1RNHA

Structure of ribonuclease h phased at 2 angstroms resolution by mad analysis of the selenomethionyl protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ribonuclease H phased at 2 A resolution by MAD analysis of the selenomethionyl protein.
pubmed rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE HI
total genus 43
structure length 151
sequence length 151
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1990-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rnhA00
4E1NA 3LPUA 5KGWA 4IG0A 1Z26A 4G1QA 4ELTA 2O4IA 1L3VA 2D0BA 3OS0A 2G8HA 2B5JA 2I5JA 4KREA 3DOLA 2ITGA 3LP1A 3DLEA 5J2PA 4IBNA 4Z4HA 4YFUA 2RKIA 4KPYA 2G8KA 3TANA 5HRRA 3MECA 3MEGA 2W42A 3NGIA 4E7LA 5I3UA 3LWLA 4DLGA 2RN2A 3OJSA 1JL1A 4AHCA 4CEQA 1S1WA 3H08A 4GVMA 4HUGA 5HLFA 1BQNA 3HPOA 4FJMA 2GUIA 4M3ZA 2ATQA 4HTUA 4Z4GA 2VG6A 4LSLA 1IKVA 3VQ6A 4M3TA 3VQ5A 3SZ2A 3HXMA 2RPIA 3ZSXA 4W5NA 3THVA 5FRNA 4CF8A 4E1MA 1U48A 3ZSRA 3OYHA 1J53A 3OYMA 1Q8IA 1XI1A 1IKXA 1KTQA 4BDZA 4MFBA 3VQQA 1WAJA 2NUBA 2G8WA 4OKEA 3ZSVA 4CJPA 3K5OA 4IFYA 4B9LA 1W9HA 3U6FA 3U3GA 1KRPA 3C95A 4C8MA 3V1QA 1YTUA 3O4NA 4KFBA 5I42A 4CHZA 4BDPA 2YHBA 5CYMA 2P1JA 4PQUA 1Z25A 2IOCA 2BANA 3NE6A 4PUOA 3DM2A 4Q0BA 4QCLA 4OKJA 1TK5A 1C1BA 3C94A 4CEBA 3QEIA 4CJSA 1RTDA 4CJ4A 1G15A 1HYSA 3P1GA 3HL8A 1LAVA 1RTIA 2Z1IA 4DQIA 4FJNA 1FK9A 5HROA 4FJHA 4M3YA 1KCFA 4CJFA 2AJQA 4W5OA 1SL0A 2E6LA 4HHTA 1SKSA 2F8TA 3S9HA 4CK3A 1NKBA 3HT3A 4ZTFA 3UIQA 4PWDA 3ZT2A 4WE1A 1LW0A 3TAFA 3AVAA 4AHSA 1IH7A 5KRSA 3BDPA 3IS9A 4F8RA 3ZSQA 3HJFA 3KD1E 3IG1A 3KKSA 3C6TA 4DTJA 4YNQA 1B9FA 4JRPA 1NK0A 1D9FA 1RDBA 3B6PA 3NGZA 2IAJA 5SWMA 4BACA 3PUFA 4CF2A 3T1AA 4LY7A 4R5PA 3AA2A 1YT3A 3MEDA 3HPGA 4LH4A 4FLYA 3KLFA 3SQ2A 1X9SA 4I9QA 3V1OA 3PV8A 4H4MA 1C1CA 5K14A 3MXMA 3S3OA 3P5JA 4NYNA 3M8RA 3PX6A 3JSMA 3VQDA 1ITGA 3L8BA 1A5WA 1WAFA 3AVNA 4DG1A 2B4JA 1KFSA 3PO5A 2KZMA 1JLBA 1I3AA 1FKOA 2KW4A 4HCBA 1TKXA 1A5VA 3M8QA 4DMNA 4KHQA 1UA1A 1JKHA 3SV3A 1LW2A 4DS4A 1U49A 2R7YA 3FFIA 3TARA 3OJUA 4O5BA 3ALYA 4QAGA 3JYTA 4E19A 1RCHA 2ZE2A 4XIUA 4FLWA 4DFJA 1R0AA 3NH2A 5C42A 4OGEA 3SJJA 1KVBA 4ZTJA 1TL1A 3QERA 1QS4A 2XY5A 4CFDA 4OKKA 4HVJA 1QTMA 1X1PA 4KAZA 3NF6A 4CHYA 4FK0A 3KK3A 3DOKA 4DTUA 1ASVA 3AVHA 1MU2A 4GW6A 2YNIA 1J5OA 1NK4A 4CHOA 4DQPA 3VQAA 4CJ5A 3M8PA 1ZBHA 3S3NA 5C25A 3TAMA 1CZ9A 3NFAA 4O44A 1HQEA 4J2DA 3AO4A 2D5RA 1EETA 2G8FA 3ZSZA 2OYQA 3AVLA 2PYJA 1TGOA 1NK7A 4EZ9A 3TAQA 4B9SA 4M42A 1NJZA 1HYZA 3HP9A 3CFPA 1ZBLA 2HHQA 1L3SA 3ZT1A 2OZSA 3CFOA 4PY5A 1I39A 3SQ4A 3NF8A 4AHTA 2G8UA 1JLAA 3RRHA 3OY9A 4E7IA 3SUNA 4N47A 1L5UA 4QOZB 1RT2A 4NCAA 4DQSA 2VG5A 4DTXA 1VSLA 4B8AB 3DLKA 4KB0A 2GBZA 1XHZA 1QSYA 3RTVA 2XY7A 1QSLA 4CIGA 4E89A 4Q5VA 1Y97A 1VSIA 5FROA 4CJEA 3NCIA 1TK8A 4KHWA 2HHUA 4I7FA 1S9GA 3O3GA 4RW7A 4E3SA 4K8ZA 1UOCA 4FZYA 5D3GA 1EP4A 1RTHA 1KFDA 4FK4A 1S1XA 4DTMA 4DTOA 4KV8A 3QEWA 3QETA 3K57A 2F96A 3NBPA 1C1AA 2DFEA 4O4GA 4CGIA 1WSJA 4CHNA 3K5MA 4FLVA 2X6NA 3OYIA 4KTWA 2XHBA 4N76A 4DTPA 4CFCA 4CGHA 1TKDA 4OPJA 3TI0A 3KLHA 4JLHA 4FM0A 2Y1IA 1U4BA 3QEPA 2HMIA 4Z4EA 2HHSA 4CGDA 3VQPA 1UA0A 4RW4A 4DU4A 3HVTA 3NGYA 3V6DA 1DTQA 3LANA 2PY5A 3LZJA 1NOZA 1RDDA 3LP2A 3WNFA 1SL1A 4IG3A 4FYDA 1T05A 3HP6A 4E7KA 1LV5A 1RBRA 1XC9A 1IG9A 4JS5A 4HCCA 4CEAA 3TWHA 3OYJA 1HJRA 5HRNA 3B6OA 3HVRA 2HB5A 1N5YA 4DSJA 4W5QA 3ISNC 4FVMA 3V1RA 4AHVA 5HP1A 1UAXA 1TVRA 4ICLA 1U47A 3WNEA 4B3OA 3K58A 1KVAA 5KTQA 4BE0A 3HYFA 3I0SA 5J2MA 1WN7A 3SNNA 2EHGA 4CIFA 3TR8A 4JRQA 2Y1JA 3ITHA 3PX0A 4FW2A 1HQUA 2OPQA 4IFVA 3SQ1A 1B9DA 2XY6A 3LALA 4CJ3A 3AO3A 4NYFA 4CECA 2Z1JA 3DMJA 3T3FA 4ZHRA 4AHUA 3KJVA 1VRTA 3VQ8A 4C8NA 5C24A 4CJVA 3EZ5A 1BCOA 3QNNA 3ZSOA 5JS1A 4BE2A 4Y1DA 3VQBA 2QKKA 2OPSA 4C8KA 3M8SA 4FCYA 4FM1A 4N41A 1RBTA 4FM2A 1S1UA 2HHTA 3V9UA 1A5XA 2P51A 3C6UA 1S9EA 2FBVA 1BI4A 1IKWA 1RT1A 4DFMA 1KVCA 3OVNA 3V9WA 1TK0A 4KHYA 4RW9A 4CK2A 2X74A 3V9ZA 3QO9A 3VQ9A 3DLHA 4DSIA 5CY4A 4EZ6A 4CJUA 1DTTA 4EP4A 4CFAA 3AO2A 3CQ8A 3RR8A 4B9VA 4FLTA 2O4GA 3ULDA 4DTNA 1WLJA 3VN5A 4NCBA 4M3UA 1WNSA 2FBYA 4FLZA 3SQ0A 1F21A 1VSDA 3K5NA 4C8OA 4FZZA 4O0IA 1JLGA 1GOCA 1NJXA 2QXFA 3S3MA 1CZBA 2HNDA 5CYQA 3OYNA 3TABA 4DSLA 3NHGA 3MAQA 3VA3A 1C0MA 2YNGA 1FXXA 3K59A 4C8LA 4KHUA 3KD5E 3CM5A 4CGGA 1S5JA 4AH9A 4FK2A 2YNFA 3VQ7A 4EP5A 2F8SA 2RF2A 1TKTA 1RBVA 1QHTA 3AA4A 3IRXA 3CM6A 2GV9A 5E41A 2B6AA 1TV6A 4CF9A 3QIPA 1HPZA 4Z4IA 4GMJB 1TAUA 2VG7A 3V81A 3OYLA 4AHRA 1Q9YA 3ZT0A 3LP3A 3OYEA 3SYZA 3TAEA 2DFHA 3AO1A 4RW6A 3L2QA 3HK2A 2BE2A 4DWIA 4B9UA 3K2PA 2FC0A 1K6YA 2X78A 4FJKA 4B9TA 4DF8A 3LWMA 3SUPA 4CEZA 1JLQA 4CJLA 3IAYA 4K8XA 1GOBA 3SPYA 1LAWA 1RBSA 3E01A 3KTQA 3KLGA 5HRPA 4KTZA 2HVHA 1IO2A 3OYBA 1EXQA 2HVIA 1BISA 3RWUA 3QINA 3KIOA 4CJTA 4DSFA 4FLUA 4J2BA 3I8DA 3SI6A 4H8KA 2IDOA 4JS4A 3AVGA 1NJWA 4FXDA 4DLEA 1X9WA 1J54A 1CXQA 1LWEA 3QNOA 1WSFA 3DLGA 1VSKA 3LP0A 3ZSWA 4ELVA 4J2EA 3QLHA 4O0JA 3P83D 4Z0UA 4CF0A 3AVKA 1VSEA 1JXEA 1VSFA 2XRIA 4FJ5A 4I2QA 3AA3A 4CERA 3MXJA 4M3XA 3D0PA 1S1VA 4DF4A 4F4KA 3KK1A 1SKWA 1NK5A 1RT6A 4B8CA 2PZSA 3OYAA 4KHNA 3QESA 3TAPA 1QQCA 5CZ1A 1ASUA 1WSIA 1S1TA 3L2WA 3LPTA 3QEVA 4UQGA 1S6QA 4M45A 4F3TA 4CGJA 3OS1A 3HO1A 3KKRA 4CJKA 4M3WA 2DY4A 3RRGA 3V4IA 4LD0A 1WSEA 4HUFA 4CIEA 5J1EA 1TAQA 4BWJA 1RTJA 1ZBFA 1TKZA 3L2RA 2OPPA 3O4QA 1HRHA 1LWCA 1GOAA 1VRUA 2D0AA 2YNHA 1JXBA 4CEEA 3NF7A 4DQQA 4DU3A 4DFKA 3MXIA 1NJYA 4OLBA 2HHWA 2YV0X 2FBXA 5DMRA 5FDLA 3ASMA 3LAMA 2P5GA 1HYVA 1YTAA 5J2QA 2YHAA 3I0RA 3DLBA 3QIOA 4CFBA 4DSEA 4FJIA 2XY8A 4W5RA 3U3YA 4RW8A 3OYDA 4ELUA 1KLMA 3TAGA 4CF1A 4CJQA 1BHLA 4CHPA 1B92A 1WSGA 4LSNA 1KLNA 3CYMA 1EX4A 4IKFA 2HW3A 3VQEA 1HNIA 1RBUA 4KKOA 2FBTA 5EU7A 4E0DA 3SUQA 3A2FA 3VA0A 2KFNA 2YKNA 1BIZA 3D45A 4W5TA 1RILA 3AVIA 5HBMA 1XHXA 5CZ2A 3NH1A 4RG8A 4M41A 3O3HA 4O55A 4CE9A 2IGIA 1VSHA 1VSMA 4Z4FA 2HHVA 2OA8A 4FZXC 4CCHA 1YVUA 2G8VA 1RT4A 5DK5A 1LWFA 3ZT3A 4OGCA 3WNHA 3V9XA 1NOYA 3OYGA 1T7PA 2OZMA 3VQ4A 1IKYA 1SV5A 3L2VA 3G0ZA 3AA5X 2Q3SA 4FJJA 1JLEA 1HMVA 2EX3A 3ZCMA 3AVFA 1JLCA 5KRTA 1U04A 3WNGA 1L3UA 4FJ8A 5JS2A 4B08A 1Q9XA 3PO4A 4KTQA 1BGXT 3RR7A 1RDAA 2YKMA 4KO0A 4N56A 2P5OA 3NAEA 3RMBA 3SCXA 2KQ2A 2KFZA 1UWBA 3AVBA 4CJRA 1X9MA 5J2NA 1REVA 2ZD1A 4CEDA 4CEOA 2X6SA 1JLFA 4E7JA 2HNZA 1JL2A 3AO5A 1XWLA 3OS2A 4DU1A 4F2RA 3RMDA 4F3OA 3KK2A 4OPKA 4MQ3A 4DTSA 4DSKA 3ZSYA 4CEFA 4J2AA 2ETJA 5HRSA 3LDSA 4HUEA 4DTRA 2A1RA 2XO7A 3O3FA 4I9LA 1EKEA 2PYLA 2HNYA 1RT3A 4M3RA 1SUQA 1RNHA 3AVJA 3DLRA 4I2PA 1ZBUA 4Y1CA 1DLOA 4N5SA 1NK8A 4OLAA 2E4LA 3LZIA 1J9AA 4DS5A 4KI6A 3OYKA 1ZYQA 5SZTA 3EYZA 1D8YA 1D9DA 1C0UA 1U45A 2IC3A 1VSJA 4OJRA 2VWJA 4E7HA 4CGFA 4DQRA 3AVCA 4FLXA 3LAKA 4FJGA 3DYAA 4FJLA 2VWKA 4NCGA 4PA1A 4KHSA 4AILC 1S6PA 3CG7A 1RDCA 4FJ7A 2DFFA 3HPHA 3K5LA 1BL3A 4ID5A 1L3TA 2Z1HA 4KI4A 3BGRA 4IDKA 1SL2A 1QE1A 4BWMA 1BQMA 2KTQA 3L2UA 3NDKA 3DRPA 3SV4A 1VK0A 4ID1A 3V9SA 3DRSA 1NKCA 1TL3A 3AV9A 3DI6A 2E6MA 3PX4A 2KZZA 2HHXA 5T7BA 4B9MA 3AVMA 3KLEA 2Z1GA 3PY8A 3NF9A 4FJXA 1T8EA 1RT5A 1NK9A 3KLIA 2OPRA 3OYFA 5KI6A 3NH0A 3OYCA 1NKEA 1NK6A 5FRMA 1FKPA 1O1WA 2DTUA 1D5AA 3EY1A 4FJ9A 1HNVA 1N6QA 3ZT4A 1C0TA 2G8IA 4KRFA 1CLQA 2WOMA 4DFPA 3HSTB 1QSSA 1WSHA 2BDPA 4H4OA 1C6VA 4TSXA 4KB1A 3G10A 3QEXA 5KGXA 4LH5A 3SPZA 4CK1A 3DRRA 1ASWA 4F2SA 4CESA 4CJWA 1SKRA 3L3VA 4Z4CA 3CFRA 3F73A 2JLEA 3HM9A 4B9NA 2WONA 4FW1A 2D0CA 3RMCA 2JGUA 4BDYA 1KSPA 1BI4B 2A1SA 1BCMA 1CXUA 1T03A 4L8RB 2LSNA 1BIUA 3L3UA 1ZBIA 2BGGA 2IS3A 4CHQA 3F9KA 4OVLA 2QK9A 3T19A 1RT7A 2QKBA 3VQCA 3SUOA 1W0HA 3RMAA 2ZQBA 4BE1A 3MEEA
chains in the Genus database with same CATH superfamily
4CZGA 1Z26A 4ELTA 3U4LA 2I5JA 3DLEA 4DR4K 4IO9L 4JHDB 3MECA 4NLCA 2ZJRL 2PAVA 3VEZA 4BRLA 3LWLA 4DV7K 4O8KA 3H08A 4FJMA 1RDUA 4HTUA 2CGJA 4BC2A 3VQ5A 3SZ2A 2Q0RA 2UYTA 5FRNA 1CZAN 4BG9A 2D4WA 4YOTA 2NUBA 4BRGA 2HHHK 3CPEA 3O4NA 5I42A 4K41A 4BDPA 3EEQA 3NE6A 4QCLA 5IT9O 1NGCA 2QWOA 4OKJA 5BPMA 3RVCA 4AQYK 4CJ4A 3HL8A 5BRDA 3VGKA 4CJ7A 3SJHA 2JWKA 3EKUA 3WEEB 4CJFA 4MLEA 5FPEA 2F8TA 1NKBA 1V4SA 2QTDA 4WE1A 4AHSA 1N32K 1FJGK 3TTCA 3BY5A 1B9FA 1D9FA 3PIPL 3CC4N 4R5PA 5AQIA 3KLFA 5JVHL 4H4MA 3S3OA 4YOXA 3P5JA 4NYNA 3M8RA 2CH5A 1RFQA 4BRDA 4DG1A 1BWFO 3AVNA 4JI2K 2AA4A 1JLBA 2W41A 2KW4A 5EX5A 4BC5A 1YF5L 4KHQA 4U7BA 3N4PA 3SV3A 4DS4A 3U8XA 3IDHA 4EAHD 4FLWA 2ZE2A 4DUYK 4X65K 3BEXA 2YX6A 4ZTJA 3OA9A 1KAXA 4YORA 2IVNA 4KAZA 3NF6A 4CHYA 2QWMA 4JK7A 4DTUA 3AVHA 4GW6A 1J5OA 2YNIA 3THYA 3NVMA 1ZBHA 5AQRA 5C25A 5M1KA 3NFAA 3TSPA 1HQEA 4J2DA 3BP8A 2G8FA 1MDUB 2PYJA 4LFCK 4EZ9A 4CVNE 4M42A 1VQ7N 1ZBLA 1L3SA 2OZSA 4PY5A 5LJWA 2FSKA 4QOZB 4E7IA 5AQPA 3H3OB 2P9KA 2VG5A 4DTXA 3OBWA 1VSLA 4LF9K 1QSYA 4CIGA 2P9NB 4I7FA 3O3GA 3CCMN 3WUHA 2IVOA 4DTMA 4O4GA 2DFEA 3KK7A 5AR0A 2GUPA 2Q1NA 4CFCA 5ADXH 2WC9A 3CXCM 3CJ9A 1WB9A 2BUPA 4KHPK 2IVPA 3NGYA 2PY5A 1DTQA 1OKJA 1RDDA 3G71N 4FYDA 1T05A 2F7TA 1IG9A 4IOXA 4CEAA 3TWHA 1BA0A 5JVGL 3L4QA 1D4XA 3A5LC 2P9LA 2NRZA 4ICLA 1TVRA 1U47A 3ZX0A 3HYFA 5J2MA 2ZGZA 1GLAG 1OVQA 1KAYA 1X9JA 3FE1A 4JRQA 2Y1JA 4YDUC 4CD1A 1XUPO 2YI1A 1XQSC 2VGMA 3LALA 3TSUA 2Z1JA 2Q36A 3VQ8A 1VQ6N 3ZSOA 3VOVA 3P39A 4R79A 2FBVA 5KQDA 5AZIB 2QEXN 3V9WA 1YHQN 4JKHA 1BUPA 4CK2A 4GV3A 2O8FB 3VQ9A 4YDUA 5CY4A 4CJUA 1DTTA 4EP4A 4K25A 5F0XA 3ULDA 4DTNA 3SBTA 4JKBA 1C0GA 3K5NA 4FZZA 2W6KA 4O0IA 1VAZA 1CZBA 3U9DA 3VA3A 3K59A 3KVGA 3KD5E 1S5JA 4AH9A 4FK2A 2YNFA 2F8SA 2NNWA 1TUYA 3IRXA 3CM6A 2GV9A 3DLLL 1TV6A 3MDQA 1HPZA 3CF5L 1TAUA 1HNXK 3ZT0A 2GWJA 1YJNN 3FZKA 3ZX3A 1VQ5N 4DWIA 4FJKA 5B8HA 4B1ZA 2W40A 3LWMA 3SPYA 1RBSA 3KTQA 5HRPA 1IO2A 2HVIA 3QINA 3I8DA 3SI6A 4C1NK 3D2EB 5JLHA 3FLCO 5TKWA 1WSFA 3HBTA 4J2EA 4O0JA 1JXEA 4FJ5A 4I2QA 2A42A 4DF4A 4F4KA 4BRCA 4B1WB 1YAGA 1SKWA 5AQNA 1MWMA 3G4SN 4WFBL 1VQKN 1KAZA 1QQCA 3I33A 1WSIA 1E4FT 3LPTA 3QEVA 3CQYA 4H0PA 4FSVA 3RRGA 5H1SQ 4HUFA 1VQNN 3THXA 3BF3A 3O4QA 1HRHA 3VTHA 1GOAA 3AAQA 3D7EO 4DU3A 3ZYYX 3AGKA 1ATNA 3G25A 3MN9A 2E1YA 3D2EA 5J2QA 3I0RA 3QMLA 4FJIA 1NGIA 3CC7N 4RW8A 4CZIA 2D1KA 1YITN 1XC3A 4JEPA 4FWPA 4LSNA 4BC3A 3BF1A 1HNWK 1KLNA 4IKFA 2HW3A 3P4IA 1RBUA 2P9UA 4KKOA 4J8FA 3A2FA 3J81O 2YKNA 1BIZA 3D45A 3R9PA 1XHXA 5CZ2A 4FVUA 4O55A 5AQJA 3V9XA 1LWFA 3C65A 3G0ZA 4LF8K 3K9JA 2NLXA 3ZCMA 3CCSN 2RHKA 3WNGA 3QFUA 1Q9XA 1RDAA 3RMBA 2QWNA 4H5WA 3AVBA 5J2NA 1REVA 2ZD1A 4F8RA 4DU1A 2W6LA 1JL2A 4ISGA 1XWLA 3ZETB 4JYAK 1RDWX 2QXLA 4BRAA 5DM7L 2ETJA 4K0KK 4DTRA 2HBJA 3J7ZO 2PYLA 1HPMA 2HNYA 3H3NO 2HHUA 3O80A 3AVJA 1ZBUA 4Y1CA 1NK8A 4JI0K 4K43A 3OYKA 1ZYQA 1NU0A 2VWJA 4E7HA 4CGFA 5BR9A 4JD2A 5GADP 2NRHA 2VWKA 1S6PA 1JCFA 1RDCA 5GIPA 4FJ7A 3HPHA 3K5LA 1HUXA 4KBOA 1EQYA 4KI4A 1SL2A 5C12A 2E1ZA 3NDKA 4ID1A 1NKCA 1TL3A 3DI6A 2E6MA 2HOEA 5AQQA 2Z1GA 3PY8A 3A5OC 2OANA 4IJNA 4G9ZA 3KLIA 4MO4A 1NK6A 1D5AA 4TSXA 3G10A 4DB3A 4CBXA 1NM1A 4OO1J 3L3VA 1BOTO 4Z4CA 2JLEA 5M1NA 4V19S 2WONA 1C0FA 5E84A 4YOVA 2D0CA 2JGUA 2UU9K 1ZC6A 3L3UA 2E2QA 5TKYA 3KWGA 1XMOK 4OVLA 1QQMA 3C7NB 3MK6A 4DQPA 3LDNA 3MEEA 4G1QA 2D0BA 5J2PA 4Z4HA 3ATVA 2V51B 2G8KA 4JKGA 3NGIA 4E7LA 4NXMK 5BPNA 4DLGA 2RN2A 3OJSA 4DUZK 1JL1A 4CEQA 1S1WA 3UKRA 3F2KA 4HUGA 4YHHK 2Q31A 3EL2A 3ULEA 2ATQA 4Z4GA 3PLAA 2VG6A 2OCEA 3QB0A 3VQ6A 4M3TA 3ZSXA 5AQWA 3EZWA 3O9RA 3THVA 4E1MA 1N33K 1J53A 1Q8IA 1XI1A 1KTQA 4BDZA 4GY2B 4YOWA 2G8WA 4OKEA 4BRFA 3K5OA 1W9HA 3U6FA 4BQZA 4KFBA 4JI1K 3R3LA 4JKDA 4CHZA 2YHBA 3VF2A 1Z25A 2IOCA 4PUOA 4Q0BA 3H1QA 3T1YK 4O5FA 3PSFA 4NO7A 5BR8K 4FJHA 2A6AA 1KCFA 4W5OA 3LM9A 4HHTA 3U9ZA 1VQON 1WBBA 4CK3A 2P9SB 4KH5A 4PWDA 3ZT2A 3IS9A 4JAXA 3QICA 3IG1A 1ILYA 3KKSA 3C6TA 3ZETA 4QS9A 4PHTX 1RDBA 2NRVA 3B6PA 3NGZA 2IAJA 1VQMN 3PUFA 4LY7A 5AQZA 1HKCA 1YJWN 3AA2A 4BRHA 3LDQA 4FLYA 3SQ2A 1HNZK 2QWPA 3VQDA 4DV5K 5DM6L 2B4JA 1I3AA 1EWRA 3SAGA 1UA1A 1LW2A 2R7YA 2HF3A 3OJUA 4NXNK 2P9PA 4E19A 1RCHA 4H0OA 1R0AA 2WTUA 3NH2A 5C42A 5CE3A 4EIAA 2QWQA 2QI2A 1TL1A 3QERA 2XY5A 1X1PA 3QBXA 4CHOA 3S3NA 1CZ9A 1RGIA 1W7AA 1OVYA 1EETA 3ZSZA 1GLLO 1FW6A 1ESVA 1NK7A 3TAQA 1NJZA 2P9NA 3HP9A 1I39A 4JK8A 3CCUN 4M7XA 4N47A 4NCAA 2E2PA 2GBZA 1T44A 4E89A 2YJEA 4CJEA 1XMQK 1S9GA 4K8ZA 4CZEA 1UOCA 1EP4A 1XNRK 1KFDA 4DTOA 3QETA 3K57A 3K5MA 3O4WA 2P9IB 2X6NA 4GVEA 1K8AO 4FM0A 2Y1IA 2HMIA 2HHSA 4CGDA 4RW4A 4DU4A 3LZJA 3WQUA 5EVZA 1SL1A 4IG3A 3VEXA 3HP6A 5AQFA 4E7KA 2WBNA 4JS5A 1HJRA 1N5YA 4W5QA 3ISNC 4FPBA 5HP1A 4B3OA 3F5TA 1KVAA 5C2FA 3CJBA 2EHGA 3AAPA 4JI4K 2ASPA 3GBTA 4FW2A 4IFVA 3CCVN 1QZ6A 3O9UA 2ZWHA 2XY6A 1ZBSA 4CJ3A 1K9MO 4BY9C 3KJVA 4CJVA 3EZ5A 1N34K 3DXMA 5JS1A 4GV9A 4BE2A 3VQBA 2QKKA 3M8SA 4FCYA 1Q86O 1RBTA 1NGAA 1S1UA 3V9UA 1A5XA 1RT1A 1IKWA 1KVCA 3OVNA 2QWLA 3QO9A 1QHAA 3VF6A 4A59A 4CFAA 5C10A 4DV3K 4B9VA 1QQOA 4WQ4C 5C15A 2FBYA 1GOCA 2QXFA 2YHYA 3NHGA 3MAQA 3N4QA 3SMPA 4B9QA 3LDOA 5JMVA 3VQ7A 3AA4A 4Z4IA 1IV0A 4DR1K 4MLHA 4DV6K 3CERA 1ATRA 4AHRA 3TAEA 4DQ8A 3DAWA 4DR2K 2VWBA 2BE2A 4B9TA 4DF8A 3SUPA 4CEZA 5ADXA 4K8XA 2GWKA 1LAWA 3KLGA 3OYBA 4FO0A 4B3TK 4A61A 4CJTA 4J2BA 5AQUA 4H03B 3CJAA 1LOTB 1NJWA 4FXDA 3ENOA 1DKGD 4H0XB 3LP0A 3VETA 3ZSWA 4ELVA 3QLHA 3P83D 1VSFA 2XRIA 2YHWA 1T3VA 3HOTA 4M3XA 3D0PA 5AQKA 4LF7K 5C0YA 1HX1A 4B8CA 5GAGP 5CZ1A 3W3DA 1K8KB 2O8BA 4BC4A 2FF6A 5HOOA 1HKGA 2CGKA 3VEYA 3KKRA 1VQPN 1NG9A 5BN8A 3V4IA 5IWAK 1DT9A 4LD0A 4CIEA 5J1EA 4K42A 4AF1A 4DV4K 4BG8A 2OPPA 1NJYA 2HHWA 3FZLA 5DMRA 3LAMA 3VESA 2GX9A 2UXDK 1IJJA 4ELUA 1KLMA 4CF1A 3WXMB 3CYMA 4BVPA 3C0BA 1HNIA 1GLBG 3OTOK 3SUQA 1OH6A 4H5VA 3L6QA 3FGUA 3O3HA 2P9PB 5KPTA 2O8EB 1VSHA 1VSMA 4CCHA 1YVUA 3WT0A 2G8VA 5EY4A 1RT4A 1NGDA 1MA9B 3WNHA 3H46O 1HKBA 4FJJA 2Q3SA 1M1KO 4A2BA 3SAHA 4BREA 3UE5A 1I94K 1HMVA 2IIRA 2EX3A 3AVFA 1JLCA 4YY3K 4FJ8A 5JS2A 3PO4A 4JKEA 2YKMA 4KO0A 2OTJN 4GKJK 2KFZA 4CEDA 4CEOA 2EWSA 5MLCQ 4DTSA 1E4GT 4DSKA 3LDSA 2A1RA 1GLJO 4I9LA 4IEEA 1RT3A 4EHTA 4N5SA 1KSPA 3DLRA 3JXUA 4WF9L 4DS5A 3OW2M 4MO5A 5SZTA 1D8YA 1D9DA 1C0UA 1TYQA 1U45A 4OJRA 1Z6RA 3THWA 4FLXA 4FJGA 3EE9A 4IWVA 3DYAA 2CGLA 4PA1A 4YOYA 1BL3A 4JI5K 4LF4K 3SK3A 5M1PA 4BWMA 3CCEN 3VEWA 3DRPA 1VK0A 3AGRA 3DRSA 3GG4A 1BG3A 3CC2N 3AVMA 4B9MA 1RT5A 2OPRA 5FRMA 1NKEA 1FKPA 3EY1A 4FJ9A 1CLQA 3ZT4A 5EXWA 1QSSA 5BREA 1WSHA 4LFBK 1NGHA 1LCUA 5KGXA 4LH5A 2KHOA 1ASWA 3NVKA 4CJWA 1IBKK 1U2VB 3HM9A 4JHDA 1NBWA 2ZJQL 3FZHA 1BI4B 1BCMA 4L8RB 2LSNA 4ILJA 4HTLA 2BGGA 3F9KA 1W2BM 1RT7A 1X3NA 3HI0A 4H0TB 3VQCA 3SUOA 4B3RK 3BUZB 3VERA 3LPUA 3HZ6A 2O4IA 1BU6O 3OS0A 3DOLA 3LP1A 2VGNA 2QWRA 4KPYA 4A2AA 2JWLA 2P9IA 5HRRA 3TANA 3RSEB 3TTFA 2UXCK 5I3UA 3HPOA 2GUIA 1YUWA 3SBGA 3MWTA 4LSLA 1U6ZA 2PFUA 3QFPA 4CF8A 3OYHA 1GLDG 3MCPA 3OYMA 4MFBA 1NLVA 2E2NA 1WAJA 5AQOA 3U3GA 1KRPA 3C95A 4C8MA 3K0SA 3O1BA 1YTUA 5FPMA 1K73O 5CYMA 4PQUA 3UKUB 2BANA 4BRPA 3DM2A 4X64K 4EHUA 1TK5A 1C1BA 3C94A 3QEIA 1G15A 1GLCG 1HYSA 2V7YA 3P1GA 4B1VA 1LAVA 1RTIA 4DQIA 4FJNA 1FK9A 5HROA 4M3YA 1SL0A 4DR5K 2I7NA 2OTLN 5I9EB 4YOUA 4PKGA 2E8AA 1LW0A 3HJFA 4A5BA 4DTJA 5GIOA 1OH8A 4YNQA 4WQ4A 4CI6A 4FL9A 1EO1A 1DGKN 5SWMA 1YT3A 4LH4A 2E2OA 5K14A 3PX6A 3JSMA 1ITGA 1WUAA 3PO5A 1KFSA 2KZMA 3O5BA 5FLXO 1FKOA 1GLEG 4F9OA 5AQMA 4FPAA 1TKXA 1A5VA 3M8QA 4DMNA 3HOSA 1VQ4N 3FFIA 3OBYA 3JYTA 4XIUA 4DFJA 5AFUH 4BGAA 2QA4N 4OGEA 3SJJA 3TPQA 1QTMA 4O8UA 4UY8O 3KK3A 4BRNA 3DOKA 1ASVA 3WXIA 4O44A 3AO4A 3M3ZA 2QM1A 3AVLA 3VENA 4B9SA 1HYZA 3CFPA 2HHQA 4PL7A 3CFOA 3LL3A 3NF8A 1KD1O 3OY9A 4FWLA 1L5UA 1RT2A 4DQSA 4B8AB 4KB0A 1XHZA 1QSLA 4JN4A 3CJ7A 3H6EA 3E9PA 3ENHA 3NCIA 4H5TA 4CZJA 4E3SA 1NGBA 4FZYA 4JKFA 5D3GA 1RTHA 3MN5A 4FK4A 1S1XA 2BTFA 4KV8A 2WFBA 2F96A 4CHNA 4CGIA 3KWIA 3D6RA 4N76A 1JCEA 4DTPA 2E88A 3O9SA 1YVNA 4CGHA 4OPJA 3KLHA 1TKDA 4Z4EA 3QEPA 3QDKA 3A5MC 4BRQA 4CZMA 3HVTA 3CCJN 4X62K 3C6HA 4BR0A 3AARA 1VQ9N 4H5RA 3O08A 3OYJA 3CI5A 5HRNA 3B6OA 2HB5A 4DSJA 3V1RA 4DR3K 1V4TA 4FWNA 4B1YB 3WNEA 2WUSA 2VQEK 5KTQA 3SNNA 2O8BB 3ITHA 2YJFA 3PX0A 2OPQA 3SQ1A 4X66K 3VPZA 3AO3A 4CECA 3T3FA 4ZHRA 1VRTA 4C8NA 1BCOA 3QNNA 1IBMK 4Y1DA 4L3QA 4H0YB 5GAEP 1NNEA 2ITMA 4C8KA 4N41A 3HTVA 4FM2A 1BDGA 2HHTA 4MDAA 1S9EA 2CH6A 1BI4A 4KHYA 4RW9A 2X74A 4DSIA 3IKMA 3CQ8A 2KLAA 1P90A 1QVFM 4FLTA 1WLJA 3VN5A 4NCBA 1WNSA 3NMUA 1VSDA 4C8OA 1JLGA 4E1JA 2GELA 1NJXA 3S3MA 2GEMA 3OYNA 4KHUA 4CGGA 5AZIA 2RF2A 1TKTA 1RBVA 1T6DA 5AQXA 5BPLA 2B6AA 1W97L 2VG7A 3OYLA 1N36K 1Q9YA 3LP3A 3A0IX 2DFHA 4B9UA 3MWPA 2X78A 1K6YA 4IZ9A 1WOQA 2O8DB 4CJLA 3IAYA 4IDHA 1GOBA 1Q82O 3I8BA 3E01A 4QS8A 3M5RA 2HVHA 3KHYA 3THWB 1BISA 4FWKA 3ATUA 3KIOA 4DSFA 3IMXA 2IDOA 4JS4A 4CZKA 4LF6K 1EWQA 1J54A 1CXQA 1LWEA 3FFKB 4BRIA 3CJ1A 4Z0UA 1VSEA 4JI8K 3FR0A 3VEOA 3MXJA 2E5LK 4FWSA 2ZGYA 5HL7L 4WFAL 4ISFA 2HBLA 3KK1A 4Z94A 1NK5A 1RT6A 4H0VB 5EOYA 3OYAA 4KHNA 1K8KA 3QESA 3TAPA 3EO3A 1S1TA 4UQGA 2UUBK 1S6QA 2F9WA 1KQSM 1NGGA 4F3TA 4CGJA 3OS1A 4CJKA 4JI6K 5M1OA 4DKWA 1X3MA 3CPWM 2P9KB 5KPRA 1TAQA 4BWJA 1RTJA 2ZM6K 3L2RA 4CEEA 2NRWA 3THXB 3E1YA 2YV0X 4BQLA 3ASMA 2P5GA 1YTAA 2A40A 4CFBA 4DSEA 5LY3A 3OYDA 3CCLN 4CHPA 1BHLA 1B92A 1WSGA 2FSJA 5E26A 1EX4A 4JNEA 3VQEA 5EU7A 3VA0A 3AVIA 4B3MK 3KZBA 5CR4A 3NH1A 1J6ZA 2VYPA 4CE9A 2IGIA 1BA1A 2OA8A 4CD3A 3EKSA 4JV5K 4OGCA 1NOYA 1T7PA 2OZMA 3ZEUB 3CD6N 4BR5A 3VQ4A 1IKYA 3MN6A 3SLCA 3L2VA 2Q97A 1ATSA 3R8EA 1OH5A 1L3UA 1U04A 1QZ5A 4B08A 3GOIA 2D0OA 3MN7A 4N56A 3NAEA 4JK9A 2KQ2A 3SCXA 4ILHA 3MMVA 1UWBA 4PKIA 4B3SK 2X6SA 4E7JA 2HNZA 2KKZA 3AO5A 4WYBA 3OS2A 4F2RA 3CCRN 3RMDA 3KK2A 4MQ3A 3CMAN 3ZSYA 4J2AA 4HUEA 3O3FA 4GKKK 1KXPA 1HR0K 4OLAA 1J9AA 5C2DA 3GE1A 4H5NA 4KI6A 1JJ2M 4FOEA 3WEEA 3EYZA 4CW7B 1VSJA 2E20A 3AVCA 4IEIA 4FJLA 3QBWA 4NCGA 2A3ZA 4AILC 2ASOA 5AJ3K 4GNIA 4IOCL 3AY9A 5AQSA 4FWMA 3RSEA 1L3TA 2Z1HA 3BGRA 2H3GX 3M6GA 5AQTA 2KTQA 1IG8A 3L2UA 3SV4A 3J80O 3V9SA 3AV9A 3PX4A 2YCHA 3O6WA 2HHXA 3MX2A 3MX5A 2KZZA 4LF5K 4IXCA 5LL6Z 3R6MA 1T8EA 1NK9A 3OYCA 4JI3K 1O1WA 3DJCA 3ZX2A 2DTUA 1HNVA 2G8IA 2WOMA 4DFPA 4BVOA 2BDPA 1C6VA 1S3XA 5AZJA 3SPZA 4CK1A 3DRRA 4CESA 1SKRA 3CFRA 3F73A 3L0QA 4JKCA 2YHXA 3H45C 4FW1A 1M90O 4B1XB 3ID6A 4BDYA 1CXUA 3DXKB 3OHRA 2ASMA 1ZBIA 1S72N 4IJAA 2F9TA 2IS3A 4CHQA 3FZFA 5LMUK 2QK9A 3T19A 1W0HA 5F2RA 4JI7K 1OH7A 4BE1A 4E1NA 5KGWA 2FXUA 4IG0A 5ELZA 1JCGA 4CZLA 1L3VA 2G8HA 2B5JA 4KREA 2ITGA 4IFEA 2P9UB 2VCPA 4IBNA 4YFUA 2RKIA 3MEGA 4EFHA 2W42A 1NWKA 4BRMA 4AHCA 1NGJA 4GVMA 5HLFA 1BQNA 5AZJB 4QS7A 3M1FA 3T69A 4M3ZA 3WXJA 2O8DA 4BR4A 1IKVA 4JD2B 3HXMA 2RPIA 4W5NA 1Q81O 1U48A 1TYQB 3ZSRA 2V52B 2UXBK 2HBMA 1IKXA 3VQQA 5AQVA 1HJOA 3ZSVA 4CJPA 4B9LA 3F9MA 4IFYA 5JICA 1P8ZA 3V1QA 4DCHA 3Q7BA 2P1JA 3P38A 5GAHP 1U2VA 3HSCA 2AP1A 4XEIA 3ZLJA 5GINA 4CEBA 3CHWA 4CJSA 1RTDA 4A5AA 3TU5A 2Z1IA 3BZCA 3IFRA 1XNQK 2P9SA 2AJQA 2E6LA 1SKSA 2FLOA 3I55N 3S9HA 1MWKA 3HT3A 3P31A 4ZTFA 3UIQA 4DV2K 4LFAK 3TAFA 2UUAK 3AVAA 5KRSA 1IH7A 3BDPA 3ZSQA 3KD1E 3VMFB 5A2QO 1VHXA 4JRPA 1NK0A 3D2FB 1R59O 4BACA 3UKUA 4CF2A 3T1AA 3D2FA 3MEDA 3HPGA 4GV6A 1VQLN 3EE8A 1X9SA 4I9QA 3V1OA 3PV8A 1C1CA 3MXMA 2D0PA 4WCEL 5BN9A 3L8BA 1WAFA 1A5WA 4RWTA 4HCBA 1JKHA 3CMEN 1U49A 1SZ2A 5LMNK 3TARA 3E9LA 4O5BA 4PKHA 3ALYA 4QAGA 4C1NI 1NMDA 4M63C 1KVBA 3T7ZA 1QS4A 4C23A 4AM7A 4CFDA 4OKKA 4HVJA 3L4IA 4FK0A 1MU2A 1NK4A 3VQAA 4CJ5A 3M8PA 1NMNA 4PL8A 3TAMA 2D5RA 4I6MB 2OYQA 3W0LA 1TGOA 1YXQA 1Y64A 3ZT1A 4JKAA 2ZF5O 3SQ4A 1Z05A 4AHTA 2G8UA 1JLAA 3RRHA 3SUNA 5JLFA 5AQGA 2O8EA 3DLKA 4DV1K 3RTVA 2XY7A 4Q5VA 1Y97A 1VSIA 5FROA 4KHWA 1TK8A 1WBDA 3WQTA 4RW7A 4FWRA 1SQKA 4I6MA 3QEWA 3NBPA 1C1AA 1WSJA 4FLVA 3OYIA 4KTWA 2FF3B 2XHBA 3HRGA 4WQ5A 3TI0A 1U4BA 4JLHA 4DV0K 3UB5A 3VQPA 1BO5O 1UA0A 3V6DA 3LANA 5F1XA 1NOZA 2HSTA 3LP2A 3WNFA 1E3MA 3J7AP 2HF4A 1LV5A 4HCCA 1RBRA 2QW9A 1XC9A 4DHYA 3O9TA 4B1UB 3MCAB 3HVRA 4FVMA 4Y0WA 3JAMO 4AHVA 1UAXA 3UKRB 1Q7YO 3K58A 4BE0A 3I0SA 1WN7A 2NRTA 4CIFA 3TR8A 5AQLA 1DEJA 4JKGB 1O13A 5AQYA 1SAZA 1HQUA 5FPNA 3Q7CA 1B9DA 3DWLA 3J8AA 4NYFA 3DMJA 4AHUA 5C24A 3TSQA 4XH1A 2OPSA 3PIOL 4FM1A 3VF4A 2P51A 3C6UA 4DFMA 1YIJN 2BH1A 3GL1A 1TK0A 1H1VA 4FWOA 4WFNL 3FZMA 4RCHA 3V9ZA 4NLBA 3DLHA 4EZ6A 3THYB 3AO2A 3EN9A 3RR8A 1TUUA 2O4GA 4M3UA 4FLZA 1GLFO 3SQ0A 1F21A 3E66A 2HNDA 3TABA 5CYQA 4DSLA 4IO8A 1C0MA 2YNGA 1FXXA 2HBKA 4C8LA 4RTFD 3CM5A 4AM6A 1J5EK 4EP5A 1QHTA 5E41A 2I7PA 4CF9A 3QIPA 1G99A 4GMJB 3S41A 3V81A 3SYZA 3OYEA 1KC8O 4U67L 1QVGM 2NRXA 3AO1A 3C6AA 4RW6A 3SAFA 3L2QA 3HK2A 3K2PA 2FC0A 4ILGB 1JLQA 3R1XA 4DR6K 3B8AX 2F4VK 4KTZA 1EXQA 3RWUA 1YI2N 4IOAL 3ID8A 4FLUA 4H8KA 3AVGA 4DLEA 1X9WA 3QNOA 1Q18A 3CJCA 1NGFA 3HM8A 3DLGA 4ISEA 2HMPA 1VSKA 3CQXA 2NZTA 4CF0A 5LJVA 3AVKA 3DXMB 3AA3A 4CERA 3T1HK 4LC9B 4CZFA 1S1VA 5M1QA 5KQ8A 1YJ9N 3O1WA 1QQNA 3CCQN 4A57A 3WXLA 2PZSA 1ASUA 2DPNA 3L2WA 4OPAA 4M45A 1NJIO 3HO1A 2A41A 4M3WA 3CIPA 2DY4A 5KPZA 1WSEA 5AFUA 1ZBFA 1TKZA 2D0AA 1LWCA 1VRUA 2NRRA 2YNHA 3GDQA 1JXBA 4DQQA 3NF7A 3MXIA 4DFKA 4OLBA 4WQ5C 2FBXA 3TTDA 5FDLA 1SS6A 3IUCA 4OPHA 1HYVA 1ZXOA 2YHAA 3DLBA 3QIOA 1IBLK 1HLUA 2XY8A 3E9OA 4W5RA 3U3YA 2GTDA 3TAGA 4CJQA 3PSIA 3A8YA 3J7YP 3ENBA 3VEVA 2FBTA 4E0DA 2KFNA 2FSNA 3SMSA 4W5TA 1RILA 4BR7A 5HBMA 4RG8A 4M41A 2Q2RA 3H1VX 4Z4FA 2HHVA 4FZXC 3VGLA 2UUCK 5DK5A 3ZT3A 5AQHA 3DXKA 3OYGA 4CBUA 1SV5A 3AA5X 2ZJPL 2PBDA 1JLEA 5KRTA 4M7YA 3JS6A 4KTQA 1BGXT 3RR7A 2P5OA 2Q0UA 5M1FA 4CJRA 1X9MA 4OX9K 1JLFA 3LM2A 4F3OA 4OPKA 4CEFA 2O8FA 5HRSA 4CBWA 3K9KA 2XO7A 1EKEA 4BGBA 3O8MA 3LDPA 4M3RA 1SUQA 1RNHA 4I2PA 4FWQA 1DLOA 2E4LA 3LZIA 3ZEUA 3G6EN 2RE2A 1NGEA 2IC3A 4CZHA 4KH6A 4BR2A 2VQFK 4DQRA 3O9QA 2O8CB 3LAKA 3LDLA 3ULEB 5CHIA 4KHSA 3VTIA 2O8CA 3CG7A 2DFFA 4A62A 4XH4A 4ID5A 1VQ8N 3A5NC 4DR7K 3WXKA 4IDKA 1QE1A 2P9LB 1BQMA 1S22A 5BRFA 2V7ZA 3BZKA 5T7BA 3KLEA 4HWIA 3NF9A 4FJXA 3C7NA 4KH4A 4BRKA 4FOIA 3OYFA 5KI6A 3NH0A 1N6QA 1C0TA 5FPDA 4KRFA 3HSTB 4NB4A 4BROA 4KB1A 4H4OA 3CETA 4MDBA 3QEXA 3VGMA 1T6CA 4F2SA 4XH5A 2A5XA 4B9NA 1N8RO 3RMCA 2A1SA 1T03A 1BIUA 5BRHA 3I56N 2J4RA 2QKBA 3RMAA 4BR9A 2ZQBA
chains in the Genus database with same CATH topology
4E1NA 3LPUA 5KGWA 4IG0A 1Z26A 4G1QA 4ELTA 2O4IA 1L3VA 2D0BA 3OS0A 2G8HA 2B5JA 2I5JA 4KREA 3DOLA 2ITGA 3LP1A 3DLEA 5J2PA 4IBNA 4Z4HA 4YFUA 2RKIA 4KPYA 2G8KA 3TANA 5HRRA 3MECA 3MEGA 2W42A 3NGIA 4E7LA 5I3UA 3LWLA 4DLGA 2RN2A 3OJSA 1JL1A 4AHCA 4CEQA 1S1WA 3H08A 4GVMA 4HUGA 5HLFA 1BQNA 3HPOA 4FJMA 2GUIA 4M3ZA 2ATQA 4HTUA 4Z4GA 2VG6A 4LSLA 1IKVA 3VQ6A 4M3TA 3VQ5A 3SZ2A 3HXMA 2RPIA 3ZSXA 4W5NA 3THVA 5FRNA 4CF8A 4E1MA 1U48A 3ZSRA 3OYHA 1J53A 3OYMA 1Q8IA 1XI1A 1IKXA 1KTQA 4BDZA 4MFBA 3VQQA 1WAJA 2NUBA 2G8WA 4OKEA 3ZSVA 4CJPA 3K5OA 4IFYA 4B9LA 1W9HA 3U6FA 3U3GA 1KRPA 3C95A 4C8MA 3V1QA 1YTUA 3O4NA 4KFBA 5I42A 4CHZA 4BDPA 2YHBA 5CYMA 2P1JA 4PQUA 1Z25A 2IOCA 2BANA 3NE6A 4PUOA 3DM2A 4Q0BA 4QCLA 4OKJA 1TK5A 1C1BA 3C94A 4CEBA 3QEIA 4CJSA 1RTDA 4CJ4A 1G15A 1HYSA 3P1GA 3HL8A 1LAVA 1RTIA 2Z1IA 4DQIA 4FJNA 1FK9A 5HROA 4FJHA 4M3YA 1KCFA 4CJFA 2AJQA 4W5OA 1SL0A 2E6LA 4HHTA 1SKSA 2F8TA 3S9HA 4CK3A 1NKBA 3HT3A 4ZTFA 3UIQA 4PWDA 3ZT2A 4WE1A 1LW0A 3TAFA 3AVAA 4AHSA 1IH7A 5KRSA 3BDPA 3IS9A 4F8RA 3ZSQA 3HJFA 3KD1E 3IG1A 3KKSA 3C6TA 4DTJA 4YNQA 1B9FA 4JRPA 1NK0A 1D9FA 1RDBA 3B6PA 3NGZA 2IAJA 5SWMA 4BACA 3PUFA 4CF2A 3T1AA 4LY7A 4R5PA 3AA2A 1YT3A 3MEDA 3HPGA 4LH4A 4FLYA 3KLFA 3SQ2A 1X9SA 4I9QA 3V1OA 3PV8A 4H4MA 1C1CA 5K14A 3MXMA 3S3OA 3P5JA 4NYNA 3M8RA 3PX6A 3JSMA 3VQDA 1ITGA 3L8BA 1A5WA 1WAFA 3AVNA 4DG1A 2B4JA 1KFSA 3PO5A 2KZMA 1JLBA 1I3AA 1FKOA 2KW4A 4HCBA 1TKXA 1A5VA 3M8QA 4DMNA 4KHQA 1UA1A 1JKHA 3SV3A 1LW2A 4DS4A 1U49A 2R7YA 3FFIA 3TARA 3OJUA 4O5BA 3ALYA 4QAGA 3JYTA 4E19A 1RCHA 2ZE2A 4XIUA 4FLWA 4DFJA 1R0AA 3NH2A 5C42A 4OGEA 3SJJA 1KVBA 4ZTJA 1TL1A 3QERA 1QS4A 2XY5A 4CFDA 4OKKA 4HVJA 1QTMA 1X1PA 4KAZA 3NF6A 4CHYA 4FK0A 3KK3A 3DOKA 4DTUA 1ASVA 3AVHA 1MU2A 4GW6A 2YNIA 1J5OA 1NK4A 4CHOA 4DQPA 3VQAA 4CJ5A 3M8PA 1ZBHA 3S3NA 5C25A 3TAMA 1CZ9A 3NFAA 4O44A 1HQEA 4J2DA 3AO4A 2D5RA 1EETA 2G8FA 3ZSZA 2OYQA 3AVLA 2PYJA 1TGOA 1NK7A 4EZ9A 3TAQA 4B9SA 4M42A 1NJZA 1HYZA 3HP9A 3CFPA 1ZBLA 2HHQA 1L3SA 3ZT1A 2OZSA 3CFOA 4PY5A 1I39A 3SQ4A 3NF8A 4AHTA 2G8UA 1JLAA 3RRHA 3OY9A 4E7IA 3SUNA 4N47A 1L5UA 4QOZB 1RT2A 4NCAA 4DQSA 2VG5A 4DTXA 1VSLA 4B8AB 3DLKA 4KB0A 2GBZA 1XHZA 1QSYA 3RTVA 2XY7A 1QSLA 4CIGA 4E89A 4Q5VA 1Y97A 1VSIA 5FROA 4CJEA 3NCIA 1TK8A 4KHWA 2HHUA 4I7FA 1S9GA 3O3GA 4RW7A 4E3SA 4K8ZA 1UOCA 4FZYA 5D3GA 1EP4A 1RTHA 1KFDA 4FK4A 1S1XA 4DTMA 4DTOA 4KV8A 3QEWA 3QETA 3K57A 2F96A 3NBPA 1C1AA 2DFEA 4O4GA 4CGIA 1WSJA 4CHNA 3K5MA 4FLVA 2X6NA 3OYIA 4KTWA 2XHBA 4N76A 4DTPA 4CFCA 4CGHA 1TKDA 4OPJA 3TI0A 3KLHA 4JLHA 4FM0A 2Y1IA 1U4BA 3QEPA 2HMIA 4Z4EA 2HHSA 4CGDA 3VQPA 1UA0A 4RW4A 4DU4A 3HVTA 3NGYA 3V6DA 1DTQA 3LANA 2PY5A 3LZJA 1NOZA 1RDDA 3LP2A 3WNFA 1SL1A 4IG3A 4FYDA 1T05A 3HP6A 4E7KA 1LV5A 1RBRA 1XC9A 1IG9A 4JS5A 4HCCA 4CEAA 3TWHA 3OYJA 1HJRA 5HRNA 3B6OA 3HVRA 2HB5A 1N5YA 4DSJA 4W5QA 3ISNC 4FVMA 3V1RA 4AHVA 5HP1A 1UAXA 1TVRA 4ICLA 1U47A 3WNEA 4B3OA 3K58A 1KVAA 5KTQA 4BE0A 3HYFA 3I0SA 5J2MA 1WN7A 3SNNA 2EHGA 4CIFA 3TR8A 4JRQA 2Y1JA 3ITHA 3PX0A 4FW2A 1HQUA 2OPQA 4IFVA 3SQ1A 1B9DA 2XY6A 3LALA 4CJ3A 3AO3A 4NYFA 4CECA 2Z1JA 3DMJA 3T3FA 4ZHRA 4AHUA 3KJVA 1VRTA 3VQ8A 4C8NA 5C24A 4CJVA 3EZ5A 1BCOA 3QNNA 3ZSOA 5JS1A 4BE2A 4Y1DA 3VQBA 2QKKA 2OPSA 4C8KA 3M8SA 4FCYA 4FM1A 4N41A 1RBTA 4FM2A 1S1UA 2HHTA 3V9UA 1A5XA 2P51A 3C6UA 1S9EA 2FBVA 1BI4A 1IKWA 1RT1A 4DFMA 1KVCA 3OVNA 3V9WA 1TK0A 4KHYA 4RW9A 4CK2A 2X74A 3V9ZA 3QO9A 3VQ9A 3DLHA 4DSIA 5CY4A 4EZ6A 4CJUA 1DTTA 4EP4A 4CFAA 3AO2A 3CQ8A 3RR8A 4B9VA 4FLTA 2O4GA 3ULDA 4DTNA 1WLJA 3VN5A 4NCBA 4M3UA 1WNSA 2FBYA 4FLZA 3SQ0A 1F21A 1VSDA 3K5NA 4C8OA 4FZZA 4O0IA 1JLGA 1GOCA 1NJXA 2QXFA 3S3MA 1CZBA 2HNDA 5CYQA 3OYNA 3TABA 4DSLA 3NHGA 3MAQA 3VA3A 1C0MA 2YNGA 1FXXA 3K59A 4C8LA 4KHUA 3KD5E 3CM5A 4CGGA 1S5JA 4AH9A 4FK2A 2YNFA 3VQ7A 4EP5A 2F8SA 2RF2A 1TKTA 1RBVA 1QHTA 3AA4A 3IRXA 3CM6A 2GV9A 5E41A 2B6AA 1TV6A 4CF9A 3QIPA 1HPZA 4Z4IA 4GMJB 1TAUA 2VG7A 3V81A 3OYLA 4AHRA 1Q9YA 3ZT0A 3LP3A 3OYEA 3SYZA 3TAEA 2DFHA 3AO1A 4RW6A 3L2QA 3HK2A 2BE2A 4DWIA 4B9UA 3K2PA 2FC0A 1K6YA 2X78A 4FJKA 4B9TA 4DF8A 3LWMA 3SUPA 4CEZA 1JLQA 4CJLA 3IAYA 4K8XA 1GOBA 3SPYA 1LAWA 1RBSA 3E01A 3KTQA 3KLGA 5HRPA 4KTZA 2HVHA 1IO2A 3OYBA 1EXQA 2HVIA 1BISA 3RWUA 3QINA 3KIOA 4CJTA 4DSFA 4FLUA 4J2BA 3I8DA 3SI6A 4H8KA 2IDOA 4JS4A 3AVGA 1NJWA 4FXDA 4DLEA 1X9WA 1J54A 1CXQA 1LWEA 3QNOA 1WSFA 3DLGA 1VSKA 3LP0A 3ZSWA 4ELVA 4J2EA 3QLHA 4O0JA 3P83D 4Z0UA 4CF0A 3AVKA 1VSEA 1JXEA 1VSFA 2XRIA 4FJ5A 4I2QA 3AA3A 4CERA 3MXJA 4M3XA 3D0PA 1S1VA 4DF4A 4F4KA 3KK1A 1SKWA 1NK5A 1RT6A 4B8CA 2PZSA 3OYAA 4KHNA 3QESA 3TAPA 1QQCA 5CZ1A 1ASUA 1WSIA 1S1TA 3L2WA 3LPTA 3QEVA 4UQGA 1S6QA 4M45A 4F3TA 4CGJA 3OS1A 3HO1A 3KKRA 4CJKA 4M3WA 2DY4A 3RRGA 3V4IA 4LD0A 1WSEA 4HUFA 4CIEA 5J1EA 1TAQA 4BWJA 1RTJA 1ZBFA 1TKZA 3L2RA 2OPPA 3O4QA 1HRHA 1LWCA 1GOAA 1VRUA 2D0AA 2YNHA 1JXBA 4CEEA 3NF7A 4DQQA 4DU3A 4DFKA 3MXIA 1NJYA 4OLBA 2HHWA 2YV0X 2FBXA 5DMRA 5FDLA 3ASMA 3LAMA 2P5GA 1HYVA 1YTAA 5J2QA 2YHAA 3I0RA 3DLBA 3QIOA 4CFBA 4DSEA 4FJIA 2XY8A 4W5RA 3U3YA 4RW8A 3OYDA 4ELUA 1KLMA 3TAGA 4CF1A 4CJQA 1BHLA 4CHPA 1B92A 1WSGA 4LSNA 1KLNA 3CYMA 1EX4A 4IKFA 2HW3A 3VQEA 1HNIA 1RBUA 4KKOA 2FBTA 5EU7A 4E0DA 3SUQA 3A2FA 3VA0A 2KFNA 2YKNA 1BIZA 3D45A 4W5TA 1RILA 3AVIA 5HBMA 1XHXA 5CZ2A 3NH1A 4RG8A 4M41A 3O3HA 4O55A 4CE9A 2IGIA 1VSHA 1VSMA 4Z4FA 2HHVA 2OA8A 4FZXC 4CCHA 1YVUA 2G8VA 1RT4A 5DK5A 1LWFA 3ZT3A 4OGCA 3WNHA 3V9XA 1NOYA 3OYGA 1T7PA 2OZMA 3VQ4A 1IKYA 1SV5A 3L2VA 3G0ZA 3AA5X 2Q3SA 4FJJA 1JLEA 1HMVA 2EX3A 3ZCMA 3AVFA 1JLCA 5KRTA 1U04A 3WNGA 1L3UA 4FJ8A 5JS2A 4B08A 1Q9XA 3PO4A 4KTQA 1BGXT 3RR7A 1RDAA 2YKMA 4KO0A 4N56A 2P5OA 3NAEA 3RMBA 3SCXA 2KQ2A 2KFZA 1UWBA 3AVBA 4CJRA 1X9MA 5J2NA 1REVA 2ZD1A 4CEDA 4CEOA 2X6SA 1JLFA 4E7JA 2HNZA 1JL2A 3AO5A 1XWLA 3OS2A 4DU1A 4F2RA 3RMDA 4F3OA 3KK2A 4OPKA 4MQ3A 4DTSA 4DSKA 3ZSYA 4CEFA 4J2AA 2ETJA 5HRSA 3LDSA 4HUEA 4DTRA 2A1RA 2XO7A 3O3FA 4I9LA 1EKEA 2PYLA 2HNYA 1RT3A 4M3RA 1SUQA 1RNHA 3AVJA 3DLRA 4I2PA 1ZBUA 4Y1CA 1DLOA 4N5SA 1NK8A 4OLAA 2E4LA 3LZIA 1J9AA 4DS5A 4KI6A 3OYKA 1ZYQA 5SZTA 3EYZA 1D8YA 1D9DA 1C0UA 1U45A 2IC3A 1VSJA 4OJRA 2VWJA 4E7HA 4CGFA 4DQRA 3AVCA 4FLXA 3LAKA 4FJGA 3DYAA 4FJLA 2VWKA 4NCGA 4PA1A 4KHSA 4AILC 1S6PA 3CG7A 1RDCA 4FJ7A 2DFFA 3HPHA 3K5LA 1BL3A 4ID5A 1L3TA 2Z1HA 4KI4A 3BGRA 4IDKA 1SL2A 1QE1A 4BWMA 1BQMA 2KTQA 3L2UA 3NDKA 3DRPA 3SV4A 1VK0A 4ID1A 3V9SA 3DRSA 1NKCA 1TL3A 3AV9A 3DI6A 2E6MA 3PX4A 2KZZA 2HHXA 5T7BA 4B9MA 3AVMA 3KLEA 2Z1GA 3PY8A 3NF9A 4FJXA 1T8EA 1RT5A 1NK9A 3KLIA 2OPRA 3OYFA 5KI6A 3NH0A 3OYCA 1NKEA 1NK6A 5FRMA 1FKPA 1O1WA 2DTUA 1D5AA 3EY1A 4FJ9A 1HNVA 1N6QA 3ZT4A 1C0TA 2G8IA 4KRFA 1CLQA 2WOMA 4DFPA 3HSTB 1QSSA 1WSHA 2BDPA 4H4OA 1C6VA 4TSXA 4KB1A 3G10A 3QEXA 5KGXA 4LH5A 3SPZA 4CK1A 3DRRA 1ASWA 4F2SA 4CESA 4CJWA 1SKRA 3L3VA 4Z4CA 3CFRA 3F73A 2JLEA 3HM9A 4B9NA 2WONA 4FW1A 2D0CA 3RMCA 2JGUA 4BDYA 1KSPA 1BI4B 2A1SA 1BCMA 1CXUA 1T03A 4L8RB 2LSNA 1BIUA 3L3UA 1ZBIA 2BGGA 2IS3A 4CHQA 3F9KA 4OVLA 2QK9A 3T19A 1RT7A 2QKBA 3VQCA 3SUOA 1W0HA 3RMAA 2ZQBA 4BE1A 3MEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1N A;  3LPU A;  5KGW A;  4IG0 A;  1Z26 A;  4G1Q A;  4ELT A;  2O4I A;  1L3V A;  2D0B A;  3OS0 A;  2G8H A;  2B5J A;  2I5J A;  4KRE A;  3DOL A;  2ITG A;  3LP1 A;  3DLE A;  5J2P A;  4IBN A;  4Z4H A;  4YFU A;  2RKI A;  4KPY A;  2G8K A;  3TAN A;  5HRR A;  3MEC A;  3MEG A;  2W42 A;  3NGI A;  4E7L A;  5I3U A;  3LWL A;  4DLG A;  2RN2 A;  3OJS A;  1JL1 A;  4AHC A;  4CEQ A;  1S1W A;  3H08 A;  4GVM A;  4HUG A;  5HLF A;  1BQN A;  3HPO A;  4FJM A;  2GUI A;  4M3Z A;  2ATQ A;  4HTU A;  4Z4G A;  2VG6 A;  4LSL A;  1IKV A;  3VQ6 A;  4M3T A;  3VQ5 A;  3SZ2 A;  3HXM A;  2RPI A;  3ZSX A;  4W5N A;  3THV A;  5FRN A;  4CF8 A;  4E1M A;  1U48 A;  3ZSR A;  3OYH A;  1J53 A;  3OYM A;  1Q8I A;  1XI1 A;  1IKX A;  1KTQ A;  4BDZ A;  4MFB A;  3VQQ A;  1WAJ A;  2NUB A;  2G8W A;  4OKE A;  3ZSV A;  4CJP A;  3K5O A;  4IFY A;  4B9L A;  1W9H A;  3U6F A;  3U3G A;  1KRP A;  3C95 A;  4C8M A;  3V1Q A;  1YTU A;  3O4N A;  4KFB A;  5I42 A;  4CHZ A;  4BDP A;  2YHB A;  5CYM A;  2P1J A;  4PQU A;  1Z25 A;  2IOC A;  2BAN A;  3NE6 A;  4PUO A;  3DM2 A;  4Q0B A;  4QCL A;  4OKJ A;  1TK5 A;  1C1B A;  3C94 A;  4CEB A;  3QEI A;  4CJS A;  1RTD A;  4CJ4 A;  1G15 A;  1HYS A;  3P1G A;  3HL8 A;  1LAV A;  1RTI A;  2Z1I A;  4DQI A;  4FJN A;  1FK9 A;  5HRO A;  4FJH A;  4M3Y A;  1KCF A;  4CJF A;  2AJQ A;  4W5O A;  1SL0 A;  2E6L A;  4HHT A;  1SKS A;  2F8T A;  3S9H A;  4CK3 A;  1NKB A;  3HT3 A;  4ZTF A;  3UIQ A;  4PWD A;  3ZT2 A;  4WE1 A;  1LW0 A;  3TAF A;  3AVA A;  4AHS A;  1IH7 A;  5KRS A;  3BDP A;  3IS9 A;  4F8R A;  3ZSQ A;  3HJF A;  3KD1 E;  3IG1 A;  3KKS A;  3C6T A;  4DTJ A;  4YNQ A;  1B9F A;  4JRP A;  1NK0 A;  1D9F A;  1RDB A;  3B6P A;  3NGZ A;  2IAJ A;  5SWM A;  4BAC A;  3PUF A;  4CF2 A;  3T1A A;  4LY7 A;  4R5P A;  3AA2 A;  1YT3 A;  3MED A;  3HPG A;  4LH4 A;  4FLY A;  3KLF A;  3SQ2 A;  1X9S A;  4I9Q A;  3V1O A;  3PV8 A;  4H4M A;  1C1C A;  5K14 A;  3MXM A;  3S3O A;  3P5J A;  4NYN A;  3M8R A;  3PX6 A;  3JSM A;  3VQD A;  1ITG A;  3L8B A;  1A5W A;  1WAF A;  3AVN A;  4DG1 A;  2B4J A;  1KFS A;  3PO5 A;  2KZM A;  1JLB A;  1I3A A;  1FKO A;  2KW4 A;  4HCB A;  1TKX A;  1A5V A;  3M8Q A;  4DMN A;  4KHQ A;  1UA1 A;  1JKH A;  3SV3 A;  1LW2 A;  4DS4 A;  1U49 A;  2R7Y A;  3FFI A;  3TAR A;  3OJU A;  4O5B A;  3ALY A;  4QAG A;  3JYT A;  4E19 A;  1RCH A;  2ZE2 A;  4XIU A;  4FLW A;  4DFJ A;  1R0A A;  3NH2 A;  5C42 A;  4OGE A;  3SJJ A;  1KVB A;  4ZTJ A;  1TL1 A;  3QER A;  1QS4 A;  2XY5 A;  4CFD A;  4OKK A;  4HVJ A;  1QTM A;  1X1P A;  4KAZ A;  3NF6 A;  4CHY A;  4FK0 A;  3KK3 A;  3DOK A;  4DTU A;  1ASV A;  3AVH A;  1MU2 A;  4GW6 A;  2YNI A;  1J5O A;  1NK4 A;  4CHO A;  4DQP A;  3VQA A;  4CJ5 A;  3M8P A;  1ZBH A;  3S3N A;  5C25 A;  3TAM A;  1CZ9 A;  3NFA A;  4O44 A;  1HQE A;  4J2D A;  3AO4 A;  2D5R A;  1EET A;  2G8F A;  3ZSZ A;  2OYQ A;  3AVL A;  2PYJ A;  1TGO A;  1NK7 A;  4EZ9 A;  3TAQ A;  4B9S A;  4M42 A;  1NJZ A;  1HYZ A;  3HP9 A;  3CFP A;  1ZBL A;  2HHQ A;  1L3S A;  3ZT1 A;  2OZS A;  3CFO A;  4PY5 A;  1I39 A;  3SQ4 A;  3NF8 A;  4AHT A;  2G8U A;  1JLA A;  3RRH A;  3OY9 A;  4E7I A;  3SUN A;  4N47 A;  1L5U A;  4QOZ B;  1RT2 A;  4NCA A;  4DQS A;  2VG5 A;  4DTX A;  1VSL A;  4B8A B;  3DLK A;  4KB0 A;  2GBZ A;  1XHZ A;  1QSY A;  3RTV A;  2XY7 A;  1QSL A;  4CIG A;  4E89 A;  4Q5V A;  1Y97 A;  1VSI A;  5FRO A;  4CJE A;  3NCI A;  1TK8 A;  4KHW A;  2HHU A;  4I7F A;  1S9G A;  3O3G A;  4RW7 A;  4E3S A;  4K8Z A;  1UOC A;  4FZY A;  5D3G A;  1EP4 A;  1RTH A;  1KFD A;  4FK4 A;  1S1X A;  4DTM A;  4DTO A;  4KV8 A;  3QEW A;  3QET A;  3K57 A;  2F96 A;  3NBP A;  1C1A A;  2DFE A;  4O4G A;  4CGI A;  1WSJ A;  4CHN A;  3K5M A;  4FLV A;  2X6N A;  3OYI A;  4KTW A;  2XHB A;  4N76 A;  4DTP A;  4CFC A;  4CGH A;  1TKD A;  4OPJ A;  3TI0 A;  3KLH A;  4JLH A;  4FM0 A;  2Y1I A;  1U4B A;  3QEP A;  2HMI A;  4Z4E A;  2HHS A;  4CGD A;  3VQP A;  1UA0 A;  4RW4 A;  4DU4 A;  3HVT A;  3NGY A;  3V6D A;  1DTQ A;  3LAN A;  2PY5 A;  3LZJ A;  1NOZ A;  1RDD A;  3LP2 A;  3WNF A;  1SL1 A;  4IG3 A;  4FYD A;  1T05 A;  3HP6 A;  4E7K A;  1LV5 A;  1RBR A;  1XC9 A;  1IG9 A;  4JS5 A;  4HCC A;  4CEA A;  3TWH A;  3OYJ A;  1HJR A;  5HRN A;  3B6O A;  3HVR A;  2HB5 A;  1N5Y A;  4DSJ A;  4W5Q A;  3ISN C;  4FVM A;  3V1R A;  4AHV A;  5HP1 A;  1UAX A;  1TVR A;  4ICL A;  1U47 A;  3WNE A;  4B3O A;  3K58 A;  1KVA A;  5KTQ A;  4BE0 A;  3HYF A;  3I0S A;  5J2M A;  1WN7 A;  3SNN A;  2EHG A;  4CIF A;  3TR8 A;  4JRQ A;  2Y1J A;  3ITH A;  3PX0 A;  4FW2 A;  1HQU A;  2OPQ A;  4IFV A;  3SQ1 A;  1B9D A;  2XY6 A;  3LAL A;  4CJ3 A;  3AO3 A;  4NYF A;  4CEC A;  2Z1J A;  3DMJ A;  3T3F A;  4ZHR A;  4AHU A;  3KJV A;  1VRT A;  3VQ8 A;  4C8N A;  5C24 A;  4CJV A;  3EZ5 A;  1BCO A;  3QNN A;  3ZSO A;  5JS1 A;  4BE2 A;  4Y1D A;  3VQB A;  2QKK A;  2OPS A;  4C8K A;  3M8S A;  4FCY A;  4FM1 A;  4N41 A;  1RBT A;  4FM2 A;  1S1U A;  2HHT A;  3V9U A;  1A5X A;  2P51 A;  3C6U A;  1S9E A;  2FBV A;  1BI4 A;  1IKW A;  1RT1 A;  4DFM A;  1KVC A;  3OVN A;  3V9W A;  1TK0 A;  4KHY A;  4RW9 A;  4CK2 A;  2X74 A;  3V9Z A;  3QO9 A;  3VQ9 A;  3DLH A;  4DSI A;  5CY4 A;  4EZ6 A;  4CJU A;  1DTT A;  4EP4 A;  4CFA A;  3AO2 A;  3CQ8 A;  3RR8 A;  4B9V A;  4FLT A;  2O4G A;  3ULD A;  4DTN A;  1WLJ A;  3VN5 A;  4NCB A;  4M3U A;  1WNS A;  2FBY A;  4FLZ A;  3SQ0 A;  1F21 A;  1VSD A;  3K5N A;  4C8O A;  4FZZ A;  4O0I A;  1JLG A;  1GOC A;  1NJX A;  2QXF A;  3S3M A;  1CZB A;  2HND A;  5CYQ A;  3OYN A;  3TAB A;  4DSL A;  3NHG A;  3MAQ A;  3VA3 A;  1C0M A;  2YNG A;  1FXX A;  3K59 A;  4C8L A;  4KHU A;  3KD5 E;  3CM5 A;  4CGG A;  1S5J A;  4AH9 A;  4FK2 A;  2YNF A;  3VQ7 A;  4EP5 A;  2F8S A;  2RF2 A;  1TKT A;  1RBV A;  1QHT A;  3AA4 A;  3IRX A;  3CM6 A;  2GV9 A;  5E41 A;  2B6A A;  1TV6 A;  4CF9 A;  3QIP A;  1HPZ A;  4Z4I A;  4GMJ B;  1TAU A;  2VG7 A;  3V81 A;  3OYL A;  4AHR A;  1Q9Y A;  3ZT0 A;  3LP3 A;  3OYE A;  3SYZ A;  3TAE A;  2DFH A;  3AO1 A;  4RW6 A;  3L2Q A;  3HK2 A;  2BE2 A;  4DWI A;  4B9U A;  3K2P A;  2FC0 A;  1K6Y A;  2X78 A;  4FJK A;  4B9T A;  4DF8 A;  3LWM A;  3SUP A;  4CEZ A;  1JLQ A;  4CJL A;  3IAY A;  4K8X A;  1GOB A;  3SPY A;  1LAW A;  1RBS A;  3E01 A;  3KTQ A;  3KLG A;  5HRP A;  4KTZ A;  2HVH A;  1IO2 A;  3OYB A;  1EXQ A;  2HVI A;  1BIS A;  3RWU A;  3QIN A;  3KIO A;  4CJT A;  4DSF A;  4FLU A;  4J2B A;  3I8D A;  3SI6 A;  4H8K A;  2IDO A;  4JS4 A;  3AVG A;  1NJW A;  4FXD A;  4DLE A;  1X9W A;  1J54 A;  1CXQ A;  1LWE A;  3QNO A;  1WSF A;  3DLG A;  1VSK A;  3LP0 A;  3ZSW A;  4ELV A;  4J2E A;  3QLH A;  4O0J A;  3P83 D;  4Z0U A;  4CF0 A;  3AVK A;  1VSE A;  1JXE A;  1VSF A;  2XRI A;  4FJ5 A;  4I2Q A;  3AA3 A;  4CER A;  3MXJ A;  4M3X A;  3D0P A;  1S1V A;  4DF4 A;  4F4K A;  3KK1 A;  1SKW A;  1NK5 A;  1RT6 A;  4B8C A;  2PZS A;  3OYA A;  4KHN A;  3QES A;  3TAP A;  1QQC A;  5CZ1 A;  1ASU A;  1WSI A;  1S1T A;  3L2W A;  3LPT A;  3QEV A;  4UQG A;  1S6Q A;  4M45 A;  4F3T A;  4CGJ A;  3OS1 A;  3HO1 A;  3KKR A;  4CJK A;  4M3W A;  2DY4 A;  3RRG A;  3V4I A;  4LD0 A;  1WSE A;  4HUF A;  4CIE A;  5J1E A;  1TAQ A;  4BWJ A;  1RTJ A;  1ZBF A;  1TKZ A;  3L2R A;  2OPP A;  3O4Q A;  1HRH A;  1LWC A;  1GOA A;  1VRU A;  2D0A A;  2YNH A;  1JXB A;  4CEE A;  3NF7 A;  4DQQ A;  4DU3 A;  4DFK A;  3MXI A;  1NJY A;  4OLB A;  2HHW A;  2YV0 X;  2FBX A;  5DMR A;  5FDL A;  3ASM A;  3LAM A;  2P5G A;  1HYV A;  1YTA A;  5J2Q A;  2YHA A;  3I0R A;  3DLB A;  3QIO A;  4CFB A;  4DSE A;  4FJI A;  2XY8 A;  4W5R A;  3U3Y A;  4RW8 A;  3OYD A;  4ELU A;  1KLM A;  3TAG A;  4CF1 A;  4CJQ A;  1BHL A;  4CHP A;  1B92 A;  1WSG A;  4LSN A;  1KLN A;  3CYM A;  1EX4 A;  4IKF A;  2HW3 A;  3VQE A;  1HNI A;  1RBU A;  4KKO A;  2FBT A;  5EU7 A;  4E0D A;  3SUQ A;  3A2F A;  3VA0 A;  2KFN A;  2YKN A;  1BIZ A;  3D45 A;  4W5T A;  1RIL A;  3AVI A;  5HBM A;  1XHX A;  5CZ2 A;  3NH1 A;  4RG8 A;  4M41 A;  3O3H A;  4O55 A;  4CE9 A;  2IGI A;  1VSH A;  1VSM A;  4Z4F A;  2HHV A;  2OA8 A;  4FZX C;  4CCH A;  1YVU A;  2G8V A;  1RT4 A;  5DK5 A;  1LWF A;  3ZT3 A;  4OGC A;  3WNH A;  3V9X A;  1NOY A;  3OYG A;  1T7P A;  2OZM A;  3VQ4 A;  1IKY A;  1SV5 A;  3L2V A;  3G0Z A;  3AA5 X;  2Q3S A;  4FJJ A;  1JLE A;  1HMV A;  2EX3 A;  3ZCM A;  3AVF A;  1JLC A;  5KRT A;  1U04 A;  3WNG A;  1L3U A;  4FJ8 A;  5JS2 A;  4B08 A;  1Q9X A;  3PO4 A;  4KTQ A;  1BGX T;  3RR7 A;  1RDA A;  2YKM A;  4KO0 A;  4N56 A;  2P5O A;  3NAE A;  3RMB A;  3SCX A;  2KQ2 A;  2KFZ A;  1UWB A;  3AVB A;  4CJR A;  1X9M A;  5J2N A;  1REV A;  2ZD1 A;  4CED A;  4CEO A;  2X6S A;  1JLF A;  4E7J A;  2HNZ A;  1JL2 A;  3AO5 A;  1XWL A;  3OS2 A;  4DU1 A;  4F2R A;  3RMD A;  4F3O A;  3KK2 A;  4OPK A;  4MQ3 A;  4DTS A;  4DSK A;  3ZSY A;  4CEF A;  4J2A A;  2ETJ A;  5HRS A;  3LDS A;  4HUE A;  4DTR A;  2A1R A;  2XO7 A;  3O3F A;  4I9L A;  1EKE A;  2PYL A;  2HNY A;  1RT3 A;  4M3R A;  1SUQ A;  1RNH A;  3AVJ A;  3DLR A;  4I2P A;  1ZBU A;  4Y1C A;  1DLO A;  4N5S A;  1NK8 A;  4OLA A;  2E4L A;  3LZI A;  1J9A A;  4DS5 A;  4KI6 A;  3OYK A;  1ZYQ A;  5SZT A;  3EYZ A;  1D8Y A;  1D9D A;  1C0U A;  1U45 A;  2IC3 A;  1VSJ A;  4OJR A;  2VWJ A;  4E7H A;  4CGF A;  4DQR A;  3AVC A;  4FLX A;  3LAK A;  4FJG A;  3DYA A;  4FJL A;  2VWK A;  4NCG A;  4PA1 A;  4KHS A;  4AIL C;  1S6P A;  3CG7 A;  1RDC A;  4FJ7 A;  2DFF A;  3HPH A;  3K5L A;  1BL3 A;  4ID5 A;  1L3T A;  2Z1H A;  4KI4 A;  3BGR A;  4IDK A;  1SL2 A;  1QE1 A;  4BWM A;  1BQM A;  2KTQ A;  3L2U A;  3NDK A;  3DRP A;  3SV4 A;  1VK0 A;  4ID1 A;  3V9S A;  3DRS A;  1NKC A;  1TL3 A;  3AV9 A;  3DI6 A;  2E6M A;  3PX4 A;  2KZZ A;  2HHX A;  5T7B A;  4B9M A;  3AVM A;  3KLE A;  2Z1G A;  3PY8 A;  3NF9 A;  4FJX A;  1T8E A;  1RT5 A;  1NK9 A;  3KLI A;  2OPR A;  3OYF A;  5KI6 A;  3NH0 A;  3OYC A;  1NKE A;  1NK6 A;  5FRM A;  1FKP A;  1O1W A;  2DTU A;  1D5A A;  3EY1 A;  4FJ9 A;  1HNV A;  1N6Q A;  3ZT4 A;  1C0T A;  2G8I A;  4KRF A;  1CLQ A;  2WOM A;  4DFP A;  3HST B;  1QSS A;  1WSH A;  2BDP A;  4H4O A;  1C6V A;  4TSX A;  4KB1 A;  3G10 A;  3QEX A;  5KGX A;  4LH5 A;  3SPZ A;  4CK1 A;  3DRR A;  1ASW A;  4F2S A;  4CES A;  4CJW A;  1SKR A;  3L3V A;  4Z4C A;  3CFR A;  3F73 A;  2JLE A;  3HM9 A;  4B9N A;  2WON A;  4FW1 A;  2D0C A;  3RMC A;  2JGU A;  4BDY A;  1KSP A;  1BI4 B;  2A1S A;  1BCM A;  1CXU A;  1T03 A;  4L8R B;  2LSN A;  1BIU A;  3L3U A;  1ZBI A;  2BGG A;  2IS3 A;  4CHQ A;  3F9K A;  4OVL A;  2QK9 A;  3T19 A;  1RT7 A;  2QKB A;  3VQC A;  3SUO A;  1W0H A;  3RMA A;  2ZQB A;  4BE1 A;  3MEE A; 
#chains in the Genus database with same CATH topology
 4CZG A;  1Z26 A;  4ELT A;  3U4L A;  2I5J A;  3DLE A;  4DR4 K;  4IO9 L;  4JHD B;  3MEC A;  4NLC A;  2ZJR L;  2PAV A;  3VEZ A;  4BRL A;  3LWL A;  4DV7 K;  4O8K A;  3H08 A;  4FJM A;  1RDU A;  4HTU A;  2CGJ A;  4BC2 A;  3VQ5 A;  3SZ2 A;  2Q0R A;  2UYT A;  5FRN A;  1CZA N;  4BG9 A;  2D4W A;  4YOT A;  2NUB A;  4BRG A;  2HHH K;  3CPE A;  3O4N A;  5I42 A;  4K41 A;  4BDP A;  3EEQ A;  3NE6 A;  4QCL A;  5IT9 O;  1NGC A;  2QWO A;  4OKJ A;  5BPM A;  3RVC A;  4AQY K;  4CJ4 A;  3HL8 A;  5BRD A;  3VGK A;  4CJ7 A;  3SJH A;  2JWK A;  3EKU A;  3WEE B;  4CJF A;  4MLE A;  5FPE A;  2F8T A;  1NKB A;  1V4S A;  2QTD A;  4WE1 A;  4AHS A;  1N32 K;  1FJG K;  3TTC A;  3BY5 A;  1B9F A;  1D9F A;  3PIP L;  3CC4 N;  4R5P A;  5AQI A;  3KLF A;  5JVH L;  4H4M A;  3S3O A;  4YOX A;  3P5J A;  4NYN A;  3M8R A;  2CH5 A;  1RFQ A;  4BRD A;  4DG1 A;  1BWF O;  3AVN A;  4JI2 K;  2AA4 A;  1JLB A;  2W41 A;  2KW4 A;  5EX5 A;  4BC5 A;  1YF5 L;  4KHQ A;  4U7B A;  3N4P A;  3SV3 A;  4DS4 A;  3U8X A;  3IDH A;  4EAH D;  4FLW A;  2ZE2 A;  4DUY K;  4X65 K;  3BEX A;  2YX6 A;  4ZTJ A;  3OA9 A;  1KAX A;  4YOR A;  2IVN A;  4KAZ A;  3NF6 A;  4CHY A;  2QWM A;  4JK7 A;  4DTU A;  3AVH A;  4GW6 A;  1J5O A;  2YNI A;  3THY A;  3NVM A;  1ZBH A;  5AQR A;  5C25 A;  5M1K A;  3NFA A;  3TSP A;  1HQE A;  4J2D A;  3BP8 A;  2G8F A;  1MDU B;  2PYJ A;  4LFC K;  4EZ9 A;  4CVN E;  4M42 A;  1VQ7 N;  1ZBL A;  1L3S A;  2OZS A;  4PY5 A;  5LJW A;  2FSK A;  4QOZ B;  4E7I A;  5AQP A;  3H3O B;  2P9K A;  2VG5 A;  4DTX A;  3OBW A;  1VSL A;  4LF9 K;  1QSY A;  4CIG A;  2P9N B;  4I7F A;  3O3G A;  3CCM N;  3WUH A;  2IVO A;  4DTM A;  4O4G A;  2DFE A;  3KK7 A;  5AR0 A;  2GUP A;  2Q1N A;  4CFC A;  5ADX H;  2WC9 A;  3CXC M;  3CJ9 A;  1WB9 A;  2BUP A;  4KHP K;  2IVP A;  3NGY A;  2PY5 A;  1DTQ A;  1OKJ A;  1RDD A;  3G71 N;  4FYD A;  1T05 A;  2F7T A;  1IG9 A;  4IOX A;  4CEA A;  3TWH A;  1BA0 A;  5JVG L;  3L4Q A;  1D4X A;  3A5L C;  2P9L A;  2NRZ A;  4ICL A;  1TVR A;  1U47 A;  3ZX0 A;  3HYF A;  5J2M A;  2ZGZ A;  1GLA G;  1OVQ A;  1KAY A;  1X9J A;  3FE1 A;  4JRQ A;  2Y1J A;  4YDU C;  4CD1 A;  1XUP O;  2YI1 A;  1XQS C;  2VGM A;  3LAL A;  3TSU A;  2Z1J A;  2Q36 A;  3VQ8 A;  1VQ6 N;  3ZSO A;  3VOV A;  3P39 A;  4R79 A;  2FBV A;  5KQD A;  5AZI B;  2QEX N;  3V9W A;  1YHQ N;  4JKH A;  1BUP A;  4CK2 A;  4GV3 A;  2O8F B;  3VQ9 A;  4YDU A;  5CY4 A;  4CJU A;  1DTT A;  4EP4 A;  4K25 A;  5F0X A;  3ULD A;  4DTN A;  3SBT A;  4JKB A;  1C0G A;  3K5N A;  4FZZ A;  2W6K A;  4O0I A;  1VAZ A;  1CZB A;  3U9D A;  3VA3 A;  3K59 A;  3KVG A;  3KD5 E;  1S5J A;  4AH9 A;  4FK2 A;  2YNF A;  2F8S A;  2NNW A;  1TUY A;  3IRX A;  3CM6 A;  2GV9 A;  3DLL L;  1TV6 A;  3MDQ A;  1HPZ A;  3CF5 L;  1TAU A;  1HNX K;  3ZT0 A;  2GWJ A;  1YJN N;  3FZK A;  3ZX3 A;  1VQ5 N;  4DWI A;  4FJK A;  5B8H A;  4B1Z A;  2W40 A;  3LWM A;  3SPY A;  1RBS A;  3KTQ A;  5HRP A;  1IO2 A;  2HVI A;  3QIN A;  3I8D A;  3SI6 A;  4C1N K;  3D2E B;  5JLH A;  3FLC O;  5TKW A;  1WSF A;  3HBT A;  4J2E A;  4O0J A;  1JXE A;  4FJ5 A;  4I2Q A;  2A42 A;  4DF4 A;  4F4K A;  4BRC A;  4B1W B;  1YAG A;  1SKW A;  5AQN A;  1MWM A;  3G4S N;  4WFB L;  1VQK N;  1KAZ A;  1QQC A;  3I33 A;  1WSI A;  1E4F T;  3LPT A;  3QEV A;  3CQY A;  4H0P A;  4FSV A;  3RRG A;  5H1S Q;  4HUF A;  1VQN N;  3THX A;  3BF3 A;  3O4Q A;  1HRH A;  3VTH A;  1GOA A;  3AAQ A;  3D7E O;  4DU3 A;  3ZYY X;  3AGK A;  1ATN A;  3G25 A;  3MN9 A;  2E1Y A;  3D2E A;  5J2Q A;  3I0R A;  3QML A;  4FJI A;  1NGI A;  3CC7 N;  4RW8 A;  4CZI A;  2D1K A;  1YIT N;  1XC3 A;  4JEP A;  4FWP A;  4LSN A;  4BC3 A;  3BF1 A;  1HNW K;  1KLN A;  4IKF A;  2HW3 A;  3P4I A;  1RBU A;  2P9U A;  4KKO A;  4J8F A;  3A2F A;  3J81 O;  2YKN A;  1BIZ A;  3D45 A;  3R9P A;  1XHX A;  5CZ2 A;  4FVU A;  4O55 A;  5AQJ A;  3V9X A;  1LWF A;  3C65 A;  3G0Z A;  4LF8 K;  3K9J A;  2NLX A;  3ZCM A;  3CCS N;  2RHK A;  3WNG A;  3QFU A;  1Q9X A;  1RDA A;  3RMB A;  2QWN A;  4H5W A;  3AVB A;  5J2N A;  1REV A;  2ZD1 A;  4F8R A;  4DU1 A;  2W6L A;  1JL2 A;  4ISG A;  1XWL A;  3ZET B;  4JYA K;  1RDW X;  2QXL A;  4BRA A;  5DM7 L;  2ETJ A;  4K0K K;  4DTR A;  2HBJ A;  3J7Z O;  2PYL A;  1HPM A;  2HNY A;  3H3N O;  2HHU A;  3O80 A;  3AVJ A;  1ZBU A;  4Y1C A;  1NK8 A;  4JI0 K;  4K43 A;  3OYK A;  1ZYQ A;  1NU0 A;  2VWJ A;  4E7H A;  4CGF A;  5BR9 A;  4JD2 A;  5GAD P;  2NRH A;  2VWK A;  1S6P A;  1JCF A;  1RDC A;  5GIP A;  4FJ7 A;  3HPH A;  3K5L A;  1HUX A;  4KBO A;  1EQY A;  4KI4 A;  1SL2 A;  5C12 A;  2E1Z A;  3NDK A;  4ID1 A;  1NKC A;  1TL3 A;  3DI6 A;  2E6M A;  2HOE A;  5AQQ A;  2Z1G A;  3PY8 A;  3A5O C;  2OAN A;  4IJN A;  4G9Z A;  3KLI A;  4MO4 A;  1NK6 A;  1D5A A;  4TSX A;  3G10 A;  4DB3 A;  4CBX A;  1NM1 A;  4OO1 J;  3L3V A;  1BOT O;  4Z4C A;  2JLE A;  5M1N A;  4V19 S;  2WON A;  1C0F A;  5E84 A;  4YOV A;  2D0C A;  2JGU A;  2UU9 K;  1ZC6 A;  3L3U A;  2E2Q A;  5TKY A;  3KWG A;  1XMO K;  4OVL A;  1QQM A;  3C7N B;  3MK6 A;  4DQP A;  3LDN A;  3MEE A;  4G1Q A;  2D0B A;  5J2P A;  4Z4H A;  3ATV A;  2V51 B;  2G8K A;  4JKG A;  3NGI A;  4E7L A;  4NXM K;  5BPN A;  4DLG A;  2RN2 A;  3OJS A;  4DUZ K;  1JL1 A;  4CEQ A;  1S1W A;  3UKR A;  3F2K A;  4HUG A;  4YHH K;  2Q31 A;  3EL2 A;  3ULE A;  2ATQ A;  4Z4G A;  3PLA A;  2VG6 A;  2OCE A;  3QB0 A;  3VQ6 A;  4M3T A;  3ZSX A;  5AQW A;  3EZW A;  3O9R A;  3THV A;  4E1M A;  1N33 K;  1J53 A;  1Q8I A;  1XI1 A;  1KTQ A;  4BDZ A;  4GY2 B;  4YOW A;  2G8W A;  4OKE A;  4BRF A;  3K5O A;  1W9H A;  3U6F A;  4BQZ A;  4KFB A;  4JI1 K;  3R3L A;  4JKD A;  4CHZ A;  2YHB A;  3VF2 A;  1Z25 A;  2IOC A;  4PUO A;  4Q0B A;  3H1Q A;  3T1Y K;  4O5F A;  3PSF A;  4NO7 A;  5BR8 K;  4FJH A;  2A6A A;  1KCF A;  4W5O A;  3LM9 A;  4HHT A;  3U9Z A;  1VQO N;  1WBB A;  4CK3 A;  2P9S B;  4KH5 A;  4PWD A;  3ZT2 A;  3IS9 A;  4JAX A;  3QIC A;  3IG1 A;  1ILY A;  3KKS A;  3C6T A;  3ZET A;  4QS9 A;  4PHT X;  1RDB A;  2NRV A;  3B6P A;  3NGZ A;  2IAJ A;  1VQM N;  3PUF A;  4LY7 A;  5AQZ A;  1HKC A;  1YJW N;  3AA2 A;  4BRH A;  3LDQ A;  4FLY A;  3SQ2 A;  1HNZ K;  2QWP A;  3VQD A;  4DV5 K;  5DM6 L;  2B4J A;  1I3A A;  1EWR A;  3SAG A;  1UA1 A;  1LW2 A;  2R7Y A;  2HF3 A;  3OJU A;  4NXN K;  2P9P A;  4E19 A;  1RCH A;  4H0O A;  1R0A A;  2WTU A;  3NH2 A;  5C42 A;  5CE3 A;  4EIA A;  2QWQ A;  2QI2 A;  1TL1 A;  3QER A;  2XY5 A;  1X1P A;  3QBX A;  4CHO A;  3S3N A;  1CZ9 A;  1RGI A;  1W7A A;  1OVY A;  1EET A;  3ZSZ A;  1GLL O;  1FW6 A;  1ESV A;  1NK7 A;  3TAQ A;  1NJZ A;  2P9N A;  3HP9 A;  1I39 A;  4JK8 A;  3CCU N;  4M7X A;  4N47 A;  4NCA A;  2E2P A;  2GBZ A;  1T44 A;  4E89 A;  2YJE A;  4CJE A;  1XMQ K;  1S9G A;  4K8Z A;  4CZE A;  1UOC A;  1EP4 A;  1XNR K;  1KFD A;  4DTO A;  3QET A;  3K57 A;  3K5M A;  3O4W A;  2P9I B;  2X6N A;  4GVE A;  1K8A O;  4FM0 A;  2Y1I A;  2HMI A;  2HHS A;  4CGD A;  4RW4 A;  4DU4 A;  3LZJ A;  3WQU A;  5EVZ A;  1SL1 A;  4IG3 A;  3VEX A;  3HP6 A;  5AQF A;  4E7K A;  2WBN A;  4JS5 A;  1HJR A;  1N5Y A;  4W5Q A;  3ISN C;  4FPB A;  5HP1 A;  4B3O A;  3F5T A;  1KVA A;  5C2F A;  3CJB A;  2EHG A;  3AAP A;  4JI4 K;  2ASP A;  3GBT A;  4FW2 A;  4IFV A;  3CCV N;  1QZ6 A;  3O9U A;  2ZWH A;  2XY6 A;  1ZBS A;  4CJ3 A;  1K9M O;  4BY9 C;  3KJV A;  4CJV A;  3EZ5 A;  1N34 K;  3DXM A;  5JS1 A;  4GV9 A;  4BE2 A;  3VQB A;  2QKK A;  3M8S A;  4FCY A;  1Q86 O;  1RBT A;  1NGA A;  1S1U A;  3V9U A;  1A5X A;  1RT1 A;  1IKW A;  1KVC A;  3OVN A;  2QWL A;  3QO9 A;  1QHA A;  3VF6 A;  4A59 A;  4CFA A;  5C10 A;  4DV3 K;  4B9V A;  1QQO A;  4WQ4 C;  5C15 A;  2FBY A;  1GOC A;  2QXF A;  2YHY A;  3NHG A;  3MAQ A;  3N4Q A;  3SMP A;  4B9Q A;  3LDO A;  5JMV A;  3VQ7 A;  3AA4 A;  4Z4I A;  1IV0 A;  4DR1 K;  4MLH A;  4DV6 K;  3CER A;  1ATR A;  4AHR A;  3TAE A;  4DQ8 A;  3DAW A;  4DR2 K;  2VWB A;  2BE2 A;  4B9T A;  4DF8 A;  3SUP A;  4CEZ A;  5ADX A;  4K8X A;  2GWK A;  1LAW A;  3KLG A;  3OYB A;  4FO0 A;  4B3T K;  4A61 A;  4CJT A;  4J2B A;  5AQU A;  4H03 B;  3CJA A;  1LOT B;  1NJW A;  4FXD A;  3ENO A;  1DKG D;  4H0X B;  3LP0 A;  3VET A;  3ZSW A;  4ELV A;  3QLH A;  3P83 D;  1VSF A;  2XRI A;  2YHW A;  1T3V A;  3HOT A;  4M3X A;  3D0P A;  5AQK A;  4LF7 K;  5C0Y A;  1HX1 A;  4B8C A;  5GAG P;  5CZ1 A;  3W3D A;  1K8K B;  2O8B A;  4BC4 A;  2FF6 A;  5HOO A;  1HKG A;  2CGK A;  3VEY A;  3KKR A;  1VQP N;  1NG9 A;  5BN8 A;  3V4I A;  5IWA K;  1DT9 A;  4LD0 A;  4CIE A;  5J1E A;  4K42 A;  4AF1 A;  4DV4 K;  4BG8 A;  2OPP A;  1NJY A;  2HHW A;  3FZL A;  5DMR A;  3LAM A;  3VES A;  2GX9 A;  2UXD K;  1IJJ A;  4ELU A;  1KLM A;  4CF1 A;  3WXM B;  3CYM A;  4BVP A;  3C0B A;  1HNI A;  1GLB G;  3OTO K;  3SUQ A;  1OH6 A;  4H5V A;  3L6Q A;  3FGU A;  3O3H A;  2P9P B;  5KPT A;  2O8E B;  1VSH A;  1VSM A;  4CCH A;  1YVU A;  3WT0 A;  2G8V A;  5EY4 A;  1RT4 A;  1NGD A;  1MA9 B;  3WNH A;  3H46 O;  1HKB A;  4FJJ A;  2Q3S A;  1M1K O;  4A2B A;  3SAH A;  4BRE A;  3UE5 A;  1I94 K;  1HMV A;  2IIR A;  2EX3 A;  3AVF A;  1JLC A;  4YY3 K;  4FJ8 A;  5JS2 A;  3PO4 A;  4JKE A;  2YKM A;  4KO0 A;  2OTJ N;  4GKJ K;  2KFZ A;  4CED A;  4CEO A;  2EWS A;  5MLC Q;  4DTS A;  1E4G T;  4DSK A;  3LDS A;  2A1R A;  1GLJ O;  4I9L A;  4IEE A;  1RT3 A;  4EHT A;  4N5S A;  1KSP A;  3DLR A;  3JXU A;  4WF9 L;  4DS5 A;  3OW2 M;  4MO5 A;  5SZT A;  1D8Y A;  1D9D A;  1C0U A;  1TYQ A;  1U45 A;  4OJR A;  1Z6R A;  3THW A;  4FLX A;  4FJG A;  3EE9 A;  4IWV A;  3DYA A;  2CGL A;  4PA1 A;  4YOY A;  1BL3 A;  4JI5 K;  4LF4 K;  3SK3 A;  5M1P A;  4BWM A;  3CCE N;  3VEW A;  3DRP A;  1VK0 A;  3AGR A;  3DRS A;  3GG4 A;  1BG3 A;  3CC2 N;  3AVM A;  4B9M A;  1RT5 A;  2OPR A;  5FRM A;  1NKE A;  1FKP A;  3EY1 A;  4FJ9 A;  1CLQ A;  3ZT4 A;  5EXW A;  1QSS A;  5BRE A;  1WSH A;  4LFB K;  1NGH A;  1LCU A;  5KGX A;  4LH5 A;  2KHO A;  1ASW A;  3NVK A;  4CJW A;  1IBK K;  1U2V B;  3HM9 A;  4JHD A;  1NBW A;  2ZJQ L;  3FZH A;  1BI4 B;  1BCM A;  4L8R B;  2LSN A;  4ILJ A;  4HTL A;  2BGG A;  3F9K A;  1W2B M;  1RT7 A;  1X3N A;  3HI0 A;  4H0T B;  3VQC A;  3SUO A;  4B3R K;  3BUZ B;  3VER A;  3LPU A;  3HZ6 A;  2O4I A;  1BU6 O;  3OS0 A;  3DOL A;  3LP1 A;  2VGN A;  2QWR A;  4KPY A;  4A2A A;  2JWL A;  2P9I A;  5HRR A;  3TAN A;  3RSE B;  3TTF A;  2UXC K;  5I3U A;  3HPO A;  2GUI A;  1YUW A;  3SBG A;  3MWT A;  4LSL A;  1U6Z A;  2PFU A;  3QFP A;  4CF8 A;  3OYH A;  1GLD G;  3MCP A;  3OYM A;  4MFB A;  1NLV A;  2E2N A;  1WAJ A;  5AQO A;  3U3G A;  1KRP A;  3C95 A;  4C8M A;  3K0S A;  3O1B A;  1YTU A;  5FPM A;  1K73 O;  5CYM A;  4PQU A;  3UKU B;  2BAN A;  4BRP A;  3DM2 A;  4X64 K;  4EHU A;  1TK5 A;  1C1B A;  3C94 A;  3QEI A;  1G15 A;  1GLC G;  1HYS A;  2V7Y A;  3P1G A;  4B1V A;  1LAV A;  1RTI A;  4DQI A;  4FJN A;  1FK9 A;  5HRO A;  4M3Y A;  1SL0 A;  4DR5 K;  2I7N A;  2OTL N;  5I9E B;  4YOU A;  4PKG A;  2E8A A;  1LW0 A;  3HJF A;  4A5B A;  4DTJ A;  5GIO A;  1OH8 A;  4YNQ A;  4WQ4 A;  4CI6 A;  4FL9 A;  1EO1 A;  1DGK N;  5SWM A;  1YT3 A;  4LH4 A;  2E2O A;  5K14 A;  3PX6 A;  3JSM A;  1ITG A;  1WUA A;  3PO5 A;  1KFS A;  2KZM A;  3O5B A;  5FLX O;  1FKO A;  1GLE G;  4F9O A;  5AQM A;  4FPA A;  1TKX A;  1A5V A;  3M8Q A;  4DMN A;  3HOS A;  1VQ4 N;  3FFI A;  3OBY A;  3JYT A;  4XIU A;  4DFJ A;  5AFU H;  4BGA A;  2QA4 N;  4OGE A;  3SJJ A;  3TPQ A;  1QTM A;  4O8U A;  4UY8 O;  3KK3 A;  4BRN A;  3DOK A;  1ASV A;  3WXI A;  4O44 A;  3AO4 A;  3M3Z A;  2QM1 A;  3AVL A;  3VEN A;  4B9S A;  1HYZ A;  3CFP A;  2HHQ A;  4PL7 A;  3CFO A;  3LL3 A;  3NF8 A;  1KD1 O;  3OY9 A;  4FWL A;  1L5U A;  1RT2 A;  4DQS A;  4B8A B;  4KB0 A;  1XHZ A;  1QSL A;  4JN4 A;  3CJ7 A;  3H6E A;  3E9P A;  3ENH A;  3NCI A;  4H5T A;  4CZJ A;  4E3S A;  1NGB A;  4FZY A;  4JKF A;  5D3G A;  1RTH A;  3MN5 A;  4FK4 A;  1S1X A;  2BTF A;  4KV8 A;  2WFB A;  2F96 A;  4CHN A;  4CGI A;  3KWI A;  3D6R A;  4N76 A;  1JCE A;  4DTP A;  2E88 A;  3O9S A;  1YVN A;  4CGH A;  4OPJ A;  3KLH A;  1TKD A;  4Z4E A;  3QEP A;  3QDK A;  3A5M C;  4BRQ A;  4CZM A;  3HVT A;  3CCJ N;  4X62 K;  3C6H A;  4BR0 A;  3AAR A;  1VQ9 N;  4H5R A;  3O08 A;  3OYJ A;  3CI5 A;  5HRN A;  3B6O A;  2HB5 A;  4DSJ A;  3V1R A;  4DR3 K;  1V4T A;  4FWN A;  4B1Y B;  3WNE A;  2WUS A;  2VQE K;  5KTQ A;  3SNN A;  2O8B B;  3ITH A;  2YJF A;  3PX0 A;  2OPQ A;  3SQ1 A;  4X66 K;  3VPZ A;  3AO3 A;  4CEC A;  3T3F A;  4ZHR A;  1VRT A;  4C8N A;  1BCO A;  3QNN A;  1IBM K;  4Y1D A;  4L3Q A;  4H0Y B;  5GAE P;  1NNE A;  2ITM A;  4C8K A;  4N41 A;  3HTV A;  4FM2 A;  1BDG A;  2HHT A;  4MDA A;  1S9E A;  2CH6 A;  1BI4 A;  4KHY A;  4RW9 A;  2X74 A;  4DSI A;  3IKM A;  3CQ8 A;  2KLA A;  1P90 A;  1QVF M;  4FLT A;  1WLJ A;  3VN5 A;  4NCB A;  1WNS A;  3NMU A;  1VSD A;  4C8O A;  1JLG A;  4E1J A;  2GEL A;  1NJX A;  3S3M A;  2GEM A;  3OYN A;  4KHU A;  4CGG A;  5AZI A;  2RF2 A;  1TKT A;  1RBV A;  1T6D A;  5AQX A;  5BPL A;  2B6A A;  1W97 L;  2VG7 A;  3OYL A;  1N36 K;  1Q9Y A;  3LP3 A;  3A0I X;  2DFH A;  4B9U A;  3MWP A;  2X78 A;  1K6Y A;  4IZ9 A;  1WOQ A;  2O8D B;  4CJL A;  3IAY A;  4IDH A;  1GOB A;  1Q82 O;  3I8B A;  3E01 A;  4QS8 A;  3M5R A;  2HVH A;  3KHY A;  3THW B;  1BIS A;  4FWK A;  3ATU A;  3KIO A;  4DSF A;  3IMX A;  2IDO A;  4JS4 A;  4CZK A;  4LF6 K;  1EWQ A;  1J54 A;  1CXQ A;  1LWE A;  3FFK B;  4BRI A;  3CJ1 A;  4Z0U A;  1VSE A;  4JI8 K;  3FR0 A;  3VEO A;  3MXJ A;  2E5L K;  4FWS A;  2ZGY A;  5HL7 L;  4WFA L;  4ISF A;  2HBL A;  3KK1 A;  4Z94 A;  1NK5 A;  1RT6 A;  4H0V B;  5EOY A;  3OYA A;  4KHN A;  1K8K A;  3QES A;  3TAP A;  3EO3 A;  1S1T A;  4UQG A;  2UUB K;  1S6Q A;  2F9W A;  1KQS M;  1NGG A;  4F3T A;  4CGJ A;  3OS1 A;  4CJK A;  4JI6 K;  5M1O A;  4DKW A;  1X3M A;  3CPW M;  2P9K B;  5KPR A;  1TAQ A;  4BWJ A;  1RTJ A;  2ZM6 K;  3L2R A;  4CEE A;  2NRW A;  3THX B;  3E1Y A;  2YV0 X;  4BQL A;  3ASM A;  2P5G A;  1YTA A;  2A40 A;  4CFB A;  4DSE A;  5LY3 A;  3OYD A;  3CCL N;  4CHP A;  1BHL A;  1B92 A;  1WSG A;  2FSJ A;  5E26 A;  1EX4 A;  4JNE A;  3VQE A;  5EU7 A;  3VA0 A;  3AVI A;  4B3M K;  3KZB A;  5CR4 A;  3NH1 A;  1J6Z A;  2VYP A;  4CE9 A;  2IGI A;  1BA1 A;  2OA8 A;  4CD3 A;  3EKS A;  4JV5 K;  4OGC A;  1NOY A;  1T7P A;  2OZM A;  3ZEU B;  3CD6 N;  4BR5 A;  3VQ4 A;  1IKY A;  3MN6 A;  3SLC A;  3L2V A;  2Q97 A;  1ATS A;  3R8E A;  1OH5 A;  1L3U A;  1U04 A;  1QZ5 A;  4B08 A;  3GOI A;  2D0O A;  3MN7 A;  4N56 A;  3NAE A;  4JK9 A;  2KQ2 A;  3SCX A;  4ILH A;  3MMV A;  1UWB A;  4PKI A;  4B3S K;  2X6S A;  4E7J A;  2HNZ A;  2KKZ A;  3AO5 A;  4WYB A;  3OS2 A;  4F2R A;  3CCR N;  3RMD A;  3KK2 A;  4MQ3 A;  3CMA N;  3ZSY A;  4J2A A;  4HUE A;  3O3F A;  4GKK K;  1KXP A;  1HR0 K;  4OLA A;  1J9A A;  5C2D A;  3GE1 A;  4H5N A;  4KI6 A;  1JJ2 M;  4FOE A;  3WEE A;  3EYZ A;  4CW7 B;  1VSJ A;  2E20 A;  3AVC A;  4IEI A;  4FJL A;  3QBW A;  4NCG A;  2A3Z A;  4AIL C;  2ASO A;  5AJ3 K;  4GNI A;  4IOC L;  3AY9 A;  5AQS A;  4FWM A;  3RSE A;  1L3T A;  2Z1H A;  3BGR A;  2H3G X;  3M6G A;  5AQT A;  2KTQ A;  1IG8 A;  3L2U A;  3SV4 A;  3J80 O;  3V9S A;  3AV9 A;  3PX4 A;  2YCH A;  3O6W A;  2HHX A;  3MX2 A;  3MX5 A;  2KZZ A;  4LF5 K;  4IXC A;  5LL6 Z;  3R6M A;  1T8E A;  1NK9 A;  3OYC A;  4JI3 K;  1O1W A;  3DJC A;  3ZX2 A;  2DTU A;  1HNV A;  2G8I A;  2WOM A;  4DFP A;  4BVO A;  2BDP A;  1C6V A;  1S3X A;  5AZJ A;  3SPZ A;  4CK1 A;  3DRR A;  4CES A;  1SKR A;  3CFR A;  3F73 A;  3L0Q A;  4JKC A;  2YHX A;  3H45 C;  4FW1 A;  1M90 O;  4B1X B;  3ID6 A;  4BDY A;  1CXU A;  3DXK B;  3OHR A;  2ASM A;  1ZBI A;  1S72 N;  4IJA A;  2F9T A;  2IS3 A;  4CHQ A;  3FZF A;  5LMU K;  2QK9 A;  3T19 A;  1W0H A;  5F2R A;  4JI7 K;  1OH7 A;  4BE1 A;  4E1N A;  5KGW A;  2FXU A;  4IG0 A;  5ELZ A;  1JCG A;  4CZL A;  1L3V A;  2G8H A;  2B5J A;  4KRE A;  2ITG A;  4IFE A;  2P9U B;  2VCP A;  4IBN A;  4YFU A;  2RKI A;  3MEG A;  4EFH A;  2W42 A;  1NWK A;  4BRM A;  4AHC A;  1NGJ A;  4GVM A;  5HLF A;  1BQN A;  5AZJ B;  4QS7 A;  3M1F A;  3T69 A;  4M3Z A;  3WXJ A;  2O8D A;  4BR4 A;  1IKV A;  4JD2 B;  3HXM A;  2RPI A;  4W5N A;  1Q81 O;  1U48 A;  1TYQ B;  3ZSR A;  2V52 B;  2UXB K;  2HBM A;  1IKX A;  3VQQ A;  5AQV A;  1HJO A;  3ZSV A;  4CJP A;  4B9L A;  3F9M A;  4IFY A;  5JIC A;  1P8Z A;  3V1Q A;  4DCH A;  3Q7B A;  2P1J A;  3P38 A;  5GAH P;  1U2V A;  3HSC A;  2AP1 A;  4XEI A;  3ZLJ A;  5GIN A;  4CEB A;  3CHW A;  4CJS A;  1RTD A;  4A5A A;  3TU5 A;  2Z1I A;  3BZC A;  3IFR A;  1XNQ K;  2P9S A;  2AJQ A;  2E6L A;  1SKS A;  2FLO A;  3I55 N;  3S9H A;  1MWK A;  3HT3 A;  3P31 A;  4ZTF A;  3UIQ A;  4DV2 K;  4LFA K;  3TAF A;  2UUA K;  3AVA A;  5KRS A;  1IH7 A;  3BDP A;  3ZSQ A;  3KD1 E;  3VMF B;  5A2Q O;  1VHX A;  4JRP A;  1NK0 A;  3D2F B;  1R59 O;  4BAC A;  3UKU A;  4CF2 A;  3T1A A;  3D2F A;  3MED A;  3HPG A;  4GV6 A;  1VQL N;  3EE8 A;  1X9S A;  4I9Q A;  3V1O A;  3PV8 A;  1C1C A;  3MXM A;  2D0P A;  4WCE L;  5BN9 A;  3L8B A;  1WAF A;  1A5W A;  4RWT A;  4HCB A;  1JKH A;  3CME N;  1U49 A;  1SZ2 A;  5LMN K;  3TAR A;  3E9L A;  4O5B A;  4PKH A;  3ALY A;  4QAG A;  4C1N I;  1NMD A;  4M63 C;  1KVB A;  3T7Z A;  1QS4 A;  4C23 A;  4AM7 A;  4CFD A;  4OKK A;  4HVJ A;  3L4I A;  4FK0 A;  1MU2 A;  1NK4 A;  3VQA A;  4CJ5 A;  3M8P A;  1NMN A;  4PL8 A;  3TAM A;  2D5R A;  4I6M B;  2OYQ A;  3W0L A;  1TGO A;  1YXQ A;  1Y64 A;  3ZT1 A;  4JKA A;  2ZF5 O;  3SQ4 A;  1Z05 A;  4AHT A;  2G8U A;  1JLA A;  3RRH A;  3SUN A;  5JLF A;  5AQG A;  2O8E A;  3DLK A;  4DV1 K;  3RTV A;  2XY7 A;  4Q5V A;  1Y97 A;  1VSI A;  5FRO A;  4KHW A;  1TK8 A;  1WBD A;  3WQT A;  4RW7 A;  4FWR A;  1SQK A;  4I6M A;  3QEW A;  3NBP A;  1C1A A;  1WSJ A;  4FLV A;  3OYI A;  4KTW A;  2FF3 B;  2XHB A;  3HRG A;  4WQ5 A;  3TI0 A;  1U4B A;  4JLH A;  4DV0 K;  3UB5 A;  3VQP A;  1BO5 O;  1UA0 A;  3V6D A;  3LAN A;  5F1X A;  1NOZ A;  2HST A;  3LP2 A;  3WNF A;  1E3M A;  3J7A P;  2HF4 A;  1LV5 A;  4HCC A;  1RBR A;  2QW9 A;  1XC9 A;  4DHY A;  3O9T A;  4B1U B;  3MCA B;  3HVR A;  4FVM A;  4Y0W A;  3JAM O;  4AHV A;  1UAX A;  3UKR B;  1Q7Y O;  3K58 A;  4BE0 A;  3I0S A;  1WN7 A;  2NRT A;  4CIF A;  3TR8 A;  5AQL A;  1DEJ A;  4JKG B;  1O13 A;  5AQY A;  1SAZ A;  1HQU A;  5FPN A;  3Q7C A;  1B9D A;  3DWL A;  3J8A A;  4NYF A;  3DMJ A;  4AHU A;  5C24 A;  3TSQ A;  4XH1 A;  2OPS A;  3PIO L;  4FM1 A;  3VF4 A;  2P51 A;  3C6U A;  4DFM A;  1YIJ N;  2BH1 A;  3GL1 A;  1TK0 A;  1H1V A;  4FWO A;  4WFN L;  3FZM A;  4RCH A;  3V9Z A;  4NLB A;  3DLH A;  4EZ6 A;  3THY B;  3AO2 A;  3EN9 A;  3RR8 A;  1TUU A;  2O4G A;  4M3U A;  4FLZ A;  1GLF O;  3SQ0 A;  1F21 A;  3E66 A;  2HND A;  3TAB A;  5CYQ A;  4DSL A;  4IO8 A;  1C0M A;  2YNG A;  1FXX A;  2HBK A;  4C8L A;  4RTF D;  3CM5 A;  4AM6 A;  1J5E K;  4EP5 A;  1QHT A;  5E41 A;  2I7P A;  4CF9 A;  3QIP A;  1G99 A;  4GMJ B;  3S41 A;  3V81 A;  3SYZ A;  3OYE A;  1KC8 O;  4U67 L;  1QVG M;  2NRX A;  3AO1 A;  3C6A A;  4RW6 A;  3SAF A;  3L2Q A;  3HK2 A;  3K2P A;  2FC0 A;  4ILG B;  1JLQ A;  3R1X A;  4DR6 K;  3B8A X;  2F4V K;  4KTZ A;  1EXQ A;  3RWU A;  1YI2 N;  4IOA L;  3ID8 A;  4FLU A;  4H8K A;  3AVG A;  4DLE A;  1X9W A;  3QNO A;  1Q18 A;  3CJC A;  1NGF A;  3HM8 A;  3DLG A;  4ISE A;  2HMP A;  1VSK A;  3CQX A;  2NZT A;  4CF0 A;  5LJV A;  3AVK A;  3DXM B;  3AA3 A;  4CER A;  3T1H K;  4LC9 B;  4CZF A;  1S1V A;  5M1Q A;  5KQ8 A;  1YJ9 N;  3O1W A;  1QQN A;  3CCQ N;  4A57 A;  3WXL A;  2PZS A;  1ASU A;  2DPN A;  3L2W A;  4OPA A;  4M45 A;  1NJI O;  3HO1 A;  2A41 A;  4M3W A;  3CIP A;  2DY4 A;  5KPZ A;  1WSE A;  5AFU A;  1ZBF A;  1TKZ A;  2D0A A;  1LWC A;  1VRU A;  2NRR A;  2YNH A;  3GDQ A;  1JXB A;  4DQQ A;  3NF7 A;  3MXI A;  4DFK A;  4OLB A;  4WQ5 C;  2FBX A;  3TTD A;  5FDL A;  1SS6 A;  3IUC A;  4OPH A;  1HYV A;  1ZXO A;  2YHA A;  3DLB A;  3QIO A;  1IBL K;  1HLU A;  2XY8 A;  3E9O A;  4W5R A;  3U3Y A;  2GTD A;  3TAG A;  4CJQ A;  3PSI A;  3A8Y A;  3J7Y P;  3ENB A;  3VEV A;  2FBT A;  4E0D A;  2KFN A;  2FSN A;  3SMS A;  4W5T A;  1RIL A;  4BR7 A;  5HBM A;  4RG8 A;  4M41 A;  2Q2R A;  3H1V X;  4Z4F A;  2HHV A;  4FZX C;  3VGL A;  2UUC K;  5DK5 A;  3ZT3 A;  5AQH A;  3DXK A;  3OYG A;  4CBU A;  1SV5 A;  3AA5 X;  2ZJP L;  2PBD A;  1JLE A;  5KRT A;  4M7Y A;  3JS6 A;  4KTQ A;  1BGX T;  3RR7 A;  2P5O A;  2Q0U A;  5M1F A;  4CJR A;  1X9M A;  4OX9 K;  1JLF A;  3LM2 A;  4F3O A;  4OPK A;  4CEF A;  2O8F A;  5HRS A;  4CBW A;  3K9K A;  2XO7 A;  1EKE A;  4BGB A;  3O8M A;  3LDP A;  4M3R A;  1SUQ A;  1RNH A;  4I2P A;  4FWQ A;  1DLO A;  2E4L A;  3LZI A;  3ZEU A;  3G6E N;  2RE2 A;  1NGE A;  2IC3 A;  4CZH A;  4KH6 A;  4BR2 A;  2VQF K;  4DQR A;  3O9Q A;  2O8C B;  3LAK A;  3LDL A;  3ULE B;  5CHI A;  4KHS A;  3VTI A;  2O8C A;  3CG7 A;  2DFF A;  4A62 A;  4XH4 A;  4ID5 A;  1VQ8 N;  3A5N C;  4DR7 K;  3WXK A;  4IDK A;  1QE1 A;  2P9L B;  1BQM A;  1S22 A;  5BRF A;  2V7Z A;  3BZK A;  5T7B A;  3KLE A;  4HWI A;  3NF9 A;  4FJX A;  3C7N A;  4KH4 A;  4BRK A;  4FOI A;  3OYF A;  5KI6 A;  3NH0 A;  1N6Q A;  1C0T A;  5FPD A;  4KRF A;  3HST B;  4NB4 A;  4BRO A;  4KB1 A;  4H4O A;  3CET A;  4MDB A;  3QEX A;  3VGM A;  1T6C A;  4F2S A;  4XH5 A;  2A5X A;  4B9N A;  1N8R O;  3RMC A;  2A1S A;  1T03 A;  1BIU A;  5BRH A;  3I56 N;  2J4R A;  2QKB A;  3RMA A;  4BR9 A;  2ZQB A; 
#chains in the Genus database with same CATH homology
 4E1N A;  3LPU A;  5KGW A;  4IG0 A;  1Z26 A;  4G1Q A;  4ELT A;  2O4I A;  1L3V A;  2D0B A;  3OS0 A;  2G8H A;  2B5J A;  2I5J A;  4KRE A;  3DOL A;  2ITG A;  3LP1 A;  3DLE A;  5J2P A;  4IBN A;  4Z4H A;  4YFU A;  2RKI A;  4KPY A;  2G8K A;  3TAN A;  5HRR A;  3MEC A;  3MEG A;  2W42 A;  3NGI A;  4E7L A;  5I3U A;  3LWL A;  4DLG A;  2RN2 A;  3OJS A;  1JL1 A;  4AHC A;  4CEQ A;  1S1W A;  3H08 A;  4GVM A;  4HUG A;  5HLF A;  1BQN A;  3HPO A;  4FJM A;  2GUI A;  4M3Z A;  2ATQ A;  4HTU A;  4Z4G A;  2VG6 A;  4LSL A;  1IKV A;  3VQ6 A;  4M3T A;  3VQ5 A;  3SZ2 A;  3HXM A;  2RPI A;  3ZSX A;  4W5N A;  3THV A;  5FRN A;  4CF8 A;  4E1M A;  1U48 A;  3ZSR A;  3OYH A;  1J53 A;  3OYM A;  1Q8I A;  1XI1 A;  1IKX A;  1KTQ A;  4BDZ A;  4MFB A;  3VQQ A;  1WAJ A;  2NUB A;  2G8W A;  4OKE A;  3ZSV A;  4CJP A;  3K5O A;  4IFY A;  4B9L A;  1W9H A;  3U6F A;  3U3G A;  1KRP A;  3C95 A;  4C8M A;  3V1Q A;  1YTU A;  3O4N A;  4KFB A;  5I42 A;  4CHZ A;  4BDP A;  2YHB A;  5CYM A;  2P1J A;  4PQU A;  1Z25 A;  2IOC A;  2BAN A;  3NE6 A;  4PUO A;  3DM2 A;  4Q0B A;  4QCL A;  4OKJ A;  1TK5 A;  1C1B A;  3C94 A;  4CEB A;  3QEI A;  4CJS A;  1RTD A;  4CJ4 A;  1G15 A;  1HYS A;  3P1G A;  3HL8 A;  1LAV A;  1RTI A;  2Z1I A;  4DQI A;  4FJN A;  1FK9 A;  5HRO A;  4FJH A;  4M3Y A;  1KCF A;  4CJF A;  2AJQ A;  4W5O A;  1SL0 A;  2E6L A;  4HHT A;  1SKS A;  2F8T A;  3S9H A;  4CK3 A;  1NKB A;  3HT3 A;  4ZTF A;  3UIQ A;  4PWD A;  3ZT2 A;  4WE1 A;  1LW0 A;  3TAF A;  3AVA A;  4AHS A;  1IH7 A;  5KRS A;  3BDP A;  3IS9 A;  4F8R A;  3ZSQ A;  3HJF A;  3KD1 E;  3IG1 A;  3KKS A;  3C6T A;  4DTJ A;  4YNQ A;  1B9F A;  4JRP A;  1NK0 A;  1D9F A;  1RDB A;  3B6P A;  3NGZ A;  2IAJ A;  5SWM A;  4BAC A;  3PUF A;  4CF2 A;  3T1A A;  4LY7 A;  4R5P A;  3AA2 A;  1YT3 A;  3MED A;  3HPG A;  4LH4 A;  4FLY A;  3KLF A;  3SQ2 A;  1X9S A;  4I9Q A;  3V1O A;  3PV8 A;  4H4M A;  1C1C A;  5K14 A;  3MXM A;  3S3O A;  3P5J A;  4NYN A;  3M8R A;  3PX6 A;  3JSM A;  3VQD A;  1ITG A;  3L8B A;  1A5W A;  1WAF A;  3AVN A;  4DG1 A;  2B4J A;  1KFS A;  3PO5 A;  2KZM A;  1JLB A;  1I3A A;  1FKO A;  2KW4 A;  4HCB A;  1TKX A;  1A5V A;  3M8Q A;  4DMN A;  4KHQ A;  1UA1 A;  1JKH A;  3SV3 A;  1LW2 A;  4DS4 A;  1U49 A;  2R7Y A;  3FFI A;  3TAR A;  3OJU A;  4O5B A;  3ALY A;  4QAG A;  3JYT A;  4E19 A;  1RCH A;  2ZE2 A;  4XIU A;  4FLW A;  4DFJ A;  1R0A A;  3NH2 A;  5C42 A;  4OGE A;  3SJJ A;  1KVB A;  4ZTJ A;  1TL1 A;  3QER A;  1QS4 A;  2XY5 A;  4CFD A;  4OKK A;  4HVJ A;  1QTM A;  1X1P A;  4KAZ A;  3NF6 A;  4CHY A;  4FK0 A;  3KK3 A;  3DOK A;  4DTU A;  1ASV A;  3AVH A;  1MU2 A;  4GW6 A;  2YNI A;  1J5O A;  1NK4 A;  4CHO A;  4DQP A;  3VQA A;  4CJ5 A;  3M8P A;  1ZBH A;  3S3N A;  5C25 A;  3TAM A;  1CZ9 A;  3NFA A;  4O44 A;  1HQE A;  4J2D A;  3AO4 A;  2D5R A;  1EET A;  2G8F A;  3ZSZ A;  2OYQ A;  3AVL A;  2PYJ A;  1TGO A;  1NK7 A;  4EZ9 A;  3TAQ A;  4B9S A;  4M42 A;  1NJZ A;  1HYZ A;  3HP9 A;  3CFP A;  1ZBL A;  2HHQ A;  1L3S A;  3ZT1 A;  2OZS A;  3CFO A;  4PY5 A;  1I39 A;  3SQ4 A;  3NF8 A;  4AHT A;  2G8U A;  1JLA A;  3RRH A;  3OY9 A;  4E7I A;  3SUN A;  4N47 A;  1L5U A;  4QOZ B;  1RT2 A;  4NCA A;  4DQS A;  2VG5 A;  4DTX A;  1VSL A;  4B8A B;  3DLK A;  4KB0 A;  2GBZ A;  1XHZ A;  1QSY A;  3RTV A;  2XY7 A;  1QSL A;  4CIG A;  4E89 A;  4Q5V A;  1Y97 A;  1VSI A;  5FRO A;  4CJE A;  3NCI A;  1TK8 A;  4KHW A;  2HHU A;  4I7F A;  1S9G A;  3O3G A;  4RW7 A;  4E3S A;  4K8Z A;  1UOC A;  4FZY A;  5D3G A;  1EP4 A;  1RTH A;  1KFD A;  4FK4 A;  1S1X A;  4DTM A;  4DTO A;  4KV8 A;  3QEW A;  3QET A;  3K57 A;  2F96 A;  3NBP A;  1C1A A;  2DFE A;  4O4G A;  4CGI A;  1WSJ A;  4CHN A;  3K5M A;  4FLV A;  2X6N A;  3OYI A;  4KTW A;  2XHB A;  4N76 A;  4DTP A;  4CFC A;  4CGH A;  1TKD A;  4OPJ A;  3TI0 A;  3KLH A;  4JLH A;  4FM0 A;  2Y1I A;  1U4B A;  3QEP A;  2HMI A;  4Z4E A;  2HHS A;  4CGD A;  3VQP A;  1UA0 A;  4RW4 A;  4DU4 A;  3HVT A;  3NGY A;  3V6D A;  1DTQ A;  3LAN A;  2PY5 A;  3LZJ A;  1NOZ A;  1RDD A;  3LP2 A;  3WNF A;  1SL1 A;  4IG3 A;  4FYD A;  1T05 A;  3HP6 A;  4E7K A;  1LV5 A;  1RBR A;  1XC9 A;  1IG9 A;  4JS5 A;  4HCC A;  4CEA A;  3TWH A;  3OYJ A;  1HJR A;  5HRN A;  3B6O A;  3HVR A;  2HB5 A;  1N5Y A;  4DSJ A;  4W5Q A;  3ISN C;  4FVM A;  3V1R A;  4AHV A;  5HP1 A;  1UAX A;  1TVR A;  4ICL A;  1U47 A;  3WNE A;  4B3O A;  3K58 A;  1KVA A;  5KTQ A;  4BE0 A;  3HYF A;  3I0S A;  5J2M A;  1WN7 A;  3SNN A;  2EHG A;  4CIF A;  3TR8 A;  4JRQ A;  2Y1J A;  3ITH A;  3PX0 A;  4FW2 A;  1HQU A;  2OPQ A;  4IFV A;  3SQ1 A;  1B9D A;  2XY6 A;  3LAL A;  4CJ3 A;  3AO3 A;  4NYF A;  4CEC A;  2Z1J A;  3DMJ A;  3T3F A;  4ZHR A;  4AHU A;  3KJV A;  1VRT A;  3VQ8 A;  4C8N A;  5C24 A;  4CJV A;  3EZ5 A;  1BCO A;  3QNN A;  3ZSO A;  5JS1 A;  4BE2 A;  4Y1D A;  3VQB A;  2QKK A;  2OPS A;  4C8K A;  3M8S A;  4FCY A;  4FM1 A;  4N41 A;  1RBT A;  4FM2 A;  1S1U A;  2HHT A;  3V9U A;  1A5X A;  2P51 A;  3C6U A;  1S9E A;  2FBV A;  1BI4 A;  1IKW A;  1RT1 A;  4DFM A;  1KVC A;  3OVN A;  3V9W A;  1TK0 A;  4KHY A;  4RW9 A;  4CK2 A;  2X74 A;  3V9Z A;  3QO9 A;  3VQ9 A;  3DLH A;  4DSI A;  5CY4 A;  4EZ6 A;  4CJU A;  1DTT A;  4EP4 A;  4CFA A;  3AO2 A;  3CQ8 A;  3RR8 A;  4B9V A;  4FLT A;  2O4G A;  3ULD A;  4DTN A;  1WLJ A;  3VN5 A;  4NCB A;  4M3U A;  1WNS A;  2FBY A;  4FLZ A;  3SQ0 A;  1F21 A;  1VSD A;  3K5N A;  4C8O A;  4FZZ A;  4O0I A;  1JLG A;  1GOC A;  1NJX A;  2QXF A;  3S3M A;  1CZB A;  2HND A;  5CYQ A;  3OYN A;  3TAB A;  4DSL A;  3NHG A;  3MAQ A;  3VA3 A;  1C0M A;  2YNG A;  1FXX A;  3K59 A;  4C8L A;  4KHU A;  3KD5 E;  3CM5 A;  4CGG A;  1S5J A;  4AH9 A;  4FK2 A;  2YNF A;  3VQ7 A;  4EP5 A;  2F8S A;  2RF2 A;  1TKT A;  1RBV A;  1QHT A;  3AA4 A;  3IRX A;  3CM6 A;  2GV9 A;  5E41 A;  2B6A A;  1TV6 A;  4CF9 A;  3QIP A;  1HPZ A;  4Z4I A;  4GMJ B;  1TAU A;  2VG7 A;  3V81 A;  3OYL A;  4AHR A;  1Q9Y A;  3ZT0 A;  3LP3 A;  3OYE A;  3SYZ A;  3TAE A;  2DFH A;  3AO1 A;  4RW6 A;  3L2Q A;  3HK2 A;  2BE2 A;  4DWI A;  4B9U A;  3K2P A;  2FC0 A;  1K6Y A;  2X78 A;  4FJK A;  4B9T A;  4DF8 A;  3LWM A;  3SUP A;  4CEZ A;  1JLQ A;  4CJL A;  3IAY A;  4K8X A;  1GOB A;  3SPY A;  1LAW A;  1RBS A;  3E01 A;  3KTQ A;  3KLG A;  5HRP A;  4KTZ A;  2HVH A;  1IO2 A;  3OYB A;  1EXQ A;  2HVI A;  1BIS A;  3RWU A;  3QIN A;  3KIO A;  4CJT A;  4DSF A;  4FLU A;  4J2B A;  3I8D A;  3SI6 A;  4H8K A;  2IDO A;  4JS4 A;  3AVG A;  1NJW A;  4FXD A;  4DLE A;  1X9W A;  1J54 A;  1CXQ A;  1LWE A;  3QNO A;  1WSF A;  3DLG A;  1VSK A;  3LP0 A;  3ZSW A;  4ELV A;  4J2E A;  3QLH A;  4O0J A;  3P83 D;  4Z0U A;  4CF0 A;  3AVK A;  1VSE A;  1JXE A;  1VSF A;  2XRI A;  4FJ5 A;  4I2Q A;  3AA3 A;  4CER A;  3MXJ A;  4M3X A;  3D0P A;  1S1V A;  4DF4 A;  4F4K A;  3KK1 A;  1SKW A;  1NK5 A;  1RT6 A;  4B8C A;  2PZS A;  3OYA A;  4KHN A;  3QES A;  3TAP A;  1QQC A;  5CZ1 A;  1ASU A;  1WSI A;  1S1T A;  3L2W A;  3LPT A;  3QEV A;  4UQG A;  1S6Q A;  4M45 A;  4F3T A;  4CGJ A;  3OS1 A;  3HO1 A;  3KKR A;  4CJK A;  4M3W A;  2DY4 A;  3RRG A;  3V4I A;  4LD0 A;  1WSE A;  4HUF A;  4CIE A;  5J1E A;  1TAQ A;  4BWJ A;  1RTJ A;  1ZBF A;  1TKZ A;  3L2R A;  2OPP A;  3O4Q A;  1HRH A;  1LWC A;  1GOA A;  1VRU A;  2D0A A;  2YNH A;  1JXB A;  4CEE A;  3NF7 A;  4DQQ A;  4DU3 A;  4DFK A;  3MXI A;  1NJY A;  4OLB A;  2HHW A;  2YV0 X;  2FBX A;  5DMR A;  5FDL A;  3ASM A;  3LAM A;  2P5G A;  1HYV A;  1YTA A;  5J2Q A;  2YHA A;  3I0R A;  3DLB A;  3QIO A;  4CFB A;  4DSE A;  4FJI A;  2XY8 A;  4W5R A;  3U3Y A;  4RW8 A;  3OYD A;  4ELU A;  1KLM A;  3TAG A;  4CF1 A;  4CJQ A;  1BHL A;  4CHP A;  1B92 A;  1WSG A;  4LSN A;  1KLN A;  3CYM A;  1EX4 A;  4IKF A;  2HW3 A;  3VQE A;  1HNI A;  1RBU A;  4KKO A;  2FBT A;  5EU7 A;  4E0D A;  3SUQ A;  3A2F A;  3VA0 A;  2KFN A;  2YKN A;  1BIZ A;  3D45 A;  4W5T A;  1RIL A;  3AVI A;  5HBM A;  1XHX A;  5CZ2 A;  3NH1 A;  4RG8 A;  4M41 A;  3O3H A;  4O55 A;  4CE9 A;  2IGI A;  1VSH A;  1VSM A;  4Z4F A;  2HHV A;  2OA8 A;  4FZX C;  4CCH A;  1YVU A;  2G8V A;  1RT4 A;  5DK5 A;  1LWF A;  3ZT3 A;  4OGC A;  3WNH A;  3V9X A;  1NOY A;  3OYG A;  1T7P A;  2OZM A;  3VQ4 A;  1IKY A;  1SV5 A;  3L2V A;  3G0Z A;  3AA5 X;  2Q3S A;  4FJJ A;  1JLE A;  1HMV A;  2EX3 A;  3ZCM A;  3AVF A;  1JLC A;  5KRT A;  1U04 A;  3WNG A;  1L3U A;  4FJ8 A;  5JS2 A;  4B08 A;  1Q9X A;  3PO4 A;  4KTQ A;  1BGX T;  3RR7 A;  1RDA A;  2YKM A;  4KO0 A;  4N56 A;  2P5O A;  3NAE A;  3RMB A;  3SCX A;  2KQ2 A;  2KFZ A;  1UWB A;  3AVB A;  4CJR A;  1X9M A;  5J2N A;  1REV A;  2ZD1 A;  4CED A;  4CEO A;  2X6S A;  1JLF A;  4E7J A;  2HNZ A;  1JL2 A;  3AO5 A;  1XWL A;  3OS2 A;  4DU1 A;  4F2R A;  3RMD A;  4F3O A;  3KK2 A;  4OPK A;  4MQ3 A;  4DTS A;  4DSK A;  3ZSY A;  4CEF A;  4J2A A;  2ETJ A;  5HRS A;  3LDS A;  4HUE A;  4DTR A;  2A1R A;  2XO7 A;  3O3F A;  4I9L A;  1EKE A;  2PYL A;  2HNY A;  1RT3 A;  4M3R A;  1SUQ A;  1RNH A;  3AVJ A;  3DLR A;  4I2P A;  1ZBU A;  4Y1C A;  1DLO A;  4N5S A;  1NK8 A;  4OLA A;  2E4L A;  3LZI A;  1J9A A;  4DS5 A;  4KI6 A;  3OYK A;  1ZYQ A;  5SZT A;  3EYZ A;  1D8Y A;  1D9D A;  1C0U A;  1U45 A;  2IC3 A;  1VSJ A;  4OJR A;  2VWJ A;  4E7H A;  4CGF A;  4DQR A;  3AVC A;  4FLX A;  3LAK A;  4FJG A;  3DYA A;  4FJL A;  2VWK A;  4NCG A;  4PA1 A;  4KHS A;  4AIL C;  1S6P A;  3CG7 A;  1RDC A;  4FJ7 A;  2DFF A;  3HPH A;  3K5L A;  1BL3 A;  4ID5 A;  1L3T A;  2Z1H A;  4KI4 A;  3BGR A;  4IDK A;  1SL2 A;  1QE1 A;  4BWM A;  1BQM A;  2KTQ A;  3L2U A;  3NDK A;  3DRP A;  3SV4 A;  1VK0 A;  4ID1 A;  3V9S A;  3DRS A;  1NKC A;  1TL3 A;  3AV9 A;  3DI6 A;  2E6M A;  3PX4 A;  2KZZ A;  2HHX A;  5T7B A;  4B9M A;  3AVM A;  3KLE A;  2Z1G A;  3PY8 A;  3NF9 A;  4FJX A;  1T8E A;  1RT5 A;  1NK9 A;  3KLI A;  2OPR A;  3OYF A;  5KI6 A;  3NH0 A;  3OYC A;  1NKE A;  1NK6 A;  5FRM A;  1FKP A;  1O1W A;  2DTU A;  1D5A A;  3EY1 A;  4FJ9 A;  1HNV A;  1N6Q A;  3ZT4 A;  1C0T A;  2G8I A;  4KRF A;  1CLQ A;  2WOM A;  4DFP A;  3HST B;  1QSS A;  1WSH A;  2BDP A;  4H4O A;  1C6V A;  4TSX A;  4KB1 A;  3G10 A;  3QEX A;  5KGX A;  4LH5 A;  3SPZ A;  4CK1 A;  3DRR A;  1ASW A;  4F2S A;  4CES A;  4CJW A;  1SKR A;  3L3V A;  4Z4C A;  3CFR A;  3F73 A;  2JLE A;  3HM9 A;  4B9N A;  2WON A;  4FW1 A;  2D0C A;  3RMC A;  2JGU A;  4BDY A;  1KSP A;  1BI4 B;  2A1S A;  1BCM A;  1CXU A;  1T03 A;  4L8R B;  2LSN A;  1BIU A;  3L3U A;  1ZBI A;  2BGG A;  2IS3 A;  4CHQ A;  3F9K A;  4OVL A;  2QK9 A;  3T19 A;  1RT7 A;  2QKB A;  3VQC A;  3SUO A;  1W0H A;  3RMA A;  2ZQB A;  4BE1 A;  3MEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...