4CHQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
148
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 52
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chqA00
4N76A 2KFZA 4G1QA 3DRPA 1FXXA 5HRNA 2FC0A 4DTPA 4OPKA 4CFDA 2R7YA 1UA0A 2B6AA 4KTQA 2VWJA 1FK9A 2X74A 5T7BA 4DU4A 4Z4CA 1R0AA 5CY4A 2ZD1A 2KW4A 4IFYA 5JS1A 4CEEA 2QKKA 5DMRA 1SL2A 1SUQA 3BGRA 4OJRA 3IG1A 4FLTA 4EP4A 3VQDA 4DTSA 3SYZA 4DFMA 4CGFA 1WSIA 1YTUA 3QIPA 3RR7A 2JLEA 4FJ9A 1BIZA 1VSMA 1K6YA 3MEDA 4M3ZA 3QNNA 5HROA 4B9VA 5HRRA 2YNFA 3OYAA 1DTQA 4OLAA 3DOLA 1B9DA 3KKSA 4PUOA 4N47A 4Z0UA 2HHXA 4DU1A 3PO4A 3QEVA 2PYJA 4C8MA 4JRQA 3VA0A 1LAVA 4CJQA 3NGIA 3DMJA 1LW2A 4CIGA 1RDDA 1JLGA 3AO2A 5FDLA 1RT7A 2RN2A 2XHBA 4DLEA 3I8DA 3KD5E 1XHXA 5KI6A 3AO1A 1YTAA 2P5GA 4CHNA 1RILA 3QESA 4LH5A 1JL1A 1S5JA 1BL3A 4I7FA 3S3NA 3DI6A 1NJXA 4UQGA 4M3XA 1I39A 4FK0A 3RMAA 2G8FA 1RT6A 4N5SA 5FRMA 1U04A 3VA3A 4KTWA 4WE1A 3OYLA 4KHSA 4MFBA 4W5TA 3NGZA 3OYCA 1HNIA 2FBXA 3LAMA 1D9FA 4DQPA 1BCMA 3LZJA 3F9KA 4KB1A 5J1EA 4FJKA 4M3TA 4KHYA 2HMIA 4OLBA 3WNHA 1JXEA 3RWUA 4EZ6A 3NHGA 1EP4A 4ICLA 5I42A 2YHBA 1JLFA 4FJ5A 1TK5A 1C6VA 5DK5A 3OYNA 1TL3A 3OS0A 3K5OA 4DSLA 1J5OA 3C95A 2X78A 3ZSVA 4RW9A 4O0JA 3VQPA 4KHWA 1C0UA 5KTQA 2D0CA 3P5JA 3NGYA 2B5JA 4LH4A 4NCAA 3OS1A 2G8KA 2F96A 4PWDA 4NCGA 5I3UA 1KRPA 3L3VA 4W5QA 4FXDA 2BANA 4DS4A 3LWMA 1CZ9A 3CYMA 4ELTA 4ZTJA 4M3UA 3VQEA 1JLQA 4I9LA 1GOBA 4AHCA 1S6QA 1U49A 3OYIA 3L8BA 2OZMA 3AA2A 3A2FA 1WNSA 3DYAA 3PUFA 3IRXA 1TL1A 2WONA 4CIFA 4FLYA 5HRPA 4GMJB 1SV5A 3LAKA 2Y1IA 1RDAA 2HHSA 4OPJA 2ZE2A 4RW7A 4E89A 3VQ6A 1RTIA 3AVFA 4GVMA 4H4OA 3OJSA 3H08A 3L3UA 3QO9A 1REVA 4DSKA 4M3WA 4KHNA 1D5AA 4E3SA 3AA3A 1XWLA 4ID1A 3NF8A 3OYHA 1N6QA 4Q0BA 3OYFA 4OKKA 4KHQA 4E7JA 3O3FA 4DQSA 4IKFA 3AVCA 1NJYA 1NK4A 4E19A 1G15A 1KVCA 2P1JA 3V1RA 4KFBA 3HVRA 2OPRA 3L2RA 3TWHA 3V9XA 4DS5A 2G8VA 1LWCA 4O0IA 4H4MA 3LP3A 4FCYA 4C8KA 2D0BA 2P51A 2HNDA 4C8NA 3NH1A 3KLEA 4FLZA 2XY7A 1S9GA 3NH2A 4J2EA 1Y97A 4XIUA 3RMBA 3ITHA 4KTZA 2PY5A 3VQBA 3KJVA 3HJFA 3AA4A 1W9HA 2QKBA 2DY4A 2E4LA 1CXUA 3M8RA 4CJVA 1RT1A 4F2RA 3ZT0A 4AH9A 1QHTA 1WSEA 4CECA 3JSMA 3F73A 1GOCA 1U48A 2OZSA 4FZXC 3LALA 4DSFA 2ETJA 4GW6A 4FZZA 2DTUA 1MU2A 3NF7A 1X9WA 5FRNA 1QSYA 3HP9A 4F8RA 3HM9A 3NDKA 4J2BA 4CEBA 3AVGA 3T1AA 1RTDA 3O4QA 1RNHA 2E6MA 3HK2A 3B6OA 1WN7A 3MXJA 3QEIA 2X6SA 4CJUA 3AVNA 1ZBFA 4FLWA 1WSGA 4M41A 3SQ4A 3G10A 1HYVA 4QOZB 4YNQA 4CJRA 3K59A 3FFIA 3DLRA 1S9EA 1TVRA 2OPPA 1A5XA 3QNOA 1VRTA 3SJJA 4N56A 2O4IA 1LAWA 4OKEA 1S1VA 2JGUA 4JLHA 4RW4A 3ZSWA 4DTNA 4E7HA 2XY5A 2GBZA 1EXQA 1UA1A 2IAJA 1ITGA 1S1WA 2HNYA 3MEGA 1JLCA 3NFAA 1TGOA 4FK2A 3U3GA 4BWJA 4RG8A 3WNGA 3NH0A 2FBVA 1VSIA 3T19A 3MXMA 4FJJA 1NKEA 3NF6A 1JL2A 3DRRA 4CGGA 3SUNA 2Z1GA 3AVKA 1Z26A 4LSLA 4E1MA 4FJMA 1ZBUA 3O4NA 5HRSA 4DLGA 1KVBA 3AO5A 3SPYA 1D8YA 4LSNA 3OYGA 4CJPA 4PY5A 1RTHA 3ZT4A 1UAXA 4FLXA 4J2AA 1KTQA 3C94A 1NK7A 3PY8A 3CM6A 2D5RA 2VG7A 4K8ZA 3HPHA 3SZ2A 1LWEA 2OPSA 4IG0A 1BGXT 3DLGA 4DFPA 1Z25A 3DRSA 1VSEA 1CLQA 5KGWA 4CGJA 1LW0A 2BE2A 2Z1HA 3NBPA 4O55A 3K58A 2HB5A 1J9AA 3KKRA 4DTXA 3AVJA 3QERA 4B08A 4F4KA 3AVLA 1BHLA 4I2QA 1T05A 1EKEA 4CEFA 4B9UA 5JS2A 3OVNA 4DQIA 1KCFA 3AVMA 3L2VA 2YHAA 4BE0A 4DFKA 3C6TA 4EP5A 2O4GA 3NCIA 3ZT3A 1KVAA 3TARA 3BDPA 1FKPA 3LANA 3VQQA 4CJ4A 3P83D 3TI0A 4HCBA 2QK9A 1QS4A 3WNEA 3K5MA 3MECA 3LZIA 4DTUA 3SV3A 5CYMA 3LWLA 4I9QA 2G8WA 4KV8A 4DSIA 3RMCA 1TKXA 1HMVA 4CJSA 1UWBA 2HHVA 1O1WA 3KK2A 3LDSA 3TR8A 2B4JA 2XO7A 1KLNA 4B9SA 1TV6A 3QEXA 1HYSA 4E7IA 4CF2A 1JLEA 4IG3A 4BDPA 3QLHA 1VRUA 1D9DA 4CJLA 2Z1JA 4O44A 1HRHA 1QTMA 1W0HA 4DF4A 4E7LA 3TAEA 1VSKA 2F8SA 4Y1DA 2D0AA 4Q5VA 3VQCA 1JKHA 2IGIA 4FW1A 1X9MA 2KZZA 2DFFA 1L3VA 3U6FA 4NCBA 5J2QA 4KB0A 3UIQA 2YNHA 1DLOA 3SUOA 3ZCMA 4W5RA 5J2MA 1IKYA 4OKJA 1C0MA 3PX6A 4E0DA 4CHOA 3ZSQA 3VQ4A 1EETA 3V1OA 1NK8A 1DTTA 4CGIA 5J2NA 2HVIA 3LP1A 4W5NA 4CJTA 4CF8A 1L3SA 4KHUA 4CFAA 3TAFA 4H8KA 4B8AB 3RR8A 4DQRA 4TSXA 1BQMA 3K2PA 2F8TA 4CEAA 4Z4EA 2HNZA 4AHTA 1C0TA 2G8HA 1VSHA 3AO4A 3B6PA 1QQCA 4CJEA 1RT3A 4HHTA 1Q9XA 5FROA 4KAZA 4Z4FA 3SV4A 4FLUA 5E41A 4JS5A 5C24A 4KI6A 4C8OA 3AO3A 3E01A 1IKXA 3ZT1A 3S3OA 1XHZA 1B92A 3AVAA 4IBNA 3P1GA 4HTUA 3TAQA 1HNVA 2RKIA 4CFBA 1RDBA 4B9TA 1QE1A 2I5JA 2LSNA 4FJXA 2Z1IA 4M45A 2QXFA 2DFHA 3D45A 1Q8IA 4DTMA 4RW8A 4B3OA 3TABA 4CGHA 3C6UA 4O5BA 4AHVA 4B9NA 4B9LA 3KLFA 4FJ8A 1WLJA 1IKVA 4FJ7A 1RDCA 3VN5A 2W42A 1NJZA 4DSJA 4ELVA 3AA5X 1S1XA 1CZBA 3SNNA 3SPZA 1TK8A 3CM5A 3KIOA 3RMDA 2IS3A 4FYDA 3HVTA 3QINA 3KK1A 2ZQBA 4E7KA 4M3YA 1JLBA 4DSEA 3TAMA 2KFNA 3DLEA 2DFEA 4NYNA 3SUPA 1L3TA 1WAJA 2IDOA 1X9SA 1BIUA 3I0SA 3V81A 1F21A 4F3TA 3NAEA 3VQ7A 1CXQA 4AHRA 3NE6A 3LP2A 1ZBHA 3HO1A 3SUQA 2HHQA 4CHQA 3SQ2A 1JLAA 3CG7A 1TAUA 1JXBA 3ALYA 2FBYA 2XY6A 4AHUA 4FJHA 2HW3A 1U4BA 3VQ9A 4CK1A 2HHWA 4CEOA 1Q9YA 3QEPA 1KFSA 4Z4IA 4E1NA 3PO5A 3OYBA 4CEDA 1YVUA 3LPUA 2XRIA 3V9WA 4FJGA 1UOCA 3OJUA 4N41A 4M3RA 1ZYQA 1ASUA 2VWKA 4L8RB 3RTVA 3OYDA 3IS9A 1ASWA 1U47A 2FBTA 3HL8A 1KFDA 3ZSZA 4CJFA 4FK4A 4CFCA 1HQEA 2HHUA 3DLHA 4CF0A 1RTJA 1SL1A 4ELUA 3PX4A 2Q3SA 2ATQA 3O3HA 4F3OA 4CCHA 1NK9A 5KRSA 4CHPA 5CZ2A 1WSJA 1BI4A 4FM2A 1TKDA 4FJLA 4ID5A 4DTOA 3ZSYA 3SQ1A 3V9ZA 4DTJA 5EU7A 2WOMA 2YKNA 3HSTB 4Z4HA 3M8SA 3K5LA 1RBRA 3V9UA 2A1RA 1T8EA 4FJNA 1T7PA 1RT4A 3V9SA 3HT3A 3QEWA 3PX0A 1RBTA 4CF9A 3EY1A 1S6PA 4JS4A 4DF8A 3ZSRA 3S9HA 3MXIA 1KLMA 1I3AA 3M8QA 4OGCA 3JYTA 1U45A 1T03A 1RCHA 1YT3A 2X6NA 3VQAA 3SQ0A 2EHGA 1TKZA 3DM2A 2ITGA 1LWFA 1IG9A 4CJ3A 3I0RA 3D0PA 4IDKA 3HP6A 3TANA 4AILC 1RBUA 3OYMA 3ISNC 1RBSA 4DFJA 1NK5A 1S1UA 2IC3A 1A5VA 1IH7A 5SWMA 4AHSA 3EYZA 5KGXA 1RBVA 5K14A 4J2DA 3V1QA 3MAQA 2GUIA 3OS2A 3DLBA 3TAGA 4JRPA 1X1PA 4QAGA 4HUEA 4HCCA 3L2UA 3DLKA 1SKWA 4CGDA 3WNFA 3ZSOA 4FM1A 4DQQA 3LPTA 4CJ5A 5HP1A 3M8PA 3TAPA 2KQ2A 1WAFA 1B9FA 3OY9A 2EX3A 1VSDA 1BI4B 4K8XA 1HQUA 1VSFA 3OYKA 1HPZA 4CJKA 3L2QA 3HXMA 3CFOA 4BDZA 2YKMA 3HPOA 4FLVA 2XY8A 4PA1A 5SZTA 2PZSA 2HHTA 1WSFA 4DWIA 3ZT2A 2IOCA 4ZTFA 1BCOA 3KLIA 4FJIA 4CE9A 3EZ5A 3O3GA 2RF2A 4DG1A 1TK0A 1SKRA 1J54A 1QSSA 1FKOA 4CK3A 3AVBA 3ZSXA 1EX4A 2VG5A 4CEZA 4KI4A 4YFUA 1L3UA 1C1AA 3OYEA 4BDYA 5D3GA 5CZ1A 3KLGA 3QETA 4FM0A 2GV9A 4FVMA 4CK2A 4BWMA 1L5UA 3RRGA 5J2PA 3G0ZA 4HVJA 1VSLA 4CF1A 5KRTA 4DMNA 4EZ9A 1WSHA 3SCXA 3OYJA 3S3MA 1NK0A 3KD1E 3KLHA 4DTRA 5C42A 4CERA 4ZHRA 3V4IA 3HYFA 4PQUA 1VSJA 4HUFA 3AVHA 4CESA 1XI1A 4M42A 3U3YA 4KO0A 3NF9A 1A5WA 1ASVA 4CIEA 3T3FA 1S1TA 1LV5A 4W5OA 3LP0A 1ZBIA 2P5OA 3K5NA 3ULDA 1QSLA 4KREA 1C1CA 1TKTA 2G8IA 4Y1CA 2KTQA 1HJRA 3SI6A 2VG6A 4BE2A 1RT2A 2OPQA 4Z4GA 4F2SA 4CEQA 4DU3A 2YV0X 5HBMA 4CHZA 4LY7A 1C1BA 1NJWA 1SL0A 4OVLA 3ASMA 3K57A 1TAQA 3VQ8A 4FZYA 2NUBA 1BQNA 4MQ3A 4IFVA 4HUGA 2Y1JA 4BACA 1NOYA 2PYLA 4KPYA 1RT5A 4RW6A 5HLFA 3KK3A 3CFPA 3RRHA 4KKOA 3IAYA 2E6LA 4OGEA 1XC9A 1SKSA 3AV9A 1IO2A 2OA8A 1J53A 4B9MA 4FW2A 1HYZA 5CYQA 4NYFA 3CQ8A 4KRFA 2YNGA 3CFRA 1NK6A 3THVA 4CHYA 2G8UA 3AVIA 1KSPA 3VQ5A 4I2PA 3KTQA 4BE1A 3PV8A 1ZBLA 2BDPA 2KZMA 3QIOA 3V6DA 4LD0A 3L2WA 2RPIA 2A1SA 4R5PA 4CJWA 1NKBA 1N5YA 4C8LA 4O4GA 4QCLA 1NKCA 1BISA 3MEEA 1VK0A 3DOKA 2AJQA 4B8CA 1NOZA 2HVHA 5C25A 2OYQA 1GOAA 1IKWA 3HPGA 2BGGA 2YNIA
chains in the Genus database with same CATH superfamily
1QQOA 4N76A 1FXXA 2YHWA 3CCRN 5AQQA 3MWTA 1UA0A 3O4WA 2X74A 3MX5A 1R0AA 4FWNA 1CZAN 2O8DB 4JD2B 4MO4A 4CEEA 2QKKA 1OH5A 4OJRA 2O8CA 2W6LA 2HHHK 3SYZA 2ZJQL 4FL9A 4JI3K 4K41A 3MEDA 3QNNA 2JWLA 3VEYA 2J4RA 3OYAA 4OLAA 3IMXA 4PUOA 2AP1A 3QEVA 4CJQA 4BRFA 3DMJA 4EFHA 1RT7A 3I8DA 3BP8A 1QHAA 5FPNA 4EIAA 4CHNA 1RILA 3QESA 2P9NB 3ULEA 1NJXA 4I7FA 4BC4A 1NG9A 4M3XA 4FK0A 2P9KA 4N5SA 5FRMA 3OYLA 4W5TA 3OYCA 1HNIA 4H0VB 5B8HA 3LAMA 4BVPA 3ZETB 4KB1A 4M3TA 3R9PA 2HMIA 4OLBA 4YOYA 4XEIA 1JXEA 1Q81O 1YITN 1JLFA 3O1BA 1TL3A 1J5OA 3C95A 2X78A 1GLLO 1D4XA 3VQPA 3LM9A 2D0CA 3P5JA 4LH4A 1E4FT 4DKWA 1W97L 4NCGA 3U4LA 5I3UA 4JI4K 1HUXA 1VQPN 5AZJA 1VQLN 4OPAA 2P9PA 4M3UA 4XH5A 3VQEA 3PLAA 1GOBA 4AHCA 3OYIA 1QZ5A 4DV0K 3DYAA 4FLYA 4CIFA 1TL1A 2WONA 3LL3A 3LDLA 3CF5L 3AVFA 2O8FB 2FLOA 2ZF5O 4JAXA 4M3WA 2P9IB 1X3MA 3D2EA 2GELA 3DAWA 1NJYA 4E19A 1NK4A 2P1JA 3HVRA 1LWCA 4FCYA 4H4MA 2P51A 3NH1A 3KLEA 3ZX3A 4XIUA 2P9UA 3K9JA 3E1YA 3VQBA 3CCLN 4BRCA 2DY4A 3DXKA 5F1XA 3BUZB 3M8RA 3EN9A 1RT1A 4CECA 4BR9A 3LALA 4EHTA 4DSFA 2DTUA 2E2NA 1MU2A 3NF7A 1QSYA 4F8RA 3HM9A 3NDKA 3AVGA 1YVNA 5KQ8A 1RNHA 3B6OA 4BC3A 4CJUA 4FLWA 1WSGA 4JKAA 3DLRA 3HTVA 5AJ3K 1A5XA 3CC2N 4N56A 3HOTA 4B1UB 4WQ5C 1S1VA 2JGUA 4RW4A 1UA1A 2XY5A 1EXQA 2IAJA 1S1WA 2HNYA 3TSQA 3VESA 3NH0A 2FBVA 1XMOK 1I94K 1VSIA 3KZBA 5LY3A 1DT9A 4DUYK 4H0PA 2Z1GA 1Z26A 3TSPA 4LSLA 4E1MA 1KVBA 3AO5A 1D8YA 3OYGA 1OH8A 1UAXA 1KTQA 4BREA 4YOXA 4OPHA 5AQLA 1TYQB 2E1YA 3DLGA 3VF4A 1CLQA 3DRSA 3QB0A 4CGJA 4FWOA 2Z1HA 4O55A 4F4KA 4B08A 1T05A 1EKEA 4B9UA 3OVNA 4DQIA 1BDGA 3I56N 4K0KK 3F9MA 2O4GA 5CE3A 3NCIA 4JKCA 1FKPA 3LANA 2A3ZA 1N33K 4FWRA 4DTUA 3SV3A 1Z6RA 4DSIA 3RMCA 1HMVA 1YHQN 1O1WA 3KK2A 2V52B 3ZX0A 1KLNA 4X66K 4PHTX 1HYSA 4CF2A 4BDPA 1D9DA 2Z1JA 2HSTA 4DV7K 4JKGB 3C6HA 4BC5A 2F8SA 2D0AA 4LF8K 3VQCA 3ATUA 2KZZA 2DFFA 3U6FA 4NCBA 3A0IX 3EL2A 3BEXA 5BR8K 4OKJA 1C0MA 2QWOA 3CJ7A 4CHOA 4DR2K 1DTTA 4I6MB 1JCEA 3CHWA 4KHUA 4CFAA 3QICA 4TSXA 4A2BA 4CEAA 4Z4EA 3C6AA 2G8HA 1BOTO 4CJEA 4HHTA 1Q9XA 5FROA 3SV4A 4AQYK 4JS5A 5C24A 3ZEUA 3E01A 3M3ZA 3ZT1A 3S3OA 3FE1A 1ILYA 1HNVA 3MCAB 4BR2A 5AR0A 4CFBA 1QE1A 2I5JA 2LSNA 3IFRA 2ZGZA 1BA1A 5AQWA 3MN6A 4AHVA 4FJ8A 3KLFA 1YXQA 2CGLA 1RDCA 3NVMA 2W42A 2A6AA 1NJZA 2YJFA 4LF6K 4JD2A 5F2RA 3SNNA 2HF4A 1NGIA 2EWSA 3RMDA 3QBWA 3HVTA 4EHUA 4M3YA 3LDNA 3TAMA 3DLEA 3O9TA 4NYNA 1WAJA 3I0SA 1S3XA 2QWRA 3NAEA 2W40A 3VQ7A 1ZBHA 2FBYA 4FJHA 2HW3A 4CK1A 4Z4IA 4AF1A 3LPUA 4A62A 3CPWM 3V9WA 1BO5O 5DM6L 3HL8A 3ZSZA 3WXIA 4H5VA 4A59A 2ZM6K 3VEVA 3DLHA 1N36K 2ATQA 3O3HA 4F3OA 5CHIA 1NK9A 1WBDA 3OA9A 1W7AA 4DB3A 1TKDA 3ZSYA 2WOMA 4B9QA 1KAYA 1X9JA 5HOOA 3K5LA 3V9UA 1T8EA 4PKIA 3CJ9A 3CCJN 1RBTA 4CF9A 2O8EA 4DF8A 3ZSRA 3S9HA 1I3AA 3M8QA 3MMVA 1U45A 1RCHA 5BRFA 3DM2A 2NLXA 1EWQA 3FZFA 3AGKA 1S1UA 3EYZA 1NGEA 1RBVA 3V1QA 3OS2A 3HI0A 1Q7YO 3DLBA 3TAGA 1XNQK 3CI5A 1G99A 4HCCA 3DLKA 4CGDA 2O8BB 4HWIA 2ZJPL 3M8PA 2F9WA 4LFBK 2KQ2A 1ATSA 1YJNN 1VSFA 4CJKA 4FLVA 3CJCA 3O9QA 2HHTA 4DWIA 3ZT2A 1BCOA 4WQ5A 2OANA 4CE9A 2RF2A 1SKRA 5FPMA 1J54A 1QSSA 1FKOA 4CK3A 4PL8A 4RCHA 2VG5A 4KI4A 1U2VA 3GL1A 5C2FA 3OYEA 3D6RA 3KLGA 2GV9A 1HNWK 3TTDA 1L5UA 4BWMA 1YUWA 3G0ZA 1VSLA 4CF1A 3KK7A 4WQ4C 1NK0A 3KD1E 3CC4N 4BG8A 4B1YB 5C42A 4JHDB 1VSJA 1QQNA 1S72N 3O5BA 4KO0A 4CIEA 1ZBIA 3AY9A 3UKRA 1C1CA 2G8IA 2KTQA 3IDHA 2HBJA 4DV2K 4BRHA 2VG6A 4F2SA 2ASPA 1YJ9N 4ILJA 1HNXK 4B1VA 4CHZA 1SL0A 2V51B 2FSNA 3ASMA 4CBUA 3K57A 4FZYA 5F0XA 4MQ3A 4IFVA 2Y1JA 4IJNA 1K8KB 4GNIA 3HRGA 1XC9A 5M1QA 3AV9A 1IO2A 2ZWHA 4LC9B 4FW2A 3CQ8A 5BPLA 4KRFA 5C15A 4F9OA 3VQ5A 1KSPA 2KZMA 5AFUH 3QIOA 3L2WA 4BRPA 1NKBA 5AQNA 4O4GA 3H6EA 1BISA 3SAGA 3MEEA 3DOKA 3C0BA 2P9LB 1GOAA 3R3LA 2HBMA 3MN5A 2BGGA 2YNIA 4BRIA 1VQMN 2KFZA 2KLAA 4YOUA 4FWQA 2FC0A 3BZCA 2B6AA 5ADXH 2VWJA 4KTQA 4DU4A 1RDWX 5CY4A 4JK8A 2KW4A 4IFYA 1NLVA 3K9KA 5DMRA 4JK7A 1SL2A 2Q0RA 3EEQA 4V19S 4FLTA 5AZIB 3VQDA 4DFMA 1WSIA 2HBKA 3FLCO 3RR7A 2JLEA 1BIZA 4M3ZA 1K6YA 5AQXA 5HROA 3SAHA 4Z0UA 4DU1A 4C8MA 4JRQA 3VA0A 1LAVA 4XH4A 3CCVN 1LW2A 4CIGA 5BRDA 1M1KO 1RDDA 2RN2A 3AO1A 3C7NA 3J7YP 4WFNL 4LH5A 1JL1A 4I6MA 1I39A 3HOSA 1RT6A 1S22A 3R6MA 4KTWA 4KHSA 4MFBA 1WBBA 3NGZA 3OHRA 2FBXA 3TSUA 1D9FA 1BCMA 3F9KA 1H1VA 2BTFA 5J1EA 3GOIA 4ICLA 1C6VA 4OX9K 3E9OA 4DSLA 3MWPA 3G4SN 5BREA 4RTFD 1BA0A 4A5BA 4DCHA 4DV6K 1XQSC 1X3NA 2QXLA 4EAHD 4FXDA 4KBOA 2BANA 4ELTA 4ZTJA 4I9LA 1HLUA 1XNRK 3H3OB 2HBLA 1WNSA 3PUFA 3FR0A 5AQFA 4GMJB 1RDAA 4OPJA 1WUAA 5JLHA 1MWMA 3QFUA 3OJSA 4DSKA 1D5AA 4E3SA 3UKUB 4FPBA 3NF8A 3OYHA 3P31A 4OKKA 4KHQA 3AVCA 1SKSA 4B9MA 3V9XA 5AQGA 2D0BA 3OBWA 2HNDA 4FLZA 5EOYA 2YCHA 1Y97A 5AQYA 4KTZA 4KH4A 3HJFA 3AGRA 1W9HA 3O1WA 4CZFA 2QKBA 4IEIA 3ZT0A 3CPEA 1QHTA 4AH9A 4FZXC 3F73A 1GOCA 2QM1A 2ETJA 3TPQA 4BQLA 1X9WA 5AQJA 4J2BA 4CEBA 1HKGA 1RTDA 2E6MA 3TTCA 1WN7A 3MXJA 2X6SA 3AVNA 1ZBFA 3VETA 3SQ4A 3G10A 1HYVA 3LDOA 3K59A 1S9EA 1TVRA 3QNOA 3SK3A 4JI2K 2O4IA 2E2OA 3VOVA 4OKEA 3VF2A 4AM7A 4E7HA 5JVGL 3MEGA 3NFAA 2NRZA 3CMEN 4BWJA 4RG8A 3WNGA 2QWQA 3MXMA 4OO1J 3DRRA 4PL7A 4CGGA 3AVKA 3PIOL 4FJMA 3EKSA 4DLGA 4JKHA 4PY5A 4J2AA 1NGCA 4WQ4A 3PY8A 2I7PA 2QTDA 3GE1A 3SZ2A 1Z25A 4BR5A 2Y1IA 1LW0A 3NBPA 4CD1A 3K58A 5BPMA 3AVJA 2VCPA 5E84A 3AVLA 3WXKA 4I2QA 4H0OA 4CEFA 3DLLL 4DR5K 1KCFA 3L2VA 1K73O 2YHAA 4CBXA 3N4QA 3PSFA 4FWPA 3BDPA 4HCBA 4CJ4A 3VGKA 3UE5A 3MECA 4CZKA 1IG8A 4CZMA 4DR1K 5KPZA 1TV6A 4IG3A 4ISGA 3QLHA 1VRUA 4A61A 4CJLA 4R79A 1HRHA 2FSJA 1W0HA 2E1ZA 1QTMA 3TAEA 1VSKA 2IGIA 5J2QA 1DLOA 3SUOA 4W5RA 5ELZA 5BRHA 2IVPA 2Q1NA 3VQ4A 3V1OA 3AARA 1KQSM 3LP1A 2QWNA 2UUCK 4CJTA 4CF8A 4B1ZA 3TAFA 1N34K 1J6ZA 1C0GA 3RR8A 4AHTA 2DPNA 3AAQA 5IT9O 1T44A 4IOXA 4KAZA 1OH7A 4NLCA 4WCEL 1U6ZA 4DV1K 3AO3A 1IKXA 1N8RO 3AVAA 5BPNA 1ATRA 4B9TA 2Z1IA 2QXFA 1GLJO 4DTMA 4UY8O 4CGHA 4O5BA 4B9NA 1O13A 1WLJA 4FJ7A 3KHYA 4IXCA 4DSJA 3D2FB 3ID8A 1S1XA 1CZBA 3SPZA 1TK8A 3KIOA 4JK9A 3DXMA 4PKHA 2IS3A 5AZIA 1YJWN 1DGKN 4FYDA 1JLBA 2KFNA 2DFEA 2RHKA 3D7EO 3O6WA 2QA4N 2IDOA 1X9SA 1BIUA 2NZTA 1F21A 3S41A 3ENBA 3SQ2A 1JLAA 4DV5K 1JXBA 3ALYA 4AHUA 4CVNE 1U4BA 1HKBA 4H5WA 4CEOA 2NRWA 3QEPA 2PFUA 3PO5A 3F5TA 2XRIA 3OJUA 3VMFB 2VWKA 1Q82O 3IS9A 3W3DA 2YHYA 4YOTA 2A42A 4CFCA 1HQEA 3E9LA 1RTJA 1SL1A 3CMAN 3PX4A 5GAGP 5CZ2A 4FM2A 3E66A 3SQ1A 1RBRA 4FJNA 3J81O 3V9SA 3QEWA 4FWKA 4JS4A 3JYTA 1YT3A 3VQAA 4FOEA 3MN7A 2WTUA 3THYA 2ITGA 1IG9A 4CJ3A 3TANA 3OYMA 4E1JA 4CZLA 4DFJA 5KGXA 4JI5K 4BR4A 3MAQA 4YORA 1P90A 1X1PA 4DR4K 2VYPA 3VGLA 4H03B 4HUEA 4FWSA 1SKWA 1NGGA 4DQQA 3LPTA 3FGUA 3TAPA 4XH1A 5C10A 1BI4B 4GKKK 3OYKA 1HPZA 3CFOA 4BDZA 4ISEA 1BU6O 3MCPA 4U67L 3CETA 2PZSA 3M5RA 3OW2M 1TK0A 3W0LA 3ZYYX 2CGKA 3P39A 1JCFA 3AVBA 3ZSXA 1EX4A 4GVEA 2A40A 1C1AA 5D3GA 5CZ1A 4FM0A 4FVMA 4CK2A 5KPRA 5J2PA 4EZ9A 4DMNA 3OYJA 3HSCA 2IVNA 4LF4K 4CERA 3V4IA 4CBWA 3HYFA 4JN4A 3U3YA 1ASVA 3T3FA 3K5NA 1QSLA 1TKTA 1HKCA 1HJRA 2KKZA 4BE2A 1RT2A 2OPQA 2O8DA 4CEQA 1YI2N 3VEOA 5M1KA 5HBMA 4LY7A 1ZXOA 4OVLA 1TAQA 4BGAA 4HUGA 1RT5A 3CJBA 2IIRA 3IAYA 4KKOA 2GX9A 5GADP 5EX5A 1KAZA 1SAZA 2OA8A 4NB4A 1HYZA 1VHXA 1EQYA 3CFRA 3ZX2A 4A5AA 3F2KA 3THVA 3NMUA 5I9EB 2QEXN 2A1SA 1XMQK 3I33A 4HTLA 3BZKA 2P9NA 1VK0A 5C12A 3HZ6A 4B8CA 5C25A 1GLEG 4MLEA 1IKWA 4CW7B 1GLFO 3THXB 2D4WA 3GG4A 5EXWA 4CFDA 1JJ2M 1FK9A 3ZETA 3RSEB 5JS1A 4BR7A 1HX1A 4ILHA 1SUQA 2Q2RA 3BGRA 1ESVA 3T1HK 4EP4A 4DTSA 4CGFA 1Y64A 5AQZA 1YTUA 4GY2B 3QIPA 4FJ9A 5HRRA 2YNFA 3DOLA 1B9DA 4CD3A 2P9SB 2PYJA 4IFEA 1LCUA 4BRLA 3AO2A 3KD5E 4LF7K 5KI6A 2FXUA 4H0YB 2P5GA 1VQKN 1S5JA 1BL3A 5AQHA 4UQGA 3RMAA 2O8FA 4JKDA 1NGBA 1U04A 1C0FA 3VA3A 2P9IA 1NMNA 3G6EN 4DQPA 2E2PA 3LZJA 4KHYA 4ISFA 2QWMA 2FF3B 3BF1A 3RWUA 4C23A 3R8EA 5DK5A 5LJWA 3OS0A 3ZSVA 4RW9A 4O0JA 4KHWA 4DR7K 1C0UA 5KTQA 3NGYA 4NCAA 3OS1A 5IWAK 4H0XB 3L3VA 1Z05A 4W5QA 3D2FA 3B8AX 3LWMA 1CZ9A 3CYMA 2ZJRL 1JLQA 4BRGA 2OZMA 3AA2A 3A2FA 2V7ZA 5HRPA 1SV5A 3ULEB 1TUUA 2E2QA 4RW7A 3QMLA 3OTOK 4H4OA 2P9KB 2UXDK 3H08A 3L3UA 1REVA 3AA3A 1XWLA 4C1NK 5H1SQ 3OYFA 4E7JA 4DQSA 4IKFA 3MXIA 1KVCA 1SZ2A 3V1RA 4KFBA 2G8VA 2OPRA 4DS5A 3TWHA 1VQNN 4C8KA 4O0IA 3LP3A 2NRTA 4MLHA 4YOWA 3J7ZO 1NMDA 5EVZA 3ITHA 3KJVA 3NVKA 3L4QA 4KH6A 4CJVA 2OZSA 1WSEA 4C1NI 2WBNA 4FZZA 2V7YA 2UXCK 3CQXA 3THWB 1TYQA 3A8YA 3T1AA 3O4QA 3KWGA 3KWIA 1YF5L 4JI8K 5AQTA 3QEIA 2QI2A 5KPTA 4BGBA 4YNQA 2UUBK 2F4VK 3FFIA 3ID6A 4JEPA 4JI0K 1VRTA 5M1FA 3LM2A 5M1OA 1HR0K 3CJ1A 1LAWA 4CZHA 3D2EB 4JLHA 3ZSWA 1YAGA 2GBZA 1JLCA 4FK2A 2HMPA 4YOVA 1WB9A 2P9UB 3T19A 3U8XA 4GV3A 5GINA 5EY4A 1OH6A 3SUNA 5HRSA 4JKGA 3SPYA 4AM6A 4CJPA 1ATNA 1RTHA 1QZ6A 4MDBA 4JI7K 2D5RA 4J8FA 3HPHA 1LWEA 5GIPA 2D1KA 4DFPA 5KGWA 2BE2A 3KKRA 3I55N 3T69A 1BHLA 3CQYA 4YHHK 5JS2A 4FWLA 3AVMA 4BE0A 4EP5A 4H5RA 3ZT3A 1QVFM 3PIPL 2WUSA 4JKFA 3ENOA 3MDQA 3WNEA 3K5MA 5LMNK 4I9QA 2G8WA 4CZIA 3LDSA 4IZ9A 3VGMA 3J7AP 1ZBSA 4B9SA 1V4TA 4O44A 5M1PA 3EO3A 4Y1DA 4BY9C 2HOEA 4FW1A 4CJ7A 1X9MA 3SBTA 4KB0A 3UIQA 3HM8A 5J2MA 5E26A 4BR0A 1BWFO 4CGIA 5J2NA 2HVIA 4W5NA 1L3SA 3GBTA 3K2PA 1LOTB 4A57A 3VPZA 3E9PA 1VQ8N 4Z4FA 4FLUA 5E41A 3G71N 4KI6A 4C8OA 3PSIA 4K25A 1GLCG 1NGDA 3P1GA 2D0OA 3SMSA 4M45A 3H1VX 2DFHA 1Q8IA 1NU0A 5AFUA 4B3OA 2H3GX 4NXMK 3C6UA 3L4IA 1IKVA 3RSEA 3AA5X 3WT0A 1IJJA 4WFAL 1KAXA 2A5XA 2BH1A 2ZQBA 4E7KA 4DSEA 1K8AO 1VQON 3SUPA 5C0YA 4YDUC 2P9SA 3NE6A 3LP2A 4MDAA 1SS6A 3CG7A 2XY6A 5LL6Z 4H5TA 1KFSA 3OYBA 2E8AA 1YVUA 4FJGA 1UOCA 5GAEP 5TKYA 1ZYQA 1NGAA 4L8RB 3RTVA 3OYDA 5JVHL 1KFDA 1OVYA 4FK4A 3LDPA 4M7YA 1K9MO 2HHUA 2O8BA 4ELUA 3EKUA 3P38A 4CCHA 2CH5A 4CHPA 4WYBA 4DQ8A 3V9ZA 3IKMA 3HSTB 2A1RA 3GDQA 1KXPA 2FF6A 3HBTA 1T7PA 3BY5A 3PX0A 3ATVA 1S6PA 2VWBA 1KLMA 3MX2A 2EHGA 1TKZA 3ZLJA 4JV5K 3D0PA 4IDKA 2OTLN 4AILC 1RBUA 4U7BA 3ISNC 4DR3K 1NK5A 1A5VA 5SWMA 3TTFA 4AHSA 4J2DA 4JHDA 3H46O 5K14A 2VGMA 3QBXA 3AAPA 2GUIA 4X64K 1DKGD 4IEEA 4JRPA 1JCGA 3ZSOA 4FM1A 4ILGB 4CJ5A 3WQTA 1WAFA 1VAZA 3O9SA 1VSDA 4K8XA 4LFCK 1HQUA 3VEXA 3TU5A 2PBDA 4O8UA 3HXMA 3HPOA 5SZTA 1WSFA 4ZTFA 2IOCA 1K8KA 3KLIA 4FJIA 2O8EB 1W2BM 3O3GA 3VTHA 4BRDA 1IBKK 4BDYA 3THWA 2YJEA 3RRGA 5KRTA 2CGJA 3SCXA 3S3MA 4DTRA 2KHOA 3A5LC 2P9LA 4HUFA 4PQUA 4CESA 4M42A 1Q86O 2NRXA 3NF9A 3WXLA 1LV5A 2NRHA 4W5OA 2P5OA 4KREA 3ULDA 3JXUA 3SI6A 1RDUA 5GAHP 2YV0X 3VQ8A 4B3RK 4CZJA 2NUBA 4CZEA 1NOYA 2PYLA 4KPYA 4RW6A 5LMUK 5HLFA 2Q31A 3KK3A 3CFPA 3RRHA 1NWKA 4B1XB 4CZGA 2IVOA 1J53A 4NYFA 2GWJA 1U2VB 5DM7L 1KC8O 1QQMA 4DUZK 4CHYA 4A2AA 4YY3K 2G8UA 3KTQA 4BE1A 2BDPA 1NGFA 3V6DA 4LD0A 4GKJK 1N5YA 4C8LA 4M63C 3M1FA 2F9TA 1NKCA 4B3MK 3VF6A 1NOZA 4JKEA 2HVHA 2ZGYA 4G1QA 2Q36A 3DRPA 5HRNA 4DTPA 4OPKA 4BQZA 3UKRB 1T6DA 2WFBA 2R7YA 5T7BA 4Z4CA 3Q7BA 3CIPA 3CCUN 2ZD1A 3U9ZA 2JWKA 3IG1A 1WOQA 1IBLK 3DWLA 3CJAA 1VSMA 1N32K 4NO7A 4B9VA 4QS9A 1DTQA 2HHXA 3KKSA 4BC2A 4N47A 3PO4A 4GV9A 3A5MC 3A5OC 1VQ6N 1BUPA 2A41A 2AA4A 3NGIA 5A2QO 1JLGA 2XHBA 5FDLA 3FZKA 4DLEA 3QDKA 1XHXA 1ZC6A 2QWLA 1IBMK 1YTAA 3FZHA 5FPDA 3VERA 3S3NA 3DI6A 2QWPA 1RFQA 2G8FA 3L0QA 4DV3K 4G9ZA 3EE8A 4WE1A 3UKUA 3I8BA 3VEWA 4BRAA 4RWTA 4B3TK 3SBGA 3H1QA 4FJKA 4FPAA 4MO5A 3VENA 3VEZA 3WNHA 4IOAL 4EZ6A 3NHGA 1EP4A 1T6CA 5I42A 2YHBA 4FJ5A 5M1NA 1TK5A 5AQOA 3OYNA 4H0TB 3RVCA 3K5OA 4YDUA 3CXCM 4BRKA 2B5JA 5AQUA 2G8KA 2F96A 4PWDA 5AQMA 3JAMO 1KRPA 3CCMN 3O80A 2ASMA 3H45C 3Q7CA 3C65A 1KD1O 4DS4A 1E3MA 1OVQA 1S6QA 1U49A 5JMVA 3VTIA 3L8BA 2FSKA 4IOCL 3O8MA 3C7NB 4LF9K 3IRXA 1GLDG 3LAKA 2HHSA 3J80O 3WEEB 2ZE2A 5AQKA 2GWKA 4E89A 3VQ6A 3T1YK 1RTIA 3L6QA 4GVMA 1YIJN 3QO9A 4KHNA 1GLAG 4ID1A 1N6QA 4Q0BA 4KHPK 3O3FA 4B1WB 1G15A 3L2RA 4JNEA 2I7NA 3T7ZA 5AQVA 5BN9A 4C8NA 2XY7A 1S9GA 5AQPA 3NH2A 4J2EA 3RMBA 3ENHA 4QS7A 2PY5A 5JLFA 2RE2A 3AA4A 2VGNA 4JYAK 4LF5K 2E4LA 4IO8A 1CXUA 4F2RA 3JSMA 2UXBK 1U48A 4IWVA 2W6KA 4GW6A 1SQKA 5FRNA 3O08A 3U9DA 3HP9A 1Q18A 5AQSA 3HK2A 1XUPO 4QS8A 3SLCA 5HL7L 4M41A 4QOZB 2QW9A 4BRNA 4CJRA 2OPPA 2UYTA 3SJJA 4DTNA 2E88A 1ITGA 5TKWA 1TGOA 4X62K 3U3GA 1VQ9N 4K43A 4O5FA 3SMPA 2D0PA 4FJJA 1NKEA 3NF6A 1JL2A 2OCEA 1MA9B 2NRVA 1ZBUA 3O4NA 4LSNA 1EO1A 3CD6N 3ZT4A 4FLXA 1NNEA 3C94A 1NK7A 1T3VA 3CM6A 2VG7A 4K8ZA 4IG0A 2OPSA 1BGXT 4BRMA 1VSEA 3SAFA 4E0DA 3WUHA 1VQ7N 3EE9A 4DTXA 2HB5A 1J9AA 3QERA 2GUPA 3SJHA 1NM1A 4DFKA 3C6TA 1KVAA 3TARA 3VQQA 3TI0A 3P83D 4FWMA 1QS4A 2QK9A 1OKJA 2O8CB 4JKBA 3LZIA 1V4SA 5CYMA 3LWLA 2W41A 4KV8A 1TKXA 4CJSA 1UWBA 2HHVA 3TR8A 2B4JA 4JI6K 5BR9A 2XO7A 3QEXA 4E7IA 3FFKB 1JLEA 1HNZK 1EWRA 5KQDA 3J8AA 3WXMB 4DF4A 4E7LA 1NGJA 2F7TA 4Q5VA 1JKHA 1L3VA 3FZLA 2YNHA 5AQRA 3ZCMA 1IKYA 3PX6A 3ZSQA 5LJVA 1EETA 1NK8A 1TUYA 1IV0A 1BG3A 4H8KA 4B8AB 4DQRA 1BQMA 2F8TA 2HNZA 1C0TA 4H5NA 1VSHA 3AO4A 3B6PA 1MWKA 1QQCA 1RT3A 4PKGA 4DV4K 4BROA 2PAVA 2YX6A 3OBYA 1XHZA 1B92A 2GTDA 4IBNA 4HTUA 3TAQA 4KH5A 1HJOA 2RKIA 3IUCA 1RDBA 4FJXA 3D45A 2Q97A 4M7XA 4RW8A 4BVOA 3TABA 4B9LA 3VN5A 4ELVA 5AZJB 4O8KA 2P9PB 3CM5A 3G25A 3WXJA 2OTJN 3DJCA 1DEJA 3QINA 3KK1A 4IO9L 3QFPA 1L3TA 3V81A 4F3TA 1NGHA 2HHQA 1CXQA 4AHRA 3HO1A 1TAUA 3SUQA 4CHQA 3BF3A 3VQ9A 2HHWA 1Q9YA 5AQIA 2HF3A 4E1NA 3FZMA 4CEDA 4Y0WA 1GLBG 4N41A 4M3RA 1ASUA 1NBWA 1U47A 1P8ZA 1ASWA 2FBTA 3DXKB 1M90O 5C2DA 4CJFA 1RGIA 4CF0A 4Z94A 4IDHA 5CR4A 4B3SK 2Q3SA 5KRSA 2UUAK 2E5LK 1WSJA 1BI4A 5FPEA 4FJLA 2YI1A 4ID5A 4DTOA 4DTJA 5EU7A 2YKNA 3DXMB 4Z4HA 4BG9A 3M8SA 1QVGM 2ASOA 4FSVA 4CI6A 1RT4A 3HT3A 4X65K 3EY1A 3WQUA 4OGCA 1T03A 3SQ0A 2X6NA 1LWFA 3I0RA 1MDUB 3HP6A 1E4GT 1RBSA 4IJAA 2IC3A 1IH7A 1FW6A 3O9UA 1J5EK 3JS6A 3LDQA 3WEEA 3CERA 4QAGA 3L2UA 3WNFA 1VQ4N 2NNWA 2Q0UA 5HP1A 3CCSN 1B9FA 3OY9A 3H3NO 2EX3A 2VQEK 5BN8A 3L2QA 2YKMA 3CCEN 2XY8A 4PA1A 1FJGK 4FOIA 3EZ5A 4DG1A 4DHYA 2VQFK 4CEZA 2YHXA 4BRQA 3P4IA 2UU9K 4YFUA 1L3UA 3THYB 3CCQN 2NRRA 3K0SA 3QETA 2BUPA 5GIOA 3CC7N 4HVJA 1WSHA 3KVGA 3KLHA 2WC9A 4ZHRA 3AVHA 4NLBA 1XI1A 3MN9A 4WF9L 3THXA 5FLXO 1A5WA 3EZWA 1S1TA 3LP0A 5JICA 2CH6A 4Y1CA 3M6GA 4LFAK 3R1XA 4Z4GA 4DU3A 2ITMA 3MK6A 1C1BA 1NJWA 4L3QA 1BQNA 4DR6K 3UB5A 5ADXA 4BACA 4JI1K 2E6LA 4OGEA 4GV6A 1XC3A 2GEMA 5CYQA 4FO0A 2YNGA 3A5NC 3O9RA 1NK6A 4FVUA 3N4PA 3AVIA 2E20A 4I2PA 5MLCQ 3PV8A 1R59O 1ZBLA 2RPIA 1NJIO 4R5PA 4CJWA 4QCLA 3ZEUB 4WFBL 4K42A 2AJQA 1HPMA 2OYQA 3HPGA 4NXNK 1VQ5N
chains in the Genus database with same CATH topology
4N76A 2KFZA 4G1QA 3DRPA 1FXXA 5HRNA 2FC0A 4DTPA 4OPKA 4CFDA 2R7YA 1UA0A 2B6AA 4KTQA 2VWJA 1FK9A 2X74A 5T7BA 4DU4A 4Z4CA 1R0AA 5CY4A 2ZD1A 2KW4A 4IFYA 5JS1A 4CEEA 2QKKA 5DMRA 1SL2A 1SUQA 3BGRA 4OJRA 3IG1A 4FLTA 4EP4A 3VQDA 4DTSA 3SYZA 4DFMA 4CGFA 1WSIA 1YTUA 3QIPA 3RR7A 2JLEA 4FJ9A 1BIZA 1VSMA 1K6YA 3MEDA 4M3ZA 3QNNA 5HROA 4B9VA 5HRRA 2YNFA 3OYAA 1DTQA 4OLAA 3DOLA 1B9DA 3KKSA 4PUOA 4N47A 4Z0UA 2HHXA 4DU1A 3PO4A 3QEVA 2PYJA 4C8MA 4JRQA 3VA0A 1LAVA 4CJQA 3NGIA 3DMJA 1LW2A 4CIGA 1RDDA 1JLGA 3AO2A 5FDLA 1RT7A 2RN2A 2XHBA 4DLEA 3I8DA 3KD5E 1XHXA 5KI6A 3AO1A 1YTAA 2P5GA 4CHNA 1RILA 3QESA 4LH5A 1JL1A 1S5JA 1BL3A 4I7FA 3S3NA 3DI6A 1NJXA 4UQGA 4M3XA 1I39A 4FK0A 3RMAA 2G8FA 1RT6A 4N5SA 5FRMA 1U04A 3VA3A 4KTWA 4WE1A 3OYLA 4KHSA 4MFBA 4W5TA 3NGZA 3OYCA 1HNIA 2FBXA 3LAMA 1D9FA 4DQPA 1BCMA 3LZJA 3F9KA 4KB1A 5J1EA 4FJKA 4M3TA 4KHYA 2HMIA 4OLBA 3WNHA 1JXEA 3RWUA 4EZ6A 3NHGA 1EP4A 4ICLA 5I42A 2YHBA 1JLFA 4FJ5A 1TK5A 1C6VA 5DK5A 3OYNA 1TL3A 3OS0A 3K5OA 4DSLA 1J5OA 3C95A 2X78A 3ZSVA 4RW9A 4O0JA 3VQPA 4KHWA 1C0UA 5KTQA 2D0CA 3P5JA 3NGYA 2B5JA 4LH4A 4NCAA 3OS1A 2G8KA 2F96A 4PWDA 4NCGA 5I3UA 1KRPA 3L3VA 4W5QA 4FXDA 2BANA 4DS4A 3LWMA 1CZ9A 3CYMA 4ELTA 4ZTJA 4M3UA 3VQEA 1JLQA 4I9LA 1GOBA 4AHCA 1S6QA 1U49A 3OYIA 3L8BA 2OZMA 3AA2A 3A2FA 1WNSA 3DYAA 3PUFA 3IRXA 1TL1A 2WONA 4CIFA 4FLYA 5HRPA 4GMJB 1SV5A 3LAKA 2Y1IA 1RDAA 2HHSA 4OPJA 2ZE2A 4RW7A 4E89A 3VQ6A 1RTIA 3AVFA 4GVMA 4H4OA 3OJSA 3H08A 3L3UA 3QO9A 1REVA 4DSKA 4M3WA 4KHNA 1D5AA 4E3SA 3AA3A 1XWLA 4ID1A 3NF8A 3OYHA 1N6QA 4Q0BA 3OYFA 4OKKA 4KHQA 4E7JA 3O3FA 4DQSA 4IKFA 3AVCA 1NJYA 1NK4A 4E19A 1G15A 1KVCA 2P1JA 3V1RA 4KFBA 3HVRA 2OPRA 3L2RA 3TWHA 3V9XA 4DS5A 2G8VA 1LWCA 4O0IA 4H4MA 3LP3A 4FCYA 4C8KA 2D0BA 2P51A 2HNDA 4C8NA 3NH1A 3KLEA 4FLZA 2XY7A 1S9GA 3NH2A 4J2EA 1Y97A 4XIUA 3RMBA 3ITHA 4KTZA 2PY5A 3VQBA 3KJVA 3HJFA 3AA4A 1W9HA 2QKBA 2DY4A 2E4LA 1CXUA 3M8RA 4CJVA 1RT1A 4F2RA 3ZT0A 4AH9A 1QHTA 1WSEA 4CECA 3JSMA 3F73A 1GOCA 1U48A 2OZSA 4FZXC 3LALA 4DSFA 2ETJA 4GW6A 4FZZA 2DTUA 1MU2A 3NF7A 1X9WA 5FRNA 1QSYA 3HP9A 4F8RA 3HM9A 3NDKA 4J2BA 4CEBA 3AVGA 3T1AA 1RTDA 3O4QA 1RNHA 2E6MA 3HK2A 3B6OA 1WN7A 3MXJA 3QEIA 2X6SA 4CJUA 3AVNA 1ZBFA 4FLWA 1WSGA 4M41A 3SQ4A 3G10A 1HYVA 4QOZB 4YNQA 4CJRA 3K59A 3FFIA 3DLRA 1S9EA 1TVRA 2OPPA 1A5XA 3QNOA 1VRTA 3SJJA 4N56A 2O4IA 1LAWA 4OKEA 1S1VA 2JGUA 4JLHA 4RW4A 3ZSWA 4DTNA 4E7HA 2XY5A 2GBZA 1EXQA 1UA1A 2IAJA 1ITGA 1S1WA 2HNYA 3MEGA 1JLCA 3NFAA 1TGOA 4FK2A 3U3GA 4BWJA 4RG8A 3WNGA 3NH0A 2FBVA 1VSIA 3T19A 3MXMA 4FJJA 1NKEA 3NF6A 1JL2A 3DRRA 4CGGA 3SUNA 2Z1GA 3AVKA 1Z26A 4LSLA 4E1MA 4FJMA 1ZBUA 3O4NA 5HRSA 4DLGA 1KVBA 3AO5A 3SPYA 1D8YA 4LSNA 3OYGA 4CJPA 4PY5A 1RTHA 3ZT4A 1UAXA 4FLXA 4J2AA 1KTQA 3C94A 1NK7A 3PY8A 3CM6A 2D5RA 2VG7A 4K8ZA 3HPHA 3SZ2A 1LWEA 2OPSA 4IG0A 1BGXT 3DLGA 4DFPA 1Z25A 3DRSA 1VSEA 1CLQA 5KGWA 4CGJA 1LW0A 2BE2A 2Z1HA 3NBPA 4O55A 3K58A 2HB5A 1J9AA 3KKRA 4DTXA 3AVJA 3QERA 4B08A 4F4KA 3AVLA 1BHLA 4I2QA 1T05A 1EKEA 4CEFA 4B9UA 5JS2A 3OVNA 4DQIA 1KCFA 3AVMA 3L2VA 2YHAA 4BE0A 4DFKA 3C6TA 4EP5A 2O4GA 3NCIA 3ZT3A 1KVAA 3TARA 3BDPA 1FKPA 3LANA 3VQQA 4CJ4A 3P83D 3TI0A 4HCBA 2QK9A 1QS4A 3WNEA 3K5MA 3MECA 3LZIA 4DTUA 3SV3A 5CYMA 3LWLA 4I9QA 2G8WA 4KV8A 4DSIA 3RMCA 1TKXA 1HMVA 4CJSA 1UWBA 2HHVA 1O1WA 3KK2A 3LDSA 3TR8A 2B4JA 2XO7A 1KLNA 4B9SA 1TV6A 3QEXA 1HYSA 4E7IA 4CF2A 1JLEA 4IG3A 4BDPA 3QLHA 1VRUA 1D9DA 4CJLA 2Z1JA 4O44A 1HRHA 1QTMA 1W0HA 4DF4A 4E7LA 3TAEA 1VSKA 2F8SA 4Y1DA 2D0AA 4Q5VA 3VQCA 1JKHA 2IGIA 4FW1A 1X9MA 2KZZA 2DFFA 1L3VA 3U6FA 4NCBA 5J2QA 4KB0A 3UIQA 2YNHA 1DLOA 3SUOA 3ZCMA 4W5RA 5J2MA 1IKYA 4OKJA 1C0MA 3PX6A 4E0DA 4CHOA 3ZSQA 3VQ4A 1EETA 3V1OA 1NK8A 1DTTA 4CGIA 5J2NA 2HVIA 3LP1A 4W5NA 4CJTA 4CF8A 1L3SA 4KHUA 4CFAA 3TAFA 4H8KA 4B8AB 3RR8A 4DQRA 4TSXA 1BQMA 3K2PA 2F8TA 4CEAA 4Z4EA 2HNZA 4AHTA 1C0TA 2G8HA 1VSHA 3AO4A 3B6PA 1QQCA 4CJEA 1RT3A 4HHTA 1Q9XA 5FROA 4KAZA 4Z4FA 3SV4A 4FLUA 5E41A 4JS5A 5C24A 4KI6A 4C8OA 3AO3A 3E01A 1IKXA 3ZT1A 3S3OA 1XHZA 1B92A 3AVAA 4IBNA 3P1GA 4HTUA 3TAQA 1HNVA 2RKIA 4CFBA 1RDBA 4B9TA 1QE1A 2I5JA 2LSNA 4FJXA 2Z1IA 4M45A 2QXFA 2DFHA 3D45A 1Q8IA 4DTMA 4RW8A 4B3OA 3TABA 4CGHA 3C6UA 4O5BA 4AHVA 4B9NA 4B9LA 3KLFA 4FJ8A 1WLJA 1IKVA 4FJ7A 1RDCA 3VN5A 2W42A 1NJZA 4DSJA 4ELVA 3AA5X 1S1XA 1CZBA 3SNNA 3SPZA 1TK8A 3CM5A 3KIOA 3RMDA 2IS3A 4FYDA 3HVTA 3QINA 3KK1A 2ZQBA 4E7KA 4M3YA 1JLBA 4DSEA 3TAMA 2KFNA 3DLEA 2DFEA 4NYNA 3SUPA 1L3TA 1WAJA 2IDOA 1X9SA 1BIUA 3I0SA 3V81A 1F21A 4F3TA 3NAEA 3VQ7A 1CXQA 4AHRA 3NE6A 3LP2A 1ZBHA 3HO1A 3SUQA 2HHQA 4CHQA 3SQ2A 1JLAA 3CG7A 1TAUA 1JXBA 3ALYA 2FBYA 2XY6A 4AHUA 4FJHA 2HW3A 1U4BA 3VQ9A 4CK1A 2HHWA 4CEOA 1Q9YA 3QEPA 1KFSA 4Z4IA 4E1NA 3PO5A 3OYBA 4CEDA 1YVUA 3LPUA 2XRIA 3V9WA 4FJGA 1UOCA 3OJUA 4N41A 4M3RA 1ZYQA 1ASUA 2VWKA 4L8RB 3RTVA 3OYDA 3IS9A 1ASWA 1U47A 2FBTA 3HL8A 1KFDA 3ZSZA 4CJFA 4FK4A 4CFCA 1HQEA 2HHUA 3DLHA 4CF0A 1RTJA 1SL1A 4ELUA 3PX4A 2Q3SA 2ATQA 3O3HA 4F3OA 4CCHA 1NK9A 5KRSA 4CHPA 5CZ2A 1WSJA 1BI4A 4FM2A 1TKDA 4FJLA 4ID5A 4DTOA 3ZSYA 3SQ1A 3V9ZA 4DTJA 5EU7A 2WOMA 2YKNA 3HSTB 4Z4HA 3M8SA 3K5LA 1RBRA 3V9UA 2A1RA 1T8EA 4FJNA 1T7PA 1RT4A 3V9SA 3HT3A 3QEWA 3PX0A 1RBTA 4CF9A 3EY1A 1S6PA 4JS4A 4DF8A 3ZSRA 3S9HA 3MXIA 1KLMA 1I3AA 3M8QA 4OGCA 3JYTA 1U45A 1T03A 1RCHA 1YT3A 2X6NA 3VQAA 3SQ0A 2EHGA 1TKZA 3DM2A 2ITGA 1LWFA 1IG9A 4CJ3A 3I0RA 3D0PA 4IDKA 3HP6A 3TANA 4AILC 1RBUA 3OYMA 3ISNC 1RBSA 4DFJA 1NK5A 1S1UA 2IC3A 1A5VA 1IH7A 5SWMA 4AHSA 3EYZA 5KGXA 1RBVA 5K14A 4J2DA 3V1QA 3MAQA 2GUIA 3OS2A 3DLBA 3TAGA 4JRPA 1X1PA 4QAGA 4HUEA 4HCCA 3L2UA 3DLKA 1SKWA 4CGDA 3WNFA 3ZSOA 4FM1A 4DQQA 3LPTA 4CJ5A 5HP1A 3M8PA 3TAPA 2KQ2A 1WAFA 1B9FA 3OY9A 2EX3A 1VSDA 1BI4B 4K8XA 1HQUA 1VSFA 3OYKA 1HPZA 4CJKA 3L2QA 3HXMA 3CFOA 4BDZA 2YKMA 3HPOA 4FLVA 2XY8A 4PA1A 5SZTA 2PZSA 2HHTA 1WSFA 4DWIA 3ZT2A 2IOCA 4ZTFA 1BCOA 3KLIA 4FJIA 4CE9A 3EZ5A 3O3GA 2RF2A 4DG1A 1TK0A 1SKRA 1J54A 1QSSA 1FKOA 4CK3A 3AVBA 3ZSXA 1EX4A 2VG5A 4CEZA 4KI4A 4YFUA 1L3UA 1C1AA 3OYEA 4BDYA 5D3GA 5CZ1A 3KLGA 3QETA 4FM0A 2GV9A 4FVMA 4CK2A 4BWMA 1L5UA 3RRGA 5J2PA 3G0ZA 4HVJA 1VSLA 4CF1A 5KRTA 4DMNA 4EZ9A 1WSHA 3SCXA 3OYJA 3S3MA 1NK0A 3KD1E 3KLHA 4DTRA 5C42A 4CERA 4ZHRA 3V4IA 3HYFA 4PQUA 1VSJA 4HUFA 3AVHA 4CESA 1XI1A 4M42A 3U3YA 4KO0A 3NF9A 1A5WA 1ASVA 4CIEA 3T3FA 1S1TA 1LV5A 4W5OA 3LP0A 1ZBIA 2P5OA 3K5NA 3ULDA 1QSLA 4KREA 1C1CA 1TKTA 2G8IA 4Y1CA 2KTQA 1HJRA 3SI6A 2VG6A 4BE2A 1RT2A 2OPQA 4Z4GA 4F2SA 4CEQA 4DU3A 2YV0X 5HBMA 4CHZA 4LY7A 1C1BA 1NJWA 1SL0A 4OVLA 3ASMA 3K57A 1TAQA 3VQ8A 4FZYA 2NUBA 1BQNA 4MQ3A 4IFVA 4HUGA 2Y1JA 4BACA 1NOYA 2PYLA 4KPYA 1RT5A 4RW6A 5HLFA 3KK3A 3CFPA 3RRHA 4KKOA 3IAYA 2E6LA 4OGEA 1XC9A 1SKSA 3AV9A 1IO2A 2OA8A 1J53A 4B9MA 4FW2A 1HYZA 5CYQA 4NYFA 3CQ8A 4KRFA 2YNGA 3CFRA 1NK6A 3THVA 4CHYA 2G8UA 3AVIA 1KSPA 3VQ5A 4I2PA 3KTQA 4BE1A 3PV8A 1ZBLA 2BDPA 2KZMA 3QIOA 3V6DA 4LD0A 3L2WA 2RPIA 2A1SA 4R5PA 4CJWA 1NKBA 1N5YA 4C8LA 4O4GA 4QCLA 1NKCA 1BISA 3MEEA 1VK0A 3DOKA 2AJQA 4B8CA 1NOZA 2HVHA 5C25A 2OYQA 1GOAA 1IKWA 3HPGA 2BGGA 2YNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N76 A;  2KFZ A;  4G1Q A;  3DRP A;  1FXX A;  5HRN A;  2FC0 A;  4DTP A;  4OPK A;  4CFD A;  2R7Y A;  1UA0 A;  2B6A A;  4KTQ A;  2VWJ A;  1FK9 A;  2X74 A;  5T7B A;  4DU4 A;  4Z4C A;  1R0A A;  5CY4 A;  2ZD1 A;  2KW4 A;  4IFY A;  5JS1 A;  4CEE A;  2QKK A;  5DMR A;  1SL2 A;  1SUQ A;  3BGR A;  4OJR A;  3IG1 A;  4FLT A;  4EP4 A;  3VQD A;  4DTS A;  3SYZ A;  4DFM A;  4CGF A;  1WSI A;  1YTU A;  3QIP A;  3RR7 A;  2JLE A;  4FJ9 A;  1BIZ A;  1VSM A;  1K6Y A;  3MED A;  4M3Z A;  3QNN A;  5HRO A;  4B9V A;  5HRR A;  2YNF A;  3OYA A;  1DTQ A;  4OLA A;  3DOL A;  1B9D A;  3KKS A;  4PUO A;  4N47 A;  4Z0U A;  2HHX A;  4DU1 A;  3PO4 A;  3QEV A;  2PYJ A;  4C8M A;  4JRQ A;  3VA0 A;  1LAV A;  4CJQ A;  3NGI A;  3DMJ A;  1LW2 A;  4CIG A;  1RDD A;  1JLG A;  3AO2 A;  5FDL A;  1RT7 A;  2RN2 A;  2XHB A;  4DLE A;  3I8D A;  3KD5 E;  1XHX A;  5KI6 A;  3AO1 A;  1YTA A;  2P5G A;  4CHN A;  1RIL A;  3QES A;  4LH5 A;  1JL1 A;  1S5J A;  1BL3 A;  4I7F A;  3S3N A;  3DI6 A;  1NJX A;  4UQG A;  4M3X A;  1I39 A;  4FK0 A;  3RMA A;  2G8F A;  1RT6 A;  4N5S A;  5FRM A;  1U04 A;  3VA3 A;  4KTW A;  4WE1 A;  3OYL A;  4KHS A;  4MFB A;  4W5T A;  3NGZ A;  3OYC A;  1HNI A;  2FBX A;  3LAM A;  1D9F A;  4DQP A;  1BCM A;  3LZJ A;  3F9K A;  4KB1 A;  5J1E A;  4FJK A;  4M3T A;  4KHY A;  2HMI A;  4OLB A;  3WNH A;  1JXE A;  3RWU A;  4EZ6 A;  3NHG A;  1EP4 A;  4ICL A;  5I42 A;  2YHB A;  1JLF A;  4FJ5 A;  1TK5 A;  1C6V A;  5DK5 A;  3OYN A;  1TL3 A;  3OS0 A;  3K5O A;  4DSL A;  1J5O A;  3C95 A;  2X78 A;  3ZSV A;  4RW9 A;  4O0J A;  3VQP A;  4KHW A;  1C0U A;  5KTQ A;  2D0C A;  3P5J A;  3NGY A;  2B5J A;  4LH4 A;  4NCA A;  3OS1 A;  2G8K A;  2F96 A;  4PWD A;  4NCG A;  5I3U A;  1KRP A;  3L3V A;  4W5Q A;  4FXD A;  2BAN A;  4DS4 A;  3LWM A;  1CZ9 A;  3CYM A;  4ELT A;  4ZTJ A;  4M3U A;  3VQE A;  1JLQ A;  4I9L A;  1GOB A;  4AHC A;  1S6Q A;  1U49 A;  3OYI A;  3L8B A;  2OZM A;  3AA2 A;  3A2F A;  1WNS A;  3DYA A;  3PUF A;  3IRX A;  1TL1 A;  2WON A;  4CIF A;  4FLY A;  5HRP A;  4GMJ B;  1SV5 A;  3LAK A;  2Y1I A;  1RDA A;  2HHS A;  4OPJ A;  2ZE2 A;  4RW7 A;  4E89 A;  3VQ6 A;  1RTI A;  3AVF A;  4GVM A;  4H4O A;  3OJS A;  3H08 A;  3L3U A;  3QO9 A;  1REV A;  4DSK A;  4M3W A;  4KHN A;  1D5A A;  4E3S A;  3AA3 A;  1XWL A;  4ID1 A;  3NF8 A;  3OYH A;  1N6Q A;  4Q0B A;  3OYF A;  4OKK A;  4KHQ A;  4E7J A;  3O3F A;  4DQS A;  4IKF A;  3AVC A;  1NJY A;  1NK4 A;  4E19 A;  1G15 A;  1KVC A;  2P1J A;  3V1R A;  4KFB A;  3HVR A;  2OPR A;  3L2R A;  3TWH A;  3V9X A;  4DS5 A;  2G8V A;  1LWC A;  4O0I A;  4H4M A;  3LP3 A;  4FCY A;  4C8K A;  2D0B A;  2P51 A;  2HND A;  4C8N A;  3NH1 A;  3KLE A;  4FLZ A;  2XY7 A;  1S9G A;  3NH2 A;  4J2E A;  1Y97 A;  4XIU A;  3RMB A;  3ITH A;  4KTZ A;  2PY5 A;  3VQB A;  3KJV A;  3HJF A;  3AA4 A;  1W9H A;  2QKB A;  2DY4 A;  2E4L A;  1CXU A;  3M8R A;  4CJV A;  1RT1 A;  4F2R A;  3ZT0 A;  4AH9 A;  1QHT A;  1WSE A;  4CEC A;  3JSM A;  3F73 A;  1GOC A;  1U48 A;  2OZS A;  4FZX C;  3LAL A;  4DSF A;  2ETJ A;  4GW6 A;  4FZZ A;  2DTU A;  1MU2 A;  3NF7 A;  1X9W A;  5FRN A;  1QSY A;  3HP9 A;  4F8R A;  3HM9 A;  3NDK A;  4J2B A;  4CEB A;  3AVG A;  3T1A A;  1RTD A;  3O4Q A;  1RNH A;  2E6M A;  3HK2 A;  3B6O A;  1WN7 A;  3MXJ A;  3QEI A;  2X6S A;  4CJU A;  3AVN A;  1ZBF A;  4FLW A;  1WSG A;  4M41 A;  3SQ4 A;  3G10 A;  1HYV A;  4QOZ B;  4YNQ A;  4CJR A;  3K59 A;  3FFI A;  3DLR A;  1S9E A;  1TVR A;  2OPP A;  1A5X A;  3QNO A;  1VRT A;  3SJJ A;  4N56 A;  2O4I A;  1LAW A;  4OKE A;  1S1V A;  2JGU A;  4JLH A;  4RW4 A;  3ZSW A;  4DTN A;  4E7H A;  2XY5 A;  2GBZ A;  1EXQ A;  1UA1 A;  2IAJ A;  1ITG A;  1S1W A;  2HNY A;  3MEG A;  1JLC A;  3NFA A;  1TGO A;  4FK2 A;  3U3G A;  4BWJ A;  4RG8 A;  3WNG A;  3NH0 A;  2FBV A;  1VSI A;  3T19 A;  3MXM A;  4FJJ A;  1NKE A;  3NF6 A;  1JL2 A;  3DRR A;  4CGG A;  3SUN A;  2Z1G A;  3AVK A;  1Z26 A;  4LSL A;  4E1M A;  4FJM A;  1ZBU A;  3O4N A;  5HRS A;  4DLG A;  1KVB A;  3AO5 A;  3SPY A;  1D8Y A;  4LSN A;  3OYG A;  4CJP A;  4PY5 A;  1RTH A;  3ZT4 A;  1UAX A;  4FLX A;  4J2A A;  1KTQ A;  3C94 A;  1NK7 A;  3PY8 A;  3CM6 A;  2D5R A;  2VG7 A;  4K8Z A;  3HPH A;  3SZ2 A;  1LWE A;  2OPS A;  4IG0 A;  1BGX T;  3DLG A;  4DFP A;  1Z25 A;  3DRS A;  1VSE A;  1CLQ A;  5KGW A;  4CGJ A;  1LW0 A;  2BE2 A;  2Z1H A;  3NBP A;  4O55 A;  3K58 A;  2HB5 A;  1J9A A;  3KKR A;  4DTX A;  3AVJ A;  3QER A;  4B08 A;  4F4K A;  3AVL A;  1BHL A;  4I2Q A;  1T05 A;  1EKE A;  4CEF A;  4B9U A;  5JS2 A;  3OVN A;  4DQI A;  1KCF A;  3AVM A;  3L2V A;  2YHA A;  4BE0 A;  4DFK A;  3C6T A;  4EP5 A;  2O4G A;  3NCI A;  3ZT3 A;  1KVA A;  3TAR A;  3BDP A;  1FKP A;  3LAN A;  3VQQ A;  4CJ4 A;  3P83 D;  3TI0 A;  4HCB A;  2QK9 A;  1QS4 A;  3WNE A;  3K5M A;  3MEC A;  3LZI A;  4DTU A;  3SV3 A;  5CYM A;  3LWL A;  4I9Q A;  2G8W A;  4KV8 A;  4DSI A;  3RMC A;  1TKX A;  1HMV A;  4CJS A;  1UWB A;  2HHV A;  1O1W A;  3KK2 A;  3LDS A;  3TR8 A;  2B4J A;  2XO7 A;  1KLN A;  4B9S A;  1TV6 A;  3QEX A;  1HYS A;  4E7I A;  4CF2 A;  1JLE A;  4IG3 A;  4BDP A;  3QLH A;  1VRU A;  1D9D A;  4CJL A;  2Z1J A;  4O44 A;  1HRH A;  1QTM A;  1W0H A;  4DF4 A;  4E7L A;  3TAE A;  1VSK A;  2F8S A;  4Y1D A;  2D0A A;  4Q5V A;  3VQC A;  1JKH A;  2IGI A;  4FW1 A;  1X9M A;  2KZZ A;  2DFF A;  1L3V A;  3U6F A;  4NCB A;  5J2Q A;  4KB0 A;  3UIQ A;  2YNH A;  1DLO A;  3SUO A;  3ZCM A;  4W5R A;  5J2M A;  1IKY A;  4OKJ A;  1C0M A;  3PX6 A;  4E0D A;  4CHO A;  3ZSQ A;  3VQ4 A;  1EET A;  3V1O A;  1NK8 A;  1DTT A;  4CGI A;  5J2N A;  2HVI A;  3LP1 A;  4W5N A;  4CJT A;  4CF8 A;  1L3S A;  4KHU A;  4CFA A;  3TAF A;  4H8K A;  4B8A B;  3RR8 A;  4DQR A;  4TSX A;  1BQM A;  3K2P A;  2F8T A;  4CEA A;  4Z4E A;  2HNZ A;  4AHT A;  1C0T A;  2G8H A;  1VSH A;  3AO4 A;  3B6P A;  1QQC A;  4CJE A;  1RT3 A;  4HHT A;  1Q9X A;  5FRO A;  4KAZ A;  4Z4F A;  3SV4 A;  4FLU A;  5E41 A;  4JS5 A;  5C24 A;  4KI6 A;  4C8O A;  3AO3 A;  3E01 A;  1IKX A;  3ZT1 A;  3S3O A;  1XHZ A;  1B92 A;  3AVA A;  4IBN A;  3P1G A;  4HTU A;  3TAQ A;  1HNV A;  2RKI A;  4CFB A;  1RDB A;  4B9T A;  1QE1 A;  2I5J A;  2LSN A;  4FJX A;  2Z1I A;  4M45 A;  2QXF A;  2DFH A;  3D45 A;  1Q8I A;  4DTM A;  4RW8 A;  4B3O A;  3TAB A;  4CGH A;  3C6U A;  4O5B A;  4AHV A;  4B9N A;  4B9L A;  3KLF A;  4FJ8 A;  1WLJ A;  1IKV A;  4FJ7 A;  1RDC A;  3VN5 A;  2W42 A;  1NJZ A;  4DSJ A;  4ELV A;  3AA5 X;  1S1X A;  1CZB A;  3SNN A;  3SPZ A;  1TK8 A;  3CM5 A;  3KIO A;  3RMD A;  2IS3 A;  4FYD A;  3HVT A;  3QIN A;  3KK1 A;  2ZQB A;  4E7K A;  4M3Y A;  1JLB A;  4DSE A;  3TAM A;  2KFN A;  3DLE A;  2DFE A;  4NYN A;  3SUP A;  1L3T A;  1WAJ A;  2IDO A;  1X9S A;  1BIU A;  3I0S A;  3V81 A;  1F21 A;  4F3T A;  3NAE A;  3VQ7 A;  1CXQ A;  4AHR A;  3NE6 A;  3LP2 A;  1ZBH A;  3HO1 A;  3SUQ A;  2HHQ A;  4CHQ A;  3SQ2 A;  1JLA A;  3CG7 A;  1TAU A;  1JXB A;  3ALY A;  2FBY A;  2XY6 A;  4AHU A;  4FJH A;  2HW3 A;  1U4B A;  3VQ9 A;  4CK1 A;  2HHW A;  4CEO A;  1Q9Y A;  3QEP A;  1KFS A;  4Z4I A;  4E1N A;  3PO5 A;  3OYB A;  4CED A;  1YVU A;  3LPU A;  2XRI A;  3V9W A;  4FJG A;  1UOC A;  3OJU A;  4N41 A;  4M3R A;  1ZYQ A;  1ASU A;  2VWK A;  4L8R B;  3RTV A;  3OYD A;  3IS9 A;  1ASW A;  1U47 A;  2FBT A;  3HL8 A;  1KFD A;  3ZSZ A;  4CJF A;  4FK4 A;  4CFC A;  1HQE A;  2HHU A;  3DLH A;  4CF0 A;  1RTJ A;  1SL1 A;  4ELU A;  3PX4 A;  2Q3S A;  2ATQ A;  3O3H A;  4F3O A;  4CCH A;  1NK9 A;  5KRS A;  4CHP A;  5CZ2 A;  1WSJ A;  1BI4 A;  4FM2 A;  1TKD A;  4FJL A;  4ID5 A;  4DTO A;  3ZSY A;  3SQ1 A;  3V9Z A;  4DTJ A;  5EU7 A;  2WOM A;  2YKN A;  3HST B;  4Z4H A;  3M8S A;  3K5L A;  1RBR A;  3V9U A;  2A1R A;  1T8E A;  4FJN A;  1T7P A;  1RT4 A;  3V9S A;  3HT3 A;  3QEW A;  3PX0 A;  1RBT A;  4CF9 A;  3EY1 A;  1S6P A;  4JS4 A;  4DF8 A;  3ZSR A;  3S9H A;  3MXI A;  1KLM A;  1I3A A;  3M8Q A;  4OGC A;  3JYT A;  1U45 A;  1T03 A;  1RCH A;  1YT3 A;  2X6N A;  3VQA A;  3SQ0 A;  2EHG A;  1TKZ A;  3DM2 A;  2ITG A;  1LWF A;  1IG9 A;  4CJ3 A;  3I0R A;  3D0P A;  4IDK A;  3HP6 A;  3TAN A;  4AIL C;  1RBU A;  3OYM A;  3ISN C;  1RBS A;  4DFJ A;  1NK5 A;  1S1U A;  2IC3 A;  1A5V A;  1IH7 A;  5SWM A;  4AHS A;  3EYZ A;  5KGX A;  1RBV A;  5K14 A;  4J2D A;  3V1Q A;  3MAQ A;  2GUI A;  3OS2 A;  3DLB A;  3TAG A;  4JRP A;  1X1P A;  4QAG A;  4HUE A;  4HCC A;  3L2U A;  3DLK A;  1SKW A;  4CGD A;  3WNF A;  3ZSO A;  4FM1 A;  4DQQ A;  3LPT A;  4CJ5 A;  5HP1 A;  3M8P A;  3TAP A;  2KQ2 A;  1WAF A;  1B9F A;  3OY9 A;  2EX3 A;  1VSD A;  1BI4 B;  4K8X A;  1HQU A;  1VSF A;  3OYK A;  1HPZ A;  4CJK A;  3L2Q A;  3HXM A;  3CFO A;  4BDZ A;  2YKM A;  3HPO A;  4FLV A;  2XY8 A;  4PA1 A;  5SZT A;  2PZS A;  2HHT A;  1WSF A;  4DWI A;  3ZT2 A;  2IOC A;  4ZTF A;  1BCO A;  3KLI A;  4FJI A;  4CE9 A;  3EZ5 A;  3O3G A;  2RF2 A;  4DG1 A;  1TK0 A;  1SKR A;  1J54 A;  1QSS A;  1FKO A;  4CK3 A;  3AVB A;  3ZSX A;  1EX4 A;  2VG5 A;  4CEZ A;  4KI4 A;  4YFU A;  1L3U A;  1C1A A;  3OYE A;  4BDY A;  5D3G A;  5CZ1 A;  3KLG A;  3QET A;  4FM0 A;  2GV9 A;  4FVM A;  4CK2 A;  4BWM A;  1L5U A;  3RRG A;  5J2P A;  3G0Z A;  4HVJ A;  1VSL A;  4CF1 A;  5KRT A;  4DMN A;  4EZ9 A;  1WSH A;  3SCX A;  3OYJ A;  3S3M A;  1NK0 A;  3KD1 E;  3KLH A;  4DTR A;  5C42 A;  4CER A;  4ZHR A;  3V4I A;  3HYF A;  4PQU A;  1VSJ A;  4HUF A;  3AVH A;  4CES A;  1XI1 A;  4M42 A;  3U3Y A;  4KO0 A;  3NF9 A;  1A5W A;  1ASV A;  4CIE A;  3T3F A;  1S1T A;  1LV5 A;  4W5O A;  3LP0 A;  1ZBI A;  2P5O A;  3K5N A;  3ULD A;  1QSL A;  4KRE A;  1C1C A;  1TKT A;  2G8I A;  4Y1C A;  2KTQ A;  1HJR A;  3SI6 A;  2VG6 A;  4BE2 A;  1RT2 A;  2OPQ A;  4Z4G A;  4F2S A;  4CEQ A;  4DU3 A;  2YV0 X;  5HBM A;  4CHZ A;  4LY7 A;  1C1B A;  1NJW A;  1SL0 A;  4OVL A;  3ASM A;  3K57 A;  1TAQ A;  3VQ8 A;  4FZY A;  2NUB A;  1BQN A;  4MQ3 A;  4IFV A;  4HUG A;  2Y1J A;  4BAC A;  1NOY A;  2PYL A;  4KPY A;  1RT5 A;  4RW6 A;  5HLF A;  3KK3 A;  3CFP A;  3RRH A;  4KKO A;  3IAY A;  2E6L A;  4OGE A;  1XC9 A;  1SKS A;  3AV9 A;  1IO2 A;  2OA8 A;  1J53 A;  4B9M A;  4FW2 A;  1HYZ A;  5CYQ A;  4NYF A;  3CQ8 A;  4KRF A;  2YNG A;  3CFR A;  1NK6 A;  3THV A;  4CHY A;  2G8U A;  3AVI A;  1KSP A;  3VQ5 A;  4I2P A;  3KTQ A;  4BE1 A;  3PV8 A;  1ZBL A;  2BDP A;  2KZM A;  3QIO A;  3V6D A;  4LD0 A;  3L2W A;  2RPI A;  2A1S A;  4R5P A;  4CJW A;  1NKB A;  1N5Y A;  4C8L A;  4O4G A;  4QCL A;  1NKC A;  1BIS A;  3MEE A;  1VK0 A;  3DOK A;  2AJQ A;  4B8C A;  1NOZ A;  2HVH A;  5C25 A;  2OYQ A;  1GOA A;  1IKW A;  3HPG A;  2BGG A;  2YNI A; 
#chains in the Genus database with same CATH topology
 1QQO A;  4N76 A;  1FXX A;  2YHW A;  3CCR N;  5AQQ A;  3MWT A;  1UA0 A;  3O4W A;  2X74 A;  3MX5 A;  1R0A A;  4FWN A;  1CZA N;  2O8D B;  4JD2 B;  4MO4 A;  4CEE A;  2QKK A;  1OH5 A;  4OJR A;  2O8C A;  2W6L A;  2HHH K;  3SYZ A;  2ZJQ L;  4FL9 A;  4JI3 K;  4K41 A;  3MED A;  3QNN A;  2JWL A;  3VEY A;  2J4R A;  3OYA A;  4OLA A;  3IMX A;  4PUO A;  2AP1 A;  3QEV A;  4CJQ A;  4BRF A;  3DMJ A;  4EFH A;  1RT7 A;  3I8D A;  3BP8 A;  1QHA A;  5FPN A;  4EIA A;  4CHN A;  1RIL A;  3QES A;  2P9N B;  3ULE A;  1NJX A;  4I7F A;  4BC4 A;  1NG9 A;  4M3X A;  4FK0 A;  2P9K A;  4N5S A;  5FRM A;  3OYL A;  4W5T A;  3OYC A;  1HNI A;  4H0V B;  5B8H A;  3LAM A;  4BVP A;  3ZET B;  4KB1 A;  4M3T A;  3R9P A;  2HMI A;  4OLB A;  4YOY A;  4XEI A;  1JXE A;  1Q81 O;  1YIT N;  1JLF A;  3O1B A;  1TL3 A;  1J5O A;  3C95 A;  2X78 A;  1GLL O;  1D4X A;  3VQP A;  3LM9 A;  2D0C A;  3P5J A;  4LH4 A;  1E4F T;  4DKW A;  1W97 L;  4NCG A;  3U4L A;  5I3U A;  4JI4 K;  1HUX A;  1VQP N;  5AZJ A;  1VQL N;  4OPA A;  2P9P A;  4M3U A;  4XH5 A;  3VQE A;  3PLA A;  1GOB A;  4AHC A;  3OYI A;  1QZ5 A;  4DV0 K;  3DYA A;  4FLY A;  4CIF A;  1TL1 A;  2WON A;  3LL3 A;  3LDL A;  3CF5 L;  3AVF A;  2O8F B;  2FLO A;  2ZF5 O;  4JAX A;  4M3W A;  2P9I B;  1X3M A;  3D2E A;  2GEL A;  3DAW A;  1NJY A;  4E19 A;  1NK4 A;  2P1J A;  3HVR A;  1LWC A;  4FCY A;  4H4M A;  2P51 A;  3NH1 A;  3KLE A;  3ZX3 A;  4XIU A;  2P9U A;  3K9J A;  3E1Y A;  3VQB A;  3CCL N;  4BRC A;  2DY4 A;  3DXK A;  5F1X A;  3BUZ B;  3M8R A;  3EN9 A;  1RT1 A;  4CEC A;  4BR9 A;  3LAL A;  4EHT A;  4DSF A;  2DTU A;  2E2N A;  1MU2 A;  3NF7 A;  1QSY A;  4F8R A;  3HM9 A;  3NDK A;  3AVG A;  1YVN A;  5KQ8 A;  1RNH A;  3B6O A;  4BC3 A;  4CJU A;  4FLW A;  1WSG A;  4JKA A;  3DLR A;  3HTV A;  5AJ3 K;  1A5X A;  3CC2 N;  4N56 A;  3HOT A;  4B1U B;  4WQ5 C;  1S1V A;  2JGU A;  4RW4 A;  1UA1 A;  2XY5 A;  1EXQ A;  2IAJ A;  1S1W A;  2HNY A;  3TSQ A;  3VES A;  3NH0 A;  2FBV A;  1XMO K;  1I94 K;  1VSI A;  3KZB A;  5LY3 A;  1DT9 A;  4DUY K;  4H0P A;  2Z1G A;  1Z26 A;  3TSP A;  4LSL A;  4E1M A;  1KVB A;  3AO5 A;  1D8Y A;  3OYG A;  1OH8 A;  1UAX A;  1KTQ A;  4BRE A;  4YOX A;  4OPH A;  5AQL A;  1TYQ B;  2E1Y A;  3DLG A;  3VF4 A;  1CLQ A;  3DRS A;  3QB0 A;  4CGJ A;  4FWO A;  2Z1H A;  4O55 A;  4F4K A;  4B08 A;  1T05 A;  1EKE A;  4B9U A;  3OVN A;  4DQI A;  1BDG A;  3I56 N;  4K0K K;  3F9M A;  2O4G A;  5CE3 A;  3NCI A;  4JKC A;  1FKP A;  3LAN A;  2A3Z A;  1N33 K;  4FWR A;  4DTU A;  3SV3 A;  1Z6R A;  4DSI A;  3RMC A;  1HMV A;  1YHQ N;  1O1W A;  3KK2 A;  2V52 B;  3ZX0 A;  1KLN A;  4X66 K;  4PHT X;  1HYS A;  4CF2 A;  4BDP A;  1D9D A;  2Z1J A;  2HST A;  4DV7 K;  4JKG B;  3C6H A;  4BC5 A;  2F8S A;  2D0A A;  4LF8 K;  3VQC A;  3ATU A;  2KZZ A;  2DFF A;  3U6F A;  4NCB A;  3A0I X;  3EL2 A;  3BEX A;  5BR8 K;  4OKJ A;  1C0M A;  2QWO A;  3CJ7 A;  4CHO A;  4DR2 K;  1DTT A;  4I6M B;  1JCE A;  3CHW A;  4KHU A;  4CFA A;  3QIC A;  4TSX A;  4A2B A;  4CEA A;  4Z4E A;  3C6A A;  2G8H A;  1BOT O;  4CJE A;  4HHT A;  1Q9X A;  5FRO A;  3SV4 A;  4AQY K;  4JS5 A;  5C24 A;  3ZEU A;  3E01 A;  3M3Z A;  3ZT1 A;  3S3O A;  3FE1 A;  1ILY A;  1HNV A;  3MCA B;  4BR2 A;  5AR0 A;  4CFB A;  1QE1 A;  2I5J A;  2LSN A;  3IFR A;  2ZGZ A;  1BA1 A;  5AQW A;  3MN6 A;  4AHV A;  4FJ8 A;  3KLF A;  1YXQ A;  2CGL A;  1RDC A;  3NVM A;  2W42 A;  2A6A A;  1NJZ A;  2YJF A;  4LF6 K;  4JD2 A;  5F2R A;  3SNN A;  2HF4 A;  1NGI A;  2EWS A;  3RMD A;  3QBW A;  3HVT A;  4EHU A;  4M3Y A;  3LDN A;  3TAM A;  3DLE A;  3O9T A;  4NYN A;  1WAJ A;  3I0S A;  1S3X A;  2QWR A;  3NAE A;  2W40 A;  3VQ7 A;  1ZBH A;  2FBY A;  4FJH A;  2HW3 A;  4CK1 A;  4Z4I A;  4AF1 A;  3LPU A;  4A62 A;  3CPW M;  3V9W A;  1BO5 O;  5DM6 L;  3HL8 A;  3ZSZ A;  3WXI A;  4H5V A;  4A59 A;  2ZM6 K;  3VEV A;  3DLH A;  1N36 K;  2ATQ A;  3O3H A;  4F3O A;  5CHI A;  1NK9 A;  1WBD A;  3OA9 A;  1W7A A;  4DB3 A;  1TKD A;  3ZSY A;  2WOM A;  4B9Q A;  1KAY A;  1X9J A;  5HOO A;  3K5L A;  3V9U A;  1T8E A;  4PKI A;  3CJ9 A;  3CCJ N;  1RBT A;  4CF9 A;  2O8E A;  4DF8 A;  3ZSR A;  3S9H A;  1I3A A;  3M8Q A;  3MMV A;  1U45 A;  1RCH A;  5BRF A;  3DM2 A;  2NLX A;  1EWQ A;  3FZF A;  3AGK A;  1S1U A;  3EYZ A;  1NGE A;  1RBV A;  3V1Q A;  3OS2 A;  3HI0 A;  1Q7Y O;  3DLB A;  3TAG A;  1XNQ K;  3CI5 A;  1G99 A;  4HCC A;  3DLK A;  4CGD A;  2O8B B;  4HWI A;  2ZJP L;  3M8P A;  2F9W A;  4LFB K;  2KQ2 A;  1ATS A;  1YJN N;  1VSF A;  4CJK A;  4FLV A;  3CJC A;  3O9Q A;  2HHT A;  4DWI A;  3ZT2 A;  1BCO A;  4WQ5 A;  2OAN A;  4CE9 A;  2RF2 A;  1SKR A;  5FPM A;  1J54 A;  1QSS A;  1FKO A;  4CK3 A;  4PL8 A;  4RCH A;  2VG5 A;  4KI4 A;  1U2V A;  3GL1 A;  5C2F A;  3OYE A;  3D6R A;  3KLG A;  2GV9 A;  1HNW K;  3TTD A;  1L5U A;  4BWM A;  1YUW A;  3G0Z A;  1VSL A;  4CF1 A;  3KK7 A;  4WQ4 C;  1NK0 A;  3KD1 E;  3CC4 N;  4BG8 A;  4B1Y B;  5C42 A;  4JHD B;  1VSJ A;  1QQN A;  1S72 N;  3O5B A;  4KO0 A;  4CIE A;  1ZBI A;  3AY9 A;  3UKR A;  1C1C A;  2G8I A;  2KTQ A;  3IDH A;  2HBJ A;  4DV2 K;  4BRH A;  2VG6 A;  4F2S A;  2ASP A;  1YJ9 N;  4ILJ A;  1HNX K;  4B1V A;  4CHZ A;  1SL0 A;  2V51 B;  2FSN A;  3ASM A;  4CBU A;  3K57 A;  4FZY A;  5F0X A;  4MQ3 A;  4IFV A;  2Y1J A;  4IJN A;  1K8K B;  4GNI A;  3HRG A;  1XC9 A;  5M1Q A;  3AV9 A;  1IO2 A;  2ZWH A;  4LC9 B;  4FW2 A;  3CQ8 A;  5BPL A;  4KRF A;  5C15 A;  4F9O A;  3VQ5 A;  1KSP A;  2KZM A;  5AFU H;  3QIO A;  3L2W A;  4BRP A;  1NKB A;  5AQN A;  4O4G A;  3H6E A;  1BIS A;  3SAG A;  3MEE A;  3DOK A;  3C0B A;  2P9L B;  1GOA A;  3R3L A;  2HBM A;  3MN5 A;  2BGG A;  2YNI A;  4BRI A;  1VQM N;  2KFZ A;  2KLA A;  4YOU A;  4FWQ A;  2FC0 A;  3BZC A;  2B6A A;  5ADX H;  2VWJ A;  4KTQ A;  4DU4 A;  1RDW X;  5CY4 A;  4JK8 A;  2KW4 A;  4IFY A;  1NLV A;  3K9K A;  5DMR A;  4JK7 A;  1SL2 A;  2Q0R A;  3EEQ A;  4V19 S;  4FLT A;  5AZI B;  3VQD A;  4DFM A;  1WSI A;  2HBK A;  3FLC O;  3RR7 A;  2JLE A;  1BIZ A;  4M3Z A;  1K6Y A;  5AQX A;  5HRO A;  3SAH A;  4Z0U A;  4DU1 A;  4C8M A;  4JRQ A;  3VA0 A;  1LAV A;  4XH4 A;  3CCV N;  1LW2 A;  4CIG A;  5BRD A;  1M1K O;  1RDD A;  2RN2 A;  3AO1 A;  3C7N A;  3J7Y P;  4WFN L;  4LH5 A;  1JL1 A;  4I6M A;  1I39 A;  3HOS A;  1RT6 A;  1S22 A;  3R6M A;  4KTW A;  4KHS A;  4MFB A;  1WBB A;  3NGZ A;  3OHR A;  2FBX A;  3TSU A;  1D9F A;  1BCM A;  3F9K A;  1H1V A;  2BTF A;  5J1E A;  3GOI A;  4ICL A;  1C6V A;  4OX9 K;  3E9O A;  4DSL A;  3MWP A;  3G4S N;  5BRE A;  4RTF D;  1BA0 A;  4A5B A;  4DCH A;  4DV6 K;  1XQS C;  1X3N A;  2QXL A;  4EAH D;  4FXD A;  4KBO A;  2BAN A;  4ELT A;  4ZTJ A;  4I9L A;  1HLU A;  1XNR K;  3H3O B;  2HBL A;  1WNS A;  3PUF A;  3FR0 A;  5AQF A;  4GMJ B;  1RDA A;  4OPJ A;  1WUA A;  5JLH A;  1MWM A;  3QFU A;  3OJS A;  4DSK A;  1D5A A;  4E3S A;  3UKU B;  4FPB A;  3NF8 A;  3OYH A;  3P31 A;  4OKK A;  4KHQ A;  3AVC A;  1SKS A;  4B9M A;  3V9X A;  5AQG A;  2D0B A;  3OBW A;  2HND A;  4FLZ A;  5EOY A;  2YCH A;  1Y97 A;  5AQY A;  4KTZ A;  4KH4 A;  3HJF A;  3AGR A;  1W9H A;  3O1W A;  4CZF A;  2QKB A;  4IEI A;  3ZT0 A;  3CPE A;  1QHT A;  4AH9 A;  4FZX C;  3F73 A;  1GOC A;  2QM1 A;  2ETJ A;  3TPQ A;  4BQL A;  1X9W A;  5AQJ A;  4J2B A;  4CEB A;  1HKG A;  1RTD A;  2E6M A;  3TTC A;  1WN7 A;  3MXJ A;  2X6S A;  3AVN A;  1ZBF A;  3VET A;  3SQ4 A;  3G10 A;  1HYV A;  3LDO A;  3K59 A;  1S9E A;  1TVR A;  3QNO A;  3SK3 A;  4JI2 K;  2O4I A;  2E2O A;  3VOV A;  4OKE A;  3VF2 A;  4AM7 A;  4E7H A;  5JVG L;  3MEG A;  3NFA A;  2NRZ A;  3CME N;  4BWJ A;  4RG8 A;  3WNG A;  2QWQ A;  3MXM A;  4OO1 J;  3DRR A;  4PL7 A;  4CGG A;  3AVK A;  3PIO L;  4FJM A;  3EKS A;  4DLG A;  4JKH A;  4PY5 A;  4J2A A;  1NGC A;  4WQ4 A;  3PY8 A;  2I7P A;  2QTD A;  3GE1 A;  3SZ2 A;  1Z25 A;  4BR5 A;  2Y1I A;  1LW0 A;  3NBP A;  4CD1 A;  3K58 A;  5BPM A;  3AVJ A;  2VCP A;  5E84 A;  3AVL A;  3WXK A;  4I2Q A;  4H0O A;  4CEF A;  3DLL L;  4DR5 K;  1KCF A;  3L2V A;  1K73 O;  2YHA A;  4CBX A;  3N4Q A;  3PSF A;  4FWP A;  3BDP A;  4HCB A;  4CJ4 A;  3VGK A;  3UE5 A;  3MEC A;  4CZK A;  1IG8 A;  4CZM A;  4DR1 K;  5KPZ A;  1TV6 A;  4IG3 A;  4ISG A;  3QLH A;  1VRU A;  4A61 A;  4CJL A;  4R79 A;  1HRH A;  2FSJ A;  1W0H A;  2E1Z A;  1QTM A;  3TAE A;  1VSK A;  2IGI A;  5J2Q A;  1DLO A;  3SUO A;  4W5R A;  5ELZ A;  5BRH A;  2IVP A;  2Q1N A;  3VQ4 A;  3V1O A;  3AAR A;  1KQS M;  3LP1 A;  2QWN A;  2UUC K;  4CJT A;  4CF8 A;  4B1Z A;  3TAF A;  1N34 K;  1J6Z A;  1C0G A;  3RR8 A;  4AHT A;  2DPN A;  3AAQ A;  5IT9 O;  1T44 A;  4IOX A;  4KAZ A;  1OH7 A;  4NLC A;  4WCE L;  1U6Z A;  4DV1 K;  3AO3 A;  1IKX A;  1N8R O;  3AVA A;  5BPN A;  1ATR A;  4B9T A;  2Z1I A;  2QXF A;  1GLJ O;  4DTM A;  4UY8 O;  4CGH A;  4O5B A;  4B9N A;  1O13 A;  1WLJ A;  4FJ7 A;  3KHY A;  4IXC A;  4DSJ A;  3D2F B;  3ID8 A;  1S1X A;  1CZB A;  3SPZ A;  1TK8 A;  3KIO A;  4JK9 A;  3DXM A;  4PKH A;  2IS3 A;  5AZI A;  1YJW N;  1DGK N;  4FYD A;  1JLB A;  2KFN A;  2DFE A;  2RHK A;  3D7E O;  3O6W A;  2QA4 N;  2IDO A;  1X9S A;  1BIU A;  2NZT A;  1F21 A;  3S41 A;  3ENB A;  3SQ2 A;  1JLA A;  4DV5 K;  1JXB A;  3ALY A;  4AHU A;  4CVN E;  1U4B A;  1HKB A;  4H5W A;  4CEO A;  2NRW A;  3QEP A;  2PFU A;  3PO5 A;  3F5T A;  2XRI A;  3OJU A;  3VMF B;  2VWK A;  1Q82 O;  3IS9 A;  3W3D A;  2YHY A;  4YOT A;  2A42 A;  4CFC A;  1HQE A;  3E9L A;  1RTJ A;  1SL1 A;  3CMA N;  3PX4 A;  5GAG P;  5CZ2 A;  4FM2 A;  3E66 A;  3SQ1 A;  1RBR A;  4FJN A;  3J81 O;  3V9S A;  3QEW A;  4FWK A;  4JS4 A;  3JYT A;  1YT3 A;  3VQA A;  4FOE A;  3MN7 A;  2WTU A;  3THY A;  2ITG A;  1IG9 A;  4CJ3 A;  3TAN A;  3OYM A;  4E1J A;  4CZL A;  4DFJ A;  5KGX A;  4JI5 K;  4BR4 A;  3MAQ A;  4YOR A;  1P90 A;  1X1P A;  4DR4 K;  2VYP A;  3VGL A;  4H03 B;  4HUE A;  4FWS A;  1SKW A;  1NGG A;  4DQQ A;  3LPT A;  3FGU A;  3TAP A;  4XH1 A;  5C10 A;  1BI4 B;  4GKK K;  3OYK A;  1HPZ A;  3CFO A;  4BDZ A;  4ISE A;  1BU6 O;  3MCP A;  4U67 L;  3CET A;  2PZS A;  3M5R A;  3OW2 M;  1TK0 A;  3W0L A;  3ZYY X;  2CGK A;  3P39 A;  1JCF A;  3AVB A;  3ZSX A;  1EX4 A;  4GVE A;  2A40 A;  1C1A A;  5D3G A;  5CZ1 A;  4FM0 A;  4FVM A;  4CK2 A;  5KPR A;  5J2P A;  4EZ9 A;  4DMN A;  3OYJ A;  3HSC A;  2IVN A;  4LF4 K;  4CER A;  3V4I A;  4CBW A;  3HYF A;  4JN4 A;  3U3Y A;  1ASV A;  3T3F A;  3K5N A;  1QSL A;  1TKT A;  1HKC A;  1HJR A;  2KKZ A;  4BE2 A;  1RT2 A;  2OPQ A;  2O8D A;  4CEQ A;  1YI2 N;  3VEO A;  5M1K A;  5HBM A;  4LY7 A;  1ZXO A;  4OVL A;  1TAQ A;  4BGA A;  4HUG A;  1RT5 A;  3CJB A;  2IIR A;  3IAY A;  4KKO A;  2GX9 A;  5GAD P;  5EX5 A;  1KAZ A;  1SAZ A;  2OA8 A;  4NB4 A;  1HYZ A;  1VHX A;  1EQY A;  3CFR A;  3ZX2 A;  4A5A A;  3F2K A;  3THV A;  3NMU A;  5I9E B;  2QEX N;  2A1S A;  1XMQ K;  3I33 A;  4HTL A;  3BZK A;  2P9N A;  1VK0 A;  5C12 A;  3HZ6 A;  4B8C A;  5C25 A;  1GLE G;  4MLE A;  1IKW A;  4CW7 B;  1GLF O;  3THX B;  2D4W A;  3GG4 A;  5EXW A;  4CFD A;  1JJ2 M;  1FK9 A;  3ZET A;  3RSE B;  5JS1 A;  4BR7 A;  1HX1 A;  4ILH A;  1SUQ A;  2Q2R A;  3BGR A;  1ESV A;  3T1H K;  4EP4 A;  4DTS A;  4CGF A;  1Y64 A;  5AQZ A;  1YTU A;  4GY2 B;  3QIP A;  4FJ9 A;  5HRR A;  2YNF A;  3DOL A;  1B9D A;  4CD3 A;  2P9S B;  2PYJ A;  4IFE A;  1LCU A;  4BRL A;  3AO2 A;  3KD5 E;  4LF7 K;  5KI6 A;  2FXU A;  4H0Y B;  2P5G A;  1VQK N;  1S5J A;  1BL3 A;  5AQH A;  4UQG A;  3RMA A;  2O8F A;  4JKD A;  1NGB A;  1U04 A;  1C0F A;  3VA3 A;  2P9I A;  1NMN A;  3G6E N;  4DQP A;  2E2P A;  3LZJ A;  4KHY A;  4ISF A;  2QWM A;  2FF3 B;  3BF1 A;  3RWU A;  4C23 A;  3R8E A;  5DK5 A;  5LJW A;  3OS0 A;  3ZSV A;  4RW9 A;  4O0J A;  4KHW A;  4DR7 K;  1C0U A;  5KTQ A;  3NGY A;  4NCA A;  3OS1 A;  5IWA K;  4H0X B;  3L3V A;  1Z05 A;  4W5Q A;  3D2F A;  3B8A X;  3LWM A;  1CZ9 A;  3CYM A;  2ZJR L;  1JLQ A;  4BRG A;  2OZM A;  3AA2 A;  3A2F A;  2V7Z A;  5HRP A;  1SV5 A;  3ULE B;  1TUU A;  2E2Q A;  4RW7 A;  3QML A;  3OTO K;  4H4O A;  2P9K B;  2UXD K;  3H08 A;  3L3U A;  1REV A;  3AA3 A;  1XWL A;  4C1N K;  5H1S Q;  3OYF A;  4E7J A;  4DQS A;  4IKF A;  3MXI A;  1KVC A;  1SZ2 A;  3V1R A;  4KFB A;  2G8V A;  2OPR A;  4DS5 A;  3TWH A;  1VQN N;  4C8K A;  4O0I A;  3LP3 A;  2NRT A;  4MLH A;  4YOW A;  3J7Z O;  1NMD A;  5EVZ A;  3ITH A;  3KJV A;  3NVK A;  3L4Q A;  4KH6 A;  4CJV A;  2OZS A;  1WSE A;  4C1N I;  2WBN A;  4FZZ A;  2V7Y A;  2UXC K;  3CQX A;  3THW B;  1TYQ A;  3A8Y A;  3T1A A;  3O4Q A;  3KWG A;  3KWI A;  1YF5 L;  4JI8 K;  5AQT A;  3QEI A;  2QI2 A;  5KPT A;  4BGB A;  4YNQ A;  2UUB K;  2F4V K;  3FFI A;  3ID6 A;  4JEP A;  4JI0 K;  1VRT A;  5M1F A;  3LM2 A;  5M1O A;  1HR0 K;  3CJ1 A;  1LAW A;  4CZH A;  3D2E B;  4JLH A;  3ZSW A;  1YAG A;  2GBZ A;  1JLC A;  4FK2 A;  2HMP A;  4YOV A;  1WB9 A;  2P9U B;  3T19 A;  3U8X A;  4GV3 A;  5GIN A;  5EY4 A;  1OH6 A;  3SUN A;  5HRS A;  4JKG A;  3SPY A;  4AM6 A;  4CJP A;  1ATN A;  1RTH A;  1QZ6 A;  4MDB A;  4JI7 K;  2D5R A;  4J8F A;  3HPH A;  1LWE A;  5GIP A;  2D1K A;  4DFP A;  5KGW A;  2BE2 A;  3KKR A;  3I55 N;  3T69 A;  1BHL A;  3CQY A;  4YHH K;  5JS2 A;  4FWL A;  3AVM A;  4BE0 A;  4EP5 A;  4H5R A;  3ZT3 A;  1QVF M;  3PIP L;  2WUS A;  4JKF A;  3ENO A;  3MDQ A;  3WNE A;  3K5M A;  5LMN K;  4I9Q A;  2G8W A;  4CZI A;  3LDS A;  4IZ9 A;  3VGM A;  3J7A P;  1ZBS A;  4B9S A;  1V4T A;  4O44 A;  5M1P A;  3EO3 A;  4Y1D A;  4BY9 C;  2HOE A;  4FW1 A;  4CJ7 A;  1X9M A;  3SBT A;  4KB0 A;  3UIQ A;  3HM8 A;  5J2M A;  5E26 A;  4BR0 A;  1BWF O;  4CGI A;  5J2N A;  2HVI A;  4W5N A;  1L3S A;  3GBT A;  3K2P A;  1LOT B;  4A57 A;  3VPZ A;  3E9P A;  1VQ8 N;  4Z4F A;  4FLU A;  5E41 A;  3G71 N;  4KI6 A;  4C8O A;  3PSI A;  4K25 A;  1GLC G;  1NGD A;  3P1G A;  2D0O A;  3SMS A;  4M45 A;  3H1V X;  2DFH A;  1Q8I A;  1NU0 A;  5AFU A;  4B3O A;  2H3G X;  4NXM K;  3C6U A;  3L4I A;  1IKV A;  3RSE A;  3AA5 X;  3WT0 A;  1IJJ A;  4WFA L;  1KAX A;  2A5X A;  2BH1 A;  2ZQB A;  4E7K A;  4DSE A;  1K8A O;  1VQO N;  3SUP A;  5C0Y A;  4YDU C;  2P9S A;  3NE6 A;  3LP2 A;  4MDA A;  1SS6 A;  3CG7 A;  2XY6 A;  5LL6 Z;  4H5T A;  1KFS A;  3OYB A;  2E8A A;  1YVU A;  4FJG A;  1UOC A;  5GAE P;  5TKY A;  1ZYQ A;  1NGA A;  4L8R B;  3RTV A;  3OYD A;  5JVH L;  1KFD A;  1OVY A;  4FK4 A;  3LDP A;  4M7Y A;  1K9M O;  2HHU A;  2O8B A;  4ELU A;  3EKU A;  3P38 A;  4CCH A;  2CH5 A;  4CHP A;  4WYB A;  4DQ8 A;  3V9Z A;  3IKM A;  3HST B;  2A1R A;  3GDQ A;  1KXP A;  2FF6 A;  3HBT A;  1T7P A;  3BY5 A;  3PX0 A;  3ATV A;  1S6P A;  2VWB A;  1KLM A;  3MX2 A;  2EHG A;  1TKZ A;  3ZLJ A;  4JV5 K;  3D0P A;  4IDK A;  2OTL N;  4AIL C;  1RBU A;  4U7B A;  3ISN C;  4DR3 K;  1NK5 A;  1A5V A;  5SWM A;  3TTF A;  4AHS A;  4J2D A;  4JHD A;  3H46 O;  5K14 A;  2VGM A;  3QBX A;  3AAP A;  2GUI A;  4X64 K;  1DKG D;  4IEE A;  4JRP A;  1JCG A;  3ZSO A;  4FM1 A;  4ILG B;  4CJ5 A;  3WQT A;  1WAF A;  1VAZ A;  3O9S A;  1VSD A;  4K8X A;  4LFC K;  1HQU A;  3VEX A;  3TU5 A;  2PBD A;  4O8U A;  3HXM A;  3HPO A;  5SZT A;  1WSF A;  4ZTF A;  2IOC A;  1K8K A;  3KLI A;  4FJI A;  2O8E B;  1W2B M;  3O3G A;  3VTH A;  4BRD A;  1IBK K;  4BDY A;  3THW A;  2YJE A;  3RRG A;  5KRT A;  2CGJ A;  3SCX A;  3S3M A;  4DTR A;  2KHO A;  3A5L C;  2P9L A;  4HUF A;  4PQU A;  4CES A;  4M42 A;  1Q86 O;  2NRX A;  3NF9 A;  3WXL A;  1LV5 A;  2NRH A;  4W5O A;  2P5O A;  4KRE A;  3ULD A;  3JXU A;  3SI6 A;  1RDU A;  5GAH P;  2YV0 X;  3VQ8 A;  4B3R K;  4CZJ A;  2NUB A;  4CZE A;  1NOY A;  2PYL A;  4KPY A;  4RW6 A;  5LMU K;  5HLF A;  2Q31 A;  3KK3 A;  3CFP A;  3RRH A;  1NWK A;  4B1X B;  4CZG A;  2IVO A;  1J53 A;  4NYF A;  2GWJ A;  1U2V B;  5DM7 L;  1KC8 O;  1QQM A;  4DUZ K;  4CHY A;  4A2A A;  4YY3 K;  2G8U A;  3KTQ A;  4BE1 A;  2BDP A;  1NGF A;  3V6D A;  4LD0 A;  4GKJ K;  1N5Y A;  4C8L A;  4M63 C;  3M1F A;  2F9T A;  1NKC A;  4B3M K;  3VF6 A;  1NOZ A;  4JKE A;  2HVH A;  2ZGY A;  4G1Q A;  2Q36 A;  3DRP A;  5HRN A;  4DTP A;  4OPK A;  4BQZ A;  3UKR B;  1T6D A;  2WFB A;  2R7Y A;  5T7B A;  4Z4C A;  3Q7B A;  3CIP A;  3CCU N;  2ZD1 A;  3U9Z A;  2JWK A;  3IG1 A;  1WOQ A;  1IBL K;  3DWL A;  3CJA A;  1VSM A;  1N32 K;  4NO7 A;  4B9V A;  4QS9 A;  1DTQ A;  2HHX A;  3KKS A;  4BC2 A;  4N47 A;  3PO4 A;  4GV9 A;  3A5M C;  3A5O C;  1VQ6 N;  1BUP A;  2A41 A;  2AA4 A;  3NGI A;  5A2Q O;  1JLG A;  2XHB A;  5FDL A;  3FZK A;  4DLE A;  3QDK A;  1XHX A;  1ZC6 A;  2QWL A;  1IBM K;  1YTA A;  3FZH A;  5FPD A;  3VER A;  3S3N A;  3DI6 A;  2QWP A;  1RFQ A;  2G8F A;  3L0Q A;  4DV3 K;  4G9Z A;  3EE8 A;  4WE1 A;  3UKU A;  3I8B A;  3VEW A;  4BRA A;  4RWT A;  4B3T K;  3SBG A;  3H1Q A;  4FJK A;  4FPA A;  4MO5 A;  3VEN A;  3VEZ A;  3WNH A;  4IOA L;  4EZ6 A;  3NHG A;  1EP4 A;  1T6C A;  5I42 A;  2YHB A;  4FJ5 A;  5M1N A;  1TK5 A;  5AQO A;  3OYN A;  4H0T B;  3RVC A;  3K5O A;  4YDU A;  3CXC M;  4BRK A;  2B5J A;  5AQU A;  2G8K A;  2F96 A;  4PWD A;  5AQM A;  3JAM O;  1KRP A;  3CCM N;  3O80 A;  2ASM A;  3H45 C;  3Q7C A;  3C65 A;  1KD1 O;  4DS4 A;  1E3M A;  1OVQ A;  1S6Q A;  1U49 A;  5JMV A;  3VTI A;  3L8B A;  2FSK A;  4IOC L;  3O8M A;  3C7N B;  4LF9 K;  3IRX A;  1GLD G;  3LAK A;  2HHS A;  3J80 O;  3WEE B;  2ZE2 A;  5AQK A;  2GWK A;  4E89 A;  3VQ6 A;  3T1Y K;  1RTI A;  3L6Q A;  4GVM A;  1YIJ N;  3QO9 A;  4KHN A;  1GLA G;  4ID1 A;  1N6Q A;  4Q0B A;  4KHP K;  3O3F A;  4B1W B;  1G15 A;  3L2R A;  4JNE A;  2I7N A;  3T7Z A;  5AQV A;  5BN9 A;  4C8N A;  2XY7 A;  1S9G A;  5AQP A;  3NH2 A;  4J2E A;  3RMB A;  3ENH A;  4QS7 A;  2PY5 A;  5JLF A;  2RE2 A;  3AA4 A;  2VGN A;  4JYA K;  4LF5 K;  2E4L A;  4IO8 A;  1CXU A;  4F2R A;  3JSM A;  2UXB K;  1U48 A;  4IWV A;  2W6K A;  4GW6 A;  1SQK A;  5FRN A;  3O08 A;  3U9D A;  3HP9 A;  1Q18 A;  5AQS A;  3HK2 A;  1XUP O;  4QS8 A;  3SLC A;  5HL7 L;  4M41 A;  4QOZ B;  2QW9 A;  4BRN A;  4CJR A;  2OPP A;  2UYT A;  3SJJ A;  4DTN A;  2E88 A;  1ITG A;  5TKW A;  1TGO A;  4X62 K;  3U3G A;  1VQ9 N;  4K43 A;  4O5F A;  3SMP A;  2D0P A;  4FJJ A;  1NKE A;  3NF6 A;  1JL2 A;  2OCE A;  1MA9 B;  2NRV A;  1ZBU A;  3O4N A;  4LSN A;  1EO1 A;  3CD6 N;  3ZT4 A;  4FLX A;  1NNE A;  3C94 A;  1NK7 A;  1T3V A;  3CM6 A;  2VG7 A;  4K8Z A;  4IG0 A;  2OPS A;  1BGX T;  4BRM A;  1VSE A;  3SAF A;  4E0D A;  3WUH A;  1VQ7 N;  3EE9 A;  4DTX A;  2HB5 A;  1J9A A;  3QER A;  2GUP A;  3SJH A;  1NM1 A;  4DFK A;  3C6T A;  1KVA A;  3TAR A;  3VQQ A;  3TI0 A;  3P83 D;  4FWM A;  1QS4 A;  2QK9 A;  1OKJ A;  2O8C B;  4JKB A;  3LZI A;  1V4S A;  5CYM A;  3LWL A;  2W41 A;  4KV8 A;  1TKX A;  4CJS A;  1UWB A;  2HHV A;  3TR8 A;  2B4J A;  4JI6 K;  5BR9 A;  2XO7 A;  3QEX A;  4E7I A;  3FFK B;  1JLE A;  1HNZ K;  1EWR A;  5KQD A;  3J8A A;  3WXM B;  4DF4 A;  4E7L A;  1NGJ A;  2F7T A;  4Q5V A;  1JKH A;  1L3V A;  3FZL A;  2YNH A;  5AQR A;  3ZCM A;  1IKY A;  3PX6 A;  3ZSQ A;  5LJV A;  1EET A;  1NK8 A;  1TUY A;  1IV0 A;  1BG3 A;  4H8K A;  4B8A B;  4DQR A;  1BQM A;  2F8T A;  2HNZ A;  1C0T A;  4H5N A;  1VSH A;  3AO4 A;  3B6P A;  1MWK A;  1QQC A;  1RT3 A;  4PKG A;  4DV4 K;  4BRO A;  2PAV A;  2YX6 A;  3OBY A;  1XHZ A;  1B92 A;  2GTD A;  4IBN A;  4HTU A;  3TAQ A;  4KH5 A;  1HJO A;  2RKI A;  3IUC A;  1RDB A;  4FJX A;  3D45 A;  2Q97 A;  4M7X A;  4RW8 A;  4BVO A;  3TAB A;  4B9L A;  3VN5 A;  4ELV A;  5AZJ B;  4O8K A;  2P9P B;  3CM5 A;  3G25 A;  3WXJ A;  2OTJ N;  3DJC A;  1DEJ A;  3QIN A;  3KK1 A;  4IO9 L;  3QFP A;  1L3T A;  3V81 A;  4F3T A;  1NGH A;  2HHQ A;  1CXQ A;  4AHR A;  3HO1 A;  1TAU A;  3SUQ A;  4CHQ A;  3BF3 A;  3VQ9 A;  2HHW A;  1Q9Y A;  5AQI A;  2HF3 A;  4E1N A;  3FZM A;  4CED A;  4Y0W A;  1GLB G;  4N41 A;  4M3R A;  1ASU A;  1NBW A;  1U47 A;  1P8Z A;  1ASW A;  2FBT A;  3DXK B;  1M90 O;  5C2D A;  4CJF A;  1RGI A;  4CF0 A;  4Z94 A;  4IDH A;  5CR4 A;  4B3S K;  2Q3S A;  5KRS A;  2UUA K;  2E5L K;  1WSJ A;  1BI4 A;  5FPE A;  4FJL A;  2YI1 A;  4ID5 A;  4DTO A;  4DTJ A;  5EU7 A;  2YKN A;  3DXM B;  4Z4H A;  4BG9 A;  3M8S A;  1QVG M;  2ASO A;  4FSV A;  4CI6 A;  1RT4 A;  3HT3 A;  4X65 K;  3EY1 A;  3WQU A;  4OGC A;  1T03 A;  3SQ0 A;  2X6N A;  1LWF A;  3I0R A;  1MDU B;  3HP6 A;  1E4G T;  1RBS A;  4IJA A;  2IC3 A;  1IH7 A;  1FW6 A;  3O9U A;  1J5E K;  3JS6 A;  3LDQ A;  3WEE A;  3CER A;  4QAG A;  3L2U A;  3WNF A;  1VQ4 N;  2NNW A;  2Q0U A;  5HP1 A;  3CCS N;  1B9F A;  3OY9 A;  3H3N O;  2EX3 A;  2VQE K;  5BN8 A;  3L2Q A;  2YKM A;  3CCE N;  2XY8 A;  4PA1 A;  1FJG K;  4FOI A;  3EZ5 A;  4DG1 A;  4DHY A;  2VQF K;  4CEZ A;  2YHX A;  4BRQ A;  3P4I A;  2UU9 K;  4YFU A;  1L3U A;  3THY B;  3CCQ N;  2NRR A;  3K0S A;  3QET A;  2BUP A;  5GIO A;  3CC7 N;  4HVJ A;  1WSH A;  3KVG A;  3KLH A;  2WC9 A;  4ZHR A;  3AVH A;  4NLB A;  1XI1 A;  3MN9 A;  4WF9 L;  3THX A;  5FLX O;  1A5W A;  3EZW A;  1S1T A;  3LP0 A;  5JIC A;  2CH6 A;  4Y1C A;  3M6G A;  4LFA K;  3R1X A;  4Z4G A;  4DU3 A;  2ITM A;  3MK6 A;  1C1B A;  1NJW A;  4L3Q A;  1BQN A;  4DR6 K;  3UB5 A;  5ADX A;  4BAC A;  4JI1 K;  2E6L A;  4OGE A;  4GV6 A;  1XC3 A;  2GEM A;  5CYQ A;  4FO0 A;  2YNG A;  3A5N C;  3O9R A;  1NK6 A;  4FVU A;  3N4P A;  3AVI A;  2E20 A;  4I2P A;  5MLC Q;  3PV8 A;  1R59 O;  1ZBL A;  2RPI A;  1NJI O;  4R5P A;  4CJW A;  4QCL A;  3ZEU B;  4WFB L;  4K42 A;  2AJQ A;  1HPM A;  2OYQ A;  3HPG A;  4NXN K;  1VQ5 N; 
#chains in the Genus database with same CATH homology
 4N76 A;  2KFZ A;  4G1Q A;  3DRP A;  1FXX A;  5HRN A;  2FC0 A;  4DTP A;  4OPK A;  4CFD A;  2R7Y A;  1UA0 A;  2B6A A;  4KTQ A;  2VWJ A;  1FK9 A;  2X74 A;  5T7B A;  4DU4 A;  4Z4C A;  1R0A A;  5CY4 A;  2ZD1 A;  2KW4 A;  4IFY A;  5JS1 A;  4CEE A;  2QKK A;  5DMR A;  1SL2 A;  1SUQ A;  3BGR A;  4OJR A;  3IG1 A;  4FLT A;  4EP4 A;  3VQD A;  4DTS A;  3SYZ A;  4DFM A;  4CGF A;  1WSI A;  1YTU A;  3QIP A;  3RR7 A;  2JLE A;  4FJ9 A;  1BIZ A;  1VSM A;  1K6Y A;  3MED A;  4M3Z A;  3QNN A;  5HRO A;  4B9V A;  5HRR A;  2YNF A;  3OYA A;  1DTQ A;  4OLA A;  3DOL A;  1B9D A;  3KKS A;  4PUO A;  4N47 A;  4Z0U A;  2HHX A;  4DU1 A;  3PO4 A;  3QEV A;  2PYJ A;  4C8M A;  4JRQ A;  3VA0 A;  1LAV A;  4CJQ A;  3NGI A;  3DMJ A;  1LW2 A;  4CIG A;  1RDD A;  1JLG A;  3AO2 A;  5FDL A;  1RT7 A;  2RN2 A;  2XHB A;  4DLE A;  3I8D A;  3KD5 E;  1XHX A;  5KI6 A;  3AO1 A;  1YTA A;  2P5G A;  4CHN A;  1RIL A;  3QES A;  4LH5 A;  1JL1 A;  1S5J A;  1BL3 A;  4I7F A;  3S3N A;  3DI6 A;  1NJX A;  4UQG A;  4M3X A;  1I39 A;  4FK0 A;  3RMA A;  2G8F A;  1RT6 A;  4N5S A;  5FRM A;  1U04 A;  3VA3 A;  4KTW A;  4WE1 A;  3OYL A;  4KHS A;  4MFB A;  4W5T A;  3NGZ A;  3OYC A;  1HNI A;  2FBX A;  3LAM A;  1D9F A;  4DQP A;  1BCM A;  3LZJ A;  3F9K A;  4KB1 A;  5J1E A;  4FJK A;  4M3T A;  4KHY A;  2HMI A;  4OLB A;  3WNH A;  1JXE A;  3RWU A;  4EZ6 A;  3NHG A;  1EP4 A;  4ICL A;  5I42 A;  2YHB A;  1JLF A;  4FJ5 A;  1TK5 A;  1C6V A;  5DK5 A;  3OYN A;  1TL3 A;  3OS0 A;  3K5O A;  4DSL A;  1J5O A;  3C95 A;  2X78 A;  3ZSV A;  4RW9 A;  4O0J A;  3VQP A;  4KHW A;  1C0U A;  5KTQ A;  2D0C A;  3P5J A;  3NGY A;  2B5J A;  4LH4 A;  4NCA A;  3OS1 A;  2G8K A;  2F96 A;  4PWD A;  4NCG A;  5I3U A;  1KRP A;  3L3V A;  4W5Q A;  4FXD A;  2BAN A;  4DS4 A;  3LWM A;  1CZ9 A;  3CYM A;  4ELT A;  4ZTJ A;  4M3U A;  3VQE A;  1JLQ A;  4I9L A;  1GOB A;  4AHC A;  1S6Q A;  1U49 A;  3OYI A;  3L8B A;  2OZM A;  3AA2 A;  3A2F A;  1WNS A;  3DYA A;  3PUF A;  3IRX A;  1TL1 A;  2WON A;  4CIF A;  4FLY A;  5HRP A;  4GMJ B;  1SV5 A;  3LAK A;  2Y1I A;  1RDA A;  2HHS A;  4OPJ A;  2ZE2 A;  4RW7 A;  4E89 A;  3VQ6 A;  1RTI A;  3AVF A;  4GVM A;  4H4O A;  3OJS A;  3H08 A;  3L3U A;  3QO9 A;  1REV A;  4DSK A;  4M3W A;  4KHN A;  1D5A A;  4E3S A;  3AA3 A;  1XWL A;  4ID1 A;  3NF8 A;  3OYH A;  1N6Q A;  4Q0B A;  3OYF A;  4OKK A;  4KHQ A;  4E7J A;  3O3F A;  4DQS A;  4IKF A;  3AVC A;  1NJY A;  1NK4 A;  4E19 A;  1G15 A;  1KVC A;  2P1J A;  3V1R A;  4KFB A;  3HVR A;  2OPR A;  3L2R A;  3TWH A;  3V9X A;  4DS5 A;  2G8V A;  1LWC A;  4O0I A;  4H4M A;  3LP3 A;  4FCY A;  4C8K A;  2D0B A;  2P51 A;  2HND A;  4C8N A;  3NH1 A;  3KLE A;  4FLZ A;  2XY7 A;  1S9G A;  3NH2 A;  4J2E A;  1Y97 A;  4XIU A;  3RMB A;  3ITH A;  4KTZ A;  2PY5 A;  3VQB A;  3KJV A;  3HJF A;  3AA4 A;  1W9H A;  2QKB A;  2DY4 A;  2E4L A;  1CXU A;  3M8R A;  4CJV A;  1RT1 A;  4F2R A;  3ZT0 A;  4AH9 A;  1QHT A;  1WSE A;  4CEC A;  3JSM A;  3F73 A;  1GOC A;  1U48 A;  2OZS A;  4FZX C;  3LAL A;  4DSF A;  2ETJ A;  4GW6 A;  4FZZ A;  2DTU A;  1MU2 A;  3NF7 A;  1X9W A;  5FRN A;  1QSY A;  3HP9 A;  4F8R A;  3HM9 A;  3NDK A;  4J2B A;  4CEB A;  3AVG A;  3T1A A;  1RTD A;  3O4Q A;  1RNH A;  2E6M A;  3HK2 A;  3B6O A;  1WN7 A;  3MXJ A;  3QEI A;  2X6S A;  4CJU A;  3AVN A;  1ZBF A;  4FLW A;  1WSG A;  4M41 A;  3SQ4 A;  3G10 A;  1HYV A;  4QOZ B;  4YNQ A;  4CJR A;  3K59 A;  3FFI A;  3DLR A;  1S9E A;  1TVR A;  2OPP A;  1A5X A;  3QNO A;  1VRT A;  3SJJ A;  4N56 A;  2O4I A;  1LAW A;  4OKE A;  1S1V A;  2JGU A;  4JLH A;  4RW4 A;  3ZSW A;  4DTN A;  4E7H A;  2XY5 A;  2GBZ A;  1EXQ A;  1UA1 A;  2IAJ A;  1ITG A;  1S1W A;  2HNY A;  3MEG A;  1JLC A;  3NFA A;  1TGO A;  4FK2 A;  3U3G A;  4BWJ A;  4RG8 A;  3WNG A;  3NH0 A;  2FBV A;  1VSI A;  3T19 A;  3MXM A;  4FJJ A;  1NKE A;  3NF6 A;  1JL2 A;  3DRR A;  4CGG A;  3SUN A;  2Z1G A;  3AVK A;  1Z26 A;  4LSL A;  4E1M A;  4FJM A;  1ZBU A;  3O4N A;  5HRS A;  4DLG A;  1KVB A;  3AO5 A;  3SPY A;  1D8Y A;  4LSN A;  3OYG A;  4CJP A;  4PY5 A;  1RTH A;  3ZT4 A;  1UAX A;  4FLX A;  4J2A A;  1KTQ A;  3C94 A;  1NK7 A;  3PY8 A;  3CM6 A;  2D5R A;  2VG7 A;  4K8Z A;  3HPH A;  3SZ2 A;  1LWE A;  2OPS A;  4IG0 A;  1BGX T;  3DLG A;  4DFP A;  1Z25 A;  3DRS A;  1VSE A;  1CLQ A;  5KGW A;  4CGJ A;  1LW0 A;  2BE2 A;  2Z1H A;  3NBP A;  4O55 A;  3K58 A;  2HB5 A;  1J9A A;  3KKR A;  4DTX A;  3AVJ A;  3QER A;  4B08 A;  4F4K A;  3AVL A;  1BHL A;  4I2Q A;  1T05 A;  1EKE A;  4CEF A;  4B9U A;  5JS2 A;  3OVN A;  4DQI A;  1KCF A;  3AVM A;  3L2V A;  2YHA A;  4BE0 A;  4DFK A;  3C6T A;  4EP5 A;  2O4G A;  3NCI A;  3ZT3 A;  1KVA A;  3TAR A;  3BDP A;  1FKP A;  3LAN A;  3VQQ A;  4CJ4 A;  3P83 D;  3TI0 A;  4HCB A;  2QK9 A;  1QS4 A;  3WNE A;  3K5M A;  3MEC A;  3LZI A;  4DTU A;  3SV3 A;  5CYM A;  3LWL A;  4I9Q A;  2G8W A;  4KV8 A;  4DSI A;  3RMC A;  1TKX A;  1HMV A;  4CJS A;  1UWB A;  2HHV A;  1O1W A;  3KK2 A;  3LDS A;  3TR8 A;  2B4J A;  2XO7 A;  1KLN A;  4B9S A;  1TV6 A;  3QEX A;  1HYS A;  4E7I A;  4CF2 A;  1JLE A;  4IG3 A;  4BDP A;  3QLH A;  1VRU A;  1D9D A;  4CJL A;  2Z1J A;  4O44 A;  1HRH A;  1QTM A;  1W0H A;  4DF4 A;  4E7L A;  3TAE A;  1VSK A;  2F8S A;  4Y1D A;  2D0A A;  4Q5V A;  3VQC A;  1JKH A;  2IGI A;  4FW1 A;  1X9M A;  2KZZ A;  2DFF A;  1L3V A;  3U6F A;  4NCB A;  5J2Q A;  4KB0 A;  3UIQ A;  2YNH A;  1DLO A;  3SUO A;  3ZCM A;  4W5R A;  5J2M A;  1IKY A;  4OKJ A;  1C0M A;  3PX6 A;  4E0D A;  4CHO A;  3ZSQ A;  3VQ4 A;  1EET A;  3V1O A;  1NK8 A;  1DTT A;  4CGI A;  5J2N A;  2HVI A;  3LP1 A;  4W5N A;  4CJT A;  4CF8 A;  1L3S A;  4KHU A;  4CFA A;  3TAF A;  4H8K A;  4B8A B;  3RR8 A;  4DQR A;  4TSX A;  1BQM A;  3K2P A;  2F8T A;  4CEA A;  4Z4E A;  2HNZ A;  4AHT A;  1C0T A;  2G8H A;  1VSH A;  3AO4 A;  3B6P A;  1QQC A;  4CJE A;  1RT3 A;  4HHT A;  1Q9X A;  5FRO A;  4KAZ A;  4Z4F A;  3SV4 A;  4FLU A;  5E41 A;  4JS5 A;  5C24 A;  4KI6 A;  4C8O A;  3AO3 A;  3E01 A;  1IKX A;  3ZT1 A;  3S3O A;  1XHZ A;  1B92 A;  3AVA A;  4IBN A;  3P1G A;  4HTU A;  3TAQ A;  1HNV A;  2RKI A;  4CFB A;  1RDB A;  4B9T A;  1QE1 A;  2I5J A;  2LSN A;  4FJX A;  2Z1I A;  4M45 A;  2QXF A;  2DFH A;  3D45 A;  1Q8I A;  4DTM A;  4RW8 A;  4B3O A;  3TAB A;  4CGH A;  3C6U A;  4O5B A;  4AHV A;  4B9N A;  4B9L A;  3KLF A;  4FJ8 A;  1WLJ A;  1IKV A;  4FJ7 A;  1RDC A;  3VN5 A;  2W42 A;  1NJZ A;  4DSJ A;  4ELV A;  3AA5 X;  1S1X A;  1CZB A;  3SNN A;  3SPZ A;  1TK8 A;  3CM5 A;  3KIO A;  3RMD A;  2IS3 A;  4FYD A;  3HVT A;  3QIN A;  3KK1 A;  2ZQB A;  4E7K A;  4M3Y A;  1JLB A;  4DSE A;  3TAM A;  2KFN A;  3DLE A;  2DFE A;  4NYN A;  3SUP A;  1L3T A;  1WAJ A;  2IDO A;  1X9S A;  1BIU A;  3I0S A;  3V81 A;  1F21 A;  4F3T A;  3NAE A;  3VQ7 A;  1CXQ A;  4AHR A;  3NE6 A;  3LP2 A;  1ZBH A;  3HO1 A;  3SUQ A;  2HHQ A;  4CHQ A;  3SQ2 A;  1JLA A;  3CG7 A;  1TAU A;  1JXB A;  3ALY A;  2FBY A;  2XY6 A;  4AHU A;  4FJH A;  2HW3 A;  1U4B A;  3VQ9 A;  4CK1 A;  2HHW A;  4CEO A;  1Q9Y A;  3QEP A;  1KFS A;  4Z4I A;  4E1N A;  3PO5 A;  3OYB A;  4CED A;  1YVU A;  3LPU A;  2XRI A;  3V9W A;  4FJG A;  1UOC A;  3OJU A;  4N41 A;  4M3R A;  1ZYQ A;  1ASU A;  2VWK A;  4L8R B;  3RTV A;  3OYD A;  3IS9 A;  1ASW A;  1U47 A;  2FBT A;  3HL8 A;  1KFD A;  3ZSZ A;  4CJF A;  4FK4 A;  4CFC A;  1HQE A;  2HHU A;  3DLH A;  4CF0 A;  1RTJ A;  1SL1 A;  4ELU A;  3PX4 A;  2Q3S A;  2ATQ A;  3O3H A;  4F3O A;  4CCH A;  1NK9 A;  5KRS A;  4CHP A;  5CZ2 A;  1WSJ A;  1BI4 A;  4FM2 A;  1TKD A;  4FJL A;  4ID5 A;  4DTO A;  3ZSY A;  3SQ1 A;  3V9Z A;  4DTJ A;  5EU7 A;  2WOM A;  2YKN A;  3HST B;  4Z4H A;  3M8S A;  3K5L A;  1RBR A;  3V9U A;  2A1R A;  1T8E A;  4FJN A;  1T7P A;  1RT4 A;  3V9S A;  3HT3 A;  3QEW A;  3PX0 A;  1RBT A;  4CF9 A;  3EY1 A;  1S6P A;  4JS4 A;  4DF8 A;  3ZSR A;  3S9H A;  3MXI A;  1KLM A;  1I3A A;  3M8Q A;  4OGC A;  3JYT A;  1U45 A;  1T03 A;  1RCH A;  1YT3 A;  2X6N A;  3VQA A;  3SQ0 A;  2EHG A;  1TKZ A;  3DM2 A;  2ITG A;  1LWF A;  1IG9 A;  4CJ3 A;  3I0R A;  3D0P A;  4IDK A;  3HP6 A;  3TAN A;  4AIL C;  1RBU A;  3OYM A;  3ISN C;  1RBS A;  4DFJ A;  1NK5 A;  1S1U A;  2IC3 A;  1A5V A;  1IH7 A;  5SWM A;  4AHS A;  3EYZ A;  5KGX A;  1RBV A;  5K14 A;  4J2D A;  3V1Q A;  3MAQ A;  2GUI A;  3OS2 A;  3DLB A;  3TAG A;  4JRP A;  1X1P A;  4QAG A;  4HUE A;  4HCC A;  3L2U A;  3DLK A;  1SKW A;  4CGD A;  3WNF A;  3ZSO A;  4FM1 A;  4DQQ A;  3LPT A;  4CJ5 A;  5HP1 A;  3M8P A;  3TAP A;  2KQ2 A;  1WAF A;  1B9F A;  3OY9 A;  2EX3 A;  1VSD A;  1BI4 B;  4K8X A;  1HQU A;  1VSF A;  3OYK A;  1HPZ A;  4CJK A;  3L2Q A;  3HXM A;  3CFO A;  4BDZ A;  2YKM A;  3HPO A;  4FLV A;  2XY8 A;  4PA1 A;  5SZT A;  2PZS A;  2HHT A;  1WSF A;  4DWI A;  3ZT2 A;  2IOC A;  4ZTF A;  1BCO A;  3KLI A;  4FJI A;  4CE9 A;  3EZ5 A;  3O3G A;  2RF2 A;  4DG1 A;  1TK0 A;  1SKR A;  1J54 A;  1QSS A;  1FKO A;  4CK3 A;  3AVB A;  3ZSX A;  1EX4 A;  2VG5 A;  4CEZ A;  4KI4 A;  4YFU A;  1L3U A;  1C1A A;  3OYE A;  4BDY A;  5D3G A;  5CZ1 A;  3KLG A;  3QET A;  4FM0 A;  2GV9 A;  4FVM A;  4CK2 A;  4BWM A;  1L5U A;  3RRG A;  5J2P A;  3G0Z A;  4HVJ A;  1VSL A;  4CF1 A;  5KRT A;  4DMN A;  4EZ9 A;  1WSH A;  3SCX A;  3OYJ A;  3S3M A;  1NK0 A;  3KD1 E;  3KLH A;  4DTR A;  5C42 A;  4CER A;  4ZHR A;  3V4I A;  3HYF A;  4PQU A;  1VSJ A;  4HUF A;  3AVH A;  4CES A;  1XI1 A;  4M42 A;  3U3Y A;  4KO0 A;  3NF9 A;  1A5W A;  1ASV A;  4CIE A;  3T3F A;  1S1T A;  1LV5 A;  4W5O A;  3LP0 A;  1ZBI A;  2P5O A;  3K5N A;  3ULD A;  1QSL A;  4KRE A;  1C1C A;  1TKT A;  2G8I A;  4Y1C A;  2KTQ A;  1HJR A;  3SI6 A;  2VG6 A;  4BE2 A;  1RT2 A;  2OPQ A;  4Z4G A;  4F2S A;  4CEQ A;  4DU3 A;  2YV0 X;  5HBM A;  4CHZ A;  4LY7 A;  1C1B A;  1NJW A;  1SL0 A;  4OVL A;  3ASM A;  3K57 A;  1TAQ A;  3VQ8 A;  4FZY A;  2NUB A;  1BQN A;  4MQ3 A;  4IFV A;  4HUG A;  2Y1J A;  4BAC A;  1NOY A;  2PYL A;  4KPY A;  1RT5 A;  4RW6 A;  5HLF A;  3KK3 A;  3CFP A;  3RRH A;  4KKO A;  3IAY A;  2E6L A;  4OGE A;  1XC9 A;  1SKS A;  3AV9 A;  1IO2 A;  2OA8 A;  1J53 A;  4B9M A;  4FW2 A;  1HYZ A;  5CYQ A;  4NYF A;  3CQ8 A;  4KRF A;  2YNG A;  3CFR A;  1NK6 A;  3THV A;  4CHY A;  2G8U A;  3AVI A;  1KSP A;  3VQ5 A;  4I2P A;  3KTQ A;  4BE1 A;  3PV8 A;  1ZBL A;  2BDP A;  2KZM A;  3QIO A;  3V6D A;  4LD0 A;  3L2W A;  2RPI A;  2A1S A;  4R5P A;  4CJW A;  1NKB A;  1N5Y A;  4C8L A;  4O4G A;  4QCL A;  1NKC A;  1BIS A;  3MEE A;  1VK0 A;  3DOK A;  2AJQ A;  4B8C A;  1NOZ A;  2HVH A;  5C25 A;  2OYQ A;  1GOA A;  1IKW A;  3HPG A;  2BGG A;  2YNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...