1RNHA

Structure of ribonuclease h phased at 2 angstroms resolution by mad analysis of the selenomethionyl protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE HI
publication title Structure of ribonuclease H phased at 2 A resolution by MAD analysis of the selenomethionyl protein.
pubmed rcsb
source organism Escherichia coli
total genus 43
structure length 151
sequence length 151
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1990-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rnhA00
1VSFA 1S1VA 3LP0A 4CEAA 4DFJA 3SYZA 1JLEA 3U3YA 3HYFA 4FK4A 4B9LA 4FJIA 4O0JA 3SQ1A 1KLNA 1NK4A 4KB0A 2Y1IA 2I5JA 4BE0A 3EYZA 1BQNA 2XO7A 2YNHA 3BDPA 5KGWA 1W0HA 2D0AA 1KCFA 1X9WA 1A5VA 1LV5A 3NH2A 1HYZA 3QETA 4HCBA 4PUOA 4E1NA 4HUEA 4FK2A 4M3WA 4CF1A 1I39A 4IDKA 3NE6A 4KTQA 1WAJA 4OJRA 5J2PA 3SUQA 4FJ5A 1ZBUA 4CIEA 3AVIA 4FCYA 5HRRA 1CZBA 1GOAA 4QAGA 1EP4A 1TKZA 5FRMA 2OPPA 3LP3A 1SL0A 5FRNA 3MXJA 1HYSA 1TAQA 2OPSA 3E01A 4FLVA 4DSEA 3TAEA 3F73A 1RDAA 3JYTA 3WNFA 4CEOA 3V1QA 1RNHA 3OJUA 4DSFA 3SUNA 3OY9A 3RMDA 2P51A 3K58A 4FJKA 2VG5A 4MFBA 1WN7A 4IG0A 4E3SA 1TKXA 3AO2A 2QXFA 1D9FA 3KLGA 4FJGA 1RT7A 4KTZA 1CXQA 4KHNA 4I9QA 1QSSA 5KRTA 1KVCA 1VSIA 3ZT0A 4CJVA 3CM6A 2ETJA 4Q0BA 1JL1A 3LP1A 2OPRA 4DF4A 1N6QA 4CFCA 1EETA 4BDZA 4ZHRA 2XHBA 2ZD1A 4B9VA 4M3TA 3HVRA 3C6UA 1T03A 3PV8A 3JSMA 1QTMA 2Z1GA 4F3OA 4KHQA 4O55A 2HNDA 4O0IA 4B9TA 3AA5X 4HCCA 1RT5A 1RTHA 3NF7A 3VQEA 1RDDA 4ID5A 5JS2A 3ZSZA 3ZT3A 4O5BA 5KGXA 1KRPA 2E6LA 3KLEA 1NK7A 1BIZA 1JLCA 4Q5VA 3RMCA 2JLEA 1NK0A 2E6MA 3NFAA 5J1EA 3L2UA 4BE1A 3V9UA 1B9FA 1HPZA 1VK0A 3G0ZA 4DTJA 3M8SA 3CG7A 3V1RA 3IS9A 4DFKA 3OYNA 1WLJA 4R5PA 3IRXA 1SKRA 4LY7A 1X9MA 4DFMA 2KZMA 3L8BA 3CFPA 1KVAA 4DSJA 4J2AA 4DTUA 3VA0A 1ZBLA 3QEWA 3K5NA 1BCMA 1SL2A 1IH7A 1KVBA 3ZSYA 3DLHA 4J2EA 4B9UA 1T7PA 4AHSA 1QQCA 4CHZA 1IKWA 1MU2A 5CZ1A 3ZT4A 2NUBA 1U45A 1EX4A 3KKRA 3KJVA 3UIQA 3QEPA 4M3ZA 4F8RA 5HLFA 2DTUA 1RCHA 1DLOA 4CFBA 1G15A 4FLYA 1QHTA 2ZE2A 3U6FA 3K57A 3RMBA 1U48A 3KLHA 4LH4A 4EP4A 3OS0A 3OYFA 3NGIA 4B9SA 3DI6A 5HRPA 1RDBA 5HROA 4OPKA 1XWLA 3QNOA 4KI4A 4CEBA 4CJSA 3TAPA 1WAFA 4CJ5A 4DS4A 3DRRA 1A5WA 1J54A 1JXBA 2GUIA 3QIPA 3OYGA 4FXDA 2IDOA 3VQQA 4C8OA 3HT3A 4RW4A 3ZSRA 5HRNA 1RBVA 4E7KA 1U47A 3D45A 1NK6A 3KD5E 1WSGA 1L3UA 1ZYQA 4DU4A 3NH1A 3ULDA 1IG9A 4F2SA 3NDKA 4M3UA 2QK9A 4Z4HA 4YFUA 2VWKA 2QKKA 4CJLA 3CFRA 3NH0A 3P83D 1S1XA 3AV9A 4OKJA 3VN5A 3HK2A 1FKOA 2W42A 4N5SA 1ASWA 5DK5A 1RT6A 4W5RA 4DTPA 3ZSOA 3LALA 1XC9A 3VQDA 1BCOA 4GW6A 4LH5A 4RW7A 1WSIA 4DMNA 2G8HA 4M42A 3O4QA 4CFDA 4JS5A 3O3FA 4KREA 4AILC 3VQAA 4G1QA 4C8LA 1NJYA 5C42A 3I0RA 1JLFA 3T3FA 2HMIA 5J2NA 4OLBA 5FROA 2RKIA 3VQ8A 1WSHA 3KK1A 3L2WA 4BDPA 3L3UA 1ITGA 3PO5A 4KB1A 3K5OA 1TGOA 4CECA 2R7YA 3SQ2A 3RR8A 3TAQA 3K2PA 4H8KA 3CFOA 3TR8A 3F9KA 4FLUA 1CXUA 1ASVA 3RTVA 4QOZB 1LW2A 4RW9A 3L2RA 4DSLA 1SV5A 1VSEA 1VSLA 1ASUA 4CF8A 4ELTA 2YNIA 4C8NA 4N56A 1BGXT 3VQ9A 3ASMA 3P5JA 3OYJA 3V6DA 5I42A 1NK8A 2OZSA 4EZ6A 1L3TA 3TANA 1Y97A 3OYMA 3H08A 3RWUA 3HXMA 3ITHA 4DTMA 3V4IA 4FJLA 4Y1CA 3AVBA 3DYAA 1SUQA 2RPIA 3VQCA 4CJQA 4K8XA 1VSHA 3ZCMA 1UWBA 4CF2A 4FYDA 4KFBA 3RRGA 4C8MA 4N41A 3AO3A 5E41A 4FJ7A 1Q8IA 4H4MA 3IAYA 1VSKA 1IO2A 1B9DA 3PX0A 4HUGA 4DTRA 1S6QA 5J2MA 4FLTA 1VRUA 4KPYA 1J53A 1S1UA 4CHPA 3HSTB 1U04A 5C25A 4DLGA 2FBXA 3L3VA 4E7HA 3LDSA 1R0AA 4FJJA 2KTQA 3ZT2A 1WNSA 3A2FA 3O4NA 4FVMA 1EKEA 2IOCA 2XY7A 1VSMA 4IG3A 1GOCA 5CZ2A 3NGZA 3HL8A 4W5NA 1BL3A 2HB5A 3QEIA 3TI0A 2P1JA 4OPJA 3KK3A 2G8UA 1L3VA 2OYQA 3KIOA 2G8IA 2G8KA 4AH9A 3SV4A 1YT3A 1XI1A 3WNHA 4E7IA 2E4LA 3CM5A 3M8RA 4Z4EA 3WNGA 3C6TA 1FKPA 3ZSQA 3NAEA 3QLHA 1QSYA 2OPQA 2X6NA 4DTSA 1Q9YA 3TAFA 2YKMA 3DLRA 3AVJA 3RR7A 3DLGA 3SUPA 4QCLA 1A5XA 1SKSA 2QKBA 4I7FA 3KD1E 1BI4A 1JLAA 4OGCA 4E19A 1X9SA 2BANA 4PA1A 2RF2A 4KAZA 4CJRA 1KFSA 1CZ9A 5SWMA 1YTAA 1NJZA 3SV3A 1RT4A 4FJ9A 1FK9A 1VSDA 4CHQA 1D8YA 4CE9A 5T7BA 4Z4IA 1F21A 2XY8A 1GOBA 2D0BA 3HPGA 3OYBA 5CYQA 1U4BA 4J2DA 4FK0A 1XHZA 3IG1A 2EX3A 3SCXA 1JLBA 2Z1HA 3QIOA 3MEEA 3SPYA 3SNNA 3NF8A 4FM0A 2FBYA 3VQ7A 1LAWA 5K14A 1YVUA 4LD0A 2VG6A 4FJ8A 3HJFA 4B08A 4JRPA 3QEVA 3AVNA 4DTOA 4DQSA 4IBNA 1DTQA 1HNIA 4B8CA 1UAXA 1HYVA 4Y1DA 1RILA 4CJEA 4OLAA 5JS1A 2YV0X 1S1TA 2XRIA 4DS5A 4PY5A 4KRFA 2HHXA 1HQUA 3HP9A 3S3NA 2GV9A 3ISNC 1TK8A 4B9MA 2A1SA 3KKSA 4CEQA 2KFZA 3VQ4A 1CLQA 2IS3A 4CF9A 4CHNA 2HVHA 3PO4A 1RT2A 3D0PA 4I2PA 3AO1A 1C0UA 1S6PA 3OYEA 3EZ5A 4CJWA 4DQRA 4M3XA 2HW3A 4CEFA 4GVMA 1NKCA 3TAGA 1WSEA 2Z1JA 1C0TA 3OYDA 2YNGA 4IFVA 4Z4CA 3L2QA 3AO4A 2FBTA 2KZZA 1TL1A 1TAUA 3AVFA 5CYMA 5EU7A 4F2RA 3ZSWA 1C0MA 2X6SA 3NGYA 1IKVA 3K5LA 4ID1A 3KLIA 2KQ2A 1LW0A 1WSJA 4CGJA 1LWFA 2BGGA 1NK5A 4OVLA 3OS2A 2YKNA 1TL3A 1U49A 3O3GA 1K6YA 1RBRA 3M8QA 4C8KA 3TWHA 3SJJA 4AHTA 1T8EA 2B5JA 4CIGA 2GBZA 4L8RB 4CEZA 2IAJA 2VG7A 4KO0A 3HVTA 3TAMA 3WNEA 4E89A 5KTQA 1N5YA 3DRSA 4CGDA 4N76A 4UQGA 3OYKA 1S5JA 2JGUA 1X1PA 4PWDA 1HNVA 1BISA 3B6OA 2YHAA 4HUFA 5HP1A 4EZ9A 1TV6A 2B4JA 4CF0A 4CGHA 3DOLA 4CHOA 3V9ZA 1QS4A 4DQPA 3NHGA 4CGIA 1Z25A 3SQ4A 3AA2A 4KV8A 3RRHA 4B8AB 1RBTA 4CESA 3VQ5A 5KRSA 4FLXA 4FJNA 4ELVA 2ITGA 5C24A 1KLMA 3I8DA 2PY5A 4HTUA 1TK0A 1REVA 3ALYA 3QEXA 2G8FA 2HHSA 2BDPA 1RT1A 1TVRA 3OYAA 1NOYA 4FZXC 4K8ZA 1XHXA 3LAKA 3VQPA 4CCHA 1DTTA 2FC0A 3KK2A 4CJTA 3FFIA 4J2BA 4CJ4A 4DSIA 2HNZA 3DOKA 1C1BA 3V9WA 4OGEA 3PX6A 4B3OA 2F96A 1D5AA 1NKEA 3EY1A 4CJUA 4Z4GA 2HHTA 1JLGA 1LWCA 4ICLA 4DU3A 1D9DA 3LZJA 4KHSA 1RDCA 4FM2A 3S9HA 2DFHA 2D5RA 4FZYA 4RW8A 1HQEA 4FLWA 3DLKA 4CGFA 3OYLA 3S3MA 1ZBIA 1HRHA 1O1WA 4KHYA 3C95A 4DU1A 3AVKA 2Z1IA 1RBSA 3SZ2A 2OZMA 4M41A 1TKTA 2DFFA 3QO9A 4CJPA 4E0DA 2F8TA 3P1GA 1VRTA 1JL2A 5HRSA 4XIUA 4JLHA 4BDYA 4W5OA 3L2VA 4KI6A 5D3GA 2HVIA 2XY6A 4CJKA 4GMJB 1RTDA 1JLQA 4CIFA 2VWJA 4Z4FA 2DY4A 5I3UA 2XY5A 3DMJA 4M3RA 3SUOA 4KHUA 3T19A 4E1MA 3V9XA 4BWMA 4E7LA 3DRPA 2OA8A 4PQUA 3PX4A 4DLEA 1LWEA 1QSLA 4OKEA 4JRQA 1B92A 3OYCA 3S3OA 3K59A 2KW4A 2FBVA 5HBMA 1YTUA 2KFNA 3LWLA 4EP5A 4FJHA 1JXEA 1J9AA 2ATQA 3MEDA 4NYNA 4CK3A 1RTJA 2Q3SA 3MEGA 5SZTA 3SPZA 4HVJA 5FDLA 3QESA 1HJRA 1ZBFA 3V9SA 1I3AA 4LSNA 2HHQA 1C1AA 3AA4A 1C6VA 5CY4A 3M8PA 4CK1A 5J2QA 2WOMA 4NCGA 3VQBA 3AVLA 3OJSA 2G8WA 1ZBHA 4DQQA 2X78A 2D0CA 1BHLA 4JS4A 4AHRA 2YNFA 3HPOA 1J5OA 3MECA 3OVNA 4FJXA 3BGRA 1HMVA 3MXMA 2A1RA 1BI4B 2P5GA 2AJQA 3AVMA 1WSFA 4CJ3A 2LSNA 4AHVA 4WE1A 3AVGA 4DG1A 4E7JA 1NK9A 4Z0UA 3ZSXA 3TABA 4CEEA 1SKWA 4M3YA 3HM9A 4I9LA 1TKDA 2B6AA 3AO5A 3NCIA 4ZTJA 1C1CA 3HO1A 4W5TA 2HHUA 1W9HA 4CERA 1KFDA 4DQIA 1LAVA 2Y1JA 3QINA 4I2QA 3LP2A 2PYJA 3LANA 3LPTA 1S1WA 3AVAA 3NBPA 3NF6A 1TK5A 2HNYA 4RW6A 3SQ0A 3QERA 1UA0A 3QNNA 4O4GA 1SL1A 1UOCA 3AVCA 4DF8A 1Q9XA 3VA3A 4F4KA 4IKFA 4FLZA 2EHGA 4CK2A 3U3GA 3RMAA 4KKOA 4NCAA 2RN2A 3K5MA 3CQ8A 4BACA 3THVA 1UA1A 3PY8A 2O4GA 3G10A 4OKKA 3DM2A 4KHWA 1RTIA 4DTNA 1BIUA 4AHCA 1T05A 1QE1A 4CJFA 4MQ3A 5DMRA 3VQ6A 4NYFA 4W5QA 3HP6A 4DSKA 4FZZA 3ZT1A 3LZIA 2PYLA 4CFAA 3O3HA 2G8VA 3TARA 4F3TA 2IGIA 4TSXA 4M45A 4DFPA 1L5UA 3LPUA 3DLEA 3MAQA 4BE2A 4ZTFA 1S9GA 4KTWA 3OYIA 4DTXA 3NF9A 2F8SA 3KLFA 2ZQBA 3V1OA 4FW2A 4O44A 1Z26A 2WONA 3V81A 1JKHA 1NKBA 4CEDA 3DLBA 4B9NA 1S9EA 4NCBA 3CYMA 4CHYA 1IKYA 2X74A 3HPHA 2IC3A 1NJXA 3OS1A 4FM1A 3PUFA 1BQMA 1KTQA 1RT3A 2O4IA 3AVHA 1IKXA 4AHUA 3OYHA 4LSLA 2HHWA 4RG8A 3T1AA 1KSPA 2P5OA 4DWIA 1EXQA 1FXXA 3SI6A 2YHBA 4BWJA 3LWMA 1NJWA 3AA3A 3C94A 1RBUA 3ZSVA 1L3SA 4CGGA 4ELUA 3I0SA 3B6PA 3LAMA 4IFYA 1VSJA 4H4OA 4YNQA 1NOZA 4FW1A 3KTQA 4N47A 4HHTA 3MXIA 2HHVA 5KI6A 2DFEA 2BE2A 4FJMA 2PZSA
chains in the Genus database with same CATH superfamily
1VSFA 1JLEA 4FK4A 3HYFA 3SQ1A 2I5JA 5AQSA 1BQNA 3EYZA 5LMNK 1W0HA 3GBTA 1KCFA 1A5VA 2O8FB 5EOYA 4HCBA 3VGLA 1I39A 2ZM6K 3J7YP 4FJ5A 5TKYA 3AVIA 3CJAA 1IBMK 5AQFA 5FRNA 1BA1A 3TAEA 2OPSA 4FLVA 3F73A 3TPQA 1RDAA 3WNFA 3D2FA 3V1QA 4DSFA 3RMDA 2P51A 4GV6A 1BUPA 2VG5A 4MFBA 3AO2A 1CXQA 2E8AA 5M1KA 2D4WA 5KRTA 5JMVA 4WCEL 2VGMA 1N6QA 4JV5K 4ZHRA 3PLAA 2UXDK 1QTMA 2ITMA 4O0IA 3O5BA 2HHHK 4B9TA 1RT5A 1RTHA 4OX9K 2E6LA 3TTDA 3ZYYX 3KLEA 1NK7A 1JLCA 4IOAL 1NK0A 2E6MA 4JKGA 4BROA 3V9UA 1HPZA 4JI8K 1LOTB 3M8SA 3FR0A 3V1RA 2CH6A 1KVAA 2UYTA 4DTUA 4DR7K 3QEWA 3K5NA 1NG9A 1SL2A 4DV5K 2NUBA 3CETA 4M3ZA 5HLFA 5C2DA 1RCHA 3L0QA 3U6FA 4DR2K 3EEQA 1QHTA 2ZE2A 4PUOA 2AA4A 4LH4A 4B9SA 4JNEA 3DI6A 3O9TA 1RFQA 1XWLA 4KI4A 2D0PA 4CJ5A 4DS4A 3LM2A 2YJEA 3U4LA 4FXDA 2IDOA 4C8OA 2NZTA 3HT3A 3ZSRA 5HRNA 4DV0K 3D45A 4DWIA 1L3UA 1IG9A 3O9QA 4DU4A 3NH1A 3ULDA 4M3UA 4YFUA 2VWKA 3WXMB 4B1VA 2QWRA 4OKJA 3G4SN 4JI4K 5DK5A 4W5RA 3BF3A 1XC9A 3MX5A 4LH5A 4K42A 3TSUA 4JS5A 1YJ9N 3DXMB 4KREA 4C8LA 3VQAA 5KPTA 3VEYA 5J2NA 5GIOA 4YDUA 5FROA 4BDPA 1WSHA 3KK1A 3RR8A 4U67L 5C10A 3SQ2A 2YHXA 3TAQA 3K2PA 1QVFM 3CFOA 1YF5L 1CXUA 1ASVA 1YJWN 4RW9A 4DSLA 3R6MA 1VSEA 2YNIA 3V6DA 4IFEA 3VQ9A 3P31A 3P5JA 4KH5A 3TANA 4FJLA 4GNIA 1E4FT 1VSHA 2CGLA 3DAWA 2VGNA 4N41A 3AO3A 1Q8IA 1K73O 3IAYA 3VETA 1VSKA 1B9DA 5FPMA 3W0LA 3OHRA 1S6QA 1VRUA 3O6WA 1S1UA 4CHPA 3HSTB 1U04A 4DLGA 5AQHA 1YIJN 4FJJA 2KTQA 2E1YA 4H5WA 1WNSA 3ZT2A 4FVMA 1EKEA 4EFHA 1KAZA 2G8IA 3E9OA 1X3NA 2CGKA 3C0BA 3CM5A 3KVGA 3WNGA 4BRDA 3NAEA 1QSYA 2OPQA 5AQPA 2X6NA 5C15A 1Q9YA 1VQKN 2YKMA 4OPAA 2OCEA 2JWKA 3KD1E 1CZAN 4KAZA 2Q31A 5SWMA 2Q1NA 1YTAA 3SV3A 5BPNA 4FJ9A 4ILHA 4CE9A 5T7BA 3OYBA 3HPGA 5CYQA 4JK8A 1XHZA 3SNNA 3MEEA 3SPYA 1BOTO 5BPMA 4FM0A 2PFUA 4LFCK 1YVUA 2VG6A 3H3OB 3M5RA 3Q7BA 4I6MB 3IUCA 4B8CA 1UAXA 4CJEA 4OLAA 3M3ZA 5JS1A 4CZEA 3S3NA 4LFBK 4M7YA 1P8ZA 2KFZA 4DKWA 3GG4A 1VQ9N 3D6RA 3PO4A 3GL1A 1C0UA 3EZ5A 4CJWA 2HW3A 4CEFA 1NKCA 1WSEA 1VQNN 4FSVA 4QS8A 4BRAA 3AO4A 2FBTA 4R79A 3KK7A 5I9EB 4AM6A 3AVFA 3WQTA 3A5NC 1K8AO 1DEJA 1C0MA 4DR4K 4ID1A 2ZF5O 1N36K 3AGRA 2BGGA 1NK5A 5LJWA 3OS2A 1RBRA 5EXWA 3TWHA 1JJ2M 5ADXA 4GKKK 4L8RB 3HVTA 3K9KA 5KTQA 2P9SB 3DRSA 3OYKA 4H5NA 4B9QA 4PWDA 4EZ9A 4CF0A 3WXKA 4BVOA 3NHGA 2V51B 3AA2A 4KV8A 2VQFK 1RBTA 4CESA 3VQ5A 3I33A 5KRSA 4FLXA 4FJNA 4ILJA 4ELVA 2PY5A 4EHTA 5BN8A 3VEOA 4HTUA 3CCEN 2O8FA 4XH1A 2HHSA 2BDPA 2E2NA 4FPAA 1HKBA 4B3TK 4IEEA 3O80A 1DTTA 4GY2B 5KQ8A 3FFIA 4J2BA 4DSIA 3GDQA 2HNZA 3PX6A 4B3OA 1D5AA 4ICLA 5AQQA 5MLCQ 5GIPA 3H3NO 1G99A 4KBOA 3OYLA 1HRHA 3AVKA 1RBSA 4JHDB 4E0DA 3P1GA 1JL2A 4XIUA 3O9SA 2HVIA 1RTDA 2DY4A 4KHUA 4M3RA 4DV4K 4E7LA 3DRPA 4PQUA 1QSLA 3HBTA 4OKEA 3VEZA 3S3OA 2P9UB 2KW4A 4H5TA 4C1NI 4NXMK 2AP1A 4EP5A 2Q3SA 3MEGA 4PKGA 3F5TA 4QS7A 5GAEP 4MDBA 4FVUA 5KPZA 3BZKA 1HJRA 3V9SA 1I3AA 3FZFA 1C1AA 3AA4A 4CK1A 2WOMA 3N4QA 3VQBA 4A61A 3EKSA 2UUAK 1YJNN 4AHRA 1NGJA 4FJXA 5EX5A 2P5GA 3AVMA 5BR8K 2LSNA 4AHVA 1BA0A 3AVGA 4E7JA 1NK9A 4Z0UA 3G25A 4CEEA 1SKWA 3HM9A 4I9LA 2B6AA 3AO5A 3NCIA 4ZTJA 1C1CA 4DQ8A 4JK7A 3L4IA 1KFDA 1LAVA 3QINA 3LP2A 3NBPA 1TK5A 2HNYA 3QNNA 4O4GA 3VA3A 4BG8A 4BRPA 3H6EA 4CK2A 2QI2A 1KAXA 4NCAA 3K5MA 4BACA 1Y64A 5LY3A 2O4GA 3IKMA 4PL7A 1KXPA 1RTIA 3CHWA 4FWQA 4B1UB 5JVHL 1HJOA 1NGEA 2I7PA 3LZIA 3HSCA 1ZC6A 2IGIA 4BRNA 3DXMA 1L5UA 3WXJA 3LPUA 2HMPA 2QWPA 3C65A 4DTXA 1VQPN 3KLFA 3EN9A 3E1YA 2A3ZA 3V81A 1YVNA 1HUXA 3SAGA 2YHWA 2IC3A 3HPHA 2NRVA 4CVNE 1BQMA 1KTQA 1IKXA 4B1ZA 3FZKA 2P5OA 4A5BA 3SI6A 1XC3A 2YHBA 4MDAA 1NJWA 1RBUA 3EKUA 3GOIA 1VSJA 3JS6A 4N47A 2HHVA 2DFEA 5J1EA 2VQEK 4CEAA 3PIOL 1KLNA 2YNHA 4FL9A 3BDPA 5KGWA 2D0AA 3BY5A 1LV5A 4RCHA 3NH2A 4OPHA 5IWAK 1NU0A 1YI2N 3NE6A 1WAJA 4H0VB 1ZBUA 4KH4A 3IDHA 3MX2A 1EP4A 5FRMA 3LP3A 1HYSA 3CC7N 3JYTA 5M1PA 1TYQB 1RNHA 4CZFA 3OJUA 3SUNA 3OY9A 2UUCK 3K58A 4IG0A 4E3SA 1TKXA 4CZKA 1N32K 1VQ5N 4KHNA 4I9QA 5AZIB 4L3QA 1KVCA 1VSIA 3CJ9A 1NGBA 2OPRA 3PSFA 4CFCA 1WBBA 3J80O 4A62A 3HVRA 3PV8A 2W41A 3JSMA 4O55A 4BC5A 2V52B 3VQEA 3ZX0A 4HCCA 1RDDA 4ID5A 5JS2A 4LF4K 4I6MA 4O5BA 5KGXA 4NO7A 4JKBA 3RMCA 2JLEA 4JKHA 3NFAA 4BE1A 1HR0K 5B8HA 1VK0A 4JKFA 4DTJA 1NM1A 4DV6K 3BP8A 2OANA 3IS9A 1RDUA 2A40A 4HTLA 3T1YK 3E9PA 3VF4A 2V7YA 4MLHA 3IRXA 4LY7A 1KAYA 5AQZA 3L8BA 4DB3A 2OTJN 1BCMA 3DLHA 1SQKA 1T7PA 1QQCA 3ZT4A 1QZ5A 3SBTA 1U45A 1EX4A 2FSJA 4CI6A 3QEPA 3VMFB 1P90A 2HMIA 1G15A 3RMBA 3C6HA 3OYFA 1RDBA 4OPKA 3QNOA 4CEBA 5AQGA 4CJSA 3F2KA 1A5WA 1JCGA 1J54A 1JXBA 2JWLA 3QIPA 4IJAA 3OYGA 4DUYK 1GLCG 4H5VA 4JI7K 5M1QA 4IO9L 4E7KA 3KD5E 1ZYQA 4E1JA 2P9SA 1NGCA 1NGHA 3ATVA 4LC9B 3MCAB 3AV9A 2KLAA 1KQSM 1FKOA 4DV7K 4KH6A 4N5SA 1ASWA 3JXUA 1WUAA 3N4PA 5E84A 1X9JA 3BUZB 1WSIA 4DMNA 4M42A 4BRIA 4CFDA 4CBUA 3SAFA 1J5EK 4AILC 1M1KO 4BRLA 1JLFA 3CPEA 3T3FA 4BY9C 2VWBA 3I55N 4OLBA 3VQ8A 4KB1A 1OVQA 3L3UA 1TGOA 4H0OA 2FSKA 2NLXA 2ZGYA 3TR8A 3L2RA 3QBXA 4B3SK 4XEIA 1JCEA 1C0GA 1C0FA 4C8NA 1BGXT 3ASMA 1LCUA 2OZSA 3OBWA 1Y97A 3RWUA 3HXMA 3ITHA 3DLLL 2QEXN 4JHDA 2RPIA 3VQCA 2WBNA 3CIPA 1QQMA 3ZCMA 4CF2A 4OO1J 4KFBA 4FYDA 2W40A 2CH5A 4C8MA 4JI0K 3HRGA 4H4MA 3A8YA 4KPYA 1HLUA 2A41A 5C25A 2FBXA 1ILYA 1IBLK 2ZWHA 4KHPK 3O4NA 2IOCA 4BR9A 1VSMA 3KWIA 1ATRA 2P9UA 3H46O 2HB5A 3QEIA 1VQON 2P1JA 1L3VA 2E2PA 2G8KA 4AH9A 1XI1A 3WNHA 4Z4EA 3M8RA 1FKPA 1K9MO 4JEPA 3TAFA 1KD1O 3AVJA 4O8KA 2ZJPL 3SUPA 1ATNA 3QICA 4IXCA 4LFAK 1JLAA 5FPEA 1DKGD 4O5FA 5GINA 1NGFA 1D8YA 1QQOA 2D0BA 1U4BA 3THYB 3QFUA 3SCXA 3QIOA 3O1BA 3NF8A 2FBYA 2P9NB 3VQ7A 3EE8A 3J8AA 5K14A 2HF4A 3E9LA 4ISGA 3NVMA 1OH8A 4CD1A 2QA4N 2HBJA 4JKCA 1XMQK 1T6DA 1WOQA 1RILA 3I8BA 4ILGB 4M7XA 3VENA 5BR9A 1S1TA 3SMSA 4DS5A 4BQZA 4CZIA 2NRTA 3HP9A 4BRGA 2GV9A 1YHQN 4B9MA 4IOCL 3KKSA 1RT2A 3D0PA 2ASMA 1S6PA 4GKJK 3EE9A 1X3MA 2E20A 4NLBA 3OYEA 4DQRA 2WTUA 3J81O 4BQLA 4GVMA 3CCQN 2Z1JA 3H45C 3OYDA 2YNGA 4IFVA 2KZZA 4Z94A 3SAHA 3C6AA 2NRRA 4IOXA 4JD2B 2X6SA 3FLCO 2Q0RA 4CGJA 1LWFA 2P9IB 5FLXO 2YKNA 1TL3A 1XMOK 1FW6A 2I7NA 4C8KA 3SJJA 1HNWK 2GBZA 2VG7A 4IO8A 3ENHA 2H3GX 4CGDA 4LF9K 4UQGA 1S5JA 2JGUA 3CJ1A 4RWTA 2ZJQL 4HUFA 1TV6A 1GLAG 1QS4A 5HL7L 1OVYA 4DQPA 2V7ZA 1W2BM 3ULEB 3R9PA 4JKAA 2ITGA 1KLMA 1TK0A 3QEXA 2F9TA 1NOYA 3OYAA 4K8ZA 3LAKA 3KK2A 4CJ4A 4WYBA 3V9WA 4OGEA 3GE1A 4IEIA 2RHKA 5BRHA 2HHTA 1LWCA 4DU3A 3LZJA 4KHSA 1RDCA 4BGBA 1TYQA 2D5RA 4FZYA 4FWNA 3PIPL 3DLKA 1ZBIA 3S3MA 1O1WA 3UKRB 3C7NB 3C95A 3S41A 5AZIA 2NRXA 4BRHA 4CJPA 3TU5A 1VRTA 2QW9A 1V4TA 4KI6A 4H0TB 4GMJB 4CJKA 2QWQA 4ISEA 4CIFA 2VWJA 3KHYA 5I3UA 3DMJA 3SUOA 4BWMA 4AM7A 3D2EB 4JRQA 2GX9A 3OYCA 4DHYA 1RTJA 3BF1A 3LL3A 1C6VA 5CY4A 3OJSA 1ZBSA 4YOVA 1BHLA 4JS4A 2YNFA 1J5OA 2P9PB 4PL8A 1BI4B 4CJ3A 2QWMA 3R1XA 3AAQA 3ZSXA 2YX6A 5CR4A 3DWLA 5CHIA 3ZEUB 4W5TA 5EY4A 3OTOK 4DV3K 1MA9B 4CERA 3CCRN 4DQIA 2PYJA 3LANA 3LPTA 4AF1A 3WT0A 3LDNA 2FF3B 5AQXA 3EZWA 3WEEB 1Q18A 1Q9XA 4F4KA 3U3GA 4KKOA 1UA1A 1NGIA 3PY8A 3WXLA 3G10A 5AJ3K 4KHWA 1QE1A 4NYFA 2O8CA 4TSXA 1SZ2A 4FWSA 3MAQA 4BE2A 1XNRK 4ZTFA 2UUBK 3HM8A 3NF9A 3T1HK 2F8SA 3M6GA 1S72N 3V1OA 1IV0A 4WF9L 4FW2A 4MO4A 1OH7A 1NKBA 1NMDA 4CEDA 5AQRA 1S9EA 3CYMA 2X74A 1BO5O 2F9WA 3B8AX 5AQOA 3PUFA 3CF5L 2P9LB 4AHUA 4LSLA 4RG8A 2GELA 2IVPA 3CMAN 1U2VB 4BWJA 3AA3A 1L3SA 4CGGA 2UU9K 4FWOA 5AFUA 4FW1A 3ZX2A 4HHTA 3MXIA 2BE2A 4FJMA 3LP0A 1S1VA 4DFJA 3SYZA 3U3YA 2W6KA 4O0JA 1NK4A 4EHUA 2O8BB 5BPLA 3DJCA 2XO7A 4WFAL 3J7AP 4H0XB 4ISFA 1X9WA 3CC2N 4GV9A 2KKZA 4NXNK 4FK2A 4PHTX 4KTQA 4IDHA 4OJRA 5J2PA 3SUQA 5BRDA 4CIEA 3NVKA 4K43A 3L6QA 1CZBA 3QBWA 2Q97A 1TKZA 3ZETB 4DSEA 2IIRA 3G6EN 3Q7CA 1YITN 4BC4A 1VHXA 1WN7A 3ID8A 2QXFA 1T6CA 1D9FA 4FJGA 1RT7A 4KTZA 3QMLA 3VTHA 4FOIA 4CBXA 4CJVA 2ETJA 5FPNA 3LP1A 3THYA 1EETA 2P9KB 2ZD1A 2P9NA 3C6UA 4F3OA 4KHQA 4X64K 3NF7A 1KRPA 2QM1A 4CZHA 1D4XA 2DPNA 1BIZA 4Q5VA 3L2UA 1B9FA 1ZXOA 3G0ZA 3CG7A 2FXUA 4DFKA 1WLJA 4DV1K 4DFMA 2KZMA 4J2AA 3LDQA 4FWRA 3MWTA 1IH7A 1KVBA 4AHSA 1IKWA 1MU2A 5CZ1A 4A5AA 4GVEA 3KKRA 3UIQA 4F8RA 1DLOA 4BR2A 4CFBA 4B1WB 2QWNA 2D0OA 3ZX3A 3OS0A 5AQVA 3NGIA 4JD2A 1Q81O 1N33K 4J8FA 2P9IA 3TAPA 1YAGA 2GUIA 3VF6A 3VQQA 1U47A 1Z6RA 3UE5A 1NK6A 5H1SQ 1MWMA 4A57A 3CMEN 2QKKA 4CJLA 3CFRA 1S1XA 3VN5A 3HK2A 3ENBA 3SK3A 3ENOA 1N8RO 4C23A 4O8UA 1SS6A 3LALA 1GLFO 3ZSOA 3ULEA 3MWPA 4G1QA 1WBDA 2QXLA 4H0YB 1IJJA 2FF6A 2RKIA 3L2WA 5TKWA 4AQYK 4H8KA 3F9KA 3RTVA 1OH5A 5HOOA 1VSLA 4CF8A 4ELTA 5AQUA 5I42A 4FOEA 4FWMA 1U6ZA 4EZ6A 1L3TA 3OBYA 1NJIO 3H08A 3UKRA 3C7NA 4DTMA 4Y1CA 1MDUB 3AVBA 3DYAA 1SUQA 5AQIA 4CJQA 2BH1A 3OA9A 5E41A 4FJ7A 4K25A 5GAGP 4JI2K 3F9MA 4HUGA 4DTRA 3AGKA 4BREA 1J53A 5DM6L 5A2QO 3LDSA 3D2EA 2XY7A 4IG3A 3NMUA 3MK6A 3O9UA 1QQNA 5CZ2A 3NGZA 2E2QA 1BL3A 3U9ZA 4OPJA 3KK3A 3IFRA 2G8UA 2WC9A 4E7IA 2E4LA 1O13A 3ZSQA 4DTSA 3DLRA 5BN9A 2YHYA 3RR7A 3DLGA 4QCLA 1A5XA 2P9PA 4WFNL 1SKSA 4I7FA 1BI4A 4OGCA 4E19A 5AQMA 2BANA 1X9SA 4PA1A 4BGAA 3RSEB 4X65K 1RT4A 1FK9A 3AY9A 1F21A 2XY8A 1GOBA 3ZEUA 4J2DA 2EX3A 1JLBA 2ASOA 3ATUA 4LF8K 1ESVA 4FWPA 1LAWA 4LD0A 2F4VK 2QWOA 1NMNA 3LDPA 4JRPA 3QEVA 1E3MA 1KC8O 3WEEA 4DQSA 4IBNA 1DTQA 1HNIA 3H1VX 3G71N 4BC2A 3SLCA 1NGDA 2YJFA 3THWB 4V19S 4KRFA 4WFBL 5F2RA 3J7ZO 5CE3A 1BU6O 1HQUA 1TK8A 4QS9A 2A1SA 4CEQA 3VQ4A 1CLQA 5AZJB 4CHNA 1W97L 2HVHA 4I2PA 3AO1A 2O8DB 1HPMA 4M3XA 5EVZA 1E4GT 2NRHA 3L2QA 1VAZA 1R59O 1TL1A 1TAUA 3O08A 2P9LA 1IKVA 3K5LA 2KQ2A 1U49A 2O8CB 1K6YA 3SJHA 1U2VA 3M8QA 5GAHP 3LM9A 2VYPA 1T8EA 2IAJA 3TAMA 4E89A 3VOVA 4N76A 1X1PA 4JAXA 2YHAA 2CGJA 4JI3K 2B4JA 4CGHA 4CHOA 1ATSA 3CJ7A 1QHAA 4CGIA 2O8BA 1Z25A 3SQ4A 2Q2RA 4WQ5C 3FZLA 3I8DA 4FWLA 1REVA 3CQYA 1BWFO 1HX1A 3P4IA 1RT1A 4JKDA 2NRZA 3JAMO 3WUHA 4Y0WA 1RDWX 2FC0A 4WQ4C 4CJTA 2WUSA 3DOKA 2Q36A 2F96A 3ZETA 1NKEA 1N34K 4CJUA 4Z4GA 1JLGA 4YOYA 3EL2A 2GTDA 4FM2A 2ZGZA 2DFHA 4RW8A 1HQEA 3PSIA 4FLWA 4CGFA 1EWQA 5F1XA 4KHYA 4DU1A 2Z1IA 1T3VA 3A5OC 3SZ2A 2OZMA 4YORA 3QO9A 3VEVA 4W5OA 3A0IX 2P9KA 3CCVN 4X66K 5AQWA 5AQJA 4PKIA 3V9XA 2IVOA 2OA8A 3PX4A 4DLEA 1NLVA 4YHHK 1J6ZA 3P39A 1B92A 5BREA 2FBVA 2KFNA 3LWLA 5M1OA 1JXEA 4NLCA 3CJCA 2E5LK 5FDLA 3QESA 4DR3K 3M8PA 5J2QA 4LF6K 4NCGA 3AVLA 4DQQA 2X78A 1GLDG 2D0CA 2W6LA 3VESA 3AAPA 3MECA 3OVNA 4BVPA 3E66A 3FZMA 3O8MA 2A1RA 1WSFA 1XUPO 4WE1A 3FGUA 3D7EO 5AQYA 3TABA 2QWLA 3H1QA 2HOEA 2HF3A 4JK9A 4I2QA 3NF6A 1K8KB 3O4WA 4RW6A 4JI6K 5KPRA 3SQ0A 1UA0A 1UOCA 2HBKA 4IKFA 3RMAA 4GV3A 1I94K 4IWVA 3CQ8A 4OKKA 4DTNA 1T05A 3HO1A 4FZZA 4MQ3A 5DMRA 3TTCA 4IZ9A 3ZT1A 2PYLA 4CFAA 3MN9A 3O3HA 4F3TA 3TARA 4DFPA 1HKGA 3THXB 4MO5A 4CJ7A 1JCFA 4KTWA 1VQMN 1QZ6A 3KWGA 4O44A 2WONA 3O1WA 2A5XA 4MLEA 3DLBA 4BR7A 3DXKB 4FM1A 2HSTA 4JYAK 1RT3A 2O4IA 3AVHA 3OYHA 4YOWA 3CJBA 3T1AA 4UY8O 1FXXA 3HOTA 5AQLA 3BZCA 3OW2M 3VPZA 5AQKA 3LAMA 3B6PA 4IFYA 1TUUA 4H4OA 4YNQA 1NOZA 4B1YB 3FE1A 3KTQA 4H03B 4BRKA 3NGYA 3OYJA 3P38A 3MCPA 4B9LA 4FJIA 3CPWM 4KB0A 2Y1IA 4BE0A 5C2FA 5AQTA 2WFBA 4CZJA 1HYZA 3QETA 4E1NA 4CZMA 4HUEA 4M3WA 4CF1A 4IDKA 3MN6A 3SMPA 3LDOA 3CCMN 4FCYA 5HRRA 2A42A 1GOAA 4QAGA 1VQLN 4FPBA 2OPPA 1SL0A 3MXJA 1TAQA 3E01A 4BRCA 1OKJA 3MDQA 3VERA 4CEOA 4BC3A 4FJKA 1YXQA 4YOUA 3KLGA 1Q7YO 1M90O 2YCHA 1QSSA 3RSEA 2NNWA 3ZT0A 3CM6A 4Q0BA 1JL1A 4DF4A 4YOTA 4BDZA 2XHBA 4B9VA 4M3TA 1DGKN 1T03A 2Z1GA 2HNDA 3AA5X 3R3LA 3ZSZA 3CXCM 3ZT3A 5GADP 3UKUB 4XH4A 3CC4N 3THWA 1H1VA 3L4QA 3MN7A 3R8EA 3OYNA 1XNQK 4R5PA 5AZJA 1FJGK 1SKRA 1X9MA 4DSJA 3CFPA 2O8DA 3VA0A 3U9DA 5DM7L 3HOSA 1ZBLA 3ZSYA 3HTVA 4J2EA 4B9UA 4NB4A 4CHZA 2GWJA 3KJVA 2DTUA 4FLYA 1U48A 1GLEG 4F2SA 5LL6Z 3K57A 3KLHA 4EP4A 3T69A 5HRPA 5F0XA 3KZBA 5HROA 4K41A 4CW7B 1W7AA 1WAFA 3DRRA 4X62K 4A2AA 1IBKK 4RW4A 3QFPA 1RBVA 1WB9A 1WSGA 1BDGA 3NDKA 2QK9A 4Z4HA 3BEXA 3NH0A 3P83D 1EWRA 2F7TA 2E88A 2A6AA 2W42A 4CZLA 3CQXA 1NGGA 4DTPA 1RT6A 4BR5A 3VQDA 1BCOA 1GLJO 4GW6A 3MMVA 4RW7A 1Q86O 3VTIA 2G8HA 3O4QA 4G9ZA 3O3FA 4EIAA 1NJYA 5C42A 3I0RA 2IVNA 4U7BA 3PO5A 1ITGA 3K0SA 3K5OA 3SBGA 4CECA 2R7YA 4EAHD 4FLUA 1OH6A 4QOZB 1LW2A 2UXCK 5E26A 1SV5A 3VGKA 2PBDA 1ASUA 2O8EB 4N56A 1NK8A 4K0KK 2E2OA 2HBMA 3OYMA 3V4IA 4RTFD 4K8XA 1UWBA 3RRGA 3CCSN 3AARA 3TTFA 1IO2A 4A2BA 3PX0A 5J2MA 4FLTA 1SAZA 4JN4A 4IJNA 1GLBG 3L3VA 4E7HA 4DV2K 1R0AA 3A2FA 2BTFA 1GOCA 3MN5A 3HL8A 4W5NA 1IG8A 1MWKA 3LDLA 3TI0A 2OYQA 3KIOA 1TUYA 4FO0A 3SV4A 1YT3A 5FPDA 3UB5A 3C6TA 3M1FA 3QLHA 5JVGL 4BG9A 4DUZK 3I56N 3D2FB 2QKBA 2RF2A 4WQ5A 3A5MC 4CJRA 4BR0A 1NBWA 1KFSA 1CZ9A 4XH5A 2Q0UA 1NJZA 1VSDA 4CHQA 4Z4IA 2RE2A 3ID6A 4FK0A 4CBWA 3IG1A 2Z1HA 4YDUC 4WQ4A 3VGMA 1K8KA 3RVCA 1EO1A 4FJ8A 3HJFA 4B08A 1NGAA 3AVNA 4DTOA 1HKCA 2FLOA 1HYVA 4Y1DA 3O9RA 2GEMA 2YV0X 4JKGB 2XRIA 3VEWA 3CI5A 4DR5K 4PY5A 2HHXA 3ISNC 2IS3A 4CF9A 3WXIA 3THXA 1XQSC 3T7ZA 2GWKA 3TAGA 4F9OA 1C0TA 4Z4CA 2BUPA 5ADXH 3DXKA 5CYMA 4DR6K 5EU7A 4F2RA 3ZSWA 1Z05A 3U8XA 3KLIA 1LW0A 1WSJA 1BG3A 1S22A 4OVLA 5C0YA 3O3GA 5AQNA 1DT9A 2VCPA 4AHTA 2B5JA 4CIGA 3TSPA 2ASPA 4CEZA 4KO0A 3WNEA 2PAVA 1N5YA 4B3MK 2ZJRL 4JI5K 2J4RA 1HNVA 1BISA 5C12A 2FSNA 1Q82O 3B6OA 5HP1A 1NWKA 3ZLJA 3DOLA 3CCUN 3V9ZA 2OTLN 5AFUH 1HNXK 3RRHA 4B8AB 4HWIA 4LF5K 5C24A 2YI1A 3QDKA 3ALYA 2G8FA 3CD6N 1TVRA 4FZXC 1XHXA 3VQPA 1HNZK 4CCHA 1C1BA 3WQUA 5KQDA 3EY1A 3HI0A 1QVGM 3FFKB 1D9DA 3S9HA 3EO3A 5ELZA 4B3RK 4BR4A 1EQYA 4B1XB 3A5LC 2F8TA 4M41A 1TKTA 2DFFA 2EWSA 4DCHA 5HRSA 4JLHA 4BDYA 5JICA 3L2VA 5D3GA 4FWKA 4H5RA 2XY6A 1JLQA 3CCJN 2XY5A 3T19A 4E1MA 3CCLN 3UKUA 1LWEA 3K59A 5HBMA 1YTUA 1GLLO 4FJHA 1J9AA 4C1NK 2ATQA 3IMXA 3MEDA 4NYNA 4CK3A 5SZTA 3HZ6A 3SPZA 4HVJA 1ZBFA 2HHQA 4LSNA 2D1KA 4BRFA 2G8WA 1ZBHA 1T44A 4BRQA 1VQ8N 3HPOA 1V4SA 4JI1K 3BGRA 1HMVA 3MXMA 3CERA 2AJQA 3QB0A 4PKHA 4DG1A 3VEXA 4M3YA 1TKDA 5IT9O 2HHUA 1W9HA 3TSQA 2Y1JA 4LF7K 1S1WA 3AVAA 3QERA 1SL1A 4YOXA 3AVCA 4A59A 4DF8A 5LMUK 4DR1K 4FLZA 2EHGA 1YUWA 5JLHA 2RN2A 5JLFA 3THVA 3W3DA 3DM2A 4M63C 1BIUA 4AHCA 4Z4FA 4CJFA 4W5QA 3HP6A 1RGIA 3VQ6A 4DSKA 1S3XA 5AR0A 2NRWA 2G8VA 4M45A 3DLEA 1S9GA 5LJVA 5M1NA 3OYIA 5BRFA 2ZQBA 4H0PA 5M1FA 4JKEA 1Z26A 1JKHA 4CD3A 4B9NA 4NCBA 2GUPA 4CHYA 1IKYA 2UXBK 1NJXA 3K9JA 3OS1A 4YY3K 1VQ6N 2HHWA 2O8EA 1NNEA 1KSPA 1VQ4N 1EXQA 4CZGA 1VQ7N 3LWMA 3C94A 3ZSVA 4ELUA 3I0SA 3FZHA 2QTDA 2KHOA 4BRMA 2HBLA 3VF2A 5KI6A 2E1ZA 2PZSA
chains in the Genus database with same CATH topology
1VSFA 1S1VA 3LP0A 4CEAA 4DFJA 3SYZA 1JLEA 3U3YA 3HYFA 4FK4A 4B9LA 4FJIA 4O0JA 3SQ1A 1KLNA 1NK4A 4KB0A 2Y1IA 2I5JA 4BE0A 3EYZA 1BQNA 2XO7A 2YNHA 3BDPA 5KGWA 1W0HA 2D0AA 1KCFA 1X9WA 1A5VA 1LV5A 3NH2A 1HYZA 3QETA 4HCBA 4PUOA 4E1NA 4HUEA 4FK2A 4M3WA 4CF1A 1I39A 4IDKA 3NE6A 4KTQA 1WAJA 4OJRA 5J2PA 3SUQA 4FJ5A 1ZBUA 4CIEA 3AVIA 4FCYA 5HRRA 1CZBA 1GOAA 4QAGA 1EP4A 1TKZA 5FRMA 2OPPA 3LP3A 1SL0A 5FRNA 3MXJA 1HYSA 1TAQA 2OPSA 3E01A 4FLVA 4DSEA 3TAEA 3F73A 1RDAA 3JYTA 3WNFA 4CEOA 3V1QA 1RNHA 3OJUA 4DSFA 3SUNA 3OY9A 3RMDA 2P51A 3K58A 4FJKA 2VG5A 4MFBA 1WN7A 4IG0A 4E3SA 1TKXA 3AO2A 2QXFA 1D9FA 3KLGA 4FJGA 1RT7A 4KTZA 1CXQA 4KHNA 4I9QA 1QSSA 5KRTA 1KVCA 1VSIA 3ZT0A 4CJVA 3CM6A 2ETJA 4Q0BA 1JL1A 3LP1A 2OPRA 4DF4A 1N6QA 4CFCA 1EETA 4BDZA 4ZHRA 2XHBA 2ZD1A 4B9VA 4M3TA 3HVRA 3C6UA 1T03A 3PV8A 3JSMA 1QTMA 2Z1GA 4F3OA 4KHQA 4O55A 2HNDA 4O0IA 4B9TA 3AA5X 4HCCA 1RT5A 1RTHA 3NF7A 3VQEA 1RDDA 4ID5A 5JS2A 3ZSZA 3ZT3A 4O5BA 5KGXA 1KRPA 2E6LA 3KLEA 1NK7A 1BIZA 1JLCA 4Q5VA 3RMCA 2JLEA 1NK0A 2E6MA 3NFAA 5J1EA 3L2UA 4BE1A 3V9UA 1B9FA 1HPZA 1VK0A 3G0ZA 4DTJA 3M8SA 3CG7A 3V1RA 3IS9A 4DFKA 3OYNA 1WLJA 4R5PA 3IRXA 1SKRA 4LY7A 1X9MA 4DFMA 2KZMA 3L8BA 3CFPA 1KVAA 4DSJA 4J2AA 4DTUA 3VA0A 1ZBLA 3QEWA 3K5NA 1BCMA 1SL2A 1IH7A 1KVBA 3ZSYA 3DLHA 4J2EA 4B9UA 1T7PA 4AHSA 1QQCA 4CHZA 1IKWA 1MU2A 5CZ1A 3ZT4A 2NUBA 1U45A 1EX4A 3KKRA 3KJVA 3UIQA 3QEPA 4M3ZA 4F8RA 5HLFA 2DTUA 1RCHA 1DLOA 4CFBA 1G15A 4FLYA 1QHTA 2ZE2A 3U6FA 3K57A 3RMBA 1U48A 3KLHA 4LH4A 4EP4A 3OS0A 3OYFA 3NGIA 4B9SA 3DI6A 5HRPA 1RDBA 5HROA 4OPKA 1XWLA 3QNOA 4KI4A 4CEBA 4CJSA 3TAPA 1WAFA 4CJ5A 4DS4A 3DRRA 1A5WA 1J54A 1JXBA 2GUIA 3QIPA 3OYGA 4FXDA 2IDOA 3VQQA 4C8OA 3HT3A 4RW4A 3ZSRA 5HRNA 1RBVA 4E7KA 1U47A 3D45A 1NK6A 3KD5E 1WSGA 1L3UA 1ZYQA 4DU4A 3NH1A 3ULDA 1IG9A 4F2SA 3NDKA 4M3UA 2QK9A 4Z4HA 4YFUA 2VWKA 2QKKA 4CJLA 3CFRA 3NH0A 3P83D 1S1XA 3AV9A 4OKJA 3VN5A 3HK2A 1FKOA 2W42A 4N5SA 1ASWA 5DK5A 1RT6A 4W5RA 4DTPA 3ZSOA 3LALA 1XC9A 3VQDA 1BCOA 4GW6A 4LH5A 4RW7A 1WSIA 4DMNA 2G8HA 4M42A 3O4QA 4CFDA 4JS5A 3O3FA 4KREA 4AILC 3VQAA 4G1QA 4C8LA 1NJYA 5C42A 3I0RA 1JLFA 3T3FA 2HMIA 5J2NA 4OLBA 5FROA 2RKIA 3VQ8A 1WSHA 3KK1A 3L2WA 4BDPA 3L3UA 1ITGA 3PO5A 4KB1A 3K5OA 1TGOA 4CECA 2R7YA 3SQ2A 3RR8A 3TAQA 3K2PA 4H8KA 3CFOA 3TR8A 3F9KA 4FLUA 1CXUA 1ASVA 3RTVA 4QOZB 1LW2A 4RW9A 3L2RA 4DSLA 1SV5A 1VSEA 1VSLA 1ASUA 4CF8A 4ELTA 2YNIA 4C8NA 4N56A 1BGXT 3VQ9A 3ASMA 3P5JA 3OYJA 3V6DA 5I42A 1NK8A 2OZSA 4EZ6A 1L3TA 3TANA 1Y97A 3OYMA 3H08A 3RWUA 3HXMA 3ITHA 4DTMA 3V4IA 4FJLA 4Y1CA 3AVBA 3DYAA 1SUQA 2RPIA 3VQCA 4CJQA 4K8XA 1VSHA 3ZCMA 1UWBA 4CF2A 4FYDA 4KFBA 3RRGA 4C8MA 4N41A 3AO3A 5E41A 4FJ7A 1Q8IA 4H4MA 3IAYA 1VSKA 1IO2A 1B9DA 3PX0A 4HUGA 4DTRA 1S6QA 5J2MA 4FLTA 1VRUA 4KPYA 1J53A 1S1UA 4CHPA 3HSTB 1U04A 5C25A 4DLGA 2FBXA 3L3VA 4E7HA 3LDSA 1R0AA 4FJJA 2KTQA 3ZT2A 1WNSA 3A2FA 3O4NA 4FVMA 1EKEA 2IOCA 2XY7A 1VSMA 4IG3A 1GOCA 5CZ2A 3NGZA 3HL8A 4W5NA 1BL3A 2HB5A 3QEIA 3TI0A 2P1JA 4OPJA 3KK3A 2G8UA 1L3VA 2OYQA 3KIOA 2G8IA 2G8KA 4AH9A 3SV4A 1YT3A 1XI1A 3WNHA 4E7IA 2E4LA 3CM5A 3M8RA 4Z4EA 3WNGA 3C6TA 1FKPA 3ZSQA 3NAEA 3QLHA 1QSYA 2OPQA 2X6NA 4DTSA 1Q9YA 3TAFA 2YKMA 3DLRA 3AVJA 3RR7A 3DLGA 3SUPA 4QCLA 1A5XA 1SKSA 2QKBA 4I7FA 3KD1E 1BI4A 1JLAA 4OGCA 4E19A 1X9SA 2BANA 4PA1A 2RF2A 4KAZA 4CJRA 1KFSA 1CZ9A 5SWMA 1YTAA 1NJZA 3SV3A 1RT4A 4FJ9A 1FK9A 1VSDA 4CHQA 1D8YA 4CE9A 5T7BA 4Z4IA 1F21A 2XY8A 1GOBA 2D0BA 3HPGA 3OYBA 5CYQA 1U4BA 4J2DA 4FK0A 1XHZA 3IG1A 2EX3A 3SCXA 1JLBA 2Z1HA 3QIOA 3MEEA 3SPYA 3SNNA 3NF8A 4FM0A 2FBYA 3VQ7A 1LAWA 5K14A 1YVUA 4LD0A 2VG6A 4FJ8A 3HJFA 4B08A 4JRPA 3QEVA 3AVNA 4DTOA 4DQSA 4IBNA 1DTQA 1HNIA 4B8CA 1UAXA 1HYVA 4Y1DA 1RILA 4CJEA 4OLAA 5JS1A 2YV0X 1S1TA 2XRIA 4DS5A 4PY5A 4KRFA 2HHXA 1HQUA 3HP9A 3S3NA 2GV9A 3ISNC 1TK8A 4B9MA 2A1SA 3KKSA 4CEQA 2KFZA 3VQ4A 1CLQA 2IS3A 4CF9A 4CHNA 2HVHA 3PO4A 1RT2A 3D0PA 4I2PA 3AO1A 1C0UA 1S6PA 3OYEA 3EZ5A 4CJWA 4DQRA 4M3XA 2HW3A 4CEFA 4GVMA 1NKCA 3TAGA 1WSEA 2Z1JA 1C0TA 3OYDA 2YNGA 4IFVA 4Z4CA 3L2QA 3AO4A 2FBTA 2KZZA 1TL1A 1TAUA 3AVFA 5CYMA 5EU7A 4F2RA 3ZSWA 1C0MA 2X6SA 3NGYA 1IKVA 3K5LA 4ID1A 3KLIA 2KQ2A 1LW0A 1WSJA 4CGJA 1LWFA 2BGGA 1NK5A 4OVLA 3OS2A 2YKNA 1TL3A 1U49A 3O3GA 1K6YA 1RBRA 3M8QA 4C8KA 3TWHA 3SJJA 4AHTA 1T8EA 2B5JA 4CIGA 2GBZA 4L8RB 4CEZA 2IAJA 2VG7A 4KO0A 3HVTA 3TAMA 3WNEA 4E89A 5KTQA 1N5YA 3DRSA 4CGDA 4N76A 4UQGA 3OYKA 1S5JA 2JGUA 1X1PA 4PWDA 1HNVA 1BISA 3B6OA 2YHAA 4HUFA 5HP1A 4EZ9A 1TV6A 2B4JA 4CF0A 4CGHA 3DOLA 4CHOA 3V9ZA 1QS4A 4DQPA 3NHGA 4CGIA 1Z25A 3SQ4A 3AA2A 4KV8A 3RRHA 4B8AB 1RBTA 4CESA 3VQ5A 5KRSA 4FLXA 4FJNA 4ELVA 2ITGA 5C24A 1KLMA 3I8DA 2PY5A 4HTUA 1TK0A 1REVA 3ALYA 3QEXA 2G8FA 2HHSA 2BDPA 1RT1A 1TVRA 3OYAA 1NOYA 4FZXC 4K8ZA 1XHXA 3LAKA 3VQPA 4CCHA 1DTTA 2FC0A 3KK2A 4CJTA 3FFIA 4J2BA 4CJ4A 4DSIA 2HNZA 3DOKA 1C1BA 3V9WA 4OGEA 3PX6A 4B3OA 2F96A 1D5AA 1NKEA 3EY1A 4CJUA 4Z4GA 2HHTA 1JLGA 1LWCA 4ICLA 4DU3A 1D9DA 3LZJA 4KHSA 1RDCA 4FM2A 3S9HA 2DFHA 2D5RA 4FZYA 4RW8A 1HQEA 4FLWA 3DLKA 4CGFA 3OYLA 3S3MA 1ZBIA 1HRHA 1O1WA 4KHYA 3C95A 4DU1A 3AVKA 2Z1IA 1RBSA 3SZ2A 2OZMA 4M41A 1TKTA 2DFFA 3QO9A 4CJPA 4E0DA 2F8TA 3P1GA 1VRTA 1JL2A 5HRSA 4XIUA 4JLHA 4BDYA 4W5OA 3L2VA 4KI6A 5D3GA 2HVIA 2XY6A 4CJKA 4GMJB 1RTDA 1JLQA 4CIFA 2VWJA 4Z4FA 2DY4A 5I3UA 2XY5A 3DMJA 4M3RA 3SUOA 4KHUA 3T19A 4E1MA 3V9XA 4BWMA 4E7LA 3DRPA 2OA8A 4PQUA 3PX4A 4DLEA 1LWEA 1QSLA 4OKEA 4JRQA 1B92A 3OYCA 3S3OA 3K59A 2KW4A 2FBVA 5HBMA 1YTUA 2KFNA 3LWLA 4EP5A 4FJHA 1JXEA 1J9AA 2ATQA 3MEDA 4NYNA 4CK3A 1RTJA 2Q3SA 3MEGA 5SZTA 3SPZA 4HVJA 5FDLA 3QESA 1HJRA 1ZBFA 3V9SA 1I3AA 4LSNA 2HHQA 1C1AA 3AA4A 1C6VA 5CY4A 3M8PA 4CK1A 5J2QA 2WOMA 4NCGA 3VQBA 3AVLA 3OJSA 2G8WA 1ZBHA 4DQQA 2X78A 2D0CA 1BHLA 4JS4A 4AHRA 2YNFA 3HPOA 1J5OA 3MECA 3OVNA 4FJXA 3BGRA 1HMVA 3MXMA 2A1RA 1BI4B 2P5GA 2AJQA 3AVMA 1WSFA 4CJ3A 2LSNA 4AHVA 4WE1A 3AVGA 4DG1A 4E7JA 1NK9A 4Z0UA 3ZSXA 3TABA 4CEEA 1SKWA 4M3YA 3HM9A 4I9LA 1TKDA 2B6AA 3AO5A 3NCIA 4ZTJA 1C1CA 3HO1A 4W5TA 2HHUA 1W9HA 4CERA 1KFDA 4DQIA 1LAVA 2Y1JA 3QINA 4I2QA 3LP2A 2PYJA 3LANA 3LPTA 1S1WA 3AVAA 3NBPA 3NF6A 1TK5A 2HNYA 4RW6A 3SQ0A 3QERA 1UA0A 3QNNA 4O4GA 1SL1A 1UOCA 3AVCA 4DF8A 1Q9XA 3VA3A 4F4KA 4IKFA 4FLZA 2EHGA 4CK2A 3U3GA 3RMAA 4KKOA 4NCAA 2RN2A 3K5MA 3CQ8A 4BACA 3THVA 1UA1A 3PY8A 2O4GA 3G10A 4OKKA 3DM2A 4KHWA 1RTIA 4DTNA 1BIUA 4AHCA 1T05A 1QE1A 4CJFA 4MQ3A 5DMRA 3VQ6A 4NYFA 4W5QA 3HP6A 4DSKA 4FZZA 3ZT1A 3LZIA 2PYLA 4CFAA 3O3HA 2G8VA 3TARA 4F3TA 2IGIA 4TSXA 4M45A 4DFPA 1L5UA 3LPUA 3DLEA 3MAQA 4BE2A 4ZTFA 1S9GA 4KTWA 3OYIA 4DTXA 3NF9A 2F8SA 3KLFA 2ZQBA 3V1OA 4FW2A 4O44A 1Z26A 2WONA 3V81A 1JKHA 1NKBA 4CEDA 3DLBA 4B9NA 1S9EA 4NCBA 3CYMA 4CHYA 1IKYA 2X74A 3HPHA 2IC3A 1NJXA 3OS1A 4FM1A 3PUFA 1BQMA 1KTQA 1RT3A 2O4IA 3AVHA 1IKXA 4AHUA 3OYHA 4LSLA 2HHWA 4RG8A 3T1AA 1KSPA 2P5OA 4DWIA 1EXQA 1FXXA 3SI6A 2YHBA 4BWJA 3LWMA 1NJWA 3AA3A 3C94A 1RBUA 3ZSVA 1L3SA 4CGGA 4ELUA 3I0SA 3B6PA 3LAMA 4IFYA 1VSJA 4H4OA 4YNQA 1NOZA 4FW1A 3KTQA 4N47A 4HHTA 3MXIA 2HHVA 5KI6A 2DFEA 2BE2A 4FJMA 2PZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSF A;  1S1V A;  3LP0 A;  4CEA A;  4DFJ A;  3SYZ A;  1JLE A;  3U3Y A;  3HYF A;  4FK4 A;  4B9L A;  4FJI A;  4O0J A;  3SQ1 A;  1KLN A;  1NK4 A;  4KB0 A;  2Y1I A;  2I5J A;  4BE0 A;  3EYZ A;  1BQN A;  2XO7 A;  2YNH A;  3BDP A;  5KGW A;  1W0H A;  2D0A A;  1KCF A;  1X9W A;  1A5V A;  1LV5 A;  3NH2 A;  1HYZ A;  3QET A;  4HCB A;  4PUO A;  4E1N A;  4HUE A;  4FK2 A;  4M3W A;  4CF1 A;  1I39 A;  4IDK A;  3NE6 A;  4KTQ A;  1WAJ A;  4OJR A;  5J2P A;  3SUQ A;  4FJ5 A;  1ZBU A;  4CIE A;  3AVI A;  4FCY A;  5HRR A;  1CZB A;  1GOA A;  4QAG A;  1EP4 A;  1TKZ A;  5FRM A;  2OPP A;  3LP3 A;  1SL0 A;  5FRN A;  3MXJ A;  1HYS A;  1TAQ A;  2OPS A;  3E01 A;  4FLV A;  4DSE A;  3TAE A;  3F73 A;  1RDA A;  3JYT A;  3WNF A;  4CEO A;  3V1Q A;  1RNH A;  3OJU A;  4DSF A;  3SUN A;  3OY9 A;  3RMD A;  2P51 A;  3K58 A;  4FJK A;  2VG5 A;  4MFB A;  1WN7 A;  4IG0 A;  4E3S A;  1TKX A;  3AO2 A;  2QXF A;  1D9F A;  3KLG A;  4FJG A;  1RT7 A;  4KTZ A;  1CXQ A;  4KHN A;  4I9Q A;  1QSS A;  5KRT A;  1KVC A;  1VSI A;  3ZT0 A;  4CJV A;  3CM6 A;  2ETJ A;  4Q0B A;  1JL1 A;  3LP1 A;  2OPR A;  4DF4 A;  1N6Q A;  4CFC A;  1EET A;  4BDZ A;  4ZHR A;  2XHB A;  2ZD1 A;  4B9V A;  4M3T A;  3HVR A;  3C6U A;  1T03 A;  3PV8 A;  3JSM A;  1QTM A;  2Z1G A;  4F3O A;  4KHQ A;  4O55 A;  2HND A;  4O0I A;  4B9T A;  3AA5 X;  4HCC A;  1RT5 A;  1RTH A;  3NF7 A;  3VQE A;  1RDD A;  4ID5 A;  5JS2 A;  3ZSZ A;  3ZT3 A;  4O5B A;  5KGX A;  1KRP A;  2E6L A;  3KLE A;  1NK7 A;  1BIZ A;  1JLC A;  4Q5V A;  3RMC A;  2JLE A;  1NK0 A;  2E6M A;  3NFA A;  5J1E A;  3L2U A;  4BE1 A;  3V9U A;  1B9F A;  1HPZ A;  1VK0 A;  3G0Z A;  4DTJ A;  3M8S A;  3CG7 A;  3V1R A;  3IS9 A;  4DFK A;  3OYN A;  1WLJ A;  4R5P A;  3IRX A;  1SKR A;  4LY7 A;  1X9M A;  4DFM A;  2KZM A;  3L8B A;  3CFP A;  1KVA A;  4DSJ A;  4J2A A;  4DTU A;  3VA0 A;  1ZBL A;  3QEW A;  3K5N A;  1BCM A;  1SL2 A;  1IH7 A;  1KVB A;  3ZSY A;  3DLH A;  4J2E A;  4B9U A;  1T7P A;  4AHS A;  1QQC A;  4CHZ A;  1IKW A;  1MU2 A;  5CZ1 A;  3ZT4 A;  2NUB A;  1U45 A;  1EX4 A;  3KKR A;  3KJV A;  3UIQ A;  3QEP A;  4M3Z A;  4F8R A;  5HLF A;  2DTU A;  1RCH A;  1DLO A;  4CFB A;  1G15 A;  4FLY A;  1QHT A;  2ZE2 A;  3U6F A;  3K57 A;  3RMB A;  1U48 A;  3KLH A;  4LH4 A;  4EP4 A;  3OS0 A;  3OYF A;  3NGI A;  4B9S A;  3DI6 A;  5HRP A;  1RDB A;  5HRO A;  4OPK A;  1XWL A;  3QNO A;  4KI4 A;  4CEB A;  4CJS A;  3TAP A;  1WAF A;  4CJ5 A;  4DS4 A;  3DRR A;  1A5W A;  1J54 A;  1JXB A;  2GUI A;  3QIP A;  3OYG A;  4FXD A;  2IDO A;  3VQQ A;  4C8O A;  3HT3 A;  4RW4 A;  3ZSR A;  5HRN A;  1RBV A;  4E7K A;  1U47 A;  3D45 A;  1NK6 A;  3KD5 E;  1WSG A;  1L3U A;  1ZYQ A;  4DU4 A;  3NH1 A;  3ULD A;  1IG9 A;  4F2S A;  3NDK A;  4M3U A;  2QK9 A;  4Z4H A;  4YFU A;  2VWK A;  2QKK A;  4CJL A;  3CFR A;  3NH0 A;  3P83 D;  1S1X A;  3AV9 A;  4OKJ A;  3VN5 A;  3HK2 A;  1FKO A;  2W42 A;  4N5S A;  1ASW A;  5DK5 A;  1RT6 A;  4W5R A;  4DTP A;  3ZSO A;  3LAL A;  1XC9 A;  3VQD A;  1BCO A;  4GW6 A;  4LH5 A;  4RW7 A;  1WSI A;  4DMN A;  2G8H A;  4M42 A;  3O4Q A;  4CFD A;  4JS5 A;  3O3F A;  4KRE A;  4AIL C;  3VQA A;  4G1Q A;  4C8L A;  1NJY A;  5C42 A;  3I0R A;  1JLF A;  3T3F A;  2HMI A;  5J2N A;  4OLB A;  5FRO A;  2RKI A;  3VQ8 A;  1WSH A;  3KK1 A;  3L2W A;  4BDP A;  3L3U A;  1ITG A;  3PO5 A;  4KB1 A;  3K5O A;  1TGO A;  4CEC A;  2R7Y A;  3SQ2 A;  3RR8 A;  3TAQ A;  3K2P A;  4H8K A;  3CFO A;  3TR8 A;  3F9K A;  4FLU A;  1CXU A;  1ASV A;  3RTV A;  4QOZ B;  1LW2 A;  4RW9 A;  3L2R A;  4DSL A;  1SV5 A;  1VSE A;  1VSL A;  1ASU A;  4CF8 A;  4ELT A;  2YNI A;  4C8N A;  4N56 A;  1BGX T;  3VQ9 A;  3ASM A;  3P5J A;  3OYJ A;  3V6D A;  5I42 A;  1NK8 A;  2OZS A;  4EZ6 A;  1L3T A;  3TAN A;  1Y97 A;  3OYM A;  3H08 A;  3RWU A;  3HXM A;  3ITH A;  4DTM A;  3V4I A;  4FJL A;  4Y1C A;  3AVB A;  3DYA A;  1SUQ A;  2RPI A;  3VQC A;  4CJQ A;  4K8X A;  1VSH A;  3ZCM A;  1UWB A;  4CF2 A;  4FYD A;  4KFB A;  3RRG A;  4C8M A;  4N41 A;  3AO3 A;  5E41 A;  4FJ7 A;  1Q8I A;  4H4M A;  3IAY A;  1VSK A;  1IO2 A;  1B9D A;  3PX0 A;  4HUG A;  4DTR A;  1S6Q A;  5J2M A;  4FLT A;  1VRU A;  4KPY A;  1J53 A;  1S1U A;  4CHP A;  3HST B;  1U04 A;  5C25 A;  4DLG A;  2FBX A;  3L3V A;  4E7H A;  3LDS A;  1R0A A;  4FJJ A;  2KTQ A;  3ZT2 A;  1WNS A;  3A2F A;  3O4N A;  4FVM A;  1EKE A;  2IOC A;  2XY7 A;  1VSM A;  4IG3 A;  1GOC A;  5CZ2 A;  3NGZ A;  3HL8 A;  4W5N A;  1BL3 A;  2HB5 A;  3QEI A;  3TI0 A;  2P1J A;  4OPJ A;  3KK3 A;  2G8U A;  1L3V A;  2OYQ A;  3KIO A;  2G8I A;  2G8K A;  4AH9 A;  3SV4 A;  1YT3 A;  1XI1 A;  3WNH A;  4E7I A;  2E4L A;  3CM5 A;  3M8R A;  4Z4E A;  3WNG A;  3C6T A;  1FKP A;  3ZSQ A;  3NAE A;  3QLH A;  1QSY A;  2OPQ A;  2X6N A;  4DTS A;  1Q9Y A;  3TAF A;  2YKM A;  3DLR A;  3AVJ A;  3RR7 A;  3DLG A;  3SUP A;  4QCL A;  1A5X A;  1SKS A;  2QKB A;  4I7F A;  3KD1 E;  1BI4 A;  1JLA A;  4OGC A;  4E19 A;  1X9S A;  2BAN A;  4PA1 A;  2RF2 A;  4KAZ A;  4CJR A;  1KFS A;  1CZ9 A;  5SWM A;  1YTA A;  1NJZ A;  3SV3 A;  1RT4 A;  4FJ9 A;  1FK9 A;  1VSD A;  4CHQ A;  1D8Y A;  4CE9 A;  5T7B A;  4Z4I A;  1F21 A;  2XY8 A;  1GOB A;  2D0B A;  3HPG A;  3OYB A;  5CYQ A;  1U4B A;  4J2D A;  4FK0 A;  1XHZ A;  3IG1 A;  2EX3 A;  3SCX A;  1JLB A;  2Z1H A;  3QIO A;  3MEE A;  3SPY A;  3SNN A;  3NF8 A;  4FM0 A;  2FBY A;  3VQ7 A;  1LAW A;  5K14 A;  1YVU A;  4LD0 A;  2VG6 A;  4FJ8 A;  3HJF A;  4B08 A;  4JRP A;  3QEV A;  3AVN A;  4DTO A;  4DQS A;  4IBN A;  1DTQ A;  1HNI A;  4B8C A;  1UAX A;  1HYV A;  4Y1D A;  1RIL A;  4CJE A;  4OLA A;  5JS1 A;  2YV0 X;  1S1T A;  2XRI A;  4DS5 A;  4PY5 A;  4KRF A;  2HHX A;  1HQU A;  3HP9 A;  3S3N A;  2GV9 A;  3ISN C;  1TK8 A;  4B9M A;  2A1S A;  3KKS A;  4CEQ A;  2KFZ A;  3VQ4 A;  1CLQ A;  2IS3 A;  4CF9 A;  4CHN A;  2HVH A;  3PO4 A;  1RT2 A;  3D0P A;  4I2P A;  3AO1 A;  1C0U A;  1S6P A;  3OYE A;  3EZ5 A;  4CJW A;  4DQR A;  4M3X A;  2HW3 A;  4CEF A;  4GVM A;  1NKC A;  3TAG A;  1WSE A;  2Z1J A;  1C0T A;  3OYD A;  2YNG A;  4IFV A;  4Z4C A;  3L2Q A;  3AO4 A;  2FBT A;  2KZZ A;  1TL1 A;  1TAU A;  3AVF A;  5CYM A;  5EU7 A;  4F2R A;  3ZSW A;  1C0M A;  2X6S A;  3NGY A;  1IKV A;  3K5L A;  4ID1 A;  3KLI A;  2KQ2 A;  1LW0 A;  1WSJ A;  4CGJ A;  1LWF A;  2BGG A;  1NK5 A;  4OVL A;  3OS2 A;  2YKN A;  1TL3 A;  1U49 A;  3O3G A;  1K6Y A;  1RBR A;  3M8Q A;  4C8K A;  3TWH A;  3SJJ A;  4AHT A;  1T8E A;  2B5J A;  4CIG A;  2GBZ A;  4L8R B;  4CEZ A;  2IAJ A;  2VG7 A;  4KO0 A;  3HVT A;  3TAM A;  3WNE A;  4E89 A;  5KTQ A;  1N5Y A;  3DRS A;  4CGD A;  4N76 A;  4UQG A;  3OYK A;  1S5J A;  2JGU A;  1X1P A;  4PWD A;  1HNV A;  1BIS A;  3B6O A;  2YHA A;  4HUF A;  5HP1 A;  4EZ9 A;  1TV6 A;  2B4J A;  4CF0 A;  4CGH A;  3DOL A;  4CHO A;  3V9Z A;  1QS4 A;  4DQP A;  3NHG A;  4CGI A;  1Z25 A;  3SQ4 A;  3AA2 A;  4KV8 A;  3RRH A;  4B8A B;  1RBT A;  4CES A;  3VQ5 A;  5KRS A;  4FLX A;  4FJN A;  4ELV A;  2ITG A;  5C24 A;  1KLM A;  3I8D A;  2PY5 A;  4HTU A;  1TK0 A;  1REV A;  3ALY A;  3QEX A;  2G8F A;  2HHS A;  2BDP A;  1RT1 A;  1TVR A;  3OYA A;  1NOY A;  4FZX C;  4K8Z A;  1XHX A;  3LAK A;  3VQP A;  4CCH A;  1DTT A;  2FC0 A;  3KK2 A;  4CJT A;  3FFI A;  4J2B A;  4CJ4 A;  4DSI A;  2HNZ A;  3DOK A;  1C1B A;  3V9W A;  4OGE A;  3PX6 A;  4B3O A;  2F96 A;  1D5A A;  1NKE A;  3EY1 A;  4CJU A;  4Z4G A;  2HHT A;  1JLG A;  1LWC A;  4ICL A;  4DU3 A;  1D9D A;  3LZJ A;  4KHS A;  1RDC A;  4FM2 A;  3S9H A;  2DFH A;  2D5R A;  4FZY A;  4RW8 A;  1HQE A;  4FLW A;  3DLK A;  4CGF A;  3OYL A;  3S3M A;  1ZBI A;  1HRH A;  1O1W A;  4KHY A;  3C95 A;  4DU1 A;  3AVK A;  2Z1I A;  1RBS A;  3SZ2 A;  2OZM A;  4M41 A;  1TKT A;  2DFF A;  3QO9 A;  4CJP A;  4E0D A;  2F8T A;  3P1G A;  1VRT A;  1JL2 A;  5HRS A;  4XIU A;  4JLH A;  4BDY A;  4W5O A;  3L2V A;  4KI6 A;  5D3G A;  2HVI A;  2XY6 A;  4CJK A;  4GMJ B;  1RTD A;  1JLQ A;  4CIF A;  2VWJ A;  4Z4F A;  2DY4 A;  5I3U A;  2XY5 A;  3DMJ A;  4M3R A;  3SUO A;  4KHU A;  3T19 A;  4E1M A;  3V9X A;  4BWM A;  4E7L A;  3DRP A;  2OA8 A;  4PQU A;  3PX4 A;  4DLE A;  1LWE A;  1QSL A;  4OKE A;  4JRQ A;  1B92 A;  3OYC A;  3S3O A;  3K59 A;  2KW4 A;  2FBV A;  5HBM A;  1YTU A;  2KFN A;  3LWL A;  4EP5 A;  4FJH A;  1JXE A;  1J9A A;  2ATQ A;  3MED A;  4NYN A;  4CK3 A;  1RTJ A;  2Q3S A;  3MEG A;  5SZT A;  3SPZ A;  4HVJ A;  5FDL A;  3QES A;  1HJR A;  1ZBF A;  3V9S A;  1I3A A;  4LSN A;  2HHQ A;  1C1A A;  3AA4 A;  1C6V A;  5CY4 A;  3M8P A;  4CK1 A;  5J2Q A;  2WOM A;  4NCG A;  3VQB A;  3AVL A;  3OJS A;  2G8W A;  1ZBH A;  4DQQ A;  2X78 A;  2D0C A;  1BHL A;  4JS4 A;  4AHR A;  2YNF A;  3HPO A;  1J5O A;  3MEC A;  3OVN A;  4FJX A;  3BGR A;  1HMV A;  3MXM A;  2A1R A;  1BI4 B;  2P5G A;  2AJQ A;  3AVM A;  1WSF A;  4CJ3 A;  2LSN A;  4AHV A;  4WE1 A;  3AVG A;  4DG1 A;  4E7J A;  1NK9 A;  4Z0U A;  3ZSX A;  3TAB A;  4CEE A;  1SKW A;  4M3Y A;  3HM9 A;  4I9L A;  1TKD A;  2B6A A;  3AO5 A;  3NCI A;  4ZTJ A;  1C1C A;  3HO1 A;  4W5T A;  2HHU A;  1W9H A;  4CER A;  1KFD A;  4DQI A;  1LAV A;  2Y1J A;  3QIN A;  4I2Q A;  3LP2 A;  2PYJ A;  3LAN A;  3LPT A;  1S1W A;  3AVA A;  3NBP A;  3NF6 A;  1TK5 A;  2HNY A;  4RW6 A;  3SQ0 A;  3QER A;  1UA0 A;  3QNN A;  4O4G A;  1SL1 A;  1UOC A;  3AVC A;  4DF8 A;  1Q9X A;  3VA3 A;  4F4K A;  4IKF A;  4FLZ A;  2EHG A;  4CK2 A;  3U3G A;  3RMA A;  4KKO A;  4NCA A;  2RN2 A;  3K5M A;  3CQ8 A;  4BAC A;  3THV A;  1UA1 A;  3PY8 A;  2O4G A;  3G10 A;  4OKK A;  3DM2 A;  4KHW A;  1RTI A;  4DTN A;  1BIU A;  4AHC A;  1T05 A;  1QE1 A;  4CJF A;  4MQ3 A;  5DMR A;  3VQ6 A;  4NYF A;  4W5Q A;  3HP6 A;  4DSK A;  4FZZ A;  3ZT1 A;  3LZI A;  2PYL A;  4CFA A;  3O3H A;  2G8V A;  3TAR A;  4F3T A;  2IGI A;  4TSX A;  4M45 A;  4DFP A;  1L5U A;  3LPU A;  3DLE A;  3MAQ A;  4BE2 A;  4ZTF A;  1S9G A;  4KTW A;  3OYI A;  4DTX A;  3NF9 A;  2F8S A;  3KLF A;  2ZQB A;  3V1O A;  4FW2 A;  4O44 A;  1Z26 A;  2WON A;  3V81 A;  1JKH A;  1NKB A;  4CED A;  3DLB A;  4B9N A;  1S9E A;  4NCB A;  3CYM A;  4CHY A;  1IKY A;  2X74 A;  3HPH A;  2IC3 A;  1NJX A;  3OS1 A;  4FM1 A;  3PUF A;  1BQM A;  1KTQ A;  1RT3 A;  2O4I A;  3AVH A;  1IKX A;  4AHU A;  3OYH A;  4LSL A;  2HHW A;  4RG8 A;  3T1A A;  1KSP A;  2P5O A;  4DWI A;  1EXQ A;  1FXX A;  3SI6 A;  2YHB A;  4BWJ A;  3LWM A;  1NJW A;  3AA3 A;  3C94 A;  1RBU A;  3ZSV A;  1L3S A;  4CGG A;  4ELU A;  3I0S A;  3B6P A;  3LAM A;  4IFY A;  1VSJ A;  4H4O A;  4YNQ A;  1NOZ A;  4FW1 A;  3KTQ A;  4N47 A;  4HHT A;  3MXI A;  2HHV A;  5KI6 A;  2DFE A;  2BE2 A;  4FJM A;  2PZS A; 
#chains in the Genus database with same CATH topology
 1VSF A;  1JLE A;  4FK4 A;  3HYF A;  3SQ1 A;  2I5J A;  5AQS A;  1BQN A;  3EYZ A;  5LMN K;  1W0H A;  3GBT A;  1KCF A;  1A5V A;  2O8F B;  5EOY A;  4HCB A;  3VGL A;  1I39 A;  2ZM6 K;  3J7Y P;  4FJ5 A;  5TKY A;  3AVI A;  3CJA A;  1IBM K;  5AQF A;  5FRN A;  1BA1 A;  3TAE A;  2OPS A;  4FLV A;  3F73 A;  3TPQ A;  1RDA A;  3WNF A;  3D2F A;  3V1Q A;  4DSF A;  3RMD A;  2P51 A;  4GV6 A;  1BUP A;  2VG5 A;  4MFB A;  3AO2 A;  1CXQ A;  2E8A A;  5M1K A;  2D4W A;  5KRT A;  5JMV A;  4WCE L;  2VGM A;  1N6Q A;  4JV5 K;  4ZHR A;  3PLA A;  2UXD K;  1QTM A;  2ITM A;  4O0I A;  3O5B A;  2HHH K;  4B9T A;  1RT5 A;  1RTH A;  4OX9 K;  2E6L A;  3TTD A;  3ZYY X;  3KLE A;  1NK7 A;  1JLC A;  4IOA L;  1NK0 A;  2E6M A;  4JKG A;  4BRO A;  3V9U A;  1HPZ A;  4JI8 K;  1LOT B;  3M8S A;  3FR0 A;  3V1R A;  2CH6 A;  1KVA A;  2UYT A;  4DTU A;  4DR7 K;  3QEW A;  3K5N A;  1NG9 A;  1SL2 A;  4DV5 K;  2NUB A;  3CET A;  4M3Z A;  5HLF A;  5C2D A;  1RCH A;  3L0Q A;  3U6F A;  4DR2 K;  3EEQ A;  1QHT A;  2ZE2 A;  4PUO A;  2AA4 A;  4LH4 A;  4B9S A;  4JNE A;  3DI6 A;  3O9T A;  1RFQ A;  1XWL A;  4KI4 A;  2D0P A;  4CJ5 A;  4DS4 A;  3LM2 A;  2YJE A;  3U4L A;  4FXD A;  2IDO A;  4C8O A;  2NZT A;  3HT3 A;  3ZSR A;  5HRN A;  4DV0 K;  3D45 A;  4DWI A;  1L3U A;  1IG9 A;  3O9Q A;  4DU4 A;  3NH1 A;  3ULD A;  4M3U A;  4YFU A;  2VWK A;  3WXM B;  4B1V A;  2QWR A;  4OKJ A;  3G4S N;  4JI4 K;  5DK5 A;  4W5R A;  3BF3 A;  1XC9 A;  3MX5 A;  4LH5 A;  4K42 A;  3TSU A;  4JS5 A;  1YJ9 N;  3DXM B;  4KRE A;  4C8L A;  3VQA A;  5KPT A;  3VEY A;  5J2N A;  5GIO A;  4YDU A;  5FRO A;  4BDP A;  1WSH A;  3KK1 A;  3RR8 A;  4U67 L;  5C10 A;  3SQ2 A;  2YHX A;  3TAQ A;  3K2P A;  1QVF M;  3CFO A;  1YF5 L;  1CXU A;  1ASV A;  1YJW N;  4RW9 A;  4DSL A;  3R6M A;  1VSE A;  2YNI A;  3V6D A;  4IFE A;  3VQ9 A;  3P31 A;  3P5J A;  4KH5 A;  3TAN A;  4FJL A;  4GNI A;  1E4F T;  1VSH A;  2CGL A;  3DAW A;  2VGN A;  4N41 A;  3AO3 A;  1Q8I A;  1K73 O;  3IAY A;  3VET A;  1VSK A;  1B9D A;  5FPM A;  3W0L A;  3OHR A;  1S6Q A;  1VRU A;  3O6W A;  1S1U A;  4CHP A;  3HST B;  1U04 A;  4DLG A;  5AQH A;  1YIJ N;  4FJJ A;  2KTQ A;  2E1Y A;  4H5W A;  1WNS A;  3ZT2 A;  4FVM A;  1EKE A;  4EFH A;  1KAZ A;  2G8I A;  3E9O A;  1X3N A;  2CGK A;  3C0B A;  3CM5 A;  3KVG A;  3WNG A;  4BRD A;  3NAE A;  1QSY A;  2OPQ A;  5AQP A;  2X6N A;  5C15 A;  1Q9Y A;  1VQK N;  2YKM A;  4OPA A;  2OCE A;  2JWK A;  3KD1 E;  1CZA N;  4KAZ A;  2Q31 A;  5SWM A;  2Q1N A;  1YTA A;  3SV3 A;  5BPN A;  4FJ9 A;  4ILH A;  4CE9 A;  5T7B A;  3OYB A;  3HPG A;  5CYQ A;  4JK8 A;  1XHZ A;  3SNN A;  3MEE A;  3SPY A;  1BOT O;  5BPM A;  4FM0 A;  2PFU A;  4LFC K;  1YVU A;  2VG6 A;  3H3O B;  3M5R A;  3Q7B A;  4I6M B;  3IUC A;  4B8C A;  1UAX A;  4CJE A;  4OLA A;  3M3Z A;  5JS1 A;  4CZE A;  3S3N A;  4LFB K;  4M7Y A;  1P8Z A;  2KFZ A;  4DKW A;  3GG4 A;  1VQ9 N;  3D6R A;  3PO4 A;  3GL1 A;  1C0U A;  3EZ5 A;  4CJW A;  2HW3 A;  4CEF A;  1NKC A;  1WSE A;  1VQN N;  4FSV A;  4QS8 A;  4BRA A;  3AO4 A;  2FBT A;  4R79 A;  3KK7 A;  5I9E B;  4AM6 A;  3AVF A;  3WQT A;  3A5N C;  1K8A O;  1DEJ A;  1C0M A;  4DR4 K;  4ID1 A;  2ZF5 O;  1N36 K;  3AGR A;  2BGG A;  1NK5 A;  5LJW A;  3OS2 A;  1RBR A;  5EXW A;  3TWH A;  1JJ2 M;  5ADX A;  4GKK K;  4L8R B;  3HVT A;  3K9K A;  5KTQ A;  2P9S B;  3DRS A;  3OYK A;  4H5N A;  4B9Q A;  4PWD A;  4EZ9 A;  4CF0 A;  3WXK A;  4BVO A;  3NHG A;  2V51 B;  3AA2 A;  4KV8 A;  2VQF K;  1RBT A;  4CES A;  3VQ5 A;  3I33 A;  5KRS A;  4FLX A;  4FJN A;  4ILJ A;  4ELV A;  2PY5 A;  4EHT A;  5BN8 A;  3VEO A;  4HTU A;  3CCE N;  2O8F A;  4XH1 A;  2HHS A;  2BDP A;  2E2N A;  4FPA A;  1HKB A;  4B3T K;  4IEE A;  3O80 A;  1DTT A;  4GY2 B;  5KQ8 A;  3FFI A;  4J2B A;  4DSI A;  3GDQ A;  2HNZ A;  3PX6 A;  4B3O A;  1D5A A;  4ICL A;  5AQQ A;  5MLC Q;  5GIP A;  3H3N O;  1G99 A;  4KBO A;  3OYL A;  1HRH A;  3AVK A;  1RBS A;  4JHD B;  4E0D A;  3P1G A;  1JL2 A;  4XIU A;  3O9S A;  2HVI A;  1RTD A;  2DY4 A;  4KHU A;  4M3R A;  4DV4 K;  4E7L A;  3DRP A;  4PQU A;  1QSL A;  3HBT A;  4OKE A;  3VEZ A;  3S3O A;  2P9U B;  2KW4 A;  4H5T A;  4C1N I;  4NXM K;  2AP1 A;  4EP5 A;  2Q3S A;  3MEG A;  4PKG A;  3F5T A;  4QS7 A;  5GAE P;  4MDB A;  4FVU A;  5KPZ A;  3BZK A;  1HJR A;  3V9S A;  1I3A A;  3FZF A;  1C1A A;  3AA4 A;  4CK1 A;  2WOM A;  3N4Q A;  3VQB A;  4A61 A;  3EKS A;  2UUA K;  1YJN N;  4AHR A;  1NGJ A;  4FJX A;  5EX5 A;  2P5G A;  3AVM A;  5BR8 K;  2LSN A;  4AHV A;  1BA0 A;  3AVG A;  4E7J A;  1NK9 A;  4Z0U A;  3G25 A;  4CEE A;  1SKW A;  3HM9 A;  4I9L A;  2B6A A;  3AO5 A;  3NCI A;  4ZTJ A;  1C1C A;  4DQ8 A;  4JK7 A;  3L4I A;  1KFD A;  1LAV A;  3QIN A;  3LP2 A;  3NBP A;  1TK5 A;  2HNY A;  3QNN A;  4O4G A;  3VA3 A;  4BG8 A;  4BRP A;  3H6E A;  4CK2 A;  2QI2 A;  1KAX A;  4NCA A;  3K5M A;  4BAC A;  1Y64 A;  5LY3 A;  2O4G A;  3IKM A;  4PL7 A;  1KXP A;  1RTI A;  3CHW A;  4FWQ A;  4B1U B;  5JVH L;  1HJO A;  1NGE A;  2I7P A;  3LZI A;  3HSC A;  1ZC6 A;  2IGI A;  4BRN A;  3DXM A;  1L5U A;  3WXJ A;  3LPU A;  2HMP A;  2QWP A;  3C65 A;  4DTX A;  1VQP N;  3KLF A;  3EN9 A;  3E1Y A;  2A3Z A;  3V81 A;  1YVN A;  1HUX A;  3SAG A;  2YHW A;  2IC3 A;  3HPH A;  2NRV A;  4CVN E;  1BQM A;  1KTQ A;  1IKX A;  4B1Z A;  3FZK A;  2P5O A;  4A5B A;  3SI6 A;  1XC3 A;  2YHB A;  4MDA A;  1NJW A;  1RBU A;  3EKU A;  3GOI A;  1VSJ A;  3JS6 A;  4N47 A;  2HHV A;  2DFE A;  5J1E A;  2VQE K;  4CEA A;  3PIO L;  1KLN A;  2YNH A;  4FL9 A;  3BDP A;  5KGW A;  2D0A A;  3BY5 A;  1LV5 A;  4RCH A;  3NH2 A;  4OPH A;  5IWA K;  1NU0 A;  1YI2 N;  3NE6 A;  1WAJ A;  4H0V B;  1ZBU A;  4KH4 A;  3IDH A;  3MX2 A;  1EP4 A;  5FRM A;  3LP3 A;  1HYS A;  3CC7 N;  3JYT A;  5M1P A;  1TYQ B;  1RNH A;  4CZF A;  3OJU A;  3SUN A;  3OY9 A;  2UUC K;  3K58 A;  4IG0 A;  4E3S A;  1TKX A;  4CZK A;  1N32 K;  1VQ5 N;  4KHN A;  4I9Q A;  5AZI B;  4L3Q A;  1KVC A;  1VSI A;  3CJ9 A;  1NGB A;  2OPR A;  3PSF A;  4CFC A;  1WBB A;  3J80 O;  4A62 A;  3HVR A;  3PV8 A;  2W41 A;  3JSM A;  4O55 A;  4BC5 A;  2V52 B;  3VQE A;  3ZX0 A;  4HCC A;  1RDD A;  4ID5 A;  5JS2 A;  4LF4 K;  4I6M A;  4O5B A;  5KGX A;  4NO7 A;  4JKB A;  3RMC A;  2JLE A;  4JKH A;  3NFA A;  4BE1 A;  1HR0 K;  5B8H A;  1VK0 A;  4JKF A;  4DTJ A;  1NM1 A;  4DV6 K;  3BP8 A;  2OAN A;  3IS9 A;  1RDU A;  2A40 A;  4HTL A;  3T1Y K;  3E9P A;  3VF4 A;  2V7Y A;  4MLH A;  3IRX A;  4LY7 A;  1KAY A;  5AQZ A;  3L8B A;  4DB3 A;  2OTJ N;  1BCM A;  3DLH A;  1SQK A;  1T7P A;  1QQC A;  3ZT4 A;  1QZ5 A;  3SBT A;  1U45 A;  1EX4 A;  2FSJ A;  4CI6 A;  3QEP A;  3VMF B;  1P90 A;  2HMI A;  1G15 A;  3RMB A;  3C6H A;  3OYF A;  1RDB A;  4OPK A;  3QNO A;  4CEB A;  5AQG A;  4CJS A;  3F2K A;  1A5W A;  1JCG A;  1J54 A;  1JXB A;  2JWL A;  3QIP A;  4IJA A;  3OYG A;  4DUY K;  1GLC G;  4H5V A;  4JI7 K;  5M1Q A;  4IO9 L;  4E7K A;  3KD5 E;  1ZYQ A;  4E1J A;  2P9S A;  1NGC A;  1NGH A;  3ATV A;  4LC9 B;  3MCA B;  3AV9 A;  2KLA A;  1KQS M;  1FKO A;  4DV7 K;  4KH6 A;  4N5S A;  1ASW A;  3JXU A;  1WUA A;  3N4P A;  5E84 A;  1X9J A;  3BUZ B;  1WSI A;  4DMN A;  4M42 A;  4BRI A;  4CFD A;  4CBU A;  3SAF A;  1J5E K;  4AIL C;  1M1K O;  4BRL A;  1JLF A;  3CPE A;  3T3F A;  4BY9 C;  2VWB A;  3I55 N;  4OLB A;  3VQ8 A;  4KB1 A;  1OVQ A;  3L3U A;  1TGO A;  4H0O A;  2FSK A;  2NLX A;  2ZGY A;  3TR8 A;  3L2R A;  3QBX A;  4B3S K;  4XEI A;  1JCE A;  1C0G A;  1C0F A;  4C8N A;  1BGX T;  3ASM A;  1LCU A;  2OZS A;  3OBW A;  1Y97 A;  3RWU A;  3HXM A;  3ITH A;  3DLL L;  2QEX N;  4JHD A;  2RPI A;  3VQC A;  2WBN A;  3CIP A;  1QQM A;  3ZCM A;  4CF2 A;  4OO1 J;  4KFB A;  4FYD A;  2W40 A;  2CH5 A;  4C8M A;  4JI0 K;  3HRG A;  4H4M A;  3A8Y A;  4KPY A;  1HLU A;  2A41 A;  5C25 A;  2FBX A;  1ILY A;  1IBL K;  2ZWH A;  4KHP K;  3O4N A;  2IOC A;  4BR9 A;  1VSM A;  3KWI A;  1ATR A;  2P9U A;  3H46 O;  2HB5 A;  3QEI A;  1VQO N;  2P1J A;  1L3V A;  2E2P A;  2G8K A;  4AH9 A;  1XI1 A;  3WNH A;  4Z4E A;  3M8R A;  1FKP A;  1K9M O;  4JEP A;  3TAF A;  1KD1 O;  3AVJ A;  4O8K A;  2ZJP L;  3SUP A;  1ATN A;  3QIC A;  4IXC A;  4LFA K;  1JLA A;  5FPE A;  1DKG D;  4O5F A;  5GIN A;  1NGF A;  1D8Y A;  1QQO A;  2D0B A;  1U4B A;  3THY B;  3QFU A;  3SCX A;  3QIO A;  3O1B A;  3NF8 A;  2FBY A;  2P9N B;  3VQ7 A;  3EE8 A;  3J8A A;  5K14 A;  2HF4 A;  3E9L A;  4ISG A;  3NVM A;  1OH8 A;  4CD1 A;  2QA4 N;  2HBJ A;  4JKC A;  1XMQ K;  1T6D A;  1WOQ A;  1RIL A;  3I8B A;  4ILG B;  4M7X A;  3VEN A;  5BR9 A;  1S1T A;  3SMS A;  4DS5 A;  4BQZ A;  4CZI A;  2NRT A;  3HP9 A;  4BRG A;  2GV9 A;  1YHQ N;  4B9M A;  4IOC L;  3KKS A;  1RT2 A;  3D0P A;  2ASM A;  1S6P A;  4GKJ K;  3EE9 A;  1X3M A;  2E20 A;  4NLB A;  3OYE A;  4DQR A;  2WTU A;  3J81 O;  4BQL A;  4GVM A;  3CCQ N;  2Z1J A;  3H45 C;  3OYD A;  2YNG A;  4IFV A;  2KZZ A;  4Z94 A;  3SAH A;  3C6A A;  2NRR A;  4IOX A;  4JD2 B;  2X6S A;  3FLC O;  2Q0R A;  4CGJ A;  1LWF A;  2P9I B;  5FLX O;  2YKN A;  1TL3 A;  1XMO K;  1FW6 A;  2I7N A;  4C8K A;  3SJJ A;  1HNW K;  2GBZ A;  2VG7 A;  4IO8 A;  3ENH A;  2H3G X;  4CGD A;  4LF9 K;  4UQG A;  1S5J A;  2JGU A;  3CJ1 A;  4RWT A;  2ZJQ L;  4HUF A;  1TV6 A;  1GLA G;  1QS4 A;  5HL7 L;  1OVY A;  4DQP A;  2V7Z A;  1W2B M;  3ULE B;  3R9P A;  4JKA A;  2ITG A;  1KLM A;  1TK0 A;  3QEX A;  2F9T A;  1NOY A;  3OYA A;  4K8Z A;  3LAK A;  3KK2 A;  4CJ4 A;  4WYB A;  3V9W A;  4OGE A;  3GE1 A;  4IEI A;  2RHK A;  5BRH A;  2HHT A;  1LWC A;  4DU3 A;  3LZJ A;  4KHS A;  1RDC A;  4BGB A;  1TYQ A;  2D5R A;  4FZY A;  4FWN A;  3PIP L;  3DLK A;  1ZBI A;  3S3M A;  1O1W A;  3UKR B;  3C7N B;  3C95 A;  3S41 A;  5AZI A;  2NRX A;  4BRH A;  4CJP A;  3TU5 A;  1VRT A;  2QW9 A;  1V4T A;  4KI6 A;  4H0T B;  4GMJ B;  4CJK A;  2QWQ A;  4ISE A;  4CIF A;  2VWJ A;  3KHY A;  5I3U A;  3DMJ A;  3SUO A;  4BWM A;  4AM7 A;  3D2E B;  4JRQ A;  2GX9 A;  3OYC A;  4DHY A;  1RTJ A;  3BF1 A;  3LL3 A;  1C6V A;  5CY4 A;  3OJS A;  1ZBS A;  4YOV A;  1BHL A;  4JS4 A;  2YNF A;  1J5O A;  2P9P B;  4PL8 A;  1BI4 B;  4CJ3 A;  2QWM A;  3R1X A;  3AAQ A;  3ZSX A;  2YX6 A;  5CR4 A;  3DWL A;  5CHI A;  3ZEU B;  4W5T A;  5EY4 A;  3OTO K;  4DV3 K;  1MA9 B;  4CER A;  3CCR N;  4DQI A;  2PYJ A;  3LAN A;  3LPT A;  4AF1 A;  3WT0 A;  3LDN A;  2FF3 B;  5AQX A;  3EZW A;  3WEE B;  1Q18 A;  1Q9X A;  4F4K A;  3U3G A;  4KKO A;  1UA1 A;  1NGI A;  3PY8 A;  3WXL A;  3G10 A;  5AJ3 K;  4KHW A;  1QE1 A;  4NYF A;  2O8C A;  4TSX A;  1SZ2 A;  4FWS A;  3MAQ A;  4BE2 A;  1XNR K;  4ZTF A;  2UUB K;  3HM8 A;  3NF9 A;  3T1H K;  2F8S A;  3M6G A;  1S72 N;  3V1O A;  1IV0 A;  4WF9 L;  4FW2 A;  4MO4 A;  1OH7 A;  1NKB A;  1NMD A;  4CED A;  5AQR A;  1S9E A;  3CYM A;  2X74 A;  1BO5 O;  2F9W A;  3B8A X;  5AQO A;  3PUF A;  3CF5 L;  2P9L B;  4AHU A;  4LSL A;  4RG8 A;  2GEL A;  2IVP A;  3CMA N;  1U2V B;  4BWJ A;  3AA3 A;  1L3S A;  4CGG A;  2UU9 K;  4FWO A;  5AFU A;  4FW1 A;  3ZX2 A;  4HHT A;  3MXI A;  2BE2 A;  4FJM A;  3LP0 A;  1S1V A;  4DFJ A;  3SYZ A;  3U3Y A;  2W6K A;  4O0J A;  1NK4 A;  4EHU A;  2O8B B;  5BPL A;  3DJC A;  2XO7 A;  4WFA L;  3J7A P;  4H0X B;  4ISF A;  1X9W A;  3CC2 N;  4GV9 A;  2KKZ A;  4NXN K;  4FK2 A;  4PHT X;  4KTQ A;  4IDH A;  4OJR A;  5J2P A;  3SUQ A;  5BRD A;  4CIE A;  3NVK A;  4K43 A;  3L6Q A;  1CZB A;  3QBW A;  2Q97 A;  1TKZ A;  3ZET B;  4DSE A;  2IIR A;  3G6E N;  3Q7C A;  1YIT N;  4BC4 A;  1VHX A;  1WN7 A;  3ID8 A;  2QXF A;  1T6C A;  1D9F A;  4FJG A;  1RT7 A;  4KTZ A;  3QML A;  3VTH A;  4FOI A;  4CBX A;  4CJV A;  2ETJ A;  5FPN A;  3LP1 A;  3THY A;  1EET A;  2P9K B;  2ZD1 A;  2P9N A;  3C6U A;  4F3O A;  4KHQ A;  4X64 K;  3NF7 A;  1KRP A;  2QM1 A;  4CZH A;  1D4X A;  2DPN A;  1BIZ A;  4Q5V A;  3L2U A;  1B9F A;  1ZXO A;  3G0Z A;  3CG7 A;  2FXU A;  4DFK A;  1WLJ A;  4DV1 K;  4DFM A;  2KZM A;  4J2A A;  3LDQ A;  4FWR A;  3MWT A;  1IH7 A;  1KVB A;  4AHS A;  1IKW A;  1MU2 A;  5CZ1 A;  4A5A A;  4GVE A;  3KKR A;  3UIQ A;  4F8R A;  1DLO A;  4BR2 A;  4CFB A;  4B1W B;  2QWN A;  2D0O A;  3ZX3 A;  3OS0 A;  5AQV A;  3NGI A;  4JD2 A;  1Q81 O;  1N33 K;  4J8F A;  2P9I A;  3TAP A;  1YAG A;  2GUI A;  3VF6 A;  3VQQ A;  1U47 A;  1Z6R A;  3UE5 A;  1NK6 A;  5H1S Q;  1MWM A;  4A57 A;  3CME N;  2QKK A;  4CJL A;  3CFR A;  1S1X A;  3VN5 A;  3HK2 A;  3ENB A;  3SK3 A;  3ENO A;  1N8R O;  4C23 A;  4O8U A;  1SS6 A;  3LAL A;  1GLF O;  3ZSO A;  3ULE A;  3MWP A;  4G1Q A;  1WBD A;  2QXL A;  4H0Y B;  1IJJ A;  2FF6 A;  2RKI A;  3L2W A;  5TKW A;  4AQY K;  4H8K A;  3F9K A;  3RTV A;  1OH5 A;  5HOO A;  1VSL A;  4CF8 A;  4ELT A;  5AQU A;  5I42 A;  4FOE A;  4FWM A;  1U6Z A;  4EZ6 A;  1L3T A;  3OBY A;  1NJI O;  3H08 A;  3UKR A;  3C7N A;  4DTM A;  4Y1C A;  1MDU B;  3AVB A;  3DYA A;  1SUQ A;  5AQI A;  4CJQ A;  2BH1 A;  3OA9 A;  5E41 A;  4FJ7 A;  4K25 A;  5GAG P;  4JI2 K;  3F9M A;  4HUG A;  4DTR A;  3AGK A;  4BRE A;  1J53 A;  5DM6 L;  5A2Q O;  3LDS A;  3D2E A;  2XY7 A;  4IG3 A;  3NMU A;  3MK6 A;  3O9U A;  1QQN A;  5CZ2 A;  3NGZ A;  2E2Q A;  1BL3 A;  3U9Z A;  4OPJ A;  3KK3 A;  3IFR A;  2G8U A;  2WC9 A;  4E7I A;  2E4L A;  1O13 A;  3ZSQ A;  4DTS A;  3DLR A;  5BN9 A;  2YHY A;  3RR7 A;  3DLG A;  4QCL A;  1A5X A;  2P9P A;  4WFN L;  1SKS A;  4I7F A;  1BI4 A;  4OGC A;  4E19 A;  5AQM A;  2BAN A;  1X9S A;  4PA1 A;  4BGA A;  3RSE B;  4X65 K;  1RT4 A;  1FK9 A;  3AY9 A;  1F21 A;  2XY8 A;  1GOB A;  3ZEU A;  4J2D A;  2EX3 A;  1JLB A;  2ASO A;  3ATU A;  4LF8 K;  1ESV A;  4FWP A;  1LAW A;  4LD0 A;  2F4V K;  2QWO A;  1NMN A;  3LDP A;  4JRP A;  3QEV A;  1E3M A;  1KC8 O;  3WEE A;  4DQS A;  4IBN A;  1DTQ A;  1HNI A;  3H1V X;  3G71 N;  4BC2 A;  3SLC A;  1NGD A;  2YJF A;  3THW B;  4V19 S;  4KRF A;  4WFB L;  5F2R A;  3J7Z O;  5CE3 A;  1BU6 O;  1HQU A;  1TK8 A;  4QS9 A;  2A1S A;  4CEQ A;  3VQ4 A;  1CLQ A;  5AZJ B;  4CHN A;  1W97 L;  2HVH A;  4I2P A;  3AO1 A;  2O8D B;  1HPM A;  4M3X A;  5EVZ A;  1E4G T;  2NRH A;  3L2Q A;  1VAZ A;  1R59 O;  1TL1 A;  1TAU A;  3O08 A;  2P9L A;  1IKV A;  3K5L A;  2KQ2 A;  1U49 A;  2O8C B;  1K6Y A;  3SJH A;  1U2V A;  3M8Q A;  5GAH P;  3LM9 A;  2VYP A;  1T8E A;  2IAJ A;  3TAM A;  4E89 A;  3VOV A;  4N76 A;  1X1P A;  4JAX A;  2YHA A;  2CGJ A;  4JI3 K;  2B4J A;  4CGH A;  4CHO A;  1ATS A;  3CJ7 A;  1QHA A;  4CGI A;  2O8B A;  1Z25 A;  3SQ4 A;  2Q2R A;  4WQ5 C;  3FZL A;  3I8D A;  4FWL A;  1REV A;  3CQY A;  1BWF O;  1HX1 A;  3P4I A;  1RT1 A;  4JKD A;  2NRZ A;  3JAM O;  3WUH A;  4Y0W A;  1RDW X;  2FC0 A;  4WQ4 C;  4CJT A;  2WUS A;  3DOK A;  2Q36 A;  2F96 A;  3ZET A;  1NKE A;  1N34 K;  4CJU A;  4Z4G A;  1JLG A;  4YOY A;  3EL2 A;  2GTD A;  4FM2 A;  2ZGZ A;  2DFH A;  4RW8 A;  1HQE A;  3PSI A;  4FLW A;  4CGF A;  1EWQ A;  5F1X A;  4KHY A;  4DU1 A;  2Z1I A;  1T3V A;  3A5O C;  3SZ2 A;  2OZM A;  4YOR A;  3QO9 A;  3VEV A;  4W5O A;  3A0I X;  2P9K A;  3CCV N;  4X66 K;  5AQW A;  5AQJ A;  4PKI A;  3V9X A;  2IVO A;  2OA8 A;  3PX4 A;  4DLE A;  1NLV A;  4YHH K;  1J6Z A;  3P39 A;  1B92 A;  5BRE A;  2FBV A;  2KFN A;  3LWL A;  5M1O A;  1JXE A;  4NLC A;  3CJC A;  2E5L K;  5FDL A;  3QES A;  4DR3 K;  3M8P A;  5J2Q A;  4LF6 K;  4NCG A;  3AVL A;  4DQQ A;  2X78 A;  1GLD G;  2D0C A;  2W6L A;  3VES A;  3AAP A;  3MEC A;  3OVN A;  4BVP A;  3E66 A;  3FZM A;  3O8M A;  2A1R A;  1WSF A;  1XUP O;  4WE1 A;  3FGU A;  3D7E O;  5AQY A;  3TAB A;  2QWL A;  3H1Q A;  2HOE A;  2HF3 A;  4JK9 A;  4I2Q A;  3NF6 A;  1K8K B;  3O4W A;  4RW6 A;  4JI6 K;  5KPR A;  3SQ0 A;  1UA0 A;  1UOC A;  2HBK A;  4IKF A;  3RMA A;  4GV3 A;  1I94 K;  4IWV A;  3CQ8 A;  4OKK A;  4DTN A;  1T05 A;  3HO1 A;  4FZZ A;  4MQ3 A;  5DMR A;  3TTC A;  4IZ9 A;  3ZT1 A;  2PYL A;  4CFA A;  3MN9 A;  3O3H A;  4F3T A;  3TAR A;  4DFP A;  1HKG A;  3THX B;  4MO5 A;  4CJ7 A;  1JCF A;  4KTW A;  1VQM N;  1QZ6 A;  3KWG A;  4O44 A;  2WON A;  3O1W A;  2A5X A;  4MLE A;  3DLB A;  4BR7 A;  3DXK B;  4FM1 A;  2HST A;  4JYA K;  1RT3 A;  2O4I A;  3AVH A;  3OYH A;  4YOW A;  3CJB A;  3T1A A;  4UY8 O;  1FXX A;  3HOT A;  5AQL A;  3BZC A;  3OW2 M;  3VPZ A;  5AQK A;  3LAM A;  3B6P A;  4IFY A;  1TUU A;  4H4O A;  4YNQ A;  1NOZ A;  4B1Y B;  3FE1 A;  3KTQ A;  4H03 B;  4BRK A;  3NGY A;  3OYJ A;  3P38 A;  3MCP A;  4B9L A;  4FJI A;  3CPW M;  4KB0 A;  2Y1I A;  4BE0 A;  5C2F A;  5AQT A;  2WFB A;  4CZJ A;  1HYZ A;  3QET A;  4E1N A;  4CZM A;  4HUE A;  4M3W A;  4CF1 A;  4IDK A;  3MN6 A;  3SMP A;  3LDO A;  3CCM N;  4FCY A;  5HRR A;  2A42 A;  1GOA A;  4QAG A;  1VQL N;  4FPB A;  2OPP A;  1SL0 A;  3MXJ A;  1TAQ A;  3E01 A;  4BRC A;  1OKJ A;  3MDQ A;  3VER A;  4CEO A;  4BC3 A;  4FJK A;  1YXQ A;  4YOU A;  3KLG A;  1Q7Y O;  1M90 O;  2YCH A;  1QSS A;  3RSE A;  2NNW A;  3ZT0 A;  3CM6 A;  4Q0B A;  1JL1 A;  4DF4 A;  4YOT A;  4BDZ A;  2XHB A;  4B9V A;  4M3T A;  1DGK N;  1T03 A;  2Z1G A;  2HND A;  3AA5 X;  3R3L A;  3ZSZ A;  3CXC M;  3ZT3 A;  5GAD P;  3UKU B;  4XH4 A;  3CC4 N;  3THW A;  1H1V A;  3L4Q A;  3MN7 A;  3R8E A;  3OYN A;  1XNQ K;  4R5P A;  5AZJ A;  1FJG K;  1SKR A;  1X9M A;  4DSJ A;  3CFP A;  2O8D A;  3VA0 A;  3U9D A;  5DM7 L;  3HOS A;  1ZBL A;  3ZSY A;  3HTV A;  4J2E A;  4B9U A;  4NB4 A;  4CHZ A;  2GWJ A;  3KJV A;  2DTU A;  4FLY A;  1U48 A;  1GLE G;  4F2S A;  5LL6 Z;  3K57 A;  3KLH A;  4EP4 A;  3T69 A;  5HRP A;  5F0X A;  3KZB A;  5HRO A;  4K41 A;  4CW7 B;  1W7A A;  1WAF A;  3DRR A;  4X62 K;  4A2A A;  1IBK K;  4RW4 A;  3QFP A;  1RBV A;  1WB9 A;  1WSG A;  1BDG A;  3NDK A;  2QK9 A;  4Z4H A;  3BEX A;  3NH0 A;  3P83 D;  1EWR A;  2F7T A;  2E88 A;  2A6A A;  2W42 A;  4CZL A;  3CQX A;  1NGG A;  4DTP A;  1RT6 A;  4BR5 A;  3VQD A;  1BCO A;  1GLJ O;  4GW6 A;  3MMV A;  4RW7 A;  1Q86 O;  3VTI A;  2G8H A;  3O4Q A;  4G9Z A;  3O3F A;  4EIA A;  1NJY A;  5C42 A;  3I0R A;  2IVN A;  4U7B A;  3PO5 A;  1ITG A;  3K0S A;  3K5O A;  3SBG A;  4CEC A;  2R7Y A;  4EAH D;  4FLU A;  1OH6 A;  4QOZ B;  1LW2 A;  2UXC K;  5E26 A;  1SV5 A;  3VGK A;  2PBD A;  1ASU A;  2O8E B;  4N56 A;  1NK8 A;  4K0K K;  2E2O A;  2HBM A;  3OYM A;  3V4I A;  4RTF D;  4K8X A;  1UWB A;  3RRG A;  3CCS N;  3AAR A;  3TTF A;  1IO2 A;  4A2B A;  3PX0 A;  5J2M A;  4FLT A;  1SAZ A;  4JN4 A;  4IJN A;  1GLB G;  3L3V A;  4E7H A;  4DV2 K;  1R0A A;  3A2F A;  2BTF A;  1GOC A;  3MN5 A;  3HL8 A;  4W5N A;  1IG8 A;  1MWK A;  3LDL A;  3TI0 A;  2OYQ A;  3KIO A;  1TUY A;  4FO0 A;  3SV4 A;  1YT3 A;  5FPD A;  3UB5 A;  3C6T A;  3M1F A;  3QLH A;  5JVG L;  4BG9 A;  4DUZ K;  3I56 N;  3D2F B;  2QKB A;  2RF2 A;  4WQ5 A;  3A5M C;  4CJR A;  4BR0 A;  1NBW A;  1KFS A;  1CZ9 A;  4XH5 A;  2Q0U A;  1NJZ A;  1VSD A;  4CHQ A;  4Z4I A;  2RE2 A;  3ID6 A;  4FK0 A;  4CBW A;  3IG1 A;  2Z1H A;  4YDU C;  4WQ4 A;  3VGM A;  1K8K A;  3RVC A;  1EO1 A;  4FJ8 A;  3HJF A;  4B08 A;  1NGA A;  3AVN A;  4DTO A;  1HKC A;  2FLO A;  1HYV A;  4Y1D A;  3O9R A;  2GEM A;  2YV0 X;  4JKG B;  2XRI A;  3VEW A;  3CI5 A;  4DR5 K;  4PY5 A;  2HHX A;  3ISN C;  2IS3 A;  4CF9 A;  3WXI A;  3THX A;  1XQS C;  3T7Z A;  2GWK A;  3TAG A;  4F9O A;  1C0T A;  4Z4C A;  2BUP A;  5ADX H;  3DXK A;  5CYM A;  4DR6 K;  5EU7 A;  4F2R A;  3ZSW A;  1Z05 A;  3U8X A;  3KLI A;  1LW0 A;  1WSJ A;  1BG3 A;  1S22 A;  4OVL A;  5C0Y A;  3O3G A;  5AQN A;  1DT9 A;  2VCP A;  4AHT A;  2B5J A;  4CIG A;  3TSP A;  2ASP A;  4CEZ A;  4KO0 A;  3WNE A;  2PAV A;  1N5Y A;  4B3M K;  2ZJR L;  4JI5 K;  2J4R A;  1HNV A;  1BIS A;  5C12 A;  2FSN A;  1Q82 O;  3B6O A;  5HP1 A;  1NWK A;  3ZLJ A;  3DOL A;  3CCU N;  3V9Z A;  2OTL N;  5AFU H;  1HNX K;  3RRH A;  4B8A B;  4HWI A;  4LF5 K;  5C24 A;  2YI1 A;  3QDK A;  3ALY A;  2G8F A;  3CD6 N;  1TVR A;  4FZX C;  1XHX A;  3VQP A;  1HNZ K;  4CCH A;  1C1B A;  3WQU A;  5KQD A;  3EY1 A;  3HI0 A;  1QVG M;  3FFK B;  1D9D A;  3S9H A;  3EO3 A;  5ELZ A;  4B3R K;  4BR4 A;  1EQY A;  4B1X B;  3A5L C;  2F8T A;  4M41 A;  1TKT A;  2DFF A;  2EWS A;  4DCH A;  5HRS A;  4JLH A;  4BDY A;  5JIC A;  3L2V A;  5D3G A;  4FWK A;  4H5R A;  2XY6 A;  1JLQ A;  3CCJ N;  2XY5 A;  3T19 A;  4E1M A;  3CCL N;  3UKU A;  1LWE A;  3K59 A;  5HBM A;  1YTU A;  1GLL O;  4FJH A;  1J9A A;  4C1N K;  2ATQ A;  3IMX A;  3MED A;  4NYN A;  4CK3 A;  5SZT A;  3HZ6 A;  3SPZ A;  4HVJ A;  1ZBF A;  2HHQ A;  4LSN A;  2D1K A;  4BRF A;  2G8W A;  1ZBH A;  1T44 A;  4BRQ A;  1VQ8 N;  3HPO A;  1V4S A;  4JI1 K;  3BGR A;  1HMV A;  3MXM A;  3CER A;  2AJQ A;  3QB0 A;  4PKH A;  4DG1 A;  3VEX A;  4M3Y A;  1TKD A;  5IT9 O;  2HHU A;  1W9H A;  3TSQ A;  2Y1J A;  4LF7 K;  1S1W A;  3AVA A;  3QER A;  1SL1 A;  4YOX A;  3AVC A;  4A59 A;  4DF8 A;  5LMU K;  4DR1 K;  4FLZ A;  2EHG A;  1YUW A;  5JLH A;  2RN2 A;  5JLF A;  3THV A;  3W3D A;  3DM2 A;  4M63 C;  1BIU A;  4AHC A;  4Z4F A;  4CJF A;  4W5Q A;  3HP6 A;  1RGI A;  3VQ6 A;  4DSK A;  1S3X A;  5AR0 A;  2NRW A;  2G8V A;  4M45 A;  3DLE A;  1S9G A;  5LJV A;  5M1N A;  3OYI A;  5BRF A;  2ZQB A;  4H0P A;  5M1F A;  4JKE A;  1Z26 A;  1JKH A;  4CD3 A;  4B9N A;  4NCB A;  2GUP A;  4CHY A;  1IKY A;  2UXB K;  1NJX A;  3K9J A;  3OS1 A;  4YY3 K;  1VQ6 N;  2HHW A;  2O8E A;  1NNE A;  1KSP A;  1VQ4 N;  1EXQ A;  4CZG A;  1VQ7 N;  3LWM A;  3C94 A;  3ZSV A;  4ELU A;  3I0S A;  3FZH A;  2QTD A;  2KHO A;  4BRM A;  2HBL A;  3VF2 A;  5KI6 A;  2E1Z A;  2PZS A; 
#chains in the Genus database with same CATH homology
 1VSF A;  1S1V A;  3LP0 A;  4CEA A;  4DFJ A;  3SYZ A;  1JLE A;  3U3Y A;  3HYF A;  4FK4 A;  4B9L A;  4FJI A;  4O0J A;  3SQ1 A;  1KLN A;  1NK4 A;  4KB0 A;  2Y1I A;  2I5J A;  4BE0 A;  3EYZ A;  1BQN A;  2XO7 A;  2YNH A;  3BDP A;  5KGW A;  1W0H A;  2D0A A;  1KCF A;  1X9W A;  1A5V A;  1LV5 A;  3NH2 A;  1HYZ A;  3QET A;  4HCB A;  4PUO A;  4E1N A;  4HUE A;  4FK2 A;  4M3W A;  4CF1 A;  1I39 A;  4IDK A;  3NE6 A;  4KTQ A;  1WAJ A;  4OJR A;  5J2P A;  3SUQ A;  4FJ5 A;  1ZBU A;  4CIE A;  3AVI A;  4FCY A;  5HRR A;  1CZB A;  1GOA A;  4QAG A;  1EP4 A;  1TKZ A;  5FRM A;  2OPP A;  3LP3 A;  1SL0 A;  5FRN A;  3MXJ A;  1HYS A;  1TAQ A;  2OPS A;  3E01 A;  4FLV A;  4DSE A;  3TAE A;  3F73 A;  1RDA A;  3JYT A;  3WNF A;  4CEO A;  3V1Q A;  1RNH A;  3OJU A;  4DSF A;  3SUN A;  3OY9 A;  3RMD A;  2P51 A;  3K58 A;  4FJK A;  2VG5 A;  4MFB A;  1WN7 A;  4IG0 A;  4E3S A;  1TKX A;  3AO2 A;  2QXF A;  1D9F A;  3KLG A;  4FJG A;  1RT7 A;  4KTZ A;  1CXQ A;  4KHN A;  4I9Q A;  1QSS A;  5KRT A;  1KVC A;  1VSI A;  3ZT0 A;  4CJV A;  3CM6 A;  2ETJ A;  4Q0B A;  1JL1 A;  3LP1 A;  2OPR A;  4DF4 A;  1N6Q A;  4CFC A;  1EET A;  4BDZ A;  4ZHR A;  2XHB A;  2ZD1 A;  4B9V A;  4M3T A;  3HVR A;  3C6U A;  1T03 A;  3PV8 A;  3JSM A;  1QTM A;  2Z1G A;  4F3O A;  4KHQ A;  4O55 A;  2HND A;  4O0I A;  4B9T A;  3AA5 X;  4HCC A;  1RT5 A;  1RTH A;  3NF7 A;  3VQE A;  1RDD A;  4ID5 A;  5JS2 A;  3ZSZ A;  3ZT3 A;  4O5B A;  5KGX A;  1KRP A;  2E6L A;  3KLE A;  1NK7 A;  1BIZ A;  1JLC A;  4Q5V A;  3RMC A;  2JLE A;  1NK0 A;  2E6M A;  3NFA A;  5J1E A;  3L2U A;  4BE1 A;  3V9U A;  1B9F A;  1HPZ A;  1VK0 A;  3G0Z A;  4DTJ A;  3M8S A;  3CG7 A;  3V1R A;  3IS9 A;  4DFK A;  3OYN A;  1WLJ A;  4R5P A;  3IRX A;  1SKR A;  4LY7 A;  1X9M A;  4DFM A;  2KZM A;  3L8B A;  3CFP A;  1KVA A;  4DSJ A;  4J2A A;  4DTU A;  3VA0 A;  1ZBL A;  3QEW A;  3K5N A;  1BCM A;  1SL2 A;  1IH7 A;  1KVB A;  3ZSY A;  3DLH A;  4J2E A;  4B9U A;  1T7P A;  4AHS A;  1QQC A;  4CHZ A;  1IKW A;  1MU2 A;  5CZ1 A;  3ZT4 A;  2NUB A;  1U45 A;  1EX4 A;  3KKR A;  3KJV A;  3UIQ A;  3QEP A;  4M3Z A;  4F8R A;  5HLF A;  2DTU A;  1RCH A;  1DLO A;  4CFB A;  1G15 A;  4FLY A;  1QHT A;  2ZE2 A;  3U6F A;  3K57 A;  3RMB A;  1U48 A;  3KLH A;  4LH4 A;  4EP4 A;  3OS0 A;  3OYF A;  3NGI A;  4B9S A;  3DI6 A;  5HRP A;  1RDB A;  5HRO A;  4OPK A;  1XWL A;  3QNO A;  4KI4 A;  4CEB A;  4CJS A;  3TAP A;  1WAF A;  4CJ5 A;  4DS4 A;  3DRR A;  1A5W A;  1J54 A;  1JXB A;  2GUI A;  3QIP A;  3OYG A;  4FXD A;  2IDO A;  3VQQ A;  4C8O A;  3HT3 A;  4RW4 A;  3ZSR A;  5HRN A;  1RBV A;  4E7K A;  1U47 A;  3D45 A;  1NK6 A;  3KD5 E;  1WSG A;  1L3U A;  1ZYQ A;  4DU4 A;  3NH1 A;  3ULD A;  1IG9 A;  4F2S A;  3NDK A;  4M3U A;  2QK9 A;  4Z4H A;  4YFU A;  2VWK A;  2QKK A;  4CJL A;  3CFR A;  3NH0 A;  3P83 D;  1S1X A;  3AV9 A;  4OKJ A;  3VN5 A;  3HK2 A;  1FKO A;  2W42 A;  4N5S A;  1ASW A;  5DK5 A;  1RT6 A;  4W5R A;  4DTP A;  3ZSO A;  3LAL A;  1XC9 A;  3VQD A;  1BCO A;  4GW6 A;  4LH5 A;  4RW7 A;  1WSI A;  4DMN A;  2G8H A;  4M42 A;  3O4Q A;  4CFD A;  4JS5 A;  3O3F A;  4KRE A;  4AIL C;  3VQA A;  4G1Q A;  4C8L A;  1NJY A;  5C42 A;  3I0R A;  1JLF A;  3T3F A;  2HMI A;  5J2N A;  4OLB A;  5FRO A;  2RKI A;  3VQ8 A;  1WSH A;  3KK1 A;  3L2W A;  4BDP A;  3L3U A;  1ITG A;  3PO5 A;  4KB1 A;  3K5O A;  1TGO A;  4CEC A;  2R7Y A;  3SQ2 A;  3RR8 A;  3TAQ A;  3K2P A;  4H8K A;  3CFO A;  3TR8 A;  3F9K A;  4FLU A;  1CXU A;  1ASV A;  3RTV A;  4QOZ B;  1LW2 A;  4RW9 A;  3L2R A;  4DSL A;  1SV5 A;  1VSE A;  1VSL A;  1ASU A;  4CF8 A;  4ELT A;  2YNI A;  4C8N A;  4N56 A;  1BGX T;  3VQ9 A;  3ASM A;  3P5J A;  3OYJ A;  3V6D A;  5I42 A;  1NK8 A;  2OZS A;  4EZ6 A;  1L3T A;  3TAN A;  1Y97 A;  3OYM A;  3H08 A;  3RWU A;  3HXM A;  3ITH A;  4DTM A;  3V4I A;  4FJL A;  4Y1C A;  3AVB A;  3DYA A;  1SUQ A;  2RPI A;  3VQC A;  4CJQ A;  4K8X A;  1VSH A;  3ZCM A;  1UWB A;  4CF2 A;  4FYD A;  4KFB A;  3RRG A;  4C8M A;  4N41 A;  3AO3 A;  5E41 A;  4FJ7 A;  1Q8I A;  4H4M A;  3IAY A;  1VSK A;  1IO2 A;  1B9D A;  3PX0 A;  4HUG A;  4DTR A;  1S6Q A;  5J2M A;  4FLT A;  1VRU A;  4KPY A;  1J53 A;  1S1U A;  4CHP A;  3HST B;  1U04 A;  5C25 A;  4DLG A;  2FBX A;  3L3V A;  4E7H A;  3LDS A;  1R0A A;  4FJJ A;  2KTQ A;  3ZT2 A;  1WNS A;  3A2F A;  3O4N A;  4FVM A;  1EKE A;  2IOC A;  2XY7 A;  1VSM A;  4IG3 A;  1GOC A;  5CZ2 A;  3NGZ A;  3HL8 A;  4W5N A;  1BL3 A;  2HB5 A;  3QEI A;  3TI0 A;  2P1J A;  4OPJ A;  3KK3 A;  2G8U A;  1L3V A;  2OYQ A;  3KIO A;  2G8I A;  2G8K A;  4AH9 A;  3SV4 A;  1YT3 A;  1XI1 A;  3WNH A;  4E7I A;  2E4L A;  3CM5 A;  3M8R A;  4Z4E A;  3WNG A;  3C6T A;  1FKP A;  3ZSQ A;  3NAE A;  3QLH A;  1QSY A;  2OPQ A;  2X6N A;  4DTS A;  1Q9Y A;  3TAF A;  2YKM A;  3DLR A;  3AVJ A;  3RR7 A;  3DLG A;  3SUP A;  4QCL A;  1A5X A;  1SKS A;  2QKB A;  4I7F A;  3KD1 E;  1BI4 A;  1JLA A;  4OGC A;  4E19 A;  1X9S A;  2BAN A;  4PA1 A;  2RF2 A;  4KAZ A;  4CJR A;  1KFS A;  1CZ9 A;  5SWM A;  1YTA A;  1NJZ A;  3SV3 A;  1RT4 A;  4FJ9 A;  1FK9 A;  1VSD A;  4CHQ A;  1D8Y A;  4CE9 A;  5T7B A;  4Z4I A;  1F21 A;  2XY8 A;  1GOB A;  2D0B A;  3HPG A;  3OYB A;  5CYQ A;  1U4B A;  4J2D A;  4FK0 A;  1XHZ A;  3IG1 A;  2EX3 A;  3SCX A;  1JLB A;  2Z1H A;  3QIO A;  3MEE A;  3SPY A;  3SNN A;  3NF8 A;  4FM0 A;  2FBY A;  3VQ7 A;  1LAW A;  5K14 A;  1YVU A;  4LD0 A;  2VG6 A;  4FJ8 A;  3HJF A;  4B08 A;  4JRP A;  3QEV A;  3AVN A;  4DTO A;  4DQS A;  4IBN A;  1DTQ A;  1HNI A;  4B8C A;  1UAX A;  1HYV A;  4Y1D A;  1RIL A;  4CJE A;  4OLA A;  5JS1 A;  2YV0 X;  1S1T A;  2XRI A;  4DS5 A;  4PY5 A;  4KRF A;  2HHX A;  1HQU A;  3HP9 A;  3S3N A;  2GV9 A;  3ISN C;  1TK8 A;  4B9M A;  2A1S A;  3KKS A;  4CEQ A;  2KFZ A;  3VQ4 A;  1CLQ A;  2IS3 A;  4CF9 A;  4CHN A;  2HVH A;  3PO4 A;  1RT2 A;  3D0P A;  4I2P A;  3AO1 A;  1C0U A;  1S6P A;  3OYE A;  3EZ5 A;  4CJW A;  4DQR A;  4M3X A;  2HW3 A;  4CEF A;  4GVM A;  1NKC A;  3TAG A;  1WSE A;  2Z1J A;  1C0T A;  3OYD A;  2YNG A;  4IFV A;  4Z4C A;  3L2Q A;  3AO4 A;  2FBT A;  2KZZ A;  1TL1 A;  1TAU A;  3AVF A;  5CYM A;  5EU7 A;  4F2R A;  3ZSW A;  1C0M A;  2X6S A;  3NGY A;  1IKV A;  3K5L A;  4ID1 A;  3KLI A;  2KQ2 A;  1LW0 A;  1WSJ A;  4CGJ A;  1LWF A;  2BGG A;  1NK5 A;  4OVL A;  3OS2 A;  2YKN A;  1TL3 A;  1U49 A;  3O3G A;  1K6Y A;  1RBR A;  3M8Q A;  4C8K A;  3TWH A;  3SJJ A;  4AHT A;  1T8E A;  2B5J A;  4CIG A;  2GBZ A;  4L8R B;  4CEZ A;  2IAJ A;  2VG7 A;  4KO0 A;  3HVT A;  3TAM A;  3WNE A;  4E89 A;  5KTQ A;  1N5Y A;  3DRS A;  4CGD A;  4N76 A;  4UQG A;  3OYK A;  1S5J A;  2JGU A;  1X1P A;  4PWD A;  1HNV A;  1BIS A;  3B6O A;  2YHA A;  4HUF A;  5HP1 A;  4EZ9 A;  1TV6 A;  2B4J A;  4CF0 A;  4CGH A;  3DOL A;  4CHO A;  3V9Z A;  1QS4 A;  4DQP A;  3NHG A;  4CGI A;  1Z25 A;  3SQ4 A;  3AA2 A;  4KV8 A;  3RRH A;  4B8A B;  1RBT A;  4CES A;  3VQ5 A;  5KRS A;  4FLX A;  4FJN A;  4ELV A;  2ITG A;  5C24 A;  1KLM A;  3I8D A;  2PY5 A;  4HTU A;  1TK0 A;  1REV A;  3ALY A;  3QEX A;  2G8F A;  2HHS A;  2BDP A;  1RT1 A;  1TVR A;  3OYA A;  1NOY A;  4FZX C;  4K8Z A;  1XHX A;  3LAK A;  3VQP A;  4CCH A;  1DTT A;  2FC0 A;  3KK2 A;  4CJT A;  3FFI A;  4J2B A;  4CJ4 A;  4DSI A;  2HNZ A;  3DOK A;  1C1B A;  3V9W A;  4OGE A;  3PX6 A;  4B3O A;  2F96 A;  1D5A A;  1NKE A;  3EY1 A;  4CJU A;  4Z4G A;  2HHT A;  1JLG A;  1LWC A;  4ICL A;  4DU3 A;  1D9D A;  3LZJ A;  4KHS A;  1RDC A;  4FM2 A;  3S9H A;  2DFH A;  2D5R A;  4FZY A;  4RW8 A;  1HQE A;  4FLW A;  3DLK A;  4CGF A;  3OYL A;  3S3M A;  1ZBI A;  1HRH A;  1O1W A;  4KHY A;  3C95 A;  4DU1 A;  3AVK A;  2Z1I A;  1RBS A;  3SZ2 A;  2OZM A;  4M41 A;  1TKT A;  2DFF A;  3QO9 A;  4CJP A;  4E0D A;  2F8T A;  3P1G A;  1VRT A;  1JL2 A;  5HRS A;  4XIU A;  4JLH A;  4BDY A;  4W5O A;  3L2V A;  4KI6 A;  5D3G A;  2HVI A;  2XY6 A;  4CJK A;  4GMJ B;  1RTD A;  1JLQ A;  4CIF A;  2VWJ A;  4Z4F A;  2DY4 A;  5I3U A;  2XY5 A;  3DMJ A;  4M3R A;  3SUO A;  4KHU A;  3T19 A;  4E1M A;  3V9X A;  4BWM A;  4E7L A;  3DRP A;  2OA8 A;  4PQU A;  3PX4 A;  4DLE A;  1LWE A;  1QSL A;  4OKE A;  4JRQ A;  1B92 A;  3OYC A;  3S3O A;  3K59 A;  2KW4 A;  2FBV A;  5HBM A;  1YTU A;  2KFN A;  3LWL A;  4EP5 A;  4FJH A;  1JXE A;  1J9A A;  2ATQ A;  3MED A;  4NYN A;  4CK3 A;  1RTJ A;  2Q3S A;  3MEG A;  5SZT A;  3SPZ A;  4HVJ A;  5FDL A;  3QES A;  1HJR A;  1ZBF A;  3V9S A;  1I3A A;  4LSN A;  2HHQ A;  1C1A A;  3AA4 A;  1C6V A;  5CY4 A;  3M8P A;  4CK1 A;  5J2Q A;  2WOM A;  4NCG A;  3VQB A;  3AVL A;  3OJS A;  2G8W A;  1ZBH A;  4DQQ A;  2X78 A;  2D0C A;  1BHL A;  4JS4 A;  4AHR A;  2YNF A;  3HPO A;  1J5O A;  3MEC A;  3OVN A;  4FJX A;  3BGR A;  1HMV A;  3MXM A;  2A1R A;  1BI4 B;  2P5G A;  2AJQ A;  3AVM A;  1WSF A;  4CJ3 A;  2LSN A;  4AHV A;  4WE1 A;  3AVG A;  4DG1 A;  4E7J A;  1NK9 A;  4Z0U A;  3ZSX A;  3TAB A;  4CEE A;  1SKW A;  4M3Y A;  3HM9 A;  4I9L A;  1TKD A;  2B6A A;  3AO5 A;  3NCI A;  4ZTJ A;  1C1C A;  3HO1 A;  4W5T A;  2HHU A;  1W9H A;  4CER A;  1KFD A;  4DQI A;  1LAV A;  2Y1J A;  3QIN A;  4I2Q A;  3LP2 A;  2PYJ A;  3LAN A;  3LPT A;  1S1W A;  3AVA A;  3NBP A;  3NF6 A;  1TK5 A;  2HNY A;  4RW6 A;  3SQ0 A;  3QER A;  1UA0 A;  3QNN A;  4O4G A;  1SL1 A;  1UOC A;  3AVC A;  4DF8 A;  1Q9X A;  3VA3 A;  4F4K A;  4IKF A;  4FLZ A;  2EHG A;  4CK2 A;  3U3G A;  3RMA A;  4KKO A;  4NCA A;  2RN2 A;  3K5M A;  3CQ8 A;  4BAC A;  3THV A;  1UA1 A;  3PY8 A;  2O4G A;  3G10 A;  4OKK A;  3DM2 A;  4KHW A;  1RTI A;  4DTN A;  1BIU A;  4AHC A;  1T05 A;  1QE1 A;  4CJF A;  4MQ3 A;  5DMR A;  3VQ6 A;  4NYF A;  4W5Q A;  3HP6 A;  4DSK A;  4FZZ A;  3ZT1 A;  3LZI A;  2PYL A;  4CFA A;  3O3H A;  2G8V A;  3TAR A;  4F3T A;  2IGI A;  4TSX A;  4M45 A;  4DFP A;  1L5U A;  3LPU A;  3DLE A;  3MAQ A;  4BE2 A;  4ZTF A;  1S9G A;  4KTW A;  3OYI A;  4DTX A;  3NF9 A;  2F8S A;  3KLF A;  2ZQB A;  3V1O A;  4FW2 A;  4O44 A;  1Z26 A;  2WON A;  3V81 A;  1JKH A;  1NKB A;  4CED A;  3DLB A;  4B9N A;  1S9E A;  4NCB A;  3CYM A;  4CHY A;  1IKY A;  2X74 A;  3HPH A;  2IC3 A;  1NJX A;  3OS1 A;  4FM1 A;  3PUF A;  1BQM A;  1KTQ A;  1RT3 A;  2O4I A;  3AVH A;  1IKX A;  4AHU A;  3OYH A;  4LSL A;  2HHW A;  4RG8 A;  3T1A A;  1KSP A;  2P5O A;  4DWI A;  1EXQ A;  1FXX A;  3SI6 A;  2YHB A;  4BWJ A;  3LWM A;  1NJW A;  3AA3 A;  3C94 A;  1RBU A;  3ZSV A;  1L3S A;  4CGG A;  4ELU A;  3I0S A;  3B6P A;  3LAM A;  4IFY A;  1VSJ A;  4H4O A;  4YNQ A;  1NOZ A;  4FW1 A;  3KTQ A;  4N47 A;  4HHT A;  3MXI A;  2HHV A;  5KI6 A;  2DFE A;  2BE2 A;  4FJM A;  2PZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...