4IOCL

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
b'RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4iocL01
1Q82O 5GADP 1Q7YO 5DM7L 1JJ2M 3PIOL 3CCQN 3CC7N 4WFAL 3OW2M 5DM6L 1VQ8N 1VQLN 2QEXN 1Q81O 4U67L 1YHQN 2OTLN 2OTJN 2ZJPL 1VQON 3CD6N 1VQPN 5GAHP 1YITN 1NJIO 3DLLL 1Q86O 3CC4N 3CCVN 3G4SN 3CCMN 1VQMN 3CXCM 3G71N 1ILYA 5JVHL 3PIPL 5GAEP 2ZJRL 1YIJN 1YJNN 5JVGL 5HL7L 1KQSM 5MLCQ 1W2BM 3CC2N 1M90O 1KD1O 1VQ9N 1M1KO 1S72N 1VQKN 1YI2N 1OVYA 5GAGP 4IOCL 3J7ZO 1YJWN 4UY8O 3I56N 4IOAL 1VQ5N 3G6EN 1QVFM 3CCRN 4WCEL 3CCUN 1QVGM 4WFNL 1KC8O 3CCJN 3CCEN 1K9MO 1N8RO 3CCSN 1K73O 5H1SQ 3CF5L 1VQ6N 2ZJQL 1VQ4N 3CMAN 4WFBL 3CCLN 1VQ7N 4WF9L 1YJ9N 3CMEN 3CPWM 1K8AO 1VQNN 3I55N 2QA4N 4IO9L
chains in the Genus database with same CATH superfamily
1UA0A 4EIAA 2YHWA 2P51A 4BR5A 4KREA 3CQYA 4ILGB 3CFRA 1HKGA 2YNGA 3QO9A 3PIOL 3GBTA 2Q2RA 2W6LA 4RW8A 3LDQA 1NGEA 3K2PA 3OW2M 3HYFA 4IZ9A 4JI0K 1XUPO 4A2AA 3RMCA 4B3MK 1HJRA 4IJNA 2XY5A 3QEWA 4JYAK 4JI6K 4FPBA 3QESA 4KKOA 4IG0A 4B1UB 2KFNA 5A2QO 2QKBA 2HSTA 3MX2A 2NLXA 3L3VA 2E2PA 4WQ4C 3VERA 5KTQA 3ENOA 3DYAA 3ASMA 3JXUA 1L3TA 1RT6A 5E84A 4CJQA 1RBUA 3HXMA 4QCLA 3VQBA 3M8QA 4DS5A 1C0GA 5DK5A 4TSXA 3PIPL 2QWMA 2P9SA 4B08A 1MWMA 2OZMA 3KWIA 3O4QA 2BGGA 3K9JA 3R6MA 3CQXA 3OYLA 3DXKB 5JLFA 1ASWA 4BRIA 4BC3A 1S5JA 2P9PB 3OS2A 2O8EB 3TARA 3UKUA 3J7ZO 3PY8A 4CZKA 4DTPA 2PZSA 4I9QA 4DR1K 1EKEA 2XY6A 3SPZA 5AQSA 4IDKA 2XRIA 3WEEB 2NRZA 4B9TA 5J1EA 2E2OA 1W9HA 3ZX3A 5AJ3K 5BREA 3ISNC 2R7YA 1KXPA 1RT1A 3K5OA 4DV4K 4AHCA 3V9XA 1K73O 3U9DA 1WSHA 3J7YP 1K8KA 3MX5A 3TR8A 1VQ4N 3TAMA 1D4XA 3ZX0A 4JLHA 3LP2A 1TKDA 3I55N 3ENHA 3D2FB 3EE8A 2YNHA 2ZQBA 1WUAA 4JI2K 3A5MC 3TANA 3HPGA 5KGXA 3F9KA 5LJWA 4HVJA 4WFAL 4FZYA 4LH5A 5AQVA 3SUQA 4CE9A 5KPTA 1FKPA 4JKGA 2P9SB 3ZSWA 3OYNA 4HWIA 3HOSA 2HBLA 3HJFA 5C2DA 1A5VA 4CJWA 3DLEA 4NLCA 3AA4A 2GEMA 3AVIA 4BWMA 5AQHA 3VETA 3V9WA 1D8YA 4JHDA 2E88A 4LH4A 2QWPA 4AF1A 1FKOA 3UKUB 1IG9A 3NFAA 1S22A 3P4IA 4HCCA 4DSLA 3ZT0A 4CERA 4RW7A 3E9OA 4MDBA 3PO5A 3QNNA 3K58A 5HL7L 4BY9C 1T03A 4Z4GA 1KQSM 4DTSA 1ZC6A 1W2BM 4CHQA 4OX9K 4IWVA 1UWBA 1WOQA 4MO5A 1NGAA 3OYCA 4E7LA 5TKYA 4KHNA 4IEIA 2ATQA 1KVAA 1QHAA 1KFSA 2IVNA 4FO0A 1RT2A 4AHSA 2ZWHA 1QTMA 1EQYA 4WCEL 4GY2B 4YOUA 3RVCA 3M5RA 3ZSVA 1C0MA 3VGKA 4M63C 3IUCA 3DAWA 3FE1A 4CBXA 5TKWA 4XH1A 3WQUA 4XH4A 3WNFA 3CCLN 4KTWA 4JD2A 4NO7A 4JKHA 1NGCA 5BPLA 4X66K 4QAGA 5FDLA 5M1QA 3TPQA 1HNXK 4KHUA 4ZTFA 2WONA 1BIUA 4PA1A 1RBSA 2ASMA 5EXWA 2ZF5O 4H8KA 1Q7YO 3T1HK 3TAQA 1YXQA 2HNZA 1KAYA 1QE1A 2KW4A 4BR9A 4ELVA 4Z4FA 3AVGA 1QQCA 3E9PA 4NXMK 4WQ4A 4AHRA 1O13A 1OKJA 1GLFO 3EN9A 3E1YA 2A3ZA 1RDBA 3C6TA 3DLGA 4BVOA 3ZEUB 1JXBA 2A42A 1GLAG 3AVNA 4LF4K 5HRRA 1YAGA 4DTXA 5CE3A 4DLEA 4X64K 4EP4A 4CJVA 2KFZA 3D7EO 1QZ6A 1WAFA 4A61A 4FWRA 4CZLA 4H0YB 3AVKA 4OKJA 2JWLA 3BZCA 5FRNA 4B1YB 3C94A 3SV4A 4IO8A 3MWPA 4DTRA 2DFHA 3P5JA 2VCPA 4JV5K 1DEJA 1NNEA 3TABA 2BUPA 3VA0A 5MLCQ 3OJUA 2HHHK 4QS7A 1Q18A 4W5TA 1SL1A 1LW0A 1U6ZA 3LP0A 1Z6RA 3HRGA 2PBDA 1YI2N 4K41A 2NRXA 1W7AA 4JD2B 4B1VA 1IV0A 3I56N 1VSKA 2D0AA 1QVFM 3N4QA 3V9ZA 2ZGYA 2E8AA 4OO1J 5ADXA 3RR7A 3VN5A 4H5RA 1NBWA 1KTQA 1IO2A 3HBTA 1N33K 3CCEN 3SK3A 3QNOA 4LF6K 4R5PA 1TK8A 4C8LA 4FLVA 1RT3A 3P38A 1SKWA 1U45A 3B8AX 1NJZA 4DTMA 2E1ZA 3CF5L 3CFOA 4W5NA 2G8HA 1OH8A 3TAGA 3LDPA 4FZXC 1U48A 2Q31A 1LAVA 4HUEA 3FZMA 3IRXA 3TSQA 2E2NA 3SUPA 2E5LK 4BREA 4Y0WA 1N32K 4CEQA 3BGRA 5C25A 3O8MA 4B9NA 3HM9A 3OYGA 4IO9L 1NK0A 2E6LA 4DQQA 4YOXA 2UU9K 2HMPA 3K59A 1RTIA 4O8KA 4Z94A 1H1VA 3M1FA 3S3OA 3CETA 3FFIA 3CPEA 4PL7A 3AVLA 2P5GA 4O5BA 3HTVA 1HNZK 3IS9A 4CD1A 3FLCO 4CEEA 2FBYA 4BRHA 4BROA 2QM1A 4CJFA 3U6FA 4FJNA 4FCYA 1SL0A 4LD0A 1C0UA 3TTDA 3VQQA 4FSVA 5SWMA 4W5RA 5GAHP 1NJIO 3BEXA 4JI3K 5CYQA 3DM2A 4O0JA 4BGAA 4B3RK 3N4PA 4LFAK 2NRVA 3RRHA 4FW2A 1WBBA 3FGUA 3L0QA 4DS4A 3EO3A 1HQUA 1X9WA 3D2EA 3ZSXA 4G1QA 3PSFA 4CF9A 1TVRA 3DLBA 1IKWA 2A6AA 3BDPA 4H4MA 3V9UA 4ISGA 3SV3A 4PKGA 4HTUA 3ALYA 1TL3A 4BDPA 2IS3A 1JLFA 2FXUA 2IIRA 4JS4A 2ZD1A 4YOVA 4BRQA 4CVNE 3CHWA 4CIFA 4DSKA 4IOAL 2UXDK 4JAXA 4I2PA 4WFNL 3SYZA 4DFMA 1RDWX 2QTDA 1SKRA 4MFBA 1JLAA 1VQ6N 1LWEA 3MMVA 1XMQK 4MO4A 4FM1A 2YHYA 1L5UA 3WXJA 5AZIA 3TAEA 4FJXA 4JRPA 3M8SA 1SL2A 3J8AA 2GBZA 1R59O 4DTJA 4J2BA 2KKZA 5F0XA 2O8DA 1XNRK 3ZETB 1KLNA 2VG5A 4K25A 2Q0UA 3TAPA 5C42A 4CFDA 2YKMA 4DWIA 5DM6L 4DUYK 1IJJA 1CXUA 2KZZA 4DU3A 1CZAN 3D2EB 1BWFO 3NF9A 3UE5A 1TAUA 3J80O 4BRDA 3AGRA 3V81A 2F9WA 3W0LA 1C6VA 3G25A 3QERA 1CXQA 3VEXA 1VQON 1WSFA 3I0RA 1TGOA 1EWQA 1E4FT 2V51B 4O8UA 2BE2A 3IMXA 2OANA 1E3MA 2XY8A 5AQMA 5LL6Z 4DV3K 1X9MA 3C0BA 5BR8K 1EETA 1S1UA 3QIOA 5GAEP 2FBXA 4FLZA 2NRRA 4RG8A 4IJAA 1NKBA 3JS6A 1QSYA 5JVGL 4OVLA 4YDUC 3IKMA 3AAPA 1S6PA 3SMSA 2H3GX 2YHAA 2GWKA 4B9SA 3LM2A 3O4NA 1BI4B 4DR7K 5F2RA 2EWSA 4C23A 4CK3A 1X9JA 3OS0A 1HRHA 1G99A 3R9PA 4OLBA 4IFVA 4XH5A 3T7ZA 3K5MA 1JXEA 4DV6K 4KRFA 4NYFA 4N47A 5F1XA 3VENA 3CCRN 4DTUA 3DRRA 2O8DB 1MWKA 1RTJA 3AARA 5AQRA 2A1RA 2E6MA 1JCEA 4GV3A 2QW9A 1JLCA 1J5EK 2W6KA 1BOTO 1GLJO 1HR0K 3KLIA 2A41A 3RRGA 3LAMA 4MDAA 3S41A 4BRFA 3F2KA 4DCHA 3ID8A 4M45A 3THYA 3OYBA 2NRHA 4PKHA 2X78A 4CI6A 1WSIA 2HHVA 3VEYA 4CIEA 2HHQA 1NMNA 4BC4A 2QA4N 4LFBK 2P9NA 2QI2A 4H0XB 4A57A 4X65K 1Q82O 1L3UA 1OH5A 3ZCMA 1NJYA 1W0HA 3I8BA 3TU5A 4CZHA 2AJQA 3T69A 2HBMA 4E7HA 1ZBSA 4JI7K 2FF6A 1W97L 5AQWA 4DR3K 4DG1A 4CGJA 2O8CB 3MN6A 3QICA 1J54A 1YTAA 4FWPA 1JLBA 4I7FA 2OZSA 2YKNA 1N6QA 5AQJA 3BY5A 1RBTA 4KHWA 3DLLL 4KHQA 1BU6O 2VGMA 3F73A 5HRPA 1V4TA 3CXCM 2W41A 4CEOA 3LDNA 2BANA 3G71N 3CI5A 4O44A 1D9DA 3AVMA 1HKBA 1XI1A 3RSEB 3LDOA 5CZ2A 1BCMA 2QWLA 2BDPA 3LALA 5C0YA 3OYAA 1ZXOA 1TYQA 3OYHA 1B9FA 3AV9A 3ZT2A 1X1PA 3SZ2A 1Y97A 4DMNA 3EEQA 3AVBA 3DLRA 3LPUA 1YJWN 5HLFA 5BPNA 2IGIA 2WTUA 4JN4A 3BUZB 1GOBA 4YOYA 3K0SA 2HVHA 1FXXA 1ATRA 2P9NB 4CZEA 3FZHA 3OYEA 2P9KB 1MU2A 1SKSA 3NMUA 4G9ZA 2GV9A 4GV6A 4EP5A 1GOAA 1Z26A 4CEBA 1Y64A 4Z4HA 4FJGA 1JLGA 4CGIA 5AFUA 1NGIA 3CMAN 4OPAA 4WFBL 4FWNA 4WF9L 4Z0UA 2VWBA 3SBGA 1BQNA 1BQMA 5M1OA 3NF7A 3OA9A 1RFQA 1VQNN 3OS1A 1QHTA 4F3TA 2CGLA 3O9TA 3LWLA 4NCGA 3QB0A 4BE1A 4JK8A 3R8EA 2YHBA 1I3AA 5HRNA 4DV7K 3NVKA 2YI1A 3U9ZA 5HOOA 4CBUA 4ZHRA 4FWSA 1MDUB 2Y1IA 1UOCA 5C2FA 3TI0A 4E1JA 3VA3A 2KHOA 2G8VA 2PYLA 2QK9A 3MAQA 1TYQB 3OBWA 3J7AP 4DTNA 3CJAA 4B1ZA 2NUBA 1RBRA 4CFCA 4AILC 4DTOA 4IEEA 4YY3K 1VSIA 1YITN 1IKVA 3RR8A 2F8SA 1NKCA 1ASVA 3CC4N 3RMBA 3A0IX 3VF2A 4ISEA 2QXFA 1G15A 1QQOA 3A8YA 1T05A 4CJKA 2GX9A 1HMVA 4KH6A 5J2PA 4FJ9A 4DSJA 3NGZA 2IAJA 2DFEA 4B9VA 3NAEA 5JS1A 2D5RA 4C1NI 4CK1A 5HRSA 3IAYA 4CESA 3PX6A 2UUAK 4DV1K 4DQIA 1XC3A 4FW1A 4DSIA 1S72N 3LDSA 4E1MA 3OYJA 3T3FA 4M3ZA 4F8RA 3ITHA 2E20A 3MCAB 3L2UA 4DFKA 1VQ5N 1IH7A 3QBWA 3VMFB 4KI6A 2P9LA 1NGGA 4HUFA 4AHTA 2FLOA 4H0OA 4J8FA 4IXCA 4MLEA 4PHTX 4FPAA 3BF1A 3H3NO 1XHZA 4JI5K 4CJTA 5E41A 3LZIA 1K8KB 2VG7A 1FJGK 3NH0A 1QS4A 3FFKB 3ZSYA 1VQ7N 1KVCA 5AQTA 1YUWA 3V1OA 1KCFA 3L3UA 5BPMA 1ZBFA 1NMDA 3CPWM 1QSLA 1UAXA 5D3GA 3EL2A 4AM6A 3CM5A 4F9OA 3VQDA 3PX4A 4C8MA 5KPZA 3VF4A 3QMLA 2CGKA 4JKCA 2GUIA 3RWUA 3KHYA 3L2VA 4BR7A 4OGCA 1RDAA 3AO2A 2DY4A 5M1FA 2HVIA 5T7BA 1GLBG 1KVBA 4QS9A 5AQXA 2FSJA 1ASUA 1RNHA 4LF5K 1OVQA 4JKGB 2J4RA 1VQLN 1SZ2A 4KH4A 4CJ7A 4B1XB 4CEAA 1CZBA 4WQ5C 4BRKA 1S1TA 2X74A 4JHDB 2F4VK 4CF8A 2Q36A 5GINA 4K0KK 2CH5A 4ZTJA 3DOLA 5AQLA 2O8BA 3DI6A 1VSJA 2VWKA 1N5YA 3R1XA 4LY7A 4DQPA 1S1WA 4FM2A 1HUXA 3MN5A 3KIOA 5FPMA 3M8RA 1VSMA 4E19A 3QETA 3DRSA 4M41A 1Z25A 2W42A 3OHRA 3T1AA 1NK5A 2JWKA 2O8FA 2JGUA 4H5VA 4KPYA 1T44A 4B9QA 2P9UA 3WQTA 1J9AA 2Q1NA 3OBYA 2VG6A 4I9LA 2QWOA 5FPDA 4E89A 3JYTA 4K43A 3U8XA 1IBMK 3KLEA 4DQ8A 3ZLJA 4O4GA 4OGEA 1BCOA 4DB3A 1BG3A 4JK7A 4A2BA 5FLXO 4HUGA 2HOEA 2WC9A 3A5NC 3AVFA 3VTHA 2FSNA 3Q7BA 4CW7B 4X62K 4RW6A 3E01A 1GOCA 5HP1A 3MXIA 2ZJQL 1QQNA 5EU7A 2ETJA 5AQZA 1NOYA 1N36K 3FZKA 3OTOK 4KTZA 4BRNA 4CGDA 3ZYYX 1HYSA 3HK2A 3HVRA 4FJMA 4FL9A 3H08A 4OJRA 3QFUA 2RHKA 4CK2A 3W3DA 5EVZA 2NNWA 2ITGA 2ZE2A 3AO1A 4N56A 2IDOA 4H0VB 1VQ8N 2Y1JA 4AHVA 1C1BA 5JICA 1WSGA 4CEFA 1YTUA 3MEDA 4M3XA 3O3GA 4H03B 3BZKA 4M7YA 5CY4A 3T1YK 3GL1A 2OTLN 2OTJN 3O1BA 3CJ7A 4CFBA 4E7JA 4XIUA 3MXMA 5AQIA 3H6EA 1KRPA 3K5NA 1J53A 3VQPA 4DUZK 3CCMN 4PQUA 3MECA 1NGFA 2ZGZA 4C8KA 1ILYA 2RE2A 5FROA 3GE1A 4BR0A 4FZZA 4FWLA 4B9UA 3HI0A 4BR4A 2B5JA 2P9IA 4JNEA 5ELZA 1IG8A 4O5FA 3WXMB 4NYNA 4M3WA 1RT4A 1DT9A 1LAWA 3NH1A 2Z1HA 1F21A 4FJHA 1ITGA 3DLHA 2O4IA 3LWMA 1JL2A 1RBVA 4LF8K 5BRDA 1Q9YA 4FK2A 2I7PA 3AA2A 2DFFA 3GDQA 4E0DA 1BHLA 2D1KA 3KK3A 2IC3A 3SUNA 1VSLA 3CJBA 4ILHA 5I42A 4FM0A 5M1PA 3VEZA 4JKBA 3KLHA 2X6NA 4BGBA 3JSMA 2D0OA 1ZYQA 5H1SQ 3OVNA 1DLOA 3VQ5A 3R3LA 3HPOA 3D0PA 3GG4A 2HNDA 1HNWK 2B6AA 3AAQA 1S1XA 5EX5A 4FLUA 4B3TK 1QSSA 2GWJA 4IFEA 3H3OB 3CMEN 1C1AA 3VQ8A 4B8CA 1T8EA 1K8AO 3QLHA 3H46O 3ATVA 2G8FA 3QDKA 2E2QA 4PL8A 1A5WA 1DTQA 3HM8A 3ZT3A 5CZ1A 3WXLA 1XNQK 1T6DA 4CJ4A 4CF2A 1U2VA 3MN9A 4KTQA 2QKKA 2PYJA 3SQ2A 4KO0A 2Z1IA 1S3XA 4BACA 3EKUA 3O5BA 3KVGA 2GUPA 4H0PA 1S6QA 2D0CA 3VPZA 4KFBA 1LW2A 4FLTA 3HT3A 1XWLA 1L3VA 2HB5A 2Z1GA 3LPTA 4CF0A 5AQFA 5JMVA 5AQNA 3NBPA 1NJWA 5JS2A 1T3VA 4EAHD 2B4JA 4JS5A 3IFRA 2YJEA 4DLGA 2YCHA 1SUQA 3BF3A 4BQLA 4EFHA 1HYZA 4R79A 5FPEA 4BDZA 1V4SA 5ADXH 2D0BA 3SLCA 3DOKA 4U7BA 1ZBHA 4YHHK 3VQ9A 4OKEA 4BRPA 3H45C 5I3UA 4NCBA 4KAZA 2HHXA 1GLLO 4CBWA 2FBVA 2X6SA 4KB0A 3CCUN 2PAVA 3DRPA 5HBMA 4CZJA 2WBNA 4M3TA 1TKXA 3S9HA 3L2WA 4DQSA 3QINA 1JLQA 1U2VB 3DLKA 3C65A 3THXA 4KHPK 1RTDA 1YT3A 5AZIB 5JLHA 4IDHA 1C0FA 1GLCG 3VTIA 2WOMA 1X9SA 2UXBK 2VYPA 3FR0A 3DXMA 3MDQA 3TSPA 2E1YA 5EY4A 4GKJK 2CGJA 4JI4K 3NHGA 1JJ2M 3RMDA 4CJEA 1TAQA 3UB5A 2HBJA 3AVCA 3MCPA 4A5BA 3OJSA 4CHYA 1HPMA 4I2QA 4FJ7A 1RCHA 4U67L 2PY5A 1YHQN 3C7NA 3KLFA 1VQPN 1LWCA 2QWNA 4Y1DA 3O3HA 3MXJA 4BWJA 4FVMA 3EY1A 2XHBA 3I0SA 1KAZA 4BDYA 2OYQA 4Q0BA 1BO5O 4EZ6A 3MEEA 1EP4A 4FYDA 4FLYA 1T6CA 1S1VA 3KK2A 4BQZA 1B9DA 2VWJA 2OCEA 2OPSA 1U47A 4BG9A 1LOTB 3NF6A 3DJCA 1TK0A 4XEIA 4FWOA 1EXQA 2QWQA 3DXKA 4BRCA 1NG9A 5GIOA 3EKSA 2W40A 1N34K 4PUOA 2HF3A 2YNFA 2P9PA 5B8HA 1VK0A 2UXCK 2I5JA 1J5OA 4FK4A 4V19S 3G6EN 4DFPA 2EHGA 4DKWA 2BH1A 4H0TB 5AQUA 3WEEA 3SAFA 1QVGM 1YF5L 4CHPA 2JLEA 4ID1A 1N8RO 2G8UA 4F2SA 2UUBK 4CJPA 3VOVA 3RMAA 4A5AA 3EE9A 2G8WA 4NXNK 1TKTA 3THYB 3KKRA 3SCXA 1SAZA 2V7ZA 1YJ9N 4AQYK 5C15A 1NK4A 1BUPA 3OYFA 2WUSA 3K57A 1TUUA 3C7NB 3SPYA 3T19A 3OYDA 2VQEK 4GKKK 1EO1A 4DHYA 2YJFA 3NH2A 3CFPA 3ULDA 3D2FA 3F5TA 2RN2A 3WT0A 4BRGA 1HJOA 4CGHA 1D5AA 3PLAA 4CFAA 3ULEA 4C1NK 1NGJA 1VRTA 2HNYA 5KQ8A 3O9QA 2HBKA 4DSEA 3P31A 1NJXA 4LSNA 4BC2A 4FK0A 3O3FA 2DTUA 4CJRA 2GELA 1R0AA 3M8PA 3HP6A 1TL1A 1VSEA 4QS8A 4FVUA 1HNVA 5LJVA 5BN9A 4PKIA 4GVMA 3HOTA 2ZJPL 4NLBA 1RT7A 3IDHA 3CG7A 2OPPA 1VAZA 4FJ8A 3C6UA 4L8RB 4B9LA 1JL1A 3VEVA 1Q86O 2OA8A 4DQRA 4M3RA 3ID6A 4JKAA 4N41A 4WYBA 1XHXA 2AA4A 5AQPA 4HCBA 3HL8A 5DMRA 1CLQA 1BL3A 3D6RA 4CECA 3MWTA 3KD5E 1KAXA 3A5LC 3CIPA 4B8AB 3FZLA 4FJKA 4E7IA 1SV5A 3C6AA 2D0PA 3WUHA 1DKGD 4YDUA 5KPRA 4BE2A 3B6PA 1RDUA 3CYMA 5M1KA 4IOCL 1JCGA 1TKZA 4YOTA 4UY8O 3THVA 3AO3A 3VQCA 3QEXA 2F7TA 3C6HA 2DPNA 2KLAA 3L4QA 4GW6A 4H5NA 4FXDA 3V1QA 1XQSC 1RGIA 3VQEA 4OPJA 4DR2K 4H5TA 3CCJN 1JKHA 3HVTA 4DV5K 5LMUK 1T7PA 5KQDA 5I9EB 3JAMO 3ULEB 1NGBA 1Z05A 2LSNA 2RF2A 3AA3A 3VEOA 3M6GA 4CD3A 2HMIA 3VESA 1IBKK 3GOIA 2ASOA 4YORA 3G10A 1LCUA 1SQKA 3QEPA 4GVEA 3ZSZA 4FJIA 4M7XA 3L8BA 1NLVA 3ZSQA 1ESVA 4NB4A 4F2RA 3V1RA 4GV9A 1P8ZA 3VQ6A 3WXKA 3K5LA 3PX0A 4OKKA 1Q81O 3O4WA 3SUOA 2GTDA 4M3UA 1J6ZA 2V52B 3O9RA 4W5OA 3KWGA 4O0IA 2F96A 2F9TA 1IBLK 3ZT1A 3B6OA 3ZEUA 3G0ZA 4BRAA 3AVAA 3IG1A 1GLDG 4F4KA 4H5WA 3ENBA 4FOEA 4DV2K 3AO4A 3LAKA 4CHNA 4CF1A 4FJLA 2V7YA 3DWLA 2PFUA 4YOWA 3WXIA 3O6WA 2F8TA 2OPRA 3OYKA 4ILJA 2YHXA 4CJUA 4BRMA 3SAHA 4DF4A 3KTQA 4JK9A 3WNHA 2VGNA 3PUFA 4O55A 5C24A 3ZX2A 4AM7A 1MA9B 1VSDA 4LFCK 3CJ1A 2QWRA 4DR6K 4BC5A 1KD1O 5AR0A 4CEZA 1C1CA 1P90A 5HROA 3U3GA 3ZT4A 1SS6A 3KD1E 2ITMA 4CZFA 3Q7CA 4CJ5A 4NCAA 5AFUH 2I7NA 2P9LB 1HYVA 5CR4A 4PY5A 4AH9A 4JEPA 3NGIA 3TSUA 4K42A 1FK9A 1NGDA 5C10A 3QBXA 3OYMA 3PV8A 4B1WB 1GLEG 1S9EA 4B3SK 3O9UA 1NGHA 1FW6A 3O80A 3U4LA 1UA1A 5CHIA 4Y1CA 4FOIA 5AQKA 4E1NA 3V4IA 1RDDA 3L6QA 1NWKA 3A2FA 5DM7L 4IBNA 1BISA 1X3MA 3AVJA 3P1GA 4CGGA 1HQEA 4AHUA 1HKCA 3V6DA 1IKXA 3EZ5A 1O1WA 3HO1A 1C0TA 2FSKA 2YV0X 2QEXN 3UIQA 3P39A 5SZTA 1RTHA 4PWDA 1VHXA 1VSHA 4CIGA 4RCHA 1A5XA 1BIZA 3ZSRA 4ELTA 1JCFA 3L4IA 5J2MA 1WSEA 3I8DA 1ZBLA 1B92A 3TWHA 2UUCK 3HZ6A 5M1NA 2BTFA 4W5QA 2KTQA 4EHUA 2O8BB 4DU4A 3TAFA 5KRSA 3CCVN 5LY3A 1Q9XA 1BDGA 3LDLA 1NKEA 1NK9A 5AQGA 4MQ3A 4ID5A 3AA5X 3TTCA 4DSFA 1NK6A 5JVHL 3THWA 1TUYA 4K8XA 4CEDA 4KBOA 5BN8A 3AGKA 4JKFA 3BP8A 3VQAA 4BE0A 4A59A 2O8FB 4HHTA 4ICLA 3D45A 1IKYA 1NU0A 5IT9O 4KH5A 1LV5A 2P9UB 4IKFA 3AO5A 4JI1K 2YX6A 3S3MA 3SAGA 4ISFA 4JKDA 3KKSA 4N5SA 1I39A 2P1JA 5KRTA 4JI8K 1OVYA 4FLWA 3HSTB 2Q0RA 3NGYA 3SJJA 3LZJA 3SQ4A 2XO7A 4YNQA 5FPNA 3NE6A 2RPIA 4CGFA 1TK5A 2QXLA 4J2DA 3KK1A 4KHSA 4ELUA 4FWQA 3CCSN 3MN7A 3H1VX 1OH7A 4DR4K 1WAJA 5EOYA 3L2QA 1NK8A 5FRMA 5J2NA 3CJ9A 3SQ0A 2Q97A 2P5OA 4C8OA 3VF6A 4CJSA 1RT5A 4LF9K 3VEWA 1WN7A 1ZBIA 4HTLA 5BR9A 3EZWA 4EHTA 2A5XA 4WE1A 5KI6A 3O08A 2ASPA 5K14A 2NZTA 4FLXA 4J2EA 1X3NA 3ZETA 4CJLA 3U3YA 3HSCA 1LWFA 3VQ7A 2HF4A 2HW3A 3CCQN 1BGXT 3CC7N 1WBDA 3H1QA 1VRUA 2IVPA 4M42A 3M3ZA 3THWB 4DF8A 1DGKN 1NM1A 3I33A 3O1WA 2HHTA 4LF7K 3MEGA 4FJJA 1RDCA 2Z1JA 4KB1A 2Q3SA 5CYMA 1EX4A 1WNSA 3QIPA 3G4SN 4Z4IA 1S9GA 4C8NA 5KGWA 4WQ5A 4IOXA 4IG3A 1VQMN 3J81O 4RW4A 1ATSA 4K8ZA 3K9KA 4I6MA 4FWMA 3KK7A 3OYIA 1YIJN 2G8KA 1YJNN 2P9IB 3SI6A 3NCIA 3AY9A 4N76A 1DTTA 3E9LA 1ZBUA 3NVMA 3CC2N 1BI4A 1BA1A 1QZ5A 3V9SA 1VQ9N 1YVNA 4CJ3A 3KLGA 1XC9A 5E26A 1VQKN 1U49A 1RILA 4A62A 3UKRA 1D9FA 1XMOK 3LP1A 2NRTA 4J2AA 3CERA 1K6YA 4FWKA 5AQQA 5C12A 2G8IA 4OLAA 2KZMA 1KC8O 2EX3A 3SMPA 1K9MO 3AVHA 4RWTA 3QEIA 2KQ2A 4B3OA 4M3YA 4F3OA 4OPKA 4E7KA 2WFBA 2CH6A 1I94K 3RTVA 2IVOA 3HPHA 2UYTA 3LM9A 2D4WA 4DFJA 1BA0A 3MK6A 3A5OC 1WSJA 4KV8A 2FBTA 3TTFA 5LMNK 2XY7A 4DR5K 2NRWA 5GADP 2FF3B 3QEVA 1JLEA 3E66A 4UQGA 1KLMA 3SNNA 1HX1A 4I6MB 4CHOA 4QOZB 3CJCA 2A1SA 3S3NA 5J2QA 3CM6A 5BRHA 2O8CA 3EYZA 1OH6A 2O4GA 4FJ5A 4BG8A 1KSPA 4DU1A 1NOZA 4E3SA 5AZJA 3CD6N 3HP9A 1Q8IA 2HHUA 1YVUA 3KJVA 4GNIA 1E4GT 4KI4A 5BRFA 3KZBA 3UKRB 3NDKA 3VQ4A 3PSIA 1TV6A 3LL3A 4IFYA 1U04A 5IWAK 3PO4A 2HHSA 1HPZA 2A40A 2OPQA 3WNGA 4H4OA 3SJHA 3QFPA 5AQYA 5AQOA 4JKEA 2ZJRL 2YNIA 3CQ8A 3LANA 3WNEA 3RSEA 2RKIA 3FZFA 1KFDA 4RW9A 4OPHA 1L3SA 4RTFD 4KHYA 1REVA 4LSLA 1M90O 1WB9A 4YFUA 2ZM6K 4CCHA 3OY9A 2IOCA 1NK7A 3VGMA 1M1KO 1WLJA 4B9MA 1QQMA 5GAGP 3F9MA 3NF8A 3P83D 4CHZA 4Z4CA 4Q5VA 2VQFK 1CZ9A 3C95A 4GMJB 3ATUA 3O9SA 3ZSOA 3SBTA 2P9KA 4CZIA 4JRQA 4EZ9A 2AP1A 1HNIA 3VGLA 3THXB 4L3QA 4DV0K 1VSFA 4CZGA 2HHWA 5GIPA 1U4BA 1EWRA 3LP3A 3SQ1A 2O8EA 4BR2A 4LC9B 1ATNA 3L2RA 3DMJA 4Z4EA 1HLUA 4BRLA 2E4LA 4CZMA 3DXMB 5AZJB 4MLHA 4BVPA 2FC0A
chains in the Genus database with same CATH topology
4FL9A 4GVEA 4EIAA 3QFUA 2RHKA 2YHWA 3ZETB 4M7XA 3W3DA 4BR5A 1NLVA 4K25A 5EVZA 1ESVA 2Q0UA 3CQYA 4ILGB 1HKGA 2NNWA 4NB4A 3PIOL 3GBTA 2Q2RA 3LDQA 4GV9A 1NGEA 3OW2M 5DM6L 1P8ZA 4H0VB 4IZ9A 1VQ8N 3WXKA 1IJJA 1XUPO 4A2AA 5JICA 1CZAN 3D2EB 1BWFO 1Q81O 3O4WA 4IJNA 2GTDA 3UE5A 1J6ZA 2V52B 3O9RA 4H03B 3KWGA 4BRDA 2F9TA 3AGRA 2F9WA 4FPBA 4M7YA 3W0LA 3GL1A 2OTLN 4B1UB 3O1BA 3ZEUA 2OTJN 3G25A 4BRAA 2HSTA 3CJ7A 3MX2A 3VEXA 1VQON 2NLXA 2E2PA 4WQ4C 3VERA 1GLDG 3ENOA 5AQIA 4H5WA 3H6EA 3ENBA 4FOEA 3JXUA 1E4FT 2V51B 4O8UA 3IMXA 5E84A 3CCMN 2OANA 2V7YA 3DWLA 2PFUA 5AQMA 1NGFA 1C0GA 2ZGZA 3C0BA 4YOWA 1ILYA 3WXIA 3O6WA 3PIPL 2RE2A 3GE1A 4BR0A 5GAEP 4ILJA 2YHXA 4FWLA 4BRMA 3SAHA 2NRRA 2QWMA 2P9SA 3HI0A 4IJAA 3JS6A 4JK9A 5JVGL 1MWMA 2VGNA 4YDUC 3IKMA 2P9IA 3AAPA 4BR4A 4JNEA 2H3GX 3SMSA 3ZX2A 2GWKA 4AM7A 1MA9B 3KWIA 3LM2A 5ELZA 3K9JA 1IG8A 3CQXA 3R6MA 3CJ1A 2QWRA 3DXKB 4O5FA 3WXMB 5F2RA 4BC5A 1DT9A 5JLFA 2EWSA 4C23A 1KD1O 1X9JA 4BRIA 4BC3A 5AR0A 3R9PA 1G99A 2P9PB 1P90A 5BRDA 1SS6A 4XH5A 3UKUA 3T7ZA 3J7ZO 4CZKA 2ITMA 4CZFA 2I7PA 3GDQA 3Q7CA 5AQSA 2D1KA 5AFUH 2I7NA 2P9LB 5F1XA 3CJBA 4ILHA 3WEEB 2NRZA 3VENA 3CCRN 2E2OA 1MWKA 3AARA 5AQRA 5CR4A 3ZX3A 1JCEA 5BREA 5M1PA 3VEZA 4JKBA 4JEPA 1KXPA 4BGBA 3TSUA 4K42A 4GV3A 2QW9A 1K73O 2D0OA 1NGDA 5C10A 3U9DA 5H1SQ 3QBXA 1BOTO 3R3LA 4B1WB 1GLJO 2A41A 1K8KA 3GG4A 3MX5A 1GLEG 3AAQA 1VQ4N 5EX5A 4MDAA 3S41A 4BRFA 2GWJA 3F2KA 4DCHA 3ID8A 4IFEA 1D4XA 3H3OB 3CMEN 2NRHA 3ZX0A 3O9UA 4PKHA 1K8AO 4CI6A 1NGHA 3VEYA 3I55N 3O80A 4BC4A 2QA4N 3U4LA 3H46O 2P9NA 3ENHA 3ATVA 3D2FB 3EE8A 2QI2A 5CHIA 1WUAA 4H0XB 4A57A 1Q82O 4FOIA 5AQKA 3QDKA 2E2QA 4PL8A 3HM8A 3A5MC 3WXLA 3L6QA 1NWKA 3I8BA 3TU5A 1T6DA 4CZHA 5DM7L 3T69A 1U2VA 3MN9A 4WFAL 1X3MA 5LJWA 2HBMA 5AQVA 1HKCA 1ZBSA 2FF6A 1W97L 2FSKA 5KPTA 4JKGA 1S3XA 5AQWA 2QEXN 2P9SB 3P39A 3EKUA 3O5BA 4HWIA 3MN6A 3KVGA 2GUPA 2HBLA 3QICA 4H0PA 4RCHA 3HOSA 1JCFA 3L4IA 4FWPA 5C2DA 4NLCA 3VPZA 2GEMA 5AQHA 3VETA 3HZ6A 4JHDA 2BTFA 5AQJA 5M1NA 4EHUA 2E88A 3DLLL 2QWPA 5AQFA 4AF1A 5JMVA 3CCVN 1BU6O 5AQNA 3UKUB 2VGMA 5LY3A 1S22A 1T3VA 1BDGA 3LDLA 4EAHD 3P4IA 1V4TA 5AQGA 3CXCM 2W41A 3G71N 3LDNA 3CI5A 3TTCA 3E9OA 5JVHL 1TUYA 3IFRA 2YJEA 4MDBA 1HKBA 2YCHA 4KBOA 5BN8A 3AGKA 4JKFA 3RSEB 3BP8A 3BF3A 3LDOA 4BQLA 4A59A 5HL7L 4BY9C 2QWLA 5C0YA 4EFHA 1ZXOA 1TYQA 1KQSM 4R79A 5FPEA 1ZC6A 1W2BM 4KH5A 1V4SA 2P9UB 5ADXH 3SLCA 4U7BA 2YX6A 3SAGA 4IWVA 4ISFA 4JKDA 1WOQA 4MO5A 1NGAA 4BRPA 3H45C 5TKYA 4IEIA 1OVYA 1QHAA 1YJWN 1GLLO 2Q0RA 4CBWA 2IVNA 4FO0A 5BPNA 2ZWHA 4JN4A 3BUZB 1EQYA 5FPNA 4WCEL 4YOYA 3CCUN 2P9NB 1ATRA 4CZEA 2QXLA 2PAVA 3FZHA 4CZJA 2WBNA 2P9KB 4FWQA 4GY2B 4YOUA 3RVCA 3CCSN 3M5RA 3NMUA 4G9ZA 3MN7A 4GV6A 3H1VX 3VGKA 1U2VB 5EOYA 4M63C 3C65A 3IUCA 3DAWA 3FE1A 4CBXA 1Y64A 5TKWA 4XH1A 3WQUA 5AFUA 1NGIA 4XH4A 3CJ9A 2Q97A 3CMAN 3VF6A 4OPAA 4WFBL 3CCLN 4FWNA 3VEWA 4WF9L 5AZIB 4JD2A 4NO7A 4JKHA 4IDHA 1NGCA 5JLHA 5BPLA 4HTLA 5BR9A 2VWBA 1C0FA 1GLCG 3EZWA 3SBGA 3VTIA 5M1QA 4EHTA 2A5XA 5M1OA 3TPQA 3OA9A 1RFQA 1VQNN 3O08A 2ASPA 2VYPA 3FR0A 2NZTA 2CGLA 3DXMA 3MDQA 3O9TA 2ASMA 5EXWA 3TSPA 3QB0A 2E1YA 2ZF5O 4JK8A 3R8EA 1Q7YO 1X3NA 5EY4A 3ZETA 2CGJA 3HSCA 1JJ2M 3NVKA 1YXQA 1KAYA 2HF4A 2YI1A 3CCQN 4BR9A 3CC7N 3U9ZA 3H1QA 3E9PA 3UB5A 2HBJA 2IVPA 3M3ZA 4CBUA 4FWSA 1MDUB 5HOOA 1DGKN 1NM1A 3I33A 4WQ4A 3MCPA 5C2FA 4A5BA 4E1JA 2KHOA 3O1WA 1O13A 1OKJA 1GLFO 1HPMA 3EN9A 3E1YA 2A3ZA 4U67L 1TYQB 3OBWA 4BVOA 1YHQN 3ZEUB 3C7NA 2A42A 3CJAA 1GLAG 4B1ZA 1VQPN 4IEEA 1YAGA 1YITN 2QWNA 5CE3A 3D7EO 1QZ6A 4A61A 3CC4N 1KAZA 3A0IX 4FWRA 3G4SN 3VF2A 4ISEA 4CZLA 4H0YB 4WQ5A 4IOXA 1VQMN 1BO5O 2JWLA 4B1YB 4IO8A 1QQOA 3A8YA 3MWPA 1ATSA 2GX9A 3K9KA 4I6MA 4FWMA 3KK7A 1T6CA 4KH6A 2VCPA 1YIJN 4BQZA 2P9IB 1YJNN 1DEJA 3AY9A 4BG9A 2BUPA 4C1NI 5MLCQ 3E9LA 3NVMA 4QS7A 3CC2N 1LOTB 1Q18A 3DJCA 4XEIA 4FWOA 1BA1A 1QZ5A 2QWQA 3DXKA 4BRCA 1YVNA 5GIOA 1U6ZA 3EKSA 1VQ9N 1Z6RA 2W40A 3HRGA 1XC3A 5E26A 2PBDA 1S72N 1VQKN 1YI2N 2HF3A 2NRXA 4K41A 4A62A 4JD2B 4B1VA 2P9PA 3UKRA 5B8HA 3I56N 2E20A 2NRTA 3MCAB 1VQ5N 3G6EN 3CERA 1QVFM 3N4QA 3QBWA 4FWKA 2ZGYA 5AQQA 3VMFB 2E8AA 4OO1J 4DKWA 2BH1A 1NGGA 2P9LA 4H0TB 5AQUA 3WEEA 5C12A 5ADXA 1YF5L 3SAFA 2FLOA 4H0OA 4H5RA 4J8FA 1QVGM 1NBWA 1KC8O 3HBTA 3CCEN 4IXCA 3SMPA 4MLEA 3SK3A 4PHTX 4FPAA 1K9MO 1N8RO 3BF1A 3H3NO 4RWTA 3P38A 3B8AX 3VOVA 1K8KB 2E1ZA 3CF5L 4A5AA 2WFBA 3EE9A 2CH6A 2IVOA 3FFKB 2UYTA 3LDPA 1VQ7N 1SAZA 2V7ZA 2Q31A 1YJ9N 3FZMA 3LM9A 5AQTA 2D4WA 3TSQA 1YUWA 2E2NA 5C15A 1BUPA 5BPMA 1BA0A 2WUSA 3CPWM 1NMDA 3MK6A 4Y0WA 4BREA 3EL2A 3A5OC 1TUUA 3C7NB 4AM6A 4F9OA 3O8MA 1EO1A 3TTFA 4DHYA 2YJFA 5KPZA 3VF4A 3QMLA 2CGKA 4JKCA 4IO9L 3D2FA 3F5TA 2NRWA 3KHYA 2FF3B 5GADP 4YOXA 2HMPA 4BR7A 3WT0A 4O8KA 4BRGA 1HJOA 4Z94A 1H1VA 3M1FA 5M1FA 3PLAA 1GLBG 4QS9A 5AQXA 3E66A 3ULEA 2FSJA 4C1NK 3CETA 3CPEA 1NGJA 4PL7A 1HX1A 4JKGB 5KQ8A 3O9QA 2HBKA 2J4RA 1VQLN 3P31A 4I6MB 1SZ2A 4BC2A 3HTVA 4KH4A 4CJ7A 4CD1A 2GELA 3CJCA 3FLCO 4BRHA 4BROA 5BRHA 4QS8A 2QM1A 4FVUA 5LJVA 4BG8A 4B1XB 5BN9A 4PKIA 4WQ5C 3TTDA 4BRKA 3HOTA 2ZJPL 5AZJA 4JHDB 4NLBA 3CD6N 3IDHA 4FSVA 5GAHP 1NJIO 2Q36A 1VAZA 5GINA 4GNIA 2CH5A 1E4GT 3BEXA 3VEVA 3KZBA 3UKRB 5BRFA 3LL3A 5AQLA 1Q86O 4BGAA 3R1XA 3N4PA 2A40A 2NRVA 3SJHA 3QFPA 5AQYA 3ID6A 5AQOA 4JKAA 1HUXA 3MN5A 4JKEA 3FGUA 3L0QA 4WYBA 5FPMA 3EO3A 2ZJRL 3D2EA 2AA4A 5AQPA 3RSEA 3FZFA 3D6RA 3OHRA 4OPHA 2JWKA 3MWTA 4RTFD 1KAXA 2A6AA 3A5LC 4H5VA 1M90O 1T44A 3CIPA 4B9QA 3FZLA 2P9UA 4ISGA 3WQTA 3C6AA 2Q1NA 3OBYA 2D0PA 4PKGA 3WUHA 2QWOA 5FPDA 3VGMA 1M1KO 4K43A 2FXUA 1DKGD 2IIRA 1QQMA 4YDUA 3U8XA 5GAGP 1RDUA 5KPRA 5M1KA 4IOCL 3F9MA 1JCGA 4YOTA 4BRQA 4YOVA 4UY8O 4DQ8A 3CHWA 4IOAL 2F7TA 3C6HA 2DPNA 2KLAA 3L4QA 4H5NA 4JAXA 4WFNL 1XQSC 1RGIA 4H5TA 3CCJN 3ATUA 3O9SA 4DB3A 3SBTA 1BG3A 2P9KA 4JK7A 4A2BA 4CZIA 1RDWX 2HOEA 2QTDA 5KQDA 5I9EB 2WC9A 2AP1A 3A5NC 3VTHA 2FSNA 3Q7BA 3ULEB 3VGLA 4L3QA 1VQ6N 4CZGA 3MMVA 2ZJQL 1QQNA 1NGBA 4MO4A 5GIPA 5AQZA 1Z05A 2YHYA 3FZKA 4BR2A 3VEOA 4BRNA 3M6GA 4LC9B 5AZIA 3WXJA 4CD3A 1ATNA 1HLUA 3VESA 3ZYYX 3J8AA 4BRLA 3GOIA 2ASOA 4YORA 1R59O 4CZMA 2KKZA 3DXMB 5AZJB 5F0XA 1LCUA 4MLHA 4BVPA 1SQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 O;  5GAD P;  1Q7Y O;  5DM7 L;  1JJ2 M;  3PIO L;  3CCQ N;  3CC7 N;  4WFA L;  3OW2 M;  5DM6 L;  1VQ8 N;  1VQL N;  2QEX N;  1Q81 O;  4U67 L;  1YHQ N;  2OTL N;  2OTJ N;  2ZJP L;  1VQO N;  3CD6 N;  1VQP N;  5GAH P;  1YIT N;  1NJI O;  3DLL L;  1Q86 O;  3CC4 N;  3CCV N;  3G4S N;  3CCM N;  1VQM N;  3CXC M;  3G71 N;  1ILY A;  5JVH L;  3PIP L;  5GAE P;  2ZJR L;  1YIJ N;  1YJN N;  5JVG L;  5HL7 L;  1KQS M;  5MLC Q;  1W2B M;  3CC2 N;  1M90 O;  1KD1 O;  1VQ9 N;  1M1K O;  1S72 N;  1VQK N;  1YI2 N;  1OVY A;  5GAG P;  4IOC L;  3J7Z O;  1YJW N;  4UY8 O;  3I56 N;  4IOA L;  1VQ5 N;  3G6E N;  1QVF M;  3CCR N;  4WCE L;  3CCU N;  1QVG M;  4WFN L;  1KC8 O;  3CCJ N;  3CCE N;  1K9M O;  1N8R O;  3CCS N;  1K73 O;  5H1S Q;  3CF5 L;  1VQ6 N;  2ZJQ L;  1VQ4 N;  3CMA N;  4WFB L;  3CCL N;  1VQ7 N;  4WF9 L;  1YJ9 N;  3CME N;  3CPW M;  1K8A O;  1VQN N;  3I55 N;  2QA4 N;  4IO9 L; 
#chains in the Genus database with same CATH topology
 1UA0 A;  4EIA A;  2YHW A;  2P51 A;  4BR5 A;  4KRE A;  3CQY A;  4ILG B;  3CFR A;  1HKG A;  2YNG A;  3QO9 A;  3PIO L;  3GBT A;  2Q2R A;  2W6L A;  4RW8 A;  3LDQ A;  1NGE A;  3K2P A;  3OW2 M;  3HYF A;  4IZ9 A;  4JI0 K;  1XUP O;  4A2A A;  3RMC A;  4B3M K;  1HJR A;  4IJN A;  2XY5 A;  3QEW A;  4JYA K;  4JI6 K;  4FPB A;  3QES A;  4KKO A;  4IG0 A;  4B1U B;  2KFN A;  5A2Q O;  2QKB A;  2HST A;  3MX2 A;  2NLX A;  3L3V A;  2E2P A;  4WQ4 C;  3VER A;  5KTQ A;  3ENO A;  3DYA A;  3ASM A;  3JXU A;  1L3T A;  1RT6 A;  5E84 A;  4CJQ A;  1RBU A;  3HXM A;  4QCL A;  3VQB A;  3M8Q A;  4DS5 A;  1C0G A;  5DK5 A;  4TSX A;  3PIP L;  2QWM A;  2P9S A;  4B08 A;  1MWM A;  2OZM A;  3KWI A;  3O4Q A;  2BGG A;  3K9J A;  3R6M A;  3CQX A;  3OYL A;  3DXK B;  5JLF A;  1ASW A;  4BRI A;  4BC3 A;  1S5J A;  2P9P B;  3OS2 A;  2O8E B;  3TAR A;  3UKU A;  3J7Z O;  3PY8 A;  4CZK A;  4DTP A;  2PZS A;  4I9Q A;  4DR1 K;  1EKE A;  2XY6 A;  3SPZ A;  5AQS A;  4IDK A;  2XRI A;  3WEE B;  2NRZ A;  4B9T A;  5J1E A;  2E2O A;  1W9H A;  3ZX3 A;  5AJ3 K;  5BRE A;  3ISN C;  2R7Y A;  1KXP A;  1RT1 A;  3K5O A;  4DV4 K;  4AHC A;  3V9X A;  1K73 O;  3U9D A;  1WSH A;  3J7Y P;  1K8K A;  3MX5 A;  3TR8 A;  1VQ4 N;  3TAM A;  1D4X A;  3ZX0 A;  4JLH A;  3LP2 A;  1TKD A;  3I55 N;  3ENH A;  3D2F B;  3EE8 A;  2YNH A;  2ZQB A;  1WUA A;  4JI2 K;  3A5M C;  3TAN A;  3HPG A;  5KGX A;  3F9K A;  5LJW A;  4HVJ A;  4WFA L;  4FZY A;  4LH5 A;  5AQV A;  3SUQ A;  4CE9 A;  5KPT A;  1FKP A;  4JKG A;  2P9S B;  3ZSW A;  3OYN A;  4HWI A;  3HOS A;  2HBL A;  3HJF A;  5C2D A;  1A5V A;  4CJW A;  3DLE A;  4NLC A;  3AA4 A;  2GEM A;  3AVI A;  4BWM A;  5AQH A;  3VET A;  3V9W A;  1D8Y A;  4JHD A;  2E88 A;  4LH4 A;  2QWP A;  4AF1 A;  1FKO A;  3UKU B;  1IG9 A;  3NFA A;  1S22 A;  3P4I A;  4HCC A;  4DSL A;  3ZT0 A;  4CER A;  4RW7 A;  3E9O A;  4MDB A;  3PO5 A;  3QNN A;  3K58 A;  5HL7 L;  4BY9 C;  1T03 A;  4Z4G A;  1KQS M;  4DTS A;  1ZC6 A;  1W2B M;  4CHQ A;  4OX9 K;  4IWV A;  1UWB A;  1WOQ A;  4MO5 A;  1NGA A;  3OYC A;  4E7L A;  5TKY A;  4KHN A;  4IEI A;  2ATQ A;  1KVA A;  1QHA A;  1KFS A;  2IVN A;  4FO0 A;  1RT2 A;  4AHS A;  2ZWH A;  1QTM A;  1EQY A;  4WCE L;  4GY2 B;  4YOU A;  3RVC A;  3M5R A;  3ZSV A;  1C0M A;  3VGK A;  4M63 C;  3IUC A;  3DAW A;  3FE1 A;  4CBX A;  5TKW A;  4XH1 A;  3WQU A;  4XH4 A;  3WNF A;  3CCL N;  4KTW A;  4JD2 A;  4NO7 A;  4JKH A;  1NGC A;  5BPL A;  4X66 K;  4QAG A;  5FDL A;  5M1Q A;  3TPQ A;  1HNX K;  4KHU A;  4ZTF A;  2WON A;  1BIU A;  4PA1 A;  1RBS A;  2ASM A;  5EXW A;  2ZF5 O;  4H8K A;  1Q7Y O;  3T1H K;  3TAQ A;  1YXQ A;  2HNZ A;  1KAY A;  1QE1 A;  2KW4 A;  4BR9 A;  4ELV A;  4Z4F A;  3AVG A;  1QQC A;  3E9P A;  4NXM K;  4WQ4 A;  4AHR A;  1O13 A;  1OKJ A;  1GLF O;  3EN9 A;  3E1Y A;  2A3Z A;  1RDB A;  3C6T A;  3DLG A;  4BVO A;  3ZEU B;  1JXB A;  2A42 A;  1GLA G;  3AVN A;  4LF4 K;  5HRR A;  1YAG A;  4DTX A;  5CE3 A;  4DLE A;  4X64 K;  4EP4 A;  4CJV A;  2KFZ A;  3D7E O;  1QZ6 A;  1WAF A;  4A61 A;  4FWR A;  4CZL A;  4H0Y B;  3AVK A;  4OKJ A;  2JWL A;  3BZC A;  5FRN A;  4B1Y B;  3C94 A;  3SV4 A;  4IO8 A;  3MWP A;  4DTR A;  2DFH A;  3P5J A;  2VCP A;  4JV5 K;  1DEJ A;  1NNE A;  3TAB A;  2BUP A;  3VA0 A;  5MLC Q;  3OJU A;  2HHH K;  4QS7 A;  1Q18 A;  4W5T A;  1SL1 A;  1LW0 A;  1U6Z A;  3LP0 A;  1Z6R A;  3HRG A;  2PBD A;  1YI2 N;  4K41 A;  2NRX A;  1W7A A;  4JD2 B;  4B1V A;  1IV0 A;  3I56 N;  1VSK A;  2D0A A;  1QVF M;  3N4Q A;  3V9Z A;  2ZGY A;  2E8A A;  4OO1 J;  5ADX A;  3RR7 A;  3VN5 A;  4H5R A;  1NBW A;  1KTQ A;  1IO2 A;  3HBT A;  1N33 K;  3CCE N;  3SK3 A;  3QNO A;  4LF6 K;  4R5P A;  1TK8 A;  4C8L A;  4FLV A;  1RT3 A;  3P38 A;  1SKW A;  1U45 A;  3B8A X;  1NJZ A;  4DTM A;  2E1Z A;  3CF5 L;  3CFO A;  4W5N A;  2G8H A;  1OH8 A;  3TAG A;  3LDP A;  4FZX C;  1U48 A;  2Q31 A;  1LAV A;  4HUE A;  3FZM A;  3IRX A;  3TSQ A;  2E2N A;  3SUP A;  2E5L K;  4BRE A;  4Y0W A;  1N32 K;  4CEQ A;  3BGR A;  5C25 A;  3O8M A;  4B9N A;  3HM9 A;  3OYG A;  4IO9 L;  1NK0 A;  2E6L A;  4DQQ A;  4YOX A;  2UU9 K;  2HMP A;  3K59 A;  1RTI A;  4O8K A;  4Z94 A;  1H1V A;  3M1F A;  3S3O A;  3CET A;  3FFI A;  3CPE A;  4PL7 A;  3AVL A;  2P5G A;  4O5B A;  3HTV A;  1HNZ K;  3IS9 A;  4CD1 A;  3FLC O;  4CEE A;  2FBY A;  4BRH A;  4BRO A;  2QM1 A;  4CJF A;  3U6F A;  4FJN A;  4FCY A;  1SL0 A;  4LD0 A;  1C0U A;  3TTD A;  3VQQ A;  4FSV A;  5SWM A;  4W5R A;  5GAH P;  1NJI O;  3BEX A;  4JI3 K;  5CYQ A;  3DM2 A;  4O0J A;  4BGA A;  4B3R K;  3N4P A;  4LFA K;  2NRV A;  3RRH A;  4FW2 A;  1WBB A;  3FGU A;  3L0Q A;  4DS4 A;  3EO3 A;  1HQU A;  1X9W A;  3D2E A;  3ZSX A;  4G1Q A;  3PSF A;  4CF9 A;  1TVR A;  3DLB A;  1IKW A;  2A6A A;  3BDP A;  4H4M A;  3V9U A;  4ISG A;  3SV3 A;  4PKG A;  4HTU A;  3ALY A;  1TL3 A;  4BDP A;  2IS3 A;  1JLF A;  2FXU A;  2IIR A;  4JS4 A;  2ZD1 A;  4YOV A;  4BRQ A;  4CVN E;  3CHW A;  4CIF A;  4DSK A;  4IOA L;  2UXD K;  4JAX A;  4I2P A;  4WFN L;  3SYZ A;  4DFM A;  1RDW X;  2QTD A;  1SKR A;  4MFB A;  1JLA A;  1VQ6 N;  1LWE A;  3MMV A;  1XMQ K;  4MO4 A;  4FM1 A;  2YHY A;  1L5U A;  3WXJ A;  5AZI A;  3TAE A;  4FJX A;  4JRP A;  3M8S A;  1SL2 A;  3J8A A;  2GBZ A;  1R59 O;  4DTJ A;  4J2B A;  2KKZ A;  5F0X A;  2O8D A;  1XNR K;  3ZET B;  1KLN A;  2VG5 A;  4K25 A;  2Q0U A;  3TAP A;  5C42 A;  4CFD A;  2YKM A;  4DWI A;  5DM6 L;  4DUY K;  1IJJ A;  1CXU A;  2KZZ A;  4DU3 A;  1CZA N;  3D2E B;  1BWF O;  3NF9 A;  3UE5 A;  1TAU A;  3J80 O;  4BRD A;  3AGR A;  3V81 A;  2F9W A;  3W0L A;  1C6V A;  3G25 A;  3QER A;  1CXQ A;  3VEX A;  1VQO N;  1WSF A;  3I0R A;  1TGO A;  1EWQ A;  1E4F T;  2V51 B;  4O8U A;  2BE2 A;  3IMX A;  2OAN A;  1E3M A;  2XY8 A;  5AQM A;  5LL6 Z;  4DV3 K;  1X9M A;  3C0B A;  5BR8 K;  1EET A;  1S1U A;  3QIO A;  5GAE P;  2FBX A;  4FLZ A;  2NRR A;  4RG8 A;  4IJA A;  1NKB A;  3JS6 A;  1QSY A;  5JVG L;  4OVL A;  4YDU C;  3IKM A;  3AAP A;  1S6P A;  3SMS A;  2H3G X;  2YHA A;  2GWK A;  4B9S A;  3LM2 A;  3O4N A;  1BI4 B;  4DR7 K;  5F2R A;  2EWS A;  4C23 A;  4CK3 A;  1X9J A;  3OS0 A;  1HRH A;  1G99 A;  3R9P A;  4OLB A;  4IFV A;  4XH5 A;  3T7Z A;  3K5M A;  1JXE A;  4DV6 K;  4KRF A;  4NYF A;  4N47 A;  5F1X A;  3VEN A;  3CCR N;  4DTU A;  3DRR A;  2O8D B;  1MWK A;  1RTJ A;  3AAR A;  5AQR A;  2A1R A;  2E6M A;  1JCE A;  4GV3 A;  2QW9 A;  1JLC A;  1J5E K;  2W6K A;  1BOT O;  1GLJ O;  1HR0 K;  3KLI A;  2A41 A;  3RRG A;  3LAM A;  4MDA A;  3S41 A;  4BRF A;  3F2K A;  4DCH A;  3ID8 A;  4M45 A;  3THY A;  3OYB A;  2NRH A;  4PKH A;  2X78 A;  4CI6 A;  1WSI A;  2HHV A;  3VEY A;  4CIE A;  2HHQ A;  1NMN A;  4BC4 A;  2QA4 N;  4LFB K;  2P9N A;  2QI2 A;  4H0X B;  4A57 A;  4X65 K;  1Q82 O;  1L3U A;  1OH5 A;  3ZCM A;  1NJY A;  1W0H A;  3I8B A;  3TU5 A;  4CZH A;  2AJQ A;  3T69 A;  2HBM A;  4E7H A;  1ZBS A;  4JI7 K;  2FF6 A;  1W97 L;  5AQW A;  4DR3 K;  4DG1 A;  4CGJ A;  2O8C B;  3MN6 A;  3QIC A;  1J54 A;  1YTA A;  4FWP A;  1JLB A;  4I7F A;  2OZS A;  2YKN A;  1N6Q A;  5AQJ A;  3BY5 A;  1RBT A;  4KHW A;  3DLL L;  4KHQ A;  1BU6 O;  2VGM A;  3F73 A;  5HRP A;  1V4T A;  3CXC M;  2W41 A;  4CEO A;  3LDN A;  2BAN A;  3G71 N;  3CI5 A;  4O44 A;  1D9D A;  3AVM A;  1HKB A;  1XI1 A;  3RSE B;  3LDO A;  5CZ2 A;  1BCM A;  2QWL A;  2BDP A;  3LAL A;  5C0Y A;  3OYA A;  1ZXO A;  1TYQ A;  3OYH A;  1B9F A;  3AV9 A;  3ZT2 A;  1X1P A;  3SZ2 A;  1Y97 A;  4DMN A;  3EEQ A;  3AVB A;  3DLR A;  3LPU A;  1YJW N;  5HLF A;  5BPN A;  2IGI A;  2WTU A;  4JN4 A;  3BUZ B;  1GOB A;  4YOY A;  3K0S A;  2HVH A;  1FXX A;  1ATR A;  2P9N B;  4CZE A;  3FZH A;  3OYE A;  2P9K B;  1MU2 A;  1SKS A;  3NMU A;  4G9Z A;  2GV9 A;  4GV6 A;  4EP5 A;  1GOA A;  1Z26 A;  4CEB A;  1Y64 A;  4Z4H A;  4FJG A;  1JLG A;  4CGI A;  5AFU A;  1NGI A;  3CMA N;  4OPA A;  4WFB L;  4FWN A;  4WF9 L;  4Z0U A;  2VWB A;  3SBG A;  1BQN A;  1BQM A;  5M1O A;  3NF7 A;  3OA9 A;  1RFQ A;  1VQN N;  3OS1 A;  1QHT A;  4F3T A;  2CGL A;  3O9T A;  3LWL A;  4NCG A;  3QB0 A;  4BE1 A;  4JK8 A;  3R8E A;  2YHB A;  1I3A A;  5HRN A;  4DV7 K;  3NVK A;  2YI1 A;  3U9Z A;  5HOO A;  4CBU A;  4ZHR A;  4FWS A;  1MDU B;  2Y1I A;  1UOC A;  5C2F A;  3TI0 A;  4E1J A;  3VA3 A;  2KHO A;  2G8V A;  2PYL A;  2QK9 A;  3MAQ A;  1TYQ B;  3OBW A;  3J7A P;  4DTN A;  3CJA A;  4B1Z A;  2NUB A;  1RBR A;  4CFC A;  4AIL C;  4DTO A;  4IEE A;  4YY3 K;  1VSI A;  1YIT N;  1IKV A;  3RR8 A;  2F8S A;  1NKC A;  1ASV A;  3CC4 N;  3RMB A;  3A0I X;  3VF2 A;  4ISE A;  2QXF A;  1G15 A;  1QQO A;  3A8Y A;  1T05 A;  4CJK A;  2GX9 A;  1HMV A;  4KH6 A;  5J2P A;  4FJ9 A;  4DSJ A;  3NGZ A;  2IAJ A;  2DFE A;  4B9V A;  3NAE A;  5JS1 A;  2D5R A;  4C1N I;  4CK1 A;  5HRS A;  3IAY A;  4CES A;  3PX6 A;  2UUA K;  4DV1 K;  4DQI A;  1XC3 A;  4FW1 A;  4DSI A;  1S72 N;  3LDS A;  4E1M A;  3OYJ A;  3T3F A;  4M3Z A;  4F8R A;  3ITH A;  2E20 A;  3MCA B;  3L2U A;  4DFK A;  1VQ5 N;  1IH7 A;  3QBW A;  3VMF B;  4KI6 A;  2P9L A;  1NGG A;  4HUF A;  4AHT A;  2FLO A;  4H0O A;  4J8F A;  4IXC A;  4MLE A;  4PHT X;  4FPA A;  3BF1 A;  3H3N O;  1XHZ A;  4JI5 K;  4CJT A;  5E41 A;  3LZI A;  1K8K B;  2VG7 A;  1FJG K;  3NH0 A;  1QS4 A;  3FFK B;  3ZSY A;  1VQ7 N;  1KVC A;  5AQT A;  1YUW A;  3V1O A;  1KCF A;  3L3U A;  5BPM A;  1ZBF A;  1NMD A;  3CPW M;  1QSL A;  1UAX A;  5D3G A;  3EL2 A;  4AM6 A;  3CM5 A;  4F9O A;  3VQD A;  3PX4 A;  4C8M A;  5KPZ A;  3VF4 A;  3QML A;  2CGK A;  4JKC A;  2GUI A;  3RWU A;  3KHY A;  3L2V A;  4BR7 A;  4OGC A;  1RDA A;  3AO2 A;  2DY4 A;  5M1F A;  2HVI A;  5T7B A;  1GLB G;  1KVB A;  4QS9 A;  5AQX A;  2FSJ A;  1ASU A;  1RNH A;  4LF5 K;  1OVQ A;  4JKG B;  2J4R A;  1VQL N;  1SZ2 A;  4KH4 A;  4CJ7 A;  4B1X B;  4CEA A;  1CZB A;  4WQ5 C;  4BRK A;  1S1T A;  2X74 A;  4JHD B;  2F4V K;  4CF8 A;  2Q36 A;  5GIN A;  4K0K K;  2CH5 A;  4ZTJ A;  3DOL A;  5AQL A;  2O8B A;  3DI6 A;  1VSJ A;  2VWK A;  1N5Y A;  3R1X A;  4LY7 A;  4DQP A;  1S1W A;  4FM2 A;  1HUX A;  3MN5 A;  3KIO A;  5FPM A;  3M8R A;  1VSM A;  4E19 A;  3QET A;  3DRS A;  4M41 A;  1Z25 A;  2W42 A;  3OHR A;  3T1A A;  1NK5 A;  2JWK A;  2O8F A;  2JGU A;  4H5V A;  4KPY A;  1T44 A;  4B9Q A;  2P9U A;  3WQT A;  1J9A A;  2Q1N A;  3OBY A;  2VG6 A;  4I9L A;  2QWO A;  5FPD A;  4E89 A;  3JYT A;  4K43 A;  3U8X A;  1IBM K;  3KLE A;  4DQ8 A;  3ZLJ A;  4O4G A;  4OGE A;  1BCO A;  4DB3 A;  1BG3 A;  4JK7 A;  4A2B A;  5FLX O;  4HUG A;  2HOE A;  2WC9 A;  3A5N C;  3AVF A;  3VTH A;  2FSN A;  3Q7B A;  4CW7 B;  4X62 K;  4RW6 A;  3E01 A;  1GOC A;  5HP1 A;  3MXI A;  2ZJQ L;  1QQN A;  5EU7 A;  2ETJ A;  5AQZ A;  1NOY A;  1N36 K;  3FZK A;  3OTO K;  4KTZ A;  4BRN A;  4CGD A;  3ZYY X;  1HYS A;  3HK2 A;  3HVR A;  4FJM A;  4FL9 A;  3H08 A;  4OJR A;  3QFU A;  2RHK A;  4CK2 A;  3W3D A;  5EVZ A;  2NNW A;  2ITG A;  2ZE2 A;  3AO1 A;  4N56 A;  2IDO A;  4H0V B;  1VQ8 N;  2Y1J A;  4AHV A;  1C1B A;  5JIC A;  1WSG A;  4CEF A;  1YTU A;  3MED A;  4M3X A;  3O3G A;  4H03 B;  3BZK A;  4M7Y A;  5CY4 A;  3T1Y K;  3GL1 A;  2OTL N;  2OTJ N;  3O1B A;  3CJ7 A;  4CFB A;  4E7J A;  4XIU A;  3MXM A;  5AQI A;  3H6E A;  1KRP A;  3K5N A;  1J53 A;  3VQP A;  4DUZ K;  3CCM N;  4PQU A;  3MEC A;  1NGF A;  2ZGZ A;  4C8K A;  1ILY A;  2RE2 A;  5FRO A;  3GE1 A;  4BR0 A;  4FZZ A;  4FWL A;  4B9U A;  3HI0 A;  4BR4 A;  2B5J A;  2P9I A;  4JNE A;  5ELZ A;  1IG8 A;  4O5F A;  3WXM B;  4NYN A;  4M3W A;  1RT4 A;  1DT9 A;  1LAW A;  3NH1 A;  2Z1H A;  1F21 A;  4FJH A;  1ITG A;  3DLH A;  2O4I A;  3LWM A;  1JL2 A;  1RBV A;  4LF8 K;  5BRD A;  1Q9Y A;  4FK2 A;  2I7P A;  3AA2 A;  2DFF A;  3GDQ A;  4E0D A;  1BHL A;  2D1K A;  3KK3 A;  2IC3 A;  3SUN A;  1VSL A;  3CJB A;  4ILH A;  5I42 A;  4FM0 A;  5M1P A;  3VEZ A;  4JKB A;  3KLH A;  2X6N A;  4BGB A;  3JSM A;  2D0O A;  1ZYQ A;  5H1S Q;  3OVN A;  1DLO A;  3VQ5 A;  3R3L A;  3HPO A;  3D0P A;  3GG4 A;  2HND A;  1HNW K;  2B6A A;  3AAQ A;  1S1X A;  5EX5 A;  4FLU A;  4B3T K;  1QSS A;  2GWJ A;  4IFE A;  3H3O B;  3CME N;  1C1A A;  3VQ8 A;  4B8C A;  1T8E A;  1K8A O;  3QLH A;  3H46 O;  3ATV A;  2G8F A;  3QDK A;  2E2Q A;  4PL8 A;  1A5W A;  1DTQ A;  3HM8 A;  3ZT3 A;  5CZ1 A;  3WXL A;  1XNQ K;  1T6D A;  4CJ4 A;  4CF2 A;  1U2V A;  3MN9 A;  4KTQ A;  2QKK A;  2PYJ A;  3SQ2 A;  4KO0 A;  2Z1I A;  1S3X A;  4BAC A;  3EKU A;  3O5B A;  3KVG A;  2GUP A;  4H0P A;  1S6Q A;  2D0C A;  3VPZ A;  4KFB A;  1LW2 A;  4FLT A;  3HT3 A;  1XWL A;  1L3V A;  2HB5 A;  2Z1G A;  3LPT A;  4CF0 A;  5AQF A;  5JMV A;  5AQN A;  3NBP A;  1NJW A;  5JS2 A;  1T3V A;  4EAH D;  2B4J A;  4JS5 A;  3IFR A;  2YJE A;  4DLG A;  2YCH A;  1SUQ A;  3BF3 A;  4BQL A;  4EFH A;  1HYZ A;  4R79 A;  5FPE A;  4BDZ A;  1V4S A;  5ADX H;  2D0B A;  3SLC A;  3DOK A;  4U7B A;  1ZBH A;  4YHH K;  3VQ9 A;  4OKE A;  4BRP A;  3H45 C;  5I3U A;  4NCB A;  4KAZ A;  2HHX A;  1GLL O;  4CBW A;  2FBV A;  2X6S A;  4KB0 A;  3CCU N;  2PAV A;  3DRP A;  5HBM A;  4CZJ A;  2WBN A;  4M3T A;  1TKX A;  3S9H A;  3L2W A;  4DQS A;  3QIN A;  1JLQ A;  1U2V B;  3DLK A;  3C65 A;  3THX A;  4KHP K;  1RTD A;  1YT3 A;  5AZI B;  5JLH A;  4IDH A;  1C0F A;  1GLC G;  3VTI A;  2WOM A;  1X9S A;  2UXB K;  2VYP A;  3FR0 A;  3DXM A;  3MDQ A;  3TSP A;  2E1Y A;  5EY4 A;  4GKJ K;  2CGJ A;  4JI4 K;  3NHG A;  1JJ2 M;  3RMD A;  4CJE A;  1TAQ A;  3UB5 A;  2HBJ A;  3AVC A;  3MCP A;  4A5B A;  3OJS A;  4CHY A;  1HPM A;  4I2Q A;  4FJ7 A;  1RCH A;  4U67 L;  2PY5 A;  1YHQ N;  3C7N A;  3KLF A;  1VQP N;  1LWC A;  2QWN A;  4Y1D A;  3O3H A;  3MXJ A;  4BWJ A;  4FVM A;  3EY1 A;  2XHB A;  3I0S A;  1KAZ A;  4BDY A;  2OYQ A;  4Q0B A;  1BO5 O;  4EZ6 A;  3MEE A;  1EP4 A;  4FYD A;  4FLY A;  1T6C A;  1S1V A;  3KK2 A;  4BQZ A;  1B9D A;  2VWJ A;  2OCE A;  2OPS A;  1U47 A;  4BG9 A;  1LOT B;  3NF6 A;  3DJC A;  1TK0 A;  4XEI A;  4FWO A;  1EXQ A;  2QWQ A;  3DXK A;  4BRC A;  1NG9 A;  5GIO A;  3EKS A;  2W40 A;  1N34 K;  4PUO A;  2HF3 A;  2YNF A;  2P9P A;  5B8H A;  1VK0 A;  2UXC K;  2I5J A;  1J5O A;  4FK4 A;  4V19 S;  3G6E N;  4DFP A;  2EHG A;  4DKW A;  2BH1 A;  4H0T B;  5AQU A;  3WEE A;  3SAF A;  1QVG M;  1YF5 L;  4CHP A;  2JLE A;  4ID1 A;  1N8R O;  2G8U A;  4F2S A;  2UUB K;  4CJP A;  3VOV A;  3RMA A;  4A5A A;  3EE9 A;  2G8W A;  4NXN K;  1TKT A;  3THY B;  3KKR A;  3SCX A;  1SAZ A;  2V7Z A;  1YJ9 N;  4AQY K;  5C15 A;  1NK4 A;  1BUP A;  3OYF A;  2WUS A;  3K57 A;  1TUU A;  3C7N B;  3SPY A;  3T19 A;  3OYD A;  2VQE K;  4GKK K;  1EO1 A;  4DHY A;  2YJF A;  3NH2 A;  3CFP A;  3ULD A;  3D2F A;  3F5T A;  2RN2 A;  3WT0 A;  4BRG A;  1HJO A;  4CGH A;  1D5A A;  3PLA A;  4CFA A;  3ULE A;  4C1N K;  1NGJ A;  1VRT A;  2HNY A;  5KQ8 A;  3O9Q A;  2HBK A;  4DSE A;  3P31 A;  1NJX A;  4LSN A;  4BC2 A;  4FK0 A;  3O3F A;  2DTU A;  4CJR A;  2GEL A;  1R0A A;  3M8P A;  3HP6 A;  1TL1 A;  1VSE A;  4QS8 A;  4FVU A;  1HNV A;  5LJV A;  5BN9 A;  4PKI A;  4GVM A;  3HOT A;  2ZJP L;  4NLB A;  1RT7 A;  3IDH A;  3CG7 A;  2OPP A;  1VAZ A;  4FJ8 A;  3C6U A;  4L8R B;  4B9L A;  1JL1 A;  3VEV A;  1Q86 O;  2OA8 A;  4DQR A;  4M3R A;  3ID6 A;  4JKA A;  4N41 A;  4WYB A;  1XHX A;  2AA4 A;  5AQP A;  4HCB A;  3HL8 A;  5DMR A;  1CLQ A;  1BL3 A;  3D6R A;  4CEC A;  3MWT A;  3KD5 E;  1KAX A;  3A5L C;  3CIP A;  4B8A B;  3FZL A;  4FJK A;  4E7I A;  1SV5 A;  3C6A A;  2D0P A;  3WUH A;  1DKG D;  4YDU A;  5KPR A;  4BE2 A;  3B6P A;  1RDU A;  3CYM A;  5M1K A;  4IOC L;  1JCG A;  1TKZ A;  4YOT A;  4UY8 O;  3THV A;  3AO3 A;  3VQC A;  3QEX A;  2F7T A;  3C6H A;  2DPN A;  2KLA A;  3L4Q A;  4GW6 A;  4H5N A;  4FXD A;  3V1Q A;  1XQS C;  1RGI A;  3VQE A;  4OPJ A;  4DR2 K;  4H5T A;  3CCJ N;  1JKH A;  3HVT A;  4DV5 K;  5LMU K;  1T7P A;  5KQD A;  5I9E B;  3JAM O;  3ULE B;  1NGB A;  1Z05 A;  2LSN A;  2RF2 A;  3AA3 A;  3VEO A;  3M6G A;  4CD3 A;  2HMI A;  3VES A;  1IBK K;  3GOI A;  2ASO A;  4YOR A;  3G10 A;  1LCU A;  1SQK A;  3QEP A;  4GVE A;  3ZSZ A;  4FJI A;  4M7X A;  3L8B A;  1NLV A;  3ZSQ A;  1ESV A;  4NB4 A;  4F2R A;  3V1R A;  4GV9 A;  1P8Z A;  3VQ6 A;  3WXK A;  3K5L A;  3PX0 A;  4OKK A;  1Q81 O;  3O4W A;  3SUO A;  2GTD A;  4M3U A;  1J6Z A;  2V52 B;  3O9R A;  4W5O A;  3KWG A;  4O0I A;  2F96 A;  2F9T A;  1IBL K;  3ZT1 A;  3B6O A;  3ZEU A;  3G0Z A;  4BRA A;  3AVA A;  3IG1 A;  1GLD G;  4F4K A;  4H5W A;  3ENB A;  4FOE A;  4DV2 K;  3AO4 A;  3LAK A;  4CHN A;  4CF1 A;  4FJL A;  2V7Y A;  3DWL A;  2PFU A;  4YOW A;  3WXI A;  3O6W A;  2F8T A;  2OPR A;  3OYK A;  4ILJ A;  2YHX A;  4CJU A;  4BRM A;  3SAH A;  4DF4 A;  3KTQ A;  4JK9 A;  3WNH A;  2VGN A;  3PUF A;  4O55 A;  5C24 A;  3ZX2 A;  4AM7 A;  1MA9 B;  1VSD A;  4LFC K;  3CJ1 A;  2QWR A;  4DR6 K;  4BC5 A;  1KD1 O;  5AR0 A;  4CEZ A;  1C1C A;  1P90 A;  5HRO A;  3U3G A;  3ZT4 A;  1SS6 A;  3KD1 E;  2ITM A;  4CZF A;  3Q7C A;  4CJ5 A;  4NCA A;  5AFU H;  2I7N A;  2P9L B;  1HYV A;  5CR4 A;  4PY5 A;  4AH9 A;  4JEP A;  3NGI A;  3TSU A;  4K42 A;  1FK9 A;  1NGD A;  5C10 A;  3QBX A;  3OYM A;  3PV8 A;  4B1W B;  1GLE G;  1S9E A;  4B3S K;  3O9U A;  1NGH A;  1FW6 A;  3O80 A;  3U4L A;  1UA1 A;  5CHI A;  4Y1C A;  4FOI A;  5AQK A;  4E1N A;  3V4I A;  1RDD A;  3L6Q A;  1NWK A;  3A2F A;  5DM7 L;  4IBN A;  1BIS A;  1X3M A;  3AVJ A;  3P1G A;  4CGG A;  1HQE A;  4AHU A;  1HKC A;  3V6D A;  1IKX A;  3EZ5 A;  1O1W A;  3HO1 A;  1C0T A;  2FSK A;  2YV0 X;  2QEX N;  3UIQ A;  3P39 A;  5SZT A;  1RTH A;  4PWD A;  1VHX A;  1VSH A;  4CIG A;  4RCH A;  1A5X A;  1BIZ A;  3ZSR A;  4ELT A;  1JCF A;  3L4I A;  5J2M A;  1WSE A;  3I8D A;  1ZBL A;  1B92 A;  3TWH A;  2UUC K;  3HZ6 A;  5M1N A;  2BTF A;  4W5Q A;  2KTQ A;  4EHU A;  2O8B B;  4DU4 A;  3TAF A;  5KRS A;  3CCV N;  5LY3 A;  1Q9X A;  1BDG A;  3LDL A;  1NKE A;  1NK9 A;  5AQG A;  4MQ3 A;  4ID5 A;  3AA5 X;  3TTC A;  4DSF A;  1NK6 A;  5JVH L;  3THW A;  1TUY A;  4K8X A;  4CED A;  4KBO A;  5BN8 A;  3AGK A;  4JKF A;  3BP8 A;  3VQA A;  4BE0 A;  4A59 A;  2O8F B;  4HHT A;  4ICL A;  3D45 A;  1IKY A;  1NU0 A;  5IT9 O;  4KH5 A;  1LV5 A;  2P9U B;  4IKF A;  3AO5 A;  4JI1 K;  2YX6 A;  3S3M A;  3SAG A;  4ISF A;  4JKD A;  3KKS A;  4N5S A;  1I39 A;  2P1J A;  5KRT A;  4JI8 K;  1OVY A;  4FLW A;  3HST B;  2Q0R A;  3NGY A;  3SJJ A;  3LZJ A;  3SQ4 A;  2XO7 A;  4YNQ A;  5FPN A;  3NE6 A;  2RPI A;  4CGF A;  1TK5 A;  2QXL A;  4J2D A;  3KK1 A;  4KHS A;  4ELU A;  4FWQ A;  3CCS N;  3MN7 A;  3H1V X;  1OH7 A;  4DR4 K;  1WAJ A;  5EOY A;  3L2Q A;  1NK8 A;  5FRM A;  5J2N A;  3CJ9 A;  3SQ0 A;  2Q97 A;  2P5O A;  4C8O A;  3VF6 A;  4CJS A;  1RT5 A;  4LF9 K;  3VEW A;  1WN7 A;  1ZBI A;  4HTL A;  5BR9 A;  3EZW A;  4EHT A;  2A5X A;  4WE1 A;  5KI6 A;  3O08 A;  2ASP A;  5K14 A;  2NZT A;  4FLX A;  4J2E A;  1X3N A;  3ZET A;  4CJL A;  3U3Y A;  3HSC A;  1LWF A;  3VQ7 A;  2HF4 A;  2HW3 A;  3CCQ N;  1BGX T;  3CC7 N;  1WBD A;  3H1Q A;  1VRU A;  2IVP A;  4M42 A;  3M3Z A;  3THW B;  4DF8 A;  1DGK N;  1NM1 A;  3I33 A;  3O1W A;  2HHT A;  4LF7 K;  3MEG A;  4FJJ A;  1RDC A;  2Z1J A;  4KB1 A;  2Q3S A;  5CYM A;  1EX4 A;  1WNS A;  3QIP A;  3G4S N;  4Z4I A;  1S9G A;  4C8N A;  5KGW A;  4WQ5 A;  4IOX A;  4IG3 A;  1VQM N;  3J81 O;  4RW4 A;  1ATS A;  4K8Z A;  3K9K A;  4I6M A;  4FWM A;  3KK7 A;  3OYI A;  1YIJ N;  2G8K A;  1YJN N;  2P9I B;  3SI6 A;  3NCI A;  3AY9 A;  4N76 A;  1DTT A;  3E9L A;  1ZBU A;  3NVM A;  3CC2 N;  1BI4 A;  1BA1 A;  1QZ5 A;  3V9S A;  1VQ9 N;  1YVN A;  4CJ3 A;  3KLG A;  1XC9 A;  5E26 A;  1VQK N;  1U49 A;  1RIL A;  4A62 A;  3UKR A;  1D9F A;  1XMO K;  3LP1 A;  2NRT A;  4J2A A;  3CER A;  1K6Y A;  4FWK A;  5AQQ A;  5C12 A;  2G8I A;  4OLA A;  2KZM A;  1KC8 O;  2EX3 A;  3SMP A;  1K9M O;  3AVH A;  4RWT A;  3QEI A;  2KQ2 A;  4B3O A;  4M3Y A;  4F3O A;  4OPK A;  4E7K A;  2WFB A;  2CH6 A;  1I94 K;  3RTV A;  2IVO A;  3HPH A;  2UYT A;  3LM9 A;  2D4W A;  4DFJ A;  1BA0 A;  3MK6 A;  3A5O C;  1WSJ A;  4KV8 A;  2FBT A;  3TTF A;  5LMN K;  2XY7 A;  4DR5 K;  2NRW A;  5GAD P;  2FF3 B;  3QEV A;  1JLE A;  3E66 A;  4UQG A;  1KLM A;  3SNN A;  1HX1 A;  4I6M B;  4CHO A;  4QOZ B;  3CJC A;  2A1S A;  3S3N A;  5J2Q A;  3CM6 A;  5BRH A;  2O8C A;  3EYZ A;  1OH6 A;  2O4G A;  4FJ5 A;  4BG8 A;  1KSP A;  4DU1 A;  1NOZ A;  4E3S A;  5AZJ A;  3CD6 N;  3HP9 A;  1Q8I A;  2HHU A;  1YVU A;  3KJV A;  4GNI A;  1E4G T;  4KI4 A;  5BRF A;  3KZB A;  3UKR B;  3NDK A;  3VQ4 A;  3PSI A;  1TV6 A;  3LL3 A;  4IFY A;  1U04 A;  5IWA K;  3PO4 A;  2HHS A;  1HPZ A;  2A40 A;  2OPQ A;  3WNG A;  4H4O A;  3SJH A;  3QFP A;  5AQY A;  5AQO A;  4JKE A;  2ZJR L;  2YNI A;  3CQ8 A;  3LAN A;  3WNE A;  3RSE A;  2RKI A;  3FZF A;  1KFD A;  4RW9 A;  4OPH A;  1L3S A;  4RTF D;  4KHY A;  1REV A;  4LSL A;  1M90 O;  1WB9 A;  4YFU A;  2ZM6 K;  4CCH A;  3OY9 A;  2IOC A;  1NK7 A;  3VGM A;  1M1K O;  1WLJ A;  4B9M A;  1QQM A;  5GAG P;  3F9M A;  3NF8 A;  3P83 D;  4CHZ A;  4Z4C A;  4Q5V A;  2VQF K;  1CZ9 A;  3C95 A;  4GMJ B;  3ATU A;  3O9S A;  3ZSO A;  3SBT A;  2P9K A;  4CZI A;  4JRQ A;  4EZ9 A;  2AP1 A;  1HNI A;  3VGL A;  3THX B;  4L3Q A;  4DV0 K;  1VSF A;  4CZG A;  2HHW A;  5GIP A;  1U4B A;  1EWR A;  3LP3 A;  3SQ1 A;  2O8E A;  4BR2 A;  4LC9 B;  1ATN A;  3L2R A;  3DMJ A;  4Z4E A;  1HLU A;  4BRL A;  2E4L A;  4CZM A;  3DXM B;  5AZJ B;  4MLH A;  4BVP A;  2FC0 A; 
#chains in the Genus database with same CATH homology
 4FL9 A;  4GVE A;  4EIA A;  3QFU A;  2RHK A;  2YHW A;  3ZET B;  4M7X A;  3W3D A;  4BR5 A;  1NLV A;  4K25 A;  5EVZ A;  1ESV A;  2Q0U A;  3CQY A;  4ILG B;  1HKG A;  2NNW A;  4NB4 A;  3PIO L;  3GBT A;  2Q2R A;  3LDQ A;  4GV9 A;  1NGE A;  3OW2 M;  5DM6 L;  1P8Z A;  4H0V B;  4IZ9 A;  1VQ8 N;  3WXK A;  1IJJ A;  1XUP O;  4A2A A;  5JIC A;  1CZA N;  3D2E B;  1BWF O;  1Q81 O;  3O4W A;  4IJN A;  2GTD A;  3UE5 A;  1J6Z A;  2V52 B;  3O9R A;  4H03 B;  3KWG A;  4BRD A;  2F9T A;  3AGR A;  2F9W A;  4FPB A;  4M7Y A;  3W0L A;  3GL1 A;  2OTL N;  4B1U B;  3O1B A;  3ZEU A;  2OTJ N;  3G25 A;  4BRA A;  2HST A;  3CJ7 A;  3MX2 A;  3VEX A;  1VQO N;  2NLX A;  2E2P A;  4WQ4 C;  3VER A;  1GLD G;  3ENO A;  5AQI A;  4H5W A;  3H6E A;  3ENB A;  4FOE A;  3JXU A;  1E4F T;  2V51 B;  4O8U A;  3IMX A;  5E84 A;  3CCM N;  2OAN A;  2V7Y A;  3DWL A;  2PFU A;  5AQM A;  1NGF A;  1C0G A;  2ZGZ A;  3C0B A;  4YOW A;  1ILY A;  3WXI A;  3O6W A;  3PIP L;  2RE2 A;  3GE1 A;  4BR0 A;  5GAE P;  4ILJ A;  2YHX A;  4FWL A;  4BRM A;  3SAH A;  2NRR A;  2QWM A;  2P9S A;  3HI0 A;  4IJA A;  3JS6 A;  4JK9 A;  5JVG L;  1MWM A;  2VGN A;  4YDU C;  3IKM A;  2P9I A;  3AAP A;  4BR4 A;  4JNE A;  2H3G X;  3SMS A;  3ZX2 A;  2GWK A;  4AM7 A;  1MA9 B;  3KWI A;  3LM2 A;  5ELZ A;  3K9J A;  1IG8 A;  3CQX A;  3R6M A;  3CJ1 A;  2QWR A;  3DXK B;  4O5F A;  3WXM B;  5F2R A;  4BC5 A;  1DT9 A;  5JLF A;  2EWS A;  4C23 A;  1KD1 O;  1X9J A;  4BRI A;  4BC3 A;  5AR0 A;  3R9P A;  1G99 A;  2P9P B;  1P90 A;  5BRD A;  1SS6 A;  4XH5 A;  3UKU A;  3T7Z A;  3J7Z O;  4CZK A;  2ITM A;  4CZF A;  2I7P A;  3GDQ A;  3Q7C A;  5AQS A;  2D1K A;  5AFU H;  2I7N A;  2P9L B;  5F1X A;  3CJB A;  4ILH A;  3WEE B;  2NRZ A;  3VEN A;  3CCR N;  2E2O A;  1MWK A;  3AAR A;  5AQR A;  5CR4 A;  3ZX3 A;  1JCE A;  5BRE A;  5M1P A;  3VEZ A;  4JKB A;  4JEP A;  1KXP A;  4BGB A;  3TSU A;  4K42 A;  4GV3 A;  2QW9 A;  1K73 O;  2D0O A;  1NGD A;  5C10 A;  3U9D A;  5H1S Q;  3QBX A;  1BOT O;  3R3L A;  4B1W B;  1GLJ O;  2A41 A;  1K8K A;  3GG4 A;  3MX5 A;  1GLE G;  3AAQ A;  1VQ4 N;  5EX5 A;  4MDA A;  3S41 A;  4BRF A;  2GWJ A;  3F2K A;  4DCH A;  3ID8 A;  4IFE A;  1D4X A;  3H3O B;  3CME N;  2NRH A;  3ZX0 A;  3O9U A;  4PKH A;  1K8A O;  4CI6 A;  1NGH A;  3VEY A;  3I55 N;  3O80 A;  4BC4 A;  2QA4 N;  3U4L A;  3H46 O;  2P9N A;  3ENH A;  3ATV A;  3D2F B;  3EE8 A;  2QI2 A;  5CHI A;  1WUA A;  4H0X B;  4A57 A;  1Q82 O;  4FOI A;  5AQK A;  3QDK A;  2E2Q A;  4PL8 A;  3HM8 A;  3A5M C;  3WXL A;  3L6Q A;  1NWK A;  3I8B A;  3TU5 A;  1T6D A;  4CZH A;  5DM7 L;  3T69 A;  1U2V A;  3MN9 A;  4WFA L;  1X3M A;  5LJW A;  2HBM A;  5AQV A;  1HKC A;  1ZBS A;  2FF6 A;  1W97 L;  2FSK A;  5KPT A;  4JKG A;  1S3X A;  5AQW A;  2QEX N;  2P9S B;  3P39 A;  3EKU A;  3O5B A;  4HWI A;  3MN6 A;  3KVG A;  2GUP A;  2HBL A;  3QIC A;  4H0P A;  4RCH A;  3HOS A;  1JCF A;  3L4I A;  4FWP A;  5C2D A;  4NLC A;  3VPZ A;  2GEM A;  5AQH A;  3VET A;  3HZ6 A;  4JHD A;  2BTF A;  5AQJ A;  5M1N A;  4EHU A;  2E88 A;  3DLL L;  2QWP A;  5AQF A;  4AF1 A;  5JMV A;  3CCV N;  1BU6 O;  5AQN A;  3UKU B;  2VGM A;  5LY3 A;  1S22 A;  1T3V A;  1BDG A;  3LDL A;  4EAH D;  3P4I A;  1V4T A;  5AQG A;  3CXC M;  2W41 A;  3G71 N;  3LDN A;  3CI5 A;  3TTC A;  3E9O A;  5JVH L;  1TUY A;  3IFR A;  2YJE A;  4MDB A;  1HKB A;  2YCH A;  4KBO A;  5BN8 A;  3AGK A;  4JKF A;  3RSE B;  3BP8 A;  3BF3 A;  3LDO A;  4BQL A;  4A59 A;  5HL7 L;  4BY9 C;  2QWL A;  5C0Y A;  4EFH A;  1ZXO A;  1TYQ A;  1KQS M;  4R79 A;  5FPE A;  1ZC6 A;  1W2B M;  4KH5 A;  1V4S A;  2P9U B;  5ADX H;  3SLC A;  4U7B A;  2YX6 A;  3SAG A;  4IWV A;  4ISF A;  4JKD A;  1WOQ A;  4MO5 A;  1NGA A;  4BRP A;  3H45 C;  5TKY A;  4IEI A;  1OVY A;  1QHA A;  1YJW N;  1GLL O;  2Q0R A;  4CBW A;  2IVN A;  4FO0 A;  5BPN A;  2ZWH A;  4JN4 A;  3BUZ B;  1EQY A;  5FPN A;  4WCE L;  4YOY A;  3CCU N;  2P9N B;  1ATR A;  4CZE A;  2QXL A;  2PAV A;  3FZH A;  4CZJ A;  2WBN A;  2P9K B;  4FWQ A;  4GY2 B;  4YOU A;  3RVC A;  3CCS N;  3M5R A;  3NMU A;  4G9Z A;  3MN7 A;  4GV6 A;  3H1V X;  3VGK A;  1U2V B;  5EOY A;  4M63 C;  3C65 A;  3IUC A;  3DAW A;  3FE1 A;  4CBX A;  1Y64 A;  5TKW A;  4XH1 A;  3WQU A;  5AFU A;  1NGI A;  4XH4 A;  3CJ9 A;  2Q97 A;  3CMA N;  3VF6 A;  4OPA A;  4WFB L;  3CCL N;  4FWN A;  3VEW A;  4WF9 L;  5AZI B;  4JD2 A;  4NO7 A;  4JKH A;  4IDH A;  1NGC A;  5JLH A;  5BPL A;  4HTL A;  5BR9 A;  2VWB A;  1C0F A;  1GLC G;  3EZW A;  3SBG A;  3VTI A;  5M1Q A;  4EHT A;  2A5X A;  5M1O A;  3TPQ A;  3OA9 A;  1RFQ A;  1VQN N;  3O08 A;  2ASP A;  2VYP A;  3FR0 A;  2NZT A;  2CGL A;  3DXM A;  3MDQ A;  3O9T A;  2ASM A;  5EXW A;  3TSP A;  3QB0 A;  2E1Y A;  2ZF5 O;  4JK8 A;  3R8E A;  1Q7Y O;  1X3N A;  5EY4 A;  3ZET A;  2CGJ A;  3HSC A;  1JJ2 M;  3NVK A;  1YXQ A;  1KAY A;  2HF4 A;  2YI1 A;  3CCQ N;  4BR9 A;  3CC7 N;  3U9Z A;  3H1Q A;  3E9P A;  3UB5 A;  2HBJ A;  2IVP A;  3M3Z A;  4CBU A;  4FWS A;  1MDU B;  5HOO A;  1DGK N;  1NM1 A;  3I33 A;  4WQ4 A;  3MCP A;  5C2F A;  4A5B A;  4E1J A;  2KHO A;  3O1W A;  1O13 A;  1OKJ A;  1GLF O;  1HPM A;  3EN9 A;  3E1Y A;  2A3Z A;  4U67 L;  1TYQ B;  3OBW A;  4BVO A;  1YHQ N;  3ZEU B;  3C7N A;  2A42 A;  3CJA A;  1GLA G;  4B1Z A;  1VQP N;  4IEE A;  1YAG A;  1YIT N;  2QWN A;  5CE3 A;  3D7E O;  1QZ6 A;  4A61 A;  3CC4 N;  1KAZ A;  3A0I X;  4FWR A;  3G4S N;  3VF2 A;  4ISE A;  4CZL A;  4H0Y B;  4WQ5 A;  4IOX A;  1VQM N;  1BO5 O;  2JWL A;  4B1Y B;  4IO8 A;  1QQO A;  3A8Y A;  3MWP A;  1ATS A;  2GX9 A;  3K9K A;  4I6M A;  4FWM A;  3KK7 A;  1T6C A;  4KH6 A;  2VCP A;  1YIJ N;  4BQZ A;  2P9I B;  1YJN N;  1DEJ A;  3AY9 A;  4BG9 A;  2BUP A;  4C1N I;  5MLC Q;  3E9L A;  3NVM A;  4QS7 A;  3CC2 N;  1LOT B;  1Q18 A;  3DJC A;  4XEI A;  4FWO A;  1BA1 A;  1QZ5 A;  2QWQ A;  3DXK A;  4BRC A;  1YVN A;  5GIO A;  1U6Z A;  3EKS A;  1VQ9 N;  1Z6R A;  2W40 A;  3HRG A;  1XC3 A;  5E26 A;  2PBD A;  1S72 N;  1VQK N;  1YI2 N;  2HF3 A;  2NRX A;  4K41 A;  4A62 A;  4JD2 B;  4B1V A;  2P9P A;  3UKR A;  5B8H A;  3I56 N;  2E20 A;  2NRT A;  3MCA B;  1VQ5 N;  3G6E N;  3CER A;  1QVF M;  3N4Q A;  3QBW A;  4FWK A;  2ZGY A;  5AQQ A;  3VMF B;  2E8A A;  4OO1 J;  4DKW A;  2BH1 A;  1NGG A;  2P9L A;  4H0T B;  5AQU A;  3WEE A;  5C12 A;  5ADX A;  1YF5 L;  3SAF A;  2FLO A;  4H0O A;  4H5R A;  4J8F A;  1QVG M;  1NBW A;  1KC8 O;  3HBT A;  3CCE N;  4IXC A;  3SMP A;  4MLE A;  3SK3 A;  4PHT X;  4FPA A;  1K9M O;  1N8R O;  3BF1 A;  3H3N O;  4RWT A;  3P38 A;  3B8A X;  3VOV A;  1K8K B;  2E1Z A;  3CF5 L;  4A5A A;  2WFB A;  3EE9 A;  2CH6 A;  2IVO A;  3FFK B;  2UYT A;  3LDP A;  1VQ7 N;  1SAZ A;  2V7Z A;  2Q31 A;  1YJ9 N;  3FZM A;  3LM9 A;  5AQT A;  2D4W A;  3TSQ A;  1YUW A;  2E2N A;  5C15 A;  1BUP A;  5BPM A;  1BA0 A;  2WUS A;  3CPW M;  1NMD A;  3MK6 A;  4Y0W A;  4BRE A;  3EL2 A;  3A5O C;  1TUU A;  3C7N B;  4AM6 A;  4F9O A;  3O8M A;  1EO1 A;  3TTF A;  4DHY A;  2YJF A;  5KPZ A;  3VF4 A;  3QML A;  2CGK A;  4JKC A;  4IO9 L;  3D2F A;  3F5T A;  2NRW A;  3KHY A;  2FF3 B;  5GAD P;  4YOX A;  2HMP A;  4BR7 A;  3WT0 A;  4O8K A;  4BRG A;  1HJO A;  4Z94 A;  1H1V A;  3M1F A;  5M1F A;  3PLA A;  1GLB G;  4QS9 A;  5AQX A;  3E66 A;  3ULE A;  2FSJ A;  4C1N K;  3CET A;  3CPE A;  1NGJ A;  4PL7 A;  1HX1 A;  4JKG B;  5KQ8 A;  3O9Q A;  2HBK A;  2J4R A;  1VQL N;  3P31 A;  4I6M B;  1SZ2 A;  4BC2 A;  3HTV A;  4KH4 A;  4CJ7 A;  4CD1 A;  2GEL A;  3CJC A;  3FLC O;  4BRH A;  4BRO A;  5BRH A;  4QS8 A;  2QM1 A;  4FVU A;  5LJV A;  4BG8 A;  4B1X B;  5BN9 A;  4PKI A;  4WQ5 C;  3TTD A;  4BRK A;  3HOT A;  2ZJP L;  5AZJ A;  4JHD B;  4NLB A;  3CD6 N;  3IDH A;  4FSV A;  5GAH P;  1NJI O;  2Q36 A;  1VAZ A;  5GIN A;  4GNI A;  2CH5 A;  1E4G T;  3BEX A;  3VEV A;  3KZB A;  3UKR B;  5BRF A;  3LL3 A;  5AQL A;  1Q86 O;  4BGA A;  3R1X A;  3N4P A;  2A40 A;  2NRV A;  3SJH A;  3QFP A;  5AQY A;  3ID6 A;  5AQO A;  4JKA A;  1HUX A;  3MN5 A;  4JKE A;  3FGU A;  3L0Q A;  4WYB A;  5FPM A;  3EO3 A;  2ZJR L;  3D2E A;  2AA4 A;  5AQP A;  3RSE A;  3FZF A;  3D6R A;  3OHR A;  4OPH A;  2JWK A;  3MWT A;  4RTF D;  1KAX A;  2A6A A;  3A5L C;  4H5V A;  1M90 O;  1T44 A;  3CIP A;  4B9Q A;  3FZL A;  2P9U A;  4ISG A;  3WQT A;  3C6A A;  2Q1N A;  3OBY A;  2D0P A;  4PKG A;  3WUH A;  2QWO A;  5FPD A;  3VGM A;  1M1K O;  4K43 A;  2FXU A;  1DKG D;  2IIR A;  1QQM A;  4YDU A;  3U8X A;  5GAG P;  1RDU A;  5KPR A;  5M1K A;  4IOC L;  3F9M A;  1JCG A;  4YOT A;  4BRQ A;  4YOV A;  4UY8 O;  4DQ8 A;  3CHW A;  4IOA L;  2F7T A;  3C6H A;  2DPN A;  2KLA A;  3L4Q A;  4H5N A;  4JAX A;  4WFN L;  1XQS C;  1RGI A;  4H5T A;  3CCJ N;  3ATU A;  3O9S A;  4DB3 A;  3SBT A;  1BG3 A;  2P9K A;  4JK7 A;  4A2B A;  4CZI A;  1RDW X;  2HOE A;  2QTD A;  5KQD A;  5I9E B;  2WC9 A;  2AP1 A;  3A5N C;  3VTH A;  2FSN A;  3Q7B A;  3ULE B;  3VGL A;  4L3Q A;  1VQ6 N;  4CZG A;  3MMV A;  2ZJQ L;  1QQN A;  1NGB A;  4MO4 A;  5GIP A;  5AQZ A;  1Z05 A;  2YHY A;  3FZK A;  4BR2 A;  3VEO A;  4BRN A;  3M6G A;  4LC9 B;  5AZI A;  3WXJ A;  4CD3 A;  1ATN A;  1HLU A;  3VES A;  3ZYY X;  3J8A A;  4BRL A;  3GOI A;  2ASO A;  4YOR A;  1R59 O;  4CZM A;  2KKZ A;  3DXM B;  5AZJ B;  5F0X A;  1LCU A;  4MLH A;  4BVP A;  1SQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...