4CHQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 52
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chqA00
1GOBA 1FXXA 2X78A 3L2UA 3JSMA 3V9UA 1U48A 3DI6A 3SI6A 4EZ9A 4KAZA 3S3OA 4FZYA 3NFAA 1KFSA 1YTAA 1D9DA 2KZZA 1WN7A 1VSIA 1XWLA 2QXFA 3NBPA 4CJWA 4HUEA 2OA8A 4PWDA 3OY9A 3OYHA 4CF2A 4FM0A 4DWIA 2XHBA 3IAYA 2P1JA 1WSFA 2DFFA 2G8KA 3F9KA 3AVBA 1S6PA 3K2PA 3V9WA 4E0DA 3OYEA 1RT4A 4IFYA 4O4GA 3QERA 3PX0A 1LWFA 4BACA 1BIZA 5CYMA 3O3HA 4W5NA 3OJSA 2PZSA 4I9QA 1WSHA 4FM1A 4EP5A 4CEFA 3QEXA 2VG5A 4DFMA 1L3TA 3O4NA 4IBNA 1HQUA 4AILC 1N6QA 2IAJA 1ASVA 2HHUA 1NOYA 1NJYA 3SUNA 4FJ5A 4E19A 3L2RA 1RTJA 1LAWA 4AHRA 5HLFA 3AVKA 4QOZB 2XY5A 1C1AA 2BE2A 1VSKA 3OYDA 3ZSXA 3KLIA 5KGWA 1RBUA 2DY4A 4FZZA 2RKIA 4EP4A 2I5JA 1HRHA 1Z26A 3VQQA 3C94A 1DLOA 3NF7A 4DSEA 4LSLA 1ZBLA 5JS1A 3THVA 1VRUA 3QNOA 4JRPA 1SL0A 3K5NA 3RMAA 2X6SA 4DTXA 3C6TA 3LWMA 4IKFA 3ITHA 4I9LA 2HB5A 3PX4A 3DRSA 1YT3A 1RBRA 3AV9A 1S1VA 3NH1A 1YTUA 4FJ9A 3DLHA 4N41A 3NGIA 3AO3A 4GW6A 1NK9A 3AVGA 4RW7A 4CFBA 5J1EA 4C8OA 1U04A 1SL2A 4YFUA 1QS4A 1EP4A 1T8EA 2G8IA 4CHZA 1TKDA 1S6QA 3SQ0A 3QEPA 5CYQA 3LANA 1LWEA 2DFEA 3O3FA 4FLWA 1S1TA 2HHWA 4B9SA 1R0AA 1JLBA 3NGYA 1XC9A 3KD5E 1KVCA 4RW8A 4CJ5A 4E89A 4DTPA 4DFJA 4B9MA 4F4KA 4IFVA 5KTQA 3KLHA 1SUQA 5HROA 1BISA 3DRPA 3A2FA 5HRNA 4ELTA 5DK5A 3OYLA 4NCAA 1NK0A 1WSEA 2YNGA 2FC0A 4M3UA 3M8RA 1JXEA 1C6VA 1JL2A 3LP2A 4I2QA 4Z4HA 4ICLA 3KJVA 4FLYA 2F96A 1Z25A 1N5YA 3BGRA 3OYNA 4DTRA 4DFKA 3ZT4A 4B8AB 5CZ2A 2HW3A 4OLBA 1Q8IA 4FW1A 3CFRA 4PUOA 1K6YA 2A1RA 4KHQA 1JKHA 1B9DA 1HMVA 4GMJB 3OJUA 2KQ2A 1EKEA 1JL1A 1KCFA 4RW9A 2HNYA 3KIOA 3VQ4A 3OYAA 4N5SA 3C6UA 1B92A 4CEZA 3ZT2A 4CECA 4HUGA 1RT3A 4B9NA 1J9AA 4MFBA 5SZTA 3HO1A 3RRGA 3I0SA 2GV9A 3VQPA 4OGCA 4BDPA 1XHZA 4DLEA 1WSJA 4FJMA 4M42A 2ZQBA 4OKEA 3TWHA 4DLGA 1TKTA 1S5JA 3SUOA 4CHQA 4CEEA 1VRTA 4KKOA 3S3MA 3RMCA 2RF2A 2P51A 4NYFA 4KHWA 1J53A 3V4IA 1XHXA 3KK2A 3SQ1A 3E01A 1CXUA 2HHVA 4J2BA 1CZBA 3SYZA 4CE9A 4FJIA 2G8UA 3HPHA 3DLRA 1S9EA 4Y1CA 3K57A 1TKZA 3LAKA 3L2WA 1QE1A 3ZSQA 4Z4CA 3S3NA 4CF0A 5K14A 2P5GA 2EX3A 1O1WA 4W5TA 4DF8A 4M3XA 2KFZA 1JLCA 1QSYA 4Q0BA 2GUIA 3ZSYA 5JS2A 4FJXA 1BHLA 4OKJA 2X6NA 3AVLA 3AO2A 4CK2A 4N47A 2OPPA 4F2SA 3ALYA 1HYSA 1KTQA 2NUBA 1SV5A 2YV0X 3OS0A 4OKKA 3MEGA 2BANA 4FLVA 1RILA 1TVRA 3AA4A 3I0RA 4DSFA 3U3YA 3V6DA 4CCHA 1XI1A 4C8NA 4ZHRA 1SKWA 2ATQA 2P5OA 1GOCA 4O44A 4CJEA 1RT6A 4Y1DA 2KW4A 3ZT0A 1JLEA 4NCGA 1BGXT 4DSKA 3HT3A 4KTWA 1NK8A 2QKKA 2B4JA 1VSMA 2YNFA 4B9TA 3HK2A 3OS2A 1IH7A 1U4BA 4E1MA 3ZSRA 1X1PA 3LALA 1IKWA 4KV8A 3K59A 1NKCA 1G15A 2FBVA 3AVMA 4I7FA 3UIQA 4KHSA 3KKSA 2E4LA 4YNQA 4DTJA 3P1GA 1WLJA 3VQEA 1EX4A 1VSLA 2A1SA 2ZD1A 3V1RA 3JYTA 4E7IA 3RR7A 4KHNA 1ITGA 3HL8A 3NF9A 4RG8A 4B08A 3NAEA 3OYJA 2PYLA 4CEAA 1HNIA 4CEOA 4JS4A 4FJGA 1UOCA 4FZXC 4AHCA 4CJ4A 3OYMA 3SZ2A 1WSIA 2YHAA 1KLNA 4KREA 3TAMA 4CHPA 3PO5A 3HPGA 4KI6A 2IC3A 4H4MA 4GVMA 3QLHA 4W5RA 4DQQA 1T03A 1NJWA 3ASMA 4C8LA 4WE1A 2YNHA 1SKRA 4Z4FA 4B8CA 4FJJA 3EYZA 3K58A 4KHYA 3L3UA 3AO5A 4IG3A 4CGDA 1RT5A 1ASUA 1BQNA 1FKPA 4KO0A 4F3TA 1ZBFA 3LZJA 3AVNA 1I39A 2VG7A 4DQSA 1TK8A 4XIUA 2EHGA 2FBXA 3EY1A 4AH9A 4E3SA 3BDPA 3V1QA 3TABA 1VSFA 5E41A 4JS5A 1BCOA 4FLTA 1TK5A 4M3YA 1VSHA 3DLGA 1IO2A 4CHNA 3PY8A 2HVHA 1TAQA 3ZT1A 2W42A 1CLQA 2JLEA 2BDPA 4M3WA 1Y97A 4M3TA 4CEDA 4CHYA 1LWCA 3O3GA 1NOZA 1ZBHA 3DOLA 3ZSOA 4B9VA 1NJZA 1A5VA 2Z1JA 2KTQA 1BCMA 3DLEA 2Q3SA 2XY6A 5FRMA 3VQBA 4AHVA 3VQ8A 3LAMA 3TI0A 1WNSA 4KFBA 1RCHA 2O4IA 4OLAA 4O0IA 3NH2A 3CG7A 3VA3A 2OPQA 4Z4GA 3AVJA 3M8PA 3NE6A 3K5OA 2YKNA 4LH5A 3TAEA 3KK3A 1T05A 4HUFA 3IRXA 2KFNA 1KVBA 4CF8A 3L2QA 1QQCA 1JLQA 4CJUA 3V81A 1LAVA 2YNIA 4ZTJA 5J2MA 5HP1A 5I3UA 3SUPA 1TL1A 3ISNC 3V1OA 4FLZA 1Q9YA 2AJQA 4LSNA 4Z4EA 4DS4A 4MQ3A 1D8YA 2PYJA 3VQAA 1KVAA 1L3SA 3RMDA 4CHOA 4DU3A 1BQMA 2Y1IA 3RRHA 4DSLA 3HVRA 4CEQA 3HM9A 2HHXA 3QIPA 4CJRA 4ID1A 3LDSA 4CEBA 4O55A 2D5RA 4DQIA 4ELUA 5FRNA 3OYIA 4W5QA 3WNFA 2RPIA 4O5BA 4N56A 4DFPA 4Z0UA 1LV5A 4CF9A 3TANA 2HHTA 1A5XA 1TGOA 3RTVA 3G10A 5FDLA 4CESA 4HVJA 1VSJA 3SNNA 4G1QA 3AVFA 3KKRA 4C8KA 4CGFA 4CGHA 3KD1E 4CFDA 3CFPA 4DTOA 3HP6A 3L3VA 3LP3A 2B5JA 3VQ5A 4OPJA 4DF4A 3ULDA 4E7HA 5D3GA 1B9FA 1BI4B 3IS9A 4HHTA 1NJXA 3PO4A 2QK9A 3AA5X 1SKSA 3I8DA 3TAQA 4NCBA 3SQ4A 1F21A 2DTUA 4DS5A 1NKEA 1J5OA 3L8BA 2IDOA 3OYGA 4K8ZA 4FJKA 4KRFA 4CK1A 3ZSWA 3OYBA 1U49A 4FXDA 4FK2A 1KSPA 1ZYQA 3ZSVA 4H4OA 3LP0A 1KRPA 3MXMA 3HYFA 2HNDA 3M8QA 1RDBA 3DLBA 5C42A 4FCYA 1YVUA 4CJQA 1WAJA 1S1WA 4KHUA 3D0PA 3MXJA 3KLGA 1BIUA 3TAPA 4M3RA 4AHSA 2HNZA 3HVTA 3FFIA 1ASWA 1J54A 1RBVA 3VQDA 1RT1A 3P5JA 4CIFA 2OYQA 4DQRA 3DMJA 3U3GA 2G8FA 1D9FA 3NF8A 4F8RA 4FK0A 3LPUA 3O4QA 3OYKA 4HCCA 2HHSA 4B9UA 1RT2A 3NCIA 3D45A 1QTMA 2D0BA 4BDYA 3V9XA 4I2PA 4HCBA 4FK4A 4B3OA 4K8XA 4CIEA 1D5AA 4W5OA 5KRSA 3AO1A 3ZT3A 1RTIA 3EZ5A 4CJPA 2E6MA 3QEIA 3KTQA 3TR8A 1C1CA 5HBMA 5HRSA 4FJLA 4KTQA 3DLKA 2WOMA 2X74A 3T19A 3HXMA 1NK5A 4BE1A 1LW2A 4KPYA 1C0MA 3AVHA 4CGIA 1I3AA 4FJHA 4CJ3A 1TKXA 1NK7A 3WNHA 1BL3A 1LW0A 1IKXA 2FBTA 4JLHA 2HVIA 4ID5A 4FLXA 4CGJA 3MAQA 4FW2A 1ZBUA 3PX6A 1HYVA 2QKBA 3B6PA 4CFAA 4OJRA 2VG6A 4OPKA 3AVAA 4ELVA 3RWUA 2O4GA 2D0AA 4KI4A 2WONA 5J2PA 3U6FA 2G8WA 5C25A 3IG1A 1UAXA 3B6OA 1S1UA 4FLUA 3MECA 4CK3A 2XO7A 1S9GA 3K5MA 1Q9XA 4BWMA 3QINA 3VN5A 4JRQA 3QESA 3T1AA 5DMRA 4F2RA 4KB0A 3CM5A 2Z1IA 4R5PA 4DU4A 4L8RB 1JLFA 1W0HA 1JLAA 1RDDA 3DM2A 4J2EA 1FKOA 1IKYA 1HJRA 4FJ7A 3HJFA 3AVCA 5CY4A 1QHTA 3OYCA 3KLFA 3QEVA 3KK1A 4ZTFA 1X9SA 1L3VA 1DTTA 4CFCA 1HQEA 2ETJA 4CJTA 1KLMA 2KZMA 4E7KA 3MXIA 3TARA 1TV6A 2BGGA 3T3FA 4DQPA 2D0CA 2IS3A 5KI6A 1RDAA 4E1NA 4Q5VA 1JXBA 3HPOA 1FK9A 4BDZA 4J2DA 4H8KA 1IKVA 3VQ6A 2G8VA 4EZ6A 4M3ZA 4Z4IA 3DYAA 2G8HA 3SCXA 1VK0A 3QO9A 3CQ8A 4LD0A 3V9SA 4KTZA 3QETA 1CXQA 4C8MA 4CIGA 4OGEA 4DTSA 4AHTA 1HPZA 4CJKA 3QNNA 3AA3A 1L5UA 1TL3A 3PUFA 1A5WA 5FROA 1JLGA 1W9HA 4QAGA 2FBYA 5CZ1A 4DSIA 2XRIA 1RBSA 2DFHA 2OPSA 4M41A 1WAFA 5J2QA 2OZSA 2HHQA 3M8SA 3LPTA 5HRRA 4IDKA 3PV8A 5EU7A 1U45A 2F8TA 3CM6A 4FYDA 1DTQA 2LSNA 1CZ9A 3HSTB 1EETA 5KGXA 3AVIA 4N76A 2XY7A 4E7JA 3KLEA 3ZCMA 2Y1JA 3LP1A 2R7YA 4RW4A 3TAFA 4PA1A 1GOAA 4BE2A 4FM2A 4E7LA 5I42A 4CGGA 4FJ8A 1C1BA 3NGZA 3SV4A 4DU1A 4PQUA 1T7PA 3VQCA 1QSSA 4BWJA 1VSEA 3QIOA 2VWJA 1C0UA 1BI4A 1EXQA 2Z1GA 1IG9A 1X9MA 2OZMA 4FJNA 3OS1A 4CJLA 2YHBA 3RMBA 4O0JA 3QEWA 1RDCA 2YKMA 4KB1A 4FVMA 2HMIA 4CJVA 4DTUA 3WNEA 4CF1A 3WNGA 3NDKA 2Z1HA 4DMNA 3AA2A 2GBZA 3MEDA 3MEEA 4B9LA 4QCLA 3LZIA 3F73A 2PY5A 1C0TA 3DOKA 2ZE2A 3HP9A 3NF6A 1X9WA 4DTNA 3P83D 4OVLA 1U47A 1RTDA 3L2VA 1S1XA 1NKBA 4LH4A 5HRPA 2E6LA 4DTMA 4DSJA 1UWBA 3H08A 4DG1A 5J2NA 3C95A 1KFDA 4NYNA 1UA0A 3ZSZA 4TSXA 1NK6A 1TK0A 2ITGA 4RW6A 4BE0A 3SPZA 4IG0A 2IGIA 1NK4A 2VWKA 4HTUA 4CERA 1QSLA 3SV3A 4CJSA 1TAUA 3VA0A 3S9HA 4AHUA 5T7BA 3K5LA 4UQGA 1HNVA 3AO4A 3CYMA 2OPRA 3CFOA 3VQ9A 1L3UA 2IOCA 4J2AA 2F8SA 1ZBIA 4F3OA 1HYZA 4CJFA 4PY5A 3SJJA 2XY8A 3VQ7A 1WSGA 3LWLA 3NH0A 1RNHA 1UA1A 3RR8A 3SPYA 3OVNA 4LY7A 5KRTA 1MU2A 1REVA 4M45A 3SQ2A 5C24A 3V9ZA 3TAGA 1SL1A 3NHGA 3DRRA 2JGUA 3OYFA 3SUQA 5SWMA 2B6AA 3G0ZA 2RN2A 1RTHA 1RBTA 1RT7A 1VSDA
chains in the Genus database with same CATH superfamily
2X78A 5M1FA 4YHHK 3L2UA 3JSMA 3LDPA 4FZYA 4YDUA 3NFAA 1KFSA 4IJAA 2KZZA 1WN7A 4JI2K 2QXFA 4CJWA 4HUEA 3OYHA 3AY9A 4CF2A 3UKUB 1W2BM 2UUCK 4DUYK 2DFFA 3AVBA 1OH7A 2IVOA 1GLLO 3K2PA 3PIPL 4E0DA 4BACA 5CR4A 4A59A 3WEEB 1ILYA 2PZSA 2BUPA 1WSHA 3QEXA 2VG5A 3O4NA 2D4WA 5BN8A 1N6QA 4AILC 1ASVA 2P9LB 4OO1J 1RTJA 1LAWA 4FOIA 4QOZB 1HNWK 4RWTA 3ZSXA 1QQNA 3ZLJA 1GLEG 1T6DA 3PIOL 4JI5K 2O8BB 1ZBLA 2ZJRL 4DR5K 1KC8O 4DTXA 4JHDA 4CZJA 3CMEN 2HB5A 3PX4A 2O8FB 3I8BA 4YOWA 5AQMA 1QS4A 1Q82O 4CHZA 1TKDA 3QEPA 5CYQA 4LF6K 2DFEA 3O3FA 1J6ZA 4B9SA 1WBBA 1XC9A 3F9MA 4B1YB 4E89A 4DFJA 4B9MA 4F4KA 4IFVA 1SUQA 1BISA 1YAGA 1JXEA 1JL2A 3JXUA 1N5YA 4ICLA 4DTRA 2NLXA 4OLBA 1K6YA 4GMJB 2VCPA 4RW9A 2HNYA 3OYAA 3B8AX 1B92A 2A3ZA 3ZT2A 3HO1A 4B9NA 3UE5A 1ESVA 3I0SA 4BREA 4H5WA 4NXMK 1S5JA 4IZ9A 3O80A 5BRHA 2OCEA 4O5FA 4KHWA 3LDOA 1ATRA 1CZBA 3G71N 4CE9A 4FJIA 2G8UA 1TKZA 4JI4K 3S3NA 4CF0A 5K14A 3T7ZA 1HUXA 5E84A 2EX3A 1NG9A 4E1JA 1JLCA 3MN9A 5JS2A 4R79A 3AO2A 4N47A 4F2SA 3ALYA 3CXCM 2NUBA 1X9SA 1SV5A 2BANA 1DT9A 4DSFA 4GKKK 2ATQA 1OH5A 3UKUA 4CJEA 1RT6A 2WC9A 4JI6K 4AF1A 2GUPA 4DSKA 3HT3A 1NK8A 2QKKA 3HK2A 2YNFA 1H1VA 4E1MA 3LALA 3WEEA 3FZMA 4KHSA 3KKSA 5BRFA 1WLJA 1T44A 4OPAA 1EX4A 2A1SA 3J81O 2P9LA 2ZD1A 4MDBA 3V1RA 3JYTA 5MLCQ 4FO0A 2YX6A 3NAEA 3AAQA 1KLNA 1FW6A 3HPGA 4ISEA 2O8BA 3QLHA 5TKYA 1OH6A 4H5TA 4DR6K 3EYZA 3K58A 1RT5A 2KHOA 2O8FA 5AQUA 2VG7A 4DQSA 2EHGA 3IMXA 3EY1A 4E3SA 3BDPA 2FLOA 3V1QA 3BY5A 4BR7A 4M3YA 1BCOA 1YF5L 1N32K 1QQMA 5GIOA 3DLGA 2HVHA 2E5LK 4MO5A 2JLEA 4M3WA 3MMVA 3R6MA 3Q7CA 4KBOA 1NOZA 4DV6K 3DOLA 4CI6A 4B9VA 5AQKA 3CCEN 1BCMA 3TI0A 3LAMA 1BUPA 2O4IA 1RCHA 4OLAA 4Z4GA 3AVJA 3NE6A 3MN5A 4JI8K 1KVBA 3EE9A 1QQCA 4ZTJA 3DXMB 5J2MA 5I3UA 1IBMK 3SUPA 4FLZA 5AQWA 2F9TA 1D8YA 2PYJA 3RMDA 3NMUA 1RDUA 2Q1NA 3E9LA 1BQMA 2Y1IA 3RRHA 3HVRA 2HHXA 3HM9A 3HBTA 4BRNA 2QWMA 4CJRA 4H5RA 4ID1A 4JEPA 3LDSA 1Q86O 1OH8A 3OYIA 4Z0UA 2HHTA 5C10A 1A5XA 3WXLA 3L4QA 1SAZA 3RTVA 3D7EO 3G10A 4CESA 4AQYK 1VSJA 3SNNA 1QVGM 2ASPA 3HM8A 5AQFA 4CGFA 3GG4A 3WXJA 4CFDA 1IBKK 4DTOA 3HP6A 3L3VA 3LP3A 2B5JA 3VQ5A 4E7HA 4JKBA 1B9FA 1BI4B 1QZ5A 3JAMO 1NJXA 2QK9A 3I8DA 4DCHA 1J5OA 2IDOA 3OYGA 4K8ZA 1KSPA 3G25A 2IIRA 3HYFA 3MDQA 5C42A 4FCYA 1YVUA 1N8RO 3O6WA 4BVPA 1VQ6N 1NLVA 2QTDA 1BIUA 3TAPA 1OVYA 3HVTA 3THYB 1HJOA 4LC9B 3P5JA 4EHTA 2HBLA 4F8RA 1D9FA 3NF8A 3QMLA 3O4QA 2UUAK 2NNWA 3ZX2A 2HHSA 2CGJA 1RT2A 3NCIA 5BRDA 4B9UA 3VF6A 4B3OA 2YJEA 5M1QA 2D0OA 5KQDA 3CD6N 4W5OA 2QWOA 3ZT3A 3ID8A 4CJPA 2E6MA 3QEIA 4QS9A 5AZIB 4KTQA 3DLKA 2WOMA 3OHRA 3T19A 3J7ZO 1EWRA 1LW2A 4KPYA 4FJHA 4CJ3A 2ZGYA 1LW0A 2FBTA 4JLHA 2HVIA 4ID5A 4BROA 3QBWA 3MAQA 2QKBA 1BU6O 1U6ZA 4RCHA 2O4GA 2D0AA 4KI4A 2WONA 4J8FA 2NRRA 2G8WA 4BG9A 3IG1A 4FLUA 3B6OA 2HW3A 3MECA 4BWMA 3VN5A 4WQ4C 3P38A 4KB0A 3CQYA 4DU4A 1RDDA 4U67L 1FKOA 1IKYA 1HJRA 4FJ7A 3HJFA 2IVNA 1KAZA 1QHTA 3CJ1A 4YOXA 1EWQA 4JKFA 3TARA 3ID6A 2BGGA 3CJCA 4DQPA 1YITN 3HPOA 1JXBA 3DXMA 3C0BA 1IKVA 4H8KA 3A0IX 4JKAA 2G8HA 1CXQA 2E20A 1HPZA 4CJKA 4JI1K 5DM6L 3CERA 4BRHA 1NGFA 4ILJA 2UU9K 4PL8A 2FBYA 5CZ1A 2NRZA 1WBDA 3SAFA 1DTQA 3HSTB 4N76A 4E7JA 2Y1JA 3ZCMA 3EE8A 4E7LA 2F7TA 1GLAG 2BTFA 4PQUA 1W97L 3HZ6A 1BI4A 1XNRK 1X9MA 2OZMA 4FL9A 5FPNA 4IDHA 2HBJA 3RMBA 3OA9A 4O0JA 1RDCA 4CJVA 3Q7BA 3NDKA 4DMNA 3AA2A 3MEDA 3LZIA 1C0TA 3HP9A 1X9WA 4GKJK 1NKBA 2PBDA 4DTMA 1UWBA 3H08A 3TSPA 3THYA 1Q18A 1U2VB 4CZGA 2E2QA 2ITGA 3SPZA 2VWKA 4HTUA 2FF3B 1NGAA 2VWBA 4AM7A 3AO4A 1NMDA 3VQ9A 2WBNA 3KVGA 3O9TA 2XY8A 3VQ7A 3CCUN 1NGCA 5CE3A 5AFUH 3OVNA 4V19S 4GV6A 5C24A 4DR4K 2IVPA 3NHGA 3DRRA 4H0XB 5GAGP 2JGUA 3OYFA 3SUQA 5SWMA 3G0ZA 2RN2A 1ZXOA 2P5GA 4JV5K 1YIJN 4CBWA 1U48A 2FSKA 4L3QA 4EZ9A 3S3OA 1NJIO 1RGIA 2P9IB 3DAWA 3NBPA 3ZEUB 4FM0A 4BRGA 2XHBA 2OANA 2O8DA 4C23A 2G8KA 3ULEB 3TTFA 1M90O 5AJ3K 3OYEA 1RT4A 4O4GA 3QERA 1LWFA 1BIZA 3TPQA 3A5LC 4W5NA 5JVGL 3H45C 4FM1A 3FLCO 3TSUA 4F9OA 3E9OA 5C12A 3LM9A 2IAJA 2HHUA 5LJWA 4IOXA 1NJYA 4FJ5A 1VQ5N 3CMAN 4AHRA 5HLFA 4BY9C 2XY5A 3DXKA 2BE2A 1VSKA 3OYDA 3KLIA 1RBUA 1SS6A 2RKIA 5GAHP 2Q36A 3O1BA 1HRHA 4DV1K 1CZAN 3C94A 5JS1A 2QWPA 4LSLA 3A8YA 1SL0A 3K5NA 4DB3A 2OTLN 3C6TA 2YHXA 4CZMA 3LWMA 4IKFA 1KD1O 3DRSA 1YT3A 1RBRA 3NH1A 4PY5A 2D0PA 3NGIA 3WQUA 4IJNA 4WCEL 4K43A 3SQ0A 2AA4A 3C65A 4DQ8A 4IEIA 1LWEA 3OW2M 2HHWA 1R0AA 1HNZK 1KVCA 4RW8A 5HROA 3N4PA 4ELTA 3O9RA 5HRNA 5DK5A 3OYLA 4NXNK 4M3UA 3M8RA 1C6VA 3KJVA 3VGKA 2F96A 4DFKA 3CC7N 5FPMA 5CZ2A 4FW1A 2PAVA 4KHQA 1V4TA 2KQ2A 1KCFA 3A5NC 4CEZA 4WQ5C 4HUGA 1J9AA 4MFBA 5SZTA 4OGCA 1U2VA 4BDPA 1WSJA 4FJMA 1EO1A 5EVZA 2ZQBA 4YORA 4DLGA 1DEJA 1VQLN 4CHQA 1VRTA 5AQPA 3S3MA 2P51A 3E01A 4J2BA 3HPHA 4Y1CA 5AQTA 5BR9A 3L2WA 3ZSQA 3CC4N 5M1OA 4DF8A 3TSQA 2KFZA 3E1YA 5JLHA 1JCEA 4H0PA 3AVLA 3O4WA 3THWB 4CK2A 2P9IA 2YV0X 3OS0A 1OKJA 4OKKA 1TVRA 4CCHA 1XI1A 4ZHRA 1SKWA 1GOCA 4O44A 3ZT0A 4NCGA 1VQPN 3I33A 5FPEA 3IFRA 1IH7A 4KV8A 1NKCA 5M1KA 2FBVA 4I7FA 4A57A 1QHAA 2W6LA 4PHTX 4YNQA 3P1GA 3VQEA 2E2NA 4DR3K 1VSLA 3RR7A 3AAPA 4E7IA 4KHNA 4CZHA 1ITGA 4RG8A 2PYLA 2QA4N 2GTDA 4CEAA 1HNIA 1NMNA 3MWPA 4FZXC 3OYMA 4AM6A 1WSIA 4DV7K 2YHAA 1NGGA 2A41A 4KI6A 2IC3A 4K25A 2WFBA 1SKRA 5BREA 4B8CA 4Z4FA 3AO5A 4CGDA 1BQNA 4JI7K 3CF5L 3LZJA 3AVNA 3M5RA 2CH6A 1TK8A 5GADP 1VSFA 5E41A 4JS5A 4FLTA 3L4IA 3CCRN 4B3RK 2W42A 1Y97A 4BRKA 4CHYA 1NGBA 1LWCA 1VHXA 4FPBA 4LF4K 1A5VA 3RVCA 2KTQA 5FRMA 4AHVA 3ENBA 3VQ8A 3P31A 2Q0RA 3NH2A 3VA3A 2YKNA 4LH5A 1T05A 3KK3A 4HUFA 2KFNA 4CF8A 2VGMA 4WFAL 5HP1A 4NLCA 2F9WA 2KKZA 3M1FA 4MQ3A 5GINA 1KVAA 3T1HK 2YJFA 3DLLL 3VEXA 3SBGA 4DSLA 4CEQA 5LMNK 1K9MO 1BG3A 1GLDG 2UUBK 2D5RA 4DQIA 3WNFA 1LV5A 4O5BA 3DWLA 4BRMA 3AARA 3ZETB 3U9DA 4OX9K 2V51B 4BC2A 3SJHA 2QM1A 3KKRA 3MWTA 3GDQA 3NVKA 4K42A 4WQ4A 2VQFK 3OTOK 4WFNL 5C15A 3CFPA 5D3GA 2ZJPL 4HHTA 3PO4A 2O8CB 3THWA 3AGRA 3SQ4A 2DTUA 4PKIA 3MN7A 3L8BA 4KH5A 4KRFA 2A42A 4FK2A 3ZSVA 1KRPA 2NRXA 3MXMA 3HSCA 1WAJA 3SMSA 3D0PA 4KHUA 3G6EN 2P9UB 4A5AA 4CIFA 3H1QA 3C6HA 3EKUA 1VQ7N 3OYKA 3EZWA 1QTMA 3VENA 3V9XA 4FK4A 3PLAA 4K8XA 4CIEA 5F2RA 1D5AA 4RTFD 1RTIA 3EZ5A 5ADXH 3KTQA 5AR0A 1MWKA 1ZC6A 2X74A 3HXMA 4BE1A 4A62A 2HOEA 5C2FA 4FPAA 2HBKA 4FW2A 4OJRA 3CJBA 3ATUA 4ILHA 3U8XA 2VG6A 4OPKA 3AVAA 4ELVA 3WUHA 3RWUA 3VESA 5J2PA 1LCUA 3R9PA 1DGKN 5EOYA 1UAXA 1S1UA 3EEQA 4M7XA 4IOAL 3K5MA 1S9GA 3D2FB 4DHYA 1N33K 2Z1IA 4R5PA 4L8RB 1JLAA 3DM2A 4J2EA 2W41A 5CY4A 3OYCA 1L3VA 1DTTA 4CFCA 1KLMA 4E7KA 1TV6A 2GX9A 4E1NA 5GIPA 3R1XA 3MCPA 1V4SA 3GE1A 4Z4IA 3DYAA 5KPRA 3QO9A 4BRFA 3CQ8A 3V9SA 3IDHA 1SQKA 5LY3A 3PSIA 5FROA 4QAGA 2KLAA 2XRIA 4GVEA 5J2QA 1WAFA 2OZSA 3VEVA 4DV3K 3LPTA 5HRRA 4IDKA 3PV8A 2P9PB 2LSNA 3QFUA 5F0XA 4PKGA 2XY7A 2E88A 1Q81O 5AQSA 3KLEA 3LP1A 3TTCA 4BE2A 1BOTO 4ISFA 3SV4A 5M1PA 1MWMA 3VQCA 1VSEA 3KHYA 3CC2N 4CZFA 2Z1GA 2O8CA 3OS1A 4CJLA 3FZFA 5AQXA 4BR9A 4BRIA 3SMPA 3C7NB 5JVHL 4CF1A 2Z1HA 3L6QA 2ZGZA 4B9LA 4FSVA 3VTIA 2NZTA 1T3VA 3DOKA 3NF6A 4CBUA 1TYQB 1RTDA 5LL6Z 3L2VA 1S1XA 4LH4A 5HRPA 4DSJA 4DG1A 2P9UA 3N4QA 3ZSZA 1NK6A 2I7PA 3FR0A 4IG0A 2IGIA 3SAGA 3O1WA 4B3MK 1QQOA 5HOOA 3K5LA 4UQGA 1HNVA 3CYMA 2OPRA 1L3UA 4EHUA 1MA9B 4I6MB 1K8AO 3NH0A 2FF6A 1UA1A 1BO5O 4O8KA 4BR0A 2F4VK 2P9NB 3VETA 3V9ZA 1IV0A 2ZM6K 1GOBA 1FXXA 3SI6A 4FOEA 2YHYA 4ISGA 4DV4K 1D9DA 4BRPA 3EN9A 1YJNN 3CI5A 2OA8A 1VQKN 3SBTA 4DWIA 1P90A 1WSFA 3D2FA 2DPNA 4PKHA 3PX0A 2D1KA 3CETA 1HKCA 4I9QA 4EP5A 4WF9L 4IBNA 3SAHA 5KPZA 1HQUA 1IJJA 1Q7YO 4OPHA 3SUNA 3ENHA 4E19A 5LJVA 3FZKA 5E26A 5AQZA 3GL1A 4DV0K 5KGWA 3U9ZA 5BPLA 4MO4A 2I5JA 1RFQA 4B3SK 3NF7A 1DLOA 3SLCA 2QWRA 3I55N 3THVA 2HSTA 1VRUA 4H0TB 4JRPA 2A40A 2P9PA 1S1VA 2P9KB 4X66K 1VQ9N 4FJ9A 1YTUA 5IT9O 3A5MC 3A5OC 3RSEB 3AO3A 4GW6A 4M7YA 4CFBA 4RW7A 1YHQN 3DLHA 1U04A 1Z6RA 4YFUA 2E2PA 1KAYA 2ASMA 4B1UB 4MLHA 3KD5E 4CJ5A 4DTPA 4CD1A 2VYPA 2QWLA 5KTQA 1HPMA 3A2FA 1E3MA 4NCAA 1NK0A 1WSEA 2YNGA 1JJ2M 3C7NA 3LP2A 4Z4HA 4I2QA 5AZJB 3BGRA 3ZT4A 4B8AB 2O8EB 1Q8IA 1TYQA 3NVMA 3CFRA 5F1XA 2A1RA 2JWLA 1B9DA 1HMVA 3LL3A 3UKRB 3OJUA 3ZYYX 1EKEA 1JL1A 3BZCA 3KIOA 4N5SA 3C6UA 1VQON 1HX1A 2GV9A 1XHZA 4DLEA 4M42A 4OKEA 3TWHA 5AQVA 1TKTA 3SUOA 5AQHA 3R3LA 1NNEA 1BA0A 4NYFA 1J53A 2OTJN 3H1VX 2HHVA 3SYZA 3FZHA 4I6MA 3DLRA 1S9EA 4M63C 3K57A 3LAKA 3VF4A 4Z4CA 4NO7A 1W7AA 4K0KK 2P9NA 1EQYA 3W0LA 4O8UA 2QW9A 4GNIA 5AZIA 4FJXA 2GWKA 1HYSA 3S9HA 3MEGA 4FWSA 1N34K 1RILA 3AA4A 3V6DA 3I0RA 1XMQK 2P5OA 3CCSN 3I56N 2WUSA 1E4GT 3BP8A 4JNEA 2ZJQL 4Y1DA 2KW4A 3K0SA 3CHWA 2QEXN 1NM1A 4B9TA 3J7YP 3H46O 3OS2A 2VQEK 3ZSRA 1IKWA 3CQXA 3KK7A 4BC3A 1QVFM 1WUAA 4BC5A 3T1YK 4FWMA 4DUZK 4EIAA 1K8KB 2CH5A 3NF9A 4B08A 3VGLA 4GV9A 5BPMA 4JS4A 3VEYA 4AHCA 3SZ2A 1BA1A 4KREA 3EL2A 3TAMA 3PO5A 4A2BA 4GVMA 3AGKA 3HOTA 4W5RA 3CCMN 2NRTA 4DQQA 1NJWA 3ASMA 2YNHA 4BQLA 4FJJA 1S22A 2ASOA 3L3UA 4QS8A 4KHYA 3ZX3A 4IG3A 1ASUA 4KO0A 1FKPA 1ZBFA 1I39A 3O08A 1XC3A 2FBXA 3RSEA 4XIUA 5CHIA 1TK5A 1VSHA 4H0YB 1IO2A 3PY8A 4HWIA 4LFBK 5LMUK 3P39A 4YOYA 4CEDA 1ZBHA 1BWFO 3ZSOA 4KH4A 3O5BA 2XY6A 4C1NK 2V7ZA 3D6RA 4GY2B 4KFBA 2HF3A 3CG7A 1J5EK 5KQ8A 5AZJA 3IRXA 4JI0K 1LAVA 2O8EA 3GOIA 1TL1A 3ISNC 1R59O 3UKRA 3MK6A 3V1OA 1Q9YA 2AJQA 4LSNA 3F5TA 4DS4A 3VQAA 1L3SA 4DU3A 3H3NO 4JN4A 4JK8A 1XMOK 4JKHA 4ELUA 1E4FT 3W3DA 2RPIA 4N56A 1TGOA 3CCJN 5FDLA 4HVJA 4G1QA 3AVFA 1XNQK 4CGHA 1NU0A 4BR5A 4B1ZA 2A5XA 3AA5X 4H0OA 5BPNA 2E1ZA 4IWVA 3KWGA 1X9JA 2NRVA 4BR2A 4CK1A 5AQYA 3OYBA 2Q0UA 1ZYQA 3LP0A 2I7NA 2HNDA 5FPDA 1RDBA 4JI3K 3O9UA 1S1WA 3J8AA 3MXJA 4DV2K 4BQZA 4XH5A 3ZEUA 4AHSA 3FE1A 3CJAA 1QZ6A 3FFIA 1ASWA 1J54A 3VQDA 2OYQA 4DQRA 3ULEA 2G8FA 4FK0A 3LPUA 4HCCA 1T6CA 4I2PA 4BRAA 5BR8K 1K8KA 2WTUA 3MX5A 5KRSA 4YOVA 5M1NA 3GBTA 3VEZA 3TR8A 3U4LA 4X64K 1C1CA 2UYTA 5HBMA 5HRSA 5DM7L 4A2AA 3VMFB 4CGIA 1I3AA 3IKMA 1NK7A 1TUUA 1YVNA 4BG8A 4FLXA 1GLFO 1ZBUA 3PX6A 1HYVA 3B6PA 4JKGB 3UB5A 2RE2A 4DV5K 2QI2A 1NGJA 5C25A 2QXLA 4CK3A 2XO7A 4JRQA 1FJGK 5DMRA 2CGKA 4BGBA 3ENOA 4B1WB 1W0HA 4FWLA 1S3XA 2QWNA 2GWJA 3QEVA 3LDNA 3KK1A 4ZTFA 5C2DA 1HQEA 4G9ZA 3CCQN 3T3FA 1HLUA 2D0CA 4KH6A 5KI6A 4H5VA 3E66A 3EKSA 2G8VA 4EZ6A 4M3ZA 4XH1A 1VK0A 4KTZA 4C8MA 3ATVA 4OGEA 4CIGA 4DTSA 3QNNA 3AA3A 4B1XB 1TL3A 1JLGA 3O9QA 1RBSA 2DFHA 1VAZA 4K41A 3M8SA 5EU7A 2F8TA 4FYDA 1ZBSA 1EETA 5KGXA 4CZKA 3QICA 3QBXA 3TAFA 4PA1A 3PSFA 4FM2A 3FGUA 4IFEA 1C1BA 3NGZA 4FJ8A 1T7PA 1QSSA 4BWJA 4DKWA 3QIOA 2VWJA 1JCFA 1C0UA 3VTHA 1EXQA 3MX2A 5AQGA 1DKGD 5EXWA 3QEWA 4BC4A 2YKMA 4FVMA 2HMIA 1M1KO 2GBZA 3O8MA 4QCLA 4X62K 2PY5A 2ZE2A 4H03B 5AFUA 1O13A 1U47A 1XQSC 2E6LA 2YI1A 4X65K 1KFDA 4NYNA 4TSXA 2YHWA 1TK0A 4RW6A 4BE0A 4CERA 3SV3A 4CJSA 1TAUA 5T7BA 3BEXA 1HNXK 2F8SA 2IOCA 4F3OA 2ZF5O 1HYZA 4CJFA 4H0VB 4BR4A 2A6AA 1RNHA 3RR8A 3SPYA 2Q2RA 2YCHA 1MU2A 1NGHA 3HRGA 3TAGA 4BRCA 1SL1A 2HHHK 4JYAK 1RTHA 1RT7A 1VSDA 3V9UA 2E8AA 3DI6A 4KAZA 2E1YA 3BUZB 1YTAA 4JKGA 4MDAA 3DJCA 4PWDA 1VSIA 1XWLA 3OY9A 3CJ7A 3MN6A 3IAYA 3WQTA 2P1JA 5AQJA 3F9KA 1S6PA 3V9WA 1KQSM 4IFYA 3FZLA 5CYMA 4GV3A 3O3HA 3OJSA 5EX5A 3LM2A 4CEFA 4DFMA 1L3TA 3KZBA 5I9EB 1NOYA 3H6EA 2HBMA 3L2RA 3KWIA 3AVKA 4CJ7A 3HI0A 1C1AA 2DY4A 3TU5A 1NGDA 4FZZA 1YUWA 4EP4A 1Z26A 4IO8A 5AQRA 3VQQA 4JD2B 4DSEA 3QNOA 4BRDA 3RMAA 2X6SA 5TKWA 3CPEA 2ITMA 1KAXA 3ITHA 4I9LA 1ATSA 3AV9A 5AQOA 2FXUA 4LFAK 4N41A 1NK9A 4C8OA 3CCVN 3AVGA 5J1EA 1SL2A 3CCLN 1EP4A 4WFBL 4A5BA 1T8EA 2G8IA 1S6QA 3R8EA 3ZETA 3LANA 3H3OB 4FLWA 1S1TA 1JLBA 3NGYA 5AQIA 4CW7B 4BGAA 4JKDA 3KLHA 3FFKB 1TUYA 3DRPA 4WYBA 2CGLA 4YDUC 3VEWA 3VERA 3QDKA 2FC0A 2UXBK 1NGEA 4FLYA 4NB4A 1Z25A 2UXDK 2ZWHA 3OYNA 4LF8K 1X3NA 1G99A 4PUOA 4FWOA 1JKHA 4FWRA 5AQLA 3VQ4A 4FVUA 4CECA 1RT3A 3C6AA 3RRGA 3VQPA 2V7YA 2Q97A 4LF5K 4CEEA 4U7BA 4KKOA 3RMCA 2RF2A 4DR2K 3V4IA 1XHXA 3E9PA 3KK2A 3SQ1A 2HF4A 5KPTA 1CXUA 3CIPA 4QS7A 1QE1A 3ZX0A 3OBYA 1GLBG 4JKCA 1O1WA 3S41A 4W5TA 4YOUA 4M3XA 1NWKA 2H3GX 1QSYA 4Q0BA 2GUIA 3ZSYA 3QFPA 2VGNA 1BHLA 1Y64A 4OKJA 2X6NA 4FWNA 3TTDA 2OPPA 1KTQA 4FLVA 2V52B 5BN9A 2QWQA 4A61A 3U3YA 4NLBA 4C8NA 1NBWA 1JLEA 1BGXT 1WOQA 4KTWA 2B4JA 1VSMA 3M3ZA 2NRHA 3J7AP 1U4BA 1X1PA 3K59A 1G15A 3AVMA 3D2EB 1LOTB 3UIQA 5AQQA 2E4LA 1KXPA 4WQ5A 4DTJA 3J80O 2W6KA 2AP1A 3HL8A 3OYJA 5HL7L 5IWAK 4CEOA 5JMVA 4FJGA 1UOCA 4CJ4A 1RDWX 4PL7A 4CHPA 4H5NA 4H4MA 3HTVA 4JD2A 2UXCK 1T03A 4C8LA 4WE1A 4EFHA 1GLJO 4JAXA 3WXIA 4F3TA 2O8DB 3QB0A 4AH9A 3TABA 5H1SQ 3LDQA 4CHNA 4FWKA 1TAQA 3ZT1A 1CLQA 3VOVA 2BDPA 4M3TA 1YI2N 3O3GA 1NGIA 3G4SN 4ILGB 1OVQA 1NJZA 4MLEA 2Z1JA 1K73O 3DLEA 2Q3SA 3VQBA 1WNSA 2E2OA 4O0IA 3IUCA 3HOSA 3DXKB 2OPQA 3M8PA 3K5OA 3TAEA 4LFCK 3L2QA 1JLQA 4CJUA 3V81A 2YNIA 1VQMN 2RHKA 4Z4EA 5AQNA 1D4XA 4CHOA 4CZEA 1YJWN 4FWQA 4YOTA 4B1VA 3QIPA 3F2KA 4CEBA 4O55A 4CZIA 5FRNA 4W5QA 2J4RA 4DFPA 4CF9A 3TANA 4XEIA 5EY4A 4C8KA 3KD1E 1VQ8N 1MDUB 4OPJA 4DF4A 3ULDA 3LDLA 3BF1A 3IS9A 1SKSA 3TAQA 1F21A 4DS5A 1NKEA 4FJKA 4CD3A 4FXDA 3ZSWA 1U49A 1YXQA 3THXB 4H4OA 5ADXA 4IO9L 3M8QA 3DLBA 2EWSA 4CJQA 3KLGA 1C0GA 4M3RA 2HNZA 1RBVA 1RT1A 3D2EA 3DMJA 4CZLA 3U3GA 4NCBA 3L0QA 3CPWM 4JK9A 3WXKA 4HCBA 4YY3K 3D45A 2D0BA 4BDYA 3VF2A 1X3MA 3AO1A 1WB9A 3SK3A 1SZ2A 1P8ZA 5B8HA 1C0FA 4Z94A 4FJLA 4C1NI 5JLFA 1NK5A 3M6GA 1ATNA 1VQNN 1I94K 1C0MA 3AVHA 3JS6A 4EAHD 1TKXA 3WNHA 1BL3A 4IOCL 2P9SB 1IKXA 2PFUA 4CGJA 3VPZA 3WXMB 4CFAA 2BH1A 3BZKA 3VGMA 3WT0A 2HMPA 3T69A 3U6FA 1Q9XA 4DR1K 5A2QO 3QINA 2P9KA 4JK7A 4BRQA 3T1AA 3QESA 4F2RA 3CM5A 1JLFA 3AVCA 2NRWA 3KLFA 4BRLA 4UY8O 3BF3A 2ETJA 4CJTA 2KZMA 3MXIA 4JKEA 4HTLA 5GAEP 2IS3A 4Q5VA 1RDAA 4BDZA 4J2DA 1FK9A 3VQ6A 3SCXA 3QETA 4LD0A 1GLCG 5JICA 4AHTA 1IG8A 1L5UA 3PUFA 1A5WA 2W40A 1IBLK 1W9HA 5ELZA 1XUPO 1N36K 3O9SA 4JHDB 4DSIA 2OPSA 4M41A 2HHQA 2GEMA 1U45A 3CM6A 1CZ9A 3K9JA 3AVIA 4DR7K 2R7YA 3OBWA 4RW4A 1S72N 2FSNA 2FSJA 1GOAA 3K9KA 5I42A 4CGGA 3P4IA 4DU1A 1IG9A 3EO3A 4FJNA 2YHBA 4CBXA 4KB1A 4DTUA 3WNEA 3WNGA 3THXA 1YJ9N 2Q31A 3MEEA 2JWKA 3F73A 1JCGA 4B9QA 4IEEA 4DTNA 2GELA 3P83D 4OVLA 4CVNE 3MCAB 1VQ4N 5C0YA 3VEOA 5J2NA 3C95A 1BDGA 1UA0A 4XH4A 1NK4A 4B3TK 1QSLA 1Z05A 5FLXO 3VA0A 4AHUA 3CFOA 4J2AA 4LF7K 4FWPA 1ZBIA 4IXCA 3SJJA 1WSGA 3LWLA 1HKGA 4LY7A 5KRTA 4LF9K 3CJ9A 1REVA 4M45A 3SQ2A 4BVOA 1HR0K 4KHPK 2P9SA 2B6AA 1HKBA 1RBTA 4Y0WA
chains in the Genus database with same CATH topology
1GOBA 1FXXA 2X78A 3L2UA 3JSMA 3V9UA 1U48A 3DI6A 3SI6A 4EZ9A 4KAZA 3S3OA 4FZYA 3NFAA 1KFSA 1YTAA 1D9DA 2KZZA 1WN7A 1VSIA 1XWLA 2QXFA 3NBPA 4CJWA 4HUEA 2OA8A 4PWDA 3OY9A 3OYHA 4CF2A 4FM0A 4DWIA 2XHBA 3IAYA 2P1JA 1WSFA 2DFFA 2G8KA 3F9KA 3AVBA 1S6PA 3K2PA 3V9WA 4E0DA 3OYEA 1RT4A 4IFYA 4O4GA 3QERA 3PX0A 1LWFA 4BACA 1BIZA 5CYMA 3O3HA 4W5NA 3OJSA 2PZSA 4I9QA 1WSHA 4FM1A 4EP5A 4CEFA 3QEXA 2VG5A 4DFMA 1L3TA 3O4NA 4IBNA 1HQUA 4AILC 1N6QA 2IAJA 1ASVA 2HHUA 1NOYA 1NJYA 3SUNA 4FJ5A 4E19A 3L2RA 1RTJA 1LAWA 4AHRA 5HLFA 3AVKA 4QOZB 2XY5A 1C1AA 2BE2A 1VSKA 3OYDA 3ZSXA 3KLIA 5KGWA 1RBUA 2DY4A 4FZZA 2RKIA 4EP4A 2I5JA 1HRHA 1Z26A 3VQQA 3C94A 1DLOA 3NF7A 4DSEA 4LSLA 1ZBLA 5JS1A 3THVA 1VRUA 3QNOA 4JRPA 1SL0A 3K5NA 3RMAA 2X6SA 4DTXA 3C6TA 3LWMA 4IKFA 3ITHA 4I9LA 2HB5A 3PX4A 3DRSA 1YT3A 1RBRA 3AV9A 1S1VA 3NH1A 1YTUA 4FJ9A 3DLHA 4N41A 3NGIA 3AO3A 4GW6A 1NK9A 3AVGA 4RW7A 4CFBA 5J1EA 4C8OA 1U04A 1SL2A 4YFUA 1QS4A 1EP4A 1T8EA 2G8IA 4CHZA 1TKDA 1S6QA 3SQ0A 3QEPA 5CYQA 3LANA 1LWEA 2DFEA 3O3FA 4FLWA 1S1TA 2HHWA 4B9SA 1R0AA 1JLBA 3NGYA 1XC9A 3KD5E 1KVCA 4RW8A 4CJ5A 4E89A 4DTPA 4DFJA 4B9MA 4F4KA 4IFVA 5KTQA 3KLHA 1SUQA 5HROA 1BISA 3DRPA 3A2FA 5HRNA 4ELTA 5DK5A 3OYLA 4NCAA 1NK0A 1WSEA 2YNGA 2FC0A 4M3UA 3M8RA 1JXEA 1C6VA 1JL2A 3LP2A 4I2QA 4Z4HA 4ICLA 3KJVA 4FLYA 2F96A 1Z25A 1N5YA 3BGRA 3OYNA 4DTRA 4DFKA 3ZT4A 4B8AB 5CZ2A 2HW3A 4OLBA 1Q8IA 4FW1A 3CFRA 4PUOA 1K6YA 2A1RA 4KHQA 1JKHA 1B9DA 1HMVA 4GMJB 3OJUA 2KQ2A 1EKEA 1JL1A 1KCFA 4RW9A 2HNYA 3KIOA 3VQ4A 3OYAA 4N5SA 3C6UA 1B92A 4CEZA 3ZT2A 4CECA 4HUGA 1RT3A 4B9NA 1J9AA 4MFBA 5SZTA 3HO1A 3RRGA 3I0SA 2GV9A 3VQPA 4OGCA 4BDPA 1XHZA 4DLEA 1WSJA 4FJMA 4M42A 2ZQBA 4OKEA 3TWHA 4DLGA 1TKTA 1S5JA 3SUOA 4CHQA 4CEEA 1VRTA 4KKOA 3S3MA 3RMCA 2RF2A 2P51A 4NYFA 4KHWA 1J53A 3V4IA 1XHXA 3KK2A 3SQ1A 3E01A 1CXUA 2HHVA 4J2BA 1CZBA 3SYZA 4CE9A 4FJIA 2G8UA 3HPHA 3DLRA 1S9EA 4Y1CA 3K57A 1TKZA 3LAKA 3L2WA 1QE1A 3ZSQA 4Z4CA 3S3NA 4CF0A 5K14A 2P5GA 2EX3A 1O1WA 4W5TA 4DF8A 4M3XA 2KFZA 1JLCA 1QSYA 4Q0BA 2GUIA 3ZSYA 5JS2A 4FJXA 1BHLA 4OKJA 2X6NA 3AVLA 3AO2A 4CK2A 4N47A 2OPPA 4F2SA 3ALYA 1HYSA 1KTQA 2NUBA 1SV5A 2YV0X 3OS0A 4OKKA 3MEGA 2BANA 4FLVA 1RILA 1TVRA 3AA4A 3I0RA 4DSFA 3U3YA 3V6DA 4CCHA 1XI1A 4C8NA 4ZHRA 1SKWA 2ATQA 2P5OA 1GOCA 4O44A 4CJEA 1RT6A 4Y1DA 2KW4A 3ZT0A 1JLEA 4NCGA 1BGXT 4DSKA 3HT3A 4KTWA 1NK8A 2QKKA 2B4JA 1VSMA 2YNFA 4B9TA 3HK2A 3OS2A 1IH7A 1U4BA 4E1MA 3ZSRA 1X1PA 3LALA 1IKWA 4KV8A 3K59A 1NKCA 1G15A 2FBVA 3AVMA 4I7FA 3UIQA 4KHSA 3KKSA 2E4LA 4YNQA 4DTJA 3P1GA 1WLJA 3VQEA 1EX4A 1VSLA 2A1SA 2ZD1A 3V1RA 3JYTA 4E7IA 3RR7A 4KHNA 1ITGA 3HL8A 3NF9A 4RG8A 4B08A 3NAEA 3OYJA 2PYLA 4CEAA 1HNIA 4CEOA 4JS4A 4FJGA 1UOCA 4FZXC 4AHCA 4CJ4A 3OYMA 3SZ2A 1WSIA 2YHAA 1KLNA 4KREA 3TAMA 4CHPA 3PO5A 3HPGA 4KI6A 2IC3A 4H4MA 4GVMA 3QLHA 4W5RA 4DQQA 1T03A 1NJWA 3ASMA 4C8LA 4WE1A 2YNHA 1SKRA 4Z4FA 4B8CA 4FJJA 3EYZA 3K58A 4KHYA 3L3UA 3AO5A 4IG3A 4CGDA 1RT5A 1ASUA 1BQNA 1FKPA 4KO0A 4F3TA 1ZBFA 3LZJA 3AVNA 1I39A 2VG7A 4DQSA 1TK8A 4XIUA 2EHGA 2FBXA 3EY1A 4AH9A 4E3SA 3BDPA 3V1QA 3TABA 1VSFA 5E41A 4JS5A 1BCOA 4FLTA 1TK5A 4M3YA 1VSHA 3DLGA 1IO2A 4CHNA 3PY8A 2HVHA 1TAQA 3ZT1A 2W42A 1CLQA 2JLEA 2BDPA 4M3WA 1Y97A 4M3TA 4CEDA 4CHYA 1LWCA 3O3GA 1NOZA 1ZBHA 3DOLA 3ZSOA 4B9VA 1NJZA 1A5VA 2Z1JA 2KTQA 1BCMA 3DLEA 2Q3SA 2XY6A 5FRMA 3VQBA 4AHVA 3VQ8A 3LAMA 3TI0A 1WNSA 4KFBA 1RCHA 2O4IA 4OLAA 4O0IA 3NH2A 3CG7A 3VA3A 2OPQA 4Z4GA 3AVJA 3M8PA 3NE6A 3K5OA 2YKNA 4LH5A 3TAEA 3KK3A 1T05A 4HUFA 3IRXA 2KFNA 1KVBA 4CF8A 3L2QA 1QQCA 1JLQA 4CJUA 3V81A 1LAVA 2YNIA 4ZTJA 5J2MA 5HP1A 5I3UA 3SUPA 1TL1A 3ISNC 3V1OA 4FLZA 1Q9YA 2AJQA 4LSNA 4Z4EA 4DS4A 4MQ3A 1D8YA 2PYJA 3VQAA 1KVAA 1L3SA 3RMDA 4CHOA 4DU3A 1BQMA 2Y1IA 3RRHA 4DSLA 3HVRA 4CEQA 3HM9A 2HHXA 3QIPA 4CJRA 4ID1A 3LDSA 4CEBA 4O55A 2D5RA 4DQIA 4ELUA 5FRNA 3OYIA 4W5QA 3WNFA 2RPIA 4O5BA 4N56A 4DFPA 4Z0UA 1LV5A 4CF9A 3TANA 2HHTA 1A5XA 1TGOA 3RTVA 3G10A 5FDLA 4CESA 4HVJA 1VSJA 3SNNA 4G1QA 3AVFA 3KKRA 4C8KA 4CGFA 4CGHA 3KD1E 4CFDA 3CFPA 4DTOA 3HP6A 3L3VA 3LP3A 2B5JA 3VQ5A 4OPJA 4DF4A 3ULDA 4E7HA 5D3GA 1B9FA 1BI4B 3IS9A 4HHTA 1NJXA 3PO4A 2QK9A 3AA5X 1SKSA 3I8DA 3TAQA 4NCBA 3SQ4A 1F21A 2DTUA 4DS5A 1NKEA 1J5OA 3L8BA 2IDOA 3OYGA 4K8ZA 4FJKA 4KRFA 4CK1A 3ZSWA 3OYBA 1U49A 4FXDA 4FK2A 1KSPA 1ZYQA 3ZSVA 4H4OA 3LP0A 1KRPA 3MXMA 3HYFA 2HNDA 3M8QA 1RDBA 3DLBA 5C42A 4FCYA 1YVUA 4CJQA 1WAJA 1S1WA 4KHUA 3D0PA 3MXJA 3KLGA 1BIUA 3TAPA 4M3RA 4AHSA 2HNZA 3HVTA 3FFIA 1ASWA 1J54A 1RBVA 3VQDA 1RT1A 3P5JA 4CIFA 2OYQA 4DQRA 3DMJA 3U3GA 2G8FA 1D9FA 3NF8A 4F8RA 4FK0A 3LPUA 3O4QA 3OYKA 4HCCA 2HHSA 4B9UA 1RT2A 3NCIA 3D45A 1QTMA 2D0BA 4BDYA 3V9XA 4I2PA 4HCBA 4FK4A 4B3OA 4K8XA 4CIEA 1D5AA 4W5OA 5KRSA 3AO1A 3ZT3A 1RTIA 3EZ5A 4CJPA 2E6MA 3QEIA 3KTQA 3TR8A 1C1CA 5HBMA 5HRSA 4FJLA 4KTQA 3DLKA 2WOMA 2X74A 3T19A 3HXMA 1NK5A 4BE1A 1LW2A 4KPYA 1C0MA 3AVHA 4CGIA 1I3AA 4FJHA 4CJ3A 1TKXA 1NK7A 3WNHA 1BL3A 1LW0A 1IKXA 2FBTA 4JLHA 2HVIA 4ID5A 4FLXA 4CGJA 3MAQA 4FW2A 1ZBUA 3PX6A 1HYVA 2QKBA 3B6PA 4CFAA 4OJRA 2VG6A 4OPKA 3AVAA 4ELVA 3RWUA 2O4GA 2D0AA 4KI4A 2WONA 5J2PA 3U6FA 2G8WA 5C25A 3IG1A 1UAXA 3B6OA 1S1UA 4FLUA 3MECA 4CK3A 2XO7A 1S9GA 3K5MA 1Q9XA 4BWMA 3QINA 3VN5A 4JRQA 3QESA 3T1AA 5DMRA 4F2RA 4KB0A 3CM5A 2Z1IA 4R5PA 4DU4A 4L8RB 1JLFA 1W0HA 1JLAA 1RDDA 3DM2A 4J2EA 1FKOA 1IKYA 1HJRA 4FJ7A 3HJFA 3AVCA 5CY4A 1QHTA 3OYCA 3KLFA 3QEVA 3KK1A 4ZTFA 1X9SA 1L3VA 1DTTA 4CFCA 1HQEA 2ETJA 4CJTA 1KLMA 2KZMA 4E7KA 3MXIA 3TARA 1TV6A 2BGGA 3T3FA 4DQPA 2D0CA 2IS3A 5KI6A 1RDAA 4E1NA 4Q5VA 1JXBA 3HPOA 1FK9A 4BDZA 4J2DA 4H8KA 1IKVA 3VQ6A 2G8VA 4EZ6A 4M3ZA 4Z4IA 3DYAA 2G8HA 3SCXA 1VK0A 3QO9A 3CQ8A 4LD0A 3V9SA 4KTZA 3QETA 1CXQA 4C8MA 4CIGA 4OGEA 4DTSA 4AHTA 1HPZA 4CJKA 3QNNA 3AA3A 1L5UA 1TL3A 3PUFA 1A5WA 5FROA 1JLGA 1W9HA 4QAGA 2FBYA 5CZ1A 4DSIA 2XRIA 1RBSA 2DFHA 2OPSA 4M41A 1WAFA 5J2QA 2OZSA 2HHQA 3M8SA 3LPTA 5HRRA 4IDKA 3PV8A 5EU7A 1U45A 2F8TA 3CM6A 4FYDA 1DTQA 2LSNA 1CZ9A 3HSTB 1EETA 5KGXA 3AVIA 4N76A 2XY7A 4E7JA 3KLEA 3ZCMA 2Y1JA 3LP1A 2R7YA 4RW4A 3TAFA 4PA1A 1GOAA 4BE2A 4FM2A 4E7LA 5I42A 4CGGA 4FJ8A 1C1BA 3NGZA 3SV4A 4DU1A 4PQUA 1T7PA 3VQCA 1QSSA 4BWJA 1VSEA 3QIOA 2VWJA 1C0UA 1BI4A 1EXQA 2Z1GA 1IG9A 1X9MA 2OZMA 4FJNA 3OS1A 4CJLA 2YHBA 3RMBA 4O0JA 3QEWA 1RDCA 2YKMA 4KB1A 4FVMA 2HMIA 4CJVA 4DTUA 3WNEA 4CF1A 3WNGA 3NDKA 2Z1HA 4DMNA 3AA2A 2GBZA 3MEDA 3MEEA 4B9LA 4QCLA 3LZIA 3F73A 2PY5A 1C0TA 3DOKA 2ZE2A 3HP9A 3NF6A 1X9WA 4DTNA 3P83D 4OVLA 1U47A 1RTDA 3L2VA 1S1XA 1NKBA 4LH4A 5HRPA 2E6LA 4DTMA 4DSJA 1UWBA 3H08A 4DG1A 5J2NA 3C95A 1KFDA 4NYNA 1UA0A 3ZSZA 4TSXA 1NK6A 1TK0A 2ITGA 4RW6A 4BE0A 3SPZA 4IG0A 2IGIA 1NK4A 2VWKA 4HTUA 4CERA 1QSLA 3SV3A 4CJSA 1TAUA 3VA0A 3S9HA 4AHUA 5T7BA 3K5LA 4UQGA 1HNVA 3AO4A 3CYMA 2OPRA 3CFOA 3VQ9A 1L3UA 2IOCA 4J2AA 2F8SA 1ZBIA 4F3OA 1HYZA 4CJFA 4PY5A 3SJJA 2XY8A 3VQ7A 1WSGA 3LWLA 3NH0A 1RNHA 1UA1A 3RR8A 3SPYA 3OVNA 4LY7A 5KRTA 1MU2A 1REVA 4M45A 3SQ2A 5C24A 3V9ZA 3TAGA 1SL1A 3NHGA 3DRRA 2JGUA 3OYFA 3SUQA 5SWMA 2B6AA 3G0ZA 2RN2A 1RTHA 1RBTA 1RT7A 1VSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOB A;  1FXX A;  2X78 A;  3L2U A;  3JSM A;  3V9U A;  1U48 A;  3DI6 A;  3SI6 A;  4EZ9 A;  4KAZ A;  3S3O A;  4FZY A;  3NFA A;  1KFS A;  1YTA A;  1D9D A;  2KZZ A;  1WN7 A;  1VSI A;  1XWL A;  2QXF A;  3NBP A;  4CJW A;  4HUE A;  2OA8 A;  4PWD A;  3OY9 A;  3OYH A;  4CF2 A;  4FM0 A;  4DWI A;  2XHB A;  3IAY A;  2P1J A;  1WSF A;  2DFF A;  2G8K A;  3F9K A;  3AVB A;  1S6P A;  3K2P A;  3V9W A;  4E0D A;  3OYE A;  1RT4 A;  4IFY A;  4O4G A;  3QER A;  3PX0 A;  1LWF A;  4BAC A;  1BIZ A;  5CYM A;  3O3H A;  4W5N A;  3OJS A;  2PZS A;  4I9Q A;  1WSH A;  4FM1 A;  4EP5 A;  4CEF A;  3QEX A;  2VG5 A;  4DFM A;  1L3T A;  3O4N A;  4IBN A;  1HQU A;  4AIL C;  1N6Q A;  2IAJ A;  1ASV A;  2HHU A;  1NOY A;  1NJY A;  3SUN A;  4FJ5 A;  4E19 A;  3L2R A;  1RTJ A;  1LAW A;  4AHR A;  5HLF A;  3AVK A;  4QOZ B;  2XY5 A;  1C1A A;  2BE2 A;  1VSK A;  3OYD A;  3ZSX A;  3KLI A;  5KGW A;  1RBU A;  2DY4 A;  4FZZ A;  2RKI A;  4EP4 A;  2I5J A;  1HRH A;  1Z26 A;  3VQQ A;  3C94 A;  1DLO A;  3NF7 A;  4DSE A;  4LSL A;  1ZBL A;  5JS1 A;  3THV A;  1VRU A;  3QNO A;  4JRP A;  1SL0 A;  3K5N A;  3RMA A;  2X6S A;  4DTX A;  3C6T A;  3LWM A;  4IKF A;  3ITH A;  4I9L A;  2HB5 A;  3PX4 A;  3DRS A;  1YT3 A;  1RBR A;  3AV9 A;  1S1V A;  3NH1 A;  1YTU A;  4FJ9 A;  3DLH A;  4N41 A;  3NGI A;  3AO3 A;  4GW6 A;  1NK9 A;  3AVG A;  4RW7 A;  4CFB A;  5J1E A;  4C8O A;  1U04 A;  1SL2 A;  4YFU A;  1QS4 A;  1EP4 A;  1T8E A;  2G8I A;  4CHZ A;  1TKD A;  1S6Q A;  3SQ0 A;  3QEP A;  5CYQ A;  3LAN A;  1LWE A;  2DFE A;  3O3F A;  4FLW A;  1S1T A;  2HHW A;  4B9S A;  1R0A A;  1JLB A;  3NGY A;  1XC9 A;  3KD5 E;  1KVC A;  4RW8 A;  4CJ5 A;  4E89 A;  4DTP A;  4DFJ A;  4B9M A;  4F4K A;  4IFV A;  5KTQ A;  3KLH A;  1SUQ A;  5HRO A;  1BIS A;  3DRP A;  3A2F A;  5HRN A;  4ELT A;  5DK5 A;  3OYL A;  4NCA A;  1NK0 A;  1WSE A;  2YNG A;  2FC0 A;  4M3U A;  3M8R A;  1JXE A;  1C6V A;  1JL2 A;  3LP2 A;  4I2Q A;  4Z4H A;  4ICL A;  3KJV A;  4FLY A;  2F96 A;  1Z25 A;  1N5Y A;  3BGR A;  3OYN A;  4DTR A;  4DFK A;  3ZT4 A;  4B8A B;  5CZ2 A;  2HW3 A;  4OLB A;  1Q8I A;  4FW1 A;  3CFR A;  4PUO A;  1K6Y A;  2A1R A;  4KHQ A;  1JKH A;  1B9D A;  1HMV A;  4GMJ B;  3OJU A;  2KQ2 A;  1EKE A;  1JL1 A;  1KCF A;  4RW9 A;  2HNY A;  3KIO A;  3VQ4 A;  3OYA A;  4N5S A;  3C6U A;  1B92 A;  4CEZ A;  3ZT2 A;  4CEC A;  4HUG A;  1RT3 A;  4B9N A;  1J9A A;  4MFB A;  5SZT A;  3HO1 A;  3RRG A;  3I0S A;  2GV9 A;  3VQP A;  4OGC A;  4BDP A;  1XHZ A;  4DLE A;  1WSJ A;  4FJM A;  4M42 A;  2ZQB A;  4OKE A;  3TWH A;  4DLG A;  1TKT A;  1S5J A;  3SUO A;  4CHQ A;  4CEE A;  1VRT A;  4KKO A;  3S3M A;  3RMC A;  2RF2 A;  2P51 A;  4NYF A;  4KHW A;  1J53 A;  3V4I A;  1XHX A;  3KK2 A;  3SQ1 A;  3E01 A;  1CXU A;  2HHV A;  4J2B A;  1CZB A;  3SYZ A;  4CE9 A;  4FJI A;  2G8U A;  3HPH A;  3DLR A;  1S9E A;  4Y1C A;  3K57 A;  1TKZ A;  3LAK A;  3L2W A;  1QE1 A;  3ZSQ A;  4Z4C A;  3S3N A;  4CF0 A;  5K14 A;  2P5G A;  2EX3 A;  1O1W A;  4W5T A;  4DF8 A;  4M3X A;  2KFZ A;  1JLC A;  1QSY A;  4Q0B A;  2GUI A;  3ZSY A;  5JS2 A;  4FJX A;  1BHL A;  4OKJ A;  2X6N A;  3AVL A;  3AO2 A;  4CK2 A;  4N47 A;  2OPP A;  4F2S A;  3ALY A;  1HYS A;  1KTQ A;  2NUB A;  1SV5 A;  2YV0 X;  3OS0 A;  4OKK A;  3MEG A;  2BAN A;  4FLV A;  1RIL A;  1TVR A;  3AA4 A;  3I0R A;  4DSF A;  3U3Y A;  3V6D A;  4CCH A;  1XI1 A;  4C8N A;  4ZHR A;  1SKW A;  2ATQ A;  2P5O A;  1GOC A;  4O44 A;  4CJE A;  1RT6 A;  4Y1D A;  2KW4 A;  3ZT0 A;  1JLE A;  4NCG A;  1BGX T;  4DSK A;  3HT3 A;  4KTW A;  1NK8 A;  2QKK A;  2B4J A;  1VSM A;  2YNF A;  4B9T A;  3HK2 A;  3OS2 A;  1IH7 A;  1U4B A;  4E1M A;  3ZSR A;  1X1P A;  3LAL A;  1IKW A;  4KV8 A;  3K59 A;  1NKC A;  1G15 A;  2FBV A;  3AVM A;  4I7F A;  3UIQ A;  4KHS A;  3KKS A;  2E4L A;  4YNQ A;  4DTJ A;  3P1G A;  1WLJ A;  3VQE A;  1EX4 A;  1VSL A;  2A1S A;  2ZD1 A;  3V1R A;  3JYT A;  4E7I A;  3RR7 A;  4KHN A;  1ITG A;  3HL8 A;  3NF9 A;  4RG8 A;  4B08 A;  3NAE A;  3OYJ A;  2PYL A;  4CEA A;  1HNI A;  4CEO A;  4JS4 A;  4FJG A;  1UOC A;  4FZX C;  4AHC A;  4CJ4 A;  3OYM A;  3SZ2 A;  1WSI A;  2YHA A;  1KLN A;  4KRE A;  3TAM A;  4CHP A;  3PO5 A;  3HPG A;  4KI6 A;  2IC3 A;  4H4M A;  4GVM A;  3QLH A;  4W5R A;  4DQQ A;  1T03 A;  1NJW A;  3ASM A;  4C8L A;  4WE1 A;  2YNH A;  1SKR A;  4Z4F A;  4B8C A;  4FJJ A;  3EYZ A;  3K58 A;  4KHY A;  3L3U A;  3AO5 A;  4IG3 A;  4CGD A;  1RT5 A;  1ASU A;  1BQN A;  1FKP A;  4KO0 A;  4F3T A;  1ZBF A;  3LZJ A;  3AVN A;  1I39 A;  2VG7 A;  4DQS A;  1TK8 A;  4XIU A;  2EHG A;  2FBX A;  3EY1 A;  4AH9 A;  4E3S A;  3BDP A;  3V1Q A;  3TAB A;  1VSF A;  5E41 A;  4JS5 A;  1BCO A;  4FLT A;  1TK5 A;  4M3Y A;  1VSH A;  3DLG A;  1IO2 A;  4CHN A;  3PY8 A;  2HVH A;  1TAQ A;  3ZT1 A;  2W42 A;  1CLQ A;  2JLE A;  2BDP A;  4M3W A;  1Y97 A;  4M3T A;  4CED A;  4CHY A;  1LWC A;  3O3G A;  1NOZ A;  1ZBH A;  3DOL A;  3ZSO A;  4B9V A;  1NJZ A;  1A5V A;  2Z1J A;  2KTQ A;  1BCM A;  3DLE A;  2Q3S A;  2XY6 A;  5FRM A;  3VQB A;  4AHV A;  3VQ8 A;  3LAM A;  3TI0 A;  1WNS A;  4KFB A;  1RCH A;  2O4I A;  4OLA A;  4O0I A;  3NH2 A;  3CG7 A;  3VA3 A;  2OPQ A;  4Z4G A;  3AVJ A;  3M8P A;  3NE6 A;  3K5O A;  2YKN A;  4LH5 A;  3TAE A;  3KK3 A;  1T05 A;  4HUF A;  3IRX A;  2KFN A;  1KVB A;  4CF8 A;  3L2Q A;  1QQC A;  1JLQ A;  4CJU A;  3V81 A;  1LAV A;  2YNI A;  4ZTJ A;  5J2M A;  5HP1 A;  5I3U A;  3SUP A;  1TL1 A;  3ISN C;  3V1O A;  4FLZ A;  1Q9Y A;  2AJQ A;  4LSN A;  4Z4E A;  4DS4 A;  4MQ3 A;  1D8Y A;  2PYJ A;  3VQA A;  1KVA A;  1L3S A;  3RMD A;  4CHO A;  4DU3 A;  1BQM A;  2Y1I A;  3RRH A;  4DSL A;  3HVR A;  4CEQ A;  3HM9 A;  2HHX A;  3QIP A;  4CJR A;  4ID1 A;  3LDS A;  4CEB A;  4O55 A;  2D5R A;  4DQI A;  4ELU A;  5FRN A;  3OYI A;  4W5Q A;  3WNF A;  2RPI A;  4O5B A;  4N56 A;  4DFP A;  4Z0U A;  1LV5 A;  4CF9 A;  3TAN A;  2HHT A;  1A5X A;  1TGO A;  3RTV A;  3G10 A;  5FDL A;  4CES A;  4HVJ A;  1VSJ A;  3SNN A;  4G1Q A;  3AVF A;  3KKR A;  4C8K A;  4CGF A;  4CGH A;  3KD1 E;  4CFD A;  3CFP A;  4DTO A;  3HP6 A;  3L3V A;  3LP3 A;  2B5J A;  3VQ5 A;  4OPJ A;  4DF4 A;  3ULD A;  4E7H A;  5D3G A;  1B9F A;  1BI4 B;  3IS9 A;  4HHT A;  1NJX A;  3PO4 A;  2QK9 A;  3AA5 X;  1SKS A;  3I8D A;  3TAQ A;  4NCB A;  3SQ4 A;  1F21 A;  2DTU A;  4DS5 A;  1NKE A;  1J5O A;  3L8B A;  2IDO A;  3OYG A;  4K8Z A;  4FJK A;  4KRF A;  4CK1 A;  3ZSW A;  3OYB A;  1U49 A;  4FXD A;  4FK2 A;  1KSP A;  1ZYQ A;  3ZSV A;  4H4O A;  3LP0 A;  1KRP A;  3MXM A;  3HYF A;  2HND A;  3M8Q A;  1RDB A;  3DLB A;  5C42 A;  4FCY A;  1YVU A;  4CJQ A;  1WAJ A;  1S1W A;  4KHU A;  3D0P A;  3MXJ A;  3KLG A;  1BIU A;  3TAP A;  4M3R A;  4AHS A;  2HNZ A;  3HVT A;  3FFI A;  1ASW A;  1J54 A;  1RBV A;  3VQD A;  1RT1 A;  3P5J A;  4CIF A;  2OYQ A;  4DQR A;  3DMJ A;  3U3G A;  2G8F A;  1D9F A;  3NF8 A;  4F8R A;  4FK0 A;  3LPU A;  3O4Q A;  3OYK A;  4HCC A;  2HHS A;  4B9U A;  1RT2 A;  3NCI A;  3D45 A;  1QTM A;  2D0B A;  4BDY A;  3V9X A;  4I2P A;  4HCB A;  4FK4 A;  4B3O A;  4K8X A;  4CIE A;  1D5A A;  4W5O A;  5KRS A;  3AO1 A;  3ZT3 A;  1RTI A;  3EZ5 A;  4CJP A;  2E6M A;  3QEI A;  3KTQ A;  3TR8 A;  1C1C A;  5HBM A;  5HRS A;  4FJL A;  4KTQ A;  3DLK A;  2WOM A;  2X74 A;  3T19 A;  3HXM A;  1NK5 A;  4BE1 A;  1LW2 A;  4KPY A;  1C0M A;  3AVH A;  4CGI A;  1I3A A;  4FJH A;  4CJ3 A;  1TKX A;  1NK7 A;  3WNH A;  1BL3 A;  1LW0 A;  1IKX A;  2FBT A;  4JLH A;  2HVI A;  4ID5 A;  4FLX A;  4CGJ A;  3MAQ A;  4FW2 A;  1ZBU A;  3PX6 A;  1HYV A;  2QKB A;  3B6P A;  4CFA A;  4OJR A;  2VG6 A;  4OPK A;  3AVA A;  4ELV A;  3RWU A;  2O4G A;  2D0A A;  4KI4 A;  2WON A;  5J2P A;  3U6F A;  2G8W A;  5C25 A;  3IG1 A;  1UAX A;  3B6O A;  1S1U A;  4FLU A;  3MEC A;  4CK3 A;  2XO7 A;  1S9G A;  3K5M A;  1Q9X A;  4BWM A;  3QIN A;  3VN5 A;  4JRQ A;  3QES A;  3T1A A;  5DMR A;  4F2R A;  4KB0 A;  3CM5 A;  2Z1I A;  4R5P A;  4DU4 A;  4L8R B;  1JLF A;  1W0H A;  1JLA A;  1RDD A;  3DM2 A;  4J2E A;  1FKO A;  1IKY A;  1HJR A;  4FJ7 A;  3HJF A;  3AVC A;  5CY4 A;  1QHT A;  3OYC A;  3KLF A;  3QEV A;  3KK1 A;  4ZTF A;  1X9S A;  1L3V A;  1DTT A;  4CFC A;  1HQE A;  2ETJ A;  4CJT A;  1KLM A;  2KZM A;  4E7K A;  3MXI A;  3TAR A;  1TV6 A;  2BGG A;  3T3F A;  4DQP A;  2D0C A;  2IS3 A;  5KI6 A;  1RDA A;  4E1N A;  4Q5V A;  1JXB A;  3HPO A;  1FK9 A;  4BDZ A;  4J2D A;  4H8K A;  1IKV A;  3VQ6 A;  2G8V A;  4EZ6 A;  4M3Z A;  4Z4I A;  3DYA A;  2G8H A;  3SCX A;  1VK0 A;  3QO9 A;  3CQ8 A;  4LD0 A;  3V9S A;  4KTZ A;  3QET A;  1CXQ A;  4C8M A;  4CIG A;  4OGE A;  4DTS A;  4AHT A;  1HPZ A;  4CJK A;  3QNN A;  3AA3 A;  1L5U A;  1TL3 A;  3PUF A;  1A5W A;  5FRO A;  1JLG A;  1W9H A;  4QAG A;  2FBY A;  5CZ1 A;  4DSI A;  2XRI A;  1RBS A;  2DFH A;  2OPS A;  4M41 A;  1WAF A;  5J2Q A;  2OZS A;  2HHQ A;  3M8S A;  3LPT A;  5HRR A;  4IDK A;  3PV8 A;  5EU7 A;  1U45 A;  2F8T A;  3CM6 A;  4FYD A;  1DTQ A;  2LSN A;  1CZ9 A;  3HST B;  1EET A;  5KGX A;  3AVI A;  4N76 A;  2XY7 A;  4E7J A;  3KLE A;  3ZCM A;  2Y1J A;  3LP1 A;  2R7Y A;  4RW4 A;  3TAF A;  4PA1 A;  1GOA A;  4BE2 A;  4FM2 A;  4E7L A;  5I42 A;  4CGG A;  4FJ8 A;  1C1B A;  3NGZ A;  3SV4 A;  4DU1 A;  4PQU A;  1T7P A;  3VQC A;  1QSS A;  4BWJ A;  1VSE A;  3QIO A;  2VWJ A;  1C0U A;  1BI4 A;  1EXQ A;  2Z1G A;  1IG9 A;  1X9M A;  2OZM A;  4FJN A;  3OS1 A;  4CJL A;  2YHB A;  3RMB A;  4O0J A;  3QEW A;  1RDC A;  2YKM A;  4KB1 A;  4FVM A;  2HMI A;  4CJV A;  4DTU A;  3WNE A;  4CF1 A;  3WNG A;  3NDK A;  2Z1H A;  4DMN A;  3AA2 A;  2GBZ A;  3MED A;  3MEE A;  4B9L A;  4QCL A;  3LZI A;  3F73 A;  2PY5 A;  1C0T A;  3DOK A;  2ZE2 A;  3HP9 A;  3NF6 A;  1X9W A;  4DTN A;  3P83 D;  4OVL A;  1U47 A;  1RTD A;  3L2V A;  1S1X A;  1NKB A;  4LH4 A;  5HRP A;  2E6L A;  4DTM A;  4DSJ A;  1UWB A;  3H08 A;  4DG1 A;  5J2N A;  3C95 A;  1KFD A;  4NYN A;  1UA0 A;  3ZSZ A;  4TSX A;  1NK6 A;  1TK0 A;  2ITG A;  4RW6 A;  4BE0 A;  3SPZ A;  4IG0 A;  2IGI A;  1NK4 A;  2VWK A;  4HTU A;  4CER A;  1QSL A;  3SV3 A;  4CJS A;  1TAU A;  3VA0 A;  3S9H A;  4AHU A;  5T7B A;  3K5L A;  4UQG A;  1HNV A;  3AO4 A;  3CYM A;  2OPR A;  3CFO A;  3VQ9 A;  1L3U A;  2IOC A;  4J2A A;  2F8S A;  1ZBI A;  4F3O A;  1HYZ A;  4CJF A;  4PY5 A;  3SJJ A;  2XY8 A;  3VQ7 A;  1WSG A;  3LWL A;  3NH0 A;  1RNH A;  1UA1 A;  3RR8 A;  3SPY A;  3OVN A;  4LY7 A;  5KRT A;  1MU2 A;  1REV A;  4M45 A;  3SQ2 A;  5C24 A;  3V9Z A;  3TAG A;  1SL1 A;  3NHG A;  3DRR A;  2JGU A;  3OYF A;  3SUQ A;  5SWM A;  2B6A A;  3G0Z A;  2RN2 A;  1RTH A;  1RBT A;  1RT7 A;  1VSD A; 
#chains in the Genus database with same CATH topology
 2X78 A;  5M1F A;  4YHH K;  3L2U A;  3JSM A;  3LDP A;  4FZY A;  4YDU A;  3NFA A;  1KFS A;  4IJA A;  2KZZ A;  1WN7 A;  4JI2 K;  2QXF A;  4CJW A;  4HUE A;  3OYH A;  3AY9 A;  4CF2 A;  3UKU B;  1W2B M;  2UUC K;  4DUY K;  2DFF A;  3AVB A;  1OH7 A;  2IVO A;  1GLL O;  3K2P A;  3PIP L;  4E0D A;  4BAC A;  5CR4 A;  4A59 A;  3WEE B;  1ILY A;  2PZS A;  2BUP A;  1WSH A;  3QEX A;  2VG5 A;  3O4N A;  2D4W A;  5BN8 A;  1N6Q A;  4AIL C;  1ASV A;  2P9L B;  4OO1 J;  1RTJ A;  1LAW A;  4FOI A;  4QOZ B;  1HNW K;  4RWT A;  3ZSX A;  1QQN A;  3ZLJ A;  1GLE G;  1T6D A;  3PIO L;  4JI5 K;  2O8B B;  1ZBL A;  2ZJR L;  4DR5 K;  1KC8 O;  4DTX A;  4JHD A;  4CZJ A;  3CME N;  2HB5 A;  3PX4 A;  2O8F B;  3I8B A;  4YOW A;  5AQM A;  1QS4 A;  1Q82 O;  4CHZ A;  1TKD A;  3QEP A;  5CYQ A;  4LF6 K;  2DFE A;  3O3F A;  1J6Z A;  4B9S A;  1WBB A;  1XC9 A;  3F9M A;  4B1Y B;  4E89 A;  4DFJ A;  4B9M A;  4F4K A;  4IFV A;  1SUQ A;  1BIS A;  1YAG A;  1JXE A;  1JL2 A;  3JXU A;  1N5Y A;  4ICL A;  4DTR A;  2NLX A;  4OLB A;  1K6Y A;  4GMJ B;  2VCP A;  4RW9 A;  2HNY A;  3OYA A;  3B8A X;  1B92 A;  2A3Z A;  3ZT2 A;  3HO1 A;  4B9N A;  3UE5 A;  1ESV A;  3I0S A;  4BRE A;  4H5W A;  4NXM K;  1S5J A;  4IZ9 A;  3O80 A;  5BRH A;  2OCE A;  4O5F A;  4KHW A;  3LDO A;  1ATR A;  1CZB A;  3G71 N;  4CE9 A;  4FJI A;  2G8U A;  1TKZ A;  4JI4 K;  3S3N A;  4CF0 A;  5K14 A;  3T7Z A;  1HUX A;  5E84 A;  2EX3 A;  1NG9 A;  4E1J A;  1JLC A;  3MN9 A;  5JS2 A;  4R79 A;  3AO2 A;  4N47 A;  4F2S A;  3ALY A;  3CXC M;  2NUB A;  1X9S A;  1SV5 A;  2BAN A;  1DT9 A;  4DSF A;  4GKK K;  2ATQ A;  1OH5 A;  3UKU A;  4CJE A;  1RT6 A;  2WC9 A;  4JI6 K;  4AF1 A;  2GUP A;  4DSK A;  3HT3 A;  1NK8 A;  2QKK A;  3HK2 A;  2YNF A;  1H1V A;  4E1M A;  3LAL A;  3WEE A;  3FZM A;  4KHS A;  3KKS A;  5BRF A;  1WLJ A;  1T44 A;  4OPA A;  1EX4 A;  2A1S A;  3J81 O;  2P9L A;  2ZD1 A;  4MDB A;  3V1R A;  3JYT A;  5MLC Q;  4FO0 A;  2YX6 A;  3NAE A;  3AAQ A;  1KLN A;  1FW6 A;  3HPG A;  4ISE A;  2O8B A;  3QLH A;  5TKY A;  1OH6 A;  4H5T A;  4DR6 K;  3EYZ A;  3K58 A;  1RT5 A;  2KHO A;  2O8F A;  5AQU A;  2VG7 A;  4DQS A;  2EHG A;  3IMX A;  3EY1 A;  4E3S A;  3BDP A;  2FLO A;  3V1Q A;  3BY5 A;  4BR7 A;  4M3Y A;  1BCO A;  1YF5 L;  1N32 K;  1QQM A;  5GIO A;  3DLG A;  2HVH A;  2E5L K;  4MO5 A;  2JLE A;  4M3W A;  3MMV A;  3R6M A;  3Q7C A;  4KBO A;  1NOZ A;  4DV6 K;  3DOL A;  4CI6 A;  4B9V A;  5AQK A;  3CCE N;  1BCM A;  3TI0 A;  3LAM A;  1BUP A;  2O4I A;  1RCH A;  4OLA A;  4Z4G A;  3AVJ A;  3NE6 A;  3MN5 A;  4JI8 K;  1KVB A;  3EE9 A;  1QQC A;  4ZTJ A;  3DXM B;  5J2M A;  5I3U A;  1IBM K;  3SUP A;  4FLZ A;  5AQW A;  2F9T A;  1D8Y A;  2PYJ A;  3RMD A;  3NMU A;  1RDU A;  2Q1N A;  3E9L A;  1BQM A;  2Y1I A;  3RRH A;  3HVR A;  2HHX A;  3HM9 A;  3HBT A;  4BRN A;  2QWM A;  4CJR A;  4H5R A;  4ID1 A;  4JEP A;  3LDS A;  1Q86 O;  1OH8 A;  3OYI A;  4Z0U A;  2HHT A;  5C10 A;  1A5X A;  3WXL A;  3L4Q A;  1SAZ A;  3RTV A;  3D7E O;  3G10 A;  4CES A;  4AQY K;  1VSJ A;  3SNN A;  1QVG M;  2ASP A;  3HM8 A;  5AQF A;  4CGF A;  3GG4 A;  3WXJ A;  4CFD A;  1IBK K;  4DTO A;  3HP6 A;  3L3V A;  3LP3 A;  2B5J A;  3VQ5 A;  4E7H A;  4JKB A;  1B9F A;  1BI4 B;  1QZ5 A;  3JAM O;  1NJX A;  2QK9 A;  3I8D A;  4DCH A;  1J5O A;  2IDO A;  3OYG A;  4K8Z A;  1KSP A;  3G25 A;  2IIR A;  3HYF A;  3MDQ A;  5C42 A;  4FCY A;  1YVU A;  1N8R O;  3O6W A;  4BVP A;  1VQ6 N;  1NLV A;  2QTD A;  1BIU A;  3TAP A;  1OVY A;  3HVT A;  3THY B;  1HJO A;  4LC9 B;  3P5J A;  4EHT A;  2HBL A;  4F8R A;  1D9F A;  3NF8 A;  3QML A;  3O4Q A;  2UUA K;  2NNW A;  3ZX2 A;  2HHS A;  2CGJ A;  1RT2 A;  3NCI A;  5BRD A;  4B9U A;  3VF6 A;  4B3O A;  2YJE A;  5M1Q A;  2D0O A;  5KQD A;  3CD6 N;  4W5O A;  2QWO A;  3ZT3 A;  3ID8 A;  4CJP A;  2E6M A;  3QEI A;  4QS9 A;  5AZI B;  4KTQ A;  3DLK A;  2WOM A;  3OHR A;  3T19 A;  3J7Z O;  1EWR A;  1LW2 A;  4KPY A;  4FJH A;  4CJ3 A;  2ZGY A;  1LW0 A;  2FBT A;  4JLH A;  2HVI A;  4ID5 A;  4BRO A;  3QBW A;  3MAQ A;  2QKB A;  1BU6 O;  1U6Z A;  4RCH A;  2O4G A;  2D0A A;  4KI4 A;  2WON A;  4J8F A;  2NRR A;  2G8W A;  4BG9 A;  3IG1 A;  4FLU A;  3B6O A;  2HW3 A;  3MEC A;  4BWM A;  3VN5 A;  4WQ4 C;  3P38 A;  4KB0 A;  3CQY A;  4DU4 A;  1RDD A;  4U67 L;  1FKO A;  1IKY A;  1HJR A;  4FJ7 A;  3HJF A;  2IVN A;  1KAZ A;  1QHT A;  3CJ1 A;  4YOX A;  1EWQ A;  4JKF A;  3TAR A;  3ID6 A;  2BGG A;  3CJC A;  4DQP A;  1YIT N;  3HPO A;  1JXB A;  3DXM A;  3C0B A;  1IKV A;  4H8K A;  3A0I X;  4JKA A;  2G8H A;  1CXQ A;  2E20 A;  1HPZ A;  4CJK A;  4JI1 K;  5DM6 L;  3CER A;  4BRH A;  1NGF A;  4ILJ A;  2UU9 K;  4PL8 A;  2FBY A;  5CZ1 A;  2NRZ A;  1WBD A;  3SAF A;  1DTQ A;  3HST B;  4N76 A;  4E7J A;  2Y1J A;  3ZCM A;  3EE8 A;  4E7L A;  2F7T A;  1GLA G;  2BTF A;  4PQU A;  1W97 L;  3HZ6 A;  1BI4 A;  1XNR K;  1X9M A;  2OZM A;  4FL9 A;  5FPN A;  4IDH A;  2HBJ A;  3RMB A;  3OA9 A;  4O0J A;  1RDC A;  4CJV A;  3Q7B A;  3NDK A;  4DMN A;  3AA2 A;  3MED A;  3LZI A;  1C0T A;  3HP9 A;  1X9W A;  4GKJ K;  1NKB A;  2PBD A;  4DTM A;  1UWB A;  3H08 A;  3TSP A;  3THY A;  1Q18 A;  1U2V B;  4CZG A;  2E2Q A;  2ITG A;  3SPZ A;  2VWK A;  4HTU A;  2FF3 B;  1NGA A;  2VWB A;  4AM7 A;  3AO4 A;  1NMD A;  3VQ9 A;  2WBN A;  3KVG A;  3O9T A;  2XY8 A;  3VQ7 A;  3CCU N;  1NGC A;  5CE3 A;  5AFU H;  3OVN A;  4V19 S;  4GV6 A;  5C24 A;  4DR4 K;  2IVP A;  3NHG A;  3DRR A;  4H0X B;  5GAG P;  2JGU A;  3OYF A;  3SUQ A;  5SWM A;  3G0Z A;  2RN2 A;  1ZXO A;  2P5G A;  4JV5 K;  1YIJ N;  4CBW A;  1U48 A;  2FSK A;  4L3Q A;  4EZ9 A;  3S3O A;  1NJI O;  1RGI A;  2P9I B;  3DAW A;  3NBP A;  3ZEU B;  4FM0 A;  4BRG A;  2XHB A;  2OAN A;  2O8D A;  4C23 A;  2G8K A;  3ULE B;  3TTF A;  1M90 O;  5AJ3 K;  3OYE A;  1RT4 A;  4O4G A;  3QER A;  1LWF A;  1BIZ A;  3TPQ A;  3A5L C;  4W5N A;  5JVG L;  3H45 C;  4FM1 A;  3FLC O;  3TSU A;  4F9O A;  3E9O A;  5C12 A;  3LM9 A;  2IAJ A;  2HHU A;  5LJW A;  4IOX A;  1NJY A;  4FJ5 A;  1VQ5 N;  3CMA N;  4AHR A;  5HLF A;  4BY9 C;  2XY5 A;  3DXK A;  2BE2 A;  1VSK A;  3OYD A;  3KLI A;  1RBU A;  1SS6 A;  2RKI A;  5GAH P;  2Q36 A;  3O1B A;  1HRH A;  4DV1 K;  1CZA N;  3C94 A;  5JS1 A;  2QWP A;  4LSL A;  3A8Y A;  1SL0 A;  3K5N A;  4DB3 A;  2OTL N;  3C6T A;  2YHX A;  4CZM A;  3LWM A;  4IKF A;  1KD1 O;  3DRS A;  1YT3 A;  1RBR A;  3NH1 A;  4PY5 A;  2D0P A;  3NGI A;  3WQU A;  4IJN A;  4WCE L;  4K43 A;  3SQ0 A;  2AA4 A;  3C65 A;  4DQ8 A;  4IEI A;  1LWE A;  3OW2 M;  2HHW A;  1R0A A;  1HNZ K;  1KVC A;  4RW8 A;  5HRO A;  3N4P A;  4ELT A;  3O9R A;  5HRN A;  5DK5 A;  3OYL A;  4NXN K;  4M3U A;  3M8R A;  1C6V A;  3KJV A;  3VGK A;  2F96 A;  4DFK A;  3CC7 N;  5FPM A;  5CZ2 A;  4FW1 A;  2PAV A;  4KHQ A;  1V4T A;  2KQ2 A;  1KCF A;  3A5N C;  4CEZ A;  4WQ5 C;  4HUG A;  1J9A A;  4MFB A;  5SZT A;  4OGC A;  1U2V A;  4BDP A;  1WSJ A;  4FJM A;  1EO1 A;  5EVZ A;  2ZQB A;  4YOR A;  4DLG A;  1DEJ A;  1VQL N;  4CHQ A;  1VRT A;  5AQP A;  3S3M A;  2P51 A;  3E01 A;  4J2B A;  3HPH A;  4Y1C A;  5AQT A;  5BR9 A;  3L2W A;  3ZSQ A;  3CC4 N;  5M1O A;  4DF8 A;  3TSQ A;  2KFZ A;  3E1Y A;  5JLH A;  1JCE A;  4H0P A;  3AVL A;  3O4W A;  3THW B;  4CK2 A;  2P9I A;  2YV0 X;  3OS0 A;  1OKJ A;  4OKK A;  1TVR A;  4CCH A;  1XI1 A;  4ZHR A;  1SKW A;  1GOC A;  4O44 A;  3ZT0 A;  4NCG A;  1VQP N;  3I33 A;  5FPE A;  3IFR A;  1IH7 A;  4KV8 A;  1NKC A;  5M1K A;  2FBV A;  4I7F A;  4A57 A;  1QHA A;  2W6L A;  4PHT X;  4YNQ A;  3P1G A;  3VQE A;  2E2N A;  4DR3 K;  1VSL A;  3RR7 A;  3AAP A;  4E7I A;  4KHN A;  4CZH A;  1ITG A;  4RG8 A;  2PYL A;  2QA4 N;  2GTD A;  4CEA A;  1HNI A;  1NMN A;  3MWP A;  4FZX C;  3OYM A;  4AM6 A;  1WSI A;  4DV7 K;  2YHA A;  1NGG A;  2A41 A;  4KI6 A;  2IC3 A;  4K25 A;  2WFB A;  1SKR A;  5BRE A;  4B8C A;  4Z4F A;  3AO5 A;  4CGD A;  1BQN A;  4JI7 K;  3CF5 L;  3LZJ A;  3AVN A;  3M5R A;  2CH6 A;  1TK8 A;  5GAD P;  1VSF A;  5E41 A;  4JS5 A;  4FLT A;  3L4I A;  3CCR N;  4B3R K;  2W42 A;  1Y97 A;  4BRK A;  4CHY A;  1NGB A;  1LWC A;  1VHX A;  4FPB A;  4LF4 K;  1A5V A;  3RVC A;  2KTQ A;  5FRM A;  4AHV A;  3ENB A;  3VQ8 A;  3P31 A;  2Q0R A;  3NH2 A;  3VA3 A;  2YKN A;  4LH5 A;  1T05 A;  3KK3 A;  4HUF A;  2KFN A;  4CF8 A;  2VGM A;  4WFA L;  5HP1 A;  4NLC A;  2F9W A;  2KKZ A;  3M1F A;  4MQ3 A;  5GIN A;  1KVA A;  3T1H K;  2YJF A;  3DLL L;  3VEX A;  3SBG A;  4DSL A;  4CEQ A;  5LMN K;  1K9M O;  1BG3 A;  1GLD G;  2UUB K;  2D5R A;  4DQI A;  3WNF A;  1LV5 A;  4O5B A;  3DWL A;  4BRM A;  3AAR A;  3ZET B;  3U9D A;  4OX9 K;  2V51 B;  4BC2 A;  3SJH A;  2QM1 A;  3KKR A;  3MWT A;  3GDQ A;  3NVK A;  4K42 A;  4WQ4 A;  2VQF K;  3OTO K;  4WFN L;  5C15 A;  3CFP A;  5D3G A;  2ZJP L;  4HHT A;  3PO4 A;  2O8C B;  3THW A;  3AGR A;  3SQ4 A;  2DTU A;  4PKI A;  3MN7 A;  3L8B A;  4KH5 A;  4KRF A;  2A42 A;  4FK2 A;  3ZSV A;  1KRP A;  2NRX A;  3MXM A;  3HSC A;  1WAJ A;  3SMS A;  3D0P A;  4KHU A;  3G6E N;  2P9U B;  4A5A A;  4CIF A;  3H1Q A;  3C6H A;  3EKU A;  1VQ7 N;  3OYK A;  3EZW A;  1QTM A;  3VEN A;  3V9X A;  4FK4 A;  3PLA A;  4K8X A;  4CIE A;  5F2R A;  1D5A A;  4RTF D;  1RTI A;  3EZ5 A;  5ADX H;  3KTQ A;  5AR0 A;  1MWK A;  1ZC6 A;  2X74 A;  3HXM A;  4BE1 A;  4A62 A;  2HOE A;  5C2F A;  4FPA A;  2HBK A;  4FW2 A;  4OJR A;  3CJB A;  3ATU A;  4ILH A;  3U8X A;  2VG6 A;  4OPK A;  3AVA A;  4ELV A;  3WUH A;  3RWU A;  3VES A;  5J2P A;  1LCU A;  3R9P A;  1DGK N;  5EOY A;  1UAX A;  1S1U A;  3EEQ A;  4M7X A;  4IOA L;  3K5M A;  1S9G A;  3D2F B;  4DHY A;  1N33 K;  2Z1I A;  4R5P A;  4L8R B;  1JLA A;  3DM2 A;  4J2E A;  2W41 A;  5CY4 A;  3OYC A;  1L3V A;  1DTT A;  4CFC A;  1KLM A;  4E7K A;  1TV6 A;  2GX9 A;  4E1N A;  5GIP A;  3R1X A;  3MCP A;  1V4S A;  3GE1 A;  4Z4I A;  3DYA A;  5KPR A;  3QO9 A;  4BRF A;  3CQ8 A;  3V9S A;  3IDH A;  1SQK A;  5LY3 A;  3PSI A;  5FRO A;  4QAG A;  2KLA A;  2XRI A;  4GVE A;  5J2Q A;  1WAF A;  2OZS A;  3VEV A;  4DV3 K;  3LPT A;  5HRR A;  4IDK A;  3PV8 A;  2P9P B;  2LSN A;  3QFU A;  5F0X A;  4PKG A;  2XY7 A;  2E88 A;  1Q81 O;  5AQS A;  3KLE A;  3LP1 A;  3TTC A;  4BE2 A;  1BOT O;  4ISF A;  3SV4 A;  5M1P A;  1MWM A;  3VQC A;  1VSE A;  3KHY A;  3CC2 N;  4CZF A;  2Z1G A;  2O8C A;  3OS1 A;  4CJL A;  3FZF A;  5AQX A;  4BR9 A;  4BRI A;  3SMP A;  3C7N B;  5JVH L;  4CF1 A;  2Z1H A;  3L6Q A;  2ZGZ A;  4B9L A;  4FSV A;  3VTI A;  2NZT A;  1T3V A;  3DOK A;  3NF6 A;  4CBU A;  1TYQ B;  1RTD A;  5LL6 Z;  3L2V A;  1S1X A;  4LH4 A;  5HRP A;  4DSJ A;  4DG1 A;  2P9U A;  3N4Q A;  3ZSZ A;  1NK6 A;  2I7P A;  3FR0 A;  4IG0 A;  2IGI A;  3SAG A;  3O1W A;  4B3M K;  1QQO A;  5HOO A;  3K5L A;  4UQG A;  1HNV A;  3CYM A;  2OPR A;  1L3U A;  4EHU A;  1MA9 B;  4I6M B;  1K8A O;  3NH0 A;  2FF6 A;  1UA1 A;  1BO5 O;  4O8K A;  4BR0 A;  2F4V K;  2P9N B;  3VET A;  3V9Z A;  1IV0 A;  2ZM6 K;  1GOB A;  1FXX A;  3SI6 A;  4FOE A;  2YHY A;  4ISG A;  4DV4 K;  1D9D A;  4BRP A;  3EN9 A;  1YJN N;  3CI5 A;  2OA8 A;  1VQK N;  3SBT A;  4DWI A;  1P90 A;  1WSF A;  3D2F A;  2DPN A;  4PKH A;  3PX0 A;  2D1K A;  3CET A;  1HKC A;  4I9Q A;  4EP5 A;  4WF9 L;  4IBN A;  3SAH A;  5KPZ A;  1HQU A;  1IJJ A;  1Q7Y O;  4OPH A;  3SUN A;  3ENH A;  4E19 A;  5LJV A;  3FZK A;  5E26 A;  5AQZ A;  3GL1 A;  4DV0 K;  5KGW A;  3U9Z A;  5BPL A;  4MO4 A;  2I5J A;  1RFQ A;  4B3S K;  3NF7 A;  1DLO A;  3SLC A;  2QWR A;  3I55 N;  3THV A;  2HST A;  1VRU A;  4H0T B;  4JRP A;  2A40 A;  2P9P A;  1S1V A;  2P9K B;  4X66 K;  1VQ9 N;  4FJ9 A;  1YTU A;  5IT9 O;  3A5M C;  3A5O C;  3RSE B;  3AO3 A;  4GW6 A;  4M7Y A;  4CFB A;  4RW7 A;  1YHQ N;  3DLH A;  1U04 A;  1Z6R A;  4YFU A;  2E2P A;  1KAY A;  2ASM A;  4B1U B;  4MLH A;  3KD5 E;  4CJ5 A;  4DTP A;  4CD1 A;  2VYP A;  2QWL A;  5KTQ A;  1HPM A;  3A2F A;  1E3M A;  4NCA A;  1NK0 A;  1WSE A;  2YNG A;  1JJ2 M;  3C7N A;  3LP2 A;  4Z4H A;  4I2Q A;  5AZJ B;  3BGR A;  3ZT4 A;  4B8A B;  2O8E B;  1Q8I A;  1TYQ A;  3NVM A;  3CFR A;  5F1X A;  2A1R A;  2JWL A;  1B9D A;  1HMV A;  3LL3 A;  3UKR B;  3OJU A;  3ZYY X;  1EKE A;  1JL1 A;  3BZC A;  3KIO A;  4N5S A;  3C6U A;  1VQO N;  1HX1 A;  2GV9 A;  1XHZ A;  4DLE A;  4M42 A;  4OKE A;  3TWH A;  5AQV A;  1TKT A;  3SUO A;  5AQH A;  3R3L A;  1NNE A;  1BA0 A;  4NYF A;  1J53 A;  2OTJ N;  3H1V X;  2HHV A;  3SYZ A;  3FZH A;  4I6M A;  3DLR A;  1S9E A;  4M63 C;  3K57 A;  3LAK A;  3VF4 A;  4Z4C A;  4NO7 A;  1W7A A;  4K0K K;  2P9N A;  1EQY A;  3W0L A;  4O8U A;  2QW9 A;  4GNI A;  5AZI A;  4FJX A;  2GWK A;  1HYS A;  3S9H A;  3MEG A;  4FWS A;  1N34 K;  1RIL A;  3AA4 A;  3V6D A;  3I0R A;  1XMQ K;  2P5O A;  3CCS N;  3I56 N;  2WUS A;  1E4G T;  3BP8 A;  4JNE A;  2ZJQ L;  4Y1D A;  2KW4 A;  3K0S A;  3CHW A;  2QEX N;  1NM1 A;  4B9T A;  3J7Y P;  3H46 O;  3OS2 A;  2VQE K;  3ZSR A;  1IKW A;  3CQX A;  3KK7 A;  4BC3 A;  1QVF M;  1WUA A;  4BC5 A;  3T1Y K;  4FWM A;  4DUZ K;  4EIA A;  1K8K B;  2CH5 A;  3NF9 A;  4B08 A;  3VGL A;  4GV9 A;  5BPM A;  4JS4 A;  3VEY A;  4AHC A;  3SZ2 A;  1BA1 A;  4KRE A;  3EL2 A;  3TAM A;  3PO5 A;  4A2B A;  4GVM A;  3AGK A;  3HOT A;  4W5R A;  3CCM N;  2NRT A;  4DQQ A;  1NJW A;  3ASM A;  2YNH A;  4BQL A;  4FJJ A;  1S22 A;  2ASO A;  3L3U A;  4QS8 A;  4KHY A;  3ZX3 A;  4IG3 A;  1ASU A;  4KO0 A;  1FKP A;  1ZBF A;  1I39 A;  3O08 A;  1XC3 A;  2FBX A;  3RSE A;  4XIU A;  5CHI A;  1TK5 A;  1VSH A;  4H0Y B;  1IO2 A;  3PY8 A;  4HWI A;  4LFB K;  5LMU K;  3P39 A;  4YOY A;  4CED A;  1ZBH A;  1BWF O;  3ZSO A;  4KH4 A;  3O5B A;  2XY6 A;  4C1N K;  2V7Z A;  3D6R A;  4GY2 B;  4KFB A;  2HF3 A;  3CG7 A;  1J5E K;  5KQ8 A;  5AZJ A;  3IRX A;  4JI0 K;  1LAV A;  2O8E A;  3GOI A;  1TL1 A;  3ISN C;  1R59 O;  3UKR A;  3MK6 A;  3V1O A;  1Q9Y A;  2AJQ A;  4LSN A;  3F5T A;  4DS4 A;  3VQA A;  1L3S A;  4DU3 A;  3H3N O;  4JN4 A;  4JK8 A;  1XMO K;  4JKH A;  4ELU A;  1E4F T;  3W3D A;  2RPI A;  4N56 A;  1TGO A;  3CCJ N;  5FDL A;  4HVJ A;  4G1Q A;  3AVF A;  1XNQ K;  4CGH A;  1NU0 A;  4BR5 A;  4B1Z A;  2A5X A;  3AA5 X;  4H0O A;  5BPN A;  2E1Z A;  4IWV A;  3KWG A;  1X9J A;  2NRV A;  4BR2 A;  4CK1 A;  5AQY A;  3OYB A;  2Q0U A;  1ZYQ A;  3LP0 A;  2I7N A;  2HND A;  5FPD A;  1RDB A;  4JI3 K;  3O9U A;  1S1W A;  3J8A A;  3MXJ A;  4DV2 K;  4BQZ A;  4XH5 A;  3ZEU A;  4AHS A;  3FE1 A;  3CJA A;  1QZ6 A;  3FFI A;  1ASW A;  1J54 A;  3VQD A;  2OYQ A;  4DQR A;  3ULE A;  2G8F A;  4FK0 A;  3LPU A;  4HCC A;  1T6C A;  4I2P A;  4BRA A;  5BR8 K;  1K8K A;  2WTU A;  3MX5 A;  5KRS A;  4YOV A;  5M1N A;  3GBT A;  3VEZ A;  3TR8 A;  3U4L A;  4X64 K;  1C1C A;  2UYT A;  5HBM A;  5HRS A;  5DM7 L;  4A2A A;  3VMF B;  4CGI A;  1I3A A;  3IKM A;  1NK7 A;  1TUU A;  1YVN A;  4BG8 A;  4FLX A;  1GLF O;  1ZBU A;  3PX6 A;  1HYV A;  3B6P A;  4JKG B;  3UB5 A;  2RE2 A;  4DV5 K;  2QI2 A;  1NGJ A;  5C25 A;  2QXL A;  4CK3 A;  2XO7 A;  4JRQ A;  1FJG K;  5DMR A;  2CGK A;  4BGB A;  3ENO A;  4B1W B;  1W0H A;  4FWL A;  1S3X A;  2QWN A;  2GWJ A;  3QEV A;  3LDN A;  3KK1 A;  4ZTF A;  5C2D A;  1HQE A;  4G9Z A;  3CCQ N;  3T3F A;  1HLU A;  2D0C A;  4KH6 A;  5KI6 A;  4H5V A;  3E66 A;  3EKS A;  2G8V A;  4EZ6 A;  4M3Z A;  4XH1 A;  1VK0 A;  4KTZ A;  4C8M A;  3ATV A;  4OGE A;  4CIG A;  4DTS A;  3QNN A;  3AA3 A;  4B1X B;  1TL3 A;  1JLG A;  3O9Q A;  1RBS A;  2DFH A;  1VAZ A;  4K41 A;  3M8S A;  5EU7 A;  2F8T A;  4FYD A;  1ZBS A;  1EET A;  5KGX A;  4CZK A;  3QIC A;  3QBX A;  3TAF A;  4PA1 A;  3PSF A;  4FM2 A;  3FGU A;  4IFE A;  1C1B A;  3NGZ A;  4FJ8 A;  1T7P A;  1QSS A;  4BWJ A;  4DKW A;  3QIO A;  2VWJ A;  1JCF A;  1C0U A;  3VTH A;  1EXQ A;  3MX2 A;  5AQG A;  1DKG D;  5EXW A;  3QEW A;  4BC4 A;  2YKM A;  4FVM A;  2HMI A;  1M1K O;  2GBZ A;  3O8M A;  4QCL A;  4X62 K;  2PY5 A;  2ZE2 A;  4H03 B;  5AFU A;  1O13 A;  1U47 A;  1XQS C;  2E6L A;  2YI1 A;  4X65 K;  1KFD A;  4NYN A;  4TSX A;  2YHW A;  1TK0 A;  4RW6 A;  4BE0 A;  4CER A;  3SV3 A;  4CJS A;  1TAU A;  5T7B A;  3BEX A;  1HNX K;  2F8S A;  2IOC A;  4F3O A;  2ZF5 O;  1HYZ A;  4CJF A;  4H0V B;  4BR4 A;  2A6A A;  1RNH A;  3RR8 A;  3SPY A;  2Q2R A;  2YCH A;  1MU2 A;  1NGH A;  3HRG A;  3TAG A;  4BRC A;  1SL1 A;  2HHH K;  4JYA K;  1RTH A;  1RT7 A;  1VSD A;  3V9U A;  2E8A A;  3DI6 A;  4KAZ A;  2E1Y A;  3BUZ B;  1YTA A;  4JKG A;  4MDA A;  3DJC A;  4PWD A;  1VSI A;  1XWL A;  3OY9 A;  3CJ7 A;  3MN6 A;  3IAY A;  3WQT A;  2P1J A;  5AQJ A;  3F9K A;  1S6P A;  3V9W A;  1KQS M;  4IFY A;  3FZL A;  5CYM A;  4GV3 A;  3O3H A;  3OJS A;  5EX5 A;  3LM2 A;  4CEF A;  4DFM A;  1L3T A;  3KZB A;  5I9E B;  1NOY A;  3H6E A;  2HBM A;  3L2R A;  3KWI A;  3AVK A;  4CJ7 A;  3HI0 A;  1C1A A;  2DY4 A;  3TU5 A;  1NGD A;  4FZZ A;  1YUW A;  4EP4 A;  1Z26 A;  4IO8 A;  5AQR A;  3VQQ A;  4JD2 B;  4DSE A;  3QNO A;  4BRD A;  3RMA A;  2X6S A;  5TKW A;  3CPE A;  2ITM A;  1KAX A;  3ITH A;  4I9L A;  1ATS A;  3AV9 A;  5AQO A;  2FXU A;  4LFA K;  4N41 A;  1NK9 A;  4C8O A;  3CCV N;  3AVG A;  5J1E A;  1SL2 A;  3CCL N;  1EP4 A;  4WFB L;  4A5B A;  1T8E A;  2G8I A;  1S6Q A;  3R8E A;  3ZET A;  3LAN A;  3H3O B;  4FLW A;  1S1T A;  1JLB A;  3NGY A;  5AQI A;  4CW7 B;  4BGA A;  4JKD A;  3KLH A;  3FFK B;  1TUY A;  3DRP A;  4WYB A;  2CGL A;  4YDU C;  3VEW A;  3VER A;  3QDK A;  2FC0 A;  2UXB K;  1NGE A;  4FLY A;  4NB4 A;  1Z25 A;  2UXD K;  2ZWH A;  3OYN A;  4LF8 K;  1X3N A;  1G99 A;  4PUO A;  4FWO A;  1JKH A;  4FWR A;  5AQL A;  3VQ4 A;  4FVU A;  4CEC A;  1RT3 A;  3C6A A;  3RRG A;  3VQP A;  2V7Y A;  2Q97 A;  4LF5 K;  4CEE A;  4U7B A;  4KKO A;  3RMC A;  2RF2 A;  4DR2 K;  3V4I A;  1XHX A;  3E9P A;  3KK2 A;  3SQ1 A;  2HF4 A;  5KPT A;  1CXU A;  3CIP A;  4QS7 A;  1QE1 A;  3ZX0 A;  3OBY A;  1GLB G;  4JKC A;  1O1W A;  3S41 A;  4W5T A;  4YOU A;  4M3X A;  1NWK A;  2H3G X;  1QSY A;  4Q0B A;  2GUI A;  3ZSY A;  3QFP A;  2VGN A;  1BHL A;  1Y64 A;  4OKJ A;  2X6N A;  4FWN A;  3TTD A;  2OPP A;  1KTQ A;  4FLV A;  2V52 B;  5BN9 A;  2QWQ A;  4A61 A;  3U3Y A;  4NLB A;  4C8N A;  1NBW A;  1JLE A;  1BGX T;  1WOQ A;  4KTW A;  2B4J A;  1VSM A;  3M3Z A;  2NRH A;  3J7A P;  1U4B A;  1X1P A;  3K59 A;  1G15 A;  3AVM A;  3D2E B;  1LOT B;  3UIQ A;  5AQQ A;  2E4L A;  1KXP A;  4WQ5 A;  4DTJ A;  3J80 O;  2W6K A;  2AP1 A;  3HL8 A;  3OYJ A;  5HL7 L;  5IWA K;  4CEO A;  5JMV A;  4FJG A;  1UOC A;  4CJ4 A;  1RDW X;  4PL7 A;  4CHP A;  4H5N A;  4H4M A;  3HTV A;  4JD2 A;  2UXC K;  1T03 A;  4C8L A;  4WE1 A;  4EFH A;  1GLJ O;  4JAX A;  3WXI A;  4F3T A;  2O8D B;  3QB0 A;  4AH9 A;  3TAB A;  5H1S Q;  3LDQ A;  4CHN A;  4FWK A;  1TAQ A;  3ZT1 A;  1CLQ A;  3VOV A;  2BDP A;  4M3T A;  1YI2 N;  3O3G A;  1NGI A;  3G4S N;  4ILG B;  1OVQ A;  1NJZ A;  4MLE A;  2Z1J A;  1K73 O;  3DLE A;  2Q3S A;  3VQB A;  1WNS A;  2E2O A;  4O0I A;  3IUC A;  3HOS A;  3DXK B;  2OPQ A;  3M8P A;  3K5O A;  3TAE A;  4LFC K;  3L2Q A;  1JLQ A;  4CJU A;  3V81 A;  2YNI A;  1VQM N;  2RHK A;  4Z4E A;  5AQN A;  1D4X A;  4CHO A;  4CZE A;  1YJW N;  4FWQ A;  4YOT A;  4B1V A;  3QIP A;  3F2K A;  4CEB A;  4O55 A;  4CZI A;  5FRN A;  4W5Q A;  2J4R A;  4DFP A;  4CF9 A;  3TAN A;  4XEI A;  5EY4 A;  4C8K A;  3KD1 E;  1VQ8 N;  1MDU B;  4OPJ A;  4DF4 A;  3ULD A;  3LDL A;  3BF1 A;  3IS9 A;  1SKS A;  3TAQ A;  1F21 A;  4DS5 A;  1NKE A;  4FJK A;  4CD3 A;  4FXD A;  3ZSW A;  1U49 A;  1YXQ A;  3THX B;  4H4O A;  5ADX A;  4IO9 L;  3M8Q A;  3DLB A;  2EWS A;  4CJQ A;  3KLG A;  1C0G A;  4M3R A;  2HNZ A;  1RBV A;  1RT1 A;  3D2E A;  3DMJ A;  4CZL A;  3U3G A;  4NCB A;  3L0Q A;  3CPW M;  4JK9 A;  3WXK A;  4HCB A;  4YY3 K;  3D45 A;  2D0B A;  4BDY A;  3VF2 A;  1X3M A;  3AO1 A;  1WB9 A;  3SK3 A;  1SZ2 A;  1P8Z A;  5B8H A;  1C0F A;  4Z94 A;  4FJL A;  4C1N I;  5JLF A;  1NK5 A;  3M6G A;  1ATN A;  1VQN N;  1I94 K;  1C0M A;  3AVH A;  3JS6 A;  4EAH D;  1TKX A;  3WNH A;  1BL3 A;  4IOC L;  2P9S B;  1IKX A;  2PFU A;  4CGJ A;  3VPZ A;  3WXM B;  4CFA A;  2BH1 A;  3BZK A;  3VGM A;  3WT0 A;  2HMP A;  3T69 A;  3U6F A;  1Q9X A;  4DR1 K;  5A2Q O;  3QIN A;  2P9K A;  4JK7 A;  4BRQ A;  3T1A A;  3QES A;  4F2R A;  3CM5 A;  1JLF A;  3AVC A;  2NRW A;  3KLF A;  4BRL A;  4UY8 O;  3BF3 A;  2ETJ A;  4CJT A;  2KZM A;  3MXI A;  4JKE A;  4HTL A;  5GAE P;  2IS3 A;  4Q5V A;  1RDA A;  4BDZ A;  4J2D A;  1FK9 A;  3VQ6 A;  3SCX A;  3QET A;  4LD0 A;  1GLC G;  5JIC A;  4AHT A;  1IG8 A;  1L5U A;  3PUF A;  1A5W A;  2W40 A;  1IBL K;  1W9H A;  5ELZ A;  1XUP O;  1N36 K;  3O9S A;  4JHD B;  4DSI A;  2OPS A;  4M41 A;  2HHQ A;  2GEM A;  1U45 A;  3CM6 A;  1CZ9 A;  3K9J A;  3AVI A;  4DR7 K;  2R7Y A;  3OBW A;  4RW4 A;  1S72 N;  2FSN A;  2FSJ A;  1GOA A;  3K9K A;  5I42 A;  4CGG A;  3P4I A;  4DU1 A;  1IG9 A;  3EO3 A;  4FJN A;  2YHB A;  4CBX A;  4KB1 A;  4DTU A;  3WNE A;  3WNG A;  3THX A;  1YJ9 N;  2Q31 A;  3MEE A;  2JWK A;  3F73 A;  1JCG A;  4B9Q A;  4IEE A;  4DTN A;  2GEL A;  3P83 D;  4OVL A;  4CVN E;  3MCA B;  1VQ4 N;  5C0Y A;  3VEO A;  5J2N A;  3C95 A;  1BDG A;  1UA0 A;  4XH4 A;  1NK4 A;  4B3T K;  1QSL A;  1Z05 A;  5FLX O;  3VA0 A;  4AHU A;  3CFO A;  4J2A A;  4LF7 K;  4FWP A;  1ZBI A;  4IXC A;  3SJJ A;  1WSG A;  3LWL A;  1HKG A;  4LY7 A;  5KRT A;  4LF9 K;  3CJ9 A;  1REV A;  4M45 A;  3SQ2 A;  4BVO A;  1HR0 K;  4KHP K;  2P9S A;  2B6A A;  1HKB A;  1RBT A;  4Y0W A; 
#chains in the Genus database with same CATH homology
 1GOB A;  1FXX A;  2X78 A;  3L2U A;  3JSM A;  3V9U A;  1U48 A;  3DI6 A;  3SI6 A;  4EZ9 A;  4KAZ A;  3S3O A;  4FZY A;  3NFA A;  1KFS A;  1YTA A;  1D9D A;  2KZZ A;  1WN7 A;  1VSI A;  1XWL A;  2QXF A;  3NBP A;  4CJW A;  4HUE A;  2OA8 A;  4PWD A;  3OY9 A;  3OYH A;  4CF2 A;  4FM0 A;  4DWI A;  2XHB A;  3IAY A;  2P1J A;  1WSF A;  2DFF A;  2G8K A;  3F9K A;  3AVB A;  1S6P A;  3K2P A;  3V9W A;  4E0D A;  3OYE A;  1RT4 A;  4IFY A;  4O4G A;  3QER A;  3PX0 A;  1LWF A;  4BAC A;  1BIZ A;  5CYM A;  3O3H A;  4W5N A;  3OJS A;  2PZS A;  4I9Q A;  1WSH A;  4FM1 A;  4EP5 A;  4CEF A;  3QEX A;  2VG5 A;  4DFM A;  1L3T A;  3O4N A;  4IBN A;  1HQU A;  4AIL C;  1N6Q A;  2IAJ A;  1ASV A;  2HHU A;  1NOY A;  1NJY A;  3SUN A;  4FJ5 A;  4E19 A;  3L2R A;  1RTJ A;  1LAW A;  4AHR A;  5HLF A;  3AVK A;  4QOZ B;  2XY5 A;  1C1A A;  2BE2 A;  1VSK A;  3OYD A;  3ZSX A;  3KLI A;  5KGW A;  1RBU A;  2DY4 A;  4FZZ A;  2RKI A;  4EP4 A;  2I5J A;  1HRH A;  1Z26 A;  3VQQ A;  3C94 A;  1DLO A;  3NF7 A;  4DSE A;  4LSL A;  1ZBL A;  5JS1 A;  3THV A;  1VRU A;  3QNO A;  4JRP A;  1SL0 A;  3K5N A;  3RMA A;  2X6S A;  4DTX A;  3C6T A;  3LWM A;  4IKF A;  3ITH A;  4I9L A;  2HB5 A;  3PX4 A;  3DRS A;  1YT3 A;  1RBR A;  3AV9 A;  1S1V A;  3NH1 A;  1YTU A;  4FJ9 A;  3DLH A;  4N41 A;  3NGI A;  3AO3 A;  4GW6 A;  1NK9 A;  3AVG A;  4RW7 A;  4CFB A;  5J1E A;  4C8O A;  1U04 A;  1SL2 A;  4YFU A;  1QS4 A;  1EP4 A;  1T8E A;  2G8I A;  4CHZ A;  1TKD A;  1S6Q A;  3SQ0 A;  3QEP A;  5CYQ A;  3LAN A;  1LWE A;  2DFE A;  3O3F A;  4FLW A;  1S1T A;  2HHW A;  4B9S A;  1R0A A;  1JLB A;  3NGY A;  1XC9 A;  3KD5 E;  1KVC A;  4RW8 A;  4CJ5 A;  4E89 A;  4DTP A;  4DFJ A;  4B9M A;  4F4K A;  4IFV A;  5KTQ A;  3KLH A;  1SUQ A;  5HRO A;  1BIS A;  3DRP A;  3A2F A;  5HRN A;  4ELT A;  5DK5 A;  3OYL A;  4NCA A;  1NK0 A;  1WSE A;  2YNG A;  2FC0 A;  4M3U A;  3M8R A;  1JXE A;  1C6V A;  1JL2 A;  3LP2 A;  4I2Q A;  4Z4H A;  4ICL A;  3KJV A;  4FLY A;  2F96 A;  1Z25 A;  1N5Y A;  3BGR A;  3OYN A;  4DTR A;  4DFK A;  3ZT4 A;  4B8A B;  5CZ2 A;  2HW3 A;  4OLB A;  1Q8I A;  4FW1 A;  3CFR A;  4PUO A;  1K6Y A;  2A1R A;  4KHQ A;  1JKH A;  1B9D A;  1HMV A;  4GMJ B;  3OJU A;  2KQ2 A;  1EKE A;  1JL1 A;  1KCF A;  4RW9 A;  2HNY A;  3KIO A;  3VQ4 A;  3OYA A;  4N5S A;  3C6U A;  1B92 A;  4CEZ A;  3ZT2 A;  4CEC A;  4HUG A;  1RT3 A;  4B9N A;  1J9A A;  4MFB A;  5SZT A;  3HO1 A;  3RRG A;  3I0S A;  2GV9 A;  3VQP A;  4OGC A;  4BDP A;  1XHZ A;  4DLE A;  1WSJ A;  4FJM A;  4M42 A;  2ZQB A;  4OKE A;  3TWH A;  4DLG A;  1TKT A;  1S5J A;  3SUO A;  4CHQ A;  4CEE A;  1VRT A;  4KKO A;  3S3M A;  3RMC A;  2RF2 A;  2P51 A;  4NYF A;  4KHW A;  1J53 A;  3V4I A;  1XHX A;  3KK2 A;  3SQ1 A;  3E01 A;  1CXU A;  2HHV A;  4J2B A;  1CZB A;  3SYZ A;  4CE9 A;  4FJI A;  2G8U A;  3HPH A;  3DLR A;  1S9E A;  4Y1C A;  3K57 A;  1TKZ A;  3LAK A;  3L2W A;  1QE1 A;  3ZSQ A;  4Z4C A;  3S3N A;  4CF0 A;  5K14 A;  2P5G A;  2EX3 A;  1O1W A;  4W5T A;  4DF8 A;  4M3X A;  2KFZ A;  1JLC A;  1QSY A;  4Q0B A;  2GUI A;  3ZSY A;  5JS2 A;  4FJX A;  1BHL A;  4OKJ A;  2X6N A;  3AVL A;  3AO2 A;  4CK2 A;  4N47 A;  2OPP A;  4F2S A;  3ALY A;  1HYS A;  1KTQ A;  2NUB A;  1SV5 A;  2YV0 X;  3OS0 A;  4OKK A;  3MEG A;  2BAN A;  4FLV A;  1RIL A;  1TVR A;  3AA4 A;  3I0R A;  4DSF A;  3U3Y A;  3V6D A;  4CCH A;  1XI1 A;  4C8N A;  4ZHR A;  1SKW A;  2ATQ A;  2P5O A;  1GOC A;  4O44 A;  4CJE A;  1RT6 A;  4Y1D A;  2KW4 A;  3ZT0 A;  1JLE A;  4NCG A;  1BGX T;  4DSK A;  3HT3 A;  4KTW A;  1NK8 A;  2QKK A;  2B4J A;  1VSM A;  2YNF A;  4B9T A;  3HK2 A;  3OS2 A;  1IH7 A;  1U4B A;  4E1M A;  3ZSR A;  1X1P A;  3LAL A;  1IKW A;  4KV8 A;  3K59 A;  1NKC A;  1G15 A;  2FBV A;  3AVM A;  4I7F A;  3UIQ A;  4KHS A;  3KKS A;  2E4L A;  4YNQ A;  4DTJ A;  3P1G A;  1WLJ A;  3VQE A;  1EX4 A;  1VSL A;  2A1S A;  2ZD1 A;  3V1R A;  3JYT A;  4E7I A;  3RR7 A;  4KHN A;  1ITG A;  3HL8 A;  3NF9 A;  4RG8 A;  4B08 A;  3NAE A;  3OYJ A;  2PYL A;  4CEA A;  1HNI A;  4CEO A;  4JS4 A;  4FJG A;  1UOC A;  4FZX C;  4AHC A;  4CJ4 A;  3OYM A;  3SZ2 A;  1WSI A;  2YHA A;  1KLN A;  4KRE A;  3TAM A;  4CHP A;  3PO5 A;  3HPG A;  4KI6 A;  2IC3 A;  4H4M A;  4GVM A;  3QLH A;  4W5R A;  4DQQ A;  1T03 A;  1NJW A;  3ASM A;  4C8L A;  4WE1 A;  2YNH A;  1SKR A;  4Z4F A;  4B8C A;  4FJJ A;  3EYZ A;  3K58 A;  4KHY A;  3L3U A;  3AO5 A;  4IG3 A;  4CGD A;  1RT5 A;  1ASU A;  1BQN A;  1FKP A;  4KO0 A;  4F3T A;  1ZBF A;  3LZJ A;  3AVN A;  1I39 A;  2VG7 A;  4DQS A;  1TK8 A;  4XIU A;  2EHG A;  2FBX A;  3EY1 A;  4AH9 A;  4E3S A;  3BDP A;  3V1Q A;  3TAB A;  1VSF A;  5E41 A;  4JS5 A;  1BCO A;  4FLT A;  1TK5 A;  4M3Y A;  1VSH A;  3DLG A;  1IO2 A;  4CHN A;  3PY8 A;  2HVH A;  1TAQ A;  3ZT1 A;  2W42 A;  1CLQ A;  2JLE A;  2BDP A;  4M3W A;  1Y97 A;  4M3T A;  4CED A;  4CHY A;  1LWC A;  3O3G A;  1NOZ A;  1ZBH A;  3DOL A;  3ZSO A;  4B9V A;  1NJZ A;  1A5V A;  2Z1J A;  2KTQ A;  1BCM A;  3DLE A;  2Q3S A;  2XY6 A;  5FRM A;  3VQB A;  4AHV A;  3VQ8 A;  3LAM A;  3TI0 A;  1WNS A;  4KFB A;  1RCH A;  2O4I A;  4OLA A;  4O0I A;  3NH2 A;  3CG7 A;  3VA3 A;  2OPQ A;  4Z4G A;  3AVJ A;  3M8P A;  3NE6 A;  3K5O A;  2YKN A;  4LH5 A;  3TAE A;  3KK3 A;  1T05 A;  4HUF A;  3IRX A;  2KFN A;  1KVB A;  4CF8 A;  3L2Q A;  1QQC A;  1JLQ A;  4CJU A;  3V81 A;  1LAV A;  2YNI A;  4ZTJ A;  5J2M A;  5HP1 A;  5I3U A;  3SUP A;  1TL1 A;  3ISN C;  3V1O A;  4FLZ A;  1Q9Y A;  2AJQ A;  4LSN A;  4Z4E A;  4DS4 A;  4MQ3 A;  1D8Y A;  2PYJ A;  3VQA A;  1KVA A;  1L3S A;  3RMD A;  4CHO A;  4DU3 A;  1BQM A;  2Y1I A;  3RRH A;  4DSL A;  3HVR A;  4CEQ A;  3HM9 A;  2HHX A;  3QIP A;  4CJR A;  4ID1 A;  3LDS A;  4CEB A;  4O55 A;  2D5R A;  4DQI A;  4ELU A;  5FRN A;  3OYI A;  4W5Q A;  3WNF A;  2RPI A;  4O5B A;  4N56 A;  4DFP A;  4Z0U A;  1LV5 A;  4CF9 A;  3TAN A;  2HHT A;  1A5X A;  1TGO A;  3RTV A;  3G10 A;  5FDL A;  4CES A;  4HVJ A;  1VSJ A;  3SNN A;  4G1Q A;  3AVF A;  3KKR A;  4C8K A;  4CGF A;  4CGH A;  3KD1 E;  4CFD A;  3CFP A;  4DTO A;  3HP6 A;  3L3V A;  3LP3 A;  2B5J A;  3VQ5 A;  4OPJ A;  4DF4 A;  3ULD A;  4E7H A;  5D3G A;  1B9F A;  1BI4 B;  3IS9 A;  4HHT A;  1NJX A;  3PO4 A;  2QK9 A;  3AA5 X;  1SKS A;  3I8D A;  3TAQ A;  4NCB A;  3SQ4 A;  1F21 A;  2DTU A;  4DS5 A;  1NKE A;  1J5O A;  3L8B A;  2IDO A;  3OYG A;  4K8Z A;  4FJK A;  4KRF A;  4CK1 A;  3ZSW A;  3OYB A;  1U49 A;  4FXD A;  4FK2 A;  1KSP A;  1ZYQ A;  3ZSV A;  4H4O A;  3LP0 A;  1KRP A;  3MXM A;  3HYF A;  2HND A;  3M8Q A;  1RDB A;  3DLB A;  5C42 A;  4FCY A;  1YVU A;  4CJQ A;  1WAJ A;  1S1W A;  4KHU A;  3D0P A;  3MXJ A;  3KLG A;  1BIU A;  3TAP A;  4M3R A;  4AHS A;  2HNZ A;  3HVT A;  3FFI A;  1ASW A;  1J54 A;  1RBV A;  3VQD A;  1RT1 A;  3P5J A;  4CIF A;  2OYQ A;  4DQR A;  3DMJ A;  3U3G A;  2G8F A;  1D9F A;  3NF8 A;  4F8R A;  4FK0 A;  3LPU A;  3O4Q A;  3OYK A;  4HCC A;  2HHS A;  4B9U A;  1RT2 A;  3NCI A;  3D45 A;  1QTM A;  2D0B A;  4BDY A;  3V9X A;  4I2P A;  4HCB A;  4FK4 A;  4B3O A;  4K8X A;  4CIE A;  1D5A A;  4W5O A;  5KRS A;  3AO1 A;  3ZT3 A;  1RTI A;  3EZ5 A;  4CJP A;  2E6M A;  3QEI A;  3KTQ A;  3TR8 A;  1C1C A;  5HBM A;  5HRS A;  4FJL A;  4KTQ A;  3DLK A;  2WOM A;  2X74 A;  3T19 A;  3HXM A;  1NK5 A;  4BE1 A;  1LW2 A;  4KPY A;  1C0M A;  3AVH A;  4CGI A;  1I3A A;  4FJH A;  4CJ3 A;  1TKX A;  1NK7 A;  3WNH A;  1BL3 A;  1LW0 A;  1IKX A;  2FBT A;  4JLH A;  2HVI A;  4ID5 A;  4FLX A;  4CGJ A;  3MAQ A;  4FW2 A;  1ZBU A;  3PX6 A;  1HYV A;  2QKB A;  3B6P A;  4CFA A;  4OJR A;  2VG6 A;  4OPK A;  3AVA A;  4ELV A;  3RWU A;  2O4G A;  2D0A A;  4KI4 A;  2WON A;  5J2P A;  3U6F A;  2G8W A;  5C25 A;  3IG1 A;  1UAX A;  3B6O A;  1S1U A;  4FLU A;  3MEC A;  4CK3 A;  2XO7 A;  1S9G A;  3K5M A;  1Q9X A;  4BWM A;  3QIN A;  3VN5 A;  4JRQ A;  3QES A;  3T1A A;  5DMR A;  4F2R A;  4KB0 A;  3CM5 A;  2Z1I A;  4R5P A;  4DU4 A;  4L8R B;  1JLF A;  1W0H A;  1JLA A;  1RDD A;  3DM2 A;  4J2E A;  1FKO A;  1IKY A;  1HJR A;  4FJ7 A;  3HJF A;  3AVC A;  5CY4 A;  1QHT A;  3OYC A;  3KLF A;  3QEV A;  3KK1 A;  4ZTF A;  1X9S A;  1L3V A;  1DTT A;  4CFC A;  1HQE A;  2ETJ A;  4CJT A;  1KLM A;  2KZM A;  4E7K A;  3MXI A;  3TAR A;  1TV6 A;  2BGG A;  3T3F A;  4DQP A;  2D0C A;  2IS3 A;  5KI6 A;  1RDA A;  4E1N A;  4Q5V A;  1JXB A;  3HPO A;  1FK9 A;  4BDZ A;  4J2D A;  4H8K A;  1IKV A;  3VQ6 A;  2G8V A;  4EZ6 A;  4M3Z A;  4Z4I A;  3DYA A;  2G8H A;  3SCX A;  1VK0 A;  3QO9 A;  3CQ8 A;  4LD0 A;  3V9S A;  4KTZ A;  3QET A;  1CXQ A;  4C8M A;  4CIG A;  4OGE A;  4DTS A;  4AHT A;  1HPZ A;  4CJK A;  3QNN A;  3AA3 A;  1L5U A;  1TL3 A;  3PUF A;  1A5W A;  5FRO A;  1JLG A;  1W9H A;  4QAG A;  2FBY A;  5CZ1 A;  4DSI A;  2XRI A;  1RBS A;  2DFH A;  2OPS A;  4M41 A;  1WAF A;  5J2Q A;  2OZS A;  2HHQ A;  3M8S A;  3LPT A;  5HRR A;  4IDK A;  3PV8 A;  5EU7 A;  1U45 A;  2F8T A;  3CM6 A;  4FYD A;  1DTQ A;  2LSN A;  1CZ9 A;  3HST B;  1EET A;  5KGX A;  3AVI A;  4N76 A;  2XY7 A;  4E7J A;  3KLE A;  3ZCM A;  2Y1J A;  3LP1 A;  2R7Y A;  4RW4 A;  3TAF A;  4PA1 A;  1GOA A;  4BE2 A;  4FM2 A;  4E7L A;  5I42 A;  4CGG A;  4FJ8 A;  1C1B A;  3NGZ A;  3SV4 A;  4DU1 A;  4PQU A;  1T7P A;  3VQC A;  1QSS A;  4BWJ A;  1VSE A;  3QIO A;  2VWJ A;  1C0U A;  1BI4 A;  1EXQ A;  2Z1G A;  1IG9 A;  1X9M A;  2OZM A;  4FJN A;  3OS1 A;  4CJL A;  2YHB A;  3RMB A;  4O0J A;  3QEW A;  1RDC A;  2YKM A;  4KB1 A;  4FVM A;  2HMI A;  4CJV A;  4DTU A;  3WNE A;  4CF1 A;  3WNG A;  3NDK A;  2Z1H A;  4DMN A;  3AA2 A;  2GBZ A;  3MED A;  3MEE A;  4B9L A;  4QCL A;  3LZI A;  3F73 A;  2PY5 A;  1C0T A;  3DOK A;  2ZE2 A;  3HP9 A;  3NF6 A;  1X9W A;  4DTN A;  3P83 D;  4OVL A;  1U47 A;  1RTD A;  3L2V A;  1S1X A;  1NKB A;  4LH4 A;  5HRP A;  2E6L A;  4DTM A;  4DSJ A;  1UWB A;  3H08 A;  4DG1 A;  5J2N A;  3C95 A;  1KFD A;  4NYN A;  1UA0 A;  3ZSZ A;  4TSX A;  1NK6 A;  1TK0 A;  2ITG A;  4RW6 A;  4BE0 A;  3SPZ A;  4IG0 A;  2IGI A;  1NK4 A;  2VWK A;  4HTU A;  4CER A;  1QSL A;  3SV3 A;  4CJS A;  1TAU A;  3VA0 A;  3S9H A;  4AHU A;  5T7B A;  3K5L A;  4UQG A;  1HNV A;  3AO4 A;  3CYM A;  2OPR A;  3CFO A;  3VQ9 A;  1L3U A;  2IOC A;  4J2A A;  2F8S A;  1ZBI A;  4F3O A;  1HYZ A;  4CJF A;  4PY5 A;  3SJJ A;  2XY8 A;  3VQ7 A;  1WSG A;  3LWL A;  3NH0 A;  1RNH A;  1UA1 A;  3RR8 A;  3SPY A;  3OVN A;  4LY7 A;  5KRT A;  1MU2 A;  1REV A;  4M45 A;  3SQ2 A;  5C24 A;  3V9Z A;  3TAG A;  1SL1 A;  3NHG A;  3DRR A;  2JGU A;  3OYF A;  3SUQ A;  5SWM A;  2B6A A;  3G0Z A;  2RN2 A;  1RTH A;  1RBT A;  1RT7 A;  1VSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...