4IG0A

Hiv-1 reverse transcriptase with bound fragment at the 507 site
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 160
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig0A05
1LWCB 3NBPB 5F8MA 4ZHRA 2RF2B 1RTIB 1WSIA 2GIQA 4IKAA 4QW9A 3VQ4A 4IFYB 1Z4UA 3MXJA 3LWLA 4WZMA 4NLWA 3M9NB 3EY1A 5HP1A 3QIDA 4CF8A 5D3GA 4YQWA 4IKFA 5CYQB 3RMCA 5L1IA 3KLHA 4CHOA 3H40A 1VSFA 1Q9YA 1SH3A 4PY5A 4LD0A 3QEXA 3VA0A 4TY8B 5HROA 1S4FA 4DTJA 3HXMA 1XR7A 3DRRB 2Q3SA 4DG1A 2OPRB 3V6JA 1CXUA 4DQQA 2YNFA 2O4GA 1O1WA 3T5JA 3G6YA 1SH0A 3V6DB 3OL8A 3THVA 2X6NA 3AVGA 2IJNA 1RT6A 5I42A 3AVLA 3TWHA 4QCLA 3TAQA 3VQ5A 1LV5A 2FVSA 4RG8A 3SQ1A 1CZBA 4FLXA 1RDCA 1VK0A 4O0JA 2OH2A 3O4NA 1LAWA 4F4ZA 4R8UA 2RKIB 1WSFA 3QO9B 4CK1A 4C8LA 2W9BA 1SKSA 1QS4A 1S9EA 3KLEA 4IDKA 1ASVA 1TVRA 1J9AA 4LH5A 1LAVA 3SNNA 4RW8A 1KHWA 5HRRA 4NYZA 2UVWA 1JXBA 3NGYA 3FFIB 1U47A 4N47A 2FJVA 1S6PB 2G8FA 3QYYA 1L3SA 1N5YA 2ZE2A 4KV8B 4ZP8A 2HAIA 4M42A 5FRMA 1CSJA 3MR5A 4YNQA 3QGGA 3AO5A 4QWCA 1IG9A 2AGOA 2ZD1A 2QE5A 5DGBA 2DPJA 4OGEA 1S1XA 4TQSA 3KK2A 3DI6A 3IGVA 3V6KA 4FM1A 1C1CB 2W9AA 3KLHB 1S48A 1J53A 2X74A 1EETB 1VSLA 3OL9A 3FQLA 4I2QA 2IS3A 3ZT3A 4AHVA 1RTHA 5DG7A 3BSOA 4Q5VA 4DSLA 4DG1B 1A5VA 2QKBA 3BSAA 4KB7A 1RT1B 4IFVB 4IH7A 2B6AA 2JEGA 4KAZA 1RYSA 3OYCA 1UA1A 4E0DA 2IJFA 1HNVB 1NJWA 3P83D 1TV6B 1VSDA 3MEDA 3VQEA 2FC0A 1L3VA 2P1JA 4FLTA 5CYMA 3LZIA 1NJXA 4PQUB 2E4LA 4MKAA 2IM1A 2W9CB 3KMQA 3AO1A 3KKRA 4CESA 1ASUA 3SQ2A 2YHBA 1UWBB 4E3SA 4M94A 4FJJA 3DYAB 5J2PB 4GC6A 1TGOA 3KJVA 3DOLB 3CDWA 3OY9A 3DLKA 3L2QA 1HPZB 2F8TA 1RILA 2ASDA 1NK5A 4G1QA 2Z1GA 4CJ3A 2X6SA 2G8KA 1SKRA 1C1BA 1JLCA 5KFSA 3DM2B 4AH9A 4DQRA 4DTSA 5DQIA 3HSTB 5FRNA 3CYMA 3ZSWA 1UA0A 2XCPA 2W7PA 5HRSA 1REVB 3AVIA 4BDYA 4FJIA 3MAQA 3LALA 4Q44A 3IG1A 3T3FA 4IH5A 3OLBA 4W5NA 3VQAA 3NH0A 4KPYA 1NJZA 3ZSOA 4K8ZA 1FKPA 4NLGA 2HB5A 1IKXA 1IKYA 5KFAA 3VQDA 1IKVA 3OYKA 1ZBUA 5KGWA 3L8BA 3PW5A 2HHTA 5DQGA 5CY4A 4CJPA 4O5BA 3CM5A 1LW2B 3SUQA 2D3UA 2HWIA 1SKWA 5C25A 1TKXA 3PW7A 4NLRA 3SFGA 1ZYQA 2E9RX 4RU9A 4ED3A 3AO3A 1NK8A 3HKWA 2W42A 3RR8A 3NF9A 5SZTA 1NK0A 2ATLA 4PWDB 3NAHA 3GV5B 4IG0B 2WOMB 3S9HA 3V81A 2IOCA 3ZT2A 4FJ8A 3I8DA 3GIMA 2W7OA 2R2UA 1Z25A 2AQ4A 4Y1CA 3NAIA 2FVQA 4FJLA 4NCGA 1JLFB 5J2NB 3E51A 4YR0A 4M3YA 1C0UB 4J2DA 2HNZA 1HMVA 2RPIA 4MH8A 4KE5A 4CGIA 4CIEA 2OPSB 4AHTA 1RDDA 3I0RA 1NKBA 3RBDA 3GILA 3V4IA 5KFTA 4CHNA 4KTWA 3K59A 2WRMA 4DTMA 4RW7B 1X9SA 4OKEA 3BDPA 4B9UA 4N5SA 4LQ9A 2EHGA 2X78A 4J9SA 1VSHA 3KIOA 1NOYA 5K14B 4IQXA 1JLEA 3BREA 4MK7A 3Q8QB 3EPGA 2XWYA 4DTNA 2OZMA 2XC9A 3H4DA 3N6LA 2FLPA 3OHBA 2Y1JA 3SV4A 3M8PB 3QIPA 4NLTA 2HVIA 3H5XA 4KKOB 3SI8A 3IN5A 4IR1A 4E1NA 1SL2A 4DTOA 1TL3B 1N6QA 4H4OA 1QE1A 1W0HA 4FM2A 3U6FA 5KT7A 5L1LA 1S1VB 3KK1A 4QOZB 2P51A 4AHRA 3BSNA 1JKHB 4CHYA 4ECVA 4K4XA 4EYIB 4M41A 3QNOA 1S6QB 3KHRA 1HQEA 4OPKA 3NL0A 5KFKA 3RBEA 3VQSA 1T94A 5F9LA 5EWGA 4RNMA 3HM9A 4M95A 1XC9A 2YNHB 4RW9B 3H59A 4J9OA 1HNIA 5KG3A 2AU0A 3L3VA 1GOAA 4O3PA 1BQNA 3VA3A 1JL2A 4RW4A 4CEFA 2HW3A 4F8RA 4DQPA 5KT6A 3I0SB 3BJYA 1MU2A 2J6SA 2W8LA 5KFOA 2HMIB 1BISA 1WLJA 4I7FA 3D45A 1Q8IA 4ECYA 3GIKA 1EKEA 3QGIA 2FJXA 1C0TA 2R8HA 3KLVA 4CGGA 4FLYA 4FBTA 5KFZA 3VQPA 1L3TA 3KD1E 1TK0A 4LSLA 4C8MA 1TK5A 4Y34A 3GIJA 3HPGA 5JUMA 4FZXC 1KLNA 2QXFA 4EBCA 2D0AA 3M8QB 3H5UA 3K5OA 1I39A 3KLIA 3KHGA 4H8KA 2RDJA 1XHZA 3TABA 2HNDB 1NK7A 3E01B 3CDUA 5J1EB 3H5SA 1FK9B 2C22A 4J9PA 5KFHA 2VA2A 3LDSA 3PX6A 2ETJA 4C8OA 4KHUA 3DRPB 1LWCA 3C6TB 3NBPA 4KTQA 1BL3A 2RF2A 3DLHA 1RTIA 4O3QA 3Q8RB 4X2BA 5C5JA 1TK8A 1HQEB 4IFYA 2XGPA 4CJEA 1RT2B 2BE2B 4JS4A 1T3NA 3V1OA 5CYQA 4F2RA 3LP2B 1SL1A 3H5YA 4CJRA 1JX4A 4RNNA 1WNEA 1G15A 2E9TA 4HHTA 4TY8A 3GYNA 3FQKA 3DRRA 1D1UA 3I5BA 2YNIB 5EWFA 2OPRA 4J2BA 3OLAA 4ECUA 5KG2A 3D28A 4FJ5A 3V6HA 3V6DA 4O4RA 4NLVA 3QESA 1JLGB 2GIRA 2JGUA 4EBDA 3AVNA 3K2PA 3VQ9A 3VQCA 5HRNA 4FCYA 1XR5A 3K5MA 2VG6B 2BQRA 1RT7B 4BE2A 4CJUA 3S3NA 4I2PA 2PYJA 4O3RA 2RKIA 1K1QA 1HYVA 3QO9A 2XGQA 4TSXA 1TKTB 4RUCA 4MKBA 5KFYA 4FJGA 2XY7A 3TAEA 1VSJA 1RT5B 5CZ2A 3M9OB 5DK5A 3HVAA 4FK0A 4YP3A 3FFIA 1S6PA 3O4QA 5F8IA 1VSKA 4KV8A 1T05B 3SFUA 1RTDB 3G86A 1NK9A 2IC3B 3RAXA 1IM4A 3C95A 4WXWA 3QINA 2UUTA 3G0ZA 2XHBA 4JS5A 4DLGA 3ZSYA 3CFRA 1D9DA 3T5LA 1C1CA 4B08A 4I9LA 2BQ3A 4NLYA 1WSJA 4F2SA 3MXIA 1EETA 2JC0A 3KHHA 1N48A 3QGHA 1JLQB 1GOBA 4M3RA 3ULDA 1HARA 2B5JB 1JLBB 2KTQA 3H4BA 1DLOB 4ZPBA 4YR3A 4K4YA 4LY7A 3CFOA 4NCBA 2PZSA 1RT1A 4IFVA 1JLAB 2OYQA 1IKWB 4DFJA 1HNVA 3SUOA 1TV6A 4EO6A 3L2VA 3TANA 3RMAA 4OLAA 1U09A 3OYHA 3SV3A 4IBNA 4LH4A 4PQUA 5DG8A 4BDPA 1ZBLA 3V9SA 3NH1A 2W9CA 3OJSA 3OS1A 3EZ5A 1UWBA 4FLUA 4CE9A 4ZMMA 3DYAA 4TYAA 4I2PB 3MECB 5J2PA 3OYLA 4KHNA 1LWFB 3JYTA 3DOLA 3ZSXA 3NDKA 4KHWA 4MFBB 1HPZA 4FYDA 4IOBA 3GV8B 4MK9A 3K5NA 2UVRA 2WONB 2XY8A 3LPTA 3NF8A 3DM2A 3OYGA 3DOKB 3QETA 4CJQA 1K1SA 4ZP9A 4KO0B 4HUFA 3M9MB 1F21A 4HUEA 4DTUA 4DTXA 1GOCA 1REVA 2ITGA 3G6VA 2HNYB 3WNFA 3PW4A 3RRGA 1YTUA 3KNAA 4FW1A 2G8WA 3QIOA 4CGFA 5JS1A 1RT4B 4R5PB 2IM3A 5KFIA 1VRTB 5KG0A 3KLGB 1RAJA 5HRPA 2AGQA 4J9RA 4EBEA 4CECA 5J2QB 1Q9XA 1SUQB 3HL8A 4ED7A 2FLLA 2AGPA 1YVFA 4FJXA 1RBTA 4ECWA 4GMJB 2UVUA 4MIAA 5KFNA 2YNGB 4F4YA 1LW2A 3RTVA 5KG1A 2LSNA 3RRHA 4Q0BB 3G10A 4KHSA 2UUWA 1X9MA 3OS0A 1VRUB 4JRPA 3OYFA 1TQLA 3TAMB 5J2MB 4NLDA 3VN5A 4DU4A 3RMDA 1N56A 1QSSA 3OYBA 2WHOA 4L8RB 4FS2A 4J9LA 5FROA 4J9QA 4PWDA 1DTQB 5CZ1A 4IG0A 2WOMA 5JS2A 3CQ8A 1A5WA 1KLMB 2BGGA 3AO4A 3QZ8A 3RMBA 3RB6A 1RT3B 1N4LA 4ED1A 1JLFA 4FW2A 3JYTB 5J2NA 5KT3A 4FJKA 4IRCA 1C0UA 5KT4A 3BQ2A 3CWJA 3SI6A 3PZPA 4LQ3A 4ZVGA 4CGDA 2HHVA 1RA6A 2OPSA 3IS9B 4W5RA 4FJMA 4ECTA 1S1WB 1SL0A 4DL3A 3AA3A 4RW7A 3PX0A 1QHTA 3QEIA 4KB0A 3CIZA 3ZSQA 3CG7A 1S10A 4N76A 5KTQA 2XY5A 5K14A 3QEVA 1JXEA 3WNEA 2XO7A 3L2RA 5KFFA 2O5DA 1ITGA 1X9WA 2NUBA 5KFQA 3HHKA 2P5OA 2IM0A 3MEEB 1SV5B 3RB4A 2OPQB 4NZ0A 3M8PA 2QV6A 3EYZA 3PVXA 4KKOA 4B9MA 3CJ0A 1TL3A 4CHQA 3PJXA 4BE1A 3CM6A 4BWMA 4KRFA 2HWHA 4O4GB 2JEIA 2HHWA 1S1VA 3L2WA 2BDPA 3C94A 1WSGA 3BSCA 5KFJA 2V9WA 4HCCA 1JKHA 1RA7A 4GVMA 4K50A 2D3ZA 4F4XA 2E6MA 3H98A 1R0AB 3HP9A 1S6QA 3PUFA 3T5HA 4CJKA 3DDKA 5KRTA 2B43A 1HYZA 4TY9A 2R8KA 1QQCA 4EZ6A 3FDSA 2YNHA 4RW9A 1YVUA 3NF7A 4DS4A 3T19A 2FVPA 3PX4A 3H2LA 4HVJA 2ILYA 4HUGA 4J2AA 4CEDA 3NGZA 3DMJB 4FLZA 4HKQA 2RDIA 4QWAA 4ZTFA 3LAMA 5KI6A 4CF1A 4RUAA 2YV0X 3I0SA 1FKOB 3ISND 3NAEA 2KZZA 1KTQA 2HMIA 4F3TA 3OL7A 4CGHA 4J2EA 3OSPA 4J9KA 4R0EA 1NOZA 3OYNA 4DU3A 2R7YA 2R2SA 4Q8FA 4Z4HA 4OGCA 1D0EA 4RZRA 2GC8A 3GIIA 5DMRA 3Q8SB 4BACA 4K4TA 3MEGB 4CIGA 3IRXB 3M8QA 4K4ZA 3UIQA 5EUHA 3ASMA 3LWMA 4O44B 4FLWA 3TQ1A 4YMEA 3D0PA 2F8SA 3TR8A 2BR0A 2HNDA 3AA5X 4WZQA 3NMAA 4BWJA 1TL1B 3E01A 5KFBA 5J1EA 3UQSA 3Q8PB 2KW4A 1JIHA 3O3FA 4KHMA 1QTMA 5KT5A 1FK9A 3ZSZA 3JSMB 2IAJB 4J9MA 3FRZA 2BQUA 1ZBHA 4DEZA 3DRPA 4OKKA 5KFVA 3SQ0A 3C6TA 4URGA 4DFKA 5FDLB 4DTRA 1C6VA 3NF6A 4DL2A 2UVVA 3BGRB 1RT2A 4CFDA 2BE2A 4K4VA 5KFRA 1IH7A 2WCXA 5KFGA 4DMNA 2EC0A 4ECXA 3HPOA 1J54A 3LP2A 3S3MA 3NHGA 4RNHA 1W9HA 4B9VA 4NRTA 1NKEA 4IH6A 2R2RA 5HLFB 2DPIA 1D9FA 3CDEA 4Q8EA 1CZ9A 1S5JA 1Y97A 3MR3A 2CJQA 4B3OB 2V0NA 2YNIA 5KFMA 1WSHA 1S97A 1C2PA 3ZT4A 1C0MA 2FBYA 4KAIA 4M3ZA 1JLGA 1B9DA 3PO5A 3QNNA 2R8IA 4KHYA 3DLEB 2Y1IA 4J9NA 3ISNC 2VA3A 2J6TA 3VQQA 3F73A 2VG6A 3T1AA 1RT7A 5HBMB 3OYEA 4DFPA 4K8XA 4CFCA 4EEYA 3MR6A 3NH2A 4DSEA 2ILZA 3OYMA 1TKTA 1T03B 3AVFA 1YTAA 3LP1B 4Z4FA 2VG7B 1CXQA 1Z26A 4URSA 1RT5A 1JXLA 1HYSB 2JC1A 3PR5B 1S9GB 3OYJA 4M3TA 1HQUB 1S1UB 2XY6A 4CJFA 2V4RA 3SPZA 1RBVA 1T05A 3LP0B 1RTDA 2OPPB 4OLBA 3SPYA 4ECRA 3KLFB 4AHSA 2IC3A 2OZSA 4WFYA 1T7PA 3V9XA 3G6XA 1RTJB 5KFXA 3BR9A 1KFSA 5T14A 3T5KA 4CEEA 5KRSA 2PYLA 3CFPA 3N6MA 4ECZA 1XI1A 4G3IA 1JLQA 4DS5A 2J6UA 3CVKA 1QAIA 3I5CA 2B5JA 1U45A 1JLBA 4DSKA 3AA4A 1DLOA 4M45A 3SUPA 3ITHB 2G8HA 4TXSA 1RCHA 3V1QA 3HP6A 1JLAA 2G8IA 3AVCA 1IKWA 4CHZA 3GV7B 4W5TA 1DTTB 1RDRA 1ZTTA 2JEJA 4B8CA 4DLEA 2DFFA 4CF0A 4NLOA 1NNDA 3SJJA 4O3OA 4CFAA 1BI4B 3N6NA 3DLGB 2HHQA 4M3UA 3ZSVA 1TKZB 2IM2A 3NGIA 5C24B 4Q45A 4M3WA 1ZTWA 2BRKA 4U6PA 3TARA 3AVMA 1S1TB 4EP4A 1LW0B 2I5JB 4K4SA 3MECA 1LWEB 1LWFA 3K58A 3AVKA 4Z0UA 4DL7A 3PR4A 5KG5A 3PJWA 1S0OA 1UAXA 3D5MA 1TKDA 4MFBA 1BQMB 5F8LA 4KTZA 4ZPDA 4FBUA 4RW6B 4NLPA 4K4UA 2D0BA 3L2UA 3SUNA 2WONA 2BANB 3DOKA 2HVHA 3KK3B 4EZ9A 4KO0A 5C42B 4CHPA 4O3NA 2BRLA 2JEFA 1W25A 4LSNB 2HNYA 1S9FA 3QLHB 2RN2A 3LAKA 1RT4A 4QAGA 4R5PA 1VRTA 3KLGA 4CEQA 4U7CA 1NK6A 5J2QA 4FLVA 4B9SA 3L3UA 4OVLA 1SUQA 3MR2A 5KT2A 2F8EX 1WAFA 3TAFA 4DSJA 4MK8A 4WXOA 1BCMA 1KCFA 2YNGA 4FJNA 4RNFA 4ZPAA 3CJ5A 2HHUA 4Q0BA 1S0NA 1VRUA 1NHUA 2XI3A 3TAMA 1TAQA 5J2MA 3NKYA 2KFNA 3QEWA 1ZBFA 2PY5A 2QKKA 4OKJA 5L9XA 4MQ3A 1DTQA 4IG3B 4YR2A 1EP4B 3VQ6A 3SZ2A 1KLMA 5I3UB 2FBXA 4QPXA 4KFBB 2VG5B 2V4QA 2Z1IA 3FSIA 1RT3A 4UQGA 4CCHA 4FJHA 2IBKA 4BE0A 2FJWA 5EU7A 4CFBA 1L3UA 3C6UB 4H4MB 4DL4A 3ICLA 1U04A 4ED8A 1OS5A 4WE1B 1B9FA 4XPEA 4JUZA 5KGXA 3SQ4A 1NK4A 2C28A 2D7SA 3IS9A 3S3OA 3PW2A 1NHVA 1S1WA 3HVRA 2YKNA 2A1RA 4CF2A 1C1AA 4ICLB 1GX6A 1QSLA 4F4KA 1RYRA 3BQ1A 3WNHA 2B4JA 1IO2A 4Y1DA 4ELTA 2HHSA 5E41A 4DQSA 4FXDA 4CJWA 2IMWP 4HCBA 3OYIA 4CF9A 5F8JA 4FJ7A 4GC7A 3HK2A 4CJSA 1J5OB 5EDWA 4CJTA 3MEEA 1SV5A 4NYFA 2OPQA 4CK3A 4PA1A 5DLGA 3KHLA 3NGDA 4ZHRB 3F9KA 1BHLA 2D0CA 2XCAA 1ZETA 4O4GA 5DG9A 3TAPA 4F3OA 3I5AA 3VQ8A 5HP1B 4AILC 2VWKA 2WTFA 5D3GB 4O55A 5F8GA 5KFPA 1R0AA 4AHCA 4N41A 3HJFA 3BQ0A 4ZP6A 5HROB 4Y2AA 2FBVA 4EO8A 4NCAA 2YNFB 2KZMA 3OSNA 3DMJA 4ED6A 1U48A 4DSFA 3DLRA 1RT6B 4CGJA 5I42B 3WNGA 2G8UA 2GV9A 3DRSA 1FKOA 4URQU 1QAJA 3EZUA 2DTUA 3A2FA 4TYBA 1HRHA 3U3YA 3V9ZA 1UOCA 4ZVEA 3AVJA 4IRKA 2FVRA 4DTPA 3P1GA 4R8UB 2YKNB 3CJ2A 3CJ3A 1U4BA 1EX4A 4NLSA 1T8EA 3MEGA 2W9BB 2G8VA 3OL6A 4C8NA 1S9EB 3IRXA 5KFCA 2YHAA 3KLEB 4MIBA 4CJLA 4IDKB 3P5JA 1KSPA 1BGXT 1TVRB 4O44A 4RW8B 2WB4A 2FVCA 4ID1A 2R2TA 4TQRA 1FXXA 1TL1A 3KKSA 4XIUA 1N5YB 3UDLA 1K6YA 2ZE2B 5KFUA 3HVTA 3JSMA 4NYNA 4YFUA 2F96A 4O3SA 2IAJA 4KHQA 3TVKA 2ZD1B 4B9TA 4KI6A 3UR0A 1S1XB 3SYZA 3KK2B 3DI6B 2D41A 2XI2A 1WAJA 2ASLA 4IR9A 1I3AA 4B9NA 1KVCA 1EXQA 4CEAA 1RDAA 4Z4EA 5FDLA 4CEOA 4I2QB 3BGRA 4CJ4A 3OS2A 1RTHB 4FJ9A 3B6OA 4DWIA 4KI4A 4Z4IA 4DL6A 1A5XA 4CEBA 3HPHA 2B6AB 5HLFA 4M3XA 2Z1JA 4WYLA 5DQHA 3PW0A 3B6PA 3MEDB 2ZKUA 4B3OA 3DRSB 5CYMB 3O3HA 4I9QA 3V9WA 5KG7A 3OVNA 3LZJA 4DL5A 3M8SA 4PUOA 3KTQA 2ATQA 4FZYA 2IGIA 1TAUA 3DLEA 4ED0A 2IA6A 4CERA 3ZCMA 3OHAA 4E7LA 3KJVB 3DLKB 1KHVA 1D5AA 1D8YA 1X1PA 4W5QA 4WFZA 4ZVHA 3KMSA 5HBMA 1S49A 1ASWA 4JV0A 5KG4A 4XPCA 4H54A 4G1QB 4ED2A 2A1SA 1I6JA 5L1JA 4TLRA 4JRQA 3V1RA 4ZTJA 3HT3A 5DLFA 1C1BB 1JLCB 2W8KA 2FLNA 1MMLA 4E7HA 4FVMA 1T03A 5KG6A 3LP1A 3TI0A 3AVHA 4RNOA 1KRPA 2VG7A 3H08A 4XO0A 5F8HA 3OJUA 3SCXA 1HYSA 3HVTB 4Y2CA 3IG1B 1S9GA 1XR6A 1HQUA 4FK4A 4BDZA 3K5LA 4E7IA 4KREA 1S1UA 1KVBA 1RBRA 4CK2A 1RDBA 5SWMA 4NLUA 3LP0A 1CLQA 4E89A 4ECQA 1FKPB 2OPPA 2FBTA 3DLBA 1IKXB 4CIFA 3KLFA 4WFXA 4JV1A 1GX5A 5JXSA 3NFAA 1IKYB 4E7KA 1IKVB 4OPJA 2I1RA 1RTJA 1SH2A 1L5UA 3AO2A 2P5GA 2C2RA 4FM0A 2JLEA 4HYKA 2DY4A 2HHXA 3IGNA 4K4WA 5C25B 1QSYA 3UPFA 4IRDA 4JLHA 3HVWA 4Q43A 1TKXB 3K57A 1BIUA 5F9NA 3QERA 3ZT1A 4NLXA 1KVAA 2WK4A 4QWEA 3LP3A 3ITHA 4Z4GA 3NE6A 2EX3A 4OJRA 4DFMA 2ASJA 3V81B 1DTTA 3PY8A 3MTKA 4PUOB 3RAQA 1VSMA 3LANA 4DF4A 1RBUA 1BI4A 2OA8A 3DLGA 1KFDA 4NCGB 1TKZA 2E6LA 1BIZA 5C24A 4E7JA 2AX0A 4NRUA 2IDOA 2HNZB 4ECSA 1S1TA 2YKMA 2Z1HA 2O4IA 4KB1A 1HMVB 1RBSA 1LW0A 2I5JA 3ALYA 2CKWA 5KFDA 2GUIA 1LWEA 3I0RB 4CJ5A 3QEPA 3V4IB 4CJVA 3RB3A 4HTUA 3PO4A 3IAYA 3QZ7A 4KBIA 3RB0A 4B8AB 4O0IA 1BQMA 4ID5A 3MFHA 3VQBA 4RW6A 4EYHB 3CO9A 2BANA 1JLEB 1VSIA 1VSEA 4FS1A 3KK3A 3AV9A 4FZZA 5C42A 1BCOA 3GQCA 1U49A 4QW8A 1XHXA 4LSNA 4KSEB 3QIPB 2AJQA 3QLHA 3CJ4A 4DSIA 4F4WA 1N6QB 4H4OB 4OL8A 1QE1B 1JL1A 3ZSRA 3LPUA 3KK1B 4NLQA 3HYFA 4F50A 4ZVFA 4C8KA 5KFLA 4B9LA 4FK2A 5EWEA 1NJYA 3AVBA 3PV8A 4EP5A 2C2EA 5F8NA 3NCIA 2R8GA 4DU1A 2ALZA 3EPIA 4QWBA 4ELVA 1HNIB 4DF8A 4N56A 4KHRA 1HJRA 2R8JA 3MXMA 4QWDA 1BQNB 3O3GA 3ZT0A 3OYAA 4RW4B 2DFHA 4JV2A 3HO1A 4WYWA 2ZQBA 2VWJA 4DQIA 3MF5A 4IG3A 3KOAA 1EP4A 2KFZA 5I3UA 4W5OA 1MU2B 4KFBA 3MFIA 5KFWA 2VG5A 3KD5E 4I7FB 1WSEA 4TN2A 2E9ZA 2YKMB 1TP7A 4E1MA 2D5RA 1YT3A 1C0TB 5DGAA 3C6UA 4H4MA 4ELUA 3RR7A 4ZPCA 3AA2A 4LSLB 2AX1A 4WE1A 2XRIA 5KFEA 5T7BA 1RNHA 2C2DA 4ID5B 1NKCA 3U3GA 3OYDA 1QUVA 2KQ2A 1S0MA 4GW6A 4Y3CA 3KLIB 2QK9A 5L1KA 1WN7A 4ICLA 3M8RA 3VQ7A 3PHEA 1ZBIA 4E19A 2AWZA 1B92A 3AVAA 4AHUA 2DFEA 3V9UA 4Z4CA 3RWUA 1WNSA 2GBZA 1XWLA 4ZP7A 4CEZA 3TAGA 1J5OA
chains in the Genus database with same CATH superfamily
3EWGA 4A5BA 1YBTA 2D1KA 4HACA 3NBPB 4ZHRA 1RTIB 4V1Ak 4FYWB 1U0HA 3VQ4A 1U2FA 4IFYB 1Z4UA 4NLWA 3M9NB 4X64K 5D15A 3D1QA 3RMCA 3KLHA 4CHOA 3H7HB 4WU3A 2X7IA 3OHRA 4N77A 3OTOK 3PIPQ 3GWCA 4LD0A 2H5EA 4KYZA 2CH6A 3GPAA 4TY8B 1S4FA 3J7AP 4LR9A 3LOUA 2QMWA 4V19S 1CXUA 1SI9A 3G6YA 3QAEA 2GO8A 2N4CA 4OX8A 2XSJA 4Z7CA 4PQAA 1SS6A 2ZH4A 3GJQB 1YBAA 3ZEUB 1JMTA 3ULEB 2UXBK 4OYWA 4DV1K 2RQCA 3CW2C 4OJ3A 1RDCA 3A1YG 2LXFA 4PRFA 4O0JA 2BV3A 3RSEA 3O4NA 4F4ZA 4I1TA 2W24A 4JI6J 4C8LA 1IBKK 1S9EA 1QVGM 3R5JB 3T9NA 3H8YA 1RKJA 4X4TA 2J0SD 3ILLA 3MHYA 1HI8A 1QDUB 1LAVA 4DR6J 1HR0K 4F02A 3FFIB 4N47A 1M90T 2GEMA 5A8KB 3DGPA 1N5YA 5T7LB 1T9YA 2W7AA 3WXJA 4U7UD 2GGPA 4ZP8A 4M42A 4YORA 1OWXA 2FZGB 1CBKA 4QWCA 4QS9A 3HLUA 3G82B 1R8PA 2DPJA 3EO3A 3CCMS 3IGVA 2WBRA 4FM1A 1C1CB 1XNQJ 3KLHB 1H2VZ 1CJVA 5FLXO 3M30B 2NLWA 1VSLA 2HFUA 2IS3A 1RTHA 2HQGA 1IJFB 3M05A 1QQNA 4O0NA 5GADP 3GU0A 2UUCK 5BYQA 2QKBA 3LDOA 4KB7A 3U02A 4DUYK 1XTZA 2W2PP 4IH7A 2Y1LB 2JEGA 3ILOA 1UA1A 1HNVB 5BRHA 1TV6B 3BH7B 2QLWA 2FC0A 3OW2M 2P1JA 5CYMA 3W8PA 4PQUB 3NGKA 3ZX0A 4KIAA 1P8GA 4CESA 4A62A 2ZGZA 3SQ2A 2MQPA 1P1LA 3EXCX 1GTEA 3WIUA 4ILHA 1UPMB 1EQYA 5DM6Q 1TGOA 3KJVA 1FWKA 3DLKA 4PPDA 4BG9A 3ET6B 2F8TA 1F9EB 1RILA 2ASDA 2HRUA 2FHOB 2FZKB 2CPXA 4BRNA 4CJ3A 2DITA 3PIPL 3CMAS 1UVLA 5HVHA 1MMDA 5DQIA 2ZWPA 3GOIA 3I8BA 3DOMB 1C4AA 3JXOA 4RPFA 5HRSA 3BPDA 2F7TA 3MAQA 4Q44A 4IH5A 4W5NA 1BD6A 5AQWA 4P7VA 3JS9A 4RUBA 3J7YU 3HMJG 1IKYA 3VQDA 1IKVA 3OYKA 1JK9B 4FNHA 4PG8A 2NLXA 2E1CA 2HRTA 4D3GA 1FRIA 4B17A 1LW2B 2QI2A 4KGVB 5A2QU 2ZOFA 2KHOA 2IVOA 4JI6F 1TKXA 1B3TA 3PW7A 4JI1J 4H5WA 3E9OA 4WTOB 4NLRA 1U6ZA 2Y9HA 2V5HG 4RX6A 3BH6B 3OXGA 3HKWA 5IT4A 1NK0A 3R9PA 2ATLA 1UPPA 3NAHA 3G8TA 1UFLA 3GV5B 4DR6F 1R59O 2WOMB 1R8BA 3T1HF 2HZCA 4X66K 4K8RA 1FJCA 4BRKA 1Z25A 2AQ4A 1XN9A 4FJLA 4NCGA 1JLFB 3BPSP 2O8EB 2QWNA 3QMLA 3CMQA 5J2NB 5AQSA 5D6GA 2KO1A 4F7VA 2C2NA 3LA0A 4NYPA 2RT3A 2VJUA 2CQ2A 1AFIA 4KE5A 4CIEA 1XNQF 1NKBA 3N28A 2I9SA 4X65K 3K59A 1IBLJ 2CPZA 2DCLA 3IMQJ 2DPNA 3SAHA 5ETKA 2ASYA 4DV5J 1HNXK 2HVDA 4LQ9A 4CLSA 1ZZNA 2CJKA 2EHGA 5K14B 3GP9A 4GMKA 2MB0B 4MK7A 4CYUB 1VI7A 2OZMA 3CJ8A 2FLPA 2LDIA 3OHBA 2Y1JA 4CH1A 2DGUA 3QIPA 3SI8A 3IN5A 3CCTA 1SL2A 4ANCA 3JTPA 3CJ9A 4NXNF 2GMJA 2LU2A 5DM6L 3J81O 1S1VB 4C3MA 4QOZB 2NSBA 1VQ9S 2P51A 4CNYA 3BSNA 1JKHB 4CLKA 1B0VA 4ECVA 3BKFA 4EYIB 3HZ6A 5MLCQ 3KHRA 3RBEA 4RNMA 1G6BA 2P9KA 4M95A 1XC9A 3FZKA 3TQEA 4JI0K 2GS8A 1AT1B 1E4GT 4UUXA 1HNIA 3SQOP 4L75A 1X4EA 1Q95G 2Y8WA 4IO9Q 3S8SA 4M5DB 4O3PA 1BQNA 2F63A 2G1HA 3MPVA 4WYBA 4CEFA 3FVYA 4JI8F 2HW3A 4DQPA 1SIZA 4CM0A 2J6SA 1QD1A 2AJ0A 4C0BA 2BJDA 4I7FA 4DQ8A 2BW7A 4JKFA 2FJXA 1DQ8A 2DGVA 3TOQA 4CGGA 3QT6A 1TK0A 1BA1A 1TK5A 1S6OA 4J7CA 3DU5A 2QXFA 1X4BA 1WC3A 2NSCA 1Q86O 4RR5A 1I39A 1RK8A 4JI1F 5IT9O 3TABA 2YWKA 5AQNA 1H2TZ 2YBVA 4FDFA 3C3LA 3W9HA 1RAHB 5J1EB 2FIUA 2YWEA 3A0IX 4BR7A 3NVMA 3L9ZA 2C22A 2VA2A 5HK4A 1G4CA 3LDSA 2ETJA 4C8OA 3HFZB 4R0JA 5M2PA 2JFDA 1NGFA 1BL3A 4A2AA 3P5BP 3DLHA 3UVJA 2RQ4A 3K17A 2I38A 2GZOA 3LPEA 3R5GA 1BOTO 3I55S 2BE2B 5CYQA 1R31A 2D0OA 5IC4B 2UXDJ 4KH0B 1JX4A 4RNNA 1G15A 4HHTA 2E9TA 3VALA 4DV5F 3MPYA 2PC6A 5EWFA 4ECUA 2R7XA 1UVMA 3V6DA 3QJJA 4WFBQ 2UXCK 3W3DA 3VQCA 3VQ9A 3HHLD 5AZJA 4FVCA 3VR1A 1RADB 3GDQA 5E0OA 5A8WA 2EW9A 5AE3A 3OFGA 1UMJA 4C1NK 1J5EF 1M1KT 2PYJA 2RKIA 1K1QA 8AT1B 1HYVA 3QO9A 5HOOA 2CZVC 2XGQA 5E3QA 3T6JA 1WJ9A 1RISA 2E1YA 1KC8O 3H90A 4IO9L 3R6LB 4USTA 1DQAA 5CZ2A 4OYZA 4M63A 4FK0A 4CT9A 2ZJPL 4OJGA 1Y3JA 2CFXA 1NG9A 1JXVA 3L7OA 3EICA 1Y11A 5IWAK 2VL1A 1YK9A 1VSKA 3W66A 1RTDB 1YVNA 3FCWA 3CCUN 3R97A 3M2UB 5AQPA 2UUTA 2E2QA 1JNZB 3G0ZA 2XHBA 4JS5A 3ZSYA 2EWHA 1VQSA 3J7YP 1EETA 4AQYK 1N48A 3QGHA 1JLQB 1GOBA 4M3RA 3ULDA 1DLOB 3CFOA 3AHPA 4A8KA 2PZSA 3MUMP 3AA9A 3C0BA 2ZHBA 4K0KK 3SUOA 4EO6A 3RMAA 3OYHA 3D9BA 4LH4A 2VQEJ 2HSTA 3OPKA 3C6HA 4NASA 3L4QA 5E7OB 3OS1A 1GEHA 9RUBA 4WWSA 4JI5J 2RRAA 1UWBA 5HMXA 2V94A 3AD9C 5BPLA 1VDHA 5J2PA 3HHLC 2Q0RA 5D4NA 3BDEA 2BM1A 2QG9B 4MFBB 3ID6A 2HF3A 5GIOA 1GK8A 3CQYA 2UXDF 3C16A 4HTLA 4J8FA 2WONB 3VEOA 3DM2A 3KDOA 1VQNS 3EL2A 2J0WA 3ZC4A 1F21A 1REVA 2ITGA 4DR5K 4JI4K 3G6VA 5IV4A 3WNFA 4WFBL 2VHGA 2UUBJ 3QIOA 2Y8YA 4YB7A 2IM3A 3KNGA 1VRTB 3DRXA 5HRPA 5ETRA 4EBEA 3W9JA 3U4LA 1SUQB 2AGPA 1YVFA 4FJXA 4AXJA 5KFNA 2CIMA 2YNGB 4GKJK 1F5AA 1YQHA 3JQJA 4NLCA 1Y10A 2IYGA 5KG1A 2CPDA 1S99A 5GAHI 2LDYA 1KAXA 3R1LA 4XH4A 1HNZJ 3OYFA 3TAMB 5J2MB 4NLDA 2EWSA 4MO4A 3QT8A 5M1NA 1N56A 2MGZA 1QSSA 2WHOA 3EE9A 1F5CA 5FROA 5KPTA 1N36K 1DTQB 4IG0A 3VVUA 5JS2A 1T9XA 1A5WA 3CQ8A 3AO4A 3K7RA 2PEHA 2QEXN 2KH9A 2CQHA 3AQPA 3MWBA 1RT3B 2ZH7A 3OR2A 1YLXA 2Q0UA 5KT3A 5KT4A 5EX3A 3D0GE 4NOHA 3SI6A 4LF8J 4R79A 3TW0A 2HHVA 2GX9A 2OPSA 2E88A 4WK3A 2GHPA 3NG8A 2CJXB 2VFVA 1HBNA 2OFHX 4OYXA 1HBMB 5HAOA 3QEIA 4KB0A 1QUPA 3CIZA 3H20A 2XY5A 1Y7PA 1U7LA 3L2RA 1ITGA 4UZCA 1X9WA 5JJBA 1SJFA 1H6KX 3CCJS 2P5OA 4LIWA 3MEEB 1AROP 1VQOS 2OPQB 3RGIA 3MOJB 2LKZA 2QV6A 2LQBA 2VQEF 5H9EK 1F3VA 2QL7B 3PVXA 2M2BA 1TL3A 3PJXA 3HHEA 4JI5F 3BSCA 4BQZA 3AODA 4K50A 4ETXA 2E6MA 3HP9A 1R0AB 4AL7A 3DDKA 2B43A 1HYZA 4TY9A 2R8KA 1FNXH 2HF4A 3LM2A 1Y4ZB 2B3TB 2RSQA 3NF7A 3TUJC 5DZ6A 4CEDA 3O8MA 2ZC3A 4DR4K 2ABYA 1DHMA 3W2VA 4C48A 5E84A 5EOYA 4RUAA 2YV0X 1FKOB 3ISND 2D3OR 1KTQA 2UUBF 4O8UA 2C3PA 2HMIA 2HYIB 4ZLLA 5C10A 3OSPA 2CQIA 3THYA 4NZ7A 1MWKA 2DGSA 2MHEA 3WXKA 4DV2J 2HQ3A 8ATCB 5DMRA 3Q8SB 1N5SA 1VQMS 4X4UA 4BACA 2L48A 4K4TA 2HQIA 3WEEA 4DPUA 4K4ZA 1FJGF 3T6BA 3F56A 1BWVA 3CJCA 3UIQA 4DR3K 4QJVA 3TUIC 5E33A 3LWMA 4ATNA 1HNZF 3TQ1A 4YMEA 3TO8A 3TR8A 2DRDA 4L3NA 3BF3A 3I96A 3VPZA 2CDRB 1GMWD 4FNIA 5KFBA 3UQSA 1Y5LB 2A18A 5CAAA 2BQUA 4CW7B 2OFGX 1X5SA 5KFVA 4FVUA 3SQ0A 2H4YB 4ZVTB 2JWKA 3CDBA 3R3TA 2K2PA 3CCES 4URGA 1NGDA 3THXA 3R1HA 2DO0A 2AYEA 1GLDG 1C6VA 4BR5A 1TMMA 5LMNK 4LF8F 5KFRA 1IH7A 2DHSA 2WCXA 1N5VA 1NZAA 1W9HA 1NKEA 1D9FA 2HIQA 1CZ9A 1R43A 2O8BB 4MKVA 2YNIA 3UDEA 4KH1B 4LF7K 3H1QA 1B9DA 3GR0A 3THYB 5HMWA 3DLEB 5AXLA 2QA4G 3N9UC 4Z7YA 3ZETB 3ISNC 1TELA 2DY9A 4ZJLA 4RU2A 2RH3A 3VQQA 5AFUA 3MUTP 3F73A 4JI3J 3MD1A 4C2MA 3T1AA 4IDHA 3OYEA 4WJBA 4CVNE 1NGIA 3KVGA 4EEYA 2MQLA 2DGOA 2MZRA 4BRAA 4EHUA 3LP1B 1Q7LB 4FYVB 1RT5A 1VJQA 1HYSB 2G0CA 3W2WB 3HHDA 3OYJA 1E6YA 4M3TA 2ZH5A 4OI1A 2Y0BB 2CWKA 2B7CB 2IBOA 2DB1A 3TVYA 2V4RA 3ENQA 4BQLA 3MTJA 4ECRA 4AHSA 1X4AA 5K5MA 4D3HA 1T7PA 4FYXB 2G2ZA 5A2QO 3DXKA 3UNYA 3DGVA 1NJIT 1AB8A 5KRSA 3KUGA 1VGYA 2ZBRA 2J6UA 3CVKA 4OYMA 3FEZA 1VHXA 1UKUA 2LQ8A 4JI2K 1QQOA 4PG5A 4OIXA 5JVGQ 1Q81T 3ITHB 4UF4A 3ADAC 4CO3A 4TXSA 1RCHA 3V1QA 4FP9A 4J37A 2G8IA 3AVCA 4CHZA 4W5TA 1RDRA 4CP5A 1ZTTA 1CJTA 4C8YA 1U1RA 3V4MA 2R9LA 1WI8A 3N6NA 4LRCA 1JB0C 2HWTA 1NGHA 4N8OA 4DV0J 1VQYA 3AOAA 3EM1A 2GVDA 1T9TA 2I5JB 3MECA 1LWEB 3K58A 2RUSA 2P2CB 3ENAA 3AVKA 4NA3A 1TL7B 1S22A 1U2RA 4QQBA 2KKZA 2VPXB 1LXJA 2BH1A 1CULA 2XZTB 5JVHQ 1WKJA 3DOKA 4WKYA 1U2VB 1ZH5A 1N54B 2IVPA 3FJ2A 3I56S 3KWIA 4DDFA 5C42B 2HNYA 3LAKA 1YZ7A 1VQPN 3DLLQ 4R5PA 1MW7A 1NK6A 4FLVA 3L3UA 4OVLA 3T1YF 4TU9A 3HI9A 3I4HX 1SQGA 4JI3F 4RNFA 2LQJA 1IJJA 2ZJRL 2LXUA 3PXGa 1F2GA 3VF6A 2EK1A 2V6AA 2BKPA 2VKRA 3QEWA 1AUDA 1H3DA 4OKJA 5L9XA 4KH4A 3DN9A 1RAIB 4IG3B 3SZ2A 5EGYA 5I3UB 3VGVA 4A8OA 4QPXA 4KFBB 4OYBA 3K9KA 4BVOA 2YTCA 3FSIA 3PCOB 1X8DA 4UQGA 4CCHA 3EX7B 3R1XA 4FJHA 2FJWA 1TUUA 1TR0A 4DL4A 3ICLA 2FTRA 1NWKA 3AJ1A 1G7CB 4ED8A 1A7GE 4J9UE 2GVZA 2HIYA 4PABA 4RWXA 1VQ8N 1NK4A 2W25A 1RAAB 3SQGA 2AJ4A 1M5HA 3PEHA 3ZNUA 4KC5A 3G4SN 2OTLS 3H25A 1MN7A 3SSRA 4CF2A 5JVGL 2H4WB 4ICLB 1NLKL 1GX6A 2XULA 5CYJA 3WNHA 2B4JA 1IO2A 4ELTA 4Y1DA 4DQSA 4CJWA 4M5HA 4BVPA 4CF9A 2NZCA 3W1YC 2AKWB 2MQNA 4CJTA 4U8YA 2B9YA 5D4PA 5DS7A 3CQXA 3L0QA 5DLGA 2FJBB 4B3SF 2V63A 2D0CA 4DV0F 3WDOA 2O3DA 5DG9A 3A8YA 2KVIA 3B54A 1YHQS 3AOBA 1YJ9N 4AILC 2VWKA 3NGTA 2ERRA 3TTFA 4O55A 1BE4A 4NA1A 5KFPA 3G6EN 1SKUB 3HD2A 3BYPA 4N41A 2CQ4A 2M9KA 1M90O 4GKKK 1RXOB 2CGKA 2K06A 1EO1A 5HROB 1QZ6A 3A3OB 3D1HA 3BM7A 1WTFA 4NCAA 2YNFB 3G25A 2KZMA 1M5SA 3DMJA 3OSNA 3DXMA 1RT6B 4CGJA 3VAGA 3DLLL 2W4DA 5LJWA 2G8UA 3CUNA 3A3PB 3H42A 1DJ0A 2DTUA 4TYBA 3QRQA 1KKHA 5FD1A 3U3YA 2EPIA 3AVJA 2HBQB 1CJUA 2FVRA 5CCLA 2KB2A 1ATNA 3MEGA 1T02A 3VENA 3FUYA 1IBMJ 3OL6A 4OZJA 4UTGA 3O9QA 3IO1A 1UWAA 2A0FB 3VAJA 3KLEB 4MIBA 4CJLA 4IDKB 3F2KA 1HD0A 3EJMA 3QBXA 1CEZA 2QTWA 1PSDA 4ZVRB 3FBBA 2VKZG 2W40A 4JV5J 1ZA1B 1FXXA 1EZZB 1W26A 4XIUA 3KKSA 1I3OB 2ZE2B 2IA0A 5KFUA 3E9PA 4EIAA 3O08A 3TVKA 2JLFA 4CH0S 1NGEA 4B9TA 3CNQP 1WAJA 1KVCA 1RDAA 4Z4EA 1WUAA 5M1QA 4JI7K 5GAHP 2OO4A 4A48A 3OS2A 4BCAA 2HHHK 1GMVA 4KI4A 1A5XA 3VAFA 1T44A 3PYEA 4LFCK 5DDPC 2B6AB 1YXQA 1ZBSA 4M3XA 2E1ZA 3CPEA 2M5YA 3CDAA 5B0GA 4PEOA 3W62A 2ZKUA 2W41A 3AD8C 4UUWA 2XG8A 2YWGA 4A2BA 2H65B 5CXTA 3OVNA 2ZOMA 1IR1A 3ENWA 2IGIA 5AJ3J 4ISEA 2V2VA 3SSQA 3S6EA 4CERA 4AXIA 2MQQA 4E7LA 5EXWA 4W5QA 3KMSA 4ZIWA 5HBMA 4JV0A 2DK2A 4IZ9A 4GV3A 4EMDA 2LQ9A 2Z30B 1EKSA 4ED2A 4LF9J 3NP5A 1I6JA 2G0JA 3V1RA 4ZTJA 2F9WA 1TL5A 5DLFA 3PIOL 3MM9B 1JLCB 2W8KA 4PG7A 2HQDA 1T03A 5A76A 5KG6A 3MCMA 2C1EB 3CD6N 1KRPA 1UJ4A 2VG7A 1FXRA 3H08A 4IFEA 5LM7E 3OJUA 1XR6A 3CC4N 3K5LA 2MDAA 1S1UA 1KVBA 1K8KA 1WKKA 1QAXA 2P9PB 2AIRB 4K5SA 2QL9B 5A8RB 2P8IA 1CLQA 3OFFA 2OPPA 2PT0A 2FBTA 4CIFA 4JV1A 2FSNA 3O5BA 3NFAA 4E7KA 1XC3A 1RTJA 1JCGA 1X0PA 2C2RA 4FM0A 1TFWA 3TZWA 4GO5X 1OVQA 3M2VA 1KDNA 2VBWA 1PJ5A 3AH6A 5ITHA 4K4WA 5C25B 1ZPVA 4B1YB 2RS2A 3K57A 3ZTPA 2QFIA 1P8ZA 3NOGA 5K8NA 4CQ1A 1IBMF 4NLXA 4YHHF 4DN9A 2YHWA 3LP3A 4QWEA 1GMUA 4LFBJ 2KVQE 4OJRA 2HBZB 3VEVA 2IYIA 4HI1A 4JV5F 2LEBA 3D6TB 3J7A1 5M2RA 3OFEA 3UE5A 4CNZA 3QFPA 1TKZA 1YJNS 2E6LA 3UE2A 5EX5A 5C24A 1KONA 4NI2B 3VWSA 3W5XA 2KXNB 4RTFD 2AX0A 3U1LA 1HMVB 2KXHA 4TU7A 4CJ5A 1AZSA 1NXIA 1YBUA 2VC0A 4USKA 2KKHA 2FSKA 2AZ3A 4BC2A 4YUDA 2RUGA 3CD0A 4O0IA 4ITSA 3L95X 1BQMA 1QY7A 4ID5A 3VAHA 3VQBA 4RW6A 4EYHB 4J90A 4AL6A 1EJ7L 4ALZA 4FS1A 4F3MA 1QAYA 2BZ2A 3GQCA 3R3LA 1XBWA 4QW8A 2ROEA 4FO0A 4LSNA 2AJQA 5ETVA 3NGRA 2KLAA 1FWPA 1FFGB 4H5NA 1JL1A 5AJ3F 3QWUA 1FKAF 1R8HA 2YX7A 4CLZA 4QIEA 3TTCA 4C8KA 3UNGC 4X64J 2L41A 1Y3KA 1F0XA 3L7PA 1DEJA 3CO0P 2C2EA 4LF9F 3EPIA 4QWBA 2JOQA 2DBBA 2YX4A 4KHRA 1HJRA 1Q0NA 4OX9K 2HLUA 4RW4B 1LWXA 4JV2A 4NMLA 3TUZC 1FXDA 2LYVA 5LJVA 1KQKA 3G8SA 3OR1B 5KFWA 5IOLA 5J1PA 1WSEA 4JK7A 1FX4A 4A5AA 2F8MA 1TP7A 4KRWA 3T7ZA 4Y6IA 1C0TB 3VEYA 5DGAA 1AZSB 4KPCA 2DCUB 4LSLB 2AX1A 2J76E 3UD3P 5GAEP 4WE1A 2XS7A 4QOTA 3NGSA 1MWQA 4I6WA 4ID5B 4DV7K 2M52A 3U3GA 4MT1A 4Z94A 3OYDA 1QUVA 3I9ZA 1IBKJ 5JLFA 1M5OC 1I5OB 2QK9A 5L1KA 2CQBA 2MQ8A 4ANDA 1UJ6A 2KG1A 1DT9A 2E2PA 3VQ7A 4E19A 1X7VA 3THPA 5BXIA 3Q8YA 4AHUA 2DFEA 4LFBF 1V5IB 2RJZA 2MSTA 3FNNA 1XWLA 4CEZA 3POTB 3TAGA 1J5OA 1M1KO 3CTRA 5F8MA 3LL3A 1QVFR 1WSIA 1Q8KA 1NO8A 3VAMA 1A0OB 1UFKA 4DUZK 2RE1A 4DCJB 4CF8A 5D3GA 4YQWA 3GZ7A 2P9LA 2RHKA 4MTPA 4BR0A 2ZF5O 1RLCL 1KQFB 2Z2ZA 1VQ6N 1AFJA 1WEYA 3HDSA 1TUGB 2J5AA 3VA0A 2COLA 3NMUA 3HXMA 1XR7A 3DRRB 2OPRB 3T5JA 2HBLA 1F60B 3J7ZO 2D74B 3AVGA 5I42A 2DIUA 4JEPA 3TWHA 1AXQA 2LQ5A 4QCLA 1GLCG 4DCHA 2LA6A 1JNRB 3ETMA 1E4FT 2MEWA 4FLXA 2JVOA 5HVGA 2GMLA 2OH2A 1LAWA 4R8UA 4X64F 1FF2A 1VLOA 5HQ8A 5AQIA 2W9BA 1RWUA 4MLHA 1UZDA 1QS4A 1PC4A 3AXKA 2N3OA 3HX9A 4MO5A 5HRRA 1JXBA 1S6PB 3BYRA 4EK2A 4CZKA 1PKUA 4LF6K 1LOTB 4KV8B 1CSJA 4I64A 3AO5A 4QYZK 3BGUA 1U02A 1YI2N 5DGBA 1FT8A 1S1XA 3KK2A 5EY4A 1WI6A 3DI6A 2UXBF 2ROGA 4Z2XA 3JAMO 4DV1F 3VTHA 3Q83A 3FKBA 2YXLA 1D4XA 4DR1K 4DPYA 1J53A 4L6V3 2XS5A 2X74A 3OL9A 4I2QA 3ZT3A 1SIWB 3MM6B 3W5YA 4Q5VA 3BSOA 3K89A 1S7HA 2ZH6A 3CMEN 4H0PA 4MKYA 2HGMA 1RT1B 1IBKF 4KAZA 2BW2A 1RYSA 2W6LA 4WIIA 3P49B 3A3NB 3CXCM 3P83D 1REGX 4HHHA 2KM8C 2D9OA 4K41A 4FLTA 2NPFA 4MKAA 2IM1A 5THWA 5EVZA 3I6PA 1P6TA 1ELOA 3CJKA 5E5NA 5DM7L 1FDNA 1CLFA 2YHBA 3PFEA 4ZITA 3M6GA 1S79A 2K1RB 4FJJA 1WC6A 3DYAB 3DOLB 3CDWA 3MMJA 1V3ZA 4FOEA 3GG0A 3L2QA 3G9CA 2XLKA 1HPZB 2IVNA 2GJIA 4X65J 1Q4RA 2AT1B 4G1QA 5LJ5Y 3M8ZA 4HH1A 2G8KA 5KFSA 1HD1A 1WF1A 4DQRA 2V8GA 3CYMA 2C3OA 1DARA 3ZSWA 4USVA 2HBRB 3HF5A 1MWMA 3AVIA 4DV3K 4FJIA 3IG1A 2NXCA 1KD1O 3T3FA 4CO0A 1VR6A 3GE1A 3NH0A 1NJZA 3ZSOA 3PKMA 4JKAA 3IBWA 4OI0A 3TSQA 1FKPA 4NLGA 4EGLA 5KFAA 1RAOA 3QDKA 3L8BA 2HBJA 1TTHB 2ZFHA 4BRHA 2HHTA 5DQGA 2ZJQQ 4CJPA 4O5BA 1UVJA 3CM5A 3SUQA 3NCQA 2D3UA 4ZVSB 2V51B 1NSQA 4USIA 3VESA 4WQ4A 1DGKN 3S1TA 3CJBA 4BRFA 2C3UA 3SFGA 1OPZA 4U8VA 2V7ZA 5F3TA 3W61A 3LM9A 2E9RX 2MKKA 3G71N 4OI4A 2YKOA 3RR8A 1C0GA 3NF9A 2ZVIA 2WVCA 3V81A 2VF3A 1ZPWX 4FJ8A 2B4OA 3OTCA 4ZLNA 3GIMA 1ZC6A 1S59A 3J7AN 3D2EB 1EB0A 2DJWA 2WW4A 2ZHOA 4Y1CA 1YF5L 3NAIA 2FVQA 3KG4A 2YPYA 4ZA1A 4BRLA 3VETA 2R42A 3E51A 1JWWA 3O80A 4YR0A 1KOOA 3RU0A 4J2DA 2HNZA 3MMBA 1VIOA 2RPIA 2ADBA 4CGIA 3GILA 2FPHX 2P5VA 4JB8B 1EX8A 4B3MJ 4RW7B 5AQOA 3NWGA 4N5SA 3THWA 2ZH3A 2QWLA 1Q82O 4C7QA 4JHDB 2X78A 4ES2A 3KJFB 4J9SA 1VSHA 2RMLA 3D4JA 3EPGA 1RE1B 2R7WA 3BN4A 3M1VB 1XEZA 3M8PB 3WT0A 4ID8A 4KKOB 1X4CA 2V9KA 4DTOA 3PKYA 3A12A 1N6QA 4RJVA 1W0HA 4FM2A 3U6FA 5KT7A 1WG5A 2HK3A 3KK1A 3B8AX 2VU5A 2CPFA 3VQTA 2P9SA 3NL0A 5KFKA 1T94A 5F9LA 3DKDA 4X65F 2OLWA 3O1WA 2YNHB 3VGMA 4RW9B 1VJWA 1WB9A 5LJ3Y 4ILRA 5KG3A 1OMSA 3CCSN 1GOAA 3NS7B 3VA3A 4HWIA 5AQMA 5LMUK 3C7NB 3K8WA 3MM5A 5KT6A 1KQSR 3I0SB 2W8LA 5KFOA 2HQCA 1BISA 1RWMB 1Q86T 3D45A 2JJ4D 3QGIA 3JTOA 4GVBB 5KFZA 4EI2A 4DUTA 1M5VC 1L3TA 4NPOA 5F2RA 4C8MA 3IBCB 4Y34A 3CGIA 4QR1A 4EBCA 2C2OB 2D0AA 2M8HA 4KR0B 3E66A 2HPUA 1HWKA 2XSFA 4FXVA 4RL1A 3KHGA 4H8KA 2O8FA 4C98A 1X60A 2VJVA 3WIVA 1NK7A 3B8HA 1S76D 3ZZTA 3I4PA 2E2NA 1FK9B 1FTRA 4O8KA 2BUPA 3UD4P 1VK8A 2OEMA 2Q43A 1LWCA 3AT1B 3V2UC 2UP1A 2RF2A 1IM6A 4X2BA 3BZKA 4YEAA 3CCVS 1TK8A 2OSQA 3U1NA 1RT2B 4JS4A 1T3NA 2Q1NA 3H5YA 5TKWA 1JJ4A 1Y9OA 4WQ5A 2XMKA 2QT7A 1FDBA 3HSDA 3J80Y 2E5HA 4J2BA 3HTVA 4GO7X 4QIFA 1WC5A 5AQFA 3D28A 3H46O 4FJ5A 4JOUA 1LEOA 3V6HA 1WHYA 1XK8A 4TLQA 1F3FA 4JKGB 3QESA 1NJIO 3FZ2A 2GIRA 1KC8T 3K2PA 2ZWOA 1IUJA 5HRNA 3CJ1A 3PM9A 1XR5A 3BBFA 2VG6B 5T41A 2BQRA 1RT7B 3JSYA 3S3NA 2F4VJ 4I2PA 2WW8A 2DD8S 3NNAA 4TSXA 3A8IA 2P9UB 5KFYA 4FJGA 2XY7A 3TAEA 1VSJA 4FPAA 5DK5A 3VZIA 3M9OB 3H3OB 4ILGB 4FWQA 3C14A 2YHXA 4CO2A 2K7JA 4JI4J 4P2SA 4WBFA 3O4QA 1BC6A 5F8IA 2OANA 1T05B 4KHPJ 2MKYA 2Z56B 2IC3B 3RAXA 2UXCF 3PJ9A 3C95A 4LF2A 4WXWA 3QINA 1MWYA 2ZC4A 3CFRA 1SJ4P 5CA5A 2OGUA 1NGJA 4B08A 4I9LA 2BQ3A 2QA4N 4GKJJ 1HBUA 2CJ9A 4FKXA 1HARA 2B5JB 1JLBB 1G1XA 1MROA 2KTQA 3H4BA 4ZPBA 4YR3A 5GAGU 4LY7A 4CLTA 1YIJN 4WTYA 4LBPA 4IFVA 4BRPA 3OQ2A 1AW0A 1WSRA 1JLAB 1H7XA 2I8EA 1OSCA 2P9NB 3W8GA 5IQ6A 4IXCA 3L2VA 5GADI 3TANA 4OLAA 2MZJA 2IIHA 1T6CA 4USJC 4M5GA 4CZCA 4JK9A 3P31A 2ASOA 2W9CA 5IWAF 4LF4K 2GW8A 2J7UA 5HSPA 2FJDB 4KBOA 4TYAA 3WXMB 4I2PB 1LWFB 3BS9A 3VERA 4M5KA 3QRRA 2BBEA 3NDKA 2ZBIA 3KUEA 3VAKA 4IOBA 4AQYF 2MYFA 2HOEA 3MMCB 2KT2A 4DPOA 3LPTA 3C14B 3QETA 1K1SA 4KO0B 1VISA 2XNRA 4HUEA 4DTUA 1SCJB 4L3QA 1OYDA 4MJKA 3RRGA 4JK8A 3EKUA 4CGFA 2V8VA 1QVGR 1RT4B 5H9EJ 5KFIA 4WFAL 4IEEA 3MI7X 1RU2A 4OZ3A 4J9RA 3M5RA 3B78A 5J2QB 1VQ7N 3GFXA 5C12A 2VGMA 2WVDA 2QZ8A 2FLLA 5K8OA 1FWLA 4ECWA 2UVUA 4RBTA 4DKWA 5C2CA 5B09A 4FWPA 2ZNYA 3RTVA 2YY3A 3G10A 3BO2A 3E3XA 1X9MA 3ONQA 3OS0A 4RBUA 1VRUB 1S12A 4DU4A 3RMDA 4OYIA 2RRBA 3HT0A 3HHLB 3O4WA 4L8RB 2ZUGA 1XIQA 4FS2A 4PWDA 5CZ1A 1SPBP 4DPTA 1HI1A 2BGGA 2QO3A 4IOAL 4DR5F 4JI4F 2BYCA 2CVEA 3QZ8A 4P9SA 2HS3A 4X4OA 1WC0A 5L46A 2AJFE 3CCQN 1N4LA 4ED1A 1ZM4A 1BA0A 2K7KA 2DXFA 3LGHA 2CWXA 1J6ZA 1XQSC 1C0UA 3OW2R 3PZPA 4LQ3A 4ZVGA 1RA6A 1WSVA 3IS9B 4TVAB 3VAIA 4JAXA 4W5RA 2JHEA 4H5VA 4GKJF 3U8XA 1S1WB 4OLOA 5HJXA 5M1OA 4B1UB 3UDCA 5D0HA 4DR3J 1QHTA 3TZYA 2CRLA 3CIMA 3ZSQA 2ZITA 4N76A 1VQ4N 5KFFA 2O5DA 3AGKA 4HT7A 3CD5A 4YDUA 1Q1KA 3HHKA 3PSFA 4QS7A 3UN2A 2C2ZB 1QQMA 1SV5B 2VC1A 1IG8A 3W3SA 4Y28C 3EYZA 3CJ0A 3BY5A 2GQ2A 3BV8A 4BE1A 2LU1A 3CM6A 3IM8A 1MWZA 2HHWA 3BGLA 4ZPTR 4CLFA 1WSGA 2J8SA 2HLTA 4GVMA 1A6LA 2VD3A 4Q2LA 1FNOA 4F4XA 4DPWA 1S6QA 2PMWA 3T5HA 2J0XA 2CNNB 3KYLA 2MTLA 1YVUA 5G0RB 2FVPA 2W01A 1GXLA 4HVJA 3J80U 1U8SA 1HQ2A 3Q2TC 4HKQA 4ZTFA 4YOYA 3LAMA 4AFFA 3NS5A 2W2MP 1V3RA 1R7IA 1APSA 2LECA 3NAEA 4NL5A 3OL7A 3IAS9 4CGHA 4J2EA 5AZIB 1GT8A 4DX8H 3OXFA 4W92B 4J9KA 4DX7A 4DU3A 4DI6A 4Z4HA 2IRUA 2UUAK 2VODA 4OGCA 1DZ5A 1DURA 4RZRA 2GC8A 3L09A 4AM7A 1W7AA 2PAVA 2QRRA 2IVYA 3IRXB 3TWZA 3M8QA 2PI4A 2Z4PA 3CPWM 2QYGA 2F8SA 1JQGA 4CBUA 4CD3A 2HNDA 1XMOJ 4ZPWR 4BWJA 3MD3A 2ZDOA 1TL1B 3E01A 2XZDB 3Q8PB 2KW4A 1JIHA 4KHMA 1QTMA 3RVCA 5F0WA 2DRAA 3JSMB 3O1BA 3QFWA 4P6QA 3FRZA 1ZBHA 4DEZA 2G0IA 3DRPA 3O9TA 3C6TA 3CHWA 1NMNA 2ITMA 2I0XA 4LRDA 2J7WA 3CCMN 5FDLB 3D6RA 4DV6K 1JCEA 4X4NA 3WXLA 3JTNA 2P9IB 3BGRB 1RSCA 1Q79A 2HS0A 5GMDA 4K4VA 3HPOA 3IFRA 3LP2A 1HKAA 4OZLA 3S3MA 2GJ2A 4RNHA 4JI2J 2JL9A 3IDHA 2DPIA 3CDEA 4PKDB 5F0XA 4Q8EA 1WOPA 1X0FA 4DR3F 1S5JA 5JMNA 1E3MA 3MR3A 7FD1A 3MX2A 2CG8A 2HRYA 2CJQA 1U1PA 1P1TA 3ZT4A 1C0MA 4M3ZA 1NRKA 1JLGA 3P45B 2PD1A 4KHYA 2Y1IA 2Y1RI 4J9NA 1NSKL 4FPRA 2NXJA 5IV3A 2J8AA 3G4SS 2APOA 3PRVA 4OFZA 1IBLK 3VVTA 1BY9A 2VGNA 2VIHA 1NDKA 4DV5K 3AAPA 4K25A 1UFWA 4LVNP 2RQMA 1TKTA 3OYMA 4ANEA 4A61A 1RHMB 3CMAN 3AVFA 1YTAA 4NA2A 3BR8A 4B3RJ 1EIYB 1CXQA 2V2QA 2E1PA 3OVAA 1AUSL 2JC1A 2CUYA 1X5OA 1S9GB 1HQUB 3QWPA 4CBXA 2XY6A 4CJFA 1T9VA 3MUVP 5J1NA 5AQHA 1CQMA 1VQLS 4BC5A 1RBVA 2MZQA 2X1BA 2OHDA 3I87A 3RW7A 2FHKA 4BBYA 3Q7CA 2XMVA 2QTDA 4WFYA 3UO0A 3QB0A 1UEUA 1YSJA 1OJ4A 3G6XA 2O8CB 3BR9A 2NRWA 3NLCA 4OX7A 2LEAA 1URNA 3J81j 3MPWA 3ATUA 4FXWA 3M1FA 4ECZA 4G3IA 4I6MA 2WBNA 2DNGA 3I5CA 1B4SA 2KHDA 3J7YI 1TUVA 1NGGA 1W97L 2DHGA 4BRCA 2HQFA 3MM8B 3HP6A 3G2XA 4F9OA 1B7YB 1FO1A 1IKWA 2CH5A 2RNEA 1HWIA 1DTTB 5DDRC 3EKSA 4NLOA 4DX6A 4EFAC 3M32B 3GMGA 2HHQA 5CR4A 4DN0A 3NGIA 3D2FA 2NRVA 1CZAN 2WZ1A 1FRMA 3TJ8A 4MMOA 5JICA 4DR2K 3TSUA 3AJDA 2UV8G 1WC4A 1UAXA 3D5MA 3JSBA 1RWWB 5IT0A 2EEYA 4Y0FA 5IS2A 2DXEA 3GJSB 1FI4A 1F5BA 4K4UA 5A0YA 3C19A 2BANB 4JI2F 3MWTA 2D4WA 2HAFA 2F7VA 3PHTA 3X1LB 4CHPA 5KQ8A 5B7WA 1RWPB 1W25A 4FF4A 1M1GA 3CD7A 3QLHB 2RN2A 3M3ZA 3H2UB 1NGAA 3KLGA 1OH8A 4U7CA 4EAHD 2L9WA 2RRNA 4CI0B 4I69A 5FIIA 4BRDA 5KT2A 1U1OA 1MA9B 4DSJA 1BCMA 1VQ9N 4PZVA 1KCFA 5LOQA 2UXDK 1FRLA 5AQUA 3KHYA 1B0PA 5B0FA 1C0FA 4Q0BA 2H1YA 4PL7A 2BOAA 4PG6A 2WVEA 1OQ6A 2NYIA 3DDIA 3P4UB 3TJAA 1VBZA 4B3RF 2K3IA 2QKKA 3FRYA 1EP4B 1KLMA 4X84A 3R5DA 2XQCA 2VG5B 4X4VA 3J8AA 4BE0A 1PJ6A 1CJKB 4CFBA 2CZ9A 3C6UB 1U04A 2V4JB 3LDQA 2VB6A 4KH6A 5BR9A 2RB7A 2H54B 1K0VA 4P2FA 2D7SA 1GLFO 5ETPA 2O8DB 4CJ7A 1C4CA 4F4KA 2CNLB 3M4XA 3D2WA 2HHSA 5BREA 1NHKL 1HA1A 2E7WA 5E41A 2HZAA 2L9NA 2IMWP 1GAOA 1U8WA 1NH7A 3BGFA 2P6SA 3T1HJ 4GC7A 3U1MA 3HK2A 3NY0A 3D6FB 3FLCO 1M0SA 4PA1A 4HACB 3KHLA 4ZHRB 1KVJA 5LL6Z 5LT5A 2ADCA 3WHIA 1U0HB 4JKHA 2FY8A 4O4GA 1P9QC 2P9EA 3I5AA 4UY8O 2CXEA 2WTFA 1RI7A 4JI7J 2WUSA 3I55N 4AHCA 2E5IA 2HHHJ 3BQ0A 1I94K 4ZP6A 2O1PA 4HTIA 2NREA 2IIRA 1B99A 4EO8A 3TP2A 1GLEG 4WF9Q 2VQEK 4IJNA 3EE3A 5LL6d 3ZFVA 1U48A 2VPZB 4XDDA 4DSFA 3DLRA 1OSDA 4A46A 1PAUB 1SQEA 3NXZA 2XSJB 2GV9A 3DRSA 4JI5K 2AJ1A 3EZUA 3A2FA 3SMZA 1HRHA 4NXNJ 4LF5J 3V9ZA 1UOCA 1RHUB 4DCOB 2A2DA 4XEIA 4IRKA 2DGTA 3CB4A 5AE2A 3RSEB 3P1GA 2Q1LA 3CJ2A 3CJ3A 3G8QA 2Z2YB 4NLSA 2A41A 2AMCB 1VMBA 4C8NA 4DL0C 1S9EB 5KFCA 2Q6CA 2YHAA 3TYTA 4BRQA 4O44A 3ETOA 1TU0B 3NNHA 1E6VA 3WX4A 3D3BJ 3ZTRA 4IEIA 2UUBK 3DGPB 1N5YB 2RHQB 1YITS 1RFQA 2GGPB 1O5JA 3T9ZA 3EGWB 4JI8J 4FWKA 4G1IA 1GNKA 1U24A 3OVSA 2F96A 4O3SA 2IAJA 1D9AA 4KHQA 5L8RC 4UT4A 5AQYA 4KI6A 2MXYA 2XM3A 3UR0A 1KTVA 1R8CA 2ZZTA 2D41A 2XI2A 3FEXB 3TNVA 4IR9A 4B9NA 4LR7A 1RUSA 1RBOB 1CJVB 4OHZA 1RDUA 2FD2A 2ZOGA 3CERA 2OKQA 4CZIA 2HFOA 4CJ4A 2B9XA 1RTHB 3B6OA 4H0XB 2PFDA 1XJWB 4GVLA 4CEBA 3HULA 1Z05A 4X62J 5HLFA 3TA1A 1GQEA 1K73O 3C2PA 3CCWA 4B3OA 2K3KA 3L6QA 3DRSB 5CYMB 5HI7A 2X3GA 3KWGA 3V9WA 3PRBA 3GFHA 2IMOA 2MLZA 3DJCA 4ED0A 4WQ4C 2IA6A 2OTJS 3UB5A 3SBTA 3KJVB 1B70B 4AUKA 3DLKB 1D5AA 3SCJE 3EGNA 1ASWA 2CQ3A 2QN6B 4XPCA 4H54A 4NZ6A 4JI7F 4TLRA 2Q2RA 2HHHF 2FLNA 1MMLA 3DAWA 3G87A 4WF9L 3AVHA 3FZHA 3U9DA 5F8HA 3SCXA 4FSVA 1VQNN 1EKRA 4KGKA 4A47A 4FK4A 4KREA 2NXUA 1RDBA 2V8DA 3LP0A 3IA0A 3HCXA 3DLBA 3KLFA 5JXSA 1IKYB 2FUG9 4A8SA 4Q2MA 4LVOP 1IKVB 2I1RA 2K8GA 1QLNA 2PA8D 1VQ6S 3M6VA 4LF5F 3J81Y 3DLJA 1NBWA 1Q7YO 3E1YA 5A6WA 1H73A 2HHXA 1J5EJ 3UPFA 4IRDA 2GTDA 3HVWA 1TKXB 1RGIA 3VV2B 1MG7A 4LIRA 2YHYA 4H5RA 3S41A 3FCHA 3EVWA 3CC7S 4Z4GA 2GA7A 2MKJA 4U96A 5DRKA 1VRQC 1EWQA 1VSMA 5ADXH 3FK4A 4C8ZA 4DF4A 1BI4A 3NWRA 2ZJPQ 3DLGA 4NCGB 3KDNA 2CJYB 4E7JA 1R6YA 1SB6A 2IDOA 4TU8A 4DV2K 4ECSA 1S1TA 2YKMA 1HJOA 2WC9A 3SMPA 1WTBA 4KB1A 1LW0A 3MGJA 3ALYA 5KFDA 1FTCA 3PO4A 2AHOB 3QZ7A 4A8WA 2FLOA 2W2NP 1EQ0A 4B8AB 1OO0B 3WC2A 2ZH8A 4U7UK 2YKAA 4C6AA 3MFHA 2Q3PA 2JWNA 4X62F 4L73A 1VSIA 3CEDA 4C11A 5IT9Y 3KK3A 5DJBA 1HWUA 2IRXA 1NGBA 3O9UA 1XHXA 3QIPB 3M2RA 2A6MA 3CCJN 5EX0A 4DSIA 4F4WA 1VQON 2XMTA 3ZXWA 3VGTA 4OZ0A 3ZSRA 2SXLA 1IV0A 2XYHB 2I2YA 3KK7A 2PE8A 4F04B 1RJJA 4U67Q 1NJYA 3H0PA 1S6UA 3AVBA 3ZZOA 2P9KB 4EP5A 3J80O 4DU1A 3O8WA 2ALZA 2QSFA 1HNIB 2BM0A 2OSRA 1HL6A 2QWQA 1HPMA 4XH5A 4HEA9 4H4KC 4QWDA 1BQNB 1KP6A 3O3GA 3OYAA 3IM9A 2QLBB 4WYWA 4C23A 2DH9A 2Q66A 3CCLS 2KFZA 4NB4A 3P5TL 4OZNA 4P74A 3KD5E 4I7FB 3NOCA 1JJCB 1WHWA 4TN2A 2YKMB 3Q0AA 1RHRB 1S72S 1WELA 1PGZA 3SDEA 4H4MA 4ELUA 2U2FA 3AA2A 3H2VE 2IDEA 3VGLA 5CCMA 5T7BA 1QJHA 4PPZA 3L4BC 1NKCA 2XYPB 3IMXA 2Q79A 5KOWA 4GW6A 1NGCA 4Y3CA 4JD2A 5AT1B 1WN7A 2MZTA 3M8RA 2B4PA 3RYLA 2AWZA 2QWOA 3RWUA 1JJHA 3EUNA 2P9CA 1W7WA 3F41A 2GBZA 2BVZA 2OI2A 3CT9A 4QYZJ 5HQLA 1WG4A 5CZXA 3UVJB 4FWMA 2GIQA 4IKAA 1NLVA 3MXJA 1H74A 3LWLA 4DR1J 3CCEN 5HP1A 3QIDA 2E5LJ 3FE1A 1WDDA 3J7ZT 2E2OA 5CYQB 5C15A 5L1IA 3H40A 3DC2A 2BMBA 4W98A 1TYQA 1VSFA 5JLHA 3ILIA 4PY5A 3HSJA 2UYTA 3Q24A 1SJRA 4DTJA 2MZSA 3CCRS 2UU9J 2Q3SA 4DG1A 3NVKA 3JSRA 4DQQA 2O4GA 3HJVA 1MMNA 3V6DB 4M5LA 1PG5B 2RE2A 4QS8A 1T9UA 3BUZB 3AVLA 1SC4B 3MM7A 4DOZA 4CTAA 4LR8A 3DCAA 4YOTA 2JDJA 3VQ5A 5AZJB 2NRTA 1LV5A 1HBOA 4RG8A 1CZBA 5A8WB 6FDRA 1VK0A 1VHFA 4F25A 4U67L 2XHWA 2RKIB 1LKZA 1HHTP 3QO9B 4CK1A 2M0GB 1SKSA 3FZLA 5BN8A 4JKCA 3KG0A 1TVRA 1J9AA 4LH5A 5HL7Q 4RW8A 1U1MA 1KHWA 4NYZA 2UVWA 2IFXA 4DV3J 3NGYA 2FJVA 3FEYB 3QYYA 1L3SA 2Z0GA 3GYGA 5FRMA 2HAIA 2M70A 3MR5A 2G4BA 4B3TJ 5GVQA 3A5NC 1IG9A 4C3LA 1NM1A 3ZX3A 2AGOA 2ZD1A 3D68A 4YB5A 4OGEA 2YX1A 1O13A 2EC2A 2XLIA 1H38A 3PYDA 5B08A 3J81U 2YX6A 3UKRA 4DMZA 1S48A 2OD6A 1EETB 3UN3A 3FQLA 4YY3K 3EE8A 2O01C 4BG8A 2EI5A 5B0CA 5DG7A 4ZVUB 4DSLA 4DG1B 2KRBA 1FJGJ 2ZH1A 3VMFB 4K2JA 2KT3A 2GJFA 3OYCA 2R7UA 3VEXA 4H0YB 4OV6A 1Z1ZA 1U1LA 3N4PA 3MEDA 5DETA 3VQEA 3WBZA 3A5LC 3LZIA 2E4LA 4BC4A 2QSWA 5D78A 3KMQA 4LF6F 7AT1B 3KKRA 4OX6A 4BLGA 4IOXA 1BMQB 2F9DA 1UWBB 4M7YA 4KGXB 3MAAA 1SXLA 5J2PB 2A42A 1U0SA 3OY9A 2R3VA 3MCAB 3UKUA 4P2MA 4ZCKA 4DR1F 5ETSA 1KD1T 4Y2MA 2E5LF 1NK5A 2Z1GA 2GAGC 1XERA 1NDPA 1C1BA 3C16B 2QMXA 3DM2B 3SAFA 4AH9A 5AE1A 2G13A 3HSTB 3AB4B 4S0MA 3HSGA 4YOVA 5FRNA 5LY3A 1UA0A 2UU9F 5IT9U 2F40A 2UV8A 5RUBA 1REVB 4BDYA 3LALA 3MCSA 3LDPA 2NQPA 4K8ZA 4UQTA 2GHVC 3BGOP 2HB5A 1IKXA 4BRMA 2ZBCA 3KFWX 2KM8B 1ZBUA 4BY9C 1HIYA 5I3QA 5CY4A 2GWJA 1R0BG 1B64A 1FE4A 4OZ2A 2HWIA 1NSAA 2F4FA 1K44A 2X1AA 3IXQA 3MMAA 1RKIA 3ZTQA 3OT9A 2MGZB 5HL7L 1ZYQA 1SBRA 4ED3A 4WU2A 1RZMA 1NK8A 4HH0A 4IG0B 3S9HA 5LMUJ 2IOCA 3ZT2A 1VQKS 5LXYA 1ZM3A 4FPIA 3ZX2A 4DV3F 3I8DA 2CYYA 4U95A 1MN9A 1YZ6A 1YUWA 2CG4A 2NUHA 3B4DA 3OR2B 4B3TF 1Q82T 3UKUB 5E2QA 5IZHA 2I7NA 4M3YA 4C0OC 4U9RA 3WQUA 3D1OA 3WUHA 3IWXA 5HANA 3NNCA 4MH8A 2OPSB 1M5KC 4AHTA 3I0RA 3V4IA 2FDNA 4JKDA 1IBMK 2NRRA 4CHNA 4OPHA 3QT7A 1HBNB 1LK7A 3BDPA 2FSJA 3GR1A 2OD4A 1HFEL 5M1PA 2F8HA 1NOYA 2YH0A 3PYFA 1U6FA 4IQXA 1JLEA 3BREA 3Q8QB 3CF5L 1F9HA 2DHHA 3HKZD 4DTNA 1Q78A 2XC9A 3PRDA 4HL9A 4WKRA 3PDNA 3SV4A 1X31C 1PBAA 4NLTA 4IR1A 4BRIA 2DR5A 5AQJA 1TL3B 2PI5A 4H4OA 1QE1A 5GADU 5L1LA 2GNKA 5D0EA 4OHXA 1FD2A 4AHRA 1PIEA 2VDIA 4CHYA 3LGNA 4I4BA 2HMPA 2CGJA 2QL5B 4K4XA 3N01A 4M41A 1YHQN 3QNOA 1LFPA 3W65A 1HQEA 1A9NB 3ZNJ1 3VQSA 4A8XA 3N79A 4RWWA 3HM9A 3A8EA 3UWTA 3H59A 4J9OA 4HHUA 2AU0A 2A3ZA 5H1SV 2VBYA 1JL2A 4NEZA 4MLEA 2DISA 3W2VB 4F8RA 1BWFO 2YI1A 4WP3A 3BO4A 2PBDA 4RUHA 1MU2A 5DDOC 4OJHA 2KT5A 2HMIB 1Q8IA 4ECYA 3EDRB 3GIKA 1EKEA 4DB3A 2BKOA 3B6BA 5BPNA 4FLYA 3EEQA 3QJLA 1VS3A 3J7Z5 3VQPA 3AAQA 3T1YJ 2C2MB 2MZ1A 1EQMA 3HPGA 2GUPA 5C2DA 3US5A 1KLNA 4YOUA 3WEEB 4HDGA 2ACYA 3H5UA 3K5OA 5GAEI 3FSXA 3KLIA 2GQCA 3Q8VA 2RDJA 1XHZA 2DNNA 1S7IA 2ZJRQ 3T69A 1F9FA 4KH5A 4BR9A 4RO0A 1K9MO 1WOOA 1VQ5S 4J9PA 5CH7B 5KFHA 5LMUF 3PX6A 2RS8A 5GMKa 3L4IA 4ZN3A 1UVIA 4CLUA 3NBPA 4KTQA 1RTIA 3Q8RB 3THXB 1P9YA 4V19J 4FWNA 1KNZA 1HQEB 1N0VC 4IFYA 2E1RA 2MKHA 3V5RA 4C4WA 1QHAA 2XGPA 4CJEA 1ZS6A 3V1OA 3GSDA 4A57A 5IC6B 4CBWA 3Q8UA 1WNEA 2P9GA 4TY8A 3GYNA 2F9JA 1R0CB 3FQKA 1FD8A 1R6VA 3I5BA 2ZH9A 2YNIB 1KBRA 2BACA 4IUFA 3OBIA 3FGUA 4O4RA 5KPRA 4NLVA 5K8PA 4CZHA 4LF4J 2JGUA 4EBDA 5ELZA 4ZLPA 3ZEUA 2YJEA 3ULEA 4BC9A 3GYXB 4B3SJ 4WCEL 1DQ9A 3MDQA 3BF4A 3K5MA 2Z57B 4DU8A 4W4MA 2DNRA 4I0WA 3Q7BA 4JNEA 3GTYX 2PEBA 2ZNZA 4A8MP 4DXLA 4O3RA 2CQGA 3TR5A 1L3KA 4UW2A 4MKBA 4RUCA 3ZTOA 5HATA 2V69A 2A6AA 1RT5B 4DZ6A 4M5IA 1E6YB 2MHNA 2EFNA 4YP3A 3FFIA 5A8KA 5FJ4A 5T7LA 4NWBA 3OTDA 2ALYB 3G86A 4RKUC 4AT1B 3GJRB 1IM4A 3G82A 1HLUA 4FWLA 4DLGA 4FYYB 4PXDA 1D9DA 4ERDA 3DXKB 3T5LA 1C1CA 2EBEA 4QR2A 1N32K 3M30A 1FW6A 1G2EA 4F2SA 2AA4A 3MXIA 2JC0A 3KHHA 1HKCA 3MN6A 3TZZA 3MCOA 4F0HA 3W63A 2BJ9A 5KOXA 2H5IB 2EFVA 4ZJOA 3FGVA 2CPYA 2MSSA 4NCBA 1NU0A 4B1WB 2DNHA 3UR3C 1TFYA 1HNVA 1YWXA 1TV6A 1CJTB 2N82B 2XHCA 1U09A 1FE0A 3UCUP 2E1AA 4IBNA 4PQUA 1ULRA 5DG8A 1SAZA 3V9SA 4FF2A 3OJSA 1G99A 3WZ0A 4USMA 5HMZA 1NM2A 1YJNN 2X51A 2CADA 4FLUA 1NH8A 2GVDB 2FC8A 4CE9A 1EARA 2MKSA 3MECB 3OYLA 4KHNA 4OYPA 3SK3A 2J9DA 4LT6A 4KHWA 3ID8A 2L08A 4FYDA 2FGCA 3ET6A 1UZHA 1KR4A 3GV8B 1GLJO 1RWOB 2UVRA 1CULB 3Q22A 2XY8A 3NF8A 3OYGA 3DOKB 4LRBA 1FDDA 4ZP9A 3DOMA 4NEYA 4DTXA 1LXNA 2D3O1 2HNYB 3PW4A 2JH3A 2EBGA 2ZEJA 4DBQA 4R5PB 5KG0A 4ZCIA 1NMDA 1RAJA 2QC3A 4LF4F 1Q9XA 3HL8A 2ZUAA 4ED7A 3G96A 1IQTA 3CC2S 1RBTA 5FPEA 3TX8A 2AJ2A 3NEKA 1NDLA 1F6TA 4OJ1A 5E3AA 4MIAA 3U27A 3FBFA 4F4YA 2KXFA 4DR7J 1LW2A 5BYRA 3RRHA 1GXTA 3D0IE 5HVFA 3LQVA 3EGZA 3QQCD 4DU7A 2XMMA 1N5TA 3OYBA 3W0LA 2HFSA 4KGMA 3PIOQ 3MN5A 1CC8A 4J9LA 3MN7A 4J9QA 4WIQA 2IPOB 1FFWB 2A10A 3K0JA 2WOMA 2NYHA 1IJEB 4PR6A 3E2EA 4PHTX 3RB6A 2CDQA 1NUEA 2E29A 1JLFA 2O8EA 2Y0SD 3CXCR 2F3JA 5J2NA 4FJKA 1X5TA 5G4DA 4IRCA 2GVZB 2DH8A 3BQ2A 2UUAJ 4CWBA 3PYGA 3CWJA 4CGDA 5C2FA 3SQGB 2RILA 4OHWA 1P90A 1YX2A 4FJMA 2HFVA 4ECTA 2XNQA 4XTTA 1SL0A 4DL3A 3RG6A 4CLLA 1VLYA 3R7SB 1YG0A 1T3OA 3NMRA 1ZBTA 3O6WA 1W2IA 3FC9A 4YHHJ 3CG7A 1S10A 2FJEB 5KTQA 5K14A 3Q23A 2DGXA 3WNEA 3MMVA 1KWMA 4CYUA 4B02A 4M5JA 3PLAA 3LUYA 3WQPA 3PFOA 2IM0A 1HHSA 3CJRA 4DV4J 1RP5A 2EFQA 4USUA 3TTDA 1BWEA 2JEIA 1S1VA 2BDPA 3C94A 2V9WA 4DV6J 1JKHA 4AE5A 3SMSA 1RA7A 2HBMA 1WD6A 3C46A 4PXBA 3FDSA 2OELA 4DS4A 1DKGD 2ILYA 4C3KA 4HTJA 2Q97A 3NGZA 3DMJB 2H48B 4M5DA 4FLZA 2MJNA 3DXMB 5CZVA 5L9NA 1CG2A 1IR0A 2KZZA 4LC9B 2B0GA 4F3TA 1N34J 2BTFA 1N33K 4OZ5A 3IR7B 4R0EA 1UVKA 1YJWS 4CDIA 3OYNA 4Q8FA 4UOFA 1CJUB 4LF1A 4OYAA 1MNEA 1D0EA 4PG4A 4ISGA 4O23A 3LDLA 3MEGB 1VC0A 4DR7F 3HZGA 3TUPA 4JYAK 5EUHA 2A5XA 1FVSA 4C9DA 4FLWA 4QU6A 1BO5O 2JX2A 1B0TA 2BR0A 3AA5X 4NXMK 3R5BA 4L74A 1VHIA 3TEHB 5J1EA 3O3FA 3ZSZA 5M1FA 1DBDA 2DNLA 3UI3A 4OKKA 2J0QD 1URRA 5H1SQ 1R8AA 1YJRA 1FRHA 4DFKA 1XUPO 2JSXA 3NF6A 3KKFA 4DL2A 2UUAF 2UVVA 2BE2A 5CQGA 4RLEA 3QPIA 1X4GA 3MOZA 4DMNA 2VWBA 3RBXA 1WBDA 2ZBQA 4B9VA 4NRTA 1O6XA 4IH6A 2R2RA 5HJYA 1WORA 2DR7A 3R8YA 5FPNA 5KFMA 1WSHA 1S97A 4BC7A 1C2PA 1EAYC 2FBYA 4KAIA 1VC5A 2QWRA 3QNNA 3NCPA 4XDCA 3BKUA 3HFKA 3CJ7A 4DV4F 3E9LA 2J6TA 5GINA 4CLWA 3ZZ0A 3OUYA 4DR2J 3AY0A 2XBPA 1B7FA 2VFUA 5HBMB