4IG0A

Hiv-1 reverse transcriptase with bound fragment at the 507 site
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 160
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig0A05
1LW0A 3MTKA 3DI6A 2R2TA 2OPRA 3NF7A 5I3UB 4CJVA 4R5PA 2BE2B 3QEVA 2OPQB 5KFVA 3OL6A 1TGOA 3C95A 1CZBA 4RZRA 1U48A 4OL8A 4AHTA 3QGGA 1XHXA 2EC0A 3ALYA 4EO8A 3NH1A 2BGGA 4GC7A 1RDBA 3V9WA 2HNYA 3S3MA 1Q9XA 1RDAA 2KW4A 3MFHA 4CEOA 3VA0A 2IAJA 4M3WA 3IG1B 4ID5B 3TWHA 3KLEB 2HHTA 5HRPA 2ALZA 3MR5A 3M8QB 1S9FA 2FLNA 3GV5B 3LP1A 3I0SB 3GV8B 4LQ9A 5HP1A 1WLJA 4IH7A 1IKYB 1XC9A 2YKMA 4MK9A 3IGNA 3NBPA 4TY8B 4NYZA 2IM0A 4QWBA 5DMRA 5FROA 4ED8A 1DTTB 1TKXA 2RN2A 3QINA 2ILYA 3GIKA 4ELUA 1ZYQA 4FW1A 1TV6B 4F50A 1C1BA 1RAJA 5DGBA 3RAQA 1C0UB 3HVRA 5KFHA 5KGXA 3L2QA 3KHRA 3M9MB 3OYCA 4GVMA 4U6PA 2W7PA 3O4NA 3HM9A 2ZE2A 4DTUA 1D1UA 4J2BA 5EDWA 2ZD1B 2XY8A 3V9XA 1WSEA 4BWMA 4YR3A 2AQ4A 3HPHA 1HNVB 1WAJA 1NOZA 3SPYA 3CJ0A 4NCGB 4Q5VA 3P83D 2CJQA 3UDLA 4CFAA 1D9DA 2W8LA 4LD0A 2BQ3A 4WZMA 2XI2A 2VWJA 3UQSA 3RMBA 4FM0A 3KLHA 1WSIA 1SV5A 4U7CA 2EHGA 2HVIA 1RT4A 3N6NA 1SKSA 3DI6B 4J9OA 4XPCA 2FBXA 2IS3A 4ZP8A 4R5PB 4WXOA 1RT5A 3OLBA 4N56A 3NF8A 4CEZA 4HUEA 1LV5A 2DPIA 3CJ3A 4HYKA 3OSPA 3UPFA 1YTUA 4KSEB 1S1WA 3RB6A 1X9SA 4JV1A 3DOLA 4JLHA 4NLQA 1FKOA 4KHMA 4K50A 4N5SA 4IKFA 4CJLA 4RW8A 4O3SA 4IR1A 4CEBA 4EBDA 2EX3A 3UIQA 1N48A 3H5YA 1QUVA 5L9XA 1QTMA 3K5NA 4OKKA 3QIPB 3QEIA 3ZSYA 3CDWA 4CK2A 4PUOA 5KG3A 4JV2A 3NBPB 1FXXA 3OYMA 3MR3A 3TR8A 1KRPA 1JLGA 3SJJA 2V9WA 3DMJA 4J9PA 3VQ5A 3CO9A 3CIZA 3CWJA 2W9CA 3P5JA 2G8HA 5J2MA 4MKBA 3F73A 5CYQA 1MU2A 4WFYA 3ICLA 2QXFA 2QE5A 2E6MA 4E89A 2B43A 1MMLA 1TKZB 3PW2A 4OKEA 4FS2A 2R2SA 2HW3A 4B9SA 3VQ7A 4NLDA 5J2QB 2ZKUA 1RBVA 3OJSA 4ECTA 3V81A 1S1UB 5L1JA 4H4MA 3MFIA 3OS2A 3LZIA 2FJXA 1TVRB 3QESA 3LP2A 3BSAA 4CJ3A 4ELVA 2BANA 1QQCA 3QIOA 3HKWA 4I9QA 3KK1A 4ECRA 2X74A 3KLGB 4O44A 3ISNC 4CF1A 3QNNA 3M9NB 1YTAA 4MIBA 4KB1A 1S6QB 4Q8FA 3WNFA 4H4OB 4CIGA 1RT4B 1J5OA 3KMSA 3SI8A 4TLRA 3CJ4A 3V6KA 4QW9A 3SI6A 3D28A 3QERA 1SL0A 4IR9A 1N5YB 2IOCA 2B4JA 4DTMA 3AVAA 3PX6A 1J9AA 4GW6A 1X9MA 2Q3SA 4CHPA 1QSLA 1N6QB 3K5OA 1IKXA 1LWEA 2IBKA 3JYTA 3DLBA 3DOLB 4DQPA 4DS5A 1FKOB 2O5DA 3OYNA 4QCLA 4JRQA 1JLQA 1TKTB 2HMIA 5KG2A 4AHVA 4RU9A 5F8IA 4ZP7A 5KFLA 4DL2A 1TL3A 2YKNA 4K4VA 1SUQB 1JIHA 4Z4IA 5JXSA 1HRHA 2X78A 3Q8QB 3DOKA 2P5OA 4DTSA 5KTQA 1SL2A 4M3TA 1RTHA 4ECUA 4DFPA 3L3VA 3DMJB 1LW2A 1CSJA 3H5SA 4C8OA 1S1VB 2W9CB 4KHRA 3WNGA 1JLBB 1GOCA 1NHUA 4XO0A 3DDKA 5CZ1A 3BR9A 4FYDA 1RT3B 4M3UA 1TL1A 3CQ8A 4BDYA 1ZTWA 4OGEA 2JEJA 3V81B 2G8FA 3K59A 4PWDB 4IOBA 4O55A 4DF8A 3OYDA 4KB0A 3QETA 1S6PB 1KTQA 3NGZA 3DRSA 1VSIA 4QOZB 4RNMA 4JS4A 5F8LA 5KT3A 4CF2A 1DTQB 4O44B 1A5VA 4Q0BB 4AHRA 3TANA 3QLHB 2XRIA 4R8UB 3OYEA 4IQXA 2OZMA 4CECA 3CFRA 3CG7A 3PW0A 2IA6A 1D9FA 3VN5A 4CERA 2WONA 4RUAA 4CHNA 3TAMA 4TYBA 5CYMA 4CJTA 1NKBA 4OVLA 3FFIB 4MFBA 1LAVA 2AX1A 4IG0B 2HNDA 4RW4A 1U04A 3PR5B 3HVWA 4G1QB 2Z1IA 4TN2A 5I42B 4ED7A 1JLQB 1J54A 3QNOA 4DSLA 4B9MA 3AA2A 1HPZA 4LSNB 4AHCA 2IM2A 1TL3B 4CHOA 1TP7A 4FJJA 3OS1A 1ASUA 1VSFA 4KHQA 5C25B 2QKBA 4URSA 3AVBA 1RTHB 4KPYA 1RYRA 1JKHA 1HARA 3VQSA 5KFSA 3LZJA 4K4YA 1U49A 2D41A 4DWIA 1SKRA 2FBVA 2RDIA 1RT1A 4AILC 3QGIA 3GIMA 1TL1B 4KO0A 1JLFB 4ZVHA 2WTFA 1XHZA 2PZSA 4Y34A 4KAZA 1HQEA 5JS1A 5DQHA 3MEEB 1EETA 4J9QA 4K8ZA 4DFJA 3KLIB 4FJ9A 2G8IA 4CK1A 5T7BA 1YVUA 3PX0A 3DRSB 1F21A 3L2UA 3GV7B 1IH7A 2AGOA 3KKRA 5KFJA 2RPIA 4MH8A 2GIQA 3T1AA 2HVHA 3SV3A 2FLLA 4I7FA 4FCYA 3AVFA 4RW6A 4NLUA 3KIOA 1BI4B 3FQKA 2WRMA 3H5XA 4K8XA 3VQQA 5CZ2A 2DY4A 5FRMA 3ULDA 1KLMA 2Y1JA 5J2PA 4MQ3A 1T03A 3L2VA 2W8KA 3DM2B 3RAXA 4KFBB 3RWUA 4MFBB 3THVA 3C6TA 5DG7A 1NJWA 3KD5E 4TQRA 4JUZA 4F4ZA 1T94A 2I5JA 3T5HA 4CEQA 3DLHA 4FLWA 2HHUA 2XWYA 1GX6A 3KOAA 2FJWA 3DLRA 3FDSA 1N4LA 3M8SA 4NRUA 2R2UA 4NLVA 1S9EA 1T7PA 4KHSA 4J9SA 5KT5A 3DYAA 4IG3B 2C22A 4KI6A 4CJQA 3NKYA 3WNEA 1S0NA 3OJUA 3AVNA 2OPSA 1HYZA 2GUIA 4FM2A 3PJXA 4CEEA 3QZ7A 1VSEA 2HB5A 3QYYA 4OJRA 3VQPA 4FBUA 1JKHB 4FLYA 1JLCB 4CFBA 2OPPB 1NJYA 5HROA 4K4WA 4NRTA 5C24B 4XIUA 4N47A 4URGA 4YMEA 3BSOA 1S0MA 4O4GA 4DSIA 1HNIA 1RT1B 3K2PA 5DQIA 4DTPA 2CKWA 1ZBIA 4KAIA 4CJWA 4YP3A 3AO1A 1NOYA 3RB4A 1BGXT 3KK2A 4HHTA 3V6HA 2HHSA 3M8PB 3OYIA 2PYJA 4FZZA 3CYMA 1KHWA 4YR0A 1QE1A 5K14A 2IM3A 4LH4A 2ASJA 4M3RA 3TQ1A 5KFTA 1X1PA 3L2RA 3H08A 1SH2A 3S3NA 1VRTB 1RT6B 4M45A 4B9NA 1KLMB 1Z25A 3H59A 5J2PB 4RNNA 3VQ8A 4IKAA 3RRHA 4DTOA 4IBNA 5KFFA 3V4IA 4WZQA 4E7LA 3D0PA 2D3ZA 4IFVB 1LWCB 1RTJA 3C6TB 2B6AA 3AVHA 3FRZA 3TABA 1S49A 2G8UA 3VQ4A 4NCAA 3E51A 2QK9A 2B5JA 3SQ2A 3ZT2A 4E7JA 3IRXB 3ZT1A 4KHNA 1IM4A 1R0AB 4DQRA 3ZSVA 4RUCA 3AVJA 5C42A 4F4XA 3HXMA 4LSLA 3DYAB 3DRRA 4DU3A 4RW9A 2JGUA 4KHWA 4ID1A 1U4BA 4J9MA 2VG7B 2FVPA 2OPSB 2YNFA 4J2AA 3NF9A 2E9TA 4NZ0A 1WSGA 1I3AA 1XR7A 3DLGB 4LH5A 3KLVA 4K4XA 3LPUA 5KFNA 4ECWA 1IKWB 2BDPA 4WFXA 1RT7B 1QHTA 3HYFA 1X9WA 1BHLA 2QV6A 1O1WA 3VQ9A 1G15A 4DLEA 5F9LA 4EBCA 2D5RA 4DSFA 4ZP9A 3AO5A 1LW0B 1EKEA 5F8JA 2OPRB 1VRUA 4FXDA 4L8RB 4DL4A 1SH0A 2R7YA 3UR0A 2WK4A 5FDLA 2C28A 1RBSA 5FRNA 4EP5A 4QPXA 3MEDA 4I2PA 3HL8A 4JRPA 4Z4GA 1BCMA 4F8RA 1TK5A 3ITHA 4ICLA 5J2NA 1EX4A 1IO2A 2HNYB 1C2PA 4G3IA 5E41A 2IAJB 3CJ5A 2LSNA 3L3UA 1S97A 4URQU 3VQDA 2IC3A 3C6UA 4B3OA 1KVAA 1KSPA 3V4IB 3LP1B 5HP1B 2XCPA 2YKMB 3CVKA 2B6AB 5HBMA 3T3FA 4GC6A 1BL3A 3V1OA 3EY1A 3LANA 1I6JA 1WNEA 1RILA 1S1TA 5KG6A 4Y3CA 1J53A 1TKXB 1VSKA 1JLAA 3PVXA 4FJ5A 4ECQA 3KMQA 1C1BB 2DFFA 4PQUA 3MR6A 4CFDA 1D0EA 3MF5A 3DRRB 3GILA 3TAQA 3TARA 5D3GA 4ZVEA 1W0HA 4EYHB 1S9GA 3AVLA 2UUTA 3CFPA 2ZE2B 5HRNA 4CIFA 4DTRA 3LP0A 2VG6A 4BDPA 4ZTJA 2YNGA 4C8KA 2D0AA 1RA6A 3KJVA 5F8MA 3MXMA 4KTWA 4I9LA 3I5BA 1BQNA 3NAHA 4TY9A 1L5UA 3GIJA 2HHVA 1S1XA 3KLHB 4Y2AA 1BCOA 1RTIA 1SV5B 4KI4A 3OYBA 2XC9A 3PJWA 1JL1A 5DG8A 1U47A 3A2FA 3NH0A 3SCXA 5KFXA 1RT5B 2UVUA 5KRTA 4JV0A 4QW8A 4RW7A 1SH3A 5HLFA 3KHHA 2HNZA 3SYZA 1RCHA 3AA4A 4CJSA 3PW4A 4ECYA 3KK3A 3GQCA 2W9AA 5KFQA 1WAFA 1S1WB 4ICLB 5EWFA 4B9TA 1L3UA 3E01A 4FJXA 4RW8B 3B6OA 4CE9A 3H98A 1HJRA 2QKKA 4B3OB 3U3YA 3ZSZA 3MXIA 1K1QA 3NE6A 3SQ4A 4KHUA 4NYNA 4DTJA 2YHBA 3HO1A 3NFAA 4NLPA 5KT7A 2A1SA 1RDRA 3I0RA 4DLGA 3CDUA 4PUOB 4M42A 3K58A 4C8LA 3AVCA 3IS9A 1JLGB 3O4QA 1WSJA 5J2MB 1S1TB 4J2DA 2ZQBA 1XWLA 4O0IA 2HAIA 4KREA 1GX5A 5CYQB 1MU2B 3Q8RB 2V4RA 2WOMA 2AGQA 3RRGA 4OKJA 4B9VA 2HHQA 4Q43A 2ETJA 3ZSWA 3KHLA 5F8GA 2DFHA 1S4FA 2IDOA 4DTNA 1WNSA 3RB0A 4Q44A 4O3RA 2F8EX 2R8HA 1K1SA 4H4MB 2FVCA 1KFSA 4DU1A 3T19A 1LWFA 3IGVA 3LP2B 3LP0B 2BANB 2KQ2A 3G6YA 4IFYA 3KLFA 2E6LA 2AGPA 5KFRA 2UUWA 3KK1B 1VSMA 4F2SA 3MECA 1RBRA 4H54A 4CHZA 5J1EA 4TYAA 4Z4EA 3TAPA 3TI0A 4PY5A 5KFYA 1RTIB 4TQSA 3KNAA 1J5OB 4ECSA 4ECVA 1T05A 4RNHA 1RBTA 5KFOA 4W5TA 5DK5A 1KCFA 2VA2A 3OYAA 4K4ZA 1ITGA 1A5XA 4RW7B 3AA3A 2HNZB 1FKPA 1IKXB 3HK2A 3PX4A 1LWEB 1BISA 4B08A 3JYTB 1JXLA 4HCCA 3FQLA 3BGRA 4Z4FA 4CF9A 2OYQA 1UA0A 3E01B 4HKQA 1A5WA 2HMIB 1EXQA 4RNOA 4FLZA 4ED2A 1RBUA 3AO2A 1NK6A 2AJQA 1BQMA 3MXJA 2YKNB 3V6DA 1C0TA 3VA3A 4NLYA 1QSSA 2UVVA 3DOKB 4M95A 1GOAA 4KKOA 4WXWA 1I39A 2F96A 5KFCA 5DG9A 4DEZA 3OYFA 2X6NA 4MK7A 2XY6A 2RKIA 3B6PA 4ZVGA 1DLOA 1LW2B 5EWEA 2BRKA 4FJMA 3SUOA 3PZPA 5KFMA 1N56A 1HYVA 1RT2A 4O5BA 1HQUA 4I2QA 5DLFA 3VQAA 4CJUA 1IKVA 4CJKA 1JXBA 2XY5A 2BQUA 5C5JA 1RTDA 3OS0A 2J6TA 1S5JA 4E7KA 4NLSA 4IRDA 2YNHA 3EPIA 4J9KA 1XI1A 2HHXA 3WNHA 2YNIA 2XY7A 2BRLA 4CGJA 4E19A 5KFUA 5DQGA 5I3UA 1KFDA 3ZSOA 4OLAA 4O3OA 2BE2A 2D7SA 4O4RA 2PY5A 5KFEA 2OPQA 3K5LA 4F2RA 1NJXA 4F3TA 2BQRA 3V9ZA 4ZP6A 4ECXA 2WONB 1YVFA 4CJFA 4F4KA 2IJNA 3TAMB 5KG7A 4GMJB 5CYMB 4IDKA 3PO5A 1NKEA 2HNDB 2AU0A 4RW4B 2WHOA 2C2EA 3AVIA 3IG1A 4ID5A 3KLEA 2OA8A 3BGRB 4O3PA 2PYLA 2E9RX 4FJGA 3I0SA 3I5AA 4DFKA 4WYWA 3AO3A 2O4IA 1IKYA 2NUBA 2BR0A 4ZPDA 1QAJA 4CIEA 3NHGA 1BQMB 1HPZB 3V6DB 3H40A 2DPJA 4TY8A 2Y1IA 1T3NA 3T5LA 4IRKA 4KKOB 1DTTA 3LAMA 2OH2A 3EYZA 1Q8IA 3JSMA 4ZTFA 4B8CA 4UQGA 3TAGA 1CXUA 2KZZA 3QZ8A 4J9NA 4CEAA 1RA7A 2R8IA 2A1RA 3G6XA 3U3GA 1NKCA 2DTUA 3OY9A 4Y1CA 1ZBHA 4FW2A 1RT2B 1Y97A 3BJYA 4E7HA 1HQUB 3SUPA 4DQIA 3P1GA 3DLEA 4KO0B 2Z1GA 1HNVA 1HQEB 1ZBFA 1RTDB 4CJRA 4FM1A 4OPKA 1ZTTA 3PW7A 4NCGA 1EETB 4JS5A 3FSIA 1L3VA 3MAQA 4KE5A 4E1MA 2R8KA 3CM6A 3BREA 4BE0A 2IMWP 3O3HA 4J2EA 4OPJA 4EEYA 2G8WA 3M9OB 2FBTA 1RYSA 1TK8A 1KVBA 4FJHA 1WSHA 2VG5A 4CCHA 1S10A 3TAFA 4FS1A 4FBTA 4I7FB 4CGIA 4YNQA 4RW6B 1L3TA 4LQ3A 5KFGA 2FVRA 4KHYA 5KFZA 1BIZA 3DLKA 3VQCA 2HWIA 5F8NA 3L2WA 4CJ5A 2ILZA 3ZSXA 2W42A 3OVNA 1K6YA 1T03B 4IDKB 3AVGA 4J9RA 3AVMA 4F4YA 1VSLA 4CJPA 1HYSA 2I5JB 4AH9A 3Q8SB 3T5JA 4NLRA 1S48A 5KG4A 4QWDA 1IG9A 3MEGA 3BQ0A 2ASDA 3QIPA 1S9EB 3V9UA 4CK3A 2OZSA 2C2DA 3H4DA 3SQ0A 1TAUA 1RDDA 4Q45A 1RDCA 1ZBUA 4DL7A 3LP3A 1SL1A 4ZPAA 3HJFA 3SV4A 3HPGA 2J6UA 3QEPA 1VSJA 1S0OA 3JSMB 1Z4UA 1TKZA 3OYKA 3TAEA 2E9ZA 4RNFA 5J2QA 5HROB 4RG8A 5SZTA 4EP4A 5KT6A 4KTZA 1S1UA 3ASMA 4FLUA 5JS2A 4FJ7A 4DL3A 2D3UA 1QAIA 3VQ6A 3QEXA 1TVRA 4IRCA 3OYGA 4O4GB 1T8EA 2G8VA 4O3QA 3D45A 1HNIB 4O0JA 3DLEB 2KFNA 3V6JA 2J6SA 4W5RA 2XGPA 4HUFA 4ZPBA 1REVA 1XR5A 5JUMA 5KT2A 4QWCA 3KLGA 3SZ2A 2Z1HA 3KK2B 3ZSQA 3PY8A 4CGDA 3N6MA 1S6QA 1TQLA 1HMVA 5L1KA 3SNNA 4H4OA 3ZCMA 2P51A 2VG5B 3QO9A 3KHGA 1QE1B 3OL9A 5K14B 3O3FA 1B9DA 1N5YA 4FVMA 4B9LA 5KGWA 4CGHA 4HTUA 3RMDA 2JEFA 4E0DA 1XR6A 3DLKB 4DMNA 3H5UA 3QEWA 1NK9A 3G6VA 1N6QA 3PO4A 1JLEA 2ATQA 4YFUA 2HWHA 3I8DA 3PW5A 3PHEA 1GOBA 3V1RA 4DL6A 4MKAA 3I5CA 2R8JA 2I1RA 4J9LA 4WYLA 4M3ZA 1RTJB 1TKTA 1UOCA 1HYSB 3KTQA 2B5JB 1VK0A 3KD1E 3MEGB 1SUQA 3SUQA 4EYIB 2DFEA 1CZ9A 2ITGA 5KT4A 5KG5A 3S9HA 5C42B 2XCAA 4LSLB 3G0ZA 4RW9B 4YQWA 4HVJA 4QAGA 4CEDA 1JX4A 2KZMA 1U45A 1S1VA 3RBEA 2YHAA 3D5MA 2YNFB 3BQ2A 3KKSA 3LWMA 3OYJA 1JLBA 5KFKA 4NLWA 4DSKA 4KBIA 4EZ9A 3HP6A 2VWKA 3OHAA 1RT3A 4F4WA 1C0MA 4Q8EA 1ASVA 1WN7A 3K5MA 2Z1JA 3NAEA 1C1CA 1KVCA 4BACA 4ZHRA 4PWDA 4CFCA 3LPTA 1S6PA 4K4UA 3F9KA 1FK9A 3SQ1A 3QIDA 1VRUB 2GBZA 3SUNA 1REVB 2V4QA 5L1IA 1DTQA 4MK8A 3ZT4A 1ASWA 4Q0BA 1ZBLA 1EP4A 3ZT0A 4KV8A 3QLHA 4R8UA 5FDLB 5HRRA 3MEDB 1NK4A 1HMVB 4I2PB 2WCXA 4Z0UA 1B9FA 4PA1A 2D0CA 4M41A 4QWEA 4F3OA 3V1QA 1TAQA 1BIUA 3EPGA 3QO9B 3BDPA 4CHQA 2GC8A 3ITHB 1B92A 4M94A 1UA1A 5J2NB 3LDSA 1OS5A 4TXSA 3MR2A 4DF4A 3FFIA 4DQQA 5KFPA 4IG0A 2RF2A 3IAYA 2FVQA 1JLEB 4C8MA 4CESA 2IC3B 3C6UB 4CJ4A 3LWLA 3N6LA 4E7IA 4FLXA 4G1QA 5I42A 4E1NA 4AHUA 3ISND 5HBMB 1CLQA 1Q9YA 4BE2A 4N76A 3NDKA 4LSNA 2IGIA 3HVTA 3SFGA 2V0NA 4ELTA 1JLAB 4YR2A 5KRSA 3PR4A 3NF6A 2D0BA 3RMCA 5C25A 4PQUB 5KFWA 1Z26A 4FK4A 3PUFA 5D3GB 4ED0A 2WB4A 2YV0X 1S9GB 3HP9A 1UAXA 4XPEA 4WE1A 2VG6B 4C8NA 2G8KA 3HHKA 4FJ8A 4EO6A 2YNGB 2FLPA 1SKWA 4NYFA 3KJVB 4O3NA 1JLFA 4DTXA 4NLXA 2W9BA 1BQNB 2AX0A 2JC0A 3MEEA 3OL7A 3GYNA 3AVKA 3NL0A 1C1CB 2XHBA 4ZHRB 5DLGA 1D8YA 3KLIA 3AV9A 5KG0A 3AO4A 3TVKA 1S1XB 4AHSA 4FJNA 5L1LA 3CDEA 4KRFA 3PV8A 4CJEA 4CEFA 3RR7A 1FK9B 2P1JA 4CGGA 4DSJA 4IH5A 4IH6A 4M3YA 1NK0A 4BDZA 4FZYA 1W9HA 1NK8A 1EP4B 3HT3A 4KV8B 2JC1A 1BI4A 3CM5A 3EZUA 3V9SA 3OYLA 5HLFB 2R8GA 1JL2A 3RTVA 5EUHA 2F8SA 2FC0A 3KK3B 2XGQA 4R0EA 4TSXA 4FJKA 5CY4A 3ZSRA 5KG1A 3DM2A 2C2RA 4X2BA 4KFBA 1L3SA 3OL8A 1NHVA 2UVWA 5KFIA 4DL5A 5KFAA 3IN5A 3CFOA 2RF2B 3BQ1A 4E3SA 1NK7A 2O4GA 4ED6A 3GIIA 2VA3A 5F8HA 2FVSA 4Z4HA 4BE1A 1C1AA 2KTQA 4K4TA 3LAKA 1NJZA 3I0RB 4NLTA 4FJIA 3IS9B 3NCIA 3U6FA 4ZVFA 4IG3A 3NMAA 3HVTB 3NAIA 3RR8A 2RDJA 1UWBA 4DSEA 2WOMB 4WFZA 3DRPA 2AWZA 4DQSA 4Y1DA 4B9UA 1KHVA 3AA5X 4LY7A 2FBYA 1TK0A 3HPOA 1JLCA 4EBEA 2OPPA 3QGHA 3NGYA 2HHWA 4NCBA 3OSNA 5C24A 4ED3A 3HVAA 2FJVA 1LWFB 3G86A 4WE1B 4CF0A 2XI3A 3BSNA 4KTQA 4IFYB 5T14A 3OLAA 3KLFB 1KLNA 4DG1A 3MECB 2F8TA 5J1EB 2W9BB 4FK2A 3VQEA 3L8BA 4ED1A 3OHBA 4M3XA 3RMAA 2UVRA 4N41A 3M8PA 4NLOA 5F9NA 1C6VA 4K4SA 3CJ2A 1T05B 3H2LA 2IJFA 2ATLA 3T5KA 1CXQA 4OLBA 4CHYA 4HCBA 2E4LA 5KI6A 3BSCA 2R2RA 4BWJA 4FLVA 1QSYA 4MIAA 1JXEA 2KFZA 4W5OA 2JEGA 1FKPB 4ZPCA 1VRTA 4FLTA 1RT6A 5SWMA 4DU4A 1NNDA 2GIRA 3HSTB 1W25A 3SFUA 2IM1A 3M8QA 5HRSA 1U09A 3S3OA 2JEIA 1WSFA 4W5QA 2X6SA 2ASLA 4IFVA 1LWCA 3O3GA 5KFBA 2P5GA 4KB7A 1C0TB 4Y2CA 2YNIB 4Z4CA 1LAWA 3LALA 5KFDA 1YT3A 3IRXA 1R0AA 4QWAA 1TV6A 2RKIB 3RBDA 1DLOB 4H8KA 1C0UA 3NGDA 4DFMA 3Q8PB 1QS4A 1UWBB 4FK0A 2VG7A 4B8AB 3DRPB 3NGIA 1TKDA 3VQBA 3ZT3A 3K57A 4I2QB 5EWGA 3G10A 3SPZA 3H4BA 3NH2A 3M8RA 2ZD1A 3RB3A 4ZMMA 1IKVB 4OGCA 4HUGA 3DLGA 4FZXC 2JLEA 1VSDA 1VSHA 4EZ6A 4FJLA 2W7OA 2GV9A 1IKWA 4DS4A 2YNHB 4CF8A 4CGFA 2XO7A 5DGAA 1RT7A 3OYHA 5EU7A 1ZETA 4NLGA 1D5AA 1NK5A 4W5NA 4ECZA 3C94A 1RNHA 4DG1B 3EZ5A
chains in the Genus database with same CATH superfamily
2J9DE 3ZTOA 3NF7A 4Z94A 4A8XA 2A5XA 5AFUH 1P8GA 2XYPB 5KFVA 1TGOA 4AXJA 2GQQA 3M6XA 5ETQA 4LUBA 5D0EA 1XHXA 2EC0A 5AXMA 2P9UA 4Y2KA 2DRDA 4WJBA 3C2PA 2CDRB 3DGVA 4OX9J 3V9WA 1HWJA 1RDAA 3DHWC 3NGTA 4LF5F 5EX3A 2GGPA 4DPYA 1KQSR 1HWKA 3FLCO 3M32B 3VGVA 5HRPA 2ALZA 3WXMB 2BE9B 1S9FA 2FLNA 3HD2A 2JVRA 2JDJA 3MM9A 3GV8B 4IH7A 5LMNK 3IGNA 3U8XA 4JHDA 3CJ1A 4TY8B 5C15A 5H9EJ 4B3RJ 4FW1A 1TV6B 1IBLF 3RAQA 1C0UB 1MROA 1HR0J 4C8ZA 5T7LB 2AV5A 1M1KO 4U6PA 3O4NA 1SJRA 4X65F 3KFWX 1GMUA 1D1UA 1X3NA 2Z57B 4DMZA 4J2BA 4NXNK 4O0NA 3PRVA 3V9XA 1WSEA 2ZWHA 2AQ4A 2K2PA 1NOZA 5ADZA 4ZJQA 3NVKA 4NCGB 2RE2A 2IJRA 2DGQA 3W5XA 1D9DA 5BPMA 3QDKA 3BF3A 3G8SA 1YTYA 1UVMA 4HI2A 2DXEA 4DUTA 2DXFA 4JK8A 1FFGB 1B64A 1JCGA 1WI8A 1RT4A 2MKHA 3DI6B 2E5IA 3IRWP 3O6QA 2FBXA 5M1PA 4ZP8A 3Q8VA 4K0KF 4R5PB 5AQVA 3MM6B 2O8CB 4WXOA 4C3MA 4A61A 1PYTA 3THXB 4N56A 1XUPO 2BJ3A 1LV5A 2VQFF 3CJ3A 1NGEA 1VQ7N 1AA1B 3OSPA 4FPAA 3FGUA 2UXBJ 3DOLA 9ATCB 1MWKA 5AZJA 1FKOA 1BWFO 2CWXA 4BVOA 4KHMA 4K50A 4O3SA 4CEBA 3MMVA 3K5PA 3W3SA 4A2AA 3NS7B 1R8BA 1Q86T 2O8FB 3H5YA 2GTDA 1ZA2B 3QIPB 4YORA 4P72A 1FEEA 3CDWA 3AD7C 3DLJA 1WHVA 4JV2A 3NBPB 4ID8A 3DMJA 3IKMA 1GAOA 3CIZA 3P5JA 4F25A 5J2MA 2YCHA 1HBMA 1MU2A 1N8RT 2O01C 4RWTA 3O4WA 2XNRA 1MMLA 2L08A 3HZ6A 1DURA 1YJ9N 1ZAXA 5A76A 4HVZA 4EMDA 1S1UB 2HFNA 5MLCQ 3DGPB 2FJXA 1Q81T 3QESA 2MHNA 3A5MC 3CMES 2KYXA 3RG6A 1XBWA 2CWKA 2X74A 3ULEB 1YTAA 3CPWR 1X4HA 4Q8FA 5GAGU 3WNFA 1MMDA 2DO4A 2HRYA 3AY0A 5LSOA 4CIGA 4KGVB 3KMSA 3SI6A 1UFLA 1GXLA 2GO9A 2QWNA 5BYQA 3A8JA 2CQ2A 3GSDA 2IOCA 1VYAA 1VQ6N 1OY8A 2MLZA 3G87A 5G0RB 5IV3A 2EKYA 3L4IA 2J0WA 1IKXA 3JYTA 3NGSA 4AQYK 1TL4A 2FZKB 2UXDJ 2QWRA 2M7SA 4JRQA 1JLQA 3MX5A 4AHVA 5IWAJ 5KFLA 3THTA 1SUQB 2QIFA 1C4CA 4Z4IA 5JXSA 3OBYA 2ZH1A 2YPZA 5CD4A 2HLUA 4DTSA 3M1FA 4KH0B 4M3TA 1RTHA 4MO4A 3GP9A 4E8UA 1S1VB 2W9CB 3WNGA 4B3MK 3MN7A 1FO1A 4M5DA 3JSRA 1NHUA 3FEYB 2FZGB 1B0PA 2MHEA 3DDKA 4LRDA 2EKNA 3BR9A 4RBVA 2KO1A 1Y5IB 1H3DA 4BDYA 2W6KA 2HHHK 3MUTP 3GR0A 3K59A 4IOBA 3MPDA 4O55A 4DF8A 1S6PB 3FKBA 4B9QA 2RQMA 2B4OA 4MKVA 4J7CA 3G71N 2MKSA 1VSIA 2V9KA 2AF6A 4IUFA 2AEFA 1J5EF 5LMNJ 5F8LA 4DV7K 3AA9A 4TU8A 3FZBA 4R8UB 2XBPA 3FMBA 5HATA 5DJBA 3CG7A 2WVCA 3PW0A 3FCHA 4HHHA 3SDEB 3HSJA 1QAYA 3VN5A 4CERA 1CLFA 4FWSA 4CJTA 3C14B 4NI2A 1N32J 3FFIB 3K2YA 2KFYA 3BN7A 4NXNJ 1U1QA 1NH7A 3IBFB 1XNRK 2AHOB 3UN3A 4ED7A 4PYAA 2DNQA 3W66A 4DCOB 1YVNA 3QNOA 4B9MA 1X7VA 5GVQA 3AA2A 1NAQA 2Y1LB 2LA6A 4F4AA 2VFVA 3GLJA 3R5JB 3T6JA 4KHQA 5JLHA 3AVBA 2IYGA 2HK2A 1RYRA 3N01A 1BHNA 2F8MA 3W2VB 2OD6A 3R5DA 1E6VB 2P5VA 3F41A 3R1XA 5L8RC 4K4YA 1FDBA 1A6LA 4WU2A 3MMAA 5C2GA 2AZ1A 2A42A 1WC6A 4LVNP 3UN5A 1RCOB 1UZHA 4H0TB 1RT1A 8AT1B 3QGIA 3GIMA 1UMJA 4Y34A 2G9OA 4CLZA 3N4PA 4GY2B 2BTFA 4X66F 4JKFA 4J9QA 4FJ9A 1CJKA 2KKZA 2GJIA 2DKOB 2A2CA 1IH7A 2DEIA 4MDBA 4DR7K 3T1AA 3HHLC 1FTRA 2AKWB 4RCHA 3L0QA 3CGIA 2M8DB 4RW6A 4NLUA 1WF2A 1VFJA 4BRIA 3AJDA 4R0JA 3H45C 4ES3A 1KLMA 3CJ8A 3CCWA 1KBRA 3MCMA 4C6AA 1NGJA 8RUCA 5HVGA 3DM2B 3RWUA 4HHJA 5EN1A 4JKCA 3C6TA 1NJWA 2GIFA 3KD5E 4JUZA 4F4ZA 1APSA 1T94A 3T5HA 5AQQA 2XMKA 3KOAA 1IBMF 3FDSA 1EKSA 2Q0RA 4OYIA 1RWPB 4CJQA 3WNEA 1KOHA 2OPSA 1XC3A 4IOXA 4YOUA 5GMKa 3CULA 1VSEA 4OJRA 2VH7A 2GWKA 3NY0A 4FL9A 2AJ4A 4IO8A 5HROA 3M2UB 4JYAK 4NRTA 5C24B 4N47A 2NXJA 1UPMB 2MQ8A 4AQYJ 1NM2A 1R27B 1G1XA 4O4GA 4DSIA 4BC3A 1JJHA 1F60B 1SC6A 3K2PA 3W9HA 5DQIA 1RKIA 4DTPA 2HFOA 4UZCA 4N7TA 1OH7A 2AJ2A 3MM7B 4HHTA 2MLYA 4FZZA 3L7UA 5C10A 3GOIA 2FSKA 1NGBA 1KHWA 1JNRB 4ILRA 2IM3A 4LH4A 2MZRA 4EFHA 1X1PA 2YWEA 3H08A 1HPMA 2HS0A 3POTB 2IVMA 3QFWA 5HANA 2ROGA 4RNNA 3VQ8A 2CQ0A 2OANA 5KFFA 3V4IA 3AODA 2ZZMA 4DV0K 4K25A 4JI1J 4IFVB 2NPFA 4A57A 3FRZA 3HHLB 3TABA 1XMOF 1S49A 2G8UA 1HA1A 3VQ4A 4OJ3A 4NCAA 2QK9A 3SQ2A 3BGLA 5E7OB 1IM4A 4DV7J 1U0HA 4NPOA 3ZSVA 3ENAA 4F4XA 3OHRA 5AQPA 4LSLA 4DU3A 3H6EA 3QAEA 4H03B 4HL9A 2HZCA 5GAEP 1HNWF 3MDQA 5DDOC 2UUBJ 1S3XA 4ILLA 3DLGB 4LH5A 4BCAA 4P2XA 3ILIA 1IKWB 1VK8A 4OYXA 3CD7A 2LCWA 1X9WA 2WW8A 1KC8O 2UUCF 1XNRJ 2QA4N 2D5RA 4ZP9A 1LW0B 1P1LA 2OPRB 3WT0A 1VRUA 1GMWD 2B9YA 2QWMA 1S72S 5AQOA 4DL4A 4Y0WA 3ZX3A 3ZX0A 3QQCD 2ABYA 1NGDA 5FDLA 2M2BA 4JRPA 3TO8A 4DCJB 1D4XA 1BCMA 2D69A 3KKFA 3ZEUA 3BBBA 4CZMA 4OYBA 2QEXS 1TK5A 1HHSA 4OV1A 3VWSA 1EX4A 2HNYB 2V68A 1JK9B 2KT3A 2IAJB 3L3UA 5BXIA 1KR4A 2XQCA 1S97A 2PFUA 2XMTA 4URQU 2A3JA 2VU5A 1DBDA 5AFUA 4WTOB 4WF9L 4N77A 3LP1B 4I69A 4CJ7A 1NDLA 2XTJP 5HBMA 3K89A 3EVOA 1OVQA 3SEOA 5A6WA 4GC6A 3CUNA 1BL3A 4ES2A 1I6JA 1S1TA 4NMXA 5H9FJ 1TKXB 1VSKA 2C2KB 4H5VA 2NRVA 5AQJA 1RAHB 2BZ2A 1C1BB 2DFFA 2V8VA 1D0EA 1RHRB 3HX9A 4LREA 3TAQA 3GILA 3TARA 5D3GA 3K7RA 2LQBA 3K9KA 2JJ4D 1B70B 3LDOA 5D8HB 3AVLA 2UUTA 3KJFB 2EC2A 2ZE2B 2DNRA 3AHPA 2CG8A 4I6AA 4F9OA 2R4FA 3LP0A 1IUJA 2ZUGA 2J9CA 1RA6A 4EK2A 4KTWA 2KT5A 4TY9A 1OQ6A 3GIJA 2YJEA 3FSXA 4Y2AA 5DM6Q 3CCLN 1FD2A 3J7ZT 3MWPA 4I1TA 2BVZA 3EWGA 4OV6A 5ETRA 2I7NA 2M4MA 3ENQA 4GO7X 5KFXA 4CZFA 5KRTA 2PT0A 1M1GA 4RW7A 1U1OA 4JI2K 5AQZA 1WSRA 4C0BA 3MMCB 2W9AA 5KFQA 1S1WB 1VHFA 4FJXA 1OYDA 1RAFB 4JYAJ 1PCAA 4DX5A 4BR7A 4CBXA 2NRZA 3GFZA 2DNKA 4B3OB 3UVJA 4ZN3A 1SS6A 2C2OB 3MPWA 3D3BJ 3W5ZA 2YHBA 1HUXA 4MLHA 2ZNZA 2A1SA 1Q5YA 1F9HA 4B17A 4DLGA 4M42A 3AVCA 3IS9A 2WW4A 2CQ1A 5M1KA 2YKAA 4J2DA 3NRBA 4O0IA 3RRGA 1A7GE 3KUHA 3CC4S 4OKJA 5F0UA 4LRAA 3WQUA 2HHQA 1N34F 4UY8O 1VRQC 5LXRA 1BOTO 2DY9A 2DFHA 3H46O 1S4FA 3RB0A 1K1SA 3J7Z5 1FJ7A 1CBKA 1OKJA 2B8PA 3CE8A 3D2FB 1DQAA 4PHTX 3KLFA 3EZOA 1FX4A 2P9GA 1BWVA 4M5IA 3R2DJ 4U96A 2L9WA 1R8PA 3VR1A 2E8AA 3TI0A 5BN8A 4QIFA 1R6VA 4XEIA 1TUGB 1GFWB 2ZOGA 3GFYA 2LQ5A 3R6LB 1Q1KA 4UT4A 4ECVA 1SKUB 1WKJA 3M2VA 1F5BA 4W5TA 1DARA 1RHQB 1KCFA 2VA2A 4GKKF 4K4ZA 2ZM6J 5K9FA 1GK8A 1LWEB 1BISA 1NG9A 2XEXA 3FCVA 2RRAA 2VHGA 3MPYA 1JXLA 3FQLA 3S01A 1W2BR 4A2BA 1XNQF 3BGRA 4Z4FA 2YX6A 1VCTA 2VODA 3R9PA 4CF9A 2ASPA 3OW2M 2YKQA 2C3OA 4V1Ak 1HWIA 1B99A 5EOYA 4C8YA 4FLZA 3C16A 4ED2A 1RBUA 2AJQA 4LF4K 2DHSA 3MXJA 1M5KC 1FJGK 4NLYA 2OD4A 3DOKB 3P45B 1GOAA 4B3TF 4TVAB 1I39A 3O80A 4FYVB 1TMMA 2VD3A 2X6NA 2I6WA 2RKIA 4ZVGA 1DLOA 3NNHA 1V5VA 1G3OA 4JI0K 1VBZA 3IMQJ 1PYOB 3HSZA 1NM1A 4CZCA 1HQUA 2QTWA 1WEZA 1ZC6A 1RAAB 3AOAA 3A3NB 1VS3A 2EFVA 3DCAA 3OS0A 2J6TA 4PZVA 1VQKS 4E7KA 4NLSA 2H5EA 2EFGA 2RB7A 3F44A 4J9KA 4DZ6A 2HHXA 1XI1A 3FZMA 3WNHA 1FNXH 1ITPA 1HKCA 5E3CA 2V7YA 2XY7A 4G1PA 1YWXA 5KFUA 5DQGA 1KFDA 3QMLA 4AF1A 5HN0A 4O4RA 3VTIA 4LFCK 1YGYA 2G0IA 3NEKA 2BW2A 4DPXA 4JI5F 2WONB 4USHA 4W92B 4F4KA 3DOMA 3TAMB 1OSDA 4A8YA 2R7TA 4P52A 1IQTA 1NKEA 2NZCA 2POKA 2BW7A 1H0HB 3R5AA 2M9KA 3M32A 1S22A 3JAMU 2PYLA 4LBPA 2X51A 3VEOA 1PYSB 4NWBA 1RKJA 2O4IA 1M1KT 2R7UA 2RIJA 4ZPDA 1QAJA 4CIEA 2W40A 4TY8A 4QZVB 3P4UB 2DNNA 1F9EB 4KGXB 3LTOA 3SQGB 3EYZA 3UKRA 2XSJB 5A2QU 2MZTA 4DX6A 2CH6A 3PIOL 3AD8C 2R8IA 2ZBIA 3CCMS 2G1HA 3QMQA 5T7LA 4JI2J 3H42A 1Y97A 4DN9A 2B9XA 5J1NA 2GZOA 4X4OA 4KO0B 5IC4B 4OLOA 2ZDPA 1RTDB 1HBOB 2CJXB 3VGKA 4NCGA 3FSIA 5H1SV 3MAQA 2L48A 1WG1A 3UWTA 2R8KA 1RHKB 3Q7CA 3BREA 5C2CA 3O3HA 1TFWA 1FRJA 3TU5A 3OFHA 4EEYA 2V5HG 1KVBA 2B3TB 3R7BB 3CD6S 3D7SB 1WUUA 3VOVA 3MM6A 3THXA 2OI2A 2QWQA 3P4IA 3MK6A 1RACB 4PXDA 3ZSXA 1YIJN 3QJLA 2OUGA 5JVHL 3HKZD 3VEZA 3OTOF 2MQOA 3AVGA 4CZJA 4X4VA 3CCTA 3CJQA 4CJPA 3CMAN 2H5JB 3CC7S 4YB7A 2O8FA 1S48A 3H90A 4L3NA 5KG4A 4QWDA 3MEGA 2OTJS 4BGAA 1N5VA 4P6QA 4H0XB 3QIPA 1S9EB 3V9UA 4A8SA 3SQ0A 1TAUA 1RDDA 2RRNA 2BJDA 4LF6K 1VQ4N 3FJ2A 4ZPAA 3HPGA 4WKRA 4LRCA 3QEPA 3O9QA 2W4DA 1OH8A 2VONA 4ZA1A 3EGZA 3TAEA 1BXNA 4RNFA 1NB7A 3ZNJ1 4ZCLA 4KTZA 4KY3A 1S1UA 3ASMA 2V50A 5JS2A 3THYB 2YY3A 3DGPA 3VQ6A 2YWHA 4BRCA 4CRJA 4O0JA 2OEJA 2J6SA 4DHYA 2BEFA 4UW2A 1N33K 4UQTA 1SQKA 4LF4J 1KAXA 1FJGJ 1JWWA 4JI7K 1HMVA 1ZM4A 1R31A 1V3RA 2ACMA 2NLWA 4RU2A 1QQMA 2B4UA 3HDSA 1C0FA 3KXDA 2Q6BA 2J4RA 4JI8K 5DETA 3G6EN 1B9DA 3V4MA 1HIYA 4FVMA 1MWMA 2K3KA 3KUGA 4DU8A 5G0RA 4HTUA 3H5UA 4HTLA 2N4CA 2YX1A 3QAUA 3PW5A 3NVMA 5J1PA 4DL6A 1GTHA 2I1RA 1B7YB 2V8PA 5A0YA 2M5YA 3HFZB 2FXUA 2VF3A 4LF8K 3KD1E 1SUQA 1S59A 5K8NA 4NB4A 1M5SA 1CZ9A 2HWTA 4K42A 2NYHA 2Y3YA 2HKEA 1RWKB 4KHPK 2XCAA 1KONA 4YQWA 4QAGA 5GADI 1C4AA 1F2HA 1VBXA 3VEVA 2FY8A 4A8MP 3T6BA 1S1VA 4LFCJ 2YHAA 3D5MA 3EGNA 4DV2K 4MIWA 2E5LF 2JRSA 5CR4A 2BKNA 3VAFA 2ROPA 5KFKA 4DSKA 4ANDA 3HP6A 3QRPA 3PTWA 4F0KA 3E8OA 1C0MA 1UVKA 2GMJA 2XG8A 4DV4J 2RQCA 1WN7A 1HW9A 2Z1JA 3O8MA 1KVCA 3MR7A 1P9YA 3F0NA 1SQGA 1ZH5A 1S6PA 2UZAA 1KOOA 5AXNA 1J6ZA 3HOSA 2HYIB 3IXQA 5LJVA 2E20A 4R8UA 3EN9A 3MEDB 4I2PB 4FVCA 1M90T 3EE3A 5FLXY 4PA1A 3SDEA 4CHQA 1F6TA 2HFSA 3D9BA 2O66A 1B92A 3ENOA 1NLVA 5J2NB 1SJ4P 4BC7A 1B7FA 3Q89A 3MR2A 3FFIA 4DQQA 1IVZA 4OZ5A 2FVQA 5LJ3Y 1NDPA 2BA9A 1JLEB 5D78A 1QZ5A 4CESA 2IC3B 3TA2A 3C6UB 2AJ0A 2GAGC 3U27A 5HQLA 4BRHA 1BG3A 2D4WA 1Q78A 1CLQA 4N76A 4Y28C 5IQ6A 1F3VA 4G9ZA 4X64F 2V0NA 4YOYA 3LGMA 2XO6A 2OTLN 3N28A 2XZDB 2HFVA 4Y00A 3MTJA 5KFWA 1Z26A 4FK4A 4JBCA 4DR6K 4ED0A 3AB4B 2ZJQQ 1S9GB 1IWGA 3W2VA 3WIVA 3HP9A 1E6VA 1Q7LB 4PG5A 1U7LA 2OMOA 2YQ0A 2LEPA 2UU9F 4EO6A 2YNGB 2FLPA 3BZKA 1SKWA 4NYFA 2RHQB 4Y2MA 4NLXA 1BQNB 3OL7A 3AVKA 1PBAA 3NL0A 1C1CB 1D8YA 1F1BB 1CJUB 5L1LA 3CDEA 4ISEA 4C1NI 2P1JA 4O5FA 4DSJA 1B3TA 5JLFA 3GFHA 1ZPVA 4KR0B 1NK0A 1W9HA 4LF6J 1K44A 2CPXA 4AXIA 3EZUA 4PXEA 3PSFA 5HLFB 1SCJB 2R8GA 3BEXA 2QG9B 4JI6K 1XERA 2F8SA 2OFGX 4A59A 4R0EA 4TSXA 1SBRA 3TSPA 4BRMA 5ETKA 1O8BA 3ZSRA 1Y7PA 3PYEA 5KG1A 3DM2A 4X2BA 2UVWA 2J0QD 4PL7A 5KFIA 4F7VA 2BKPA 2QLFB 3BQ1A 4ITSA 2V51B 1GLJO 3D1QA 1NK7A 2QMWA 4ED6A 2VA3A 2FVSA 1N33J 4Z4HA 1E6YB 4ED5A 2DHAA 1KEKA 2L41A 2QTDA 2W7AA 3U6FA 1RHJB 3NAIA 5K20B 4DR1J 5GAEU 1P1TA 2W1BA 1U6BA 2WOMB 4WFZA 3DRPA 1U26A 2R7SA 3HM8A 2AWZA 2PEBA 3WBZA 4CYUB 4JI8J 1OH5A 1H38A 5E0OA 3HPOA 3VZHA 2ALYB 3M2UA 2G2ZA 4NCBA 1CJVB 5C24A 1VQMS 3HVAA 2OKQA 1ELOA 1FVQA 3G86A 5HO4A 2ZITA 4IFYB 1LKZA 1KLNA 1RWXB 3NG8A 5BRDA 2W9BB 3UD3P 3ZX2A 4GKJK 3T7ZA 3A12A 4LF8J 1U2RA 1GNKA 3OHBA 2UVRA 2HURA 2JSXA 4B1YB 3I9V9 1T05B 3T5KA 3CQXA 4RBTA 4KHPJ 4OLBA 4B1ZA 2KM8C 4A46A 2R7VA 3EXYA 3S1TA 5HL7Q 3GSIA 4U67L 5L39A 4DR5F 5KI6A 2R2RA 3PYGA 4FLVA 3ZZOA 4MIAA 3QJPA 2KFZA 4W5OA 3GU0A 1FKPB 3POTA 2P9IB 2GVZB 4JKDA 1DEJA 3FBCA 3O08A 4LF7F 1WUAA 1K8KB 1BY9A 3CCVS 3CJTA 2X6SA 4IFVA 3HHLA 2B9EA 2P5GA 1C0TB 1VIXA 3ZETB 1YF5L 4Z4CA 3J7AP 3U9ZA 2O8EB 1LAWA 3LALA 5KFDA 4C3KA 5TKYA 3RBDA 1YAGA 4CWBA 3O9TA 2AW0A 1RLDA 2Z2LA 2CJKA 5E5NA 4GV9A 3NGIA 3VQBA 3K57A 3A5OC 5EWGA 3G10A 2ZD1A 4OGCA 4OX8A 2Q1LA 3DLGA 2VPYB 1VSDA 2X3DA 1I94F 2W7OA 1BA0A 1IKWA 1MN9A 4CGFA 3OYHA 3CJKB 4N8NA 1D5AA 2UV8G 5DZ6A 2RDDA 1SIZA 4DUZF 1RUSA 1IBLK 2JZ5A 1LW0A 2Q0UA 2OPRA 1OMSA 1K9MT 1KAYA 3OR2B 1MG7A 4CJVA 2QW9A 3AGKA 3KG4A 1S57A 2OPQB 1CZBA 4K8RA 2V2VA 3ZTRA 4RZRA 1U48A 4LFAK 3G8QA 4TU9A 5F1XA 2D0OA 4ETZA 3QGGA 4DR6J 4XK8C 3HOTA 4LR7A 2F5GA 2BGGA 2HNYA 3S3MA 2IAJA 5IM0B 4ID5B 5E33A 3T1HF 4WIQA 3CCSS 3DDNA 2YH1A 1GT8A 3LP1A 4K0KK 4LQ9A 4C98A 4DB3A 3VQTA 3EMTA 4MK9A 1FDDA 1I3OB 2ZH3A 4DUYF 1OPIA 4NYZA 2VQFK 2IM0A 4JKBA 5FROA 1IXKA 1TKXA 3N4QA 2RN2A 4PKDB 1ZYQA 1RGIA 1C1BA 3X3UA 3A13A 1CULB 3B8AX 5KFHA 5KGXA 3TZWA 2BX6A 3M9MB 5AQLA 2W7PA 4JI6J 2ZE2A 4DTUA 3DWLA 4JKHA 1I1GA 5BJRA 5EDWA 2BE7D 3D6MB 4PKHA 2JLFA 1HI1A 1HNVB 3SPYA 4U7UK 4MYTA 3P83D 4CFAA 1NGAA 3MAHA 2W8LA 2BQ3A 3UR3C 2BOAA 2XI2A 1H98A 2HFUA 5JVGL 4BR2A 1RAOA 1PBUA 2XNQA 2VBYA 6FDRA 2EHGA 1SKSA 4J9OA 4MDAA 1KVIA 3SJHA 3HSGA 4IOAQ 2VQEK 3J7YI 1EARA 1YRUA 1XMBA 4LR9A 3RUBL 1RFQA 2HGMA 2DH9A 2E2PA 4BROA 2ZJPL 2ZFHA 3MMCA 1HL6A 2YWWA 2P9UB 3Q24A 1S1WA 2L9DA 1X9SA 3HFVA 4PQAA 4USJC 4RPFA 2GGPB 3UIQA 1N48A 3JQJA 1YBUA 4QIEA 4ZIVA 4UY8T 2IVOA 5IQQA 1QTMA 1HD0A 3K5NA 4OKKA 4RKUC 3UW1A 3MM9B 4DQ8A 1GEHA 4M5HA 3TQEA 3QEIA 3ZSYA 1G6BA 4CLFA 4DV1F 4GKJJ 3TTCA 3H3NO 2B56A 2PI4A 2V9WA 2XMUA 3CWJA 2CNLB 4ZVPB 2UYTA 2B43A 4E89A 5C7PA 4ES1A 4K5SA 3PW2A 4OKEA 4PKIA 3GL1A 4B9SA 5J2QB 2W2NP 4OI4A 3OJSA 3V81A 3ZXWA 5BPLA 3LZIA 1RQ0A 3D2FA 4ELVA 1KVJA 4M7YA 4PG7A 4O44A 3QNNA 3G96A 3CMQA 4MIBA 5TKWA 1S6QB 2ZGYA 4K7QA 3A5LC 1VQNS 3MMJA 4H4OB 1RT4B 3CJ4A 4QW9A 3S7RA 3VF2A 4LF5J 1N5YB 4DTMA 3CCUN 3AVAA 2UP1A 3IFRA 4JKGB 4GW6A 5U47A 4B02A 1LWEA 5ETVA 3CJAA 2HSEB 3ETMA 3DOLB 4DR3K 1FKOB 5D0HA 4M8LA 4QCLA 1T95A 3W65A 5D4NA 1GQEA 4RU9A 2KJWA 2MQNA 4OJHA 4ZP7A 4DL2A 1T9YA 3UNYA 2IDEA 5DDPC 4NLCA 5F0XA 1IBLJ 3DOKA 2P5OA 4WWSA 3N4WA 2EPIA 1S72N 3L3VA 4X65J 2AP6A 3DMJB 1CSJA 3H5SA 1UVLA 4C8OA 2IPOB 3VMFB 2LXIA 1JLBB 4OZ3A 1GOCA 2CQDA 2Q66A 1XJWB 2FHJD 4FYDA 1RT3B 2Z30B 4M3UA 2P9PB 2BACA 1EKRA 2YH0A 4OGEA 2A0FB 5AQTA 2FD2A 3VAJA 3OYDA 4KB0A 1UTAA 2QMUB 1KTQA 3MCAB 3A0IX 4K0KJ 3DRSA 2DGVA 2ZC4A 2QLWA 4PWWA 5EGYA 1N8RO 5DRKA 5KT3A 1RBOB 1R89A 3M1VA 4CD3A 1A5VA 1ZZFA 4LF1A 2XRIA 3OYEA 4IQXA 2VQFJ 2RS2A 4B3SK 3TYTA 2OELA 2GW8A 2XMJA 3UDEA 4ZLJA 3CFRA 5AQMA 4ZJLA 1T6DA 1D9FA 3MPUB 2YI1A 3GG1A 4K2JA 1Q81O 2WONA 1YJTA 4OZLA 4X66K 4CHNA 3TAMA 4TKTA 2QO3A 1NKBA 4MFBA 1LAVA 2AX1A 4IG0B 2QWOA 3MWTA 4JV5F 3D2EB 3SAFA 1MWZA 1WG4A 5CHIA 5ETPA 2A41A 2G2YA 4YOTA 3HVWA 4OPAA 4G1QB 4FDFA 2J7KA 4YB5A 4TN2A 1WJ9A 1JLQB 1J54A 4PAAA 5F3TA 3TUIC 5DDQC 4FF4A 2IM2A 5AQKA 3OTCA 4ENOA 4G6VB 4C11A 1VSFA 4FWLA 4URSA 1RTHB 5D0RA 4FWNA 1VQOS 3TUPA 3D0GE 2YBVA 2AEMA 4OPHA 3NMUA 3I55N 2ZH6A 3FGVA 3QGPA 3LZJA 4W98A 4TNOA 1IBMK 1TL7B 3NCQA 2GJ2A 3NS5A 3SMPA 4M5DB 4OI3A 4DWIA 2FBVA 1BD6A 3QICA 1NRKA 3BYPA 1QDUB 4KO0A 1JLFB 2WTFA 4U8VA 2QA1A 5JS1A 1WC5A 2MTLA 2G8IA 1QAXA 3NLCA 3IDHA 2YX4A 3F2KA 2OLWA 2Z4PA 1CC8A 2RPIA 1F2GA 2ASYA 4A8QA 1HJOA 2FLLA 3AA8A 3KZBA 4ZVQB 1WACA 3O6WA 3H5XA 1TR0A 3CDBA 2WAQD 3ULDA 2D0PA 3HRGA 4FWRA 2Y1JA 2JOQA 3CIMA 5CA5A 3CC4N 5J2PA 3PDNA 3RU0A 3L2VA 2HBYB 2LA4A 4KFBB 3ID6A 1U1MA 2CFXA 2XS2A 5DG7A 1HBUB 2FB0A 4TQRA 1QVGR 4ZKAA 3WX8A 2BXJA 3ZO7A 2K7JA 2HHUA 2FJWA 5A6PA 2J8AA 3T41A 2R2UA 1FDAA 5JMNA 1S9EA 1T7PA 1TUVA 2HRTA 5HMXA 4J9SA 3DYAA 4IG3B 5ETLA 2KU7A 1F9FA 1T02A 3OA9A 3PXGa 3CDAA 3AVNA 3PJXA 4A4JA 3VQPA 1DQ8A 3I4PA 4HR2A 4RO0A 1XMOK 1NJYA 4CFBA 2YXLA 5K8PA 4URGA 4CIOA 3FC9A 3BSOA 2XHCA 1F5AA 3PYFA 1S0MA 3THYA 3PKYA 1J5EJ 5LMUK 1YI2N 1RT1B 3CCEN 2CKWA 3BGOP 1ZBIA 4KAIA 4RWXA 4CJWA 1NOYA 3RB4A 3B82A 4DV5K 1HNWK 5K8OA 2HHSA 2PYJA 4BBYA 5BR8K 3MD3A 4YDXA 2F4VF 4M3RA 2DRAA 5KFTA 1SH2A 3S3NA 2UUCK 3M2RA 3HHEA 1KLMB 4B9NA 3GDQA 3H59A 4LBHA 4BC4A 1PSDA 4P71A 4IBNA 4DTOA 3HULA 1HNZK 3D6RA 2XMVA 1N0UA 3D0PA 2D3ZA 1FXLA 3C6TB 3SXLA 2A6MA 1VQKN 3DJCA 1S7HA 1S0VA 2Q3PA 1B4SA 3HCXA 4LMZA 1M5OC 3SLCA 3E51A 4G1IA 4C2MA 4YHHK 4E7JA 1R8CA 3IRXB 1X4GA 3ZT1A 4KHNA 2DR6A 4N8OA 3FNNA 3EICA 4RUCA 2K06A 3AVJA 4P10A 5HVHA 3HXMA 4DPOA 1R3NA 1U4BA 4ZLNA 4J9MA 1NMDA 2FVPA 2OPSB 4CLWA 2WSCC 4J2AA 3NF9A 1YX2A 3J81U 1I3AA 3WEEB 5GAHI 4X66J 1X3MA 3KLVA 4K4XA 2HS3A 4B1WB 4J91A 3ZTSA 4ECWA 3D68A 5HI7A 2E1RA 3JS6A 2BDPA 1TYQA 2F1FA 4WFBL 1RT7B 4OO1J 1QHTA 3WXJA 3UKUB 2CPIA 4P9SA 4EBCA 3F5TA 4OHYA 2KVIA 4OI0A 3OFGA 1Y0HA 1Z6RA 1M5HA 4I4BA 4FXDA 3VEYA 2PIIA 1VLOA 3UR0A 2WK4A 4Y65A 4EP5A 3MEDA 4I2PA 3MN5A 2E2NA 3ADAC 4UTGA 4ICLA 3MM8B 2CUYA 5J2NA 5E41A 2OIHA 3B4DA 1IBMJ 1X4DA 2Z2YB 5CD4H 3MDFA 2F63A 3LM2A 1DQ9A 2IC3A 3C6UA 2MPUA 3V4IB 3CI5A 5B0DA 5HP1B 4P7TA 4QYRA 3FR0A 4IXCA 4QR2A 4USWA 3MCOA 3TA1A 3R1LA 3DU6A 3PSIA 4FWPA 2OSQA 4FP9A 2OEKA 3HZEA 3PVXA 3KMQA 2VC1A 3A3OB 4LRBA 2LDYA 3MF5A 4ZCMA 5D4LA 4ZVEA 1ACMB 1Q53A 3CD6N 1S9GA 5HVFA 1JJ2M 3CFPA 4ZVTB 2VWBA 2CQCA 4CO5A 1FD8A 1UVJA 4CIFA 2Q6CA 4ALZA 1M5VC 4DTRA 3ZLJA 3CCJS 3BF1A 2YNGA 1VJQA 1BO5O 4M63C 2D0AA 1YK9A 5F8MA 1DJ0A 2D1CA 5DS7A 2IMOA 1BQNA 4FWMA 3H1VX 4ZLLA 5BRFA 3NAHA 3Q8YA 4WF9Q 3DXKB 4ATNA 2FC9A 3MD1A 2F7VA 3VVTA 1JL1A 1BWEA 1WOQA 1EWQA 1WBBA 1Y10A 2EK1A 4C48A 4JV0A 2IVYA 1IR0A 4JD2B 1HBNB 1SH3A 5HLFA 3QBXA 3JQMA 3GG4A 1JQGA 3N79A 4WQ5C 2QL7B 4CJSA 4ECYA 2Y1RI 4QIWD 3D0IE 3CD5A 1LXJA 2YX7A 2PEHA 4B9TA 1Y5LB 3NWRA 1XMOJ 4ED4A 2CJ9A 4RW8B 4OYMA 2CA9A 5GINA 1OPZA 2HIQA 2ZH5A 5CCMA 1NU0A 2QKKA 3D3CJ 5M1NA 2NR0A 3J7AN 1JJ4A 1K1QA 1WDDA 4P74A 4KHUA 1HHQA 3HO1A 4NLPA 1E6YA 4FWKA 2GFFA 3EJMA 3CDUA 3K58A 4DV5J 1JLGB 1HNWJ 2X7IA 2D3O1 4K43A 4HDHA 1LCUA 1S1TB 1U24A 2ZQBA 1XWLA 2HAIA 3V5RA 3E66A 3LUYA 3Q8RB 3EM1A 2WOMA 2E7WA 3ILJA 3RBZA 3SIPB 2QWPA 2RMLA 3W63A 4B9VA 2CPJA 4CYUA 5E3PA 3G4SN 5GIOA 2O8DA 2E5JA 3BH6B 1XN9A 3R6MA 2XSFA 2R8HA 2UUCJ 4OX9K 1CJVA 2KL8A 3CO0P 5IZHA 1KFSA 4DU1A 3IGVA 4MO5A 3LP0B 4B3TK 1QQOA 1NNEA 2Q97A 4IFYA 3AQPA 4CNYA 4X4UA 3H0PA 2AGPA 5CZVA 2UUWA 3KK1B 1VSMA 4H54A 1PAEX 3LDNA 4PXCA 4CHZA 4TYAA 1CG2A 4KGMA 4AL5A 2VASA 3CJSA 1JB0C 1Z2ZA 3VEXA 1D8ZA 1NUEA 2VPWB 1ZS6A 2FF6A 1J5OB 4JB8B 5KPRA 2WBNA 1T05A 1RU2A 4JI3F 3T9ZA 1QD1A 1HR0K 4RW7B 3PRDA 1FKPA 1NBWA 3HK2A 1D09B 2DGTA 1DGKN 2P9IA 2GVZA 1MWYA 4B3MF 2A10A 2CVIA 2V2KA 1K8KA 1RP5A 4OFZA 4ILJA 2HMIB 3WIUA 5CH7B 2A2DA 2VB6A 5E3QA 2JWNA 1SQFA 1NK6A 4H5RA 2HZVA 1YRXA 2HHHF 3TOQA 2YKNB 3V6DA 1C0TA 3I9ZA 3ZETA 1QSSA 4M95A 4KKOA 3B4MA 4WXWA 2DGXA 4DPTA 5KFCA 5DG9A 4DEZA 3OYFA 4M5MA 2RVJA 1JXVA 1CPZA 5BPNA 1LW2B 4HLBA 5EWEA 4FN5A 2R7OA 2BM1A 5KFMA 3HTVA 3GCXP 2DK2A 1HYVA 1RT2A 1IBKF 3Q8UA 2HQIA 1NSQA 1JXBA 5DZ7A 1ATSA 2ZBRA 2UXBK 4JP8A 4AFFA 4OIXA 3K9JA 4IRDA 2B8QA 2DNOA 4H5NA 3CJKA 1M5PC 2B4PA 4QBUA 4H5TA 3FZLA 5IC6B 3NS6A 2P9NB 1VQPN 2F9DA 3WX4A 2XULA 4XH1A 3CC2S 2BRLA 4E19A 2EFOA 3OR2A 4USMA 2OPQA 1AFJA 2VFUA 4F2RA 1NJXA 2GO8A 2PA8D 2AD9A 4E2FB 4ECXA 2IJNA 1BMQB 2KHCA 5KG7A 4WFAL 2VOPA 4IDKA 3R27A 1PKUA 3D6TB 2QLJB 2HNDB 4CTAB 4RW4B 2NRWA 5IM0A 2VYPA 2C2EA 5L46A 4ID5A 4E98A 4NE9C 4F26A 2YWKA 3BGRB 2OA8A 1U02A 4P73A 3I31A 2E9RX 1X4EA 4FJGA 4BRAA 4MJKA 4QU6A 1S79A 2W41A 1Q8BA 3SMSA 1IQZA 3C16B 2IVFB 2QM1A 4QOTA 3W9JA 4KYZA 2R9LA 1FA0A 1N34J 3T5LA 1VQ7S 4X62F 4FYXB 1AW0A 3JSMA 1FERA 4DZDA 1LOUA 3ZZ0A 4ZTFA 5IS2A 4UQGA 4B8CA 2ZVSA 1CXUA 3I33A 3CCZA 1V5IB 4DR7F 4QIVA 4CEAA 1RA7A 2EFNA 3G6XA 1NKCA 1BQXA 2L3MA 2DTUA 3OY9A 2E1MC 1ZBHA 2F40A 4FW2A 2N7YA 1HQUB 3N0VA 1S6UA 3F56A 2RILA 2UXDK 1HNVA 4FM1A 1ZBFA 4CJRA 1ROFA 2VGNA 1EETB 1DHMA 1L3VA 2Y0SD 1Q0NA 2PAVA 2MZJA 2IMWP 3SAHA 2NS1B 4KGKA 4GKKJ 3M9OB 2V7ZA 1WC4A 4FJHA 1YJ9S 4CCHA 1WF0A 2BOPA 5LT5A 1U6FA 5FIIA 1L3TA 1X60A 1XNQJ 4F36A 3VQCA 2HWIA 4A48A 4BRLA 3L2WA 4CJ5A 2QFJA 3RBXA 2IRXA 2QLXA 3OVNA 3DOMB 3OVAA 3PIOQ 4J9RA 1VMBA 2WTUA 3AVMA 4UUWA 5THWA 5AQRA 1VSLA 3W2WB 2C2MB 1KDNA 3LO3A 4PKGA 3WHIA 1PIEA 4B3TJ 4AH9A 1RLCL 5AJ3K 3PIPL 4ZITA 3BZQA 4ZJOA 4NLRA 4NXMF 2PO4A 2MGZB 1IG9A 3BQ0A 2GJFA 1LK5A 1LQ9A 2HZAA 5K5MA 4CK3A 4FWQA 5CE3A 2ZH8A 4DL7A 3ONQA 1RWMB 3HMJG 3HJFA 2NUHA 3IMXA 1FE4A 5KQDA 5L9NA 1KTVA 1VC6A 3H7HB 1YKWA 3UKRB 2GCFA 2UV8A 2E9ZA 5J2QA 1VQSA 4RG8A 4GVEA 3US5A 2R7XA 5HMZA 1N32K 4H0OA 4FLUA 2V52B 3KWGA 3CCRS 4DL3A 4FNIA 2D3UA 1QAIA 2G8VA 5EXWA 3DU5A 5JVHQ 1HNIB 1YG0A 4F0HA 4D3GA 3ZZUA 2KFNA 2EBEA 1MDUB 2YWGA 3KHYA 4BC2A 1REVA 5KT2A 2PMZD 3SZ2A 1RB0A 2CH5A 3KK2B 1IM6A 3IWXA 4DV0F 1SAZA 3MGJA 2E5LK 2BJ8A 4CGDA 1YJNN 2VFSA 4JI5J 2V67A 1S6QA 3SNNA 4H4OA 4BG9A 1GLFO 4F0MA 1RK8A 3QO9A 3E9OA 5K14B 3O5TB 1C0GA 1N5YA 4JKGA 3QEWA 3EEQA 1NPKA 1Q16B 3PO4A 1SPBP 2ATQA 4WP3A 4YFUA 3G71S 4OI6A 2C3UA 1WDTA 5DM6L 4WCEL 4OHWA 1X8DA 3LDQA 1HWLA 4WIIA 4WYLA 4F02A 2OP5A 3M6WA 3MXHP 4DX7A 3MEGB 3Q0AA 4EYIB 2HEKA 2ITGA 5KT4A 2QFIA 3VENA 5C0YA 2DPNA 3S9HA 5C42B 4RW9B 4ZPWR 2NRXA 4HI1A 3TVZA 4CEDA 2AYGA 2KZMA 2YNFB 3RW7A 1TFYA 3BQ2A 3LWMA 2ZGZA 1JLBA 4YOVA 2WUSA 1HNXK 4BQLA 3O9UA 2VWKA 3C7NA 3IWLA 1RT3A 2V2QA 4F4WA 3VEWA 2P9PA 2E1CA 3K5MA 4X64K 3NAEA 4BACA 4CVNE 4WFNL 3J80U 1EQMA 3EE8A 3CF5L 3ZZTA 4NLBA 3B78A 2BMBA 4K4UA 3F9KA 5IOLA 3CCSN 1FK9A 2HS4A 2HGLA 3F9MA 1XEZA 2DJWA 1R8AA 3QT6A 2V4QA 2X3GA 4I6WA 4AM6A 2MQLA 2ZDOA 5B0AA 5FLXU 3ZT0A 2QL9B 4X4TA 4LBIA 1NK4A 1HMVB 3TX0A 2YKPA 3OTOJ 2D0CA 4QWEA 4NYPA 2QGFB 3BDPA 2GC8A 1UA1A 1FCAA 2GX8A 4CT8A 4TXSA 3CHWA 2CJYB 5CCLA 3VZIA 4IG0A 5JICA 2RF2A 1DFDA 3D2EA 1SJFA 4CJ4A 2MJUA 3N6LA 1LWXA 4G1QA 2LFVA 4I6MB 4EFAC 2XM3A 4LIWA 2NUUG 2LKZA 3ISND 3ZFVA 5A0YB 2UUAF 2MQMA 4BE2A 3HVTA 2NRTA 4ELTA 5AQYA 3MHYA 2ZOMA 3PR4A 3NF6A 1UJ5A 4RJVA 4PQUB 1GLLO 4CM0A 4CP5A 3PUFA 4DR4F 3D0HE 3VTHA 2WB4A 2YV0X 2DR7A 4PABA 1JNZB 5GADP 4XPEA 1B0TA 2H65B 4QR0A 1TL7A 2E5GA 4JI4F 2P9LB 2VG6B 4JI2F 3W62A 2VC0A 3M6VA 4O3NA 1JLFA 3OBWA 1OIAA 1TZ0A 4KH5A 1WWHA 3GYNA 3TR5A 4JI1K 5AJ3J 5KG0A 3Q2SC 3VAKA 3PV8A 4CJEA 4YUDA 4CEFA 5GMDA 3GPAA 4CGGA 4FVUA 4Q7AA 4FZYA 1R0BG 5LL6Z 1NK8A 1VJWA 3ILLA 4A5BA 3P6YC 1UL3A 3E9LA 2J8SA 4NX9A 2NPIA 2FC0A 6AT1B 2UUBK 1I51B 4FJKA 2ZHBA 5CY4A 1X31C 2O1PA 4IEEA 4KFBA 2BYCA 1Z05A 2VL1A 2CNNB 1ZM2A 4DL5A 3IN5A 3EZWA 3CFOA 1HBUA 2O4GA 2FY1A 1ZAWA 2AMCB 2UXCF 1M90O 3AJ1A 1C1AA 2KTQA 3JS9A 4K4TA 5IXUA 1VR6A 5D15A 4DR5K 1NJZA 3I0RB 3QFUA 4FJIA 2E5LJ 1Y3KA 4FYYB 4IG3A 3NMAA 3UDVA 1YJ7A 5A8WB 2FGOA 3MUVP 3RR8A 2RDJA 5FPDA 1T9XA 3MURP 4LF7K 3EVWA 4Y1DA 4KJIA 1KHVA 4PR6A 2FQQB 5D6GA 3OW2R 2DNPA 4EBEA 2DTJA 3QGHA 2ATCB 3OSNA 2LXUA 2FJVA 1UFWA 3E3XA 2MKIA 1LWFB 2YQ1A 5KOWA 4CF0A 1X5SA 4KTQA 3UE2A 3OLAA 2DGOA 4JKAA 4U95A 2DISA 4CLKA 4DG1A 3CTRA 2F8TA 1ZAVA 1BDGA 3VQEA 4IO9L 3O1LA 2GQCA 1UWAA 3RMAA 4N41A 3MOZA 4ZS6A 3OFEA 2Q43A 4K4SA 1C6VA 2DNMA 3CNQP 4P7VA 5H9FK 2ATLA 4QU7A 4QJVA 4CHYA 1I94K 1CS4B 3IAM9 3HLUA 2VZ9A 2DNGA 4KBOA 1IJJA 2RD5C 3IR6B 2ZWOA 3HFKA 1NXIA 2Z56B 4J9VA 5F2RA 5SWMA 4JI0F 4H0PA 4DCHA 1HNXJ 2GIRA 3HSTB 2BUPA 1W25A 3KG1A 1NPPA 3SFUA 4DV3F 3MCPA 3M8QA 3H8YA 4J8FA 1U09A 3BKUA 4W5QA 4X64J 3L9ZA 2ASLA 3O3GA 5KFBA 5LOQA 4Y2CA 2R7WA 2QXLA 1WSVA 3S8SA 1WHYA 3AXMA 3IRXA 4HTIA 2HQGA 3KNGA 2EG1A 2EW9A 3UO0A 3DHXA 3O44A 2XZTB 4CI6A 4DFMA 1QS4A 2AYEA 3T1HK 4CI0B 2B4VA 3DRPB 3ZT3A 2KG1A 2APOA 3M8YA 3SPZA 3VAMA 3H4BA 5HJYA 1S5ZA 3RB3A 3NH2A 3WEEA 1IKVB 2DCLA 4HUGA 4U67Q 1YBAA 2JLEA 1VSHA 2JWLA 4LC9B 2QJ3A 4DS4A 4DUYK 1WB9A 3H2VE 4ERDA 5DGAA 1RT7A 3TEGA 4R79A 3UKUA 1O0PA 4W5NA 5IT0A 3LPYA 3TP2A 1RNHA 3EZ5A 2VJUA 2OAUA 2E1PA 1FX2A 3GIRA 3MTKA 3G82B 1K73O 3OT9A 3QEVA 3DRYA 1FE0A 1RABB 3OL6A 3C95A 1T6CA 3IUCA 2I2YA 4OZ2A 5B0FA 2HG4A 2C2NA 2X1GA 4DV6K 3GFXA 3MM8A 3EE9A 1VQON 4GC7A 4KT0C 1Q9XA 4CEOA 3MFHA 3JQKA 4M3WA 1J2VA 5HK4A 3TWHA 3KLEB 3CCLS 2HHTA 2KN4A 2DO0A 1AYEA 3GV5B 3I0SB 2IIHA 5HP1A 1WLJA 4M5NA 1GTEA 3U1MA 4CLUA 1XC9A 1KVKA 3D6FB 2DBBA 1WTFA 2EK6A 3OXGA 3JAMO 4QWBA 5DMRA 2VBXA 1YJVA 3QINA 3GIKA 2LLZA 4EIAA 2NCKL 2HBLA 4F50A 3I96A 5DGBA 3HVRA 2CAJA 4YY3F 3HD1A 2ZHOA 4ETXA 3OYCA 2ZM6K 4GVMA 1ZBTA 4GNIA 3HM9A 2RNEA 1KP6A 5A2QO 2ZD1B 4C1NK 3HPHA 4DV1K 2B7BB 4Q5VA 3UDLA 1ZOTA 4KPCA 4OYPA 1IR1A 2ZHAA 3G25A 1SZ2A 3UQSA 3CCQN 2WVEA 3DXKA 3RMBA 7AT1B 4FM0A 3BGFA 1T3VA 3TNVA 3N9UC 4U7CA 2HVIA 3ZNUA 4DR5J 2IVNA 3MMBB 1FJCA 1FRLA 5D4PA 5AR0A 3IR7B 2DH8A 3OLBA 2ERRA 1EO1A 5IT9U 4JD2A 1HBNA 4LF7J 4HUEA 2DPIA 3C3LA 3BO4A 2H1YA 4JN4A 3UPFA 4KSEB 3RB6A 3FSYA 1WBDA 1KD1O 2DIUA 2K3IA 4N5SA 4IKFA 4CJLA 4RW8A 3UCGA 1YJRA 4NO7A 1K9MO 2M3DA 4DU7A 2EX3A 3R3TA 2YHYA 1MNEA 3BBFA 5L9XA 2RJZA 3IWNC 3CETA 2NZTA 3ZZRA 2QA2A 5B0BA 3FRYA 3GCWP 4CK2A 1Z2LA 3MR3A 1JLGA 4HEA9 3LOUA 4J9PA 5JVGQ 3CO9A 3QFHA 4MKBA 2A6OA 3FZFA 3ICLA 2PE8A 4JI7F 2QE5A 4KH1B 4YOEA 2QXFA 1FT8A 3NMRA 3M5RA 2O8BB 2VKRA 1I94J 4KC5A 4FS2A 2NSBA 2R2SA 1RADB 3VQ7A 4LFBF 2ZKUA 2NQPA 1LK7A 4X4QA 2NYIA 3I56S 3EO3A 4ECTA 4L73A 1VC0A 5L1JA 2HAFA 2PMHA 4DUZJ 3DXMB 1TVRB 2ZJPQ 3BSAA 4CJ3A 1BU6O 2E1YA 3EVMA 3BUZB 3NOGA 1QQCA 2H3GX 1Y00A 4I9QA 4OYWA 4CH0S 3KK1A 2WBMA 1E4GT 3EL2A 1YXQA 3A5NC 4CF1A 3M9NB 3ZZYA 2V34A 2CIMA 4KB1A 3ISZA 5DM7L 2MSSA 1H74A 2KKHA 2B7CB 2WVDA 2G1DA 1J5OA 1AROP 2W2MP 4YOXA 3KWMA 3QERA 1SL0A 4IR9A 2B4JA 4M63A 3PX6A 3T1HJ 1EZZB 2MMYA 1J9AA 2D9OA 2HHPA 2N7CA 1N6QB 3K5OA 1Q8KA 3J7YP 4USKA 1SVDA 3QBWA 4DV2F 2WB1D 4DS5A 2F3JA 2O5DA 3OYNA 1H1VA 1X0PA 2AJ1A 4J90A 4DUYJ 4TLQA 2HMIA 5KG2A 3D2WA 2F65A 1TL3A 2YKNA 2HVEA 4OX7A 4K4VA 2HBJA 1NPRA 1HRHA 5M1QA 4A62A 4D3HA 4UOFA 4EWTA 1RXOB 4CT9A 4PL8A 1U1KA 3O9RA 4JV5K 3R8EA 1LW2A 2RHSB 3P31A 4KHRA 4G65A 5BN9A 1SIWB 5E3RA 4PXBA 1P90A 4Y0FA 5T41A 4DV6J 1YJWN 1TL1A 2R7QA 3CQ8A 2GWJA 3V81B 1VQ5N 5IV4A 4C0HA 2G8FA 2ZJRL 1EJ7L 2E66A 4PWDB 3C15B 2P9CA 4Q2MA 2V4JB 4M5JA 5E26A 2P9NA 5A8RA 2NRHA 1OWXA 1TU0B 4NMLA 4QOZB 3Q22A 2LU2A 4CF2A 1HKAA 4O44B 3D6HB 4AHRA 1OSCA 3TANA 2CPYA 3QLHB 3IP0A 3THWA 3TZZA 4CECA 3PLAA 2MYFA 4BGBA 2J9DA 4FWOA 1DZ5A 4TYBA 2XYHB 1EB0A 2Z58B 3FK4A 2KI2A 4HDGA 3EXCX 4ZDNA 2HNDA 4CTAA 4RW4A 5K8MA 4O8KA 1QVFM 2CQ3A 2DGSA 4DV1J 3LM9A 2W4PA 4YS2A 4TU7A 1D3WA 4AM7A 1TELA 4AHCA 4CHOA 5RUBA 1TP7A 2VOOA 1YIJS 4FJJA 3MUMP 3OS1A 1ASUA 4U7BA 4IOCL 5C25B 1RJJA 4KPYA 2VGMA 2E44A 4OZ1A 1JKHA 3CQYA 3CMAS 1WC1A 3GJRB 1UAWA 2CJAA 3FVYA 2DHHA 3I6PA 2D41A 3P38A 1NSKL 2OSRA 1SKRA 5I9EB 4AILC 1OQ3A 1IR2A 3CXCM 3MEEB 1EETA 4DL0C 3PX0A 4BHQA 3MX2A 2YKOA 4BRFA 3DRSB 5KFJA 3M1VB 4IO1A 3AVFA 3KIOA 1BI4B 3OBIA 3BBCA 3FQKA 2JX2A 2JH3A 4K8XA 3RVCA 2O3DA 3KJQB 3VQQA 3HT0A 3OVBA 3GR1A 5FRMA 3B54A 3KWIA 4MQ3A 4IJNA 2W8KA 4MT1A 3RAXA 2ZUAA 1H7WA 1ICEB 4DV4K 2GAHC 4MFBB 4OJGA 3W2WA 4OZ0A 3J8AA 1U6ZA 3DLHA 2GA7A 1RISA 2XWYA 3IM9A 3HF5A 3DLRA 2MGZA 3U02A 3BZCA 4NLVA 2YVSA 4Z7YA 4KHSA 2CGJA 2C22A 1OYEA 4HHUA 3NKYA 4GKJF 3OJUA 1NZAA 2V8GA 4BVPA 2GUIA 2E1ZA 4C11B 4FM2A 3JTOA 3ILOA 1UP1A 4CEEA 3QYYA 4MKYA 2PFFB 4FBUA 5FD1A 3UDCA 4FLYA 2CGKA 4XIUA 1A0OB 2HSTA 1HNIA 1L3KA 2O67A 1MWQA 1JCFA 4YP3A 3IAS9 3IFEA 1BGXT 1VHXA 3KK2A 5L38A 4CBUA 3M8PB 3AAQA 3CYMA 2KXFA 2BJ1A 2FTRA 1X5TA 4YN3B 5K14A 2ASJA 4JV5J 5HSPA 3K0JA 3L2RA 2NSCA 3MPVA 3R97A 3D66A 5ADXH 3LGHA 5J2PB 4IKAA 3RRHA 5KAKA 2PA3A 2W2QP 1MLAA 3DC2A 4E7LA 4L3KA 1IBCB 4UF4A 4F3MA 1LWCB 2B6AA 3JSYA 3GYGA 3FBFA 4IOAL 3LA0A 1RCXB 1FEHA 3ZT2A 3C65A 2Q36A 3GZ7A 1VQLN 3U1LA 4X4RA 4PG8A 3CC2N 5C42A 4EAHD 1NGGA 2RQKA 3DYAB 3DRRA 4RW9A 3VERA 2JGUA 4DXLA 5GADU 3GWCA 3OTDA 2CZ4A 4OMFG 1TUUA 4AYBD 2VCPA 4ID1A 2VG7B 2YNFA 2CQPA 4NZ0A 4XH5A 4H0YB 2F7TA 4LFAF 3R1HA 2GV1A 3O8WA 1S99A 4BC9A 4BREA 3ET6B 1F5CA 2V63A 1GMWA 4M7XA 2VPXB 2ZZTA 5AQFA 2QV6A 1O1WA 3VQ9A 1U0SA 2OTLS 1LEOA 2IIRA 1GLDG 2EBGA 3AO5A 3BPDA 1FNOA 1OJ4A 3OPKA 3CSKA 5F8JA 4F3QA 1U8SA 4WP8A 2HF4A 4L8RB 2NREA 3AOBA 1IJEB 2GHPA 3QT5A 1DT9A 2CRLA 2C28A 4DR1K 4QPXA 4Z4GA 5M2UA 2CYYA 3R5BA 1VHIA 2HMPA 5AQUA 4G3IA 5KPZA 2LSNA 3NGKA 3M2RB 5CHCB 2QLBB 1VGYA 4OZJA 1ZPWX 1KSPA 1KVAA 3W3DA 4YDDB 2RAQA 3M8ZA 4NZ6A 4I6MA 2YKMB 4WFBQ 3N5BA 3T3FA 1RSCA 4USIA 3V1OA 3EY1A 3LANA 1VIOA 1ZXOA 1VAZA 4CNZA 5KG6A 4Y3CA 1J53A 3O1BA 4ECQA 3UI3A 4CFDA 4PQUA 3MR6A 5EX0A 2RUSA 4ZPVR 4CLSA 3AARA 1KS2A 1W0HA 2DNHA 2VQEF 2FYXA 1NGIA 5HRNA 5F41A 1MMNA 2P9LA 2VG6A 1FDNA 4EU0A 2PI5A 2HQDA 4ZTJA 1K0VA 4C7QA 1Y5NB 5CYJA 5GAHP 3MXMA 3HHDA 4I9LA 1TYQB 1Q82O 3PG9A 4ZVRB 4C9DA 3TZXA 1L5UA 4OX6A 3DRXA 3KLHB 1RTIA 1SV5B 1SJ1A 2OJ3A 2F4VJ 3OYBA 2XC9A 2BABA 4AT1B 3PJWA 4UOCA 5DG8A 1U47A 3A2FA 3NH0A 1RT5B 2EG2A 2UVUA 3MN9A 3ID8A 2CVEA 4QW8A 2HNZA 4ILMA 2LU1A 9RUBA 3JXOA 2HOEA 3RGIA 2VPZB 1RWOB 4ICLB 3E01A 4ZCKA 4CO1A 5AXLA 2V8HA 1FHTA 2L9NA 2LP4A 2Q79A 1URRA 2LECA 5EVZA 3CCRN 3C6HA 4OI1A 3U3YA 1RWWB 2WSEC 3MXIA 2D1KA 2KVQE 2MKCA 2CZVC 3SQ4A 5DO2A 3TJ8A 4DTJA 5KT7A 4JI3K 3I0RA 3R7NB 4PUOB 2P9KB 2VIHA 2FJAB 2I8EA 1WSJA 5A8WA 1FFSB 4OI2A 3PKMA 4KREA 5CYQB 2V4RA 2AGQA 2JLGA 3UB5A 2ETJA 3ZSWA 3KHLA 1Q8LA 1I5OB 5F8GA 2GUPA 4ZOSA 5FPEA 4DTNA 1WNSA 2ZF5O 1V3ZA 4H4MB 3T19A 1LWFA 3LP2B 2BANB 2KQ2A 2LMIA 2OEMA 5FPMA 3AAWB 3SBTA 2RRBA 4DR3F 4P75A 4Z4EA 1RZMA 3TAPA 1EIYB 1RAIB 5GAGI 4TQSA 1IBKK 4I0WA 3KNAA 2DXDA 4KGZB 4RNHA 4UZBA 2YQ3A 1RBTA 2AP1A 1CS4A 1GXUA 3OYAA 1URNA 4LSZB 2QYGA 5LXYA 3AA3A 3OFFA 2J5AA 4CZGA 3MCNA 4WQ4C 4HCCA 1N52B 2P9SB 1VI7A 2HFZA 2OYQA 3SMZA 1UA0A 3D7EO 5ETMA 2AEJA 4HKQA 5AQXA 3NCPA 3AO2A 3SSQA 1BQMA 1FRMA 2H48B 1FNMA 1P6TA 2WZ1A 3ATUA 2MZSA 3QWUA 2F96A 3CMEN 2MXYA 4A8KA 3B6PA 1FXDA 1DAXA 3C66A 1KQFB 1VQ9S 4FJMA 3SUOA 4B3SF 1N56A 1HLUA 3QWPA 4O5BA 4RR5A 2GVDA 3Q2TC 1PC5A 1IKVA 1K73T 5AXKA 4CQ1A 2BQUA 2O8DB 4FNHA 5C5JA