4DV3K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv3K00
1I94K 4DV3K 4LF5K 1XNQK 4JI1K 2E5LK 2VQEK 4YHHK 4NXMK 4DR4K 4LFBK 5FLXO 1IBMK 5IT9O 3T1HK 4LF9K 4V19S 1XMOK 4LF6K 1IBKK 2F4VK 4DV7K 4DR3K 1XMQK 4DR7K 4JI6K 4B3MK 3JAMO 5LMUK 4OX9K 4DV4K 2UU9K 4GKKK 4JYAK 5LL6Z 4JI0K 4DV2K 4DV1K 4GKJK 1XNRK 4B3SK 2HHHK 4DR1K 2UUAK 1N34K 4X62K 1J5EK 4JI8K 5A2QO 4JI7K 4X64K 4DV0K 3J7AP 1N36K 5LMNK 4DV6K 4B3TK 4CVNE 4DR2K 4KHPK 4AQYK 4K0KK 4X66K 4LFAK 4LF4K 4JV5K 2UXDK 2UXCK 4DR5K 1HNWK 2ZM6K 4JI5K 4DUZK 2UXBK 1N33K 1HNXK 5BR8K 3J81O 4JI2K 2UUCK 4X65K 4NXNK 2UUBK 1FJGK 1N32K 3OTOK 5IWAK 3J80O 1IBLK 3J7YP 4JI3K 4LFCK 4YY3K 4CW7B 4B3RK 5AJ3K 1HR0K 4LF7K 4DUYK 4DV5K 1HNZK 3T1YK 4DR6K 4LF8K 2VQFK 4JI4K
chains in the Genus database with same CATH superfamily
3OYAA 1KC8O 4LF5K 1HJRA 3TAMA 2E4LA 3QERA 4PUOA 4BG9A 1U47A 1YTAA 3N4PA 1VHXA 2IGIA 1DEJA 4BRMA 3DYAA 4KHQA 4IZ9A 2E2QA 3T7ZA 4B1YB 1QSSA 1KXPA 1NK0A 4FWQA 2G8WA 1LOTB 5GIOA 3HPOA 3CCUN 1IBKK 4DV7K 5EU7A 4DTMA 1XMQK 5MLCQ 1JLBA 2XY6A 3TSUA 4DTRA 3OYNA 3TU5A 4RW4A 3TTCA 1TYQB 3CI5A 1XNRK 4MDBA 5CYQA 4CZKA 2G8UA 4AF1A 4NCAA 4EHUA 3HPHA 3LPTA 1KLMA 1J5OA 3G71N 3AVGA 3ATVA 1WB9A 4DU3A 3SMSA 1SL1A 1RNHA 4CGDA 4W5OA 2P9KB 5E84A 4FZXC 4BE0A 5ADXH 3OW2M 2A42A 2IDOA 1RFQA 2D0OA 4EP5A 4WE1A 1DLOA 3CJ1A 3QIOA 1OVYA 1VQ5N 3V1QA 4BC2A 4K0KK 3VQAA 2O4IA 4GVEA 4C8NA 5JS2A 4DR5K 2DFEA 3FZMA 3CF5L 3O4WA 3NMUA 3RSEA 4KH5A 1TAQA 1Q7YO 1EWQA 5AQGA 3U9DA 4QS8A 5CR4A 4DQPA 3M8PA 5C24A 3VOVA 3QNNA 3HT3A 4JI2K 4CJSA 3MCAB 4JD2A 3LPUA 3AA5X 4JKFA 4DTXA 3WXLA 1UOCA 1CZBA 2OPRA 1VQ6N 5BRFA 1NWKA 3D2FB 3KWGA 3O6WA 3VESA 3TAFA 4FWLA 3DXKA 4NO7A 4IEIA 3T1YK 3NH1A 3CC4N 2VG5A 4MFBA 2YHWA 4OKEA 2VGNA 4YOUA 4PHTX 3T1HK 4OPKA 3BUZB 3P39A 3CM6A 4BGBA 4CIGA 3BY5A 4FLYA 1KCFA 2J4RA 3NVKA 2P9LA 4LF6K 2FBYA 2F9WA 2YHXA 3MXJA 2V7ZA 3HTVA 4DR7K 5C0YA 3R9PA 2PZSA 2NNWA 2AJQA 4PKGA 1NOZA 4LD0A 2UU9K 3CPEA 1WSGA 3M1FA 3DOLA 1SAZA 4HUFA 4DR1K 3OYMA 4CZFA 4CJEA 3E9LA 1N34K 5I3UA 1IO2A 3SLCA 3ZSVA 4CZHA 3OJSA 3ZETA 4EZ9A 3MX2A 3HPGA 4ICLA 2HF4A 3QEPA 1BOTO 3R3LA 3A0IX 3IRXA 2ATQA 3EKUA 1S6PA 3KVGA 2HBMA 4CEFA 3ZX2A 4Z4CA 1BHLA 3TAQA 4PKHA 5FPDA 4W5QA 4FJGA 1T3VA 3Q7BA 3FFIA 4CGGA 2DFHA 3I33A 3UKUA 3ULEA 3H3OB 1DT9A 1WN7A 4Z4HA 4JI5K 3L4QA 1G99A 1N33K 4A5AA 2YKMA 1VQPN 1ZBLA 2E2OA 3VQDA 4ELVA 3OYEA 2OZMA 1TK0A 3I8DA 1YVNA 4FK0A 1YHQN 5AQHA 3J7ZO 3HXMA 5D3GA 3O3FA 1YUWA 4DG1A 4JKAA 3S3NA 2KLAA 4JI3K 4FPAA 4CHPA 1V4SA 4F8RA 5K14A 4B3RK 1NJYA 1NJXA 2BUPA 1DGKN 5KPTA 4PY5A 1W7AA 3ULDA 3KTQA 2O8FB 4DV3K 2E2PA 5TKYA 2YNHA 4DQQA 1FW6A 4FVMA 3CCSN 1YITN 3F5TA 4LFBK 4K25A 1Q8IA 1UAXA 3QESA 4H0PA 4O5FA 3OYIA 1EKEA 3EYZA 2V7YA 1V4TA 2I7PA 1N8RO 3G0ZA 4FWKA 4ZTFA 4M42A 3ID6A 3GDQA 1GLCG 4F3TA 2HBJA 3LM9A 3HP9A 2ASMA 5CE3A 3OYDA 5BPNA 4OKJA 2B4JA 4FLXA 2A5XA 4JLHA 4N41A 1VK0A 4E89A 4B3SK 4BDZA 4DF4A 4NLBA 4RW9A 3WUHA 3RMCA 4XH4A 4BRKA 4IWVA 3GOIA 1YJ9N 4CJKA 3AVNA 4ZHRA 2F7TA 4HTLA 5JVHL 5GADP 4B9SA 1D4XA 3WXKA 1C0TA 1BL3A 1ZXOA 2O8BA 2D0AA 1NG9A 3AGKA 1KAZA 3JS6A 4IXCA 4RW7A 2P5GA 5F0XA 4W5TA 4A57A 1BCMA 3NF7A 4QS9A 2HB5A 1CZAN 4DSFA 4WF9L 1WAJA 4CD1A 3AA2A 2VG6A 2IOCA 3AO1A 4Z4GA 3D7EO 3EE8A 1K8KA 3UKRA 2O8CA 3VEOA 2ASOA 2P9UA 3LDSA 1NGCA 4FJMA 4BC5A 5HRRA 4KHNA 4ISGA 4X65K 3EE9A 1CLQA 5AQPA 3H46O 4BDPA 3J80O 3DLGA 3MCPA 4B1ZA 1NGGA 3SAGA 4CW7B 4YORA 1IG8A 1BCOA 1FK9A 3OYFA 3F9KA 5LJWA 3NF9A 3O9UA 3RWUA 2QM1A 5J2QA 5AQZA 1H1VA 1TL3A 5FPMA 1NGBA 3EEQA 4FL9A 5EXWA 4IBNA 4C23A 4M7YA 5J2PA 3D2EA 4B1XB 4BRLA 4JEPA 4O8KA 4WQ4A 1VQON 1X9MA 4M3ZA 4B1WB 3DXKB 4DTNA 4JRQA 3OYGA 3L6QA 1TL1A 5HBMA 3QLHA 4CK3A 1WOQA 3C95A 3T69A 4KRFA 3OYBA 3P31A 3A5OC 4QOZB 1VSEA 4DTOA 1C1AA 4JK9A 3O1WA 1JLFA 3MEGA 2NRRA 3MN7A 2P9LB 1QHTA 5KQ8A 4AM6A 4CZLA 1G15A 1TUUA 3WT0A 1KQSM 2QWQA 3THWA 4WQ4C 3THVA 1Q81O 2O4GA 5BR9A 3QMLA 3DWLA 3SUNA 4FVUA 2YHBA 3MECA 3SAHA 4AH9A 1RT6A 4CJPA 1Q86O 5C2DA 2QKBA 2RF2A 3ZETB 1GOAA 1NKCA 4F3OA 2D5RA 1E3MA 5GAHP 3WXMB 3TSQA 1FXXA 4CESA 4HCCA 4OKKA 1Z26A 3V9UA 4H0TB 2FSJA 4FM0A 5M1KA 1YJNN 4ELUA 3RMAA 3OTOK 3PUFA 2H3GX 3VQ5A 4CJVA 3EZ5A 3K5MA 2OTLN 4XH1A 2WONA 4CEAA 1IKWA 4CCHA 1QQNA 4PWDA 1HNVA 1VSDA 2WUSA 1JLCA 1E4FT 4YOWA 4OJRA 1I39A 3CD6N 2FF6A 3ID8A 5FLXO 2FLOA 1IKXA 4FLVA 2Z1GA 2G8HA 1RT1A 3QB0A 3ZX0A 1R0AA 2HNYA 3L0QA 1LAVA 4FWPA 4CBWA 2Z1IA 1HYSA 1JLEA 2BE2A 3SUQA 4J2EA 3J8AA 4B9TA 2FBXA 3SV3A 4AHSA 1FKOA 1Z05A 2PYJA 2P5OA 3K9JA 2QXFA 2AP1A 1ZBFA 4DFKA 3DLKA 5HL7L 1NK9A 4IDHA 3IDHA 3AVAA 3G10A 4NYFA 3U8XA 3ZSWA 4Q5VA 3PO5A 2KHOA 1JJ2M 1NGIA 4GV9A 5FRNA 1GOCA 3LDQA 5EY4A 3OHRA 4CBXA 5E41A 1N36K 3G25A 2LSNA 4BG8A 4WQ5C 5LMNK 3FZKA 4CVNE 1NGAA 1S1XA 3WNHA 3WXJA 2O8DA 2Q31A 1JLQA 4DSEA 4BVPA 2OPPA 3TANA 4FXDA 2EHGA 5GAEP 5J2NA 4IO9L 2B5JA 2Q36A 4LSLA 4E7KA 5KPZA 5LJVA 4CFBA 4DSIA 4B8AB 1S22A 4MDAA 1TGOA 2YJEA 5M1QA 3PSFA 4NB4A 1SUQA 1JL2A 2GUPA 2KW4A 3ISNC 4CJ4A 2VYPA 4DSLA 1U2VA 2GELA 2IVOA 1TK8A 3MMVA 3ZSZA 4DMNA 3VQ8A 1U04A 4KPYA 2F8SA 4ZTJA 2P9SA 4M41A 2P9UB 4CERA 3QDKA 4O4GA 4TSXA 3HOTA 3CC7N 4JKGA 4FJKA 4IDKA 1TK5A 3AVIA 3MX5A 3SNNA 1KVBA 3E9PA 1ZBUA 4HHTA 3CG7A 2YHYA 3BDPA 1RGIA 1QVFM 4DQRA 4WYBA 3OYLA 4WFAL 4K8ZA 2NRWA 2QXLA 4KREA 2D0CA 4JI6K 3ZCMA 3U6FA 4GKKK 2VGMA 3FZHA 3SPYA 1OVQA 5BPMA 1BIUA 2YV0X 1CXUA 4JKCA 1KVAA 4B08A 2KKZA 4BR7A 5AFUA 5BRHA 4IOCL 4JHDA 2PYLA 4B8CA 4FWRA 4H5TA 1S5JA 1QE1A 3DAWA 4E7JA 3IAYA 4OLAA 4H4OA 3T1AA 3OA9A 5BPLA 3C94A 5AQOA 3D2EB 1VQMN 3GBTA 1HX1A 2QWMA 4CGHA 4CEDA 1HUXA 1LW0A 4B3OA 1NMDA 3C6AA 2ZGZA 3S9HA 2PFUA 1HMVA 3O1BA 4BRGA 3HL8A 3E66A 3ZSXA 4U67L 3CCVN 4OVLA 3CETA 3O9TA 2IAJA 1D9FA 3TWHA 1K9MO 3OS2A 2HOEA 1RT2A 3WXIA 4KBOA 4DHYA 4JS4A 3LP2A 2YX6A 3HBTA 5CHIA 3DI6A 1U45A 1F21A 4IEEA 4AILC 4Z0UA 3KLEA 4JRPA 1MU2A 1C0FA 1JXEA 4XH5A 3CCLN 4PA1A 3GL1A 2CGKA 1QHAA 3OYJA 1UA1A 2FSKA 3TARA 3THWB 2FC0A 3OS1A 1TKZA 1N32K 2QI2A 2HHWA 4EZ6A 2AA4A 4OPAA 4ILGB 3O8MA 4FPBA 3RRHA 1RBUA 4KTZA 1EX4A 3AO2A 4DKWA 2BDPA 1NLVA 1JL1A 3SZ2A 1B92A 2PY5A 4R5PA 2VWBA 2HVIA 5C12A 3B8AX 4XEIA 4E1NA 3ZT4A 4DQSA 3ZSRA 4O0IA 4CE9A 2ZF5O 2Y1IA 3ZYYX 2VQEK 2E88A 4EFHA 3HP6A 4Z94A 3KLFA 4ILHA 5CZ1A 4YOYA 3HK2A 3PX0A 4IOAL 3CJ9A 2FBTA 3ZT0A 1E4GT 3M3ZA 1XC3A 3MK6A 3AGRA 3O3HA 5M1OA 4RG8A 1NK7A 1ILYA 2IIRA 2DTUA 3LP0A 4DLGA 3F9MA 5LL6Z 3A5LC 3QIPA 4DV2K 1YIJN 2OPSA 1XHZA 2E2NA 3C7NB 2Y1JA 3RR8A 2UYTA 2QWPA 3SK3A 1WSFA 3G4SN 4KHYA 1J5EK 1S1UA 2HNZA 4QAGA 4FJHA 5A2QO 3H3NO 3CJ7A 3AA4A 3AVJA 3CHWA 1VRUA 3LP3A 1YXQA 2HSTA 3DXMA 3F73A 1LWEA 4KTWA 3QNOA 1JCGA 3V1OA 4WFNL 3VPZA 3LDOA 3VEZA 3PIOL 4H0YB 1X9SA 4YDUA 1T05A 3OYCA 3CFRA 2Z1HA 2UXCK 1C1CA 5KPRA 1HNWK 3LM2A 2D0BA 4O55A 4K8XA 2ZM6K 2A1SA 4BR0A 3U3YA 4KI4A 2F96A 3AAQA 1NKEA 3AO5A 1BA1A 4CZGA 3VGKA 3SPZA 4CJRA 2W40A 2UUCK 3P5JA 2BGGA 2GWKA 3CCJN 3R1XA 4CHQA 2GWJA 1IBLK 3RTVA 4R79A 5I9EB 1VSJA 4UQGA 3V9ZA 1NGFA 3M6GA 1HR0K 1S9GA 4J2AA 2W41A 3LWLA 3WQUA 2VQFK 4KHUA 3A2FA 3HRGA 4C8KA 1HPMA 3SYZA 3U4LA 3R6MA 4CBUA 1T8EA 1L3UA 1VSLA 1DTQA 4PL8A 5HOOA 4KB0A 1VQ4N 1NU0A 3E1YA 1XHXA 4IG0A 1EP4A 3OVNA 4AHRA 3DMJA 3KK1A 4DQIA 3VQPA 5AZJA 4CJ7A 4N56A 4F2RA 4M3WA 5DM7L 1ASVA 3DRPA 1X9JA 4LH5A 3ZSQA 3KZBA 4PQUA 3S3OA 4OX9K 4E7IA 3M8QA 3CJCA 4BQLA 3VQ7A 3AA3A 1RDAA 3K5OA 3VQ6A 4C8OA 4FK4A 3SJHA 4E3SA 2P9SB 3P38A 3EZWA 3VGMA 4GKJK 2YI1A 3WQTA 4HUGA 3THXA 4H0XB 4JKGB 3AVLA 2HHVA 1SKWA 4BE2A 4H5VA 3S3MA 5FRMA 3V1RA 2GTDA 1BO5O 2Z1JA 1VSFA 4C8LA 4CF2A 1IKYA 4MLEA 2NLXA 3KK3A 4I6MA 1RDUA 4CJWA 4FJ7A 3C6TA 4YNQA 4QS7A 4Y1DA 1N5YA 1KTQA 1L5UA 3TABA 2RN2A 3VGLA 4LFAK 1UA0A 1FKPA 1RTIA 3W0LA 3O3GA 4JHDB 4U7BA 1KAYA 2BH1A 2G8IA 2P1JA 1TAUA 2YKNA 4GV3A 3CYMA 4K41A 4AHTA 5HROA 3FZLA 4JKBA 1VQKN 4BR2A 4KFBA 5JICA 4C1NI 3OYKA 1TKXA 4M3TA 5FPNA 1T6DA 2D4WA 4DU1A 1W9HA 4IJAA 1Y97A 4E1JA 3RMDA 1XWLA 1SV5A 4CHZA 1NJWA 3L2WA 2FF3B 4Z4FA 3LAMA 3VF2A 1S1TA 1BISA 3FZFA 2WTUA 4JI1K 4DR4K 4CGJA 5IT9O 3TSPA 4LF9K 4A59A 5FPEA 3CCMN 4JAXA 1EWRA 5AQJA 2OA8A 5AQTA 4CJUA 2GBZA 4ID5A 1REVA 1M90O 3TPQA 3ZT1A 5F1XA 1HYZA 1T7PA 3L8BA 3FR0A 3LWMA 4OGCA 3RSEB 3IMXA 1BU6O 4HWIA 1WNSA 4L8RB 1WAFA 2Q0UA 4A2AA 1BDGA 4H0VB 1MDUB 4JD2B 1YT3A 2P9NA 3NH0A 3ZT3A 1DTTA 3L3VA 3AVCA 4DFPA 3NGIA 1P90A 1NGEA 3THYA 2IVNA 1GLJO 4FW2A 4DV0K 3J7AP 2HBKA 2W42A 4JKDA 3G6EN 2EWSA 5F2RA 3SI6A 4CIFA 4N47A 4DFMA 4FM1A 1KD1O 1HQEA 3O4QA 4O5BA 1SL0A 3SQ0A 4RCHA 1A5XA 3DRSA 4B9VA 2XRIA 4DWIA 1VSIA 1TV6A 1I3AA 2OANA 4ELTA 2YJFA 4FLWA 1T6CA 4FLTA 5AQIA 4DUZK 2ITGA 4KH6A 4BACA 4H8KA 5H1SQ 3H45C 3KK2A 1DKGD 3QFUA 3KD1E 4NXNK 3B6OA 3DXMB 4HVJA 1FJGK 3O9SA 1SKSA 3CQYA 3V9SA 3DOKA 3QINA 3VQBA 1Y64A 3SJJA 4BY9C 4LFCK 4CJFA 4H5RA 4KH4A 4CI6A 3KHYA 1NJIO 3RMBA 2Q2RA 1HJOA 3VN5A 4Y1CA 4LF8K 3QEXA 5DK5A 2CH6A 1I94K 2KQ2A 4BRCA 2WFBA 1IV0A 2HNDA 3N4QA 5GAGP 3KWIA 5GIPA 1L3TA 1RT7A 3EY1A 1XI1A 5KRSA 3VQ9A 3AO3A 3WEEA 5SWMA 3UKUB 1BA0A 3CM5A 3ITHA 4C1NK 2NRXA 4I7FA 3ULEB 2HHXA 2KFZA 3HSTB 5LMUK 3VF6A 1U49A 1JKHA 3WNGA 4J2DA 2KZZA 3KLIA 4B9NA 2GV9A 2HMPA 4BRHA 3E01A 1NK6A 4OO1J 4IKFA 3HM9A 4DTUA 4FJ8A 4UY8O 3QO9A 2HVHA 3LAKA 3QFPA 3V9WA 4CZIA 1RDCA 1X3NA 2E20A 3E9OA 4J8FA 2VWKA 3PV8A 2GX9A 1BQNA 3O5BA 1O13A 4DV6K 3PX4A 1OH5A 1K73O 1HKGA 2DY4A 1QQMA 4KB1A 5AQSA 4M3XA 2WBNA 1EQYA 1Z6RA 1MWKA 4I2QA 4BE1A 3C0BA 4FZZA 5I42A 3DLRA 2QWRA 4CIEA 2DFFA 1NBWA 1RT5A 1QTMA 5J2MA 2KZMA 4A5BA 4Y0WA 4I6MB 4FJ9A 4B9UA 5HRSA 4RW8A 5EX5A 3QEVA 1Q9XA 2QWNA 5HP1A 2YNIA 4M7XA 3AV9A 4BRQA 5C15A 3L4IA 3DLBA 4A62A 3CERA 4AHVA 4FJIA 3ENOA 4DV5K 2NZTA 2F9TA 3SMPA 4JI4K 3NGYA 1EO1A 3KLGA 3HVRA 3I56N 2W6LA 1C0MA 2YNGA 4F4KA 4YHHK 4J2BA 2YCHA 3C6UA 2O8BB 2XY5A 4LC9B 1B9FA 3SUOA 1ASWA 1RT4A 3T3FA 4CK2A 5HLFA 4H5WA 1NKBA 1R59O 1T03A 2G8FA 1WBDA 4IFYA 3PO4A 4DV4K 1TUYA 1K8KB 3UKRB 2O8CB 1VQLN 2NRTA 4E19A 3IS9A 2Q97A 2P9PA 4JI0K 3A8YA 3BGRA 3VEXA 3TTDA 4M3YA 4CGIA 1RILA 4CJ3A 3L2VA 4KI6A 1NM1A 1C1BA 4EP4A 4RWTA 1QVGM 4IJNA 3SCXA 4FJLA 4OPJA 4O0JA 5BN8A 4LSNA 1S1WA 4KHWA 1QSYA 3RR7A 1XQSC 4GV6A 3HO1A 1RBTA 1XUPO 1QS4A 1JCEA 3CMAN 2BTFA 4FCYA 5AFUH 3DLHA 1RBSA 4B3TK 5JS1A 3U9ZA 1N6QA 2HW3A 4G1QA 4H0OA 3PIPL 4H4MA 5AQWA 4PKIA 1D5AA 4AM7A 3V81A 3EL2A 5AR0A 4BVOA 3HM8A 1NGHA 3B6PA 1YJWN 4FLUA 2UXBK 3K58A 4JKEA 4CZEA 1BGXT 1K6YA 1HYVA 3MXMA 1OKJA 3AAPA 3ENHA 5KRTA 1ATRA 4NYNA 3KLHA 2DPNA 2ZJPL 5M1NA 3QEIA 4AHUA 1NGJA 3BP8A 1RTHA 4CF0A 1A5WA 3EO3A 5AQYA 4BRAA 3QEWA 2BANA 1YAGA 2O8EA 3CJAA 3IFRA 1S9EA 1VQ9N 4I9QA 1BI4A 3V9XA 5C2FA 4A61A 1L3VA 1QSLA 2XY8A 3I55N 5KQDA 4OGEA 2E1ZA 2HHUA 1HLUA 4KKOA 2NRVA 1LV5A 1JLGA 1IBMK 2X78A 4OLBA 1T44A 2RE2A 2D1KA 4JKHA 4CJLA 1NMNA 2F4VK 3SQ1A 4CJQA 4B3MK 1YF5L 4DB3A 2XO7A 1JXBA 3VEYA 2ZD1A 3MEDA 4DF8A 4RTFD 3PLAA 2I7NA 2VWJA 3K2PA 3W3DA 5ADXA 4G9ZA 4JN4A 3NH2A 4MO5A 4BQZA 1W0HA 1J6ZA 3HVTA 4MQ3A 4JI8K 1BWFO 4X64K 4E7LA 4O8UA 3WEEB 4CHYA 4WFBL 3JXUA 4H03B 4GW6A 2P9IA 1ASUA 1WSJA 4HUEA 3AO4A 2X74A 4CZJA 1RDWX 5HRNA 5FDLA 4WCEL 1KRPA 5AQMA 4F9OA 4M45A 2E8AA 3ASMA 4B9QA 1OH7A 1NOYA 4I9LA 4Q0BA 2YNFA 1QZ5A 4JV5K 4JS5A 3L2UA 2X6NA 4BROA 3QICA 1HQUA 2WC9A 1ITGA 1J54A 3AY9A 3K59A 2GEMA 3IUCA 5TKWA 2ZE2A 4CD3A 4B9LA 1NK5A 2HF3A 1C0GA 1HKBA 2OCEA 2IC3A 4FLZA 5BR8K 3ATUA 2A1RA 2JWLA 2ETJA 3KKSA 1WSHA 1IJJA 2RHKA 4DFJA 2ASPA 2UUBK 4FOEA 3QBXA 4K43A 3AVBA 1YTUA 1BQMA 3ZEUA 5SZTA 1OH6A 4YY3K 3JYTA 3LDLA 1HKCA 3FGUA 4GVMA 4IOXA 5AJ3K 1LW2A 2ITMA 1NNEA 1HNZK 1TKTA 4YOXA 1HRHA 3H08A 1RBVA 4JK7A 1XNQK 4BREA 4NXMK 5KGWA 4DCHA 1RCHA 4KTQA 4V19S 1Q9YA 1KSPA 2O8DB 4JNEA 1TVRA 1WLJA 3NCIA 1IH7A 2WOMA 3MAQA 3M8RA 1U6ZA 1ZBSA 4YDUC 3BZCA 5AQQA 1CXQA 4M3UA 3EKSA 2QWLA 4N5SA 1WSIA 4BRDA 4JYAK 4KAZA 3CCRN 4Z4IA 4CFAA 1GLDG 1GOBA 3O9RA 2HHHK 3WNEA 2OYQA 1GLLO 1S6QA 4RW6A 3MN5A 5AQRA 1O1WA 4JI7K 2EX3A 4E1MA 3UIQA 1JCFA 3KIOA 1ZBIA 3BEXA 1XC9A 4H5NA 4PL7A 1U2VB 4NCGA 3NVMA 3H1VX 1IKVA 2QW9A 4CK1A 5AQXA 4MO4A 2OZSA 1D9DA 1SL2A 2ZJRL 2A40A 2E6MA 2P9PB 1SKRA 3D6RA 5CY4A 3ZX3A 3K0SA 3QBWA 3TAEA 2G8VA 4LF4K 2UXDK 1UWBA 4M63C 4Z4EA 3Q7CA 3UB5A 2I5JA 3H1QA 3CCQN 1WUAA 4CECA 3BF3A 5BRDA 3J81O 1EETA 4BRPA 3TAGA 4CF9A 2V51B 4IO8A 2ZQBA 2GUIA 2PBDA 5JLFA 2JGUA 4KHSA 1EXQA 5IWAK 4FOIA 1YVUA 5AQUA 3MWTA 1SZ2A 3CCEN 4BWMA 2QA4N 4LF7K 5AQLA 3I8BA 4CHNA 3V6DA 5JVGL 1GLEG 3CJBA 2XY7A 4FWOA 4CEOA 3MDQA 3M5RA 2ZWHA 3I0SA 5E26A 3DLEA 3CMEN 5JMVA 3LANA 4LH4A 3LDPA 1ZYQA 3ENBA 4ISFA 1D8YA 1GLFO 2O8EB 4BRFA 3NE6A 3AVHA 3M8SA 1BI4B 4DR3K 5DM6L 3CC2N 1KVCA 4IFEA 1L3SA 4DTJA 1KAXA 1CZ9A 3ZSOA 1U48A 3O08A 3OY9A 4B1VA 4DSKA 1QQCA 5HRPA 4ID1A 4JK8A 2P51A 1Z25A 2NUBA 4HTUA 4FWSA 2IS3A 5AZIA 4X62K 1X9WA 4CHOA 3NBPA 3VQEA 2IVPA 2RPIA 3K5LA 4AHCA 5AQVA 3RRGA 3VEWA 3LZIA 4FK2A 5EOYA 3ZLJA 4I2PA 3UE5A 3A5NC 3VTHA 2HHSA 4BRNA 3P4IA 4BC3A 5CZ2A 4FW1A 3NAEA 3SUPA 3CIPA 4DSJA 5T7BA 4YOVA 4CEZA 1HNIA 4FWNA 5AQKA 1Q82O 2XHBA 4KO0A 2QWOA 2HHTA 3VA0A 4C8MA 3S41A 4BRIA 1SS6A 1P8ZA 1BIZA 2Q1NA 1LAWA 3K57A 3VEVA 3T19A 2CGLA 3VQ4A 2CH5A 4EAHD 1C0UA 3LL3A 3K5NA 2P9IB 3VF4A 2OTJN 3VETA 4GY2B 4BDYA 3JSMA 4W5RA 5LY3A 4BR5A 1LWFA 1GLBG 3J7YP 4GNIA 3C65A 4CF8A 5BREA 1W97L 4NLCA 2KTQA 5B8HA 2A3ZA 3HI0A 1ESVA 3AARA 4FSVA 1S72N 1TYQA 1C6VA 3AVFA 2E5LK 1VSMA 3OS0A 3TI0A 1Q18A 3KK7A 3TTFA 1NK8A 3GE1A 3NGZA 3SBTA 3TAPA 4DS4A 4F2SA 1QZ6A 3CXCM 2FBVA 2HMIA 4FYDA 2A41A 3V4IA 4CFCA 3ZEUB 1QQOA 4YOTA 2ZGYA 4FM2A 3LP1A 4DTSA 2A6AA 3ALYA 1GLAG 2P9KA 3AVMA 1KLNA 1LCUA 4FJJA 3KJVA 1RBRA 3FE1A 3CPWM 4OPHA 5C42A 4FO0A 4EHTA 2JLEA 3SV4A 2KFNA 1MA9B 4DS5A 3HYFA 2VG7A 4BWJA 4N76A 3O4NA 3MN9A 5C10A 3EN9A 3PX6A 5KGXA 3CQXA 1VQ7N 2HBLA 3SBGA 2OPQA 3QETA 1HPZA 5CYMA 3WNFA 4CJTA 2X6SA 3PSIA 5C25A 2E6LA 3A5MC 3FFKB 1IG9A 1VSHA 3C6HA 4BGAA 4BR4A 3OYHA 3CQ8A 4W5NA 3MWPA 4X66K 4FJ5A 3D2FA 4DU4A 2R7YA 1YI2N 3KD5E 5FROA 1JLAA 1ZBHA 4O44A 3FLCO 4ILJA 5AZJB 3VERA 1U4BA 4B1UB 3IKMA 4K42A 3C7NA 2FSNA 5BN9A 4DQ8A 1WBBA 4L3QA 4CJ5A 4IG3A 1RTDA 4A2BA 2ZJQL 4QCLA 3SQ2A 3THXB 1RDDA 3D0PA 1S1VA 3OJUA 3H6EA 4WQ5A 1OH8A 5KI6A 1KFSA 2F8TA 2NRHA 2Q0RA 3MXIA 3MEEA 4DUYK 4FJNA 2JWKA 2QEXN 3VQQA 3ZSYA 1NJZA 3MN6A 1J53A 3IG1A 3O9QA 3DJCA 3HSCA 3K9KA 2YHAA 4CZMA 2HHQA 4BR9A 3PY8A 4GMJB 2PAVA 1XMOK 3OBWA 2CGJA 4XIUA 3U3GA 1MWMA 4M3RA 2G8KA 2VCPA 5AQFA 5JLHA 4CGFA 3NHGA 1RDBA 2RKIA 3L3UA 1ATNA 2NRZA 2D0PA 2QK9A 1J9AA 3JAMO 1VSKA 1VRTA 1WSEA 3BZKA 1LWCA 2W6KA 4E0DA 1ATSA 4DV1K 3DRRA 1KFDA 3DLLL 4CEBA 3HJFA 3VTIA 4BC4A 3P83D 4FWMA 3NF8A 5DMRA 2UUAK 1X3MA 1BUPA 3CFPA 3TR8A 1VAZA 1S3XA 4YFUA 1NK4A 4DLEA 4EIAA 3NDKA 3CFOA 2FXUA 3L2RA 3SQ4A 3VQCA 3VMFB 3LALA 1BG3A 4CEQA 3OBYA 5M1PA 1VQNN 3NFAA 4DR2K 3HZ6A 4KHPK 5J1EA 4AQYK 4IFVA 4CF1A 1VQ8N 3I0RA 3NF6A 4FZYA 2B6AA 1SQKA 3HOSA 4ISEA 3GG4A 2E1YA 1B9DA 3P1GA 2Q3SA 3SAFA 4CEEA 5AZIB 4E7HA 3ZT2A 2O8FA 1HNXK 1K8AO 3R8EA 3BF1A 5KTQA 3LZJA 4CFDA 1RTJA 4B9MA 1A5VA 5AQNA 3VA3A 2QKKA 3LDNA 3RVCA 5EVZA 1TKDA 3L2QA 3DM2A 5GINA 4HCBA 3VENA 1RT3A 1ZC6A 4KV8A 1NGDA 5ELZA 2P9NB 3KKRA 5M1FA 3AVKA 1M1KO 1X1PA 3D45A 4FJXA 1W2BM 4NCBA 2QTDA 3O80A 4MLHA 4LY7A 4DTPA 3THYB 4DR6K 2V52B 3F2KA
chains in the Genus database with same CATH topology
1I94K 4DV3K 4LF5K 1XNQK 4JI1K 2E5LK 2VQEK 4YHHK 4NXMK 4DR4K 4LFBK 5FLXO 1IBMK 5IT9O 3T1HK 4LF9K 4V19S 1XMOK 4LF6K 1IBKK 2F4VK 4DV7K 4DR3K 1XMQK 4DR7K 4JI6K 4B3MK 3JAMO 5LMUK 4OX9K 4DV4K 2UU9K 4GKKK 4JYAK 5LL6Z 4JI0K 4DV2K 4DV1K 4GKJK 1XNRK 4B3SK 2HHHK 4DR1K 2UUAK 1N34K 4X62K 1J5EK 4JI8K 5A2QO 4JI7K 4X64K 4DV0K 3J7AP 1N36K 5LMNK 4DV6K 4B3TK 4CVNE 4DR2K 4KHPK 4AQYK 4K0KK 4X66K 4LFAK 4LF4K 4JV5K 2UXDK 2UXCK 4DR5K 1HNWK 2ZM6K 4JI5K 4DUZK 2UXBK 1N33K 1HNXK 5BR8K 3J81O 4JI2K 2UUCK 4X65K 4NXNK 2UUBK 1FJGK 1N32K 3OTOK 5IWAK 3J80O 1IBLK 3J7YP 4JI3K 4LFCK 4YY3K 4CW7B 4B3RK 5AJ3K 1HR0K 4LF7K 4DUYK 4DV5K 1HNZK 3T1YK 4DR6K 4LF8K 2VQFK 4JI4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 K;  4DV3 K;  4LF5 K;  1XNQ K;  4JI1 K;  2E5L K;  2VQE K;  4YHH K;  4NXM K;  4DR4 K;  4LFB K;  5FLX O;  1IBM K;  5IT9 O;  3T1H K;  4LF9 K;  4V19 S;  1XMO K;  4LF6 K;  1IBK K;  2F4V K;  4DV7 K;  4DR3 K;  1XMQ K;  4DR7 K;  4JI6 K;  4B3M K;  3JAM O;  5LMU K;  4OX9 K;  4DV4 K;  2UU9 K;  4GKK K;  4JYA K;  5LL6 Z;  4JI0 K;  4DV2 K;  4DV1 K;  4GKJ K;  1XNR K;  4B3S K;  2HHH K;  4DR1 K;  2UUA K;  1N34 K;  4X62 K;  1J5E K;  4JI8 K;  5A2Q O;  4JI7 K;  4X64 K;  4DV0 K;  3J7A P;  1N36 K;  5LMN K;  4DV6 K;  4B3T K;  4CVN E;  4DR2 K;  4KHP K;  4AQY K;  4K0K K;  4X66 K;  4LFA K;  4LF4 K;  4JV5 K;  2UXD K;  2UXC K;  4DR5 K;  1HNW K;  2ZM6 K;  4JI5 K;  4DUZ K;  2UXB K;  1N33 K;  1HNX K;  5BR8 K;  3J81 O;  4JI2 K;  2UUC K;  4X65 K;  4NXN K;  2UUB K;  1FJG K;  1N32 K;  3OTO K;  5IWA K;  3J80 O;  1IBL K;  3J7Y P;  4JI3 K;  4LFC K;  4YY3 K;  4CW7 B;  4B3R K;  5AJ3 K;  1HR0 K;  4LF7 K;  4DUY K;  4DV5 K;  1HNZ K;  3T1Y K;  4DR6 K;  4LF8 K;  2VQF K;  4JI4 K; 
#chains in the Genus database with same CATH topology
 3OYA A;  1KC8 O;  4LF5 K;  1HJR A;  3TAM A;  2E4L A;  3QER A;  4PUO A;  4BG9 A;  1U47 A;  1YTA A;  3N4P A;  1VHX A;  2IGI A;  1DEJ A;  4BRM A;  3DYA A;  4KHQ A;  4IZ9 A;  2E2Q A;  3T7Z A;  4B1Y B;  1QSS A;  1KXP A;  1NK0 A;  4FWQ A;  2G8W A;  1LOT B;  5GIO A;  3HPO A;  3CCU N;  1IBK K;  4DV7 K;  5EU7 A;  4DTM A;  1XMQ K;  5MLC Q;  1JLB A;  2XY6 A;  3TSU A;  4DTR A;  3OYN A;  3TU5 A;  4RW4 A;  3TTC A;  1TYQ B;  3CI5 A;  1XNR K;  4MDB A;  5CYQ A;  4CZK A;  2G8U A;  4AF1 A;  4NCA A;  4EHU A;  3HPH A;  3LPT A;  1KLM A;  1J5O A;  3G71 N;  3AVG A;  3ATV A;  1WB9 A;  4DU3 A;  3SMS A;  1SL1 A;  1RNH A;  4CGD A;  4W5O A;  2P9K B;  5E84 A;  4FZX C;  4BE0 A;  5ADX H;  3OW2 M;  2A42 A;  2IDO A;  1RFQ A;  2D0O A;  4EP5 A;  4WE1 A;  1DLO A;  3CJ1 A;  3QIO A;  1OVY A;  1VQ5 N;  3V1Q A;  4BC2 A;  4K0K K;  3VQA A;  2O4I A;  4GVE A;  4C8N A;  5JS2 A;  4DR5 K;  2DFE A;  3FZM A;  3CF5 L;  3O4W A;  3NMU A;  3RSE A;  4KH5 A;  1TAQ A;  1Q7Y O;  1EWQ A;  5AQG A;  3U9D A;  4QS8 A;  5CR4 A;  4DQP A;  3M8P A;  5C24 A;  3VOV A;  3QNN A;  3HT3 A;  4JI2 K;  4CJS A;  3MCA B;  4JD2 A;  3LPU A;  3AA5 X;  4JKF A;  4DTX A;  3WXL A;  1UOC A;  1CZB A;  2OPR A;  1VQ6 N;  5BRF A;  1NWK A;  3D2F B;  3KWG A;  3O6W A;  3VES A;  3TAF A;  4FWL A;  3DXK A;  4NO7 A;  4IEI A;  3T1Y K;  3NH1 A;  3CC4 N;  2VG5 A;  4MFB A;  2YHW A;  4OKE A;  2VGN A;  4YOU A;  4PHT X;  3T1H K;  4OPK A;  3BUZ B;  3P39 A;  3CM6 A;  4BGB A;  4CIG A;  3BY5 A;  4FLY A;  1KCF A;  2J4R A;  3NVK A;  2P9L A;  4LF6 K;  2FBY A;  2F9W A;  2YHX A;  3MXJ A;  2V7Z A;  3HTV A;  4DR7 K;  5C0Y A;  3R9P A;  2PZS A;  2NNW A;  2AJQ A;  4PKG A;  1NOZ A;  4LD0 A;  2UU9 K;  3CPE A;  1WSG A;  3M1F A;  3DOL A;  1SAZ A;  4HUF A;  4DR1 K;  3OYM A;  4CZF A;  4CJE A;  3E9L A;  1N34 K;  5I3U A;  1IO2 A;  3SLC A;  3ZSV A;  4CZH A;  3OJS A;  3ZET A;  4EZ9 A;  3MX2 A;  3HPG A;  4ICL A;  2HF4 A;  3QEP A;  1BOT O;  3R3L A;  3A0I X;  3IRX A;  2ATQ A;  3EKU A;  1S6P A;  3KVG A;  2HBM A;  4CEF A;  3ZX2 A;  4Z4C A;  1BHL A;  3TAQ A;  4PKH A;  5FPD A;  4W5Q A;  4FJG A;  1T3V A;  3Q7B A;  3FFI A;  4CGG A;  2DFH A;  3I33 A;  3UKU A;  3ULE A;  3H3O B;  1DT9 A;  1WN7 A;  4Z4H A;  4JI5 K;  3L4Q A;  1G99 A;  1N33 K;  4A5A A;  2YKM A;  1VQP N;  1ZBL A;  2E2O A;  3VQD A;  4ELV A;  3OYE A;  2OZM A;  1TK0 A;  3I8D A;  1YVN A;  4FK0 A;  1YHQ N;  5AQH A;  3J7Z O;  3HXM A;  5D3G A;  3O3F A;  1YUW A;  4DG1 A;  4JKA A;  3S3N A;  2KLA A;  4JI3 K;  4FPA A;  4CHP A;  1V4S A;  4F8R A;  5K14 A;  4B3R K;  1NJY A;  1NJX A;  2BUP A;  1DGK N;  5KPT A;  4PY5 A;  1W7A A;  3ULD A;  3KTQ A;  2O8F B;  4DV3 K;  2E2P A;  5TKY A;  2YNH A;  4DQQ A;  1FW6 A;  4FVM A;  3CCS N;  1YIT N;  3F5T A;  4LFB K;  4K25 A;  1Q8I A;  1UAX A;  3QES A;  4H0P A;  4O5F A;  3OYI A;  1EKE A;  3EYZ A;  2V7Y A;  1V4T A;  2I7P A;  1N8R O;  3G0Z A;  4FWK A;  4ZTF A;  4M42 A;  3ID6 A;  3GDQ A;  1GLC G;  4F3T A;  2HBJ A;  3LM9 A;  3HP9 A;  2ASM A;  5CE3 A;  3OYD A;  5BPN A;  4OKJ A;  2B4J A;  4FLX A;  2A5X A;  4JLH A;  4N41 A;  1VK0 A;  4E89 A;  4B3S K;  4BDZ A;  4DF4 A;  4NLB A;  4RW9 A;  3WUH A;  3RMC A;  4XH4 A;  4BRK A;  4IWV A;  3GOI A;  1YJ9 N;  4CJK A;  3AVN A;  4ZHR A;  2F7T A;  4HTL A;  5JVH L;  5GAD P;  4B9S A;  1D4X A;  3WXK A;  1C0T A;  1BL3 A;  1ZXO A;  2O8B A;  2D0A A;  1NG9 A;  3AGK A;  1KAZ A;  3JS6 A;  4IXC A;  4RW7 A;  2P5G A;  5F0X A;  4W5T A;  4A57 A;  1BCM A;  3NF7 A;  4QS9 A;  2HB5 A;  1CZA N;  4DSF A;  4WF9 L;  1WAJ A;  4CD1 A;  3AA2 A;  2VG6 A;  2IOC A;  3AO1 A;  4Z4G A;  3D7E O;  3EE8 A;  1K8K A;  3UKR A;  2O8C A;  3VEO A;  2ASO A;  2P9U A;  3LDS A;  1NGC A;  4FJM A;  4BC5 A;  5HRR A;  4KHN A;  4ISG A;  4X65 K;  3EE9 A;  1CLQ A;  5AQP A;  3H46 O;  4BDP A;  3J80 O;  3DLG A;  3MCP A;  4B1Z A;  1NGG A;  3SAG A;  4CW7 B;  4YOR A;  1IG8 A;  1BCO A;  1FK9 A;  3OYF A;  3F9K A;  5LJW A;  3NF9 A;  3O9U A;  3RWU A;  2QM1 A;  5J2Q A;  5AQZ A;  1H1V A;  1TL3 A;  5FPM A;  1NGB A;  3EEQ A;  4FL9 A;  5EXW A;  4IBN A;  4C23 A;  4M7Y A;  5J2P A;  3D2E A;  4B1X B;  4BRL A;  4JEP A;  4O8K A;  4WQ4 A;  1VQO N;  1X9M A;  4M3Z A;  4B1W B;  3DXK B;  4DTN A;  4JRQ A;  3OYG A;  3L6Q A;  1TL1 A;  5HBM A;  3QLH A;  4CK3 A;  1WOQ A;  3C95 A;  3T69 A;  4KRF A;  3OYB A;  3P31 A;  3A5O C;  4QOZ B;  1VSE A;  4DTO A;  1C1A A;  4JK9 A;  3O1W A;  1JLF A;  3MEG A;  2NRR A;  3MN7 A;  2P9L B;  1QHT A;  5KQ8 A;  4AM6 A;  4CZL A;  1G15 A;  1TUU A;  3WT0 A;  1KQS M;  2QWQ A;  3THW A;  4WQ4 C;  3THV A;  1Q81 O;  2O4G A;  5BR9 A;  3QML A;  3DWL A;  3SUN A;  4FVU A;  2YHB A;  3MEC A;  3SAH A;  4AH9 A;  1RT6 A;  4CJP A;  1Q86 O;  5C2D A;  2QKB A;  2RF2 A;  3ZET B;  1GOA A;  1NKC A;  4F3O A;  2D5R A;  1E3M A;  5GAH P;  3WXM B;  3TSQ A;  1FXX A;  4CES A;  4HCC A;  4OKK A;  1Z26 A;  3V9U A;  4H0T B;  2FSJ A;  4FM0 A;  5M1K A;  1YJN N;  4ELU A;  3RMA A;  3OTO K;  3PUF A;  2H3G X;  3VQ5 A;  4CJV A;  3EZ5 A;  3K5M A;  2OTL N;  4XH1 A;  2WON A;  4CEA A;  1IKW A;  4CCH A;  1QQN A;  4PWD A;  1HNV A;  1VSD A;  2WUS A;  1JLC A;  1E4F T;  4YOW A;  4OJR A;  1I39 A;  3CD6 N;  2FF6 A;  3ID8 A;  5FLX O;  2FLO A;  1IKX A;  4FLV A;  2Z1G A;  2G8H A;  1RT1 A;  3QB0 A;  3ZX0 A;  1R0A A;  2HNY A;  3L0Q A;  1LAV A;  4FWP A;  4CBW A;  2Z1I A;  1HYS A;  1JLE A;  2BE2 A;  3SUQ A;  4J2E A;  3J8A A;  4B9T A;  2FBX A;  3SV3 A;  4AHS A;  1FKO A;  1Z05 A;  2PYJ A;  2P5O A;  3K9J A;  2QXF A;  2AP1 A;  1ZBF A;  4DFK A;  3DLK A;  5HL7 L;  1NK9 A;  4IDH A;  3IDH A;  3AVA A;  3G10 A;  4NYF A;  3U8X A;  3ZSW A;  4Q5V A;  3PO5 A;  2KHO A;  1JJ2 M;  1NGI A;  4GV9 A;  5FRN A;  1GOC A;  3LDQ A;  5EY4 A;  3OHR A;  4CBX A;  5E41 A;  1N36 K;  3G25 A;  2LSN A;  4BG8 A;  4WQ5 C;  5LMN K;  3FZK A;  4CVN E;  1NGA A;  1S1X A;  3WNH A;  3WXJ A;  2O8D A;  2Q31 A;  1JLQ A;  4DSE A;  4BVP A;  2OPP A;  3TAN A;  4FXD A;  2EHG A;  5GAE P;  5J2N A;  4IO9 L;  2B5J A;  2Q36 A;  4LSL A;  4E7K A;  5KPZ A;  5LJV A;  4CFB A;  4DSI A;  4B8A B;  1S22 A;  4MDA A;  1TGO A;  2YJE A;  5M1Q A;  3PSF A;  4NB4 A;  1SUQ A;  1JL2 A;  2GUP A;  2KW4 A;  3ISN C;  4CJ4 A;  2VYP A;  4DSL A;  1U2V A;  2GEL A;  2IVO A;  1TK8 A;  3MMV A;  3ZSZ A;  4DMN A;  3VQ8 A;  1U04 A;  4KPY A;  2F8S A;  4ZTJ A;  2P9S A;  4M41 A;  2P9U B;  4CER A;  3QDK A;  4O4G A;  4TSX A;  3HOT A;  3CC7 N;  4JKG A;  4FJK A;  4IDK A;  1TK5 A;  3AVI A;  3MX5 A;  3SNN A;  1KVB A;  3E9P A;  1ZBU A;  4HHT A;  3CG7 A;  2YHY A;  3BDP A;  1RGI A;  1QVF M;  4DQR A;  4WYB A;  3OYL A;  4WFA L;  4K8Z A;  2NRW A;  2QXL A;  4KRE A;  2D0C A;  4JI6 K;  3ZCM A;  3U6F A;  4GKK K;  2VGM A;  3FZH A;  3SPY A;  1OVQ A;  5BPM A;  1BIU A;  2YV0 X;  1CXU A;  4JKC A;  1KVA A;  4B08 A;  2KKZ A;  4BR7 A;  5AFU A;  5BRH A;  4IOC L;  4JHD A;  2PYL A;  4B8C A;  4FWR A;  4H5T A;  1S5J A;  1QE1 A;  3DAW A;  4E7J A;  3IAY A;  4OLA A;  4H4O A;  3T1A A;  3OA9 A;  5BPL A;  3C94 A;  5AQO A;  3D2E B;  1VQM N;  3GBT A;  1HX1 A;  2QWM A;  4CGH A;  4CED A;  1HUX A;  1LW0 A;  4B3O A;  1NMD A;  3C6A A;  2ZGZ A;  3S9H A;  2PFU A;  1HMV A;  3O1B A;  4BRG A;  3HL8 A;  3E66 A;  3ZSX A;  4U67 L;  3CCV N;  4OVL A;  3CET A;  3O9T A;  2IAJ A;  1D9F A;  3TWH A;  1K9M O;  3OS2 A;  2HOE A;  1RT2 A;  3WXI A;  4KBO A;  4DHY A;  4JS4 A;  3LP2 A;  2YX6 A;  3HBT A;  5CHI A;  3DI6 A;  1U45 A;  1F21 A;  4IEE A;  4AIL C;  4Z0U A;  3KLE A;  4JRP A;  1MU2 A;  1C0F A;  1JXE A;  4XH5 A;  3CCL N;  4PA1 A;  3GL1 A;  2CGK A;  1QHA A;  3OYJ A;  1UA1 A;  2FSK A;  3TAR A;  3THW B;  2FC0 A;  3OS1 A;  1TKZ A;  1N32 K;  2QI2 A;  2HHW A;  4EZ6 A;  2AA4 A;  4OPA A;  4ILG B;  3O8M A;  4FPB A;  3RRH A;  1RBU A;  4KTZ A;  1EX4 A;  3AO2 A;  4DKW A;  2BDP A;  1NLV A;  1JL1 A;  3SZ2 A;  1B92 A;  2PY5 A;  4R5P A;  2VWB A;  2HVI A;  5C12 A;  3B8A X;  4XEI A;  4E1N A;  3ZT4 A;  4DQS A;  3ZSR A;  4O0I A;  4CE9 A;  2ZF5 O;  2Y1I A;  3ZYY X;  2VQE K;  2E88 A;  4EFH A;  3HP6 A;  4Z94 A;  3KLF A;  4ILH A;  5CZ1 A;  4YOY A;  3HK2 A;  3PX0 A;  4IOA L;  3CJ9 A;  2FBT A;  3ZT0 A;  1E4G T;  3M3Z A;  1XC3 A;  3MK6 A;  3AGR A;  3O3H A;  5M1O A;  4RG8 A;  1NK7 A;  1ILY A;  2IIR A;  2DTU A;  3LP0 A;  4DLG A;  3F9M A;  5LL6 Z;  3A5L C;  3QIP A;  4DV2 K;  1YIJ N;  2OPS A;  1XHZ A;  2E2N A;  3C7N B;  2Y1J A;  3RR8 A;  2UYT A;  2QWP A;  3SK3 A;  1WSF A;  3G4S N;  4KHY A;  1J5E K;  1S1U A;  2HNZ A;  4QAG A;  4FJH A;  5A2Q O;  3H3N O;  3CJ7 A;  3AA4 A;  3AVJ A;  3CHW A;  1VRU A;  3LP3 A;  1YXQ A;  2HST A;  3DXM A;  3F73 A;  1LWE A;  4KTW A;  3QNO A;  1JCG A;  3V1O A;  4WFN L;  3VPZ A;  3LDO A;  3VEZ A;  3PIO L;  4H0Y B;  1X9S A;  4YDU A;  1T05 A;  3OYC A;  3CFR A;  2Z1H A;  2UXC K;  1C1C A;  5KPR A;  1HNW K;  3LM2 A;  2D0B A;  4O55 A;  4K8X A;  2ZM6 K;  2A1S A;  4BR0 A;  3U3Y A;  4KI4 A;  2F96 A;  3AAQ A;  1NKE A;  3AO5 A;  1BA1 A;  4CZG A;  3VGK A;  3SPZ A;  4CJR A;  2W40 A;  2UUC K;  3P5J A;  2BGG A;  2GWK A;  3CCJ N;  3R1X A;  4CHQ A;  2GWJ A;  1IBL K;  3RTV A;  4R79 A;  5I9E B;  1VSJ A;  4UQG A;  3V9Z A;  1NGF A;  3M6G A;  1HR0 K;  1S9G A;  4J2A A;  2W41 A;  3LWL A;  3WQU A;  2VQF K;  4KHU A;  3A2F A;  3HRG A;  4C8K A;  1HPM A;  3SYZ A;  3U4L A;  3R6M A;  4CBU A;  1T8E A;  1L3U A;  1VSL A;  1DTQ A;  4PL8 A;  5HOO A;  4KB0 A;  1VQ4 N;  1NU0 A;  3E1Y A;  1XHX A;  4IG0 A;  1EP4 A;  3OVN A;  4AHR A;  3DMJ A;  3KK1 A;  4DQI A;  3VQP A;  5AZJ A;  4CJ7 A;  4N56 A;  4F2R A;  4M3W A;  5DM7 L;  1ASV A;  3DRP A;  1X9J A;  4LH5 A;  3ZSQ A;  3KZB A;  4PQU A;  3S3O A;  4OX9 K;  4E7I A;  3M8Q A;  3CJC A;  4BQL A;  3VQ7 A;  3AA3 A;  1RDA A;  3K5O A;  3VQ6 A;  4C8O A;  4FK4 A;  3SJH A;  4E3S A;  2P9S B;  3P38 A;  3EZW A;  3VGM A;  4GKJ K;  2YI1 A;  3WQT A;  4HUG A;  3THX A;  4H0X B;  4JKG B;  3AVL A;  2HHV A;  1SKW A;  4BE2 A;  4H5V A;  3S3M A;  5FRM A;  3V1R A;  2GTD A;  1BO5 O;  2Z1J A;  1VSF A;  4C8L A;  4CF2 A;  1IKY A;  4MLE A;  2NLX A;  3KK3 A;  4I6M A;  1RDU A;  4CJW A;  4FJ7 A;  3C6T A;  4YNQ A;  4QS7 A;  4Y1D A;  1N5Y A;  1KTQ A;  1L5U A;  3TAB A;  2RN2 A;  3VGL A;  4LFA K;  1UA0 A;  1FKP A;  1RTI A;  3W0L A;  3O3G A;  4JHD B;  4U7B A;  1KAY A;  2BH1 A;  2G8I A;  2P1J A;  1TAU A;  2YKN A;  4GV3 A;  3CYM A;  4K41 A;  4AHT A;  5HRO A;  3FZL A;  4JKB A;  1VQK N;  4BR2 A;  4KFB A;  5JIC A;  4C1N I;  3OYK A;  1TKX A;  4M3T A;  5FPN A;  1T6D A;  2D4W A;  4DU1 A;  1W9H A;  4IJA A;  1Y97 A;  4E1J A;  3RMD A;  1XWL A;  1SV5 A;  4CHZ A;  1NJW A;  3L2W A;  2FF3 B;  4Z4F A;  3LAM A;  3VF2 A;  1S1T A;  1BIS A;  3FZF A;  2WTU A;  4JI1 K;  4DR4 K;  4CGJ A;  5IT9 O;  3TSP A;  4LF9 K;  4A59 A;  5FPE A;  3CCM N;  4JAX A;  1EWR A;  5AQJ A;  2OA8 A;  5AQT A;  4CJU A;  2GBZ A;  4ID5 A;  1REV A;  1M90 O;  3TPQ A;  3ZT1 A;  5F1X A;  1HYZ A;  1T7P A;  3L8B A;  3FR0 A;  3LWM A;  4OGC A;  3RSE B;  3IMX A;  1BU6 O;  4HWI A;  1WNS A;  4L8R B;  1WAF A;  2Q0U A;  4A2A A;  1BDG A;  4H0V B;  1MDU B;  4JD2 B;  1YT3 A;  2P9N A;  3NH0 A;  3ZT3 A;  1DTT A;  3L3V A;  3AVC A;  4DFP A;  3NGI A;  1P90 A;  1NGE A;  3THY A;  2IVN A;  1GLJ O;  4FW2 A;  4DV0 K;  3J7A P;  2HBK A;  2W42 A;  4JKD A;  3G6E N;  2EWS A;  5F2R A;  3SI6 A;  4CIF A;  4N47 A;  4DFM A;  4FM1 A;  1KD1 O;  1HQE A;  3O4Q A;  4O5B A;  1SL0 A;  3SQ0 A;  4RCH A;  1A5X A;  3DRS A;  4B9V A;  2XRI A;  4DWI A;  1VSI A;  1TV6 A;  1I3A A;  2OAN A;  4ELT A;  2YJF A;  4FLW A;  1T6C A;  4FLT A;  5AQI A;  4DUZ K;  2ITG A;  4KH6 A;  4BAC A;  4H8K A;  5H1S Q;  3H45 C;  3KK2 A;  1DKG D;  3QFU A;  3KD1 E;  4NXN K;  3B6O A;  3DXM B;  4HVJ A;  1FJG K;  3O9S A;  1SKS A;  3CQY A;  3V9S A;  3DOK A;  3QIN A;  3VQB A;  1Y64 A;  3SJJ A;  4BY9 C;  4LFC K;  4CJF A;  4H5R A;  4KH4 A;  4CI6 A;  3KHY A;  1NJI O;  3RMB A;  2Q2R A;  1HJO A;  3VN5 A;  4Y1C A;  4LF8 K;  3QEX A;  5DK5 A;  2CH6 A;  1I94 K;  2KQ2 A;  4BRC A;  2WFB A;  1IV0 A;  2HND A;  3N4Q A;  5GAG P;  3KWI A;  5GIP A;  1L3T A;  1RT7 A;  3EY1 A;  1XI1 A;  5KRS A;  3VQ9 A;  3AO3 A;  3WEE A;  5SWM A;  3UKU B;  1BA0 A;  3CM5 A;  3ITH A;  4C1N K;  2NRX A;  4I7F A;  3ULE B;  2HHX A;  2KFZ A;  3HST B;  5LMU K;  3VF6 A;  1U49 A;  1JKH A;  3WNG A;  4J2D A;  2KZZ A;  3KLI A;  4B9N A;  2GV9 A;  2HMP A;  4BRH A;  3E01 A;  1NK6 A;  4OO1 J;  4IKF A;  3HM9 A;  4DTU A;  4FJ8 A;  4UY8 O;  3QO9 A;  2HVH A;  3LAK A;  3QFP A;  3V9W A;  4CZI A;  1RDC A;  1X3N A;  2E20 A;  3E9O A;  4J8F A;  2VWK A;  3PV8 A;  2GX9 A;  1BQN A;  3O5B A;  1O13 A;  4DV6 K;  3PX4 A;  1OH5 A;  1K73 O;  1HKG A;  2DY4 A;  1QQM A;  4KB1 A;  5AQS A;  4M3X A;  2WBN A;  1EQY A;  1Z6R A;  1MWK A;  4I2Q A;  4BE1 A;  3C0B A;  4FZZ A;  5I42 A;  3DLR A;  2QWR A;  4CIE A;  2DFF A;  1NBW A;  1RT5 A;  1QTM A;  5J2M A;  2KZM A;  4A5B A;  4Y0W A;  4I6M B;  4FJ9 A;  4B9U A;  5HRS A;  4RW8 A;  5EX5 A;  3QEV A;  1Q9X A;  2QWN A;  5HP1 A;  2YNI A;  4M7X A;  3AV9 A;  4BRQ A;  5C15 A;  3L4I A;  3DLB A;  4A62 A;  3CER A;  4AHV A;  4FJI A;  3ENO A;  4DV5 K;  2NZT A;  2F9T A;  3SMP A;  4JI4 K;  3NGY A;  1EO1 A;  3KLG A;  3HVR A;  3I56 N;  2W6L A;  1C0M A;  2YNG A;  4F4K A;  4YHH K;  4J2B A;  2YCH A;  3C6U A;  2O8B B;  2XY5 A;  4LC9 B;  1B9F A;  3SUO A;  1ASW A;  1RT4 A;  3T3F A;  4CK2 A;  5HLF A;  4H5W A;  1NKB A;  1R59 O;  1T03 A;  2G8F A;  1WBD A;  4IFY A;  3PO4 A;  4DV4 K;  1TUY A;  1K8K B;  3UKR B;  2O8C B;  1VQL N;  2NRT A;  4E19 A;  3IS9 A;  2Q97 A;  2P9P A;  4JI0 K;  3A8Y A;  3BGR A;  3VEX A;  3TTD A;  4M3Y A;  4CGI A;  1RIL A;  4CJ3 A;  3L2V A;  4KI6 A;  1NM1 A;  1C1B A;  4EP4 A;  4RWT A;  1QVG M;  4IJN A;  3SCX A;  4FJL A;  4OPJ A;  4O0J A;  5BN8 A;  4LSN A;  1S1W A;  4KHW A;  1QSY A;  3RR7 A;  1XQS C;  4GV6 A;  3HO1 A;  1RBT A;  1XUP O;  1QS4 A;  1JCE A;  3CMA N;  2BTF A;  4FCY A;  5AFU H;  3DLH A;  1RBS A;  4B3T K;  5JS1 A;  3U9Z A;  1N6Q A;  2HW3 A;  4G1Q A;  4H0O A;  3PIP L;  4H4M A;  5AQW A;  4PKI A;  1D5A A;  4AM7 A;  3V81 A;  3EL2 A;  5AR0 A;  4BVO A;  3HM8 A;  1NGH A;  3B6P A;  1YJW N;  4FLU A;  2UXB K;  3K58 A;  4JKE A;  4CZE A;  1BGX T;  1K6Y A;  1HYV A;  3MXM A;  1OKJ A;  3AAP A;  3ENH A;  5KRT A;  1ATR A;  4NYN A;  3KLH A;  2DPN A;  2ZJP L;  5M1N A;  3QEI A;  4AHU A;  1NGJ A;  3BP8 A;  1RTH A;  4CF0 A;  1A5W A;  3EO3 A;  5AQY A;  4BRA A;  3QEW A;  2BAN A;  1YAG A;  2O8E A;  3CJA A;  3IFR A;  1S9E A;  1VQ9 N;  4I9Q A;  1BI4 A;  3V9X A;  5C2F A;  4A61 A;  1L3V A;  1QSL A;  2XY8 A;  3I55 N;  5KQD A;  4OGE A;  2E1Z A;  2HHU A;  1HLU A;  4KKO A;  2NRV A;  1LV5 A;  1JLG A;  1IBM K;  2X78 A;  4OLB A;  1T44 A;  2RE2 A;  2D1K A;  4JKH A;  4CJL A;  1NMN A;  2F4V K;  3SQ1 A;  4CJQ A;  4B3M K;  1YF5 L;  4DB3 A;  2XO7 A;  1JXB A;  3VEY A;  2ZD1 A;  3MED A;  4DF8 A;  4RTF D;  3PLA A;  2I7N A;  2VWJ A;  3K2P A;  3W3D A;  5ADX A;  4G9Z A;  4JN4 A;  3NH2 A;  4MO5 A;  4BQZ A;  1W0H A;  1J6Z A;  3HVT A;  4MQ3 A;  4JI8 K;  1BWF O;  4X64 K;  4E7L A;  4O8U A;  3WEE B;  4CHY A;  4WFB L;  3JXU A;  4H03 B;  4GW6 A;  2P9I A;  1ASU A;  1WSJ A;  4HUE A;  3AO4 A;  2X74 A;  4CZJ A;  1RDW X;  5HRN A;  5FDL A;  4WCE L;  1KRP A;  5AQM A;  4F9O A;  4M45 A;  2E8A A;  3ASM A;  4B9Q A;  1OH7 A;  1NOY A;  4I9L A;  4Q0B A;  2YNF A;  1QZ5 A;  4JV5 K;  4JS5 A;  3L2U A;  2X6N A;  4BRO A;  3QIC A;  1HQU A;  2WC9 A;  1ITG A;  1J54 A;  3AY9 A;  3K59 A;  2GEM A;  3IUC A;  5TKW A;  2ZE2 A;  4CD3 A;  4B9L A;  1NK5 A;  2HF3 A;  1C0G A;  1HKB A;  2OCE A;  2IC3 A;  4FLZ A;  5BR8 K;  3ATU A;  2A1R A;  2JWL A;  2ETJ A;  3KKS A;  1WSH A;  1IJJ A;  2RHK A;  4DFJ A;  2ASP A;  2UUB K;  4FOE A;  3QBX A;  4K43 A;  3AVB A;  1YTU A;  1BQM A;  3ZEU A;  5SZT A;  1OH6 A;  4YY3 K;  3JYT A;  3LDL A;  1HKC A;  3FGU A;  4GVM A;  4IOX A;  5AJ3 K;  1LW2 A;  2ITM A;  1NNE A;  1HNZ K;  1TKT A;  4YOX A;  1HRH A;  3H08 A;  1RBV A;  4JK7 A;  1XNQ K;  4BRE A;  4NXM K;  5KGW A;  4DCH A;  1RCH A;  4KTQ A;  4V19 S;  1Q9Y A;  1KSP A;  2O8D B;  4JNE A;  1TVR A;  1WLJ A;  3NCI A;  1IH7 A;  2WOM A;  3MAQ A;  3M8R A;  1U6Z A;  1ZBS A;  4YDU C;  3BZC A;  5AQQ A;  1CXQ A;  4M3U A;  3EKS A;  2QWL A;  4N5S A;  1WSI A;  4BRD A;  4JYA K;  4KAZ A;  3CCR N;  4Z4I A;  4CFA A;  1GLD G;  1GOB A;  3O9R A;  2HHH K;  3WNE A;  2OYQ A;  1GLL O;  1S6Q A;  4RW6 A;  3MN5 A;  5AQR A;  1O1W A;  4JI7 K;  2EX3 A;  4E1M A;  3UIQ A;  1JCF A;  3KIO A;  1ZBI A;  3BEX A;  1XC9 A;  4H5N A;  4PL7 A;  1U2V B;  4NCG A;  3NVM A;  3H1V X;  1IKV A;  2QW9 A;  4CK1 A;  5AQX A;  4MO4 A;  2OZS A;  1D9D A;  1SL2 A;  2ZJR L;  2A40 A;  2E6M A;  2P9P B;  1SKR A;  3D6R A;  5CY4 A;  3ZX3 A;  3K0S A;  3QBW A;  3TAE A;  2G8V A;  4LF4 K;  2UXD K;  1UWB A;  4M63 C;  4Z4E A;  3Q7C A;  3UB5 A;  2I5J A;  3H1Q A;  3CCQ N;  1WUA A;  4CEC A;  3BF3 A;  5BRD A;  3J81 O;  1EET A;  4BRP A;  3TAG A;  4CF9 A;  2V51 B;  4IO8 A;  2ZQB A;  2GUI A;  2PBD A;  5JLF A;  2JGU A;  4KHS A;  1EXQ A;  5IWA K;  4FOI A;  1YVU A;  5AQU A;  3MWT A;  1SZ2 A;  3CCE N;  4BWM A;  2QA4 N;  4LF7 K;  5AQL A;  3I8B A;  4CHN A;  3V6D A;  5JVG L;  1GLE G;  3CJB A;  2XY7 A;  4FWO A;  4CEO A;  3MDQ A;  3M5R A;  2ZWH A;  3I0S A;  5E26 A;  3DLE A;  3CME N;  5JMV A;  3LAN A;  4LH4 A;  3LDP A;  1ZYQ A;  3ENB A;  4ISF A;  1D8Y A;  1GLF O;  2O8E B;  4BRF A;  3NE6 A;  3AVH A;  3M8S A;  1BI4 B;  4DR3 K;  5DM6 L;  3CC2 N;  1KVC A;  4IFE A;  1L3S A;  4DTJ A;  1KAX A;  1CZ9 A;  3ZSO A;  1U48 A;  3O08 A;  3OY9 A;  4B1V A;  4DSK A;  1QQC A;  5HRP A;  4ID1 A;  4JK8 A;  2P51 A;  1Z25 A;  2NUB A;  4HTU A;  4FWS A;  2IS3 A;  5AZI A;  4X62 K;  1X9W A;  4CHO A;  3NBP A;  3VQE A;  2IVP A;  2RPI A;  3K5L A;  4AHC A;  5AQV A;  3RRG A;  3VEW A;  3LZI A;  4FK2 A;  5EOY A;  3ZLJ A;  4I2P A;  3UE5 A;  3A5N C;  3VTH A;  2HHS A;  4BRN A;  3P4I A;  4BC3 A;  5CZ2 A;  4FW1 A;  3NAE A;  3SUP A;  3CIP A;  4DSJ A;  5T7B A;  4YOV A;  4CEZ A;  1HNI A;  4FWN A;  5AQK A;  1Q82 O;  2XHB A;  4KO0 A;  2QWO A;  2HHT A;  3VA0 A;  4C8M A;  3S41 A;  4BRI A;  1SS6 A;  1P8Z A;  1BIZ A;  2Q1N A;  1LAW A;  3K57 A;  3VEV A;  3T19 A;  2CGL A;  3VQ4 A;  2CH5 A;  4EAH D;  1C0U A;  3LL3 A;  3K5N A;  2P9I B;  3VF4 A;  2OTJ N;  3VET A;  4GY2 B;  4BDY A;  3JSM A;  4W5R A;  5LY3 A;  4BR5 A;  1LWF A;  1GLB G;  3J7Y P;  4GNI A;  3C65 A;  4CF8 A;  5BRE A;  1W97 L;  4NLC A;  2KTQ A;  5B8H A;  2A3Z A;  3HI0 A;  1ESV A;  3AAR A;  4FSV A;  1S72 N;  1TYQ A;  1C6V A;  3AVF A;  2E5L K;  1VSM A;  3OS0 A;  3TI0 A;  1Q18 A;  3KK7 A;  3TTF A;  1NK8 A;  3GE1 A;  3NGZ A;  3SBT A;  3TAP A;  4DS4 A;  4F2S A;  1QZ6 A;  3CXC M;  2FBV A;  2HMI A;  4FYD A;  2A41 A;  3V4I A;  4CFC A;  3ZEU B;  1QQO A;  4YOT A;  2ZGY A;  4FM2 A;  3LP1 A;  4DTS A;  2A6A A;  3ALY A;  1GLA G;  2P9K A;  3AVM A;  1KLN A;  1LCU A;  4FJJ A;  3KJV A;  1RBR A;  3FE1 A;  3CPW M;  4OPH A;  5C42 A;  4FO0 A;  4EHT A;  2JLE A;  3SV4 A;  2KFN A;  1MA9 B;  4DS5 A;  3HYF A;  2VG7 A;  4BWJ A;  4N76 A;  3O4N A;  3MN9 A;  5C10 A;  3EN9 A;  3PX6 A;  5KGX A;  3CQX A;  1VQ7 N;  2HBL A;  3SBG A;  2OPQ A;  3QET A;  1HPZ A;  5CYM A;  3WNF A;  4CJT A;  2X6S A;  3PSI A;  5C25 A;  2E6L A;  3A5M C;  3FFK B;  1IG9 A;  1VSH A;  3C6H A;  4BGA A;  4BR4 A;  3OYH A;  3CQ8 A;  4W5N A;  3MWP A;  4X66 K;  4FJ5 A;  3D2F A;  4DU4 A;  2R7Y A;  1YI2 N;  3KD5 E;  5FRO A;  1JLA A;  1ZBH A;  4O44 A;  3FLC O;  4ILJ A;  5AZJ B;  3VER A;  1U4B A;  4B1U B;  3IKM A;  4K42 A;  3C7N A;  2FSN A;  5BN9 A;  4DQ8 A;  1WBB A;  4L3Q A;  4CJ5 A;  4IG3 A;  1RTD A;  4A2B A;  2ZJQ L;  4QCL A;  3SQ2 A;  3THX B;  1RDD A;  3D0P A;  1S1V A;  3OJU A;  3H6E A;  4WQ5 A;  1OH8 A;  5KI6 A;  1KFS A;  2F8T A;  2NRH A;  2Q0R A;  3MXI A;  3MEE A;  4DUY K;  4FJN A;  2JWK A;  2QEX N;  3VQQ A;  3ZSY A;  1NJZ A;  3MN6 A;  1J53 A;  3IG1 A;  3O9Q A;  3DJC A;  3HSC A;  3K9K A;  2YHA A;  4CZM A;  2HHQ A;  4BR9 A;  3PY8 A;  4GMJ B;  2PAV A;  1XMO K;  3OBW A;  2CGJ A;  4XIU A;  3U3G A;  1MWM A;  4M3R A;  2G8K A;  2VCP A;  5AQF A;  5JLH A;  4CGF A;  3NHG A;  1RDB A;  2RKI A;  3L3U A;  1ATN A;  2NRZ A;  2D0P A;  2QK9 A;  1J9A A;  3JAM O;  1VSK A;  1VRT A;  1WSE A;  3BZK A;  1LWC A;  2W6K A;  4E0D A;  1ATS A;  4DV1 K;  3DRR A;  1KFD A;  3DLL L;  4CEB A;  3HJF A;  3VTI A;  4BC4 A;  3P83 D;  4FWM A;  3NF8 A;  5DMR A;  2UUA K;  1X3M A;  1BUP A;  3CFP A;  3TR8 A;  1VAZ A;  1S3X A;  4YFU A;  1NK4 A;  4DLE A;  4EIA A;  3NDK A;  3CFO A;  2FXU A;  3L2R A;  3SQ4 A;  3VQC A;  3VMF B;  3LAL A;  1BG3 A;  4CEQ A;  3OBY A;  5M1P A;  1VQN N;  3NFA A;  4DR2 K;  3HZ6 A;  4KHP K;  5J1E A;  4AQY K;  4IFV A;  4CF1 A;  1VQ8 N;  3I0R A;  3NF6 A;  4FZY A;  2B6A A;  1SQK A;  3HOS A;  4ISE A;  3GG4 A;  2E1Y A;  1B9D A;  3P1G A;  2Q3S A;  3SAF A;  4CEE A;  5AZI B;  4E7H A;  3ZT2 A;  2O8F A;  1HNX K;  1K8A O;  3R8E A;  3BF1 A;  5KTQ A;  3LZJ A;  4CFD A;  1RTJ A;  4B9M A;  1A5V A;  5AQN A;  3VA3 A;  2QKK A;  3LDN A;  3RVC A;  5EVZ A;  1TKD A;  3L2Q A;  3DM2 A;  5GIN A;  4HCB A;  3VEN A;  1RT3 A;  1ZC6 A;  4KV8 A;  1NGD A;  5ELZ A;  2P9N B;  3KKR A;  5M1F A;  3AVK A;  1M1K O;  1X1P A;  3D45 A;  4FJX A;  1W2B M;  4NCB A;  2QTD A;  3O80 A;  4MLH A;  4LY7 A;  4DTP A;  3THY B;  4DR6 K;  2V52 B;  3F2K A; 
#chains in the Genus database with same CATH homology
 1I94 K;  4DV3 K;  4LF5 K;  1XNQ K;  4JI1 K;  2E5L K;  2VQE K;  4YHH K;  4NXM K;  4DR4 K;  4LFB K;  5FLX O;  1IBM K;  5IT9 O;  3T1H K;  4LF9 K;  4V19 S;  1XMO K;  4LF6 K;  1IBK K;  2F4V K;  4DV7 K;  4DR3 K;  1XMQ K;  4DR7 K;  4JI6 K;  4B3M K;  3JAM O;  5LMU K;  4OX9 K;  4DV4 K;  2UU9 K;  4GKK K;  4JYA K;  5LL6 Z;  4JI0 K;  4DV2 K;  4DV1 K;  4GKJ K;  1XNR K;  4B3S K;  2HHH K;  4DR1 K;  2UUA K;  1N34 K;  4X62 K;  1J5E K;  4JI8 K;  5A2Q O;  4JI7 K;  4X64 K;  4DV0 K;  3J7A P;  1N36 K;  5LMN K;  4DV6 K;  4B3T K;  4CVN E;  4DR2 K;  4KHP K;  4AQY K;  4K0K K;  4X66 K;  4LFA K;  4LF4 K;  4JV5 K;  2UXD K;  2UXC K;  4DR5 K;  1HNW K;  2ZM6 K;  4JI5 K;  4DUZ K;  2UXB K;  1N33 K;  1HNX K;  5BR8 K;  3J81 O;  4JI2 K;  2UUC K;  4X65 K;  4NXN K;  2UUB K;  1FJG K;  1N32 K;  3OTO K;  5IWA K;  3J80 O;  1IBL K;  3J7Y P;  4JI3 K;  4LFC K;  4YY3 K;  4CW7 B;  4B3R K;  5AJ3 K;  1HR0 K;  4LF7 K;  4DUY K;  4DV5 K;  1HNZ K;  3T1Y K;  4DR6 K;  4LF8 K;  2VQF K;  4JI4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...