4CHQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 52
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chqA00
1BISA 3A2FA 1YTAA 2HMIA 3TAPA 4ICLA 4RW9A 4PUOA 3NH0A 4DQRA 1J5OA 1J9AA 1LWEA 1C0TA 3V9WA 2GUIA 4RW8A 1XI1A 3DYAA 3NBPA 3KLGA 3HM9A 4FM0A 1BQMA 2Y1IA 1UA0A 4Z0UA 2VG6A 2QKKA 4FJIA 2BANA 3K2PA 1J53A 1ZBHA 3L2WA 2G8IA 1VRUA 4EP5A 3P1GA 5SWMA 3U6FA 3ASMA 5DK5A 5D3GA 1RDDA 4Z4HA 3IG1A 3ZSXA 4JRPA 4FJHA 3AVJA 2G8KA 4KREA 5J2QA 2FBVA 2OA8A 3B6OA 4H8KA 2KZZA 1CZ9A 1TL3A 1KLNA 1JLCA 4DLEA 1HYVA 4DQPA 4N41A 4HHTA 4DFJA 1B9DA 1QHTA 1VSFA 2PYLA 3ZT4A 1C1AA 4N76A 1RDCA 2IS3A 2X74A 2OPQA 4O5BA 4JRQA 3QEVA 3P5JA 3OYIA 2HHWA 4CK1A 3PUFA 4RW7A 3CQ8A 3QEXA 3OYMA 1UWBA 3OYDA 4FJ9A 3KKRA 5C25A 4OLBA 3U3GA 1L3VA 5FRNA 3VQPA 4QAGA 4IFVA 3L3UA 2P5GA 2HHUA 3NH2A 4CHOA 4H4OA 3DOKA 3IAYA 4Z4EA 4DSKA 2XY6A 1S1UA 3G10A 3V9UA 3SCXA 1KLMA 2B5JA 3WNEA 4YNQA 4CJLA 1TGOA 3L8BA 4DU1A 1KVAA 1U45A 3KD1E 4FK0A 3AVKA 3LP3A 3SUQA 2AJQA 1UOCA 3SQ1A 4CCHA 3OJUA 1CXUA 1FK9A 3TARA 5HLFA 3DLRA 4B9NA 3HPGA 4FVMA 1TAQA 1HPZA 4ID5A 3NGZA 2DTUA 1ZBUA 3ZSQA 3ZSWA 4ELVA 3ULDA 3I8DA 2G8FA 2O4GA 2KFNA 1KVBA 1LV5A 3CM5A 2EX3A 3VQQA 1RBUA 4CEZA 3JYTA 3OS2A 4I7FA 3LWLA 5CYQA 4FM1A 3SPZA 1T8EA 2RN2A 4M42A 4CERA 4DU3A 4FJGA 1IKYA 1SL0A 3F9KA 2YNIA 2Z1HA 4KFBA 4EP4A 4CIFA 4RW4A 3HP6A 3K58A 4EZ9A 3O3FA 2ITGA 4CEBA 2ATQA 2DFFA 4B9UA 1CLQA 4PQUA 3TAGA 1S1XA 2HVHA 3T1AA 1X9WA 2KFZA 4N47A 2WOMA 1NKBA 1T7PA 3F73A 4KI6A 1BCMA 2I5JA 2BGGA 1S6PA 1JKHA 1IKXA 4PA1A 5EU7A 1RT7A 2XY8A 4CK2A 1WAFA 4DQIA 5KRTA 1TKDA 1FXXA 4B9LA 4FW1A 1S5JA 4OVLA 1JL2A 2QXFA 4OGCA 3IRXA 4O4GA 2IDOA 3UIQA 3SI6A 3KTQA 1KFSA 4FW2A 4AHRA 1BQNA 2XHBA 4DTOA 3U3YA 1DTTA 1KCFA 1TKTA 2DFHA 4K8ZA 4I2PA 3PO4A 3OYEA 4F3OA 4M3XA 3D45A 4CJVA 4HUGA 5KGWA 4KPYA 3VN5A 3MEEA 3V9SA 5HRPA 1S9GA 2X78A 3AVBA 2YNHA 3ZT3A 3G0ZA 3OYCA 3KK1A 4JS4A 1R0AA 4CF0A 1QSLA 4B3OA 4DMNA 4E7HA 1LAVA 1I39A 4BWMA 4DWIA 5CYMA 3AO5A 1TV6A 1L3UA 4M3ZA 4DSFA 1RTDA 3ITHA 3T3FA 4NCBA 3NGIA 4ZHRA 3HPHA 4DU4A 1SKRA 3V1OA 1N5YA 4CJEA 3THVA 3QINA 3KK3A 3KIOA 1JXBA 4DFMA 3V9XA 3SUNA 3HSTB 4CESA 4BE0A 2A1RA 2G8WA 1S6QA 3WNGA 1U4BA 1YT3A 1BL3A 4WE1A 1KSPA 1TL1A 4DTSA 2ZQBA 2HHSA 1C0UA 3LZIA 3VQ9A 4DQSA 1Q8IA 4W5OA 3O4NA 4CJ3A 3S3MA 4AHUA 4FZXC 3VQ6A 3AVHA 1A5VA 3VQEA 1XHZA 3C6UA 4DG1A 3OS1A 1F21A 3QEWA 4DTRA 3HJFA 4M41A 3VQCA 4CJRA 4YFUA 1S1WA 2FBXA 2X6NA 3M8SA 3S3OA 3SUOA 2X6SA 4KB1A 2OZMA 4BACA 3MEGA 3VQBA 3OYKA 2OYQA 4HVJA 3I0SA 1SL1A 3DOLA 3TR8A 4IKFA 4KHQA 4F3TA 1A5WA 3KLFA 2B6AA 2D0BA 2YKMA 3LANA 3M8PA 4KB0A 4CJPA 4IDKA 4DLGA 1S1VA 4W5NA 4I2QA 1KFDA 1NKEA 4Y1DA 1UA1A 1RTJA 3AO3A 4CF9A 2Y1JA 3C6TA 4DTUA 1B9FA 1WLJA 3NHGA 4FJLA 4DSEA 1JLGA 2XY5A 3HVRA 1NK6A 3L3VA 2KZMA 3RMCA 1SL2A 3SQ0A 4G1QA 4Z4CA 2DY4A 1RDAA 4DSJA 1BGXT 3AVAA 3TAMA 4CGGA 4CFBA 1GOAA 1TK8A 2F8SA 1LW0A 4DF4A 1Y97A 3RR7A 1QQCA 1RNHA 4DTNA 3OY9A 4CEQA 2XY7A 2WONA 2FC0A 3S9HA 4KHNA 1VRTA 4B9MA 3K5LA 3LALA 4W5TA 3TANA 4CF2A 1NJZA 1WAJA 3EZ5A 2HNZA 1C0MA 3LPTA 2OPRA 1DTQA 4B08A 4CJWA 3LZJA 2R7YA 4PY5A 1ZBFA 4CK3A 3CFPA 3CFRA 1KVCA 2OPPA 4FJ7A 1VSHA 1LWFA 4KHYA 1RDBA 2E6MA 1U48A 3LP1A 2IOCA 3NCIA 3AVNA 1D8YA 4QOZB 2DFEA 3MXJA 4DQQA 4O0IA 3ZSRA 1BI4A 4DTXA 4B9VA 4E1NA 1NK9A 3ZSOA 3PX0A 4CF1A 3H08A 1K6YA 3RWUA 3EYZA 3MAQA 4CJ4A 2JLEA 2VWJA 4FJXA 5HP1A 4BWJA 3KLEA 4KTZA 3ZCMA 4CGJA 5J1EA 3K5MA 3TWHA 4MQ3A 4AHVA 3ZSYA 4OKEA 3HPOA 3QNNA 1BHLA 3SNNA 4FLWA 4LD0A 5J2PA 3ZT0A 1U47A 4GMJB 3AO2A 4IG0A 1TKZA 1U49A 4AHCA 1L5UA 1IKWA 4CJTA 4M3TA 1LWCA 3SYZA 2VG5A 3LAMA 4CHNA 1A5XA 4LY7A 2HVIA 4E7IA 1YTUA 3DLGA 1NOZA 3RMBA 3T19A 3DLHA 4DTJA 5CY4A 1XWLA 2YV0X 3AA5X 5HRRA 3TAQA 2OPSA 3AO4A 3AVLA 4DS5A 4J2AA 3HP9A 4CGHA 3DI6A 1L3SA 2HW3A 3WNFA 3CFOA 3VQ8A 4E1MA 1TAUA 2YKNA 3IS9A 1IO2A 4I9QA 3QERA 3SQ4A 4Z4FA 1UAXA 4CEAA 1T03A 2D5RA 4W5RA 1Z25A 4Z4GA 4OGEA 3D0PA 4C8NA 4C8KA 4EZ6A 3ALYA 3AO1A 3K5NA 1EKEA 4ELTA 4PWDA 2BE2A 3V81A 1HJRA 2VWKA 3O4QA 4FJKA 4LSNA 1HMVA 3BDPA 4QCLA 3K59A 3VA3A 2HHQA 2O4IA 3AA4A 4FCYA 3PX6A 4CEEA 3DM2A 1FKOA 4TSXA 1BIZA 1C1CA 1U04A 3P83D 5KI6A 4E19A 4XIUA 1EX4A 4B8CA 3B6PA 1SUQA 1WSFA 4LSLA 4AH9A 3NAEA 5C24A 3QEPA 1L3TA 2P5OA 4BE2A 4M45A 3LP2A 4CHQA 3L2UA 1WN7A 4BDPA 1B92A 3PY8A 1REVA 4FLZA 4KO0A 4KRFA 1HNVA 4CHYA 5FROA 3SJJA 1QS4A 4LH4A 1VSEA 3V6DA 2QK9A 1RTIA 4NYNA 4N56A 3TAFA 3VQ5A 3AVMA 2ZE2A 2HHTA 4B9TA 4C8MA 3AVGA 1JXEA 2G8HA 4OLAA 3DRSA 4FLVA 1NJYA 2Z1GA 3HVTA 3NF9A 3M8QA 1SKSA 3HL8A 5KRSA 2NUBA 1NJWA 1S1TA 1HQUA 1ASUA 1WSHA 2IC3A 3L2VA 1JLQA 4HUEA 3OYNA 3SQ2A 3MXIA 5HRNA 4FLXA 1SV5A 4C8OA 1WSIA 4M3UA 3OJSA 3BGRA 1QE1A 1JLEA 2GV9A 1HQEA 3MEDA 4AHTA 4J2DA 1JL1A 1VSIA 4CJKA 4C8LA 3HK2A 4FK2A 4E7JA 1RILA 2YHBA 1SKWA 4FK4A 3AA3A 1EXQA 1X9SA 1KTQA 4CFCA 3RRGA 1VSDA 4GW6A 2FBYA 3NF7A 4IG3A 3VQDA 4DSLA 3NF8A 5I3UA 3HYFA 3AVCA 3DRRA 1CXQA 4RG8A 3AVFA 3DMJA 1VSJA 1NK5A 2RF2A 4KTQA 1RBSA 1XHXA 3NDKA 2PZSA 2HNDA 3LDSA 3V1RA 1WSJA 3HT3A 2BDPA 4FJ8A 2ZD1A 3CG7A 1MU2A 4OKJA 2FBTA 3KLIA 2VG7A 5E41A 4HTUA 2XRIA 3NF6A 4CGFA 3QEIA 3NGYA 3E01A 3O3GA 3SV4A 1WNSA 2RKIA 3LPUA 2E6LA 3SPYA 4JS5A 3QETA 4KHSA 2W42A 1TVRA 4Q5VA 3O3HA 1Q9XA 3LP0A 2HB5A 1HYSA 3I0RA 1X9MA 1RTHA 2IGIA 3LAKA 3PX4A 2P51A 4Q0BA 2ETJA 2KW4A 3QIPA 1ASVA 2PY5A 1D9FA 2KQ2A 1S9EA 1VSMA 1RT6A 3OYAA 1BCOA 3JSMA 4FM2A 5SZTA 1YVUA 2OZSA 4AILC 4FZYA 1EP4A 5FDLA 4M3RA 3KLHA 2G8VA 3TAEA 1QSYA 3V4IA 1VK0A 5I42A 1EETA 4OKKA 3SUPA 4ELUA 4KI4A 1RT1A 1RT5A 4B8AB 4E7KA 1W0HA 1NOYA 4E89A 4J2BA 1D9DA 3TABA 2Z1IA 3CYMA 3DLBA 4KHWA 4O44A 1VSKA 5JS2A 4E7LA 3VA0A 5J2MA 1BIUA 5J2NA 1KRPA 4FJNA 4GVMA 4CEDA 1Q9YA 3ZT1A 1LW2A 3ZSVA 1BI4B 4CHPA 4DF8A 3QIOA 3OYLA 2HHXA 4F4KA 3PV8A 1HYZA 4CECA 5KGXA 1T05A 5FRMA 2HNYA 4HCBA 1W9HA 3QO9A 4BDYA 4CEOA 5C42A 4FYDA 2YNGA 3V1QA 1TK0A 2F8TA 1O1WA 3CM6A 4R5PA 1QSSA 4W5QA 2YHAA 3VQAA 4L8RB 4FJ5A 4E3SA 1DLOA 4KKOA 2XO7A 5KTQA 3RRHA 1NK0A 4O55A 3AV9A 4FLUA 3MECA 2B4JA 3L2QA 1ZYQA 4DFPA 3ISNC 2IAJA 3OYBA 3ZSZA 1NJXA 4F2SA 3V9ZA 4KAZA 1NK7A 4I9LA 3KKSA 4H4MA 3RTVA 2D0AA 4DS4A 4IBNA 1IG9A 1N6QA 3OS0A 1D5AA 4Y1CA 2P1JA 1ZBIA 4NCAA 4CJFA 4CJUA 1TK5A 3OYGA 2F96A 3FFIA 1X1PA 4F8RA 3SZ2A 4NYFA 1JLBA 3QLHA 3AVIA 1WSEA 3AA2A 4IFYA 1XC9A 1QTMA 2KTQA 4OPKA 4M3YA 1CZBA 2E4LA 4AHSA 3RMAA 4UQGA 5DMRA 4CIEA 3OYHA 5HROA 4E0DA 3LWMA 1TKXA 4OPJA 5HBMA 3QNOA 4ZTFA 4FJMA 4OJRA 2GBZA 4DSIA 4DFKA 3RMDA 2Q3SA 1C6VA 4FXDA 1RBVA 4CFDA 3HO1A 1IKVA 4CGDA 4J2EA 2A1SA 4LH5A 1RT4A 4DTPA 3HXMA 5CZ2A 1FKPA 1VSLA 3K5OA 3EY1A 4B9SA 1WSGA 4BE1A 4HCCA 1RBTA 4CGIA 4Z4IA 3KK2A 3OVNA 1RT2A 4CJSA 4FLYA 3QESA 3TI0A 3MXMA 4FZZA 1J54A 1HRHA 3VQ4A 3NE6A 2RPIA 4CIGA 3VQ7A 1ASWA 1GOBA 4N5SA 4HUFA 4RW6A 5HRSA 4CF8A 1ZBLA 3DLKA 2Z1JA 5CZ1A 4BDZA 4FLTA 4CJ5A 2EHGA 1Z26A 1GOCA 1RBRA 4O0JA 1NK8A 4FJJA 1IH7A 4CEFA 3OYJA 3DRPA 2D0CA 3RR8A 1G15A 2JGUA 4K8XA 1LAWA 4JLHA 1JLFA 3L2RA 2PYJA 4KV8A 5T7BA 3KJVA 4M3WA 2LSNA 3DLEA 2HHVA 4CHZA 1ITGA 5JS1A 1I3AA 1RCHA 4ID1A 3M8RA 3ZT2A 3S3NA 1NK4A 2G8UA 1RT3A 1NKCA 5K14A 4MFBA 2YNFA 3K57A 3PO5A 2QKBA 3NH1A 3KD5E 3SV3A 3NFAA 4CJQA 3C95A 4NCGA 1HNIA 3OYFA 1C1BA 4F2RA 4ZTJA 4CFAA 4DTMA 4KHUA 3WNHA 1JLAA 4CE9A 3C94A 4KTWA
chains in the Genus database with same CATH superfamily
1VQPN 3TAPA 1J5OA 1J9AA 3O1BA 5AQZA 2ZM6K 4OPHA 1BQMA 3A0IX 5JVGL 3WQUA 2VG6A 4IDHA 3E9OA 3GDQA 2G8IA 1GLBG 1VRUA 3ASMA 5D3GA 3CF5L 1G99A 4IJAA 2W40A 2G8KA 2OA8A 3B6OA 1CZ9A 1TL3A 3CXCM 1HYVA 4LC9B 4HWIA 3ENHA 4DFJA 4ISEA 3ZT4A 4JYAK 4BGBA 3QEVA 4LF6K 3OYIA 3PUFA 3CQ8A 3R6MA 4JI3K 3KKRA 3U3GA 1L3VA 3CIPA 4A2AA 2NRWA 4B1WB 4DSKA 3SCXA 1S72N 2B5JA 1KVAA 1U45A 3AVKA 5LJVA 5HLFA 4B9NA 4FVMA 3NGZA 1HPZA 4ID5A 3ZSQA 2O4GA 4EAHD 4CZIA 2KFNA 1LV5A 3CM5A 1RBUA 4CEZA 2A3ZA 2A6AA 4WFAL 4A2BA 5CYQA 1VQ4N 2RN2A 3O9UA 3ZEUA 3WEEA 4EHTA 3HP6A 4EZ9A 1NGGA 2DFFA 4CZLA 1OH5A 4PQUA 3TAGA 2HVHA 3DXMA 1HKCA 2KFZA 1W2BM 1K8KA 3CJCA 2WOMA 3MN9A 4GV9A 1JKHA 4PA1A 4B1XB 4DQIA 1WAFA 5ADXH 1TKDA 4FW1A 1HPMA 2HF4A 4M63C 4GV6A 2GWKA 4OGCA 1BDGA 2JWKA 1BOTO 3UIQA 3U4LA 1KFSA 4AHRA 2WC9A 3CPEA 1XC3A 1KCFA 3OYEA 5KGWA 2AP1A 3AY9A 2X78A 4BROA 2HHXA 2YNHA 4B3OA 4BVPA 1QSLA 4BWMA 3QMLA 1L3UA 4M3ZA 2KLAA 3L4QA 3HPHA 4CJEA 3QINA 1JXBA 4WQ5A 4DFMA 2NNWA 3UKRB 3PIOL 2A1RA 1S6QA 4I6MB 3OBWA 1X3NA 3VQ9A 2P9LA 1K8AO 1ATSA 4BRCA 1YAGA 1XHZA 2QWPA 4DG1A 3QEWA 3ZETA 4YORA 3VQCA 5HL7L 2FBXA 2Q97A 4FOIA 2X6SA 4KB1A 3VQBA 3RSEA 4YOVA 4GVEA 2D0BA 3M8PA 1TUYA 4O8UA 4DR4K 3TTDA 4CJPA 1ESVA 1NKEA 2VWBA 3U9DA 4BGAA 4BVOA 4A57A 4CZKA 4DUZK 3VEXA 3T69A 4DSEA 3HVRA 3L3VA 2KZMA 4C23A 4CJ7A 3A5LC 4KH6A 1Q86O 4BR4A 5KQ8A 1Y97A 3RR7A 5IT9O 1VQKN 5JMVA 3HOTA 3E9PA 2XY7A 4IO8A 4B3MK 1VRTA 4XH1A 3K5LA 3TANA 1IV0A 5AQJA 3EZ5A 3LZJA 4CJWA 4BRIA 1U2VB 4CZGA 3IUCA 1N33K 2AA4A 1LWFA 4KHYA 2E6MA 1U48A 3I33A 1Q7YO 1GLJO 3AVNA 4NB4A 1D8YA 4H0OA 2BTFA 3PX0A 4CF1A 3IMXA 2Q0UA 4A62A 2JLEA 4JI6K 3C65A 5HP1A 1Y64A 3KLEA 3WQTA 4MQ3A 1T44A 3CCEN 5GIPA 3QNNA 3MN7A 3D6RA 5J2PA 3H1VX 3O8MA 3Q7CA 1U47A 4DQ8A 4QS9A 4CJTA 2P9SB 4H0PA 3LAMA 4CHNA 4DB3A 2KHOA 4LY7A 3DAWA 1NOZA 3A5NC 3KWIA 3T19A 2ZWHA 3RMBA 2O8CB 3AA5X 3P39A 4DS5A 1YJNN 4J2AA 3HP9A 2RHKA 3AAPA 4CGHA 2HW3A 3A5OC 3VQ8A 3IS9A 1IO2A 3SQ4A 4CEAA 4YOUA 1HJOA 5BREA 5I9EB 4OGEA 1GLDG 3K5NA 4PWDA 5FLXO 1HJRA 3BDPA 3WT0A 2HHQA 2O4IA 5KPZA 3PX6A 4FCYA 4EZ6A 3NAEA 1SUQA 1WSFA 1L3TA 4FWSA 3O4WA 1U2VA 1D4XA 4BDPA 4IEIA 4FLZA 4LFCK 3ZEUB 4KRFA 1HNVA 4N56A 2I7NA 3AVMA 2ZE2A 2G8HA 1JXEA 2QM1A 4KH5A 3L6QA 1NJYA 3HVTA 3CC7N 3WUHA 2ZJQL 1S1TA 4PHTX 1NGIA 1WSHA 4UY8O 3OYNA 4GV3A 3HBTA 1QE1A 3C0BA 4H5NA 2GV9A 3MEDA 3HK2A 1JL1A 3QDKA 2YHBA 1SKWA 3AA3A 2HBMA 3ZYYX 4IOAL 3SLCA 4CFCA 1VSDA 2QWQA 4GW6A 2FBYA 4AM7A 3ATVA 4DSLA 1HX1A 3DRRA 1CXQA 4WQ4C 4KTQA 1XHXA 2HNDA 2PAVA 4JI2K 1WSJA 2E1ZA 4FJ8A 5EXWA 3ZETB 4OKJA 2FBTA 5E41A 5AQQA 3EL2A 4CGFA 3GBTA 1NJIO 1WNSA 2RKIA 3SPYA 3D2EA 2W42A 2O8BA 4Q5VA 1Q9XA 3LP0A 2HF3A 3PX4A 2ETJA 4BR9A 3IKMA 1ASVA 3QIPA 2KQ2A 1S9EA 4EIAA 1VSMA 2OTJN 4FM2A 4BRAA 2OZSA 4FVUA 3KLHA 3TAEA 3V4IA 2EWSA 4KI4A 4CW7B 1RT1A 1RT5A 1W0HA 1NOYA 4B3RK 4E89A 4J2BA 3VGLA 1D9DA 2Z1IA 1BA1A 5JS2A 1DKGD 4E7LA 1KRPA 4CZFA 5JVHL 4OO1J 4GVMA 1LW2A 3EZWA 1YVNA 3ZSVA 1ATRA 4BC3A 3QIOA 1J5EK 4ILJA 1T05A 4CECA 5KGXA 3H3NO 1RDUA 2RE2A 1S22A 1QSSA 1BO5O 3D2FB 2YHAA 1QZ5A 3VQAA 3F2KA 4FJ5A 2XO7A 1NK0A 4K25A 4FLUA 3MECA 5LMNK 4YDUC 4DFPA 4F2SA 3Q7BA 3V9ZA 4IO9L 4I9LA 4H4MA 5H1SQ 1NM1A 3RTVA 1N6QA 3THXB 1TK5A 3OYGA 5FPNA 5EOYA 5F2RA 2YCHA 1SAZA 4BR5A 4NYFA 3SZ2A 1GLLO 3THWB 4IEEA 2P9LB 4AHSA 3RMAA 4XH4A 1IG8A 4MO5A 1KC8O 3QNOA 1OH8A 5MLCQ 5BR8K 4BRFA 3RMDA 4FXDA 3HO1A 2W6LA 4CGDA 4J2EA 3IDHA 4AF1A 1P90A 4DTPA 1FKPA 2D0PA 3K5OA 1IJJA 1WSGA 4CGIA 4Z4IA 4BRGA 1VAZA 3QESA 5ELZA 3TI0A 1WUAA 2RPIA 3VF2A 4CIGA 1MDUB 2QW9A 5HRSA 2Z1JA 4CJ5A 3CI5A 2EHGA 3FZHA 4IZ9A 1RBRA 4X64K 1NK8A 3G71N 1QQNA 2JGUA 4A5BA 4CHZA 5JS1A 4JKHA 1I3AA 3S3NA 1NK4A 2G8UA 1NKCA 5K14A 3PO5A 2YHXA 2O8FB 4CJQA 4NCGA 5AQMA 4F2RA 3JS6A 4KHUA 4CE9A 3SJHA 3BF1A 1YTAA 4FZZA 4PUOA 1LWEA 3V9WA 4FM0A 2Y1IA 3ZX3A 4B1YB 2HBJA 4FJIA 1S3XA 3K2PA 1ZBHA 4EP5A 5SWMA 3C7NB 3CCMN 1N36K 3DJCA 4Z4HA 3WXJA 3IG1A 4JRPA 1HNXK 4FJHA 3AVJA 3O9TA 4PKGA 3SAGA 2KZZA 1I94K 4H8KA 1X3MA 4DLEA 2NLXA 2UU9K 1QHTA 1C1AA 5AQVA 4JRQA 4DR5K 4CK1A 4B3SK 4RW7A 3BF3A 4M7XA 4X62K 4FJ9A 5C25A 4IFVA 1BWFO 2HHUA 2A42A 1S1UA 3G10A 3V9UA 1KLMA 3KD1E 3LP3A 3DXKA 4WCEL 1DEJA 1FK9A 3TARA 3DLRA 5BR9A 3ZSWA 3ULDA 2G8FA 3TTCA 4FL9A 3VERA 5AZJB 2EX3A 3VQQA 3JYTA 5AQUA 1T8EA 4M42A 2HMPA 1SL0A 2Z1HA 4EP4A 4AQYK 1JCGA 4B9UA 5E26A 3O1WA 3T1AA 2D4WA 3VETA 4BG9A 1XQSC 1MA9B 1WOQA 5AQFA 1YITN 1BCMA 2I5JA 4CZHA 2BGGA 5EU7A 2XY8A 1S5JA 1JL2A 1YJ9N 3KTQA 4FW2A 2XHBA 1W7AA 5M1NA 3U3YA 1MWKA 1E3MA 4JKAA 1TKTA 2DFHA 3PO4A 5HRPA 2H3GX 3G0ZA 4CF0A 4E7HA 2GX9A 2I7PA 3CJAA 3AO5A 4H5VA 3O9SA 4DSFA 1RGIA 3ITHA 3E66A 4NCBA 4WYBA 3NGIA 1RDWX 3V1OA 4DHYA 3KK3A 2OCEA 3V9XA 4CESA 2F4VK 4EHUA 1U4BA 1YT3A 1BL3A 1KSPA 4V19S 2ZQBA 1YXQA 3LZIA 1Q8IA 1NNEA 4W5OA 5BRFA 2HBLA 4CVNE 3VQ6A 3VQEA 4A5AA 1F21A 2E2NA 2P9KB 4CZEA 4JKCA 1S1WA 4EFHA 4PL7A 4YOYA 3MEGA 3OYKA 4F3TA 4E1JA 1SL1A 3DOLA 1A5WA 4H0TB 4IDKA 1S1VA 4H5RA 1KFDA 1RTJA 3AO3A 1TYQA 5C15A 5AQNA 1WLJA 2E2OA 4FJLA 2ASMA 2YI1A 5DM6L 3SQ0A 1N32K 4DSJA 3TAMA 4CGGA 1GOAA 1TK8A 5IWAK 1QQCA 4DTNA 1VQ8N 3OY9A 3SBGA 3MN5A 4ISFA 1JCEA 3FR0A 2FC0A 4H03B 3LALA 4M7YA 1WAJA 1SS6A 2HNZA 1C0MA 3LPTA 2OPRA 1DTQA 3SK3A 3HI0A 4PY5A 4CK3A 1FW6A 4B1ZA 2OPPA 5AZIA 2P9SA 2P9UA 3VEVA 3THWA 3H45C 1RDBA 4QOZB 3I8BA 3M5RA 3ZSRA 1BI4A 4B9VA 4BRQA 3H08A 1K6YA 3EYZA 3AGKA 3KHYA 1NGDA 3LDQA 5J1EA 3AAQA 3K5MA 4OKEA 2GELA 3E1YA 3FLCO 4GMJB 3AO2A 4IG0A 1TKZA 1IKWA 3SYZA 2VG5A 1YTUA 3O9RA 3DLGA 3DLHA 4R79A 1XWLA 3CJ1A 3TAQA 4E1MA 4DV7K 1TAUA 4I9QA 4JN4A 4Z4FA 1NWKA 1QZ6A 4BRKA 4W5RA 5C10A 3VF6A 2QEXN 3ALYA 3NVMA 3R1XA 5AQWA 3O4QA 4JEPA 1HMVA 3VGKA 3AA4A 3DM2A 1VHXA 4TSXA 1BIZA 1C1CA 4K43A 3KLFA 5A2QO 4X65K 4XIUA 4LSLA 3J7YP 3ULEB 4BE2A 3PIPL 2E8AA 2QA4N 1REVA 3GE1A 5AQTA 3OA9A 1SQKA 4DV0K 2PBDA 4NYNA 3TAFA 3EN9A 3VQ5A 3FE1A 3DRSA 4KHPK 4PKIA 1NJWA 4FPBA 3P38A 1JLQA 3MXIA 3SQ2A 3O08A 5HRNA 1WSIA 1H1VA 4DR7K 1HQEA 2ASPA 4CJKA 1ZXOA 4Z94A 3FZLA 1RILA 3P31A 4FK4A 2V7ZA 3MCPA 4U7BA 3D2FA 3MX5A 4LF5K 4IG3A 3NF8A 3CCQN 2VQFK 3AVFA 3DMJA 1VSJA 2RF2A 4KH4A 1RBSA 2PZSA 4JI4K 1NGAA 3JXUA 3HT3A 1M90O 2ZD1A 3CG7A 4DV6K 3OW2M 2XRIA 3QEIA 1EO1A 3E01A 5AZJA 3LPUA 3ATUA 5GADP 1TVRA 2QI2A 3I0RA 1X9MA 2YX6A 1RTHA 2BUPA 4Q0BA 5M1FA 3MWPA 2GTDA 2WUSA 1Z6RA 3MX2A 3OYAA 3JSMA 1EP4A 3DXMB 3VF4A 4M3RA 1BG3A 2CH6A 1EETA 4OKKA 3EO3A 3SUPA 4ELUA 4B8AB 4YOWA 5CE3A 5FPMA 3J7ZO 5GAGP 4JKDA 4CEDA 1N34K 2J4RA 3C6HA 3DXKB 3ZT1A 4WQ4A 3NMUA 4DF8A 1R59O 2HOEA 3WXLA 2P9IB 3CJBA 5FRMA 4HCBA 1W9HA 3QO9A 4FYDA 4OPAA 4CD1A 4E3SA 1DLOA 4KKOA 4BR7A 5KTQA 2Q2RA 3AV9A 2OANA 1ZYQA 4CBXA 3KKSA 2D0AA 4IBNA 1IG9A 3OS0A 2HBKA 4NCAA 1ZBIA 4CJFA 3LDLA 4IJNA 2O8DB 1X1PA 3VEWA 1T6DA 1JLBA 1QTMA 3AA2A 1XC9A 1W97L 4UQGA 3CETA 4JK7A 2Q31A 3LWMA 2W41A 4JAXA 2FSJA 4OPJA 4FJMA 4ZTFA 5BN8A 2D1KA 4DFKA 2Q3SA 1E4FT 4CFDA 1IKVA 2ZF5O 5BRHA 4LF4K 3HXMA 4LFAK 4B9SA 4BE1A 1GLAG 5AQLA 4CJSA 1OH7A 4FLYA 1VQ9N 5JLFA 2GWJA 4B1UB 1GOBA 4N5SA 2QXLA 4LF8K 4CF8A 4BDZA 5CZ1A 1LOTB 4FLTA 1Z26A 4FJJA 1IH7A 4CEFA 5FPEA 3OYJA 1G15A 3L2RA 2PYJA 4PKHA 4M3WA 2LSNA 3DLEA 1M1KO 1U6ZA 3ZT2A 4FO0A 3LDNA 4B9QA 4NO7A 3CQXA 3K57A 2QKBA 3UKUA 3KD5E 1HNIA 3VEOA 1BU6O 1GLCG 4ZTJA 5CR4A 4JI1K 4KTWA 4CZMA 1BISA 3A2FA 2HMIA 3CJ7A 4RW9A 3NH0A 4DQRA 4BRLA 3IFRA 2GUIA 4RW8A 3UB5A 5AQGA 3KLGA 3NBPA 5EX5A 1XI1A 4BR0A 5AQPA 4Z0UA 2QKKA 1J53A 2P9IA 3HTVA 3L2WA 3M3ZA 3P1GA 3U6FA 3N4PA 5DK5A 1RDDA 1NGBA 4L3QA 3CCJN 1C0GA 5J2QA 2FBVA 3FZKA 3J7AP 1KLNA 4JD2B 4DQPA 4HHTA 4JKFA 1VSFA 2WTUA 1RDCA 2IS3A 4JV5K 4DR1K 3P5JA 3OYMA 2OTLN 1NGCA 4OLBA 4FWOA 4JNEA 5FRNA 3L3UA 2P5GA 4QS7A 4CHOA 4H4OA 3IAYA 2IIRA 4Z4EA 5GAHP 4MLEA 2XY6A 1K8KB 4YNQA 4CJLA 4DU1A 3E9LA 3SUQA 2AJQA 3SQ1A 3J8AA 1CXUA 3QICA 1Q81O 2DTUA 1ZBUA 1E4GT 3VMFB 3I8DA 1WBDA 4LF7K 4FPAA 1VQ6N 3OS2A 4I7FA 5EY4A 5AQRA 4FJGA 1IKYA 5M1KA 3CCVN 2YNIA 4KFBA 3K58A 4RW4A 1Z05A 2YJEA 2ITGA 2ATQA 1CLQA 3MK6A 1HNZK 1S1XA 4N47A 4DUYK 1OVQA 1NKBA 1KAYA 1T7PA 3F73A 4KI6A 1WB9A 2IVOA 4CK2A 2NRZA 1FXXA 2P9NB 4OVLA 2QXFA 2NRHA 3VTIA 4O4GA 2IDOA 4XH5A 4C1NK 4DTOA 1DTTA 1GLEG 5LY3A 3OHRA 3D45A 4GNIA 4HUGA 4KPYA 3VN5A 3MEEA 3KK7A 4F8RA 2D0OA 1R0AA 3OBYA 3K0SA 1JCFA 3EEQA 1LAVA 1I39A 5KQDA 1RTDA 2QWMA 4QS8A 4DU4A 1SKRA 2UUAK 3SUNA 4BE0A 4WE1A 4IXCA 3CCSN 1TL1A 2UYTA 4DQSA 3U9ZA 1VQNN 4AHUA 4FZXC 3HZ6A 3WEEB 2QWRA 3OS1A 4YOTA 3M8SA 3S3OA 2ZGZA 2OYQA 4KHQA 3TR8A 2A5XA 3ZX0A 5E84A 2FXUA 4KB0A 4DLGA 4W5NA 4Y1DA 1UA1A 2UUBK 3F5TA 4CF9A 1YF5L 4DR3K 1NK6A 3D2EB 2O8BB 3RMCA 1SL2A 3G4SN 4G1QA 4Z4CA 3QBWA 1RDAA 2DY4A 1BGXT 3AVAA 4OX9K 4CFBA 3QBXA 3GL1A 2F8SA 4DF4A 3GOIA 5KPRA 1RNHA 2FF6A 4CEQA 2CGLA 2WONA 4KHNA 4B9MA 1KXPA 4W5TA 2R7YA 3S41A 3FFKB 1ZBFA 1YIJN 3LM2A 1NU0A 1QQMA 4FJ7A 4BG8A 4BC5A 3LP1A 2GEMA 3NCIA 4RWTA 1XNRK 3VEYA 2DFEA 3MXJA 3KVGA 4DTXA 4H0YB 4K41A 4E1NA 3ZSOA 4H5TA 3RWUA 4H0XB 3MAQA 2VWJA 4FJXA 2VGNA 4FWQA 4BWJA 1SZ2A 4KTZA 3ZCMA 3TWHA 3HOSA 4CBWA 2WFBA 3RVCA 3SNNA 4FLWA 3I56N 3ZT0A 1U49A 1QHAA 4HTLA 4M3TA 1LWCA 2QWOA 1A5XA 2A40A 4CD3A 1YHQN 2HVIA 1ILYA 3I55N 3T7ZA 1T3VA 3CCRN 4DTJA 3AO4A 3AVLA 2O8DA 3DI6A 4BY9C 3CFOA 1QVFM 1X9JA 3QERA 1UAXA 1T03A 4C1NI 4BR2A 2D5RA 5AQKA 1Z25A 5AQXA 4Z4GA 4C8NA 4C8KA 3JAMO 3VPZA 1KAZA 3AO1A 1EKEA 2NRXA 1IBMK 4ELTA 4I6MA 2F7TA 4JI8K 3V81A 4QCLA 4LSNA 3G6EN 3VA3A 4CEEA 3HRGA 3B6PA 4AH9A 5C24A 4BC2A 2P5OA 3LP2A 1Q18A 4CHQA 3L2UA 3MWTA 4A59A 2HSTA 4KO0A 2W6KA 4H0VB 3QFPA 5FROA 4CHYA 1QS4A 1RFQA 4LH4A 3CMAN 3V6DA 3U8XA 2QK9A 3CCUN 3CERA 2HHTA 4C8MA 1V4SA 3AVGA 4XEIA 3NF9A 3M8QA 5KRSA 2NUBA 3LM9A 1TUUA 2IC3A 4HUEA 4X66K 1SV5A 5BRDA 3CMEN 4J2DA 4C8LA 4WFNL 3R8EA 4E7JA 4MDAA 5AFUH 1EXQA 5JICA 2VGMA 3NF7A 3MN6A 4NLBA 3AVCA 3TSUA 4RG8A 5AQYA 4GY2B 5LL6Z 2ZGYA 3V1RA 4BC4A 5AJ3K 2BDPA 2F9WA 5BPMA 3LDPA 2DPNA 5B8HA 1VQ5N 3O3GA 2E6LA 4JS5A 4KHSA 4A61A 2VYPA 3WXMB 2IGIA 3H1QA 4DKWA 1NGJA 2P51A 4U67L 2PY5A 3H6EA 1YVUA 1Q82O 3B8AX 2G8VA 4E7KA 3TABA 3DLBA 1QQOA 4KHWA 3M1FA 1VSKA 4BQLA 1YI2N 3VA0A 4NLCA 5J2NA 4YDUA 2P9UB 1Q9YA 5C12A 3VTHA 1BI4B 3BZKA 3F9MA 4IWVA 2A41A 4BRDA 4F4KA 1HYZA 4JI7K 2HNYA 4CEOA 2YNGA 3V1QA 2F8TA 1WBBA 4R5PA 4PL8A 4W5QA 5LMUK 4O55A 2ITMA 4DR2K 2B4JA 2V51B 2E20A 5GAEP 4LFBK 1KAXA 3ISNC 4YY3K 3OYBA 1NJXA 4KAZA 2O8FA 3MMVA 3AARA 1D5AA 2GUPA 3ENOA 2F96A 3FFIA 2HHHK 2FSKA 4FSVA 3QLHA 3AVIA 1WSEA 4IFYA 1BUPA 4M3YA 2E4LA 5DMRA 3OYHA 5HROA 4NXMK 3CQYA 4DSIA 4JKBA 1C6VA 1RBVA 4RTFD 4LH5A 3DWLA 5CZ2A 1VSLA 3EY1A 4DV2K 3L0QA 3KK2A 1RT2A 1ZC6A 3MXMA 1J54A 5AQSA 3VQ7A 1ASWA 3VESA 4RW6A 1ZBLA 4MLHA 2Q0RA 5KPTA 4O0JA 4GKJK 3RR8A 1LAWA 2CGJA 4KV8A 5T7BA 3KJVA 2HHVA 1ITGA 3C7NA 3DLLL 3QFUA 2E1YA 4FWLA 1RT3A 1ATNA 3W0LA 4MFBA 4BQZA 2YNFA 3TSQA 3ZX2A 5M1QA 2E2PA 3C95A 1OVYA 4DCHA 3OYFA 4CFAA 3G25A 4BRHA 3WNHA 4CJ4A 3TU5A 4ICLA 4DV4K 3GG4A 3VENA 1C0TA 4B3TK 3DYAA 1UA0A 3HM9A 1MWMA 4IOCL 4GKKK 2O8EB 1HUXA 2BANA 5F1XA 3L4IA 3ZSXA 3ENBA 2FLOA 2YHYA 4KREA 2IVPA 1JLCA 1YJWN 4N41A 1B9DA 4DV1K 3A8YA 2PYLA 4N76A 2X74A 4O5BA 2OPQA 1HR0K 2HHWA 3QEXA 1UWBA 3HSCA 3OYDA 1EWQA 1XNQK 3VQPA 4QAGA 3NH2A 3LL3A 1K73O 1FJGK 3DOKA 4IOXA 3WNEA 3O6WA 4FK0A 1TGOA 3L8BA 4B1VA 1UOCA 4KBOA 2ZJRL 3OJUA 4CCHA 1NGHA 5M1OA 3HPGA 1OKJA 1TAQA 3K9KA 1KVBA 4O5FA 4FM1A 3LWLA 3CC4N 3SPZA 4F9OA 2CGKA 2FF3B 4CERA 5TKWA 4DU3A 3F9KA 4BREA 4CIFA 3O3FA 4CEBA 3O80A 4MDBA 1X9WA 2E2QA 3D7EO 2YJFA 1S6PA 1IKXA 2ZJPL 5AQHA 1RT7A 5KRTA 4B9LA 2NRRA 4MO4A 4BRPA 4JI5K 3IRXA 2F9TA 3SI6A 1VQON 4K42A 3PLAA 1OH6A 1BQNA 4FOEA 4CBUA 4K8ZA 4I2PA 4F3OA 4M3XA 5GINA 4CJVA 1XUPO 1QVGM 4ELVA 3V9SA 3OYCA 1S9GA 3KK1A 3AVBA 3ZT3A 4JS4A 1K9MO 4DMNA 4DWIA 3J81O 5CYMA 1TV6A 3ID6A 3VGMA 1T6CA 3T3FA 4ZHRA 4JKEA 1N5YA 3THVA 3BZCA 1YUWA 2V7YA 3EKUA 3KIOA 3HSTB 2KKZA 3EE9A 2G8WA 3HM8A 3WNGA 2CH5A 4DTSA 2HHSA 1C0UA 2P9PB 3CCLN 3VEZA 3O4NA 4CJ3A 4CI6A 3S3MA 2JWLA 3AVHA 1A5VA 3C6UA 3CPWM 4DTRA 3HJFA 4M41A 4CJRA 4YFUA 3J80O 2X6NA 3SUOA 1HLUA 2OZMA 4BACA 4WQ5C 3I0SA 1NBWA 4HVJA 4IKFA 4BRMA 4Y0WA 5CHIA 2B6AA 2YKMA 3LANA 2FSNA 3UKRA 2YHWA 5AQOA 3THYA 5BN9A 4I2QA 1KD1O 2QWLA 5ADXA 2PFUA 2Y1JA 5JLHA 3C6TA 4DTUA 1B9FA 4RCHA 3NHGA 3BP8A 1JLGA 2XY5A 4ILGB 5TKYA 1BA0A 3T1YK 1VQMN 4FWMA 1TYQB 3CC2N 3VOVA 1LW0A 5F0XA 5EVZA 3SMPA 3OTOK 3SBTA 3S9HA 4JI0K 2ASOA 4CF2A 1NJZA 2WBNA 2BH1A 1DT9A 4B08A 3CFPA 3O5BA 3CFRA 1KVCA 4LF9K 3ULEA 1VSHA 2UXCK 2IOCA 3C6AA 4ILHA 4DQQA 2V52B 4O0IA 3O9QA 1NK9A 5AFUA 5DM7L 4CGJA 4AHVA 3ZSYA 4AM6A 3HPOA 1BHLA 4JKGB 4LD0A 1GLFO 4AHCA 5GIOA 3AGRA 1L5UA 3THYB 4E7IA 3EKSA 3K9JA 5CY4A 4FWRA 2YV0X 5HRRA 1NLVA 2OPSA 1XMOK 1L3SA 5C2FA 2VCPA 3WNFA 4J8FA 5HOOA 2YKNA 3TSPA 2E88A 5FPDA 3T1HK 3D0PA 1NGEA 2BE2A 2VWKA 4FJKA 3K59A 3NVKA 1FKOA 1U04A 3P83D 5KI6A 4E19A 1EX4A 4B8CA 3QEPA 4M45A 1WN7A 1B92A 2QTDA 3PY8A 1KQSM 4WFBL 3SJJA 1VSEA 1RTIA 4JKGA 4YHHK 3H3OB 4B9TA 1HNWK 1NGFA 4OLAA 4FLVA 2Z1GA 1SKSA 3HL8A 3MDQA 5LJWA 1ASUA 1HQUA 1IBLK 3L2VA 4FLXA 4M3UA 4C8OA 3OJSA 3BGRA 1JLEA 1DGKN 4AHTA 1VSIA 2Q1NA 4FK2A 4WF9L 3BEXA 3SMSA 3EE8A 1X9SA 1KTQA 3RRGA 5AR0A 1NMDA 3W3DA 3VQDA 2UXBK 5I3UA 3HYFA 2P9KA 1NK5A 1HKBA 3NDKA 2E5LK 3LDSA 1XMQK 5M1PA 1MU2A 3ZLJA 3KLIA 2VG7A 4HTUA 3NF6A 3NGYA 3SV4A 4G9ZA 3TTFA 2VQEK 3QETA 3O3HA 3KZBA 2HB5A 1HYSA 5C0YA 3FZMA 3LAKA 4JD2A 2KW4A 1D9FA 3N4QA 1RT6A 1BCOA 4O8KA 5SZTA 3CJ9A 4FZYA 4AILC 5FDLA 4K0KK 1LCUA 3BY5A 1QSYA 1VK0A 5I42A 3UE5A 3WXKA 4JHDA 3FZFA 1O13A 3CYMA 4O44A 1EQYA 4ISGA 5J2MA 1BIUA 4FJNA 4JK9A 3QB0A 4CHPA 3SAFA 3PSIA 4DR6K 3OYLA 1NG9A 3PV8A 1VQ7N 4BDYA 5C42A 1TK0A 3R3LA 1ZBSA 4H5WA 1O1WA 3CM6A 4L8RB 3WXIA 2IVNA 2Q36A 3PSFA 3RRHA 2NRVA 4DV5K 4JHDB 3L2QA 2IAJA 3ZSZA 5BPLA 3CHWA 1NK7A 4DS4A 4FWNA 4Y1CA 2P1JA 4CJUA 1HKGA 3M6GA 2KTQA 4OPKA 3MCAB 1CZBA 2O8EA 1VQLN 5AQIA 4CIEA 3A5MC 4E0DA 2O8CA 1IBKK 1TKXA 5HBMA 4OJRA 2GBZA 4YOXA 4FWPA 3RSEB 3ID8A 2A1SA 3BUZB 1NMNA 1V4TA 4NXNK 1RT4A 1J6ZA 3FGUA 3THXA 4IFEA 4FWKA 3CD6N 4HCCA 1C0FA 2P9PA 1RBTA 3OVNA 2NZTA 3UKUB 5C2DA 3VQ4A 1HRHA 3NE6A 1N8RO 3H46O 4HUFA 2QWNA 3DLKA 1CZAN 1GOCA 5AZIB 5BPNA 3DRPA 2P9NA 2D0CA 3R9PA 4K8XA 4JLHA 1JLFA 1JJ2M 4JK8A 1RCHA 4ID1A 3M8RA 3SAHA 3TPQA 3KWGA 2UUCK 4BRNA 2NRTA 1EWRA 3NH1A 3SV3A 3NFAA 3P4IA 1P8ZA 1C1BA 3LDOA 4DTMA 2UXDK 1JLAA 4CZJA 3C94A 4DV3K
chains in the Genus database with same CATH topology
1BISA 3A2FA 1YTAA 2HMIA 3TAPA 4ICLA 4RW9A 4PUOA 3NH0A 4DQRA 1J5OA 1J9AA 1LWEA 1C0TA 3V9WA 2GUIA 4RW8A 1XI1A 3DYAA 3NBPA 3KLGA 3HM9A 4FM0A 1BQMA 2Y1IA 1UA0A 4Z0UA 2VG6A 2QKKA 4FJIA 2BANA 3K2PA 1J53A 1ZBHA 3L2WA 2G8IA 1VRUA 4EP5A 3P1GA 5SWMA 3U6FA 3ASMA 5DK5A 5D3GA 1RDDA 4Z4HA 3IG1A 3ZSXA 4JRPA 4FJHA 3AVJA 2G8KA 4KREA 5J2QA 2FBVA 2OA8A 3B6OA 4H8KA 2KZZA 1CZ9A 1TL3A 1KLNA 1JLCA 4DLEA 1HYVA 4DQPA 4N41A 4HHTA 4DFJA 1B9DA 1QHTA 1VSFA 2PYLA 3ZT4A 1C1AA 4N76A 1RDCA 2IS3A 2X74A 2OPQA 4O5BA 4JRQA 3QEVA 3P5JA 3OYIA 2HHWA 4CK1A 3PUFA 4RW7A 3CQ8A 3QEXA 3OYMA 1UWBA 3OYDA 4FJ9A 3KKRA 5C25A 4OLBA 3U3GA 1L3VA 5FRNA 3VQPA 4QAGA 4IFVA 3L3UA 2P5GA 2HHUA 3NH2A 4CHOA 4H4OA 3DOKA 3IAYA 4Z4EA 4DSKA 2XY6A 1S1UA 3G10A 3V9UA 3SCXA 1KLMA 2B5JA 3WNEA 4YNQA 4CJLA 1TGOA 3L8BA 4DU1A 1KVAA 1U45A 3KD1E 4FK0A 3AVKA 3LP3A 3SUQA 2AJQA 1UOCA 3SQ1A 4CCHA 3OJUA 1CXUA 1FK9A 3TARA 5HLFA 3DLRA 4B9NA 3HPGA 4FVMA 1TAQA 1HPZA 4ID5A 3NGZA 2DTUA 1ZBUA 3ZSQA 3ZSWA 4ELVA 3ULDA 3I8DA 2G8FA 2O4GA 2KFNA 1KVBA 1LV5A 3CM5A 2EX3A 3VQQA 1RBUA 4CEZA 3JYTA 3OS2A 4I7FA 3LWLA 5CYQA 4FM1A 3SPZA 1T8EA 2RN2A 4M42A 4CERA 4DU3A 4FJGA 1IKYA 1SL0A 3F9KA 2YNIA 2Z1HA 4KFBA 4EP4A 4CIFA 4RW4A 3HP6A 3K58A 4EZ9A 3O3FA 2ITGA 4CEBA 2ATQA 2DFFA 4B9UA 1CLQA 4PQUA 3TAGA 1S1XA 2HVHA 3T1AA 1X9WA 2KFZA 4N47A 2WOMA 1NKBA 1T7PA 3F73A 4KI6A 1BCMA 2I5JA 2BGGA 1S6PA 1JKHA 1IKXA 4PA1A 5EU7A 1RT7A 2XY8A 4CK2A 1WAFA 4DQIA 5KRTA 1TKDA 1FXXA 4B9LA 4FW1A 1S5JA 4OVLA 1JL2A 2QXFA 4OGCA 3IRXA 4O4GA 2IDOA 3UIQA 3SI6A 3KTQA 1KFSA 4FW2A 4AHRA 1BQNA 2XHBA 4DTOA 3U3YA 1DTTA 1KCFA 1TKTA 2DFHA 4K8ZA 4I2PA 3PO4A 3OYEA 4F3OA 4M3XA 3D45A 4CJVA 4HUGA 5KGWA 4KPYA 3VN5A 3MEEA 3V9SA 5HRPA 1S9GA 2X78A 3AVBA 2YNHA 3ZT3A 3G0ZA 3OYCA 3KK1A 4JS4A 1R0AA 4CF0A 1QSLA 4B3OA 4DMNA 4E7HA 1LAVA 1I39A 4BWMA 4DWIA 5CYMA 3AO5A 1TV6A 1L3UA 4M3ZA 4DSFA 1RTDA 3ITHA 3T3FA 4NCBA 3NGIA 4ZHRA 3HPHA 4DU4A 1SKRA 3V1OA 1N5YA 4CJEA 3THVA 3QINA 3KK3A 3KIOA 1JXBA 4DFMA 3V9XA 3SUNA 3HSTB 4CESA 4BE0A 2A1RA 2G8WA 1S6QA 3WNGA 1U4BA 1YT3A 1BL3A 4WE1A 1KSPA 1TL1A 4DTSA 2ZQBA 2HHSA 1C0UA 3LZIA 3VQ9A 4DQSA 1Q8IA 4W5OA 3O4NA 4CJ3A 3S3MA 4AHUA 4FZXC 3VQ6A 3AVHA 1A5VA 3VQEA 1XHZA 3C6UA 4DG1A 3OS1A 1F21A 3QEWA 4DTRA 3HJFA 4M41A 3VQCA 4CJRA 4YFUA 1S1WA 2FBXA 2X6NA 3M8SA 3S3OA 3SUOA 2X6SA 4KB1A 2OZMA 4BACA 3MEGA 3VQBA 3OYKA 2OYQA 4HVJA 3I0SA 1SL1A 3DOLA 3TR8A 4IKFA 4KHQA 4F3TA 1A5WA 3KLFA 2B6AA 2D0BA 2YKMA 3LANA 3M8PA 4KB0A 4CJPA 4IDKA 4DLGA 1S1VA 4W5NA 4I2QA 1KFDA 1NKEA 4Y1DA 1UA1A 1RTJA 3AO3A 4CF9A 2Y1JA 3C6TA 4DTUA 1B9FA 1WLJA 3NHGA 4FJLA 4DSEA 1JLGA 2XY5A 3HVRA 1NK6A 3L3VA 2KZMA 3RMCA 1SL2A 3SQ0A 4G1QA 4Z4CA 2DY4A 1RDAA 4DSJA 1BGXT 3AVAA 3TAMA 4CGGA 4CFBA 1GOAA 1TK8A 2F8SA 1LW0A 4DF4A 1Y97A 3RR7A 1QQCA 1RNHA 4DTNA 3OY9A 4CEQA 2XY7A 2WONA 2FC0A 3S9HA 4KHNA 1VRTA 4B9MA 3K5LA 3LALA 4W5TA 3TANA 4CF2A 1NJZA 1WAJA 3EZ5A 2HNZA 1C0MA 3LPTA 2OPRA 1DTQA 4B08A 4CJWA 3LZJA 2R7YA 4PY5A 1ZBFA 4CK3A 3CFPA 3CFRA 1KVCA 2OPPA 4FJ7A 1VSHA 1LWFA 4KHYA 1RDBA 2E6MA 1U48A 3LP1A 2IOCA 3NCIA 3AVNA 1D8YA 4QOZB 2DFEA 3MXJA 4DQQA 4O0IA 3ZSRA 1BI4A 4DTXA 4B9VA 4E1NA 1NK9A 3ZSOA 3PX0A 4CF1A 3H08A 1K6YA 3RWUA 3EYZA 3MAQA 4CJ4A 2JLEA 2VWJA 4FJXA 5HP1A 4BWJA 3KLEA 4KTZA 3ZCMA 4CGJA 5J1EA 3K5MA 3TWHA 4MQ3A 4AHVA 3ZSYA 4OKEA 3HPOA 3QNNA 1BHLA 3SNNA 4FLWA 4LD0A 5J2PA 3ZT0A 1U47A 4GMJB 3AO2A 4IG0A 1TKZA 1U49A 4AHCA 1L5UA 1IKWA 4CJTA 4M3TA 1LWCA 3SYZA 2VG5A 3LAMA 4CHNA 1A5XA 4LY7A 2HVIA 4E7IA 1YTUA 3DLGA 1NOZA 3RMBA 3T19A 3DLHA 4DTJA 5CY4A 1XWLA 2YV0X 3AA5X 5HRRA 3TAQA 2OPSA 3AO4A 3AVLA 4DS5A 4J2AA 3HP9A 4CGHA 3DI6A 1L3SA 2HW3A 3WNFA 3CFOA 3VQ8A 4E1MA 1TAUA 2YKNA 3IS9A 1IO2A 4I9QA 3QERA 3SQ4A 4Z4FA 1UAXA 4CEAA 1T03A 2D5RA 4W5RA 1Z25A 4Z4GA 4OGEA 3D0PA 4C8NA 4C8KA 4EZ6A 3ALYA 3AO1A 3K5NA 1EKEA 4ELTA 4PWDA 2BE2A 3V81A 1HJRA 2VWKA 3O4QA 4FJKA 4LSNA 1HMVA 3BDPA 4QCLA 3K59A 3VA3A 2HHQA 2O4IA 3AA4A 4FCYA 3PX6A 4CEEA 3DM2A 1FKOA 4TSXA 1BIZA 1C1CA 1U04A 3P83D 5KI6A 4E19A 4XIUA 1EX4A 4B8CA 3B6PA 1SUQA 1WSFA 4LSLA 4AH9A 3NAEA 5C24A 3QEPA 1L3TA 2P5OA 4BE2A 4M45A 3LP2A 4CHQA 3L2UA 1WN7A 4BDPA 1B92A 3PY8A 1REVA 4FLZA 4KO0A 4KRFA 1HNVA 4CHYA 5FROA 3SJJA 1QS4A 4LH4A 1VSEA 3V6DA 2QK9A 1RTIA 4NYNA 4N56A 3TAFA 3VQ5A 3AVMA 2ZE2A 2HHTA 4B9TA 4C8MA 3AVGA 1JXEA 2G8HA 4OLAA 3DRSA 4FLVA 1NJYA 2Z1GA 3HVTA 3NF9A 3M8QA 1SKSA 3HL8A 5KRSA 2NUBA 1NJWA 1S1TA 1HQUA 1ASUA 1WSHA 2IC3A 3L2VA 1JLQA 4HUEA 3OYNA 3SQ2A 3MXIA 5HRNA 4FLXA 1SV5A 4C8OA 1WSIA 4M3UA 3OJSA 3BGRA 1QE1A 1JLEA 2GV9A 1HQEA 3MEDA 4AHTA 4J2DA 1JL1A 1VSIA 4CJKA 4C8LA 3HK2A 4FK2A 4E7JA 1RILA 2YHBA 1SKWA 4FK4A 3AA3A 1EXQA 1X9SA 1KTQA 4CFCA 3RRGA 1VSDA 4GW6A 2FBYA 3NF7A 4IG3A 3VQDA 4DSLA 3NF8A 5I3UA 3HYFA 3AVCA 3DRRA 1CXQA 4RG8A 3AVFA 3DMJA 1VSJA 1NK5A 2RF2A 4KTQA 1RBSA 1XHXA 3NDKA 2PZSA 2HNDA 3LDSA 3V1RA 1WSJA 3HT3A 2BDPA 4FJ8A 2ZD1A 3CG7A 1MU2A 4OKJA 2FBTA 3KLIA 2VG7A 5E41A 4HTUA 2XRIA 3NF6A 4CGFA 3QEIA 3NGYA 3E01A 3O3GA 3SV4A 1WNSA 2RKIA 3LPUA 2E6LA 3SPYA 4JS5A 3QETA 4KHSA 2W42A 1TVRA 4Q5VA 3O3HA 1Q9XA 3LP0A 2HB5A 1HYSA 3I0RA 1X9MA 1RTHA 2IGIA 3LAKA 3PX4A 2P51A 4Q0BA 2ETJA 2KW4A 3QIPA 1ASVA 2PY5A 1D9FA 2KQ2A 1S9EA 1VSMA 1RT6A 3OYAA 1BCOA 3JSMA 4FM2A 5SZTA 1YVUA 2OZSA 4AILC 4FZYA 1EP4A 5FDLA 4M3RA 3KLHA 2G8VA 3TAEA 1QSYA 3V4IA 1VK0A 5I42A 1EETA 4OKKA 3SUPA 4ELUA 4KI4A 1RT1A 1RT5A 4B8AB 4E7KA 1W0HA 1NOYA 4E89A 4J2BA 1D9DA 3TABA 2Z1IA 3CYMA 3DLBA 4KHWA 4O44A 1VSKA 5JS2A 4E7LA 3VA0A 5J2MA 1BIUA 5J2NA 1KRPA 4FJNA 4GVMA 4CEDA 1Q9YA 3ZT1A 1LW2A 3ZSVA 1BI4B 4CHPA 4DF8A 3QIOA 3OYLA 2HHXA 4F4KA 3PV8A 1HYZA 4CECA 5KGXA 1T05A 5FRMA 2HNYA 4HCBA 1W9HA 3QO9A 4BDYA 4CEOA 5C42A 4FYDA 2YNGA 3V1QA 1TK0A 2F8TA 1O1WA 3CM6A 4R5PA 1QSSA 4W5QA 2YHAA 3VQAA 4L8RB 4FJ5A 4E3SA 1DLOA 4KKOA 2XO7A 5KTQA 3RRHA 1NK0A 4O55A 3AV9A 4FLUA 3MECA 2B4JA 3L2QA 1ZYQA 4DFPA 3ISNC 2IAJA 3OYBA 3ZSZA 1NJXA 4F2SA 3V9ZA 4KAZA 1NK7A 4I9LA 3KKSA 4H4MA 3RTVA 2D0AA 4DS4A 4IBNA 1IG9A 1N6QA 3OS0A 1D5AA 4Y1CA 2P1JA 1ZBIA 4NCAA 4CJFA 4CJUA 1TK5A 3OYGA 2F96A 3FFIA 1X1PA 4F8RA 3SZ2A 4NYFA 1JLBA 3QLHA 3AVIA 1WSEA 3AA2A 4IFYA 1XC9A 1QTMA 2KTQA 4OPKA 4M3YA 1CZBA 2E4LA 4AHSA 3RMAA 4UQGA 5DMRA 4CIEA 3OYHA 5HROA 4E0DA 3LWMA 1TKXA 4OPJA 5HBMA 3QNOA 4ZTFA 4FJMA 4OJRA 2GBZA 4DSIA 4DFKA 3RMDA 2Q3SA 1C6VA 4FXDA 1RBVA 4CFDA 3HO1A 1IKVA 4CGDA 4J2EA 2A1SA 4LH5A 1RT4A 4DTPA 3HXMA 5CZ2A 1FKPA 1VSLA 3K5OA 3EY1A 4B9SA 1WSGA 4BE1A 4HCCA 1RBTA 4CGIA 4Z4IA 3KK2A 3OVNA 1RT2A 4CJSA 4FLYA 3QESA 3TI0A 3MXMA 4FZZA 1J54A 1HRHA 3VQ4A 3NE6A 2RPIA 4CIGA 3VQ7A 1ASWA 1GOBA 4N5SA 4HUFA 4RW6A 5HRSA 4CF8A 1ZBLA 3DLKA 2Z1JA 5CZ1A 4BDZA 4FLTA 4CJ5A 2EHGA 1Z26A 1GOCA 1RBRA 4O0JA 1NK8A 4FJJA 1IH7A 4CEFA 3OYJA 3DRPA 2D0CA 3RR8A 1G15A 2JGUA 4K8XA 1LAWA 4JLHA 1JLFA 3L2RA 2PYJA 4KV8A 5T7BA 3KJVA 4M3WA 2LSNA 3DLEA 2HHVA 4CHZA 1ITGA 5JS1A 1I3AA 1RCHA 4ID1A 3M8RA 3ZT2A 3S3NA 1NK4A 2G8UA 1RT3A 1NKCA 5K14A 4MFBA 2YNFA 3K57A 3PO5A 2QKBA 3NH1A 3KD5E 3SV3A 3NFAA 4CJQA 3C95A 4NCGA 1HNIA 3OYFA 1C1BA 4F2RA 4ZTJA 4CFAA 4DTMA 4KHUA 3WNHA 1JLAA 4CE9A 3C94A 4KTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIS A;  3A2F A;  1YTA A;  2HMI A;  3TAP A;  4ICL A;  4RW9 A;  4PUO A;  3NH0 A;  4DQR A;  1J5O A;  1J9A A;  1LWE A;  1C0T A;  3V9W A;  2GUI A;  4RW8 A;  1XI1 A;  3DYA A;  3NBP A;  3KLG A;  3HM9 A;  4FM0 A;  1BQM A;  2Y1I A;  1UA0 A;  4Z0U A;  2VG6 A;  2QKK A;  4FJI A;  2BAN A;  3K2P A;  1J53 A;  1ZBH A;  3L2W A;  2G8I A;  1VRU A;  4EP5 A;  3P1G A;  5SWM A;  3U6F A;  3ASM A;  5DK5 A;  5D3G A;  1RDD A;  4Z4H A;  3IG1 A;  3ZSX A;  4JRP A;  4FJH A;  3AVJ A;  2G8K A;  4KRE A;  5J2Q A;  2FBV A;  2OA8 A;  3B6O A;  4H8K A;  2KZZ A;  1CZ9 A;  1TL3 A;  1KLN A;  1JLC A;  4DLE A;  1HYV A;  4DQP A;  4N41 A;  4HHT A;  4DFJ A;  1B9D A;  1QHT A;  1VSF A;  2PYL A;  3ZT4 A;  1C1A A;  4N76 A;  1RDC A;  2IS3 A;  2X74 A;  2OPQ A;  4O5B A;  4JRQ A;  3QEV A;  3P5J A;  3OYI A;  2HHW A;  4CK1 A;  3PUF A;  4RW7 A;  3CQ8 A;  3QEX A;  3OYM A;  1UWB A;  3OYD A;  4FJ9 A;  3KKR A;  5C25 A;  4OLB A;  3U3G A;  1L3V A;  5FRN A;  3VQP A;  4QAG A;  4IFV A;  3L3U A;  2P5G A;  2HHU A;  3NH2 A;  4CHO A;  4H4O A;  3DOK A;  3IAY A;  4Z4E A;  4DSK A;  2XY6 A;  1S1U A;  3G10 A;  3V9U A;  3SCX A;  1KLM A;  2B5J A;  3WNE A;  4YNQ A;  4CJL A;  1TGO A;  3L8B A;  4DU1 A;  1KVA A;  1U45 A;  3KD1 E;  4FK0 A;  3AVK A;  3LP3 A;  3SUQ A;  2AJQ A;  1UOC A;  3SQ1 A;  4CCH A;  3OJU A;  1CXU A;  1FK9 A;  3TAR A;  5HLF A;  3DLR A;  4B9N A;  3HPG A;  4FVM A;  1TAQ A;  1HPZ A;  4ID5 A;  3NGZ A;  2DTU A;  1ZBU A;  3ZSQ A;  3ZSW A;  4ELV A;  3ULD A;  3I8D A;  2G8F A;  2O4G A;  2KFN A;  1KVB A;  1LV5 A;  3CM5 A;  2EX3 A;  3VQQ A;  1RBU A;  4CEZ A;  3JYT A;  3OS2 A;  4I7F A;  3LWL A;  5CYQ A;  4FM1 A;  3SPZ A;  1T8E A;  2RN2 A;  4M42 A;  4CER A;  4DU3 A;  4FJG A;  1IKY A;  1SL0 A;  3F9K A;  2YNI A;  2Z1H A;  4KFB A;  4EP4 A;  4CIF A;  4RW4 A;  3HP6 A;  3K58 A;  4EZ9 A;  3O3F A;  2ITG A;  4CEB A;  2ATQ A;  2DFF A;  4B9U A;  1CLQ A;  4PQU A;  3TAG A;  1S1X A;  2HVH A;  3T1A A;  1X9W A;  2KFZ A;  4N47 A;  2WOM A;  1NKB A;  1T7P A;  3F73 A;  4KI6 A;  1BCM A;  2I5J A;  2BGG A;  1S6P A;  1JKH A;  1IKX A;  4PA1 A;  5EU7 A;  1RT7 A;  2XY8 A;  4CK2 A;  1WAF A;  4DQI A;  5KRT A;  1TKD A;  1FXX A;  4B9L A;  4FW1 A;  1S5J A;  4OVL A;  1JL2 A;  2QXF A;  4OGC A;  3IRX A;  4O4G A;  2IDO A;  3UIQ A;  3SI6 A;  3KTQ A;  1KFS A;  4FW2 A;  4AHR A;  1BQN A;  2XHB A;  4DTO A;  3U3Y A;  1DTT A;  1KCF A;  1TKT A;  2DFH A;  4K8Z A;  4I2P A;  3PO4 A;  3OYE A;  4F3O A;  4M3X A;  3D45 A;  4CJV A;  4HUG A;  5KGW A;  4KPY A;  3VN5 A;  3MEE A;  3V9S A;  5HRP A;  1S9G A;  2X78 A;  3AVB A;  2YNH A;  3ZT3 A;  3G0Z A;  3OYC A;  3KK1 A;  4JS4 A;  1R0A A;  4CF0 A;  1QSL A;  4B3O A;  4DMN A;  4E7H A;  1LAV A;  1I39 A;  4BWM A;  4DWI A;  5CYM A;  3AO5 A;  1TV6 A;  1L3U A;  4M3Z A;  4DSF A;  1RTD A;  3ITH A;  3T3F A;  4NCB A;  3NGI A;  4ZHR A;  3HPH A;  4DU4 A;  1SKR A;  3V1O A;  1N5Y A;  4CJE A;  3THV A;  3QIN A;  3KK3 A;  3KIO A;  1JXB A;  4DFM A;  3V9X A;  3SUN A;  3HST B;  4CES A;  4BE0 A;  2A1R A;  2G8W A;  1S6Q A;  3WNG A;  1U4B A;  1YT3 A;  1BL3 A;  4WE1 A;  1KSP A;  1TL1 A;  4DTS A;  2ZQB A;  2HHS A;  1C0U A;  3LZI A;  3VQ9 A;  4DQS A;  1Q8I A;  4W5O A;  3O4N A;  4CJ3 A;  3S3M A;  4AHU A;  4FZX C;  3VQ6 A;  3AVH A;  1A5V A;  3VQE A;  1XHZ A;  3C6U A;  4DG1 A;  3OS1 A;  1F21 A;  3QEW A;  4DTR A;  3HJF A;  4M41 A;  3VQC A;  4CJR A;  4YFU A;  1S1W A;  2FBX A;  2X6N A;  3M8S A;  3S3O A;  3SUO A;  2X6S A;  4KB1 A;  2OZM A;  4BAC A;  3MEG A;  3VQB A;  3OYK A;  2OYQ A;  4HVJ A;  3I0S A;  1SL1 A;  3DOL A;  3TR8 A;  4IKF A;  4KHQ A;  4F3T A;  1A5W A;  3KLF A;  2B6A A;  2D0B A;  2YKM A;  3LAN A;  3M8P A;  4KB0 A;  4CJP A;  4IDK A;  4DLG A;  1S1V A;  4W5N A;  4I2Q A;  1KFD A;  1NKE A;  4Y1D A;  1UA1 A;  1RTJ A;  3AO3 A;  4CF9 A;  2Y1J A;  3C6T A;  4DTU A;  1B9F A;  1WLJ A;  3NHG A;  4FJL A;  4DSE A;  1JLG A;  2XY5 A;  3HVR A;  1NK6 A;  3L3V A;  2KZM A;  3RMC A;  1SL2 A;  3SQ0 A;  4G1Q A;  4Z4C A;  2DY4 A;  1RDA A;  4DSJ A;  1BGX T;  3AVA A;  3TAM A;  4CGG A;  4CFB A;  1GOA A;  1TK8 A;  2F8S A;  1LW0 A;  4DF4 A;  1Y97 A;  3RR7 A;  1QQC A;  1RNH A;  4DTN A;  3OY9 A;  4CEQ A;  2XY7 A;  2WON A;  2FC0 A;  3S9H A;  4KHN A;  1VRT A;  4B9M A;  3K5L A;  3LAL A;  4W5T A;  3TAN A;  4CF2 A;  1NJZ A;  1WAJ A;  3EZ5 A;  2HNZ A;  1C0M A;  3LPT A;  2OPR A;  1DTQ A;  4B08 A;  4CJW A;  3LZJ A;  2R7Y A;  4PY5 A;  1ZBF A;  4CK3 A;  3CFP A;  3CFR A;  1KVC A;  2OPP A;  4FJ7 A;  1VSH A;  1LWF A;  4KHY A;  1RDB A;  2E6M A;  1U48 A;  3LP1 A;  2IOC A;  3NCI A;  3AVN A;  1D8Y A;  4QOZ B;  2DFE A;  3MXJ A;  4DQQ A;  4O0I A;  3ZSR A;  1BI4 A;  4DTX A;  4B9V A;  4E1N A;  1NK9 A;  3ZSO A;  3PX0 A;  4CF1 A;  3H08 A;  1K6Y A;  3RWU A;  3EYZ A;  3MAQ A;  4CJ4 A;  2JLE A;  2VWJ A;  4FJX A;  5HP1 A;  4BWJ A;  3KLE A;  4KTZ A;  3ZCM A;  4CGJ A;  5J1E A;  3K5M A;  3TWH A;  4MQ3 A;  4AHV A;  3ZSY A;  4OKE A;  3HPO A;  3QNN A;  1BHL A;  3SNN A;  4FLW A;  4LD0 A;  5J2P A;  3ZT0 A;  1U47 A;  4GMJ B;  3AO2 A;  4IG0 A;  1TKZ A;  1U49 A;  4AHC A;  1L5U A;  1IKW A;  4CJT A;  4M3T A;  1LWC A;  3SYZ A;  2VG5 A;  3LAM A;  4CHN A;  1A5X A;  4LY7 A;  2HVI A;  4E7I A;  1YTU A;  3DLG A;  1NOZ A;  3RMB A;  3T19 A;  3DLH A;  4DTJ A;  5CY4 A;  1XWL A;  2YV0 X;  3AA5 X;  5HRR A;  3TAQ A;  2OPS A;  3AO4 A;  3AVL A;  4DS5 A;  4J2A A;  3HP9 A;  4CGH A;  3DI6 A;  1L3S A;  2HW3 A;  3WNF A;  3CFO A;  3VQ8 A;  4E1M A;  1TAU A;  2YKN A;  3IS9 A;  1IO2 A;  4I9Q A;  3QER A;  3SQ4 A;  4Z4F A;  1UAX A;  4CEA A;  1T03 A;  2D5R A;  4W5R A;  1Z25 A;  4Z4G A;  4OGE A;  3D0P A;  4C8N A;  4C8K A;  4EZ6 A;  3ALY A;  3AO1 A;  3K5N A;  1EKE A;  4ELT A;  4PWD A;  2BE2 A;  3V81 A;  1HJR A;  2VWK A;  3O4Q A;  4FJK A;  4LSN A;  1HMV A;  3BDP A;  4QCL A;  3K59 A;  3VA3 A;  2HHQ A;  2O4I A;  3AA4 A;  4FCY A;  3PX6 A;  4CEE A;  3DM2 A;  1FKO A;  4TSX A;  1BIZ A;  1C1C A;  1U04 A;  3P83 D;  5KI6 A;  4E19 A;  4XIU A;  1EX4 A;  4B8C A;  3B6P A;  1SUQ A;  1WSF A;  4LSL A;  4AH9 A;  3NAE A;  5C24 A;  3QEP A;  1L3T A;  2P5O A;  4BE2 A;  4M45 A;  3LP2 A;  4CHQ A;  3L2U A;  1WN7 A;  4BDP A;  1B92 A;  3PY8 A;  1REV A;  4FLZ A;  4KO0 A;  4KRF A;  1HNV A;  4CHY A;  5FRO A;  3SJJ A;  1QS4 A;  4LH4 A;  1VSE A;  3V6D A;  2QK9 A;  1RTI A;  4NYN A;  4N56 A;  3TAF A;  3VQ5 A;  3AVM A;  2ZE2 A;  2HHT A;  4B9T A;  4C8M A;  3AVG A;  1JXE A;  2G8H A;  4OLA A;  3DRS A;  4FLV A;  1NJY A;  2Z1G A;  3HVT A;  3NF9 A;  3M8Q A;  1SKS A;  3HL8 A;  5KRS A;  2NUB A;  1NJW A;  1S1T A;  1HQU A;  1ASU A;  1WSH A;  2IC3 A;  3L2V A;  1JLQ A;  4HUE A;  3OYN A;  3SQ2 A;  3MXI A;  5HRN A;  4FLX A;  1SV5 A;  4C8O A;  1WSI A;  4M3U A;  3OJS A;  3BGR A;  1QE1 A;  1JLE A;  2GV9 A;  1HQE A;  3MED A;  4AHT A;  4J2D A;  1JL1 A;  1VSI A;  4CJK A;  4C8L A;  3HK2 A;  4FK2 A;  4E7J A;  1RIL A;  2YHB A;  1SKW A;  4FK4 A;  3AA3 A;  1EXQ A;  1X9S A;  1KTQ A;  4CFC A;  3RRG A;  1VSD A;  4GW6 A;  2FBY A;  3NF7 A;  4IG3 A;  3VQD A;  4DSL A;  3NF8 A;  5I3U A;  3HYF A;  3AVC A;  3DRR A;  1CXQ A;  4RG8 A;  3AVF A;  3DMJ A;  1VSJ A;  1NK5 A;  2RF2 A;  4KTQ A;  1RBS A;  1XHX A;  3NDK A;  2PZS A;  2HND A;  3LDS A;  3V1R A;  1WSJ A;  3HT3 A;  2BDP A;  4FJ8 A;  2ZD1 A;  3CG7 A;  1MU2 A;  4OKJ A;  2FBT A;  3KLI A;  2VG7 A;  5E41 A;  4HTU A;  2XRI A;  3NF6 A;  4CGF A;  3QEI A;  3NGY A;  3E01 A;  3O3G A;  3SV4 A;  1WNS A;  2RKI A;  3LPU A;  2E6L A;  3SPY A;  4JS5 A;  3QET A;  4KHS A;  2W42 A;  1TVR A;  4Q5V A;  3O3H A;  1Q9X A;  3LP0 A;  2HB5 A;  1HYS A;  3I0R A;  1X9M A;  1RTH A;  2IGI A;  3LAK A;  3PX4 A;  2P51 A;  4Q0B A;  2ETJ A;  2KW4 A;  3QIP A;  1ASV A;  2PY5 A;  1D9F A;  2KQ2 A;  1S9E A;  1VSM A;  1RT6 A;  3OYA A;  1BCO A;  3JSM A;  4FM2 A;  5SZT A;  1YVU A;  2OZS A;  4AIL C;  4FZY A;  1EP4 A;  5FDL A;  4M3R A;  3KLH A;  2G8V A;  3TAE A;  1QSY A;  3V4I A;  1VK0 A;  5I42 A;  1EET A;  4OKK A;  3SUP A;  4ELU A;  4KI4 A;  1RT1 A;  1RT5 A;  4B8A B;  4E7K A;  1W0H A;  1NOY A;  4E89 A;  4J2B A;  1D9D A;  3TAB A;  2Z1I A;  3CYM A;  3DLB A;  4KHW A;  4O44 A;  1VSK A;  5JS2 A;  4E7L A;  3VA0 A;  5J2M A;  1BIU A;  5J2N A;  1KRP A;  4FJN A;  4GVM A;  4CED A;  1Q9Y A;  3ZT1 A;  1LW2 A;  3ZSV A;  1BI4 B;  4CHP A;  4DF8 A;  3QIO A;  3OYL A;  2HHX A;  4F4K A;  3PV8 A;  1HYZ A;  4CEC A;  5KGX A;  1T05 A;  5FRM A;  2HNY A;  4HCB A;  1W9H A;  3QO9 A;  4BDY A;  4CEO A;  5C42 A;  4FYD A;  2YNG A;  3V1Q A;  1TK0 A;  2F8T A;  1O1W A;  3CM6 A;  4R5P A;  1QSS A;  4W5Q A;  2YHA A;  3VQA A;  4L8R B;  4FJ5 A;  4E3S A;  1DLO A;  4KKO A;  2XO7 A;  5KTQ A;  3RRH A;  1NK0 A;  4O55 A;  3AV9 A;  4FLU A;  3MEC A;  2B4J A;  3L2Q A;  1ZYQ A;  4DFP A;  3ISN C;  2IAJ A;  3OYB A;  3ZSZ A;  1NJX A;  4F2S A;  3V9Z A;  4KAZ A;  1NK7 A;  4I9L A;  3KKS A;  4H4M A;  3RTV A;  2D0A A;  4DS4 A;  4IBN A;  1IG9 A;  1N6Q A;  3OS0 A;  1D5A A;  4Y1C A;  2P1J A;  1ZBI A;  4NCA A;  4CJF A;  4CJU A;  1TK5 A;  3OYG A;  2F96 A;  3FFI A;  1X1P A;  4F8R A;  3SZ2 A;  4NYF A;  1JLB A;  3QLH A;  3AVI A;  1WSE A;  3AA2 A;  4IFY A;  1XC9 A;  1QTM A;  2KTQ A;  4OPK A;  4M3Y A;  1CZB A;  2E4L A;  4AHS A;  3RMA A;  4UQG A;  5DMR A;  4CIE A;  3OYH A;  5HRO A;  4E0D A;  3LWM A;  1TKX A;  4OPJ A;  5HBM A;  3QNO A;  4ZTF A;  4FJM A;  4OJR A;  2GBZ A;  4DSI A;  4DFK A;  3RMD A;  2Q3S A;  1C6V A;  4FXD A;  1RBV A;  4CFD A;  3HO1 A;  1IKV A;  4CGD A;  4J2E A;  2A1S A;  4LH5 A;  1RT4 A;  4DTP A;  3HXM A;  5CZ2 A;  1FKP A;  1VSL A;  3K5O A;  3EY1 A;  4B9S A;  1WSG A;  4BE1 A;  4HCC A;  1RBT A;  4CGI A;  4Z4I A;  3KK2 A;  3OVN A;  1RT2 A;  4CJS A;  4FLY A;  3QES A;  3TI0 A;  3MXM A;  4FZZ A;  1J54 A;  1HRH A;  3VQ4 A;  3NE6 A;  2RPI A;  4CIG A;  3VQ7 A;  1ASW A;  1GOB A;  4N5S A;  4HUF A;  4RW6 A;  5HRS A;  4CF8 A;  1ZBL A;  3DLK A;  2Z1J A;  5CZ1 A;  4BDZ A;  4FLT A;  4CJ5 A;  2EHG A;  1Z26 A;  1GOC A;  1RBR A;  4O0J A;  1NK8 A;  4FJJ A;  1IH7 A;  4CEF A;  3OYJ A;  3DRP A;  2D0C A;  3RR8 A;  1G15 A;  2JGU A;  4K8X A;  1LAW A;  4JLH A;  1JLF A;  3L2R A;  2PYJ A;  4KV8 A;  5T7B A;  3KJV A;  4M3W A;  2LSN A;  3DLE A;  2HHV A;  4CHZ A;  1ITG A;  5JS1 A;  1I3A A;  1RCH A;  4ID1 A;  3M8R A;  3ZT2 A;  3S3N A;  1NK4 A;  2G8U A;  1RT3 A;  1NKC A;  5K14 A;  4MFB A;  2YNF A;  3K57 A;  3PO5 A;  2QKB A;  3NH1 A;  3KD5 E;  3SV3 A;  3NFA A;  4CJQ A;  3C95 A;  4NCG A;  1HNI A;  3OYF A;  1C1B A;  4F2R A;  4ZTJ A;  4CFA A;  4DTM A;  4KHU A;  3WNH A;  1JLA A;  4CE9 A;  3C94 A;  4KTW A; 
#chains in the Genus database with same CATH topology
 1VQP N;  3TAP A;  1J5O A;  1J9A A;  3O1B A;  5AQZ A;  2ZM6 K;  4OPH A;  1BQM A;  3A0I X;  5JVG L;  3WQU A;  2VG6 A;  4IDH A;  3E9O A;  3GDQ A;  2G8I A;  1GLB G;  1VRU A;  3ASM A;  5D3G A;  3CF5 L;  1G99 A;  4IJA A;  2W40 A;  2G8K A;  2OA8 A;  3B6O A;  1CZ9 A;  1TL3 A;  3CXC M;  1HYV A;  4LC9 B;  4HWI A;  3ENH A;  4DFJ A;  4ISE A;  3ZT4 A;  4JYA K;  4BGB A;  3QEV A;  4LF6 K;  3OYI A;  3PUF A;  3CQ8 A;  3R6M A;  4JI3 K;  3KKR A;  3U3G A;  1L3V A;  3CIP A;  4A2A A;  2NRW A;  4B1W B;  4DSK A;  3SCX A;  1S72 N;  2B5J A;  1KVA A;  1U45 A;  3AVK A;  5LJV A;  5HLF A;  4B9N A;  4FVM A;  3NGZ A;  1HPZ A;  4ID5 A;  3ZSQ A;  2O4G A;  4EAH D;  4CZI A;  2KFN A;  1LV5 A;  3CM5 A;  1RBU A;  4CEZ A;  2A3Z A;  2A6A A;  4WFA L;  4A2B A;  5CYQ A;  1VQ4 N;  2RN2 A;  3O9U A;  3ZEU A;  3WEE A;  4EHT A;  3HP6 A;  4EZ9 A;  1NGG A;  2DFF A;  4CZL A;  1OH5 A;  4PQU A;  3TAG A;  2HVH A;  3DXM A;  1HKC A;  2KFZ A;  1W2B M;  1K8K A;  3CJC A;  2WOM A;  3MN9 A;  4GV9 A;  1JKH A;  4PA1 A;  4B1X B;  4DQI A;  1WAF A;  5ADX H;  1TKD A;  4FW1 A;  1HPM A;  2HF4 A;  4M63 C;  4GV6 A;  2GWK A;  4OGC A;  1BDG A;  2JWK A;  1BOT O;  3UIQ A;  3U4L A;  1KFS A;  4AHR A;  2WC9 A;  3CPE A;  1XC3 A;  1KCF A;  3OYE A;  5KGW A;  2AP1 A;  3AY9 A;  2X78 A;  4BRO A;  2HHX A;  2YNH A;  4B3O A;  4BVP A;  1QSL A;  4BWM A;  3QML A;  1L3U A;  4M3Z A;  2KLA A;  3L4Q A;  3HPH A;  4CJE A;  3QIN A;  1JXB A;  4WQ5 A;  4DFM A;  2NNW A;  3UKR B;  3PIO L;  2A1R A;  1S6Q A;  4I6M B;  3OBW A;  1X3N A;  3VQ9 A;  2P9L A;  1K8A O;  1ATS A;  4BRC A;  1YAG A;  1XHZ A;  2QWP A;  4DG1 A;  3QEW A;  3ZET A;  4YOR A;  3VQC A;  5HL7 L;  2FBX A;  2Q97 A;  4FOI A;  2X6S A;  4KB1 A;  3VQB A;  3RSE A;  4YOV A;  4GVE A;  2D0B A;  3M8P A;  1TUY A;  4O8U A;  4DR4 K;  3TTD A;  4CJP A;  1ESV A;  1NKE A;  2VWB A;  3U9D A;  4BGA A;  4BVO A;  4A57 A;  4CZK A;  4DUZ K;  3VEX A;  3T69 A;  4DSE A;  3HVR A;  3L3V A;  2KZM A;  4C23 A;  4CJ7 A;  3A5L C;  4KH6 A;  1Q86 O;  4BR4 A;  5KQ8 A;  1Y97 A;  3RR7 A;  5IT9 O;  1VQK N;  5JMV A;  3HOT A;  3E9P A;  2XY7 A;  4IO8 A;  4B3M K;  1VRT A;  4XH1 A;  3K5L A;  3TAN A;  1IV0 A;  5AQJ A;  3EZ5 A;  3LZJ A;  4CJW A;  4BRI A;  1U2V B;  4CZG A;  3IUC A;  1N33 K;  2AA4 A;  1LWF A;  4KHY A;  2E6M A;  1U48 A;  3I33 A;  1Q7Y O;  1GLJ O;  3AVN A;  4NB4 A;  1D8Y A;  4H0O A;  2BTF A;  3PX0 A;  4CF1 A;  3IMX A;  2Q0U A;  4A62 A;  2JLE A;  4JI6 K;  3C65 A;  5HP1 A;  1Y64 A;  3KLE A;  3WQT A;  4MQ3 A;  1T44 A;  3CCE N;  5GIP A;  3QNN A;  3MN7 A;  3D6R A;  5J2P A;  3H1V X;  3O8M A;  3Q7C A;  1U47 A;  4DQ8 A;  4QS9 A;  4CJT A;  2P9S B;  4H0P A;  3LAM A;  4CHN A;  4DB3 A;  2KHO A;  4LY7 A;  3DAW A;  1NOZ A;  3A5N C;  3KWI A;  3T19 A;  2ZWH A;  3RMB A;  2O8C B;  3AA5 X;  3P39 A;  4DS5 A;  1YJN N;  4J2A A;  3HP9 A;  2RHK A;  3AAP A;  4CGH A;  2HW3 A;  3A5O C;  3VQ8 A;  3IS9 A;  1IO2 A;  3SQ4 A;  4CEA A;  4YOU A;  1HJO A;  5BRE A;  5I9E B;  4OGE A;  1GLD G;  3K5N A;  4PWD A;  5FLX O;  1HJR A;  3BDP A;  3WT0 A;  2HHQ A;  2O4I A;  5KPZ A;  3PX6 A;  4FCY A;  4EZ6 A;  3NAE A;  1SUQ A;  1WSF A;  1L3T A;  4FWS A;  3O4W A;  1U2V A;  1D4X A;  4BDP A;  4IEI A;  4FLZ A;  4LFC K;  3ZEU B;  4KRF A;  1HNV A;  4N56 A;  2I7N A;  3AVM A;  2ZE2 A;  2G8H A;  1JXE A;  2QM1 A;  4KH5 A;  3L6Q A;  1NJY A;  3HVT A;  3CC7 N;  3WUH A;  2ZJQ L;  1S1T A;  4PHT X;  1NGI A;  1WSH A;  4UY8 O;  3OYN A;  4GV3 A;  3HBT A;  1QE1 A;  3C0B A;  4H5N A;  2GV9 A;  3MED A;  3HK2 A;  1JL1 A;  3QDK A;  2YHB A;  1SKW A;  3AA3 A;  2HBM A;  3ZYY X;  4IOA L;  3SLC A;  4CFC A;  1VSD A;  2QWQ A;  4GW6 A;  2FBY A;  4AM7 A;  3ATV A;  4DSL A;  1HX1 A;  3DRR A;  1CXQ A;  4WQ4 C;  4KTQ A;  1XHX A;  2HND A;  2PAV A;  4JI2 K;  1WSJ A;  2E1Z A;  4FJ8 A;  5EXW A;  3ZET B;  4OKJ A;  2FBT A;  5E41 A;  5AQQ A;  3EL2 A;  4CGF A;  3GBT A;  1NJI O;  1WNS A;  2RKI A;  3SPY A;  3D2E A;  2W42 A;  2O8B A;  4Q5V A;  1Q9X A;  3LP0 A;  2HF3 A;  3PX4 A;  2ETJ A;  4BR9 A;  3IKM A;  1ASV A;  3QIP A;  2KQ2 A;  1S9E A;  4EIA A;  1VSM A;  2OTJ N;  4FM2 A;  4BRA A;  2OZS A;  4FVU A;  3KLH A;  3TAE A;  3V4I A;  2EWS A;  4KI4 A;  4CW7 B;  1RT1 A;  1RT5 A;  1W0H A;  1NOY A;  4B3R K;  4E89 A;  4J2B A;  3VGL A;  1D9D A;  2Z1I A;  1BA1 A;  5JS2 A;  1DKG D;  4E7L A;  1KRP A;  4CZF A;  5JVH L;  4OO1 J;  4GVM A;  1LW2 A;  3EZW A;  1YVN A;  3ZSV A;  1ATR A;  4BC3 A;  3QIO A;  1J5E K;  4ILJ A;  1T05 A;  4CEC A;  5KGX A;  3H3N O;  1RDU A;  2RE2 A;  1S22 A;  1QSS A;  1BO5 O;  3D2F B;  2YHA A;  1QZ5 A;  3VQA A;  3F2K A;  4FJ5 A;  2XO7 A;  1NK0 A;  4K25 A;  4FLU A;  3MEC A;  5LMN K;  4YDU C;  4DFP A;  4F2S A;  3Q7B A;  3V9Z A;  4IO9 L;  4I9L A;  4H4M A;  5H1S Q;  1NM1 A;  3RTV A;  1N6Q A;  3THX B;  1TK5 A;  3OYG A;  5FPN A;  5EOY A;  5F2R A;  2YCH A;  1SAZ A;  4BR5 A;  4NYF A;  3SZ2 A;  1GLL O;  3THW B;  4IEE A;  2P9L B;  4AHS A;  3RMA A;  4XH4 A;  1IG8 A;  4MO5 A;  1KC8 O;  3QNO A;  1OH8 A;  5MLC Q;  5BR8 K;  4BRF A;  3RMD A;  4FXD A;  3HO1 A;  2W6L A;  4CGD A;  4J2E A;  3IDH A;  4AF1 A;  1P90 A;  4DTP A;  1FKP A;  2D0P A;  3K5O A;  1IJJ A;  1WSG A;  4CGI A;  4Z4I A;  4BRG A;  1VAZ A;  3QES A;  5ELZ A;  3TI0 A;  1WUA A;  2RPI A;  3VF2 A;  4CIG A;  1MDU B;  2QW9 A;  5HRS A;  2Z1J A;  4CJ5 A;  3CI5 A;  2EHG A;  3FZH A;  4IZ9 A;  1RBR A;  4X64 K;  1NK8 A;  3G71 N;  1QQN A;  2JGU A;  4A5B A;  4CHZ A;  5JS1 A;  4JKH A;  1I3A A;  3S3N A;  1NK4 A;  2G8U A;  1NKC A;  5K14 A;  3PO5 A;  2YHX A;  2O8F B;  4CJQ A;  4NCG A;  5AQM A;  4F2R A;  3JS6 A;  4KHU A;  4CE9 A;  3SJH A;  3BF1 A;  1YTA A;  4FZZ A;  4PUO A;  1LWE A;  3V9W A;  4FM0 A;  2Y1I A;  3ZX3 A;  4B1Y B;  2HBJ A;  4FJI A;  1S3X A;  3K2P A;  1ZBH A;  4EP5 A;  5SWM A;  3C7N B;  3CCM N;  1N36 K;  3DJC A;  4Z4H A;  3WXJ A;  3IG1 A;  4JRP A;  1HNX K;  4FJH A;  3AVJ A;  3O9T A;  4PKG A;  3SAG A;  2KZZ A;  1I94 K;  4H8K A;  1X3M A;  4DLE A;  2NLX A;  2UU9 K;  1QHT A;  1C1A A;  5AQV A;  4JRQ A;  4DR5 K;  4CK1 A;  4B3S K;  4RW7 A;  3BF3 A;  4M7X A;  4X62 K;  4FJ9 A;  5C25 A;  4IFV A;  1BWF O;  2HHU A;  2A42 A;  1S1U A;  3G10 A;  3V9U A;  1KLM A;  3KD1 E;  3LP3 A;  3DXK A;  4WCE L;  1DEJ A;  1FK9 A;  3TAR A;  3DLR A;  5BR9 A;  3ZSW A;  3ULD A;  2G8F A;  3TTC A;  4FL9 A;  3VER A;  5AZJ B;  2EX3 A;  3VQQ A;  3JYT A;  5AQU A;  1T8E A;  4M42 A;  2HMP A;  1SL0 A;  2Z1H A;  4EP4 A;  4AQY K;  1JCG A;  4B9U A;  5E26 A;  3O1W A;  3T1A A;  2D4W A;  3VET A;  4BG9 A;  1XQS C;  1MA9 B;  1WOQ A;  5AQF A;  1YIT N;  1BCM A;  2I5J A;  4CZH A;  2BGG A;  5EU7 A;  2XY8 A;  1S5J A;  1JL2 A;  1YJ9 N;  3KTQ A;  4FW2 A;  2XHB A;  1W7A A;  5M1N A;  3U3Y A;  1MWK A;  1E3M A;  4JKA A;  1TKT A;  2DFH A;  3PO4 A;  5HRP A;  2H3G X;  3G0Z A;  4CF0 A;  4E7H A;  2GX9 A;  2I7P A;  3CJA A;  3AO5 A;  4H5V A;  3O9S A;  4DSF A;  1RGI A;  3ITH A;  3E66 A;  4NCB A;  4WYB A;  3NGI A;  1RDW X;  3V1O A;  4DHY A;  3KK3 A;  2OCE A;  3V9X A;  4CES A;  2F4V K;  4EHU A;  1U4B A;  1YT3 A;  1BL3 A;  1KSP A;  4V19 S;  2ZQB A;  1YXQ A;  3LZI A;  1Q8I A;  1NNE A;  4W5O A;  5BRF A;  2HBL A;  4CVN E;  3VQ6 A;  3VQE A;  4A5A A;  1F21 A;  2E2N A;  2P9K B;  4CZE A;  4JKC A;  1S1W A;  4EFH A;  4PL7 A;  4YOY A;  3MEG A;  3OYK A;  4F3T A;  4E1J A;  1SL1 A;  3DOL A;  1A5W A;  4H0T B;  4IDK A;  1S1V A;  4H5R A;  1KFD A;  1RTJ A;  3AO3 A;  1TYQ A;  5C15 A;  5AQN A;  1WLJ A;  2E2O A;  4FJL A;  2ASM A;  2YI1 A;  5DM6 L;  3SQ0 A;  1N32 K;  4DSJ A;  3TAM A;  4CGG A;  1GOA A;  1TK8 A;  5IWA K;  1QQC A;  4DTN A;  1VQ8 N;  3OY9 A;  3SBG A;  3MN5 A;  4ISF A;  1JCE A;  3FR0 A;  2FC0 A;  4H03 B;  3LAL A;  4M7Y A;  1WAJ A;  1SS6 A;  2HNZ A;  1C0M A;  3LPT A;  2OPR A;  1DTQ A;  3SK3 A;  3HI0 A;  4PY5 A;  4CK3 A;  1FW6 A;  4B1Z A;  2OPP A;  5AZI A;  2P9S A;  2P9U A;  3VEV A;  3THW A;  3H45 C;  1RDB A;  4QOZ B;  3I8B A;  3M5R A;  3ZSR A;  1BI4 A;  4B9V A;  4BRQ A;  3H08 A;  1K6Y A;  3EYZ A;  3AGK A;  3KHY A;  1NGD A;  3LDQ A;  5J1E A;  3AAQ A;  3K5M A;  4OKE A;  2GEL A;  3E1Y A;  3FLC O;  4GMJ B;  3AO2 A;  4IG0 A;  1TKZ A;  1IKW A;  3SYZ A;  2VG5 A;  1YTU A;  3O9R A;  3DLG A;  3DLH A;  4R79 A;  1XWL A;  3CJ1 A;  3TAQ A;  4E1M A;  4DV7 K;  1TAU A;  4I9Q A;  4JN4 A;  4Z4F A;  1NWK A;  1QZ6 A;  4BRK A;  4W5R A;  5C10 A;  3VF6 A;  2QEX N;  3ALY A;  3NVM A;  3R1X A;  5AQW A;  3O4Q A;  4JEP A;  1HMV A;  3VGK A;  3AA4 A;  3DM2 A;  1VHX A;  4TSX A;  1BIZ A;  1C1C A;  4K43 A;  3KLF A;  5A2Q O;  4X65 K;  4XIU A;  4LSL A;  3J7Y P;  3ULE B;  4BE2 A;  3PIP L;  2E8A A;  2QA4 N;  1REV A;  3GE1 A;  5AQT A;  3OA9 A;  1SQK A;  4DV0 K;  2PBD A;  4NYN A;  3TAF A;  3EN9 A;  3VQ5 A;  3FE1 A;  3DRS A;  4KHP K;  4PKI A;  1NJW A;  4FPB A;  3P38 A;  1JLQ A;  3MXI A;  3SQ2 A;  3O08 A;  5HRN A;  1WSI A;  1H1V A;  4DR7 K;  1HQE A;  2ASP A;  4CJK A;  1ZXO A;  4Z94 A;  3FZL A;  1RIL A;  3P31 A;  4FK4 A;  2V7Z A;  3MCP A;  4U7B A;  3D2F A;  3MX5 A;  4LF5 K;  4IG3 A;  3NF8 A;  3CCQ N;  2VQF K;  3AVF A;  3DMJ A;  1VSJ A;  2RF2 A;  4KH4 A;  1RBS A;  2PZS A;  4JI4 K;  1NGA A;  3JXU A;  3HT3 A;  1M90 O;  2ZD1 A;  3CG7 A;  4DV6 K;  3OW2 M;  2XRI A;  3QEI A;  1EO1 A;  3E01 A;  5AZJ A;  3LPU A;  3ATU A;  5GAD P;  1TVR A;  2QI2 A;  3I0R A;  1X9M A;  2YX6 A;  1RTH A;  2BUP A;  4Q0B A;  5M1F A;  3MWP A;  2GTD A;  2WUS A;  1Z6R A;  3MX2 A;  3OYA A;  3JSM A;  1EP4 A;  3DXM B;  3VF4 A;  4M3R A;  1BG3 A;  2CH6 A;  1EET A;  4OKK A;  3EO3 A;  3SUP A;  4ELU A;  4B8A B;  4YOW A;  5CE3 A;  5FPM A;  3J7Z O;  5GAG P;  4JKD A;  4CED A;  1N34 K;  2J4R A;  3C6H A;  3DXK B;  3ZT1 A;  4WQ4 A;  3NMU A;  4DF8 A;  1R59 O;  2HOE A;  3WXL A;  2P9I B;  3CJB A;  5FRM A;  4HCB A;  1W9H A;  3QO9 A;  4FYD A;  4OPA A;  4CD1 A;  4E3S A;  1DLO A;  4KKO A;  4BR7 A;  5KTQ A;  2Q2R A;  3AV9 A;  2OAN A;  1ZYQ A;  4CBX A;  3KKS A;  2D0A A;  4IBN A;  1IG9 A;  3OS0 A;  2HBK A;  4NCA A;  1ZBI A;  4CJF A;  3LDL A;  4IJN A;  2O8D B;  1X1P A;  3VEW A;  1T6D A;  1JLB A;  1QTM A;  3AA2 A;  1XC9 A;  1W97 L;  4UQG A;  3CET A;  4JK7 A;  2Q31 A;  3LWM A;  2W41 A;  4JAX A;  2FSJ A;  4OPJ A;  4FJM A;  4ZTF A;  5BN8 A;  2D1K A;  4DFK A;  2Q3S A;  1E4F T;  4CFD A;  1IKV A;  2ZF5 O;  5BRH A;  4LF4 K;  3HXM A;  4LFA K;  4B9S A;  4BE1 A;  1GLA G;  5AQL A;  4CJS A;  1OH7 A;  4FLY A;  1VQ9 N;  5JLF A;  2GWJ A;  4B1U B;  1GOB A;  4N5S A;  2QXL A;  4LF8 K;  4CF8 A;  4BDZ A;  5CZ1 A;  1LOT B;  4FLT A;  1Z26 A;  4FJJ A;  1IH7 A;  4CEF A;  5FPE A;  3OYJ A;  1G15 A;  3L2R A;  2PYJ A;  4PKH A;  4M3W A;  2LSN A;  3DLE A;  1M1K O;  1U6Z A;  3ZT2 A;  4FO0 A;  3LDN A;  4B9Q A;  4NO7 A;  3CQX A;  3K57 A;  2QKB A;  3UKU A;  3KD5 E;  1HNI A;  3VEO A;  1BU6 O;  1GLC G;  4ZTJ A;  5CR4 A;  4JI1 K;  4KTW A;  4CZM A;  1BIS A;  3A2F A;  2HMI A;  3CJ7 A;  4RW9 A;  3NH0 A;  4DQR A;  4BRL A;  3IFR A;  2GUI A;  4RW8 A;  3UB5 A;  5AQG A;  3KLG A;  3NBP A;  5EX5 A;  1XI1 A;  4BR0 A;  5AQP A;  4Z0U A;  2QKK A;  1J53 A;  2P9I A;  3HTV A;  3L2W A;  3M3Z A;  3P1G A;  3U6F A;  3N4P A;  5DK5 A;  1RDD A;  1NGB A;  4L3Q A;  3CCJ N;  1C0G A;  5J2Q A;  2FBV A;  3FZK A;  3J7A P;  1KLN A;  4JD2 B;  4DQP A;  4HHT A;  4JKF A;  1VSF A;  2WTU A;  1RDC A;  2IS3 A;  4JV5 K;  4DR1 K;  3P5J A;  3OYM A;  2OTL N;  1NGC A;  4OLB A;  4FWO A;  4JNE A;  5FRN A;  3L3U A;  2P5G A;  4QS7 A;  4CHO A;  4H4O A;  3IAY A;  2IIR A;  4Z4E A;  5GAH P;  4MLE A;  2XY6 A;  1K8K B;  4YNQ A;  4CJL A;  4DU1 A;  3E9L A;  3SUQ A;  2AJQ A;  3SQ1 A;  3J8A A;  1CXU A;  3QIC A;  1Q81 O;  2DTU A;  1ZBU A;  1E4G T;  3VMF B;  3I8D A;  1WBD A;  4LF7 K;  4FPA A;  1VQ6 N;  3OS2 A;  4I7F A;  5EY4 A;  5AQR A;  4FJG A;  1IKY A;  5M1K A;  3CCV N;  2YNI A;  4KFB A;  3K58 A;  4RW4 A;  1Z05 A;  2YJE A;  2ITG A;  2ATQ A;  1CLQ A;  3MK6 A;  1HNZ K;  1S1X A;  4N47 A;  4DUY K;  1OVQ A;  1NKB A;  1KAY A;  1T7P A;  3F73 A;  4KI6 A;  1WB9 A;  2IVO A;  4CK2 A;  2NRZ A;  1FXX A;  2P9N B;  4OVL A;  2QXF A;  2NRH A;  3VTI A;  4O4G A;  2IDO A;  4XH5 A;  4C1N K;  4DTO A;  1DTT A;  1GLE G;  5LY3 A;  3OHR A;  3D45 A;  4GNI A;  4HUG A;  4KPY A;  3VN5 A;  3MEE A;  3KK7 A;  4F8R A;  2D0O A;  1R0A A;  3OBY A;  3K0S A;  1JCF A;  3EEQ A;  1LAV A;  1I39 A;  5KQD A;  1RTD A;  2QWM A;  4QS8 A;  4DU4 A;  1SKR A;  2UUA K;  3SUN A;  4BE0 A;  4WE1 A;  4IXC A;  3CCS N;  1TL1 A;  2UYT A;  4DQS A;  3U9Z A;  1VQN N;  4AHU A;  4FZX C;  3HZ6 A;  3WEE B;  2QWR A;  3OS1 A;  4YOT A;  3M8S A;  3S3O A;  2ZGZ A;  2OYQ A;  4KHQ A;  3TR8 A;  2A5X A;  3ZX0 A;  5E84 A;  2FXU A;  4KB0 A;  4DLG A;  4W5N A;  4Y1D A;  1UA1 A;  2UUB K;  3F5T A;  4CF9 A;  1YF5 L;  4DR3 K;  1NK6 A;  3D2E B;  2O8B B;  3RMC A;  1SL2 A;  3G4S N;  4G1Q A;  4Z4C A;  3QBW A;  1RDA A;  2DY4 A;  1BGX T;  3AVA A;  4OX9 K;  4CFB A;  3QBX A;  3GL1 A;  2F8S A;  4DF4 A;  3GOI A;  5KPR A;  1RNH A;  2FF6 A;  4CEQ A;  2CGL A;  2WON A;  4KHN A;  4B9M A;  1KXP A;  4W5T A;  2R7Y A;  3S41 A;  3FFK B;  1ZBF A;  1YIJ N;  3LM2 A;  1NU0 A;  1QQM A;  4FJ7 A;  4BG8 A;  4BC5 A;  3LP1 A;  2GEM A;  3NCI A;  4RWT A;  1XNR K;  3VEY A;  2DFE A;  3MXJ A;  3KVG A;  4DTX A;  4H0Y B;  4K41 A;  4E1N A;  3ZSO A;  4H5T A;  3RWU A;  4H0X B;  3MAQ A;  2VWJ A;  4FJX A;  2VGN A;  4FWQ A;  4BWJ A;  1SZ2 A;  4KTZ A;  3ZCM A;  3TWH A;  3HOS A;  4CBW A;  2WFB A;  3RVC A;  3SNN A;  4FLW A;  3I56 N;  3ZT0 A;  1U49 A;  1QHA A;  4HTL A;  4M3T A;  1LWC A;  2QWO A;  1A5X A;  2A40 A;  4CD3 A;  1YHQ N;  2HVI A;  1ILY A;  3I55 N;  3T7Z A;  1T3V A;  3CCR N;  4DTJ A;  3AO4 A;  3AVL A;  2O8D A;  3DI6 A;  4BY9 C;  3CFO A;  1QVF M;  1X9J A;  3QER A;  1UAX A;  1T03 A;  4C1N I;  4BR2 A;  2D5R A;  5AQK A;  1Z25 A;  5AQX A;  4Z4G A;  4C8N A;  4C8K A;  3JAM O;  3VPZ A;  1KAZ A;  3AO1 A;  1EKE A;  2NRX A;  1IBM K;  4ELT A;  4I6M A;  2F7T A;  4JI8 K;  3V81 A;  4QCL A;  4LSN A;  3G6E N;  3VA3 A;  4CEE A;  3HRG A;  3B6P A;  4AH9 A;  5C24 A;  4BC2 A;  2P5O A;  3LP2 A;  1Q18 A;  4CHQ A;  3L2U A;  3MWT A;  4A59 A;  2HST A;  4KO0 A;  2W6K A;  4H0V B;  3QFP A;  5FRO A;  4CHY A;  1QS4 A;  1RFQ A;  4LH4 A;  3CMA N;  3V6D A;  3U8X A;  2QK9 A;  3CCU N;  3CER A;  2HHT A;  4C8M A;  1V4S A;  3AVG A;  4XEI A;  3NF9 A;  3M8Q A;  5KRS A;  2NUB A;  3LM9 A;  1TUU A;  2IC3 A;  4HUE A;  4X66 K;  1SV5 A;  5BRD A;  3CME N;  4J2D A;  4C8L A;  4WFN L;  3R8E A;  4E7J A;  4MDA A;  5AFU H;  1EXQ A;  5JIC A;  2VGM A;  3NF7 A;  3MN6 A;  4NLB A;  3AVC A;  3TSU A;  4RG8 A;  5AQY A;  4GY2 B;  5LL6 Z;  2ZGY A;  3V1R A;  4BC4 A;  5AJ3 K;  2BDP A;  2F9W A;  5BPM A;  3LDP A;  2DPN A;  5B8H A;  1VQ5 N;  3O3G A;  2E6L A;  4JS5 A;  4KHS A;  4A61 A;  2VYP A;  3WXM B;  2IGI A;  3H1Q A;  4DKW A;  1NGJ A;  2P51 A;  4U67 L;  2PY5 A;  3H6E A;  1YVU A;  1Q82 O;  3B8A X;  2G8V A;  4E7K A;  3TAB A;  3DLB A;  1QQO A;  4KHW A;  3M1F A;  1VSK A;  4BQL A;  1YI2 N;  3VA0 A;  4NLC A;  5J2N A;  4YDU A;  2P9U B;  1Q9Y A;  5C12 A;  3VTH A;  1BI4 B;  3BZK A;  3F9M A;  4IWV A;  2A41 A;  4BRD A;  4F4K A;  1HYZ A;  4JI7 K;  2HNY A;  4CEO A;  2YNG A;  3V1Q A;  2F8T A;  1WBB A;  4R5P A;  4PL8 A;  4W5Q A;  5LMU K;  4O55 A;  2ITM A;  4DR2 K;  2B4J A;  2V51 B;  2E20 A;  5GAE P;  4LFB K;  1KAX A;  3ISN C;  4YY3 K;  3OYB A;  1NJX A;  4KAZ A;  2O8F A;  3MMV A;  3AAR A;  1D5A A;  2GUP A;  3ENO A;  2F96 A;  3FFI A;  2HHH K;  2FSK A;  4FSV A;  3QLH A;  3AVI A;  1WSE A;  4IFY A;  1BUP A;  4M3Y A;  2E4L A;  5DMR A;  3OYH A;  5HRO A;  4NXM K;  3CQY A;  4DSI A;  4JKB A;  1C6V A;  1RBV A;  4RTF D;  4LH5 A;  3DWL A;  5CZ2 A;  1VSL A;  3EY1 A;  4DV2 K;  3L0Q A;  3KK2 A;  1RT2 A;  1ZC6 A;  3MXM A;  1J54 A;  5AQS A;  3VQ7 A;  1ASW A;  3VES A;  4RW6 A;  1ZBL A;  4MLH A;  2Q0R A;  5KPT A;  4O0J A;  4GKJ K;  3RR8 A;  1LAW A;  2CGJ A;  4KV8 A;  5T7B A;  3KJV A;  2HHV A;  1ITG A;  3C7N A;  3DLL L;  3QFU A;  2E1Y A;  4FWL A;  1RT3 A;  1ATN A;  3W0L A;  4MFB A;  4BQZ A;  2YNF A;  3TSQ A;  3ZX2 A;  5M1Q A;  2E2P A;  3C95 A;  1OVY A;  4DCH A;  3OYF A;  4CFA A;  3G25 A;  4BRH A;  3WNH A;  4CJ4 A;  3TU5 A;  4ICL A;  4DV4 K;  3GG4 A;  3VEN A;  1C0T A;  4B3T K;  3DYA A;  1UA0 A;  3HM9 A;  1MWM A;  4IOC L;  4GKK K;  2O8E B;  1HUX A;  2BAN A;  5F1X A;  3L4I A;  3ZSX A;  3ENB A;  2FLO A;  2YHY A;  4KRE A;  2IVP A;  1JLC A;  1YJW N;  4N41 A;  1B9D A;  4DV1 K;  3A8Y A;  2PYL A;  4N76 A;  2X74 A;  4O5B A;  2OPQ A;  1HR0 K;  2HHW A;  3QEX A;  1UWB A;  3HSC A;  3OYD A;  1EWQ A;  1XNQ K;  3VQP A;  4QAG A;  3NH2 A;  3LL3 A;  1K73 O;  1FJG K;  3DOK A;  4IOX A;  3WNE A;  3O6W A;  4FK0 A;  1TGO A;  3L8B A;  4B1V A;  1UOC A;  4KBO A;  2ZJR L;  3OJU A;  4CCH A;  1NGH A;  5M1O A;  3HPG A;  1OKJ A;  1TAQ A;  3K9K A;  1KVB A;  4O5F A;  4FM1 A;  3LWL A;  3CC4 N;  3SPZ A;  4F9O A;  2CGK A;  2FF3 B;  4CER A;  5TKW A;  4DU3 A;  3F9K A;  4BRE A;  4CIF A;  3O3F A;  4CEB A;  3O80 A;  4MDB A;  1X9W A;  2E2Q A;  3D7E O;  2YJF A;  1S6P A;  1IKX A;  2ZJP L;  5AQH A;  1RT7 A;  5KRT A;  4B9L A;  2NRR A;  4MO4 A;  4BRP A;  4JI5 K;  3IRX A;  2F9T A;  3SI6 A;  1VQO N;  4K42 A;  3PLA A;  1OH6 A;  1BQN A;  4FOE A;  4CBU A;  4K8Z A;  4I2P A;  4F3O A;  4M3X A;  5GIN A;  4CJV A;  1XUP O;  1QVG M;  4ELV A;  3V9S A;  3OYC A;  1S9G A;  3KK1 A;  3AVB A;  3ZT3 A;  4JS4 A;  1K9M O;  4DMN A;  4DWI A;  3J81 O;  5CYM A;  1TV6 A;  3ID6 A;  3VGM A;  1T6C A;  3T3F A;  4ZHR A;  4JKE A;  1N5Y A;  3THV A;  3BZC A;  1YUW A;  2V7Y A;  3EKU A;  3KIO A;  3HST B;  2KKZ A;  3EE9 A;  2G8W A;  3HM8 A;  3WNG A;  2CH5 A;  4DTS A;  2HHS A;  1C0U A;  2P9P B;  3CCL N;  3VEZ A;  3O4N A;  4CJ3 A;  4CI6 A;  3S3M A;  2JWL A;  3AVH A;  1A5V A;  3C6U A;  3CPW M;  4DTR A;  3HJF A;  4M41 A;  4CJR A;  4YFU A;  3J80 O;  2X6N A;  3SUO A;  1HLU A;  2OZM A;  4BAC A;  4WQ5 C;  3I0S A;  1NBW A;  4HVJ A;  4IKF A;  4BRM A;  4Y0W A;  5CHI A;  2B6A A;  2YKM A;  3LAN A;  2FSN A;  3UKR A;  2YHW A;  5AQO A;  3THY A;  5BN9 A;  4I2Q A;  1KD1 O;  2QWL A;  5ADX A;  2PFU A;  2Y1J A;  5JLH A;  3C6T A;  4DTU A;  1B9F A;  4RCH A;  3NHG A;  3BP8 A;  1JLG A;  2XY5 A;  4ILG B;  5TKY A;  1BA0 A;  3T1Y K;  1VQM N;  4FWM A;  1TYQ B;  3CC2 N;  3VOV A;  1LW0 A;  5F0X A;  5EVZ A;  3SMP A;  3OTO K;  3SBT A;  3S9H A;  4JI0 K;  2ASO A;  4CF2 A;  1NJZ A;  2WBN A;  2BH1 A;  1DT9 A;  4B08 A;  3CFP A;  3O5B A;  3CFR A;  1KVC A;  4LF9 K;  3ULE A;  1VSH A;  2UXC K;  2IOC A;  3C6A A;  4ILH A;  4DQQ A;  2V52 B;  4O0I A;  3O9Q A;  1NK9 A;  5AFU A;  5DM7 L;  4CGJ A;  4AHV A;  3ZSY A;  4AM6 A;  3HPO A;  1BHL A;  4JKG B;  4LD0 A;  1GLF O;  4AHC A;  5GIO A;  3AGR A;  1L5U A;  3THY B;  4E7I A;  3EKS A;  3K9J A;  5CY4 A;  4FWR A;  2YV0 X;  5HRR A;  1NLV A;  2OPS A;  1XMO K;  1L3S A;  5C2F A;  2VCP A;  3WNF A;  4J8F A;  5HOO A;  2YKN A;  3TSP A;  2E88 A;  5FPD A;  3T1H K;  3D0P A;  1NGE A;  2BE2 A;  2VWK A;  4FJK A;  3K59 A;  3NVK A;  1FKO A;  1U04 A;  3P83 D;  5KI6 A;  4E19 A;  1EX4 A;  4B8C A;  3QEP A;  4M45 A;  1WN7 A;  1B92 A;  2QTD A;  3PY8 A;  1KQS M;  4WFB L;  3SJJ A;  1VSE A;  1RTI A;  4JKG A;  4YHH K;  3H3O B;  4B9T A;  1HNW K;  1NGF A;  4OLA A;  4FLV A;  2Z1G A;  1SKS A;  3HL8 A;  3MDQ A;  5LJW A;  1ASU A;  1HQU A;  1IBL K;  3L2V A;  4FLX A;  4M3U A;  4C8O A;  3OJS A;  3BGR A;  1JLE A;  1DGK N;  4AHT A;  1VSI A;  2Q1N A;  4FK2 A;  4WF9 L;  3BEX A;  3SMS A;  3EE8 A;  1X9S A;  1KTQ A;  3RRG A;  5AR0 A;  1NMD A;  3W3D A;  3VQD A;  2UXB K;  5I3U A;  3HYF A;  2P9K A;  1NK5 A;  1HKB A;  3NDK A;  2E5L K;  3LDS A;  1XMQ K;  5M1P A;  1MU2 A;  3ZLJ A;  3KLI A;  2VG7 A;  4HTU A;  3NF6 A;  3NGY A;  3SV4 A;  4G9Z A;  3TTF A;  2VQE K;  3QET A;  3O3H A;  3KZB A;  2HB5 A;  1HYS A;  5C0Y A;  3FZM A;  3LAK A;  4JD2 A;  2KW4 A;  1D9F A;  3N4Q A;  1RT6 A;  1BCO A;  4O8K A;  5SZT A;  3CJ9 A;  4FZY A;  4AIL C;  5FDL A;  4K0K K;  1LCU A;  3BY5 A;  1QSY A;  1VK0 A;  5I42 A;  3UE5 A;  3WXK A;  4JHD A;  3FZF A;  1O13 A;  3CYM A;  4O44 A;  1EQY A;  4ISG A;  5J2M A;  1BIU A;  4FJN A;  4JK9 A;  3QB0 A;  4CHP A;  3SAF A;  3PSI A;  4DR6 K;  3OYL A;  1NG9 A;  3PV8 A;  1VQ7 N;  4BDY A;  5C42 A;  1TK0 A;  3R3L A;  1ZBS A;  4H5W A;  1O1W A;  3CM6 A;  4L8R B;  3WXI A;  2IVN A;  2Q36 A;  3PSF A;  3RRH A;  2NRV A;  4DV5 K;  4JHD B;  3L2Q A;  2IAJ A;  3ZSZ A;  5BPL A;  3CHW A;  1NK7 A;  4DS4 A;  4FWN A;  4Y1C A;  2P1J A;  4CJU A;  1HKG A;  3M6G A;  2KTQ A;  4OPK A;  3MCA B;  1CZB A;  2O8E A;  1VQL N;  5AQI A;  4CIE A;  3A5M C;  4E0D A;  2O8C A;  1IBK K;  1TKX A;  5HBM A;  4OJR A;  2GBZ A;  4YOX A;  4FWP A;  3RSE B;  3ID8 A;  2A1S A;  3BUZ B;  1NMN A;  1V4T A;  4NXN K;  1RT4 A;  1J6Z A;  3FGU A;  3THX A;  4IFE A;  4FWK A;  3CD6 N;  4HCC A;  1C0F A;  2P9P A;  1RBT A;  3OVN A;  2NZT A;  3UKU B;  5C2D A;  3VQ4 A;  1HRH A;  3NE6 A;  1N8R O;  3H46 O;  4HUF A;  2QWN A;  3DLK A;  1CZA N;  1GOC A;  5AZI B;  5BPN A;  3DRP A;  2P9N A;  2D0C A;  3R9P A;  4K8X A;  4JLH A;  1JLF A;  1JJ2 M;  4JK8 A;  1RCH A;  4ID1 A;  3M8R A;  3SAH A;  3TPQ A;  3KWG A;  2UUC K;  4BRN A;  2NRT A;  1EWR A;  3NH1 A;  3SV3 A;  3NFA A;  3P4I A;  1P8Z A;  1C1B A;  3LDO A;  4DTM A;  2UXD K;  1JLA A;  4CZJ A;  3C94 A;  4DV3 K; 
#chains in the Genus database with same CATH homology
 1BIS A;  3A2F A;  1YTA A;  2HMI A;  3TAP A;  4ICL A;  4RW9 A;  4PUO A;  3NH0 A;  4DQR A;  1J5O A;  1J9A A;  1LWE A;  1C0T A;  3V9W A;  2GUI A;  4RW8 A;  1XI1 A;  3DYA A;  3NBP A;  3KLG A;  3HM9 A;  4FM0 A;  1BQM A;  2Y1I A;  1UA0 A;  4Z0U A;  2VG6 A;  2QKK A;  4FJI A;  2BAN A;  3K2P A;  1J53 A;  1ZBH A;  3L2W A;  2G8I A;  1VRU A;  4EP5 A;  3P1G A;  5SWM A;  3U6F A;  3ASM A;  5DK5 A;  5D3G A;  1RDD A;  4Z4H A;  3IG1 A;  3ZSX A;  4JRP A;  4FJH A;  3AVJ A;  2G8K A;  4KRE A;  5J2Q A;  2FBV A;  2OA8 A;  3B6O A;  4H8K A;  2KZZ A;  1CZ9 A;  1TL3 A;  1KLN A;  1JLC A;  4DLE A;  1HYV A;  4DQP A;  4N41 A;  4HHT A;  4DFJ A;  1B9D A;  1QHT A;  1VSF A;  2PYL A;  3ZT4 A;  1C1A A;  4N76 A;  1RDC A;  2IS3 A;  2X74 A;  2OPQ A;  4O5B A;  4JRQ A;  3QEV A;  3P5J A;  3OYI A;  2HHW A;  4CK1 A;  3PUF A;  4RW7 A;  3CQ8 A;  3QEX A;  3OYM A;  1UWB A;  3OYD A;  4FJ9 A;  3KKR A;  5C25 A;  4OLB A;  3U3G A;  1L3V A;  5FRN A;  3VQP A;  4QAG A;  4IFV A;  3L3U A;  2P5G A;  2HHU A;  3NH2 A;  4CHO A;  4H4O A;  3DOK A;  3IAY A;  4Z4E A;  4DSK A;  2XY6 A;  1S1U A;  3G10 A;  3V9U A;  3SCX A;  1KLM A;  2B5J A;  3WNE A;  4YNQ A;  4CJL A;  1TGO A;  3L8B A;  4DU1 A;  1KVA A;  1U45 A;  3KD1 E;  4FK0 A;  3AVK A;  3LP3 A;  3SUQ A;  2AJQ A;  1UOC A;  3SQ1 A;  4CCH A;  3OJU A;  1CXU A;  1FK9 A;  3TAR A;  5HLF A;  3DLR A;  4B9N A;  3HPG A;  4FVM A;  1TAQ A;  1HPZ A;  4ID5 A;  3NGZ A;  2DTU A;  1ZBU A;  3ZSQ A;  3ZSW A;  4ELV A;  3ULD A;  3I8D A;  2G8F A;  2O4G A;  2KFN A;  1KVB A;  1LV5 A;  3CM5 A;  2EX3 A;  3VQQ A;  1RBU A;  4CEZ A;  3JYT A;  3OS2 A;  4I7F A;  3LWL A;  5CYQ A;  4FM1 A;  3SPZ A;  1T8E A;  2RN2 A;  4M42 A;  4CER A;  4DU3 A;  4FJG A;  1IKY A;  1SL0 A;  3F9K A;  2YNI A;  2Z1H A;  4KFB A;  4EP4 A;  4CIF A;  4RW4 A;  3HP6 A;  3K58 A;  4EZ9 A;  3O3F A;  2ITG A;  4CEB A;  2ATQ A;  2DFF A;  4B9U A;  1CLQ A;  4PQU A;  3TAG A;  1S1X A;  2HVH A;  3T1A A;  1X9W A;  2KFZ A;  4N47 A;  2WOM A;  1NKB A;  1T7P A;  3F73 A;  4KI6 A;  1BCM A;  2I5J A;  2BGG A;  1S6P A;  1JKH A;  1IKX A;  4PA1 A;  5EU7 A;  1RT7 A;  2XY8 A;  4CK2 A;  1WAF A;  4DQI A;  5KRT A;  1TKD A;  1FXX A;  4B9L A;  4FW1 A;  1S5J A;  4OVL A;  1JL2 A;  2QXF A;  4OGC A;  3IRX A;  4O4G A;  2IDO A;  3UIQ A;  3SI6 A;  3KTQ A;  1KFS A;  4FW2 A;  4AHR A;  1BQN A;  2XHB A;  4DTO A;  3U3Y A;  1DTT A;  1KCF A;  1TKT A;  2DFH A;  4K8Z A;  4I2P A;  3PO4 A;  3OYE A;  4F3O A;  4M3X A;  3D45 A;  4CJV A;  4HUG A;  5KGW A;  4KPY A;  3VN5 A;  3MEE A;  3V9S A;  5HRP A;  1S9G A;  2X78 A;  3AVB A;  2YNH A;  3ZT3 A;  3G0Z A;  3OYC A;  3KK1 A;  4JS4 A;  1R0A A;  4CF0 A;  1QSL A;  4B3O A;  4DMN A;  4E7H A;  1LAV A;  1I39 A;  4BWM A;  4DWI A;  5CYM A;  3AO5 A;  1TV6 A;  1L3U A;  4M3Z A;  4DSF A;  1RTD A;  3ITH A;  3T3F A;  4NCB A;  3NGI A;  4ZHR A;  3HPH A;  4DU4 A;  1SKR A;  3V1O A;  1N5Y A;  4CJE A;  3THV A;  3QIN A;  3KK3 A;  3KIO A;  1JXB A;  4DFM A;  3V9X A;  3SUN A;  3HST B;  4CES A;  4BE0 A;  2A1R A;  2G8W A;  1S6Q A;  3WNG A;  1U4B A;  1YT3 A;  1BL3 A;  4WE1 A;  1KSP A;  1TL1 A;  4DTS A;  2ZQB A;  2HHS A;  1C0U A;  3LZI A;  3VQ9 A;  4DQS A;  1Q8I A;  4W5O A;  3O4N A;  4CJ3 A;  3S3M A;  4AHU A;  4FZX C;  3VQ6 A;  3AVH A;  1A5V A;  3VQE A;  1XHZ A;  3C6U A;  4DG1 A;  3OS1 A;  1F21 A;  3QEW A;  4DTR A;  3HJF A;  4M41 A;  3VQC A;  4CJR A;  4YFU A;  1S1W A;  2FBX A;  2X6N A;  3M8S A;  3S3O A;  3SUO A;  2X6S A;  4KB1 A;  2OZM A;  4BAC A;  3MEG A;  3VQB A;  3OYK A;  2OYQ A;  4HVJ A;  3I0S A;  1SL1 A;  3DOL A;  3TR8 A;  4IKF A;  4KHQ A;  4F3T A;  1A5W A;  3KLF A;  2B6A A;  2D0B A;  2YKM A;  3LAN A;  3M8P A;  4KB0 A;  4CJP A;  4IDK A;  4DLG A;  1S1V A;  4W5N A;  4I2Q A;  1KFD A;  1NKE A;  4Y1D A;  1UA1 A;  1RTJ A;  3AO3 A;  4CF9 A;  2Y1J A;  3C6T A;  4DTU A;  1B9F A;  1WLJ A;  3NHG A;  4FJL A;  4DSE A;  1JLG A;  2XY5 A;  3HVR A;  1NK6 A;  3L3V A;  2KZM A;  3RMC A;  1SL2 A;  3SQ0 A;  4G1Q A;  4Z4C A;  2DY4 A;  1RDA A;  4DSJ A;  1BGX T;  3AVA A;  3TAM A;  4CGG A;  4CFB A;  1GOA A;  1TK8 A;  2F8S A;  1LW0 A;  4DF4 A;  1Y97 A;  3RR7 A;  1QQC A;  1RNH A;  4DTN A;  3OY9 A;  4CEQ A;  2XY7 A;  2WON A;  2FC0 A;  3S9H A;  4KHN A;  1VRT A;  4B9M A;  3K5L A;  3LAL A;  4W5T A;  3TAN A;  4CF2 A;  1NJZ A;  1WAJ A;  3EZ5 A;  2HNZ A;  1C0M A;  3LPT A;  2OPR A;  1DTQ A;  4B08 A;  4CJW A;  3LZJ A;  2R7Y A;  4PY5 A;  1ZBF A;  4CK3 A;  3CFP A;  3CFR A;  1KVC A;  2OPP A;  4FJ7 A;  1VSH A;  1LWF A;  4KHY A;  1RDB A;  2E6M A;  1U48 A;  3LP1 A;  2IOC A;  3NCI A;  3AVN A;  1D8Y A;  4QOZ B;  2DFE A;  3MXJ A;  4DQQ A;  4O0I A;  3ZSR A;  1BI4 A;  4DTX A;  4B9V A;  4E1N A;  1NK9 A;  3ZSO A;  3PX0 A;  4CF1 A;  3H08 A;  1K6Y A;  3RWU A;  3EYZ A;  3MAQ A;  4CJ4 A;  2JLE A;  2VWJ A;  4FJX A;  5HP1 A;  4BWJ A;  3KLE A;  4KTZ A;  3ZCM A;  4CGJ A;  5J1E A;  3K5M A;  3TWH A;  4MQ3 A;  4AHV A;  3ZSY A;  4OKE A;  3HPO A;  3QNN A;  1BHL A;  3SNN A;  4FLW A;  4LD0 A;  5J2P A;  3ZT0 A;  1U47 A;  4GMJ B;  3AO2 A;  4IG0 A;  1TKZ A;  1U49 A;  4AHC A;  1L5U A;  1IKW A;  4CJT A;  4M3T A;  1LWC A;  3SYZ A;  2VG5 A;  3LAM A;  4CHN A;  1A5X A;  4LY7 A;  2HVI A;  4E7I A;  1YTU A;  3DLG A;  1NOZ A;  3RMB A;  3T19 A;  3DLH A;  4DTJ A;  5CY4 A;  1XWL A;  2YV0 X;  3AA5 X;  5HRR A;  3TAQ A;  2OPS A;  3AO4 A;  3AVL A;  4DS5 A;  4J2A A;  3HP9 A;  4CGH A;  3DI6 A;  1L3S A;  2HW3 A;  3WNF A;  3CFO A;  3VQ8 A;  4E1M A;  1TAU A;  2YKN A;  3IS9 A;  1IO2 A;  4I9Q A;  3QER A;  3SQ4 A;  4Z4F A;  1UAX A;  4CEA A;  1T03 A;  2D5R A;  4W5R A;  1Z25 A;  4Z4G A;  4OGE A;  3D0P A;  4C8N A;  4C8K A;  4EZ6 A;  3ALY A;  3AO1 A;  3K5N A;  1EKE A;  4ELT A;  4PWD A;  2BE2 A;  3V81 A;  1HJR A;  2VWK A;  3O4Q A;  4FJK A;  4LSN A;  1HMV A;  3BDP A;  4QCL A;  3K59 A;  3VA3 A;  2HHQ A;  2O4I A;  3AA4 A;  4FCY A;  3PX6 A;  4CEE A;  3DM2 A;  1FKO A;  4TSX A;  1BIZ A;  1C1C A;  1U04 A;  3P83 D;  5KI6 A;  4E19 A;  4XIU A;  1EX4 A;  4B8C A;  3B6P A;  1SUQ A;  1WSF A;  4LSL A;  4AH9 A;  3NAE A;  5C24 A;  3QEP A;  1L3T A;  2P5O A;  4BE2 A;  4M45 A;  3LP2 A;  4CHQ A;  3L2U A;  1WN7 A;  4BDP A;  1B92 A;  3PY8 A;  1REV A;  4FLZ A;  4KO0 A;  4KRF A;  1HNV A;  4CHY A;  5FRO A;  3SJJ A;  1QS4 A;  4LH4 A;  1VSE A;  3V6D A;  2QK9 A;  1RTI A;  4NYN A;  4N56 A;  3TAF A;  3VQ5 A;  3AVM A;  2ZE2 A;  2HHT A;  4B9T A;  4C8M A;  3AVG A;  1JXE A;  2G8H A;  4OLA A;  3DRS A;  4FLV A;  1NJY A;  2Z1G A;  3HVT A;  3NF9 A;  3M8Q A;  1SKS A;  3HL8 A;  5KRS A;  2NUB A;  1NJW A;  1S1T A;  1HQU A;  1ASU A;  1WSH A;  2IC3 A;  3L2V A;  1JLQ A;  4HUE A;  3OYN A;  3SQ2 A;  3MXI A;  5HRN A;  4FLX A;  1SV5 A;  4C8O A;  1WSI A;  4M3U A;  3OJS A;  3BGR A;  1QE1 A;  1JLE A;  2GV9 A;  1HQE A;  3MED A;  4AHT A;  4J2D A;  1JL1 A;  1VSI A;  4CJK A;  4C8L A;  3HK2 A;  4FK2 A;  4E7J A;  1RIL A;  2YHB A;  1SKW A;  4FK4 A;  3AA3 A;  1EXQ A;  1X9S A;  1KTQ A;  4CFC A;  3RRG A;  1VSD A;  4GW6 A;  2FBY A;  3NF7 A;  4IG3 A;  3VQD A;  4DSL A;  3NF8 A;  5I3U A;  3HYF A;  3AVC A;  3DRR A;  1CXQ A;  4RG8 A;  3AVF A;  3DMJ A;  1VSJ A;  1NK5 A;  2RF2 A;  4KTQ A;  1RBS A;  1XHX A;  3NDK A;  2PZS A;  2HND A;  3LDS A;  3V1R A;  1WSJ A;  3HT3 A;  2BDP A;  4FJ8 A;  2ZD1 A;  3CG7 A;  1MU2 A;  4OKJ A;  2FBT A;  3KLI A;  2VG7 A;  5E41 A;  4HTU A;  2XRI A;  3NF6 A;  4CGF A;  3QEI A;  3NGY A;  3E01 A;  3O3G A;  3SV4 A;  1WNS A;  2RKI A;  3LPU A;  2E6L A;  3SPY A;  4JS5 A;  3QET A;  4KHS A;  2W42 A;  1TVR A;  4Q5V A;  3O3H A;  1Q9X A;  3LP0 A;  2HB5 A;  1HYS A;  3I0R A;  1X9M A;  1RTH A;  2IGI A;  3LAK A;  3PX4 A;  2P51 A;  4Q0B A;  2ETJ A;  2KW4 A;  3QIP A;  1ASV A;  2PY5 A;  1D9F A;  2KQ2 A;  1S9E A;  1VSM A;  1RT6 A;  3OYA A;  1BCO A;  3JSM A;  4FM2 A;  5SZT A;  1YVU A;  2OZS A;  4AIL C;  4FZY A;  1EP4 A;  5FDL A;  4M3R A;  3KLH A;  2G8V A;  3TAE A;  1QSY A;  3V4I A;  1VK0 A;  5I42 A;  1EET A;  4OKK A;  3SUP A;  4ELU A;  4KI4 A;  1RT1 A;  1RT5 A;  4B8A B;  4E7K A;  1W0H A;  1NOY A;  4E89 A;  4J2B A;  1D9D A;  3TAB A;  2Z1I A;  3CYM A;  3DLB A;  4KHW A;  4O44 A;  1VSK A;  5JS2 A;  4E7L A;  3VA0 A;  5J2M A;  1BIU A;  5J2N A;  1KRP A;  4FJN A;  4GVM A;  4CED A;  1Q9Y A;  3ZT1 A;  1LW2 A;  3ZSV A;  1BI4 B;  4CHP A;  4DF8 A;  3QIO A;  3OYL A;  2HHX A;  4F4K A;  3PV8 A;  1HYZ A;  4CEC A;  5KGX A;  1T05 A;  5FRM A;  2HNY A;  4HCB A;  1W9H A;  3QO9 A;  4BDY A;  4CEO A;  5C42 A;  4FYD A;  2YNG A;  3V1Q A;  1TK0 A;  2F8T A;  1O1W A;  3CM6 A;  4R5P A;  1QSS A;  4W5Q A;  2YHA A;  3VQA A;  4L8R B;  4FJ5 A;  4E3S A;  1DLO A;  4KKO A;  2XO7 A;  5KTQ A;  3RRH A;  1NK0 A;  4O55 A;  3AV9 A;  4FLU A;  3MEC A;  2B4J A;  3L2Q A;  1ZYQ A;  4DFP A;  3ISN C;  2IAJ A;  3OYB A;  3ZSZ A;  1NJX A;  4F2S A;  3V9Z A;  4KAZ A;  1NK7 A;  4I9L A;  3KKS A;  4H4M A;  3RTV A;  2D0A A;  4DS4 A;  4IBN A;  1IG9 A;  1N6Q A;  3OS0 A;  1D5A A;  4Y1C A;  2P1J A;  1ZBI A;  4NCA A;  4CJF A;  4CJU A;  1TK5 A;  3OYG A;  2F96 A;  3FFI A;  1X1P A;  4F8R A;  3SZ2 A;  4NYF A;  1JLB A;  3QLH A;  3AVI A;  1WSE A;  3AA2 A;  4IFY A;  1XC9 A;  1QTM A;  2KTQ A;  4OPK A;  4M3Y A;  1CZB A;  2E4L A;  4AHS A;  3RMA A;  4UQG A;  5DMR A;  4CIE A;  3OYH A;  5HRO A;  4E0D A;  3LWM A;  1TKX A;  4OPJ A;  5HBM A;  3QNO A;  4ZTF A;  4FJM A;  4OJR A;  2GBZ A;  4DSI A;  4DFK A;  3RMD A;  2Q3S A;  1C6V A;  4FXD A;  1RBV A;  4CFD A;  3HO1 A;  1IKV A;  4CGD A;  4J2E A;  2A1S A;  4LH5 A;  1RT4 A;  4DTP A;  3HXM A;  5CZ2 A;  1FKP A;  1VSL A;  3K5O A;  3EY1 A;  4B9S A;  1WSG A;  4BE1 A;  4HCC A;  1RBT A;  4CGI A;  4Z4I A;  3KK2 A;  3OVN A;  1RT2 A;  4CJS A;  4FLY A;  3QES A;  3TI0 A;  3MXM A;  4FZZ A;  1J54 A;  1HRH A;  3VQ4 A;  3NE6 A;  2RPI A;  4CIG A;  3VQ7 A;  1ASW A;  1GOB A;  4N5S A;  4HUF A;  4RW6 A;  5HRS A;  4CF8 A;  1ZBL A;  3DLK A;  2Z1J A;  5CZ1 A;  4BDZ A;  4FLT A;  4CJ5 A;  2EHG A;  1Z26 A;  1GOC A;  1RBR A;  4O0J A;  1NK8 A;  4FJJ A;  1IH7 A;  4CEF A;  3OYJ A;  3DRP A;  2D0C A;  3RR8 A;  1G15 A;  2JGU A;  4K8X A;  1LAW A;  4JLH A;  1JLF A;  3L2R A;  2PYJ A;  4KV8 A;  5T7B A;  3KJV A;  4M3W A;  2LSN A;  3DLE A;  2HHV A;  4CHZ A;  1ITG A;  5JS1 A;  1I3A A;  1RCH A;  4ID1 A;  3M8R A;  3ZT2 A;  3S3N A;  1NK4 A;  2G8U A;  1RT3 A;  1NKC A;  5K14 A;  4MFB A;  2YNF A;  3K57 A;  3PO5 A;  2QKB A;  3NH1 A;  3KD5 E;  3SV3 A;  3NFA A;  4CJQ A;  3C95 A;  4NCG A;  1HNI A;  3OYF A;  1C1B A;  4F2R A;  4ZTJ A;  4CFA A;  4DTM A;  4KHU A;  3WNH A;  1JLA A;  4CE9 A;  3C94 A;  4KTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...