4CIGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cigA00
4HUEA 4C8NA 1JXEA 2IDOA 3QETA 4PUOA 1HYVA 1FK9A 4CJLA 4Z4FA 4PQUA 4M3RA 2KZMA 3HSTB 3VQ5A 1U4BA 5FROA 2OPQA 3KLFA 2IGIA 1KVBA 2RN2A 1WSGA 4EP4A 4CHOA 4DFKA 3AVHA 2HHTA 3O4NA 4JRPA 2A1RA 1BHLA 3RMBA 4IBNA 4KPYA 3ZT0A 1BI4B 2Z1HA 1JLGA 1WSFA 1T8EA 1EKEA 3AO2A 1Z26A 4KTZA 3AO1A 1HQUA 4BWJA 2FBVA 1QS4A 4FLVA 3QIPA 1RTHA 1KVAA 1TKZA 3VA3A 4DS4A 3V9ZA 4CJ3A 1T05A 1A5VA 1C0UA 2LSNA 1HNIA 1TKTA 3AV9A 3KLGA 3CFRA 4N5SA 4DTPA 3V1OA 1NK7A 1WSHA 1WAJA 4Y1DA 4WE1A 3NAEA 3VQPA 3PUFA 2IOCA 4DTSA 2HVIA 5HBMA 3NHGA 2ETJA 3DI6A 1LW2A 1NK5A 2ATQA 4J2DA 4FZZA 4OKKA 4AHUA 4B9MA 2PY5A 1LW0A 3V9UA 4H8KA 2XY7A 2PZSA 1RT5A 4FYDA 1JL2A 4IG3A 3VA0A 3V1QA 3LZIA 3LDSA 2G8HA 4Z4IA 1B9FA 3G0ZA 4FJ7A 1YT3A 1NOZA 4H4OA 4CFBA 3V4IA 3AA2A 1XHXA 4NYNA 4CEBA 3AVIA 4DLEA 3TANA 4F4KA 4CF1A 1NOYA 3HJFA 4Q5VA 4CHZA 3QERA 1RBSA 3DM2A 1S1WA 2RPIA 4BDYA 1TK0A 4KTQA 1NJXA 4Q0BA 3DRPA 1VSFA 2GBZA 3VQ6A 3WNHA 4KFBA 1NJYA 5EU7A 4AH9A 4CJEA 3B6OA 3NGIA 3K58A 1B9DA 1HMVA 2HNZA 1S1TA 1J9AA 4CCHA 4FW2A 1RILA 5CY4A 4DQIA 4DTRA 4CJ5A 4KI4A 3KD5E 4DTUA 4RW8A 4DQQA 3ITHA 4CF0A 3OJUA 4CHPA 2YNGA 5KRTA 1IKVA 1HJRA 3AA4A 3QEXA 4OLAA 2VWJA 4NYFA 3O3GA 4CFDA 4O55A 4TSXA 4RW6A 1ZBFA 2X78A 4KREA 2BE2A 3LALA 3PX4A 4CIFA 2R7YA 1RT1A 4Z4GA 4J2EA 3AA5X 3VN5A 4HCBA 4DLGA 2DFEA 1JLEA 1MU2A 3AVKA 2KQ2A 1NJWA 2QKKA 1RT3A 3DLGA 3MECA 3B6PA 3ZSOA 5HRSA 2G8KA 2BDPA 4N76A 3LAMA 3TAQA 1N5YA 4AHTA 5DK5A 1IH7A 5J2QA 3SPYA 3TAPA 1VSHA 3M8SA 4FJLA 1UA0A 1DTQA 4B08A 3C94A 4LD0A 3ZSXA 3AVNA 1IKXA 2YHAA 5CYMA 4CGDA 4DQPA 4PWDA 3AVBA 3CFPA 2XO7A 4DSJA 3VQCA 4CJSA 1HNVA 4E7HA 2KZZA 4ZHRA 3U3GA 5C25A 3TAMA 3SUPA 1W0HA 4GVMA 2P5OA 4B9NA 5HRRA 3OS1A 4DFJA 4B3OA 3AVAA 2GUIA 4C8MA 5D3GA 1QHTA 3MEDA 3ISNC 3HL8A 3NF9A 4E7JA 1I39A 3KLHA 1BISA 1C1BA 4AILC 3QEIA 1L3VA 1SKSA 1JKHA 3TAFA 3AO3A 4KV8A 3OYLA 3S3OA 1JLBA 4M42A 3I8DA 1G15A 2ZD1A 5KGXA 2ZQBA 3QESA 3AVJA 4CK2A 1D8YA 4CHQA 4FM2A 3OS0A 3H08A 3LP1A 4CEOA 4CEAA 1VK0A 4FVMA 1YTAA 3K5NA 3SZ2A 3SJJA 1T7PA 4O0JA 2OYQA 4FJHA 4FW1A 4M3XA 5FRNA 3HPOA 4DSFA 4CIEA 4QOZB 2YNIA 3DYAA 4DTNA 3WNEA 1I3AA 3VQQA 4R5PA 3SPZA 3CM5A 4Y1CA 1NK8A 1U45A 4EZ6A 3V9WA 5E41A 3V6DA 1KLMA 5JS1A 2P5GA 4FJ8A 4ELVA 3LPTA 2E4LA 5CZ2A 1SKWA 1JLFA 4F3OA 1IKWA 2WONA 1XC9A 2XY6A 3CM6A 3SYZA 3QEPA 4CJKA 4B8CA 4CJVA 2G8WA 2BANA 4J2BA 5K14A 1SKRA 2XY8A 1BCMA 2JLEA 3CQ8A 4M45A 3RR7A 3AA3A 3LANA 1RT2A 4ZTJA 2G8IA 2VG5A 1UA1A 2ZE2A 3HP6A 2HHVA 3SUOA 4LSLA 1WAFA 3QIOA 4KRFA 4YNQA 1L3UA 2VWKA 3RRHA 4E0DA 2OPPA 4CHYA 1J54A 4KB0A 5HLFA 1NKBA 1A5XA 3BGRA 4JRQA 1U47A 4LSNA 3SQ4A 3JYTA 4DSKA 3G10A 3U3YA 1BQMA 3DLEA 4OKJA 4CE9A 3KLEA 3OVNA 3TARA 1QSYA 1B92A 2HB5A 5HRNA 3K5OA 3VQ7A 3EY1A 3OYAA 3CYMA 2B6AA 1HPZA 1NK4A 3TAEA 1JLAA 4OGCA 1WSJA 4E89A 3OYDA 2Z1GA 1VSIA 3S9HA 4OLBA 1RT4A 4C8KA 2D0BA 3NH1A 4DWIA 1HYZA 2D0AA 3OY9A 3V81A 2DY4A 2FBXA 4M3UA 4W5NA 4CJWA 3S3NA 1TV6A 1TKXA 1VSMA 1RBUA 3NGYA 4RG8A 5DMRA 2HVHA 3F73A 3SI6A 2RKIA 1JLCA 3NH2A 4ZTFA 1HRHA 2AJQA 1EP4A 1C1CA 2VG7A 4H4MA 4CJPA 3L2QA 4YFUA 4FJMA 4B8AB 4LH4A 4FJ9A 2B5JA 2EHGA 4DU4A 3ALYA 4CECA 2G8VA 3SQ1A 4OJRA 3MAQA 4M3WA 4CF2A 3QO9A 2XY5A 1TK5A 3ZSQA 3OS2A 3PO5A 4M3TA 1VSEA 3HK2A 1D9DA 1SV5A 3QNNA 3IRXA 4IFYA 4W5TA 4NCBA 4CF8A 1VSLA 3OYHA 2XRIA 2Z1IA 4FJ5A 3S3MA 2X6SA 4DQRA 4N47A 4E1NA 1X9SA 3ZSRA 3HM9A 2DTUA 1CXUA 1KFSA 1BCOA 1Q8IA 4FLXA 4FK4A 2HW3A 4FCYA 4DU1A 3FFIA 1D9FA 3KTQA 2O4GA 4CEEA 1VRUA 1QE1A 1FKPA 4CFAA 4IFVA 1RBVA 3DMJA 4O0IA 1ZYQA 4KI6A 2Z1JA 2YKMA 2W42A 4NCAA 1WLJA 1BIUA 4KHUA 4B9SA 3ZCMA 3SV3A 3L3UA 4DS5A 3LWMA 2NUBA 4W5QA 4DQSA 1UAXA 5J2PA 3TAGA 3L2UA 1RBRA 3NBPA 3RTVA 2IC3A 4AHRA 3AVFA 4Z4CA 5HRPA 1KRPA 1Q9YA 1QSLA 3MEGA 4HVJA 3TI0A 1LWEA 1KTQA 1UOCA 4DFPA 1KSPA 3HXMA 2GV9A 1N6QA 4BE1A 4CFCA 4RW4A 3MEEA 3OYNA 2OPRA 3LAKA 4NCGA 3WNFA 4CJTA 3T3FA 4C8LA 4F2SA 3QINA 2O4IA 2D0CA 1TGOA 4W5OA 3OJSA 3IAYA 1KVCA 3ZSVA 3U6FA 3OYJA 3M8PA 4E7LA 4K8ZA 1ASWA 4KHYA 4E19A 4FZXC 1J53A 4KO0A 2DFHA 5C42A 4I7FA 4FJKA 4CK3A 4CGIA 3MXMA 4CHNA 3OYMA 1TKDA 3P83D 3DOKA 1LAWA 3VQEA 4O5BA 2OPSA 5KI6A 2X74A 1ZBUA 5CZ1A 3LZJA 4FJJA 4DMNA 1T03A 4EZ9A 4CGHA 4KB1A 4CGJA 4DF8A 4CJ4A 1RNHA 2VG6A 3OYKA 3K59A 1NKCA 4B9LA 3KD1E 1CZ9A 3HVTA 3F9KA 3QEVA 1K6YA 4LY7A 5SWMA 3L3VA 3CG7A 4DSIA 3PO4A 1KCFA 5C24A 4HHTA 2KW4A 3NF7A 4GMJB 2FBTA 3ZT3A 4KTWA 4W5RA 3KK3A 3DLBA 2IAJA 4CJQA 4FXDA 3SV4A 1ZBLA 4CIGA 4K8XA 1IKYA 4E7IA 3KK2A 3DRRA 3PV8A 3IS9A 1S9GA 3P5JA 4N56A 5J2MA 3NF8A 3M8RA 5KGWA 4OKEA 1F21A 4ID1A 3VQAA 3A2FA 3TR8A 3I0SA 4FJNA 1BQNA 3VQ9A 1L3SA 1TAQA 4EP5A 3C6TA 3V1RA 3DRSA 4CEDA 4DTXA 1QSSA 3HPHA 3EYZA 1NJZA 1Z25A 2HHSA 3TABA 2JGUA 1RDDA 4M3YA 1S6QA 3OYFA 1GOBA 3RRGA 4B9TA 3ZSZA 1S1UA 1RT6A 4AHVA 3K5LA 2A1SA 4UQGA 1EETA 4DF4A 1IO2A 3THVA 3VQ8A 4O4GA 1REVA 4CEZA 5KRSA 4CERA 4G1QA 4HUFA 2DFFA 4N41A 3O4QA 4LH5A 3KK1A 1RDAA 4FLWA 2KTQA 2ITGA 3ASMA 3HP9A 4FLYA 2B4JA 1IG9A 1TL3A 4DSEA 2G8UA 4C8OA 3VQBA 3M8QA 2Q3SA 3AVMA 3NGZA 1XWLA 4I9LA 1HYSA 2XHBA 4CESA 1W9HA 2F96A 3T1AA 4CK1A 3EZ5A 1NK0A 3PY8A 4FLZA 1TK8A 1L3TA 4FK0A 4FK2A 4BWMA 1JL1A 5FRMA 1JLQA 4MQ3A 4FM1A 2HHQA 4QAGA 4OPJA 2QKBA 4CEQA 4DSLA 4Z0UA 4CGGA 1DLOA 2QK9A 1LAVA 4QCLA 4O44A 1DTTA 1WN7A 4F8RA 5I3UA 3ZT4A 4BACA 1LV5A 4BDPA 3AVGA 1GOCA 5HROA 1BGXT 2F8SA 4Z4EA 1BI4A 3CFOA 2P51A 4FM0A 4I2PA 4F2RA 5CYQA 3P1GA 3QNOA 2HHUA 1X1PA 3VQDA 3E01A 2PYJA 1GOAA 4KHWA 3HPGA 1CZBA 3IG1A 4M41A 4CJFA 4DFMA 4CEFA 2OZMA 4PY5A 4HCCA 2E6LA 1Y97A 3UIQA 1ZBHA 3SCXA 4PA1A 3RWUA 5J1EA 1SL1A 1ASUA 3KKSA 5T7BA 3SUQA 3HO1A 4Z4HA 4DU3A 3AVCA 4OVLA 2Y1IA 1RBTA 1Q9XA 3D0PA 4FLTA 1S1XA 1VSDA 3MXIA 2KFZA 1X9WA 1VRTA 2E6MA 3C6UA 1RTIA 1WSEA 4I2QA 3V9SA 3SQ0A 1XI1A 3NE6A 1U49A 3MXJA 3LP0A 1J5OA 3LP2A 1S5JA 1ZBIA 2HNDA 4HUGA 1C6VA 1S6PA 3K57A 4OGEA 4OPKA 3SUNA 4B9VA 2G8FA 4JS5A 4ID5A 3NDKA 4E7KA 3QEWA 1LWFA 2I5JA 3RMCA 3ZSWA 3KKRA 1YVUA 3HT3A 5HP1A 3AO4A 4CJRA 3O3HA 2FC0A 1S9EA 3HYFA 4AHCA 3OYCA 1BIZA 3DLRA 4ICLA 2PYLA 1RDBA 2FBYA 3VQ4A 3PX0A 1NK9A 1U04A 4BE0A 2OA8A 1SL0A 4ELUA 2HHXA 1VSKA 2BGGA 2EX3A 3L8BA 4IKFA 3NFAA 2HNYA 1VSJA 3NF6A 3K5MA 1TVRA 3SQ2A 3QLHA 4RW7A 4XIUA 1SL2A 3OYGA 2KFNA 5KTQA 4GW6A 1ITGA 4L8RB 4FJIA 3DLHA 4RW9A 4KKOA 3LWLA 4KHSA 1CXQA 2QXFA 4FZYA 1RDCA 3D45A 4J2AA 1KLNA 3K2PA 1YTUA 1A5WA 1WSIA 1JXBA 1SUQA 2D5RA 3KJVA 4AHSA 3T19A 1NK6A 3BDPA 1RTJA 3PX6A 1EX4A 1HQEA 4IG0A 2HMIA 2YNFA 1LWCA 1O1WA 3TWHA 3SNNA 1RTDA 1QTMA 4ELTA 4IDKA 1WNSA 4F3TA 1L5UA 4FJGA 3C95A 5JS2A 1C0TA 2YKNA 3RMDA 4KHNA 4B9UA 2Y1JA 4DTOA 4BDZA 1XHZA 2YV0X 3LP3A 3O3FA 5J2NA 3ZT2A 1U48A 3OYIA 2RF2A 4DTJA 3NH0A 3JSMA 3KLIA 5SZTA 4JS4A 1ASVA 3OYEA 5FDLA 1X9MA 1KFDA 2YNHA 1EXQA 3AO5A 3LPUA 4E3SA 4E1MA 3NCIA 5I42A 1FKOA 3L2WA 1NKEA 4I9QA 4FJXA 2IS3A 1RCHA 3ULDA 3ZT1A 4KHQA 1FXXA 2YHBA 3DOLA 3HVRA 1C0MA 1TAUA 1UWBA 3RMAA 1CLQA 4DTMA 3RR8A 3L2VA 2WOMA 4CGFA 1QQCA 4BE2A 1S1VA 1R0AA 2HHWA 1RT7A 4CJUA 4FLUA 2P1JA 3AVLA 2X6NA 3L2RA 4CF9A 2F8TA 1C1AA 1BL3A 3OYBA 3I0RA 3WNGA 4JLHA 3ZSYA 3DLKA 3KIOA 1D5AA 4MFBA 2OZSA 1TL1A 4DG1A 4M3ZA 4HTUA 3V9XA 4KAZA
chains in the Genus database with same CATH superfamily
1JXEA 4PQUA 1U4BA 3LDLA 3FLCO 5DM6L 2RN2A 2E88A 3CJBA 3WQUA 4DFKA 2HHTA 2A1RA 3RMBA 4CBWA 2O8BA 1YAGA 1WSFA 2O8DA 1EKEA 3AO2A 4BWJA 2FBVA 3A8YA 3D2FB 1TKTA 3KLGA 3CFRA 4N5SA 3V1OA 1WSHA 1WAJA 4Y1DA 3PIOL 3NAEA 5AQXA 2P9UA 3NHGA 3DI6A 4J2DA 2ATQA 3CJCA 3LL3A 1YXQA 3WT0A 3VTIA 3SMPA 4Z4IA 4L3QA 3WXMB 1YT3A 1NOZA 3AY9A 4H4OA 3AA2A 2ZM6K 4NYNA 3TANA 3F5TA 1P90A 5ADXA 4CHZA 2RHKA 3FZHA 4B1YB 1NJXA 4Q0BA 4BRLA 3FR0A 1WOQA 3WNHA 3ENOA 1NJYA 4DR6K 3P38A 2VCPA 1IV0A 4CJEA 3B6OA 1HMVA 1S1TA 1RILA 5CY4A 4AQYK 3HI0A 3CMAN 3O3GA 4O55A 4FWNA 4PHTX 4KREA 4FO0A 3LALA 4H0PA 2R7YA 1C0GA 2FXUA 4U7BA 2KQ2A 4JKHA 3MECA 3B6PA 4N76A 3CCQN 3LAMA 1N5YA 3CJ7A 4AHTA 2ZJPL 3R6MA 1LOTB 4CBXA 3JAMO 2AA4A 2YHAA 4JEPA 3AVBA 3GE1A 3CFPA 4NLCA 3U3GA 4BRFA 3SUPA 1OVYA 3FZLA 4IDHA 3MWTA 4GKKK 3AVAA 2GUIA 2QTDA 3NF9A 3HL8A 5KQ8A 3I8BA 3Q7CA 4H5NA 1N8RO 4M42A 3S3OA 3MN9A 4LFAK 3D2EB 1D8YA 3H08A 4MO4A 1YHQN 5FPNA 4BR0A 3J80O 1GLJO 1YTAA 1T7PA 2OYQA 4M3XA 5FRNA 1E4GT 4YDUA 3HPOA 3CQXA 4BG8A 3VQQA 1NK8A 3M6GA 3CM5A 3HBTA 2RE2A 4Y1CA 3V9WA 3TTFA 2NRXA 3ATUA 5E41A 1GLAG 3V6DA 2E4LA 1SKWA 1S3XA 2W41A 1JLFA 3CC2N 3F2KA 1IKWA 1NBWA 1IG8A 3QEPA 1S22A 4B8CA 5K14A 2XY8A 3CQ8A 4M45A 2HMPA 5I9EB 3LANA 3RR7A 3GBTA 3N4QA 3C0BA 3HP6A 1MWMA 5DM7L 3SUOA 4JYAK 3QIOA 2YCHA 4E1JA 1L3UA 4E0DA 1J54A 1V4TA 5HLFA 5AQFA 4DV6K 2JWKA 4LSNA 3SQ4A 3JYTA 5FPDA 3L6QA 3DLEA 4OKJA 2WFBA 4WQ5C 3K5OA 3TTDA 4CZMA 2B6AA 4DR7K 4IO9L 3TAEA 4OGCA 4C23A 5BREA 5AQIA 1EQYA 1VSIA 3S9HA 1V4SA 2ITMA 1HYZA 3OY9A 2AP1A 1TV6A 5DMRA 5IT9O 1Q82O 1JLCA 5EY4A 1HRHA 4FJMA 1TYQA 4CJPA 4LF6K 4JI0K 3RSEA 3SQ1A 3MCAB 1VAZA 3PO5A 3OS2A 4M3TA 3HK2A 1D9DA 1SV5A 3IRXA 5BRDA 2O8EA 3HOSA 1NNEA 4DV7K 2Z1IA 3S3MA 2X6SA 2DTUA 1ZBSA 4B1UB 4A61A 4JK7A 1CXUA 1BCOA 4FLXA 1KAXA 4IFVA 1RBVA 3EKSA 3VESA 1ILYA 5LY3A 3HOTA 2OTJN 5AQUA 1N33K 4KHUA 4B9SA 2UYTA 2IVPA 4DS5A 4DQSA 1UAXA 3E9PA 4JK8A 2IC3A 1K8KA 4BRAA 3MEGA 1LWEA 4JI7K 1UOCA 4DFPA 3BP8A 2P9KB 4KH5A 1N6QA 3OYNA 2F4VK 2OPRA 4C8LA 3WNFA 1HKBA 1TGOA 3IAYA 1KVCA 3U6FA 5LMNK 3P31A 3EE9A 3ZETA 4EFHA 3CI5A 4CGIA 2NRVA 3OYMA 3SLCA 4B9QA 3VQEA 2CGJA 3ZYYX 5CZ1A 1NGDA 4CGJA 4DF8A 3HVTA 3F9KA 4MLEA 1K6YA 2FSJA 3MX2A 1GLFO 3OHRA 3VENA 3CG7A 5M1KA 5SWMA 2P9PB 4HHTA 2KW4A 3NF7A 1BUPA 3DLBA 1ZBLA 4CIGA 2JWLA 1IKYA 1E3MA 3ENHA 3KK2A 3DRRA 5E84A 5IWAK 2F9WA 3TR8A 3I0SA 3VQ9A 2A3ZA 1QSSA 4CEDA 1DKGD 1NJZA 2HHSA 2Q1NA 4DCHA 1S1UA 1RT6A 4AHVA 3UKRB 3I33A 4H0VB 3THVA 3VQ8A 4CEZA 5KRSA 2KHOA 1MA9B 2YX6A 4LH5A 3KK1A 1H1VA 2CH6A 4C8OA 1TL3A 2G8UA 1WBDA 4IJNA 2Q97A 3NGZA 1XWLA 4I9LA 4CZFA 2XHBA 4JD2A 1W9HA 3TU5A 1NK0A 1L3TA 1JLQA 2YHWA 3TSPA 2HHQA 3I55N 4CGGA 1DLOA 1DTTA 3LM2A 1YITN 3B8AX 4O5FA 1N32K 5I3UA 1JCFA 4BACA 4BDPA 3SAHA 3VF6A 3MN5A 2I7NA 1BGXT 3KWIA 2F8SA 3QBXA 5FPEA 4B3RK 4F2RA 3P1GA 4V19S 3VQDA 5BPMA 4FPAA 3HPGA 1X3NA 3H1VX 1CZBA 3IG1A 4DFMA 3CCVN 4PY5A 3J7YP 3CJAA 3KKSA 4CZKA 4Z4HA 3QDKA 1LCUA 1RBTA 3LDOA 2E6MA 3BF3A 1J5OA 3SQ0A 3NE6A 3MXJA 5M1OA 2HNDA 4JKAA 4HUGA 4OPKA 4ID5A 3QEWA 1LWFA 2I5JA 3RMCA 3ZSWA 5HP1A 3AO4A 3BF1A 5AQRA 2FC0A 4XH4A 3DLRA 4ICLA 1RDBA 1NGGA 3VQ4A 3PX0A 2HHXA 4BE0A 2BGGA 4BRGA 3NMUA 5EVZA 2P9SB 5ADXH 1VSJA 4RCHA 3K5MA 4LFCK 4NXMK 3QLHA 4XIUA 2Q2RA 2KFNA 5KTQA 2D1KA 4FJIA 1RDCA 3D45A 1QVFM 1WSIA 2GX9A 3EEQA 3H3OB 1RTJA 1QQMA 1OH8A 1HQEA 4IG0A 3VEOA 4DR4K 3F9MA 1QTMA 2H3GX 4ELTA 1WNSA 3MMVA 4O8KA 2YKNA 3RMDA 2V7YA 1XHZA 2W6LA 1K9MO 1X9JA 3VF2A 3ATVA 4JKDA 5AR0A 3KLIA 3RVCA 5AZIB 2P9IB 2UXDK 3T1YK 1ASVA 1X9MA 1JCEA 3NCIA 2WBNA 1RCHA 3A5OC 2QA4N 3ZT1A 3IDHA 4DV0K 3GL1A 4GV3A 3VGKA 1TUYA 2NLXA 2WOMA 5EOYA 5GAHP 4A62A 4CZEA 4IOCL 2BUPA 3A5NC 2F8TA 1EWQA 5LJWA 4CI6A 4ISEA 4JLHA 3SBGA 1GLLO 4M3ZA 3QETA 4PUOA 1FK9A 4M3RA 4X64K 2OPQA 1X3MA 2E20A 2IGIA 1WB9A 4JRPA 4DUYK 3R9PA 2CGLA 1VQ8N 5AZJB 1T8EA 3BEXA 3AO1A 4DB3A 4FLVA 4DS4A 2ZWHA 1NK7A 2HVIA 5HBMA 2ZJQL 2ETJA 1LW2A 4OKKA 3GG4A 4B9MA 2PY5A 4FYDA 4DV4K 3VA0A 1Q81O 3R1XA 1BA0A 3LDSA 1SZ2A 3G0ZA 4FJ7A 2NNWA 4CFBA 1XHXA 4WYBA 3O8MA 1U6ZA 4DLEA 5C15A 4GV9A 4IOXA 1ZXOA 1RBSA 5FLXO 3TPQA 2RPIA 5JVHL 4BDYA 4KTQA 4JV5K 2NRWA 5TKWA 4A2AA 1VSFA 1QHAA 4KFBA 1N36K 2I7PA 3K58A 1B9DA 1P8ZA 2HNZA 4IJAA 4QCLA 4KI4A 3D6RA 3KD5E 4DTUA 4RW8A 4R79A 3L0QA 3CIPA 2YNGA 1IKVA 1RGIA 3QEXA 1NGAA 4YOTA 2P9NA 4NYFA 1ZBFA 4IFEA 4A57A 4DKWA 3OTOK 4CIFA 3EL2A 3WEEB 3PLAA 2QKKA 1MU2A 3ID6A 1NJWA 3CJ9A 5AQQA 3A5LC 5J2QA 1NMDA 1UA0A 4LD0A 1U2VB 3BZKA 3ZSXA 1VQ5N 3AVNA 5M1QA 4DQPA 3VQCA 4CJSA 4E7HA 2KZZA 3G6EN 4CBUA 3TSQA 2P9KA 4FWRA 4GVMA 4CZGA 4YY3K 2ZGYA 3ID8A 1QHTA 1KAZA 3ISNC 4E7JA 1L3VA 3QEIA 4B3OA 1SKSA 1JKHA 2PBDA 3AO3A 3OYLA 1JLBA 2UU9K 1T44A 2Q0RA 5M1FA 1NJIO 1SS6A 4YOWA 5AQLA 4GVEA 1VK0A 4FVMA 3SZ2A 4FJHA 4O0JA 4QOZB 3DYAA 1DEJA 1I3AA 3ZX3A 4R5PA 4DR1K 4BGAA 1IJJA 1C0FA 5JS1A 2ASPA 2NRTA 3LPTA 3SAGA 5CZ2A 1JJ2M 2P9PA 1T3VA 3QEVA 1D4XA 1XC9A 2V51B 4EHUA 3U9ZA 4BRCA 2G8WA 4J2BA 5A2QO 4X62K 2JLEA 3QFUA 2G8IA 3H46O 1UA1A 2ZE2A 1XNRK 3FFKB 3ZEUA 5AQSA 1GLDG 3RRHA 2YHYA 2OPPA 4CHYA 1Z6RA 4JRQA 4AM7A 4DSKA 1BQMA 3KLEA 3TARA 4FSVA 2HB5A 3LDQA 3C6HA 3EY1A 3OYAA 1QQOA 1JLAA 1WSJA 5BPNA 1BDGA 1GLEG 1RT4A 3NH1A 4BROA 3O08A 3V81A 1VQ9N 3QB0A 3CCMN 4YHHK 1RBUA 4RG8A 3SK3A 1C1CA 2VG7A 4H0TB 3U4LA 4CD3A 4LH4A 3DLLL 2B5JA 1WUAA 3MCPA 2QI2A 3MAQA 1TK5A 3ZSQA 1VSEA 4DHYA 1KD1O 3OYHA 1R59O 2XRIA 4N47A 1X9SA 4QS8A 5CHIA 2YI1A 3EE8A 1QE1A 4H5RA 4DV2K 4O0IA 1ZYQA 3J8AA 3ZLJA 1BIUA 2NZTA 3ZCMA 3SV3A 3CETA 4KBOA 3LWMA 5J2PA 3TAGA 1RBRA 1BU6O 1Q9YA 4BRDA 1XQSC 5HL7L 4BC2A 1KSPA 1OH7A 4BE1A 4RW4A 3MEEA 2FF6A 3CMEN 4JI3K 3OJSA 1VQ7N 4K8ZA 2P9SA 4KHYA 4E19A 4DQ8A 1J53A 2HF4A 3C65A 4I7FA 3THXB 4CK3A 4CHNA 3CC4N 3J81O 3DJCA 4O5BA 2OPSA 4FJJA 1ZBUA 4EZ9A 3LM9A 4KB1A 1RNHA 2VG6A 3OYKA 4B9LA 4BC3A 3KD1E 1CZ9A 3L3VA 3MX5A 4JKGB 3PO4A 4GMJB 3KK3A 2FBTA 1GLBG 4BR7A 2IAJA 3SJHA 3E66A 5M1NA 3SV4A 4E7IA 1FW6A 3PV8A 3IS9A 2O8FB 3P5JA 5J2MA 3N4PA 3QMLA 2HBJA 4OKEA 4ID1A 3VQAA 3A2FA 4LF9K 4A59A 1L3SA 2A5XA 1DT9A 1TAQA 3FGUA 4B3MK 1DGKN 1Z25A 4CZJA 2JGUA 4YOYA 4FWOA 1G99A 3RRGA 3K5LA 2A1SA 2HF3A 2GUPA 4DF4A 1IO2A 1W7AA 4N41A 1REVA 4CERA 4G1QA 3O4QA 1RDAA 4FLWA 3ASMA 3D7EO 3VQBA 2Q3SA 3O9QA 3AAQA 4MDBA 3EZ5A 4FWPA 2O8CB 1JL1A 2HBKA 2QM1A 4MQ3A 4QAGA 4OPJA 4Y0WA 4ISFA 1LAVA 1Q18A 4I6MA 1WN7A 3BUZB 2HHHK 2GEMA 3AVGA 4A5BA 5AZJA 4FM0A 4I2PA 2UUBK 4JI5K 3E01A 4KHWA 2Q0UA 3K9JA 4CJFA 4HCCA 1Y97A 1ZBHA 3U9DA 3J7AP 4YDUC 1N34K 1NGFA 2ASMA 5T7BA 3QICA 2Y1IA 2KFZA 4FLTA 1S1XA 3MXIA 2IIRA 3C6UA 3V9SA 1RTIA 1WSEA 4OO1J 3LP2A 1VQ6N 1ZBIA 1C6VA 2OANA 2FLOA 3S41A 4E7KA 5AQNA 3ULEB 1IBLK 4FWKA 4CJRA 2E2PA 4AHCA 3KVGA 4BR4A 2VWBA 1U04A 1SL0A 4IKFA 5MLCQ 3Q7BA 1TVRA 3SQ2A 3KK7A 4KKOA 2D0OA 4FZYA 4J2AA 1KLNA 1A5WA 1JXBA 1NK6A 3VEYA 3PX6A 5EX5A 5CE3A 4JI1K 1LWCA 1RTDA 3SNNA 3T7ZA 4JI2K 3C95A 3CF5L 1C0TA 5BN9A 4B9UA 2Y1JA 4BVPA 3LP3A 1U48A 1GLCG 1OKJA 3NH0A 3VETA 1HUXA 3O9RA 3JSMA 2V52B 4JS4A 3WXKA 2CH5A 3OYEA 2KKZA 2YHXA 3AO5A 5F2RA 5GAEP 4BC5A 4E1MA 1NKEA 3ULDA 3CCUN 4KHQA 4EIAA 1I94K 2GTDA 1TAUA 3RMAA 3A5MC 4DTMA 3RR8A 4HWIA 4CGFA 1RT7A 2HSTA 3PSFA 4CF9A 1NLVA 3VTHA 3DXMA 3OYBA 4MFBA 2OZSA 2E2OA 3V9XA 1VQNN 4C8NA 5BRHA 3K9KA 3HSTB 3THWB 5FROA 5CR4A 2O8BB 1KVBA 4WCEL 4EP4A 2O8DB 3O4NA 3J7ZO 1BI4B 3LDPA 2Z1HA 1JLGA 3QFPA 1Z26A 2DPNA 1QS4A 3QIPA 2A6AA 1TKZA 3VA3A 3IFRA 2P9UB 4CJ3A 3V9ZA 2LSNA 4DTPA 3AV9A 4CVNE 4QS9A 4WE1A 3VQPA 3PUFA 2VGMA 2IOCA 4BC4A 4DTSA 3D2FA 1NK5A 3V9UA 4H8KA 2FF3B 2XY7A 2PZSA 1RT5A 4IG3A 4O8UA 3V1QA 2WUSA 1B9FA 4H0XB 5GINA 4JN4A 3AVIA 4CF1A 1NOYA 4BY9C 4Q5VA 3QERA 3DM2A 1TK0A 3HM8A 4GKJK 5AFUA 4XH5A 3DRPA 4KHPK 3VQ6A 3MWPA 4AH9A 4A5AA 4DQIA 2FSKA 2E1ZA 2QWLA 4FW2A 4XEIA 4CJ5A 1RDWX 4DTRA 2HOEA 5JLHA 3OJUA 4CHPA 5KRTA 4RTFD 3CCJN 3CCRN 2QWNA 4IOAL 4CFDA 4IZ9A 4RW6A 2X78A 4J8FA 2BE2A 3PX4A 1RT1A 4Z4GA 4J2EA 3O1BA 4FOIA 3AA5X 4H0OA 3VN5A 5GAGP 4DLGA 2DFEA 4HCBA 3AVKA 5C2DA 3THYB 1RT3A 3L4IA 3P4IA 3EO3A 3ZSOA 5HRSA 3M3ZA 3TAQA 5DK5A 5AQGA 1IH7A 3UB5A 1HKCA 4FJLA 1IBMK 5KPTA 1DTQA 4B08A 4NLBA 5CYMA 4PWDA 1ATRA 3MN7A 4DSJA 1HNVA 2VYPA 3ZX0A 5JVGL 1W0HA 4B9NA 5HRRA 3OS1A 4MDAA 4DFJA 4JKCA 4C8MA 4AILC 1BISA 1C1BA 1SQKA 3TAFA 4KV8A 1G15A 2ZD1A 3THXA 3AVJA 3OS0A 4CEOA 3K5NA 3SJJA 1KAYA 3IUCA 4FW1A 3DXKB 4DSFA 2WTUA 4CIEA 3D2EA 4WQ4A 4DTNA 1NGEA 3WNEA 3SPZA 4OPHA 2E2NA 2P5GA 4FJ8A 4ELVA 5AJ3K 1EWRA 4BVOA 2WONA 5JICA 2FSNA 1Q7YO 3CM6A 3GOIA 2BANA 3M1FA 1VQON 1SKRA 1K8AO 1BCMA 3AA3A 3HTVA 1RT2A 1XMOK 4ZTJA 2NRZA 2VG5A 3BZCA 1WAFA 1XC3A 4KRFA 2VWKA 2V7ZA 4KB0A 2YJEA 1NKBA 1A5XA 1U47A 3H6EA 5HOOA 3U3YA 4IWVA 3MDQA 1QSYA 1B92A 5HRNA 3CYMA 2EWSA 1M90O 1HPZA 1NK4A 4GNIA 2Z1GA 3W3DA 4C8KA 2D0BA 4FWQA 3O80A 4U67L 4DWIA 2O8CA 2D0AA 2DY4A 2FBXA 1W97L 1TYQB 3KHYA 4CJWA 1TKXA 1VSMA 2HVHA 3RSEB 3F73A 4ZTFA 2RKIA 2AJQA 5F0XA 1EP4A 1VHXA 3O5BA 4H4MA 3L2QA 4B8AB 2EHGA 3ALYA 4FWMA 4CECA 2G8VA 4OJRA 4EAHD 5AQJA 4CF2A 2XY5A 4M3WA 3AGKA 3EKUA 4W5TA 4NCBA 3H3NO 4FJ5A 2ASOA 4DQRA 4E1NA 3ZSRA 3HM9A 1KFSA 1Q8IA 1ZC6A 3O9UA 3TSUA 1HNZK 2HW3A 4FCYA 3H45C 4DU1A 1VRUA 4CFAA 3DMJA 1Z05A 2Z1JA 1KXPA 4WFNL 3BY5A 4ILHA 5H1SQ 2W42A 2UUAK 1K8KB 1WLJA 3L3UA 4MLHA 3PIPL 2NUBA 3O9TA 3L2UA 2F7TA 3T1HK 4AHRA 2GWJA 3ULEA 5HRPA 1QSLA 1KRPA 4HVJA 3R8EA 3WQTA 3HXMA 5AQPA 4CFCA 3LAKA 4NCGA 1NWKA 3E1YA 3QINA 3ZETB 4BRIA 4GV6A 2O4IA 1MDUB 3ZSVA 4E7LA 4C1NI 4JKBA 4FZXC 4KO0A 3I56N 5C42A 4FJKA 3MXMA 4BRHA 1LAWA 2P9LB 2X74A 1T03A 1J6ZA 3K59A 5C12A 4KH6A 5C24A 3H1QA 4BRMA 4KTWA 3VOVA 4CJQA 4FXDA 4K8XA 2NRRA 4IO8A 4NB4A 1S9GA 3NF8A 5KGWA 2ZF5O 4BQLA 5KPZA 4FJNA 2F9TA 3DAWA 1W2BM 4EP5A 2HBLA 3C6TA 3V1RA 3DRSA 3UE5A 3OBWA 3EYZA 1S72N 1RDDA 1S6QA 2A41A 3IMXA 3ZSZA 4B1WB 1QQNA 3T69A 3R3LA 4UQGA 1EETA 3CPEA 4O4GA 4JHDB 4HUFA 2DFFA 4K0KK 3UKRA 4PL8A 3CC7N 4JD2B 2ITGA 1IG9A 2B4JA 1HYSA 4BRKA 4CESA 2F96A 3T1AA 4CK1A 3PY8A 1HLUA 4FLZA 1TK8A 4FK2A 5FRMA 4B3TK 2GWKA 2BH1A 1YJWN 2QKBA 3OW2M 2D4WA 4Z0UA 4DSLA 1YVNA 3IKMA 4LF8K 4O44A 3THWA 2WC9A 1NGBA 1NGCA 4F8RA 3ZT4A 1LV5A 1GOCA 5HROA 4BR9A 1BWFO 1BI4A 3CFOA 5JMVA 3VEXA 2P51A 4H0YB 4CW7B 1M1KO 3CQYA 4BQZA 2HHUA 2CGKA 5EXWA 2OZMA 3FZKA 3CERA 5BR9A 4PA1A 1NU0A 3G4SN 2QWPA 3RWUA 3SUQA 4IEEA 4OVLA 4B1ZA 1CZAN 3D0PA 3FE1A 4YOVA 1X9WA 4I2QA 1XI1A 1NGJA 1U49A 1S5JA 4LF7K 1EO1A 4B9VA 4OGEA 3SUNA 4H5VA 4Z94A 1YVUA 3HT3A 3JS6A 1T6CA 1S9EA 1BIZA 5FPMA 4FWSA 2FBYA 1OH5A 2EX3A 4HTLA 1SL2A 3OYGA 5AFUH 3VEVA 1ITGA 4L8RB 3DLHA 3LWLA 4KHSA 2QXFA 4WQ5A 1BO5O 4YOXA 5AQMA 1SUQA 2D5RA 4PKHA 3KJVA 4AHSA 3T19A 3BDPA 4BRQA 3THYA 1VQKN 5GADP 2Q31A 2E1YA 5AQKA 4F3TA 4KH4A 3ZX2A 5JS2A 5BN8A 4DV5K 4KHNA 1K73O 2UXCK 3CD6N 4BDZA 2YV0X 5J2NA 3UKUB 4K42A 3OYIA 4DTJA 4PL7A 5LJVA 3VGMA 5SZTA 2YJFA 5FDLA 1BOTO 4DR5K 1EXQA 4OLBA 4E3SA 5AZIA 2P9IA 1FKOA 5E26A 4PKIA 4FWLA 3DOLA 4JKEA 2BTFA 1UWBA 3L2VA 1QQCA 4F9OA 3DXKA 4BE2A 2HHWA 4IXCA 4CJUA 4FLUA 2W6KA 3AVLA 3L2RA 2Q36A 4A2BA 4DR2K 1C1AA 1ATSA 1BL3A 3ZSYA 3VEWA 3KIOA 4QS7A 1D5AA 4DG1A 1Q86O 4HTUA 4KAZA 4HUEA 4Z4FA 2IDOA 1BA1A 1HYVA 2D0PA 4CJLA 2KZMA 2IVOA 3VQ5A 1TUUA 3KLFA 1WSGA 4CHOA 4H5WA 1YI2N 3AVHA 1YUWA 1BHLA 5B8HA 4IBNA 4KPYA 3ZT0A 4KTZA 1HQUA 1RTHA 1KVAA 1T05A 1A5VA 1C0UA 4G9ZA 1HNIA 1E4FT 3NVKA 3TTCA 1ATNA 3CJ1A 4FZZA 1O13A 4CD1A 4AHUA 2QEXN 1LW0A 1YIJN 2A42A 1JL2A 3LZIA 2G8HA 4BRNA 4OX9K 4H03B 4AF1A 4X66K 3V4IA 3FZFA 4CEBA 4F4KA 3HJFA 2E5LK 1S1WA 5AQWA 2GBZA 4FVUA 5EU7A 3NGIA 1VQLN 1J9AA 3ENBA 4CCHA 2P9NB 2VGNA 3P39A 4DQQA 4JI4K 3HRGA 3ITHA 4CF0A 1HJRA 3VF4A 3AA4A 4OLAA 3C7NB 2VWJA 4TSXA 3K0SA 3E9LA 1JCGA 1HNXK 3VPZA 4DR3K 1JLEA 3DWLA 3DLGA 4AM6A 2BDPA 2G8KA 3WEEA 1YJ9N 2PAVA 3SPYA 3TAPA 1VSHA 3M8SA 3C94A 4K25A 1IKXA 4CGDA 4JI6K 3HSCA 2XO7A 3SBTA 1YJNN 4ZHRA 1U2VA 1YF5L 3TAMA 5C25A 2P5OA 5BPLA 5D3GA 3MEDA 1I39A 3KLHA 4F2SA 2NRHA 3AAPA 3I8DA 3OBYA 5C0YA 5KGXA 2ZQBA 3QESA 4CK2A 4CHQA 4FM2A 3LP1A 4JAXA 4CEAA 3VEZA 2P9LA 1FJGK 1J5EK 1QZ6A 2YNIA 3A0IX 4EZ6A 3M5RA 1U45A 4M63C 4M7YA 1KLMA 1NGIA 3EN9A 4F3OA 2VQFK 2XY6A 1OVQA 3SYZA 4CJKA 4CJVA 4MO5A 3ZEUB 1BG3A 4DV3K 4K43A 3AARA 4EHTA 3AGRA 2HHVA 4LSLA 2VQEK 4LF5K 4YNQA 5AQZA 4BG9A 1NGHA 1Y64A 3BGRA 1IBKK 2QWOA 3U8XA 3G10A 3CCEN 4CE9A 3OVNA 4JHDA 3VQ7A 4X65K 4E89A 3OYDA 3CCLN 4M3UA 4W5NA 3MN6A 3S3NA 3NGYA 3CXCM 1HX1A 3SI6A 3NH2A 2E2QA 2QWMA 4IEIA 2UXBK 4ISGA 4YFUA 4FJ9A 3GDQA 4DU4A 4FL9A 3QO9A 3QNNA 4LFBK 4IFYA 4OPAA 4CF8A 1VSLA 4C1NK 1MWKA 4FK4A 1QZ5A 1D9FA 3KTQA 3FFIA 2O4GA 4CEEA 1KC8O 3G71N 1FKPA 1NMNA 3CHWA 4KI6A 2YKMA 4NCAA 1HNWK 2ZJRL 2UUCK 5BRFA 3QBWA 4BGBA 3OA9A 4NXNK 4W5QA 3NBPA 3RTVA 3AVFA 4Z4CA 3TI0A 1KTQA 5BR8K 2GV9A 3L4QA 1VQMN 4B1XB 4CZIA 4CJTA 4RWTA 3CCSN 3T3FA 2D0CA 4W5OA 3G25A 3WUHA 3OYJA 3M8PA 1ASWA 2QXLA 2DFHA 5TKYA 1TKDA 3P83D 3DOKA 3VGLA 4B3SK 5KI6A 3LZJA 4DMNA 4CGHA 4CJ4A 1NKCA 5ELZA 2QWRA 4LY7A 1HR0K 4DSIA 1KCFA 3ZT3A 4W5RA 4DUZK 5KPRA 1HJOA 3VMFB 4JKGA 2A40A 3JXUA 3UKUA 4N56A 5GIOA 3M8RA 1F21A 1BQNA 2O8FA 4DTXA 3HPHA 3TABA 2KLAA 3CPWM 4M3YA 3OYFA 1VQPN 1GOBA 1NG9A 2ZGZA 4B9TA 5GIPA 1QVGM 1OH6A 1VQ4N 4M7XA 4UY8O 4JNEA 2KTQA 4BR5A 4FLYA 3HP9A 3PSIA 4WFAL 4DSEA 3M8QA 3AVMA 3O9SA 2GELA 3O6WA 5JLFA 4FK0A 4FOEA 5AQVA 4CZHA 4BWMA 4I6MB 4BREA 4FM1A 5LMUK 4CEQA 5C10A 2QK9A 3O1WA 2OTLN 5AQYA 3FZMA 2IVNA 3O4WA 1HKGA 4Z4EA 4B1VA 4ILJA 1XUPO 3SAFA 5CYQA 4CZLA 1SAZA 2O8EB 3QNOA 1X1PA 3KWGA 2PYJA 1GOAA 1T6DA 4M41A 4CEFA 2E6LA 4H5TA 3UIQA 3WXLA 3SCXA 4JI8K 4WQ4C 5J1EA 1SL1A 1ASUA 2J4RA 3EZWA 3HO1A 4DU3A 3AVCA 5AQHA 1Q9XA 1VSDA 1VRTA 3LP0A 4LF4K 1S6PA 5AQOA 3K57A 2G8FA 2PFUA 4JS5A 3NDKA 4ILGB 3KKRA 3O3HA 3KZBA 3HYFA 3OYCA 2PYLA 4YOUA 4JKFA 1NK9A 2OA8A 4ELUA 1VSKA 3L8BA 1XNQK 3NFAA 2HNYA 3NF6A 4GY2B 4RW7A 2W40A 4GW6A 5KQDA 3SMSA 4RW9A 1KQSM 3C7NA 1CXQA 4BRPA 3VERA 3K2PA 1YTUA 4JK9A 4YORA 3C6AA 3HZ6A 4LC9B 1EX4A 2HMIA 5C2FA 2YNFA 1O1WA 3TWHA 3NVMA 2HBMA 4IDKA 3W0LA 4PKGA 1L5UA 4FJGA 5M1PA 5AQTA 4WFBL 3MK6A 4FPBA 4DTOA 3WXIA 3O3FA 3ZT2A 1XMQK 2RF2A 3WXJA 1ESVA 1KFDA 2YNHA 1HPMA 4K41A 3LPUA 5I42A 4I9QA 3L2WA 3LDNA 4XH1A 4FJXA 2IS3A 5F1XA 1FXXA 2YHBA 3HVRA 1C0MA 1CLQA 2OCEA 4NO7A 1S1VA 2QW9A 3DXMB 4BR2A 1R0AA 2P1JA 3E9OA 2X6NA 2QWQA 1RDUA 1WBBA 3I0RA 3WNGA 4CJ7A 4DV1K 3DLKA 4WF9L 2E8AA 5LL6Z 1RFQA 1TL1A 1NM1A
chains in the Genus database with same CATH topology
4HUEA 4C8NA 1JXEA 2IDOA 3QETA 4PUOA 1HYVA 1FK9A 4CJLA 4Z4FA 4PQUA 4M3RA 2KZMA 3HSTB 3VQ5A 1U4BA 5FROA 2OPQA 3KLFA 2IGIA 1KVBA 2RN2A 1WSGA 4EP4A 4CHOA 4DFKA 3AVHA 2HHTA 3O4NA 4JRPA 2A1RA 1BHLA 3RMBA 4IBNA 4KPYA 3ZT0A 1BI4B 2Z1HA 1JLGA 1WSFA 1T8EA 1EKEA 3AO2A 1Z26A 4KTZA 3AO1A 1HQUA 4BWJA 2FBVA 1QS4A 4FLVA 3QIPA 1RTHA 1KVAA 1TKZA 3VA3A 4DS4A 3V9ZA 4CJ3A 1T05A 1A5VA 1C0UA 2LSNA 1HNIA 1TKTA 3AV9A 3KLGA 3CFRA 4N5SA 4DTPA 3V1OA 1NK7A 1WSHA 1WAJA 4Y1DA 4WE1A 3NAEA 3VQPA 3PUFA 2IOCA 4DTSA 2HVIA 5HBMA 3NHGA 2ETJA 3DI6A 1LW2A 1NK5A 2ATQA 4J2DA 4FZZA 4OKKA 4AHUA 4B9MA 2PY5A 1LW0A 3V9UA 4H8KA 2XY7A 2PZSA 1RT5A 4FYDA 1JL2A 4IG3A 3VA0A 3V1QA 3LZIA 3LDSA 2G8HA 4Z4IA 1B9FA 3G0ZA 4FJ7A 1YT3A 1NOZA 4H4OA 4CFBA 3V4IA 3AA2A 1XHXA 4NYNA 4CEBA 3AVIA 4DLEA 3TANA 4F4KA 4CF1A 1NOYA 3HJFA 4Q5VA 4CHZA 3QERA 1RBSA 3DM2A 1S1WA 2RPIA 4BDYA 1TK0A 4KTQA 1NJXA 4Q0BA 3DRPA 1VSFA 2GBZA 3VQ6A 3WNHA 4KFBA 1NJYA 5EU7A 4AH9A 4CJEA 3B6OA 3NGIA 3K58A 1B9DA 1HMVA 2HNZA 1S1TA 1J9AA 4CCHA 4FW2A 1RILA 5CY4A 4DQIA 4DTRA 4CJ5A 4KI4A 3KD5E 4DTUA 4RW8A 4DQQA 3ITHA 4CF0A 3OJUA 4CHPA 2YNGA 5KRTA 1IKVA 1HJRA 3AA4A 3QEXA 4OLAA 2VWJA 4NYFA 3O3GA 4CFDA 4O55A 4TSXA 4RW6A 1ZBFA 2X78A 4KREA 2BE2A 3LALA 3PX4A 4CIFA 2R7YA 1RT1A 4Z4GA 4J2EA 3AA5X 3VN5A 4HCBA 4DLGA 2DFEA 1JLEA 1MU2A 3AVKA 2KQ2A 1NJWA 2QKKA 1RT3A 3DLGA 3MECA 3B6PA 3ZSOA 5HRSA 2G8KA 2BDPA 4N76A 3LAMA 3TAQA 1N5YA 4AHTA 5DK5A 1IH7A 5J2QA 3SPYA 3TAPA 1VSHA 3M8SA 4FJLA 1UA0A 1DTQA 4B08A 3C94A 4LD0A 3ZSXA 3AVNA 1IKXA 2YHAA 5CYMA 4CGDA 4DQPA 4PWDA 3AVBA 3CFPA 2XO7A 4DSJA 3VQCA 4CJSA 1HNVA 4E7HA 2KZZA 4ZHRA 3U3GA 5C25A 3TAMA 3SUPA 1W0HA 4GVMA 2P5OA 4B9NA 5HRRA 3OS1A 4DFJA 4B3OA 3AVAA 2GUIA 4C8MA 5D3GA 1QHTA 3MEDA 3ISNC 3HL8A 3NF9A 4E7JA 1I39A 3KLHA 1BISA 1C1BA 4AILC 3QEIA 1L3VA 1SKSA 1JKHA 3TAFA 3AO3A 4KV8A 3OYLA 3S3OA 1JLBA 4M42A 3I8DA 1G15A 2ZD1A 5KGXA 2ZQBA 3QESA 3AVJA 4CK2A 1D8YA 4CHQA 4FM2A 3OS0A 3H08A 3LP1A 4CEOA 4CEAA 1VK0A 4FVMA 1YTAA 3K5NA 3SZ2A 3SJJA 1T7PA 4O0JA 2OYQA 4FJHA 4FW1A 4M3XA 5FRNA 3HPOA 4DSFA 4CIEA 4QOZB 2YNIA 3DYAA 4DTNA 3WNEA 1I3AA 3VQQA 4R5PA 3SPZA 3CM5A 4Y1CA 1NK8A 1U45A 4EZ6A 3V9WA 5E41A 3V6DA 1KLMA 5JS1A 2P5GA 4FJ8A 4ELVA 3LPTA 2E4LA 5CZ2A 1SKWA 1JLFA 4F3OA 1IKWA 2WONA 1XC9A 2XY6A 3CM6A 3SYZA 3QEPA 4CJKA 4B8CA 4CJVA 2G8WA 2BANA 4J2BA 5K14A 1SKRA 2XY8A 1BCMA 2JLEA 3CQ8A 4M45A 3RR7A 3AA3A 3LANA 1RT2A 4ZTJA 2G8IA 2VG5A 1UA1A 2ZE2A 3HP6A 2HHVA 3SUOA 4LSLA 1WAFA 3QIOA 4KRFA 4YNQA 1L3UA 2VWKA 3RRHA 4E0DA 2OPPA 4CHYA 1J54A 4KB0A 5HLFA 1NKBA 1A5XA 3BGRA 4JRQA 1U47A 4LSNA 3SQ4A 3JYTA 4DSKA 3G10A 3U3YA 1BQMA 3DLEA 4OKJA 4CE9A 3KLEA 3OVNA 3TARA 1QSYA 1B92A 2HB5A 5HRNA 3K5OA 3VQ7A 3EY1A 3OYAA 3CYMA 2B6AA 1HPZA 1NK4A 3TAEA 1JLAA 4OGCA 1WSJA 4E89A 3OYDA 2Z1GA 1VSIA 3S9HA 4OLBA 1RT4A 4C8KA 2D0BA 3NH1A 4DWIA 1HYZA 2D0AA 3OY9A 3V81A 2DY4A 2FBXA 4M3UA 4W5NA 4CJWA 3S3NA 1TV6A 1TKXA 1VSMA 1RBUA 3NGYA 4RG8A 5DMRA 2HVHA 3F73A 3SI6A 2RKIA 1JLCA 3NH2A 4ZTFA 1HRHA 2AJQA 1EP4A 1C1CA 2VG7A 4H4MA 4CJPA 3L2QA 4YFUA 4FJMA 4B8AB 4LH4A 4FJ9A 2B5JA 2EHGA 4DU4A 3ALYA 4CECA 2G8VA 3SQ1A 4OJRA 3MAQA 4M3WA 4CF2A 3QO9A 2XY5A 1TK5A 3ZSQA 3OS2A 3PO5A 4M3TA 1VSEA 3HK2A 1D9DA 1SV5A 3QNNA 3IRXA 4IFYA 4W5TA 4NCBA 4CF8A 1VSLA 3OYHA 2XRIA 2Z1IA 4FJ5A 3S3MA 2X6SA 4DQRA 4N47A 4E1NA 1X9SA 3ZSRA 3HM9A 2DTUA 1CXUA 1KFSA 1BCOA 1Q8IA 4FLXA 4FK4A 2HW3A 4FCYA 4DU1A 3FFIA 1D9FA 3KTQA 2O4GA 4CEEA 1VRUA 1QE1A 1FKPA 4CFAA 4IFVA 1RBVA 3DMJA 4O0IA 1ZYQA 4KI6A 2Z1JA 2YKMA 2W42A 4NCAA 1WLJA 1BIUA 4KHUA 4B9SA 3ZCMA 3SV3A 3L3UA 4DS5A 3LWMA 2NUBA 4W5QA 4DQSA 1UAXA 5J2PA 3TAGA 3L2UA 1RBRA 3NBPA 3RTVA 2IC3A 4AHRA 3AVFA 4Z4CA 5HRPA 1KRPA 1Q9YA 1QSLA 3MEGA 4HVJA 3TI0A 1LWEA 1KTQA 1UOCA 4DFPA 1KSPA 3HXMA 2GV9A 1N6QA 4BE1A 4CFCA 4RW4A 3MEEA 3OYNA 2OPRA 3LAKA 4NCGA 3WNFA 4CJTA 3T3FA 4C8LA 4F2SA 3QINA 2O4IA 2D0CA 1TGOA 4W5OA 3OJSA 3IAYA 1KVCA 3ZSVA 3U6FA 3OYJA 3M8PA 4E7LA 4K8ZA 1ASWA 4KHYA 4E19A 4FZXC 1J53A 4KO0A 2DFHA 5C42A 4I7FA 4FJKA 4CK3A 4CGIA 3MXMA 4CHNA 3OYMA 1TKDA 3P83D 3DOKA 1LAWA 3VQEA 4O5BA 2OPSA 5KI6A 2X74A 1ZBUA 5CZ1A 3LZJA 4FJJA 4DMNA 1T03A 4EZ9A 4CGHA 4KB1A 4CGJA 4DF8A 4CJ4A 1RNHA 2VG6A 3OYKA 3K59A 1NKCA 4B9LA 3KD1E 1CZ9A 3HVTA 3F9KA 3QEVA 1K6YA 4LY7A 5SWMA 3L3VA 3CG7A 4DSIA 3PO4A 1KCFA 5C24A 4HHTA 2KW4A 3NF7A 4GMJB 2FBTA 3ZT3A 4KTWA 4W5RA 3KK3A 3DLBA 2IAJA 4CJQA 4FXDA 3SV4A 1ZBLA 4CIGA 4K8XA 1IKYA 4E7IA 3KK2A 3DRRA 3PV8A 3IS9A 1S9GA 3P5JA 4N56A 5J2MA 3NF8A 3M8RA 5KGWA 4OKEA 1F21A 4ID1A 3VQAA 3A2FA 3TR8A 3I0SA 4FJNA 1BQNA 3VQ9A 1L3SA 1TAQA 4EP5A 3C6TA 3V1RA 3DRSA 4CEDA 4DTXA 1QSSA 3HPHA 3EYZA 1NJZA 1Z25A 2HHSA 3TABA 2JGUA 1RDDA 4M3YA 1S6QA 3OYFA 1GOBA 3RRGA 4B9TA 3ZSZA 1S1UA 1RT6A 4AHVA 3K5LA 2A1SA 4UQGA 1EETA 4DF4A 1IO2A 3THVA 3VQ8A 4O4GA 1REVA 4CEZA 5KRSA 4CERA 4G1QA 4HUFA 2DFFA 4N41A 3O4QA 4LH5A 3KK1A 1RDAA 4FLWA 2KTQA 2ITGA 3ASMA 3HP9A 4FLYA 2B4JA 1IG9A 1TL3A 4DSEA 2G8UA 4C8OA 3VQBA 3M8QA 2Q3SA 3AVMA 3NGZA 1XWLA 4I9LA 1HYSA 2XHBA 4CESA 1W9HA 2F96A 3T1AA 4CK1A 3EZ5A 1NK0A 3PY8A 4FLZA 1TK8A 1L3TA 4FK0A 4FK2A 4BWMA 1JL1A 5FRMA 1JLQA 4MQ3A 4FM1A 2HHQA 4QAGA 4OPJA 2QKBA 4CEQA 4DSLA 4Z0UA 4CGGA 1DLOA 2QK9A 1LAVA 4QCLA 4O44A 1DTTA 1WN7A 4F8RA 5I3UA 3ZT4A 4BACA 1LV5A 4BDPA 3AVGA 1GOCA 5HROA 1BGXT 2F8SA 4Z4EA 1BI4A 3CFOA 2P51A 4FM0A 4I2PA 4F2RA 5CYQA 3P1GA 3QNOA 2HHUA 1X1PA 3VQDA 3E01A 2PYJA 1GOAA 4KHWA 3HPGA 1CZBA 3IG1A 4M41A 4CJFA 4DFMA 4CEFA 2OZMA 4PY5A 4HCCA 2E6LA 1Y97A 3UIQA 1ZBHA 3SCXA 4PA1A 3RWUA 5J1EA 1SL1A 1ASUA 3KKSA 5T7BA 3SUQA 3HO1A 4Z4HA 4DU3A 3AVCA 4OVLA 2Y1IA 1RBTA 1Q9XA 3D0PA 4FLTA 1S1XA 1VSDA 3MXIA 2KFZA 1X9WA 1VRTA 2E6MA 3C6UA 1RTIA 1WSEA 4I2QA 3V9SA 3SQ0A 1XI1A 3NE6A 1U49A 3MXJA 3LP0A 1J5OA 3LP2A 1S5JA 1ZBIA 2HNDA 4HUGA 1C6VA 1S6PA 3K57A 4OGEA 4OPKA 3SUNA 4B9VA 2G8FA 4JS5A 4ID5A 3NDKA 4E7KA 3QEWA 1LWFA 2I5JA 3RMCA 3ZSWA 3KKRA 1YVUA 3HT3A 5HP1A 3AO4A 4CJRA 3O3HA 2FC0A 1S9EA 3HYFA 4AHCA 3OYCA 1BIZA 3DLRA 4ICLA 2PYLA 1RDBA 2FBYA 3VQ4A 3PX0A 1NK9A 1U04A 4BE0A 2OA8A 1SL0A 4ELUA 2HHXA 1VSKA 2BGGA 2EX3A 3L8BA 4IKFA 3NFAA 2HNYA 1VSJA 3NF6A 3K5MA 1TVRA 3SQ2A 3QLHA 4RW7A 4XIUA 1SL2A 3OYGA 2KFNA 5KTQA 4GW6A 1ITGA 4L8RB 4FJIA 3DLHA 4RW9A 4KKOA 3LWLA 4KHSA 1CXQA 2QXFA 4FZYA 1RDCA 3D45A 4J2AA 1KLNA 3K2PA 1YTUA 1A5WA 1WSIA 1JXBA 1SUQA 2D5RA 3KJVA 4AHSA 3T19A 1NK6A 3BDPA 1RTJA 3PX6A 1EX4A 1HQEA 4IG0A 2HMIA 2YNFA 1LWCA 1O1WA 3TWHA 3SNNA 1RTDA 1QTMA 4ELTA 4IDKA 1WNSA 4F3TA 1L5UA 4FJGA 3C95A 5JS2A 1C0TA 2YKNA 3RMDA 4KHNA 4B9UA 2Y1JA 4DTOA 4BDZA 1XHZA 2YV0X 3LP3A 3O3FA 5J2NA 3ZT2A 1U48A 3OYIA 2RF2A 4DTJA 3NH0A 3JSMA 3KLIA 5SZTA 4JS4A 1ASVA 3OYEA 5FDLA 1X9MA 1KFDA 2YNHA 1EXQA 3AO5A 3LPUA 4E3SA 4E1MA 3NCIA 5I42A 1FKOA 3L2WA 1NKEA 4I9QA 4FJXA 2IS3A 1RCHA 3ULDA 3ZT1A 4KHQA 1FXXA 2YHBA 3DOLA 3HVRA 1C0MA 1TAUA 1UWBA 3RMAA 1CLQA 4DTMA 3RR8A 3L2VA 2WOMA 4CGFA 1QQCA 4BE2A 1S1VA 1R0AA 2HHWA 1RT7A 4CJUA 4FLUA 2P1JA 3AVLA 2X6NA 3L2RA 4CF9A 2F8TA 1C1AA 1BL3A 3OYBA 3I0RA 3WNGA 4JLHA 3ZSYA 3DLKA 3KIOA 1D5AA 4MFBA 2OZSA 1TL1A 4DG1A 4M3ZA 4HTUA 3V9XA 4KAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HUE A;  4C8N A;  1JXE A;  2IDO A;  3QET A;  4PUO A;  1HYV A;  1FK9 A;  4CJL A;  4Z4F A;  4PQU A;  4M3R A;  2KZM A;  3HST B;  3VQ5 A;  1U4B A;  5FRO A;  2OPQ A;  3KLF A;  2IGI A;  1KVB A;  2RN2 A;  1WSG A;  4EP4 A;  4CHO A;  4DFK A;  3AVH A;  2HHT A;  3O4N A;  4JRP A;  2A1R A;  1BHL A;  3RMB A;  4IBN A;  4KPY A;  3ZT0 A;  1BI4 B;  2Z1H A;  1JLG A;  1WSF A;  1T8E A;  1EKE A;  3AO2 A;  1Z26 A;  4KTZ A;  3AO1 A;  1HQU A;  4BWJ A;  2FBV A;  1QS4 A;  4FLV A;  3QIP A;  1RTH A;  1KVA A;  1TKZ A;  3VA3 A;  4DS4 A;  3V9Z A;  4CJ3 A;  1T05 A;  1A5V A;  1C0U A;  2LSN A;  1HNI A;  1TKT A;  3AV9 A;  3KLG A;  3CFR A;  4N5S A;  4DTP A;  3V1O A;  1NK7 A;  1WSH A;  1WAJ A;  4Y1D A;  4WE1 A;  3NAE A;  3VQP A;  3PUF A;  2IOC A;  4DTS A;  2HVI A;  5HBM A;  3NHG A;  2ETJ A;  3DI6 A;  1LW2 A;  1NK5 A;  2ATQ A;  4J2D A;  4FZZ A;  4OKK A;  4AHU A;  4B9M A;  2PY5 A;  1LW0 A;  3V9U A;  4H8K A;  2XY7 A;  2PZS A;  1RT5 A;  4FYD A;  1JL2 A;  4IG3 A;  3VA0 A;  3V1Q A;  3LZI A;  3LDS A;  2G8H A;  4Z4I A;  1B9F A;  3G0Z A;  4FJ7 A;  1YT3 A;  1NOZ A;  4H4O A;  4CFB A;  3V4I A;  3AA2 A;  1XHX A;  4NYN A;  4CEB A;  3AVI A;  4DLE A;  3TAN A;  4F4K A;  4CF1 A;  1NOY A;  3HJF A;  4Q5V A;  4CHZ A;  3QER A;  1RBS A;  3DM2 A;  1S1W A;  2RPI A;  4BDY A;  1TK0 A;  4KTQ A;  1NJX A;  4Q0B A;  3DRP A;  1VSF A;  2GBZ A;  3VQ6 A;  3WNH A;  4KFB A;  1NJY A;  5EU7 A;  4AH9 A;  4CJE A;  3B6O A;  3NGI A;  3K58 A;  1B9D A;  1HMV A;  2HNZ A;  1S1T A;  1J9A A;  4CCH A;  4FW2 A;  1RIL A;  5CY4 A;  4DQI A;  4DTR A;  4CJ5 A;  4KI4 A;  3KD5 E;  4DTU A;  4RW8 A;  4DQQ A;  3ITH A;  4CF0 A;  3OJU A;  4CHP A;  2YNG A;  5KRT A;  1IKV A;  1HJR A;  3AA4 A;  3QEX A;  4OLA A;  2VWJ A;  4NYF A;  3O3G A;  4CFD A;  4O55 A;  4TSX A;  4RW6 A;  1ZBF A;  2X78 A;  4KRE A;  2BE2 A;  3LAL A;  3PX4 A;  4CIF A;  2R7Y A;  1RT1 A;  4Z4G A;  4J2E A;  3AA5 X;  3VN5 A;  4HCB A;  4DLG A;  2DFE A;  1JLE A;  1MU2 A;  3AVK A;  2KQ2 A;  1NJW A;  2QKK A;  1RT3 A;  3DLG A;  3MEC A;  3B6P A;  3ZSO A;  5HRS A;  2G8K A;  2BDP A;  4N76 A;  3LAM A;  3TAQ A;  1N5Y A;  4AHT A;  5DK5 A;  1IH7 A;  5J2Q A;  3SPY A;  3TAP A;  1VSH A;  3M8S A;  4FJL A;  1UA0 A;  1DTQ A;  4B08 A;  3C94 A;  4LD0 A;  3ZSX A;  3AVN A;  1IKX A;  2YHA A;  5CYM A;  4CGD A;  4DQP A;  4PWD A;  3AVB A;  3CFP A;  2XO7 A;  4DSJ A;  3VQC A;  4CJS A;  1HNV A;  4E7H A;  2KZZ A;  4ZHR A;  3U3G A;  5C25 A;  3TAM A;  3SUP A;  1W0H A;  4GVM A;  2P5O A;  4B9N A;  5HRR A;  3OS1 A;  4DFJ A;  4B3O A;  3AVA A;  2GUI A;  4C8M A;  5D3G A;  1QHT A;  3MED A;  3ISN C;  3HL8 A;  3NF9 A;  4E7J A;  1I39 A;  3KLH A;  1BIS A;  1C1B A;  4AIL C;  3QEI A;  1L3V A;  1SKS A;  1JKH A;  3TAF A;  3AO3 A;  4KV8 A;  3OYL A;  3S3O A;  1JLB A;  4M42 A;  3I8D A;  1G15 A;  2ZD1 A;  5KGX A;  2ZQB A;  3QES A;  3AVJ A;  4CK2 A;  1D8Y A;  4CHQ A;  4FM2 A;  3OS0 A;  3H08 A;  3LP1 A;  4CEO A;  4CEA A;  1VK0 A;  4FVM A;  1YTA A;  3K5N A;  3SZ2 A;  3SJJ A;  1T7P A;  4O0J A;  2OYQ A;  4FJH A;  4FW1 A;  4M3X A;  5FRN A;  3HPO A;  4DSF A;  4CIE A;  4QOZ B;  2YNI A;  3DYA A;  4DTN A;  3WNE A;  1I3A A;  3VQQ A;  4R5P A;  3SPZ A;  3CM5 A;  4Y1C A;  1NK8 A;  1U45 A;  4EZ6 A;  3V9W A;  5E41 A;  3V6D A;  1KLM A;  5JS1 A;  2P5G A;  4FJ8 A;  4ELV A;  3LPT A;  2E4L A;  5CZ2 A;  1SKW A;  1JLF A;  4F3O A;  1IKW A;  2WON A;  1XC9 A;  2XY6 A;  3CM6 A;  3SYZ A;  3QEP A;  4CJK A;  4B8C A;  4CJV A;  2G8W A;  2BAN A;  4J2B A;  5K14 A;  1SKR A;  2XY8 A;  1BCM A;  2JLE A;  3CQ8 A;  4M45 A;  3RR7 A;  3AA3 A;  3LAN A;  1RT2 A;  4ZTJ A;  2G8I A;  2VG5 A;  1UA1 A;  2ZE2 A;  3HP6 A;  2HHV A;  3SUO A;  4LSL A;  1WAF A;  3QIO A;  4KRF A;  4YNQ A;  1L3U A;  2VWK A;  3RRH A;  4E0D A;  2OPP A;  4CHY A;  1J54 A;  4KB0 A;  5HLF A;  1NKB A;  1A5X A;  3BGR A;  4JRQ A;  1U47 A;  4LSN A;  3SQ4 A;  3JYT A;  4DSK A;  3G10 A;  3U3Y A;  1BQM A;  3DLE A;  4OKJ A;  4CE9 A;  3KLE A;  3OVN A;  3TAR A;  1QSY A;  1B92 A;  2HB5 A;  5HRN A;  3K5O A;  3VQ7 A;  3EY1 A;  3OYA A;  3CYM A;  2B6A A;  1HPZ A;  1NK4 A;  3TAE A;  1JLA A;  4OGC A;  1WSJ A;  4E89 A;  3OYD A;  2Z1G A;  1VSI A;  3S9H A;  4OLB A;  1RT4 A;  4C8K A;  2D0B A;  3NH1 A;  4DWI A;  1HYZ A;  2D0A A;  3OY9 A;  3V81 A;  2DY4 A;  2FBX A;  4M3U A;  4W5N A;  4CJW A;  3S3N A;  1TV6 A;  1TKX A;  1VSM A;  1RBU A;  3NGY A;  4RG8 A;  5DMR A;  2HVH A;  3F73 A;  3SI6 A;  2RKI A;  1JLC A;  3NH2 A;  4ZTF A;  1HRH A;  2AJQ A;  1EP4 A;  1C1C A;  2VG7 A;  4H4M A;  4CJP A;  3L2Q A;  4YFU A;  4FJM A;  4B8A B;  4LH4 A;  4FJ9 A;  2B5J A;  2EHG A;  4DU4 A;  3ALY A;  4CEC A;  2G8V A;  3SQ1 A;  4OJR A;  3MAQ A;  4M3W A;  4CF2 A;  3QO9 A;  2XY5 A;  1TK5 A;  3ZSQ A;  3OS2 A;  3PO5 A;  4M3T A;  1VSE A;  3HK2 A;  1D9D A;  1SV5 A;  3QNN A;  3IRX A;  4IFY A;  4W5T A;  4NCB A;  4CF8 A;  1VSL A;  3OYH A;  2XRI A;  2Z1I A;  4FJ5 A;  3S3M A;  2X6S A;  4DQR A;  4N47 A;  4E1N A;  1X9S A;  3ZSR A;  3HM9 A;  2DTU A;  1CXU A;  1KFS A;  1BCO A;  1Q8I A;  4FLX A;  4FK4 A;  2HW3 A;  4FCY A;  4DU1 A;  3FFI A;  1D9F A;  3KTQ A;  2O4G A;  4CEE A;  1VRU A;  1QE1 A;  1FKP A;  4CFA A;  4IFV A;  1RBV A;  3DMJ A;  4O0I A;  1ZYQ A;  4KI6 A;  2Z1J A;  2YKM A;  2W42 A;  4NCA A;  1WLJ A;  1BIU A;  4KHU A;  4B9S A;  3ZCM A;  3SV3 A;  3L3U A;  4DS5 A;  3LWM A;  2NUB A;  4W5Q A;  4DQS A;  1UAX A;  5J2P A;  3TAG A;  3L2U A;  1RBR A;  3NBP A;  3RTV A;  2IC3 A;  4AHR A;  3AVF A;  4Z4C A;  5HRP A;  1KRP A;  1Q9Y A;  1QSL A;  3MEG A;  4HVJ A;  3TI0 A;  1LWE A;  1KTQ A;  1UOC A;  4DFP A;  1KSP A;  3HXM A;  2GV9 A;  1N6Q A;  4BE1 A;  4CFC A;  4RW4 A;  3MEE A;  3OYN A;  2OPR A;  3LAK A;  4NCG A;  3WNF A;  4CJT A;  3T3F A;  4C8L A;  4F2S A;  3QIN A;  2O4I A;  2D0C A;  1TGO A;  4W5O A;  3OJS A;  3IAY A;  1KVC A;  3ZSV A;  3U6F A;  3OYJ A;  3M8P A;  4E7L A;  4K8Z A;  1ASW A;  4KHY A;  4E19 A;  4FZX C;  1J53 A;  4KO0 A;  2DFH A;  5C42 A;  4I7F A;  4FJK A;  4CK3 A;  4CGI A;  3MXM A;  4CHN A;  3OYM A;  1TKD A;  3P83 D;  3DOK A;  1LAW A;  3VQE A;  4O5B A;  2OPS A;  5KI6 A;  2X74 A;  1ZBU A;  5CZ1 A;  3LZJ A;  4FJJ A;  4DMN A;  1T03 A;  4EZ9 A;  4CGH A;  4KB1 A;  4CGJ A;  4DF8 A;  4CJ4 A;  1RNH A;  2VG6 A;  3OYK A;  3K59 A;  1NKC A;  4B9L A;  3KD1 E;  1CZ9 A;  3HVT A;  3F9K A;  3QEV A;  1K6Y A;  4LY7 A;  5SWM A;  3L3V A;  3CG7 A;  4DSI A;  3PO4 A;  1KCF A;  5C24 A;  4HHT A;  2KW4 A;  3NF7 A;  4GMJ B;  2FBT A;  3ZT3 A;  4KTW A;  4W5R A;  3KK3 A;  3DLB A;  2IAJ A;  4CJQ A;  4FXD A;  3SV4 A;  1ZBL A;  4CIG A;  4K8X A;  1IKY A;  4E7I A;  3KK2 A;  3DRR A;  3PV8 A;  3IS9 A;  1S9G A;  3P5J A;  4N56 A;  5J2M A;  3NF8 A;  3M8R A;  5KGW A;  4OKE A;  1F21 A;  4ID1 A;  3VQA A;  3A2F A;  3TR8 A;  3I0S A;  4FJN A;  1BQN A;  3VQ9 A;  1L3S A;  1TAQ A;  4EP5 A;  3C6T A;  3V1R A;  3DRS A;  4CED A;  4DTX A;  1QSS A;  3HPH A;  3EYZ A;  1NJZ A;  1Z25 A;  2HHS A;  3TAB A;  2JGU A;  1RDD A;  4M3Y A;  1S6Q A;  3OYF A;  1GOB A;  3RRG A;  4B9T A;  3ZSZ A;  1S1U A;  1RT6 A;  4AHV A;  3K5L A;  2A1S A;  4UQG A;  1EET A;  4DF4 A;  1IO2 A;  3THV A;  3VQ8 A;  4O4G A;  1REV A;  4CEZ A;  5KRS A;  4CER A;  4G1Q A;  4HUF A;  2DFF A;  4N41 A;  3O4Q A;  4LH5 A;  3KK1 A;  1RDA A;  4FLW A;  2KTQ A;  2ITG A;  3ASM A;  3HP9 A;  4FLY A;  2B4J A;  1IG9 A;  1TL3 A;  4DSE A;  2G8U A;  4C8O A;  3VQB A;  3M8Q A;  2Q3S A;  3AVM A;  3NGZ A;  1XWL A;  4I9L A;  1HYS A;  2XHB A;  4CES A;  1W9H A;  2F96 A;  3T1A A;  4CK1 A;  3EZ5 A;  1NK0 A;  3PY8 A;  4FLZ A;  1TK8 A;  1L3T A;  4FK0 A;  4FK2 A;  4BWM A;  1JL1 A;  5FRM A;  1JLQ A;  4MQ3 A;  4FM1 A;  2HHQ A;  4QAG A;  4OPJ A;  2QKB A;  4CEQ A;  4DSL A;  4Z0U A;  4CGG A;  1DLO A;  2QK9 A;  1LAV A;  4QCL A;  4O44 A;  1DTT A;  1WN7 A;  4F8R A;  5I3U A;  3ZT4 A;  4BAC A;  1LV5 A;  4BDP A;  3AVG A;  1GOC A;  5HRO A;  1BGX T;  2F8S A;  4Z4E A;  1BI4 A;  3CFO A;  2P51 A;  4FM0 A;  4I2P A;  4F2R A;  5CYQ A;  3P1G A;  3QNO A;  2HHU A;  1X1P A;  3VQD A;  3E01 A;  2PYJ A;  1GOA A;  4KHW A;  3HPG A;  1CZB A;  3IG1 A;  4M41 A;  4CJF A;  4DFM A;  4CEF A;  2OZM A;  4PY5 A;  4HCC A;  2E6L A;  1Y97 A;  3UIQ A;  1ZBH A;  3SCX A;  4PA1 A;  3RWU A;  5J1E A;  1SL1 A;  1ASU A;  3KKS A;  5T7B A;  3SUQ A;  3HO1 A;  4Z4H A;  4DU3 A;  3AVC A;  4OVL A;  2Y1I A;  1RBT A;  1Q9X A;  3D0P A;  4FLT A;  1S1X A;  1VSD A;  3MXI A;  2KFZ A;  1X9W A;  1VRT A;  2E6M A;  3C6U A;  1RTI A;  1WSE A;  4I2Q A;  3V9S A;  3SQ0 A;  1XI1 A;  3NE6 A;  1U49 A;  3MXJ A;  3LP0 A;  1J5O A;  3LP2 A;  1S5J A;  1ZBI A;  2HND A;  4HUG A;  1C6V A;  1S6P A;  3K57 A;  4OGE A;  4OPK A;  3SUN A;  4B9V A;  2G8F A;  4JS5 A;  4ID5 A;  3NDK A;  4E7K A;  3QEW A;  1LWF A;  2I5J A;  3RMC A;  3ZSW A;  3KKR A;  1YVU A;  3HT3 A;  5HP1 A;  3AO4 A;  4CJR A;  3O3H A;  2FC0 A;  1S9E A;  3HYF A;  4AHC A;  3OYC A;  1BIZ A;  3DLR A;  4ICL A;  2PYL A;  1RDB A;  2FBY A;  3VQ4 A;  3PX0 A;  1NK9 A;  1U04 A;  4BE0 A;  2OA8 A;  1SL0 A;  4ELU A;  2HHX A;  1VSK A;  2BGG A;  2EX3 A;  3L8B A;  4IKF A;  3NFA A;  2HNY A;  1VSJ A;  3NF6 A;  3K5M A;  1TVR A;  3SQ2 A;  3QLH A;  4RW7 A;  4XIU A;  1SL2 A;  3OYG A;  2KFN A;  5KTQ A;  4GW6 A;  1ITG A;  4L8R B;  4FJI A;  3DLH A;  4RW9 A;  4KKO A;  3LWL A;  4KHS A;  1CXQ A;  2QXF A;  4FZY A;  1RDC A;  3D45 A;  4J2A A;  1KLN A;  3K2P A;  1YTU A;  1A5W A;  1WSI A;  1JXB A;  1SUQ A;  2D5R A;  3KJV A;  4AHS A;  3T19 A;  1NK6 A;  3BDP A;  1RTJ A;  3PX6 A;  1EX4 A;  1HQE A;  4IG0 A;  2HMI A;  2YNF A;  1LWC A;  1O1W A;  3TWH A;  3SNN A;  1RTD A;  1QTM A;  4ELT A;  4IDK A;  1WNS A;  4F3T A;  1L5U A;  4FJG A;  3C95 A;  5JS2 A;  1C0T A;  2YKN A;  3RMD A;  4KHN A;  4B9U A;  2Y1J A;  4DTO A;  4BDZ A;  1XHZ A;  2YV0 X;  3LP3 A;  3O3F A;  5J2N A;  3ZT2 A;  1U48 A;  3OYI A;  2RF2 A;  4DTJ A;  3NH0 A;  3JSM A;  3KLI A;  5SZT A;  4JS4 A;  1ASV A;  3OYE A;  5FDL A;  1X9M A;  1KFD A;  2YNH A;  1EXQ A;  3AO5 A;  3LPU A;  4E3S A;  4E1M A;  3NCI A;  5I42 A;  1FKO A;  3L2W A;  1NKE A;  4I9Q A;  4FJX A;  2IS3 A;  1RCH A;  3ULD A;  3ZT1 A;  4KHQ A;  1FXX A;  2YHB A;  3DOL A;  3HVR A;  1C0M A;  1TAU A;  1UWB A;  3RMA A;  1CLQ A;  4DTM A;  3RR8 A;  3L2V A;  2WOM A;  4CGF A;  1QQC A;  4BE2 A;  1S1V A;  1R0A A;  2HHW A;  1RT7 A;  4CJU A;  4FLU A;  2P1J A;  3AVL A;  2X6N A;  3L2R A;  4CF9 A;  2F8T A;  1C1A A;  1BL3 A;  3OYB A;  3I0R A;  3WNG A;  4JLH A;  3ZSY A;  3DLK A;  3KIO A;  1D5A A;  4MFB A;  2OZS A;  1TL1 A;  4DG1 A;  4M3Z A;  4HTU A;  3V9X A;  4KAZ A; 
#chains in the Genus database with same CATH topology
 1JXE A;  4PQU A;  1U4B A;  3LDL A;  3FLC O;  5DM6 L;  2RN2 A;  2E88 A;  3CJB A;  3WQU A;  4DFK A;  2HHT A;  2A1R A;  3RMB A;  4CBW A;  2O8B A;  1YAG A;  1WSF A;  2O8D A;  1EKE A;  3AO2 A;  4BWJ A;  2FBV A;  3A8Y A;  3D2F B;  1TKT A;  3KLG A;  3CFR A;  4N5S A;  3V1O A;  1WSH A;  1WAJ A;  4Y1D A;  3PIO L;  3NAE A;  5AQX A;  2P9U A;  3NHG A;  3DI6 A;  4J2D A;  2ATQ A;  3CJC A;  3LL3 A;  1YXQ A;  3WT0 A;  3VTI A;  3SMP A;  4Z4I A;  4L3Q A;  3WXM B;  1YT3 A;  1NOZ A;  3AY9 A;  4H4O A;  3AA2 A;  2ZM6 K;  4NYN A;  3TAN A;  3F5T A;  1P90 A;  5ADX A;  4CHZ A;  2RHK A;  3FZH A;  4B1Y B;  1NJX A;  4Q0B A;  4BRL A;  3FR0 A;  1WOQ A;  3WNH A;  3ENO A;  1NJY A;  4DR6 K;  3P38 A;  2VCP A;  1IV0 A;  4CJE A;  3B6O A;  1HMV A;  1S1T A;  1RIL A;  5CY4 A;  4AQY K;  3HI0 A;  3CMA N;  3O3G A;  4O55 A;  4FWN A;  4PHT X;  4KRE A;  4FO0 A;  3LAL A;  4H0P A;  2R7Y A;  1C0G A;  2FXU A;  4U7B A;  2KQ2 A;  4JKH A;  3MEC A;  3B6P A;  4N76 A;  3CCQ N;  3LAM A;  1N5Y A;  3CJ7 A;  4AHT A;  2ZJP L;  3R6M A;  1LOT B;  4CBX A;  3JAM O;  2AA4 A;  2YHA A;  4JEP A;  3AVB A;  3GE1 A;  3CFP A;  4NLC A;  3U3G A;  4BRF A;  3SUP A;  1OVY A;  3FZL A;  4IDH A;  3MWT A;  4GKK K;  3AVA A;  2GUI A;  2QTD A;  3NF9 A;  3HL8 A;  5KQ8 A;  3I8B A;  3Q7C A;  4H5N A;  1N8R O;  4M42 A;  3S3O A;  3MN9 A;  4LFA K;  3D2E B;  1D8Y A;  3H08 A;  4MO4 A;  1YHQ N;  5FPN A;  4BR0 A;  3J80 O;  1GLJ O;  1YTA A;  1T7P A;  2OYQ A;  4M3X A;  5FRN A;  1E4G T;  4YDU A;  3HPO A;  3CQX A;  4BG8 A;  3VQQ A;  1NK8 A;  3M6G A;  3CM5 A;  3HBT A;  2RE2 A;  4Y1C A;  3V9W A;  3TTF A;  2NRX A;  3ATU A;  5E41 A;  1GLA G;  3V6D A;  2E4L A;  1SKW A;  1S3X A;  2W41 A;  1JLF A;  3CC2 N;  3F2K A;  1IKW A;  1NBW A;  1IG8 A;  3QEP A;  1S22 A;  4B8C A;  5K14 A;  2XY8 A;  3CQ8 A;  4M45 A;  2HMP A;  5I9E B;  3LAN A;  3RR7 A;  3GBT A;  3N4Q A;  3C0B A;  3HP6 A;  1MWM A;  5DM7 L;  3SUO A;  4JYA K;  3QIO A;  2YCH A;  4E1J A;  1L3U A;  4E0D A;  1J54 A;  1V4T A;  5HLF A;  5AQF A;  4DV6 K;  2JWK A;  4LSN A;  3SQ4 A;  3JYT A;  5FPD A;  3L6Q A;  3DLE A;  4OKJ A;  2WFB A;  4WQ5 C;  3K5O A;  3TTD A;  4CZM A;  2B6A A;  4DR7 K;  4IO9 L;  3TAE A;  4OGC A;  4C23 A;  5BRE A;  5AQI A;  1EQY A;  1VSI A;  3S9H A;  1V4S A;  2ITM A;  1HYZ A;  3OY9 A;  2AP1 A;  1TV6 A;  5DMR A;  5IT9 O;  1Q82 O;  1JLC A;  5EY4 A;  1HRH A;  4FJM A;  1TYQ A;  4CJP A;  4LF6 K;  4JI0 K;  3RSE A;  3SQ1 A;  3MCA B;  1VAZ A;  3PO5 A;  3OS2 A;  4M3T A;  3HK2 A;  1D9D A;  1SV5 A;  3IRX A;  5BRD A;  2O8E A;  3HOS A;  1NNE A;  4DV7 K;  2Z1I A;  3S3M A;  2X6S A;  2DTU A;  1ZBS A;  4B1U B;  4A61 A;  4JK7 A;  1CXU A;  1BCO A;  4FLX A;  1KAX A;  4IFV A;  1RBV A;  3EKS A;  3VES A;  1ILY A;  5LY3 A;  3HOT A;  2OTJ N;  5AQU A;  1N33 K;  4KHU A;  4B9S A;  2UYT A;  2IVP A;  4DS5 A;  4DQS A;  1UAX A;  3E9P A;  4JK8 A;  2IC3 A;  1K8K A;  4BRA A;  3MEG A;  1LWE A;  4JI7 K;  1UOC A;  4DFP A;  3BP8 A;  2P9K B;  4KH5 A;  1N6Q A;  3OYN A;  2F4V K;  2OPR A;  4C8L A;  3WNF A;  1HKB A;  1TGO A;  3IAY A;  1KVC A;  3U6F A;  5LMN K;  3P31 A;  3EE9 A;  3ZET A;  4EFH A;  3CI5 A;  4CGI A;  2NRV A;  3OYM A;  3SLC A;  4B9Q A;  3VQE A;  2CGJ A;  3ZYY X;  5CZ1 A;  1NGD A;  4CGJ A;  4DF8 A;  3HVT A;  3F9K A;  4MLE A;  1K6Y A;  2FSJ A;  3MX2 A;  1GLF O;  3OHR A;  3VEN A;  3CG7 A;  5M1K A;  5SWM A;  2P9P B;  4HHT A;  2KW4 A;  3NF7 A;  1BUP A;  3DLB A;  1ZBL A;  4CIG A;  2JWL A;  1IKY A;  1E3M A;  3ENH A;  3KK2 A;  3DRR A;  5E84 A;  5IWA K;  2F9W A;  3TR8 A;  3I0S A;  3VQ9 A;  2A3Z A;  1QSS A;  4CED A;  1DKG D;  1NJZ A;  2HHS A;  2Q1N A;  4DCH A;  1S1U A;  1RT6 A;  4AHV A;  3UKR B;  3I33 A;  4H0V B;  3THV A;  3VQ8 A;  4CEZ A;  5KRS A;  2KHO A;  1MA9 B;  2YX6 A;  4LH5 A;  3KK1 A;  1H1V A;  2CH6 A;  4C8O A;  1TL3 A;  2G8U A;  1WBD A;  4IJN A;  2Q97 A;  3NGZ A;  1XWL A;  4I9L A;  4CZF A;  2XHB A;  4JD2 A;  1W9H A;  3TU5 A;  1NK0 A;  1L3T A;  1JLQ A;  2YHW A;  3TSP A;  2HHQ A;  3I55 N;  4CGG A;  1DLO A;  1DTT A;  3LM2 A;  1YIT N;  3B8A X;  4O5F A;  1N32 K;  5I3U A;  1JCF A;  4BAC A;  4BDP A;  3SAH A;  3VF6 A;  3MN5 A;  2I7N A;  1BGX T;  3KWI A;  2F8S A;  3QBX A;  5FPE A;  4B3R K;  4F2R A;  3P1G A;  4V19 S;  3VQD A;  5BPM A;  4FPA A;  3HPG A;  1X3N A;  3H1V X;  1CZB A;  3IG1 A;  4DFM A;  3CCV N;  4PY5 A;  3J7Y P;  3CJA A;  3KKS A;  4CZK A;  4Z4H A;  3QDK A;  1LCU A;  1RBT A;  3LDO A;  2E6M A;  3BF3 A;  1J5O A;  3SQ0 A;  3NE6 A;  3MXJ A;  5M1O A;  2HND A;  4JKA A;  4HUG A;  4OPK A;  4ID5 A;  3QEW A;  1LWF A;  2I5J A;  3RMC A;  3ZSW A;  5HP1 A;  3AO4 A;  3BF1 A;  5AQR A;  2FC0 A;  4XH4 A;  3DLR A;  4ICL A;  1RDB A;  1NGG A;  3VQ4 A;  3PX0 A;  2HHX A;  4BE0 A;  2BGG A;  4BRG A;  3NMU A;  5EVZ A;  2P9S B;  5ADX H;  1VSJ A;  4RCH A;  3K5M A;  4LFC K;  4NXM K;  3QLH A;  4XIU A;  2Q2R A;  2KFN A;  5KTQ A;  2D1K A;  4FJI A;  1RDC A;  3D45 A;  1QVF M;  1WSI A;  2GX9 A;  3EEQ A;  3H3O B;  1RTJ A;  1QQM A;  1OH8 A;  1HQE A;  4IG0 A;  3VEO A;  4DR4 K;  3F9M A;  1QTM A;  2H3G X;  4ELT A;  1WNS A;  3MMV A;  4O8K A;  2YKN A;  3RMD A;  2V7Y A;  1XHZ A;  2W6L A;  1K9M O;  1X9J A;  3VF2 A;  3ATV A;  4JKD A;  5AR0 A;  3KLI A;  3RVC A;  5AZI B;  2P9I B;  2UXD K;  3T1Y K;  1ASV A;  1X9M A;  1JCE A;  3NCI A;  2WBN A;  1RCH A;  3A5O C;  2QA4 N;  3ZT1 A;  3IDH A;  4DV0 K;  3GL1 A;  4GV3 A;  3VGK A;  1TUY A;  2NLX A;  2WOM A;  5EOY A;  5GAH P;  4A62 A;  4CZE A;  4IOC L;  2BUP A;  3A5N C;  2F8T A;  1EWQ A;  5LJW A;  4CI6 A;  4ISE A;  4JLH A;  3SBG A;  1GLL O;  4M3Z A;  3QET A;  4PUO A;  1FK9 A;  4M3R A;  4X64 K;  2OPQ A;  1X3M A;  2E20 A;  2IGI A;  1WB9 A;  4JRP A;  4DUY K;  3R9P A;  2CGL A;  1VQ8 N;  5AZJ B;  1T8E A;  3BEX A;  3AO1 A;  4DB3 A;  4FLV A;  4DS4 A;  2ZWH A;  1NK7 A;  2HVI A;  5HBM A;  2ZJQ L;  2ETJ A;  1LW2 A;  4OKK A;  3GG4 A;  4B9M A;  2PY5 A;  4FYD A;  4DV4 K;  3VA0 A;  1Q81 O;  3R1X A;  1BA0 A;  3LDS A;  1SZ2 A;  3G0Z A;  4FJ7 A;  2NNW A;  4CFB A;  1XHX A;  4WYB A;  3O8M A;  1U6Z A;  4DLE A;  5C15 A;  4GV9 A;  4IOX A;  1ZXO A;  1RBS A;  5FLX O;  3TPQ A;  2RPI A;  5JVH L;  4BDY A;  4KTQ A;  4JV5 K;  2NRW A;  5TKW A;  4A2A A;  1VSF A;  1QHA A;  4KFB A;  1N36 K;  2I7P A;  3K58 A;  1B9D A;  1P8Z A;  2HNZ A;  4IJA A;  4QCL A;  4KI4 A;  3D6R A;  3KD5 E;  4DTU A;  4RW8 A;  4R79 A;  3L0Q A;  3CIP A;  2YNG A;  1IKV A;  1RGI A;  3QEX A;  1NGA A;  4YOT A;  2P9N A;  4NYF A;  1ZBF A;  4IFE A;  4A57 A;  4DKW A;  3OTO K;  4CIF A;  3EL2 A;  3WEE B;  3PLA A;  2QKK A;  1MU2 A;  3ID6 A;  1NJW A;  3CJ9 A;  5AQQ A;  3A5L C;  5J2Q A;  1NMD A;  1UA0 A;  4LD0 A;  1U2V B;  3BZK A;  3ZSX A;  1VQ5 N;  3AVN A;  5M1Q A;  4DQP A;  3VQC A;  4CJS A;  4E7H A;  2KZZ A;  3G6E N;  4CBU A;  3TSQ A;  2P9K A;  4FWR A;  4GVM A;  4CZG A;  4YY3 K;  2ZGY A;  3ID8 A;  1QHT A;  1KAZ A;  3ISN C;  4E7J A;  1L3V A;  3QEI A;  4B3O A;  1SKS A;  1JKH A;  2PBD A;  3AO3 A;  3OYL A;  1JLB A;  2UU9 K;  1T44 A;  2Q0R A;  5M1F A;  1NJI O;  1SS6 A;  4YOW A;  5AQL A;  4GVE A;  1VK0 A;  4FVM A;  3SZ2 A;  4FJH A;  4O0J A;  4QOZ B;  3DYA A;  1DEJ A;  1I3A A;  3ZX3 A;  4R5P A;  4DR1 K;  4BGA A;  1IJJ A;  1C0F A;  5JS1 A;  2ASP A;  2NRT A;  3LPT A;  3SAG A;  5CZ2 A;  1JJ2 M;  2P9P A;  1T3V A;  3QEV A;  1D4X A;  1XC9 A;  2V51 B;  4EHU A;  3U9Z A;  4BRC A;  2G8W A;  4J2B A;  5A2Q O;  4X62 K;  2JLE A;  3QFU A;  2G8I A;  3H46 O;  1UA1 A;  2ZE2 A;  1XNR K;  3FFK B;  3ZEU A;  5AQS A;  1GLD G;  3RRH A;  2YHY A;  2OPP A;  4CHY A;  1Z6R A;  4JRQ A;  4AM7 A;  4DSK A;  1BQM A;  3KLE A;  3TAR A;  4FSV A;  2HB5 A;  3LDQ A;  3C6H A;  3EY1 A;  3OYA A;  1QQO A;  1JLA A;  1WSJ A;  5BPN A;  1BDG A;  1GLE G;  1RT4 A;  3NH1 A;  4BRO A;  3O08 A;  3V81 A;  1VQ9 N;  3QB0 A;  3CCM N;  4YHH K;  1RBU A;  4RG8 A;  3SK3 A;  1C1C A;  2VG7 A;  4H0T B;  3U4L A;  4CD3 A;  4LH4 A;  3DLL L;  2B5J A;  1WUA A;  3MCP A;  2QI2 A;  3MAQ A;  1TK5 A;  3ZSQ A;  1VSE A;  4DHY A;  1KD1 O;  3OYH A;  1R59 O;  2XRI A;  4N47 A;  1X9S A;  4QS8 A;  5CHI A;  2YI1 A;  3EE8 A;  1QE1 A;  4H5R A;  4DV2 K;  4O0I A;  1ZYQ A;  3J8A A;  3ZLJ A;  1BIU A;  2NZT A;  3ZCM A;  3SV3 A;  3CET A;  4KBO A;  3LWM A;  5J2P A;  3TAG A;  1RBR A;  1BU6 O;  1Q9Y A;  4BRD A;  1XQS C;  5HL7 L;  4BC2 A;  1KSP A;  1OH7 A;  4BE1 A;  4RW4 A;  3MEE A;  2FF6 A;  3CME N;  4JI3 K;  3OJS A;  1VQ7 N;  4K8Z A;  2P9S A;  4KHY A;  4E19 A;  4DQ8 A;  1J53 A;  2HF4 A;  3C65 A;  4I7F A;  3THX B;  4CK3 A;  4CHN A;  3CC4 N;  3J81 O;  3DJC A;  4O5B A;  2OPS A;  4FJJ A;  1ZBU A;  4EZ9 A;  3LM9 A;  4KB1 A;  1RNH A;  2VG6 A;  3OYK A;  4B9L A;  4BC3 A;  3KD1 E;  1CZ9 A;  3L3V A;  3MX5 A;  4JKG B;  3PO4 A;  4GMJ B;  3KK3 A;  2FBT A;  1GLB G;  4BR7 A;  2IAJ A;  3SJH A;  3E66 A;  5M1N A;  3SV4 A;  4E7I A;  1FW6 A;  3PV8 A;  3IS9 A;  2O8F B;  3P5J A;  5J2M A;  3N4P A;  3QML A;  2HBJ A;  4OKE A;  4ID1 A;  3VQA A;  3A2F A;  4LF9 K;  4A59 A;  1L3S A;  2A5X A;  1DT9 A;  1TAQ A;  3FGU A;  4B3M K;  1DGK N;  1Z25 A;  4CZJ A;  2JGU A;  4YOY A;  4FWO A;  1G99 A;  3RRG A;  3K5L A;  2A1S A;  2HF3 A;  2GUP A;  4DF4 A;  1IO2 A;  1W7A A;  4N41 A;  1REV A;  4CER A;  4G1Q A;  3O4Q A;  1RDA A;  4FLW A;  3ASM A;  3D7E O;  3VQB A;  2Q3S A;  3O9Q A;  3AAQ A;  4MDB A;  3EZ5 A;  4FWP A;  2O8C B;  1JL1 A;  2HBK A;  2QM1 A;  4MQ3 A;  4QAG A;  4OPJ A;  4Y0W A;  4ISF A;  1LAV A;  1Q18 A;  4I6M A;  1WN7 A;  3BUZ B;  2HHH K;  2GEM A;  3AVG A;  4A5B A;  5AZJ A;  4FM0 A;  4I2P A;  2UUB K;  4JI5 K;  3E01 A;  4KHW A;  2Q0U A;  3K9J A;  4CJF A;  4HCC A;  1Y97 A;  1ZBH A;  3U9D A;  3J7A P;  4YDU C;  1N34 K;  1NGF A;  2ASM A;  5T7B A;  3QIC A;  2Y1I A;  2KFZ A;  4FLT A;  1S1X A;  3MXI A;  2IIR A;  3C6U A;  3V9S A;  1RTI A;  1WSE A;  4OO1 J;  3LP2 A;  1VQ6 N;  1ZBI A;  1C6V A;  2OAN A;  2FLO A;  3S41 A;  4E7K A;  5AQN A;  3ULE B;  1IBL K;  4FWK A;  4CJR A;  2E2P A;  4AHC A;  3KVG A;  4BR4 A;  2VWB A;  1U04 A;  1SL0 A;  4IKF A;  5MLC Q;  3Q7B A;  1TVR A;  3SQ2 A;  3KK7 A;  4KKO A;  2D0O A;  4FZY A;  4J2A A;  1KLN A;  1A5W A;  1JXB A;  1NK6 A;  3VEY A;  3PX6 A;  5EX5 A;  5CE3 A;  4JI1 K;  1LWC A;  1RTD A;  3SNN A;  3T7Z A;  4JI2 K;  3C95 A;  3CF5 L;  1C0T A;  5BN9 A;  4B9U A;  2Y1J A;  4BVP A;  3LP3 A;  1U48 A;  1GLC G;  1OKJ A;  3NH0 A;  3VET A;  1HUX A;  3O9R A;  3JSM A;  2V52 B;  4JS4 A;  3WXK A;  2CH5 A;  3OYE A;  2KKZ A;  2YHX A;  3AO5 A;  5F2R A;  5GAE P;  4BC5 A;  4E1M A;  1NKE A;  3ULD A;  3CCU N;  4KHQ A;  4EIA A;  1I94 K;  2GTD A;  1TAU A;  3RMA A;  3A5M C;  4DTM A;  3RR8 A;  4HWI A;  4CGF A;  1RT7 A;  2HST A;  3PSF A;  4CF9 A;  1NLV A;  3VTH A;  3DXM A;  3OYB A;  4MFB A;  2OZS A;  2E2O A;  3V9X A;  1VQN N;  4C8N A;  5BRH A;  3K9K A;  3HST B;  3THW B;  5FRO A;  5CR4 A;  2O8B B;  1KVB A;  4WCE L;  4EP4 A;  2O8D B;  3O4N A;  3J7Z O;  1BI4 B;  3LDP A;  2Z1H A;  1JLG A;  3QFP A;  1Z26 A;  2DPN A;  1QS4 A;  3QIP A;  2A6A A;  1TKZ A;  3VA3 A;  3IFR A;  2P9U B;  4CJ3 A;  3V9Z A;  2LSN A;  4DTP A;  3AV9 A;  4CVN E;  4QS9 A;  4WE1 A;  3VQP A;  3PUF A;  2VGM A;  2IOC A;  4BC4 A;  4DTS A;  3D2F A;  1NK5 A;  3V9U A;  4H8K A;  2FF3 B;  2XY7 A;  2PZS A;  1RT5 A;  4IG3 A;  4O8U A;  3V1Q A;  2WUS A;  1B9F A;  4H0X B;  5GIN A;  4JN4 A;  3AVI A;  4CF1 A;  1NOY A;  4BY9 C;  4Q5V A;  3QER A;  3DM2 A;  1TK0 A;  3HM8 A;  4GKJ K;  5AFU A;  4XH5 A;  3DRP A;  4KHP K;  3VQ6 A;  3MWP A;  4AH9 A;  4A5A A;  4DQI A;  2FSK A;  2E1Z A;  2QWL A;  4FW2 A;  4XEI A;  4CJ5 A;  1RDW X;  4DTR A;  2HOE A;  5JLH A;  3OJU A;  4CHP A;  5KRT A;  4RTF D;  3CCJ N;  3CCR N;  2QWN A;  4IOA L;  4CFD A;  4IZ9 A;  4RW6 A;  2X78 A;  4J8F A;  2BE2 A;  3PX4 A;  1RT1 A;  4Z4G A;  4J2E A;  3O1B A;  4FOI A;  3AA5 X;  4H0O A;  3VN5 A;  5GAG P;  4DLG A;  2DFE A;  4HCB A;  3AVK A;  5C2D A;  3THY B;  1RT3 A;  3L4I A;  3P4I A;  3EO3 A;  3ZSO A;  5HRS A;  3M3Z A;  3TAQ A;  5DK5 A;  5AQG A;  1IH7 A;  3UB5 A;  1HKC A;  4FJL A;  1IBM K;  5KPT A;  1DTQ A;  4B08 A;  4NLB A;  5CYM A;  4PWD A;  1ATR A;  3MN7 A;  4DSJ A;  1HNV A;  2VYP A;  3ZX0 A;  5JVG L;  1W0H A;  4B9N A;  5HRR A;  3OS1 A;  4MDA A;  4DFJ A;  4JKC A;  4C8M A;  4AIL C;  1BIS A;  1C1B A;  1SQK A;  3TAF A;  4KV8 A;  1G15 A;  2ZD1 A;  3THX A;  3AVJ A;  3OS0 A;  4CEO A;  3K5N A;  3SJJ A;  1KAY A;  3IUC A;  4FW1 A;  3DXK B;  4DSF A;  2WTU A;  4CIE A;  3D2E A;  4WQ4 A;  4DTN A;  1NGE A;  3WNE A;  3SPZ A;  4OPH A;  2E2N A;  2P5G A;  4FJ8 A;  4ELV A;  5AJ3 K;  1EWR A;  4BVO A;  2WON A;  5JIC A;  2FSN A;  1Q7Y O;  3CM6 A;  3GOI A;  2BAN A;  3M1F A;  1VQO N;  1SKR A;  1K8A O;  1BCM A;  3AA3 A;  3HTV A;  1RT2 A;  1XMO K;  4ZTJ A;  2NRZ A;  2VG5 A;  3BZC A;  1WAF A;  1XC3 A;  4KRF A;  2VWK A;  2V7Z A;  4KB0 A;  2YJE A;  1NKB A;  1A5X A;  1U47 A;  3H6E A;  5HOO A;  3U3Y A;  4IWV A;  3MDQ A;  1QSY A;  1B92 A;  5HRN A;  3CYM A;  2EWS A;  1M90 O;  1HPZ A;  1NK4 A;  4GNI A;  2Z1G A;  3W3D A;  4C8K A;  2D0B A;  4FWQ A;  3O80 A;  4U67 L;  4DWI A;  2O8C A;  2D0A A;  2DY4 A;  2FBX A;  1W97 L;  1TYQ B;  3KHY A;  4CJW A;  1TKX A;  1VSM A;  2HVH A;  3RSE B;  3F73 A;  4ZTF A;  2RKI A;  2AJQ A;  5F0X A;  1EP4 A;  1VHX A;  3O5B A;  4H4M A;  3L2Q A;  4B8A B;  2EHG A;  3ALY A;  4FWM A;  4CEC A;  2G8V A;  4OJR A;  4EAH D;  5AQJ A;  4CF2 A;  2XY5 A;  4M3W A;  3AGK A;  3EKU A;  4W5T A;  4NCB A;  3H3N O;  4FJ5 A;  2ASO A;  4DQR A;  4E1N A;  3ZSR A;  3HM9 A;  1KFS A;  1Q8I A;  1ZC6 A;  3O9U A;  3TSU A;  1HNZ K;  2HW3 A;  4FCY A;  3H45 C;  4DU1 A;  1VRU A;  4CFA A;  3DMJ A;  1Z05 A;  2Z1J A;  1KXP A;  4WFN L;  3BY5 A;  4ILH A;  5H1S Q;  2W42 A;  2UUA K;  1K8K B;  1WLJ A;  3L3U A;  4MLH A;  3PIP L;  2NUB A;  3O9T A;  3L2U A;  2F7T A;  3T1H K;  4AHR A;  2GWJ A;  3ULE A;  5HRP A;  1QSL A;  1KRP A;  4HVJ A;  3R8E A;  3WQT A;  3HXM A;  5AQP A;  4CFC A;  3LAK A;  4NCG A;  1NWK A;  3E1Y A;  3QIN A;  3ZET B;  4BRI A;  4GV6 A;  2O4I A;  1MDU B;  3ZSV A;  4E7L A;  4C1N I;  4JKB A;  4FZX C;  4KO0 A;  3I56 N;  5C42 A;  4FJK A;  3MXM A;  4BRH A;  1LAW A;  2P9L B;  2X74 A;  1T03 A;  1J6Z A;  3K59 A;  5C12 A;  4KH6 A;  5C24 A;  3H1Q A;  4BRM A;  4KTW A;  3VOV A;  4CJQ A;  4FXD A;  4K8X A;  2NRR A;  4IO8 A;  4NB4 A;  1S9G A;  3NF8 A;  5KGW A;  2ZF5 O;  4BQL A;  5KPZ A;  4FJN A;  2F9T A;  3DAW A;  1W2B M;  4EP5 A;  2HBL A;  3C6T A;  3V1R A;  3DRS A;  3UE5 A;  3OBW A;  3EYZ A;  1S72 N;  1RDD A;  1S6Q A;  2A41 A;  3IMX A;  3ZSZ A;  4B1W B;  1QQN A;  3T69 A;  3R3L A;  4UQG A;  1EET A;  3CPE A;  4O4G A;  4JHD B;  4HUF A;  2DFF A;  4K0K K;  3UKR A;  4PL8 A;  3CC7 N;  4JD2 B;  2ITG A;  1IG9 A;  2B4J A;  1HYS A;  4BRK A;  4CES A;  2F96 A;  3T1A A;  4CK1 A;  3PY8 A;  1HLU A;  4FLZ A;  1TK8 A;  4FK2 A;  5FRM A;  4B3T K;  2GWK A;  2BH1 A;  1YJW N;  2QKB A;  3OW2 M;  2D4W A;  4Z0U A;  4DSL A;  1YVN A;  3IKM A;  4LF8 K;  4O44 A;  3THW A;  2WC9 A;  1NGB A;  1NGC A;  4F8R A;  3ZT4 A;  1LV5 A;  1GOC A;  5HRO A;  4BR9 A;  1BWF O;  1BI4 A;  3CFO A;  5JMV A;  3VEX A;  2P51 A;  4H0Y B;  4CW7 B;  1M1K O;  3CQY A;  4BQZ A;  2HHU A;  2CGK A;  5EXW A;  2OZM A;  3FZK A;  3CER A;  5BR9 A;  4PA1 A;  1NU0 A;  3G4S N;  2QWP A;  3RWU A;  3SUQ A;  4IEE A;  4OVL A;  4B1Z A;  1CZA N;  3D0P A;  3FE1 A;  4YOV A;  1X9W A;  4I2Q A;  1XI1 A;  1NGJ A;  1U49 A;  1S5J A;  4LF7 K;  1EO1 A;  4B9V A;  4OGE A;  3SUN A;  4H5V A;  4Z94 A;  1YVU A;  3HT3 A;  3JS6 A;  1T6C A;  1S9E A;  1BIZ A;  5FPM A;  4FWS A;  2FBY A;  1OH5 A;  2EX3 A;  4HTL A;  1SL2 A;  3OYG A;  5AFU H;  3VEV A;  1ITG A;  4L8R B;  3DLH A;  3LWL A;  4KHS A;  2QXF A;  4WQ5 A;  1BO5 O;  4YOX A;  5AQM A;  1SUQ A;  2D5R A;  4PKH A;  3KJV A;  4AHS A;  3T19 A;  3BDP A;  4BRQ A;  3THY A;  1VQK N;  5GAD P;  2Q31 A;  2E1Y A;  5AQK A;  4F3T A;  4KH4 A;  3ZX2 A;  5JS2 A;  5BN8 A;  4DV5 K;  4KHN A;  1K73 O;  2UXC K;  3CD6 N;  4BDZ A;  2YV0 X;  5J2N A;  3UKU B;  4K42 A;  3OYI A;  4DTJ A;  4PL7 A;  5LJV A;  3VGM A;  5SZT A;  2YJF A;  5FDL A;  1BOT O;  4DR5 K;  1EXQ A;  4OLB A;  4E3S A;  5AZI A;  2P9I A;  1FKO A;  5E26 A;  4PKI A;  4FWL A;  3DOL A;  4JKE A;  2BTF A;  1UWB A;  3L2V A;  1QQC A;  4F9O A;  3DXK A;  4BE2 A;  2HHW A;  4IXC A;  4CJU A;  4FLU A;  2W6K A;  3AVL A;  3L2R A;  2Q36 A;  4A2B A;  4DR2 K;  1C1A A;  1ATS A;  1BL3 A;  3ZSY A;  3VEW A;  3KIO A;  4QS7 A;  1D5A A;  4DG1 A;  1Q86 O;  4HTU A;  4KAZ A;  4HUE A;  4Z4F A;  2IDO A;  1BA1 A;  1HYV A;  2D0P A;  4CJL A;  2KZM A;  2IVO A;  3VQ5 A;  1TUU A;  3KLF A;  1WSG A;  4CHO A;  4H5W A;  1YI2 N;  3AVH A;  1YUW A;  1BHL A;  5B8H A;  4IBN A;  4KPY A;  3ZT0 A;  4KTZ A;  1HQU A;  1RTH A;  1KVA A;  1T05 A;  1A5V A;  1C0U A;  4G9Z A;  1HNI A;  1E4F T;  3NVK A;  3TTC A;  1ATN A;  3CJ1 A;  4FZZ A;  1O13 A;  4CD1 A;  4AHU A;  2QEX N;  1LW0 A;  1YIJ N;  2A42 A;  1JL2 A;  3LZI A;  2G8H A;  4BRN A;  4OX9 K;  4H03 B;  4AF1 A;  4X66 K;  3V4I A;  3FZF A;  4CEB A;  4F4K A;  3HJF A;  2E5L K;  1S1W A;  5AQW A;  2GBZ A;  4FVU A;  5EU7 A;  3NGI A;  1VQL N;  1J9A A;  3ENB A;  4CCH A;  2P9N B;  2VGN A;  3P39 A;  4DQQ A;  4JI4 K;  3HRG A;  3ITH A;  4CF0 A;  1HJR A;  3VF4 A;  3AA4 A;  4OLA A;  3C7N B;  2VWJ A;  4TSX A;  3K0S A;  3E9L A;  1JCG A;  1HNX K;  3VPZ A;  4DR3 K;  1JLE A;  3DWL A;  3DLG A;  4AM6 A;  2BDP A;  2G8K A;  3WEE A;  1YJ9 N;  2PAV A;  3SPY A;  3TAP A;  1VSH A;  3M8S A;  3C94 A;  4K25 A;  1IKX A;  4CGD A;  4JI6 K;  3HSC A;  2XO7 A;  3SBT A;  1YJN N;  4ZHR A;  1U2V A;  1YF5 L;  3TAM A;  5C25 A;  2P5O A;  5BPL A;  5D3G A;  3MED A;  1I39 A;  3KLH A;  4F2S A;  2NRH A;  3AAP A;  3I8D A;  3OBY A;  5C0Y A;  5KGX A;  2ZQB A;  3QES A;  4CK2 A;  4CHQ A;  4FM2 A;  3LP1 A;  4JAX A;  4CEA A;  3VEZ A;  2P9L A;  1FJG K;  1J5E K;  1QZ6 A;  2YNI A;  3A0I X;  4EZ6 A;  3M5R A;  1U45 A;  4M63 C;  4M7Y A;  1KLM A;  1NGI A;  3EN9 A;  4F3O A;  2VQF K;  2XY6 A;  1OVQ A;  3SYZ A;  4CJK A;  4CJV A;  4MO5 A;  3ZEU B;  1BG3 A;  4DV3 K;  4K43 A;  3AAR A;  4EHT A;  3AGR A;  2HHV A;  4LSL A;  2VQE K;  4LF5 K;  4YNQ A;  5AQZ A;  4BG9 A;  1NGH A;  1Y64 A;  3BGR A;  1IBK K;  2QWO A;  3U8X A;  3G10 A;  3CCE N;  4CE9 A;  3OVN A;  4JHD A;  3VQ7 A;  4X65 K;  4E89 A;  3OYD A;  3CCL N;  4M3U A;  4W5N A;  3MN6 A;  3S3N A;  3NGY A;  3CXC M;  1HX1 A;  3SI6 A;  3NH2 A;  2E2Q A;  2QWM A;  4IEI A;  2UXB K;  4ISG A;  4YFU A;  4FJ9 A;  3GDQ A;  4DU4 A;  4FL9 A;  3QO9 A;  3QNN A;  4LFB K;  4IFY A;  4OPA A;  4CF8 A;  1VSL A;  4C1N K;  1MWK A;  4FK4 A;  1QZ5 A;  1D9F A;  3KTQ A;  3FFI A;  2O4G A;  4CEE A;  1KC8 O;  3G71 N;  1FKP A;  1NMN A;  3CHW A;  4KI6 A;  2YKM A;  4NCA A;  1HNW K;  2ZJR L;  2UUC K;  5BRF A;  3QBW A;  4BGB A;  3OA9 A;  4NXN K;  4W5Q A;  3NBP A;  3RTV A;  3AVF A;  4Z4C A;  3TI0 A;  1KTQ A;  5BR8 K;  2GV9 A;  3L4Q A;  1VQM N;  4B1X B;  4CZI A;  4CJT A;  4RWT A;  3CCS N;  3T3F A;  2D0C A;  4W5O A;  3G25 A;  3WUH A;  3OYJ A;  3M8P A;  1ASW A;  2QXL A;  2DFH A;  5TKY A;  1TKD A;  3P83 D;  3DOK A;  3VGL A;  4B3S K;  5KI6 A;  3LZJ A;  4DMN A;  4CGH A;  4CJ4 A;  1NKC A;  5ELZ A;  2QWR A;  4LY7 A;  1HR0 K;  4DSI A;  1KCF A;  3ZT3 A;  4W5R A;  4DUZ K;  5KPR A;  1HJO A;  3VMF B;  4JKG A;  2A40 A;  3JXU A;  3UKU A;  4N56 A;  5GIO A;  3M8R A;  1F21 A;  1BQN A;  2O8F A;  4DTX A;  3HPH A;  3TAB A;  2KLA A;  3CPW M;  4M3Y A;  3OYF A;  1VQP N;  1GOB A;  1NG9 A;  2ZGZ A;  4B9T A;  5GIP A;  1QVG M;  1OH6 A;  1VQ4 N;  4M7X A;  4UY8 O;  4JNE A;  2KTQ A;  4BR5 A;  4FLY A;  3HP9 A;  3PSI A;  4WFA L;  4DSE A;  3M8Q A;  3AVM A;  3O9S A;  2GEL A;  3O6W A;  5JLF A;  4FK0 A;  4FOE A;  5AQV A;  4CZH A;  4BWM A;  4I6M B;  4BRE A;  4FM1 A;  5LMU K;  4CEQ A;  5C10 A;  2QK9 A;  3O1W A;  2OTL N;  5AQY A;  3FZM A;  2IVN A;  3O4W A;  1HKG A;  4Z4E A;  4B1V A;  4ILJ A;  1XUP O;  3SAF A;  5CYQ A;  4CZL A;  1SAZ A;  2O8E B;  3QNO A;  1X1P A;  3KWG A;  2PYJ A;  1GOA A;  1T6D A;  4M41 A;  4CEF A;  2E6L A;  4H5T A;  3UIQ A;  3WXL A;  3SCX A;  4JI8 K;  4WQ4 C;  5J1E A;  1SL1 A;  1ASU A;  2J4R A;  3EZW A;  3HO1 A;  4DU3 A;  3AVC A;  5AQH A;  1Q9X A;  1VSD A;  1VRT A;  3LP0 A;  4LF4 K;  1S6P A;  5AQO A;  3K57 A;  2G8F A;  2PFU A;  4JS5 A;  3NDK A;  4ILG B;  3KKR A;  3O3H A;  3KZB A;  3HYF A;  3OYC A;  2PYL A;  4YOU A;  4JKF A;  1NK9 A;  2OA8 A;  4ELU A;  1VSK A;  3L8B A;  1XNQ K;  3NFA A;  2HNY A;  3NF6 A;  4GY2 B;  4RW7 A;  2W40 A;  4GW6 A;  5KQD A;  3SMS A;  4RW9 A;  1KQS M;  3C7N A;  1CXQ A;  4BRP A;  3VER A;  3K2P A;  1YTU A;  4JK9 A;  4YOR A;  3C6A A;  3HZ6 A;  4LC9 B;  1EX4 A;  2HMI A;  5C2F A;  2YNF A;  1O1W A;  3TWH A;  3NVM A;  2HBM A;  4IDK A;  3W0L A;  4PKG A;  1L5U A;  4FJG A;  5M1P A;  5AQT A;  4WFB L;  3MK6 A;  4FPB A;  4DTO A;  3WXI A;  3O3F A;  3ZT2 A;  1XMQ K;  2RF2 A;  3WXJ A;  1ESV A;  1KFD A;  2YNH A;  1HPM A;  4K41 A;  3LPU A;  5I42 A;  4I9Q A;  3L2W A;  3LDN A;  4XH1 A;  4FJX A;  2IS3 A;  5F1X A;  1FXX A;  2YHB A;  3HVR A;  1C0M A;  1CLQ A;  2OCE A;  4NO7 A;  1S1V A;  2QW9 A;  3DXM B;  4BR2 A;  1R0A A;  2P1J A;  3E9O A;  2X6N A;  2QWQ A;  1RDU A;  1WBB A;  3I0R A;  3WNG A;  4CJ7 A;  4DV1 K;  3DLK A;  4WF9 L;  2E8A A;  5LL6 Z;  1RFQ A;  1TL1 A;  1NM1 A; 
#chains in the Genus database with same CATH homology
 4HUE A;  4C8N A;  1JXE A;  2IDO A;  3QET A;  4PUO A;  1HYV A;  1FK9 A;  4CJL A;  4Z4F A;  4PQU A;  4M3R A;  2KZM A;  3HST B;  3VQ5 A;  1U4B A;  5FRO A;  2OPQ A;  3KLF A;  2IGI A;  1KVB A;  2RN2 A;  1WSG A;  4EP4 A;  4CHO A;  4DFK A;  3AVH A;  2HHT A;  3O4N A;  4JRP A;  2A1R A;  1BHL A;  3RMB A;  4IBN A;  4KPY A;  3ZT0 A;  1BI4 B;  2Z1H A;  1JLG A;  1WSF A;  1T8E A;  1EKE A;  3AO2 A;  1Z26 A;  4KTZ A;  3AO1 A;  1HQU A;  4BWJ A;  2FBV A;  1QS4 A;  4FLV A;  3QIP A;  1RTH A;  1KVA A;  1TKZ A;  3VA3 A;  4DS4 A;  3V9Z A;  4CJ3 A;  1T05 A;  1A5V A;  1C0U A;  2LSN A;  1HNI A;  1TKT A;  3AV9 A;  3KLG A;  3CFR A;  4N5S A;  4DTP A;  3V1O A;  1NK7 A;  1WSH A;  1WAJ A;  4Y1D A;  4WE1 A;  3NAE A;  3VQP A;  3PUF A;  2IOC A;  4DTS A;  2HVI A;  5HBM A;  3NHG A;  2ETJ A;  3DI6 A;  1LW2 A;  1NK5 A;  2ATQ A;  4J2D A;  4FZZ A;  4OKK A;  4AHU A;  4B9M A;  2PY5 A;  1LW0 A;  3V9U A;  4H8K A;  2XY7 A;  2PZS A;  1RT5 A;  4FYD A;  1JL2 A;  4IG3 A;  3VA0 A;  3V1Q A;  3LZI A;  3LDS A;  2G8H A;  4Z4I A;  1B9F A;  3G0Z A;  4FJ7 A;  1YT3 A;  1NOZ A;  4H4O A;  4CFB A;  3V4I A;  3AA2 A;  1XHX A;  4NYN A;  4CEB A;  3AVI A;  4DLE A;  3TAN A;  4F4K A;  4CF1 A;  1NOY A;  3HJF A;  4Q5V A;  4CHZ A;  3QER A;  1RBS A;  3DM2 A;  1S1W A;  2RPI A;  4BDY A;  1TK0 A;  4KTQ A;  1NJX A;  4Q0B A;  3DRP A;  1VSF A;  2GBZ A;  3VQ6 A;  3WNH A;  4KFB A;  1NJY A;  5EU7 A;  4AH9 A;  4CJE A;  3B6O A;  3NGI A;  3K58 A;  1B9D A;  1HMV A;  2HNZ A;  1S1T A;  1J9A A;  4CCH A;  4FW2 A;  1RIL A;  5CY4 A;  4DQI A;  4DTR A;  4CJ5 A;  4KI4 A;  3KD5 E;  4DTU A;  4RW8 A;  4DQQ A;  3ITH A;  4CF0 A;  3OJU A;  4CHP A;  2YNG A;  5KRT A;  1IKV A;  1HJR A;  3AA4 A;  3QEX A;  4OLA A;  2VWJ A;  4NYF A;  3O3G A;  4CFD A;  4O55 A;  4TSX A;  4RW6 A;  1ZBF A;  2X78 A;  4KRE A;  2BE2 A;  3LAL A;  3PX4 A;  4CIF A;  2R7Y A;  1RT1 A;  4Z4G A;  4J2E A;  3AA5 X;  3VN5 A;  4HCB A;  4DLG A;  2DFE A;  1JLE A;  1MU2 A;  3AVK A;  2KQ2 A;  1NJW A;  2QKK A;  1RT3 A;  3DLG A;  3MEC A;  3B6P A;  3ZSO A;  5HRS A;  2G8K A;  2BDP A;  4N76 A;  3LAM A;  3TAQ A;  1N5Y A;  4AHT A;  5DK5 A;  1IH7 A;  5J2Q A;  3SPY A;  3TAP A;  1VSH A;  3M8S A;  4FJL A;  1UA0 A;  1DTQ A;  4B08 A;  3C94 A;  4LD0 A;  3ZSX A;  3AVN A;  1IKX A;  2YHA A;  5CYM A;  4CGD A;  4DQP A;  4PWD A;  3AVB A;  3CFP A;  2XO7 A;  4DSJ A;  3VQC A;  4CJS A;  1HNV A;  4E7H A;  2KZZ A;  4ZHR A;  3U3G A;  5C25 A;  3TAM A;  3SUP A;  1W0H A;  4GVM A;  2P5O A;  4B9N A;  5HRR A;  3OS1 A;  4DFJ A;  4B3O A;  3AVA A;  2GUI A;  4C8M A;  5D3G A;  1QHT A;  3MED A;  3ISN C;  3HL8 A;  3NF9 A;  4E7J A;  1I39 A;  3KLH A;  1BIS A;  1C1B A;  4AIL C;  3QEI A;  1L3V A;  1SKS A;  1JKH A;  3TAF A;  3AO3 A;  4KV8 A;  3OYL A;  3S3O A;  1JLB A;  4M42 A;  3I8D A;  1G15 A;  2ZD1 A;  5KGX A;  2ZQB A;  3QES A;  3AVJ A;  4CK2 A;  1D8Y A;  4CHQ A;  4FM2 A;  3OS0 A;  3H08 A;  3LP1 A;  4CEO A;  4CEA A;  1VK0 A;  4FVM A;  1YTA A;  3K5N A;  3SZ2 A;  3SJJ A;  1T7P A;  4O0J A;  2OYQ A;  4FJH A;  4FW1 A;  4M3X A;  5FRN A;  3HPO A;  4DSF A;  4CIE A;  4QOZ B;  2YNI A;  3DYA A;  4DTN A;  3WNE A;  1I3A A;  3VQQ A;  4R5P A;  3SPZ A;  3CM5 A;  4Y1C A;  1NK8 A;  1U45 A;  4EZ6 A;  3V9W A;  5E41 A;  3V6D A;  1KLM A;  5JS1 A;  2P5G A;  4FJ8 A;  4ELV A;  3LPT A;  2E4L A;  5CZ2 A;  1SKW A;  1JLF A;  4F3O A;  1IKW A;  2WON A;  1XC9 A;  2XY6 A;  3CM6 A;  3SYZ A;  3QEP A;  4CJK A;  4B8C A;  4CJV A;  2G8W A;  2BAN A;  4J2B A;  5K14 A;  1SKR A;  2XY8 A;  1BCM A;  2JLE A;  3CQ8 A;  4M45 A;  3RR7 A;  3AA3 A;  3LAN A;  1RT2 A;  4ZTJ A;  2G8I A;  2VG5 A;  1UA1 A;  2ZE2 A;  3HP6 A;  2HHV A;  3SUO A;  4LSL A;  1WAF A;  3QIO A;  4KRF A;  4YNQ A;  1L3U A;  2VWK A;  3RRH A;  4E0D A;  2OPP A;  4CHY A;  1J54 A;  4KB0 A;  5HLF A;  1NKB A;  1A5X A;  3BGR A;  4JRQ A;  1U47 A;  4LSN A;  3SQ4 A;  3JYT A;  4DSK A;  3G10 A;  3U3Y A;  1BQM A;  3DLE A;  4OKJ A;  4CE9 A;  3KLE A;  3OVN A;  3TAR A;  1QSY A;  1B92 A;  2HB5 A;  5HRN A;  3K5O A;  3VQ7 A;  3EY1 A;  3OYA A;  3CYM A;  2B6A A;  1HPZ A;  1NK4 A;  3TAE A;  1JLA A;  4OGC A;  1WSJ A;  4E89 A;  3OYD A;  2Z1G A;  1VSI A;  3S9H A;  4OLB A;  1RT4 A;  4C8K A;  2D0B A;  3NH1 A;  4DWI A;  1HYZ A;  2D0A A;  3OY9 A;  3V81 A;  2DY4 A;  2FBX A;  4M3U A;  4W5N A;  4CJW A;  3S3N A;  1TV6 A;  1TKX A;  1VSM A;  1RBU A;  3NGY A;  4RG8 A;  5DMR A;  2HVH A;  3F73 A;  3SI6 A;  2RKI A;  1JLC A;  3NH2 A;  4ZTF A;  1HRH A;  2AJQ A;  1EP4 A;  1C1C A;  2VG7 A;  4H4M A;  4CJP A;  3L2Q A;  4YFU A;  4FJM A;  4B8A B;  4LH4 A;  4FJ9 A;  2B5J A;  2EHG A;  4DU4 A;  3ALY A;  4CEC A;  2G8V A;  3SQ1 A;  4OJR A;  3MAQ A;  4M3W A;  4CF2 A;  3QO9 A;  2XY5 A;  1TK5 A;  3ZSQ A;  3OS2 A;  3PO5 A;  4M3T A;  1VSE A;  3HK2 A;  1D9D A;  1SV5 A;  3QNN A;  3IRX A;  4IFY A;  4W5T A;  4NCB A;  4CF8 A;  1VSL A;  3OYH A;  2XRI A;  2Z1I A;  4FJ5 A;  3S3M A;  2X6S A;  4DQR A;  4N47 A;  4E1N A;  1X9S A;  3ZSR A;  3HM9 A;  2DTU A;  1CXU A;  1KFS A;  1BCO A;  1Q8I A;  4FLX A;  4FK4 A;  2HW3 A;  4FCY A;  4DU1 A;  3FFI A;  1D9F A;  3KTQ A;  2O4G A;  4CEE A;  1VRU A;  1QE1 A;  1FKP A;  4CFA A;  4IFV A;  1RBV A;  3DMJ A;  4O0I A;  1ZYQ A;  4KI6 A;  2Z1J A;  2YKM A;  2W42 A;  4NCA A;  1WLJ A;  1BIU A;  4KHU A;  4B9S A;  3ZCM A;  3SV3 A;  3L3U A;  4DS5 A;  3LWM A;  2NUB A;  4W5Q A;  4DQS A;  1UAX A;  5J2P A;  3TAG A;  3L2U A;  1RBR A;  3NBP A;  3RTV A;  2IC3 A;  4AHR A;  3AVF A;  4Z4C A;  5HRP A;  1KRP A;  1Q9Y A;  1QSL A;  3MEG A;  4HVJ A;  3TI0 A;  1LWE A;  1KTQ A;  1UOC A;  4DFP A;  1KSP A;  3HXM A;  2GV9 A;  1N6Q A;  4BE1 A;  4CFC A;  4RW4 A;  3MEE A;  3OYN A;  2OPR A;  3LAK A;  4NCG A;  3WNF A;  4CJT A;  3T3F A;  4C8L A;  4F2S A;  3QIN A;  2O4I A;  2D0C A;  1TGO A;  4W5O A;  3OJS A;  3IAY A;  1KVC A;  3ZSV A;  3U6F A;  3OYJ A;  3M8P A;  4E7L A;  4K8Z A;  1ASW A;  4KHY A;  4E19 A;  4FZX C;  1J53 A;  4KO0 A;  2DFH A;  5C42 A;  4I7F A;  4FJK A;  4CK3 A;  4CGI A;  3MXM A;  4CHN A;  3OYM A;  1TKD A;  3P83 D;  3DOK A;  1LAW A;  3VQE A;  4O5B A;  2OPS A;  5KI6 A;  2X74 A;  1ZBU A;  5CZ1 A;  3LZJ A;  4FJJ A;  4DMN A;  1T03 A;  4EZ9 A;  4CGH A;  4KB1 A;  4CGJ A;  4DF8 A;  4CJ4 A;  1RNH A;  2VG6 A;  3OYK A;  3K59 A;  1NKC A;  4B9L A;  3KD1 E;  1CZ9 A;  3HVT A;  3F9K A;  3QEV A;  1K6Y A;  4LY7 A;  5SWM A;  3L3V A;  3CG7 A;  4DSI A;  3PO4 A;  1KCF A;  5C24 A;  4HHT A;  2KW4 A;  3NF7 A;  4GMJ B;  2FBT A;  3ZT3 A;  4KTW A;  4W5R A;  3KK3 A;  3DLB A;  2IAJ A;  4CJQ A;  4FXD A;  3SV4 A;  1ZBL A;  4CIG A;  4K8X A;  1IKY A;  4E7I A;  3KK2 A;  3DRR A;  3PV8 A;  3IS9 A;  1S9G A;  3P5J A;  4N56 A;  5J2M A;  3NF8 A;  3M8R A;  5KGW A;  4OKE A;  1F21 A;  4ID1 A;  3VQA A;  3A2F A;  3TR8 A;  3I0S A;  4FJN A;  1BQN A;  3VQ9 A;  1L3S A;  1TAQ A;  4EP5 A;  3C6T A;  3V1R A;  3DRS A;  4CED A;  4DTX A;  1QSS A;  3HPH A;  3EYZ A;  1NJZ A;  1Z25 A;  2HHS A;  3TAB A;  2JGU A;  1RDD A;  4M3Y A;  1S6Q A;  3OYF A;  1GOB A;  3RRG A;  4B9T A;  3ZSZ A;  1S1U A;  1RT6 A;  4AHV A;  3K5L A;  2A1S A;  4UQG A;  1EET A;  4DF4 A;  1IO2 A;  3THV A;  3VQ8 A;  4O4G A;  1REV A;  4CEZ A;  5KRS A;  4CER A;  4G1Q A;  4HUF A;  2DFF A;  4N41 A;  3O4Q A;  4LH5 A;  3KK1 A;  1RDA A;  4FLW A;  2KTQ A;  2ITG A;  3ASM A;  3HP9 A;  4FLY A;  2B4J A;  1IG9 A;  1TL3 A;  4DSE A;  2G8U A;  4C8O A;  3VQB A;  3M8Q A;  2Q3S A;  3AVM A;  3NGZ A;  1XWL A;  4I9L A;  1HYS A;  2XHB A;  4CES A;  1W9H A;  2F96 A;  3T1A A;  4CK1 A;  3EZ5 A;  1NK0 A;  3PY8 A;  4FLZ A;  1TK8 A;  1L3T A;  4FK0 A;  4FK2 A;  4BWM A;  1JL1 A;  5FRM A;  1JLQ A;  4MQ3 A;  4FM1 A;  2HHQ A;  4QAG A;  4OPJ A;  2QKB A;  4CEQ A;  4DSL A;  4Z0U A;  4CGG A;  1DLO A;  2QK9 A;  1LAV A;  4QCL A;  4O44 A;  1DTT A;  1WN7 A;  4F8R A;  5I3U A;  3ZT4 A;  4BAC A;  1LV5 A;  4BDP A;  3AVG A;  1GOC A;  5HRO A;  1BGX T;  2F8S A;  4Z4E A;  1BI4 A;  3CFO A;  2P51 A;  4FM0 A;  4I2P A;  4F2R A;  5CYQ A;  3P1G A;  3QNO A;  2HHU A;  1X1P A;  3VQD A;  3E01 A;  2PYJ A;  1GOA A;  4KHW A;  3HPG A;  1CZB A;  3IG1 A;  4M41 A;  4CJF A;  4DFM A;  4CEF A;  2OZM A;  4PY5 A;  4HCC A;  2E6L A;  1Y97 A;  3UIQ A;  1ZBH A;  3SCX A;  4PA1 A;  3RWU A;  5J1E A;  1SL1 A;  1ASU A;  3KKS A;  5T7B A;  3SUQ A;  3HO1 A;  4Z4H A;  4DU3 A;  3AVC A;  4OVL A;  2Y1I A;  1RBT A;  1Q9X A;  3D0P A;  4FLT A;  1S1X A;  1VSD A;  3MXI A;  2KFZ A;  1X9W A;  1VRT A;  2E6M A;  3C6U A;  1RTI A;  1WSE A;  4I2Q A;  3V9S A;  3SQ0 A;  1XI1 A;  3NE6 A;  1U49 A;  3MXJ A;  3LP0 A;  1J5O A;  3LP2 A;  1S5J A;  1ZBI A;  2HND A;  4HUG A;  1C6V A;  1S6P A;  3K57 A;  4OGE A;  4OPK A;  3SUN A;  4B9V A;  2G8F A;  4JS5 A;  4ID5 A;  3NDK A;  4E7K A;  3QEW A;  1LWF A;  2I5J A;  3RMC A;  3ZSW A;  3KKR A;  1YVU A;  3HT3 A;  5HP1 A;  3AO4 A;  4CJR A;  3O3H A;  2FC0 A;  1S9E A;  3HYF A;  4AHC A;  3OYC A;  1BIZ A;  3DLR A;  4ICL A;  2PYL A;  1RDB A;  2FBY A;  3VQ4 A;  3PX0 A;  1NK9 A;  1U04 A;  4BE0 A;  2OA8 A;  1SL0 A;  4ELU A;  2HHX A;  1VSK A;  2BGG A;  2EX3 A;  3L8B A;  4IKF A;  3NFA A;  2HNY A;  1VSJ A;  3NF6 A;  3K5M A;  1TVR A;  3SQ2 A;  3QLH A;  4RW7 A;  4XIU A;  1SL2 A;  3OYG A;  2KFN A;  5KTQ A;  4GW6 A;  1ITG A;  4L8R B;  4FJI A;  3DLH A;  4RW9 A;  4KKO A;  3LWL A;  4KHS A;  1CXQ A;  2QXF A;  4FZY A;  1RDC A;  3D45 A;  4J2A A;  1KLN A;  3K2P A;  1YTU A;  1A5W A;  1WSI A;  1JXB A;  1SUQ A;  2D5R A;  3KJV A;  4AHS A;  3T19 A;  1NK6 A;  3BDP A;  1RTJ A;  3PX6 A;  1EX4 A;  1HQE A;  4IG0 A;  2HMI A;  2YNF A;  1LWC A;  1O1W A;  3TWH A;  3SNN A;  1RTD A;  1QTM A;  4ELT A;  4IDK A;  1WNS A;  4F3T A;  1L5U A;  4FJG A;  3C95 A;  5JS2 A;  1C0T A;  2YKN A;  3RMD A;  4KHN A;  4B9U A;  2Y1J A;  4DTO A;  4BDZ A;  1XHZ A;  2YV0 X;  3LP3 A;  3O3F A;  5J2N A;  3ZT2 A;  1U48 A;  3OYI A;  2RF2 A;  4DTJ A;  3NH0 A;  3JSM A;  3KLI A;  5SZT A;  4JS4 A;  1ASV A;  3OYE A;  5FDL A;  1X9M A;  1KFD A;  2YNH A;  1EXQ A;  3AO5 A;  3LPU A;  4E3S A;  4E1M A;  3NCI A;  5I42 A;  1FKO A;  3L2W A;  1NKE A;  4I9Q A;  4FJX A;  2IS3 A;  1RCH A;  3ULD A;  3ZT1 A;  4KHQ A;  1FXX A;  2YHB A;  3DOL A;  3HVR A;  1C0M A;  1TAU A;  1UWB A;  3RMA A;  1CLQ A;  4DTM A;  3RR8 A;  3L2V A;  2WOM A;  4CGF A;  1QQC A;  4BE2 A;  1S1V A;  1R0A A;  2HHW A;  1RT7 A;  4CJU A;  4FLU A;  2P1J A;  3AVL A;  2X6N A;  3L2R A;  4CF9 A;  2F8T A;  1C1A A;  1BL3 A;  3OYB A;  3I0R A;  3WNG A;  4JLH A;  3ZSY A;  3DLK A;  3KIO A;  1D5A A;  4MFB A;  2OZS A;  1TL1 A;  4DG1 A;  4M3Z A;  4HTU A;  3V9X A;  4KAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...