5C10A

Nuclease domain of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
242
structure length
230
Chain Sequence
b'MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
total genus 82
structure length 230
sequence length 242
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c10A00
4IFEA 3CPEA 5C2DA 5M1QA 5C10A 4IEIA 4IDHA 5C15A 4IEEA 5M1NA 5C2FA 5M1PA 3C6HA 5C12A 5M1FA 5M1OA 3C6AA 5M1KA
chains in the Genus database with same CATH superfamily
1HRHA 1LWFA 1R59O 4CJWA 2G8HA 3LP1A 4CJEA 1DKGD 3K5MA 3UKUA 1QQNA 4MLEA 3S9HA 4HUEA 3IAYA 1MWMA 3EY1A 5DMRA 5CE3A 4NCBA 4KHQA 2XY5A 1J5OA 2QKBA 3NCIA 5ELZA 2ASMA 3NF9A 3LM9A 2NRHA 1RDBA 2QA4N 3Q7BA 1XNQK 5LJVA 3RSEB 2ZM6K 4U7BA 2A42A 3JXUA 4JEPA 5LY3A 1NLVA 3BF3A 3G6EN 1NMDA 2XO7A 2YNIA 3ATVA 1QHAA 3DXKB 1T05A 3OS1A 2IS3A 3VEOA 4DLEA 2IIRA 3E01A 3SBGA 1SV5A 4H5RA 3CCUN 5BRHA 2QWNA 1WAJA 4FJMA 5GADP 3PV8A 4E1NA 3K59A 1X9SA 5CYMA 4CZGA 3ZX2A 4GW6A 3AO4A 1KC8O 3HTVA 2D5RA 2HBLA 3AV9A 5MLCQ 3LP0A 3HBTA 2G8UA 4BY9C 1ZBSA 3ZSOA 3QINA 5IWAK 4G9ZA 4CBXA 3CCLN 5AQVA 1C1BA 1JLEA 5LMNK 2O8DB 4DQPA 4FWRA 4WQ4C 3TWHA 4I9LA 1NMNA 3ENOA 3G71N 3MWTA 4CERA 4FCYA 1S1VA 3QLHA 2V7ZA 4E19A 3ZT1A 4JHDB 4FSVA 4B1VA 3KTQA 1RT5A 4BR0A 4DR4K 2I7PA 1NK0A 1YVNA 3S41A 3LDNA 1BQMA 3MEGA 1SKWA 4BE2A 1YHQN 1NK4A 1Q9YA 4OO1J 4CGIA 2G8FA 5CY4A 2V7YA 3OYFA 3K2PA 2JLEA 2P5GA 3O6WA 3OJSA 1X3NA 1W9HA 3T1HK 4DV2K 4IO9L 3RMBA 3QEWA 3J7AP 3LDQA 2F8TA 2QWOA 4A5BA 3EZ5A 3B6PA 1HYVA 3WXMB 4O8KA 3DRRA 3ZCMA 2DPNA 1WOQA 2X6NA 4LD0A 2QM1A 2F7TA 4B9UA 4CGDA 2W6LA 2YKMA 3EE8A 1OH7A 1JLFA 3J81O 4JI4K 1J54A 4W5QA 3RSEA 1NG9A 1IBKK 1HLUA 1LW2A 1L3SA 3MXJA 4IEIA 3O4QA 4YY3K 2A5XA 3DXKA 3O9SA 3FZMA 3TSPA 3CCQN 1S9GA 2UUAK 4B3TK 2E4LA 3E66A 3LPTA 4DR6K 2FC0A 4B9TA 3SV4A 1BO5O 4IWVA 1FW6A 1RBTA 4MO5A 4B1XB 3QEPA 3DYAA 4FLWA 2KLAA 1N5YA 2YNGA 2HHTA 3PY8A 4FZYA 4NYNA 3KK2A 1I39A 2KZZA 5AJ3K 3FZHA 3VQCA 1U47A 4BE0A 5AQGA 1VQ6N 3U6FA 1MWKA 2QI2A 4I2QA 4CJTA 3ZT4A 2YHWA 4BACA 1VHXA 4BRDA 2GX9A 4HUFA 3D0PA 4CHNA 2NRZA 4RCHA 4CBUA 5FRNA 1NGAA 3SK3A 4E1JA 4Z4FA 1K8KA 3PIOL 1X3MA 2RF2A 4F3TA 3DRPA 1QSSA 4WQ5A 4CCHA 5BN9A 3OW2M 4CK3A 2BANA 4DF8A 2VQEK 3TAFA 4FJXA 4IFYA 2O8FA 2E1ZA 5AZIB 2HNDA 1BIUA 1RILA 5JICA 3O08A 4LF6K 1D9DA 4J8FA 3NMUA 1JCEA 3K9JA 4M3ZA 3ZYYX 4OLAA 4E7LA 5JS1A 3QESA 1T7PA 3F9KA 5T7BA 1TGOA 5EOYA 1GOAA 2BH1A 1IBLK 3VMFB 2Q0UA 4CK1A 3D7EO 2VCPA 3MCAB 3KD1E 3RTVA 4CEBA 3DLBA 2GELA 2HBMA 3ITHA 1RBUA 3OYEA 1NK6A 3IG1A 3CJ9A 2YI1A 1IO2A 5AQNA 3V1OA 3QBXA 3MN6A 1XMOK 1L3VA 4ILHA 2PY5A 2JWKA 3DLEA 2OZMA 3KIOA 1KD1O 3BEXA 2QK9A 1S1XA 1JLBA 1VQ4N 2O8BA 1NWKA 3VQ9A 2JGUA 1SS6A 1VSLA 3HP6A 3CCSN 4DQRA 2HMPA 4DR3K 4FO0A 3D2EB 1KLNA 3ZSXA 3KWIA 4FOEA 3FFKB 5J1EA 4AHTA 3HVRA 1DGKN 1XC9A 1YT3A 2RKIA 3PUFA 4JK8A 4YNQA 4A2AA 3DMJA 4RW8A 1UA1A 5AQMA 1YXQA 5KQ8A 3AGKA 3CMAN 3NGZA 4FM1A 5HRSA 3HXMA 4DLGA 1RFQA 4OGEA 4DU3A 4BWJA 4F4KA 1RT2A 1GLCG 3KHYA 5EXWA 4KV8A 2GUPA 3K5OA 3LZIA 1JJ2M 3DJCA 1CZAN 4KHWA 2BGGA 2HF3A 3CC2N 1VQKN 1T6CA 3A5NC 4BGAA 3H1QA 1BHLA 3WXIA 3SZ2A 4DSJA 1FKOA 1L3UA 4R79A 3R6MA 1ASVA 4KBOA 3NVKA 4DR2K 5SZTA 4DTPA 1YJNN 2P9NA 3W0LA 1I94K 1VSJA 1BL3A 3OYNA 4KAZA 4LSLA 3R1XA 3ENBA 5AQWA 3SMPA 2YHAA 3KD5E 1YAGA 5M1OA 4BREA 4CJQA 4LF8K 3CFOA 4FJNA 3VF4A 4CECA 4FLVA 1BOTO 1NOYA 4LY7A 2Q36A 3D2FB 1EX4A 4KTZA 3IDHA 4CE9A 3HYFA 3WXJA 3CFRA 4FWMA 2EWSA 4WCEL 3A5LC 2UYTA 4FWSA 4FLTA 1IKWA 3GL1A 3OYLA 4V19S 4B9LA 1RNHA 4A57A 4CVNE 1Q9XA 1QQOA 1NGHA 1KQSM 1B92A 4JKFA 4B1UB 3THYB 1NJXA 2OZSA 1NJZA 3LAMA 2F9TA 1T3VA 3BDPA 3P83D 1TYQB 1BQNA 4L3QA 3KK1A 4Z94A 3LP3A 5I9EB 4MDAA 3TAGA 1JLGA 5I42A 3AO5A 5KRSA 4OKKA 4WF9L 3HM9A 3AA3A 3K0SA 2E8AA 3VQ6A 1U6ZA 4DTXA 3L4QA 4CJKA 5KGXA 2FXUA 2JWLA 4BRPA 3CI5A 3VEYA 4BDZA 3QMLA 3QNOA 3NF6A 4JYAK 3R3LA 4BRLA 2PYJA 4FLYA 4NB4A 3V6DA 3V9WA 2D4WA 2HNYA 1QTMA 1EKEA 1RT6A 4YFUA 1HNVA 5LJWA 5I3UA 4R5PA 2CGKA 3TABA 3NF7A 4AHSA 1KRPA 4B9SA 4N5SA 3KK7A 1TK5A 2CGLA 5HOOA 2IC3A 1IJJA 4HCCA 2F9WA 3EO3A 4FW1A 1BGXT 1WSEA 1FJGK 4QCLA 2P9LB 4BRAA 4DTUA 5HRNA 1S6PA 1X1PA 4H0PA 1LAWA 1Z25A 4JKHA 1LWCA 2DY4A 1TKZA 1C0GA 1VSEA 2KW4A 1OH8A 4YOWA 4FOIA 4IFVA 4CZKA 3SUPA 4BDPA 4CD3A 4IO8A 1HMVA 2FSKA 3ATUA 2KFZA 3SUQA 3ASMA 4J2BA 1BUPA 4QS8A 2NRWA 4IOCL 3THXB 3SQ1A 1T44A 3AAPA 5FPEA 3SBTA 2Y1IA 5DK5A 2GBZA 2IDOA 4DB3A 5KPTA 4E1MA 3SQ4A 3OYDA 3VQ7A 1NJYA 4X65K 2B5JA 4DHYA 4DQQA 3DLHA 4OPAA 2EX3A 4ZHRA 4F9OA 4DR1K 4BDYA 1ASWA 1Z6RA 3AVLA 4LF9K 3HJFA 4AILC 3IKMA 3U9ZA 3I55N 1ZBIA 3A8YA 3VQ5A 3L3UA 1KAXA 1K8AO 4RTFD 1VSKA 3VQDA 3ZSYA 3LDLA 3CCJN 3THYA 3MN5A 1QHTA 2GWKA 4ID1A 2RE2A 3WNFA 3J7YP 1GLJO 3KJVA 1HNXK 1RBSA 2CGJA 3E1YA 4E3SA 4FJ8A 4PQUA 1A5XA 1ZYQA 2B4JA 3AGRA 3L4IA 4XIUA 3QBWA 1M90O 5AQUA 1MU2A 1GLLO 1HKBA 3NH2A 1TAQA 4DTRA 3VTIA 4CJVA 4JI2K 3PX6A 5KGWA 2I7NA 3VEXA 3CCRN 4CEDA 3RVCA 1RBRA 2WONA 2P51A 5KPZA 3H6EA 4UY8O 3CCVN 3HSTB 5AQIA 1XUPO 2P9SA 4M3UA 2PYLA 3DWLA 5TKWA 2OPPA 3MEDA 3ZT0A 2VGNA 5E41A 1VQLN 1WLJA 3ULDA 2HHWA 4XH1A 4B9MA 2P9PB 2NRVA 3ZSZA 3THWB 1P90A 1JLAA 5JMVA 4M3RA 4CHZA 1L3TA 3AAQA 2HHVA 3O9TA 1R0AA 3O4NA 4JKDA 3QIOA 4OKEA 3O9UA 1TK8A 2G8VA 5DM6L 3PSFA 2P9LA 4RWTA 3MXMA 4B8AB 5C42A 2YJFA 4N47A 3HK2A 4BGBA 2G8WA 3KKSA 2OTJN 4DTOA 3C6HA 4ZTFA 2XY8A 1XHXA 2P9IB 4Z4GA 2E2OA 4B1YB 4AHUA 2ATQA 3BGRA 1VQPN 2F8SA 3THXA 1J53A 4NXMK 4O8UA 2KFNA 4K25A 4DTJA 5C12A 3DLLL 3J7ZO 4F2SA 1HR0K 1WNSA 3VETA 4YOXA 4W5NA 1J5EK 4DTMA 4FJGA 5FRMA 2QWRA 4GVEA 1KXPA 1RBVA 3P39A 3MAQA 1K6YA 2XRIA 5M1QA 3QERA 3VA0A 2HF4A 4AM7A 4AHVA 2P9UB 4LH5A 2NRTA 4A59A 1HNZK 3L2QA 1WSJA 4CF9A 1U48A 4KO0A 2ITGA 1TL3A 1NGIA 5JLHA 1WSFA 3CCEN 2DFHA 3P4IA 4FJHA 2A3ZA 4W5OA 4MDBA 1O13A 4DR5K 3AVBA 4NCGA 2X6SA 1RT4A 3MK6A 4FVUA 4CF2A 3AARA 5FPDA 4CZEA 3ZSQA 1VQMN 2VWKA 2W40A 4LFCK 4CFCA 1ZBLA 4FLZA 3V9SA 1QZ6A 4KI6A 3VEVA 3QFPA 5HP1A 1BCMA 3KWGA 1E4GT 4JS4A 4JI6K 3HI0A 3VESA 3HPHA 1CZBA 5CHIA 4GV6A 5M1NA 3OYMA 3F73A 4AQYK 4LF7K 2P9PA 4ZTJA 3THWA 3OYBA 5EX5A 3CF5L 4PKIA 4O44A 4IOXA 5AQHA 3NH1A 4BQLA 5HRPA 2F4VK 1W7AA 2IGIA 3AA5X 3K58A 3VGLA 3OS2A 1K73O 5C24A 3TR8A 4DV1K 4BROA 1HYZA 4LSNA 3EL2A 2XY6A 2VYPA 5BPNA 3OTOK 3I0RA 3EKSA 4DSIA 2ASPA 4FWPA 4MFBA 1KFSA 4O5FA 5AQJA 4F8RA 4K8ZA 3O3GA 4K8XA 1T03A 3L2VA 2KTQA 2P9IA 3CC4N 4WQ5C 3MEEA 2AJQA 3AVHA 4JRQA 4E0DA 1NM1A 1NU0A 4JV5K 4L8RB 2RHKA 2F96A 4ID5A 3ZSWA 4JI3K 2D0AA 4EFHA 5AQKA 1D9FA 4DV7K 1DTQA 1S3XA 3IMXA 1U49A 1HNWK 3SAFA 4YDUA 4DU1A 4DU4A 3VGMA 3VEWA 3AO1A 1VAZA 3OYKA 5EVZA 2YKNA 1HKCA 1XQSC 3RMAA 4MQ3A 4CFDA 4A5AA 3SYZA 2ZQBA 4GNIA 4JLHA 5AFUH 4YOUA 1P8ZA 3BUZB 3D45A 4AHCA 3SI6A 4YORA 1TUYA 3QFUA 2P9UA 5FPMA 2OTLN 2QW9A 5C0YA 1VK0A 1YUWA 1EETA 3VGKA 4JKEA 4I2PA 4B9QA 4WE1A 2XY7A 3LPUA 3OA9A 3G25A 3QO9A 4C8MA 4B9VA 2E20A 1TKTA 3VN5A 4U67L 3PO5A 2RPIA 1KAZA 2HHHK 3O5BA 4JNEA 2O8DA 3C7NB 5HBMA 4I6MB 2QTDA 3JSMA 3SAHA 1RTDA 4FZZA 2FBXA 4JHDA 2P9KB 1YJ9N 2X74A 2WTUA 4H8KA 3TAQA 1KAYA 1RDCA 3OHRA 5DM7L 3AA2A 1TAUA 5AQRA 4A62A 1BIZA 5GIPA 5H1SQ 2ITMA 2Z1IA 1VSHA 4CF8A 3AO2A 3QB0A 1WN7A 4DSKA 2WUSA 2ZJPL 5C2DA 4N41A 2UXBK 1C0MA 2AP1A 3RWUA 4K0KK 4X62K 4E7KA 2YHYA 2A41A 1XMQK 3QICA 3B6OA 4FJJA 4ICLA 2DFEA 3WNHA 4QOZB 1F21A 4QAGA 1TKDA 5AR0A 3LAKA 3FZLA 2QXLA 3C0BA 4FM2A 3FE1A 3O80A 4KKOA 4Z4HA 1Q8IA 4DQ8A 4DSEA 3E9PA 3JYTA 2FBTA 4DQSA 5CR4A 3NGYA 3AVIA 5J2PA 4HHTA 2OA8A 4B9NA 4LF5K 3VPZA 4CZHA 1NGJA 4EHUA 4KB1A 2I5JA 3FLCO 4CFAA 2X78A 3F9MA 3VF6A 3V9ZA 2Z1JA 1RTHA 3N4PA 1YJWN 2VQFK 3O8MA 1ESVA 1ZXOA 5BR9A 3O3FA 1SL0A 4OJRA 3SMSA 4DTSA 3T69A 4DS4A 2A6AA 4OPJA 3LANA 4RW7A 2QXFA 3SJJA 5M1PA 4OX9K 4OLBA 1VQ5N 1IKYA 3JS6A 2OPQA 3AVNA 1NK7A 5AQYA 4C8NA 4DF4A 1WBBA 1RDAA 5FLXO 1CXQA 3AVMA 2GTDA 3ZSVA 1SKRA 1K9MO 3L3VA 4JKAA 1C0TA 1KSPA 3IS9A 4O0IA 1VSIA 3SPZA 2HVIA 1YITN 3EEQA 3UE5A 1D8YA 3DI6A 3HP9A 2QKKA 2W41A 4WYBA 4DV3K 2D0OA 2DFFA 1HQEA 4CJRA 4BR9A 3BF1A 5BRFA 1MDUB 3CPEA 1Y64A 2P9KA 5AZIA 1LW0A 4AM6A 3AO3A 4GKKK 4XH5A 3ID6A 4CEAA 3HT3A 2D1KA 1QVGM 2HW3A 4FWQA 4H0OA 4BRIA 1KFDA 2VG5A 3TTCA 3HO1A 4CJ5A 4OVLA 4NO7A 3L0QA 2RN2A 4RW6A 2LSNA 4BRQA 2G8KA 4DUZK 2E6MA 3KKRA 1RT1A 3AVCA 3O4WA 1X9WA 3SLCA 4WFAL 1T6DA 3QEVA 1HYSA 1J6ZA 1CXUA 3V4IA 3C6AA 3VQAA 3T3FA 4CJ3A 3V81A 4BRHA 1Q81O 1HQUA 1VSDA 4YOVA 1A5VA 3OYAA 4M7YA 4XH4A 3TAMA 3U3YA 4K42A 4JRPA 4GVMA 2UUCK 1A5WA 4FZXC 4DMNA 4H5VA 4X64K 3G0ZA 1JCGA 1N32K 4CGHA 4Z4CA 3C94A 2E5LK 3PSIA 3D2EA 4B3MK 1IH7A 2W6KA 3MN9A 4GV3A 5LMUK 4DSFA 3PX4A 3CJAA 3G10A 1XWLA 2HSTA 3PO4A 4W5TA 3K5LA 3SAGA 4PUOA 4H03B 1DT9A 2PBDA 3I56N 3HSCA 4CEEA 5AQSA 1T8EA 4IOAL 5SWMA 4DUYK 3GOIA 3SQ2A 4JI7K 3HM8A 3FR0A 3IUCA 4E89A 2FSNA 3MECA 4CFBA 3RR7A 4JAXA 1LOTB 3NE6A 4EP4A 1D5AA 5BPLA 3C65A 1E4FT 1DLOA 2HOEA 4H0TB 3RR8A 3CXCM 2HHQA 4PA1A 5CYQA 3WEEB 3EN9A 1HPZA 2NZTA 3H3NO 1U2VB 4UQGA 1ILYA 1S9EA 3PX0A 4BRFA 4NXNK 4B3OA 1L5UA 4CIGA 5M1FA 3ULEB 4M3YA 2E6LA 3UKRB 4PWDA 1NK5A 1BA0A 1Q7YO 1SZ2A 2ZE2A 4BC3A 3VTHA 2HHXA 2IVNA 1NGBA 1HJOA 4CD1A 1TUUA 3KVGA 3KLGA 3NFAA 2P1JA 5FPNA 4Z4IA 1UOCA 3UKUB 4RW4A 2WOMA 3CM5A 3D2FA 5JS2A 3HRGA 1REVA 3UIQA 4F2RA 2DTUA 2B6AA 2IAJA 1OVQA 1H1VA 4IJAA 5AQQA 3LDSA 3K9KA 5JVGL 3AA4A 2OPSA 5LL6Z 2EHGA 3A5OC 4DCHA 4J2EA 2V51B 3AVAA 4JI1K 4WFNL 4BRNA 2WBNA 1TYQA 3WNGA 3O9QA 4KHUA 4B08A 4BR2A 2YNHA 5EU7A 4CIEA 5AQLA 2KQ2A 3K57A 4KI4A 4IDHA 4FM0A 5M1KA 4RG8A 4KHYA 4O0JA 3VQ8A 1HX1A 2A1SA 5FROA 3CYMA 4H0XB 1TKXA 4DQIA 4CHOA 1FKPA 3OYIA 1NK8A 1HPMA 5ADXH 1YTAA 2WFBA 3VQQA 4ILGB 4KH5A 1YTUA 4CZMA 3O9RA 4H5TA 1W0HA 1QQMA 4CZFA 2Q0RA 1JKHA 1KVBA 4BC5A 1NGCA 4CW7B 3CHWA 2HBKA 2HHSA 1X9JA 2O4GA 1S1TA 2NRXA 3O1WA 3CD6N 3NH0A 3TSUA 2O8CB 5TKYA 3TU5A 4CJFA 1RTIA 3PIPL 4H5NA 3RRHA 4CZJA 4NYFA 3J80O 2R7YA 4DFMA 2YNFA 3BY5A 4CI6A 3CQYA 2PFUA 5BRDA 3E9LA 5AQPA 2BUPA 4BR5A 4EAHD 4Y1CA 4O55A 1ZBHA 4LFAK 3QIPA 1JXBA 3QNNA 3ULEA 4DV0K 1V4SA 3UKRA 4FJ7A 4W5RA 4EZ9A 5AQTA 3WQTA 4Y0WA 4OPKA 3CQXA 4CHQA 3L2WA 5CZ2A 3CCMN 2NLXA 4XEIA 1G15A 4IG3A 5GIOA 4IG0A 1QZ5A 1NGFA 3RMDA 5GINA 4DV6K 1IG8A 4EHTA 3ZT2A 1SL1A 5KTQA 1JL1A 3KLEA 3BP8A 1KCFA 3U3GA 1YI2N 4I7FA 4YOTA 5JLFA 3DLRA 4M41A 1Z05A 3LP2A 3QEXA 3P38A 2FF6A 1GOBA 4O4GA 4Z0UA 4BR7A 3NDKA 4BG9A 1GLAG 3M8PA 3LWMA 4M3XA 5D3GA 1IV0A 3RRGA 4BRMA 3KZBA 3THVA 3SUOA 2OCEA 3O1BA 3OJUA 3LM2A 1N34K 4PKHA 4JKGB 3CMEN 3OVNA 3TTFA 2O8EB 4CGJA 1BA1A 3WXLA 4E7JA 1EXQA 5HRRA 4M45A 3P5JA 5KRTA 3CERA 3AY9A 1GOCA 4JK9A 3T19A 4FL9A 3M5RA 1VQNN 3WXKA 3GG4A 4ILJA 4YDUC 3SCXA 1KVAA 4KTWA 4ELUA 5IT9O 3W3DA 3OY9A 1C1AA 2UU9K 2ZF5O 4FPBA 4DV5K 4Q5VA 5B8HA 1IKXA 2YCHA 1QQCA 1YVUA 2KHOA 2ZGZA 4KB0A 2O8CA 2ZJQL 3ALYA 4OPHA 4C1NK 4CBWA 1VQ8N 1K8KB 1WSIA 1NGGA 1ZBFA 4B3SK 5AQXA 2H3GX 2E2QA 2O8FB 3QEIA 3H45C 3NAEA 4IDKA 1RT7A 5AZJB 4BC2A 2UXDK 3F5TA 4IXCA 1BG3A 4KH6A 5CZ1A 3EYZA 4MLHA 4JS5A 3PLAA 1VSFA 3R8EA 4CF1A 4PHTX 2AA4A 3HZ6A 4BG8A 4BWMA 5J2NA 4CEZA 3TSQA 5JVHL 4PY5A 3GBTA 1N6QA 1NJWA 3CJBA 3FGUA 3O3HA 3L2UA 5F0XA 2GUIA 2Q97A 4CJUA 3NF8A 1N36K 2OYQA 1I3AA 1OH6A 1WBDA 2YHXA 5J2MA 1HNIA 1RDDA 4OKJA 3SJHA 4KTQA 3WQUA 1W97L 3L6QA 4BVOA 1S6QA 2Q3SA 4HWIA 2Q1NA 1GLFO 1S22A 3T1AA 4H0YB 4B1WB 3LZJA 2CH5A 3DOKA 3WT0A 3CM6A 1Q18A 2O8BB 3LDPA 4GMJB 1NOZA 2VGMA 3MX2A 1S72N 4NLBA 3QDKA 2OANA 3KLIA 3SUNA 2GWJA 4KH4A 4O5BA 2ZD1A 5HROA 4WQ4A 4DFPA 3C6TA 5FDLA 4B3RK 1C1CA 2QWQA 1NNEA 1EWRA 2HMIA 4KHNA 4CEFA 2V52B 4JKGA 5J2QA 5KQDA 1ATRA 2O8EA 4EIAA 3HOTA 4JI0K 1IG9A 1LCUA 1YF5L 2GEMA 3NGIA 4CEOA 1M1KO 2Q2RA 3HOSA 4M42A 3P31A 1XC3A 1VRUA 5GAHP 4QS7A 3ZX0A 3BZCA 5E84A 1JLQA 3QETA 4J2DA 3VERA 4K41A 5BPMA 1U45A 3OYCA 1ZBUA 2E88A 5AQOA 1QSLA 4TSXA 4Z4EA 3VQBA 3V9XA 5C15A 5BR8K 1D4XA 3F2KA 3KLHA 4JKCA 2VG6A 3CJ1A 1XNRK 3GDQA 1OH5A 5GAEP 1C6VA 4C8OA 4N76A 2P9NB 2BE2A 1JL2A 3A0IX 4A2BA 2HVHA 1BU6O 1XHZA 4C8KA 3MX5A 1N8RO 1XI1A 1HJRA 1O1WA 4CJSA 3N4QA 2NUBA 3JAMO 4CJ4A 4BRKA 1QE1A 3CJ7A 3G4SN 5AQZA 3MDQA 5AZJA 2J4RA 1VQ7N 1RGIA 3R9PA 4J2AA 3CFPA 5BREA 5C25A 2P5OA 2Z1GA 4M63C 1SAZA 4HTLA 4FWOA 2ETJA 5F1XA 4FXDA 3S3MA 3E9OA 2ZGYA 4DWIA 2HNZA 3MXIA 4NCAA 5ADXA 3NBPA 1BDGA 2KZMA 4M3WA 2OPRA 4DV4K 3SNNA 1B9DA 4FK4A 1NGEA 4I9QA 4FJIA 3OBWA 2PZSA 1C0UA 2WC9A 2ASOA 4JKBA 1VRTA 2YX6A 4FJLA 4FWKA 1NGDA 3ZX3A 1SKSA 3VEZA 3OBYA 3ZSRA 3EE9A 1RT3A 3D6RA 1QS4A 3AVGA 4DFKA 3AVKA 1BI4B 3LDOA 2QWPA 2ZJRL 2A40A 1NKEA 1JCFA 1LAVA 3KK3A 4IZ9A 3RMCA 3TAPA 4KPYA 1JXEA 1VSMA 1ATSA 4X66K 2HBJA 3H3OB 3I33A 4C1NI 5BN8A 3IRXA 5K14A 1QVFM 3L8BA 2YHBA 3SQ0A 3DLGA 1NK9A 1KLMA 3MN7A 4G1QA 4CGGA 3M8RA 3C7NA 4LH4A 1BISA 3CPWM 4F3OA 3OYJA 4I6MA 1WUAA 1YIJN 4AH9A 2XHBA 1CZ9A 2BTFA 1UAXA 5C10A 1RCHA 4IBNA 3UB5A 3ZETB 2UXCK 3HL8A 4HCBA 3IFRA 3K5NA 4PL8A 3VQPA 2Y1JA 1B9FA 3CG7A 5AQFA 2YJEA 3OYGA 2VWJA 3A2FA 3C95A 1EWQA 3Q7CA 3MMVA 3TPQA 4OGCA 4CHPA 2VG7A 3DLKA 1ITGA 2QWLA 4QS9A 1WSHA 4BQZA 4PL7A 4DFJA 3HPGA 4CESA 1UWBA 3TI0A 3J8AA 3HVTA 4M3TA 1OKJA 3ZT3A 1EO1A 4Y1DA 3NVMA 3U8XA 3OYHA 3U9DA 2E1YA 3S3NA 3CETA 2VWBA 3DAWA 4H4MA 5GAGP 3KLFA 3I0SA 5A2QO 4ELTA 1NKBA 1ATNA 3VQEA 3SV3A 2E2NA 3FZKA 3MWPA 2HHUA 3C6UA 2D0PA 4KREA 2QEXN 3P1GA 4ELVA 4FK2A 1FXXA 4BRCA 1HUXA 4BVPA 3FFIA 3LALA 1E3MA 3U4LA 2NRRA 4JD2B 1VQ9N 4H0VB 3LWLA 3AVJA 1EQYA 2IVOA 4AHRA 2CH6A 4M7XA 1NBWA 1G99A 4CF0A 3ZEUB 3H08A 3T7ZA 1TK0A 4FLXA 3BZKA 3OS0A 4E7HA 2P9SB 1Q82O 1C0FA 3ID8A 4FWNA 4HUGA 1BI4A 4FWLA 1S5JA 1VQON 2FLOA 2Q31A 4YHHK 4KFBA 3WNEA 4YOYA 4FPAA 1SQKA 4EP5A 4IJNA 5HLFA 3M1FA 4HVJA 4DSLA 2HB5A 3ENHA 2E2PA 4BR4A 1Q86O 4GV9A 4JI8K 4IFEA 4ISFA 4NLCA 3TAEA 4IEEA 1ZC6A 1QSYA 3CIPA 2BDPA 1J9AA 3B8AX 3NHGA 4E7IA 1MA9B 1S1WA 3V9UA 1Z26A 4FJ5A 3T1YK 3HPOA 3CQ8A 2KKZA 1X9MA 4CIFA 3DXMB 4FLUA 5C2FA 4CJLA 1DEJA 1ASUA 4Q0BA 3LL3A 5HL7L 4DR7K 4FK0A 4CGFA 4A61A 3SPYA 1KVCA 3ZETA 4ISGA 3H46O 2Z1HA 3I8BA 3FZFA 4DKWA 1GLBG 4FYDA 3V1QA 1N33K 4CJPA 4MO4A 2ZWHA 5AFUA 1V4TA 1WSGA 3V1RA 4WFBL 2FSJA 2D0BA 1IKVA 4FVMA 4CZLA 3EZWA 1NKCA 2FBYA 2FBVA 3A5MC 4CZIA 4CJ7A 4JK7A 1RDWX 3EKUA 1UA0A 2PAVA 3I8DA 1LWEA 4IKFA 3VF2A 3DOLA 2GV9A 3MCPA 1HKGA 3TANA 4LC9B 3VENA 3M3ZA 4C23A 3S3OA 1U4BA 5KI6A 1TV6A 3M8QA 4ISEA 4CHYA 3H1VX 4JN4A 3DM2A 2FF3B 4LFBK 3CC7N 1NJIO 2NNWA 4K43A 4BC4A 2A1RA 5KPRA 1SL2A 4JD2A 2D0CA 4CK2A 4FJ9A 1TVRA 1KTQA 1BCOA 3ZLJA 5F2RA 1WAFA 3ZEUA 4B1ZA 4BRGA 4GY2B 1LV5A 1TL1A 3M8SA 2G8IA 1W2BM 4KRFA 3ISNC 2YV0X 1RTJA 4PKGA 3DRSA 3VOVA 4C8LA 4N56A 1GLEG 3L2RA 3AVFA 1EP4A 4FW2A 3CJCA 5E26A 1JLCA 2W42A 2IOCA 4DTNA 4BE1A 3VQ4A 2UUBK 4JI5K 4FJKA 4AF1A 4DG1A 3TTDA 4HTUA 3WUHA 1GLDG 1SUQA 3WEEA 4GKJK 4KHSA 1OVYA 1U2VA 4H4OA 1CLQA 1RDUA 4EZ6A 2QWMA 4RW9A 1IBMK 4LF4K 3TARA 4H5WA 4B8CA 1Y97A 3VA3A 1BWFO 2O4IA 1FK9A 1DTTA 1S1UA 3DXMA 1WB9A 4KHPK 3GE1A 1U04A 4CEQA 4DS5A 5EY4A 2IVPA 3M6GA
chains in the Genus database with same CATH topology
1W97L 3L6QA 4BVOA 3O8MA 5HOOA 1ESVA 1IJJA 1R59O 1ZXOA 4HWIA 2Q1NA 1DKGD 1GLFO 1S22A 5BR9A 2F9WA 3EO3A 3UKUA 1QQNA 4MLEA 4H0YB 3SMSA 4B1WB 3T69A 2P9LB 4BRAA 1MWMA 2CH5A 3WT0A 1Q18A 5CE3A 2A6AA 3LDPA 4H0PA 4JKHA 5ELZA 2VGMA 3MX2A 1S72N 5M1PA 2ASMA 4NLBA 3LM9A 3QDKA 1VQ5N 2OANA 2NRHA 3JS6A 3Q7BA 2GWJA 1C0GA 2QA4N 4KH4A 5LJVA 3N4PA 5AQYA 4WQ4A 4YOWA 4FOIA 3RSEB 4CZKA 4U7BA 4CD3A 2A42A 4IO8A 3JXUA 2FSKA 2QWQA 3ATUA 2GTDA 4JEPA 1K9MO 5LY3A 1NLVA 1BUPA 4JKAA 4QS8A 3BF3A 2NRWA 2V52B 4IOCL 1T44A 4JKGA 3G6EN 5KQDA 1ATRA 1NMDA 3AAPA 5FPEA 4EIAA 3ATVA 3HOTA 1QHAA 1YITN 3UE5A 3SBTA 1LCUA 3DXKB 2W41A 4WYBA 1YF5L 2GEMA 3VEOA 4DB3A 5KPTA 2IIRA 2D0OA 1M1KO 2Q2RA 3SBGA 3HOSA 4H5RA 4BR9A 3P31A 5BRHA 3BF1A 1XC3A 5GAHP 4DHYA 4QS7A 2QWNA 3ZX0A 5BRFA 1MDUB 4OPAA 3CPEA 5E84A 4F9OA 5GADP 1Z6RA 1Y64A 2P9KA 5AZIA 3VERA 4K41A 5BPMA 4AM6A 3IKMA 3ID6A 4XH5A 2E88A 5AQOA 3U9ZA 3I55N 3A8YA 2D1KA 1QVGM 1KAXA 4CZGA 1K8AO 4RTFD 3ZX2A 4FWQA 3CCJN 3LDLA 4H0OA 3MN5A 5C15A 4BRIA 3CCUN 1KC8O 3HTVA 2GWKA 2HBLA 1D4XA 3F2KA 5MLCQ 2RE2A 3TTCA 1GLJO 4JKCA 3HBTA 3CJ1A 3GDQA 4NO7A 3L0QA 4BY9C 2CGJA 3E1YA 5GAEP 1ZBSA 4BRQA 2P9NB 4A2BA 3A0IX 3AGRA 3L4IA 1BU6O 4G9ZA 3QBWA 1M90O 5AQUA 4CBXA 3CCLN 1GLLO 1HKBA 3MX5A 5AQVA 1N8RO 3VTIA 3N4QA 3VEXA 2I7NA 3O4WA 3CCRN 3RVCA 3SLCA 4WFAL 1T6DA 5KPZA 4FWRA 4WQ4C 1J6ZA 4BRKA 3C6AA 3ENOA 3G71N 3H6EA 3CJ7A 3MWTA 4UY8O 4BRHA 5AQZA 3MDQA 3G4SN 3CCVN 5AZJA 1Q81O 2J4RA 2V7ZA 4YOVA 1RGIA 5AQIA 3R9PA 4JHDB 4FSVA 4B1VA 1VQ7N 1VQNN 1XUPO 2P9SA 4M7YA 4XH4A 3DWLA 5BREA 4BR0A 5TKWA 2I7PA 4K42A 1YVNA 3S41A 4M63C 1SAZA 2VGNA 3LDNA 4FWOA 4HTLA 4H5VA 1JCGA 5F1XA 3E9OA 2ZGYA 3D2EA 1YHQN 1VQLN 4OO1J 4XH1A 3MN9A 4GV3A 2V7YA 5ADXA 2P9PB 3CJAA 2NRVA 1BDGA 2HSTA 1P90A 3O6WA 3SAGA 5JMVA 4H03B 1DT9A 1X3NA 2PBDA 1NGEA 3I56N 4IO9L 3HSCA 3AAQA 5AQSA 3O9TA 4JKDA 4IOAL 3LDQA 3O9UA 2QWOA 3GOIA 3OBWA 4A5BA 5DM6L 3HM8A 2WC9A 2ASOA 3FR0A 3IUCA 2YX6A 2P9LA 2FSNA 4JKBA 4FWKA 4O8KA 1NGDA 3WXMB 3ZX3A 4RWTA 4JAXA 1LOTB 2YJFA 3VEZA 3OBYA 2DPNA 1WOQA 4BGBA 3EE9A 2QM1A 5BPLA 3D6RA 2F7TA 3C65A 1E4FT 2HOEA 4H0TB 3CXCM 3LDOA 2QWPA 2OTJN 3C6HA 3WEEB 2ZJRL 2A40A 2P9IB 3EN9A 2NZTA 3EE8A 3H3NO 1U2VB 1ILYA 1JCFA 3RSEA 2E2OA 4B1YB 4BRFA 5M1FA 1HLUA 3ULEB 4IZ9A 1VQPN 3UKRB 4IEIA 1BA0A 1Q7YO 1ATSA 1SZ2A 2HBJA 3H3OB 3I33A 4C1NI 4O8UA 2A5XA 4K25A 4BC3A 5BN8A 3VTHA 1QVFM 3DXKA 2IVNA 1NGBA 1HJOA 4CD1A 5C12A 1TUUA 3O9SA 3KVGA 3J7ZO 3DLLL 3FZMA 3TSPA 3CCQN 3MN7A 3VETA 4YOXA 3E66A 5FPNA 1BO5O 4IWVA 2QWRA 4GVEA 3UKUB 4MO5A 3C7NA 3CPWM 4B1XB 1KXPA 3D2FA 4I6MA 2KLAA 3HRGA 3P39A 1WUAA 1YIJN 5M1QA 2BTFA 2HF4A 5C10A 4AM7A 3UB5A 2P9UB 3FZHA 2NRTA 4A59A 3ZETB 1H1VA 4IJAA 5AQGA 3IFRA 5AQQA 1VQ6N 1MWKA 2QI2A 3K9KA 4PL8A 5JVGL 2YHWA 1NGIA 4BRDA 3A5OC 2YJEA 5AQFA 4DCHA 2V51B 5JLHA 3CCEN 2GX9A 3P4IA 4WFNL 4BRNA 2A3ZA 1TYQA 2WBNA 3O9QA 2NRZA 4RCHA 4MDBA 1O13A 4BR2A 4CBUA 1NGAA 3SK3A 4E1JA 3Q7CA 3MMVA 5AQLA 1K8KA 3TPQA 3PIOL 1X3MA 3MK6A 4FVUA 3AARA 4WQ5A 4IDHA 5BN9A 5FPDA 4CZEA 3OW2M 2QWLA 4QS9A 1VQMN 5M1KA 4BQZA 2W40A 4PL7A 1HX1A 2E1ZA 5AZIB 1QZ6A 3J8AA 5JICA 1OKJA 3O08A 4H0XB 3VEVA 1EO1A 3QFPA 3KWGA 1E4GT 4J8FA 3NMUA 3HI0A 3VESA 1JCEA 3NVMA 1HPMA 3U8XA 5ADXH 3K9JA 2E1YA 2WFBA 3U9DA 3ZYYX 3CETA 4ILGB 4KH5A 5M1NA 4CZMA 5CHIA 2VWBA 3O9RA 4H5TA 4GV6A 3DAWA 5GAGP 1QQMA 4CZFA 2Q0RA 1ATNA 4BC5A 1NGCA 2E2NA 3FZKA 3MWPA 2P9PA 3CHWA 2HBKA 2D0PA 1X9JA 5EX5A 5EOYA 4PKIA 2BH1A 3CF5L 2QEXN 3VMFB 2Q0UA 4IOXA 4BRCA 5AQHA 1HUXA 2NRXA 4BVPA 3O1WA 3D7EO 4BQLA 3CD6N 3TSUA 3U4LA 2VCPA 5TKYA 3TU5A 3MCAB 2NRRA 4JD2B 1VQ9N 2GELA 2HBMA 4H0VB 3VGLA 1K73O 1EQYA 2IVOA 3CJ9A 2CH6A 2YI1A 4M7XA 1NBWA 1G99A 5AQNA 3ZEUB 3QBXA 3PIPL 3MN6A 4BROA 4H5NA 3T7ZA 4CZJA 3EL2A 4ILHA 4CI6A 2VYPA 2PFUA 2JWKA 3CQYA 5BPNA 5BRDA 3EKSA 2P9SB 1Q82O 1C0FA 2ASPA 3ID8A 4FWPA 4FWNA 3E9LA 4O5FA 5AQJA 4FWLA 2BUPA 5AQPA 4BR5A 1VQON 2FLOA 2Q31A 3BEXA 1KD1O 4EAHD 4YOYA 2P9IA 3CC4N 4FPAA 4WQ5C 1VQ4N 1SQKA 1NWKA 4IJNA 1SS6A 3M1FA 3CCSN 3ULEA 1NM1A 2HMPA 4FO0A 3D2EB 3ENHA 1V4SA 2E2PA 3KWIA 3UKRA 4BR4A 1Q86O 4GV9A 2RHKA 4IFEA 4FOEA 4ISFA 3FFKB 4NLCA 5AQTA 4IEEA 1ZC6A 5AQKA 4Y0WA 3WQTA 4EFHA 3CIPA 3CQXA 1DGKN 3B8AX 1S3XA 3IMXA 2NLXA 1MA9B 3CCMN 3SAFA 4XEIA 4YDUA 4JK8A 3VGMA 3VEWA 4A2AA 2KKZA 1VAZA 5GIOA 5EVZA 1HKCA 1XQSC 5AQMA 3DXMB 5C2FA 1QZ5A 1YXQA 4A5AA 5KQ8A 3AGKA 1NGFA 4GNIA 3CMAN 1DEJA 5AFUH 4YOUA 5GINA 1IG8A 1P8ZA 3BUZB 4EHTA 3LL3A 5HL7L 1RFQA 4YORA 1TUYA 3QFUA 2P9UA 5FPMA 4A61A 2OTLN 2QW9A 3ZETA 4ISGA 5C0YA 1GLCG 3BP8A 3H46O 1YI2N 3I8BA 3FZFA 4YOTA 5JLFA 3KHYA 5EXWA 1YUWA 1Z05A 3VGKA 2GUPA 4JKEA 3P38A 4DKWA 4B9QA 1JJ2M 3DJCA 1CZAN 2FF6A 3OA9A 3G25A 1GLBG 2HF3A 4BR7A 3CC2N 1VQKN 1T6CA 3A5NC 4BGAA 4MO4A 2ZWHA 3H1QA 1V4TA 3WXIA 1GLAG 4BG9A 5AFUA 4R79A 3R6MA 4WFBL 4KBOA 2FSJA 4CZLA 4BRMA 2E20A 3NVKA 3KZBA 3EZWA 1YJNN 2P9NA 3W0LA 3O1BA 4U67L 3LM2A 3A5MC 4PKHA 4CZIA 4CJ7A 4JK7A 4JKGB 3CMEN 1KAZA 1RDWX 3R1XA 3ENBA 5AQWA 3SMPA 3O5BA 3TTFA 1YAGA 1BA1A 3EKUA 4JNEA 5M1OA 3WXLA 4BREA 2PAVA 3VF4A 3C7NB 3CERA 1BOTO 3AY9A 4JK9A 2Q36A 3D2FB 4I6MB 2QTDA 3IDHA 3SAHA 4FL9A 3VF2A 3WXJA 3M5RA 4FWMA 3MCPA 2EWSA 3WXKA 1HKGA 3A5LC 3GG4A 2UYTA 4FWSA 4ILJA 4JHDA 4LC9B 4YDUC 2P9KB 3VENA 1YJ9N 3GL1A 3W3DA 3M3ZA 4C23A 4A57A 1KAYA 3OHRA 1QQOA 1NGHA 5DM7L 4ISEA 1KQSM 2ZF5O 3H1VX 4FPBA 4JKFA 5AQRA 4A62A 5B8HA 4JN4A 4B1UB 5GIPA 2FF3B 5H1SQ 2F9TA 2ITMA 2YCHA 1T3VA 1NJIO 3CC7N 1TYQB 2NNWA 4K43A 2KHOA 2ZGZA 4L3QA 4BC4A 5KPRA 3QB0A 2ZJQL 4Z94A 4JD2A 4OPHA 4C1NK 2WUSA 4CBWA 5I9EB 4MDAA 4WCEL 1VQ8N 1K8KB 2ZJPL 5C2DA 5F2RA 2AP1A 3ZEUA 4B1ZA 4BRGA 4GY2B 1NGGA 2YHYA 2A41A 1W2BM 4WF9L 3QICA 5AQXA 2H3GX 2E2QA 4PKGA 2E8AA 1U6ZA 5AR0A 3FZLA 3L4QA 3H45C 2FXUA 3VOVA 2QXLA 3C0BA 1GLEG 2JWLA 3FE1A 3O80A 3CI5A 4BRPA 3VEYA 5AZJB 3CJCA 5E26A 4BC2A 4DQ8A 3F5TA 4IXCA 3QMLA 1BG3A 4KH6A 4MLHA 3E9PA 3PLAA 3R3LA 3R8EA 4BRLA 4AF1A 4NB4A 3TTDA 4PHTX 5CR4A 3WUHA 2AA4A 3HZ6A 1GLDG 3WEEA 4BG8A 1OVYA 1U2VA 1RDUA 2D4WA 3TSQA 5JVHL 2QWMA 4H5WA 3GBTA 3CJBA 3VPZA 3FGUA 4CZHA 1NGJA 4EHUA 1BWFO 5F0XA 2Q97A 5LJWA 3FLCO 2CGKA 3DXMA 3F9MA 2YHXA 3GE1A 3SJHA 3KK7A 3VF6A 5EY4A 2IVPA 3M6GA 1YJWN 2CGLA 3WQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFE A;  3CPE A;  5C2D A;  5M1Q A;  5C10 A;  4IEI A;  4IDH A;  5C15 A;  4IEE A;  5M1N A;  5C2F A;  5M1P A;  3C6H A;  5C12 A;  5M1F A;  5M1O A;  3C6A A;  5M1K A; 
#chains in the Genus database with same CATH topology
 1HRH A;  1LWF A;  1R59 O;  4CJW A;  2G8H A;  3LP1 A;  4CJE A;  1DKG D;  3K5M A;  3UKU A;  1QQN A;  4MLE A;  3S9H A;  4HUE A;  3IAY A;  1MWM A;  3EY1 A;  5DMR A;  5CE3 A;  4NCB A;  4KHQ A;  2XY5 A;  1J5O A;  2QKB A;  3NCI A;  5ELZ A;  2ASM A;  3NF9 A;  3LM9 A;  2NRH A;  1RDB A;  2QA4 N;  3Q7B A;  1XNQ K;  5LJV A;  3RSE B;  2ZM6 K;  4U7B A;  2A42 A;  3JXU A;  4JEP A;  5LY3 A;  1NLV A;  3BF3 A;  3G6E N;  1NMD A;  2XO7 A;  2YNI A;  3ATV A;  1QHA A;  3DXK B;  1T05 A;  3OS1 A;  2IS3 A;  3VEO A;  4DLE A;  2IIR A;  3E01 A;  3SBG A;  1SV5 A;  4H5R A;  3CCU N;  5BRH A;  2QWN A;  1WAJ A;  4FJM A;  5GAD P;  3PV8 A;  4E1N A;  3K59 A;  1X9S A;  5CYM A;  4CZG A;  3ZX2 A;  4GW6 A;  3AO4 A;  1KC8 O;  3HTV A;  2D5R A;  2HBL A;  3AV9 A;  5MLC Q;  3LP0 A;  3HBT A;  2G8U A;  4BY9 C;  1ZBS A;  3ZSO A;  3QIN A;  5IWA K;  4G9Z A;  4CBX A;  3CCL N;  5AQV A;  1C1B A;  1JLE A;  5LMN K;  2O8D B;  4DQP A;  4FWR A;  4WQ4 C;  3TWH A;  4I9L A;  1NMN A;  3ENO A;  3G71 N;  3MWT A;  4CER A;  4FCY A;  1S1V A;  3QLH A;  2V7Z A;  4E19 A;  3ZT1 A;  4JHD B;  4FSV A;  4B1V A;  3KTQ A;  1RT5 A;  4BR0 A;  4DR4 K;  2I7P A;  1NK0 A;  1YVN A;  3S41 A;  3LDN A;  1BQM A;  3MEG A;  1SKW A;  4BE2 A;  1YHQ N;  1NK4 A;  1Q9Y A;  4OO1 J;  4CGI A;  2G8F A;  5CY4 A;  2V7Y A;  3OYF A;  3K2P A;  2JLE A;  2P5G A;  3O6W A;  3OJS A;  1X3N A;  1W9H A;  3T1H K;  4DV2 K;  4IO9 L;  3RMB A;  3QEW A;  3J7A P;  3LDQ A;  2F8T A;  2QWO A;  4A5B A;  3EZ5 A;  3B6P A;  1HYV A;  3WXM B;  4O8K A;  3DRR A;  3ZCM A;  2DPN A;  1WOQ A;  2X6N A;  4LD0 A;  2QM1 A;  2F7T A;  4B9U A;  4CGD A;  2W6L A;  2YKM A;  3EE8 A;  1OH7 A;  1JLF A;  3J81 O;  4JI4 K;  1J54 A;  4W5Q A;  3RSE A;  1NG9 A;  1IBK K;  1HLU A;  1LW2 A;  1L3S A;  3MXJ A;  4IEI A;  3O4Q A;  4YY3 K;  2A5X A;  3DXK A;  3O9S A;  3FZM A;  3TSP A;  3CCQ N;  1S9G A;  2UUA K;  4B3T K;  2E4L A;  3E66 A;  3LPT A;  4DR6 K;  2FC0 A;  4B9T A;  3SV4 A;  1BO5 O;  4IWV A;  1FW6 A;  1RBT A;  4MO5 A;  4B1X B;  3QEP A;  3DYA A;  4FLW A;  2KLA A;  1N5Y A;  2YNG A;  2HHT A;  3PY8 A;  4FZY A;  4NYN A;  3KK2 A;  1I39 A;  2KZZ A;  5AJ3 K;  3FZH A;  3VQC A;  1U47 A;  4BE0 A;  5AQG A;  1VQ6 N;  3U6F A;  1MWK A;  2QI2 A;  4I2Q A;  4CJT A;  3ZT4 A;  2YHW A;  4BAC A;  1VHX A;  4BRD A;  2GX9 A;  4HUF A;  3D0P A;  4CHN A;  2NRZ A;  4RCH A;  4CBU A;  5FRN A;  1NGA A;  3SK3 A;  4E1J A;  4Z4F A;  1K8K A;  3PIO L;  1X3M A;  2RF2 A;  4F3T A;  3DRP A;  1QSS A;  4WQ5 A;  4CCH A;  5BN9 A;  3OW2 M;  4CK3 A;  2BAN A;  4DF8 A;  2VQE K;  3TAF A;  4FJX A;  4IFY A;  2O8F A;  2E1Z A;  5AZI B;  2HND A;  1BIU A;  1RIL A;  5JIC A;  3O08 A;  4LF6 K;  1D9D A;  4J8F A;  3NMU A;  1JCE A;  3K9J A;  4M3Z A;  3ZYY X;  4OLA A;  4E7L A;  5JS1 A;  3QES A;  1T7P A;  3F9K A;  5T7B A;  1TGO A;  5EOY A;  1GOA A;  2BH1 A;  1IBL K;  3VMF B;  2Q0U A;  4CK1 A;  3D7E O;  2VCP A;  3MCA B;  3KD1 E;  3RTV A;  4CEB A;  3DLB A;  2GEL A;  2HBM A;  3ITH A;  1RBU A;  3OYE A;  1NK6 A;  3IG1 A;  3CJ9 A;  2YI1 A;  1IO2 A;  5AQN A;  3V1O A;  3QBX A;  3MN6 A;  1XMO K;  1L3V A;  4ILH A;  2PY5 A;  2JWK A;  3DLE A;  2OZM A;  3KIO A;  1KD1 O;  3BEX A;  2QK9 A;  1S1X A;  1JLB A;  1VQ4 N;  2O8B A;  1NWK A;  3VQ9 A;  2JGU A;  1SS6 A;  1VSL A;  3HP6 A;  3CCS N;  4DQR A;  2HMP A;  4DR3 K;  4FO0 A;  3D2E B;  1KLN A;  3ZSX A;  3KWI A;  4FOE A;  3FFK B;  5J1E A;  4AHT A;  3HVR A;  1DGK N;  1XC9 A;  1YT3 A;  2RKI A;  3PUF A;  4JK8 A;  4YNQ A;  4A2A A;  3DMJ A;  4RW8 A;  1UA1 A;  5AQM A;  1YXQ A;  5KQ8 A;  3AGK A;  3CMA N;  3NGZ A;  4FM1 A;  5HRS A;  3HXM A;  4DLG A;  1RFQ A;  4OGE A;  4DU3 A;  4BWJ A;  4F4K A;  1RT2 A;  1GLC G;  3KHY A;  5EXW A;  4KV8 A;  2GUP A;  3K5O A;  3LZI A;  1JJ2 M;  3DJC A;  1CZA N;  4KHW A;  2BGG A;  2HF3 A;  3CC2 N;  1VQK N;  1T6C A;  3A5N C;  4BGA A;  3H1Q A;  1BHL A;  3WXI A;  3SZ2 A;  4DSJ A;  1FKO A;  1L3U A;  4R79 A;  3R6M A;  1ASV A;  4KBO A;  3NVK A;  4DR2 K;  5SZT A;  4DTP A;  1YJN N;  2P9N A;  3W0L A;  1I94 K;  1VSJ A;  1BL3 A;  3OYN A;  4KAZ A;  4LSL A;  3R1X A;  3ENB A;  5AQW A;  3SMP A;  2YHA A;  3KD5 E;  1YAG A;  5M1O A;  4BRE A;  4CJQ A;  4LF8 K;  3CFO A;  4FJN A;  3VF4 A;  4CEC A;  4FLV A;  1BOT O;  1NOY A;  4LY7 A;  2Q36 A;  3D2F B;  1EX4 A;  4KTZ A;  3IDH A;  4CE9 A;  3HYF A;  3WXJ A;  3CFR A;  4FWM A;  2EWS A;  4WCE L;  3A5L C;  2UYT A;  4FWS A;  4FLT A;  1IKW A;  3GL1 A;  3OYL A;  4V19 S;  4B9L A;  1RNH A;  4A57 A;  4CVN E;  1Q9X A;  1QQO A;  1NGH A;  1KQS M;  1B92 A;  4JKF A;  4B1U B;  3THY B;  1NJX A;  2OZS A;  1NJZ A;  3LAM A;  2F9T A;  1T3V A;  3BDP A;  3P83 D;  1TYQ B;  1BQN A;  4L3Q A;  3KK1 A;  4Z94 A;  3LP3 A;  5I9E B;  4MDA A;  3TAG A;  1JLG A;  5I42 A;  3AO5 A;  5KRS A;  4OKK A;  4WF9 L;  3HM9 A;  3AA3 A;  3K0S A;  2E8A A;  3VQ6 A;  1U6Z A;  4DTX A;  3L4Q A;  4CJK A;  5KGX A;  2FXU A;  2JWL A;  4BRP A;  3CI5 A;  3VEY A;  4BDZ A;  3QML A;  3QNO A;  3NF6 A;  4JYA K;  3R3L A;  4BRL A;  2PYJ A;  4FLY A;  4NB4 A;  3V6D A;  3V9W A;  2D4W A;  2HNY A;  1QTM A;  1EKE A;  1RT6 A;  4YFU A;  1HNV A;  5LJW A;  5I3U A;  4R5P A;  2CGK A;  3TAB A;  3NF7 A;  4AHS A;  1KRP A;  4B9S A;  4N5S A;  3KK7 A;  1TK5 A;  2CGL A;  5HOO A;  2IC3 A;  1IJJ A;  4HCC A;  2F9W A;  3EO3 A;  4FW1 A;  1BGX T;  1WSE A;  1FJG K;  4QCL A;  2P9L B;  4BRA A;  4DTU A;  5HRN A;  1S6P A;  1X1P A;  4H0P A;  1LAW A;  1Z25 A;  4JKH A;  1LWC A;  2DY4 A;  1TKZ A;  1C0G A;  1VSE A;  2KW4 A;  1OH8 A;  4YOW A;  4FOI A;  4IFV A;  4CZK A;  3SUP A;  4BDP A;  4CD3 A;  4IO8 A;  1HMV A;  2FSK A;  3ATU A;  2KFZ A;  3SUQ A;  3ASM A;  4J2B A;  1BUP A;  4QS8 A;  2NRW A;  4IOC L;  3THX B;  3SQ1 A;  1T44 A;  3AAP A;  5FPE A;  3SBT A;  2Y1I A;  5DK5 A;  2GBZ A;  2IDO A;  4DB3 A;  5KPT A;  4E1M A;  3SQ4 A;  3OYD A;  3VQ7 A;  1NJY A;  4X65 K;  2B5J A;  4DHY A;  4DQQ A;  3DLH A;  4OPA A;  2EX3 A;  4ZHR A;  4F9O A;  4DR1 K;  4BDY A;  1ASW A;  1Z6R A;  3AVL A;  4LF9 K;  3HJF A;  4AIL C;  3IKM A;  3U9Z A;  3I55 N;  1ZBI A;  3A8Y A;  3VQ5 A;  3L3U A;  1KAX A;  1K8A O;  4RTF D;  1VSK A;  3VQD A;  3ZSY A;  3LDL A;  3CCJ N;  3THY A;  3MN5 A;  1QHT A;  2GWK A;  4ID1 A;  2RE2 A;  3WNF A;  3J7Y P;  1GLJ O;  3KJV A;  1HNX K;  1RBS A;  2CGJ A;  3E1Y A;  4E3S A;  4FJ8 A;  4PQU A;  1A5X A;  1ZYQ A;  2B4J A;  3AGR A;  3L4I A;  4XIU A;  3QBW A;  1M90 O;  5AQU A;  1MU2 A;  1GLL O;  1HKB A;  3NH2 A;  1TAQ A;  4DTR A;  3VTI A;  4CJV A;  4JI2 K;  3PX6 A;  5KGW A;  2I7N A;  3VEX A;  3CCR N;  4CED A;  3RVC A;  1RBR A;  2WON A;  2P51 A;  5KPZ A;  3H6E A;  4UY8 O;  3CCV N;  3HST B;  5AQI A;  1XUP O;  2P9S A;  4M3U A;  2PYL A;  3DWL A;  5TKW A;  2OPP A;  3MED A;  3ZT0 A;  2VGN A;  5E41 A;  1VQL N;  1WLJ A;  3ULD A;  2HHW A;  4XH1 A;  4B9M A;  2P9P B;  2NRV A;  3ZSZ A;  3THW B;  1P90 A;  1JLA A;  5JMV A;  4M3R A;  4CHZ A;  1L3T A;  3AAQ A;  2HHV A;  3O9T A;  1R0A A;  3O4N A;  4JKD A;  3QIO A;  4OKE A;  3O9U A;  1TK8 A;  2G8V A;  5DM6 L;  3PSF A;  2P9L A;  4RWT A;  3MXM A;  4B8A B;  5C42 A;  2YJF A;  4N47 A;  3HK2 A;  4BGB A;  2G8W A;  3KKS A;  2OTJ N;  4DTO A;  3C6H A;  4ZTF A;  2XY8 A;  1XHX A;  2P9I B;  4Z4G A;  2E2O A;  4B1Y B;  4AHU A;  2ATQ A;  3BGR A;  1VQP N;  2F8S A;  3THX A;  1J53 A;  4NXM K;  4O8U A;  2KFN A;  4K25 A;  4DTJ A;  5C12 A;  3DLL L;  3J7Z O;  4F2S A;  1HR0 K;  1WNS A;  3VET A;  4YOX A;  4W5N A;  1J5E K;  4DTM A;  4FJG A;  5FRM A;  2QWR A;  4GVE A;  1KXP A;  1RBV A;  3P39 A;  3MAQ A;  1K6Y A;  2XRI A;  5M1Q A;  3QER A;  3VA0 A;  2HF4 A;  4AM7 A;  4AHV A;  2P9U B;  4LH5 A;  2NRT A;  4A59 A;  1HNZ K;  3L2Q A;  1WSJ A;  4CF9 A;  1U48 A;  4KO0 A;  2ITG A;  1TL3 A;  1NGI A;  5JLH A;  1WSF A;  3CCE N;  2DFH A;  3P4I A;  4FJH A;  2A3Z A;  4W5O A;  4MDB A;  1O13 A;  4DR5 K;  3AVB A;  4NCG A;  2X6S A;  1RT4 A;  3MK6 A;  4FVU A;  4CF2 A;  3AAR A;  5FPD A;  4CZE A;  3ZSQ A;  1VQM N;  2VWK A;  2W40 A;  4LFC K;  4CFC A;  1ZBL A;  4FLZ A;  3V9S A;  1QZ6 A;  4KI6 A;  3VEV A;  3QFP A;  5HP1 A;  1BCM A;  3KWG A;  1E4G T;  4JS4 A;  4JI6 K;  3HI0 A;  3VES A;  3HPH A;  1CZB A;  5CHI A;  4GV6 A;  5M1N A;  3OYM A;  3F73 A;  4AQY K;  4LF7 K;  2P9P A;  4ZTJ A;  3THW A;  3OYB A;  5EX5 A;  3CF5 L;  4PKI A;  4O44 A;  4IOX A;  5AQH A;  3NH1 A;  4BQL A;  5HRP A;  2F4V K;  1W7A A;  2IGI A;  3AA5 X;  3K58 A;  3VGL A;  3OS2 A;  1K73 O;  5C24 A;  3TR8 A;  4DV1 K;  4BRO A;  1HYZ A;  4LSN A;  3EL2 A;  2XY6 A;  2VYP A;  5BPN A;  3OTO K;  3I0R A;  3EKS A;  4DSI A;  2ASP A;  4FWP A;  4MFB A;  1KFS A;  4O5F A;  5AQJ A;  4F8R A;  4K8Z A;  3O3G A;  4K8X A;  1T03 A;  3L2V A;  2KTQ A;  2P9I A;  3CC4 N;  4WQ5 C;  3MEE A;  2AJQ A;  3AVH A;  4JRQ A;  4E0D A;  1NM1 A;  1NU0 A;  4JV5 K;  4L8R B;  2RHK A;  2F96 A;  4ID5 A;  3ZSW A;  4JI3 K;  2D0A A;  4EFH A;  5AQK A;  1D9F A;  4DV7 K;  1DTQ A;  1S3X A;  3IMX A;  1U49 A;  1HNW K;  3SAF A;  4YDU A;  4DU1 A;  4DU4 A;  3VGM A;  3VEW A;  3AO1 A;  1VAZ A;  3OYK A;  5EVZ A;  2YKN A;  1HKC A;  1XQS C;  3RMA A;  4MQ3 A;  4CFD A;  4A5A A;  3SYZ A;  2ZQB A;  4GNI A;  4JLH A;  5AFU H;  4YOU A;  1P8Z A;  3BUZ B;  3D45 A;  4AHC A;  3SI6 A;  4YOR A;  1TUY A;  3QFU A;  2P9U A;  5FPM A;  2OTL N;  2QW9 A;  5C0Y A;  1VK0 A;  1YUW A;  1EET A;  3VGK A;  4JKE A;  4I2P A;  4B9Q A;  4WE1 A;  2XY7 A;  3LPU A;  3OA9 A;  3G25 A;  3QO9 A;  4C8M A;  4B9V A;  2E20 A;  1TKT A;  3VN5 A;  4U67 L;  3PO5 A;  2RPI A;  1KAZ A;  2HHH K;  3O5B A;  4JNE A;  2O8D A;  3C7N B;  5HBM A;  4I6M B;  2QTD A;  3JSM A;  3SAH A;  1RTD A;  4FZZ A;  2FBX A;  4JHD A;  2P9K B;  1YJ9 N;  2X74 A;  2WTU A;  4H8K A;  3TAQ A;  1KAY A;  1RDC A;  3OHR A;  5DM7 L;  3AA2 A;  1TAU A;  5AQR A;  4A62 A;  1BIZ A;  5GIP A;  5H1S Q;  2ITM A;  2Z1I A;  1VSH A;  4CF8 A;  3AO2 A;  3QB0 A;  1WN7 A;  4DSK A;  2WUS A;  2ZJP L;  5C2D A;  4N41 A;  2UXB K;  1C0M A;  2AP1 A;  3RWU A;  4K0K K;  4X62 K;  4E7K A;  2YHY A;  2A41 A;  1XMQ K;  3QIC A;  3B6O A;  4FJJ A;  4ICL A;  2DFE A;  3WNH A;  4QOZ B;  1F21 A;  4QAG A;  1TKD A;  5AR0 A;  3LAK A;  3FZL A;  2QXL A;  3C0B A;  4FM2 A;  3FE1 A;  3O80 A;  4KKO A;  4Z4H A;  1Q8I A;  4DQ8 A;  4DSE A;  3E9P A;  3JYT A;  2FBT A;  4DQS A;  5CR4 A;  3NGY A;  3AVI A;  5J2P A;  4HHT A;  2OA8 A;  4B9N A;  4LF5 K;  3VPZ A;  4CZH A;  1NGJ A;  4EHU A;  4KB1 A;  2I5J A;  3FLC O;  4CFA A;  2X78 A;  3F9M A;  3VF6 A;  3V9Z A;  2Z1J A;  1RTH A;  3N4P A;  1YJW N;  2VQF K;  3O8M A;  1ESV A;  1ZXO A;  5BR9 A;  3O3F A;  1SL0 A;  4OJR A;  3SMS A;  4DTS A;  3T69 A;  4DS4 A;  2A6A A;  4OPJ A;  3LAN A;  4RW7 A;  2QXF A;  3SJJ A;  5M1P A;  4OX9 K;  4OLB A;  1VQ5 N;  1IKY A;  3JS6 A;  2OPQ A;  3AVN A;  1NK7 A;  5AQY A;  4C8N A;  4DF4 A;  1WBB A;  1RDA A;  5FLX O;  1CXQ A;  3AVM A;  2GTD A;  3ZSV A;  1SKR A;  1K9M O;  3L3V A;  4JKA A;  1C0T A;  1KSP A;  3IS9 A;  4O0I A;  1VSI A;  3SPZ A;  2HVI A;  1YIT N;  3EEQ A;  3UE5 A;  1D8Y A;  3DI6 A;  3HP9 A;  2QKK A;  2W41 A;  4WYB A;  4DV3 K;  2D0O A;  2DFF A;  1HQE A;  4CJR A;  4BR9 A;  3BF1 A;  5BRF A;  1MDU B;  3CPE A;  1Y64 A;  2P9K A;  5AZI A;  1LW0 A;  4AM6 A;  3AO3 A;  4GKK K;  4XH5 A;  3ID6 A;  4CEA A;  3HT3 A;  2D1K A;  1QVG M;  2HW3 A;  4FWQ A;  4H0O A;  4BRI A;  1KFD A;  2VG5 A;  3TTC A;  3HO1 A;  4CJ5 A;  4OVL A;  4NO7 A;  3L0Q A;  2RN2 A;  4RW6 A;  2LSN A;  4BRQ A;  2G8K A;  4DUZ K;  2E6M A;  3KKR A;  1RT1 A;  3AVC A;  3O4W A;  1X9W A;  3SLC A;  4WFA L;  1T6D A;  3QEV A;  1HYS A;  1J6Z A;  1CXU A;  3V4I A;  3C6A A;  3VQA A;  3T3F A;  4CJ3 A;  3V81 A;  4BRH A;  1Q81 O;  1HQU A;  1VSD A;  4YOV A;  1A5V A;  3OYA A;  4M7Y A;  4XH4 A;  3TAM A;  3U3Y A;  4K42 A;  4JRP A;  4GVM A;  2UUC K;  1A5W A;  4FZX C;  4DMN A;  4H5V A;  4X64 K;  3G0Z A;  1JCG A;  1N32 K;  4CGH A;  4Z4C A;  3C94 A;  2E5L K;  3PSI A;  3D2E A;  4B3M K;  1IH7 A;  2W6K A;  3MN9 A;  4GV3 A;  5LMU K;  4DSF A;  3PX4 A;  3CJA A;  3G10 A;  1XWL A;  2HST A;  3PO4 A;  4W5T A;  3K5L A;  3SAG A;  4PUO A;  4H03 B;  1DT9 A;  2PBD A;  3I56 N;  3HSC A;  4CEE A;  5AQS A;  1T8E A;  4IOA L;  5SWM A;  4DUY K;  3GOI A;  3SQ2 A;  4JI7 K;  3HM8 A;  3FR0 A;  3IUC A;  4E89 A;  2FSN A;  3MEC A;  4CFB A;  3RR7 A;  4JAX A;  1LOT B;  3NE6 A;  4EP4 A;  1D5A A;  5BPL A;  3C65 A;  1E4F T;  1DLO A;  2HOE A;  4H0T B;  3RR8 A;  3CXC M;  2HHQ A;  4PA1 A;  5CYQ A;  3WEE B;  3EN9 A;  1HPZ A;  2NZT A;  3H3N O;  1U2V B;  4UQG A;  1ILY A;  1S9E A;  3PX0 A;  4BRF A;  4NXN K;  4B3O A;  1L5U A;  4CIG A;  5M1F A;  3ULE B;  4M3Y A;  2E6L A;  3UKR B;  4PWD A;  1NK5 A;  1BA0 A;  1Q7Y O;  1SZ2 A;  2ZE2 A;  4BC3 A;  3VTH A;  2HHX A;  2IVN A;  1NGB A;  1HJO A;  4CD1 A;  1TUU A;  3KVG A;  3KLG A;  3NFA A;  2P1J A;  5FPN A;  4Z4I A;  1UOC A;  3UKU B;  4RW4 A;  2WOM A;  3CM5 A;  3D2F A;  5JS2 A;  3HRG A;  1REV A;  3UIQ A;  4F2R A;  2DTU A;  2B6A A;  2IAJ A;  1OVQ A;  1H1V A;  4IJA A;  5AQQ A;  3LDS A;  3K9K A;  5JVG L;  3AA4 A;  2OPS A;  5LL6 Z;  2EHG A;  3A5O C;  4DCH A;  4J2E A;  2V51 B;  3AVA A;  4JI1 K;  4WFN L;  4BRN A;  2WBN A;  1TYQ A;  3WNG A;  3O9Q A;  4KHU A;  4B08 A;  4BR2 A;  2YNH A;  5EU7 A;  4CIE A;  5AQL A;  2KQ2 A;  3K57 A;  4KI4 A;  4IDH A;  4FM0 A;  5M1K A;  4RG8 A;  4KHY A;  4O0J A;  3VQ8 A;  1HX1 A;  2A1S A;  5FRO A;  3CYM A;  4H0X B;  1TKX A;  4DQI A;  4CHO A;  1FKP A;  3OYI A;  1NK8 A;  1HPM A;  5ADX H;  1YTA A;  2WFB A;  3VQQ A;  4ILG B;  4KH5 A;  1YTU A;  4CZM A;  3O9R A;  4H5T A;  1W0H A;  1QQM A;  4CZF A;  2Q0R A;  1JKH A;  1KVB A;  4BC5 A;  1NGC A;  4CW7 B;  3CHW A;  2HBK A;  2HHS A;  1X9J A;  2O4G A;  1S1T A;  2NRX A;  3O1W A;  3CD6 N;  3NH0 A;  3TSU A;  2O8C B;  5TKY A;  3TU5 A;  4CJF A;  1RTI A;  3PIP L;  4H5N A;  3RRH A;  4CZJ A;  4NYF A;  3J80 O;  2R7Y A;  4DFM A;  2YNF A;  3BY5 A;  4CI6 A;  3CQY A;  2PFU A;  5BRD A;  3E9L A;  5AQP A;  2BUP A;  4BR5 A;  4EAH D;  4Y1C A;  4O55 A;  1ZBH A;  4LFA K;  3QIP A;  1JXB A;  3QNN A;  3ULE A;  4DV0 K;  1V4S A;  3UKR A;  4FJ7 A;  4W5R A;  4EZ9 A;  5AQT A;  3WQT A;  4Y0W A;  4OPK A;  3CQX A;  4CHQ A;  3L2W A;  5CZ2 A;  3CCM N;  2NLX A;  4XEI A;  1G15 A;  4IG3 A;  5GIO A;  4IG0 A;  1QZ5 A;  1NGF A;  3RMD A;  5GIN A;  4DV6 K;  1IG8 A;  4EHT A;  3ZT2 A;  1SL1 A;  5KTQ A;  1JL1 A;  3KLE A;  3BP8 A;  1KCF A;  3U3G A;  1YI2 N;  4I7F A;  4YOT A;  5JLF A;  3DLR A;  4M41 A;  1Z05 A;  3LP2 A;  3QEX A;  3P38 A;  2FF6 A;  1GOB A;  4O4G A;  4Z0U A;  4BR7 A;  3NDK A;  4BG9 A;  1GLA G;  3M8P A;  3LWM A;  4M3X A;  5D3G A;  1IV0 A;  3RRG A;  4BRM A;  3KZB A;  3THV A;  3SUO A;  2OCE A;  3O1B A;  3OJU A;  3LM2 A;  1N34 K;  4PKH A;  4JKG B;  3CME N;  3OVN A;  3TTF A;  2O8E B;  4CGJ A;  1BA1 A;  3WXL A;  4E7J A;  1EXQ A;  5HRR A;  4M45 A;  3P5J A;  5KRT A;  3CER A;  3AY9 A;  1GOC A;  4JK9 A;  3T19 A;  4FL9 A;  3M5R A;  1VQN N;  3WXK A;  3GG4 A;  4ILJ A;  4YDU C;  3SCX A;  1KVA A;  4KTW A;  4ELU A;  5IT9 O;  3W3D A;  3OY9 A;  1C1A A;  2UU9 K;  2ZF5 O;  4FPB A;  4DV5 K;  4Q5V A;  5B8H A;  1IKX A;  2YCH A;  1QQC A;  1YVU A;  2KHO A;  2ZGZ A;  4KB0 A;  2O8C A;  2ZJQ L;  3ALY A;  4OPH A;  4C1N K;  4CBW A;  1VQ8 N;  1K8K B;  1WSI A;  1NGG A;  1ZBF A;  4B3S K;  5AQX A;  2H3G X;  2E2Q A;  2O8F B;  3QEI A;  3H45 C;  3NAE A;  4IDK A;  1RT7 A;  5AZJ B;  4BC2 A;  2UXD K;  3F5T A;  4IXC A;  1BG3 A;  4KH6 A;  5CZ1 A;  3EYZ A;  4MLH A;  4JS5 A;  3PLA A;  1VSF A;  3R8E A;  4CF1 A;  4PHT X;  2AA4 A;  3HZ6 A;  4BG8 A;  4BWM A;  5J2N A;  4CEZ A;  3TSQ A;  5JVH L;  4PY5 A;  3GBT A;  1N6Q A;  1NJW A;  3CJB A;  3FGU A;  3O3H A;  3L2U A;  5F0X A;  2GUI A;  2Q97 A;  4CJU A;  3NF8 A;  1N36 K;  2OYQ A;  1I3A A;  1OH6 A;  1WBD A;  2YHX A;  5J2M A;  1HNI A;  1RDD A;  4OKJ A;  3SJH A;  4KTQ A;  3WQU A;  1W97 L;  3L6Q A;  4BVO A;  1S6Q A;  2Q3S A;  4HWI A;  2Q1N A;  1GLF O;  1S22 A;  3T1A A;  4H0Y B;  4B1W B;  3LZJ A;  2CH5 A;  3DOK A;  3WT0 A;  3CM6 A;  1Q18 A;  2O8B B;  3LDP A;  4GMJ B;  1NOZ A;  2VGM A;  3MX2 A;  1S72 N;  4NLB A;  3QDK A;  2OAN A;  3KLI A;  3SUN A;  2GWJ A;  4KH4 A;  4O5B A;  2ZD1 A;  5HRO A;  4WQ4 A;  4DFP A;  3C6T A;  5FDL A;  4B3R K;  1C1C A;  2QWQ A;  1NNE A;  1EWR A;  2HMI A;  4KHN A;  4CEF A;  2V52 B;  4JKG A;  5J2Q A;  5KQD A;  1ATR A;  2O8E A;  4EIA A;  3HOT A;  4JI0 K;  1IG9 A;  1LCU A;  1YF5 L;  2GEM A;  3NGI A;  4CEO A;  1M1K O;  2Q2R A;  3HOS A;  4M42 A;  3P31 A;  1XC3 A;  1VRU A;  5GAH P;  4QS7 A;  3ZX0 A;  3BZC A;  5E84 A;  1JLQ A;  3QET A;  4J2D A;  3VER A;  4K41 A;  5BPM A;  1U45 A;  3OYC A;  1ZBU A;  2E88 A;  5AQO A;  1QSL A;  4TSX A;  4Z4E A;  3VQB A;  3V9X A;  5C15 A;  5BR8 K;  1D4X A;  3F2K A;  3KLH A;  4JKC A;  2VG6 A;  3CJ1 A;  1XNR K;  3GDQ A;  1OH5 A;  5GAE P;  1C6V A;  4C8O A;  4N76 A;  2P9N B;  2BE2 A;  1JL2 A;  3A0I X;  4A2B A;  2HVH A;  1BU6 O;  1XHZ A;  4C8K A;  3MX5 A;  1N8R O;  1XI1 A;  1HJR A;  1O1W A;  4CJS A;  3N4Q A;  2NUB A;  3JAM O;  4CJ4 A;  4BRK A;  1QE1 A;  3CJ7 A;  3G4S N;  5AQZ A;  3MDQ A;  5AZJ A;  2J4R A;  1VQ7 N;  1RGI A;  3R9P A;  4J2A A;  3CFP A;  5BRE A;  5C25 A;  2P5O A;  2Z1G A;  4M63 C;  1SAZ A;  4HTL A;  4FWO A;  2ETJ A;  5F1X A;  4FXD A;  3S3M A;  3E9O A;  2ZGY A;  4DWI A;  2HNZ A;  3MXI A;  4NCA A;  5ADX A;  3NBP A;  1BDG A;  2KZM A;  4M3W A;  2OPR A;  4DV4 K;  3SNN A;  1B9D A;  4FK4 A;  1NGE A;  4I9Q A;  4FJI A;  3OBW A;  2PZS A;  1C0U A;  2WC9 A;  2ASO A;  4JKB A;  1VRT A;  2YX6 A;  4FJL A;  4FWK A;  1NGD A;  3ZX3 A;  1SKS A;  3VEZ A;  3OBY A;  3ZSR A;  3EE9 A;  1RT3 A;  3D6R A;  1QS4 A;  3AVG A;  4DFK A;  3AVK A;  1BI4 B;  3LDO A;  2QWP A;  2ZJR L;  2A40 A;  1NKE A;  1JCF A;  1LAV A;  3KK3 A;  4IZ9 A;  3RMC A;  3TAP A;  4KPY A;  1JXE A;  1VSM A;  1ATS A;  4X66 K;  2HBJ A;  3H3O B;  3I33 A;  4C1N I;  5BN8 A;  3IRX A;  5K14 A;  1QVF M;  3L8B A;  2YHB A;  3SQ0 A;  3DLG A;  1NK9 A;  1KLM A;  3MN7 A;  4G1Q A;  4CGG A;  3M8R A;  3C7N A;  4LH4 A;  1BIS A;  3CPW M;  4F3O A;  3OYJ A;  4I6M A;  1WUA A;  1YIJ N;  4AH9 A;  2XHB A;  1CZ9 A;  2BTF A;  1UAX A;  5C10 A;  1RCH A;  4IBN A;  3UB5 A;  3ZET B;  2UXC K;  3HL8 A;  4HCB A;  3IFR A;  3K5N A;  4PL8 A;  3VQP A;  2Y1J A;  1B9F A;  3CG7 A;  5AQF A;  2YJE A;  3OYG A;  2VWJ A;  3A2F A;  3C95 A;  1EWQ A;  3Q7C A;  3MMV A;  3TPQ A;  4OGC A;  4CHP A;  2VG7 A;  3DLK A;  1ITG A;  2QWL A;  4QS9 A;  1WSH A;  4BQZ A;  4PL7 A;  4DFJ A;  3HPG A;  4CES A;  1UWB A;  3TI0 A;  3J8A A;  3HVT A;  4M3T A;  1OKJ A;  3ZT3 A;  1EO1 A;  4Y1D A;  3NVM A;  3U8X A;  3OYH A;  3U9D A;  2E1Y A;  3S3N A;  3CET A;  2VWB A;  3DAW A;  4H4M A;  5GAG P;  3KLF A;  3I0S A;  5A2Q O;  4ELT A;  1NKB A;  1ATN A;  3VQE A;  3SV3 A;  2E2N A;  3FZK A;  3MWP A;  2HHU A;  3C6U A;  2D0P A;  4KRE A;  2QEX N;  3P1G A;  4ELV A;  4FK2 A;  1FXX A;  4BRC A;  1HUX A;  4BVP A;  3FFI A;  3LAL A;  1E3M A;  3U4L A;  2NRR A;  4JD2 B;  1VQ9 N;  4H0V B;  3LWL A;  3AVJ A;  1EQY A;  2IVO A;  4AHR A;  2CH6 A;  4M7X A;  1NBW A;  1G99 A;  4CF0 A;  3ZEU B;  3H08 A;  3T7Z A;  1TK0 A;  4FLX A;  3BZK A;  3OS0 A;  4E7H A;  2P9S B;  1Q82 O;  1C0F A;  3ID8 A;  4FWN A;  4HUG A;  1BI4 A;  4FWL A;  1S5J A;  1VQO N;  2FLO A;  2Q31 A;  4YHH K;  4KFB A;  3WNE A;  4YOY A;  4FPA A;  1SQK A;  4EP5 A;  4IJN A;  5HLF A;  3M1F A;  4HVJ A;  4DSL A;  2HB5 A;  3ENH A;  2E2P A;  4BR4 A;  1Q86 O;  4GV9 A;  4JI8 K;  4IFE A;  4ISF A;  4NLC A;  3TAE A;  4IEE A;  1ZC6 A;  1QSY A;  3CIP A;  2BDP A;  1J9A A;  3B8A X;  3NHG A;  4E7I A;  1MA9 B;  1S1W A;  3V9U A;  1Z26 A;  4FJ5 A;  3T1Y K;  3HPO A;  3CQ8 A;  2KKZ A;  1X9M A;  4CIF A;  3DXM B;  4FLU A;  5C2F A;  4CJL A;  1DEJ A;  1ASU A;  4Q0B A;  3LL3 A;  5HL7 L;  4DR7 K;  4FK0 A;  4CGF A;  4A61 A;  3SPY A;  1KVC A;  3ZET A;  4ISG A;  3H46 O;  2Z1H A;  3I8B A;  3FZF A;  4DKW A;  1GLB G;  4FYD A;  3V1Q A;  1N33 K;  4CJP A;  4MO4 A;  2ZWH A;  5AFU A;  1V4T A;  1WSG A;  3V1R A;  4WFB L;  2FSJ A;  2D0B A;  1IKV A;  4FVM A;  4CZL A;  3EZW A;  1NKC A;  2FBY A;  2FBV A;  3A5M C;  4CZI A;  4CJ7 A;  4JK7 A;  1RDW X;  3EKU A;  1UA0 A;  2PAV A;  3I8D A;  1LWE A;  4IKF A;  3VF2 A;  3DOL A;  2GV9 A;  3MCP A;  1HKG A;  3TAN A;  4LC9 B;  3VEN A;  3M3Z A;  4C23 A;  3S3O A;  1U4B A;  5KI6 A;  1TV6 A;  3M8Q A;  4ISE A;  4CHY A;  3H1V X;  4JN4 A;  3DM2 A;  2FF3 B;  4LFB K;  3CC7 N;  1NJI O;  2NNW A;  4K43 A;  4BC4 A;  2A1R A;  5KPR A;  1SL2 A;  4JD2 A;  2D0C A;  4CK2 A;  4FJ9 A;  1TVR A;  1KTQ A;  1BCO A;  3ZLJ A;  5F2R A;  1WAF A;  3ZEU A;  4B1Z A;  4BRG A;  4GY2 B;  1LV5 A;  1TL1 A;  3M8S A;  2G8I A;  1W2B M;  4KRF A;  3ISN C;  2YV0 X;  1RTJ A;  4PKG A;  3DRS A;  3VOV A;  4C8L A;  4N56 A;  1GLE G;  3L2R A;  3AVF A;  1EP4 A;  4FW2 A;  3CJC A;  5E26 A;  1JLC A;  2W42 A;  2IOC A;  4DTN A;  4BE1 A;  3VQ4 A;  2UUB K;  4JI5 K;  4FJK A;  4AF1 A;  4DG1 A;  3TTD A;  4HTU A;  3WUH A;  1GLD G;  1SUQ A;  3WEE A;  4GKJ K;  4KHS A;  1OVY A;  1U2V A;  4H4O A;  1CLQ A;  1RDU A;  4EZ6 A;  2QWM A;  4RW9 A;  1IBM K;  4LF4 K;  3TAR A;  4H5W A;  4B8C A;  1Y97 A;  3VA3 A;  1BWF O;  2O4I A;  1FK9 A;  1DTT A;  1S1U A;  3DXM A;  1WB9 A;  4KHP K;  3GE1 A;  1U04 A;  4CEQ A;  4DS5 A;  5EY4 A;  2IVP A;  3M6G A; 
#chains in the Genus database with same CATH homology
 1W97 L;  3L6Q A;  4BVO A;  3O8M A;  5HOO A;  1ESV A;  1IJJ A;  1R59 O;  1ZXO A;  4HWI A;  2Q1N A;  1DKG D;  1GLF O;  1S22 A;  5BR9 A;  2F9W A;  3EO3 A;  3UKU A;  1QQN A;  4MLE A;  4H0Y B;  3SMS A;  4B1W B;  3T69 A;  2P9L B;  4BRA A;  1MWM A;  2CH5 A;  3WT0 A;  1Q18 A;  5CE3 A;  2A6A A;  3LDP A;  4H0P A;  4JKH A;  5ELZ A;  2VGM A;  3MX2 A;  1S72 N;  5M1P A;  2ASM A;  4NLB A;  3LM9 A;  3QDK A;  1VQ5 N;  2OAN A;  2NRH A;  3JS6 A;  3Q7B A;  2GWJ A;  1C0G A;  2QA4 N;  4KH4 A;  5LJV A;  3N4P A;  5AQY A;  4WQ4 A;  4YOW A;  4FOI A;  3RSE B;  4CZK A;  4U7B A;  4CD3 A;  2A42 A;  4IO8 A;  3JXU A;  2FSK A;  2QWQ A;  3ATU A;  2GTD A;  4JEP A;  1K9M O;  5LY3 A;  1NLV A;  1BUP A;  4JKA A;  4QS8 A;  3BF3 A;  2NRW A;  2V52 B;  4IOC L;  1T44 A;  4JKG A;  3G6E N;  5KQD A;  1ATR A;  1NMD A;  3AAP A;  5FPE A;  4EIA A;  3ATV A;  3HOT A;  1QHA A;  1YIT N;  3UE5 A;  3SBT A;  1LCU A;  3DXK B;  2W41 A;  4WYB A;  1YF5 L;  2GEM A;  3VEO A;  4DB3 A;  5KPT A;  2IIR A;  2D0O A;  1M1K O;  2Q2R A;  3SBG A;  3HOS A;  4H5R A;  4BR9 A;  3P31 A;  5BRH A;  3BF1 A;  1XC3 A;  5GAH P;  4DHY A;  4QS7 A;  2QWN A;  3ZX0 A;  5BRF A;  1MDU B;  4OPA A;  3CPE A;  5E84 A;  4F9O A;  5GAD P;  1Z6R A;  1Y64 A;  2P9K A;  5AZI A;  3VER A;  4K41 A;  5BPM A;  4AM6 A;  3IKM A;  3ID6 A;  4XH5 A;  2E88 A;  5AQO A;  3U9Z A;  3I55 N;  3A8Y A;  2D1K A;  1QVG M;  1KAX A;  4CZG A;  1K8A O;  4RTF D;  3ZX2 A;  4FWQ A;  3CCJ N;  3LDL A;  4H0O A;  3MN5 A;  5C15 A;  4BRI A;  3CCU N;  1KC8 O;  3HTV A;  2GWK A;  2HBL A;  1D4X A;  3F2K A;  5MLC Q;  2RE2 A;  3TTC A;  1GLJ O;  4JKC A;  3HBT A;  3CJ1 A;  3GDQ A;  4NO7 A;  3L0Q A;  4BY9 C;  2CGJ A;  3E1Y A;  5GAE P;  1ZBS A;  4BRQ A;  2P9N B;  4A2B A;  3A0I X;  3AGR A;  3L4I A;  1BU6 O;  4G9Z A;  3QBW A;  1M90 O;  5AQU A;  4CBX A;  3CCL N;  1GLL O;  1HKB A;  3MX5 A;  5AQV A;  1N8R O;  3VTI A;  3N4Q A;  3VEX A;  2I7N A;  3O4W A;  3CCR N;  3RVC A;  3SLC A;  4WFA L;  1T6D A;  5KPZ A;  4FWR A;  4WQ4 C;  1J6Z A;  4BRK A;  3C6A A;  3ENO A;  3G71 N;  3H6E A;  3CJ7 A;  3MWT A;  4UY8 O;  4BRH A;  5AQZ A;  3MDQ A;  3G4S N;  3CCV N;  5AZJ A;  1Q81 O;  2J4R A;  2V7Z A;  4YOV A;  1RGI A;  5AQI A;  3R9P A;  4JHD B;  4FSV A;  4B1V A;  1VQ7 N;  1VQN N;  1XUP O;  2P9S A;  4M7Y A;  4XH4 A;  3DWL A;  5BRE A;  4BR0 A;  5TKW A;  2I7P A;  4K42 A;  1YVN A;  3S41 A;  4M63 C;  1SAZ A;  2VGN A;  3LDN A;  4FWO A;  4HTL A;  4H5V A;  1JCG A;  5F1X A;  3E9O A;  2ZGY A;  3D2E A;  1YHQ N;  1VQL N;  4OO1 J;  4XH1 A;  3MN9 A;  4GV3 A;  2V7Y A;  5ADX A;  2P9P B;  3CJA A;  2NRV A;  1BDG A;  2HST A;  1P90 A;  3O6W A;  3SAG A;  5JMV A;  4H03 B;  1DT9 A;  1X3N A;  2PBD A;  1NGE A;  3I56 N;  4IO9 L;  3HSC A;  3AAQ A;  5AQS A;  3O9T A;  4JKD A;  4IOA L;  3LDQ A;  3O9U A;  2QWO A;  3GOI A;  3OBW A;  4A5B A;  5DM6 L;  3HM8 A;  2WC9 A;  2ASO A;  3FR0 A;  3IUC A;  2YX6 A;  2P9L A;  2FSN A;  4JKB A;  4FWK A;  4O8K A;  1NGD A;  3WXM B;  3ZX3 A;  4RWT A;  4JAX A;  1LOT B;  2YJF A;  3VEZ A;  3OBY A;  2DPN A;  1WOQ A;  4BGB A;  3EE9 A;  2QM1 A;  5BPL A;  3D6R A;  2F7T A;  3C65 A;  1E4F T;  2HOE A;  4H0T B;  3CXC M;  3LDO A;  2QWP A;  2OTJ N;  3C6H A;  3WEE B;  2ZJR L;  2A40 A;  2P9I B;  3EN9 A;  2NZT A;  3EE8 A;  3H3N O;  1U2V B;  1ILY A;  1JCF A;  3RSE A;  2E2O A;  4B1Y B;  4BRF A;  5M1F A;  1HLU A;  3ULE B;  4IZ9 A;  1VQP N;  3UKR B;  4IEI A;  1BA0 A;  1Q7Y O;  1ATS A;  1SZ2 A;  2HBJ A;  3H3O B;  3I33 A;  4C1N I;  4O8U A;  2A5X A;  4K25 A;  4BC3 A;  5BN8 A;  3VTH A;  1QVF M;  3DXK A;  2IVN A;  1NGB A;  1HJO A;  4CD1 A;  5C12 A;  1TUU A;  3O9S A;  3KVG A;  3J7Z O;  3DLL L;  3FZM A;  3TSP A;  3CCQ N;  3MN7 A;  3VET A;  4YOX A;  3E66 A;  5FPN A;  1BO5 O;  4IWV A;  2QWR A;  4GVE A;  3UKU B;  4MO5 A;  3C7N A;  3CPW M;  4B1X B;  1KXP A;  3D2F A;  4I6M A;  2KLA A;  3HRG A;  3P39 A;  1WUA A;  1YIJ N;  5M1Q A;  2BTF A;  2HF4 A;  5C10 A;  4AM7 A;  3UB5 A;  2P9U B;  3FZH A;  2NRT A;  4A59 A;  3ZET B;  1H1V A;  4IJA A;  5AQG A;  3IFR A;  5AQQ A;  1VQ6 N;  1MWK A;  2QI2 A;  3K9K A;  4PL8 A;  5JVG L;  2YHW A;  1NGI A;  4BRD A;  3A5O C;  2YJE A;  5AQF A;  4DCH A;  2V51 B;  5JLH A;  3CCE N;  2GX9 A;  3P4I A;  4WFN L;  4BRN A;  2A3Z A;  1TYQ A;  2WBN A;  3O9Q A;  2NRZ A;  4RCH A;  4MDB A;  1O13 A;  4BR2 A;  4CBU A;  1NGA A;  3SK3 A;  4E1J A;  3Q7C A;  3MMV A;  5AQL A;  1K8K A;  3TPQ A;  3PIO L;  1X3M A;  3MK6 A;  4FVU A;  3AAR A;  4WQ5 A;  4IDH A;  5BN9 A;  5FPD A;  4CZE A;  3OW2 M;  2QWL A;  4QS9 A;  1VQM N;  5M1K A;  4BQZ A;  2W40 A;  4PL7 A;  1HX1 A;  2E1Z A;  5AZI B;  1QZ6 A;  3J8A A;  5JIC A;  1OKJ A;  3O08 A;  4H0X B;  3VEV A;  1EO1 A;  3QFP A;  3KWG A;  1E4G T;  4J8F A;  3NMU A;  3HI0 A;  3VES A;  1JCE A;  3NVM A;  1HPM A;  3U8X A;  5ADX H;  3K9J A;  2E1Y A;  2WFB A;  3U9D A;  3ZYY X;  3CET A;  4ILG B;  4KH5 A;  5M1N A;  4CZM A;  5CHI A;  2VWB A;  3O9R A;  4H5T A;  4GV6 A;  3DAW A;  5GAG P;  1QQM A;  4CZF A;  2Q0R A;  1ATN A;  4BC5 A;  1NGC A;  2E2N A;  3FZK A;  3MWP A;  2P9P A;  3CHW A;  2HBK A;  2D0P A;  1X9J A;  5EX5 A;  5EOY A;  4PKI A;  2BH1 A;  3CF5 L;  2QEX N;  3VMF B;  2Q0U A;  4IOX A;  4BRC A;  5AQH A;  1HUX A;  2NRX A;  4BVP A;  3O1W A;  3D7E O;  4BQL A;  3CD6 N;  3TSU A;  3U4L A;  2VCP A;  5TKY A;  3TU5 A;  3MCA B;  2NRR A;  4JD2 B;  1VQ9 N;  2GEL A;  2HBM A;  4H0V B;  3VGL A;  1K73 O;  1EQY A;  2IVO A;  3CJ9 A;  2CH6 A;  2YI1 A;  4M7X A;  1NBW A;  1G99 A;  5AQN A;  3ZEU B;  3QBX A;  3PIP L;  3MN6 A;  4BRO A;  4H5N A;  3T7Z A;  4CZJ A;  3EL2 A;  4ILH A;  4CI6 A;  2VYP A;  2PFU A;  2JWK A;  3CQY A;  5BPN A;  5BRD A;  3EKS A;  2P9S B;  1Q82 O;  1C0F A;  2ASP A;  3ID8 A;  4FWP A;  4FWN A;  3E9L A;  4O5F A;  5AQJ A;  4FWL A;  2BUP A;  5AQP A;  4BR5 A;  1VQO N;  2FLO A;  2Q31 A;  3BEX A;  1KD1 O;  4EAH D;  4YOY A;  2P9I A;  3CC4 N;  4FPA A;  4WQ5 C;  1VQ4 N;  1SQK A;  1NWK A;  4IJN A;  1SS6 A;  3M1F A;  3CCS N;  3ULE A;  1NM1 A;  2HMP A;  4FO0 A;  3D2E B;  3ENH A;  1V4S A;  2E2P A;  3KWI A;  3UKR A;  4BR4 A;  1Q86 O;  4GV9 A;  2RHK A;  4IFE A;  4FOE A;  4ISF A;  3FFK B;  4NLC A;  5AQT A;  4IEE A;  1ZC6 A;  5AQK A;  4Y0W A;  3WQT A;  4EFH A;  3CIP A;  3CQX A;  1DGK N;  3B8A X;  1S3X A;  3IMX A;  2NLX A;  1MA9 B;  3CCM N;  3SAF A;  4XEI A;  4YDU A;  4JK8 A;  3VGM A;  3VEW A;  4A2A A;  2KKZ A;  1VAZ A;  5GIO A;  5EVZ A;  1HKC A;  1XQS C;  5AQM A;  3DXM B;  5C2F A;  1QZ5 A;  1YXQ A;  4A5A A;  5KQ8 A;  3AGK A;  1NGF A;  4GNI A;  3CMA N;  1DEJ A;  5AFU H;  4YOU A;  5GIN A;  1IG8 A;  1P8Z A;  3BUZ B;  4EHT A;  3LL3 A;  5HL7 L;  1RFQ A;  4YOR A;  1TUY A;  3QFU A;  2P9U A;  5FPM A;  4A61 A;  2OTL N;  2QW9 A;  3ZET A;  4ISG A;  5C0Y A;  1GLC G;  3BP8 A;  3H46 O;  1YI2 N;  3I8B A;  3FZF A;  4YOT A;  5JLF A;  3KHY A;  5EXW A;  1YUW A;  1Z05 A;  3VGK A;  2GUP A;  4JKE A;  3P38 A;  4DKW A;  4B9Q A;  1JJ2 M;  3DJC A;  1CZA N;  2FF6 A;  3OA9 A;  3G25 A;  1GLB G;  2HF3 A;  4BR7 A;  3CC2 N;  1VQK N;  1T6C A;  3A5N C;  4BGA A;  4MO4 A;  2ZWH A;  3H1Q A;  1V4T A;  3WXI A;  1GLA G;  4BG9 A;  5AFU A;  4R79 A;  3R6M A;  4WFB L;  4KBO A;  2FSJ A;  4CZL A;  4BRM A;  2E20 A;  3NVK A;  3KZB A;  3EZW A;  1YJN N;  2P9N A;  3W0L A;  3O1B A;  4U67 L;  3LM2 A;  3A5M C;  4PKH A;  4CZI A;  4CJ7 A;  4JK7 A;  4JKG B;  3CME N;  1KAZ A;  1RDW X;  3R1X A;  3ENB A;  5AQW A;  3SMP A;  3O5B A;  3TTF A;  1YAG A;  1BA1 A;  3EKU A;  4JNE A;  5M1O A;  3WXL A;  4BRE A;  2PAV A;  3VF4 A;  3C7N B;  3CER A;  1BOT O;  3AY9 A;  4JK9 A;  2Q36 A;  3D2F B;  4I6M B;  2QTD A;  3IDH A;  3SAH A;  4FL9 A;  3VF2 A;  3WXJ A;  3M5R A;  4FWM A;  3MCP A;  2EWS A;  3WXK A;  1HKG A;  3A5L C;  3GG4 A;  2UYT A;  4FWS A;  4ILJ A;  4JHD A;  4LC9 B;  4YDU C;  2P9K B;  3VEN A;  1YJ9 N;  3GL1 A;  3W3D A;  3M3Z A;  4C23 A;  4A57 A;  1KAY A;  3OHR A;  1QQO A;  1NGH A;  5DM7 L;  4ISE A;  1KQS M;  2ZF5 O;  3H1V X;  4FPB A;  4JKF A;  5AQR A;  4A62 A;  5B8H A;  4JN4 A;  4B1U B;  5GIP A;  2FF3 B;  5H1S Q;  2F9T A;  2ITM A;  2YCH A;  1T3V A;  1NJI O;  3CC7 N;  1TYQ B;  2NNW A;  4K43 A;  2KHO A;  2ZGZ A;  4L3Q A;  4BC4 A;  5KPR A;  3QB0 A;  2ZJQ L;  4Z94 A;  4JD2 A;  4OPH A;  4C1N K;  2WUS A;  4CBW A;  5I9E B;  4MDA A;  4WCE L;  1VQ8 N;  1K8K B;  2ZJP L;  5C2D A;  5F2R A;  2AP1 A;  3ZEU A;  4B1Z A;  4BRG A;  4GY2 B;  1NGG A;  2YHY A;  2A41 A;  1W2B M;  4WF9 L;  3QIC A;  5AQX A;  2H3G X;  2E2Q A;  4PKG A;  2E8A A;  1U6Z A;  5AR0 A;  3FZL A;  3L4Q A;  3H45 C;  2FXU A;  3VOV A;  2QXL A;  3C0B A;  1GLE G;  2JWL A;  3FE1 A;  3O80 A;  3CI5 A;  4BRP A;  3VEY A;  5AZJ B;  3CJC A;  5E26 A;  4BC2 A;  4DQ8 A;  3F5T A;  4IXC A;  3QML A;  1BG3 A;  4KH6 A;  4MLH A;  3E9P A;  3PLA A;  3R3L A;  3R8E A;  4BRL A;  4AF1 A;  4NB4 A;  3TTD A;  4PHT X;  5CR4 A;  3WUH A;  2AA4 A;  3HZ6 A;  1GLD G;  3WEE A;  4BG8 A;  1OVY A;  1U2V A;  1RDU A;  2D4W A;  3TSQ A;  5JVH L;  2QWM A;  4H5W A;  3GBT A;  3CJB A;  3VPZ A;  3FGU A;  4CZH A;  1NGJ A;  4EHU A;  1BWF O;  5F0X A;  2Q97 A;  5LJW A;  3FLC O;  2CGK A;  3DXM A;  3F9M A;  2YHX A;  3GE1 A;  3SJH A;  3KK7 A;  3VF6 A;  5EY4 A;  2IVP A;  3M6G A;  1YJW N;  2CGL A;  3WQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...