4CIGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cigA00
1WLJA 3DRRA 3NDKA 3RMAA 3L3VA 3DM2A 3DLBA 1HRHA 1L3TA 4Z4EA 3QEPA 4Z4GA 4CJLA 4O0IA 3ALYA 4MQ3A 1CZ9A 3AVFA 1J5OA 4FJ7A 4EP5A 4C8NA 2P5OA 2YNHA 3DLKA 3NH1A 3V9WA 1RTJA 4CIFA 4G1QA 4CK3A 3V81A 3TAQA 3RRGA 1TAQA 3OYIA 3C94A 3H08A 1KRPA 2BDPA 1UA0A 4ICLA 1RDBA 4KTQA 3O3HA 1TVRA 1J54A 2IAJA 2KTQA 2ITGA 4AHUA 5SWMA 3OYLA 1Y97A 2XY5A 4B08A 1HYVA 1XC9A 2O4IA 1IKXA 1NJWA 3O3FA 4H4OA 2X78A 3OS0A 3SUQA 1LWEA 1NK9A 1NKEA 4KHNA 4OLBA 4NYNA 3B6PA 3ZSOA 2OZMA 5JS1A 3NBPA 2ZE2A 3AVCA 4M3ZA 2WONA 3I8DA 1X1PA 3OYJA 4CGIA 2G8IA 3NF7A 1ASUA 4KHSA 4LY7A 3VQ8A 2YV0X 3ISNC 1U49A 4FYDA 3SZ2A 4FXDA 4BACA 3LANA 4F2SA 1HYZA 3DLEA 4NYFA 1BCMA 2RN2A 2E4LA 1L3UA 2KFZA 4FJNA 3VN5A 1TAUA 1BIZA 1YVUA 4CECA 4DTSA 4CCHA 4J2DA 3CM5A 2RPIA 3E01A 3IRXA 3HL8A 1S5JA 4CJRA 2HHWA 3O4QA 4DSEA 4DS4A 4DS5A 1RTHA 3NAEA 2X6SA 4FZZA 4IBNA 1JL2A 1VSEA 2XY7A 4B8CA 1UAXA 4W5QA 4FJLA 4H4MA 4CGGA 4CGFA 1RBUA 3M8PA 1I39A 1WAJA 4OJRA 5DMRA 1Z25A 1HQUA 1NK4A 4KHYA 4DU4A 3MEDA 1KTQA 4CFBA 3LPUA 1RBVA 1JLQA 2OPSA 4RW9A 3TAFA 5HLFA 4ZTFA 3L2QA 4PQUA 2XRIA 3S3OA 1R0AA 4YFUA 1S1WA 2YKMA 4M3YA 2DFHA 3AA5X 4PUOA 3IG1A 1CXQA 1RTIA 1TGOA 3AVKA 4IG0A 4CFAA 4CIGA 3PX6A 2BANA 3AVIA 3TR8A 3THVA 3RTVA 1VRUA 1L5UA 4CJ4A 1VSHA 4KO0A 4BWJA 3LWLA 3U6FA 2KW4A 3PUFA 4DTRA 1TK0A 2OA8A 1J53A 3SV4A 3LP1A 2HB5A 2KZZA 1I3AA 2Y1JA 4CE9A 4DFKA 4CJPA 5J2NA 4DQRA 5T7BA 3OY9A 3DLGA 3VQCA 4CEBA 4CESA 5KTQA 3TWHA 1S6QA 1ASVA 4FZYA 1VSJA 1LW2A 4M41A 3D0PA 1O1WA 5C24A 4Y1CA 1CXUA 3OYKA 2GUIA 4CEFA 2D0BA 3DRSA 3LAMA 1JLAA 3KJVA 4CEDA 3PV8A 1SKWA 3C95A 1JLFA 4DTOA 1XI1A 4F4KA 1YT3A 1A5VA 2LSNA 4CF8A 2G8VA 4CJUA 4W5NA 1RBTA 3HPGA 5CYMA 2QK9A 4FVMA 1XHXA 3AVAA 3LAKA 1VSKA 4DTPA 3OYFA 3OYHA 1RT6A 1YTUA 4HTUA 3MXJA 1NK0A 4W5RA 4KRFA 1UOCA 3K5OA 3AA2A 3L2UA 3IS9A 2D5RA 3JYTA 1RILA 2E6MA 1EETA 4RW8A 2EHGA 1FKPA 4I2QA 4DQSA 1HNIA 1C6VA 4ELUA 3HVRA 2PYJA 2BGGA 1FKOA 3LP2A 3EZ5A 1SL2A 1GOCA 1ZBHA 3U3YA 1KVBA 3VQEA 4OGEA 4E7IA 2JGUA 1S9EA 5HRPA 3OYGA 4DF8A 2I5JA 2A1SA 4KPYA 4CGJA 3AO4A 1XWLA 4BDYA 3SI6A 5HRNA 3OS1A 3QEXA 3NGZA 1HJRA 1EX4A 1JLGA 1L3VA 1QSYA 4ELVA 3SNNA 4F3OA 3CYMA 4BE1A 3P83D 1TV6A 4AHVA 1IO2A 4DTUA 1CLQA 4FM2A 1RBSA 3HP6A 4B9TA 4N5SA 3OYMA 1QHTA 1UWBA 3B6OA 4CFCA 4YNQA 2QXFA 3L8BA 3O3GA 4J2AA 1LV5A 4RW4A 2YNGA 1EP4A 5CYQA 3VQ9A 4FLXA 3RWUA 4DTMA 1ZBLA 1W0HA 2YHAA 4GW6A 4LSLA 4JS5A 5HBMA 3U3GA 4BDZA 5J2PA 1RT1A 3QEWA 5KI6A 4OPKA 3RRHA 2HHUA 3AVHA 2HMIA 1KLNA 5CZ2A 4CK2A 1VSFA 1C1BA 3KIOA 3V1OA 1S6PA 2B5JA 4TSXA 2OYQA 1RNHA 3O4NA 4CK1A 1TK8A 1IG9A 4B9SA 2IS3A 3QETA 3DLRA 3ZT4A 1QSLA 2HHXA 2VWKA 4CHOA 2DTUA 3NF6A 3VQBA 3P1GA 3VQ6A 4KTZA 2PZSA 4KI6A 2A1RA 4IDKA 2DFFA 4CJEA 4CIEA 4E1MA 4FLYA 3PO4A 4EZ9A 1BIUA 4M3RA 4DMNA 3NGIA 3QEVA 1S1TA 1KLMA 3AA3A 4C8LA 1XHZA 4C8OA 4AHSA 3AA4A 4JLHA 4CF9A 4CEAA 4OPJA 4Q0BA 4CEQA 3ZT0A 1VRTA 3KK2A 4ID1A 4HUEA 1BCOA 3OJSA 4IFVA 1JKHA 3QO9A 4LH5A 5KGWA 4KKOA 1RDAA 4OLAA 3HM9A 3DLHA 3VA3A 3CFRA 3S3NA 4IKFA 4B9MA 4FK4A 5HP1A 1WSIA 2Y1IA 4Z4CA 2FBYA 1Q9XA 3G0ZA 3PX0A 2PYLA 3V6DA 4B9VA 4E19A 4UQGA 4B9LA 3P5JA 3ZSVA 1C0TA 3L2RA 4L8RB 4I2PA 4DSKA 1HYSA 3SCXA 4QCLA 2G8KA 3RMCA 1WAFA 3RR8A 3HVTA 1WSEA 1B92A 4CJVA 2XHBA 4OKEA 2FC0A 4DTJA 3ZSQA 4E7JA 1BQNA 1NK7A 3ZCMA 3K5LA 1VSMA 3KLEA 4E7HA 1N5YA 4DTXA 3BDPA 3LP3A 3QERA 4QAGA 4CJQA 4M3XA 1C0MA 3TAEA 3AV9A 4FLWA 1WNSA 3QEIA 1QTMA 2HNZA 1U04A 3HSTB 1N6QA 4CJFA 3RMDA 1Q9YA 2Z1HA 5EU7A 4JRPA 3F73A 1NK5A 1SKRA 5C42A 1S9GA 2B4JA 5DK5A 1U45A 2Z1GA 1BQMA 1WSHA 2X6NA 1JL1A 2B6AA 2IOCA 1RT7A 4CHQA 3MEGA 3HT3A 3CFPA 3HJFA 4AHCA 3KKRA 1JLEA 4CF1A 1NJYA 3LP0A 2G8FA 3HYFA 3VQ5A 3RMBA 2D0AA 1QSSA 1KFDA 4C8KA 3UIQA 1TL1A 2VG5A 4RG8A 3KLHA 4AH9A 1T05A 4JRQA 3V9SA 5E41A 1RBRA 3PO5A 4WE1A 3TI0A 5FRMA 2YNIA 3QIPA 3VQQA 3D45A 3TARA 3AO5A 5KRTA 2Q3SA 3SQ0A 5FROA 3NFAA 4Z0UA 2HHSA 5KRSA 1RCHA 3SYZA 5I42A 3KLGA 1ZBFA 1LAWA 4DSFA 2GBZA 2HHTA 1TKTA 3SJJA 4O4GA 1T8EA 2P1JA 1T7PA 4N41A 3NH2A 4K8ZA 3OYEA 2VG7A 4FJ8A 1RT5A 4E89A 4Q5VA 4FJHA 4FJJA 1K6YA 1S1XA 2HHVA 4HUGA 4M42A 4CF2A 4DLGA 2FBVA 3AVNA 3TAPA 4DWIA 3NH0A 1DTQA 1LAVA 1TKZA 1KCFA 4FJIA 3CFOA 5FRNA 4C8MA 3T1AA 4E1NA 3AO1A 5HRRA 1J9AA 1C0UA 3QESA 3TANA 1RT2A 3DOLA 1X9SA 2E6LA 2OPPA 3DI6A 4M45A 3F9KA 5C25A 3SPZA 4KHQA 2OPQA 3SQ2A 4HVJA 4OVLA 1ZYQA 1X9MA 4NCGA 5CZ1A 4FJXA 2NUBA 1A5XA 3AO2A 4RW6A 3AVLA 1SV5A 3S3MA 1S1VA 4CERA 1B9DA 2G8UA 4CHZA 1IKWA 4FK0A 4FW1A 3K58A 1F21A 3WNEA 3QNOA 1L3SA 4DFJA 4N56A 1NK6A 4FM0A 1ASWA 1LWFA 2G8WA 2QKKA 4BE2A 1GOBA 2VWJA 4O0JA 4FK2A 3HXMA 4AHTA 1NJXA 4CJWA 4F8RA 3VQ4A 5J1EA 3ZSWA 3KLIA 3ZT3A 3SV3A 3FFIA 4DFPA 3MEEA 4E7LA 4DU1A 2FBXA 4JS4A 4PWDA 1WSJA 1EKEA 1VSDA 3K57A 4BDPA 4DU3A 3OYAA 4ID5A 1KSPA 3ZSZA 1G15A 4W5OA 1IKVA 1SUQA 3I0RA 1MU2A 3L3UA 3ZSYA 4W5TA 4FJKA 5SZTA 4KFBA 1WN7A 2ETJA 3V9ZA 4M3TA 1W9HA 4N47A 1QS4A 1A5WA 4RW7A 4OKKA 4CGHA 4O5BA 4CJTA 1TL3A 4BE0A 1ZBIA 3LWMA 2QKBA 4B3OA 4Y1DA 4ZTJA 1RTDA 1QE1A 4I9QA 3CM6A 3PY8A 4IG3A 4B9UA 3C6UA 2VG6A 3LZJA 2BE2A 4J2BA 4NCBA 1BHLA 3OYBA 1B9FA 2Z1IA 1BI4A 3AVJA 1NKBA 2EX3A 3I0SA 3OS2A 4Z4FA 3HO1A 4KHWA 4FZXC 3NHGA 2HNDA 4CEOA 1BL3A 3K5NA 3MXMA 4FJGA 1JLBA 2AJQA 4M3WA 1LWCA 1EXQA 3QIOA 1GOAA 5KGXA 3RR7A 1IH7A 3LALA 4PA1A 1U48A 3QINA 1LW0A 3TAMA 3CG7A 3AVMA 1HNVA 3WNGA 5J2QA 3KTQA 4HHTA 2P5GA 4EP4A 4J2EA 2D0CA 3DMJA 2ZQBA 3EY1A 2G8HA 4HCBA 2P51A 4XIUA 3HPHA 4FLVA 3AVBA 1TKDA 1NKCA 3T19A 3S9HA 3WNHA 1Z26A 4CHPA 1VSIA 3M8RA 1U47A 1X9WA 4EZ6A 2F96A 2GV9A 3NF8A 3TABA 1RT4A 4GMJB 1VK0A 1QQCA 4DFMA 3VA0A 1TK5A 1REVA 3A2FA 5JS2A 3BGRA 1BISA 3OJUA 3QNNA 1NK8A 1D8YA 1CZBA 4CHNA 5HRSA 2Z1JA 3KD5E 2KZMA 2ZD1A 3NCIA 4KI4A 1NJZA 1FXXA 4FCYA 3V9XA 3ULDA 3PX4A 4DG1A 4BWMA 4DSIA 3HPOA 3KK1A 4E3SA 2DFEA 4E7KA 3OYDA 3KD1E 3SUPA 3AVGA 1S1UA 3ITHA 2R7YA 1SKSA 4NCAA 4KAZA 4HCCA 1KVCA 3ASMA 4CGDA 4GVMA 2XY8A 2X74A 4FW2A 3SQ4A 2IDOA 1HQEA 4M3UA 3JSMA 4DLEA 3V1QA 3G10A 4LD0A 3ZT1A 3NGYA 4CJKA 4N76A 1BI4B 1SL1A 2RKIA 3MECA 3DOKA 4HUFA 3SQ1A 4LH4A 4KV8A 4F3TA 4DSLA 4ELTA 3SUNA 3K59A 1IKYA 3DRPA 3LPTA 2YHBA 4AHRA 1HPZA 3OYNA 3CQ8A 5HROA 3C6TA 2XO7A 3M8QA 3SUOA 1RDDA 4FLUA 3T3FA 4FJMA 1JXBA 4LSNA 4KREA 4DTNA 3MAQA 1JLCA 1YTAA 1ZBUA 4AILC 3K2PA 4I7FA 3ZSRA 2O4GA 2KQ2A 5J2MA 2OPRA 3HP9A 4KB1A 3L2VA 2HVIA 2DY4A 3KK3A 3KKSA 3K5MA 1FK9A 4DQIA 4FJ9A 5FDLA 5D3GA 4PY5A 3ZT2A 3VQ7A 1HMVA 5I3UA 2HNYA 3LZIA 2OZSA 4DQPA 3HK2A 4R5PA 4O44A 3OYCA 1D9DA 1UA1A 2KFNA 4IFYA 2JLEA 3KLFA 4Z4HA 1KVAA 2IGIA 3QLHA 2HVHA 2HHQA 4CFDA 1C1AA 4FLTA 4KHUA 4CEEA 2HW3A 3L2WA 1RT3A 4O55A 3IAYA 4F2RA 4MFBA 3M8SA 1WSGA 5CY4A 3DYAA 4CHYA 4K8XA 1SL0A 3NF9A 4B8AB 2YKNA 1TKXA 1RDCA 4CF0A 3VQAA 1BGXT 3VQPA 1NOZA 3LDSA 4DF4A 1NOYA 1WSFA 3V1RA 2W42A 3AO3A 2ATQA 4Z4IA 1VSLA 1Q8IA 4FM1A 1KFSA 4FLZA 4CEZA 4B9NA 3TAGA 2F8TA 1D5AA 4H8KA 4FJ5A 4DQQA 2FBTA 5K14A 2WOMA 4OGCA 3WNFA 4CJSA 4ZHRA 2XY6A 3SPYA 3V4IA 1ITGA 4E0DA 4DSJA 3MXIA 1U4BA 4KTWA 1T03A 2RF2A 1DLOA 3V9UA 1D9FA 3OVNA 4KB0A 2IC3A 1C1CA 2PY5A 4QOZB 2F8SA 1DTTA 3ZSXA 3EYZA 1JXEA 3VQDA 4CJ3A 2YNFA 4I9LA 4CJ5A 3NE6A 4OKJA
chains in the Genus database with same CATH superfamily
1NWKA 2ZM6K 4A2AA 4DV3K 4CJLA 4O0IA 1QVFM 4MQ3A 2P9PB 3AVFA 4FJ7A 4EP5A 4C8NA 4KHPK 2YNHA 4XEIA 3S41A 4CIFA 2H3GX 3TAQA 4PL7A 3RRGA 4BR9A 4BQZA 4YY3K 2ZGYA 3OYIA 4ICLA 2OTJN 5AQHA 3CHWA 2ITGA 2QTDA 1IKXA 3AAPA 4H4OA 4JK7A 2OZMA 3B6PA 4OLBA 3NBPA 1X1PA 3ID6A 3CJ7A 1VQKN 2UUCK 4JD2A 5M1OA 2YV0X 4LF4K 3LANA 4NYFA 1L3UA 4CECA 4GKJK 3IRXA 1S5JA 1W2BM 4BY9C 4WFBL 4DS5A 3NAEA 2X6SA 5AQJA 1VSEA 4B8CA 4W5QA 4PKHA 3M8PA 5AZJB 1KTQA 3MCPA 5JMVA 1JLQA 5HLFA 3PSIA 4YFUA 4IG0A 4A5BA 3PX6A 2AA4A 4ISEA 4KO0A 4BVPA 2OA8A 1NGJA 1BUPA 3LP1A 3RSEA 2Y1JA 4CE9A 4CJPA 4DQRA 1Q86O 4CESA 4DHYA 1S6QA 1Q18A 3G25A 1IJJA 4J8FA 2PAVA 4B1ZA 3OYKA 2GUIA 3DRSA 4YHHK 4CEDA 3FFKB 1SKWA 1JLFA 4H03B 2E2PA 1YT3A 2G8VA 3OBWA 4YORA 3C0BA 1T6DA 3MK6A 3ZETB 5CYMA 3LAKA 3OYHA 4CVNE 3NMUA 4W5RA 1M1KO 2BUPA 4IO8A 2O8CA 3JYTA 1RILA 1EETA 4RW8A 1VQNN 1C6VA 4ELUA 1VQ8N 1GOCA 1ZBHA 4WF9L 1TUUA 2JGUA 3OYGA 3A8YA 4KPYA 3VETA 1E4FT 3AO4A 1KQSM 3E1YA 1HJRA 1JLGA 3NGZA 3CMEN 2QWPA 1R59O 4FM2A 4WFAL 1QHTA 4DV5K 3ZYYX 1LV5A 4RW4A 3VQ9A 4FVUA 2YHAA 4JI0K 2QI2A 4BDZA 3U8XA 2OTLN 3KVGA 2HMIA 5AQQA 1YJ9N 3V1OA 4B9SA 4JI6K 1KAXA 4IFEA 2VWKA 3VQBA 3VQ6A 4H0OA 4B1YB 2W41A 4IDKA 4CIEA 3PO4A 1CZAN 1HKBA 4EZ9A 2D0PA 4M3RA 2AP1A 1S1TA 4ILJA 4C8OA 3CQXA 4CEAA 4OPJA 3TTCA 4Q0BA 4CEQA 5GAHP 3KK2A 4K0KK 2ASOA 5AFUA 3Q7CA 4IFVA 1JKHA 1Z6RA 3S3NA 4GKKK 4YDUC 4B9MA 1WSIA 2FBYA 3G0ZA 4E19A 3ZSVA 5BRDA 4I2PA 2BTFA 5H1SQ 2G8KA 1C0GA 1B92A 3QICA 4BRKA 4OKEA 4DTJA 2P9LB 3K5LA 4FJJA 1VSMA 3KLEA 4M3UA 4QS8A 2GWJA 3QERA 4CJQA 4M3XA 3AV9A 3QEIA 1ZXOA 1U04A 3HSTB 1Q9YA 1NK5A 5DK5A 1EWQA 1WSHA 3VTHA 2X6NA 2B6AA 2IOCA 3HT3A 4CF1A 3LP0A 3HYFA 1WBBA 2YI1A 4RG8A 1ESVA 3O9SA 1YHQN 1RBRA 4CW7B 1ATRA 3WXIA 5AQXA 4JD2B 3CETA 4PHTX 3AO5A 1Q7YO 2Q36A 3NFAA 3T1HK 3CCRN 1RCHA 3HSCA 5GADP 3OBYA 1LAWA 4IXCA 3W0LA 4DR4K 2P1JA 1T7PA 1HKCA 3O8MA 1RT5A 4BG9A 4E89A 4FJHA 3NVKA 2HHVA 1S1XA 2FSKA 4HUGA 5E26A 3AVNA 4DWIA 4NB4A 3VENA 1LAVA 1TKZA 1KCFA 3AO1A 1NM1A 3ZX3A 3DOLA 4M45A 3H46O 4BGAA 1X9MA 3VEXA 2Q2RA 4FSVA 3FZHA 3WQUA 3F9MA 1S1VA 1B9DA 4CHZA 3VF6A 1K8AO 1F21A 1OVYA 4WQ4C 1L3SA 3SK3A 3SAFA 1VHXA 1ASWA 2G8WA 4BE2A 2E2OA 2PFUA 2VWJA 4O0JA 5KQDA 3MWPA 3QDKA 1KD1O 3KLIA 4DFPA 4FWPA 4JK9A 4PWDA 1EKEA 3K57A 1NGAA 1IKVA 3ZSYA 3ULEA 1TYQA 4M3TA 2WFBA 4DUZK 4AQYK 1ZBIA 4OKKA 1TL3A 4Y1DA 4ZTJA 1RTDA 1QE1A 3PY8A 2QWRA 2O8CB 4CZIA 4J2BA 2NZTA 4EIAA 2YHWA 5GINA 1E3MA 3OS2A 3NHGA 2HNDA 2AJQA 1JLBA 4M3WA 1LWCA 5GAGP 1D4XA 5KGXA 1U48A 5AR0A 1JJ2M 4J2EA 5C0YA 1P8ZA 3AGKA 4HHTA 2G8HA 3EY1A 1TKDA 3T19A 4CHPA 3DJCA 3DXMA 3NF8A 4GMJB 1VQLN 4H0VB 3BGRA 3BZCA 1NK8A 1CZBA 4OPHA 2Z1JA 1OKJA 1FXXA 4DG1A 1QQMA 3H6EA 3CF5L 3MN9A 3SUPA 1SKSA 1KVCA 3ASMA 4BR5A 4JV5K 4IJNA 2X74A 3D2EB 4LD0A 4CJKA 3NGYA 1BI4B 5TKWA 2P9KA 4HUFA 5MLCQ 1HLUA 4LH4A 4F3TA 4DSLA 4ELTA 3K59A 5M1QA 4AF1A 2UXDK 4QS7A 4BRMA 4ILGB 2XO7A 1YIJN 3KK7A 4JK8A 4KREA 2YHYA 4BR4A 3K2PA 5C2DA 4DR1K 3BF1A 3ZSRA 3THWA 2HVIA 4KB1A 3L2VA 4YOYA 2KHOA 3TU5A 3P31A 3VQ7A 4XH1A 1XQSC 1W97L 4O44A 4B9QA 1WB9A 4IFYA 1S72N 3KLFA 1KVAA 3QLHA 3FLCO 4JKDA 2E20A 4FLTA 5JVHL 1NGHA 2W40A 3IAYA 1HKGA 5LL6Z 1OH8A 1NOZA 1NOYA 5FPEA 1HR0K 2W42A 3AO3A 3CCVN 1H1VA 4FLZA 4CZGA 3D2FA 3TAGA 1ILYA 4FJ5A 2FBTA 4CJSA 3WNFA 4JKCA 4LF9K 1U4BA 3OVNA 2F8SA 5LMNK 4DUYK 3E66A 3VQDA 2ZF5O 4OKJA 4BR7A 3NDKA 3RMAA 3DLBA 3UE5A 1HRHA 3IDHA 4GV3A 1CZ9A 5GIOA 1OH6A 1RGIA 2JWKA 2FF3B 4B1WB 4CK3A 4NLCA 1TAQA 2ZJRL 3T7ZA 1UA0A 1MDUB 4KTQA 2QEXN 1J54A 4Y0WA 4AHUA 1U2VB 3OYLA 1Y97A 4BRPA 3IKMA 1NNEA 1NJWA 3BP8A 3MX5A 2X78A 1NKEA 4KHNA 4NYNA 3ZSOA 1U6ZA 4M3ZA 3HRGA 3I8DA 4BVOA 4IOXA 4WQ5C 4DR5K 2IVPA 1KAYA 1ASUA 3MN5A 4LY7A 5AQFA 1MWKA 3QB0A 4BROA 3TTFA 1BIZA 4CCHA 3CM5A 2RPIA 1Q82O 3EKUA 4CJRA 4JHDB 4DSEA 1RTHA 1E4GT 2OANA 1JL2A 4FJLA 4JKGB 4KBOA 4CGGA 4IEEA 5DMRA 1WOQA 3N4QA 4CFBA 4FO0A 1RBVA 3TAFA 3DLHA 1NGEA 4ZTFA 1Z05A 1HJOA 3H1VX 1S1WA 5AQOA 2DFHA 2E8AA 3EE9A 5BN8A 3AVKA 4CIGA 2BANA 3TR8A 1VRUA 1VQ9N 1RDUA 3LWLA 3U6FA 2KW4A 3PUFA 4DV2K 1NU0A 3D6RA 1I3AA 4OX9K 5J2NA 2KZZA 5T7BA 5FPNA 3DXKB 5KTQA 2VGMA 3TWHA 3I56N 1VSJA 4CZJA 1LW2A 4H0XB 3D0PA 4IZ9A 1NGIA 5AQMA 4CEFA 2D0BA 1VAZA 3C95A 4DTOA 4CF8A 4NO7A 2QK9A 4G9ZA 2E5LK 1ATSA 3NVMA 3MXJA 1NK0A 3P4IA 1UOCA 3K5OA 2QXLA 2D5RA 2CGJA 2EHGA 4I2QA 1N32K 2PYJA 2BGGA 1NGGA 3U3YA 4OGEA 4E7IA 2D0OA 4MO5A 2GEMA 2A1SA 3M5RA 4CGJA 4CBUA 3SI6A 5HRNA 1EX4A 2IIRA 4FWMA 3P83D 1TV6A 4EHUA 1IO2A 4DTUA 1RBSA 3HP6A 4N5SA 2GUPA 3OYMA 5I9EB 2NRZA 3L8BA 4YNQA 3O3GA 4BRIA 4BRCA 4CD3A 1EP4A 5CYQA 3RWUA 2QM1A 2A5XA 4BGBA 2P9LA 1W0HA 3C65A 5EY4A 2O8EA 5HBMA 1RT1A 4BQLA 3CIPA 4NXNK 1BU6O 4CK2A 1BG3A 1C1BA 1VSFA 1S6PA 4TSXA 1IG9A 4DQ8A 4E1JA 1G99A 4JI8K 3QETA 1ATNA 2HBMA 3HBTA 1NGFA 3ZT4A 4CHOA 2HHXA 2DTUA 5AZIA 2PZSA 2HOEA 4KI6A 2Q0RA 3TSPA 2DFFA 3H3NO 4CJEA 1YUWA 3D7EO 5A2QO 3D2FB 3QEVA 2KLAA 2E2NA 1XHZA 3AA4A 5C10A 4JLHA 3CJCA 4LFAK 4FOEA 4K43A 3OJSA 5KGWA 4OLAA 3CFRA 4IKFA 4FK4A 5HP1A 2GX9A 3RMCA 4LF5K 4CJVA 1WSEA 2XHBA 1BDGA 5C15A 3BDPA 4DTXA 3KWGA 3L6QA 4C1NK 3EE8A 1QTMA 5AQYA 4CJFA 5AQIA 5EU7A 5C42A 1S9GA 2B4JA 2Z1GA 1BA0A 1BQMA 5AQRA 3MEGA 4BR0A 2HSTA 3VQ5A 2D0AA 1QSSA 4BRNA 3KLHA 4AH9A 4M63C 1T05A 3WXJA 1W7AA 3HTVA 3CQYA 3PO5A 4WE1A 3QIPA 5BRHA 2QWQA 1K9MO 5FROA 2E2QA 3O5BA 1ZBFA 4FWKA 4DSFA 1JCGA 5EX5A 3JAMO 1Q81O 2HHTA 4O4GA 4JKEA 4K8ZA 3OYEA 2VG7A 2V52B 4B3TK 4M42A 2GWKA 1LOTB 2YJFA 4MDBA 4FJIA 2FSNA 3U9ZA 4FWRA 5LJWA 5HRRA 1VQPN 3QESA 1RT2A 4GVEA 4BREA 5IWAK 4HVJA 4OVLA 1ZYQA 5CZ1A 1A5XA 4A62A 3QFUA 4X66K 2I7PA 3AVLA 3TSQA 1VQ4N 3MDQA 3RVCA 3O08A 3WXMB 4DR3K 4FK0A 3K58A 3LDOA 4N56A 4O5FA 1OH5A 3EKSA 4AHTA 1ZBSA 3F2KA 4H5VA 5ELZA 3ENOA 1OVQA 3MEEA 4DR2K 1NG9A 3KHYA 4PKGA 1WSJA 1VSDA 4EAHD 5JLHA 1VQ7N 1G15A 3CXCM 4WYBA 1SUQA 3I0RA 1MU2A 1XC3A 1WN7A 3V9ZA 3EL2A 1QS4A 4IWVA 1VQ5N 2UUBK 4EHTA 4YOVA 4BRHA 3CM6A 3HZ6A 2D1KA 3D2EA 2BE2A 2Z1IA 3AVJA 1BI4A 1S3XA 1XUPO 3WXLA 3WT0A 1EXQA 2P9NB 5BREA 4BRFA 2WBNA 1IH7A 3LALA 4PA1A 5J2QA 1WBDA 3AVMA 3KTQA 2P5GA 4IDHA 4EP4A 2ZQBA 4HCBA 2P51A 4FLVA 2OCEA 4OPAA 3AVBA 1N34K 4BC2A 1U47A 1Z26A 3M8RA 1X9WA 3J7AP 3IUCA 4IJAA 3G6EN 3TABA 1TK5A 4LFBK 1D8YA 2O8EB 3KD5E 4CHNA 2KZMA 4ISFA 3PX4A 1FJGK 4BWMA 4DSIA 3KK1A 4E3SA 2R7YA 1JCFA 4KAZA 4HCCA 2XY8A 5AZIB 3SQ4A 2IDOA 5KPTA 3L4QA 1GLLO 3JSMA 3CC4N 3ZT1A 3U4LA 2RKIA 5F1XA 3DOKA 3I55N 4KV8A 3SUNA 3LPTA 1HPZA 3CQ8A 1EQYA 3CCLN 3M8QA 1MA9B 3SUOA 5M1PA 1JLCA 4JKHA 4FWOA 2O4GA 5J2MA 3K0SA 3K9JA 3VGLA 4IO9L 4FOIA 3K5MA 4GY2B 1V4TA 4FJ9A 5FDLA 3TPQA 5C2FA 3ZT2A 2HNYA 1HX1A 4X65K 2OZSA 4DQPA 4QS9A 3LM9A 4BG8A 2NRXA 3CCQN 4CFDA 5AQUA 5LY3A 4CEEA 1YF5L 3L2WA 1RT3A 4O55A 4MFBA 2FLOA 4BC5A 4CHYA 2CH6A 1VQON 1SL0A 2YKNA 1U2VA 1TKXA 1RDCA 3ZX0A 4CF0A 3FZFA 4JI1K 1WSFA 3V1RA 3N4PA 2ATQA 3AAQA 1Q8IA 1KFSA 4K42A 1QVGM 4H8KA 2WOMA 4ZHRA 1JCEA 3VGKA 1ITGA 3JS6A 3MXIA 3GOIA 5JICA 3V9UA 1M90O 2PY5A 4B1XB 4NLBA 3ZSXA 1JXEA 4CJ3A 4I9LA 3LM2A 4CJ5A 3QFPA 4BE0A 1HPMA 1X3NA 3L3VA 3DM2A 4JHDA 4Z4EA 3QEPA 4Z4GA 3SMPA 3ALYA 1J5OA 3E9LA 3DLKA 2UXBK 3V9WA 4JKGA 3IFRA 2VQFK 3V81A 2I7NA 5LMUK 1YJWN 4MDAA 4YOUA 1RDBA 1TVRA 2IAJA 1NLVA 2XY5A 5SWMA 1XC9A 4B08A 3OS0A 5AQGA 4DR6K 5JS1A 2ZE2A 3AVCA 2P9SB 2NRHA 3CCSN 3OYJA 1YVNA 4CGIA 4B3RK 4H5NA 3DXKA 2Q31A 3H1QA 3VQ8A 1GLEG 5AQNA 4BACA 4F2SA 1BCMA 2RN2A 1HNXK 1TAUA 3VN5A 4H0TB 1YVUA 4DTSA 3M6GA 3AGRA 4J2DA 3E01A 2PBDA 2HHWA 3O4QA 4O8KA 1FW6A 4JI3K 4IBNA 4EFHA 3HM8A 4H4MA 4CGFA 1RBUA 1I39A 4OJRA 1Z25A 1HQUA 5B8HA 3KWIA 3MEDA 3A5OC 3LPUA 2OPSA 4PQUA 5M1KA 3L2QA 2XRIA 4X64K 3MMVA 4DV6K 4PUOA 1CXQA 1RTIA 5JVGL 1ZC6A 1KC8O 3MN7A 3IMXA 2A6AA 2HMPA 1J53A 3SV4A 5AQKA 3CCUN 4DFKA 1NMDA 5GIPA 3CJAA 3OY9A 3THYA 4CEBA 1ASVA 3LDLA 4FZYA 1J6ZA 4Y1CA 4WCEL 3ATVA 1JLAA 2JWLA 5EXWA 3H3OB 3KJVA 4YOXA 2CGKA 3PIPL 2UYTA 1DT9A 3CERA 4W5NA 1GLCG 4FVMA 4M7XA 4DTPA 3OYFA 1YTUA 2A41A 5ADXH 3R3LA 3AA2A 3IS9A 2FF6A 1FKPA 4DQSA 2YX6A 1IBLK 5F2RA 1FKOA 2HBKA 1SZ2A 3LP2A 5KQ8A 3EZ5A 5HRPA 1S9EA 4DF8A 2O8FB 2I5JA 4JNEA 1XWLA 3OS1A 4DV4K 3QEXA 4CZHA 3SNNA 3CYMA 4BE1A 4B9TA 3WXKA 1UWBA 2ZJQL 3J81O 4J2AA 1KXPA 4DV7K 2YNGA 2VWBA 1BWFO 1BO5O 3K9KA 4JS5A 3U3GA 4H5TA 3KZBA 4GNIA 5KI6A 4OPKA 3RRHA 2HHUA 3AVHA 5CZ2A 1DKGD 2B5JA 2OYQA 3O4NA 2IS3A 1QSLA 3P1GA 4BC4A 3L0QA 4E1MA 4FLYA 4DMNA 1XNRK 4BRGA 1V4SA 3HI0A 1BCOA 4LH5A 3QO9A 4KKOA 2YHXA 1RDAA 3VA3A 2Y1IA 4Z4CA 4DV0K 3PX0A 2PYLA 4UQGA 4B9LA 1C0TA 3L2RA 4L8RB 3SLCA 4DSKA 3SCXA 1WAFA 2P9UB 3CPWM 2FC0A 3ZSQA 1KLNA 1BQNA 3ZCMA 3FZLA 1N5YA 4E7HA 3LP3A 4QAGA 3ENHA 3TAEA 2O8BA 2VQEK 1K73O 2Z1HA 4M7YA 1SKRA 4CJ7A 3F73A 4XH5A 4YOTA 2WUSA 1RT7A 4CHQA 3CFPA 3KKRA 1NJYA 4C8KA 1KFDA 4DB3A 1TL1A 2F9TA 2NRWA 3E9PA 4H0PA 3UKRB 4JRQA 3V9SA 5FRMA 3H45C 3VQQA 3D45A 3SQ0A 2HHSA 5KRSA 3SYZA 1GLDG 3EEQA 3AARA 5BR9A 5CHIA 4HTLA 3KLGA 1TKTA 3SJJA 4N41A 3NH2A 4B3MK 4F9OA 4Q5VA 5CE3A 3LL3A 3MWTA 4C23A 4GV6A 4DLGA 3NH0A 1DTQA 3O1WA 3T1YK 4KH5A 3CFOA 4C8MA 3T1AA 5EVZA 2RE2A 4E1NA 3THXA 3TSUA 1C0UA 3TANA 2E6LA 4IOCL 5C25A 3F9KA 3OW2M 4KHQA 4NCGA 3AO2A 1SS6A 1P90A 4RW6A 2P9NA 4CERA 1YI2N 4O8UA 4FW1A 3BY5A 3WNEA 3QNOA 4LC9B 1NK6A 2QWOA 1IBMK 3O4WA 4KH6A 1GOBA 1NBWA 3THYB 3HXMA 4FK2A 4LF8K 2F4VK 3VQ4A 5J1EA 3ZT3A 3FFIA 4E7LA 4DU1A 2FBXA 3G4SN 3EO3A 3C7NB 4DU3A 2ZWHA 3C6AA 3L4IA 3ZSZA 3GG4A 3L3UA 4W5TA 4FJKA 3PSFA 1W9HA 4CJTA 4RW7A 4X62K 3T69A 5GAEP 4I9QA 3BUZB 3VEVA 4PKIA 4B9UA 1QZ6A 3EZWA 2VG6A 3LZJA 2CH5A 2V51B 1BHLA 3OYBA 1NKBA 5BPNA 5DM7L 3I0SA 4Z4FA 3HO1A 4BR2A 2BH1A 4FZXC 1BL3A 1GLJO 3MXMA 4MLHA 4JI2K 5F0XA 3J8AA 3RR7A 3LDPA 3QINA 3CG7A 1HNVA 3WNGA 3EN9A 2D0CA 3DMJA 2CGLA 3ENBA 4AM6A 3HPHA 2F9WA 3OTOK 1RDWX 3WNHA 3VERA 2F96A 3TTDA 1T6CA 1RT4A 3BEXA 3GBTA 1QQCA 3VA0A 1REVA 3A2FA 1BISA 4WFNL 3OJUA 3QNNA 5HRSA 3WEEB 1IV0A 2ZD1A 4KI4A 4FCYA 3VMFB 4CZMA 4CBXA 2DFEA 3O6WA 3MN6A 3AVGA 1S1UA 3ITHA 4CGDA 5ADXA 1VQ6N 4DLEA 1NGCA 4N76A 4YDUA 1SL1A 4CZEA 3MECA 2P9IB 4FWNA 1OH7A 5C12A 3OYNA 5HROA 3C6TA 1RDDA 4I6MB 4FLUA 5KPZA 3T3FA 4CZFA 4LSNA 3MAQA 1ZBUA 1YTAA 4AILC 2YCHA 4I7FA 5AQWA 2KQ2A 1GLFO 2OPRA 3HP9A 3FGUA 3KKSA 4DQIA 3SAGA 4L3QA 5D3GA 4PY5A 1HMVA 4BRQA 3LZIA 3HK2A 3OYCA 3CD6N 5BPMA 2KFNA 4Z4HA 4JI7K 2IGIA 4CZLA 2O8BB 2HHQA 2ZGZA 3R8EA 3O1BA 5BPLA 2HW3A 1HNZK 2O8DB 1WSGA 3DYAA 2NRRA 2RHKA 3LDSA 4DF4A 4RTFD 2E1ZA 1VSLA 2V7YA 4DCHA 4FM1A 4U7BA 2P9SA 2FXUA 3VOVA 3MX2A 2F8TA 1D5AA 4DQQA 1TUYA 3SBTA 4OGCA 2XY6A 3SPYA 1KAZA 2NLXA 3V4IA 4E0DA 5M1FA 4RWTA 3O9QA 4CI6A 2RF2A 1C1CA 4QOZB 5KPRA 3EYZA 3NE6A 3JXUA 4DTMA 3O9UA 1WLJA 4AM7A 3DRRA 3R6MA 1O13A 1L3TA 4JKAA 3O9RA 4WQ4A 3THXB 2P5OA 3NH1A 1GLAG 1RTJA 4G1QA 1X3MA 4KH4A 3C94A 3H08A 1KRPA 2BDPA 4JN4A 1DGKN 3O3HA 2ASPA 2KTQA 3VTIA 2O4IA 1HYVA 1K8KB 4K41A 1C0FA 2Q1NA 3O3FA 1J5EK 3SUQA 1LWEA 1NK9A 1QHAA 3A0IX 4A61A 2D4WA 2WONA 2G8IA 3NF7A 3CCJN 2QWNA 2J4RA 4KHSA 5AQLA 3ISNC 1Y64A 1U49A 4FYDA 3SZ2A 4FXDA 3VF2A 2HBJA 1HYZA 3DLEA 2KFZA 2E4LA 3SJHA 3C6HA 4FJNA 3CC2N 3VPZA 4BC3A 3O9TA 1YAGA 4A5AA 3HL8A 3VGMA 3BZKA 4A2BA 1N36K 3HOSA 4DS4A 4FZZA 3WQTA 2XY7A 1UAXA 3ZEUA 2A42A 5JLFA 5EOYA 1NK4A 1WAJA 4KHYA 3QBWA 3PLAA 4DU4A 3DWLA 1QQOA 4RW9A 3CC7N 3S3OA 1R0AA 5IT9O 2YKMA 4M3YA 3AA5X 3IG1A 1TGOA 4CFAA 2O8FA 3AVIA 3THVA 3RTVA 3M1FA 1L5UA 4CJ4A 1VSHA 4BWJA 2FSJA 4JKFA 4CBWA 3QMLA 4DTRA 1TK0A 4UY8O 3A5MC 2HB5A 3CJBA 3B8AX 4LFCK 2A3ZA 3DLGA 3VQCA 5BR8K 2A40A 2ZJPL 4M41A 1O1WA 5C24A 1CXUA 3LAMA 1QQNA 3PV8A 1XI1A 4F4KA 1A5VA 2LSNA 4BRLA 4CJUA 4V19S 1RBTA 3HPGA 3CCEN 1XHXA 3AVAA 1VSKA 1RT6A 4HTUA 4LF6K 3FR0A 3R9PA 4KRFA 3L2UA 1MWMA 2E6MA 3A5LC 1HNIA 3HVRA 1SL2A 2QW9A 1KVBA 3VQEA 5DM6L 3J7ZO 2UUAK 3W3DA 1SAZA 4JKBA 4DV1K 4NXMK 2QWLA 4BDYA 2DY4A 1QSYA 3HOTA 1L3VA 4ELVA 4F3OA 3RSEB 5BN9A 3BF3A 4AHVA 1CLQA 3B6OA 3GE1A 3P38A 4CFCA 1N8RO 2QXFA 4IEIA 2Q0UA 2KKZA 4FLXA 2P9UA 4XH4A 1ZBLA 3UKUA 1QZ5A 3CCMN 4LSLA 4GW6A 4H5RA 3PIOL 3Q7BA 1T44A 4B1UB 5J2PA 3QEWA 3J80O 3GDQA 3A5NC 2V7ZA 3KIOA 5CR4A 1RNHA 3ATUA 4CK1A 3ZLJA 3DLRA 1RFQA 4GV9A 3NF6A 3OA9A 5FLXO 4KTZA 2A1RA 4FWQA 2QA4N 2WC9A 1BIUA 5FPDA 3NGIA 1KLMA 3AA3A 3UKRA 4C8LA 4AHSA 4CF9A 3AY9A 3ZT0A 1VRTA 5M1NA 4ID1A 3VESA 4HUEA 4A59A 4PL8A 3HM9A 3DAWA 4A57A 1Q9XA 2UXCK 3V6DA 4B9VA 1S22A 3P5JA 4Z94A 4FWSA 3VF4A 3FE1A 1HYSA 4QCLA 1NMNA 3RR8A 3HVTA 3LDQA 4E7JA 1NK7A 4H0YB 3SMSA 4CD1A 1C0MA 4FLWA 1WNSA 2HNZA 4CZKA 1N6QA 3RMDA 4WQ5A 3LDNA 3R1XA 4JRPA 5AQVA 1U45A 2VCPA 1JL1A 4ISGA 1XNQK 4C1NI 3HJFA 4AHCA 1JLEA 3VEYA 3WUHA 2G8FA 3GL1A 3RMBA 4B3SK 1VQMN 3UIQA 3CJ1A 2VG5A 5E41A 3TI0A 2YNIA 3TARA 3U9DA 1YXQA 2Q3SA 5KRTA 1EWRA 3MCAB 4MLEA 4Z0UA 3CMAN 4DR7K 5I42A 2GBZA 3C7NA 3E9OA 1T8EA 4ILHA 4FJ8A 5BRFA 1K6YA 3M3ZA 1BA1A 4CF2A 4B1VA 2FBVA 4YOWA 3TAPA 1HUXA 3ZEUB 5FRNA 4JI5K 1BOTO 2EWSA 1YITN 2P9PA 5FPMA 1J9AA 1X9SA 2OPPA 3DI6A 3SPZA 2OPQA 2ITMA 3SQ2A 3F5TA 4FJXA 2NUBA 3FZKA 3S3MA 1SV5A 2G8UA 1IKWA 2VGNA 4IOAL 4DFJA 4JYAK 4FM0A 1LWFA 2QKKA 1NJXA 4CJWA 1WUAA 4F8RA 3ZSWA 3SV3A 1N33K 2W6LA 3SBGA 4JS4A 3VEWA 4BDPA 3O80A 3WEEA 3OYAA 4ID5A 4DKWA 1KSPA 2NNWA 4W5OA 2NRVA 5SZTA 4KFBA 2ETJA 4BRDA 4N47A 4JI4K 4CGHA 1A5WA 2QKBA 4O5BA 5LJVA 3CI5A 3LWMA 4B3OA 3OHRA 5TKYA 1GLBG 4IG3A 2F7TA 3C6UA 4NCBA 4JEPA 1B9FA 3G71N 2EX3A 5AZJA 4KHWA 2P9IA 4CEOA 3K5NA 4FJGA 2E1YA 3QIOA 1GOAA 1YJNN 1XMOK 5E84A 2E88A 3CPEA 3TAMA 1LW0A 4JAXA 4I6MA 1XMQK 4XIUA 4R79A 1NKCA 3S9HA 1VSIA 4EZ6A 2GV9A 4FL9A 1I94K 1VK0A 1DEJA 4DFMA 3UKUB 5JS2A 4MO4A 4FWLA 4LF7K 3NCIA 1NJZA 3V9XA 3ULDA 4OO1J 3ULEB 3HPOA 1TYQB 4E7KA 3OYDA 3KD1E 5HL7L 4NCAA 3J7YP 2O8DA 3ZETA 4GVMA 4FW2A 4U67L 2HF3A 1HQEA 3V1QA 3G10A 2QWMA 1EO1A 3SQ1A 2IVNA 2W6KA 1IBKK 3CJ9A 5AQTA 1IKYA 3DRPA 2YHBA 4AHRA 3QBXA 4K25A 4RCHA 5AFUH 4FJMA 1JXBA 3I8BA 4DTNA 2VYPA 2Q97A 3ID8A 3KK3A 1FK9A 3DXMB 1HNWK 3FZMA 5AQSA 4FPAA 5I3UA 2NRTA 4R5PA 1D9DA 1UA1A 2JLEA 1T3VA 2HVHA 5HOOA 2HF4A 1C1AA 4KHUA 3VEOA 5AQPA 2UU9K 5AJ3K 1NGBA 2YJEA 1LCUA 3VEZA 4F2RA 1IG8A 3M8SA 5CY4A 4K8XA 4BRAA 2HHHK 3NF9A 4B8AB 1K8KA 3VQAA 1BGXT 2P9KB 3VQPA 4HWIA 3DLLL 3P39A 4Z4IA 3I33A 1X9JA 1NGDA 4CEZA 2WTUA 4B9NA 2GELA 2IVOA 5K14A 2ASMA 2DPNA 4H5WA 4DSJA 1NJIO 4KTWA 3UB5A 1T03A 5AQZA 1DLOA 1D9FA 4KB0A 2IC3A 3THWB 2GTDA 1SQKA 1DTTA 4FPBA 2HBLA 3SAHA 3ZX2A 2YNFA 1TK8A
chains in the Genus database with same CATH topology
1WLJA 3DRRA 3NDKA 3RMAA 3L3VA 3DM2A 3DLBA 1HRHA 1L3TA 4Z4EA 3QEPA 4Z4GA 4CJLA 4O0IA 3ALYA 4MQ3A 1CZ9A 3AVFA 1J5OA 4FJ7A 4EP5A 4C8NA 2P5OA 2YNHA 3DLKA 3NH1A 3V9WA 1RTJA 4CIFA 4G1QA 4CK3A 3V81A 3TAQA 3RRGA 1TAQA 3OYIA 3C94A 3H08A 1KRPA 2BDPA 1UA0A 4ICLA 1RDBA 4KTQA 3O3HA 1TVRA 1J54A 2IAJA 2KTQA 2ITGA 4AHUA 5SWMA 3OYLA 1Y97A 2XY5A 4B08A 1HYVA 1XC9A 2O4IA 1IKXA 1NJWA 3O3FA 4H4OA 2X78A 3OS0A 3SUQA 1LWEA 1NK9A 1NKEA 4KHNA 4OLBA 4NYNA 3B6PA 3ZSOA 2OZMA 5JS1A 3NBPA 2ZE2A 3AVCA 4M3ZA 2WONA 3I8DA 1X1PA 3OYJA 4CGIA 2G8IA 3NF7A 1ASUA 4KHSA 4LY7A 3VQ8A 2YV0X 3ISNC 1U49A 4FYDA 3SZ2A 4FXDA 4BACA 3LANA 4F2SA 1HYZA 3DLEA 4NYFA 1BCMA 2RN2A 2E4LA 1L3UA 2KFZA 4FJNA 3VN5A 1TAUA 1BIZA 1YVUA 4CECA 4DTSA 4CCHA 4J2DA 3CM5A 2RPIA 3E01A 3IRXA 3HL8A 1S5JA 4CJRA 2HHWA 3O4QA 4DSEA 4DS4A 4DS5A 1RTHA 3NAEA 2X6SA 4FZZA 4IBNA 1JL2A 1VSEA 2XY7A 4B8CA 1UAXA 4W5QA 4FJLA 4H4MA 4CGGA 4CGFA 1RBUA 3M8PA 1I39A 1WAJA 4OJRA 5DMRA 1Z25A 1HQUA 1NK4A 4KHYA 4DU4A 3MEDA 1KTQA 4CFBA 3LPUA 1RBVA 1JLQA 2OPSA 4RW9A 3TAFA 5HLFA 4ZTFA 3L2QA 4PQUA 2XRIA 3S3OA 1R0AA 4YFUA 1S1WA 2YKMA 4M3YA 2DFHA 3AA5X 4PUOA 3IG1A 1CXQA 1RTIA 1TGOA 3AVKA 4IG0A 4CFAA 4CIGA 3PX6A 2BANA 3AVIA 3TR8A 3THVA 3RTVA 1VRUA 1L5UA 4CJ4A 1VSHA 4KO0A 4BWJA 3LWLA 3U6FA 2KW4A 3PUFA 4DTRA 1TK0A 2OA8A 1J53A 3SV4A 3LP1A 2HB5A 2KZZA 1I3AA 2Y1JA 4CE9A 4DFKA 4CJPA 5J2NA 4DQRA 5T7BA 3OY9A 3DLGA 3VQCA 4CEBA 4CESA 5KTQA 3TWHA 1S6QA 1ASVA 4FZYA 1VSJA 1LW2A 4M41A 3D0PA 1O1WA 5C24A 4Y1CA 1CXUA 3OYKA 2GUIA 4CEFA 2D0BA 3DRSA 3LAMA 1JLAA 3KJVA 4CEDA 3PV8A 1SKWA 3C95A 1JLFA 4DTOA 1XI1A 4F4KA 1YT3A 1A5VA 2LSNA 4CF8A 2G8VA 4CJUA 4W5NA 1RBTA 3HPGA 5CYMA 2QK9A 4FVMA 1XHXA 3AVAA 3LAKA 1VSKA 4DTPA 3OYFA 3OYHA 1RT6A 1YTUA 4HTUA 3MXJA 1NK0A 4W5RA 4KRFA 1UOCA 3K5OA 3AA2A 3L2UA 3IS9A 2D5RA 3JYTA 1RILA 2E6MA 1EETA 4RW8A 2EHGA 1FKPA 4I2QA 4DQSA 1HNIA 1C6VA 4ELUA 3HVRA 2PYJA 2BGGA 1FKOA 3LP2A 3EZ5A 1SL2A 1GOCA 1ZBHA 3U3YA 1KVBA 3VQEA 4OGEA 4E7IA 2JGUA 1S9EA 5HRPA 3OYGA 4DF8A 2I5JA 2A1SA 4KPYA 4CGJA 3AO4A 1XWLA 4BDYA 3SI6A 5HRNA 3OS1A 3QEXA 3NGZA 1HJRA 1EX4A 1JLGA 1L3VA 1QSYA 4ELVA 3SNNA 4F3OA 3CYMA 4BE1A 3P83D 1TV6A 4AHVA 1IO2A 4DTUA 1CLQA 4FM2A 1RBSA 3HP6A 4B9TA 4N5SA 3OYMA 1QHTA 1UWBA 3B6OA 4CFCA 4YNQA 2QXFA 3L8BA 3O3GA 4J2AA 1LV5A 4RW4A 2YNGA 1EP4A 5CYQA 3VQ9A 4FLXA 3RWUA 4DTMA 1ZBLA 1W0HA 2YHAA 4GW6A 4LSLA 4JS5A 5HBMA 3U3GA 4BDZA 5J2PA 1RT1A 3QEWA 5KI6A 4OPKA 3RRHA 2HHUA 3AVHA 2HMIA 1KLNA 5CZ2A 4CK2A 1VSFA 1C1BA 3KIOA 3V1OA 1S6PA 2B5JA 4TSXA 2OYQA 1RNHA 3O4NA 4CK1A 1TK8A 1IG9A 4B9SA 2IS3A 3QETA 3DLRA 3ZT4A 1QSLA 2HHXA 2VWKA 4CHOA 2DTUA 3NF6A 3VQBA 3P1GA 3VQ6A 4KTZA 2PZSA 4KI6A 2A1RA 4IDKA 2DFFA 4CJEA 4CIEA 4E1MA 4FLYA 3PO4A 4EZ9A 1BIUA 4M3RA 4DMNA 3NGIA 3QEVA 1S1TA 1KLMA 3AA3A 4C8LA 1XHZA 4C8OA 4AHSA 3AA4A 4JLHA 4CF9A 4CEAA 4OPJA 4Q0BA 4CEQA 3ZT0A 1VRTA 3KK2A 4ID1A 4HUEA 1BCOA 3OJSA 4IFVA 1JKHA 3QO9A 4LH5A 5KGWA 4KKOA 1RDAA 4OLAA 3HM9A 3DLHA 3VA3A 3CFRA 3S3NA 4IKFA 4B9MA 4FK4A 5HP1A 1WSIA 2Y1IA 4Z4CA 2FBYA 1Q9XA 3G0ZA 3PX0A 2PYLA 3V6DA 4B9VA 4E19A 4UQGA 4B9LA 3P5JA 3ZSVA 1C0TA 3L2RA 4L8RB 4I2PA 4DSKA 1HYSA 3SCXA 4QCLA 2G8KA 3RMCA 1WAFA 3RR8A 3HVTA 1WSEA 1B92A 4CJVA 2XHBA 4OKEA 2FC0A 4DTJA 3ZSQA 4E7JA 1BQNA 1NK7A 3ZCMA 3K5LA 1VSMA 3KLEA 4E7HA 1N5YA 4DTXA 3BDPA 3LP3A 3QERA 4QAGA 4CJQA 4M3XA 1C0MA 3TAEA 3AV9A 4FLWA 1WNSA 3QEIA 1QTMA 2HNZA 1U04A 3HSTB 1N6QA 4CJFA 3RMDA 1Q9YA 2Z1HA 5EU7A 4JRPA 3F73A 1NK5A 1SKRA 5C42A 1S9GA 2B4JA 5DK5A 1U45A 2Z1GA 1BQMA 1WSHA 2X6NA 1JL1A 2B6AA 2IOCA 1RT7A 4CHQA 3MEGA 3HT3A 3CFPA 3HJFA 4AHCA 3KKRA 1JLEA 4CF1A 1NJYA 3LP0A 2G8FA 3HYFA 3VQ5A 3RMBA 2D0AA 1QSSA 1KFDA 4C8KA 3UIQA 1TL1A 2VG5A 4RG8A 3KLHA 4AH9A 1T05A 4JRQA 3V9SA 5E41A 1RBRA 3PO5A 4WE1A 3TI0A 5FRMA 2YNIA 3QIPA 3VQQA 3D45A 3TARA 3AO5A 5KRTA 2Q3SA 3SQ0A 5FROA 3NFAA 4Z0UA 2HHSA 5KRSA 1RCHA 3SYZA 5I42A 3KLGA 1ZBFA 1LAWA 4DSFA 2GBZA 2HHTA 1TKTA 3SJJA 4O4GA 1T8EA 2P1JA 1T7PA 4N41A 3NH2A 4K8ZA 3OYEA 2VG7A 4FJ8A 1RT5A 4E89A 4Q5VA 4FJHA 4FJJA 1K6YA 1S1XA 2HHVA 4HUGA 4M42A 4CF2A 4DLGA 2FBVA 3AVNA 3TAPA 4DWIA 3NH0A 1DTQA 1LAVA 1TKZA 1KCFA 4FJIA 3CFOA 5FRNA 4C8MA 3T1AA 4E1NA 3AO1A 5HRRA 1J9AA 1C0UA 3QESA 3TANA 1RT2A 3DOLA 1X9SA 2E6LA 2OPPA 3DI6A 4M45A 3F9KA 5C25A 3SPZA 4KHQA 2OPQA 3SQ2A 4HVJA 4OVLA 1ZYQA 1X9MA 4NCGA 5CZ1A 4FJXA 2NUBA 1A5XA 3AO2A 4RW6A 3AVLA 1SV5A 3S3MA 1S1VA 4CERA 1B9DA 2G8UA 4CHZA 1IKWA 4FK0A 4FW1A 3K58A 1F21A 3WNEA 3QNOA 1L3SA 4DFJA 4N56A 1NK6A 4FM0A 1ASWA 1LWFA 2G8WA 2QKKA 4BE2A 1GOBA 2VWJA 4O0JA 4FK2A 3HXMA 4AHTA 1NJXA 4CJWA 4F8RA 3VQ4A 5J1EA 3ZSWA 3KLIA 3ZT3A 3SV3A 3FFIA 4DFPA 3MEEA 4E7LA 4DU1A 2FBXA 4JS4A 4PWDA 1WSJA 1EKEA 1VSDA 3K57A 4BDPA 4DU3A 3OYAA 4ID5A 1KSPA 3ZSZA 1G15A 4W5OA 1IKVA 1SUQA 3I0RA 1MU2A 3L3UA 3ZSYA 4W5TA 4FJKA 5SZTA 4KFBA 1WN7A 2ETJA 3V9ZA 4M3TA 1W9HA 4N47A 1QS4A 1A5WA 4RW7A 4OKKA 4CGHA 4O5BA 4CJTA 1TL3A 4BE0A 1ZBIA 3LWMA 2QKBA 4B3OA 4Y1DA 4ZTJA 1RTDA 1QE1A 4I9QA 3CM6A 3PY8A 4IG3A 4B9UA 3C6UA 2VG6A 3LZJA 2BE2A 4J2BA 4NCBA 1BHLA 3OYBA 1B9FA 2Z1IA 1BI4A 3AVJA 1NKBA 2EX3A 3I0SA 3OS2A 4Z4FA 3HO1A 4KHWA 4FZXC 3NHGA 2HNDA 4CEOA 1BL3A 3K5NA 3MXMA 4FJGA 1JLBA 2AJQA 4M3WA 1LWCA 1EXQA 3QIOA 1GOAA 5KGXA 3RR7A 1IH7A 3LALA 4PA1A 1U48A 3QINA 1LW0A 3TAMA 3CG7A 3AVMA 1HNVA 3WNGA 5J2QA 3KTQA 4HHTA 2P5GA 4EP4A 4J2EA 2D0CA 3DMJA 2ZQBA 3EY1A 2G8HA 4HCBA 2P51A 4XIUA 3HPHA 4FLVA 3AVBA 1TKDA 1NKCA 3T19A 3S9HA 3WNHA 1Z26A 4CHPA 1VSIA 3M8RA 1U47A 1X9WA 4EZ6A 2F96A 2GV9A 3NF8A 3TABA 1RT4A 4GMJB 1VK0A 1QQCA 4DFMA 3VA0A 1TK5A 1REVA 3A2FA 5JS2A 3BGRA 1BISA 3OJUA 3QNNA 1NK8A 1D8YA 1CZBA 4CHNA 5HRSA 2Z1JA 3KD5E 2KZMA 2ZD1A 3NCIA 4KI4A 1NJZA 1FXXA 4FCYA 3V9XA 3ULDA 3PX4A 4DG1A 4BWMA 4DSIA 3HPOA 3KK1A 4E3SA 2DFEA 4E7KA 3OYDA 3KD1E 3SUPA 3AVGA 1S1UA 3ITHA 2R7YA 1SKSA 4NCAA 4KAZA 4HCCA 1KVCA 3ASMA 4CGDA 4GVMA 2XY8A 2X74A 4FW2A 3SQ4A 2IDOA 1HQEA 4M3UA 3JSMA 4DLEA 3V1QA 3G10A 4LD0A 3ZT1A 3NGYA 4CJKA 4N76A 1BI4B 1SL1A 2RKIA 3MECA 3DOKA 4HUFA 3SQ1A 4LH4A 4KV8A 4F3TA 4DSLA 4ELTA 3SUNA 3K59A 1IKYA 3DRPA 3LPTA 2YHBA 4AHRA 1HPZA 3OYNA 3CQ8A 5HROA 3C6TA 2XO7A 3M8QA 3SUOA 1RDDA 4FLUA 3T3FA 4FJMA 1JXBA 4LSNA 4KREA 4DTNA 3MAQA 1JLCA 1YTAA 1ZBUA 4AILC 3K2PA 4I7FA 3ZSRA 2O4GA 2KQ2A 5J2MA 2OPRA 3HP9A 4KB1A 3L2VA 2HVIA 2DY4A 3KK3A 3KKSA 3K5MA 1FK9A 4DQIA 4FJ9A 5FDLA 5D3GA 4PY5A 3ZT2A 3VQ7A 1HMVA 5I3UA 2HNYA 3LZIA 2OZSA 4DQPA 3HK2A 4R5PA 4O44A 3OYCA 1D9DA 1UA1A 2KFNA 4IFYA 2JLEA 3KLFA 4Z4HA 1KVAA 2IGIA 3QLHA 2HVHA 2HHQA 4CFDA 1C1AA 4FLTA 4KHUA 4CEEA 2HW3A 3L2WA 1RT3A 4O55A 3IAYA 4F2RA 4MFBA 3M8SA 1WSGA 5CY4A 3DYAA 4CHYA 4K8XA 1SL0A 3NF9A 4B8AB 2YKNA 1TKXA 1RDCA 4CF0A 3VQAA 1BGXT 3VQPA 1NOZA 3LDSA 4DF4A 1NOYA 1WSFA 3V1RA 2W42A 3AO3A 2ATQA 4Z4IA 1VSLA 1Q8IA 4FM1A 1KFSA 4FLZA 4CEZA 4B9NA 3TAGA 2F8TA 1D5AA 4H8KA 4FJ5A 4DQQA 2FBTA 5K14A 2WOMA 4OGCA 3WNFA 4CJSA 4ZHRA 2XY6A 3SPYA 3V4IA 1ITGA 4E0DA 4DSJA 3MXIA 1U4BA 4KTWA 1T03A 2RF2A 1DLOA 3V9UA 1D9FA 3OVNA 4KB0A 2IC3A 1C1CA 2PY5A 4QOZB 2F8SA 1DTTA 3ZSXA 3EYZA 1JXEA 3VQDA 4CJ3A 2YNFA 4I9LA 4CJ5A 3NE6A 4OKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLJ A;  3DRR A;  3NDK A;  3RMA A;  3L3V A;  3DM2 A;  3DLB A;  1HRH A;  1L3T A;  4Z4E A;  3QEP A;  4Z4G A;  4CJL A;  4O0I A;  3ALY A;  4MQ3 A;  1CZ9 A;  3AVF A;  1J5O A;  4FJ7 A;  4EP5 A;  4C8N A;  2P5O A;  2YNH A;  3DLK A;  3NH1 A;  3V9W A;  1RTJ A;  4CIF A;  4G1Q A;  4CK3 A;  3V81 A;  3TAQ A;  3RRG A;  1TAQ A;  3OYI A;  3C94 A;  3H08 A;  1KRP A;  2BDP A;  1UA0 A;  4ICL A;  1RDB A;  4KTQ A;  3O3H A;  1TVR A;  1J54 A;  2IAJ A;  2KTQ A;  2ITG A;  4AHU A;  5SWM A;  3OYL A;  1Y97 A;  2XY5 A;  4B08 A;  1HYV A;  1XC9 A;  2O4I A;  1IKX A;  1NJW A;  3O3F A;  4H4O A;  2X78 A;  3OS0 A;  3SUQ A;  1LWE A;  1NK9 A;  1NKE A;  4KHN A;  4OLB A;  4NYN A;  3B6P A;  3ZSO A;  2OZM A;  5JS1 A;  3NBP A;  2ZE2 A;  3AVC A;  4M3Z A;  2WON A;  3I8D A;  1X1P A;  3OYJ A;  4CGI A;  2G8I A;  3NF7 A;  1ASU A;  4KHS A;  4LY7 A;  3VQ8 A;  2YV0 X;  3ISN C;  1U49 A;  4FYD A;  3SZ2 A;  4FXD A;  4BAC A;  3LAN A;  4F2S A;  1HYZ A;  3DLE A;  4NYF A;  1BCM A;  2RN2 A;  2E4L A;  1L3U A;  2KFZ A;  4FJN A;  3VN5 A;  1TAU A;  1BIZ A;  1YVU A;  4CEC A;  4DTS A;  4CCH A;  4J2D A;  3CM5 A;  2RPI A;  3E01 A;  3IRX A;  3HL8 A;  1S5J A;  4CJR A;  2HHW A;  3O4Q A;  4DSE A;  4DS4 A;  4DS5 A;  1RTH A;  3NAE A;  2X6S A;  4FZZ A;  4IBN A;  1JL2 A;  1VSE A;  2XY7 A;  4B8C A;  1UAX A;  4W5Q A;  4FJL A;  4H4M A;  4CGG A;  4CGF A;  1RBU A;  3M8P A;  1I39 A;  1WAJ A;  4OJR A;  5DMR A;  1Z25 A;  1HQU A;  1NK4 A;  4KHY A;  4DU4 A;  3MED A;  1KTQ A;  4CFB A;  3LPU A;  1RBV A;  1JLQ A;  2OPS A;  4RW9 A;  3TAF A;  5HLF A;  4ZTF A;  3L2Q A;  4PQU A;  2XRI A;  3S3O A;  1R0A A;  4YFU A;  1S1W A;  2YKM A;  4M3Y A;  2DFH A;  3AA5 X;  4PUO A;  3IG1 A;  1CXQ A;  1RTI A;  1TGO A;  3AVK A;  4IG0 A;  4CFA A;  4CIG A;  3PX6 A;  2BAN A;  3AVI A;  3TR8 A;  3THV A;  3RTV A;  1VRU A;  1L5U A;  4CJ4 A;  1VSH A;  4KO0 A;  4BWJ A;  3LWL A;  3U6F A;  2KW4 A;  3PUF A;  4DTR A;  1TK0 A;  2OA8 A;  1J53 A;  3SV4 A;  3LP1 A;  2HB5 A;  2KZZ A;  1I3A A;  2Y1J A;  4CE9 A;  4DFK A;  4CJP A;  5J2N A;  4DQR A;  5T7B A;  3OY9 A;  3DLG A;  3VQC A;  4CEB A;  4CES A;  5KTQ A;  3TWH A;  1S6Q A;  1ASV A;  4FZY A;  1VSJ A;  1LW2 A;  4M41 A;  3D0P A;  1O1W A;  5C24 A;  4Y1C A;  1CXU A;  3OYK A;  2GUI A;  4CEF A;  2D0B A;  3DRS A;  3LAM A;  1JLA A;  3KJV A;  4CED A;  3PV8 A;  1SKW A;  3C95 A;  1JLF A;  4DTO A;  1XI1 A;  4F4K A;  1YT3 A;  1A5V A;  2LSN A;  4CF8 A;  2G8V A;  4CJU A;  4W5N A;  1RBT A;  3HPG A;  5CYM A;  2QK9 A;  4FVM A;  1XHX A;  3AVA A;  3LAK A;  1VSK A;  4DTP A;  3OYF A;  3OYH A;  1RT6 A;  1YTU A;  4HTU A;  3MXJ A;  1NK0 A;  4W5R A;  4KRF A;  1UOC A;  3K5O A;  3AA2 A;  3L2U A;  3IS9 A;  2D5R A;  3JYT A;  1RIL A;  2E6M A;  1EET A;  4RW8 A;  2EHG A;  1FKP A;  4I2Q A;  4DQS A;  1HNI A;  1C6V A;  4ELU A;  3HVR A;  2PYJ A;  2BGG A;  1FKO A;  3LP2 A;  3EZ5 A;  1SL2 A;  1GOC A;  1ZBH A;  3U3Y A;  1KVB A;  3VQE A;  4OGE A;  4E7I A;  2JGU A;  1S9E A;  5HRP A;  3OYG A;  4DF8 A;  2I5J A;  2A1S A;  4KPY A;  4CGJ A;  3AO4 A;  1XWL A;  4BDY A;  3SI6 A;  5HRN A;  3OS1 A;  3QEX A;  3NGZ A;  1HJR A;  1EX4 A;  1JLG A;  1L3V A;  1QSY A;  4ELV A;  3SNN A;  4F3O A;  3CYM A;  4BE1 A;  3P83 D;  1TV6 A;  4AHV A;  1IO2 A;  4DTU A;  1CLQ A;  4FM2 A;  1RBS A;  3HP6 A;  4B9T A;  4N5S A;  3OYM A;  1QHT A;  1UWB A;  3B6O A;  4CFC A;  4YNQ A;  2QXF A;  3L8B A;  3O3G A;  4J2A A;  1LV5 A;  4RW4 A;  2YNG A;  1EP4 A;  5CYQ A;  3VQ9 A;  4FLX A;  3RWU A;  4DTM A;  1ZBL A;  1W0H A;  2YHA A;  4GW6 A;  4LSL A;  4JS5 A;  5HBM A;  3U3G A;  4BDZ A;  5J2P A;  1RT1 A;  3QEW A;  5KI6 A;  4OPK A;  3RRH A;  2HHU A;  3AVH A;  2HMI A;  1KLN A;  5CZ2 A;  4CK2 A;  1VSF A;  1C1B A;  3KIO A;  3V1O A;  1S6P A;  2B5J A;  4TSX A;  2OYQ A;  1RNH A;  3O4N A;  4CK1 A;  1TK8 A;  1IG9 A;  4B9S A;  2IS3 A;  3QET A;  3DLR A;  3ZT4 A;  1QSL A;  2HHX A;  2VWK A;  4CHO A;  2DTU A;  3NF6 A;  3VQB A;  3P1G A;  3VQ6 A;  4KTZ A;  2PZS A;  4KI6 A;  2A1R A;  4IDK A;  2DFF A;  4CJE A;  4CIE A;  4E1M A;  4FLY A;  3PO4 A;  4EZ9 A;  1BIU A;  4M3R A;  4DMN A;  3NGI A;  3QEV A;  1S1T A;  1KLM A;  3AA3 A;  4C8L A;  1XHZ A;  4C8O A;  4AHS A;  3AA4 A;  4JLH A;  4CF9 A;  4CEA A;  4OPJ A;  4Q0B A;  4CEQ A;  3ZT0 A;  1VRT A;  3KK2 A;  4ID1 A;  4HUE A;  1BCO A;  3OJS A;  4IFV A;  1JKH A;  3QO9 A;  4LH5 A;  5KGW A;  4KKO A;  1RDA A;  4OLA A;  3HM9 A;  3DLH A;  3VA3 A;  3CFR A;  3S3N A;  4IKF A;  4B9M A;  4FK4 A;  5HP1 A;  1WSI A;  2Y1I A;  4Z4C A;  2FBY A;  1Q9X A;  3G0Z A;  3PX0 A;  2PYL A;  3V6D A;  4B9V A;  4E19 A;  4UQG A;  4B9L A;  3P5J A;  3ZSV A;  1C0T A;  3L2R A;  4L8R B;  4I2P A;  4DSK A;  1HYS A;  3SCX A;  4QCL A;  2G8K A;  3RMC A;  1WAF A;  3RR8 A;  3HVT A;  1WSE A;  1B92 A;  4CJV A;  2XHB A;  4OKE A;  2FC0 A;  4DTJ A;  3ZSQ A;  4E7J A;  1BQN A;  1NK7 A;  3ZCM A;  3K5L A;  1VSM A;  3KLE A;  4E7H A;  1N5Y A;  4DTX A;  3BDP A;  3LP3 A;  3QER A;  4QAG A;  4CJQ A;  4M3X A;  1C0M A;  3TAE A;  3AV9 A;  4FLW A;  1WNS A;  3QEI A;  1QTM A;  2HNZ A;  1U04 A;  3HST B;  1N6Q A;  4CJF A;  3RMD A;  1Q9Y A;  2Z1H A;  5EU7 A;  4JRP A;  3F73 A;  1NK5 A;  1SKR A;  5C42 A;  1S9G A;  2B4J A;  5DK5 A;  1U45 A;  2Z1G A;  1BQM A;  1WSH A;  2X6N A;  1JL1 A;  2B6A A;  2IOC A;  1RT7 A;  4CHQ A;  3MEG A;  3HT3 A;  3CFP A;  3HJF A;  4AHC A;  3KKR A;  1JLE A;  4CF1 A;  1NJY A;  3LP0 A;  2G8F A;  3HYF A;  3VQ5 A;  3RMB A;  2D0A A;  1QSS A;  1KFD A;  4C8K A;  3UIQ A;  1TL1 A;  2VG5 A;  4RG8 A;  3KLH A;  4AH9 A;  1T05 A;  4JRQ A;  3V9S A;  5E41 A;  1RBR A;  3PO5 A;  4WE1 A;  3TI0 A;  5FRM A;  2YNI A;  3QIP A;  3VQQ A;  3D45 A;  3TAR A;  3AO5 A;  5KRT A;  2Q3S A;  3SQ0 A;  5FRO A;  3NFA A;  4Z0U A;  2HHS A;  5KRS A;  1RCH A;  3SYZ A;  5I42 A;  3KLG A;  1ZBF A;  1LAW A;  4DSF A;  2GBZ A;  2HHT A;  1TKT A;  3SJJ A;  4O4G A;  1T8E A;  2P1J A;  1T7P A;  4N41 A;  3NH2 A;  4K8Z A;  3OYE A;  2VG7 A;  4FJ8 A;  1RT5 A;  4E89 A;  4Q5V A;  4FJH A;  4FJJ A;  1K6Y A;  1S1X A;  2HHV A;  4HUG A;  4M42 A;  4CF2 A;  4DLG A;  2FBV A;  3AVN A;  3TAP A;  4DWI A;  3NH0 A;  1DTQ A;  1LAV A;  1TKZ A;  1KCF A;  4FJI A;  3CFO A;  5FRN A;  4C8M A;  3T1A A;  4E1N A;  3AO1 A;  5HRR A;  1J9A A;  1C0U A;  3QES A;  3TAN A;  1RT2 A;  3DOL A;  1X9S A;  2E6L A;  2OPP A;  3DI6 A;  4M45 A;  3F9K A;  5C25 A;  3SPZ A;  4KHQ A;  2OPQ A;  3SQ2 A;  4HVJ A;  4OVL A;  1ZYQ A;  1X9M A;  4NCG A;  5CZ1 A;  4FJX A;  2NUB A;  1A5X A;  3AO2 A;  4RW6 A;  3AVL A;  1SV5 A;  3S3M A;  1S1V A;  4CER A;  1B9D A;  2G8U A;  4CHZ A;  1IKW A;  4FK0 A;  4FW1 A;  3K58 A;  1F21 A;  3WNE A;  3QNO A;  1L3S A;  4DFJ A;  4N56 A;  1NK6 A;  4FM0 A;  1ASW A;  1LWF A;  2G8W A;  2QKK A;  4BE2 A;  1GOB A;  2VWJ A;  4O0J A;  4FK2 A;  3HXM A;  4AHT A;  1NJX A;  4CJW A;  4F8R A;  3VQ4 A;  5J1E A;  3ZSW A;  3KLI A;  3ZT3 A;  3SV3 A;  3FFI A;  4DFP A;  3MEE A;  4E7L A;  4DU1 A;  2FBX A;  4JS4 A;  4PWD A;  1WSJ A;  1EKE A;  1VSD A;  3K57 A;  4BDP A;  4DU3 A;  3OYA A;  4ID5 A;  1KSP A;  3ZSZ A;  1G15 A;  4W5O A;  1IKV A;  1SUQ A;  3I0R A;  1MU2 A;  3L3U A;  3ZSY A;  4W5T A;  4FJK A;  5SZT A;  4KFB A;  1WN7 A;  2ETJ A;  3V9Z A;  4M3T A;  1W9H A;  4N47 A;  1QS4 A;  1A5W A;  4RW7 A;  4OKK A;  4CGH A;  4O5B A;  4CJT A;  1TL3 A;  4BE0 A;  1ZBI A;  3LWM A;  2QKB A;  4B3O A;  4Y1D A;  4ZTJ A;  1RTD A;  1QE1 A;  4I9Q A;  3CM6 A;  3PY8 A;  4IG3 A;  4B9U A;  3C6U A;  2VG6 A;  3LZJ A;  2BE2 A;  4J2B A;  4NCB A;  1BHL A;  3OYB A;  1B9F A;  2Z1I A;  1BI4 A;  3AVJ A;  1NKB A;  2EX3 A;  3I0S A;  3OS2 A;  4Z4F A;  3HO1 A;  4KHW A;  4FZX C;  3NHG A;  2HND A;  4CEO A;  1BL3 A;  3K5N A;  3MXM A;  4FJG A;  1JLB A;  2AJQ A;  4M3W A;  1LWC A;  1EXQ A;  3QIO A;  1GOA A;  5KGX A;  3RR7 A;  1IH7 A;  3LAL A;  4PA1 A;  1U48 A;  3QIN A;  1LW0 A;  3TAM A;  3CG7 A;  3AVM A;  1HNV A;  3WNG A;  5J2Q A;  3KTQ A;  4HHT A;  2P5G A;  4EP4 A;  4J2E A;  2D0C A;  3DMJ A;  2ZQB A;  3EY1 A;  2G8H A;  4HCB A;  2P51 A;  4XIU A;  3HPH A;  4FLV A;  3AVB A;  1TKD A;  1NKC A;  3T19 A;  3S9H A;  3WNH A;  1Z26 A;  4CHP A;  1VSI A;  3M8R A;  1U47 A;  1X9W A;  4EZ6 A;  2F96 A;  2GV9 A;  3NF8 A;  3TAB A;  1RT4 A;  4GMJ B;  1VK0 A;  1QQC A;  4DFM A;  3VA0 A;  1TK5 A;  1REV A;  3A2F A;  5JS2 A;  3BGR A;  1BIS A;  3OJU A;  3QNN A;  1NK8 A;  1D8Y A;  1CZB A;  4CHN A;  5HRS A;  2Z1J A;  3KD5 E;  2KZM A;  2ZD1 A;  3NCI A;  4KI4 A;  1NJZ A;  1FXX A;  4FCY A;  3V9X A;  3ULD A;  3PX4 A;  4DG1 A;  4BWM A;  4DSI A;  3HPO A;  3KK1 A;  4E3S A;  2DFE A;  4E7K A;  3OYD A;  3KD1 E;  3SUP A;  3AVG A;  1S1U A;  3ITH A;  2R7Y A;  1SKS A;  4NCA A;  4KAZ A;  4HCC A;  1KVC A;  3ASM A;  4CGD A;  4GVM A;  2XY8 A;  2X74 A;  4FW2 A;  3SQ4 A;  2IDO A;  1HQE A;  4M3U A;  3JSM A;  4DLE A;  3V1Q A;  3G10 A;  4LD0 A;  3ZT1 A;  3NGY A;  4CJK A;  4N76 A;  1BI4 B;  1SL1 A;  2RKI A;  3MEC A;  3DOK A;  4HUF A;  3SQ1 A;  4LH4 A;  4KV8 A;  4F3T A;  4DSL A;  4ELT A;  3SUN A;  3K59 A;  1IKY A;  3DRP A;  3LPT A;  2YHB A;  4AHR A;  1HPZ A;  3OYN A;  3CQ8 A;  5HRO A;  3C6T A;  2XO7 A;  3M8Q A;  3SUO A;  1RDD A;  4FLU A;  3T3F A;  4FJM A;  1JXB A;  4LSN A;  4KRE A;  4DTN A;  3MAQ A;  1JLC A;  1YTA A;  1ZBU A;  4AIL C;  3K2P A;  4I7F A;  3ZSR A;  2O4G A;  2KQ2 A;  5J2M A;  2OPR A;  3HP9 A;  4KB1 A;  3L2V A;  2HVI A;  2DY4 A;  3KK3 A;  3KKS A;  3K5M A;  1FK9 A;  4DQI A;  4FJ9 A;  5FDL A;  5D3G A;  4PY5 A;  3ZT2 A;  3VQ7 A;  1HMV A;  5I3U A;  2HNY A;  3LZI A;  2OZS A;  4DQP A;  3HK2 A;  4R5P A;  4O44 A;  3OYC A;  1D9D A;  1UA1 A;  2KFN A;  4IFY A;  2JLE A;  3KLF A;  4Z4H A;  1KVA A;  2IGI A;  3QLH A;  2HVH A;  2HHQ A;  4CFD A;  1C1A A;  4FLT A;  4KHU A;  4CEE A;  2HW3 A;  3L2W A;  1RT3 A;  4O55 A;  3IAY A;  4F2R A;  4MFB A;  3M8S A;  1WSG A;  5CY4 A;  3DYA A;  4CHY A;  4K8X A;  1SL0 A;  3NF9 A;  4B8A B;  2YKN A;  1TKX A;  1RDC A;  4CF0 A;  3VQA A;  1BGX T;  3VQP A;  1NOZ A;  3LDS A;  4DF4 A;  1NOY A;  1WSF A;  3V1R A;  2W42 A;  3AO3 A;  2ATQ A;  4Z4I A;  1VSL A;  1Q8I A;  4FM1 A;  1KFS A;  4FLZ A;  4CEZ A;  4B9N A;  3TAG A;  2F8T A;  1D5A A;  4H8K A;  4FJ5 A;  4DQQ A;  2FBT A;  5K14 A;  2WOM A;  4OGC A;  3WNF A;  4CJS A;  4ZHR A;  2XY6 A;  3SPY A;  3V4I A;  1ITG A;  4E0D A;  4DSJ A;  3MXI A;  1U4B A;  4KTW A;  1T03 A;  2RF2 A;  1DLO A;  3V9U A;  1D9F A;  3OVN A;  4KB0 A;  2IC3 A;  1C1C A;  2PY5 A;  4QOZ B;  2F8S A;  1DTT A;  3ZSX A;  3EYZ A;  1JXE A;  3VQD A;  4CJ3 A;  2YNF A;  4I9L A;  4CJ5 A;  3NE6 A;  4OKJ A; 
#chains in the Genus database with same CATH topology
 1NWK A;  2ZM6 K;  4A2A A;  4DV3 K;  4CJL A;  4O0I A;  1QVF M;  4MQ3 A;  2P9P B;  3AVF A;  4FJ7 A;  4EP5 A;  4C8N A;  4KHP K;  2YNH A;  4XEI A;  3S41 A;  4CIF A;  2H3G X;  3TAQ A;  4PL7 A;  3RRG A;  4BR9 A;  4BQZ A;  4YY3 K;  2ZGY A;  3OYI A;  4ICL A;  2OTJ N;  5AQH A;  3CHW A;  2ITG A;  2QTD A;  1IKX A;  3AAP A;  4H4O A;  4JK7 A;  2OZM A;  3B6P A;  4OLB A;  3NBP A;  1X1P A;  3ID6 A;  3CJ7 A;  1VQK N;  2UUC K;  4JD2 A;  5M1O A;  2YV0 X;  4LF4 K;  3LAN A;  4NYF A;  1L3U A;  4CEC A;  4GKJ K;  3IRX A;  1S5J A;  1W2B M;  4BY9 C;  4WFB L;  4DS5 A;  3NAE A;  2X6S A;  5AQJ A;  1VSE A;  4B8C A;  4W5Q A;  4PKH A;  3M8P A;  5AZJ B;  1KTQ A;  3MCP A;  5JMV A;  1JLQ A;  5HLF A;  3PSI A;  4YFU A;  4IG0 A;  4A5B A;  3PX6 A;  2AA4 A;  4ISE A;  4KO0 A;  4BVP A;  2OA8 A;  1NGJ A;  1BUP A;  3LP1 A;  3RSE A;  2Y1J A;  4CE9 A;  4CJP A;  4DQR A;  1Q86 O;  4CES A;  4DHY A;  1S6Q A;  1Q18 A;  3G25 A;  1IJJ A;  4J8F A;  2PAV A;  4B1Z A;  3OYK A;  2GUI A;  3DRS A;  4YHH K;  4CED A;  3FFK B;  1SKW A;  1JLF A;  4H03 B;  2E2P A;  1YT3 A;  2G8V A;  3OBW A;  4YOR A;  3C0B A;  1T6D A;  3MK6 A;  3ZET B;  5CYM A;  3LAK A;  3OYH A;  4CVN E;  3NMU A;  4W5R A;  1M1K O;  2BUP A;  4IO8 A;  2O8C A;  3JYT A;  1RIL A;  1EET A;  4RW8 A;  1VQN N;  1C6V A;  4ELU A;  1VQ8 N;  1GOC A;  1ZBH A;  4WF9 L;  1TUU A;  2JGU A;  3OYG A;  3A8Y A;  4KPY A;  3VET A;  1E4F T;  3AO4 A;  1KQS M;  3E1Y A;  1HJR A;  1JLG A;  3NGZ A;  3CME N;  2QWP A;  1R59 O;  4FM2 A;  4WFA L;  1QHT A;  4DV5 K;  3ZYY X;  1LV5 A;  4RW4 A;  3VQ9 A;  4FVU A;  2YHA A;  4JI0 K;  2QI2 A;  4BDZ A;  3U8X A;  2OTL N;  3KVG A;  2HMI A;  5AQQ A;  1YJ9 N;  3V1O A;  4B9S A;  4JI6 K;  1KAX A;  4IFE A;  2VWK A;  3VQB A;  3VQ6 A;  4H0O A;  4B1Y B;  2W41 A;  4IDK A;  4CIE A;  3PO4 A;  1CZA N;  1HKB A;  4EZ9 A;  2D0P A;  4M3R A;  2AP1 A;  1S1T A;  4ILJ A;  4C8O A;  3CQX A;  4CEA A;  4OPJ A;  3TTC A;  4Q0B A;  4CEQ A;  5GAH P;  3KK2 A;  4K0K K;  2ASO A;  5AFU A;  3Q7C A;  4IFV A;  1JKH A;  1Z6R A;  3S3N A;  4GKK K;  4YDU C;  4B9M A;  1WSI A;  2FBY A;  3G0Z A;  4E19 A;  3ZSV A;  5BRD A;  4I2P A;  2BTF A;  5H1S Q;  2G8K A;  1C0G A;  1B92 A;  3QIC A;  4BRK A;  4OKE A;  4DTJ A;  2P9L B;  3K5L A;  4FJJ A;  1VSM A;  3KLE A;  4M3U A;  4QS8 A;  2GWJ A;  3QER A;  4CJQ A;  4M3X A;  3AV9 A;  3QEI A;  1ZXO A;  1U04 A;  3HST B;  1Q9Y A;  1NK5 A;  5DK5 A;  1EWQ A;  1WSH A;  3VTH A;  2X6N A;  2B6A A;  2IOC A;  3HT3 A;  4CF1 A;  3LP0 A;  3HYF A;  1WBB A;  2YI1 A;  4RG8 A;  1ESV A;  3O9S A;  1YHQ N;  1RBR A;  4CW7 B;  1ATR A;  3WXI A;  5AQX A;  4JD2 B;  3CET A;  4PHT X;  3AO5 A;  1Q7Y O;  2Q36 A;  3NFA A;  3T1H K;  3CCR N;  1RCH A;  3HSC A;  5GAD P;  3OBY A;  1LAW A;  4IXC A;  3W0L A;  4DR4 K;  2P1J A;  1T7P A;  1HKC A;  3O8M A;  1RT5 A;  4BG9 A;  4E89 A;  4FJH A;  3NVK A;  2HHV A;  1S1X A;  2FSK A;  4HUG A;  5E26 A;  3AVN A;  4DWI A;  4NB4 A;  3VEN A;  1LAV A;  1TKZ A;  1KCF A;  3AO1 A;  1NM1 A;  3ZX3 A;  3DOL A;  4M45 A;  3H46 O;  4BGA A;  1X9M A;  3VEX A;  2Q2R A;  4FSV A;  3FZH A;  3WQU A;  3F9M A;  1S1V A;  1B9D A;  4CHZ A;  3VF6 A;  1K8A O;  1F21 A;  1OVY A;  4WQ4 C;  1L3S A;  3SK3 A;  3SAF A;  1VHX A;  1ASW A;  2G8W A;  4BE2 A;  2E2O A;  2PFU A;  2VWJ A;  4O0J A;  5KQD A;  3MWP A;  3QDK A;  1KD1 O;  3KLI A;  4DFP A;  4FWP A;  4JK9 A;  4PWD A;  1EKE A;  3K57 A;  1NGA A;  1IKV A;  3ZSY A;  3ULE A;  1TYQ A;  4M3T A;  2WFB A;  4DUZ K;  4AQY K;  1ZBI A;  4OKK A;  1TL3 A;  4Y1D A;  4ZTJ A;  1RTD A;  1QE1 A;  3PY8 A;  2QWR A;  2O8C B;  4CZI A;  4J2B A;  2NZT A;  4EIA A;  2YHW A;  5GIN A;  1E3M A;  3OS2 A;  3NHG A;  2HND A;  2AJQ A;  1JLB A;  4M3W A;  1LWC A;  5GAG P;  1D4X A;  5KGX A;  1U48 A;  5AR0 A;  1JJ2 M;  4J2E A;  5C0Y A;  1P8Z A;  3AGK A;  4HHT A;  2G8H A;  3EY1 A;  1TKD A;  3T19 A;  4CHP A;  3DJC A;  3DXM A;  3NF8 A;  4GMJ B;  1VQL N;  4H0V B;  3BGR A;  3BZC A;  1NK8 A;  1CZB A;  4OPH A;  2Z1J A;  1OKJ A;  1FXX A;  4DG1 A;  1QQM A;  3H6E A;  3CF5 L;  3MN9 A;  3SUP A;  1SKS A;  1KVC A;  3ASM A;  4BR5 A;  4JV5 K;  4IJN A;  2X74 A;  3D2E B;  4LD0 A;  4CJK A;  3NGY A;  1BI4 B;  5TKW A;  2P9K A;  4HUF A;  5MLC Q;  1HLU A;  4LH4 A;  4F3T A;  4DSL A;  4ELT A;  3K59 A;  5M1Q A;  4AF1 A;  2UXD K;  4QS7 A;  4BRM A;  4ILG B;  2XO7 A;  1YIJ N;  3KK7 A;  4JK8 A;  4KRE A;  2YHY A;  4BR4 A;  3K2P A;  5C2D A;  4DR1 K;  3BF1 A;  3ZSR A;  3THW A;  2HVI A;  4KB1 A;  3L2V A;  4YOY A;  2KHO A;  3TU5 A;  3P31 A;  3VQ7 A;  4XH1 A;  1XQS C;  1W97 L;  4O44 A;  4B9Q A;  1WB9 A;  4IFY A;  1S72 N;  3KLF A;  1KVA A;  3QLH A;  3FLC O;  4JKD A;  2E20 A;  4FLT A;  5JVH L;  1NGH A;  2W40 A;  3IAY A;  1HKG A;  5LL6 Z;  1OH8 A;  1NOZ A;  1NOY A;  5FPE A;  1HR0 K;  2W42 A;  3AO3 A;  3CCV N;  1H1V A;  4FLZ A;  4CZG A;  3D2F A;  3TAG A;  1ILY A;  4FJ5 A;  2FBT A;  4CJS A;  3WNF A;  4JKC A;  4LF9 K;  1U4B A;  3OVN A;  2F8S A;  5LMN K;  4DUY K;  3E66 A;  3VQD A;  2ZF5 O;  4OKJ A;  4BR7 A;  3NDK A;  3RMA A;  3DLB A;  3UE5 A;  1HRH A;  3IDH A;  4GV3 A;  1CZ9 A;  5GIO A;  1OH6 A;  1RGI A;  2JWK A;  2FF3 B;  4B1W B;  4CK3 A;  4NLC A;  1TAQ A;  2ZJR L;  3T7Z A;  1UA0 A;  1MDU B;  4KTQ A;  2QEX N;  1J54 A;  4Y0W A;  4AHU A;  1U2V B;  3OYL A;  1Y97 A;  4BRP A;  3IKM A;  1NNE A;  1NJW A;  3BP8 A;  3MX5 A;  2X78 A;  1NKE A;  4KHN A;  4NYN A;  3ZSO A;  1U6Z A;  4M3Z A;  3HRG A;  3I8D A;  4BVO A;  4IOX A;  4WQ5 C;  4DR5 K;  2IVP A;  1KAY A;  1ASU A;  3MN5 A;  4LY7 A;  5AQF A;  1MWK A;  3QB0 A;  4BRO A;  3TTF A;  1BIZ A;  4CCH A;  3CM5 A;  2RPI A;  1Q82 O;  3EKU A;  4CJR A;  4JHD B;  4DSE A;  1RTH A;  1E4G T;  2OAN A;  1JL2 A;  4FJL A;  4JKG B;  4KBO A;  4CGG A;  4IEE A;  5DMR A;  1WOQ A;  3N4Q A;  4CFB A;  4FO0 A;  1RBV A;  3TAF A;  3DLH A;  1NGE A;  4ZTF A;  1Z05 A;  1HJO A;  3H1V X;  1S1W A;  5AQO A;  2DFH A;  2E8A A;  3EE9 A;  5BN8 A;  3AVK A;  4CIG A;  2BAN A;  3TR8 A;  1VRU A;  1VQ9 N;  1RDU A;  3LWL A;  3U6F A;  2KW4 A;  3PUF A;  4DV2 K;  1NU0 A;  3D6R A;  1I3A A;  4OX9 K;  5J2N A;  2KZZ A;  5T7B A;  5FPN A;  3DXK B;  5KTQ A;  2VGM A;  3TWH A;  3I56 N;  1VSJ A;  4CZJ A;  1LW2 A;  4H0X B;  3D0P A;  4IZ9 A;  1NGI A;  5AQM A;  4CEF A;  2D0B A;  1VAZ A;  3C95 A;  4DTO A;  4CF8 A;  4NO7 A;  2QK9 A;  4G9Z A;  2E5L K;  1ATS A;  3NVM A;  3MXJ A;  1NK0 A;  3P4I A;  1UOC A;  3K5O A;  2QXL A;  2D5R A;  2CGJ A;  2EHG A;  4I2Q A;  1N32 K;  2PYJ A;  2BGG A;  1NGG A;  3U3Y A;  4OGE A;  4E7I A;  2D0O A;  4MO5 A;  2GEM A;  2A1S A;  3M5R A;  4CGJ A;  4CBU A;  3SI6 A;  5HRN A;  1EX4 A;  2IIR A;  4FWM A;  3P83 D;  1TV6 A;  4EHU A;  1IO2 A;  4DTU A;  1RBS A;  3HP6 A;  4N5S A;  2GUP A;  3OYM A;  5I9E B;  2NRZ A;  3L8B A;  4YNQ A;  3O3G A;  4BRI A;  4BRC A;  4CD3 A;  1EP4 A;  5CYQ A;  3RWU A;  2QM1 A;  2A5X A;  4BGB A;  2P9L A;  1W0H A;  3C65 A;  5EY4 A;  2O8E A;  5HBM A;  1RT1 A;  4BQL A;  3CIP A;  4NXN K;  1BU6 O;  4CK2 A;  1BG3 A;  1C1B A;  1VSF A;  1S6P A;  4TSX A;  1IG9 A;  4DQ8 A;  4E1J A;  1G99 A;  4JI8 K;  3QET A;  1ATN A;  2HBM A;  3HBT A;  1NGF A;  3ZT4 A;  4CHO A;  2HHX A;  2DTU A;  5AZI A;  2PZS A;  2HOE A;  4KI6 A;  2Q0R A;  3TSP A;  2DFF A;  3H3N O;  4CJE A;  1YUW A;  3D7E O;  5A2Q O;  3D2F B;  3QEV A;  2KLA A;  2E2N A;  1XHZ A;  3AA4 A;  5C10 A;  4JLH A;  3CJC A;  4LFA K;  4FOE A;  4K43 A;  3OJS A;  5KGW A;  4OLA A;  3CFR A;  4IKF A;  4FK4 A;  5HP1 A;  2GX9 A;  3RMC A;  4LF5 K;  4CJV A;  1WSE A;  2XHB A;  1BDG A;  5C15 A;  3BDP A;  4DTX A;  3KWG A;  3L6Q A;  4C1N K;  3EE8 A;  1QTM A;  5AQY A;  4CJF A;  5AQI A;  5EU7 A;  5C42 A;  1S9G A;  2B4J A;  2Z1G A;  1BA0 A;  1BQM A;  5AQR A;  3MEG A;  4BR0 A;  2HST A;  3VQ5 A;  2D0A A;  1QSS A;  4BRN A;  3KLH A;  4AH9 A;  4M63 C;  1T05 A;  3WXJ A;  1W7A A;  3HTV A;  3CQY A;  3PO5 A;  4WE1 A;  3QIP A;  5BRH A;  2QWQ A;  1K9M O;  5FRO A;  2E2Q A;  3O5B A;  1ZBF A;  4FWK A;  4DSF A;  1JCG A;  5EX5 A;  3JAM O;  1Q81 O;  2HHT A;  4O4G A;  4JKE A;  4K8Z A;  3OYE A;  2VG7 A;  2V52 B;  4B3T K;  4M42 A;  2GWK A;  1LOT B;  2YJF A;  4MDB A;  4FJI A;  2FSN A;  3U9Z A;  4FWR A;  5LJW A;  5HRR A;  1VQP N;  3QES A;  1RT2 A;  4GVE A;  4BRE A;  5IWA K;  4HVJ A;  4OVL A;  1ZYQ A;  5CZ1 A;  1A5X A;  4A62 A;  3QFU A;  4X66 K;  2I7P A;  3AVL A;  3TSQ A;  1VQ4 N;  3MDQ A;  3RVC A;  3O08 A;  3WXM B;  4DR3 K;  4FK0 A;  3K58 A;  3LDO A;  4N56 A;  4O5F A;  1OH5 A;  3EKS A;  4AHT A;  1ZBS A;  3F2K A;  4H5V A;  5ELZ A;  3ENO A;  1OVQ A;  3MEE A;  4DR2 K;  1NG9 A;  3KHY A;  4PKG A;  1WSJ A;  1VSD A;  4EAH D;  5JLH A;  1VQ7 N;  1G15 A;  3CXC M;  4WYB A;  1SUQ A;  3I0R A;  1MU2 A;  1XC3 A;  1WN7 A;  3V9Z A;  3EL2 A;  1QS4 A;  4IWV A;  1VQ5 N;  2UUB K;  4EHT A;  4YOV A;  4BRH A;  3CM6 A;  3HZ6 A;  2D1K A;  3D2E A;  2BE2 A;  2Z1I A;  3AVJ A;  1BI4 A;  1S3X A;  1XUP O;  3WXL A;  3WT0 A;  1EXQ A;  2P9N B;  5BRE A;  4BRF A;  2WBN A;  1IH7 A;  3LAL A;  4PA1 A;  5J2Q A;  1WBD A;  3AVM A;  3KTQ A;  2P5G A;  4IDH A;  4EP4 A;  2ZQB A;  4HCB A;  2P51 A;  4FLV A;  2OCE A;  4OPA A;  3AVB A;  1N34 K;  4BC2 A;  1U47 A;  1Z26 A;  3M8R A;  1X9W A;  3J7A P;  3IUC A;  4IJA A;  3G6E N;  3TAB A;  1TK5 A;  4LFB K;  1D8Y A;  2O8E B;  3KD5 E;  4CHN A;  2KZM A;  4ISF A;  3PX4 A;  1FJG K;  4BWM A;  4DSI A;  3KK1 A;  4E3S A;  2R7Y A;  1JCF A;  4KAZ A;  4HCC A;  2XY8 A;  5AZI B;  3SQ4 A;  2IDO A;  5KPT A;  3L4Q A;  1GLL O;  3JSM A;  3CC4 N;  3ZT1 A;  3U4L A;  2RKI A;  5F1X A;  3DOK A;  3I55 N;  4KV8 A;  3SUN A;  3LPT A;  1HPZ A;  3CQ8 A;  1EQY A;  3CCL N;  3M8Q A;  1MA9 B;  3SUO A;  5M1P A;  1JLC A;  4JKH A;  4FWO A;  2O4G A;  5J2M A;  3K0S A;  3K9J A;  3VGL A;  4IO9 L;  4FOI A;  3K5M A;  4GY2 B;  1V4T A;  4FJ9 A;  5FDL A;  3TPQ A;  5C2F A;  3ZT2 A;  2HNY A;  1HX1 A;  4X65 K;  2OZS A;  4DQP A;  4QS9 A;  3LM9 A;  4BG8 A;  2NRX A;  3CCQ N;  4CFD A;  5AQU A;  5LY3 A;  4CEE A;  1YF5 L;  3L2W A;  1RT3 A;  4O55 A;  4MFB A;  2FLO A;  4BC5 A;  4CHY A;  2CH6 A;  1VQO N;  1SL0 A;  2YKN A;  1U2V A;  1TKX A;  1RDC A;  3ZX0 A;  4CF0 A;  3FZF A;  4JI1 K;  1WSF A;  3V1R A;  3N4P A;  2ATQ A;  3AAQ A;  1Q8I A;  1KFS A;  4K42 A;  1QVG M;  4H8K A;  2WOM A;  4ZHR A;  1JCE A;  3VGK A;  1ITG A;  3JS6 A;  3MXI A;  3GOI A;  5JIC A;  3V9U A;  1M90 O;  2PY5 A;  4B1X B;  4NLB A;  3ZSX A;  1JXE A;  4CJ3 A;  4I9L A;  3LM2 A;  4CJ5 A;  3QFP A;  4BE0 A;  1HPM A;  1X3N A;  3L3V A;  3DM2 A;  4JHD A;  4Z4E A;  3QEP A;  4Z4G A;  3SMP A;  3ALY A;  1J5O A;  3E9L A;  3DLK A;  2UXB K;  3V9W A;  4JKG A;  3IFR A;  2VQF K;  3V81 A;  2I7N A;  5LMU K;  1YJW N;  4MDA A;  4YOU A;  1RDB A;  1TVR A;  2IAJ A;  1NLV A;  2XY5 A;  5SWM A;  1XC9 A;  4B08 A;  3OS0 A;  5AQG A;  4DR6 K;  5JS1 A;  2ZE2 A;  3AVC A;  2P9S B;  2NRH A;  3CCS N;  3OYJ A;  1YVN A;  4CGI A;  4B3R K;  4H5N A;  3DXK A;  2Q31 A;  3H1Q A;  3VQ8 A;  1GLE G;  5AQN A;  4BAC A;  4F2S A;  1BCM A;  2RN2 A;  1HNX K;  1TAU A;  3VN5 A;  4H0T B;  1YVU A;  4DTS A;  3M6G A;  3AGR A;  4J2D A;  3E01 A;  2PBD A;  2HHW A;  3O4Q A;  4O8K A;  1FW6 A;  4JI3 K;  4IBN A;  4EFH A;  3HM8 A;  4H4M A;  4CGF A;  1RBU A;  1I39 A;  4OJR A;  1Z25 A;  1HQU A;  5B8H A;  3KWI A;  3MED A;  3A5O C;  3LPU A;  2OPS A;  4PQU A;  5M1K A;  3L2Q A;  2XRI A;  4X64 K;  3MMV A;  4DV6 K;  4PUO A;  1CXQ A;  1RTI A;  5JVG L;  1ZC6 A;  1KC8 O;  3MN7 A;  3IMX A;  2A6A A;  2HMP A;  1J53 A;  3SV4 A;  5AQK A;  3CCU N;  4DFK A;  1NMD A;  5GIP A;  3CJA A;  3OY9 A;  3THY A;  4CEB A;  1ASV A;  3LDL A;  4FZY A;  1J6Z A;  4Y1C A;  4WCE L;  3ATV A;  1JLA A;  2JWL A;  5EXW A;  3H3O B;  3KJV A;  4YOX A;  2CGK A;  3PIP L;  2UYT A;  1DT9 A;  3CER A;  4W5N A;  1GLC G;  4FVM A;  4M7X A;  4DTP A;  3OYF A;  1YTU A;  2A41 A;  5ADX H;  3R3L A;  3AA2 A;  3IS9 A;  2FF6 A;  1FKP A;  4DQS A;  2YX6 A;  1IBL K;  5F2R A;  1FKO A;  2HBK A;  1SZ2 A;  3LP2 A;  5KQ8 A;  3EZ5 A;  5HRP A;  1S9E A;  4DF8 A;  2O8F B;  2I5J A;  4JNE A;  1XWL A;  3OS1 A;  4DV4 K;  3QEX A;  4CZH A;  3SNN A;  3CYM A;  4BE1 A;  4B9T A;  3WXK A;  1UWB A;  2ZJQ L;  3J81 O;  4J2A A;  1KXP A;  4DV7 K;  2YNG A;  2VWB A;  1BWF O;  1BO5 O;  3K9K A;  4JS5 A;  3U3G A;  4H5T A;  3KZB A;  4GNI A;  5KI6 A;  4OPK A;  3RRH A;  2HHU A;  3AVH A;  5CZ2 A;  1DKG D;  2B5J A;  2OYQ A;  3O4N A;  2IS3 A;  1QSL A;  3P1G A;  4BC4 A;  3L0Q A;  4E1M A;  4FLY A;  4DMN A;  1XNR K;  4BRG A;  1V4S A;  3HI0 A;  1BCO A;  4LH5 A;  3QO9 A;  4KKO A;  2YHX A;  1RDA A;  3VA3 A;  2Y1I A;  4Z4C A;  4DV0 K;  3PX0 A;  2PYL A;  4UQG A;  4B9L A;  1C0T A;  3L2R A;  4L8R B;  3SLC A;  4DSK A;  3SCX A;  1WAF A;  2P9U B;  3CPW M;  2FC0 A;  3ZSQ A;  1KLN A;  1BQN A;  3ZCM A;  3FZL A;  1N5Y A;  4E7H A;  3LP3 A;  4QAG A;  3ENH A;  3TAE A;  2O8B A;  2VQE K;  1K73 O;  2Z1H A;  4M7Y A;  1SKR A;  4CJ7 A;  3F73 A;  4XH5 A;  4YOT A;  2WUS A;  1RT7 A;  4CHQ A;  3CFP A;  3KKR A;  1NJY A;  4C8K A;  1KFD A;  4DB3 A;  1TL1 A;  2F9T A;  2NRW A;  3E9P A;  4H0P A;  3UKR B;  4JRQ A;  3V9S A;  5FRM A;  3H45 C;  3VQQ A;  3D45 A;  3SQ0 A;  2HHS A;  5KRS A;  3SYZ A;  1GLD G;  3EEQ A;  3AAR A;  5BR9 A;  5CHI A;  4HTL A;  3KLG A;  1TKT A;  3SJJ A;  4N41 A;  3NH2 A;  4B3M K;  4F9O A;  4Q5V A;  5CE3 A;  3LL3 A;  3MWT A;  4C23 A;  4GV6 A;  4DLG A;  3NH0 A;  1DTQ A;  3O1W A;  3T1Y K;  4KH5 A;  3CFO A;  4C8M A;  3T1A A;  5EVZ A;  2RE2 A;  4E1N A;  3THX A;  3TSU A;  1C0U A;  3TAN A;  2E6L A;  4IOC L;  5C25 A;  3F9K A;  3OW2 M;  4KHQ A;  4NCG A;  3AO2 A;  1SS6 A;  1P90 A;  4RW6 A;  2P9N A;  4CER A;  1YI2 N;  4O8U A;  4FW1 A;  3BY5 A;  3WNE A;  3QNO A;  4LC9 B;  1NK6 A;  2QWO A;  1IBM K;  3O4W A;  4KH6 A;  1GOB A;  1NBW A;  3THY B;  3HXM A;  4FK2 A;  4LF8 K;  2F4V K;  3VQ4 A;  5J1E A;  3ZT3 A;  3FFI A;  4E7L A;  4DU1 A;  2FBX A;  3G4S N;  3EO3 A;  3C7N B;  4DU3 A;  2ZWH A;  3C6A A;  3L4I A;  3ZSZ A;  3GG4 A;  3L3U A;  4W5T A;  4FJK A;  3PSF A;  1W9H A;  4CJT A;  4RW7 A;  4X62 K;  3T69 A;  5GAE P;  4I9Q A;  3BUZ B;  3VEV A;  4PKI A;  4B9U A;  1QZ6 A;  3EZW A;  2VG6 A;  3LZJ A;  2CH5 A;  2V51 B;  1BHL A;  3OYB A;  1NKB A;  5BPN A;  5DM7 L;  3I0S A;  4Z4F A;  3HO1 A;  4BR2 A;  2BH1 A;  4FZX C;  1BL3 A;  1GLJ O;  3MXM A;  4MLH A;  4JI2 K;  5F0X A;  3J8A A;  3RR7 A;  3LDP A;  3QIN A;  3CG7 A;  1HNV A;  3WNG A;  3EN9 A;  2D0C A;  3DMJ A;  2CGL A;  3ENB A;  4AM6 A;  3HPH A;  2F9W A;  3OTO K;  1RDW X;  3WNH A;  3VER A;  2F96 A;  3TTD A;  1T6C A;  1RT4 A;  3BEX A;  3GBT A;  1QQC A;  3VA0 A;  1REV A;  3A2F A;  1BIS A;  4WFN L;  3OJU A;  3QNN A;  5HRS A;  3WEE B;  1IV0 A;  2ZD1 A;  4KI4 A;  4FCY A;  3VMF B;  4CZM A;  4CBX A;  2DFE A;  3O6W A;  3MN6 A;  3AVG A;  1S1U A;  3ITH A;  4CGD A;  5ADX A;  1VQ6 N;  4DLE A;  1NGC A;  4N76 A;  4YDU A;  1SL1 A;  4CZE A;  3MEC A;  2P9I B;  4FWN A;  1OH7 A;  5C12 A;  3OYN A;  5HRO A;  3C6T A;  1RDD A;  4I6M B;  4FLU A;  5KPZ A;  3T3F A;  4CZF A;  4LSN A;  3MAQ A;  1ZBU A;  1YTA A;  4AIL C;  2YCH A;  4I7F A;  5AQW A;  2KQ2 A;  1GLF O;  2OPR A;  3HP9 A;  3FGU A;  3KKS A;  4DQI A;  3SAG A;  4L3Q A;  5D3G A;  4PY5 A;  1HMV A;  4BRQ A;  3LZI A;  3HK2 A;  3OYC A;  3CD6 N;  5BPM A;  2KFN A;  4Z4H A;  4JI7 K;  2IGI A;  4CZL A;  2O8B B;  2HHQ A;  2ZGZ A;  3R8E A;  3O1B A;  5BPL A;  2HW3 A;  1HNZ K;  2O8D B;  1WSG A;  3DYA A;  2NRR A;  2RHK A;  3LDS A;  4DF4 A;  4RTF D;  2E1Z A;  1VSL A;  2V7Y A;  4DCH A;  4FM1 A;  4U7B A;  2P9S A;  2FXU A;  3VOV A;  3MX2 A;  2F8T A;  1D5A A;  4DQQ A;  1TUY A;  3SBT A;  4OGC A;  2XY6 A;  3SPY A;  1KAZ A;  2NLX A;  3V4I A;  4E0D A;  5M1F A;  4RWT A;  3O9Q A;  4CI6 A;  2RF2 A;  1C1C A;  4QOZ B;  5KPR A;  3EYZ A;  3NE6 A;  3JXU A;  4DTM A;  3O9U A;  1WLJ A;  4AM7 A;  3DRR A;  3R6M A;  1O13 A;  1L3T A;  4JKA A;  3O9R A;  4WQ4 A;  3THX B;  2P5O A;  3NH1 A;  1GLA G;  1RTJ A;  4G1Q A;  1X3M A;  4KH4 A;  3C94 A;  3H08 A;  1KRP A;  2BDP A;  4JN4 A;  1DGK N;  3O3H A;  2ASP A;  2KTQ A;  3VTI A;  2O4I A;  1HYV A;  1K8K B;  4K41 A;  1C0F A;  2Q1N A;  3O3F A;  1J5E K;  3SUQ A;  1LWE A;  1NK9 A;  1QHA A;  3A0I X;  4A61 A;  2D4W A;  2WON A;  2G8I A;  3NF7 A;  3CCJ N;  2QWN A;  2J4R A;  4KHS A;  5AQL A;  3ISN C;  1Y64 A;  1U49 A;  4FYD A;  3SZ2 A;  4FXD A;  3VF2 A;  2HBJ A;  1HYZ A;  3DLE A;  2KFZ A;  2E4L A;  3SJH A;  3C6H A;  4FJN A;  3CC2 N;  3VPZ A;  4BC3 A;  3O9T A;  1YAG A;  4A5A A;  3HL8 A;  3VGM A;  3BZK A;  4A2B A;  1N36 K;  3HOS A;  4DS4 A;  4FZZ A;  3WQT A;  2XY7 A;  1UAX A;  3ZEU A;  2A42 A;  5JLF A;  5EOY A;  1NK4 A;  1WAJ A;  4KHY A;  3QBW A;  3PLA A;  4DU4 A;  3DWL A;  1QQO A;  4RW9 A;  3CC7 N;  3S3O A;  1R0A A;  5IT9 O;  2YKM A;  4M3Y A;  3AA5 X;  3IG1 A;  1TGO A;  4CFA A;  2O8F A;  3AVI A;  3THV A;  3RTV A;  3M1F A;  1L5U A;  4CJ4 A;  1VSH A;  4BWJ A;  2FSJ A;  4JKF A;  4CBW A;  3QML A;  4DTR A;  1TK0 A;  4UY8 O;  3A5M C;  2HB5 A;  3CJB A;  3B8A X;  4LFC K;  2A3Z A;  3DLG A;  3VQC A;  5BR8 K;  2A40 A;  2ZJP L;  4M41 A;  1O1W A;  5C24 A;  1CXU A;  3LAM A;  1QQN A;  3PV8 A;  1XI1 A;  4F4K A;  1A5V A;  2LSN A;  4BRL A;  4CJU A;  4V19 S;  1RBT A;  3HPG A;  3CCE N;  1XHX A;  3AVA A;  1VSK A;  1RT6 A;  4HTU A;  4LF6 K;  3FR0 A;  3R9P A;  4KRF A;  3L2U A;  1MWM A;  2E6M A;  3A5L C;  1HNI A;  3HVR A;  1SL2 A;  2QW9 A;  1KVB A;  3VQE A;  5DM6 L;  3J7Z O;  2UUA K;  3W3D A;  1SAZ A;  4JKB A;  4DV1 K;  4NXM K;  2QWL A;  4BDY A;  2DY4 A;  1QSY A;  3HOT A;  1L3V A;  4ELV A;  4F3O A;  3RSE B;  5BN9 A;  3BF3 A;  4AHV A;  1CLQ A;  3B6O A;  3GE1 A;  3P38 A;  4CFC A;  1N8R O;  2QXF A;  4IEI A;  2Q0U A;  2KKZ A;  4FLX A;  2P9U A;  4XH4 A;  1ZBL A;  3UKU A;  1QZ5 A;  3CCM N;  4LSL A;  4GW6 A;  4H5R A;  3PIO L;  3Q7B A;  1T44 A;  4B1U B;  5J2P A;  3QEW A;  3J80 O;  3GDQ A;  3A5N C;  2V7Z A;  3KIO A;  5CR4 A;  1RNH A;  3ATU A;  4CK1 A;  3ZLJ A;  3DLR A;  1RFQ A;  4GV9 A;  3NF6 A;  3OA9 A;  5FLX O;  4KTZ A;  2A1R A;  4FWQ A;  2QA4 N;  2WC9 A;  1BIU A;  5FPD A;  3NGI A;  1KLM A;  3AA3 A;  3UKR A;  4C8L A;  4AHS A;  4CF9 A;  3AY9 A;  3ZT0 A;  1VRT A;  5M1N A;  4ID1 A;  3VES A;  4HUE A;  4A59 A;  4PL8 A;  3HM9 A;  3DAW A;  4A57 A;  1Q9X A;  2UXC K;  3V6D A;  4B9V A;  1S22 A;  3P5J A;  4Z94 A;  4FWS A;  3VF4 A;  3FE1 A;  1HYS A;  4QCL A;  1NMN A;  3RR8 A;  3HVT A;  3LDQ A;  4E7J A;  1NK7 A;  4H0Y B;  3SMS A;  4CD1 A;  1C0M A;  4FLW A;  1WNS A;  2HNZ A;  4CZK A;  1N6Q A;  3RMD A;  4WQ5 A;  3LDN A;  3R1X A;  4JRP A;  5AQV A;  1U45 A;  2VCP A;  1JL1 A;  4ISG A;  1XNQ K;  4C1N I;  3HJF A;  4AHC A;  1JLE A;  3VEY A;  3WUH A;  2G8F A;  3GL1 A;  3RMB A;  4B3S K;  1VQM N;  3UIQ A;  3CJ1 A;  2VG5 A;  5E41 A;  3TI0 A;  2YNI A;  3TAR A;  3U9D A;  1YXQ A;  2Q3S A;  5KRT A;  1EWR A;  3MCA B;  4MLE A;  4Z0U A;  3CMA N;  4DR7 K;  5I42 A;  2GBZ A;  3C7N A;  3E9O A;  1T8E A;  4ILH A;  4FJ8 A;  5BRF A;  1K6Y A;  3M3Z A;  1BA1 A;  4CF2 A;  4B1V A;  2FBV A;  4YOW A;  3TAP A;  1HUX A;  3ZEU B;  5FRN A;  4JI5 K;  1BOT O;  2EWS A;  1YIT N;  2P9P A;  5FPM A;  1J9A A;  1X9S A;  2OPP A;  3DI6 A;  3SPZ A;  2OPQ A;  2ITM A;  3SQ2 A;  3F5T A;  4FJX A;  2NUB A;  3FZK A;  3S3M A;  1SV5 A;  2G8U A;  1IKW A;  2VGN A;  4IOA L;  4DFJ A;  4JYA K;  4FM0 A;  1LWF A;  2QKK A;  1NJX A;  4CJW A;  1WUA A;  4F8R A;  3ZSW A;  3SV3 A;  1N33 K;  2W6L A;  3SBG A;  4JS4 A;  3VEW A;  4BDP A;  3O80 A;  3WEE A;  3OYA A;  4ID5 A;  4DKW A;  1KSP A;  2NNW A;  4W5O A;  2NRV A;  5SZT A;  4KFB A;  2ETJ A;  4BRD A;  4N47 A;  4JI4 K;  4CGH A;  1A5W A;  2QKB A;  4O5B A;  5LJV A;  3CI5 A;  3LWM A;  4B3O A;  3OHR A;  5TKY A;  1GLB G;  4IG3 A;  2F7T A;  3C6U A;  4NCB A;  4JEP A;  1B9F A;  3G71 N;  2EX3 A;  5AZJ A;  4KHW A;  2P9I A;  4CEO A;  3K5N A;  4FJG A;  2E1Y A;  3QIO A;  1GOA A;  1YJN N;  1XMO K;  5E84 A;  2E88 A;  3CPE A;  3TAM A;  1LW0 A;  4JAX A;  4I6M A;  1XMQ K;  4XIU A;  4R79 A;  1NKC A;  3S9H A;  1VSI A;  4EZ6 A;  2GV9 A;  4FL9 A;  1I94 K;  1VK0 A;  1DEJ A;  4DFM A;  3UKU B;  5JS2 A;  4MO4 A;  4FWL A;  4LF7 K;  3NCI A;  1NJZ A;  3V9X A;  3ULD A;  4OO1 J;  3ULE B;  3HPO A;  1TYQ B;  4E7K A;  3OYD A;  3KD1 E;  5HL7 L;  4NCA A;  3J7Y P;  2O8D A;  3ZET A;  4GVM A;  4FW2 A;  4U67 L;  2HF3 A;  1HQE A;  3V1Q A;  3G10 A;  2QWM A;  1EO1 A;  3SQ1 A;  2IVN A;  2W6K A;  1IBK K;  3CJ9 A;  5AQT A;  1IKY A;  3DRP A;  2YHB A;  4AHR A;  3QBX A;  4K25 A;  4RCH A;  5AFU H;  4FJM A;  1JXB A;  3I8B A;  4DTN A;  2VYP A;  2Q97 A;  3ID8 A;  3KK3 A;  1FK9 A;  3DXM B;  1HNW K;  3FZM A;  5AQS A;  4FPA A;  5I3U A;  2NRT A;  4R5P A;  1D9D A;  1UA1 A;  2JLE A;  1T3V A;  2HVH A;  5HOO A;  2HF4 A;  1C1A A;  4KHU A;  3VEO A;  5AQP A;  2UU9 K;  5AJ3 K;  1NGB A;  2YJE A;  1LCU A;  3VEZ A;  4F2R A;  1IG8 A;  3M8S A;  5CY4 A;  4K8X A;  4BRA A;  2HHH K;  3NF9 A;  4B8A B;  1K8K A;  3VQA A;  1BGX T;  2P9K B;  3VQP A;  4HWI A;  3DLL L;  3P39 A;  4Z4I A;  3I33 A;  1X9J A;  1NGD A;  4CEZ A;  2WTU A;  4B9N A;  2GEL A;  2IVO A;  5K14 A;  2ASM A;  2DPN A;  4H5W A;  4DSJ A;  1NJI O;  4KTW A;  3UB5 A;  1T03 A;  5AQZ A;  1DLO A;  1D9F A;  4KB0 A;  2IC3 A;  3THW B;  2GTD A;  1SQK A;  1DTT A;  4FPB A;  2HBL A;  3SAH A;  3ZX2 A;  2YNF A;  1TK8 A; 
#chains in the Genus database with same CATH homology
 1WLJ A;  3DRR A;  3NDK A;  3RMA A;  3L3V A;  3DM2 A;  3DLB A;  1HRH A;  1L3T A;  4Z4E A;  3QEP A;  4Z4G A;  4CJL A;  4O0I A;  3ALY A;  4MQ3 A;  1CZ9 A;  3AVF A;  1J5O A;  4FJ7 A;  4EP5 A;  4C8N A;  2P5O A;  2YNH A;  3DLK A;  3NH1 A;  3V9W A;  1RTJ A;  4CIF A;  4G1Q A;  4CK3 A;  3V81 A;  3TAQ A;  3RRG A;  1TAQ A;  3OYI A;  3C94 A;  3H08 A;  1KRP A;  2BDP A;  1UA0 A;  4ICL A;  1RDB A;  4KTQ A;  3O3H A;  1TVR A;  1J54 A;  2IAJ A;  2KTQ A;  2ITG A;  4AHU A;  5SWM A;  3OYL A;  1Y97 A;  2XY5 A;  4B08 A;  1HYV A;  1XC9 A;  2O4I A;  1IKX A;  1NJW A;  3O3F A;  4H4O A;  2X78 A;  3OS0 A;  3SUQ A;  1LWE A;  1NK9 A;  1NKE A;  4KHN A;  4OLB A;  4NYN A;  3B6P A;  3ZSO A;  2OZM A;  5JS1 A;  3NBP A;  2ZE2 A;  3AVC A;  4M3Z A;  2WON A;  3I8D A;  1X1P A;  3OYJ A;  4CGI A;  2G8I A;  3NF7 A;  1ASU A;  4KHS A;  4LY7 A;  3VQ8 A;  2YV0 X;  3ISN C;  1U49 A;  4FYD A;  3SZ2 A;  4FXD A;  4BAC A;  3LAN A;  4F2S A;  1HYZ A;  3DLE A;  4NYF A;  1BCM A;  2RN2 A;  2E4L A;  1L3U A;  2KFZ A;  4FJN A;  3VN5 A;  1TAU A;  1BIZ A;  1YVU A;  4CEC A;  4DTS A;  4CCH A;  4J2D A;  3CM5 A;  2RPI A;  3E01 A;  3IRX A;  3HL8 A;  1S5J A;  4CJR A;  2HHW A;  3O4Q A;  4DSE A;  4DS4 A;  4DS5 A;  1RTH A;  3NAE A;  2X6S A;  4FZZ A;  4IBN A;  1JL2 A;  1VSE A;  2XY7 A;  4B8C A;  1UAX A;  4W5Q A;  4FJL A;  4H4M A;  4CGG A;  4CGF A;  1RBU A;  3M8P A;  1I39 A;  1WAJ A;  4OJR A;  5DMR A;  1Z25 A;  1HQU A;  1NK4 A;  4KHY A;  4DU4 A;  3MED A;  1KTQ A;  4CFB A;  3LPU A;  1RBV A;  1JLQ A;  2OPS A;  4RW9 A;  3TAF A;  5HLF A;  4ZTF A;  3L2Q A;  4PQU A;  2XRI A;  3S3O A;  1R0A A;  4YFU A;  1S1W A;  2YKM A;  4M3Y A;  2DFH A;  3AA5 X;  4PUO A;  3IG1 A;  1CXQ A;  1RTI A;  1TGO A;  3AVK A;  4IG0 A;  4CFA A;  4CIG A;  3PX6 A;  2BAN A;  3AVI A;  3TR8 A;  3THV A;  3RTV A;  1VRU A;  1L5U A;  4CJ4 A;  1VSH A;  4KO0 A;  4BWJ A;  3LWL A;  3U6F A;  2KW4 A;  3PUF A;  4DTR A;  1TK0 A;  2OA8 A;  1J53 A;  3SV4 A;  3LP1 A;  2HB5 A;  2KZZ A;  1I3A A;  2Y1J A;  4CE9 A;  4DFK A;  4CJP A;  5J2N A;  4DQR A;  5T7B A;  3OY9 A;  3DLG A;  3VQC A;  4CEB A;  4CES A;  5KTQ A;  3TWH A;  1S6Q A;  1ASV A;  4FZY A;  1VSJ A;  1LW2 A;  4M41 A;  3D0P A;  1O1W A;  5C24 A;  4Y1C A;  1CXU A;  3OYK A;  2GUI A;  4CEF A;  2D0B A;  3DRS A;  3LAM A;  1JLA A;  3KJV A;  4CED A;  3PV8 A;  1SKW A;  3C95 A;  1JLF A;  4DTO A;  1XI1 A;  4F4K A;  1YT3 A;  1A5V A;  2LSN A;  4CF8 A;  2G8V A;  4CJU A;  4W5N A;  1RBT A;  3HPG A;  5CYM A;  2QK9 A;  4FVM A;  1XHX A;  3AVA A;  3LAK A;  1VSK A;  4DTP A;  3OYF A;  3OYH A;  1RT6 A;  1YTU A;  4HTU A;  3MXJ A;  1NK0 A;  4W5R A;  4KRF A;  1UOC A;  3K5O A;  3AA2 A;  3L2U A;  3IS9 A;  2D5R A;  3JYT A;  1RIL A;  2E6M A;  1EET A;  4RW8 A;  2EHG A;  1FKP A;  4I2Q A;  4DQS A;  1HNI A;  1C6V A;  4ELU A;  3HVR A;  2PYJ A;  2BGG A;  1FKO A;  3LP2 A;  3EZ5 A;  1SL2 A;  1GOC A;  1ZBH A;  3U3Y A;  1KVB A;  3VQE A;  4OGE A;  4E7I A;  2JGU A;  1S9E A;  5HRP A;  3OYG A;  4DF8 A;  2I5J A;  2A1S A;  4KPY A;  4CGJ A;  3AO4 A;  1XWL A;  4BDY A;  3SI6 A;  5HRN A;  3OS1 A;  3QEX A;  3NGZ A;  1HJR A;  1EX4 A;  1JLG A;  1L3V A;  1QSY A;  4ELV A;  3SNN A;  4F3O A;  3CYM A;  4BE1 A;  3P83 D;  1TV6 A;  4AHV A;  1IO2 A;  4DTU A;  1CLQ A;  4FM2 A;  1RBS A;  3HP6 A;  4B9T A;  4N5S A;  3OYM A;  1QHT A;  1UWB A;  3B6O A;  4CFC A;  4YNQ A;  2QXF A;  3L8B A;  3O3G A;  4J2A A;  1LV5 A;  4RW4 A;  2YNG A;  1EP4 A;  5CYQ A;  3VQ9 A;  4FLX A;  3RWU A;  4DTM A;  1ZBL A;  1W0H A;  2YHA A;  4GW6 A;  4LSL A;  4JS5 A;  5HBM A;  3U3G A;  4BDZ A;  5J2P A;  1RT1 A;  3QEW A;  5KI6 A;  4OPK A;  3RRH A;  2HHU A;  3AVH A;  2HMI A;  1KLN A;  5CZ2 A;  4CK2 A;  1VSF A;  1C1B A;  3KIO A;  3V1O A;  1S6P A;  2B5J A;  4TSX A;  2OYQ A;  1RNH A;  3O4N A;  4CK1 A;  1TK8 A;  1IG9 A;  4B9S A;  2IS3 A;  3QET A;  3DLR A;  3ZT4 A;  1QSL A;  2HHX A;  2VWK A;  4CHO A;  2DTU A;  3NF6 A;  3VQB A;  3P1G A;  3VQ6 A;  4KTZ A;  2PZS A;  4KI6 A;  2A1R A;  4IDK A;  2DFF A;  4CJE A;  4CIE A;  4E1M A;  4FLY A;  3PO4 A;  4EZ9 A;  1BIU A;  4M3R A;  4DMN A;  3NGI A;  3QEV A;  1S1T A;  1KLM A;  3AA3 A;  4C8L A;  1XHZ A;  4C8O A;  4AHS A;  3AA4 A;  4JLH A;  4CF9 A;  4CEA A;  4OPJ A;  4Q0B A;  4CEQ A;  3ZT0 A;  1VRT A;  3KK2 A;  4ID1 A;  4HUE A;  1BCO A;  3OJS A;  4IFV A;  1JKH A;  3QO9 A;  4LH5 A;  5KGW A;  4KKO A;  1RDA A;  4OLA A;  3HM9 A;  3DLH A;  3VA3 A;  3CFR A;  3S3N A;  4IKF A;  4B9M A;  4FK4 A;  5HP1 A;  1WSI A;  2Y1I A;  4Z4C A;  2FBY A;  1Q9X A;  3G0Z A;  3PX0 A;  2PYL A;  3V6D A;  4B9V A;  4E19 A;  4UQG A;  4B9L A;  3P5J A;  3ZSV A;  1C0T A;  3L2R A;  4L8R B;  4I2P A;  4DSK A;  1HYS A;  3SCX A;  4QCL A;  2G8K A;  3RMC A;  1WAF A;  3RR8 A;  3HVT A;  1WSE A;  1B92 A;  4CJV A;  2XHB A;  4OKE A;  2FC0 A;  4DTJ A;  3ZSQ A;  4E7J A;  1BQN A;  1NK7 A;  3ZCM A;  3K5L A;  1VSM A;  3KLE A;  4E7H A;  1N5Y A;  4DTX A;  3BDP A;  3LP3 A;  3QER A;  4QAG A;  4CJQ A;  4M3X A;  1C0M A;  3TAE A;  3AV9 A;  4FLW A;  1WNS A;  3QEI A;  1QTM A;  2HNZ A;  1U04 A;  3HST B;  1N6Q A;  4CJF A;  3RMD A;  1Q9Y A;  2Z1H A;  5EU7 A;  4JRP A;  3F73 A;  1NK5 A;  1SKR A;  5C42 A;  1S9G A;  2B4J A;  5DK5 A;  1U45 A;  2Z1G A;  1BQM A;  1WSH A;  2X6N A;  1JL1 A;  2B6A A;  2IOC A;  1RT7 A;  4CHQ A;  3MEG A;  3HT3 A;  3CFP A;  3HJF A;  4AHC A;  3KKR A;  1JLE A;  4CF1 A;  1NJY A;  3LP0 A;  2G8F A;  3HYF A;  3VQ5 A;  3RMB A;  2D0A A;  1QSS A;  1KFD A;  4C8K A;  3UIQ A;  1TL1 A;  2VG5 A;  4RG8 A;  3KLH A;  4AH9 A;  1T05 A;  4JRQ A;  3V9S A;  5E41 A;  1RBR A;  3PO5 A;  4WE1 A;  3TI0 A;  5FRM A;  2YNI A;  3QIP A;  3VQQ A;  3D45 A;  3TAR A;  3AO5 A;  5KRT A;  2Q3S A;  3SQ0 A;  5FRO A;  3NFA A;  4Z0U A;  2HHS A;  5KRS A;  1RCH A;  3SYZ A;  5I42 A;  3KLG A;  1ZBF A;  1LAW A;  4DSF A;  2GBZ A;  2HHT A;  1TKT A;  3SJJ A;  4O4G A;  1T8E A;  2P1J A;  1T7P A;  4N41 A;  3NH2 A;  4K8Z A;  3OYE A;  2VG7 A;  4FJ8 A;  1RT5 A;  4E89 A;  4Q5V A;  4FJH A;  4FJJ A;  1K6Y A;  1S1X A;  2HHV A;  4HUG A;  4M42 A;  4CF2 A;  4DLG A;  2FBV A;  3AVN A;  3TAP A;  4DWI A;  3NH0 A;  1DTQ A;  1LAV A;  1TKZ A;  1KCF A;  4FJI A;  3CFO A;  5FRN A;  4C8M A;  3T1A A;  4E1N A;  3AO1 A;  5HRR A;  1J9A A;  1C0U A;  3QES A;  3TAN A;  1RT2 A;  3DOL A;  1X9S A;  2E6L A;  2OPP A;  3DI6 A;  4M45 A;  3F9K A;  5C25 A;  3SPZ A;  4KHQ A;  2OPQ A;  3SQ2 A;  4HVJ A;  4OVL A;  1ZYQ A;  1X9M A;  4NCG A;  5CZ1 A;  4FJX A;  2NUB A;  1A5X A;  3AO2 A;  4RW6 A;  3AVL A;  1SV5 A;  3S3M A;  1S1V A;  4CER A;  1B9D A;  2G8U A;  4CHZ A;  1IKW A;  4FK0 A;  4FW1 A;  3K58 A;  1F21 A;  3WNE A;  3QNO A;  1L3S A;  4DFJ A;  4N56 A;  1NK6 A;  4FM0 A;  1ASW A;  1LWF A;  2G8W A;  2QKK A;  4BE2 A;  1GOB A;  2VWJ A;  4O0J A;  4FK2 A;  3HXM A;  4AHT A;  1NJX A;  4CJW A;  4F8R A;  3VQ4 A;  5J1E A;  3ZSW A;  3KLI A;  3ZT3 A;  3SV3 A;  3FFI A;  4DFP A;  3MEE A;  4E7L A;  4DU1 A;  2FBX A;  4JS4 A;  4PWD A;  1WSJ A;  1EKE A;  1VSD A;  3K57 A;  4BDP A;  4DU3 A;  3OYA A;  4ID5 A;  1KSP A;  3ZSZ A;  1G15 A;  4W5O A;  1IKV A;  1SUQ A;  3I0R A;  1MU2 A;  3L3U A;  3ZSY A;  4W5T A;  4FJK A;  5SZT A;  4KFB A;  1WN7 A;  2ETJ A;  3V9Z A;  4M3T A;  1W9H A;  4N47 A;  1QS4 A;  1A5W A;  4RW7 A;  4OKK A;  4CGH A;  4O5B A;  4CJT A;  1TL3 A;  4BE0 A;  1ZBI A;  3LWM A;  2QKB A;  4B3O A;  4Y1D A;  4ZTJ A;  1RTD A;  1QE1 A;  4I9Q A;  3CM6 A;  3PY8 A;  4IG3 A;  4B9U A;  3C6U A;  2VG6 A;  3LZJ A;  2BE2 A;  4J2B A;  4NCB A;  1BHL A;  3OYB A;  1B9F A;  2Z1I A;  1BI4 A;  3AVJ A;  1NKB A;  2EX3 A;  3I0S A;  3OS2 A;  4Z4F A;  3HO1 A;  4KHW A;  4FZX C;  3NHG A;  2HND A;  4CEO A;  1BL3 A;  3K5N A;  3MXM A;  4FJG A;  1JLB A;  2AJQ A;  4M3W A;  1LWC A;  1EXQ A;  3QIO A;  1GOA A;  5KGX A;  3RR7 A;  1IH7 A;  3LAL A;  4PA1 A;  1U48 A;  3QIN A;  1LW0 A;  3TAM A;  3CG7 A;  3AVM A;  1HNV A;  3WNG A;  5J2Q A;  3KTQ A;  4HHT A;  2P5G A;  4EP4 A;  4J2E A;  2D0C A;  3DMJ A;  2ZQB A;  3EY1 A;  2G8H A;  4HCB A;  2P51 A;  4XIU A;  3HPH A;  4FLV A;  3AVB A;  1TKD A;  1NKC A;  3T19 A;  3S9H A;  3WNH A;  1Z26 A;  4CHP A;  1VSI A;  3M8R A;  1U47 A;  1X9W A;  4EZ6 A;  2F96 A;  2GV9 A;  3NF8 A;  3TAB A;  1RT4 A;  4GMJ B;  1VK0 A;  1QQC A;  4DFM A;  3VA0 A;  1TK5 A;  1REV A;  3A2F A;  5JS2 A;  3BGR A;  1BIS A;  3OJU A;  3QNN A;  1NK8 A;  1D8Y A;  1CZB A;  4CHN A;  5HRS A;  2Z1J A;  3KD5 E;  2KZM A;  2ZD1 A;  3NCI A;  4KI4 A;  1NJZ A;  1FXX A;  4FCY A;  3V9X A;  3ULD A;  3PX4 A;  4DG1 A;  4BWM A;  4DSI A;  3HPO A;  3KK1 A;  4E3S A;  2DFE A;  4E7K A;  3OYD A;  3KD1 E;  3SUP A;  3AVG A;  1S1U A;  3ITH A;  2R7Y A;  1SKS A;  4NCA A;  4KAZ A;  4HCC A;  1KVC A;  3ASM A;  4CGD A;  4GVM A;  2XY8 A;  2X74 A;  4FW2 A;  3SQ4 A;  2IDO A;  1HQE A;  4M3U A;  3JSM A;  4DLE A;  3V1Q A;  3G10 A;  4LD0 A;  3ZT1 A;  3NGY A;  4CJK A;  4N76 A;  1BI4 B;  1SL1 A;  2RKI A;  3MEC A;  3DOK A;  4HUF A;  3SQ1 A;  4LH4 A;  4KV8 A;  4F3T A;  4DSL A;  4ELT A;  3SUN A;  3K59 A;  1IKY A;  3DRP A;  3LPT A;  2YHB A;  4AHR A;  1HPZ A;  3OYN A;  3CQ8 A;  5HRO A;  3C6T A;  2XO7 A;  3M8Q A;  3SUO A;  1RDD A;  4FLU A;  3T3F A;  4FJM A;  1JXB A;  4LSN A;  4KRE A;  4DTN A;  3MAQ A;  1JLC A;  1YTA A;  1ZBU A;  4AIL C;  3K2P A;  4I7F A;  3ZSR A;  2O4G A;  2KQ2 A;  5J2M A;  2OPR A;  3HP9 A;  4KB1 A;  3L2V A;  2HVI A;  2DY4 A;  3KK3 A;  3KKS A;  3K5M A;  1FK9 A;  4DQI A;  4FJ9 A;  5FDL A;  5D3G A;  4PY5 A;  3ZT2 A;  3VQ7 A;  1HMV A;  5I3U A;  2HNY A;  3LZI A;  2OZS A;  4DQP A;  3HK2 A;  4R5P A;  4O44 A;  3OYC A;  1D9D A;  1UA1 A;  2KFN A;  4IFY A;  2JLE A;  3KLF A;  4Z4H A;  1KVA A;  2IGI A;  3QLH A;  2HVH A;  2HHQ A;  4CFD A;  1C1A A;  4FLT A;  4KHU A;  4CEE A;  2HW3 A;  3L2W A;  1RT3 A;  4O55 A;  3IAY A;  4F2R A;  4MFB A;  3M8S A;  1WSG A;  5CY4 A;  3DYA A;  4CHY A;  4K8X A;  1SL0 A;  3NF9 A;  4B8A B;  2YKN A;  1TKX A;  1RDC A;  4CF0 A;  3VQA A;  1BGX T;  3VQP A;  1NOZ A;  3LDS A;  4DF4 A;  1NOY A;  1WSF A;  3V1R A;  2W42 A;  3AO3 A;  2ATQ A;  4Z4I A;  1VSL A;  1Q8I A;  4FM1 A;  1KFS A;  4FLZ A;  4CEZ A;  4B9N A;  3TAG A;  2F8T A;  1D5A A;  4H8K A;  4FJ5 A;  4DQQ A;  2FBT A;  5K14 A;  2WOM A;  4OGC A;  3WNF A;  4CJS A;  4ZHR A;  2XY6 A;  3SPY A;  3V4I A;  1ITG A;  4E0D A;  4DSJ A;  3MXI A;  1U4B A;  4KTW A;  1T03 A;  2RF2 A;  1DLO A;  3V9U A;  1D9F A;  3OVN A;  4KB0 A;  2IC3 A;  1C1C A;  2PY5 A;  4QOZ B;  2F8S A;  1DTT A;  3ZSX A;  3EYZ A;  1JXE A;  3VQD A;  4CJ3 A;  2YNF A;  4I9L A;  4CJ5 A;  3NE6 A;  4OKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...