4DV3K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 23
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv3K00
4DUYK 4YHHK 2UUAK 4AQYK 4DR2K 2F4VK 4DR7K 4OX9K 3T1HK 4CW7B 4K0KK 4JI7K 4V19S 4DR1K 4GKKK 1HNZK 4LF6K 3OTOK 4LFCK 4DV7K 4DV4K 4JI5K 4NXMK 4X64K 3J7AP 1N36K 4DR5K 1XMQK 4X66K 5IWAK 4DV6K 3JAMO 5AJ3K 1IBKK 1XMOK 1XNQK 2VQFK 4JI1K 5A2QO 2E5LK 4KHPK 4DR4K 3J7YP 1HNWK 2UXCK 4B3MK 5IT9O 4X65K 2UXBK 2UU9K 4JYAK 4B3RK 1J5EK 2UXDK 1HR0K 3J80O 4DV2K 4JI2K 4YY3K 4JI4K 1N34K 4JI3K 4DUZK 1IBMK 1XNRK 4JI0K 3T1YK 4DV3K 5BR8K 2HHHK 4B3TK 4DV5K 2ZM6K 4JI6K 4NXNK 4GKJK 1I94K 3J81O 4LF7K 4DR3K 4X62K 1IBLK 4JV5K 5LMUK 4B3SK 5FLXO 4LF8K 4LFAK 2UUCK 1N33K 1FJGK 4LF9K 4LFBK 4LF4K 4CVNE 4DV0K 5LL6Z 2VQEK 2UUBK 4LF5K 1N32K 5LMNK 4DV1K 4DR6K 1HNXK 4JI8K
chains in the Genus database with same CATH superfamily
3WXKA 4HVJA 4BACA 4B9LA 4B1YB 4A57A 3P83D 5LJVA 5ADXH 4YDUC 1NJIO 2VG7A 3H1VX 3VQBA 1J5OA 2V7YA 1ILYA 5KQDA 5KRSA 3VGLA 4B1UB 3L4IA 4YDUA 2O8FA 3LAMA 4LF6K 4Z4IA 3VEYA 4O55A 3RSEB 1S6QA 3VQEA 1DT9A 2YNIA 4NXMK 2HHQA 4YORA 2YNGA 1NOZA 1TGOA 3DLBA 4BR5A 3PO5A 4AH9A 5IWAK 3AVAA 1RT1A 3I8DA 2IVNA 1KAYA 3K9JA 5ADXA 4F3TA 1BA1A 4KHUA 4DF8A 1S1XA 1F21A 5GADP 2XY6A 2HVHA 1XHXA 2ITGA 3SPZA 4CF8A 1HJRA 2QWLA 4QS9A 2P9UA 4E7HA 3SCXA 2QWPA 4I2QA 4KHQA 2QXLA 5M1QA 3ZSQA 4BR7A 1VSIA 2I7PA 4CFCA 3LM2A 3QIPA 2HW3A 5T7BA 1IBMK 3SV4A 2VWKA 3HL8A 3D7EO 4Q5VA 4CF0A 4DQIA 3P38A 4JK7A 4JKCA 2X6SA 3WXLA 3KKRA 3A5LC 4DG1A 4WFAL 2WOMA 3I56N 4CEEA 2YKMA 4XH1A 3L0QA 1IBLK 3KWIA 4E7KA 4B3SK 4JS4A 3TI0A 3LDOA 2KZMA 4DTXA 3QEWA 2UUCK 3QDKA 1ATRA 3PLAA 2DY4A 2NRZA 4TSXA 3HP6A 1JLQA 3AO2A 4DV0K 2HBKA 5ELZA 3IAYA 4CD1A 2P5OA 5AQQA 1C6VA 2ZD1A 1RCHA 3MN9A 4I6MB 5C24A 3UKUB 2F4VK 3MAQA 2RHKA 4CZFA 2QM1A 5KGWA 5GINA 3VQPA 1K73O 1DEJA 4H5RA 2E4LA 2DTUA 4BE1A 3VQAA 3U3GA 4B1XB 3G4SN 4E89A 4FO0A 4LFCK 4DV7K 4KHNA 3A0IX 1IH7A 2XY8A 3C6TA 1TUYA 1MDUB 4L3QA 4CJQA 5DM7L 2HBJA 3U3YA 1NGBA 3GDQA 5M1OA 3LAKA 3G71N 1U48A 1JKHA 3BZCA 5C12A 2QW9A 4FWSA 4BC4A 3DM2A 1Q86O 3OYJA 4C1NI 4DU1A 3J7YP 2OPPA 1HNWK 3I0RA 4CEFA 5E41A 2IOCA 3K2PA 1TKZA 2GX9A 4B1WB 3RSEA 1FKOA 4Y1DA 5AQKA 3S3NA 4O5BA 2UU9K 5AQPA 2P5GA 1U47A 4F8RA 4AILC 1RDCA 1YVUA 4PKIA 2P9PA 4BWMA 2OPQA 3ULEB 4B9TA 1HR0K 2G8FA 2D4WA 4BC2A 5AQGA 1Q81O 3PY8A 2HF4A 1N6QA 3SK3A 1NGJA 3S9HA 1XNRK 3VQ6A 1WBBA 1ZBSA 5EXWA 1NGFA 2VWJA 1WAJA 2ASPA 4A2BA 4CJ4A 2O4IA 4WCEL 3SJJA 1TK5A 3R8EA 4FJ7A 2OTJN 1RFQA 2KTQA 1R0AA 3V9ZA 1VQ5N 5FLXO 1GOAA 4BRHA 5C42A 4Z4CA 3P4IA 1DTTA 1GOBA 4LFAK 3MN6A 4PA1A 1ASWA 3MXMA 3SNNA 4CVNE 2Q1NA 4WYBA 4KO0A 3WNHA 1HLUA 3V4IA 4RCHA 4CEQA 3R6MA 3BZKA 3LPUA 1QHTA 4IG3A 3LP2A 2E6MA 3AVHA 1S3XA 1C1CA 4DS4A 3RMCA 3ZSYA 4DWIA 4MLEA 2KQ2A 4DFKA 1JCEA 3VQ8A 4NCGA 3CM5A 1NMNA 2VCPA 1VQMN 4FZXC 4ISFA 4WQ5C 3HOSA 1WSFA 1MU2A 5GAHP 2ZQBA 2GTDA 5CHIA 1IV0A 3VQ4A 1NK6A 1XMQK 1SKSA 3TAEA 3VQ5A 4EZ9A 3MX2A 1Z05A 4YOUA 5C25A 3L3UA 2P9IB 3QMLA 3NHGA 4M3ZA 4I9LA 3WXMB 2QXFA 3G6EN 4DFJA 3OJSA 4DHYA 2ZJPL 2OANA 4IG0A 4CEAA 5AQVA 1BA0A 1LWFA 3O9TA 1J5EK 3KIOA 4PL8A 3J8AA 3O3GA 3TAPA 3N4QA 1ZXOA 4FOIA 2OZMA 1QQNA 2D5RA 3D2FB 2DFHA 2B6AA 1I39A 3VENA 4FM1A 1J53A 4CF9A 4A62A 4J2AA 3P5JA 1Q8IA 2FXUA 3DWLA 1ZBLA 4Q0BA 1HPMA 4DTOA 3EL2A 3PX0A 3AO4A 5JLHA 4E3SA 5SZTA 1W7AA 3BF1A 1LW0A 4EHTA 2XY5A 1I94K 2RF2A 3ZX3A 1ASUA 4CJRA 2G8WA 4BRPA 3ZT3A 2RN2A 4PKHA 5TKWA 4MFBA 3DLGA 5CY4A 3SLCA 5AQHA 3K9KA 4F9OA 1TKXA 3MWPA 1TVRA 4FLUA 4H5VA 4KH6A 2OZSA 4H5NA 4FLZA 4B9VA 1UOCA 3ENBA 1LOTB 4U67L 3AVKA 4M42A 1GLJO 3SUQA 1C1BA 1EWRA 4BGBA 4HUGA 1CXUA 1K8AO 4NO7A 4F2SA 4K8ZA 4M3YA 5C10A 1REVA 3O5BA 3SUNA 2OPRA 3B6OA 5FPNA 1XUPO 3O08A 4K0KK 2WUSA 3DJCA 4DR1K 4HCCA 1U2VB 5F1XA 2IVPA 3DOKA 3I55N 4CK1A 2BE2A 3OBWA 4FLYA 4M3UA 3LALA 4KH5A 4DR5K 2YX6A 4MO4A 1P90A 1NM1A 4CHZA 3OYDA 2ZJQL 3QESA 4I9QA 3NBPA 4YFUA 3ZEUB 1OVQA 3RMDA 1NWKA 2F9WA 1B9FA 3WNEA 1LWCA 5AR0A 3M5RA 2QA4N 4BE2A 3M8RA 1RBSA 2YJFA 2HB5A 1JLBA 3H1QA 4IO8A 5KRTA 3NGYA 3CCEN 3VN5A 3O1BA 5KPRA 4M45A 4IOCL 4CJTA 5C0YA 3MMVA 3AY9A 5C2FA 1UWBA 3SQ0A 1RTHA 4B8CA 5FRNA 3WT0A 1HYVA 1HQUA 4CGIA 4JI3K 1BL3A 3T19A 1NGAA 3N4PA 3T1YK 2P9IA 4CBXA 3GL1A 4CJLA 4ELVA 2QWNA 3AARA 2KZZA 5AQYA 1NBWA 2IC3A 4KH4A 3E9PA 4XEIA 4UQGA 3JYTA 4JD2B 3ITHA 4FK4A 3T7ZA 3CC4N 4YOTA 4IBNA 2W42A 1X9WA 3SYZA 3FZLA 1L3VA 2EHGA 1JLCA 4JKAA 2VGMA 3K5LA 3UKRA 4J8FA 3D2FA 1EETA 2FF6A 3MEEA 2ITMA 4RTFD 4A61A 1QQOA 5J2QA 3CMEN 1VQ9N 3B8AX 4I2PA 4AF1A 3VEVA 3D0PA 1OH7A 4EP4A 4LF5K 1SV5A 3RMAA 1N8RO 4FZYA 3HM9A 3E66A 4AHRA 4DV1K 4CJPA 4OO1J 1IKYA 1YJWN 3OHRA 3NF9A 2E2OA 3AVMA 2O8EB 3L4QA 2QWMA 2CH5A 1WBDA 4A5AA 2YNFA 4B9MA 1SAZA 3V9SA 3C0BA 5I42A 2WTUA 3DMJA 2X74A 1JLEA 3VEXA 4BC5A 3IMXA 4N56A 1Q82O 3CCRN 3J7AP 3QERA 4CJUA 2KFNA 3K5NA 5C2DA 4C8KA 4PY5A 3ID8A 4RW9A 1KFDA 1VQLN 1TK0A 1Q9XA 3DXKA 2RPIA 1IBKK 2JWKA 1BCOA 1T44A 3DLKA 4O8UA 4YOWA 1K8KB 4YOVA 1JJ2M 5JLFA 2RKIA 2Y1IA 1FK9A 1U2VA 2Q2RA 1JXEA 2IAJA 4JNEA 1KVAA 3AAQA 4JRPA 3ZCMA 2ZGZA 3MXJA 5M1PA 4M3TA 4CEOA 3CQ8A 3OYLA 4HTUA 1NJXA 2FBVA 4DSIA 5I9EB 3ZEUA 4DTJA 5JMVA 3V1RA 4BRMA 5EY4A 4EFHA 2ZM6K 5K14A 5BPMA 3HXMA 3EKUA 3EKSA 1L3SA 2D0OA 4FJJA 4GKJK 3HT3A 4Y1CA 5AQXA 4CJWA 3NVMA 3WQTA 4LY7A 1L3TA 3ENHA 3CC7N 2WBNA 4LSNA 3TAQA 3C6UA 1TL1A 4IEIA 1ZBFA 5DMRA 3BF3A 3O1WA 4DFPA 4BR9A 3C7NB 3A5OC 3TWHA 1TYQB 1LAVA 4IWVA 4C23A 1YJNN 4C1NK 1K6YA 2JLEA 1RT4A 3PX6A 1NGDA 3O3FA 3AA4A 1VQON 4BC3A 4HHTA 1IKXA 1D9FA 3VGKA 3MK6A 3PUFA 3VF6A 5HBMA 1U4BA 4IOXA 3LDQA 1T7PA 4FYDA 3CYMA 3T69A 4CZHA 5F2RA 2IS3A 3LWLA 4KB0A 2DFEA 3QIOA 2BH1A 2ZE2A 1QTMA 3K5MA 4ILGB 5BRHA 1OH5A 4M3WA 4HCBA 1CZAN 4DCHA 1NJYA 1VQ8N 2F7TA 2HNYA 1WLJA 1OVYA 4M63C 2NNWA 1HYSA 3ENOA 4WFBL 3QNNA 2O8EA 3NGZA 2VQFK 3V81A 1T05A 3P31A 4BG8A 3HSCA 4DLGA 1V4TA 4RW4A 3ZX0A 4E7JA 4W5NA 2OCEA 1KTQA 3LP3A 1N5YA 2Q31A 4I7FA 3ZT0A 4DU3A 1ZBIA 4OKJA 1GLCG 4IFVA 1SQKA 2P9PB 3ALYA 3DAWA 4MO5A 4FWKA 2PBDA 2A5XA 1OH6A 1MWKA 3B6PA 2G8HA 4WE1A 3O4WA 3VQCA 4GVEA 5AQFA 2WONA 4R79A 1NGEA 2QK9A 4L8RB 1K8KA 4DV3K 1XWLA 3HI0A 4JK9A 4DTMA 4CZLA 3ATVA 1T6CA 4FJLA 3DI6A 2V7ZA 4LF7K 2I7NA 2EWSA 2P9SA 4BE0A 2Q0RA 4A5BA 2X78A 3HK2A 2OPSA 3TTCA 1HNVA 1G99A 2W6KA 3NE6A 3AVNA 4CBWA 4GV6A 4KV8A 3TTFA 3THXB 4PQUA 4FK0A 5FDLA 4F4KA 4AHVA 1YHQN 3FZHA 3CJ7A 5J2PA 2VQEK 4BRAA 1VRTA 2GUIA 4BDPA 4DR6K 4CHOA 2B4JA 4BRFA 2HMIA 1WSJA 2YNHA 4BDZA 3HYFA 1VSHA 2F96A 4FL9A 1CLQA 4IDHA 3CJCA 1RT5A 3AO1A 3K0SA 3C7NA 4V19S 1QZ5A 1TYQA 2FF3B 4DV4K 3HOTA 3UE5A 4MDAA 1C1AA 5HOOA 1BG3A 3Q7CA 1BI4B 3PIOL 3NVKA 3PSFA 4B8AB 5BRDA 1TV6A 3C6HA 2QI2A 3THWB 4DQPA 3O80A 1KC8O 2P51A 1XI1A 2PZSA 2HHUA 2P9KA 1QVFM 1IKVA 1I3AA 4BGAA 2PYJA 4DTSA 3DRRA 1K9MO 4BG9A 1LAWA 1VSKA 1JL1A 3D45A 1KLNA 5KGXA 1JLFA 1NG9A 3KLEA 4H5TA 4JKEA 3W3DA 4AHTA 4BY9C 2F9TA 3CCVN 3DLHA 2YHXA 3HSTB 1BISA 4C8MA 4DSLA 2NRRA 1C0MA 3T1AA 1VRUA 4PWDA 3MEGA 2CGKA 1CZ9A 1FJGK 5AQLA 3KJVA 4DQQA 1RT2A 1ITGA 1KQSM 3DOLA 4Z4EA 2QKBA 4BVPA 3H3OB 2RE2A 5HRNA 1QE1A 3EE9A 3IRXA 1X9SA 3TTDA 4FPBA 3ZT1A 1HNXK 5C15A 2OTLN 3CPWM 2XHBA 4DMNA 3IKMA 4NLCA 4R5PA 4QOZB 3DXMB 3PX4A 3M1FA 1SL0A 3O9UA 1C0TA 4ILJA 2FLOA 1NKBA 4CZKA 4ZTJA 4NCBA 1HKCA 4JI7K 3THXA 3Q7BA 1RBUA 4CJSA 2BTFA 4K43A 3FLCO 3EO3A 1RDWX 1NOYA 1VSFA 4B9NA 1HKBA 1S6PA 1YUWA 2NRHA 3KK1A 1YF5L 4DV6K 3WNGA 5AQOA 4ID1A 4FWNA 4BRCA 1NGIA 4BRDA 3THYA 4C8LA 3SUPA 4E7IA 1A5XA 2E88A 3HVTA 2O8BB 4DSJA 1VHXA 4KI6A 3VESA 5DK5A 4FCYA 3A5NC 4JYAK 3CMAN 3VMFB 5LJWA 3M6GA 3ZSZA 3MN7A 2O4GA 4NLBA 4GY2B 1BI4A 4OKEA 2IVOA 2HBLA 3TARA 3E01A 4CJ5A 1WN7A 1XHZA 3HBTA 1GOCA 1BHLA 1C0FA 3SQ4A 2Q0UA 4PL7A 3THWA 3L8BA 4DTNA 4DV5K 3CFOA 4JI6K 4JS5A 3LDSA 4DR3K 4IEEA 3KK7A 3LZJA 3HO1A 1ASVA 3KLFA 2Q36A 4MLHA 3M8PA 1Q18A 3UKRB 3KLIA 3TAMA 4J2EA 4B9QA 1IG9A 2PFUA 3A2FA 1G15A 3PSIA 2F8SA 4WQ4C 4LF4K 3W0LA 5AQJA 3QEXA 5J2MA 4DQSA 4WQ4A 3HTVA 2A6AA 4FOEA 1S1VA 1P8ZA 4JI8K 3SQ2A 4BR4A 4FW2A 3DLRA 4OPKA 1S5JA 4C8NA 4CEZA 4CZJA 4H0TB 1JXBA 1B9DA 5BR9A 2A3ZA 5M1KA 2Z1HA 4J2BA 2D0CA 3K57A 1QSLA 3EEQA 3LP1A 4H0VB 1TKTA 3KK3A 2OA8A 5JS1A 4IO9L 4JKGA 4GV3A 3VOVA 3DXKB 1D4XA 4X66K 2NRVA 4O44A 1MA9B 1HUXA 3DXMA 1XNQK 1Y97A 5HLFA 4DSFA 3D2EA 4RW8A 2R7YA 4W5RA 3SQ1A 3RR7A 1WSHA 4OLBA 3AGKA 1NMDA 1BQNA 4X65K 3QBWA 3OYMA 4XH5A 1WB9A 4CIGA 1YTUA 4CJ7A 1BCMA 3NH2A 1WNSA 1L5UA 1JLGA 3J80O 1W0HA 3U8XA 2V52B 2GV9A 5HL7L 3CPEA 3L3VA 3A8YA 4CD3A 2HHHK 3CCQN 1WUAA 4FJKA 2YKNA 3OYAA 2O8BA 3J81O 3NAEA 3RTVA 1SZ2A 2NRWA 4KKOA 4BRGA 3OYBA 1IO2A 4FJMA 4ID5A 4BREA 5F0XA 3FE1A 3KZBA 1NK9A 1FW6A 3MECA 2Q3SA 4HUEA 3IG1A 4B9UA 2HHVA 4CHNA 1E4FT 4CF1A 1GLEG 4KTWA 1A5VA 3VPZA 2AA4A 3SBGA 4G1QA 1E3MA 4N41A 4LD0A 2AJQA 3K58A 4DLEA 4FWOA 4AQYK 4Z0UA 4W5TA 5CR4A 3AVCA 5LY3A 4AM6A 3EZWA 5AQTA 5AQWA 4BR0A 2P9LA 1D5AA 4CW7B 2ASMA 1BU6O 3PO4A 4ELUA 4U7BA 4CK2A 2O8DA 3CC2N 4FLXA 4FJ5A 3AV9A 1BIUA 1ZBHA 1RTJA 3H3NO 1T3VA 4WFNL 3NH1A 3OYIA 3BDPA 4IFYA 2FBTA 3AVGA 3KD5E 3SAFA 1ZYQA 4CHPA 2QWQA 3R9PA 3VF2A 5KTQA 4KHSA 2FBXA 1V4SA 3F9MA 5HROA 3AA2A 3OYCA 4E19A 1QQMA 1VSJA 3AVIA 2E1YA 1SKRA 3S3OA 2E20A 5FPMA 4M7YA 1WSEA 3F9KA 5AFUH 2ZGYA 5B8HA 4UY8O 2OYQA 3O9QA 3OYNA 3DYAA 3V6DA 3V9XA 3HJFA 2YHAA 1RGIA 3TSPA 5DM6L 3CQXA 4DUZK 4CECA 1ATNA 3CJAA 2W41A 5EU7A 5GAEP 4IXCA 4JKHA 4CBUA 1QHAA 2P9SB 4FJHA 3MEDA 1NJWA 5AFUA 1B92A 3OBYA 5J2NA 2VWBA 1UA1A 2WC9A 2A41A 3AVLA 3P1GA 4CGDA 3O8MA 4CE9A 4JKDA 4LFBK 3OVNA 1RILA 2GUPA 3C65A 4N47A 5LL6Z 4JRQA 5BPLA 1RTDA 2VG5A 3HZ6A 3OJUA 3LM9A 3U6FA 3V9WA 3MCPA 5M1NA 3SUOA 4CFBA 5AZJB 3OYKA 2PYLA 1GLAG 2B5JA 3HPOA 4FVUA 2HBMA 4OPJA 4W5QA 3SJHA 3EE8A 4KRFA 4FLTA 1NKEA 1W9HA 4CJ3A 4NCAA 3OTOK 2NRXA 3G25A 2BUPA 1T6DA 5JICA 1VSDA 4FJNA 4JI5K 3FR0A 2D0AA 5EOYA 3CF5L 2XO7A 2Z1JA 2ETJA 2UYTA 3TAGA 2GWKA 5HRPA 3ASMA 2Q97A 4HTLA 4Z4HA 5A2QO 1TAUA 1O1WA 3O9SA 3OS1A 2O8CB 3CI5A 3CCMN 4FVMA 1BDGA 2A1RA 4FJ9A 1BGXT 2X6NA 4FWLA 2CGLA 2P1JA 1YVNA 4Y0WA 2P9KB 4YOYA 5FPEA 1H1VA 4K42A 2AP1A 3FZKA 4FW1A 5KPTA 3TABA 4H4OA 2UXDK 4PKGA 3GG4A 1ESVA 4JI4K 4J2DA 5AQNA 1NGHA 1BQMA 3EYZA 3K59A 1WSGA 1XC9A 5JS2A 4CGFA 3H6EA 4GW6A 2HNDA 2HSTA 3T3FA 1VQ6N 4RG8A 3R1XA 1RDUA 1KLMA 1WSIA 2HOEA 2XRIA 2HF3A 1YI2N 1KCFA 1RT3A 3E1YA 4MDBA 1X9MA 2YCHA 3LP0A 3QEVA 1VQNN 3CJ9A 3ZSOA 3SI6A 1CXQA 2VG6A 3QFUA 1DTQA 3RR8A 1NK0A 2Z1IA 3LZIA 3DRPA 3AAPA 4BQLA 4A59A 3KD1E 3U9DA 4KFBA 4YHHK 2UUAK 5J1EA 3SAHA 3WXIA 4BROA 1TUUA 3CIPA 3V1QA 4DTPA 1VK0A 3KWGA 3LL3A 4OX9K 1M90O 1S9GA 4LC9B 5CZ1A 1X9JA 3D6RA 1TL3A 4CZMA 5KQ8A 2QTDA 1JCGA 1HPZA 1RDBA 3G0ZA 2QWRA 4PUOA 3WNFA 2GBZA 3QICA 3CJ1A 2FSKA 1QZ6A 1FXXA 2WFBA 1C0UA 1U04A 1YAGA 2I5JA 1YXQA 2KFZA 4CFDA 3VQQA 1RBVA 3KKSA 1DLOA 1ZC6A 3AO5A 5CZ2A 3OYFA 3CCJN 4KTZA 4CIEA 1KAXA 4CIFA 1NJZA 3ID6A 4JI1K 4BR2A 4DTRA 1NK5A 5AZJA 3VEWA 3THYB 4K8XA 1HX1A 2DPNA 3AO3A 3E9LA 1X3MA 4JAXA 3ULDA 4DR4K 4OPHA 2A40A 3VA0A 4CJEA 2GWJA 4CJVA 4B3MK 5IT9O 3UB5A 4CEDA 1VQ7N 3NCIA 2UXBK 3BY5A 4DTUA 3L2WA 1RDAA 2V51B 4B3RK 4A2AA 1YTAA 1DGKN 3NF6A 5HRRA 3S41A 2NZTA 5BREA 1E4GT 2ASOA 4IKFA 1GLFO 2HVIA 2PY5A 4KHWA 3AA5X 2P9NA 1LW2A 2O8CA 4DQRA 4H4MA 3NF7A 3LDLA 3JSMA 4E1NA 3VEOA 3QO9A 3TU5A 3E9OA 1VQ4N 3TAFA 4FK2A 3FFKB 2VGNA 3BUZB 3H45C 5BPNA 3QB0A 4H5WA 4XIUA 2HHXA 1QVGM 3C95A 4KB1A 2D0PA 3KLGA 1NKCA 5FROA 1XQSC 1HKGA 4H0XB 1JL2A 3QLHA 4IJAA 1YJ9N 4LF9K 3ZLJA 1Q9YA 2A42A 3NF8A 1EX4A 3H08A 3QEPA 3L2VA 4G9ZA 4CZEA 2NRTA 1X1PA 1D9DA 1T8EA 2G8UA 1T03A 3O4NA 4OVLA 4C8OA 3L2QA 2HMPA 5AZIB 5D3GA 1ZBUA 3F73A 4H0OA 1XC3A 3RRGA 3ZX2A 3KHYA 4HWIA 4QS7A 1CZBA 4BVOA 1S1TA 1SL1A 4IOAL 3SPYA 4IDKA 2F8TA 4JKGB 4CF2A 4FJXA 4KPYA 1N36K 4BRKA 2LSNA 1SL2A 4FLVA 2YHBA 2Z1GA 5AQUA 5KI6A 1TK8A 1SS6A 5FRMA 3D2EB 4E1JA 4O0JA 3WEEB 4GV9A 3OS0A 4O0IA 2IGIA 2BDPA 2G8VA 1RTIA 3MN5A 2E2QA 1NU0A 4M3RA 4E1MA 4Z94A 3QFPA 3TANA 2QWOA 3VA3A 2G8IA 3OY9A 2QKKA 1SKWA 3VTHA 4FWMA 3KTQA 1TAQA 4JKBA 1D8YA 4DV2K 4CESA 3K5OA 2A1SA 3J7ZO 4JI0K 1WOQA 1VAZA 3SAGA 5AQZA 1BWFO 4AHSA 4DFMA 2Y1JA 2IDOA 2E1ZA 4O5FA 4ZTFA 2QEXN 4CJFA 5LMUK 3TSUA 4O8KA 2CGJA 4GVMA 4FWPA 4CI6A 1EKEA 3VF4A 4MQ3A 4FM2A 3CJBA 3CCSN 4DKWA 1KXPA 3OA9A 3NH0A 3IFRA 5GIOA 1BUPA 3ATUA 4WQ5A 1YIJN 4I6MA 4M7XA 4DR2K 2YI1A 3OYEA 3UKUA 4DS5A 2YV0X 4CZGA 4B3OA 5E84A 3O4QA 3I0SA 4Z4GA 1HMVA 3DLLL 3CD6N 2P9LB 4H8KA 5E26A 3RMBA 4NB4A 4BDYA 3SZ2A 2O8DB 3VGMA 1A5WA 3HP9A 1Q7YO 1KRPA 3HPHA 2KLAA 4FZZA 3AVBA 3AVJA 1IJJA 1BOTO 1HQEA 3LPTA 4AHCA 3V1OA 1IG8A 2GEMA 4BQZA 4HUFA 3JAMO 3VEZA 3OW2M 3NMUA 2NUBA 4CK3A 2E5LK 4BWJA 5AZIA 2ZF5O 5EX5A 3ZSXA 3ZYYX 4DU4A 4CHQA 1UA0A 3R3LA 3ZT4A 5TKYA 2W6LA 4H03B 1TKDA 2UXCK 1O13A 3JS6A 5GAGP 4DF4A 4CCHA 4RW7A 1U6ZA 3QEIA 3V9UA 3GOIA 4KBOA 5I3UA 5EVZA 3CM6A 4NYFA 3VERA 3KK2A 4N5SA 1RBTA 3DLEA 4H0YB 4QS8A 3ULEA 3G10A 4YNQA 4IZ9A 3AVFA 5AQMA 1S9EA 4M41A 3IS9A 2YHWA 3VQDA 5BN8A 1IKWA 5AQSA 3ZETB 3UIQA 3WEEA 3NFAA 4OPAA 4KTQA 1HNIA 4ELTA 4N76A 4XH4A 4PHTX 4BRIA 5BR8K 4FLWA 1KSPA 4EAHD 4EHUA 4FWRA 1QSYA 5HP1A 3VETA 4JK8A 1S1WA 4ISGA 4CGGA 3OYHA 2VYPA 1U49A 4DSKA 4IJNA 4RW6A 3LWMA 4F3OA 4CERA 1RNHA 3LDNA 4CGHA 2D0BA 1RT6A 1R59O 5BRFA 3HVRA 4K25A 4FWQA 4GMJB 4B1ZA 2ZWHA 2E2PA 3ZSRA 3L2RA 4YOXA 4LH4A 3CFPA 4DUYK 3ZSWA 5GIPA 4E0DA 2FSNA 3I33A 4KI4A 1Y64A 3SBTA 3KLHA 4DQ8A 1KVBA 3A5MC 5CYQA 3AA3A 5AQIA 1HJOA 5JVHL 1VQPN 4FXDA 1OKJA 4EZ6A 1YT3A 1VSMA 5JVGL 4GKKK 1HNZK 3ZT2A 3LDPA 1S22A 1NGCA 4QAGA 4KAZA 4FJIA 5MLCQ 4X64K 1QS4A 3QETA 2BGGA 2KHOA 3ISNC 4CJKA 3SMSA 3THVA 1HRHA 1KFSA 3L6QA 1EP4A 4KHYA 2CH6A 1KAZA 5AJ3K 3M3ZA 4OLAA 1VQKN 3MCAB 3OS2A 2J4RA 3O9RA 2ATQA 1ATSA 1EQYA 3DRSA 4KREA 3U9ZA 3CCLN 1EXQA 5SWMA 4JKFA 2KKZA 1C0GA 2D1KA 4JHDB 3WXJA 3FZMA 3WUHA 3MDQA 3AGRA 4ISEA 3S3MA 4FPAA 4OKKA 4H0PA 2FC0A 3CCUN 4AM7A 4JN4A 1Z26A 4NYNA 3QBXA 3SV3A 4CHYA 2NLXA 3BEXA 1N34K 3BP8A 1W97L 3OYGA 1JCFA 5KPZA 1GLLO 4CFAA 1LWEA 1NK8A 4B3TK 1NGGA 1U45A 3FGUA 1VSLA 3EY1A 4WF9L 3HM8A 4GNIA 2E6LA 1J9AA 1YITN 4Z4FA 1JLAA 2E8AA 3NDKA 4JLHA 4K41A 4OGEA 3FZFA 3JXUA 1N33K 2O8FB 3CFRA 3CXCM 2HHTA 4FJ8A 3F5TA 5CE3A 4DB3A 2PAVA 4ZHRA 3ZETA 4IFEA 4FM0A 4QCLA 3HPGA 3PV8A 1L3UA 3NGIA 1S1UA 5LMNK 2FSJA 3C94A 4DSEA 1NK7A 1NK4A 3KVGA 4CGJA 2GELA 1EWQA 4DR7K 4RWTA 4BRQA 3TSQA 2DFFA 2BANA 1Z6RA 4LH5A 3T1HK 3RWUA 5H1SQ 3F2KA 4BRLA 2E2NA 1M1KO 3M8SA 1RBRA 3VQ9A 3CQYA 1LV5A 3M8QA 5HRSA 3P39A 1FKPA 3TR8A 5M1FA 4B08A 4W5OA 2YHYA 3SMPA 1RT7A 2P9UB 3MXIA 2FBYA 1S72N 1LCUA 1DKGD 1XMOK 1QQCA 1NLVA 1BIZA 3MWTA 3QINA 4ILHA 3EZ5A 2JWLA 4FSVA 1X3NA 1BO5O 4KHPK 3IDHA 3ZSVA 5CYMA 3GBTA 3U4LA 3CG7A 3CERA 4E7LA 2W40A 4EIAA 2EX3A 3O3HA 5AQRA 3GE1A 4AHUA 3EN9A 4O4GA 3L2UA 1WAFA 4ICLA 2HHWA 2YJEA 2JGUA 3QNOA 1OH8A 3HRGA 4JI2K 3I8BA 2G8KA 4YY3K 3VQ7A 1UAXA 3IUCA 2H3GX 1RDDA 4LSLA 3CHWA 1Z25A 2P9NB 3O6WA 2ZJRL 4B9SA 2KW4A 1MWMA 3WQUA 1KD1O 3FFIA 4JHDA 4JEPA 1W2BM 1QSSA 4CZIA 2XY7A 4NXNK 3BGRA 4JD2A 3C6AA 4FJGA 3PIPL 4EP5A 4CEBA 1SUQA 3LANA 4X62K 3CETA 4OGCA 4JV5K 3RRHA 1GLBG 2HNZA 4LF8K 2HHSA 4OJRA 5FPDA 3VTIA 1NNEA 5BN9A 1EO1A 1GLDG 1KVCA 4M3XA 2UUBK 1J54A 3RVCA 3H46O 1HYZA 1N32K 1J6ZA 2IIRA 4BRNA 3TPQA 1VSEA 3MX5A 4B1VA 4F2RA
chains in the Genus database with same CATH topology
4DUYK 4YHHK 2UUAK 4AQYK 4DR2K 2F4VK 4DR7K 4OX9K 3T1HK 4CW7B 4K0KK 4JI7K 4V19S 4DR1K 4GKKK 1HNZK 4LF6K 3OTOK 4LFCK 4DV7K 4DV4K 4JI5K 4NXMK 4X64K 3J7AP 1N36K 4DR5K 1XMQK 4X66K 5IWAK 4DV6K 3JAMO 5AJ3K 1IBKK 1XMOK 1XNQK 2VQFK 4JI1K 5A2QO 2E5LK 4KHPK 4DR4K 3J7YP 1HNWK 2UXCK 4B3MK 5IT9O 4X65K 2UXBK 2UU9K 4JYAK 4B3RK 1J5EK 2UXDK 1HR0K 3J80O 4DV2K 4JI2K 4YY3K 4JI4K 1N34K 4JI3K 4DUZK 1IBMK 1XNRK 4JI0K 3T1YK 4DV3K 5BR8K 2HHHK 4B3TK 4DV5K 2ZM6K 4JI6K 4NXNK 4GKJK 1I94K 3J81O 4LF7K 4DR3K 4X62K 1IBLK 4JV5K 5LMUK 4B3SK 5FLXO 4LF8K 4LFAK 2UUCK 1N33K 1FJGK 4LF9K 4LFBK 4LF4K 4CVNE 4DV0K 5LL6Z 2VQEK 2UUBK 4LF5K 1N32K 5LMNK 4DV1K 4DR6K 1HNXK 4JI8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY K;  4YHH K;  2UUA K;  4AQY K;  4DR2 K;  2F4V K;  4DR7 K;  4OX9 K;  3T1H K;  4CW7 B;  4K0K K;  4JI7 K;  4V19 S;  4DR1 K;  4GKK K;  1HNZ K;  4LF6 K;  3OTO K;  4LFC K;  4DV7 K;  4DV4 K;  4JI5 K;  4NXM K;  4X64 K;  3J7A P;  1N36 K;  4DR5 K;  1XMQ K;  4X66 K;  5IWA K;  4DV6 K;  3JAM O;  5AJ3 K;  1IBK K;  1XMO K;  1XNQ K;  2VQF K;  4JI1 K;  5A2Q O;  2E5L K;  4KHP K;  4DR4 K;  3J7Y P;  1HNW K;  2UXC K;  4B3M K;  5IT9 O;  4X65 K;  2UXB K;  2UU9 K;  4JYA K;  4B3R K;  1J5E K;  2UXD K;  1HR0 K;  3J80 O;  4DV2 K;  4JI2 K;  4YY3 K;  4JI4 K;  1N34 K;  4JI3 K;  4DUZ K;  1IBM K;  1XNR K;  4JI0 K;  3T1Y K;  4DV3 K;  5BR8 K;  2HHH K;  4B3T K;  4DV5 K;  2ZM6 K;  4JI6 K;  4NXN K;  4GKJ K;  1I94 K;  3J81 O;  4LF7 K;  4DR3 K;  4X62 K;  1IBL K;  4JV5 K;  5LMU K;  4B3S K;  5FLX O;  4LF8 K;  4LFA K;  2UUC K;  1N33 K;  1FJG K;  4LF9 K;  4LFB K;  4LF4 K;  4CVN E;  4DV0 K;  5LL6 Z;  2VQE K;  2UUB K;  4LF5 K;  1N32 K;  5LMN K;  4DV1 K;  4DR6 K;  1HNX K;  4JI8 K; 
#chains in the Genus database with same CATH topology
 3WXK A;  4HVJ A;  4BAC A;  4B9L A;  4B1Y B;  4A57 A;  3P83 D;  5LJV A;  5ADX H;  4YDU C;  1NJI O;  2VG7 A;  3H1V X;  3VQB A;  1J5O A;  2V7Y A;  1ILY A;  5KQD A;  5KRS A;  3VGL A;  4B1U B;  3L4I A;  4YDU A;  2O8F A;  3LAM A;  4LF6 K;  4Z4I A;  3VEY A;  4O55 A;  3RSE B;  1S6Q A;  3VQE A;  1DT9 A;  2YNI A;  4NXM K;  2HHQ A;  4YOR A;  2YNG A;  1NOZ A;  1TGO A;  3DLB A;  4BR5 A;  3PO5 A;  4AH9 A;  5IWA K;  3AVA A;  1RT1 A;  3I8D A;  2IVN A;  1KAY A;  3K9J A;  5ADX A;  4F3T A;  1BA1 A;  4KHU A;  4DF8 A;  1S1X A;  1F21 A;  5GAD P;  2XY6 A;  2HVH A;  1XHX A;  2ITG A;  3SPZ A;  4CF8 A;  1HJR A;  2QWL A;  4QS9 A;  2P9U A;  4E7H A;  3SCX A;  2QWP A;  4I2Q A;  4KHQ A;  2QXL A;  5M1Q A;  3ZSQ A;  4BR7 A;  1VSI A;  2I7P A;  4CFC A;  3LM2 A;  3QIP A;  2HW3 A;  5T7B A;  1IBM K;  3SV4 A;  2VWK A;  3HL8 A;  3D7E O;  4Q5V A;  4CF0 A;  4DQI A;  3P38 A;  4JK7 A;  4JKC A;  2X6S A;  3WXL A;  3KKR A;  3A5L C;  4DG1 A;  4WFA L;  2WOM A;  3I56 N;  4CEE A;  2YKM A;  4XH1 A;  3L0Q A;  1IBL K;  3KWI A;  4E7K A;  4B3S K;  4JS4 A;  3TI0 A;  3LDO A;  2KZM A;  4DTX A;  3QEW A;  2UUC K;  3QDK A;  1ATR A;  3PLA A;  2DY4 A;  2NRZ A;  4TSX A;  3HP6 A;  1JLQ A;  3AO2 A;  4DV0 K;  2HBK A;  5ELZ A;  3IAY A;  4CD1 A;  2P5O A;  5AQQ A;  1C6V A;  2ZD1 A;  1RCH A;  3MN9 A;  4I6M B;  5C24 A;  3UKU B;  2F4V K;  3MAQ A;  2RHK A;  4CZF A;  2QM1 A;  5KGW A;  5GIN A;  3VQP A;  1K73 O;  1DEJ A;  4H5R A;  2E4L A;  2DTU A;  4BE1 A;  3VQA A;  3U3G A;  4B1X B;  3G4S N;  4E89 A;  4FO0 A;  4LFC K;  4DV7 K;  4KHN A;  3A0I X;  1IH7 A;  2XY8 A;  3C6T A;  1TUY A;  1MDU B;  4L3Q A;  4CJQ A;  5DM7 L;  2HBJ A;  3U3Y A;  1NGB A;  3GDQ A;  5M1O A;  3LAK A;  3G71 N;  1U48 A;  1JKH A;  3BZC A;  5C12 A;  2QW9 A;  4FWS A;  4BC4 A;  3DM2 A;  1Q86 O;  3OYJ A;  4C1N I;  4DU1 A;  3J7Y P;  2OPP A;  1HNW K;  3I0R A;  4CEF A;  5E41 A;  2IOC A;  3K2P A;  1TKZ A;  2GX9 A;  4B1W B;  3RSE A;  1FKO A;  4Y1D A;  5AQK A;  3S3N A;  4O5B A;  2UU9 K;  5AQP A;  2P5G A;  1U47 A;  4F8R A;  4AIL C;  1RDC A;  1YVU A;  4PKI A;  2P9P A;  4BWM A;  2OPQ A;  3ULE B;  4B9T A;  1HR0 K;  2G8F A;  2D4W A;  4BC2 A;  5AQG A;  1Q81 O;  3PY8 A;  2HF4 A;  1N6Q A;  3SK3 A;  1NGJ A;  3S9H A;  1XNR K;  3VQ6 A;  1WBB A;  1ZBS A;  5EXW A;  1NGF A;  2VWJ A;  1WAJ A;  2ASP A;  4A2B A;  4CJ4 A;  2O4I A;  4WCE L;  3SJJ A;  1TK5 A;  3R8E A;  4FJ7 A;  2OTJ N;  1RFQ A;  2KTQ A;  1R0A A;  3V9Z A;  1VQ5 N;  5FLX O;  1GOA A;  4BRH A;  5C42 A;  4Z4C A;  3P4I A;  1DTT A;  1GOB A;  4LFA K;  3MN6 A;  4PA1 A;  1ASW A;  3MXM A;  3SNN A;  4CVN E;  2Q1N A;  4WYB A;  4KO0 A;  3WNH A;  1HLU A;  3V4I A;  4RCH A;  4CEQ A;  3R6M A;  3BZK A;  3LPU A;  1QHT A;  4IG3 A;  3LP2 A;  2E6M A;  3AVH A;  1S3X A;  1C1C A;  4DS4 A;  3RMC A;  3ZSY A;  4DWI A;  4MLE A;  2KQ2 A;  4DFK A;  1JCE A;  3VQ8 A;  4NCG A;  3CM5 A;  1NMN A;  2VCP A;  1VQM N;  4FZX C;  4ISF A;  4WQ5 C;  3HOS A;  1WSF A;  1MU2 A;  5GAH P;  2ZQB A;  2GTD A;  5CHI A;  1IV0 A;  3VQ4 A;  1NK6 A;  1XMQ K;  1SKS A;  3TAE A;  3VQ5 A;  4EZ9 A;  3MX2 A;  1Z05 A;  4YOU A;  5C25 A;  3L3U A;  2P9I B;  3QML A;  3NHG A;  4M3Z A;  4I9L A;  3WXM B;  2QXF A;  3G6E N;  4DFJ A;  3OJS A;  4DHY A;  2ZJP L;  2OAN A;  4IG0 A;  4CEA A;  5AQV A;  1BA0 A;  1LWF A;  3O9T A;  1J5E K;  3KIO A;  4PL8 A;  3J8A A;  3O3G A;  3TAP A;  3N4Q A;  1ZXO A;  4FOI A;  2OZM A;  1QQN A;  2D5R A;  3D2F B;  2DFH A;  2B6A A;  1I39 A;  3VEN A;  4FM1 A;  1J53 A;  4CF9 A;  4A62 A;  4J2A A;  3P5J A;  1Q8I A;  2FXU A;  3DWL A;  1ZBL A;  4Q0B A;  1HPM A;  4DTO A;  3EL2 A;  3PX0 A;  3AO4 A;  5JLH A;  4E3S A;  5SZT A;  1W7A A;  3BF1 A;  1LW0 A;  4EHT A;  2XY5 A;  1I94 K;  2RF2 A;  3ZX3 A;  1ASU A;  4CJR A;  2G8W A;  4BRP A;  3ZT3 A;  2RN2 A;  4PKH A;  5TKW A;  4MFB A;  3DLG A;  5CY4 A;  3SLC A;  5AQH A;  3K9K A;  4F9O A;  1TKX A;  3MWP A;  1TVR A;  4FLU A;  4H5V A;  4KH6 A;  2OZS A;  4H5N A;  4FLZ A;  4B9V A;  1UOC A;  3ENB A;  1LOT B;  4U67 L;  3AVK A;  4M42 A;  1GLJ O;  3SUQ A;  1C1B A;  1EWR A;  4BGB A;  4HUG A;  1CXU A;  1K8A O;  4NO7 A;  4F2S A;  4K8Z A;  4M3Y A;  5C10 A;  1REV A;  3O5B A;  3SUN A;  2OPR A;  3B6O A;  5FPN A;  1XUP O;  3O08 A;  4K0K K;  2WUS A;  3DJC A;  4DR1 K;  4HCC A;  1U2V B;  5F1X A;  2IVP A;  3DOK A;  3I55 N;  4CK1 A;  2BE2 A;  3OBW A;  4FLY A;  4M3U A;  3LAL A;  4KH5 A;  4DR5 K;  2YX6 A;  4MO4 A;  1P90 A;  1NM1 A;  4CHZ A;  3OYD A;  2ZJQ L;  3QES A;  4I9Q A;  3NBP A;  4YFU A;  3ZEU B;  1OVQ A;  3RMD A;  1NWK A;  2F9W A;  1B9F A;  3WNE A;  1LWC A;  5AR0 A;  3M5R A;  2QA4 N;  4BE2 A;  3M8R A;  1RBS A;  2YJF A;  2HB5 A;  1JLB A;  3H1Q A;  4IO8 A;  5KRT A;  3NGY A;  3CCE N;  3VN5 A;  3O1B A;  5KPR A;  4M45 A;  4IOC L;  4CJT A;  5C0Y A;  3MMV A;  3AY9 A;  5C2F A;  1UWB A;  3SQ0 A;  1RTH A;  4B8C A;  5FRN A;  3WT0 A;  1HYV A;  1HQU A;  4CGI A;  4JI3 K;  1BL3 A;  3T19 A;  1NGA A;  3N4P A;  3T1Y K;  2P9I A;  4CBX A;  3GL1 A;  4CJL A;  4ELV A;  2QWN A;  3AAR A;  2KZZ A;  5AQY A;  1NBW A;  2IC3 A;  4KH4 A;  3E9P A;  4XEI A;  4UQG A;  3JYT A;  4JD2 B;  3ITH A;  4FK4 A;  3T7Z A;  3CC4 N;  4YOT A;  4IBN A;  2W42 A;  1X9W A;  3SYZ A;  3FZL A;  1L3V A;  2EHG A;  1JLC A;  4JKA A;  2VGM A;  3K5L A;  3UKR A;  4J8F A;  3D2F A;  1EET A;  2FF6 A;  3MEE A;  2ITM A;  4RTF D;  4A61 A;  1QQO A;  5J2Q A;  3CME N;  1VQ9 N;  3B8A X;  4I2P A;  4AF1 A;  3VEV A;  3D0P A;  1OH7 A;  4EP4 A;  4LF5 K;  1SV5 A;  3RMA A;  1N8R O;  4FZY A;  3HM9 A;  3E66 A;  4AHR A;  4DV1 K;  4CJP A;  4OO1 J;  1IKY A;  1YJW N;  3OHR A;  3NF9 A;  2E2O A;  3AVM A;  2O8E B;  3L4Q A;  2QWM A;  2CH5 A;  1WBD A;  4A5A A;  2YNF A;  4B9M A;  1SAZ A;  3V9S A;  3C0B A;  5I42 A;  2WTU A;  3DMJ A;  2X74 A;  1JLE A;  3VEX A;  4BC5 A;  3IMX A;  4N56 A;  1Q82 O;  3CCR N;  3J7A P;  3QER A;  4CJU A;  2KFN A;  3K5N A;  5C2D A;  4C8K A;  4PY5 A;  3ID8 A;  4RW9 A;  1KFD A;  1VQL N;  1TK0 A;  1Q9X A;  3DXK A;  2RPI A;  1IBK K;  2JWK A;  1BCO A;  1T44 A;  3DLK A;  4O8U A;  4YOW A;  1K8K B;  4YOV A;  1JJ2 M;  5JLF A;  2RKI A;  2Y1I A;  1FK9 A;  1U2V A;  2Q2R A;  1JXE A;  2IAJ A;  4JNE A;  1KVA A;  3AAQ A;  4JRP A;  3ZCM A;  2ZGZ A;  3MXJ A;  5M1P A;  4M3T A;  4CEO A;  3CQ8 A;  3OYL A;  4HTU A;  1NJX A;  2FBV A;  4DSI A;  5I9E B;  3ZEU A;  4DTJ A;  5JMV A;  3V1R A;  4BRM A;  5EY4 A;  4EFH A;  2ZM6 K;  5K14 A;  5BPM A;  3HXM A;  3EKU A;  3EKS A;  1L3S A;  2D0O A;  4FJJ A;  4GKJ K;  3HT3 A;  4Y1C A;  5AQX A;  4CJW A;  3NVM A;  3WQT A;  4LY7 A;  1L3T A;  3ENH A;  3CC7 N;  2WBN A;  4LSN A;  3TAQ A;  3C6U A;  1TL1 A;  4IEI A;  1ZBF A;  5DMR A;  3BF3 A;  3O1W A;  4DFP A;  4BR9 A;  3C7N B;  3A5O C;  3TWH A;  1TYQ B;  1LAV A;  4IWV A;  4C23 A;  1YJN N;  4C1N K;  1K6Y A;  2JLE A;  1RT4 A;  3PX6 A;  1NGD A;  3O3F A;  3AA4 A;  1VQO N;  4BC3 A;  4HHT A;  1IKX A;  1D9F A;  3VGK A;  3MK6 A;  3PUF A;  3VF6 A;  5HBM A;  1U4B A;  4IOX A;  3LDQ A;  1T7P A;  4FYD A;  3CYM A;  3T69 A;  4CZH A;  5F2R A;  2IS3 A;  3LWL A;  4KB0 A;  2DFE A;  3QIO A;  2BH1 A;  2ZE2 A;  1QTM A;  3K5M A;  4ILG B;  5BRH A;  1OH5 A;  4M3W A;  4HCB A;  1CZA N;  4DCH A;  1NJY A;  1VQ8 N;  2F7T A;  2HNY A;  1WLJ A;  1OVY A;  4M63 C;  2NNW A;  1HYS A;  3ENO A;  4WFB L;  3QNN A;  2O8E A;  3NGZ A;  2VQF K;  3V81 A;  1T05 A;  3P31 A;  4BG8 A;  3HSC A;  4DLG A;  1V4T A;  4RW4 A;  3ZX0 A;  4E7J A;  4W5N A;  2OCE A;  1KTQ A;  3LP3 A;  1N5Y A;  2Q31 A;  4I7F A;  3ZT0 A;  4DU3 A;  1ZBI A;  4OKJ A;  1GLC G;  4IFV A;  1SQK A;  2P9P B;  3ALY A;  3DAW A;  4MO5 A;  4FWK A;  2PBD A;  2A5X A;  1OH6 A;  1MWK A;  3B6P A;  2G8H A;  4WE1 A;  3O4W A;  3VQC A;  4GVE A;  5AQF A;  2WON A;  4R79 A;  1NGE A;  2QK9 A;  4L8R B;  1K8K A;  4DV3 K;  1XWL A;  3HI0 A;  4JK9 A;  4DTM A;  4CZL A;  3ATV A;  1T6C A;  4FJL A;  3DI6 A;  2V7Z A;  4LF7 K;  2I7N A;  2EWS A;  2P9S A;  4BE0 A;  2Q0R A;  4A5B A;  2X78 A;  3HK2 A;  2OPS A;  3TTC A;  1HNV A;  1G99 A;  2W6K A;  3NE6 A;  3AVN A;  4CBW A;  4GV6 A;  4KV8 A;  3TTF A;  3THX B;  4PQU A;  4FK0 A;  5FDL A;  4F4K A;  4AHV A;  1YHQ N;  3FZH A;  3CJ7 A;  5J2P A;  2VQE K;  4BRA A;  1VRT A;  2GUI A;  4BDP A;  4DR6 K;  4CHO A;  2B4J A;  4BRF A;  2HMI A;  1WSJ A;  2YNH A;  4BDZ A;  3HYF A;  1VSH A;  2F96 A;  4FL9 A;  1CLQ A;  4IDH A;  3CJC A;  1RT5 A;  3AO1 A;  3K0S A;  3C7N A;  4V19 S;  1QZ5 A;  1TYQ A;  2FF3 B;  4DV4 K;  3HOT A;  3UE5 A;  4MDA A;  1C1A A;  5HOO A;  1BG3 A;  3Q7C A;  1BI4 B;  3PIO L;  3NVK A;  3PSF A;  4B8A B;  5BRD A;  1TV6 A;  3C6H A;  2QI2 A;  3THW B;  4DQP A;  3O80 A;  1KC8 O;  2P51 A;  1XI1 A;  2PZS A;  2HHU A;  2P9K A;  1QVF M;  1IKV A;  1I3A A;  4BGA A;  2PYJ A;  4DTS A;  3DRR A;  1K9M O;  4BG9 A;  1LAW A;  1VSK A;  1JL1 A;  3D45 A;  1KLN A;  5KGX A;  1JLF A;  1NG9 A;  3KLE A;  4H5T A;  4JKE A;  3W3D A;  4AHT A;  4BY9 C;  2F9T A;  3CCV N;  3DLH A;  2YHX A;  3HST B;  1BIS A;  4C8M A;  4DSL A;  2NRR A;  1C0M A;  3T1A A;  1VRU A;  4PWD A;  3MEG A;  2CGK A;  1CZ9 A;  1FJG K;  5AQL A;  3KJV A;  4DQQ A;  1RT2 A;  1ITG A;  1KQS M;  3DOL A;  4Z4E A;  2QKB A;  4BVP A;  3H3O B;  2RE2 A;  5HRN A;  1QE1 A;  3EE9 A;  3IRX A;  1X9S A;  3TTD A;  4FPB A;  3ZT1 A;  1HNX K;  5C15 A;  2OTL N;  3CPW M;  2XHB A;  4DMN A;  3IKM A;  4NLC A;  4R5P A;  4QOZ B;  3DXM B;  3PX4 A;  3M1F A;  1SL0 A;  3O9U A;  1C0T A;  4ILJ A;  2FLO A;  1NKB A;  4CZK A;  4ZTJ A;  4NCB A;  1HKC A;  4JI7 K;  3THX A;  3Q7B A;  1RBU A;  4CJS A;  2BTF A;  4K43 A;  3FLC O;  3EO3 A;  1RDW X;  1NOY A;  1VSF A;  4B9N A;  1HKB A;  1S6P A;  1YUW A;  2NRH A;  3KK1 A;  1YF5 L;  4DV6 K;  3WNG A;  5AQO A;  4ID1 A;  4FWN A;  4BRC A;  1NGI A;  4BRD A;  3THY A;  4C8L A;  3SUP A;  4E7I A;  1A5X A;  2E88 A;  3HVT A;  2O8B B;  4DSJ A;  1VHX A;  4KI6 A;  3VES A;  5DK5 A;  4FCY A;  3A5N C;  4JYA K;  3CMA N;  3VMF B;  5LJW A;  3M6G A;  3ZSZ A;  3MN7 A;  2O4G A;  4NLB A;  4GY2 B;  1BI4 A;  4OKE A;  2IVO A;  2HBL A;  3TAR A;  3E01 A;  4CJ5 A;  1WN7 A;  1XHZ A;  3HBT A;  1GOC A;  1BHL A;  1C0F A;  3SQ4 A;  2Q0U A;  4PL7 A;  3THW A;  3L8B A;  4DTN A;  4DV5 K;  3CFO A;  4JI6 K;  4JS5 A;  3LDS A;  4DR3 K;  4IEE A;  3KK7 A;  3LZJ A;  3HO1 A;  1ASV A;  3KLF A;  2Q36 A;  4MLH A;  3M8P A;  1Q18 A;  3UKR B;  3KLI A;  3TAM A;  4J2E A;  4B9Q A;  1IG9 A;  2PFU A;  3A2F A;  1G15 A;  3PSI A;  2F8S A;  4WQ4 C;  4LF4 K;  3W0L A;  5AQJ A;  3QEX A;  5J2M A;  4DQS A;  4WQ4 A;  3HTV A;  2A6A A;  4FOE A;  1S1V A;  1P8Z A;  4JI8 K;  3SQ2 A;  4BR4 A;  4FW2 A;  3DLR A;  4OPK A;  1S5J A;  4C8N A;  4CEZ A;  4CZJ A;  4H0T B;  1JXB A;  1B9D A;  5BR9 A;  2A3Z A;  5M1K A;  2Z1H A;  4J2B A;  2D0C A;  3K57 A;  1QSL A;  3EEQ A;  3LP1 A;  4H0V B;  1TKT A;  3KK3 A;  2OA8 A;  5JS1 A;  4IO9 L;  4JKG A;  4GV3 A;  3VOV A;  3DXK B;  1D4X A;  4X66 K;  2NRV A;  4O44 A;  1MA9 B;  1HUX A;  3DXM A;  1XNQ K;  1Y97 A;  5HLF A;  4DSF A;  3D2E A;  4RW8 A;  2R7Y A;  4W5R A;  3SQ1 A;  3RR7 A;  1WSH A;  4OLB A;  3AGK A;  1NMD A;  1BQN A;  4X65 K;  3QBW A;  3OYM A;  4XH5 A;  1WB9 A;  4CIG A;  1YTU A;  4CJ7 A;  1BCM A;  3NH2 A;  1WNS A;  1L5U A;  1JLG A;  3J80 O;  1W0H A;  3U8X A;  2V52 B;  2GV9 A;  5HL7 L;  3CPE A;  3L3V A;  3A8Y A;  4CD3 A;  2HHH K;  3CCQ N;  1WUA A;  4FJK A;  2YKN A;  3OYA A;  2O8B A;  3J81 O;  3NAE A;  3RTV A;  1SZ2 A;  2NRW A;  4KKO A;  4BRG A;  3OYB A;  1IO2 A;  4FJM A;  4ID5 A;  4BRE A;  5F0X A;  3FE1 A;  3KZB A;  1NK9 A;  1FW6 A;  3MEC A;  2Q3S A;  4HUE A;  3IG1 A;  4B9U A;  2HHV A;  4CHN A;  1E4F T;  4CF1 A;  1GLE G;  4KTW A;  1A5V A;  3VPZ A;  2AA4 A;  3SBG A;  4G1Q A;  1E3M A;  4N41 A;  4LD0 A;  2AJQ A;  3K58 A;  4DLE A;  4FWO A;  4AQY K;  4Z0U A;  4W5T A;  5CR4 A;  3AVC A;  5LY3 A;  4AM6 A;  3EZW A;  5AQT A;  5AQW A;  4BR0 A;  2P9L A;  1D5A A;  4CW7 B;  2ASM A;  1BU6 O;  3PO4 A;  4ELU A;  4U7B A;  4CK2 A;  2O8D A;  3CC2 N;  4FLX A;  4FJ5 A;  3AV9 A;  1BIU A;  1ZBH A;  1RTJ A;  3H3N O;  1T3V A;  4WFN L;  3NH1 A;  3OYI A;  3BDP A;  4IFY A;  2FBT A;  3AVG A;  3KD5 E;  3SAF A;  1ZYQ A;  4CHP A;  2QWQ A;  3R9P A;  3VF2 A;  5KTQ A;  4KHS A;  2FBX A;  1V4S A;  3F9M A;  5HRO A;  3AA2 A;  3OYC A;  4E19 A;  1QQM A;  1VSJ A;  3AVI A;  2E1Y A;  1SKR A;  3S3O A;  2E20 A;  5FPM A;  4M7Y A;  1WSE A;  3F9K A;  5AFU H;  2ZGY A;  5B8H A;  4UY8 O;  2OYQ A;  3O9Q A;  3OYN A;  3DYA A;  3V6D A;  3V9X A;  3HJF A;  2YHA A;  1RGI A;  3TSP A;  5DM6 L;  3CQX A;  4DUZ K;  4CEC A;  1ATN A;  3CJA A;  2W41 A;  5EU7 A;  5GAE P;  4IXC A;  4JKH A;  4CBU A;  1QHA A;  2P9S B;  4FJH A;  3MED A;  1NJW A;  5AFU A;  1B92 A;  3OBY A;  5J2N A;  2VWB A;  1UA1 A;  2WC9 A;  2A41 A;  3AVL A;  3P1G A;  4CGD A;  3O8M A;  4CE9 A;  4JKD A;  4LFB K;  3OVN A;  1RIL A;  2GUP A;  3C65 A;  4N47 A;  5LL6 Z;  4JRQ A;  5BPL A;  1RTD A;  2VG5 A;  3HZ6 A;  3OJU A;  3LM9 A;  3U6F A;  3V9W A;  3MCP A;  5M1N A;  3SUO A;  4CFB A;  5AZJ B;  3OYK A;  2PYL A;  1GLA G;  2B5J A;  3HPO A;  4FVU A;  2HBM A;  4OPJ A;  4W5Q A;  3SJH A;  3EE8 A;  4KRF A;  4FLT A;  1NKE A;  1W9H A;  4CJ3 A;  4NCA A;  3OTO K;  2NRX A;  3G25 A;  2BUP A;  1T6D A;  5JIC A;  1VSD A;  4FJN A;  4JI5 K;  3FR0 A;  2D0A A;  5EOY A;  3CF5 L;  2XO7 A;  2Z1J A;  2ETJ A;  2UYT A;  3TAG A;  2GWK A;  5HRP A;  3ASM A;  2Q97 A;  4HTL A;  4Z4H A;  5A2Q O;  1TAU A;  1O1W A;  3O9S A;  3OS1 A;  2O8C B;  3CI5 A;  3CCM N;  4FVM A;  1BDG A;  2A1R A;  4FJ9 A;  1BGX T;  2X6N A;  4FWL A;  2CGL A;  2P1J A;  1YVN A;  4Y0W A;  2P9K B;  4YOY A;  5FPE A;  1H1V A;  4K42 A;  2AP1 A;  3FZK A;  4FW1 A;  5KPT A;  3TAB A;  4H4O A;  2UXD K;  4PKG A;  3GG4 A;  1ESV A;  4JI4 K;  4J2D A;  5AQN A;  1NGH A;  1BQM A;  3EYZ A;  3K59 A;  1WSG A;  1XC9 A;  5JS2 A;  4CGF A;  3H6E A;  4GW6 A;  2HND A;  2HST A;  3T3F A;  1VQ6 N;  4RG8 A;  3R1X A;  1RDU A;  1KLM A;  1WSI A;  2HOE A;  2XRI A;  2HF3 A;  1YI2 N;  1KCF A;  1RT3 A;  3E1Y A;  4MDB A;  1X9M A;  2YCH A;  3LP0 A;  3QEV A;  1VQN N;  3CJ9 A;  3ZSO A;  3SI6 A;  1CXQ A;  2VG6 A;  3QFU A;  1DTQ A;  3RR8 A;  1NK0 A;  2Z1I A;  3LZI A;  3DRP A;  3AAP A;  4BQL A;  4A59 A;  3KD1 E;  3U9D A;  4KFB A;  4YHH K;  2UUA K;  5J1E A;  3SAH A;  3WXI A;  4BRO A;  1TUU A;  3CIP A;  3V1Q A;  4DTP A;  1VK0 A;  3KWG A;  3LL3 A;  4OX9 K;  1M90 O;  1S9G A;  4LC9 B;  5CZ1 A;  1X9J A;  3D6R A;  1TL3 A;  4CZM A;  5KQ8 A;  2QTD A;  1JCG A;  1HPZ A;  1RDB A;  3G0Z A;  2QWR A;  4PUO A;  3WNF A;  2GBZ A;  3QIC A;  3CJ1 A;  2FSK A;  1QZ6 A;  1FXX A;  2WFB A;  1C0U A;  1U04 A;  1YAG A;  2I5J A;  1YXQ A;  2KFZ A;  4CFD A;  3VQQ A;  1RBV A;  3KKS A;  1DLO A;  1ZC6 A;  3AO5 A;  5CZ2 A;  3OYF A;  3CCJ N;  4KTZ A;  4CIE A;  1KAX A;  4CIF A;  1NJZ A;  3ID6 A;  4JI1 K;  4BR2 A;  4DTR A;  1NK5 A;  5AZJ A;  3VEW A;  3THY B;  4K8X A;  1HX1 A;  2DPN A;  3AO3 A;  3E9L A;  1X3M A;  4JAX A;  3ULD A;  4DR4 K;  4OPH A;  2A40 A;  3VA0 A;  4CJE A;  2GWJ A;  4CJV A;  4B3M K;  5IT9 O;  3UB5 A;  4CED A;  1VQ7 N;  3NCI A;  2UXB K;  3BY5 A;  4DTU A;  3L2W A;  1RDA A;  2V51 B;  4B3R K;  4A2A A;  1YTA A;  1DGK N;  3NF6 A;  5HRR A;  3S41 A;  2NZT A;  5BRE A;  1E4G T;  2ASO A;  4IKF A;  1GLF O;  2HVI A;  2PY5 A;  4KHW A;  3AA5 X;  2P9N A;  1LW2 A;  2O8C A;  4DQR A;  4H4M A;  3NF7 A;  3LDL A;  3JSM A;  4E1N A;  3VEO A;  3QO9 A;  3TU5 A;  3E9O A;  1VQ4 N;  3TAF A;  4FK2 A;  3FFK B;  2VGN A;  3BUZ B;  3H45 C;  5BPN A;  3QB0 A;  4H5W A;  4XIU A;  2HHX A;  1QVG M;  3C95 A;  4KB1 A;  2D0P A;  3KLG A;  1NKC A;  5FRO A;  1XQS C;  1HKG A;  4H0X B;  1JL2 A;  3QLH A;  4IJA A;  1YJ9 N;  4LF9 K;  3ZLJ A;  1Q9Y A;  2A42 A;  3NF8 A;  1EX4 A;  3H08 A;  3QEP A;  3L2V A;  4G9Z A;  4CZE A;  2NRT A;  1X1P A;  1D9D A;  1T8E A;  2G8U A;  1T03 A;  3O4N A;  4OVL A;  4C8O A;  3L2Q A;  2HMP A;  5AZI B;  5D3G A;  1ZBU A;  3F73 A;  4H0O A;  1XC3 A;  3RRG A;  3ZX2 A;  3KHY A;  4HWI A;  4QS7 A;  1CZB A;  4BVO A;  1S1T A;  1SL1 A;  4IOA L;  3SPY A;  4IDK A;  2F8T A;  4JKG B;  4CF2 A;  4FJX A;  4KPY A;  1N36 K;  4BRK A;  2LSN A;  1SL2 A;  4FLV A;  2YHB A;  2Z1G A;  5AQU A;  5KI6 A;  1TK8 A;  1SS6 A;  5FRM A;  3D2E B;  4E1J A;  4O0J A;  3WEE B;  4GV9 A;  3OS0 A;  4O0I A;  2IGI A;  2BDP A;  2G8V A;  1RTI A;  3MN5 A;  2E2Q A;  1NU0 A;  4M3R A;  4E1M A;  4Z94 A;  3QFP A;  3TAN A;  2QWO A;  3VA3 A;  2G8I A;  3OY9 A;  2QKK A;  1SKW A;  3VTH A;  4FWM A;  3KTQ A;  1TAQ A;  4JKB A;  1D8Y A;  4DV2 K;  4CES A;  3K5O A;  2A1S A;  3J7Z O;  4JI0 K;  1WOQ A;  1VAZ A;  3SAG A;  5AQZ A;  1BWF O;  4AHS A;  4DFM A;  2Y1J A;  2IDO A;  2E1Z A;  4O5F A;  4ZTF A;  2QEX N;  4CJF A;  5LMU K;  3TSU A;  4O8K A;  2CGJ A;  4GVM A;  4FWP A;  4CI6 A;  1EKE A;  3VF4 A;  4MQ3 A;  4FM2 A;  3CJB A;  3CCS N;  4DKW A;  1KXP A;  3OA9 A;  3NH0 A;  3IFR A;  5GIO A;  1BUP A;  3ATU A;  4WQ5 A;  1YIJ N;  4I6M A;  4M7X A;  4DR2 K;  2YI1 A;  3OYE A;  3UKU A;  4DS5 A;  2YV0 X;  4CZG A;  4B3O A;  5E84 A;  3O4Q A;  3I0S A;  4Z4G A;  1HMV A;  3DLL L;  3CD6 N;  2P9L B;  4H8K A;  5E26 A;  3RMB A;  4NB4 A;  4BDY A;  3SZ2 A;  2O8D B;  3VGM A;  1A5W A;  3HP9 A;  1Q7Y O;  1KRP A;  3HPH A;  2KLA A;  4FZZ A;  3AVB A;  3AVJ A;  1IJJ A;  1BOT O;  1HQE A;  3LPT A;  4AHC A;  3V1O A;  1IG8 A;  2GEM A;  4BQZ A;  4HUF A;  3JAM O;  3VEZ A;  3OW2 M;  3NMU A;  2NUB A;  4CK3 A;  2E5L K;  4BWJ A;  5AZI A;  2ZF5 O;  5EX5 A;  3ZSX A;  3ZYY X;  4DU4 A;  4CHQ A;  1UA0 A;  3R3L A;  3ZT4 A;  5TKY A;  2W6L A;  4H03 B;  1TKD A;  2UXC K;  1O13 A;  3JS6 A;  5GAG P;  4DF4 A;  4CCH A;  4RW7 A;  1U6Z A;  3QEI A;  3V9U A;  3GOI A;  4KBO A;  5I3U A;  5EVZ A;  3CM6 A;  4NYF A;  3VER A;  3KK2 A;  4N5S A;  1RBT A;  3DLE A;  4H0Y B;  4QS8 A;  3ULE A;  3G10 A;  4YNQ A;  4IZ9 A;  3AVF A;  5AQM A;  1S9E A;  4M41 A;  3IS9 A;  2YHW A;  3VQD A;  5BN8 A;  1IKW A;  5AQS A;  3ZET B;  3UIQ A;  3WEE A;  3NFA A;  4OPA A;  4KTQ A;  1HNI A;  4ELT A;  4N76 A;  4XH4 A;  4PHT X;  4BRI A;  5BR8 K;  4FLW A;  1KSP A;  4EAH D;  4EHU A;  4FWR A;  1QSY A;  5HP1 A;  3VET A;  4JK8 A;  1S1W A;  4ISG A;  4CGG A;  3OYH A;  2VYP A;  1U49 A;  4DSK A;  4IJN A;  4RW6 A;  3LWM A;  4F3O A;  4CER A;  1RNH A;  3LDN A;  4CGH A;  2D0B A;  1RT6 A;  1R59 O;  5BRF A;  3HVR A;  4K25 A;  4FWQ A;  4GMJ B;  4B1Z A;  2ZWH A;  2E2P A;  3ZSR A;  3L2R A;  4YOX A;  4LH4 A;  3CFP A;  4DUY K;  3ZSW A;  5GIP A;  4E0D A;  2FSN A;  3I33 A;  4KI4 A;  1Y64 A;  3SBT A;  3KLH A;  4DQ8 A;  1KVB A;  3A5M C;  5CYQ A;  3AA3 A;  5AQI A;  1HJO A;  5JVH L;  1VQP N;  4FXD A;  1OKJ A;  4EZ6 A;  1YT3 A;  1VSM A;  5JVG L;  4GKK K;  1HNZ K;  3ZT2 A;  3LDP A;  1S22 A;  1NGC A;  4QAG A;  4KAZ A;  4FJI A;  5MLC Q;  4X64 K;  1QS4 A;  3QET A;  2BGG A;  2KHO A;  3ISN C;  4CJK A;  3SMS A;  3THV A;  1HRH A;  1KFS A;  3L6Q A;  1EP4 A;  4KHY A;  2CH6 A;  1KAZ A;  5AJ3 K;  3M3Z A;  4OLA A;  1VQK N;  3MCA B;  3OS2 A;  2J4R A;  3O9R A;  2ATQ A;  1ATS A;  1EQY A;  3DRS A;  4KRE A;  3U9Z A;  3CCL N;  1EXQ A;  5SWM A;  4JKF A;  2KKZ A;  1C0G A;  2D1K A;  4JHD B;  3WXJ A;  3FZM A;  3WUH A;  3MDQ A;  3AGR A;  4ISE A;  3S3M A;  4FPA A;  4OKK A;  4H0P A;  2FC0 A;  3CCU N;  4AM7 A;  4JN4 A;  1Z26 A;  4NYN A;  3QBX A;  3SV3 A;  4CHY A;  2NLX A;  3BEX A;  1N34 K;  3BP8 A;  1W97 L;  3OYG A;  1JCF A;  5KPZ A;  1GLL O;  4CFA A;  1LWE A;  1NK8 A;  4B3T K;  1NGG A;  1U45 A;  3FGU A;  1VSL A;  3EY1 A;  4WF9 L;  3HM8 A;  4GNI A;  2E6L A;  1J9A A;  1YIT N;  4Z4F A;  1JLA A;  2E8A A;  3NDK A;  4JLH A;  4K41 A;  4OGE A;  3FZF A;  3JXU A;  1N33 K;  2O8F B;  3CFR A;  3CXC M;  2HHT A;  4FJ8 A;  3F5T A;  5CE3 A;  4DB3 A;  2PAV A;  4ZHR A;  3ZET A;  4IFE A;  4FM0 A;  4QCL A;  3HPG A;  3PV8 A;  1L3U A;  3NGI A;  1S1U A;  5LMN K;  2FSJ A;  3C94 A;  4DSE A;  1NK7 A;  1NK4 A;  3KVG A;  4CGJ A;  2GEL A;  1EWQ A;  4DR7 K;  4RWT A;  4BRQ A;  3TSQ A;  2DFF A;  2BAN A;  1Z6R A;  4LH5 A;  3T1H K;  3RWU A;  5H1S Q;  3F2K A;  4BRL A;  2E2N A;  1M1K O;  3M8S A;  1RBR A;  3VQ9 A;  3CQY A;  1LV5 A;  3M8Q A;  5HRS A;  3P39 A;  1FKP A;  3TR8 A;  5M1F A;  4B08 A;  4W5O A;  2YHY A;  3SMP A;  1RT7 A;  2P9U B;  3MXI A;  2FBY A;  1S72 N;  1LCU A;  1DKG D;  1XMO K;  1QQC A;  1NLV A;  1BIZ A;  3MWT A;  3QIN A;  4ILH A;  3EZ5 A;  2JWL A;  4FSV A;  1X3N A;  1BO5 O;  4KHP K;  3IDH A;  3ZSV A;  5CYM A;  3GBT A;  3U4L A;  3CG7 A;  3CER A;  4E7L A;  2W40 A;  4EIA A;  2EX3 A;  3O3H A;  5AQR A;  3GE1 A;  4AHU A;  3EN9 A;  4O4G A;  3L2U A;  1WAF A;  4ICL A;  2HHW A;  2YJE A;  2JGU A;  3QNO A;  1OH8 A;  3HRG A;  4JI2 K;  3I8B A;  2G8K A;  4YY3 K;  3VQ7 A;  1UAX A;  3IUC A;  2H3G X;  1RDD A;  4LSL A;  3CHW A;  1Z25 A;  2P9N B;  3O6W A;  2ZJR L;  4B9S A;  2KW4 A;  1MWM A;  3WQU A;  1KD1 O;  3FFI A;  4JHD A;  4JEP A;  1W2B M;  1QSS A;  4CZI A;  2XY7 A;  4NXN K;  3BGR A;  4JD2 A;  3C6A A;  4FJG A;  3PIP L;  4EP5 A;  4CEB A;  1SUQ A;  3LAN A;  4X62 K;  3CET A;  4OGC A;  4JV5 K;  3RRH A;  1GLB G;  2HNZ A;  4LF8 K;  2HHS A;  4OJR A;  5FPD A;  3VTI A;  1NNE A;  5BN9 A;  1EO1 A;  1GLD G;  1KVC A;  4M3X A;  2UUB K;  1J54 A;  3RVC A;  3H46 O;  1HYZ A;  1N32 K;  1J6Z A;  2IIR A;  4BRN A;  3TPQ A;  1VSE A;  3MX5 A;  4B1V A;  4F2R A; 
#chains in the Genus database with same CATH homology
 4DUY K;  4YHH K;  2UUA K;  4AQY K;  4DR2 K;  2F4V K;  4DR7 K;  4OX9 K;  3T1H K;  4CW7 B;  4K0K K;  4JI7 K;  4V19 S;  4DR1 K;  4GKK K;  1HNZ K;  4LF6 K;  3OTO K;  4LFC K;  4DV7 K;  4DV4 K;  4JI5 K;  4NXM K;  4X64 K;  3J7A P;  1N36 K;  4DR5 K;  1XMQ K;  4X66 K;  5IWA K;  4DV6 K;  3JAM O;  5AJ3 K;  1IBK K;  1XMO K;  1XNQ K;  2VQF K;  4JI1 K;  5A2Q O;  2E5L K;  4KHP K;  4DR4 K;  3J7Y P;  1HNW K;  2UXC K;  4B3M K;  5IT9 O;  4X65 K;  2UXB K;  2UU9 K;  4JYA K;  4B3R K;  1J5E K;  2UXD K;  1HR0 K;  3J80 O;  4DV2 K;  4JI2 K;  4YY3 K;  4JI4 K;  1N34 K;  4JI3 K;  4DUZ K;  1IBM K;  1XNR K;  4JI0 K;  3T1Y K;  4DV3 K;  5BR8 K;  2HHH K;  4B3T K;  4DV5 K;  2ZM6 K;  4JI6 K;  4NXN K;  4GKJ K;  1I94 K;  3J81 O;  4LF7 K;  4DR3 K;  4X62 K;  1IBL K;  4JV5 K;  5LMU K;  4B3S K;  5FLX O;  4LF8 K;  4LFA K;  2UUC K;  1N33 K;  1FJG K;  4LF9 K;  4LFB K;  4LF4 K;  4CVN E;  4DV0 K;  5LL6 Z;  2VQE K;  2UUB K;  4LF5 K;  1N32 K;  5LMN K;  4DV1 K;  4DR6 K;  1HNX K;  4JI8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...