5C10A

Nuclease domain of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
242
structure length
230
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
total genus 82
structure length 230
sequence length 242
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c10A00
3CPEA 4IFEA 5C2FA 5M1KA 4IEEA 3C6HA 4IEIA 5M1OA 5M1QA 4IDHA 3C6AA 5M1PA 5M1NA 5C12A 5M1FA 5C15A 5C10A 5C2DA
chains in the Genus database with same CATH superfamily
2HHTA 3QB0A 3AGRA 4XH5A 4BC2A 3ZSXA 2A6AA 4KHQA 3JS6A 4BDPA 4OKJA 4FJKA 5LL6Z 4NLBA 1OVQA 4BE2A 2E2QA 1SL2A 2W41A 2W40A 1BG3A 3HI0A 3DLBA 1L3SA 3BF3A 3S9HA 3QLHA 2KW4A 4K0KK 4A57A 3EY1A 1KSPA 4NO7A 3MK6A 5BPLA 3KKRA 2P9PB 4FSVA 3LANA 5AZIA 2O8FB 3BF1A 2WFBA 1X9JA 4WCEL 2KHOA 1U49A 1J9AA 3OYEA 2G8HA 2ITGA 1R59O 1VSEA 1JLGA 4M3XA 4HCCA 3THYA 4RCHA 2UUBK 4KHWA 3HVRA 1YTUA 3NVMA 4YHHK 2A41A 1NOYA 4LFAK 4KH6A 4E19A 1A5XA 3ULEA 3MXIA 4PQUA 3VQ4A 1E4GT 3MDQA 4CZIA 4CJTA 1C0TA 5AR0A 1HKBA 1XMOK 3TANA 3O9SA 1O1WA 1RTIA 3WXKA 3MMVA 1YAGA 2GTDA 2YNHA 1W2BM 3EN9A 3RRGA 5J1EA 3ZX2A 3HBTA 4Y0WA 1OKJA 4BRIA 4CEBA 1D9DA 4GY2B 1BIUA 2QWLA 1Y97A 1S6PA 3WNFA 4FJ7A 3AA2A 3K9KA 3ZT3A 1IKVA 1WAFA 3SV3A 3V81A 4HUEA 1UWBA 2ZQBA 2BANA 5GINA 1NMNA 4YOXA 5BRHA 3EZ5A 3VQ5A 4IWVA 3OVNA 3AO1A 2QWNA 2BDPA 3ZLJA 3MEEA 2QKKA 2UUCK 2X6SA 4G9ZA 4FLXA 4NYFA 4QOZB 1FKOA 1HNZK 3FE1A 4H5WA 3P39A 3O3FA 3RSEB 3NCIA 3CJ1A 1P8ZA 3QFPA 4ISFA 1W0HA 4CK2A 4JRQA 2HMIA 1RGIA 2GELA 2HHVA 3SMPA 4WQ4C 1TKZA 1XHZA 3NDKA 3MCPA 2VGMA 1WUAA 3KD5E 4L3QA 3E9LA 1W97L 3OS1A 3P31A 4E7HA 3CJCA 5GAGP 4I2PA 4RW6A 5AQLA 1GLFO 1XC3A 4BR4A 4LH4A 5LJWA 3HPHA 4FJHA 3WNGA 1VQPN 4FWLA 1BA1A 1Z25A 4JI1K 1SUQA 1YUWA 3WNEA 5HRPA 4AILC 4DFMA 4ZTFA 1SL1A 2HHSA 1RNHA 3AA3A 5LJVA 4FK4A 4H5TA 1WSFA 3LAKA 5FPNA 3AV9A 3UKUA 1N6QA 2KZZA 3THXA 3VOVA 4CK1A 3D2FB 5J2QA 3RWUA 3PO4A 4JS4A 1QHAA 3WXMB 4CZFA 1IKWA 4WFBL 3A5NC 3HP9A 2FC0A 1L3UA 2O8CB 4B8AB 3AVNA 1NJIO 3BEXA 2Q36A 2VQEK 1K8KB 3TSPA 3AY9A 4GVEA 4KRFA 4E7IA 1RBRA 2B6AA 4F3TA 1HPZA 2ZE2A 3P38A 1FXXA 4FVMA 3JXUA 4LF8K 4LF9K 2PZSA 1L3TA 2OANA 3M8SA 1C0FA 2P5GA 3EKUA 3WUHA 3L8BA 4CEOA 1VSDA 3DI6A 2UXDK 5IT9O 3OYDA 3K9JA 4L8RB 4CGDA 1NGGA 1ZYQA 1HYSA 1NGFA 4CI6A 4FCYA 2QM1A 4IFEA 5KGWA 2KTQA 1SZ2A 3U3GA 3UB5A 4FLWA 4BC3A 5BR8K 4IEEA 4E1MA 2ZWHA 3FZHA 3OYCA 2O8EA 3HXMA 3KVGA 4BDYA 2BUPA 1T3VA 2JWKA 4OPHA 4JI4K 4JKDA 1X9MA 3KLFA 3ZCMA 3M6GA 3LZIA 3RVCA 4JKEA 3KK2A 4X64K 3VQDA 4F4KA 4FJXA 4OGCA 4ELUA 1BHLA 3DXMA 2RF2A 3CCRN 3SYZA 4CF8A 2A40A 3FZMA 5BPNA 1NJYA 3ATUA 1RBUA 1RDDA 4DTOA 4XH4A 1BU6O 4CK3A 2WTUA 2RHKA 3LP3A 1KFDA 4BRHA 1LWCA 4CZKA 5GAEP 3NAEA 1M1KO 1Q9XA 3OY9A 1IG9A 3SPYA 4CJWA 3LPTA 3G4SN 1BWFO 4I6MB 3RTVA 3QEIA 1TGOA 4BR7A 1DLOA 3L4IA 4B9UA 1T05A 3QFUA 4CJVA 2HHWA 1GLAG 4Z4HA 4DU3A 1VQ6N 5HL7L 4ISEA 3TR8A 4CIFA 5AQQA 5K14A 3V9UA 5CZ1A 3D6RA 4GMJB 3SQ4A 1NK0A 4CJUA 3VGLA 2Z1GA 1JL1A 1D9FA 2EWSA 2XY8A 5T7BA 1S9EA 3R1XA 2F7TA 3PSFA 1CXUA 1KD1O 2G8VA 2PYJA 1NLVA 5AZJA 3K57A 3AVIA 1VRTA 2XHBA 4FM0A 4XH1A 2RPIA 2O4IA 2OYQA 4K8XA 1Q7YO 3QIOA 4H0TB 2NRRA 3QDKA 4YOVA 4CCHA 2ASOA 1HKCA 5GIPA 1NGCA 4B1UB 2D1KA 2P9NB 5KQ8A 2HOEA 4DU4A 1QVGM 1RT4A 1XC9A 4B9VA 1BISA 4AHUA 3CFPA 4I2QA 4BQLA 4GV6A 3PUFA 1WBDA 3AA5X 2HW3A 1UOCA 2NZTA 5M1NA 3SQ1A 3R8EA 5B8HA 1NK6A 3QICA 1YITN 5LMNK 3SJHA 2HF3A 3AO5A 2P9IA 4Z4CA 5AQWA 1D4XA 4IG0A 1VQ9N 4N5SA 2P51A 1B9DA 3H08A 3I55N 4CZEA 2WBNA 5AQIA 2P9SB 4R5PA 3CERA 4H0XB 1S3XA 3VESA 3VEVA 3CM5A 3VETA 1CZBA 4YNQA 5KQDA 1YIJN 4ZHRA 2P9UB 1KQSM 4OO1J 1C1BA 2P9LB 1JLAA 3BY5A 2CH6A 1KVBA 1VK0A 4CHQA 4Y1DA 3KD1E 1MA9B 4CHZA 5BN8A 1KAZA 3L2UA 1NM1A 4ID1A 4LY7A 4YORA 3M8PA 1T8EA 4CGIA 5JLFA 3MX5A 1LV5A 2I7NA 2DPNA 3LP1A 1XNRK 4NB4A 3ENBA 4E1NA 2G8KA 3PX0A 5BREA 2HNDA 3OYFA 2QWRA 1Q82O 4FLTA 2G8UA 3RR8A 3V9XA 3HRGA 1Q86O 1NGAA 2BH1A 3O4QA 3QNNA 1REVA 3TU5A 3J7ZO 4OLAA 3O1BA 4JKBA 4YDUC 1IG8A 5JVGL 4PA1A 4OVLA 1NKEA 4JEPA 4WQ5C 4CEEA 3D45A 4LFBK 3RMDA 3MAQA 2CGLA 3TWHA 4BR5A 1VSFA 1HNIA 3VTIA 1GLDG 2P9KA 4NXMK 1VRUA 4E1JA 1N33K 3ATVA 2DY4A 1ASUA 2ZF5O 3G25A 4IJNA 1YHQN 4W5NA 1MU2A 5IWAK 1LAVA 1XUPO 4DTNA 1KAXA 3VQ9A 5CYQA 3ULDA 5KTQA 4M7YA 5KI6A 2GBZA 3PO5A 3ULEB 4DSFA 4NLCA 5I42A 2X74A 3OJSA 3V9SA 4PHTX 4HWIA 1YT3A 3HTVA 3J7AP 3CJ9A 1HJOA 4B8CA 3VF4A 4QS9A 1EP4A 2PFUA 4PL7A 3AVHA 5A2QO 1X3MA 1QQNA 1BL3A 2IAJA 1VSMA 1KC8O 4CEAA 5E84A 3T19A 4CJPA 3I56N 2YJFA 3C7NB 1WB9A 1JL2A 2NRTA 3K5OA 4DF4A 3LDSA 1C1CA 1Y64A 4CERA 2A42A 1VQMN 4BG9A 3DLEA 3SUPA 4DB3A 2P1JA 3O9RA 4DR3K 4JN4A 4DFPA 3S3OA 3OYBA 2VYPA 3CD6N 4MLHA 3LDLA 1I3AA 2B5JA 1YVUA 3R9PA 1U2VB 4RW4A 3KHYA 4ILHA 2ZJRL 3SMSA 1WSHA 4ID5A 2B4JA 3H45C 3LALA 1NJXA 5FDLA 3CMAN 3MN5A 4CJKA 3OYMA 4YOUA 5C0YA 3AVGA 2DTUA 3LL3A 4DFJA 3VERA 5AFUA 3D2EB 4DV5K 4AHRA 1C0GA 3UKRA 2XY7A 3MWPA 5EVZA 2HBLA 3HJFA 3RMAA 1NK7A 3DWLA 3J81O 1SV5A 2HHQA 2DFEA 4IG3A 1WSGA 3CC2N 4DQSA 4KPYA 4F8RA 4IOAL 1JCFA 3VN5A 4H8KA 4PKIA 4DR7K 3KKSA 3UKUB 4DUYK 4LD0A 3I8BA 4JD2A 3DLKA 4H0OA 1RDAA 3A5OC 1RT6A 3AVBA 3BGRA 4CJRA 4KH5A 5AQKA 4CF9A 2P5OA 4CD3A 3HSCA 5F2RA 4C8MA 3T69A 3BUZB 3ID8A 4CGFA 2A1RA 2YV0X 4B1XB 5ADXA 1SKSA 1TV6A 5CE3A 5ELZA 2QA4N 4JS5A 4EAHD 2HBMA 3ASMA 1TL3A 1QVFM 3LPUA 4OKKA 1W9HA 2JWLA 1J6ZA 4ELVA 4KREA 5AQPA 4B9SA 4FJIA 4E89A 3V1OA 3EYZA 4CJSA 4JV5K 1JJ2M 2FF3B 3J8AA 5C2FA 4JHDA 4PWDA 1GLLO 4A59A 3L2VA 3F2KA 4BC4A 4FK2A 3JSMA 1HR0K 4LFCK 3AAPA 4DQ8A 4A5BA 4CIGA 1BI4A 3R6MA 2AJQA 3SUOA 1KVAA 2VG6A 3H1VX 1BOTO 4DSEA 2E5LK 3MWTA 1C0MA 4KO0A 3ZETA 4M3RA 1G99A 2NRHA 1TKXA 5FROA 2V7YA 4C8NA 3O08A 4WQ4A 1BCOA 4LF5K 1U4BA 3CC7N 3V9ZA 3IRXA 4DTJA 3CCMN 1KFSA 1EO1A 3QIPA 3CCVN 4J2AA 1UA1A 4BRGA 2CGJA 3TSUA 4H4MA 2UXBK 1DTTA 3HYFA 4F3OA 4WF9L 4FW1A 1GOAA 4LF6K 2GEMA 4B9TA 5M1KA 1TUYA 4B3TK 3HPOA 2CH5A 3ZSYA 3QMLA 1NGJA 1Q81O 3KWIA 4FJLA 2FBTA 2GUIA 4DSKA 3LP0A 1RT1A 4JK8A 3THVA 2LSNA 3AVAA 3VF2A 4DMNA 3SAGA 4EHUA 4G1QA 2QEXN 2I7PA 5HRRA 3T1AA 4I9QA 1EKEA 3E9OA 3T1YK 3D0PA 4B1WB 4CHPA 4H5NA 2WC9A 4FZYA 2OTJN 5DMRA 4J2DA 5EU7A 4F2RA 1WOQA 2YHBA 3SQ0A 3A5MC 2IIRA 4WYBA 2FBXA 3FZLA 4PL8A 3ZT1A 5C25A 4BRFA 1U48A 2D4WA 4DWIA 3I0SA 2O4GA 3SBTA 4FJ5A 1ZBSA 2G8IA 1VQON 1NGHA 5AZJB 3CPEA 1EX4A 4LSLA 5KPRA 4DTSA 3PLAA 2VG7A 4MQ3A 4CGJA 4FWNA 3HP6A 5C10A 1NGEA 3WXLA 1V4TA 3B6PA 1WAJA 3EE8A 1X9WA 3WNHA 4H0VB 3QEPA 4FJ8A 4UY8O 3M5RA 1ZBFA 4DV6K 4JKFA 4JI7K 3GE1A 3L3UA 1NBWA 4DLGA 4OPJA 4ILJA 1S1XA 3NMUA 3LDNA 1N36K 2GX9A 4EIAA 1IBLK 1V4SA 4NXNK 3I33A 3DRSA 2J4RA 2P9IB 4FLYA 3A8YA 4CZJA 3EE9A 3AO4A 1RBVA 4DSJA 5SWMA 3V6DA 2OTLN 3CJBA 1B9FA 4U67L 2IC3A 4CE9A 2QKBA 3C65A 2YKMA 3CMEN 1UA0A 4KKOA 4NYNA 3ZT4A 3VPZA 4N76A 4GW6A 4DKWA 3C6TA 3PX6A 1Q9YA 2NUBA 4B3RK 1NOZA 4CZGA 4KTQA 2NRWA 3O1WA 1VSKA 4PKGA 1HQUA 5AJ3K 2PAVA 4B3OA 1HNXK 3HO1A 1EXQA 2E88A 3AAQA 1ASVA 2ZGYA 3CCQN 4BE0A 1VQ8N 4CBWA 4GV3A 4PKHA 1QS4A 2IVPA 4BRPA 4C23A 3CJAA 3MEGA 5AQOA 4CIEA 4FPBA 4KHNA 1O13A 1ZXOA 2PBDA 3NF9A 4Q5VA 1TVRA 3FR0A 4DF8A 3NF6A 1HKGA 3O4WA 1YI2N 4CEFA 3SUNA 1HX1A 1DGKN 4WFNL 4HTLA 4BQZA 2P9PA 5AFUH 3SNNA 3QBWA 3LP2A 1KVCA 4OX9K 3N4QA 4FWPA 4TSXA 4BY9C 4KFBA 1IBMK 4JI5K 3KK1A 1L5UA 4IEIA 3OYJA 4IJAA 2ASMA 4BRAA 4DUZK 4RW9A 2FSKA 4BWJA 3DRRA 4CZLA 3CCJN 3AVKA 4EFHA 3O5BA 4KH4A 1XMQK 3HOTA 3VA0A 5JLHA 3CHWA 1FJGK 4JAXA 3M3ZA 1TK5A 5AQVA 3G10A 5DK5A 1TKTA 2F96A 1ATSA 3VF6A 4DQQA 2QTDA 4IOXA 3B8AX 1LAWA 1GLJO 1RT7A 4CEQA 4K25A 4Z4GA 3G0ZA 4KHPK 1RDUA 2GWJA 1KTQA 4JK9A 4ELTA 4KB0A 4B1YB 2QWMA 1NK5A 2D5RA 5JMVA 3AVJA 2OPRA 2F4VK 2D0OA 2YHYA 5HROA 1BUPA 2E8AA 2FF6A 4OLBA 1KCFA 4CF0A 3QO9A 1VQ7N 5AQFA 2BTFA 1L3VA 3NH2A 4FYDA 4FOIA 4I9LA 3ITHA 2HHHK 2HF4A 1WSJA 2JLEA 4A2BA 3J80O 1BQMA 3CCEN 2GV9A 2E20A 4O8KA 4B9LA 2ZJPL 4LSNA 5LY3A 5SZTA 2HHXA 3AVLA 2YHWA 3OYGA 3HPGA 4BVOA 3OS2A 3NVKA 3IFRA 2Q0RA 4CHYA 3KZBA 3BZCA 3IG1A 1XQSC 1MDUB 2VCPA 1EWRA 4X66K 4DTUA 3FZFA 3NGZA 1IBKK 1VQ5N 3OS0A 2VQFK 2H3GX 3QINA 4A61A 5GIOA 2F8TA 1OH5A 4BR2A 3GOIA 3ZSRA 3ZSOA 4B3MK 3TTFA 4YDUA 1FW6A 2EX3A 2YNGA 3A5LC 3CF5L 3DOKA 3KTQA 2AP1A 2QK9A 3CQ8A 1LOTB 4WQ5A 3OYKA 3LM2A 3MX2A 3UKRB 5JICA 3FLCO 3QERA 4C8OA 5JS2A 4JKCA 3WXJA 4BC5A 3V1QA 4CFCA 3VENA 4CZMA 2Q31A 1TYQA 3C0BA 5KGXA 3TPQA 3N4PA 2O8CA 3H6EA 3I0RA 1DEJA 3DXKA 4BRQA 3KK3A 4CJFA 5KRSA 3G71N 4DG1A 1ZBUA 3O9UA 4BACA 1S72N 5FPMA 4FXDA 1Q8IA 4JK7A 3HM9A 4JD2B 5EOYA 3CETA 3TI0A 3TSQA 1RFQA 2E6MA 4JKGA 2E4LA 1TUUA 4FJGA 1TL1A 3HK2A 4CECA 3O80A 3UE5A 3AVCA 1VQKN 2W6LA 5CYMA 2F9TA 3ZSZA 4J8FA 3O3GA 5F0XA 2ATQA 4FJNA 3CQXA 5BR9A 4C1NI 4A62A 4NCAA 1WNSA 2D0CA 1VSJA 5FPEA 3OHRA 3V9WA 4GKKK 4M3YA 3CYMA 3WEEA 3CFOA 4AM6A 1F21A 3CC4N 3BDPA 5BPMA 1S1UA 3E9PA 4DR4K 4FWRA 3TARA 2O8DA 1ZBHA 5H1SQ 1NU0A 2YCHA 4KBOA 2A3ZA 1QTMA 2KQ2A 1WSIA 3BZKA 4Z94A 1MWKA 5EXWA 2OPPA 3ZSVA 1BI4B 1QSYA 2FSNA 4FLUA 5AZIB 3B6OA 2XRIA 2YNFA 1RTDA 4Q0BA 5HP1A 3ZETB 4DSIA 3VA3A 2A1SA 5D3GA 1RTHA 4UQGA 3THYB 3DLHA 1SS6A 3TAPA 1Z05A 3KJVA 4KTWA 1ZC6A 4W5TA 4BRNA 3K5NA 1T03A 3NHGA 3FFIA 1TAQA 4YOTA 1EQYA 3SK3A 3CI5A 1B92A 1JKHA 2X78A 4EZ9A 1QZ5A 2Q1NA 4HUFA 3AA4A 1OH7A 2OPSA 2RKIA 4A5AA 4DV3K 4CJ5A 3SI6A 2QWQA 3Q7BA 4CVNE 4AH9A 1N5YA 2IVNA 1NG9A 4BRMA 3K59A 3QNOA 1ITGA 1VSIA 3IDHA 4GVMA 2UYTA 1T6DA 4O55A 5E26A 5AQTA 4Z4IA 3MN9A 3CIPA 2G8FA 4B08A 4R79A 3PSIA 1DKGD 2V51B 3E1YA 1T44A 3T7ZA 5M1FA 4PUOA 4IXCA 3OBWA 2FBVA 5CHIA 4FVUA 1H1VA 4E7LA 3SV4A 5C2DA 1IO2A 3EL2A 4B9QA 1J5EK 1YJ9N 1RBSA 3CCUN 3PIOL 4M42A 1ATRA 4CBXA 4O5FA 3JYTA 4DTMA 4E3SA 4MO5A 1QQOA 3KLHA 3U9ZA 1BIZA 4H0YB 3VQEA 3TAQA 4AHSA 4DS5A 2G8WA 2WOMA 4OKEA 3T3FA 1K8AO 2O8BA 4OPKA 4H4OA 3OYAA 1FKPA 2KFNA 4FM2A 5C24A 2YHAA 4ISGA 4GKJK 4IO9L 2W42A 5BRFA 4CGHA 4Z4EA 1DT9A 2YHXA 5AQRA 1J53A 5KRTA 1MWMA 5KPZA 4ZTJA 4C8LA 4N47A 3V1RA 4HCBA 1U47A 3ISNC 4M41A 3DLLL 4JI3K 4E7KA 1KXPA 2GUPA 3MEDA 5TKYA 4DV2K 4CD1A 4BREA 2Z1JA 4JI6K 4M3UA 3THXB 1U04A 3HOSA 4MDBA 4RW8A 2ZGZA 1JXEA 2VGNA 2P9UA 4CFAA 3QEVA 3NBPA 4DV7K 3VQ6A 1VQNN 2D0BA 2Z1HA 1DTQA 3OYLA 1LWFA 1RTJA 3VEZA 4JI2K 4AHTA 4ICLA 4BGAA 4KHYA 3LAMA 2YI1A 4H0PA 3SUQA 4WE1A 2HBKA 4CJ4A 3O6WA 3WQUA 1U45A 3WT0A 1NK8A 3F73A 4CJ7A 3AO3A 3AARA 1BGXT 2KKZA 4JKHA 4M7XA 2ASPA 4IO8A 1S1VA 2ZD1A 3OBYA 2OZSA 4KHSA 1HNWK 2ITMA 3DAWA 4LF7K 1JXBA 5EY4A 1C6VA 3HT3A 1QSLA 4BE1A 4FO0A 1YXQA 2NRVA 1VSHA 4FWOA 2O8EB 2ZM6K 3FGUA 4AM7A 4MFBA 1NMDA 1ESVA 4K41A 1RILA 3DJCA 4E0DA 4CEZA 2D0PA 5FRMA 1GLCG 3CG7A 3VGMA 4OGEA 1HMVA 3DXMB 3DMJA 3IMXA 2HHUA 1HYZA 3IS9A 1C0UA 1TK0A 4O4GA 4AQYK 1RT2A 4V19S 3NF7A 3NF8A 3FZKA 3A0IX 3EO3A 2HBJA 4W5RA 3F9MA 3W0LA 4F9OA 4DR1K 2XO7A 3LDQA 4EP4A 1RDCA 1JCGA 4O0IA 1HUXA 4KI6A 3PV8A 3THWA 4DR2K 4BG8A 3VEWA 3IKMA 1HQEA 1LCUA 4AF1A 4EP5A 5KPTA 3L4QA 4DV4K 2QWPA 3K5MA 1QQCA 1ASWA 4W5OA 5HBMA 4LF4K 2XY5A 4FJJA 3C7NA 4FL9A 5F1XA 4XEIA 3KIOA 3U9DA 2VWBA 4DS4A 3ZEUA 3VQPA 4DQPA 1K9MO 3SAFA 3L2WA 4BGBA 2HNZA 3TTCA 1N34K 1HJRA 5FPDA 1U2VA 4CW7B 4JI0K 1QHTA 1WN7A 4J2BA 5JVHL 4JRPA 3M1FA 4QS7A 4M3WA 3J7YP 1NWKA 3LDPA 4Y1CA 3U6FA 3MXMA 1BDGA 1BCMA 1S1TA 1YTAA 5AQNA 5EX5A 1T7PA 5AQJA 2F8SA 3D2EA 4K42A 3CXCM 4DR5K 1S22A 4DTXA 4E7JA 3F5TA 4H5VA 3FFKB 4ILGB 1SQKA 4DV0K 2IOCA 2KFZA 1E4FT 3V4IA 3VMFB 2HSTA 1JLEA 3Q7CA 1S9GA 4CBUA 3VQAA 3IAYA 2QWOA 2QXFA 3HSTB 4OPAA 3O3HA 1SKRA 2OCEA 1QE1A 3DLRA 1U6ZA 4RW7A 4CEDA 4DTRA 4XIUA 2EHGA 3HL8A 4YFUA 1UAXA 5LMUK 4OJRA 3T1HK 2X6NA 3VEOA 3PX4A 3G6EN 5BN9A 5M1QA 2HMPA 3ENHA 3ZX3A 1TAUA 3K58A 2Y1JA 1TYQB 1RCHA 3NFAA 1SKWA 4FZZA 3CM6A 3DXKB 1CZ9A 4IOCL 1BQNA 1RDWX 1YF5L 3GG4A 4WFAL 1SAZA 1NKBA 4FWSA 2Q3SA 3BP8A 4JKGB 2IGIA 3P1GA 1NGDA 4MDAA 5AQUA 3RMCA 5C12A 3TAMA 4BROA 2GWKA 3LWMA 1YJNN 2RE2A 4KTZA 5HRSA 3CPWM 1LW0A 1N32K 1XWLA 3DLGA 4IBNA 3NE6A 1I94K 4O44A 1S5JA 1TKDA 2O8FA 4HUGA 1XI1A 1RT3A 1VQLN 3S3NA 3DYAA 4H5RA 3ALYA 1NGIA 3S41A 1LWEA 2UUAK 5M1OA 3WEEB 4IDKA 3VQ7A 4NCBA 4O5BA 2KZMA 5AQYA 2QXLA 3H3NO 3WQTA 2O8DB 2IS3A 1LW2A 3L2QA 3OYIA 2OPQA 1E3MA 1QSSA 2JGUA 3GL1A 4JI8K 4FK0A 4BRLA 1RT5A 1GOCA 2P9KB 1I39A 2UU9K 3QEXA 4DQRA 2I5JA 2IVOA 3TABA 3C6HA 4KV8A 2VWKA 2PYLA 1SL0A 3ZT2A 3GDQA 3VTHA 1JLCA 5HLFA 2QI2A 4HTUA 4DSLA 1P90A 5FRNA 3DM2A 3SQ2A 3MN6A 5FLXO 1OVYA 2E2NA 2Q0UA 2FSJA 4QAGA 5ADXH 2VWJA 4B9NA 1CZAN 3DRPA 1IH7A 1QZ6A 4AHCA 5AQHA 4K43A 4I7FA 4DR6K 3MCAB 1VQ4N 1NK9A 1NJZA 2HVIA 4CFBA 1Z26A 1ZBIA 2HNYA 3DOLA 2F9WA 4BRDA 4KAZA 2NRZA 3P83D 1NJWA 4NCGA 3JAMO 1ZBLA 3RSEA 1FK9A 3P5JA 4KHUA 3ZT0A 1Q18A 1WBBA 3CCSN 2NRXA 4CZHA 1D5AA 5BRDA 3TAEA 3LDOA 3C6UA 3D7EO 3HM8A 3PIPL 1X1PA 1GOBA 2V7ZA 1KLMA 4FLZA 2QW9A 3C94A 3ID6A 3VQ8A 1CXQA 4IFYA 3TTDA 3IUCA 3O4NA 4W5QA 4B9MA 3L0QA 2RN2A 3AGKA 3U3YA 5AQSA 2KLAA 2HVHA 2V52B 3L6QA 3O8MA 3KK7A 1HRHA 5CY4A 4CF1A 4O8UA 2WUSA 3OA9A 1IKXA 3QESA 4BRKA 2O8BB 4N41A 3F9KA 4F2SA 3W3DA 1ATNA 4Z0UA 4FJMA 4DU1A 3D2FA 1VHXA 4B1ZA 4O0JA 2HB5A 3HZ6A 2E6LA 3HVTA 4YOWA 2UXCK 4CJEA 1RDBA 3AO2A 3K5LA 3SAHA 3MECA 1K8KA 5AQGA 1JLBA 3GBTA 2DFFA 4YOYA 2Q2RA 3C95A 4X62K 3OTOK 3AVMA 3S3MA 1HYVA 2YJEA 3LWLA 3WXIA 1XNQK 1T6CA 2Q97A 3UIQA 3TAGA 3O9TA 4M3TA 4N56A 2XY6A 3I8DA 1JCEA 5CR4A 3ENOA 5J2PA 4GV9A 3U8XA 3OYNA 1IKYA 1HNVA 4DFKA 3L3VA 3NH0A 3P4IA 5C15A 4K8ZA 4FZXC 1OH6A 1RBTA 5M1PA 4MO4A 1KLNA 1HPMA 4RG8A 3VEYA 2BGGA 1R0AA 2BE2A 3ZX0A 4EZ6A 3O9QA 4HHTA 1K73O 4JLHA 4RWTA 4JHDB 3M8QA 5TKWA 4CJ3A 4DV1K 1QQMA 1J54A 1IV0A 4FM1A 4CHNA 4LC9B 1IJJA 5MLCQ 3ZSQA 1KAYA 1NKCA 4HVJA 4CHOA 3ZSWA 4H03B 3QBXA 3VGKA 3E01A 1JLQA 3R3LA 3CQYA 4KI4A 3CFRA 4IDHA 4LH5A 5AQXA 3SJJA 1EWQA 4CESA 4EHTA 5JS1A 2YX6A 1A5VA 5J2MA 5C42A 4CJQA 3C6AA 1YVNA 4FOEA 2E1ZA 1W7AA 1CLQA 3VQQA 1S6QA 2ZJQL 1YJWN 3E66A 2DFHA 1HLUA 1ILYA 4I6MA 4M63C 3VQBA 1G15A 2E2PA 3M8RA 4QCLA 1X9SA 1D8YA 2FLOA 4C1NK 1BO5O 5HOOA 4BWMA 3H46O 5DM7L 1EETA 4MLEA 5AQZA 4JNEA 4DHYA 4BR0A 1NNEA 2NLXA 1GLBG 1M90O 3VEXA 4FWQA 1VSLA 4J2EA 3MXJA 3H3OB 3EZWA 3RRHA 3RMBA 2D0AA 4GNIA 4IFVA 3THWB 5E41A 5I3UA 3SBGA 4FW2A 2ETJA 2AA4A 3A2FA 2A5XA 4KB1A 2IDOA 4FWKA 5GADP 1GLEG 3SCXA 4DCHA 1XHXA 2P9NA 3KLIA 2YKNA 2Z1IA 2YNIA 3TAFA 4JYAK 3EEQA 3QEWA 3SZ2A 3MN7A 4JKAA 3ZEUB 5GAHP 4BR9A 2VG5A 4X65K 1Z6RA 3PY8A 3KLEA 3CCLN 1N8RO 1JLFA 5J2NA 1C1AA 4M3ZA 4FJ9A 4IZ9A 1NK4A 3LM9A 4PY5A 5HRNA 3NH1A 1BA0A 2OZMA 2NNWA 4B3SK 2WONA 3NGIA 3RR7A 3OYHA 4M45A 4B1VA 1NGBA 2Y1IA 3K2PA 5I9EB 2CGKA 1X3NA 3ZYYX 4QS8A 2FBYA 4BVPA 3QETA 4CF2A 3KWGA 1S1WA 3VQCA 4U7BA 1TK8A 2E2OA 4C8KA 2P9SA 5DM6L 3SPZA 4FPAA 4CFDA 3LZJA 5CZ2A 2E1YA 1WLJA 3H1QA 4DTPA 3NGYA 2R7YA 2P9LA 4IKFA 1WSEA 3AVFA 1KRPA 4FLVA 4BRCA 3U4LA 3L2RA 1J5OA 4YY3K 3OJUA 4RTFD 2FXUA 3CJ7A 5AQMA 4DQIA 4AHVA 3K0SA 4CJLA 4Z4FA 3EKSA 4CGGA 2OA8A 1OH8A 3KLGA 2PY5A 3SLCA 4DLEA 1VAZA 1A5WA 1K6YA 4BDZA 3OW2M 4FWMA 2W6KA 4A2AA
chains in the Genus database with same CATH topology
4FOIA 4E1JA 3ATVA 3Q7CA 3AGRA 2ZF5O 3QB0A 4XH5A 4BC2A 2QWOA 4CBUA 3G25A 4OPAA 2HF4A 4A2BA 2A6AA 1U6ZA 3JS6A 4IJNA 1YHQN 3CCEN 2E20A 4NLBA 4O8KA 2ZJPL 1XUPO 1KAXA 2E2QA 5LY3A 2W41A 2W40A 1BG3A 2YHWA 1Q7YO 3HI0A 4M7YA 3BF3A 4BVOA 3VEOA 3ULEB 3G6EN 3NVKA 5BN9A 3IFRA 4NLCA 2HMPA 2Q0RA 5M1QA 4A57A 3ENHA 3KZBA 3ZX3A 4NO7A 1XQSC 3MK6A 1MDUB 4PHTX 5BPLA 4HWIA 1TYQB 2VCPA 3HTVA 2P9PB 4FSVA 3FZFA 3CJ9A 1HJOA 5AZIA 3BF1A 2WFBA 1X9JA 4WCEL 2KHOA 1VQ5N 3VF4A 3DXKB 1E4FT 4QS9A 4IOCL 2PFUA 1RDWX 1YF5L 4PL7A 2H3GX 3GG4A 4A61A 5GIOA 1R59O 4WFAL 1X3MA 1SAZA 1QQNA 4RCHA 4FWSA 4BR2A 3GOIA 3BP8A 1KC8O 3TTFA 4JKGB 4YDUA 5E84A 1NGDA 3A5LC 2YJFA 4MDAA 5AQUA 2AP1A 3C7NB 3NVMA 1LOTB 3I56N 2NRTA 4WQ5A 5C12A 3LM2A 3MX2A 2A41A 3UKRB 3FLCO 5JICA 4JKCA 2GWKA 1Y64A 3WXJA 2A42A 4KH6A 4BC5A 4BG9A 4BROA 1YJNN 1VQMN 2RE2A 3ULEA 4DB3A 3O9RA 4JN4A 3CPWM 1E4GT 3MDQA 3VENA 4CZIA 4CZMA 3CD6N 2VYPA 5AR0A 1HKBA 4MLHA 2Q31A 3LDLA 1TYQA 3C0BA 3TPQA 3O9SA 3R9PA 1U2VB 3N4PA 3H6EA 3KHYA 4ILHA 3WXKA 2ZJRL 3MMVA 1YAGA 3SMSA 1VQLN 1DEJA 3DXKA 2GTDA 4BRQA 3H45C 3G71N 4H5RA 3S41A 1NGIA 3CMAN 3EN9A 1W2BM 3MN5A 3O9UA 3ZX2A 4YOUA 1S72N 5C0YA 3HBTA 5M1OA 5FPMA 4Y0WA 1OKJA 3LL3A 4JK7A 3WEEB 4BRIA 4GY2B 4JD2B 2QWLA 5EOYA 3CETA 3VERA 3TSQA 1RFQA 5AFUA 4JKGA 5AQYA 1TUUA 3D2EB 2QXLA 3K9KA 3H3NO 3WQTA 3O80A 1C0GA 3UKRA 5GINA 3MWPA 5EVZA 4YOXA 3GL1A 3UE5A 5BRHA 4BRLA 2HBLA 4IWVA 1VQKN 2QWNA 2F9TA 4G9ZA 2P9KB 3DWLA 4J8FA 3FE1A 5F0XA 2IVOA 3CC2N 3C6HA 3CQXA 4H5WA 3P39A 5BR9A 4IOAL 1JCFA 4C1NI 3GDQA 3VTHA 4PKIA 3RSEB 4A62A 3CJ1A 1P8ZA 5FPEA 3QFPA 4ISFA 2QI2A 3OHRA 3UKUB 1RGIA 1P90A 3I8BA 2GELA 3WEEA 4JD2A 3SMPA 4AM6A 3CC4N 5BPMA 3E9PA 4WQ4C 4H0OA 3MN6A 3A5OC 4FWRA 3MCPA 2VGMA 1OVYA 1WUAA 2E2NA 2FSJA 2Q0UA 5ADXH 1CZAN 4L3QA 2YCHA 5H1SQ 3E9LA 2A3ZA 4KBOA 1W97L 1QZ6A 4KH5A 5AQKA 4Z94A 1MWKA 4K43A 5AQHA 5EXWA 3MCAB 3P31A 1VQ4N 4CD3A 3HSCA 3CJCA 5F2RA 5GAGP 2FSNA 5AQLA 5AZIB 3T69A 1GLFO 3BUZB 3ID8A 1XC3A 4BR4A 5LJWA 4B1XB 5ADXA 2F9WA 4BRDA 5CE3A 3ZETB 1VQPN 5ELZA 4FWLA 2NRZA 2QA4N 4EAHD 1BA1A 2HBMA 1SS6A 1Z05A 3RSEA 1YUWA 1QVFM 1ZC6A 2JWLA 1J6ZA 4BRNA 1Q18A 5LJVA 4H5TA 5FPNA 5AQPA 3UKUA 3CCSN 4YOTA 2NRXA 1EQYA 4CZHA 5BRDA 3SK3A 1JJ2M 3LDOA 2FF3B 3J8AA 3D7EO 3HM8A 3VOVA 3CI5A 5C2FA 3D2FB 4JHDA 3PIPL 1GLLO 1QZ5A 4A59A 2Q1NA 3F2KA 4BC4A 1QHAA 3WXMB 4CZFA 3AAPA 2V7ZA 4DQ8A 4WFBL 2QW9A 3A5NC 4A5BA 3ID6A 3R6MA 3IUCA 3TTDA 3H1VX 4A5AA 1NJIO 3L0QA 3AGKA 2QWQA 3Q7BA 5AQSA 1BOTO 2KLAA 3BEXA 3MWTA 2V52B 3L6QA 3O8MA 2Q36A 3KK7A 3ZETA 2IVNA 1G99A 4O8UA 1K8KB 4BRMA 3TSPA 3AY9A 2NRHA 2WUSA 4GVEA 3IDHA 2V7YA 3OA9A 3O08A 4WQ4A 2UYTA 1T6DA 4BRKA 5E26A 5AQTA 3MN9A 3CIPA 3P38A 3W3DA 1ATNA 4R79A 3CC7N 3JXUA 3CCMN 1DKGD 3CCVN 2V51B 1EO1A 3E1YA 1T44A 3T7ZA 4BRGA 2OANA 5M1FA 1C0FA 3D2FA 2CGJA 4IXCA 3TSUA 3EKUA 3WUHA 3OBWA 5CHIA 4B1ZA 4FVUA 1H1VA 4WF9L 3HZ6A 5C2DA 4YOWA 3EL2A 4B9QA 1YJ9N 3K9JA 3CCUN 2GEMA 3PIOL 5M1KA 1ATRA 1TUYA 4CBXA 4O5FA 2CH5A 1NGGA 3QMLA 1NGJA 1Q81O 3KWIA 1NGFA 4CI6A 4MO5A 1QQOA 2QM1A 4IFEA 3SAHA 3U9ZA 1SZ2A 1K8KA 5AQGA 4JK8A 3UB5A 3GBTA 4H0YB 4YOYA 3CF5L 2Q2RA 3VF2A 4BC3A 3SAGA 4IEEA 4EHUA 2YJEA 1K8AO 2QEXN 2I7PA 3WXIA 2ZWHA 3FZHA 1T6CA 2Q97A 3E9OA 3O9TA 3KVGA 2BUPA 4ISGA 4B1WB 1T3VA 2JWKA 4OPHA 4H5NA 4JKDA 4IO9L 2WC9A 1JCEA 5BRFA 1DT9A 2YHXA 3M6GA 5CR4A 3RVCA 2OTJN 3ENOA 4JKEA 5AQRA 4GV9A 1MWMA 1WOQA 3U8XA 5KPZA 3DXMA 3A5MC 3CCRN 2IIRA 3P4IA 5C15A 4WYBA 2A40A 3FZMA 5BPNA 3ATUA 3DLLL 1KXPA 2GUPA 3FZLA 4PL8A 4XH4A 5M1PA 1BU6O 4MO4A 5TKYA 1HPMA 4BREA 3VEYA 4CD1A 4BRFA 2RHKA 2D4WA 4BRHA 3ZX0A 3HOSA 4CZKA 3O9QA 3SBTA 5GAEP 4MDBA 1K73O 1M1KO 4RWTA 1ZBSA 1VQON 1NGHA 4JHDB 2ZGZA 5TKWA 2VGNA 1QQMA 5AZJB 2P9UA 3CPEA 5KPRA 3G4SN 1BWFO 4LC9B 3PLAA 1IJJA 4I6MB 5MLCQ 4FWNA 1KAYA 1NGEA 5C10A 1VQNN 3WXLA 1V4TA 4BR7A 3EE8A 4H03B 3QBXA 4H0VB 3L4IA 3VGKA 3QFUA 4UY8O 3M5RA 3VEZA 3R3LA 4JKFA 3CQYA 4BGAA 3GE1A 1NBWA 1GLAG 4IDHA 2YI1A 5AQXA 4H0PA 1VQ6N 5HL7L 4ISEA 4EHTA 4ILJA 2HBKA 5AQQA 2YX6A 3NMUA 3D6RA 3O6WA 3LDNA 3WQUA 3VGLA 3WT0A 2EWSA 4CJ7A 2GX9A 3C6AA 4EIAA 1YVNA 3AARA 3R1XA 4FOEA 2E1ZA 2KKZA 2F7TA 4JKHA 1V4SA 2ASPA 4M7XA 1KD1O 4IO8A 3I33A 2J4RA 1NLVA 5AZJA 2P9IB 3A8YA 3OBYA 4CZJA 2ZJQL 3EE9A 1YJWN 3E66A 4XH1A 1HLUA 1ILYA 4I6MA 2OTLN 3CJBA 4M63C 4H0TB 2ITMA 2NRRA 3QDKA 2E2PA 4U67L 2ASOA 4YOVA 1HKCA 3C65A 5GIPA 3DAWA 1NGCA 4B1UB 2D1KA 2P9NB 5KQ8A 2FLOA 2HOEA 4C1NK 1BO5O 3CMEN 5EY4A 5HOOA 1QVGM 3VPZA 3H46O 5DM7L 4DKWA 4MLEA 5AQZA 4BQLA 4GV6A 4JNEA 4FO0A 4DHYA 4BR0A 2NLXA 1YXQA 1GLBG 4CZGA 2NRVA 3VEXA 1M90O 2NRWA 4FWQA 4FWOA 3O1WA 2NZTA 3H3OB 4PKGA 5M1NA 3EZWA 4GNIA 3FGUA 3R8EA 5B8HA 4AM7A 2PAVA 3QICA 1NMDA 1YITN 2E88A 1ESVA 4K41A 3DJCA 2HF3A 3SBGA 3SJHA 3AAQA 2D0PA 2AA4A 2P9IA 2ZGYA 2A5XA 3CCQN 4FWKA 1GLCG 3VGMA 1VQ8N 5GADP 1GLEG 3DXMB 5AQWA 4CBWA 4GV3A 4PKHA 2IVPA 4BRPA 4DCHA 4C23A 3IMXA 1D4XA 3CJAA 1VQ9N 2P9NA 5AQOA 4FPBA 1O13A 1ZXOA 2PBDA 3I55N 3MN7A 4CZEA 3FR0A 4JKAA 3ZEUB 2WBNA 5AQIA 2P9SB 1HKGA 4BR9A 3O4WA 5GAHP 1YI2N 3CERA 4H0XB 1HX1A 1S3XA 3FZKA 1Z6RA 1DGKN 2HBJA 3A0IX 3EO3A 3VESA 3VEVA 4WFNL 4HTLA 3F9MA 3VETA 3W0LA 4F9OA 4BQZA 3CCLN 1N8RO 5KQDA 2P9PA 1YIJN 3LDQA 5AFUH 3VMFB 3QBWA 1JCGA 2P9UB 1KQSM 4OO1J 1HUXA 4IZ9A 3N4QA 2P9LB 3LM9A 1BA0A 4FWPA 4BG8A 3VEWA 3IKMA 4AF1A 1LCUA 4BY9C 2CH6A 2NNWA 5KPTA 3L4QA 2QWPA 4IEIA 4IJAA 4B1VA 2ASMA 4BRAA 1NGBA 5I9EB 1MA9B 2CGKA 1X3NA 3ZYYX 2FSKA 4QS8A 4BVPA 3C7NA 4CZLA 3CCJN 4FL9A 5F1XA 5BN8A 4XEIA 1KAZA 4EFHA 1NM1A 3O5BA 4KH4A 4YORA 3KWGA 3HOTA 3U9DA 2VWBA 5JLHA 4U7BA 3CHWA 2E2OA 3ZEUA 4JAXA 2P9SA 5JLFA 3M3ZA 3MX5A 5AQVA 5DM6L 1K9MO 4FPAA 3SAFA 1ATSA 2I7NA 4BGBA 2DPNA 3VF6A 3TTCA 2QTDA 3ENBA 3B8AX 4IOXA 4NB4A 5BREA 1GLJO 5FPDA 1U2VA 2E1YA 2QWRA 1Q82O 3H1QA 4K25A 3HRGA 2P9LA 1Q86O 5JVHL 3M1FA 4QS7A 1RDUA 2GWJA 4JK9A 4BRCA 1NGAA 1NWKA 3LDPA 3U4LA 2BH1A 2QWMA 4B1YB 1BDGA 5AQNA 5EX5A 3TU5A 3J7ZO 5AQJA 5JMVA 4RTFD 2FXUA 3O1BA 4JKBA 4YDUC 1IG8A 3D2EA 4K42A 3CXCM 3CJ7A 5AQMA 5JVGL 4JEPA 2D0OA 2YHYA 4WQ5C 3EKSA 1BUPA 2E8AA 2FF6A 1S22A 2CGLA 3F5TA 3SLCA 4BR5A 4H5VA 3FFKB 4ILGB 1VQ7N 1SQKA 1VAZA 5AQFA 2BTFA 3VTIA 4FWMA 1GLDG 3OW2M 4A2AA 2P9KA 2HSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPE A;  4IFE A;  5C2F A;  5M1K A;  4IEE A;  3C6H A;  4IEI A;  5M1O A;  5M1Q A;  4IDH A;  3C6A A;  5M1P A;  5M1N A;  5C12 A;  5M1F A;  5C15 A;  5C10 A;  5C2D A; 
#chains in the Genus database with same CATH topology
 2HHT A;  3QB0 A;  3AGR A;  4XH5 A;  4BC2 A;  3ZSX A;  2A6A A;  4KHQ A;  3JS6 A;  4BDP A;  4OKJ A;  4FJK A;  5LL6 Z;  4NLB A;  1OVQ A;  4BE2 A;  2E2Q A;  1SL2 A;  2W41 A;  2W40 A;  1BG3 A;  3HI0 A;  3DLB A;  1L3S A;  3BF3 A;  3S9H A;  3QLH A;  2KW4 A;  4K0K K;  4A57 A;  3EY1 A;  1KSP A;  4NO7 A;  3MK6 A;  5BPL A;  3KKR A;  2P9P B;  4FSV A;  3LAN A;  5AZI A;  2O8F B;  3BF1 A;  2WFB A;  1X9J A;  4WCE L;  2KHO A;  1U49 A;  1J9A A;  3OYE A;  2G8H A;  2ITG A;  1R59 O;  1VSE A;  1JLG A;  4M3X A;  4HCC A;  3THY A;  4RCH A;  2UUB K;  4KHW A;  3HVR A;  1YTU A;  3NVM A;  4YHH K;  2A41 A;  1NOY A;  4LFA K;  4KH6 A;  4E19 A;  1A5X A;  3ULE A;  3MXI A;  4PQU A;  3VQ4 A;  1E4G T;  3MDQ A;  4CZI A;  4CJT A;  1C0T A;  5AR0 A;  1HKB A;  1XMO K;  3TAN A;  3O9S A;  1O1W A;  1RTI A;  3WXK A;  3MMV A;  1YAG A;  2GTD A;  2YNH A;  1W2B M;  3EN9 A;  3RRG A;  5J1E A;  3ZX2 A;  3HBT A;  4Y0W A;  1OKJ A;  4BRI A;  4CEB A;  1D9D A;  4GY2 B;  1BIU A;  2QWL A;  1Y97 A;  1S6P A;  3WNF A;  4FJ7 A;  3AA2 A;  3K9K A;  3ZT3 A;  1IKV A;  1WAF A;  3SV3 A;  3V81 A;  4HUE A;  1UWB A;  2ZQB A;  2BAN A;  5GIN A;  1NMN A;  4YOX A;  5BRH A;  3EZ5 A;  3VQ5 A;  4IWV A;  3OVN A;  3AO1 A;  2QWN A;  2BDP A;  3ZLJ A;  3MEE A;  2QKK A;  2UUC K;  2X6S A;  4G9Z A;  4FLX A;  4NYF A;  4QOZ B;  1FKO A;  1HNZ K;  3FE1 A;  4H5W A;  3P39 A;  3O3F A;  3RSE B;  3NCI A;  3CJ1 A;  1P8Z A;  3QFP A;  4ISF A;  1W0H A;  4CK2 A;  4JRQ A;  2HMI A;  1RGI A;  2GEL A;  2HHV A;  3SMP A;  4WQ4 C;  1TKZ A;  1XHZ A;  3NDK A;  3MCP A;  2VGM A;  1WUA A;  3KD5 E;  4L3Q A;  3E9L A;  1W97 L;  3OS1 A;  3P31 A;  4E7H A;  3CJC A;  5GAG P;  4I2P A;  4RW6 A;  5AQL A;  1GLF O;  1XC3 A;  4BR4 A;  4LH4 A;  5LJW A;  3HPH A;  4FJH A;  3WNG A;  1VQP N;  4FWL A;  1BA1 A;  1Z25 A;  4JI1 K;  1SUQ A;  1YUW A;  3WNE A;  5HRP A;  4AIL C;  4DFM A;  4ZTF A;  1SL1 A;  2HHS A;  1RNH A;  3AA3 A;  5LJV A;  4FK4 A;  4H5T A;  1WSF A;  3LAK A;  5FPN A;  3AV9 A;  3UKU A;  1N6Q A;  2KZZ A;  3THX A;  3VOV A;  4CK1 A;  3D2F B;  5J2Q A;  3RWU A;  3PO4 A;  4JS4 A;  1QHA A;  3WXM B;  4CZF A;  1IKW A;  4WFB L;  3A5N C;  3HP9 A;  2FC0 A;  1L3U A;  2O8C B;  4B8A B;  3AVN A;  1NJI O;  3BEX A;  2Q36 A;  2VQE K;  1K8K B;  3TSP A;  3AY9 A;  4GVE A;  4KRF A;  4E7I A;  1RBR A;  2B6A A;  4F3T A;  1HPZ A;  2ZE2 A;  3P38 A;  1FXX A;  4FVM A;  3JXU A;  4LF8 K;  4LF9 K;  2PZS A;  1L3T A;  2OAN A;  3M8S A;  1C0F A;  2P5G A;  3EKU A;  3WUH A;  3L8B A;  4CEO A;  1VSD A;  3DI6 A;  2UXD K;  5IT9 O;  3OYD A;  3K9J A;  4L8R B;  4CGD A;  1NGG A;  1ZYQ A;  1HYS A;  1NGF A;  4CI6 A;  4FCY A;  2QM1 A;  4IFE A;  5KGW A;  2KTQ A;  1SZ2 A;  3U3G A;  3UB5 A;  4FLW A;  4BC3 A;  5BR8 K;  4IEE A;  4E1M A;  2ZWH A;  3FZH A;  3OYC A;  2O8E A;  3HXM A;  3KVG A;  4BDY A;  2BUP A;  1T3V A;  2JWK A;  4OPH A;  4JI4 K;  4JKD A;  1X9M A;  3KLF A;  3ZCM A;  3M6G A;  3LZI A;  3RVC A;  4JKE A;  3KK2 A;  4X64 K;  3VQD A;  4F4K A;  4FJX A;  4OGC A;  4ELU A;  1BHL A;  3DXM A;  2RF2 A;  3CCR N;  3SYZ A;  4CF8 A;  2A40 A;  3FZM A;  5BPN A;  1NJY A;  3ATU A;  1RBU A;  1RDD A;  4DTO A;  4XH4 A;  1BU6 O;  4CK3 A;  2WTU A;  2RHK A;  3LP3 A;  1KFD A;  4BRH A;  1LWC A;  4CZK A;  5GAE P;  3NAE A;  1M1K O;  1Q9X A;  3OY9 A;  1IG9 A;  3SPY A;  4CJW A;  3LPT A;  3G4S N;  1BWF O;  4I6M B;  3RTV A;  3QEI A;  1TGO A;  4BR7 A;  1DLO A;  3L4I A;  4B9U A;  1T05 A;  3QFU A;  4CJV A;  2HHW A;  1GLA G;  4Z4H A;  4DU3 A;  1VQ6 N;  5HL7 L;  4ISE A;  3TR8 A;  4CIF A;  5AQQ A;  5K14 A;  3V9U A;  5CZ1 A;  3D6R A;  4GMJ B;  3SQ4 A;  1NK0 A;  4CJU A;  3VGL A;  2Z1G A;  1JL1 A;  1D9F A;  2EWS A;  2XY8 A;  5T7B A;  1S9E A;  3R1X A;  2F7T A;  3PSF A;  1CXU A;  1KD1 O;  2G8V A;  2PYJ A;  1NLV A;  5AZJ A;  3K57 A;  3AVI A;  1VRT A;  2XHB A;  4FM0 A;  4XH1 A;  2RPI A;  2O4I A;  2OYQ A;  4K8X A;  1Q7Y O;  3QIO A;  4H0T B;  2NRR A;  3QDK A;  4YOV A;  4CCH A;  2ASO A;  1HKC A;  5GIP A;  1NGC A;  4B1U B;  2D1K A;  2P9N B;  5KQ8 A;  2HOE A;  4DU4 A;  1QVG M;  1RT4 A;  1XC9 A;  4B9V A;  1BIS A;  4AHU A;  3CFP A;  4I2Q A;  4BQL A;  4GV6 A;  3PUF A;  1WBD A;  3AA5 X;  2HW3 A;  1UOC A;  2NZT A;  5M1N A;  3SQ1 A;  3R8E A;  5B8H A;  1NK6 A;  3QIC A;  1YIT N;  5LMN K;  3SJH A;  2HF3 A;  3AO5 A;  2P9I A;  4Z4C A;  5AQW A;  1D4X A;  4IG0 A;  1VQ9 N;  4N5S A;  2P51 A;  1B9D A;  3H08 A;  3I55 N;  4CZE A;  2WBN A;  5AQI A;  2P9S B;  4R5P A;  3CER A;  4H0X B;  1S3X A;  3VES A;  3VEV A;  3CM5 A;  3VET A;  1CZB A;  4YNQ A;  5KQD A;  1YIJ N;  4ZHR A;  2P9U B;  1KQS M;  4OO1 J;  1C1B A;  2P9L B;  1JLA A;  3BY5 A;  2CH6 A;  1KVB A;  1VK0 A;  4CHQ A;  4Y1D A;  3KD1 E;  1MA9 B;  4CHZ A;  5BN8 A;  1KAZ A;  3L2U A;  1NM1 A;  4ID1 A;  4LY7 A;  4YOR A;  3M8P A;  1T8E A;  4CGI A;  5JLF A;  3MX5 A;  1LV5 A;  2I7N A;  2DPN A;  3LP1 A;  1XNR K;  4NB4 A;  3ENB A;  4E1N A;  2G8K A;  3PX0 A;  5BRE A;  2HND A;  3OYF A;  2QWR A;  1Q82 O;  4FLT A;  2G8U A;  3RR8 A;  3V9X A;  3HRG A;  1Q86 O;  1NGA A;  2BH1 A;  3O4Q A;  3QNN A;  1REV A;  3TU5 A;  3J7Z O;  4OLA A;  3O1B A;  4JKB A;  4YDU C;  1IG8 A;  5JVG L;  4PA1 A;  4OVL A;  1NKE A;  4JEP A;  4WQ5 C;  4CEE A;  3D45 A;  4LFB K;  3RMD A;  3MAQ A;  2CGL A;  3TWH A;  4BR5 A;  1VSF A;  1HNI A;  3VTI A;  1GLD G;  2P9K A;  4NXM K;  1VRU A;  4E1J A;  1N33 K;  3ATV A;  2DY4 A;  1ASU A;  2ZF5 O;  3G25 A;  4IJN A;  1YHQ N;  4W5N A;  1MU2 A;  5IWA K;  1LAV A;  1XUP O;  4DTN A;  1KAX A;  3VQ9 A;  5CYQ A;  3ULD A;  5KTQ A;  4M7Y A;  5KI6 A;  2GBZ A;  3PO5 A;  3ULE B;  4DSF A;  4NLC A;  5I42 A;  2X74 A;  3OJS A;  3V9S A;  4PHT X;  4HWI A;  1YT3 A;  3HTV A;  3J7A P;  3CJ9 A;  1HJO A;  4B8C A;  3VF4 A;  4QS9 A;  1EP4 A;  2PFU A;  4PL7 A;  3AVH A;  5A2Q O;  1X3M A;  1QQN A;  1BL3 A;  2IAJ A;  1VSM A;  1KC8 O;  4CEA A;  5E84 A;  3T19 A;  4CJP A;  3I56 N;  2YJF A;  3C7N B;  1WB9 A;  1JL2 A;  2NRT A;  3K5O A;  4DF4 A;  3LDS A;  1C1C A;  1Y64 A;  4CER A;  2A42 A;  1VQM N;  4BG9 A;  3DLE A;  3SUP A;  4DB3 A;  2P1J A;  3O9R A;  4DR3 K;  4JN4 A;  4DFP A;  3S3O A;  3OYB A;  2VYP A;  3CD6 N;  4MLH A;  3LDL A;  1I3A A;  2B5J A;  1YVU A;  3R9P A;  1U2V B;  4RW4 A;  3KHY A;  4ILH A;  2ZJR L;  3SMS A;  1WSH A;  4ID5 A;  2B4J A;  3H45 C;  3LAL A;  1NJX A;  5FDL A;  3CMA N;  3MN5 A;  4CJK A;  3OYM A;  4YOU A;  5C0Y A;  3AVG A;  2DTU A;  3LL3 A;  4DFJ A;  3VER A;  5AFU A;  3D2E B;  4DV5 K;  4AHR A;  1C0G A;  3UKR A;  2XY7 A;  3MWP A;  5EVZ A;  2HBL A;  3HJF A;  3RMA A;  1NK7 A;  3DWL A;  3J81 O;  1SV5 A;  2HHQ A;  2DFE A;  4IG3 A;  1WSG A;  3CC2 N;  4DQS A;  4KPY A;  4F8R A;  4IOA L;  1JCF A;  3VN5 A;  4H8K A;  4PKI A;  4DR7 K;  3KKS A;  3UKU B;  4DUY K;  4LD0 A;  3I8B A;  4JD2 A;  3DLK A;  4H0O A;  1RDA A;  3A5O C;  1RT6 A;  3AVB A;  3BGR A;  4CJR A;  4KH5 A;  5AQK A;  4CF9 A;  2P5O A;  4CD3 A;  3HSC A;  5F2R A;  4C8M A;  3T69 A;  3BUZ B;  3ID8 A;  4CGF A;  2A1R A;  2YV0 X;  4B1X B;  5ADX A;  1SKS A;  1TV6 A;  5CE3 A;  5ELZ A;  2QA4 N;  4JS5 A;  4EAH D;  2HBM A;  3ASM A;  1TL3 A;  1QVF M;  3LPU A;  4OKK A;  1W9H A;  2JWL A;  1J6Z A;  4ELV A;  4KRE A;  5AQP A;  4B9S A;  4FJI A;  4E89 A;  3V1O A;  3EYZ A;  4CJS A;  4JV5 K;  1JJ2 M;  2FF3 B;  3J8A A;  5C2F A;  4JHD A;  4PWD A;  1GLL O;  4A59 A;  3L2V A;  3F2K A;  4BC4 A;  4FK2 A;  3JSM A;  1HR0 K;  4LFC K;  3AAP A;  4DQ8 A;  4A5B A;  4CIG A;  1BI4 A;  3R6M A;  2AJQ A;  3SUO A;  1KVA A;  2VG6 A;  3H1V X;  1BOT O;  4DSE A;  2E5L K;  3MWT A;  1C0M A;  4KO0 A;  3ZET A;  4M3R A;  1G99 A;  2NRH A;  1TKX A;  5FRO A;  2V7Y A;  4C8N A;  3O08 A;  4WQ4 A;  1BCO A;  4LF5 K;  1U4B A;  3CC7 N;  3V9Z A;  3IRX A;  4DTJ A;  3CCM N;  1KFS A;  1EO1 A;  3QIP A;  3CCV N;  4J2A A;  1UA1 A;  4BRG A;  2CGJ A;  3TSU A;  4H4M A;  2UXB K;  1DTT A;  3HYF A;  4F3O A;  4WF9 L;  4FW1 A;  1GOA A;  4LF6 K;  2GEM A;  4B9T A;  5M1K A;  1TUY A;  4B3T K;  3HPO A;  2CH5 A;  3ZSY A;  3QML A;  1NGJ A;  1Q81 O;  3KWI A;  4FJL A;  2FBT A;  2GUI A;  4DSK A;  3LP0 A;  1RT1 A;  4JK8 A;  3THV A;  2LSN A;  3AVA A;  3VF2 A;  4DMN A;  3SAG A;  4EHU A;  4G1Q A;  2QEX N;  2I7P A;  5HRR A;  3T1A A;  4I9Q A;  1EKE A;  3E9O A;  3T1Y K;  3D0P A;  4B1W B;  4CHP A;  4H5N A;  2WC9 A;  4FZY A;  2OTJ N;  5DMR A;  4J2D A;  5EU7 A;  4F2R A;  1WOQ A;  2YHB A;  3SQ0 A;  3A5M C;  2IIR A;  4WYB A;  2FBX A;  3FZL A;  4PL8 A;  3ZT1 A;  5C25 A;  4BRF A;  1U48 A;  2D4W A;  4DWI A;  3I0S A;  2O4G A;  3SBT A;  4FJ5 A;  1ZBS A;  2G8I A;  1VQO N;  1NGH A;  5AZJ B;  3CPE A;  1EX4 A;  4LSL A;  5KPR A;  4DTS A;  3PLA A;  2VG7 A;  4MQ3 A;  4CGJ A;  4FWN A;  3HP6 A;  5C10 A;  1NGE A;  3WXL A;  1V4T A;  3B6P A;  1WAJ A;  3EE8 A;  1X9W A;  3WNH A;  4H0V B;  3QEP A;  4FJ8 A;  4UY8 O;  3M5R A;  1ZBF A;  4DV6 K;  4JKF A;  4JI7 K;  3GE1 A;  3L3U A;  1NBW A;  4DLG A;  4OPJ A;  4ILJ A;  1S1X A;  3NMU A;  3LDN A;  1N36 K;  2GX9 A;  4EIA A;  1IBL K;  1V4S A;  4NXN K;  3I33 A;  3DRS A;  2J4R A;  2P9I B;  4FLY A;  3A8Y A;  4CZJ A;  3EE9 A;  3AO4 A;  1RBV A;  4DSJ A;  5SWM A;  3V6D A;  2OTL N;  3CJB A;  1B9F A;  4U67 L;  2IC3 A;  4CE9 A;  2QKB A;  3C65 A;  2YKM A;  3CME N;  1UA0 A;  4KKO A;  4NYN A;  3ZT4 A;  3VPZ A;  4N76 A;  4GW6 A;  4DKW A;  3C6T A;  3PX6 A;  1Q9Y A;  2NUB A;  4B3R K;  1NOZ A;  4CZG A;  4KTQ A;  2NRW A;  3O1W A;  1VSK A;  4PKG A;  1HQU A;  5AJ3 K;  2PAV A;  4B3O A;  1HNX K;  3HO1 A;  1EXQ A;  2E88 A;  3AAQ A;  1ASV A;  2ZGY A;  3CCQ N;  4BE0 A;  1VQ8 N;  4CBW A;  4GV3 A;  4PKH A;  1QS4 A;  2IVP A;  4BRP A;  4C23 A;  3CJA A;  3MEG A;  5AQO A;  4CIE A;  4FPB A;  4KHN A;  1O13 A;  1ZXO A;  2PBD A;  3NF9 A;  4Q5V A;  1TVR A;  3FR0 A;  4DF8 A;  3NF6 A;  1HKG A;  3O4W A;  1YI2 N;  4CEF A;  3SUN A;  1HX1 A;  1DGK N;  4WFN L;  4HTL A;  4BQZ A;  2P9P A;  5AFU H;  3SNN A;  3QBW A;  3LP2 A;  1KVC A;  4OX9 K;  3N4Q A;  4FWP A;  4TSX A;  4BY9 C;  4KFB A;  1IBM K;  4JI5 K;  3KK1 A;  1L5U A;  4IEI A;  3OYJ A;  4IJA A;  2ASM A;  4BRA A;  4DUZ K;  4RW9 A;  2FSK A;  4BWJ A;  3DRR A;  4CZL A;  3CCJ N;  3AVK A;  4EFH A;  3O5B A;  4KH4 A;  1XMQ K;  3HOT A;  3VA0 A;  5JLH A;  3CHW A;  1FJG K;  4JAX A;  3M3Z A;  1TK5 A;  5AQV A;  3G10 A;  5DK5 A;  1TKT A;  2F96 A;  1ATS A;  3VF6 A;  4DQQ A;  2QTD A;  4IOX A;  3B8A X;  1LAW A;  1GLJ O;  1RT7 A;  4CEQ A;  4K25 A;  4Z4G A;  3G0Z A;  4KHP K;  1RDU A;  2GWJ A;  1KTQ A;  4JK9 A;  4ELT A;  4KB0 A;  4B1Y B;  2QWM A;  1NK5 A;  2D5R A;  5JMV A;  3AVJ A;  2OPR A;  2F4V K;  2D0O A;  2YHY A;  5HRO A;  1BUP A;  2E8A A;  2FF6 A;  4OLB A;  1KCF A;  4CF0 A;  3QO9 A;  1VQ7 N;  5AQF A;  2BTF A;  1L3V A;  3NH2 A;  4FYD A;  4FOI A;  4I9L A;  3ITH A;  2HHH K;  2HF4 A;  1WSJ A;  2JLE A;  4A2B A;  3J80 O;  1BQM A;  3CCE N;  2GV9 A;  2E20 A;  4O8K A;  4B9L A;  2ZJP L;  4LSN A;  5LY3 A;  5SZT A;  2HHX A;  3AVL A;  2YHW A;  3OYG A;  3HPG A;  4BVO A;  3OS2 A;  3NVK A;  3IFR A;  2Q0R A;  4CHY A;  3KZB A;  3BZC A;  3IG1 A;  1XQS C;  1MDU B;  2VCP A;  1EWR A;  4X66 K;  4DTU A;  3FZF A;  3NGZ A;  1IBK K;  1VQ5 N;  3OS0 A;  2VQF K;  2H3G X;  3QIN A;  4A61 A;  5GIO A;  2F8T A;  1OH5 A;  4BR2 A;  3GOI A;  3ZSR A;  3ZSO A;  4B3M K;  3TTF A;  4YDU A;  1FW6 A;  2EX3 A;  2YNG A;  3A5L C;  3CF5 L;  3DOK A;  3KTQ A;  2AP1 A;  2QK9 A;  3CQ8 A;  1LOT B;  4WQ5 A;  3OYK A;  3LM2 A;  3MX2 A;  3UKR B;  5JIC A;  3FLC O;  3QER A;  4C8O A;  5JS2 A;  4JKC A;  3WXJ A;  4BC5 A;  3V1Q A;  4CFC A;  3VEN A;  4CZM A;  2Q31 A;  1TYQ A;  3C0B A;  5KGX A;  3TPQ A;  3N4P A;  2O8C A;  3H6E A;  3I0R A;  1DEJ A;  3DXK A;  4BRQ A;  3KK3 A;  4CJF A;  5KRS A;  3G71 N;  4DG1 A;  1ZBU A;  3O9U A;  4BAC A;  1S72 N;  5FPM A;  4FXD A;  1Q8I A;  4JK7 A;  3HM9 A;  4JD2 B;  5EOY A;  3CET A;  3TI0 A;  3TSQ A;  1RFQ A;  2E6M A;  4JKG A;  2E4L A;  1TUU A;  4FJG A;  1TL1 A;  3HK2 A;  4CEC A;  3O80 A;  3UE5 A;  3AVC A;  1VQK N;  2W6L A;  5CYM A;  2F9T A;  3ZSZ A;  4J8F A;  3O3G A;  5F0X A;  2ATQ A;  4FJN A;  3CQX A;  5BR9 A;  4C1N I;  4A62 A;  4NCA A;  1WNS A;  2D0C A;  1VSJ A;  5FPE A;  3OHR A;  3V9W A;  4GKK K;  4M3Y A;  3CYM A;  3WEE A;  3CFO A;  4AM6 A;  1F21 A;  3CC4 N;  3BDP A;  5BPM A;  1S1U A;  3E9P A;  4DR4 K;  4FWR A;  3TAR A;  2O8D A;  1ZBH A;  5H1S Q;  1NU0 A;  2YCH A;  4KBO A;  2A3Z A;  1QTM A;  2KQ2 A;  1WSI A;  3BZK A;  4Z94 A;  1MWK A;  5EXW A;  2OPP A;  3ZSV A;  1BI4 B;  1QSY A;  2FSN A;  4FLU A;  5AZI B;  3B6O A;  2XRI A;  2YNF A;  1RTD A;  4Q0B A;  5HP1 A;  3ZET B;  4DSI A;  3VA3 A;  2A1S A;  5D3G A;  1RTH A;  4UQG A;  3THY B;  3DLH A;  1SS6 A;  3TAP A;  1Z05 A;  3KJV A;  4KTW A;  1ZC6 A;  4W5T A;  4BRN A;  3K5N A;  1T03 A;  3NHG A;  3FFI A;  1TAQ A;  4YOT A;  1EQY A;  3SK3 A;  3CI5 A;  1B92 A;  1JKH A;  2X78 A;  4EZ9 A;  1QZ5 A;  2Q1N A;  4HUF A;  3AA4 A;  1OH7 A;  2OPS A;  2RKI A;  4A5A A;  4DV3 K;  4CJ5 A;  3SI6 A;  2QWQ A;  3Q7B A;  4CVN E;  4AH9 A;  1N5Y A;  2IVN A;  1NG9 A;  4BRM A;  3K59 A;  3QNO A;  1ITG A;  1VSI A;  3IDH A;  4GVM A;  2UYT A;  1T6D A;  4O55 A;  5E26 A;  5AQT A;  4Z4I A;  3MN9 A;  3CIP A;  2G8F A;  4B08 A;  4R79 A;  3PSI A;  1DKG D;  2V51 B;  3E1Y A;  1T44 A;  3T7Z A;  5M1F A;  4PUO A;  4IXC A;  3OBW A;  2FBV A;  5CHI A;  4FVU A;  1H1V A;  4E7L A;  3SV4 A;  5C2D A;  1IO2 A;  3EL2 A;  4B9Q A;  1J5E K;  1YJ9 N;  1RBS A;  3CCU N;  3PIO L;  4M42 A;  1ATR A;  4CBX A;  4O5F A;  3JYT A;  4DTM A;  4E3S A;  4MO5 A;  1QQO A;  3KLH A;  3U9Z A;  1BIZ A;  4H0Y B;  3VQE A;  3TAQ A;  4AHS A;  4DS5 A;  2G8W A;  2WOM A;  4OKE A;  3T3F A;  1K8A O;  2O8B A;  4OPK A;  4H4O A;  3OYA A;  1FKP A;  2KFN A;  4FM2 A;  5C24 A;  2YHA A;  4ISG A;  4GKJ K;  4IO9 L;  2W42 A;  5BRF A;  4CGH A;  4Z4E A;  1DT9 A;  2YHX A;  5AQR A;  1J53 A;  5KRT A;  1MWM A;  5KPZ A;  4ZTJ A;  4C8L A;  4N47 A;  3V1R A;  4HCB A;  1U47 A;  3ISN C;  4M41 A;  3DLL L;  4JI3 K;  4E7K A;  1KXP A;  2GUP A;  3MED A;  5TKY A;  4DV2 K;  4CD1 A;  4BRE A;  2Z1J A;  4JI6 K;  4M3U A;  3THX B;  1U04 A;  3HOS A;  4MDB A;  4RW8 A;  2ZGZ A;  1JXE A;  2VGN A;  2P9U A;  4CFA A;  3QEV A;  3NBP A;  4DV7 K;  3VQ6 A;  1VQN N;  2D0B A;  2Z1H A;  1DTQ A;  3OYL A;  1LWF A;  1RTJ A;  3VEZ A;  4JI2 K;  4AHT A;  4ICL A;  4BGA A;  4KHY A;  3LAM A;  2YI1 A;  4H0P A;  3SUQ A;  4WE1 A;  2HBK A;  4CJ4 A;  3O6W A;  3WQU A;  1U45 A;  3WT0 A;  1NK8 A;  3F73 A;  4CJ7 A;  3AO3 A;  3AAR A;  1BGX T;  2KKZ A;  4JKH A;  4M7X A;  2ASP A;  4IO8 A;  1S1V A;  2ZD1 A;  3OBY A;  2OZS A;  4KHS A;  1HNW K;  2ITM A;  3DAW A;  4LF7 K;  1JXB A;  5EY4 A;  1C6V A;  3HT3 A;  1QSL A;  4BE1 A;  4FO0 A;  1YXQ A;  2NRV A;  1VSH A;  4FWO A;  2O8E B;  2ZM6 K;  3FGU A;  4AM7 A;  4MFB A;  1NMD A;  1ESV A;  4K41 A;  1RIL A;  3DJC A;  4E0D A;  4CEZ A;  2D0P A;  5FRM A;  1GLC G;  3CG7 A;  3VGM A;  4OGE A;  1HMV A;  3DXM B;  3DMJ A;  3IMX A;  2HHU A;  1HYZ A;  3IS9 A;  1C0U A;  1TK0 A;  4O4G A;  4AQY K;  1RT2 A;  4V19 S;  3NF7 A;  3NF8 A;  3FZK A;  3A0I X;  3EO3 A;  2HBJ A;  4W5R A;  3F9M A;  3W0L A;  4F9O A;  4DR1 K;  2XO7 A;  3LDQ A;  4EP4 A;  1RDC A;  1JCG A;  4O0I A;  1HUX A;  4KI6 A;  3PV8 A;  3THW A;  4DR2 K;  4BG8 A;  3VEW A;  3IKM A;  1HQE A;  1LCU A;  4AF1 A;  4EP5 A;  5KPT A;  3L4Q A;  4DV4 K;  2QWP A;  3K5M A;  1QQC A;  1ASW A;  4W5O A;  5HBM A;  4LF4 K;  2XY5 A;  4FJJ A;  3C7N A;  4FL9 A;  5F1X A;  4XEI A;  3KIO A;  3U9D A;  2VWB A;  4DS4 A;  3ZEU A;  3VQP A;  4DQP A;  1K9M O;  3SAF A;  3L2W A;  4BGB A;  2HNZ A;  3TTC A;  1N34 K;  1HJR A;  5FPD A;  1U2V A;  4CW7 B;  4JI0 K;  1QHT A;  1WN7 A;  4J2B A;  5JVH L;  4JRP A;  3M1F A;  4QS7 A;  4M3W A;  3J7Y P;  1NWK A;  3LDP A;  4Y1C A;  3U6F A;  3MXM A;  1BDG A;  1BCM A;  1S1T A;  1YTA A;  5AQN A;  5EX5 A;  1T7P A;  5AQJ A;  2F8S A;  3D2E A;  4K42 A;  3CXC M;  4DR5 K;  1S22 A;  4DTX A;  4E7J A;  3F5T A;  4H5V A;  3FFK B;  4ILG B;  1SQK A;  4DV0 K;  2IOC A;  2KFZ A;  1E4F T;  3V4I A;  3VMF B;  2HST A;  1JLE A;  3Q7C A;  1S9G A;  4CBU A;  3VQA A;  3IAY A;  2QWO A;  2QXF A;  3HST B;  4OPA A;  3O3H A;  1SKR A;  2OCE A;  1QE1 A;  3DLR A;  1U6Z A;  4RW7 A;  4CED A;  4DTR A;  4XIU A;  2EHG A;  3HL8 A;  4YFU A;  1UAX A;  5LMU K;  4OJR A;  3T1H K;  2X6N A;  3VEO A;  3PX4 A;  3G6E N;  5BN9 A;  5M1Q A;  2HMP A;  3ENH A;  3ZX3 A;  1TAU A;  3K58 A;  2Y1J A;  1TYQ B;  1RCH A;  3NFA A;  1SKW A;  4FZZ A;  3CM6 A;  3DXK B;  1CZ9 A;  4IOC L;  1BQN A;  1RDW X;  1YF5 L;  3GG4 A;  4WFA L;  1SAZ A;  1NKB A;  4FWS A;  2Q3S A;  3BP8 A;  4JKG B;  2IGI A;  3P1G A;  1NGD A;  4MDA A;  5AQU A;  3RMC A;  5C12 A;  3TAM A;  4BRO A;  2GWK A;  3LWM A;  1YJN N;  2RE2 A;  4KTZ A;  5HRS A;  3CPW M;  1LW0 A;  1N32 K;  1XWL A;  3DLG A;  4IBN A;  3NE6 A;  1I94 K;  4O44 A;  1S5J A;  1TKD A;  2O8F A;  4HUG A;  1XI1 A;  1RT3 A;  1VQL N;  3S3N A;  3DYA A;  4H5R A;  3ALY A;  1NGI A;  3S41 A;  1LWE A;  2UUA K;  5M1O A;  3WEE B;  4IDK A;  3VQ7 A;  4NCB A;  4O5B A;  2KZM A;  5AQY A;  2QXL A;  3H3N O;  3WQT A;  2O8D B;  2IS3 A;  1LW2 A;  3L2Q A;  3OYI A;  2OPQ A;  1E3M A;  1QSS A;  2JGU A;  3GL1 A;  4JI8 K;  4FK0 A;  4BRL A;  1RT5 A;  1GOC A;  2P9K B;  1I39 A;  2UU9 K;  3QEX A;  4DQR A;  2I5J A;  2IVO A;  3TAB A;  3C6H A;  4KV8 A;  2VWK A;  2PYL A;  1SL0 A;  3ZT2 A;  3GDQ A;  3VTH A;  1JLC A;  5HLF A;  2QI2 A;  4HTU A;  4DSL A;  1P90 A;  5FRN A;  3DM2 A;  3SQ2 A;  3MN6 A;  5FLX O;  1OVY A;  2E2N A;  2Q0U A;  2FSJ A;  4QAG A;  5ADX H;  2VWJ A;  4B9N A;  1CZA N;  3DRP A;  1IH7 A;  1QZ6 A;  4AHC A;  5AQH A;  4K43 A;  4I7F A;  4DR6 K;  3MCA B;  1VQ4 N;  1NK9 A;  1NJZ A;  2HVI A;  4CFB A;  1Z26 A;  1ZBI A;  2HNY A;  3DOL A;  2F9W A;  4BRD A;  4KAZ A;  2NRZ A;  3P83 D;  1NJW A;  4NCG A;  3JAM O;  1ZBL A;  3RSE A;  1FK9 A;  3P5J A;  4KHU A;  3ZT0 A;  1Q18 A;  1WBB A;  3CCS N;  2NRX A;  4CZH A;  1D5A A;  5BRD A;  3TAE A;  3LDO A;  3C6U A;  3D7E O;  3HM8 A;  3PIP L;  1X1P A;  1GOB A;  2V7Z A;  1KLM A;  4FLZ A;  2QW9 A;  3C94 A;  3ID6 A;  3VQ8 A;  1CXQ A;  4IFY A;  3TTD A;  3IUC A;  3O4N A;  4W5Q A;  4B9M A;  3L0Q A;  2RN2 A;  3AGK A;  3U3Y A;  5AQS A;  2KLA A;  2HVH A;  2V52 B;  3L6Q A;  3O8M A;  3KK7 A;  1HRH A;  5CY4 A;  4CF1 A;  4O8U A;  2WUS A;  3OA9 A;  1IKX A;  3QES A;  4BRK A;  2O8B B;  4N41 A;  3F9K A;  4F2S A;  3W3D A;  1ATN A;  4Z0U A;  4FJM A;  4DU1 A;  3D2F A;  1VHX A;  4B1Z A;  4O0J A;  2HB5 A;  3HZ6 A;  2E6L A;  3HVT A;  4YOW A;  2UXC K;  4CJE A;  1RDB A;  3AO2 A;  3K5L A;  3SAH A;  3MEC A;  1K8K A;  5AQG A;  1JLB A;  3GBT A;  2DFF A;  4YOY A;  2Q2R A;  3C95 A;  4X62 K;  3OTO K;  3AVM A;  3S3M A;  1HYV A;  2YJE A;  3LWL A;  3WXI A;  1XNQ K;  1T6C A;  2Q97 A;  3UIQ A;  3TAG A;  3O9T A;  4M3T A;  4N56 A;  2XY6 A;  3I8D A;  1JCE A;  5CR4 A;  3ENO A;  5J2P A;  4GV9 A;  3U8X A;  3OYN A;  1IKY A;  1HNV A;  4DFK A;  3L3V A;  3NH0 A;  3P4I A;  5C15 A;  4K8Z A;  4FZX C;  1OH6 A;  1RBT A;  5M1P A;  4MO4 A;  1KLN A;  1HPM A;  4RG8 A;  3VEY A;  2BGG A;  1R0A A;  2BE2 A;  3ZX0 A;  4EZ6 A;  3O9Q A;  4HHT A;  1K73 O;  4JLH A;  4RWT A;  4JHD B;  3M8Q A;  5TKW A;  4CJ3 A;  4DV1 K;  1QQM A;  1J54 A;  1IV0 A;  4FM1 A;  4CHN A;  4LC9 B;  1IJJ A;  5MLC Q;  3ZSQ A;  1KAY A;  1NKC A;  4HVJ A;  4CHO A;  3ZSW A;  4H03 B;  3QBX A;  3VGK A;  3E01 A;  1JLQ A;  3R3L A;  3CQY A;  4KI4 A;  3CFR A;  4IDH A;  4LH5 A;  5AQX A;  3SJJ A;  1EWQ A;  4CES A;  4EHT A;  5JS1 A;  2YX6 A;  1A5V A;  5J2M A;  5C42 A;  4CJQ A;  3C6A A;  1YVN A;  4FOE A;  2E1Z A;  1W7A A;  1CLQ A;  3VQQ A;  1S6Q A;  2ZJQ L;  1YJW N;  3E66 A;  2DFH A;  1HLU A;  1ILY A;  4I6M A;  4M63 C;  3VQB A;  1G15 A;  2E2P A;  3M8R A;  4QCL A;  1X9S A;  1D8Y A;  2FLO A;  4C1N K;  1BO5 O;  5HOO A;  4BWM A;  3H46 O;  5DM7 L;  1EET A;  4MLE A;  5AQZ A;  4JNE A;  4DHY A;  4BR0 A;  1NNE A;  2NLX A;  1GLB G;  1M90 O;  3VEX A;  4FWQ A;  1VSL A;  4J2E A;  3MXJ A;  3H3O B;  3EZW A;  3RRH A;  3RMB A;  2D0A A;  4GNI A;  4IFV A;  3THW B;  5E41 A;  5I3U A;  3SBG A;  4FW2 A;  2ETJ A;  2AA4 A;  3A2F A;  2A5X A;  4KB1 A;  2IDO A;  4FWK A;  5GAD P;  1GLE G;  3SCX A;  4DCH A;  1XHX A;  2P9N A;  3KLI A;  2YKN A;  2Z1I A;  2YNI A;  3TAF A;  4JYA K;  3EEQ A;  3QEW A;  3SZ2 A;  3MN7 A;  4JKA A;  3ZEU B;  5GAH P;  4BR9 A;  2VG5 A;  4X65 K;  1Z6R A;  3PY8 A;  3KLE A;  3CCL N;  1N8R O;  1JLF A;  5J2N A;  1C1A A;  4M3Z A;  4FJ9 A;  4IZ9 A;  1NK4 A;  3LM9 A;  4PY5 A;  5HRN A;  3NH1 A;  1BA0 A;  2OZM A;  2NNW A;  4B3S K;  2WON A;  3NGI A;  3RR7 A;  3OYH A;  4M45 A;  4B1V A;  1NGB A;  2Y1I A;  3K2P A;  5I9E B;  2CGK A;  1X3N A;  3ZYY X;  4QS8 A;  2FBY A;  4BVP A;  3QET A;  4CF2 A;  3KWG A;  1S1W A;  3VQC A;  4U7B A;  1TK8 A;  2E2O A;  4C8K A;  2P9S A;  5DM6 L;  3SPZ A;  4FPA A;  4CFD A;  3LZJ A;  5CZ2 A;  2E1Y A;  1WLJ A;  3H1Q A;  4DTP A;  3NGY A;  2R7Y A;  2P9L A;  4IKF A;  1WSE A;  3AVF A;  1KRP A;  4FLV A;  4BRC A;  3U4L A;  3L2R A;  1J5O A;  4YY3 K;  3OJU A;  4RTF D;  2FXU A;  3CJ7 A;  5AQM A;  4DQI A;  4AHV A;  3K0S A;  4CJL A;  4Z4F A;  3EKS A;  4CGG A;  2OA8 A;  1OH8 A;  3KLG A;  2PY5 A;  3SLC A;  4DLE A;  1VAZ A;  1A5W A;  1K6Y A;  4BDZ A;  3OW2 M;  4FWM A;  2W6K A;  4A2A A; 
#chains in the Genus database with same CATH homology
 4FOI A;  4E1J A;  3ATV A;  3Q7C A;  3AGR A;  2ZF5 O;  3QB0 A;  4XH5 A;  4BC2 A;  2QWO A;  4CBU A;  3G25 A;  4OPA A;  2HF4 A;  4A2B A;  2A6A A;  1U6Z A;  3JS6 A;  4IJN A;  1YHQ N;  3CCE N;  2E20 A;  4NLB A;  4O8K A;  2ZJP L;  1XUP O;  1KAX A;  2E2Q A;  5LY3 A;  2W41 A;  2W40 A;  1BG3 A;  2YHW A;  1Q7Y O;  3HI0 A;  4M7Y A;  3BF3 A;  4BVO A;  3VEO A;  3ULE B;  3G6E N;  3NVK A;  5BN9 A;  3IFR A;  4NLC A;  2HMP A;  2Q0R A;  5M1Q A;  4A57 A;  3ENH A;  3KZB A;  3ZX3 A;  4NO7 A;  1XQS C;  3MK6 A;  1MDU B;  4PHT X;  5BPL A;  4HWI A;  1TYQ B;  2VCP A;  3HTV A;  2P9P B;  4FSV A;  3FZF A;  3CJ9 A;  1HJO A;  5AZI A;  3BF1 A;  2WFB A;  1X9J A;  4WCE L;  2KHO A;  1VQ5 N;  3VF4 A;  3DXK B;  1E4F T;  4QS9 A;  4IOC L;  2PFU A;  1RDW X;  1YF5 L;  4PL7 A;  2H3G X;  3GG4 A;  4A61 A;  5GIO A;  1R59 O;  4WFA L;  1X3M A;  1SAZ A;  1QQN A;  4RCH A;  4FWS A;  4BR2 A;  3GOI A;  3BP8 A;  1KC8 O;  3TTF A;  4JKG B;  4YDU A;  5E84 A;  1NGD A;  3A5L C;  2YJF A;  4MDA A;  5AQU A;  2AP1 A;  3C7N B;  3NVM A;  1LOT B;  3I56 N;  2NRT A;  4WQ5 A;  5C12 A;  3LM2 A;  3MX2 A;  2A41 A;  3UKR B;  3FLC O;  5JIC A;  4JKC A;  2GWK A;  1Y64 A;  3WXJ A;  2A42 A;  4KH6 A;  4BC5 A;  4BG9 A;  4BRO A;  1YJN N;  1VQM N;  2RE2 A;  3ULE A;  4DB3 A;  3O9R A;  4JN4 A;  3CPW M;  1E4G T;  3MDQ A;  3VEN A;  4CZI A;  4CZM A;  3CD6 N;  2VYP A;  5AR0 A;  1HKB A;  4MLH A;  2Q31 A;  3LDL A;  1TYQ A;  3C0B A;  3TPQ A;  3O9S A;  3R9P A;  1U2V B;  3N4P A;  3H6E A;  3KHY A;  4ILH A;  3WXK A;  2ZJR L;  3MMV A;  1YAG A;  3SMS A;  1VQL N;  1DEJ A;  3DXK A;  2GTD A;  4BRQ A;  3H45 C;  3G71 N;  4H5R A;  3S41 A;  1NGI A;  3CMA N;  3EN9 A;  1W2B M;  3MN5 A;  3O9U A;  3ZX2 A;  4YOU A;  1S72 N;  5C0Y A;  3HBT A;  5M1O A;  5FPM A;  4Y0W A;  1OKJ A;  3LL3 A;  4JK7 A;  3WEE B;  4BRI A;  4GY2 B;  4JD2 B;  2QWL A;  5EOY A;  3CET A;  3VER A;  3TSQ A;  1RFQ A;  5AFU A;  4JKG A;  5AQY A;  1TUU A;  3D2E B;  2QXL A;  3K9K A;  3H3N O;  3WQT A;  3O80 A;  1C0G A;  3UKR A;  5GIN A;  3MWP A;  5EVZ A;  4YOX A;  3GL1 A;  3UE5 A;  5BRH A;  4BRL A;  2HBL A;  4IWV A;  1VQK N;  2QWN A;  2F9T A;  4G9Z A;  2P9K B;  3DWL A;  4J8F A;  3FE1 A;  5F0X A;  2IVO A;  3CC2 N;  3C6H A;  3CQX A;  4H5W A;  3P39 A;  5BR9 A;  4IOA L;  1JCF A;  4C1N I;  3GDQ A;  3VTH A;  4PKI A;  3RSE B;  4A62 A;  3CJ1 A;  1P8Z A;  5FPE A;  3QFP A;  4ISF A;  2QI2 A;  3OHR A;  3UKU B;  1RGI A;  1P90 A;  3I8B A;  2GEL A;  3WEE A;  4JD2 A;  3SMP A;  4AM6 A;  3CC4 N;  5BPM A;  3E9P A;  4WQ4 C;  4H0O A;  3MN6 A;  3A5O C;  4FWR A;  3MCP A;  2VGM A;  1OVY A;  1WUA A;  2E2N A;  2FSJ A;  2Q0U A;  5ADX H;  1CZA N;  4L3Q A;  2YCH A;  5H1S Q;  3E9L A;  2A3Z A;  4KBO A;  1W97 L;  1QZ6 A;  4KH5 A;  5AQK A;  4Z94 A;  1MWK A;  4K43 A;  5AQH A;  5EXW A;  3MCA B;  3P31 A;  1VQ4 N;  4CD3 A;  3HSC A;  3CJC A;  5F2R A;  5GAG P;  2FSN A;  5AQL A;  5AZI B;  3T69 A;  1GLF O;  3BUZ B;  3ID8 A;  1XC3 A;  4BR4 A;  5LJW A;  4B1X B;  5ADX A;  2F9W A;  4BRD A;  5CE3 A;  3ZET B;  1VQP N;  5ELZ A;  4FWL A;  2NRZ A;  2QA4 N;  4EAH D;  1BA1 A;  2HBM A;  1SS6 A;  1Z05 A;  3RSE A;  1YUW A;  1QVF M;  1ZC6 A;  2JWL A;  1J6Z A;  4BRN A;  1Q18 A;  5LJV A;  4H5T A;  5FPN A;  5AQP A;  3UKU A;  3CCS N;  4YOT A;  2NRX A;  1EQY A;  4CZH A;  5BRD A;  3SK3 A;  1JJ2 M;  3LDO A;  2FF3 B;  3J8A A;  3D7E O;  3HM8 A;  3VOV A;  3CI5 A;  5C2F A;  3D2F B;  4JHD A;  3PIP L;  1GLL O;  1QZ5 A;  4A59 A;  2Q1N A;  3F2K A;  4BC4 A;  1QHA A;  3WXM B;  4CZF A;  3AAP A;  2V7Z A;  4DQ8 A;  4WFB L;  2QW9 A;  3A5N C;  4A5B A;  3ID6 A;  3R6M A;  3IUC A;  3TTD A;  3H1V X;  4A5A A;  1NJI O;  3L0Q A;  3AGK A;  2QWQ A;  3Q7B A;  5AQS A;  1BOT O;  2KLA A;  3BEX A;  3MWT A;  2V52 B;  3L6Q A;  3O8M A;  2Q36 A;  3KK7 A;  3ZET A;  2IVN A;  1G99 A;  4O8U A;  1K8K B;  4BRM A;  3TSP A;  3AY9 A;  2NRH A;  2WUS A;  4GVE A;  3IDH A;  2V7Y A;  3OA9 A;  3O08 A;  4WQ4 A;  2UYT A;  1T6D A;  4BRK A;  5E26 A;  5AQT A;  3MN9 A;  3CIP A;  3P38 A;  3W3D A;  1ATN A;  4R79 A;  3CC7 N;  3JXU A;  3CCM N;  1DKG D;  3CCV N;  2V51 B;  1EO1 A;  3E1Y A;  1T44 A;  3T7Z A;  4BRG A;  2OAN A;  5M1F A;  1C0F A;  3D2F A;  2CGJ A;  4IXC A;  3TSU A;  3EKU A;  3WUH A;  3OBW A;  5CHI A;  4B1Z A;  4FVU A;  1H1V A;  4WF9 L;  3HZ6 A;  5C2D A;  4YOW A;  3EL2 A;  4B9Q A;  1YJ9 N;  3K9J A;  3CCU N;  2GEM A;  3PIO L;  5M1K A;  1ATR A;  1TUY A;  4CBX A;  4O5F A;  2CH5 A;  1NGG A;  3QML A;  1NGJ A;  1Q81 O;  3KWI A;  1NGF A;  4CI6 A;  4MO5 A;  1QQO A;  2QM1 A;  4IFE A;  3SAH A;  3U9Z A;  1SZ2 A;  1K8K A;  5AQG A;  4JK8 A;  3UB5 A;  3GBT A;  4H0Y B;  4YOY A;  3CF5 L;  2Q2R A;  3VF2 A;  4BC3 A;  3SAG A;  4IEE A;  4EHU A;  2YJE A;  1K8A O;  2QEX N;  2I7P A;  3WXI A;  2ZWH A;  3FZH A;  1T6C A;  2Q97 A;  3E9O A;  3O9T A;  3KVG A;  2BUP A;  4ISG A;  4B1W B;  1T3V A;  2JWK A;  4OPH A;  4H5N A;  4JKD A;  4IO9 L;  2WC9 A;  1JCE A;  5BRF A;  1DT9 A;  2YHX A;  3M6G A;  5CR4 A;  3RVC A;  2OTJ N;  3ENO A;  4JKE A;  5AQR A;  4GV9 A;  1MWM A;  1WOQ A;  3U8X A;  5KPZ A;  3DXM A;  3A5M C;  3CCR N;  2IIR A;  3P4I A;  5C15 A;  4WYB A;  2A40 A;  3FZM A;  5BPN A;  3ATU A;  3DLL L;  1KXP A;  2GUP A;  3FZL A;  4PL8 A;  4XH4 A;  5M1P A;  1BU6 O;  4MO4 A;  5TKY A;  1HPM A;  4BRE A;  3VEY A;  4CD1 A;  4BRF A;  2RHK A;  2D4W A;  4BRH A;  3ZX0 A;  3HOS A;  4CZK A;  3O9Q A;  3SBT A;  5GAE P;  4MDB A;  1K73 O;  1M1K O;  4RWT A;  1ZBS A;  1VQO N;  1NGH A;  4JHD B;  2ZGZ A;  5TKW A;  2VGN A;  1QQM A;  5AZJ B;  2P9U A;  3CPE A;  5KPR A;  3G4S N;  1BWF O;  4LC9 B;  3PLA A;  1IJJ A;  4I6M B;  5MLC Q;  4FWN A;  1KAY A;  1NGE A;  5C10 A;  1VQN N;  3WXL A;  1V4T A;  4BR7 A;  3EE8 A;  4H03 B;  3QBX A;  4H0V B;  3L4I A;  3VGK A;  3QFU A;  4UY8 O;  3M5R A;  3VEZ A;  3R3L A;  4JKF A;  3CQY A;  4BGA A;  3GE1 A;  1NBW A;  1GLA G;  4IDH A;  2YI1 A;  5AQX A;  4H0P A;  1VQ6 N;  5HL7 L;  4ISE A;  4EHT A;  4ILJ A;  2HBK A;  5AQQ A;  2YX6 A;  3NMU A;  3D6R A;  3O6W A;  3LDN A;  3WQU A;  3VGL A;  3WT0 A;  2EWS A;  4CJ7 A;  2GX9 A;  3C6A A;  4EIA A;  1YVN A;  3AAR A;  3R1X A;  4FOE A;  2E1Z A;  2KKZ A;  2F7T A;  4JKH A;  1V4S A;  2ASP A;  4M7X A;  1KD1 O;  4IO8 A;  3I33 A;  2J4R A;  1NLV A;  5AZJ A;  2P9I B;  3A8Y A;  3OBY A;  4CZJ A;  2ZJQ L;  3EE9 A;  1YJW N;  3E66 A;  4XH1 A;  1HLU A;  1ILY A;  4I6M A;  2OTL N;  3CJB A;  4M63 C;  4H0T B;  2ITM A;  2NRR A;  3QDK A;  2E2P A;  4U67 L;  2ASO A;  4YOV A;  1HKC A;  3C65 A;  5GIP A;  3DAW A;  1NGC A;  4B1U B;  2D1K A;  2P9N B;  5KQ8 A;  2FLO A;  2HOE A;  4C1N K;  1BO5 O;  3CME N;  5EY4 A;  5HOO A;  1QVG M;  3VPZ A;  3H46 O;  5DM7 L;  4DKW A;  4MLE A;  5AQZ A;  4BQL A;  4GV6 A;  4JNE A;  4FO0 A;  4DHY A;  4BR0 A;  2NLX A;  1YXQ A;  1GLB G;  4CZG A;  2NRV A;  3VEX A;  1M90 O;  2NRW A;  4FWQ A;  4FWO A;  3O1W A;  2NZT A;  3H3O B;  4PKG A;  5M1N A;  3EZW A;  4GNI A;  3FGU A;  3R8E A;  5B8H A;  4AM7 A;  2PAV A;  3QIC A;  1NMD A;  1YIT N;  2E88 A;  1ESV A;  4K41 A;  3DJC A;  2HF3 A;  3SBG A;  3SJH A;  3AAQ A;  2D0P A;  2AA4 A;  2P9I A;  2ZGY A;  2A5X A;  3CCQ N;  4FWK A;  1GLC G;  3VGM A;  1VQ8 N;  5GAD P;  1GLE G;  3DXM B;  5AQW A;  4CBW A;  4GV3 A;  4PKH A;  2IVP A;  4BRP A;  4DCH A;  4C23 A;  3IMX A;  1D4X A;  3CJA A;  1VQ9 N;  2P9N A;  5AQO A;  4FPB A;  1O13 A;  1ZXO A;  2PBD A;  3I55 N;  3MN7 A;  4CZE A;  3FR0 A;  4JKA A;  3ZEU B;  2WBN A;  5AQI A;  2P9S B;  1HKG A;  4BR9 A;  3O4W A;  5GAH P;  1YI2 N;  3CER A;  4H0X B;  1HX1 A;  1S3X A;  3FZK A;  1Z6R A;  1DGK N;  2HBJ A;  3A0I X;  3EO3 A;  3VES A;  3VEV A;  4WFN L;  4HTL A;  3F9M A;  3VET A;  3W0L A;  4F9O A;  4BQZ A;  3CCL N;  1N8R O;  5KQD A;  2P9P A;  1YIJ N;  3LDQ A;  5AFU H;  3VMF B;  3QBW A;  1JCG A;  2P9U B;  1KQS M;  4OO1 J;  1HUX A;  4IZ9 A;  3N4Q A;  2P9L B;  3LM9 A;  1BA0 A;  4FWP A;  4BG8 A;  3VEW A;  3IKM A;  4AF1 A;  1LCU A;  4BY9 C;  2CH6 A;  2NNW A;  5KPT A;  3L4Q A;  2QWP A;  4IEI A;  4IJA A;  4B1V A;  2ASM A;  4BRA A;  1NGB A;  5I9E B;  1MA9 B;  2CGK A;  1X3N A;  3ZYY X;  2FSK A;  4QS8 A;  4BVP A;  3C7N A;  4CZL A;  3CCJ N;  4FL9 A;  5F1X A;  5BN8 A;  4XEI A;  1KAZ A;  4EFH A;  1NM1 A;  3O5B A;  4KH4 A;  4YOR A;  3KWG A;  3HOT A;  3U9D A;  2VWB A;  5JLH A;  4U7B A;  3CHW A;  2E2O A;  3ZEU A;  4JAX A;  2P9S A;  5JLF A;  3M3Z A;  3MX5 A;  5AQV A;  5DM6 L;  1K9M O;  4FPA A;  3SAF A;  1ATS A;  2I7N A;  4BGB A;  2DPN A;  3VF6 A;  3TTC A;  2QTD A;  3ENB A;  3B8A X;  4IOX A;  4NB4 A;  5BRE A;  1GLJ O;  5FPD A;  1U2V A;  2E1Y A;  2QWR A;  1Q82 O;  3H1Q A;  4K25 A;  3HRG A;  2P9L A;  1Q86 O;  5JVH L;  3M1F A;  4QS7 A;  1RDU A;  2GWJ A;  4JK9 A;  4BRC A;  1NGA A;  1NWK A;  3LDP A;  3U4L A;  2BH1 A;  2QWM A;  4B1Y B;  1BDG A;  5AQN A;  5EX5 A;  3TU5 A;  3J7Z O;  5AQJ A;  5JMV A;  4RTF D;  2FXU A;  3O1B A;  4JKB A;  4YDU C;  1IG8 A;  3D2E A;  4K42 A;  3CXC M;  3CJ7 A;  5AQM A;  5JVG L;  4JEP A;  2D0O A;  2YHY A;  4WQ5 C;  3EKS A;  1BUP A;  2E8A A;  2FF6 A;  1S22 A;  2CGL A;  3F5T A;  3SLC A;  4BR5 A;  4H5V A;  3FFK B;  4ILG B;  1VQ7 N;  1SQK A;  1VAZ A;  5AQF A;  2BTF A;  3VTI A;  4FWM A;  1GLD G;  3OW2 M;  4A2A A;  2P9K A;  2HST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...