4IG0A

Hiv-1 reverse transcriptase with bound fragment at the 507 site
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 160
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig0A05
1FKOA 1RBVA 2AGPA 4Z4FA 4Y3CA 1NJWA 4EEYA 3SQ2A 1VSLA 3KK3B 4J9LA 1DLOA 1S1UB 1WSEA 4I2QA 4IRKA 3VQEA 5HROA 3PR5B 2B5JA 2W7OA 3VN5A 4ECSA 1D9DA 4FVMA 4N47A 2ATLA 2UVUA 4CGGA 1X9SA 1BISA 3EPIA 1FK9A 2E4LA 3IS9B 3I0RB 5FDLA 4H4MB 5J2QA 4CHQA 1RTHB 3QGGA 4CHNA 4ZVEA 5C25B 2E9ZA 4CGDA 4FJJA 3TVKA 4KHNA 3DLGB 4MFBA 3I0SA 2BANB 2V4QA 4DL6A 3QZ8A 4JV2A 4NLOA 2BR0A 1LWCA 4CECA 3V1OA 4K4ZA 1JLBB 3BSAA 1D1UA 4EYHB 4E7KA 1LAVA 3G6XA 1VRUA 3CJ4A 2YNIB 4DG1A 1W9HA 3OYCA 3CG7A 5I3UB 1DTQA 4DF8A 3UPFA 4KRFA 1S1WB 4FBUA 4RNHA 1RT7B 2Y1IA 3KLIA 4CGFA 3KHHA 1HYSB 1W25A 3V9XA 4URGA 1CZBA 4M42A 1C1BB 3AV9A 3C6TB 4PQUB 3BGRA 2KW4A 1GOCA 3ZSOA 5J2MB 1S5JA 4Q8FA 3SCXA 5KI6A 1SKSA 3IRXB 1YTUA 2RKIB 1T03A 2IDOA 4QPXA 1IKXA 1U04A 3K5OA 1HNIA 4IG0A 2PYLA 4B9MA 2ZE2A 3ZSXA 3BSCA 2OPRA 1IKWA 2J6UA 3TI0A 3HYFA 4FJ5A 4RW6B 2AGQA 1ZBFA 1XWLA 2FVSA 3HPGA 3K2PA 4C8NA 5CZ1A 3MEGA 4DTRA 3KLEB 2HVHA 4IH5A 3DMJB 4Q5VA 5KFOA 4IFYB 4ELVA 4X2BA 3OYHA 1TKTA 3TAMB 2G8HA 2BDPA 1WSGA 1RDCA 2E9TA 4FJIA 5K14A 3LPTA 1KLMA 4Q44A 3MAQA 5EWEA 3H2LA 1IG9A 1XHXA 5HLFB 3TAEA 3RBDA 2WTFA 5F9LA 1ZBUA 3MXIA 5DMRA 1U09A 4HHTA 1JLGA 4RG8A 4MKAA 3NCIA 2WCXA 4KE5A 3LZJA 4GC7A 4BDZA 3P5JA 1JIHA 4B9NA 1TL3B 3KK1A 2VA2A 4B8AB 3LP1B 4GC6A 4O4GB 1SH3A 3PHEA 1KVAA 4KHUA 5F8IA 2FJWA 3LPUA 4AILC 5F8HA 5J2PA 4M3UA 4KV8B 5I42A 4EP4A 3OS2A 3LP0A 4DU1A 4WYLA 4M41A 4O3OA 2AU0A 2ILZA 3F73A 4NLSA 3H40A 5DLGA 4DS5A 3QEIA 2JEGA 3AVNA 2BE2A 1HNVB 2OPQA 2R8GA 4CF8A 1JXEA 4JV0A 4PUOB 1JX4A 4WZQA 4RW8B 3B6PA 3NFAA 2D0BA 1J9AA 3ZSVA 1IKYA 1RDBA 1T05B 3OSNA 1EXQA 1JLQB 3AVKA 4CF2A 4WYWA 1JLFA 5CYMB 4ZHRB 4FJKA 1S49A 1VSDA 1C0MA 1TL1B 1TKDA 2FVCA 2G8FA 4CGHA 4Q0BB 2D3ZA 4NLTA 2FLLA 3PY8A 4IG3A 1S0NA 1RNHA 1KFDA 1BL3A 4ECUA 3MTKA 5FROA 4FXDA 4YR3A 4EZ9A 4FZYA 4CEAA 1Q9YA 3NAIA 1RT6B 1LW0B 3DRSA 1DTTB 4Z4EA 3SUOA 4ED6A 2VG6A 3PW4A 4ID5A 3QIPB 3RRGA 4CERA 4CEFA 3Q8SB 3AVFA 4Q45A 4Y1CA 4NCGB 1RT3A 4MIAA 1TKZB 3V6DA 3KJVA 3NF6A 5KGWA 3V9WA 3RMBA 3GILA 1WNSA 3MEEA 2BQUA 4M3ZA 3H5XA 2QKKA 4OLBA 4OL8A 3EZUA 3LAMA 3QIOA 1RBRA 4W5QA 4DS4A 3CO9A 3U3YA 4DQSA 3HPOA 4TY8A 2ATQA 1LWEA 3T19A 1DLOB 3OYGA 1TVRA 4I2QB 5HRRA 1TKXA 5HROB 4CIGA 3EZ5A 4CK3A 1NK4A 2HHTA 2IGIA 2D7SA 4CEEA 4ED2A 3V4IA 2DPIA 4M45A 1FK9B 3KKRA 3N6MA 5FDLB 3OLAA 2FVRA 5J2QB 1QAJA 3OYDA 4KHQA 4KB0A 4J9RA 3I0SB 3PJWA 4FM2A 4F3OA 4JS4A 4KTQA 4CHOA 2EC0A 4AHUA 1LWCB 3CQ8A 2EHGA 3PO5A 5CYQA 1NKBA 4RNOA 2C22A 3OL9A 2OPPB 1ZYQA 2E6LA 4DG1B 3FQLA 4F50A 2Z1JA 4MK7A 1KHWA 2YKNA 3NF9A 1FXXA 1TP7A 3KLFA 1ASVA 3KLIB 3ZT1A 3VA0A 2R8HA 1UWBA 4AHCA 3KD1E 4DTMA 4AH9A 3TAGA 3BDPA 1A5XA 5JS1A 4XIUA 1NK8A 2FBVA 2IJNA 1VSKA 1RT4A 1YVUA 3RMCA 4Z4IA 4LY7A 3UQSA 3GIKA 4DU4A 3CJ3A 5F9NA 5CY4A 5KFIA 1T03B 3CFPA 4C8KA 3OHAA 4IG0B 5HBMA 4QWEA 2ZE2B 5EWFA 1S9FA 2V9WA 3AVLA 2OPRB 4ED1A 3V9ZA 1IKWB 2O5DA 3QEXA 4WFZA 4O0JA 4E1NA 3Q8QB 3T5JA 5DG9A 3SPZA 4CFDA 4G1QA 3MEGB 3IAYA 3CJ2A 1WLJA 3E51A 2Y1JA 1TKTB 3SI8A 3DLKB 3P1GA 2ILYA 4DL2A 5DGBA 5KT5A 2HVIA 5K14B 3N6NA 4FJ7A 1BIUA 4O3NA 2DFHA 2F96A 4URSA 3HVWA 3LAKA 3TAQA 3AVAA 3OYJA 2HNZA 3M8SA 1TAUA 5JXSA 4F8RA 2WOMA 5KFHA 5KFEA 4YR0A 2BRKA 3AVIA 3DI6A 2AQ4A 2VWJA 4QWAA 2W9BA 2R8KA 1HPZB 4ICLA 4J2AA 4CIFA 3OLBA 3NGIA 3KHLA 1EP4A 1VSMA 2XCPA 3BQ2A 4OLAA 1KVCA 4KHWA 1L3SA 5KFFA 2FBXA 2OZMA 2OPSB 3VQ6A 4NYNA 3CJ0A 4QAGA 4J2EA 4U7CA 3SUNA 5HP1A 5C24A 3DM2A 4HUEA 4N41A 1RBTA 4Q43A 4DTJA 1S1TB 2HMIA 2KFZA 4AHSA 5I42B 2A1RA 1K6YA 3CDWA 4HCBA 3RR8A 2JEIA 5E41A 2W8LA 2R7YA 4PY5A 4K4TA 2WK4A 3KHRA 1BCMA 4FK0A 2BE2B 4NCBA 4ECTA 2JC1A 1HQUA 3DRRA 1RBSA 3NF8A 4TY9A 4AHTA 3I8DA 5KFWA 3WNHA 1BIZA 4KAIA 2YNFA 3DOKA 4O55A 4FJMA 3SZ2A 4M3RA 2D5RA 1KLNA 4FLUA 4HUFA 1RAJA 2GIRA 2IAJA 3HPHA 4OKKA 4YNQA 4J2BA 3RBEA 4KHMA 2YNHB 1JLFB 5KFPA 4H8KA 4ECXA 3MEDA 4E3SA 3UIQA 2B4JA 3IN5A 1NK5A 4KHSA 3KLHA 1GOBA 4FLTA 4DSFA 3V6JA 4I9QA 1I39A 1JXBA 2JC0A 1C1CB 1S6PA 3WNEA 5KFVA 2FVQA 2RF2A 4N5SA 2VG6B 4ID5B 4ZVGA 1RT1B 1HARA 2YHAA 3QERA 2B43A 2HNDA 5DLFA 1CXUA 1KVBA 3DYAA 2XY6A 5KFUA 2A1SA 3LP2B 3T5HA 3LZIA 3V6DB 1J54A 3KJVB 1U45A 3MEEB 1N5YA 3M8RA 2ZD1A 3IG1A 4CJKA 4CJQA 3E01A 2BQ3A 3KK2A 4TYBA 4BDYA 2HHVA 2Z1HA 1D8YA 2RDIA 3SUQA 1S6QA 1NNDA 3NF7A 2ITGA 4DQIA 1LWEB 2OZSA 1JLEA 4CK2A 3MF5A 4KO0A 5KFNA 4KB1A 2HHSA 4CJEA 3V9SA 4IKFA 3V4IB 1UOCA 1SL1A 4CJWA 3VQQA 3DLHA 5KT3A 4IRCA 4ECQA 2W9CA 1W0HA 4ECVA 3AVJA 4DFJA 3OYEA 4CFCA 3DRPA 1TAQA 4DTUA 1SV5A 5C5JA 5FRMA 4IFVA 4CEDA 5KG3A 3TQ1A 3O4NA 4HKQA 4PWDB 3M9OB 4C8LA 3EYZA 3OYMA 4LSNA 3JYTB 3RAQA 4NLGA 2IM2A 5CYQB 4H4OA 2IOCA 4DTNA 1LAWA 1S9EA 1RTDB 2KTQA 5KFJA 1FKPA 3OHBA 3OL7A 3NAEA 4NCAA 1RDDA 5F8GA 4M94A 2QKBA 3F9KA 4ECZA 3VQ7A 1BQMB 4CHYA 3KLFB 5KGXA 1S9GA 1U48A 3KD5E 4FS1A 4CJLA 2XY8A 2IA6A 4F2SA 4Z4GA 1HMVA 1J5OB 4E19A 1UWBB 2ASJA 3HVTA 5DK5A 3NGZA 2G8VA 4YQWA 4B08A 3GIIA 2B6AA 3ASMA 4DU3A 3VQPA 2E9RX 4O3QA 4DQRA 4E7IA 2FBYA 3H5UA 3DLEA 4ED3A 4W5NA 3NBPA 3KIOA 3PX4A 2KZMA 1HYVA 3THVA 4N56A 2AWZA 2X78A 4PA1A 4DFPA 3RB0A 4QWDA 4FJ8A 4L8RB 5HBMB 3U3GA 4CIEA 4ED0A 3OYLA 4CCHA 1S1XB 5DQIA 1LW2B 2V0NA 3D5MA 3RMDA 4I7FA 4G1QB 5KRSA 2HW3A 2VG5B 5FRNA 2IMWP 1SKWA 4LSLA 5KFDA 4C8MA 3NL0A 3HK2A 2F8TA 4O4RA 2XY7A 3L2VA 2W42A 4R8UA 5EWGA 4M3TA 1T94A 3GIMA 4FLVA 1R0AA 3G0ZA 3HVRA 3I5BA 1ZETA 2XGPA 4RZRA 4K8XA 1KTQA 4DL3A 4RNNA 4LH5A 1RT5A 2WOMB 3DI6B 2WHOA 1VSHA 3OYIA 2W9BB 4KAZA 3L3UA 3QGIA 4NYFA 4R5PB 1TK8A 1EP4B 4F4YA 4YP3A 3NH2A 3K5LA 4ZMMA 3IGNA 2LSNA 1QUVA 3WNGA 1NHVA 2GC8A 2XHBA 2XC9A 1CSJA 4NLUA 1UA0A 4XO0A 5HP1B 2QE5A 3VQSA 5C24B 1QQCA 1XI1A 4FS2A 5KFCA 4RU9A 4OGEA 2IC3A 4NLXA 1B9DA 3TAPA 1CLQA 3KLGA 4DL4A 2BRLA 3Q8RB 4JS5A 4CESA 1VSIA 1RYRA 5KG5A 4CEOA 4F4KA 1EETA 5L1KA 1RCHA 4RW9A 4EP5A 4IOBA 4DMNA 5EU7A 1LWFA 4I9LA 2HAIA 3QEWA 1GX6A 1D0EA 1HQUB 3DRRB 2QK9A 4ID1A 2EX3A 1HRHA 3MFHA 3ZT4A 4CEZA 3T5LA 3SQ4A 1REVB 3DOKB 2X6SA 2DY4A 2HHXA 1J53A 2R2RA 3KK3A 4TXSA 2IAJB 1I6JA 2WONB 2DPJA 4FLXA 3HKWA 2X6NA 1JL2A 3OVNA 4NLYA 5KFRA 2ETJA 1JLAB 1ZBHA 3S9HA 4FK4A 3OL6A 3IGVA 2UUWA 4JRPA 3KLHB 3ZSQA 3I0RA 1WSIA 1FKOB 3RTVA 1GOAA 3SI6A 4KI6A 1GX5A 2OH2A 1S0MA 1S6PB 3CWJA 3ZSYA 4CFAA 2B5JB 1CZ9A 4CJRA 3AA4A 3AO5A 4QW9A 1T8EA 1ASWA 2HNDB 4LQ3A 1RBUA 3DYAB 4MH8A 5KFTA 3ZSWA 4J9NA 4WZMA 4K8ZA 2D3UA 2ZD1B 1MMLA 4TN2A 3IG1B 2YKMA 2DFFA 4B9UA 3AVCA 4FBTA 3E01B 3ISNC 4W5RA 3QNOA 4NRTA 4MFBB 4FJ9A 3KK2B 3JSMA 4EBEA 1S1WA 1Z4UA 1S6QB 1K1SA 1RT7A 5C42A 4ZPDA 4FCYA 2HB5A 1JLEB 2VWKA 1HYSA 4MK8A 3H08A 3CM5A 2Z1IA 4ZPAA 3RRHA 1RA7A 1NK9A 3UR0A 2F8EX 4E1MA 4NZ0A 1VRUB 1C1BA 3L8BA 3QNNA 1DTQB 3C6TA 3QYYA 3QLHA 3TABA 4RW4A 2AX1A 2OA8A 3SV3A 2W9CB 4QOZB 2ZQBA 2AX0A 4DL5A 4J9QA 3PX6A 3NH1A 2RKIA 4TYAA 3FFIA 3GYNA 3DRPB 5D3GA 5F8JA 3SQ1A 4BE1A 4CJTA 4IFVB 3HVAA 4MIBA 2VG7A 3AO3A 4FK2A 4DLGA 1IKVA 3BGRB 3DDKA 4J9KA 2UVRA 1VK0A 4YR2A 3T1AA 4LSNB 5KFGA 2W8KA 4H4OB 1SL2A 1IKXB 4I2PA 1FKPB 1HNIB 3V6KA 1T7PA 4DQPA 4FM1A 1U4BA 1SL0A 1S9GB 3RMAA 5KG6A 2YHBA 1HMVB 2XRIA 4ZVFA 3TANA 2HHWA 4IQXA 1X9WA 3HVTB 4XPEA 2P5GA 4NLRA 1RILA 3BQ0A 5KG7A 2B6AB 4Q8EA 5J2NA 4OGCA 1JKHA 4KREA 1RDAA 4Y1DA 1XHZA 3PR4A 3O3FA 1U47A 4M3XA 4IDKA 4CJPA 5KT7A 3OYKA 1WSFA 1KLMB 1IO2A 3RB6A 1EKEA 3DLEB 1TK0A 4ZP7A 3MR2A 3NBPB 1TL3A 3FQKA 4O3SA 2JGUA 3V81A 1S97A 3OY9A 4ZTJA 4MK9A 3ALYA 1WAJA 1JLGB 3GV8B 4DFKA 2XY5A 2ZKUA 4O3RA 4TLRA 3SNNA 3KLVA 4DTOA 3S3OA 3MECA 4KV8A 4DSEA 4KFBA 3G6YA 3WNFA 3SFGA 2C28A 5JUMA 3KK1B 4G3IA 5KFXA 5KG2A 4LSLB 3CYMA 1Y97A 3CVKA 1NK7A 4KTZA 3RAXA 4FJHA 1R0AB 4EBDA 2UVWA 2FBTA 1NJXA 4TQRA 4PUOA 4K4SA 3TWHA 5J2PB 4J9SA 1TV6A 2JEFA 4CJ5A 1X1PA 5DQGA 3BJYA 2UVVA 4K4VA 3LP0B 5SWMA 1RT5B 1QAIA 2IJFA 3FRZA 1T05A 1VRTA 4FZXC 3NKYA 4M95A 1X9MA 4DSJA 3PW2A 2XGQA 2IBKA 3HT3A 3RWUA 5CYMA 4ZHRA 3H4BA 2OPQB 4J9OA 3QGHA 4AHVA 4CFBA 1BGXT 4Q0BA 4GVMA 3C95A 3QZ7A 4E7LA 3NMAA 4IH6A 5L1LA 3V6HA 1IKYB 5KFKA 2IS3A 4CHZA 4QW8A 4ZPBA 1RTJA 3SUPA 2YNGA 1WNEA 3MXMA 2J6TA 4Y2CA 3K58A 2IC3B 1C2PA 3O3HA 5KG1A 4FW1A 1C0UA 4WFXA 1RYSA 2PY5A 3QIPA 2R8JA 2GUIA 1S48A 1NKCA 4NLWA 3CIZA 3LWMA 4NYZA 4YFUA 4IG3B 4RW9B 4NCGA 4LD0A 3GIJA 4HUGA 4HVJA 5EDWA 3Q8PB 4RNMA 2R8IA 5L1IA 1S0OA 3AO1A 3HP6A 3OS0A 1YTAA 3DRSB 3K5NA 3TR8A 4WXOA 3H5YA 4ZVHA 1YVFA 4IR1A 5F8MA 4OPKA 4LQ9A 3QO9A 4JV1A 2JLEA 1RDRA 3CDEA 4NLPA 2ASLA 1RT3B 3T3FA 2FC0A 3H59A 2RPIA 1C1AA 1JXLA 1RTIA 2C2RA 3LALA 3AA2A 2C2DA 1A5VA 3H5SA 1S10A 5KRTA 3PVXA 3M8QA 1QSLA 2HHQA 4TY8B 3BSOA 1HQEA 1WAFA 2KQ2A 3M9MB 1L3UA 4OKJA 4DL7A 1XR5A 1D5AA 4ELTA 2R2SA 3VQAA 1TVRB 1TKXB 5KFAA 3P83D 4F4XA 4DTXA 2XCAA 3LANA 3AVGA 1ASUA 4CJ3A 4FJLA 2G8UA 3SPYA 4KTWA 4K4UA 3OJUA 5KG4A 3MR3A 3O3GA 1XR7A 1I3AA 3M8PA 3AVMA 1OS5A 1S1VA 2RDJA 2OPPA 2YKMB 4BE0A 4EBCA 1A5WA 4OKEA 5J1EA 3JSMB 3L3VA 2I5JA 3GV7B 4OVLA 1WN7A 4URQU 3G10A 4DLEA 5C42B 1BQNA 4K4WA 1NHUA 4KKOA 3KNAA 1ZBIA 4CHPA 3OL8A 1C6VA 3N6LA 1QSYA 2OYQA 3CJ5A 3HL8A 3K5MA 1XR6A 3ITHA 5EUHA 4RNFA 4BWJA 4CK1A 4EYIB 3HO1A 3NGDA 2HNYA 2YKNB 1IH7A 2BQRA 3QLHB 1NK0A 4RW4B 4KHYA 4HCCA 2BGGA 4DSIA 4R0EA 2D0AA 3NDKA 1NK6A 4IBNA 4EO8A 3HSTB 1ZTTA 3NH0A 3FFIB 5D3GB 1UA1A 1QSSA 4K4XA 2GBZA 3C6UA 1S4FA 2VG7B 1VSFA 2Z1GA 2Q3SA 1IKVB 4CF1A 3OYBA 3KKSA 4DF4A 1RT4B 3MXJA 3K57A 1D9FA 2PYJA 5KG0A 4DTSA 4B9SA 4ZP8A 5T7BA 4CE9A 4I2PB 4QCLA 4FJXA 1ITGA 3VQ5A 4Z4HA 3DLKA 4KHRA 2CJQA 4FLZA 4B3OA 1JLCA 3DOLA 4O44A 3L2UA 4WFYA 4KPYA 1KHVA 2FLPA 1ZTWA 3AO4A 4DQQA 3H98A 4N76A 5KFBA 4HYKA 3OYFA 3RB3A 4H54A 4CJVA 2P1JA 2XI3A 4Z4CA 1HPZA 4ED8A 4KI4A 5J2NB 1JKHB 3CFRA 1QE1A 2XWYA 4IDKB 3ZT0A 4FJGA 4BACA 3BQ1A 2P51A 1N56A 4J9MA 2OPSA 4ZP6A 3PJXA 3V81B 1RT2A 4RW7A 2HNZB 4HTUA 3MR6A 3S3MA 2O4GA 3O4QA 2GIQA 4FYDA 4M3YA 1U49A 1NKEA 4ICLB 3AVHA 1S1TA 4GMJB 1BI4A 1YT3A 1ZBLA 4O5BA 3QEVA 3MECB 3G6VA 4CF0A 4ZTFA 4DTPA 4KFBB 3HM9A 3D0PA 5JS2A 3NHGA 1N6QA 1G15A 3DLRA 4FM0A 4UQGA 1L5UA 3HP9A 3DM2B 2IM1A 3PW5A 3BREA 2RN2A 3SFUA 5HRPA 3NAHA 2HMIB 3AVBA 3EY1A 2IM0A 3KTQA 2IM3A 1TV6B 3RR7A 1Q8IA 4BWMA 1MU2A 4LH4A 4NLDA 1Q9XA 1VRTB 4KSEB 1QHTA 4JLHA 5L9XA 1KFSA 4GW6A 1C0TA 4IR9A 1NOYA 2YNHA 4DWIA 3QEPA 1SH2A 4YMEA 2W7PA 3LWLA 3V1QA 1SUQA 3A2FA 2WB4A 3CDUA 3PZPA 2F8SA 4EZ6A 3OYAA 4WE1A 2KFNA 2YNFB 3NGYA 1RTJB 2G8IA 5KFSA 4Z0UA 2YNGB 5SZTA 1C1CA 4O3PA 5F8NA 1S1UA 1VSJA 4KB7A 2FJXA 4C8OA 3VQDA 1WSHA 3VQ9A 5KFMA 1KSPA 1C0UB 3MEDB 4CJUA 4QWBA 1RT1A 3MR5A 4B9VA 5DG7A 1B9FA 1TK5A 4QWCA 2I1RA 2HWIA 3IS9A 3LP2A 3HHKA 4H4MA 1RTHA 1TQLA 5C25A 3LDSA 2RF2B 3DLGA 1NJZA 3FDSA 3KHGA 4ECYA 2FJVA 2BANA 4Y34A 4CEQA 3AA5X 3QINA 3ZSRA 2FLNA 3QO9B 4ECRA 1XC9A 4DSKA 3CM6A 2AJQA 1JLBA 4DEZA 4B9LA 3AO2A 4IKAA 4CJ4A 5KFLA 4JUZA 1N5YB 1RTIB 3QETA 2DFEA 4B8CA 3BR9A 4WXWA 3AA3A 3TAFA 1QTMA 2YNIA 5HRNA 5I3UA 3KOAA 3M8QB 1HQEB 2J6SA 5KT6A 1BCOA 4DFMA 3PUFA 4F4ZA 4KO0B 1CXQA 1T3NA 2VA3A 3I5CA 3CFOA 4FZZA 2HHUA 4PQUA 4F4WA 4PWDA 4CEBA 5J2MA 3D45A 1NJYA 3OSPA 3U6FA 3JYTA 3M8PB 2D41A 3H4DA 4ELUA 3IRXA 3T5KA 1S1VB 5T14A 4CGIA 1RTDA 2UUTA 4TQSA 1SV5B 5KTQA 1KRPA 3SJJA 5J1EB 3L2RA 1N4LA 3FSIA 2I5JB 1BQMA 1VSEA 3V9UA 4RW6A 2AGOA 4F2RA 1BQNB 3KMQA 4E7JA 3VA3A 4BE2A 4KKOB 2C2EA 3HXMA 3KLEA 1J5OA 3SV4A 4J2DA 4EO6A 3DMJA 4IFYA 3GV5B 4ZP9A 1S9EB 2W9AA 1Z26A 4XPCA 3ITHB 4CJSA 4OJRA 1KCFA 1UAXA 3TAMA 3QIDA 2O4IA 2HNYB 2KZZA 3OS1A 3UDLA 3OYNA 3EPGA 1SH0A 3NE6A 1BHLA 3PW7A 1SKRA 3ISND 5HLFA 1HJRA 3ZSZA 3K59A 3PW0A 4K50A 4E89A 2XI2A 3ULDA 3C6UB 2ASDA 4KBIA 1S1XA 5DG8A 1LW2A 4RUAA 3S3NA 4ECWA 3G86A 5KFQA 4NRUA 3GQCA 2VG5A 3SQ0A 3LP1A 4AHRA 3VQ4A 4RUCA 5L1JA 4O4GA 3V1RA 3M9NB 3ZT3A 1F21A 2PZSA 2QXFA 5KFZA 2P5OA 4B3OB 1JLCB 1IM4A 3DOLB 4O44B 4FLWA 3MFIA 4JRQA 4W5OA 4IRDA 2JEJA 1L3VA 5KT2A 1TGOA 4I7FB 3HJFA 4MKBA 2YV0X 4Y2AA 2E6MA 3ICLA 4F3TA 4NLVA 4K4YA 3KMSA 4FW2A 5CZ2A 3VQ8A 3L2WA 4R8UB 3LP3A 4R5PA 3C94A 1QE1B 3PO4A 4U6PA 1HNVA 1O1WA 2HWHA 3PV8A 2CKWA 3BSNA 3I5AA 4RW8A 3QESA 4MQ3A 4CF9A 5DQHA 3RB4A 1RT2B 4RW7B 4CJFA 4W5TA 4IH7A 2GV9A 1K1QA 3PX0A 1JLQA 2WRMA 4FLYA 2X74A 1B92A 5F8LA 3VQBA 2NUBA 3ZCMA 1BI4B 4NLQA 1WSJA 2XO7A 2QV6A 4OPJA 1TL1A 4B9TA 2G8KA 4FJNA 1N6QB 1JL1A 5HRSA 2R2UA 2FVPA 1HYZA 1L3TA 1NOZA 4CGJA 5KT4A 1RT6A 1LW0A 1DTTA 2ALZA 4E0DA 3OJSA 3KLGB 3B6OA 3DLBA 2V4RA 4M3WA 2R2TA 3D28A 2DTUA 1QS4A 1MU2B 1Z25A 1EX4A 4E7HA 1EETB 1REVA 4BDPA 4TSXA 1TKZA 3ZT2A 1LWFB 1C0TB 2WONA 1N48A 4ZPCA 3L2QA 2D0CA 4O0IA 1JLAA 4DSLA 5KFYA 2G8WA 4ED7A 1SUQB 3TARA 5DGAA 1LV5A 3VQCA 3SYZA 1RA6A 4WE1B 4J9PA
chains in the Genus database with same CATH superfamily
2ATCB 4GV3A 4Z4FA 3SQ2A 2DTJA 2Q0RA 2QM1A 1N8RO 3EKSA 3KFWX 1E4FT 3TZWA 3VQEA 4A8MP 5HROA 2DYAA 3PR5B 2W7OA 5LMNJ 2R7VA 3PNIA 1SIZA 4CGGA 1BISA 2MSTA 1FK9A 2RU9A 4Y00A 4H4MB 1ZM4A 4CHQA 1RTHB 1UETA 4C3MA 4C2MA 1ITPA 1RDUA 4BRPA 1U25A 4OZ3A 2NRXA 3FSYA 2V5HG 4ED4A 2CQCA 2V9KA 5FJ4A 1RAEB 2IDEA 4DUZF 3G8QA 2V4QA 1SJ3P 3QZ8A 4NLOA 2BR0A 3VZIA 4K4ZA 1JLBB 5CHCB 1FRHA 3HZEA 3CJQA 2RQ4A 4G6VB 3FJ2A 4DPOA 3G6XA 2AT1B 4DG1A 4CW7B 5I3UB 3PTWA 3GCXP 5B0GA 3UPFA 1P8GA 2ZWHA 4YN3B 4RNHA 4DPYA 4TU8A 2QI2A 1N52B 1U1PA 4ATNA 1VOMA 4JB8B 2BX6A 1W25A 2ACMA 4OV6A 3V9XA 5A8WB 4GO5X 4EMDA 2PGCA 1CZBA 8RUCA 4CLKA 2Q36A 4ETZA 1Y9OA 3CCES 4PQUB 4M63A 1S5JA 1SKSA 4NPOA 4IOAQ 1XNQJ 1E6VA 2K3KA 4QPXA 2B3TB 1IKXA 1DJ0A 3K5OA 4B9MA 2HGLA 3I33A 4CO4A 1IKWA 4ZPTR 2R7XA 4RW6B 4Q2MA 2CZVC 1WACA 1Q79A 1WSVA 4C8NA 3K2PA 3Q8UA 2G9OA 1WOOA 2HVHA 5KFOA 2AIRB 2LDYA 4X2BA 2RJZA 3OV7A 5D4NA 1IBMF 2HF3A 2JVRA 4HVZA 1WTFA 3FKBA 2DR5A 5EWEA 2NS1B 3TSPA 3UNYA 2YJEA 2CWKA 5HLFB 1X4FA 3LQVA 2WTFA 5DMRA 4M5GA 4RG8A 4MKAA 5DRKA 2RNEA 1B4SA 4KE5A 2VL1A 2KH9A 1OH5A 3C15B 2PA3A 1V4TA 3CCJN 5A8RB 3P5JA 1JIHA 3KWIA 1B3TA 1FXRA 2V2QA 2VQEJ 4ZIVA 4O4GB 2FHKA 3Q0AA 4JK8A 3F44A 2NXUA 3CULA 3NS7B 2R7OA 4IO9L 3AD7C 2XS2A 4M5DA 1K73O 3UDVA 3DGPB 4KV8B 5EX5A 5I42A 4YOUA 3B78A 5KAKA 2RE2A 4QZVB 4F02A 2OTLN 3U02A 2V50A 4WQ4C 2XEXA 2RHKA 5AQIA 2AU0A 3F73A 3TRGA 1VQ4S 2GWKA 2DH9A 3QEIA 2BE2A 1VAZA 2HKEA 3C6HA 2ZZTA 4X64K 5L38A 3GJRB 3I8BA 2DCUB 3AAQA 2D0BA 4AQYF 2E1PA 1J9AA 1IKYA 2W4DA 3AB2B 3M6WA 3BV8A 4OI4A 4CF2A 3AVKA 1WG5A 2NRZA 2NQPA 4L72B 3MCMA 2EBGA 4H4KC 2D3O1 1REGX 4CTAB 1Z6RA 2CNKB 5IT9U 2G8FA 2XZTB 3PY8A 2E1YA 3J7YP 1KVKA 4DV2J 2GHVC 1KFDA 2QGFB 1RACB 1EIYB 5GIPA 1AUSL 1RT6B 1LW0B 4Z4EA 1YJNN 4NA2A 2CQDA 3RRGA 3A8EA 2N82B 4CEFA 2CPZA 4Q45A 4NCGB 1RT3A 3CXCR 4XAKA 4JI4J 2FSJA 2EWHA 2FSNA 4OL8A 3LAMA 3G4SS 2CZ4A 1CJUA 3GYXB 2E2NA 3PYEA 4LF1A 2LXUA 2EXUA 2Q43A 2N7YA 4H03B 4A57A 3WDOA 4UZBA 1E6YB 4CIGA 3F56A 2B7CB 2FZGB 1KONA 2IGIA 3WUHA 2DGXA 1Q7YT 4PRFA 4TU9A 3KKRA 3N6MA 4K0KJ 1QJHA 2YWFA 1VIOA 2KRRA 2N4CA 2MHEA 1FRKA 3OBIA 4LREA 5CAAA 1DFDA 4NLCA 1U24A 4F3OA 2JRSA 1ZZFA 1EWQA 2EC0A 5ELZA 5EN1A 1JNZB 4WTOB 1X7VA 2UXCF 3HT0A 2C22A 3MD1A 3TWZA 3Q83A 1WC1A 3D2EB 4PXCA 5GVQA 2ZC3A 2GFFA 3NF9A 1UW9A 3KLFA 4USMA 5AQWA 4JKDA 3KLIB 1NZ8A 1TUGB 4MT1A 4JI5F 1UEUA 2R8HA 1UWBA 3FFKB 4W92B 1HNXF 1Z2ZA 3KJNB 4M5IA 4OI2A 3MCPA 3ZLJA 2W24A 2FBVA 1VQNS 3DXMA 2WSEC 1IR0A 3TA2A 2XLJA 3EMTA 3A8JA 4EFAC 5H9EK 4CZEA 3B82A 2MQ8A 5CY4A 4ZVPB 3DJCA 3M1VA 4QWEA 1AFJA 5EWFA 3QFUA 3T5JA 3KKFA 5DG9A 5AZIB 2ZBPA 3OUYB 2JSXA 5K8PA 2BYCA 3IBFB 1YZ6A 3IAYA 3E51A 3U7JA 5CH7B 2E5IA 3VCDA 2H5EA 1R43A 1HQ2A 4Y2IA 5U47A 3P1GA 2AJ2A 3N9UC 1HW9A 5DGBA 5IV4A 2ZBCA 3BF4A 4HT7A 4URSA 1ZPVA 2G1HA 3AVAA 1NCLA 2ZH3A 3TJAA 4F8RA 4YR0A 2VWJA 4WP3A 2CVEA 2OAUA 4J2AA 2OANA 3KHLA 1EP4A 4QOTA 1QQOA 2GCFA 2EK6A 1KP6A 1XK8A 3VQ6A 3R1HA 4JI7J 1ELOA 4J2EA 3SUNA 5ETLA 2Y8WA 5C24A 4ZITA 3DM2A 4CIOA 4QPTA 3SK3A 4CLZA 4Q43A 1N34K 2PSZA 4ERDA 1QY7A 2DR8A 4WKRA 4C9DA 2UUCJ 5M1KA 2A1RA 4W90B 3Q89A 5E41A 2JEIA 2W8LA 4PY5A 3DOMA 2LEAA 2WK4A 5CXTA 5FPEA 3MDFA 1NHKL 4NXNK 2A0FB 1RBSA 3NF8A 4TY9A 4X4UA 3A5NC 2UYTA 1F3VA 1A9NB 2F63A 3TUIC 1KN6A 3F2KA 4H5VA 4CZKA 4JI1F 4DPWA 2EFGA 1EJ7L 2D5RA 1KLNA 4DV0F 4HUFA 2IAJA 2R7TA 1OYDA 1OYEA 3RBEA 1OMSA 1H0HB 5KFPA 2ZFHA 4BRKA 1I3OB 1URNA 3P38A 4AYBD 2RH3A 1Y64A 5M1QA 1FEEA 5GADP 4FLTA 1HNWK 2V63A 1ILYA 3MMCA 2JC0A 5IWAJ 3MOJB 2XZDB 4OX9J 5KFVA 5MLCV 2FVQA 1WC4A 3MN6A 1CJTA 2VG6B 2VCPA 4PG4A 1HARA 5AXLA 5DLFA 2AZ1A 5E2QA 2A1SA 4AL7A 3T5HA 3V6DB 2FD2A 2HF4A 3EGNA 2QFJA 4A2BA 4NXMF 2Z2ZA 3IAS9 3G8SA 3MWBA 4TYBA 4CZIA 4BDYA 4WCEQ 4B3RK 2XMWA 6FD1A 3NF7A 1LWEB 2DNOA 4BRMA 2OZSA 3GE9A 3E9PA 4JKBA 4K59A 4U95A 5LJ5Y 3DLLL 3MCAB 4KO0A 1X4EA 2IYGA 2QZ8A 5KFNA 5LSRA 3V9SA 1GFWB 4FPAA 3V4IB 2BJEA 1UOCA 1SL1A 4CJWA 1GAOA 3DLHA 1WEYA 2QRRA 1W0HA 2XMJA 1VRQC 2HWTA 4AF1A 3ENOA 4DFJA 5T41A 2QTWA 3OYEA 4DR1K 5CD4A 4DTUA 5GAEP 2MY8A 1SJ4P 4WFNQ 3JSRA 3HHLB 1S79A 4C8LA 3GSDA 3EYZA 4LSNA 3JYTB 3RAQA 2P9KA 2IM2A 2LECA 1G2EA 4X4PA 2W2OP 2HRYA 1LAWA 1S9EA 2VODA 5AE2A 1M90O 1FKPA 3K7RA 1RDDA 1N36K 5GMEA 1N34F 4RLEA 4DBQA 3R5JB 1S9GA 5A8KA 4CJLA 2W25A 2BOAA 4NLBA 4F2SA 3MOZA 1RHJB 5IXUA 4DUYF 2ZZNA 1UP1A 2M8HA 2G8VA 1G3OA 4YQWA 4B08A 4OYWA 2OTJN 2B9XA 3WQTA 3TX8A 4DQRA 3Q7BA 1WUUA 3H5UA 4ED3A 2H54B 4W5NA 2H3GX 5BREA 1BE4A 4ILGB 1CC8A 2QA1A 3MGJA 3PX4A 2KZMA 5M1PA 3C14A 1AROP 2AWZA 4LIRA 2X78A 4PA1A 4QWDA 2YX1A 4FJ8A 5HBMB 2RUSA 1LW2B 3T1YK 2DHSA 3ELHA 1HBOA 5AQUA 4CT9A 5FRNA 2YX6A 1XMOJ 2CJ9A 4LSLA 5H9FJ 4R8UA 3CMEN 4M3TA 1T94A 3GIMA 1FW6A 2V4JB 1YBTA 3AY9A 1IBKJ 4DL3A 3I32A 1RT5A 1KQSR 1ZA2B 3DI6B 5HJYA 4B3MF 1VQKS 1Q7LB 2DGVA 4CJ7A 2GA7A 2O8DA 2NRRA 2XHBA 2XC9A 2G0CA 4NLUA 4XO0A 5HP1B 1XI1A 3VQSA 4FS2A 4V19X 4OGEA 3HM8A 1OQ3A 3HHDA 5G4DA 1B9DA 2D69A 4MKYA 1NDCA 1XMBA 1EQ0A 4JS5A 4CESA 1RYRA 1EETA 1VQPN 4KR0B 4RBTA 3UE5A 5EU7A 4QIGA 3JXOA 4AL5A 2CQ1A 4GVBA 2QEXN 1GX6A 2HAFA 2HHHF 1HQUB 1NDKA 3DRRB 3TA1A 4IOAL 3L6QA 3WHIA 4ID1A 3ZT4A 4UZCA 4HACB 1JCFA 3SCIE 4CEZA 3DOKB 2ZWOA 1NU0A 5M2UA 3RJMB 3OTOK 2EFVA 1NM2A 1I6JA 2DPJA 4X62K 1ZAVA 2AYGA 2E20A 1ZBHA 3S9HA 4DCOB 1N36F 3K89A 3UD3P 4EIAA 1HPMA 4PKGA 3MM8B 1FKOB 4KI6A 1GX5A 2OH2A 3CCLN 3BBFA 3ZSYA 4CFAA 3W7BA 4JI0J 1YQHA 4YUDA 3DYAB 5GAGU 4LF4K 5KFTA 4TU7A 1X4CA 2VFUA 4YY3K 2ZD1B 2Z0GA 4I4BA 1UVJA 3IG1B 4DR7K 2DFFA 3AH6A 3AVCA 3EL2A 3E01B 4DV5F 4MFBB 3HI9A 1NUEA 1X3NA 4CLYA 1HLUA 4HI2A 3T1YF 1NBEB 1FRIA 4ZPDA 4PKDB 2JDJA 3U1NA 2VWKA 4MK8A 4ZPAA 1X4AA 2C42A 1RADB 2ITMA 2HYIB 4NOHA 3CF5Q 2OIHA 3H7HB 4BRLA 3IP0A 1DTQB 3QYYA 1UTAA 4IFEA 3H1QA 3IM8A 1R8BA 3TABA 4RW4A 3V2UC 2OA8A 5HMZA 4L75A 1HWKA 1SJFA 3CDBA 4M5HA 3PX6A 4TYAA 3J81O 3C8YA 3DRPB 5F8JA 1UFLA 4GVLA 2A1BA 3J80O 3HVAA 2MGZA 4CH7A 4DLGA 1IKVA 1XNRF 1NGJA 2UVRA 4KBOA 4C48A 5KFGA 3HFVA 1RCXB 2OCEA 4BC5A 4ZVRB 3K0SA 2PFDA 3L95X 4I2PA 1FRJA 1NMDA 2GTDA 1T7PA 4JYAF 4UY8T 4DQPA 5EHHA 4FM1A 4QIEA 3T1HK 2MQLA 3WX4A 1GK8A 3RMAA 5JVHQ 2EG2A 2YH1A 2YHBA 3G82A 3I56N 4NWBA 3R5AA 3M4XA 1HMVB 2XRIA 4ZVFA 3DWLA 4JI3J 4IQXA 1X9WA 4YDXA 5LT5A 4XPEA 4GKJK 3AD8C 1FFGB 3O9UA 5HN0A 4OGCA 2H4WB 4DV1K 3PR4A 1WF2A 5I3QA 1VCTA 4CJPA 5M1OA 3OYKA 1KLMB 1IO2A 1AB8A 3AA9A 3RB6A 3DLEB 1H74A 4ZP7A 2CZ9A 4J91A 4KHPF 2C1EB 1BOTO 2FJEB 1HKCA 3UNGC 3R27A 5B0CA 3OTOF 3IXQA 3GV8B 4DFKA 2BMBA 2FHJA 3MECA 3LM2A 4KV8A 4KFBA 1VR6A 2C28A 2WUSA 5KFXA 4ZKAA 3CYMA 3VV2B 3FEXB 4LFCF 3UKRB 1R0AB 4EBDA 4QBUA 2M88A 1NMNA 3TWHA 5J2PB 3P4UB 1TV6A 2HQDA 1P6TA 3J7ZT 4ER8A 4CH0S 3FRZA 4LF4F 2XNQA 1VRTA 2K7KA 3O2IA 4DSJA 1V4SA 1F3FA 2ZH2A 3RWUA 2AYMA 4CFBA 1BGXT 2VB6A 4BQLA 3W9JA 5ETRA 1BXNA 2OEKA 4IH6A 1OPIA 3V6HA 1NPPA 3TZZA 3VR1A 1FNXH 4ZPBA 1YIJN 3BBCA 2QA4N 3EXCX 5BRFA 1WNEA 2J6TA 5LMNF 2IC3B 4KQZA 5EOYA 1X0FA 4A4JA 4FW1A 1C0UA 4WFXA 1RYSA 3A13A 2AP1A 3C6AA 1UJ4A 1NKCA 2O8CB 3CIZA 4JNEA 3LWMA 4NYZA 4RW9B 4NCGA 2RVJA 4HUGA 3TSQA 1C4AA 3X1LB 3DNCA 3CD7A 3AO1A 4QIVA 4BRHA 2UUBK 4WQ5A 1GT8A 3ILOA 1UJ5A 2P6SA 2LEBA 3TR8A 1B99A 2B7BB 3K0JA 1YVFA 4QR0A 3L0QA 4BRGA 2O8EB 2JLEA 1RDRA 2A18A 3H3NO 2XWXA 2MKIA 1R8PA 1E6YA 1C1AA 1U2RA 1A5VA 3H5SA 3T1HF 4CLSA 3M8QA 1P90A 4TY8B 1WAFA 1JB0C 3GJQB 1L3UA 4U7UD 1I5OB 4GVEA 2UU9J 3G9CA 3MX5A 2NXCA 3MN7A 2X3GA 1O0PA 4F4XA 4FL9A 3CXCM 2VONA 2G8UA 3SPYA 3BH7B 3RAMA 2HBLA 3SMPA 2G2OA 3NNAA 4X4QA 5IM0A 1XNQF 4NE9C 1I3AA 3M8PA 2E88A 2B4PA 3AVMA 3UN5A 1RI7A 5RUBA 3OTDA 2YKMB 4B1XB 4EBCA 4OKEA 3HSDA 3ENVA 5J1EA 1S6OA 2YKQA 3GV7B 4ZLNA 2B9YA 2Y1LB 1WN7A 2QL9B 8AT1B 2PT0A 4KKOA 4DV1J 2M8DB 3OL8A 1ZBIA 4BR9A 2OEMA 3CJ5A 2WBNA 1KWMA 1NB2A 1XR6A 3BS9A 4EYIB 4FKXA 3HO1A 2L9WA 1EWRA 2APOA 1R8AA 3SQOP 3IR5B 3OBWA 4U67Q 2BE9B 4EO8A 1ZTTA 3FFIB 1M1KT 3MEKA 3P3DA 1HWJA 4WU2A 2MEWA 2B51A 1BA0A 4B3SK 2BEFA 2Z1GA 1ULRA 5AZIA 1HBMB 2Q3SA 3OUYA 3JAMO 3OYBA 1YK9A 2VQEF 1RT4B 3UDEA 2JH3A 3CCQS 5KG0A 4FYWB 4JK7A 4ZP8A 5T7BA 3AQPA 4JEPA 2HOEA 2GJ2A 4CE9A 4DPUA 1ITGA 2CJQA 3JTNA 4B3OA 1JLCA 3DOLA 4O44A 2ZVSA 5D15A 2VJVA 3W2WA 4C1NK 2WVEA 4UOHA 4N76A 4HYKA 4H54A 2W2QP 4YOWA 4ED8A 4KI4A 1RAOA 3FVYA 4QR2A 4HTLA 2XWYA 4J8FA 1RK8A 3ZT0A 1RLDA 1PJ6A 3L4IA 4BR5A 3MTJA 1X8DA 2GO9A 4J9MA 1CQMA 2WSCC 2PBDA 3PJXA 1C0FA 4UUXA 4EAHD 3JTPA 1M5OC 1U6BA 1BG3A 2EEYA 2O4GA 3O4QA 2GIQA 3KUEA 4WCEL 5HATA 2MHNA 1BI4A 2DGQA 1WC5A 4RR5A 1S59A 5CABA 1OY9A 4DV2F 4BCAA 5JS2A 3NHGA 1N6QA 3DLRA 2YWWA 4BRAA 1RWUA 1L5UA 1ATSA 2XYPB 2NRHA 1JMTA 3BREA 1DT9A 1WHXA 2MZJA 3VHQA 3SFUA 1LOTB 1VQ4N 3NAHA 3TUPA 3EY1A 4DR5J 2IM0A 2WVDA 4JI4F 2HBZB 1Q8IA 4LH4A 1EQYA 1HUXA 4C98A 2E5LJ 4WFNL 1K44A 4X4NA 3FSXA 4DXLA 1SI9A 5L9XA 1KFSA 1OSCA 5HL7L 4IR9A 1NOYA 1PYSB 3QEPA 4C1NI 2DHGA 1SUQA 3A2FA 1EKSA 2YHWA 1HBNB 3N5FA 4LBIA 5AJ3J 4WE1A 4WIIA 4KY3A 2P8IA 2NZTA 3SEOA 2G8IA 1FRMA 5F8NA 1UEVA 4KB7A 3LF0A 3VQ9A 3MEDB 4H5TA 4K0KF 4QWBA 3MR5A 1BLUA 3HRGA 3THYA 1FO1A 3EE8A 1WWHA 5D4LA 1FJEB 2FSKA 5F1XA 5C25A 2AF6A 2Z2YB 1U7LA 2J0XA 3LDSA 2A2DA 3Q2TC 1SIWB 1Q81O 4ECYA 2FJVA 2EKYA 2QWNA 3QINA 3G4SN 4DSKA 2VFRA 3CEDA 4B9LA 4IKAA 1DQAA 5KFLA 3C65A 5AQJA 1N5YB 1G1XA 5AQOA 3SBGA 4WXWA 4XK8C 3J7YU 1WKKA 2QWQA 2E5JA 3RBZA 3VAMA 2MKCA 3KOAA 3N01A 3SDEB 2BABA 1HQEB 1U1MA 2FQQB 5ETQA 2QTDA 4ISFA 4R79A 2KKHA 9RUBA 3WXJA 3CCTA 3NEKA 1LOUA 1MNEA 4FZZA 2AV5A 3M30B 4C3LA 5THWA 3D45A 1NJYA 1GMUA 3JYTA 2F4VJ 3H4DA 1S99A 4DPTA 1RGIA 4ISGA 1S1VB 2CNNB 3D6RA 3C16B 3SJJA 3D4JA 3LGNA 3FSIA 4DV3J 2I5JB 3ENBA 2Q1NA 2BJ1A 2EC2A 5D4OA 4IFYA 2HQ3A 4RUHA 1EX8A 5D77A 1B0VA 1TL4A 4E1JA 3DRXA 3BO3A 4O8KA 2YH0A 3UDLA 3PRBA 1G99A 1SH0A 3NE6A 1JQGA 3W63A 2UXBJ 1VQNN 1OH8A 3ISND 2XI2A 3MK6A 1N8RT 3RG6A 3CJAA 3S7RA 2GGPB 4H5NA 4OZLA 1LW2A 4WJBA 5DG8A 1SAZA 3PCOB 3S3NA 4JI7F 2MY7A 1FVQA 4DQ8A 3GQCA 1IBCB 4BS2A 4FWPA 3SQ0A 3G87A 4AHRA 3VQ4A 4AM7A 3CB4A 5L1JA 3V1RA 1SB6A 3C0BA 1S72N 4I1TA 4P2FA 1IM4A 4FLWA 3MFIA 2F1FA 5KT2A 2HLTA 1VDHA 3J7AP 2DNMA 3NWGA 4MKBA 2YV0X 2CQBA 3D7EO 1X4BA 4F3TA 1RAHB 4ETXA 4K4YA 3KMSA 3VQ8A 3LDPA 4KJIA 3TTFA 1JCGA 1QE1B 3OTCA 4GY2B 2HWHA 3CC2S 4ANDA 3LGHA 1NGFA 3LDQA 1RT2B 2DITA 4W5TA 2DCLA 3G71S 1K1QA 4JV5J 2DD8S 3GR0A 2NUBA 4PABA 4OX6A 3DU5A 3MMBA 2H51B 1GLDG 2XO7A 2QV6A 1TL1A 1YTYA 2G8KA 3BUZB 3CF5L 3GSIA 1RAFB 5IWAF 2FVPA 4OX9F 2YKPA 4DMZA 2F9TA 4CZHA 1VC5A 2XMAA 1DTTA 4E0DA 3DLJA 3DLBA 4LF2A 5K8OA 4FO0A 2DTUA 3BBBA 1FWLA 4I6MB 4E7HA 3CC4S 5MLCQ 2FHJD 1UCNA 5DM6Q 2MPUA 3ZT2A 1LWFB 2O8FB 4ZPCA 3TZXA 3M32B 1PJ5A 3BGLA 2KJVA 4P75A 2PEBA 3W2VB 3GP9A 4Z2XA 3SYZA 4DR6K 2L9NA 3MM8A 1FKOA 2CJAA 2AGPA 1NJWA 1YRUA 4EEYA 3KK3B 2JVOA 1WSEA 2HIYA 4IRKA 2CG8A 1TL5A 2V8GA 2QLBB 1AZSB 4FVMA 2QLJB 2ATLA 2G2ZA 1X9SA 3AD9C 4IWVA 2E4LA 1CEZA 2COLA 2GX8A 4WIQA 2GVZA 3QGGA 2JWKA 4CHNA 4JI8J 2LA6A 2O01C 3FE1A 2E9ZA 4FJJA 4RO0A 4MFBA 3I0SA 1MG7A 3Q22A 2O66A 3SAFA 2FY8A 2OO4A 1K73T 1HR0F 4JV2A 3S41A 3MMAA 3BSAA 1V5VA 3J81U 3LH2S 1D1UA 4X66K 5IC4B 3VGLA 4RBVA 3BEXA 3J80U 2ZDOA 1UAWA 2X1BA 3CG7A 1DTQA 3ZZRA 3DHXA 5LJ3Y 5GADU 1CJKA 3H2VE 2Y1IA 3D1QA 3W64A 2D1KA 4CLUA 4F0MA 2DNQA 1T0TV 2F40A 3KHHA 1HYSB 1SJ1A 1JJ2M 2HFUA 4M42A 1C1BB 2Y1RI 1YJVA 2ROGA 2OP5A 1TYQA 3ZSOA 1WHYA 4RWTA 4FVUA 2VICA 3CPWM 3S01A 3SLCA 1A6LA 2OPRA 5HQMA 2B8QA 2J6UA 3W3DA 3TTCA 3HYFA 3J8AA 1XMOF 1U8SA 1QLNA 3ENHA 2FVSA 3HPGA 4BBYA 3MEGA 4DTRA 2GMJA 1R0BG 4XTTA 4IH5A 3DMJB 4HI1A 4USJC 3KJQB 4AL6A 4ELVA 3OYHA 4DL0C 3TAMB 2G8HA 2VPXB 3TEGA 1WSGA 1UPMB 3O3LA 1RDCA 1N32J 1KLMA 4BGBA 3AOCA 3H2LA 1T02A 2X51A 3TAEA 2DNYA 5GAEU 4CLLA 5F9LA 3ZNUA 1ZBUA 3E9OA 3WQPA 4FOEA 1U09A 5AQPA 1EHWA 1NGDA 3NCIA 2QLWA 1WKJA 4IUFA 3LZJA 3D6FB 4GC7A 4BDZA 3HSGA 5GMDA 3U1LA 3HFZB 4B9NA 1WUAA 4X65K 2ZH5A 1TL3B 1VFJA 3LP1B 4FXVA 4JKGA 3PHEA 5ETVA 5B08A 3A4TA 4KHUA 3D7SB 4LF8K 4LF5K 1CZAN 5J2PA 3SBTA 4L3QA 4OYZA 3PACA 2EFNA 4M41A 3MM6B 2ILZA 3H40A 5DLGA 3AVNA 1R7IA 3CD5A 2AP6A 4CF8A 4WQ4A 4JV0A 4RW8B 1WTBA 1VQKN 1VYAA 2NSCA 4NEZA 5JLHA 2Q66A 3FCVA 2Y8YA 3D9BA 1EXQA 2C3YA 1JLFA 3PYDA 5LOQA 4P52A 3ZETA 2CJKA 3E3XA 2YHYA 3CCRN 2D3ZA 2O8CA 4KGMA 4H4KA 1X4DA 3WC2A 2C3UA 2I8EA 4V19J 3MTKA 1NO8A 4YR3A 4EZ9A 4CEAA 3PSIA 5E0OA 3HTVA 3IWLA 4C3KA 4JI0F 4M7YA 2CAJA 3F9MA 4CERA 4FYVB 3C7NB 5AQKA 1BQXA 4Y1CA 4LFAK 4MIAA 4CO1A 2FF6A 2I7NA 2KFYA 5KGWA 1WNSA 3MEEA 1NGGA 1RHKB 2QKKA 2VDIA 4USWA 1VHXA 3FGVA 4ES2A 1RBRA 4DS4A 3CO9A 4DR4J 3FMWA 2V8PA 4OJGA 3HPOA 4TY8A 1CULA 4S0MA 4ZCIA 3T19A 3OYGA 1SBRA 3H25A 5HROB 4DZ6A 3LGMA 2HHTA 3U9ZA 2HZVA 4PXBA 7FD1A 2D7SA 2DPIA 4A46A 4DR2K 1EKRA 1FK9B 1WI8A 3KJFB 4PPDA 1QAJA 3D1OA 3QSYB 2RB7A 2DPNA 3VQTA 4QIWD 1Y11A 2OLWA 1T11A 4KB0A 4K2XA 3UR3C 3R3LA 4B1YB 2MZQA 3VAFA 3PJWA 2R4FA 2VQFK 3HLUA 1R89A 5BR8J 4NYOA 2MZTA 1VQ5N 4LT6A 1F2HA 4AHUA 3OW2M 1N33K 4YDUC 2AJ4A 3PO5A 5CYQA 3MM9B 3VF4A 2FC9A 1FHTA 4DV4J 3TW0A 3OL9A 1QAYA 2OPPB 1VQLN 1ZYQA 4DG1B 4F50A 1KHWA 3CGIA 1OSDA 3NVKA 2KHCA 3QMLA 2IA0A 2GHPA 3G96A 1FDNA 2J0WA 1EQMA 2NRVA 1SC3B 3M5RA 4AH9A 3TAGA 3FZ2A 1D09B 1HBMA 3D6TB 5JS1A 4XIUA 4DR3J 1NK8A 1VSKA 1RT4A 2V2VA 1WEXA 4Z4IA 4N77A 3GIKA 3KUGA 4FWOA 3BKTA 4GKKF 3R5GA 1X3MA 1WC3A 4L73A 3T6BA 5M2RA 3HMJG 4ED1A 3V9ZA 1IKWB 2O5DA 3QEXA 4E1NA 3Q8QB 1ZS6A 4U7BA 1SCJB 1FDDA 1RISA 2CJYB 3EUNA 3CJ2A 3NG8A 3TEHB 2JX2A 2FJBB 2VH7A 1LXNA 4ZJLA 3DLKB 2HSTA 4Q7AA 4CLTA 4C97A 4YB5A 5I3PA 2HVIA 1LEOA 4CO2A 1B0PA 5D0GA 2PFUA 3TAQA 4YOVA 1X4GA 5BN8A 4F67A 5JXSA 2WOMA 5KFHA 2AQ4A 3ZXWA 3DRYA 4ZK7M 2W9BA 2R8KA 4LF9K 1AYEA 5DJBA 3OLBA 3P6YC 4OFZA 5H1SQ 2KB2A 4OLAA 1NU4A 1L3SA 5LXYA 2OZMA 1YSJA 3ILLA 1MA9B 3NMUA 3PRDA 1N54B 4HUEA 2X1AA 3T6JA 3W8PA 3KWMA 2X3DA 2KFZA 3LPEA 4M5DB 1U2CA 2PI4A 5I42B 5C2DA 2KT2A 2ZC4A 2HEKA 2GUPA 2KLAA 1K6YA 3G2XA 3CDWA 4HR2A 4HCBA 4J9VA 1YG0A 3H6EA 3KHRA 4FWQA 4WK1A 2BE2B 4C0HA 4NCBA 3JS9A 1M90T 3RW6A 3NCRA 2NXNA 1RJJA 5ETPA 3MUTP 4AHTA 3CJTA 1HBNA 4FJMA 4MYUA 4B9QA 3SZ2A 5BYRA 4AXIA 1VQMS 2GIRA 3HPHA 4J2BA 4KHMA 2YNHB 4LC9B 5BRHA 1TELA 2DO0A 2HRTA 1T44A 1NPKA 4ECXA 3MEDA 4E3SA 3VAHA 2RE1A 2B4JA 5EXWA 4CBXA 1F5AA 1FXLA 2UU9F 1WOPA 3V6JA 4H0TB 2LU1A 3VTHA 2VQFJ 4I9QA 1C1CB 5MAOA 1CPZA 1QQNA 3U4LA 3W60A 4BRFA 1IQTA 4N5SA 3OR1A 3QSIA 5IT9O 3QERA 2B43A 3D3BJ 2HNDA 4EFHA 2JHEA 3CCVS 1J54A 3MPUB 3AAPA 4ISEA 1Q4RA 5KOXA 4K42A 3C2PA 2QG9B 5EX0A 1FJ7A 1U45A 1T95A 1DKGD 2VFSA 1Q18A 1N5YA 3VGMA 3CERA 3EO3A 4DJBA 5GAHI 1C0GA 1YUWA 4FP9A 2V68A 1D8YA 2Z1HA 2RDIA 1V9OA 3SUQA 5LM7E 4WF9Q 4CK2A 2WVBA 5FPDA 2KT3A 3VAIA 3VQQA 5KT3A 4PG6A 4QU7A 4Y2KA 1T9TA 1GLAG 3C16A 3VEYA 3DN9A 4P71A 4IFVA 3VGVA 4LF9F 4JHDA 5FIIA 3EX7B 3TQ1A 5AXMA 4OV1A 2PIIA 4OJ1A 3OYMA 4JAXA 4NLGA 4H4OA 1VQ9N 1NAQA 1NBWA 3IA0A 2ASYA 5C2CA 1S0VA 2ZH9A 4LR8A 3MN5A 4B1UB 4CHYA 4OZ5A 3KLFB 5KGXA 1U48A 3KD5E 4FS1A 2XY8A 5E33A 1UWBB 4OYOA 1N5SA 2PO4A 1P1LA 5DM6L 3NXZA 1S5ZA 3VQPA 2O8BA 3DXMB 3N28A 4E7IA 1NJIO 3NBPA 3NVMA 2QL7B 2BUNA 3WIVA 4LF7K 3ETMA 5I9EB 3M1VB 3CCQN 3JAMY 3U3GA 4K43A 5LJVA 3W3SA 3A3OB 5BR9A 4DUTA 5AE1A 3OPKA 4DV7J 1HNZJ 4QS8A 2EI5A 4BR0A 1WG4A 2XYGB 3M2RB 3D5MA 4BQZA 3RMDA 3OHRA 3BYPA 2P9PA 2CQ4A 2VG5B 1H7XA 3QDKA 2IDLA 3T9ZA 3E1YA 4AE5A 1M5SA 5KFDA 4C8MA 3K2YA 2PC6A 3L2VA 1U8WA 3AGRA 2UXDK 5EWGA 4DR5F 1QDUB 1VMBA 3BN7A 3R9PA 3HVRA 2E5LF 2DH7A 1KTQA 1Q16B 2VPYB 3FZHA 1P9YA 3QGIA 3OA9A 1FTRA 1TK8A 3FBCA 1EP4B 2L3MA 4OZ1A 3NH2A 5AJ3F 2DISA 3IGNA 3WNGA 3GG4A 1NHVA 2JZ5A 2ZGYA 2HHPA 2LXIA 2C2OB 5CD4H 4PKIA 2QE5A 5C24B 4G1PA 4EHUA 4L3NA 1VBZA 2DB1A 2BTFA 4PL8A 4NLXA 1Y5LB 3BPSP 3TAPA 2QWPA 2BRLA 3CJ9A 4CEOA 4F4KA 1HD1A 1RCHA 2RS8A 2QLFB 4EP5A 4IOBA 2CVIA 4DMNA 1F6TA 5AQMA 1LWFA 1FX4A 3DOMB 4B02A 4I9LA 2O8FA 1GLFO 2HAIA 3QEWA 2CGJA 5D4PA 3M32A 2Q3PA 3FRYA 2QK9A 2BOPA 2LQJA 2EX3A 1F60B 3W2VA 4A5AA 2A2CA 3ZC4A 1QM9A 1MWKA 5DDOC 2KKZA 2DNZA 2DY4A 4JI2J 4A8YA 1J53A 4A61A 3KK3A 2P9GA 2IAJB 2WONB 1XMQJ 3QT6A 2ETJA 2UUAK 3NWRA 4I68A 4GRSA 4P2SA 4KH4A 3THTA 4FSVA 2DGOA 4JRPA 5KQ8A 3ZSQA 3LTOA 3G6EN 4KIAA 1GMWD 3RTVA 3BH6B 3MMCB 3NP5A 2V7YA 3KWGA 3CWJA 1CJTB 2B5JB 1CZ9A 4CJRA 5C7PA 1YITS 2L08A 4QW9A 1P1TA 1NGHA 5SUHA 3RRKA 4A59A 3JQJA 1GLCG 3UB5A 1IQZA 2OMOA 4MDAA 1B0TA 4K8ZA 2UZAA 2D3UA 4RJVA 3IR7B 5IQ6A 1MMLA 4DV3F 1WF1A 4FJ9A 3PLAA 3V5RA 2MZSA 3NY0A 1Z4UA 4JI6K 3KYLA 1K1SA 3GFXA 1ZM3A 2ZJQQ 2HB5A 2FLOA 1FDBA 4USVA 1HYSA 1RHRB 3RRHA 9ATCB 2YPYA 5T7LA 2GVDB 2M9KA 1VRUB 1C1BA 4IEEA 2AX1A 2UXBF 2QO3A 4LFBK 2A3JA 2VKRA 3J7AN 2ZQBA 3QB0A 2AX0A 4DL5A 3NH1A 1J27A 4PYAA 2HZCA 1VQOS 3GYNA 3CCUS 4BE1A 3SQ1A 4J9KA 2W40A 3TTDA 2IVMA 3OTBA 4LSNB 2H4YB 2P9KB 1FKPB 1HNIB 3M8WA 1JJCB 2QC3A 1RWOB 2OSRA 1WKLA 1NMEB 1WC0A 1U4BA 2JWNA 3NCQA 1S9GB 2E7WA 2RAQA 2NCKL 4BRIA 3D67A 3QICA 5AQVA 4B3TJ 3VGTA 3P31A 4FPBA 2ZITA 3BQ0A 2LA4A 1RAIB 4DUZK 3B6BA 4Q8EA 1JKHA 4Y1DA 5KT7A 4ID8A 1VC0A 1WSFA 1HKBA 3MR2A 2F3JA 1TL3A 4WTYA 3C14B 2JGUA 3V81A 4JV5F 3IMQJ 2Z2MA 2FPHX 2MYFA 4MK9A 3ALYA 4F36A 2FC8A 1JLGB 5B0EA 2XY5A 3CTRA 3DDNA 4OX8A 4TLRA 3CUNA 3S3OA 2CQPA 3R6MA 1HBOB 3SFGA 5AQTA 3WNFA 3QJJA 3RSEA 5KG2A 4LSLB 1Y97A 1H72C 1Z2LA 3CVKA 2PA8D 4KTZA 3RW7A 1IBLJ 2UVWA 2FBTA 5DM7Q 2XM3A 1VQ6S 4F0KA 3HSJA 2HBKA 4WFAL 4MTPA 3BJYA 2UVVA 3UI3A 3A5MC 3LP0B 4M5MA 1RT5B 1QAIA 2RQKA 3NKYA 4M95A 1UVLA 2XB2D 2XGQA 1KNZA 4X4SA 3H4BA 1CG2A 3G71N 1CS4A 1FRXA 3H3OB 2AZ3A 2GV1A 2E7XA 2D0OA 2ZOMA 2WZ1A 2O8DB 3VERA 2G2YA 4E7LA 5L1LA 4V1Ak 4EU0A 5KFKA 4LMZA 3BZKA 1RTJA 2KG0A 3SUPA 3GOIA 5AQNA 1O8BA 3R8EA 1IBMK 3MUVP 1NG9A 1C2PA 3O3HA 4QIFA 1FJGJ 2GUIA 1S48A 3OFGA 3S8SA 4CI0B 3I82A 2QW9A 4IG3B 2MTLA 3JQMA 4JI8F 3GIJA 2Q0UA 3GMGA 1JJHA 1IWAA 4GVBB 5FLXY 3CC4N 3O5BA 3HP6A 1IM6A 3OS0A 2NPFA 1YTAA 4K5SA 3L7UA 3R2DJ 4WXOA 5AT1B 2IY5B 1VJQA 4OPKA 1RZMA 4LQ9A 3QO9A 4JV1A 3CDEA 3T3FA 4FF4A 3UFCX 1D8ZA 4R25A 1SJRA 3LALA 1J6ZA 3ISZA 2N3LA 2HFOA 3NS5A 3MM7B 2DNHA 1S10A 2B9EA 3IC1A 1QSLA 1LFPA 1H1VA 1D5AA 3GJSB 4BC4A 2ZDPA 3H1VX 3O5TB 3R5DA 4OZJA 2HS0A 4DTXA 3LANA 4D3HA 2ZM6J 4LRBA 1GLJO 1ASUA 4FWKA 4FJLA 4AQYK 4L3KA 3BKUA 3OJUA 5F41A 1TUUA 3MR3A 3O3GA 2F8HA 3MM9A 1G6BA 1VQYA 2OPPA 3HBTA 5LMUJ 1Q82O 2DHHA 1KOHA 3GZ7A 4RKUC 3MN9A 3ZYYX 4DX8H 2XMUA 1MSWD 4K4WA 1OH6A 4RL1A 4NYPA 3THXB 2OSQA 3KUHA 5EUHA 4BG9A 5F0UA 4YHHJ 2R9LA 1N32F 3FNNA 4B1ZA 4HL9A 3NGDA 2D9OA 2HNYA 3PFOA 2BW7A 2BQRA 4RW4B 2CPHA 2D0AA 3UN3A 4CRJA 1WDTA 3NH0A 3TOQA 2E2PA 2QWMA 1BUXA 1OO0B 3P5TL 2FF3B 2ZHAA 1DHMA 3JSYA 2MGZB 4ZJOA 1IKVB 2DGUA 3K57A 2PYJA 4FVCA 1VJWA 1PG5B 3CJKA 3FR0A 4I2PB 2WTUA 4QCLA 4P7VA 4LR7A 2DRDA 2V67A 5HQ8A 3DLKA 5HQLA 2NRTA 1YRTA 1GLBG 1Q81T 1KHVA 3SCLE 2Z58B 1OKJA 3G82B 4QYZJ 3AO4A 1QZ6A 4J9UE 1PC4A 2CPDA 4BHQA 2CA9A 2M52A 2HVEA 4YOEA 1VC6A 3CFRA 2XLKA 4FJGA 4BACA 3BQ1A 3HOTA 2P51A 2OTLS 3HSCA 2NYIA 2UXCK 4RW7A 1TTHB 2J9CA 3KXDA 4LJMA 3S3MA 2A40A 1HD0A 2EG1A 4FYDA 4M3YA 1FWPA 1NKEA 2H5JB 1W26A 3ZEUA 3G25A 5AR0A 4QQBA 2FIUA 2ZHBA 4WF9L 1ZBLA 3QEVA 3MECB 2CJBA 4KFBB 4JI5K 2W2MP 1RU2A 1T9WA 5CZVA 3N5BA 4U9RA 2Z4PA 2AJ0A 4UQGA 1HNXK 3O6QA 2IM1A 2VJUA 2M5YA 1I94J 4I0WA 3C66A 5HRPA 2P9CA 2HMIB 1HI0P 1OIAA 1TV6B 2VBWA 3FZKA 1P8ZA 5TKYA 1Q9XA 1VRTB 1QHTA 4JLHA 2OEJA 4HWIA 1C0TA 1LKZA 3AHPA 3I55S 1YJNS 3O6WA 2YNHA 4DWIA 2OI2A 4YMEA 4DR4F 4P73A 4ALZA 3LWLA 1YBAA 3B8AX 4QYRA 2V8DA 3BGUA 5DS7A 3HJVA 3CDUA 2F8SA 3R1LA 4EZ6A 4PYDA 1Y4ZB 2YNFB 2FB0A 2P2CB 5SZTA 1C1CA 3EDQB 1S1UA 2Q1LA 1U0HB 4KH0B 4C8OA 4CZLA 2OFGX 1WSHA 2C3OA 5KFMA 1GTHA 1KSPA 1C0UB 2QFIA 1W2BR 4B9VA 5DG7A 3GU0A 4QWCA 2KL8A 1NLVA 2I1RA 3IS9A 1S77D 4IJNA 4LR9A 1TQLA 3M6GA 4KH5A 3HX9A 4FDFA 1F2GA 4G9ZA 5F0WA 1WB9A 3DLGA 1NH8A 4UUWA 5BR8F 3FDSA 4NO7A 2BANA 4CEQA 4FPIA 2FLNA 1YJWN 2XBPA 4DCPB 3I9V9 4DV4F 4DEZA 3VETA 2WW4A 3AO2A 4JUZA 6FDRA 2KYZA 2KXHA 2DFEA 4DKWA 3TAFA 1QTMA 2YNIA 1RKJA 1ZC6A 5HRNA 2KXFA 2CPFA 4ZCKA 3M8QB 1F9HA 1TUYA 3I31A 1M1HA 4ZLPA 1BCOA 4DFMA 4FWMA 2HGNA 4DR3F 1WBDA 1T3NA 1RHUB 5IS2A 5AQSA 3HKZD 2KHDA 4CYUA 4CO0A 4X4TA 4JI1K 2XS7A 5IM0B 5J2MA 3OSPA 2YCHA 3U6FA 4DV0K 3M8PB 1T3OA 3IRXA 2ZJPL 3AJDA 1GEHA 2DNRA 3TSUA 1SV5B 2UP1A 5J1EB 3L2RA 1N4LA 3AA8A 1VSEA 1RAAB 2ZH4A 2AGOA 1RGVA 4DZDA 2F9DA 4E7JA 3VA3A 4BE2A 4KKOB 3KLEA 2WSFC 4E2FB 3LA0A 3OVSA 3GV5B 2W9AA 1Z26A 4XPCA 4OJRA 1KCFA 4MYTA 3QIDA 3GR1A 2J7KA 1Q78A 4LIWA 2KZZA 1D9AA 1X9JA 4FNIA 4UY85 2VWBA 1SKRA 3K59A 1HJRA 4NXMK 3PW0A 4K50A 3ULDA 1U2FA 4IQMA 2VU5A 1H98A 3PIPL 1YVNA 4KBIA 1G4CA 3M2RA 5AFUA 3G86A 4NRUA 5GAGI 2VG5A 4X64J 3R6GB 5ADXA 4P2MA 1NXIA 2ZNYA 2P5OA 3CMAS 4B3OB 1JLCB 2NRWA 3DOLB 4O44B 3I4PA 4JRQA 4W5OA 1L3VA 3W2WB 3UE2A 3US5A 3KNGA 4I7FB 3HJFA 4ES3A 4NA3A 3NRBA 4NLVA 4BLGA 4B17A 2J8SA 3C94A 3ILIA 1HNVA 1NEEA 2CKWA 2RD5C 3O8WA 4K41A 3QESA 3W61A 3O1WA 5AZJA 2PAVA 4E98A 3EE9A 2E29A 4IH7A 1CJVA 2GV9A 4X84A 3FK4A 1JLQA 3VQBA 1QD1A 1BI4B 1WSJA 3R5CA 4OPJA 3MPYA 1VI7A 4FJNA 2OHDA 1N6QB 4DUYK 1MWQA 5HRSA 2R2UA 4WKYA 1S22A 4M5NA 2IBOA 1NNEA 2HBJA 2EK1A 3LO3A 1U26A 2R7SA 5BN9A 4OI6A 3OJSA 3R1XA 2IJRA 2Z30B 4CD1A 5E26A 4M3WA 1RHQB 1X60A 1QS4A 2JLFA 2J8AA 1EX4A 1GLLO 1XEZA 4TSXA 3EM1A 2ZGZA 1TKZA 3U1MA 2DY9A 2WONA 1J2VA 1N48A 2KM8B 2D0CA 4O0IA 4DSLA 5KFYA 2G8WA 4ED7A 1SUQB 1V3SA 2DXFA 3RVCA 3D3CJ 1LV5A 3VQCA 4WE1B 2ABYA 3O1LA 1NSPA 4BRDA 1VSLA 1R31A 4J9LA 1DLOA 1ZPWX 4I2QA 3HD2A 5BXIA 3CD6S 2B5JA 3VN5A 5AQYA 4ECSA 3GJTB 2NSBA 1PYOB 2UVUA 3EPIA 4ZVUB 5FDLA 3THYB 5J2QA 3MAAB 2ZBIA 4B3MK 1Q95G 1JWWA 4ZVEA 5C25B 5IT9Y 2J9DE 4KHNA 2Z8QA 2DEJA 1VHFA 3VEXA 4CLFA 2YX4A 4KPCA 4DL6A 2MJUA 3QQCD 1LWCA 2E1ZA 3V1OA 4FF3A 3P5BP 3H42A 1QQMA 3UD4P 4E7KA 2GAHC 2GVDA 1PJ7A 5H9EJ 2EFOA 1VRUA 3CJ4A 1Y5IB 1W9HA 4DF8A 2CPEA 4KRFA 4ES1A 5AXKA 4FBUA 3M8ZA 4C8ZA 2BKPA 2E8AA 2DVIA 5DM7L 4PQAA 5C12A 2MB0B 3WC0A 3TVYA 2HHHK 3VOVA 1CC7A 1JJ4A 1U02A 2LLZA 3LOUA 4CM2A 4ILRA 3C6TB 3PDNA 3TVZA 2QL5B 4LBPA 3I4HX 1GOCA 2EVZA 2ZJRL 4OHYA 4Q8FA 3THWA 4YB1P 2RDDA 1YTUA 1T03A 1WHVA 1HNZF 2IPOB 1KQFB 1HNIA 1N5VA 4IG0A 2PYLA 2ZE2A 5ETMA 4FJ5A 3SAGA 2AGQA 4ITSA 4NEYA 3ETOA 1XWLA 2CQIA 2XO6A 3WZ0A 4CO3A 1OQ6A 3ZFVA 5CZ1A 3T41A 4Q5VA 4IFYB 3VENA 2AW0A 1TKTA 3MX2A 3ZZYA 2BDPA 3BY5A 4MLEA 2GQQA 4C4WA 3FGUA 5K14A 5K20B 4Q44A 1GXLA 3E66A 3MAQA 1N34J 1IG9A 3FEYB 4NZ7A 3NGUA 1XHXA 5K8NA 3RBDA 1IG8A 2VUGA 4DV5K 4EWTA 4HHTA 2XMTA 1JLGA 2MZ1A 1UZHA 2E5HA 2WCXA 1M5PC 1WJ9A 5AQHA 2GEMA 1NRKA 5HSPA 4NXNJ 2VA2A 5D0RA 4GC6A 4DU8A 4I64A 3IO1A 2ZBRA 2HQCA 2A6MA 3BR8A 3ZTQA 5A2QU 2DIVA 3NGSA 4KGZB 3W0LA 2FJWA 4AILC 4QS9A 3QRPA 5F8HA 3OFHA 1YGYA 1FE0A 3EWGA 3LP0A 4UOCA 4DU1A 4CM0A 5KPTA 4O3OA 1J5EK 1YLXA 3HSZA 2VGMA 2JEGA 1ATRA 4ZVOB 1KD1O 1HNWJ 1XNRK 1JXEA 2BM0A 4WZQA 5F2RA 3TQEA 5CA5A 3ZSVA 4IZ9A 4BR4A 1XMQF 1U2VA 1T05B 2J5AA 1KS2A 1DBDA 4JYAK 3QGPA 3H45C 4RUBA 3MMBB 1Y10A 5CYMB 4FJKA 3LW5C 3BYRA 2KI2A 3DXKB 1C0MA 1TL1B 1UZDA 2FVCA 4OIXA 1MN7A 4C7QA 4CGHA 3DFEA 4Q0BB 1DAXA 4NLTA 3M6XA 1E4GT 4IG3A 1S0NA 3EN9A 2X1GA 5EVZA 1BL3A 2IMOA 4USIA 2FZKB 4E8UA 4PG7A 1GLEG 2AYEA 5B0FA 1NPRA 4B3RJ 1MN9A 1Q9YA 3NAIA 1XN9A 1M5KC 1DTTB 4CDIA 4WWSA 3PW4A 4ID5A 3ZO7A 3QIPB 4KHPK 2QJ3A 1FCAA 3NCPA 3Q8SB 3AVFA 1T3VA 2YPZA 3KJVA 3M7VA 3NF6A 3V9WA 3GILA 1NSAA 3L4BC 3FLCO 2RIJA 3QIOA 2HHHJ 4DV6K 4LF6K 3MPDA 3MM7A 4BRNA 1VHIA 3W5ZA 4DR1J 5E3QA 4AD6A 2ATQA 2XTJP 4LFCK 2V8HA 3EZ5A 1PBAA 4CK3A 1DARA 1NK4A 2VBXA 1Y0HA 1JJ2R 4AXJA 4CEEA 3P49B 4C0OC 5IC6B 1N36J 1YITN 1N88A 2FVRA 2GVZB 3OYDA 3LM9A 2RILA 3T69A 1XQIA 3ULEB 3HHLC 4KHQA 1RHMB 3ENAA 4J9RA 2XHCA 3I0SB 2ZWPA 3CPWR 4ZS6A 4RBUA 3AOAA 1YI2N 3MMAB 2Y0BB 2EHGA 5LMNK 3GYGA 2WC9A 3ZZZA 1NKBA 4RNOA 3THXA 1E3MA 1S6UA 2MQPA 2IHR1 2W4PA 1XC3A 4YDUA 4CD3A 2Z1JA 1NWKA 2OGUA 1A0OB 2C2NA 1S4EA 2OD4A 1FXXA 3C3LA 1CJKB 3TJ9A 5GINA 1ASVA 4B3TF 3T1YJ 1U6ZA 2P9IA 4AHCA 2OELA 1J5EF 3VZHA 4BR7A 1HHTP 3KD1E 3A8KA 2CADA 2AYBA 3BDPA 3I56S 1B7FA 1TYQB 1LXJA 2IJNA 4USUA 2IYIA 4A8FA 3CD0A 4LY7A 3UQSA 4DU4A 2YWGA 3CJ3A 5F9NA 1HBUB 3WQUA 5D0EA 3CSKA 3CJ7A 5TKWA 1S9FA 2OPRB 4WFZA 4ILLA 2O3DA 3SPZA 3UO0A 2H1YA 4CFDA 3ENQA 3SQGA 4G1QA 3MEGB 1IBLF 2Y1JA 4ZPWR 3SI8A 3CC7S 3J7YI 4DL2A 3N6NA 4FJ7A 4DX6A 3O80A 1BIUA 1XNQK 2DFHA 3MM5A 2F96A 3DLLQ 1D4XA 5JMVA 3LAKA 1UMJA 1YJTA 3OYJA 5D78A 3M8SA 4CZFA 1TAUA 5KFEA 2BRKA 3AVIA 1LK7A 3M2VA 4XH5A 4QWAA 1HPZB 3Q23A 4OHXA 3NGIA 2E1CA 4Y0WA 3D66A 5IOLA 5K9FA 2FGOA 3FZMA 3BQ2A 4KHWA 4DV6F 4LF6F 5KFFA 5C2GA 3JXUA 4NYNA 3CJ0A 4QAGA 5JVGQ 1MROA 5JMNA 4KHPJ 1H73A 4JKGB 4AT1B 1RBTA 2NZCA 1B7YB 4EHTA 4YORA 1FJGF 1S1TB 5EX3A 2RT3A 2HMIA 3OTOJ 2D0PA 4AHSA 4X62J 3U8XA 2MQQA 2LDIA 3W66A 1YIJS 4M5JA 2QA4S 1FFWB 2GWJA 1VQ6N 2HVZA 2R7YA 3GG1A 5G0RA 2R7UA 2VQEK 2O1PA 3GB0A 2VYPA 4IOCQ 2VFVA 1BIZA 4KAIA 3MCNA 2YNFA 4O55A 5LJWA 4IXCA 4M3RA 1RAJA 1NSQA 4OKKA 1U0HA 4LF4J 1JLFB 4MIWA 3C46A 3JS6A 4MLHA 4K25A 4M7XA 4H8KA 1OY6A 3ZETB 5CHIA 3PYFA 2C3MA 4YY3J 1YDLA 4HLBA 2CQ2A 1QAXA 3POTA 4DR7J 1RBAA 5HANA 2P9LA 4A2AA 4KHSA 3KLHA 2BZ2A 1GOBA 3UCUP 4DSFA 2PN6A 1NJIT 2Y3YA 3BN4A 1IUJA 2GX9A 5C2FA 1KC8O 2E5GA 1YRXA 1S6PA 2ZM6F 3BPDA 3LDOA 5ITHA 1NDPA 1RT1B 4J7CA 2K8GA 5IT0A 1X5TA 4L6V3 5IFMA 1KVBA 2XY6A 5KFUA 3Q8YA 3LP2B 1PGZA 1PILA 3MEEB 3UD5A 1YAGA 3OW2R 5LMUF 5CCLA 4CJKA 4CJQA 4DV2K 4TVAB 2BQ3A 4A8WA 3R9LA 3KK2A 5HVGA 2AJ1A 4BGAA 1S6QA 1NNDA 2DR6A 2DNKA 1CULB 1KTVA 2FTRA 4DQIA 1JLEA 4QS7A 4YHHF 3FBFA 2ZH8A 4IEIA 1W2BM 4CJEA 4K5RA 4JI4K 1BD6A 2QX0A 4IRCA 4ECQA 2W9CA 3GLJA 3T1HJ 5L8RC 2F7TA 4OI0A 1SV5A 5C5JA 4F7VA 5L9NA 4CEDA 4JD2A 4GKJJ 3VF6A 3O4NA 4HKQA 3GPAA 3A5LC 3FCHA 2XSFA 3M9OB 3CDAA 3ZTOA 5AQGA 3M05A 4OZ2A 5CYQB 3I87A 1IR1A 1K0TA 2IOCA 4DTNA 2B9WA 1M5VC 3NAEA 3OL7A 2YWKA 1YHQS 2VGNA 4K0KK 3GFYA 3F9KA 2JL9A 1BQMB 2H3EB 4M5KA 1ZAXA 3CCEN 3A8YA 2XG8A 3I96A 1IJJA 1J5OB 2OKQA 4E19A 2YVSA 2ASJA 3HVTA 4PWUA 2W2NP 5DK5A 4MDBA 2M2BA 2YKAA 4BC2A 2B6AA 4XDDA 2E9RX 4O3QA 4ZN1A 1DEJA 3QJPA 5IT4A 1NH7A 1KAYA 1D3WA 4N56A 2ZUAA 3R5BA 4L8RB 4CIEA 3TA0A 1CBKA 5J1PA 3QT5A 5DQIA 2E1MC 1SJQA 4JOUA 2ROPA 3UVJB 3GWCA 3A8IA 4I7FA 5KRSA 2HW3A 4P6QA 1SKWA 1R3NA 2N3OA 4KGVB 1I94F 2F8TA 5HO4A 3NOCA 2A5XA 2QXLA 3FCWA 1VK8A 3KHYA 1PCAA 5GADI 1AW0A 3A12A 3G0ZA 4A48A 4ZLJA 2XGPA 4RZRA 4K8XA 2DNGA 1T6CA 4LH5A 2LMIA 2WOMB 1VSHA 3OYIA 2W9BB 1SPBP 4NYFA 4R5PB 4NASA 1RUSA 1LQ9A 2OJ3A 4Y65A 1RWMB 4ZMMA 1ESVA 4M8LA 2UUBJ 4ILMA 4CZJA 1CSJA 2CPIA 2VIHA 2ROEA 3D6MB 4RU9A 3OXFA 1FX2A 3GE1A 3HHNB 1Z1ZA 2ZKTA 3M6UA 4K2JA 4DL4A 3IAM9 3LPYA 1VSIA 5KG5A 3CI5A 2Q6CA 1T9XA 4NI2A 5GIOA 3UKUA 2X7IA 4CQ1A 3U9DA 1X0PA 2JJ4D 1YF5L 2DXEA 1SS6A 4JI7K 3MFHA 3I55N 4FF1A 3VEWA 1KR4A 3SQ4A 4YS2A 4ZVQB 1S7IA 2HHXA 4ANCA 5GAEI 3TZYA 3FBBA 2XZWA 4JKCA 3TUJC 3HKWA 5DZ6A 1JL2A 3OVNA 2UUCK 1TU0B 3CJBA 5KFRA 1Q8LA 1JLAB 3QPIA 2MKYA 2LVWA 2LXFA 3OL6A 3IGVA 1K8KA 2UUWA 3ZZUA 1N0UA 2MLYA 4G1IA 1WSIA 1NSKL 2YWHA 3OR2A 3MAAA 5F3ZA 2XULA 3BF3A 3W8GA 1WG1A 5C10A 2PEHA 4OZ0A 3OR1B 2J4RA 1KKHA 3PKYA 3AA4A 3AO5A 1T8EA 1MLAA 2NZ4A 2HNDB 4AUKA 1R59O 4MH8A 2RQCA 3ZSWA 3QFPA 4J9NA 1OPZA 2J76E 2K06A 2L41A 3VEZA 5DDPC 2ALYB 3HHEA 4B9UA 4W5RA 3QNOA 4NRTA 2FY1A 3JSMA 1R27B 3K17A 5IWAK 4B3SJ 1HX1A 4OX9K 5C42A 2HBMA 2OD6A 4A8KA 3H08A 5ETTA 3O1BA 1RA7A 3UR0A 4Y6IA 2J9DA 2E2QA 2F8EX 4E1MA 4NZ0A 1QVFM 3L8BA 3C6TA 2NXEA 3QLHA 2I9SA 5B0DA 2HURA 2IVPA 4QOZB 1BWEA 3I9ZA 1JCEA 5D3GA 1RBLA 3M2UB 3AFGA 4CJTA 4IFVB 2VG7A 1BHNA 4JHDB 1UFWA 1V3ZA 2P9UA 4FK2A 2IRYA 4X64F 3BGRB 3DDKA 1LNQA 4ZVTB 3T1AA 4TLQA 4H4OB 2KHOA 3MUMP 1LFWA 5K8MA 1CLFA 3V6KA 3IDHA 2EPIA 5KOWA 5LL6d 4IO1A 5KG6A 4C23A 4R0JA 3AT1B 3GFHA 3ILJA 3TANA 1PKUA 1S72S 1FKAF 2HHWA 2NXJA 2F8MA 2P5GA 4NLRA 1VK3A 3HI0A 5KG7A 5J2NA 1RDAA 4FWRA 1XHZA 3B4DA 3O3FA 3BM7A 4M3XA 4IDKA 1HR0K 2O8BB 2K1RA 2KJWA 1TK0A 1EKEA 3WEEA 3NBPB 2YJFA 3FQKA 1FERA 1S97A 4QR1A 4ZTJA 3NGTA 2W2PP 3F41A 1WAJA 2XSJB 2ZKUA 2UUCF 1YWXA 3OQ2A 4DTOA 3EZOA 2P9PB 3CMAN 1HWLA 4RX6A 3G6YA 5JUMA 3KK1B 4G3IA 2Q97A 2W4CA 4X4VA 1RWXB 3P4IA 1NK7A 4OHZA 1Q1KA 3L7OA 4CZGA 2XS5A 4FJHA 2ACYA 1I51B 1NJXA 4TQRA 1Y5NB 1Q82T 4K4SA 2K2PA 2NR0A 4HH1A 1X1PA 5E3RA 4K4VA 3ET6A 3OT9A 5SWMA 3TU5A