4IG0A

Hiv-1 reverse transcriptase with bound fragment at the 507 site
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
556
structure length
556
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 160
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig0A05
3HVTB 4DFJA 2BQ3A 4RNHA 1N56A 3NF6A 4KTWA 3DRSA 4RNOA 3T5JA 2UVWA 2XRIA 2Z1HA 4EP4A 3H4BA 1RILA 2EX3A 3OYCA 3E01A 3MECB 5F8IA 3Q8QB 1U47A 4IR1A 1BIUA 1HYSA 1VSDA 1T03A 1S9GB 2XY8A 4B8CA 5KG1A 3LANA 2D3UA 1S1UA 1VSLA 2DPJA 4CEOA 2WK4A 2F8TA 3KLEA 1RBRA 4FLYA 2KFNA 4FM0A 3F9KA 1BISA 1SKSA 4URSA 1WAJA 3CIZA 4Y3CA 4G1QA 4JUZA 4OJRA 1SL2A 3SNNA 3DI6B 4H4OB 2YKMA 5DQIA 3MR2A 4DU3A 1TK8A 2W42A 3O4QA 2ETJA 3HM9A 4KAZA 1NK0A 2D3ZA 2GIRA 2WONA 2B6AA 3SPYA 5K14B 3LZJA 4F50A 3UR0A 4DQRA 1SUQB 4LSNB 1NJYA 3IAYA 4H8KA 2AU0A 5KFWA 4M94A 1RT2A 3BSAA 3KLVA 5KT6A 3VQCA 2VA3A 3H5XA 2OPRB 4CGGA 4Z4IA 1OS5A 1G15A 3BSOA 2F96A 3AVLA 3KLIB 2BE2A 1RT4A 3AO2A 4CJ5A 1A5VA 1HYZA 3ZCMA 4H4MA 1CXUA 2HNZA 3NF9A 4NLYA 4E7LA 4WZMA 4Q8EA 5I42B 2ZKUA 2XY7A 1O1WA 2YV0X 1S9EA 3HVAA 1VSKA 1RT1B 3IG1B 2R7YA 4CFDA 1C1BB 3QEIA 3SV4A 5SZTA 1T05A 4IH7A 2ILYA 2XY6A 3ZSQA 4KBIA 3ZT2A 3K5LA 3EZUA 3KOAA 4Y1CA 5CYQA 1CZ9A 3HVRA 5KFPA 2IJNA 1S5JA 3NH1A 4WZQA 4KHRA 3GIJA 3CO9A 2WTFA 3GILA 4EBDA 5DGBA 5C25B 4ICLB 1LAVA 4HHTA 2ILZA 2G8IA 3PY8A 4U6PA 4KAIA 2YNGB 2BRLA 3PW2A 4CHNA 1XI1A 3NFAA 3S3MA 1REVA 1DTTB 1EXQA 3SV3A 2E9RX 2IM0A 3TANA 4ECRA 4E3SA 4DL3A 4FJ7A 3QIDA 5KFEA 4DQSA 4CE9A 4KHWA 1ASWA 4OKKA 5KG4A 2J6TA 1ZBHA 4I7FA 4ED8A 1TK5A 4TY9A 3RTVA 2DPIA 3A2FA 2IS3A 3OS2A 3CQ8A 3RAXA 3H2LA 1MMLA 3PV8A 4URGA 2WOMB 4DSJA 3NE6A 2LSNA 5C5JA 4Z4GA 5KFNA 2FLNA 3BQ2A 1F21A 5FRNA 4E7IA 2AQ4A 1S10A 1NHVA 1C1AA 3QGHA 4EYIB 4LQ9A 2HNDB 2E9TA 5J2PB 4H54A 1J9AA 3DRPB 5KFAA 4FLZA 3KD1E 3ISND 5CZ1A 5I3UA 4BWJA 1JKHA 2P5OA 4PQUB 4KE5A 5D3GA 3G0ZA 4I2QA 4FBUA 2HW3A 2G8KA 3QERA 1BL3A 3AO1A 3AA4A 1S97A 1LV5A 1YTAA 2F8EX 4ELTA 1JLCA 1N6QA 1CSJA 5DQGA 5J2MB 3TAMA 2BANA 4KSEB 2HHWA 3MEEB 1T7PA 3DM2B 4FJ8A 4M41A 3VQEA 4QW8A 4M45A 4YMEA 3JYTA 3PHEA 4Q45A 3BJYA 4DF8A 1D9FA 3ITHB 1RT6B 1TVRA 4HUEA 4E7KA 4CJEA 4DLEA 4ZP6A 2RDJA 1KVAA 4KTZA 4JS5A 3QGGA 4J9MA 1NKCA 2RPIA 1UA0A 4ID5A 3GIIA 1L5UA 3TAPA 3OYNA 3DLEA 4FJXA 4TY8B 4DSKA 5HLFB 5KFMA 5KG6A 2C28A 1DLOA 1NHUA 4K4XA 3AVAA 3U3GA 3NF7A 5KT5A 4LSLA 1TL1A 4O4GB 2VG7A 4RU9A 4TQRA 1IH7A 4BWMA 3QZ7A 4OGEA 4BE1A 4BE0A 2Z1JA 4CK1A 4KRFA 2UUTA 5CY4A 3D5MA 1NK9A 4IRDA 1S0MA 4ZP7A 4CERA 4F3TA 1ZYQA 4DTOA 1LWFA 4M3ZA 1XR6A 1S0NA 4DU1A 2VG6A 3LZIA 3KIOA 4CEEA 2DFFA 1RDBA 2FBTA 1JXEA 4E7JA 1TV6B 4K4UA 4MKAA 4Z4EA 1ZBIA 4CHOA 4JV1A 3RMBA 5KG5A 3CM5A 3SPZA 1LWEB 5DQHA 1S6QB 5HBMA 1IKYB 2V0NA 3V6DB 3C6TA 1TQLA 5KG3A 3V81B 3DYAA 5CYMA 1S9FA 1VK0A 4DLGA 4RW7A 3D28A 4IRKA 4RW8B 1X9MA 3ASMA 3HT3A 4CHYA 2JC1A 2JGUA 1ZBFA 2VA2A 4IFYB 4R8UA 4TYBA 4O3NA 1S6PB 3DMJB 3UPFA 3FDSA 4ZVGA 3OL8A 2FJXA 5L1IA 3NBPB 3N6MA 5KFRA 1JLGA 4DSEA 4NCGA 3HVWA 3H59A 1HNIA 4KKOB 4CFCA 4K4SA 4CEDA 2E9ZA 1S1WB 3KK2B 2ASDA 3CDWA 2JEGA 4KFBB 1XWLA 1MU2A 4DL2A 1JLGB 3KHHA 1GOBA 4IG0B 2JEJA 4O4RA 2V4QA 4CCHA 5KFGA 4I2PA 3QLHA 1EP4A 1HMVA 4E0DA 2OZSA 3UQSA 5KFKA 1A5XA 4JV2A 3L8BA 4JRQA 2IAJB 4GVMA 3FQKA 4KPYA 3HSTB 4B9LA 5DG8A 4PA1A 3BSNA 4E1NA 2HHTA 5HP1B 1X1PA 5F8JA 2QXFA 3CM6A 4CJFA 1NJXA 1WSFA 4M3XA 5HROA 4DQQA 3DLBA 1RTIB 1BQNA 4PWDA 1T8EA 4O44A 3M8RA 2J6UA 2A1SA 2IA6A 3N6LA 2HHVA 3RR8A 3SFUA 2JLEA 5KGXA 1RBVA 4LH4A 4CIFA 4Z4CA 1WAFA 2HHSA 5EWEA 1JLFB 2D0AA 3DLGA 1TGOA 4TN2A 4IFVB 4C8MA 4DQPA 2YNFB 1NKEA 3P1GA 3GYNA 4ECZA 1B9DA 2ALZA 1UOCA 4CEFA 2AGQA 2ATLA 5CZ2A 4EZ6A 1TKTB 3TI0A 2HAIA 1KCFA 4CJKA 1W9HA 4KO0A 4ZPCA 3AVHA 5E41A 3PO4A 4M95A 4LH5A 3PW0A 1LW2A 4RNFA 2P5GA 3CDUA 1KRPA 1HJRA 3MR3A 4E7HA 1RDAA 3SCXA 4O5BA 4EO8A 1TKZA 5HRPA 2XI2A 5FDLB 2ZE2B 4W5NA 3OLAA 3VQPA 1WNSA 4ZMMA 3H40A 3SQ0A 2Y1IA 1RT3B 2RF2B 2OA8A 2D0CA 1BI4A 2FJVA 4J9QA 3VQDA 4FJGA 2W8LA 3AA5X 3QESA 4LY7A 3G10A 4CJTA 3TQ1A 4WE1B 4KHSA 1NNDA 4K50A 1TAQA 1WSIA 4M3YA 3U3YA 2ZD1B 4Y2AA 1DTQB 3V4IB 4IG3A 3C95A 4NLVA 4CJRA 4Z4HA 3MXJA 4B3OB 4ECTA 2FVSA 3V6KA 4TSXA 4FVMA 3AO3A 2AJQA 4RZRA 3NAHA 3PO5A 5C24B 3DLKB 4PUOA 4CFBA 1FKOA 4ZPDA 4MFBA 1IKXB 3OL6A 1KLMB 1SV5A 5EU7A 4DL4A 1RTJB 3IGNA 1VRTA 2HMIB 4QWEA 1WLJA 2A1RA 2JEIA 2XY5A 3M8QB 4RNNA 3OYKA 3C6UB 4IQXA 5KFJA 1U45A 4ECYA 3OYHA 1FKPB 3NMAA 3P5JA 1QUVA 3WNGA 2R2RA 5T7BA 2YNIB 3NGYA 4J9NA 4F4XA 3ZSXA 4C8LA 3NGDA 3MECA 1XR7A 4FZXC 1LWCB 4J9PA 1Y97A 1S9GA 2C2RA 3OSNA 4Y34A 4K4ZA 3MFIA 3AA2A 4CHPA 1S1TB 3KK1B 1BQMB 1WN7A 4CJQA 3OY9A 3KLHB 3DI6A 4H4OA 4YR0A 3MEGB 2AX0A 4FJKA 1ASVA 3CFPA 5T14A 2OPSB 2RDIA 1VSHA 2YHAA 4DQIA 4QW9A 2R8IA 5K14A 2R8KA 3K58A 3AVCA 3EPGA 4QWCA 1SUQA 4FM1A 4OVLA 3OYAA 4LSNA 3QIOA 4GMJB 3OYIA 2FLLA 1HPZB 2OPRA 2R8HA 4CJPA 4CF9A 2FVPA 4CF2A 3KLFB 1B9FA 1D9DA 1SH3A 3PZPA 2C2EA 4R5PB 3KLIA 4B9VA 3VQ8A 3KJVB 1XHZA 2OZMA 3SYZA 2BRKA 5KRSA 2HHUA 4DTUA 3UIQA 2IJFA 5J1EB 3VQQA 4K4VA 3ULDA 4J9KA 5I42A 3EPIA 4FJNA 2JC0A 4XPCA 3Q8SB 1S1VB 3O4NA 3CFRA 1EETB 5L1LA 4B9MA 1RT1A 3IG1A 2OYQA 4I9LA 1C1BA 3IRXB 1B92A 3VA0A 4FZYA 3RB6A 4EZ9A 4ED3A 2B4JA 1QE1B 4CJLA 2XCAA 1U4BA 3LP2B 2C22A 3MXMA 2PYJA 3AVKA 5J2NB 4ID1A 4L8RB 2W9BB 2UVUA 3NGIA 4ELUA 4ZHRB 4KHYA 3I0RB 4Z4FA 3TAGA 1KFSA 5C25A 4ICLA 4YR2A 4KHNA 4YQWA 3SQ2A 3K5NA 4FYDA 2YNGA 4KHMA 3V1QA 4N76A 2OPPB 1DTTA 1D0EA 4EBEA 1L3TA 3Q8PB 1QSYA 3KHGA 3AVJA 4ECUA 1WNEA 3IS9B 3SQ1A 4MIAA 4NLPA 4RG8A 3I8DA 2G8WA 1CZBA 2CKWA 5DK5A 3WNHA 4OPJA 3ZT0A 1N5YB 4J2DA 5F8LA 3BGRB 4NZ0A 3M9NB 3D0PA 1U49A 3FRZA 4CF0A 4M3TA 4CHZA 3AVMA 4MK7A 1FXXA 2WOMA 4BACA 2DTUA 4TXSA 3TR8A 4LQ3A 3L3UA 4CFAA 3LPUA 3BREA 4FLWA 1JL2A 2HNDA 5C42B 1Z4UA 4M3WA 5J2PA 1D1UA 4CIGA 3DRPA 4RW4B 4BDYA 1VRUB 2G8UA 1I3AA 5SWMA 4PQUA 1GX6A 1WSGA 4XO0A 3ZT1A 3EY1A 4LD0A 2B43A 2HWIA 3L3VA 4DG1B 4DL6A 4F2SA 4RW9B 3SI8A 2YKNB 4NYFA 1RTHB 2R2UA 4DS4A 3B6OA 5J2MA 3V9WA 4EBCA 4Q0BB 3MEEA 3BQ1A 3DM2A 3ZT3A 4ZTJA 4EO6A 4MK9A 1HQUA 1BCOA 3T5HA 3ITHA 1RT6A 2HNYB 4DMNA 4FJLA 2FC0A 5HRRA 1BIZA 4G3IA 1JLAB 4URQU 3MF5A 4AHCA 2E6LA 3HYFA 1NK6A 2V9WA 3K5OA 2KZMA 1HQUB 1J5OB 1L3SA 3LDSA 2IOCA 3CDEA 5KTQA 3PW5A 4FM2A 1QAIA 1RTDA 4ZPAA 3RB3A 2W9CB 4TY8A 2PY5A 3WNEA 5HLFA 4R0EA 4ED1A 2FBYA 4PY5A 3RRHA 4RW6B 1ZETA 1RT5A 4XIUA 2XCPA 5J2QB 3QNOA 1ITGA 1ZTTA 4W5QA 3F73A 1RTDB 5KFZA 1IO2A 1JL1A 4O4GA 3QZ8A 1C0UB 2KW4A 1U48A 2XWYA 1RNHA 1XR5A 3L2UA 1RT5B 4OKEA 4ZVFA 3G6XA 1TAUA 1N48A 2VG5A 3QO9B 2D41A 2QKKA 4FJ9A 4ED0A 3SUPA 1S1XB 2RKIB 5EWGA 3LAMA 3HJFA 5JXSA 3T5LA 2VG5B 4DWIA 4ZP8A 3KMQA 4CJWA 2XGPA 1TV6A 3UDLA 3ZSZA 5DLGA 4NYNA 3NL0A 2NUBA 2I5JB 1HNVB 2R2TA 4FK4A 5L9XA 4B08A 1LWEA 4FZZA 1S6QA 1IKYA 1NK8A 3V6DA 3NF8A 3PVXA 4WYLA 3ZSRA 2PZSA 3V81A 4RW8A 3SI6A 1YVUA 3SZ2A 4KV8B 4FW2A 3V1RA 2AWZA 3CWJA 4IFYA 4E89A 1RT7B 4QCLA 1S6PA 3H08A 3DMJA 3MTKA 3TABA 1TL3B 4DEZA 1U09A 3AO5A 3OYLA 3NBPA 3CYMA 4WXWA 4F4WA 3M8SA 2W7PA 4KKOA 1QS4A 1U04A 2IC3B 4FLVA 4J9OA 3T3FA 1S1WA 2AX1A 3NGZA 1VSMA 3K5MA 3KK2A 1EX4A 1UWBB 3NKYA 5DLFA 4KFBA 3HO1A 3B6PA 3QEXA 1S4FA 4IG0A 3DOKB 1QSLA 2ASJA 3MR6A 2G8FA 4WFXA 4EEYA 3OJSA 3THVA 2HWHA 3G6YA 4N56A 2HVHA 2D7SA 4Y2CA 2IAJA 1NOYA 2E4LA 2W7OA 4WXOA 1GOAA 1T3NA 3O3HA 3L2VA 2J6SA 4NLRA 5HP1A 3LP1B 4O0JA 4FJMA 3IGVA 4K4WA 4AHVA 3QEWA 2EC0A 1RTIA 3I5AA 3I5CA 3FFIB 1IG9A 3VQ4A 3ZSWA 4DTPA 3SUNA 4IOBA 3AVNA 1C0TB 3RBEA 2KQ2A 3QIPB 5KFHA 3NHGA 2X6SA 1Q9YA 1UA1A 5F8MA 1JLFA 4IFVA 3CJ2A 5FRMA 1IM4A 3ZSYA 1C0MA 2YNFA 1ZTWA 2BQUA 1RBSA 4J2EA 1TKDA 1QHTA 1T94A 4IDKB 4ZTFA 2O5DA 2D0BA 3KKSA 3NH0A 1LW0B 5F8GA 3KLGB 4CEQA 4IKAA 3CJ5A 3MAQA 3LAKA 4NLOA 4J9LA 1TKTA 1R0AB 4HUFA 4K4TA 4GW6A 1TKXB 5F9NA 2R2SA 3ISNC 4Q8FA 1JLEB 4FLXA 3GV8B 5KRTA 4F4YA 1GX5A 1RYSA 2FVQA 2DFHA 1C1CB 2IBKA 5KFYA 3S9HA 4CGHA 3DOLB 3S3NA 3RB4A 1LAWA 1QAJA 3DDKA 5KG7A 4BDZA 4KTQA 3QETA 4ED7A 4CECA 2HHXA 1FK9B 2VWKA 3LP0B 4B9SA 3RMAA 4J9RA 5FDLA 3C94A 2ZE2A 3MEDB 3H5UA 4KB0A 3KKRA 4ECSA 1RT3A 3HHKA 4DF4A 2RF2A 4FJJA 2AGOA 2DFEA 4OL8A 3CJ0A 4O55A 5F8HA 2Y1JA 4O3OA 3GIKA 3P83D 3RBDA 5L1JA 1Q9XA 5KI6A 4CIEA 2QKBA 1K1SA 4WE1A 1TP7A 3BR9A 4IR9A 4I9QA 2KZZA 4E1MA 4J9SA 4W5OA 1SKRA 2ZD1A 1S49A 4ED2A 5L1KA 2JEFA 1XHXA 1DTQA 3V4IA 3VN5A 4W5RA 4B9NA 1BHLA 3SFGA 4E19A 4CGIA 3HPHA 4KHUA 4B3OA 4CEAA 3QGIA 3OVNA 4NLSA 4DFMA 2G8VA 4YR3A 4CJSA 5C24A 3DLKA 4HVJA 3PJWA 3OYMA 1SH2A 3CVKA 1IKXA 4WFZA 1KLMA 5DG7A 4J2BA 2CJQA 3OYDA 1RTJA 2Z1IA 4NCAA 2HMIA 4AHTA 3Q8RB 2UVRA 3M8QA 4ECVA 3C6UA 4WFYA 5KFFA 1RDCA 3JSMB 4DU4A 4F8RA 1FKPA 3KTQA 2C2DA 3M8PB 2YNIA 1K6YA 4QWBA 2HVIA 3L2RA 3SUQA 2PYLA 3HP6A 3L2QA 4DL7A 5EDWA 3MXIA 1JLQB 4DL5A 3RWUA 1LWCA 4M3UA 5KFDA 2YNHB 3OS0A 1IKWB 2HB5A 1I6JA 4TLRA 5KFUA 3HPOA 3CFOA 3U6FA 1KSPA 1SL1A 4F4KA 1S1TA 3KK1A 2WRMA 1BQMA 1X9WA 3L2WA 3DRRB 3AVGA 3KMSA 1UAXA 1Z26A 1J54A 3KLHA 4F4ZA 4CESA 1NK5A 3MEGA 2XI3A 2OPSA 4QAGA 4MQ3A 2E6MA 4ZP9A 1JLBB 5DMRA 4M42A 1CLQA 3N6NA 3GQCA 1ASUA 3EZ5A 3BSCA 1HQEB 1YTUA 4B8AB 3TAEA 2XGQA 3I0SB 3DLRA 2KTQA 1HPZA 1VSIA 4AHSA 1K1QA 3DRSB 3KLFA 4BDPA 1W0HA 4R5PA 4O3RA 4CEZA 2O4IA 2QE5A 2X6NA 3KJVA 5KGWA 4X2BA 3NCIA 4F2RA 4KI4A 3E01B 5J1EA 4ELVA 1JX4A 1BCMA 3KHLA 4DTNA 1HYSB 5DG9A 1T03B 4CK2A 4FXDA 1S1VA 1EETA 1S1UB 3KLEB 3VQBA 5KFCA 3IRXA 5DGAA 1QE1A 1RA7A 1NK7A 4G1QB 3LP2A 4O3QA 3V9XA 3SJJA 1IKVA 4XPEA 4CGFA 2YKMB 2KFZA 5J2NA 4DTMA 4CF1A 2W9BA 2WB4A 4ZHRA 2WONB 3MR5A 4CK3A 2B6AB 3I0RA 3D45A 3M9OB 4FLUA 1IKVB 5KG2A 1JXBA 5KFVA 3V9ZA 3QYYA 1NJWA 1JIHA 1RT2B 3K2PA 4NLGA 4FLTA 2IM1A 2OPPA 1NOZA 4N47A 3PUFA 2B5JA 2BE2B 1RT4B 3BQ0A 4FCYA 3IS9A 4H4MB 2OPQA 2HNZB 5KT2A 4O3PA 4ECQA 1JXLA 2B5JB 4UQGA 5JS1A 1N5YA 4K4YA 1S9EB 3BGRA 3HP9A 4DTRA 4QOZB 2IM3A 2OPQB 3PX4A 1T05B 3LALA 1KHVA 2BR0A 4RNMA 3OYEA 1BGXT 4C8KA 2FBXA 2UVVA 5JS2A 1S48A 4FBTA 5CYQB 3H5YA 1KHWA 2XO7A 2FLPA 4HKQA 5C42A 4OLBA 3AO4A 2QV6A 2UUWA 4RW4A 3QINA 3SUOA 1VRUA 3V9UA 4O3SA 3CG7A 3LWMA 1NK4A 1REVB 1KLNA 1KVBA 4IH5A 1TK0A 2V4RA 4DG1A 1QTMA 2FVRA 4OLAA 4RW9A 4YNQA 2YKNA 4TQSA 1RTHA 4I7FB 4FS1A 2I1RA 2W8KA 3PX6A 4Q0BA 3AA3A 3OS1A 3FSIA 3RB0A 3HPGA 3TAQA 1YVFA 4WYWA 1WSHA 3VA3A 1WSEA 5KFIA 2HNYA 4C8NA 4DTSA 1N4LA 2R8JA 4FS2A 2FJWA 1JLAA 4DTXA 1NJZA 4CJUA 1J5OA 5KT4A 3V9SA 3T5KA 1L3UA 2BQRA 3RMCA 2GV9A 3IN5A 3CJ3A 5KFOA 3GV7B 2OH2A 2BDPA 1L3VA 1D8YA 1I39A 2W9CA 1HRHA 3H4DA 3OYBA 3DLHA 4KREA 4RW6A 5I3UB 5J2QA 3RRGA 1JKHB 1KTQA 2D5RA 3PX0A 4GC7A 1YT3A 5D3GB 4I2QB 3NAEA 1C0UA 1EKEA 3K57A 1RA6A 3PR4A 3KD5E 1JLCB 3QO9A 1N6QB 1W25A 4C8OA 4Y1DA 3TAFA 3TAMB 3KHRA 3VQAA 4Q43A 2BANB 4HCCA 4AH9A 1S1XA 4N41A 2RKIA 4QWDA 4NYZA 2X78A 3JYTB 4J2AA 3NDKA 3QNNA 4OGCA 1TVRB 3V1OA 5F8NA 3RR7A 2WHOA 2I5JA 1HNVA 1WSJA 1A5WA 4OKJA 3LPTA 5KFBA 1Z25A 1J53A 4JS4A 4ECWA 3CJ4A 4CGJA 1VSEA 1Q8IA 4HYKA 3HXMA 4ID5B 2IMWP 3DLEB 3I5BA 2G8HA 4KV8A 2Z1GA 1DLOB 4JLHA 1RT7A 3OJUA 4K8ZA 3H98A 4GC6A 1TL3A 1HYVA 4FK2A 4M3RA 4LSLB 1TL1B 4IKFA 2VG7B 4W5TA 5KFSA 5FROA 4BE2A 2IC3A 3K59A 3OYFA 3EYZA 4JRPA 1UWBA 3RAQA 3ZT4A 4MIBA 3RMDA 4HTUA 3DOKA 1LWFB 4DFKA 2VG6B 4Z0UA 2IM2A 2BGGA 3AV9A 3OL9A 3WNFA 5HBMB 3V6JA 2HHQA 1ZBLA 3C6TB 3ALYA 3OYGA 4NLQA 3VQ5A 3LP1A 3GIMA 4DTJA 2DY4A 1C6VA 3DYAB 5CYMB 2XC9A 4RW7B 1S0OA 5KFTA 5F9LA 3HK2A 4CEBA 3FFIA 2YHBA 3VQ6A 3NAIA 4R8UB 4EP5A 1SH0A 1C0TA 3QIPA 1SKWA 2P51A 5KT3A 4KB1A 4CF8A 1RAJA 4NCGB 1HNIB 2ASLA 2GIQA 2P1JA 5HRNA 2FVCA 3ZSOA 2R8GA 3SQ4A 1RCHA 4IDKA 4KB7A 2VWJA 4DFPA 3ICLA 3G6VA 1MU2B 1LW0A 3PW7A 2FBVA 2IGIA 3QEVA 3KLGA 2X74A 4ECXA 1D5AA 1KFDA 4I2PB 1HARA 3QLHB 1EP4B 2AGPA 4DSLA 1HMVB 1R0AA 3OSPA 1TKXA 4NRUA 1SL0A 4B9TA 1JLEA 5KT7A 4MKBA 1X9SA 4AHRA 3AVFA 1RBUA 4FJ5A 1C1CA 3E51A 3LP3A 2GC8A 3DOLA 5KFXA 4OPKA 4IH6A 4TYAA 3AVBA 1QSSA 4ZPBA 1FK9A 4FJIA 3LP0A 4Q5VA 5HROB 4NLWA 4QPXA 1BQNB 4PWDB 3MEDA 4O44B 3OLBA 3PW4A 2Q3SA 3G86A 3S3OA 4EYHB 5KFQA 4ZVEA 4FK0A 2F8SA 1VSFA 3DLGB 4CJ4A 1QQCA 1ZBUA 5KFLA 4NLXA 4JV0A 4CJ3A 4O0IA 5EUHA 1NKBA 4IBNA 4IRCA 1XC9A 4DSIA 3AVIA 1RBTA 4AHUA 3OHBA 2ATQA 4HCBA 4KO0B 4YFUA 3OHAA 1LW2B 3H5SA 4KHQA 2W9AA 5KG0A 2ZQBA 3GV5B 3HL8A 4RUCA 4F3OA 1RDDA 2IDOA 1RDRA 3FQLA 4NLTA 2WCXA 2EHGA 4NCBA 3PJXA 3JSMA 3TVKA 1TKZB 2GBZA 4RUAA 3M8PA 3VQ7A 4NLDA 4Q44A 3MFHA 2GUIA 3LWLA 4HUGA 4MH8A 1RYRA 3OL7A 4K8XA 4ED6A 4CGDA 1BI4B 5JUMA 3KK3A 3O3GA 1JLQA 4DSFA 3HKWA 4KI6A 2YNHA 1IKWA 3PR5B 2RN2A 3OYJA 4NRTA 5EWFA 4ZVHA 3M9MB 3QEPA 3KK3B 4IG3B 4FJHA 5HRSA 3T19A 2XHBA 1CXQA 4DS5A 3DRRA 2ITGA 3O3FA 3TWHA 4B9UA 4AILC 3V6HA 4U7CA 4CHQA 3ZSVA 3KNAA 4CJVA 1C2PA 4FW1A 3TARA 3HVTA 3T1AA 1JLBA 4PUOB 3NH2A 1FKOB 3VQSA 4MFBB 2O4GA 1GOCA 4NLUA 1HQEA 1SV5B 1KVCA 4MK8A 4N5SA 1VRTB 4QWAA 2QK9A 3BDPA 1VSJA 3VQ9A 4YP3A 3I0SA
chains in the Genus database with same CATH superfamily
3EKSA 5F0WA 4KTWA 3PDNA 2ZJRQ 4IUFA 1XMOK 2Z1HA 2P9UB 3DGPA 3QT6A 3F44A 4JBCA 4N7TA 3E01A 3MECB 4CDIA 3Q8QB 5GVQA 2RMLA 1BIUA 1YAGA 4DU8A 2XY8A 5KG1A 5LT5A 1S1UA 2CQGA 2F9WA 4CEOA 2F8TA 2QYCA 3F9KA 2OANA 5BRFA 4OHZA 1S76D 2A3JA 1SKSA 3G82B 4NYOA 3ZZYA 4JUZA 2DRDA 1M5PC 1V3RA 4H4OB 3CCJN 2DNYA 2YKMA 1S7HA 2ETJA 3HM9A 4KAZA 1NK0A 2D3ZA 2GIRA 2NSBA 2E1ZA 2B6AA 4F50A 3KKFA 2GHWA 3IAYA 2HWTA 2P9PA 2ZM6K 4DV0J 4PXBA 1YITN 1RT2A 5JVHL 2OPRB 1GLBG 4XH5A 1G15A 3BSOA 2DNOA 1WF2A 5CE3A 3OV7A 1RT4A 4YUDA 1A5VA 1X3NA 1U7LA 1CXUA 5AQNA 4B02A 3NF9A 4KH5A 1VOMA 2RS8A 1CZAN 3GJRB 1O1WA 2DXFA 1RT1B 3IG1B 3MM5B 2R7YA 1C1BB 1HNZK 2Q0RA 4IH7A 3JS9A 2DR6A 3BO3A 4ENOA 2UXCJ 1NAQA 2GO8A 4KBIA 4PG7A 3MM6B 3WDOA 1O5JA 2W4CA 1Q8LA 1Z05A 1B7YB 1SQEA 1KQGB 3GL1A 3FNNA 5KFPA 1WF0A 1S5JA 3NH1A 1KQSM 2YVSA 3AXMA 4DV7F 4EBDA 1NM1A 4CO4A 4HHTA 2ILZA 2G8IA 5GADU 1RAEB 2GX8A 4KAIA 3US5A 4CLYA 2H54B 4CHNA 1XI1A 3S3MA 1REVA 2VPYB 3SV3A 1CJVB 1GT8A 3VENA 2IM0A 3Q23A 1S7IA 4E3SA 4DL3A 2QGFB 2C2OB 4ZA1A 3HSCA 4CE9A 3KJNB 2V8DA 3RTVA 2MEWA 2P5VA 2QYGA 2O01C 2FYXA 3OS2A 2ZITA 4BC7A 4IJAA 3C15A 2DR8A 1HR0F 3T69A 1RB0A 3NE6A 2LSNA 4DX5A 1Y00A 1VQPS 1KOHA 1HBUB 3LO3A 4ZITA 2FLNA 1F21A 3ZTRA 1RUSA 1ATRA 3ILJA 4CO0A 4DUZK 1NHVA 1C1AA 3X1LB 2FTRA 3IBWA 4LQ9A 4UY8O 1FDDA 4U7BA 2LXUA 1RDUA 3VETA 3NNHA 2NQPA 4OHWA 1WELA 3TVZA 2Z56B 4LFCK 4B3RK 3CF5Q 2G8KA 1BL3A 5AQIA 3AO1A 3NVMA 2QW9A 3AA4A 2RHQB 3AOBA 3H1QA 2HF3A 1QAYA 4Z7YA 4KC5A 1C4AA 2ZH8A 2LECA 4F04B 5FPMA 2BANA 1ZZFA 2QEXN 3R2CJ 1NGAA 4JKAA 2VZ9A 3PHEA 4KIAA 1FD2A 1Y10A 3S7RA 2VJVA 1FVQA 2ZNYA 3H8YA 2CADA 4W98A 2HQGA 5IC4B 2DNKA 3MWBA 1NKCA 4QPTA 1GLLO 3CMAS 2ZDPA 2VU5A 3R5JB 1KONA 5HLFB 5KFMA 2ASPA 2UU9J 2AEFA 4PWWA 4WFAQ 1NHUA 3RYLA 5KT5A 1TL1A 2NPIA 3K8WA 3LDOA 4JAXA 4OGEA 2Z1JA 3LM9A 4CK1A 2B7CB 5TKWA 2R42A 4MYTA 1SQGA 4YDUA 4IRDA 1QVFR 1QQMA 3QICA 4CERA 2PD1A 3VF6A 1ZYQA 3T9ZA 5AQYA 1RE1B 1LWFA 4CBWA 4M3ZA 1XR6A 2CXEA 3LZIA 2DFFA 4X4RA 3U7JA 4YOVA 2BJEA 3OPKA 3PXGa 3HI9A 1Q7YO 5GAEU 2GWJA 2DNRA 2XNRA 3LL3A 1LWEB 3V6DB 2OUGA 4ZS6A 4HTJA 3DC2A 3R9PA 3DYAA 4HLBA 4RW7A 4IRKA 4NEYA 3ASMA 4CHYA 2ITMA 4IFYB 1S6PB 1B99A 2U2FA 5JVGL 2O8DB 5L1IA 4YB7A 4DSEA 4DR5F 2L9NA 1WKKA 5LSRA 4A47A 2P9SA 2JEGA 2AYEA 3OBWA 1MU2A 1JLGB 2V4QA 1TR0A 2QN6B 2W4PA 4RR5A 4ZCKA 3L8BA 4FYWB 1F9EB 4A8FA 2C3UA 4BRQA 4JRQA 3QSYB 4KPYA 3IAS9 4B9LA 4OI1A 4GY2B 2PEHA 2YX7A 4E1NA 4BRAA 3CM6A 5F8JA 4UT4A 3HSGA 2ZJPQ 3E3XA 1SJRA 2EBEA 3WIUA 3NRBA 4F25A 2VOPA 1R8CA 1FJ7A 3BBCA 1Y64A 1T8EA 3FEXB 2A1SA 1RAGB 2B3TB 4JB8B 2P6SA 2G0IA 2RIJA 3LDLA 4O5FA 2V7YA 2M88A 4QR2A 3SFUA 4KR0B 2JLEA 4TN2A 1JK9B 2O8CA 2BJ3A 3GYXB 3P1GA 1FERA 5ADXH 3GYNA 4ECZA 2VYPA 2QTWA 4B3MF 2V68A 1X5SA 5CZ2A 4CLSA 1XNRF 1H7WA 3SCIE 2DCUB 3OFFA 3KYLA 1UZDA 3PW0A 5BYRA 2P5GA 4ZCIA 1T44A 1IBMF 1CJKB 3T1YJ 3NLCA 4E7HA 3WBZA 3Q7CA 2FSNA 3SCXA 4O5BA 4OV1A 3UVJB 3R6LB 4QIFA 2BA9A 4O0NA 2CA9A 1LK7A 4DV5J 3JTOA 1WNSA 3H40A 1NH7A 5KAKA 5GAGU 2OA8A 1RWUA 2VWBA 4OZ3A 4J9QA 3VQDA 4OYZA 2LCWA 2W8LA 3AA5X 2Y1RI 4BC5A 1FI4A 2HFNA 3M8ZA 1VQNS 3KK7A 4DPTA 4K50A 1U2FA 1TTHB 3P3DA 1WSIA 4M3YA 4BR4A 3P5TL 1V6HA 2V4JB 4NLVA 4CJRA 2FF3B 4A5AA 4Z4HA 4B3OB 3VZIA 2AP6A 2EG2A 3MDFA 4FVMA 3CJQA 3G6ES 4DV0F 2VF3A 4RZRA 2HURA 2BTFA 3NAHA 2HYIB 5C24B 3DLKB 1FKOA 5MLCQ 1H72C 2FGCA 2P9NA 2R7OA 4DL4A 1VRTA 2UXDK 4C0OC 2HMIB 4QWEA 1MROA 5DS7A 1WLJA 2FUG9 2JEIA 4JI8F 3C6UB 2RNEA 1UTAA 1PKUA 1Y7PA 4C3LA 1K8AT 3TTDA 3NGYA 3G9CA 3D54A 4QYZJ 3WZ0A 4F4XA 1G7CB 2QLJB 2GMHA 1KVIA 1YF5L 4AM6A 4BRHA 3PSIA 1S9GA 2UXCF 2C2RA 1R43A 3U1MA 2UUAJ 4FPBA 2HSEB 1MN7A 3QAEA 4BHQA 3ET6A 3UCZP 1UVLA 3KK1B 1BQMB 2WVFA 3HZ6A 1ZBSA 1WN7A 1HWUA 3OY9A 1FA0A 2E7VA 3DI6A 2LA6A 1RDWX 4NZ7A 4WP3A 1VSHA 1WF1A 4BC9A 2R8KA 3K58A 3AVCA 5CCMA 1SUQA 1BU6O 3OYAA 4LSNA 2NRWA 2LXFA 4XH1A 2WW8A 5B8HA 3UDVA 4I1TA 2AEJA 2DGVA 2R8HA 3PIPL 4CF9A 2FVPA 1CPZA 2QA1A 4LF8J 4B9VA 3I9V9 2BRKA 1UAWA 4B1UB 5E7OB 1N5SA 1E4GT 1NB2A 2F4VK 2P9KB 2MJUA 5I42A 3AOCA 1BWFO 4FJNA 2HVDA 1UW9A 3Q8SB 2BJDA 1S1VB 2E5JA 3O4NA 3MM8B 2FZGB 5AQSA 1R3NA 3QATA 3RB6A 1NSPA 2KYXA 1X4FA 2DHAA 1W7WA 3RSEA 2IYIA 4RWWA 3LP2B 1Q78A 1YUWA 4CLKA 1NJIO 3AVKA 1NPKA 1OY8A 2YX4A 3I0RB 4KGMA 1XIQA 4Z4FA 4ILGB 3TAGA 4ICLA 4KHNA 4YQWA 2EXUA 2E8AA 3FBCA 4NL5A 1YK9A 4FYDA 2YNGA 1KAYA 5M1PA 4JKFA 1S3XA 2AW0A 3Q8PB 3KHGA 4ECUA 2UXBF 1WNEA 3IS9B 3SQ1A 2ERRA 1K44A 3OTEA 4MIAA 2ALYB 3AD7C 4IEIA 3PFEA 5D0RA 4YHHJ 1CZBA 4OX8A 1WC3A 5ETOA 3MR7A 5F8LA 4NZ0A 1U49A 3D0PA 1WOPA 1HUXA 4CF0A 4M3TA 1FXXA 3TSUA 3AY9A 3CJBA 2WOMA 4LVOP 1ACMB 1SKUB 1VJWA 4I4BA 2UU9F 1H98A 3HFVA 3BREA 3M6WA 1VR6A 1ZPWX 4YDUC 2M2BA 3EM1A 3DXMB 2V8PA 3DRPA 4RW4B 3C3LA 1NHKL 4G9ZA 3CD0A 2W2PP 3TEGA 4OX6A 2HBYB 1I3AA 2Z2ZA 4ANCA 1EX8A 4PQUA 2NUUG 1HBOB 2EK6A 4X84A 1HNWK 1ZS6A 2QWMA 3CJSA 1GLDG 2MQ8A 3B4DA 3P38A 3WUHA 4EBCA 4RX6A 3BQ1A 3Q22A 3DXBA 3O5BA 4PG5A 4DMNA 1BIZA 3OVBA 3WC2A 4G3IA 4GNIA 4URQU 3HYFA 2V9WA 2IYGA 3K5OA 2KZMA 1L3SA 1VLYA 3GCWP 2E2OA 1X5OA 1RHRB 2IOCA 3CDEA 4JP8A 2FQQB 3EL2A 2WBRA 4M8LA 3RG6A 2CQBA 2HZVA 4DQ8A 2IVFB 2EFOA 4IEEA 4TNOA 4ED1A 3EUNA 2FBYA 4PY5A 4UQTA 1VQ9S 5K5MA 3ULEB 3F73A 3ZZOA 5KFZA 1IO2A 1CJTA 1UJ4A 3O8MA 1WKJA 3H2UB 4ITSA 2XWYA 3PEHA 1XR5A 3ZC4A 3L2UA 3W62A 1RT5B 2KYZA 1X4BA 3J7YU 3EKUA 4K0KJ 1Y9OA 2HLTA 1M90T 5JVGQ 4C8ZA 5AQQA 2LQ5A 5B08A 1QM9A 3ENWA 4DR3K 3CJTA 4HHHA 3HJFA 3D2EB 4NWBA 5JXSA 3H25A 2XG8A 4I6MA 3IR5B 2XGPA 1YRTA 1YWXA 4RCHA 3CJRA 3QJLA 4OZLA 4Z94A 4WKYA 2R2TA 4FK4A 4B08A 4JI1J 3TJ8A 2OIHA 5F41A 5CHCB 3ZSRA 5D77A 3LA0A 2PBDA 1UWAA 4X64J 2KVIA 2VBWA 3NGSA 3MTKA 4OYWA 1TL3B 4DEZA 3B54A 3AO5A 3RBZA 3OYLA 3EGVA 3M8SA 2EFPA 2V8HA 4JK7A 1MWYA 2IC3B 3FZ2A 2E1AA 4X4SA 1KR4A 1FD8A 2AX1A 5I9EB 1EX4A 1UWBB 3NKYA 4ETXA 4KFBA 1G6BA 5A2QY 1S4FA 3OBYA 1ZM4A 5EXWA 3OXFA 4G6VB 3NG8A 3T6JA 3MCOA 1DFDA 2G8FA 1V4SA 3C14B 3VWSA 3T1YF 4EEYA 3OJSA 3THVA 5AE3A 2JLFA 1MNEA 3DGVA 1NOYA 1SZ2A 1VBXA 3CCRN 4GKJK 5HVFA 1T3NA 3UKRB 2J6SA 1KQKA 4PYDA 5HP1A 2F65A 2VBXA 1XK8A 3OFEA 1E6VB 5CQGA 5L39A 1P8GA 2Y0SD 4LFBJ 3A0IX 1RTIA 3I5AA 2VPWB 2BZ2A 3K0JA 3ZSWA 3AVNA 2BOPA 1C0TB 3T1HJ 5JMVA 4FWLA 3R6GB 3QPIA 4PHTX 5KFHA 3NHGA 2QT7A 4X4OA 5H9FK 5F8MA 1Q82T 2GO9A 3A5NC 3R1XA 4LF6J 3ZSYA 5BR9A 2F63A 5JMNA 2BQUA 1KNZA 4OMFG 3NH0A 1LW0B 5F8GA 5LM7E 1P90A 3QJPA 4CO5A 4FWNA 1MLAA 1TKTA 1R0AB 4HUFA 4GW6A 2BKOA 4L76A 5LMUK 3THXA 4DDFA 5F9NA 2V67A 3AHPA 1NZ8A 2LVWA 3GV8B 4IDHA 1AUDA 1T3VA 3AXKA 2FVQA 5KFYA 4CGHA 3IWLA 3RB4A 4HH0A 3DDKA 3TZZA 4WF9Q 3QETA 4H0YB 3TNVA 1IBCB 2HHXA 4F3MA 3MEDB 3H5UA 5FPDA 4ECSA 3WEEB 1HA1A 1RT3A 4FJJA 2F3JA 2AGOA 3BY5A 2DFEA 4DV7K 3CJ0A 5F8HA 1PAEX 2YH0A 2UUAF 4O3OA 3FE1A 5L1JA 5KI6A 5A6WA 1NXIA 1S72N 1GFWB 2NSCA 4CZHA 4JI6F 2E29A 4C11A 2JEFA 1S49A 1DTQA 3V4IA 3SFGA 4CGIA 3E9PA 2V8VA 5IQQA 1DHMA 3VZHA 1YJWS 1U24A 3OVNA 1BA1A 2DTJA 4NLSA 2VDHA 4YR3A 4M7XA 4FWQA 3KJQB 2XSJA 3PJWA 1HHSA 3BBFA 4PCQA 4XDCA 2BBEA 1HR0K 3OYDA 3VAMA 5E33A 1RTJA 4NCAA 5ELZA 3NWRA 4CYUA 4LF8F 3VGLA 2W4DA 4F8RA 1VAZA 3M8PB 4WFNL 1K6YA 4DI6A 3PLAA 4QBUA 2P9LA 3HP6A 1F5BA 2HQ3A 3PRVA 4TU8A 2D3OR 4H0VB 3RWUA 1NBEB 2RB7A 4S0MA 3PIPQ 4R0JA 3GDQA 5I3QA 3W60A 5BXIA 4UY8T 6FD1A 3HPOA 1IVZA 4CZEA 3CFOA 2RU3A 3U6FA 1J5EJ 3ENQA 2WVEA 3R7BB 1GK8A 3AVGA 3MM9B 2QMXA 3CPWM 4IWVA 1R8AA 4DCHA 1R0CB 3QT7A 4F4ZA 2XI3A 3OTDA 3I55N 2OPSA 1VDHA 3O5TB 2E6MA 1JLBB 5A8RB 3N4WA 1NUEA 1RCOB 3EZ5A 4LBIA 1PG5B 2W2MP 3TAEA 2VJUA 2J7UA 3I0SB 1UVJA 3RRKA 1BMQB 4DX6A 3G8TA 3M32B 1N34F 3KLFA 4YHHF 3QRPA 2C2KB 4A8WA 4R5PA 1WJ9A 4O3RA 4XEIA 2X6NA 4X2BA 4F2RA 3QMLA 2LU2A 2M0GB 1JX4A 4DTNA 5DG9A 5LMNF 5GMDA 3UE2A 4BCAA 2HBLA 4USHA 3KLEB 4P9SA 3MCMA 2HBJA 2XMAA 3CJ7A 2ZKTA 1IKVA 4XPEA 1ZM3A 4EFAC 3VESA 4L75A 5J2NA 2KJWA 1FE4A 3PEJA 2GGPA 3M9OB 5AQGA 3FRYA 5KFVA 4H5NA 3QYYA 3IRWP 3AD8C 3CCTA 4XAKA 4KGVB 4I67A 3C66A 4P71A 3PUFA 2B5JA 2VKZG 2GJIA 2BE2B 4JI5J 1OO0B 4I6YA 4H4MB 5HSPA 1JJHA 1JXLA 3CD6S 2B9EA 4UW2A 3UO0A 4UQGA 5JS1A 1N5YA 3ENOA 4FKXA 5A8WB 4IO8A 2OTJN 2I9SA 4DR5K 4QOZB 2VUGA 1EKSA 2R3VA 2RQ4A 3CB4A 1T05B 3LALA 3R5BA 3VAGA 2VQEK 1BGXT 4C8KA 5LOQA 4ISFA 1Q8KA 3I31A 5CYQB 3QMQA 3RJMB 3N79A 2D9OA 5BR8J 2JFKA 4USIA 3GIRA 3QINA 2GVDA 4NO7A 3SUOA 5H1SQ 3DRYA 1JQGA 1Y0HA 5IZHA 3CCQS 3IO1A 4BRLA 4K0KF 2L08A 1P1TA 4H0PA 3CCWA 4BBYA 4IH5A 4YOWA 4BRKA 4DG1A 3JAMU 2Z2MA 1QTMA 1T9XA 4GV3A 4FS1A 3BB5A 3OTCA 3LGHA 2I1RA 3P4IA 4Q0BA 3QFWA 3FSIA 1Y3KA 3TAQA 1YVFA 1WSHA 4DR6J 2HBRB 1WSEA 2J0QD 4OYMA 1N4LA 2R8JA 4FS2A 3W3SA 1JLAA 3O80A 1NB7A 2Z58B 2EFVA 3R5DA 4X64F 4CJUA 4HI1A 3V9SA 1BY9A 4DV3J 4B3MK 1L3UA 3OR2B 5KFOA 1RJJA 2OH2A 5EHHA 1XNRK 4PZVA 2W9CA 2XS2A 4F0MA 3THWA 1HRHA 3DLHA 4KREA 4USUA 4ZIVA 4CTAA 3TZXA 3R8EA 1YT3A 3WXLA 5D3GB 3VEVA 2NPFA 3HRGA 2JVOA 3W9IA 2PMWA 4LF1A 2W6LA 1EKEA 2FPHX 3KD5E 2BKNA 3QO9A 1N6QB 4C8OA 2H5EA 2WSCC 3VQAA 2NRZA 4OJHA 3VAIA 4QWDA 2ZBCA 1EKRA 4DR2J 3NDKA 3NS6A 3G8SA 4OGCA 2DKOB 2XLIA 3WXKA 4LIRA 2GVZB 1UP1A 1WSJA 1F5CA 4CLFA 4LFBF 2PAVA 4HTIA 5KFBA 1J53A 4CGJA 1VSEA 4RUHA 2UV8A 3AA9A 2Z57B 3HFZB 3SQGB 3I5BA 3FZFA 2IPOB 4DV0K 3AQPA 1TYQA 3BV8A 4LF6F 5LL6d 4M3RA 2GQCA 3J80U 3GLJA 2W2QP 4NOHA 4ZVUB 2FZKB 3DHWC 3HTVA 5ETLA 5FROA 1V3SA 2L9WA 3OYFA 3EYZA 2MQPA 1BOTO 5G0RA 2QA4N 3C65A 1E6YA 5AQJA 4FWRA 2J5AA 2CJKA 5E3AA 1X5TA 1WG5A 3MMJA 2OTLS 2W01A 4NA3A 2UXCK 3A4TA 2VL1A 5CA5A 2DPNA 2JWKA 3OL9A 3UD5A 1VQ5N 5HBMB 4X62F 4QS7A 1ZBLA 1HI1A 1SB6A 3ALYA 3OYGA 2CGJA 3VQ5A 3LP1A 4UOCA 2EKYA 5CYMB 4EIAA 2CUYA 4KH4A 2ZWPA 4FPAA 1AROP 5KFTA 4JI7J 1JJCB 1OSCA 3FFIA 4JOUA 3MM7B 1JCFA 2AYMA 1BG3A 4BG8A 5KT3A 2VONA 2GNKA 1HNIB 2ASLA 2GIQA 4CLZA 2JVRA 2A6OA 2E5LJ 5DRKA 3SQ4A 4IDKA 4Y2IA 1YDLA 1JJ2M 1RQ0A 4FF4A 5ETMA 2GW8A 4RBVA 2BKPA 3GJTB 1RGIA 1VQYA 2X74A 4I2PB 3D3BJ 3GJSB 5HN0A 2PSZA 1K9MT 2F4FA 4B9TA 2OI2A 1WC1A 1UVMA 4MDBA 3JAMO 3CCSN 4MKBA 3UKUB 4AHRA 2AMCB 4FJ5A 1C1CA 4QIWD 3H45C 8ATCB 1YBTA 3ILLA 4V19X 1F1BB 1HBMB 1QSSA 1FK9A 4Q5VA 4QPXA 4DBQA 3MMVA 3R3LA 3EEQA 4K59A 4USJC 4O44B 1NPPA 2B4PA 1UW4A 2F40A 2Q3SA 3S3OA 3LF0A 4EYHB 1YXQA 2NXJA 5D4NA 4ZVEA 1FW6A 4LBHA 7FDRA 1NJIT 4FK0A 2KKHA 1J5EF 1NEEA 1HNZJ 3R3TA 3NGUA 3DLGB 1YGYA 4H4KA 3ZO7A 4WFNQ 3CJKA 4CJ4A 1VHFA 4FNHA 4N8NA 1O0PA 3PYFA 5JJBA 4HDGA 5EUHA 1NKBA 1NMDA 4IBNA 4IRCA 3AVIA 2L41A 1CC8A 2FIUA 3OHBA 4A8MP 4M5DA 3E9OA 2P6TA 2C2NA 3OHAA 3AJ2A 3KWGA 3UFCX 2W9AA 5KG0A 1HI8A 4F3OA 3ATVA 1XTZA 2ABYA 4NLTA 2WCXA 2KL8A 2EHGA 3O9TA 3PJXA 2DH7A 3TVKA 5GAHU 1CJUB 2UU9K 4RUAA 4NB4A 5AQRA 3VQ7A 1IV0A 2GAHC 3BN7A 1N0UA 1Q7LB 3NGTA 2UV8G 3M2UB 1SXLA 4HEA9 4CGDA 5GAGP 1BI4B 5JUMA 2C1EB 2ASMA 4ES3A 3O3GA 1JLQA 1WEYA 4ILHA 2YNHA 1AZSA 2RN2A 3IKMA 2XBPA 4NRTA 4ZVHA 1D8ZA 2HOEA 4DU7A 1T9TA 3C0BA 3KK3B 3OVSA 4FJHA 3CC2S 3ULHA 4DS5A 1K8KB 3O3FA 3J80O 4MAKA 1XQSC 4CHQA 1AYEA 3K5PA 3ZSVA 3KNAA 4CJVA 3EE8A 4FW1A 4BVOA 5GINA 2O4GA 4P74A 3TQEA 3UCUP 4CJ7A 1SV5B 1KVCA 4MK8A 4FWKA 4QWAA 3BDPA 3FFKB 4BROA 3VQ9A 4JI5F 4D3GA 5T7LB 3L95X 4F0KA 3IC1A 3DRSA 3AARA 4RNOA 3OTOJ 1BD6A 3G2XA 2O3DA 1S6OA 2WC9A 5F8IA 4CLUA 1VQOS 5KOWA 2IVPA 3CCUS 3BP8A 1HYSA 2HQFA 1VSDA 1T03A 4K43A 4AUKA 2OEJA 1VSLA 1LFWA 4FLYA 3THYA 1O6XA 2KFNA 5LJWA 4FM0A 3SSQA 2V69A 4LRDA 4M1KA 2VPZB 4LF2A 3QT5A 1RK8A 2H3EB 5HMZA 2MLYA 4Y3CA 5BR8F 1SL2A 4F0HA 1KBRA 1RWKB 2OAUA 3BDEA 3HBTA 1NNEA 3MR2A 1VK3A 2W42A 1MMNA 3O4QA 1WDTA 1U2RA 2WONA 2HS3A 2QL7B 2KG0A 5K14B 2M52A 3NGRA 1XEZA 3G8QA 3LQVA 1LWXA 4OX7A 3VF4A 3BSAA 3KLVA 2VA3A 4FO0A 4CGGA 5D4PA 4LF9J 3ZTPA 4OHYA 1I5OB 2UYTA 4J90A 2BM1A 2EI5A 2Z2YB 3VEXA 1HYZA 3SQOP 4X66J 4DR6F 1Q81O 3FJ2A 2HNZA 4WZMA 4HACB 1DBDA 4CH0S 2ZKUA 2XY7A 2YV0X 3GG4A 3HVAA 4DV3F 3HHNB 1UJ6A 1QY7A 4CFDA 3SV4A 3CCLN 2X1BA 3CCES 3CMQA 2NZCA 4PXEA 3K7RA 3QGPA 3EZUA 2DNPA 1FXDA 3VR1A 1XNQF 3O08A 4KHRA 3LW5C 3GIJA 1IR0A 3T1YK 3CO9A 3CCVS 2AEMA 3FCVA 5C25B 1IBLJ 3PKYA 4BQZA 2AT1B 3PW2A 1P6TA 5CAAA 1SC6A 1QTNB 4DV5K 1EXQA 1Z1ZA 3ZLJA 2E9RX 4MLEA 1IJJA 1F3FA 4FJ7A 4DQSA 4PQAA 4DR2F 4AYBD 1WOSA 1ASWA 4OKKA 4BRNA 2J6TA 1DY3A 3I96A 4I7FA 1TK5A 1G2EA 1VIXA 4I69A 4TY9A 3A2FA 4BGBA 3IDHA 2VGMA 3CQ8A 3ENBA 3RAXA 3QWPA 3HF5A 5K9FA 1MMLA 3TX0A 3M1VB 4URGA 4DSJA 3KZBA 3IWNC 1G1XA 3NCRA 5C5JA 4Z4GA 2MKCA 5KFNA 2R7VA 3DOMA 3P31A 2Z0GA 2DIUA 1S10A 4CZIA 4EYIB 3LOUA 3K8VA 2HNDB 5J2PB 4H54A 5I3UA 2KU7A 1JKHA 5EX0A 4KE5A 4I2QA 4QYZK 2W41A 3QERA 3VTHA 3UCGA 1LV5A 2YJEA 2B56A 5AZJB 5DQGA 3TAMA 5IV3A 2BX6A 4NA2A 4F02A 2YQ3A 4B3SJ 3MEEB 3DM2B 2UUAK 3CIMA 4FJ8A 4QW8A 2AJ4A 4UY85 1RHKB 3LTOA 3CW2C 4YMEA 1RWVB 3BJYA 2QLBB 4DF8A 3TWZA 5DM7Q 1B7FA 1RT6B 1TVRA 1PC4A 3G87A 3RBXA 4HUEA 4E7KA 4FOIA 3BO4A 4LR8A 4P2FA 3R8YA 3ZZ0A 2XLJA 1M5SA 1RHQB 2RDJA 4JI7F 1VQSA 1KVAA 4JS5A 4J9MA 4BRPA 3G4SN 1L5UA 2H48B 3TAPA 3DLEA 4TY8B 4DSKA 5KG6A 5AQWA 1Y5NB 4X4PA 2MKKA 3SJHA 3AVAA 1UETA 2E5LF 1ILYA 1YQHA 4LF8K 4TQRA 1IH7A 3CC7S 1I94J 5E3PA 4JKDA 1YJUA 8AT1B 1I51B 2BACA 1KVJA 3D5MA 1NK9A 2P9IA 2AYGA 3HI0A 1AFIA 5L38A 2H9ZA 4GMKA 1KQFB 1S0NA 2VG6A 5AQLA 2KXNB 3VAKA 4CEEA 1W7AA 2HQCA 1RDBA 4K4UA 4Z4EA 1ZBIA 3QQCD 4OZ2A 2V0NA 5B0EA 3C6TA 2QXLA 1TQLA 5KG3A 1VK0A 3D28A 4RW8B 2GZOA 2KB2A 3S6EA 4ZN1A 3Q24A 4R8UA 3BGFA 1PO6A 4O3NA 2B51A 1HNZF 3Q2TC 3FDSA 3OD2A 2XS7A 3MD1A 5EOYA 2DYAA 5KFRA 1VQKN 3HVWA 2DITA 4KKOB 4CFCA 4CEDA 1S1WB 2Y3YA 2DHSA 2ASDA 4YHHK 2VFTA 5I3PA 4X4TA 3KHHA 4IG0B 2YHYA 4O4RA 5KFGA 3QLHA 4DPUA 1HMVA 3FEYB 1UEUA 3EICA 2H65B 1HFEL 4E0DA 2OZSA 3NNAA 3Q7BA 4ZCMA 5KFKA 1A5XA 5D4LA 1U2VB 1KC8O 4ZLJA 2IAJB 2ZZMA 3FQKA 1QJHA 3BSNA 2QXFA 4UZBA 3TW0A 3QWUA 4M3XA 5HROA 3DLBA 2HIQA 1BQNA 3TOQA 1FEEA 3M8RA 3H20A 4XK8C 1WI8A 5AQMA 2HHVA 4FWOA 2RH3A 1X5PA 2IRYA 4JHDA 4WKRA 2VHGA 1N0VC 1RBVA 2VB6A 4CIFA 1WAFA 3GYGA 2D0AA 2JRSA 1TU0B 1TGOA 4IFVB 2JL9A 5BRDA 3WXJA 2YNFB 1NKEA 2VIHA 2FHOB 3J7AN 2B8QA 4TKTA 2ATLA 3TI0A 2DJWA 1VQ6S 1KCFA 2ATCB 4CJKA 4KO0A 4B3RF 1ZM9A 5E41A 4LH5A 1S4EA 2VQFJ 3P49B 2FJBB 4RNFA 3CDUA 2HFOA 4UTGA 1HJRA 3UNGC 4CWBA 3OTOF 1RDAA 4FWSA 7FD1A 5HRPA 4A61A 3QRRA 3E8OA 5AT1B 4W5NA 3MMBB 2Y1IA 3WC0A 2RF2B 2FJVA 4Y2MA 3D7SB 3QESA 2C3MA 4LY7A 3MHYA 3UD4P 2ZFHA 3TQ1A 4K0KK 4KHSA 2MDAA 3O8WA 5EX3A 2RVJA 1MN9A 1TAQA 4KPCA 2ZD1B 3K9KA 2VBYA 4IG3A 1CULA 4LF5J 1XERA 4ECTA 4OI2A 1XN9A 2K8GA 1RLCL 1QVFM 4Y0FA 2AJQA 3JQMA 3PO5A 4JI1K 4XH4A 4ZPDA 2RRAA 1IKXB 1KLMB 2HFSA 3IGNA 1DZ5A 4WIIA 3D1OA 1WTFA 3OYKA 2NLXA 4IQXA 1U45A 2KVQE 4X66F 1FKPB 2D9PA 2YNIB 4JN4A 2AZ1A 4J9NA 2XSFA 2EWHA 4DOZA 2P9UA 4Y00A 3SK3A 1BWEA 4C8LA 3MECA 1XR7A 3SDEB 4FVCA 4WQ4C 1R89A 2RS2A 4DV6J 2QSWA 1OH5A 1KD1O 4H0OA 4Y34A 3FEZA 4I56A 3MURP 3G82A 3ZXWA 5IM0B 1QVGM 4A57A 3KLHB 4ZPTR 4H4OA 1IBLF 3MEGB 2AX0A 4FJKA 3CFPA 3OUYB 2U1AA 1TUVA 2MSTA 2YHAA 2R8IA 5A0YB 4DB3A 2LQ8A 5THWA 4FM1A 1IR2A 1H74A 1WBBA 2JDJA 4RWXA 3EWGA 3C8YA 2FLLA 4LFBK 1HPZB 1RAHB 1URNA 3EE3A 4NLCA 2OPRA 2G2OA 3GBTA 1GLFO 4CF2A 3T1HK 2N82B 4LVNP 1D9DA 1SH3A 2HBMA 2R7SA 2QLFB 3OXLA 3BGLA 4OJ1A 1TMJA 3UIQA 3VQQA 5J1EB 2MYFA 4LF6K 3THPA 3EPIA 4M7YA 3S41A 2KKZA 4DCJB 4B9MA 1RT1A 3IG1A 5BPNA 3MM5A 1C1BA 3IRXB 2BMBA 4PXCA 2YWWA 2QZ8A 4EZ9A 5E0OA 4ED3A 2DT9A 5G4DA 3MM6A 1U4BA 4CZCA 1JXVA 1TL7B 2PYJA 5JICA 2CPDA 2E1PA 4G1IA 2R7TA 2W9BB 2YHWA 3NGIA 4ELUA 2ZWHA 4KHYA 3HHLB 3I56N 3OR1B 3PRDA 3U1LA 1OQ6A 3R1HA 3K5NA 1NGBA 3D1QA 4ZLLA 3LDQA 4KHMA 4ANEA 3DRXA 5CD4H 3V1QA 2OPPB 3NCQA 1CJVA 4LRAA 4CBXA 3CC4S 4B3SF 1M1HA 3AVJA 4PPZA 2YQ1A 1P8ZA 4KH6A 4AM7A 1XMQJ 3I8DA 2CKWA 5DK5A 2B4UA 4QIGA 3FK4A 4J2DA 3F0NA 1MW7A 3BGRB 1AFJA 3K0SA 3IUCA 3FRZA 1GXUA 4GKJJ 2I38A 2ZH4A 4CHZA 3TA1A 2ADCA 3I4HX 4BACA 4C3MA 1HBUA 3CDAA 4CFAA 2PMZD 2RD5C 3C16B 3LPUA 2FF6A 4OI3A 2A2DA 3H90A 1JL2A 1YIJN 5C42B 4CIGA 3DCAA 3T41A 4X65J 1I94F 3IMQJ 2ZOGA 1VRUB 5SWMA 1GX6A 1WSGA 4A2AA 3ZT1A 3EY1A 1DEJA 4LD0A 2Q6CA 2B43A 1X4EA 2KN4A 2RJZA 3CIPA 4F2SA 2KI2A 2CPFA 2Y8WA 4RW9B 3SI8A 3CCJS 2YKNB 1J2VA 4DS4A 3BKFA 1YHQN 3P96A 2DNNA 2E5IA 1KWMA 3ZT3A 2AKWB 3MMAB 1J5EK 5HRRA 1TZ0A 2B4OA 4AHCA 1NK6A 5CYJA 2J9EA 1YBAA 4U8YA 1N8RO 4IQMA 4CM0A 3LDSA 3PW5A 4FM2A 1RTDA 1S0VA 3MEKA 3FUYA 3WNEA 2IDEA 5HLFA 2YWEA 3RRHA 4L3NA 1ZETA 1DQAA 1MDUB 3W8GA 2XCPA 5J2QB 3BF1A 3QNOA 1Q53A 1CS4B 1U1QA 2QWNA 3BEXA 2K1RB 2V50A 1V3ZA 1CQNA 2OO4A 4P10A 4JKEA 1N32J 2YJFA 5FIIA 4ZVFA 2RHKA 5A8KB 4PEOA 1TAUA 3O9UA 2ZBIA 2VG5A 3ZFVA 2VODA 3MCPA 3IFEA 2CJAA 3SUPA 2RKIB 2OFHX 5EWGA 2DVIA 3LAMA 2E5HA 4JI4J 4J5OA 4ZP8A 3CF5L 1SS6A 3MUMP 2I5JB 1HNVB 3MUTP 5L9XA 4FKYA 1LWEA 2OCEA 3PIOL 3R6MA 3V6DA 4CZJA 4AT1B 1LKZA 3PVXA 3FBBA 4G1PA 4DZDA 4CNYA 1YVUA 4OI6A 4ZVOB 1OQ3A 5FPEA 4C8YA 4FW2A 1FT8A 3CWJA 3D6MB 4IFYA 4E89A 1RT7B 4QCLA 1S6PA 3H08A 3MMCB 2FY1A 2O8DA 3FC9A 2DNZA 4JI5K 4PABA 1YJWN 2W7PA 1U04A 4J9OA 1V5VA 2O8EA 3KUGA 2DEIA 4QIVA 4M5LA 1PGZA 4LR7A 2M5YA 2VQFF 3DOKB 5D78A 1QSLA 1M5KC 5F1XA 3CHWA 2E1RA 2XYGB 4WIQA 3MR6A 3OXGA 5DDOC 2V2KA 4N56A 3G6YA 3M6VA 2D7SA 3VGVA 2E4LA 1VJQA 1GOAA 2WAQD 3O3HA 2DNQA 3KUHA 3UD3P 2O8FB 4O0JA 5EY4A 5C2FA 5BR8K 3IGVA 4K4WA 4AHVA 3QEWA 2MY8A 1N5QA 3JXUA 3MOJB 2QEXS 4NA1A 1R8HA 3SUNA 1FRJA 2V5HG 2DGWA 3RBEA 2KQ2A 2BJ1A 2ZBQA 2D1CA 2C42A 4CBUA 2RU9A 2ZVSA 2RAQA 1D3WA 3H3NO 1UA1A 4FPRA 4LF5F 1YX2A 5FRMA 2KHDA 3M2VB 1ZTWA 4F9OA 2D0BA 1GH8A 4DR6K 3CJ5A 3MAQA 3R1LA 3O1LA 3LAKA 2ZJQL 5GAHI 1RHUB 5B0CA 1JLEB 4DV3K 3BS9A 1RYSA 1LOTB 2VGNA 1U1OA 4CP5A 3O3LA 1CJKA 3S3NA 1RHJB 4PPDA 2VWKA 3LP0B 1M1GA 3UVJA 4B9SA 3RMAA 3WQPA 4J9RA 3C94A 4GVEA 3KKRA 4DV6F 3HHKA 3ZZZA 2HRYA 4KGKA 1FESA 3GIKA 3MPDA 5ETPA 1Q9XA 1FCAA 3D2WA 1RADB 2QLXA 2NXEA 4I9QA 3EJMA 4E1MA 6FDRA 5J1PA 4BR9A 4JI0J 3PG9A 5L1KA 4WTYA 2FGOA 4W5RA 4B9NA 1YZ6A 1BHLA 2V4JA 4DR2K 1P27B 1R27B 4F67A 5B0GA 3MD3A 1RFQA 4B3OA 2I7NA 2OFGX 4CEAA 3QGIA 4CD3A 4DUYJ 1NGJA 4CJSA 5C24A 3DLKA 2P9CA 3HSZA 2ROEA 4A8QA 3UNYA 2Z1IA 4E2FB 4EGLA 2HMIA 3Q8RB 2UVRA 3C6UA 3IAM9 5KFFA 3R5AA 3JSMB 4ZVRB 4PKDB 2GA7A 2HHHJ 1KKHA 2EFQA 3R27A 2ZZNA 1TFWA 2HRTA 2HVIA 1XJWB 3SUQA 2PYLA 2X51A 2YCHA 1HNXJ 1H2TZ 4DL5A 4ZJOA 1IJEB 1YJ7A 3GFYA 5KFDA 2LLZA 1IKWB 1HD1A 5KFUA 1KSPA 4RO0A 2ZZTA 2MZSA 3KK1A 2WRMA 1BQMA 1X9WA 4ED5A 3DRRB 3N4PA 1CVJA 2FSKA 2DHGA 1UAXA 1FDBA 4CESA 3FBFA 5F3ZA 3T6BA 4MQ3A 4UUWA 5A2QO 1UL3A 3N6NA 2ZH5A 3GQCA 5AXMA 2CJBA 1YTUA 3M7VA 4OX9J 1NM2A 3W3DA 2NS1B 3LPYA 4YB6A 3O6QA 4JI7K 3KG4A 4WJBA 1C0GA 2ACMA 2QTDA 1XMQF 3SLCA 3E9LA 1W26A 3Q89A 2O4IA 3OT9A 2DNHA 1MMDA 1RU2A 1KEKA 3NCIA 1QZ5A 5JLHA 1IWAA 4GKJF 3BO2A 2P9KA 1R8BA 2E5LK 3HZEA 5AJ3J 4FXDA 1S1VA 1RU1A 2DO0A 3MM8A 1LEOA 5KFCA 4YOXA 1Q82O 2NZ4A 5DGAA 1RA7A 2DIVA 4G1QB 4DX7A 3LP2A 3V9XA 2Q1LA 4X65F 3SIPB 2KFZA 4QS9A 2WVCA 2P2CB 4DTMA 3TUIC 2WB4A 3PNIA 4CK3A 3I0RA 1IKVB 5KG2A 1NJWA 3ZYYX 3MK6A 3V9ZA 3A5MC 4W92B 3ZZTA 2GEMA 3U8XA 1PJ7A 3K2PA 2IA0A 2FC8A 2MQQA 1EHWA 2R7RA 5LMUF 4KY3A 3JTPA 2NNWA 4FCYA 3IS9A 4KH1B 2OPQA 4ECQA 1FF2A 2PA8D 2KJVA 4YN3B 2B5JB 4X4VA 4K4YA 1S9EB 1DAXA 3CULA 2YH1A 2CQIA 2NREA 4C1NI 4P7TA 1KHVA 2BR0A 2FJAB 1RCXB 5EX5A 2FBXA 1ELOA 5JS2A 2I6WA 3DXMA 1X0PA 3N01A 1UVKA 3AO4A 1FRKA 4H5VA 4RW4A 5C0YA 1RISA 4OQJA 4QU7A 1N32F 1AW0A 3V9UA 5LSOA 4O3SA 1B4SA 3CG7A 2MZQA 1KLNA 4OPHA 1HBOA 1X8DA 2GVDB 2MZJA 5DM6L 4WBFA 3HKZD 1KC8T 3O9SA 2FVRA 3OA9A 2YQ0A 4GRSA 4JI4F 4DR7J 3FSYA 3Q8UA 1LQ9A 2W8KA 3FZLA 3PX6A 2HGMA 3CMEN 4MYUA 3HPGA 3HDSA 4WYWA 5DDRC 3RW6A 3EN9A 5KFIA 3H2VE 2V52B 2FZCB 3A13A 2A0FB 1NJZA 1LCUA 1U1LA 4A8OA 2DH9A 3T5KA 1NMNA 3HSDA 4OV6A 1Y4ZB 5M1NA 2GV9A 3CJ3A 3M30A 2M8HA 4LSZB 4NLBA 3OYBA 1LXNA 2DR7A 1B0PA 2OEKA 4BY9C 1KTQA 3PIOQ 3JS6A 3OTOK 3THWB 1Q5VA 3M3ZA 1YG0A 1DQ8A 3K57A 1JLCB 1EIYB 2GELA 2D0OA 3KHRA 5KPRA 4CI0B 3VV2B 3UN5A 4Q7AA 4FF1A 5LJ3Y 3D2FB 1GXLA 2F8MA 3D2EA 3JYTB 2YBVA 1GTEA 1WG1A 2NXCA 2DXDA 3V1OA 3RR7A 4IOXA 1UFWA 4QR1A 1A5WA 3R7NB 3W2VB 1TFYA 4LRCA 4JS4A 2IVOA 1VLOA 2CAJA 2HHPA 3EVWA 4IOCL 3HXMA 2L9DA 3MWPA 4FWMA 3TZWA 4ID5B 1Q4RA 5C15A 2G8HA 1FDAA 1DLOB 5A6PA 1IQTA 5AE2A 1RWNB 1TL3A 1HYVA 4LF9K 4FK2A 2OSQA 4LSLB 2RQKA 4MKYA 2ZH3A 4IKFA 2VG7B 2CWKA 5KFSA 2F9DA 4X66K 3W65A 2IC3A 1S6UA 3O2IA 3K59A 3AD9C 4JRPA 1UWBA 2YWHA 3MOZA 3RMDA 3DNCA 3JSYA 4KH0B 4Z0UA 2ZBRA 5M1OA 3IA0A 3C14A 1J27A 3POTB 3B82A 4BR7A 3ADAC 1HHQA 3UKRA 4P73A 2ZJQQ 1JCEA 4NLQA 4C48A 5RUBA 3GIMA 2DY4A 3FZHA 2XC9A 1KD1T 1RWMB 4MIWA 1E6VA 1IBLK 1Q79A 1S57A 2XEXA 2XMUA 4CLPA 1PYSB 3M4XA 1FXRA 2YHBA 3VQ6A 3NAIA 4QYRA 4PRFA 1FRHA 1LNQA 1C0TA 3BKUA 1SJ3P 1FWKA 2VQEF 1SKWA 4EAHD 4NCGB 4CZKA 5AQTA 5HRNA 2Q43A 5E3CA 3DJCA 2R8GA 4DUYF 1X4GA 4ZIWA 2VWJA 1UPPA 4ZOSA 1KN6A 1IG8A 4CIOA 1LW0A 2FBVA 5AQUA 1RSCA 3CJAA 5TKYA 3FMWA 1EP4B 2AGPA 1R0AA 4LC9B 2PT0A 1WBDA 1HW9A 1OWXA 2G0CA 2BOAA 4NRUA 2YI1A 3AVFA 2MY7A 2HHHF 4DL0C 4BRGA 2PC6A 5KFXA 2QWLA 4ZVPB 1GAOA 2LEAA 4LT6A 2E1CA 3AVBA 4B1ZA 2M8DB 1FRMA 4ZPBA 3CCUN 4JK9A 1HNXF 4NLWA 3L9ZA 1OKJA 4PWDB 3MEDA 2K06A 4WYBA 3WEEA 4BQLA 3EVOA 2PIIA 2JX2A 2XULA 5KFQA 1HI0P 3CEDA 1OY6A 2GAGC 2F8SA 1P1LA 3MCNA 1FNMA 4B3SK 3H46O 2P9EA 1JCGA 3EGWB 5ETNA 2IFXA 1GMWA 1BUXA 5BPMA 1YJVA 2Y1LB 3N9UC 2HBQB 1RBTA 4B9QA 4IO9L 2X3GA 4OX9F 2KLAA 4F36A 2MHNA 3W66A 4OO1J 1LW2B 4BRFA 4ETZA 3GV5B 3HL8A 4RUCA 4HTLA 4YOYA 1RDDA 4JKGB 1RDRA 1FNXH 4ZVTB 3U9DA 1EQMA 3GE9A 1TKZB 2XMWA 2VDIA 1GLEG 4M5IA 1PILA 3TA2A 3M8PA 4NLDA 4HUGA 1TMMA 5AJ3F 4ED6A 4MJKA 5BPLA 4V19S 1I94K 2EK1A 3W2WB 1B3TA 1NRKA 1XQIA 3G71N 3HKWA 3CJ1A 4KI6A 4UZCA 5IFMA 3CCRS 3OYJA 4WF9L 4CZGA 2IHR1 4CLWA 3EX7B 3M8YA 2EPIA 4TLQA 2HZAA 1RBLA 5HRSA 2UUBK 3T19A 4B9UA 2XHBA 2QX0A 3MM9A 1NDPA 3GU0A 2DGXA 1R8PA 1H0HB 3K9JA 1IR1A 4DN0A 3CI5A 3TARA 5L8RC 3HVTA 1JLBA 3BN4A 4PUOB 5A8RA 3NH2A 4MFBB 1F9HA 4JKCA 1FXLA 5AZIB 4N5SA 1VSJA 1AXQA 2CG8A 3I0SA 3NS7B 1HLUA 1PYTA 3DHXA 1RI7A 2IVYA 4RNHA 1N56A 3M32A 3QBCA 3ENAA 3T5JA 2KT5A 2XRIA 2V7ZA 4P2XA 3RZAA 4XDDA 2FLOA 1N8RT 4IR1A 2RT3A 4B8CA 3H6EA 1NU0A 3LANA 4EUVA 2D3UA 2XMTA 1X60A 1EQYA 2WK4A 3KLEA 2E88A 3I8BA 2HBZB 2RDDA 2HPUA 1W97L 1WAJA 3CIZA 3TPQA 3P4UB 4OJRA 3KHYA 3SNNA 3SCJE 2PI5A 1SCJB 4B17A 5DQIA 3MCSA 4DU3A 1H6KX 4U8VA 3NGKA 2EC2A 2IRUA 3GB0A 2ZUAA 3LZJA 4GO7X 3E66A 1K9MO 2O8BB 1S72S 3NXZA 2QG9B 4H8KA 5KPZA 2AU0A 5KFWA 4M94A 5KT6A 1YJNN 1RAIB 5D6GA 4DR7F 4QZVB 3W64A 4Z4IA 3IR6B 2F96A 4K5SA 3AVLA 3GWCA 3KLIB 2BE2A 2VFVA 1RBAA 3AO2A 4CJ5A 1G4CA 4H4MA 4DUTA 4NLYA 4YY3J 4ZCLA 5HANA 2OEMA 4Q8EA 3DU5A 3N28A 3ENHA 1BE4A 1H2VZ 3M5RA 1HW8A 5A8WA 4HT7A 2R7UA 5DM6Q 1ZOTA 3FZKA 3CQYA 3QEIA 1TELA 2Q0UA 2CDQA 4PKGA 1T05A 3L4QA 2XMJA 3CT9A 3ZT2A 2M7SA 3MUVP 2FHMA 1XMBA 2VQFK 3SEOA 4QU6A 1YJRA 5CYQA 2HQIA 3HVRA 1B0VA 3CC7N 4WZQA 3HJVA 2FHJD 1NDCA 2CH6A 4A2BA 3HT0A 4ZDNA 3W0LA 4U6PA 3D6HB 1PBUA 1N36J 3C7NB 3NFAA 2QL9B 1DTTB 4L3QA 2VFRA 4DPOA 3P39A 4P2SA 3FR0A 3G25A 3CETA 5KFEA 1RTZA 3W5ZA 4KHWA 5KG4A 3QFHA 1ZBHA 5F0UA 2KM8C 4ED8A 1S22A 3I55S 1FEHA 1VQ4N 1YI2N 2RSQA 2IS3A 1XBWA 4WWSA 4PKIA 3H2LA 3C6HA 3OVAA 3JAMY 2GTDA 3DKDA 4LF5K 2M70A 3HZGA 1D4XA 5AFUA 3AOAA 2G2ZA 2A10A 5FRNA 2F1FA 2AF6A 3OR2A 1RWWB 3E2EA 1T9YA 1J9AA 5KFAA 4N77A 4NX9A 3BUZB 2QWQA 2P5OA 1M5VC 1W2BM 5D3GA 5F3TA 4FBUA 4IOCQ 4LF4J 2HW3A 2PFUA 3VERA 3ZETB 1FFGB 4LJMA 1SI9A 4JI2J 1S97A 4ELTA 3L7PA 1F5AA 1N6QA 4M63C 4DV6K 1WTBA 5J2MB 5M1KA 4KSEB 1U8WA 1WI6A 2PFFB 3KG1A 2QMUB 1AA1B 1D9FA 3ITHB 3GCXP 4U95A 5M2RA 1RLDA 4O23A 4DLEA 2GJ2A 2X1GA 2DISA 4ZP6A 5E3QA 4DZ6A 3BF4A 1T95A 3D3CJ 3QGGA 5JLFA 3KUEA 2RPIA 3UDEA 3GIIA 3OYNA 3SQGA 1XUPO 1NGEA 2C28A 1KTVA 2IMOA 2OTJS 1ZC6A 3CDBA 3SBMA 3VAFA 3NF7A 2GIFA 1Z2LA 4PKHA 4O4GB 4RU9A 4BE1A 1P9QC 4CZMA 2H1YA 4BR2A 1EWRA 1YLXA 1WSVA 4KRFA 2UUTA 5T41A 1GLCG 4NI2B 2HQDA 1S0MA 4ZP7A 3J80Y 2IDLA 3D6FB 4F3TA 4AQYJ 4DU1A 4H5RA 5B7WA 1R7IA 2KM8B 5DZ7A 2FBTA 1DJ0A 5HQMA 1JXEA 9ATCB 4E7JA 1TV6B 4MKAA 1KDNA 2VKRA 1T9VA 5KG5A 4Q2MA 1Z2ZA 3SPZA 1IJFB 1S6QB 5HBMA 1IKYB 2KG1A 3O9QA 4Z7CA 1QUPA 3QRQA 2RRNA 3V81B 5CYMA 5BYSA 2G13A 1X9MA 3HT3A 1FKAF 3DDIA 1ZBFA 2RE1A 2VA2A 4TYBA 1FJCA 3DMJB 3UPFA 3MM7A 3VAHA 4ZVGA 3OL8A 3J7ZO 2FJXA 1BLUA 2ZWOA 3NBPB 1XC3A 2FJEB 3VEOA 3RUBL 3MAAB 2MQNA 1HNIA 4WPAA 2XZWA 3ZTSA 2E9ZA 1YJ9N 1U0HB 1XMQK 1FO1A 2MGZB 3KK2B 3F41A 4OZ1A 4U67L 1XWLA 4Y28C 1GOBA 3KDNA 1HIYA 1ZA1B 2JEJA 4I2PA 3X3UA 5CXTA 2MZ1A 4DV5F 3UQSA 1VC5A 5D4OA 5ADZA 3B4MA 3AODA 3UKUA 4GVMA 3HSTB 1VISA 3Q2SC 2DNGA 3HHEA 5DG8A 4PA1A 1X1PA 3WQUA 4CJFA 1NJXA 1HBMA 1WSFA 4IO9Q 3KDOA 1FJGJ 4X65K 3MPYA 1U1MA 2QMWA 2CJ9A 4USTA 4O44A 3IM9A 2IA6A 3N6LA 2EKNA 5E5NA 1BWVA 3CCMN 4AXIA 3RR8A 2BUNA 4C98A 2OHDA 1ZA2B 5KGXA 4OZ0A 4NMXA 4Z4CA 2HHSA 5EWEA 1JLFB 1TUGB 3DLGA 5AQKA 4DQPA 1TUWA 2ZH7A 1C4CA 3IM8A 5C10A 1UZHA 2A6MA 1UOCA 2AGQA 2BV3A 3DLLQ 2CQCA 1FNOA 2JJ4D 1M0SA 4RL1A 4GV9A 4C97A 3IBFB 3A3NB 4EI2A 1KRPA 2YKOA 3F5TA 3BF3A 4JD2B 1KVKA 3AQOA 2GMLA 2XMVA 1CJUA 3VF0B 5FDLB 2ZE2B 1NGGA 4RU2A 3TR5A 3VQPA 5M1FA 3SQ0A 3M2UA 2AYBA 1EJ7L 2D0CA 1BI4A 4ZVQB 1N32K 2XZDB 1VHIA 5I4MA 2EWSA 4CJTA 3VGUA 2P9GA 4WE1B 1NDKA 4PG6A 3ZNJ1 3KJFB 3U3YA 4Y2AA 3TX8A 1K8KA 2XYHB 4JI4K 3M05A 2QA2A 4K5RA 4CVNE 2FVSA 3V6KA 3FCHA 1IQZA 4K25A 4QJVA 1VQ7N 2H3GX 4JEPA 5M2PA 3OL6A 4DPWA 3DXKB 1SV5A 2NRTA 4OYBA 1Y5IB 4OI4A 2A1RA 2CZVC 2XY5A 4EHUA 2HLUA 3M8QB 2G9OA 5T7LA 4FPIA 3OYHA 2KXFA 3NMAA 1QUVA 4YY3F 5T7BA 5BRHA 2ROGA 1VK8A 3TP2A 4CLTA 3GZ7A 3MWTA 3QJJA 3NGDA 5D15A 9RUBA 2V9KA 3JSRA 4FXWA 1IBMJ 3ID8A 1LWCB 3CCSS 4J9PA 1HKCA 1Y97A 1KAZA 3TYTA 1OPIA 2ZBPA 1GXTA 4K4ZA 1N52B 3I87A 3MFIA 4CHPA 2ZH1A 1S1TB 2PA3A 4DV1J 1QZ6A 2CQ2A 2F5GA 2CNOB 4YR0A 5AXNA 5AXKA 5T14A 2C3YA 1N36F 1X7VA 3R9LA 5K14A 4MMOA 1HKAA 3BEGB 4OVLA 3QIOA 4K2XA 4PWUA 3P45B 4WQ5A 4CJPA 2E2QA 5ETRA 1B9FA 3PZPA 2J9DA 1C0FA 2GS8A 3KJVB 1XHZA 2I0XA 3SYZA 4AL7A 2HHUA 4DTUA 4Z2XA 1NLKL 5IT9U 4K4VA 4HACA 3M2RB 3ULDA 2N7YA 5GADI 4J9KA 2R9LA 3ILOA 4JI8J 3CFRA 1EETB 1ZXOA 2OYQA 4I9LA 1B92A 4FZYA 1LFPA 5E3RA 1QE1B 4OIXA 4AE5A 4CJLA 2XCAA 3Q8VA 3EZWA 2C22A 1CQMA 2HF4A 1PSDA 4OYOA 3S1TA 4ZHRB 2KH9A 2Q6BA 4LF4F 1KFSA 5C25A 4YR2A 3SQ2A 4LUBA 4JI2F 1JNZB 3OW2M 3A12A 5LL6Z 5EGYA 1VQLN 1DKGD 2NXNA 4EBEA 1F9FA 1X4CA 2DNLA 2Q3PA 5F0XA 5B0DA 5K8OA 3PRBA 2OJ3A 4L73A 3VQTA 4NLPA 4RG8A 1D09B 2HIYA 1VGYA 1RAOA 3WNHA 3N5BA 3ZT0A 4JI0K 2A6AA 3M9NB 1DQ9A 1RACB 3FBEA 4P6QA 4MK7A 4W90B 3M1VA 1T6CA 4DUYK 4TXSA 3CE8A 2RQCA 3CXCM 1VFJA 3NS5A 2DHXA 5LJ5Y 3L4IA 2XM3A 2HNDA 5J2PA 3OFGA 5IQ6A 1N5TA 2MZRA 3LGMA 4BDYA 4G65A 2G8UA 1V4TA 2HHHK 1YTYA 1AT1B 3QFUA 2JZ5A 3ZZRA 2K7KA 3HMJG 2CQ1A 4F4AA 3L3VA 4AQYF 1HNXK 2B9WA 3VEZA 1Q18A 4JI1F 3DN9A 4NYFA 1RTHB 2R2UA 5AZJA 3B6OA 3BR8A 3V9WA 4TU7A 3MEEA 3DM2A 4ZTJA 4M5JA 1RWPB 3MDQA 2XO6A 4EO6A 2A42A 2HZCA 1HQUA 2ZEJA 3HLUA 1BHNA 4KT0C 1RT6A 2HNYB 1JNRB 4CQ1A 4FJLA 2NYHA 2CGLA 5DDQC 4I0WA 3M6UA 5HL7Q 1VYAA 1WOOA 2E6LA 2KRRA 4K2JA 2UXBJ 4HHJA 2AJ2A 1Q95G 3DDNA 1BXNA 1J5OB 1UVIA 4ED4A 4KJIA 4ZLPA 1ATSA 1U1NA 2FC9A 3QT8A 5KTQA 1QAIA 2PE8A 4OX9K 1X4AA 3RB3A 2ADBA 4TY8A 2MKJA 3QB0A 2J9CA 2XQCA 4RW6B 3O44A 2ZHBA 3VVTA 5GAEI 4W5QA 1RTDB 5CABA 3CCLS 1C0UB 2QFJA 1MA9B 2KW4A 2HFVA 5HATA 4OKEA 4KQZA 2H51B 1N48A 4OFZA 2AHOB 2D41A 5D0GA 3UR3C 3CQXA 3TSPA 2E2PA 3P6YC 3FGVA 5AJ3K 2Z2LA 1S1XB 3PHTA 3MN6A 1YVNA 4R25A 2ZF5O 3T5LA 2VG5B 5BN8A 4ID8A 2HVEA 1V5IB 1SJ4P 3T1HF 4NYNA 1F2HA 3O4WA 3NL0A 1FJGF 3SXLA 4U67Q 4FZZA 4USMA 2V34A 4ZVSB 3L7OA 2M3DA 1NK8A 3NF8A 5IT9O 3F56A 4MT1A 4WYLA 1WKLA 2PZSA 4OHXA 2ZHOA 4RW8A 4QIEA 3SZ2A 2EFNA 2MLZA 4KV8B 5DM7L 5HVHA 1U09A 3UDCA 3DU6A 2ZH2A 4WXWA 4F4WA 2PEBA 1RKJA 2ASYA 3GMGA 4C9DA 3UI3A 1QS4A 4KKOA 2UUCJ 4FLVA 1IWGA 1S1WA 5ADXA 3NGZA 1VQ8N 3K5MA 1SC4B 5DLFA 4P72A 3QEXA 3B8HA 4LMZA 4IG0A 3BH6B 4PL8A 2G1DA 1VQMN 2O8EB 2ASJA 1YRXA 1QVGR 5HO4A 3PJ9A 2OMOA 3H7HB 4WFXA 5FLXU 1VS3A 1U2VA 4LFAJ 1S59A 4ES1A 1PIEA 4Y2CA 4CLLA 2IAJA 2W7OA 3L2VA 3UE5A 3PYGA 3AAPA 2F9TA 3EVMA 5HQLA 3TJAA 2XZTB 3ZZPA 2OD4A 2EC0A 2V2VA 4BRDA 3DLJA 4CO3A 1F6TA 3BZQA 1IG9A 3VCDA 2CQDA 1U1RA 2QA4G 2DR9A 3A5OC 3QIPB 4ER8A 2OGUA 1RZMA 4DR7K 4CT9A 2QJ3A 2IIRA 4IFVA 3CJ2A 4L3KA 1C0MA 2YNFA 4J2EA 1TKDA 1QHTA 5AQVA 4KHPK