5C10A

Nuclease domain of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
242
structure length
230
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
total genus 82
structure length 230
sequence length 242
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c10A00
5C10A 4IDHA 5M1PA 5C15A 5C2DA 4IEIA 4IFEA 5M1QA 5C12A 3CPEA 5M1OA 5C2FA 5M1NA 5M1KA 3C6AA 5M1FA 4IEEA 3C6HA
chains in the Genus database with same CATH superfamily
3PO5A 4BQZA 1FKPA 3FR0A 1QTMA 1TKXA 4Z4FA 3CQXA 4FWMA 1UA0A 1NOZA 2KZMA 1NK5A 4L3QA 4KTZA 1WLJA 4YOWA 4IOCL 4DMNA 4CD1A 3K9JA 1Q81O 4CJ7A 5FRNA 4FLXA 1HNZK 1GLDG 3E66A 3O9UA 2JWKA 3AA5X 3TTCA 5JS2A 3VQ4A 3OJSA 1C0FA 4DV4K 1P8ZA 4IBNA 4C8LA 1SZ2A 4HVJA 2ETJA 2KFZA 4CBUA 2YHWA 3THVA 2YHAA 3UKUA 2HNZA 2X74A 4F4KA 1N36K 1JCEA 1J9AA 3LDLA 2YNIA 3CCEN 4FJIA 4JK8A 3SI6A 3C65A 3OW2M 4B9MA 1YAGA 4RWTA 1Q86O 3T1HK 2NRHA 3ENHA 4ZHRA 1KLNA 4FPBA 4CFCA 1RCHA 3H45C 3A0IX 4H5RA 2FBVA 3LM2A 3EYZA 3P5JA 3C0BA 4CGHA 3P1GA 4XIUA 3O1WA 3HT3A 4CJEA 2P9SB 1OH6A 4O0JA 4CJSA 3THWB 4DR6K 4OKEA 4O0IA 3ENOA 3THXA 3SAFA 3DYAA 4H0YB 1T7PA 4WQ5A 2CGLA 2P9LB 4IJNA 4CF2A 1EETA 4DSEA 3TAMA 5JLHA 4B9NA 2PZSA 1GOCA 1EQYA 3MXIA 1RNHA 3CERA 1QS4A 5EY4A 3L0QA 4QS9A 3CI5A 5JICA 2QEXN 2P5OA 3IG1A 2HB5A 4AHTA 3VGMA 4CK1A 3VQ6A 3H1VX 4AH9A 4BGBA 4UQGA 5FLXO 4QAGA 1CZAN 3VEXA 4CW7B 2FBXA 4YHHK 5H1SQ 2D0PA 3VENA 3HPOA 1RDAA 3QFUA 4JKBA 2GWJA 3SJHA 3TU5A 3OYNA 3CCUN 3L2WA 4FM0A 1ATNA 3CQYA 2I7NA 4GV3A 3LP2A 4CZHA 4OPJA 3VTHA 4KHYA 1YVUA 1CZ9A 1J54A 3EE9A 2O8CB 4B1VA 3OJUA 1KAZA 3WEEB 1SV5A 2EWSA 1RT5A 1BOTO 3D7EO 5AQNA 3PUFA 2PBDA 3SQ4A 3O6WA 3F9KA 3D2FB 5AQUA 5AZJB 4JHDB 3KK3A 1JLBA 1G99A 1KXPA 3DLRA 2OPQA 4LSNA 3LAKA 1VSIA 2RN2A 3SBTA 4B3TK 1W97L 3DXMB 5AZIB 4BC2A 3ZT1A 1RT6A 2KZZA 4OLBA 1TKTA 2QWPA 3AGRA 3HI0A 1EWRA 3VTIA 4I9QA 2F4VK 3J7AP 5KQ8A 2QK9A 1QZ5A 1WSEA 4DB3A 1EXQA 1HNIA 3C95A 2D0CA 4WYBA 4KB1A 1TK5A 4E89A 1HUXA 4GKKK 3VEOA 3QINA 1S1TA 1LOTB 5LJVA 3THYA 3CFOA 4I6MB 4HUEA 1RT2A 2VWKA 4M3ZA 1S9GA 4RW7A 2ASPA 3MECA 1G15A 1LAVA 5C24A 3TAFA 4OLAA 3NGIA 3PX6A 4R79A 4FLUA 1QVFM 4PUOA 3OVNA 3LDNA 1HQEA 1S1VA 4H0XB 2YNGA 2XHBA 4CGGA 3VQQA 3ZSVA 2HHQA 3NGYA 5GIPA 4KRFA 1X3MA 2HW3A 3OYFA 3QESA 4CHNA 1TYQA 3FLCO 4DR5K 5T7BA 4FJKA 4Q0BA 4E7JA 4XH1A 5SWMA 2HVIA 3DJCA 4JK7A 4BR4A 3K59A 3I56N 3WXJA 1WSJA 3BF3A 1N8RO 3H08A 3DOLA 1YUWA 3OBYA 3KKSA 3RTVA 3VQBA 3U8XA 4FWOA 2G8IA 4KH4A 4G9ZA 1ASWA 4CEQA 3VQEA 4BE0A 5HP1A 1D5AA 5KI6A 4F8RA 4ISGA 4YOXA 4QCLA 1VK0A 4GVMA 3OY9A 4CGFA 1S3XA 4M42A 3VQ7A 4CJ5A 1RBUA 3C7NB 3H6EA 3SQ2A 2BH1A 1BI4A 5B8HA 4OVLA 3HP6A 2Q0UA 3BY5A 3MDQA 2JWLA 2QXFA 4JEPA 1LV5A 4OO1J 4IKFA 1ZXOA 4R5PA 2P9NA 1VHXA 1VQMN 2QTDA 3M8QA 3O3GA 2RF2A 5AQHA 3AVCA 5DM6L 4FWKA 3BGRA 3TR8A 1IJJA 2O8BB 2A5XA 3RSEA 3ZT4A 3O3FA 1YTUA 4PL7A 1L5UA 4JI0K 1KTQA 4CHZA 1T8EA 3VQ9A 4BR7A 1VSHA 2E1YA 2VQFK 3DRRA 2G8VA 4B8CA 4FJXA 3AVLA 3BZKA 1HPMA 3C6TA 4HTLA 3DI6A 1NG9A 4DUZK 5LL6Z 2ZJPL 1ZBIA 3CCVN 2OPRA 3KTQA 3RRGA 3F73A 3PO4A 4FOEA 1RTDA 1QZ6A 3CJ9A 1HKGA 3C6AA 4ISFA 4DTRA 4WF9L 4CJUA 3OS2A 3S3OA 1CXUA 2NRWA 1NK4A 4BVPA 4DSLA 3QDKA 4BRQA 2WUSA 3F5TA 1BHLA 3PX4A 3SQ0A 1BQMA 3TTFA 1P90A 4LFBK 3CG7A 4W5OA 2YNFA 3AA4A 3P83D 3G4SN 2OYQA 3OHRA 4IEIA 4DQSA 4Z4IA 4JV5K 2HMPA 4N41A 4FPAA 3N4QA 4DR1K 1I39A 3MXMA 2GELA 3FE1A 4FWSA 1OKJA 1KVCA 2FSJA 1NGGA 5GAGP 4CEDA 2GUPA 4H0VB 4EAHD 3PLAA 5E26A 3GE1A 3DLLL 4Q5VA 3SNNA 1Y64A 1NKCA 2WTUA 4G1QA 2A41A 2E2OA 3CC2N 4DFPA 4A5AA 3G25A 3R1XA 3OYDA 1K9MO 4X66K 3VQDA 1ZC6A 2XY8A 4FJNA 2YX6A 5HL7L 1BIZA 1NJWA 3OYKA 3ZEUA 1OVQA 3AVMA 5HOOA 3LAMA 4I2QA 4FK0A 3NGZA 4BACA 2UXBK 4BGAA 3V9ZA 3CJAA 3NE6A 4CZJA 3FZKA 1NGAA 4JS5A 5J2NA 1TUYA 4DF8A 4LFAK 1RTHA 3EEQA 4BDYA 3SAHA 2QKKA 3KD1E 1HR0K 4FXDA 2HBKA 4CJQA 1U04A 2WOMA 3SCXA 4HUGA 4L8RB 2H3GX 4NLCA 3QO9A 2XRIA 2YKNA 1RDCA 3SK3A 4IJAA 5BR8K 3DXKA 1HX1A 1GLBG 3MCPA 4W5QA 3SPYA 4MO5A 3WNEA 3P38A 4CD3A 4CCHA 4E3SA 1S72N 1GLFO 4FO0A 3L2RA 4LH5A 2BUPA 1XUPO 3SUQA 2QM1A 4CEFA 1JXEA 4EP5A 4KHPK 3PX0A 1KSPA 4JI4K 4BRAA 2DFEA 3QICA 2O8FA 5CY4A 1ZBHA 4B3OA 2IS3A 4QS8A 4DU4A 4BRPA 4DV2K 3ZLJA 3ULDA 4LFCK 3KJVA 4LD0A 4DV3K 2HNDA 3QEIA 1MDUB 2OANA 4W5RA 5AQFA 4WQ5C 1REVA 3AVJA 4JD2B 1N32K 1LW0A 4FJGA 1JLEA 3T1YK 4H4OA 4XH5A 1N5YA 3AVNA 3CD6N 2LSNA 2P9PA 1XWLA 4BRFA 4CZGA 1K8KB 4CI6A 4ID5A 4HWIA 4RW8A 3G10A 2QWRA 4KTWA 3LZIA 5SZTA 2ZD1A 2QWNA 1NK0A 4KO0A 1LWCA 3CFPA 2E1ZA 1XI1A 4FM2A 1E3MA 4DLGA 4JI1K 2DPNA 4GW6A 3V1QA 2Y1JA 1LWFA 5I9EB 3NBPA 1LCUA 1SL2A 1KAYA 3UKRB 3DLKA 4BRGA 3CMEN 4OPAA 1IBMK 5J2PA 1YJNN 1KC8O 4JI6K 4I7FA 4YY3K 3A5NC 1U45A 1TAUA 4E7IA 3S3NA 3E9LA 1HNXK 1XMQK 4KPYA 4KH6A 4F2RA 3ZSYA 1W7AA 2DFHA 1WSFA 1YF5L 1BA0A 1DEJA 4ELTA 3P39A 1NM1A 1T44A 2NLXA 2P9UB 3KHYA 1SL0A 4DQIA 4OGEA 1C0UA 1IKWA 1U2VB 3ISNC 1WBDA 3TANA 1K8AO 1T6CA 3KLHA 1KVBA 3LZJA 4FM1A 4DTOA 4E1JA 4C8OA 1ATSA 1SAZA 1X9JA 5FPMA 4CERA 2O4GA 3CCSN 2OPSA 1CXQA 4CJWA 4BRHA 4DKWA 2VG5A 1W2BM 4A61A 1VSKA 2O8DB 1TV6A 4RCHA 3PIPL 2D0OA 2KQ2A 4YOYA 1YT3A 4FJ7A 1S22A 4NYFA 5EVZA 3NAEA 3V9SA 4KBOA 1UAXA 1MWMA 1QQCA 1NWKA 4BRMA 3N4PA 3O8MA 4YDUA 2G8HA 2Q36A 4I9LA 3B8AX 4KAZA 4BVOA 3EL2A 3H1QA 4C23A 1GLEG 5AQSA 3T7ZA 1TK8A 1JLGA 4M45A 3HSCA 5CR4A 1VQKN 3MN9A 1D9DA 1A5VA 1NU0A 1K6YA 4JI7K 3HK2A 2XY7A 1VSEA 3KWGA 4JKGA 4FW1A 2KHOA 1X1PA 2P9IA 4BE2A 3VQ8A 3QEXA 1O1WA 3R9PA 3SZ2A 1C0MA 1ZYQA 2HBJA 1FKOA 1BWFO 3QFPA 4AF1A 5AQLA 3L4IA 2P51A 3DRPA 5CE3A 5BPMA 1D9FA 4KHUA 2AJQA 4WCEL 1WAJA 3Q7CA 4PKGA 5K14A 3VA3A 4NLBA 4IDKA 3CCJN 5BN9A 4IFEA 3K5LA 4B3MK 1IBLK 3S41A 3CCQN 1WN7A 3K2PA 5AR0A 3FGUA 2F9WA 4QOZB 3VEZA 4HTUA 2QXLA 3CCRN 3LP1A 2BTFA 3U3GA 2V52B 3R6MA 1ZBSA 4U67L 1B9DA 2G8KA 1MWKA 3O80A 4MLHA 3SYZA 3OYIA 3TAQA 2AA4A 3EKUA 5CYQA 1D4XA 3ZETB 1RTJA 1RDWX 4CF1A 1FXXA 4DTXA 4DU1A 4A62A 4DCHA 1CZBA 3JS6A 1X3NA 1GLJO 4JKCA 4CIFA 3VQAA 3QNOA 4ELVA 1VQ6N 1VQNN 3EY1A 3K0SA 4JNEA 5CZ2A 1T3VA 2F8TA 3AO3A 4WFNL 4GMJB 4FZXC 2W6KA 5LMNK 3V9XA 2CH5A 5KPRA 3DLEA 1DLOA 1BUPA 1Q8IA 5HROA 3C94A 3KLIA 1GOAA 3SAGA 1X9SA 2CGJA 2FF6A 3PV8A 4IOXA 5AQOA 3VESA 1NBWA 3D0PA 4B9SA 1XHZA 3FZLA 1RBSA 4ILGB 4CIEA 3HJFA 4IXCA 2VQEK 1IO2A 2IC3A 2YHXA 4DSJA 2ZJRL 3BDPA 1WB9A 5CHIA 1Q9YA 4KKOA 3AVHA 3IS9A 2YJFA 1VSMA 3BF1A 3SJJA 4FJHA 4K43A 1ATRA 5FRMA 2I5JA 4PA1A 4E1MA 4BRLA 3KLEA 3L2VA 4BRDA 4QS7A 3PY8A 4BR9A 3JAMO 4IO8A 3ZSXA 4DS4A 3VERA 4BWMA 3EZ5A 1Y97A 4O4GA 5GADP 3TI0A 4CJ3A 3D2EB 1TUUA 3KZBA 1HYVA 1DT9A 3U4LA 4DV0K 1EX4A 3IUCA 2O8EB 2V51B 4HCCA 5M1QA 1GLLO 2E4LA 2UUBK 5AQZA 4FSVA 4CEZA 1E4FT 3SV4A 4M63C 4AILC 1NK6A 3LDSA 2HSTA 1SKWA 3ATVA 2Q0RA 4KHWA 4KTQA 1BCMA 5AQTA 2HHTA 3CCMN 4YNQA 2F9TA 1RT7A 3NCIA 1GLAG 1NK7A 4B9VA 3DOKA 3I0SA 4GKJK 3ZCMA 1NJIO 2YNHA 1T6DA 4DF4A 4K42A 5FPDA 3J7ZO 4BC3A 5AFUH 4E7HA 4PL8A 2E6MA 3J80O 3HOTA 3B6OA 3MX2A 3RMBA 3HRGA 3KLFA 2E2QA 2HHXA 3K5OA 5KTQA 4DFJA 3FZFA 4ELUA 1C1CA 1S6PA 1C6VA 5BN8A 1NGBA 2AP1A 1NJZA 3CF5L 3SMPA 1N34K 3DLHA 3ZSRA 4LF4K 1HNVA 1OH5A 5ELZA 3LM9A 3T19A 1R59O 3NH2A 1UOCA 3SBGA 4EFHA 4ID1A 3W0LA 1L3SA 4AQYK 5AQPA 4LF5K 4B9LA 5FPNA 1KLMA 4IZ9A 3WQUA 4FLVA 2NRXA 2PYJA 3MN7A 1EWQA 2ASMA 5FDLA 1S1XA 3HTVA 4DQPA 5JMVA 3CJ7A 4JK9A 4N47A 4J2BA 3SUNA 1U6ZA 4MDAA 3K57A 3D6RA 3LL3A 4FWLA 3AVFA 2P9SA 1NJXA 2QWLA 1RBVA 3THWA 4BRCA 4RW9A 2CGKA 2ATQA 3HPHA 3L8BA 3LWMA 5AQMA 2P9LA 1RT3A 3G71N 4DV1K 1YITN 3VEVA 4MLEA 3JSMA 5C15A 4B1UB 1Z05A 3OYLA 3DLBA 3QIPA 2YHBA 1TK0A 3A5OC 2EHGA 3ZT0A 4H5WA 5KGWA 2HNYA 4BG9A 4IOAL 1X9MA 3AA3A 4EIAA 1ZBFA 4DR2K 4CK3A 4CHOA 3UE5A 3T3FA 4B8AB 3FFKB 4H5TA 2E8AA 4FWNA 4B08A 4CZFA 1HNWK 4IFYA 2QWMA 2P9KB 3NF7A 5DK5A 4AHUA 3GG4A 4PWDA 4EHTA 1BG3A 3I8DA 1NJYA 1VQ9N 3LALA 2HVHA 3AGKA 1MA9B 2EX3A 3KKRA 5E84A 4CZKA 5DM7L 3VQCA 2PFUA 1YXQA 3AVGA 3O4QA 4B1XB 2FBYA 4FCYA 4FK2A 2VWBA 3H3NO 4DTNA 2E2PA 4MDBA 4AHSA 4M3UA 3S3MA 1SS6A 2O8CA 4C8MA 4CEEA 2OCEA 5M1FA 4KI6A 3B6PA 3WEEA 5LJWA 3NF9A 3RRHA 2PY5A 2HMIA 1HPZA 4MO4A 4ISEA 5D3GA 4J8FA 1RBRA 4A57A 3D2FA 3C6HA 4CF8A 3ULEB 5AZJA 4JHDA 4C8NA 4IFVA 1WSHA 4B3RK 2OA8A 1VQLN 4Z4HA 4CVNE 3DXMA 5AZIA 4H5VA 1IBKK 1LWEA 1IV0A 2JLEA 1VRTA 3RR7A 4CEBA 2G8UA 4DV6K 1XC3A 4DTMA 1IKVA 3T1AA 3SUOA 1QQMA 4MFBA 5BRHA 4CF9A 3AVKA 4DV5K 1Q9XA 3CFRA 4HUFA 1VSLA 2ZGYA 4DG1A 4NCGA 3D45A 1VRUA 4B1ZA 2W6LA 4DFMA 4F2SA 3ASMA 4CJKA 3LPTA 4ZTJA 5MLCQ 3TWHA 4BG8A 3U3YA 3BZCA 2BE2A 3M5RA 4I6MA 3ZT2A 3QBXA 4BRIA 4K41A 3HZ6A 1Q18A 3NFAA 2RPIA 2ZWHA 1JLFA 3LWLA 1BCOA 3I0RA 2NNWA 4YDUC 1YI2N 4CK2A 5BRDA 3OTOK 5I42A 1HYZA 3HM8A 1VQ7N 3RR8A 3WXMB 4H8KA 3HVRA 4DS5A 3AO5A 5BREA 3CC7N 3Q7BA 4JYAK 2NRTA 3CJCA 1NGEA 1YHQN 4JLHA 1Z6RA 3VQPA 2IGIA 3TAGA 2XY5A 3WNHA 1OH7A 3J8AA 5F1XA 5IWAK 4CF0A 2D4WA 3T69A 4OGCA 5AQKA 1RDDA 1ITGA 2P5GA 1K73O 1JLAA 3S9HA 1HMVA 2HBLA 4CBWA 2HHVA 2OPPA 3UKUB 1M90O 4C8KA 2G8FA 3SQ1A 1Q7YO 3CMAN 5J2QA 3LDOA 3KVGA 2QW9A 3C7NA 3ENBA 3NF8A 1KAXA 2B5JA 4BREA 4RTFD 1L3UA 1U49A 4K0KK 1CLQA 4J2AA 3NH0A 4H0PA 2YI1A 1S9EA 4M41A 5AQWA 2E5LK 4BWJA 2UXCK 3SV3A 2B4JA 1IKYA 1X9WA 4FZYA 3MWTA 3OYCA 3CM6A 4JS4A 3L2UA 2OZMA 1TGOA 1W9HA 4O8UA 3F9MA 3L3VA 4XH4A 4JKHA 5M1PA 3WXKA 2O8BA 2HF4A 2A6AA 3H46O 3BUZB 2HHWA 4FK4A 3OYMA 3FZMA 1A5XA 3VF4A 5GIOA 4N5SA 3THXB 1RILA 4RW4A 3QEVA 1TL3A 3K5NA 3J7YP 4JKFA 4H03B 3ZT3A 2BDPA 4UY8O 1I94K 3TSUA 1TKDA 2Q1NA 4FJJA 2GWKA 5CYMA 4OKKA 4JKAA 4B9UA 2WC9A 2WBNA 2OTJN 1RFQA 2ITMA 4IEEA 4CZIA 4JI5K 1BDGA 2O4IA 2YJEA 4BC5A 4CJVA 4CFDA 3ZSQA 1Z26A 3O1BA 3VEYA 2D5RA 3DLGA 1JCGA 2W42A 2BANA 4O55A 4WFBL 3TPQA 1B92A 3OYEA 5M1NA 2HOEA 4DTUA 4H5NA 1NMNA 1HJRA 4LF8K 2FSNA 3KWIA 4B1WB 3CCLN 1SKSA 3M8PA 2Q97A 1VQ8N 1IG9A 1VSDA 5AQRA 4RW6A 1JL2A 5C25A 1EP4A 4FVUA 3MWPA 2RHKA 2ZE2A 1E4GT 3QMLA 3QBWA 2VG6A 4CEAA 4Y0WA 1QQNA 4YFUA 3AVBA 1BU6O 3ZX3A 1J5OA 2A40A 5E41A 4DQQA 5TKYA 3TAEA 1YVNA 4A59A 4CECA 1KCFA 3QLHA 3ZSZA 1SL1A 1ASVA 3IMXA 5FROA 4GV9A 3IFRA 4E0DA 1JLQA 1KFSA 2GBZA 5C10A 2ZJQL 4PY5A 2PAVA 3VMFB 3QERA 1WUAA 3SMSA 3V4IA 3M8RA 5JS1A 3THYB 5FPEA 4F3OA 4FWPA 2HBMA 4DU3A 4FL9A 1NGCA 3O9RA 2FBTA 4RG8A 4Z94A 3O9SA 3U9ZA 5HRSA 3MEGA 2QWOA 4DWIA 2FXUA 4FJLA 3NVMA 1VQON 1RDUA 4M3YA 5TKWA 2Z1IA 3SUPA 1S1UA 4DLEA 3MN5A 4GV6A 2E20A 2NUBA 4C1NI 3GL1A 2F96A 1TYQB 3I33A 2D0BA 3HXMA 1Q82O 2BGGA 4NYNA 1VAZA 5CZ1A 1GLCG 3F2KA 4IDHA 3PSIA 4DQ8A 1YIJN 3EZWA 5KPTA 4O8KA 2UUCK 1TKZA 3GDQA 4A2AA 3MMVA 3EE8A 5GINA 3MX5A 4DSKA 3MXJA 1BA1A 1NLVA 3BP8A 2W41A 2GEMA 3NHGA 3ATUA 2GUIA 1NOYA 1TL1A 5F2RA 3EN9A 1QVGM 4LF9K 3M1FA 4PQUA 3O5BA 4CE9A 4KHQA 3MK6A 4IG3A 3OYAA 3LANA 2RKIA 5AQYA 4Y1DA 3VF2A 3M8SA 4CZMA 1BI4B 4BY9C 5I3UA 1ILYA 4FWQA 2FLOA 1NNEA 5C12A 2QKBA 2VCPA 2QI2A 1RT1A 4KHSA 4JKDA 3K9KA 4IG0A 4JD2A 1RDBA 4NXNK 2P9NB 3NVKA 4B9TA 2HHUA 1NK9A 5C0YA 4K8ZA 5F0XA 4EZ6A 3MCAB 1J53A 3CJBA 1K8KA 1A5WA 3A5MC 4DHYA 3ZSWA 3RSEB 5JLFA 3RWUA 1ZBUA 3HO1A 1Z25A 1NGDA 3M6GA 1IG8A 3ALYA 3MAQA 1QHTA 2D1KA 4FZZA 4B1YB 3VETA 4WQ4A 3UKRA 4LF7K 4X65K 1C1AA 2Q3SA 3AVIA 4E19A 3HBTA 3A8YA 3RMAA 3O9QA 3TSQA 3ZYYX 2ASOA 2IDOA 1XNQK 1WSGA 3HM9A 5M1OA 1JKHA 1NGJA 3VGKA 5C42A 1T05A 4DV7K 4YOUA 5AQGA 2VGMA 3ZSOA 3O4NA 3I55N 3G0ZA 2UXDK 3RMCA 4FW2A 3VF6A 3KLGA 1VQPN 4H4MA 4HCBA 3WNGA 4BQLA 2P9UA 1B9FA 2ZGZA 3HOSA 4J2EA 4E7KA 2F8SA 1U2VA 1KRPA 1RGIA 3C6UA 3EKSA 4CJLA 3AY9A 4CFAA 3U9DA 2DTUA 1LAWA 3IAYA 4NO7A 2P1JA 2F7TA 2E88A 4V19S 1U48A 2Q31A 4LC9B 1KD1O 4NXMK 5EX5A 2YKMA 3OYHA 2O8DA 4ICLA 1TAQA 4AM6A 1L3TA 3CYMA 1SKRA 4DSFA 3HL8A 2NZTA 4CJPA 1GOBA 1NMDA 3OYJA 3A2FA 4YOVA 3HSTB 5HLFA 3NMUA 2KTQA 2HF3A 3QEWA 3VGLA 4DFKA 2ZF5O 1D8YA 1TVRA 2Z1GA 3ZEUB 4BDPA 1JXBA 1NKEA 3V1RA 3WQTA 3DM2A 5HBMA 3CIPA 2J4RA 4DUYK 3OS1A 2NRZA 1IH7A 3AAPA 3WUHA 1XHXA 4BRKA 3MN6A 3VOVA 1VSFA 2OTLN 4ILJA 1BGXT 3UIQA 2UYTA 1L3VA 3HVTA 3V9WA 5BPNA 3L6QA 2WONA 2YV0X 4FWRA 1NKBA 2KW4A 4CESA 3MEDA 3DXKB 4JRPA 3WXIA 4EP4A 4BC4A 3QNNA 4CJFA 4EZ9A 2JGUA 4M7XA 3O9TA 3VPZA 5AFUA 3KK2A 4U7BA 2FF3B 2QA4N 4JI8K 2A1SA 2I7PA 2V7YA 1C1BA 4GNIA 3LP3A 5KGXA 4CEOA 4BR5A 4XEIA 4Y1CA 5ADXH 4W5TA 1W0HA 4BROA 4I2PA 2O8FB 2FSKA 4X62K 1WNSA 2UU9K 2IVPA 2W40A 3K58A 4BE1A 3ZETA 3WT0A 1J5EK 1J6ZA 3OS0A 1V4SA 3OA9A 3ZX2A 4AHCA 3AARA 1FJGK 3JXUA 1EO1A 4OJRA 1QSSA 1RTIA 1HYSA 5AJ3K 4DTPA 1UA1A 3PIOL 2P9PB 4BRNA 4CGDA 5ADXA 2R7YA 2GTDA 1JCFA 3E9OA 3OYGA 2HHSA 2XO7A 1M1KO 3VEWA 1NK8A 2QWQA 2FC0A 4NB4A 4KREA 3FFIA 4H0OA 4PHTX 4TSXA 5KRSA 5BR9A 1YJWN 1V4TA 3CPWM 3LDQA 3GOIA 4IO9L 4Z4EA 2G8WA 3TSPA 3P31A 2KLAA 2E2NA 1H1VA 3FZHA 3LDPA 1U47A 3EO3A 4JN4A 4WFAL 1BIUA 3AAQA 3GBTA 5EU7A 2A1RA 1IKXA 4CHPA 4DTJA 2IVOA 1YJ9N 3QEPA 1C0TA 4FJ5A 4MQ3A 4LF6K 3SLCA 3RMDA 1RT4A 3RVCA 3QETA 2DFFA 3NDKA 3AO1A 3L2QA 4A5BA 4KHNA 1HKCA 3TAPA 4FJMA 3A5LC 1N6QA 2IOCA 4PKHA 4FLYA 4O44A 5M1KA 3IKMA 1SQKA 2ITGA 3E1YA 3D2EA 2Z1JA 3HPGA 1EKEA 4DR4K 4GVEA 3TTDA 4M3TA 4OX9K 3R8EA 3DAWA 1DTQA 4X64K 3ID8A 3KK7A 2XY6A 2O8EA 2YHYA 3J81O 3L3UA 3IRXA 4N56A 3KIOA 1HJOA 1R0AA 4ZTFA 4F3TA 1T03A 2NRVA 3V6DA 3HYFA 4JKEA 4OPHA 1JJ2M 4AHVA 3AV9A 4CJ4A 2ZQBA 4FLWA 1LW2A 1QE1A 4DSIA 4CIGA 2KFNA 1XC9A 5BRFA 4BDZA 4JRQA 4W5NA 1O13A 5GAEP 2HHHK 4J2DA 5J2MA 3O4WA 4B9QA 3O3HA 3OYBA 4DQRA 2VYPA 2X6NA 4HHTA 4CFBA 1HLUA 2RE2A 3P4IA 1RBTA 3R3LA 2PYLA 3SPZA 4CJTA 4DTSA 1I3AA 1N33K 4CJRA 3BEXA 2OZSA 3CHWA 3ZX0A 4Z4CA 4BR2A 2VWJA 4CHYA 3CM5A 4JKGB 4BR0A 2E6LA 5DMRA 1DGKN 1QQOA 2P9IB 2VG7A 3AO4A 3CQ8A 3UB5A 3V9UA 5KQDA 1JL1A 3I8BA 2KKZA 4A2BA 3NH1A 4H0TB 1NGFA 1S1WA 5EOYA 2IIRA 1XMOK 4FVMA 1HQUA 4K25A 4O5BA 1U4BA 3V1OA 1SUQA 4M3XA 5KPZA 2YCHA 3V81A 1MU2A 1HKBA 2UUAK 3ID6A 2VGNA 3LPUA 2D0AA 4ILHA 1WAFA 1XNRK 3CETA 5HRRA 4GY2B 1UWBA 3VA0A 4LH4A 4CZEA 3H3OB 3MEEA 1HRHA 3NF6A 2ZM6K 4CGJA 2DY4A 3G6EN 3CPEA 4NCBA 3AVAA 4AM7A 3CXCM 4JI3K 1KVAA 1QSYA 4CBXA 1BL3A 4CZLA 1BO5O 5JVGL 1S5JA 4FJ9A 4LSLA 4YOTA 3TARA 2Y1IA 5C2FA 3WNFA 1DTTA 1S6QA 4KV8A 3M3ZA 1ZBLA 5IT9O 3K5MA 4CGIA 5JVHL 3LP0A 4LY7A 3VQ5A 4K8XA 3TABA 3OBWA 3DWLA 1F21A 1FK9A 1DKGD 4KB0A 1NGIA 5J1EA 2P9KA 4OKJA 4EHUA 3AA2A 2B6AA 3CC4N 1QHAA 3AO2A 3KD5E 3QB0A 4WQ4C 1KQSM 2V7ZA 2Q2RA 4KH5A 5LMUK 4AHRA 3E01A 4OPKA 2X78A 1VQ4N 5HRPA 3VN5A 1OH8A 1BQNA 4KI4A 5A2QO 4FYDA 1VSJA 3U6FA 2Z1HA 5AQVA 5HRNA 2NRRA 3ITHA 4JI2K 4Z4GA 2IAJA 3CJ1A 3DRSA 1ASUA 2X6SA 5GAHP 4YORA 2GX9A 1WBBA 3ULEA 2CH6A 1KFDA 5AQJA 3WXLA 4FOIA 1QSLA 1OVYA 4M3WA 5AQXA 5AQIA 4E1NA 3QIOA 1JLCA 2IVNA 4FJ8A 1BISA 5AQQA 2WFBA 2GV9A 1ESVA 4IWVA 4PKIA 3PSFA 4C1NK 4DR7K 4F9OA 3HP9A 4E7LA 4FLZA 3L4QA 1WOQA 3DMJA 4Z0UA 5LY3A 5BPLA 3O08A 4CHQA 4FLTA 1WSIA 3KK1A 1YTAA 1FW6A 4NCAA 4N76A 1XQSC 4DR3K 4KFBA 4WE1A 5EXWA 1VQ5N 2A42A 4M7YA 4M3RA 4B3SK 1NGHA 4JAXA 4O5FA 5C2DA 3JYTA 2A3ZA 5KRTA 1C0GA 3W3DA 3E9PA 3IDHA
chains in the Genus database with same CATH topology
4IOAL 3HOSA 4BQZA 4EIAA 2QM1A 3FR0A 1U2VA 4BRAA 3UE5A 3CQXA 3FFKB 4H5TA 2E8AA 4FWMA 3QICA 4FWNA 1RGIA 4CZFA 3EKSA 2QWMA 2P9KB 4L3QA 3GG4A 3AY9A 3U9DA 4QS8A 4EHTA 4NO7A 1BG3A 4YOWA 4IOCL 2F7TA 2E88A 4CD1A 4BRPA 1VQ9N 2Q31A 3AGKA 1MA9B 3K9JA 4LC9B 4CJ7A 1Q81O 5E84A 4CZKA 1GLDG 3E66A 3O9UA 5EX5A 2JWKA 5DM7L 1KD1O 2PFUA 4AM6A 3TTCA 1YXQA 1MDUB 4B1XB 1C0FA 2OANA 1P8ZA 2NZTA 4WQ5C 2VWBA 5AQFA 3H3NO 2E2PA 4MDBA 4JD2B 1SZ2A 1NMDA 1SS6A 4YOVA 4CBUA 2YHWA 4XH5A 3UKUA 3NMUA 3CD6N 5M1FA 3WEEA 5LJWA 2HF3A 2P9PA 4BRFA 4CZGA 3VGLA 2ZF5O 4MO4A 4ISEA 4J8FA 4A57A 3ZEUB 1JCEA 3D2FA 3C6HA 3LDLA 1K8KB 4CI6A 3ULEB 3WQTA 4HWIA 5AZJA 4JHDA 2QWRA 3CCEN 4JK8A 1VQLN 3C65A 3CIPA 3DXMA 2QWNA 5AZIA 2J4RA 3OW2M 4H5VA 2E1ZA 1YAGA 2NRZA 4RWTA 1XC3A 3AAPA 1Q86O 2NRHA 3WUHA 3ENHA 1QQMA 4BRKA 3MN6A 2DPNA 4FPBA 3VOVA 3H45C 3A0IX 5BRHA 4H5RA 5I9EB 2OTLN 1LCUA 1KAYA 3LM2A 3UKRB 4ILJA 3C0BA 4BRGA 3CMEN 4OPAA 3O1WA 2UYTA 2ZGYA 1YJNN 2P9SB 1KC8O 4B1ZA 5BPNA 3L6QA 3A5NC 5MLCQ 4BG8A 4FWRA 3ENOA 3SAFA 4H0YB 3M5RA 4WQ5A 2CGLA 2P9LB 4I6MA 3DXKB 3E9LA 4IJNA 3WXIA 4BC4A 3QBXA 4KH6A 4BRIA 4K41A 3HZ6A 1Q18A 5JLHA 2ZWHA 3O9TA 1YF5L 4M7XA 3VPZA 1EQYA 1BA0A 5AFUA 1DEJA 3CERA 2FF3B 4U7BA 2NNWA 4YDUC 2QA4N 5EY4A 2I7PA 2V7YA 3L0QA 3P39A 1NM1A 3CI5A 4QS9A 1T44A 4GNIA 2NLXA 5BRDA 2P9UB 5JICA 2QEXN 3KHYA 4BR5A 3HM8A 1VQ7N 4XEIA 3WXMB 3VGMA 1U2VB 5ADXH 5BREA 1K8AO 3CC7N 3H1VX 1T6CA 4BGBA 3Q7BA 4BROA 2FSKA 2NRTA 3CJCA 1NGEA 1YHQN 1Z6RA 1CZAN 3VEXA 4E1JA 1ATSA 1SAZA 1X9JA 2IVPA 2W40A 5FPMA 5H1SQ 3ZETA 3CCSN 2D0PA 3VENA 3WT0A 4BRHA 4DKWA 1J6ZA 3J8AA 1W2BM 1V4SA 4A61A 3OA9A 3QFUA 3ZX2A 4JKBA 2GWJA 3SJHA 3TU5A 3AARA 5F1XA 3CCUN 1ATNA 4RCHA 3PIPL 3CQYA 2I7NA 3JXUA 4GV3A 2D0OA 2D4WA 3T69A 4CZHA 4YOYA 1EO1A 3VTHA 1S22A 5AQKA 5EVZA 1K73O 3EE9A 1YI2N 4KBOA 4B1VA 2HBLA 4CBWA 3UKUB 1M90O 1KAZA 1MWMA 3WEEB 2EWSA 3PIOL 2P9PB 4BRNA 5ADXA 1Q7YO 1BOTO 2GTDA 3D7EO 1JCFA 5AQNA 1NWKA 3E9OA 2PBDA 3N4PA 3O8MA 3LDOA 4YDUA 2Q36A 3KVGA 4BRMA 3B8AX 2QW9A 3C7NA 3ENBA 3D2FB 3O6WA 4BVOA 1M1KO 3EL2A 1KAXA 3VEWA 2QWQA 5AQUA 4BREA 4RTFD 4NB4A 4JHDB 3H1QA 5AZJB 4C23A 1GLEG 1G99A 1KXPA 4H0OA 5AQSA 3T7ZA 4H0PA 4PHTX 2YI1A 3SBTA 3HSCA 3W3DA 1W97L 5CR4A 3MN9A 5BR9A 3DXMB 1VQKN 5AZIB 1V4TA 4BC2A 5AQWA 3CPWM 1YJWN 3LDQA 2QWPA 3AGRA 3GOIA 3HI0A 3MWTA 4IO9L 3VTIA 3TSPA 3KWGA 4JKGA 3P31A 2KHOA 5KQ8A 2KLAA 1QZ5A 1H1VA 2E2NA 3FZHA 3LDPA 4O8UA 2P9IA 3F9MA 4DB3A 3EO3A 4JN4A 4XH4A 4JKHA 3AAQA 5M1PA 3GBTA 3WXKA 4WYBA 4WFAL 2HF4A 2A6AA 3R9PA 3H46O 3BUZB 1HUXA 2IVOA 1YJ9N 3VEOA 2HBJA 3FZMA 1BWFO 3QFPA 3VF4A 1LOTB 5GIOA 4AF1A 5LJVA 5AQLA 3L4IA 3SLCA 4BG9A 3RVCA 4I6MB 5CE3A 4A5BA 4JKFA 5BPMA 4H03B 1HKCA 2ASPA 4WCEL 3A5LC 4UY8O 3Q7CA 4PKGA 4PKHA 4NLBA 3TSUA 4R79A 2Q1NA 1QVFM 3LDNA 5M1KA 2GWKA 3IKMA 1SQKA 3CCJN 4H0XB 3E1YA 4JKAA 4IFEA 3D2EA 5BN9A 3S41A 3CCQN 2WC9A 4GVEA 5AR0A 3TTDA 5GIPA 3FGUA 1X3MA 2F9WA 2WBNA 2OTJN 3R8EA 3VEZA 3DAWA 1RFQA 2ITMA 4IEEA 3ID8A 3KK7A 2YHYA 1TYQA 3FLCO 2QXLA 4CZIA 3CCRN 2BTFA 2V52B 1BDGA 1HJOA 4XH1A 3R6MA 1ZBSA 4U67L 3DJCA 2YJEA 2NRVA 4JK7A 1MWKA 4BR4A 3O80A 4MLHA 4BC5A 3I56N 3WXJA 2AA4A 3EKUA 4JKEA 1D4XA 4OPHA 3BF3A 3ZETB 1N8RO 3O1BA 3VEYA 1JJ2M 1RDWX 1JCGA 1YUWA 3OBYA 3TPQA 4WFBL 4A62A 4DCHA 5M1NA 2HOEA 3JS6A 3U8XA 1X3NA 4FWOA 4H5NA 1GLJO 4KH4A 4G9ZA 4JKCA 2FSNA 3KWIA 4B1WB 1VQ6N 3CCLN 5BRFA 1VQNN 2Q97A 1VQ8N 1O13A 5GAEP 4JNEA 1T3VA 5AQRA 4ISGA 4YOXA 3O4WA 4B9QA 4WFNL 2VYPA 1S3XA 4FVUA 3MWPA 2RHKA 1HLUA 1E4GT 2CH5A 5KPRA 3C7NB 3H6EA 3QMLA 2BH1A 2RE2A 3P4IA 1BUPA 3QBWA 3R3LA 5B8HA 2Q0UA 3MDQA 1QQNA 2CGJA 4Y0WA 3SAGA 2JWLA 4JEPA 2FF6A 3BEXA 4OO1J 1BU6O 3CHWA 4IOXA 3ZX0A 5AQOA 1ZXOA 3VESA 4BR2A 1NBWA 3ZX3A 2A40A 5TKYA 2P9NA 1VQMN 3FZLA 1YVNA 2QTDA 4A59A 4JKGB 4BR0A 4ILGB 4IXCA 5AQHA 1DGKN 1QQOA 2P9IB 5DM6L 4FWKA 3IMXA 3UB5A 4GV9A 2YHXA 5KQDA 3IFRA 1IJJA 3I8BA 3CMAN 2ZJRL 2KKZA 4A2BA 4H0TB 2A5XA 5CHIA 5C10A 2ZJQL 2YJFA 1NGFA 2PAVA 3VMFB 3BF1A 3RSEA 4K43A 1ATRA 5EOYA 1WUAA 2IIRA 3SMSA 4PL7A 4BRLA 4BRDA 4QS7A 5FPEA 4BR7A 4K25A 4BR9A 4FWPA 2E1YA 2HBMA 4FL9A 4IO8A 1NGCA 3O9RA 5KPZA 4Z94A 3O9SA 3U9ZA 3VERA 1HPMA 2YCHA 1HKBA 4HTLA 5GADP 3ID6A 2QWOA 2VGNA 2FXUA 4ILHA 3D2EB 3CETA 1TUUA 4GY2B 3NVMA 1VQON 1RDUA 3KZBA 5TKWA 1DT9A 3U4LA 3H3OB 4CZEA 2ZJPL 3MN5A 3CCVN 4GV6A 2E20A 3IUCA 4C1NI 3GL1A 1TYQB 3I33A 2V51B 3G6EN 1Q82O 4FOEA 5M1QA 1QZ6A 3CJ9A 1GLLO 1VAZA 3CPEA 1HKGA 1GLCG 3F2KA 3C6AA 4ISFA 4FSVA 5AQZA 4AM7A 1E4FT 4IDHA 3CXCM 4WF9L 4CBXA 4CZLA 3EZWA 1BO5O 4DQ8A 4O8KA 4M63C 5KPTA 5JVGL 1YIJN 2NRWA 4BVPA 3GDQA 3QDKA 3MMVA 4A2AA 3EE8A 4YOTA 4BRQA 5GINA 2HSTA 3MX5A 2WUSA 3F5TA 5C2FA 3ATVA 1BA1A 2Q0RA 1NLVA 3BP8A 3TTFA 1P90A 5AQTA 3M3ZA 2W41A 2GEMA 3CCMN 5JVHL 2F9TA 3G4SN 1GLAG 3ATUA 3OHRA 5F2RA 3EN9A 3DWLA 3OBWA 3M1FA 1QVGM 4IEIA 1DKGD 3O5BA 1NGIA 1NJIO 2P9KA 4EHUA 2HMPA 3MK6A 3CC4N 1T6DA 4FPAA 3N4QA 1QHAA 3QB0A 2GELA 4K42A 4WQ4C 5FPDA 1KQSM 2V7ZA 3J7ZO 3FE1A 2Q2RA 4FWSA 4KH5A 1OKJA 2FSJA 5AQYA 1NGGA 5GAGP 4BC3A 5AFUH 3VF2A 4CZMA 4BY9C 2GUPA 4H0VB 4PL8A 4EAHD 3PLAA 1VQ4N 5E26A 4FWQA 3HOTA 3GE1A 1ILYA 3MX2A 3DLLL 3HRGA 2FLOA 2E2QA 5C12A 1Y64A 2QI2A 2VCPA 3FZFA 4JKDA 3K9KA 4JD2A 5BN8A 2A41A 2E2OA 1NGBA 2P9NB 3CC2N 2AP1A 4A5AA 3G25A 3R1XA 5AQVA 3SMPA 3CF5L 3NVKA 2NRRA 1K9MO 5C0YA 1ZC6A 3CJ1A 5GAHP 2YX6A 4YORA 5ELZA 3IDHA 3LM9A 2GX9A 5F0XA 5HL7L 3MCAB 1R59O 3ZEUA 3CJBA 1K8KA 3SBGA 3ULEA 4EFHA 5HOOA 2CH6A 5AQJA 3WXLA 3W0LA 3A5MC 4DHYA 4FOIA 3RSEB 4BGAA 5AQPA 1OVYA 3CJAA 5JLFA 5AQXA 4CZJA 5AQIA 5FPNA 1NGDA 3FZKA 3M6GA 4IZ9A 1NGAA 3WQUA 1TUYA 2NRXA 1IG8A 2IVNA 3MN7A 3SAHA 5AQQA 2WFBA 2ASMA 1ESVA 4IWVA 4PKIA 3HTVA 2D1KA 5JMVA 3CJ7A 4C1NK 4B1YB 4JK9A 3VETA 4F9OA 4WQ4A 3UKRA 1U6ZA 2HBKA 4MDAA 3D6RA 3L4QA 3LL3A 4FWLA 1WOQA 3HBTA 2P9SA 3A8YA 5LY3A 2QWLA 5BPLA 2H3GX 4NLCA 4BRCA 3O08A 3O9QA 3TSQA 2CGKA 3ZYYX 3SK3A 2ASOA 4IJAA 5AQMA 2P9LA 3DXKA 1HX1A 5M1OA 1NGJA 1GLBG 3VGKA 3MCPA 3G71N 1YITN 3VEVA 4MLEA 1XQSC 4YOUA 5AQGA 2VGMA 4MO5A 5C15A 5EXWA 1VQ5N 2A42A 4B1UB 3P38A 3I55N 1Z05A 4M7YA 1NGHA 4CD3A 4JAXA 3VF6A 4O5FA 1VQPN 3A5OC 5C2DA 1S72N 1GLFO 2A3ZA 4FO0A 4BQLA 1C0GA 2P9UA 4H5WA 3E9PA 2ZGZA 2BUPA 1XUPO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C10 A;  4IDH A;  5M1P A;  5C15 A;  5C2D A;  4IEI A;  4IFE A;  5M1Q A;  5C12 A;  3CPE A;  5M1O A;  5C2F A;  5M1N A;  5M1K A;  3C6A A;  5M1F A;  4IEE A;  3C6H A; 
#chains in the Genus database with same CATH topology
 3PO5 A;  4BQZ A;  1FKP A;  3FR0 A;  1QTM A;  1TKX A;  4Z4F A;  3CQX A;  4FWM A;  1UA0 A;  1NOZ A;  2KZM A;  1NK5 A;  4L3Q A;  4KTZ A;  1WLJ A;  4YOW A;  4IOC L;  4DMN A;  4CD1 A;  3K9J A;  1Q81 O;  4CJ7 A;  5FRN A;  4FLX A;  1HNZ K;  1GLD G;  3E66 A;  3O9U A;  2JWK A;  3AA5 X;  3TTC A;  5JS2 A;  3VQ4 A;  3OJS A;  1C0F A;  4DV4 K;  1P8Z A;  4IBN A;  4C8L A;  1SZ2 A;  4HVJ A;  2ETJ A;  2KFZ A;  4CBU A;  2YHW A;  3THV A;  2YHA A;  3UKU A;  2HNZ A;  2X74 A;  4F4K A;  1N36 K;  1JCE A;  1J9A A;  3LDL A;  2YNI A;  3CCE N;  4FJI A;  4JK8 A;  3SI6 A;  3C65 A;  3OW2 M;  4B9M A;  1YAG A;  4RWT A;  1Q86 O;  3T1H K;  2NRH A;  3ENH A;  4ZHR A;  1KLN A;  4FPB A;  4CFC A;  1RCH A;  3H45 C;  3A0I X;  4H5R A;  2FBV A;  3LM2 A;  3EYZ A;  3P5J A;  3C0B A;  4CGH A;  3P1G A;  4XIU A;  3O1W A;  3HT3 A;  4CJE A;  2P9S B;  1OH6 A;  4O0J A;  4CJS A;  3THW B;  4DR6 K;  4OKE A;  4O0I A;  3ENO A;  3THX A;  3SAF A;  3DYA A;  4H0Y B;  1T7P A;  4WQ5 A;  2CGL A;  2P9L B;  4IJN A;  4CF2 A;  1EET A;  4DSE A;  3TAM A;  5JLH A;  4B9N A;  2PZS A;  1GOC A;  1EQY A;  3MXI A;  1RNH A;  3CER A;  1QS4 A;  5EY4 A;  3L0Q A;  4QS9 A;  3CI5 A;  5JIC A;  2QEX N;  2P5O A;  3IG1 A;  2HB5 A;  4AHT A;  3VGM A;  4CK1 A;  3VQ6 A;  3H1V X;  4AH9 A;  4BGB A;  4UQG A;  5FLX O;  4QAG A;  1CZA N;  3VEX A;  4CW7 B;  2FBX A;  4YHH K;  5H1S Q;  2D0P A;  3VEN A;  3HPO A;  1RDA A;  3QFU A;  4JKB A;  2GWJ A;  3SJH A;  3TU5 A;  3OYN A;  3CCU N;  3L2W A;  4FM0 A;  1ATN A;  3CQY A;  2I7N A;  4GV3 A;  3LP2 A;  4CZH A;  4OPJ A;  3VTH A;  4KHY A;  1YVU A;  1CZ9 A;  1J54 A;  3EE9 A;  2O8C B;  4B1V A;  3OJU A;  1KAZ A;  3WEE B;  1SV5 A;  2EWS A;  1RT5 A;  1BOT O;  3D7E O;  5AQN A;  3PUF A;  2PBD A;  3SQ4 A;  3O6W A;  3F9K A;  3D2F B;  5AQU A;  5AZJ B;  4JHD B;  3KK3 A;  1JLB A;  1G99 A;  1KXP A;  3DLR A;  2OPQ A;  4LSN A;  3LAK A;  1VSI A;  2RN2 A;  3SBT A;  4B3T K;  1W97 L;  3DXM B;  5AZI B;  4BC2 A;  3ZT1 A;  1RT6 A;  2KZZ A;  4OLB A;  1TKT A;  2QWP A;  3AGR A;  3HI0 A;  1EWR A;  3VTI A;  4I9Q A;  2F4V K;  3J7A P;  5KQ8 A;  2QK9 A;  1QZ5 A;  1WSE A;  4DB3 A;  1EXQ A;  1HNI A;  3C95 A;  2D0C A;  4WYB A;  4KB1 A;  1TK5 A;  4E89 A;  1HUX A;  4GKK K;  3VEO A;  3QIN A;  1S1T A;  1LOT B;  5LJV A;  3THY A;  3CFO A;  4I6M B;  4HUE A;  1RT2 A;  2VWK A;  4M3Z A;  1S9G A;  4RW7 A;  2ASP A;  3MEC A;  1G15 A;  1LAV A;  5C24 A;  3TAF A;  4OLA A;  3NGI A;  3PX6 A;  4R79 A;  4FLU A;  1QVF M;  4PUO A;  3OVN A;  3LDN A;  1HQE A;  1S1V A;  4H0X B;  2YNG A;  2XHB A;  4CGG A;  3VQQ A;  3ZSV A;  2HHQ A;  3NGY A;  5GIP A;  4KRF A;  1X3M A;  2HW3 A;  3OYF A;  3QES A;  4CHN A;  1TYQ A;  3FLC O;  4DR5 K;  5T7B A;  4FJK A;  4Q0B A;  4E7J A;  4XH1 A;  5SWM A;  2HVI A;  3DJC A;  4JK7 A;  4BR4 A;  3K59 A;  3I56 N;  3WXJ A;  1WSJ A;  3BF3 A;  1N8R O;  3H08 A;  3DOL A;  1YUW A;  3OBY A;  3KKS A;  3RTV A;  3VQB A;  3U8X A;  4FWO A;  2G8I A;  4KH4 A;  4G9Z A;  1ASW A;  4CEQ A;  3VQE A;  4BE0 A;  5HP1 A;  1D5A A;  5KI6 A;  4F8R A;  4ISG A;  4YOX A;  4QCL A;  1VK0 A;  4GVM A;  3OY9 A;  4CGF A;  1S3X A;  4M42 A;  3VQ7 A;  4CJ5 A;  1RBU A;  3C7N B;  3H6E A;  3SQ2 A;  2BH1 A;  1BI4 A;  5B8H A;  4OVL A;  3HP6 A;  2Q0U A;  3BY5 A;  3MDQ A;  2JWL A;  2QXF A;  4JEP A;  1LV5 A;  4OO1 J;  4IKF A;  1ZXO A;  4R5P A;  2P9N A;  1VHX A;  1VQM N;  2QTD A;  3M8Q A;  3O3G A;  2RF2 A;  5AQH A;  3AVC A;  5DM6 L;  4FWK A;  3BGR A;  3TR8 A;  1IJJ A;  2O8B B;  2A5X A;  3RSE A;  3ZT4 A;  3O3F A;  1YTU A;  4PL7 A;  1L5U A;  4JI0 K;  1KTQ A;  4CHZ A;  1T8E A;  3VQ9 A;  4BR7 A;  1VSH A;  2E1Y A;  2VQF K;  3DRR A;  2G8V A;  4B8C A;  4FJX A;  3AVL A;  3BZK A;  1HPM A;  3C6T A;  4HTL A;  3DI6 A;  1NG9 A;  4DUZ K;  5LL6 Z;  2ZJP L;  1ZBI A;  3CCV N;  2OPR A;  3KTQ A;  3RRG A;  3F73 A;  3PO4 A;  4FOE A;  1RTD A;  1QZ6 A;  3CJ9 A;  1HKG A;  3C6A A;  4ISF A;  4DTR A;  4WF9 L;  4CJU A;  3OS2 A;  3S3O A;  1CXU A;  2NRW A;  1NK4 A;  4BVP A;  4DSL A;  3QDK A;  4BRQ A;  2WUS A;  3F5T A;  1BHL A;  3PX4 A;  3SQ0 A;  1BQM A;  3TTF A;  1P90 A;  4LFB K;  3CG7 A;  4W5O A;  2YNF A;  3AA4 A;  3P83 D;  3G4S N;  2OYQ A;  3OHR A;  4IEI A;  4DQS A;  4Z4I A;  4JV5 K;  2HMP A;  4N41 A;  4FPA A;  3N4Q A;  4DR1 K;  1I39 A;  3MXM A;  2GEL A;  3FE1 A;  4FWS A;  1OKJ A;  1KVC A;  2FSJ A;  1NGG A;  5GAG P;  4CED A;  2GUP A;  4H0V B;  4EAH D;  3PLA A;  5E26 A;  3GE1 A;  3DLL L;  4Q5V A;  3SNN A;  1Y64 A;  1NKC A;  2WTU A;  4G1Q A;  2A41 A;  2E2O A;  3CC2 N;  4DFP A;  4A5A A;  3G25 A;  3R1X A;  3OYD A;  1K9M O;  4X66 K;  3VQD A;  1ZC6 A;  2XY8 A;  4FJN A;  2YX6 A;  5HL7 L;  1BIZ A;  1NJW A;  3OYK A;  3ZEU A;  1OVQ A;  3AVM A;  5HOO A;  3LAM A;  4I2Q A;  4FK0 A;  3NGZ A;  4BAC A;  2UXB K;  4BGA A;  3V9Z A;  3CJA A;  3NE6 A;  4CZJ A;  3FZK A;  1NGA A;  4JS5 A;  5J2N A;  1TUY A;  4DF8 A;  4LFA K;  1RTH A;  3EEQ A;  4BDY A;  3SAH A;  2QKK A;  3KD1 E;  1HR0 K;  4FXD A;  2HBK A;  4CJQ A;  1U04 A;  2WOM A;  3SCX A;  4HUG A;  4L8R B;  2H3G X;  4NLC A;  3QO9 A;  2XRI A;  2YKN A;  1RDC A;  3SK3 A;  4IJA A;  5BR8 K;  3DXK A;  1HX1 A;  1GLB G;  3MCP A;  4W5Q A;  3SPY A;  4MO5 A;  3WNE A;  3P38 A;  4CD3 A;  4CCH A;  4E3S A;  1S72 N;  1GLF O;  4FO0 A;  3L2R A;  4LH5 A;  2BUP A;  1XUP O;  3SUQ A;  2QM1 A;  4CEF A;  1JXE A;  4EP5 A;  4KHP K;  3PX0 A;  1KSP A;  4JI4 K;  4BRA A;  2DFE A;  3QIC A;  2O8F A;  5CY4 A;  1ZBH A;  4B3O A;  2IS3 A;  4QS8 A;  4DU4 A;  4BRP A;  4DV2 K;  3ZLJ A;  3ULD A;  4LFC K;  3KJV A;  4LD0 A;  4DV3 K;  2HND A;  3QEI A;  1MDU B;  2OAN A;  4W5R A;  5AQF A;  4WQ5 C;  1REV A;  3AVJ A;  4JD2 B;  1N32 K;  1LW0 A;  4FJG A;  1JLE A;  3T1Y K;  4H4O A;  4XH5 A;  1N5Y A;  3AVN A;  3CD6 N;  2LSN A;  2P9P A;  1XWL A;  4BRF A;  4CZG A;  1K8K B;  4CI6 A;  4ID5 A;  4HWI A;  4RW8 A;  3G10 A;  2QWR A;  4KTW A;  3LZI A;  5SZT A;  2ZD1 A;  2QWN A;  1NK0 A;  4KO0 A;  1LWC A;  3CFP A;  2E1Z A;  1XI1 A;  4FM2 A;  1E3M A;  4DLG A;  4JI1 K;  2DPN A;  4GW6 A;  3V1Q A;  2Y1J A;  1LWF A;  5I9E B;  3NBP A;  1LCU A;  1SL2 A;  1KAY A;  3UKR B;  3DLK A;  4BRG A;  3CME N;  4OPA A;  1IBM K;  5J2P A;  1YJN N;  1KC8 O;  4JI6 K;  4I7F A;  4YY3 K;  3A5N C;  1U45 A;  1TAU A;  4E7I A;  3S3N A;  3E9L A;  1HNX K;  1XMQ K;  4KPY A;  4KH6 A;  4F2R A;  3ZSY A;  1W7A A;  2DFH A;  1WSF A;  1YF5 L;  1BA0 A;  1DEJ A;  4ELT A;  3P39 A;  1NM1 A;  1T44 A;  2NLX A;  2P9U B;  3KHY A;  1SL0 A;  4DQI A;  4OGE A;  1C0U A;  1IKW A;  1U2V B;  3ISN C;  1WBD A;  3TAN A;  1K8A O;  1T6C A;  3KLH A;  1KVB A;  3LZJ A;  4FM1 A;  4DTO A;  4E1J A;  4C8O A;  1ATS A;  1SAZ A;  1X9J A;  5FPM A;  4CER A;  2O4G A;  3CCS N;  2OPS A;  1CXQ A;  4CJW A;  4BRH A;  4DKW A;  2VG5 A;  1W2B M;  4A61 A;  1VSK A;  2O8D B;  1TV6 A;  4RCH A;  3PIP L;  2D0O A;  2KQ2 A;  4YOY A;  1YT3 A;  4FJ7 A;  1S22 A;  4NYF A;  5EVZ A;  3NAE A;  3V9S A;  4KBO A;  1UAX A;  1MWM A;  1QQC A;  1NWK A;  4BRM A;  3N4P A;  3O8M A;  4YDU A;  2G8H A;  2Q36 A;  4I9L A;  3B8A X;  4KAZ A;  4BVO A;  3EL2 A;  3H1Q A;  4C23 A;  1GLE G;  5AQS A;  3T7Z A;  1TK8 A;  1JLG A;  4M45 A;  3HSC A;  5CR4 A;  1VQK N;  3MN9 A;  1D9D A;  1A5V A;  1NU0 A;  1K6Y A;  4JI7 K;  3HK2 A;  2XY7 A;  1VSE A;  3KWG A;  4JKG A;  4FW1 A;  2KHO A;  1X1P A;  2P9I A;  4BE2 A;  3VQ8 A;  3QEX A;  1O1W A;  3R9P A;  3SZ2 A;  1C0M A;  1ZYQ A;  2HBJ A;  1FKO A;  1BWF O;  3QFP A;  4AF1 A;  5AQL A;  3L4I A;  2P51 A;  3DRP A;  5CE3 A;  5BPM A;  1D9F A;  4KHU A;  2AJQ A;  4WCE L;  1WAJ A;  3Q7C A;  4PKG A;  5K14 A;  3VA3 A;  4NLB A;  4IDK A;  3CCJ N;  5BN9 A;  4IFE A;  3K5L A;  4B3M K;  1IBL K;  3S41 A;  3CCQ N;  1WN7 A;  3K2P A;  5AR0 A;  3FGU A;  2F9W A;  4QOZ B;  3VEZ A;  4HTU A;  2QXL A;  3CCR N;  3LP1 A;  2BTF A;  3U3G A;  2V52 B;  3R6M A;  1ZBS A;  4U67 L;  1B9D A;  2G8K A;  1MWK A;  3O80 A;  4MLH A;  3SYZ A;  3OYI A;  3TAQ A;  2AA4 A;  3EKU A;  5CYQ A;  1D4X A;  3ZET B;  1RTJ A;  1RDW X;  4CF1 A;  1FXX A;  4DTX A;  4DU1 A;  4A62 A;  4DCH A;  1CZB A;  3JS6 A;  1X3N A;  1GLJ O;  4JKC A;  4CIF A;  3VQA A;  3QNO A;  4ELV A;  1VQ6 N;  1VQN N;  3EY1 A;  3K0S A;  4JNE A;  5CZ2 A;  1T3V A;  2F8T A;  3AO3 A;  4WFN L;  4GMJ B;  4FZX C;  2W6K A;  5LMN K;  3V9X A;  2CH5 A;  5KPR A;  3DLE A;  1DLO A;  1BUP A;  1Q8I A;  5HRO A;  3C94 A;  3KLI A;  1GOA A;  3SAG A;  1X9S A;  2CGJ A;  2FF6 A;  3PV8 A;  4IOX A;  5AQO A;  3VES A;  1NBW A;  3D0P A;  4B9S A;  1XHZ A;  3FZL A;  1RBS A;  4ILG B;  4CIE A;  3HJF A;  4IXC A;  2VQE K;  1IO2 A;  2IC3 A;  2YHX A;  4DSJ A;  2ZJR L;  3BDP A;  1WB9 A;  5CHI A;  1Q9Y A;  4KKO A;  3AVH A;  3IS9 A;  2YJF A;  1VSM A;  3BF1 A;  3SJJ A;  4FJH A;  4K43 A;  1ATR A;  5FRM A;  2I5J A;  4PA1 A;  4E1M A;  4BRL A;  3KLE A;  3L2V A;  4BRD A;  4QS7 A;  3PY8 A;  4BR9 A;  3JAM O;  4IO8 A;  3ZSX A;  4DS4 A;  3VER A;  4BWM A;  3EZ5 A;  1Y97 A;  4O4G A;  5GAD P;  3TI0 A;  4CJ3 A;  3D2E B;  1TUU A;  3KZB A;  1HYV A;  1DT9 A;  3U4L A;  4DV0 K;  1EX4 A;  3IUC A;  2O8E B;  2V51 B;  4HCC A;  5M1Q A;  1GLL O;  2E4L A;  2UUB K;  5AQZ A;  4FSV A;  4CEZ A;  1E4F T;  3SV4 A;  4M63 C;  4AIL C;  1NK6 A;  3LDS A;  2HST A;  1SKW A;  3ATV A;  2Q0R A;  4KHW A;  4KTQ A;  1BCM A;  5AQT A;  2HHT A;  3CCM N;  4YNQ A;  2F9T A;  1RT7 A;  3NCI A;  1GLA G;  1NK7 A;  4B9V A;  3DOK A;  3I0S A;  4GKJ K;  3ZCM A;  1NJI O;  2YNH A;  1T6D A;  4DF4 A;  4K42 A;  5FPD A;  3J7Z O;  4BC3 A;  5AFU H;  4E7H A;  4PL8 A;  2E6M A;  3J80 O;  3HOT A;  3B6O A;  3MX2 A;  3RMB A;  3HRG A;  3KLF A;  2E2Q A;  2HHX A;  3K5O A;  5KTQ A;  4DFJ A;  3FZF A;  4ELU A;  1C1C A;  1S6P A;  1C6V A;  5BN8 A;  1NGB A;  2AP1 A;  1NJZ A;  3CF5 L;  3SMP A;  1N34 K;  3DLH A;  3ZSR A;  4LF4 K;  1HNV A;  1OH5 A;  5ELZ A;  3LM9 A;  3T19 A;  1R59 O;  3NH2 A;  1UOC A;  3SBG A;  4EFH A;  4ID1 A;  3W0L A;  1L3S A;  4AQY K;  5AQP A;  4LF5 K;  4B9L A;  5FPN A;  1KLM A;  4IZ9 A;  3WQU A;  4FLV A;  2NRX A;  2PYJ A;  3MN7 A;  1EWQ A;  2ASM A;  5FDL A;  1S1X A;  3HTV A;  4DQP A;  5JMV A;  3CJ7 A;  4JK9 A;  4N47 A;  4J2B A;  3SUN A;  1U6Z A;  4MDA A;  3K57 A;  3D6R A;  3LL3 A;  4FWL A;  3AVF A;  2P9S A;  1NJX A;  2QWL A;  1RBV A;  3THW A;  4BRC A;  4RW9 A;  2CGK A;  2ATQ A;  3HPH A;  3L8B A;  3LWM A;  5AQM A;  2P9L A;  1RT3 A;  3G71 N;  4DV1 K;  1YIT N;  3VEV A;  4MLE A;  3JSM A;  5C15 A;  4B1U B;  1Z05 A;  3OYL A;  3DLB A;  3QIP A;  2YHB A;  1TK0 A;  3A5O C;  2EHG A;  3ZT0 A;  4H5W A;  5KGW A;  2HNY A;  4BG9 A;  4IOA L;  1X9M A;  3AA3 A;  4EIA A;  1ZBF A;  4DR2 K;  4CK3 A;  4CHO A;  3UE5 A;  3T3F A;  4B8A B;  3FFK B;  4H5T A;  2E8A A;  4FWN A;  4B08 A;  4CZF A;  1HNW K;  4IFY A;  2QWM A;  2P9K B;  3NF7 A;  5DK5 A;  4AHU A;  3GG4 A;  4PWD A;  4EHT A;  1BG3 A;  3I8D A;  1NJY A;  1VQ9 N;  3LAL A;  2HVH A;  3AGK A;  1MA9 B;  2EX3 A;  3KKR A;  5E84 A;  4CZK A;  5DM7 L;  3VQC A;  2PFU A;  1YXQ A;  3AVG A;  3O4Q A;  4B1X B;  2FBY A;  4FCY A;  4FK2 A;  2VWB A;  3H3N O;  4DTN A;  2E2P A;  4MDB A;  4AHS A;  4M3U A;  3S3M A;  1SS6 A;  2O8C A;  4C8M A;  4CEE A;  2OCE A;  5M1F A;  4KI6 A;  3B6P A;  3WEE A;  5LJW A;  3NF9 A;  3RRH A;  2PY5 A;  2HMI A;  1HPZ A;  4MO4 A;  4ISE A;  5D3G A;  4J8F A;  1RBR A;  4A57 A;  3D2F A;  3C6H A;  4CF8 A;  3ULE B;  5AZJ A;  4JHD A;  4C8N A;  4IFV A;  1WSH A;  4B3R K;  2OA8 A;  1VQL N;  4Z4H A;  4CVN E;  3DXM A;  5AZI A;  4H5V A;  1IBK K;  1LWE A;  1IV0 A;  2JLE A;  1VRT A;  3RR7 A;  4CEB A;  2G8U A;  4DV6 K;  1XC3 A;  4DTM A;  1IKV A;  3T1A A;  3SUO A;  1QQM A;  4MFB A;  5BRH A;  4CF9 A;  3AVK A;  4DV5 K;  1Q9X A;  3CFR A;  4HUF A;  1VSL A;  2ZGY A;  4DG1 A;  4NCG A;  3D45 A;  1VRU A;  4B1Z A;  2W6L A;  4DFM A;  4F2S A;  3ASM A;  4CJK A;  3LPT A;  4ZTJ A;  5MLC Q;  3TWH A;  4BG8 A;  3U3Y A;  3BZC A;  2BE2 A;  3M5R A;  4I6M A;  3ZT2 A;  3QBX A;  4BRI A;  4K41 A;  3HZ6 A;  1Q18 A;  3NFA A;  2RPI A;  2ZWH A;  1JLF A;  3LWL A;  1BCO A;  3I0R A;  2NNW A;  4YDU C;  1YI2 N;  4CK2 A;  5BRD A;  3OTO K;  5I42 A;  1HYZ A;  3HM8 A;  1VQ7 N;  3RR8 A;  3WXM B;  4H8K A;  3HVR A;  4DS5 A;  3AO5 A;  5BRE A;  3CC7 N;  3Q7B A;  4JYA K;  2NRT A;  3CJC A;  1NGE A;  1YHQ N;  4JLH A;  1Z6R A;  3VQP A;  2IGI A;  3TAG A;  2XY5 A;  3WNH A;  1OH7 A;  3J8A A;  5F1X A;  5IWA K;  4CF0 A;  2D4W A;  3T69 A;  4OGC A;  5AQK A;  1RDD A;  1ITG A;  2P5G A;  1K73 O;  1JLA A;  3S9H A;  1HMV A;  2HBL A;  4CBW A;  2HHV A;  2OPP A;  3UKU B;  1M90 O;  4C8K A;  2G8F A;  3SQ1 A;  1Q7Y O;  3CMA N;  5J2Q A;  3LDO A;  3KVG A;  2QW9 A;  3C7N A;  3ENB A;  3NF8 A;  1KAX A;  2B5J A;  4BRE A;  4RTF D;  1L3U A;  1U49 A;  4K0K K;  1CLQ A;  4J2A A;  3NH0 A;  4H0P A;  2YI1 A;  1S9E A;  4M41 A;  5AQW A;  2E5L K;  4BWJ A;  2UXC K;  3SV3 A;  2B4J A;  1IKY A;  1X9W A;  4FZY A;  3MWT A;  3OYC A;  3CM6 A;  4JS4 A;  3L2U A;  2OZM A;  1TGO A;  1W9H A;  4O8U A;  3F9M A;  3L3V A;  4XH4 A;  4JKH A;  5M1P A;  3WXK A;  2O8B A;  2HF4 A;  2A6A A;  3H46 O;  3BUZ B;  2HHW A;  4FK4 A;  3OYM A;  3FZM A;  1A5X A;  3VF4 A;  5GIO A;  4N5S A;  3THX B;  1RIL A;  4RW4 A;  3QEV A;  1TL3 A;  3K5N A;  3J7Y P;  4JKF A;  4H03 B;  3ZT3 A;  2BDP A;  4UY8 O;  1I94 K;  3TSU A;  1TKD A;  2Q1N A;  4FJJ A;  2GWK A;  5CYM A;  4OKK A;  4JKA A;  4B9U A;  2WC9 A;  2WBN A;  2OTJ N;  1RFQ A;  2ITM A;  4IEE A;  4CZI A;  4JI5 K;  1BDG A;  2O4I A;  2YJE A;  4BC5 A;  4CJV A;  4CFD A;  3ZSQ A;  1Z26 A;  3O1B A;  3VEY A;  2D5R A;  3DLG A;  1JCG A;  2W42 A;  2BAN A;  4O55 A;  4WFB L;  3TPQ A;  1B92 A;  3OYE A;  5M1N A;  2HOE A;  4DTU A;  4H5N A;  1NMN A;  1HJR A;  4LF8 K;  2FSN A;  3KWI A;  4B1W B;  3CCL N;  1SKS A;  3M8P A;  2Q97 A;  1VQ8 N;  1IG9 A;  1VSD A;  5AQR A;  4RW6 A;  1JL2 A;  5C25 A;  1EP4 A;  4FVU A;  3MWP A;  2RHK A;  2ZE2 A;  1E4G T;  3QML A;  3QBW A;  2VG6 A;  4CEA A;  4Y0W A;  1QQN A;  4YFU A;  3AVB A;  1BU6 O;  3ZX3 A;  1J5O A;  2A40 A;  5E41 A;  4DQQ A;  5TKY A;  3TAE A;  1YVN A;  4A59 A;  4CEC A;  1KCF A;  3QLH A;  3ZSZ A;  1SL1 A;  1ASV A;  3IMX A;  5FRO A;  4GV9 A;  3IFR A;  4E0D A;  1JLQ A;  1KFS A;  2GBZ A;  5C10 A;  2ZJQ L;  4PY5 A;  2PAV A;  3VMF B;  3QER A;  1WUA A;  3SMS A;  3V4I A;  3M8R A;  5JS1 A;  3THY B;  5FPE A;  4F3O A;  4FWP A;  2HBM A;  4DU3 A;  4FL9 A;  1NGC A;  3O9R A;  2FBT A;  4RG8 A;  4Z94 A;  3O9S A;  3U9Z A;  5HRS A;  3MEG A;  2QWO A;  4DWI A;  2FXU A;  4FJL A;  3NVM A;  1VQO N;  1RDU A;  4M3Y A;  5TKW A;  2Z1I A;  3SUP A;  1S1U A;  4DLE A;  3MN5 A;  4GV6 A;  2E20 A;  2NUB A;  4C1N I;  3GL1 A;  2F96 A;  1TYQ B;  3I33 A;  2D0B A;  3HXM A;  1Q82 O;  2BGG A;  4NYN A;  1VAZ A;  5CZ1 A;  1GLC G;  3F2K A;  4IDH A;  3PSI A;  4DQ8 A;  1YIJ N;  3EZW A;  5KPT A;  4O8K A;  2UUC K;  1TKZ A;  3GDQ A;  4A2A A;  3MMV A;  3EE8 A;  5GIN A;  3MX5 A;  4DSK A;  3MXJ A;  1BA1 A;  1NLV A;  3BP8 A;  2W41 A;  2GEM A;  3NHG A;  3ATU A;  2GUI A;  1NOY A;  1TL1 A;  5F2R A;  3EN9 A;  1QVG M;  4LF9 K;  3M1F A;  4PQU A;  3O5B A;  4CE9 A;  4KHQ A;  3MK6 A;  4IG3 A;  3OYA A;  3LAN A;  2RKI A;  5AQY A;  4Y1D A;  3VF2 A;  3M8S A;  4CZM A;  1BI4 B;  4BY9 C;  5I3U A;  1ILY A;  4FWQ A;  2FLO A;  1NNE A;  5C12 A;  2QKB A;  2VCP A;  2QI2 A;  1RT1 A;  4KHS A;  4JKD A;  3K9K A;  4IG0 A;  4JD2 A;  1RDB A;  4NXN K;  2P9N B;  3NVK A;  4B9T A;  2HHU A;  1NK9 A;  5C0Y A;  4K8Z A;  5F0X A;  4EZ6 A;  3MCA B;  1J53 A;  3CJB A;  1K8K A;  1A5W A;  3A5M C;  4DHY A;  3ZSW A;  3RSE B;  5JLF A;  3RWU A;  1ZBU A;  3HO1 A;  1Z25 A;  1NGD A;  3M6G A;  1IG8 A;  3ALY A;  3MAQ A;  1QHT A;  2D1K A;  4FZZ A;  4B1Y B;  3VET A;  4WQ4 A;  3UKR A;  4LF7 K;  4X65 K;  1C1A A;  2Q3S A;  3AVI A;  4E19 A;  3HBT A;  3A8Y A;  3RMA A;  3O9Q A;  3TSQ A;  3ZYY X;  2ASO A;  2IDO A;  1XNQ K;  1WSG A;  3HM9 A;  5M1O A;  1JKH A;  1NGJ A;  3VGK A;  5C42 A;  1T05 A;  4DV7 K;  4YOU A;  5AQG A;  2VGM A;  3ZSO A;  3O4N A;  3I55 N;  3G0Z A;  2UXD K;  3RMC A;  4FW2 A;  3VF6 A;  3KLG A;  1VQP N;  4H4M A;  4HCB A;  3WNG A;  4BQL A;  2P9U A;  1B9F A;  2ZGZ A;  3HOS A;  4J2E A;  4E7K A;  2F8S A;  1U2V A;  1KRP A;  1RGI A;  3C6U A;  3EKS A;  4CJL A;  3AY9 A;  4CFA A;  3U9D A;  2DTU A;  1LAW A;  3IAY A;  4NO7 A;  2P1J A;  2F7T A;  2E88 A;  4V19 S;  1U48 A;  2Q31 A;  4LC9 B;  1KD1 O;  4NXM K;  5EX5 A;  2YKM A;  3OYH A;  2O8D A;  4ICL A;  1TAQ A;  4AM6 A;  1L3T A;  3CYM A;  1SKR A;  4DSF A;  3HL8 A;  2NZT A;  4CJP A;  1GOB A;  1NMD A;  3OYJ A;  3A2F A;  4YOV A;  3HST B;  5HLF A;  3NMU A;  2KTQ A;  2HF3 A;  3QEW A;  3VGL A;  4DFK A;  2ZF5 O;  1D8Y A;  1TVR A;  2Z1G A;  3ZEU B;  4BDP A;  1JXB A;  1NKE A;  3V1R A;  3WQT A;  3DM2 A;  5HBM A;  3CIP A;  2J4R A;  4DUY K;  3OS1 A;  2NRZ A;  1IH7 A;  3AAP A;  3WUH A;  1XHX A;  4BRK A;  3MN6 A;  3VOV A;  1VSF A;  2OTL N;  4ILJ A;  1BGX T;  3UIQ A;  2UYT A;  1L3V A;  3HVT A;  3V9W A;  5BPN A;  3L6Q A;  2WON A;  2YV0 X;  4FWR A;  1NKB A;  2KW4 A;  4CES A;  3MED A;  3DXK B;  4JRP A;  3WXI A;  4EP4 A;  4BC4 A;  3QNN A;  4CJF A;  4EZ9 A;  2JGU A;  4M7X A;  3O9T A;  3VPZ A;  5AFU A;  3KK2 A;  4U7B A;  2FF3 B;  2QA4 N;  4JI8 K;  2A1S A;  2I7P A;  2V7Y A;  1C1B A;  4GNI A;  3LP3 A;  5KGX A;  4CEO A;  4BR5 A;  4XEI A;  4Y1C A;  5ADX H;  4W5T A;  1W0H A;  4BRO A;  4I2P A;  2O8F B;  2FSK A;  4X62 K;  1WNS A;  2UU9 K;  2IVP A;  2W40 A;  3K58 A;  4BE1 A;  3ZET A;  3WT0 A;  1J5E K;  1J6Z A;  3OS0 A;  1V4S A;  3OA9 A;  3ZX2 A;  4AHC A;  3AAR A;  1FJG K;  3JXU A;  1EO1 A;  4OJR A;  1QSS A;  1RTI A;  1HYS A;  5AJ3 K;  4DTP A;  1UA1 A;  3PIO L;  2P9P B;  4BRN A;  4CGD A;  5ADX A;  2R7Y A;  2GTD A;  1JCF A;  3E9O A;  3OYG A;  2HHS A;  2XO7 A;  1M1K O;  3VEW A;  1NK8 A;  2QWQ A;  2FC0 A;  4NB4 A;  4KRE A;  3FFI A;  4H0O A;  4PHT X;  4TSX A;  5KRS A;  5BR9 A;  1YJW N;  1V4T A;  3CPW M;  3LDQ A;  3GOI A;  4IO9 L;  4Z4E A;  2G8W A;  3TSP A;  3P31 A;  2KLA A;  2E2N A;  1H1V A;  3FZH A;  3LDP A;  1U47 A;  3EO3 A;  4JN4 A;  4WFA L;  1BIU A;  3AAQ A;  3GBT A;  5EU7 A;  2A1R A;  1IKX A;  4CHP A;  4DTJ A;  2IVO A;  1YJ9 N;  3QEP A;  1C0T A;  4FJ5 A;  4MQ3 A;  4LF6 K;  3SLC A;  3RMD A;  1RT4 A;  3RVC A;  3QET A;  2DFF A;  3NDK A;  3AO1 A;  3L2Q A;  4A5B A;  4KHN A;  1HKC A;  3TAP A;  4FJM A;  3A5L C;  1N6Q A;  2IOC A;  4PKH A;  4FLY A;  4O44 A;  5M1K A;  3IKM A;  1SQK A;  2ITG A;  3E1Y A;  3D2E A;  2Z1J A;  3HPG A;  1EKE A;  4DR4 K;  4GVE A;  3TTD A;  4M3T A;  4OX9 K;  3R8E A;  3DAW A;  1DTQ A;  4X64 K;  3ID8 A;  3KK7 A;  2XY6 A;  2O8E A;  2YHY A;  3J81 O;  3L3U A;  3IRX A;  4N56 A;  3KIO A;  1HJO A;  1R0A A;  4ZTF A;  4F3T A;  1T03 A;  2NRV A;  3V6D A;  3HYF A;  4JKE A;  4OPH A;  1JJ2 M;  4AHV A;  3AV9 A;  4CJ4 A;  2ZQB A;  4FLW A;  1LW2 A;  1QE1 A;  4DSI A;  4CIG A;  2KFN A;  1XC9 A;  5BRF A;  4BDZ A;  4JRQ A;  4W5N A;  1O13 A;  5GAE P;  2HHH K;  4J2D A;  5J2M A;  3O4W A;  4B9Q A;  3O3H A;  3OYB A;  4DQR A;  2VYP A;  2X6N A;  4HHT A;  4CFB A;  1HLU A;  2RE2 A;  3P4I A;  1RBT A;  3R3L A;  2PYL A;  3SPZ A;  4CJT A;  4DTS A;  1I3A A;  1N33 K;  4CJR A;  3BEX A;  2OZS A;  3CHW A;  3ZX0 A;  4Z4C A;  4BR2 A;  2VWJ A;  4CHY A;  3CM5 A;  4JKG B;  4BR0 A;  2E6L A;  5DMR A;  1DGK N;  1QQO A;  2P9I B;  2VG7 A;  3AO4 A;  3CQ8 A;  3UB5 A;  3V9U A;  5KQD A;  1JL1 A;  3I8B A;  2KKZ A;  4A2B A;  3NH1 A;  4H0T B;  1NGF A;  1S1W A;  5EOY A;  2IIR A;  1XMO K;  4FVM A;  1HQU A;  4K25 A;  4O5B A;  1U4B A;  3V1O A;  1SUQ A;  4M3X A;  5KPZ A;  2YCH A;  3V81 A;  1MU2 A;  1HKB A;  2UUA K;  3ID6 A;  2VGN A;  3LPU A;  2D0A A;  4ILH A;  1WAF A;  1XNR K;  3CET A;  5HRR A;  4GY2 B;  1UWB A;  3VA0 A;  4LH4 A;  4CZE A;  3H3O B;  3MEE A;  1HRH A;  3NF6 A;  2ZM6 K;  4CGJ A;  2DY4 A;  3G6E N;  3CPE A;  4NCB A;  3AVA A;  4AM7 A;  3CXC M;  4JI3 K;  1KVA A;  1QSY A;  4CBX A;  1BL3 A;  4CZL A;  1BO5 O;  5JVG L;  1S5J A;  4FJ9 A;  4LSL A;  4YOT A;  3TAR A;  2Y1I A;  5C2F A;  3WNF A;  1DTT A;  1S6Q A;  4KV8 A;  3M3Z A;  1ZBL A;  5IT9 O;  3K5M A;  4CGI A;  5JVH L;  3LP0 A;  4LY7 A;  3VQ5 A;  4K8X A;  3TAB A;  3OBW A;  3DWL A;  1F21 A;  1FK9 A;  1DKG D;  4KB0 A;  1NGI A;  5J1E A;  2P9K A;  4OKJ A;  4EHU A;  3AA2 A;  2B6A A;  3CC4 N;  1QHA A;  3AO2 A;  3KD5 E;  3QB0 A;  4WQ4 C;  1KQS M;  2V7Z A;  2Q2R A;  4KH5 A;  5LMU K;  4AHR A;  3E01 A;  4OPK A;  2X78 A;  1VQ4 N;  5HRP A;  3VN5 A;  1OH8 A;  1BQN A;  4KI4 A;  5A2Q O;  4FYD A;  1VSJ A;  3U6F A;  2Z1H A;  5AQV A;  5HRN A;  2NRR A;  3ITH A;  4JI2 K;  4Z4G A;  2IAJ A;  3CJ1 A;  3DRS A;  1ASU A;  2X6S A;  5GAH P;  4YOR A;  2GX9 A;  1WBB A;  3ULE A;  2CH6 A;  1KFD A;  5AQJ A;  3WXL A;  4FOI A;  1QSL A;  1OVY A;  4M3W A;  5AQX A;  5AQI A;  4E1N A;  3QIO A;  1JLC A;  2IVN A;  4FJ8 A;  1BIS A;  5AQQ A;  2WFB A;  2GV9 A;  1ESV A;  4IWV A;  4PKI A;  3PSF A;  4C1N K;  4DR7 K;  4F9O A;  3HP9 A;  4E7L A;  4FLZ A;  3L4Q A;  1WOQ A;  3DMJ A;  4Z0U A;  5LY3 A;  5BPL A;  3O08 A;  4CHQ A;  4FLT A;  1WSI A;  3KK1 A;  1YTA A;  1FW6 A;  4NCA A;  4N76 A;  1XQS C;  4DR3 K;  4KFB A;  4WE1 A;  5EXW A;  1VQ5 N;  2A42 A;  4M7Y A;  4M3R A;  4B3S K;  1NGH A;  4JAX A;  4O5F A;  5C2D A;  3JYT A;  2A3Z A;  5KRT A;  1C0G A;  3W3D A;  3E9P A;  3IDH A; 
#chains in the Genus database with same CATH homology
 4IOA L;  3HOS A;  4BQZ A;  4EIA A;  2QM1 A;  3FR0 A;  1U2V A;  4BRA A;  3UE5 A;  3CQX A;  3FFK B;  4H5T A;  2E8A A;  4FWM A;  3QIC A;  4FWN A;  1RGI A;  4CZF A;  3EKS A;  2QWM A;  2P9K B;  4L3Q A;  3GG4 A;  3AY9 A;  3U9D A;  4QS8 A;  4EHT A;  4NO7 A;  1BG3 A;  4YOW A;  4IOC L;  2F7T A;  2E88 A;  4CD1 A;  4BRP A;  1VQ9 N;  2Q31 A;  3AGK A;  1MA9 B;  3K9J A;  4LC9 B;  4CJ7 A;  1Q81 O;  5E84 A;  4CZK A;  1GLD G;  3E66 A;  3O9U A;  5EX5 A;  2JWK A;  5DM7 L;  1KD1 O;  2PFU A;  4AM6 A;  3TTC A;  1YXQ A;  1MDU B;  4B1X B;  1C0F A;  2OAN A;  1P8Z A;  2NZT A;  4WQ5 C;  2VWB A;  5AQF A;  3H3N O;  2E2P A;  4MDB A;  4JD2 B;  1SZ2 A;  1NMD A;  1SS6 A;  4YOV A;  4CBU A;  2YHW A;  4XH5 A;  3UKU A;  3NMU A;  3CD6 N;  5M1F A;  3WEE A;  5LJW A;  2HF3 A;  2P9P A;  4BRF A;  4CZG A;  3VGL A;  2ZF5 O;  4MO4 A;  4ISE A;  4J8F A;  4A57 A;  3ZEU B;  1JCE A;  3D2F A;  3C6H A;  3LDL A;  1K8K B;  4CI6 A;  3ULE B;  3WQT A;  4HWI A;  5AZJ A;  4JHD A;  2QWR A;  3CCE N;  4JK8 A;  1VQL N;  3C65 A;  3CIP A;  3DXM A;  2QWN A;  5AZI A;  2J4R A;  3OW2 M;  4H5V A;  2E1Z A;  1YAG A;  2NRZ A;  4RWT A;  1XC3 A;  3AAP A;  1Q86 O;  2NRH A;  3WUH A;  3ENH A;  1QQM A;  4BRK A;  3MN6 A;  2DPN A;  4FPB A;  3VOV A;  3H45 C;  3A0I X;  5BRH A;  4H5R A;  5I9E B;  2OTL N;  1LCU A;  1KAY A;  3LM2 A;  3UKR B;  4ILJ A;  3C0B A;  4BRG A;  3CME N;  4OPA A;  3O1W A;  2UYT A;  2ZGY A;  1YJN N;  2P9S B;  1KC8 O;  4B1Z A;  5BPN A;  3L6Q A;  3A5N C;  5MLC Q;  4BG8 A;  4FWR A;  3ENO A;  3SAF A;  4H0Y B;  3M5R A;  4WQ5 A;  2CGL A;  2P9L B;  4I6M A;  3DXK B;  3E9L A;  4IJN A;  3WXI A;  4BC4 A;  3QBX A;  4KH6 A;  4BRI A;  4K41 A;  3HZ6 A;  1Q18 A;  5JLH A;  2ZWH A;  3O9T A;  1YF5 L;  4M7X A;  3VPZ A;  1EQY A;  1BA0 A;  5AFU A;  1DEJ A;  3CER A;  2FF3 B;  4U7B A;  2NNW A;  4YDU C;  2QA4 N;  5EY4 A;  2I7P A;  2V7Y A;  3L0Q A;  3P39 A;  1NM1 A;  3CI5 A;  4QS9 A;  1T44 A;  4GNI A;  2NLX A;  5BRD A;  2P9U B;  5JIC A;  2QEX N;  3KHY A;  4BR5 A;  3HM8 A;  1VQ7 N;  4XEI A;  3WXM B;  3VGM A;  1U2V B;  5ADX H;  5BRE A;  1K8A O;  3CC7 N;  3H1V X;  1T6C A;  4BGB A;  3Q7B A;  4BRO A;  2FSK A;  2NRT A;  3CJC A;  1NGE A;  1YHQ N;  1Z6R A;  1CZA N;  3VEX A;  4E1J A;  1ATS A;  1SAZ A;  1X9J A;  2IVP A;  2W40 A;  5FPM A;  5H1S Q;  3ZET A;  3CCS N;  2D0P A;  3VEN A;  3WT0 A;  4BRH A;  4DKW A;  1J6Z A;  3J8A A;  1W2B M;  1V4S A;  4A61 A;  3OA9 A;  3QFU A;  3ZX2 A;  4JKB A;  2GWJ A;  3SJH A;  3TU5 A;  3AAR A;  5F1X A;  3CCU N;  1ATN A;  4RCH A;  3PIP L;  3CQY A;  2I7N A;  3JXU A;  4GV3 A;  2D0O A;  2D4W A;  3T69 A;  4CZH A;  4YOY A;  1EO1 A;  3VTH A;  1S22 A;  5AQK A;  5EVZ A;  1K73 O;  3EE9 A;  1YI2 N;  4KBO A;  4B1V A;  2HBL A;  4CBW A;  3UKU B;  1M90 O;  1KAZ A;  1MWM A;  3WEE B;  2EWS A;  3PIO L;  2P9P B;  4BRN A;  5ADX A;  1Q7Y O;  1BOT O;  2GTD A;  3D7E O;  1JCF A;  5AQN A;  1NWK A;  3E9O A;  2PBD A;  3N4P A;  3O8M A;  3LDO A;  4YDU A;  2Q36 A;  3KVG A;  4BRM A;  3B8A X;  2QW9 A;  3C7N A;  3ENB A;  3D2F B;  3O6W A;  4BVO A;  1M1K O;  3EL2 A;  1KAX A;  3VEW A;  2QWQ A;  5AQU A;  4BRE A;  4RTF D;  4NB4 A;  4JHD B;  3H1Q A;  5AZJ B;  4C23 A;  1GLE G;  1G99 A;  1KXP A;  4H0O A;  5AQS A;  3T7Z A;  4H0P A;  4PHT X;  2YI1 A;  3SBT A;  3HSC A;  3W3D A;  1W97 L;  5CR4 A;  3MN9 A;  5BR9 A;  3DXM B;  1VQK N;  5AZI B;  1V4T A;  4BC2 A;  5AQW A;  3CPW M;  1YJW N;  3LDQ A;  2QWP A;  3AGR A;  3GOI A;  3HI0 A;  3MWT A;  4IO9 L;  3VTI A;  3TSP A;  3KWG A;  4JKG A;  3P31 A;  2KHO A;  5KQ8 A;  2KLA A;  1QZ5 A;  1H1V A;  2E2N A;  3FZH A;  3LDP A;  4O8U A;  2P9I A;  3F9M A;  4DB3 A;  3EO3 A;  4JN4 A;  4XH4 A;  4JKH A;  3AAQ A;  5M1P A;  3GBT A;  3WXK A;  4WYB A;  4WFA L;  2HF4 A;  2A6A A;  3R9P A;  3H46 O;  3BUZ B;  1HUX A;  2IVO A;  1YJ9 N;  3VEO A;  2HBJ A;  3FZM A;  1BWF O;  3QFP A;  3VF4 A;  1LOT B;  5GIO A;  4AF1 A;  5LJV A;  5AQL A;  3L4I A;  3SLC A;  4BG9 A;  3RVC A;  4I6M B;  5CE3 A;  4A5B A;  4JKF A;  5BPM A;  4H03 B;  1HKC A;  2ASP A;  4WCE L;  3A5L C;  4UY8 O;  3Q7C A;  4PKG A;  4PKH A;  4NLB A;  3TSU A;  4R79 A;  2Q1N A;  1QVF M;  3LDN A;  5M1K A;  2GWK A;  3IKM A;  1SQK A;  3CCJ N;  4H0X B;  3E1Y A;  4JKA A;  4IFE A;  3D2E A;  5BN9 A;  3S41 A;  3CCQ N;  2WC9 A;  4GVE A;  5AR0 A;  3TTD A;  5GIP A;  3FGU A;  1X3M A;  2F9W A;  2WBN A;  2OTJ N;  3R8E A;  3VEZ A;  3DAW A;  1RFQ A;  2ITM A;  4IEE A;  3ID8 A;  3KK7 A;  2YHY A;  1TYQ A;  3FLC O;  2QXL A;  4CZI A;  3CCR N;  2BTF A;  2V52 B;  1BDG A;  1HJO A;  4XH1 A;  3R6M A;  1ZBS A;  4U67 L;  3DJC A;  2YJE A;  2NRV A;  4JK7 A;  1MWK A;  4BR4 A;  3O80 A;  4MLH A;  4BC5 A;  3I56 N;  3WXJ A;  2AA4 A;  3EKU A;  4JKE A;  1D4X A;  4OPH A;  3BF3 A;  3ZET B;  1N8R O;  3O1B A;  3VEY A;  1JJ2 M;  1RDW X;  1JCG A;  1YUW A;  3OBY A;  3TPQ A;  4WFB L;  4A62 A;  4DCH A;  5M1N A;  2HOE A;  3JS6 A;  3U8X A;  1X3N A;  4FWO A;  4H5N A;  1GLJ O;  4KH4 A;  4G9Z A;  4JKC A;  2FSN A;  3KWI A;  4B1W B;  1VQ6 N;  3CCL N;  5BRF A;  1VQN N;  2Q97 A;  1VQ8 N;  1O13 A;  5GAE P;  4JNE A;  1T3V A;  5AQR A;  4ISG A;  4YOX A;  3O4W A;  4B9Q A;  4WFN L;  2VYP A;  1S3X A;  4FVU A;  3MWP A;  2RHK A;  1HLU A;  1E4G T;  2CH5 A;  5KPR A;  3C7N B;  3H6E A;  3QML A;  2BH1 A;  2RE2 A;  3P4I A;  1BUP A;  3QBW A;  3R3L A;  5B8H A;  2Q0U A;  3MDQ A;  1QQN A;  2CGJ A;  4Y0W A;  3SAG A;  2JWL A;  4JEP A;  2FF6 A;  3BEX A;  4OO1 J;  1BU6 O;  3CHW A;  4IOX A;  3ZX0 A;  5AQO A;  1ZXO A;  3VES A;  4BR2 A;  1NBW A;  3ZX3 A;  2A40 A;  5TKY A;  2P9N A;  1VQM N;  3FZL A;  1YVN A;  2QTD A;  4A59 A;  4JKG B;  4BR0 A;  4ILG B;  4IXC A;  5AQH A;  1DGK N;  1QQO A;  2P9I B;  5DM6 L;  4FWK A;  3IMX A;  3UB5 A;  4GV9 A;  2YHX A;  5KQD A;  3IFR A;  1IJJ A;  3I8B A;  3CMA N;  2ZJR L;  2KKZ A;  4A2B A;  4H0T B;  2A5X A;  5CHI A;  5C10 A;  2ZJQ L;  2YJF A;  1NGF A;  2PAV A;  3VMF B;  3BF1 A;  3RSE A;  4K43 A;  1ATR A;  5EOY A;  1WUA A;  2IIR A;  3SMS A;  4PL7 A;  4BRL A;  4BRD A;  4QS7 A;  5FPE A;  4BR7 A;  4K25 A;  4BR9 A;  4FWP A;  2E1Y A;  2HBM A;  4FL9 A;  4IO8 A;  1NGC A;  3O9R A;  5KPZ A;  4Z94 A;  3O9S A;  3U9Z A;  3VER A;  1HPM A;  2YCH A;  1HKB A;  4HTL A;  5GAD P;  3ID6 A;  2QWO A;  2VGN A;  2FXU A;  4ILH A;  3D2E B;  3CET A;  1TUU A;  4GY2 B;  3NVM A;  1VQO N;  1RDU A;  3KZB A;  5TKW A;  1DT9 A;  3U4L A;  3H3O B;  4CZE A;  2ZJP L;  3MN5 A;  3CCV N;  4GV6 A;  2E20 A;  3IUC A;  4C1N I;  3GL1 A;  1TYQ B;  3I33 A;  2V51 B;  3G6E N;  1Q82 O;  4FOE A;  5M1Q A;  1QZ6 A;  3CJ9 A;  1GLL O;  1VAZ A;  3CPE A;  1HKG A;  1GLC G;  3F2K A;  3C6A A;  4ISF A;  4FSV A;  5AQZ A;  4AM7 A;  1E4F T;  4IDH A;  3CXC M;  4WF9 L;  4CBX A;  4CZL A;  3EZW A;  1BO5 O;  4DQ8 A;  4O8K A;  4M63 C;  5KPT A;  5JVG L;  1YIJ N;  2NRW A;  4BVP A;  3GDQ A;  3QDK A;  3MMV A;  4A2A A;  3EE8 A;  4YOT A;  4BRQ A;  5GIN A;  2HST A;  3MX5 A;  2WUS A;  3F5T A;  5C2F A;  3ATV A;  1BA1 A;  2Q0R A;  1NLV A;  3BP8 A;  3TTF A;  1P90 A;  5AQT A;  3M3Z A;  2W41 A;  2GEM A;  3CCM N;  5JVH L;  2F9T A;  3G4S N;  1GLA G;  3ATU A;  3OHR A;  5F2R A;  3EN9 A;  3DWL A;  3OBW A;  3M1F A;  1QVG M;  4IEI A;  1DKG D;  3O5B A;  1NGI A;  1NJI O;  2P9K A;  4EHU A;  2HMP A;  3MK6 A;  3CC4 N;  1T6D A;  4FPA A;  3N4Q A;  1QHA A;  3QB0 A;  2GEL A;  4K42 A;  4WQ4 C;  5FPD A;  1KQS M;  2V7Z A;  3J7Z O;  3FE1 A;  2Q2R A;  4FWS A;  4KH5 A;  1OKJ A;  2FSJ A;  5AQY A;  1NGG A;  5GAG P;  4BC3 A;  5AFU H;  3VF2 A;  4CZM A;  4BY9 C;  2GUP A;  4H0V B;  4PL8 A;  4EAH D;  3PLA A;  1VQ4 N;  5E26 A;  4FWQ A;  3HOT A;  3GE1 A;  1ILY A;  3MX2 A;  3DLL L;  3HRG A;  2FLO A;  2E2Q A;  5C12 A;  1Y64 A;  2QI2 A;  2VCP A;  3FZF A;  4JKD A;  3K9K A;  4JD2 A;  5BN8 A;  2A41 A;  2E2O A;  1NGB A;  2P9N B;  3CC2 N;  2AP1 A;  4A5A A;  3G25 A;  3R1X A;  5AQV A;  3SMP A;  3CF5 L;  3NVK A;  2NRR A;  1K9M O;  5C0Y A;  1ZC6 A;  3CJ1 A;  5GAH P;  2YX6 A;  4YOR A;  5ELZ A;  3IDH A;  3LM9 A;  2GX9 A;  5F0X A;  5HL7 L;  3MCA B;  1R59 O;  3ZEU A;  3CJB A;  1K8K A;  3SBG A;  3ULE A;  4EFH A;  5HOO A;  2CH6 A;  5AQJ A;  3WXL A;  3W0L A;  3A5M C;  4DHY A;  4FOI A;  3RSE B;  4BGA A;  5AQP A;  1OVY A;  3CJA A;  5JLF A;  5AQX A;  4CZJ A;  5AQI A;  5FPN A;  1NGD A;  3FZK A;  3M6G A;  4IZ9 A;  1NGA A;  3WQU A;  1TUY A;  2NRX A;  1IG8 A;  2IVN A;  3MN7 A;  3SAH A;  5AQQ A;  2WFB A;  2ASM A;  1ESV A;  4IWV A;  4PKI A;  3HTV A;  2D1K A;  5JMV A;  3CJ7 A;  4C1N K;  4B1Y B;  4JK9 A;  3VET A;  4F9O A;  4WQ4 A;  3UKR A;  1U6Z A;  2HBK A;  4MDA A;  3D6R A;  3L4Q A;  3LL3 A;  4FWL A;  1WOQ A;  3HBT A;  2P9S A;  3A8Y A;  5LY3 A;  2QWL A;  5BPL A;  2H3G X;  4NLC A;  4BRC A;  3O08 A;  3O9Q A;  3TSQ A;  2CGK A;  3ZYY X;  3SK3 A;  2ASO A;  4IJA A;  5AQM A;  2P9L A;  3DXK A;  1HX1 A;  5M1O A;  1NGJ A;  1GLB G;  3VGK A;  3MCP A;  3G71 N;  1YIT N;  3VEV A;  4MLE A;  1XQS C;  4YOU A;  5AQG A;  2VGM A;  4MO5 A;  5C15 A;  5EXW A;  1VQ5 N;  2A42 A;  4B1U B;  3P38 A;  3I55 N;  1Z05 A;  4M7Y A;  1NGH A;  4CD3 A;  4JAX A;  3VF6 A;  4O5F A;  1VQP N;  3A5O C;  5C2D A;  1S72 N;  1GLF O;  2A3Z A;  4FO0 A;  4BQL A;  1C0G A;  2P9U A;  4H5W A;  3E9P A;  2ZGZ A;  2BUP A;  1XUP O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...