWA 2UUBK 1S22A 4M3WA 1I3AA 3EN9A 3TR8A 3NAEA 2Q0RA 3I0SA 1VQ4N 2CGKA 3VEWA 4O8KA 3AARA 4U67L 2E6MA 3SUNA 4DSFA 3VENA 3CIPA 3VQ5A 4B3SK 4EZ9A 1XNQK 1KAZA 4CK1A 2O8CB 3CCSN 4B9MA 1ZC6A 4CBUA 3OW2M 4DSEA 4BWJA 1N8RO 4DR1K 4A2AA 4B3OA 3KZBA 1UOCA 3VMFB 3THYA 1ZYQA 1F21A 3VA3A 2P5GA 4E7LA 4I6MA 1SQKA 3G71N 3HSTB 3WNGA 1BWFO 1VHXA 3AAQA 4N56A 4PQUA 3D7EO 2ZJQL 2O8FB 1KFDA 3MEEA 2W42A 4BRKA 4CJEA 2VCPA 4FZYA 4WQ5C 4JV5K 3UB5A 3H45C 3HL8A 4H5TA 4PL7A 4FVUA 4ILHA 3SQ0A 1WAJA 1ILYA 2XO7A 4DV5K 4B3MK 1IKVA 3VQ4A 3VF6A 4DUYK 3D2EB 4IEIA 4C8KA 2VQFK 4B9UA 4DS4A 1NLVA 3HXMA 4BG8A 4BR4A 4CEFA 3CJ1A 3ZT4A 1X1PA 3F73A 4IFVA 2Z1GA 3RR8A 3ZETB 4KI6A 1DEJA 3P1GA 1B92A 3U8XA 4IG3A 1BQMA 4BRLA 1QVGM 4LH4A 4RW9A 4WQ5A 5AQXA 4IZ9A 3N4QA 3M8SA 3QLHA 3QDKA 4Z4GA 3AGRA 2Q97A 4KBOA 5KPTA 4X65K 2ETJA 1T44A 1QS4A 1VQLN 3DXMA 4NYNA 1TKDA 2HHHK 3HOSA 2OPPA 3MN9A 1OVQA 4YOWA 3AA3A 3HJFA 3ZT0A 3ULEB 1RBSA 3CM6A 5C2FA 3V9UA 2BGGA 4DWIA 4BRIA 4AHSA 1KD1O 3L3UA 4CJRA 3C95A 4JN4A 5AQFA 3VTHA 4DV1K 3KK7A 1DGKN 3WXIA 3AO2A 3G25A 4CF8A 3SAFA 2ZJPL 1JCFA 3PSFA 4Y1DA 3OYFA 1IBLK 3LDOA 4JI1K 1HKCA 5I3UA 2GUIA 2UXBK 5IT9O 3CC7N 3VA0A 5FRNA 4OX9K 1FJGK 3VGKA 4CZMA 1J6ZA 4BQZA 1BA0A 3VQ6A 4IJNA 1NGEA 4FJ7A 4CEDA 3LDLA 3DLEA 3OYNA 4CJWA 4FJHA 4M45A 3LWLA 1EX4A 1SZ2A 3SBTA 2IVPA 2Z1IA 2YI1A 5AR0A 1ASUA 4CZGA 4CFBA 5GIOA 2HF4A 4DLEA 2FXUA 1HJRA 1NK4A 2O4IA 4MLEA 3VETA 1R0AA 4RW6A 5BRFA 3C7NB 3EL2A 1U47A 3FZMA 3LM2A 2WFBA 3QFUA 4ILJA 3THWA 4JYAK 3AVAA 4O8UA 1VQ5N 3QNNA 2BE2A 4CEAA 1LOTB 4CJPA 2YKMA 1WSHA 2WONA 3WNHA 1RDWX 4CD1A 5JVHL 4MO5A 1VQPN 4J2EA 4DR5K 1RDDA 4B9LA 1HRHA 1E4FT 3CCRN 1SV5A 1FKPA 5AQWA 1GLCG 5AJ3K 1NMDA 3VQAA 3GL1A 3MX2A 3KK3A 3CJ7A 3VEYA 3SPYA 5EOYA 2V7ZA 4MFBA 5BN9A 4OKEA 5AQRA 3P5JA 4CHZA 3OYLA 4CD3A 4DTNA 4FZXC 4MDAA 2HBMA 2P9LB 3L2VA 4DUZK 2QXFA 3BZKA 3THXA 4H0YB 2WUSA 5CR4A 1YJNN 1NGDA 2RHKA 1HNVA 4RW8A 4BRDA 4KHUA 4JI8K 5KI6A 2KHOA 4OPKA 1W2BM 5EY4A 5C42A 3P38A 3K2PA 3QNOA 4CCHA 4K0KK 2PAVA 3JYTA 2HBLA 1HYZA 2ZM6K 3HRGA 3CQ8A 4IOXA 3MXIA 4H4OA 3Q7CA 2YHBA 4HTLA 3OY9A 1BDGA 4H5NA 1LWCA 2RPIA 2Z1HA 4MQ3A 5EVZA 3EO3A 2O8BA 4OVLA 1KFSA 3V9WA 3CETA 4OO1J 3P83D 3WEEA 1C0FA 1JLCA 3R6MA 1RT4A 3UKRB 2YV0X 4CJ5A 4FWQA 1C1AA 1TKXA 1LWFA 2Q1NA 3FLCO 3H3NO 1KVAA 1HYVA 4DSIA 4FM2A 4PKHA 4B9NA 4Z94A 1T7PA 3F9KA 5AQQA 3U6FA 4HUFA 4JI7K 1EETA 4O0IA 2O8EA 3MCPA 3BP8A 1TV6A 4FJMA 2E2NA 4DQSA 4GVMA 3SNNA 5FPNA 4CJLA 4HCCA 5E26A 2F9TA 3QEPA 3ZX3A 1RDUA 1T6DA 3H08A 1RGIA 4KTQA 1FXXA 2HNYA 4B8CA 1ASVA 1NU0A 2UXCK 2HNDA 2F8SA 3AAPA 2YHWA 4BDYA 4PWDA 5CE3A 4MDBA 1EWQA 2UYTA 2V7YA 1K6YA 3MECA 1WOQA 5GAEP 5AQKA 1YVNA 4A2BA 2E8AA 1NMNA 3ZX0A 2I7NA 3ZEUB 4FWRA 3LDSA 1JLEA 4FW1A 1OVYA 3I8DA 4KFBA 4U7BA 2CGLA 3G10A 3O9SA 3VEXA 1TYQB 3K59A 1HX1A 3KTQA 1TAUA 2ITGA 4H0TB 3T19A 4AH9A 3ATVA 2UUAK 3KHYA 3PSIA 5GINA 3PLAA 4CK3A 1SL2A 3CCLN 4HVJA 3OA9A 1T03A 1MWKA 4FM0A 4Z4IA 4DQIA 4NB4A 4G9ZA 4BC5A 4KTWA 5AQHA 3AVLA 3ZSZA 1U2VB 4BGAA 3HTVA 4CVNE 1GLFO 1O1WA 3OYDA 2PZSA 3DRPA 1TL1A 3H1VX 2QK9A 3VQCA 2DY4A 2VWKA 4BR9A 3H6EA 4WCEL 4E0DA 3RTVA 3MCAB 2KFNA 2FSNA 1UA1A 5KGXA 3KVGA 1KVBA 4CGIA 1D9FA 1NNEA 5DM7L 4BRQA 2YNHA 1NK5A 3NVMA 3OBYA 4LF7K 4NLBA 2Q36A 5GAHP 2NZTA 1HNXK 4B9VA 5AZJA 4ZTJA 3VEOA 5BRDA 2KKZA 4M3ZA 3QMLA 4Q5VA 5FPEA 4CF9A 3PX0A 2I7PA 4M63C 1X3NA 4IG0A 4FJ9A 4LF8K 5I9EB 1C1CA 1VQNN 4RCHA 3LALA 5J2PA 1QZ5A 3V9SA 4ISEA 3BGRA 1NJXA 4F4KA 3A0IX 4YOYA 3CCQN 2EWSA 1NGJA 3OJUA 1ZBFA 2DPNA 4BC4A 3KLHA 1QVFM 3QIOA 3TAFA 3OYEA 3K5MA 4JI0K 4C8LA 1V4SA 5CY4A 4M3XA 1BOTO 1SL0A 2HSTA 3BY5A 1C1BA 3NF9A 1YT3A 2P9UB 1RDAA 2G8UA 2WBNA 1ATRA 3DLRA 3FFIA 3VQ8A 4BROA 4DKWA 4H0PA 3MN5A 3E9PA 3CMEN 2HF3A 3CD6N 3WXKA 3V4IA 2QWNA 3A5LC 3QINA 3EKUA 5JLFA 2D0BA 1VQ9N 2HMPA 2GELA 2GWKA 2FF6A 4JHDA 5M1FA 2G8FA 1TK8A 3ZYYX 5JVGL 1YF5L 1JLGA 4QS8A 4LF9K 1OH7A 4FLTA 3OYKA 4QS7A 3DOLA 1BQNA 1NGIA 5KTQA 4DTRA 1NKBA 4A62A 3MEGA 1QSLA 3OTOK 3KK2A 4DFKA 3THWB 4ZHRA 4DS5A 1EWRA 5J2NA 4JI6K 2JWKA 1SKRA 2W40A 4DQ8A 4OPHA 4FOIA 1M90O 3HI0A 1TUUA 1ATSA 4AM6A 4LY7A 4GV9A 1ASWA 4CF2A 3C6TA 5ADXA 1D5AA 3V9XA 3NH1A 3C6HA 3VERA 4ID5A 4A59A 4DFMA 2YHAA 3V6DA 4F9OA 3KWIA 4YOUA 4PA1A 1RT6A 3NDKA 1JCEA 2XY5A 2O8DB 1T3VA 3V1RA 3T1YK 3RRHA 3SAHA 3J7ZO 2HVHA 4KH6A 3NH2A 3TAGA 4OPJA 1Q7YO 1WLJA 3ZSVA 5F2RA 4NYFA 3L2UA 3NHGA 1QTMA 1BUPA 4CF0A 4OPAA 2QXLA 4NCAA 4DTJA 1VK0A 3V9ZA 5AQUA 1B9DA 2NRVA 2KZMA 2NRWA 3TAMA 3V81A 5BR9A 1NK7A 5AZIB 3SQ4A 2BANA 4CJVA 5HRPA 3A2FA 2HHTA 5C15A 4DF4A 3PO5A 1C0GA 4EP5A 3IG1A 3ZX2A 1HKGA 3MWPA 2P9PB 4BR7A 2G8KA 1K8KA 2JGUA 1WAFA 3O9UA 1T6CA 4B08A 4PUOA 3AVFA 2D4WA 3JS6A 3O3GA 3EZ5A 4DR7K 4DCHA 3HBTA 3DLHA 3LP3A 3WUHA 4Y0WA 4PHTX 3DOKA 4B9QA 1LV5A 3Q7BA 2J4RA 1UWBA 1ZBHA 2W6LA 4GY2B 5TKYA 4FWPA 3VQ7A 3C6AA 2QWLA 1NOYA 2G8VA 4QCLA 1SS6A 2FBVA 1HNIA 2E20A 3OS1A 3ZSOA 3QFPA 3SMSA 2P9IB 5KRSA 4FWLA 2HVIA 4ID1A 3QERA 1P90A 3QB0A 4NXNK 4OGEA 5AQMA 3RWUA 2O8EB 1S6QA 1XC3A 4DTMA 3WQTA 3C65A 2JWLA 2A6AA 3L0QA 2B6AA 3RVCA 4CIEA 3O9QA 2X6NA 3BZCA 3ZCMA 4IBNA 3AVMA 1VSMA 1D8YA 1YTAA 2YNFA 4XH1A 4DR3K 4FL9A 2B4JA 4DR4K 2FF3B 5ADXH 3BF1A 4M42A 2OTJN 4K43A 5BPLA 2QWMA 4BVPA 2BUPA 5GIPA 4E7JA 4B1ZA 3QEXA 3U3YA 4C1NI 3CPWM 3A5MC 4JKEA 3SUOA 2ZJRL 1WSEA 1NGHA 4BVOA 5AQSA 3AO3A 1LWEA 3HZ6A 1S5JA 4CJUA 1S1TA 1U49A 2QA4N 2NRHA 1L3UA 4O4GA 1GLLO 2P9NB 2QWOA 3AO4A 3O80A 4YFUA 4H0XB 4LFBK 2P5OA 4BQLA 4YOVA 4HWIA 3TANA 3NF6A 1NJIO 4DSKA 1LAVA 1TKZA 1WSFA 4EIAA 3AA2A 4BR5A 1BCMA 2ZGZA 2FBYA 3H46O 2YCHA 4CFCA 3HYFA 3W3DA 3ZSXA 4H4MA 1MU2A 1RT3A 3WXMB 5B8HA 4CHNA 3ID8A 2QTDA 4E7HA 3F9MA 3QO9A 3D0PA 3LDQA 2WOMA 2BTFA 3HM8A 1S1UA 3S3MA 5JLHA 3CC4N 4AILC 1RBRA 1XC9A 4B9SA 2VWBA 3BF3A 3B6PA 1OH5A 3AVHA 1WBBA 3PO4A 4X66K 1ESVA 3RSEB 4Z4FA 4F2SA 2QI2A 1SAZA 3QBWA 4FVMA 1Q8IA 2ZE2A 3BEXA 5AQOA 1EO1A 4AHCA 2RE2A 3MAQA 4JD2B 1HPMA 2QKBA 3O5BA 2P9SB 4JNEA 4CJQA 1QQNA 2ZGYA 4CK2A 1BI4A 4FSVA 1E3MA 5HRSA 4LD0A 3ALYA 3JXUA 3SBGA 1BGXT 4CW7B 4DR6K 1LW0A 3VQEA 5GAGP 1CZ9A 4BC2A 1GLJO 4JKDA 5HRNA 4BE1A 1TGOA 3A8YA 1FK9A 3B6OA 1RT2A 1S1WA 1EXQA 2RN2A 4FWKA 2VWJA 4B1WB 1Q86O 2GWJA 3T7ZA 1HLUA 1U6ZA 1QQMA 2P9KB 5FPDA 4WYBA 3L3VA 3L2RA 2YHXA 3AGKA 1VQMN 4CZLA 4C23A 2G8IA 4JS4A 4M3RA 4JI4K 3AO1A 4FPBA 3DXKA 4IOAL 4GVEA 3H1QA 4KHSA 4M41A 2A40A 3LP2A 4FJNA 4FJIA 5E41A 5CYQA 1UA0A 1DKGD 3S41A 5AQGA 3SMPA 3IMXA 2VQEK 4L3QA 4E3SA 1YUWA 4BDPA 3CPEA 4GNIA 4I9QA 3UKUA 3UIQA 4QS9A 4LF6K 3PUFA 1GLEG 3IRXA 3R3LA 4TSXA 1IKWA 3MEDA 4KI4A 4F3TA 4FJ5A 4CGDA 5J1EA 2PYLA 4AQYK 1Z25A 3J7YP 3D2FA 3I8BA 1KLMA 3QBXA 3FE1A 4ELTA 4FJJA 4RW4A 1LAWA 3KLIA 4CHQA 2X74A 4I2PA 2A3ZA 2HHXA 5FRMA 2AA4A 4JK8A 2HW3A 3H3OB 3ZLJA 3CM5A 4O0JA 4NXMK 3I33A 1A5XA 4JKGB 4MLHA 5KPRA 3WXJA 2WC9A 3F5TA 3O08A 1IO2A 4E1NA 3DMJA 4IFEA 2QWPA 3RMDA 3AA4A 1X9WA 2ZWHA 2IVOA 1T8EA 1VQ7N 3NBPA 4KRFA 4KPYA 2KQ2A 3MX5A 3P31A 4DTOA 5AQVA 1RBUA 2H3GX 1BIUA 3CQXA 3ZSYA 3M5RA 3LAMA 3NE6A 1X9SA 3LDNA 4DV4K 1NK6A 4IJAA 3OS2A 1HPZA 1JL1A 1NJWA 1IJJA 1KTQA 4FCYA 4FO0A 3EZWA 4FWSA 3AVIA 4FLZA 3GBTA 1IKYA 4KHQA 4BRPA 1QHTA 3CXCM 5J2MA 2E88A 3L2WA 3LANA 3ULDA 4LH5A 1MDUB 3BDPA 3O9RA 1I39A 2Y1IA 5EU7A 4LFCK 5A2QO 3ID6A 4BE2A 2YKNA 5T7BA 5M1OA 4X64K 3EYZA 1IBKK 3K5LA 3DAWA 4FK0A 5KGWA 3HT3A 1C6VA 3OYBA 2A1SA 3D6RA 3SJHA 1S3XA 1JLFA 3CYMA 5D3GA 2HOEA 3CQYA 4EHTA 4YY3K 2GTDA 4QAGA 3C0BA 3KWGA 3D2EA 1VAZA 3J7AP 4FOEA 3O1WA 4CERA 2BDPA 2QWQA 1CZAN 4IOCL 5AQIA 1YJWN 1RTIA 1M1KO 1KRPA 2DFHA 4FYDA 4DTXA 4CEZA 4JKHA 3VQ9A 3C94A 4CEBA 4CHPA 1YHQN 4CGJA 4DSLA 1TAQA 1QQCA 3ZT2A 3GDQA 2PBDA 3MMVA 1KXPA 5AQZA 3THYB 1RTDA 5HLFA 2QM1A 4I6MB 1U4BA 1WNSA 4CFAA 1BO5O 4AF1A 1TK0A 4RW7A 5FPMA 3ULEA 2D0CA 1U04A 1ITGA 1WSGA 2XY8A 3R8EA 2FBXA 4YNQA 1OH8A 1VRTA 3U3GA 3WNFA 3KK1A 4HCBA 2VYPA 5HOOA 3CC2N 3QIPA 3P39A 3O9TA 3R1XA 1NG9A 5I42A 3HM9A 2NRXA 2YJFA 5E84A 3SZ2A 1E4GT 4KHYA 1ZBUA 2HHSA 1VSDA 1VSEA 4M7YA 3FR0A 3DM2A 3CCMN 3ZT3A 3LPTA 1XNRK 2D0OA 5M1NA 4CBWA 5CZ1A 1YIJN 4W5QA 1HJOA 3VOVA 3VQPA 4NCGA 2V51B 1RILA 4CBXA 3TTCA 5GADP 4CZEA 5C24A 3F2KA 4DQRA 1JXBA 5HRRA 4F2RA 1NK8A 2GV9A 1U48A 3DXMB 5LJWA 1S1XA 3G6EN 1GLDG 2KFZA 4N41A 3C7NA 4CIFA 4B9TA 1S9EA 2XHBA 4GW6A 3L6QA 3PIOL 1Q82O 3UE5A 3NMUA 1VSJA 4BRFA 3VEZA 2OZMA 4LSNA 1DLOA 1NOZA 1N34K 1JLAA 1H1VA 1JKHA 4R79A 4DTSA 4H0VB 4CJSA 3KJVA 4FM1A 4GKKK 4BR2A 1DTQA 2F9WA 1XHXA 1I94K 1NJYA 4BE0A 3N4PA 5DMRA 4K41A 1G99A 5FROA 1NGFA 1SUQA 2X6SA 4OLBA 4FK4A 2UUCK 2OA8A 3PX6A 2F4VK 3CHWA 5AQYA 1NWKA 1QSSA 3MK6A 4GMJB 3ENHA 1BHLA 1B9FA 1NK9A 3RMCA 1U45A 3ATUA 3TWHA 3WQUA 1QSYA 1QZ6A 2P9LA 3IS9A 1WSIA 1BI4B 3O6WA 4A5AA 4DG1A 2OPSA 3VQQA 4J2DA 3VTIA 4AHTA 1Q18A 1TUYA 2DFEA 2HB5A 4DHYA 4HUEA 5AQJA 2F8TA 3DLKA 4GV6A 5LY3A 2KZZA 3OYIA 1YJ9N 4FJ8A 3SUPA 3TU5A 3JAMO 3B8AX 3WT0A 1WUAA 4CZIA 1QE1A 1VQKN 4O55A 3LWMA 2D1KA 3RMAA 4PY5A 4CECA 3LM9A 4M3TA 3QEWA 1Z26A 1KQSM 4DB3A 5ELZA 3M1FA 4H03B 4WFBL 3K5NA 4JKBA 3SPZA 2LSNA 1FW6A 2OZSA 3TABA 3LDPA 1BU6O 3K57A 3KIOA 3FZKA 4MO4A 4ISFA 2ATQA 3UKRA 3SCXA 1J53A 2D0PA 4DV7K 1VSFA 2KW4A 3KD5E 2Q2RA 3THXB 2F7TA 5AQTA 4C8OA 4LC9B 1L5UA 1WBDA 3DLLL 1RDCA 1GOAA 3CCJN 4FK2A 5C25A 1W0HA 4B1VA 4KV8A 3VGLA 2YJEA 3K58A 4BC3A 4BRAA 3KD1E 3OYCA 3O3FA 4NO7A 1RFQA 3VF4A 2Q31A 5H1SQ 4AM7A 1S9GA 3GOIA 3LP1A 4E1JA 4BDZA 3DWLA 2NNWA 3CJAA 2VG6A 3O4QA 3DRSA 4LF5K 4NLCA 1EQYA 1CZBA 2FSKA 5M1KA 4CZJA 3LL3A 5CZ2A 2IDOA 4E7IA 3HVTA 4CE9A 4K8ZA 3THVA 4WQ4C 2O8BB 3WEEB 1X9JA 5CHIA 2X78A 3TAQA 1N32K 4B1YB 3KLGA 1Q9XA 4WFAL 4H5WA 4CJ3A 1DT9A 3EE8A 4YDUA 3ZEUA 4DTPA 3SAGA 3GE1A 2PYJA 1UAXA 4CFDA 4Y1CA 3TTFA 4IDKA 2AP1A 4ICLA 4XIUA 2ASMA 4JI5K 4EAHD 1TYQA 1X3MA 1IV0A 4FLUA 1JL2A 1JLQA 4KHPK 2Y1JA 4DQPA 2I5JA 3EKSA 4BRNA 4DU1A 4WQ4A 2OPRA 4C8MA 3E9OA 4FZZA 4WF9L 4JRPA 3ASMA 4F3OA 1X9MA 4X62K 4KH4A 4W5NA 2YNIA 3HPOA 1BIZA 3OJSA 1T05A 3CCUN 1N33K 3FFKB 1BISA 3VPZA 1YAGA 1RBTA 1U2VA 4FPAA 1NKEA 1S1VA 3QESA 4FW2A 3HP6A 1J54A 1J5EK 4JKCA 1OH6A 1ZBSA 4J8FA 1N5YA 2EX3A 4JI2K 3W0LA 5BPMA 3DRRA 3M8RA 3VGMA 3CF5L 1P8ZA 4KAZA 4ILGB 3CFOA 5C10A 1RT5A 4OJRA 3QEVA 1XUPO 2GX9A 1NKCA 2UU9K 3I55N 2HHVA 4W5RA 4H5RA 3L4IA 3CFRA 3IAYA 4CJFA 3QICA 3AA5X 2OYQA 4QOZB 5C2DA 4Z4EA 3QEIA 2GEMA 2E6LA 3M8QA 2FLOA 5F0XA 3K0SA 4DF8A 2NRRA 5AQLA 5HP1A 4HHTA 1XMOK 1YVUA 3TSPA
chains in the Genus database with same CATH topology
1KVBA 1RBVA 4CGIA 4JRQA 1KCFA 4DTUA 3S3NA 1D9FA 2HHXA 1KSPA 5FRMA 4KTZA 1G15A 1TKTA 1SKSA 2HW3A 2VG5A 4CESA 4HTUA 3NF8A 2YNHA 4AHRA 1NK5A 1A5VA 3CM5A 4O0JA 2RKIA 1REVA 3OYMA 1J5OA 3AVBA 3CFPA 3CG7A 4G1QA 4B9VA 1A5XA 3I0RA 4CJTA 4E89A 4UQGA 1IO2A 3S3OA 1JXEA 1RTJA 4E1NA 4ZTJA 4M3UA 3DMJA 3RMDA 4M3ZA 4DLGA 3AA4A 3ZSRA 1X9WA 1RNHA 4M3YA 1TL3A 1T8EA 3HP9A 4Q5VA 1L3TA 3AVGA 4CF9A 1WSJA 3NBPA 3PX0A 4KRFA 4KPYA 2KQ2A 1KVCA 4FJ9A 4IG0A 1CLQA 4DTOA 2R7YA 1RBUA 4FLXA 4CJ4A 1RDBA 2XY6A 5DK5A 3G0ZA 4KO0A 1BIUA 1C1CA 3ITHA 4CEQA 4DU3A 3ZSYA 4IKFA 3LAMA 3NE6A 3LALA 5J2PA 1X9SA 3RMBA 1NK6A 3OS2A 3V9SA 1HPZA 3BGRA 1JL1A 3L8BA 4DFJA 3TAEA 1NJXA 4F4KA 1NJWA 1VRUA 2FBTA 4N47A 1KTQA 4FCYA 1VSKA 3AVKA 4FLZA 3AVIA 4I9LA 4CGHA 3OJUA 1ZBFA 4FLWA 1IKYA 4KHQA 4Z0UA 1QHTA 1C0MA 3KLHA 5J2MA 2HHWA 3L2WA 3LANA 4M3WA 1I3AA 3QIOA 3ULDA 3TAFA 3S9HA 3TR8A 3OYEA 4LH5A 3K5MA 3NAEA 3I0SA 3BDPA 4C8LA 1I39A 4FJGA 2Y1IA 1VSLA 5CY4A 5EU7A 3LZJA 4ELVA 4M3XA 1SL0A 5HBMA 4E19A 1C1BA 3NF9A 4BE2A 1YT3A 2E6MA 2P51A 2YKNA 5T7BA 3EYZA 1RDAA 3SUNA 2G8UA 3DLRA 3FFIA 3OVNA 3VQ8A 3K5LA 5KGWA 4DSFA 4FK0A 3NF7A 3HT3A 3VQ5A 1C6VA 4EZ9A 3OYBA 1CXQA 2A1SA 4CK1A 1RT1A 3O4NA 2EHGA 4B9MA 2D0AA 3EY1A 3AVCA 2IOCA 3V4IA 1JLFA 3CYMA 4BWJA 4E1MA 4DSEA 1XHZA 5D3GA 4B3OA 4L8RB 3QINA 4QAGA 1UOCA 3V1OA 1ZYQA 1F21A 3VA3A 2P5GA 2D0BA 4E7LA 3PV8A 4CERA 2BDPA 3AVJA 4C8NA 5JS2A 3NGIA 3HSTB 3WNGA 1SKWA 1A5WA 1RTIA 1KRPA 2G8FA 3OS0A 2DFHA 4N56A 1TK8A 4PQUA 3LAKA 1JLGA 4FYDA 1KFDA 3MEEA 4DTXA 2W42A 4FLTA 4CJEA 4CEZA 4FZYA 3OYKA 3VQ9A 3C94A 1BQNA 3DOLA 1RCHA 4CEBA 4CHPA 5KTQA 1GOBA 3KLEA 4DTRA 4CGJA 3HL8A 1NKBA 3MEGA 1QSLA 4DSLA 1TAQA 1QQCA 3ZT2A 3SQ0A 1N6QA 1WAJA 3KKSA 3KK2A 4DFKA 2XO7A 4ZHRA 2QKKA 4DS5A 2F96A 4B8AB 1L3VA 5J2NA 1RTDA 4E7KA 1IKVA 3VQ4A 5HROA 3OYAA 1LW2A 5HLFA 1U4BA 1SKRA 1WNSA 4CFAA 4C8KA 4B9UA 4DS4A 3HPHA 3HXMA 4CEFA 3ZT4A 1X1PA 4LY7A 4RW7A 4IFVA 2Z1GA 3F73A 1J9AA 1TK0A 3T3FA 3RR8A 1ASWA 4KI6A 4CF2A 3P1GA 4CJKA 3C6TA 3O3HA 1D5AA 1B92A 4KHWA 2D0CA 4IG3A 1U04A 1ITGA 2FC0A 3V9XA 1BQMA 1WSGA 2XY8A 3NH1A 1KLNA 4ID5A 4LH4A 4RW9A 2FBXA 4YNQA 2YHAA 4DFMA 3V6DA 5KGXA 4N76A 1VRTA 4FJXA 3M8SA 3QLHA 4PA1A 3U3GA 3WNFA 1RT6A 5SZTA 3KK1A 4Z4GA 4HCBA 3NDKA 3QIPA 4JS5A 2XY5A 2ETJA 3V1RA 5I42A 1QS4A 3HM9A 2XRIA 3RRHA 1TKDA 4NYNA 4W5OA 1RTHA 2HVHA 3SZ2A 3NH2A 2OPPA 3TAGA 1VSIA 4ELUA 4OPJA 1ZBUA 4KHYA 1WLJA 2HHSA 3ZSVA 1VSDA 1VSEA 4NYFA 3L2UA 3AA3A 4DMNA 3NHGA 1QTMA 2GBZA 3DM2A 3HJFA 4CF0A 3ZT3A 3LPTA 3ZT0A 4NCAA 1RBSA 3CM6A 4DTJA 3V9UA 2BGGA 1VK0A 3V9ZA 5CZ1A 4DWIA 1B9DA 4W5QA 2KZMA 3VQPA 3VQDA 3TAMA 4AHSA 1RT7A 4NCGA 3V81A 3L3UA 3HK2A 4CJRA 1Q9YA 2KTQA 3C95A 1RILA 2G8HA 5C24A 1VSHA 3OYJA 1NK7A 2YNGA 3SQ4A 4DQRA 1JXBA 2BANA 5HRRA 3A2FA 3AO2A 4CJVA 5HRPA 1NK8A 4CF8A 4F2RA 2HHTA 2GV9A 1U48A 4BWMA 4DF4A 3PO5A 1S6PA 2RF2A 4EP4A 1S1XA 4EP5A 3OYFA 4Y1DA 3IG1A 1ZBLA 5I3UA 2GUIA 2KFZA 2G8KA 4N41A 3VA0A 5FRNA 4CIFA 2JGUA 2ZQBA 4B9TA 1WAFA 1S9EA 2XHBA 3KKRA 3NGYA 4GW6A 1XWLA 2P1JA 3AVNA 4B08A 4PUOA 3AVFA 3VQ6A 1VSJA 3O3GA 3EZ5A 2OZMA 4FJ7A 4CEDA 1W9HA 4LSNA 3DLHA 1DLOA 1NOZA 1JLAA 1HQUA 3DLEA 3LP3A 3OYNA 4CJWA 2Z1JA 1JKHA 3DOKA 4DTSA 1FKOA 1LV5A 4FJHA 4CJSA 3KJVA 1UWBA 4FM1A 3TAPA 4M45A 1ZBHA 3LWLA 3HVRA 1EX4A 4O5BA 1DTQA 2Z1IA 1D9DA 3VQ7A 1ASUA 1XHXA 4CFBA 5SWMA 4DLEA 1NOYA 1NJYA 1HJRA 4BE0A 1NK4A 2O4IA 5DMRA 1R0AA 2G8VA 4QCLA 2FBVA 4RW6A 1HNIA 5FROA 1SUQA 2X6SA 3OS1A 4OLBA 4FK4A 3ZSOA 1U47A 5KRSA 2HVIA 3TARA 3D45A 4ID1A 3MXMA 1TK5A 2OA8A 3QERA 3AVAA 3PX6A 4OGEA 3SYZA 3DLBA 3QNNA 3RWUA 1QSSA 2BE2A 4CEEA 4GMJB 1S6QA 3ISNC 3VN5A 4CEAA 1BHLA 4DTMA 1B9FA 4CJPA 3RMCA 2YKMA 4DU4A 1WSHA 2WONA 3WNHA 1NK9A 2HHQA 1U45A 4JLHA 2B6AA 4CIEA 3TWHA 2X6NA 1QSYA 3ZCMA 1C0UA 4R5PA 4J2EA 4F8RA 3IS9A 4IBNA 3AVMA 1WSIA 4B9LA 1RDDA 1BI4B 1HRHA 1VSMA 4DG1A 1SV5A 1FKPA 1D8YA 1YTAA 2YNFA 2OPSA 3VQQA 4FJ5A 4J2DA 2B4JA 4IFYA 3SI6A 4OGCA 4AHTA 3VQAA 4M42A 2DFEA 4HUEA 2HB5A 3AO5A 3KK3A 3KLFA 4CEOA 3PX4A 2F8TA 3DLKA 3NGZA 3AV9A 3SPYA 4RG8A 3ZSQA 3NCIA 4H8KA 3C6UA 3OYIA 4E7JA 2KZZA 4FJ8A 3SUPA 4MFBA 3RRGA 4OLAA 3NH0A 3QEXA 4OKEA 3P5JA 4CHZA 1QE1A 3OYLA 3SV3A 4O55A 3U3YA 1XI1A 3SUOA 4DTNA 4FZXC 3LWMA 1WSEA 1Y97A 1ZBIA 3RMAA 1HQEA 3JSMA 4PY5A 4KKOA 3L2VA 2Q3SA 4CECA 4M3TA 1NK0A 2QXFA 1Z26A 3QEWA 3AO3A 3PY8A 1LWEA 1S5JA 3MXJA 5KRTA 4CJUA 1S1TA 1U49A 1HNVA 4RW8A 4FLVA 3K5NA 4KHUA 3DYAA 3T1AA 3SPZA 5KI6A 4CHOA 1L3UA 3SUQA 4K8XA 1BCOA 4O4GA 4OPKA 2LSNA 3E01A 3AO4A 2OZSA 4KB1A 4CGGA 4YFUA 3TABA 4W5TA 3LZIA 5C42A 3K57A 2P5OA 2VG7A 3KIOA 3K2PA 3QNOA 4AHVA 4CCHA 2ATQA 5JS1A 3SCXA 1J53A 3JYTA 1HYZA 4LSLA 4DFPA 4I7FA 1VSFA 2KW4A 3TANA 4HUGA 3L2QA 3CQ8A 3NF6A 3KD5E 3K5OA 3MXIA 4H4OA 4DSKA 1JLBA 1LAVA 1TKZA 1WSFA 2YHBA 4C8OA 3AA2A 4J2BA 4CIGA 1BCMA 1L5UA 3DI6A 3OY9A 1RDCA 1GOAA 2FBYA 2IAJA 4FK2A 5C25A 4CFCA 3HYFA 1W0HA 2ZD1A 1LWCA 3ZSXA 2RPIA 1MU2A 1RT3A 2Z1HA 4H4MA 4KV8A 4MQ3A 5CYMA 4CHYA 4CHNA 3K58A 4I2QA 4E7HA 3QO9A 3KD1E 3D0PA 3OYCA 4OVLA 1KFSA 2A1RA 3O3FA 3V9WA 3P83D 2WOMA 1JLCA 2XY7A 4CJ5A 1RT4A 1S1UA 2YV0X 3S3MA 4BDZA 1S9GA 4AILC 1C1AA 1RBRA 3LP1A 5K14A 1XC9A 4B9SA 1TKXA 1LWFA 3B6PA 3OYHA 3AVHA 3RR7A 1KVAA 4FJLA 5FDLA 3PO4A 1HYVA 2VG6A 4DSIA 2HMIA 4KB0A 3O4QA 4FM2A 4Z4HA 1IG9A 4OKJA 3DRSA 4F2SA 4NCBA 4Z4FA 4O44A 4B9NA 1IKXA 2PY5A 4CF1A 4FVMA 2ZE2A 1Q8IA 1CZBA 1T7PA 3F9KA 3U6FA 4AHCA 4HUFA 1EETA 5CZ2A 4O0IA 2IDOA 3MAQA 4E7IA 4EZ6A 1DTTA 1TV6A 3HVTA 4CE9A 4DQSA 4FJMA 4GVMA 4K8ZA 3SNNA 3THVA 4CJLA 2QKBA 2AJQA 4HCCA 2JLEA 3QEPA 4WE1A 4Z4CA 4CJQA 2X78A 4N5SA 2OPQA 3TAQA 4CK2A 3KLGA 1BI4A 5HRSA 1Q9XA 3H08A 4AHUA 1IH7A 3ALYA 4LD0A 4CJ3A 4KTQA 1YTUA 1FXXA 2D5RA 1BGXT 2IC3A 1LW0A 3VQEA 4DTPA 2HNYA 4BACA 2G8WA 1CZ9A 2PYJA 1UAXA 3ZT1A 4B8CA 4CFDA 1ASVA 4Y1CA 3VQBA 4J2AA 5HRNA 2HNDA 1SL1A 4BE1A 4IDKA 2F8SA 4ICLA 1TGOA 4XIUA 1FK9A 3B6OA 1RT2A 1S1WA 1EXQA 2RN2A 2VWJA 4BDYA 2NUBA 3WNEA 4PWDA 4FLUA 1JL2A 1JLQA 3LP0A 4KHNA 2Y1JA 4DQPA 2I5JA 4DU1A 1EKEA 1K6YA 2OPRA 3MECA 4C8MA 4FZZA 4ZTFA 2DTUA 4JRPA 3ASMA 4F3OA 1X9MA 3L3VA 1GOCA 3L2RA 4W5NA 2YNIA 3HPOA 1BIZA 3OJSA 1T05A 5J2QA 2G8IA 2E4LA 4JS4A 4M3RA 1BL3A 3LDSA 3AO1A 4DQQA 1BISA 2IS3A 1JLEA 4Q0BA 4FW1A 2HNZA 1TVRA 3SJJA 1RBTA 3V1QA 3I8DA 4KFBA 3M8PA 1CXUA 4KHSA 3G10A 1NKEA 4M41A 1S1VA 3QESA 4FW2A 3LP2A 3K59A 3KTQA 4FJNA 1TAUA 3HP6A 4FJIA 1J54A 2ITGA 3T19A 3NFAA 4AH9A 5E41A 4KREA 5CYQA 3QETA 3DLGA 1C0TA 1UA0A 1N5YA 2EX3A 4CK3A 1SL2A 2HHUA 3SQ2A 4FLYA 3DRRA 1HYSA 3M8RA 1HMVA 4HVJA 4KAZA 3ZSWA 3CFOA 3SQ1A 2B5JA 1RT5A 4OJRA 4OKKA 3QEVA 4E3SA 1T03A 3HPGA 4FM0A 3TI0A 1NKCA 4BDPA 4Z4IA 4DQIA 2HHVA 4W5RA 3LPUA 3SV4A 4KTWA 4I9QA 3CFRA 3AVLA 3UIQA 3ZSZA 4FXDA 3IAYA 4CJFA 3PUFA 3AA5X 2OYQA 2IGIA 4QOZB 4DSJA 1L3SA 3IRXA 3OYGA 4TSXA 1IKWA 3QEIA 4Z4EA 3MEDA 4KI4A 4F3TA 1O1WA 2E6LA 2O4GA 3M8QA 4CGDA 4CGFA 5J1EA 3OYDA 2PYLA 2PZSA 3DRPA 1TL1A 1Z25A 1NJZA 2QK9A 3VQCA 2DY4A 1EP4A 2VWKA 1KLMA 4DF8A 3HO1A 4FJKA 4ELTA 4E0DA 5HP1A 4FJJA 3RTVA 4RW4A 1LAWA 3KLIA 4CHQA 1WN7A 4HHTA 2KFNA 1UA1A 2X74A 1YVUA 4I2PA 2DFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVB A;  1RBV A;  4CGI A;  4JRQ A;  1KCF A;  4DTU A;  3S3N A;  1D9F A;  2HHX A;  1KSP A;  5FRM A;  4KTZ A;  1G15 A;  1TKT A;  1SKS A;  2HW3 A;  2VG5 A;  4CES A;  4HTU A;  3NF8 A;  2YNH A;  4AHR A;  1NK5 A;  1A5V A;  3CM5 A;  4O0J A;  2RKI A;  1REV A;  3OYM A;  1J5O A;  3AVB A;  3CFP A;  3CG7 A;  4G1Q A;  4B9V A;  1A5X A;  3I0R A;  4CJT A;  4E89 A;  4UQG A;  1IO2 A;  3S3O A;  1JXE A;  1RTJ A;  4E1N A;  4ZTJ A;  4M3U A;  3DMJ A;  3RMD A;  4M3Z A;  4DLG A;  3AA4 A;  3ZSR A;  1X9W A;  1RNH A;  4M3Y A;  1TL3 A;  1T8E A;  3HP9 A;  4Q5V A;  1L3T A;  3AVG A;  4CF9 A;  1WSJ A;  3NBP A;  3PX0 A;  4KRF A;  4KPY A;  2KQ2 A;  1KVC A;  4FJ9 A;  4IG0 A;  1CLQ A;  4DTO A;  2R7Y A;  1RBU A;  4FLX A;  4CJ4 A;  1RDB A;  2XY6 A;  5DK5 A;  3G0Z A;  4KO0 A;  1BIU A;  1C1C A;  3ITH A;  4CEQ A;  4DU3 A;  3ZSY A;  4IKF A;  3LAM A;  3NE6 A;  3LAL A;  5J2P A;  1X9S A;  3RMB A;  1NK6 A;  3OS2 A;  3V9S A;  1HPZ A;  3BGR A;  1JL1 A;  3L8B A;  4DFJ A;  3TAE A;  1NJX A;  4F4K A;  1NJW A;  1VRU A;  2FBT A;  4N47 A;  1KTQ A;  4FCY A;  1VSK A;  3AVK A;  4FLZ A;  3AVI A;  4I9L A;  4CGH A;  3OJU A;  1ZBF A;  4FLW A;  1IKY A;  4KHQ A;  4Z0U A;  1QHT A;  1C0M A;  3KLH A;  5J2M A;  2HHW A;  3L2W A;  3LAN A;  4M3W A;  1I3A A;  3QIO A;  3ULD A;  3TAF A;  3S9H A;  3TR8 A;  3OYE A;  4LH5 A;  3K5M A;  3NAE A;  3I0S A;  3BDP A;  4C8L A;  1I39 A;  4FJG A;  2Y1I A;  1VSL A;  5CY4 A;  5EU7 A;  3LZJ A;  4ELV A;  4M3X A;  1SL0 A;  5HBM A;  4E19 A;  1C1B A;  3NF9 A;  4BE2 A;  1YT3 A;  2E6M A;  2P51 A;  2YKN A;  5T7B A;  3EYZ A;  1RDA A;  3SUN A;  2G8U A;  3DLR A;  3FFI A;  3OVN A;  3VQ8 A;  3K5L A;  5KGW A;  4DSF A;  4FK0 A;  3NF7 A;  3HT3 A;  3VQ5 A;  1C6V A;  4EZ9 A;  3OYB A;  1CXQ A;  2A1S A;  4CK1 A;  1RT1 A;  3O4N A;  2EHG A;  4B9M A;  2D0A A;  3EY1 A;  3AVC A;  2IOC A;  3V4I A;  1JLF A;  3CYM A;  4BWJ A;  4E1M A;  4DSE A;  1XHZ A;  5D3G A;  4B3O A;  4L8R B;  3QIN A;  4QAG A;  1UOC A;  3V1O A;  1ZYQ A;  1F21 A;  3VA3 A;  2P5G A;  2D0B A;  4E7L A;  3PV8 A;  4CER A;  2BDP A;  3AVJ A;  4C8N A;  5JS2 A;  3NGI A;  3HST B;  3WNG A;  1SKW A;  1A5W A;  1RTI A;  1KRP A;  2G8F A;  3OS0 A;  2DFH A;  4N56 A;  1TK8 A;  4PQU A;  3LAK A;  1JLG A;  4FYD A;  1KFD A;  3MEE A;  4DTX A;  2W42 A;  4FLT A;  4CJE A;  4CEZ A;  4FZY A;  3OYK A;  3VQ9 A;  3C94 A;  1BQN A;  3DOL A;  1RCH A;  4CEB A;  4CHP A;  5KTQ A;  1GOB A;  3KLE A;  4DTR A;  4CGJ A;  3HL8 A;  1NKB A;  3MEG A;  1QSL A;  4DSL A;  1TAQ A;  1QQC A;  3ZT2 A;  3SQ0 A;  1N6Q A;  1WAJ A;  3KKS A;  3KK2 A;  4DFK A;  2XO7 A;  4ZHR A;  2QKK A;  4DS5 A;  2F96 A;  4B8A B;  1L3V A;  5J2N A;  1RTD A;  4E7K A;  1IKV A;  3VQ4 A;  5HRO A;  3OYA A;  1LW2 A;  5HLF A;  1U4B A;  1SKR A;  1WNS A;  4CFA A;  4C8K A;  4B9U A;  4DS4 A;  3HPH A;  3HXM A;  4CEF A;  3ZT4 A;  1X1P A;  4LY7 A;  4RW7 A;  4IFV A;  2Z1G A;  3F73 A;  1J9A A;  1TK0 A;  3T3F A;  3RR8 A;  1ASW A;  4KI6 A;  4CF2 A;  3P1G A;  4CJK A;  3C6T A;  3O3H A;  1D5A A;  1B92 A;  4KHW A;  2D0C A;  4IG3 A;  1U04 A;  1ITG A;  2FC0 A;  3V9X A;  1BQM A;  1WSG A;  2XY8 A;  3NH1 A;  1KLN A;  4ID5 A;  4LH4 A;  4RW9 A;  2FBX A;  4YNQ A;  2YHA A;  4DFM A;  3V6D A;  5KGX A;  4N76 A;  1VRT A;  4FJX A;  3M8S A;  3QLH A;  4PA1 A;  3U3G A;  3WNF A;  1RT6 A;  5SZT A;  3KK1 A;  4Z4G A;  4HCB A;  3NDK A;  3QIP A;  4JS5 A;  2XY5 A;  2ETJ A;  3V1R A;  5I42 A;  1QS4 A;  3HM9 A;  2XRI A;  3RRH A;  1TKD A;  4NYN A;  4W5O A;  1RTH A;  2HVH A;  3SZ2 A;  3NH2 A;  2OPP A;  3TAG A;  1VSI A;  4ELU A;  4OPJ A;  1ZBU A;  4KHY A;  1WLJ A;  2HHS A;  3ZSV A;  1VSD A;  1VSE A;  4NYF A;  3L2U A;  3AA3 A;  4DMN A;  3NHG A;  1QTM A;  2GBZ A;  3DM2 A;  3HJF A;  4CF0 A;  3ZT3 A;  3LPT A;  3ZT0 A;  4NCA A;  1RBS A;  3CM6 A;  4DTJ A;  3V9U A;  2BGG A;  1VK0 A;  3V9Z A;  5CZ1 A;  4DWI A;  1B9D A;  4W5Q A;  2KZM A;  3VQP A;  3VQD A;  3TAM A;  4AHS A;  1RT7 A;  4NCG A;  3V81 A;  3L3U A;  3HK2 A;  4CJR A;  1Q9Y A;  2KTQ A;  3C95 A;  1RIL A;  2G8H A;  5C24 A;  1VSH A;  3OYJ A;  1NK7 A;  2YNG A;  3SQ4 A;  4DQR A;  1JXB A;  2BAN A;  5HRR A;  3A2F A;  3AO2 A;  4CJV A;  5HRP A;  1NK8 A;  4CF8 A;  4F2R A;  2HHT A;  2GV9 A;  1U48 A;  4BWM A;  4DF4 A;  3PO5 A;  1S6P A;  2RF2 A;  4EP4 A;  1S1X A;  4EP5 A;  3OYF A;  4Y1D A;  3IG1 A;  1ZBL A;  5I3U A;  2GUI A;  2KFZ A;  2G8K A;  4N41 A;  3VA0 A;  5FRN A;  4CIF A;  2JGU A;  2ZQB A;  4B9T A;  1WAF A;  1S9E A;  2XHB A;  3KKR A;  3NGY A;  4GW6 A;  1XWL A;  2P1J A;  3AVN A;  4B08 A;  4PUO A;  3AVF A;  3VQ6 A;  1VSJ A;  3O3G A;  3EZ5 A;  2OZM A;  4FJ7 A;  4CED A;  1W9H A;  4LSN A;  3DLH A;  1DLO A;  1NOZ A;  1JLA A;  1HQU A;  3DLE A;  3LP3 A;  3OYN A;  4CJW A;  2Z1J A;  1JKH A;  3DOK A;  4DTS A;  1FKO A;  1LV5 A;  4FJH A;  4CJS A;  3KJV A;  1UWB A;  4FM1 A;  3TAP A;  4M45 A;  1ZBH A;  3LWL A;  3HVR A;  1EX4 A;  4O5B A;  1DTQ A;  2Z1I A;  1D9D A;  3VQ7 A;  1ASU A;  1XHX A;  4CFB A;  5SWM A;  4DLE A;  1NOY A;  1NJY A;  1HJR A;  4BE0 A;  1NK4 A;  2O4I A;  5DMR A;  1R0A A;  2G8V A;  4QCL A;  2FBV A;  4RW6 A;  1HNI A;  5FRO A;  1SUQ A;  2X6S A;  3OS1 A;  4OLB A;  4FK4 A;  3ZSO A;  1U47 A;  5KRS A;  2HVI A;  3TAR A;  3D45 A;  4ID1 A;  3MXM A;  1TK5 A;  2OA8 A;  3QER A;  3AVA A;  3PX6 A;  4OGE A;  3SYZ A;  3DLB A;  3QNN A;  3RWU A;  1QSS A;  2BE2 A;  4CEE A;  4GMJ B;  1S6Q A;  3ISN C;  3VN5 A;  4CEA A;  1BHL A;  4DTM A;  1B9F A;  4CJP A;  3RMC A;  2YKM A;  4DU4 A;  1WSH A;  2WON A;  3WNH A;  1NK9 A;  2HHQ A;  1U45 A;  4JLH A;  2B6A A;  4CIE A;  3TWH A;  2X6N A;  1QSY A;  3ZCM A;  1C0U A;  4R5P A;  4J2E A;  4F8R A;  3IS9 A;  4IBN A;  3AVM A;  1WSI A;  4B9L A;  1RDD A;  1BI4 B;  1HRH A;  1VSM A;  4DG1 A;  1SV5 A;  1FKP A;  1D8Y A;  1YTA A;  2YNF A;  2OPS A;  3VQQ A;  4FJ5 A;  4J2D A;  2B4J A;  4IFY A;  3SI6 A;  4OGC A;  4AHT A;  3VQA A;  4M42 A;  2DFE A;  4HUE A;  2HB5 A;  3AO5 A;  3KK3 A;  3KLF A;  4CEO A;  3PX4 A;  2F8T A;  3DLK A;  3NGZ A;  3AV9 A;  3SPY A;  4RG8 A;  3ZSQ A;  3NCI A;  4H8K A;  3C6U A;  3OYI A;  4E7J A;  2KZZ A;  4FJ8 A;  3SUP A;  4MFB A;  3RRG A;  4OLA A;  3NH0 A;  3QEX A;  4OKE A;  3P5J A;  4CHZ A;  1QE1 A;  3OYL A;  3SV3 A;  4O55 A;  3U3Y A;  1XI1 A;  3SUO A;  4DTN A;  4FZX C;  3LWM A;  1WSE A;  1Y97 A;  1ZBI A;  3RMA A;  1HQE A;  3JSM A;  4PY5 A;  4KKO A;  3L2V A;  2Q3S A;  4CEC A;  4M3T A;  1NK0 A;  2QXF A;  1Z26 A;  3QEW A;  3AO3 A;  3PY8 A;  1LWE A;  1S5J A;  3MXJ A;  5KRT A;  4CJU A;  1S1T A;  1U49 A;  1HNV A;  4RW8 A;  4FLV A;  3K5N A;  4KHU A;  3DYA A;  3T1A A;  3SPZ A;  5KI6 A;  4CHO A;  1L3U A;  3SUQ A;  4K8X A;  1BCO A;  4O4G A;  4OPK A;  2LSN A;  3E01 A;  3AO4 A;  2OZS A;  4KB1 A;  4CGG A;  4YFU A;  3TAB A;  4W5T A;  3LZI A;  5C42 A;  3K57 A;  2P5O A;  2VG7 A;  3KIO A;  3K2P A;  3QNO A;  4AHV A;  4CCH A;  2ATQ A;  5JS1 A;  3SCX A;  1J53 A;  3JYT A;  1HYZ A;  4LSL A;  4DFP A;  4I7F A;  1VSF A;  2KW4 A;  3TAN A;  4HUG A;  3L2Q A;  3CQ8 A;  3NF6 A;  3KD5 E;  3K5O A;  3MXI A;  4H4O A;  4DSK A;  1JLB A;  1LAV A;  1TKZ A;  1WSF A;  2YHB A;  4C8O A;  3AA2 A;  4J2B A;  4CIG A;  1BCM A;  1L5U A;  3DI6 A;  3OY9 A;  1RDC A;  1GOA A;  2FBY A;  2IAJ A;  4FK2 A;  5C25 A;  4CFC A;  3HYF A;  1W0H A;  2ZD1 A;  1LWC A;  3ZSX A;  2RPI A;  1MU2 A;  1RT3 A;  2Z1H A;  4H4M A;  4KV8 A;  4MQ3 A;  5CYM A;  4CHY A;  4CHN A;  3K58 A;  4I2Q A;  4E7H A;  3QO9 A;  3KD1 E;  3D0P A;  3OYC A;  4OVL A;  1KFS A;  2A1R A;  3O3F A;  3V9W A;  3P83 D;  2WOM A;  1JLC A;  2XY7 A;  4CJ5 A;  1RT4 A;  1S1U A;  2YV0 X;  3S3M A;  4BDZ A;  1S9G A;  4AIL C;  1C1A A;  1RBR A;  3LP1 A;  5K14 A;  1XC9 A;  4B9S A;  1TKX A;  1LWF A;  3B6P A;  3OYH A;  3AVH A;  3RR7 A;  1KVA A;  4FJL A;  5FDL A;  3PO4 A;  1HYV A;  2VG6 A;  4DSI A;  2HMI A;  4KB0 A;  3O4Q A;  4FM2 A;  4Z4H A;  1IG9 A;  4OKJ A;  3DRS A;  4F2S A;  4NCB A;  4Z4F A;  4O44 A;  4B9N A;  1IKX A;  2PY5 A;  4CF1 A;  4FVM A;  2ZE2 A;  1Q8I A;  1CZB A;  1T7P A;  3F9K A;  3U6F A;  4AHC A;  4HUF A;  1EET A;  5CZ2 A;  4O0I A;  2IDO A;  3MAQ A;  4E7I A;  4EZ6 A;  1DTT A;  1TV6 A;  3HVT A;  4CE9 A;  4DQS A;  4FJM A;  4GVM A;  4K8Z A;  3SNN A;  3THV A;  4CJL A;  2QKB A;  2AJQ A;  4HCC A;  2JLE A;  3QEP A;  4WE1 A;  4Z4C A;  4CJQ A;  2X78 A;  4N5S A;  2OPQ A;  3TAQ A;  4CK2 A;  3KLG A;  1BI4 A;  5HRS A;  1Q9X A;  3H08 A;  4AHU A;  1IH7 A;  3ALY A;  4LD0 A;  4CJ3 A;  4KTQ A;  1YTU A;  1FXX A;  2D5R A;  1BGX T;  2IC3 A;  1LW0 A;  3VQE A;  4DTP A;  2HNY A;  4BAC A;  2G8W A;  1CZ9 A;  2PYJ A;  1UAX A;  3ZT1 A;  4B8C A;  4CFD A;  1ASV A;  4Y1C A;  3VQB A;  4J2A A;  5HRN A;  2HND A;  1SL1 A;  4BE1 A;  4IDK A;  2F8S A;  4ICL A;  1TGO A;  4XIU A;  1FK9 A;  3B6O A;  1RT2 A;  1S1W A;  1EXQ A;  2RN2 A;  2VWJ A;  4BDY A;  2NUB A;  3WNE A;  4PWD A;  4FLU A;  1JL2 A;  1JLQ A;  3LP0 A;  4KHN A;  2Y1J A;  4DQP A;  2I5J A;  4DU1 A;  1EKE A;  1K6Y A;  2OPR A;  3MEC A;  4C8M A;  4FZZ A;  4ZTF A;  2DTU A;  4JRP A;  3ASM A;  4F3O A;  1X9M A;  3L3V A;  1GOC A;  3L2R A;  4W5N A;  2YNI A;  3HPO A;  1BIZ A;  3OJS A;  1T05 A;  5J2Q A;  2G8I A;  2E4L A;  4JS4 A;  4M3R A;  1BL3 A;  3LDS A;  3AO1 A;  4DQQ A;  1BIS A;  2IS3 A;  1JLE A;  4Q0B A;  4FW1 A;  2HNZ A;  1TVR A;  3SJJ A;  1RBT A;  3V1Q A;  3I8D A;  4KFB A;  3M8P A;  1CXU A;  4KHS A;  3G10 A;  1NKE A;  4M41 A;  1S1V A;  3QES A;  4FW2 A;  3LP2 A;  3K59 A;  3KTQ A;  4FJN A;  1TAU A;  3HP6 A;  4FJI A;  1J54 A;  2ITG A;  3T19 A;  3NFA A;  4AH9 A;  5E41 A;  4KRE A;  5CYQ A;  3QET A;  3DLG A;  1C0T A;  1UA0 A;  1N5Y A;  2EX3 A;  4CK3 A;  1SL2 A;  2HHU A;  3SQ2 A;  4FLY A;  3DRR A;  1HYS A;  3M8R A;  1HMV A;  4HVJ A;  4KAZ A;  3ZSW A;  3CFO A;  3SQ1 A;  2B5J A;  1RT5 A;  4OJR A;  4OKK A;  3QEV A;  4E3S A;  1T03 A;  3HPG A;  4FM0 A;  3TI0 A;  1NKC A;  4BDP A;  4Z4I A;  4DQI A;  2HHV A;  4W5R A;  3LPU A;  3SV4 A;  4KTW A;  4I9Q A;  3CFR A;  3AVL A;  3UIQ A;  3ZSZ A;  4FXD A;  3IAY A;  4CJF A;  3PUF A;  3AA5 X;  2OYQ A;  2IGI A;  4QOZ B;  4DSJ A;  1L3S A;  3IRX A;  3OYG A;  4TSX A;  1IKW A;  3QEI A;  4Z4E A;  3MED A;  4KI4 A;  4F3T A;  1O1W A;  2E6L A;  2O4G A;  3M8Q A;  4CGD A;  4CGF A;  5J1E A;  3OYD A;  2PYL A;  2PZS A;  3DRP A;  1TL1 A;  1Z25 A;  1NJZ A;  2QK9 A;  3VQC A;  2DY4 A;  1EP4 A;  2VWK A;  1KLM A;  4DF8 A;  3HO1 A;  4FJK A;  4ELT A;  4E0D A;  5HP1 A;  4FJJ A;  3RTV A;  4RW4 A;  1LAW A;  3KLI A;  4CHQ A;  1WN7 A;  4HHT A;  2KFN A;  1UA1 A;  2X74 A;  1YVU A;  4I2P A;  2DFF A; 
#chains in the Genus database with same CATH topology
 1RBV A;  3NVK A;  1KCF A;  4BG9 A;  4HTU A;  3NF8 A;  4AHR A;  4BRH A;  2RKI A;  5C0Y A;  1J5O A;  4UY8 O;  3AVB A;  1R59 O;  4BRG A;  4CJT A;  5AQN A;  4E89 A;  5KQ8 A;  4UQG A;  1RTJ A;  4DLG A;  3ZSR A;  1TL3 A;  1W7A A;  1QHA A;  4IDH A;  4DV6 K;  5KQD A;  4PKI A;  5BR8 K;  4FWO A;  1CLQ A;  2R7Y A;  4FLX A;  4WFN L;  2XY6 A;  3G0Z A;  4KO0 A;  3ITH A;  1MWM A;  2P9U A;  1NGC A;  5AZJ B;  3CJ9 A;  4DFJ A;  1VRU A;  3IKM A;  2V52 B;  1VSK A;  3AVK A;  4FLW A;  1HNZ K;  1YXQ A;  3S9H A;  4YHH K;  5AFU A;  2FSJ A;  3J8A A;  4FJG A;  1VSL A;  4RWT A;  3LZJ A;  4ELV A;  1NGB A;  5HBM A;  4A61 A;  4E19 A;  3BUZ B;  2P51 A;  4B1X B;  4GKJ K;  3OVN A;  3MN7 A;  3NF7 A;  1BG3 A;  1CXQ A;  3J81 O;  1RT1 A;  2NRZ A;  2EHG A;  3O4N A;  4RTF D;  2D0A A;  5MLC Q;  1XQS C;  3O8M A;  3EY1 A;  3AVC A;  2IOC A;  1XHZ A;  4E1M A;  2CH6 A;  4L8R B;  3V1O A;  3PV8 A;  1Z05 A;  3AVJ A;  4C8N A;  5JS2 A;  3NGI A;  4EFH A;  1SKW A;  1A5W A;  2IIR A;  4H0O A;  3OS0 A;  3LAK A;  4JAX A;  4PKG A;  4H5V A;  1RCH A;  1GOB A;  3KLE A;  1N6Q A;  3KKS A;  4FWM A;  2IVN A;  1YI2 N;  3MN6 A;  3OHR A;  2QKK A;  4BRM A;  2O8D A;  2F96 A;  4B8A B;  1L3V A;  4E7K A;  5HRO A;  3OYA A;  1LW2 A;  3IFR A;  4JHD B;  3HPH A;  1KC8 O;  3TPQ A;  3CER A;  1J9A A;  3T3F A;  3O3H A;  4CJK A;  3IDH A;  4KHW A;  2FC0 A;  4GV3 A;  4O5F A;  1KLN A;  2CGJ A;  2KLA A;  4N76 A;  4FJX A;  2QEX N;  4M7X A;  4XH5 A;  5SZT A;  2WTU A;  1K9M O;  1K73 O;  4JS5 A;  1HNW K;  5AZI A;  2Q0U A;  4IO8 A;  2XRI A;  4YOX A;  4W5O A;  2A42 A;  1RTH A;  3U9Z A;  4ELU A;  1VSI A;  3O4W A;  4DR2 K;  4DMN A;  2OTL N;  2GBZ A;  2P9P A;  2E1Y A;  1NBW A;  3TSU A;  3VQD A;  1MA9 B;  5AQP A;  1RT7 A;  4JK7 A;  3HK2 A;  1Q9Y A;  2KTQ A;  2G8H A;  1VQ8 N;  3OYJ A;  1VSH A;  2YNG A;  3WXL A;  4B1U B;  5AFU H;  2W6K A;  2ITM A;  4BWM A;  1S6P A;  2RF2 A;  1GLB G;  4EP4 A;  5IWA K;  3A5N C;  2E2O A;  1ZBL A;  1ATN A;  2A41 A;  2ZQB A;  2P9I A;  2O8C A;  3KKR A;  3NGY A;  1XWL A;  2P1J A;  2OAN A;  3AVN A;  4LF4 K;  3SK3 A;  5BN8 A;  1W9H A;  1HQU A;  2Z1J A;  1HUX A;  3CI5 A;  1FKO A;  3TAP A;  3HVR A;  4O5B A;  5TKW A;  3FZH A;  4XH4 A;  1D9D A;  1VQ6 N;  2O8F A;  5SWM A;  3E1Y A;  1IG8 A;  3SLC A;  1WB9 A;  3CCV N;  1K8K B;  2VGM A;  1JJ2 M;  2NRT A;  3TTD A;  3TAR A;  1K8A O;  3D45 A;  3MXM A;  1TK5 A;  1KAY A;  4A5B A;  3SYZ A;  3DLB A;  4CEE A;  3I56 N;  3ISN C;  3VN5 A;  4CI6 A;  4DU4 A;  2HHQ A;  4JLH A;  1C0U A;  4R5P A;  4F8R A;  4JI3 K;  2ASP A;  2GUP A;  3ZET A;  4DV0 K;  1NM1 A;  4IFY A;  3SI6 A;  4OGC A;  4JK9 A;  3AO5 A;  5BPN A;  3KLF A;  4CEO A;  3PX4 A;  3NGZ A;  3AV9 A;  1Y64 A;  4RG8 A;  3ZSQ A;  3NCI A;  4H8K A;  2P9N A;  3C6U A;  4ISG A;  4LFA K;  4JKA A;  2HBK A;  3RRG A;  4JKF A;  5M1P A;  3NH0 A;  4OLA A;  3SV3 A;  1XI1 A;  3CCE N;  1Y97 A;  1ZBI A;  3E66 A;  1HQE A;  2PFU A;  3JSM A;  3FZL A;  4KKO A;  2Q3S A;  1NK0 A;  3EEQ A;  4A57 A;  3O1B A;  3PY8 A;  3MXJ A;  5KRT A;  1IBM K;  3AY9 A;  4FLV A;  3DYA A;  3T1A A;  4CHO A;  3SUQ A;  1BCO A;  2YHY A;  2E2Q A;  3E01 A;  1Z6R A;  4KB1 A;  5LL6 Z;  4CGG A;  4BRC A;  4W5T A;  3LZI A;  2A5X A;  2VG7 A;  4AHV A;  1S72 N;  5JS1 A;  1N36 K;  5EX5 A;  2HBJ A;  4LSL A;  2QWR A;  4DFP A;  4I7F A;  3U9D A;  4IWV A;  1HKB A;  4HUG A;  3L2Q A;  3K5O A;  3RSE A;  1JLB A;  5LJV A;  4J2B A;  4CIG A;  3DI6 A;  1KAX A;  2BH1 A;  5M1Q A;  2IAJ A;  3M6G A;  4CJ7 A;  3R9P A;  1BA1 A;  2ZD1 A;  3CJB A;  4CZK A;  5CYM A;  3DJC A;  4JD2 A;  4CHY A;  4I2Q A;  3CMA N;  2A1R A;  2P9S A;  2XY7 A;  1QQO A;  5JMV A;  5K14 A;  3U4L A;  4IXC A;  3RR7 A;  3OYH A;  4FJL A;  5FDL A;  4KB0 A;  2HMI A;  4NCB A;  4Z4H A;  1VQO N;  4OKJ A;  1IG9 A;  4O44 A;  1IKX A;  2PY5 A;  4CF1 A;  3K9J A;  5HL7 L;  1HR0 K;  5C12 A;  2E1Z A;  3A5O C;  4BRE A;  1NGG A;  4EZ6 A;  1DTT A;  1W97 L;  1XMQ K;  2P9K A;  2AJQ A;  2JLE A;  4WE1 A;  4Z4C A;  4V19 S;  4N5S A;  2OPQ A;  4AHU A;  1IH7 A;  5DM6 L;  4FWN A;  1YTU A;  2D5R A;  2IC3 A;  4XEI A;  4BAC A;  2G8W A;  1ZXO A;  3ZT1 A;  3ENB A;  3VQB A;  4J2A A;  1SL1 A;  5BRE A;  5FLX O;  4K25 A;  4K8X A;  2CH5 A;  2NUB A;  3WNE A;  3MWT A;  3VEV A;  3TSQ A;  4KHN A;  3FGU A;  3LP0 A;  4YOR A;  1EKE A;  1YIT N;  3CJC A;  4ZTF A;  2DTU A;  5JIC A;  1OKJ A;  1GOC A;  5J2Q A;  2E4L A;  2NLX A;  1BL3 A;  4DQQ A;  2IS3 A;  4YOT A;  4Q0B A;  4JEP A;  2HNZ A;  1TVR A;  3SJJ A;  5F1X A;  3OBW A;  3V1Q A;  2E5L K;  3M8P A;  4BGB A;  1CXU A;  1O13 A;  2ASO A;  3NFA A;  4KRE A;  3VES A;  3DLG A;  1C0T A;  3QET A;  2HHU A;  3SQ2 A;  2ZF5 O;  4FLY A;  1HYS A;  1HMV A;  3GG4 A;  3T69 A;  4CZH A;  3ZSW A;  2QW9 A;  4BR0 A;  3SQ1 A;  4DV3 K;  2B5J A;  4OKK A;  4B3R K;  2W41 A;  3HPG A;  3TI0 A;  3DXK B;  3LPU A;  3SV4 A;  4FXD A;  4PL8 A;  2IGI A;  5KPZ A;  4DSJ A;  2VGN A;  1L3S A;  3OYG A;  3P4I A;  2O4G A;  4JKG A;  4CGF A;  4IO9 L;  1NJZ A;  3L4Q A;  1EP4 A;  3EE9 A;  3HO1 A;  4FJK A;  1WN7 A;  5EXW A;  3J80 O;  2DFF A;  2UXD K;  3VF2 A;  4JRQ A;  3E9L A;  4CZF A;  4DTU A;  3S3N A;  3PIP L;  1KSP A;  4KTZ A;  1G15 A;  1TKT A;  2E2P A;  3UKU B;  1SKS A;  5LMU K;  2VG5 A;  4CES A;  1A5V A;  5BRH A;  1REV A;  3OYM A;  3CFP A;  3CG7 A;  1LCU A;  4G1Q A;  3I0R A;  2YX6 A;  4B3T K;  4K42 A;  3FZF A;  1JXE A;  3M3Z A;  3S3O A;  4YDU C;  4M3U A;  3D2F B;  1JCG A;  1V4T A;  2OCE A;  1RNH A;  4M3Y A;  3ENO A;  4IEE A;  3HP9 A;  1L3T A;  3AVG A;  1WSJ A;  1KVC A;  1D4X A;  3G4S N;  1NGA A;  3K9K A;  3HSC A;  3IUC A;  4CJ4 A;  3HOT A;  1RDB A;  5DK5 A;  4DU3 A;  4CEQ A;  3MDQ A;  1Q81 O;  4IKF A;  3T1H K;  3RMB A;  4KH5 A;  3L8B A;  4DV2 K;  3TAE A;  4EHU A;  5LMN K;  1GLA G;  2FBT A;  4N47 A;  4I9L A;  4CGH A;  4BY9 C;  4Z0U A;  1C0M A;  4C1N K;  2HHW A;  2UUB K;  1S22 A;  4M3W A;  1I3A A;  3EN9 A;  3TR8 A;  3NAE A;  2Q0R A;  3I0S A;  1VQ4 N;  2CGK A;  3VEW A;  4O8K A;  3AAR A;  4U67 L;  2E6M A;  3SUN A;  4DSF A;  3VEN A;  3CIP A;  3VQ5 A;  4B3S K;  4EZ9 A;  1XNQ K;  1KAZ A;  4CK1 A;  2O8C B;  3CCS N;  4B9M A;  1ZC6 A;  4CBU A;  3OW2 M;  4DSE A;  4BWJ A;  1N8R O;  4DR1 K;  4A2A A;  4B3O A;  3KZB A;  1UOC A;  3VMF B;  3THY A;  1ZYQ A;  1F21 A;  3VA3 A;  2P5G A;  4E7L A;  4I6M A;  1SQK A;  3G71 N;  3HST B;  3WNG A;  1BWF O;  1VHX A;  3AAQ A;  4N56 A;  4PQU A;  3D7E O;  2ZJQ L;  2O8F B;  1KFD A;  3MEE A;  2W42 A;  4BRK A;  4CJE A;  2VCP A;  4FZY A;  4WQ5 C;  4JV5 K;  3UB5 A;  3H45 C;  3HL8 A;  4H5T A;  4PL7 A;  4FVU A;  4ILH A;  3SQ0 A;  1WAJ A;  1ILY A;  2XO7 A;  4DV5 K;  4B3M K;  1IKV A;  3VQ4 A;  3VF6 A;  4DUY K;  3D2E B;  4IEI A;  4C8K A;  2VQF K;  4B9U A;  4DS4 A;  1NLV A;  3HXM A;  4BG8 A;  4BR4 A;  4CEF A;  3CJ1 A;  3ZT4 A;  1X1P A;  3F73 A;  4IFV A;  2Z1G A;  3RR8 A;  3ZET B;  4KI6 A;  1DEJ A;  3P1G A;  1B92 A;  3U8X A;  4IG3 A;  1BQM A;  4BRL A;  1QVG M;  4LH4 A;  4RW9 A;  4WQ5 A;  5AQX A;  4IZ9 A;  3N4Q A;  3M8S A;  3QLH A;  3QDK A;  4Z4G A;  3AGR A;  2Q97 A;  4KBO A;  5KPT A;  4X65 K;  2ETJ A;  1T44 A;  1QS4 A;  1VQL N;  3DXM A;  4NYN A;  1TKD A;  2HHH K;  3HOS A;  2OPP A;  3MN9 A;  1OVQ A;  4YOW A;  3AA3 A;  3HJF A;  3ZT0 A;  3ULE B;  1RBS A;  3CM6 A;  5C2F A;  3V9U A;  2BGG A;  4DWI A;  4BRI A;  4AHS A;  1KD1 O;  3L3U A;  4CJR A;  3C95 A;  4JN4 A;  5AQF A;  3VTH A;  4DV1 K;  3KK7 A;  1DGK N;  3WXI A;  3AO2 A;  3G25 A;  4CF8 A;  3SAF A;  2ZJP L;  1JCF A;  3PSF A;  4Y1D A;  3OYF A;  1IBL K;  3LDO A;  4JI1 K;  1HKC A;  5I3U A;  2GUI A;  2UXB K;  5IT9 O;  3CC7 N;  3VA0 A;  5FRN A;  4OX9 K;  1FJG K;  3VGK A;  4CZM A;  1J6Z A;  4BQZ A;  1BA0 A;  3VQ6 A;  4IJN A;  1NGE A;  4FJ7 A;  4CED A;  3LDL A;  3DLE A;  3OYN A;  4CJW A;  4FJH A;  4M45 A;  3LWL A;  1EX4 A;  1SZ2 A;  3SBT A;  2IVP A;  2Z1I A;  2YI1 A;  5AR0 A;  1ASU A;  4CZG A;  4CFB A;  5GIO A;  2HF4 A;  4DLE A;  2FXU A;  1HJR A;  1NK4 A;  2O4I A;  4MLE A;  3VET A;  1R0A A;  4RW6 A;  5BRF A;  3C7N B;  3EL2 A;  1U47 A;  3FZM A;  3LM2 A;  2WFB A;  3QFU A;  4ILJ A;  3THW A;  4JYA K;  3AVA A;  4O8U A;  1VQ5 N;  3QNN A;  2BE2 A;  4CEA A;  1LOT B;  4CJP A;  2YKM A;  1WSH A;  2WON A;  3WNH A;  1RDW X;  4CD1 A;  5JVH L;  4MO5 A;  1VQP N;  4J2E A;  4DR5 K;  1RDD A;  4B9L A;  1HRH A;  1E4F T;  3CCR N;  1SV5 A;  1FKP A;  5AQW A;  1GLC G;  5AJ3 K;  1NMD A;  3VQA A;  3GL1 A;  3MX2 A;  3KK3 A;  3CJ7 A;  3VEY A;  3SPY A;  5EOY A;  2V7Z A;  4MFB A;  5BN9 A;  4OKE A;  5AQR A;  3P5J A;  4CHZ A;  3OYL A;  4CD3 A;  4DTN A;  4FZX C;  4MDA A;  2HBM A;  2P9L B;  3L2V A;  4DUZ K;  2QXF A;  3BZK A;  3THX A;  4H0Y B;  2WUS A;  5CR4 A;  1YJN N;  1NGD A;  2RHK A;  1HNV A;  4RW8 A;  4BRD A;  4KHU A;  4JI8 K;  5KI6 A;  2KHO A;  4OPK A;  1W2B M;  5EY4 A;  5C42 A;  3P38 A;  3K2P A;  3QNO A;  4CCH A;  4K0K K;  2PAV A;  3JYT A;  2HBL A;  1HYZ A;  2ZM6 K;  3HRG A;  3CQ8 A;  4IOX A;  3MXI A;  4H4O A;  3Q7C A;  2YHB A;  4HTL A;  3OY9 A;  1BDG A;  4H5N A;  1LWC A;  2RPI A;  2Z1H A;  4MQ3 A;  5EVZ A;  3EO3 A;  2O8B A;  4OVL A;  1KFS A;  3V9W A;  3CET A;  4OO1 J;  3P83 D;  3WEE A;  1C0F A;  1JLC A;  3R6M A;  1RT4 A;  3UKR B;  2YV0 X;  4CJ5 A;  4FWQ A;  1C1A A;  1TKX A;  1LWF A;  2Q1N A;  3FLC O;  3H3N O;  1KVA A;  1HYV A;  4DSI A;  4FM2 A;  4PKH A;  4B9N A;  4Z94 A;  1T7P A;  3F9K A;  5AQQ A;  3U6F A;  4HUF A;  4JI7 K;  1EET A;  4O0I A;  2O8E A;  3MCP A;  3BP8 A;  1TV6 A;  4FJM A;  2E2N A;  4DQS A;  4GVM A;  3SNN A;  5FPN A;  4CJL A;  4HCC A;  5E26 A;  2F9T A;  3QEP A;  3ZX3 A;  1RDU A;  1T6D A;  3H08 A;  1RGI A;  4KTQ A;  1FXX A;  2HNY A;  4B8C A;  1ASV A;  1NU0 A;  2UXC K;  2HND A;  2F8S A;  3AAP A;  2YHW A;  4BDY A;  4PWD A;  5CE3 A;  4MDB A;  1EWQ A;  2UYT A;  2V7Y A;  1K6Y A;  3MEC A;  1WOQ A;  5GAE P;  5AQK A;  1YVN A;  4A2B A;  2E8A A;  1NMN A;  3ZX0 A;  2I7N A;  3ZEU B;  4FWR A;  3LDS A;  1JLE A;  4FW1 A;  1OVY A;  3I8D A;  4KFB A;  4U7B A;  2CGL A;  3G10 A;  3O9S A;  3VEX A;  1TYQ B;  3K59 A;  1HX1 A;  3KTQ A;  1TAU A;  2ITG A;  4H0T B;  3T19 A;  4AH9 A;  3ATV A;  2UUA K;  3KHY A;  3PSI A;  5GIN A;  3PLA A;  4CK3 A;  1SL2 A;  3CCL N;  4HVJ A;  3OA9 A;  1T03 A;  1MWK A;  4FM0 A;  4Z4I A;  4DQI A;  4NB4 A;  4G9Z A;  4BC5 A;  4KTW A;  5AQH A;  3AVL A;  3ZSZ A;  1U2V B;  4BGA A;  3HTV A;  4CVN E;  1GLF O;  1O1W A;  3OYD A;  2PZS A;  3DRP A;  1TL1 A;  3H1V X;  2QK9 A;  3VQC A;  2DY4 A;  2VWK A;  4BR9 A;  3H6E A;  4WCE L;  4E0D A;  3RTV A;  3MCA B;  2KFN A;  2FSN A;  1UA1 A;  5KGX A;  3KVG A;  1KVB A;  4CGI A;  1D9F A;  1NNE A;  5DM7 L;  4BRQ A;  2YNH A;  1NK5 A;  3NVM A;  3OBY A;  4LF7 K;  4NLB A;  2Q36 A;  5GAH P;  2NZT A;  1HNX K;  4B9V A;  5AZJ A;  4ZTJ A;  3VEO A;  5BRD A;  2KKZ A;  4M3Z A;  3QML A;  4Q5V A;  5FPE A;  4CF9 A;  3PX0 A;  2I7P A;  4M63 C;  1X3N A;  4IG0 A;  4FJ9 A;  4LF8 K;  5I9E B;  1C1C A;  1VQN N;  4RCH A;  3LAL A;  5J2P A;  1QZ5 A;  3V9S A;  4ISE A;  3BGR A;  1NJX A;  4F4K A;  3A0I X;  4YOY A;  3CCQ N;  2EWS A;  1NGJ A;  3OJU A;  1ZBF A;  2DPN A;  4BC4 A;  3KLH A;  1QVF M;  3QIO A;  3TAF A;  3OYE A;  3K5M A;  4JI0 K;  4C8L A;  1V4S A;  5CY4 A;  4M3X A;  1BOT O;  1SL0 A;  2HST A;  3BY5 A;  1C1B A;  3NF9 A;  1YT3 A;  2P9U B;  1RDA A;  2G8U A;  2WBN A;  1ATR A;  3DLR A;  3FFI A;  3VQ8 A;  4BRO A;  4DKW A;  4H0P A;  3MN5 A;  3E9P A;  3CME N;  2HF3 A;  3CD6 N;  3WXK A;  3V4I A;  2QWN A;  3A5L C;  3QIN A;  3EKU A;  5JLF A;  2D0B A;  1VQ9 N;  2HMP A;  2GEL A;  2GWK A;  2FF6 A;  4JHD A;  5M1F A;  2G8F A;  1TK8 A;  3ZYY X;  5JVG L;  1YF5 L;  1JLG A;  4QS8 A;  4LF9 K;  1OH7 A;  4FLT A;  3OYK A;  4QS7 A;  3DOL A;  1BQN A;  1NGI A;  5KTQ A;  4DTR A;  1NKB A;  4A62 A;  3MEG A;  1QSL A;  3OTO K;  3KK2 A;  4DFK A;  3THW B;  4ZHR A;  4DS5 A;  1EWR A;  5J2N A;  4JI6 K;  2JWK A;  1SKR A;  2W40 A;  4DQ8 A;  4OPH A;  4FOI A;  1M90 O;  3HI0 A;  1TUU A;  1ATS A;  4AM6 A;  4LY7 A;  4GV9 A;  1ASW A;  4CF2 A;  3C6T A;  5ADX A;  1D5A A;  3V9X A;  3NH1 A;  3C6H A;  3VER A;  4ID5 A;  4A59 A;  4DFM A;  2YHA A;  3V6D A;  4F9O A;  3KWI A;  4YOU A;  4PA1 A;  1RT6 A;  3NDK A;  1JCE A;  2XY5 A;  2O8D B;  1T3V A;  3V1R A;  3T1Y K;  3RRH A;  3SAH A;  3J7Z O;  2HVH A;  4KH6 A;  3NH2 A;  3TAG A;  4OPJ A;  1Q7Y O;  1WLJ A;  3ZSV A;  5F2R A;  4NYF A;  3L2U A;  3NHG A;  1QTM A;  1BUP A;  4CF0 A;  4OPA A;  2QXL A;  4NCA A;  4DTJ A;  1VK0 A;  3V9Z A;  5AQU A;  1B9D A;  2NRV A;  2KZM A;  2NRW A;  3TAM A;  3V81 A;  5BR9 A;  1NK7 A;  5AZI B;  3SQ4 A;  2BAN A;  4CJV A;  5HRP A;  3A2F A;  2HHT A;  5C15 A;  4DF4 A;  3PO5 A;  1C0G A;  4EP5 A;  3IG1 A;  3ZX2 A;  1HKG A;  3MWP A;  2P9P B;  4BR7 A;  2G8K A;  1K8K A;  2JGU A;  1WAF A;  3O9U A;  1T6C A;  4B08 A;  4PUO A;  3AVF A;  2D4W A;  3JS6 A;  3O3G A;  3EZ5 A;  4DR7 K;  4DCH A;  3HBT A;  3DLH A;  3LP3 A;  3WUH A;  4Y0W A;  4PHT X;  3DOK A;  4B9Q A;  1LV5 A;  3Q7B A;  2J4R A;  1UWB A;  1ZBH A;  2W6L A;  4GY2 B;  5TKY A;  4FWP A;  3VQ7 A;  3C6A A;  2QWL A;  1NOY A;  2G8V A;  4QCL A;  1SS6 A;  2FBV A;  1HNI A;  2E20 A;  3OS1 A;  3ZSO A;  3QFP A;  3SMS A;  2P9I B;  5KRS A;  4FWL A;  2HVI A;  4ID1 A;  3QER A;  1P90 A;  3QB0 A;  4NXN K;  4OGE A;  5AQM A;  3RWU A;  2O8E B;  1S6Q A;  1XC3 A;  4DTM A;  3WQT A;  3C65 A;  2JWL A;  2A6A A;  3L0Q A;  2B6A A;  3RVC A;  4CIE A;  3O9Q A;  2X6N A;  3BZC A;  3ZCM A;  4IBN A;  3AVM A;  1VSM A;  1D8Y A;  1YTA A;  2YNF A;  4XH1 A;  4DR3 K;  4FL9 A;  2B4J A;  4DR4 K;  2FF3 B;  5ADX H;  3BF1 A;  4M42 A;  2OTJ N;  4K43 A;  5BPL A;  2QWM A;  4BVP A;  2BUP A;  5GIP A;  4E7J A;  4B1Z A;  3QEX A;  3U3Y A;  4C1N I;  3CPW M;  3A5M C;  4JKE A;  3SUO A;  2ZJR L;  1WSE A;  1NGH A;  4BVO A;  5AQS A;  3AO3 A;  1LWE A;  3HZ6 A;  1S5J A;  4CJU A;  1S1T A;  1U49 A;  2QA4 N;  2NRH A;  1L3U A;  4O4G A;  1GLL O;  2P9N B;  2QWO A;  3AO4 A;  3O80 A;  4YFU A;  4H0X B;  4LFB K;  2P5O A;  4BQL A;  4YOV A;  4HWI A;  3TAN A;  3NF6 A;  1NJI O;  4DSK A;  1LAV A;  1TKZ A;  1WSF A;  4EIA A;  3AA2 A;  4BR5 A;  1BCM A;  2ZGZ A;  2FBY A;  3H46 O;  2YCH A;  4CFC A;  3HYF A;  3W3D A;  3ZSX A;  4H4M A;  1MU2 A;  1RT3 A;  3WXM B;  5B8H A;  4CHN A;  3ID8 A;  2QTD A;  4E7H A;  3F9M A;  3QO9 A;  3D0P A;  3LDQ A;  2WOM A;  2BTF A;  3HM8 A;  1S1U A;  3S3M A;  5JLH A;  3CC4 N;  4AIL C;  1RBR A;  1XC9 A;  4B9S A;  2VWB A;  3BF3 A;  3B6P A;  1OH5 A;  3AVH A;  1WBB A;  3PO4 A;  4X66 K;  1ESV A;  3RSE B;  4Z4F A;  4F2S A;  2QI2 A;  1SAZ A;  3QBW A;  4FVM A;  1Q8I A;  2ZE2 A;  3BEX A;  5AQO A;  1EO1 A;  4AHC A;  2RE2 A;  3MAQ A;  4JD2 B;  1HPM A;  2QKB A;  3O5B A;  2P9S B;  4JNE A;  4CJQ A;  1QQN A;  2ZGY A;  4CK2 A;  1BI4 A;  4FSV A;  1E3M A;  5HRS A;  4LD0 A;  3ALY A;  3JXU A;  3SBG A;  1BGX T;  4CW7 B;  4DR6 K;  1LW0 A;  3VQE A;  5GAG P;  1CZ9 A;  4BC2 A;  1GLJ O;  4JKD A;  5HRN A;  4BE1 A;  1TGO A;  3A8Y A;  1FK9 A;  3B6O A;  1RT2 A;  1S1W A;  1EXQ A;  2RN2 A;  4FWK A;  2VWJ A;  4B1W B;  1Q86 O;  2GWJ A;  3T7Z A;  1HLU A;  1U6Z A;  1QQM A;  2P9K B;  5FPD A;  4WYB A;  3L3V A;  3L2R A;  2YHX A;  3AGK A;  1VQM N;  4CZL A;  4C23 A;  2G8I A;  4JS4 A;  4M3R A;  4JI4 K;  3AO1 A;  4FPB A;  3DXK A;  4IOA L;  4GVE A;  3H1Q A;  4KHS A;  4M41 A;  2A40 A;  3LP2 A;  4FJN A;  4FJI A;  5E41 A;  5CYQ A;  1UA0 A;  1DKG D;  3S41 A;  5AQG A;  3SMP A;  3IMX A;  2VQE K;  4L3Q A;  4E3S A;  1YUW A;  4BDP A;  3CPE A;  4GNI A;  4I9Q A;  3UKU A;  3UIQ A;  4QS9 A;  4LF6 K;  3PUF A;  1GLE G;  3IRX A;  3R3L A;  4TSX A;  1IKW A;  3MED A;  4KI4 A;  4F3T A;  4FJ5 A;  4CGD A;  5J1E A;  2PYL A;  4AQY K;  1Z25 A;  3J7Y P;  3D2F A;  3I8B A;  1KLM A;  3QBX A;  3FE1 A;  4ELT A;  4FJJ A;  4RW4 A;  1LAW A;  3KLI A;  4CHQ A;  2X74 A;  4I2P A;  2A3Z A;  2HHX A;  5FRM A;  2AA4 A;  4JK8 A;  2HW3 A;  3H3O B;  3ZLJ A;  3CM5 A;  4O0J A;  4NXM K;  3I33 A;  1A5X A;  4JKG B;  4MLH A;  5KPR A;  3WXJ A;  2WC9 A;  3F5T A;  3O08 A;  1IO2 A;  4E1N A;  3DMJ A;  4IFE A;  2QWP A;  3RMD A;  3AA4 A;  1X9W A;  2ZWH A;  2IVO A;  1T8E A;  1VQ7 N;  3NBP A;  4KRF A;  4KPY A;  2KQ2 A;  3MX5 A;  3P31 A;  4DTO A;  5AQV A;  1RBU A;  2H3G X;  1BIU A;  3CQX A;  3ZSY A;  3M5R A;  3LAM A;  3NE6 A;  1X9S A;  3LDN A;  4DV4 K;  1NK6 A;  4IJA A;  3OS2 A;  1HPZ A;  1JL1 A;  1NJW A;  1IJJ A;  1KTQ A;  4FCY A;  4FO0 A;  3EZW A;  4FWS A;  3AVI A;  4FLZ A;  3GBT A;  1IKY A;  4KHQ A;  4BRP A;  1QHT A;  3CXC M;  5J2M A;  2E88 A;  3L2W A;  3LAN A;  3ULD A;  4LH5 A;  1MDU B;  3BDP A;  3O9R A;  1I39 A;  2Y1I A;  5EU7 A;  4LFC K;  5A2Q O;  3ID6 A;  4BE2 A;  2YKN A;  5T7B A;  5M1O A;  4X64 K;  3EYZ A;  1IBK K;  3K5L A;  3DAW A;  4FK0 A;  5KGW A;  3HT3 A;  1C6V A;  3OYB A;  2A1S A;  3D6R A;  3SJH A;  1S3X A;  1JLF A;  3CYM A;  5D3G A;  2HOE A;  3CQY A;  4EHT A;  4YY3 K;  2GTD A;  4QAG A;  3C0B A;  3KWG A;  3D2E A;  1VAZ A;  3J7A P;  4FOE A;  3O1W A;  4CER A;  2BDP A;  2QWQ A;  1CZA N;  4IOC L;  5AQI A;  1YJW N;  1RTI A;  1M1K O;  1KRP A;  2DFH A;  4FYD A;  4DTX A;  4CEZ A;  4JKH A;  3VQ9 A;  3C94 A;  4CEB A;  4CHP A;  1YHQ N;  4CGJ A;  4DSL A;  1TAQ A;  1QQC A;  3ZT2 A;  3GDQ A;  2PBD A;  3MMV A;  1KXP A;  5AQZ A;  3THY B;  1RTD A;  5HLF A;  2QM1 A;  4I6M B;  1U4B A;  1WNS A;  4CFA A;  1BO5 O;  4AF1 A;  1TK0 A;  4RW7 A;  5FPM A;  3ULE A;  2D0C A;  1U04 A;  1ITG A;  1WSG A;  2XY8 A;  3R8E A;  2FBX A;  4YNQ A;  1OH8 A;  1VRT A;  3U3G A;  3WNF A;  3KK1 A;  4HCB A;  2VYP A;  5HOO A;  3CC2 N;  3QIP A;  3P39 A;  3O9T A;  3R1X A;  1NG9 A;  5I42 A;  3HM9 A;  2NRX A;  2YJF A;  5E84 A;  3SZ2 A;  1E4G T;  4KHY A;  1ZBU A;  2HHS A;  1VSD A;  1VSE A;  4M7Y A;  3FR0 A;  3DM2 A;  3CCM N;  3ZT3 A;  3LPT A;  1XNR K;  2D0O A;  5M1N A;  4CBW A;  5CZ1 A;  1YIJ N;  4W5Q A;  1HJO A;  3VOV A;  3VQP A;  4NCG A;  2V51 B;  1RIL A;  4CBX A;  3TTC A;  5GAD P;  4CZE A;  5C24 A;  3F2K A;  4DQR A;  1JXB A;  5HRR A;  4F2R A;  1NK8 A;  2GV9 A;  1U48 A;  3DXM B;  5LJW A;  1S1X A;  3G6E N;  1GLD G;  2KFZ A;  4N41 A;  3C7N A;  4CIF A;  4B9T A;  1S9E A;  2XHB A;  4GW6 A;  3L6Q A;  3PIO L;  1Q82 O;  3UE5 A;  3NMU A;  1VSJ A;  4BRF A;  3VEZ A;  2OZM A;  4LSN A;  1DLO A;  1NOZ A;  1N34 K;  1JLA A;  1H1V A;  1JKH A;  4R79 A;  4DTS A;  4H0V B;  4CJS A;  3KJV A;  4FM1 A;  4GKK K;  4BR2 A;  1DTQ A;  2F9W A;  1XHX A;  1I94 K;  1NJY A;  4BE0 A;  3N4P A;  5DMR A;  4K41 A;  1G99 A;  5FRO A;  1NGF A;  1SUQ A;  2X6S A;  4OLB A;  4FK4 A;  2UUC K;  2OA8 A;  3PX6 A;  2F4V K;  3CHW A;  5AQY A;  1NWK A;  1QSS A;  3MK6 A;  4GMJ B;  3ENH A;  1BHL A;  1B9F A;  1NK9 A;  3RMC A;  1U45 A;  3ATU A;  3TWH A;  3WQU A;  1QSY A;  1QZ6 A;  2P9L A;  3IS9 A;  1WSI A;  1BI4 B;  3O6W A;  4A5A A;  4DG1 A;  2OPS A;  3VQQ A;  4J2D A;  3VTI A;  4AHT A;  1Q18 A;  1TUY A;  2DFE A;  2HB5 A;  4DHY A;  4HUE A;  5AQJ A;  2F8T A;  3DLK A;  4GV6 A;  5LY3 A;  2KZZ A;  3OYI A;  1YJ9 N;  4FJ8 A;  3SUP A;  3TU5 A;  3JAM O;  3B8A X;  3WT0 A;  1WUA A;  4CZI A;  1QE1 A;  1VQK N;  4O55 A;  3LWM A;  2D1K A;  3RMA A;  4PY5 A;  4CEC A;  3LM9 A;  4M3T A;  3QEW A;  1Z26 A;  1KQS M;  4DB3 A;  5ELZ A;  3M1F A;  4H03 B;  4WFB L;  3K5N A;  4JKB A;  3SPZ A;  2LSN A;  1FW6 A;  2OZS A;  3TAB A;  3LDP A;  1BU6 O;  3K57 A;  3KIO A;  3FZK A;  4MO4 A;  4ISF A;  2ATQ A;  3UKR A;  3SCX A;  1J53 A;  2D0P A;  4DV7 K;  1VSF A;  2KW4 A;  3KD5 E;  2Q2R A;  3THX B;  2F7T A;  5AQT A;  4C8O A;  4LC9 B;  1L5U A;  1WBD A;  3DLL L;  1RDC A;  1GOA A;  3CCJ N;  4FK2 A;  5C25 A;  1W0H A;  4B1V A;  4KV8 A;  3VGL A;  2YJE A;  3K58 A;  4BC3 A;  4BRA A;  3KD1 E;  3OYC A;  3O3F A;  4NO7 A;  1RFQ A;  3VF4 A;  2Q31 A;  5H1S Q;  4AM7 A;  1S9G A;  3GOI A;  3LP1 A;  4E1J A;  4BDZ A;  3DWL A;  2NNW A;  3CJA A;  2VG6 A;  3O4Q A;  3DRS A;  4LF5 K;  4NLC A;  1EQY A;  1CZB A;  2FSK A;  5M1K A;  4CZJ A;  3LL3 A;  5CZ2 A;  2IDO A;  4E7I A;  3HVT A;  4CE9 A;  4K8Z A;  3THV A;  4WQ4 C;  2O8B B;  3WEE B;  1X9J A;  5CHI A;  2X78 A;  3TAQ A;  1N32 K;  4B1Y B;  3KLG A;  1Q9X A;  4WFA L;  4H5W A;  4CJ3 A;  1DT9 A;  3EE8 A;  4YDU A;  3ZEU A;  4DTP A;  3SAG A;  3GE1 A;  2PYJ A;  1UAX A;  4CFD A;  4Y1C A;  3TTF A;  4IDK A;  2AP1 A;  4ICL A;  4XIU A;  2ASM A;  4JI5 K;  4EAH D;  1TYQ A;  1X3M A;  1IV0 A;  4FLU A;  1JL2 A;  1JLQ A;  4KHP K;  2Y1J A;  4DQP A;  2I5J A;  3EKS A;  4BRN A;  4DU1 A;  4WQ4 A;  2OPR A;  4C8M A;  3E9O A;  4FZZ A;  4WF9 L;  4JRP A;  3ASM A;  4F3O A;  1X9M A;  4X62 K;  4KH4 A;  4W5N A;  2YNI A;  3HPO A;  1BIZ A;  3OJS A;  1T05 A;  3CCU N;  1N33 K;  3FFK B;  1BIS A;  3VPZ A;  1YAG A;  1RBT A;  1U2V A;  4FPA A;  1NKE A;  1S1V A;  3QES A;  4FW2 A;  3HP6 A;  1J54 A;  1J5E K;  4JKC A;  1OH6 A;  1ZBS A;  4J8F A;  1N5Y A;  2EX3 A;  4JI2 K;  3W0L A;  5BPM A;  3DRR A;  3M8R A;  3VGM A;  3CF5 L;  1P8Z A;  4KAZ A;  4ILG B;  3CFO A;  5C10 A;  1RT5 A;  4OJR A;  3QEV A;  1XUP O;  2GX9 A;  1NKC A;  2UU9 K;  3I55 N;  2HHV A;  4W5R A;  4H5R A;  3L4I A;  3CFR A;  3IAY A;  4CJF A;  3QIC A;  3AA5 X;  2OYQ A;  4QOZ B;  5C2D A;  4Z4E A;  3QEI A;  2GEM A;  2E6L A;  3M8Q A;  2FLO A;  5F0X A;  3K0S A;  4DF8 A;  2NRR A;  5AQL A;  5HP1 A;  4HHT A;  1XMO K;  1YVU A;  3TSP A; 
#chains in the Genus database with same CATH homology
 1KVB A;  1RBV A;  4CGI A;  4JRQ A;  1KCF A;  4DTU A;  3S3N A;  1D9F A;  2HHX A;  1KSP A;  5FRM A;  4KTZ A;  1G15 A;  1TKT A;  1SKS A;  2HW3 A;  2VG5 A;  4CES A;  4HTU A;  3NF8 A;  2YNH A;  4AHR A;  1NK5 A;  1A5V A;  3CM5 A;  4O0J A;  2RKI A;  1REV A;  3OYM A;  1J5O A;  3AVB A;  3CFP A;  3CG7 A;  4G1Q A;  4B9V A;  1A5X A;  3I0R A;  4CJT A;  4E89 A;  4UQG A;  1IO2 A;  3S3O A;  1JXE A;  1RTJ A;  4E1N A;  4ZTJ A;  4M3U A;  3DMJ A;  3RMD A;  4M3Z A;  4DLG A;  3AA4 A;  3ZSR A;  1X9W A;  1RNH A;  4M3Y A;  1TL3 A;  1T8E A;  3HP9 A;  4Q5V A;  1L3T A;  3AVG A;  4CF9 A;  1WSJ A;  3NBP A;  3PX0 A;  4KRF A;  4KPY A;  2KQ2 A;  1KVC A;  4FJ9 A;  4IG0 A;  1CLQ A;  4DTO A;  2R7Y A;  1RBU A;  4FLX A;  4CJ4 A;  1RDB A;  2XY6 A;  5DK5 A;  3G0Z A;  4KO0 A;  1BIU A;  1C1C A;  3ITH A;  4CEQ A;  4DU3 A;  3ZSY A;  4IKF A;  3LAM A;  3NE6 A;  3LAL A;  5J2P A;  1X9S A;  3RMB A;  1NK6 A;  3OS2 A;  3V9S A;  1HPZ A;  3BGR A;  1JL1 A;  3L8B A;  4DFJ A;  3TAE A;  1NJX A;  4F4K A;  1NJW A;  1VRU A;  2FBT A;  4N47 A;  1KTQ A;  4FCY A;  1VSK A;  3AVK A;  4FLZ A;  3AVI A;  4I9L A;  4CGH A;  3OJU A;  1ZBF A;  4FLW A;  1IKY A;  4KHQ A;  4Z0U A;  1QHT A;  1C0M A;  3KLH A;  5J2M A;  2HHW A;  3L2W A;  3LAN A;  4M3W A;  1I3A A;  3QIO A;  3ULD A;  3TAF A;  3S9H A;  3TR8 A;  3OYE A;  4LH5 A;  3K5M A;  3NAE A;  3I0S A;  3BDP A;  4C8L A;  1I39 A;  4FJG A;  2Y1I A;  1VSL A;  5CY4 A;  5EU7 A;  3LZJ A;  4ELV A;  4M3X A;  1SL0 A;  5HBM A;  4E19 A;  1C1B A;  3NF9 A;  4BE2 A;  1YT3 A;  2E6M A;  2P51 A;  2YKN A;  5T7B A;  3EYZ A;  1RDA A;  3SUN A;  2G8U A;  3DLR A;  3FFI A;  3OVN A;  3VQ8 A;  3K5L A;  5KGW A;  4DSF A;  4FK0 A;  3NF7 A;  3HT3 A;  3VQ5 A;  1C6V A;  4EZ9 A;  3OYB A;  1CXQ A;  2A1S A;  4CK1 A;  1RT1 A;  3O4N A;  2EHG A;  4B9M A;  2D0A A;  3EY1 A;  3AVC A;  2IOC A;  3V4I A;  1JLF A;  3CYM A;  4BWJ A;  4E1M A;  4DSE A;  1XHZ A;  5D3G A;  4B3O A;  4L8R B;  3QIN A;  4QAG A;  1UOC A;  3V1O A;  1ZYQ A;  1F21 A;  3VA3 A;  2P5G A;  2D0B A;  4E7L A;  3PV8 A;  4CER A;  2BDP A;  3AVJ A;  4C8N A;  5JS2 A;  3NGI A;  3HST B;  3WNG A;  1SKW A;  1A5W A;  1RTI A;  1KRP A;  2G8F A;  3OS0 A;  2DFH A;  4N56 A;  1TK8 A;  4PQU A;  3LAK A;  1JLG A;  4FYD A;  1KFD A;  3MEE A;  4DTX A;  2W42 A;  4FLT A;  4CJE A;  4CEZ A;  4FZY A;  3OYK A;  3VQ9 A;  3C94 A;  1BQN A;  3DOL A;  1RCH A;  4CEB A;  4CHP A;  5KTQ A;  1GOB A;  3KLE A;  4DTR A;  4CGJ A;  3HL8 A;  1NKB A;  3MEG A;  1QSL A;  4DSL A;  1TAQ A;  1QQC A;  3ZT2 A;  3SQ0 A;  1N6Q A;  1WAJ A;  3KKS A;  3KK2 A;  4DFK A;  2XO7 A;  4ZHR A;  2QKK A;  4DS5 A;  2F96 A;  4B8A B;  1L3V A;  5J2N A;  1RTD A;  4E7K A;  1IKV A;  3VQ4 A;  5HRO A;  3OYA A;  1LW2 A;  5HLF A;  1U4B A;  1SKR A;  1WNS A;  4CFA A;  4C8K A;  4B9U A;  4DS4 A;  3HPH A;  3HXM A;  4CEF A;  3ZT4 A;  1X1P A;  4LY7 A;  4RW7 A;  4IFV A;  2Z1G A;  3F73 A;  1J9A A;  1TK0 A;  3T3F A;  3RR8 A;  1ASW A;  4KI6 A;  4CF2 A;  3P1G A;  4CJK A;  3C6T A;  3O3H A;  1D5A A;  1B92 A;  4KHW A;  2D0C A;  4IG3 A;  1U04 A;  1ITG A;  2FC0 A;  3V9X A;  1BQM A;  1WSG A;  2XY8 A;  3NH1 A;  1KLN A;  4ID5 A;  4LH4 A;  4RW9 A;  2FBX A;  4YNQ A;  2YHA A;  4DFM A;  3V6D A;  5KGX A;  4N76 A;  1VRT A;  4FJX A;  3M8S A;  3QLH A;  4PA1 A;  3U3G A;  3WNF A;  1RT6 A;  5SZT A;  3KK1 A;  4Z4G A;  4HCB A;  3NDK A;  3QIP A;  4JS5 A;  2XY5 A;  2ETJ A;  3V1R A;  5I42 A;  1QS4 A;  3HM9 A;  2XRI A;  3RRH A;  1TKD A;  4NYN A;  4W5O A;  1RTH A;  2HVH A;  3SZ2 A;  3NH2 A;  2OPP A;  3TAG A;  1VSI A;  4ELU A;  4OPJ A;  1ZBU A;  4KHY A;  1WLJ A;  2HHS A;  3ZSV A;  1VSD A;  1VSE A;  4NYF A;  3L2U A;  3AA3 A;  4DMN A;  3NHG A;  1QTM A;  2GBZ A;  3DM2 A;  3HJF A;  4CF0 A;  3ZT3 A;  3LPT A;  3ZT0 A;  4NCA A;  1RBS A;  3CM6 A;  4DTJ A;  3V9U A;  2BGG A;  1VK0 A;  3V9Z A;  5CZ1 A;  4DWI A;  1B9D A;  4W5Q A;  2KZM A;  3VQP A;  3VQD A;  3TAM A;  4AHS A;  1RT7 A;  4NCG A;  3V81 A;  3L3U A;  3HK2 A;  4CJR A;  1Q9Y A;  2KTQ A;  3C95 A;  1RIL A;  2G8H A;  5C24 A;  1VSH A;  3OYJ A;  1NK7 A;  2YNG A;  3SQ4 A;  4DQR A;  1JXB A;  2BAN A;  5HRR A;  3A2F A;  3AO2 A;  4CJV A;  5HRP A;  1NK8 A;  4CF8 A;  4F2R A;  2HHT A;  2GV9 A;  1U48 A;  4BWM A;  4DF4 A;  3PO5 A;  1S6P A;  2RF2 A;  4EP4 A;  1S1X A;  4EP5 A;  3OYF A;  4Y1D A;  3IG1 A;  1ZBL A;  5I3U A;  2GUI A;  2KFZ A;  2G8K A;  4N41 A;  3VA0 A;  5FRN A;  4CIF A;  2JGU A;  2ZQB A;  4B9T A;  1WAF A;  1S9E A;  2XHB A;  3KKR A;  3NGY A;  4GW6 A;  1XWL A;  2P1J A;  3AVN A;  4B08 A;  4PUO A;  3AVF A;  3VQ6 A;  1VSJ A;  3O3G A;  3EZ5 A;  2OZM A;  4FJ7 A;  4CED A;  1W9H A;  4LSN A;  3DLH A;  1DLO A;  1NOZ A;  1JLA A;  1HQU A;  3DLE A;  3LP3 A;  3OYN A;  4CJW A;  2Z1J A;  1JKH A;  3DOK A;  4DTS A;  1FKO A;  1LV5 A;  4FJH A;  4CJS A;  3KJV A;  1UWB A;  4FM1 A;  3TAP A;  4M45 A;  1ZBH A;  3LWL A;  3HVR A;  1EX4 A;  4O5B A;  1DTQ A;  2Z1I A;  1D9D A;  3VQ7 A;  1ASU A;  1XHX A;  4CFB A;  5SWM A;  4DLE A;  1NOY A;  1NJY A;  1HJR A;  4BE0 A;  1NK4 A;  2O4I A;  5DMR A;  1R0A A;  2G8V A;  4QCL A;  2FBV A;  4RW6 A;  1HNI A;  5FRO A;  1SUQ A;  2X6S A;  3OS1 A;  4OLB A;  4FK4 A;  3ZSO A;  1U47 A;  5KRS A;  2HVI A;  3TAR A;  3D45 A;  4ID1 A;  3MXM A;  1TK5 A;  2OA8 A;  3QER A;  3AVA A;  3PX6 A;  4OGE A;  3SYZ A;  3DLB A;  3QNN A;  3RWU A;  1QSS A;  2BE2 A;  4CEE A;  4GMJ B;  1S6Q A;  3ISN C;  3VN5 A;  4CEA A;  1BHL A;  4DTM A;  1B9F A;  4CJP A;  3RMC A;  2YKM A;  4DU4 A;  1WSH A;  2WON A;  3WNH A;  1NK9 A;  2HHQ A;  1U45 A;  4JLH A;  2B6A A;  4CIE A;  3TWH A;  2X6N A;  1QSY A;  3ZCM A;  1C0U A;  4R5P A;  4J2E A;  4F8R A;  3IS9 A;  4IBN A;  3AVM A;  1WSI A;  4B9L A;  1RDD A;  1BI4 B;  1HRH A;  1VSM A;  4DG1 A;  1SV5 A;  1FKP A;  1D8Y A;  1YTA A;  2YNF A;  2OPS A;  3VQQ A;  4FJ5 A;  4J2D A;  2B4J A;  4IFY A;  3SI6 A;  4OGC A;  4AHT A;  3VQA A;  4M42 A;  2DFE A;  4HUE A;  2HB5 A;  3AO5 A;  3KK3 A;  3KLF A;  4CEO A;  3PX4 A;  2F8T A;  3DLK A;  3NGZ A;  3AV9 A;  3SPY A;  4RG8 A;  3ZSQ A;  3NCI A;  4H8K A;  3C6U A;  3OYI A;  4E7J A;  2KZZ A;  4FJ8 A;  3SUP A;  4MFB A;  3RRG A;  4OLA A;  3NH0 A;  3QEX A;  4OKE A;  3P5J A;  4CHZ A;  1QE1 A;  3OYL A;  3SV3 A;  4O55 A;  3U3Y A;  1XI1 A;  3SUO A;  4DTN A;  4FZX C;  3LWM A;  1WSE A;  1Y97 A;  1ZBI A;  3RMA A;  1HQE A;  3JSM A;  4PY5 A;  4KKO A;  3L2V A;  2Q3S A;  4CEC A;  4M3T A;  1NK0 A;  2QXF A;  1Z26 A;  3QEW A;  3AO3 A;  3PY8 A;  1LWE A;  1S5J A;  3MXJ A;  5KRT A;  4CJU A;  1S1T A;  1U49 A;  1HNV A;  4RW8 A;  4FLV A;  3K5N A;  4KHU A;  3DYA A;  3T1A A;  3SPZ A;  5KI6 A;  4CHO A;  1L3U A;  3SUQ A;  4K8X A;  1BCO A;  4O4G A;  4OPK A;  2LSN A;  3E01 A;  3AO4 A;  2OZS A;  4KB1 A;  4CGG A;  4YFU A;  3TAB A;  4W5T A;  3LZI A;  5C42 A;  3K57 A;  2P5O A;  2VG7 A;  3KIO A;  3K2P A;  3QNO A;  4AHV A;  4CCH A;  2ATQ A;  5JS1 A;  3SCX A;  1J53 A;  3JYT A;  1HYZ A;  4LSL A;  4DFP A;  4I7F A;  1VSF A;  2KW4 A;  3TAN A;  4HUG A;  3L2Q A;  3CQ8 A;  3NF6 A;  3KD5 E;  3K5O A;  3MXI A;  4H4O A;  4DSK A;  1JLB A;  1LAV A;  1TKZ A;  1WSF A;  2YHB A;  4C8O A;  3AA2 A;  4J2B A;  4CIG A;  1BCM A;  1L5U A;  3DI6 A;  3OY9 A;  1RDC A;  1GOA A;  2FBY A;  2IAJ A;  4FK2 A;  5C25 A;  4CFC A;  3HYF A;  1W0H A;  2ZD1 A;  1LWC A;  3ZSX A;  2RPI A;  1MU2 A;  1RT3 A;  2Z1H A;  4H4M A;  4KV8 A;  4MQ3 A;  5CYM A;  4CHY A;  4CHN A;  3K58 A;  4I2Q A;  4E7H A;  3QO9 A;  3KD1 E;  3D0P A;  3OYC A;  4OVL A;  1KFS A;  2A1R A;  3O3F A;  3V9W A;  3P83 D;  2WOM A;  1JLC A;  2XY7 A;  4CJ5 A;  1RT4 A;  1S1U A;  2YV0 X;  3S3M A;  4BDZ A;  1S9G A;  4AIL C;  1C1A A;  1RBR A;  3LP1 A;  5K14 A;  1XC9 A;  4B9S A;  1TKX A;  1LWF A;  3B6P A;  3OYH A;  3AVH A;  3RR7 A;  1KVA A;  4FJL A;  5FDL A;  3PO4 A;  1HYV A;  2VG6 A;  4DSI A;  2HMI A;  4KB0 A;  3O4Q A;  4FM2 A;  4Z4H A;  1IG9 A;  4OKJ A;  3DRS A;  4F2S A;  4NCB A;  4Z4F A;  4O44 A;  4B9N A;  1IKX A;  2PY5 A;  4CF1 A;  4FVM A;  2ZE2 A;  1Q8I A;  1CZB A;  1T7P A;  3F9K A;  3U6F A;  4AHC A;  4HUF A;  1EET A;  5CZ2 A;  4O0I A;  2IDO A;  3MAQ A;  4E7I A;  4EZ6 A;  1DTT A;  1TV6 A;  3HVT A;  4CE9 A;  4DQS A;  4FJM A;  4GVM A;  4K8Z A;  3SNN A;  3THV A;  4CJL A;  2QKB A;  2AJQ A;  4HCC A;  2JLE A;  3QEP A;  4WE1 A;  4Z4C A;  4CJQ A;  2X78 A;  4N5S A;  2OPQ A;  3TAQ A;  4CK2 A;  3KLG A;  1BI4 A;  5HRS A;  1Q9X A;  3H08 A;  4AHU A;  1IH7 A;  3ALY A;  4LD0 A;  4CJ3 A;  4KTQ A;  1YTU A;  1FXX A;  2D5R A;  1BGX T;  2IC3 A;  1LW0 A;  3VQE A;  4DTP A;  2HNY A;  4BAC A;  2G8W A;  1CZ9 A;  2PYJ A;  1UAX A;  3ZT1 A;  4B8C A;  4CFD A;  1ASV A;  4Y1C A;  3VQB A;  4J2A A;  5HRN A;  2HND A;  1SL1 A;  4BE1 A;  4IDK A;  2F8S A;  4ICL A;  1TGO A;  4XIU A;  1FK9 A;  3B6O A;  1RT2 A;  1S1W A;  1EXQ A;  2RN2 A;  2VWJ A;  4BDY A;  2NUB A;  3WNE A;  4PWD A;  4FLU A;  1JL2 A;  1JLQ A;  3LP0 A;  4KHN A;  2Y1J A;  4DQP A;  2I5J A;  4DU1 A;  1EKE A;  1K6Y A;  2OPR A;  3MEC A;  4C8M A;  4FZZ A;  4ZTF A;  2DTU A;  4JRP A;  3ASM A;  4F3O A;  1X9M A;  3L3V A;  1GOC A;  3L2R A;  4W5N A;  2YNI A;  3HPO A;  1BIZ A;  3OJS A;  1T05 A;  5J2Q A;  2G8I A;  2E4L A;  4JS4 A;  4M3R A;  1BL3 A;  3LDS A;  3AO1 A;  4DQQ A;  1BIS A;  2IS3 A;  1JLE A;  4Q0B A;  4FW1 A;  2HNZ A;  1TVR A;  3SJJ A;  1RBT A;  3V1Q A;  3I8D A;  4KFB A;  3M8P A;  1CXU A;  4KHS A;  3G10 A;  1NKE A;  4M41 A;  1S1V A;  3QES A;  4FW2 A;  3LP2 A;  3K59 A;  3KTQ A;  4FJN A;  1TAU A;  3HP6 A;  4FJI A;  1J54 A;  2ITG A;  3T19 A;  3NFA A;  4AH9 A;  5E41 A;  4KRE A;  5CYQ A;  3QET A;  3DLG A;  1C0T A;  1UA0 A;  1N5Y A;  2EX3 A;  4CK3 A;  1SL2 A;  2HHU A;  3SQ2 A;  4FLY A;  3DRR A;  1HYS A;  3M8R A;  1HMV A;  4HVJ A;  4KAZ A;  3ZSW A;  3CFO A;  3SQ1 A;  2B5J A;  1RT5 A;  4OJR A;  4OKK A;  3QEV A;  4E3S A;  1T03 A;  3HPG A;  4FM0 A;  3TI0 A;  1NKC A;  4BDP A;  4Z4I A;  4DQI A;  2HHV A;  4W5R A;  3LPU A;  3SV4 A;  4KTW A;  4I9Q A;  3CFR A;  3AVL A;  3UIQ A;  3ZSZ A;  4FXD A;  3IAY A;  4CJF A;  3PUF A;  3AA5 X;  2OYQ A;  2IGI A;  4QOZ B;  4DSJ A;  1L3S A;  3IRX A;  3OYG A;  4TSX A;  1IKW A;  3QEI A;  4Z4E A;  3MED A;  4KI4 A;  4F3T A;  1O1W A;  2E6L A;  2O4G A;  3M8Q A;  4CGD A;  4CGF A;  5J1E A;  3OYD A;  2PYL A;  2PZS A;  3DRP A;  1TL1 A;  1Z25 A;  1NJZ A;  2QK9 A;  3VQC A;  2DY4 A;  1EP4 A;  2VWK A;  1KLM A;  4DF8 A;  3HO1 A;  4FJK A;  4ELT A;  4E0D A;  5HP1 A;  4FJJ A;  3RTV A;  4RW4 A;  1LAW A;  3KLI A;  4CHQ A;  1WN7 A;  4HHT A;  2KFN A;  1UA1 A;  2X74 A;  1YVU A;  4I2P A;  2DFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...