4CIGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cigA00
4AHRA 2HHTA 3ITHA 4O44A 3LZIA 1ITGA 4LD0A 3TANA 1RT1A 3ALYA 2FBYA 4CF9A 4CGDA 5HRPA 4KHQA 4KHNA 3MAQA 3NH2A 3DOLA 3AO2A 1IKXA 4RW4A 3S3NA 1BL3A 4CK2A 1GOBA 3K2PA 3C6UA 1NJWA 4B9MA 3NF9A 4I9QA 4R5PA 3PO5A 4H4MA 4M3XA 3AA2A 3MXIA 1ZBFA 2PY5A 2Z1JA 4HTUA 3HSTB 1U49A 4OVLA 2PZSA 4CIEA 1L3SA 1C1CA 1WSIA 4CESA 3OYAA 5SWMA 2IAJA 1W0HA 2XY5A 5I42A 1JKHA 1TV6A 3I8DA 3ZSXA 2Y1IA 4I2PA 3NGYA 3RWUA 1KVAA 3C94A 3NBPA 4FM1A 4F3TA 3OYCA 1J53A 1HNIA 4DTMA 5FRMA 1KVBA 4DQPA 3NAEA 1QTMA 3E01A 3V9ZA 1XHZA 1Q9XA 3VQDA 3SUQA 4DF4A 4KHSA 3S3OA 2YNHA 4CF1A 3AVJA 4RG8A 2KFZA 2DTUA 4J2AA 4OGEA 1U47A 1RT3A 3QIOA 2G8UA 3D0PA 4NYFA 2YKNA 4OKJA 1HNVA 4DLEA 3SNNA 2P5GA 2RN2A 1FKPA 1JLFA 3QIPA 4CERA 1VRUA 3OS1A 3T19A 3CFRA 5J2PA 3CYMA 4Z4HA 1T05A 3HK2A 2D0CA 1JLQA 1RT4A 2GBZA 2BDPA 2Y1JA 1YT3A 3QINA 1F21A 3OYHA 1A5XA 1TKTA 4DQIA 4ELTA 3ZSRA 2IOCA 5D3GA 2XO7A 4EP5A 4BWJA 5C25A 1YTUA 4F2SA 4DLGA 4CJUA 1XC9A 3P5JA 4W5RA 3EY1A 1B92A 3AO5A 1TL1A 3F73A 3AVIA 4HVJA 3KKSA 2GUIA 4CHZA 1NOYA 1QSYA 3OY9A 3SPYA 4LH5A 1GOAA 5KRTA 3NH0A 1K6YA 3U3YA 1NK0A 4N41A 2HVIA 1EXQA 5K14A 1SV5A 1TL3A 4F3OA 1REVA 2HHWA 1X9WA 2KFNA 1QQCA 2F8SA 4FJIA 3AVKA 3LALA 3MXJA 2HNYA 1TK8A 4B9UA 3K5OA 1KFDA 5HRSA 4FCYA 4HUGA 3ZSZA 5DK5A 4KFBA 4DMNA 3I0RA 5T7BA 3TAGA 3HL8A 1BIUA 1D5AA 4H8KA 4CGFA 4E7KA 4DTUA 1JLBA 4C8MA 3HVTA 1DLOA 3DLKA 4GVMA 4CEFA 2BGGA 1BQNA 1U04A 2O4IA 4DF8A 4FLVA 2KTQA 3RMBA 2P1JA 2QXFA 3UIQA 4M41A 4M42A 3P83D 3U3GA 1X1PA 4DG1A 1Y97A 1DTQA 4E3SA 3EZ5A 4DU1A 2Z1GA 3MEDA 3FFIA 3VQQA 4NCBA 4KI4A 3AV9A 1GOCA 4WE1A 2HNDA 3AVGA 4FK0A 3RTVA 4J2BA 3KKRA 1HYSA 4DFMA 1JXEA 4F8RA 2XRIA 2ZQBA 2BANA 3OYEA 4Z4GA 4NCAA 3V9SA 4DTXA 3LWMA 1KSPA 4DQSA 2B4JA 4JRPA 3OVNA 4CFCA 3TR8A 1RBSA 3VQ6A 2ZE2A 3NFAA 3DLHA 4BDZA 3AVHA 1NK9A 1KCFA 3SUPA 4PUOA 1SL0A 1YVUA 1IG9A 4CFDA 4OPKA 2BE2A 4CK3A 3VA0A 4CE9A 2X6SA 4E1NA 5HRRA 1D9DA 1JLAA 1WSFA 3K5LA 3SV4A 4CEAA 2XHBA 3WNHA 4HCBA 3RMAA 2YV0X 4RW9A 3QESA 3CQ8A 1L5UA 1QHTA 2G8HA 1NKBA 3D45A 3OYDA 4E7IA 3HP9A 4FJLA 3OJUA 3HPGA 4AHTA 3RRGA 4DS4A 3QO9A 1RCHA 3K5NA 3QEIA 4DTJA 1VSDA 3SQ4A 4F2RA 2HHSA 1BCMA 3AA4A 1ASVA 3IG1A 4CFBA 4O0IA 3LAMA 3LAKA 3K58A 4CJWA 4BE2A 4BE0A 3DYAA 3L2VA 4FLXA 3HPHA 1RT2A 3ZT2A 2ZD1A 4B9TA 1C6VA 3L3VA 4CEOA 5SZTA 3CM5A 1WSJA 4CJKA 3OYIA 3KD1E 1ASWA 1Z26A 4CEEA 1T7PA 1J54A 3M8QA 4CGGA 1ZBLA 4C8KA 2HMIA 3F9KA 3CG7A 4IFVA 1R0AA 4BDYA 3NE6A 4F4KA 2VG7A 3VQEA 3TAFA 3HPOA 4CGJA 1BHLA 3P1GA 3KLHA 1RBVA 3QNNA 4FJ7A 1EX4A 2YKMA 2IS3A 3MEEA 5JS1A 4CHQA 3NHGA 1S9GA 1NK5A 1UAXA 1WSHA 3ZCMA 5HLFA 4L8RB 2JGUA 2ITGA 4IKFA 3M8RA 4HUFA 1NKCA 2AJQA 3L2QA 1BCOA 1LWFA 3MEGA 3HO1A 4FJ5A 4XIUA 3ZT3A 2KQ2A 1UA1A 4FXDA 1TK0A 4M3ZA 1VK0A 4ELVA 1JL1A 3ZT4A 1ZYQA 4CJQA 1D9FA 1LW2A 2A1SA 1KLNA 4M3WA 3NF8A 2W42A 3LP2A 3OYFA 3L2UA 4FJXA 3V1OA 2B5JA 4FLTA 4NCGA 1RBUA 3VN5A 3NF7A 3U6FA 3BDPA 4ZTJA 4FM0A 1UWBA 4LSNA 2OPSA 4CJSA 3PX6A 1Z25A 5KTQA 1SKRA 4KHYA 3DLEA 1RT5A 5KRSA 3DMJA 3ZSWA 1RBRA 1S1TA 3T3FA 1U48A 3ASMA 1WAJA 4DSLA 4OGCA 2KZZA 4ZHRA 1JLGA 3V9WA 1BGXT 3LP0A 4GW6A 3LP1A 4KB0A 3JSMA 4FJJA 1RTJA 4H4OA 3MECA 3C95A 3ZT0A 2OZSA 1BQMA 2O4GA 4GMJB 4DSFA 4CCHA 4KRFA 1CXUA 1IH7A 1NK4A 1JXBA 1S1UA 1JLEA 2GV9A 3NGZA 3THVA 1G15A 1C1AA 3DLGA 3DLRA 1BISA 1RILA 1KTQA 4KTWA 3CFPA 3V6DA 3SQ2A 2HHUA 1FKOA 4CIGA 3ZT1A 1J5OA 1CZBA 4CECA 4N76A 1TVRA 2F8TA 2A1RA 2QKBA 4HUEA 4FZXC 2B6AA 4CJFA 1LWEA 3OS0A 3DLBA 4J2DA 3VQ8A 1SL2A 2Q3SA 3OYLA 4W5TA 3OS2A 1YTAA 3AA3A 1W9HA 1WSEA 3QLHA 4E1MA 3HP6A 1VSIA 1IKYA 2DFEA 4M45A 1B9FA 1TGOA 4CJ4A 4CGHA 5E41A 2WOMA 3ULDA 3TARA 4BE1A 4PWDA 1NKEA 4E19A 4QAGA 1XI1A 1CZ9A 4OLAA 3V4IA 4FK4A 1FXXA 2G8KA 4AHSA 4FJ8A 4K8XA 4E7HA 4C8LA 3CFOA 4PQUA 5FRNA 3VQPA 1RTDA 4FW2A 4AH9A 4LY7A 4M3UA 1EP4A 4DFPA 2KW4A 2DFHA 1I39A 3TABA 4B9SA 3TI0A 2IDOA 3L3UA 3SJJA 2D0BA 4CEBA 4NYNA 4RW6A 3RRHA 4K8ZA 1KVCA 4PY5A 3LDSA 4FVMA 2OA8A 3V1RA 3NF6A 3M8SA 2HHXA 1S6QA 4IG0A 4DSEA 2I5JA 3M8PA 3CM6A 2ETJA 4N5SA 4HHTA 3RR7A 4BWMA 4G1QA 3JYTA 4DU4A 2YNGA 4FJGA 3DM2A 3HVRA 4CF0A 4FLZA 3ZSVA 3PY8A 3O3HA 5I3UA 3V9XA 4Z4EA 3BGRA 3T1AA 4DTSA 3SYZA 1NJZA 2VWJA 4CHPA 5HROA 3NCIA 1RNHA 4AILC 1C0UA 1RDDA 1N5YA 4KO0A 3O4NA 4DU3A 3DI6A 4BDPA 3IAYA 4CJ3A 3LZJA 4DSJA 4Y1CA 4DFJA 1NK7A 4OLBA 4DS5A 4QOZB 3IS9A 2RF2A 2OPPA 1QE1A 4KHWA 1C0TA 2G8VA 3NH1A 1HRHA 3PX0A 4CEZA 2JLEA 3DRSA 4CIFA 4Z4CA 3OJSA 4CJPA 1KFSA 4B9NA 4M3TA 3SCXA 3TAQA 4FK2A 1UA0A 4I7FA 2G8IA 3DOKA 4W5OA 1VSJA 3TAMA 2QKKA 1RT6A 4CJTA 3QERA 4KV8A 5C24A 4TSXA 4CHYA 4N47A 3KLFA 2FC0A 4AHUA 1IKVA 3LWLA 3HM9A 3VQAA 3HXMA 4JS4A 4E7JA 4LSLA 1T8EA 2OYQA 4ELUA 4FJHA 1I3AA 1NK6A 4Q0BA 3VQ5A 2IC3A 2WONA 3DRRA 5CYMA 2OPQA 4FLUA 1SKSA 1T03A 1NJXA 4FJKA 4CF8A 5CY4A 3KK3A 1HMVA 4CJEA 1U4BA 4C8OA 3S3MA 1LAVA 3G10A 3VQ9A 3KK1A 1RBTA 3NGIA 3KTQA 4B8AB 1X9MA 4JRQA 1A5WA 4LH4A 4CHNA 4FZYA 1D8YA 2P5OA 1TAUA 1RDCA 4CEDA 2HHVA 4EZ9A 4N56A 4PA1A 3B6OA 4OKEA 3ZSQA 4FLYA 3AVAA 3AO1A 4CK1A 3QEWA 1VSEA 1L3VA 4M3YA 2FBXA 3OYMA 3H08A 1LAWA 1RTIA 3QETA 1S1XA 3WNFA 4DWIA 2F96A 3IRXA 4W5QA 4CHOA 4E0DA 1WLJA 3TAPA 3O3GA 2YNFA 2HB5A 2YNIA 3VQ7A 3QEPA 4Z4FA 5FROA 1QSSA 2EX3A 1BI4B 1A5VA 3KLEA 3SUNA 2RKIA 4I2QA 2YHAA 4IBNA 2FBTA 3O3FA 2ATQA 3RMDA 4W5NA 3PV8A 3SI6A 3ZSYA 4KHUA 3KJVA 2VG6A 1VSHA 4ID1A 4YNQA 4RW7A 1ZBUA 4UQGA 4KI6A 3AO4A 4FW1A 4O4GA 1HQUA 5CYQA 3L8BA 4DQRA 2E6MA 3AA5X 4DFKA 1RTHA 2E6LA 3QEXA 4KPYA 1LW0A 3AVBA 1TK5A 1HQEA 1L3TA 3C6TA 3O4QA 4FM2A 3HT3A 3K5MA 4IFYA 1HJRA 4EP4A 4DTOA 4B3OA 4FJ9A 4Q5VA 1XWLA 1FK9A 1HYVA 4KTQA 1ZBHA 1Q9YA 1S6PA 3LANA 5JS2A 3OYJA 1KRPA 3OYGA 3B6PA 4MQ3A 3WNGA 2R7YA 4DTNA 3KK2A 1EETA 3HYFA 4OJRA 2VWKA 1TAQA 4IDKA 4B08A 3PO4A 3K57A 3LPUA 3QNOA 4BACA 3QEVA 4CJVA 1O1WA 4E7LA 1MU2A 2RPIA 3V1QA 3VA3A 4AHVA 4B8CA 4KAZA 4OKKA 3SQ1A 4CJRA 1ZBIA 2D0AA 3RR8A 3VQCA 4JLHA 4FYDA 3SUOA 1HYZA 4KTZA 1S1WA 1BI4A 3VQBA 5J2MA 1XHXA 3V81A 4Z4IA 3TWHA 3KLIA 1QSLA 2HW3A 3OYKA 3L2RA 4CEQA 3K59A 4OPJA 1HPZA 2Z1HA 1C1BA 5J2QA 2XY6A 1B9DA 3AVCA 3WNEA 2G8WA 3L2WA 4ZTFA 4FZZA 1KLMA 5J2NA 1LWCA 2E4LA 2EHGA 3ZSOA 1NK8A 2PYLA 4HCCA 4B9VA 3ISNC 1WN7A 3EYZA 2KZMA 3AVFA 1L3UA 1SL1A 2Z1IA 4YFUA 4IG3A 4FJNA 4E89A 1BIZA 3RMCA 2NUBA 2VG5A 1DTTA 3AVMA 4DTRA 1RT7A 2X6NA 5HBMA 4B9LA 4EZ6A 5HRNA 2XY8A 1WNSA 4QCLA 5EU7A 1CXQA 2D5RA 3AVLA 4KKOA 4DTPA 3AVNA 4CGIA 4ICLA 3KLGA 4ID5A 1VSKA 3NDKA 2P51A 3V9UA 3PX4A 3S9HA 3HJFA 2IGIA 5C42A 5HP1A 1QS4A 1S5JA 4Y1DA 1U45A 1CLQA 2X78A 1VRTA 1RDBA 1EKEA 1VSLA 2G8FA 1VSFA 3KD5E 4AHCA 2YHBA 3DRPA 1TKDA 4J2EA 1LV5A 3SZ2A 5CZ2A 5DMRA 4KREA 4RW8A 1C0MA 1RDAA 1JLCA 3LP3A 1ASUA 2HNZA 4FLWA 4CJ5A 4DSKA 5FDLA 5KGWA 1N6QA 3I0SA 1NOZA 3SPZA 2X74A 2LSNA 1NJYA 2PYJA 1TKXA 4JS5A 2DFFA 2HVHA 2OPRA 1S9EA 4CFAA 3OYBA 5KI6A 4MFBA 1SUQA 3SQ0A 3LPTA 3MXMA 1S1VA 5CZ1A 4FJMA 3OYNA 1WSGA 4CJLA 3TAEA 3VQ4A 1IO2A 1X9SA 1TKZA 3KIOA 5KGXA 4KB1A 4I9LA 1WAFA 3PUFA 1J9AA 4DSIA 2FBVA 5J1EA 2DY4A 1UOCA 4Z0UA 4CF2A 4DQQA 2XY7A 4C8NA 1Q8IA 4M3RA 2QK9A 2OZMA 4O5BA 1VSMA 1SKWA 4O0JA 3A2FA 1IKWA 1JL2A 3AO3A 4O55A 3SV3A 2HHQA 3G0ZA
chains in the Genus database with same CATH superfamily
1JCFA 4CZHA 1C0GA 4LD0A 3BZCA 1BA0A 2FBYA 3THWA 4RW4A 1ZXOA 3S3NA 3H3NO 3SAGA 4PKIA 4CK2A 5GAEP 4R5PA 4M3XA 1ZBFA 4OVLA 4CIEA 1L3SA 3CCLN 5SWMA 3IKMA 2IAJA 2XY5A 3PIPL 4A59A 3ZSXA 5DM6L 1ATSA 3NBPA 4F3TA 3CCVN 3EKSA 2QW9A 3D6RA 4A57A 1KVBA 3NAEA 1QTMA 5TKWA 4X65K 1Q9XA 3H6EA 3E1YA 3SUQA 2YNHA 2DTUA 3QIOA 3D0PA 4NYFA 4DV2K 2HBJA 4QS8A 3ENHA 5AQPA 3SNNA 2P5GA 3DWLA 3CFRA 3T19A 3HK2A 2RE2A 2HBLA 3HOTA 4QS7A 4DQIA 3ZSRA 1QQMA 4GY2B 5C25A 1TUYA 3O5BA 4BR7A 2BH1A 1XC9A 5C12A 4W5RA 1O13A 4BR2A 5DM7L 3OHRA 3G6EN 4CHZA 4B3RK 3CCJN 3SPYA 3U3YA 5LMNK 1NK0A 1NGIA 4H0PA 1RGIA 4BRGA 1TL3A 2P9IB 3TSPA 2KFNA 3LALA 3MXJA 2HNYA 3O1BA 4DR7K 4LC9B 3H1QA 1GLEG 4GKKK 4KFBA 4DMNA 3I0RA 5AZJB 4E7KA 4DTUA 1JLBA 4JKHA 3A0IX 3DLKA 4GVMA 3E9OA 1BQNA 1Z6RA 4DF8A 2KTQA 2GWJA 4JKGA 2HOEA 1X1PA 4DG1A 1MDUB 2Z1GA 3CPWM 4NCBA 1U2VA 4WE1A 2HNDA 2VQFK 4FK0A 4GNIA 3HOSA 4WFNL 1HYSA 4YOYA 1VQLN 2XRIA 3OYEA 4XEIA 3J80O 3LWMA 4CZKA 4K25A 4JRPA 4CFCA 3NFAA 3DLHA 1NK9A 4PUOA 1KCFA 4DR1K 4UY8O 4E1NA 3OBYA 1JLAA 1WSFA 2Q1NA 2YV0X 1ZC6A 4RW9A 3GOIA 1L5UA 3U4LA 2G8HA 1NKBA 2H3GX 3OYDA 4BGAA 4E7IA 3O08A 1YITN 4AHTA 3QFPA 3QO9A 3NMUA 2HHSA 3SQ4A 4F2RA 4O0IA 3LAKA 4A5BA 3BP8A 1XMOK 4FLXA 5MLCQ 5GAGP 3ZT2A 2ZD1A 1HR0K 3CM5A 3CCUN 4JN4A 4JAXA 3CG7A 1R0AA 3NE6A 2VG7A 3D2EB 3VQEA 3TAFA 3HPOA 1YAGA 4BC4A 3Q7CA 1BHLA 3P1GA 1P8ZA 3DLLL 1NK5A 1OVYA 4L8RB 1E4GT 2JGUA 4H0TB 5FPNA 1NKCA 2AJQA 3HO1A 3P38A 4X64K 4CJQA 4M3WA 2YHXA 2DPNA 2YX6A 4R79A 3QFUA 5HOOA 4ZTJA 4CJSA 3CCRN 3PX6A 4GV6A 2QWMA 1RT5A 3T3FA 3KWIA 1RBRA 3ASMA 3AY9A 4DSLA 4OGCA 5AQKA 1BGXT 4KB0A 3MX5A 3JSMA 1EO1A 3C7NA 1E4FT 3ZT0A 5A2QO 4GMJB 4KRFA 1CXUA 1JXBA 2GV9A 1VQKN 5BREA 5BPLA 1G15A 3THVA 4H5NA 1C1AA 3DLGA 4DUYK 3J81O 1FKOA 1CZBA 4HUEA 5AQXA 2B6AA 3OS0A 3OYLA 3OS2A 1YTAA 4E1MA 4LF5K 1VSIA 1IKYA 3O9QA 4FWOA 2P9IA 1TUUA 2WBNA 4BE1A 4BRPA 4PL7A 4OLAA 3NVMA 4EHUA 2QWLA 4E7HA 5FRNA 5C2DA 4G9ZA 4AH9A 4M3UA 3F5TA 1TYQB 2DFHA 3TABA 4B9SA 5AQVA 1RDWX 2IDOA 4CEBA 4RW6A 4K8ZA 4JI7K 2HHXA 5JLHA 4N5SA 2P9SA 5EVZA 2YNGA 1KQSM 3WUHA 3ZSVA 4RWTA 3O3HA 2PBDA 1YUWA 3BGRA 3DXMB 3SYZA 1NJZA 5HROA 3NCIA 2OANA 5TKYA 2F4VK 3O4NA 4DV3K 4BDPA 4DFJA 1NK7A 4DS5A 2OPPA 1QE1A 3GE1A 3CJBA 5AJ3K 2Q97A 2JLEA 4CIFA 3OJSA 3ENBA 4IOXA 2E20A 4CJPA 3QB0A 3TAQA 1ATNA 2G8IA 2RHKA 1RT6A 4KV8A 4X62K 3HM9A 3KLFA 3LL3A 4E7JA 3LWLA 3THWB 4Q0BA 1NGGA 1I3AA 4BROA 3DRRA 5CYMA 4KH4A 3VESA 5AQIA 4X66K 4FLUA 4FJKA 1HMVA 1U4BA 1LAVA 2HHHK 3KTQA 2GWKA 3T1YK 3UKUB 2P9SB 1RDCA 4CEDA 3UB5A 3QICA 3HI0A 3Q7BA 4HTLA 4OKEA 3ZSQA 5CE3A 3CC7N 4FLYA 4M3YA 3VEWA 3QETA 1ILYA 4JI1K 3D2FA 3D7EO 4M63C 2HB5A 3QEPA 4Z4FA 4LF6K 2O8DB 4JI2K 4CW7B 1E3MA 2NRWA 2WTUA 3SI6A 3O80A 4KHUA 1VSHA 4YNQA 4UQGA 3AO4A 3L8BA 2A40A 2E2PA 2E6MA 1RTHA 3AA5X 2E6LA 4BG9A 1K8KA 2FSJA 4FM2A 3THXB 5BRFA 4EP4A 1HJRA 4B3OA 1HYVA 4KTQA 1ZBHA 2QWQA 1S6PA 2NRVA 3BZKA 5AQTA 3OYJA 4WQ4C 3THXA 5C2FA 3WNGA 2R7YA 3HYFA 4OO1J 3ULEA 4IDKA 3PO4A 1IBMK 4OPAA 1ZBIA 3VQCA 3UKRA 4IO9L 3SUOA 4KTZA 3VQBA 5J2MA 3V81A 4Z4IA 4FVUA 5KQ8A 3CF5L 3AVCA 3L2WA 4FZZA 5GIPA 1OH8A 1NMNA 2O8CB 2E4LA 3ZSOA 1NK8A 3THYB 4B9VA 1YF5L 3AVFA 4BG8A 2OCEA 5BPNA 2VCPA 1J6ZA 4JV5K 4BR9A 3EE8A 2VG5A 1DTTA 1RT7A 2X6NA 5HBMA 4B9LA 4EZ6A 5HRNA 1BDGA 2P9PB 4QCLA 5EU7A 3KLGA 4ILGB 3G71N 3V9UA 3HJFA 2P51A 5C42A 2F9TA 1S5JA 4EAHD 1MWKA 5JICA 1VSFA 3LDNA 4AHCA 2YHBA 4KREA 5CZ2A 1C0MA 1ASUA 2HNZA 4ISGA 2YJFA 4DSKA 2O8EA 5FDLA 1NOZA 1OH5A 2CGLA 2DFFA 2OPRA 1WBDA 4CFAA 3HRGA 3KVGA 1SUQA 3NVKA 1XMQK 4FJMA 3OYNA 1WSGA 3TAEA 4DR3K 4BREA 1Z05A 3MN5A 4GKJK 3KIOA 5KGXA 4I9LA 1WAFA 3CCSN 5J1EA 2XY7A 4C8NA 1K73O 2CGJA 2P9NA 2OZMA 1VSMA 4O0JA 4O55A 3LZIA 4O44A 1ITGA 1RT1A 4CGDA 3NH2A 3EO3A 3WEEB 4U67L 1Q7YO 1BL3A 4I9QA 3CJ9A 2OTLN 4H4MA 1U49A 2ZJPL 4CZIA 2D0OA 3VGLA 1P90A 5I42A 1TV6A 1HX1A 3I8DA 3FR0A 3QMLA 4I2PA 3NGYA 3H3OB 3C94A 4YDUA 3TTCA 2GEMA 1HNIA 2A6AA 4BR0A 2IIRA 3V9ZA 3VQDA 3S3OA 3AVJA 4FWKA 4J2AA 4JK7A 2YKNA 2RN2A 3N4PA 1DT9A 4CERA 2FSKA 1M90O 1T05A 2D0CA 2BDPA 1RT4A 3QINA 1F21A 2QWPA 2IOCA 4EP5A 4BWJA 3J7AP 1BU6O 1YTUA 4GV3A 4CJUA 3EE9A 3P5JA 3CJ7A 1B92A 3C65A 1TL1A 3WQUA 3F73A 4HVJA 5KRTA 3AARA 4XH1A 4FOEA 4NLBA 1SV5A 3LM9A 1YJ9N 1QQCA 2F8SA 3QDKA 5LL6Z 3KZBA 1KFDA 1JJ2M 5AQQA 4M7XA 5DK5A 4YOWA 3ZX2A 4H8KA 4CBXA 2BGGA 2O4IA 1U04A 3I56N 3CERA 3K9KA 4M41A 3GL1A 1HUXA 1Y97A 3EZ5A 4DU1A 3MEDA 3FFIA 4KI4A 1GOCA 1NBWA 3AV9A 4JI4K 3D2EA 4LFBK 2GELA 3GG4A 4J2BA 4ILHA 3MK6A 1R59O 1JXEA 4F8RA 2BANA 2ZJRL 3J7YP 4DTXA 1KSPA 4DQSA 3OVNA 3VQ6A 4FWRA 3AVHA 1IG9A 4ILJA 5M1KA 5AQUA 4JKDA 4CE9A 2X6SA 3K5LA 2P9LA 3WNHA 4HCBA 4BC2A 4NO7A 3AAPA 4MLHA 4FWQA 3ID8A 4H03B 3RRGA 3CMAN 1RCHA 2P9KA 1VSDA 4DTJA 1ASVA 3IG1A 1BO5O 3RMCA 3SMSA 4DKWA 3DYAA 3L2VA 1MA9B 3HPHA 4L3QA 3L3VA 3U8XA 1WSJA 3KD1E 5IT9O 4CEEA 4C1NI 4C8KA 1J54A 3M8QA 4CGGA 5BR9A 4WFAL 3F9KA 5ADXA 4BDYA 3R8EA 1RBVA 4FJ7A 2YKMA 4CD3A 3MEEA 2VYPA 3CJCA 3NHGA 1UAXA 3ZCMA 4K41A 2FSNA 2HF3A 3CMEN 4IOAL 5AZJA 4JKGB 1BCOA 3PLAA 1LWFA 4XIUA 4RCHA 1FW6A 4ELVA 3ZT4A 1ZYQA 2NRRA 4IXCA 1KLNA 1GLBG 5FPEA 3NF8A 4YHHK 3SLCA 4JHDB 3OYFA 3L2UA 3R1XA 1K8KB 3FZFA 3FGUA 3NF7A 3MDQA 4Y0WA 2V52B 4FM0A 3T69A 1UWBA 4LSNA 2OPSA 2UXCK 1NGDA 4OPHA 4KHYA 4BVPA 4BQLA 1T6CA 3V9WA 1NGBA 3LP1A 3ULEB 1Y64A 3RSEA 4H4OA 1I94K 1BQMA 2O4GA 4JHDA 2CH5A 1NK4A 1JLEA 1HKBA 3R9PA 3NGZA 2HHUA 1BISA 1RILA 3DLRA 3JS6A 3A5LC 3ZT1A 4CECA 2QKBA 1TVRA 4FZXC 4CJFA 3R3LA 3VQ8A 3VTIA 2Q3SA 4XH5A 3QLHA 1NM1A 3LM2A 4CGHA 3TARA 3VETA 5AQWA 3VTHA 2G8KA 4FJ8A 4A2AA 3CIPA 3KK7A 1RTDA 4FW2A 4LY7A 3BUZB 4DFPA 4PKGA 3EL2A 1I39A 3L3UA 5B8HA 2D0BA 4NYNA 4DUZK 3V1RA 3NF6A 3M8SA 4IG0A 4BRAA 4BRQA 4FLZA 3PY8A 3C6HA 1BA1A 5JMVA 2VWJA 4CHPA 1RNHA 4WF9L 4DU3A 5AQZA 4CZEA 4QS9A 4Y1CA 4AF1A 4OLBA 4QOZB 2RF2A 4KHWA 5C0YA 1C0TA 4FWLA 4Z4CA 1KFSA 4B9NA 1S22A 4YOXA 3SCXA 4M3TA 4EFHA 3UKRB 3SAFA 4W5OA 3U9DA 4Z94A 1VSJA 2O8BA 4TSXA 4N47A 3HXMA 4JS4A 4ELUA 4LSLA 1T8EA 2OYQA 2W6KA 2IC3A 2WONA 1GLAG 1T03A 2KKZA 5CY4A 3IMXA 4CJEA 1IV0A 3S3MA 1WB9A 3VQ9A 3KK1A 4B8AB 4JD2B 3A5MC 4JRQA 1X9MA 4CHNA 4FZYA 4OX9K 3SJHA 3H46O 2HHVA 4EZ9A 3B6OA 4MLEA 4B1WB 1L3VA 4NB4A 4JK8A 3H08A 1RTIA 2QXLA 1Q86O 4DCHA 4DWIA 4JI3K 4CHOA 4E0DA 3TAPA 2YNIA 2EX3A 3KLEA 3SUNA 2WUSA 2J4RA 2Q0RA 5EX5A 4CZGA 2YHAA 4IBNA 4WYBA 3ZSYA 3KJVA 4ID1A 4NLCA 2E2OA 3T7ZA 3QEXA 3C6TA 4O8UA 2W6LA 3PSIA 3A5NC 5AQNA 4KHPK 3SBTA 3OYGA 2QWNA 3KK2A 1EETA 1GLFO 2VWKA 1TAQA 5JLFA 3K57A 3LPUA 3QNOA 4BRIA 5ADXH 1N33K 3V1QA 4AHVA 4CZFA 4CJRA 1YVNA 2D0AA 2E88A 3EZWA 2Q2RA 3J8AA 2E2QA 3TTDA 3L2RA 3K59A 4OPJA 2Z1HA 4FWMA 4ZTFA 3ZYYX 1KLMA 1FJGK 4H0YB 5J2NA 3MMVA 4BR4A 3IFRA 2KZMA 1L3UA 4A5AA 4DR6K 4YFUA 4IG3A 4FJNA 1IBLK 5F2RA 2OTJN 2ZGZA 4B1UB 4DTRA 4PHTX 3QBXA 3WXIA 2XY8A 5BN8A 1WNSA 4DTPA 3NDKA 3S9HA 1VSKA 5M1NA 5GADP 1U45A 2X78A 4IJNA 1EKEA 2G8FA 1QQOA 3DRPA 4J2EA 1LV5A 3A8YA 5DMRA 4RW8A 2QWOA 5LMUK 4YOTA 5KGWA 3QBWA 1N6QA 3I0SA 1NJYA 1TKXA 3O9UA 1VQ5N 4JI0K 4ISEA 5AQYA 1S1VA 4IFEA 1KXPA 3VQ4A 3OW2M 4KB1A 2ASOA 3PUFA 4GVEA 4IEIA 2V7ZA 2FBVA 2DY4A 3CPEA 4CF2A 3MN9A 4DQQA 2QK9A 4CVNE 3VGMA 1IKWA 4CZLA 4BR5A 2NLXA 3HM8A 3MCAB 4JKEA 3SV3A 4AHRA 4C1NK 2HHTA 3ITHA 4YY3K 3ALYA 5AR0A 3DOLA 3AO2A 1IKXA 5HL7L 1GOBA 3K2PA 3C6UA 5LJWA 1GLCG 2KHOA 3NF9A 2VQEK 1N8RO 1U2VB 2PY5A 4HTUA 3L0QA 2PZSA 4CJ7A 3HBTA 1WSIA 4CESA 3OYAA 3MWPA 1JKHA 4IJAA 3FZLA 3RWUA 1KVAA 3OYCA 4DTMA 1H1VA 4DQPA 4IEEA 3ZLJA 4DB3A 3DXKA 3E01A 3F9MA 1YIJN 4E1JA 3FLCO 4DR5K 4DF4A 4KHSA 3CETA 4OGEA 2P9NB 5IWAK 1U47A 2G8UA 4OKJA 4CBUA 1HNVA 5J2PA 3QIPA 1VQ9N 1VRUA 1KAZA 3CYMA 2YHYA 2IVPA 4Z4HA 1JLQA 4CZJA 2Y1JA 2ZWHA 3OYHA 1A5XA 2PAVA 3J7ZO 1QHAA 1TKTA 2VGNA 4ELTA 2XO7A 4DR2K 4DLGA 3AVIA 1NOYA 3OY9A 4KBOA 4AM6A 4LH5A 4N41A 3NH0A 4A2BA 3LDQA 1EXQA 4MDBA 4H0OA 1OVQA 4F3OA 1REVA 4IDHA 2HHWA 4F9OA 3AVKA 4H0XB 3K5OA 3K9JA 5HRSA 1JCEA 4HUGA 3DAWA 4FCYA 4JI8K 1ESVA 5T7BA 3MN7A 3EN9A 4IOCL 4AM7A 3KHYA 4CEFA 4A62A 3U9ZA 2P1JA 3P31A 3RMBA 5E84A 3UIQA 4LFCK 1RDUA 1DTQA 2O8EB 3VQQA 2QI2A 1Q18A 3AVGA 3VEZA 5EXWA 5E26A 4DFMA 3O9RA 4Z4GA 4NCAA 3CCMN 5AQLA 3VEVA 1DEJA 2ASPA 3TR8A 1RBSA 3F2KA 1HKGA 1SL0A 1YVUA 5AZIB 4CFDA 4OPKA 3VA0A 2IVOA 5CHIA 2V51B 1D9DA 3JXUA 4CEAA 3RMAA 3QESA 3THYA 3CQ8A 3D45A 2UUBK 3WXLA 3HP9A 3E66A 3H1VX 5FLXO 3SMPA 3K5NA 3QEIA 4DR4K 5M1OA 4O8KA 3SK3A 4CFBA 3K58A 4BE2A 4CJWA 3MN6A 2GX9A 2QA4N 4H5VA 1RT2A 4B9TA 4KH5A 4CEOA 4CJKA 2BTFA 1ASWA 5KPRA 3WXKA 2HMIA 1KAYA 2ASMA 4IFVA 3TSQA 5I9EB 2NRXA 1EX4A 1NNEA 2IS3A 1ATRA 4H5WA 5JS1A 4CHQA 1S9GA 1WSHA 3WXJA 2ITGA 4IKFA 5AFUH 3M8RA 4HUFA 3L2QA 1LOTB 2P9UB 3BF1A 3OA9A 2KQ2A 3ZT3A 4HWIA 4WCEL 1UA1A 2QTDA 1TK0A 4M3ZA 4FXDA 1D9FA 2HBMA 3DJCA 5F0XA 4FJXA 4BRFA 3V1OA 4FLTA 3VN5A 3U6FA 3BDPA 2NZTA 1T6DA 5KTQA 1SKRA 2ZM6K 5KRSA 3DMJA 3ZSWA 1S1TA 2KZZA 3HZ6A 4WFBL 4GW6A 1RTJA 3MECA 4DSFA 2IVNA 3L4IA 3TPQA 4WQ5A 2ZF5O 3CFPA 3V6DA 4KTWA 3O8MA 3O4WA 1W7AA 1J5OA 5FPMA 2D4WA 4N76A 2F8TA 4JKAA 3DLBA 4J2DA 3K0SA 3PSFA 4LF8K 1M1KO 4YOUA 1W9HA 1WSEA 4M45A 1B9FA 4CJ4A 3ULDA 5H1SQ 2WOMA 4DV5K 4JK9A 4PWDA 1SZ2A 4E19A 4QAGA 1XI1A 1CZ9A 4BRDA 3V4IA 4FK4A 1CZAN 1FXXA 3KWGA 3ZEUB 4H5RA 2A3ZA 2A41A 4V19S 2UYTA 1GLDG 1EP4A 2KW4A 1U6ZA 4PL8A 4DQ8A 3VPZA 4FWNA 3TI0A 3SJJA 4PY5A 4FVMA 4B1XB 5BPMA 1S72N 1HNZK 4XH4A 4DSEA 2I5JA 3M8PA 3VGKA 3RR7A 3N4QA 3JYTA 4DU4A 1VQ6N 1IJJA 3DM2A 4JNEA 2NRHA 3DXKB 3HVRA 5I3UA 1NWKA 3T1AA 4DTSA 4C23A 1N5YA 4KO0A 3DI6A 1VQON 2A5XA 3HSCA 1XQSC 2G8VA 3SBGA 3C6AA 3PX0A 3L6QA 4CEZA 1VQMN 2QWRA 3DRSA 3C7NB 3E9LA 2FF3B 1KAXA 3CJAA 3E9PA 3CXCM 4FK2A 2VGMA 3GDQA 3C0BA 4I7FA 5C10A 3DOKA 3LDLA 3TAMA 2I7PA 4CJTA 3QERA 4CI6A 4CHYA 4AHUA 1IKVA 2QKKA 3VQAA 2F7TA 4EHTA 2OPQA 1QZ5A 3KK3A 4C8OA 1YJNN 1BWFO 3NGIA 1RBTA 3CCEN 2P5OA 1NGJA 1TAUA 1BOTO 3QEWA 1VSEA 5GAHP 2JWKA 2FBXA 1QZ6A 2F96A 3IRXA 1VQNN 5FROA 1BI4B 3I33A 4I2QA 3ZEUA 2NRZA 2FBTA 3O3FA 3G25A 3PV8A 2BUPA 1ZBUA 2GUPA 4KI6A 4O4GA 3WEEA 5CYQA 4DQRA 4KPYA 3O9SA 2W41A 3AVBA 3W0LA 3O4QA 3HT3A 3K5MA 4IFYA 4FJ9A 1Q9YA 1DGKN 1YJWN 3LANA 5JS2A 1YI2N 3B6PA 1X3NA 4MQ3A 4B3MK 3OTOK 3W3DA 4DTNA 1N34K 4OJRA 3TTFA 4K43A 3M3ZA 4B08A 3QEVA 5M1QA 1WOQA 3CJ1A 1X9JA 1NJIO 3VA3A 5AQRA 4OKKA 3SQ1A 3RR8A 4FSVA 4JLHA 1BUPA 4FYDA 1N32K 5JVHL 1S1WA 1BI4A 2W40A 3TWHA 3KLIA 2O8FA 1QSLA 2CH6A 3OYKA 1SS6A 3TU5A 3BEXA 5J2QA 1C1BA 2XY6A 2G8WA 5CR4A 1QQNA 1DKGD 4I6MB 1HNXK 5M1PA 3CC4N 4HCCA 3ISNC 3EYZA 1SL1A 2Z1IA 1YHQN 2P9UA 1XNQK 3AVMA 3ENOA 3OBWA 2E2NA 1CXQA 2D5RA 3AVLA 4KKOA 4ICLA 2FF6A 1OKJA 5HP1A 3M6GA 1K9MO 1QS4A 4Y1DA 3KD5E 1JCGA 3ZX0A 5AQFA 4A61A 3SZ2A 3ZETB 1RDAA 1JLCA 3LDPA 3LP3A 2ZGYA 4FLWA 1NGEA 2X74A 2LSNA 2PYJA 3RVCA 2HVHA 4BRMA 2UXDK 5KI6A 4IZ9A 5AQGA 3MXMA 3JAMO 4J8FA 1IO2A 1TKZA 1NGFA 4BRNA 1J9AA 3TSUA 4DSIA 3VEOA 1UOCA 4Z0UA 4M3RA 1Q8IA 1VQ7N 1IG8A 1NMDA 1SKWA 3AO3A 4O5FA 3CHWA 2HHQA 3G0ZA 2UU9K 1HPMA 2O8BB 3TANA 4MO4A 4CF9A 4KHQA 5HRPA 4DV6K 5KPZA 4KHNA 3MAQA 1NJWA 4B9MA 3I55N 3PO5A 3AAQA 3AA2A 3MXIA 2Z1JA 2ITMA 3HSTB 4FWPA 1C1CA 1QVFM 1W0HA 3D2FB 2Y1IA 2A42A 4DV7K 4FM1A 3FE1A 1J53A 5FRMA 1N36K 3SAHA 5JVGL 4IO8A 4WQ4A 2E8AA 4B1YB 1XHZA 2P9LB 4CF1A 4RG8A 2KFZA 3B8AX 4NXMK 1RT3A 1W97L 3ZX3A 4DLEA 3O9TA 1FKPA 1JLFA 4AQYK 3OS1A 1EWRA 2GBZA 1YT3A 1OH6A 5D3GA 2HMPA 4FO0A 4F2SA 3AGRA 3VERA 3EY1A 3AO5A 1S3XA 4DV4K 3KKSA 2GUIA 1VHXA 1QSYA 1GOAA 1K6YA 2Q36A 2YCHA 4MDAA 2HVIA 5K14A 4KH6A 1VAZA 2HSTA 4K0KK 3VENA 1X9WA 2NRTA 2P9PA 4CBWA 4FJIA 4B9UA 1TK8A 2QEXN 3ZSZA 3TAGA 4JI5K 2HF4A 3HL8A 1BIUA 1D5AA 4CGFA 4C8MA 3HVTA 1DLOA 4FLVA 5EY4A 2QXFA 3MCPA 4M42A 3P83D 3U3GA 1HNWK 3R6MA 1NGCA 3M1FA 5AQJA 4CZMA 4E3SA 2Q0UA 4BRLA 3AGKA 2YHWA 3O6WA 1TYQA 2E1YA 3RTVA 3WXMB 3KKRA 4DV0K 5FPDA 3PIOL 2AA4A 2PFUA 2ZQBA 1WUAA 3V9SA 2YJEA 3FZHA 4BQZA 3ZETA 1ZBSA 2B4JA 2ZE2A 4BRKA 4BDZA 3SUPA 3GBTA 3FFKB 2WFBA 2BE2A 4CK3A 1HKCA 5HRRA 3SV4A 2XHBA 3BF3A 4JKBA 1QHTA 4WQ5C 5AQMA 2JWLA 4FPAA 2EWSA 4FJLA 3OJUA 4LF7K 3HPGA 2GTDA 4DS4A 1MWMA 4NXNK 1T3VA 1IBKK 5AZIA 1BCMA 3AA4A 3P39A 4BRHA 3LAMA 4BE0A 3CQYA 3VF4A 1C6VA 5SZTA 3IDHA 3OYIA 1Z26A 1EQYA 1T7PA 1ZBLA 2P9KB 1WBBA 1C0FA 3O1WA 4F4KA 3LDOA 4CGJA 3KLHA 3MWTA 3QNNA 3I8BA 4YOVA 3UKUA 1V4SA 3VEXA 5HLFA 2AP1A 3MEGA 1HLUA 4M7YA 4FJ5A 1NU0A 1VK0A 1JL1A 1LW2A 2A1SA 1NGHA 2W42A 3LP2A 2B5JA 3EKUA 5AQHA 4NCGA 1RBUA 2O8FB 1K8AO 1V4TA 5AFUA 3BY5A 1Z25A 3DLEA 1X3MA 1U48A 1WAJA 4ZHRA 1JLGA 3LP0A 4ISFA 1QVGM 4FJJA 4FOIA 2OZSA 3C95A 4B9QA 4CCHA 2UUAK 1IH7A 1S1UA 5KPTA 3DXMA 1EWQA 5BRHA 1KTQA 2FLOA 3M5RA 3SQ2A 4BRCA 3CC2N 4JKFA 4CIGA 2A1RA 1OH7A 2I7NA 1LWEA 5C15A 1SL2A 4W5TA 1VQ4N 5BRDA 3AA3A 3HP6A 1XNRK 1SAZA 2DFEA 1TGOA 5E41A 1NKEA 3HTVA 4AHSA 4K8XA 4C8LA 3CFOA 1XUPO 4FL9A 4PQUA 3VQPA 5GIOA 3RRHA 1KVCA 4PKHA 3LDSA 2OA8A 1S6QA 3T1HK 2NNWA 4BVOA 3CM6A 2ETJA 5BR8K 4HHTA 4BWMA 4G1QA 4FJGA 4EIAA 4CF0A 3V9XA 2YI1A 4Z4EA 4AILC 1C0UA 1RDDA 1VQ8N 3IAYA 4CJ3A 3LZJA 4DSJA 4I6MA 1T44A 2Q31A 1Q82O 4JI6K 3IS9A 3VEYA 2V7YA 3NH1A 1HRHA 4B1VA 1BG3A 3WQTA 4B3SK 1UA0A 4JEPA 5C24A 3WT0A 2FC0A 4FJHA 2FXUA 1NK6A 2HW3A 3VQ5A 1SKSA 1NJXA 5AQOA 4CF8A 1J5EK 4B3TK 3G10A 4BC3A 1A5WA 1SQKA 4LH4A 4BY9C 1D8YA 4N56A 4PA1A 2VWBA 3AVAA 3AO1A 4CK1A 1NG9A 3L4QA 3OYMA 1LAWA 2E1ZA 1S1XA 3ATVA 3WNFA 4W5QA 1WLJA 3O3GA 2YNFA 3VQ7A 2F9WA 3P4IA 4K42A 1GLLO 1QSSA 1A5VA 2E5LK 2RKIA 3UE5A 3RMDA 2ATQA 4W5NA 4MO5A 3VMFB 2VG6A 4RW7A 2CGKA 4FW1A 1W2BM 4DFKA 1HQUA 2KLAA 3ATUA 2UUCK 1LW0A 1TK5A 1HQEA 1L3TA 3G4SN 1G99A 3FZMA 4DTOA 2QM1A 1NGAA 3CQXA 4Q5VA 1VQPN 3H45C 3ID6A 1XWLA 1FK9A 3S41A 4YORA 3VOVA 2HBKA 1KRPA 3VF6A 1YXQA 4GV9A 4YDUC 5LJVA 4LFAK 3EEQA 4JKCA 4RTFD 5AQSA 4BACA 1KC8O 3FZKA 1O1WA 1XC3A 4CJVA 4E7LA 2O8CA 1MU2A 1RFQA 2RPIA 4KAZA 4B8CA 3RSEB 1HYZA 1XHXA 4B1ZA 3IUCA 4CEQA 1HPZA 1B9DA 3WNEA 1Q81O 1GLJO 5M1FA 1HJOA 1LWCA 5F1XA 2EHGA 2PYLA 1WN7A 4IWVA 2UXBK 4E89A 1BIZA 2NUBA 2ZJQL 4JD2A 3CCQN 1D4XA 4DHYA 3AVNA 4CGIA 3PX4A 4ID5A 2IGIA 2D0PA 1CLQA 4DV1K 1VRTA 1RDBA 1VSLA 4LF9K 4CD1A 3MX2A 1TKDA 2O8DA 4LF4K 4FWSA 3A5OC 4CJ5A 2WC9A 4FPBA 4H0VB 3CI5A 3SPZA 4BC5A 3VF2A 4JS5A 1NLVA 1S9EA 3OYBA 4MFBA 3SQ0A 3LPTA 5CZ1A 4CJLA 5BN9A 4BGBA 5KQDA 2D1KA 1KD1O 3CD6N 1X9SA 4JYAK 1LCUA 4U7BA 4O5BA 3A2FA 5ELZA 5EOYA 1JL2A 5GINA 5LY3A 4H5TA
chains in the Genus database with same CATH topology
4AHRA 2HHTA 3ITHA 4O44A 3LZIA 1ITGA 4LD0A 3TANA 1RT1A 3ALYA 2FBYA 4CF9A 4CGDA 5HRPA 4KHQA 4KHNA 3MAQA 3NH2A 3DOLA 3AO2A 1IKXA 4RW4A 3S3NA 1BL3A 4CK2A 1GOBA 3K2PA 3C6UA 1NJWA 4B9MA 3NF9A 4I9QA 4R5PA 3PO5A 4H4MA 4M3XA 3AA2A 3MXIA 1ZBFA 2PY5A 2Z1JA 4HTUA 3HSTB 1U49A 4OVLA 2PZSA 4CIEA 1L3SA 1C1CA 1WSIA 4CESA 3OYAA 5SWMA 2IAJA 1W0HA 2XY5A 5I42A 1JKHA 1TV6A 3I8DA 3ZSXA 2Y1IA 4I2PA 3NGYA 3RWUA 1KVAA 3C94A 3NBPA 4FM1A 4F3TA 3OYCA 1J53A 1HNIA 4DTMA 5FRMA 1KVBA 4DQPA 3NAEA 1QTMA 3E01A 3V9ZA 1XHZA 1Q9XA 3VQDA 3SUQA 4DF4A 4KHSA 3S3OA 2YNHA 4CF1A 3AVJA 4RG8A 2KFZA 2DTUA 4J2AA 4OGEA 1U47A 1RT3A 3QIOA 2G8UA 3D0PA 4NYFA 2YKNA 4OKJA 1HNVA 4DLEA 3SNNA 2P5GA 2RN2A 1FKPA 1JLFA 3QIPA 4CERA 1VRUA 3OS1A 3T19A 3CFRA 5J2PA 3CYMA 4Z4HA 1T05A 3HK2A 2D0CA 1JLQA 1RT4A 2GBZA 2BDPA 2Y1JA 1YT3A 3QINA 1F21A 3OYHA 1A5XA 1TKTA 4DQIA 4ELTA 3ZSRA 2IOCA 5D3GA 2XO7A 4EP5A 4BWJA 5C25A 1YTUA 4F2SA 4DLGA 4CJUA 1XC9A 3P5JA 4W5RA 3EY1A 1B92A 3AO5A 1TL1A 3F73A 3AVIA 4HVJA 3KKSA 2GUIA 4CHZA 1NOYA 1QSYA 3OY9A 3SPYA 4LH5A 1GOAA 5KRTA 3NH0A 1K6YA 3U3YA 1NK0A 4N41A 2HVIA 1EXQA 5K14A 1SV5A 1TL3A 4F3OA 1REVA 2HHWA 1X9WA 2KFNA 1QQCA 2F8SA 4FJIA 3AVKA 3LALA 3MXJA 2HNYA 1TK8A 4B9UA 3K5OA 1KFDA 5HRSA 4FCYA 4HUGA 3ZSZA 5DK5A 4KFBA 4DMNA 3I0RA 5T7BA 3TAGA 3HL8A 1BIUA 1D5AA 4H8KA 4CGFA 4E7KA 4DTUA 1JLBA 4C8MA 3HVTA 1DLOA 3DLKA 4GVMA 4CEFA 2BGGA 1BQNA 1U04A 2O4IA 4DF8A 4FLVA 2KTQA 3RMBA 2P1JA 2QXFA 3UIQA 4M41A 4M42A 3P83D 3U3GA 1X1PA 4DG1A 1Y97A 1DTQA 4E3SA 3EZ5A 4DU1A 2Z1GA 3MEDA 3FFIA 3VQQA 4NCBA 4KI4A 3AV9A 1GOCA 4WE1A 2HNDA 3AVGA 4FK0A 3RTVA 4J2BA 3KKRA 1HYSA 4DFMA 1JXEA 4F8RA 2XRIA 2ZQBA 2BANA 3OYEA 4Z4GA 4NCAA 3V9SA 4DTXA 3LWMA 1KSPA 4DQSA 2B4JA 4JRPA 3OVNA 4CFCA 3TR8A 1RBSA 3VQ6A 2ZE2A 3NFAA 3DLHA 4BDZA 3AVHA 1NK9A 1KCFA 3SUPA 4PUOA 1SL0A 1YVUA 1IG9A 4CFDA 4OPKA 2BE2A 4CK3A 3VA0A 4CE9A 2X6SA 4E1NA 5HRRA 1D9DA 1JLAA 1WSFA 3K5LA 3SV4A 4CEAA 2XHBA 3WNHA 4HCBA 3RMAA 2YV0X 4RW9A 3QESA 3CQ8A 1L5UA 1QHTA 2G8HA 1NKBA 3D45A 3OYDA 4E7IA 3HP9A 4FJLA 3OJUA 3HPGA 4AHTA 3RRGA 4DS4A 3QO9A 1RCHA 3K5NA 3QEIA 4DTJA 1VSDA 3SQ4A 4F2RA 2HHSA 1BCMA 3AA4A 1ASVA 3IG1A 4CFBA 4O0IA 3LAMA 3LAKA 3K58A 4CJWA 4BE2A 4BE0A 3DYAA 3L2VA 4FLXA 3HPHA 1RT2A 3ZT2A 2ZD1A 4B9TA 1C6VA 3L3VA 4CEOA 5SZTA 3CM5A 1WSJA 4CJKA 3OYIA 3KD1E 1ASWA 1Z26A 4CEEA 1T7PA 1J54A 3M8QA 4CGGA 1ZBLA 4C8KA 2HMIA 3F9KA 3CG7A 4IFVA 1R0AA 4BDYA 3NE6A 4F4KA 2VG7A 3VQEA 3TAFA 3HPOA 4CGJA 1BHLA 3P1GA 3KLHA 1RBVA 3QNNA 4FJ7A 1EX4A 2YKMA 2IS3A 3MEEA 5JS1A 4CHQA 3NHGA 1S9GA 1NK5A 1UAXA 1WSHA 3ZCMA 5HLFA 4L8RB 2JGUA 2ITGA 4IKFA 3M8RA 4HUFA 1NKCA 2AJQA 3L2QA 1BCOA 1LWFA 3MEGA 3HO1A 4FJ5A 4XIUA 3ZT3A 2KQ2A 1UA1A 4FXDA 1TK0A 4M3ZA 1VK0A 4ELVA 1JL1A 3ZT4A 1ZYQA 4CJQA 1D9FA 1LW2A 2A1SA 1KLNA 4M3WA 3NF8A 2W42A 3LP2A 3OYFA 3L2UA 4FJXA 3V1OA 2B5JA 4FLTA 4NCGA 1RBUA 3VN5A 3NF7A 3U6FA 3BDPA 4ZTJA 4FM0A 1UWBA 4LSNA 2OPSA 4CJSA 3PX6A 1Z25A 5KTQA 1SKRA 4KHYA 3DLEA 1RT5A 5KRSA 3DMJA 3ZSWA 1RBRA 1S1TA 3T3FA 1U48A 3ASMA 1WAJA 4DSLA 4OGCA 2KZZA 4ZHRA 1JLGA 3V9WA 1BGXT 3LP0A 4GW6A 3LP1A 4KB0A 3JSMA 4FJJA 1RTJA 4H4OA 3MECA 3C95A 3ZT0A 2OZSA 1BQMA 2O4GA 4GMJB 4DSFA 4CCHA 4KRFA 1CXUA 1IH7A 1NK4A 1JXBA 1S1UA 1JLEA 2GV9A 3NGZA 3THVA 1G15A 1C1AA 3DLGA 3DLRA 1BISA 1RILA 1KTQA 4KTWA 3CFPA 3V6DA 3SQ2A 2HHUA 1FKOA 4CIGA 3ZT1A 1J5OA 1CZBA 4CECA 4N76A 1TVRA 2F8TA 2A1RA 2QKBA 4HUEA 4FZXC 2B6AA 4CJFA 1LWEA 3OS0A 3DLBA 4J2DA 3VQ8A 1SL2A 2Q3SA 3OYLA 4W5TA 3OS2A 1YTAA 3AA3A 1W9HA 1WSEA 3QLHA 4E1MA 3HP6A 1VSIA 1IKYA 2DFEA 4M45A 1B9FA 1TGOA 4CJ4A 4CGHA 5E41A 2WOMA 3ULDA 3TARA 4BE1A 4PWDA 1NKEA 4E19A 4QAGA 1XI1A 1CZ9A 4OLAA 3V4IA 4FK4A 1FXXA 2G8KA 4AHSA 4FJ8A 4K8XA 4E7HA 4C8LA 3CFOA 4PQUA 5FRNA 3VQPA 1RTDA 4FW2A 4AH9A 4LY7A 4M3UA 1EP4A 4DFPA 2KW4A 2DFHA 1I39A 3TABA 4B9SA 3TI0A 2IDOA 3L3UA 3SJJA 2D0BA 4CEBA 4NYNA 4RW6A 3RRHA 4K8ZA 1KVCA 4PY5A 3LDSA 4FVMA 2OA8A 3V1RA 3NF6A 3M8SA 2HHXA 1S6QA 4IG0A 4DSEA 2I5JA 3M8PA 3CM6A 2ETJA 4N5SA 4HHTA 3RR7A 4BWMA 4G1QA 3JYTA 4DU4A 2YNGA 4FJGA 3DM2A 3HVRA 4CF0A 4FLZA 3ZSVA 3PY8A 3O3HA 5I3UA 3V9XA 4Z4EA 3BGRA 3T1AA 4DTSA 3SYZA 1NJZA 2VWJA 4CHPA 5HROA 3NCIA 1RNHA 4AILC 1C0UA 1RDDA 1N5YA 4KO0A 3O4NA 4DU3A 3DI6A 4BDPA 3IAYA 4CJ3A 3LZJA 4DSJA 4Y1CA 4DFJA 1NK7A 4OLBA 4DS5A 4QOZB 3IS9A 2RF2A 2OPPA 1QE1A 4KHWA 1C0TA 2G8VA 3NH1A 1HRHA 3PX0A 4CEZA 2JLEA 3DRSA 4CIFA 4Z4CA 3OJSA 4CJPA 1KFSA 4B9NA 4M3TA 3SCXA 3TAQA 4FK2A 1UA0A 4I7FA 2G8IA 3DOKA 4W5OA 1VSJA 3TAMA 2QKKA 1RT6A 4CJTA 3QERA 4KV8A 5C24A 4TSXA 4CHYA 4N47A 3KLFA 2FC0A 4AHUA 1IKVA 3LWLA 3HM9A 3VQAA 3HXMA 4JS4A 4E7JA 4LSLA 1T8EA 2OYQA 4ELUA 4FJHA 1I3AA 1NK6A 4Q0BA 3VQ5A 2IC3A 2WONA 3DRRA 5CYMA 2OPQA 4FLUA 1SKSA 1T03A 1NJXA 4FJKA 4CF8A 5CY4A 3KK3A 1HMVA 4CJEA 1U4BA 4C8OA 3S3MA 1LAVA 3G10A 3VQ9A 3KK1A 1RBTA 3NGIA 3KTQA 4B8AB 1X9MA 4JRQA 1A5WA 4LH4A 4CHNA 4FZYA 1D8YA 2P5OA 1TAUA 1RDCA 4CEDA 2HHVA 4EZ9A 4N56A 4PA1A 3B6OA 4OKEA 3ZSQA 4FLYA 3AVAA 3AO1A 4CK1A 3QEWA 1VSEA 1L3VA 4M3YA 2FBXA 3OYMA 3H08A 1LAWA 1RTIA 3QETA 1S1XA 3WNFA 4DWIA 2F96A 3IRXA 4W5QA 4CHOA 4E0DA 1WLJA 3TAPA 3O3GA 2YNFA 2HB5A 2YNIA 3VQ7A 3QEPA 4Z4FA 5FROA 1QSSA 2EX3A 1BI4B 1A5VA 3KLEA 3SUNA 2RKIA 4I2QA 2YHAA 4IBNA 2FBTA 3O3FA 2ATQA 3RMDA 4W5NA 3PV8A 3SI6A 3ZSYA 4KHUA 3KJVA 2VG6A 1VSHA 4ID1A 4YNQA 4RW7A 1ZBUA 4UQGA 4KI6A 3AO4A 4FW1A 4O4GA 1HQUA 5CYQA 3L8BA 4DQRA 2E6MA 3AA5X 4DFKA 1RTHA 2E6LA 3QEXA 4KPYA 1LW0A 3AVBA 1TK5A 1HQEA 1L3TA 3C6TA 3O4QA 4FM2A 3HT3A 3K5MA 4IFYA 1HJRA 4EP4A 4DTOA 4B3OA 4FJ9A 4Q5VA 1XWLA 1FK9A 1HYVA 4KTQA 1ZBHA 1Q9YA 1S6PA 3LANA 5JS2A 3OYJA 1KRPA 3OYGA 3B6PA 4MQ3A 3WNGA 2R7YA 4DTNA 3KK2A 1EETA 3HYFA 4OJRA 2VWKA 1TAQA 4IDKA 4B08A 3PO4A 3K57A 3LPUA 3QNOA 4BACA 3QEVA 4CJVA 1O1WA 4E7LA 1MU2A 2RPIA 3V1QA 3VA3A 4AHVA 4B8CA 4KAZA 4OKKA 3SQ1A 4CJRA 1ZBIA 2D0AA 3RR8A 3VQCA 4JLHA 4FYDA 3SUOA 1HYZA 4KTZA 1S1WA 1BI4A 3VQBA 5J2MA 1XHXA 3V81A 4Z4IA 3TWHA 3KLIA 1QSLA 2HW3A 3OYKA 3L2RA 4CEQA 3K59A 4OPJA 1HPZA 2Z1HA 1C1BA 5J2QA 2XY6A 1B9DA 3AVCA 3WNEA 2G8WA 3L2WA 4ZTFA 4FZZA 1KLMA 5J2NA 1LWCA 2E4LA 2EHGA 3ZSOA 1NK8A 2PYLA 4HCCA 4B9VA 3ISNC 1WN7A 3EYZA 2KZMA 3AVFA 1L3UA 1SL1A 2Z1IA 4YFUA 4IG3A 4FJNA 4E89A 1BIZA 3RMCA 2NUBA 2VG5A 1DTTA 3AVMA 4DTRA 1RT7A 2X6NA 5HBMA 4B9LA 4EZ6A 5HRNA 2XY8A 1WNSA 4QCLA 5EU7A 1CXQA 2D5RA 3AVLA 4KKOA 4DTPA 3AVNA 4CGIA 4ICLA 3KLGA 4ID5A 1VSKA 3NDKA 2P51A 3V9UA 3PX4A 3S9HA 3HJFA 2IGIA 5C42A 5HP1A 1QS4A 1S5JA 4Y1DA 1U45A 1CLQA 2X78A 1VRTA 1RDBA 1EKEA 1VSLA 2G8FA 1VSFA 3KD5E 4AHCA 2YHBA 3DRPA 1TKDA 4J2EA 1LV5A 3SZ2A 5CZ2A 5DMRA 4KREA 4RW8A 1C0MA 1RDAA 1JLCA 3LP3A 1ASUA 2HNZA 4FLWA 4CJ5A 4DSKA 5FDLA 5KGWA 1N6QA 3I0SA 1NOZA 3SPZA 2X74A 2LSNA 1NJYA 2PYJA 1TKXA 4JS5A 2DFFA 2HVHA 2OPRA 1S9EA 4CFAA 3OYBA 5KI6A 4MFBA 1SUQA 3SQ0A 3LPTA 3MXMA 1S1VA 5CZ1A 4FJMA 3OYNA 1WSGA 4CJLA 3TAEA 3VQ4A 1IO2A 1X9SA 1TKZA 3KIOA 5KGXA 4KB1A 4I9LA 1WAFA 3PUFA 1J9AA 4DSIA 2FBVA 5J1EA 2DY4A 1UOCA 4Z0UA 4CF2A 4DQQA 2XY7A 4C8NA 1Q8IA 4M3RA 2QK9A 2OZMA 4O5BA 1VSMA 1SKWA 4O0JA 3A2FA 1IKWA 1JL2A 3AO3A 4O55A 3SV3A 2HHQA 3G0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AHR A;  2HHT A;  3ITH A;  4O44 A;  3LZI A;  1ITG A;  4LD0 A;  3TAN A;  1RT1 A;  3ALY A;  2FBY A;  4CF9 A;  4CGD A;  5HRP A;  4KHQ A;  4KHN A;  3MAQ A;  3NH2 A;  3DOL A;  3AO2 A;  1IKX A;  4RW4 A;  3S3N A;  1BL3 A;  4CK2 A;  1GOB A;  3K2P A;  3C6U A;  1NJW A;  4B9M A;  3NF9 A;  4I9Q A;  4R5P A;  3PO5 A;  4H4M A;  4M3X A;  3AA2 A;  3MXI A;  1ZBF A;  2PY5 A;  2Z1J A;  4HTU A;  3HST B;  1U49 A;  4OVL A;  2PZS A;  4CIE A;  1L3S A;  1C1C A;  1WSI A;  4CES A;  3OYA A;  5SWM A;  2IAJ A;  1W0H A;  2XY5 A;  5I42 A;  1JKH A;  1TV6 A;  3I8D A;  3ZSX A;  2Y1I A;  4I2P A;  3NGY A;  3RWU A;  1KVA A;  3C94 A;  3NBP A;  4FM1 A;  4F3T A;  3OYC A;  1J53 A;  1HNI A;  4DTM A;  5FRM A;  1KVB A;  4DQP A;  3NAE A;  1QTM A;  3E01 A;  3V9Z A;  1XHZ A;  1Q9X A;  3VQD A;  3SUQ A;  4DF4 A;  4KHS A;  3S3O A;  2YNH A;  4CF1 A;  3AVJ A;  4RG8 A;  2KFZ A;  2DTU A;  4J2A A;  4OGE A;  1U47 A;  1RT3 A;  3QIO A;  2G8U A;  3D0P A;  4NYF A;  2YKN A;  4OKJ A;  1HNV A;  4DLE A;  3SNN A;  2P5G A;  2RN2 A;  1FKP A;  1JLF A;  3QIP A;  4CER A;  1VRU A;  3OS1 A;  3T19 A;  3CFR A;  5J2P A;  3CYM A;  4Z4H A;  1T05 A;  3HK2 A;  2D0C A;  1JLQ A;  1RT4 A;  2GBZ A;  2BDP A;  2Y1J A;  1YT3 A;  3QIN A;  1F21 A;  3OYH A;  1A5X A;  1TKT A;  4DQI A;  4ELT A;  3ZSR A;  2IOC A;  5D3G A;  2XO7 A;  4EP5 A;  4BWJ A;  5C25 A;  1YTU A;  4F2S A;  4DLG A;  4CJU A;  1XC9 A;  3P5J A;  4W5R A;  3EY1 A;  1B92 A;  3AO5 A;  1TL1 A;  3F73 A;  3AVI A;  4HVJ A;  3KKS A;  2GUI A;  4CHZ A;  1NOY A;  1QSY A;  3OY9 A;  3SPY A;  4LH5 A;  1GOA A;  5KRT A;  3NH0 A;  1K6Y A;  3U3Y A;  1NK0 A;  4N41 A;  2HVI A;  1EXQ A;  5K14 A;  1SV5 A;  1TL3 A;  4F3O A;  1REV A;  2HHW A;  1X9W A;  2KFN A;  1QQC A;  2F8S A;  4FJI A;  3AVK A;  3LAL A;  3MXJ A;  2HNY A;  1TK8 A;  4B9U A;  3K5O A;  1KFD A;  5HRS A;  4FCY A;  4HUG A;  3ZSZ A;  5DK5 A;  4KFB A;  4DMN A;  3I0R A;  5T7B A;  3TAG A;  3HL8 A;  1BIU A;  1D5A A;  4H8K A;  4CGF A;  4E7K A;  4DTU A;  1JLB A;  4C8M A;  3HVT A;  1DLO A;  3DLK A;  4GVM A;  4CEF A;  2BGG A;  1BQN A;  1U04 A;  2O4I A;  4DF8 A;  4FLV A;  2KTQ A;  3RMB A;  2P1J A;  2QXF A;  3UIQ A;  4M41 A;  4M42 A;  3P83 D;  3U3G A;  1X1P A;  4DG1 A;  1Y97 A;  1DTQ A;  4E3S A;  3EZ5 A;  4DU1 A;  2Z1G A;  3MED A;  3FFI A;  3VQQ A;  4NCB A;  4KI4 A;  3AV9 A;  1GOC A;  4WE1 A;  2HND A;  3AVG A;  4FK0 A;  3RTV A;  4J2B A;  3KKR A;  1HYS A;  4DFM A;  1JXE A;  4F8R A;  2XRI A;  2ZQB A;  2BAN A;  3OYE A;  4Z4G A;  4NCA A;  3V9S A;  4DTX A;  3LWM A;  1KSP A;  4DQS A;  2B4J A;  4JRP A;  3OVN A;  4CFC A;  3TR8 A;  1RBS A;  3VQ6 A;  2ZE2 A;  3NFA A;  3DLH A;  4BDZ A;  3AVH A;  1NK9 A;  1KCF A;  3SUP A;  4PUO A;  1SL0 A;  1YVU A;  1IG9 A;  4CFD A;  4OPK A;  2BE2 A;  4CK3 A;  3VA0 A;  4CE9 A;  2X6S A;  4E1N A;  5HRR A;  1D9D A;  1JLA A;  1WSF A;  3K5L A;  3SV4 A;  4CEA A;  2XHB A;  3WNH A;  4HCB A;  3RMA A;  2YV0 X;  4RW9 A;  3QES A;  3CQ8 A;  1L5U A;  1QHT A;  2G8H A;  1NKB A;  3D45 A;  3OYD A;  4E7I A;  3HP9 A;  4FJL A;  3OJU A;  3HPG A;  4AHT A;  3RRG A;  4DS4 A;  3QO9 A;  1RCH A;  3K5N A;  3QEI A;  4DTJ A;  1VSD A;  3SQ4 A;  4F2R A;  2HHS A;  1BCM A;  3AA4 A;  1ASV A;  3IG1 A;  4CFB A;  4O0I A;  3LAM A;  3LAK A;  3K58 A;  4CJW A;  4BE2 A;  4BE0 A;  3DYA A;  3L2V A;  4FLX A;  3HPH A;  1RT2 A;  3ZT2 A;  2ZD1 A;  4B9T A;  1C6V A;  3L3V A;  4CEO A;  5SZT A;  3CM5 A;  1WSJ A;  4CJK A;  3OYI A;  3KD1 E;  1ASW A;  1Z26 A;  4CEE A;  1T7P A;  1J54 A;  3M8Q A;  4CGG A;  1ZBL A;  4C8K A;  2HMI A;  3F9K A;  3CG7 A;  4IFV A;  1R0A A;  4BDY A;  3NE6 A;  4F4K A;  2VG7 A;  3VQE A;  3TAF A;  3HPO A;  4CGJ A;  1BHL A;  3P1G A;  3KLH A;  1RBV A;  3QNN A;  4FJ7 A;  1EX4 A;  2YKM A;  2IS3 A;  3MEE A;  5JS1 A;  4CHQ A;  3NHG A;  1S9G A;  1NK5 A;  1UAX A;  1WSH A;  3ZCM A;  5HLF A;  4L8R B;  2JGU A;  2ITG A;  4IKF A;  3M8R A;  4HUF A;  1NKC A;  2AJQ A;  3L2Q A;  1BCO A;  1LWF A;  3MEG A;  3HO1 A;  4FJ5 A;  4XIU A;  3ZT3 A;  2KQ2 A;  1UA1 A;  4FXD A;  1TK0 A;  4M3Z A;  1VK0 A;  4ELV A;  1JL1 A;  3ZT4 A;  1ZYQ A;  4CJQ A;  1D9F A;  1LW2 A;  2A1S A;  1KLN A;  4M3W A;  3NF8 A;  2W42 A;  3LP2 A;  3OYF A;  3L2U A;  4FJX A;  3V1O A;  2B5J A;  4FLT A;  4NCG A;  1RBU A;  3VN5 A;  3NF7 A;  3U6F A;  3BDP A;  4ZTJ A;  4FM0 A;  1UWB A;  4LSN A;  2OPS A;  4CJS A;  3PX6 A;  1Z25 A;  5KTQ A;  1SKR A;  4KHY A;  3DLE A;  1RT5 A;  5KRS A;  3DMJ A;  3ZSW A;  1RBR A;  1S1T A;  3T3F A;  1U48 A;  3ASM A;  1WAJ A;  4DSL A;  4OGC A;  2KZZ A;  4ZHR A;  1JLG A;  3V9W A;  1BGX T;  3LP0 A;  4GW6 A;  3LP1 A;  4KB0 A;  3JSM A;  4FJJ A;  1RTJ A;  4H4O A;  3MEC A;  3C95 A;  3ZT0 A;  2OZS A;  1BQM A;  2O4G A;  4GMJ B;  4DSF A;  4CCH A;  4KRF A;  1CXU A;  1IH7 A;  1NK4 A;  1JXB A;  1S1U A;  1JLE A;  2GV9 A;  3NGZ A;  3THV A;  1G15 A;  1C1A A;  3DLG A;  3DLR A;  1BIS A;  1RIL A;  1KTQ A;  4KTW A;  3CFP A;  3V6D A;  3SQ2 A;  2HHU A;  1FKO A;  4CIG A;  3ZT1 A;  1J5O A;  1CZB A;  4CEC A;  4N76 A;  1TVR A;  2F8T A;  2A1R A;  2QKB A;  4HUE A;  4FZX C;  2B6A A;  4CJF A;  1LWE A;  3OS0 A;  3DLB A;  4J2D A;  3VQ8 A;  1SL2 A;  2Q3S A;  3OYL A;  4W5T A;  3OS2 A;  1YTA A;  3AA3 A;  1W9H A;  1WSE A;  3QLH A;  4E1M A;  3HP6 A;  1VSI A;  1IKY A;  2DFE A;  4M45 A;  1B9F A;  1TGO A;  4CJ4 A;  4CGH A;  5E41 A;  2WOM A;  3ULD A;  3TAR A;  4BE1 A;  4PWD A;  1NKE A;  4E19 A;  4QAG A;  1XI1 A;  1CZ9 A;  4OLA A;  3V4I A;  4FK4 A;  1FXX A;  2G8K A;  4AHS A;  4FJ8 A;  4K8X A;  4E7H A;  4C8L A;  3CFO A;  4PQU A;  5FRN A;  3VQP A;  1RTD A;  4FW2 A;  4AH9 A;  4LY7 A;  4M3U A;  1EP4 A;  4DFP A;  2KW4 A;  2DFH A;  1I39 A;  3TAB A;  4B9S A;  3TI0 A;  2IDO A;  3L3U A;  3SJJ A;  2D0B A;  4CEB A;  4NYN A;  4RW6 A;  3RRH A;  4K8Z A;  1KVC A;  4PY5 A;  3LDS A;  4FVM A;  2OA8 A;  3V1R A;  3NF6 A;  3M8S A;  2HHX A;  1S6Q A;  4IG0 A;  4DSE A;  2I5J A;  3M8P A;  3CM6 A;  2ETJ A;  4N5S A;  4HHT A;  3RR7 A;  4BWM A;  4G1Q A;  3JYT A;  4DU4 A;  2YNG A;  4FJG A;  3DM2 A;  3HVR A;  4CF0 A;  4FLZ A;  3ZSV A;  3PY8 A;  3O3H A;  5I3U A;  3V9X A;  4Z4E A;  3BGR A;  3T1A A;  4DTS A;  3SYZ A;  1NJZ A;  2VWJ A;  4CHP A;  5HRO A;  3NCI A;  1RNH A;  4AIL C;  1C0U A;  1RDD A;  1N5Y A;  4KO0 A;  3O4N A;  4DU3 A;  3DI6 A;  4BDP A;  3IAY A;  4CJ3 A;  3LZJ A;  4DSJ A;  4Y1C A;  4DFJ A;  1NK7 A;  4OLB A;  4DS5 A;  4QOZ B;  3IS9 A;  2RF2 A;  2OPP A;  1QE1 A;  4KHW A;  1C0T A;  2G8V A;  3NH1 A;  1HRH A;  3PX0 A;  4CEZ A;  2JLE A;  3DRS A;  4CIF A;  4Z4C A;  3OJS A;  4CJP A;  1KFS A;  4B9N A;  4M3T A;  3SCX A;  3TAQ A;  4FK2 A;  1UA0 A;  4I7F A;  2G8I A;  3DOK A;  4W5O A;  1VSJ A;  3TAM A;  2QKK A;  1RT6 A;  4CJT A;  3QER A;  4KV8 A;  5C24 A;  4TSX A;  4CHY A;  4N47 A;  3KLF A;  2FC0 A;  4AHU A;  1IKV A;  3LWL A;  3HM9 A;  3VQA A;  3HXM A;  4JS4 A;  4E7J A;  4LSL A;  1T8E A;  2OYQ A;  4ELU A;  4FJH A;  1I3A A;  1NK6 A;  4Q0B A;  3VQ5 A;  2IC3 A;  2WON A;  3DRR A;  5CYM A;  2OPQ A;  4FLU A;  1SKS A;  1T03 A;  1NJX A;  4FJK A;  4CF8 A;  5CY4 A;  3KK3 A;  1HMV A;  4CJE A;  1U4B A;  4C8O A;  3S3M A;  1LAV A;  3G10 A;  3VQ9 A;  3KK1 A;  1RBT A;  3NGI A;  3KTQ A;  4B8A B;  1X9M A;  4JRQ A;  1A5W A;  4LH4 A;  4CHN A;  4FZY A;  1D8Y A;  2P5O A;  1TAU A;  1RDC A;  4CED A;  2HHV A;  4EZ9 A;  4N56 A;  4PA1 A;  3B6O A;  4OKE A;  3ZSQ A;  4FLY A;  3AVA A;  3AO1 A;  4CK1 A;  3QEW A;  1VSE A;  1L3V A;  4M3Y A;  2FBX A;  3OYM A;  3H08 A;  1LAW A;  1RTI A;  3QET A;  1S1X A;  3WNF A;  4DWI A;  2F96 A;  3IRX A;  4W5Q A;  4CHO A;  4E0D A;  1WLJ A;  3TAP A;  3O3G A;  2YNF A;  2HB5 A;  2YNI A;  3VQ7 A;  3QEP A;  4Z4F A;  5FRO A;  1QSS A;  2EX3 A;  1BI4 B;  1A5V A;  3KLE A;  3SUN A;  2RKI A;  4I2Q A;  2YHA A;  4IBN A;  2FBT A;  3O3F A;  2ATQ A;  3RMD A;  4W5N A;  3PV8 A;  3SI6 A;  3ZSY A;  4KHU A;  3KJV A;  2VG6 A;  1VSH A;  4ID1 A;  4YNQ A;  4RW7 A;  1ZBU A;  4UQG A;  4KI6 A;  3AO4 A;  4FW1 A;  4O4G A;  1HQU A;  5CYQ A;  3L8B A;  4DQR A;  2E6M A;  3AA5 X;  4DFK A;  1RTH A;  2E6L A;  3QEX A;  4KPY A;  1LW0 A;  3AVB A;  1TK5 A;  1HQE A;  1L3T A;  3C6T A;  3O4Q A;  4FM2 A;  3HT3 A;  3K5M A;  4IFY A;  1HJR A;  4EP4 A;  4DTO A;  4B3O A;  4FJ9 A;  4Q5V A;  1XWL A;  1FK9 A;  1HYV A;  4KTQ A;  1ZBH A;  1Q9Y A;  1S6P A;  3LAN A;  5JS2 A;  3OYJ A;  1KRP A;  3OYG A;  3B6P A;  4MQ3 A;  3WNG A;  2R7Y A;  4DTN A;  3KK2 A;  1EET A;  3HYF A;  4OJR A;  2VWK A;  1TAQ A;  4IDK A;  4B08 A;  3PO4 A;  3K57 A;  3LPU A;  3QNO A;  4BAC A;  3QEV A;  4CJV A;  1O1W A;  4E7L A;  1MU2 A;  2RPI A;  3V1Q A;  3VA3 A;  4AHV A;  4B8C A;  4KAZ A;  4OKK A;  3SQ1 A;  4CJR A;  1ZBI A;  2D0A A;  3RR8 A;  3VQC A;  4JLH A;  4FYD A;  3SUO A;  1HYZ A;  4KTZ A;  1S1W A;  1BI4 A;  3VQB A;  5J2M A;  1XHX A;  3V81 A;  4Z4I A;  3TWH A;  3KLI A;  1QSL A;  2HW3 A;  3OYK A;  3L2R A;  4CEQ A;  3K59 A;  4OPJ A;  1HPZ A;  2Z1H A;  1C1B A;  5J2Q A;  2XY6 A;  1B9D A;  3AVC A;  3WNE A;  2G8W A;  3L2W A;  4ZTF A;  4FZZ A;  1KLM A;  5J2N A;  1LWC A;  2E4L A;  2EHG A;  3ZSO A;  1NK8 A;  2PYL A;  4HCC A;  4B9V A;  3ISN C;  1WN7 A;  3EYZ A;  2KZM A;  3AVF A;  1L3U A;  1SL1 A;  2Z1I A;  4YFU A;  4IG3 A;  4FJN A;  4E89 A;  1BIZ A;  3RMC A;  2NUB A;  2VG5 A;  1DTT A;  3AVM A;  4DTR A;  1RT7 A;  2X6N A;  5HBM A;  4B9L A;  4EZ6 A;  5HRN A;  2XY8 A;  1WNS A;  4QCL A;  5EU7 A;  1CXQ A;  2D5R A;  3AVL A;  4KKO A;  4DTP A;  3AVN A;  4CGI A;  4ICL A;  3KLG A;  4ID5 A;  1VSK A;  3NDK A;  2P51 A;  3V9U A;  3PX4 A;  3S9H A;  3HJF A;  2IGI A;  5C42 A;  5HP1 A;  1QS4 A;  1S5J A;  4Y1D A;  1U45 A;  1CLQ A;  2X78 A;  1VRT A;  1RDB A;  1EKE A;  1VSL A;  2G8F A;  1VSF A;  3KD5 E;  4AHC A;  2YHB A;  3DRP A;  1TKD A;  4J2E A;  1LV5 A;  3SZ2 A;  5CZ2 A;  5DMR A;  4KRE A;  4RW8 A;  1C0M A;  1RDA A;  1JLC A;  3LP3 A;  1ASU A;  2HNZ A;  4FLW A;  4CJ5 A;  4DSK A;  5FDL A;  5KGW A;  1N6Q A;  3I0S A;  1NOZ A;  3SPZ A;  2X74 A;  2LSN A;  1NJY A;  2PYJ A;  1TKX A;  4JS5 A;  2DFF A;  2HVH A;  2OPR A;  1S9E A;  4CFA A;  3OYB A;  5KI6 A;  4MFB A;  1SUQ A;  3SQ0 A;  3LPT A;  3MXM A;  1S1V A;  5CZ1 A;  4FJM A;  3OYN A;  1WSG A;  4CJL A;  3TAE A;  3VQ4 A;  1IO2 A;  1X9S A;  1TKZ A;  3KIO A;  5KGX A;  4KB1 A;  4I9L A;  1WAF A;  3PUF A;  1J9A A;  4DSI A;  2FBV A;  5J1E A;  2DY4 A;  1UOC A;  4Z0U A;  4CF2 A;  4DQQ A;  2XY7 A;  4C8N A;  1Q8I A;  4M3R A;  2QK9 A;  2OZM A;  4O5B A;  1VSM A;  1SKW A;  4O0J A;  3A2F A;  1IKW A;  1JL2 A;  3AO3 A;  4O55 A;  3SV3 A;  2HHQ A;  3G0Z A; 
#chains in the Genus database with same CATH topology
 1JCF A;  4CZH A;  1C0G A;  4LD0 A;  3BZC A;  1BA0 A;  2FBY A;  3THW A;  4RW4 A;  1ZXO A;  3S3N A;  3H3N O;  3SAG A;  4PKI A;  4CK2 A;  5GAE P;  4R5P A;  4M3X A;  1ZBF A;  4OVL A;  4CIE A;  1L3S A;  3CCL N;  5SWM A;  3IKM A;  2IAJ A;  2XY5 A;  3PIP L;  4A59 A;  3ZSX A;  5DM6 L;  1ATS A;  3NBP A;  4F3T A;  3CCV N;  3EKS A;  2QW9 A;  3D6R A;  4A57 A;  1KVB A;  3NAE A;  1QTM A;  5TKW A;  4X65 K;  1Q9X A;  3H6E A;  3E1Y A;  3SUQ A;  2YNH A;  2DTU A;  3QIO A;  3D0P A;  4NYF A;  4DV2 K;  2HBJ A;  4QS8 A;  3ENH A;  5AQP A;  3SNN A;  2P5G A;  3DWL A;  3CFR A;  3T19 A;  3HK2 A;  2RE2 A;  2HBL A;  3HOT A;  4QS7 A;  4DQI A;  3ZSR A;  1QQM A;  4GY2 B;  5C25 A;  1TUY A;  3O5B A;  4BR7 A;  2BH1 A;  1XC9 A;  5C12 A;  4W5R A;  1O13 A;  4BR2 A;  5DM7 L;  3OHR A;  3G6E N;  4CHZ A;  4B3R K;  3CCJ N;  3SPY A;  3U3Y A;  5LMN K;  1NK0 A;  1NGI A;  4H0P A;  1RGI A;  4BRG A;  1TL3 A;  2P9I B;  3TSP A;  2KFN A;  3LAL A;  3MXJ A;  2HNY A;  3O1B A;  4DR7 K;  4LC9 B;  3H1Q A;  1GLE G;  4GKK K;  4KFB A;  4DMN A;  3I0R A;  5AZJ B;  4E7K A;  4DTU A;  1JLB A;  4JKH A;  3A0I X;  3DLK A;  4GVM A;  3E9O A;  1BQN A;  1Z6R A;  4DF8 A;  2KTQ A;  2GWJ A;  4JKG A;  2HOE A;  1X1P A;  4DG1 A;  1MDU B;  2Z1G A;  3CPW M;  4NCB A;  1U2V A;  4WE1 A;  2HND A;  2VQF K;  4FK0 A;  4GNI A;  3HOS A;  4WFN L;  1HYS A;  4YOY A;  1VQL N;  2XRI A;  3OYE A;  4XEI A;  3J80 O;  3LWM A;  4CZK A;  4K25 A;  4JRP A;  4CFC A;  3NFA A;  3DLH A;  1NK9 A;  4PUO A;  1KCF A;  4DR1 K;  4UY8 O;  4E1N A;  3OBY A;  1JLA A;  1WSF A;  2Q1N A;  2YV0 X;  1ZC6 A;  4RW9 A;  3GOI A;  1L5U A;  3U4L A;  2G8H A;  1NKB A;  2H3G X;  3OYD A;  4BGA A;  4E7I A;  3O08 A;  1YIT N;  4AHT A;  3QFP A;  3QO9 A;  3NMU A;  2HHS A;  3SQ4 A;  4F2R A;  4O0I A;  3LAK A;  4A5B A;  3BP8 A;  1XMO K;  4FLX A;  5MLC Q;  5GAG P;  3ZT2 A;  2ZD1 A;  1HR0 K;  3CM5 A;  3CCU N;  4JN4 A;  4JAX A;  3CG7 A;  1R0A A;  3NE6 A;  2VG7 A;  3D2E B;  3VQE A;  3TAF A;  3HPO A;  1YAG A;  4BC4 A;  3Q7C A;  1BHL A;  3P1G A;  1P8Z A;  3DLL L;  1NK5 A;  1OVY A;  4L8R B;  1E4G T;  2JGU A;  4H0T B;  5FPN A;  1NKC A;  2AJQ A;  3HO1 A;  3P38 A;  4X64 K;  4CJQ A;  4M3W A;  2YHX A;  2DPN A;  2YX6 A;  4R79 A;  3QFU A;  5HOO A;  4ZTJ A;  4CJS A;  3CCR N;  3PX6 A;  4GV6 A;  2QWM A;  1RT5 A;  3T3F A;  3KWI A;  1RBR A;  3ASM A;  3AY9 A;  4DSL A;  4OGC A;  5AQK A;  1BGX T;  4KB0 A;  3MX5 A;  3JSM A;  1EO1 A;  3C7N A;  1E4F T;  3ZT0 A;  5A2Q O;  4GMJ B;  4KRF A;  1CXU A;  1JXB A;  2GV9 A;  1VQK N;  5BRE A;  5BPL A;  1G15 A;  3THV A;  4H5N A;  1C1A A;  3DLG A;  4DUY K;  3J81 O;  1FKO A;  1CZB A;  4HUE A;  5AQX A;  2B6A A;  3OS0 A;  3OYL A;  3OS2 A;  1YTA A;  4E1M A;  4LF5 K;  1VSI A;  1IKY A;  3O9Q A;  4FWO A;  2P9I A;  1TUU A;  2WBN A;  4BE1 A;  4BRP A;  4PL7 A;  4OLA A;  3NVM A;  4EHU A;  2QWL A;  4E7H A;  5FRN A;  5C2D A;  4G9Z A;  4AH9 A;  4M3U A;  3F5T A;  1TYQ B;  2DFH A;  3TAB A;  4B9S A;  5AQV A;  1RDW X;  2IDO A;  4CEB A;  4RW6 A;  4K8Z A;  4JI7 K;  2HHX A;  5JLH A;  4N5S A;  2P9S A;  5EVZ A;  2YNG A;  1KQS M;  3WUH A;  3ZSV A;  4RWT A;  3O3H A;  2PBD A;  1YUW A;  3BGR A;  3DXM B;  3SYZ A;  1NJZ A;  5HRO A;  3NCI A;  2OAN A;  5TKY A;  2F4V K;  3O4N A;  4DV3 K;  4BDP A;  4DFJ A;  1NK7 A;  4DS5 A;  2OPP A;  1QE1 A;  3GE1 A;  3CJB A;  5AJ3 K;  2Q97 A;  2JLE A;  4CIF A;  3OJS A;  3ENB A;  4IOX A;  2E20 A;  4CJP A;  3QB0 A;  3TAQ A;  1ATN A;  2G8I A;  2RHK A;  1RT6 A;  4KV8 A;  4X62 K;  3HM9 A;  3KLF A;  3LL3 A;  4E7J A;  3LWL A;  3THW B;  4Q0B A;  1NGG A;  1I3A A;  4BRO A;  3DRR A;  5CYM A;  4KH4 A;  3VES A;  5AQI A;  4X66 K;  4FLU A;  4FJK A;  1HMV A;  1U4B A;  1LAV A;  2HHH K;  3KTQ A;  2GWK A;  3T1Y K;  3UKU B;  2P9S B;  1RDC A;  4CED A;  3UB5 A;  3QIC A;  3HI0 A;  3Q7B A;  4HTL A;  4OKE A;  3ZSQ A;  5CE3 A;  3CC7 N;  4FLY A;  4M3Y A;  3VEW A;  3QET A;  1ILY A;  4JI1 K;  3D2F A;  3D7E O;  4M63 C;  2HB5 A;  3QEP A;  4Z4F A;  4LF6 K;  2O8D B;  4JI2 K;  4CW7 B;  1E3M A;  2NRW A;  2WTU A;  3SI6 A;  3O80 A;  4KHU A;  1VSH A;  4YNQ A;  4UQG A;  3AO4 A;  3L8B A;  2A40 A;  2E2P A;  2E6M A;  1RTH A;  3AA5 X;  2E6L A;  4BG9 A;  1K8K A;  2FSJ A;  4FM2 A;  3THX B;  5BRF A;  4EP4 A;  1HJR A;  4B3O A;  1HYV A;  4KTQ A;  1ZBH A;  2QWQ A;  1S6P A;  2NRV A;  3BZK A;  5AQT A;  3OYJ A;  4WQ4 C;  3THX A;  5C2F A;  3WNG A;  2R7Y A;  3HYF A;  4OO1 J;  3ULE A;  4IDK A;  3PO4 A;  1IBM K;  4OPA A;  1ZBI A;  3VQC A;  3UKR A;  4IO9 L;  3SUO A;  4KTZ A;  3VQB A;  5J2M A;  3V81 A;  4Z4I A;  4FVU A;  5KQ8 A;  3CF5 L;  3AVC A;  3L2W A;  4FZZ A;  5GIP A;  1OH8 A;  1NMN A;  2O8C B;  2E4L A;  3ZSO A;  1NK8 A;  3THY B;  4B9V A;  1YF5 L;  3AVF A;  4BG8 A;  2OCE A;  5BPN A;  2VCP A;  1J6Z A;  4JV5 K;  4BR9 A;  3EE8 A;  2VG5 A;  1DTT A;  1RT7 A;  2X6N A;  5HBM A;  4B9L A;  4EZ6 A;  5HRN A;  1BDG A;  2P9P B;  4QCL A;  5EU7 A;  3KLG A;  4ILG B;  3G71 N;  3V9U A;  3HJF A;  2P51 A;  5C42 A;  2F9T A;  1S5J A;  4EAH D;  1MWK A;  5JIC A;  1VSF A;  3LDN A;  4AHC A;  2YHB A;  4KRE A;  5CZ2 A;  1C0M A;  1ASU A;  2HNZ A;  4ISG A;  2YJF A;  4DSK A;  2O8E A;  5FDL A;  1NOZ A;  1OH5 A;  2CGL A;  2DFF A;  2OPR A;  1WBD A;  4CFA A;  3HRG A;  3KVG A;  1SUQ A;  3NVK A;  1XMQ K;  4FJM A;  3OYN A;  1WSG A;  3TAE A;  4DR3 K;  4BRE A;  1Z05 A;  3MN5 A;  4GKJ K;  3KIO A;  5KGX A;  4I9L A;  1WAF A;  3CCS N;  5J1E A;  2XY7 A;  4C8N A;  1K73 O;  2CGJ A;  2P9N A;  2OZM A;  1VSM A;  4O0J A;  4O55 A;  3LZI A;  4O44 A;  1ITG A;  1RT1 A;  4CGD A;  3NH2 A;  3EO3 A;  3WEE B;  4U67 L;  1Q7Y O;  1BL3 A;  4I9Q A;  3CJ9 A;  2OTL N;  4H4M A;  1U49 A;  2ZJP L;  4CZI A;  2D0O A;  3VGL A;  1P90 A;  5I42 A;  1TV6 A;  1HX1 A;  3I8D A;  3FR0 A;  3QML A;  4I2P A;  3NGY A;  3H3O B;  3C94 A;  4YDU A;  3TTC A;  2GEM A;  1HNI A;  2A6A A;  4BR0 A;  2IIR A;  3V9Z A;  3VQD A;  3S3O A;  3AVJ A;  4FWK A;  4J2A A;  4JK7 A;  2YKN A;  2RN2 A;  3N4P A;  1DT9 A;  4CER A;  2FSK A;  1M90 O;  1T05 A;  2D0C A;  2BDP A;  1RT4 A;  3QIN A;  1F21 A;  2QWP A;  2IOC A;  4EP5 A;  4BWJ A;  3J7A P;  1BU6 O;  1YTU A;  4GV3 A;  4CJU A;  3EE9 A;  3P5J A;  3CJ7 A;  1B92 A;  3C65 A;  1TL1 A;  3WQU A;  3F73 A;  4HVJ A;  5KRT A;  3AAR A;  4XH1 A;  4FOE A;  4NLB A;  1SV5 A;  3LM9 A;  1YJ9 N;  1QQC A;  2F8S A;  3QDK A;  5LL6 Z;  3KZB A;  1KFD A;  1JJ2 M;  5AQQ A;  4M7X A;  5DK5 A;  4YOW A;  3ZX2 A;  4H8K A;  4CBX A;  2BGG A;  2O4I A;  1U04 A;  3I56 N;  3CER A;  3K9K A;  4M41 A;  3GL1 A;  1HUX A;  1Y97 A;  3EZ5 A;  4DU1 A;  3MED A;  3FFI A;  4KI4 A;  1GOC A;  1NBW A;  3AV9 A;  4JI4 K;  3D2E A;  4LFB K;  2GEL A;  3GG4 A;  4J2B A;  4ILH A;  3MK6 A;  1R59 O;  1JXE A;  4F8R A;  2BAN A;  2ZJR L;  3J7Y P;  4DTX A;  1KSP A;  4DQS A;  3OVN A;  3VQ6 A;  4FWR A;  3AVH A;  1IG9 A;  4ILJ A;  5M1K A;  5AQU A;  4JKD A;  4CE9 A;  2X6S A;  3K5L A;  2P9L A;  3WNH A;  4HCB A;  4BC2 A;  4NO7 A;  3AAP A;  4MLH A;  4FWQ A;  3ID8 A;  4H03 B;  3RRG A;  3CMA N;  1RCH A;  2P9K A;  1VSD A;  4DTJ A;  1ASV A;  3IG1 A;  1BO5 O;  3RMC A;  3SMS A;  4DKW A;  3DYA A;  3L2V A;  1MA9 B;  3HPH A;  4L3Q A;  3L3V A;  3U8X A;  1WSJ A;  3KD1 E;  5IT9 O;  4CEE A;  4C1N I;  4C8K A;  1J54 A;  3M8Q A;  4CGG A;  5BR9 A;  4WFA L;  3F9K A;  5ADX A;  4BDY A;  3R8E A;  1RBV A;  4FJ7 A;  2YKM A;  4CD3 A;  3MEE A;  2VYP A;  3CJC A;  3NHG A;  1UAX A;  3ZCM A;  4K41 A;  2FSN A;  2HF3 A;  3CME N;  4IOA L;  5AZJ A;  4JKG B;  1BCO A;  3PLA A;  1LWF A;  4XIU A;  4RCH A;  1FW6 A;  4ELV A;  3ZT4 A;  1ZYQ A;  2NRR A;  4IXC A;  1KLN A;  1GLB G;  5FPE A;  3NF8 A;  4YHH K;  3SLC A;  4JHD B;  3OYF A;  3L2U A;  3R1X A;  1K8K B;  3FZF A;  3FGU A;  3NF7 A;  3MDQ A;  4Y0W A;  2V52 B;  4FM0 A;  3T69 A;  1UWB A;  4LSN A;  2OPS A;  2UXC K;  1NGD A;  4OPH A;  4KHY A;  4BVP A;  4BQL A;  1T6C A;  3V9W A;  1NGB A;  3LP1 A;  3ULE B;  1Y64 A;  3RSE A;  4H4O A;  1I94 K;  1BQM A;  2O4G A;  4JHD A;  2CH5 A;  1NK4 A;  1JLE A;  1HKB A;  3R9P A;  3NGZ A;  2HHU A;  1BIS A;  1RIL A;  3DLR A;  3JS6 A;  3A5L C;  3ZT1 A;  4CEC A;  2QKB A;  1TVR A;  4FZX C;  4CJF A;  3R3L A;  3VQ8 A;  3VTI A;  2Q3S A;  4XH5 A;  3QLH A;  1NM1 A;  3LM2 A;  4CGH A;  3TAR A;  3VET A;  5AQW A;  3VTH A;  2G8K A;  4FJ8 A;  4A2A A;  3CIP A;  3KK7 A;  1RTD A;  4FW2 A;  4LY7 A;  3BUZ B;  4DFP A;  4PKG A;  3EL2 A;  1I39 A;  3L3U A;  5B8H A;  2D0B A;  4NYN A;  4DUZ K;  3V1R A;  3NF6 A;  3M8S A;  4IG0 A;  4BRA A;  4BRQ A;  4FLZ A;  3PY8 A;  3C6H A;  1BA1 A;  5JMV A;  2VWJ A;  4CHP A;  1RNH A;  4WF9 L;  4DU3 A;  5AQZ A;  4CZE A;  4QS9 A;  4Y1C A;  4AF1 A;  4OLB A;  4QOZ B;  2RF2 A;  4KHW A;  5C0Y A;  1C0T A;  4FWL A;  4Z4C A;  1KFS A;  4B9N A;  1S22 A;  4YOX A;  3SCX A;  4M3T A;  4EFH A;  3UKR B;  3SAF A;  4W5O A;  3U9D A;  4Z94 A;  1VSJ A;  2O8B A;  4TSX A;  4N47 A;  3HXM A;  4JS4 A;  4ELU A;  4LSL A;  1T8E A;  2OYQ A;  2W6K A;  2IC3 A;  2WON A;  1GLA G;  1T03 A;  2KKZ A;  5CY4 A;  3IMX A;  4CJE A;  1IV0 A;  3S3M A;  1WB9 A;  3VQ9 A;  3KK1 A;  4B8A B;  4JD2 B;  3A5M C;  4JRQ A;  1X9M A;  4CHN A;  4FZY A;  4OX9 K;  3SJH A;  3H46 O;  2HHV A;  4EZ9 A;  3B6O A;  4MLE A;  4B1W B;  1L3V A;  4NB4 A;  4JK8 A;  3H08 A;  1RTI A;  2QXL A;  1Q86 O;  4DCH A;  4DWI A;  4JI3 K;  4CHO A;  4E0D A;  3TAP A;  2YNI A;  2EX3 A;  3KLE A;  3SUN A;  2WUS A;  2J4R A;  2Q0R A;  5EX5 A;  4CZG A;  2YHA A;  4IBN A;  4WYB A;  3ZSY A;  3KJV A;  4ID1 A;  4NLC A;  2E2O A;  3T7Z A;  3QEX A;  3C6T A;  4O8U A;  2W6L A;  3PSI A;  3A5N C;  5AQN A;  4KHP K;  3SBT A;  3OYG A;  2QWN A;  3KK2 A;  1EET A;  1GLF O;  2VWK A;  1TAQ A;  5JLF A;  3K57 A;  3LPU A;  3QNO A;  4BRI A;  5ADX H;  1N33 K;  3V1Q A;  4AHV A;  4CZF A;  4CJR A;  1YVN A;  2D0A A;  2E88 A;  3EZW A;  2Q2R A;  3J8A A;  2E2Q A;  3TTD A;  3L2R A;  3K59 A;  4OPJ A;  2Z1H A;  4FWM A;  4ZTF A;  3ZYY X;  1KLM A;  1FJG K;  4H0Y B;  5J2N A;  3MMV A;  4BR4 A;  3IFR A;  2KZM A;  1L3U A;  4A5A A;  4DR6 K;  4YFU A;  4IG3 A;  4FJN A;  1IBL K;  5F2R A;  2OTJ N;  2ZGZ A;  4B1U B;  4DTR A;  4PHT X;  3QBX A;  3WXI A;  2XY8 A;  5BN8 A;  1WNS A;  4DTP A;  3NDK A;  3S9H A;  1VSK A;  5M1N A;  5GAD P;  1U45 A;  2X78 A;  4IJN A;  1EKE A;  2G8F A;  1QQO A;  3DRP A;  4J2E A;  1LV5 A;  3A8Y A;  5DMR A;  4RW8 A;  2QWO A;  5LMU K;  4YOT A;  5KGW A;  3QBW A;  1N6Q A;  3I0S A;  1NJY A;  1TKX A;  3O9U A;  1VQ5 N;  4JI0 K;  4ISE A;  5AQY A;  1S1V A;  4IFE A;  1KXP A;  3VQ4 A;  3OW2 M;  4KB1 A;  2ASO A;  3PUF A;  4GVE A;  4IEI A;  2V7Z A;  2FBV A;  2DY4 A;  3CPE A;  4CF2 A;  3MN9 A;  4DQQ A;  2QK9 A;  4CVN E;  3VGM A;  1IKW A;  4CZL A;  4BR5 A;  2NLX A;  3HM8 A;  3MCA B;  4JKE A;  3SV3 A;  4AHR A;  4C1N K;  2HHT A;  3ITH A;  4YY3 K;  3ALY A;  5AR0 A;  3DOL A;  3AO2 A;  1IKX A;  5HL7 L;  1GOB A;  3K2P A;  3C6U A;  5LJW A;  1GLC G;  2KHO A;  3NF9 A;  2VQE K;  1N8R O;  1U2V B;  2PY5 A;  4HTU A;  3L0Q A;  2PZS A;  4CJ7 A;  3HBT A;  1WSI A;  4CES A;  3OYA A;  3MWP A;  1JKH A;  4IJA A;  3FZL A;  3RWU A;  1KVA A;  3OYC A;  4DTM A;  1H1V A;  4DQP A;  4IEE A;  3ZLJ A;  4DB3 A;  3DXK A;  3E01 A;  3F9M A;  1YIJ N;  4E1J A;  3FLC O;  4DR5 K;  4DF4 A;  4KHS A;  3CET A;  4OGE A;  2P9N B;  5IWA K;  1U47 A;  2G8U A;  4OKJ A;  4CBU A;  1HNV A;  5J2P A;  3QIP A;  1VQ9 N;  1VRU A;  1KAZ A;  3CYM A;  2YHY A;  2IVP A;  4Z4H A;  1JLQ A;  4CZJ A;  2Y1J A;  2ZWH A;  3OYH A;  1A5X A;  2PAV A;  3J7Z O;  1QHA A;  1TKT A;  2VGN A;  4ELT A;  2XO7 A;  4DR2 K;  4DLG A;  3AVI A;  1NOY A;  3OY9 A;  4KBO A;  4AM6 A;  4LH5 A;  4N41 A;  3NH0 A;  4A2B A;  3LDQ A;  1EXQ A;  4MDB A;  4H0O A;  1OVQ A;  4F3O A;  1REV A;  4IDH A;  2HHW A;  4F9O A;  3AVK A;  4H0X B;  3K5O A;  3K9J A;  5HRS A;  1JCE A;  4HUG A;  3DAW A;  4FCY A;  4JI8 K;  1ESV A;  5T7B A;  3MN7 A;  3EN9 A;  4IOC L;  4AM7 A;  3KHY A;  4CEF A;  4A62 A;  3U9Z A;  2P1J A;  3P31 A;  3RMB A;  5E84 A;  3UIQ A;  4LFC K;  1RDU A;  1DTQ A;  2O8E B;  3VQQ A;  2QI2 A;  1Q18 A;  3AVG A;  3VEZ A;  5EXW A;  5E26 A;  4DFM A;  3O9R A;  4Z4G A;  4NCA A;  3CCM N;  5AQL A;  3VEV A;  1DEJ A;  2ASP A;  3TR8 A;  1RBS A;  3F2K A;  1HKG A;  1SL0 A;  1YVU A;  5AZI B;  4CFD A;  4OPK A;  3VA0 A;  2IVO A;  5CHI A;  2V51 B;  1D9D A;  3JXU A;  4CEA A;  3RMA A;  3QES A;  3THY A;  3CQ8 A;  3D45 A;  2UUB K;  3WXL A;  3HP9 A;  3E66 A;  3H1V X;  5FLX O;  3SMP A;  3K5N A;  3QEI A;  4DR4 K;  5M1O A;  4O8K A;  3SK3 A;  4CFB A;  3K58 A;  4BE2 A;  4CJW A;  3MN6 A;  2GX9 A;  2QA4 N;  4H5V A;  1RT2 A;  4B9T A;  4KH5 A;  4CEO A;  4CJK A;  2BTF A;  1ASW A;  5KPR A;  3WXK A;  2HMI A;  1KAY A;  2ASM A;  4IFV A;  3TSQ A;  5I9E B;  2NRX A;  1EX4 A;  1NNE A;  2IS3 A;  1ATR A;  4H5W A;  5JS1 A;  4CHQ A;  1S9G A;  1WSH A;  3WXJ A;  2ITG A;  4IKF A;  5AFU H;  3M8R A;  4HUF A;  3L2Q A;  1LOT B;  2P9U B;  3BF1 A;  3OA9 A;  2KQ2 A;  3ZT3 A;  4HWI A;  4WCE L;  1UA1 A;  2QTD A;  1TK0 A;  4M3Z A;  4FXD A;  1D9F A;  2HBM A;  3DJC A;  5F0X A;  4FJX A;  4BRF A;  3V1O A;  4FLT A;  3VN5 A;  3U6F A;  3BDP A;  2NZT A;  1T6D A;  5KTQ A;  1SKR A;  2ZM6 K;  5KRS A;  3DMJ A;  3ZSW A;  1S1T A;  2KZZ A;  3HZ6 A;  4WFB L;  4GW6 A;  1RTJ A;  3MEC A;  4DSF A;  2IVN A;  3L4I A;  3TPQ A;  4WQ5 A;  2ZF5 O;  3CFP A;  3V6D A;  4KTW A;  3O8M A;  3O4W A;  1W7A A;  1J5O A;  5FPM A;  2D4W A;  4N76 A;  2F8T A;  4JKA A;  3DLB A;  4J2D A;  3K0S A;  3PSF A;  4LF8 K;  1M1K O;  4YOU A;  1W9H A;  1WSE A;  4M45 A;  1B9F A;  4CJ4 A;  3ULD A;  5H1S Q;  2WOM A;  4DV5 K;  4JK9 A;  4PWD A;  1SZ2 A;  4E19 A;  4QAG A;  1XI1 A;  1CZ9 A;  4BRD A;  3V4I A;  4FK4 A;  1CZA N;  1FXX A;  3KWG A;  3ZEU B;  4H5R A;  2A3Z A;  2A41 A;  4V19 S;  2UYT A;  1GLD G;  1EP4 A;  2KW4 A;  1U6Z A;  4PL8 A;  4DQ8 A;  3VPZ A;  4FWN A;  3TI0 A;  3SJJ A;  4PY5 A;  4FVM A;  4B1X B;  5BPM A;  1S72 N;  1HNZ K;  4XH4 A;  4DSE A;  2I5J A;  3M8P A;  3VGK A;  3RR7 A;  3N4Q A;  3JYT A;  4DU4 A;  1VQ6 N;  1IJJ A;  3DM2 A;  4JNE A;  2NRH A;  3DXK B;  3HVR A;  5I3U A;  1NWK A;  3T1A A;  4DTS A;  4C23 A;  1N5Y A;  4KO0 A;  3DI6 A;  1VQO N;  2A5X A;  3HSC A;  1XQS C;  2G8V A;  3SBG A;  3C6A A;  3PX0 A;  3L6Q A;  4CEZ A;  1VQM N;  2QWR A;  3DRS A;  3C7N B;  3E9L A;  2FF3 B;  1KAX A;  3CJA A;  3E9P A;  3CXC M;  4FK2 A;  2VGM A;  3GDQ A;  3C0B A;  4I7F A;  5C10 A;  3DOK A;  3LDL A;  3TAM A;  2I7P A;  4CJT A;  3QER A;  4CI6 A;  4CHY A;  4AHU A;  1IKV A;  2QKK A;  3VQA A;  2F7T A;  4EHT A;  2OPQ A;  1QZ5 A;  3KK3 A;  4C8O A;  1YJN N;  1BWF O;  3NGI A;  1RBT A;  3CCE N;  2P5O A;  1NGJ A;  1TAU A;  1BOT O;  3QEW A;  1VSE A;  5GAH P;  2JWK A;  2FBX A;  1QZ6 A;  2F96 A;  3IRX A;  1VQN N;  5FRO A;  1BI4 B;  3I33 A;  4I2Q A;  3ZEU A;  2NRZ A;  2FBT A;  3O3F A;  3G25 A;  3PV8 A;  2BUP A;  1ZBU A;  2GUP A;  4KI6 A;  4O4G A;  3WEE A;  5CYQ A;  4DQR A;  4KPY A;  3O9S A;  2W41 A;  3AVB A;  3W0L A;  3O4Q A;  3HT3 A;  3K5M A;  4IFY A;  4FJ9 A;  1Q9Y A;  1DGK N;  1YJW N;  3LAN A;  5JS2 A;  1YI2 N;  3B6P A;  1X3N A;  4MQ3 A;  4B3M K;  3OTO K;  3W3D A;  4DTN A;  1N34 K;  4OJR A;  3TTF A;  4K43 A;  3M3Z A;  4B08 A;  3QEV A;  5M1Q A;  1WOQ A;  3CJ1 A;  1X9J A;  1NJI O;  3VA3 A;  5AQR A;  4OKK A;  3SQ1 A;  3RR8 A;  4FSV A;  4JLH A;  1BUP A;  4FYD A;  1N32 K;  5JVH L;  1S1W A;  1BI4 A;  2W40 A;  3TWH A;  3KLI A;  2O8F A;  1QSL A;  2CH6 A;  3OYK A;  1SS6 A;  3TU5 A;  3BEX A;  5J2Q A;  1C1B A;  2XY6 A;  2G8W A;  5CR4 A;  1QQN A;  1DKG D;  4I6M B;  1HNX K;  5M1P A;  3CC4 N;  4HCC A;  3ISN C;  3EYZ A;  1SL1 A;  2Z1I A;  1YHQ N;  2P9U A;  1XNQ K;  3AVM A;  3ENO A;  3OBW A;  2E2N A;  1CXQ A;  2D5R A;  3AVL A;  4KKO A;  4ICL A;  2FF6 A;  1OKJ A;  5HP1 A;  3M6G A;  1K9M O;  1QS4 A;  4Y1D A;  3KD5 E;  1JCG A;  3ZX0 A;  5AQF A;  4A61 A;  3SZ2 A;  3ZET B;  1RDA A;  1JLC A;  3LDP A;  3LP3 A;  2ZGY A;  4FLW A;  1NGE A;  2X74 A;  2LSN A;  2PYJ A;  3RVC A;  2HVH A;  4BRM A;  2UXD K;  5KI6 A;  4IZ9 A;  5AQG A;  3MXM A;  3JAM O;  4J8F A;  1IO2 A;  1TKZ A;  1NGF A;  4BRN A;  1J9A A;  3TSU A;  4DSI A;  3VEO A;  1UOC A;  4Z0U A;  4M3R A;  1Q8I A;  1VQ7 N;  1IG8 A;  1NMD A;  1SKW A;  3AO3 A;  4O5F A;  3CHW A;  2HHQ A;  3G0Z A;  2UU9 K;  1HPM A;  2O8B B;  3TAN A;  4MO4 A;  4CF9 A;  4KHQ A;  5HRP A;  4DV6 K;  5KPZ A;  4KHN A;  3MAQ A;  1NJW A;  4B9M A;  3I55 N;  3PO5 A;  3AAQ A;  3AA2 A;  3MXI A;  2Z1J A;  2ITM A;  3HST B;  4FWP A;  1C1C A;  1QVF M;  1W0H A;  3D2F B;  2Y1I A;  2A42 A;  4DV7 K;  4FM1 A;  3FE1 A;  1J53 A;  5FRM A;  1N36 K;  3SAH A;  5JVG L;  4IO8 A;  4WQ4 A;  2E8A A;  4B1Y B;  1XHZ A;  2P9L B;  4CF1 A;  4RG8 A;  2KFZ A;  3B8A X;  4NXM K;  1RT3 A;  1W97 L;  3ZX3 A;  4DLE A;  3O9T A;  1FKP A;  1JLF A;  4AQY K;  3OS1 A;  1EWR A;  2GBZ A;  1YT3 A;  1OH6 A;  5D3G A;  2HMP A;  4FO0 A;  4F2S A;  3AGR A;  3VER A;  3EY1 A;  3AO5 A;  1S3X A;  4DV4 K;  3KKS A;  2GUI A;  1VHX A;  1QSY A;  1GOA A;  1K6Y A;  2Q36 A;  2YCH A;  4MDA A;  2HVI A;  5K14 A;  4KH6 A;  1VAZ A;  2HST A;  4K0K K;  3VEN A;  1X9W A;  2NRT A;  2P9P A;  4CBW A;  4FJI A;  4B9U A;  1TK8 A;  2QEX N;  3ZSZ A;  3TAG A;  4JI5 K;  2HF4 A;  3HL8 A;  1BIU A;  1D5A A;  4CGF A;  4C8M A;  3HVT A;  1DLO A;  4FLV A;  5EY4 A;  2QXF A;  3MCP A;  4M42 A;  3P83 D;  3U3G A;  1HNW K;  3R6M A;  1NGC A;  3M1F A;  5AQJ A;  4CZM A;  4E3S A;  2Q0U A;  4BRL A;  3AGK A;  2YHW A;  3O6W A;  1TYQ A;  2E1Y A;  3RTV A;  3WXM B;  3KKR A;  4DV0 K;  5FPD A;  3PIO L;  2AA4 A;  2PFU A;  2ZQB A;  1WUA A;  3V9S A;  2YJE A;  3FZH A;  4BQZ A;  3ZET A;  1ZBS A;  2B4J A;  2ZE2 A;  4BRK A;  4BDZ A;  3SUP A;  3GBT A;  3FFK B;  2WFB A;  2BE2 A;  4CK3 A;  1HKC A;  5HRR A;  3SV4 A;  2XHB A;  3BF3 A;  4JKB A;  1QHT A;  4WQ5 C;  5AQM A;  2JWL A;  4FPA A;  2EWS A;  4FJL A;  3OJU A;  4LF7 K;  3HPG A;  2GTD A;  4DS4 A;  1MWM A;  4NXN K;  1T3V A;  1IBK K;  5AZI A;  1BCM A;  3AA4 A;  3P39 A;  4BRH A;  3LAM A;  4BE0 A;  3CQY A;  3VF4 A;  1C6V A;  5SZT A;  3IDH A;  3OYI A;  1Z26 A;  1EQY A;  1T7P A;  1ZBL A;  2P9K B;  1WBB A;  1C0F A;  3O1W A;  4F4K A;  3LDO A;  4CGJ A;  3KLH A;  3MWT A;  3QNN A;  3I8B A;  4YOV A;  3UKU A;  1V4S A;  3VEX A;  5HLF A;  2AP1 A;  3MEG A;  1HLU A;  4M7Y A;  4FJ5 A;  1NU0 A;  1VK0 A;  1JL1 A;  1LW2 A;  2A1S A;  1NGH A;  2W42 A;  3LP2 A;  2B5J A;  3EKU A;  5AQH A;  4NCG A;  1RBU A;  2O8F B;  1K8A O;  1V4T A;  5AFU A;  3BY5 A;  1Z25 A;  3DLE A;  1X3M A;  1U48 A;  1WAJ A;  4ZHR A;  1JLG A;  3LP0 A;  4ISF A;  1QVG M;  4FJJ A;  4FOI A;  2OZS A;  3C95 A;  4B9Q A;  4CCH A;  2UUA K;  1IH7 A;  1S1U A;  5KPT A;  3DXM A;  1EWQ A;  5BRH A;  1KTQ A;  2FLO A;  3M5R A;  3SQ2 A;  4BRC A;  3CC2 N;  4JKF A;  4CIG A;  2A1R A;  1OH7 A;  2I7N A;  1LWE A;  5C15 A;  1SL2 A;  4W5T A;  1VQ4 N;  5BRD A;  3AA3 A;  3HP6 A;  1XNR K;  1SAZ A;  2DFE A;  1TGO A;  5E41 A;  1NKE A;  3HTV A;  4AHS A;  4K8X A;  4C8L A;  3CFO A;  1XUP O;  4FL9 A;  4PQU A;  3VQP A;  5GIO A;  3RRH A;  1KVC A;  4PKH A;  3LDS A;  2OA8 A;  1S6Q A;  3T1H K;  2NNW A;  4BVO A;  3CM6 A;  2ETJ A;  5BR8 K;  4HHT A;  4BWM A;  4G1Q A;  4FJG A;  4EIA A;  4CF0 A;  3V9X A;  2YI1 A;  4Z4E A;  4AIL C;  1C0U A;  1RDD A;  1VQ8 N;  3IAY A;  4CJ3 A;  3LZJ A;  4DSJ A;  4I6M A;  1T44 A;  2Q31 A;  1Q82 O;  4JI6 K;  3IS9 A;  3VEY A;  2V7Y A;  3NH1 A;  1HRH A;  4B1V A;  1BG3 A;  3WQT A;  4B3S K;  1UA0 A;  4JEP A;  5C24 A;  3WT0 A;  2FC0 A;  4FJH A;  2FXU A;  1NK6 A;  2HW3 A;  3VQ5 A;  1SKS A;  1NJX A;  5AQO A;  4CF8 A;  1J5E K;  4B3T K;  3G10 A;  4BC3 A;  1A5W A;  1SQK A;  4LH4 A;  4BY9 C;  1D8Y A;  4N56 A;  4PA1 A;  2VWB A;  3AVA A;  3AO1 A;  4CK1 A;  1NG9 A;  3L4Q A;  3OYM A;  1LAW A;  2E1Z A;  1S1X A;  3ATV A;  3WNF A;  4W5Q A;  1WLJ A;  3O3G A;  2YNF A;  3VQ7 A;  2F9W A;  3P4I A;  4K42 A;  1GLL O;  1QSS A;  1A5V A;  2E5L K;  2RKI A;  3UE5 A;  3RMD A;  2ATQ A;  4W5N A;  4MO5 A;  3VMF B;  2VG6 A;  4RW7 A;  2CGK A;  4FW1 A;  1W2B M;  4DFK A;  1HQU A;  2KLA A;  3ATU A;  2UUC K;  1LW0 A;  1TK5 A;  1HQE A;  1L3T A;  3G4S N;  1G99 A;  3FZM A;  4DTO A;  2QM1 A;  1NGA A;  3CQX A;  4Q5V A;  1VQP N;  3H45 C;  3ID6 A;  1XWL A;  1FK9 A;  3S41 A;  4YOR A;  3VOV A;  2HBK A;  1KRP A;  3VF6 A;  1YXQ A;  4GV9 A;  4YDU C;  5LJV A;  4LFA K;  3EEQ A;  4JKC A;  4RTF D;  5AQS A;  4BAC A;  1KC8 O;  3FZK A;  1O1W A;  1XC3 A;  4CJV A;  4E7L A;  2O8C A;  1MU2 A;  1RFQ A;  2RPI A;  4KAZ A;  4B8C A;  3RSE B;  1HYZ A;  1XHX A;  4B1Z A;  3IUC A;  4CEQ A;  1HPZ A;  1B9D A;  3WNE A;  1Q81 O;  1GLJ O;  5M1F A;  1HJO A;  1LWC A;  5F1X A;  2EHG A;  2PYL A;  1WN7 A;  4IWV A;  2UXB K;  4E89 A;  1BIZ A;  2NUB A;  2ZJQ L;  4JD2 A;  3CCQ N;  1D4X A;  4DHY A;  3AVN A;  4CGI A;  3PX4 A;  4ID5 A;  2IGI A;  2D0P A;  1CLQ A;  4DV1 K;  1VRT A;  1RDB A;  1VSL A;  4LF9 K;  4CD1 A;  3MX2 A;  1TKD A;  2O8D A;  4LF4 K;  4FWS A;  3A5O C;  4CJ5 A;  2WC9 A;  4FPB A;  4H0V B;  3CI5 A;  3SPZ A;  4BC5 A;  3VF2 A;  4JS5 A;  1NLV A;  1S9E A;  3OYB A;  4MFB A;  3SQ0 A;  3LPT A;  5CZ1 A;  4CJL A;  5BN9 A;  4BGB A;  5KQD A;  2D1K A;  1KD1 O;  3CD6 N;  1X9S A;  4JYA K;  1LCU A;  4U7B A;  4O5B A;  3A2F A;  5ELZ A;  5EOY A;  1JL2 A;  5GIN A;  5LY3 A;  4H5T A; 
#chains in the Genus database with same CATH homology
 4AHR A;  2HHT A;  3ITH A;  4O44 A;  3LZI A;  1ITG A;  4LD0 A;  3TAN A;  1RT1 A;  3ALY A;  2FBY A;  4CF9 A;  4CGD A;  5HRP A;  4KHQ A;  4KHN A;  3MAQ A;  3NH2 A;  3DOL A;  3AO2 A;  1IKX A;  4RW4 A;  3S3N A;  1BL3 A;  4CK2 A;  1GOB A;  3K2P A;  3C6U A;  1NJW A;  4B9M A;  3NF9 A;  4I9Q A;  4R5P A;  3PO5 A;  4H4M A;  4M3X A;  3AA2 A;  3MXI A;  1ZBF A;  2PY5 A;  2Z1J A;  4HTU A;  3HST B;  1U49 A;  4OVL A;  2PZS A;  4CIE A;  1L3S A;  1C1C A;  1WSI A;  4CES A;  3OYA A;  5SWM A;  2IAJ A;  1W0H A;  2XY5 A;  5I42 A;  1JKH A;  1TV6 A;  3I8D A;  3ZSX A;  2Y1I A;  4I2P A;  3NGY A;  3RWU A;  1KVA A;  3C94 A;  3NBP A;  4FM1 A;  4F3T A;  3OYC A;  1J53 A;  1HNI A;  4DTM A;  5FRM A;  1KVB A;  4DQP A;  3NAE A;  1QTM A;  3E01 A;  3V9Z A;  1XHZ A;  1Q9X A;  3VQD A;  3SUQ A;  4DF4 A;  4KHS A;  3S3O A;  2YNH A;  4CF1 A;  3AVJ A;  4RG8 A;  2KFZ A;  2DTU A;  4J2A A;  4OGE A;  1U47 A;  1RT3 A;  3QIO A;  2G8U A;  3D0P A;  4NYF A;  2YKN A;  4OKJ A;  1HNV A;  4DLE A;  3SNN A;  2P5G A;  2RN2 A;  1FKP A;  1JLF A;  3QIP A;  4CER A;  1VRU A;  3OS1 A;  3T19 A;  3CFR A;  5J2P A;  3CYM A;  4Z4H A;  1T05 A;  3HK2 A;  2D0C A;  1JLQ A;  1RT4 A;  2GBZ A;  2BDP A;  2Y1J A;  1YT3 A;  3QIN A;  1F21 A;  3OYH A;  1A5X A;  1TKT A;  4DQI A;  4ELT A;  3ZSR A;  2IOC A;  5D3G A;  2XO7 A;  4EP5 A;  4BWJ A;  5C25 A;  1YTU A;  4F2S A;  4DLG A;  4CJU A;  1XC9 A;  3P5J A;  4W5R A;  3EY1 A;  1B92 A;  3AO5 A;  1TL1 A;  3F73 A;  3AVI A;  4HVJ A;  3KKS A;  2GUI A;  4CHZ A;  1NOY A;  1QSY A;  3OY9 A;  3SPY A;  4LH5 A;  1GOA A;  5KRT A;  3NH0 A;  1K6Y A;  3U3Y A;  1NK0 A;  4N41 A;  2HVI A;  1EXQ A;  5K14 A;  1SV5 A;  1TL3 A;  4F3O A;  1REV A;  2HHW A;  1X9W A;  2KFN A;  1QQC A;  2F8S A;  4FJI A;  3AVK A;  3LAL A;  3MXJ A;  2HNY A;  1TK8 A;  4B9U A;  3K5O A;  1KFD A;  5HRS A;  4FCY A;  4HUG A;  3ZSZ A;  5DK5 A;  4KFB A;  4DMN A;  3I0R A;  5T7B A;  3TAG A;  3HL8 A;  1BIU A;  1D5A A;  4H8K A;  4CGF A;  4E7K A;  4DTU A;  1JLB A;  4C8M A;  3HVT A;  1DLO A;  3DLK A;  4GVM A;  4CEF A;  2BGG A;  1BQN A;  1U04 A;  2O4I A;  4DF8 A;  4FLV A;  2KTQ A;  3RMB A;  2P1J A;  2QXF A;  3UIQ A;  4M41 A;  4M42 A;  3P83 D;  3U3G A;  1X1P A;  4DG1 A;  1Y97 A;  1DTQ A;  4E3S A;  3EZ5 A;  4DU1 A;  2Z1G A;  3MED A;  3FFI A;  3VQQ A;  4NCB A;  4KI4 A;  3AV9 A;  1GOC A;  4WE1 A;  2HND A;  3AVG A;  4FK0 A;  3RTV A;  4J2B A;  3KKR A;  1HYS A;  4DFM A;  1JXE A;  4F8R A;  2XRI A;  2ZQB A;  2BAN A;  3OYE A;  4Z4G A;  4NCA A;  3V9S A;  4DTX A;  3LWM A;  1KSP A;  4DQS A;  2B4J A;  4JRP A;  3OVN A;  4CFC A;  3TR8 A;  1RBS A;  3VQ6 A;  2ZE2 A;  3NFA A;  3DLH A;  4BDZ A;  3AVH A;  1NK9 A;  1KCF A;  3SUP A;  4PUO A;  1SL0 A;  1YVU A;  1IG9 A;  4CFD A;  4OPK A;  2BE2 A;  4CK3 A;  3VA0 A;  4CE9 A;  2X6S A;  4E1N A;  5HRR A;  1D9D A;  1JLA A;  1WSF A;  3K5L A;  3SV4 A;  4CEA A;  2XHB A;  3WNH A;  4HCB A;  3RMA A;  2YV0 X;  4RW9 A;  3QES A;  3CQ8 A;  1L5U A;  1QHT A;  2G8H A;  1NKB A;  3D45 A;  3OYD A;  4E7I A;  3HP9 A;  4FJL A;  3OJU A;  3HPG A;  4AHT A;  3RRG A;  4DS4 A;  3QO9 A;  1RCH A;  3K5N A;  3QEI A;  4DTJ A;  1VSD A;  3SQ4 A;  4F2R A;  2HHS A;  1BCM A;  3AA4 A;  1ASV A;  3IG1 A;  4CFB A;  4O0I A;  3LAM A;  3LAK A;  3K58 A;  4CJW A;  4BE2 A;  4BE0 A;  3DYA A;  3L2V A;  4FLX A;  3HPH A;  1RT2 A;  3ZT2 A;  2ZD1 A;  4B9T A;  1C6V A;  3L3V A;  4CEO A;  5SZT A;  3CM5 A;  1WSJ A;  4CJK A;  3OYI A;  3KD1 E;  1ASW A;  1Z26 A;  4CEE A;  1T7P A;  1J54 A;  3M8Q A;  4CGG A;  1ZBL A;  4C8K A;  2HMI A;  3F9K A;  3CG7 A;  4IFV A;  1R0A A;  4BDY A;  3NE6 A;  4F4K A;  2VG7 A;  3VQE A;  3TAF A;  3HPO A;  4CGJ A;  1BHL A;  3P1G A;  3KLH A;  1RBV A;  3QNN A;  4FJ7 A;  1EX4 A;  2YKM A;  2IS3 A;  3MEE A;  5JS1 A;  4CHQ A;  3NHG A;  1S9G A;  1NK5 A;  1UAX A;  1WSH A;  3ZCM A;  5HLF A;  4L8R B;  2JGU A;  2ITG A;  4IKF A;  3M8R A;  4HUF A;  1NKC A;  2AJQ A;  3L2Q A;  1BCO A;  1LWF A;  3MEG A;  3HO1 A;  4FJ5 A;  4XIU A;  3ZT3 A;  2KQ2 A;  1UA1 A;  4FXD A;  1TK0 A;  4M3Z A;  1VK0 A;  4ELV A;  1JL1 A;  3ZT4 A;  1ZYQ A;  4CJQ A;  1D9F A;  1LW2 A;  2A1S A;  1KLN A;  4M3W A;  3NF8 A;  2W42 A;  3LP2 A;  3OYF A;  3L2U A;  4FJX A;  3V1O A;  2B5J A;  4FLT A;  4NCG A;  1RBU A;  3VN5 A;  3NF7 A;  3U6F A;  3BDP A;  4ZTJ A;  4FM0 A;  1UWB A;  4LSN A;  2OPS A;  4CJS A;  3PX6 A;  1Z25 A;  5KTQ A;  1SKR A;  4KHY A;  3DLE A;  1RT5 A;  5KRS A;  3DMJ A;  3ZSW A;  1RBR A;  1S1T A;  3T3F A;  1U48 A;  3ASM A;  1WAJ A;  4DSL A;  4OGC A;  2KZZ A;  4ZHR A;  1JLG A;  3V9W A;  1BGX T;  3LP0 A;  4GW6 A;  3LP1 A;  4KB0 A;  3JSM A;  4FJJ A;  1RTJ A;  4H4O A;  3MEC A;  3C95 A;  3ZT0 A;  2OZS A;  1BQM A;  2O4G A;  4GMJ B;  4DSF A;  4CCH A;  4KRF A;  1CXU A;  1IH7 A;  1NK4 A;  1JXB A;  1S1U A;  1JLE A;  2GV9 A;  3NGZ A;  3THV A;  1G15 A;  1C1A A;  3DLG A;  3DLR A;  1BIS A;  1RIL A;  1KTQ A;  4KTW A;  3CFP A;  3V6D A;  3SQ2 A;  2HHU A;  1FKO A;  4CIG A;  3ZT1 A;  1J5O A;  1CZB A;  4CEC A;  4N76 A;  1TVR A;  2F8T A;  2A1R A;  2QKB A;  4HUE A;  4FZX C;  2B6A A;  4CJF A;  1LWE A;  3OS0 A;  3DLB A;  4J2D A;  3VQ8 A;  1SL2 A;  2Q3S A;  3OYL A;  4W5T A;  3OS2 A;  1YTA A;  3AA3 A;  1W9H A;  1WSE A;  3QLH A;  4E1M A;  3HP6 A;  1VSI A;  1IKY A;  2DFE A;  4M45 A;  1B9F A;  1TGO A;  4CJ4 A;  4CGH A;  5E41 A;  2WOM A;  3ULD A;  3TAR A;  4BE1 A;  4PWD A;  1NKE A;  4E19 A;  4QAG A;  1XI1 A;  1CZ9 A;  4OLA A;  3V4I A;  4FK4 A;  1FXX A;  2G8K A;  4AHS A;  4FJ8 A;  4K8X A;  4E7H A;  4C8L A;  3CFO A;  4PQU A;  5FRN A;  3VQP A;  1RTD A;  4FW2 A;  4AH9 A;  4LY7 A;  4M3U A;  1EP4 A;  4DFP A;  2KW4 A;  2DFH A;  1I39 A;  3TAB A;  4B9S A;  3TI0 A;  2IDO A;  3L3U A;  3SJJ A;  2D0B A;  4CEB A;  4NYN A;  4RW6 A;  3RRH A;  4K8Z A;  1KVC A;  4PY5 A;  3LDS A;  4FVM A;  2OA8 A;  3V1R A;  3NF6 A;  3M8S A;  2HHX A;  1S6Q A;  4IG0 A;  4DSE A;  2I5J A;  3M8P A;  3CM6 A;  2ETJ A;  4N5S A;  4HHT A;  3RR7 A;  4BWM A;  4G1Q A;  3JYT A;  4DU4 A;  2YNG A;  4FJG A;  3DM2 A;  3HVR A;  4CF0 A;  4FLZ A;  3ZSV A;  3PY8 A;  3O3H A;  5I3U A;  3V9X A;  4Z4E A;  3BGR A;  3T1A A;  4DTS A;  3SYZ A;  1NJZ A;  2VWJ A;  4CHP A;  5HRO A;  3NCI A;  1RNH A;  4AIL C;  1C0U A;  1RDD A;  1N5Y A;  4KO0 A;  3O4N A;  4DU3 A;  3DI6 A;  4BDP A;  3IAY A;  4CJ3 A;  3LZJ A;  4DSJ A;  4Y1C A;  4DFJ A;  1NK7 A;  4OLB A;  4DS5 A;  4QOZ B;  3IS9 A;  2RF2 A;  2OPP A;  1QE1 A;  4KHW A;  1C0T A;  2G8V A;  3NH1 A;  1HRH A;  3PX0 A;  4CEZ A;  2JLE A;  3DRS A;  4CIF A;  4Z4C A;  3OJS A;  4CJP A;  1KFS A;  4B9N A;  4M3T A;  3SCX A;  3TAQ A;  4FK2 A;  1UA0 A;  4I7F A;  2G8I A;  3DOK A;  4W5O A;  1VSJ A;  3TAM A;  2QKK A;  1RT6 A;  4CJT A;  3QER A;  4KV8 A;  5C24 A;  4TSX A;  4CHY A;  4N47 A;  3KLF A;  2FC0 A;  4AHU A;  1IKV A;  3LWL A;  3HM9 A;  3VQA A;  3HXM A;  4JS4 A;  4E7J A;  4LSL A;  1T8E A;  2OYQ A;  4ELU A;  4FJH A;  1I3A A;  1NK6 A;  4Q0B A;  3VQ5 A;  2IC3 A;  2WON A;  3DRR A;  5CYM A;  2OPQ A;  4FLU A;  1SKS A;  1T03 A;  1NJX A;  4FJK A;  4CF8 A;  5CY4 A;  3KK3 A;  1HMV A;  4CJE A;  1U4B A;  4C8O A;  3S3M A;  1LAV A;  3G10 A;  3VQ9 A;  3KK1 A;  1RBT A;  3NGI A;  3KTQ A;  4B8A B;  1X9M A;  4JRQ A;  1A5W A;  4LH4 A;  4CHN A;  4FZY A;  1D8Y A;  2P5O A;  1TAU A;  1RDC A;  4CED A;  2HHV A;  4EZ9 A;  4N56 A;  4PA1 A;  3B6O A;  4OKE A;  3ZSQ A;  4FLY A;  3AVA A;  3AO1 A;  4CK1 A;  3QEW A;  1VSE A;  1L3V A;  4M3Y A;  2FBX A;  3OYM A;  3H08 A;  1LAW A;  1RTI A;  3QET A;  1S1X A;  3WNF A;  4DWI A;  2F96 A;  3IRX A;  4W5Q A;  4CHO A;  4E0D A;  1WLJ A;  3TAP A;  3O3G A;  2YNF A;  2HB5 A;  2YNI A;  3VQ7 A;  3QEP A;  4Z4F A;  5FRO A;  1QSS A;  2EX3 A;  1BI4 B;  1A5V A;  3KLE A;  3SUN A;  2RKI A;  4I2Q A;  2YHA A;  4IBN A;  2FBT A;  3O3F A;  2ATQ A;  3RMD A;  4W5N A;  3PV8 A;  3SI6 A;  3ZSY A;  4KHU A;  3KJV A;  2VG6 A;  1VSH A;  4ID1 A;  4YNQ A;  4RW7 A;  1ZBU A;  4UQG A;  4KI6 A;  3AO4 A;  4FW1 A;  4O4G A;  1HQU A;  5CYQ A;  3L8B A;  4DQR A;  2E6M A;  3AA5 X;  4DFK A;  1RTH A;  2E6L A;  3QEX A;  4KPY A;  1LW0 A;  3AVB A;  1TK5 A;  1HQE A;  1L3T A;  3C6T A;  3O4Q A;  4FM2 A;  3HT3 A;  3K5M A;  4IFY A;  1HJR A;  4EP4 A;  4DTO A;  4B3O A;  4FJ9 A;  4Q5V A;  1XWL A;  1FK9 A;  1HYV A;  4KTQ A;  1ZBH A;  1Q9Y A;  1S6P A;  3LAN A;  5JS2 A;  3OYJ A;  1KRP A;  3OYG A;  3B6P A;  4MQ3 A;  3WNG A;  2R7Y A;  4DTN A;  3KK2 A;  1EET A;  3HYF A;  4OJR A;  2VWK A;  1TAQ A;  4IDK A;  4B08 A;  3PO4 A;  3K57 A;  3LPU A;  3QNO A;  4BAC A;  3QEV A;  4CJV A;  1O1W A;  4E7L A;  1MU2 A;  2RPI A;  3V1Q A;  3VA3 A;  4AHV A;  4B8C A;  4KAZ A;  4OKK A;  3SQ1 A;  4CJR A;  1ZBI A;  2D0A A;  3RR8 A;  3VQC A;  4JLH A;  4FYD A;  3SUO A;  1HYZ A;  4KTZ A;  1S1W A;  1BI4 A;  3VQB A;  5J2M A;  1XHX A;  3V81 A;  4Z4I A;  3TWH A;  3KLI A;  1QSL A;  2HW3 A;  3OYK A;  3L2R A;  4CEQ A;  3K59 A;  4OPJ A;  1HPZ A;  2Z1H A;  1C1B A;  5J2Q A;  2XY6 A;  1B9D A;  3AVC A;  3WNE A;  2G8W A;  3L2W A;  4ZTF A;  4FZZ A;  1KLM A;  5J2N A;  1LWC A;  2E4L A;  2EHG A;  3ZSO A;  1NK8 A;  2PYL A;  4HCC A;  4B9V A;  3ISN C;  1WN7 A;  3EYZ A;  2KZM A;  3AVF A;  1L3U A;  1SL1 A;  2Z1I A;  4YFU A;  4IG3 A;  4FJN A;  4E89 A;  1BIZ A;  3RMC A;  2NUB A;  2VG5 A;  1DTT A;  3AVM A;  4DTR A;  1RT7 A;  2X6N A;  5HBM A;  4B9L A;  4EZ6 A;  5HRN A;  2XY8 A;  1WNS A;  4QCL A;  5EU7 A;  1CXQ A;  2D5R A;  3AVL A;  4KKO A;  4DTP A;  3AVN A;  4CGI A;  4ICL A;  3KLG A;  4ID5 A;  1VSK A;  3NDK A;  2P51 A;  3V9U A;  3PX4 A;  3S9H A;  3HJF A;  2IGI A;  5C42 A;  5HP1 A;  1QS4 A;  1S5J A;  4Y1D A;  1U45 A;  1CLQ A;  2X78 A;  1VRT A;  1RDB A;  1EKE A;  1VSL A;  2G8F A;  1VSF A;  3KD5 E;  4AHC A;  2YHB A;  3DRP A;  1TKD A;  4J2E A;  1LV5 A;  3SZ2 A;  5CZ2 A;  5DMR A;  4KRE A;  4RW8 A;  1C0M A;  1RDA A;  1JLC A;  3LP3 A;  1ASU A;  2HNZ A;  4FLW A;  4CJ5 A;  4DSK A;  5FDL A;  5KGW A;  1N6Q A;  3I0S A;  1NOZ A;  3SPZ A;  2X74 A;  2LSN A;  1NJY A;  2PYJ A;  1TKX A;  4JS5 A;  2DFF A;  2HVH A;  2OPR A;  1S9E A;  4CFA A;  3OYB A;  5KI6 A;  4MFB A;  1SUQ A;  3SQ0 A;  3LPT A;  3MXM A;  1S1V A;  5CZ1 A;  4FJM A;  3OYN A;  1WSG A;  4CJL A;  3TAE A;  3VQ4 A;  1IO2 A;  1X9S A;  1TKZ A;  3KIO A;  5KGX A;  4KB1 A;  4I9L A;  1WAF A;  3PUF A;  1J9A A;  4DSI A;  2FBV A;  5J1E A;  2DY4 A;  1UOC A;  4Z0U A;  4CF2 A;  4DQQ A;  2XY7 A;  4C8N A;  1Q8I A;  4M3R A;  2QK9 A;  2OZM A;  4O5B A;  1VSM A;  1SKW A;  4O0J A;  3A2F A;  1IKW A;  1JL2 A;  3AO3 A;  4O55 A;  3SV3 A;  2HHQ A;  3G0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...