4CHQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 52
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chqA00
5HRRA 2LSNA 3C6UA 3KD5E 1NKBA 4DTUA 4IG3A 1F21A 4CJTA 4NCAA 2DFHA 3VQPA 1WNSA 4HCCA 1RDAA 4BWJA 5K14A 3AVFA 2X74A 3DMJA 2OZSA 4B9UA 4DSLA 3ZSYA 1BI4B 3AVAA 4DSKA 4ID5A 4KHQA 4BACA 1X9WA 3QO9A 2HMIA 4CJKA 1RTDA 4CJLA 4KHNA 2B4JA 1KFDA 4XIUA 1U47A 2O4IA 4OVLA 4W5TA 2HHUA 4CF1A 3IS9A 4M3RA 2YHBA 5KGXA 4KTQA 5KTQA 1IH7A 3HPHA 1U49A 4PUOA 4C8NA 3OYKA 3DLRA 3VQEA 4HUFA 4CJRA 3QETA 1HNVA 1C0TA 4AHRA 1NK4A 4F8RA 2XY5A 1RBRA 3OJSA 4EZ6A 4M3ZA 4GVMA 2X6NA 3CFOA 3QNOA 1EX4A 1IKWA 1TK5A 2OA8A 4FJIA 3OYHA 4FLWA 1LWFA 3AVMA 1NJZA 4OKKA 1KVCA 4EP5A 1RT7A 2G8HA 4FVMA 4CIFA 4CESA 2EHGA 1RT2A 1FK9A 3MAQA 1BCMA 2YKNA 2YNGA 4DF8A 4CFCA 3S3NA 4PA1A 3SQ1A 4KHYA 3VQ6A 4C8LA 2VWJA 1NK9A 4FZYA 4QAGA 4FLZA 4CGJA 4OJRA 3KLEA 4KFBA 1FKOA 1DTQA 3CM5A 1S1XA 4IFVA 2Z1JA 3SUNA 2ZQBA 1DLOA 3KK1A 1CZBA 1RBUA 2KFNA 5JS1A 3B6OA 3ISNC 4KHUA 4DFJA 1J53A 3KK2A 1KVAA 3MXMA 1WN7A 3HJFA 1WAJA 2WOMA 1LWEA 4CEBA 1KLNA 3SZ2A 4NCGA 4DQSA 1TKDA 3RMCA 1SV5A 2XY7A 4CJ4A 1B9FA 2KZMA 4FW2A 3K57A 1JL1A 4DQQA 1C1BA 3LANA 4FJGA 3HVRA 4CEDA 1VSDA 3O4QA 1R0AA 3LP3A 1QE1A 1BCOA 3MECA 3OYLA 5J2QA 4Z4FA 1MU2A 1WSHA 3ITHA 3CYMA 3KKSA 3RR8A 4CJPA 3DI6A 1BIUA 4DTOA 2HHQA 2B6AA 3CM6A 3SQ0A 1D8YA 4CFDA 1KSPA 2IDOA 1Y97A 2X78A 1ASWA 1L3VA 4ELTA 3MEEA 1VSMA 1S1UA 4AH9A 1VSJA 1LW0A 2HHTA 4CERA 1RT6A 4FK4A 5HRNA 1ASVA 3DRPA 3AVJA 5KRSA 4DU4A 1I39A 3O4NA 4N5SA 3OYIA 3TAMA 3DM2A 2HHWA 3K59A 2IOCA 2KW4A 4CE9A 4E1NA 4C8OA 3NDKA 2Y1JA 5I42A 4DSJA 3AVCA 3VQAA 2YKMA 3NH2A 1X9MA 2NUBA 4E0DA 4E19A 4CGGA 2IC3A 3HP9A 4CHPA 4JRPA 4KRFA 1VRTA 4CF8A 1IG9A 5CZ1A 1RTIA 1RT1A 1LV5A 4CHQA 4W5OA 3LAMA 2VWKA 3PX0A 2RN2A 1S1TA 3MEDA 3VQBA 4YNQA 3TAQA 2AJQA 4IBNA 2P5GA 4FJ8A 3V1OA 4DQRA 4IFYA 4DTMA 1B92A 1S1WA 1G15A 3DLGA 3LP1A 1VSKA 3SUQA 4FJ9A 4QCLA 2ZE2A 1U04A 3QLHA 4W5QA 5HRSA 1CXUA 1WSGA 4W5RA 4FCYA 2ATQA 4DFPA 3PX6A 2P5OA 3U3YA 4KI6A 3D0PA 3P5JA 1L5UA 3NE6A 1ZYQA 1NJXA 1ZBFA 2FBTA 4DLGA 4FJNA 1RILA 2RPIA 5FRMA 3V4IA 3TAFA 2D0CA 4OKJA 1JXEA 4H8KA 1JLEA 3WNHA 3OYGA 3SQ4A 3ZSQA 3I0SA 3LP2A 2HNDA 3VQDA 1EP4A 1YVUA 3V9SA 1HPZA 4NYFA 3LZJA 1NOYA 4M3XA 3I8DA 4KO0A 3TI0A 4HTUA 1WSIA 1EKEA 2DFFA 2YNIA 4CECA 2OPRA 3K5NA 1U45A 1T7PA 4CGIA 3L2VA 2OPPA 2Q3SA 4DMNA 3A2FA 1NKCA 2G8FA 2FBXA 4UQGA 4J2BA 4FJKA 1IKXA 3DYAA 4KV8A 3HPGA 1C1CA 1VSLA 4DTXA 1HNIA 1YTAA 4FM1A 3HK2A 2JLEA 3AVNA 3VA0A 3LALA 3NF8A 4KHWA 2XHBA 4KI4A 1C0MA 4FXDA 4BE2A 3HM9A 3SPYA 3DLBA 4W5NA 3MEGA 4O44A 4AHTA 4CEQA 4F2SA 2HHVA 2FBYA 2RKIA 4CFAA 1NOZA 1QTMA 4CJSA 1SKWA 3ALYA 3PX4A 1J5OA 3K5MA 2Y1IA 2GBZA 2FBVA 2IS3A 3NHGA 1C1AA 3T1AA 1WLJA 3VQ4A 3VQQA 4B9VA 4PQUA 3SV4A 3V9WA 3QEVA 3VQCA 4DSEA 5HROA 4DG1A 3KLGA 1I3AA 4CJVA 3KK3A 1VK0A 1XWLA 1Z26A 4DFKA 3CFRA 1J9AA 4YFUA 4N56A 1RDBA 2G8WA 4RW4A 1KTQA 3IG1A 3RRHA 1U4BA 2HW3A 3AO2A 3VQ9A 3ZT4A 4BE1A 1GOCA 1S6QA 4CIEA 1RTJA 1VSIA 1BL3A 4DTRA 3OYMA 4B08A 3V9ZA 1FXXA 5DK5A 3VQ5A 1Q9XA 2YNFA 3ZCMA 4JS4A 2HNYA 1RNHA 4CJUA 2KTQA 5JS2A 2ETJA 3OY9A 4OPJA 4B8AB 2WONA 3NAEA 2GUIA 2Z1IA 4M45A 1A5XA 3ZSRA 2W42A 2YHAA 4B9MA 4M3TA 1QSLA 4BDYA 2DFEA 1CXQA 4DTSA 4NCBA 1BISA 3RR7A 3FFIA 4KB1A 4KTWA 3EZ5A 1T03A 1UA0A 3ASMA 2DY4A 1S9GA 4FK2A 1X1PA 5SZTA 1LWCA 1S5JA 1K6YA 2PZSA 3OYNA 3OVNA 4E3SA 3QNNA 1SKSA 1UOCA 3ZT0A 4Q0BA 3AA4A 4AHSA 1TL1A 4WE1A 3RTVA 3MXIA 1HMVA 5CYQA 1WSJA 4DWIA 3AA2A 4FJ7A 1IKVA 1A5VA 1XC9A 4IDKA 1JLFA 1S9EA 1QQCA 4I7FA 3PO4A 4FJ5A 3C6TA 5KI6A 1J54A 3NF6A 3K2PA 4OPKA 4Z4IA 3KLIA 3SJJA 1TKXA 3LPUA 4Z4GA 1ZBHA 1C0UA 5E41A 3HL8A 1QHTA 3ZSXA 4LH4A 3OS0A 3V1RA 1QS4A 1IKYA 2GV9A 4G1QA 3OYFA 4E7JA 1C6VA 4LSLA 2RF2A 2YNHA 4DS4A 3C94A 3V81A 4M3WA 4LY7A 4CJ3A 3T19A 4FLUA 4F3TA 4GW6A 3MXJA 1WSEA 4CK1A 3E01A 2BGGA 1XHXA 3KKRA 1SKRA 2VG7A 1W0HA 3QEWA 4FJXA 1EXQA 3S3OA 4N76A 1TL3A 4H4OA 3S3MA 3DRSA 3SNNA 1BI4A 3KLHA 4LSNA 4ELVA 4KHSA 3TAEA 2ITGA 4LD0A 3HT3A 3UIQA 3AVLA 4K8ZA 4I2QA 4MFBA 3L3VA 5C25A 3B6PA 3NH0A 1ITGA 4BWMA 3DLHA 3SUPA 4O0IA 1Q9YA 4EP4A 3LPTA 3KJVA 4FLTA 4B8CA 4FLYA 4KB0A 2Z1GA 2F8TA 3RMDA 1JLQA 1KRPA 1ZBUA 5FDLA 4Z4CA 1RCHA 3O3FA 1KFSA 2PY5A 2E6MA 3G10A 4HCBA 3AVBA 2G8KA 3K5OA 2VG5A 3AA3A 3RMBA 3VQ8A 3EY1A 1HYSA 1CLQA 4LH5A 4E7KA 4RW8A 2PYJA 4JS5A 3KTQA 3AVIA 1REVA 3QEIA 3KLFA 1QSSA 1RT4A 4Z0UA 4J2AA 2QXFA 1O1WA 3HVTA 4I9LA 4ZTFA 5KGWA 4DFMA 1VSFA 4CEFA 5HLFA 4L8RB 3LZIA 4F4KA 1FKPA 3QIPA 4J2EA 1VRUA 1RDDA 2G8UA 4CJWA 1BQNA 1VSHA 3AO1A 2IAJA 3K5LA 3V6DA 4CHOA 4O4GA 1X9SA 4ZTJA 4OKEA 4KKOA 1TK8A 1SUQA 3QINA 3S9HA 4CF9A 4B9SA 1HYVA 1WSFA 4FLVA 4M3YA 3ZT3A 3OJUA 2Z1HA 1BIZA 1RDCA 1JLBA 1TVRA 3M8RA 3M8SA 3F73A 1TK0A 4B9LA 3EYZA 4Y1CA 3THVA 3NBPA 2ZD1A 4FZZA 5J1EA 3CFPA 1BGXT 1KVBA 3I0RA 3OYCA 1GOBA 3SPZA 2KZZA 3AA5X 1S1VA 2A1SA 1VSEA 3P1GA 1ZBLA 1XI1A 2DTUA 1T05A 5C24A 3M8PA 1D9FA 3M8QA 3U6FA 1HQEA 1D9DA 3PV8A 2G8VA 1DTTA 3SQ2A 1ZBIA 5CY4A 1NK6A 3V1QA 3NGIA 5CYMA 3OYAA 1NJYA 1GOAA 3DOKA 2JGUA 4CJQA 4FW1A 2D5RA 3VA3A 3SYZA 5I3UA 1NK0A 3TR8A 4RW6A 2VG6A 4FJHA 1NKEA 4FJJA 4IG0A 4CJFA 3RMAA 2HB5A 4OGEA 3PO5A 4OLAA 3C95A 1JLCA 4MQ3A 1RBTA 1NK8A 3SCXA 2P51A 1TV6A 3TAPA 2PYLA 4B9NA 4BDPA 3QEPA 3HXMA 1S6PA 4E7IA 4DQPA 4DS5A 5T7BA 4AHUA 1L3UA 4K8XA 4HUGA 1TKZA 4AHVA 3KD1E 1YTUA 2HNZA 3ZSWA 3WNEA 3BGRA 1TAQA 1UA1A 3TABA 2BE2A 3PY8A 2KQ2A 4DF4A 5J2MA 1RTHA 4O5BA 3DLKA 3JSMA 3T3FA 1UAXA 4DQIA 1RBVA 1KLMA 3QESA 3L2RA 2XY8A 3ZT2A 4DU3A 2QKKA 1B9DA 3L3UA 1JLAA 1A5WA 2B5JA 4DTPA 3SUOA 3D45A 1Q8IA 4FK0A 4PY5A 2E6LA 1TKTA 4Z4EA 3ZSZA 3DLEA 4ELUA 1HQUA 3NF9A 3QEXA 4CHZA 2X6SA 2IGIA 4F3OA 4RW9A 3LWLA 1LW2A 3OS2A 4M3UA 1JXBA 3JYTA 5FRNA 4CFBA 3L8BA 1RT3A 3G0ZA 4J2DA 3F9KA 4FLXA 4HUEA 3V9XA 4CIGA 4KTZA 3CG7A 3VN5A 5C42A 2F8SA 3HYFA 3LAKA 3SV3A 1BHLA 3AVGA 3NCIA 3RWUA 3AVHA 1JL2A 3WNFA 4CK2A 3SI6A 2OZMA 4GMJB 1RT5A 4Y1DA 4M41A 4CK3A 4Q5VA 4E7LA 4FJLA 4E1MA 2HHXA 3ZSOA 1SL0A 1ASUA 5KRTA 4RW7A 3IRXA 1U48A 4CEEA 1W9HA 4RG8A 4CHYA 4OGCA 3OYJA 3TANA 3OYBA 4C8KA 3U3GA 1HYZA 4JRQA 2YV0X 3NH1A 1NK7A 3ULDA 4B3OA 2F96A 4F2RA 4KREA 4CJEA 4DTJA 4EZ9A 3L2QA 3AO4A 1UWBA 5HRPA 3CQ8A 3P83D 3O3GA 4C8MA 2P1JA 3LP0A 2R7YA 4I9QA 4N41A 3OYEA 2G8IA 1CZ9A 1D5AA 4B9TA 5J2NA 5FROA 4CGDA 4CF2A 3L2WA 4DU1A 1QSYA 4FZXC 4CGHA 3AO3A 5CZ2A 3ZT1A 3OYDA 2XY6A 1N5YA 1L3SA 1IO2A 1BQMA 2EX3A 4TSXA 2FC0A 4O55A 4HVJA 4AILC 1SL1A 2QKBA 4E89A 3NF7A 3IAYA 2E4LA 4AHCA 4NYNA 2OYQA 2HVIA 5D3GA 3PUFA 1T8EA 3OS1A 4E7HA 3HSTB 4M42A 1YT3A 3WNGA 2OPQA 4H4MA 4ID1A 4CEOA 4CEZA 1HJRA 5SWMA 1KCFA 2O4GA 3KIOA 4HHTA 2I5JA 3RRGA 4OLBA 3H08A 3K58A 1TAUA 5HP1A 3HPOA 3TAGA 3DOLA 4JLHA 5DMRA 4Z4HA 3L2UA 4BDZA 4DSFA 4DSIA 2QK9A 4FYDA 3QIOA 3VQ7A 2D0AA 1JKHA 2XO7A 1N6QA 4CCHA 4IKFA 3AO5A 3ZSVA 4CGFA 4FM2A 2XRIA 1JLGA 1WAFA 5HBMA 4PWDA 3LDSA 1NK5A 1RBSA 1L3TA 3QERA 2D0BA 4CHNA 4DTNA 4O0JA 3BDPA 4QOZB 2A1RA 4ZHRA 4CJ5A 3LWMA 1Z25A 2HVHA 2BANA 4CEAA 3V9UA 2OPSA 1LAVA 3NGZA 1XHZA 1LAWA 2KFZA 4N47A 4I2PA 3AV9A 3NFAA 3AVKA 4BE0A 5J2PA 3DRRA 3TWHA 5EU7A 3O3HA 1TGOA 4KAZA 1EETA 3NGYA 4ICLA 2HHSA 4FJMA 1HRHA 1SL2A 2BDPA 3HP6A 4DLEA 4KPYA 4R5PA 3HO1A 4CF0A 3TARA 4FM0A 1NJWA
chains in the Genus database with same CATH superfamily
2P9IB 5AQWA 5K14A 1HJOA 5A2QO 4KH4A 3TU5A 4KHQA 4CJKA 1RTDA 5JMVA 1KFDA 1NMNA 4OVLA 2HHUA 3IS9A 4YDUC 5KGXA 3SMPA 4Y0WA 2E5LK 1DEJA 4PUOA 1X3NA 4DR4K 3OYKA 3VQEA 4HUFA 3QETA 1HNVA 4F9OA 2VQFK 4EZ6A 3CFOA 3D7EO 1LWFA 1KAXA 3L4QA 4DV7K 4IOAL 4XH1A 4CI6A 1E3MA 3ID6A 1FK9A 3MAQA 5KQ8A 4FWPA 5FPMA 2YNGA 2V7YA 3ULEA 4CFCA 3SQ1A 3WEEA 3E9OA 2VWJA 4FZYA 4QAGA 4CGJA 1BWFO 3NMUA 1S1XA 1T3VA 1DKGD 1CZBA 1RBUA 3H1QA 5EX5A 2Q0RA 3ISNC 3RVCA 1J53A 1KVAA 3QDKA 3SAHA 4ISEA 3WXJA 4XEIA 4DQSA 3IUCA 5JICA 4LFCK 1JL1A 3CCLN 1C1BA 3LANA 1FW6A 4FJGA 4CEDA 4Z4FA 1WSHA 3O9RA 4CJPA 3DI6A 1KSPA 3VPZA 3FR0A 4JN4A 4AH9A 5HRNA 1NGAA 3DRPA 4OPAA 2HHWA 3KZBA 3K59A 2IOCA 3NDKA 3I33A 2YKMA 3ZX2A 2RE2A 4FWSA 4E0DA 4XH5A 3CJCA 2IC3A 4YDUA 1BU6O 4WQ5A 4JI5K 3MK6A 1VRTA 1RT1A 4CHQA 3LAMA 2VWKA 4IBNA 3VEYA 2QI2A 3V1OA 4IFYA 1B92A 1S1WA 1G15A 1VSKA 2ZE2A 5HRSA 4A59A 4BG8A 1WUAA 2GX9A 4JAXA 4WYBA 1ZBFA 4DLGA 4LF5K 1RILA 4OKJA 1JXEA 5KQDA 2CGJA 3BUZB 2HNDA 3L6QA 4DQ8A 1HPZA 3ENBA 3I8DA 1U45A 1VQLN 4BROA 1T7PA 1NKCA 4FJKA 2FBXA 4J8FA 1HKBA 3O4WA 3HPGA 3A8YA 3SBGA 3VTIA 4FM1A 3P31A 3HK2A 2O8EB 4FXDA 2HHVA 4F2SA 4BR4A 4A62A 5AQMA 2RKIA 1R59O 1QTMA 3CCVN 1SKWA 3EKUA 2ZJRL 3ALYA 4JK9A 3Q7BA 1QQOA 1J5OA 1V4TA 2GBZA 2FBVA 3NHGA 1C1AA 3CJBA 4B9VA 2HMPA 3CFRA 3CCEN 1NGHA 3AO2A 1GOCA 1S6QA 3C6AA 1RTJA 4YHHK 4GV9A 4DTRA 3HBTA 5E26A 1FXXA 5DK5A 1BOTO 4KH6A 2HNYA 1VQ9N 5BR9A 5JS2A 4I6MB 1GLEG 3ZSRA 2W42A 4B9MA 5AQNA 2OTLN 1QSLA 4YOTA 4BDYA 4LF4K 1CXQA 1BISA 4IJAA 3EZ5A 4DV2K 3ASMA 3ZX0A 5SZTA 4JI7K 3KWGA 3O9SA 3OVNA 4E3SA 4Q0BA 1UOCA 4AHSA 1NGJA 4WE1A 1JCFA 2UXBK 3FZLA 1WSJA 1U6ZA 4DWIA 3QBXA 4FJ5A 4WFNL 4FL9A 3MN9A 3CQXA 3KLIA 1TKXA 1ZXOA 1C0UA 3HL8A 4E7JA 1QS4A 3SAFA 4LSLA 2PAVA 4R79A 4DS4A 2QWQA 4M3WA 3O6WA 4L3QA 3T19A 4FLUA 4F3TA 1O13A 1WSEA 4U7BA 1XHXA 1SKRA 3S3OA 4LC9B 2P9UA 3KWIA 3KLHA 4KHSA 3TAEA 4LD0A 4WFBL 1SS6A 4BWMA 4FWOA 4B8CA 4KB0A 2Z1GA 2W40A 4DR2K 3RMDA 1JLQA 5FDLA 3BF1A 1KFSA 2O8CB 2E6MA 4IDHA 3J81O 4HCBA 3H3NO 2G8KA 3K5OA 3AA3A 3K9JA 1HYSA 1CLQA 4LH5A 4RW8A 3AVIA 3THYA 4CZHA 3KLFA 4DUZK 3FZKA 2QXFA 1O1WA 3HVTA 4DFMA 3GE1A 4BRIA 3CC2N 1VSFA 2NRRA 3DWLA 4F4KA 1FKPA 2A40A 2G8UA 3PSIA 4FWQA 1Z6RA 2IAJA 3BY5A 4HWIA 4E1JA 3S9HA 1HYVA 5M1KA 3ZT3A 1BIZA 3F73A 3VEXA 3NBPA 2WBNA 5AQQA 4DHYA 3UKRA 3QB0A 1KVBA 3I0RA 3VMFB 1T6CA 1XI1A 2QTDA 1NU0A 1NGEA 1OKJA 5FLXO 3DOKA 5M1NA 3CC7N 3VEWA 1NK0A 4IG0A 4GV6A 3BP8A 5M1FA 4B9NA 3SCXA 4BR9A 1TV6A 5HL7L 4B9QA 4BDPA 3QEPA 3HXMA 2VCPA 4DS5A 4BRKA 1L3UA 3E9LA 4AHVA 3DAWA 3KD1E 2Q1NA 1WB9A 1UA1A 1YUWA 5BPNA 3EKSA 3PY8A 5J2MA 3CETA 1XQSC 5GIOA 1KLMA 3QESA 3L2RA 2XY8A 1B9DA 5AZIB 1JLAA 2Q36A 3VF4A 4YOWA 2E6LA 4M7XA 4BC2A 3ZSZA 2ITMA 2HBKA 4CHZA 2IGIA 3C65A 3J8AA 5F0XA 3CD6N 3OW2M 4CFBA 3E66A 4HUEA 2GELA 3JAMO 4K42A 4KTZA 3CERA 2F8SA 1DGKN 2JWKA 2OZMA 3SI6A 4KI6A 4CK3A 4E7LA 1HNXK 4E1MA 4WQ4A 2FXUA 3OBWA 2ASPA 4BR5A 3U3GA 1HYZA 3GDQA 3NH1A 3ULDA 2F96A 4B1ZA 2HBMA 2D4WA 4CJEA 2D1KA 3WUHA 4N41A 3P83D 3NVMA 3W3DA 1CZ9A 3TTDA 5J2NA 5FROA 2VQEK 3OYDA 1N5YA 1BO5O 4HVJA 2FC0A 4DUYK 2IVPA 2HVIA 1W2BM 5F2RA 4BR2A 1YT3A 4M42A 4CEOA 4OLBA 2UUAK 3H08A 3K58A 1TAUA 3CCSN 4JI2K 3THXB 5HP1A 3TAGA 4JLHA 5DMRA 2QK9A 4AM6A 4FYDA 3QIOA 3VQ7A 3C6HA 4M7YA 1GLCG 4BR0A 3G4SN 4OO1J 1NK5A 1RBSA 4CHNA 2E20A 2IIRA 5KPTA 4ZHRA 2GWJA 2UU9K 4ISGA 2HVHA 3FGUA 4B3RK 4CEAA 4FPBA 4Z94A 3V9UA 2OPSA 1XHZA 2P9PA 2KFZA 1IBKK 4I2PA 1ILYA 4BE0A 1N33K 4FOIA 2ZGZA 1KAYA 5FPNA 3P39A 1EETA 4ICLA 2HHSA 4KBOA 3TARA 5ELZA 4FM0A 1NJWA 5HRRA 2LSNA 3C6UA 3KD5E 1XMOK 3VQPA 4HCCA 1WNSA 4A57A 4AM7A 3DMJA 4GY2B 3AVAA 4DSKA 4ID5A 5AR0A 1HNZK 4CJLA 2O8FA 1C0GA 1JJ2M 4G9ZA 4XIUA 5AQHA 1U47A 3VENA 3O9QA 1BA1A 1VQNN 4JI0K 5I9EB 3D2FA 1E4GT 4C8NA 2VWBA 2BUPA 1C0TA 3OJSA 4GVMA 2OA8A 4FLWA 5FPDA 1NJZA 4EP5A 3P4IA 2G8HA 3AARA 4CESA 2NRVA 1BCMA 2YKNA 4JV5K 4DF8A 3S3NA 2UUBK 4C1NI 4C8LA 4BREA 4FLZA 3CQYA 4GKJK 3TSPA 3OHRA 1DLOA 5AQGA 2GWKA 2WFBA 3U8XA 4KHUA 3Q7CA 5AQPA 3MXMA 3HJFA 2WOMA 4CEBA 1KLNA 3SZ2A 4CZIA 3L0QA 1SV5A 4CJ4A 1B9FA 4DQQA 3W0LA 4MLEA 1ATRA 3O4QA 1YJWN 3LP3A 3OYLA 1BCOA 2HBLA 4IZ9A 4B1WB 3KKSA 1KD1O 2ZF5O 2Q31A 2B6AA 1V4SA 2X78A 5AQIA 1VSJA 2HHTA 4CERA 1RT6A 4YOUA 2HHHK 3CIPA 1ATNA 1NWKA 4QS8A 5FPEA 4DU4A 1VQ6N 4N5SA 3TAMA 4C8OA 3VQAA 2D0OA 1M90O 4CBUA 1X9MA 2NUBA 4E19A 4CGGA 3HP9A 2YJEA 4CHPA 1HPMA 4H5NA 3WEEB 4KRFA 4CF8A 4IOCL 1XNQK 3C7NA 3VQBA 3MEDA 3ATVA 4B1XB 2W6LA 4FJ8A 3CC4N 4DTMA 2WTUA 3O9TA 1Z05A 1WSGA 2AP1A 5GAHP 1X3MA 4YOYA 3ZEUA 4DFPA 2P5OA 3D0PA 1ZYQA 2YX6A 2FBTA 5FRMA 2RPIA 4CD1A 5GINA 3TAFA 4H8KA 3M1FA 3SQ4A 3ZSQA 1EP4A 4NYFA 4DB3A 2YI1A 2YNIA 3K5NA 4JHDA 4DV4K 3L2VA 2WUSA 3AAQA 4DMNA 4J2BA 4UQGA 3DYAA 4LF8K 1VSLA 3CCMN 2ZM6K 1EO1A 3AAPA 3AVNA 1J6ZA 3VEVA 4BY9C 4KHWA 2XHBA 2NRWA 1YVNA 1S22A 3SPYA 4WQ5C 3MX5A 4W5NA 3QFPA 4CEQA 4OPHA 3VOVA 2FBYA 1N32K 3IMXA 1QVFM 4CJSA 2O8BA 1Q81O 1WOQA 2I7PA 4CJ7A 4PKHA 3T1AA 2V51B 4PQUA 3SV4A 2QM1A 3ZX3A 5JVHL 4DSEA 5HROA 1I3AA 4CJVA 3RSEA 1XWLA 4YFUA 4RW4A 2HW3A 3VQ9A 2W41A 4BE1A 1QZ6A 1VSIA 1S72N 1BL3A 4BVOA 2AA4A 3V9ZA 3U4LA 3CJ9A 3ZCMA 3ZETA 3D2EB 4ILHA 2P9LA 4OPJA 2WONA 3NAEA 2GUIA 2YHAA 3O5BA 1TUYA 1JCGA 1NNEA 1UA0A 3I56N 2DY4A 4XH4A 1K8KA 1S5JA 2PZSA 4IJNA 3ENHA 3NVKA 3MDQA 1VQ5N 3AA2A 3JS6A 2CH5A 1BG3A 1QQCA 4JK7A 3C6TA 3FZHA 3DXKA 4FWLA 3K2PA 4OPKA 4Z4IA 2A41A 2PFUA 4Z4GA 3LPUA 1ZBHA 2GTDA 1HLUA 4H5VA 3OYFA 4KH5A 5BN8A 1C6VA 1JCEA 4M63C 1QZ5A 2YNHA 2FSNA 3FFKB 4NLBA 4ILJA 4CJ3A 4QS9A 4GW6A 3MXJA 2VG7A 4FJXA 4N76A 2E88A 5DM7L 2P9NA 4LSNA 1OVQA 4BRHA 3OBYA 3AVLA 4I2QA 5M1QA 1GLJO 5C25A 3DLHA 3SUPA 4EIAA 4CW7B 3KJVA 4FLTA 2F8TA 3CCUN 4FLYA 1ZBUA 4C23A 3UE5A 3O3FA 2E2QA 3G10A 5CR4A 1MDUB 2QWMA 3RMBA 5KPZA 4H0TB 3IDHA 1EWQA 4CZJA 1Y64A 4LF7K 4I9LA 5HLFA 1NGFA 3QIPA 1RDDA 3VTHA 1VSHA 2VGMA 2DPNA 1SUQA 3QINA 4B9SA 2CH6A 4FLVA 1OH7A 1TVRA 3M8SA 4B9LA 3EYZA 5AQXA 3THVA 4DR5K 4WCEL 3CFPA 2KZZA 3OYCA 3AA5X 1S1VA 4BQLA 2DTUA 1T05A 3U6FA 3PV8A 4PHTX 3FZMA 1HR0K 2HBJA 2JGUA 2D5RA 1RFQA 4MO4A 4RW6A 3F5TA 3WQTA 1NKEA 4CJFA 3VF6A 1JLCA 1GLLO 5H1SQ 2PYLA 1RDUA 1G99A 2NRXA 4BG9A 4E7IA 4DQPA 5T7BA 4AHUA 5M1PA 3TSUA 3I8BA 1IBMK 3ZSWA 2W6KA 4IWVA 1TAQA 2UXCK 4BRMA 4DF4A 1RTHA 3DLKA 2QWLA 3LDPA 2YHYA 4JD2A 1VQ8N 5LL6Z 2NLXA 3ZT2A 1IJJA 3L3UA 1A5WA 4H0PA 3D45A 2QEXN 4FK0A 1TKTA 4Z4EA 2OTJN 3JXUA 4WF9L 4MLHA 4F3OA 4RW9A 3LWLA 1LW2A 4M3UA 5FRNA 3L8BA 3T1HK 4J2DA 4CIGA 2UXDK 3A5OC 3VN5A 3UKRB 5C42A 2ZJQL 4JKGA 3RWUA 4GMJB 1RT5A 4M41A 4Q5VA 2HHXA 1SL0A 5KRTA 3GL1A 2UUCK 3IRXA 1U48A 1W9HA 3TANA 3H6EA 4CZEA 1NMDA 1ESVA 4RWTA 1NK7A 4B3OA 4F2RA 3D6RA 4BRFA 5AFUA 4EZ9A 3WQUA 3WXLA 2NRZA 1UWBA 4C8MA 4I9QA 3MN6A 1C0FA 1D5AA 3SK3A 4FZXC 3AO3A 1QHAA 1L3SA 4O55A 2QKBA 2Q0UA 1VAZA 4AHCA 2OYQA 5LJVA 3PUFA 3WNGA 4H4MA 3SYZA 5SWMA 4CEZA 1HJRA 4CZLA 5AQUA 2I5JA 3L2UA 4DSIA 4RTFD 1N6QA 1JKHA 3DXMB 5AZJB 4BRAA 3AO5A 5EVZA 2XRIA 4HTLA 1NJIO 3ZYYX 4NO7A 2A42A 1N34K 3ZLJA 3LDSA 4PWDA 3EL2A 1L3TA 4DTNA 3J7YP 4WQ4C 3CI5A 3THWB 3O1BA 1XNRK 5AFUH 3TSQA 2HOEA 1LAVA 3NGZA 5B8HA 3H3OB 4O5FA 3AVKA 1CZAN 2HF3A 5J2PA 3O3HA 2OANA 3VEZA 4FJMA 1TYQA 2BDPA 4R5PA 5GAEP 4DV3K 1NKBA 4I6MA 1F21A 3C0BA 4IG3A 2DFHA 4CJTA 3HSCA 1RDAA 2X74A 2OZSA 4B9UA 4CZKA 1BI4B 3A0IX 3HTVA 1D4XA 4BACA 1X9WA 2HMIA 4DR6K 4AQYK 2B4JA 5C0YA 2O4IA 3DLLL 1KAZA 4GVEA 3SAGA 5LY3A 1IH7A 1RDWX 4A61A 1OH8A 3EO3A 2E1ZA 5AQOA 4H0YB 3DLRA 4CJRA 3HOSA 2O8DB 4AHRA 2XY5A 5AQFA 1VQ7N 4M3ZA 2X6NA 1T6DA 3QNOA 5C15A 1MA9B 4OKKA 4JKAA 1VHXA 1RT2A 3G6EN 1QQMA 2BH1A 1YJNN 3QBWA 1NLVA 4BC4A 3H46O 3VQ6A 5ADXA 1NK9A 2P9PB 3KLEA 3TPQA 1FKOA 4IFVA 5JS1A 4DFJA 3KK2A 3L4IA 4DR3K 1WN7A 1LWEA 4NCGA 1TKDA 3RMCA 3LM9A 2XY7A 3J80O 2KZMA 2F7TA 3KK7A 2NNWA 1VSDA 1R0AA 1QE1A 5TKYA 5J2QA 3ITHA 3O08A 3D2FB 2HHQA 1ATSA 1BIUA 4DTOA 3SQ0A 1D8YA 4CFDA 2IDOA 1Y97A 1HNWK 2YCHA 1VSMA 1S1UA 4CZMA 4FK4A 1ASVA 2F9WA 5KRSA 3K0SA 3O4NA 1NGGA 1YIJN 2KW4A 4CE9A 4E1NA 4DSJA 3AVCA 3NH2A 4X65K 1ZBSA 4JRPA 4KHPK 2FF3B 3LDNA 1RTIA 3PX0A 4W5OA 4YNQA 1S1TA 4K0KK 3TAQA 5AQJA 5AQLA 3SUQA 2ZJPL 1U04A 3QLHA 4FCYA 1OVYA 1FJGK 2I7NA 3U3YA 2UYTA 3P5JA 1L5UA 3WXKA 4JK8A 2KKZA 2D0CA 1JLEA 4CVNE 1XC3A 2A6AA 3VQDA 1YVUA 3V9SA 3LZJA 2P9KB 1NOYA 4M3XA 3TI0A 1P90A 1WSIA 1EKEA 2P9SA 3UB5A 4CECA 1LOTB 4CGIA 1YAGA 3EE9A 1IKXA 5AZIA 4JKCA 4IXCA 1C1CA 4IO9L 1MWMA 3H1VX 3GG4A 2JLEA 3VA0A 3LALA 3NF8A 4IEIA 4BE2A 3HM9A 2F4VK 3HI0A 3DLBA 3O80A 4BR7A 5EOYA 4AHTA 3MCPA 3C7NB 4CFAA 5AQKA 3PX4A 1GLBG 3K5MA 2IS3A 3AGKA 1VQ4N 3N4QA 3VQCA 3CCRN 3KK3A 4DFKA 3ZEUB 4EFHA 2G8WA 4DKWA 3IG1A 4CIEA 1T44A 4B3SK 3OYMA 4B08A 3VQ5A 2YNFA 3QMLA 3M5RA 4JS4A 1RNHA 3AGRA 3M3ZA 4CJUA 2KTQA 1SAZA 2ETJA 4B8AB 1A5XA 4AF1A 4A5AA 4NCBA 1EWRA 3RR7A 3FFIA 3THXA 1T03A 4IO8A 1YI2N 2YHXA 4O8KA 4FK2A 1WBDA 1LWCA 4GV3A 2J4RA 3OYNA 3F9MA 1SKSA 3AA4A 3MXIA 1HMVA 5CYQA 1IKVA 1JLFA 1S9EA 3ATUA 3PO4A 5HOOA 3GBTA 2A3ZA 5C10A 1J54A 3NF6A 4UY8O 4JI1K 1HKGA 4FWKA 4CBXA 2A5XA 4LF6K 4G1QA 1IKYA 4NB4A 3ULEB 2RF2A 3C94A 3V81A 4LY7A 1WBBA 4CD3A 4JNEA 3KKRA 3LM2A 4H4OA 3S3MA 3DRSA 3SNNA 1VQMN 4ELVA 2P9LB 2ITGA 3HT3A 3UIQA 4MFBA 4BRCA 3B6PA 1Q86O 1ITGA 4O0IA 4EP4A 3LPTA 1K9MO 4BRNA 1BUPA 1KRPA 4Z4CA 1RCHA 1Q7YO 4ISFA 2Q2RA 3SJHA 2VGNA 3E9PA 4JS5A 3QEIA 1QSSA 4J2AA 3QICA 4K41A 4IOXA 4JKFA 5KGWA 2FSJA 4CZGA 4CEFA 1H1VA 3LZIA 2CGKA 4CJWA 4JI4K 1DT9A 5BRFA 1IV0A 3AO1A 3K5LA 4RCHA 5MLCQ 1M1KO 1TK8A 4KKOA 3VEOA 1VQKN 5AJ3K 3LDOA 2Z1HA 4A2AA 1RDCA 4O8UA 1SQKA 2ASMA 3CCQN 4Y1CA 2ZD1A 5J1EA 3SPZA 1IBLK 1EQYA 3FE1A 3MN7A 1D9FA 1D9DA 2P9NB 2G8VA 1DTTA 1J5EK 4MDBA 4FSVA 1ZBIA 3NGIA 1NJYA 3MWPA 3VA3A 2OCEA 3TTCA 5I3UA 4FJHA 2KLAA 2VG6A 1XUPO 4OGEA 3C95A 2JWLA 4DV0K 4H0OA 4HUGA 1YTUA 4GNIA 3FLCO 2HNZA 3TABA 2BE2A 3MCAB 2KQ2A 3JSMA 5E84A 3SBTA 3T3FA 4DQIA 4PKIA 5CHIA 1U2VA 4DTPA 3MN5A 1N8RO 3MMVA 5C2FA 3DLEA 4FVUA 1YHQN 3VERA 2IVOA 1JXBA 3JYTA 1RT3A 3G0ZA 4FLXA 3CG7A 3BZKA 3EE8A 3HYFA 3LAKA 3UKUA 4FWMA 2Q97A 3WNFA 4BGBA 4CK2A 1W97L 4QS7A 3ZSOA 3CJAA 1ASUA 4CHYA 2QWOA 4C8KA 1LCUA 5KPRA 4JRQA 2YV0X 3O1WA 4ILGB 3CHWA 3BZCA 3L2QA 2E2PA 5HRPA 2R7YA 3O3GA 5LMUK 2P1JA 3LP0A 2G8IA 3OYEA 2P9IA 3CF5L 4FPAA 4B9TA 4BQZA 2QA4N 4CGDA 3L2WA 3CPEA 3KVGA 2XY6A 1IO2A 1SL1A 2EX3A 4TSXA 4AILC 4E89A 3NF7A 3CXCM 3IAYA 1I94K 4NYNA 5D3GA 1T8EA 3OS1A 4JD2B 2QXLA 3R1XA 4E7HA 4H5WA 2OPQA 5AQVA 1K73O 1KCFA 2O4GA 4HHTA 4BRLA 2RHKA 5F1XA 3HPOA 4BDZA 1QVGM 2FSKA 3G25A 2D0AA 3EN9A 4CCHA 3PLAA 4IKFA 3ZSVA 4CGFA 3A5LC 4FM2A 1HUXA 1KQSM 4NXNK 1WAFA 5BN9A 3EZWA 1GLFO 3H45C 4JKGB 3A5MC 3BDPA 3TTFA 2A1RA 3CCJN 4CJ5A 3LWMA 1Z25A 2BANA 4PKGA 3T69A 4B1YB 3MWTA 3NFAA 3DRRA 5EU7A 4KAZA 1TGOA 3NGYA 1SL2A 2NRHA 4KPYA 3HP6A 4DLEA 4X66K 4JI3K 3D2EA 1KXPA 4NCAA 4DTUA 4V19S 2KHOA 4BWJA 4FWNA 3AVFA 1HX1A 2P9UB 4DSLA 3ZSYA 3QO9A 4KHNA 4JYAK 3CMEN 4W5TA 4IFEA 1YJ9N 4CF1A 3WXIA 4M3RA 2YHBA 1P8ZA 4KTQA 5KTQA 3HPHA 3QFUA 5AQTA 1U49A 2E2NA 3VF2A 3HM8A 4F8RA 1NK4A 1QQNA 1RBRA 4EAHD 1TK5A 1EX4A 1IKWA 4FJIA 3THYB 5C12A 3OYHA 2ASOA 3AVMA 3T1YK 1KVCA 1RT7A 4FVMA 4CIFA 3O9UA 2EHGA 3HZ6A 5JVGL 4H03B 1N36K 2WC9A 4PA1A 4KHYA 5DM6L 2E1YA 2FLOA 4OJRA 5GIPA 4KFBA 1DTQA 3CM5A 4H0XB 1TYQB 2Z1JA 5IWAK 3SUNA 2ZQBA 3KK1A 2KFNA 5AQSA 3B6OA 4B1UB 1OH5A 4YORA 3VETA 5CE3A 1WAJA 3VGLA 1Q82O 3P38A 1IG8A 4FW2A 4BRPA 3K57A 3J7AP 4U67L 1KC8O 3MECA 1MU2A 4LFAK 3CYMA 3RR8A 4FO0A 1NG9A 3CM6A 4ELTA 1L3VA 1ASWA 3MEEA 1YF5L 1LW0A 1GLAG 4BVPA 3AVJA 1I39A 2ZWHA 3OYIA 3DM2A 2BTFA 3U9DA 2Y1JA 5I42A 3A5NC 2O8EA 3O8MA 3N4PA 4YOVA 2QW9A 1IG9A 5CZ1A 1LV5A 2RN2A 2AJQA 2P5GA 2H3GX 4H0VB 4DQRA 2ZGYA 1S3XA 3LP1A 3DLGA 2HSTA 4QCLA 3LDLA 4FJ9A 4W5QA 1CXUA 4W5RA 2ATQA 3PX6A 3K9KA 1HKCA 3NE6A 1NJXA 4FJNA 4CZFA 3CMAN 3VGKA 3VESA 1SZ2A 4NLCA 5BPLA 3V4IA 3WNHA 5GADP 3OYGA 3I0SA 3IFRA 3LP2A 3WXMB 2YHWA 3OA9A 4KO0A 4HTUA 2EWSA 2DFFA 2OPRA 4BRQA 2OPPA 2Q3SA 2G8FA 3A2FA 4K25A 2IVNA 1NGCA 4LFBK 4KV8A 4K43A 4DTXA 1HNIA 1YTAA 4FOEA 2V52B 1Q18A 4BRGA 4KI4A 3SMSA 1C0MA 1NGDA 3HRGA 1OH6A 3MEGA 4O44A 3EEQA 1NOZA 3E1YA 3MX2A 1VQPN 2Y1IA 5AQYA 3VQQA 3VQ4A 1WLJA 1TUUA 2F9TA 3VGMA 3FZFA 3V9WA 3QEVA 4DG1A 3KLGA 1YITN 1VK0A 1Z26A 1J9AA 4JKEA 1NGBA 1RDBA 4N56A 4H5RA 1KTQA 1U4BA 4A2BA 3RRHA 3ZT4A 4PL7A 3PSFA 2VYPA 4DV6K 5LMNK 3WT0A 3LL3A 1Q9XA 3F2KA 4YY3K 3OY9A 4H5TA 2P9SB 2Z1IA 4MO5A 4M45A 4M3TA 5BRDA 2DFEA 4DTSA 2QWPA 3U9ZA 3DJCA 3IKMA 4KB1A 2O8FB 4KTWA 2O8CA 1S9GA 1X1PA 3DXMA 5AZJA 1K6YA 1BDGA 3QNNA 3ZT0A 2E8AA 1TL1A 3RTVA 2PBDA 4FJ7A 1A5VA 3THWA 4IDKA 1XC9A 4I7FA 1NM1A 5KI6A 3SJJA 5ADXH 5E41A 4JKBA 1QHTA 3ZSXA 4LH4A 3OS0A 3V1RA 3HVRA 5AQZA 2GV9A 5BPMA 1GLDG 4DCHA 1RGIA 5GAGP 3CJ7A 3R8EA 4CK1A 3E01A 2BGGA 3LDQA 1W0HA 3QEWA 1EXQA 1TL3A 4EHUA 1BI4A 4JKDA 3J7ZO 5IT9O 3AY9A 4K8ZA 3L3VA 3NH0A 5BRHA 1Q9YA 5LJWA 2E2OA 2PY5A 4WFAL 3AVBA 2O8DA 2VG5A 3BF3A 4B3MK 3VQ8A 3EY1A 4E7KA 2PYJA 3GOIA 3S41A 4BRDA 2QWNA 3KTQA 3OTOK 1REVA 1NBWA 1RT4A 4Z0UA 4ZTFA 2D0PA 4L8RB 4IEEA 4J2EA 3R3LA 1VRUA 1BA0A 1BQNA 4BC5A 3PIOL 3V6DA 4DR1K 4CHOA 4O4GA 4DV1K 1X9SA 4ZTJA 4OKEA 4CF9A 4M3YA 1WSFA 3OJUA 3M8RA 1JLBA 1TK0A 2QWRA 2NZTA 1XMQK 4FZZA 1BGXT 1GOBA 4GKKK 3R6MA 2A1SA 1VSEA 3P1GA 1ZBLA 5C24A 3M8PA 3M8QA 1HQEA 3BEXA 3I55N 2GUPA 3SQ2A 5CY4A 1NK6A 3V1QA 2V7ZA 5CYMA 4JI6K 3OYAA 4OX9K 1GOAA 4FWRA 4CJQA 4FW1A 3TR8A 4FJJA 3RMAA 2HB5A 3PO5A 4OLAA 4MQ3A 1RBTA 1NK8A 2P51A 3ID8A 3TAPA 4X64K 5BREA 1S6PA 3SLCA 5M1OA 2NRTA 4K8XA 1TKZA 3WNEA 3BGRA 4O5BA 4JHDB 1UAXA 5JLHA 1RBVA 1MWKA 2QKKA 4DU3A 1YXQA 2B5JA 3SUOA 1Q8IA 4PY5A 4JKHA 3PIPL 3CPWM 4ELUA 1HQUA 1X9JA 3NF9A 3QEXA 5EY4A 4DR7K 2X6SA 3OS2A 3CJ1A 3F9KA 3HOTA 3V9XA 3R9PA 5JLFA 3SV3A 1BHLA 3AVGA 3NCIA 2O8BB 3AVHA 1JL2A 4Y1DA 4FJLA 1W7AA 4RW7A 4CEEA 4RG8A 2YJFA 4OGCA 3OYJA 3OYBA 4PL8A 2HF4A 3RSEB 4KREA 4DTJA 4JI8K 4A5BA 3AO4A 2P9KA 3CQ8A 4BC3A 4CF2A 4DU1A 1QSYA 4CGHA 5CZ2A 3ZT1A 3ZETB 5BR8K 1BQMA 5AQRA 1VQON 4B3TK 2E4LA 1K8AO 5EXWA 3HSTB 4ID1A 3RRGA 3KIOA 1U2VB 3B8AX 4LF9K 3T7ZA 4DV5K 3DOLA 4DSFA 4Z4HA 4NXMK 5TKWA 4BGAA 2XO7A 1K8KB 2CGLA 4MDAA 1NGIA 4YOXA 3KHYA 5C2DA 1JLGA 1E4FT 5HBMA 4EHTA 4C1NK 3UKUB 2D0BA 3QERA 4O0JA 4QOZB 4CBWA 4X62K 3DXKB 4JEPA 3G71N 2FF6A 2GEMA 1LAWA 4N47A 3AV9A 3TWHA 1ZC6A 3ENOA 1HRHA 3HO1A 4CF0A 4B1VA 3M6GA
chains in the Genus database with same CATH topology
5HRRA 2LSNA 3C6UA 3KD5E 1NKBA 4DTUA 4IG3A 1F21A 4CJTA 4NCAA 2DFHA 3VQPA 1WNSA 4HCCA 1RDAA 4BWJA 5K14A 3AVFA 2X74A 3DMJA 2OZSA 4B9UA 4DSLA 3ZSYA 1BI4B 3AVAA 4DSKA 4ID5A 4KHQA 4BACA 1X9WA 3QO9A 2HMIA 4CJKA 1RTDA 4CJLA 4KHNA 2B4JA 1KFDA 4XIUA 1U47A 2O4IA 4OVLA 4W5TA 2HHUA 4CF1A 3IS9A 4M3RA 2YHBA 5KGXA 4KTQA 5KTQA 1IH7A 3HPHA 1U49A 4PUOA 4C8NA 3OYKA 3DLRA 3VQEA 4HUFA 4CJRA 3QETA 1HNVA 1C0TA 4AHRA 1NK4A 4F8RA 2XY5A 1RBRA 3OJSA 4EZ6A 4M3ZA 4GVMA 2X6NA 3CFOA 3QNOA 1EX4A 1IKWA 1TK5A 2OA8A 4FJIA 3OYHA 4FLWA 1LWFA 3AVMA 1NJZA 4OKKA 1KVCA 4EP5A 1RT7A 2G8HA 4FVMA 4CIFA 4CESA 2EHGA 1RT2A 1FK9A 3MAQA 1BCMA 2YKNA 2YNGA 4DF8A 4CFCA 3S3NA 4PA1A 3SQ1A 4KHYA 3VQ6A 4C8LA 2VWJA 1NK9A 4FZYA 4QAGA 4FLZA 4CGJA 4OJRA 3KLEA 4KFBA 1FKOA 1DTQA 3CM5A 1S1XA 4IFVA 2Z1JA 3SUNA 2ZQBA 1DLOA 3KK1A 1CZBA 1RBUA 2KFNA 5JS1A 3B6OA 3ISNC 4KHUA 4DFJA 1J53A 3KK2A 1KVAA 3MXMA 1WN7A 3HJFA 1WAJA 2WOMA 1LWEA 4CEBA 1KLNA 3SZ2A 4NCGA 4DQSA 1TKDA 3RMCA 1SV5A 2XY7A 4CJ4A 1B9FA 2KZMA 4FW2A 3K57A 1JL1A 4DQQA 1C1BA 3LANA 4FJGA 3HVRA 4CEDA 1VSDA 3O4QA 1R0AA 3LP3A 1QE1A 1BCOA 3MECA 3OYLA 5J2QA 4Z4FA 1MU2A 1WSHA 3ITHA 3CYMA 3KKSA 3RR8A 4CJPA 3DI6A 1BIUA 4DTOA 2HHQA 2B6AA 3CM6A 3SQ0A 1D8YA 4CFDA 1KSPA 2IDOA 1Y97A 2X78A 1ASWA 1L3VA 4ELTA 3MEEA 1VSMA 1S1UA 4AH9A 1VSJA 1LW0A 2HHTA 4CERA 1RT6A 4FK4A 5HRNA 1ASVA 3DRPA 3AVJA 5KRSA 4DU4A 1I39A 3O4NA 4N5SA 3OYIA 3TAMA 3DM2A 2HHWA 3K59A 2IOCA 2KW4A 4CE9A 4E1NA 4C8OA 3NDKA 2Y1JA 5I42A 4DSJA 3AVCA 3VQAA 2YKMA 3NH2A 1X9MA 2NUBA 4E0DA 4E19A 4CGGA 2IC3A 3HP9A 4CHPA 4JRPA 4KRFA 1VRTA 4CF8A 1IG9A 5CZ1A 1RTIA 1RT1A 1LV5A 4CHQA 4W5OA 3LAMA 2VWKA 3PX0A 2RN2A 1S1TA 3MEDA 3VQBA 4YNQA 3TAQA 2AJQA 4IBNA 2P5GA 4FJ8A 3V1OA 4DQRA 4IFYA 4DTMA 1B92A 1S1WA 1G15A 3DLGA 3LP1A 1VSKA 3SUQA 4FJ9A 4QCLA 2ZE2A 1U04A 3QLHA 4W5QA 5HRSA 1CXUA 1WSGA 4W5RA 4FCYA 2ATQA 4DFPA 3PX6A 2P5OA 3U3YA 4KI6A 3D0PA 3P5JA 1L5UA 3NE6A 1ZYQA 1NJXA 1ZBFA 2FBTA 4DLGA 4FJNA 1RILA 2RPIA 5FRMA 3V4IA 3TAFA 2D0CA 4OKJA 1JXEA 4H8KA 1JLEA 3WNHA 3OYGA 3SQ4A 3ZSQA 3I0SA 3LP2A 2HNDA 3VQDA 1EP4A 1YVUA 3V9SA 1HPZA 4NYFA 3LZJA 1NOYA 4M3XA 3I8DA 4KO0A 3TI0A 4HTUA 1WSIA 1EKEA 2DFFA 2YNIA 4CECA 2OPRA 3K5NA 1U45A 1T7PA 4CGIA 3L2VA 2OPPA 2Q3SA 4DMNA 3A2FA 1NKCA 2G8FA 2FBXA 4UQGA 4J2BA 4FJKA 1IKXA 3DYAA 4KV8A 3HPGA 1C1CA 1VSLA 4DTXA 1HNIA 1YTAA 4FM1A 3HK2A 2JLEA 3AVNA 3VA0A 3LALA 3NF8A 4KHWA 2XHBA 4KI4A 1C0MA 4FXDA 4BE2A 3HM9A 3SPYA 3DLBA 4W5NA 3MEGA 4O44A 4AHTA 4CEQA 4F2SA 2HHVA 2FBYA 2RKIA 4CFAA 1NOZA 1QTMA 4CJSA 1SKWA 3ALYA 3PX4A 1J5OA 3K5MA 2Y1IA 2GBZA 2FBVA 2IS3A 3NHGA 1C1AA 3T1AA 1WLJA 3VQ4A 3VQQA 4B9VA 4PQUA 3SV4A 3V9WA 3QEVA 3VQCA 4DSEA 5HROA 4DG1A 3KLGA 1I3AA 4CJVA 3KK3A 1VK0A 1XWLA 1Z26A 4DFKA 3CFRA 1J9AA 4YFUA 4N56A 1RDBA 2G8WA 4RW4A 1KTQA 3IG1A 3RRHA 1U4BA 2HW3A 3AO2A 3VQ9A 3ZT4A 4BE1A 1GOCA 1S6QA 4CIEA 1RTJA 1VSIA 1BL3A 4DTRA 3OYMA 4B08A 3V9ZA 1FXXA 5DK5A 3VQ5A 1Q9XA 2YNFA 3ZCMA 4JS4A 2HNYA 1RNHA 4CJUA 2KTQA 5JS2A 2ETJA 3OY9A 4OPJA 4B8AB 2WONA 3NAEA 2GUIA 2Z1IA 4M45A 1A5XA 3ZSRA 2W42A 2YHAA 4B9MA 4M3TA 1QSLA 4BDYA 2DFEA 1CXQA 4DTSA 4NCBA 1BISA 3RR7A 3FFIA 4KB1A 4KTWA 3EZ5A 1T03A 1UA0A 3ASMA 2DY4A 1S9GA 4FK2A 1X1PA 5SZTA 1LWCA 1S5JA 1K6YA 2PZSA 3OYNA 3OVNA 4E3SA 3QNNA 1SKSA 1UOCA 3ZT0A 4Q0BA 3AA4A 4AHSA 1TL1A 4WE1A 3RTVA 3MXIA 1HMVA 5CYQA 1WSJA 4DWIA 3AA2A 4FJ7A 1IKVA 1A5VA 1XC9A 4IDKA 1JLFA 1S9EA 1QQCA 4I7FA 3PO4A 4FJ5A 3C6TA 5KI6A 1J54A 3NF6A 3K2PA 4OPKA 4Z4IA 3KLIA 3SJJA 1TKXA 3LPUA 4Z4GA 1ZBHA 1C0UA 5E41A 3HL8A 1QHTA 3ZSXA 4LH4A 3OS0A 3V1RA 1QS4A 1IKYA 2GV9A 4G1QA 3OYFA 4E7JA 1C6VA 4LSLA 2RF2A 2YNHA 4DS4A 3C94A 3V81A 4M3WA 4LY7A 4CJ3A 3T19A 4FLUA 4F3TA 4GW6A 3MXJA 1WSEA 4CK1A 3E01A 2BGGA 1XHXA 3KKRA 1SKRA 2VG7A 1W0HA 3QEWA 4FJXA 1EXQA 3S3OA 4N76A 1TL3A 4H4OA 3S3MA 3DRSA 3SNNA 1BI4A 3KLHA 4LSNA 4ELVA 4KHSA 3TAEA 2ITGA 4LD0A 3HT3A 3UIQA 3AVLA 4K8ZA 4I2QA 4MFBA 3L3VA 5C25A 3B6PA 3NH0A 1ITGA 4BWMA 3DLHA 3SUPA 4O0IA 1Q9YA 4EP4A 3LPTA 3KJVA 4FLTA 4B8CA 4FLYA 4KB0A 2Z1GA 2F8TA 3RMDA 1JLQA 1KRPA 1ZBUA 5FDLA 4Z4CA 1RCHA 3O3FA 1KFSA 2PY5A 2E6MA 3G10A 4HCBA 3AVBA 2G8KA 3K5OA 2VG5A 3AA3A 3RMBA 3VQ8A 3EY1A 1HYSA 1CLQA 4LH5A 4E7KA 4RW8A 2PYJA 4JS5A 3KTQA 3AVIA 1REVA 3QEIA 3KLFA 1QSSA 1RT4A 4Z0UA 4J2AA 2QXFA 1O1WA 3HVTA 4I9LA 4ZTFA 5KGWA 4DFMA 1VSFA 4CEFA 5HLFA 4L8RB 3LZIA 4F4KA 1FKPA 3QIPA 4J2EA 1VRUA 1RDDA 2G8UA 4CJWA 1BQNA 1VSHA 3AO1A 2IAJA 3K5LA 3V6DA 4CHOA 4O4GA 1X9SA 4ZTJA 4OKEA 4KKOA 1TK8A 1SUQA 3QINA 3S9HA 4CF9A 4B9SA 1HYVA 1WSFA 4FLVA 4M3YA 3ZT3A 3OJUA 2Z1HA 1BIZA 1RDCA 1JLBA 1TVRA 3M8RA 3M8SA 3F73A 1TK0A 4B9LA 3EYZA 4Y1CA 3THVA 3NBPA 2ZD1A 4FZZA 5J1EA 3CFPA 1BGXT 1KVBA 3I0RA 3OYCA 1GOBA 3SPZA 2KZZA 3AA5X 1S1VA 2A1SA 1VSEA 3P1GA 1ZBLA 1XI1A 2DTUA 1T05A 5C24A 3M8PA 1D9FA 3M8QA 3U6FA 1HQEA 1D9DA 3PV8A 2G8VA 1DTTA 3SQ2A 1ZBIA 5CY4A 1NK6A 3V1QA 3NGIA 5CYMA 3OYAA 1NJYA 1GOAA 3DOKA 2JGUA 4CJQA 4FW1A 2D5RA 3VA3A 3SYZA 5I3UA 1NK0A 3TR8A 4RW6A 2VG6A 4FJHA 1NKEA 4FJJA 4IG0A 4CJFA 3RMAA 2HB5A 4OGEA 3PO5A 4OLAA 3C95A 1JLCA 4MQ3A 1RBTA 1NK8A 3SCXA 2P51A 1TV6A 3TAPA 2PYLA 4B9NA 4BDPA 3QEPA 3HXMA 1S6PA 4E7IA 4DQPA 4DS5A 5T7BA 4AHUA 1L3UA 4K8XA 4HUGA 1TKZA 4AHVA 3KD1E 1YTUA 2HNZA 3ZSWA 3WNEA 3BGRA 1TAQA 1UA1A 3TABA 2BE2A 3PY8A 2KQ2A 4DF4A 5J2MA 1RTHA 4O5BA 3DLKA 3JSMA 3T3FA 1UAXA 4DQIA 1RBVA 1KLMA 3QESA 3L2RA 2XY8A 3ZT2A 4DU3A 2QKKA 1B9DA 3L3UA 1JLAA 1A5WA 2B5JA 4DTPA 3SUOA 3D45A 1Q8IA 4FK0A 4PY5A 2E6LA 1TKTA 4Z4EA 3ZSZA 3DLEA 4ELUA 1HQUA 3NF9A 3QEXA 4CHZA 2X6SA 2IGIA 4F3OA 4RW9A 3LWLA 1LW2A 3OS2A 4M3UA 1JXBA 3JYTA 5FRNA 4CFBA 3L8BA 1RT3A 3G0ZA 4J2DA 3F9KA 4FLXA 4HUEA 3V9XA 4CIGA 4KTZA 3CG7A 3VN5A 5C42A 2F8SA 3HYFA 3LAKA 3SV3A 1BHLA 3AVGA 3NCIA 3RWUA 3AVHA 1JL2A 3WNFA 4CK2A 3SI6A 2OZMA 4GMJB 1RT5A 4Y1DA 4M41A 4CK3A 4Q5VA 4E7LA 4FJLA 4E1MA 2HHXA 3ZSOA 1SL0A 1ASUA 5KRTA 4RW7A 3IRXA 1U48A 4CEEA 1W9HA 4RG8A 4CHYA 4OGCA 3OYJA 3TANA 3OYBA 4C8KA 3U3GA 1HYZA 4JRQA 2YV0X 3NH1A 1NK7A 3ULDA 4B3OA 2F96A 4F2RA 4KREA 4CJEA 4DTJA 4EZ9A 3L2QA 3AO4A 1UWBA 5HRPA 3CQ8A 3P83D 3O3GA 4C8MA 2P1JA 3LP0A 2R7YA 4I9QA 4N41A 3OYEA 2G8IA 1CZ9A 1D5AA 4B9TA 5J2NA 5FROA 4CGDA 4CF2A 3L2WA 4DU1A 1QSYA 4FZXC 4CGHA 3AO3A 5CZ2A 3ZT1A 3OYDA 2XY6A 1N5YA 1L3SA 1IO2A 1BQMA 2EX3A 4TSXA 2FC0A 4O55A 4HVJA 4AILC 1SL1A 2QKBA 4E89A 3NF7A 3IAYA 2E4LA 4AHCA 4NYNA 2OYQA 2HVIA 5D3GA 3PUFA 1T8EA 3OS1A 4E7HA 3HSTB 4M42A 1YT3A 3WNGA 2OPQA 4H4MA 4ID1A 4CEOA 4CEZA 1HJRA 5SWMA 1KCFA 2O4GA 3KIOA 4HHTA 2I5JA 3RRGA 4OLBA 3H08A 3K58A 1TAUA 5HP1A 3HPOA 3TAGA 3DOLA 4JLHA 5DMRA 4Z4HA 3L2UA 4BDZA 4DSFA 4DSIA 2QK9A 4FYDA 3QIOA 3VQ7A 2D0AA 1JKHA 2XO7A 1N6QA 4CCHA 4IKFA 3AO5A 3ZSVA 4CGFA 4FM2A 2XRIA 1JLGA 1WAFA 5HBMA 4PWDA 3LDSA 1NK5A 1RBSA 1L3TA 3QERA 2D0BA 4CHNA 4DTNA 4O0JA 3BDPA 4QOZB 2A1RA 4ZHRA 4CJ5A 3LWMA 1Z25A 2HVHA 2BANA 4CEAA 3V9UA 2OPSA 1LAVA 3NGZA 1XHZA 1LAWA 2KFZA 4N47A 4I2PA 3AV9A 3NFAA 3AVKA 4BE0A 5J2PA 3DRRA 3TWHA 5EU7A 3O3HA 1TGOA 4KAZA 1EETA 3NGYA 4ICLA 2HHSA 4FJMA 1HRHA 1SL2A 2BDPA 3HP6A 4DLEA 4KPYA 4R5PA 3HO1A 4CF0A 3TARA 4FM0A 1NJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRR A;  2LSN A;  3C6U A;  3KD5 E;  1NKB A;  4DTU A;  4IG3 A;  1F21 A;  4CJT A;  4NCA A;  2DFH A;  3VQP A;  1WNS A;  4HCC A;  1RDA A;  4BWJ A;  5K14 A;  3AVF A;  2X74 A;  3DMJ A;  2OZS A;  4B9U A;  4DSL A;  3ZSY A;  1BI4 B;  3AVA A;  4DSK A;  4ID5 A;  4KHQ A;  4BAC A;  1X9W A;  3QO9 A;  2HMI A;  4CJK A;  1RTD A;  4CJL A;  4KHN A;  2B4J A;  1KFD A;  4XIU A;  1U47 A;  2O4I A;  4OVL A;  4W5T A;  2HHU A;  4CF1 A;  3IS9 A;  4M3R A;  2YHB A;  5KGX A;  4KTQ A;  5KTQ A;  1IH7 A;  3HPH A;  1U49 A;  4PUO A;  4C8N A;  3OYK A;  3DLR A;  3VQE A;  4HUF A;  4CJR A;  3QET A;  1HNV A;  1C0T A;  4AHR A;  1NK4 A;  4F8R A;  2XY5 A;  1RBR A;  3OJS A;  4EZ6 A;  4M3Z A;  4GVM A;  2X6N A;  3CFO A;  3QNO A;  1EX4 A;  1IKW A;  1TK5 A;  2OA8 A;  4FJI A;  3OYH A;  4FLW A;  1LWF A;  3AVM A;  1NJZ A;  4OKK A;  1KVC A;  4EP5 A;  1RT7 A;  2G8H A;  4FVM A;  4CIF A;  4CES A;  2EHG A;  1RT2 A;  1FK9 A;  3MAQ A;  1BCM A;  2YKN A;  2YNG A;  4DF8 A;  4CFC A;  3S3N A;  4PA1 A;  3SQ1 A;  4KHY A;  3VQ6 A;  4C8L A;  2VWJ A;  1NK9 A;  4FZY A;  4QAG A;  4FLZ A;  4CGJ A;  4OJR A;  3KLE A;  4KFB A;  1FKO A;  1DTQ A;  3CM5 A;  1S1X A;  4IFV A;  2Z1J A;  3SUN A;  2ZQB A;  1DLO A;  3KK1 A;  1CZB A;  1RBU A;  2KFN A;  5JS1 A;  3B6O A;  3ISN C;  4KHU A;  4DFJ A;  1J53 A;  3KK2 A;  1KVA A;  3MXM A;  1WN7 A;  3HJF A;  1WAJ A;  2WOM A;  1LWE A;  4CEB A;  1KLN A;  3SZ2 A;  4NCG A;  4DQS A;  1TKD A;  3RMC A;  1SV5 A;  2XY7 A;  4CJ4 A;  1B9F A;  2KZM A;  4FW2 A;  3K57 A;  1JL1 A;  4DQQ A;  1C1B A;  3LAN A;  4FJG A;  3HVR A;  4CED A;  1VSD A;  3O4Q A;  1R0A A;  3LP3 A;  1QE1 A;  1BCO A;  3MEC A;  3OYL A;  5J2Q A;  4Z4F A;  1MU2 A;  1WSH A;  3ITH A;  3CYM A;  3KKS A;  3RR8 A;  4CJP A;  3DI6 A;  1BIU A;  4DTO A;  2HHQ A;  2B6A A;  3CM6 A;  3SQ0 A;  1D8Y A;  4CFD A;  1KSP A;  2IDO A;  1Y97 A;  2X78 A;  1ASW A;  1L3V A;  4ELT A;  3MEE A;  1VSM A;  1S1U A;  4AH9 A;  1VSJ A;  1LW0 A;  2HHT A;  4CER A;  1RT6 A;  4FK4 A;  5HRN A;  1ASV A;  3DRP A;  3AVJ A;  5KRS A;  4DU4 A;  1I39 A;  3O4N A;  4N5S A;  3OYI A;  3TAM A;  3DM2 A;  2HHW A;  3K59 A;  2IOC A;  2KW4 A;  4CE9 A;  4E1N A;  4C8O A;  3NDK A;  2Y1J A;  5I42 A;  4DSJ A;  3AVC A;  3VQA A;  2YKM A;  3NH2 A;  1X9M A;  2NUB A;  4E0D A;  4E19 A;  4CGG A;  2IC3 A;  3HP9 A;  4CHP A;  4JRP A;  4KRF A;  1VRT A;  4CF8 A;  1IG9 A;  5CZ1 A;  1RTI A;  1RT1 A;  1LV5 A;  4CHQ A;  4W5O A;  3LAM A;  2VWK A;  3PX0 A;  2RN2 A;  1S1T A;  3MED A;  3VQB A;  4YNQ A;  3TAQ A;  2AJQ A;  4IBN A;  2P5G A;  4FJ8 A;  3V1O A;  4DQR A;  4IFY A;  4DTM A;  1B92 A;  1S1W A;  1G15 A;  3DLG A;  3LP1 A;  1VSK A;  3SUQ A;  4FJ9 A;  4QCL A;  2ZE2 A;  1U04 A;  3QLH A;  4W5Q A;  5HRS A;  1CXU A;  1WSG A;  4W5R A;  4FCY A;  2ATQ A;  4DFP A;  3PX6 A;  2P5O A;  3U3Y A;  4KI6 A;  3D0P A;  3P5J A;  1L5U A;  3NE6 A;  1ZYQ A;  1NJX A;  1ZBF A;  2FBT A;  4DLG A;  4FJN A;  1RIL A;  2RPI A;  5FRM A;  3V4I A;  3TAF A;  2D0C A;  4OKJ A;  1JXE A;  4H8K A;  1JLE A;  3WNH A;  3OYG A;  3SQ4 A;  3ZSQ A;  3I0S A;  3LP2 A;  2HND A;  3VQD A;  1EP4 A;  1YVU A;  3V9S A;  1HPZ A;  4NYF A;  3LZJ A;  1NOY A;  4M3X A;  3I8D A;  4KO0 A;  3TI0 A;  4HTU A;  1WSI A;  1EKE A;  2DFF A;  2YNI A;  4CEC A;  2OPR A;  3K5N A;  1U45 A;  1T7P A;  4CGI A;  3L2V A;  2OPP A;  2Q3S A;  4DMN A;  3A2F A;  1NKC A;  2G8F A;  2FBX A;  4UQG A;  4J2B A;  4FJK A;  1IKX A;  3DYA A;  4KV8 A;  3HPG A;  1C1C A;  1VSL A;  4DTX A;  1HNI A;  1YTA A;  4FM1 A;  3HK2 A;  2JLE A;  3AVN A;  3VA0 A;  3LAL A;  3NF8 A;  4KHW A;  2XHB A;  4KI4 A;  1C0M A;  4FXD A;  4BE2 A;  3HM9 A;  3SPY A;  3DLB A;  4W5N A;  3MEG A;  4O44 A;  4AHT A;  4CEQ A;  4F2S A;  2HHV A;  2FBY A;  2RKI A;  4CFA A;  1NOZ A;  1QTM A;  4CJS A;  1SKW A;  3ALY A;  3PX4 A;  1J5O A;  3K5M A;  2Y1I A;  2GBZ A;  2FBV A;  2IS3 A;  3NHG A;  1C1A A;  3T1A A;  1WLJ A;  3VQ4 A;  3VQQ A;  4B9V A;  4PQU A;  3SV4 A;  3V9W A;  3QEV A;  3VQC A;  4DSE A;  5HRO A;  4DG1 A;  3KLG A;  1I3A A;  4CJV A;  3KK3 A;  1VK0 A;  1XWL A;  1Z26 A;  4DFK A;  3CFR A;  1J9A A;  4YFU A;  4N56 A;  1RDB A;  2G8W A;  4RW4 A;  1KTQ A;  3IG1 A;  3RRH A;  1U4B A;  2HW3 A;  3AO2 A;  3VQ9 A;  3ZT4 A;  4BE1 A;  1GOC A;  1S6Q A;  4CIE A;  1RTJ A;  1VSI A;  1BL3 A;  4DTR A;  3OYM A;  4B08 A;  3V9Z A;  1FXX A;  5DK5 A;  3VQ5 A;  1Q9X A;  2YNF A;  3ZCM A;  4JS4 A;  2HNY A;  1RNH A;  4CJU A;  2KTQ A;  5JS2 A;  2ETJ A;  3OY9 A;  4OPJ A;  4B8A B;  2WON A;  3NAE A;  2GUI A;  2Z1I A;  4M45 A;  1A5X A;  3ZSR A;  2W42 A;  2YHA A;  4B9M A;  4M3T A;  1QSL A;  4BDY A;  2DFE A;  1CXQ A;  4DTS A;  4NCB A;  1BIS A;  3RR7 A;  3FFI A;  4KB1 A;  4KTW A;  3EZ5 A;  1T03 A;  1UA0 A;  3ASM A;  2DY4 A;  1S9G A;  4FK2 A;  1X1P A;  5SZT A;  1LWC A;  1S5J A;  1K6Y A;  2PZS A;  3OYN A;  3OVN A;  4E3S A;  3QNN A;  1SKS A;  1UOC A;  3ZT0 A;  4Q0B A;  3AA4 A;  4AHS A;  1TL1 A;  4WE1 A;  3RTV A;  3MXI A;  1HMV A;  5CYQ A;  1WSJ A;  4DWI A;  3AA2 A;  4FJ7 A;  1IKV A;  1A5V A;  1XC9 A;  4IDK A;  1JLF A;  1S9E A;  1QQC A;  4I7F A;  3PO4 A;  4FJ5 A;  3C6T A;  5KI6 A;  1J54 A;  3NF6 A;  3K2P A;  4OPK A;  4Z4I A;  3KLI A;  3SJJ A;  1TKX A;  3LPU A;  4Z4G A;  1ZBH A;  1C0U A;  5E41 A;  3HL8 A;  1QHT A;  3ZSX A;  4LH4 A;  3OS0 A;  3V1R A;  1QS4 A;  1IKY A;  2GV9 A;  4G1Q A;  3OYF A;  4E7J A;  1C6V A;  4LSL A;  2RF2 A;  2YNH A;  4DS4 A;  3C94 A;  3V81 A;  4M3W A;  4LY7 A;  4CJ3 A;  3T19 A;  4FLU A;  4F3T A;  4GW6 A;  3MXJ A;  1WSE A;  4CK1 A;  3E01 A;  2BGG A;  1XHX A;  3KKR A;  1SKR A;  2VG7 A;  1W0H A;  3QEW A;  4FJX A;  1EXQ A;  3S3O A;  4N76 A;  1TL3 A;  4H4O A;  3S3M A;  3DRS A;  3SNN A;  1BI4 A;  3KLH A;  4LSN A;  4ELV A;  4KHS A;  3TAE A;  2ITG A;  4LD0 A;  3HT3 A;  3UIQ A;  3AVL A;  4K8Z A;  4I2Q A;  4MFB A;  3L3V A;  5C25 A;  3B6P A;  3NH0 A;  1ITG A;  4BWM A;  3DLH A;  3SUP A;  4O0I A;  1Q9Y A;  4EP4 A;  3LPT A;  3KJV A;  4FLT A;  4B8C A;  4FLY A;  4KB0 A;  2Z1G A;  2F8T A;  3RMD A;  1JLQ A;  1KRP A;  1ZBU A;  5FDL A;  4Z4C A;  1RCH A;  3O3F A;  1KFS A;  2PY5 A;  2E6M A;  3G10 A;  4HCB A;  3AVB A;  2G8K A;  3K5O A;  2VG5 A;  3AA3 A;  3RMB A;  3VQ8 A;  3EY1 A;  1HYS A;  1CLQ A;  4LH5 A;  4E7K A;  4RW8 A;  2PYJ A;  4JS5 A;  3KTQ A;  3AVI A;  1REV A;  3QEI A;  3KLF A;  1QSS A;  1RT4 A;  4Z0U A;  4J2A A;  2QXF A;  1O1W A;  3HVT A;  4I9L A;  4ZTF A;  5KGW A;  4DFM A;  1VSF A;  4CEF A;  5HLF A;  4L8R B;  3LZI A;  4F4K A;  1FKP A;  3QIP A;  4J2E A;  1VRU A;  1RDD A;  2G8U A;  4CJW A;  1BQN A;  1VSH A;  3AO1 A;  2IAJ A;  3K5L A;  3V6D A;  4CHO A;  4O4G A;  1X9S A;  4ZTJ A;  4OKE A;  4KKO A;  1TK8 A;  1SUQ A;  3QIN A;  3S9H A;  4CF9 A;  4B9S A;  1HYV A;  1WSF A;  4FLV A;  4M3Y A;  3ZT3 A;  3OJU A;  2Z1H A;  1BIZ A;  1RDC A;  1JLB A;  1TVR A;  3M8R A;  3M8S A;  3F73 A;  1TK0 A;  4B9L A;  3EYZ A;  4Y1C A;  3THV A;  3NBP A;  2ZD1 A;  4FZZ A;  5J1E A;  3CFP A;  1BGX T;  1KVB A;  3I0R A;  3OYC A;  1GOB A;  3SPZ A;  2KZZ A;  3AA5 X;  1S1V A;  2A1S A;  1VSE A;  3P1G A;  1ZBL A;  1XI1 A;  2DTU A;  1T05 A;  5C24 A;  3M8P A;  1D9F A;  3M8Q A;  3U6F A;  1HQE A;  1D9D A;  3PV8 A;  2G8V A;  1DTT A;  3SQ2 A;  1ZBI A;  5CY4 A;  1NK6 A;  3V1Q A;  3NGI A;  5CYM A;  3OYA A;  1NJY A;  1GOA A;  3DOK A;  2JGU A;  4CJQ A;  4FW1 A;  2D5R A;  3VA3 A;  3SYZ A;  5I3U A;  1NK0 A;  3TR8 A;  4RW6 A;  2VG6 A;  4FJH A;  1NKE A;  4FJJ A;  4IG0 A;  4CJF A;  3RMA A;  2HB5 A;  4OGE A;  3PO5 A;  4OLA A;  3C95 A;  1JLC A;  4MQ3 A;  1RBT A;  1NK8 A;  3SCX A;  2P51 A;  1TV6 A;  3TAP A;  2PYL A;  4B9N A;  4BDP A;  3QEP A;  3HXM A;  1S6P A;  4E7I A;  4DQP A;  4DS5 A;  5T7B A;  4AHU A;  1L3U A;  4K8X A;  4HUG A;  1TKZ A;  4AHV A;  3KD1 E;  1YTU A;  2HNZ A;  3ZSW A;  3WNE A;  3BGR A;  1TAQ A;  1UA1 A;  3TAB A;  2BE2 A;  3PY8 A;  2KQ2 A;  4DF4 A;  5J2M A;  1RTH A;  4O5B A;  3DLK A;  3JSM A;  3T3F A;  1UAX A;  4DQI A;  1RBV A;  1KLM A;  3QES A;  3L2R A;  2XY8 A;  3ZT2 A;  4DU3 A;  2QKK A;  1B9D A;  3L3U A;  1JLA A;  1A5W A;  2B5J A;  4DTP A;  3SUO A;  3D45 A;  1Q8I A;  4FK0 A;  4PY5 A;  2E6L A;  1TKT A;  4Z4E A;  3ZSZ A;  3DLE A;  4ELU A;  1HQU A;  3NF9 A;  3QEX A;  4CHZ A;  2X6S A;  2IGI A;  4F3O A;  4RW9 A;  3LWL A;  1LW2 A;  3OS2 A;  4M3U A;  1JXB A;  3JYT A;  5FRN A;  4CFB A;  3L8B A;  1RT3 A;  3G0Z A;  4J2D A;  3F9K A;  4FLX A;  4HUE A;  3V9X A;  4CIG A;  4KTZ A;  3CG7 A;  3VN5 A;  5C42 A;  2F8S A;  3HYF A;  3LAK A;  3SV3 A;  1BHL A;  3AVG A;  3NCI A;  3RWU A;  3AVH A;  1JL2 A;  3WNF A;  4CK2 A;  3SI6 A;  2OZM A;  4GMJ B;  1RT5 A;  4Y1D A;  4M41 A;  4CK3 A;  4Q5V A;  4E7L A;  4FJL A;  4E1M A;  2HHX A;  3ZSO A;  1SL0 A;  1ASU A;  5KRT A;  4RW7 A;  3IRX A;  1U48 A;  4CEE A;  1W9H A;  4RG8 A;  4CHY A;  4OGC A;  3OYJ A;  3TAN A;  3OYB A;  4C8K A;  3U3G A;  1HYZ A;  4JRQ A;  2YV0 X;  3NH1 A;  1NK7 A;  3ULD A;  4B3O A;  2F96 A;  4F2R A;  4KRE A;  4CJE A;  4DTJ A;  4EZ9 A;  3L2Q A;  3AO4 A;  1UWB A;  5HRP A;  3CQ8 A;  3P83 D;  3O3G A;  4C8M A;  2P1J A;  3LP0 A;  2R7Y A;  4I9Q A;  4N41 A;  3OYE A;  2G8I A;  1CZ9 A;  1D5A A;  4B9T A;  5J2N A;  5FRO A;  4CGD A;  4CF2 A;  3L2W A;  4DU1 A;  1QSY A;  4FZX C;  4CGH A;  3AO3 A;  5CZ2 A;  3ZT1 A;  3OYD A;  2XY6 A;  1N5Y A;  1L3S A;  1IO2 A;  1BQM A;  2EX3 A;  4TSX A;  2FC0 A;  4O55 A;  4HVJ A;  4AIL C;  1SL1 A;  2QKB A;  4E89 A;  3NF7 A;  3IAY A;  2E4L A;  4AHC A;  4NYN A;  2OYQ A;  2HVI A;  5D3G A;  3PUF A;  1T8E A;  3OS1 A;  4E7H A;  3HST B;  4M42 A;  1YT3 A;  3WNG A;  2OPQ A;  4H4M A;  4ID1 A;  4CEO A;  4CEZ A;  1HJR A;  5SWM A;  1KCF A;  2O4G A;  3KIO A;  4HHT A;  2I5J A;  3RRG A;  4OLB A;  3H08 A;  3K58 A;  1TAU A;  5HP1 A;  3HPO A;  3TAG A;  3DOL A;  4JLH A;  5DMR A;  4Z4H A;  3L2U A;  4BDZ A;  4DSF A;  4DSI A;  2QK9 A;  4FYD A;  3QIO A;  3VQ7 A;  2D0A A;  1JKH A;  2XO7 A;  1N6Q A;  4CCH A;  4IKF A;  3AO5 A;  3ZSV A;  4CGF A;  4FM2 A;  2XRI A;  1JLG A;  1WAF A;  5HBM A;  4PWD A;  3LDS A;  1NK5 A;  1RBS A;  1L3T A;  3QER A;  2D0B A;  4CHN A;  4DTN A;  4O0J A;  3BDP A;  4QOZ B;  2A1R A;  4ZHR A;  4CJ5 A;  3LWM A;  1Z25 A;  2HVH A;  2BAN A;  4CEA A;  3V9U A;  2OPS A;  1LAV A;  3NGZ A;  1XHZ A;  1LAW A;  2KFZ A;  4N47 A;  4I2P A;  3AV9 A;  3NFA A;  3AVK A;  4BE0 A;  5J2P A;  3DRR A;  3TWH A;  5EU7 A;  3O3H A;  1TGO A;  4KAZ A;  1EET A;  3NGY A;  4ICL A;  2HHS A;  4FJM A;  1HRH A;  1SL2 A;  2BDP A;  3HP6 A;  4DLE A;  4KPY A;  4R5P A;  3HO1 A;  4CF0 A;  3TAR A;  4FM0 A;  1NJW A; 
#chains in the Genus database with same CATH topology
 2P9I B;  5AQW A;  5K14 A;  1HJO A;  5A2Q O;  4KH4 A;  3TU5 A;  4KHQ A;  4CJK A;  1RTD A;  5JMV A;  1KFD A;  1NMN A;  4OVL A;  2HHU A;  3IS9 A;  4YDU C;  5KGX A;  3SMP A;  4Y0W A;  2E5L K;  1DEJ A;  4PUO A;  1X3N A;  4DR4 K;  3OYK A;  3VQE A;  4HUF A;  3QET A;  1HNV A;  4F9O A;  2VQF K;  4EZ6 A;  3CFO A;  3D7E O;  1LWF A;  1KAX A;  3L4Q A;  4DV7 K;  4IOA L;  4XH1 A;  4CI6 A;  1E3M A;  3ID6 A;  1FK9 A;  3MAQ A;  5KQ8 A;  4FWP A;  5FPM A;  2YNG A;  2V7Y A;  3ULE A;  4CFC A;  3SQ1 A;  3WEE A;  3E9O A;  2VWJ A;  4FZY A;  4QAG A;  4CGJ A;  1BWF O;  3NMU A;  1S1X A;  1T3V A;  1DKG D;  1CZB A;  1RBU A;  3H1Q A;  5EX5 A;  2Q0R A;  3ISN C;  3RVC A;  1J53 A;  1KVA A;  3QDK A;  3SAH A;  4ISE A;  3WXJ A;  4XEI A;  4DQS A;  3IUC A;  5JIC A;  4LFC K;  1JL1 A;  3CCL N;  1C1B A;  3LAN A;  1FW6 A;  4FJG A;  4CED A;  4Z4F A;  1WSH A;  3O9R A;  4CJP A;  3DI6 A;  1KSP A;  3VPZ A;  3FR0 A;  4JN4 A;  4AH9 A;  5HRN A;  1NGA A;  3DRP A;  4OPA A;  2HHW A;  3KZB A;  3K59 A;  2IOC A;  3NDK A;  3I33 A;  2YKM A;  3ZX2 A;  2RE2 A;  4FWS A;  4E0D A;  4XH5 A;  3CJC A;  2IC3 A;  4YDU A;  1BU6 O;  4WQ5 A;  4JI5 K;  3MK6 A;  1VRT A;  1RT1 A;  4CHQ A;  3LAM A;  2VWK A;  4IBN A;  3VEY A;  2QI2 A;  3V1O A;  4IFY A;  1B92 A;  1S1W A;  1G15 A;  1VSK A;  2ZE2 A;  5HRS A;  4A59 A;  4BG8 A;  1WUA A;  2GX9 A;  4JAX A;  4WYB A;  1ZBF A;  4DLG A;  4LF5 K;  1RIL A;  4OKJ A;  1JXE A;  5KQD A;  2CGJ A;  3BUZ B;  2HND A;  3L6Q A;  4DQ8 A;  1HPZ A;  3ENB A;  3I8D A;  1U45 A;  1VQL N;  4BRO A;  1T7P A;  1NKC A;  4FJK A;  2FBX A;  4J8F A;  1HKB A;  3O4W A;  3HPG A;  3A8Y A;  3SBG A;  3VTI A;  4FM1 A;  3P31 A;  3HK2 A;  2O8E B;  4FXD A;  2HHV A;  4F2S A;  4BR4 A;  4A62 A;  5AQM A;  2RKI A;  1R59 O;  1QTM A;  3CCV N;  1SKW A;  3EKU A;  2ZJR L;  3ALY A;  4JK9 A;  3Q7B A;  1QQO A;  1J5O A;  1V4T A;  2GBZ A;  2FBV A;  3NHG A;  1C1A A;  3CJB A;  4B9V A;  2HMP A;  3CFR A;  3CCE N;  1NGH A;  3AO2 A;  1GOC A;  1S6Q A;  3C6A A;  1RTJ A;  4YHH K;  4GV9 A;  4DTR A;  3HBT A;  5E26 A;  1FXX A;  5DK5 A;  1BOT O;  4KH6 A;  2HNY A;  1VQ9 N;  5BR9 A;  5JS2 A;  4I6M B;  1GLE G;  3ZSR A;  2W42 A;  4B9M A;  5AQN A;  2OTL N;  1QSL A;  4YOT A;  4BDY A;  4LF4 K;  1CXQ A;  1BIS A;  4IJA A;  3EZ5 A;  4DV2 K;  3ASM A;  3ZX0 A;  5SZT A;  4JI7 K;  3KWG A;  3O9S A;  3OVN A;  4E3S A;  4Q0B A;  1UOC A;  4AHS A;  1NGJ A;  4WE1 A;  1JCF A;  2UXB K;  3FZL A;  1WSJ A;  1U6Z A;  4DWI A;  3QBX A;  4FJ5 A;  4WFN L;  4FL9 A;  3MN9 A;  3CQX A;  3KLI A;  1TKX A;  1ZXO A;  1C0U A;  3HL8 A;  4E7J A;  1QS4 A;  3SAF A;  4LSL A;  2PAV A;  4R79 A;  4DS4 A;  2QWQ A;  4M3W A;  3O6W A;  4L3Q A;  3T19 A;  4FLU A;  4F3T A;  1O13 A;  1WSE A;  4U7B A;  1XHX A;  1SKR A;  3S3O A;  4LC9 B;  2P9U A;  3KWI A;  3KLH A;  4KHS A;  3TAE A;  4LD0 A;  4WFB L;  1SS6 A;  4BWM A;  4FWO A;  4B8C A;  4KB0 A;  2Z1G A;  2W40 A;  4DR2 K;  3RMD A;  1JLQ A;  5FDL A;  3BF1 A;  1KFS A;  2O8C B;  2E6M A;  4IDH A;  3J81 O;  4HCB A;  3H3N O;  2G8K A;  3K5O A;  3AA3 A;  3K9J A;  1HYS A;  1CLQ A;  4LH5 A;  4RW8 A;  3AVI A;  3THY A;  4CZH A;  3KLF A;  4DUZ K;  3FZK A;  2QXF A;  1O1W A;  3HVT A;  4DFM A;  3GE1 A;  4BRI A;  3CC2 N;  1VSF A;  2NRR A;  3DWL A;  4F4K A;  1FKP A;  2A40 A;  2G8U A;  3PSI A;  4FWQ A;  1Z6R A;  2IAJ A;  3BY5 A;  4HWI A;  4E1J A;  3S9H A;  1HYV A;  5M1K A;  3ZT3 A;  1BIZ A;  3F73 A;  3VEX A;  3NBP A;  2WBN A;  5AQQ A;  4DHY A;  3UKR A;  3QB0 A;  1KVB A;  3I0R A;  3VMF B;  1T6C A;  1XI1 A;  2QTD A;  1NU0 A;  1NGE A;  1OKJ A;  5FLX O;  3DOK A;  5M1N A;  3CC7 N;  3VEW A;  1NK0 A;  4IG0 A;  4GV6 A;  3BP8 A;  5M1F A;  4B9N A;  3SCX A;  4BR9 A;  1TV6 A;  5HL7 L;  4B9Q A;  4BDP A;  3QEP A;  3HXM A;  2VCP A;  4DS5 A;  4BRK A;  1L3U A;  3E9L A;  4AHV A;  3DAW A;  3KD1 E;  2Q1N A;  1WB9 A;  1UA1 A;  1YUW A;  5BPN A;  3EKS A;  3PY8 A;  5J2M A;  3CET A;  1XQS C;  5GIO A;  1KLM A;  3QES A;  3L2R A;  2XY8 A;  1B9D A;  5AZI B;  1JLA A;  2Q36 A;  3VF4 A;  4YOW A;  2E6L A;  4M7X A;  4BC2 A;  3ZSZ A;  2ITM A;  2HBK A;  4CHZ A;  2IGI A;  3C65 A;  3J8A A;  5F0X A;  3CD6 N;  3OW2 M;  4CFB A;  3E66 A;  4HUE A;  2GEL A;  3JAM O;  4K42 A;  4KTZ A;  3CER A;  2F8S A;  1DGK N;  2JWK A;  2OZM A;  3SI6 A;  4KI6 A;  4CK3 A;  4E7L A;  1HNX K;  4E1M A;  4WQ4 A;  2FXU A;  3OBW A;  2ASP A;  4BR5 A;  3U3G A;  1HYZ A;  3GDQ A;  3NH1 A;  3ULD A;  2F96 A;  4B1Z A;  2HBM A;  2D4W A;  4CJE A;  2D1K A;  3WUH A;  4N41 A;  3P83 D;  3NVM A;  3W3D A;  1CZ9 A;  3TTD A;  5J2N A;  5FRO A;  2VQE K;  3OYD A;  1N5Y A;  1BO5 O;  4HVJ A;  2FC0 A;  4DUY K;  2IVP A;  2HVI A;  1W2B M;  5F2R A;  4BR2 A;  1YT3 A;  4M42 A;  4CEO A;  4OLB A;  2UUA K;  3H08 A;  3K58 A;  1TAU A;  3CCS N;  4JI2 K;  3THX B;  5HP1 A;  3TAG A;  4JLH A;  5DMR A;  2QK9 A;  4AM6 A;  4FYD A;  3QIO A;  3VQ7 A;  3C6H A;  4M7Y A;  1GLC G;  4BR0 A;  3G4S N;  4OO1 J;  1NK5 A;  1RBS A;  4CHN A;  2E20 A;  2IIR A;  5KPT A;  4ZHR A;  2GWJ A;  2UU9 K;  4ISG A;  2HVH A;  3FGU A;  4B3R K;  4CEA A;  4FPB A;  4Z94 A;  3V9U A;  2OPS A;  1XHZ A;  2P9P A;  2KFZ A;  1IBK K;  4I2P A;  1ILY A;  4BE0 A;  1N33 K;  4FOI A;  2ZGZ A;  1KAY A;  5FPN A;  3P39 A;  1EET A;  4ICL A;  2HHS A;  4KBO A;  3TAR A;  5ELZ A;  4FM0 A;  1NJW A;  5HRR A;  2LSN A;  3C6U A;  3KD5 E;  1XMO K;  3VQP A;  4HCC A;  1WNS A;  4A57 A;  4AM7 A;  3DMJ A;  4GY2 B;  3AVA A;  4DSK A;  4ID5 A;  5AR0 A;  1HNZ K;  4CJL A;  2O8F A;  1C0G A;  1JJ2 M;  4G9Z A;  4XIU A;  5AQH A;  1U47 A;  3VEN A;  3O9Q A;  1BA1 A;  1VQN N;  4JI0 K;  5I9E B;  3D2F A;  1E4G T;  4C8N A;  2VWB A;  2BUP A;  1C0T A;  3OJS A;  4GVM A;  2OA8 A;  4FLW A;  5FPD A;  1NJZ A;  4EP5 A;  3P4I A;  2G8H A;  3AAR A;  4CES A;  2NRV A;  1BCM A;  2YKN A;  4JV5 K;  4DF8 A;  3S3N A;  2UUB K;  4C1N I;  4C8L A;  4BRE A;  4FLZ A;  3CQY A;  4GKJ K;  3TSP A;  3OHR A;  1DLO A;  5AQG A;  2GWK A;  2WFB A;  3U8X A;  4KHU A;  3Q7C A;  5AQP A;  3MXM A;  3HJF A;  2WOM A;  4CEB A;  1KLN A;  3SZ2 A;  4CZI A;  3L0Q A;  1SV5 A;  4CJ4 A;  1B9F A;  4DQQ A;  3W0L A;  4MLE A;  1ATR A;  3O4Q A;  1YJW N;  3LP3 A;  3OYL A;  1BCO A;  2HBL A;  4IZ9 A;  4B1W B;  3KKS A;  1KD1 O;  2ZF5 O;  2Q31 A;  2B6A A;  1V4S A;  2X78 A;  5AQI A;  1VSJ A;  2HHT A;  4CER A;  1RT6 A;  4YOU A;  2HHH K;  3CIP A;  1ATN A;  1NWK A;  4QS8 A;  5FPE A;  4DU4 A;  1VQ6 N;  4N5S A;  3TAM A;  4C8O A;  3VQA A;  2D0O A;  1M90 O;  4CBU A;  1X9M A;  2NUB A;  4E19 A;  4CGG A;  3HP9 A;  2YJE A;  4CHP A;  1HPM A;  4H5N A;  3WEE B;  4KRF A;  4CF8 A;  4IOC L;  1XNQ K;  3C7N A;  3VQB A;  3MED A;  3ATV A;  4B1X B;  2W6L A;  4FJ8 A;  3CC4 N;  4DTM A;  2WTU A;  3O9T A;  1Z05 A;  1WSG A;  2AP1 A;  5GAH P;  1X3M A;  4YOY A;  3ZEU A;  4DFP A;  2P5O A;  3D0P A;  1ZYQ A;  2YX6 A;  2FBT A;  5FRM A;  2RPI A;  4CD1 A;  5GIN A;  3TAF A;  4H8K A;  3M1F A;  3SQ4 A;  3ZSQ A;  1EP4 A;  4NYF A;  4DB3 A;  2YI1 A;  2YNI A;  3K5N A;  4JHD A;  4DV4 K;  3L2V A;  2WUS A;  3AAQ A;  4DMN A;  4J2B A;  4UQG A;  3DYA A;  4LF8 K;  1VSL A;  3CCM N;  2ZM6 K;  1EO1 A;  3AAP A;  3AVN A;  1J6Z A;  3VEV A;  4BY9 C;  4KHW A;  2XHB A;  2NRW A;  1YVN A;  1S22 A;  3SPY A;  4WQ5 C;  3MX5 A;  4W5N A;  3QFP A;  4CEQ A;  4OPH A;  3VOV A;  2FBY A;  1N32 K;  3IMX A;  1QVF M;  4CJS A;  2O8B A;  1Q81 O;  1WOQ A;  2I7P A;  4CJ7 A;  4PKH A;  3T1A A;  2V51 B;  4PQU A;  3SV4 A;  2QM1 A;  3ZX3 A;  5JVH L;  4DSE A;  5HRO A;  1I3A A;  4CJV A;  3RSE A;  1XWL A;  4YFU A;  4RW4 A;  2HW3 A;  3VQ9 A;  2W41 A;  4BE1 A;  1QZ6 A;  1VSI A;  1S72 N;  1BL3 A;  4BVO A;  2AA4 A;  3V9Z A;  3U4L A;  3CJ9 A;  3ZCM A;  3ZET A;  3D2E B;  4ILH A;  2P9L A;  4OPJ A;  2WON A;  3NAE A;  2GUI A;  2YHA A;  3O5B A;  1TUY A;  1JCG A;  1NNE A;  1UA0 A;  3I56 N;  2DY4 A;  4XH4 A;  1K8K A;  1S5J A;  2PZS A;  4IJN A;  3ENH A;  3NVK A;  3MDQ A;  1VQ5 N;  3AA2 A;  3JS6 A;  2CH5 A;  1BG3 A;  1QQC A;  4JK7 A;  3C6T A;  3FZH A;  3DXK A;  4FWL A;  3K2P A;  4OPK A;  4Z4I A;  2A41 A;  2PFU A;  4Z4G A;  3LPU A;  1ZBH A;  2GTD A;  1HLU A;  4H5V A;  3OYF A;  4KH5 A;  5BN8 A;  1C6V A;  1JCE A;  4M63 C;  1QZ5 A;  2YNH A;  2FSN A;  3FFK B;  4NLB A;  4ILJ A;  4CJ3 A;  4QS9 A;  4GW6 A;  3MXJ A;  2VG7 A;  4FJX A;  4N76 A;  2E88 A;  5DM7 L;  2P9N A;  4LSN A;  1OVQ A;  4BRH A;  3OBY A;  3AVL A;  4I2Q A;  5M1Q A;  1GLJ O;  5C25 A;  3DLH A;  3SUP A;  4EIA A;  4CW7 B;  3KJV A;  4FLT A;  2F8T A;  3CCU N;  4FLY A;  1ZBU A;  4C23 A;  3UE5 A;  3O3F A;  2E2Q A;  3G10 A;  5CR4 A;  1MDU B;  2QWM A;  3RMB A;  5KPZ A;  4H0T B;  3IDH A;  1EWQ A;  4CZJ A;  1Y64 A;  4LF7 K;  4I9L A;  5HLF A;  1NGF A;  3QIP A;  1RDD A;  3VTH A;  1VSH A;  2VGM A;  2DPN A;  1SUQ A;  3QIN A;  4B9S A;  2CH6 A;  4FLV A;  1OH7 A;  1TVR A;  3M8S A;  4B9L A;  3EYZ A;  5AQX A;  3THV A;  4DR5 K;  4WCE L;  3CFP A;  2KZZ A;  3OYC A;  3AA5 X;  1S1V A;  4BQL A;  2DTU A;  1T05 A;  3U6F A;  3PV8 A;  4PHT X;  3FZM A;  1HR0 K;  2HBJ A;  2JGU A;  2D5R A;  1RFQ A;  4MO4 A;  4RW6 A;  3F5T A;  3WQT A;  1NKE A;  4CJF A;  3VF6 A;  1JLC A;  1GLL O;  5H1S Q;  2PYL A;  1RDU A;  1G99 A;  2NRX A;  4BG9 A;  4E7I A;  4DQP A;  5T7B A;  4AHU A;  5M1P A;  3TSU A;  3I8B A;  1IBM K;  3ZSW A;  2W6K A;  4IWV A;  1TAQ A;  2UXC K;  4BRM A;  4DF4 A;  1RTH A;  3DLK A;  2QWL A;  3LDP A;  2YHY A;  4JD2 A;  1VQ8 N;  5LL6 Z;  2NLX A;  3ZT2 A;  1IJJ A;  3L3U A;  1A5W A;  4H0P A;  3D45 A;  2QEX N;  4FK0 A;  1TKT A;  4Z4E A;  2OTJ N;  3JXU A;  4WF9 L;  4MLH A;  4F3O A;  4RW9 A;  3LWL A;  1LW2 A;  4M3U A;  5FRN A;  3L8B A;  3T1H K;  4J2D A;  4CIG A;  2UXD K;  3A5O C;  3VN5 A;  3UKR B;  5C42 A;  2ZJQ L;  4JKG A;  3RWU A;  4GMJ B;  1RT5 A;  4M41 A;  4Q5V A;  2HHX A;  1SL0 A;  5KRT A;  3GL1 A;  2UUC K;  3IRX A;  1U48 A;  1W9H A;  3TAN A;  3H6E A;  4CZE A;  1NMD A;  1ESV A;  4RWT A;  1NK7 A;  4B3O A;  4F2R A;  3D6R A;  4BRF A;  5AFU A;  4EZ9 A;  3WQU A;  3WXL A;  2NRZ A;  1UWB A;  4C8M A;  4I9Q A;  3MN6 A;  1C0F A;  1D5A A;  3SK3 A;  4FZX C;  3AO3 A;  1QHA A;  1L3S A;  4O55 A;  2QKB A;  2Q0U A;  1VAZ A;  4AHC A;  2OYQ A;  5LJV A;  3PUF A;  3WNG A;  4H4M A;  3SYZ A;  5SWM A;  4CEZ A;  1HJR A;  4CZL A;  5AQU A;  2I5J A;  3L2U A;  4DSI A;  4RTF D;  1N6Q A;  1JKH A;  3DXM B;  5AZJ B;  4BRA A;  3AO5 A;  5EVZ A;  2XRI A;  4HTL A;  1NJI O;  3ZYY X;  4NO7 A;  2A42 A;  1N34 K;  3ZLJ A;  3LDS A;  4PWD A;  3EL2 A;  1L3T A;  4DTN A;  3J7Y P;  4WQ4 C;  3CI5 A;  3THW B;  3O1B A;  1XNR K;  5AFU H;  3TSQ A;  2HOE A;  1LAV A;  3NGZ A;  5B8H A;  3H3O B;  4O5F A;  3AVK A;  1CZA N;  2HF3 A;  5J2P A;  3O3H A;  2OAN A;  3VEZ A;  4FJM A;  1TYQ A;  2BDP A;  4R5P A;  5GAE P;  4DV3 K;  1NKB A;  4I6M A;  1F21 A;  3C0B A;  4IG3 A;  2DFH A;  4CJT A;  3HSC A;  1RDA A;  2X74 A;  2OZS A;  4B9U A;  4CZK A;  1BI4 B;  3A0I X;  3HTV A;  1D4X A;  4BAC A;  1X9W A;  2HMI A;  4DR6 K;  4AQY K;  2B4J A;  5C0Y A;  2O4I A;  3DLL L;  1KAZ A;  4GVE A;  3SAG A;  5LY3 A;  1IH7 A;  1RDW X;  4A61 A;  1OH8 A;  3EO3 A;  2E1Z A;  5AQO A;  4H0Y B;  3DLR A;  4CJR A;  3HOS A;  2O8D B;  4AHR A;  2XY5 A;  5AQF A;  1VQ7 N;  4M3Z A;  2X6N A;  1T6D A;  3QNO A;  5C15 A;  1MA9 B;  4OKK A;  4JKA A;  1VHX A;  1RT2 A;  3G6E N;  1QQM A;  2BH1 A;  1YJN N;  3QBW A;  1NLV A;  4BC4 A;  3H46 O;  3VQ6 A;  5ADX A;  1NK9 A;  2P9P B;  3KLE A;  3TPQ A;  1FKO A;  4IFV A;  5JS1 A;  4DFJ A;  3KK2 A;  3L4I A;  4DR3 K;  1WN7 A;  1LWE A;  4NCG A;  1TKD A;  3RMC A;  3LM9 A;  2XY7 A;  3J80 O;  2KZM A;  2F7T A;  3KK7 A;  2NNW A;  1VSD A;  1R0A A;  1QE1 A;  5TKY A;  5J2Q A;  3ITH A;  3O08 A;  3D2F B;  2HHQ A;  1ATS A;  1BIU A;  4DTO A;  3SQ0 A;  1D8Y A;  4CFD A;  2IDO A;  1Y97 A;  1HNW K;  2YCH A;  1VSM A;  1S1U A;  4CZM A;  4FK4 A;  1ASV A;  2F9W A;  5KRS A;  3K0S A;  3O4N A;  1NGG A;  1YIJ N;  2KW4 A;  4CE9 A;  4E1N A;  4DSJ A;  3AVC A;  3NH2 A;  4X65 K;  1ZBS A;  4JRP A;  4KHP K;  2FF3 B;  3LDN A;  1RTI A;  3PX0 A;  4W5O A;  4YNQ A;  1S1T A;  4K0K K;  3TAQ A;  5AQJ A;  5AQL A;  3SUQ A;  2ZJP L;  1U04 A;  3QLH A;  4FCY A;  1OVY A;  1FJG K;  2I7N A;  3U3Y A;  2UYT A;  3P5J A;  1L5U A;  3WXK A;  4JK8 A;  2KKZ A;  2D0C A;  1JLE A;  4CVN E;  1XC3 A;  2A6A A;  3VQD A;  1YVU A;  3V9S A;  3LZJ A;  2P9K B;  1NOY A;  4M3X A;  3TI0 A;  1P90 A;  1WSI A;  1EKE A;  2P9S A;  3UB5 A;  4CEC A;  1LOT B;  4CGI A;  1YAG A;  3EE9 A;  1IKX A;  5AZI A;  4JKC A;  4IXC A;  1C1C A;  4IO9 L;  1MWM A;  3H1V X;  3GG4 A;  2JLE A;  3VA0 A;  3LAL A;  3NF8 A;  4IEI A;  4BE2 A;  3HM9 A;  2F4V K;  3HI0 A;  3DLB A;  3O80 A;  4BR7 A;  5EOY A;  4AHT A;  3MCP A;  3C7N B;  4CFA A;  5AQK A;  3PX4 A;  1GLB G;  3K5M A;  2IS3 A;  3AGK A;  1VQ4 N;  3N4Q A;  3VQC A;  3CCR N;  3KK3 A;  4DFK A;  3ZEU B;  4EFH A;  2G8W A;  4DKW A;  3IG1 A;  4CIE A;  1T44 A;  4B3S K;  3OYM A;  4B08 A;  3VQ5 A;  2YNF A;  3QML A;  3M5R A;  4JS4 A;  1RNH A;  3AGR A;  3M3Z A;  4CJU A;  2KTQ A;  1SAZ A;  2ETJ A;  4B8A B;  1A5X A;  4AF1 A;  4A5A A;  4NCB A;  1EWR A;  3RR7 A;  3FFI A;  3THX A;  1T03 A;  4IO8 A;  1YI2 N;  2YHX A;  4O8K A;  4FK2 A;  1WBD A;  1LWC A;  4GV3 A;  2J4R A;  3OYN A;  3F9M A;  1SKS A;  3AA4 A;  3MXI A;  1HMV A;  5CYQ A;  1IKV A;  1JLF A;  1S9E A;  3ATU A;  3PO4 A;  5HOO A;  3GBT A;  2A3Z A;  5C10 A;  1J54 A;  3NF6 A;  4UY8 O;  4JI1 K;  1HKG A;  4FWK A;  4CBX A;  2A5X A;  4LF6 K;  4G1Q A;  1IKY A;  4NB4 A;  3ULE B;  2RF2 A;  3C94 A;  3V81 A;  4LY7 A;  1WBB A;  4CD3 A;  4JNE A;  3KKR A;  3LM2 A;  4H4O A;  3S3M A;  3DRS A;  3SNN A;  1VQM N;  4ELV A;  2P9L B;  2ITG A;  3HT3 A;  3UIQ A;  4MFB A;  4BRC A;  3B6P A;  1Q86 O;  1ITG A;  4O0I A;  4EP4 A;  3LPT A;  1K9M O;  4BRN A;  1BUP A;  1KRP A;  4Z4C A;  1RCH A;  1Q7Y O;  4ISF A;  2Q2R A;  3SJH A;  2VGN A;  3E9P A;  4JS5 A;  3QEI A;  1QSS A;  4J2A A;  3QIC A;  4K41 A;  4IOX A;  4JKF A;  5KGW A;  2FSJ A;  4CZG A;  4CEF A;  1H1V A;  3LZI A;  2CGK A;  4CJW A;  4JI4 K;  1DT9 A;  5BRF A;  1IV0 A;  3AO1 A;  3K5L A;  4RCH A;  5MLC Q;  1M1K O;  1TK8 A;  4KKO A;  3VEO A;  1VQK N;  5AJ3 K;  3LDO A;  2Z1H A;  4A2A A;  1RDC A;  4O8U A;  1SQK A;  2ASM A;  3CCQ N;  4Y1C A;  2ZD1 A;  5J1E A;  3SPZ A;  1IBL K;  1EQY A;  3FE1 A;  3MN7 A;  1D9F A;  1D9D A;  2P9N B;  2G8V A;  1DTT A;  1J5E K;  4MDB A;  4FSV A;  1ZBI A;  3NGI A;  1NJY A;  3MWP A;  3VA3 A;  2OCE A;  3TTC A;  5I3U A;  4FJH A;  2KLA A;  2VG6 A;  1XUP O;  4OGE A;  3C95 A;  2JWL A;  4DV0 K;  4H0O A;  4HUG A;  1YTU A;  4GNI A;  3FLC O;  2HNZ A;  3TAB A;  2BE2 A;  3MCA B;  2KQ2 A;  3JSM A;  5E84 A;  3SBT A;  3T3F A;  4DQI A;  4PKI A;  5CHI A;  1U2V A;  4DTP A;  3MN5 A;  1N8R O;  3MMV A;  5C2F A;  3DLE A;  4FVU A;  1YHQ N;  3VER A;  2IVO A;  1JXB A;  3JYT A;  1RT3 A;  3G0Z A;  4FLX A;  3CG7 A;  3BZK A;  3EE8 A;  3HYF A;  3LAK A;  3UKU A;  4FWM A;  2Q97 A;  3WNF A;  4BGB A;  4CK2 A;  1W97 L;  4QS7 A;  3ZSO A;  3CJA A;  1ASU A;  4CHY A;  2QWO A;  4C8K A;  1LCU A;  5KPR A;  4JRQ A;  2YV0 X;  3O1W A;  4ILG B;  3CHW A;  3BZC A;  3L2Q A;  2E2P A;  5HRP A;  2R7Y A;  3O3G A;  5LMU K;  2P1J A;  3LP0 A;  2G8I A;  3OYE A;  2P9I A;  3CF5 L;  4FPA A;  4B9T A;  4BQZ A;  2QA4 N;  4CGD A;  3L2W A;  3CPE A;  3KVG A;  2XY6 A;  1IO2 A;  1SL1 A;  2EX3 A;  4TSX A;  4AIL C;  4E89 A;  3NF7 A;  3CXC M;  3IAY A;  1I94 K;  4NYN A;  5D3G A;  1T8E A;  3OS1 A;  4JD2 B;  2QXL A;  3R1X A;  4E7H A;  4H5W A;  2OPQ A;  5AQV A;  1K73 O;  1KCF A;  2O4G A;  4HHT A;  4BRL A;  2RHK A;  5F1X A;  3HPO A;  4BDZ A;  1QVG M;  2FSK A;  3G25 A;  2D0A A;  3EN9 A;  4CCH A;  3PLA A;  4IKF A;  3ZSV A;  4CGF A;  3A5L C;  4FM2 A;  1HUX A;  1KQS M;  4NXN K;  1WAF A;  5BN9 A;  3EZW A;  1GLF O;  3H45 C;  4JKG B;  3A5M C;  3BDP A;  3TTF A;  2A1R A;  3CCJ N;  4CJ5 A;  3LWM A;  1Z25 A;  2BAN A;  4PKG A;  3T69 A;  4B1Y B;  3MWT A;  3NFA A;  3DRR A;  5EU7 A;  4KAZ A;  1TGO A;  3NGY A;  1SL2 A;  2NRH A;  4KPY A;  3HP6 A;  4DLE A;  4X66 K;  4JI3 K;  3D2E A;  1KXP A;  4NCA A;  4DTU A;  4V19 S;  2KHO A;  4BWJ A;  4FWN A;  3AVF A;  1HX1 A;  2P9U B;  4DSL A;  3ZSY A;  3QO9 A;  4KHN A;  4JYA K;  3CME N;  4W5T A;  4IFE A;  1YJ9 N;  4CF1 A;  3WXI A;  4M3R A;  2YHB A;  1P8Z A;  4KTQ A;  5KTQ A;  3HPH A;  3QFU A;  5AQT A;  1U49 A;  2E2N A;  3VF2 A;  3HM8 A;  4F8R A;  1NK4 A;  1QQN A;  1RBR A;  4EAH D;  1TK5 A;  1EX4 A;  1IKW A;  4FJI A;  3THY B;  5C12 A;  3OYH A;  2ASO A;  3AVM A;  3T1Y K;  1KVC A;  1RT7 A;  4FVM A;  4CIF A;  3O9U A;  2EHG A;  3HZ6 A;  5JVG L;  4H03 B;  1N36 K;  2WC9 A;  4PA1 A;  4KHY A;  5DM6 L;  2E1Y A;  2FLO A;  4OJR A;  5GIP A;  4KFB A;  1DTQ A;  3CM5 A;  4H0X B;  1TYQ B;  2Z1J A;  5IWA K;  3SUN A;  2ZQB A;  3KK1 A;  2KFN A;  5AQS A;  3B6O A;  4B1U B;  1OH5 A;  4YOR A;  3VET A;  5CE3 A;  1WAJ A;  3VGL A;  1Q82 O;  3P38 A;  1IG8 A;  4FW2 A;  4BRP A;  3K57 A;  3J7A P;  4U67 L;  1KC8 O;  3MEC A;  1MU2 A;  4LFA K;  3CYM A;  3RR8 A;  4FO0 A;  1NG9 A;  3CM6 A;  4ELT A;  1L3V A;  1ASW A;  3MEE A;  1YF5 L;  1LW0 A;  1GLA G;  4BVP A;  3AVJ A;  1I39 A;  2ZWH A;  3OYI A;  3DM2 A;  2BTF A;  3U9D A;  2Y1J A;  5I42 A;  3A5N C;  2O8E A;  3O8M A;  3N4P A;  4YOV A;  2QW9 A;  1IG9 A;  5CZ1 A;  1LV5 A;  2RN2 A;  2AJQ A;  2P5G A;  2H3G X;  4H0V B;  4DQR A;  2ZGY A;  1S3X A;  3LP1 A;  3DLG A;  2HST A;  4QCL A;  3LDL A;  4FJ9 A;  4W5Q A;  1CXU A;  4W5R A;  2ATQ A;  3PX6 A;  3K9K A;  1HKC A;  3NE6 A;  1NJX A;  4FJN A;  4CZF A;  3CMA N;  3VGK A;  3VES A;  1SZ2 A;  4NLC A;  5BPL A;  3V4I A;  3WNH A;  5GAD P;  3OYG A;  3I0S A;  3IFR A;  3LP2 A;  3WXM B;  2YHW A;  3OA9 A;  4KO0 A;  4HTU A;  2EWS A;  2DFF A;  2OPR A;  4BRQ A;  2OPP A;  2Q3S A;  2G8F A;  3A2F A;  4K25 A;  2IVN A;  1NGC A;  4LFB K;  4KV8 A;  4K43 A;  4DTX A;  1HNI A;  1YTA A;  4FOE A;  2V52 B;  1Q18 A;  4BRG A;  4KI4 A;  3SMS A;  1C0M A;  1NGD A;  3HRG A;  1OH6 A;  3MEG A;  4O44 A;  3EEQ A;  1NOZ A;  3E1Y A;  3MX2 A;  1VQP N;  2Y1I A;  5AQY A;  3VQQ A;  3VQ4 A;  1WLJ A;  1TUU A;  2F9T A;  3VGM A;  3FZF A;  3V9W A;  3QEV A;  4DG1 A;  3KLG A;  1YIT N;  1VK0 A;  1Z26 A;  1J9A A;  4JKE A;  1NGB A;  1RDB A;  4N56 A;  4H5R A;  1KTQ A;  1U4B A;  4A2B A;  3RRH A;  3ZT4 A;  4PL7 A;  3PSF A;  2VYP A;  4DV6 K;  5LMN K;  3WT0 A;  3LL3 A;  1Q9X A;  3F2K A;  4YY3 K;  3OY9 A;  4H5T A;  2P9S B;  2Z1I A;  4MO5 A;  4M45 A;  4M3T A;  5BRD A;  2DFE A;  4DTS A;  2QWP A;  3U9Z A;  3DJC A;  3IKM A;  4KB1 A;  2O8F B;  4KTW A;  2O8C A;  1S9G A;  1X1P A;  3DXM A;  5AZJ A;  1K6Y A;  1BDG A;  3QNN A;  3ZT0 A;  2E8A A;  1TL1 A;  3RTV A;  2PBD A;  4FJ7 A;  1A5V A;  3THW A;  4IDK A;  1XC9 A;  4I7F A;  1NM1 A;  5KI6 A;  3SJJ A;  5ADX H;  5E41 A;  4JKB A;  1QHT A;  3ZSX A;  4LH4 A;  3OS0 A;  3V1R A;  3HVR A;  5AQZ A;  2GV9 A;  5BPM A;  1GLD G;  4DCH A;  1RGI A;  5GAG P;  3CJ7 A;  3R8E A;  4CK1 A;  3E01 A;  2BGG A;  3LDQ A;  1W0H A;  3QEW A;  1EXQ A;  1TL3 A;  4EHU A;  1BI4 A;  4JKD A;  3J7Z O;  5IT9 O;  3AY9 A;  4K8Z A;  3L3V A;  3NH0 A;  5BRH A;  1Q9Y A;  5LJW A;  2E2O A;  2PY5 A;  4WFA L;  3AVB A;  2O8D A;  2VG5 A;  3BF3 A;  4B3M K;  3VQ8 A;  3EY1 A;  4E7K A;  2PYJ A;  3GOI A;  3S41 A;  4BRD A;  2QWN A;  3KTQ A;  3OTO K;  1REV A;  1NBW A;  1RT4 A;  4Z0U A;  4ZTF A;  2D0P A;  4L8R B;  4IEE A;  4J2E A;  3R3L A;  1VRU A;  1BA0 A;  1BQN A;  4BC5 A;  3PIO L;  3V6D A;  4DR1 K;  4CHO A;  4O4G A;  4DV1 K;  1X9S A;  4ZTJ A;  4OKE A;  4CF9 A;  4M3Y A;  1WSF A;  3OJU A;  3M8R A;  1JLB A;  1TK0 A;  2QWR A;  2NZT A;  1XMQ K;  4FZZ A;  1BGX T;  1GOB A;  4GKK K;  3R6M A;  2A1S A;  1VSE A;  3P1G A;  1ZBL A;  5C24 A;  3M8P A;  3M8Q A;  1HQE A;  3BEX A;  3I55 N;  2GUP A;  3SQ2 A;  5CY4 A;  1NK6 A;  3V1Q A;  2V7Z A;  5CYM A;  4JI6 K;  3OYA A;  4OX9 K;  1GOA A;  4FWR A;  4CJQ A;  4FW1 A;  3TR8 A;  4FJJ A;  3RMA A;  2HB5 A;  3PO5 A;  4OLA A;  4MQ3 A;  1RBT A;  1NK8 A;  2P51 A;  3ID8 A;  3TAP A;  4X64 K;  5BRE A;  1S6P A;  3SLC A;  5M1O A;  2NRT A;  4K8X A;  1TKZ A;  3WNE A;  3BGR A;  4O5B A;  4JHD B;  1UAX A;  5JLH A;  1RBV A;  1MWK A;  2QKK A;  4DU3 A;  1YXQ A;  2B5J A;  3SUO A;  1Q8I A;  4PY5 A;  4JKH A;  3PIP L;  3CPW M;  4ELU A;  1HQU A;  1X9J A;  3NF9 A;  3QEX A;  5EY4 A;  4DR7 K;  2X6S A;  3OS2 A;  3CJ1 A;  3F9K A;  3HOT A;  3V9X A;  3R9P A;  5JLF A;  3SV3 A;  1BHL A;  3AVG A;  3NCI A;  2O8B B;  3AVH A;  1JL2 A;  4Y1D A;  4FJL A;  1W7A A;  4RW7 A;  4CEE A;  4RG8 A;  2YJF A;  4OGC A;  3OYJ A;  3OYB A;  4PL8 A;  2HF4 A;  3RSE B;  4KRE A;  4DTJ A;  4JI8 K;  4A5B A;  3AO4 A;  2P9K A;  3CQ8 A;  4BC3 A;  4CF2 A;  4DU1 A;  1QSY A;  4CGH A;  5CZ2 A;  3ZT1 A;  3ZET B;  5BR8 K;  1BQM A;  5AQR A;  1VQO N;  4B3T K;  2E4L A;  1K8A O;  5EXW A;  3HST B;  4ID1 A;  3RRG A;  3KIO A;  1U2V B;  3B8A X;  4LF9 K;  3T7Z A;  4DV5 K;  3DOL A;  4DSF A;  4Z4H A;  4NXM K;  5TKW A;  4BGA A;  2XO7 A;  1K8K B;  2CGL A;  4MDA A;  1NGI A;  4YOX A;  3KHY A;  5C2D A;  1JLG A;  1E4F T;  5HBM A;  4EHT A;  4C1N K;  3UKU B;  2D0B A;  3QER A;  4O0J A;  4QOZ B;  4CBW A;  4X62 K;  3DXK B;  4JEP A;  3G71 N;  2FF6 A;  2GEM A;  1LAW A;  4N47 A;  3AV9 A;  3TWH A;  1ZC6 A;  3ENO A;  1HRH A;  3HO1 A;  4CF0 A;  4B1V A;  3M6G A; 
#chains in the Genus database with same CATH homology
 5HRR A;  2LSN A;  3C6U A;  3KD5 E;  1NKB A;  4DTU A;  4IG3 A;  1F21 A;  4CJT A;  4NCA A;  2DFH A;  3VQP A;  1WNS A;  4HCC A;  1RDA A;  4BWJ A;  5K14 A;  3AVF A;  2X74 A;  3DMJ A;  2OZS A;  4B9U A;  4DSL A;  3ZSY A;  1BI4 B;  3AVA A;  4DSK A;  4ID5 A;  4KHQ A;  4BAC A;  1X9W A;  3QO9 A;  2HMI A;  4CJK A;  1RTD A;  4CJL A;  4KHN A;  2B4J A;  1KFD A;  4XIU A;  1U47 A;  2O4I A;  4OVL A;  4W5T A;  2HHU A;  4CF1 A;  3IS9 A;  4M3R A;  2YHB A;  5KGX A;  4KTQ A;  5KTQ A;  1IH7 A;  3HPH A;  1U49 A;  4PUO A;  4C8N A;  3OYK A;  3DLR A;  3VQE A;  4HUF A;  4CJR A;  3QET A;  1HNV A;  1C0T A;  4AHR A;  1NK4 A;  4F8R A;  2XY5 A;  1RBR A;  3OJS A;  4EZ6 A;  4M3Z A;  4GVM A;  2X6N A;  3CFO A;  3QNO A;  1EX4 A;  1IKW A;  1TK5 A;  2OA8 A;  4FJI A;  3OYH A;  4FLW A;  1LWF A;  3AVM A;  1NJZ A;  4OKK A;  1KVC A;  4EP5 A;  1RT7 A;  2G8H A;  4FVM A;  4CIF A;  4CES A;  2EHG A;  1RT2 A;  1FK9 A;  3MAQ A;  1BCM A;  2YKN A;  2YNG A;  4DF8 A;  4CFC A;  3S3N A;  4PA1 A;  3SQ1 A;  4KHY A;  3VQ6 A;  4C8L A;  2VWJ A;  1NK9 A;  4FZY A;  4QAG A;  4FLZ A;  4CGJ A;  4OJR A;  3KLE A;  4KFB A;  1FKO A;  1DTQ A;  3CM5 A;  1S1X A;  4IFV A;  2Z1J A;  3SUN A;  2ZQB A;  1DLO A;  3KK1 A;  1CZB A;  1RBU A;  2KFN A;  5JS1 A;  3B6O A;  3ISN C;  4KHU A;  4DFJ A;  1J53 A;  3KK2 A;  1KVA A;  3MXM A;  1WN7 A;  3HJF A;  1WAJ A;  2WOM A;  1LWE A;  4CEB A;  1KLN A;  3SZ2 A;  4NCG A;  4DQS A;  1TKD A;  3RMC A;  1SV5 A;  2XY7 A;  4CJ4 A;  1B9F A;  2KZM A;  4FW2 A;  3K57 A;  1JL1 A;  4DQQ A;  1C1B A;  3LAN A;  4FJG A;  3HVR A;  4CED A;  1VSD A;  3O4Q A;  1R0A A;  3LP3 A;  1QE1 A;  1BCO A;  3MEC A;  3OYL A;  5J2Q A;  4Z4F A;  1MU2 A;  1WSH A;  3ITH A;  3CYM A;  3KKS A;  3RR8 A;  4CJP A;  3DI6 A;  1BIU A;  4DTO A;  2HHQ A;  2B6A A;  3CM6 A;  3SQ0 A;  1D8Y A;  4CFD A;  1KSP A;  2IDO A;  1Y97 A;  2X78 A;  1ASW A;  1L3V A;  4ELT A;  3MEE A;  1VSM A;  1S1U A;  4AH9 A;  1VSJ A;  1LW0 A;  2HHT A;  4CER A;  1RT6 A;  4FK4 A;  5HRN A;  1ASV A;  3DRP A;  3AVJ A;  5KRS A;  4DU4 A;  1I39 A;  3O4N A;  4N5S A;  3OYI A;  3TAM A;  3DM2 A;  2HHW A;  3K59 A;  2IOC A;  2KW4 A;  4CE9 A;  4E1N A;  4C8O A;  3NDK A;  2Y1J A;  5I42 A;  4DSJ A;  3AVC A;  3VQA A;  2YKM A;  3NH2 A;  1X9M A;  2NUB A;  4E0D A;  4E19 A;  4CGG A;  2IC3 A;  3HP9 A;  4CHP A;  4JRP A;  4KRF A;  1VRT A;  4CF8 A;  1IG9 A;  5CZ1 A;  1RTI A;  1RT1 A;  1LV5 A;  4CHQ A;  4W5O A;  3LAM A;  2VWK A;  3PX0 A;  2RN2 A;  1S1T A;  3MED A;  3VQB A;  4YNQ A;  3TAQ A;  2AJQ A;  4IBN A;  2P5G A;  4FJ8 A;  3V1O A;  4DQR A;  4IFY A;  4DTM A;  1B92 A;  1S1W A;  1G15 A;  3DLG A;  3LP1 A;  1VSK A;  3SUQ A;  4FJ9 A;  4QCL A;  2ZE2 A;  1U04 A;  3QLH A;  4W5Q A;  5HRS A;  1CXU A;  1WSG A;  4W5R A;  4FCY A;  2ATQ A;  4DFP A;  3PX6 A;  2P5O A;  3U3Y A;  4KI6 A;  3D0P A;  3P5J A;  1L5U A;  3NE6 A;  1ZYQ A;  1NJX A;  1ZBF A;  2FBT A;  4DLG A;  4FJN A;  1RIL A;  2RPI A;  5FRM A;  3V4I A;  3TAF A;  2D0C A;  4OKJ A;  1JXE A;  4H8K A;  1JLE A;  3WNH A;  3OYG A;  3SQ4 A;  3ZSQ A;  3I0S A;  3LP2 A;  2HND A;  3VQD A;  1EP4 A;  1YVU A;  3V9S A;  1HPZ A;  4NYF A;  3LZJ A;  1NOY A;  4M3X A;  3I8D A;  4KO0 A;  3TI0 A;  4HTU A;  1WSI A;  1EKE A;  2DFF A;  2YNI A;  4CEC A;  2OPR A;  3K5N A;  1U45 A;  1T7P A;  4CGI A;  3L2V A;  2OPP A;  2Q3S A;  4DMN A;  3A2F A;  1NKC A;  2G8F A;  2FBX A;  4UQG A;  4J2B A;  4FJK A;  1IKX A;  3DYA A;  4KV8 A;  3HPG A;  1C1C A;  1VSL A;  4DTX A;  1HNI A;  1YTA A;  4FM1 A;  3HK2 A;  2JLE A;  3AVN A;  3VA0 A;  3LAL A;  3NF8 A;  4KHW A;  2XHB A;  4KI4 A;  1C0M A;  4FXD A;  4BE2 A;  3HM9 A;  3SPY A;  3DLB A;  4W5N A;  3MEG A;  4O44 A;  4AHT A;  4CEQ A;  4F2S A;  2HHV A;  2FBY A;  2RKI A;  4CFA A;  1NOZ A;  1QTM A;  4CJS A;  1SKW A;  3ALY A;  3PX4 A;  1J5O A;  3K5M A;  2Y1I A;  2GBZ A;  2FBV A;  2IS3 A;  3NHG A;  1C1A A;  3T1A A;  1WLJ A;  3VQ4 A;  3VQQ A;  4B9V A;  4PQU A;  3SV4 A;  3V9W A;  3QEV A;  3VQC A;  4DSE A;  5HRO A;  4DG1 A;  3KLG A;  1I3A A;  4CJV A;  3KK3 A;  1VK0 A;  1XWL A;  1Z26 A;  4DFK A;  3CFR A;  1J9A A;  4YFU A;  4N56 A;  1RDB A;  2G8W A;  4RW4 A;  1KTQ A;  3IG1 A;  3RRH A;  1U4B A;  2HW3 A;  3AO2 A;  3VQ9 A;  3ZT4 A;  4BE1 A;  1GOC A;  1S6Q A;  4CIE A;  1RTJ A;  1VSI A;  1BL3 A;  4DTR A;  3OYM A;  4B08 A;  3V9Z A;  1FXX A;  5DK5 A;  3VQ5 A;  1Q9X A;  2YNF A;  3ZCM A;  4JS4 A;  2HNY A;  1RNH A;  4CJU A;  2KTQ A;  5JS2 A;  2ETJ A;  3OY9 A;  4OPJ A;  4B8A B;  2WON A;  3NAE A;  2GUI A;  2Z1I A;  4M45 A;  1A5X A;  3ZSR A;  2W42 A;  2YHA A;  4B9M A;  4M3T A;  1QSL A;  4BDY A;  2DFE A;  1CXQ A;  4DTS A;  4NCB A;  1BIS A;  3RR7 A;  3FFI A;  4KB1 A;  4KTW A;  3EZ5 A;  1T03 A;  1UA0 A;  3ASM A;  2DY4 A;  1S9G A;  4FK2 A;  1X1P A;  5SZT A;  1LWC A;  1S5J A;  1K6Y A;  2PZS A;  3OYN A;  3OVN A;  4E3S A;  3QNN A;  1SKS A;  1UOC A;  3ZT0 A;  4Q0B A;  3AA4 A;  4AHS A;  1TL1 A;  4WE1 A;  3RTV A;  3MXI A;  1HMV A;  5CYQ A;  1WSJ A;  4DWI A;  3AA2 A;  4FJ7 A;  1IKV A;  1A5V A;  1XC9 A;  4IDK A;  1JLF A;  1S9E A;  1QQC A;  4I7F A;  3PO4 A;  4FJ5 A;  3C6T A;  5KI6 A;  1J54 A;  3NF6 A;  3K2P A;  4OPK A;  4Z4I A;  3KLI A;  3SJJ A;  1TKX A;  3LPU A;  4Z4G A;  1ZBH A;  1C0U A;  5E41 A;  3HL8 A;  1QHT A;  3ZSX A;  4LH4 A;  3OS0 A;  3V1R A;  1QS4 A;  1IKY A;  2GV9 A;  4G1Q A;  3OYF A;  4E7J A;  1C6V A;  4LSL A;  2RF2 A;  2YNH A;  4DS4 A;  3C94 A;  3V81 A;  4M3W A;  4LY7 A;  4CJ3 A;  3T19 A;  4FLU A;  4F3T A;  4GW6 A;  3MXJ A;  1WSE A;  4CK1 A;  3E01 A;  2BGG A;  1XHX A;  3KKR A;  1SKR A;  2VG7 A;  1W0H A;  3QEW A;  4FJX A;  1EXQ A;  3S3O A;  4N76 A;  1TL3 A;  4H4O A;  3S3M A;  3DRS A;  3SNN A;  1BI4 A;  3KLH A;  4LSN A;  4ELV A;  4KHS A;  3TAE A;  2ITG A;  4LD0 A;  3HT3 A;  3UIQ A;  3AVL A;  4K8Z A;  4I2Q A;  4MFB A;  3L3V A;  5C25 A;  3B6P A;  3NH0 A;  1ITG A;  4BWM A;  3DLH A;  3SUP A;  4O0I A;  1Q9Y A;  4EP4 A;  3LPT A;  3KJV A;  4FLT A;  4B8C A;  4FLY A;  4KB0 A;  2Z1G A;  2F8T A;  3RMD A;  1JLQ A;  1KRP A;  1ZBU A;  5FDL A;  4Z4C A;  1RCH A;  3O3F A;  1KFS A;  2PY5 A;  2E6M A;  3G10 A;  4HCB A;  3AVB A;  2G8K A;  3K5O A;  2VG5 A;  3AA3 A;  3RMB A;  3VQ8 A;  3EY1 A;  1HYS A;  1CLQ A;  4LH5 A;  4E7K A;  4RW8 A;  2PYJ A;  4JS5 A;  3KTQ A;  3AVI A;  1REV A;  3QEI A;  3KLF A;  1QSS A;  1RT4 A;  4Z0U A;  4J2A A;  2QXF A;  1O1W A;  3HVT A;  4I9L A;  4ZTF A;  5KGW A;  4DFM A;  1VSF A;  4CEF A;  5HLF A;  4L8R B;  3LZI A;  4F4K A;  1FKP A;  3QIP A;  4J2E A;  1VRU A;  1RDD A;  2G8U A;  4CJW A;  1BQN A;  1VSH A;  3AO1 A;  2IAJ A;  3K5L A;  3V6D A;  4CHO A;  4O4G A;  1X9S A;  4ZTJ A;  4OKE A;  4KKO A;  1TK8 A;  1SUQ A;  3QIN A;  3S9H A;  4CF9 A;  4B9S A;  1HYV A;  1WSF A;  4FLV A;  4M3Y A;  3ZT3 A;  3OJU A;  2Z1H A;  1BIZ A;  1RDC A;  1JLB A;  1TVR A;  3M8R A;  3M8S A;  3F73 A;  1TK0 A;  4B9L A;  3EYZ A;  4Y1C A;  3THV A;  3NBP A;  2ZD1 A;  4FZZ A;  5J1E A;  3CFP A;  1BGX T;  1KVB A;  3I0R A;  3OYC A;  1GOB A;  3SPZ A;  2KZZ A;  3AA5 X;  1S1V A;  2A1S A;  1VSE A;  3P1G A;  1ZBL A;  1XI1 A;  2DTU A;  1T05 A;  5C24 A;  3M8P A;  1D9F A;  3M8Q A;  3U6F A;  1HQE A;  1D9D A;  3PV8 A;  2G8V A;  1DTT A;  3SQ2 A;  1ZBI A;  5CY4 A;  1NK6 A;  3V1Q A;  3NGI A;  5CYM A;  3OYA A;  1NJY A;  1GOA A;  3DOK A;  2JGU A;  4CJQ A;  4FW1 A;  2D5R A;  3VA3 A;  3SYZ A;  5I3U A;  1NK0 A;  3TR8 A;  4RW6 A;  2VG6 A;  4FJH A;  1NKE A;  4FJJ A;  4IG0 A;  4CJF A;  3RMA A;  2HB5 A;  4OGE A;  3PO5 A;  4OLA A;  3C95 A;  1JLC A;  4MQ3 A;  1RBT A;  1NK8 A;  3SCX A;  2P51 A;  1TV6 A;  3TAP A;  2PYL A;  4B9N A;  4BDP A;  3QEP A;  3HXM A;  1S6P A;  4E7I A;  4DQP A;  4DS5 A;  5T7B A;  4AHU A;  1L3U A;  4K8X A;  4HUG A;  1TKZ A;  4AHV A;  3KD1 E;  1YTU A;  2HNZ A;  3ZSW A;  3WNE A;  3BGR A;  1TAQ A;  1UA1 A;  3TAB A;  2BE2 A;  3PY8 A;  2KQ2 A;  4DF4 A;  5J2M A;  1RTH A;  4O5B A;  3DLK A;  3JSM A;  3T3F A;  1UAX A;  4DQI A;  1RBV A;  1KLM A;  3QES A;  3L2R A;  2XY8 A;  3ZT2 A;  4DU3 A;  2QKK A;  1B9D A;  3L3U A;  1JLA A;  1A5W A;  2B5J A;  4DTP A;  3SUO A;  3D45 A;  1Q8I A;  4FK0 A;  4PY5 A;  2E6L A;  1TKT A;  4Z4E A;  3ZSZ A;  3DLE A;  4ELU A;  1HQU A;  3NF9 A;  3QEX A;  4CHZ A;  2X6S A;  2IGI A;  4F3O A;  4RW9 A;  3LWL A;  1LW2 A;  3OS2 A;  4M3U A;  1JXB A;  3JYT A;  5FRN A;  4CFB A;  3L8B A;  1RT3 A;  3G0Z A;  4J2D A;  3F9K A;  4FLX A;  4HUE A;  3V9X A;  4CIG A;  4KTZ A;  3CG7 A;  3VN5 A;  5C42 A;  2F8S A;  3HYF A;  3LAK A;  3SV3 A;  1BHL A;  3AVG A;  3NCI A;  3RWU A;  3AVH A;  1JL2 A;  3WNF A;  4CK2 A;  3SI6 A;  2OZM A;  4GMJ B;  1RT5 A;  4Y1D A;  4M41 A;  4CK3 A;  4Q5V A;  4E7L A;  4FJL A;  4E1M A;  2HHX A;  3ZSO A;  1SL0 A;  1ASU A;  5KRT A;  4RW7 A;  3IRX A;  1U48 A;  4CEE A;  1W9H A;  4RG8 A;  4CHY A;  4OGC A;  3OYJ A;  3TAN A;  3OYB A;  4C8K A;  3U3G A;  1HYZ A;  4JRQ A;  2YV0 X;  3NH1 A;  1NK7 A;  3ULD A;  4B3O A;  2F96 A;  4F2R A;  4KRE A;  4CJE A;  4DTJ A;  4EZ9 A;  3L2Q A;  3AO4 A;  1UWB A;  5HRP A;  3CQ8 A;  3P83 D;  3O3G A;  4C8M A;  2P1J A;  3LP0 A;  2R7Y A;  4I9Q A;  4N41 A;  3OYE A;  2G8I A;  1CZ9 A;  1D5A A;  4B9T A;  5J2N A;  5FRO A;  4CGD A;  4CF2 A;  3L2W A;  4DU1 A;  1QSY A;  4FZX C;  4CGH A;  3AO3 A;  5CZ2 A;  3ZT1 A;  3OYD A;  2XY6 A;  1N5Y A;  1L3S A;  1IO2 A;  1BQM A;  2EX3 A;  4TSX A;  2FC0 A;  4O55 A;  4HVJ A;  4AIL C;  1SL1 A;  2QKB A;  4E89 A;  3NF7 A;  3IAY A;  2E4L A;  4AHC A;  4NYN A;  2OYQ A;  2HVI A;  5D3G A;  3PUF A;  1T8E A;  3OS1 A;  4E7H A;  3HST B;  4M42 A;  1YT3 A;  3WNG A;  2OPQ A;  4H4M A;  4ID1 A;  4CEO A;  4CEZ A;  1HJR A;  5SWM A;  1KCF A;  2O4G A;  3KIO A;  4HHT A;  2I5J A;  3RRG A;  4OLB A;  3H08 A;  3K58 A;  1TAU A;  5HP1 A;  3HPO A;  3TAG A;  3DOL A;  4JLH A;  5DMR A;  4Z4H A;  3L2U A;  4BDZ A;  4DSF A;  4DSI A;  2QK9 A;  4FYD A;  3QIO A;  3VQ7 A;  2D0A A;  1JKH A;  2XO7 A;  1N6Q A;  4CCH A;  4IKF A;  3AO5 A;  3ZSV A;  4CGF A;  4FM2 A;  2XRI A;  1JLG A;  1WAF A;  5HBM A;  4PWD A;  3LDS A;  1NK5 A;  1RBS A;  1L3T A;  3QER A;  2D0B A;  4CHN A;  4DTN A;  4O0J A;  3BDP A;  4QOZ B;  2A1R A;  4ZHR A;  4CJ5 A;  3LWM A;  1Z25 A;  2HVH A;  2BAN A;  4CEA A;  3V9U A;  2OPS A;  1LAV A;  3NGZ A;  1XHZ A;  1LAW A;  2KFZ A;  4N47 A;  4I2P A;  3AV9 A;  3NFA A;  3AVK A;  4BE0 A;  5J2P A;  3DRR A;  3TWH A;  5EU7 A;  3O3H A;  1TGO A;  4KAZ A;  1EET A;  3NGY A;  4ICL A;  2HHS A;  4FJM A;  1HRH A;  1SL2 A;  2BDP A;  3HP6 A;  4DLE A;  4KPY A;  4R5P A;  3HO1 A;  4CF0 A;  3TAR A;  4FM0 A;  1NJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...