4WQ4A

E. coli ygjd(e12a)-yeaz heterodimer in complex with atp
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
336
structure length
336
Chain Sequence
MRVLGIETSCDATGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA N6-adenosine threonylcarbamoyltransferase
publication title The ATP-mediated formation of the YgjD-YeaZ-YjeE complex is required for the biosynthesis of tRNA t6A in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 113
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.3.1.234: N(6)-L-threonylcarbamoyladenine synthase.
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wq4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wq4A01
4CZEA 2Q2RA 3CJAA 1Z05A 5JICA 4PKIA 4H5VA 3GDQA 3U4LA 2QWQA 2D0OA 3H1VX 3O8MA 1GLFO 4YDUA 2A42A 3S41A 1XUPO 4IXCA 1HX1A 1YAGA 4BR2A 2V7YA 1ATSA 3QDKA 3F9MA 3HZ6A 3VPZA 1IJJA 4BRLA 5KQDA 3B8AX 3D7EO 3TU5A 1ZBSA 1GLAG 1SQKA 1RDWX 1GLJO 4O8KA 3SK3A 2YJEA 4DHYA 5F2RA 3SLCA 5AQWA 2BUPA 5BRFA 3H1QA 2F9TA 2UYTA 2QWRA 3UKUA 3RSEB 2E2OA 5LJVA 3O1WA 5BREA 4BR0A 2A3ZA 4EHUA 4CZLA 1HPMA 4CZMA 1U2VA 4JHDB 4JAXA 3ATUA 2ASMA 2P9KA 5AZIA 2PBDA 3HTVA 3U8XA 3UE5A 4Y0WA 4CZKA 1NLVA 5AQVA 3VOVA 2BTFA 3AAQA 4FPAA 1T44A 4WQ5C 4FWRA 5BRHA 2FSJA 5BRDA 2YJFA 3KZBA 1MWKA 2CH6A 4BRKA 1GLDG 5F0XA 2A40A 3H3OB 3D2FA 2GWKA 1KAXA 1NGCA 4BVPA 2IVOA 1V4SA 1NMDA 4BR7A 1ATNA 3DXKA 5AQYA 2A5XA 4C23A 3VENA 3C7NA 5KQ8A 4BC4A 1R59O 2P9PA 3SMSA 3ZX2A 2GUPA 3CQYA 1D4XA 3ENOA 2VYPA 4NO7A 1ESVA 2AA4A 3LDPA 4H5TA 4F9OA 2ZGZA 5E84A 3VEZA 3MMVA 3DAWA 1MA9B 4B1YB 2D0PA 4DCHA 2P9IA 4M7YA 3ZETB 5AZJB 4A2BA 1BDGA 1TUYA 1KXPA 1QZ5A 2IIRA 4HWIA 3I33A 5AQJA 3VETA 4CI6A 2FF3B 4FWLA 3CHWA 4H0XB 4ISFA 3LL3A 2VCPA 2YHWA 2ITMA 1X9JA 4JD2A 2P9NA 4B1VA 3VGMA 3WXIA 2E2PA 4PL8A 2QWOA 4MLEA 4J8FA 4B1XB 1G99A 3LDNA 1QQMA 5KPTA 4BC3A 2CGKA 2IVNA 3IUCA 1HUXA 3BP8A 4WQ4C 3GE1A 1NGJA 2A41A 3MN6A 2J4RA 3FZFA 5BN8A 3EN9A 1TYQB 1WUAA 2KHOA 3A5MC 4NB4A 4BGAA 1BOTO 1H1VA 3QFPA 4BGBA 2GEMA 3LDQA 3P4IA 4IJNA 1HKBA 2E20A 2WUSA 3CQXA 4BR5A 5AQIA 1Y64A 2F9WA 4EHTA 1SAZA 2E8AA 1QQOA 1U2VB 2E2NA 1NGDA 4FOIA 3AAPA 5FPMA 4BRGA 3WXKA 5AZIB 3ZEUA 1X3NA 1K8KA 4B9QA 4MO5A 1E4GT 3KVGA 1XC3A 2E1YA 2Q36A 1T6DA 3GOIA 4H5WA 3AY9A 5AQLA 2QW9A 5ADXH 2DPNA 3C0BA 1NGGA 4H5NA 4Z94A 3M3ZA 1BA1A 4ISGA 5AQKA 4FO0A 3WUHA 5JLHA 5FPEA 3FZHA 4B1WB 3JXUA 4JNEA 3D2FB 4DQ8A 1SZ2A 4BRIA 2GWJA 3EL2A 3DXKB 4BR9A 4MO4A 3VESA 3C7NB 5TKYA 4BG9A 3FGUA 3ATVA 1NGHA 2W40A 1TUUA 3FFKB 1DGKN 4BRFA 3VERA 2FSKA 2P9SA 4FWOA 3CI5A 3WQTA 3U9ZA 3ENHA 4K42A 5EX5A 3L0QA 2P9IB 3FE1A 1OKJA 5BR9A 4FOEA 1GLBG 4IO8A 3QBXA 3UKRA 4CD1A 2ASPA 3MN9A 4I6MA 5AQMA 4FWPA 3VF6A 4CBWA 5JLFA 2ZGYA 4RWTA 2GTDA 4EFHA 5ELZA 2QXLA 3QMLA 1GLCG 2W41A 2P9NB 3D2EB 2P9UB 2E1ZA 3CJ1A 3GG4A 3QB0A 2Q97A 5AQZA 1DEJA 4JN4A 3W3DA 4CZHA 1S3XA 5LJWA 4BRNA 1IG8A 1RFQA 5BPLA 2FSNA 3VGKA 4GNIA 5AQTA 2CGJA 4H0PA 4YDUC 3J8AA 4MLHA 1JCGA 1E4FT 4XEIA 3IDHA 3RSEA 3H45C 4BROA 4FSVA 2FXUA 2FF6A 4IWVA 3CJ7A 3IMXA 1NGEA 4KBOA 3WQUA 3A8YA 4BQLA 3DXMA 5I9EB 3EKSA 3FLCO 2HOEA 3G25A 4FWSA 4H0OA 5JMVA 4JHDA 4RCHA 5AFUA 4HTLA 5FPDA 1NBWA 2QM1A 1QZ6A 2YHXA 3BUZB 4CZJA 3GL1A 3CETA 3FZMA 3BF3A 4BR4A 3A5LC 4BRMA 3ZEUB 3HSCA 3H6EA 3EKUA 2D4WA 1K8KB 4CZIA 1Q18A 4WYBA 3CIPA 1J6ZA 3L6QA 4BRAA 4CD3A 3MK6A 4GY2B 3O6WA 3WEEA 5KPRA 2HF3A 3VEWA 4AM6A 3BEXA 1C0FA 5F1XA 2YCHA 4EAHD 1NGBA 3LDOA 3ULEA 1YVNA 3VGLA 3UKUB 3W0LA 1GLEG 1P8ZA 1BA0A 1U6ZA 1CZAN 1NGFA 3O80A 4FPBA 5EOYA 1MWMA 3SJHA 4FWQA 1KAZA 1NGAA 2H3GX 4BRDA 4BVOA 1WOQA 1XQSC 2YI1A 1BO5O 4QS8A 4A61A 4BC5A 4FWKA 4CBUA 2ZF5O 2Q0UA 2E2QA 2P9KB 3DJCA 1HLUA 2P9SB 2HF4A 3ZETA 4FWMA 1V4TA 3GBTA 4PKGA 2D1KA 3LDLA 2GELA 3O08A 4L3QA 2QWNA 3SMPA 4CZFA 3O1BA 3VEVA 5CE3A 4M7XA 1NGIA 3VF4A 3VEXA 5FPNA 3R6MA 1HJOA 4BRPA 4FWNA 2NLXA 3FZLA 4XH4A 4CZGA 3MCPA 2P9PB 2EWSA 3JS6A 3QICA 5AQRA 1BU6O 1TYQA 3IFRA 4BRQA 5BN9A 2V51B 2NRHA 5KPZA 5AQQA 3AARA 1YXQA 2P9LA 1HKGA 2AP1A 3VEYA 3LM2A 3DXMB 3UB5A 4K41A 2V52B 4E1JA 3LM9A 3A5NC 3CJBA 5AQXA 4BRHA 1LOTB 2Q1NA 4LC9B 4WQ4A 2QWPA 3MN7A 5AQFA 4B1UB 4JD2B 4RTFD 1NWKA 1KAYA 3DWLA 1T6CA 4K43A 2I7NA 5EY4A 3O4WA 3A0IX 5AR0A 2V7ZA 3OHRA 1Z6RA 3FR0A 3R9PA 1BG3A 3WXJA 2VWBA 5E26A 4CJ7A 2QWLA 3WEEB 3M1FA 3H46O 3CJCA 3I8BA 1QQNA 4IZ9A 3HM8A 5EVZA 2YHYA 3TPQA 2ZWHA 4BREA 4QS7A 4IJAA 5AQNA 3ULEB 4H5RA 3BF1A 1ZC6A 5BPMA 4EIAA 3QFUA 2A6AA 2CGLA 4BG8A 4AM7A 2PAVA 2QWMA 5AQHA 4B1ZA 2ASOA 4ISEA 4DB3A 4M63C 5AQUA 1HKCA 2Q31A 1ZXOA 5AQGA 1JCEA 4FL9A 1NM1A 4A62A 4A2AA 1JCFA 2IVPA 4O5FA 3VEOA 2OANA 1YUWA 1ATRA 4H03B 4BC2A 2HMPA 5LY3A 2E88A 5ADXA 1C0GA 2I7PA 4BRCA 3MN5A 1RGIA 2FLOA 3O5BA 3D2EA 3H3NO 2P9UA 2NZTA 4H0YB 4QS9A 3VF2A 4BQZA 3ZX0A 2CH5A 4XH5A 3KHYA 1BWFO 3QBWA 3HBTA 5EXWA 3ZX3A 4PL7A 5AQOA 3L4IA 3M6GA 5BPNA 4WQ5A 4CBXA 3CERA 4K25A 4XH1A 3WXLA 3HI0A 3R8EA 1QHAA 1GLLO 1DKGD 1MDUB 1S22A 3A5OC 5B8HA 3CJ9A 3MDQA 5AZJA 1X3MA 4H0TB 3WT0A 1LCUA 1EQYA 3EO3A 2Q0RA 5AQSA 3UKRB 2P9LB 4H0VB 3ID8A 5AQPA 1BUPA 4PKHA 4I6MB 3EZWA 5AFUH 3U9DA 3FZKA
chains in the Genus database with same CATH superfamily
4DSIA 4KH6A 4CHZA 4DFPA 4PKIA 3LAMA 1NKBA 4JI0K 4IXCA 4BR2A 3DOKA 2V7YA 3QDKA 2JGUA 1NOZA 1T05A 3B8AX 4JI3K 1ZBSA 3I0RA 1RDWX 1GLJO 4O8KA 3SK3A 2YJEA 3SLCA 5AQWA 3SPYA 4OKKA 3NHGA 3CM6A 2DY4A 2QWRA 3U6FA 3QIOA 1KCFA 1JJ2M 2E2OA 4Q0BA 4OGEA 2O8EB 1S5JA 2Y1IA 4CJKA 4LFAK 1HPMA 3VA0A 3QERA 1Y97A 1U2VA 4YOTA 4JHDB 3ATUA 4FJHA 5GIPA 1XHXA 5AZIA 4WFAL 3NH0A 3UE5A 4Y0WA 4CZKA 1NLVA 3VOVA 4CF8A 4DV4K 5GAGP 1OVQA 3AVGA 2YJFA 4OKJA 3VQ7A 1IKWA 1YVUA 3D0PA 4CJEA 4B9MA 2A1SA 5C24A 3LP3A 1VQPN 1VQ9N 2GWKA 1BISA 4BVPA 3E9PA 5SZTA 3BDPA 1NMDA 4BR7A 1C0TA 2ZQBA 1T7PA 4OO1J 5AQYA 3QEIA 3KKSA 1HYVA 3NFAA 4W5TA 4C8LA 4FJ7A 4BC4A 3ZX2A 1VQ6N 3ENOA 1NMNA 1ESVA 1VQKN 1VQLN 3ENBA 2Z1IA 3MMVA 1MA9B 4CF0A 3DLGA 1A5VA 1X9SA 3C6HA 3QESA 3NVKA 1QZ5A 2IIRA 3H08A 4HWIA 4CI6A 4CCHA 3ZSRA 1SL2A 3LL3A 2VCPA 4JD2A 4DTMA 2HVHA 2O8CB 3THYB 1X1PA 3SUPA 2O8BB 1QHTA 4BACA 4BDZA 3SZ2A 3MCAB 5D3GA 3LDNA 1QQMA 4GKJK 4NCBA 3GE1A 3THWB 4Z4IA 5KRSA 4DR1K 4NLCA 4FJLA 2HHVA 3BY5A 2OA8A 4QOZB 3MN6A 3HPOA 3FZFA 3A2FA 3NH2A 2KHOA 3SQ0A 3PO5A 4BGBA 2F8TA 2WC9A 1O1WA 2IAJA 1SS6A 4DU4A 1R0AA 4I2PA 1CZBA 1OH6A 1C1AA 5JS2A 4R79A 3D6RA 4EHTA 3VQ4A 3ZYYX 4DSLA 3AAPA 5FPMA 1J53A 4BRGA 2F7TA 2WFBA 3KK3A 2Z1GA 1X3NA 3KTQA 4CHPA 4FZXC 4J2BA 3LANA 4MDBA 2QKKA 5HRPA 3WNGA 3PSIA 4MO5A 3TAEA 3CD6N 3K5MA 2IDOA 1T6DA 5AQLA 3VTIA 3AVHA 2YNFA 4Z94A 1P90A 3L2UA 5JLHA 4FO0A 4NCGA 3HO1A 3FZHA 4E7LA 4DSEA 3D2FB 5HROA 3MXMA 2ETJA 3SUNA 2GWJA 3AVAA 3DXKB 3AV9A 4BR9A 4MO4A 3VESA 3NCIA 4JKEA 1W9HA 2JLEA 1LWEA 5TKYA 1TAUA 3LDSA 3DLLL 3ATVA 4FM2A 2ZJRL 4LY7A 2OCEA 5HRSA 3CI5A 4DLGA 3L0QA 2P9IB 2VWJA 1SKSA 2Q3SA 1GLBG 1RT7A 4IO8A 1K9MO 3DLHA 3AA2A 1XMQK 4YNQA 3PX0A 4KTZA 4CEOA 4AILC 1I3AA 4CBWA 4ILJA 5JLFA 2ZM6K 3O3FA 1GLCG 3U3GA 3D2EB 1I39A 4KHQA 1DEJA 1EWRA 1EETA 3W3DA 4RW7A 4BRNA 5BPLA 3M8PA 2BH1A 1RTHA 4YDUC 4E1MA 4PY5A 1E4FT 3AA3A 3L2VA 3IDHA 1JLAA 4FSVA 3NF6A 3WQUA 3DM2A 1LV5A 3G25A 2ZD1A 3P5JA 4FCYA 2HNDA 4JHDA 5AFUA 4YOXA 4W5NA 5H1SQ 1EKEA 3G4SN 4HTLA 1NBWA 3ZSZA 2QM1A 2YHXA 3BUZB 2QEXN 3TAGA 3MEEA 3TAPA 3KK7A 3EE9A 4BR4A 3DI6A 4IDKA 4CZIA 1C6VA 4IG0A 3OYMA 1J6ZA 3TAFA 4CD3A 4GY2B 1Q8IA 5IT9O 5KPRA 3ZSXA 3BEXA 4DG1A 1YTAA 4JI4K 4M45A 3QEWA 2NRZA 3UKUB 4O4GA 4CFAA 4FWQA 2YHBA 4E19A 3SAHA 2H3GX 4BVOA 1WOQA 1BO5O 3AVIA 4CBUA 4HCBA 3F9KA 2ZF5O 3K9KA 4Q5VA 1VRTA 4C1NK 4KHUA 1BQMA 4B9TA 2E2QA 3ZT0A 2P9SB 1HLUA 3DJCA 2HF4A 1RTDA 3GBTA 3TTDA 3JYTA 4GW6A 3O08A 3VQ5A 1NJZA 3SMPA 3L3UA 1IO2A 3LP1A 1B9DA 4JKDA 1KRPA 4H4OA 1Q82O 1NGIA 3VF4A 5LMNK 4DR4K 4X62K 2OPPA 1XMOK 4A59A 4CJVA 4CVNE 3SJJA 2R7YA 1BQNA 2NLXA 3EE8A 1S6PA 5IWAK 3TTCA 3HP9A 1CXUA 1J9AA 5AQRA 3TR8A 3K5OA 1T03A 1FK9A 4M3RA 3MAQA 4DKWA 1DLOA 1YJ9N 3K2PA 5KPZA 2P5GA 4E7JA 4CEEA 1RTJA 1FKOA 3S3NA 4RW9A 2XY5A 3UB5A 4K0KK 4E1JA 1BHLA 5LL6Z 2Q1NA 3OBYA 4LC9B 1TKTA 4ID5A 4B1UB 3TABA 3PO4A 5CZ2A 2WBNA 1T6CA 5KI6A 5LMUK 4K43A 1RT5A 4OKEA 4HUFA 1JL2A 3O4WA 4DR3K 3A0IX 2V7ZA 1VQ7N 3R9PA 5HP1A 3QNNA 2HBLA 2HSTA 3EEQA 4O55A 1Z25A 5E26A 2QWLA 3WEEB 3I8BA 2UXBK 3QINA 4CHYA 1JXBA 2ZWHA 4FK4A 3O4QA 2W6LA 4IJAA 5AQNA 2PZSA 3BF1A 4KPYA 3V81A 5BPMA 1S1TA 4EIAA 4FW2A 2XY8A 4DQRA 2A6AA 2CGLA 4BG8A 1VSDA 4JKFA 4AM7A 2QWMA 4U7BA 1IV0A 3SQ2A 5AQUA 1EWQA 3RMCA 4E7KA 2Q31A 1CXQA 4FJ8A 4C8KA 4IFVA 2IVPA 1HNZK 3AO2A 2B4JA 2OANA 1YUWA 4H03B 4BC2A 4LF9K 2E88A 5ADXA 4BRCA 3MN5A 1JXEA 3KLGA 3L4QA 4ELVA 3D45A 3DOLA 2XY7A 3D2EA 4QS9A 1JL1A 3N4QA 3ZX0A 4XH5A 2KW4A 2RHKA 3HBTA 5AQOA 1KLMA 5BPNA 2VG6A 4K25A 3R8EA 3DLEA 2D0CA 3F5TA 1MDUB 1S9EA 4FVMA 3KLEA 1K73O 3CJ9A 3OA9A 5AZJA 3WT0A 4EZ6A 3SUQA 2ZJQL 3LZJA 4W5OA 2ATQA 3EO3A 3NBPA 3SV3A 5AQSA 3UKRB 3HP6A 4AQYK 5AQPA 1TK5A 1JKHA 4CZEA 2Q2RA 4JKBA 3ZCMA 1Z05A 5JICA 4FJ9A 3CCQN 3O8MA 1TKXA 3CCRN 4KHSA 1RDDA 4FJNA 3BZCA 1HX1A 1U04A 1ATSA 3F9MA 5GADP 1SUQA 3RR8A 1MU2A 3D7EO 3TU5A 1ZBHA 3V9WA 1OH8A 1HNWK 2BUPA 3H1QA 4IOCL 4DSJA 3UKUA 2OPQA 4KH5A 2XO7A 2NRWA 4BR0A 5M1KA 2BGGA 1X9WA 2IGIA 3ID6A 4MDAA 3O9RA 4JAXA 3AO4A 2ASMA 2PBDA 1YF5L 3U8XA 4E7HA 2BTFA 4LSLA 3AVJA 1T44A 4CJSA 4JS5A 5BRHA 1TVRA 4YOVA 4DSFA 4FLYA 4IEIA 2PFUA 4PUOA 2KZZA 3VA3A 2HHSA 3KZBA 4Z4CA 2IC3A 1L3SA 4CGGA 1KAXA 4FJMA 3RMAA 2IVOA 4I9QA 3CF5L 5CY4A 5C10A 3CQYA 1D4XA 1OVYA 4DS5A 2VYPA 4LF4K 2G8IA 4JKCA 1NG9A 4BE1A 1RBUA 3VEZA 3DAWA 4ZTFA 2D0PA 5FROA 4DCHA 4M7YA 3ZETB 4UQGA 2HHTA 3OYCA 4BE2A 4J2AA 1W97L 1TUYA 4DFMA 3AVNA 4UY8O 1C1BA 3C65A 1WB9A 4HHTA 5K14A 4O44A 3I33A 1O13A 2FF3B 1WSGA 4KV8A 2P9NA 4CJRA 1XNQK 3WXIA 3KKRA 4B9UA 1HJRA 4LF6K 4O5BA 4MLEA 4J8FA 4B1XB 4GV3A 3TSUA 2UUAK 5KPTA 4N56A 2CGKA 2YKNA 4WQ4C 3CCSN 2UUBK 3P1GA 1TL3A 3TSPA 3KK1A 2J4RA 3A5MC 1WUAA 1WSFA 4NB4A 4BGAA 1SKRA 1BOTO 3QFPA 2GEMA 3LDQA 2IS3A 4KRFA 2WUSA 3CQXA 3OVNA 1Y64A 1VQMN 2F9WA 4DTRA 4DV2K 1SAZA 1N32K 4DF4A 3HPHA 4LH5A 4CIEA 4N5SA 1GOAA 4JEPA 1QSYA 3CC2N 1E3MA 3ZEUA 4DR7K 4CGFA 1M1KO 1K8KA 3I8DA 1DTTA 3G6EN 1ILYA 1E4GT 4IDHA 2E1YA 4ICLA 4FK2A 4LD0A 1JLBA 3OYGA 3SQ1A 2QW9A 3OS2A 3C0BA 4H5NA 1NGGA 3E9OA 3OYAA 1BA1A 4ISGA 3WUHA 4E3SA 4OX9K 4QCLA 4JNEA 1NNEA 5JVHL 2QTDA 1SL0A 3T1HK 4F3OA 3C7NB 1RTIA 3FGUA 1RDUA 1NGHA 5CYMA 2HNZA 4CHOA 3KK2A 3QEPA 5M1OA 3G71N 3LALA 3MXJA 3L8BA 3FE1A 5BR9A 1JLEA 3WNFA 3N4PA 3UKRA 2ASPA 4JKAA 3VF6A 4FLTA 2KFZA 3V1OA 2YX6A 1N8RO 3ZSYA 3ZT2A 4WCEL 1KFDA 1CLQA 1NK0A 1NJXA 5AQZA 2OYQA 4JN4A 5I42A 1Q81O 5C2FA 1RFQA 4DQSA 1L3VA 3ZT3A 2FSNA 4YY3K 4GNIA 4H0PA 4FJIA 3VQBA 3VQQA 4MLHA 1JCGA 2D0AA 4XEIA 4AHRA 4F2SA 3C6UA 1KVAA 5J2NA 4NXNK 2FF6A 3SV4A 1QTMA 4B9VA 4BQLA 3A8YA 4KHYA 3G10A 4JLHA 1XNRK 3EKSA 3FLCO 2BANA 2HOEA 4H0OA 4JI6K 3TAMA 3TWHA 4RCHA 1S9GA 2GBZA 5M1NA 1QZ6A 4CZJA 3HOSA 1U48A 1YITN 4DLEA 1IKXA 2IOCA 3J7ZO 4KTWA 3EKUA 2NRRA 4WYBA 4DWIA 2KZMA 1N6QA 4CEFA 3MK6A 1HMVA 1YHQN 2HF3A 3G0ZA 1C0FA 2KFNA 2YNGA 2YCHA 1BIUA 3LDOA 3ULEA 3VGLA 3HK2A 1NK6A 1GLEG 2O8FB 1HYSA 4J2EA 1CZAN 1B9FA 1S72N 1L3TA 3RR7A 4BRDA 1XQSC 4A61A 2ZE2A 3T1AA 4CGHA 2RE2A 4JKGB 1LW0A 4CFCA 3ZETA 4FWMA 4OLAA 1V4TA 1VSFA 2D1KA 4FLZA 3OYHA 1JLQA 1S1VA 4KI6A 3CQ8A 3OW2M 1LWFA 3CCLN 4CJUA 5FRNA 5CE3A 4M3XA 1QVGM 4E1NA 2FBVA 4B8AB 3R6MA 4DTNA 1HJOA 3OYDA 1ZBIA 1VSKA 4FK0A 4Z4EA 1ASWA 3SBTA 1UA1A 3MWPA 3MCPA 4OLBA 4JK7A 2VG5A 2RF2A 2O4IA 4CF2A 1NKEA 3J81O 3HVTA 1Q86O 3IFRA 1J5OA 4BRQA 5J2MA 3NMUA 4OPHA 2V51B 1HR0K 4YOUA 5AQQA 3F2KA 2AP1A 5EU7A 3VEYA 1U4BA 3LM2A 3DXMB 2V52B 3LM9A 3A5NC 4DV0K 1WNSA 4NCAA 4Z0UA 4RTFD 1NWKA 5T7BA 1BGXT 4CEAA 3DWLA 4YOWA 3OTOK 4FW1A 2I7NA 5EY4A 4WFNL 5DM6L 1Z6RA 4Y1DA 3PUFA 4JS4A 4CJ7A 2YNHA 3O9QA 3M1FA 1ZYQA 1QQNA 4M3YA 4IZ9A 4G9ZA 2YHYA 4DV6K 4CGIA 3IS9A 4B3SK 2O8EA 1M90O 3KLHA 3M8QA 1QE1A 3CXCM 4FM1A 4DB3A 1X9MA 1HKCA 4NXMK 4Z4GA 3PSFA 2YKMA 1ZXOA 3THXB 1EP4A 2HNYA 4F8RA 1NM1A 4A2AA 1C0MA 3LZIA 4KB1A 2Z1HA 4FZYA 3AO1A 4CF1A 1N34K 4GMJB 1JLCA 2I7PA 1RGIA 4YORA 1W0HA 5M1PA 3H3NO 2NZTA 1Q9YA 3ISNC 3V4IA 1IG9A 4PL7A 4H4MA 5EXWA 3PX6A 3HT3A 4DU1A 3LPUA 4WFBL 1FW6A 4CBXA 4NYNA 4DTPA 1HYZA 4CEZA 3OY9A 4IO9L 3TSQA 3LPTA 4A5BA 5B8HA 1UAXA 1Q9XA 1X3MA 3SBGA 1LCUA 1NU0A 2P9LB 3C95A 4I6MB 3TI0A 1RCHA 2E6MA 5AFUH 3VF2A 3U9DA 4CJWA 1TKDA 3E9LA 3MXIA 2O8CA 3THYA 5MLCQ 2D0BA 3HRGA 3GDQA 1DTQA 4H5VA 3U4LA 3ZSWA 4DSKA 2D0OA 3H1VX 4CHQA 4J2DA 1GLFO 4DTJA 2O8BA 1NK5A 2A42A 3S41A 3O9UA 3HZ6A 1OH7A 4YOYA 4BRLA 2QI2A 5SWMA 3L2WA 3THWA 4BDYA 2HBJA 2O8DB 3SAFA 4DMNA 2UXCK 5BRFA 2F9TA 2UYTA 5FDLA 4TSXA 3RSEB 3CCJN 3O1WA 3ZSVA 3P83D 1D8YA 2HW3A 2E6LA 2PYJA 1QSLA 2RKIA 4EHUA 1NK7A 3LAKA 2FBYA 3BZKA 2XHBA 3AVLA 4MQ3A 3K5LA 2HHHK 4F2RA 1W2BM 4CECA 1YTUA 5AQVA 3AAQA 3KD5E 4FPAA 2A1RA 1I94K 4IOXA 3MEDA 2YV0X 3S9HA 4H8KA 2FSJA 4M41A 1B92A 3ITHA 3TTFA 4JI2K 1VSMA 2P1JA 3CM5A 1MWKA 4BRKA 3VQAA 1GLDG 3H3OB 3D2FA 1NGCA 1WSHA 1V4SA 1ATNA 3DXKA 3HJFA 4M3ZA 2A5XA 3VENA 5KQ8A 1REVA 1R59O 4CK1A 3QETA 2HBKA 3CFRA 4E0DA 4BY9C 4B3RK 4NO7A 2AA4A 1BIZA 3OYBA 3KLFA 5E84A 2RPIA 5HRNA 2KKZA 2P9IA 2X74A 4A2BA 3V9SA 4GKKK 1TK8A 1Q7YO 3NF8A 2OPSA 4AHVA 1HQEA 3B6OA 2BE2A 5AQJA 3VETA 4FWLA 4ISFA 4Z4HA 3DLKA 2YHWA 1K6YA 1X9JA 2VQEK 4JK9A 2E2PA 1LAWA 2G8HA 3HXMA 4PL8A 4LF8K 3WNHA 2QWOA 3R3LA 1VSLA 3MX2A 4KH4A 1G99A 3RRHA 4IFYA 4PWDA 3JAMO 5HOOA 2IVNA 4R5PA 1HUXA 3BP8A 3VQCA 3EY1A 1RT1A 2F4VK 1S1UA 1RT4A 3EYZA 5DM7L 2FBXA 3RMBA 1KSPA 4KKOA 3WXMB 5BN8A 3EN9A 1TYQB 1Z26A 3VQ9A 3BGRA 4N76A 3JSMA 3P4IA 4CF9A 2D5RA 4IJNA 4KREA 1HKBA 3K57A 1WLJA 4BR5A 5M1QA 1RBVA 1WSJA 2EX3A 1ZBFA 2VG7A 2E8AA 1QQOA 1U2VB 4KFBA 4FOIA 4DU3A 4KAZA 5AJ3K 4BWJA 4O8UA 4LFCK 3ZT1A 3WXKA 5AZIB 4DFJA 4B9QA 3NAEA 3NF9A 3KVGA 1HPZA 1XC3A 1GOCA 2Q36A 2NUBA 3AY9A 5ADXH 2DPNA 5BR8K 1J5EK 4E7IA 3M3ZA 3O3HA 4GVMA 5FPEA 4RW4A 1SZ2A 4BRIA 3EL2A 4IFEA 3K9JA 4C8NA 5J2PA 3ASMA 3CPEA 4ZHRA 1L5UA 3HVRA 3IKMA 3O3GA 2HHWA 4KI4A 3HYFA 2W40A 1TUUA 3OYFA 1DGKN 3F73A 3VERA 2P9SA 5KRTA 3LWLA 3ENHA 4K42A 1D9FA 4M3TA 1VSEA 4FOEA 4CW7B 2AJQA 3OS0A 3QBXA 4CD1A 3MN9A 4I6MA 4FWPA 1TL1A 3NVMA 5ELZA 3OYLA 2NRVA 4FJKA 1IBMK 4PHTX 2DFFA 1CZ9A 2E1ZA 1OH5A 4JI7K 3GG4A 3QB0A 2F8SA 4ID1A 2Q97A 3VQDA 3HOTA 1ZBUA 3TAQA 1ZBLA 4FJJA 1QVFM 1DT9A 4CZHA 5LJWA 2QKBA 2CGJA 2X6NA 3RSEA 4IWVA 2G8FA 2DFEA 4KBOA 4G1QA 5I9EB 3E01A 3S3OA 5JMVA 4JYAK 2F96A 5FPDA 2HHQA 1S1WA 3FFIA 3VQPA 2XRIA 3BF3A 3A5LC 3HSCA 1RDCA 4A57A 1VSHA 1Q18A 3CIPA 3L6QA 4BRAA 1SKWA 3OYJA 3O6WA 3WEEA 4B08A 3T69A 4WF9L 4IKFA 3VEWA 4CIFA 1NGBA 5J2QA 1YVNA 1IKYA 1P8ZA 4FZZA 1U6ZA 3C6TA 1NGFA 4FPBA 1F21A 3HL8A 4CGDA 4K8XA 3J7AP 4DF8A 1KAZA 3VTHA 3THVA 2VGMA 2YI1A 2B6AA 4FWKA 4EP5A 2UUCK 2W6KA 2P9KB 4GVEA 1RT3A 3DRSA 5CZ1A 5CR4A 4PKGA 3LDLA 1NJWA 3AO3A 4B8CA 2GELA 1FJGK 1HNIA 4L3QA 5CHIA 2QWNA 2UU9K 4FVUA 4CZFA 2G8WA 4CIGA 2KTQA 4AHSA 4HUEA 3VEXA 5KTQA 4BRPA 1NJIO 5GINA 2Y1JA 4CEDA 4FWNA 4XH4A 2G8VA 4DUZK 2P9PB 4LSNA 3JS6A 3K59A 4CJ5A 1BU6O 3K58A 1KFSA 1KVBA 1VHXA 1EXQA 5HBMA 2G8UA 1G15A 3EZ5A 2I5JA 1TYQA 1TV6A 3QLHA 5BN9A 2NRHA 2VWKA 3OJSA 1YXQA 1HKGA 3HM9A 1ITGA 3OYKA 3UIQA 4FYDA 3T19A 4BRHA 5C15A 2PY5A 4KHWA 4M42A 4JV5K 3I55N 1KAYA 4X64K 3P38A 3CMAN 3OHRA 4CFBA 3AVBA 3WXJA 1D5AA 4DTOA 1RBRA 4OGCA 2PYLA 3TPQA 4QS7A 3LWMA 4B9NA 3AGKA 1ZC6A 3WNEA 2WONA 1RT2A 1J54A 1YI2N 2PAVA 5HL7L 4X66K 3KWGA 5C2DA 3AO5A 3KWIA 3DRRA 2P51A 5AQGA 2G8KA 4O0IA 4FL9A 3TANA 4PA1A 3VEOA 3CFPA 1KVCA 1U49A 4AF1A 3CCEN 4E89A 5LY3A 1C0GA 2FLOA 1HQUA 3O5BA 1SV5A 5GAEP 3CFOA 3P39A 3SNNA 4I7FA 1XC9A 4V19S 1WN7A 5TKWA 5J1EA 1BCMA 1BWFO 3ZX3A 1VSIA 1QQCA 4CJ4A 3VMFB 3M6GA 4WQ5A 3ULDA 4XH1A 3WXLA 4KB0A 3HI0A 5DK5A 1QHAA 3E1YA 2WOMA 4FXDA 3SPZA 1NOYA 1S22A 5GAHP 4BDPA 1UWBA 3MDQA 3SUOA 4L8RB 1VQON 3DLRA 1EQYA 4CJLA 4CHNA 2Q0RA 4HTUA 3ID8A 1NK9A 3DLBA 4IEEA 1BUPA 1BI4B 4IBNA 1RDAA 2X6SA 4AHTA 3CJAA 2QWQA 2RN2A 5FLXO 3V9ZA 4YDUA 5JS1A 4JRPA 5E41A 1XUPO 5KGXA 1YAGA 3VPZA 1EX4A 1IJJA 4DUYK 1VQ8N 1FKPA 5KQDA 2QK9A 1GLAG 1A5XA 3HPGA 1SQKA 3CMEN 4DHYA 5F2RA 3V9XA 4OPAA 4DV3K 2VGNA 5LJVA 5BREA 3MX5A 3T7ZA 3PY8A 4ELTA 1IH7A 4GV9A 2A3ZA 4JK8A 2WTUA 4CZLA 1RBSA 2GX9A 4CZMA 3R1XA 1RT6A 3ZLJA 5C12A 2OZSA 2P9KA 3QO9A 3HTVA 4OPKA 3OYNA 4WQ5C 1U45A 4FWRA 3AVFA 5BRDA 2ZJPL 1VRUA 1HRHA 5GIOA 4DTXA 2NRXA 1IBKK 4CJ3A 2CH6A 1N33K 5F0XA 2A40A 3QNOA 4PQUA 4FJ5A 5M1FA 1K8AO 3ZSQA 4K8ZA 4DR6K 4CJPA 3NGIA 4C23A 4O0JA 1WAFA 3C7NA 4CJQA 2P9PA 2YNIA 3SMSA 2W42A 4GV6A 3M5RA 2GUPA 1JLGA 4KO0A 3AVKA 3LDPA 3RVCA 4H5TA 4CE9A 1NK8A 1RILA 4F9OA 3M8SA 2ZGZA 4IOAL 4CERA 4B1YB 2QXFA 3AVCA 1HNXK 1VK0A 4IG3A 2OZMA 1T3VA 5AZJB 3LP2A 1BDGA 2HVIA 1KXPA 3CCUN 3VQEA 4YFUA 4JI8K 3C94A 3CHWA 4H0XB 1C1CA 2ITMA 2HMIA 4B1VA 3VGMA 2Z1JA 4CEBA 3QEVA 4LFBK 4BC3A 3IUCA 3IRXA 5HRRA 4W5RA 3CCMN 1NGJA 2A41A 2YHAA 1GOBA 2DFHA 1YIJN 3O9TA 4OJRA 4B3OA 1H1VA 4DTSA 1T8EA 3T3FA 4CESA 4B9LA 3Q7CA 2E20A 4KTQA 4AHUA 5AQIA 3AVMA 4ELUA 2E2NA 3RMDA 1NGDA 3B6PA 3RRGA 5C42A 1L3UA 4HUGA 3PV8A 3PLAA 3NF7A 4DQIA 3I0SA 3GOIA 4H5WA 4U67L 1NK4A 3OYEA 5A2QO 2XY6A 5AQKA 4B1WB 3JXUA 1WAJA 4DQ8A 2O8FA 3SCXA 3ZSOA 3RWUA 4F4KA 2LSNA 4BG9A 1VAZA 3AA4A 1LW2A 4C8MA 3FFKB 3T1YK 4FLVA 4JKGA 1XHZA 4BRFA 4DV5K 1EO1A 2NRTA 2FSKA 3OJUA 4FWOA 3WQTA 3U9ZA 4AHCA 5EX5A 3TARA 2KLAA 1OKJA 4XIUA 1VSJA 3KJVA 4M3UA 2NNWA 1S6QA 4CJFA 1BI4A 5AQMA 1KTQA 2ZGYA 1RNHA 4RWTA 5FRMA 2GTDA 4EFHA 2QXLA 3K5NA 3QMLA 3DRPA 1SL1A 3E66A 4EZ9A 2W41A 3KD1E 2P9NB 2P9UB 3CJ1A 4B9SA 1QSSA 1C0UA 2B5JA 4C8OA 5C25A 2ITGA 4HCCA 1S3XA 1WSEA 3NDKA 1IG8A 2FC0A 3V1RA 1ASUA 3VGKA 4CEQA 5AQTA 4DR2K 3J8AA 3KIOA 3OYIA 2FBTA 2HBMA 3H45C 4BROA 2FXUA 2OPRA 3CJ7A 3IMXA 4DV1K 1NGEA 1N36K 3DXMA 3V6DA 4I2QA 3L2RA 4FWSA 3DYAA 3CC7N 3OBWA 3V9UA 1XI1A 4RW8A 3SQ4A 2GUIA 2JWKA 2EHGA 3DMJA 1TGOA 1BL3A 1LWCA 3Q7BA 1NKCA 3PIOL 3GL1A 3CETA 3FZMA 1KLNA 4FJGA 4BRMA 3ZEUB 1D9DA 3H6EA 4QAGA 2D4WA 1S1XA 1K8KB 1VQNN 2HB5A 3I56N 1WBDA 4FM0A 4FLWA 4ZTJA 4CJTA 1NJYA 3L3VA 4AM6A 5F1XA 4DS4A 3CC4N 4EAHD 5C0YA 5KGWA 1YJNN 3PX4A 3W0LA 1BA0A 3QIPA 3O80A 5EOYA 4HVJA 1MWMA 3SJHA 3RTVA 2BDPA 1NGAA 4QS8A 4BC5A 5I3UA 2Q0UA 4DV7K 3THXA 1IBLK 1VQ4N 5DMRA 4MFBA 4I9LA 4C1NI 1BCOA 3CCVN 3O1BA 1UOCA 4NYFA 3VEVA 4LF5K 3J7YP 4M7XA 4B3TK 3VQ8A 2X78A 5FPNA 1TAQA 4FJXA 1RBTA 3AGRA 1XWLA 4LF7K 3SI6A 1A5WA 3FZLA 4CGJA 3O9SA 1JLFA 4CZGA 3O4NA 4YHHK 2EWSA 4CK3A 4JI5K 2JWLA 4OVLA 3QICA 4FLUA 3MWTA 4FLXA 4X65K 3NGZA 1ASVA 4ILHA 4KHNA 2HHXA 3NE6A 3HSTB 3AARA 3SAGA 2P9LA 4ILGB 3SYZA 4K41A 1YT3A 5AQXA 3CJBA 3CYMA 1UA0A 1LOTB 3QEXA 4WQ4A 2QWPA 3C6AA 3MN7A 5AQFA 1KD1O 2DTUA 1RDBA 4JD2B 4B3MK 4WE1A 2OTLN 4DTUA 5AR0A 1TKZA 3FR0A 1BG3A 2O8DA 1LAVA 2VWBA 4F3TA 4JRQA 3H46O 3CJCA 3MECA 1KQSM 3NH1A 4Z4FA 3PIPL 3HM8A 3ZT4A 3VQ6A 5EVZA 4DR5K 2E5LK 4BREA 5JVGL 1TK0A 3ULEB 4H5RA 1KC8O 3NGYA 4KHPK 3KLIA 4RW6A 1WSIA 4BE0A 4LH4A 3VN5A 3QFUA 1W7AA 1U47A 4BWMA 4B1ZA 5AQHA 2ASOA 4ISEA 3S3MA 4M63C 1WBBA 2E4LA 3P31A 4AH9A 4CK2A 3OS1A 4N47A 3U3YA 4A5AA 4DQPA 1JCEA 3ALYA 4A62A 1JCFA 3IAYA 4M3WA 4N41A 4O5FA 1N5YA 2P5OA 4DFKA 1ATRA 4CFDA 2HMPA 3M8RA 3CPWM 3K0SA 4JKHA 4RG8A 3J80O 1FXXA 2VQFK 3L2QA 2P9UA 4H0YB 4EP4A 4BQZA 1IKVA 2CH5A 3IG1A 3AA5X 3KHYA 3QBWA 4NLBA 3L4IA 3CERA 2QA4N 1VQ5N 1GLLO 1DKGD 1HNVA 3V1QA 1YJWN 2GV9A 3A5OC 4DQQA 2KQ2A 2HHUA 4JI1K 4H0TB 2UXDK 3CG7A 3MEGA 2O4GA 4Y1CA 5HLFA 4H0VB 5CYQA 1QS4A 4W5QA 4OPJA 4PKHA 3EZWA 3LP0A 2OTJN 3FZKA
chains in the Genus database with same CATH topology
4CZEA 2Q2RA 4JKBA 3E9LA 4KH6A 3CJAA 1Z05A 5MLCQ 5JICA 4PKIA 3HRGA 3GDQA 4H5VA 3U4LA 2QWQA 3CCQN 2D0OA 3H1VX 3O8MA 3CCRN 1GLFO 4YDUA 2A42A 3S41A 1XUPO 4IXCA 1HX1A 1YAGA 3O9UA 2V7YA 4BR2A 1ATSA 3QDKA 3F9MA 5GADP 3HZ6A 3VPZA 1IJJA 4YOYA 4BRLA 1VQ8N 2QI2A 3B8AX 3D7EO 3TU5A 5KQDA 1ZBSA 2HBJA 1GLAG 1SQKA 1RDWX 3SAFA 3CMEN 1GLJO 4O8KA 3SK3A 2YJEA 4DHYA 5F2RA 3SLCA 5AQWA 2BUPA 5BRFA 3H1QA 4IOCL 2F9TA 4OPAA 2UYTA 2QWRA 3UKUA 3RSEB 2VGNA 1JJ2M 2E2OA 4KH5A 5LJVA 3O1WA 5BREA 2NRWA 4BR0A 3MX5A 5M1KA 3CCJN 3T7ZA 3ID6A 4MDAA 4GV9A 3O9RA 2A3ZA 4JK8A 4EHUA 4CZLA 1HPMA 4CZMA 2GX9A 1U2VA 4YOTA 3R1XA 4JHDB 4JAXA 3ATUA 5C12A 5GIPA 2ASMA 2P9KA 5AZIA 1W2BM 4WFAL 2PBDA 3HTVA 1YF5L 3U8XA 3UE5A 4Y0WA 4CZKA 1NLVA 5AQVA 3VOVA 2BTFA 3AAQA 4FPAA 4IOXA 1T44A 4WQ5C 4FWRA 5BRHA 2FSJA 5BRDA 4YOVA 2ZJPL 5GAGP 2YJFA 4IEIA 2PFUA 3TTFA 5GIOA 2NRXA 3KZBA 1MWKA 2CH6A 4BRKA 1GLDG 5F0XA 1VQPN 2A40A 3H3OB 3D2FA 1VQ9N 2GWKA 1KAXA 5M1FA 1NGCA 1K8AO 4BVPA 3E9PA 2IVOA 1V4SA 1NMDA 4BR7A 1ATNA 3DXKA 4OO1J 5AQYA 2A5XA 4C23A 3VENA 3C7NA 3CF5L 5KQ8A 4BC4A 5C10A 1R59O 2P9PA 3SMSA 4GV6A 2HBKA 3M5RA 2GUPA 3CQYA 1D4XA 1OVYA 3ZX2A 4BY9C 1VQ6N 3ENOA 2VYPA 4NO7A 1ESVA 1VQKN 2AA4A 1VQLN 3ENBA 3LDPA 4H5TA 3RVCA 4JKCA 4F9OA 2ZGZA 5E84A 4IOAL 3VEZA 3MMVA 3DAWA 1MA9B 4B1YB 2KKZA 2D0PA 4DCHA 2P9IA 4M7YA 3ZETB 1T3VA 5AZJB 4A2BA 1BDGA 1W97L 1TUYA 1Q7YO 3C6HA 1KXPA 4UY8O 3NVKA 1QZ5A 2IIRA 3C65A 3CCUN 4HWIA 3I33A 1O13A 5AQJA 3VETA 2FF3B 4FWLA 4CI6A 3CHWA 4H0XB 4ISFA 3LL3A 2VCPA 2YHWA 2ITMA 2OTJN 1X9JA 4JD2A 2P9NA 4B1VA 3VGMA 4JK9A 2E2PA 3WXIA 4PL8A 2QWOA 3R3LA 3MX2A 4MLEA 3MCAB 4J8FA 4KH4A 4B1XB 1G99A 3TSUA 4GV3A 3LDNA 1QQMA 5KPTA 4BC3A 5HOOA 4U67L 2CGKA 2IVNA 3IUCA 1HUXA 3BP8A 4WQ4C 3GE1A 3CCMN 1NGJA 3CCSN 2A41A 4NLCA 3TSPA 5DM7L 1YIJN 3MN6A 2J4RA 3FZFA 3WXMB 5BN8A 3EN9A 3O9TA 1TYQB 1WUAA 2KHOA 3A5MC 4NB4A 4BGAA 1BOTO 1H1VA 3QFPA 4BGBA 2WC9A 1SS6A 2GEMA 3LDQA 3P4IA 3Q7CA 4IJNA 1HKBA 2E20A 2WUSA 3CQXA 4BR5A 4R79A 5AQIA 1Y64A 1VQMN 5M1QA 2F9WA 3D6RA 4EHTA 1SAZA 2E8AA 1QQOA 1U2VB 2E2NA 3ZYYX 1NGDA 4FOIA 3AAPA 5FPMA 4JEPA 4BRGA 4O8UA 2F7TA 2WFBA 3CC2N 3WXKA 5AZIB 3ZEUA 1X3NA 1M1KO 1K8KA 4B9QA 4MDBA 3G6EN 1ILYA 4MO5A 3CD6N 1E4GT 4IDHA 3KVGA 1XC3A 2E1YA 3PLAA 2Q36A 1T6DA 3GOIA 4H5WA 3AY9A 5AQLA 2QW9A 3VTIA 3C0BA 2DPNA 1NGGA 1P90A 4H5NA 3M3ZA 4Z94A 3E9OA 1BA1A 4ISGA 5AQKA 4FO0A 3WUHA 5JLHA 5FPEA 3FZHA 4B1WB 3JXUA 4JNEA 3D2FB 4DQ8A 1SZ2A 4BRIA 2GWJA 3EL2A 4IFEA 3DXKB 3K9JA 2QTDA 4BR9A 4MO4A 5JVHL 3VESA 4JKEA 3CPEA 3IKMA 3C7NB 5TKYA 4BG9A 1VAZA 3FGUA 1RDUA 3DLLL 3ATVA 1NGHA 2ZJRL 2W40A 1TUUA 3FFKB 1DGKN 4JKGA 1EO1A 4BRFA 5M1OA 2NRTA 3VERA 2FSKA 2P9SA 3G71N 4FWOA 3CI5A 3WQTA 3U9ZA 3ENHA 4K42A 5EX5A 2KLAA 3L0QA 2P9IB 3FE1A 1OKJA 5BR9A 4FOEA 1GLBG 4IO8A 3N4PA 2NNWA 3QBXA 3UKRA 4CD1A 1K9MO 2ASPA 4JKAA 3MN9A 4I6MA 5AQMA 4FWPA 3VF6A 3NVMA 4CBWA 5JLFA 2ZGYA 4ILJA 4RWTA 2YX6A 2GTDA 4EFHA 1N8RO 5ELZA 2QXLA 3QMLA 2NRVA 1GLCG 3E66A 4WCEL 2W41A 4PHTX 2P9NB 3D2EB 2P9UB 2E1ZA 3CJ1A 3GG4A 3QB0A 2Q97A 5AQZA 3HOTA 1DEJA 4JN4A 3W3DA 5ADXH 1Q81O 1QVFM 1DT9A 4CZHA 1S3XA 5C2FA 5LJWA 4BRNA 1IG8A 1RFQA 5BPLA 2FSNA 3VGKA 4GNIA 5AQTA 2BH1A 2CGJA 4H0PA 4YDUC 3J8AA 4MLHA 1JCGA 1E4FT 4XEIA 2HBMA 3IDHA 3RSEA 3H45C 4BROA 4FSVA 2FXUA 2FF6A 4IWVA 3CJ7A 3IMXA 1NGEA 4KBOA 3WQUA 3A8YA 4BQLA 3DXMA 5I9EB 3EKSA 3FLCO 2HOEA 3G25A 4FWSA 3CC7N 3OBWA 4H0OA 5JMVA 4JHDA 4RCHA 5AFUA 4YOXA 2JWKA 5H1SQ 3G4SN 4HTLA 5FPDA 5M1NA 1NBWA 2QM1A 1QZ6A 2YHXA 3BUZB 3Q7BA 4CZJA 2QEXN 3HOSA 3PIOL 3GL1A 3CETA 3FZMA 3BF3A 3KK7A 1YITN 3EE9A 3J7ZO 4BR4A 3A5LC 4BRMA 3ZEUB 3HSCA 3H6EA 3EKUA 2D4WA 1K8KB 4A57A 1VQNN 2NRRA 4CZIA 1Q18A 4WYBA 3I56N 3CIPA 1J6ZA 3L6QA 4BRAA 4CD3A 3MK6A 4GY2B 3O6WA 3WEEA 3T69A 5KPRA 4WF9L 1YHQN 2HF3A 3VEWA 4AM6A 3BEXA 1C0FA 5F1XA 2YCHA 3CC4N 4EAHD 5C0YA 1NGBA 3LDOA 1YJNN 3ULEA 1YVNA 2NRZA 3VGLA 3UKUB 3W0LA 1GLEG 1P8ZA 1BA0A 1U6ZA 1CZAN 1NGFA 3O80A 4FPBA 5EOYA 1S72N 1MWMA 3SJHA 4FWQA 1KAZA 3VTHA 3SAHA 1NGAA 2H3GX 4BRDA 2VGMA 1WOQA 1XQSC 4BVOA 2YI1A 1BO5O 4QS8A 4A61A 4BC5A 4FWKA 4CBUA 2ZF5O 3K9KA 2Q0UA 4C1NK 2RE2A 2E2QA 4JKGB 2P9KB 4GVEA 2P9SB 1HLUA 3DJCA 2HF4A 3ZETA 4FWMA 5CR4A 1V4TA 3GBTA 4PKGA 2D1KA 3LDLA 3TTDA 1VQ4N 2GELA 3O08A 4L3QA 3OW2M 5CHIA 2QWNA 4C1NI 3CCVN 4FVUA 3SMPA 4CZFA 3O1BA 3CCLN 3VEVA 4JKDA 5CE3A 4M7XA 1Q82O 1QVGM 1NGIA 3VF4A 3VEXA 5FPNA 3R6MA 4A59A 1HJOA 4BRPA 1NJIO 5GINA 3AGRA 4FWNA 3SBTA 2NLXA 3FZLA 3EE8A 3O9SA 4XH4A 4CZGA 3MWPA 3MCPA 3TTCA 2P9PB 2EWSA 4JK7A 3JS6A 2JWLA 3QICA 5AQRA 1BU6O 3MWTA 4PL7A 1Q86O 4DKWA 4ILHA 1YJ9N 1TYQA 3IFRA 4BRQA 5BN9A 3NMUA 4OPHA 2V51B 4YOUA 2NRHA 5KPZA 5AQQA 3F2KA 3AARA 3SAGA 1YXQA 2P9LA 1HKGA 2AP1A 3VEYA 3LM2A 4ILGB 3DXMB 3UB5A 4K41A 2V52B 4E1JA 3LM9A 3A5NC 3CJBA 5AQXA 4BRHA 1LOTB 5C15A 2Q1NA 3OBYA 4LC9B 4WQ4A 2QWPA 3C6AA 3MN7A 5AQFA 1KD1O 4B1UB 4JD2B 3I55N 4RTFD 1NWKA 1KAYA 3DWLA 4YOWA 2WBNA 1T6CA 4K43A 3P38A 2I7NA 5EY4A 3O4WA 2OTLN 3A0IX 4WFNL 5AR0A 2V7ZA 5DM6L 3OHRA 3CMAN 1Z6RA 3FR0A 3R9PA 1VQ7N 1BG3A 2HBLA 3WXJA 2HSTA 2VWBA 5E26A 4CJ7A 3O9QA 2QWLA 3WEEB 3M1FA 3H46O 3CJCA 3I8BA 1KQSM 1QQNA 3PIPL 4IZ9A 3HM8A 4G9ZA 5EVZA 2YHYA 3TPQA 2ZWHA 4BREA 4QS7A 5JVGL 4IJAA 5AQNA 3ULEB 4H5RA 1KC8O 3BF1A 3AGKA 1ZC6A 5BPMA 1M90O 4EIAA 3QFUA 2A6AA 2CGLA 4BG8A 4JKFA 1YI2N 4AM7A 2PAVA 2QWMA 5AQHA 4B1ZA 5HL7L 4U7BA 2ASOA 3CXCM 4ISEA 4DB3A 4M63C 3KWGA 5AQUA 5C2DA 1HKCA 3KWIA 3P31A 2Q31A 1ZXOA 5AQGA 4A5AA 1JCEA 4FL9A 1NM1A 4A62A 4A2AA 1JCFA 2IVPA 4O5FA 3VEOA 2OANA 1YUWA 4AF1A 3CCEN 1ATRA 4H03B 4BC2A 2HMPA 3CPWM 5LY3A 2E88A 4JKHA 5ADXA 1C0GA 2I7PA 4BRCA 3MN5A 1RGIA 2FLOA 4YORA 3O5BA 5GAEP 3L4QA 3P39A 5M1PA 3D2EA 3H3NO 2P9UA 2NZTA 4H0YB 4QS9A 3N4QA 3VF2A 4BQZA 3ZX0A 2CH5A 4XH5A 5TKWA 3KHYA 1BWFO 3QBWA 2RHKA 3HBTA 4NLBA 5EXWA 5AQOA 3VMFB 3ZX3A 3L4IA 3M6GA 5BPNA 4WQ5A 4CBXA 3CERA 4K25A 4XH1A 3WXLA 4WFBL 3HI0A 2QA4N 1VQ5N 3R8EA 4IO9L 1QHAA 3E1YA 1GLLO 3TSQA 1DKGD 3F5TA 1MDUB 1YJWN 1S22A 5GAHP 3A5OC 1K73O 4A5BA 5B8HA 3CJ9A 3MDQA 3OA9A 5AZJA 1X3MA 1VQON 4H0TB 3WT0A 3SBGA 1LCUA 1EQYA 2ZJQL 3EO3A 2Q0RA 5AQSA 3UKRB 2P9LB 4H0VB 3ID8A 4IEEA 5AQPA 1BUPA 4PKHA 4I6MB 3EZWA 5AFUH 3U9DA 3FZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZE A;  2Q2R A;  3CJA A;  1Z05 A;  5JIC A;  4PKI A;  4H5V A;  3GDQ A;  3U4L A;  2QWQ A;  2D0O A;  3H1V X;  3O8M A;  1GLF O;  4YDU A;  2A42 A;  3S41 A;  1XUP O;  4IXC A;  1HX1 A;  1YAG A;  4BR2 A;  2V7Y A;  1ATS A;  3QDK A;  3F9M A;  3HZ6 A;  3VPZ A;  1IJJ A;  4BRL A;  5KQD A;  3B8A X;  3D7E O;  3TU5 A;  1ZBS A;  1GLA G;  1SQK A;  1RDW X;  1GLJ O;  4O8K A;  3SK3 A;  2YJE A;  4DHY A;  5F2R A;  3SLC A;  5AQW A;  2BUP A;  5BRF A;  3H1Q A;  2F9T A;  2UYT A;  2QWR A;  3UKU A;  3RSE B;  2E2O A;  5LJV A;  3O1W A;  5BRE A;  4BR0 A;  2A3Z A;  4EHU A;  4CZL A;  1HPM A;  4CZM A;  1U2V A;  4JHD B;  4JAX A;  3ATU A;  2ASM A;  2P9K A;  5AZI A;  2PBD A;  3HTV A;  3U8X A;  3UE5 A;  4Y0W A;  4CZK A;  1NLV A;  5AQV A;  3VOV A;  2BTF A;  3AAQ A;  4FPA A;  1T44 A;  4WQ5 C;  4FWR A;  5BRH A;  2FSJ A;  5BRD A;  2YJF A;  3KZB A;  1MWK A;  2CH6 A;  4BRK A;  1GLD G;  5F0X A;  2A40 A;  3H3O B;  3D2F A;  2GWK A;  1KAX A;  1NGC A;  4BVP A;  2IVO A;  1V4S A;  1NMD A;  4BR7 A;  1ATN A;  3DXK A;  5AQY A;  2A5X A;  4C23 A;  3VEN A;  3C7N A;  5KQ8 A;  4BC4 A;  1R59 O;  2P9P A;  3SMS A;  3ZX2 A;  2GUP A;  3CQY A;  1D4X A;  3ENO A;  2VYP A;  4NO7 A;  1ESV A;  2AA4 A;  3LDP A;  4H5T A;  4F9O A;  2ZGZ A;  5E84 A;  3VEZ A;  3MMV A;  3DAW A;  1MA9 B;  4B1Y B;  2D0P A;  4DCH A;  2P9I A;  4M7Y A;  3ZET B;  5AZJ B;  4A2B A;  1BDG A;  1TUY A;  1KXP A;  1QZ5 A;  2IIR A;  4HWI A;  3I33 A;  5AQJ A;  3VET A;  4CI6 A;  2FF3 B;  4FWL A;  3CHW A;  4H0X B;  4ISF A;  3LL3 A;  2VCP A;  2YHW A;  2ITM A;  1X9J A;  4JD2 A;  2P9N A;  4B1V A;  3VGM A;  3WXI A;  2E2P A;  4PL8 A;  2QWO A;  4MLE A;  4J8F A;  4B1X B;  1G99 A;  3LDN A;  1QQM A;  5KPT A;  4BC3 A;  2CGK A;  2IVN A;  3IUC A;  1HUX A;  3BP8 A;  4WQ4 C;  3GE1 A;  1NGJ A;  2A41 A;  3MN6 A;  2J4R A;  3FZF A;  5BN8 A;  3EN9 A;  1TYQ B;  1WUA A;  2KHO A;  3A5M C;  4NB4 A;  4BGA A;  1BOT O;  1H1V A;  3QFP A;  4BGB A;  2GEM A;  3LDQ A;  3P4I A;  4IJN A;  1HKB A;  2E20 A;  2WUS A;  3CQX A;  4BR5 A;  5AQI A;  1Y64 A;  2F9W A;  4EHT A;  1SAZ A;  2E8A A;  1QQO A;  1U2V B;  2E2N A;  1NGD A;  4FOI A;  3AAP A;  5FPM A;  4BRG A;  3WXK A;  5AZI B;  3ZEU A;  1X3N A;  1K8K A;  4B9Q A;  4MO5 A;  1E4G T;  3KVG A;  1XC3 A;  2E1Y A;  2Q36 A;  1T6D A;  3GOI A;  4H5W A;  3AY9 A;  5AQL A;  2QW9 A;  5ADX H;  2DPN A;  3C0B A;  1NGG A;  4H5N A;  4Z94 A;  3M3Z A;  1BA1 A;  4ISG A;  5AQK A;  4FO0 A;  3WUH A;  5JLH A;  5FPE A;  3FZH A;  4B1W B;  3JXU A;  4JNE A;  3D2F B;  4DQ8 A;  1SZ2 A;  4BRI A;  2GWJ A;  3EL2 A;  3DXK B;  4BR9 A;  4MO4 A;  3VES A;  3C7N B;  5TKY A;  4BG9 A;  3FGU A;  3ATV A;  1NGH A;  2W40 A;  1TUU A;  3FFK B;  1DGK N;  4BRF A;  3VER A;  2FSK A;  2P9S A;  4FWO A;  3CI5 A;  3WQT A;  3U9Z A;  3ENH A;  4K42 A;  5EX5 A;  3L0Q A;  2P9I B;  3FE1 A;  1OKJ A;  5BR9 A;  4FOE A;  1GLB G;  4IO8 A;  3QBX A;  3UKR A;  4CD1 A;  2ASP A;  3MN9 A;  4I6M A;  5AQM A;  4FWP A;  3VF6 A;  4CBW A;  5JLF A;  2ZGY A;  4RWT A;  2GTD A;  4EFH A;  5ELZ A;  2QXL A;  3QML A;  1GLC G;  2W41 A;  2P9N B;  3D2E B;  2P9U B;  2E1Z A;  3CJ1 A;  3GG4 A;  3QB0 A;  2Q97 A;  5AQZ A;  1DEJ A;  4JN4 A;  3W3D A;  4CZH A;  1S3X A;  5LJW A;  4BRN A;  1IG8 A;  1RFQ A;  5BPL A;  2FSN A;  3VGK A;  4GNI A;  5AQT A;  2CGJ A;  4H0P A;  4YDU C;  3J8A A;  4MLH A;  1JCG A;  1E4F T;  4XEI A;  3IDH A;  3RSE A;  3H45 C;  4BRO A;  4FSV A;  2FXU A;  2FF6 A;  4IWV A;  3CJ7 A;  3IMX A;  1NGE A;  4KBO A;  3WQU A;  3A8Y A;  4BQL A;  3DXM A;  5I9E B;  3EKS A;  3FLC O;  2HOE A;  3G25 A;  4FWS A;  4H0O A;  5JMV A;  4JHD A;  4RCH A;  5AFU A;  4HTL A;  5FPD A;  1NBW A;  2QM1 A;  1QZ6 A;  2YHX A;  3BUZ B;  4CZJ A;  3GL1 A;  3CET A;  3FZM A;  3BF3 A;  4BR4 A;  3A5L C;  4BRM A;  3ZEU B;  3HSC A;  3H6E A;  3EKU A;  2D4W A;  1K8K B;  4CZI A;  1Q18 A;  4WYB A;  3CIP A;  1J6Z A;  3L6Q A;  4BRA A;  4CD3 A;  3MK6 A;  4GY2 B;  3O6W A;  3WEE A;  5KPR A;  2HF3 A;  3VEW A;  4AM6 A;  3BEX A;  1C0F A;  5F1X A;  2YCH A;  4EAH D;  1NGB A;  3LDO A;  3ULE A;  1YVN A;  3VGL A;  3UKU B;  3W0L A;  1GLE G;  1P8Z A;  1BA0 A;  1U6Z A;  1CZA N;  1NGF A;  3O80 A;  4FPB A;  5EOY A;  1MWM A;  3SJH A;  4FWQ A;  1KAZ A;  1NGA A;  2H3G X;  4BRD A;  4BVO A;  1WOQ A;  1XQS C;  2YI1 A;  1BO5 O;  4QS8 A;  4A61 A;  4BC5 A;  4FWK A;  4CBU A;  2ZF5 O;  2Q0U A;  2E2Q A;  2P9K B;  3DJC A;  1HLU A;  2P9S B;  2HF4 A;  3ZET A;  4FWM A;  1V4T A;  3GBT A;  4PKG A;  2D1K A;  3LDL A;  2GEL A;  3O08 A;  4L3Q A;  2QWN A;  3SMP A;  4CZF A;  3O1B A;  3VEV A;  5CE3 A;  4M7X A;  1NGI A;  3VF4 A;  3VEX A;  5FPN A;  3R6M A;  1HJO A;  4BRP A;  4FWN A;  2NLX A;  3FZL A;  4XH4 A;  4CZG A;  3MCP A;  2P9P B;  2EWS A;  3JS6 A;  3QIC A;  5AQR A;  1BU6 O;  1TYQ A;  3IFR A;  4BRQ A;  5BN9 A;  2V51 B;  2NRH A;  5KPZ A;  5AQQ A;  3AAR A;  1YXQ A;  2P9L A;  1HKG A;  2AP1 A;  3VEY A;  3LM2 A;  3DXM B;  3UB5 A;  4K41 A;  2V52 B;  4E1J A;  3LM9 A;  3A5N C;  3CJB A;  5AQX A;  4BRH A;  1LOT B;  2Q1N A;  4LC9 B;  4WQ4 A;  2QWP A;  3MN7 A;  5AQF A;  4B1U B;  4JD2 B;  4RTF D;  1NWK A;  1KAY A;  3DWL A;  1T6C A;  4K43 A;  2I7N A;  5EY4 A;  3O4W A;  3A0I X;  5AR0 A;  2V7Z A;  3OHR A;  1Z6R A;  3FR0 A;  3R9P A;  1BG3 A;  3WXJ A;  2VWB A;  5E26 A;  4CJ7 A;  2QWL A;  3WEE B;  3M1F A;  3H46 O;  3CJC A;  3I8B A;  1QQN A;  4IZ9 A;  3HM8 A;  5EVZ A;  2YHY A;  3TPQ A;  2ZWH A;  4BRE A;  4QS7 A;  4IJA A;  5AQN A;  3ULE B;  4H5R A;  3BF1 A;  1ZC6 A;  5BPM A;  4EIA A;  3QFU A;  2A6A A;  2CGL A;  4BG8 A;  4AM7 A;  2PAV A;  2QWM A;  5AQH A;  4B1Z A;  2ASO A;  4ISE A;  4DB3 A;  4M63 C;  5AQU A;  1HKC A;  2Q31 A;  1ZXO A;  5AQG A;  1JCE A;  4FL9 A;  1NM1 A;  4A62 A;  4A2A A;  1JCF A;  2IVP A;  4O5F A;  3VEO A;  2OAN A;  1YUW A;  1ATR A;  4H03 B;  4BC2 A;  2HMP A;  5LY3 A;  2E88 A;  5ADX A;  1C0G A;  2I7P A;  4BRC A;  3MN5 A;  1RGI A;  2FLO A;  3O5B A;  3D2E A;  3H3N O;  2P9U A;  2NZT A;  4H0Y B;  4QS9 A;  3VF2 A;  4BQZ A;  3ZX0 A;  2CH5 A;  4XH5 A;  3KHY A;  1BWF O;  3QBW A;  3HBT A;  5EXW A;  3ZX3 A;  4PL7 A;  5AQO A;  3L4I A;  3M6G A;  5BPN A;  4WQ5 A;  4CBX A;  3CER A;  4K25 A;  4XH1 A;  3WXL A;  3HI0 A;  3R8E A;  1QHA A;  1GLL O;  1DKG D;  1MDU B;  1S22 A;  3A5O C;  5B8H A;  3CJ9 A;  3MDQ A;  5AZJ A;  1X3M A;  4H0T B;  3WT0 A;  1LCU A;  1EQY A;  3EO3 A;  2Q0R A;  5AQS A;  3UKR B;  2P9L B;  4H0V B;  3ID8 A;  5AQP A;  1BUP A;  4PKH A;  4I6M B;  3EZW A;  5AFU H;  3U9D A;  3FZK A; 
#chains in the Genus database with same CATH topology
 4DSI A;  4KH6 A;  4CHZ A;  4DFP A;  4PKI A;  3LAM A;  1NKB A;  4JI0 K;  4IXC A;  4BR2 A;  3DOK A;  2V7Y A;  3QDK A;  2JGU A;  1NOZ A;  1T05 A;  3B8A X;  4JI3 K;  1ZBS A;  3I0R A;  1RDW X;  1GLJ O;  4O8K A;  3SK3 A;  2YJE A;  3SLC A;  5AQW A;  3SPY A;  4OKK A;  3NHG A;  3CM6 A;  2DY4 A;  2QWR A;  3U6F A;  3QIO A;  1KCF A;  1JJ2 M;  2E2O A;  4Q0B A;  4OGE A;  2O8E B;  1S5J A;  2Y1I A;  4CJK A;  4LFA K;  1HPM A;  3VA0 A;  3QER A;  1Y97 A;  1U2V A;  4YOT A;  4JHD B;  3ATU A;  4FJH A;  5GIP A;  1XHX A;  5AZI A;  4WFA L;  3NH0 A;  3UE5 A;  4Y0W A;  4CZK A;  1NLV A;  3VOV A;  4CF8 A;  4DV4 K;  5GAG P;  1OVQ A;  3AVG A;  2YJF A;  4OKJ A;  3VQ7 A;  1IKW A;  1YVU A;  3D0P A;  4CJE A;  4B9M A;  2A1S A;  5C24 A;  3LP3 A;  1VQP N;  1VQ9 N;  2GWK A;  1BIS A;  4BVP A;  3E9P A;  5SZT A;  3BDP A;  1NMD A;  4BR7 A;  1C0T A;  2ZQB A;  1T7P A;  4OO1 J;  5AQY A;  3QEI A;  3KKS A;  1HYV A;  3NFA A;  4W5T A;  4C8L A;  4FJ7 A;  4BC4 A;  3ZX2 A;  1VQ6 N;  3ENO A;  1NMN A;  1ESV A;  1VQK N;  1VQL N;  3ENB A;  2Z1I A;  3MMV A;  1MA9 B;  4CF0 A;  3DLG A;  1A5V A;  1X9S A;  3C6H A;  3QES A;  3NVK A;  1QZ5 A;  2IIR A;  3H08 A;  4HWI A;  4CI6 A;  4CCH A;  3ZSR A;  1SL2 A;  3LL3 A;  2VCP A;  4JD2 A;  4DTM A;  2HVH A;  2O8C B;  3THY B;  1X1P A;  3SUP A;  2O8B B;  1QHT A;  4BAC A;  4BDZ A;  3SZ2 A;  3MCA B;  5D3G A;  3LDN A;  1QQM A;  4GKJ K;  4NCB A;  3GE1 A;  3THW B;  4Z4I A;  5KRS A;  4DR1 K;  4NLC A;  4FJL A;  2HHV A;  3BY5 A;  2OA8 A;  4QOZ B;  3MN6 A;  3HPO A;  3FZF A;  3A2F A;  3NH2 A;  2KHO A;  3SQ0 A;  3PO5 A;  4BGB A;  2F8T A;  2WC9 A;  1O1W A;  2IAJ A;  1SS6 A;  4DU4 A;  1R0A A;  4I2P A;  1CZB A;  1OH6 A;  1C1A A;  5JS2 A;  4R79 A;  3D6R A;  4EHT A;  3VQ4 A;  3ZYY X;  4DSL A;  3AAP A;  5FPM A;  1J53 A;  4BRG A;  2F7T A;  2WFB A;  3KK3 A;  2Z1G A;  1X3N A;  3KTQ A;  4CHP A;  4FZX C;  4J2B A;  3LAN A;  4MDB A;  2QKK A;  5HRP A;  3WNG A;  3PSI A;  4MO5 A;  3TAE A;  3CD6 N;  3K5M A;  2IDO A;  1T6D A;  5AQL A;  3VTI A;  3AVH A;  2YNF A;  4Z94 A;  1P90 A;  3L2U A;  5JLH A;  4FO0 A;  4NCG A;  3HO1 A;  3FZH A;  4E7L A;  4DSE A;  3D2F B;  5HRO A;  3MXM A;  2ETJ A;  3SUN A;  2GWJ A;  3AVA A;  3DXK B;  3AV9 A;  4BR9 A;  4MO4 A;  3VES A;  3NCI A;  4JKE A;  1W9H A;  2JLE A;  1LWE A;  5TKY A;  1TAU A;  3LDS A;  3DLL L;  3ATV A;  4FM2 A;  2ZJR L;  4LY7 A;  2OCE A;  5HRS A;  3CI5 A;  4DLG A;  3L0Q A;  2P9I B;  2VWJ A;  1SKS A;  2Q3S A;  1GLB G;  1RT7 A;  4IO8 A;  1K9M O;  3DLH A;  3AA2 A;  1XMQ K;  4YNQ A;  3PX0 A;  4KTZ A;  4CEO A;  4AIL C;  1I3A A;  4CBW A;  4ILJ A;  5JLF A;  2ZM6 K;  3O3F A;  1GLC G;  3U3G A;  3D2E B;  1I39 A;  4KHQ A;  1DEJ A;  1EWR A;  1EET A;  3W3D A;  4RW7 A;  4BRN A;  5BPL A;  3M8P A;  2BH1 A;  1RTH A;  4YDU C;  4E1M A;  4PY5 A;  1E4F T;  3AA3 A;  3L2V A;  3IDH A;  1JLA A;  4FSV A;  3NF6 A;  3WQU A;  3DM2 A;  1LV5 A;  3G25 A;  2ZD1 A;  3P5J A;  4FCY A;  2HND A;  4JHD A;  5AFU A;  4YOX A;  4W5N A;  5H1S Q;  1EKE A;  3G4S N;  4HTL A;  1NBW A;  3ZSZ A;  2QM1 A;  2YHX A;  3BUZ B;  2QEX N;  3TAG A;  3MEE A;  3TAP A;  3KK7 A;  3EE9 A;  4BR4 A;  3DI6 A;  4IDK A;  4CZI A;  1C6V A;  4IG0 A;  3OYM A;  1J6Z A;  3TAF A;  4CD3 A;  4GY2 B;  1Q8I A;  5IT9 O;  5KPR A;  3ZSX A;  3BEX A;  4DG1 A;  1YTA A;  4JI4 K;  4M45 A;  3QEW A;  2NRZ A;  3UKU B;  4O4G A;  4CFA A;  4FWQ A;  2YHB A;  4E19 A;  3SAH A;  2H3G X;  4BVO A;  1WOQ A;  1BO5 O;  3AVI A;  4CBU A;  4HCB A;  3F9K A;  2ZF5 O;  3K9K A;  4Q5V A;  1VRT A;  4C1N K;  4KHU A;  1BQM A;  4B9T A;  2E2Q A;  3ZT0 A;  2P9S B;  1HLU A;  3DJC A;  2HF4 A;  1RTD A;  3GBT A;  3TTD A;  3JYT A;  4GW6 A;  3O08 A;  3VQ5 A;  1NJZ A;  3SMP A;  3L3U A;  1IO2 A;  3LP1 A;  1B9D A;  4JKD A;  1KRP A;  4H4O A;  1Q82 O;  1NGI A;  3VF4 A;  5LMN K;  4DR4 K;  4X62 K;  2OPP A;  1XMO K;  4A59 A;  4CJV A;  4CVN E;  3SJJ A;  2R7Y A;  1BQN A;  2NLX A;  3EE8 A;  1S6P A;  5IWA K;  3TTC A;  3HP9 A;  1CXU A;  1J9A A;  5AQR A;  3TR8 A;  3K5O A;  1T03 A;  1FK9 A;  4M3R A;  3MAQ A;  4DKW A;  1DLO A;  1YJ9 N;  3K2P A;  5KPZ A;  2P5G A;  4E7J A;  4CEE A;  1RTJ A;  1FKO A;  3S3N A;  4RW9 A;  2XY5 A;  3UB5 A;  4K0K K;  4E1J A;  1BHL A;  5LL6 Z;  2Q1N A;  3OBY A;  4LC9 B;  1TKT A;  4ID5 A;  4B1U B;  3TAB A;  3PO4 A;  5CZ2 A;  2WBN A;  1T6C A;  5KI6 A;  5LMU K;  4K43 A;  1RT5 A;  4OKE A;  4HUF A;  1JL2 A;  3O4W A;  4DR3 K;  3A0I X;  2V7Z A;  1VQ7 N;  3R9P A;  5HP1 A;  3QNN A;  2HBL A;  2HST A;  3EEQ A;  4O55 A;  1Z25 A;  5E26 A;  2QWL A;  3WEE B;  3I8B A;  2UXB K;  3QIN A;  4CHY A;  1JXB A;  2ZWH A;  4FK4 A;  3O4Q A;  2W6L A;  4IJA A;  5AQN A;  2PZS A;  3BF1 A;  4KPY A;  3V81 A;  5BPM A;  1S1T A;  4EIA A;  4FW2 A;  2XY8 A;  4DQR A;  2A6A A;  2CGL A;  4BG8 A;  1VSD A;  4JKF A;  4AM7 A;  2QWM A;  4U7B A;  1IV0 A;  3SQ2 A;  5AQU A;  1EWQ A;  3RMC A;  4E7K A;  2Q31 A;  1CXQ A;  4FJ8 A;  4C8K A;  4IFV A;  2IVP A;  1HNZ K;  3AO2 A;  2B4J A;  2OAN A;  1YUW A;  4H03 B;  4BC2 A;  4LF9 K;  2E88 A;  5ADX A;  4BRC A;  3MN5 A;  1JXE A;  3KLG A;  3L4Q A;  4ELV A;  3D45 A;  3DOL A;  2XY7 A;  3D2E A;  4QS9 A;  1JL1 A;  3N4Q A;  3ZX0 A;  4XH5 A;  2KW4 A;  2RHK A;  3HBT A;  5AQO A;  1KLM A;  5BPN A;  2VG6 A;  4K25 A;  3R8E A;  3DLE A;  2D0C A;  3F5T A;  1MDU B;  1S9E A;  4FVM A;  3KLE A;  1K73 O;  3CJ9 A;  3OA9 A;  5AZJ A;  3WT0 A;  4EZ6 A;  3SUQ A;  2ZJQ L;  3LZJ A;  4W5O A;  2ATQ A;  3EO3 A;  3NBP A;  3SV3 A;  5AQS A;  3UKR B;  3HP6 A;  4AQY K;  5AQP A;  1TK5 A;  1JKH A;  4CZE A;  2Q2R A;  4JKB A;  3ZCM A;  1Z05 A;  5JIC A;  4FJ9 A;  3CCQ N;  3O8M A;  1TKX A;  3CCR N;  4KHS A;  1RDD A;  4FJN A;  3BZC A;  1HX1 A;  1U04 A;  1ATS A;  3F9M A;  5GAD P;  1SUQ A;  3RR8 A;  1MU2 A;  3D7E O;  3TU5 A;  1ZBH A;  3V9W A;  1OH8 A;  1HNW K;  2BUP A;  3H1Q A;  4IOC L;  4DSJ A;  3UKU A;  2OPQ A;  4KH5 A;  2XO7 A;  2NRW A;  4BR0 A;  5M1K A;  2BGG A;  1X9W A;  2IGI A;  3ID6 A;  4MDA A;  3O9R A;  4JAX A;  3AO4 A;  2ASM A;  2PBD A;  1YF5 L;  3U8X A;  4E7H A;  2BTF A;  4LSL A;  3AVJ A;  1T44 A;  4CJS A;  4JS5 A;  5BRH A;  1TVR A;  4YOV A;  4DSF A;  4FLY A;  4IEI A;  2PFU A;  4PUO A;  2KZZ A;  3VA3 A;  2HHS A;  3KZB A;  4Z4C A;  2IC3 A;  1L3S A;  4CGG A;  1KAX A;  4FJM A;  3RMA A;  2IVO A;  4I9Q A;  3CF5 L;  5CY4 A;  5C10 A;  3CQY A;  1D4X A;  1OVY A;  4DS5 A;  2VYP A;  4LF4 K;  2G8I A;  4JKC A;  1NG9 A;  4BE1 A;  1RBU A;  3VEZ A;  3DAW A;  4ZTF A;  2D0P A;  5FRO A;  4DCH A;  4M7Y A;  3ZET B;  4UQG A;  2HHT A;  3OYC A;  4BE2 A;  4J2A A;  1W97 L;  1TUY A;  4DFM A;  3AVN A;  4UY8 O;  1C1B A;  3C65 A;  1WB9 A;  4HHT A;  5K14 A;  4O44 A;  3I33 A;  1O13 A;  2FF3 B;  1WSG A;  4KV8 A;  2P9N A;  4CJR A;  1XNQ K;  3WXI A;  3KKR A;  4B9U A;  1HJR A;  4LF6 K;  4O5B A;  4MLE A;  4J8F A;  4B1X B;  4GV3 A;  3TSU A;  2UUA K;  5KPT A;  4N56 A;  2CGK A;  2YKN A;  4WQ4 C;  3CCS N;  2UUB K;  3P1G A;  1TL3 A;  3TSP A;  3KK1 A;  2J4R A;  3A5M C;  1WUA A;  1WSF A;  4NB4 A;  4BGA A;  1SKR A;  1BOT O;  3QFP A;  2GEM A;  3LDQ A;  2IS3 A;  4KRF A;  2WUS A;  3CQX A;  3OVN A;  1Y64 A;  1VQM N;  2F9W A;  4DTR A;  4DV2 K;  1SAZ A;  1N32 K;  4DF4 A;  3HPH A;  4LH5 A;  4CIE A;  4N5S A;  1GOA A;  4JEP A;  1QSY A;  3CC2 N;  1E3M A;  3ZEU A;  4DR7 K;  4CGF A;  1M1K O;  1K8K A;  3I8D A;  1DTT A;  3G6E N;  1ILY A;  1E4G T;  4IDH A;  2E1Y A;  4ICL A;  4FK2 A;  4LD0 A;  1JLB A;  3OYG A;  3SQ1 A;  2QW9 A;  3OS2 A;  3C0B A;  4H5N A;  1NGG A;  3E9O A;  3OYA A;  1BA1 A;  4ISG A;  3WUH A;  4E3S A;  4OX9 K;  4QCL A;  4JNE A;  1NNE A;  5JVH L;  2QTD A;  1SL0 A;  3T1H K;  4F3O A;  3C7N B;  1RTI A;  3FGU A;  1RDU A;  1NGH A;  5CYM A;  2HNZ A;  4CHO A;  3KK2 A;  3QEP A;  5M1O A;  3G71 N;  3LAL A;  3MXJ A;  3L8B A;  3FE1 A;  5BR9 A;  1JLE A;  3WNF A;  3N4P A;  3UKR A;  2ASP A;  4JKA A;  3VF6 A;  4FLT A;  2KFZ A;  3V1O A;  2YX6 A;  1N8R O;  3ZSY A;  3ZT2 A;  4WCE L;  1KFD A;  1CLQ A;  1NK0 A;  1NJX A;  5AQZ A;  2OYQ A;  4JN4 A;  5I42 A;  1Q81 O;  5C2F A;  1RFQ A;  4DQS A;  1L3V A;  3ZT3 A;  2FSN A;  4YY3 K;  4GNI A;  4H0P A;  4FJI A;  3VQB A;  3VQQ A;  4MLH A;  1JCG A;  2D0A A;  4XEI A;  4AHR A;  4F2S A;  3C6U A;  1KVA A;  5J2N A;  4NXN K;  2FF6 A;  3SV4 A;  1QTM A;  4B9V A;  4BQL A;  3A8Y A;  4KHY A;  3G10 A;  4JLH A;  1XNR K;  3EKS A;  3FLC O;  2BAN A;  2HOE A;  4H0O A;  4JI6 K;  3TAM A;  3TWH A;  4RCH A;  1S9G A;  2GBZ A;  5M1N A;  1QZ6 A;  4CZJ A;  3HOS A;  1U48 A;  1YIT N;  4DLE A;  1IKX A;  2IOC A;  3J7Z O;  4KTW A;  3EKU A;  2NRR A;  4WYB A;  4DWI A;  2KZM A;  1N6Q A;  4CEF A;  3MK6 A;  1HMV A;  1YHQ N;  2HF3 A;  3G0Z A;  1C0F A;  2KFN A;  2YNG A;  2YCH A;  1BIU A;  3LDO A;  3ULE A;  3VGL A;  3HK2 A;  1NK6 A;  1GLE G;  2O8F B;  1HYS A;  4J2E A;  1CZA N;  1B9F A;  1S72 N;  1L3T A;  3RR7 A;  4BRD A;  1XQS C;  4A61 A;  2ZE2 A;  3T1A A;  4CGH A;  2RE2 A;  4JKG B;  1LW0 A;  4CFC A;  3ZET A;  4FWM A;  4OLA A;  1V4T A;  1VSF A;  2D1K A;  4FLZ A;  3OYH A;  1JLQ A;  1S1V A;  4KI6 A;  3CQ8 A;  3OW2 M;  1LWF A;  3CCL N;  4CJU A;  5FRN A;  5CE3 A;  4M3X A;  1QVG M;  4E1N A;  2FBV A;  4B8A B;  3R6M A;  4DTN A;  1HJO A;  3OYD A;  1ZBI A;  1VSK A;  4FK0 A;  4Z4E A;  1ASW A;  3SBT A;  1UA1 A;  3MWP A;  3MCP A;  4OLB A;  4JK7 A;  2VG5 A;  2RF2 A;  2O4I A;  4CF2 A;  1NKE A;  3J81 O;  3HVT A;  1Q86 O;  3IFR A;  1J5O A;  4BRQ A;  5J2M A;  3NMU A;  4OPH A;  2V51 B;  1HR0 K;  4YOU A;  5AQQ A;  3F2K A;  2AP1 A;  5EU7 A;  3VEY A;  1U4B A;  3LM2 A;  3DXM B;  2V52 B;  3LM9 A;  3A5N C;  4DV0 K;  1WNS A;  4NCA A;  4Z0U A;  4RTF D;  1NWK A;  5T7B A;  1BGX T;  4CEA A;  3DWL A;  4YOW A;  3OTO K;  4FW1 A;  2I7N A;  5EY4 A;  4WFN L;  5DM6 L;  1Z6R A;  4Y1D A;  3PUF A;  4JS4 A;  4CJ7 A;  2YNH A;  3O9Q A;  3M1F A;  1ZYQ A;  1QQN A;  4M3Y A;  4IZ9 A;  4G9Z A;  2YHY A;  4DV6 K;  4CGI A;  3IS9 A;  4B3S K;  2O8E A;  1M90 O;  3KLH A;  3M8Q A;  1QE1 A;  3CXC M;  4FM1 A;  4DB3 A;  1X9M A;  1HKC A;  4NXM K;  4Z4G A;  3PSF A;  2YKM A;  1ZXO A;  3THX B;  1EP4 A;  2HNY A;  4F8R A;  1NM1 A;  4A2A A;  1C0M A;  3LZI A;  4KB1 A;  2Z1H A;  4FZY A;  3AO1 A;  4CF1 A;  1N34 K;  4GMJ B;  1JLC A;  2I7P A;  1RGI A;  4YOR A;  1W0H A;  5M1P A;  3H3N O;  2NZT A;  1Q9Y A;  3ISN C;  3V4I A;  1IG9 A;  4PL7 A;  4H4M A;  5EXW A;  3PX6 A;  3HT3 A;  4DU1 A;  3LPU A;  4WFB L;  1FW6 A;  4CBX A;  4NYN A;  4DTP A;  1HYZ A;  4CEZ A;  3OY9 A;  4IO9 L;  3TSQ A;  3LPT A;  4A5B A;  5B8H A;  1UAX A;  1Q9X A;  1X3M A;  3SBG A;  1LCU A;  1NU0 A;  2P9L B;  3C95 A;  4I6M B;  3TI0 A;  1RCH A;  2E6M A;  5AFU H;  3VF2 A;  3U9D A;  4CJW A;  1TKD A;  3E9L A;  3MXI A;  2O8C A;  3THY A;  5MLC Q;  2D0B A;  3HRG A;  3GDQ A;  1DTQ A;  4H5V A;  3U4L A;  3ZSW A;  4DSK A;  2D0O A;  3H1V X;  4CHQ A;  4J2D A;  1GLF O;  4DTJ A;  2O8B A;  1NK5 A;  2A42 A;  3S41 A;  3O9U A;  3HZ6 A;  1OH7 A;  4YOY A;  4BRL A;  2QI2 A;  5SWM A;  3L2W A;  3THW A;  4BDY A;  2HBJ A;  2O8D B;  3SAF A;  4DMN A;  2UXC K;  5BRF A;  2F9T A;  2UYT A;  5FDL A;  4TSX A;  3RSE B;  3CCJ N;  3O1W A;  3ZSV A;  3P83 D;  1D8Y A;  2HW3 A;  2E6L A;  2PYJ A;  1QSL A;  2RKI A;  4EHU A;  1NK7 A;  3LAK A;  2FBY A;  3BZK A;  2XHB A;  3AVL A;  4MQ3 A;  3K5L A;  2HHH K;  4F2R A;  1W2B M;  4CEC A;  1YTU A;  5AQV A;  3AAQ A;  3KD5 E;  4FPA A;  2A1R A;  1I94 K;  4IOX A;  3MED A;  2YV0 X;  3S9H A;  4H8K A;  2FSJ A;  4M41 A;  1B92 A;  3ITH A;  3TTF A;  4JI2 K;  1VSM A;  2P1J A;  3CM5 A;  1MWK A;  4BRK A;  3VQA A;  1GLD G;  3H3O B;  3D2F A;  1NGC A;  1WSH A;  1V4S A;  1ATN A;  3DXK A;  3HJF A;  4M3Z A;  2A5X A;  3VEN A;  5KQ8 A;  1REV A;  1R59 O;  4CK1 A;  3QET A;  2HBK A;  3CFR A;  4E0D A;  4BY9 C;  4B3R K;  4NO7 A;  2AA4 A;  1BIZ A;  3OYB A;  3KLF A;  5E84 A;  2RPI A;  5HRN A;  2KKZ A;  2P9I A;  2X74 A;  4A2B A;  3V9S A;  4GKK K;  1TK8 A;  1Q7Y O;  3NF8 A;  2OPS A;  4AHV A;  1HQE A;  3B6O A;  2BE2 A;  5AQJ A;  3VET A;  4FWL A;  4ISF A;  4Z4H A;  3DLK A;  2YHW A;  1K6Y A;  1X9J A;  2VQE K;  4JK9 A;  2E2P A;  1LAW A;  2G8H A;  3HXM A;  4PL8 A;  4LF8 K;  3WNH A;  2QWO A;  3R3L A;  1VSL A;  3MX2 A;  4KH4 A;  1G99 A;  3RRH A;  4IFY A;  4PWD A;  3JAM O;  5HOO A;  2IVN A;  4R5P A;  1HUX A;  3BP8 A;  3VQC A;  3EY1 A;  1RT1 A;  2F4V K;  1S1U A;  1RT4 A;  3EYZ A;  5DM7 L;  2FBX A;  3RMB A;  1KSP A;  4KKO A;  3WXM B;  5BN8 A;  3EN9 A;  1TYQ B;  1Z26 A;  3VQ9 A;  3BGR A;  4N76 A;  3JSM A;  3P4I A;  4CF9 A;  2D5R A;  4IJN A;  4KRE A;  1HKB A;  3K57 A;  1WLJ A;  4BR5 A;  5M1Q A;  1RBV A;  1WSJ A;  2EX3 A;  1ZBF A;  2VG7 A;  2E8A A;  1QQO A;  1U2V B;  4KFB A;  4FOI A;  4DU3 A;  4KAZ A;  5AJ3 K;  4BWJ A;  4O8U A;  4LFC K;  3ZT1 A;  3WXK A;  5AZI B;  4DFJ A;  4B9Q A;  3NAE A;  3NF9 A;  3KVG A;  1HPZ A;  1XC3 A;  1GOC A;  2Q36 A;  2NUB A;  3AY9 A;  5ADX H;  2DPN A;  5BR8 K;  1J5E K;  4E7I A;  3M3Z A;  3O3H A;  4GVM A;  5FPE A;  4RW4 A;  1SZ2 A;  4BRI A;  3EL2 A;  4IFE A;  3K9J A;  4C8N A;  5J2P A;  3ASM A;  3CPE A;  4ZHR A;  1L5U A;  3HVR A;  3IKM A;  3O3G A;  2HHW A;  4KI4 A;  3HYF A;  2W40 A;  1TUU A;  3OYF A;  1DGK N;  3F73 A;  3VER A;  2P9S A;  5KRT A;  3LWL A;  3ENH A;  4K42 A;  1D9F A;  4M3T A;  1VSE A;  4FOE A;  4CW7 B;  2AJQ A;  3OS0 A;  3QBX A;  4CD1 A;  3MN9 A;  4I6M A;  4FWP A;  1TL1 A;  3NVM A;  5ELZ A;  3OYL A;  2NRV A;  4FJK A;  1IBM K;  4PHT X;  2DFF A;  1CZ9 A;  2E1Z A;  1OH5 A;  4JI7 K;  3GG4 A;  3QB0 A;  2F8S A;  4ID1 A;  2Q97 A;  3VQD A;  3HOT A;  1ZBU A;  3TAQ A;  1ZBL A;  4FJJ A;  1QVF M;  1DT9 A;  4CZH A;  5LJW A;  2QKB A;  2CGJ A;  2X6N A;  3RSE A;  4IWV A;  2G8F A;  2DFE A;  4KBO A;  4G1Q A;  5I9E B;  3E01 A;  3S3O A;  5JMV A;  4JYA K;  2F96 A;  5FPD A;  2HHQ A;  1S1W A;  3FFI A;  3VQP A;  2XRI A;  3BF3 A;  3A5L C;  3HSC A;  1RDC A;  4A57 A;  1VSH A;  1Q18 A;  3CIP A;  3L6Q A;  4BRA A;  1SKW A;  3OYJ A;  3O6W A;  3WEE A;  4B08 A;  3T69 A;  4WF9 L;  4IKF A;  3VEW A;  4CIF A;  1NGB A;  5J2Q A;  1YVN A;  1IKY A;  1P8Z A;  4FZZ A;  1U6Z A;  3C6T A;  1NGF A;  4FPB A;  1F21 A;  3HL8 A;  4CGD A;  4K8X A;  3J7A P;  4DF8 A;  1KAZ A;  3VTH A;  3THV A;  2VGM A;  2YI1 A;  2B6A A;  4FWK A;  4EP5 A;  2UUC K;  2W6K A;  2P9K B;  4GVE A;  1RT3 A;  3DRS A;  5CZ1 A;  5CR4 A;  4PKG A;  3LDL A;  1NJW A;  3AO3 A;  4B8C A;  2GEL A;  1FJG K;  1HNI A;  4L3Q A;  5CHI A;  2QWN A;  2UU9 K;  4FVU A;  4CZF A;  2G8W A;  4CIG A;  2KTQ A;  4AHS A;  4HUE A;  3VEX A;  5KTQ A;  4BRP A;  1NJI O;  5GIN A;  2Y1J A;  4CED A;  4FWN A;  4XH4 A;  2G8V A;  4DUZ K;  2P9P B;  4LSN A;  3JS6 A;  3K59 A;  4CJ5 A;  1BU6 O;  3K58 A;  1KFS A;  1KVB A;  1VHX A;  1EXQ A;  5HBM A;  2G8U A;  1G15 A;  3EZ5 A;  2I5J A;  1TYQ A;  1TV6 A;  3QLH A;  5BN9 A;  2NRH A;  2VWK A;  3OJS A;  1YXQ A;  1HKG A;  3HM9 A;  1ITG A;  3OYK A;  3UIQ A;  4FYD A;  3T19 A;  4BRH A;  5C15 A;  2PY5 A;  4KHW A;  4M42 A;  4JV5 K;  3I55 N;  1KAY A;  4X64 K;  3P38 A;  3CMA N;  3OHR A;  4CFB A;  3AVB A;  3WXJ A;  1D5A A;  4DTO A;  1RBR A;  4OGC A;  2PYL A;  3TPQ A;  4QS7 A;  3LWM A;  4B9N A;  3AGK A;  1ZC6 A;  3WNE A;  2WON A;  1RT2 A;  1J54 A;  1YI2 N;  2PAV A;  5HL7 L;  4X66 K;  3KWG A;  5C2D A;  3AO5 A;  3KWI A;  3DRR A;  2P51 A;  5AQG A;  2G8K A;  4O0I A;  4FL9 A;  3TAN A;  4PA1 A;  3VEO A;  3CFP A;  1KVC A;  1U49 A;  4AF1 A;  3CCE N;  4E89 A;  5LY3 A;  1C0G A;  2FLO A;  1HQU A;  3O5B A;  1SV5 A;  5GAE P;  3CFO A;  3P39 A;  3SNN A;  4I7F A;  1XC9 A;  4V19 S;  1WN7 A;  5TKW A;  5J1E A;  1BCM A;  1BWF O;  3ZX3 A;  1VSI A;  1QQC A;  4CJ4 A;  3VMF B;  3M6G A;  4WQ5 A;  3ULD A;  4XH1 A;  3WXL A;  4KB0 A;  3HI0 A;  5DK5 A;  1QHA A;  3E1Y A;  2WOM A;  4FXD A;  3SPZ A;  1NOY A;  1S22 A;  5GAH P;  4BDP A;  1UWB A;  3MDQ A;  3SUO A;  4L8R B;  1VQO N;  3DLR A;  1EQY A;  4CJL A;  4CHN A;  2Q0R A;  4HTU A;  3ID8 A;  1NK9 A;  3DLB A;  4IEE A;  1BUP A;  1BI4 B;  4IBN A;  1RDA A;  2X6S A;  4AHT A;  3CJA A;  2QWQ A;  2RN2 A;  5FLX O;  3V9Z A;  4YDU A;  5JS1 A;  4JRP A;  5E41 A;  1XUP O;  5KGX A;  1YAG A;  3VPZ A;  1EX4 A;  1IJJ A;  4DUY K;  1VQ8 N;  1FKP A;  5KQD A;  2QK9 A;  1GLA G;  1A5X A;  3HPG A;  1SQK A;  3CME N;  4DHY A;  5F2R A;  3V9X A;  4OPA A;  4DV3 K;  2VGN A;  5LJV A;  5BRE A;  3MX5 A;  3T7Z A;  3PY8 A;  4ELT A;  1IH7 A;  4GV9 A;  2A3Z A;  4JK8 A;  2WTU A;  4CZL A;  1RBS A;  2GX9 A;  4CZM A;  3R1X A;  1RT6 A;  3ZLJ A;  5C12 A;  2OZS A;  2P9K A;  3QO9 A;  3HTV A;  4OPK A;  3OYN A;  4WQ5 C;  1U45 A;  4FWR A;  3AVF A;  5BRD A;  2ZJP L;  1VRU A;  1HRH A;  5GIO A;  4DTX A;  2NRX A;  1IBK K;  4CJ3 A;  2CH6 A;  1N33 K;  5F0X A;  2A40 A;  3QNO A;  4PQU A;  4FJ5 A;  5M1F A;  1K8A O;  3ZSQ A;  4K8Z A;  4DR6 K;  4CJP A;  3NGI A;  4C23 A;  4O0J A;  1WAF A;  3C7N A;  4CJQ A;  2P9P A;  2YNI A;  3SMS A;  2W42 A;  4GV6 A;  3M5R A;  2GUP A;  1JLG A;  4KO0 A;  3AVK A;  3LDP A;  3RVC A;  4H5T A;  4CE9 A;  1NK8 A;  1RIL A;  4F9O A;  3M8S A;  2ZGZ A;  4IOA L;  4CER A;  4B1Y B;  2QXF A;  3AVC A;  1HNX K;  1VK0 A;  4IG3 A;  2OZM A;  1T3V A;  5AZJ B;  3LP2 A;  1BDG A;  2HVI A;  1KXP A;  3CCU N;  3VQE A;  4YFU A;  4JI8 K;  3C94 A;  3CHW A;  4H0X B;  1C1C A;  2ITM A;  2HMI A;  4B1V A;  3VGM A;  2Z1J A;  4CEB A;  3QEV A;  4LFB K;  4BC3 A;  3IUC A;  3IRX A;  5HRR A;  4W5R A;  3CCM N;  1NGJ A;  2A41 A;  2YHA A;  1GOB A;  2DFH A;  1YIJ N;  3O9T A;  4OJR A;  4B3O A;  1H1V A;  4DTS A;  1T8E A;  3T3F A;  4CES A;  4B9L A;  3Q7C A;  2E20 A;  4KTQ A;  4AHU A;  5AQI A;  3AVM A;  4ELU A;  2E2N A;  3RMD A;  1NGD A;  3B6P A;  3RRG A;  5C42 A;  1L3U A;  4HUG A;  3PV8 A;  3PLA A;  3NF7 A;  4DQI A;  3I0S A;  3GOI A;  4H5W A;  4U67 L;  1NK4 A;  3OYE A;  5A2Q O;  2XY6 A;  5AQK A;  4B1W B;  3JXU A;  1WAJ A;  4DQ8 A;  2O8F A;  3SCX A;  3ZSO A;  3RWU A;  4F4K A;  2LSN A;  4BG9 A;  1VAZ A;  3AA4 A;  1LW2 A;  4C8M A;  3FFK B;  3T1Y K;  4FLV A;  4JKG A;  1XHZ A;  4BRF A;  4DV5 K;  1EO1 A;  2NRT A;  2FSK A;  3OJU A;  4FWO A;  3WQT A;  3U9Z A;  4AHC A;  5EX5 A;  3TAR A;  2KLA A;  1OKJ A;  4XIU A;  1VSJ A;  3KJV A;  4M3U A;  2NNW A;  1S6Q A;  4CJF A;  1BI4 A;  5AQM A;  1KTQ A;  2ZGY A;  1RNH A;  4RWT A;  5FRM A;  2GTD A;  4EFH A;  2QXL A;  3K5N A;  3QML A;  3DRP A;  1SL1 A;  3E66 A;  4EZ9 A;  2W41 A;  3KD1 E;  2P9N B;  2P9U B;  3CJ1 A;  4B9S A;  1QSS A;  1C0U A;  2B5J A;  4C8O A;  5C25 A;  2ITG A;  4HCC A;  1S3X A;  1WSE A;  3NDK A;  1IG8 A;  2FC0 A;  3V1R A;  1ASU A;  3VGK A;  4CEQ A;  5AQT A;  4DR2 K;  3J8A A;  3KIO A;  3OYI A;  2FBT A;  2HBM A;  3H45 C;  4BRO A;  2FXU A;  2OPR A;  3CJ7 A;  3IMX A;  4DV1 K;  1NGE A;  1N36 K;  3DXM A;  3V6D A;  4I2Q A;  3L2R A;  4FWS A;  3DYA A;  3CC7 N;  3OBW A;  3V9U A;  1XI1 A;  4RW8 A;  3SQ4 A;  2GUI A;  2JWK A;  2EHG A;  3DMJ A;  1TGO A;  1BL3 A;  1LWC A;  3Q7B A;  1NKC A;  3PIO L;  3GL1 A;  3CET A;  3FZM A;  1KLN A;  4FJG A;  4BRM A;  3ZEU B;  1D9D A;  3H6E A;  4QAG A;  2D4W A;  1S1X A;  1K8K B;  1VQN N;  2HB5 A;  3I56 N;  1WBD A;  4FM0 A;  4FLW A;  4ZTJ A;  4CJT A;  1NJY A;  3L3V A;  4AM6 A;  5F1X A;  4DS4 A;  3CC4 N;  4EAH D;  5C0Y A;  5KGW A;  1YJN N;  3PX4 A;  3W0L A;  1BA0 A;  3QIP A;  3O80 A;  5EOY A;  4HVJ A;  1MWM A;  3SJH A;  3RTV A;  2BDP A;  1NGA A;  4QS8 A;  4BC5 A;  5I3U A;  2Q0U A;  4DV7 K;  3THX A;  1IBL K;  1VQ4 N;  5DMR A;  4MFB A;  4I9L A;  4C1N I;  1BCO A;  3CCV N;  3O1B A;  1UOC A;  4NYF A;  3VEV A;  4LF5 K;  3J7Y P;  4M7X A;  4B3T K;  3VQ8 A;  2X78 A;  5FPN A;  1TAQ A;  4FJX A;  1RBT A;  3AGR A;  1XWL A;  4LF7 K;  3SI6 A;  1A5W A;  3FZL A;  4CGJ A;  3O9S A;  1JLF A;  4CZG A;  3O4N A;  4YHH K;  2EWS A;  4CK3 A;  4JI5 K;  2JWL A;  4OVL A;  3QIC A;  4FLU A;  3MWT A;  4FLX A;  4X65 K;  3NGZ A;  1ASV A;  4ILH A;  4KHN A;  2HHX A;  3NE6 A;  3HST B;  3AAR A;  3SAG A;  2P9L A;  4ILG B;  3SYZ A;  4K41 A;  1YT3 A;  5AQX A;  3CJB A;  3CYM A;  1UA0 A;  1LOT B;  3QEX A;  4WQ4 A;  2QWP A;  3C6A A;  3MN7 A;  5AQF A;  1KD1 O;  2DTU A;  1RDB A;  4JD2 B;  4B3M K;  4WE1 A;  2OTL N;  4DTU A;  5AR0 A;  1TKZ A;  3FR0 A;  1BG3 A;  2O8D A;  1LAV A;  2VWB A;  4F3T A;  4JRQ A;  3H46 O;  3CJC A;  3MEC A;  1KQS M;  3NH1 A;  4Z4F A;  3PIP L;  3HM8 A;  3ZT4 A;  3VQ6 A;  5EVZ A;  4DR5 K;  2E5L K;  4BRE A;  5JVG L;  1TK0 A;  3ULE B;  4H5R A;  1KC8 O;  3NGY A;  4KHP K;  3KLI A;  4RW6 A;  1WSI A;  4BE0 A;  4LH4 A;  3VN5 A;  3QFU A;  1W7A A;  1U47 A;  4BWM A;  4B1Z A;  5AQH A;  2ASO A;  4ISE A;  3S3M A;  4M63 C;  1WBB A;  2E4L A;  3P31 A;  4AH9 A;  4CK2 A;  3OS1 A;  4N47 A;  3U3Y A;  4A5A A;  4DQP A;  1JCE A;  3ALY A;  4A62 A;  1JCF A;  3IAY A;  4M3W A;  4N41 A;  4O5F A;  1N5Y A;  2P5O A;  4DFK A;  1ATR A;  4CFD A;  2HMP A;  3M8R A;  3CPW M;  3K0S A;  4JKH A;  4RG8 A;  3J80 O;  1FXX A;  2VQF K;  3L2Q A;  2P9U A;  4H0Y B;  4EP4 A;  4BQZ A;  1IKV A;  2CH5 A;  3IG1 A;  3AA5 X;  3KHY A;  3QBW A;  4NLB A;  3L4I A;  3CER A;  2QA4 N;  1VQ5 N;  1GLL O;  1DKG D;  1HNV A;  3V1Q A;  1YJW N;  2GV9 A;  3A5O C;  4DQQ A;  2KQ2 A;  2HHU A;  4JI1 K;  4H0T B;  2UXD K;  3CG7 A;  3MEG A;  2O4G A;  4Y1C A;  5HLF A;  4H0V B;  5CYQ A;  1QS4 A;  4W5Q A;  4OPJ A;  4PKH A;  3EZW A;  3LP0 A;  2OTJ N;  3FZK A; 
#chains in the Genus database with same CATH homology
 4CZE A;  2Q2R A;  4JKB A;  3E9L A;  4KH6 A;  3CJA A;  1Z05 A;  5MLC Q;  5JIC A;  4PKI A;  3HRG A;  3GDQ A;  4H5V A;  3U4L A;  2QWQ A;  3CCQ N;  2D0O A;  3H1V X;  3O8M A;  3CCR N;  1GLF O;  4YDU A;  2A42 A;  3S41 A;  1XUP O;  4IXC A;  1HX1 A;  1YAG A;  3O9U A;  2V7Y A;  4BR2 A;  1ATS A;  3QDK A;  3F9M A;  5GAD P;  3HZ6 A;  3VPZ A;  1IJJ A;  4YOY A;  4BRL A;  1VQ8 N;  2QI2 A;  3B8A X;  3D7E O;  3TU5 A;  5KQD A;  1ZBS A;  2HBJ A;  1GLA G;  1SQK A;  1RDW X;  3SAF A;  3CME N;  1GLJ O;  4O8K A;  3SK3 A;  2YJE A;  4DHY A;  5F2R A;  3SLC A;  5AQW A;  2BUP A;  5BRF A;  3H1Q A;  4IOC L;  2F9T A;  4OPA A;  2UYT A;  2QWR A;  3UKU A;  3RSE B;  2VGN A;  1JJ2 M;  2E2O A;  4KH5 A;  5LJV A;  3O1W A;  5BRE A;  2NRW A;  4BR0 A;  3MX5 A;  5M1K A;  3CCJ N;  3T7Z A;  3ID6 A;  4MDA A;  4GV9 A;  3O9R A;  2A3Z A;  4JK8 A;  4EHU A;  4CZL A;  1HPM A;  4CZM A;  2GX9 A;  1U2V A;  4YOT A;  3R1X A;  4JHD B;  4JAX A;  3ATU A;  5C12 A;  5GIP A;  2ASM A;  2P9K A;  5AZI A;  1W2B M;  4WFA L;  2PBD A;  3HTV A;  1YF5 L;  3U8X A;  3UE5 A;  4Y0W A;  4CZK A;  1NLV A;  5AQV A;  3VOV A;  2BTF A;  3AAQ A;  4FPA A;  4IOX A;  1T44 A;  4WQ5 C;  4FWR A;  5BRH A;  2FSJ A;  5BRD A;  4YOV A;  2ZJP L;  5GAG P;  2YJF A;  4IEI A;  2PFU A;  3TTF A;  5GIO A;  2NRX A;  3KZB A;  1MWK A;  2CH6 A;  4BRK A;  1GLD G;  5F0X A;  1VQP N;  2A40 A;  3H3O B;  3D2F A;  1VQ9 N;  2GWK A;  1KAX A;  5M1F A;  1NGC A;  1K8A O;  4BVP A;  3E9P A;  2IVO A;  1V4S A;  1NMD A;  4BR7 A;  1ATN A;  3DXK A;  4OO1 J;  5AQY A;  2A5X A;  4C23 A;  3VEN A;  3C7N A;  3CF5 L;  5KQ8 A;  4BC4 A;  5C10 A;  1R59 O;  2P9P A;  3SMS A;  4GV6 A;  2HBK A;  3M5R A;  2GUP A;  3CQY A;  1D4X A;  1OVY A;  3ZX2 A;  4BY9 C;  1VQ6 N;  3ENO A;  2VYP A;  4NO7 A;  1ESV A;  1VQK N;  2AA4 A;  1VQL N;  3ENB A;  3LDP A;  4H5T A;  3RVC A;  4JKC A;  4F9O A;  2ZGZ A;  5E84 A;  4IOA L;  3VEZ A;  3MMV A;  3DAW A;  1MA9 B;  4B1Y B;  2KKZ A;  2D0P A;  4DCH A;  2P9I A;  4M7Y A;  3ZET B;  1T3V A;  5AZJ B;  4A2B A;  1BDG A;  1W97 L;  1TUY A;  1Q7Y O;  3C6H A;  1KXP A;  4UY8 O;  3NVK A;  1QZ5 A;  2IIR A;  3C65 A;  3CCU N;  4HWI A;  3I33 A;  1O13 A;  5AQJ A;  3VET A;  2FF3 B;  4FWL A;  4CI6 A;  3CHW A;  4H0X B;  4ISF A;  3LL3 A;  2VCP A;  2YHW A;  2ITM A;  2OTJ N;  1X9J A;  4JD2 A;  2P9N A;  4B1V A;  3VGM A;  4JK9 A;  2E2P A;  3WXI A;  4PL8 A;  2QWO A;  3R3L A;  3MX2 A;  4MLE A;  3MCA B;  4J8F A;  4KH4 A;  4B1X B;  1G99 A;  3TSU A;  4GV3 A;  3LDN A;  1QQM A;  5KPT A;  4BC3 A;  5HOO A;  4U67 L;  2CGK A;  2IVN A;  3IUC A;  1HUX A;  3BP8 A;  4WQ4 C;  3GE1 A;  3CCM N;  1NGJ A;  3CCS N;  2A41 A;  4NLC A;  3TSP A;  5DM7 L;  1YIJ N;  3MN6 A;  2J4R A;  3FZF A;  3WXM B;  5BN8 A;  3EN9 A;  3O9T A;  1TYQ B;  1WUA A;  2KHO A;  3A5M C;  4NB4 A;  4BGA A;  1BOT O;  1H1V A;  3QFP A;  4BGB A;  2WC9 A;  1SS6 A;  2GEM A;  3LDQ A;  3P4I A;  3Q7C A;  4IJN A;  1HKB A;  2E20 A;  2WUS A;  3CQX A;  4BR5 A;  4R79 A;  5AQI A;  1Y64 A;  1VQM N;  5M1Q A;  2F9W A;  3D6R A;  4EHT A;  1SAZ A;  2E8A A;  1QQO A;  1U2V B;  2E2N A;  3ZYY X;  1NGD A;  4FOI A;  3AAP A;  5FPM A;  4JEP A;  4BRG A;  4O8U A;  2F7T A;  2WFB A;  3CC2 N;  3WXK A;  5AZI B;  3ZEU A;  1X3N A;  1M1K O;  1K8K A;  4B9Q A;  4MDB A;  3G6E N;  1ILY A;  4MO5 A;  3CD6 N;  1E4G T;  4IDH A;  3KVG A;  1XC3 A;  2E1Y A;  3PLA A;  2Q36 A;  1T6D A;  3GOI A;  4H5W A;  3AY9 A;  5AQL A;  2QW9 A;  3VTI A;  3C0B A;  2DPN A;  1NGG A;  1P90 A;  4H5N A;  3M3Z A;  4Z94 A;  3E9O A;  1BA1 A;  4ISG A;  5AQK A;  4FO0 A;  3WUH A;  5JLH A;  5FPE A;  3FZH A;  4B1W B;  3JXU A;  4JNE A;  3D2F B;  4DQ8 A;  1SZ2 A;  4BRI A;  2GWJ A;  3EL2 A;  4IFE A;  3DXK B;  3K9J A;  2QTD A;  4BR9 A;  4MO4 A;  5JVH L;  3VES A;  4JKE A;  3CPE A;  3IKM A;  3C7N B;  5TKY A;  4BG9 A;  1VAZ A;  3FGU A;  1RDU A;  3DLL L;  3ATV A;  1NGH A;  2ZJR L;  2W40 A;  1TUU A;  3FFK B;  1DGK N;  4JKG A;  1EO1 A;  4BRF A;  5M1O A;  2NRT A;  3VER A;  2FSK A;  2P9S A;  3G71 N;  4FWO A;  3CI5 A;  3WQT A;  3U9Z A;  3ENH A;  4K42 A;  5EX5 A;  2KLA A;  3L0Q A;  2P9I B;  3FE1 A;  1OKJ A;  5BR9 A;  4FOE A;  1GLB G;  4IO8 A;  3N4P A;  2NNW A;  3QBX A;  3UKR A;  4CD1 A;  1K9M O;  2ASP A;  4JKA A;  3MN9 A;  4I6M A;  5AQM A;  4FWP A;  3VF6 A;  3NVM A;  4CBW A;  5JLF A;  2ZGY A;  4ILJ A;  4RWT A;  2YX6 A;  2GTD A;  4EFH A;  1N8R O;  5ELZ A;  2QXL A;  3QML A;  2NRV A;  1GLC G;  3E66 A;  4WCE L;  2W41 A;  4PHT X;  2P9N B;  3D2E B;  2P9U B;  2E1Z A;  3CJ1 A;  3GG4 A;  3QB0 A;  2Q97 A;  5AQZ A;  3HOT A;  1DEJ A;  4JN4 A;  3W3D A;  5ADX H;  1Q81 O;  1QVF M;  1DT9 A;  4CZH A;  1S3X A;  5C2F A;  5LJW A;  4BRN A;  1IG8 A;  1RFQ A;  5BPL A;  2FSN A;  3VGK A;  4GNI A;  5AQT A;  2BH1 A;  2CGJ A;  4H0P A;  4YDU C;  3J8A A;  4MLH A;  1JCG A;  1E4F T;  4XEI A;  2HBM A;  3IDH A;  3RSE A;  3H45 C;  4BRO A;  4FSV A;  2FXU A;  2FF6 A;  4IWV A;  3CJ7 A;  3IMX A;  1NGE A;  4KBO A;  3WQU A;  3A8Y A;  4BQL A;  3DXM A;  5I9E B;  3EKS A;  3FLC O;  2HOE A;  3G25 A;  4FWS A;  3CC7 N;  3OBW A;  4H0O A;  5JMV A;  4JHD A;  4RCH A;  5AFU A;  4YOX A;  2JWK A;  5H1S Q;  3G4S N;  4HTL A;  5FPD A;  5M1N A;  1NBW A;  2QM1 A;  1QZ6 A;  2YHX A;  3BUZ B;  3Q7B A;  4CZJ A;  2QEX N;  3HOS A;  3PIO L;  3GL1 A;  3CET A;  3FZM A;  3BF3 A;  3KK7 A;  1YIT N;  3EE9 A;  3J7Z O;  4BR4 A;  3A5L C;  4BRM A;  3ZEU B;  3HSC A;  3H6E A;  3EKU A;  2D4W A;  1K8K B;  4A57 A;  1VQN N;  2NRR A;  4CZI A;  1Q18 A;  4WYB A;  3I56 N;  3CIP A;  1J6Z A;  3L6Q A;  4BRA A;  4CD3 A;  3MK6 A;  4GY2 B;  3O6W A;  3WEE A;  3T69 A;  5KPR A;  4WF9 L;  1YHQ N;  2HF3 A;  3VEW A;  4AM6 A;  3BEX A;  1C0F A;  5F1X A;  2YCH A;  3CC4 N;  4EAH D;  5C0Y A;  1NGB A;  3LDO A;  1YJN N;  3ULE A;  1YVN A;  2NRZ A;  3VGL A;  3UKU B;  3W0L A;  1GLE G;  1P8Z A;  1BA0 A;  1U6Z A;  1CZA N;  1NGF A;  3O80 A;  4FPB A;  5EOY A;  1S72 N;  1MWM A;  3SJH A;  4FWQ A;  1KAZ A;  3VTH A;  3SAH A;  1NGA A;  2H3G X;  4BRD A;  2VGM A;  1WOQ A;  1XQS C;  4BVO A;  2YI1 A;  1BO5 O;  4QS8 A;  4A61 A;  4BC5 A;  4FWK A;  4CBU A;  2ZF5 O;  3K9K A;  2Q0U A;  4C1N K;  2RE2 A;  2E2Q A;  4JKG B;  2P9K B;  4GVE A;  2P9S B;  1HLU A;  3DJC A;  2HF4 A;  3ZET A;  4FWM A;  5CR4 A;  1V4T A;  3GBT A;  4PKG A;  2D1K A;  3LDL A;  3TTD A;  1VQ4 N;  2GEL A;  3O08 A;  4L3Q A;  3OW2 M;  5CHI A;  2QWN A;  4C1N I;  3CCV N;  4FVU A;  3SMP A;  4CZF A;  3O1B A;  3CCL N;  3VEV A;  4JKD A;  5CE3 A;  4M7X A;  1Q82 O;  1QVG M;  1NGI A;  3VF4 A;  3VEX A;  5FPN A;  3R6M A;  4A59 A;  1HJO A;  4BRP A;  1NJI O;  5GIN A;  3AGR A;  4FWN A;  3SBT A;  2NLX A;  3FZL A;  3EE8 A;  3O9S A;  4XH4 A;  4CZG A;  3MWP A;  3MCP A;  3TTC A;  2P9P B;  2EWS A;  4JK7 A;  3JS6 A;  2JWL A;  3QIC A;  5AQR A;  1BU6 O;  3MWT A;  4PL7 A;  1Q86 O;  4DKW A;  4ILH A;  1YJ9 N;  1TYQ A;  3IFR A;  4BRQ A;  5BN9 A;  3NMU A;  4OPH A;  2V51 B;  4YOU A;  2NRH A;  5KPZ A;  5AQQ A;  3F2K A;  3AAR A;  3SAG A;  1YXQ A;  2P9L A;  1HKG A;  2AP1 A;  3VEY A;  3LM2 A;  4ILG B;  3DXM B;  3UB5 A;  4K41 A;  2V52 B;  4E1J A;  3LM9 A;  3A5N C;  3CJB A;  5AQX A;  4BRH A;  1LOT B;  5C15 A;  2Q1N A;  3OBY A;  4LC9 B;  4WQ4 A;  2QWP A;  3C6A A;  3MN7 A;  5AQF A;  1KD1 O;  4B1U B;  4JD2 B;  3I55 N;  4RTF D;  1NWK A;  1KAY A;  3DWL A;  4YOW A;  2WBN A;  1T6C A;  4K43 A;  3P38 A;  2I7N A;  5EY4 A;  3O4W A;  2OTL N;  3A0I X;  4WFN L;  5AR0 A;  2V7Z A;  5DM6 L;  3OHR A;  3CMA N;  1Z6R A;  3FR0 A;  3R9P A;  1VQ7 N;  1BG3 A;  2HBL A;  3WXJ A;  2HST A;  2VWB A;  5E26 A;  4CJ7 A;  3O9Q A;  2QWL A;  3WEE B;  3M1F A;  3H46 O;  3CJC A;  3I8B A;  1KQS M;  1QQN A;  3PIP L;  4IZ9 A;  3HM8 A;  4G9Z A;  5EVZ A;  2YHY A;  3TPQ A;  2ZWH A;  4BRE A;  4QS7 A;  5JVG L;  4IJA A;  5AQN A;  3ULE B;  4H5R A;  1KC8 O;  3BF1 A;  3AGK A;  1ZC6 A;  5BPM A;  1M90 O;  4EIA A;  3QFU A;  2A6A A;  2CGL A;  4BG8 A;  4JKF A;  1YI2 N;  4AM7 A;  2PAV A;  2QWM A;  5AQH A;  4B1Z A;  5HL7 L;  4U7B A;  2ASO A;  3CXC M;  4ISE A;  4DB3 A;  4M63 C;  3KWG A;  5AQU A;  5C2D A;  1HKC A;  3KWI A;  3P31 A;  2Q31 A;  1ZXO A;  5AQG A;  4A5A A;  1JCE A;  4FL9 A;  1NM1 A;  4A62 A;  4A2A A;  1JCF A;  2IVP A;  4O5F A;  3VEO A;  2OAN A;  1YUW A;  4AF1 A;  3CCE N;  1ATR A;  4H03 B;  4BC2 A;  2HMP A;  3CPW M;  5LY3 A;  2E88 A;  4JKH A;  5ADX A;  1C0G A;  2I7P A;  4BRC A;  3MN5 A;  1RGI A;  2FLO A;  4YOR A;  3O5B A;  5GAE P;  3L4Q A;  3P39 A;  5M1P A;  3D2E A;  3H3N O;  2P9U A;  2NZT A;  4H0Y B;  4QS9 A;  3N4Q A;  3VF2 A;  4BQZ A;  3ZX0 A;  2CH5 A;  4XH5 A;  5TKW A;  3KHY A;  1BWF O;  3QBW A;  2RHK A;  3HBT A;  4NLB A;  5EXW A;  5AQO A;  3VMF B;  3ZX3 A;  3L4I A;  3M6G A;  5BPN A;  4WQ5 A;  4CBX A;  3CER A;  4K25 A;  4XH1 A;  3WXL A;  4WFB L;  3HI0 A;  2QA4 N;  1VQ5 N;  3R8E A;  4IO9 L;  1QHA A;  3E1Y A;  1GLL O;  3TSQ A;  1DKG D;  3F5T A;  1MDU B;  1YJW N;  1S22 A;  5GAH P;  3A5O C;  1K73 O;  4A5B A;  5B8H A;  3CJ9 A;  3MDQ A;  3OA9 A;  5AZJ A;  1X3M A;  1VQO N;  4H0T B;  3WT0 A;  3SBG A;  1LCU A;  1EQY A;  2ZJQ L;  3EO3 A;  2Q0R A;  5AQS A;  3UKR B;  2P9L B;  4H0V B;  3ID8 A;  4IEE A;  5AQP A;  1BUP A;  4PKH A;  4I6M B;  3EZW A;  5AFU H;  3U9D A;  3FZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...