4CIGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cigA00
4XIUA 4DU4A 3ZT1A 1NKCA 3AV9A 1QQCA 4YNQA 3K5NA 1HQUA 4KHUA 3WNFA 4CGIA 4Q0BA 4OLAA 4C8MA 4CHPA 1TKZA 4B8AB 2RKIA 2F8TA 3HT3A 4DTNA 3K59A 3MEDA 3P5JA 1YVUA 1BL3A 2YV0X 4CEDA 3KLGA 2Y1JA 2XRIA 1C1BA 3E01A 3MECA 4B9LA 1KVAA 3NCIA 2DFFA 4NYNA 3LP0A 4E1NA 4IG0A 4FJKA 3V6DA 4F2SA 1RDDA 1YTAA 2F96A 3OYKA 5KRSA 5FDLA 4M45A 1HPZA 2P51A 3NFAA 3VQ4A 4IKFA 4CF0A 2YNGA 1NK6A 4OGCA 1HYSA 1WSEA 4FJ5A 3FFIA 3L2RA 3C6TA 1C0MA 2OPSA 4M3RA 2XY5A 4F2RA 3NF6A 3TABA 3ASMA 4F3OA 1UA0A 2QK9A 4C8OA 3VA0A 3NAEA 4CHNA 4F8RA 3AVMA 2G8WA 2XY8A 3CM5A 2HNDA 3HYFA 2HHQA 1C0UA 3QLHA 3OYEA 4E7LA 3KK3A 1WSFA 4OKKA 1U47A 1VSDA 3SJJA 2VG5A 4FZYA 4AH9A 4CFCA 4FJ9A 5J2QA 3QERA 2HVHA 3I0SA 4W5NA 1VRTA 1KCFA 3LP2A 4CJEA 3L3VA 3NH2A 3HP9A 4ZTFA 4DQRA 1ZBHA 3T3FA 4F4KA 3ULDA 1D5AA 1S6QA 4ELTA 4FK0A 3AO4A 4BWMA 3ZSQA 3MAQA 4KB0A 3NGIA 4LH4A 1HNIA 1RT6A 3LALA 4J2BA 1FKOA 4E3SA 4BE0A 4FK2A 1JLCA 4Z4HA 4RW9A 4AHTA 4IDKA 3OYAA 3RMCA 3SPZA 3SQ4A 2R7YA 1J5OA 1BQMA 4HUFA 3K5MA 4MFBA 3DLHA 3I8DA 1RTIA 4DFMA 1SL0A 3DRPA 4E89A 4CEBA 5CY4A 2B4JA 1VSJA 3AA2A 2WONA 3HPHA 4W5RA 3CFPA 3OYGA 3MEEA 4LD0A 3T1AA 5I42A 1A5VA 2A1RA 2VWKA 5J1EA 3SV4A 1LAWA 1MU2A 1JXBA 3AA3A 4DS4A 1BIUA 3F73A 3LP1A 1RT7A 3VQQA 3OY9A 1SV5A 3VQ5A 5C25A 4QAGA 1B9FA 1JL1A 5CYQA 3SI6A 4B9UA 3NDKA 1VSMA 3AA4A 2VWJA 1I39A 4CFAA 4CJTA 4Z4CA 4BWJA 2RN2A 4CK1A 4DQQA 3VQEA 4YFUA 3TAGA 4DQIA 3QEIA 2FBYA 1VSKA 5EU7A 3SUPA 4Q5VA 1YTUA 2P1JA 3LAMA 5J2NA 1B9DA 3MXJA 4FJ7A 3TAQA 4CHQA 5KTQA 3SQ0A 4OPJA 2Z1GA 1KVCA 3DLBA 4HUEA 3ALYA 4M3ZA 1KFSA 3HVRA 5SZTA 3MXMA 3QEVA 2BANA 4W5TA 3DLGA 4RW7A 3AVAA 4B08A 1CXQA 4N56A 1NJWA 1RT2A 3PX0A 1TAUA 2HB5A 2X78A 3O3GA 3HPOA 3SPYA 3WNGA 4EZ6A 3V9WA 3V81A 1ZBLA 3NGYA 3PUFA 1D8YA 2XHBA 3VQ8A 1DTQA 3TI0A 3RR7A 4O5BA 4B9TA 3HL8A 5HLFA 3PX6A 2ZE2A 3D0PA 2XY6A 2AJQA 3S9HA 4CJWA 1BI4A 4FZXC 2X6NA 1RBVA 4CHYA 3OYCA 2OYQA 4CE9A 1ITGA 4CK3A 4CEQA 4BE1A 4N41A 2FBXA 4EZ9A 4FW2A 2E4LA 4J2AA 3KKRA 4IBNA 3KK1A 4GW6A 3AVLA 4CF8A 3CG7A 4TSXA 2IOCA 1JLBA 4B8CA 3V9UA 3QEPA 4HCCA 1WAFA 3P1GA 3S3MA 1WSJA 4GMJB 1RT5A 1J9AA 3CFRA 4RW6A 3K5LA 3H08A 3B6PA 3VQCA 1RDBA 3U3GA 2W42A 3AVBA 4BDYA 1T05A 3D45A 3DRSA 2IDOA 4EP4A 3LZIA 4NCAA 3AVKA 3VA3A 4OLBA 4KHQA 3M8PA 1IO2A 4FXDA 3SV3A 2OPPA 1XHXA 1NJZA 1NK7A 4FLYA 3ZSWA 4W5QA 4CGHA 2Z1JA 4CJLA 4H4OA 4FM1A 3KD1E 4CEAA 1RTJA 4FJLA 3ZSVA 3KK2A 1RT3A 3NF7A 1Z26A 1KSPA 4OKEA 4DSLA 3V1RA 1I3AA 3DYAA 4NYFA 4NCGA 4RW8A 4CIGA 4DTRA 1TV6A 3NGZA 3NH1A 2D0CA 4CJ5A 3AVIA 4FJJA 2YHAA 3OYNA 1VSEA 3VQBA 3T19A 4KTWA 3JSMA 1QE1A 2KW4A 4N76A 1TKXA 1NK5A 4OVLA 4ELUA 1XI1A 2F8SA 2KFZA 2OA8A 4AHRA 3C6UA 4DWIA 3TANA 4FJ8A 1LWEA 1LWCA 2HHWA 1D9FA 5T7BA 4M42A 4M3UA 1WAJA 1VSFA 2VG7A 3CYMA 4DTMA 4O0JA 3HXMA 3HK2A 4FJHA 2FBTA 1SKSA 1ZBUA 4J2DA 2Y1IA 1C1CA 2E6LA 2JLEA 4Y1CA 5HBMA 3QESA 1X1PA 5KRTA 3NH0A 2Z1IA 3ZT4A 2IC3A 4N5SA 1U45A 4Z4EA 1KRPA 1EKEA 1J53A 4E7HA 3OYDA 3L2VA 2E6MA 3OVNA 4FLWA 4AILC 1JLGA 1KTQA 1QS4A 1RDCA 1QSSA 4KKOA 4FLZA 5CYMA 4ID1A 1KLNA 4CECA 3MEGA 4O44A 3THVA 3OYHA 1XHZA 1RTHA 1A5WA 4CEEA 3EYZA 1L5UA 1HRHA 2DY4A 1N6QA 3K57A 2HHTA 3QINA 3K2PA 3HJFA 3AVJA 1HYVA 5K14A 2OZMA 2DFHA 3ISNC 1Q8IA 4W5OA 4KPYA 4KFBA 4E19A 1RBUA 3DOLA 4DSJA 3L2QA 4WE1A 3V9ZA 3SCXA 4FK4A 3SNNA 3DI6A 2VG6A 4E1MA 1C6VA 1Q9XA 1HJRA 3OYIA 2PZSA 4H4MA 4FW1A 4CCHA 4K8ZA 2PYLA 4KTZA 2D0BA 2LSNA 1HMVA 3CM6A 4CFDA 3B6OA 2IGIA 4EP5A 4KAZA 1VRUA 3CFOA 1UOCA 2B5JA 2X6SA 1K6YA 3M8QA 3ZSZA 4O0IA 1IKYA 4FM0A 4CJUA 4ZHRA 4DTPA 4B9SA 2BGGA 2HHUA 4Y1DA 3PO4A 4DSKA 1BIZA 1HQEA 1S6PA 5HRNA 4DQPA 3SZ2A 3QNNA 4CJSA 4CJ4A 4Z4IA 1FKPA 1RT4A 3AA5X 4M3XA 4OPKA 4ELVA 1WSGA 3QEXA 5I3UA 1RTDA 4R5PA 4CF9A 5SWMA 4M41A 1DTTA 4M3TA 4FJIA 4C8KA 1S9EA 1F21A 3SUQA 3V9XA 5JS2A 1ZBFA 3VQDA 4KREA 3JYTA 4LY7A 4FLTA 4DU1A 4KO0A 1L3TA 3SUNA 3OYLA 1RCHA 3F9KA 1R0AA 4IFYA 2XO7A 3NF9A 4ID5A 4E7JA 2KZMA 1SL2A 4KHWA 4Z4FA 3HP6A 2EX3A 1RDAA 4H8KA 4B9NA 3C95A 1EP4A 1G15A 5C42A 1NOYA 4KI6A 2ATQA 3TAFA 1XWLA 2NUBA 4M3WA 2OZSA 4F3TA 1ASWA 1HNVA 3K5OA 2QKBA 1T03A 2YNHA 1NK8A 3C94A 1FXXA 4DTOA 3LAKA 1RBTA 4LSLA 1TGOA 1NKEA 3IRXA 5JS1A 1X9WA 1J54A 3VQ9A 1TKDA 1NK0A 4FJMA 4PY5A 3L3UA 4CF2A 4N47A 2KZZA 3V4IA 3L8BA 1EETA 3AVHA 3TAEA 3TR8A 1KFDA 3P83D 2G8VA 3A2FA 4FM2A 1Y97A 2D0AA 5KGXA 4PQUA 4HHTA 4E0DA 4QOZB 5C24A 4DFKA 3EZ5A 1A5XA 1RBSA 3KIOA 1BQNA 3ZSRA 3OYMA 5HRRA 4DF4A 3BDPA 4FYDA 3AVNA 1JLEA 3V9SA 4QCLA 4KRFA 1RBRA 2JGUA 1CZ9A 4Z4GA 3AO3A 4FLUA 2B6AA 4HCBA 3IAYA 1CLQA 3DRRA 4AHSA 1LAVA 3RRHA 1U04A 3HVTA 4DFJA 1VSLA 4Z0UA 3U6FA 3SUOA 4FJGA 1Q9YA 1TKTA 4CERA 1YT3A 3KJVA 2ZD1A 3L2UA 1U48A 2RPIA 4DSEA 5FRNA 1BI4B 3IS9A 4DTSA 1JLQA 1U49A 1TK8A 1NKBA 1LV5A 1SUQA 1S1TA 4CF1A 4FLXA 5D3GA 4CHZA 3VQPA 3OJUA 3BGRA 4CHOA 1QSYA 2X74A 5FROA 1LW2A 2BDPA 3AO2A 2P5GA 1S1VA 2G8KA 1C1AA 1JLFA 1VSIA 5DK5A 1CXUA 3LDSA 4BDZA 3RR8A 4BDPA 4I2QA 1W9HA 4CEZA 4J2EA 4FJXA 4DTJA 5KI6A 3LPTA 5J2PA 3DLEA 3QIPA 3DOKA 1WSIA 5CZ2A 1IKWA 3UIQA 3DLKA 3NBPA 1JXEA 3QIOA 3KLHA 4G1QA 2QKKA 4KHYA 2HHSA 3G0ZA 1VSHA 3ITHA 3AO5A 1GOBA 1BGXT 4RG8A 1HYZA 4DLEA 1UA1A 2Q3SA 4B9MA 3AO1A 3NE6A 1ASUA 2DTUA 4KHNA 2O4GA 4HVJA 4KB1A 4CESA 4RW4A 2DFEA 3ZSXA 4CGGA 2EHGA 3ZT0A 3RMDA 4PUOA 4I2PA 3HSTB 4HTUA 5DMRA 4JS4A 3OS1A 3NHGA 1XC9A 4PA1A 1FK9A 4CJPA 3SYZA 4DFPA 2YKMA 3VQ7A 5KGWA 1T7PA 1GOCA 3U3YA 3OS2A 3S3OA 4DTUA 1EXQA 3MXIA 2IAJA 4C8LA 3LPUA 3HPGA 2KQ2A 3HM9A 2YKNA 3ZT2A 1RILA 3AVGA 3QO9A 1TVRA 3OYJA 2RF2A 2YNFA 3O3FA 3OS0A 4HUGA 4IG3A 2HMIA 2HHVA 2P5OA 4L8RB 3S3NA 2G8UA 4FLVA 2FC0A 4FJNA 1IKVA 4LSNA 2GBZA 1IG9A 4JRPA 1IH7A 4AHVA 3NF8A 3V1QA 3KLFA 3PV8A 2PY5A 2OPQA 4ICLA 4NCBA 4FCYA 4JS5A 2Z1HA 1L3SA 1KLMA 5FRMA 1NOZA 4CJ3A 3SQ2A 2KTQA 5HP1A 3DMJA 3PO5A 5CZ1A 1NJXA 1SL1A 4I9QA 4UQGA 3WNHA 3VN5A 1S1XA 1X9SA 5E41A 2WOMA 3M8RA 3LP3A 4DQSA 1TL3A 2PYJA 4CEFA 2GUIA 1SKRA 1S1WA 1NK4A 2YNIA 4I9LA 1TL1A 2ETJA 4OJRA 2GV9A 4KI4A 1D9DA 3OYFA 4DSFA 4CJVA 4K8XA 1T8EA 1DLOA 4CJQA 1Z25A 2G8FA 4CGDA 3ZCMA 4CIEA 1ZYQA 1REVA 1KVBA 1TAQA 2IS3A 2QXFA 1UWBA 4CJKA 3LZJA 3KKSA 4CIFA 4BACA 3RMBA 4LH5A 3WNEA 5HRPA 2G8IA 2O4IA 4B3OA 4CJRA 3KLEA 2HNYA 3M8SA 3QETA 2ITGA 4CJFA 3DM2A 1EX4A 3KTQA 1S9GA 3KD5E 1S5JA 4JLHA 3RTVA 4AHCA 4M3YA 4KTQA 1LWFA 1QHTA 3VQ6A 4DTXA 1X9MA 1NK9A 1JLAA 1W0HA 4ZTJA 3V1OA 3L2WA 3QNOA 1QSLA 1QTMA 3RRGA 3AVCA 4AHUA 3ZSYA 1TK5A 4KHSA 3K58A 3CQ8A 4CGFA 2OPRA 3IG1A 1O1WA 1WSHA 2HNZA 4IFVA 4O55A 4JRQA 1L3VA 1C0TA 4CK2A 4FZZA 1RT1A 1BISA 4DS5A 4OGEA 4DU3A 4FVMA 3ZT3A 5J2MA 1U4BA 3LWLA 4C8NA 3LWMA 3ZSOA 5HRSA 3HO1A 3TAMA 4GVMA 2HHXA 1GOAA 3OJSA 4BE2A 2FBVA 3LANA 3TAPA 3DLRA 1RNHA 3TWHA 1NJYA 4DMNA 4DSIA 3SQ1A 1IKXA 4CFBA 3KLIA 4MQ3A 2XY7A 1BCMA 1CZBA 2YHBA 3AVFA 4CEOA 4CGJA 3PY8A 4I7FA 2A1SA 1N5YA 3O4NA 1VK0A 1WNSA 3O3HA 1JL2A 3EY1A 4OKJA 3G10A 1BCOA 4B9VA 1WLJA 1ASVA 3VQAA 1BHLA 1JKHA 2G8HA 3PX4A 3RWUA 2HVIA 2I5JA 4O4GA 3RMAA 5HROA 1LW0A 3TARA 1ZBIA 4PWDA 4E7KA 3O4QA 1L3UA 3I0RA 4E7IA 2ZQBA 2HW3A 1S1UA 1TK0A 4DG1A 4DLGA 4KV8A 2BE2A 4DF8A 3QEWA 1WN7A 3OYBA 2D5RA 1UAXA 2KFNA 1SKWA 1B92A
chains in the Genus database with same CATH superfamily
1KAXA 4BR5A 3J8AA 4YNQA 4H03B 3WNFA 5AQQA 4C8MA 4IXCA 3I55N 3MN9A 5EY4A 3KLGA 2Y1JA 4YOYA 3MECA 1KVAA 3NCIA 2DFFA 1X3NA 3ATUA 4IG0A 4FJKA 1KAZA 4JK7A 4DKWA 4CF0A 1NK6A 1T3VA 4FJ5A 1I94K 3FFIA 4BQZA 4C8OA 3VA0A 4JI2K 3KHYA 4UY8O 2O8BB 3QLHA 4OO1J 3KK3A 4FZYA 1VSDA 5M1QA 2VG5A 4CFCA 2HVHA 5J2QA 3QERA 3U8XA 3QMLA 1KCFA 3LP2A 3ID8A 3L3VA 3HP9A 1ZBHA 4F4KA 5BR9A 3AO4A 3FZKA 1M1KO 3SJHA 3THWA 4KB0A 2NNWA 1HNIA 4J2BA 1OH7A 3RMCA 3SQ4A 3DLHA 1P8ZA 3DRPA 3SK3A 2B4JA 4U67L 2WONA 3W0LA 2A1RA 2VWKA 5J1EA 1LAWA 1MU2A 2E2NA 3PIPL 4DS4A 1BIUA 1VQ6N 3F73A 4H0XB 4JKFA 3LP1A 4H0TB 1B9FA 5KQDA 2O8CA 2ZF5O 4RCHA 3NDKA 2VWJA 3CC7N 3U9ZA 3TAGA 2RN2A 2P9SB 3QEIA 1VSKA 3DAWA 4CHQA 5A2QO 4M3ZA 3BF3A 5ADXH 4BG8A 3DLGA 4KH6A 2QA4N 3PX0A 2HB5A 2X78A 3UB5A 4EIAA 3SPYA 1IV0A 4LF9K 3PUFA 2UXDK 4F9OA 2V7YA 1VQ4N 4A5AA 2E2OA 2AA4A 1ITGA 4CEQA 4N41A 2P9LA 1ATNA 4J2AA 1XUPO 4IBNA 3KK1A 2P9UA 4CF8A 4TSXA 1JLBA 3TU5A 4HCCA 1SAZA 1WAFA 3S3MA 2GELA 1JCGA 3ID6A 1J9AA 3H08A 3VQCA 1RDBA 3U3GA 2RHKA 3D45A 1K8AO 4OLBA 3QB0A 3M8PA 1VQ8N 3P38A 2Z1JA 3ENHA 5AQZA 1KSPA 4DV2K 3V1RA 3DYAA 4CIGA 4NCGA 2P9KA 4Y0WA 4CJ5A 3A5MC 3AVIA 1VSEA 2HOEA 4JKEA 1VQMN 4N76A 3LL3A 1NK5A 4OVLA 2F8SA 1XI1A 2GUPA 1RGIA 3M5RA 2HMPA 3C6UA 1D9FA 5T7BA 1XC3A 2VG7A 4DV6K 3K9KA 3HXMA 4J2DA 4JEPA 4OPAA 1ZBUA 1C1CA 5HBMA 3NH0A 3HBTA 3ZT4A 4N5SA 5KPZA 1J53A 4E7HA 1TK5A 1ATSA 3OVNA 3M3ZA 4IOAL 3MN5A 4BC2A 4ID1A 3ZEUB 4CECA 3HRGA 2UU9K 1RTHA 3K57A 3QINA 2O8FA 1G99A 1P90A 1WB9A 1JCEA 4KPYA 4KFBA 3DWLA 1V4SA 4E1MA 3A0IX 1Q9XA 2PZSA 4DUZK 4BR7A 4K8ZA 2PYLA 2D0BA 2LSNA 3CM6A 3ZETB 2IGIA 4KAZA 1VRUA 4O0IA 2X6SA 1SKWA 4DTPA 3ZYYX 4DQPA 3IMXA 4CJ4A 4DR4K 4Z4IA 1RT4A 2E88A 4M3XA 3C7NB 5AQGA 4OPKA 4M7YA 4CZGA 4ELVA 5M1OA 1RTDA 4CF9A 4M41A 4M3TA 4XH5A 4EAHD 3SUQA 1ZBFA 2F7TA 4BGBA 4JHDB 4LY7A 5AQSA 4A61A 1FJGK 3SUNA 2HBLA 2NRZA 3F9KA 4JKAA 2KZMA 4KHWA 5DM7L 1KD1O 4DUYK 4KI6A 1NG9A 2ATQA 1XWLA 2NUBA 4M3WA 3K5OA 1NGCA 3MCAB 4DTOA 1FXXA 3LAKA 4YY3K 3IRXA 5BRDA 1J54A 2IVNA 1NK0A 4NXNK 1X9JA 3L3UA 4CF2A 3VERA 2KZZA 4YOTA 1C0GA 2G8VA 4FM2A 2D0AA 2GEMA 5E26A 4E0DA 3CCMN 5FLXO 5BPLA 1RBSA 4DF4A 4FOEA 3V9SA 3ULEA 3IAYA 2UXBK 3EN9A 1Q9YA 4CERA 1GLCG 2NRHA 3PSIA 2VYPA 4IWVA 5C2FA 1SUQA 3GG4A 5D3GA 3OJUA 3BGRA 4CHOA 4X62K 4ISFA 5HL7L 1QSYA 1LW2A 4H0VB 2BDPA 2QWLA 1BU6O 1S1VA 1XNQK 4BDZA 1VSIA 5DK5A 5AQHA 3RR8A 4I2QA 2P9NA 4I6MA 4BRFA 3QIPA 4KHYA 3QIOA 4G1QA 3E9PA 4DLEA 2DTUA 4B9MA 3NE6A 2O4GA 3CJ1A 3OW2M 4RW4A 3ZSXA 2EHGA 3ZT0A 4I2PA 3G4SN 3HSTB 4HTUA 4CZFA 1TYQA 5DMRA 4JS4A 4PA1A 3OHRA 1JCFA 1T7PA 2OANA 1K9MO 3MX5A 4JI1K 4BGAA 2KQ2A 1RILA 3AVGA 3QO9A 1N36K 3OYJA 1OH5A 5C2DA 4GV3A 4L8RB 3O80A 1K8KA 4FLVA 4MO4A 5C10A 4CZKA 2E2PA 2PY5A 1BG3A 3KLFA 1YUWA 4IO9L 3AARA 1KLMA 1NOZA 4CJ3A 3D2EB 3DMJA 3PO5A 5CZ1A 4BVOA 3LM2A 4I9QA 4UQGA 3DJCA 3WNHA 2NRTA 4IDHA 1X9SA 1VQNN 2GUIA 2YX6A 4B1WB 2YNIA 1ZXOA 5IWAK 1Z25A 4XEIA 4CBWA 4CGDA 4GNIA 4CIEA 1KVBA 4BACA 4FWSA 3KKSA 4FWRA 1XMOK 3D6RA 3DM2A 3KD5E 1OH8A 4U7BA 3RTVA 1LWFA 2QWQA 4HTLA 5M1NA 5FPNA 5GADP 4LFBK 3QNOA 4OX9K 5JLHA 4CGFA 3H46O 3CC2N 2HNZA 4B3MK 4FZZA 3SBTA 4DS5A 4OGEA 4DU3A 5LJVA 2E2QA 2QTDA 3LWMA 3ZSOA 4PKHA 3DLRA 4BR4A 4QS8A 2CGKA 4A62A 3PY8A 3AVFA 3VEVA 2UUAK 1N5YA 1JL2A 3G10A 3HSCA 2G8HA 1KAYA 2I5JA 5HROA 5C12A 3I8BA 3VEXA 3O5BA 2BTFA 1IBLK 1L3UA 3VF6A 2HW3A 1TK0A 4DG1A 4DLGA 4DF8A 2E8AA 2P9IA 1WN7A 4X64K 2D5RA 1UAXA 4DQ8A 1B92A 4BRLA 1QQCA 5JVGL 3K5NA 4KHUA 5JICA 4OLAA 4CHPA 4DTNA 3VGMA 3P5JA 1O13A 4CEDA 3O9RA 2P9KB 4BY9C 3F9MA 3V6DA 1RDDA 1YTAA 3OYKA 1K73O 5KRSA 4M45A 2IVPA 3VGLA 3NFAA 2FLOA 3IKMA 2YNGA 1HYSA 3L2RA 3CJ9A 1DGKN 3NF6A 2UXCK 4F3OA 4CJ7A 4ISGA 3AVMA 4B9QA 3FZLA 2XY8A 3CM5A 2HHQA 3OYEA 5AQXA 4E7LA 3DXMB 4FWLA 3IFRA 3CQYA 5KPTA 4FJ9A 1IBMK 5LL6Z 3I0SA 5AQVA 1VRTA 3H1VX 3K9JA 4DQRA 1ATRA 5AJ3K 1CZAN 3WEEB 1S6QA 4ELTA 4FK0A 3CCLN 3VENA 3ZSQA 3NGIA 4BC4A 4LH4A 1RT6A 4NLBA 4Z4HA 4GKJK 1NJIO 5AZIA 4PL7A 3I8DA 1RTIA 1SL0A 5CY4A 1DKGD 1VSJA 3AA2A 3HPHA 2D0OA 5LMNK 3CFPA 3R6MA 4JKGA 4LD0A 5AZIB 3T1AA 3U9DA 5FPEA 1JXBA 3AA3A 4FWMA 3KZBA 3D2FB 1QHAA 1E4FT 3OY9A 5C25A 3SI6A 1JL1A 4O8KA 4FJ8A 4YOXA 3MK6A 3CJBA 2P9SA 4CFAA 4CJTA 4CK1A 4Z4CA 3CCRN 2E5LK 3VQEA 1HNZK 2O8CB 2FBYA 1VQ5N 2P1JA 3H3NO 1BA0A 4BRNA 1XMQK 5AQWA 3I56N 4OPJA 3MMVA 3ALYA 1N8RO 1VAZA 2P9NB 4W5TA 4E1JA 4RW7A 5AZJA 2YHXA 3AVAA 4M63C 4XH4A 4N56A 1RT2A 2OTJN 3MX2A 3HPOA 3D7EO 4EZ6A 3CERA 4YHHK 3VPZA 1ZBLA 3CCSN 3H45C 1YIJN 2UYTA 4DR2K 2ZE2A 1Q7YO 1V4TA 4LFAK 4NO7A 3D0PA 2XY6A 3S9HA 4CJWA 3JXUA 4FZXC 2A41A 2X6NA 1RBVA 1MWMA 2OYQA 1HKBA 4B1ZA 2E4LA 3KKRA 3WXIA 2VGNA 5I9EB 5MLCQ 3AVLA 3CMAN 4H5WA 3CG7A 3ULEB 2IOCA 4B8CA 3QEPA 4X66K 3WXJA 3E9LA 3RVCA 2GX9A 2W42A 3JS6A 3DRSA 4JK9A 3SV3A 2OPPA 1XHXA 1IJJA 4CJLA 5F2RA 4CEAA 3ZSVA 3KK2A 4JI6K 4OKEA 4NYFA 3ZX2A 3O08A 2D0CA 3J80O 2FF6A 5BN8A 2FSJA 3VQBA 1NMDA 2CH6A 3T19A 1QE1A 4R79A 1TKXA 3VOVA 4LFCK 2KFZA 4PKIA 3O6WA 1LWCA 2HHWA 1YXQA 4BRIA 3AAPA 1RFQA 4DTMA 4BR2A 2FBTA 1SKSA 4JAXA 4Y1CA 1X1PA 3SMSA 4BRKA 2Z1IA 4Z4EA 4BRPA 4JV5K 1RDCA 4PL8A 1QSSA 1KLNA 3MEGA 4WF9L 3EYZA 4DCHA 1Q81O 1L5UA 2NRWA 2HHTA 3H1QA 3C6HA 3HJFA 3AVJA 5CR4A 1HYVA 3BZKA 2OCEA 4W5OA 2HBKA 1RBUA 2KLAA 3DOLA 4DSJA 5GINA 3V9ZA 2YJFA 4FK4A 4QS7A 1HJRA 3OYIA 3AGKA 2H3GX 4H4MA 4JI3K 4JI4K 4O8UA 4CFDA 3CFOA 1UOCA 3D2EA 1IKYA 4ZHRA 1NWKA 3UKUA 2NRXA 4DSKA 3PO4A 1HQEA 3N4PA 3SZ2A 3QNNA 2VQFK 2JWKA 4CD1A 3AA5X 2EWSA 1QQMA 3QEXA 4R5PA 1U6ZA 3WUHA 2NRRA 1S9EA 2QXLA 4H5NA 4KREA 5AFUH 3JYTA 4FLTA 2BUPA 3HTVA 2P9PB 4IO8A 4WFBL 5AQRA 4ID5A 3THXA 1SL2A 4FPAA 4EHTA 3VEOA 4WQ5A 3C95A 4CW7B 3TAFA 3MN7A 4F3TA 4BG9A 2VWBA 3C6AA 3T69A 4AM7A 5JS1A 3W3DA 4B1XB 3A8YA 3VQ9A 2NRVA 4PY5A 4IEIA 4N47A 4FVUA 3OA9A 1EETA 4YOVA 2CGLA 3A2FA 1Y97A 4DV4K 1OKJA 3M6GA 2HSTA 4DFKA 4A2BA 1A5XA 3KIOA 5JVHL 5HRRA 1JLEA 4GV9A 4QCLA 4KRFA 3SAFA 1RBRA 1LOTB 4Z4GA 3AO3A 2V51B 4HCBA 4NB4A 3DRRA 3RRHA 1U04A 4FJGA 1YT3A 3DXKA 3CCEN 4W5NA 1BOTO 2RPIA 4H5TA 4DSEA 1BDGA 3CXCM 1S1TA 3CJCA 4CF1A 4CHZA 5BREA 2X74A 3M1FA 2G8KA 1C1AA 4FSVA 1JLFA 1NLVA 3OBYA 3LDSA 4FJXA 2YHYA 4DTJA 3LPTA 5J2PA 3GE1A 3DOKA 5CZ2A 3UIQA 1NGFA 3DLKA 1JXEA 4BROA 4B3RK 1VSHA 2WUSA 1DT9A 3RMDA 4PUOA 3NHGA 1XC9A 1FK9A 3DXKB 5CHIA 5KGWA 1GOCA 3U3YA 4DTUA 1MWKA 1W2BM 1EWQA 3LPUA 3FGUA 4G9ZA 3O9TA 3OS0A 2HMIA 1KXPA 4JD2A 3TSQA 2GBZA 3C7NA 4JRPA 3ATVA 1IH7A 4DR1K 1IG9A 3NF8A 3V1QA 3PV8A 2OPQA 3BF1A 4NCBA 1ESVA 3TTCA 3SQ2A 2YCHA 2AP1A 4DB3A 1SL1A 3VN5A 2WOMA 3M8RA 3LP3A 4CBXA 2PYJA 3IDHA 4OJRA 1TL1A 2ETJA 4WQ4A 4B1YB 3D2FA 4Z94A 1D9DA 3P4IA 3VEYA 2G8FA 1EWRA 3Q7BA 3ZCMA 3NVMA 3WQUA 3RMBA 2IS3A 4K8XA 3LZJA 4CIFA 2O4IA 4LH5A 5HRPA 4JKGB 2G8IA 4A2AA 4CJRA 2HNYA 3M8SA 4CJFA 1RDUA 1EX4A 2D4WA 3R3LA 4AHCA 4M3YA 2IVOA 1X9MA 1NK9A 1GLEG 3FZHA 3TTDA 3T7ZA 2CH5A 1QSLA 3RRGA 3MCPA 3K58A 5AQIA 4IOCL 2OPRA 1L3VA 4O55A 4JRQA 5EVZA 3L4IA 3SLCA 3OTOK 4B3SK 1NBWA 4V19S 3CPWM 1U4BA 5J2MA 1BO5O 4C8NA 3HO1A 3LANA 3LM9A 3TWHA 2UUCK 3O9UA 5DM6L 4DSIA 3SQ1A 4CFBA 3KLIA 4MQ3A 2XY7A 1BCMA 1CZBA 4CEOA 4CGJA 5H1SQ 4I7FA 5F0XA 3O4NA 3J81O 2WBNA 3CCVN 3CCJN 3BUZB 4ILHA 1WLJA 1VQ7N 3RWUA 2O8EA 2A40A 1ZBIA 4E7KA 2BE2A 3QEWA 1NGDA 5AQKA 1VQKN 4XIUA 3ZT1A 3THYB 3AV9A 1HQUA 3P31A 4CGIA 1Q18A 4B8AB 1NMNA 3K59A 2VCPA 3L6QA 1SQKA 2P9LB 4BR9A 1Y64A 3ENOA 1J5EK 3E01A 4B9LA 4NYNA 1RDWX 4E1NA 4F2SA 2F96A 5ELZA 3GL1A 5GAHP 1HPZA 4IKFA 1HKGA 1WSEA 4B1VA 3C6TA 4DV3K 3J7AP 2OPSA 4M3RA 4F2RA 3ASMA 3EL2A 2QK9A 4OPHA 2VQEK 2GWKA 4F8RA 5GAGP 2HNDA 1Z6RA 3HYFA 3VF2A 1C0UA 1U47A 3SJJA 3UKRA 4AH9A 4FWQA 4CVNE 4XH1A 4CJEA 4ZTFA 3NH2A 4LF6K 3ULDA 4M7XA 4PKGA 2PBDA 3J7ZO 2HBJA 3G71N 4FK2A 1JLCA 4RW9A 4AHTA 4IDKA 4FPBA 3OYAA 3SPZA 3K5MA 4DFMA 4E89A 5LY3A 2QM1A 2FXUA 3OYGA 1A5VA 3CCQN 3SV4A 1NNEA 3Q7CA 2A42A 1RT7A 3VQQA 4B9UA 3OBWA 3AA4A 1I39A 4DQQA 4BWJA 3VEWA 3ZX3A 4YFUA 2QWNA 4Q5VA 3LAMA 5J2NA 4FJ7A 2O8BA 3TAQA 5KTQA 4CI6A 4HUEA 1KFSA 2GWJA 3QDKA 4JKBA 1CXQA 1NJWA 3ZLJA 3NVKA 3PLAA 1D8YA 4B9TA 2A3ZA 3TI0A 4O5BA 3HL8A 2KKZA 1HJOA 3EEQA 3PX6A 4CZMA 4CE9A 4BE1A 2FBXA 4BC3A 4GW6A 1GLAG 4GMJB 3CFRA 2YI1A 3DXMA 3K5LA 3AGRA 1T05A 4BDYA 3EKUA 3F2KA 4NCAA 3VA3A 4I6MB 4GKKK 1SS6A 4KHQA 4FLYA 4W5QA 4FM1A 1GLJO 1RTJA 2HBMA 1Z26A 1YJ9N 2PAVA 4H0YB 1TV6A 1SZ2A 4FJJA 2YHAA 3THXB 3JSMA 3I33A 4DWIA 3TANA 3CMEN 4M42A 1S72N 4M3UA 1WAJA 1VSFA 4MLHA 3HK2A 4FJHA 2P9IB 1YI2N 2Y1IA 5AQTA 2HHHK 3QESA 4NLCA 3BEXA 2IC3A 2QWOA 5BR8K 1U45A 1KRPA 1EKEA 4AILC 2E6MA 1KTQA 1YF5L 3UKUB 1GLDG 4KKOA 4FLZA 4O44A 3THVA 1XHZA 1WBBA 1U2VB 2DY4A 3TSPA 1N6QA 3S41A 3K2PA 1N34K 4YDUA 1GLFO 5AQNA 4KBOA 5K14A 2DFHA 1YJNN 3ISNC 1Q8IA 3GBTA 3EZWA 3SCXA 3DI6A 2VG6A 1C6VA 4FWKA 4CZIA 4CCHA 1KQSM 5AR0A 3B6OA 2B5JA 1HKCA 3WXMB 4BRCA 4CJUA 4B9SA 2HHUA 1BIZA 3AY9A 4JK8A 5HRNA 4CJSA 3FZMA 3VTHA 3RSEB 3E1YA 2V7ZA 5SWMA 4LF7K 1DTTA 3CHWA 5HOOA 4YOWA 2NLXA 1F21A 5TKYA 4BRGA 3ZETA 3V9XA 3VQDA 1L3TA 5M1FA 1RCHA 3EO3A 1EO1A 1Z05A 4IFYA 2XO7A 5JLFA 3NF9A 4E7JA 1RDAA 4H8KA 5AQLA 4B9NA 1G15A 3WXKA 3R8EA 1HNVA 1T03A 2YNHA 3C94A 1TGOA 1X9WA 4FJMA 3V4IA 4JI5K 3TR8A 3P83D 3EKSA 4DR5K 5KGXA 2ASPA 4HHTA 3WQTA 3EZ5A 3TPQA 1BQNA 4FYDA 3BY5A 3QICA 2JGUA 4FLUA 1VQLN 2B6AA 2Q36A 1LAVA 3UE5A 3HVTA 1VSLA 4Z0UA 3SUOA 2W40A 3KJVA 3L2UA 5FPDA 1U48A 1BI4B 3IS9A 3VESA 1JLQA 1TYQB 4DTSA 1TK8A 1NKBA 2QI2A 3QBWA 1YJWN 1QZ5A 3LDLA 2Q0RA 2ZGYA 5FROA 3AO2A 1HUXA 2ZJRL 4DR3K 2NZTA 5AZJB 1W9HA 4CEZA 3HI0A 4J2EA 2ASOA 1XNRK 4AQYK 3DLEA 3NBPA 2QKKA 2HHSA 3G0ZA 3ITHA 1GOBA 5AQJA 4RG8A 1HYZA 3EE8A 4KHNA 4HVJA 3HOSA 3SAHA 2DFEA 3ENBA 3OS1A 5GIOA 3SYZA 4DFPA 3K0SA 1LCUA 2YKMA 5EXWA 3VQ7A 3VMFB 3CETA 2W6KA 3QFPA 1EXQA 4C8LA 3HPGA 2YJEA 4MLEA 3ZT2A 4K42A 3ZX0A 1TVRA 2WFBA 2YNFA 4YDUC 5AQOA 3SBGA 1DEJA 5KPRA 3S3NA 2G8UA 2FC0A 2A5XA 2ZJPL 3CQXA 4LSNA 3LDQA 4ICLA 4FCYA 1NGIA 2Z1HA 2KTQA 5GIPA 5HP1A 3CC4N 3PSFA 1S1XA 5E41A 4CZJA 4DQSA 4FWNA 2F9TA 3VEZA 4CEFA 1VQPN 1S1WA 4JN4A 3DLLL 4JKDA 3CF5L 4DSFA 3VTIA 4CJVA 4CJQA 1ZYQA 3CD6N 3CJAA 3WNEA 2QWRA 4B3OA 5AQPA 2ITGA 3KTQA 1S5JA 4JLHA 4RWTA 4JI0K 4LF5K 3VQ6A 3P39A 4DTXA 1W0HA 3HM8A 1WBDA 3KK7A 3V1OA 3L2WA 2O8DA 2F4VK 1QTMA 3AVCA 3ZSYA 4KHSA 1BWFO 3THWB 3CQ8A 4B3TK 3L4QA 3A5LC 4JNEA 3IG1A 1O1WA 1QZ6A 2I7PA 4JKHA 4CK2A 1RT1A 1BISA 1VQ9N 4FVMA 1NGGA 3MDQA 3CPEA 4KH4A 5HRSA 3FE1A 2HHXA 3OJSA 4BE2A 3TAPA 1NJYA 1IKXA 1HNWK 2BH1A 2YHBA 2O8FB 3HOTA 2A1SA 4K0KK 1WNSA 5C15A 3EY1A 3EE9A 1BCOA 1ASVA 1JKHA 2HVIA 2JWLA 4A59A 4O4GA 1LW0A 5BPNA 3TARA 4CZHA 3C65A 3O4QA 3I0RA 4C1NK 2ZQBA 1M90O 4DR6K 2V52B 3H3OB 4DV5K 2KFNA 3SMPA 4DU4A 1NKCA 1TUUA 3FZFA 3LDNA 1KC8O 3VF4A 4Q0BA 2QWPA 3G25A 1TKZA 2F8TA 2RKIA 3GDQA 4WFAL 3HT3A 1ILYA 2VGMA 3O9QA 1QVGM 1ZC6A 3MEDA 1YVUA 4L3QA 1BL3A 2YV0X 1JJ2M 4DR7K 2XRIA 1C1BA 1WOQA 1BUPA 3LP0A 2QWMA 1T6DA 4BR0A 1Q86O 2GTDA 5FDLA 2P51A 3VQ4A 4CD3A 1GLBG 4OGCA 4WCEL 5JMVA 1C0MA 3C0BA 2XY5A 3TABA 5LJWA 1UA0A 3NAEA 4CHNA 2G8WA 4BC5A 1WSFA 4OKKA 2WTUA 1EQYA 3O1BA 4IZ9A 4GV6A 1IBKK 2DPNA 3O1WA 3T3FA 4IOXA 1T6CA 2P9UB 1D5AA 5BN9A 1S3XA 2Q97A 4BWMA 3MAQA 5KQ8A 2I7NA 4BQLA 3LALA 1FKOA 4E3SA 4BE0A 2E1YA 2Q2RA 2R7YA 5BRHA 1BQMA 3E9OA 4HUFA 1K8KB 4MFBA 1J5OA 2ASMA 2FSKA 5B8HA 3TSUA 4CEBA 1HPMA 4RTFD 4JYAK 3MWTA 4FWPA 4W5RA 3MEEA 3T1YK 5I42A 1WUAA 4HWIA 1SV5A 3VQ5A 4QAGA 5CYQA 1VSMA 4DQIA 1YAGA 5AQUA 5EU7A 3SUPA 1QVFM 1YTUA 4FOIA 1B9DA 3MXJA 1HX1A 3SQ0A 2Z1GA 1KVCA 3DLBA 3GOIA 3HVRA 1NU0A 5SZTA 3QEVA 3MXMA 2BANA 3QFUA 4B08A 1TAUA 3O3GA 3MWPA 3WNGA 3V9WA 4B1UB 3V81A 3NGYA 2XHBA 3VQ8A 1DTQA 3RR7A 2E1ZA 5HLFA 2AJQA 2QW9A 1BI4A 4CHYA 3OYCA 4CK3A 4EZ9A 4FW2A 4CZEA 4DV1K 3V9UA 3P1GA 1VQON 1WSJA 1BA1A 1RT5A 4RW6A 4BRHA 5IT9O 3B6PA 4ILGB 3AVBA 4BVPA 4EP4A 5BRFA 1NGEA 2IDOA 3LZIA 2YHWA 3AVKA 4DV0K 1Q82O 1IO2A 4FXDA 1NJZA 1NK7A 4H0PA 4YOUA 3ZSWA 1S22A 3KD1E 4C23A 4CGHA 1XQSC 4H4OA 1FW6A 3L0QA 1W7AA 5TKWA 4FJLA 1RT3A 3NF7A 1N33K 3BZCA 3R9PA 5F1XA 4DSLA 1I3AA 1X3MA 4DTRA 4RW8A 3NGZA 1IG8A 3NH1A 3LDOA 1HNXK 3OYNA 4KTWA 2KW4A 2FSNA 5AQMA 4IFEA 3MN6A 2WC9A 2HF3A 2ITMA 4ELUA 4AF1A 2OA8A 4AHRA 2A6AA 1LWEA 4WYBA 4JHDA 4JKCA 4WQ4C 3THYA 3CYMA 3F5TA 4O0JA 4DHYA 3B8AX 3O8MA 2E6LA 2JLEA 4GY2B 5KRTA 4CZLA 2O8DB 3RSEA 4C1NI 3OYDA 3L2VA 4A5BA 4FLWA 1JLGA 1QS4A 2ZM6K 5FPMA 5CYMA 5GAEP 5C0YA 4BRQA 3OYHA 1A5WA 4CEEA 1HRHA 2D0PA 2QEXN 2PFUA 4IJAA 2OZMA 4E19A 4YORA 3L2QA 2F9WA 4WE1A 3SNNA 1GLLO 2Q31A 1NGHA 3VETA 3O4WA 4FW1A 3FLCO 3HZ6A 4KTZA 4BRDA 1HMVA 4EP5A 3ZEUA 3M8QA 3ZSZA 4ISEA 1K6YA 4FM0A 1OVYA 5BPMA 2BGGA 4Y1DA 1TUYA 4QS9A 1S6PA 1FKPA 4NXMK 4K41A 1WSGA 5EOYA 5I3UA 4FJIA 4C8KA 5JS2A 2HF4A 3R1XA 4DU1A 4KO0A 5E84A 3OYLA 4BREA 1R0AA 1ZBSA 4Z4FA 3HP6A 4A57A 2EX3A 3E66A 1EP4A 1NOYA 5C42A 4AM6A 2OZSA 1ASWA 2QKBA 1NK8A 3JAMO 4LSLA 1RBTA 1NKEA 1MA9B 4LF8K 3G6EN 3BP8A 1TKDA 4KHPK 4H0OA 4CBUA 4GVEA 3VGKA 1MDUB 4FL9A 3L8BA 3AVHA 1D4XA 3TAEA 1KFDA 4JD2B 1W97L 4WFNL 2CGJA 1YVNA 2Q0UA 4PQUA 3FFKB 4QOZB 1OH6A 5C24A 3ZSRA 3OYMA 3BDPA 3AVNA 4KH5A 2ZGZA 1N32K 5AQYA 3QBXA 1CZ9A 4BRAA 1CLQA 3A5NC 4AHSA 3SAGA 4DFJA 3U6FA 1TKTA 2ZD1A 4MO5A 5FRNA 1U49A 2ZWHA 1NM1A 5EX5A 1LV5A 3KVGA 4WQ5C 1H1VA 4FLXA 4H5RA 1QQNA 3VQPA 3N4QA 2P5GA 4BDPA 1CXUA 5CE3A 5M1PA 5KI6A 3U4LA 5AQFA 4X65K 3J7YP 2Q1NA 1WSIA 1IKWA 3KLHA 3AO5A 3WT0A 1BGXT 1UA1A 2Q3SA 3AO1A 1ASUA 2IIRA 5ADXA 4KB1A 4CESA 4IEEA 4CGGA 4JI7K 4PHTX 4BRMA 4IJNA 4CJPA 4ILJA 3OS2A 3S3OA 3WXLA 3CIPA 3MXIA 2IAJA 1J6ZA 3HM9A 1QQOA 2YKNA 1T44A 4MDAA 4O5FA 3A5OC 2RF2A 3O9SA 1E3MA 3O3FA 4HUGA 4IG3A 2HHVA 1VHXA 2P5OA 2W41A 5LMUK 3PIOL 4FJNA 1IKVA 4AHVA 1YITN 4JS5A 4LF4K 3FR0A 1L3SA 5FRMA 1NJXA 4K43A 4LC9B 1C0FA 4K25A 2KHOA 1TL3A 1HR0K 4MDBA 4EHUA 1SKRA 1NK4A 4I9LA 3UKRB 2GV9A 4KI4A 3OYFA 1YHQN 1T8EA 1DLOA 4H5VA 2P9PA 2J4RA 1REVA 1TAQA 2QXFA 1UWBA 3IUCA 4CJKA 4FO0A 1U2VA 1NGAA 3KLEA 3QETA 1S9GA 4KTQA 1QHTA 4EFHA 5M1KA 1JLAA 4J8FA 3CJ7A 2ZJQL 4ZTJA 3CCUN 4AHUA 3AAQA 2W6LA 3T1HK 4DV7K 3TTFA 1WSHA 4IFVA 3WEEA 2OTLN 1C0TA 4FWOA 3ZT3A 3KWIA 3LWLA 3H6EA 2FF3B 3TAMA 4GVMA 1GOAA 2FBVA 1RNHA 2D1KA 3KWGA 3LDPA 4JI8K 1E4GT 4DMNA 2E20A 2UUBK 2O8EB 3NMUA 1HLUA 1VK0A 3O3HA 4OKJA 1NGJA 5AFUA 4B9VA 3VQAA 1BHLA 1OVQA 3PX4A 3RMAA 4PWDA 4E7IA 1S1UA 4KV8A 1NGBA 1R59O 3OYBA 3CI5A 2RE2A
chains in the Genus database with same CATH topology
4XIUA 4DU4A 3ZT1A 1NKCA 3AV9A 1QQCA 4YNQA 3K5NA 1HQUA 4KHUA 3WNFA 4CGIA 4Q0BA 4OLAA 4C8MA 4CHPA 1TKZA 4B8AB 2RKIA 2F8TA 3HT3A 4DTNA 3K59A 3MEDA 3P5JA 1YVUA 1BL3A 2YV0X 4CEDA 3KLGA 2Y1JA 2XRIA 1C1BA 3E01A 3MECA 4B9LA 1KVAA 3NCIA 2DFFA 4NYNA 3LP0A 4E1NA 4IG0A 4FJKA 3V6DA 4F2SA 1RDDA 1YTAA 2F96A 3OYKA 5KRSA 5FDLA 4M45A 1HPZA 2P51A 3NFAA 3VQ4A 4IKFA 4CF0A 2YNGA 1NK6A 4OGCA 1HYSA 1WSEA 4FJ5A 3FFIA 3L2RA 3C6TA 1C0MA 2OPSA 4M3RA 2XY5A 4F2RA 3NF6A 3TABA 3ASMA 4F3OA 1UA0A 2QK9A 4C8OA 3VA0A 3NAEA 4CHNA 4F8RA 3AVMA 2G8WA 2XY8A 3CM5A 2HNDA 3HYFA 2HHQA 1C0UA 3QLHA 3OYEA 4E7LA 3KK3A 1WSFA 4OKKA 1U47A 1VSDA 3SJJA 2VG5A 4FZYA 4AH9A 4CFCA 4FJ9A 5J2QA 3QERA 2HVHA 3I0SA 4W5NA 1VRTA 1KCFA 3LP2A 4CJEA 3L3VA 3NH2A 3HP9A 4ZTFA 4DQRA 1ZBHA 3T3FA 4F4KA 3ULDA 1D5AA 1S6QA 4ELTA 4FK0A 3AO4A 4BWMA 3ZSQA 3MAQA 4KB0A 3NGIA 4LH4A 1HNIA 1RT6A 3LALA 4J2BA 1FKOA 4E3SA 4BE0A 4FK2A 1JLCA 4Z4HA 4RW9A 4AHTA 4IDKA 3OYAA 3RMCA 3SPZA 3SQ4A 2R7YA 1J5OA 1BQMA 4HUFA 3K5MA 4MFBA 3DLHA 3I8DA 1RTIA 4DFMA 1SL0A 3DRPA 4E89A 4CEBA 5CY4A 2B4JA 1VSJA 3AA2A 2WONA 3HPHA 4W5RA 3CFPA 3OYGA 3MEEA 4LD0A 3T1AA 5I42A 1A5VA 2A1RA 2VWKA 5J1EA 3SV4A 1LAWA 1MU2A 1JXBA 3AA3A 4DS4A 1BIUA 3F73A 3LP1A 1RT7A 3VQQA 3OY9A 1SV5A 3VQ5A 5C25A 4QAGA 1B9FA 1JL1A 5CYQA 3SI6A 4B9UA 3NDKA 1VSMA 3AA4A 2VWJA 1I39A 4CFAA 4CJTA 4Z4CA 4BWJA 2RN2A 4CK1A 4DQQA 3VQEA 4YFUA 3TAGA 4DQIA 3QEIA 2FBYA 1VSKA 5EU7A 3SUPA 4Q5VA 1YTUA 2P1JA 3LAMA 5J2NA 1B9DA 3MXJA 4FJ7A 3TAQA 4CHQA 5KTQA 3SQ0A 4OPJA 2Z1GA 1KVCA 3DLBA 4HUEA 3ALYA 4M3ZA 1KFSA 3HVRA 5SZTA 3MXMA 3QEVA 2BANA 4W5TA 3DLGA 4RW7A 3AVAA 4B08A 1CXQA 4N56A 1NJWA 1RT2A 3PX0A 1TAUA 2HB5A 2X78A 3O3GA 3HPOA 3SPYA 3WNGA 4EZ6A 3V9WA 3V81A 1ZBLA 3NGYA 3PUFA 1D8YA 2XHBA 3VQ8A 1DTQA 3TI0A 3RR7A 4O5BA 4B9TA 3HL8A 5HLFA 3PX6A 2ZE2A 3D0PA 2XY6A 2AJQA 3S9HA 4CJWA 1BI4A 4FZXC 2X6NA 1RBVA 4CHYA 3OYCA 2OYQA 4CE9A 1ITGA 4CK3A 4CEQA 4BE1A 4N41A 2FBXA 4EZ9A 4FW2A 2E4LA 4J2AA 3KKRA 4IBNA 3KK1A 4GW6A 3AVLA 4CF8A 3CG7A 4TSXA 2IOCA 1JLBA 4B8CA 3V9UA 3QEPA 4HCCA 1WAFA 3P1GA 3S3MA 1WSJA 4GMJB 1RT5A 1J9AA 3CFRA 4RW6A 3K5LA 3H08A 3B6PA 3VQCA 1RDBA 3U3GA 2W42A 3AVBA 4BDYA 1T05A 3D45A 3DRSA 2IDOA 4EP4A 3LZIA 4NCAA 3AVKA 3VA3A 4OLBA 4KHQA 3M8PA 1IO2A 4FXDA 3SV3A 2OPPA 1XHXA 1NJZA 1NK7A 4FLYA 3ZSWA 4W5QA 4CGHA 2Z1JA 4CJLA 4H4OA 4FM1A 3KD1E 4CEAA 1RTJA 4FJLA 3ZSVA 3KK2A 1RT3A 3NF7A 1Z26A 1KSPA 4OKEA 4DSLA 3V1RA 1I3AA 3DYAA 4NYFA 4NCGA 4RW8A 4CIGA 4DTRA 1TV6A 3NGZA 3NH1A 2D0CA 4CJ5A 3AVIA 4FJJA 2YHAA 3OYNA 1VSEA 3VQBA 3T19A 4KTWA 3JSMA 1QE1A 2KW4A 4N76A 1TKXA 1NK5A 4OVLA 4ELUA 1XI1A 2F8SA 2KFZA 2OA8A 4AHRA 3C6UA 4DWIA 3TANA 4FJ8A 1LWEA 1LWCA 2HHWA 1D9FA 5T7BA 4M42A 4M3UA 1WAJA 1VSFA 2VG7A 3CYMA 4DTMA 4O0JA 3HXMA 3HK2A 4FJHA 2FBTA 1SKSA 1ZBUA 4J2DA 2Y1IA 1C1CA 2E6LA 2JLEA 4Y1CA 5HBMA 3QESA 1X1PA 5KRTA 3NH0A 2Z1IA 3ZT4A 2IC3A 4N5SA 1U45A 4Z4EA 1KRPA 1EKEA 1J53A 4E7HA 3OYDA 3L2VA 2E6MA 3OVNA 4FLWA 4AILC 1JLGA 1KTQA 1QS4A 1RDCA 1QSSA 4KKOA 4FLZA 5CYMA 4ID1A 1KLNA 4CECA 3MEGA 4O44A 3THVA 3OYHA 1XHZA 1RTHA 1A5WA 4CEEA 3EYZA 1L5UA 1HRHA 2DY4A 1N6QA 3K57A 2HHTA 3QINA 3K2PA 3HJFA 3AVJA 1HYVA 5K14A 2OZMA 2DFHA 3ISNC 1Q8IA 4W5OA 4KPYA 4KFBA 4E19A 1RBUA 3DOLA 4DSJA 3L2QA 4WE1A 3V9ZA 3SCXA 4FK4A 3SNNA 3DI6A 2VG6A 4E1MA 1C6VA 1Q9XA 1HJRA 3OYIA 2PZSA 4H4MA 4FW1A 4CCHA 4K8ZA 2PYLA 4KTZA 2D0BA 2LSNA 1HMVA 3CM6A 4CFDA 3B6OA 2IGIA 4EP5A 4KAZA 1VRUA 3CFOA 1UOCA 2B5JA 2X6SA 1K6YA 3M8QA 3ZSZA 4O0IA 1IKYA 4FM0A 4CJUA 4ZHRA 4DTPA 4B9SA 2BGGA 2HHUA 4Y1DA 3PO4A 4DSKA 1BIZA 1HQEA 1S6PA 5HRNA 4DQPA 3SZ2A 3QNNA 4CJSA 4CJ4A 4Z4IA 1FKPA 1RT4A 3AA5X 4M3XA 4OPKA 4ELVA 1WSGA 3QEXA 5I3UA 1RTDA 4R5PA 4CF9A 5SWMA 4M41A 1DTTA 4M3TA 4FJIA 4C8KA 1S9EA 1F21A 3SUQA 3V9XA 5JS2A 1ZBFA 3VQDA 4KREA 3JYTA 4LY7A 4FLTA 4DU1A 4KO0A 1L3TA 3SUNA 3OYLA 1RCHA 3F9KA 1R0AA 4IFYA 2XO7A 3NF9A 4ID5A 4E7JA 2KZMA 1SL2A 4KHWA 4Z4FA 3HP6A 2EX3A 1RDAA 4H8KA 4B9NA 3C95A 1EP4A 1G15A 5C42A 1NOYA 4KI6A 2ATQA 3TAFA 1XWLA 2NUBA 4M3WA 2OZSA 4F3TA 1ASWA 1HNVA 3K5OA 2QKBA 1T03A 2YNHA 1NK8A 3C94A 1FXXA 4DTOA 3LAKA 1RBTA 4LSLA 1TGOA 1NKEA 3IRXA 5JS1A 1X9WA 1J54A 3VQ9A 1TKDA 1NK0A 4FJMA 4PY5A 3L3UA 4CF2A 4N47A 2KZZA 3V4IA 3L8BA 1EETA 3AVHA 3TAEA 3TR8A 1KFDA 3P83D 2G8VA 3A2FA 4FM2A 1Y97A 2D0AA 5KGXA 4PQUA 4HHTA 4E0DA 4QOZB 5C24A 4DFKA 3EZ5A 1A5XA 1RBSA 3KIOA 1BQNA 3ZSRA 3OYMA 5HRRA 4DF4A 3BDPA 4FYDA 3AVNA 1JLEA 3V9SA 4QCLA 4KRFA 1RBRA 2JGUA 1CZ9A 4Z4GA 3AO3A 4FLUA 2B6AA 4HCBA 3IAYA 1CLQA 3DRRA 4AHSA 1LAVA 3RRHA 1U04A 3HVTA 4DFJA 1VSLA 4Z0UA 3U6FA 3SUOA 4FJGA 1Q9YA 1TKTA 4CERA 1YT3A 3KJVA 2ZD1A 3L2UA 1U48A 2RPIA 4DSEA 5FRNA 1BI4B 3IS9A 4DTSA 1JLQA 1U49A 1TK8A 1NKBA 1LV5A 1SUQA 1S1TA 4CF1A 4FLXA 5D3GA 4CHZA 3VQPA 3OJUA 3BGRA 4CHOA 1QSYA 2X74A 5FROA 1LW2A 2BDPA 3AO2A 2P5GA 1S1VA 2G8KA 1C1AA 1JLFA 1VSIA 5DK5A 1CXUA 3LDSA 4BDZA 3RR8A 4BDPA 4I2QA 1W9HA 4CEZA 4J2EA 4FJXA 4DTJA 5KI6A 3LPTA 5J2PA 3DLEA 3QIPA 3DOKA 1WSIA 5CZ2A 1IKWA 3UIQA 3DLKA 3NBPA 1JXEA 3QIOA 3KLHA 4G1QA 2QKKA 4KHYA 2HHSA 3G0ZA 1VSHA 3ITHA 3AO5A 1GOBA 1BGXT 4RG8A 1HYZA 4DLEA 1UA1A 2Q3SA 4B9MA 3AO1A 3NE6A 1ASUA 2DTUA 4KHNA 2O4GA 4HVJA 4KB1A 4CESA 4RW4A 2DFEA 3ZSXA 4CGGA 2EHGA 3ZT0A 3RMDA 4PUOA 4I2PA 3HSTB 4HTUA 5DMRA 4JS4A 3OS1A 3NHGA 1XC9A 4PA1A 1FK9A 4CJPA 3SYZA 4DFPA 2YKMA 3VQ7A 5KGWA 1T7PA 1GOCA 3U3YA 3OS2A 3S3OA 4DTUA 1EXQA 3MXIA 2IAJA 4C8LA 3LPUA 3HPGA 2KQ2A 3HM9A 2YKNA 3ZT2A 1RILA 3AVGA 3QO9A 1TVRA 3OYJA 2RF2A 2YNFA 3O3FA 3OS0A 4HUGA 4IG3A 2HMIA 2HHVA 2P5OA 4L8RB 3S3NA 2G8UA 4FLVA 2FC0A 4FJNA 1IKVA 4LSNA 2GBZA 1IG9A 4JRPA 1IH7A 4AHVA 3NF8A 3V1QA 3KLFA 3PV8A 2PY5A 2OPQA 4ICLA 4NCBA 4FCYA 4JS5A 2Z1HA 1L3SA 1KLMA 5FRMA 1NOZA 4CJ3A 3SQ2A 2KTQA 5HP1A 3DMJA 3PO5A 5CZ1A 1NJXA 1SL1A 4I9QA 4UQGA 3WNHA 3VN5A 1S1XA 1X9SA 5E41A 2WOMA 3M8RA 3LP3A 4DQSA 1TL3A 2PYJA 4CEFA 2GUIA 1SKRA 1S1WA 1NK4A 2YNIA 4I9LA 1TL1A 2ETJA 4OJRA 2GV9A 4KI4A 1D9DA 3OYFA 4DSFA 4CJVA 4K8XA 1T8EA 1DLOA 4CJQA 1Z25A 2G8FA 4CGDA 3ZCMA 4CIEA 1ZYQA 1REVA 1KVBA 1TAQA 2IS3A 2QXFA 1UWBA 4CJKA 3LZJA 3KKSA 4CIFA 4BACA 3RMBA 4LH5A 3WNEA 5HRPA 2G8IA 2O4IA 4B3OA 4CJRA 3KLEA 2HNYA 3M8SA 3QETA 2ITGA 4CJFA 3DM2A 1EX4A 3KTQA 1S9GA 3KD5E 1S5JA 4JLHA 3RTVA 4AHCA 4M3YA 4KTQA 1LWFA 1QHTA 3VQ6A 4DTXA 1X9MA 1NK9A 1JLAA 1W0HA 4ZTJA 3V1OA 3L2WA 3QNOA 1QSLA 1QTMA 3RRGA 3AVCA 4AHUA 3ZSYA 1TK5A 4KHSA 3K58A 3CQ8A 4CGFA 2OPRA 3IG1A 1O1WA 1WSHA 2HNZA 4IFVA 4O55A 4JRQA 1L3VA 1C0TA 4CK2A 4FZZA 1RT1A 1BISA 4DS5A 4OGEA 4DU3A 4FVMA 3ZT3A 5J2MA 1U4BA 3LWLA 4C8NA 3LWMA 3ZSOA 5HRSA 3HO1A 3TAMA 4GVMA 2HHXA 1GOAA 3OJSA 4BE2A 2FBVA 3LANA 3TAPA 3DLRA 1RNHA 3TWHA 1NJYA 4DMNA 4DSIA 3SQ1A 1IKXA 4CFBA 3KLIA 4MQ3A 2XY7A 1BCMA 1CZBA 2YHBA 3AVFA 4CEOA 4CGJA 3PY8A 4I7FA 2A1SA 1N5YA 3O4NA 1VK0A 1WNSA 3O3HA 1JL2A 3EY1A 4OKJA 3G10A 1BCOA 4B9VA 1WLJA 1ASVA 3VQAA 1BHLA 1JKHA 2G8HA 3PX4A 3RWUA 2HVIA 2I5JA 4O4GA 3RMAA 5HROA 1LW0A 3TARA 1ZBIA 4PWDA 4E7KA 3O4QA 1L3UA 3I0RA 4E7IA 2ZQBA 2HW3A 1S1UA 1TK0A 4DG1A 4DLGA 4KV8A 2BE2A 4DF8A 3QEWA 1WN7A 3OYBA 2D5RA 1UAXA 2KFNA 1SKWA 1B92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIU A;  4DU4 A;  3ZT1 A;  1NKC A;  3AV9 A;  1QQC A;  4YNQ A;  3K5N A;  1HQU A;  4KHU A;  3WNF A;  4CGI A;  4Q0B A;  4OLA A;  4C8M A;  4CHP A;  1TKZ A;  4B8A B;  2RKI A;  2F8T A;  3HT3 A;  4DTN A;  3K59 A;  3MED A;  3P5J A;  1YVU A;  1BL3 A;  2YV0 X;  4CED A;  3KLG A;  2Y1J A;  2XRI A;  1C1B A;  3E01 A;  3MEC A;  4B9L A;  1KVA A;  3NCI A;  2DFF A;  4NYN A;  3LP0 A;  4E1N A;  4IG0 A;  4FJK A;  3V6D A;  4F2S A;  1RDD A;  1YTA A;  2F96 A;  3OYK A;  5KRS A;  5FDL A;  4M45 A;  1HPZ A;  2P51 A;  3NFA A;  3VQ4 A;  4IKF A;  4CF0 A;  2YNG A;  1NK6 A;  4OGC A;  1HYS A;  1WSE A;  4FJ5 A;  3FFI A;  3L2R A;  3C6T A;  1C0M A;  2OPS A;  4M3R A;  2XY5 A;  4F2R A;  3NF6 A;  3TAB A;  3ASM A;  4F3O A;  1UA0 A;  2QK9 A;  4C8O A;  3VA0 A;  3NAE A;  4CHN A;  4F8R A;  3AVM A;  2G8W A;  2XY8 A;  3CM5 A;  2HND A;  3HYF A;  2HHQ A;  1C0U A;  3QLH A;  3OYE A;  4E7L A;  3KK3 A;  1WSF A;  4OKK A;  1U47 A;  1VSD A;  3SJJ A;  2VG5 A;  4FZY A;  4AH9 A;  4CFC A;  4FJ9 A;  5J2Q A;  3QER A;  2HVH A;  3I0S A;  4W5N A;  1VRT A;  1KCF A;  3LP2 A;  4CJE A;  3L3V A;  3NH2 A;  3HP9 A;  4ZTF A;  4DQR A;  1ZBH A;  3T3F A;  4F4K A;  3ULD A;  1D5A A;  1S6Q A;  4ELT A;  4FK0 A;  3AO4 A;  4BWM A;  3ZSQ A;  3MAQ A;  4KB0 A;  3NGI A;  4LH4 A;  1HNI A;  1RT6 A;  3LAL A;  4J2B A;  1FKO A;  4E3S A;  4BE0 A;  4FK2 A;  1JLC A;  4Z4H A;  4RW9 A;  4AHT A;  4IDK A;  3OYA A;  3RMC A;  3SPZ A;  3SQ4 A;  2R7Y A;  1J5O A;  1BQM A;  4HUF A;  3K5M A;  4MFB A;  3DLH A;  3I8D A;  1RTI A;  4DFM A;  1SL0 A;  3DRP A;  4E89 A;  4CEB A;  5CY4 A;  2B4J A;  1VSJ A;  3AA2 A;  2WON A;  3HPH A;  4W5R A;  3CFP A;  3OYG A;  3MEE A;  4LD0 A;  3T1A A;  5I42 A;  1A5V A;  2A1R A;  2VWK A;  5J1E A;  3SV4 A;  1LAW A;  1MU2 A;  1JXB A;  3AA3 A;  4DS4 A;  1BIU A;  3F73 A;  3LP1 A;  1RT7 A;  3VQQ A;  3OY9 A;  1SV5 A;  3VQ5 A;  5C25 A;  4QAG A;  1B9F A;  1JL1 A;  5CYQ A;  3SI6 A;  4B9U A;  3NDK A;  1VSM A;  3AA4 A;  2VWJ A;  1I39 A;  4CFA A;  4CJT A;  4Z4C A;  4BWJ A;  2RN2 A;  4CK1 A;  4DQQ A;  3VQE A;  4YFU A;  3TAG A;  4DQI A;  3QEI A;  2FBY A;  1VSK A;  5EU7 A;  3SUP A;  4Q5V A;  1YTU A;  2P1J A;  3LAM A;  5J2N A;  1B9D A;  3MXJ A;  4FJ7 A;  3TAQ A;  4CHQ A;  5KTQ A;  3SQ0 A;  4OPJ A;  2Z1G A;  1KVC A;  3DLB A;  4HUE A;  3ALY A;  4M3Z A;  1KFS A;  3HVR A;  5SZT A;  3MXM A;  3QEV A;  2BAN A;  4W5T A;  3DLG A;  4RW7 A;  3AVA A;  4B08 A;  1CXQ A;  4N56 A;  1NJW A;  1RT2 A;  3PX0 A;  1TAU A;  2HB5 A;  2X78 A;  3O3G A;  3HPO A;  3SPY A;  3WNG A;  4EZ6 A;  3V9W A;  3V81 A;  1ZBL A;  3NGY A;  3PUF A;  1D8Y A;  2XHB A;  3VQ8 A;  1DTQ A;  3TI0 A;  3RR7 A;  4O5B A;  4B9T A;  3HL8 A;  5HLF A;  3PX6 A;  2ZE2 A;  3D0P A;  2XY6 A;  2AJQ A;  3S9H A;  4CJW A;  1BI4 A;  4FZX C;  2X6N A;  1RBV A;  4CHY A;  3OYC A;  2OYQ A;  4CE9 A;  1ITG A;  4CK3 A;  4CEQ A;  4BE1 A;  4N41 A;  2FBX A;  4EZ9 A;  4FW2 A;  2E4L A;  4J2A A;  3KKR A;  4IBN A;  3KK1 A;  4GW6 A;  3AVL A;  4CF8 A;  3CG7 A;  4TSX A;  2IOC A;  1JLB A;  4B8C A;  3V9U A;  3QEP A;  4HCC A;  1WAF A;  3P1G A;  3S3M A;  1WSJ A;  4GMJ B;  1RT5 A;  1J9A A;  3CFR A;  4RW6 A;  3K5L A;  3H08 A;  3B6P A;  3VQC A;  1RDB A;  3U3G A;  2W42 A;  3AVB A;  4BDY A;  1T05 A;  3D45 A;  3DRS A;  2IDO A;  4EP4 A;  3LZI A;  4NCA A;  3AVK A;  3VA3 A;  4OLB A;  4KHQ A;  3M8P A;  1IO2 A;  4FXD A;  3SV3 A;  2OPP A;  1XHX A;  1NJZ A;  1NK7 A;  4FLY A;  3ZSW A;  4W5Q A;  4CGH A;  2Z1J A;  4CJL A;  4H4O A;  4FM1 A;  3KD1 E;  4CEA A;  1RTJ A;  4FJL A;  3ZSV A;  3KK2 A;  1RT3 A;  3NF7 A;  1Z26 A;  1KSP A;  4OKE A;  4DSL A;  3V1R A;  1I3A A;  3DYA A;  4NYF A;  4NCG A;  4RW8 A;  4CIG A;  4DTR A;  1TV6 A;  3NGZ A;  3NH1 A;  2D0C A;  4CJ5 A;  3AVI A;  4FJJ A;  2YHA A;  3OYN A;  1VSE A;  3VQB A;  3T19 A;  4KTW A;  3JSM A;  1QE1 A;  2KW4 A;  4N76 A;  1TKX A;  1NK5 A;  4OVL A;  4ELU A;  1XI1 A;  2F8S A;  2KFZ A;  2OA8 A;  4AHR A;  3C6U A;  4DWI A;  3TAN A;  4FJ8 A;  1LWE A;  1LWC A;  2HHW A;  1D9F A;  5T7B A;  4M42 A;  4M3U A;  1WAJ A;  1VSF A;  2VG7 A;  3CYM A;  4DTM A;  4O0J A;  3HXM A;  3HK2 A;  4FJH A;  2FBT A;  1SKS A;  1ZBU A;  4J2D A;  2Y1I A;  1C1C A;  2E6L A;  2JLE A;  4Y1C A;  5HBM A;  3QES A;  1X1P A;  5KRT A;  3NH0 A;  2Z1I A;  3ZT4 A;  2IC3 A;  4N5S A;  1U45 A;  4Z4E A;  1KRP A;  1EKE A;  1J53 A;  4E7H A;  3OYD A;  3L2V A;  2E6M A;  3OVN A;  4FLW A;  4AIL C;  1JLG A;  1KTQ A;  1QS4 A;  1RDC A;  1QSS A;  4KKO A;  4FLZ A;  5CYM A;  4ID1 A;  1KLN A;  4CEC A;  3MEG A;  4O44 A;  3THV A;  3OYH A;  1XHZ A;  1RTH A;  1A5W A;  4CEE A;  3EYZ A;  1L5U A;  1HRH A;  2DY4 A;  1N6Q A;  3K57 A;  2HHT A;  3QIN A;  3K2P A;  3HJF A;  3AVJ A;  1HYV A;  5K14 A;  2OZM A;  2DFH A;  3ISN C;  1Q8I A;  4W5O A;  4KPY A;  4KFB A;  4E19 A;  1RBU A;  3DOL A;  4DSJ A;  3L2Q A;  4WE1 A;  3V9Z A;  3SCX A;  4FK4 A;  3SNN A;  3DI6 A;  2VG6 A;  4E1M A;  1C6V A;  1Q9X A;  1HJR A;  3OYI A;  2PZS A;  4H4M A;  4FW1 A;  4CCH A;  4K8Z A;  2PYL A;  4KTZ A;  2D0B A;  2LSN A;  1HMV A;  3CM6 A;  4CFD A;  3B6O A;  2IGI A;  4EP5 A;  4KAZ A;  1VRU A;  3CFO A;  1UOC A;  2B5J A;  2X6S A;  1K6Y A;  3M8Q A;  3ZSZ A;  4O0I A;  1IKY A;  4FM0 A;  4CJU A;  4ZHR A;  4DTP A;  4B9S A;  2BGG A;  2HHU A;  4Y1D A;  3PO4 A;  4DSK A;  1BIZ A;  1HQE A;  1S6P A;  5HRN A;  4DQP A;  3SZ2 A;  3QNN A;  4CJS A;  4CJ4 A;  4Z4I A;  1FKP A;  1RT4 A;  3AA5 X;  4M3X A;  4OPK A;  4ELV A;  1WSG A;  3QEX A;  5I3U A;  1RTD A;  4R5P A;  4CF9 A;  5SWM A;  4M41 A;  1DTT A;  4M3T A;  4FJI A;  4C8K A;  1S9E A;  1F21 A;  3SUQ A;  3V9X A;  5JS2 A;  1ZBF A;  3VQD A;  4KRE A;  3JYT A;  4LY7 A;  4FLT A;  4DU1 A;  4KO0 A;  1L3T A;  3SUN A;  3OYL A;  1RCH A;  3F9K A;  1R0A A;  4IFY A;  2XO7 A;  3NF9 A;  4ID5 A;  4E7J A;  2KZM A;  1SL2 A;  4KHW A;  4Z4F A;  3HP6 A;  2EX3 A;  1RDA A;  4H8K A;  4B9N A;  3C95 A;  1EP4 A;  1G15 A;  5C42 A;  1NOY A;  4KI6 A;  2ATQ A;  3TAF A;  1XWL A;  2NUB A;  4M3W A;  2OZS A;  4F3T A;  1ASW A;  1HNV A;  3K5O A;  2QKB A;  1T03 A;  2YNH A;  1NK8 A;  3C94 A;  1FXX A;  4DTO A;  3LAK A;  1RBT A;  4LSL A;  1TGO A;  1NKE A;  3IRX A;  5JS1 A;  1X9W A;  1J54 A;  3VQ9 A;  1TKD A;  1NK0 A;  4FJM A;  4PY5 A;  3L3U A;  4CF2 A;  4N47 A;  2KZZ A;  3V4I A;  3L8B A;  1EET A;  3AVH A;  3TAE A;  3TR8 A;  1KFD A;  3P83 D;  2G8V A;  3A2F A;  4FM2 A;  1Y97 A;  2D0A A;  5KGX A;  4PQU A;  4HHT A;  4E0D A;  4QOZ B;  5C24 A;  4DFK A;  3EZ5 A;  1A5X A;  1RBS A;  3KIO A;  1BQN A;  3ZSR A;  3OYM A;  5HRR A;  4DF4 A;  3BDP A;  4FYD A;  3AVN A;  1JLE A;  3V9S A;  4QCL A;  4KRF A;  1RBR A;  2JGU A;  1CZ9 A;  4Z4G A;  3AO3 A;  4FLU A;  2B6A A;  4HCB A;  3IAY A;  1CLQ A;  3DRR A;  4AHS A;  1LAV A;  3RRH A;  1U04 A;  3HVT A;  4DFJ A;  1VSL A;  4Z0U A;  3U6F A;  3SUO A;  4FJG A;  1Q9Y A;  1TKT A;  4CER A;  1YT3 A;  3KJV A;  2ZD1 A;  3L2U A;  1U48 A;  2RPI A;  4DSE A;  5FRN A;  1BI4 B;  3IS9 A;  4DTS A;  1JLQ A;  1U49 A;  1TK8 A;  1NKB A;  1LV5 A;  1SUQ A;  1S1T A;  4CF1 A;  4FLX A;  5D3G A;  4CHZ A;  3VQP A;  3OJU A;  3BGR A;  4CHO A;  1QSY A;  2X74 A;  5FRO A;  1LW2 A;  2BDP A;  3AO2 A;  2P5G A;  1S1V A;  2G8K A;  1C1A A;  1JLF A;  1VSI A;  5DK5 A;  1CXU A;  3LDS A;  4BDZ A;  3RR8 A;  4BDP A;  4I2Q A;  1W9H A;  4CEZ A;  4J2E A;  4FJX A;  4DTJ A;  5KI6 A;  3LPT A;  5J2P A;  3DLE A;  3QIP A;  3DOK A;  1WSI A;  5CZ2 A;  1IKW A;  3UIQ A;  3DLK A;  3NBP A;  1JXE A;  3QIO A;  3KLH A;  4G1Q A;  2QKK A;  4KHY A;  2HHS A;  3G0Z A;  1VSH A;  3ITH A;  3AO5 A;  1GOB A;  1BGX T;  4RG8 A;  1HYZ A;  4DLE A;  1UA1 A;  2Q3S A;  4B9M A;  3AO1 A;  3NE6 A;  1ASU A;  2DTU A;  4KHN A;  2O4G A;  4HVJ A;  4KB1 A;  4CES A;  4RW4 A;  2DFE A;  3ZSX A;  4CGG A;  2EHG A;  3ZT0 A;  3RMD A;  4PUO A;  4I2P A;  3HST B;  4HTU A;  5DMR A;  4JS4 A;  3OS1 A;  3NHG A;  1XC9 A;  4PA1 A;  1FK9 A;  4CJP A;  3SYZ A;  4DFP A;  2YKM A;  3VQ7 A;  5KGW A;  1T7P A;  1GOC A;  3U3Y A;  3OS2 A;  3S3O A;  4DTU A;  1EXQ A;  3MXI A;  2IAJ A;  4C8L A;  3LPU A;  3HPG A;  2KQ2 A;  3HM9 A;  2YKN A;  3ZT2 A;  1RIL A;  3AVG A;  3QO9 A;  1TVR A;  3OYJ A;  2RF2 A;  2YNF A;  3O3F A;  3OS0 A;  4HUG A;  4IG3 A;  2HMI A;  2HHV A;  2P5O A;  4L8R B;  3S3N A;  2G8U A;  4FLV A;  2FC0 A;  4FJN A;  1IKV A;  4LSN A;  2GBZ A;  1IG9 A;  4JRP A;  1IH7 A;  4AHV A;  3NF8 A;  3V1Q A;  3KLF A;  3PV8 A;  2PY5 A;  2OPQ A;  4ICL A;  4NCB A;  4FCY A;  4JS5 A;  2Z1H A;  1L3S A;  1KLM A;  5FRM A;  1NOZ A;  4CJ3 A;  3SQ2 A;  2KTQ A;  5HP1 A;  3DMJ A;  3PO5 A;  5CZ1 A;  1NJX A;  1SL1 A;  4I9Q A;  4UQG A;  3WNH A;  3VN5 A;  1S1X A;  1X9S A;  5E41 A;  2WOM A;  3M8R A;  3LP3 A;  4DQS A;  1TL3 A;  2PYJ A;  4CEF A;  2GUI A;  1SKR A;  1S1W A;  1NK4 A;  2YNI A;  4I9L A;  1TL1 A;  2ETJ A;  4OJR A;  2GV9 A;  4KI4 A;  1D9D A;  3OYF A;  4DSF A;  4CJV A;  4K8X A;  1T8E A;  1DLO A;  4CJQ A;  1Z25 A;  2G8F A;  4CGD A;  3ZCM A;  4CIE A;  1ZYQ A;  1REV A;  1KVB A;  1TAQ A;  2IS3 A;  2QXF A;  1UWB A;  4CJK A;  3LZJ A;  3KKS A;  4CIF A;  4BAC A;  3RMB A;  4LH5 A;  3WNE A;  5HRP A;  2G8I A;  2O4I A;  4B3O A;  4CJR A;  3KLE A;  2HNY A;  3M8S A;  3QET A;  2ITG A;  4CJF A;  3DM2 A;  1EX4 A;  3KTQ A;  1S9G A;  3KD5 E;  1S5J A;  4JLH A;  3RTV A;  4AHC A;  4M3Y A;  4KTQ A;  1LWF A;  1QHT A;  3VQ6 A;  4DTX A;  1X9M A;  1NK9 A;  1JLA A;  1W0H A;  4ZTJ A;  3V1O A;  3L2W A;  3QNO A;  1QSL A;  1QTM A;  3RRG A;  3AVC A;  4AHU A;  3ZSY A;  1TK5 A;  4KHS A;  3K58 A;  3CQ8 A;  4CGF A;  2OPR A;  3IG1 A;  1O1W A;  1WSH A;  2HNZ A;  4IFV A;  4O55 A;  4JRQ A;  1L3V A;  1C0T A;  4CK2 A;  4FZZ A;  1RT1 A;  1BIS A;  4DS5 A;  4OGE A;  4DU3 A;  4FVM A;  3ZT3 A;  5J2M A;  1U4B A;  3LWL A;  4C8N A;  3LWM A;  3ZSO A;  5HRS A;  3HO1 A;  3TAM A;  4GVM A;  2HHX A;  1GOA A;  3OJS A;  4BE2 A;  2FBV A;  3LAN A;  3TAP A;  3DLR A;  1RNH A;  3TWH A;  1NJY A;  4DMN A;  4DSI A;  3SQ1 A;  1IKX A;  4CFB A;  3KLI A;  4MQ3 A;  2XY7 A;  1BCM A;  1CZB A;  2YHB A;  3AVF A;  4CEO A;  4CGJ A;  3PY8 A;  4I7F A;  2A1S A;  1N5Y A;  3O4N A;  1VK0 A;  1WNS A;  3O3H A;  1JL2 A;  3EY1 A;  4OKJ A;  3G10 A;  1BCO A;  4B9V A;  1WLJ A;  1ASV A;  3VQA A;  1BHL A;  1JKH A;  2G8H A;  3PX4 A;  3RWU A;  2HVI A;  2I5J A;  4O4G A;  3RMA A;  5HRO A;  1LW0 A;  3TAR A;  1ZBI A;  4PWD A;  4E7K A;  3O4Q A;  1L3U A;  3I0R A;  4E7I A;  2ZQB A;  2HW3 A;  1S1U A;  1TK0 A;  4DG1 A;  4DLG A;  4KV8 A;  2BE2 A;  4DF8 A;  3QEW A;  1WN7 A;  3OYB A;  2D5R A;  1UAX A;  2KFN A;  1SKW A;  1B92 A; 
#chains in the Genus database with same CATH topology
 1KAX A;  4BR5 A;  3J8A A;  4YNQ A;  4H03 B;  3WNF A;  5AQQ A;  4C8M A;  4IXC A;  3I55 N;  3MN9 A;  5EY4 A;  3KLG A;  2Y1J A;  4YOY A;  3MEC A;  1KVA A;  3NCI A;  2DFF A;  1X3N A;  3ATU A;  4IG0 A;  4FJK A;  1KAZ A;  4JK7 A;  4DKW A;  4CF0 A;  1NK6 A;  1T3V A;  4FJ5 A;  1I94 K;  3FFI A;  4BQZ A;  4C8O A;  3VA0 A;  4JI2 K;  3KHY A;  4UY8 O;  2O8B B;  3QLH A;  4OO1 J;  3KK3 A;  4FZY A;  1VSD A;  5M1Q A;  2VG5 A;  4CFC A;  2HVH A;  5J2Q A;  3QER A;  3U8X A;  3QML A;  1KCF A;  3LP2 A;  3ID8 A;  3L3V A;  3HP9 A;  1ZBH A;  4F4K A;  5BR9 A;  3AO4 A;  3FZK A;  1M1K O;  3SJH A;  3THW A;  4KB0 A;  2NNW A;  1HNI A;  4J2B A;  1OH7 A;  3RMC A;  3SQ4 A;  3DLH A;  1P8Z A;  3DRP A;  3SK3 A;  2B4J A;  4U67 L;  2WON A;  3W0L A;  2A1R A;  2VWK A;  5J1E A;  1LAW A;  1MU2 A;  2E2N A;  3PIP L;  4DS4 A;  1BIU A;  1VQ6 N;  3F73 A;  4H0X B;  4JKF A;  3LP1 A;  4H0T B;  1B9F A;  5KQD A;  2O8C A;  2ZF5 O;  4RCH A;  3NDK A;  2VWJ A;  3CC7 N;  3U9Z A;  3TAG A;  2RN2 A;  2P9S B;  3QEI A;  1VSK A;  3DAW A;  4CHQ A;  5A2Q O;  4M3Z A;  3BF3 A;  5ADX H;  4BG8 A;  3DLG A;  4KH6 A;  2QA4 N;  3PX0 A;  2HB5 A;  2X78 A;  3UB5 A;  4EIA A;  3SPY A;  1IV0 A;  4LF9 K;  3PUF A;  2UXD K;  4F9O A;  2V7Y A;  1VQ4 N;  4A5A A;  2E2O A;  2AA4 A;  1ITG A;  4CEQ A;  4N41 A;  2P9L A;  1ATN A;  4J2A A;  1XUP O;  4IBN A;  3KK1 A;  2P9U A;  4CF8 A;  4TSX A;  1JLB A;  3TU5 A;  4HCC A;  1SAZ A;  1WAF A;  3S3M A;  2GEL A;  1JCG A;  3ID6 A;  1J9A A;  3H08 A;  3VQC A;  1RDB A;  3U3G A;  2RHK A;  3D45 A;  1K8A O;  4OLB A;  3QB0 A;  3M8P A;  1VQ8 N;  3P38 A;  2Z1J A;  3ENH A;  5AQZ A;  1KSP A;  4DV2 K;  3V1R A;  3DYA A;  4CIG A;  4NCG A;  2P9K A;  4Y0W A;  4CJ5 A;  3A5M C;  3AVI A;  1VSE A;  2HOE A;  4JKE A;  1VQM N;  4N76 A;  3LL3 A;  1NK5 A;  4OVL A;  2F8S A;  1XI1 A;  2GUP A;  1RGI A;  3M5R A;  2HMP A;  3C6U A;  1D9F A;  5T7B A;  1XC3 A;  2VG7 A;  4DV6 K;  3K9K A;  3HXM A;  4J2D A;  4JEP A;  4OPA A;  1ZBU A;  1C1C A;  5HBM A;  3NH0 A;  3HBT A;  3ZT4 A;  4N5S A;  5KPZ A;  1J53 A;  4E7H A;  1TK5 A;  1ATS A;  3OVN A;  3M3Z A;  4IOA L;  3MN5 A;  4BC2 A;  4ID1 A;  3ZEU B;  4CEC A;  3HRG A;  2UU9 K;  1RTH A;  3K57 A;  3QIN A;  2O8F A;  1G99 A;  1P90 A;  1WB9 A;  1JCE A;  4KPY A;  4KFB A;  3DWL A;  1V4S A;  4E1M A;  3A0I X;  1Q9X A;  2PZS A;  4DUZ K;  4BR7 A;  4K8Z A;  2PYL A;  2D0B A;  2LSN A;  3CM6 A;  3ZET B;  2IGI A;  4KAZ A;  1VRU A;  4O0I A;  2X6S A;  1SKW A;  4DTP A;  3ZYY X;  4DQP A;  3IMX A;  4CJ4 A;  4DR4 K;  4Z4I A;  1RT4 A;  2E88 A;  4M3X A;  3C7N B;  5AQG A;  4OPK A;  4M7Y A;  4CZG A;  4ELV A;  5M1O A;  1RTD A;  4CF9 A;  4M41 A;  4M3T A;  4XH5 A;  4EAH D;  3SUQ A;  1ZBF A;  2F7T A;  4BGB A;  4JHD B;  4LY7 A;  5AQS A;  4A61 A;  1FJG K;  3SUN A;  2HBL A;  2NRZ A;  3F9K A;  4JKA A;  2KZM A;  4KHW A;  5DM7 L;  1KD1 O;  4DUY K;  4KI6 A;  1NG9 A;  2ATQ A;  1XWL A;  2NUB A;  4M3W A;  3K5O A;  1NGC A;  3MCA B;  4DTO A;  1FXX A;  3LAK A;  4YY3 K;  3IRX A;  5BRD A;  1J54 A;  2IVN A;  1NK0 A;  4NXN K;  1X9J A;  3L3U A;  4CF2 A;  3VER A;  2KZZ A;  4YOT A;  1C0G A;  2G8V A;  4FM2 A;  2D0A A;  2GEM A;  5E26 A;  4E0D A;  3CCM N;  5FLX O;  5BPL A;  1RBS A;  4DF4 A;  4FOE A;  3V9S A;  3ULE A;  3IAY A;  2UXB K;  3EN9 A;  1Q9Y A;  4CER A;  1GLC G;  2NRH A;  3PSI A;  2VYP A;  4IWV A;  5C2F A;  1SUQ A;  3GG4 A;  5D3G A;  3OJU A;  3BGR A;  4CHO A;  4X62 K;  4ISF A;  5HL7 L;  1QSY A;  1LW2 A;  4H0V B;  2BDP A;  2QWL A;  1BU6 O;  1S1V A;  1XNQ K;  4BDZ A;  1VSI A;  5DK5 A;  5AQH A;  3RR8 A;  4I2Q A;  2P9N A;  4I6M A;  4BRF A;  3QIP A;  4KHY A;  3QIO A;  4G1Q A;  3E9P A;  4DLE A;  2DTU A;  4B9M A;  3NE6 A;  2O4G A;  3CJ1 A;  3OW2 M;  4RW4 A;  3ZSX A;  2EHG A;  3ZT0 A;  4I2P A;  3G4S N;  3HST B;  4HTU A;  4CZF A;  1TYQ A;  5DMR A;  4JS4 A;  4PA1 A;  3OHR A;  1JCF A;  1T7P A;  2OAN A;  1K9M O;  3MX5 A;  4JI1 K;  4BGA A;  2KQ2 A;  1RIL A;  3AVG A;  3QO9 A;  1N36 K;  3OYJ A;  1OH5 A;  5C2D A;  4GV3 A;  4L8R B;  3O80 A;  1K8K A;  4FLV A;  4MO4 A;  5C10 A;  4CZK A;  2E2P A;  2PY5 A;  1BG3 A;  3KLF A;  1YUW A;  4IO9 L;  3AAR A;  1KLM A;  1NOZ A;  4CJ3 A;  3D2E B;  3DMJ A;  3PO5 A;  5CZ1 A;  4BVO A;  3LM2 A;  4I9Q A;  4UQG A;  3DJC A;  3WNH A;  2NRT A;  4IDH A;  1X9S A;  1VQN N;  2GUI A;  2YX6 A;  4B1W B;  2YNI A;  1ZXO A;  5IWA K;  1Z25 A;  4XEI A;  4CBW A;  4CGD A;  4GNI A;  4CIE A;  1KVB A;  4BAC A;  4FWS A;  3KKS A;  4FWR A;  1XMO K;  3D6R A;  3DM2 A;  3KD5 E;  1OH8 A;  4U7B A;  3RTV A;  1LWF A;  2QWQ A;  4HTL A;  5M1N A;  5FPN A;  5GAD P;  4LFB K;  3QNO A;  4OX9 K;  5JLH A;  4CGF A;  3H46 O;  3CC2 N;  2HNZ A;  4B3M K;  4FZZ A;  3SBT A;  4DS5 A;  4OGE A;  4DU3 A;  5LJV A;  2E2Q A;  2QTD A;  3LWM A;  3ZSO A;  4PKH A;  3DLR A;  4BR4 A;  4QS8 A;  2CGK A;  4A62 A;  3PY8 A;  3AVF A;  3VEV A;  2UUA K;  1N5Y A;  1JL2 A;  3G10 A;  3HSC A;  2G8H A;  1KAY A;  2I5J A;  5HRO A;  5C12 A;  3I8B A;  3VEX A;  3O5B A;  2BTF A;  1IBL K;  1L3U A;  3VF6 A;  2HW3 A;  1TK0 A;  4DG1 A;  4DLG A;  4DF8 A;  2E8A A;  2P9I A;  1WN7 A;  4X64 K;  2D5R A;  1UAX A;  4DQ8 A;  1B92 A;  4BRL A;  1QQC A;  5JVG L;  3K5N A;  4KHU A;  5JIC A;  4OLA A;  4CHP A;  4DTN A;  3VGM A;  3P5J A;  1O13 A;  4CED A;  3O9R A;  2P9K B;  4BY9 C;  3F9M A;  3V6D A;  1RDD A;  1YTA A;  3OYK A;  1K73 O;  5KRS A;  4M45 A;  2IVP A;  3VGL A;  3NFA A;  2FLO A;  3IKM A;  2YNG A;  1HYS A;  3L2R A;  3CJ9 A;  1DGK N;  3NF6 A;  2UXC K;  4F3O A;  4CJ7 A;  4ISG A;  3AVM A;  4B9Q A;  3FZL A;  2XY8 A;  3CM5 A;  2HHQ A;  3OYE A;  5AQX A;  4E7L A;  3DXM B;  4FWL A;  3IFR A;  3CQY A;  5KPT A;  4FJ9 A;  1IBM K;  5LL6 Z;  3I0S A;  5AQV A;  1VRT A;  3H1V X;  3K9J A;  4DQR A;  1ATR A;  5AJ3 K;  1CZA N;  3WEE B;  1S6Q A;  4ELT A;  4FK0 A;  3CCL N;  3VEN A;  3ZSQ A;  3NGI A;  4BC4 A;  4LH4 A;  1RT6 A;  4NLB A;  4Z4H A;  4GKJ K;  1NJI O;  5AZI A;  4PL7 A;  3I8D A;  1RTI A;  1SL0 A;  5CY4 A;  1DKG D;  1VSJ A;  3AA2 A;  3HPH A;  2D0O A;  5LMN K;  3CFP A;  3R6M A;  4JKG A;  4LD0 A;  5AZI B;  3T1A A;  3U9D A;  5FPE A;  1JXB A;  3AA3 A;  4FWM A;  3KZB A;  3D2F B;  1QHA A;  1E4F T;  3OY9 A;  5C25 A;  3SI6 A;  1JL1 A;  4O8K A;  4FJ8 A;  4YOX A;  3MK6 A;  3CJB A;  2P9S A;  4CFA A;  4CJT A;  4CK1 A;  4Z4C A;  3CCR N;  2E5L K;  3VQE A;  1HNZ K;  2O8C B;  2FBY A;  1VQ5 N;  2P1J A;  3H3N O;  1BA0 A;  4BRN A;  1XMQ K;  5AQW A;  3I56 N;  4OPJ A;  3MMV A;  3ALY A;  1N8R O;  1VAZ A;  2P9N B;  4W5T A;  4E1J A;  4RW7 A;  5AZJ A;  2YHX A;  3AVA A;  4M63 C;  4XH4 A;  4N56 A;  1RT2 A;  2OTJ N;  3MX2 A;  3HPO A;  3D7E O;  4EZ6 A;  3CER A;  4YHH K;  3VPZ A;  1ZBL A;  3CCS N;  3H45 C;  1YIJ N;  2UYT A;  4DR2 K;  2ZE2 A;  1Q7Y O;  1V4T A;  4LFA K;  4NO7 A;  3D0P A;  2XY6 A;  3S9H A;  4CJW A;  3JXU A;  4FZX C;  2A41 A;  2X6N A;  1RBV A;  1MWM A;  2OYQ A;  1HKB A;  4B1Z A;  2E4L A;  3KKR A;  3WXI A;  2VGN A;  5I9E B;  5MLC Q;  3AVL A;  3CMA N;  4H5W A;  3CG7 A;  3ULE B;  2IOC A;  4B8C A;  3QEP A;  4X66 K;  3WXJ A;  3E9L A;  3RVC A;  2GX9 A;  2W42 A;  3JS6 A;  3DRS A;  4JK9 A;  3SV3 A;  2OPP A;  1XHX A;  1IJJ A;  4CJL A;  5F2R A;  4CEA A;  3ZSV A;  3KK2 A;  4JI6 K;  4OKE A;  4NYF A;  3ZX2 A;  3O08 A;  2D0C A;  3J80 O;  2FF6 A;  5BN8 A;  2FSJ A;  3VQB A;  1NMD A;  2CH6 A;  3T19 A;  1QE1 A;  4R79 A;  1TKX A;  3VOV A;  4LFC K;  2KFZ A;  4PKI A;  3O6W A;  1LWC A;  2HHW A;  1YXQ A;  4BRI A;  3AAP A;  1RFQ A;  4DTM A;  4BR2 A;  2FBT A;  1SKS A;  4JAX A;  4Y1C A;  1X1P A;  3SMS A;  4BRK A;  2Z1I A;  4Z4E A;  4BRP A;  4JV5 K;  1RDC A;  4PL8 A;  1QSS A;  1KLN A;  3MEG A;  4WF9 L;  3EYZ A;  4DCH A;  1Q81 O;  1L5U A;  2NRW A;  2HHT A;  3H1Q A;  3C6H A;  3HJF A;  3AVJ A;  5CR4 A;  1HYV A;  3BZK A;  2OCE A;  4W5O A;  2HBK A;  1RBU A;  2KLA A;  3DOL A;  4DSJ A;  5GIN A;  3V9Z A;  2YJF A;  4FK4 A;  4QS7 A;  1HJR A;  3OYI A;  3AGK A;  2H3G X;  4H4M A;  4JI3 K;  4JI4 K;  4O8U A;  4CFD A;  3CFO A;  1UOC A;  3D2E A;  1IKY A;  4ZHR A;  1NWK A;  3UKU A;  2NRX A;  4DSK A;  3PO4 A;  1HQE A;  3N4P A;  3SZ2 A;  3QNN A;  2VQF K;  2JWK A;  4CD1 A;  3AA5 X;  2EWS A;  1QQM A;  3QEX A;  4R5P A;  1U6Z A;  3WUH A;  2NRR A;  1S9E A;  2QXL A;  4H5N A;  4KRE A;  5AFU H;  3JYT A;  4FLT A;  2BUP A;  3HTV A;  2P9P B;  4IO8 A;  4WFB L;  5AQR A;  4ID5 A;  3THX A;  1SL2 A;  4FPA A;  4EHT A;  3VEO A;  4WQ5 A;  3C95 A;  4CW7 B;  3TAF A;  3MN7 A;  4F3T A;  4BG9 A;  2VWB A;  3C6A A;  3T69 A;  4AM7 A;  5JS1 A;  3W3D A;  4B1X B;  3A8Y A;  3VQ9 A;  2NRV A;  4PY5 A;  4IEI A;  4N47 A;  4FVU A;  3OA9 A;  1EET A;  4YOV A;  2CGL A;  3A2F A;  1Y97 A;  4DV4 K;  1OKJ A;  3M6G A;  2HST A;  4DFK A;  4A2B A;  1A5X A;  3KIO A;  5JVH L;  5HRR A;  1JLE A;  4GV9 A;  4QCL A;  4KRF A;  3SAF A;  1RBR A;  1LOT B;  4Z4G A;  3AO3 A;  2V51 B;  4HCB A;  4NB4 A;  3DRR A;  3RRH A;  1U04 A;  4FJG A;  1YT3 A;  3DXK A;  3CCE N;  4W5N A;  1BOT O;  2RPI A;  4H5T A;  4DSE A;  1BDG A;  3CXC M;  1S1T A;  3CJC A;  4CF1 A;  4CHZ A;  5BRE A;  2X74 A;  3M1F A;  2G8K A;  1C1A A;  4FSV A;  1JLF A;  1NLV A;  3OBY A;  3LDS A;  4FJX A;  2YHY A;  4DTJ A;  3LPT A;  5J2P A;  3GE1 A;  3DOK A;  5CZ2 A;  3UIQ A;  1NGF A;  3DLK A;  1JXE A;  4BRO A;  4B3R K;  1VSH A;  2WUS A;  1DT9 A;  3RMD A;  4PUO A;  3NHG A;  1XC9 A;  1FK9 A;  3DXK B;  5CHI A;  5KGW A;  1GOC A;  3U3Y A;  4DTU A;  1MWK A;  1W2B M;  1EWQ A;  3LPU A;  3FGU A;  4G9Z A;  3O9T A;  3OS0 A;  2HMI A;  1KXP A;  4JD2 A;  3TSQ A;  2GBZ A;  3C7N A;  4JRP A;  3ATV A;  1IH7 A;  4DR1 K;  1IG9 A;  3NF8 A;  3V1Q A;  3PV8 A;  2OPQ A;  3BF1 A;  4NCB A;  1ESV A;  3TTC A;  3SQ2 A;  2YCH A;  2AP1 A;  4DB3 A;  1SL1 A;  3VN5 A;  2WOM A;  3M8R A;  3LP3 A;  4CBX A;  2PYJ A;  3IDH A;  4OJR A;  1TL1 A;  2ETJ A;  4WQ4 A;  4B1Y B;  3D2F A;  4Z94 A;  1D9D A;  3P4I A;  3VEY A;  2G8F A;  1EWR A;  3Q7B A;  3ZCM A;  3NVM A;  3WQU A;  3RMB A;  2IS3 A;  4K8X A;  3LZJ A;  4CIF A;  2O4I A;  4LH5 A;  5HRP A;  4JKG B;  2G8I A;  4A2A A;  4CJR A;  2HNY A;  3M8S A;  4CJF A;  1RDU A;  1EX4 A;  2D4W A;  3R3L A;  4AHC A;  4M3Y A;  2IVO A;  1X9M A;  1NK9 A;  1GLE G;  3FZH A;  3TTD A;  3T7Z A;  2CH5 A;  1QSL A;  3RRG A;  3MCP A;  3K58 A;  5AQI A;  4IOC L;  2OPR A;  1L3V A;  4O55 A;  4JRQ A;  5EVZ A;  3L4I A;  3SLC A;  3OTO K;  4B3S K;  1NBW A;  4V19 S;  3CPW M;  1U4B A;  5J2M A;  1BO5 O;  4C8N A;  3HO1 A;  3LAN A;  3LM9 A;  3TWH A;  2UUC K;  3O9U A;  5DM6 L;  4DSI A;  3SQ1 A;  4CFB A;  3KLI A;  4MQ3 A;  2XY7 A;  1BCM A;  1CZB A;  4CEO A;  4CGJ A;  5H1S Q;  4I7F A;  5F0X A;  3O4N A;  3J81 O;  2WBN A;  3CCV N;  3CCJ N;  3BUZ B;  4ILH A;  1WLJ A;  1VQ7 N;  3RWU A;  2O8E A;  2A40 A;  1ZBI A;  4E7K A;  2BE2 A;  3QEW A;  1NGD A;  5AQK A;  1VQK N;  4XIU A;  3ZT1 A;  3THY B;  3AV9 A;  1HQU A;  3P31 A;  4CGI A;  1Q18 A;  4B8A B;  1NMN A;  3K59 A;  2VCP A;  3L6Q A;  1SQK A;  2P9L B;  4BR9 A;  1Y64 A;  3ENO A;  1J5E K;  3E01 A;  4B9L A;  4NYN A;  1RDW X;  4E1N A;  4F2S A;  2F96 A;  5ELZ A;  3GL1 A;  5GAH P;  1HPZ A;  4IKF A;  1HKG A;  1WSE A;  4B1V A;  3C6T A;  4DV3 K;  3J7A P;  2OPS A;  4M3R A;  4F2R A;  3ASM A;  3EL2 A;  2QK9 A;  4OPH A;  2VQE K;  2GWK A;  4F8R A;  5GAG P;  2HND A;  1Z6R A;  3HYF A;  3VF2 A;  1C0U A;  1U47 A;  3SJJ A;  3UKR A;  4AH9 A;  4FWQ A;  4CVN E;  4XH1 A;  4CJE A;  4ZTF A;  3NH2 A;  4LF6 K;  3ULD A;  4M7X A;  4PKG A;  2PBD A;  3J7Z O;  2HBJ A;  3G71 N;  4FK2 A;  1JLC A;  4RW9 A;  4AHT A;  4IDK A;  4FPB A;  3OYA A;  3SPZ A;  3K5M A;  4DFM A;  4E89 A;  5LY3 A;  2QM1 A;  2FXU A;  3OYG A;  1A5V A;  3CCQ N;  3SV4 A;  1NNE A;  3Q7C A;  2A42 A;  1RT7 A;  3VQQ A;  4B9U A;  3OBW A;  3AA4 A;  1I39 A;  4DQQ A;  4BWJ A;  3VEW A;  3ZX3 A;  4YFU A;  2QWN A;  4Q5V A;  3LAM A;  5J2N A;  4FJ7 A;  2O8B A;  3TAQ A;  5KTQ A;  4CI6 A;  4HUE A;  1KFS A;  2GWJ A;  3QDK A;  4JKB A;  1CXQ A;  1NJW A;  3ZLJ A;  3NVK A;  3PLA A;  1D8Y A;  4B9T A;  2A3Z A;  3TI0 A;  4O5B A;  3HL8 A;  2KKZ A;  1HJO A;  3EEQ A;  3PX6 A;  4CZM A;  4CE9 A;  4BE1 A;  2FBX A;  4BC3 A;  4GW6 A;  1GLA G;  4GMJ B;  3CFR A;  2YI1 A;  3DXM A;  3K5L A;  3AGR A;  1T05 A;  4BDY A;  3EKU A;  3F2K A;  4NCA A;  3VA3 A;  4I6M B;  4GKK K;  1SS6 A;  4KHQ A;  4FLY A;  4W5Q A;  4FM1 A;  1GLJ O;  1RTJ A;  2HBM A;  1Z26 A;  1YJ9 N;  2PAV A;  4H0Y B;  1TV6 A;  1SZ2 A;  4FJJ A;  2YHA A;  3THX B;  3JSM A;  3I33 A;  4DWI A;  3TAN A;  3CME N;  4M42 A;  1S72 N;  4M3U A;  1WAJ A;  1VSF A;  4MLH A;  3HK2 A;  4FJH A;  2P9I B;  1YI2 N;  2Y1I A;  5AQT A;  2HHH K;  3QES A;  4NLC A;  3BEX A;  2IC3 A;  2QWO A;  5BR8 K;  1U45 A;  1KRP A;  1EKE A;  4AIL C;  2E6M A;  1KTQ A;  1YF5 L;  3UKU B;  1GLD G;  4KKO A;  4FLZ A;  4O44 A;  3THV A;  1XHZ A;  1WBB A;  1U2V B;  2DY4 A;  3TSP A;  1N6Q A;  3S41 A;  3K2P A;  1N34 K;  4YDU A;  1GLF O;  5AQN A;  4KBO A;  5K14 A;  2DFH A;  1YJN N;  3ISN C;  1Q8I A;  3GBT A;  3EZW A;  3SCX A;  3DI6 A;  2VG6 A;  1C6V A;  4FWK A;  4CZI A;  4CCH A;  1KQS M;  5AR0 A;  3B6O A;  2B5J A;  1HKC A;  3WXM B;  4BRC A;  4CJU A;  4B9S A;  2HHU A;  1BIZ A;  3AY9 A;  4JK8 A;  5HRN A;  4CJS A;  3FZM A;  3VTH A;  3RSE B;  3E1Y A;  2V7Z A;  5SWM A;  4LF7 K;  1DTT A;  3CHW A;  5HOO A;  4YOW A;  2NLX A;  1F21 A;  5TKY A;  4BRG A;  3ZET A;  3V9X A;  3VQD A;  1L3T A;  5M1F A;  1RCH A;  3EO3 A;  1EO1 A;  1Z05 A;  4IFY A;  2XO7 A;  5JLF A;  3NF9 A;  4E7J A;  1RDA A;  4H8K A;  5AQL A;  4B9N A;  1G15 A;  3WXK A;  3R8E A;  1HNV A;  1T03 A;  2YNH A;  3C94 A;  1TGO A;  1X9W A;  4FJM A;  3V4I A;  4JI5 K;  3TR8 A;  3P83 D;  3EKS A;  4DR5 K;  5KGX A;  2ASP A;  4HHT A;  3WQT A;  3EZ5 A;  3TPQ A;  1BQN A;  4FYD A;  3BY5 A;  3QIC A;  2JGU A;  4FLU A;  1VQL N;  2B6A A;  2Q36 A;  1LAV A;  3UE5 A;  3HVT A;  1VSL A;  4Z0U A;  3SUO A;  2W40 A;  3KJV A;  3L2U A;  5FPD A;  1U48 A;  1BI4 B;  3IS9 A;  3VES A;  1JLQ A;  1TYQ B;  4DTS A;  1TK8 A;  1NKB A;  2QI2 A;  3QBW A;  1YJW N;  1QZ5 A;  3LDL A;  2Q0R A;  2ZGY A;  5FRO A;  3AO2 A;  1HUX A;  2ZJR L;  4DR3 K;  2NZT A;  5AZJ B;  1W9H A;  4CEZ A;  3HI0 A;  4J2E A;  2ASO A;  1XNR K;  4AQY K;  3DLE A;  3NBP A;  2QKK A;  2HHS A;  3G0Z A;  3ITH A;  1GOB A;  5AQJ A;  4RG8 A;  1HYZ A;  3EE8 A;  4KHN A;  4HVJ A;  3HOS A;  3SAH A;  2DFE A;  3ENB A;  3OS1 A;  5GIO A;  3SYZ A;  4DFP A;  3K0S A;  1LCU A;  2YKM A;  5EXW A;  3VQ7 A;  3VMF B;  3CET A;  2W6K A;  3QFP A;  1EXQ A;  4C8L A;  3HPG A;  2YJE A;  4MLE A;  3ZT2 A;  4K42 A;  3ZX0 A;  1TVR A;  2WFB A;  2YNF A;  4YDU C;  5AQO A;  3SBG A;  1DEJ A;  5KPR A;  3S3N A;  2G8U A;  2FC0 A;  2A5X A;  2ZJP L;  3CQX A;  4LSN A;  3LDQ A;  4ICL A;  4FCY A;  1NGI A;  2Z1H A;  2KTQ A;  5GIP A;  5HP1 A;  3CC4 N;  3PSF A;  1S1X A;  5E41 A;  4CZJ A;  4DQS A;  4FWN A;  2F9T A;  3VEZ A;  4CEF A;  1VQP N;  1S1W A;  4JN4 A;  3DLL L;  4JKD A;  3CF5 L;  4DSF A;  3VTI A;  4CJV A;  4CJQ A;  1ZYQ A;  3CD6 N;  3CJA A;  3WNE A;  2QWR A;  4B3O A;  5AQP A;  2ITG A;  3KTQ A;  1S5J A;  4JLH A;  4RWT A;  4JI0 K;  4LF5 K;  3VQ6 A;  3P39 A;  4DTX A;  1W0H A;  3HM8 A;  1WBD A;  3KK7 A;  3V1O A;  3L2W A;  2O8D A;  2F4V K;  1QTM A;  3AVC A;  3ZSY A;  4KHS A;  1BWF O;  3THW B;  3CQ8 A;  4B3T K;  3L4Q A;  3A5L C;  4JNE A;  3IG1 A;  1O1W A;  1QZ6 A;  2I7P A;  4JKH A;  4CK2 A;  1RT1 A;  1BIS A;  1VQ9 N;  4FVM A;  1NGG A;  3MDQ A;  3CPE A;  4KH4 A;  5HRS A;  3FE1 A;  2HHX A;  3OJS A;  4BE2 A;  3TAP A;  1NJY A;  1IKX A;  1HNW K;  2BH1 A;  2YHB A;  2O8F B;  3HOT A;  2A1S A;  4K0K K;  1WNS A;  5C15 A;  3EY1 A;  3EE9 A;  1BCO A;  1ASV A;  1JKH A;  2HVI A;  2JWL A;  4A59 A;  4O4G A;  1LW0 A;  5BPN A;  3TAR A;  4CZH A;  3C65 A;  3O4Q A;  3I0R A;  4C1N K;  2ZQB A;  1M90 O;  4DR6 K;  2V52 B;  3H3O B;  4DV5 K;  2KFN A;  3SMP A;  4DU4 A;  1NKC A;  1TUU A;  3FZF A;  3LDN A;  1KC8 O;  3VF4 A;  4Q0B A;  2QWP A;  3G25 A;  1TKZ A;  2F8T A;  2RKI A;  3GDQ A;  4WFA L;  3HT3 A;  1ILY A;  2VGM A;  3O9Q A;  1QVG M;  1ZC6 A;  3MED A;  1YVU A;  4L3Q A;  1BL3 A;  2YV0 X;  1JJ2 M;  4DR7 K;  2XRI A;  1C1B A;  1WOQ A;  1BUP A;  3LP0 A;  2QWM A;  1T6D A;  4BR0 A;  1Q86 O;  2GTD A;  5FDL A;  2P51 A;  3VQ4 A;  4CD3 A;  1GLB G;  4OGC A;  4WCE L;  5JMV A;  1C0M A;  3C0B A;  2XY5 A;  3TAB A;  5LJW A;  1UA0 A;  3NAE A;  4CHN A;  2G8W A;  4BC5 A;  1WSF A;  4OKK A;  2WTU A;  1EQY A;  3O1B A;  4IZ9 A;  4GV6 A;  1IBK K;  2DPN A;  3O1W A;  3T3F A;  4IOX A;  1T6C A;  2P9U B;  1D5A A;  5BN9 A;  1S3X A;  2Q97 A;  4BWM A;  3MAQ A;  5KQ8 A;  2I7N A;  4BQL A;  3LAL A;  1FKO A;  4E3S A;  4BE0 A;  2E1Y A;  2Q2R A;  2R7Y A;  5BRH A;  1BQM A;  3E9O A;  4HUF A;  1K8K B;  4MFB A;  1J5O A;  2ASM A;  2FSK A;  5B8H A;  3TSU A;  4CEB A;  1HPM A;  4RTF D;  4JYA K;  3MWT A;  4FWP A;  4W5R A;  3MEE A;  3T1Y K;  5I42 A;  1WUA A;  4HWI A;  1SV5 A;  3VQ5 A;  4QAG A;  5CYQ A;  1VSM A;  4DQI A;  1YAG A;  5AQU A;  5EU7 A;  3SUP A;  1QVF M;  1YTU A;  4FOI A;  1B9D A;  3MXJ A;  1HX1 A;  3SQ0 A;  2Z1G A;  1KVC A;  3DLB A;  3GOI A;  3HVR A;  1NU0 A;  5SZT A;  3QEV A;  3MXM A;  2BAN A;  3QFU A;  4B08 A;  1TAU A;  3O3G A;  3MWP A;  3WNG A;  3V9W A;  4B1U B;  3V81 A;  3NGY A;  2XHB A;  3VQ8 A;  1DTQ A;  3RR7 A;  2E1Z A;  5HLF A;  2AJQ A;  2QW9 A;  1BI4 A;  4CHY A;  3OYC A;  4CK3 A;  4EZ9 A;  4FW2 A;  4CZE A;  4DV1 K;  3V9U A;  3P1G A;  1VQO N;  1WSJ A;  1BA1 A;  1RT5 A;  4RW6 A;  4BRH A;  5IT9 O;  3B6P A;  4ILG B;  3AVB A;  4BVP A;  4EP4 A;  5BRF A;  1NGE A;  2IDO A;  3LZI A;  2YHW A;  3AVK A;  4DV0 K;  1Q82 O;  1IO2 A;  4FXD A;  1NJZ A;  1NK7 A;  4H0P A;  4YOU A;  3ZSW A;  1S22 A;  3KD1 E;  4C23 A;  4CGH A;  1XQS C;  4H4O A;  1FW6 A;  3L0Q A;  1W7A A;  5TKW A;  4FJL A;  1RT3 A;  3NF7 A;  1N33 K;  3BZC A;  3R9P A;  5F1X A;  4DSL A;  1I3A A;  1X3M A;  4DTR A;  4RW8 A;  3NGZ A;  1IG8 A;  3NH1 A;  3LDO A;  1HNX K;  3OYN A;  4KTW A;  2KW4 A;  2FSN A;  5AQM A;  4IFE A;  3MN6 A;  2WC9 A;  2HF3 A;  2ITM A;  4ELU A;  4AF1 A;  2OA8 A;  4AHR A;  2A6A A;  1LWE A;  4WYB A;  4JHD A;  4JKC A;  4WQ4 C;  3THY A;  3CYM A;  3F5T A;  4O0J A;  4DHY A;  3B8A X;  3O8M A;  2E6L A;  2JLE A;  4GY2 B;  5KRT A;  4CZL A;  2O8D B;  3RSE A;  4C1N I;  3OYD A;  3L2V A;  4A5B A;  4FLW A;  1JLG A;  1QS4 A;  2ZM6 K;  5FPM A;  5CYM A;  5GAE P;  5C0Y A;  4BRQ A;  3OYH A;  1A5W A;  4CEE A;  1HRH A;  2D0P A;  2QEX N;  2PFU A;  4IJA A;  2OZM A;  4E19 A;  4YOR A;  3L2Q A;  2F9W A;  4WE1 A;  3SNN A;  1GLL O;  2Q31 A;  1NGH A;  3VET A;  3O4W A;  4FW1 A;  3FLC O;  3HZ6 A;  4KTZ A;  4BRD A;  1HMV A;  4EP5 A;  3ZEU A;  3M8Q A;  3ZSZ A;  4ISE A;  1K6Y A;  4FM0 A;  1OVY A;  5BPM A;  2BGG A;  4Y1D A;  1TUY A;  4QS9 A;  1S6P A;  1FKP A;  4NXM K;  4K41 A;  1WSG A;  5EOY A;  5I3U A;  4FJI A;  4C8K A;  5JS2 A;  2HF4 A;  3R1X A;  4DU1 A;  4KO0 A;  5E84 A;  3OYL A;  4BRE A;  1R0A A;  1ZBS A;  4Z4F A;  3HP6 A;  4A57 A;  2EX3 A;  3E66 A;  1EP4 A;  1NOY A;  5C42 A;  4AM6 A;  2OZS A;  1ASW A;  2QKB A;  1NK8 A;  3JAM O;  4LSL A;  1RBT A;  1NKE A;  1MA9 B;  4LF8 K;  3G6E N;  3BP8 A;  1TKD A;  4KHP K;  4H0O A;  4CBU A;  4GVE A;  3VGK A;  1MDU B;  4FL9 A;  3L8B A;  3AVH A;  1D4X A;  3TAE A;  1KFD A;  4JD2 B;  1W97 L;  4WFN L;  2CGJ A;  1YVN A;  2Q0U A;  4PQU A;  3FFK B;  4QOZ B;  1OH6 A;  5C24 A;  3ZSR A;  3OYM A;  3BDP A;  3AVN A;  4KH5 A;  2ZGZ A;  1N32 K;  5AQY A;  3QBX A;  1CZ9 A;  4BRA A;  1CLQ A;  3A5N C;  4AHS A;  3SAG A;  4DFJ A;  3U6F A;  1TKT A;  2ZD1 A;  4MO5 A;  5FRN A;  1U49 A;  2ZWH A;  1NM1 A;  5EX5 A;  1LV5 A;  3KVG A;  4WQ5 C;  1H1V A;  4FLX A;  4H5R A;  1QQN A;  3VQP A;  3N4Q A;  2P5G A;  4BDP A;  1CXU A;  5CE3 A;  5M1P A;  5KI6 A;  3U4L A;  5AQF A;  4X65 K;  3J7Y P;  2Q1N A;  1WSI A;  1IKW A;  3KLH A;  3AO5 A;  3WT0 A;  1BGX T;  1UA1 A;  2Q3S A;  3AO1 A;  1ASU A;  2IIR A;  5ADX A;  4KB1 A;  4CES A;  4IEE A;  4CGG A;  4JI7 K;  4PHT X;  4BRM A;  4IJN A;  4CJP A;  4ILJ A;  3OS2 A;  3S3O A;  3WXL A;  3CIP A;  3MXI A;  2IAJ A;  1J6Z A;  3HM9 A;  1QQO A;  2YKN A;  1T44 A;  4MDA A;  4O5F A;  3A5O C;  2RF2 A;  3O9S A;  1E3M A;  3O3F A;  4HUG A;  4IG3 A;  2HHV A;  1VHX A;  2P5O A;  2W41 A;  5LMU K;  3PIO L;  4FJN A;  1IKV A;  4AHV A;  1YIT N;  4JS5 A;  4LF4 K;  3FR0 A;  1L3S A;  5FRM A;  1NJX A;  4K43 A;  4LC9 B;  1C0F A;  4K25 A;  2KHO A;  1TL3 A;  1HR0 K;  4MDB A;  4EHU A;  1SKR A;  1NK4 A;  4I9L A;  3UKR B;  2GV9 A;  4KI4 A;  3OYF A;  1YHQ N;  1T8E A;  1DLO A;  4H5V A;  2P9P A;  2J4R A;  1REV A;  1TAQ A;  2QXF A;  1UWB A;  3IUC A;  4CJK A;  4FO0 A;  1U2V A;  1NGA A;  3KLE A;  3QET A;  1S9G A;  4KTQ A;  1QHT A;  4EFH A;  5M1K A;  1JLA A;  4J8F A;  3CJ7 A;  2ZJQ L;  4ZTJ A;  3CCU N;  4AHU A;  3AAQ A;  2W6L A;  3T1H K;  4DV7 K;  3TTF A;  1WSH A;  4IFV A;  3WEE A;  2OTL N;  1C0T A;  4FWO A;  3ZT3 A;  3KWI A;  3LWL A;  3H6E A;  2FF3 B;  3TAM A;  4GVM A;  1GOA A;  2FBV A;  1RNH A;  2D1K A;  3KWG A;  3LDP A;  4JI8 K;  1E4G T;  4DMN A;  2E20 A;  2UUB K;  2O8E B;  3NMU A;  1HLU A;  1VK0 A;  3O3H A;  4OKJ A;  1NGJ A;  5AFU A;  4B9V A;  3VQA A;  1BHL A;  1OVQ A;  3PX4 A;  3RMA A;  4PWD A;  4E7I A;  1S1U A;  4KV8 A;  1NGB A;  1R59 O;  3OYB A;  3CI5 A;  2RE2 A; 
#chains in the Genus database with same CATH homology
 4XIU A;  4DU4 A;  3ZT1 A;  1NKC A;  3AV9 A;  1QQC A;  4YNQ A;  3K5N A;  1HQU A;  4KHU A;  3WNF A;  4CGI A;  4Q0B A;  4OLA A;  4C8M A;  4CHP A;  1TKZ A;  4B8A B;  2RKI A;  2F8T A;  3HT3 A;  4DTN A;  3K59 A;  3MED A;  3P5J A;  1YVU A;  1BL3 A;  2YV0 X;  4CED A;  3KLG A;  2Y1J A;  2XRI A;  1C1B A;  3E01 A;  3MEC A;  4B9L A;  1KVA A;  3NCI A;  2DFF A;  4NYN A;  3LP0 A;  4E1N A;  4IG0 A;  4FJK A;  3V6D A;  4F2S A;  1RDD A;  1YTA A;  2F96 A;  3OYK A;  5KRS A;  5FDL A;  4M45 A;  1HPZ A;  2P51 A;  3NFA A;  3VQ4 A;  4IKF A;  4CF0 A;  2YNG A;  1NK6 A;  4OGC A;  1HYS A;  1WSE A;  4FJ5 A;  3FFI A;  3L2R A;  3C6T A;  1C0M A;  2OPS A;  4M3R A;  2XY5 A;  4F2R A;  3NF6 A;  3TAB A;  3ASM A;  4F3O A;  1UA0 A;  2QK9 A;  4C8O A;  3VA0 A;  3NAE A;  4CHN A;  4F8R A;  3AVM A;  2G8W A;  2XY8 A;  3CM5 A;  2HND A;  3HYF A;  2HHQ A;  1C0U A;  3QLH A;  3OYE A;  4E7L A;  3KK3 A;  1WSF A;  4OKK A;  1U47 A;  1VSD A;  3SJJ A;  2VG5 A;  4FZY A;  4AH9 A;  4CFC A;  4FJ9 A;  5J2Q A;  3QER A;  2HVH A;  3I0S A;  4W5N A;  1VRT A;  1KCF A;  3LP2 A;  4CJE A;  3L3V A;  3NH2 A;  3HP9 A;  4ZTF A;  4DQR A;  1ZBH A;  3T3F A;  4F4K A;  3ULD A;  1D5A A;  1S6Q A;  4ELT A;  4FK0 A;  3AO4 A;  4BWM A;  3ZSQ A;  3MAQ A;  4KB0 A;  3NGI A;  4LH4 A;  1HNI A;  1RT6 A;  3LAL A;  4J2B A;  1FKO A;  4E3S A;  4BE0 A;  4FK2 A;  1JLC A;  4Z4H A;  4RW9 A;  4AHT A;  4IDK A;  3OYA A;  3RMC A;  3SPZ A;  3SQ4 A;  2R7Y A;  1J5O A;  1BQM A;  4HUF A;  3K5M A;  4MFB A;  3DLH A;  3I8D A;  1RTI A;  4DFM A;  1SL0 A;  3DRP A;  4E89 A;  4CEB A;  5CY4 A;  2B4J A;  1VSJ A;  3AA2 A;  2WON A;  3HPH A;  4W5R A;  3CFP A;  3OYG A;  3MEE A;  4LD0 A;  3T1A A;  5I42 A;  1A5V A;  2A1R A;  2VWK A;  5J1E A;  3SV4 A;  1LAW A;  1MU2 A;  1JXB A;  3AA3 A;  4DS4 A;  1BIU A;  3F73 A;  3LP1 A;  1RT7 A;  3VQQ A;  3OY9 A;  1SV5 A;  3VQ5 A;  5C25 A;  4QAG A;  1B9F A;  1JL1 A;  5CYQ A;  3SI6 A;  4B9U A;  3NDK A;  1VSM A;  3AA4 A;  2VWJ A;  1I39 A;  4CFA A;  4CJT A;  4Z4C A;  4BWJ A;  2RN2 A;  4CK1 A;  4DQQ A;  3VQE A;  4YFU A;  3TAG A;  4DQI A;  3QEI A;  2FBY A;  1VSK A;  5EU7 A;  3SUP A;  4Q5V A;  1YTU A;  2P1J A;  3LAM A;  5J2N A;  1B9D A;  3MXJ A;  4FJ7 A;  3TAQ A;  4CHQ A;  5KTQ A;  3SQ0 A;  4OPJ A;  2Z1G A;  1KVC A;  3DLB A;  4HUE A;  3ALY A;  4M3Z A;  1KFS A;  3HVR A;  5SZT A;  3MXM A;  3QEV A;  2BAN A;  4W5T A;  3DLG A;  4RW7 A;  3AVA A;  4B08 A;  1CXQ A;  4N56 A;  1NJW A;  1RT2 A;  3PX0 A;  1TAU A;  2HB5 A;  2X78 A;  3O3G A;  3HPO A;  3SPY A;  3WNG A;  4EZ6 A;  3V9W A;  3V81 A;  1ZBL A;  3NGY A;  3PUF A;  1D8Y A;  2XHB A;  3VQ8 A;  1DTQ A;  3TI0 A;  3RR7 A;  4O5B A;  4B9T A;  3HL8 A;  5HLF A;  3PX6 A;  2ZE2 A;  3D0P A;  2XY6 A;  2AJQ A;  3S9H A;  4CJW A;  1BI4 A;  4FZX C;  2X6N A;  1RBV A;  4CHY A;  3OYC A;  2OYQ A;  4CE9 A;  1ITG A;  4CK3 A;  4CEQ A;  4BE1 A;  4N41 A;  2FBX A;  4EZ9 A;  4FW2 A;  2E4L A;  4J2A A;  3KKR A;  4IBN A;  3KK1 A;  4GW6 A;  3AVL A;  4CF8 A;  3CG7 A;  4TSX A;  2IOC A;  1JLB A;  4B8C A;  3V9U A;  3QEP A;  4HCC A;  1WAF A;  3P1G A;  3S3M A;  1WSJ A;  4GMJ B;  1RT5 A;  1J9A A;  3CFR A;  4RW6 A;  3K5L A;  3H08 A;  3B6P A;  3VQC A;  1RDB A;  3U3G A;  2W42 A;  3AVB A;  4BDY A;  1T05 A;  3D45 A;  3DRS A;  2IDO A;  4EP4 A;  3LZI A;  4NCA A;  3AVK A;  3VA3 A;  4OLB A;  4KHQ A;  3M8P A;  1IO2 A;  4FXD A;  3SV3 A;  2OPP A;  1XHX A;  1NJZ A;  1NK7 A;  4FLY A;  3ZSW A;  4W5Q A;  4CGH A;  2Z1J A;  4CJL A;  4H4O A;  4FM1 A;  3KD1 E;  4CEA A;  1RTJ A;  4FJL A;  3ZSV A;  3KK2 A;  1RT3 A;  3NF7 A;  1Z26 A;  1KSP A;  4OKE A;  4DSL A;  3V1R A;  1I3A A;  3DYA A;  4NYF A;  4NCG A;  4RW8 A;  4CIG A;  4DTR A;  1TV6 A;  3NGZ A;  3NH1 A;  2D0C A;  4CJ5 A;  3AVI A;  4FJJ A;  2YHA A;  3OYN A;  1VSE A;  3VQB A;  3T19 A;  4KTW A;  3JSM A;  1QE1 A;  2KW4 A;  4N76 A;  1TKX A;  1NK5 A;  4OVL A;  4ELU A;  1XI1 A;  2F8S A;  2KFZ A;  2OA8 A;  4AHR A;  3C6U A;  4DWI A;  3TAN A;  4FJ8 A;  1LWE A;  1LWC A;  2HHW A;  1D9F A;  5T7B A;  4M42 A;  4M3U A;  1WAJ A;  1VSF A;  2VG7 A;  3CYM A;  4DTM A;  4O0J A;  3HXM A;  3HK2 A;  4FJH A;  2FBT A;  1SKS A;  1ZBU A;  4J2D A;  2Y1I A;  1C1C A;  2E6L A;  2JLE A;  4Y1C A;  5HBM A;  3QES A;  1X1P A;  5KRT A;  3NH0 A;  2Z1I A;  3ZT4 A;  2IC3 A;  4N5S A;  1U45 A;  4Z4E A;  1KRP A;  1EKE A;  1J53 A;  4E7H A;  3OYD A;  3L2V A;  2E6M A;  3OVN A;  4FLW A;  4AIL C;  1JLG A;  1KTQ A;  1QS4 A;  1RDC A;  1QSS A;  4KKO A;  4FLZ A;  5CYM A;  4ID1 A;  1KLN A;  4CEC A;  3MEG A;  4O44 A;  3THV A;  3OYH A;  1XHZ A;  1RTH A;  1A5W A;  4CEE A;  3EYZ A;  1L5U A;  1HRH A;  2DY4 A;  1N6Q A;  3K57 A;  2HHT A;  3QIN A;  3K2P A;  3HJF A;  3AVJ A;  1HYV A;  5K14 A;  2OZM A;  2DFH A;  3ISN C;  1Q8I A;  4W5O A;  4KPY A;  4KFB A;  4E19 A;  1RBU A;  3DOL A;  4DSJ A;  3L2Q A;  4WE1 A;  3V9Z A;  3SCX A;  4FK4 A;  3SNN A;  3DI6 A;  2VG6 A;  4E1M A;  1C6V A;  1Q9X A;  1HJR A;  3OYI A;  2PZS A;  4H4M A;  4FW1 A;  4CCH A;  4K8Z A;  2PYL A;  4KTZ A;  2D0B A;  2LSN A;  1HMV A;  3CM6 A;  4CFD A;  3B6O A;  2IGI A;  4EP5 A;  4KAZ A;  1VRU A;  3CFO A;  1UOC A;  2B5J A;  2X6S A;  1K6Y A;  3M8Q A;  3ZSZ A;  4O0I A;  1IKY A;  4FM0 A;  4CJU A;  4ZHR A;  4DTP A;  4B9S A;  2BGG A;  2HHU A;  4Y1D A;  3PO4 A;  4DSK A;  1BIZ A;  1HQE A;  1S6P A;  5HRN A;  4DQP A;  3SZ2 A;  3QNN A;  4CJS A;  4CJ4 A;  4Z4I A;  1FKP A;  1RT4 A;  3AA5 X;  4M3X A;  4OPK A;  4ELV A;  1WSG A;  3QEX A;  5I3U A;  1RTD A;  4R5P A;  4CF9 A;  5SWM A;  4M41 A;  1DTT A;  4M3T A;  4FJI A;  4C8K A;  1S9E A;  1F21 A;  3SUQ A;  3V9X A;  5JS2 A;  1ZBF A;  3VQD A;  4KRE A;  3JYT A;  4LY7 A;  4FLT A;  4DU1 A;  4KO0 A;  1L3T A;  3SUN A;  3OYL A;  1RCH A;  3F9K A;  1R0A A;  4IFY A;  2XO7 A;  3NF9 A;  4ID5 A;  4E7J A;  2KZM A;  1SL2 A;  4KHW A;  4Z4F A;  3HP6 A;  2EX3 A;  1RDA A;  4H8K A;  4B9N A;  3C95 A;  1EP4 A;  1G15 A;  5C42 A;  1NOY A;  4KI6 A;  2ATQ A;  3TAF A;  1XWL A;  2NUB A;  4M3W A;  2OZS A;  4F3T A;  1ASW A;  1HNV A;  3K5O A;  2QKB A;  1T03 A;  2YNH A;  1NK8 A;  3C94 A;  1FXX A;  4DTO A;  3LAK A;  1RBT A;  4LSL A;  1TGO A;  1NKE A;  3IRX A;  5JS1 A;  1X9W A;  1J54 A;  3VQ9 A;  1TKD A;  1NK0 A;  4FJM A;  4PY5 A;  3L3U A;  4CF2 A;  4N47 A;  2KZZ A;  3V4I A;  3L8B A;  1EET A;  3AVH A;  3TAE A;  3TR8 A;  1KFD A;  3P83 D;  2G8V A;  3A2F A;  4FM2 A;  1Y97 A;  2D0A A;  5KGX A;  4PQU A;  4HHT A;  4E0D A;  4QOZ B;  5C24 A;  4DFK A;  3EZ5 A;  1A5X A;  1RBS A;  3KIO A;  1BQN A;  3ZSR A;  3OYM A;  5HRR A;  4DF4 A;  3BDP A;  4FYD A;  3AVN A;  1JLE A;  3V9S A;  4QCL A;  4KRF A;  1RBR A;  2JGU A;  1CZ9 A;  4Z4G A;  3AO3 A;  4FLU A;  2B6A A;  4HCB A;  3IAY A;  1CLQ A;  3DRR A;  4AHS A;  1LAV A;  3RRH A;  1U04 A;  3HVT A;  4DFJ A;  1VSL A;  4Z0U A;  3U6F A;  3SUO A;  4FJG A;  1Q9Y A;  1TKT A;  4CER A;  1YT3 A;  3KJV A;  2ZD1 A;  3L2U A;  1U48 A;  2RPI A;  4DSE A;  5FRN A;  1BI4 B;  3IS9 A;  4DTS A;  1JLQ A;  1U49 A;  1TK8 A;  1NKB A;  1LV5 A;  1SUQ A;  1S1T A;  4CF1 A;  4FLX A;  5D3G A;  4CHZ A;  3VQP A;  3OJU A;  3BGR A;  4CHO A;  1QSY A;  2X74 A;  5FRO A;  1LW2 A;  2BDP A;  3AO2 A;  2P5G A;  1S1V A;  2G8K A;  1C1A A;  1JLF A;  1VSI A;  5DK5 A;  1CXU A;  3LDS A;  4BDZ A;  3RR8 A;  4BDP A;  4I2Q A;  1W9H A;  4CEZ A;  4J2E A;  4FJX A;  4DTJ A;  5KI6 A;  3LPT A;  5J2P A;  3DLE A;  3QIP A;  3DOK A;  1WSI A;  5CZ2 A;  1IKW A;  3UIQ A;  3DLK A;  3NBP A;  1JXE A;  3QIO A;  3KLH A;  4G1Q A;  2QKK A;  4KHY A;  2HHS A;  3G0Z A;  1VSH A;  3ITH A;  3AO5 A;  1GOB A;  1BGX T;  4RG8 A;  1HYZ A;  4DLE A;  1UA1 A;  2Q3S A;  4B9M A;  3AO1 A;  3NE6 A;  1ASU A;  2DTU A;  4KHN A;  2O4G A;  4HVJ A;  4KB1 A;  4CES A;  4RW4 A;  2DFE A;  3ZSX A;  4CGG A;  2EHG A;  3ZT0 A;  3RMD A;  4PUO A;  4I2P A;  3HST B;  4HTU A;  5DMR A;  4JS4 A;  3OS1 A;  3NHG A;  1XC9 A;  4PA1 A;  1FK9 A;  4CJP A;  3SYZ A;  4DFP A;  2YKM A;  3VQ7 A;  5KGW A;  1T7P A;  1GOC A;  3U3Y A;  3OS2 A;  3S3O A;  4DTU A;  1EXQ A;  3MXI A;  2IAJ A;  4C8L A;  3LPU A;  3HPG A;  2KQ2 A;  3HM9 A;  2YKN A;  3ZT2 A;  1RIL A;  3AVG A;  3QO9 A;  1TVR A;  3OYJ A;  2RF2 A;  2YNF A;  3O3F A;  3OS0 A;  4HUG A;  4IG3 A;  2HMI A;  2HHV A;  2P5O A;  4L8R B;  3S3N A;  2G8U A;  4FLV A;  2FC0 A;  4FJN A;  1IKV A;  4LSN A;  2GBZ A;  1IG9 A;  4JRP A;  1IH7 A;  4AHV A;  3NF8 A;  3V1Q A;  3KLF A;  3PV8 A;  2PY5 A;  2OPQ A;  4ICL A;  4NCB A;  4FCY A;  4JS5 A;  2Z1H A;  1L3S A;  1KLM A;  5FRM A;  1NOZ A;  4CJ3 A;  3SQ2 A;  2KTQ A;  5HP1 A;  3DMJ A;  3PO5 A;  5CZ1 A;  1NJX A;  1SL1 A;  4I9Q A;  4UQG A;  3WNH A;  3VN5 A;  1S1X A;  1X9S A;  5E41 A;  2WOM A;  3M8R A;  3LP3 A;  4DQS A;  1TL3 A;  2PYJ A;  4CEF A;  2GUI A;  1SKR A;  1S1W A;  1NK4 A;  2YNI A;  4I9L A;  1TL1 A;  2ETJ A;  4OJR A;  2GV9 A;  4KI4 A;  1D9D A;  3OYF A;  4DSF A;  4CJV A;  4K8X A;  1T8E A;  1DLO A;  4CJQ A;  1Z25 A;  2G8F A;  4CGD A;  3ZCM A;  4CIE A;  1ZYQ A;  1REV A;  1KVB A;  1TAQ A;  2IS3 A;  2QXF A;  1UWB A;  4CJK A;  3LZJ A;  3KKS A;  4CIF A;  4BAC A;  3RMB A;  4LH5 A;  3WNE A;  5HRP A;  2G8I A;  2O4I A;  4B3O A;  4CJR A;  3KLE A;  2HNY A;  3M8S A;  3QET A;  2ITG A;  4CJF A;  3DM2 A;  1EX4 A;  3KTQ A;  1S9G A;  3KD5 E;  1S5J A;  4JLH A;  3RTV A;  4AHC A;  4M3Y A;  4KTQ A;  1LWF A;  1QHT A;  3VQ6 A;  4DTX A;  1X9M A;  1NK9 A;  1JLA A;  1W0H A;  4ZTJ A;  3V1O A;  3L2W A;  3QNO A;  1QSL A;  1QTM A;  3RRG A;  3AVC A;  4AHU A;  3ZSY A;  1TK5 A;  4KHS A;  3K58 A;  3CQ8 A;  4CGF A;  2OPR A;  3IG1 A;  1O1W A;  1WSH A;  2HNZ A;  4IFV A;  4O55 A;  4JRQ A;  1L3V A;  1C0T A;  4CK2 A;  4FZZ A;  1RT1 A;  1BIS A;  4DS5 A;  4OGE A;  4DU3 A;  4FVM A;  3ZT3 A;  5J2M A;  1U4B A;  3LWL A;  4C8N A;  3LWM A;  3ZSO A;  5HRS A;  3HO1 A;  3TAM A;  4GVM A;  2HHX A;  1GOA A;  3OJS A;  4BE2 A;  2FBV A;  3LAN A;  3TAP A;  3DLR A;  1RNH A;  3TWH A;  1NJY A;  4DMN A;  4DSI A;  3SQ1 A;  1IKX A;  4CFB A;  3KLI A;  4MQ3 A;  2XY7 A;  1BCM A;  1CZB A;  2YHB A;  3AVF A;  4CEO A;  4CGJ A;  3PY8 A;  4I7F A;  2A1S A;  1N5Y A;  3O4N A;  1VK0 A;  1WNS A;  3O3H A;  1JL2 A;  3EY1 A;  4OKJ A;  3G10 A;  1BCO A;  4B9V A;  1WLJ A;  1ASV A;  3VQA A;  1BHL A;  1JKH A;  2G8H A;  3PX4 A;  3RWU A;  2HVI A;  2I5J A;  4O4G A;  3RMA A;  5HRO A;  1LW0 A;  3TAR A;  1ZBI A;  4PWD A;  4E7K A;  3O4Q A;  1L3U A;  3I0R A;  4E7I A;  2ZQB A;  2HW3 A;  1S1U A;  1TK0 A;  4DG1 A;  4DLG A;  4KV8 A;  2BE2 A;  4DF8 A;  3QEW A;  1WN7 A;  3OYB A;  2D5R A;  1UAX A;  2KFN A;  1SKW A;  1B92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...