4IOCL

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4iocL01
3CCUN 5JVGL 2QEXN 5DM6L 4WF9L 1VQ4N 5MLCQ 5GADP 1YHQN 4IO9L 4WFAL 2QA4N 3CXCM 3PIPL 1QVGM 1KC8O 3CCLN 1KQSM 2OTJN 3PIOL 1M1KO 3CC2N 1K8AO 3J7ZO 4WCEL 3CCEN 1ILYA 3G4SN 5DM7L 1YJWN 4UY8O 1VQ9N 1VQLN 3CC7N 3G6EN 3DLLL 1M90O 1YJ9N 3CCJN 2ZJQL 1K73O 5GAGP 2ZJRL 5JVHL 1QVFM 1YITN 3G71N 3CCSN 5H1SQ 2OTLN 1VQ7N 1YIJN 1N8RO 3CCRN 4U67L 3CD6N 3I56N 1S72N 4WFBL 1W2BM 1VQMN 3CMEN 1Q82O 5HL7L 1VQNN 3CCVN 4IOCL 3CPWM 1JJ2M 3I55N 1KD1O 1K9MO 1VQ8N 1Q86O 3CCMN 5GAHP 1VQON 3CC4N 3CMAN 1YI2N 4WFNL 1YJNN 4IOAL 1VQPN 2ZJPL 1VQKN 5GAEP 1OVYA 3CF5L 1VQ6N 1NJIO 1Q7YO 3OW2M 1VQ5N 3CCQN 1Q81O
chains in the Genus database with same CATH superfamily
3VENA 3VQ6A 4IBNA 3L3UA 4JK7A 4QS9A 1KAZA 3SAGA 1S22A 4CFBA 1TYQA 3U8XA 3AO4A 1L3TA 1Y97A 4RW4A 3F5TA 4M41A 4ILGB 1EWQA 2OANA 4C8KA 4X66K 3MXJA 3GDQA 1WAJA 1VSFA 4ISFA 3CCEN 4R5PA 2D0AA 3MCPA 4OKJA 4DHYA 3SUNA 4BGBA 2F8SA 3SPYA 1KCFA 5AQQA 1NGDA 1C0TA 1NGCA 3JXUA 4CZFA 2Q97A 3QERA 4CD3A 1BDGA 3WEEA 4FM1A 3LZIA 3I8BA 3ZSWA 4OLBA 5CHIA 3MN5A 3S9HA 1HNWK 2IDOA 2UXCK 4EP4A 3LP0A 4ICLA 3JAMO 4M45A 4O5FA 1IG8A 3WQUA 4FM0A 4DQQA 1C6VA 3WNGA 4FXDA 3OY9A 3THYA 4A61A 3OYEA 1KSPA 1Q9XA 3HXMA 5C10A 3ENOA 1HNIA 2Y1IA 4GVMA 2I7NA 3OS2A 2XY7A 1HLUA 2DFFA 1IBKK 4KHNA 3MDQA 3VQBA 3KHYA 1RT2A 3HRGA 3LAKA 4C8OA 4BRGA 3CM6A 3L8BA 3TSPA 2PZSA 2ETJA 1RDCA 3ZX0A 1VSDA 2XY6A 5J2QA 5JLHA 3VQQA 4I2QA 4N76A 5AQRA 2UYTA 4DTXA 3M8PA 3SMSA 3W3DA 3M8SA 4EIAA 1MWKA 5BRHA 4JN4A 4XH5A 1NJIO 4BC2A 4FK2A 3LWMA 5LMUK 4LH4A 3KK7A 1JL1A 4FW2A 3ZX2A 3U6FA 3THWA 5BPLA 1C0FA 4RW6A 4B8CA 3J8AA 1WBDA 4V19S 1YTUA 2QTDA 2AJQA 3M8QA 4BRHA 1KLMA 4G1QA 4YOUA 4KHYA 4PHTX 1L3UA 5IWAK 1RT6A 1JLEA 3OBYA 1ZBHA 4BRLA 2P9IB 3UKRB 4DUZK 1NGAA 3VQEA 4UY8O 1P8ZA 3LL3A 3WNFA 2Q36A 3NBPA 1VQLN 2UUBK 3WXJA 3AGRA 2YJFA 4FJXA 4EHTA 1LW2A 4DMNA 1ZXOA 1S1XA 2O8EA 5A2QO 3CETA 4CJVA 2NRTA 1S1TA 3O9TA 4JHDA 4BWMA 2ZJRL 1XQSC 1OH5A 5JVHL 2HNYA 4H03B 1YITN 1QVFM 5FPNA 3RRGA 3Q7CA 4IJNA 4ELTA 4ELVA 2IOCA 1FK9A 5KQ8A 4DTRA 2NNWA 3EEQA 3ENHA 2O8BB 5AQSA 4C1NK 4LF4K 1VHXA 4DQIA 2O4IA 3QEXA 1ITGA 5M1KA 1YT3A 5I42A 4A62A 3OYKA 2IC3A 3K5NA 3MX2A 3CCMN 4H0TB 5SZTA 4DQSA 4BC5A 3J7AP 4DV5K 1NKBA 1K8KB 4E1JA 2P9KB 5AQJA 3SBTA 5E84A 4JI4K 5FRMA 5BR8K 4Z4IA 3CI5A 2VWBA 5TKYA 1NNEA 3H1QA 4E1NA 3D2FA 3K5MA 3HTVA 3T1YK 5LJWA 1HQEA 1XWLA 4BVOA 1L5UA 1U04A 2O4GA 4CBXA 1JLQA 4JAXA 4BE0A 1BU6O 3TR8A 1KC8O 1RDWX 3QMLA 2Z1IA 1V4TA 2GEMA 5LJVA 5AQKA 2WC9A 1JLAA 1NGIA 3O3HA 1HRHA 4PA1A 3OYMA 1XUPO 4CHQA 4FWRA 3K5LA 4CEDA 3WXMB 4NLBA 3P4IA 3K59A 4HCCA 4CJUA 3GOIA 5IT9O 4EFHA 3CC7N 3HK2A 4RCHA 4BRQA 1FKPA 3M6GA 3P39A 3NH2A 2YX6A 2FF6A 3C6UA 4CI6A 2WBNA 4W5QA 1RBTA 1NJZA 1RBVA 4KREA 3AAPA 1YAGA 5I3UA 1KRPA 5FPMA 3G71N 5H1SQ 4Q0BA 2HHUA 1KVAA 4DF4A 4W5TA 2KW4A 3WT0A 3VGLA 5M1PA 1JXBA 2P9UA 5CYMA 3VESA 4CEAA 4BRPA 1HYZA 4OLAA 1JLGA 3BEXA 4YOVA 1R59O 1QTMA 2GV9A 3DYAA 2O8CA 4GV3A 3FZKA 4ELUA 4DR5K 4DLGA 3I0SA 2E8AA 2E4LA 1U4BA 3QIOA 4M63C 1KFDA 3CMAN 1YTAA 2HOEA 5AQHA 1YJNN 1BI4B 1HYSA 1S3XA 4BRKA 4CHNA 4J2DA 1VQPN 4WQ4C 4ID5A 1TVRA 1QZ6A 4NLCA 2GX9A 3DI6A 1BOTO 4FOEA 4CZMA 1ASVA 3R6MA 4XH4A 2V51B 3DLHA 1ZBUA 3TTDA 4EAHD 4BDPA 1Q81O 4B1VA 3AO1A 3SLCA 4M3XA 4QS8A 2HSTA 3AVGA 1U49A 2ASMA 3NF7A 4FPBA 4IXCA 3TU5A 5SWMA 4FJKA 2X6NA 4MFBA 5J2MA 1GLCG 2QM1A 5KPTA 3Q7BA 3CQYA 2G8IA 3B6OA 2B6AA 1I39A 4C23A 1J5OA 3DMJA 5AQPA 3P1GA 1XHXA 3HO1A 4HTUA 1U2VA 4JKDA 1A5VA 3KJVA 3S41A 4E0DA 1YJWN 3EO3A 3OBWA 3NDKA 3LPUA 2LSNA 3QEPA 4B9NA 1SKSA 1T44A 3PLAA 1J54A 2RKIA 1B9FA 2V7ZA 5FPEA 3ZT2A 3LANA 3SUPA 4JI1K 4FLVA 4DTNA 3CG7A 4FWQA 4I2PA 5HROA 4A59A 3NE6A 4CGHA 4CF8A 3LM2A 3K57A 4LD0A 3E9OA 2HBMA 1RTHA 1CLQA 5KGXA 4E1MA 3O08A 1E3MA 2GUPA 4YDUC 3C6TA 3NGIA 3KLEA 1GOBA 4BR2A 5AQOA 4JKGB 2E20A 1QHAA 3FLCO 3NF8A 3VQ4A 2PYLA 4BRIA 4J2BA 3KVGA 3ASMA 4HWIA 4JLHA 4FJ5A 1S1UA 3E01A 1NK8A 3JS6A 3HI0A 3VTIA 4CZEA 5BREA 4JKHA 4K8XA 3VQPA 5KQDA 1T05A 2G8VA 3PY8A 3K9KA 3DLBA 3UIQA 3EE9A 2A5XA 3H45C 4I6MB 4H5TA 1B9DA 3RR7A 1VSJA 2JLEA 3ZSQA 2Z1JA 3LM9A 4B9QA 5E26A 2GBZA 4RW8A 3LAMA 1VQ4N 4F3TA 1YHQN 3CQ8A 3D45A 2QA4N 4B9TA 4BDYA 2VGMA 4LH5A 4J8FA 1OH7A 3GBTA 3M3ZA 3SJJA 4LF8K 4BC4A 4N56A 1MA9B 2Y1JA 2VCPA 5AZJA 4CHYA 1HKBA 1ASUA 4DU3A 4YOTA 3QBXA 2XHBA 1WLJA 3D2EA 3SZ2A 4BE1A 4OPHA 2BANA 1RT7A 4BACA 1OH6A 5CZ1A 3AVNA 3H3OB 3IMXA 2W6KA 5ADXH 4CZHA 1BO5O 3LDLA 1S5JA 2JGUA 4H0PA 5CR4A 2ZQBA 1QSYA 3A5NC 5AQTA 3H46O 4CJ4A 1O13A 2BH1A 3WUHA 2UXDK 4DTJA 4LFAK 2R7YA 4U67L 4FSVA 3ZLJA 3VEWA 3PX0A 1N6QA 3AVBA 3HP6A 1IKVA 3AO5A 3LDPA 2P5GA 1SL0A 4BR0A 2E6LA 1RT5A 2GWJA 4MLEA 2QWRA 3G10A 3M1FA 4BR9A 4F8RA 2CH6A 4AM6A 4BC3A 4CK1A 4KBOA 3UB5A 4NXMK 2FSJA 5HLFA 3VA3A 3O4NA 4B1YB 4CF1A 4E7IA 3AVLA 2QWPA 2IVOA 3D0PA 2ZGYA 4FWNA 4HTLA 4B08A 4N47A 2D1KA 5M1FA 3SNNA 4YNQA 1RTIA 3QNNA 1EWRA 2IIRA 5GINA 2OZMA 1EKEA 3OW2M 5CYQA 5T7BA 2P9NA 4FL9A 5AQUA 3HZ6A 4B3SK 1NJXA 5CZ2A 4RWTA 2Q0UA 4CF0A 2HHQA 2E2OA 3AAQA 1QQOA 4JKCA 3BZKA 1DGKN 4BRCA 1ATSA 4CFDA 3QDKA 4K0KK 1YUWA 1GLDG 4Y1DA 3PIOL 4FJJA 1C1BA 4DQ8A 3VQCA 2P9PB 4K42A 2HHTA 1BHLA 2YHXA 3ZSYA 5HRNA 4BR4A 4GMJB 2D0CA 2IVPA 1WNSA 4FJLA 3O3FA 3MX5A 4CZKA 4BDZA 1CZBA 1TKTA 4FW1A 3AVFA 4BE2A 1JLCA 2Q31A 3TI0A 1LAWA 1BIUA 1I94K 1XC3A 1NK6A 3ID8A 4KH5A 1LWEA 4GV9A 4K41A 2DY4A 5FPDA 4O44A 1IKWA 1T6CA 5AQIA 3DXMA 3CCSN 1TAQA 1VQ7N 2XRIA 2ASPA 3D6RA 1WAFA 2BUPA 1N34K 4LF6K 5AQYA 4LY7A 3KWIA 4KB1A 3THXB 4LF7K 3O4QA 4RW7A 2HNZA 3PUFA 4K8ZA 2O8DB 3SV3A 2HHVA 3FZLA 4DR1K 3O5BA 4CGGA 5AQZA 5HL7L 1EQYA 1TK5A 2YV0X 1HX1A 3VA0A 4MLHA 4F3OA 3MCAB 1KFSA 3RMBA 1K9MO 1GLJO 4W5RA 4ILJA 1NWKA 1SKWA 1ZBLA 3TTFA 4CGJA 5AFUA 4DWIA 4CEQA 3C0BA 4AH9A 4GVEA 1TK8A 5E41A 3I8DA 5HRRA 3V1RA 1VQ5N 4FJGA 1C1CA 3DRPA 2VGNA 3L2RA 3V9SA 4E7KA 5C0YA 2HMPA 2VWJA 3CQXA 3L2UA 3FZHA 4YFUA 3SPZA 1Z25A 1RBUA 3T7ZA 4CK2A 3NF6A 1K8KA 1L3SA 4DB3A 4CFAA 2VG6A 1K8AO 3E66A 1ATRA 3IS9A 4IG0A 4WQ5A 4H0VB 3QNOA 3ZETB 1ILYA 1RT3A 4CF2A 1G99A 2OYQA 1SZ2A 4BWJA 2BDPA 4W5OA 3LP1A 1X1PA 4M3YA 3QICA 4CHZA 2FBTA 4FJ9A 2CGKA 3SBGA 2J4RA 3VGMA 3G6EN 3TARA 4NO7A 4KAZA 3VF2A 3MXIA 3HPGA 3NCIA 3RTVA 1WUAA 4DSJA 5C25A 1S6QA 4HCBA 1FXXA 4ZTFA 2NRWA 4YHHK 1GOCA 4ISGA 4MO5A 1YIJN 4DSKA 1YXQA 3OS1A 4PL8A 1XNRK 3IFRA 1Q8IA 2CGJA 5C12A 1BG3A 4WFBL 5GIPA 3O9UA 1HNVA 4IFEA 1S9GA 2HNDA 4GY2B 1VQMN 3WXLA 1QQNA 3I0RA 4CIFA 3ISNC 4GNIA 4TSXA 2P1JA 4FCYA 5C24A 4CF9A 4JI3K 3CCVN 1HQUA 2YKNA 3WXIA 5AZIA 3ZSVA 5TKWA 2ZWHA 3ULEA 3IRXA 3AV9A 2OPRA 5AQNA 3RSEB 1RDAA 3C94A 1YI2N 1NK5A 2NRHA 2VG7A 4FLZA 4KV8A 3CJCA 2F9WA 1KLNA 3WEEB 1KVCA 1Z26A 1NKCA 4YOYA 4FJHA 1VQKN 3VETA 5GAEP 3SI6A 1OVYA 1SAZA 2ZD1A 1Q9YA 2F9TA 3SUOA 4Z4FA 3P38A 1NU0A 1HJOA 3VEXA 1S1VA 5JICA 3ZT1A 3CCUN 4CECA 4FK4A 5JS1A 3S3NA 3DXKB 1NGFA 3F73A 4JKEA 1N5YA 3F9MA 3J81O 3VERA 1O1WA 1VSLA 2I5JA 4L8RB 1HNZK 1BI4A 1UAXA 3THVA 4BVPA 3SQ2A 1M1KO 3NMUA 1RBRA 3CYMA 3ZYYX 1HPMA 1NBWA 3QIPA 5HRPA 4AQYK 4CJPA 4F2SA 2WTUA 3VQ7A 2OCEA 4MO4A 5HOOA 3OVNA 3VQ9A 4DU1A 4Z4HA 1RDUA 4DFPA 4CBUA 3O4WA 1RDBA 1JXEA 3ZX3A 5C42A 4XEIA 4FZZA 3PO5A 2RPIA 3H08A 1QQMA 4Z0UA 1TL3A 2E2PA 3EYZA 1JCGA 4H5NA 3DM2A 3LALA 4Z4CA 2NRXA 4QOZB 4KB0A 3ZT4A 2ZGZA 3QETA 4DV0K 4B1UB 3I56N 4DS5A 3HOSA 4M3ZA 2GTDA 3LDOA 4JK8A 2O8FB 3OJUA 2E6MA 1NGEA 3FZMA 2B5JA 4HHTA 4WYBA 4HUFA 3DRSA 1TUYA 3AARA 1D9FA 4LFBK 4JD2B 2WONA 3PO4A 5J2NA 3L3VA 4EP5A 3A2FA 4H5WA 3ENBA 5KRSA 5GAHP 4AHUA 2UUCK 3HVTA 4B9VA 1U45A 2D0BA 4KKOA 4YY3K 3CFPA 4LSLA 2P9SA 1NGHA 1RFQA 4B9SA 3TAQA 1DLOA 4XH1A 5KTQA 3BUZB 2YHAA 4JHDB 4CJWA 3MEDA 4CEOA 4M3UA 3MWPA 1JLFA 3VQDA 1HKGA 4JKGA 2D0PA 3HSCA 4O0JA 3NVMA 3UKUB 4YOWA 4CCHA 4JEPA 3K5OA 1K6YA 1F21A 4CIEA 1Z6RA 2UUAK 1CXUA 4B3OA 3IDHA 3MN6A 4PUOA 4PY5A 4PL7A 2OTJN 3T69A 4DQRA 4BGAA 4C8MA 4OPAA 4KPYA 1IJJA 3KK2A 3B6PA 3G4SN 4IOXA 3CJ9A 4NYFA 4O8KA 2G8HA 3C6AA 5BN8A 1NG9A 3RMAA 4DFJA 4A5AA 4IJAA 4OX9K 4KH6A 4IEIA 2JWKA 4GKJK 4FJIA 2Q0RA 4BRDA 3CM5A 3D2FB 3AVIA 3NHGA 3CERA 1LW0A 3TAMA 1K73O 5GAGP 4BRNA 1QS4A 2E1YA 2YKMA 4FLXA 3V4IA 1EETA 4JYAK 1Y64A 1RNHA 3DLRA 1R0AA 3O80A 2OTLN 3P31A 4JI5K 3CD6N 1RT4A 3NGYA 3AY9A 4J2EA 3V9XA 5DK5A 2VQEK 2FSNA 4OPJA 1I3AA 1LWFA 1NK9A 2BTFA 4BQZA 2NRRA 4CIGA 4AM7A 4EZ9A 4U7BA 5K14A 4KO0A 1NKEA 4LF9K 4CJEA 1XMQK 1JJ2M 4ISEA 1D9DA 4QCLA 5AQLA 4DV4K 4O55A 4CZLA 4CGFA 3MAQA 1WBBA 4FJ8A 1LAVA 1IO2A 3E1YA 3BF1A 2YHYA 4H8KA 1W9HA 3LDNA 4CFCA 3ZSRA 2KTQA 3VMFB 1L3VA 2XY5A 3R9PA 2QWLA 3C7NA 3BP8A 4CJQA 4BQLA 4DS4A 4IKFA 1HYVA 1GOAA 2VG5A 5GIOA 3LP2A 1WN7A 4X64K 5EOYA 4B9UA 5HRSA 5FROA 3OYCA 2QEXN 2X74A 4RTFD 1XC9A 1BL3A 1HKCA 1RDDA 4OJRA 1X9JA 4CEFA 3RR8A 1IH7A 3CXCM 3WNHA 4PWDA 1HNXK 1ESVA 5AQMA 2VQFK 1TK0A 1KQSM 4ID1A 4IDKA 3MN7A 4BRAA 5LY3A 2HW3A 4ZHRA 3A8YA 1A5XA 4LFCK 2ASOA 3IKMA 1LOTB 2Z1HA 4B9MA 4H0XB 1TUUA 4K43A 3D7EO 3EKSA 3BZCA 3GL1A 1N33K 2NRVA 4PKIA 1ATNA 4FLYA 3MN9A 4B8AB 1IBLK 1VSIA 3KLGA 2P9PA 4CD1A 3NVKA 2KFZA 3U9ZA 3EN9A 2CGLA 1OVQA 1Q18A 3A0IX 2P9LA 4DR3K 4CJFA 1CZ9A 2HF3A 1NK4A 3OYDA 4OVLA 1W2BM 3AVCA 3QEIA 2KZMA 4OGEA 4DV1K 2NUBA 4DSLA 5B8HA 4NXNK 2QKBA 1U2VB 5AQWA 4E19A 4IEEA 3AO2A 1NMDA 4Y0WA 2X6SA 1ZC6A 1DTQA 2ITGA 3KK1A 1C0UA 4OPKA 3SQ0A 3HP9A 4RW9A 4KH4A 1NK0A 3A5OC 2RHKA 1IKYA 2HVIA 5CE3A 3V81A 1VAZA 1VSMA 2EHGA 1LV5A 1BQNA 5BRDA 1OKJA 3NH1A 4H5VA 4HVJA 1UA0A 4CHOA 2F96A 3L4IA 3KLIA 4BG8A 1BGXT 4CZGA 3N4PA 3AVMA 4BRMA 1U6ZA 2HHHK 4GKKK 3C6HA 3DJCA 1QVGM 4FVUA 2QWNA 3AGKA 1VRTA 4G9ZA 4LC9B 4WQ5C 3QB0A 1D8YA 1P90A 1V4SA 1T6DA 2FC0A 4FOIA 4C8LA 4CZJA 4IO8A 4HUGA 3IG1A 2FF3B 3KLHA 5D3GA 2F4VK 4FPAA 1UOCA 2PAVA 3EZ5A 1FJGK 2OPSA 1MDUB 1SUQA 3MWTA 3O1WA 2OPQA 1DEJA 3DLEA 4FLUA 3VOVA 4AHCA 1SKRA 3F9KA 4AHTA 3V9ZA 3EY1A 4CW7B 1X3NA 2ZM6K 4N41A 3O3GA 3CFRA 1WB9A 1SV5A 2F7TA 3SUQA 5BPNA 4O0IA 3EZWA 2JWLA 3LDQA 2HBLA 3ZETA 2W42A 3DWLA 4FWOA 3SJHA 5C15A 2GUIA 3J80O 3VEVA 5AZJB 3CMEN 3VQAA 4FVMA 2ZF5O 3OYIA 1E4FT 1G15A 2A6AA 3FR0A 1VQNN 3D2EB 3AA4A 5KGWA 1WSFA 3LDSA 1LWCA 3HPOA 2E1ZA 2KFNA 2HHXA 3VQ5A 1VQ8N 2OA8A 3AVJA 1Q86O 1FKOA 2W41A 4FJNA 3WNEA 1VQON 3L2WA 5KI6A 2P9IA 3U4LA 3UKRA 4WFNL 5EY4A 4DLEA 1D5AA 1MWMA 2W40A 1UA1A 3SMPA 3CF5L 1BA1A 1WOQA 1NGGA 1QE1A 4AHVA 3R8EA 1TGOA 4C8NA 4R79A 3L2VA 5EX5A 3VGKA 4CK3A 4YOXA 2PYJA 4CJTA 1X9MA 2DFEA 5DM6L 4FZYA 4DSEA 1TV6A 4FLTA 3T1AA 3ALYA 4FM2A 3P5JA 1NOZA 3RSEA 3JSMA 2BE2A 3HOTA 5BPMA 1BUPA 3AA5X 3QESA 3U3GA 1JLBA 3OYFA 3K9JA 3OS0A 3K58A 2O8BA 3CC2N 1Z05A 4J2AA 1FW6A 4BRFA 1NMNA 1ZBSA 3TPQA 3VN5A 4KTQA 1YVUA 1RBSA 2HMIA 1T8EA 4BROA 4DF8A 2YNFA 1VQ9N 2A40A 3DXKA 4CE9A 4JKAA 3CJAA 2P5OA 5KRTA 4KI4A 4I9LA 3K0SA 4CHPA 1T03A 1QSLA 3OTOK 3ATVA 3HYFA 1KAYA 1X3MA 2KQ2A 2RN2A 4BG9A 3OYJA 2ZJQL 2P9KA 2Q3SA 2P9NB 3KKRA 4O5BA 3TANA 3ZEUB 4DR2K 2FLOA 2DTUA 3HL8A 4CZIA 1N8RO 4HUEA 1EP4A 4CJSA 4N5SA 3CCRN 3CPEA 4DR4K 3OYGA 4CJ7A 1S72N 4NCBA 5J1EA 4JI0K 3BGRA 3HM8A 2DFHA 5J2PA 3O9SA 2HHWA 3NF9A 1S6PA 3OYNA 1Q82O 5AQXA 5C2FA 2IVNA 4JI2K 1HUXA 4FZXC 4K25A 1KD1O 4DTSA 1BA0A 1KXPA 2FXUA 2HBKA 1MU2A 1XI1A 1TYQB 3DOLA 1GLFO 3QEWA 3KK3A 3MEEA 2YNGA 1TKXA 3KD5E 4CJ3A 1IKXA 2HB5A 3MEGA 3VTHA 2O8FA 3T19A 3W0LA 4KRFA 4IFYA 5F1XA 2KZZA 1Q7YO 1BCOA 3ZT0A 3H3NO 4Z4EA 3DXMB 1VSEA 4BR5A 3VEZA 3CCQN 1X9WA 4OKEA 3ZT3A 3PX4A 4JD2A 1DTTA 4DV7K 1XMOK 4DSFA 4WFAL 1J9AA 1J6ZA 5HBMA 3HJFA 3WXKA 2YNHA 1SS6A 4CJRA 4DQPA 3J7ZO 4WCEL 3LWLA 4X65K 1RTDA 2QWMA 3QBWA 1WSIA 4ZTJA 3ZSZA 3VEYA 3U3YA 3UKUA 1JCEA 3O8MA 3THYB 2E2NA 3U9DA 3LZJA 2E88A 3C95A 4CERA 1ASWA 4M42A 1GLBG 3SAFA 4I7FA 4RG8A 3RVCA 1KAXA 1E4GT 5EU7A 4B9LA 5ADXA 1A5WA 4AHRA 4DR7K 1BCMA 1BWFO 3OJSA 3TAPA 5EXWA 3NH0A 2QWOA 1BQMA 1IBMK 3EKUA 3EE8A 3EL2A 3K2PA 4DV6K 2CH5A 3S3MA 4KHWA 4JK9A 3AVAA 4PQUA 1XHZA 3G0ZA 5AJ3K 3HBTA 2QKKA 4AF1A 3AA3A 4JKBA 3KLFA 4KHUA 3ZSOA 2P51A 1JCFA 4IWVA 3THWB 3CPWM 5LMNK 1KTQA 1EO1A 2AP1A 4BREA 4W5NA 2UXBK 3SCXA 2Z1GA 4O8UA 5I9EB 4E7HA 2YCHA 2WOMA 4LF5K 1VSKA 5AQFA 1NGBA 1NK7A 3L0QA 1JKHA 3PSIA 4DUYK 3NGZA 3SYZA 2YHWA 3P83D 2A41A 3WQTA 1TKZA 2VWKA 4DTUA 4B1ZA 2IGIA 3ULDA 4MDAA 3KZBA 4A5BA 1NJYA 3O9QA 2RE2A 3CJBA 2A1SA 4DTPA 3SK3A 3G25A 2KLAA 4BY9C 3OYLA 3SQ4A 5MLCQ 5GADP 4KHSA 3ID6A 3OYHA 2PFUA 3VEOA 2Q2RA 3ATUA 3VQ8A 4B1XB 1B92A 3CJ1A 3TABA 5CY4A 1WSHA 2YHBA 2NRZA 1UWBA 1IV0A 1VK0A 1SL1A 2O8EB 3L4QA 3MMVA 4AHSA 5AZIB 3NAEA 4H5RA 1CXQA 3ULEB 3RWUA 5JS2A 1GLAG 3PX6A 1HR0K 1BISA 3AVHA 3M5RA 4JS5A 1J5EK 5FDLA 4MDBA 1N32K 5AQGA 2XY8A 4H0YB 1NGJA 4E3SA 4F2RA 1NLVA 3AA2A 4B3MK 2IAJA 5AR0A 4CGIA 4FWKA 1NM1A 3CIPA 3GG4A 3KKSA 3KD1E 3CFOA 3GE1A 3DRRA 4L3QA 4DU4A 1YJ9N 2DPNA 1M90O 1T7PA 3KTQA 3FFKB 1QZ5A 1ZBIA 3HT3A 3V9WA 4F4KA 3SAHA 4M3TA 2NLXA 4DKWA 4M3RA 4CBWA 4I6MA 2E2QA 1W97L 3BF3A 3V1QA 3QO9A 5KPRA 2YNIA 4B3RK 1C1AA 3LP3A 2NZTA 2XO7A 2V7YA 4OGCA 2FBVA 2HF4A 1DT9A 2QXFA 4A2BA 3E9LA 3J7YP 1TL1A 3TWHA 3MK6A 2B4JA 4PKGA 4NCAA 4X62K 3SQ1A 4IOCL 3TAFA 3TAEA 2V52B 3BY5A 5FLXO 3QLHA 4CGDA 1ZBFA 3V1OA 1WSEA 3F2KA 2H3GX 5AFUH 3RRHA 1QSSA 4PKHA 2QXLA 4IDHA 1XNQK 4JV5K 4KFBA 1VQ6N 3DOKA 2BGGA 1U47A 2GWKA 4IZ9A 4XIUA 1IG9A 2ATQA 3L2QA 2QI2A 3OHRA 3O9RA 2IS3A 2D5RA 1X9SA 3HM9A 4DFMA 4IFVA 1WSGA 4WF9L 3OYBA 2RF2A 4KHPK 5KPZA 3I33A 4IO9L 2KHOA 4CJKA 3QEVA 2PY5A 4FYDA 2WUSA 2EWSA 3T1HK 3PIPL 3T3FA 4KTZA 5ELZA 2FBYA 1W0HA 1RGIA 3CJ7A 3FZFA 1NJWA 2YI1A 4CEEA 1QQCA 1QHTA 4NCGA 1S9EA 4CEZA 5F0XA 4AILC 1W7AA 4KI6A 1HPZA 4CJLA 3O6WA 4QAGA 5BN9A 2P9SB 5BRFA 1GLEG 1T3VA 2P9UB 3N4QA 4CESA 4JI7K 2HBJA 5C2DA 3DLLL 2O8CB 2AA4A 5DMRA 4OKKA 4E7LA 2E5LK 1S1WA 3HSTB 4BR7A 1LCUA 1D4XA 1SQKA 4M3WA 4E7JA 4FLWA 3M8RA 3L6QA 4ILHA 2G8KA 4DFKA 4FWLA 4FK0A 3FGUA 1C0MA 2Q1NA 3VF4A 3OA9A 3ZSXA 1U48A 2ITMA 4E89A 1OH8A 2A3ZA 2A1RA 3ZCMA 3QFPA 3FFIA 2I7PA 1KVBA 5EVZA 4EZ6A 3SV4A 3DLGA 4DTOA 2ZE2A 4DCHA 4FO0A 2GELA 3JYTA 3V9UA 5JMVA 3QFUA 4JRPA 4FJ7A 2VYPA 1TKDA 4DSIA 5FRNA 1RT1A 4O4GA 1J53A 2PBDA 5AQVA 4FJMA 4CEBA 4EHUA 4IOAL 3CHWA 2FSKA 4FWPA 4DR6K 4FWMA 1REVA 5LL6Z 2X78A 2W6LA 4LSNA 2ZJPL 3TSQA 2FBXA 5M1QA 1SL2A 4WQ4A 3E9PA 4IG3A 1YF5L 4MQ3A 3HPHA 2G8WA 4C1NI 3DLKA 4YORA 3AO3A 4GW6A 3AVKA 3R3LA 5JVGL 4KHQA 3LPTA 3ITHA 4GV6A 2D4WA 2EX3A 5F2RA 2UU9K 3KIOA 1EX4A 3QINA 2F8TA 4NB4A 4JKFA 3CCLN 4M7YA 3NFAA 5BR9A 4JS4A 1HJRA 4UQGA 3THXA 2QW9A 4B1WB 4H4MA 4A57A 2O8DA 4Y1CA 4WE1A 1NOYA 4CVNE 1N36K 1RCHA 1GLLO 4H0OA 3MXMA 5DM7L 1TAUA 3TSUA 3S3OA 2HVHA 4Q5VA 3UE5A 4Z4GA 3VF6A 3DAWA 1WSJA 4DTMA 3R1XA 5HP1A 3C7NB 4JI8K 2G8UA 3C65A 3CCJN 2OZSA 3BDPA 3V6DA 3IAYA 2QWQA 4KTWA 3VPZA 1JL2A 1BIZA 1VRUA 1VSHA 1HMVA 5M1OA 4JRQA 4DG1A 3B8AX 3A5LC 4NYNA 4CJ5A 3TTCA 3O1BA 3MECA 3A5MC 3H1VX 3FE1A 2OPPA 4I9QA 4FWSA 3IUCA 3PSFA 4YDUA 4JNEA 4QS7A 4DV2K 2D0OA 4Z94A 3RMCA 1YVNA 3OYAA 4M7XA 4F9OA 5JLFA 3I55N 3KWGA 4DV3K 2QK9A 2YJEA 2HHSA 3ZEUA 1RTJA 3CC4N 3H6EA 2G8FA 2WFBA 1DKGD 1H1VA 3HVRA 4B3TK 1C0GA 4JI6K 4OO1J 1RILA 5M1NA 2A42A 4H4OA 2KKZA 1EXQA 3RMDA 1ZYQA 3PV8A 1CZAN 2P9LB 3TAGA 4A2AA
chains in the Genus database with same CATH topology
3LM9A 3VENA 4JEPA 4B9QA 5E26A 4JK7A 1VQ4N 4JD2A 1YHQN 4QS9A 1KAZA 3SAGA 1S22A 1Z6RA 1TYQA 4WFAL 2QA4N 3U8XA 2VGMA 3F5TA 3IDHA 4ILGB 4J8FA 1J6ZA 3GBTA 3M3ZA 2OANA 3MN6A 3WXKA 4BC4A 1MA9B 3GDQA 2VCPA 4PL7A 2OTJN 4YOWA 1SS6A 3T69A 5AZJA 1HKBA 3J7ZO 4BGAA 4ISFA 4WCEL 4YOTA 3CCEN 3QBXA 4OPAA 1IJJA 2QWMA 3QBWA 3G4SN 3MCPA 3VEYA 4IOXA 3D2EA 3UKUA 3CJ9A 1JCEA 3O8MA 2E2NA 4O8KA 4OPHA 3C6AA 3U9DA 4DHYA 2E88A 5BN8A 4BGBA 4A5AA 1GLBG 4IJAA 3H3OB 3SAFA 4KH6A 3IMXA 4IEIA 2JWKA 5AQQA 5ADXH 4CZHA 3RVCA 1BO5O 3LDLA 1KAXA 1E4GT 1NGDA 2Q0RA 4BRDA 1NGCA 3JXUA 4H0PA 4CZFA 5ADXA 2Q97A 3D2FB 5CR4A 4CD3A 1BDGA 3CERA 3WEEA 1K73O 5GAGP 3I8BA 1BWFO 3A5NC 5AQTA 4BRNA 3H46O 5CHIA 2E1YA 3MN5A 5EXWA 1O13A 2BH1A 2QWOA 1Y64A 3WUHA 3O80A 2OTLN 4O5FA 1IG8A 3P31A 3WQUA 3EKUA 3EE8A 3EL2A 4U67L 4FSVA 3CD6N 4A61A 3VEWA 3AY9A 2CH5A 3LDPA 2FSNA 4JK9A 5C10A 3ENOA 4BR0A 2GWJA 3HBTA 4MLEA 2BTFA 2QWRA 2I7NA 4AF1A 4BQZA 2NRRA 1HLUA 4AM7A 4JKBA 4BR9A 3M1FA 4U7BA 2CH6A 4AM6A 3MDQA 4BC3A 1JCFA 4IWVA 3CPWM 3KHYA 1JJ2M 3HRGA 2AP1A 4ISEA 4BREA 1EO1A 4BRGA 4KBOA 5AQLA 3TSPA 4CZLA 4O8UA 3ZX0A 5I9EB 3UB5A 2YCHA 2FSJA 5JLHA 5AQFA 4B1YB 3E1YA 3BF1A 1NGBA 2YHYA 2UYTA 5AQRA 3L0QA 3LDNA 2QWPA 2IVOA 3SMSA 2YHWA 3W3DA 3VMFB 2ZGYA 4FWNA 4EIAA 2A41A 1MWKA 4HTLA 2D1KA 3WQTA 5M1FA 3R9PA 5BRHA 4JN4A 2QWLA 4B1ZA 4XH5A 2IIRA 4MDAA 3KZBA 4A5BA 5GINA 1NJIO 3C7NA 2RE2A 3BP8A 3O9QA 3CJBA 4BC2A 3SK3A 4BQLA 3G25A 3OW2M 2KLAA 4BY9C 3KK7A 5GIOA 2P9NA 5EOYA 4FL9A 3ZX2A 2QEXN 4RTFD 3HZ6A 5AQUA 5MLCQ 5GADP 5BPLA 1HKCA 3ID6A 1X9JA 4RWTA 1C0FA 2PFUA 3VEOA 2Q2RA 3ATUA 3J8AA 4B1XB 2Q0UA 3CXCM 2E2OA 2QTDA 1QQOA 3AAQA 3CJ1A 4JKCA 4BRHA 2NRZA 1DGKN 1ESVA 5AQMA 1ATSA 4BRCA 1KQSM 3QDKA 1YUWA 1GLDG 3L4QA 3MMVA 4YOUA 3PIOL 4PHTX 4DQ8A 5AZIB 2P9PB 4H5RA 3MN7A 4BRAA 3ULEB 5LY3A 1GLAG 4K42A 3OBYA 3A8YA 2ASOA 2YHXA 4BRLA 3M5RA 2P9IB 3IKMA 4MDBA 5AQGA 3UKRB 1LOTB 1NGAA 4BR4A 2IVPA 4H0YB 1NGJA 4UY8O 1P8ZA 3LL3A 3MX5A 4CZKA 1NLVA 2Q36A 1VQLN 4H0XB 3WXJA 3AGRA 1TUUA 2YJFA 4K43A 3D7EO 5AR0A 2Q31A 4FWKA 1NM1A 3CIPA 3GG4A 4EHTA 4L3QA 3EKSA 3GE1A 1XC3A 3GL1A 1YJ9N 2DPNA 1ZXOA 1M90O 2NRVA 4PKIA 1ATNA 3FFKB 1QZ5A 3ID8A 3MN9A 4KH5A 4GV9A 3CETA 2NRTA 3SAHA 3O9TA 2NLXA 4K41A 4DKWA 4JHDA 2P9PA 1XQSC 2ZJRL 4CD1A 3NVKA 4CBWA 5JVHL 5FPDA 3U9ZA 3EN9A 2CGLA 4H03B 4I6MA 1YITN 1QVFM 1T6CA 5AQIA 2E2QA 3DXMA 3CCSN 5FPNA 1VQ7N 1Q18A 3A0IX 1W97L 2ASPA 2P9LA 3BF3A 3D6RA 3Q7CA 2BUPA 4IJNA 5KPRA 5KQ8A 2HF3A 2NNWA 2NZTA 5AQYA 2V7YA 3KWIA 3ENHA 2HF4A 1DT9A 4A2BA 1W2BM 1VQKN 5AQSA 3E9LA 4C1NK 3FZLA 3MK6A 3O5BA 4PKGA 5B8HA 1U2VB 5AQZA 1EQYA 5HL7L 5AQWA 1HX1A 4IEEA 5M1KA 4IOCL 2V52B 4MLHA 1NMDA 3MCAB 4Y0WA 4A62A 1K9MO 1GLJO 4ILJA 1ZC6A 1NWKA 3F2KA 3MX2A 3CCMN 2H3GX 4H0TB 5AFUH 4KH4A 3TTFA 3A5OC 2RHKA 4BC5A 5CE3A 5AFUA 1K8KB 4PKHA 1VAZA 2QXLA 4E1JA 3C0BA 4IDHA 2P9KB 5AQJA 3SBTA 5E84A 5BRDA 4GVEA 1OKJA 1VQ6N 3CI5A 4H5VA 2VWBA 5TKYA 2GWKA 4IZ9A 3H1QA 3L4IA 4BG8A 3D2FA 2QI2A 3OHRA 1VQ5N 3HTVA 3O9RA 5LJWA 4WF9L 2VGNA 4CZGA 4BVOA 3N4PA 5C0YA 5KPZA 2HMPA 3I33A 4CBXA 4IO9L 2KHOA 3CQXA 4BRMA 1U6ZA 2WUSA 2EWSA 3FZHA 4JAXA 3PIPL 3C6HA 1BU6O 3DJCA 1QVGM 1RDWX 3QMLA 5ELZA 1RGIA 3CJ7A 3T7ZA 1V4TA 2GEMA 3FZFA 1KC8O 2QWNA 4FVUA 1K8KA 3AGKA 4DB3A 5LJVA 2YI1A 5AQKA 4G9ZA 2WC9A 1K8AO 3E66A 4LC9B 1ATRA 3QB0A 4WQ5C 1NGIA 1P90A 1V4SA 1T6DA 4WQ5A 1XUPO 4FOIA 4H0VB 3ZETB 5F0XA 1ILYA 4CZJA 4IO8A 1G99A 1SZ2A 2FF3B 4FWRA 3WXMB 3O6WA 5BN9A 2P9SB 4NLBA 3P4IA 3QICA 5BRFA 1GLEG 4FPAA 2PAVA 1T3VA 2P9UB 3GOIA 1MDUB 3MWTA 4EFHA 2CGKA 3O1WA 3SBGA 2J4RA 3VGMA 3N4QA 3CC7N 4RCHA 1DEJA 4BRQA 3G6EN 3M6GA 3VOVA 2HBJA 5C2DA 3P39A 3DLLL 2YX6A 4NO7A 3VF2A 2FF6A 1X3NA 2AA4A 4CI6A 2WBNA 4BR7A 1LCUA 2F7TA 1D4XA 1SQKA 1WUAA 3AAPA 1YAGA 2NRWA 3L6QA 5BPNA 4ILHA 3EZWA 5FPMA 2JWLA 3G71N 3LDQA 2HBLA 4FWLA 3ZETA 5H1SQ 3FGUA 4ISGA 4MO5A 1YIJN 1YXQA 2Q1NA 3DWLA 4FWOA 4PL8A 3SJHA 3VF4A 3IFRA 3OA9A 3WT0A 2CGJA 5C12A 3VGLA 5M1PA 1BG3A 2ITMA 5C15A 5GIPA 4WFBL 3O9UA 3VEVA 2P9UA 5AZJB 2A3ZA 4IFEA 4GY2B 1VQMN 3VESA 4BRPA 3CMEN 3QFPA 3BEXA 4YOVA 1R59O 2I7PA 3WXLA 1QQNA 2ZF5O 5EVZA 4GNIA 1E4FT 2A6AA 3FR0A 1VQNN 3D2EB 4GV3A 3FZKA 3CCVN 4DCHA 3WXIA 4FO0A 2E1ZA 2GELA 5AZIA 5TKWA 2ZWHA 1VQ8N 2E8AA 3ULEA 5JMVA 3QFUA 1Q86O 2VYPA 2W41A 5AQNA 1VQON 3RSEB 4M63C 3CMAN 1YI2N 2NRHA 2HOEA 2P9IA 2PBDA 5AQVA 3U4LA 5AQHA 3UKRA 3CCQN 4WFNL 4EHUA 1YJNN 4IOAL 3CHWA 2FSKA 4FWPA 3CJCA 2F9WA 5EY4A 4FWMA 1S3XA 4BRKA 1VQPN 4WQ4C 3WEEB 2ZJPL 4NLCA 1QZ6A 4YOYA 2GX9A 1MWMA 1BOTO 2W40A 3TSQA 5M1QA 4FOEA 3SMPA 3VETA 5GAEP 4WQ4A 3E9PA 1OVYA 1SAZA 4CZMA 3CF5L 1BA1A 1YF5L 1WOQA 3R6MA 1NGGA 2F9TA 4XH4A 2V51B 3P38A 3R8EA 4C1NI 4YORA 4R79A 3TTDA 1HJOA 3VEXA 4EAHD 5EX5A 3VGKA 5JICA 4YOXA 1Q81O 3R3LA 3CCUN 5JVGL 4B1VA 4GV6A 5DM6L 3SLCA 3DXKB 1NGFA 2D4WA 4QS8A 2HSTA 4JKEA 3F9MA 5F2RA 2ASMA 3VERA 4FPBA 4IXCA 3RSEA 3TU5A 3HOTA 5BPMA 1BUPA 4NB4A 4JKFA 3CCLN 4M7YA 5BR9A 1GLCG 2QM1A 4BVPA 5KPTA 3K9JA 3Q7BA 1M1KO 3CQYA 2QW9A 4B1WB 3CC2N 4A57A 3NMUA 1Z05A 4C23A 3ZYYX 1HPMA 5AQPA 1NBWA 1GLLO 4H0OA 4BRFA 5DM7L 1ZBSA 1U2VA 3TPQA 4JKDA 3TSUA 3S41A 4MO4A 1YJWN 3EO3A 3OBWA 4BROA 3UE5A 1VQ9N 2A40A 3DXKA 5HOOA 4JKAA 3CJAA 3VF6A 3DAWA 1RDUA 1T44A 3R1XA 3PLAA 3C7NB 3ATVA 4CBUA 3C65A 3O4WA 3CCJN 1KAYA 1X3MA 2V7ZA 5FPEA 3ZX3A 4BG9A 2ZJQL 2P9KA 4XEIA 2P9NB 2QWQA 1QQMA 4FWQA 2E2PA 3VPZA 3ZEUB 2FLOA 1JCGA 4H5NA 4A59A 5M1OA 2NRXA 3B8AX 3LM2A 3A5LC 2ZGZA 4CZIA 1N8RO 4B1UB 3CCRN 3E9OA 2HBMA 3CPEA 3TTCA 3I56N 3O1BA 4CJ7A 3A5MC 3H1VX 3FE1A 3HOSA 1S72N 3O08A 2GTDA 3LDOA 2GUPA 4FWSA 4JK8A 4YDUC 3HM8A 3IUCA 4YDUA 1NGEA 4JNEA 3O9SA 4BR2A 5AQOA 3FZMA 4JKGB 4QS7A 2E20A 1QHAA 2D0OA 3FLCO 4Z94A 1Q82O 1YVNA 5AQXA 4WYBA 4BRIA 4M7XA 4F9OA 5C2FA 2IVNA 5JLFA 1HUXA 1TUYA 3AARA 4K25A 3KVGA 3I55N 1KD1O 1BA0A 1KXPA 4JD2B 2FXUA 2HBKA 3KWGA 4HWIA 1TYQB 2YJEA 1GLFO 4H5WA 3ENBA 3ZEUA 5GAHP 3CC4N 3H6EA 3JS6A 3HI0A 3VTIA 2WFBA 1DKGD 4CZEA 2P9SA 1H1VA 1NGHA 5BREA 4JKHA 1RFQA 1C0GA 4OO1J 5KQDA 4XH1A 3VTHA 3BUZB 3W0LA 5M1NA 4JHDB 3K9KA 5F1XA 3EE9A 2A5XA 2A42A 3H45C 3MWPA 2KKZA 1Q7YO 4I6MB 1HKGA 4JKGA 2D0PA 3H3NO 4H5TA 3HSCA 3DXMB 3NVMA 3UKUB 4BR5A 1CZAN 2P9LB 3VEZA 4A2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU N;  5JVG L;  2QEX N;  5DM6 L;  4WF9 L;  1VQ4 N;  5MLC Q;  5GAD P;  1YHQ N;  4IO9 L;  4WFA L;  2QA4 N;  3CXC M;  3PIP L;  1QVG M;  1KC8 O;  3CCL N;  1KQS M;  2OTJ N;  3PIO L;  1M1K O;  3CC2 N;  1K8A O;  3J7Z O;  4WCE L;  3CCE N;  1ILY A;  3G4S N;  5DM7 L;  1YJW N;  4UY8 O;  1VQ9 N;  1VQL N;  3CC7 N;  3G6E N;  3DLL L;  1M90 O;  1YJ9 N;  3CCJ N;  2ZJQ L;  1K73 O;  5GAG P;  2ZJR L;  5JVH L;  1QVF M;  1YIT N;  3G71 N;  3CCS N;  5H1S Q;  2OTL N;  1VQ7 N;  1YIJ N;  1N8R O;  3CCR N;  4U67 L;  3CD6 N;  3I56 N;  1S72 N;  4WFB L;  1W2B M;  1VQM N;  3CME N;  1Q82 O;  5HL7 L;  1VQN N;  3CCV N;  4IOC L;  3CPW M;  1JJ2 M;  3I55 N;  1KD1 O;  1K9M O;  1VQ8 N;  1Q86 O;  3CCM N;  5GAH P;  1VQO N;  3CC4 N;  3CMA N;  1YI2 N;  4WFN L;  1YJN N;  4IOA L;  1VQP N;  2ZJP L;  1VQK N;  5GAE P;  1OVY A;  3CF5 L;  1VQ6 N;  1NJI O;  1Q7Y O;  3OW2 M;  1VQ5 N;  3CCQ N;  1Q81 O; 
#chains in the Genus database with same CATH topology
 3VEN A;  3VQ6 A;  4IBN A;  3L3U A;  4JK7 A;  4QS9 A;  1KAZ A;  3SAG A;  1S22 A;  4CFB A;  1TYQ A;  3U8X A;  3AO4 A;  1L3T A;  1Y97 A;  4RW4 A;  3F5T A;  4M41 A;  4ILG B;  1EWQ A;  2OAN A;  4C8K A;  4X66 K;  3MXJ A;  3GDQ A;  1WAJ A;  1VSF A;  4ISF A;  3CCE N;  4R5P A;  2D0A A;  3MCP A;  4OKJ A;  4DHY A;  3SUN A;  4BGB A;  2F8S A;  3SPY A;  1KCF A;  5AQQ A;  1NGD A;  1C0T A;  1NGC A;  3JXU A;  4CZF A;  2Q97 A;  3QER A;  4CD3 A;  1BDG A;  3WEE A;  4FM1 A;  3LZI A;  3I8B A;  3ZSW A;  4OLB A;  5CHI A;  3MN5 A;  3S9H A;  1HNW K;  2IDO A;  2UXC K;  4EP4 A;  3LP0 A;  4ICL A;  3JAM O;  4M45 A;  4O5F A;  1IG8 A;  3WQU A;  4FM0 A;  4DQQ A;  1C6V A;  3WNG A;  4FXD A;  3OY9 A;  3THY A;  4A61 A;  3OYE A;  1KSP A;  1Q9X A;  3HXM A;  5C10 A;  3ENO A;  1HNI A;  2Y1I A;  4GVM A;  2I7N A;  3OS2 A;  2XY7 A;  1HLU A;  2DFF A;  1IBK K;  4KHN A;  3MDQ A;  3VQB A;  3KHY A;  1RT2 A;  3HRG A;  3LAK A;  4C8O A;  4BRG A;  3CM6 A;  3L8B A;  3TSP A;  2PZS A;  2ETJ A;  1RDC A;  3ZX0 A;  1VSD A;  2XY6 A;  5J2Q A;  5JLH A;  3VQQ A;  4I2Q A;  4N76 A;  5AQR A;  2UYT A;  4DTX A;  3M8P A;  3SMS A;  3W3D A;  3M8S A;  4EIA A;  1MWK A;  5BRH A;  4JN4 A;  4XH5 A;  1NJI O;  4BC2 A;  4FK2 A;  3LWM A;  5LMU K;  4LH4 A;  3KK7 A;  1JL1 A;  4FW2 A;  3ZX2 A;  3U6F A;  3THW A;  5BPL A;  1C0F A;  4RW6 A;  4B8C A;  3J8A A;  1WBD A;  4V19 S;  1YTU A;  2QTD A;  2AJQ A;  3M8Q A;  4BRH A;  1KLM A;  4G1Q A;  4YOU A;  4KHY A;  4PHT X;  1L3U A;  5IWA K;  1RT6 A;  1JLE A;  3OBY A;  1ZBH A;  4BRL A;  2P9I B;  3UKR B;  4DUZ K;  1NGA A;  3VQE A;  4UY8 O;  1P8Z A;  3LL3 A;  3WNF A;  2Q36 A;  3NBP A;  1VQL N;  2UUB K;  3WXJ A;  3AGR A;  2YJF A;  4FJX A;  4EHT A;  1LW2 A;  4DMN A;  1ZXO A;  1S1X A;  2O8E A;  5A2Q O;  3CET A;  4CJV A;  2NRT A;  1S1T A;  3O9T A;  4JHD A;  4BWM A;  2ZJR L;  1XQS C;  1OH5 A;  5JVH L;  2HNY A;  4H03 B;  1YIT N;  1QVF M;  5FPN A;  3RRG A;  3Q7C A;  4IJN A;  4ELT A;  4ELV A;  2IOC A;  1FK9 A;  5KQ8 A;  4DTR A;  2NNW A;  3EEQ A;  3ENH A;  2O8B B;  5AQS A;  4C1N K;  4LF4 K;  1VHX A;  4DQI A;  2O4I A;  3QEX A;  1ITG A;  5M1K A;  1YT3 A;  5I42 A;  4A62 A;  3OYK A;  2IC3 A;  3K5N A;  3MX2 A;  3CCM N;  4H0T B;  5SZT A;  4DQS A;  4BC5 A;  3J7A P;  4DV5 K;  1NKB A;  1K8K B;  4E1J A;  2P9K B;  5AQJ A;  3SBT A;  5E84 A;  4JI4 K;  5FRM A;  5BR8 K;  4Z4I A;  3CI5 A;  2VWB A;  5TKY A;  1NNE A;  3H1Q A;  4E1N A;  3D2F A;  3K5M A;  3HTV A;  3T1Y K;  5LJW A;  1HQE A;  1XWL A;  4BVO A;  1L5U A;  1U04 A;  2O4G A;  4CBX A;  1JLQ A;  4JAX A;  4BE0 A;  1BU6 O;  3TR8 A;  1KC8 O;  1RDW X;  3QML A;  2Z1I A;  1V4T A;  2GEM A;  5LJV A;  5AQK A;  2WC9 A;  1JLA A;  1NGI A;  3O3H A;  1HRH A;  4PA1 A;  3OYM A;  1XUP O;  4CHQ A;  4FWR A;  3K5L A;  4CED A;  3WXM B;  4NLB A;  3P4I A;  3K59 A;  4HCC A;  4CJU A;  3GOI A;  5IT9 O;  4EFH A;  3CC7 N;  3HK2 A;  4RCH A;  4BRQ A;  1FKP A;  3M6G A;  3P39 A;  3NH2 A;  2YX6 A;  2FF6 A;  3C6U A;  4CI6 A;  2WBN A;  4W5Q A;  1RBT A;  1NJZ A;  1RBV A;  4KRE A;  3AAP A;  1YAG A;  5I3U A;  1KRP A;  5FPM A;  3G71 N;  5H1S Q;  4Q0B A;  2HHU A;  1KVA A;  4DF4 A;  4W5T A;  2KW4 A;  3WT0 A;  3VGL A;  5M1P A;  1JXB A;  2P9U A;  5CYM A;  3VES A;  4CEA A;  4BRP A;  1HYZ A;  4OLA A;  1JLG A;  3BEX A;  4YOV A;  1R59 O;  1QTM A;  2GV9 A;  3DYA A;  2O8C A;  4GV3 A;  3FZK A;  4ELU A;  4DR5 K;  4DLG A;  3I0S A;  2E8A A;  2E4L A;  1U4B A;  3QIO A;  4M63 C;  1KFD A;  3CMA N;  1YTA A;  2HOE A;  5AQH A;  1YJN N;  1BI4 B;  1HYS A;  1S3X A;  4BRK A;  4CHN A;  4J2D A;  1VQP N;  4WQ4 C;  4ID5 A;  1TVR A;  1QZ6 A;  4NLC A;  2GX9 A;  3DI6 A;  1BOT O;  4FOE A;  4CZM A;  1ASV A;  3R6M A;  4XH4 A;  2V51 B;  3DLH A;  1ZBU A;  3TTD A;  4EAH D;  4BDP A;  1Q81 O;  4B1V A;  3AO1 A;  3SLC A;  4M3X A;  4QS8 A;  2HST A;  3AVG A;  1U49 A;  2ASM A;  3NF7 A;  4FPB A;  4IXC A;  3TU5 A;  5SWM A;  4FJK A;  2X6N A;  4MFB A;  5J2M A;  1GLC G;  2QM1 A;  5KPT A;  3Q7B A;  3CQY A;  2G8I A;  3B6O A;  2B6A A;  1I39 A;  4C23 A;  1J5O A;  3DMJ A;  5AQP A;  3P1G A;  1XHX A;  3HO1 A;  4HTU A;  1U2V A;  4JKD A;  1A5V A;  3KJV A;  3S41 A;  4E0D A;  1YJW N;  3EO3 A;  3OBW A;  3NDK A;  3LPU A;  2LSN A;  3QEP A;  4B9N A;  1SKS A;  1T44 A;  3PLA A;  1J54 A;  2RKI A;  1B9F A;  2V7Z A;  5FPE A;  3ZT2 A;  3LAN A;  3SUP A;  4JI1 K;  4FLV A;  4DTN A;  3CG7 A;  4FWQ A;  4I2P A;  5HRO A;  4A59 A;  3NE6 A;  4CGH A;  4CF8 A;  3LM2 A;  3K57 A;  4LD0 A;  3E9O A;  2HBM A;  1RTH A;  1CLQ A;  5KGX A;  4E1M A;  3O08 A;  1E3M A;  2GUP A;  4YDU C;  3C6T A;  3NGI A;  3KLE A;  1GOB A;  4BR2 A;  5AQO A;  4JKG B;  2E20 A;  1QHA A;  3FLC O;  3NF8 A;  3VQ4 A;  2PYL A;  4BRI A;  4J2B A;  3KVG A;  3ASM A;  4HWI A;  4JLH A;  4FJ5 A;  1S1U A;  3E01 A;  1NK8 A;  3JS6 A;  3HI0 A;  3VTI A;  4CZE A;  5BRE A;  4JKH A;  4K8X A;  3VQP A;  5KQD A;  1T05 A;  2G8V A;  3PY8 A;  3K9K A;  3DLB A;  3UIQ A;  3EE9 A;  2A5X A;  3H45 C;  4I6M B;  4H5T A;  1B9D A;  3RR7 A;  1VSJ A;  2JLE A;  3ZSQ A;  2Z1J A;  3LM9 A;  4B9Q A;  5E26 A;  2GBZ A;  4RW8 A;  3LAM A;  1VQ4 N;  4F3T A;  1YHQ N;  3CQ8 A;  3D45 A;  2QA4 N;  4B9T A;  4BDY A;  2VGM A;  4LH5 A;  4J8F A;  1OH7 A;  3GBT A;  3M3Z A;  3SJJ A;  4LF8 K;  4BC4 A;  4N56 A;  1MA9 B;  2Y1J A;  2VCP A;  5AZJ A;  4CHY A;  1HKB A;  1ASU A;  4DU3 A;  4YOT A;  3QBX A;  2XHB A;  1WLJ A;  3D2E A;  3SZ2 A;  4BE1 A;  4OPH A;  2BAN A;  1RT7 A;  4BAC A;  1OH6 A;  5CZ1 A;  3AVN A;  3H3O B;  3IMX A;  2W6K A;  5ADX H;  4CZH A;  1BO5 O;  3LDL A;  1S5J A;  2JGU A;  4H0P A;  5CR4 A;  2ZQB A;  1QSY A;  3A5N C;  5AQT A;  3H46 O;  4CJ4 A;  1O13 A;  2BH1 A;  3WUH A;  2UXD K;  4DTJ A;  4LFA K;  2R7Y A;  4U67 L;  4FSV A;  3ZLJ A;  3VEW A;  3PX0 A;  1N6Q A;  3AVB A;  3HP6 A;  1IKV A;  3AO5 A;  3LDP A;  2P5G A;  1SL0 A;  4BR0 A;  2E6L A;  1RT5 A;  2GWJ A;  4MLE A;  2QWR A;  3G10 A;  3M1F A;  4BR9 A;  4F8R A;  2CH6 A;  4AM6 A;  4BC3 A;  4CK1 A;  4KBO A;  3UB5 A;  4NXM K;  2FSJ A;  5HLF A;  3VA3 A;  3O4N A;  4B1Y B;  4CF1 A;  4E7I A;  3AVL A;  2QWP A;  2IVO A;  3D0P A;  2ZGY A;  4FWN A;  4HTL A;  4B08 A;  4N47 A;  2D1K A;  5M1F A;  3SNN A;  4YNQ A;  1RTI A;  3QNN A;  1EWR A;  2IIR A;  5GIN A;  2OZM A;  1EKE A;  3OW2 M;  5CYQ A;  5T7B A;  2P9N A;  4FL9 A;  5AQU A;  3HZ6 A;  4B3S K;  1NJX A;  5CZ2 A;  4RWT A;  2Q0U A;  4CF0 A;  2HHQ A;  2E2O A;  3AAQ A;  1QQO A;  4JKC A;  3BZK A;  1DGK N;  4BRC A;  1ATS A;  4CFD A;  3QDK A;  4K0K K;  1YUW A;  1GLD G;  4Y1D A;  3PIO L;  4FJJ A;  1C1B A;  4DQ8 A;  3VQC A;  2P9P B;  4K42 A;  2HHT A;  1BHL A;  2YHX A;  3ZSY A;  5HRN A;  4BR4 A;  4GMJ B;  2D0C A;  2IVP A;  1WNS A;  4FJL A;  3O3F A;  3MX5 A;  4CZK A;  4BDZ A;  1CZB A;  1TKT A;  4FW1 A;  3AVF A;  4BE2 A;  1JLC A;  2Q31 A;  3TI0 A;  1LAW A;  1BIU A;  1I94 K;  1XC3 A;  1NK6 A;  3ID8 A;  4KH5 A;  1LWE A;  4GV9 A;  4K41 A;  2DY4 A;  5FPD A;  4O44 A;  1IKW A;  1T6C A;  5AQI A;  3DXM A;  3CCS N;  1TAQ A;  1VQ7 N;  2XRI A;  2ASP A;  3D6R A;  1WAF A;  2BUP A;  1N34 K;  4LF6 K;  5AQY A;  4LY7 A;  3KWI A;  4KB1 A;  3THX B;  4LF7 K;  3O4Q A;  4RW7 A;  2HNZ A;  3PUF A;  4K8Z A;  2O8D B;  3SV3 A;  2HHV A;  3FZL A;  4DR1 K;  3O5B A;  4CGG A;  5AQZ A;  5HL7 L;  1EQY A;  1TK5 A;  2YV0 X;  1HX1 A;  3VA0 A;  4MLH A;  4F3O A;  3MCA B;  1KFS A;  3RMB A;  1K9M O;  1GLJ O;  4W5R A;  4ILJ A;  1NWK A;  1SKW A;  1ZBL A;  3TTF A;  4CGJ A;  5AFU A;  4DWI A;  4CEQ A;  3C0B A;  4AH9 A;  4GVE A;  1TK8 A;  5E41 A;  3I8D A;  5HRR A;  3V1R A;  1VQ5 N;  4FJG A;  1C1C A;  3DRP A;  2VGN A;  3L2R A;  3V9S A;  4E7K A;  5C0Y A;  2HMP A;  2VWJ A;  3CQX A;  3L2U A;  3FZH A;  4YFU A;  3SPZ A;  1Z25 A;  1RBU A;  3T7Z A;  4CK2 A;  3NF6 A;  1K8K A;  1L3S A;  4DB3 A;  4CFA A;  2VG6 A;  1K8A O;  3E66 A;  1ATR A;  3IS9 A;  4IG0 A;  4WQ5 A;  4H0V B;  3QNO A;  3ZET B;  1ILY A;  1RT3 A;  4CF2 A;  1G99 A;  2OYQ A;  1SZ2 A;  4BWJ A;  2BDP A;  4W5O A;  3LP1 A;  1X1P A;  4M3Y A;  3QIC A;  4CHZ A;  2FBT A;  4FJ9 A;  2CGK A;  3SBG A;  2J4R A;  3VGM A;  3G6E N;  3TAR A;  4NO7 A;  4KAZ A;  3VF2 A;  3MXI A;  3HPG A;  3NCI A;  3RTV A;  1WUA A;  4DSJ A;  5C25 A;  1S6Q A;  4HCB A;  1FXX A;  4ZTF A;  2NRW A;  4YHH K;  1GOC A;  4ISG A;  4MO5 A;  1YIJ N;  4DSK A;  1YXQ A;  3OS1 A;  4PL8 A;  1XNR K;  3IFR A;  1Q8I A;  2CGJ A;  5C12 A;  1BG3 A;  4WFB L;  5GIP A;  3O9U A;  1HNV A;  4IFE A;  1S9G A;  2HND A;  4GY2 B;  1VQM N;  3WXL A;  1QQN A;  3I0R A;  4CIF A;  3ISN C;  4GNI A;  4TSX A;  2P1J A;  4FCY A;  5C24 A;  4CF9 A;  4JI3 K;  3CCV N;  1HQU A;  2YKN A;  3WXI A;  5AZI A;  3ZSV A;  5TKW A;  2ZWH A;  3ULE A;  3IRX A;  3AV9 A;  2OPR A;  5AQN A;  3RSE B;  1RDA A;  3C94 A;  1YI2 N;  1NK5 A;  2NRH A;  2VG7 A;  4FLZ A;  4KV8 A;  3CJC A;  2F9W A;  1KLN A;  3WEE B;  1KVC A;  1Z26 A;  1NKC A;  4YOY A;  4FJH A;  1VQK N;  3VET A;  5GAE P;  3SI6 A;  1OVY A;  1SAZ A;  2ZD1 A;  1Q9Y A;  2F9T A;  3SUO A;  4Z4F A;  3P38 A;  1NU0 A;  1HJO A;  3VEX A;  1S1V A;  5JIC A;  3ZT1 A;  3CCU N;  4CEC A;  4FK4 A;  5JS1 A;  3S3N A;  3DXK B;  1NGF A;  3F73 A;  4JKE A;  1N5Y A;  3F9M A;  3J81 O;  3VER A;  1O1W A;  1VSL A;  2I5J A;  4L8R B;  1HNZ K;  1BI4 A;  1UAX A;  3THV A;  4BVP A;  3SQ2 A;  1M1K O;  3NMU A;  1RBR A;  3CYM A;  3ZYY X;  1HPM A;  1NBW A;  3QIP A;  5HRP A;  4AQY K;  4CJP A;  4F2S A;  2WTU A;  3VQ7 A;  2OCE A;  4MO4 A;  5HOO A;  3OVN A;  3VQ9 A;  4DU1 A;  4Z4H A;  1RDU A;  4DFP A;  4CBU A;  3O4W A;  1RDB A;  1JXE A;  3ZX3 A;  5C42 A;  4XEI A;  4FZZ A;  3PO5 A;  2RPI A;  3H08 A;  1QQM A;  4Z0U A;  1TL3 A;  2E2P A;  3EYZ A;  1JCG A;  4H5N A;  3DM2 A;  3LAL A;  4Z4C A;  2NRX A;  4QOZ B;  4KB0 A;  3ZT4 A;  2ZGZ A;  3QET A;  4DV0 K;  4B1U B;  3I56 N;  4DS5 A;  3HOS A;  4M3Z A;  2GTD A;  3LDO A;  4JK8 A;  2O8F B;  3OJU A;  2E6M A;  1NGE A;  3FZM A;  2B5J A;  4HHT A;  4WYB A;  4HUF A;  3DRS A;  1TUY A;  3AAR A;  1D9F A;  4LFB K;  4JD2 B;  2WON A;  3PO4 A;  5J2N A;  3L3V A;  4EP5 A;  3A2F A;  4H5W A;  3ENB A;  5KRS A;  5GAH P;  4AHU A;  2UUC K;  3HVT A;  4B9V A;  1U45 A;  2D0B A;  4KKO A;  4YY3 K;  3CFP A;  4LSL A;  2P9S A;  1NGH A;  1RFQ A;  4B9S A;  3TAQ A;  1DLO A;  4XH1 A;  5KTQ A;  3BUZ B;  2YHA A;  4JHD B;  4CJW A;  3MED A;  4CEO A;  4M3U A;  3MWP A;  1JLF A;  3VQD A;  1HKG A;  4JKG A;  2D0P A;  3HSC A;  4O0J A;  3NVM A;  3UKU B;  4YOW A;  4CCH A;  4JEP A;  3K5O A;  1K6Y A;  1F21 A;  4CIE A;  1Z6R A;  2UUA K;  1CXU A;  4B3O A;  3IDH A;  3MN6 A;  4PUO A;  4PY5 A;  4PL7 A;  2OTJ N;  3T69 A;  4DQR A;  4BGA A;  4C8M A;  4OPA A;  4KPY A;  1IJJ A;  3KK2 A;  3B6P A;  3G4S N;  4IOX A;  3CJ9 A;  4NYF A;  4O8K A;  2G8H A;  3C6A A;  5BN8 A;  1NG9 A;  3RMA A;  4DFJ A;  4A5A A;  4IJA A;  4OX9 K;  4KH6 A;  4IEI A;  2JWK A;  4GKJ K;  4FJI A;  2Q0R A;  4BRD A;  3CM5 A;  3D2F B;  3AVI A;  3NHG A;  3CER A;  1LW0 A;  3TAM A;  1K73 O;  5GAG P;  4BRN A;  1QS4 A;  2E1Y A;  2YKM A;  4FLX A;  3V4I A;  1EET A;  4JYA K;  1Y64 A;  1RNH A;  3DLR A;  1R0A A;  3O80 A;  2OTL N;  3P31 A;  4JI5 K;  3CD6 N;  1RT4 A;  3NGY A;  3AY9 A;  4J2E A;  3V9X A;  5DK5 A;  2VQE K;  2FSN A;  4OPJ A;  1I3A A;  1LWF A;  1NK9 A;  2BTF A;  4BQZ A;  2NRR A;  4CIG A;  4AM7 A;  4EZ9 A;  4U7B A;  5K14 A;  4KO0 A;  1NKE A;  4LF9 K;  4CJE A;  1XMQ K;  1JJ2 M;  4ISE A;  1D9D A;  4QCL A;  5AQL A;  4DV4 K;  4O55 A;  4CZL A;  4CGF A;  3MAQ A;  1WBB A;  4FJ8 A;  1LAV A;  1IO2 A;  3E1Y A;  3BF1 A;  2YHY A;  4H8K A;  1W9H A;  3LDN A;  4CFC A;  3ZSR A;  2KTQ A;  3VMF B;  1L3V A;  2XY5 A;  3R9P A;  2QWL A;  3C7N A;  3BP8 A;  4CJQ A;  4BQL A;  4DS4 A;  4IKF A;  1HYV A;  1GOA A;  2VG5 A;  5GIO A;  3LP2 A;  1WN7 A;  4X64 K;  5EOY A;  4B9U A;  5HRS A;  5FRO A;  3OYC A;  2QEX N;  2X74 A;  4RTF D;  1XC9 A;  1BL3 A;  1HKC A;  1RDD A;  4OJR A;  1X9J A;  4CEF A;  3RR8 A;  1IH7 A;  3CXC M;  3WNH A;  4PWD A;  1HNX K;  1ESV A;  5AQM A;  2VQF K;  1TK0 A;  1KQS M;  4ID1 A;  4IDK A;  3MN7 A;  4BRA A;  5LY3 A;  2HW3 A;  4ZHR A;  3A8Y A;  1A5X A;  4LFC K;  2ASO A;  3IKM A;  1LOT B;  2Z1H A;  4B9M A;  4H0X B;  1TUU A;  4K43 A;  3D7E O;  3EKS A;  3BZC A;  3GL1 A;  1N33 K;  2NRV A;  4PKI A;  1ATN A;  4FLY A;  3MN9 A;  4B8A B;  1IBL K;  1VSI A;  3KLG A;  2P9P A;  4CD1 A;  3NVK A;  2KFZ A;  3U9Z A;  3EN9 A;  2CGL A;  1OVQ A;  1Q18 A;  3A0I X;  2P9L A;  4DR3 K;  4CJF A;  1CZ9 A;  2HF3 A;  1NK4 A;  3OYD A;  4OVL A;  1W2B M;  3AVC A;  3QEI A;  2KZM A;  4OGE A;  4DV1 K;  2NUB A;  4DSL A;  5B8H A;  4NXN K;  2QKB A;  1U2V B;  5AQW A;  4E19 A;  4IEE A;  3AO2 A;  1NMD A;  4Y0W A;  2X6S A;  1ZC6 A;  1DTQ A;  2ITG A;  3KK1 A;  1C0U A;  4OPK A;  3SQ0 A;  3HP9 A;  4RW9 A;  4KH4 A;  1NK0 A;  3A5O C;  2RHK A;  1IKY A;  2HVI A;  5CE3 A;  3V81 A;  1VAZ A;  1VSM A;  2EHG A;  1LV5 A;  1BQN A;  5BRD A;  1OKJ A;  3NH1 A;  4H5V A;  4HVJ A;  1UA0 A;  4CHO A;  2F96 A;  3L4I A;  3KLI A;  4BG8 A;  1BGX T;  4CZG A;  3N4P A;  3AVM A;  4BRM A;  1U6Z A;  2HHH K;  4GKK K;  3C6H A;  3DJC A;  1QVG M;  4FVU A;  2QWN A;  3AGK A;  1VRT A;  4G9Z A;  4LC9 B;  4WQ5 C;  3QB0 A;  1D8Y A;  1P90 A;  1V4S A;  1T6D A;  2FC0 A;  4FOI A;  4C8L A;  4CZJ A;  4IO8 A;  4HUG A;  3IG1 A;  2FF3 B;  3KLH A;  5D3G A;  2F4V K;  4FPA A;  1UOC A;  2PAV A;  3EZ5 A;  1FJG K;  2OPS A;  1MDU B;  1SUQ A;  3MWT A;  3O1W A;  2OPQ A;  1DEJ A;  3DLE A;  4FLU A;  3VOV A;  4AHC A;  1SKR A;  3F9K A;  4AHT A;  3V9Z A;  3EY1 A;  4CW7 B;  1X3N A;  2ZM6 K;  4N41 A;  3O3G A;  3CFR A;  1WB9 A;  1SV5 A;  2F7T A;  3SUQ A;  5BPN A;  4O0I A;  3EZW A;  2JWL A;  3LDQ A;  2HBL A;  3ZET A;  2W42 A;  3DWL A;  4FWO A;  3SJH A;  5C15 A;  2GUI A;  3J80 O;  3VEV A;  5AZJ B;  3CME N;  3VQA A;  4FVM A;  2ZF5 O;  3OYI A;  1E4F T;  1G15 A;  2A6A A;  3FR0 A;  1VQN N;  3D2E B;  3AA4 A;  5KGW A;  1WSF A;  3LDS A;  1LWC A;  3HPO A;  2E1Z A;  2KFN A;  2HHX A;  3VQ5 A;  1VQ8 N;  2OA8 A;  3AVJ A;  1Q86 O;  1FKO A;  2W41 A;  4FJN A;  3WNE A;  1VQO N;  3L2W A;  5KI6 A;  2P9I A;  3U4L A;  3UKR A;  4WFN L;  5EY4 A;  4DLE A;  1D5A A;  1MWM A;  2W40 A;  1UA1 A;  3SMP A;  3CF5 L;  1BA1 A;  1WOQ A;  1NGG A;  1QE1 A;  4AHV A;  3R8E A;  1TGO A;  4C8N A;  4R79 A;  3L2V A;  5EX5 A;  3VGK A;  4CK3 A;  4YOX A;  2PYJ A;  4CJT A;  1X9M A;  2DFE A;  5DM6 L;  4FZY A;  4DSE A;  1TV6 A;  4FLT A;  3T1A A;  3ALY A;  4FM2 A;  3P5J A;  1NOZ A;  3RSE A;  3JSM A;  2BE2 A;  3HOT A;  5BPM A;  1BUP A;  3AA5 X;  3QES A;  3U3G A;  1JLB A;  3OYF A;  3K9J A;  3OS0 A;  3K58 A;  2O8B A;  3CC2 N;  1Z05 A;  4J2A A;  1FW6 A;  4BRF A;  1NMN A;  1ZBS A;  3TPQ A;  3VN5 A;  4KTQ A;  1YVU A;  1RBS A;  2HMI A;  1T8E A;  4BRO A;  4DF8 A;  2YNF A;  1VQ9 N;  2A40 A;  3DXK A;  4CE9 A;  4JKA A;  3CJA A;  2P5O A;  5KRT A;  4KI4 A;  4I9L A;  3K0S A;  4CHP A;  1T03 A;  1QSL A;  3OTO K;  3ATV A;  3HYF A;  1KAY A;  1X3M A;  2KQ2 A;  2RN2 A;  4BG9 A;  3OYJ A;  2ZJQ L;  2P9K A;  2Q3S A;  2P9N B;  3KKR A;  4O5B A;  3TAN A;  3ZEU B;  4DR2 K;  2FLO A;  2DTU A;  3HL8 A;  4CZI A;  1N8R O;  4HUE A;  1EP4 A;  4CJS A;  4N5S A;  3CCR N;  3CPE A;  4DR4 K;  3OYG A;  4CJ7 A;  1S72 N;  4NCB A;  5J1E A;  4JI0 K;  3BGR A;  3HM8 A;  2DFH A;  5J2P A;  3O9S A;  2HHW A;  3NF9 A;  1S6P A;  3OYN A;  1Q82 O;  5AQX A;  5C2F A;  2IVN A;  4JI2 K;  1HUX A;  4FZX C;  4K25 A;  1KD1 O;  4DTS A;  1BA0 A;  1KXP A;  2FXU A;  2HBK A;  1MU2 A;  1XI1 A;  1TYQ B;  3DOL A;  1GLF O;  3QEW A;  3KK3 A;  3MEE A;  2YNG A;  1TKX A;  3KD5 E;  4CJ3 A;  1IKX A;  2HB5 A;  3MEG A;  3VTH A;  2O8F A;  3T19 A;  3W0L A;  4KRF A;  4IFY A;  5F1X A;  2KZZ A;  1Q7Y O;  1BCO A;  3ZT0 A;  3H3N O;  4Z4E A;  3DXM B;  1VSE A;  4BR5 A;  3VEZ A;  3CCQ N;  1X9W A;  4OKE A;  3ZT3 A;  3PX4 A;  4JD2 A;  1DTT A;  4DV7 K;  1XMO K;  4DSF A;  4WFA L;  1J9A A;  1J6Z A;  5HBM A;  3HJF A;  3WXK A;  2YNH A;  1SS6 A;  4CJR A;  4DQP A;  3J7Z O;  4WCE L;  3LWL A;  4X65 K;  1RTD A;  2QWM A;  3QBW A;  1WSI A;  4ZTJ A;  3ZSZ A;  3VEY A;  3U3Y A;  3UKU A;  1JCE A;  3O8M A;  3THY B;  2E2N A;  3U9D A;  3LZJ A;  2E88 A;  3C95 A;  4CER A;  1ASW A;  4M42 A;  1GLB G;  3SAF A;  4I7F A;  4RG8 A;  3RVC A;  1KAX A;  1E4G T;  5EU7 A;  4B9L A;  5ADX A;  1A5W A;  4AHR A;  4DR7 K;  1BCM A;  1BWF O;  3OJS A;  3TAP A;  5EXW A;  3NH0 A;  2QWO A;  1BQM A;  1IBM K;  3EKU A;  3EE8 A;  3EL2 A;  3K2P A;  4DV6 K;  2CH5 A;  3S3M A;  4KHW A;  4JK9 A;  3AVA A;  4PQU A;  1XHZ A;  3G0Z A;  5AJ3 K;  3HBT A;  2QKK A;  4AF1 A;  3AA3 A;  4JKB A;  3KLF A;  4KHU A;  3ZSO A;  2P51 A;  1JCF A;  4IWV A;  3THW B;  3CPW M;  5LMN K;  1KTQ A;  1EO1 A;  2AP1 A;  4BRE A;  4W5N A;  2UXB K;  3SCX A;  2Z1G A;  4O8U A;  5I9E B;  4E7H A;  2YCH A;  2WOM A;  4LF5 K;  1VSK A;  5AQF A;  1NGB A;  1NK7 A;  3L0Q A;  1JKH A;  3PSI A;  4DUY K;  3NGZ A;  3SYZ A;  2YHW A;  3P83 D;  2A41 A;  3WQT A;  1TKZ A;  2VWK A;  4DTU A;  4B1Z A;  2IGI A;  3ULD A;  4MDA A;  3KZB A;  4A5B A;  1NJY A;  3O9Q A;  2RE2 A;  3CJB A;  2A1S A;  4DTP A;  3SK3 A;  3G25 A;  2KLA A;  4BY9 C;  3OYL A;  3SQ4 A;  5MLC Q;  5GAD P;  4KHS A;  3ID6 A;  3OYH A;  2PFU A;  3VEO A;  2Q2R A;  3ATU A;  3VQ8 A;  4B1X B;  1B92 A;  3CJ1 A;  3TAB A;  5CY4 A;  1WSH A;  2YHB A;  2NRZ A;  1UWB A;  1IV0 A;  1VK0 A;  1SL1 A;  2O8E B;  3L4Q A;  3MMV A;  4AHS A;  5AZI B;  3NAE A;  4H5R A;  1CXQ A;  3ULE B;  3RWU A;  5JS2 A;  1GLA G;  3PX6 A;  1HR0 K;  1BIS A;  3AVH A;  3M5R A;  4JS5 A;  1J5E K;  5FDL A;  4MDB A;  1N32 K;  5AQG A;  2XY8 A;  4H0Y B;  1NGJ A;  4E3S A;  4F2R A;  1NLV A;  3AA2 A;  4B3M K;  2IAJ A;  5AR0 A;  4CGI A;  4FWK A;  1NM1 A;  3CIP A;  3GG4 A;  3KKS A;  3KD1 E;  3CFO A;  3GE1 A;  3DRR A;  4L3Q A;  4DU4 A;  1YJ9 N;  2DPN A;  1M90 O;  1T7P A;  3KTQ A;  3FFK B;  1QZ5 A;  1ZBI A;  3HT3 A;  3V9W A;  4F4K A;  3SAH A;  4M3T A;  2NLX A;  4DKW A;  4M3R A;  4CBW A;  4I6M A;  2E2Q A;  1W97 L;  3BF3 A;  3V1Q A;  3QO9 A;  5KPR A;  2YNI A;  4B3R K;  1C1A A;  3LP3 A;  2NZT A;  2XO7 A;  2V7Y A;  4OGC A;  2FBV A;  2HF4 A;  1DT9 A;  2QXF A;  4A2B A;  3E9L A;  3J7Y P;  1TL1 A;  3TWH A;  3MK6 A;  2B4J A;  4PKG A;  4NCA A;  4X62 K;  3SQ1 A;  4IOC L;  3TAF A;  3TAE A;  2V52 B;  3BY5 A;  5FLX O;  3QLH A;  4CGD A;  1ZBF A;  3V1O A;  1WSE A;  3F2K A;  2H3G X;  5AFU H;  3RRH A;  1QSS A;  4PKH A;  2QXL A;  4IDH A;  1XNQ K;  4JV5 K;  4KFB A;  1VQ6 N;  3DOK A;  2BGG A;  1U47 A;  2GWK A;  4IZ9 A;  4XIU A;  1IG9 A;  2ATQ A;  3L2Q A;  2QI2 A;  3OHR A;  3O9R A;  2IS3 A;  2D5R A;  1X9S A;  3HM9 A;  4DFM A;  4IFV A;  1WSG A;  4WF9 L;  3OYB A;  2RF2 A;  4KHP K;  5KPZ A;  3I33 A;  4IO9 L;  2KHO A;  4CJK A;  3QEV A;  2PY5 A;  4FYD A;  2WUS A;  2EWS A;  3T1H K;  3PIP L;  3T3F A;  4KTZ A;  5ELZ A;  2FBY A;  1W0H A;  1RGI A;  3CJ7 A;  3FZF A;  1NJW A;  2YI1 A;  4CEE A;  1QQC A;  1QHT A;  4NCG A;  1S9E A;  4CEZ A;  5F0X A;  4AIL C;  1W7A A;  4KI6 A;  1HPZ A;  4CJL A;  3O6W A;  4QAG A;  5BN9 A;  2P9S B;  5BRF A;  1GLE G;  1T3V A;  2P9U B;  3N4Q A;  4CES A;  4JI7 K;  2HBJ A;  5C2D A;  3DLL L;  2O8C B;  2AA4 A;  5DMR A;  4OKK A;  4E7L A;  2E5L K;  1S1W A;  3HST B;  4BR7 A;  1LCU A;  1D4X A;  1SQK A;  4M3W A;  4E7J A;  4FLW A;  3M8R A;  3L6Q A;  4ILH A;  2G8K A;  4DFK A;  4FWL A;  4FK0 A;  3FGU A;  1C0M A;  2Q1N A;  3VF4 A;  3OA9 A;  3ZSX A;  1U48 A;  2ITM A;  4E89 A;  1OH8 A;  2A3Z A;  2A1R A;  3ZCM A;  3QFP A;  3FFI A;  2I7P A;  1KVB A;  5EVZ A;  4EZ6 A;  3SV4 A;  3DLG A;  4DTO A;  2ZE2 A;  4DCH A;  4FO0 A;  2GEL A;  3JYT A;  3V9U A;  5JMV A;  3QFU A;  4JRP A;  4FJ7 A;  2VYP A;  1TKD A;  4DSI A;  5FRN A;  1RT1 A;  4O4G A;  1J53 A;  2PBD A;  5AQV A;  4FJM A;  4CEB A;  4EHU A;  4IOA L;  3CHW A;  2FSK A;  4FWP A;  4DR6 K;  4FWM A;  1REV A;  5LL6 Z;  2X78 A;  2W6L A;  4LSN A;  2ZJP L;  3TSQ A;  2FBX A;  5M1Q A;  1SL2 A;  4WQ4 A;  3E9P A;  4IG3 A;  1YF5 L;  4MQ3 A;  3HPH A;  2G8W A;  4C1N I;  3DLK A;  4YOR A;  3AO3 A;  4GW6 A;  3AVK A;  3R3L A;  5JVG L;  4KHQ A;  3LPT A;  3ITH A;  4GV6 A;  2D4W A;  2EX3 A;  5F2R A;  2UU9 K;  3KIO A;  1EX4 A;  3QIN A;  2F8T A;  4NB4 A;  4JKF A;  3CCL N;  4M7Y A;  3NFA A;  5BR9 A;  4JS4 A;  1HJR A;  4UQG A;  3THX A;  2QW9 A;  4B1W B;  4H4M A;  4A57 A;  2O8D A;  4Y1C A;  4WE1 A;  1NOY A;  4CVN E;  1N36 K;  1RCH A;  1GLL O;  4H0O A;  3MXM A;  5DM7 L;  1TAU A;  3TSU A;  3S3O A;  2HVH A;  4Q5V A;  3UE5 A;  4Z4G A;  3VF6 A;  3DAW A;  1WSJ A;  4DTM A;  3R1X A;  5HP1 A;  3C7N B;  4JI8 K;  2G8U A;  3C65 A;  3CCJ N;  2OZS A;  3BDP A;  3V6D A;  3IAY A;  2QWQ A;  4KTW A;  3VPZ A;  1JL2 A;  1BIZ A;  1VRU A;  1VSH A;  1HMV A;  5M1O A;  4JRQ A;  4DG1 A;  3B8A X;  3A5L C;  4NYN A;  4CJ5 A;  3TTC A;  3O1B A;  3MEC A;  3A5M C;  3H1V X;  3FE1 A;  2OPP A;  4I9Q A;  4FWS A;  3IUC A;  3PSF A;  4YDU A;  4JNE A;  4QS7 A;  4DV2 K;  2D0O A;  4Z94 A;  3RMC A;  1YVN A;  3OYA A;  4M7X A;  4F9O A;  5JLF A;  3I55 N;  3KWG A;  4DV3 K;  2QK9 A;  2YJE A;  2HHS A;  3ZEU A;  1RTJ A;  3CC4 N;  3H6E A;  2G8F A;  2WFB A;  1DKG D;  1H1V A;  3HVR A;  4B3T K;  1C0G A;  4JI6 K;  4OO1 J;  1RIL A;  5M1N A;  2A42 A;  4H4O A;  2KKZ A;  1EXQ A;  3RMD A;  1ZYQ A;  3PV8 A;  1CZA N;  2P9L B;  3TAG A;  4A2A A; 
#chains in the Genus database with same CATH homology
 3LM9 A;  3VEN A;  4JEP A;  4B9Q A;  5E26 A;  4JK7 A;  1VQ4 N;  4JD2 A;  1YHQ N;  4QS9 A;  1KAZ A;  3SAG A;  1S22 A;  1Z6R A;  1TYQ A;  4WFA L;  2QA4 N;  3U8X A;  2VGM A;  3F5T A;  3IDH A;  4ILG B;  4J8F A;  1J6Z A;  3GBT A;  3M3Z A;  2OAN A;  3MN6 A;  3WXK A;  4BC4 A;  1MA9 B;  3GDQ A;  2VCP A;  4PL7 A;  2OTJ N;  4YOW A;  1SS6 A;  3T69 A;  5AZJ A;  1HKB A;  3J7Z O;  4BGA A;  4ISF A;  4WCE L;  4YOT A;  3CCE N;  3QBX A;  4OPA A;  1IJJ A;  2QWM A;  3QBW A;  3G4S N;  3MCP A;  3VEY A;  4IOX A;  3D2E A;  3UKU A;  3CJ9 A;  1JCE A;  3O8M A;  2E2N A;  4O8K A;  4OPH A;  3C6A A;  3U9D A;  4DHY A;  2E88 A;  5BN8 A;  4BGB A;  4A5A A;  1GLB G;  4IJA A;  3H3O B;  3SAF A;  4KH6 A;  3IMX A;  4IEI A;  2JWK A;  5AQQ A;  5ADX H;  4CZH A;  3RVC A;  1BO5 O;  3LDL A;  1KAX A;  1E4G T;  1NGD A;  2Q0R A;  4BRD A;  1NGC A;  3JXU A;  4H0P A;  4CZF A;  5ADX A;  2Q97 A;  3D2F B;  5CR4 A;  4CD3 A;  1BDG A;  3CER A;  3WEE A;  1K73 O;  5GAG P;  3I8B A;  1BWF O;  3A5N C;  5AQT A;  4BRN A;  3H46 O;  5CHI A;  2E1Y A;  3MN5 A;  5EXW A;  1O13 A;  2BH1 A;  2QWO A;  1Y64 A;  3WUH A;  3O80 A;  2OTL N;  4O5F A;  1IG8 A;  3P31 A;  3WQU A;  3EKU A;  3EE8 A;  3EL2 A;  4U67 L;  4FSV A;  3CD6 N;  4A61 A;  3VEW A;  3AY9 A;  2CH5 A;  3LDP A;  2FSN A;  4JK9 A;  5C10 A;  3ENO A;  4BR0 A;  2GWJ A;  3HBT A;  4MLE A;  2BTF A;  2QWR A;  2I7N A;  4AF1 A;  4BQZ A;  2NRR A;  1HLU A;  4AM7 A;  4JKB A;  4BR9 A;  3M1F A;  4U7B A;  2CH6 A;  4AM6 A;  3MDQ A;  4BC3 A;  1JCF A;  4IWV A;  3CPW M;  3KHY A;  1JJ2 M;  3HRG A;  2AP1 A;  4ISE A;  4BRE A;  1EO1 A;  4BRG A;  4KBO A;  5AQL A;  3TSP A;  4CZL A;  4O8U A;  3ZX0 A;  5I9E B;  3UB5 A;  2YCH A;  2FSJ A;  5JLH A;  5AQF A;  4B1Y B;  3E1Y A;  3BF1 A;  1NGB A;  2YHY A;  2UYT A;  5AQR A;  3L0Q A;  3LDN A;  2QWP A;  2IVO A;  3SMS A;  2YHW A;  3W3D A;  3VMF B;  2ZGY A;  4FWN A;  4EIA A;  2A41 A;  1MWK A;  4HTL A;  2D1K A;  3WQT A;  5M1F A;  3R9P A;  5BRH A;  4JN4 A;  2QWL A;  4B1Z A;  4XH5 A;  2IIR A;  4MDA A;  3KZB A;  4A5B A;  5GIN A;  1NJI O;  3C7N A;  2RE2 A;  3BP8 A;  3O9Q A;  3CJB A;  4BC2 A;  3SK3 A;  4BQL A;  3G25 A;  3OW2 M;  2KLA A;  4BY9 C;  3KK7 A;  5GIO A;  2P9N A;  5EOY A;  4FL9 A;  3ZX2 A;  2QEX N;  4RTF D;  3HZ6 A;  5AQU A;  5MLC Q;  5GAD P;  5BPL A;  1HKC A;  3ID6 A;  1X9J A;  4RWT A;  1C0F A;  2PFU A;  3VEO A;  2Q2R A;  3ATU A;  3J8A A;  4B1X B;  2Q0U A;  3CXC M;  2E2O A;  2QTD A;  1QQO A;  3AAQ A;  3CJ1 A;  4JKC A;  4BRH A;  2NRZ A;  1DGK N;  1ESV A;  5AQM A;  1ATS A;  4BRC A;  1KQS M;  3QDK A;  1YUW A;  1GLD G;  3L4Q A;  3MMV A;  4YOU A;  3PIO L;  4PHT X;  4DQ8 A;  5AZI B;  2P9P B;  4H5R A;  3MN7 A;  4BRA A;  3ULE B;  5LY3 A;  1GLA G;  4K42 A;  3OBY A;  3A8Y A;  2ASO A;  2YHX A;  4BRL A;  3M5R A;  2P9I B;  3IKM A;  4MDB A;  5AQG A;  3UKR B;  1LOT B;  1NGA A;  4BR4 A;  2IVP A;  4H0Y B;  1NGJ A;  4UY8 O;  1P8Z A;  3LL3 A;  3MX5 A;  4CZK A;  1NLV A;  2Q36 A;  1VQL N;  4H0X B;  3WXJ A;  3AGR A;  1TUU A;  2YJF A;  4K43 A;  3D7E O;  5AR0 A;  2Q31 A;  4FWK A;  1NM1 A;  3CIP A;  3GG4 A;  4EHT A;  4L3Q A;  3EKS A;  3GE1 A;  1XC3 A;  3GL1 A;  1YJ9 N;  2DPN A;  1ZXO A;  1M90 O;  2NRV A;  4PKI A;  1ATN A;  3FFK B;  1QZ5 A;  3ID8 A;  3MN9 A;  4KH5 A;  4GV9 A;  3CET A;  2NRT A;  3SAH A;  3O9T A;  2NLX A;  4K41 A;  4DKW A;  4JHD A;  2P9P A;  1XQS C;  2ZJR L;  4CD1 A;  3NVK A;  4CBW A;  5JVH L;  5FPD A;  3U9Z A;  3EN9 A;  2CGL A;  4H03 B;  4I6M A;  1YIT N;  1QVF M;  1T6C A;  5AQI A;  2E2Q A;  3DXM A;  3CCS N;  5FPN A;  1VQ7 N;  1Q18 A;  3A0I X;  1W97 L;  2ASP A;  2P9L A;  3BF3 A;  3D6R A;  3Q7C A;  2BUP A;  4IJN A;  5KPR A;  5KQ8 A;  2HF3 A;  2NNW A;  2NZT A;  5AQY A;  2V7Y A;  3KWI A;  3ENH A;  2HF4 A;  1DT9 A;  4A2B A;  1W2B M;  1VQK N;  5AQS A;  3E9L A;  4C1N K;  3FZL A;  3MK6 A;  3O5B A;  4PKG A;  5B8H A;  1U2V B;  5AQZ A;  1EQY A;  5HL7 L;  5AQW A;  1HX1 A;  4IEE A;  5M1K A;  4IOC L;  2V52 B;  4MLH A;  1NMD A;  3MCA B;  4Y0W A;  4A62 A;  1K9M O;  1GLJ O;  4ILJ A;  1ZC6 A;  1NWK A;  3F2K A;  3MX2 A;  3CCM N;  2H3G X;  4H0T B;  5AFU H;  4KH4 A;  3TTF A;  3A5O C;  2RHK A;  4BC5 A;  5CE3 A;  5AFU A;  1K8K B;  4PKH A;  1VAZ A;  2QXL A;  4E1J A;  3C0B A;  4IDH A;  2P9K B;  5AQJ A;  3SBT A;  5E84 A;  5BRD A;  4GVE A;  1OKJ A;  1VQ6 N;  3CI5 A;  4H5V A;  2VWB A;  5TKY A;  2GWK A;  4IZ9 A;  3H1Q A;  3L4I A;  4BG8 A;  3D2F A;  2QI2 A;  3OHR A;  1VQ5 N;  3HTV A;  3O9R A;  5LJW A;  4WF9 L;  2VGN A;  4CZG A;  4BVO A;  3N4P A;  5C0Y A;  5KPZ A;  2HMP A;  3I33 A;  4CBX A;  4IO9 L;  2KHO A;  3CQX A;  4BRM A;  1U6Z A;  2WUS A;  2EWS A;  3FZH A;  4JAX A;  3PIP L;  3C6H A;  1BU6 O;  3DJC A;  1QVG M;  1RDW X;  3QML A;  5ELZ A;  1RGI A;  3CJ7 A;  3T7Z A;  1V4T A;  2GEM A;  3FZF A;  1KC8 O;  2QWN A;  4FVU A;  1K8K A;  3AGK A;  4DB3 A;  5LJV A;  2YI1 A;  5AQK A;  4G9Z A;  2WC9 A;  1K8A O;  3E66 A;  4LC9 B;  1ATR A;  3QB0 A;  4WQ5 C;  1NGI A;  1P90 A;  1V4S A;  1T6D A;  4WQ5 A;  1XUP O;  4FOI A;  4H0V B;  3ZET B;  5F0X A;  1ILY A;  4CZJ A;  4IO8 A;  1G99 A;  1SZ2 A;  2FF3 B;  4FWR A;  3WXM B;  3O6W A;  5BN9 A;  2P9S B;  4NLB A;  3P4I A;  3QIC A;  5BRF A;  1GLE G;  4FPA A;  2PAV A;  1T3V A;  2P9U B;  3GOI A;  1MDU B;  3MWT A;  4EFH A;  2CGK A;  3O1W A;  3SBG A;  2J4R A;  3VGM A;  3N4Q A;  3CC7 N;  4RCH A;  1DEJ A;  4BRQ A;  3G6E N;  3M6G A;  3VOV A;  2HBJ A;  5C2D A;  3P39 A;  3DLL L;  2YX6 A;  4NO7 A;  3VF2 A;  2FF6 A;  1X3N A;  2AA4 A;  4CI6 A;  2WBN A;  4BR7 A;  1LCU A;  2F7T A;  1D4X A;  1SQK A;  1WUA A;  3AAP A;  1YAG A;  2NRW A;  3L6Q A;  5BPN A;  4ILH A;  3EZW A;  5FPM A;  2JWL A;  3G71 N;  3LDQ A;  2HBL A;  4FWL A;  3ZET A;  5H1S Q;  3FGU A;  4ISG A;  4MO5 A;  1YIJ N;  1YXQ A;  2Q1N A;  3DWL A;  4FWO A;  4PL8 A;  3SJH A;  3VF4 A;  3IFR A;  3OA9 A;  3WT0 A;  2CGJ A;  5C12 A;  3VGL A;  5M1P A;  1BG3 A;  2ITM A;  5C15 A;  5GIP A;  4WFB L;  3O9U A;  3VEV A;  2P9U A;  5AZJ B;  2A3Z A;  4IFE A;  4GY2 B;  1VQM N;  3VES A;  4BRP A;  3CME N;  3QFP A;  3BEX A;  4YOV A;  1R59 O;  2I7P A;  3WXL A;  1QQN A;  2ZF5 O;  5EVZ A;  4GNI A;  1E4F T;  2A6A A;  3FR0 A;  1VQN N;  3D2E B;  4GV3 A;  3FZK A;  3CCV N;  4DCH A;  3WXI A;  4FO0 A;  2E1Z A;  2GEL A;  5AZI A;  5TKW A;  2ZWH A;  1VQ8 N;  2E8A A;  3ULE A;  5JMV A;  3QFU A;  1Q86 O;  2VYP A;  2W41 A;  5AQN A;  1VQO N;  3RSE B;  4M63 C;  3CMA N;  1YI2 N;  2NRH A;  2HOE A;  2P9I A;  2PBD A;  5AQV A;  3U4L A;  5AQH A;  3UKR A;  3CCQ N;  4WFN L;  4EHU A;  1YJN N;  4IOA L;  3CHW A;  2FSK A;  4FWP A;  3CJC A;  2F9W A;  5EY4 A;  4FWM A;  1S3X A;  4BRK A;  1VQP N;  4WQ4 C;  3WEE B;  2ZJP L;  4NLC A;  1QZ6 A;  4YOY A;  2GX9 A;  1MWM A;  1BOT O;  2W40 A;  3TSQ A;  5M1Q A;  4FOE A;  3SMP A;  3VET A;  5GAE P;  4WQ4 A;  3E9P A;  1OVY A;  1SAZ A;  4CZM A;  3CF5 L;  1BA1 A;  1YF5 L;  1WOQ A;  3R6M A;  1NGG A;  2F9T A;  4XH4 A;  2V51 B;  3P38 A;  3R8E A;  4C1N I;  4YOR A;  4R79 A;  3TTD A;  1HJO A;  3VEX A;  4EAH D;  5EX5 A;  3VGK A;  5JIC A;  4YOX A;  1Q81 O;  3R3L A;  3CCU N;  5JVG L;  4B1V A;  4GV6 A;  5DM6 L;  3SLC A;  3DXK B;  1NGF A;  2D4W A;  4QS8 A;  2HST A;  4JKE A;  3F9M A;  5F2R A;  2ASM A;  3VER A;  4FPB A;  4IXC A;  3RSE A;  3TU5 A;  3HOT A;  5BPM A;  1BUP A;  4NB4 A;  4JKF A;  3CCL N;  4M7Y A;  5BR9 A;  1GLC G;  2QM1 A;  4BVP A;  5KPT A;  3K9J A;  3Q7B A;  1M1K O;  3CQY A;  2QW9 A;  4B1W B;  3CC2 N;  4A57 A;  3NMU A;  1Z05 A;  4C23 A;  3ZYY X;  1HPM A;  5AQP A;  1NBW A;  1GLL O;  4H0O A;  4BRF A;  5DM7 L;  1ZBS A;  1U2V A;  3TPQ A;  4JKD A;  3TSU A;  3S41 A;  4MO4 A;  1YJW N;  3EO3 A;  3OBW A;  4BRO A;  3UE5 A;  1VQ9 N;  2A40 A;  3DXK A;  5HOO A;  4JKA A;  3CJA A;  3VF6 A;  3DAW A;  1RDU A;  1T44 A;  3R1X A;  3PLA A;  3C7N B;  3ATV A;  4CBU A;  3C65 A;  3O4W A;  3CCJ N;  1KAY A;  1X3M A;  2V7Z A;  5FPE A;  3ZX3 A;  4BG9 A;  2ZJQ L;  2P9K A;  4XEI A;  2P9N B;  2QWQ A;  1QQM A;  4FWQ A;  2E2P A;  3VPZ A;  3ZEU B;  2FLO A;  1JCG A;  4H5N A;  4A59 A;  5M1O A;  2NRX A;  3B8A X;  3LM2 A;  3A5L C;  2ZGZ A;  4CZI A;  1N8R O;  4B1U B;  3CCR N;  3E9O A;  2HBM A;  3CPE A;  3TTC A;  3I56 N;  3O1B A;  4CJ7 A;  3A5M C;  3H1V X;  3FE1 A;  3HOS A;  1S72 N;  3O08 A;  2GTD A;  3LDO A;  2GUP A;  4FWS A;  4JK8 A;  4YDU C;  3HM8 A;  3IUC A;  4YDU A;  1NGE A;  4JNE A;  3O9S A;  4BR2 A;  5AQO A;  3FZM A;  4JKG B;  4QS7 A;  2E20 A;  1QHA A;  2D0O A;  3FLC O;  4Z94 A;  1Q82 O;  1YVN A;  5AQX A;  4WYB A;  4BRI A;  4M7X A;  4F9O A;  5C2F A;  2IVN A;  5JLF A;  1HUX A;  1TUY A;  3AAR A;  4K25 A;  3KVG A;  3I55 N;  1KD1 O;  1BA0 A;  1KXP A;  4JD2 B;  2FXU A;  2HBK A;  3KWG A;  4HWI A;  1TYQ B;  2YJE A;  1GLF O;  4H5W A;  3ENB A;  3ZEU A;  5GAH P;  3CC4 N;  3H6E A;  3JS6 A;  3HI0 A;  3VTI A;  2WFB A;  1DKG D;  4CZE A;  2P9S A;  1H1V A;  1NGH A;  5BRE A;  4JKH A;  1RFQ A;  1C0G A;  4OO1 J;  5KQD A;  4XH1 A;  3VTH A;  3BUZ B;  3W0L A;  5M1N A;  4JHD B;  3K9K A;  5F1X A;  3EE9 A;  2A5X A;  2A42 A;  3H45 C;  3MWP A;  2KKZ A;  1Q7Y O;  4I6M B;  1HKG A;  4JKG A;  2D0P A;  3H3N O;  4H5T A;  3HSC A;  3DXM B;  3NVM A;  3UKU B;  4BR5 A;  1CZA N;  2P9L B;  3VEZ A;  4A2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...