4CHQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 52
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chqA00
4ELUA 4DF8A 3D0PA 1XHXA 3ISNC 4CJ5A 1ASWA 5C25A 3OYBA 4B9TA 2YNGA 4E1NA 1IH7A 1TV6A 1TKZA 3D45A 1C0MA 4I9LA 3OYLA 1JKHA 3NF7A 4N5SA 3MXMA 4F3TA 4Q5VA 4MQ3A 4N56A 4FJIA 1JXEA 1Y97A 3M8PA 4DTOA 2O4GA 2IAJA 4M3WA 3DYAA 4LSLA 1J9AA 4CECA 3AO5A 3ZT0A 4OLAA 1N5YA 1WSJA 1REVA 2ZE2A 4CJFA 2EX3A 4AILC 4CF9A 3M8QA 1X9SA 2NUBA 4LY7A 4OJRA 3HVRA 4PQUA 3AA2A 3L8BA 3V1OA 1S9EA 2Y1IA 3VA3A 1B9FA 3KLFA 2Z1GA 2HVIA 3RMDA 1IKYA 2DY4A 1SV5A 3CG7A 1VK0A 2OA8A 1A5VA 1D9DA 4DTRA 2P5GA 3QETA 3C94A 3O4NA 3V6DA 3JYTA 1IKVA 4FK4A 4IG0A 3VQBA 3SQ2A 4M3XA 2RKIA 3IS9A 1MU2A 2Z1HA 3ALYA 4RW8A 4FYDA 1B92A 2YHAA 2HHQA 1JXBA 5I3UA 3BDPA 4I2PA 3VQDA 4FLYA 4DS4A 3AO4A 3V9ZA 2ZD1A 1XWLA 5C42A 5FRNA 1HNVA 3AVCA 2GBZA 3HP9A 3CM5A 5JS1A 1C6VA 4QOZB 1WSHA 3PX4A 4CK1A 3KJVA 1RTDA 4OLBA 4AHCA 1NK8A 1RDAA 4IG3A 3OVNA 4FCYA 4DFPA 1NK0A 1UOCA 4BE2A 4DQQA 4FJKA 3AVHA 4CJEA 1R0AA 2BDPA 3ZT4A 3SQ1A 3LP0A 1RBSA 4KHYA 1TL1A 3M8RA 4F2RA 3DLGA 4IKFA 3B6PA 4BDYA 3SUNA 4KPYA 4UQGA 4FZYA 2A1SA 3I0SA 3L3VA 1HMVA 3VQ4A 5T7BA 3NH2A 1T8EA 3AO2A 1S6QA 3V81A 5FRMA 4RW9A 1CXQA 3AVGA 4CJWA 1Q9YA 1RT4A 3AO1A 3O3GA 2XY5A 1RDDA 3RMBA 2G8KA 4N41A 1BIZA 2IGIA 4B3OA 1LWCA 3SUQA 3AVLA 3BGRA 1RCHA 1NOZA 2VWKA 4CEQA 1A5WA 3OY9A 5K14A 1BQNA 1UA0A 3HVTA 3S9HA 1NJYA 3PO4A 4N76A 1J54A 3WNGA 4FJMA 3OYMA 1JLEA 3OJSA 2VG5A 3FFIA 4PUOA 1TKDA 4DSIA 4FJ8A 3ZT3A 1T7PA 1WSFA 3AVMA 3C6UA 1VSEA 3NAEA 4FK2A 1RNHA 1U45A 4ELTA 1ASUA 4H4MA 3VQQA 2G8IA 1TVRA 4I9QA 3B6OA 2QKBA 3SI6A 4KTZA 4B08A 4IDKA 4CF2A 3T19A 3P83D 1S1TA 4HVJA 2JGUA 3AVFA 3O3FA 2DFHA 4B8AB 4DTJA 4H8KA 4M45A 1XI1A 4E19A 4Y1CA 4M3UA 2HB5A 1RTJA 4NCBA 4Z4EA 2YHBA 3G0ZA 3OYGA 1RBUA 4FJ7A 1RILA 4ZTJA 1L3UA 1S1UA 3NGZA 1KVAA 4Z0UA 1BISA 1D5AA 1WSIA 3AVKA 5CYMA 1UAXA 1NKEA 4KREA 2DTUA 3KK2A 3CFPA 3NDKA 3K5NA 2XY7A 1KVCA 1W9HA 4CESA 4OGEA 4PWDA 2O4IA 4CERA 3ULDA 3V4IA 4AHUA 3ITHA 4E7HA 4CJLA 1HNIA 5HRRA 5J2MA 1ZYQA 1N6QA 4J2DA 4O55A 3AVAA 3U3YA 4CK2A 1RT2A 4C8NA 2HHSA 3ZT1A 4KRFA 4C8MA 3PY8A 3AVBA 2GV9A 4KO0A 4CIEA 1LAVA 1ZBFA 3OYNA 4LD0A 4O0JA 4DTNA 3RR8A 2HW3A 3SPZA 1KFSA 1L3SA 3VQ9A 4AHSA 1EP4A 1VRUA 1L5UA 1EKEA 1NKCA 3RWUA 4CE9A 5EU7A 1HYZA 1LAWA 1HJRA 2YNIA 1L3VA 1O1WA 2RF2A 1JL2A 3TAMA 1LV5A 2IDOA 1D8YA 2G8HA 4HUFA 4B9SA 4CEOA 2BANA 3OS1A 4KAZA 3CYMA 4Z4HA 4CFCA 2GUIA 3K58A 1HQUA 3OYIA 1FKPA 1VSFA 2QXFA 3MEDA 5D3GA 2KZZA 4CGJA 1W0HA 4CGFA 5FDLA 4FLTA 3PV8A 2HHUA 1UWBA 3KKSA 3VQEA 2Y1JA 2D0CA 2F96A 3VQ6A 3F73A 1JLBA 3OYAA 4O0IA 3TI0A 3EYZA 3HT3A 4ICLA 4M41A 2HVHA 1QSYA 1J5OA 2OZSA 3QEWA 3HK2A 4EZ9A 4OKKA 3U3GA 4FLUA 1VSDA 5J2NA 1JLGA 4H4OA 4FM0A 4M3YA 5HRNA 4DQSA 3AO3A 1QSSA 1HYSA 4B9LA 4NCAA 1TKTA 4CEZA 4DTMA 4DSLA 4OKEA 1RT7A 3OYDA 1RBVA 3LZIA 4FJLA 3OYKA 5J2PA 4DSFA 3HXMA 1BL3A 2OPQA 1HQEA 1S1VA 3CFRA 3V9SA 2G8UA 3LAMA 4CJSA 3PUFA 3SQ4A 2D5RA 3LZJA 4BE1A 1JLFA 2JLEA 3RMCA 3LDSA 4M42A 1WN7A 5HLFA 1ASVA 1BCOA 3V1RA 1CZ9A 1HPZA 2Q3SA 3AVJA 3NF6A 1SKSA 4E7LA 5J2QA 4CCHA 1VSJA 3HPOA 2QK9A 3HSTB 3HM9A 4AHTA 4DWIA 4GVMA 4CJTA 4JRQA 4E89A 4DSEA 3SUPA 4QCLA 1QS4A 4O5BA 2YKMA 3NH1A 1TK5A 3V9UA 1ITGA 4JS4A 3NF9A 2Z1IA 3C95A 3SQ0A 2HNZA 2IC3A 4DU4A 1HYVA 4DU1A 3NE6A 3LWLA 4HCBA 1SUQA 3CM6A 2BGGA 4Q0BA 2FBXA 1SKWA 4FJHA 4BWJA 1B9DA 3LAKA 3QO9A 3SV3A 4E7JA 3AA4A 4KFBA 4C8OA 4NCGA 3S3OA 3LP3A 4BWMA 3ZCMA 4DLEA 3LP2A 4CHNA 1NKBA 2G8FA 4E0DA 1BCMA 1XC9A 2P51A 4F2SA 4N47A 4TSXA 3ZSWA 2HHWA 2E4LA 2EHGA 4CJUA 1UA1A 3U6FA 4LSNA 3HPHA 1BHLA 4IFVA 1FXXA 5SZTA 2ZQBA 4W5NA 2D0BA 1SL1A 1TK0A 4FJXA 1RTIA 3MXJA 3WNHA 1GOBA 3K5LA 2E6MA 3HO1A 1S1WA 3C6TA 3K5OA 3P1GA 1IO2A 4ELVA 3NGIA 1QQCA 2XRIA 4CFBA 4FLZA 3VQAA 5KGXA 1U4BA 4KHWA 4GW6A 2YKNA 1TL3A 1SL2A 3TAPA 1KSPA 1S9GA 4CJVA 1C0TA 4K8ZA 4Z4IA 3O4QA 3TAGA 3KTQA 4RW6A 3T1AA 3SPYA 3SJJA 3OYCA 4E7IA 4DFJA 1VSLA 4DS5A 2OPPA 1U47A 3NGYA 4FLVA 3DI6A 3MEEA 3L2VA 5KRTA 4WE1A 1TGOA 1BQMA 3ZSXA 3K5MA 3DOKA 4CEDA 2RN2A 1RT5A 4FM1A 5CYQA 1NK4A 1J53A 5FROA 3SCXA 4FK0A 3SUOA 3IAYA 4CGGA 3AVNA 4HTUA 3KLGA 1LWEA 4KTQA 1DTTA 1VSIA 4OVLA 1QHTA 4ZHRA 4JRPA 4C8KA 3K57A 5JS2A 3CFOA 3NHGA 1BI4A 1GOAA 1LW0A 2FC0A 3NH0A 4DU3A 1VRTA 4FVMA 1IG9A 3QNOA 3QEXA 3DLHA 4BE0A 2F8SA 3L2WA 3ZT2A 4FJ5A 1VSKA 4DFMA 1KVBA 1C1BA 1K6YA 1NK7A 3LALA 4L8RB 2KTQA 2KW4A 3H08A 4ID5A 5DK5A 4DMNA 1YVUA 1NJWA 4CHPA 2D0AA 4DQRA 1ZBLA 1ZBUA 1RDCA 3TAFA 1G15A 2WOMA 3AA5X 2OYQA 3EZ5A 3KD1E 2B6AA 3OYHA 3AA3A 3PO5A 1FK9A 3OS0A 3QLHA 4EZ6A 4CGDA 4QAGA 3ZSVA 1NOYA 1RT3A 2LSNA 5KI6A 4W5QA 3ASMA 1LWFA 1WAJA 3QINA 4B9MA 4KB0A 1U04A 4M3ZA 4OPJA 1NJZA 1I39A 3AV9A 3AVIA 1NJXA 3E01A 4CJRA 3ZSQA 4CIGA 1C0UA 3DM2A 1Z26A 3RMAA 1TAQA 1Q8IA 4CJKA 4CIFA 4DTPA 3KLHA 3DRPA 3KK3A 2X74A 3K59A 2ETJA 4DSKA 4JLHA 1T05A 3SYZA 2WONA 5J1EA 3O3HA 1KLMA 4J2EA 2DFEA 1X9WA 4BDZA 4Z4FA 1Z25A 1BI4B 3OYEA 2HMIA 4FJNA 2FBVA 5CY4A 1TKXA 1F21A 3LANA 4FW2A 3WNEA 4I2QA 1EX4A 3I8DA 2ITGA 4FJJA 1RT6A 1QE1A 3V9XA 1JLCA 2KQ2A 3QNNA 4KHNA 4B9NA 3RR7A 4PA1A 2IOCA 4AHRA 4CJ4A 1CXUA 3TR8A 3TANA 4KB1A 4OKJA 4CF8A 1YTAA 4YFUA 4KI4A 1KCFA 4HUGA 4OPKA 1DLOA 3QEPA 1RTHA 4R5PA 4KHUA 2YNHA 4FZXC 3S3MA 3LPTA 4F4KA 2VG6A 2HNYA 4B9VA 4F3OA 3VQ7A 4HUEA 3LP1A 1X1PA 4Z4CA 1QSLA 1VSMA 3DLBA 5KTQA 4CHZA 4B8CA 1HRHA 4ZTFA 3DRSA 4DLGA 3MEGA 3QESA 4EP4A 1ZBHA 3UIQA 4HHTA 3NF8A 3ZSZA 3KLIA 1RDBA 3LPUA 4CGHA 1EXQA 1WLJA 1S1XA 2RPIA 1KFDA 3L2QA 2XHBA 3PX6A 2FBTA 4CGIA 4MFBA 2XY6A 4CHQA 3L2UA 1BGXT 1L3TA 3RRGA 4K8XA 1Q9XA 3HJFA 3RRHA 4CEEA 2G8WA 3HYFA 2PZSA 1C1CA 1ZBIA 3KKRA 1C1AA 2BE2A 3A2FA 4Y1DA 3ZSOA 3QIPA 2HHXA 2B4JA 4IFYA 2B5JA 2PY5A 3VQCA 3MXIA 4CJ3A 2KFZA 2X6NA 4E1MA 2I5JA 4KV8A 3F9KA 3QIOA 4LH5A 2VWJA 1NK9A 2HHVA 5HRSA 4KHSA 1RBRA 3VQPA 4ID1A 3IRXA 2ATQA 1BIUA 3SZ2A 3I0RA 5E41A 1NK5A 4FZZA 2P5OA 3MAQA 3SV4A 5SWMA 4C8LA 4IBNA 3M8SA 1KTQA 1JLAA 3OJUA 1TK8A 2OZMA 3IG1A 3OYJA 4J2AA 3HP6A 1GOCA 3VQ8A 4BDPA 1I3AA 3DMJA 4GMJB 4AHVA 3PX0A 5HP1A 4Z4GA 4RG8A 2G8VA 1DTQA 3TARA 3DLRA 4FM2A 1WSEA 3HPGA 2X78A 1NK6A 4JS5A 2YV0X 4AH9A 5I42A 5HBMA 3G10A 3T3FA 2HHTA 1CZBA 2XO7A 4XIUA 4DG1A 3OYFA 1U49A 4J2BA 4NYNA 2HNDA 4YNQA 4M3RA 3NBPA 1SKRA 3TABA 4FJ9A 4M3TA 3NCIA 1A5XA 1VSHA 2DFFA 2PYLA 4CFDA 3QERA 1JLQA 3KIOA 4G1QA 4RW4A 3QEIA 1LW2A 3VA0A 1U48A 1X9MA 3DRRA 3L2RA 3RTVA 4RW7A 2E6LA 4FLXA 1SL0A 1D9FA 1RBTA 3DLKA 4DQPA 4KI6A 2XY8A 5DMRA 3KLEA 3DLEA 5KGWA 4CEAA 4EP5A 4OGCA 4B9UA 3THVA 3ZSRA 1WSGA 4DSJA 3MECA 4DTUA 4DF4A 3VQ5A 3VN5A 4CHOA 2FBYA 4O44A 2A1RA 2PYJA 4CF0A 3SNNA 2IS3A 5CZ1A 3TAQA 2OPSA 4BACA 4CJQA 3S3NA 4E3SA 2YNFA 2VG7A 4FJGA 3K2PA 5C24A 3OS2A 1FKOA 1WAFA 3LWMA 4CHYA 1YTUA 4KKOA 4CF1A 5HROA 2AJQA 4CEFA 4F8RA 4KHQA 3TWHA 1KRPA 4W5OA 4FW1A 4I7FA 2QKKA 4DFKA 1RT1A 3QEVA 4HCCA 1EETA 2KFNA 2F8TA 4W5RA 4CJPA 4FLWA 3NFAA 1TAUA 1KLNA 1IKXA 3ZSYA 1CLQA 2R7YA 4W5TA 1S5JA 1WNSA 4FXDA 1IKWA 5CZ2A 2KZMA 2Z1JA 4CEBA 3CQ8A 3EY1A 2P1JA 3L3UA 1XHZA 2OPRA 3P5JA 5HRPA 3KK1A 5KRSA 3V9WA 4KTWA 3JSMA 4CFAA 4CK3A 4NYFA 1T03A 3DOLA 1S6PA 1JL1A 4DTXA 4DQIA 3V1QA 4DTSA 2W42A 4LH4A 4E7KA 1QTMA 3TAEA 2X6SA 1YT3A 4O4GA 3HL8A 3WNFA 4PY5A 3KD5E
chains in the Genus database with same CATH superfamily
3O1BA 5CE3A 3ISNC 4CJ5A 3C0BA 1NNEA 4E1NA 3D45A 3MXMA 1TKZA 3O5BA 5GAEP 1NK4A 4N5SA 4F3TA 4Q5VA 4FJIA 2RHKA 1NGJA 3WXJA 4EHTA 3OA9A 4JI5K 4BROA 3MCAB 3T1HK 1WSJA 5CHIA 3M8QA 2NUBA 4LY7A 3HVRA 2Q36A 4GVEA 4WQ4C 4Z94A 5KPTA 4WFAL 1HUXA 3KLFA 2HVIA 1YJWN 3WXIA 3F9MA 3O80A 3G6EN 1S3XA 3CCSN 4GY2B 5AZIA 1RDWX 2VGMA 3BDPA 3AO4A 1NGAA 1NGDA 2GTDA 4JI6K 1XWLA 5C42A 2A6AA 5AQZA 5FRNA 4QOZB 2ZJQL 3PX4A 4OLBA 4AHCA 1YITN 1RDAA 3ATUA 3CCMN 4DFPA 1UOCA 3TU5A 4CJEA 3RVCA 5AQWA 3EN9A 3LP0A 5M1KA 4KHYA 3DLGA 3B6PA 3Q7CA 2E1YA 3R1XA 2UXDK 5T7BA 1HMVA 4X64K 4CZHA 4O8KA 4CI6A 1S6QA 4BC5A 3CERA 1CXQA 3O3GA 4N41A 1RDDA 4ISGA 4JKDA 1JJ2M 2VCPA 1N33K 4BGBA 1W7AA 1NOZA 2VWKA 1A5WA 3OY9A 5K14A 3G71N 5FLXO 3FFIA 2HF3A 1VSEA 4C23A 2QA4N 4ELTA 3MWPA 2BH1A 3SI6A 4HVJA 4B8AB 3ZEUA 4E19A 4JV5K 4M3UA 2HB5A 1RTJA 2ITMA 4NCBA 4Z4EA 3CHWA 2YHBA 4K43A 1ZBSA 1RBUA 4A2BA 2YHWA 1WSIA 1LCUA 1UAXA 1NKEA 3NDKA 1KVCA 1W9HA 4CESA 4DV1K 4OGEA 4H0OA 2UUBK 4MDBA 5AQGA 4LFAK 3ULDA 3V4IA 2UXBK 5JICA 5J2MA 4H03B 4I6MB 4DB3A 2BTFA 1XNRK 4DR6K 2HHSA 3PY8A 2VQEK 4CIEA 1WBDA 1GLLO 1XNQK 4DTNA 3RR8A 1X3NA 5A2QO 4H5VA 4BGAA 1E3MA 2GEMA 1EP4A 1L5UA 1EKEA 1NKCA 1L3VA 1HJRA 3TAMA 1JL2A 2ASMA 2IDOA 4HUFA 3UKUA 4B9SA 4KAZA 3MMVA 2GUIA 5DM7L 5EOYA 1HQUA 3OYIA 1FKPA 3FZHA 4NXNK 2ZF5O 2H3GX 3VGMA 3OTOK 3Q7BA 1OH7A 3I8BA 5BPMA 3OYAA 5H1SQ 3B8AX 3FZKA 1J5OA 4JKBA 2OZSA 4OKKA 3U3GA 1VSDA 4H4OA 4DQSA 3AO3A 1HYSA 3CJAA 1RT7A 1HNXK 1W97L 3OYKA 1VQKN 1HQEA 4CJSA 2NRWA 3CC7N 2UU9K 1K8KA 3H46O 1HPZA 3NF6A 4KH5A 1SKSA 4BRGA 4CCHA 1VSJA 3HSTB 3HM9A 4E89A 2AA4A 5AQIA 3V9UA 3VESA 3SQ0A 3NE6A 3LDPA 5C10A 1WB9A 5AQMA 4BWJA 3QO9A 5AQSA 3AA4A 4KFBA 1NBWA 4BWMA 1TUUA 3LP2A 3ZYYX 4F2SA 2P51A 2HHWA 5E84A 4N47A 4CJUA 3U6FA 4IFVA 5AQRA 1DEJA 3ZX2A 2UYTA 3A5MC 4FJXA 1RTIA 3MXJA 3WNHA 1GOBA 1RFQA 2E2PA 3HO1A 3P1GA 1IO2A 1NGIA 4CBWA 1T6DA 1J6ZA 1KXPA 2QWQA 3TAPA 4CJVA 1C0TA 3O1WA 3MWTA 3SLCA 3KTQA 3T1AA 4E7IA 4DFJA 1U47A 3ULEB 1KQSM 3DI6A 4BC4A 5KRTA 2GWJA 1TGOA 3J80O 1HKBA 3SUOA 5BRFA 1DTTA 1VSIA 2VQFK 4JK9A 3VEWA 3K57A 3IMXA 5JS2A 3CFOA 1BG3A 1BI4A 1GOAA 2FC0A 3NHGA 4DU3A 3H3NO 4BE0A 3MN5A 5HL7L 4FJ5A 4DFMA 1C1BA 2KTQA 2KW4A 1GLDG 4XH5A 4DV5K 2D0AA 2NZTA 3E9LA 3HTVA 3AA5X 1J5EK 2OYQA 3KD1E 3OYHA 2ASOA 1VQ6N 2OANA 1NGCA 2CGKA 4FL9A 1U04A 3KK7A 1FJGK 1NJZA 4CJRA 1YI2N 1Z26A 3J7AP 1Q8IA 2FLOA 2UUCK 3AAQA 2X74A 1TYQB 4FWKA 4DSKA 4JKEA 2NRXA 4PL8A 1T05A 5J1EA 1Q86O 2HF4A 2HMIA 3ID8A 3SBGA 2GWKA 3I8DA 2ITGA 3SBTA 1RT6A 3DAWA 4LF6K 2QXLA 3ENOA 4LF8K 3ATVA 3QNNA 4B9NA 4PA1A 5FPDA 3TANA 4KB1A 4OKJA 4MLEA 1YTAA 4CF8A 5C15A 4YFUA 2V51B 1DLOA 4OPKA 1NG9A 4BQZA 4KHUA 1ESVA 4JNEA 4A62A 2HNYA 4B9VA 3A5OC 3DXKA 1QSLA 5KTQA 4DR4K 1NGBA 4B8CA 3MEGA 1BOTO 1ZBHA 2E2NA 4O8UA 2GUPA 4CGHA 2O8DA 1WLJA 3QMLA 3L2QA 1N32K 4MFBA 3AGKA 3L2UA 1L3TA 3O8MA 4H0VB 4B1XB 4CEEA 2G8WA 2PZSA 1C1AA 4WFBL 1D4XA 5BN8A 2HHXA 2B4JA 4IFYA 2PY5A 2X6NA 4ISFA 2I5JA 4KV8A 3QIOA 5AQUA 2VWJA 2HHVA 4LF7K 4OX9K 5HRSA 4R79A 4JD2A 3IRXA 3VEVA 1QQMA 3A5LC 2P5OA 3SV4A 3MN9A 4DUZK 3DLLL 3M8SA 4FSVA 5FPEA 2HBLA 4ILGB 3PX0A 3M6GA 4AHVA 2A3ZA 1WSEA 4FM2A 1NK6A 4CZEA 2XO7A 1QZ6A 3N4QA 4XIUA 5JLHA 4J2BA 2P9KA 3ZLJA 2BUPA 2OCEA 3TABA 2DFFA 2F7TA 4CFDA 3QERA 4FOEA 3CMEN 4RW7A 2E6LA 4IDHA 1RBTA 3DLKA 2E88A 4KI6A 5DMRA 2WTUA 1VQ5N 4CEAA 4EP5A 3THVA 3ZSRA 1RDUA 4DF4A 3VETA 5M1NA 3T7ZA 3N4PA 3SNNA 2QM1A 4CZLA 2YJFA 2OPSA 3S3NA 4FWMA 1QVFM 4CHYA 2Q97A 2AJQA 4CF1A 5AQJA 4DFKA 1RT1A 4HCCA 4W5RA 1NGHA 1KLNA 3UKRA 1WNSA 4CEBA 3EY1A 2OPRA 5HRPA 3KK1A 3CCUN 4CFAA 4NYFA 2E8AA 4DTSA 4KBOA 4E7KA 2QWPA 3HL8A 4IFEA 4CZFA 3CC4N 3BZKA 4B9TA 2YNGA 3VOVA 1IH7A 1C0MA 3AARA 2VWBA 3NF7A 3WEEA 2I7NA 4MQ3A 3KWGA 1Y97A 3M8PA 4M7YA 3U9ZA 3NVMA 2O4GA 3DYAA 4OLAA 1V4SA 1REVA 3CPEA 2EX3A 2YCHA 1HNZK 1YAGA 1X9SA 4OJRA 4PQUA 3AA2A 3DWLA 2D0PA 2Z1GA 1IKYA 1SV5A 1YVNA 3CG7A 2OA8A 4DQ8A 2P5GA 1Z6RA 3VQBA 3IS9A 4FWOA 2Z1HA 4RW8A 5C2DA 2YHAA 4JI2K 5B8HA 3KWIA 3VQDA 2QTDA 3UKUB 1SAZA 4DKWA 1HNVA 3HI0A 3HP9A 2P9UA 1RTDA 1ZC6A 3LDNA 4GKJK 3MCPA 3O6WA 4FJKA 1JCEA 5KPRA 2CGJA 1TL1A 3M8RA 4IKFA 3E9PA 3SUNA 4KPYA 4FZYA 4M63C 3L4QA 3CJBA 3AO2A 4RW9A 4CJWA 5AZJA 3RMBA 4HTLA 2A40A 4A59A 1BIZA 2IGIA 2HMPA 1YUWA 4CEQA 4BRFA 3HVTA 4MDAA 4N76A 3WNGA 3OYMA 1JLEA 3CMAN 2VG5A 4PUOA 4DSIA 3ZT3A 1T7PA 3AVMA 1T6CA 1KAXA 2G8IA 1ASUA 3VQQA 3B6OA 3BF3A 3D7EO 1DT9A 4KTZA 2W6KA 4CF2A 2KLAA 3O3FA 4DTJA 3AVFA 4YDUC 1ILYA 2DFHA 3CJ1A 1XI1A 2GELA 1GLAG 3J7YP 2FSNA 1E4FT 4ZTJA 1ATNA 3NGZA 1KVAA 3AVKA 2DTUA 2O8BA 3KK2A 4H0YB 3K5NA 4MLHA 1K9MO 5C12A 4CERA 4K41A 4AHUA 4E7HA 4CJLA 1HNIA 2FSKA 5HRRA 4J2DA 4O55A 3AVAA 2HBMA 2P9SB 1NGGA 1RT2A 4C8NA 5HOOA 3AVBA 2GV9A 3J7ZO 4CZJA 1ZBFA 3OYNA 3SPZA 4IOCL 1KFSA 1G99A 3VQ9A 4A2AA 1VRUA 4AHSA 1LAWA 4BG9A 4FPAA 1D8YA 2ASPA 2O8CA 2QXFA 2KZZA 4CGJA 4CGFA 5FDLA 5IWAK 4FLTA 3PV8A 4FWPA 2Y1JA 2D0CA 3F73A 3VQ6A 1JLBA 4O0IA 5JMVA 3EYZA 3HT3A 4ICLA 4M41A 1QSYA 4BRHA 3HK2A 4EZ9A 4FLUA 1WBBA 1BWFO 4B9LA 1TKTA 2IVOA 4DTMA 4DSLA 4OKEA 4BRMA 3VF4A 4FJLA 1HLUA 2YJEA 3HXMA 2OPQA 3CFRA 2O8EA 3LAMA 3SQ4A 3PUFA 1HPMA 4B3SK 1JLFA 1MWKA 2NLXA 3LDSA 4M42A 1WN7A 1BCOA 4PHTX 4WCEL 2Q3SA 3CQYA 4E7LA 3EZWA 5C2FA 2QK9A 4AHTA 3SK3A 4DWIA 4CJTA 4DSEA 3SUPA 4A5BA 3ENHA 2D4WA 2CGLA 1OH8A 1YJNN 2HNZA 2IC3A 1HYVA 5EXWA 1SUQA 2BGGA 4Q0BA 1SKWA 5AQPA 1MWMA 4V19S 3LAKA 3BF1A 4NCGA 3S3OA 4DLEA 2G8FA 3VEYA 3JXUA 1JCFA 4XH1A 1BCMA 1NKBA 1NJIO 2YHYA 3ZSWA 2EHGA 4IEEA 3K9JA 5F2RA 5SZTA 3L0QA 1SL1A 3VMFB 3IKMA 3CETA 4BREA 4CVNE 1TK0A 3CCRN 3SMSA 1NGEA 4BR5A 3K5LA 2E6MA 1S1WA 3C6TA 3NGIA 3FZLA 1QQCA 3CJ9A 3DXKB 3VQAA 3ZETB 1U4BA 4GW6A 2YKNA 1TL3A 3O4WA 1SL2A 1S9GA 3TAGA 4RW6A 1GLFO 4QS8A 2O8DB 1VSLA 3MEEA 3L2VA 4WE1A 2VYPA 3TPQA 4CEDA 4FWNA 5FROA 3M5RA 4DR5K 3IAYA 4CGGA 4EFHA 1LWEA 5JLFA 4JD2B 4ZHRA 3NH0A 2F8SA 4HWIA 1VSKA 1KVBA 1K6YA 1NK7A 3LALA 3VEXA 3H08A 4K25A 4DMNA 4EIAA 1P90A 1YVUA 1ZBLA 1ZBUA 1VQNN 4DV4K 2P9KB 2B6AA 2P9NA 1FK9A 1BA1A 3MX5A 4CGDA 4QAGA 1HJOA 1XC3A 2LSNA 5KI6A 4RTFD 3ZSVA 3QINA 1WAJA 3LDOA 2P9PA 4M3ZA 1Q18A 3AV9A 1NJXA 2O8FA 4CIGA 1C0UA 1TAQA 5M1OA 3THWA 3DRPA 3LDLA 4CZIA 3SYZA 2WONA 3O3HA 1KLMA 3C7NA 1C0GA 1MDUB 1Z25A 4IZ9A 2FBVA 4YOUA 4B3TK 5CY4A 5KQ8A 1TKXA 3LANA 3WNEA 3DXMA 1U2VA 4FJJA 3V9XA 4PKGA 3RR7A 4AHRA 1CXUA 3TR8A 5ADXA 2QWOA 4HUGA 4R5PA 4FZXC 3G25A 3QFUA 3UKRB 2VG6A 3BZCA 3H1QA 2KKZA 5JVHL 3PSIA 4CHZA 4ZTFA 3DRSA 4DLGA 3R6MA 4HHTA 3KLIA 3QBWA 3LPUA 1EXQA 2RPIA 1S1XA 3JS6A 4DR2K 3FLCO 2XY6A 1QZ5A 3GL1A 4JHDA 4B1YB 3D2FB 3F2KA 1BGXT 3RRGA 1Q9XA 3U4LA 1ZBIA 4L3QA 2P9IA 3QIPA 4B9QA 1IBMK 4E1MA 4LH5A 1I94K 3I55N 4KH4A 1BIUA 1VQON 1NK5A 4FZZA 5AQVA 5SWMA 4IBNA 1BU6O 3HP6A 1GOCA 3DMJA 5GINA 3K0SA 4IJNA 2YV0X 3H6EA 4LC9B 4AH9A 2HHTA 3G10A 3ZX3A 1CZBA 4DG1A 1K73O 2NNWA 1U49A 3NBPA 3NCIA 1E4GT 4BR9A 5C0YA 3VA0A 1X9MA 1YHQN 1SL0A 2XY8A 5LJWA 4OGCA 2P9UB 3THXB 4QS9A 1K8AO 4DSJA 2FSJA 4CHOA 3P38A 4JN4A 2ZGZA 2EWSA 2IS3A 4B1VA 5BR9A 3TAQA 4ILHA 4BACA 1GLCG 4DR1K 3MK6A 1LOTB 3K2PA 5C24A 5BRHA 3OS2A 3C6HA 3LWMA 4KKOA 5AFUA 5HROA 4FW1A 1EETA 2F8TA 1TAUA 3CC2N 3ZSYA 1CLQA 4H0TB 2P1JA 3P5JA 2WBNA 4KTWA 2OTJN 4CK3A 4LH4A 4KH6A 2GX9A 1HR0K 1YT3A 4O4GA 3WNFA 3KD5E 4ELUA 4DF8A 1XHXA 4BRNA 3BP8A 3OYBA 4NXMK 2ZWHA 1JKHA 1T3VA 1NM1A 4LF9K 4AM7A 1JXEA 4C1NI 2O8BB 2E1ZA 5GAGP 4B3RK 3RSEB 4DTOA 4LSLA 1N5YA 1KAYA 2PBDA 4CJFA 3M1FA 4CF9A 1OH5A 3UE5A 4XEIA 5CR4A 3MN6A 2NRRA 3A5NC 3VA3A 4FWSA 1NMDA 4BRKA 4PKHA 1GLEG 3EKSA 1VK0A 4BG8A 4NLBA 1D9DA 4DTRA 3C94A 3O4NA 3V6DA 4FK4A 4IG0A 3SQ2A 4M3XA 2NRTA 2RKIA 3L4IA 4GNIA 3ALYA 1FW6A 1B92A 2HHQA 5I3UA 4IXCA 4DS4A 2ZGYA 2VGNA 2O8CB 1W2BM 5EX5A 3O9UA 2GBZA 1C6VA 2Q0RA 1WSHA 4CK1A 3U9DA 3NMUA 4FCYA 1VAZA 4BE2A 4DQQA 3OHRA 3ZT4A 3SQ1A 4F2RA 4UQGA 3L3VA 4JKGA 4YOYA 5M1PA 4LFCK 3AVGA 2G8KA 3AO1A 1OVYA 1HNWK 1GLBG 1GLJO 2ZJRL 3BGRA 1BDGA 1RCHA 1NJYA 2O8EB 5AZIB 1J54A 1VHXA 4FJMA 5BPNA 3OJSA 4LF4K 1TKDA 3HBTA 4JI1K 3C6UA 4E1JA 2E2OA 4FK2A 1RNHA 1U45A 4H4MA 4I9QA 3QICA 4JKAA 2QKBA 5JVGL 4B08A 1V4TA 1X3MA 1S1TA 3P83D 2JGUA 4H8KA 4DV7K 3U8XA 4Y1CA 2HOEA 1XMOK 3G0ZA 3OYGA 5AQNA 4FJ7A 3WXLA 3CXCM 1L3UA 4FVUA 1D5AA 3VGLA 2HSTA 4PWDA 1M1KO 2O4IA 3C65A 4PL7A 3ITHA 1N6QA 2IVPA 5KPZA 1HX1A 4CK2A 2FF3B 5EY4A 3E9OA 3HSCA 4KO0A 4UY8O 4LF5K 4LD0A 4O0JA 1L3SA 1YF5L 3AY9A 4WQ4A 3RWUA 1HYZA 2J4RA 2YNIA 3ZEUB 1O1WA 4FWRA 3QFPA 3G4SN 3WQUA 3OS1A 3CYMA 3MEDA 5D3GA 5BPLA 1W0HA 4DV2K 4NLCA 2HHUA 1UWBA 3VQEA 2F96A 3TI0A 1WOQA 2FXUA 3FFKB 5J2NA 2E5LK 1JLGA 4FM0A 5AQLA 1QSSA 4NCAA 4F9OA 3OYDA 3LZIA 5J2PA 1BL3A 2NRVA 1S1VA 3UB5A 2HHHK 3V9SA 2G8UA 4ISEA 3LZJA 5BREA 3BY5A 3RMCA 4WQ5A 4BQLA 3MX2A 1VQLN 2V52B 2P9NB 5J2QA 4H5WA 4JRQA 4QCLA 1JCGA 4O5BA 1TK5A 2Z1IA 1NGFA 3SMPA 3GDQA 3VF2A 4DU4A 4DU1A 1O13A 3LWLA 3THWB 4HCBA 3CCQN 4FJHA 1B9DA 3C7NB 3SV3A 4E7JA 4C8OA 1ATSA 3ZCMA 4DUYK 1XC9A 5F0XA 3DXMB 4TSXA 4IOAL 4CZMA 4AQYK 3H3OB 2D0BA 1K8KB 4CD1A 4JK8A 3VENA 3TSPA 3CCJN 3D6RA 2NRHA 3VF6A 3K5OA 4ELVA 4KHWA 1ZXOA 1KSPA 3O4QA 2KHOA 1R59O 2OPPA 4EAHD 4AM6A 4JHDB 1BUPA 3ZSXA 3DOKA 2RN2A 3O9QA 4FM1A 4IWVA 4JK7A 3L6QA 3VGKA 1XUPO 3SCXA 3AVNA 3KLGA 4BVOA 4CW7B 1QVGM 1P8ZA 4C8KA 1SS6A 4NO7A 1VRTA 4FVMA 4ILJA 1IG9A 3QEXA 3EL2A 3DLHA 4OPAA 1NWKA 2F9WA 2W40A 2YI1A 5GADP 4L8RB 5DK5A 2JWLA 4A5AA 3HZ6A 1RDCA 5BRDA 3EKUA 1G15A 3EZ5A 4BR7A 3PO5A 3QLHA 3FE1A 3CPWM 4W5QA 4B9MA 4CBXA 2HBKA 4OPJA 5BN9A 1I39A 3AVIA 4BRDA 3DM2A 3QBXA 3CF5L 4GV6A 4CJKA 4DTPA 3KLHA 4YY3K 2QW9A 2DFEA 2PAVA 4BY9C 1NLVA 1BI4B 3OYEA 1YXQA 4FW2A 1F21A 1EX4A 4IEIA 4H0XB 1JLCA 2KQ2A 4B3MK 4KHNA 2E2QA 1IBLK 5GIOA 2QWNA 4K0KK 3QEPA 3F5TA 2YNHA 3S3MA 1EWRA 3LPTA 3ID6A 1VQ7N 1X1PA 4FOIA 4Z4CA 3DLBA 1HRHA 3PSFA 3PIOL 3QESA 4EP4A 3NF8A 2ZJPL 1RDBA 4JKCA 3PX6A 5BR8K 3NVKA 2FBTA 4CHQA 4K8XA 3HJFA 3HYFA 4B1UB 3KKRA 3ZSOA 3CCLN 2Q2RA 3VEOA 1QHAA 2IIRA 4FWLA 1RBRA 5AQKA 2ATQA 3I0RA 3MAQA 1KTQA 1CZAN 3OJUA 4H0PA 3IG1A 3OYJA 1IV0A 3VQ8A 3KHYA 4DCHA 1I3AA 3VERA 4WQ5C 3CQXA 3I33A 4RG8A 2G8VA 1DTQA 4YOXA 2QEXN 4CZKA 3W0LA 1YIJN 5AQOA 5M1FA 3T3FA 4DV0K 5LMUK 3WT0A 2HNDA 2UXCK 1SKRA 3WQTA 1VSHA 4BRCA 2JWKA 3BUZB 3KIOA 4G1QA 1LW2A 3LDQA 5AQYA 1U48A 1H1VA 3R9PA 3RTVA 1VQ9N 4FLXA 1D9FA 4OPHA 4DV6K 3KLEA 3DLEA 5AR0A 1WSGA 4DTUA 5TKYA 3VQ5A 4BRIA 1S72N 4O44A 2PYJA 1IG8A 3O9TA 4GV9A 4CJQA 4JKGB 2YNFA 3S41A 2VG7A 4FJGA 1WAFA 1YTUA 4WF9L 4CEFA 4KHQA 4WFNL 3TWHA 1KRPA 4I7FA 2QKKA 3QEVA 2KFNA 1KC8O 3MDQA 4B1WB 4CJPA 5GAHP 3NFAA 4FLWA 1IKXA 4JI0K 3C6AA 4W5TA 4FXDA 5M1QA 1IKWA 2KZMA 2Z1JA 4BRPA 3CQ8A 3L3UA 4YORA 5AQTA 5KRSA 3V9WA 1N36K 3EE8A 3QB0A 1S6PA 4DTXA 1QTMA 1U6ZA 2W42A 3THYA 3TAEA 4Z4GA 1M90O 3D0PA 3TTDA 1ASWA 5C25A 3WXKA 4I9LA 1TV6A 3OYLA 4CBUA 2I7PA 2OTLN 4N56A 4H5RA 2AP1A 3FR0A 4M3WA 2IAJA 3VTIA 1J9AA 4CECA 5AQQA 4BR0A 3AO5A 3ZT0A 2ZE2A 4YOTA 3P4IA 4AILC 3OBYA 4CZGA 4JAXA 5AQXA 2V7ZA 3L8BA 3V1OA 1S9EA 2Y1IA 2D0OA 1B9FA 1VQMN 3IFRA 3RMDA 3SAHA 2DY4A 3A0IX 1A5VA 4U67L 3QETA 3JYTA 1IKVA 1VQPN 4JI3K 2QWRA 3PIPL 1MU2A 3D2EA 4FYDA 2A41A 3GOIA 1JXBA 1NU0A 4I2PA 1KD1O 4FLYA 3V9ZA 2ZD1A 5ADXH 3AVCA 3WEEB 2YX6A 3CM5A 5JS1A 4QS7A 5AQFA 3KJVA 1NK8A 2RE2A 4IG3A 3OVNA 4MO4A 1NK0A 3J8AA 3CCVN 3AVHA 4FPBA 1R0AA 2BDPA 4BRQA 1RBSA 3JAMO 5TKWA 4BDYA 1EWQA 1Z05A 2A1SA 3I0SA 3VQ4A 4RWTA 3NH2A 1T8EA 3CD6N 4H5NA 3V81A 5FRMA 1Q9YA 3GG4A 1RT4A 1Q82O 2XY5A 4GV3A 2P9LA 4B3OA 1LWCA 3SUQA 3AVLA 1UA0A 3PO4A 5IT9O 1BQNA 3S9HA 2P9SA 3BEXA 4JI4K 2FF6A 1KAZA 4FJ8A 1WSFA 3P31A 4C1NK 3NAEA 1TVRA 4BVPA 4IDKA 3T19A 1DGKN 4M45A 1QQOA 4JKFA 2QWMA 3EE9A 1S22A 1RILA 3KVGA 4BR2A 4DV3K 3PLAA 1S1UA 4Z0UA 1BISA 5CYMA 4KREA 3CFPA 2XY7A 2Q31A 5AZJB 5I9EB 3VTHA 4IJAA 4DR3K 3IUCA 2IVNA 3ZX0A 1ZYQA 3U3YA 1HKGA 2A42A 1OH6A 1SZ2A 4BR4A 3ZT1A 4KRFA 4C8MA 3TSQA 1IBKK 1LAVA 1Q7YO 2HW3A 3FZMA 4CE9A 5EU7A 3R3LA 2F9TA 4FWQA 2RF2A 1LV5A 4JI7K 5AFUH 2G8HA 4BC2A 4CEOA 3J81O 2BANA 4Z4HA 3DJCA 4CFCA 3K58A 1VSFA 2A5XA 2NRZA 3KKSA 2WC9A 3LM2A 1OVQA 1BO5O 1T44A 3T69A 4FO0A 3GE1A 5LL6Z 4DR7K 3LL3A 5LY3A 4A57A 2HVHA 4PKIA 3QEWA 1X9JA 4M3YA 5HRNA 1C0FA 5LJVA 4CEZA 1RBVA 4J8FA 3E66A 4DSFA 2D5RA 3MN7A 4BE1A 4JYAK 2JLEA 4BRLA 2PFUA 3GBTA 5HLFA 1ASVA 3V1RA 1CZ9A 3AVJA 5ELZA 3CIPA 3OW2M 3HPOA 4GVMA 3ZETA 1QS4A 3NH1A 2YKMA 1ITGA 4JS4A 3NF9A 2CH5A 3K9KA 3C95A 4YOWA 1EQYA 4JI8K 1N8RO 3CM6A 2FBXA 4YOVA 1EO1A 4YDUA 3LP3A 4CHNA 4E0DA 3HM8A 4Y0WA 2E4LA 3EO3A 1UA1A 3FZFA 4LSNA 3HPHA 1BHLA 4YHHK 1FXXA 4W5NA 2ZQBA 4I6MA 4B1ZA 1N34K 4CD3A 5AJ3K 3R8EA 3TSUA 3WXMB 3EEQA 4CFBA 2XRIA 4EHUA 1YJ9N 4FLZA 5KGXA 4BRAA 5LMNK 4K8ZA 4Z4IA 3CJCA 1TUYA 3SPYA 3SJJA 4JKHA 3OYCA 2UUAK 4DS5A 4JEPA 3NGYA 4K42A 3E1YA 1IJJA 4FLVA 1BQMA 3K5MA 1BA0A 1RT5A 5CYQA 1J53A 3WUHA 4FK0A 4OO1J 4HTUA 4KTQA 4OVLA 1OKJA 1QHTA 4JRPA 1DKGD 2WFBA 1LW0A 2D1KA 3QNOA 2Q1NA 3CJ7A 3T1YK 1MA9B 3L2WA 3ZT2A 4NB4A 3O9RA 4IOXA 3CCEN 4ID5A 4M7XA 3HOSA 4A61A 1NJWA 4CHPA 4DQRA 3TAFA 4RCHA 2WOMA 4BC3A 3AA3A 3OS0A 4EZ6A 3LM9A 1NOYA 1RT3A 4H5TA 3ASMA 1LWFA 4KB0A 5FPNA 3FGUA 3E01A 3ZSQA 4LFBK 2HBJA 3RMAA 1QQNA 4CIFA 1VQ8N 3KK3A 3K59A 2ETJA 4JLHA 5E26A 3SAGA 5KQDA 4J2EA 3H1VX 3D2FA 1X9WA 4X62K 5MLCQ 4BDZA 4Z4FA 4FJNA 5EVZA 2WUSA 4I2QA 4G9ZA 3I56N 2E20A 1QE1A 1Y64A 4IO9L 3HRGA 2DPNA 2IOCA 4CJ4A 4KI4A 1KCFA 2W41A 1RTHA 3CI5A 1NMNA 4F4KA 1Q81O 4X65K 1HKCA 4F3OA 3VQ7A 4HUEA 2P9PB 3LP1A 1XMQK 1VSMA 2O8FB 1ATRA 3IDHA 3UIQA 1XQSC 3ZSZA 3THYB 2XHBA 1KFDA 3ULEA 2Q0UA 4CGIA 3VPZA 5GIPA 4WYBA 2F4VK 4DHYA 3KZBA 5DM6L 3RRHA 1C1CA 2BE2A 4Y1DA 3A2FA 3THXA 4U7BA 1U2VB 2B5JA 3VQCA 3MXIA 4CJ3A 2KFZA 3F9KA 1NK9A 4KHSA 3VQPA 4ID1A 3SZ2A 5E41A 3OBWA 4C8LA 3O08A 2OZMA 1JLAA 1TK8A 3O9SA 2V7YA 3TTFA 2CH6A 4J2AA 4BDPA 4GMJB 5HP1A 4O5FA 3TTCA 3TARA 3DLRA 3HPGA 2X78A 4JS5A 4CJ7A 5I42A 5HBMA 3M3ZA 3OYFA 4NYNA 3VEZA 4YNQA 4M3RA 3D2EB 4FJ9A 4M3TA 1A5XA 2PYLA 1JLQA 1VQ4N 4RW4A 5FPMA 3QEIA 4KHPK 3DRRA 3L2RA 1WUAA 4DQPA 3HOTA 5KGWA 2P9IB 4B9UA 3QDKA 3MECA 5AQHA 1TYQA 3VN5A 2FBYA 2QWLA 4X66K 2A1RA 4CF0A 5CZ1A 1RGIA 4GKKK 4E3SA 5F1XA 3A8YA 3SJHA 3RSEA 1FKOA 4IO8A 2ZM6K 2P9LB 4XH4A 4AF1A 4F8RA 1SQKA 3ENBA 4W5OA 3W3DA 3P39A 3H45C 2R7YA 3AGRA 1S5JA 5CZ2A 2W6LA 3SAFA 3AAPA 1XHZA 3JSMA 2YHXA 1T03A 3DOLA 1JL1A 4DQIA 4MO5A 3V1QA 2QI2A 2X6SA 4PY5A
chains in the Genus database with same CATH topology
4ELUA 4DF8A 3D0PA 1XHXA 3ISNC 4CJ5A 1ASWA 5C25A 3OYBA 4B9TA 2YNGA 4E1NA 1IH7A 1TV6A 1TKZA 3D45A 1C0MA 4I9LA 3OYLA 1JKHA 3NF7A 4N5SA 3MXMA 4F3TA 4Q5VA 4MQ3A 4N56A 4FJIA 1JXEA 1Y97A 3M8PA 4DTOA 2O4GA 2IAJA 4M3WA 3DYAA 4LSLA 1J9AA 4CECA 3AO5A 3ZT0A 4OLAA 1N5YA 1WSJA 1REVA 2ZE2A 4CJFA 2EX3A 4AILC 4CF9A 3M8QA 1X9SA 2NUBA 4LY7A 4OJRA 3HVRA 4PQUA 3AA2A 3L8BA 3V1OA 1S9EA 2Y1IA 3VA3A 1B9FA 3KLFA 2Z1GA 2HVIA 3RMDA 1IKYA 2DY4A 1SV5A 3CG7A 1VK0A 2OA8A 1A5VA 1D9DA 4DTRA 2P5GA 3QETA 3C94A 3O4NA 3V6DA 3JYTA 1IKVA 4FK4A 4IG0A 3VQBA 3SQ2A 4M3XA 2RKIA 3IS9A 1MU2A 2Z1HA 3ALYA 4RW8A 4FYDA 1B92A 2YHAA 2HHQA 1JXBA 5I3UA 3BDPA 4I2PA 3VQDA 4FLYA 4DS4A 3AO4A 3V9ZA 2ZD1A 1XWLA 5C42A 5FRNA 1HNVA 3AVCA 2GBZA 3HP9A 3CM5A 5JS1A 1C6VA 4QOZB 1WSHA 3PX4A 4CK1A 3KJVA 1RTDA 4OLBA 4AHCA 1NK8A 1RDAA 4IG3A 3OVNA 4FCYA 4DFPA 1NK0A 1UOCA 4BE2A 4DQQA 4FJKA 3AVHA 4CJEA 1R0AA 2BDPA 3ZT4A 3SQ1A 3LP0A 1RBSA 4KHYA 1TL1A 3M8RA 4F2RA 3DLGA 4IKFA 3B6PA 4BDYA 3SUNA 4KPYA 4UQGA 4FZYA 2A1SA 3I0SA 3L3VA 1HMVA 3VQ4A 5T7BA 3NH2A 1T8EA 3AO2A 1S6QA 3V81A 5FRMA 4RW9A 1CXQA 3AVGA 4CJWA 1Q9YA 1RT4A 3AO1A 3O3GA 2XY5A 1RDDA 3RMBA 2G8KA 4N41A 1BIZA 2IGIA 4B3OA 1LWCA 3SUQA 3AVLA 3BGRA 1RCHA 1NOZA 2VWKA 4CEQA 1A5WA 3OY9A 5K14A 1BQNA 1UA0A 3HVTA 3S9HA 1NJYA 3PO4A 4N76A 1J54A 3WNGA 4FJMA 3OYMA 1JLEA 3OJSA 2VG5A 3FFIA 4PUOA 1TKDA 4DSIA 4FJ8A 3ZT3A 1T7PA 1WSFA 3AVMA 3C6UA 1VSEA 3NAEA 4FK2A 1RNHA 1U45A 4ELTA 1ASUA 4H4MA 3VQQA 2G8IA 1TVRA 4I9QA 3B6OA 2QKBA 3SI6A 4KTZA 4B08A 4IDKA 4CF2A 3T19A 3P83D 1S1TA 4HVJA 2JGUA 3AVFA 3O3FA 2DFHA 4B8AB 4DTJA 4H8KA 4M45A 1XI1A 4E19A 4Y1CA 4M3UA 2HB5A 1RTJA 4NCBA 4Z4EA 2YHBA 3G0ZA 3OYGA 1RBUA 4FJ7A 1RILA 4ZTJA 1L3UA 1S1UA 3NGZA 1KVAA 4Z0UA 1BISA 1D5AA 1WSIA 3AVKA 5CYMA 1UAXA 1NKEA 4KREA 2DTUA 3KK2A 3CFPA 3NDKA 3K5NA 2XY7A 1KVCA 1W9HA 4CESA 4OGEA 4PWDA 2O4IA 4CERA 3ULDA 3V4IA 4AHUA 3ITHA 4E7HA 4CJLA 1HNIA 5HRRA 5J2MA 1ZYQA 1N6QA 4J2DA 4O55A 3AVAA 3U3YA 4CK2A 1RT2A 4C8NA 2HHSA 3ZT1A 4KRFA 4C8MA 3PY8A 3AVBA 2GV9A 4KO0A 4CIEA 1LAVA 1ZBFA 3OYNA 4LD0A 4O0JA 4DTNA 3RR8A 2HW3A 3SPZA 1KFSA 1L3SA 3VQ9A 4AHSA 1EP4A 1VRUA 1L5UA 1EKEA 1NKCA 3RWUA 4CE9A 5EU7A 1HYZA 1LAWA 1HJRA 2YNIA 1L3VA 1O1WA 2RF2A 1JL2A 3TAMA 1LV5A 2IDOA 1D8YA 2G8HA 4HUFA 4B9SA 4CEOA 2BANA 3OS1A 4KAZA 3CYMA 4Z4HA 4CFCA 2GUIA 3K58A 1HQUA 3OYIA 1FKPA 1VSFA 2QXFA 3MEDA 5D3GA 2KZZA 4CGJA 1W0HA 4CGFA 5FDLA 4FLTA 3PV8A 2HHUA 1UWBA 3KKSA 3VQEA 2Y1JA 2D0CA 2F96A 3VQ6A 3F73A 1JLBA 3OYAA 4O0IA 3TI0A 3EYZA 3HT3A 4ICLA 4M41A 2HVHA 1QSYA 1J5OA 2OZSA 3QEWA 3HK2A 4EZ9A 4OKKA 3U3GA 4FLUA 1VSDA 5J2NA 1JLGA 4H4OA 4FM0A 4M3YA 5HRNA 4DQSA 3AO3A 1QSSA 1HYSA 4B9LA 4NCAA 1TKTA 4CEZA 4DTMA 4DSLA 4OKEA 1RT7A 3OYDA 1RBVA 3LZIA 4FJLA 3OYKA 5J2PA 4DSFA 3HXMA 1BL3A 2OPQA 1HQEA 1S1VA 3CFRA 3V9SA 2G8UA 3LAMA 4CJSA 3PUFA 3SQ4A 2D5RA 3LZJA 4BE1A 1JLFA 2JLEA 3RMCA 3LDSA 4M42A 1WN7A 5HLFA 1ASVA 1BCOA 3V1RA 1CZ9A 1HPZA 2Q3SA 3AVJA 3NF6A 1SKSA 4E7LA 5J2QA 4CCHA 1VSJA 3HPOA 2QK9A 3HSTB 3HM9A 4AHTA 4DWIA 4GVMA 4CJTA 4JRQA 4E89A 4DSEA 3SUPA 4QCLA 1QS4A 4O5BA 2YKMA 3NH1A 1TK5A 3V9UA 1ITGA 4JS4A 3NF9A 2Z1IA 3C95A 3SQ0A 2HNZA 2IC3A 4DU4A 1HYVA 4DU1A 3NE6A 3LWLA 4HCBA 1SUQA 3CM6A 2BGGA 4Q0BA 2FBXA 1SKWA 4FJHA 4BWJA 1B9DA 3LAKA 3QO9A 3SV3A 4E7JA 3AA4A 4KFBA 4C8OA 4NCGA 3S3OA 3LP3A 4BWMA 3ZCMA 4DLEA 3LP2A 4CHNA 1NKBA 2G8FA 4E0DA 1BCMA 1XC9A 2P51A 4F2SA 4N47A 4TSXA 3ZSWA 2HHWA 2E4LA 2EHGA 4CJUA 1UA1A 3U6FA 4LSNA 3HPHA 1BHLA 4IFVA 1FXXA 5SZTA 2ZQBA 4W5NA 2D0BA 1SL1A 1TK0A 4FJXA 1RTIA 3MXJA 3WNHA 1GOBA 3K5LA 2E6MA 3HO1A 1S1WA 3C6TA 3K5OA 3P1GA 1IO2A 4ELVA 3NGIA 1QQCA 2XRIA 4CFBA 4FLZA 3VQAA 5KGXA 1U4BA 4KHWA 4GW6A 2YKNA 1TL3A 1SL2A 3TAPA 1KSPA 1S9GA 4CJVA 1C0TA 4K8ZA 4Z4IA 3O4QA 3TAGA 3KTQA 4RW6A 3T1AA 3SPYA 3SJJA 3OYCA 4E7IA 4DFJA 1VSLA 4DS5A 2OPPA 1U47A 3NGYA 4FLVA 3DI6A 3MEEA 3L2VA 5KRTA 4WE1A 1TGOA 1BQMA 3ZSXA 3K5MA 3DOKA 4CEDA 2RN2A 1RT5A 4FM1A 5CYQA 1NK4A 1J53A 5FROA 3SCXA 4FK0A 3SUOA 3IAYA 4CGGA 3AVNA 4HTUA 3KLGA 1LWEA 4KTQA 1DTTA 1VSIA 4OVLA 1QHTA 4ZHRA 4JRPA 4C8KA 3K57A 5JS2A 3CFOA 3NHGA 1BI4A 1GOAA 1LW0A 2FC0A 3NH0A 4DU3A 1VRTA 4FVMA 1IG9A 3QNOA 3QEXA 3DLHA 4BE0A 2F8SA 3L2WA 3ZT2A 4FJ5A 1VSKA 4DFMA 1KVBA 1C1BA 1K6YA 1NK7A 3LALA 4L8RB 2KTQA 2KW4A 3H08A 4ID5A 5DK5A 4DMNA 1YVUA 1NJWA 4CHPA 2D0AA 4DQRA 1ZBLA 1ZBUA 1RDCA 3TAFA 1G15A 2WOMA 3AA5X 2OYQA 3EZ5A 3KD1E 2B6AA 3OYHA 3AA3A 3PO5A 1FK9A 3OS0A 3QLHA 4EZ6A 4CGDA 4QAGA 3ZSVA 1NOYA 1RT3A 2LSNA 5KI6A 4W5QA 3ASMA 1LWFA 1WAJA 3QINA 4B9MA 4KB0A 1U04A 4M3ZA 4OPJA 1NJZA 1I39A 3AV9A 3AVIA 1NJXA 3E01A 4CJRA 3ZSQA 4CIGA 1C0UA 3DM2A 1Z26A 3RMAA 1TAQA 1Q8IA 4CJKA 4CIFA 4DTPA 3KLHA 3DRPA 3KK3A 2X74A 3K59A 2ETJA 4DSKA 4JLHA 1T05A 3SYZA 2WONA 5J1EA 3O3HA 1KLMA 4J2EA 2DFEA 1X9WA 4BDZA 4Z4FA 1Z25A 1BI4B 3OYEA 2HMIA 4FJNA 2FBVA 5CY4A 1TKXA 1F21A 3LANA 4FW2A 3WNEA 4I2QA 1EX4A 3I8DA 2ITGA 4FJJA 1RT6A 1QE1A 3V9XA 1JLCA 2KQ2A 3QNNA 4KHNA 4B9NA 3RR7A 4PA1A 2IOCA 4AHRA 4CJ4A 1CXUA 3TR8A 3TANA 4KB1A 4OKJA 4CF8A 1YTAA 4YFUA 4KI4A 1KCFA 4HUGA 4OPKA 1DLOA 3QEPA 1RTHA 4R5PA 4KHUA 2YNHA 4FZXC 3S3MA 3LPTA 4F4KA 2VG6A 2HNYA 4B9VA 4F3OA 3VQ7A 4HUEA 3LP1A 1X1PA 4Z4CA 1QSLA 1VSMA 3DLBA 5KTQA 4CHZA 4B8CA 1HRHA 4ZTFA 3DRSA 4DLGA 3MEGA 3QESA 4EP4A 1ZBHA 3UIQA 4HHTA 3NF8A 3ZSZA 3KLIA 1RDBA 3LPUA 4CGHA 1EXQA 1WLJA 1S1XA 2RPIA 1KFDA 3L2QA 2XHBA 3PX6A 2FBTA 4CGIA 4MFBA 2XY6A 4CHQA 3L2UA 1BGXT 1L3TA 3RRGA 4K8XA 1Q9XA 3HJFA 3RRHA 4CEEA 2G8WA 3HYFA 2PZSA 1C1CA 1ZBIA 3KKRA 1C1AA 2BE2A 3A2FA 4Y1DA 3ZSOA 3QIPA 2HHXA 2B4JA 4IFYA 2B5JA 2PY5A 3VQCA 3MXIA 4CJ3A 2KFZA 2X6NA 4E1MA 2I5JA 4KV8A 3F9KA 3QIOA 4LH5A 2VWJA 1NK9A 2HHVA 5HRSA 4KHSA 1RBRA 3VQPA 4ID1A 3IRXA 2ATQA 1BIUA 3SZ2A 3I0RA 5E41A 1NK5A 4FZZA 2P5OA 3MAQA 3SV4A 5SWMA 4C8LA 4IBNA 3M8SA 1KTQA 1JLAA 3OJUA 1TK8A 2OZMA 3IG1A 3OYJA 4J2AA 3HP6A 1GOCA 3VQ8A 4BDPA 1I3AA 3DMJA 4GMJB 4AHVA 3PX0A 5HP1A 4Z4GA 4RG8A 2G8VA 1DTQA 3TARA 3DLRA 4FM2A 1WSEA 3HPGA 2X78A 1NK6A 4JS5A 2YV0X 4AH9A 5I42A 5HBMA 3G10A 3T3FA 2HHTA 1CZBA 2XO7A 4XIUA 4DG1A 3OYFA 1U49A 4J2BA 4NYNA 2HNDA 4YNQA 4M3RA 3NBPA 1SKRA 3TABA 4FJ9A 4M3TA 3NCIA 1A5XA 1VSHA 2DFFA 2PYLA 4CFDA 3QERA 1JLQA 3KIOA 4G1QA 4RW4A 3QEIA 1LW2A 3VA0A 1U48A 1X9MA 3DRRA 3L2RA 3RTVA 4RW7A 2E6LA 4FLXA 1SL0A 1D9FA 1RBTA 3DLKA 4DQPA 4KI6A 2XY8A 5DMRA 3KLEA 3DLEA 5KGWA 4CEAA 4EP5A 4OGCA 4B9UA 3THVA 3ZSRA 1WSGA 4DSJA 3MECA 4DTUA 4DF4A 3VQ5A 3VN5A 4CHOA 2FBYA 4O44A 2A1RA 2PYJA 4CF0A 3SNNA 2IS3A 5CZ1A 3TAQA 2OPSA 4BACA 4CJQA 3S3NA 4E3SA 2YNFA 2VG7A 4FJGA 3K2PA 5C24A 3OS2A 1FKOA 1WAFA 3LWMA 4CHYA 1YTUA 4KKOA 4CF1A 5HROA 2AJQA 4CEFA 4F8RA 4KHQA 3TWHA 1KRPA 4W5OA 4FW1A 4I7FA 2QKKA 4DFKA 1RT1A 3QEVA 4HCCA 1EETA 2KFNA 2F8TA 4W5RA 4CJPA 4FLWA 3NFAA 1TAUA 1KLNA 1IKXA 3ZSYA 1CLQA 2R7YA 4W5TA 1S5JA 1WNSA 4FXDA 1IKWA 5CZ2A 2KZMA 2Z1JA 4CEBA 3CQ8A 3EY1A 2P1JA 3L3UA 1XHZA 2OPRA 3P5JA 5HRPA 3KK1A 5KRSA 3V9WA 4KTWA 3JSMA 4CFAA 4CK3A 4NYFA 1T03A 3DOLA 1S6PA 1JL1A 4DTXA 4DQIA 3V1QA 4DTSA 2W42A 4LH4A 4E7KA 1QTMA 3TAEA 2X6SA 1YT3A 4O4GA 3HL8A 3WNFA 4PY5A 3KD5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELU A;  4DF8 A;  3D0P A;  1XHX A;  3ISN C;  4CJ5 A;  1ASW A;  5C25 A;  3OYB A;  4B9T A;  2YNG A;  4E1N A;  1IH7 A;  1TV6 A;  1TKZ A;  3D45 A;  1C0M A;  4I9L A;  3OYL A;  1JKH A;  3NF7 A;  4N5S A;  3MXM A;  4F3T A;  4Q5V A;  4MQ3 A;  4N56 A;  4FJI A;  1JXE A;  1Y97 A;  3M8P A;  4DTO A;  2O4G A;  2IAJ A;  4M3W A;  3DYA A;  4LSL A;  1J9A A;  4CEC A;  3AO5 A;  3ZT0 A;  4OLA A;  1N5Y A;  1WSJ A;  1REV A;  2ZE2 A;  4CJF A;  2EX3 A;  4AIL C;  4CF9 A;  3M8Q A;  1X9S A;  2NUB A;  4LY7 A;  4OJR A;  3HVR A;  4PQU A;  3AA2 A;  3L8B A;  3V1O A;  1S9E A;  2Y1I A;  3VA3 A;  1B9F A;  3KLF A;  2Z1G A;  2HVI A;  3RMD A;  1IKY A;  2DY4 A;  1SV5 A;  3CG7 A;  1VK0 A;  2OA8 A;  1A5V A;  1D9D A;  4DTR A;  2P5G A;  3QET A;  3C94 A;  3O4N A;  3V6D A;  3JYT A;  1IKV A;  4FK4 A;  4IG0 A;  3VQB A;  3SQ2 A;  4M3X A;  2RKI A;  3IS9 A;  1MU2 A;  2Z1H A;  3ALY A;  4RW8 A;  4FYD A;  1B92 A;  2YHA A;  2HHQ A;  1JXB A;  5I3U A;  3BDP A;  4I2P A;  3VQD A;  4FLY A;  4DS4 A;  3AO4 A;  3V9Z A;  2ZD1 A;  1XWL A;  5C42 A;  5FRN A;  1HNV A;  3AVC A;  2GBZ A;  3HP9 A;  3CM5 A;  5JS1 A;  1C6V A;  4QOZ B;  1WSH A;  3PX4 A;  4CK1 A;  3KJV A;  1RTD A;  4OLB A;  4AHC A;  1NK8 A;  1RDA A;  4IG3 A;  3OVN A;  4FCY A;  4DFP A;  1NK0 A;  1UOC A;  4BE2 A;  4DQQ A;  4FJK A;  3AVH A;  4CJE A;  1R0A A;  2BDP A;  3ZT4 A;  3SQ1 A;  3LP0 A;  1RBS A;  4KHY A;  1TL1 A;  3M8R A;  4F2R A;  3DLG A;  4IKF A;  3B6P A;  4BDY A;  3SUN A;  4KPY A;  4UQG A;  4FZY A;  2A1S A;  3I0S A;  3L3V A;  1HMV A;  3VQ4 A;  5T7B A;  3NH2 A;  1T8E A;  3AO2 A;  1S6Q A;  3V81 A;  5FRM A;  4RW9 A;  1CXQ A;  3AVG A;  4CJW A;  1Q9Y A;  1RT4 A;  3AO1 A;  3O3G A;  2XY5 A;  1RDD A;  3RMB A;  2G8K A;  4N41 A;  1BIZ A;  2IGI A;  4B3O A;  1LWC A;  3SUQ A;  3AVL A;  3BGR A;  1RCH A;  1NOZ A;  2VWK A;  4CEQ A;  1A5W A;  3OY9 A;  5K14 A;  1BQN A;  1UA0 A;  3HVT A;  3S9H A;  1NJY A;  3PO4 A;  4N76 A;  1J54 A;  3WNG A;  4FJM A;  3OYM A;  1JLE A;  3OJS A;  2VG5 A;  3FFI A;  4PUO A;  1TKD A;  4DSI A;  4FJ8 A;  3ZT3 A;  1T7P A;  1WSF A;  3AVM A;  3C6U A;  1VSE A;  3NAE A;  4FK2 A;  1RNH A;  1U45 A;  4ELT A;  1ASU A;  4H4M A;  3VQQ A;  2G8I A;  1TVR A;  4I9Q A;  3B6O A;  2QKB A;  3SI6 A;  4KTZ A;  4B08 A;  4IDK A;  4CF2 A;  3T19 A;  3P83 D;  1S1T A;  4HVJ A;  2JGU A;  3AVF A;  3O3F A;  2DFH A;  4B8A B;  4DTJ A;  4H8K A;  4M45 A;  1XI1 A;  4E19 A;  4Y1C A;  4M3U A;  2HB5 A;  1RTJ A;  4NCB A;  4Z4E A;  2YHB A;  3G0Z A;  3OYG A;  1RBU A;  4FJ7 A;  1RIL A;  4ZTJ A;  1L3U A;  1S1U A;  3NGZ A;  1KVA A;  4Z0U A;  1BIS A;  1D5A A;  1WSI A;  3AVK A;  5CYM A;  1UAX A;  1NKE A;  4KRE A;  2DTU A;  3KK2 A;  3CFP A;  3NDK A;  3K5N A;  2XY7 A;  1KVC A;  1W9H A;  4CES A;  4OGE A;  4PWD A;  2O4I A;  4CER A;  3ULD A;  3V4I A;  4AHU A;  3ITH A;  4E7H A;  4CJL A;  1HNI A;  5HRR A;  5J2M A;  1ZYQ A;  1N6Q A;  4J2D A;  4O55 A;  3AVA A;  3U3Y A;  4CK2 A;  1RT2 A;  4C8N A;  2HHS A;  3ZT1 A;  4KRF A;  4C8M A;  3PY8 A;  3AVB A;  2GV9 A;  4KO0 A;  4CIE A;  1LAV A;  1ZBF A;  3OYN A;  4LD0 A;  4O0J A;  4DTN A;  3RR8 A;  2HW3 A;  3SPZ A;  1KFS A;  1L3S A;  3VQ9 A;  4AHS A;  1EP4 A;  1VRU A;  1L5U A;  1EKE A;  1NKC A;  3RWU A;  4CE9 A;  5EU7 A;  1HYZ A;  1LAW A;  1HJR A;  2YNI A;  1L3V A;  1O1W A;  2RF2 A;  1JL2 A;  3TAM A;  1LV5 A;  2IDO A;  1D8Y A;  2G8H A;  4HUF A;  4B9S A;  4CEO A;  2BAN A;  3OS1 A;  4KAZ A;  3CYM A;  4Z4H A;  4CFC A;  2GUI A;  3K58 A;  1HQU A;  3OYI A;  1FKP A;  1VSF A;  2QXF A;  3MED A;  5D3G A;  2KZZ A;  4CGJ A;  1W0H A;  4CGF A;  5FDL A;  4FLT A;  3PV8 A;  2HHU A;  1UWB A;  3KKS A;  3VQE A;  2Y1J A;  2D0C A;  2F96 A;  3VQ6 A;  3F73 A;  1JLB A;  3OYA A;  4O0I A;  3TI0 A;  3EYZ A;  3HT3 A;  4ICL A;  4M41 A;  2HVH A;  1QSY A;  1J5O A;  2OZS A;  3QEW A;  3HK2 A;  4EZ9 A;  4OKK A;  3U3G A;  4FLU A;  1VSD A;  5J2N A;  1JLG A;  4H4O A;  4FM0 A;  4M3Y A;  5HRN A;  4DQS A;  3AO3 A;  1QSS A;  1HYS A;  4B9L A;  4NCA A;  1TKT A;  4CEZ A;  4DTM A;  4DSL A;  4OKE A;  1RT7 A;  3OYD A;  1RBV A;  3LZI A;  4FJL A;  3OYK A;  5J2P A;  4DSF A;  3HXM A;  1BL3 A;  2OPQ A;  1HQE A;  1S1V A;  3CFR A;  3V9S A;  2G8U A;  3LAM A;  4CJS A;  3PUF A;  3SQ4 A;  2D5R A;  3LZJ A;  4BE1 A;  1JLF A;  2JLE A;  3RMC A;  3LDS A;  4M42 A;  1WN7 A;  5HLF A;  1ASV A;  1BCO A;  3V1R A;  1CZ9 A;  1HPZ A;  2Q3S A;  3AVJ A;  3NF6 A;  1SKS A;  4E7L A;  5J2Q A;  4CCH A;  1VSJ A;  3HPO A;  2QK9 A;  3HST B;  3HM9 A;  4AHT A;  4DWI A;  4GVM A;  4CJT A;  4JRQ A;  4E89 A;  4DSE A;  3SUP A;  4QCL A;  1QS4 A;  4O5B A;  2YKM A;  3NH1 A;  1TK5 A;  3V9U A;  1ITG A;  4JS4 A;  3NF9 A;  2Z1I A;  3C95 A;  3SQ0 A;  2HNZ A;  2IC3 A;  4DU4 A;  1HYV A;  4DU1 A;  3NE6 A;  3LWL A;  4HCB A;  1SUQ A;  3CM6 A;  2BGG A;  4Q0B A;  2FBX A;  1SKW A;  4FJH A;  4BWJ A;  1B9D A;  3LAK A;  3QO9 A;  3SV3 A;  4E7J A;  3AA4 A;  4KFB A;  4C8O A;  4NCG A;  3S3O A;  3LP3 A;  4BWM A;  3ZCM A;  4DLE A;  3LP2 A;  4CHN A;  1NKB A;  2G8F A;  4E0D A;  1BCM A;  1XC9 A;  2P51 A;  4F2S A;  4N47 A;  4TSX A;  3ZSW A;  2HHW A;  2E4L A;  2EHG A;  4CJU A;  1UA1 A;  3U6F A;  4LSN A;  3HPH A;  1BHL A;  4IFV A;  1FXX A;  5SZT A;  2ZQB A;  4W5N A;  2D0B A;  1SL1 A;  1TK0 A;  4FJX A;  1RTI A;  3MXJ A;  3WNH A;  1GOB A;  3K5L A;  2E6M A;  3HO1 A;  1S1W A;  3C6T A;  3K5O A;  3P1G A;  1IO2 A;  4ELV A;  3NGI A;  1QQC A;  2XRI A;  4CFB A;  4FLZ A;  3VQA A;  5KGX A;  1U4B A;  4KHW A;  4GW6 A;  2YKN A;  1TL3 A;  1SL2 A;  3TAP A;  1KSP A;  1S9G A;  4CJV A;  1C0T A;  4K8Z A;  4Z4I A;  3O4Q A;  3TAG A;  3KTQ A;  4RW6 A;  3T1A A;  3SPY A;  3SJJ A;  3OYC A;  4E7I A;  4DFJ A;  1VSL A;  4DS5 A;  2OPP A;  1U47 A;  3NGY A;  4FLV A;  3DI6 A;  3MEE A;  3L2V A;  5KRT A;  4WE1 A;  1TGO A;  1BQM A;  3ZSX A;  3K5M A;  3DOK A;  4CED A;  2RN2 A;  1RT5 A;  4FM1 A;  5CYQ A;  1NK4 A;  1J53 A;  5FRO A;  3SCX A;  4FK0 A;  3SUO A;  3IAY A;  4CGG A;  3AVN A;  4HTU A;  3KLG A;  1LWE A;  4KTQ A;  1DTT A;  1VSI A;  4OVL A;  1QHT A;  4ZHR A;  4JRP A;  4C8K A;  3K57 A;  5JS2 A;  3CFO A;  3NHG A;  1BI4 A;  1GOA A;  1LW0 A;  2FC0 A;  3NH0 A;  4DU3 A;  1VRT A;  4FVM A;  1IG9 A;  3QNO A;  3QEX A;  3DLH A;  4BE0 A;  2F8S A;  3L2W A;  3ZT2 A;  4FJ5 A;  1VSK A;  4DFM A;  1KVB A;  1C1B A;  1K6Y A;  1NK7 A;  3LAL A;  4L8R B;  2KTQ A;  2KW4 A;  3H08 A;  4ID5 A;  5DK5 A;  4DMN A;  1YVU A;  1NJW A;  4CHP A;  2D0A A;  4DQR A;  1ZBL A;  1ZBU A;  1RDC A;  3TAF A;  1G15 A;  2WOM A;  3AA5 X;  2OYQ A;  3EZ5 A;  3KD1 E;  2B6A A;  3OYH A;  3AA3 A;  3PO5 A;  1FK9 A;  3OS0 A;  3QLH A;  4EZ6 A;  4CGD A;  4QAG A;  3ZSV A;  1NOY A;  1RT3 A;  2LSN A;  5KI6 A;  4W5Q A;  3ASM A;  1LWF A;  1WAJ A;  3QIN A;  4B9M A;  4KB0 A;  1U04 A;  4M3Z A;  4OPJ A;  1NJZ A;  1I39 A;  3AV9 A;  3AVI A;  1NJX A;  3E01 A;  4CJR A;  3ZSQ A;  4CIG A;  1C0U A;  3DM2 A;  1Z26 A;  3RMA A;  1TAQ A;  1Q8I A;  4CJK A;  4CIF A;  4DTP A;  3KLH A;  3DRP A;  3KK3 A;  2X74 A;  3K59 A;  2ETJ A;  4DSK A;  4JLH A;  1T05 A;  3SYZ A;  2WON A;  5J1E A;  3O3H A;  1KLM A;  4J2E A;  2DFE A;  1X9W A;  4BDZ A;  4Z4F A;  1Z25 A;  1BI4 B;  3OYE A;  2HMI A;  4FJN A;  2FBV A;  5CY4 A;  1TKX A;  1F21 A;  3LAN A;  4FW2 A;  3WNE A;  4I2Q A;  1EX4 A;  3I8D A;  2ITG A;  4FJJ A;  1RT6 A;  1QE1 A;  3V9X A;  1JLC A;  2KQ2 A;  3QNN A;  4KHN A;  4B9N A;  3RR7 A;  4PA1 A;  2IOC A;  4AHR A;  4CJ4 A;  1CXU A;  3TR8 A;  3TAN A;  4KB1 A;  4OKJ A;  4CF8 A;  1YTA A;  4YFU A;  4KI4 A;  1KCF A;  4HUG A;  4OPK A;  1DLO A;  3QEP A;  1RTH A;  4R5P A;  4KHU A;  2YNH A;  4FZX C;  3S3M A;  3LPT A;  4F4K A;  2VG6 A;  2HNY A;  4B9V A;  4F3O A;  3VQ7 A;  4HUE A;  3LP1 A;  1X1P A;  4Z4C A;  1QSL A;  1VSM A;  3DLB A;  5KTQ A;  4CHZ A;  4B8C A;  1HRH A;  4ZTF A;  3DRS A;  4DLG A;  3MEG A;  3QES A;  4EP4 A;  1ZBH A;  3UIQ A;  4HHT A;  3NF8 A;  3ZSZ A;  3KLI A;  1RDB A;  3LPU A;  4CGH A;  1EXQ A;  1WLJ A;  1S1X A;  2RPI A;  1KFD A;  3L2Q A;  2XHB A;  3PX6 A;  2FBT A;  4CGI A;  4MFB A;  2XY6 A;  4CHQ A;  3L2U A;  1BGX T;  1L3T A;  3RRG A;  4K8X A;  1Q9X A;  3HJF A;  3RRH A;  4CEE A;  2G8W A;  3HYF A;  2PZS A;  1C1C A;  1ZBI A;  3KKR A;  1C1A A;  2BE2 A;  3A2F A;  4Y1D A;  3ZSO A;  3QIP A;  2HHX A;  2B4J A;  4IFY A;  2B5J A;  2PY5 A;  3VQC A;  3MXI A;  4CJ3 A;  2KFZ A;  2X6N A;  4E1M A;  2I5J A;  4KV8 A;  3F9K A;  3QIO A;  4LH5 A;  2VWJ A;  1NK9 A;  2HHV A;  5HRS A;  4KHS A;  1RBR A;  3VQP A;  4ID1 A;  3IRX A;  2ATQ A;  1BIU A;  3SZ2 A;  3I0R A;  5E41 A;  1NK5 A;  4FZZ A;  2P5O A;  3MAQ A;  3SV4 A;  5SWM A;  4C8L A;  4IBN A;  3M8S A;  1KTQ A;  1JLA A;  3OJU A;  1TK8 A;  2OZM A;  3IG1 A;  3OYJ A;  4J2A A;  3HP6 A;  1GOC A;  3VQ8 A;  4BDP A;  1I3A A;  3DMJ A;  4GMJ B;  4AHV A;  3PX0 A;  5HP1 A;  4Z4G A;  4RG8 A;  2G8V A;  1DTQ A;  3TAR A;  3DLR A;  4FM2 A;  1WSE A;  3HPG A;  2X78 A;  1NK6 A;  4JS5 A;  2YV0 X;  4AH9 A;  5I42 A;  5HBM A;  3G10 A;  3T3F A;  2HHT A;  1CZB A;  2XO7 A;  4XIU A;  4DG1 A;  3OYF A;  1U49 A;  4J2B A;  4NYN A;  2HND A;  4YNQ A;  4M3R A;  3NBP A;  1SKR A;  3TAB A;  4FJ9 A;  4M3T A;  3NCI A;  1A5X A;  1VSH A;  2DFF A;  2PYL A;  4CFD A;  3QER A;  1JLQ A;  3KIO A;  4G1Q A;  4RW4 A;  3QEI A;  1LW2 A;  3VA0 A;  1U48 A;  1X9M A;  3DRR A;  3L2R A;  3RTV A;  4RW7 A;  2E6L A;  4FLX A;  1SL0 A;  1D9F A;  1RBT A;  3DLK A;  4DQP A;  4KI6 A;  2XY8 A;  5DMR A;  3KLE A;  3DLE A;  5KGW A;  4CEA A;  4EP5 A;  4OGC A;  4B9U A;  3THV A;  3ZSR A;  1WSG A;  4DSJ A;  3MEC A;  4DTU A;  4DF4 A;  3VQ5 A;  3VN5 A;  4CHO A;  2FBY A;  4O44 A;  2A1R A;  2PYJ A;  4CF0 A;  3SNN A;  2IS3 A;  5CZ1 A;  3TAQ A;  2OPS A;  4BAC A;  4CJQ A;  3S3N A;  4E3S A;  2YNF A;  2VG7 A;  4FJG A;  3K2P A;  5C24 A;  3OS2 A;  1FKO A;  1WAF A;  3LWM A;  4CHY A;  1YTU A;  4KKO A;  4CF1 A;  5HRO A;  2AJQ A;  4CEF A;  4F8R A;  4KHQ A;  3TWH A;  1KRP A;  4W5O A;  4FW1 A;  4I7F A;  2QKK A;  4DFK A;  1RT1 A;  3QEV A;  4HCC A;  1EET A;  2KFN A;  2F8T A;  4W5R A;  4CJP A;  4FLW A;  3NFA A;  1TAU A;  1KLN A;  1IKX A;  3ZSY A;  1CLQ A;  2R7Y A;  4W5T A;  1S5J A;  1WNS A;  4FXD A;  1IKW A;  5CZ2 A;  2KZM A;  2Z1J A;  4CEB A;  3CQ8 A;  3EY1 A;  2P1J A;  3L3U A;  1XHZ A;  2OPR A;  3P5J A;  5HRP A;  3KK1 A;  5KRS A;  3V9W A;  4KTW A;  3JSM A;  4CFA A;  4CK3 A;  4NYF A;  1T03 A;  3DOL A;  1S6P A;  1JL1 A;  4DTX A;  4DQI A;  3V1Q A;  4DTS A;  2W42 A;  4LH4 A;  4E7K A;  1QTM A;  3TAE A;  2X6S A;  1YT3 A;  4O4G A;  3HL8 A;  3WNF A;  4PY5 A;  3KD5 E; 
#chains in the Genus database with same CATH topology
 3O1B A;  5CE3 A;  3ISN C;  4CJ5 A;  3C0B A;  1NNE A;  4E1N A;  3D45 A;  3MXM A;  1TKZ A;  3O5B A;  5GAE P;  1NK4 A;  4N5S A;  4F3T A;  4Q5V A;  4FJI A;  2RHK A;  1NGJ A;  3WXJ A;  4EHT A;  3OA9 A;  4JI5 K;  4BRO A;  3MCA B;  3T1H K;  1WSJ A;  5CHI A;  3M8Q A;  2NUB A;  4LY7 A;  3HVR A;  2Q36 A;  4GVE A;  4WQ4 C;  4Z94 A;  5KPT A;  4WFA L;  1HUX A;  3KLF A;  2HVI A;  1YJW N;  3WXI A;  3F9M A;  3O80 A;  3G6E N;  1S3X A;  3CCS N;  4GY2 B;  5AZI A;  1RDW X;  2VGM A;  3BDP A;  3AO4 A;  1NGA A;  1NGD A;  2GTD A;  4JI6 K;  1XWL A;  5C42 A;  2A6A A;  5AQZ A;  5FRN A;  4QOZ B;  2ZJQ L;  3PX4 A;  4OLB A;  4AHC A;  1YIT N;  1RDA A;  3ATU A;  3CCM N;  4DFP A;  1UOC A;  3TU5 A;  4CJE A;  3RVC A;  5AQW A;  3EN9 A;  3LP0 A;  5M1K A;  4KHY A;  3DLG A;  3B6P A;  3Q7C A;  2E1Y A;  3R1X A;  2UXD K;  5T7B A;  1HMV A;  4X64 K;  4CZH A;  4O8K A;  4CI6 A;  1S6Q A;  4BC5 A;  3CER A;  1CXQ A;  3O3G A;  4N41 A;  1RDD A;  4ISG A;  4JKD A;  1JJ2 M;  2VCP A;  1N33 K;  4BGB A;  1W7A A;  1NOZ A;  2VWK A;  1A5W A;  3OY9 A;  5K14 A;  3G71 N;  5FLX O;  3FFI A;  2HF3 A;  1VSE A;  4C23 A;  2QA4 N;  4ELT A;  3MWP A;  2BH1 A;  3SI6 A;  4HVJ A;  4B8A B;  3ZEU A;  4E19 A;  4JV5 K;  4M3U A;  2HB5 A;  1RTJ A;  2ITM A;  4NCB A;  4Z4E A;  3CHW A;  2YHB A;  4K43 A;  1ZBS A;  1RBU A;  4A2B A;  2YHW A;  1WSI A;  1LCU A;  1UAX A;  1NKE A;  3NDK A;  1KVC A;  1W9H A;  4CES A;  4DV1 K;  4OGE A;  4H0O A;  2UUB K;  4MDB A;  5AQG A;  4LFA K;  3ULD A;  3V4I A;  2UXB K;  5JIC A;  5J2M A;  4H03 B;  4I6M B;  4DB3 A;  2BTF A;  1XNR K;  4DR6 K;  2HHS A;  3PY8 A;  2VQE K;  4CIE A;  1WBD A;  1GLL O;  1XNQ K;  4DTN A;  3RR8 A;  1X3N A;  5A2Q O;  4H5V A;  4BGA A;  1E3M A;  2GEM A;  1EP4 A;  1L5U A;  1EKE A;  1NKC A;  1L3V A;  1HJR A;  3TAM A;  1JL2 A;  2ASM A;  2IDO A;  4HUF A;  3UKU A;  4B9S A;  4KAZ A;  3MMV A;  2GUI A;  5DM7 L;  5EOY A;  1HQU A;  3OYI A;  1FKP A;  3FZH A;  4NXN K;  2ZF5 O;  2H3G X;  3VGM A;  3OTO K;  3Q7B A;  1OH7 A;  3I8B A;  5BPM A;  3OYA A;  5H1S Q;  3B8A X;  3FZK A;  1J5O A;  4JKB A;  2OZS A;  4OKK A;  3U3G A;  1VSD A;  4H4O A;  4DQS A;  3AO3 A;  1HYS A;  3CJA A;  1RT7 A;  1HNX K;  1W97 L;  3OYK A;  1VQK N;  1HQE A;  4CJS A;  2NRW A;  3CC7 N;  2UU9 K;  1K8K A;  3H46 O;  1HPZ A;  3NF6 A;  4KH5 A;  1SKS A;  4BRG A;  4CCH A;  1VSJ A;  3HST B;  3HM9 A;  4E89 A;  2AA4 A;  5AQI A;  3V9U A;  3VES A;  3SQ0 A;  3NE6 A;  3LDP A;  5C10 A;  1WB9 A;  5AQM A;  4BWJ A;  3QO9 A;  5AQS A;  3AA4 A;  4KFB A;  1NBW A;  4BWM A;  1TUU A;  3LP2 A;  3ZYY X;  4F2S A;  2P51 A;  2HHW A;  5E84 A;  4N47 A;  4CJU A;  3U6F A;  4IFV A;  5AQR A;  1DEJ A;  3ZX2 A;  2UYT A;  3A5M C;  4FJX A;  1RTI A;  3MXJ A;  3WNH A;  1GOB A;  1RFQ A;  2E2P A;  3HO1 A;  3P1G A;  1IO2 A;  1NGI A;  4CBW A;  1T6D A;  1J6Z A;  1KXP A;  2QWQ A;  3TAP A;  4CJV A;  1C0T A;  3O1W A;  3MWT A;  3SLC A;  3KTQ A;  3T1A A;  4E7I A;  4DFJ A;  1U47 A;  3ULE B;  1KQS M;  3DI6 A;  4BC4 A;  5KRT A;  2GWJ A;  1TGO A;  3J80 O;  1HKB A;  3SUO A;  5BRF A;  1DTT A;  1VSI A;  2VQF K;  4JK9 A;  3VEW A;  3K57 A;  3IMX A;  5JS2 A;  3CFO A;  1BG3 A;  1BI4 A;  1GOA A;  2FC0 A;  3NHG A;  4DU3 A;  3H3N O;  4BE0 A;  3MN5 A;  5HL7 L;  4FJ5 A;  4DFM A;  1C1B A;  2KTQ A;  2KW4 A;  1GLD G;  4XH5 A;  4DV5 K;  2D0A A;  2NZT A;  3E9L A;  3HTV A;  3AA5 X;  1J5E K;  2OYQ A;  3KD1 E;  3OYH A;  2ASO A;  1VQ6 N;  2OAN A;  1NGC A;  2CGK A;  4FL9 A;  1U04 A;  3KK7 A;  1FJG K;  1NJZ A;  4CJR A;  1YI2 N;  1Z26 A;  3J7A P;  1Q8I A;  2FLO A;  2UUC K;  3AAQ A;  2X74 A;  1TYQ B;  4FWK A;  4DSK A;  4JKE A;  2NRX A;  4PL8 A;  1T05 A;  5J1E A;  1Q86 O;  2HF4 A;  2HMI A;  3ID8 A;  3SBG A;  2GWK A;  3I8D A;  2ITG A;  3SBT A;  1RT6 A;  3DAW A;  4LF6 K;  2QXL A;  3ENO A;  4LF8 K;  3ATV A;  3QNN A;  4B9N A;  4PA1 A;  5FPD A;  3TAN A;  4KB1 A;  4OKJ A;  4MLE A;  1YTA A;  4CF8 A;  5C15 A;  4YFU A;  2V51 B;  1DLO A;  4OPK A;  1NG9 A;  4BQZ A;  4KHU A;  1ESV A;  4JNE A;  4A62 A;  2HNY A;  4B9V A;  3A5O C;  3DXK A;  1QSL A;  5KTQ A;  4DR4 K;  1NGB A;  4B8C A;  3MEG A;  1BOT O;  1ZBH A;  2E2N A;  4O8U A;  2GUP A;  4CGH A;  2O8D A;  1WLJ A;  3QML A;  3L2Q A;  1N32 K;  4MFB A;  3AGK A;  3L2U A;  1L3T A;  3O8M A;  4H0V B;  4B1X B;  4CEE A;  2G8W A;  2PZS A;  1C1A A;  4WFB L;  1D4X A;  5BN8 A;  2HHX A;  2B4J A;  4IFY A;  2PY5 A;  2X6N A;  4ISF A;  2I5J A;  4KV8 A;  3QIO A;  5AQU A;  2VWJ A;  2HHV A;  4LF7 K;  4OX9 K;  5HRS A;  4R79 A;  4JD2 A;  3IRX A;  3VEV A;  1QQM A;  3A5L C;  2P5O A;  3SV4 A;  3MN9 A;  4DUZ K;  3DLL L;  3M8S A;  4FSV A;  5FPE A;  2HBL A;  4ILG B;  3PX0 A;  3M6G A;  4AHV A;  2A3Z A;  1WSE A;  4FM2 A;  1NK6 A;  4CZE A;  2XO7 A;  1QZ6 A;  3N4Q A;  4XIU A;  5JLH A;  4J2B A;  2P9K A;  3ZLJ A;  2BUP A;  2OCE A;  3TAB A;  2DFF A;  2F7T A;  4CFD A;  3QER A;  4FOE A;  3CME N;  4RW7 A;  2E6L A;  4IDH A;  1RBT A;  3DLK A;  2E88 A;  4KI6 A;  5DMR A;  2WTU A;  1VQ5 N;  4CEA A;  4EP5 A;  3THV A;  3ZSR A;  1RDU A;  4DF4 A;  3VET A;  5M1N A;  3T7Z A;  3N4P A;  3SNN A;  2QM1 A;  4CZL A;  2YJF A;  2OPS A;  3S3N A;  4FWM A;  1QVF M;  4CHY A;  2Q97 A;  2AJQ A;  4CF1 A;  5AQJ A;  4DFK A;  1RT1 A;  4HCC A;  4W5R A;  1NGH A;  1KLN A;  3UKR A;  1WNS A;  4CEB A;  3EY1 A;  2OPR A;  5HRP A;  3KK1 A;  3CCU N;  4CFA A;  4NYF A;  2E8A A;  4DTS A;  4KBO A;  4E7K A;  2QWP A;  3HL8 A;  4IFE A;  4CZF A;  3CC4 N;  3BZK A;  4B9T A;  2YNG A;  3VOV A;  1IH7 A;  1C0M A;  3AAR A;  2VWB A;  3NF7 A;  3WEE A;  2I7N A;  4MQ3 A;  3KWG A;  1Y97 A;  3M8P A;  4M7Y A;  3U9Z A;  3NVM A;  2O4G A;  3DYA A;  4OLA A;  1V4S A;  1REV A;  3CPE A;  2EX3 A;  2YCH A;  1HNZ K;  1YAG A;  1X9S A;  4OJR A;  4PQU A;  3AA2 A;  3DWL A;  2D0P A;  2Z1G A;  1IKY A;  1SV5 A;  1YVN A;  3CG7 A;  2OA8 A;  4DQ8 A;  2P5G A;  1Z6R A;  3VQB A;  3IS9 A;  4FWO A;  2Z1H A;  4RW8 A;  5C2D A;  2YHA A;  4JI2 K;  5B8H A;  3KWI A;  3VQD A;  2QTD A;  3UKU B;  1SAZ A;  4DKW A;  1HNV A;  3HI0 A;  3HP9 A;  2P9U A;  1RTD A;  1ZC6 A;  3LDN A;  4GKJ K;  3MCP A;  3O6W A;  4FJK A;  1JCE A;  5KPR A;  2CGJ A;  1TL1 A;  3M8R A;  4IKF A;  3E9P A;  3SUN A;  4KPY A;  4FZY A;  4M63 C;  3L4Q A;  3CJB A;  3AO2 A;  4RW9 A;  4CJW A;  5AZJ A;  3RMB A;  4HTL A;  2A40 A;  4A59 A;  1BIZ A;  2IGI A;  2HMP A;  1YUW A;  4CEQ A;  4BRF A;  3HVT A;  4MDA A;  4N76 A;  3WNG A;  3OYM A;  1JLE A;  3CMA N;  2VG5 A;  4PUO A;  4DSI A;  3ZT3 A;  1T7P A;  3AVM A;  1T6C A;  1KAX A;  2G8I A;  1ASU A;  3VQQ A;  3B6O A;  3BF3 A;  3D7E O;  1DT9 A;  4KTZ A;  2W6K A;  4CF2 A;  2KLA A;  3O3F A;  4DTJ A;  3AVF A;  4YDU C;  1ILY A;  2DFH A;  3CJ1 A;  1XI1 A;  2GEL A;  1GLA G;  3J7Y P;  2FSN A;  1E4F T;  4ZTJ A;  1ATN A;  3NGZ A;  1KVA A;  3AVK A;  2DTU A;  2O8B A;  3KK2 A;  4H0Y B;  3K5N A;  4MLH A;  1K9M O;  5C12 A;  4CER A;  4K41 A;  4AHU A;  4E7H A;  4CJL A;  1HNI A;  2FSK A;  5HRR A;  4J2D A;  4O55 A;  3AVA A;  2HBM A;  2P9S B;  1NGG A;  1RT2 A;  4C8N A;  5HOO A;  3AVB A;  2GV9 A;  3J7Z O;  4CZJ A;  1ZBF A;  3OYN A;  3SPZ A;  4IOC L;  1KFS A;  1G99 A;  3VQ9 A;  4A2A A;  1VRU A;  4AHS A;  1LAW A;  4BG9 A;  4FPA A;  1D8Y A;  2ASP A;  2O8C A;  2QXF A;  2KZZ A;  4CGJ A;  4CGF A;  5FDL A;  5IWA K;  4FLT A;  3PV8 A;  4FWP A;  2Y1J A;  2D0C A;  3F73 A;  3VQ6 A;  1JLB A;  4O0I A;  5JMV A;  3EYZ A;  3HT3 A;  4ICL A;  4M41 A;  1QSY A;  4BRH A;  3HK2 A;  4EZ9 A;  4FLU A;  1WBB A;  1BWF O;  4B9L A;  1TKT A;  2IVO A;  4DTM A;  4DSL A;  4OKE A;  4BRM A;  3VF4 A;  4FJL A;  1HLU A;  2YJE A;  3HXM A;  2OPQ A;  3CFR A;  2O8E A;  3LAM A;  3SQ4 A;  3PUF A;  1HPM A;  4B3S K;  1JLF A;  1MWK A;  2NLX A;  3LDS A;  4M42 A;  1WN7 A;  1BCO A;  4PHT X;  4WCE L;  2Q3S A;  3CQY A;  4E7L A;  3EZW A;  5C2F A;  2QK9 A;  4AHT A;  3SK3 A;  4DWI A;  4CJT A;  4DSE A;  3SUP A;  4A5B A;  3ENH A;  2D4W A;  2CGL A;  1OH8 A;  1YJN N;  2HNZ A;  2IC3 A;  1HYV A;  5EXW A;  1SUQ A;  2BGG A;  4Q0B A;  1SKW A;  5AQP A;  1MWM A;  4V19 S;  3LAK A;  3BF1 A;  4NCG A;  3S3O A;  4DLE A;  2G8F A;  3VEY A;  3JXU A;  1JCF A;  4XH1 A;  1BCM A;  1NKB A;  1NJI O;  2YHY A;  3ZSW A;  2EHG A;  4IEE A;  3K9J A;  5F2R A;  5SZT A;  3L0Q A;  1SL1 A;  3VMF B;  3IKM A;  3CET A;  4BRE A;  4CVN E;  1TK0 A;  3CCR N;  3SMS A;  1NGE A;  4BR5 A;  3K5L A;  2E6M A;  1S1W A;  3C6T A;  3NGI A;  3FZL A;  1QQC A;  3CJ9 A;  3DXK B;  3VQA A;  3ZET B;  1U4B A;  4GW6 A;  2YKN A;  1TL3 A;  3O4W A;  1SL2 A;  1S9G A;  3TAG A;  4RW6 A;  1GLF O;  4QS8 A;  2O8D B;  1VSL A;  3MEE A;  3L2V A;  4WE1 A;  2VYP A;  3TPQ A;  4CED A;  4FWN A;  5FRO A;  3M5R A;  4DR5 K;  3IAY A;  4CGG A;  4EFH A;  1LWE A;  5JLF A;  4JD2 B;  4ZHR A;  3NH0 A;  2F8S A;  4HWI A;  1VSK A;  1KVB A;  1K6Y A;  1NK7 A;  3LAL A;  3VEX A;  3H08 A;  4K25 A;  4DMN A;  4EIA A;  1P90 A;  1YVU A;  1ZBL A;  1ZBU A;  1VQN N;  4DV4 K;  2P9K B;  2B6A A;  2P9N A;  1FK9 A;  1BA1 A;  3MX5 A;  4CGD A;  4QAG A;  1HJO A;  1XC3 A;  2LSN A;  5KI6 A;  4RTF D;  3ZSV A;  3QIN A;  1WAJ A;  3LDO A;  2P9P A;  4M3Z A;  1Q18 A;  3AV9 A;  1NJX A;  2O8F A;  4CIG A;  1C0U A;  1TAQ A;  5M1O A;  3THW A;  3DRP A;  3LDL A;  4CZI A;  3SYZ A;  2WON A;  3O3H A;  1KLM A;  3C7N A;  1C0G A;  1MDU B;  1Z25 A;  4IZ9 A;  2FBV A;  4YOU A;  4B3T K;  5CY4 A;  5KQ8 A;  1TKX A;  3LAN A;  3WNE A;  3DXM A;  1U2V A;  4FJJ A;  3V9X A;  4PKG A;  3RR7 A;  4AHR A;  1CXU A;  3TR8 A;  5ADX A;  2QWO A;  4HUG A;  4R5P A;  4FZX C;  3G25 A;  3QFU A;  3UKR B;  2VG6 A;  3BZC A;  3H1Q A;  2KKZ A;  5JVH L;  3PSI A;  4CHZ A;  4ZTF A;  3DRS A;  4DLG A;  3R6M A;  4HHT A;  3KLI A;  3QBW A;  3LPU A;  1EXQ A;  2RPI A;  1S1X A;  3JS6 A;  4DR2 K;  3FLC O;  2XY6 A;  1QZ5 A;  3GL1 A;  4JHD A;  4B1Y B;  3D2F B;  3F2K A;  1BGX T;  3RRG A;  1Q9X A;  3U4L A;  1ZBI A;  4L3Q A;  2P9I A;  3QIP A;  4B9Q A;  1IBM K;  4E1M A;  4LH5 A;  1I94 K;  3I55 N;  4KH4 A;  1BIU A;  1VQO N;  1NK5 A;  4FZZ A;  5AQV A;  5SWM A;  4IBN A;  1BU6 O;  3HP6 A;  1GOC A;  3DMJ A;  5GIN A;  3K0S A;  4IJN A;  2YV0 X;  3H6E A;  4LC9 B;  4AH9 A;  2HHT A;  3G10 A;  3ZX3 A;  1CZB A;  4DG1 A;  1K73 O;  2NNW A;  1U49 A;  3NBP A;  3NCI A;  1E4G T;  4BR9 A;  5C0Y A;  3VA0 A;  1X9M A;  1YHQ N;  1SL0 A;  2XY8 A;  5LJW A;  4OGC A;  2P9U B;  3THX B;  4QS9 A;  1K8A O;  4DSJ A;  2FSJ A;  4CHO A;  3P38 A;  4JN4 A;  2ZGZ A;  2EWS A;  2IS3 A;  4B1V A;  5BR9 A;  3TAQ A;  4ILH A;  4BAC A;  1GLC G;  4DR1 K;  3MK6 A;  1LOT B;  3K2P A;  5C24 A;  5BRH A;  3OS2 A;  3C6H A;  3LWM A;  4KKO A;  5AFU A;  5HRO A;  4FW1 A;  1EET A;  2F8T A;  1TAU A;  3CC2 N;  3ZSY A;  1CLQ A;  4H0T B;  2P1J A;  3P5J A;  2WBN A;  4KTW A;  2OTJ N;  4CK3 A;  4LH4 A;  4KH6 A;  2GX9 A;  1HR0 K;  1YT3 A;  4O4G A;  3WNF A;  3KD5 E;  4ELU A;  4DF8 A;  1XHX A;  4BRN A;  3BP8 A;  3OYB A;  4NXM K;  2ZWH A;  1JKH A;  1T3V A;  1NM1 A;  4LF9 K;  4AM7 A;  1JXE A;  4C1N I;  2O8B B;  2E1Z A;  5GAG P;  4B3R K;  3RSE B;  4DTO A;  4LSL A;  1N5Y A;  1KAY A;  2PBD A;  4CJF A;  3M1F A;  4CF9 A;  1OH5 A;  3UE5 A;  4XEI A;  5CR4 A;  3MN6 A;  2NRR A;  3A5N C;  3VA3 A;  4FWS A;  1NMD A;  4BRK A;  4PKH A;  1GLE G;  3EKS A;  1VK0 A;  4BG8 A;  4NLB A;  1D9D A;  4DTR A;  3C94 A;  3O4N A;  3V6D A;  4FK4 A;  4IG0 A;  3SQ2 A;  4M3X A;  2NRT A;  2RKI A;  3L4I A;  4GNI A;  3ALY A;  1FW6 A;  1B92 A;  2HHQ A;  5I3U A;  4IXC A;  4DS4 A;  2ZGY A;  2VGN A;  2O8C B;  1W2B M;  5EX5 A;  3O9U A;  2GBZ A;  1C6V A;  2Q0R A;  1WSH A;  4CK1 A;  3U9D A;  3NMU A;  4FCY A;  1VAZ A;  4BE2 A;  4DQQ A;  3OHR A;  3ZT4 A;  3SQ1 A;  4F2R A;  4UQG A;  3L3V A;  4JKG A;  4YOY A;  5M1P A;  4LFC K;  3AVG A;  2G8K A;  3AO1 A;  1OVY A;  1HNW K;  1GLB G;  1GLJ O;  2ZJR L;  3BGR A;  1BDG A;  1RCH A;  1NJY A;  2O8E B;  5AZI B;  1J54 A;  1VHX A;  4FJM A;  5BPN A;  3OJS A;  4LF4 K;  1TKD A;  3HBT A;  4JI1 K;  3C6U A;  4E1J A;  2E2O A;  4FK2 A;  1RNH A;  1U45 A;  4H4M A;  4I9Q A;  3QIC A;  4JKA A;  2QKB A;  5JVG L;  4B08 A;  1V4T A;  1X3M A;  1S1T A;  3P83 D;  2JGU A;  4H8K A;  4DV7 K;  3U8X A;  4Y1C A;  2HOE A;  1XMO K;  3G0Z A;  3OYG A;  5AQN A;  4FJ7 A;  3WXL A;  3CXC M;  1L3U A;  4FVU A;  1D5A A;  3VGL A;  2HST A;  4PWD A;  1M1K O;  2O4I A;  3C65 A;  4PL7 A;  3ITH A;  1N6Q A;  2IVP A;  5KPZ A;  1HX1 A;  4CK2 A;  2FF3 B;  5EY4 A;  3E9O A;  3HSC A;  4KO0 A;  4UY8 O;  4LF5 K;  4LD0 A;  4O0J A;  1L3S A;  1YF5 L;  3AY9 A;  4WQ4 A;  3RWU A;  1HYZ A;  2J4R A;  2YNI A;  3ZEU B;  1O1W A;  4FWR A;  3QFP A;  3G4S N;  3WQU A;  3OS1 A;  3CYM A;  3MED A;  5D3G A;  5BPL A;  1W0H A;  4DV2 K;  4NLC A;  2HHU A;  1UWB A;  3VQE A;  2F96 A;  3TI0 A;  1WOQ A;  2FXU A;  3FFK B;  5J2N A;  2E5L K;  1JLG A;  4FM0 A;  5AQL A;  1QSS A;  4NCA A;  4F9O A;  3OYD A;  3LZI A;  5J2P A;  1BL3 A;  2NRV A;  1S1V A;  3UB5 A;  2HHH K;  3V9S A;  2G8U A;  4ISE A;  3LZJ A;  5BRE A;  3BY5 A;  3RMC A;  4WQ5 A;  4BQL A;  3MX2 A;  1VQL N;  2V52 B;  2P9N B;  5J2Q A;  4H5W A;  4JRQ A;  4QCL A;  1JCG A;  4O5B A;  1TK5 A;  2Z1I A;  1NGF A;  3SMP A;  3GDQ A;  3VF2 A;  4DU4 A;  4DU1 A;  1O13 A;  3LWL A;  3THW B;  4HCB A;  3CCQ N;  4FJH A;  1B9D A;  3C7N B;  3SV3 A;  4E7J A;  4C8O A;  1ATS A;  3ZCM A;  4DUY K;  1XC9 A;  5F0X A;  3DXM B;  4TSX A;  4IOA L;  4CZM A;  4AQY K;  3H3O B;  2D0B A;  1K8K B;  4CD1 A;  4JK8 A;  3VEN A;  3TSP A;  3CCJ N;  3D6R A;  2NRH A;  3VF6 A;  3K5O A;  4ELV A;  4KHW A;  1ZXO A;  1KSP A;  3O4Q A;  2KHO A;  1R59 O;  2OPP A;  4EAH D;  4AM6 A;  4JHD B;  1BUP A;  3ZSX A;  3DOK A;  2RN2 A;  3O9Q A;  4FM1 A;  4IWV A;  4JK7 A;  3L6Q A;  3VGK A;  1XUP O;  3SCX A;  3AVN A;  3KLG A;  4BVO A;  4CW7 B;  1QVG M;  1P8Z A;  4C8K A;  1SS6 A;  4NO7 A;  1VRT A;  4FVM A;  4ILJ A;  1IG9 A;  3QEX A;  3EL2 A;  3DLH A;  4OPA A;  1NWK A;  2F9W A;  2W40 A;  2YI1 A;  5GAD P;  4L8R B;  5DK5 A;  2JWL A;  4A5A A;  3HZ6 A;  1RDC A;  5BRD A;  3EKU A;  1G15 A;  3EZ5 A;  4BR7 A;  3PO5 A;  3QLH A;  3FE1 A;  3CPW M;  4W5Q A;  4B9M A;  4CBX A;  2HBK A;  4OPJ A;  5BN9 A;  1I39 A;  3AVI A;  4BRD A;  3DM2 A;  3QBX A;  3CF5 L;  4GV6 A;  4CJK A;  4DTP A;  3KLH A;  4YY3 K;  2QW9 A;  2DFE A;  2PAV A;  4BY9 C;  1NLV A;  1BI4 B;  3OYE A;  1YXQ A;  4FW2 A;  1F21 A;  1EX4 A;  4IEI A;  4H0X B;  1JLC A;  2KQ2 A;  4B3M K;  4KHN A;  2E2Q A;  1IBL K;  5GIO A;  2QWN A;  4K0K K;  3QEP A;  3F5T A;  2YNH A;  3S3M A;  1EWR A;  3LPT A;  3ID6 A;  1VQ7 N;  1X1P A;  4FOI A;  4Z4C A;  3DLB A;  1HRH A;  3PSF A;  3PIO L;  3QES A;  4EP4 A;  3NF8 A;  2ZJP L;  1RDB A;  4JKC A;  3PX6 A;  5BR8 K;  3NVK A;  2FBT A;  4CHQ A;  4K8X A;  3HJF A;  3HYF A;  4B1U B;  3KKR A;  3ZSO A;  3CCL N;  2Q2R A;  3VEO A;  1QHA A;  2IIR A;  4FWL A;  1RBR A;  5AQK A;  2ATQ A;  3I0R A;  3MAQ A;  1KTQ A;  1CZA N;  3OJU A;  4H0P A;  3IG1 A;  3OYJ A;  1IV0 A;  3VQ8 A;  3KHY A;  4DCH A;  1I3A A;  3VER A;  4WQ5 C;  3CQX A;  3I33 A;  4RG8 A;  2G8V A;  1DTQ A;  4YOX A;  2QEX N;  4CZK A;  3W0L A;  1YIJ N;  5AQO A;  5M1F A;  3T3F A;  4DV0 K;  5LMU K;  3WT0 A;  2HND A;  2UXC K;  1SKR A;  3WQT A;  1VSH A;  4BRC A;  2JWK A;  3BUZ B;  3KIO A;  4G1Q A;  1LW2 A;  3LDQ A;  5AQY A;  1U48 A;  1H1V A;  3R9P A;  3RTV A;  1VQ9 N;  4FLX A;  1D9F A;  4OPH A;  4DV6 K;  3KLE A;  3DLE A;  5AR0 A;  1WSG A;  4DTU A;  5TKY A;  3VQ5 A;  4BRI A;  1S72 N;  4O44 A;  2PYJ A;  1IG8 A;  3O9T A;  4GV9 A;  4CJQ A;  4JKG B;  2YNF A;  3S41 A;  2VG7 A;  4FJG A;  1WAF A;  1YTU A;  4WF9 L;  4CEF A;  4KHQ A;  4WFN L;  3TWH A;  1KRP A;  4I7F A;  2QKK A;  3QEV A;  2KFN A;  1KC8 O;  3MDQ A;  4B1W B;  4CJP A;  5GAH P;  3NFA A;  4FLW A;  1IKX A;  4JI0 K;  3C6A A;  4W5T A;  4FXD A;  5M1Q A;  1IKW A;  2KZM A;  2Z1J A;  4BRP A;  3CQ8 A;  3L3U A;  4YOR A;  5AQT A;  5KRS A;  3V9W A;  1N36 K;  3EE8 A;  3QB0 A;  1S6P A;  4DTX A;  1QTM A;  1U6Z A;  2W42 A;  3THY A;  3TAE A;  4Z4G A;  1M90 O;  3D0P A;  3TTD A;  1ASW A;  5C25 A;  3WXK A;  4I9L A;  1TV6 A;  3OYL A;  4CBU A;  2I7P A;  2OTL N;  4N56 A;  4H5R A;  2AP1 A;  3FR0 A;  4M3W A;  2IAJ A;  3VTI A;  1J9A A;  4CEC A;  5AQQ A;  4BR0 A;  3AO5 A;  3ZT0 A;  2ZE2 A;  4YOT A;  3P4I A;  4AIL C;  3OBY A;  4CZG A;  4JAX A;  5AQX A;  2V7Z A;  3L8B A;  3V1O A;  1S9E A;  2Y1I A;  2D0O A;  1B9F A;  1VQM N;  3IFR A;  3RMD A;  3SAH A;  2DY4 A;  3A0I X;  1A5V A;  4U67 L;  3QET A;  3JYT A;  1IKV A;  1VQP N;  4JI3 K;  2QWR A;  3PIP L;  1MU2 A;  3D2E A;  4FYD A;  2A41 A;  3GOI A;  1JXB A;  1NU0 A;  4I2P A;  1KD1 O;  4FLY A;  3V9Z A;  2ZD1 A;  5ADX H;  3AVC A;  3WEE B;  2YX6 A;  3CM5 A;  5JS1 A;  4QS7 A;  5AQF A;  3KJV A;  1NK8 A;  2RE2 A;  4IG3 A;  3OVN A;  4MO4 A;  1NK0 A;  3J8A A;  3CCV N;  3AVH A;  4FPB A;  1R0A A;  2BDP A;  4BRQ A;  1RBS A;  3JAM O;  5TKW A;  4BDY A;  1EWQ A;  1Z05 A;  2A1S A;  3I0S A;  3VQ4 A;  4RWT A;  3NH2 A;  1T8E A;  3CD6 N;  4H5N A;  3V81 A;  5FRM A;  1Q9Y A;  3GG4 A;  1RT4 A;  1Q82 O;  2XY5 A;  4GV3 A;  2P9L A;  4B3O A;  1LWC A;  3SUQ A;  3AVL A;  1UA0 A;  3PO4 A;  5IT9 O;  1BQN A;  3S9H A;  2P9S A;  3BEX A;  4JI4 K;  2FF6 A;  1KAZ A;  4FJ8 A;  1WSF A;  3P31 A;  4C1N K;  3NAE A;  1TVR A;  4BVP A;  4IDK A;  3T19 A;  1DGK N;  4M45 A;  1QQO A;  4JKF A;  2QWM A;  3EE9 A;  1S22 A;  1RIL A;  3KVG A;  4BR2 A;  4DV3 K;  3PLA A;  1S1U A;  4Z0U A;  1BIS A;  5CYM A;  4KRE A;  3CFP A;  2XY7 A;  2Q31 A;  5AZJ B;  5I9E B;  3VTH A;  4IJA A;  4DR3 K;  3IUC A;  2IVN A;  3ZX0 A;  1ZYQ A;  3U3Y A;  1HKG A;  2A42 A;  1OH6 A;  1SZ2 A;  4BR4 A;  3ZT1 A;  4KRF A;  4C8M A;  3TSQ A;  1IBK K;  1LAV A;  1Q7Y O;  2HW3 A;  3FZM A;  4CE9 A;  5EU7 A;  3R3L A;  2F9T A;  4FWQ A;  2RF2 A;  1LV5 A;  4JI7 K;  5AFU H;  2G8H A;  4BC2 A;  4CEO A;  3J81 O;  2BAN A;  4Z4H A;  3DJC A;  4CFC A;  3K58 A;  1VSF A;  2A5X A;  2NRZ A;  3KKS A;  2WC9 A;  3LM2 A;  1OVQ A;  1BO5 O;  1T44 A;  3T69 A;  4FO0 A;  3GE1 A;  5LL6 Z;  4DR7 K;  3LL3 A;  5LY3 A;  4A57 A;  2HVH A;  4PKI A;  3QEW A;  1X9J A;  4M3Y A;  5HRN A;  1C0F A;  5LJV A;  4CEZ A;  1RBV A;  4J8F A;  3E66 A;  4DSF A;  2D5R A;  3MN7 A;  4BE1 A;  4JYA K;  2JLE A;  4BRL A;  2PFU A;  3GBT A;  5HLF A;  1ASV A;  3V1R A;  1CZ9 A;  3AVJ A;  5ELZ A;  3CIP A;  3OW2 M;  3HPO A;  4GVM A;  3ZET A;  1QS4 A;  3NH1 A;  2YKM A;  1ITG A;  4JS4 A;  3NF9 A;  2CH5 A;  3K9K A;  3C95 A;  4YOW A;  1EQY A;  4JI8 K;  1N8R O;  3CM6 A;  2FBX A;  4YOV A;  1EO1 A;  4YDU A;  3LP3 A;  4CHN A;  4E0D A;  3HM8 A;  4Y0W A;  2E4L A;  3EO3 A;  1UA1 A;  3FZF A;  4LSN A;  3HPH A;  1BHL A;  4YHH K;  1FXX A;  4W5N A;  2ZQB A;  4I6M A;  4B1Z A;  1N34 K;  4CD3 A;  5AJ3 K;  3R8E A;  3TSU A;  3WXM B;  3EEQ A;  4CFB A;  2XRI A;  4EHU A;  1YJ9 N;  4FLZ A;  5KGX A;  4BRA A;  5LMN K;  4K8Z A;  4Z4I A;  3CJC A;  1TUY A;  3SPY A;  3SJJ A;  4JKH A;  3OYC A;  2UUA K;  4DS5 A;  4JEP A;  3NGY A;  4K42 A;  3E1Y A;  1IJJ A;  4FLV A;  1BQM A;  3K5M A;  1BA0 A;  1RT5 A;  5CYQ A;  1J53 A;  3WUH A;  4FK0 A;  4OO1 J;  4HTU A;  4KTQ A;  4OVL A;  1OKJ A;  1QHT A;  4JRP A;  1DKG D;  2WFB A;  1LW0 A;  2D1K A;  3QNO A;  2Q1N A;  3CJ7 A;  3T1Y K;  1MA9 B;  3L2W A;  3ZT2 A;  4NB4 A;  3O9R A;  4IOX A;  3CCE N;  4ID5 A;  4M7X A;  3HOS A;  4A61 A;  1NJW A;  4CHP A;  4DQR A;  3TAF A;  4RCH A;  2WOM A;  4BC3 A;  3AA3 A;  3OS0 A;  4EZ6 A;  3LM9 A;  1NOY A;  1RT3 A;  4H5T A;  3ASM A;  1LWF A;  4KB0 A;  5FPN A;  3FGU A;  3E01 A;  3ZSQ A;  4LFB K;  2HBJ A;  3RMA A;  1QQN A;  4CIF A;  1VQ8 N;  3KK3 A;  3K59 A;  2ETJ A;  4JLH A;  5E26 A;  3SAG A;  5KQD A;  4J2E A;  3H1V X;  3D2F A;  1X9W A;  4X62 K;  5MLC Q;  4BDZ A;  4Z4F A;  4FJN A;  5EVZ A;  2WUS A;  4I2Q A;  4G9Z A;  3I56 N;  2E20 A;  1QE1 A;  1Y64 A;  4IO9 L;  3HRG A;  2DPN A;  2IOC A;  4CJ4 A;  4KI4 A;  1KCF A;  2W41 A;  1RTH A;  3CI5 A;  1NMN A;  4F4K A;  1Q81 O;  4X65 K;  1HKC A;  4F3O A;  3VQ7 A;  4HUE A;  2P9P B;  3LP1 A;  1XMQ K;  1VSM A;  2O8F B;  1ATR A;  3IDH A;  3UIQ A;  1XQS C;  3ZSZ A;  3THY B;  2XHB A;  1KFD A;  3ULE A;  2Q0U A;  4CGI A;  3VPZ A;  5GIP A;  4WYB A;  2F4V K;  4DHY A;  3KZB A;  5DM6 L;  3RRH A;  1C1C A;  2BE2 A;  4Y1D A;  3A2F A;  3THX A;  4U7B A;  1U2V B;  2B5J A;  3VQC A;  3MXI A;  4CJ3 A;  2KFZ A;  3F9K A;  1NK9 A;  4KHS A;  3VQP A;  4ID1 A;  3SZ2 A;  5E41 A;  3OBW A;  4C8L A;  3O08 A;  2OZM A;  1JLA A;  1TK8 A;  3O9S A;  2V7Y A;  3TTF A;  2CH6 A;  4J2A A;  4BDP A;  4GMJ B;  5HP1 A;  4O5F A;  3TTC A;  3TAR A;  3DLR A;  3HPG A;  2X78 A;  4JS5 A;  4CJ7 A;  5I42 A;  5HBM A;  3M3Z A;  3OYF A;  4NYN A;  3VEZ A;  4YNQ A;  4M3R A;  3D2E B;  4FJ9 A;  4M3T A;  1A5X A;  2PYL A;  1JLQ A;  1VQ4 N;  4RW4 A;  5FPM A;  3QEI A;  4KHP K;  3DRR A;  3L2R A;  1WUA A;  4DQP A;  3HOT A;  5KGW A;  2P9I B;  4B9U A;  3QDK A;  3MEC A;  5AQH A;  1TYQ A;  3VN5 A;  2FBY A;  2QWL A;  4X66 K;  2A1R A;  4CF0 A;  5CZ1 A;  1RGI A;  4GKK K;  4E3S A;  5F1X A;  3A8Y A;  3SJH A;  3RSE A;  1FKO A;  4IO8 A;  2ZM6 K;  2P9L B;  4XH4 A;  4AF1 A;  4F8R A;  1SQK A;  3ENB A;  4W5O A;  3W3D A;  3P39 A;  3H45 C;  2R7Y A;  3AGR A;  1S5J A;  5CZ2 A;  2W6L A;  3SAF A;  3AAP A;  1XHZ A;  3JSM A;  2YHX A;  1T03 A;  3DOL A;  1JL1 A;  4DQI A;  4MO5 A;  3V1Q A;  2QI2 A;  2X6S A;  4PY5 A; 
#chains in the Genus database with same CATH homology
 4ELU A;  4DF8 A;  3D0P A;  1XHX A;  3ISN C;  4CJ5 A;  1ASW A;  5C25 A;  3OYB A;  4B9T A;  2YNG A;  4E1N A;  1IH7 A;  1TV6 A;  1TKZ A;  3D45 A;  1C0M A;  4I9L A;  3OYL A;  1JKH A;  3NF7 A;  4N5S A;  3MXM A;  4F3T A;  4Q5V A;  4MQ3 A;  4N56 A;  4FJI A;  1JXE A;  1Y97 A;  3M8P A;  4DTO A;  2O4G A;  2IAJ A;  4M3W A;  3DYA A;  4LSL A;  1J9A A;  4CEC A;  3AO5 A;  3ZT0 A;  4OLA A;  1N5Y A;  1WSJ A;  1REV A;  2ZE2 A;  4CJF A;  2EX3 A;  4AIL C;  4CF9 A;  3M8Q A;  1X9S A;  2NUB A;  4LY7 A;  4OJR A;  3HVR A;  4PQU A;  3AA2 A;  3L8B A;  3V1O A;  1S9E A;  2Y1I A;  3VA3 A;  1B9F A;  3KLF A;  2Z1G A;  2HVI A;  3RMD A;  1IKY A;  2DY4 A;  1SV5 A;  3CG7 A;  1VK0 A;  2OA8 A;  1A5V A;  1D9D A;  4DTR A;  2P5G A;  3QET A;  3C94 A;  3O4N A;  3V6D A;  3JYT A;  1IKV A;  4FK4 A;  4IG0 A;  3VQB A;  3SQ2 A;  4M3X A;  2RKI A;  3IS9 A;  1MU2 A;  2Z1H A;  3ALY A;  4RW8 A;  4FYD A;  1B92 A;  2YHA A;  2HHQ A;  1JXB A;  5I3U A;  3BDP A;  4I2P A;  3VQD A;  4FLY A;  4DS4 A;  3AO4 A;  3V9Z A;  2ZD1 A;  1XWL A;  5C42 A;  5FRN A;  1HNV A;  3AVC A;  2GBZ A;  3HP9 A;  3CM5 A;  5JS1 A;  1C6V A;  4QOZ B;  1WSH A;  3PX4 A;  4CK1 A;  3KJV A;  1RTD A;  4OLB A;  4AHC A;  1NK8 A;  1RDA A;  4IG3 A;  3OVN A;  4FCY A;  4DFP A;  1NK0 A;  1UOC A;  4BE2 A;  4DQQ A;  4FJK A;  3AVH A;  4CJE A;  1R0A A;  2BDP A;  3ZT4 A;  3SQ1 A;  3LP0 A;  1RBS A;  4KHY A;  1TL1 A;  3M8R A;  4F2R A;  3DLG A;  4IKF A;  3B6P A;  4BDY A;  3SUN A;  4KPY A;  4UQG A;  4FZY A;  2A1S A;  3I0S A;  3L3V A;  1HMV A;  3VQ4 A;  5T7B A;  3NH2 A;  1T8E A;  3AO2 A;  1S6Q A;  3V81 A;  5FRM A;  4RW9 A;  1CXQ A;  3AVG A;  4CJW A;  1Q9Y A;  1RT4 A;  3AO1 A;  3O3G A;  2XY5 A;  1RDD A;  3RMB A;  2G8K A;  4N41 A;  1BIZ A;  2IGI A;  4B3O A;  1LWC A;  3SUQ A;  3AVL A;  3BGR A;  1RCH A;  1NOZ A;  2VWK A;  4CEQ A;  1A5W A;  3OY9 A;  5K14 A;  1BQN A;  1UA0 A;  3HVT A;  3S9H A;  1NJY A;  3PO4 A;  4N76 A;  1J54 A;  3WNG A;  4FJM A;  3OYM A;  1JLE A;  3OJS A;  2VG5 A;  3FFI A;  4PUO A;  1TKD A;  4DSI A;  4FJ8 A;  3ZT3 A;  1T7P A;  1WSF A;  3AVM A;  3C6U A;  1VSE A;  3NAE A;  4FK2 A;  1RNH A;  1U45 A;  4ELT A;  1ASU A;  4H4M A;  3VQQ A;  2G8I A;  1TVR A;  4I9Q A;  3B6O A;  2QKB A;  3SI6 A;  4KTZ A;  4B08 A;  4IDK A;  4CF2 A;  3T19 A;  3P83 D;  1S1T A;  4HVJ A;  2JGU A;  3AVF A;  3O3F A;  2DFH A;  4B8A B;  4DTJ A;  4H8K A;  4M45 A;  1XI1 A;  4E19 A;  4Y1C A;  4M3U A;  2HB5 A;  1RTJ A;  4NCB A;  4Z4E A;  2YHB A;  3G0Z A;  3OYG A;  1RBU A;  4FJ7 A;  1RIL A;  4ZTJ A;  1L3U A;  1S1U A;  3NGZ A;  1KVA A;  4Z0U A;  1BIS A;  1D5A A;  1WSI A;  3AVK A;  5CYM A;  1UAX A;  1NKE A;  4KRE A;  2DTU A;  3KK2 A;  3CFP A;  3NDK A;  3K5N A;  2XY7 A;  1KVC A;  1W9H A;  4CES A;  4OGE A;  4PWD A;  2O4I A;  4CER A;  3ULD A;  3V4I A;  4AHU A;  3ITH A;  4E7H A;  4CJL A;  1HNI A;  5HRR A;  5J2M A;  1ZYQ A;  1N6Q A;  4J2D A;  4O55 A;  3AVA A;  3U3Y A;  4CK2 A;  1RT2 A;  4C8N A;  2HHS A;  3ZT1 A;  4KRF A;  4C8M A;  3PY8 A;  3AVB A;  2GV9 A;  4KO0 A;  4CIE A;  1LAV A;  1ZBF A;  3OYN A;  4LD0 A;  4O0J A;  4DTN A;  3RR8 A;  2HW3 A;  3SPZ A;  1KFS A;  1L3S A;  3VQ9 A;  4AHS A;  1EP4 A;  1VRU A;  1L5U A;  1EKE A;  1NKC A;  3RWU A;  4CE9 A;  5EU7 A;  1HYZ A;  1LAW A;  1HJR A;  2YNI A;  1L3V A;  1O1W A;  2RF2 A;  1JL2 A;  3TAM A;  1LV5 A;  2IDO A;  1D8Y A;  2G8H A;  4HUF A;  4B9S A;  4CEO A;  2BAN A;  3OS1 A;  4KAZ A;  3CYM A;  4Z4H A;  4CFC A;  2GUI A;  3K58 A;  1HQU A;  3OYI A;  1FKP A;  1VSF A;  2QXF A;  3MED A;  5D3G A;  2KZZ A;  4CGJ A;  1W0H A;  4CGF A;  5FDL A;  4FLT A;  3PV8 A;  2HHU A;  1UWB A;  3KKS A;  3VQE A;  2Y1J A;  2D0C A;  2F96 A;  3VQ6 A;  3F73 A;  1JLB A;  3OYA A;  4O0I A;  3TI0 A;  3EYZ A;  3HT3 A;  4ICL A;  4M41 A;  2HVH A;  1QSY A;  1J5O A;  2OZS A;  3QEW A;  3HK2 A;  4EZ9 A;  4OKK A;  3U3G A;  4FLU A;  1VSD A;  5J2N A;  1JLG A;  4H4O A;  4FM0 A;  4M3Y A;  5HRN A;  4DQS A;  3AO3 A;  1QSS A;  1HYS A;  4B9L A;  4NCA A;  1TKT A;  4CEZ A;  4DTM A;  4DSL A;  4OKE A;  1RT7 A;  3OYD A;  1RBV A;  3LZI A;  4FJL A;  3OYK A;  5J2P A;  4DSF A;  3HXM A;  1BL3 A;  2OPQ A;  1HQE A;  1S1V A;  3CFR A;  3V9S A;  2G8U A;  3LAM A;  4CJS A;  3PUF A;  3SQ4 A;  2D5R A;  3LZJ A;  4BE1 A;  1JLF A;  2JLE A;  3RMC A;  3LDS A;  4M42 A;  1WN7 A;  5HLF A;  1ASV A;  1BCO A;  3V1R A;  1CZ9 A;  1HPZ A;  2Q3S A;  3AVJ A;  3NF6 A;  1SKS A;  4E7L A;  5J2Q A;  4CCH A;  1VSJ A;  3HPO A;  2QK9 A;  3HST B;  3HM9 A;  4AHT A;  4DWI A;  4GVM A;  4CJT A;  4JRQ A;  4E89 A;  4DSE A;  3SUP A;  4QCL A;  1QS4 A;  4O5B A;  2YKM A;  3NH1 A;  1TK5 A;  3V9U A;  1ITG A;  4JS4 A;  3NF9 A;  2Z1I A;  3C95 A;  3SQ0 A;  2HNZ A;  2IC3 A;  4DU4 A;  1HYV A;  4DU1 A;  3NE6 A;  3LWL A;  4HCB A;  1SUQ A;  3CM6 A;  2BGG A;  4Q0B A;  2FBX A;  1SKW A;  4FJH A;  4BWJ A;  1B9D A;  3LAK A;  3QO9 A;  3SV3 A;  4E7J A;  3AA4 A;  4KFB A;  4C8O A;  4NCG A;  3S3O A;  3LP3 A;  4BWM A;  3ZCM A;  4DLE A;  3LP2 A;  4CHN A;  1NKB A;  2G8F A;  4E0D A;  1BCM A;  1XC9 A;  2P51 A;  4F2S A;  4N47 A;  4TSX A;  3ZSW A;  2HHW A;  2E4L A;  2EHG A;  4CJU A;  1UA1 A;  3U6F A;  4LSN A;  3HPH A;  1BHL A;  4IFV A;  1FXX A;  5SZT A;  2ZQB A;  4W5N A;  2D0B A;  1SL1 A;  1TK0 A;  4FJX A;  1RTI A;  3MXJ A;  3WNH A;  1GOB A;  3K5L A;  2E6M A;  3HO1 A;  1S1W A;  3C6T A;  3K5O A;  3P1G A;  1IO2 A;  4ELV A;  3NGI A;  1QQC A;  2XRI A;  4CFB A;  4FLZ A;  3VQA A;  5KGX A;  1U4B A;  4KHW A;  4GW6 A;  2YKN A;  1TL3 A;  1SL2 A;  3TAP A;  1KSP A;  1S9G A;  4CJV A;  1C0T A;  4K8Z A;  4Z4I A;  3O4Q A;  3TAG A;  3KTQ A;  4RW6 A;  3T1A A;  3SPY A;  3SJJ A;  3OYC A;  4E7I A;  4DFJ A;  1VSL A;  4DS5 A;  2OPP A;  1U47 A;  3NGY A;  4FLV A;  3DI6 A;  3MEE A;  3L2V A;  5KRT A;  4WE1 A;  1TGO A;  1BQM A;  3ZSX A;  3K5M A;  3DOK A;  4CED A;  2RN2 A;  1RT5 A;  4FM1 A;  5CYQ A;  1NK4 A;  1J53 A;  5FRO A;  3SCX A;  4FK0 A;  3SUO A;  3IAY A;  4CGG A;  3AVN A;  4HTU A;  3KLG A;  1LWE A;  4KTQ A;  1DTT A;  1VSI A;  4OVL A;  1QHT A;  4ZHR A;  4JRP A;  4C8K A;  3K57 A;  5JS2 A;  3CFO A;  3NHG A;  1BI4 A;  1GOA A;  1LW0 A;  2FC0 A;  3NH0 A;  4DU3 A;  1VRT A;  4FVM A;  1IG9 A;  3QNO A;  3QEX A;  3DLH A;  4BE0 A;  2F8S A;  3L2W A;  3ZT2 A;  4FJ5 A;  1VSK A;  4DFM A;  1KVB A;  1C1B A;  1K6Y A;  1NK7 A;  3LAL A;  4L8R B;  2KTQ A;  2KW4 A;  3H08 A;  4ID5 A;  5DK5 A;  4DMN A;  1YVU A;  1NJW A;  4CHP A;  2D0A A;  4DQR A;  1ZBL A;  1ZBU A;  1RDC A;  3TAF A;  1G15 A;  2WOM A;  3AA5 X;  2OYQ A;  3EZ5 A;  3KD1 E;  2B6A A;  3OYH A;  3AA3 A;  3PO5 A;  1FK9 A;  3OS0 A;  3QLH A;  4EZ6 A;  4CGD A;  4QAG A;  3ZSV A;  1NOY A;  1RT3 A;  2LSN A;  5KI6 A;  4W5Q A;  3ASM A;  1LWF A;  1WAJ A;  3QIN A;  4B9M A;  4KB0 A;  1U04 A;  4M3Z A;  4OPJ A;  1NJZ A;  1I39 A;  3AV9 A;  3AVI A;  1NJX A;  3E01 A;  4CJR A;  3ZSQ A;  4CIG A;  1C0U A;  3DM2 A;  1Z26 A;  3RMA A;  1TAQ A;  1Q8I A;  4CJK A;  4CIF A;  4DTP A;  3KLH A;  3DRP A;  3KK3 A;  2X74 A;  3K59 A;  2ETJ A;  4DSK A;  4JLH A;  1T05 A;  3SYZ A;  2WON A;  5J1E A;  3O3H A;  1KLM A;  4J2E A;  2DFE A;  1X9W A;  4BDZ A;  4Z4F A;  1Z25 A;  1BI4 B;  3OYE A;  2HMI A;  4FJN A;  2FBV A;  5CY4 A;  1TKX A;  1F21 A;  3LAN A;  4FW2 A;  3WNE A;  4I2Q A;  1EX4 A;  3I8D A;  2ITG A;  4FJJ A;  1RT6 A;  1QE1 A;  3V9X A;  1JLC A;  2KQ2 A;  3QNN A;  4KHN A;  4B9N A;  3RR7 A;  4PA1 A;  2IOC A;  4AHR A;  4CJ4 A;  1CXU A;  3TR8 A;  3TAN A;  4KB1 A;  4OKJ A;  4CF8 A;  1YTA A;  4YFU A;  4KI4 A;  1KCF A;  4HUG A;  4OPK A;  1DLO A;  3QEP A;  1RTH A;  4R5P A;  4KHU A;  2YNH A;  4FZX C;  3S3M A;  3LPT A;  4F4K A;  2VG6 A;  2HNY A;  4B9V A;  4F3O A;  3VQ7 A;  4HUE A;  3LP1 A;  1X1P A;  4Z4C A;  1QSL A;  1VSM A;  3DLB A;  5KTQ A;  4CHZ A;  4B8C A;  1HRH A;  4ZTF A;  3DRS A;  4DLG A;  3MEG A;  3QES A;  4EP4 A;  1ZBH A;  3UIQ A;  4HHT A;  3NF8 A;  3ZSZ A;  3KLI A;  1RDB A;  3LPU A;  4CGH A;  1EXQ A;  1WLJ A;  1S1X A;  2RPI A;  1KFD A;  3L2Q A;  2XHB A;  3PX6 A;  2FBT A;  4CGI A;  4MFB A;  2XY6 A;  4CHQ A;  3L2U A;  1BGX T;  1L3T A;  3RRG A;  4K8X A;  1Q9X A;  3HJF A;  3RRH A;  4CEE A;  2G8W A;  3HYF A;  2PZS A;  1C1C A;  1ZBI A;  3KKR A;  1C1A A;  2BE2 A;  3A2F A;  4Y1D A;  3ZSO A;  3QIP A;  2HHX A;  2B4J A;  4IFY A;  2B5J A;  2PY5 A;  3VQC A;  3MXI A;  4CJ3 A;  2KFZ A;  2X6N A;  4E1M A;  2I5J A;  4KV8 A;  3F9K A;  3QIO A;  4LH5 A;  2VWJ A;  1NK9 A;  2HHV A;  5HRS A;  4KHS A;  1RBR A;  3VQP A;  4ID1 A;  3IRX A;  2ATQ A;  1BIU A;  3SZ2 A;  3I0R A;  5E41 A;  1NK5 A;  4FZZ A;  2P5O A;  3MAQ A;  3SV4 A;  5SWM A;  4C8L A;  4IBN A;  3M8S A;  1KTQ A;  1JLA A;  3OJU A;  1TK8 A;  2OZM A;  3IG1 A;  3OYJ A;  4J2A A;  3HP6 A;  1GOC A;  3VQ8 A;  4BDP A;  1I3A A;  3DMJ A;  4GMJ B;  4AHV A;  3PX0 A;  5HP1 A;  4Z4G A;  4RG8 A;  2G8V A;  1DTQ A;  3TAR A;  3DLR A;  4FM2 A;  1WSE A;  3HPG A;  2X78 A;  1NK6 A;  4JS5 A;  2YV0 X;  4AH9 A;  5I42 A;  5HBM A;  3G10 A;  3T3F A;  2HHT A;  1CZB A;  2XO7 A;  4XIU A;  4DG1 A;  3OYF A;  1U49 A;  4J2B A;  4NYN A;  2HND A;  4YNQ A;  4M3R A;  3NBP A;  1SKR A;  3TAB A;  4FJ9 A;  4M3T A;  3NCI A;  1A5X A;  1VSH A;  2DFF A;  2PYL A;  4CFD A;  3QER A;  1JLQ A;  3KIO A;  4G1Q A;  4RW4 A;  3QEI A;  1LW2 A;  3VA0 A;  1U48 A;  1X9M A;  3DRR A;  3L2R A;  3RTV A;  4RW7 A;  2E6L A;  4FLX A;  1SL0 A;  1D9F A;  1RBT A;  3DLK A;  4DQP A;  4KI6 A;  2XY8 A;  5DMR A;  3KLE A;  3DLE A;  5KGW A;  4CEA A;  4EP5 A;  4OGC A;  4B9U A;  3THV A;  3ZSR A;  1WSG A;  4DSJ A;  3MEC A;  4DTU A;  4DF4 A;  3VQ5 A;  3VN5 A;  4CHO A;  2FBY A;  4O44 A;  2A1R A;  2PYJ A;  4CF0 A;  3SNN A;  2IS3 A;  5CZ1 A;  3TAQ A;  2OPS A;  4BAC A;  4CJQ A;  3S3N A;  4E3S A;  2YNF A;  2VG7 A;  4FJG A;  3K2P A;  5C24 A;  3OS2 A;  1FKO A;  1WAF A;  3LWM A;  4CHY A;  1YTU A;  4KKO A;  4CF1 A;  5HRO A;  2AJQ A;  4CEF A;  4F8R A;  4KHQ A;  3TWH A;  1KRP A;  4W5O A;  4FW1 A;  4I7F A;  2QKK A;  4DFK A;  1RT1 A;  3QEV A;  4HCC A;  1EET A;  2KFN A;  2F8T A;  4W5R A;  4CJP A;  4FLW A;  3NFA A;  1TAU A;  1KLN A;  1IKX A;  3ZSY A;  1CLQ A;  2R7Y A;  4W5T A;  1S5J A;  1WNS A;  4FXD A;  1IKW A;  5CZ2 A;  2KZM A;  2Z1J A;  4CEB A;  3CQ8 A;  3EY1 A;  2P1J A;  3L3U A;  1XHZ A;  2OPR A;  3P5J A;  5HRP A;  3KK1 A;  5KRS A;  3V9W A;  4KTW A;  3JSM A;  4CFA A;  4CK3 A;  4NYF A;  1T03 A;  3DOL A;  1S6P A;  1JL1 A;  4DTX A;  4DQI A;  3V1Q A;  4DTS A;  2W42 A;  4LH4 A;  4E7K A;  1QTM A;  3TAE A;  2X6S A;  1YT3 A;  4O4G A;  3HL8 A;  3WNF A;  4PY5 A;  3KD5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...