4WQ4A

E. coli ygjd(e12a)-yeaz heterodimer in complex with atp
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
336
structure length
336
Chain Sequence
MRVLGIETSCDATGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA N6-adenosine threonylcarbamoyltransferase
publication title The ATP-mediated formation of the YgjD-YeaZ-YjeE complex is required for the biosynthesis of tRNA t6A in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 113
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.3.1.234: N(6)-L-threonylcarbamoyladenine synthase.
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wq4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wq4A01
4PKIA 1Z05A 4M63C 1U2VB 1Z6RA 4IO8A 3IMXA 4H0VB 1XC3A 4CBXA 1ATRA 1JCFA 3A5OC 2P9LB 3DAWA 3QDKA 3DXKB 3QMLA 3H45C 1KAXA 5AFUH 2YJEA 2V52B 2NRHA 1V4SA 3WXIA 3D7EO 5AQNA 3DJCA 3H46O 4FWKA 2CGKA 2YHWA 4I6MA 2YCHA 1GLBG 3WEEB 5AQMA 5AQZA 2D4WA 3H1VX 1HKCA 3WXJA 5BRFA 3EKUA 3ULEB 1E4GT 2QM1A 1D4XA 5F2RA 4BRIA 3CJCA 2P9NA 3JS6A 3U9DA 2GELA 2IVOA 1ESVA 2IVNA 4WQ5A 5I9EB 4BRPA 2E1YA 3L6QA 1QZ5A 2FSJA 4FPAA 2HOEA 4BG9A 3A8YA 4O8KA 5AZJA 3O6WA 4H0TB 2IVPA 1QQOA 4PL8A 2F9TA 1RFQA 1TYQA 3EO3A 1BUPA 3TPQA 4JNEA 2A3ZA 4EHTA 3VETA 1TUYA 3AY9A 4ISGA 3UKUA 1H1VA 3WXKA 2P9IA 4CZFA 5KQ8A 2V51B 1XUPO 1WOQA 4H5WA 2ZWHA 3SK3A 3VERA 3B8AX 1GLLO 4FWLA 2QWQA 3H1QA 1DGKN 1MWMA 5BPNA 3VGLA 1MA9B 5AQRA 1SAZA 3JXUA 4BRCA 2E2NA 4H0OA 2PBDA 4H5TA 4YDUC 1TUUA 1NGGA 4H0YB 4IXCA 1NM1A 3CJ1A 2PAVA 3ID8A 4EFHA 5B8HA 4BRFA 2QWOA 5AQHA 2A6AA 2BUPA 1YXQA 3DXMB 3U9ZA 4GNIA 4CD1A 2FXUA 2D1KA 3VEOA 4WQ4A 3EN9A 4FWRA 4HWIA 3A5MC 4PL7A 3VGKA 1T6DA 1NGEA 2ZGYA 4BQZA 3LM9A 4CZIA 1T44A 1QQMA 4JD2A 4CJ7A 4DQ8A 4FWQA 1U6ZA 3M6GA 2QWNA 3EZWA 3MN9A 1NGBA 4BREA 3U4LA 3UE5A 5LY3A 5BRDA 3VF4A 3FZLA 3SLCA 2QWLA 5FPEA 3FZKA 2OANA 3H3OB 4FWOA 4A2AA 5AQQA 4NO7A 3LDNA 4XH1A 3SMSA 4K41A 4A62A 1CZAN 3DXMA 1YUWA 1XQSC 1NGCA 5AZIA 4HTLA 3VPZA 4FWMA 3QFPA 2FSKA 3FLCO 1BO5O 4I6MB 4L3QA 3D2FB 4BC3A 2ITMA 4DB3A 3QICA 3C7NA 2HMPA 3MCPA 1NGAA 1P8ZA 4CD3A 2A40A 4CZLA 3OHRA 3CI5A 1KAZA 2Q97A 3EL2A 1IG8A 2P9NB 3MDQA 3GL1A 2J4RA 4ISFA 3BEXA 5AQLA 2D0PA 4K25A 3ZEUB 5KPTA 2E1ZA 3L0QA 3ZX3A 4BRQA 3QBWA 5AZJB 3FGUA 5AQWA 2P9PA 1GLEG 1NGDA 4QS9A 4B9QA 2W41A 5JMVA 1TYQB 1GLAG 3CJAA 3WT0A 2ZF5O 3VOVA 4CBWA 1KAYA 4CZEA 2W40A 3UKUB 2ZGZA 2V7ZA 2P9IB 3WQTA 5AQVA 3D2FA 4BRAA 3HM8A 1QQNA 1BDGA 3CIPA 4BRLA 5FPNA 4XH5A 3VEXA 1BU6O 3IFRA 4BC4A 4QS8A 2QWRA 1NLVA 3VEWA 2FF6A 2NZTA 3GDQA 3VESA 1BA0A 4Y0WA 5TKYA 4BGBA 5EOYA 4IWVA 3LDPA 2NLXA 3L4IA 3ZEUA 3HBTA 4BVOA 1V4TA 3WXLA 1QZ6A 2BTFA 3MK6A 1DEJA 3G25A 4CZGA 2GEMA 4E1JA 2Q31A 4H5VA 4CZKA 1BWFO 2F9WA 2GTDA 1SZ2A 4BRDA 2A42A 5ADXH 5AQPA 1X3MA 2Q2RA 4BRHA 5E26A 3U8XA 5EXWA 5BN8A 5JICA 3KHYA 4AM7A 2I7NA 1EQYA 1GLDG 3D2EA 4YDUA 4JD2B 3O80A 3BP8A 5ELZA 3O1WA 3CJ9A 5LJVA 1Q18A 2VYPA 3HTVA 5E84A 3FFKB 3VEVA 4IJAA 2ASOA 4BROA 4JHDA 2AA4A 5AQIA 5AQGA 3ENOA 2A41A 4C23A 1C0FA 5AZIB 3CQXA 3GBTA 1MDUB 4BRMA 4B1XB 2VWBA 3A5NC 4H03B 2I7PA 1G99A 1QHAA 5EVZA 3C7NB 3ZX2A 1NBWA 3LDLA 2HF3A 2E2OA 2E88A 3FZMA 5AFUA 5KPZA 3ATUA 1JCEA 5AR0A 3VF6A 4B1VA 4FSVA 1BA1A 1ZC6A 3ENHA 2ASPA 4B1UB 5KQDA 3GG4A 4A2BA 1BG3A 3IUCA 2P9PB 3SJHA 3FZHA 2QXLA 4J8FA 1ATSA 4DHYA 4O5FA 1C0GA 5BPMA 4BR4A 3A5LC 1R59O 3VENA 4H5NA 4MO4A 5AQKA 3S41A 1GLCG 4FPBA 3GOIA 1JCGA 4EHUA 5JLFA 3HI0A 4CI6A 3M1FA 2KHOA 3R8EA 5BPLA 4BG8A 4FWNA 3IDHA 1NGIA 4BR2A 1LCUA 3VGMA 1DKGD 2HF4A 2GWKA 3HZ6A 3QB0A 2Q36A 3FZFA 4FO0A 3FR0A 2Q1NA 3ATVA 4BR0A 4CBUA 4CZMA 1K8KA 2QW9A 3I8BA 4BRNA 4BC5A 1KXPA 2YHXA 4H0PA 4PKHA 1E4FT 1BOTO 3H3NO 1GLJO 3I33A 4FWSA 2QWPA 3O4WA 2UYTA 1NGFA 2GUPA 3CHWA 4H0XB 2P9SA 1NGHA 3D2EB 4ISEA 5BRHA 3ZETB 3QFUA 5F1XA 3KVGA 2WUSA 3AARA 3VF2A 2FF3B 3EKSA 1NGJA 4LC9B 3WUHA 2VCPA 3MN6A 2GWJA 3LDOA 4QS7A 2D0OA 4MLEA 1S22A 3O5BA 3LM2A 2Q0UA 4JHDB 3RSEA 3J8AA 3UKRA 3LDQA 4K42A 4CZJA 4KBOA 3UB5A 3AAQA 2H3GX 4BVPA 3F9MA 2A5XA 4B1ZA 2YI1A 3VEZA 3MN7A 1U2VA 4WQ5C 4AM6A 4DCHA 2P9UB 2YHYA 3QBXA 3BF1A 2P9LA 5AQJA 4RWTA 3DXKA 4EAHD 5AQFA 2P9KB 3ZETA 4RTFD 1YAGA 1ATNA 5AQSA 3CERA 4BR9A 4GY2B 3BF3A 4BR7A 2CGLA 5FPDA 1SQKA 3WEEA 2V7YA 1HUXA 3P4IA 1GLFO 2AP1A 1NMDA 1HLUA 4CZHA 3ULEA 4EIAA 3VEYA 3O8MA 5AQXA 3O1BA 2CH6A 3H6EA 5BREA 3SMPA 2Q0RA 3ZX0A 4JN4A 1RGIA 3KZBA 5LJWA 3LL3A 4IJNA 2DPNA 2E2PA 2P9UA 2E2QA 3GE1A 4K43A 4NB4A 2E20A 3C0BA 3HSCA 1IJJA 1HX1A 1RDWX 2P9KA 3TU5A 1HKGA 3FE1A 4M7YA 3BUZB 3CJ7A 4IZ9A 1J6ZA 4Z94A 3R9PA 1HPMA 5JLHA 5AQTA 1ZBSA 4M7XA 1X3NA 1LOTB 1HKBA 3O08A 4FWPA 5AQOA 3W0LA 4RCHA 3MN5A 5AQUA 4WYBA 4WQ4C 4B1WB 1YVNA 1K8KB 2QWMA 3CETA 2CH5A 5KPRA 1X9JA 4MLHA 4F9OA 4MO5A 3W3DA 5BN9A 2ASMA 5F0XA 4BRGA 3AAPA 4XH4A 2YJFA 2P9SB 5AQYA 5CE3A 1HJOA 1ZXOA 3A0IX 3MMVA 2FLOA 4H5RA 5BR9A 4BGAA 5FPMA 3M3ZA 2FSNA 4BRKA 4BR5A 5EX5A 4A61A 2CGJA 5EY4A 5ADXA 1OKJA 1S3XA 2IIRA 2E8AA 4FL9A 4XEIA 4FOIA 3CQYA 3RSEB 4BQLA 3DWLA 1Y64A 4BC2A 3UKRB 3CJBA 1NWKA 2EWSA 4FOEA 1WUAA 1T6CA 1MWKA 3WQUA 4B1YB 3R6MA 4PKGA 4JAXA
chains in the Genus database with same CATH superfamily
4PKIA 2EX3A 3DLLL 1DTTA 1Z6RA 1SL1A 4FLTA 5GADP 3RVCA 4AF1A 3P1GA 3DAWA 4CGFA 3H45C 4FVUA 4DR1K 2NRHA 2WOMA 3S9HA 3WXIA 3QEPA 2P5GA 1WSJA 1SKSA 4M3RA 5C0YA 3PO5A 2YCHA 3MECA 5AQMA 4N41A 2D4WA 5BRFA 3WXJA 4F3TA 3EKUA 1E4GT 1RDBA 3IG1A 3CJCA 3JS6A 4DV6K 1OVYA 1ESVA 5I9EB 3T19A 1VSFA 4H4MA 4E7HA 3L6QA 1TVRA 2NNWA 4DR3K 3JSMA 1XNRK 1S5JA 4PL8A 3ZLJA 1RFQA 2HNDA 3EO3A 3VETA 1TUYA 1N34K 4EP4A 5GIOA 2P9IA 3CG7A 4CZFA 5KQ8A 2V51B 1TKDA 1M90O 4QOZB 2ZWHA 2G8HA 3DLKA 3B8AX 5HROA 4GV6A 1BISA 1NJXA 1DGKN 4OPAA 4CHYA 1C1BA 3ZT4A 1RBSA 4H0OA 4LY7A 4LSLA 4M45A 1XWLA 4FZYA 3HPOA 4JKEA 3G4SN 2DFEA 5B8HA 1T8EA 3IKMA 2D5RA 3OTOK 4BE2A 1FW6A 4JKHA 4DFJA 2NUBA 4CD1A 3CFPA 2D1KA 5SZTA 4WQ4A 3SI6A 3ZSXA 3A5MC 1U47A 1T6DA 4BQZA 4BWJA 2QA4N 3HOSA 3VQ6A 3KLHA 1HMVA 3HT3A 4LFCK 4DQ8A 3C94A 4JD2A 1EX4A 1VSKA 1RDAA 4JI3K 1IO2A 3EZWA 1XI1A 3C6TA 1NGBA 4YOXA 4ZTJA 1FKOA 4BREA 1NK9A 3VF4A 3SLCA 4E7LA 3O9TA 4FWOA 4A2AA 4YNQA 4XH1A 3K9KA 3THWB 3J7ZO 4A62A 1YJWN 4KRFA 3DXMA 4HTLA 3VPZA 2B6AA 3NF6A 1KQSM 4E3SA 2JGUA 3QICA 4CD3A 1NK7A 4I2PA 3M5RA 5HRNA 1L3VA 2P9NB 2X74A 3GL1A 1S1VA 3RWUA 3HPGA 4C1NK 3K2PA 1TK5A 4XIUA 3MWPA 3OYHA 3L0QA 4FK2A 3ZX3A 4BRQA 1QE1A 1GLEG 4CK3A 4BDYA 3SBTA 2VWKA 4QS9A 3SV3A 3I56N 2X78A 1GLAG 3WT0A 4KAZA 3VOVA 1JJ2M 2F8TA 3UKUB 2V7ZA 3WQTA 3HVRA 2O8CB 2P1JA 5AQVA 3TSUA 4BRAA 3AO4A 3S3OA 4DUZK 3CIPA 5HRSA 4F8RA 1WSIA 3L2QA 2O8FA 1U4BA 3EE8A 5HP1A 2X6SA 3VEWA 2NZTA 3KWGA 4Y0WA 5TKYA 2D0AA 4IWVA 4DQSA 2NLXA 3AVIA 4KTWA 1EWQA 4NXNK 1UA1A 3T1HK 4BVOA 3T1AA 1QZ6A 3SCXA 3NF9A 3TSQA 4H5VA 1YJ9N 2HVIA 2G8VA 1YTAA 1N5YA 5AQPA 2HB5A 1M1KO 4GV3A 2WBNA 3U8XA 5EXWA 3OYNA 3K59A 4PUOA 1J5EK 2VQFK 2I7NA 4LF6K 4DV3K 3VMFB 3O80A 5ELZA 3O1WA 3CJ9A 1XMQK 4GMJB 3DM2A 4WFAL 5E84A 3FFKB 2ASOA 4OKJA 1KSPA 4OKEA 4AILC 2HHQA 1LAVA 3LWMA 1RTHA 2A41A 3ULDA 2UXCK 4J2AA 4EZ6A 3CQXA 3NFAA 4BRMA 4B1XB 2VWBA 4H03B 5TKWA 3QINA 1G99A 3QEXA 4KO0A 3C7NB 4FLZA 3P83D 2DTUA 1X9WA 1VQKN 4CF0A 3FZMA 5KPZA 3HM9A 2NRVA 3ATUA 2KQ2A 4Q5VA 1NJZA 3LAMA 3VF6A 4DV5K 4ICLA 1Q81O 3THVA 1S1WA 3VQDA 4ELVA 3I0SA 4K8XA 3NDKA 4DF8A 1N33K 1RT1A 2QXLA 1R0AA 2PYLA 1ATSA 4JI1K 5BPMA 4H5NA 5E41A 3NF8A 1GLCG 1HYZA 3HJFA 4DU3A 4DLEA 3LANA 2UU9K 2D0BA 5DMRA 3SQ1A 3QEWA 2FBTA 4JK9A 1YT3A 4M3XA 3LP2A 4O44A 3HL8A 2Z1GA 4BR2A 4M3WA 2HF4A 3TTFA 1O13A 3LPUA 3KTQA 3QB0A 3ZCMA 2YNIA 3SNNA 4CJKA 3OYDA 2OTJN 1JL1A 3FR0A 4IFYA 1UAXA 4HTUA 3KK3A 1K8KA 4NCAA 3VA0A 1KXPA 3F2KA 1SKRA 3H3NO 2QKKA 4DKWA 3HSTB 3THXA 3I33A 3LZIA 2IOCA 2P9SA 3K0SA 3D2EB 1YVUA 1GOBA 2GV9A 3JAMO 1WN7A 3CD6N 1S9GA 5CY4A 2Q3SA 3WUHA 4PA1A 3MN6A 4GW6A 2BANA 3PSFA 3RSEA 2BE2A 4K42A 4FJLA 1KLNA 4O5BA 1D5AA 1EO1A 2BGGA 1IKWA 4KPYA 3F9MA 4B1ZA 4YOWA 4IKFA 1VQNN 3MN7A 1S1UA 4DTOA 4AHVA 2P9UB 3AVGA 2YHYA 4RWTA 2P9LA 2IS3A 3ZETA 4E1MA 4RTFD 4B9NA 3DLGA 4BR9A 4GY2B 3RMCA 3MEEA 2HHSA 2CGLA 5FPDA 3WEEA 2V7YA 1HUXA 4YHHK 2HBMA 4RW7A 4CEOA 3PO4A 3VEYA 2YNHA 3O8MA 4FJGA 3VQ4A 2Q0RA 3KIOA 3CCJN 3EE9A 4A5AA 1RGIA 1RILA 3LL3A 2DPNA 2E2PA 2E2QA 4K43A 2E20A 3PIOL 3HSCA 3R1XA 4IBNA 3TU5A 2KFZA 3AA5X 3DRSA 1J6ZA 4Z94A 1HPMA 4M3YA 1ZBSA 4JKBA 5AQOA 3OS2A 2A1RA 3HK2A 4WYBA 3A2FA 4FW1A 3C6UA 3KK1A 2QWMA 1YITN 5C12A 4MLHA 4F9OA 4MO5A 4LF8K 2F7TA 3WNEA 3DLEA 4B9VA 2B4JA 4DTPA 3PV8A 4B3TK 2OCEA 5CYQA 1TKTA 5BR9A 1NKBA 1QVGM 2QK9A 3O9QA 3KK2A 2G8KA 2WTUA 4BRKA 3AGRA 2RN2A 3WNGA 5EY4A 1WSGA 2E6LA 3K58A 2E8AA 3VQ5A 2XY7A 2DFHA 3CQYA 4BQLA 3DWLA 3CJBA 4Y1DA 3K5NA 4FOEA 2E5LK 3AVHA 1Z05A 3O9RA 3ENBA 3CF5L 1HRHA 1U2VB 4NXMK 3IMXA 3OYMA 1JCFA 3A5OC 4DQRA 4FLWA 4W5QA 1EXQA 1Q8IA 4E89A 5HOOA 5AQNA 3G10A 3DJCA 5KRTA 1T3VA 2CGKA 1VRUA 4B9SA 1GLBG 3AO1A 4ID5A 5C25A 3TTCA 2OZMA 5F2RA 1VQMN 4U7BA 3OA9A 3R3LA 1QZ5A 4CFBA 4FPAA 3ALYA 5AZJA 4O55A 3I55N 4H0TB 2IVPA 1NK5A 1ZBUA 1A5XA 2F9TA 1TYQA 4ID1A 4ZTFA 1BUPA 4N47A 3SQ2A 4M41A 5J2QA 4ISGA 4CHZA 5HBMA 3CCSN 4M3ZA 3WXKA 1HQEA 5M1FA 4OGEA 4J2EA 1IBKK 1WOQA 4H5WA 3SK3A 3VERA 4OPJA 3D6RA 1SL2A 1GLLO 4FM0A 2NRTA 4PWDA 3ISNC 1MWMA 1XHZA 4FJKA 3TARA 2Z1IA 4BRCA 2PBDA 1VSMA 4YDUC 1NG9A 3HXMA 1NGGA 1VSEA 2HBKA 2HHVA 4H0YB 4IXCA 3C95A 1NM1A 3NBPA 3CJ1A 2PAVA 4J2BA 4EFHA 4LF4K 3F73A 4BRFA 3MEDA 4CJQA 4AQYK 3H08A 2KFNA 4ILJA 3DXMB 4JYAK 2GX9A 4GNIA 3D0PA 4KB1A 1QS4A 2EHGA 2P51A 1VAZA 3EN9A 4HWIA 1WSEA 4PL7A 1LV5A 2ZGYA 1NMNA 3LM9A 3CC2N 4DSLA 1GOAA 2AJQA 1T44A 4FWQA 4WF9L 1WSHA 3M6GA 1LWCA 3DI6A 1ZBLA 3MN9A 4JS5A 1S72N 3UE5A 5BRDA 2OPSA 3VQEA 3HP6A 2QWLA 5H1SQ 2OANA 3H3OB 1YTUA 4GV9A 5AQQA 2O4IA 4NO7A 1NOZA 4FLXA 1CZAN 3SAFA 1XQSC 1RDCA 5AZIA 2X6NA 2F8SA 4FWMA 5JS2A 3OYAA 1BO5O 3OVNA 4I6MB 4L3QA 3TANA 1RTDA 2ITMA 5C24A 2HMPA 2O8EA 2A40A 3CI5A 3V9SA 1QTMA 2J4RA 3BEXA 2D0PA 4K25A 2E1ZA 1CZ9A 3SPZA 3FGUA 3AVMA 4V19S 5HLFA 4KI6A 1NK0A 4B9QA 2W41A 4CBWA 4N76A 4M3TA 2W40A 2ZGZA 1RTJA 3D2FA 1BI4B 4CJVA 1QQNA 5C15A 4AHRA 2ZM6K 3V9ZA 4BRLA 5FPNA 4F2RA 3VEXA 5I3UA 3IFRA 1NKCA 4CGDA 1NLVA 3GDQA 3VESA 3OYIA 4B9UA 4BGBA 3PX0A 3HRGA 3WXLA 4YOVA 4YOTA 2GEMA 1TL3A 1LW2A 3THYB 1VQ7N 4CZKA 1BWFO 1SZ2A 3FFIA 1X3MA 1X1PA 4FJ5A 5E26A 1IBMK 1VSHA 1I39A 3M8QA 1KVAA 5BN8A 3KHYA 2KLAA 1BIUA 4YDUA 3JYTA 4C8OA 1JLBA 1Q18A 3DLRA 3B6PA 3WNHA 4LH4A 1OH5A 1WAFA 1VQON 1NOYA 1J5OA 3CPEA 3Q7CA 1DT9A 4CJFA 4BROA 4JHDA 3HPHA 5AQIA 4FCYA 3MX2A 4JI2K 1C0FA 4CEAA 2IDOA 3GBTA 2UXBK 4AHSA 4DFKA 1MDUB 1VQ5N 3ZT2A 4ILGB 3CC4N 3SYZA 5EVZA 3ZX2A 1K8AO 1NBWA 5CHIA 1VSJA 2KTQA 2NRRA 1K73O 3NMUA 5CR4A 1JCEA 3TR8A 5CZ1A 2O8BB 3ENHA 4FJ9A 4B1UB 1BG3A 3LDSA 2P9PB 4WFNL 4CJTA 2UXDK 3MCAB 5J2MA 4O5FA 1OH8A 4OPHA 3VENA 3C65A 3TAQA 4MO4A 1RCHA 1KD1O 3THXB 4CEEA 5JLFA 5AJ3K 4CI6A 1RT4A 2NRWA 3M1FA 3SUNA 2ITGA 5HL7L 2XY8A 4FWNA 3OYKA 2QI2A 3KD5E 2YNFA 4JKAA 1DKGD 4K8ZA 3PSIA 4FJ8A 3FZFA 2OA8A 3ATVA 2HHHK 1HNZK 3CFRA 4CZMA 4BRNA 4BC5A 1WB9A 2YHXA 4KH4A 4H0PA 1N36K 1RT3A 3OYEA 2W6KA 3S3MA 1GLJO 4CGHA 1NKEA 3O4WA 1K9MO 2UYTA 4CEFA 3KK7A 1NGFA 2YKMA 3TAFA 4ISEA 3RR7A 3LP3A 5BRHA 3ZETB 1L3UA 1BGXT 3QFUA 4KHWA 2WUSA 1NGJA 4LC9B 3M8SA 2GWJA 3LDOA 5IWAK 2D0OA 2XY5A 3O5BA 2ZJPL 2FC0A 3RMAA 2RPIA 4JK7A 3J8AA 4DR2K 3UKRA 4JK8A 3LPTA 4JKGA 4EZ9A 4JLHA 4BVPA 3SJJA 3SQ0A 3KLIA 5FDLA 3VEZA 2I5JA 3E9LA 3QBXA 5AQFA 4KB0A 5J2PA 5M1OA 1I94K 3AO2A 4GVEA 2GBZA 2G8WA 3OW2M 4FVMA 1U45A 4DR6K 1SQKA 2OTLN 3HYFA 2E4LA 2HMIA 4BDZA 4CJ4A 3P31A 2AP1A 1NMDA 1Q86O 1EETA 3UIQA 1ZYQA 3AVAA 4DF4A 3O1BA 4CEQA 3G71N 4EP5A 3KLGA 3QIOA 2VWJA 3OYBA 3PIPL 4IJNA 3GE1A 1KRPA 1HX1A 4OKKA 2P9KA 3QO9A 1HKGA 1VK0A 2NRXA 3BUZB 3CJ7A 4IZ9A 3OYLA 3L2RA 3CMAN 2VG6A 5JLHA 1X3NA 1GOCA 1HKBA 3O08A 4FWPA 4CFDA 4DLGA 3MN5A 5AQUA 4DSEA 4KH6A 1O1WA 5KPRA 1KFSA 3CCLN 3W3DA 4X65K 3M8RA 5BN9A 1DTQA 2ASMA 1RT7A 5F0XA 3VTHA 1ZXOA 3A0IX 1KVCA 4CGIA 4BGAA 3L3UA 1HJRA 4DQPA 3M3ZA 4BR5A 4Z4IA 2CGJA 4OX9K 1FXXA 5D3GA 4DTSA 4FJHA 4MDBA 4XEIA 3KKRA 4FOIA 1SKWA 4H8KA 1D8YA 1Y97A 3VN5A 4WCEL 2EWSA 2F96A 1WUAA 1ZBIA 4MDAA 4W5OA 4H4OA 5HRRA 3E1YA 3SBGA 4M63C 3D45A 4IO8A 1XC3A 1ATRA 2UUBK 4DV7K 3DXKB 5K14A 3EY1A 3VQPA 1KAXA 5AFUH 5HRPA 2YJEA 1CXUA 2V52B 2PYJA 2LSNA 3T1YK 3D7EO 2KW4A 3AVKA 5DM7L 4M42A 4W5TA 3AVBA 3S3NA 1NK6A 2YHWA 3HOTA 1BCMA 3L8BA 4B9TA 2XY6A 1HKCA 5DM6L 5GIPA 3TI0A 4WE1A 3E9OA 3ULEB 2QM1A 5C2DA 4CJWA 4KREA 4LH5A 2P9NA 4B8CA 5FRMA 3U9DA 2HHXA 1CZBA 2IVOA 2HBJA 1NK4A 2E1YA 4M3UA 3ID6A 4CEDA 3MXMA 1E3MA 2HOEA 4BG9A 3A8YA 4O8KA 4IO9L 1VSLA 4HVJA 3O3HA 1QQOA 3E9PA 4Q0BA 3OS1A 1TK0A 4CJSA 3AY9A 3UKUA 2O8CA 4KHUA 1XUPO 1YF5L 3LAKA 3LWLA 4FK0A 2DFFA 3ASMA 1W2BM 2B5JA 4FK4A 3OY9A 3MXJA 1L5UA 4RW6A 2ZQBA 4IG3A 1SAZA 4C8LA 4Z4FA 4H5TA 4PQUA 3VA3A 4C8NA 3V1RA 3ZSYA 3MXIA 3ID8A 5M1PA 1J54A 5AQHA 5A2QO 4Z4EA 2BUPA 1YXQA 3AVLA 4TSXA 1ZBHA 1Q9XA 1S1TA 2FXUA 4O4GA 4KFBA 3U6FA 2ZJRL 2ZE2A 3VGKA 2GUIA 2O8EB 4DV1K 4CGJA 1ITGA 2G8FA 1YIJN 1QQMA 1CLQA 1YI2N 4U67L 2QWNA 4J2DA 3CCQN 2A1SA 3F5TA 3U4LA 5IT9O 1J53A 5FPEA 3FZKA 3NH0A 1T05A 1T7PA 1MU2A 4JI5K 3SMSA 4C1NI 4CK1A 4R79A 4DSFA 3V6DA 4LF5K 4OO1J 3QFPA 3FLCO 3D2FB 4BE1A 4BC3A 3O3FA 2VG5A 4DB3A 1KFDA 3C7NA 1P8ZA 4CZLA 3AVCA 3OHRA 1W7AA 1KAZA 2W42A 2Q97A 3EL2A 1IG8A 4QCLA 4KHNA 3QIPA 1YHQN 1IKVA 4RG8A 5KPTA 3QBWA 4DV0K 1NGDA 3VQAA 3T7ZA 3CJAA 4B8AB 2ZF5O 5CZ2A 3QEIA 4CZEA 4DR5K 4A5BA 4LFBK 3CCRN 3KLEA 2P9IB 4JKDA 4JRQA 3N4QA 1OH7A 1F21A 1BDGA 2RKIA 5KRSA 4N5SA 1BU6O 4KHQA 4QS8A 3I8DA 2QWRA 4E7IA 3EZ5A 4KHYA 5GAGP 5J1EA 3NHGA 3RR8A 4DTNA 4CCHA 5EOYA 3L4IA 3ZEUA 3HBTA 1NK8A 1Z26A 1VQ4N 2HVHA 1QSYA 4Z4GA 3MK6A 4DR4K 4CZGA 2Q31A 3QESA 3K5MA 2GTDA 4BRDA 3J7AP 4BRHA 1HR0K 3V1OA 3AO3A 5JICA 2IAJA 4AM7A 4UQGA 4FM1A 1TK8A 3D2EA 3J7YP 4JD2B 3CMEN 1XNQK 1RTIA 4CHQA 5LJVA 4PHTX 3DOKA 5SWMA 5I42A 4IJAA 2HHUA 2XHBA 1ZBFA 4CF2A 3PUFA 1LAWA 2AA4A 3L4QA 5AQGA 4UY8O 3ENOA 3M8PA 1RDUA 3ZSWA 2O4GA 4YOUA 3V9WA 3TAPA 1S6QA 4DTRA 2I7PA 3SZ2A 3SUOA 1KLMA 1QHAA 4CE9A 2FBVA 4AHUA 2UUAK 1Q82O 3DRPA 4JS4A 1EP4A 1YJNN 2E2OA 3J81O 4JI4K 4JV5K 1HYSA 5AFUA 2PFUA 4GKKK 5AR0A 3QERA 2ZJQL 2Y1IA 3KLFA 1BA1A 1ZC6A 4JI6K 4X64K 4FJJA 2HSTA 4KI4A 4FW2A 5KQDA 3P38A 3ZT1A 4IEIA 4A2BA 4FLVA 1QSSA 3OBWA 3SJHA 3AA3A 1W0HA 3FZHA 2DY4A 4CW7B 1NJWA 5LMNK 4J8FA 4DU4A 4DHYA 4E1NA 3PLAA 3A5LC 1R59O 3N4PA 2VGMA 2HBLA 1VQLN 2QTDA 4CIFA 4OLBA 4KTQA 1NNEA 5JVGL 3GOIA 1JCGA 2XO7A 4LF9K 3HVTA 4EHUA 1BL3A 1XMOK 2O8FB 2KHOA 4QAGA 2OPRA 1WNSA 4CK2A 5BPLA 1BHLA 3IDHA 1NGIA 1FK9A 5BR8K 3O9UA 3VQBA 1RBRA 3LALA 3OYGA 4FLUA 3AGKA 2Q36A 5KGXA 4DFPA 4FO0A 2O8DA 5MLCQ 2Q1NA 1I3AA 1JKHA 4DSIA 4CBUA 4PKHA 3ZSRA 3V9UA 4HUFA 4CFAA 2JWLA 2JWKA 4FZXC 4CFCA 1IKYA 4IG0A 3ZSQA 3OYJA 3G0ZA 1JLAA 5F1XA 2F4VK 3AARA 3VF2A 2FF3B 1QQCA 3CM6A 3EKSA 4CIEA 4I2QA 4DS4A 4I9QA 4FJMA 1JLEA 4MLEA 1S22A 3LM2A 1S9EA 3RTVA 2FBXA 2Q0UA 4FJ7A 4OPKA 2VGNA 3LDQA 4L8RB 1XHXA 4C8KA 3AAQA 2G8IA 4AHTA 4YOYA 2YI1A 3CCMN 1U2VA 1HQUA 3BZCA 4WQ5C 4AM6A 5JVHL 4IOXA 1J9AA 4AH9A 2Z1JA 3BF1A 5AQJA 3CCEN 4EAHD 2P9KB 3MEGA 1YAGA 1ATNA 5AQSA 4GKJK 3V81A 2VQEK 3CERA 4LF7K 3BDPA 4LFAK 5LMUK 1EKEA 4BR7A 3MX5A 1D9FA 1LW0A 3AA4A 3QETA 1X9MA 2QKBA 3E01A 1HLUA 4EIAA 4ZHRA 1VHXA 4BDPA 4O0IA 1JXEA 2CH6A 3TAEA 3VQ9A 4JN4A 3MAQA 5LJWA 3KZBA 1UA0A 1B9DA 3C0BA 3LP1A 1IJJA 4WFBL 3AO5A 1U49A 4M7YA 3FE1A 4DV2K 4ELTA 4W5RA 1BQNA 1NJIO 3CFOA 5AQTA 2W6LA 3RRHA 4DQIA 4CJUA 1LOTB 1C0MA 4Z0UA 1LWFA 4RCHA 3V1QA 4LD0A 3WNFA 1Q9YA 1K8KB 1DLOA 3O3GA 3BGRA 1HYVA 1KVBA 4XH4A 2YJFA 4HCBA 2P9SB 5AQYA 3ZSOA 3DYAA 1C0TA 3G6EN 1VQPN 4H5RA 3Q7BA 2D0CA 4G9ZA 3IS9A 2FSNA 1IBLK 5EX5A 4A61A 4DTXA 3VQ7A 1L3SA 2IIRA 1HPZA 4FLYA 4KHPK 3RSEB 4BC2A 3KJVA 3QNOA 1TKXA 1MWKA 1VQ6N 3WQUA 3R6MA 4PKGA 4JAXA 4E0DA 4A57A 1UWBA 2BDPA 4H0VB 2RHKA 4F2SA 4CBXA 3OJUA 3TAGA 3PX4A 2P9LB 3QDKA 3RRGA 3QMLA 3CM5A 4ILHA 1V4SA 5DK5A 3H46O 4FWKA 5M1KA 3NGZA 4DV4K 4I6MA 3WEEB 5AQZA 4N56A 3H1VX 4CJPA 2R7YA 1D4XA 4DTJA 3NH2A 4IOAL 4GVMA 4BRIA 3O4QA 1TGOA 1S6PA 2GELA 2IVNA 4WQ5A 1TV6A 4BRPA 4OVLA 2FSJA 1FJGK 3KWIA 4C8MA 4DSKA 3SAHA 3O6WA 3AVFA 1NJYA 4MFBA 1WLJA 3TPQA 1NU0A 4JNEA 2A3ZA 4EHTA 3OYCA 4B3SK 4OGCA 5KGWA 1H1VA 1BI4A 4CJEA 2HHTA 1JLGA 4CEBA 4DUYK 4FWLA 2QWQA 3C6AA 3H1QA 5BPNA 3VGLA 1MA9B 5AQRA 3VQ8A 3JXUA 2E2NA 1WBBA 1TUUA 2E6MA 4O8UA 1SS6A 1FKPA 1TAQA 3AA2A 2QWOA 3L2WA 2A6AA 4JKCA 3THYA 3LZJA 3TAMA 4HUEA 4KTZA 3U9ZA 5M1NA 1RT5A 3VEOA 2FBYA 3T3FA 3ZSVA 4FWRA 1ASWA 1NGEA 1BCOA 3ZYYX 4RW9A 4CZIA 4CJ7A 1U6ZA 4IDHA 4NLCA 1W9HA 3OS0A 1VSDA 1RBVA 3DMJA 5LY3A 3PX6A 4CHPA 3FZLA 2IGIA 3TTDA 1JLFA 3L2VA 3LDNA 4HUGA 1QHTA 4K41A 4DSJA 2YX6A 4NCBA 2XRIA 1YUWA 4CESA 1NGCA 1BQMA 3SUPA 2FSKA 3L3VA 1T03A 4YY3K 4RW8A 1VQ8N 2JLEA 1L3TA 3MCPA 1B9FA 1NGAA 5C2FA 2KZMA 1RDDA 5EU7A 4CJLA 3OJSA 1RT6A 3MDQA 5FROA 1TAUA 2O8BA 4ISFA 3AV9A 5AQLA 3ZEUB 4CJ3A 1Q7YO 5AZJB 5AQWA 2P9PA 4IDKA 3VQCA 1KTQA 3THWA 2G8UA 5JMVA 1TYQB 3SAGA 1KAYA 1C0UA 4X66K 4X62K 3NAEA 3CCUN 1IV0A 4NCGA 3HM8A 4CGGA 3KKSA 2UUCK 4XH5A 3NE6A 4BC4A 2YHAA 4JI0K 3SPYA 1BIZA 1ASVA 4KHSA 2FF6A 1BA0A 3DOLA 4FZZA 3CCVN 3LDPA 4CEZA 5FRNA 4HCCA 1V4TA 2BTFA 1LWEA 4FJIA 3K5LA 2IC3A 1N8RO 4OLAA 1DEJA 3G25A 4E1JA 1N32K 4FYDA 4NYFA 1C1CA 3BY5A 5C10A 2F9WA 2PY5A 2BH1A 2A42A 3OBYA 5ADXH 4B3RK 3QNNA 2Q2RA 4Y1CA 4B9LA 3OYFA 1G15A 1EQYA 1GLDG 2YV0X 1RBTA 4CERA 3BP8A 1U48A 1TKZA 4I7FA 1B92A 2ATQA 2VYPA 3HTVA 4NLBA 4IFVA 4JEPA 1UOCA 3VEVA 4DWIA 2WC9A 4K0KK 4ELUA 3ZSZA 4CJRA 3QLHA 4KH5A 1D9DA 3DLBA 1Z25A 1XC9A 4B3MK 4FXDA 4C23A 4AHCA 5M1QA 4Z4HA 5AZIB 5LL6Z 3ZT0A 3A5NC 1IKXA 3DLHA 5GINA 3LDLA 4BY9C 2HF3A 3V9XA 3K57A 2E88A 3B6OA 4KV8A 1RBUA 4CF9A 1VSIA 4B1VA 4FSVA 2QEXN 2WFBA 2ASPA 4FJXA 4MQ3A 3GG4A 1JXBA 1RNHA 1HNXK 3IUCA 2Z1HA 2O8DB 4DS5A 1C0GA 4E19A 3C6HA 4BR4A 5AQKA 3S41A 5KTQA 4FPBA 3U3YA 2YKNA 5KI6A 1VRTA 3V4IA 4RW4A 1X9SA 4I9LA 2RF2A 2VG7A 3IAYA 3ZT3A 4IFEA 3HI0A 3PY8A 1C1AA 4O0JA 3SV4A 4DMNA 3R8EA 3SUQA 4B9MA 4HHTA 4BG8A 3SQ4A 4YORA 3TABA 1LCUA 3CXCM 3P39A 3RMBA 3VGMA 5GAHP 2GWKA 2KKZA 3HZ6A 2QXFA 1HNIA 4Z4CA 4CF1A 4IOCL 4BR0A 5GAEP 3WXMB 4YFUA 1N6QA 4DTUA 3HO1A 1IG9A 2QW9A 3I8BA 3NVKA 3ITHA 2HW3A 1E4FT 1BOTO 1RT2A 4FWSA 2QWPA 3MWTA 2GUPA 3CHWA 4H0XB 1NGHA 4JI8K 2ETJA 4B08A 3HP9A 2OYQA 3RMDA 2Y1JA 1QSLA 3KVGA 1WSFA 4F4KA 4DR7K 2VCPA 3TWHA 4DQQA 1OH6A 1P90A 4QS7A 2HNZA 3LP0A 4JI7K 4JHDB 4DU1A 4CZJA 4KBOA 3O9SA 3UB5A 3KD1E 2H3GX 1TL1A 2A5XA 1REVA 1OVQA 3U3GA 1VQ9N 4DCHA 2HHWA 2P5OA 3NH1A 5J2NA 3AVJA 3VQQA 3DXKA 4DTMA 1SL0A 2NRZA 3NGYA 3CQ8A 1A5VA 3AVNA 1JL2A 2WONA 3T69A 4CVNE 4JKFA 2OPPA 4E7KA 2KZZA 4CHOA 3BF3A 5C42A 3CC7N 1U04A 3P4IA 1GLFO 2RE2A 4CZHA 3ULEA 1HNWK 1ILYA 4OJRA 5AQXA 4CIGA 3H6EA 3I0RA 5BREA 3EEQA 3SMPA 4E7JA 3VTIA 3ZX0A 1QVFM 3BZKA 1CXQA 1SV5A 4FM2A 2P9UA 4NB4A 4CJ5A 4IEEA 4PY5A 4LSNA 1RDWX 3IRXA 3K9JA 1K6YA 3TSPA 4DFMA 4BWMA 4R5PA 1JLQA 1JLCA 3R9PA 4M7XA 1HNVA 1ASUA 3W0LA 5CYMA 3QEVA 1KC8O 3NVMA 1EWRA 3E66A 2YHBA 4CF8A 4WQ4C 3DRRA 4B1WB 3CPWM 1YVNA 4G1QA 3CETA 2YNGA 2CH5A 3CYMA 4KKOA 3NGIA 1WAJA 1X9JA 3L2UA 1WBDA 3O4NA 4NYNA 3J80O 4BRGA 1C6VA 4CECA 4DG1A 1SUQA 1A5WA 3AAPA 1IH7A 5CE3A 1HJOA 5T7BA 3MMVA 5JS1A 4BACA 2FLOA 1S1XA 2HNYA 4BE0A 5FLXO 3NCIA 5FPMA 3P5JA 4JRPA 2OZSA 3F9KA 4B3OA 5ADXA 1OKJA 1S3XA 4CHNA 4F3OA 4FL9A 2PZSA 3K5OA 1KCFA 1Y64A 2OPQA 3UKRB 2ZD1A 3NF7A 4FJNA 1NWKA 1W97L 4JKGB 1T6CA 4A59A 3EYZA 4W5NA 4B1YB
chains in the Genus database with same CATH topology
4PKIA 3E1YA 3DLLL 1Z05A 3O9RA 4M63C 3ENBA 3SBGA 4A57A 3CF5L 1U2VB 1Z6RA 4IO8A 3IMXA 4H0VB 2RHKA 1XC3A 4CBXA 1ATRA 1JCFA 3A5OC 5GADP 3RVCA 4AF1A 2P9LB 3DAWA 3QDKA 3DXKB 3QMLA 3H45C 1KAXA 5AFUH 2YJEA 4ILHA 4FVUA 2V52B 2NRHA 1V4SA 5HOOA 3WXIA 3D7EO 5AQNA 3DJCA 3H46O 5DM7L 1T3VA 4FWKA 5M1KA 2CGKA 5C0YA 2YHWA 3HOTA 4I6MA 2YCHA 1GLBG 3WEEB 5AQMA 5AQZA 2D4WA 3H1VX 1HKCA 3WXJA 5BRFA 5GIPA 5DM6L 3EKUA 3E9OA 3ULEB 1E4GT 2QM1A 3TTCA 5C2DA 1D4XA 5F2RA 1VQMN 4IOAL 4BRIA 3CJCA 2P9NA 3JS6A 3U9DA 1OVYA 4U7BA 2GELA 2IVOA 1ESVA 2IVNA 4WQ5A 5I9EB 2HBJA 4BRPA 2E1YA 3OA9A 3L6QA 3ID6A 3R3LA 1QZ5A 2FSJA 2NNWA 4FPAA 2HOEA 4BG9A 3A8YA 4O8KA 3KWIA 5AZJA 4IO9L 3SAHA 3I55N 3O6WA 4H0TB 2IVPA 1QQOA 3E9PA 4PL8A 2F9TA 1RFQA 1TYQA 3EO3A 1BUPA 3TPQA 4JNEA 2A3ZA 4EHTA 3VETA 1TUYA 3AY9A 4ISGA 3UKUA 3CCSN 1H1VA 3WXKA 5GIOA 2P9IA 4CZFA 5KQ8A 5M1FA 2V51B 1M90O 1XUPO 1YF5L 1WOQA 4H5WA 2ZWHA 3SK3A 3VERA 3B8AX 3D6RA 1GLLO 1W2BM 4FWLA 4GV6A 2NRTA 2QWQA 3C6AA 3H1QA 1DGKN 1MWMA 4OPAA 5BPNA 3VGLA 1MA9B 5AQRA 1SAZA 3JXUA 4BRCA 2E2NA 4H0OA 2PBDA 4H5TA 4YDUC 1TUUA 1NGGA 4O8UA 2HBKA 4H0YB 4IXCA 1SS6A 1NM1A 4JKEA 3G4SN 3CJ1A 2PAVA 3ID8A 5M1PA 4EFHA 5B8HA 3IKMA 4BRFA 2QWOA 5AQHA 2A6AA 4JKCA 4JKHA 2BUPA 1YXQA 4ILJA 3DXMB 3U9ZA 5M1NA 2GX9A 4GNIA 4CD1A 2FXUA 2D1KA 3VEOA 4WQ4A 2ZJRL 1VAZA 3EN9A 4FWRA 3A5MC 4HWIA 4PL7A 3VGKA 1T6DA 1NGEA 2ZGYA 4BQZA 3LM9A 2QA4N 3ZYYX 3HOSA 3CC2N 4CZIA 1T44A 1QQMA 4JD2A 4CJ7A 4DQ8A 1YI2N 4FWQA 4U67L 1U6ZA 1YIJN 4WF9L 4IDHA 3M6GA 4NLCA 2QWNA 3EZWA 3CCQN 3MN9A 1NGBA 4YOXA 3F5TA 4BREA 3U4LA 1S72N 3UE5A 5LY3A 5BRDA 3VF4A 3FZLA 3SLCA 2QWLA 5FPEA 3FZKA 5H1SQ 2OANA 3H3OB 3O9TA 4FWOA 4A2AA 4GV9A 5AQQA 3TTDA 4NO7A 3LDNA 3K9KA 4XH1A 3SMSA 4K41A 4C1NI 3J7ZO 4R79A 2YX6A 4A62A 1CZAN 3SAFA 1YJWN 3DXMA 1YUWA 1XQSC 1NGCA 5AZIA 4OO1J 4HTLA 3VPZA 4FWMA 3QFPA 2FSKA 3FLCO 1BO5O 4I6MB 4L3QA 1KQSM 3D2FB 4BC3A 1VQ8N 2ITMA 4DB3A 3QICA 3C7NA 2HMPA 3MCPA 5C2FA 1NGAA 1P8ZA 4CD3A 2A40A 4CZLA 3OHRA 3CI5A 1KAZA 3M5RA 2Q97A 3EL2A 1IG8A 2P9NB 3MDQA 3GL1A 1YHQN 4C1NK 2J4RA 4ISFA 3BEXA 5AQLA 2D0PA 3MWPA 4K25A 3ZEUB 5KPTA 2E1ZA 3L0QA 3ZX3A 4BRQA 1Q7YO 3QBWA 5AZJB 3FGUA 5AQWA 2P9PA 1GLEG 3SBTA 1NGDA 4QS9A 4B9QA 2W41A 5JMVA 3I56N 1TYQB 1GLAG 3CJAA 3T7ZA 3WT0A 2ZF5O 3VOVA 4CBWA 1KAYA 4CZEA 3SAGA 1JJ2M 4A5BA 2W40A 3UKUB 2ZGZA 3CCRN 2V7ZA 2P9IB 4JKDA 3WQTA 3CCUN 5AQVA 3D2FA 3TSUA 4BRAA 3N4QA 3HM8A 1QQNA 5C15A 1BDGA 3CIPA 4BRLA 5FPNA 4XH5A 3VEXA 1BU6O 3IFRA 4BC4A 4QS8A 2QWRA 3EE8A 1NLVA 3VEWA 2FF6A 2NZTA 3GDQA 3KWGA 1BA0A 4Y0WA 3VESA 5TKYA 5GAGP 4BGBA 5EOYA 4IWVA 3LDPA 2NLXA 3L4IA 3ZEUA 3CCVN 3HBTA 3HRGA 4BVOA 1V4TA 3WXLA 1QZ6A 2BTFA 1VQ4N 1N8RO 4YOVA 3MK6A 1DEJA 3G25A 4YOTA 2GEMA 4CZGA 4E1JA 2Q31A 3TSQA 4H5VA 1YJ9N 1VQ7N 4CZKA 5C10A 1BWFO 2F9WA 2GTDA 1SZ2A 4BRDA 2BH1A 2A42A 3OBYA 5ADXH 5AQPA 1X3MA 2Q2RA 1M1KO 4BRHA 5E26A 4GV3A 2WBNA 3U8XA 5EXWA 5BN8A 5JICA 3KHYA 2KLAA 4AM7A 2I7NA 1EQYA 1GLDG 3D2EA 4YDUA 3VMFB 4JD2B 3O80A 3BP8A 5ELZA 3O1WA 3CJ9A 3CMEN 5LJVA 1Q18A 4PHTX 2VYPA 3HTVA 4NLBA 4WFAL 5E84A 4JEPA 3FFKB 3VEVA 4IJAA 2ASOA 1VQON 2WC9A 3CPEA 3Q7CA 1DT9A 4BROA 4KH5A 4JHDA 2AA4A 5AQIA 3L4QA 5AQGA 4UY8O 3ENOA 2A41A 3MX2A 4C23A 5M1QA 1C0FA 1RDUA 5AZIB 3CQXA 4YOUA 3GBTA 1MDUB 4BRMA 1VQ5N 4B1XB 2VWBA 3A5NC 4H03B 4ILGB 2I7PA 5TKWA 1G99A 1QHAA 3CC4N 1Q82O 5EVZA 3C7NB 3ZX2A 1K8AO 5GINA 1NBWA 3LDLA 5CHIA 4BY9C 2HF3A 2NRRA 1YJNN 2E2OA 2E88A 1K73O 1VQKN 5CR4A 3FZMA 5AFUA 2PFUA 2NRVA 3ATUA 1JCEA 5AR0A 5KPZA 4MDAA 3VF6A 4B1VA 4FSVA 2ZJQL 2QEXN 1BA1A 1ZC6A 3ENHA 2WFBA 1Q81O 2ASPA 2HSTA 4B1UB 3P38A 5KQDA 3GG4A 4IEIA 4A2BA 1BG3A 3IUCA 2P9PB 3OBWA 3SJHA 3FZHA 4WFNL 2QXLA 3MCAB 4J8FA 1ATSA 4DHYA 4O5FA 1C0GA 5BPMA 3PLAA 3C6HA 4BR4A 3A5LC 1R59O 3N4PA 2VGMA 2HBLA 4OPHA 2QTDA 1VQLN 3VENA 3C65A 4H5NA 4MO4A 5AQKA 3S41A 1GLCG 4FPBA 5JVGL 4A59A 3GOIA 1KD1O 1JCGA 4EHUA 5JLFA 4IFEA 3HI0A 4CI6A 4JK9A 3M1FA 2KHOA 2NRWA 3R8EA 5HL7L 5BPLA 4BG8A 4FWNA 3IDHA 2QI2A 1NGIA 4YORA 4BR2A 3O9UA 1LCUA 3CXCM 3P39A 4JKAA 3VGMA 1DKGD 2HF4A 2GWKA 3TTFA 5GAHP 1O13A 2KKZA 3HZ6A 3QB0A 3AGKA 2Q36A 3FZFA 4FO0A 3NMUA 5MLCQ 2OTJN 3FR0A 2Q1NA 3ATVA 4IOCL 4BR0A 5GAEP 3WXMB 4CBUA 4CZMA 1K8KA 2QW9A 3I8BA 4BRNA 4BC5A 3NVKA 1KXPA 2YHXA 4KH4A 4H0PA 4PKHA 3F2KA 1E4FT 1BOTO 3H3NO 1GLJO 4DKWA 3I33A 4FWSA 2QWPA 2JWLA 3O4WA 2JWKA 1K9MO 2UYTA 3KK7A 1NGFA 3MWTA 2GUPA 3CHWA 4H0XB 2P9SA 1NGHA 3D2EB 4ISEA 5BRHA 3ZETB 3QFUA 5F1XA 3KVGA 2WUSA 3AARA 3VF2A 3CD6N 2FF3B 3EKSA 1NGJA 4LC9B 3WUHA 2VCPA 3MN6A 1P90A 2GWJA 3LDOA 4QS7A 2D0OA 4MLEA 1S22A 3O5BA 2ZJPL 3LM2A 2Q0UA 4JK7A 4JHDB 3RSEA 3J8AA 3UKRA 2VGNA 3LDQA 4K42A 4CZJA 4KBOA 4JK8A 3O9SA 3UB5A 3AAQA 1EO1A 4JKGA 2H3GX 4YOYA 4BVPA 3F9MA 2A5XA 4B1ZA 2YI1A 3VEZA 4YOWA 3CCMN 1VQNN 3MN7A 1U2VA 3E9LA 4WQ5C 4AM6A 1VQ9N 4DCHA 5JVHL 4IOXA 2P9UB 2YHYA 3QBXA 3BF1A 2P9LA 5AQJA 4RWTA 3CCEN 3DXKA 4EAHD 5AQFA 2NRZA 2P9KB 3ZETA 4RTFD 1YAGA 1ATNA 5AQSA 5M1OA 3CERA 3T69A 4JKFA 4GVEA 3OW2M 4BR9A 4GY2B 3BF3A 4BR7A 3MX5A 2CGLA 5FPDA 1SQKA 2OTLN 3WEEA 3CC7N 2V7YA 1HUXA 3P4IA 2HBMA 1GLFO 2AP1A 1NMDA 2RE2A 3P31A 1HLUA 4CZHA 3ULEA 4EIAA 1Q86O 3VEYA 3O8MA 1ILYA 5AQXA 3O1BA 2CH6A 3G71N 3H6EA 5BREA 3SMPA 3VTIA 2Q0RA 3ZX0A 1QVFM 3CCJN 3EE9A 4A5AA 4JN4A 1RGIA 3KZBA 5LJWA 3LL3A 3PIPL 4IJNA 2DPNA 2E2PA 2P9UA 2E2QA 3GE1A 4K43A 4NB4A 2E20A 3C0BA 4IEEA 3PIOL 3HSCA 1IJJA 3R1XA 4WFBL 1HX1A 1RDWX 2P9KA 3TU5A 1HKGA 3FE1A 4M7YA 3K9JA 2NRXA 3BUZB 3CJ7A 4IZ9A 1J6ZA 3TSPA 4Z94A 3CMAN 3R9PA 1HPMA 1NJIO 5JLHA 5AQTA 1ZBSA 4M7XA 1X3NA 4JKBA 1LOTB 1HKBA 3O08A 4FWPA 5AQOA 3W0LA 4RCHA 3NVMA 3MN5A 5AQUA 1KC8O 3E66A 4WYBA 4KH6A 4WQ4C 4B1WB 3CPWM 1YVNA 1K8KB 2QWMA 3CETA 1YITN 2CH5A 5C12A 5KPRA 1X9JA 4MLHA 4F9OA 3CCLN 4MO5A 3W3DA 5BN9A 2F7TA 2ASMA 5F0XA 4BRGA 3AAPA 4XH4A 2YJFA 3VTHA 2P9SB 5AQYA 5CE3A 1HJOA 1ZXOA 3A0IX 3MMVA 3G6EN 1VQPN 2FLOA 3Q7BA 4H5RA 5BR9A 3O9QA 4BGAA 1QVGM 4G9ZA 5FPMA 3M3ZA 2FSNA 4BRKA 4BR5A 3AGRA 5EX5A 4A61A 2CGJA 5EY4A 5ADXA 1OKJA 1S3XA 2IIRA 2E8AA 4FL9A 4MDBA 4XEIA 4FOIA 3CQYA 3RSEB 4BQLA 3DWLA 1Y64A 4BC2A 3UKRB 3CJBA 1NWKA 4WCEL 1W97L 2EWSA 4FOEA 1WUAA 4JKGB 1T6CA 1MWKA 1VQ6N 3WQUA 4B1YB 3R6MA 4PKGA 4JAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKI A;  1Z05 A;  4M63 C;  1U2V B;  1Z6R A;  4IO8 A;  3IMX A;  4H0V B;  1XC3 A;  4CBX A;  1ATR A;  1JCF A;  3A5O C;  2P9L B;  3DAW A;  3QDK A;  3DXK B;  3QML A;  3H45 C;  1KAX A;  5AFU H;  2YJE A;  2V52 B;  2NRH A;  1V4S A;  3WXI A;  3D7E O;  5AQN A;  3DJC A;  3H46 O;  4FWK A;  2CGK A;  2YHW A;  4I6M A;  2YCH A;  1GLB G;  3WEE B;  5AQM A;  5AQZ A;  2D4W A;  3H1V X;  1HKC A;  3WXJ A;  5BRF A;  3EKU A;  3ULE B;  1E4G T;  2QM1 A;  1D4X A;  5F2R A;  4BRI A;  3CJC A;  2P9N A;  3JS6 A;  3U9D A;  2GEL A;  2IVO A;  1ESV A;  2IVN A;  4WQ5 A;  5I9E B;  4BRP A;  2E1Y A;  3L6Q A;  1QZ5 A;  2FSJ A;  4FPA A;  2HOE A;  4BG9 A;  3A8Y A;  4O8K A;  5AZJ A;  3O6W A;  4H0T B;  2IVP A;  1QQO A;  4PL8 A;  2F9T A;  1RFQ A;  1TYQ A;  3EO3 A;  1BUP A;  3TPQ A;  4JNE A;  2A3Z A;  4EHT A;  3VET A;  1TUY A;  3AY9 A;  4ISG A;  3UKU A;  1H1V A;  3WXK A;  2P9I A;  4CZF A;  5KQ8 A;  2V51 B;  1XUP O;  1WOQ A;  4H5W A;  2ZWH A;  3SK3 A;  3VER A;  3B8A X;  1GLL O;  4FWL A;  2QWQ A;  3H1Q A;  1DGK N;  1MWM A;  5BPN A;  3VGL A;  1MA9 B;  5AQR A;  1SAZ A;  3JXU A;  4BRC A;  2E2N A;  4H0O A;  2PBD A;  4H5T A;  4YDU C;  1TUU A;  1NGG A;  4H0Y B;  4IXC A;  1NM1 A;  3CJ1 A;  2PAV A;  3ID8 A;  4EFH A;  5B8H A;  4BRF A;  2QWO A;  5AQH A;  2A6A A;  2BUP A;  1YXQ A;  3DXM B;  3U9Z A;  4GNI A;  4CD1 A;  2FXU A;  2D1K A;  3VEO A;  4WQ4 A;  3EN9 A;  4FWR A;  4HWI A;  3A5M C;  4PL7 A;  3VGK A;  1T6D A;  1NGE A;  2ZGY A;  4BQZ A;  3LM9 A;  4CZI A;  1T44 A;  1QQM A;  4JD2 A;  4CJ7 A;  4DQ8 A;  4FWQ A;  1U6Z A;  3M6G A;  2QWN A;  3EZW A;  3MN9 A;  1NGB A;  4BRE A;  3U4L A;  3UE5 A;  5LY3 A;  5BRD A;  3VF4 A;  3FZL A;  3SLC A;  2QWL A;  5FPE A;  3FZK A;  2OAN A;  3H3O B;  4FWO A;  4A2A A;  5AQQ A;  4NO7 A;  3LDN A;  4XH1 A;  3SMS A;  4K41 A;  4A62 A;  1CZA N;  3DXM A;  1YUW A;  1XQS C;  1NGC A;  5AZI A;  4HTL A;  3VPZ A;  4FWM A;  3QFP A;  2FSK A;  3FLC O;  1BO5 O;  4I6M B;  4L3Q A;  3D2F B;  4BC3 A;  2ITM A;  4DB3 A;  3QIC A;  3C7N A;  2HMP A;  3MCP A;  1NGA A;  1P8Z A;  4CD3 A;  2A40 A;  4CZL A;  3OHR A;  3CI5 A;  1KAZ A;  2Q97 A;  3EL2 A;  1IG8 A;  2P9N B;  3MDQ A;  3GL1 A;  2J4R A;  4ISF A;  3BEX A;  5AQL A;  2D0P A;  4K25 A;  3ZEU B;  5KPT A;  2E1Z A;  3L0Q A;  3ZX3 A;  4BRQ A;  3QBW A;  5AZJ B;  3FGU A;  5AQW A;  2P9P A;  1GLE G;  1NGD A;  4QS9 A;  4B9Q A;  2W41 A;  5JMV A;  1TYQ B;  1GLA G;  3CJA A;  3WT0 A;  2ZF5 O;  3VOV A;  4CBW A;  1KAY A;  4CZE A;  2W40 A;  3UKU B;  2ZGZ A;  2V7Z A;  2P9I B;  3WQT A;  5AQV A;  3D2F A;  4BRA A;  3HM8 A;  1QQN A;  1BDG A;  3CIP A;  4BRL A;  5FPN A;  4XH5 A;  3VEX A;  1BU6 O;  3IFR A;  4BC4 A;  4QS8 A;  2QWR A;  1NLV A;  3VEW A;  2FF6 A;  2NZT A;  3GDQ A;  3VES A;  1BA0 A;  4Y0W A;  5TKY A;  4BGB A;  5EOY A;  4IWV A;  3LDP A;  2NLX A;  3L4I A;  3ZEU A;  3HBT A;  4BVO A;  1V4T A;  3WXL A;  1QZ6 A;  2BTF A;  3MK6 A;  1DEJ A;  3G25 A;  4CZG A;  2GEM A;  4E1J A;  2Q31 A;  4H5V A;  4CZK A;  1BWF O;  2F9W A;  2GTD A;  1SZ2 A;  4BRD A;  2A42 A;  5ADX H;  5AQP A;  1X3M A;  2Q2R A;  4BRH A;  5E26 A;  3U8X A;  5EXW A;  5BN8 A;  5JIC A;  3KHY A;  4AM7 A;  2I7N A;  1EQY A;  1GLD G;  3D2E A;  4YDU A;  4JD2 B;  3O80 A;  3BP8 A;  5ELZ A;  3O1W A;  3CJ9 A;  5LJV A;  1Q18 A;  2VYP A;  3HTV A;  5E84 A;  3FFK B;  3VEV A;  4IJA A;  2ASO A;  4BRO A;  4JHD A;  2AA4 A;  5AQI A;  5AQG A;  3ENO A;  2A41 A;  4C23 A;  1C0F A;  5AZI B;  3CQX A;  3GBT A;  1MDU B;  4BRM A;  4B1X B;  2VWB A;  3A5N C;  4H03 B;  2I7P A;  1G99 A;  1QHA A;  5EVZ A;  3C7N B;  3ZX2 A;  1NBW A;  3LDL A;  2HF3 A;  2E2O A;  2E88 A;  3FZM A;  5AFU A;  5KPZ A;  3ATU A;  1JCE A;  5AR0 A;  3VF6 A;  4B1V A;  4FSV A;  1BA1 A;  1ZC6 A;  3ENH A;  2ASP A;  4B1U B;  5KQD A;  3GG4 A;  4A2B A;  1BG3 A;  3IUC A;  2P9P B;  3SJH A;  3FZH A;  2QXL A;  4J8F A;  1ATS A;  4DHY A;  4O5F A;  1C0G A;  5BPM A;  4BR4 A;  3A5L C;  1R59 O;  3VEN A;  4H5N A;  4MO4 A;  5AQK A;  3S41 A;  1GLC G;  4FPB A;  3GOI A;  1JCG A;  4EHU A;  5JLF A;  3HI0 A;  4CI6 A;  3M1F A;  2KHO A;  3R8E A;  5BPL A;  4BG8 A;  4FWN A;  3IDH A;  1NGI A;  4BR2 A;  1LCU A;  3VGM A;  1DKG D;  2HF4 A;  2GWK A;  3HZ6 A;  3QB0 A;  2Q36 A;  3FZF A;  4FO0 A;  3FR0 A;  2Q1N A;  3ATV A;  4BR0 A;  4CBU A;  4CZM A;  1K8K A;  2QW9 A;  3I8B A;  4BRN A;  4BC5 A;  1KXP A;  2YHX A;  4H0P A;  4PKH A;  1E4F T;  1BOT O;  3H3N O;  1GLJ O;  3I33 A;  4FWS A;  2QWP A;  3O4W A;  2UYT A;  1NGF A;  2GUP A;  3CHW A;  4H0X B;  2P9S A;  1NGH A;  3D2E B;  4ISE A;  5BRH A;  3ZET B;  3QFU A;  5F1X A;  3KVG A;  2WUS A;  3AAR A;  3VF2 A;  2FF3 B;  3EKS A;  1NGJ A;  4LC9 B;  3WUH A;  2VCP A;  3MN6 A;  2GWJ A;  3LDO A;  4QS7 A;  2D0O A;  4MLE A;  1S22 A;  3O5B A;  3LM2 A;  2Q0U A;  4JHD B;  3RSE A;  3J8A A;  3UKR A;  3LDQ A;  4K42 A;  4CZJ A;  4KBO A;  3UB5 A;  3AAQ A;  2H3G X;  4BVP A;  3F9M A;  2A5X A;  4B1Z A;  2YI1 A;  3VEZ A;  3MN7 A;  1U2V A;  4WQ5 C;  4AM6 A;  4DCH A;  2P9U B;  2YHY A;  3QBX A;  3BF1 A;  2P9L A;  5AQJ A;  4RWT A;  3DXK A;  4EAH D;  5AQF A;  2P9K B;  3ZET A;  4RTF D;  1YAG A;  1ATN A;  5AQS A;  3CER A;  4BR9 A;  4GY2 B;  3BF3 A;  4BR7 A;  2CGL A;  5FPD A;  1SQK A;  3WEE A;  2V7Y A;  1HUX A;  3P4I A;  1GLF O;  2AP1 A;  1NMD A;  1HLU A;  4CZH A;  3ULE A;  4EIA A;  3VEY A;  3O8M A;  5AQX A;  3O1B A;  2CH6 A;  3H6E A;  5BRE A;  3SMP A;  2Q0R A;  3ZX0 A;  4JN4 A;  1RGI A;  3KZB A;  5LJW A;  3LL3 A;  4IJN A;  2DPN A;  2E2P A;  2P9U A;  2E2Q A;  3GE1 A;  4K43 A;  4NB4 A;  2E20 A;  3C0B A;  3HSC A;  1IJJ A;  1HX1 A;  1RDW X;  2P9K A;  3TU5 A;  1HKG A;  3FE1 A;  4M7Y A;  3BUZ B;  3CJ7 A;  4IZ9 A;  1J6Z A;  4Z94 A;  3R9P A;  1HPM A;  5JLH A;  5AQT A;  1ZBS A;  4M7X A;  1X3N A;  1LOT B;  1HKB A;  3O08 A;  4FWP A;  5AQO A;  3W0L A;  4RCH A;  3MN5 A;  5AQU A;  4WYB A;  4WQ4 C;  4B1W B;  1YVN A;  1K8K B;  2QWM A;  3CET A;  2CH5 A;  5KPR A;  1X9J A;  4MLH A;  4F9O A;  4MO5 A;  3W3D A;  5BN9 A;  2ASM A;  5F0X A;  4BRG A;  3AAP A;  4XH4 A;  2YJF A;  2P9S B;  5AQY A;  5CE3 A;  1HJO A;  1ZXO A;  3A0I X;  3MMV A;  2FLO A;  4H5R A;  5BR9 A;  4BGA A;  5FPM A;  3M3Z A;  2FSN A;  4BRK A;  4BR5 A;  5EX5 A;  4A61 A;  2CGJ A;  5EY4 A;  5ADX A;  1OKJ A;  1S3X A;  2IIR A;  2E8A A;  4FL9 A;  4XEI A;  4FOI A;  3CQY A;  3RSE B;  4BQL A;  3DWL A;  1Y64 A;  4BC2 A;  3UKR B;  3CJB A;  1NWK A;  2EWS A;  4FOE A;  1WUA A;  1T6C A;  1MWK A;  3WQU A;  4B1Y B;  3R6M A;  4PKG A;  4JAX A; 
#chains in the Genus database with same CATH topology
 4PKI A;  2EX3 A;  3DLL L;  1DTT A;  1Z6R A;  1SL1 A;  4FLT A;  5GAD P;  3RVC A;  4AF1 A;  3P1G A;  3DAW A;  4CGF A;  3H45 C;  4FVU A;  4DR1 K;  2NRH A;  2WOM A;  3S9H A;  3WXI A;  3QEP A;  2P5G A;  1WSJ A;  1SKS A;  4M3R A;  5C0Y A;  3PO5 A;  2YCH A;  3MEC A;  5AQM A;  4N41 A;  2D4W A;  5BRF A;  3WXJ A;  4F3T A;  3EKU A;  1E4G T;  1RDB A;  3IG1 A;  3CJC A;  3JS6 A;  4DV6 K;  1OVY A;  1ESV A;  5I9E B;  3T19 A;  1VSF A;  4H4M A;  4E7H A;  3L6Q A;  1TVR A;  2NNW A;  4DR3 K;  3JSM A;  1XNR K;  1S5J A;  4PL8 A;  3ZLJ A;  1RFQ A;  2HND A;  3EO3 A;  3VET A;  1TUY A;  1N34 K;  4EP4 A;  5GIO A;  2P9I A;  3CG7 A;  4CZF A;  5KQ8 A;  2V51 B;  1TKD A;  1M90 O;  4QOZ B;  2ZWH A;  2G8H A;  3DLK A;  3B8A X;  5HRO A;  4GV6 A;  1BIS A;  1NJX A;  1DGK N;  4OPA A;  4CHY A;  1C1B A;  3ZT4 A;  1RBS A;  4H0O A;  4LY7 A;  4LSL A;  4M45 A;  1XWL A;  4FZY A;  3HPO A;  4JKE A;  3G4S N;  2DFE A;  5B8H A;  1T8E A;  3IKM A;  2D5R A;  3OTO K;  4BE2 A;  1FW6 A;  4JKH A;  4DFJ A;  2NUB A;  4CD1 A;  3CFP A;  2D1K A;  5SZT A;  4WQ4 A;  3SI6 A;  3ZSX A;  3A5M C;  1U47 A;  1T6D A;  4BQZ A;  4BWJ A;  2QA4 N;  3HOS A;  3VQ6 A;  3KLH A;  1HMV A;  3HT3 A;  4LFC K;  4DQ8 A;  3C94 A;  4JD2 A;  1EX4 A;  1VSK A;  1RDA A;  4JI3 K;  1IO2 A;  3EZW A;  1XI1 A;  3C6T A;  1NGB A;  4YOX A;  4ZTJ A;  1FKO A;  4BRE A;  1NK9 A;  3VF4 A;  3SLC A;  4E7L A;  3O9T A;  4FWO A;  4A2A A;  4YNQ A;  4XH1 A;  3K9K A;  3THW B;  3J7Z O;  4A62 A;  1YJW N;  4KRF A;  3DXM A;  4HTL A;  3VPZ A;  2B6A A;  3NF6 A;  1KQS M;  4E3S A;  2JGU A;  3QIC A;  4CD3 A;  1NK7 A;  4I2P A;  3M5R A;  5HRN A;  1L3V A;  2P9N B;  2X74 A;  3GL1 A;  1S1V A;  3RWU A;  3HPG A;  4C1N K;  3K2P A;  1TK5 A;  4XIU A;  3MWP A;  3OYH A;  3L0Q A;  4FK2 A;  3ZX3 A;  4BRQ A;  1QE1 A;  1GLE G;  4CK3 A;  4BDY A;  3SBT A;  2VWK A;  4QS9 A;  3SV3 A;  3I56 N;  2X78 A;  1GLA G;  3WT0 A;  4KAZ A;  3VOV A;  1JJ2 M;  2F8T A;  3UKU B;  2V7Z A;  3WQT A;  3HVR A;  2O8C B;  2P1J A;  5AQV A;  3TSU A;  4BRA A;  3AO4 A;  3S3O A;  4DUZ K;  3CIP A;  5HRS A;  4F8R A;  1WSI A;  3L2Q A;  2O8F A;  1U4B A;  3EE8 A;  5HP1 A;  2X6S A;  3VEW A;  2NZT A;  3KWG A;  4Y0W A;  5TKY A;  2D0A A;  4IWV A;  4DQS A;  2NLX A;  3AVI A;  4KTW A;  1EWQ A;  4NXN K;  1UA1 A;  3T1H K;  4BVO A;  3T1A A;  1QZ6 A;  3SCX A;  3NF9 A;  3TSQ A;  4H5V A;  1YJ9 N;  2HVI A;  2G8V A;  1YTA A;  1N5Y A;  5AQP A;  2HB5 A;  1M1K O;  4GV3 A;  2WBN A;  3U8X A;  5EXW A;  3OYN A;  3K59 A;  4PUO A;  1J5E K;  2VQF K;  2I7N A;  4LF6 K;  4DV3 K;  3VMF B;  3O80 A;  5ELZ A;  3O1W A;  3CJ9 A;  1XMQ K;  4GMJ B;  3DM2 A;  4WFA L;  5E84 A;  3FFK B;  2ASO A;  4OKJ A;  1KSP A;  4OKE A;  4AIL C;  2HHQ A;  1LAV A;  3LWM A;  1RTH A;  2A41 A;  3ULD A;  2UXC K;  4J2A A;  4EZ6 A;  3CQX A;  3NFA A;  4BRM A;  4B1X B;  2VWB A;  4H03 B;  5TKW A;  3QIN A;  1G99 A;  3QEX A;  4KO0 A;  3C7N B;  4FLZ A;  3P83 D;  2DTU A;  1X9W A;  1VQK N;  4CF0 A;  3FZM A;  5KPZ A;  3HM9 A;  2NRV A;  3ATU A;  2KQ2 A;  4Q5V A;  1NJZ A;  3LAM A;  3VF6 A;  4DV5 K;  4ICL A;  1Q81 O;  3THV A;  1S1W A;  3VQD A;  4ELV A;  3I0S A;  4K8X A;  3NDK A;  4DF8 A;  1N33 K;  1RT1 A;  2QXL A;  1R0A A;  2PYL A;  1ATS A;  4JI1 K;  5BPM A;  4H5N A;  5E41 A;  3NF8 A;  1GLC G;  1HYZ A;  3HJF A;  4DU3 A;  4DLE A;  3LAN A;  2UU9 K;  2D0B A;  5DMR A;  3SQ1 A;  3QEW A;  2FBT A;  4JK9 A;  1YT3 A;  4M3X A;  3LP2 A;  4O44 A;  3HL8 A;  2Z1G A;  4BR2 A;  4M3W A;  2HF4 A;  3TTF A;  1O13 A;  3LPU A;  3KTQ A;  3QB0 A;  3ZCM A;  2YNI A;  3SNN A;  4CJK A;  3OYD A;  2OTJ N;  1JL1 A;  3FR0 A;  4IFY A;  1UAX A;  4HTU A;  3KK3 A;  1K8K A;  4NCA A;  3VA0 A;  1KXP A;  3F2K A;  1SKR A;  3H3N O;  2QKK A;  4DKW A;  3HST B;  3THX A;  3I33 A;  3LZI A;  2IOC A;  2P9S A;  3K0S A;  3D2E B;  1YVU A;  1GOB A;  2GV9 A;  3JAM O;  1WN7 A;  3CD6 N;  1S9G A;  5CY4 A;  2Q3S A;  3WUH A;  4PA1 A;  3MN6 A;  4GW6 A;  2BAN A;  3PSF A;  3RSE A;  2BE2 A;  4K42 A;  4FJL A;  1KLN A;  4O5B A;  1D5A A;  1EO1 A;  2BGG A;  1IKW A;  4KPY A;  3F9M A;  4B1Z A;  4YOW A;  4IKF A;  1VQN N;  3MN7 A;  1S1U A;  4DTO A;  4AHV A;  2P9U B;  3AVG A;  2YHY A;  4RWT A;  2P9L A;  2IS3 A;  3ZET A;  4E1M A;  4RTF D;  4B9N A;  3DLG A;  4BR9 A;  4GY2 B;  3RMC A;  3MEE A;  2HHS A;  2CGL A;  5FPD A;  3WEE A;  2V7Y A;  1HUX A;  4YHH K;  2HBM A;  4RW7 A;  4CEO A;  3PO4 A;  3VEY A;  2YNH A;  3O8M A;  4FJG A;  3VQ4 A;  2Q0R A;  3KIO A;  3CCJ N;  3EE9 A;  4A5A A;  1RGI A;  1RIL A;  3LL3 A;  2DPN A;  2E2P A;  2E2Q A;  4K43 A;  2E20 A;  3PIO L;  3HSC A;  3R1X A;  4IBN A;  3TU5 A;  2KFZ A;  3AA5 X;  3DRS A;  1J6Z A;  4Z94 A;  1HPM A;  4M3Y A;  1ZBS A;  4JKB A;  5AQO A;  3OS2 A;  2A1R A;  3HK2 A;  4WYB A;  3A2F A;  4FW1 A;  3C6U A;  3KK1 A;  2QWM A;  1YIT N;  5C12 A;  4MLH A;  4F9O A;  4MO5 A;  4LF8 K;  2F7T A;  3WNE A;  3DLE A;  4B9V A;  2B4J A;  4DTP A;  3PV8 A;  4B3T K;  2OCE A;  5CYQ A;  1TKT A;  5BR9 A;  1NKB A;  1QVG M;  2QK9 A;  3O9Q A;  3KK2 A;  2G8K A;  2WTU A;  4BRK A;  3AGR A;  2RN2 A;  3WNG A;  5EY4 A;  1WSG A;  2E6L A;  3K58 A;  2E8A A;  3VQ5 A;  2XY7 A;  2DFH A;  3CQY A;  4BQL A;  3DWL A;  3CJB A;  4Y1D A;  3K5N A;  4FOE A;  2E5L K;  3AVH A;  1Z05 A;  3O9R A;  3ENB A;  3CF5 L;  1HRH A;  1U2V B;  4NXM K;  3IMX A;  3OYM A;  1JCF A;  3A5O C;  4DQR A;  4FLW A;  4W5Q A;  1EXQ A;  1Q8I A;  4E89 A;  5HOO A;  5AQN A;  3G10 A;  3DJC A;  5KRT A;  1T3V A;  2CGK A;  1VRU A;  4B9S A;  1GLB G;  3AO1 A;  4ID5 A;  5C25 A;  3TTC A;  2OZM A;  5F2R A;  1VQM N;  4U7B A;  3OA9 A;  3R3L A;  1QZ5 A;  4CFB A;  4FPA A;  3ALY A;  5AZJ A;  4O55 A;  3I55 N;  4H0T B;  2IVP A;  1NK5 A;  1ZBU A;  1A5X A;  2F9T A;  1TYQ A;  4ID1 A;  4ZTF A;  1BUP A;  4N47 A;  3SQ2 A;  4M41 A;  5J2Q A;  4ISG A;  4CHZ A;  5HBM A;  3CCS N;  4M3Z A;  3WXK A;  1HQE A;  5M1F A;  4OGE A;  4J2E A;  1IBK K;  1WOQ A;  4H5W A;  3SK3 A;  3VER A;  4OPJ A;  3D6R A;  1SL2 A;  1GLL O;  4FM0 A;  2NRT A;  4PWD A;  3ISN C;  1MWM A;  1XHZ A;  4FJK A;  3TAR A;  2Z1I A;  4BRC A;  2PBD A;  1VSM A;  4YDU C;  1NG9 A;  3HXM A;  1NGG A;  1VSE A;  2HBK A;  2HHV A;  4H0Y B;  4IXC A;  3C95 A;  1NM1 A;  3NBP A;  3CJ1 A;  2PAV A;  4J2B A;  4EFH A;  4LF4 K;  3F73 A;  4BRF A;  3MED A;  4CJQ A;  4AQY K;  3H08 A;  2KFN A;  4ILJ A;  3DXM B;  4JYA K;  2GX9 A;  4GNI A;  3D0P A;  4KB1 A;  1QS4 A;  2EHG A;  2P51 A;  1VAZ A;  3EN9 A;  4HWI A;  1WSE A;  4PL7 A;  1LV5 A;  2ZGY A;  1NMN A;  3LM9 A;  3CC2 N;  4DSL A;  1GOA A;  2AJQ A;  1T44 A;  4FWQ A;  4WF9 L;  1WSH A;  3M6G A;  1LWC A;  3DI6 A;  1ZBL A;  3MN9 A;  4JS5 A;  1S72 N;  3UE5 A;  5BRD A;  2OPS A;  3VQE A;  3HP6 A;  2QWL A;  5H1S Q;  2OAN A;  3H3O B;  1YTU A;  4GV9 A;  5AQQ A;  2O4I A;  4NO7 A;  1NOZ A;  4FLX A;  1CZA N;  3SAF A;  1XQS C;  1RDC A;  5AZI A;  2X6N A;  2F8S A;  4FWM A;  5JS2 A;  3OYA A;  1BO5 O;  3OVN A;  4I6M B;  4L3Q A;  3TAN A;  1RTD A;  2ITM A;  5C24 A;  2HMP A;  2O8E A;  2A40 A;  3CI5 A;  3V9S A;  1QTM A;  2J4R A;  3BEX A;  2D0P A;  4K25 A;  2E1Z A;  1CZ9 A;  3SPZ A;  3FGU A;  3AVM A;  4V19 S;  5HLF A;  4KI6 A;  1NK0 A;  4B9Q A;  2W41 A;  4CBW A;  4N76 A;  4M3T A;  2W40 A;  2ZGZ A;  1RTJ A;  3D2F A;  1BI4 B;  4CJV A;  1QQN A;  5C15 A;  4AHR A;  2ZM6 K;  3V9Z A;  4BRL A;  5FPN A;  4F2R A;  3VEX A;  5I3U A;  3IFR A;  1NKC A;  4CGD A;  1NLV A;  3GDQ A;  3VES A;  3OYI A;  4B9U A;  4BGB A;  3PX0 A;  3HRG A;  3WXL A;  4YOV A;  4YOT A;  2GEM A;  1TL3 A;  1LW2 A;  3THY B;  1VQ7 N;  4CZK A;  1BWF O;  1SZ2 A;  3FFI A;  1X3M A;  1X1P A;  4FJ5 A;  5E26 A;  1IBM K;  1VSH A;  1I39 A;  3M8Q A;  1KVA A;  5BN8 A;  3KHY A;  2KLA A;  1BIU A;  4YDU A;  3JYT A;  4C8O A;  1JLB A;  1Q18 A;  3DLR A;  3B6P A;  3WNH A;  4LH4 A;  1OH5 A;  1WAF A;  1VQO N;  1NOY A;  1J5O A;  3CPE A;  3Q7C A;  1DT9 A;  4CJF A;  4BRO A;  4JHD A;  3HPH A;  5AQI A;  4FCY A;  3MX2 A;  4JI2 K;  1C0F A;  4CEA A;  2IDO A;  3GBT A;  2UXB K;  4AHS A;  4DFK A;  1MDU B;  1VQ5 N;  3ZT2 A;  4ILG B;  3CC4 N;  3SYZ A;  5EVZ A;  3ZX2 A;  1K8A O;  1NBW A;  5CHI A;  1VSJ A;  2KTQ A;  2NRR A;  1K73 O;  3NMU A;  5CR4 A;  1JCE A;  3TR8 A;  5CZ1 A;  2O8B B;  3ENH A;  4FJ9 A;  4B1U B;  1BG3 A;  3LDS A;  2P9P B;  4WFN L;  4CJT A;  2UXD K;  3MCA B;  5J2M A;  4O5F A;  1OH8 A;  4OPH A;  3VEN A;  3C65 A;  3TAQ A;  4MO4 A;  1RCH A;  1KD1 O;  3THX B;  4CEE A;  5JLF A;  5AJ3 K;  4CI6 A;  1RT4 A;  2NRW A;  3M1F A;  3SUN A;  2ITG A;  5HL7 L;  2XY8 A;  4FWN A;  3OYK A;  2QI2 A;  3KD5 E;  2YNF A;  4JKA A;  1DKG D;  4K8Z A;  3PSI A;  4FJ8 A;  3FZF A;  2OA8 A;  3ATV A;  2HHH K;  1HNZ K;  3CFR A;  4CZM A;  4BRN A;  4BC5 A;  1WB9 A;  2YHX A;  4KH4 A;  4H0P A;  1N36 K;  1RT3 A;  3OYE A;  2W6K A;  3S3M A;  1GLJ O;  4CGH A;  1NKE A;  3O4W A;  1K9M O;  2UYT A;  4CEF A;  3KK7 A;  1NGF A;  2YKM A;  3TAF A;  4ISE A;  3RR7 A;  3LP3 A;  5BRH A;  3ZET B;  1L3U A;  1BGX T;  3QFU A;  4KHW A;  2WUS A;  1NGJ A;  4LC9 B;  3M8S A;  2GWJ A;  3LDO A;  5IWA K;  2D0O A;  2XY5 A;  3O5B A;  2ZJP L;  2FC0 A;  3RMA A;  2RPI A;  4JK7 A;  3J8A A;  4DR2 K;  3UKR A;  4JK8 A;  3LPT A;  4JKG A;  4EZ9 A;  4JLH A;  4BVP A;  3SJJ A;  3SQ0 A;  3KLI A;  5FDL A;  3VEZ A;  2I5J A;  3E9L A;  3QBX A;  5AQF A;  4KB0 A;  5J2P A;  5M1O A;  1I94 K;  3AO2 A;  4GVE A;  2GBZ A;  2G8W A;  3OW2 M;  4FVM A;  1U45 A;  4DR6 K;  1SQK A;  2OTL N;  3HYF A;  2E4L A;  2HMI A;  4BDZ A;  4CJ4 A;  3P31 A;  2AP1 A;  1NMD A;  1Q86 O;  1EET A;  3UIQ A;  1ZYQ A;  3AVA A;  4DF4 A;  3O1B A;  4CEQ A;  3G71 N;  4EP5 A;  3KLG A;  3QIO A;  2VWJ A;  3OYB A;  3PIP L;  4IJN A;  3GE1 A;  1KRP A;  1HX1 A;  4OKK A;  2P9K A;  3QO9 A;  1HKG A;  1VK0 A;  2NRX A;  3BUZ B;  3CJ7 A;  4IZ9 A;  3OYL A;  3L2R A;  3CMA N;  2VG6 A;  5JLH A;  1X3N A;  1GOC A;  1HKB A;  3O08 A;  4FWP A;  4CFD A;  4DLG A;  3MN5 A;  5AQU A;  4DSE A;  4KH6 A;  1O1W A;  5KPR A;  1KFS A;  3CCL N;  3W3D A;  4X65 K;  3M8R A;  5BN9 A;  1DTQ A;  2ASM A;  1RT7 A;  5F0X A;  3VTH A;  1ZXO A;  3A0I X;  1KVC A;  4CGI A;  4BGA A;  3L3U A;  1HJR A;  4DQP A;  3M3Z A;  4BR5 A;  4Z4I A;  2CGJ A;  4OX9 K;  1FXX A;  5D3G A;  4DTS A;  4FJH A;  4MDB A;  4XEI A;  3KKR A;  4FOI A;  1SKW A;  4H8K A;  1D8Y A;  1Y97 A;  3VN5 A;  4WCE L;  2EWS A;  2F96 A;  1WUA A;  1ZBI A;  4MDA A;  4W5O A;  4H4O A;  5HRR A;  3E1Y A;  3SBG A;  4M63 C;  3D45 A;  4IO8 A;  1XC3 A;  1ATR A;  2UUB K;  4DV7 K;  3DXK B;  5K14 A;  3EY1 A;  3VQP A;  1KAX A;  5AFU H;  5HRP A;  2YJE A;  1CXU A;  2V52 B;  2PYJ A;  2LSN A;  3T1Y K;  3D7E O;  2KW4 A;  3AVK A;  5DM7 L;  4M42 A;  4W5T A;  3AVB A;  3S3N A;  1NK6 A;  2YHW A;  3HOT A;  1BCM A;  3L8B A;  4B9T A;  2XY6 A;  1HKC A;  5DM6 L;  5GIP A;  3TI0 A;  4WE1 A;  3E9O A;  3ULE B;  2QM1 A;  5C2D A;  4CJW A;  4KRE A;  4LH5 A;  2P9N A;  4B8C A;  5FRM A;  3U9D A;  2HHX A;  1CZB A;  2IVO A;  2HBJ A;  1NK4 A;  2E1Y A;  4M3U A;  3ID6 A;  4CED A;  3MXM A;  1E3M A;  2HOE A;  4BG9 A;  3A8Y A;  4O8K A;  4IO9 L;  1VSL A;  4HVJ A;  3O3H A;  1QQO A;  3E9P A;  4Q0B A;  3OS1 A;  1TK0 A;  4CJS A;  3AY9 A;  3UKU A;  2O8C A;  4KHU A;  1XUP O;  1YF5 L;  3LAK A;  3LWL A;  4FK0 A;  2DFF A;  3ASM A;  1W2B M;  2B5J A;  4FK4 A;  3OY9 A;  3MXJ A;  1L5U A;  4RW6 A;  2ZQB A;  4IG3 A;  1SAZ A;  4C8L A;  4Z4F A;  4H5T A;  4PQU A;  3VA3 A;  4C8N A;  3V1R A;  3ZSY A;  3MXI A;  3ID8 A;  5M1P A;  1J54 A;  5AQH A;  5A2Q O;  4Z4E A;  2BUP A;  1YXQ A;  3AVL A;  4TSX A;  1ZBH A;  1Q9X A;  1S1T A;  2FXU A;  4O4G A;  4KFB A;  3U6F A;  2ZJR L;  2ZE2 A;  3VGK A;  2GUI A;  2O8E B;  4DV1 K;  4CGJ A;  1ITG A;  2G8F A;  1YIJ N;  1QQM A;  1CLQ A;  1YI2 N;  4U67 L;  2QWN A;  4J2D A;  3CCQ N;  2A1S A;  3F5T A;  3U4L A;  5IT9 O;  1J53 A;  5FPE A;  3FZK A;  3NH0 A;  1T05 A;  1T7P A;  1MU2 A;  4JI5 K;  3SMS A;  4C1N I;  4CK1 A;  4R79 A;  4DSF A;  3V6D A;  4LF5 K;  4OO1 J;  3QFP A;  3FLC O;  3D2F B;  4BE1 A;  4BC3 A;  3O3F A;  2VG5 A;  4DB3 A;  1KFD A;  3C7N A;  1P8Z A;  4CZL A;  3AVC A;  3OHR A;  1W7A A;  1KAZ A;  2W42 A;  2Q97 A;  3EL2 A;  1IG8 A;  4QCL A;  4KHN A;  3QIP A;  1YHQ N;  1IKV A;  4RG8 A;  5KPT A;  3QBW A;  4DV0 K;  1NGD A;  3VQA A;  3T7Z A;  3CJA A;  4B8A B;  2ZF5 O;  5CZ2 A;  3QEI A;  4CZE A;  4DR5 K;  4A5B A;  4LFB K;  3CCR N;  3KLE A;  2P9I B;  4JKD A;  4JRQ A;  3N4Q A;  1OH7 A;  1F21 A;  1BDG A;  2RKI A;  5KRS A;  4N5S A;  1BU6 O;  4KHQ A;  4QS8 A;  3I8D A;  2QWR A;  4E7I A;  3EZ5 A;  4KHY A;  5GAG P;  5J1E A;  3NHG A;  3RR8 A;  4DTN A;  4CCH A;  5EOY A;  3L4I A;  3ZEU A;  3HBT A;  1NK8 A;  1Z26 A;  1VQ4 N;  2HVH A;  1QSY A;  4Z4G A;  3MK6 A;  4DR4 K;  4CZG A;  2Q31 A;  3QES A;  3K5M A;  2GTD A;  4BRD A;  3J7A P;  4BRH A;  1HR0 K;  3V1O A;  3AO3 A;  5JIC A;  2IAJ A;  4AM7 A;  4UQG A;  4FM1 A;  1TK8 A;  3D2E A;  3J7Y P;  4JD2 B;  3CME N;  1XNQ K;  1RTI A;  4CHQ A;  5LJV A;  4PHT X;  3DOK A;  5SWM A;  5I42 A;  4IJA A;  2HHU A;  2XHB A;  1ZBF A;  4CF2 A;  3PUF A;  1LAW A;  2AA4 A;  3L4Q A;  5AQG A;  4UY8 O;  3ENO A;  3M8P A;  1RDU A;  3ZSW A;  2O4G A;  4YOU A;  3V9W A;  3TAP A;  1S6Q A;  4DTR A;  2I7P A;  3SZ2 A;  3SUO A;  1KLM A;  1QHA A;  4CE9 A;  2FBV A;  4AHU A;  2UUA K;  1Q82 O;  3DRP A;  4JS4 A;  1EP4 A;  1YJN N;  2E2O A;  3J81 O;  4JI4 K;  4JV5 K;  1HYS A;  5AFU A;  2PFU A;  4GKK K;  5AR0 A;  3QER A;  2ZJQ L;  2Y1I A;  3KLF A;  1BA1 A;  1ZC6 A;  4JI6 K;  4X64 K;  4FJJ A;  2HST A;  4KI4 A;  4FW2 A;  5KQD A;  3P38 A;  3ZT1 A;  4IEI A;  4A2B A;  4FLV A;  1QSS A;  3OBW A;  3SJH A;  3AA3 A;  1W0H A;  3FZH A;  2DY4 A;  4CW7 B;  1NJW A;  5LMN K;  4J8F A;  4DU4 A;  4DHY A;  4E1N A;  3PLA A;  3A5L C;  1R59 O;  3N4P A;  2VGM A;  2HBL A;  1VQL N;  2QTD A;  4CIF A;  4OLB A;  4KTQ A;  1NNE A;  5JVG L;  3GOI A;  1JCG A;  2XO7 A;  4LF9 K;  3HVT A;  4EHU A;  1BL3 A;  1XMO K;  2O8F B;  2KHO A;  4QAG A;  2OPR A;  1WNS A;  4CK2 A;  5BPL A;  1BHL A;  3IDH A;  1NGI A;  1FK9 A;  5BR8 K;  3O9U A;  3VQB A;  1RBR A;  3LAL A;  3OYG A;  4FLU A;  3AGK A;  2Q36 A;  5KGX A;  4DFP A;  4FO0 A;  2O8D A;  5MLC Q;  2Q1N A;  1I3A A;  1JKH A;  4DSI A;  4CBU A;  4PKH A;  3ZSR A;  3V9U A;  4HUF A;  4CFA A;  2JWL A;  2JWK A;  4FZX C;  4CFC A;  1IKY A;  4IG0 A;  3ZSQ A;  3OYJ A;  3G0Z A;  1JLA A;  5F1X A;  2F4V K;  3AAR A;  3VF2 A;  2FF3 B;  1QQC A;  3CM6 A;  3EKS A;  4CIE A;  4I2Q A;  4DS4 A;  4I9Q A;  4FJM A;  1JLE A;  4MLE A;  1S22 A;  3LM2 A;  1S9E A;  3RTV A;  2FBX A;  2Q0U A;  4FJ7 A;  4OPK A;  2VGN A;  3LDQ A;  4L8R B;  1XHX A;  4C8K A;  3AAQ A;  2G8I A;  4AHT A;  4YOY A;  2YI1 A;  3CCM N;  1U2V A;  1HQU A;  3BZC A;  4WQ5 C;  4AM6 A;  5JVH L;  4IOX A;  1J9A A;  4AH9 A;  2Z1J A;  3BF1 A;  5AQJ A;  3CCE N;  4EAH D;  2P9K B;  3MEG A;  1YAG A;  1ATN A;  5AQS A;  4GKJ K;  3V81 A;  2VQE K;  3CER A;  4LF7 K;  3BDP A;  4LFA K;  5LMU K;  1EKE A;  4BR7 A;  3MX5 A;  1D9F A;  1LW0 A;  3AA4 A;  3QET A;  1X9M A;  2QKB A;  3E01 A;  1HLU A;  4EIA A;  4ZHR A;  1VHX A;  4BDP A;  4O0I A;  1JXE A;  2CH6 A;  3TAE A;  3VQ9 A;  4JN4 A;  3MAQ A;  5LJW A;  3KZB A;  1UA0 A;  1B9D A;  3C0B A;  3LP1 A;  1IJJ A;  4WFB L;  3AO5 A;  1U49 A;  4M7Y A;  3FE1 A;  4DV2 K;  4ELT A;  4W5R A;  1BQN A;  1NJI O;  3CFO A;  5AQT A;  2W6L A;  3RRH A;  4DQI A;  4CJU A;  1LOT B;  1C0M A;  4Z0U A;  1LWF A;  4RCH A;  3V1Q A;  4LD0 A;  3WNF A;  1Q9Y A;  1K8K B;  1DLO A;  3O3G A;  3BGR A;  1HYV A;  1KVB A;  4XH4 A;  2YJF A;  4HCB A;  2P9S B;  5AQY A;  3ZSO A;  3DYA A;  1C0T A;  3G6E N;  1VQP N;  4H5R A;  3Q7B A;  2D0C A;  4G9Z A;  3IS9 A;  2FSN A;  1IBL K;  5EX5 A;  4A61 A;  4DTX A;  3VQ7 A;  1L3S A;  2IIR A;  1HPZ A;  4FLY A;  4KHP K;  3RSE B;  4BC2 A;  3KJV A;  3QNO A;  1TKX A;  1MWK A;  1VQ6 N;  3WQU A;  3R6M A;  4PKG A;  4JAX A;  4E0D A;  4A57 A;  1UWB A;  2BDP A;  4H0V B;  2RHK A;  4F2S A;  4CBX A;  3OJU A;  3TAG A;  3PX4 A;  2P9L B;  3QDK A;  3RRG A;  3QML A;  3CM5 A;  4ILH A;  1V4S A;  5DK5 A;  3H46 O;  4FWK A;  5M1K A;  3NGZ A;  4DV4 K;  4I6M A;  3WEE B;  5AQZ A;  4N56 A;  3H1V X;  4CJP A;  2R7Y A;  1D4X A;  4DTJ A;  3NH2 A;  4IOA L;  4GVM A;  4BRI A;  3O4Q A;  1TGO A;  1S6P A;  2GEL A;  2IVN A;  4WQ5 A;  1TV6 A;  4BRP A;  4OVL A;  2FSJ A;  1FJG K;  3KWI A;  4C8M A;  4DSK A;  3SAH A;  3O6W A;  3AVF A;  1NJY A;  4MFB A;  1WLJ A;  3TPQ A;  1NU0 A;  4JNE A;  2A3Z A;  4EHT A;  3OYC A;  4B3S K;  4OGC A;  5KGW A;  1H1V A;  1BI4 A;  4CJE A;  2HHT A;  1JLG A;  4CEB A;  4DUY K;  4FWL A;  2QWQ A;  3C6A A;  3H1Q A;  5BPN A;  3VGL A;  1MA9 B;  5AQR A;  3VQ8 A;  3JXU A;  2E2N A;  1WBB A;  1TUU A;  2E6M A;  4O8U A;  1SS6 A;  1FKP A;  1TAQ A;  3AA2 A;  2QWO A;  3L2W A;  2A6A A;  4JKC A;  3THY A;  3LZJ A;  3TAM A;  4HUE A;  4KTZ A;  3U9Z A;  5M1N A;  1RT5 A;  3VEO A;  2FBY A;  3T3F A;  3ZSV A;  4FWR A;  1ASW A;  1NGE A;  1BCO A;  3ZYY X;  4RW9 A;  4CZI A;  4CJ7 A;  1U6Z A;  4IDH A;  4NLC A;  1W9H A;  3OS0 A;  1VSD A;  1RBV A;  3DMJ A;  5LY3 A;  3PX6 A;  4CHP A;  3FZL A;  2IGI A;  3TTD A;  1JLF A;  3L2V A;  3LDN A;  4HUG A;  1QHT A;  4K41 A;  4DSJ A;  2YX6 A;  4NCB A;  2XRI A;  1YUW A;  4CES A;  1NGC A;  1BQM A;  3SUP A;  2FSK A;  3L3V A;  1T03 A;  4YY3 K;  4RW8 A;  1VQ8 N;  2JLE A;  1L3T A;  3MCP A;  1B9F A;  1NGA A;  5C2F A;  2KZM A;  1RDD A;  5EU7 A;  4CJL A;  3OJS A;  1RT6 A;  3MDQ A;  5FRO A;  1TAU A;  2O8B A;  4ISF A;  3AV9 A;  5AQL A;  3ZEU B;  4CJ3 A;  1Q7Y O;  5AZJ B;  5AQW A;  2P9P A;  4IDK A;  3VQC A;  1KTQ A;  3THW A;  2G8U A;  5JMV A;  1TYQ B;  3SAG A;  1KAY A;  1C0U A;  4X66 K;  4X62 K;  3NAE A;  3CCU N;  1IV0 A;  4NCG A;  3HM8 A;  4CGG A;  3KKS A;  2UUC K;  4XH5 A;  3NE6 A;  4BC4 A;  2YHA A;  4JI0 K;  3SPY A;  1BIZ A;  1ASV A;  4KHS A;  2FF6 A;  1BA0 A;  3DOL A;  4FZZ A;  3CCV N;  3LDP A;  4CEZ A;  5FRN A;  4HCC A;  1V4T A;  2BTF A;  1LWE A;  4FJI A;  3K5L A;  2IC3 A;  1N8R O;  4OLA A;  1DEJ A;  3G25 A;  4E1J A;  1N32 K;  4FYD A;  4NYF A;  1C1C A;  3BY5 A;  5C10 A;  2F9W A;  2PY5 A;  2BH1 A;  2A42 A;  3OBY A;  5ADX H;  4B3R K;  3QNN A;  2Q2R A;  4Y1C A;  4B9L A;  3OYF A;  1G15 A;  1EQY A;  1GLD G;  2YV0 X;  1RBT A;  4CER A;  3BP8 A;  1U48 A;  1TKZ A;  4I7F A;  1B92 A;  2ATQ A;  2VYP A;  3HTV A;  4NLB A;  4IFV A;  4JEP A;  1UOC A;  3VEV A;  4DWI A;  2WC9 A;  4K0K K;  4ELU A;  3ZSZ A;  4CJR A;  3QLH A;  4KH5 A;  1D9D A;  3DLB A;  1Z25 A;  1XC9 A;  4B3M K;  4FXD A;  4C23 A;  4AHC A;  5M1Q A;  4Z4H A;  5AZI B;  5LL6 Z;  3ZT0 A;  3A5N C;  1IKX A;  3DLH A;  5GIN A;  3LDL A;  4BY9 C;  2HF3 A;  3V9X A;  3K57 A;  2E88 A;  3B6O A;  4KV8 A;  1RBU A;  4CF9 A;  1VSI A;  4B1V A;  4FSV A;  2QEX N;  2WFB A;  2ASP A;  4FJX A;  4MQ3 A;  3GG4 A;  1JXB A;  1RNH A;  1HNX K;  3IUC A;  2Z1H A;  2O8D B;  4DS5 A;  1C0G A;  4E19 A;  3C6H A;  4BR4 A;  5AQK A;  3S41 A;  5KTQ A;  4FPB A;  3U3Y A;  2YKN A;  5KI6 A;  1VRT A;  3V4I A;  4RW4 A;  1X9S A;  4I9L A;  2RF2 A;  2VG7 A;  3IAY A;  3ZT3 A;  4IFE A;  3HI0 A;  3PY8 A;  1C1A A;  4O0J A;  3SV4 A;  4DMN A;  3R8E A;  3SUQ A;  4B9M A;  4HHT A;  4BG8 A;  3SQ4 A;  4YOR A;  3TAB A;  1LCU A;  3CXC M;  3P39 A;  3RMB A;  3VGM A;  5GAH P;  2GWK A;  2KKZ A;  3HZ6 A;  2QXF A;  1HNI A;  4Z4C A;  4CF1 A;  4IOC L;  4BR0 A;  5GAE P;  3WXM B;  4YFU A;  1N6Q A;  4DTU A;  3HO1 A;  1IG9 A;  2QW9 A;  3I8B A;  3NVK A;  3ITH A;  2HW3 A;  1E4F T;  1BOT O;  1RT2 A;  4FWS A;  2QWP A;  3MWT A;  2GUP A;  3CHW A;  4H0X B;  1NGH A;  4JI8 K;  2ETJ A;  4B08 A;  3HP9 A;  2OYQ A;  3RMD A;  2Y1J A;  1QSL A;  3KVG A;  1WSF A;  4F4K A;  4DR7 K;  2VCP A;  3TWH A;  4DQQ A;  1OH6 A;  1P90 A;  4QS7 A;  2HNZ A;  3LP0 A;  4JI7 K;  4JHD B;  4DU1 A;  4CZJ A;  4KBO A;  3O9S A;  3UB5 A;  3KD1 E;  2H3G X;  1TL1 A;  2A5X A;  1REV A;  1OVQ A;  3U3G A;  1VQ9 N;  4DCH A;  2HHW A;  2P5O A;  3NH1 A;  5J2N A;  3AVJ A;  3VQQ A;  3DXK A;  4DTM A;  1SL0 A;  2NRZ A;  3NGY A;  3CQ8 A;  1A5V A;  3AVN A;  1JL2 A;  2WON A;  3T69 A;  4CVN E;  4JKF A;  2OPP A;  4E7K A;  2KZZ A;  4CHO A;  3BF3 A;  5C42 A;  3CC7 N;  1U04 A;  3P4I A;  1GLF O;  2RE2 A;  4CZH A;  3ULE A;  1HNW K;  1ILY A;  4OJR A;  5AQX A;  4CIG A;  3H6E A;  3I0R A;  5BRE A;  3EEQ A;  3SMP A;  4E7J A;  3VTI A;  3ZX0 A;  1QVF M;  3BZK A;  1CXQ A;  1SV5 A;  4FM2 A;  2P9U A;  4NB4 A;  4CJ5 A;  4IEE A;  4PY5 A;  4LSN A;  1RDW X;  3IRX A;  3K9J A;  1K6Y A;  3TSP A;  4DFM A;  4BWM A;  4R5P A;  1JLQ A;  1JLC A;  3R9P A;  4M7X A;  1HNV A;  1ASU A;  3W0L A;  5CYM A;  3QEV A;  1KC8 O;  3NVM A;  1EWR A;  3E66 A;  2YHB A;  4CF8 A;  4WQ4 C;  3DRR A;  4B1W B;  3CPW M;  1YVN A;  4G1Q A;  3CET A;  2YNG A;  2CH5 A;  3CYM A;  4KKO A;  3NGI A;  1WAJ A;  1X9J A;  3L2U A;  1WBD A;  3O4N A;  4NYN A;  3J80 O;  4BRG A;  1C6V A;  4CEC A;  4DG1 A;  1SUQ A;  1A5W A;  3AAP A;  1IH7 A;  5CE3 A;  1HJO A;  5T7B A;  3MMV A;  5JS1 A;  4BAC A;  2FLO A;  1S1X A;  2HNY A;  4BE0 A;  5FLX O;  3NCI A;  5FPM A;  3P5J A;  4JRP A;  2OZS A;  3F9K A;  4B3O A;  5ADX A;  1OKJ A;  1S3X A;  4CHN A;  4F3O A;  4FL9 A;  2PZS A;  3K5O A;  1KCF A;  1Y64 A;  2OPQ A;  3UKR B;  2ZD1 A;  3NF7 A;  4FJN A;  1NWK A;  1W97 L;  4JKG B;  1T6C A;  4A59 A;  3EYZ A;  4W5N A;  4B1Y B; 
#chains in the Genus database with same CATH homology
 4PKI A;  3E1Y A;  3DLL L;  1Z05 A;  3O9R A;  4M63 C;  3ENB A;  3SBG A;  4A57 A;  3CF5 L;  1U2V B;  1Z6R A;  4IO8 A;  3IMX A;  4H0V B;  2RHK A;  1XC3 A;  4CBX A;  1ATR A;  1JCF A;  3A5O C;  5GAD P;  3RVC A;  4AF1 A;  2P9L B;  3DAW A;  3QDK A;  3DXK B;  3QML A;  3H45 C;  1KAX A;  5AFU H;  2YJE A;  4ILH A;  4FVU A;  2V52 B;  2NRH A;  1V4S A;  5HOO A;  3WXI A;  3D7E O;  5AQN A;  3DJC A;  3H46 O;  5DM7 L;  1T3V A;  4FWK A;  5M1K A;  2CGK A;  5C0Y A;  2YHW A;  3HOT A;  4I6M A;  2YCH A;  1GLB G;  3WEE B;  5AQM A;  5AQZ A;  2D4W A;  3H1V X;  1HKC A;  3WXJ A;  5BRF A;  5GIP A;  5DM6 L;  3EKU A;  3E9O A;  3ULE B;  1E4G T;  2QM1 A;  3TTC A;  5C2D A;  1D4X A;  5F2R A;  1VQM N;  4IOA L;  4BRI A;  3CJC A;  2P9N A;  3JS6 A;  3U9D A;  1OVY A;  4U7B A;  2GEL A;  2IVO A;  1ESV A;  2IVN A;  4WQ5 A;  5I9E B;  2HBJ A;  4BRP A;  2E1Y A;  3OA9 A;  3L6Q A;  3ID6 A;  3R3L A;  1QZ5 A;  2FSJ A;  2NNW A;  4FPA A;  2HOE A;  4BG9 A;  3A8Y A;  4O8K A;  3KWI A;  5AZJ A;  4IO9 L;  3SAH A;  3I55 N;  3O6W A;  4H0T B;  2IVP A;  1QQO A;  3E9P A;  4PL8 A;  2F9T A;  1RFQ A;  1TYQ A;  3EO3 A;  1BUP A;  3TPQ A;  4JNE A;  2A3Z A;  4EHT A;  3VET A;  1TUY A;  3AY9 A;  4ISG A;  3UKU A;  3CCS N;  1H1V A;  3WXK A;  5GIO A;  2P9I A;  4CZF A;  5KQ8 A;  5M1F A;  2V51 B;  1M90 O;  1XUP O;  1YF5 L;  1WOQ A;  4H5W A;  2ZWH A;  3SK3 A;  3VER A;  3B8A X;  3D6R A;  1GLL O;  1W2B M;  4FWL A;  4GV6 A;  2NRT A;  2QWQ A;  3C6A A;  3H1Q A;  1DGK N;  1MWM A;  4OPA A;  5BPN A;  3VGL A;  1MA9 B;  5AQR A;  1SAZ A;  3JXU A;  4BRC A;  2E2N A;  4H0O A;  2PBD A;  4H5T A;  4YDU C;  1TUU A;  1NGG A;  4O8U A;  2HBK A;  4H0Y B;  4IXC A;  1SS6 A;  1NM1 A;  4JKE A;  3G4S N;  3CJ1 A;  2PAV A;  3ID8 A;  5M1P A;  4EFH A;  5B8H A;  3IKM A;  4BRF A;  2QWO A;  5AQH A;  2A6A A;  4JKC A;  4JKH A;  2BUP A;  1YXQ A;  4ILJ A;  3DXM B;  3U9Z A;  5M1N A;  2GX9 A;  4GNI A;  4CD1 A;  2FXU A;  2D1K A;  3VEO A;  4WQ4 A;  2ZJR L;  1VAZ A;  3EN9 A;  4FWR A;  3A5M C;  4HWI A;  4PL7 A;  3VGK A;  1T6D A;  1NGE A;  2ZGY A;  4BQZ A;  3LM9 A;  2QA4 N;  3ZYY X;  3HOS A;  3CC2 N;  4CZI A;  1T44 A;  1QQM A;  4JD2 A;  4CJ7 A;  4DQ8 A;  1YI2 N;  4FWQ A;  4U67 L;  1U6Z A;  1YIJ N;  4WF9 L;  4IDH A;  3M6G A;  4NLC A;  2QWN A;  3EZW A;  3CCQ N;  3MN9 A;  1NGB A;  4YOX A;  3F5T A;  4BRE A;  3U4L A;  1S72 N;  3UE5 A;  5LY3 A;  5BRD A;  3VF4 A;  3FZL A;  3SLC A;  2QWL A;  5FPE A;  3FZK A;  5H1S Q;  2OAN A;  3H3O B;  3O9T A;  4FWO A;  4A2A A;  4GV9 A;  5AQQ A;  3TTD A;  4NO7 A;  3LDN A;  3K9K A;  4XH1 A;  3SMS A;  4K41 A;  4C1N I;  3J7Z O;  4R79 A;  2YX6 A;  4A62 A;  1CZA N;  3SAF A;  1YJW N;  3DXM A;  1YUW A;  1XQS C;  1NGC A;  5AZI A;  4OO1 J;  4HTL A;  3VPZ A;  4FWM A;  3QFP A;  2FSK A;  3FLC O;  1BO5 O;  4I6M B;  4L3Q A;  1KQS M;  3D2F B;  4BC3 A;  1VQ8 N;  2ITM A;  4DB3 A;  3QIC A;  3C7N A;  2HMP A;  3MCP A;  5C2F A;  1NGA A;  1P8Z A;  4CD3 A;  2A40 A;  4CZL A;  3OHR A;  3CI5 A;  1KAZ A;  3M5R A;  2Q97 A;  3EL2 A;  1IG8 A;  2P9N B;  3MDQ A;  3GL1 A;  1YHQ N;  4C1N K;  2J4R A;  4ISF A;  3BEX A;  5AQL A;  2D0P A;  3MWP A;  4K25 A;  3ZEU B;  5KPT A;  2E1Z A;  3L0Q A;  3ZX3 A;  4BRQ A;  1Q7Y O;  3QBW A;  5AZJ B;  3FGU A;  5AQW A;  2P9P A;  1GLE G;  3SBT A;  1NGD A;  4QS9 A;  4B9Q A;  2W41 A;  5JMV A;  3I56 N;  1TYQ B;  1GLA G;  3CJA A;  3T7Z A;  3WT0 A;  2ZF5 O;  3VOV A;  4CBW A;  1KAY A;  4CZE A;  3SAG A;  1JJ2 M;  4A5B A;  2W40 A;  3UKU B;  2ZGZ A;  3CCR N;  2V7Z A;  2P9I B;  4JKD A;  3WQT A;  3CCU N;  5AQV A;  3D2F A;  3TSU A;  4BRA A;  3N4Q A;  3HM8 A;  1QQN A;  5C15 A;  1BDG A;  3CIP A;  4BRL A;  5FPN A;  4XH5 A;  3VEX A;  1BU6 O;  3IFR A;  4BC4 A;  4QS8 A;  2QWR A;  3EE8 A;  1NLV A;  3VEW A;  2FF6 A;  2NZT A;  3GDQ A;  3KWG A;  1BA0 A;  4Y0W A;  3VES A;  5TKY A;  5GAG P;  4BGB A;  5EOY A;  4IWV A;  3LDP A;  2NLX A;  3L4I A;  3ZEU A;  3CCV N;  3HBT A;  3HRG A;  4BVO A;  1V4T A;  3WXL A;  1QZ6 A;  2BTF A;  1VQ4 N;  1N8R O;  4YOV A;  3MK6 A;  1DEJ A;  3G25 A;  4YOT A;  2GEM A;  4CZG A;  4E1J A;  2Q31 A;  3TSQ A;  4H5V A;  1YJ9 N;  1VQ7 N;  4CZK A;  5C10 A;  1BWF O;  2F9W A;  2GTD A;  1SZ2 A;  4BRD A;  2BH1 A;  2A42 A;  3OBY A;  5ADX H;  5AQP A;  1X3M A;  2Q2R A;  1M1K O;  4BRH A;  5E26 A;  4GV3 A;  2WBN A;  3U8X A;  5EXW A;  5BN8 A;  5JIC A;  3KHY A;  2KLA A;  4AM7 A;  2I7N A;  1EQY A;  1GLD G;  3D2E A;  4YDU A;  3VMF B;  4JD2 B;  3O80 A;  3BP8 A;  5ELZ A;  3O1W A;  3CJ9 A;  3CME N;  5LJV A;  1Q18 A;  4PHT X;  2VYP A;  3HTV A;  4NLB A;  4WFA L;  5E84 A;  4JEP A;  3FFK B;  3VEV A;  4IJA A;  2ASO A;  1VQO N;  2WC9 A;  3CPE A;  3Q7C A;  1DT9 A;  4BRO A;  4KH5 A;  4JHD A;  2AA4 A;  5AQI A;  3L4Q A;  5AQG A;  4UY8 O;  3ENO A;  2A41 A;  3MX2 A;  4C23 A;  5M1Q A;  1C0F A;  1RDU A;  5AZI B;  3CQX A;  4YOU A;  3GBT A;  1MDU B;  4BRM A;  1VQ5 N;  4B1X B;  2VWB A;  3A5N C;  4H03 B;  4ILG B;  2I7P A;  5TKW A;  1G99 A;  1QHA A;  3CC4 N;  1Q82 O;  5EVZ A;  3C7N B;  3ZX2 A;  1K8A O;  5GIN A;  1NBW A;  3LDL A;  5CHI A;  4BY9 C;  2HF3 A;  2NRR A;  1YJN N;  2E2O A;  2E88 A;  1K73 O;  1VQK N;  5CR4 A;  3FZM A;  5AFU A;  2PFU A;  2NRV A;  3ATU A;  1JCE A;  5AR0 A;  5KPZ A;  4MDA A;  3VF6 A;  4B1V A;  4FSV A;  2ZJQ L;  2QEX N;  1BA1 A;  1ZC6 A;  3ENH A;  2WFB A;  1Q81 O;  2ASP A;  2HST A;  4B1U B;  3P38 A;  5KQD A;  3GG4 A;  4IEI A;  4A2B A;  1BG3 A;  3IUC A;  2P9P B;  3OBW A;  3SJH A;  3FZH A;  4WFN L;  2QXL A;  3MCA B;  4J8F A;  1ATS A;  4DHY A;  4O5F A;  1C0G A;  5BPM A;  3PLA A;  3C6H A;  4BR4 A;  3A5L C;  1R59 O;  3N4P A;  2VGM A;  2HBL A;  4OPH A;  2QTD A;  1VQL N;  3VEN A;  3C65 A;  4H5N A;  4MO4 A;  5AQK A;  3S41 A;  1GLC G;  4FPB A;  5JVG L;  4A59 A;  3GOI A;  1KD1 O;  1JCG A;  4EHU A;  5JLF A;  4IFE A;  3HI0 A;  4CI6 A;  4JK9 A;  3M1F A;  2KHO A;  2NRW A;  3R8E A;  5HL7 L;  5BPL A;  4BG8 A;  4FWN A;  3IDH A;  2QI2 A;  1NGI A;  4YOR A;  4BR2 A;  3O9U A;  1LCU A;  3CXC M;  3P39 A;  4JKA A;  3VGM A;  1DKG D;  2HF4 A;  2GWK A;  3TTF A;  5GAH P;  1O13 A;  2KKZ A;  3HZ6 A;  3QB0 A;  3AGK A;  2Q36 A;  3FZF A;  4FO0 A;  3NMU A;  5MLC Q;  2OTJ N;  3FR0 A;  2Q1N A;  3ATV A;  4IOC L;  4BR0 A;  5GAE P;  3WXM B;  4CBU A;  4CZM A;  1K8K A;  2QW9 A;  3I8B A;  4BRN A;  4BC5 A;  3NVK A;  1KXP A;  2YHX A;  4KH4 A;  4H0P A;  4PKH A;  3F2K A;  1E4F T;  1BOT O;  3H3N O;  1GLJ O;  4DKW A;  3I33 A;  4FWS A;  2QWP A;  2JWL A;  3O4W A;  2JWK A;  1K9M O;  2UYT A;  3KK7 A;  1NGF A;  3MWT A;  2GUP A;  3CHW A;  4H0X B;  2P9S A;  1NGH A;  3D2E B;  4ISE A;  5BRH A;  3ZET B;  3QFU A;  5F1X A;  3KVG A;  2WUS A;  3AAR A;  3VF2 A;  3CD6 N;  2FF3 B;  3EKS A;  1NGJ A;  4LC9 B;  3WUH A;  2VCP A;  3MN6 A;  1P90 A;  2GWJ A;  3LDO A;  4QS7 A;  2D0O A;  4MLE A;  1S22 A;  3O5B A;  2ZJP L;  3LM2 A;  2Q0U A;  4JK7 A;  4JHD B;  3RSE A;  3J8A A;  3UKR A;  2VGN A;  3LDQ A;  4K42 A;  4CZJ A;  4KBO A;  4JK8 A;  3O9S A;  3UB5 A;  3AAQ A;  1EO1 A;  4JKG A;  2H3G X;  4YOY A;  4BVP A;  3F9M A;  2A5X A;  4B1Z A;  2YI1 A;  3VEZ A;  4YOW A;  3CCM N;  1VQN N;  3MN7 A;  1U2V A;  3E9L A;  4WQ5 C;  4AM6 A;  1VQ9 N;  4DCH A;  5JVH L;  4IOX A;  2P9U B;  2YHY A;  3QBX A;  3BF1 A;  2P9L A;  5AQJ A;  4RWT A;  3CCE N;  3DXK A;  4EAH D;  5AQF A;  2NRZ A;  2P9K B;  3ZET A;  4RTF D;  1YAG A;  1ATN A;  5AQS A;  5M1O A;  3CER A;  3T69 A;  4JKF A;  4GVE A;  3OW2 M;  4BR9 A;  4GY2 B;  3BF3 A;  4BR7 A;  3MX5 A;  2CGL A;  5FPD A;  1SQK A;  2OTL N;  3WEE A;  3CC7 N;  2V7Y A;  1HUX A;  3P4I A;  2HBM A;  1GLF O;  2AP1 A;  1NMD A;  2RE2 A;  3P31 A;  1HLU A;  4CZH A;  3ULE A;  4EIA A;  1Q86 O;  3VEY A;  3O8M A;  1ILY A;  5AQX A;  3O1B A;  2CH6 A;  3G71 N;  3H6E A;  5BRE A;  3SMP A;  3VTI A;  2Q0R A;  3ZX0 A;  1QVF M;  3CCJ N;  3EE9 A;  4A5A A;  4JN4 A;  1RGI A;  3KZB A;  5LJW A;  3LL3 A;  3PIP L;  4IJN A;  2DPN A;  2E2P A;  2P9U A;  2E2Q A;  3GE1 A;  4K43 A;  4NB4 A;  2E20 A;  3C0B A;  4IEE A;  3PIO L;  3HSC A;  1IJJ A;  3R1X A;  4WFB L;  1HX1 A;  1RDW X;  2P9K A;  3TU5 A;  1HKG A;  3FE1 A;  4M7Y A;  3K9J A;  2NRX A;  3BUZ B;  3CJ7 A;  4IZ9 A;  1J6Z A;  3TSP A;  4Z94 A;  3CMA N;  3R9P A;  1HPM A;  1NJI O;  5JLH A;  5AQT A;  1ZBS A;  4M7X A;  1X3N A;  4JKB A;  1LOT B;  1HKB A;  3O08 A;  4FWP A;  5AQO A;  3W0L A;  4RCH A;  3NVM A;  3MN5 A;  5AQU A;  1KC8 O;  3E66 A;  4WYB A;  4KH6 A;  4WQ4 C;  4B1W B;  3CPW M;  1YVN A;  1K8K B;  2QWM A;  3CET A;  1YIT N;  2CH5 A;  5C12 A;  5KPR A;  1X9J A;  4MLH A;  4F9O A;  3CCL N;  4MO5 A;  3W3D A;  5BN9 A;  2F7T A;  2ASM A;  5F0X A;  4BRG A;  3AAP A;  4XH4 A;  2YJF A;  3VTH A;  2P9S B;  5AQY A;  5CE3 A;  1HJO A;  1ZXO A;  3A0I X;  3MMV A;  3G6E N;  1VQP N;  2FLO A;  3Q7B A;  4H5R A;  5BR9 A;  3O9Q A;  4BGA A;  1QVG M;  4G9Z A;  5FPM A;  3M3Z A;  2FSN A;  4BRK A;  4BR5 A;  3AGR A;  5EX5 A;  4A61 A;  2CGJ A;  5EY4 A;  5ADX A;  1OKJ A;  1S3X A;  2IIR A;  2E8A A;  4FL9 A;  4MDB A;  4XEI A;  4FOI A;  3CQY A;  3RSE B;  4BQL A;  3DWL A;  1Y64 A;  4BC2 A;  3UKR B;  3CJB A;  1NWK A;  4WCE L;  1W97 L;  2EWS A;  4FOE A;  1WUA A;  4JKG B;  1T6C A;  1MWK A;  1VQ6 N;  3WQU A;  4B1Y B;  3R6M A;  4PKG A;  4JAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...