1RNHA

Structure of ribonuclease h phased at 2 angstroms resolution by mad analysis of the selenomethionyl protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ribonuclease H phased at 2 A resolution by MAD analysis of the selenomethionyl protein.
pubmed rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE HI
total genus 43
structure length 151
sequence length 151
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1990-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rnhA00
3DMJA 4J2EA 2KTQA 5CYMA 3QNOA 3TAEA 2EHGA 4DTSA 4FLUA 2DFEA 3PX6A 4KHSA 4CEFA 4LH5A 3L2UA 2OPQA 3NHGA 1HNIA 1S1TA 3NH0A 4FJGA 4O4GA 4CFAA 1VK0A 4CJSA 1LAVA 3SYZA 3TAPA 1KLNA 4I9QA 4N41A 2HB5A 4KTQA 3S9HA 1LWFA 4HCBA 4IKFA 4E0DA 2FBTA 5C42A 3IG1A 3DLHA 3L3UA 4IDKA 3K5NA 4CJTA 4Z4IA 3SQ2A 4FZZA 4KKOA 1CXUA 2XY5A 3KLFA 3SCXA 4NCGA 4ID1A 1U48A 1R0AA 1S1VA 1C1CA 4HUGA 1B9FA 3D45A 2FBVA 4LSLA 2ZE2A 5FROA 4FJXA 1CXQA 1S5JA 4DLGA 1NKBA 2OYQA 1RTDA 3DLGA 3HPOA 3TARA 5SZTA 4DSIA 2NUBA 4NCBA 3CYMA 1J53A 3V6DA 4CHZA 1JLAA 3DLKA 1NOYA 3T19A 4DU4A 1NK7A 2IDOA 3ZT2A 4KRFA 4DQPA 3O3GA 1KCFA 1WSEA 4CJWA 2OPPA 5HRRA 4CJVA 4HCCA 3ISNC 3TAQA 4AHCA 1N6QA 4FJLA 4DU3A 4AHRA 4CFCA 4M41A 4KREA 3G0ZA 3IS9A 4KV8A 4F2SA 4DFJA 3SUPA 2EX3A 1N5YA 3PX0A 4FJMA 4FJNA 2HVIA 1U4BA 5KGWA 4DTNA 1RBTA 1WAJA 4Y1CA 3KK2A 2KZMA 3OYGA 3THVA 3C6TA 3AO4A 4E7KA 4M42A 3V81A 3ZCMA 4EZ6A 1VSDA 1LV5A 1BIUA 2LSNA 1KVBA 4FLYA 4W5NA 3OJUA 4DU1A 1XC9A 2Y1JA 3OJSA 1TKDA 2VG6A 4OVLA 2OPSA 1G15A 4AHUA 1A5VA 1HYVA 4E7IA 2XRIA 1VSKA 3HP6A 4DTMA 1RBUA 3LAMA 1CZ9A 4M3UA 2G8WA 4W5TA 2G8KA 4AH9A 1BGXT 2YNGA 3FFIA 3V4IA 3L8BA 4M3ZA 2XO7A 1BL3A 5E41A 1UOCA 2VG5A 2F8TA 4LH4A 1KFDA 3AVMA 1XHZA 1WLJA 4CHYA 1QE1A 2D0BA 4CHQA 2D0AA 5J2QA 4M3WA 1HYSA 1Z26A 5CZ2A 4CEQA 3H08A 3SPYA 1B92A 4FK2A 4E89A 4KHQA 3AVLA 3DLBA 4B08A 1JL2A 3V1OA 4HVJA 3K59A 1SL2A 3OYIA 4K8ZA 1FK9A 3UIQA 1S1UA 3ZT4A 1BHLA 4DFKA 1QSSA 3M8RA 1EP4A 2B4JA 5HRSA 5HRNA 3SV3A 4FJ9A 1IO2A 4EP4A 3LPUA 1ZBLA 2HNYA 1NJZA 5J2MA 3VQDA 5DMRA 4KHYA 4FVMA 2BANA 5FRNA 2W42A 2IS3A 1JLQA 3V9UA 4GVMA 4FXDA 3ZSXA 1SKWA 1S9GA 3OYKA 3M8SA 1LWCA 4ID5A 4B9VA 3P83D 4CFDA 3V9SA 2WONA 2G8UA 4JRQA 3ZSRA 1T03A 1ZBHA 2I5JA 1LW0A 2QKBA 1X1PA 3AVKA 2ZQBA 4CIGA 1BQMA 2HHXA 2Z1JA 3AV9A 4RW8A 1J9AA 2YKNA 3CG7A 5KGXA 3AO1A 4Z4CA 4DG1A 3NH2A 4JS5A 4DQSA 3RMCA 1JXBA 4OPKA 1L3TA 1ZBUA 1ASWA 1BQNA 1DLOA 1VSFA 3VQ4A 4CJ4A 4W5QA 3L2QA 4JS4A 2OZMA 4EZ9A 4KPYA 4CJEA 3SI6A 4CEEA 3K5OA 3AVNA 3B6PA 3S3NA 4MQ3A 4CE9A 4TSXA 3DYAA 3MAQA 1B9DA 1FKOA 3WNFA 1RDBA 4E1MA 4CIFA 3HO1A 4FZYA 3QEVA 1WN7A 4FJ5A 3LWLA 4FK4A 4I7FA 4BWJA 1VRUA 2FBYA 4FLZA 4FYDA 2E6LA 1TK5A 1J54A 3SQ0A 1JKHA 1C6VA 1RNHA 4O5BA 1TV6A 4KO0A 4DSLA 3ZSWA 1RT4A 3HM9A 1L3VA 4QCLA 3HPHA 1WAFA 3MEDA 4CJPA 3VQBA 1SV5A 4CK3A 4KAZA 3HJFA 3RMBA 1S6QA 3ITHA 4O0JA 3NH1A 1T05A 1TKTA 1RT2A 4DTXA 5J2NA 1TAUA 4FLWA 1L3UA 4YFUA 1I39A 3ZSYA 3V9XA 3O4NA 1IKYA 2X78A 3VQQA 3OY9A 1SUQA 1VSIA 1NJWA 3RRGA 3OYHA 3LP2A 5KI6A 1BCMA 4CHOA 4KHUA 4Z4FA 4CJKA 3NGZA 4M45A 3K5LA 1L3SA 2XY8A 2R7YA 1IG9A 4Z4EA 1XWLA 2HHUA 1U47A 5SWMA 4N5SA 3K57A 2YKMA 4BDZA 4CJQA 4DTUA 3QIOA 3U3YA 4C8KA 2D0CA 2KW4A 1HRHA 3VQ5A 3ZSZA 4DWIA 3V1QA 1EXQA 2P51A 3KKRA 4OPJA 4F3TA 4FW1A 2Z1IA 1D5AA 1S1WA 3AVBA 3LANA 4KTWA 3U3GA 4PY5A 4OGCA 3NF6A 3LP1A 3K5MA 2JGUA 1BIZA 4HHTA 4LD0A 1NOZA 4CEBA 3C95A 4CCHA 4E7HA 2DY4A 3OS0A 1A5XA 1Q9XA 4GMJB 3S3OA 1REVA 1RDCA 2HNDA 5T7BA 3VQ7A 4F2RA 3LP3A 4H4MA 1KFSA 3KD5E 3RWUA 3HPGA 3PV8A 3QEPA 1C0MA 2YHBA 3L2WA 3TAFA 1TVRA 1S1XA 1YTAA 4FK0A 1X9SA 3T3FA 1WSIA 4E7LA 1RBVA 4JLHA 4Q0BA 4Z4HA 4BACA 2VWKA 1YVUA 1XHXA 3MXMA 4N47A 1RT3A 5HLFA 4RW6A 3DRSA 3M8PA 2IGIA 4DQIA 1KVCA 3DOLA 3IRXA 1NK0A 1TK0A 2BDPA 5I3UA 3PO5A 3WNHA 3DLRA 3ZT3A 1IH7A 4QOZB 1TK8A 3JYTA 2HHSA 2FC0A 3HYFA 2PYLA 2A1SA 4CJ3A 3SUQA 2PYJA 3HK2A 3K2PA 2E4LA 4FM1A 1C0UA 3LAKA 4DLEA 1ZBFA 1HYZA 1SL1A 3L3VA 2HHWA 2KZZA 4JRPA 2ATQA 5C24A 4FJIA 5J2PA 5FDLA 2PZSA 4FM0A 4DTPA 3NE6A 4KB0A 3L2VA 3A2FA 4M3XA 3EYZA 3VQPA 3OYCA 4DSKA 1BCOA 3HXMA 4ICLA 3KLEA 3I0RA 1VSLA 3VQ8A 2P1JA 5JS1A 2RN2A 5FRMA 4W5OA 3K58A 2F8SA 4N76A 3VA3A 1TL3A 2ETJA 2X6NA 4CECA 1BI4A 3O4QA 1T8EA 4B3OA 3P1GA 4CHNA 3DRPA 4M3RA 4CEAA 1U49A 3NDKA 3PUFA 3OYNA 4FLVA 4OLAA 4I2QA 1XI1A 4IG0A 4KFBA 5CZ1A 4KTZA 3EY1A 1Q8IA 2A1RA 2DFFA 2ITGA 1UAXA 4Q5VA 3OYAA 1RTJA 1RTHA 1VSEA 3HP9A 4KB1A 4DFPA 1ASVA 3F73A 3CM6A 3OS1A 4FLTA 5EU7A 3WNEA 4CK1A 1JLGA 3O3HA 1VSMA 3BGRA 2O4GA 1L5UA 4RW4A 3C94A 4DTJA 2G8IA 3U6FA 4ELVA 4E7JA 4KI4A 1W0HA 3F9KA 5CY4A 3CFPA 4KI6A 1RT6A 4ZHRA 3KTQA 1S6PA 1NK8A 3SUNA 3AVHA 1YT3A 3LALA 2GBZA 4Z0UA 4CGIA 3RMDA 4OGEA 1KSPA 4B9MA 4NYNA 4CK2A 1RDDA 2GUIA 4GW6A 3VQEA 4DSFA 3SQ1A 3QINA 5C25A 1JLEA 4DQQA 3PO4A 4LY7A 2GV9A 2YNFA 4WE1A 3D0PA 2HHTA 1KRPA 2G8VA 1ZBIA 3ZT0A 4BE1A 4M3YA 3NCIA 1C1AA 4W5RA 2YNHA 3VQ9A 2Z1GA 4CGHA 4HUFA 1JXEA 3TANA 3ASMA 4MFBA 3HL8A 3KK3A 2YV0X 3LPTA 3B6OA 1ITGA 4BDYA 3HSTB 3RR7A 3ZSOA 1JL1A 1Z25A 4I2PA 5K14A 2QXFA 4CJRA 4ELUA 3CFRA 3KK1A 3LDSA 4Z4GA 1JLBA 4HUEA 2P5OA 3MEEA 3CQ8A 4J2AA 1EX4A 1SKRA 4PUOA 1CLQA 2OPRA 2HHQA 5DK5A 3MXJA 4BE0A 4L8RB 1QS4A 2E6MA 3NBPA 3NAEA 1FKPA 2F96A 1WSJA 3NGYA 3ZSVA 3IAYA 2DTUA 3QNNA 3LZIA 2HMIA 4FJ7A 5HP1A 4AHTA 4CF9A 1RT1A 4CJLA 1C0TA 1VRTA 3NF8A 3T1AA 3AVIA 4YNQA 2BE2A 1IKVA 4IG3A 3TAGA 1TGOA 1HQUA 2X6SA 2YNIA 2HHVA 4BWMA 4DF8A 2Y1IA 4XIUA 3HVRA 2IOCA 2FBXA 4CEOA 4O44A 1O1WA 3I0SA 3OYBA 1RT7A 4QAGA 1NJXA 3RRHA 1QHTA 4Y1DA 3TI0A 3KKSA 1GOCA 2X74A 4J2BA 2KFZA 4CIEA 3I8DA 1K6YA 3QEWA 2QK9A 4CEZA 3SPZA 2RKIA 4FJKA 4DS4A 2O4IA 3AO5A 5KRTA 2XY6A 1WSGA 3RTVA 4ZTFA 3AVGA 3AO3A 4CJ5A 3VA0A 3MECA 4OJRA 2HW3A 4E3SA 4M3TA 1NKCA 2HNZA 1VSJA 2B5JA 3AVAA 4CEDA 3OS2A 1NJYA 1LW2A 1D9DA 2DFHA 1TL1A 4CF1A 4CF0A 4F8RA 1A5WA 4DFMA 1RCHA 3TAMA 1D8YA 2WOMA 1RDAA 4AHSA 3QEIA 2VWJA 3SQ4A 3AA3A 1I3AA 1QQCA 4DQRA 3AA4A 3OYJA 1JLCA 3AVCA 4RW7A 1KTQA 4B8CA 3O3FA 4BE2A 3V9ZA 1NK6A 4B9UA 2P5GA 3E01A 1VSHA 1RBRA 2RPIA 4IBNA 1BI4B 1TKZA 4G1QA 3ZSQA 3QO9A 2KFNA 3P5JA 1Q9YA 4B9NA 5HBMA 1HJRA 1UWBA 1DTQA 1BISA 4AILC 1TKXA 3OYFA 4B9TA 5I42A 2RF2A 3SJJA 1FXXA 2VG7A 1U45A 3OYLA 3L2RA 4CJUA 4OKEA 3VQCA 1QSLA 3RR8A 4FJHA 4CGJA 5HROA 4ZTJA 3AA5X 4O0IA 4B8AB 3KLHA 3HT3A 4FCYA 4DTRA 5CYQA 1UA0A 1D9FA 1IKWA 3DI6A 4OKKA 4F3OA 4CGDA 1YTUA 4R5PA 3ULDA 2Z1HA 4I9LA 3QEXA 3SUOA 3KLIA 1JLFA 2G8FA 1WNSA 2XHBA 2B6AA 3QLHA 1KVAA 4B9SA 2IC3A 4CJFA 1X9WA 1HNVA 3LP0A 4CF2A 1DTTA 2G8HA 3ZT1A 4DF4A 1RILA 1TAQA 3SV4A 4H8KA 4IFVA 2HVHA 4IFYA 4NYFA 4UQGA 1HQEA 1SL0A 4LSNA 4F4KA 4PA1A 3DRRA 3C6UA 3AVJA 3AVFA 3DLEA 4CERA 4DSEA 3TABA 1EETA 3OYDA 3AO2A 1U04A 4FZXC 1RT5A 3HVTA 3QIPA 1HPZA 3DM2A 3KIOA 4E1NA 3KD1E 1Y97A 1NK4A 2BGGA 4FW2A 3NFAA 3ALYA 4CGGA 1GOBA 1HMVA 4CESA 4CGFA 3KJVA 4C8NA 1NKEA 1F21A 4CFBA 3EZ5A 4FLXA 3TWHA 4H4OA 4O55A 2ZD1A 3V1RA 1X9MA 1W9HA 3V9WA 3WNGA 1MU2A 2PY5A 1LWEA 1WSFA 1WSHA 4J2DA 3M8QA 1C1BA 4RW9A 4E19A 4DMNA 3CFOA 1UA1A 2IAJA 5KRSA 2AJQA 3QETA 1GOAA 3TR8A 1LAWA 1IKXA 4EP5A 4BDPA 3VQAA 3OYEA 4DSJA 3LWMA 4AHVA 3RMAA 5D3GA 2QKKA 1QTMA 3QESA 2OZSA 4HTUA 4KHWA 2KQ2A 4PQUA 4RG8A 3JSMA 2YHAA 1RBSA 2Q3SA 1NK5A 1T7PA 4K8XA 1S9EA 3KLGA 3AA2A 3CM5A 5JS2A 1J5OA 3DOKA 3PX4A 4FM2A 4PWDA 3SNNA 3MEGA 5KTQA 5HRPA 3NF9A 4OLBA 5J1EA 2OA8A 4ELTA 3SZ2A 1NK9A 3PY8A 4B9LA 4FJ8A 4C8OA 2XY7A 3BDPA 4CHPA 1KLMA 4C8MA 4N56A 3NGIA 4DTOA 4KHNA 3OYMA 3NF7A 1ASUA 4NCAA 3G10A 3S3MA 1ZYQA 1CZBA 3VN5A 1EKEA 4CF8A 3MXIA 1SKSA 3QERA 3VQ6A 3OVNA 4DS5A 1RTIA 1QSYA 4OKJA 2JLEA 4FJJA 2D5RA 3LZJA 4C8LA
chains in the Genus database with same CATH superfamily
4J2EA 4WCEL 4CW7B 5CYMA 3DXMA 2P9LA 2ASPA 4LH5A 3L2UA 3D6RA 4PL8A 1J5EK 3NH0A 1VK0A 1LCUA 3WT0A 3SYZA 1OVQA 4I9QA 1LWFA 3KWGA 3A5MC 4E0DA 3CC4N 4Z4IA 3UE5A 2AP1A 4XH1A 2XY5A 1Q18A 1U48A 4HUGA 1C1CA 3I55N 3D45A 1YXQA 2NRZA 2BTFA 4DSIA 3CERA 1XMOK 1IBMK 4IJNA 4CJVA 5HRRA 1N6QA 4FJLA 3QICA 3G0ZA 3IS9A 4AM7A 4DFJA 2FXUA 1N5YA 2ZJQL 3CJBA 3A5OC 2HVIA 5KGWA 1WAJA 3E9OA 3CD6N 4E7KA 2WC9A 4CZMA 2E2PA 1LV5A 2LSNA 1KVBA 4DU1A 4OVLA 1A5VA 1JCFA 4E7IA 4ISFA 5AQYA 3HP6A 4DTMA 4BRAA 4W5TA 2G8KA 2G8WA 3V4IA 3FFIA 4BGAA 4BRKA 4CZFA 1BL3A 2VG5A 4DV0K 1XHZA 1VQMN 1WLJA 4LFCK 1MDUB 4M3WA 4CEQA 3SAHA 4DV5K 5AZIB 4WF9L 3DLBA 3QFPA 3SAFA 3OYIA 2FSNA 1S1UA 3WEEA 3ZT4A 1QSSA 2Q36A 3M8RA 4FJ9A 2B4JA 4CZGA 3VEOA 5GIOA 3CQYA 1NGFA 3T7ZA 1ZBLA 1NJZA 3EE8A 1XC3A 3J8AA 5M1OA 3VQDA 2W42A 3ENBA 4FPAA 4EIAA 3ZSXA 1SKWA 3OYKA 1VQNN 3P83D 4NB4A 2WONA 1T03A 4H5WA 3THXA 3AV9A 2YKNA 3CG7A 4JS5A 3RMCA 3SJHA 4DQSA 4OPKA 1BQNA 1VSFA 1I94K 1BG3A 3VQ4A 4CJ4A 2D4WA 3L2QA 4KPYA 3OTOK 4CJEA 1Q81O 4PKHA 2JWLA 4CEEA 3K5OA 4PKGA 3CCMN 3VENA 4MQ3A 3RSEB 1FKOA 4X64K 5AZJB 1N33K 4Y0WA 1ZBSA 5FPDA 1WN7A 2O8CA 4I7FA 4BGBA 4BWJA 2FBYA 3NMUA 2HBMA 1J54A 2HHHK 4JI7K 2NRRA 4QS9A 4BRQA 1TV6A 4WQ5A 4QCLA 1IJJA 2FLOA 1WAFA 4KAZA 1SV5A 4H0YB 2Q0UA 4YY3K 5J2NA 1L3UA 3QFUA 3ZSYA 3V9XA 2HMPA 3O4NA 2X78A 1KAYA 3CIPA 3VQQA 3OY9A 1VSIA 4DV3K 1NJWA 3LP2A 3A5LC 1L3SA 4M45A 2WUSA 2HHUA 4DTUA 2KW4A 5AQTA 1E4GT 4F3TA 1D5AA 3AVBA 3D7EO 4PY5A 4FO0A 3H1VX 4KBOA 4JYAK 3LP1A 3I33A 2JGUA 3HTVA 3DXKA 2YHWA 4GV9A 1RDCA 1X9JA 2V51B 4LFBK 5EOYA 4F2RA 1GLBG 4JK8A 2KLAA 3HPGA 3PV8A 3HSCA 2YHBA 5EXWA 1YTAA 4FK0A 4Q0BA 1RBVA 4Z4HA 4V19S 3J7AP 4N47A 4DR3K 5HLFA 5TKYA 2OTLN 1QZ6A 2A40A 2QWQA 4M7XA 2A6AA 1IH7A 2HHSA 2ZJPL 3LAKA 3EKUA 5LMUK 1SL1A 2IVOA 1OVYA 4HWIA 4JRPA 5C24A 3PIOL 3B8AX 4FM0A 3NE6A 2CGKA 3EYZA 3OYCA 2HOEA 3AGKA 2P1JA 4CI6A 1ZXOA 4W5OA 3CC2N 3L4IA 4CECA 5LMNK 3P1GA 4CHNA 4IKFA 4I2QA 5CZ1A 1GLJO 3EY1A 1SAZA 1SS6A 1RTJA 4DFPA 5BPMA 3P38A 3CM6A 5I9EB 4KH4A 1K8KA 4CK1A 3O3HA 4RW4A 3THYA 4E7JA 3FZKA 4KI6A 3MWPA 2CH6A 1S6PA 4NXNK 5JLHA 3AVHA 3LALA 4Z0UA 3WXIA 4IEEA 4CK2A 1RDDA 3VQEA 5C25A 3A8YA 4CZKA 4DR4K 5BPLA 4B3SK 4MLEA 4BRGA 1KRPA 4IDHA 5C12A 4BREA 2ZJRL 1QQOA 2ITMA 4JD2B 2OANA 3ASMA 4MFBA 5TKWA 3B6OA 2P9SA 4B1YB 3K9JA 3RR7A 1Z25A 4I2PA 5AQKA 4IO9L 3CFRA 3KK1A 4Z4GA 2P5OA 3MEEA 2VQFK 2OPRA 1QS4A 2E6MA 1FKPA 2F96A 3H1QA 3QNNA 4DR1K 5HP1A 1RT1A 3T1AA 1IKVA 1TGOA 2X6SA 2YNIA 4CZIA 4DF8A 5F0XA 3T1HK 1W2BM 1V4SA 1Z6RA 3QBXA 3I0SA 1RT7A 4QAGA 5KPTA 4YOWA 4Y1DA 2KFZA 2E20A 3I8DA 3QEWA 1HKGA 4CEZA 3SPZA 4DS4A 2O4IA 3AO5A 3MX5A 5BN8A 4CBUA 3R6MA 4E3SA 1NKCA 1VSJA 2B5JA 3OS2A 4CEDA 1RCHA 2WOMA 5AQSA 4AHSA 3QEIA 3CMEN 3TSQA 3AA4A 3AVCA 3V9ZA 4B9UA 1T6DA 1VSHA 4G1QA 3ZSQA 3PLAA 3P31A 1UWBA 1E3MA 3TU5A 1TKXA 5KQDA 4BRFA 1V4TA 5BN9A 5EY4A 1U45A 4JK9A 3L2RA 3VQCA 4CGJA 4IFEA 3C65A 4FCYA 3HRGA 3C7NA 5CYQA 4OKKA 1GLAG 4YDUA 4CGDA 4R5PA 4I9LA 4H5TA 3QEXA 2UXBK 1WNSA 3HBTA 1KVAA 1X9WA 2F9TA 4ILJA 1DTTA 4DF4A 1RILA 5AQZA 4IFVA 5HL7L 4A57A 1SL0A 4F4KA 1N32K 2YHXA 4JV5K 1GLEG 4CERA 4AF1A 1BO5O 4DSEA 1EETA 4FZXC 1NG9A 1HPZA 4GV3A 3KD1E 2BUPA 1VQ9N 1GOBA 3KJVA 1NGBA 5GINA 2GTDA 1VQ5N 3ZLJA 2PY5A 1LWEA 1ILYA 4FWSA 1VQPN 5AFUA 2IAJA 5BRHA 1N8RO 4BRPA 4PQUA 2OZSA 5DM7L 2WBNA 3HI0A 4FWQA 4RG8A 3JSMA 2Q3SA 4K8XA 3TSPA 1S9EA 4CZHA 3LM9A 3DOKA 4DV2K 3PX4A 4PWDA 2P9KA 5HRPA 3NF9A 2V7YA 1KQSM 4O8KA 4B9LA 4JI2K 4C8MA 4NCAA 4BRCA 3VN5A 4DS5A 3UKRB 3U9ZA 3OA9A 4FJJA 3LZJA 2P9KB 1VQ6N 1TYQB 3DMJA 1NMNA 2KTQA 4WQ5C 3TAEA 4DTSA 4DCHA 1NGEA 4FJGA 1IV0A 2ASMA 1KLNA 4WFBL 2UXCK 1NMDA 2HB5A 4JKCA 5AJ3K 4KTQA 2VWBA 3BUZB 4AQYK 4NLBA 4WYBA 5C42A 4A61A 3K5NA 4CJTA 4FZZA 4KKOA 3ULEB 1KXPA 1R0AA 4L3QA 2FBVA 2ZE2A 5FROA 1CXQA 2OYQA 3DLGA 5FPNA 3HPOA 3R8EA 1BWFO 4EAHD 1NGCA 1JLAA 4KRFA 1WSEA 4FPBA 4CJWA 3UKRA 1ZC6A 3ISNC 3TAQA 1N34K 3VGKA 4AHRA 4KREA 4M41A 4CZLA 3EZWA 4JNEA 2EX3A 4FJMA 4JI8K 2VGMA 3SLCA 4Y1CA 3THVA 3ATVA 3LM2A 3Q7CA 3KZBA 1VSDA 3MN9A 4W5NA 3O8MA 2Y1JA 2OPSA 1HYVA 1VSKA 1HR0K 5C10A 1CZ9A 2GWKA 5AQUA 2HF4A 2YNGA 2E88A 3L8BA 2Q31A 4LH4A 3MN7A 4JKAA 3QB0A 2UUBK 3CF5L 3J81O 2FSJA 4FK2A 4E89A 3V1OA 3QDKA 3WUHA 1BHLA 3ZETB 5AFUH 3LPUA 2HNYA 4CZEA 3E9PA 3W3DA 2IS3A 2O8EB 3VESA 4FXDA 4B9VA 3WXMB 3M8SA 1Y64A 3V9SA 2G8UA 3ZSRA 1LW0A 2D0OA 3AVKA 2HHXA 5AQRA 4OO1J 1ZBUA 2OZMA 5CR4A 3SAGA 3Q7BA 3F9MA 1OH7A 1BA0A 3SI6A 3AVNA 1WBDA 4JKGA 4CE9A 4TSXA 3DYAA 3MAQA 1B9DA 2RE2A 3FZLA 1X3NA 4FJ5A 3O9TA 3LWLA 4FK4A 4FYDA 5LL6Z 1RNHA 3HPHA 3HJFA 4C1NK 1T05A 2HBKA 1YIJN 4JK7A 1TAUA 2NNWA 4C23A 1I39A 1HX1A 4FOEA 4DR7K 3WXKA 5AQMA 1C0GA 3RRGA 3OYHA 5A2QO 5KI6A 1BCMA 4CHOA 4KHUA 1ATRA 1YJNN 2ZGYA 4IZ9A 4MDAA 1IG9A 4Z4EA 1U47A 3K57A 2YKMA 4C8KA 3VQ5A 4RWTA 3V1QA 1EXQA 4OPJA 1GLDG 3KKRA 4CBWA 2A3ZA 1BIZA 4B9QA 4CEBA 4CCHA 1XUPO 3O9UA 2EWSA 2PFUA 2A5XA 1A5XA 3GL1A 1Q9XA 4GMJB 2IIRA 4XH5A 4H4MA 3KD5E 3RWUA 1HNZK 2P9IA 4BY9C 4JI6K 4LF5K 3LDQA 1X9SA 4E7LA 2CGLA 1BA1A 3H45C 4GY2B 3DRSA 3CCVN 5C2DA 3I56N 2QWMA 4DR2K 3DOLA 2W6LA 4H0PA 3IRXA 1TK0A 2BDPA 4MO5A 5I3UA 4QS8A 3ZT3A 3ZETA 4I6MB 2YI1A 2NRHA 2A1SA 3CCQN 2PYJA 3K2PA 3LDPA 4FM1A 1NGIA 3AARA 2ATQA 1RGIA 2PZSA 4EHUA 4M3XA 3O1BA 1BCOA 3G25A 4Z94A 4YOUA 3I0RA 2QI2A 3SK3A 1FJGK 4DUZK 1Z05A 1NWKA 2RN2A 2F8SA 1WOQA 3FZMA 1BUPA 2X6NA 4H5NA 4A62A 1YITN 3FZHA 4OLAA 4JEPA 4BVPA 1NGHA 4CZJA 4IG0A 3CCRN 4KTZA 4LF4K 4YOTA 3A0IX 3VTHA 2PBDA 1RTHA 3HP9A 1VSEA 4K42A 4FWNA 3OS1A 1BDGA 3E9LA 1JLGA 3TSUA 3C94A 3LDOA 3U6FA 3O1WA 4ELVA 5CY4A 3JS6A 3KTQA 1NBWA 4CGIA 3RMDA 4B9MA 1QHAA 4GW6A 3P39A 1QZ5A 3FR0A 4LY7A 2GV9A 1W97L 4E1JA 2G8VA 4DV7K 4BE1A 4GKKK 1DEJA 3NCIA 1VQON 2YNHA 3MWTA 4CGHA 4HUFA 2YV0X 3LPTA 4WFAL 1IBKK 1ITGA 2BH1A 3HSTB 3GDQA 5K14A 4BR0A 4BRMA 3VMFB 4DKWA 1YI2N 4FL9A 3CJCA 3N4QA 3CQ8A 3NBPA 3VPZA 1HNWK 3LDNA 2DTUA 5GAHP 3ZSVA 2ZF5O 4AHTA 4CF9A 5JVHL 4CJLA 3NF8A 5BR8K 4ILGB 3TAGA 4A2AA 4BWMA 2Y1IA 4KH5A 2FBXA 4BC5A 4O8UA 4A5BA 1NJXA 1S3XA 4IEIA 3KKSA 1GOCA 4DQ8A 4CIEA 5GAEP 2RKIA 4LC9B 5IWAK 3HOSA 4B1ZA 1WSGA 3RTVA 3DWLA 4PKIA 4HTLA 4M3TA 2HNZA 3AVAA 1LW2A 2DFHA 4CF1A 4CF0A 4F8RA 4DFMA 3TAMA 1I3AA 1QQCA 4B8CA 4RW7A 3O3FA 1NK6A 2O8EA 4BG8A 4K43A 1TKZA 3QO9A 2KFNA 2VYPA 1Q9YA 4B9NA 4GV6A 4AILC 1DTQA 5C2FA 3OYFA 5I42A 4X65K 4IOXA 1FXXA 3C6AA 4BRLA 4YOYA 3ULEA 3D2EB 4IOCL 1UA0A 4O0IA 4B8AB 2Z1HA 5M1QA 2G8FA 2B6AA 3QLHA 1NGDA 1XNRK 3LP0A 2QEXN 2QWOA 3ZT1A 1TAQA 4CD1A 3SV4A 2HVHA 3CJAA 4NYFA 3VERA 3AVJA 1HPMA 1P8ZA 5M1FA 3TABA 3OYDA 1RT5A 4I6MA 4KH6A 4C8NA 1F21A 3C7NB 4ISEA 3O5BA 2O8BA 2PAVA 4O55A 1X9MA 2RHKA 4K0KK 1MU2A 5C0YA 1WSFA 3M8QA 1C1BA 4BC4A 1UA1A 1GOAA 4JI1K 4MO4A 3TR8A 1JJ2M 4EP5A 1QVGM 2NLXA 3WQTA 3VF4A 1WBBA 4BDPA 4LFAK 5D3GA 2D1KA 1QTMA 2Q97A 5FPEA 4KHWA 2KQ2A 2YHAA 1J5OA 4BC2A 3BP8A 3ENHA 4FM2A 4UY8O 3MEGA 5KTQA 3UB5A 1D4XA 2OA8A 5CE3A 3IMXA 3BDPA 1KLMA 3O9QA 3NF7A 3G10A 3MCAB 3QERA 3OVNA 1QSYA 4OKJA 2JLEA 4BR7A 2QWNA 4JAXA 3QNOA 3CHWA 4FLUA 4PL7A 3PX6A 1VAZA 4KHSA 4CEFA 3VF6A 2OPQA 1HNIA 3CI5A 4O4GA 3QBWA 1LAVA 4K25A 4N41A 3BEXA 3S9HA 2D0PA 3IG1A 3DLHA 4IDKA 2O8FA 4JN4A 1CXUA 1YJWN 3SCXA 4YOXA 1S1VA 4LSLA 4FJXA 4DLGA 1NKBA 1RTDA 3TARA 3C6HA 1TYQA 5SZTA 2P9LB 4ISGA 2NUBA 4M63C 3C0BA 4G9ZA 2O8BB 3V6DA 4CHZA 1NOYA 3T19A 4DU4A 4H5VA 2IDOA 5JVGL 3ZT2A 1NK7A 3CCLN 2QXLA 1KCFA 3O3GA 4HCCA 4AHCA 4CFCA 1YAGA 3AAPA 4KV8A 1YF5L 5BREA 3A5NC 2KZMA 3OYGA 3C6TA 3AO4A 4M42A 1NGGA 3V81A 1RFQA 4JKFA 4EZ6A 4YHHK 2NRVA 1YVNA 4FLYA 3OJUA 1XC9A 3OJSA 1TKDA 2VG6A 4AHUA 1JCEA 3LAMA 4AH9A 1MWKA 1BGXT 4M3ZA 3CCEN 2XO7A 1NJIO 5E41A 3GOIA 1KFDA 2JWKA 3R1XA 1QE1A 1P90A 4PHTX 1YUWA 5MLCQ 3CQXA 1HYSA 1Z26A 5CZ2A 3H08A 3SPYA 1B92A 1TUYA 3H3OB 3L4QA 4KHQA 4B08A 1JL2A 4HVJA 3K59A 4EHTA 3UIQA 1EP4A 1MA9B 5HRNA 1IO2A 1IBLK 5FRNA 4FVMA 1JLQA 1S9GA 1HLUA 4ID5A 3S41A 1H1VA 3VEYA 1DKGD 3M1FA 1ZBHA 2I5JA 4H0TB 2QKBA 1X1PA 2ZQBA 1BQMA 5KGXA 3AO1A 5E26A 4DG1A 4Z4CA 1L3TA 1JXBA 4JS4A 4W5QA 4N76A 4EZ9A 4NXMK 1K73O 1U6ZA 3S3NA 5KPRA 2VCPA 2I7PA 4E1MA 4CIFA 3J80O 4FZYA 3QEVA 3IUCA 3U9DA 4CVNE 1C6VA 3ID8A 4O5BA 4CJ7A 1MWMA 2QWRA 1RT4A 3HM9A 1L3VA 1OH8A 3MEDA 4CJPA 3VQBA 1Q86O 2QWPA 5AZJA 3ITHA 4O0JA 4BQZA 3NH1A 1RT2A 4DV4K 3BF1A 4YFUA 4J8FA 1HUXA 3N4PA 2V52B 2NRXA 1SUQA 4Z4FA 3OW2M 5AQGA 3K5LA 2XY8A 2R7YA 2YJEA 4N5SA 3CCUN 4BDZA 3PSIA 3QIOA 2D0CA 4FW1A 2Z1IA 3U3GA 4OGCA 5AQIA 1CZAN 3K5MA 2O8CB 4H0OA 3T1YK 4E7HA 3OS0A 3THWA 3KWIA 2HNDA 3ZX3A 5T7BA 3VQ7A 3LP3A 3SBGA 4K41A 4DV6K 3QEPA 3L2WA 5AR0A 4JI3K 3T3FA 1WSIA 3CMAN 2VWKA 3DXKB 4BRHA 1M1KO 3DAWA 4LF7K 5M1PA 4RW6A 2A41A 3M8PA 2IGIA 4DQIA 3BF3A 1NK0A 4B3RK 3KVGA 3DLRA 4BRNA 1Q82O 2W6KA 4QOZB 3KK7A 2FC0A 3HYFA 5BR9A 3OHRA 4CJ3A 4OX9K 2E4LA 1Q7YO 1C0UA 3NVKA 5AZIA 3R9PA 1ZBFA 1HYZA 3L3VA 5AQXA 5FDLA 4BG9A 2WTUA 4KB0A 4DSKA 3GG4A 3HXMA 4ICLA 3KLEA 5GAGP 1VSLA 3VQ8A 2QTDA 5FRMA 2ETJA 1VQLN 4H0VB 1BI4A 5FLXO 2P9IB 4B3OA 3DRPA 3F5TA 3PUFA 1U2VB 1BOTO 1VQ8N 2DFFA 1UAXA 2A42A 5H1SQ 4Q5VA 4KB1A 4FSVA 4BR9A 4FLTA 1L5UA 1VSMA 2HSTA 2O4GA 5CHIA 4DB3A 4JD2A 5FPMA 4A59A 4KI4A 2F9WA 4X62K 3CFPA 5F1XA 1NK8A 3SUNA 3DJCA 1YT3A 1QQMA 3J7YP 1KSPA 3SQ1A 5EVZA 4DSFA 3CJ7A 1JLEA 4DQQA 1SQKA 3PO4A 4WE1A 1ZBIA 4M3YA 4GNIA 1C1AA 3VQ9A 2Z1GA 4BVOA 3TANA 1JXEA 3AY9A 2E2NA 2Q0RA 4BDYA 2VQEK 3ZSOA 3ZX0A 4CJRA 1C0FA 4DR5K 1JLBA 4HUEA 2YJFA 3VEZA 1SKRA 4PUOA 1QVFM 3MXJA 4L8RB 1K9MO 2ASOA 5AQJA 3F2KA 1C0TA 1VRTA 3AVIA 2VGNA 4IG3A 2HHVA 3DXMB 4XIUA 4JKGB 3J7ZO 2IOCA 4CEOA 3G4SN 2FSKA 1O1WA 3OYBA 1QHTA 3VETA 4J2BA 3ZYYX 4FJKA 3DLLL 1S22A 5F2RA 2XY6A 4ZTFA 3AVGA 5AQPA 5M1KA 4JKEA 4CJ5A 3VA0A 5B8HA 3MECA 2HW3A 5AQHA 1JCGA 2HF3A 3D2FA 1NJYA 3WXJA 3VGMA 3THXB 1A5WA 3NVMA 2YHYA 3AGRA 1RDAA 2VWJA 3AA3A 1NGAA 3OYJA 2P5GA 3UKUB 1VQKN 3O6WA 4JI5K 1RBRA 2RPIA 3I8BA 1KAZA 1U2VA 1HJRA 3M3ZA 2RF2A 2VG7A 3OYLA 4CJUA 5HROA 3AA5X 3HT3A 4DTRA 1D9FA 4JI4K 1EWRA 3ULDA 3SUOA 1JLFA 4B9SA 2IC3A 1HNVA 2G8HA 4OPAA 3O4WA 4H8KA 4FWKA 4IFYA 4UQGA 2V7ZA 4BRIA 4IOAL 4U67L 4PA1A 3DLEA 3AVFA 3O80A 3ZEUB 3AO2A 1U04A 3KIOA 3EN9A 4DV1K 4E1NA 4A5AA 2BGGA 4FW2A 3JXUA 4CGGA 5E84A 4CGFA 1S72N 4CFBA 3EZ5A 4H4OA 3V1RA 1NGJA 1W9HA 3V9WA 1W7AA 1WSHA 4J2DA 4E19A 4DMNA 4WFNL 3QETA 1IKXA 3LWMA 4AHVA 3RMAA 4DUYK 2QKKA 4MDBA 1RBSA 3KLGA 3AA2A 3CM5A 3PSFA 3JAMO 4GKJK 2GX9A 3SZ2A 3TTDA 1NK9A 5AQQA 4FJ8A 4C8OA 2XY7A 3D2FB 3FGUA 4N56A 3NGIA 4DTOA 4CBXA 1ASUA 3MXIA 3VQ6A 1KC8O 3FZFA 4BQLA 2D5RA 1G99A 1E4FT 4C8LA 5IT9O 4B3MK 2E8AA 2EHGA 2DFEA 3THYB 3AAQA 3NHGA 4U7BA 1S1TA 3VEXA 5BRFA 4RTFD 4CFAA 4CJSA 1GLCG 5C15A 2W41A 4FWPA 3TAPA 2DPNA 4BROA 2CGJA 4HCBA 1J6ZA 1T3VA 3EKSA 2FBTA 3RVCA 3L3UA 4WQ4C 3SQ2A 4YOVA 3KLFA 2Q1NA 4NCGA 4ID1A 1NNEA 1B9FA 3CXCM 1S5JA 5AQNA 4NCBA 3CYMA 1J53A 4H0XB 3TTFA 2QM1A 3DLKA 4DQPA 2OPPA 4DU3A 4IXCA 4F2SA 1N36K 3SUPA 1WB9A 5M1NA 3PX0A 1RDUA 4FJNA 3ZX2A 1U4BA 4DTNA 3SMSA 1RBTA 3KK2A 3BZKA 3ZCMA 2ZGZA 1BIUA 3CPWM 1IG8A 3TTCA 4F9OA 4LF6K 1G15A 2XRIA 3FFKB 3U8XA 3CC7N 4M3UA 1RBUA 3VF2A 2GWJA 3WEEB 1SZ2A 2QW9A 4YORA 3EL2A 4M7YA 1UOCA 2F8TA 1XMQK 3AVMA 3WXLA 3WQUA 3MCPA 3R3LA 4CHYA 2D0BA 2QA4N 4CHQA 2D0AA 5J2QA 1OH6A 5AQWA 2NRTA 2KHOA 3AVLA 4MLHA 1SL2A 4K8ZA 1FK9A 4DFKA 5HRSA 3EE9A 3SV3A 1NLVA 4EP4A 1O13A 4B1UB 3QMLA 3CPEA 3G71N 2W40A 5J2MA 5DMRA 2Q2RA 4KHYA 2BANA 1KAXA 3VGLA 1VQ7N 3V9UA 4GVMA 3ZEUA 1LWCA 1ATNA 1K8AO 4CFDA 4JRQA 4EFHA 2GUPA 2UXDK 3CJ1A 4CIGA 3OBYA 2Z1JA 4RW8A 1J9AA 2QWLA 3NH2A 3O9SA 1ASWA 4JHDA 3LL3A 5ELZA 1DLOA 3K0SA 3VOVA 4JKBA 1EWQA 3B6PA 2O8FB 3WNFA 1RDBA 2P9PB 3K9KA 3HO1A 2E1YA 2KKZA 3E1YA 3THWB 2FF6A 4FLZA 1VRUA 4ILHA 1VQ4N 2E6LA 1TK5A 3SQ0A 1JKHA 4IWVA 4KO0A 1M90O 3ZSWA 4DSLA 3UKUA 3RSEA 4CK3A 3RMBA 2IVNA 1S6QA 1TKTA 3MN5A 2P9SB 4DTXA 4FLWA 4C1NI 4H5RA 5KPZA 4FVUA 1IKYA 4JI0K 1YHQN 2IVPA 2NZTA 5EX5A 1LOTB 5GIPA 3U4LA 4B1XB 3CJ9A 2E2QA 4CJKA 2GELA 3NGZA 4A2BA 1HKBA 2O8DA 1XWLA 5SWMA 4CJQA 3T69A 3U3YA 1HRHA 3ZSZA 4DWIA 2P51A 4KTWA 1S1WA 3LANA 2UUCK 1K8KB 2P9UA 3GE1A 3HM8A 3NF6A 4QS7A 3MX2A 4HHTA 2GEMA 1NOZA 3MMVA 3C95A 4LD0A 2ZM6K 2DY4A 5JLFA 3S3OA 1REVA 5AQLA 1KFSA 4FWOA 1C0MA 2J4RA 5HOOA 3MK6A 1TVRA 1S1XA 3TAFA 4JLHA 4BACA 4H03B 4AM6A 2WFBA 1R59O 2ZWHA 1YVUA 3CCSN 1VHXA 1XHXA 3MXMA 5ADXA 1RT3A 4B1WB 4BR5A 3GBTA 1KVCA 4X66K 2OTJN 3PO5A 3WNHA 3ID6A 1TK8A 3JYTA 2PYLA 3SUQA 3HK2A 4XEIA 4YDUC 1WUAA 4DLEA 2HHWA 2KZZA 4FJIA 3MN6A 3BY5A 5J2PA 4DTPA 2OCEA 3L2VA 3H46O 3A2FA 3VQPA 3VEVA 5ADXH 1TUUA 3VTIA 4FWLA 2F7TA 5JS1A 3K58A 5LY3A 3D2EA 3VA3A 1TL3A 3O4QA 1T8EA 4CEAA 4M3RA 1U49A 3NDKA 4FLVA 3OYNA 1XI1A 4KFBA 1Q8IA 2A1RA 2ITGA 1BU6O 3OYAA 2P9NA 1ASVA 3F73A 4BR4A 2UUAK 3LDLA 1OH5A 5EU7A 3WNEA 3IFRA 4DSJA 3BGRA 3CETA 2G8IA 4DTJA 4IO8A 3FLCO 1W0HA 3F9KA 1NU0A 1RT6A 4ZHRA 5BRDA 2GBZA 3HOTA 4OGEA 4DHYA 4IJAA 4NYNA 2GUIA 3QINA 1T6CA 2YNFA 3D0PA 2HHTA 5AQFA 1HNXK 3ZT0A 2YCHA 3H6EA 5LJWA 1DGKN 4GVEA 4W5RA 3HL8A 3M6GA 3KK3A 4OPHA 2F4VK 3ATUA 1JL1A 3IKMA 1RDWX 2QXFA 4ELUA 3IDHA 3LDSA 2NRWA 4J2AA 1EX4A 3BZCA 1CLQA 2HHQA 5DK5A 4BE0A 2AA4A 3NAEA 1WSJA 3NGYA 3IAYA 3LZIA 2HMIA 4FJ7A 1XQSC 1XNQK 4YNQA 4B3TK 2BE2A 3CCJN 5JICA 1HQUA 3W0LA 4O5FA 3HVRA 4O44A 5AQOA 4JKHA 3RRHA 3L6QA 5KQ8A 4BR2A 3TI0A 3HZ6A 4BC3A 2X74A 2QK9A 1K6YA 1KD1O 4JHDB 5KRTA 1OKJA 3AO3A 3OBWA 4OJRA 3TPQA 2E1ZA 4XH4A 1D9DA 1TL1A 1D8YA 1GLLO 5LJVA 3SQ4A 4NLCA 4DQRA 1FW6A 1JLCA 4BE2A 1KTQA 1T44A 3E01A 4NO7A 2HBJA 4FOIA 4IBNA 1BI4B 3SMPA 3P5JA 5HBMA 1BISA 4RCHA 4B1VA 4B9TA 1EO1A 4BRDA 3EO3A 3SJJA 2P9NB 3RR8A 4OKEA 1HKCA 1QSLA 4FJHA 4ZTJA 2E2OA 3KLHA 1NM1A 4LF8K 3ENOA 1ESVA 1IKWA 3DI6A 4F3OA 1YTUA 3KLIA 2CH5A 2XHBA 4R79A 2UYTA 4FWRA 4CJFA 1X3MA 4CD3A 4CF2A 3VEWA 3E66A 2UU9K 1HJOA 1HQEA 1YJ9N 4LSNA 4DR6K 3DRRA 3C6UA 2HBLA 5AQVA 3HVTA 3QIPA 3DM2A 2I7NA 2E5LK 4FWMA 4KHPK 1Y97A 1NK4A 3NFAA 5BPNA 3ALYA 1GLFO 1HMVA 4CESA 1NKEA 1EQYA 4FLXA 3TWHA 5DM6L 2ZD1A 3O08A 3WNGA 3EEQA 4RW9A 3CFOA 5JMVA 4JKDA 1DT9A 5KRSA 3PIPL 2AJQA 1ATSA 1LAWA 3SBTA 3VQAA 3OYEA 3KHYA 3QESA 4HTUA 3G6EN 2P9PA 1NK5A 1T7PA 3L0QA 5JS2A 1QQNA 3SNNA 4OLBA 3M5RA 3MDQA 5J1EA 4ELTA 5GADP 4WQ4A 3PY8A 3H3NO 4CHPA 2P9UB 3O9RA 4KHNA 3OYMA 1ZYQA 3S3MA 3P4IA 1CZBA 1EKEA 4CF8A 1SKSA 2H3GX 2YX6A 1RTIA 2FF3B 4LF9K 3FE1A 2O8DB
chains in the Genus database with same CATH topology
3DMJA 4J2EA 2KTQA 5CYMA 3QNOA 3TAEA 2EHGA 4DTSA 4FLUA 2DFEA 3PX6A 4KHSA 4CEFA 4LH5A 3L2UA 2OPQA 3NHGA 1HNIA 1S1TA 3NH0A 4FJGA 4O4GA 4CFAA 1VK0A 4CJSA 1LAVA 3SYZA 3TAPA 1KLNA 4I9QA 4N41A 2HB5A 4KTQA 3S9HA 1LWFA 4HCBA 4IKFA 4E0DA 2FBTA 5C42A 3IG1A 3DLHA 3L3UA 4IDKA 3K5NA 4CJTA 4Z4IA 3SQ2A 4FZZA 4KKOA 1CXUA 2XY5A 3KLFA 3SCXA 4NCGA 4ID1A 1U48A 1R0AA 1S1VA 1C1CA 4HUGA 1B9FA 3D45A 2FBVA 4LSLA 2ZE2A 5FROA 4FJXA 1CXQA 1S5JA 4DLGA 1NKBA 2OYQA 1RTDA 3DLGA 3HPOA 3TARA 5SZTA 4DSIA 2NUBA 4NCBA 3CYMA 1J53A 3V6DA 4CHZA 1JLAA 3DLKA 1NOYA 3T19A 4DU4A 1NK7A 2IDOA 3ZT2A 4KRFA 4DQPA 3O3GA 1KCFA 1WSEA 4CJWA 2OPPA 5HRRA 4CJVA 4HCCA 3ISNC 3TAQA 4AHCA 1N6QA 4FJLA 4DU3A 4AHRA 4CFCA 4M41A 4KREA 3G0ZA 3IS9A 4KV8A 4F2SA 4DFJA 3SUPA 2EX3A 1N5YA 3PX0A 4FJMA 4FJNA 2HVIA 1U4BA 5KGWA 4DTNA 1RBTA 1WAJA 4Y1CA 3KK2A 2KZMA 3OYGA 3THVA 3C6TA 3AO4A 4E7KA 4M42A 3V81A 3ZCMA 4EZ6A 1VSDA 1LV5A 1BIUA 2LSNA 1KVBA 4FLYA 4W5NA 3OJUA 4DU1A 1XC9A 2Y1JA 3OJSA 1TKDA 2VG6A 4OVLA 2OPSA 1G15A 4AHUA 1A5VA 1HYVA 4E7IA 2XRIA 1VSKA 3HP6A 4DTMA 1RBUA 3LAMA 1CZ9A 4M3UA 2G8WA 4W5TA 2G8KA 4AH9A 1BGXT 2YNGA 3FFIA 3V4IA 3L8BA 4M3ZA 2XO7A 1BL3A 5E41A 1UOCA 2VG5A 2F8TA 4LH4A 1KFDA 3AVMA 1XHZA 1WLJA 4CHYA 1QE1A 2D0BA 4CHQA 2D0AA 5J2QA 4M3WA 1HYSA 1Z26A 5CZ2A 4CEQA 3H08A 3SPYA 1B92A 4FK2A 4E89A 4KHQA 3AVLA 3DLBA 4B08A 1JL2A 3V1OA 4HVJA 3K59A 1SL2A 3OYIA 4K8ZA 1FK9A 3UIQA 1S1UA 3ZT4A 1BHLA 4DFKA 1QSSA 3M8RA 1EP4A 2B4JA 5HRSA 5HRNA 3SV3A 4FJ9A 1IO2A 4EP4A 3LPUA 1ZBLA 2HNYA 1NJZA 5J2MA 3VQDA 5DMRA 4KHYA 4FVMA 2BANA 5FRNA 2W42A 2IS3A 1JLQA 3V9UA 4GVMA 4FXDA 3ZSXA 1SKWA 1S9GA 3OYKA 3M8SA 1LWCA 4ID5A 4B9VA 3P83D 4CFDA 3V9SA 2WONA 2G8UA 4JRQA 3ZSRA 1T03A 1ZBHA 2I5JA 1LW0A 2QKBA 1X1PA 3AVKA 2ZQBA 4CIGA 1BQMA 2HHXA 2Z1JA 3AV9A 4RW8A 1J9AA 2YKNA 3CG7A 5KGXA 3AO1A 4Z4CA 4DG1A 3NH2A 4JS5A 4DQSA 3RMCA 1JXBA 4OPKA 1L3TA 1ZBUA 1ASWA 1BQNA 1DLOA 1VSFA 3VQ4A 4CJ4A 4W5QA 3L2QA 4JS4A 2OZMA 4EZ9A 4KPYA 4CJEA 3SI6A 4CEEA 3K5OA 3AVNA 3B6PA 3S3NA 4MQ3A 4CE9A 4TSXA 3DYAA 3MAQA 1B9DA 1FKOA 3WNFA 1RDBA 4E1MA 4CIFA 3HO1A 4FZYA 3QEVA 1WN7A 4FJ5A 3LWLA 4FK4A 4I7FA 4BWJA 1VRUA 2FBYA 4FLZA 4FYDA 2E6LA 1TK5A 1J54A 3SQ0A 1JKHA 1C6VA 1RNHA 4O5BA 1TV6A 4KO0A 4DSLA 3ZSWA 1RT4A 3HM9A 1L3VA 4QCLA 3HPHA 1WAFA 3MEDA 4CJPA 3VQBA 1SV5A 4CK3A 4KAZA 3HJFA 3RMBA 1S6QA 3ITHA 4O0JA 3NH1A 1T05A 1TKTA 1RT2A 4DTXA 5J2NA 1TAUA 4FLWA 1L3UA 4YFUA 1I39A 3ZSYA 3V9XA 3O4NA 1IKYA 2X78A 3VQQA 3OY9A 1SUQA 1VSIA 1NJWA 3RRGA 3OYHA 3LP2A 5KI6A 1BCMA 4CHOA 4KHUA 4Z4FA 4CJKA 3NGZA 4M45A 3K5LA 1L3SA 2XY8A 2R7YA 1IG9A 4Z4EA 1XWLA 2HHUA 1U47A 5SWMA 4N5SA 3K57A 2YKMA 4BDZA 4CJQA 4DTUA 3QIOA 3U3YA 4C8KA 2D0CA 2KW4A 1HRHA 3VQ5A 3ZSZA 4DWIA 3V1QA 1EXQA 2P51A 3KKRA 4OPJA 4F3TA 4FW1A 2Z1IA 1D5AA 1S1WA 3AVBA 3LANA 4KTWA 3U3GA 4PY5A 4OGCA 3NF6A 3LP1A 3K5MA 2JGUA 1BIZA 4HHTA 4LD0A 1NOZA 4CEBA 3C95A 4CCHA 4E7HA 2DY4A 3OS0A 1A5XA 1Q9XA 4GMJB 3S3OA 1REVA 1RDCA 2HNDA 5T7BA 3VQ7A 4F2RA 3LP3A 4H4MA 1KFSA 3KD5E 3RWUA 3HPGA 3PV8A 3QEPA 1C0MA 2YHBA 3L2WA 3TAFA 1TVRA 1S1XA 1YTAA 4FK0A 1X9SA 3T3FA 1WSIA 4E7LA 1RBVA 4JLHA 4Q0BA 4Z4HA 4BACA 2VWKA 1YVUA 1XHXA 3MXMA 4N47A 1RT3A 5HLFA 4RW6A 3DRSA 3M8PA 2IGIA 4DQIA 1KVCA 3DOLA 3IRXA 1NK0A 1TK0A 2BDPA 5I3UA 3PO5A 3WNHA 3DLRA 3ZT3A 1IH7A 4QOZB 1TK8A 3JYTA 2HHSA 2FC0A 3HYFA 2PYLA 2A1SA 4CJ3A 3SUQA 2PYJA 3HK2A 3K2PA 2E4LA 4FM1A 1C0UA 3LAKA 4DLEA 1ZBFA 1HYZA 1SL1A 3L3VA 2HHWA 2KZZA 4JRPA 2ATQA 5C24A 4FJIA 5J2PA 5FDLA 2PZSA 4FM0A 4DTPA 3NE6A 4KB0A 3L2VA 3A2FA 4M3XA 3EYZA 3VQPA 3OYCA 4DSKA 1BCOA 3HXMA 4ICLA 3KLEA 3I0RA 1VSLA 3VQ8A 2P1JA 5JS1A 2RN2A 5FRMA 4W5OA 3K58A 2F8SA 4N76A 3VA3A 1TL3A 2ETJA 2X6NA 4CECA 1BI4A 3O4QA 1T8EA 4B3OA 3P1GA 4CHNA 3DRPA 4M3RA 4CEAA 1U49A 3NDKA 3PUFA 3OYNA 4FLVA 4OLAA 4I2QA 1XI1A 4IG0A 4KFBA 5CZ1A 4KTZA 3EY1A 1Q8IA 2A1RA 2DFFA 2ITGA 1UAXA 4Q5VA 3OYAA 1RTJA 1RTHA 1VSEA 3HP9A 4KB1A 4DFPA 1ASVA 3F73A 3CM6A 3OS1A 4FLTA 5EU7A 3WNEA 4CK1A 1JLGA 3O3HA 1VSMA 3BGRA 2O4GA 1L5UA 4RW4A 3C94A 4DTJA 2G8IA 3U6FA 4ELVA 4E7JA 4KI4A 1W0HA 3F9KA 5CY4A 3CFPA 4KI6A 1RT6A 4ZHRA 3KTQA 1S6PA 1NK8A 3SUNA 3AVHA 1YT3A 3LALA 2GBZA 4Z0UA 4CGIA 3RMDA 4OGEA 1KSPA 4B9MA 4NYNA 4CK2A 1RDDA 2GUIA 4GW6A 3VQEA 4DSFA 3SQ1A 3QINA 5C25A 1JLEA 4DQQA 3PO4A 4LY7A 2GV9A 2YNFA 4WE1A 3D0PA 2HHTA 1KRPA 2G8VA 1ZBIA 3ZT0A 4BE1A 4M3YA 3NCIA 1C1AA 4W5RA 2YNHA 3VQ9A 2Z1GA 4CGHA 4HUFA 1JXEA 3TANA 3ASMA 4MFBA 3HL8A 3KK3A 2YV0X 3LPTA 3B6OA 1ITGA 4BDYA 3HSTB 3RR7A 3ZSOA 1JL1A 1Z25A 4I2PA 5K14A 2QXFA 4CJRA 4ELUA 3CFRA 3KK1A 3LDSA 4Z4GA 1JLBA 4HUEA 2P5OA 3MEEA 3CQ8A 4J2AA 1EX4A 1SKRA 4PUOA 1CLQA 2OPRA 2HHQA 5DK5A 3MXJA 4BE0A 4L8RB 1QS4A 2E6MA 3NBPA 3NAEA 1FKPA 2F96A 1WSJA 3NGYA 3ZSVA 3IAYA 2DTUA 3QNNA 3LZIA 2HMIA 4FJ7A 5HP1A 4AHTA 4CF9A 1RT1A 4CJLA 1C0TA 1VRTA 3NF8A 3T1AA 3AVIA 4YNQA 2BE2A 1IKVA 4IG3A 3TAGA 1TGOA 1HQUA 2X6SA 2YNIA 2HHVA 4BWMA 4DF8A 2Y1IA 4XIUA 3HVRA 2IOCA 2FBXA 4CEOA 4O44A 1O1WA 3I0SA 3OYBA 1RT7A 4QAGA 1NJXA 3RRHA 1QHTA 4Y1DA 3TI0A 3KKSA 1GOCA 2X74A 4J2BA 2KFZA 4CIEA 3I8DA 1K6YA 3QEWA 2QK9A 4CEZA 3SPZA 2RKIA 4FJKA 4DS4A 2O4IA 3AO5A 5KRTA 2XY6A 1WSGA 3RTVA 4ZTFA 3AVGA 3AO3A 4CJ5A 3VA0A 3MECA 4OJRA 2HW3A 4E3SA 4M3TA 1NKCA 2HNZA 1VSJA 2B5JA 3AVAA 4CEDA 3OS2A 1NJYA 1LW2A 1D9DA 2DFHA 1TL1A 4CF1A 4CF0A 4F8RA 1A5WA 4DFMA 1RCHA 3TAMA 1D8YA 2WOMA 1RDAA 4AHSA 3QEIA 2VWJA 3SQ4A 3AA3A 1I3AA 1QQCA 4DQRA 3AA4A 3OYJA 1JLCA 3AVCA 4RW7A 1KTQA 4B8CA 3O3FA 4BE2A 3V9ZA 1NK6A 4B9UA 2P5GA 3E01A 1VSHA 1RBRA 2RPIA 4IBNA 1BI4B 1TKZA 4G1QA 3ZSQA 3QO9A 2KFNA 3P5JA 1Q9YA 4B9NA 5HBMA 1HJRA 1UWBA 1DTQA 1BISA 4AILC 1TKXA 3OYFA 4B9TA 5I42A 2RF2A 3SJJA 1FXXA 2VG7A 1U45A 3OYLA 3L2RA 4CJUA 4OKEA 3VQCA 1QSLA 3RR8A 4FJHA 4CGJA 5HROA 4ZTJA 3AA5X 4O0IA 4B8AB 3KLHA 3HT3A 4FCYA 4DTRA 5CYQA 1UA0A 1D9FA 1IKWA 3DI6A 4OKKA 4F3OA 4CGDA 1YTUA 4R5PA 3ULDA 2Z1HA 4I9LA 3QEXA 3SUOA 3KLIA 1JLFA 2G8FA 1WNSA 2XHBA 2B6AA 3QLHA 1KVAA 4B9SA 2IC3A 4CJFA 1X9WA 1HNVA 3LP0A 4CF2A 1DTTA 2G8HA 3ZT1A 4DF4A 1RILA 1TAQA 3SV4A 4H8KA 4IFVA 2HVHA 4IFYA 4NYFA 4UQGA 1HQEA 1SL0A 4LSNA 4F4KA 4PA1A 3DRRA 3C6UA 3AVJA 3AVFA 3DLEA 4CERA 4DSEA 3TABA 1EETA 3OYDA 3AO2A 1U04A 4FZXC 1RT5A 3HVTA 3QIPA 1HPZA 3DM2A 3KIOA 4E1NA 3KD1E 1Y97A 1NK4A 2BGGA 4FW2A 3NFAA 3ALYA 4CGGA 1GOBA 1HMVA 4CESA 4CGFA 3KJVA 4C8NA 1NKEA 1F21A 4CFBA 3EZ5A 4FLXA 3TWHA 4H4OA 4O55A 2ZD1A 3V1RA 1X9MA 1W9HA 3V9WA 3WNGA 1MU2A 2PY5A 1LWEA 1WSFA 1WSHA 4J2DA 3M8QA 1C1BA 4RW9A 4E19A 4DMNA 3CFOA 1UA1A 2IAJA 5KRSA 2AJQA 3QETA 1GOAA 3TR8A 1LAWA 1IKXA 4EP5A 4BDPA 3VQAA 3OYEA 4DSJA 3LWMA 4AHVA 3RMAA 5D3GA 2QKKA 1QTMA 3QESA 2OZSA 4HTUA 4KHWA 2KQ2A 4PQUA 4RG8A 3JSMA 2YHAA 1RBSA 2Q3SA 1NK5A 1T7PA 4K8XA 1S9EA 3KLGA 3AA2A 3CM5A 5JS2A 1J5OA 3DOKA 3PX4A 4FM2A 4PWDA 3SNNA 3MEGA 5KTQA 5HRPA 3NF9A 4OLBA 5J1EA 2OA8A 4ELTA 3SZ2A 1NK9A 3PY8A 4B9LA 4FJ8A 4C8OA 2XY7A 3BDPA 4CHPA 1KLMA 4C8MA 4N56A 3NGIA 4DTOA 4KHNA 3OYMA 3NF7A 1ASUA 4NCAA 3G10A 3S3MA 1ZYQA 1CZBA 3VN5A 1EKEA 4CF8A 3MXIA 1SKSA 3QERA 3VQ6A 3OVNA 4DS5A 1RTIA 1QSYA 4OKJA 2JLEA 4FJJA 2D5RA 3LZJA 4C8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMJ A;  4J2E A;  2KTQ A;  5CYM A;  3QNO A;  3TAE A;  2EHG A;  4DTS A;  4FLU A;  2DFE A;  3PX6 A;  4KHS A;  4CEF A;  4LH5 A;  3L2U A;  2OPQ A;  3NHG A;  1HNI A;  1S1T A;  3NH0 A;  4FJG A;  4O4G A;  4CFA A;  1VK0 A;  4CJS A;  1LAV A;  3SYZ A;  3TAP A;  1KLN A;  4I9Q A;  4N41 A;  2HB5 A;  4KTQ A;  3S9H A;  1LWF A;  4HCB A;  4IKF A;  4E0D A;  2FBT A;  5C42 A;  3IG1 A;  3DLH A;  3L3U A;  4IDK A;  3K5N A;  4CJT A;  4Z4I A;  3SQ2 A;  4FZZ A;  4KKO A;  1CXU A;  2XY5 A;  3KLF A;  3SCX A;  4NCG A;  4ID1 A;  1U48 A;  1R0A A;  1S1V A;  1C1C A;  4HUG A;  1B9F A;  3D45 A;  2FBV A;  4LSL A;  2ZE2 A;  5FRO A;  4FJX A;  1CXQ A;  1S5J A;  4DLG A;  1NKB A;  2OYQ A;  1RTD A;  3DLG A;  3HPO A;  3TAR A;  5SZT A;  4DSI A;  2NUB A;  4NCB A;  3CYM A;  1J53 A;  3V6D A;  4CHZ A;  1JLA A;  3DLK A;  1NOY A;  3T19 A;  4DU4 A;  1NK7 A;  2IDO A;  3ZT2 A;  4KRF A;  4DQP A;  3O3G A;  1KCF A;  1WSE A;  4CJW A;  2OPP A;  5HRR A;  4CJV A;  4HCC A;  3ISN C;  3TAQ A;  4AHC A;  1N6Q A;  4FJL A;  4DU3 A;  4AHR A;  4CFC A;  4M41 A;  4KRE A;  3G0Z A;  3IS9 A;  4KV8 A;  4F2S A;  4DFJ A;  3SUP A;  2EX3 A;  1N5Y A;  3PX0 A;  4FJM A;  4FJN A;  2HVI A;  1U4B A;  5KGW A;  4DTN A;  1RBT A;  1WAJ A;  4Y1C A;  3KK2 A;  2KZM A;  3OYG A;  3THV A;  3C6T A;  3AO4 A;  4E7K A;  4M42 A;  3V81 A;  3ZCM A;  4EZ6 A;  1VSD A;  1LV5 A;  1BIU A;  2LSN A;  1KVB A;  4FLY A;  4W5N A;  3OJU A;  4DU1 A;  1XC9 A;  2Y1J A;  3OJS A;  1TKD A;  2VG6 A;  4OVL A;  2OPS A;  1G15 A;  4AHU A;  1A5V A;  1HYV A;  4E7I A;  2XRI A;  1VSK A;  3HP6 A;  4DTM A;  1RBU A;  3LAM A;  1CZ9 A;  4M3U A;  2G8W A;  4W5T A;  2G8K A;  4AH9 A;  1BGX T;  2YNG A;  3FFI A;  3V4I A;  3L8B A;  4M3Z A;  2XO7 A;  1BL3 A;  5E41 A;  1UOC A;  2VG5 A;  2F8T A;  4LH4 A;  1KFD A;  3AVM A;  1XHZ A;  1WLJ A;  4CHY A;  1QE1 A;  2D0B A;  4CHQ A;  2D0A A;  5J2Q A;  4M3W A;  1HYS A;  1Z26 A;  5CZ2 A;  4CEQ A;  3H08 A;  3SPY A;  1B92 A;  4FK2 A;  4E89 A;  4KHQ A;  3AVL A;  3DLB A;  4B08 A;  1JL2 A;  3V1O A;  4HVJ A;  3K59 A;  1SL2 A;  3OYI A;  4K8Z A;  1FK9 A;  3UIQ A;  1S1U A;  3ZT4 A;  1BHL A;  4DFK A;  1QSS A;  3M8R A;  1EP4 A;  2B4J A;  5HRS A;  5HRN A;  3SV3 A;  4FJ9 A;  1IO2 A;  4EP4 A;  3LPU A;  1ZBL A;  2HNY A;  1NJZ A;  5J2M A;  3VQD A;  5DMR A;  4KHY A;  4FVM A;  2BAN A;  5FRN A;  2W42 A;  2IS3 A;  1JLQ A;  3V9U A;  4GVM A;  4FXD A;  3ZSX A;  1SKW A;  1S9G A;  3OYK A;  3M8S A;  1LWC A;  4ID5 A;  4B9V A;  3P83 D;  4CFD A;  3V9S A;  2WON A;  2G8U A;  4JRQ A;  3ZSR A;  1T03 A;  1ZBH A;  2I5J A;  1LW0 A;  2QKB A;  1X1P A;  3AVK A;  2ZQB A;  4CIG A;  1BQM A;  2HHX A;  2Z1J A;  3AV9 A;  4RW8 A;  1J9A A;  2YKN A;  3CG7 A;  5KGX A;  3AO1 A;  4Z4C A;  4DG1 A;  3NH2 A;  4JS5 A;  4DQS A;  3RMC A;  1JXB A;  4OPK A;  1L3T A;  1ZBU A;  1ASW A;  1BQN A;  1DLO A;  1VSF A;  3VQ4 A;  4CJ4 A;  4W5Q A;  3L2Q A;  4JS4 A;  2OZM A;  4EZ9 A;  4KPY A;  4CJE A;  3SI6 A;  4CEE A;  3K5O A;  3AVN A;  3B6P A;  3S3N A;  4MQ3 A;  4CE9 A;  4TSX A;  3DYA A;  3MAQ A;  1B9D A;  1FKO A;  3WNF A;  1RDB A;  4E1M A;  4CIF A;  3HO1 A;  4FZY A;  3QEV A;  1WN7 A;  4FJ5 A;  3LWL A;  4FK4 A;  4I7F A;  4BWJ A;  1VRU A;  2FBY A;  4FLZ A;  4FYD A;  2E6L A;  1TK5 A;  1J54 A;  3SQ0 A;  1JKH A;  1C6V A;  1RNH A;  4O5B A;  1TV6 A;  4KO0 A;  4DSL A;  3ZSW A;  1RT4 A;  3HM9 A;  1L3V A;  4QCL A;  3HPH A;  1WAF A;  3MED A;  4CJP A;  3VQB A;  1SV5 A;  4CK3 A;  4KAZ A;  3HJF A;  3RMB A;  1S6Q A;  3ITH A;  4O0J A;  3NH1 A;  1T05 A;  1TKT A;  1RT2 A;  4DTX A;  5J2N A;  1TAU A;  4FLW A;  1L3U A;  4YFU A;  1I39 A;  3ZSY A;  3V9X A;  3O4N A;  1IKY A;  2X78 A;  3VQQ A;  3OY9 A;  1SUQ A;  1VSI A;  1NJW A;  3RRG A;  3OYH A;  3LP2 A;  5KI6 A;  1BCM A;  4CHO A;  4KHU A;  4Z4F A;  4CJK A;  3NGZ A;  4M45 A;  3K5L A;  1L3S A;  2XY8 A;  2R7Y A;  1IG9 A;  4Z4E A;  1XWL A;  2HHU A;  1U47 A;  5SWM A;  4N5S A;  3K57 A;  2YKM A;  4BDZ A;  4CJQ A;  4DTU A;  3QIO A;  3U3Y A;  4C8K A;  2D0C A;  2KW4 A;  1HRH A;  3VQ5 A;  3ZSZ A;  4DWI A;  3V1Q A;  1EXQ A;  2P51 A;  3KKR A;  4OPJ A;  4F3T A;  4FW1 A;  2Z1I A;  1D5A A;  1S1W A;  3AVB A;  3LAN A;  4KTW A;  3U3G A;  4PY5 A;  4OGC A;  3NF6 A;  3LP1 A;  3K5M A;  2JGU A;  1BIZ A;  4HHT A;  4LD0 A;  1NOZ A;  4CEB A;  3C95 A;  4CCH A;  4E7H A;  2DY4 A;  3OS0 A;  1A5X A;  1Q9X A;  4GMJ B;  3S3O A;  1REV A;  1RDC A;  2HND A;  5T7B A;  3VQ7 A;  4F2R A;  3LP3 A;  4H4M A;  1KFS A;  3KD5 E;  3RWU A;  3HPG A;  3PV8 A;  3QEP A;  1C0M A;  2YHB A;  3L2W A;  3TAF A;  1TVR A;  1S1X A;  1YTA A;  4FK0 A;  1X9S A;  3T3F A;  1WSI A;  4E7L A;  1RBV A;  4JLH A;  4Q0B A;  4Z4H A;  4BAC A;  2VWK A;  1YVU A;  1XHX A;  3MXM A;  4N47 A;  1RT3 A;  5HLF A;  4RW6 A;  3DRS A;  3M8P A;  2IGI A;  4DQI A;  1KVC A;  3DOL A;  3IRX A;  1NK0 A;  1TK0 A;  2BDP A;  5I3U A;  3PO5 A;  3WNH A;  3DLR A;  3ZT3 A;  1IH7 A;  4QOZ B;  1TK8 A;  3JYT A;  2HHS A;  2FC0 A;  3HYF A;  2PYL A;  2A1S A;  4CJ3 A;  3SUQ A;  2PYJ A;  3HK2 A;  3K2P A;  2E4L A;  4FM1 A;  1C0U A;  3LAK A;  4DLE A;  1ZBF A;  1HYZ A;  1SL1 A;  3L3V A;  2HHW A;  2KZZ A;  4JRP A;  2ATQ A;  5C24 A;  4FJI A;  5J2P A;  5FDL A;  2PZS A;  4FM0 A;  4DTP A;  3NE6 A;  4KB0 A;  3L2V A;  3A2F A;  4M3X A;  3EYZ A;  3VQP A;  3OYC A;  4DSK A;  1BCO A;  3HXM A;  4ICL A;  3KLE A;  3I0R A;  1VSL A;  3VQ8 A;  2P1J A;  5JS1 A;  2RN2 A;  5FRM A;  4W5O A;  3K58 A;  2F8S A;  4N76 A;  3VA3 A;  1TL3 A;  2ETJ A;  2X6N A;  4CEC A;  1BI4 A;  3O4Q A;  1T8E A;  4B3O A;  3P1G A;  4CHN A;  3DRP A;  4M3R A;  4CEA A;  1U49 A;  3NDK A;  3PUF A;  3OYN A;  4FLV A;  4OLA A;  4I2Q A;  1XI1 A;  4IG0 A;  4KFB A;  5CZ1 A;  4KTZ A;  3EY1 A;  1Q8I A;  2A1R A;  2DFF A;  2ITG A;  1UAX A;  4Q5V A;  3OYA A;  1RTJ A;  1RTH A;  1VSE A;  3HP9 A;  4KB1 A;  4DFP A;  1ASV A;  3F73 A;  3CM6 A;  3OS1 A;  4FLT A;  5EU7 A;  3WNE A;  4CK1 A;  1JLG A;  3O3H A;  1VSM A;  3BGR A;  2O4G A;  1L5U A;  4RW4 A;  3C94 A;  4DTJ A;  2G8I A;  3U6F A;  4ELV A;  4E7J A;  4KI4 A;  1W0H A;  3F9K A;  5CY4 A;  3CFP A;  4KI6 A;  1RT6 A;  4ZHR A;  3KTQ A;  1S6P A;  1NK8 A;  3SUN A;  3AVH A;  1YT3 A;  3LAL A;  2GBZ A;  4Z0U A;  4CGI A;  3RMD A;  4OGE A;  1KSP A;  4B9M A;  4NYN A;  4CK2 A;  1RDD A;  2GUI A;  4GW6 A;  3VQE A;  4DSF A;  3SQ1 A;  3QIN A;  5C25 A;  1JLE A;  4DQQ A;  3PO4 A;  4LY7 A;  2GV9 A;  2YNF A;  4WE1 A;  3D0P A;  2HHT A;  1KRP A;  2G8V A;  1ZBI A;  3ZT0 A;  4BE1 A;  4M3Y A;  3NCI A;  1C1A A;  4W5R A;  2YNH A;  3VQ9 A;  2Z1G A;  4CGH A;  4HUF A;  1JXE A;  3TAN A;  3ASM A;  4MFB A;  3HL8 A;  3KK3 A;  2YV0 X;  3LPT A;  3B6O A;  1ITG A;  4BDY A;  3HST B;  3RR7 A;  3ZSO A;  1JL1 A;  1Z25 A;  4I2P A;  5K14 A;  2QXF A;  4CJR A;  4ELU A;  3CFR A;  3KK1 A;  3LDS A;  4Z4G A;  1JLB A;  4HUE A;  2P5O A;  3MEE A;  3CQ8 A;  4J2A A;  1EX4 A;  1SKR A;  4PUO A;  1CLQ A;  2OPR A;  2HHQ A;  5DK5 A;  3MXJ A;  4BE0 A;  4L8R B;  1QS4 A;  2E6M A;  3NBP A;  3NAE A;  1FKP A;  2F96 A;  1WSJ A;  3NGY A;  3ZSV A;  3IAY A;  2DTU A;  3QNN A;  3LZI A;  2HMI A;  4FJ7 A;  5HP1 A;  4AHT A;  4CF9 A;  1RT1 A;  4CJL A;  1C0T A;  1VRT A;  3NF8 A;  3T1A A;  3AVI A;  4YNQ A;  2BE2 A;  1IKV A;  4IG3 A;  3TAG A;  1TGO A;  1HQU A;  2X6S A;  2YNI A;  2HHV A;  4BWM A;  4DF8 A;  2Y1I A;  4XIU A;  3HVR A;  2IOC A;  2FBX A;  4CEO A;  4O44 A;  1O1W A;  3I0S A;  3OYB A;  1RT7 A;  4QAG A;  1NJX A;  3RRH A;  1QHT A;  4Y1D A;  3TI0 A;  3KKS A;  1GOC A;  2X74 A;  4J2B A;  2KFZ A;  4CIE A;  3I8D A;  1K6Y A;  3QEW A;  2QK9 A;  4CEZ A;  3SPZ A;  2RKI A;  4FJK A;  4DS4 A;  2O4I A;  3AO5 A;  5KRT A;  2XY6 A;  1WSG A;  3RTV A;  4ZTF A;  3AVG A;  3AO3 A;  4CJ5 A;  3VA0 A;  3MEC A;  4OJR A;  2HW3 A;  4E3S A;  4M3T A;  1NKC A;  2HNZ A;  1VSJ A;  2B5J A;  3AVA A;  4CED A;  3OS2 A;  1NJY A;  1LW2 A;  1D9D A;  2DFH A;  1TL1 A;  4CF1 A;  4CF0 A;  4F8R A;  1A5W A;  4DFM A;  1RCH A;  3TAM A;  1D8Y A;  2WOM A;  1RDA A;  4AHS A;  3QEI A;  2VWJ A;  3SQ4 A;  3AA3 A;  1I3A A;  1QQC A;  4DQR A;  3AA4 A;  3OYJ A;  1JLC A;  3AVC A;  4RW7 A;  1KTQ A;  4B8C A;  3O3F A;  4BE2 A;  3V9Z A;  1NK6 A;  4B9U A;  2P5G A;  3E01 A;  1VSH A;  1RBR A;  2RPI A;  4IBN A;  1BI4 B;  1TKZ A;  4G1Q A;  3ZSQ A;  3QO9 A;  2KFN A;  3P5J A;  1Q9Y A;  4B9N A;  5HBM A;  1HJR A;  1UWB A;  1DTQ A;  1BIS A;  4AIL C;  1TKX A;  3OYF A;  4B9T A;  5I42 A;  2RF2 A;  3SJJ A;  1FXX A;  2VG7 A;  1U45 A;  3OYL A;  3L2R A;  4CJU A;  4OKE A;  3VQC A;  1QSL A;  3RR8 A;  4FJH A;  4CGJ A;  5HRO A;  4ZTJ A;  3AA5 X;  4O0I A;  4B8A B;  3KLH A;  3HT3 A;  4FCY A;  4DTR A;  5CYQ A;  1UA0 A;  1D9F A;  1IKW A;  3DI6 A;  4OKK A;  4F3O A;  4CGD A;  1YTU A;  4R5P A;  3ULD A;  2Z1H A;  4I9L A;  3QEX A;  3SUO A;  3KLI A;  1JLF A;  2G8F A;  1WNS A;  2XHB A;  2B6A A;  3QLH A;  1KVA A;  4B9S A;  2IC3 A;  4CJF A;  1X9W A;  1HNV A;  3LP0 A;  4CF2 A;  1DTT A;  2G8H A;  3ZT1 A;  4DF4 A;  1RIL A;  1TAQ A;  3SV4 A;  4H8K A;  4IFV A;  2HVH A;  4IFY A;  4NYF A;  4UQG A;  1HQE A;  1SL0 A;  4LSN A;  4F4K A;  4PA1 A;  3DRR A;  3C6U A;  3AVJ A;  3AVF A;  3DLE A;  4CER A;  4DSE A;  3TAB A;  1EET A;  3OYD A;  3AO2 A;  1U04 A;  4FZX C;  1RT5 A;  3HVT A;  3QIP A;  1HPZ A;  3DM2 A;  3KIO A;  4E1N A;  3KD1 E;  1Y97 A;  1NK4 A;  2BGG A;  4FW2 A;  3NFA A;  3ALY A;  4CGG A;  1GOB A;  1HMV A;  4CES A;  4CGF A;  3KJV A;  4C8N A;  1NKE A;  1F21 A;  4CFB A;  3EZ5 A;  4FLX A;  3TWH A;  4H4O A;  4O55 A;  2ZD1 A;  3V1R A;  1X9M A;  1W9H A;  3V9W A;  3WNG A;  1MU2 A;  2PY5 A;  1LWE A;  1WSF A;  1WSH A;  4J2D A;  3M8Q A;  1C1B A;  4RW9 A;  4E19 A;  4DMN A;  3CFO A;  1UA1 A;  2IAJ A;  5KRS A;  2AJQ A;  3QET A;  1GOA A;  3TR8 A;  1LAW A;  1IKX A;  4EP5 A;  4BDP A;  3VQA A;  3OYE A;  4DSJ A;  3LWM A;  4AHV A;  3RMA A;  5D3G A;  2QKK A;  1QTM A;  3QES A;  2OZS A;  4HTU A;  4KHW A;  2KQ2 A;  4PQU A;  4RG8 A;  3JSM A;  2YHA A;  1RBS A;  2Q3S A;  1NK5 A;  1T7P A;  4K8X A;  1S9E A;  3KLG A;  3AA2 A;  3CM5 A;  5JS2 A;  1J5O A;  3DOK A;  3PX4 A;  4FM2 A;  4PWD A;  3SNN A;  3MEG A;  5KTQ A;  5HRP A;  3NF9 A;  4OLB A;  5J1E A;  2OA8 A;  4ELT A;  3SZ2 A;  1NK9 A;  3PY8 A;  4B9L A;  4FJ8 A;  4C8O A;  2XY7 A;  3BDP A;  4CHP A;  1KLM A;  4C8M A;  4N56 A;  3NGI A;  4DTO A;  4KHN A;  3OYM A;  3NF7 A;  1ASU A;  4NCA A;  3G10 A;  3S3M A;  1ZYQ A;  1CZB A;  3VN5 A;  1EKE A;  4CF8 A;  3MXI A;  1SKS A;  3QER A;  3VQ6 A;  3OVN A;  4DS5 A;  1RTI A;  1QSY A;  4OKJ A;  2JLE A;  4FJJ A;  2D5R A;  3LZJ A;  4C8L A; 
#chains in the Genus database with same CATH topology
 4J2E A;  4WCE L;  4CW7 B;  5CYM A;  3DXM A;  2P9L A;  2ASP A;  4LH5 A;  3L2U A;  3D6R A;  4PL8 A;  1J5E K;  3NH0 A;  1VK0 A;  1LCU A;  3WT0 A;  3SYZ A;  1OVQ A;  4I9Q A;  1LWF A;  3KWG A;  3A5M C;  4E0D A;  3CC4 N;  4Z4I A;  3UE5 A;  2AP1 A;  4XH1 A;  2XY5 A;  1Q18 A;  1U48 A;  4HUG A;  1C1C A;  3I55 N;  3D45 A;  1YXQ A;  2NRZ A;  2BTF A;  4DSI A;  3CER A;  1XMO K;  1IBM K;  4IJN A;  4CJV A;  5HRR A;  1N6Q A;  4FJL A;  3QIC A;  3G0Z A;  3IS9 A;  4AM7 A;  4DFJ A;  2FXU A;  1N5Y A;  2ZJQ L;  3CJB A;  3A5O C;  2HVI A;  5KGW A;  1WAJ A;  3E9O A;  3CD6 N;  4E7K A;  2WC9 A;  4CZM A;  2E2P A;  1LV5 A;  2LSN A;  1KVB A;  4DU1 A;  4OVL A;  1A5V A;  1JCF A;  4E7I A;  4ISF A;  5AQY A;  3HP6 A;  4DTM A;  4BRA A;  4W5T A;  2G8K A;  2G8W A;  3V4I A;  3FFI A;  4BGA A;  4BRK A;  4CZF A;  1BL3 A;  2VG5 A;  4DV0 K;  1XHZ A;  1VQM N;  1WLJ A;  4LFC K;  1MDU B;  4M3W A;  4CEQ A;  3SAH A;  4DV5 K;  5AZI B;  4WF9 L;  3DLB A;  3QFP A;  3SAF A;  3OYI A;  2FSN A;  1S1U A;  3WEE A;  3ZT4 A;  1QSS A;  2Q36 A;  3M8R A;  4FJ9 A;  2B4J A;  4CZG A;  3VEO A;  5GIO A;  3CQY A;  1NGF A;  3T7Z A;  1ZBL A;  1NJZ A;  3EE8 A;  1XC3 A;  3J8A A;  5M1O A;  3VQD A;  2W42 A;  3ENB A;  4FPA A;  4EIA A;  3ZSX A;  1SKW A;  3OYK A;  1VQN N;  3P83 D;  4NB4 A;  2WON A;  1T03 A;  4H5W A;  3THX A;  3AV9 A;  2YKN A;  3CG7 A;  4JS5 A;  3RMC A;  3SJH A;  4DQS A;  4OPK A;  1BQN A;  1VSF A;  1I94 K;  1BG3 A;  3VQ4 A;  4CJ4 A;  2D4W A;  3L2Q A;  4KPY A;  3OTO K;  4CJE A;  1Q81 O;  4PKH A;  2JWL A;  4CEE A;  3K5O A;  4PKG A;  3CCM N;  3VEN A;  4MQ3 A;  3RSE B;  1FKO A;  4X64 K;  5AZJ B;  1N33 K;  4Y0W A;  1ZBS A;  5FPD A;  1WN7 A;  2O8C A;  4I7F A;  4BGB A;  4BWJ A;  2FBY A;  3NMU A;  2HBM A;  1J54 A;  2HHH K;  4JI7 K;  2NRR A;  4QS9 A;  4BRQ A;  1TV6 A;  4WQ5 A;  4QCL A;  1IJJ A;  2FLO A;  1WAF A;  4KAZ A;  1SV5 A;  4H0Y B;  2Q0U A;  4YY3 K;  5J2N A;  1L3U A;  3QFU A;  3ZSY A;  3V9X A;  2HMP A;  3O4N A;  2X78 A;  1KAY A;  3CIP A;  3VQQ A;  3OY9 A;  1VSI A;  4DV3 K;  1NJW A;  3LP2 A;  3A5L C;  1L3S A;  4M45 A;  2WUS A;  2HHU A;  4DTU A;  2KW4 A;  5AQT A;  1E4G T;  4F3T A;  1D5A A;  3AVB A;  3D7E O;  4PY5 A;  4FO0 A;  3H1V X;  4KBO A;  4JYA K;  3LP1 A;  3I33 A;  2JGU A;  3HTV A;  3DXK A;  2YHW A;  4GV9 A;  1RDC A;  1X9J A;  2V51 B;  4LFB K;  5EOY A;  4F2R A;  1GLB G;  4JK8 A;  2KLA A;  3HPG A;  3PV8 A;  3HSC A;  2YHB A;  5EXW A;  1YTA A;  4FK0 A;  4Q0B A;  1RBV A;  4Z4H A;  4V19 S;  3J7A P;  4N47 A;  4DR3 K;  5HLF A;  5TKY A;  2OTL N;  1QZ6 A;  2A40 A;  2QWQ A;  4M7X A;  2A6A A;  1IH7 A;  2HHS A;  2ZJP L;  3LAK A;  3EKU A;  5LMU K;  1SL1 A;  2IVO A;  1OVY A;  4HWI A;  4JRP A;  5C24 A;  3PIO L;  3B8A X;  4FM0 A;  3NE6 A;  2CGK A;  3EYZ A;  3OYC A;  2HOE A;  3AGK A;  2P1J A;  4CI6 A;  1ZXO A;  4W5O A;  3CC2 N;  3L4I A;  4CEC A;  5LMN K;  3P1G A;  4CHN A;  4IKF A;  4I2Q A;  5CZ1 A;  1GLJ O;  3EY1 A;  1SAZ A;  1SS6 A;  1RTJ A;  4DFP A;  5BPM A;  3P38 A;  3CM6 A;  5I9E B;  4KH4 A;  1K8K A;  4CK1 A;  3O3H A;  4RW4 A;  3THY A;  4E7J A;  3FZK A;  4KI6 A;  3MWP A;  2CH6 A;  1S6P A;  4NXN K;  5JLH A;  3AVH A;  3LAL A;  4Z0U A;  3WXI A;  4IEE A;  4CK2 A;  1RDD A;  3VQE A;  5C25 A;  3A8Y A;  4CZK A;  4DR4 K;  5BPL A;  4B3S K;  4MLE A;  4BRG A;  1KRP A;  4IDH A;  5C12 A;  4BRE A;  2ZJR L;  1QQO A;  2ITM A;  4JD2 B;  2OAN A;  3ASM A;  4MFB A;  5TKW A;  3B6O A;  2P9S A;  4B1Y B;  3K9J A;  3RR7 A;  1Z25 A;  4I2P A;  5AQK A;  4IO9 L;  3CFR A;  3KK1 A;  4Z4G A;  2P5O A;  3MEE A;  2VQF K;  2OPR A;  1QS4 A;  2E6M A;  1FKP A;  2F96 A;  3H1Q A;  3QNN A;  4DR1 K;  5HP1 A;  1RT1 A;  3T1A A;  1IKV A;  1TGO A;  2X6S A;  2YNI A;  4CZI A;  4DF8 A;  5F0X A;  3T1H K;  1W2B M;  1V4S A;  1Z6R A;  3QBX A;  3I0S A;  1RT7 A;  4QAG A;  5KPT A;  4YOW A;  4Y1D A;  2KFZ A;  2E20 A;  3I8D A;  3QEW A;  1HKG A;  4CEZ A;  3SPZ A;  4DS4 A;  2O4I A;  3AO5 A;  3MX5 A;  5BN8 A;  4CBU A;  3R6M A;  4E3S A;  1NKC A;  1VSJ A;  2B5J A;  3OS2 A;  4CED A;  1RCH A;  2WOM A;  5AQS A;  4AHS A;  3QEI A;  3CME N;  3TSQ A;  3AA4 A;  3AVC A;  3V9Z A;  4B9U A;  1T6D A;  1VSH A;  4G1Q A;  3ZSQ A;  3PLA A;  3P31 A;  1UWB A;  1E3M A;  3TU5 A;  1TKX A;  5KQD A;  4BRF A;  1V4T A;  5BN9 A;  5EY4 A;  1U45 A;  4JK9 A;  3L2R A;  3VQC A;  4CGJ A;  4IFE A;  3C65 A;  4FCY A;  3HRG A;  3C7N A;  5CYQ A;  4OKK A;  1GLA G;  4YDU A;  4CGD A;  4R5P A;  4I9L A;  4H5T A;  3QEX A;  2UXB K;  1WNS A;  3HBT A;  1KVA A;  1X9W A;  2F9T A;  4ILJ A;  1DTT A;  4DF4 A;  1RIL A;  5AQZ A;  4IFV A;  5HL7 L;  4A57 A;  1SL0 A;  4F4K A;  1N32 K;  2YHX A;  4JV5 K;  1GLE G;  4CER A;  4AF1 A;  1BO5 O;  4DSE A;  1EET A;  4FZX C;  1NG9 A;  1HPZ A;  4GV3 A;  3KD1 E;  2BUP A;  1VQ9 N;  1GOB A;  3KJV A;  1NGB A;  5GIN A;  2GTD A;  1VQ5 N;  3ZLJ A;  2PY5 A;  1LWE A;  1ILY A;  4FWS A;  1VQP N;  5AFU A;  2IAJ A;  5BRH A;  1N8R O;  4BRP A;  4PQU A;  2OZS A;  5DM7 L;  2WBN A;  3HI0 A;  4FWQ A;  4RG8 A;  3JSM A;  2Q3S A;  4K8X A;  3TSP A;  1S9E A;  4CZH A;  3LM9 A;  3DOK A;  4DV2 K;  3PX4 A;  4PWD A;  2P9K A;  5HRP A;  3NF9 A;  2V7Y A;  1KQS M;  4O8K A;  4B9L A;  4JI2 K;  4C8M A;  4NCA A;  4BRC A;  3VN5 A;  4DS5 A;  3UKR B;  3U9Z A;  3OA9 A;  4FJJ A;  3LZJ A;  2P9K B;  1VQ6 N;  1TYQ B;  3DMJ A;  1NMN A;  2KTQ A;  4WQ5 C;  3TAE A;  4DTS A;  4DCH A;  1NGE A;  4FJG A;  1IV0 A;  2ASM A;  1KLN A;  4WFB L;  2UXC K;  1NMD A;  2HB5 A;  4JKC A;  5AJ3 K;  4KTQ A;  2VWB A;  3BUZ B;  4AQY K;  4NLB A;  4WYB A;  5C42 A;  4A61 A;  3K5N A;  4CJT A;  4FZZ A;  4KKO A;  3ULE B;  1KXP A;  1R0A A;  4L3Q A;  2FBV A;  2ZE2 A;  5FRO A;  1CXQ A;  2OYQ A;  3DLG A;  5FPN A;  3HPO A;  3R8E A;  1BWF O;  4EAH D;  1NGC A;  1JLA A;  4KRF A;  1WSE A;  4FPB A;  4CJW A;  3UKR A;  1ZC6 A;  3ISN C;  3TAQ A;  1N34 K;  3VGK A;  4AHR A;  4KRE A;  4M41 A;  4CZL A;  3EZW A;  4JNE A;  2EX3 A;  4FJM A;  4JI8 K;  2VGM A;  3SLC A;  4Y1C A;  3THV A;  3ATV A;  3LM2 A;  3Q7C A;  3KZB A;  1VSD A;  3MN9 A;  4W5N A;  3O8M A;  2Y1J A;  2OPS A;  1HYV A;  1VSK A;  1HR0 K;  5C10 A;  1CZ9 A;  2GWK A;  5AQU A;  2HF4 A;  2YNG A;  2E88 A;  3L8B A;  2Q31 A;  4LH4 A;  3MN7 A;  4JKA A;  3QB0 A;  2UUB K;  3CF5 L;  3J81 O;  2FSJ A;  4FK2 A;  4E89 A;  3V1O A;  3QDK A;  3WUH A;  1BHL A;  3ZET B;  5AFU H;  3LPU A;  2HNY A;  4CZE A;  3E9P A;  3W3D A;  2IS3 A;  2O8E B;  3VES A;  4FXD A;  4B9V A;  3WXM B;  3M8S A;  1Y64 A;  3V9S A;  2G8U A;  3ZSR A;  1LW0 A;  2D0O A;  3AVK A;  2HHX A;  5AQR A;  4OO1 J;  1ZBU A;  2OZM A;  5CR4 A;  3SAG A;  3Q7B A;  3F9M A;  1OH7 A;  1BA0 A;  3SI6 A;  3AVN A;  1WBD A;  4JKG A;  4CE9 A;  4TSX A;  3DYA A;  3MAQ A;  1B9D A;  2RE2 A;  3FZL A;  1X3N A;  4FJ5 A;  3O9T A;  3LWL A;  4FK4 A;  4FYD A;  5LL6 Z;  1RNH A;  3HPH A;  3HJF A;  4C1N K;  1T05 A;  2HBK A;  1YIJ N;  4JK7 A;  1TAU A;  2NNW A;  4C23 A;  1I39 A;  1HX1 A;  4FOE A;  4DR7 K;  3WXK A;  5AQM A;  1C0G A;  3RRG A;  3OYH A;  5A2Q O;  5KI6 A;  1BCM A;  4CHO A;  4KHU A;  1ATR A;  1YJN N;  2ZGY A;  4IZ9 A;  4MDA A;  1IG9 A;  4Z4E A;  1U47 A;  3K57 A;  2YKM A;  4C8K A;  3VQ5 A;  4RWT A;  3V1Q A;  1EXQ A;  4OPJ A;  1GLD G;  3KKR A;  4CBW A;  2A3Z A;  1BIZ A;  4B9Q A;  4CEB A;  4CCH A;  1XUP O;  3O9U A;  2EWS A;  2PFU A;  2A5X A;  1A5X A;  3GL1 A;  1Q9X A;  4GMJ B;  2IIR A;  4XH5 A;  4H4M A;  3KD5 E;  3RWU A;  1HNZ K;  2P9I A;  4BY9 C;  4JI6 K;  4LF5 K;  3LDQ A;  1X9S A;  4E7L A;  2CGL A;  1BA1 A;  3H45 C;  4GY2 B;  3DRS A;  3CCV N;  5C2D A;  3I56 N;  2QWM A;  4DR2 K;  3DOL A;  2W6L A;  4H0P A;  3IRX A;  1TK0 A;  2BDP A;  4MO5 A;  5I3U A;  4QS8 A;  3ZT3 A;  3ZET A;  4I6M B;  2YI1 A;  2NRH A;  2A1S A;  3CCQ N;  2PYJ A;  3K2P A;  3LDP A;  4FM1 A;  1NGI A;  3AAR A;  2ATQ A;  1RGI A;  2PZS A;  4EHU A;  4M3X A;  3O1B A;  1BCO A;  3G25 A;  4Z94 A;  4YOU A;  3I0R A;  2QI2 A;  3SK3 A;  1FJG K;  4DUZ K;  1Z05 A;  1NWK A;  2RN2 A;  2F8S A;  1WOQ A;  3FZM A;  1BUP A;  2X6N A;  4H5N A;  4A62 A;  1YIT N;  3FZH A;  4OLA A;  4JEP A;  4BVP A;  1NGH A;  4CZJ A;  4IG0 A;  3CCR N;  4KTZ A;  4LF4 K;  4YOT A;  3A0I X;  3VTH A;  2PBD A;  1RTH A;  3HP9 A;  1VSE A;  4K42 A;  4FWN A;  3OS1 A;  1BDG A;  3E9L A;  1JLG A;  3TSU A;  3C94 A;  3LDO A;  3U6F A;  3O1W A;  4ELV A;  5CY4 A;  3JS6 A;  3KTQ A;  1NBW A;  4CGI A;  3RMD A;  4B9M A;  1QHA A;  4GW6 A;  3P39 A;  1QZ5 A;  3FR0 A;  4LY7 A;  2GV9 A;  1W97 L;  4E1J A;  2G8V A;  4DV7 K;  4BE1 A;  4GKK K;  1DEJ A;  3NCI A;  1VQO N;  2YNH A;  3MWT A;  4CGH A;  4HUF A;  2YV0 X;  3LPT A;  4WFA L;  1IBK K;  1ITG A;  2BH1 A;  3HST B;  3GDQ A;  5K14 A;  4BR0 A;  4BRM A;  3VMF B;  4DKW A;  1YI2 N;  4FL9 A;  3CJC A;  3N4Q A;  3CQ8 A;  3NBP A;  3VPZ A;  1HNW K;  3LDN A;  2DTU A;  5GAH P;  3ZSV A;  2ZF5 O;  4AHT A;  4CF9 A;  5JVH L;  4CJL A;  3NF8 A;  5BR8 K;  4ILG B;  3TAG A;  4A2A A;  4BWM A;  2Y1I A;  4KH5 A;  2FBX A;  4BC5 A;  4O8U A;  4A5B A;  1NJX A;  1S3X A;  4IEI A;  3KKS A;  1GOC A;  4DQ8 A;  4CIE A;  5GAE P;  2RKI A;  4LC9 B;  5IWA K;  3HOS A;  4B1Z A;  1WSG A;  3RTV A;  3DWL A;  4PKI A;  4HTL A;  4M3T A;  2HNZ A;  3AVA A;  1LW2 A;  2DFH A;  4CF1 A;  4CF0 A;  4F8R A;  4DFM A;  3TAM A;  1I3A A;  1QQC A;  4B8C A;  4RW7 A;  3O3F A;  1NK6 A;  2O8E A;  4BG8 A;  4K43 A;  1TKZ A;  3QO9 A;  2KFN A;  2VYP A;  1Q9Y A;  4B9N A;  4GV6 A;  4AIL C;  1DTQ A;  5C2F A;  3OYF A;  5I42 A;  4X65 K;  4IOX A;  1FXX A;  3C6A A;  4BRL A;  4YOY A;  3ULE A;  3D2E B;  4IOC L;  1UA0 A;  4O0I A;  4B8A B;  2Z1H A;  5M1Q A;  2G8F A;  2B6A A;  3QLH A;  1NGD A;  1XNR K;  3LP0 A;  2QEX N;  2QWO A;  3ZT1 A;  1TAQ A;  4CD1 A;  3SV4 A;  2HVH A;  3CJA A;  4NYF A;  3VER A;  3AVJ A;  1HPM A;  1P8Z A;  5M1F A;  3TAB A;  3OYD A;  1RT5 A;  4I6M A;  4KH6 A;  4C8N A;  1F21 A;  3C7N B;  4ISE A;  3O5B A;  2O8B A;  2PAV A;  4O55 A;  1X9M A;  2RHK A;  4K0K K;  1MU2 A;  5C0Y A;  1WSF A;  3M8Q A;  1C1B A;  4BC4 A;  1UA1 A;  1GOA A;  4JI1 K;  4MO4 A;  3TR8 A;  1JJ2 M;  4EP5 A;  1QVG M;  2NLX A;  3WQT A;  3VF4 A;  1WBB A;  4BDP A;  4LFA K;  5D3G A;  2D1K A;  1QTM A;  2Q97 A;  5FPE A;  4KHW A;  2KQ2 A;  2YHA A;  1J5O A;  4BC2 A;  3BP8 A;  3ENH A;  4FM2 A;  4UY8 O;  3MEG A;  5KTQ A;  3UB5 A;  1D4X A;  2OA8 A;  5CE3 A;  3IMX A;  3BDP A;  1KLM A;  3O9Q A;  3NF7 A;  3G10 A;  3MCA B;  3QER A;  3OVN A;  1QSY A;  4OKJ A;  2JLE A;  4BR7 A;  2QWN A;  4JAX A;  3QNO A;  3CHW A;  4FLU A;  4PL7 A;  3PX6 A;  1VAZ A;  4KHS A;  4CEF A;  3VF6 A;  2OPQ A;  1HNI A;  3CI5 A;  4O4G A;  3QBW A;  1LAV A;  4K25 A;  4N41 A;  3BEX A;  3S9H A;  2D0P A;  3IG1 A;  3DLH A;  4IDK A;  2O8F A;  4JN4 A;  1CXU A;  1YJW N;  3SCX A;  4YOX A;  1S1V A;  4LSL A;  4FJX A;  4DLG A;  1NKB A;  1RTD A;  3TAR A;  3C6H A;  1TYQ A;  5SZT A;  2P9L B;  4ISG A;  2NUB A;  4M63 C;  3C0B A;  4G9Z A;  2O8B B;  3V6D A;  4CHZ A;  1NOY A;  3T19 A;  4DU4 A;  4H5V A;  2IDO A;  5JVG L;  3ZT2 A;  1NK7 A;  3CCL N;  2QXL A;  1KCF A;  3O3G A;  4HCC A;  4AHC A;  4CFC A;  1YAG A;  3AAP A;  4KV8 A;  1YF5 L;  5BRE A;  3A5N C;  2KZM A;  3OYG A;  3C6T A;  3AO4 A;  4M42 A;  1NGG A;  3V81 A;  1RFQ A;  4JKF A;  4EZ6 A;  4YHH K;  2NRV A;  1YVN A;  4FLY A;  3OJU A;  1XC9 A;  3OJS A;  1TKD A;  2VG6 A;  4AHU A;  1JCE A;  3LAM A;  4AH9 A;  1MWK A;  1BGX T;  4M3Z A;  3CCE N;  2XO7 A;  1NJI O;  5E41 A;  3GOI A;  1KFD A;  2JWK A;  3R1X A;  1QE1 A;  1P90 A;  4PHT X;  1YUW A;  5MLC Q;  3CQX A;  1HYS A;  1Z26 A;  5CZ2 A;  3H08 A;  3SPY A;  1B92 A;  1TUY A;  3H3O B;  3L4Q A;  4KHQ A;  4B08 A;  1JL2 A;  4HVJ A;  3K59 A;  4EHT A;  3UIQ A;  1EP4 A;  1MA9 B;  5HRN A;  1IO2 A;  1IBL K;  5FRN A;  4FVM A;  1JLQ A;  1S9G A;  1HLU A;  4ID5 A;  3S41 A;  1H1V A;  3VEY A;  1DKG D;  3M1F A;  1ZBH A;  2I5J A;  4H0T B;  2QKB A;  1X1P A;  2ZQB A;  1BQM A;  5KGX A;  3AO1 A;  5E26 A;  4DG1 A;  4Z4C A;  1L3T A;  1JXB A;  4JS4 A;  4W5Q A;  4N76 A;  4EZ9 A;  4NXM K;  1K73 O;  1U6Z A;  3S3N A;  5KPR A;  2VCP A;  2I7P A;  4E1M A;  4CIF A;  3J80 O;  4FZY A;  3QEV A;  3IUC A;  3U9D A;  4CVN E;  1C6V A;  3ID8 A;  4O5B A;  4CJ7 A;  1MWM A;  2QWR A;  1RT4 A;  3HM9 A;  1L3V A;  1OH8 A;  3MED A;  4CJP A;  3VQB A;  1Q86 O;  2QWP A;  5AZJ A;  3ITH A;  4O0J A;  4BQZ A;  3NH1 A;  1RT2 A;  4DV4 K;  3BF1 A;  4YFU A;  4J8F A;  1HUX A;  3N4P A;  2V52 B;  2NRX A;  1SUQ A;  4Z4F A;  3OW2 M;  5AQG A;  3K5L A;  2XY8 A;  2R7Y A;  2YJE A;  4N5S A;  3CCU N;  4BDZ A;  3PSI A;  3QIO A;  2D0C A;  4FW1 A;  2Z1I A;  3U3G A;  4OGC A;  5AQI A;  1CZA N;  3K5M A;  2O8C B;  4H0O A;  3T1Y K;  4E7H A;  3OS0 A;  3THW A;  3KWI A;  2HND A;  3ZX3 A;  5T7B A;  3VQ7 A;  3LP3 A;  3SBG A;  4K41 A;  4DV6 K;  3QEP A;  3L2W A;  5AR0 A;  4JI3 K;  3T3F A;  1WSI A;  3CMA N;  2VWK A;  3DXK B;  4BRH A;  1M1K O;  3DAW A;  4LF7 K;  5M1P A;  4RW6 A;  2A41 A;  3M8P A;  2IGI A;  4DQI A;  3BF3 A;  1NK0 A;  4B3R K;  3KVG A;  3DLR A;  4BRN A;  1Q82 O;  2W6K A;  4QOZ B;  3KK7 A;  2FC0 A;  3HYF A;  5BR9 A;  3OHR A;  4CJ3 A;  4OX9 K;  2E4L A;  1Q7Y O;  1C0U A;  3NVK A;  5AZI A;  3R9P A;  1ZBF A;  1HYZ A;  3L3V A;  5AQX A;  5FDL A;  4BG9 A;  2WTU A;  4KB0 A;  4DSK A;  3GG4 A;  3HXM A;  4ICL A;  3KLE A;  5GAG P;  1VSL A;  3VQ8 A;  2QTD A;  5FRM A;  2ETJ A;  1VQL N;  4H0V B;  1BI4 A;  5FLX O;  2P9I B;  4B3O A;  3DRP A;  3F5T A;  3PUF A;  1U2V B;  1BOT O;  1VQ8 N;  2DFF A;  1UAX A;  2A42 A;  5H1S Q;  4Q5V A;  4KB1 A;  4FSV A;  4BR9 A;  4FLT A;  1L5U A;  1VSM A;  2HST A;  2O4G A;  5CHI A;  4DB3 A;  4JD2 A;  5FPM A;  4A59 A;  4KI4 A;  2F9W A;  4X62 K;  3CFP A;  5F1X A;  1NK8 A;  3SUN A;  3DJC A;  1YT3 A;  1QQM A;  3J7Y P;  1KSP A;  3SQ1 A;  5EVZ A;  4DSF A;  3CJ7 A;  1JLE A;  4DQQ A;  1SQK A;  3PO4 A;  4WE1 A;  1ZBI A;  4M3Y A;  4GNI A;  1C1A A;  3VQ9 A;  2Z1G A;  4BVO A;  3TAN A;  1JXE A;  3AY9 A;  2E2N A;  2Q0R A;  4BDY A;  2VQE K;  3ZSO A;  3ZX0 A;  4CJR A;  1C0F A;  4DR5 K;  1JLB A;  4HUE A;  2YJF A;  3VEZ A;  1SKR A;  4PUO A;  1QVF M;  3MXJ A;  4L8R B;  1K9M O;  2ASO A;  5AQJ A;  3F2K A;  1C0T A;  1VRT A;  3AVI A;  2VGN A;  4IG3 A;  2HHV A;  3DXM B;  4XIU A;  4JKG B;  3J7Z O;  2IOC A;  4CEO A;  3G4S N;  2FSK A;  1O1W A;  3OYB A;  1QHT A;  3VET A;  4J2B A;  3ZYY X;  4FJK A;  3DLL L;  1S22 A;  5F2R A;  2XY6 A;  4ZTF A;  3AVG A;  5AQP A;  5M1K A;  4JKE A;  4CJ5 A;  3VA0 A;  5B8H A;  3MEC A;  2HW3 A;  5AQH A;  1JCG A;  2HF3 A;  3D2F A;  1NJY A;  3WXJ A;  3VGM A;  3THX B;  1A5W A;  3NVM A;  2YHY A;  3AGR A;  1RDA A;  2VWJ A;  3AA3 A;  1NGA A;  3OYJ A;  2P5G A;  3UKU B;  1VQK N;  3O6W A;  4JI5 K;  1RBR A;  2RPI A;  3I8B A;  1KAZ A;  1U2V A;  1HJR A;  3M3Z A;  2RF2 A;  2VG7 A;  3OYL A;  4CJU A;  5HRO A;  3AA5 X;  3HT3 A;  4DTR A;  1D9F A;  4JI4 K;  1EWR A;  3ULD A;  3SUO A;  1JLF A;  4B9S A;  2IC3 A;  1HNV A;  2G8H A;  4OPA A;  3O4W A;  4H8K A;  4FWK A;  4IFY A;  4UQG A;  2V7Z A;  4BRI A;  4IOA L;  4U67 L;  4PA1 A;  3DLE A;  3AVF A;  3O80 A;  3ZEU B;  3AO2 A;  1U04 A;  3KIO A;  3EN9 A;  4DV1 K;  4E1N A;  4A5A A;  2BGG A;  4FW2 A;  3JXU A;  4CGG A;  5E84 A;  4CGF A;  1S72 N;  4CFB A;  3EZ5 A;  4H4O A;  3V1R A;  1NGJ A;  1W9H A;  3V9W A;  1W7A A;  1WSH A;  4J2D A;  4E19 A;  4DMN A;  4WFN L;  3QET A;  1IKX A;  3LWM A;  4AHV A;  3RMA A;  4DUY K;  2QKK A;  4MDB A;  1RBS A;  3KLG A;  3AA2 A;  3CM5 A;  3PSF A;  3JAM O;  4GKJ K;  2GX9 A;  3SZ2 A;  3TTD A;  1NK9 A;  5AQQ A;  4FJ8 A;  4C8O A;  2XY7 A;  3D2F B;  3FGU A;  4N56 A;  3NGI A;  4DTO A;  4CBX A;  1ASU A;  3MXI A;  3VQ6 A;  1KC8 O;  3FZF A;  4BQL A;  2D5R A;  1G99 A;  1E4F T;  4C8L A;  5IT9 O;  4B3M K;  2E8A A;  2EHG A;  2DFE A;  3THY B;  3AAQ A;  3NHG A;  4U7B A;  1S1T A;  3VEX A;  5BRF A;  4RTF D;  4CFA A;  4CJS A;  1GLC G;  5C15 A;  2W41 A;  4FWP A;  3TAP A;  2DPN A;  4BRO A;  2CGJ A;  4HCB A;  1J6Z A;  1T3V A;  3EKS A;  2FBT A;  3RVC A;  3L3U A;  4WQ4 C;  3SQ2 A;  4YOV A;  3KLF A;  2Q1N A;  4NCG A;  4ID1 A;  1NNE A;  1B9F A;  3CXC M;  1S5J A;  5AQN A;  4NCB A;  3CYM A;  1J53 A;  4H0X B;  3TTF A;  2QM1 A;  3DLK A;  4DQP A;  2OPP A;  4DU3 A;  4IXC A;  4F2S A;  1N36 K;  3SUP A;  1WB9 A;  5M1N A;  3PX0 A;  1RDU A;  4FJN A;  3ZX2 A;  1U4B A;  4DTN A;  3SMS A;  1RBT A;  3KK2 A;  3BZK A;  3ZCM A;  2ZGZ A;  1BIU A;  3CPW M;  1IG8 A;  3TTC A;  4F9O A;  4LF6 K;  1G15 A;  2XRI A;  3FFK B;  3U8X A;  3CC7 N;  4M3U A;  1RBU A;  3VF2 A;  2GWJ A;  3WEE B;  1SZ2 A;  2QW9 A;  4YOR A;  3EL2 A;  4M7Y A;  1UOC A;  2F8T A;  1XMQ K;  3AVM A;  3WXL A;  3WQU A;  3MCP A;  3R3L A;  4CHY A;  2D0B A;  2QA4 N;  4CHQ A;  2D0A A;  5J2Q A;  1OH6 A;  5AQW A;  2NRT A;  2KHO A;  3AVL A;  4MLH A;  1SL2 A;  4K8Z A;  1FK9 A;  4DFK A;  5HRS A;  3EE9 A;  3SV3 A;  1NLV A;  4EP4 A;  1O13 A;  4B1U B;  3QML A;  3CPE A;  3G71 N;  2W40 A;  5J2M A;  5DMR A;  2Q2R A;  4KHY A;  2BAN A;  1KAX A;  3VGL A;  1VQ7 N;  3V9U A;  4GVM A;  3ZEU A;  1LWC A;  1ATN A;  1K8A O;  4CFD A;  4JRQ A;  4EFH A;  2GUP A;  2UXD K;  3CJ1 A;  4CIG A;  3OBY A;  2Z1J A;  4RW8 A;  1J9A A;  2QWL A;  3NH2 A;  3O9S A;  1ASW A;  4JHD A;  3LL3 A;  5ELZ A;  1DLO A;  3K0S A;  3VOV A;  4JKB A;  1EWQ A;  3B6P A;  2O8F B;  3WNF A;  1RDB A;  2P9P B;  3K9K A;  3HO1 A;  2E1Y A;  2KKZ A;  3E1Y A;  3THW B;  2FF6 A;  4FLZ A;  1VRU A;  4ILH A;  1VQ4 N;  2E6L A;  1TK5 A;  3SQ0 A;  1JKH A;  4IWV A;  4KO0 A;  1M90 O;  3ZSW A;  4DSL A;  3UKU A;  3RSE A;  4CK3 A;  3RMB A;  2IVN A;  1S6Q A;  1TKT A;  3MN5 A;  2P9S B;  4DTX A;  4FLW A;  4C1N I;  4H5R A;  5KPZ A;  4FVU A;  1IKY A;  4JI0 K;  1YHQ N;  2IVP A;  2NZT A;  5EX5 A;  1LOT B;  5GIP A;  3U4L A;  4B1X B;  3CJ9 A;  2E2Q A;  4CJK A;  2GEL A;  3NGZ A;  4A2B A;  1HKB A;  2O8D A;  1XWL A;  5SWM A;  4CJQ A;  3T69 A;  3U3Y A;  1HRH A;  3ZSZ A;  4DWI A;  2P51 A;  4KTW A;  1S1W A;  3LAN A;  2UUC K;  1K8K B;  2P9U A;  3GE1 A;  3HM8 A;  3NF6 A;  4QS7 A;  3MX2 A;  4HHT A;  2GEM A;  1NOZ A;  3MMV A;  3C95 A;  4LD0 A;  2ZM6 K;  2DY4 A;  5JLF A;  3S3O A;  1REV A;  5AQL A;  1KFS A;  4FWO A;  1C0M A;  2J4R A;  5HOO A;  3MK6 A;  1TVR A;  1S1X A;  3TAF A;  4JLH A;  4BAC A;  4H03 B;  4AM6 A;  2WFB A;  1R59 O;  2ZWH A;  1YVU A;  3CCS N;  1VHX A;  1XHX A;  3MXM A;  5ADX A;  1RT3 A;  4B1W B;  4BR5 A;  3GBT A;  1KVC A;  4X66 K;  2OTJ N;  3PO5 A;  3WNH A;  3ID6 A;  1TK8 A;  3JYT A;  2PYL A;  3SUQ A;  3HK2 A;  4XEI A;  4YDU C;  1WUA A;  4DLE A;  2HHW A;  2KZZ A;  4FJI A;  3MN6 A;  3BY5 A;  5J2P A;  4DTP A;  2OCE A;  3L2V A;  3H46 O;  3A2F A;  3VQP A;  3VEV A;  5ADX H;  1TUU A;  3VTI A;  4FWL A;  2F7T A;  5JS1 A;  3K58 A;  5LY3 A;  3D2E A;  3VA3 A;  1TL3 A;  3O4Q A;  1T8E A;  4CEA A;  4M3R A;  1U49 A;  3NDK A;  4FLV A;  3OYN A;  1XI1 A;  4KFB A;  1Q8I A;  2A1R A;  2ITG A;  1BU6 O;  3OYA A;  2P9N A;  1ASV A;  3F73 A;  4BR4 A;  2UUA K;  3LDL A;  1OH5 A;  5EU7 A;  3WNE A;  3IFR A;  4DSJ A;  3BGR A;  3CET A;  2G8I A;  4DTJ A;  4IO8 A;  3FLC O;  1W0H A;  3F9K A;  1NU0 A;  1RT6 A;  4ZHR A;  5BRD A;  2GBZ A;  3HOT A;  4OGE A;  4DHY A;  4IJA A;  4NYN A;  2GUI A;  3QIN A;  1T6C A;  2YNF A;  3D0P A;  2HHT A;  5AQF A;  1HNX K;  3ZT0 A;  2YCH A;  3H6E A;  5LJW A;  1DGK N;  4GVE A;  4W5R A;  3HL8 A;  3M6G A;  3KK3 A;  4OPH A;  2F4V K;  3ATU A;  1JL1 A;  3IKM A;  1RDW X;  2QXF A;  4ELU A;  3IDH A;  3LDS A;  2NRW A;  4J2A A;  1EX4 A;  3BZC A;  1CLQ A;  2HHQ A;  5DK5 A;  4BE0 A;  2AA4 A;  3NAE A;  1WSJ A;  3NGY A;  3IAY A;  3LZI A;  2HMI A;  4FJ7 A;  1XQS C;  1XNQ K;  4YNQ A;  4B3T K;  2BE2 A;  3CCJ N;  5JIC A;  1HQU A;  3W0L A;  4O5F A;  3HVR A;  4O44 A;  5AQO A;  4JKH A;  3RRH A;  3L6Q A;  5KQ8 A;  4BR2 A;  3TI0 A;  3HZ6 A;  4BC3 A;  2X74 A;  2QK9 A;  1K6Y A;  1KD1 O;  4JHD B;  5KRT A;  1OKJ A;  3AO3 A;  3OBW A;  4OJR A;  3TPQ A;  2E1Z A;  4XH4 A;  1D9D A;  1TL1 A;  1D8Y A;  1GLL O;  5LJV A;  3SQ4 A;  4NLC A;  4DQR A;  1FW6 A;  1JLC A;  4BE2 A;  1KTQ A;  1T44 A;  3E01 A;  4NO7 A;  2HBJ A;  4FOI A;  4IBN A;  1BI4 B;  3SMP A;  3P5J A;  5HBM A;  1BIS A;  4RCH A;  4B1V A;  4B9T A;  1EO1 A;  4BRD A;  3EO3 A;  3SJJ A;  2P9N B;  3RR8 A;  4OKE A;  1HKC A;  1QSL A;  4FJH A;  4ZTJ A;  2E2O A;  3KLH A;  1NM1 A;  4LF8 K;  3ENO A;  1ESV A;  1IKW A;  3DI6 A;  4F3O A;  1YTU A;  3KLI A;  2CH5 A;  2XHB A;  4R79 A;  2UYT A;  4FWR A;  4CJF A;  1X3M A;  4CD3 A;  4CF2 A;  3VEW A;  3E66 A;  2UU9 K;  1HJO A;  1HQE A;  1YJ9 N;  4LSN A;  4DR6 K;  3DRR A;  3C6U A;  2HBL A;  5AQV A;  3HVT A;  3QIP A;  3DM2 A;  2I7N A;  2E5L K;  4FWM A;  4KHP K;  1Y97 A;  1NK4 A;  3NFA A;  5BPN A;  3ALY A;  1GLF O;  1HMV A;  4CES A;  1NKE A;  1EQY A;  4FLX A;  3TWH A;  5DM6 L;  2ZD1 A;  3O08 A;  3WNG A;  3EEQ A;  4RW9 A;  3CFO A;  5JMV A;  4JKD A;  1DT9 A;  5KRS A;  3PIP L;  2AJQ A;  1ATS A;  1LAW A;  3SBT A;  3VQA A;  3OYE A;  3KHY A;  3QES A;  4HTU A;  3G6E N;  2P9P A;  1NK5 A;  1T7P A;  3L0Q A;  5JS2 A;  1QQN A;  3SNN A;  4OLB A;  3M5R A;  3MDQ A;  5J1E A;  4ELT A;  5GAD P;  4WQ4 A;  3PY8 A;  3H3N O;  4CHP A;  2P9U B;  3O9R A;  4KHN A;  3OYM A;  1ZYQ A;  3S3M A;  3P4I A;  1CZB A;  1EKE A;  4CF8 A;  1SKS A;  2H3G X;  2YX6 A;  1RTI A;  2FF3 B;  4LF9 K;  3FE1 A;  2O8D B; 
#chains in the Genus database with same CATH homology
 3DMJ A;  4J2E A;  2KTQ A;  5CYM A;  3QNO A;  3TAE A;  2EHG A;  4DTS A;  4FLU A;  2DFE A;  3PX6 A;  4KHS A;  4CEF A;  4LH5 A;  3L2U A;  2OPQ A;  3NHG A;  1HNI A;  1S1T A;  3NH0 A;  4FJG A;  4O4G A;  4CFA A;  1VK0 A;  4CJS A;  1LAV A;  3SYZ A;  3TAP A;  1KLN A;  4I9Q A;  4N41 A;  2HB5 A;  4KTQ A;  3S9H A;  1LWF A;  4HCB A;  4IKF A;  4E0D A;  2FBT A;  5C42 A;  3IG1 A;  3DLH A;  3L3U A;  4IDK A;  3K5N A;  4CJT A;  4Z4I A;  3SQ2 A;  4FZZ A;  4KKO A;  1CXU A;  2XY5 A;  3KLF A;  3SCX A;  4NCG A;  4ID1 A;  1U48 A;  1R0A A;  1S1V A;  1C1C A;  4HUG A;  1B9F A;  3D45 A;  2FBV A;  4LSL A;  2ZE2 A;  5FRO A;  4FJX A;  1CXQ A;  1S5J A;  4DLG A;  1NKB A;  2OYQ A;  1RTD A;  3DLG A;  3HPO A;  3TAR A;  5SZT A;  4DSI A;  2NUB A;  4NCB A;  3CYM A;  1J53 A;  3V6D A;  4CHZ A;  1JLA A;  3DLK A;  1NOY A;  3T19 A;  4DU4 A;  1NK7 A;  2IDO A;  3ZT2 A;  4KRF A;  4DQP A;  3O3G A;  1KCF A;  1WSE A;  4CJW A;  2OPP A;  5HRR A;  4CJV A;  4HCC A;  3ISN C;  3TAQ A;  4AHC A;  1N6Q A;  4FJL A;  4DU3 A;  4AHR A;  4CFC A;  4M41 A;  4KRE A;  3G0Z A;  3IS9 A;  4KV8 A;  4F2S A;  4DFJ A;  3SUP A;  2EX3 A;  1N5Y A;  3PX0 A;  4FJM A;  4FJN A;  2HVI A;  1U4B A;  5KGW A;  4DTN A;  1RBT A;  1WAJ A;  4Y1C A;  3KK2 A;  2KZM A;  3OYG A;  3THV A;  3C6T A;  3AO4 A;  4E7K A;  4M42 A;  3V81 A;  3ZCM A;  4EZ6 A;  1VSD A;  1LV5 A;  1BIU A;  2LSN A;  1KVB A;  4FLY A;  4W5N A;  3OJU A;  4DU1 A;  1XC9 A;  2Y1J A;  3OJS A;  1TKD A;  2VG6 A;  4OVL A;  2OPS A;  1G15 A;  4AHU A;  1A5V A;  1HYV A;  4E7I A;  2XRI A;  1VSK A;  3HP6 A;  4DTM A;  1RBU A;  3LAM A;  1CZ9 A;  4M3U A;  2G8W A;  4W5T A;  2G8K A;  4AH9 A;  1BGX T;  2YNG A;  3FFI A;  3V4I A;  3L8B A;  4M3Z A;  2XO7 A;  1BL3 A;  5E41 A;  1UOC A;  2VG5 A;  2F8T A;  4LH4 A;  1KFD A;  3AVM A;  1XHZ A;  1WLJ A;  4CHY A;  1QE1 A;  2D0B A;  4CHQ A;  2D0A A;  5J2Q A;  4M3W A;  1HYS A;  1Z26 A;  5CZ2 A;  4CEQ A;  3H08 A;  3SPY A;  1B92 A;  4FK2 A;  4E89 A;  4KHQ A;  3AVL A;  3DLB A;  4B08 A;  1JL2 A;  3V1O A;  4HVJ A;  3K59 A;  1SL2 A;  3OYI A;  4K8Z A;  1FK9 A;  3UIQ A;  1S1U A;  3ZT4 A;  1BHL A;  4DFK A;  1QSS A;  3M8R A;  1EP4 A;  2B4J A;  5HRS A;  5HRN A;  3SV3 A;  4FJ9 A;  1IO2 A;  4EP4 A;  3LPU A;  1ZBL A;  2HNY A;  1NJZ A;  5J2M A;  3VQD A;  5DMR A;  4KHY A;  4FVM A;  2BAN A;  5FRN A;  2W42 A;  2IS3 A;  1JLQ A;  3V9U A;  4GVM A;  4FXD A;  3ZSX A;  1SKW A;  1S9G A;  3OYK A;  3M8S A;  1LWC A;  4ID5 A;  4B9V A;  3P83 D;  4CFD A;  3V9S A;  2WON A;  2G8U A;  4JRQ A;  3ZSR A;  1T03 A;  1ZBH A;  2I5J A;  1LW0 A;  2QKB A;  1X1P A;  3AVK A;  2ZQB A;  4CIG A;  1BQM A;  2HHX A;  2Z1J A;  3AV9 A;  4RW8 A;  1J9A A;  2YKN A;  3CG7 A;  5KGX A;  3AO1 A;  4Z4C A;  4DG1 A;  3NH2 A;  4JS5 A;  4DQS A;  3RMC A;  1JXB A;  4OPK A;  1L3T A;  1ZBU A;  1ASW A;  1BQN A;  1DLO A;  1VSF A;  3VQ4 A;  4CJ4 A;  4W5Q A;  3L2Q A;  4JS4 A;  2OZM A;  4EZ9 A;  4KPY A;  4CJE A;  3SI6 A;  4CEE A;  3K5O A;  3AVN A;  3B6P A;  3S3N A;  4MQ3 A;  4CE9 A;  4TSX A;  3DYA A;  3MAQ A;  1B9D A;  1FKO A;  3WNF A;  1RDB A;  4E1M A;  4CIF A;  3HO1 A;  4FZY A;  3QEV A;  1WN7 A;  4FJ5 A;  3LWL A;  4FK4 A;  4I7F A;  4BWJ A;  1VRU A;  2FBY A;  4FLZ A;  4FYD A;  2E6L A;  1TK5 A;  1J54 A;  3SQ0 A;  1JKH A;  1C6V A;  1RNH A;  4O5B A;  1TV6 A;  4KO0 A;  4DSL A;  3ZSW A;  1RT4 A;  3HM9 A;  1L3V A;  4QCL A;  3HPH A;  1WAF A;  3MED A;  4CJP A;  3VQB A;  1SV5 A;  4CK3 A;  4KAZ A;  3HJF A;  3RMB A;  1S6Q A;  3ITH A;  4O0J A;  3NH1 A;  1T05 A;  1TKT A;  1RT2 A;  4DTX A;  5J2N A;  1TAU A;  4FLW A;  1L3U A;  4YFU A;  1I39 A;  3ZSY A;  3V9X A;  3O4N A;  1IKY A;  2X78 A;  3VQQ A;  3OY9 A;  1SUQ A;  1VSI A;  1NJW A;  3RRG A;  3OYH A;  3LP2 A;  5KI6 A;  1BCM A;  4CHO A;  4KHU A;  4Z4F A;  4CJK A;  3NGZ A;  4M45 A;  3K5L A;  1L3S A;  2XY8 A;  2R7Y A;  1IG9 A;  4Z4E A;  1XWL A;  2HHU A;  1U47 A;  5SWM A;  4N5S A;  3K57 A;  2YKM A;  4BDZ A;  4CJQ A;  4DTU A;  3QIO A;  3U3Y A;  4C8K A;  2D0C A;  2KW4 A;  1HRH A;  3VQ5 A;  3ZSZ A;  4DWI A;  3V1Q A;  1EXQ A;  2P51 A;  3KKR A;  4OPJ A;  4F3T A;  4FW1 A;  2Z1I A;  1D5A A;  1S1W A;  3AVB A;  3LAN A;  4KTW A;  3U3G A;  4PY5 A;  4OGC A;  3NF6 A;  3LP1 A;  3K5M A;  2JGU A;  1BIZ A;  4HHT A;  4LD0 A;  1NOZ A;  4CEB A;  3C95 A;  4CCH A;  4E7H A;  2DY4 A;  3OS0 A;  1A5X A;  1Q9X A;  4GMJ B;  3S3O A;  1REV A;  1RDC A;  2HND A;  5T7B A;  3VQ7 A;  4F2R A;  3LP3 A;  4H4M A;  1KFS A;  3KD5 E;  3RWU A;  3HPG A;  3PV8 A;  3QEP A;  1C0M A;  2YHB A;  3L2W A;  3TAF A;  1TVR A;  1S1X A;  1YTA A;  4FK0 A;  1X9S A;  3T3F A;  1WSI A;  4E7L A;  1RBV A;  4JLH A;  4Q0B A;  4Z4H A;  4BAC A;  2VWK A;  1YVU A;  1XHX A;  3MXM A;  4N47 A;  1RT3 A;  5HLF A;  4RW6 A;  3DRS A;  3M8P A;  2IGI A;  4DQI A;  1KVC A;  3DOL A;  3IRX A;  1NK0 A;  1TK0 A;  2BDP A;  5I3U A;  3PO5 A;  3WNH A;  3DLR A;  3ZT3 A;  1IH7 A;  4QOZ B;  1TK8 A;  3JYT A;  2HHS A;  2FC0 A;  3HYF A;  2PYL A;  2A1S A;  4CJ3 A;  3SUQ A;  2PYJ A;  3HK2 A;  3K2P A;  2E4L A;  4FM1 A;  1C0U A;  3LAK A;  4DLE A;  1ZBF A;  1HYZ A;  1SL1 A;  3L3V A;  2HHW A;  2KZZ A;  4JRP A;  2ATQ A;  5C24 A;  4FJI A;  5J2P A;  5FDL A;  2PZS A;  4FM0 A;  4DTP A;  3NE6 A;  4KB0 A;  3L2V A;  3A2F A;  4M3X A;  3EYZ A;  3VQP A;  3OYC A;  4DSK A;  1BCO A;  3HXM A;  4ICL A;  3KLE A;  3I0R A;  1VSL A;  3VQ8 A;  2P1J A;  5JS1 A;  2RN2 A;  5FRM A;  4W5O A;  3K58 A;  2F8S A;  4N76 A;  3VA3 A;  1TL3 A;  2ETJ A;  2X6N A;  4CEC A;  1BI4 A;  3O4Q A;  1T8E A;  4B3O A;  3P1G A;  4CHN A;  3DRP A;  4M3R A;  4CEA A;  1U49 A;  3NDK A;  3PUF A;  3OYN A;  4FLV A;  4OLA A;  4I2Q A;  1XI1 A;  4IG0 A;  4KFB A;  5CZ1 A;  4KTZ A;  3EY1 A;  1Q8I A;  2A1R A;  2DFF A;  2ITG A;  1UAX A;  4Q5V A;  3OYA A;  1RTJ A;  1RTH A;  1VSE A;  3HP9 A;  4KB1 A;  4DFP A;  1ASV A;  3F73 A;  3CM6 A;  3OS1 A;  4FLT A;  5EU7 A;  3WNE A;  4CK1 A;  1JLG A;  3O3H A;  1VSM A;  3BGR A;  2O4G A;  1L5U A;  4RW4 A;  3C94 A;  4DTJ A;  2G8I A;  3U6F A;  4ELV A;  4E7J A;  4KI4 A;  1W0H A;  3F9K A;  5CY4 A;  3CFP A;  4KI6 A;  1RT6 A;  4ZHR A;  3KTQ A;  1S6P A;  1NK8 A;  3SUN A;  3AVH A;  1YT3 A;  3LAL A;  2GBZ A;  4Z0U A;  4CGI A;  3RMD A;  4OGE A;  1KSP A;  4B9M A;  4NYN A;  4CK2 A;  1RDD A;  2GUI A;  4GW6 A;  3VQE A;  4DSF A;  3SQ1 A;  3QIN A;  5C25 A;  1JLE A;  4DQQ A;  3PO4 A;  4LY7 A;  2GV9 A;  2YNF A;  4WE1 A;  3D0P A;  2HHT A;  1KRP A;  2G8V A;  1ZBI A;  3ZT0 A;  4BE1 A;  4M3Y A;  3NCI A;  1C1A A;  4W5R A;  2YNH A;  3VQ9 A;  2Z1G A;  4CGH A;  4HUF A;  1JXE A;  3TAN A;  3ASM A;  4MFB A;  3HL8 A;  3KK3 A;  2YV0 X;  3LPT A;  3B6O A;  1ITG A;  4BDY A;  3HST B;  3RR7 A;  3ZSO A;  1JL1 A;  1Z25 A;  4I2P A;  5K14 A;  2QXF A;  4CJR A;  4ELU A;  3CFR A;  3KK1 A;  3LDS A;  4Z4G A;  1JLB A;  4HUE A;  2P5O A;  3MEE A;  3CQ8 A;  4J2A A;  1EX4 A;  1SKR A;  4PUO A;  1CLQ A;  2OPR A;  2HHQ A;  5DK5 A;  3MXJ A;  4BE0 A;  4L8R B;  1QS4 A;  2E6M A;  3NBP A;  3NAE A;  1FKP A;  2F96 A;  1WSJ A;  3NGY A;  3ZSV A;  3IAY A;  2DTU A;  3QNN A;  3LZI A;  2HMI A;  4FJ7 A;  5HP1 A;  4AHT A;  4CF9 A;  1RT1 A;  4CJL A;  1C0T A;  1VRT A;  3NF8 A;  3T1A A;  3AVI A;  4YNQ A;  2BE2 A;  1IKV A;  4IG3 A;  3TAG A;  1TGO A;  1HQU A;  2X6S A;  2YNI A;  2HHV A;  4BWM A;  4DF8 A;  2Y1I A;  4XIU A;  3HVR A;  2IOC A;  2FBX A;  4CEO A;  4O44 A;  1O1W A;  3I0S A;  3OYB A;  1RT7 A;  4QAG A;  1NJX A;  3RRH A;  1QHT A;  4Y1D A;  3TI0 A;  3KKS A;  1GOC A;  2X74 A;  4J2B A;  2KFZ A;  4CIE A;  3I8D A;  1K6Y A;  3QEW A;  2QK9 A;  4CEZ A;  3SPZ A;  2RKI A;  4FJK A;  4DS4 A;  2O4I A;  3AO5 A;  5KRT A;  2XY6 A;  1WSG A;  3RTV A;  4ZTF A;  3AVG A;  3AO3 A;  4CJ5 A;  3VA0 A;  3MEC A;  4OJR A;  2HW3 A;  4E3S A;  4M3T A;  1NKC A;  2HNZ A;  1VSJ A;  2B5J A;  3AVA A;  4CED A;  3OS2 A;  1NJY A;  1LW2 A;  1D9D A;  2DFH A;  1TL1 A;  4CF1 A;  4CF0 A;  4F8R A;  1A5W A;  4DFM A;  1RCH A;  3TAM A;  1D8Y A;  2WOM A;  1RDA A;  4AHS A;  3QEI A;  2VWJ A;  3SQ4 A;  3AA3 A;  1I3A A;  1QQC A;  4DQR A;  3AA4 A;  3OYJ A;  1JLC A;  3AVC A;  4RW7 A;  1KTQ A;  4B8C A;  3O3F A;  4BE2 A;  3V9Z A;  1NK6 A;  4B9U A;  2P5G A;  3E01 A;  1VSH A;  1RBR A;  2RPI A;  4IBN A;  1BI4 B;  1TKZ A;  4G1Q A;  3ZSQ A;  3QO9 A;  2KFN A;  3P5J A;  1Q9Y A;  4B9N A;  5HBM A;  1HJR A;  1UWB A;  1DTQ A;  1BIS A;  4AIL C;  1TKX A;  3OYF A;  4B9T A;  5I42 A;  2RF2 A;  3SJJ A;  1FXX A;  2VG7 A;  1U45 A;  3OYL A;  3L2R A;  4CJU A;  4OKE A;  3VQC A;  1QSL A;  3RR8 A;  4FJH A;  4CGJ A;  5HRO A;  4ZTJ A;  3AA5 X;  4O0I A;  4B8A B;  3KLH A;  3HT3 A;  4FCY A;  4DTR A;  5CYQ A;  1UA0 A;  1D9F A;  1IKW A;  3DI6 A;  4OKK A;  4F3O A;  4CGD A;  1YTU A;  4R5P A;  3ULD A;  2Z1H A;  4I9L A;  3QEX A;  3SUO A;  3KLI A;  1JLF A;  2G8F A;  1WNS A;  2XHB A;  2B6A A;  3QLH A;  1KVA A;  4B9S A;  2IC3 A;  4CJF A;  1X9W A;  1HNV A;  3LP0 A;  4CF2 A;  1DTT A;  2G8H A;  3ZT1 A;  4DF4 A;  1RIL A;  1TAQ A;  3SV4 A;  4H8K A;  4IFV A;  2HVH A;  4IFY A;  4NYF A;  4UQG A;  1HQE A;  1SL0 A;  4LSN A;  4F4K A;  4PA1 A;  3DRR A;  3C6U A;  3AVJ A;  3AVF A;  3DLE A;  4CER A;  4DSE A;  3TAB A;  1EET A;  3OYD A;  3AO2 A;  1U04 A;  4FZX C;  1RT5 A;  3HVT A;  3QIP A;  1HPZ A;  3DM2 A;  3KIO A;  4E1N A;  3KD1 E;  1Y97 A;  1NK4 A;  2BGG A;  4FW2 A;  3NFA A;  3ALY A;  4CGG A;  1GOB A;  1HMV A;  4CES A;  4CGF A;  3KJV A;  4C8N A;  1NKE A;  1F21 A;  4CFB A;  3EZ5 A;  4FLX A;  3TWH A;  4H4O A;  4O55 A;  2ZD1 A;  3V1R A;  1X9M A;  1W9H A;  3V9W A;  3WNG A;  1MU2 A;  2PY5 A;  1LWE A;  1WSF A;  1WSH A;  4J2D A;  3M8Q A;  1C1B A;  4RW9 A;  4E19 A;  4DMN A;  3CFO A;  1UA1 A;  2IAJ A;  5KRS A;  2AJQ A;  3QET A;  1GOA A;  3TR8 A;  1LAW A;  1IKX A;  4EP5 A;  4BDP A;  3VQA A;  3OYE A;  4DSJ A;  3LWM A;  4AHV A;  3RMA A;  5D3G A;  2QKK A;  1QTM A;  3QES A;  2OZS A;  4HTU A;  4KHW A;  2KQ2 A;  4PQU A;  4RG8 A;  3JSM A;  2YHA A;  1RBS A;  2Q3S A;  1NK5 A;  1T7P A;  4K8X A;  1S9E A;  3KLG A;  3AA2 A;  3CM5 A;  5JS2 A;  1J5O A;  3DOK A;  3PX4 A;  4FM2 A;  4PWD A;  3SNN A;  3MEG A;  5KTQ A;  5HRP A;  3NF9 A;  4OLB A;  5J1E A;  2OA8 A;  4ELT A;  3SZ2 A;  1NK9 A;  3PY8 A;  4B9L A;  4FJ8 A;  4C8O A;  2XY7 A;  3BDP A;  4CHP A;  1KLM A;  4C8M A;  4N56 A;  3NGI A;  4DTO A;  4KHN A;  3OYM A;  3NF7 A;  1ASU A;  4NCA A;  3G10 A;  3S3M A;  1ZYQ A;  1CZB A;  3VN5 A;  1EKE A;  4CF8 A;  3MXI A;  1SKS A;  3QER A;  3VQ6 A;  3OVN A;  4DS5 A;  1RTI A;  1QSY A;  4OKJ A;  2JLE A;  4FJJ A;  2D5R A;  3LZJ A;  4C8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...