4DV3K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv3K00
2UXCK 4YHHK 4LF7K 4JI1K 3J81O 4B3MK 4AQYK 5FLXO 1XMQK 1XNQK 1I94K 1HNZK 4LF5K 4DR3K 4CW7B 4JI8K 1N36K 4JI5K 1XNRK 2UUCK 4CVNE 4NXNK 4DR2K 1IBMK 2UU9K 4LFAK 4LF9K 4DR4K 4JI4K 4DR5K 1HNWK 5LL6Z 3J7AP 4B3RK 4JYAK 1IBKK 4DR6K 1FJGK 4OX9K 1HNXK 4V19S 4B3TK 4K0KK 2ZM6K 1N33K 4DV5K 4JI2K 4DR7K 2E5LK 4JI6K 1IBLK 1J5EK 3T1HK 5IT9O 4X62K 2UUAK 5BR8K 4JI7K 2F4VK 3J80O 3OTOK 4X65K 5AJ3K 2UUBK 4GKKK 1XMOK 4KHPK 1HR0K 4JV5K 5IWAK 2UXBK 4DV7K 1N32K 2HHHK 4NXMK 2VQEK 4JI3K 4YY3K 3JAMO 4DV6K 2UXDK 4DUYK 4X64K 4JI0K 4DV0K 1N34K 3J7YP 4LF4K 4B3SK 4DV3K 4DV1K 4LF8K 4LFBK 2VQFK 4DUZK 4GKJK 5LMNK 5LMUK 4LFCK 4DV4K 4X66K 4LF6K 5A2QO 3T1YK 4DV2K 4DR1K
chains in the Genus database with same CATH superfamily
2JLEA 4W5TA 3CJ7A 2A1SA 1YI2N 3J81O 3IKMA 4NYFA 3WQUA 3S3NA 1YTAA 2FBYA 3RVCA 5JLFA 2D1KA 3O9SA 3NVMA 4CEBA 2QEXN 1NWKA 3ISNC 4CHZA 3VGMA 2FXUA 3DLHA 3SUOA 1U2VB 3R8EA 3QEPA 3IAYA 4KTWA 2HF3A 3AVKA 2HBMA 3G0ZA 4BR7A 2E6MA 2GEMA 3GL1A 3HL8A 4ID1A 1W9HA 4QS7A 1LWEA 2F9TA 3C7NA 3HM8A 1RDBA 1HX1A 4E3SA 4BVPA 4K0KK 3SQ1A 1P90A 1BUPA 2CGLA 1RBVA 2P9PB 2IC3A 4PQUA 1BO5O 3G10A 4CK3A 4AHVA 4JKBA 3M8PA 1F21A 3VETA 3OS2A 1BIZA 2OA8A 1O1WA 3I8BA 4OLAA 1RDCA 2CGKA 5AJ3K 3RSEB 4NCGA 4EHTA 1X3MA 2HMPA 4FK2A 2FBTA 4JN4A 5C25A 3OYFA 3MN6A 4B1XB 3TAEA 5AQIA 2A5XA 3CCRN 4OO1J 5SWMA 3NFAA 5LJVA 1BIUA 4O55A 2X74A 1EXQA 4QS8A 1SL1A 3FE1A 5MLCQ 1VSJA 3PSIA 1S72N 2Q36A 1B92A 3CXCM 3PLAA 3OBYA 4N5SA 1SUQA 1RTJA 1QTMA 4GVEA 2A40A 4QS9A 2YJFA 3V9ZA 1GLEG 3KK3A 4LF6K 4MLHA 4DQ8A 1WSEA 3L2WA 4DMNA 1VSLA 1BCOA 4CJ5A 4JI1K 1NGDA 2XRIA 3MMVA 4FZZA 3CHWA 1JKHA 4AQYK 1Z25A 3ENOA 1SL0A 1DTTA 3U9ZA 5F0XA 1N6QA 3WXJA 1I94K 3BGRA 4DR3K 5GINA 1DT9A 3ZSYA 3ZCMA 1XNRK 4J2EA 3CG7A 4ISFA 3NE6A 5M1QA 1K6YA 3EN9A 1JCEA 2W41A 4M3TA 4CZJA 3PX0A 2DY4A 3OVNA 4DF4A 1KRPA 3HVRA 3ZX3A 2QW9A 5GAEP 1RT3A 1NK6A 3T7ZA 2O4GA 2WONA 1XC9A 1RFQA 3ITHA 5CE3A 3HPHA 1UA1A 1VSHA 3VQPA 3LAKA 2BE2A 1OH7A 4KFBA 1KLNA 4H5NA 1KAYA 2E88A 4WQ4A 3D0PA 1BI4B 4CJRA 3QB0A 5M1KA 1SKRA 5BPLA 1KLMA 1NGIA 4H0XB 1IBLK 3B8AX 4FWNA 3O9TA 2V52B 3BF3A 4X62K 1KC8O 1NJYA 3DAWA 4CEDA 4KHQA 3HT3A 4H4OA 5HRPA 2EHGA 2CH6A 1ZC6A 3IG1A 4BACA 3OYBA 4GKKK 2FC0A 3Q7BA 4CZEA 5D3GA 2D4WA 2NZTA 1K73O 4DSIA 2HOEA 4QAGA 3OYEA 4H5VA 4IWVA 4G9ZA 1L3UA 3MK6A 3ZT2A 1KSPA 4B3OA 1RT4A 3OBWA 2HBKA 2ZJPL 3PO4A 4OKJA 3V1OA 4CZFA 4DV4K 3F9MA 3CYMA 3I55N 4CFBA 1TKDA 1JLQA 3AA4A 1NJWA 2PYLA 4FJKA 1GOAA 1TV6A 1ATNA 3L3VA 3HPOA 3WNHA 3CPEA 3OYDA 1XWLA 1YJWN 4FZYA 1S9EA 4KI4A 4A62A 1LWFA 4HTLA 2NRRA 3TSUA 1VAZA 1J5OA 2RE2A 2KZZA 1WN7A 3TTCA 1VQKN 4IBNA 4YOUA 3ZEUA 2YNFA 3SV4A 3LDPA 3RRGA 4CJFA 1LAVA 3LPTA 3CQ8A 1Q18A 1NG9A 4O5BA 3OS1A 5KRTA 3V4IA 4BRHA 3P31A 5JVHL 4R5PA 3CMEN 1YVNA 4IOCL 4Y1DA 2P9KB 4LSLA 2EX3A 4B9QA 1GLFO 2G8IA 3O4WA 5HLFA 1LCUA 1RCHA 4OPAA 3DM2A 5HP1A 4FXDA 4CK1A 1FKPA 4FWSA 1L3TA 4B1VA 5AQVA 3LDLA 4EIAA 4HCBA 3FR0A 3QIOA 4ISEA 2VCPA 3A2FA 3LANA 3VA3A 4KHYA 4E1NA 4C1NK 2UYTA 4CI6A 4EZ9A 4E1MA 5GADP 1WSHA 3S3OA 1N32K 4NXMK 4YNQA 3QLHA 1UAXA 2YNIA 3LP3A 1Q7YO 3CI5A 3HPGA 4FSVA 4PWDA 3TPQA 2GX9A 1GLJO 3K5NA 4BDPA 1KVCA 3PSFA 3C6UA 4DV3K 4DV1K 2QWRA 3AVIA 4CBWA 3SK3A 5ADXH 1VSEA 3KHYA 2E2QA 4AHUA 3PO5A 4QOZB 2NRWA 3NBPA 2KQ2A 5LMUK 4LFCK 4JKHA 2HBJA 1LOTB 1SKSA 1WAJA 4AHRA 5J2MA 4GV9A 3M3ZA 1Q9XA 2H3GX 1RILA 3OJUA 2UXCK 1RBTA 1S5JA 4CEOA 5FPEA 3C0BA 3AVCA 5AZJB 4CJPA 4B9SA 4IDKA 4CIFA 2FBXA 4FJGA 1S9GA 5E26A 3U6FA 3SQ2A 4FLWA 3VQ8A 3NF9A 1N36K 1EX4A 1YT3A 3E9PA 4JD2A 2LSNA 1TAUA 2HBLA 1TKXA 1W2BM 5EX5A 5AZIB 3KK1A 1DTQA 3DLEA 3GOIA 3ZLJA 4XH1A 5KQDA 3W0LA 4PKGA 2OZMA 4PKHA 4M7XA 4F2RA 4B3RK 3DLGA 3OYMA 1FJGK 1V4TA 1D4XA 1K8KA 3DLBA 2QI2A 4J2DA 4C1NI 1GLCG 2ZM6K 1WSFA 4M3UA 4BROA 5CY4A 3NH2A 2NRXA 1BGXT 3U3GA 2OPPA 3M6GA 4HHTA 1HPZA 3IRXA 1JXEA 5M1FA 2QXFA 3CCVN 5EVZA 2JWLA 3R6MA 1K8AO 4IJNA 3DOKA 4CZHA 4WFAL 2QA4N 1ZXOA 3ZX0A 1KXPA 3TANA 5BPMA 4JV5K 1Y97A 2OYQA 4IFVA 1WSGA 1NOZA 4YDUC 1D5AA 3L3UA 3CFRA 4FL9A 2P9SB 1YHQN 1QHTA 4DSLA 3OYAA 2ITGA 3DLKA 3CC2N 3VA0A 4RTFD 3O6WA 5BREA 1ASVA 3IUCA 4PUOA 5BN9A 3AO3A 4BR0A 3SNNA 4I9LA 4M63C 4ELUA 1QSSA 4GKJK 4FW2A 5DM7L 2NLXA 5LMNK 1B9FA 3TU5A 3LP0A 4H0PA 4CF1A 2DTUA 3LZJA 4QCLA 3CC7N 3LP1A 1VSKA 2VG6A 4CEQA 3BZKA 1MU2A 1EWRA 5B8HA 4B3MK 4BRFA 1RBSA 3PX4A 2G8VA 1W0HA 3THXA 1D9DA 4LF5K 1GLAG 4WF9L 3SUPA 3WEEA 4FVUA 3WQTA 1BDGA 2UUCK 2HNZA 4IZ9A 4BRDA 2WTUA 1S1VA 3O3GA 2XY6A 4OKKA 4BRMA 4BQLA 3ZT4A 4KRFA 3WT0A 1TUUA 1LWCA 1CZAN 1NGJA 4K41A 1L5UA 1K9MO 1IBKK 1LW2A 4DTSA 3CCUN 3PV8A 4OX9K 1ASWA 4CGDA 4YOVA 4HVJA 3G4SN 1HYSA 1C1BA 4BGBA 5KI6A 1N33K 4FWMA 1W97L 5CR4A 2QWLA 1BU6O 2ZE2A 1YTUA 3UKUB 3T1HK 4C8LA 4A57A 2E2NA 3VQDA 5IT9O 3C6TA 4CJEA 3I0RA 4OVLA 4R79A 1C0UA 4FO0A 4BQZA 3L2VA 5AQKA 4N56A 3RMDA 1QZ5A 1EP4A 1JLFA 5AQTA 3WNGA 3ULEB 5KGXA 2GUIA 3T19A 4Z4CA 3AVLA 3FZLA 4JKGA 4BVOA 2IVNA 4DV7K 3OYHA 1DGKN 3O80A 5HRSA 2RHKA 1XQSC 4B9TA 2ZJQL 3QBWA 2A6AA 3LWMA 4FCYA 2QWMA 1TYQB 1X9JA 4X64K 1C0MA 1VSDA 4FWPA 4DV0K 3AY9A 3OYGA 4O0IA 4PL8A 3NH0A 2BANA 1U47A 1JLEA 2E1ZA 5FRNA 5TKWA 4HCCA 3LAMA 3SPZA 1RT6A 2WOMA 1QVFM 3QFPA 3KJVA 2P5OA 4CGHA 4M42A 3DXKA 4CHQA 5DM6L 5LJWA 4FOIA 4I9QA 1T8EA 1RTHA 4H0VB 1VRUA 3IMXA 3E01A 4B9MA 3WNFA 3LM9A 3K2PA 3UKRB 4GV6A 2O8DA 4JI8K 4CJKA 3HVTA 2ZJRL 3K5OA 2PBDA 4CBXA 2UU9K 3H45C 3C94A 5KRSA 3V1QA 1KAZA 5M1OA 1TKTA 4IG3A 3VMFB 1QSLA 2OTJN 1HKCA 4KB1A 3LPUA 3AARA 2QXLA 3KKSA 3HRGA 3CJ9A 3K9KA 4V19S 1Z05A 3JXUA 3MXIA 5AFUH 4KH6A 5DK5A 4A2AA 5C12A 2W40A 1OVYA 3D2EA 2G8FA 3QINA 2HVIA 4DQIA 3FZMA 2F4VK 1OKJA 2O8BA 4E7LA 3O4QA 4K8XA 1HLUA 1S1TA 5BRFA 4EZ6A 3MCAB 4H5WA 4YOTA 4DQSA 1KD1O 2I7NA 4WQ4C 4G1QA 4IEIA 1BA0A 2A3ZA 2A42A 4IFYA 4JK7A 1A5VA 2AA4A 2NUBA 4DB3A 5AQRA 1C6VA 4FLXA 3S41A 3QESA 3WXMB 1NK0A 4BR9A 3V9SA 3H6EA 2HF4A 3VEVA 1UWBA 1KCFA 4CFDA 4KV8A 4CGGA 2ASOA 4BWJA 4JK8A 1LW0A 3TARA 4DFJA 2VQFK 3L8BA 1SZ2A 1BHLA 3THYB 1T7PA 1WOQA 1HQUA 1NOYA 4OGCA 3LWLA 4E0DA 2E6LA 5C0YA 5T7BA 1WBBA 4BRAA 1Q9YA 3ULDA 4I7FA 3VGKA 1ASUA 4J2AA 3U8XA 2Q0RA 2WFBA 3CMAN 1S6PA 3VOVA 3HYFA 4ILHA 1FK9A 2O4IA 2HMIA 4FJ8A 2E1YA 1YUWA 2O8CB 3GDQA 3CJ1A 2PY5A 3HI0A 3P83D 4ZTFA 2CGJA 3L4IA 3VERA 2DFHA 3RMAA 4B9NA 4DLGA 1C0FA 2Q31A 3TAQA 4O0JA 1R59O 5AQQA 2P9LA 4NLBA 5TKYA 4IG0A 3QNNA 1KTQA 1BOTO 4I6MB 3IS9A 1L3SA 3MEGA 4GW6A 4RG8A 3MN7A 1TL3A 1YITN 3V9WA 1YJ9N 5AQFA 3CPWM 1U6ZA 1I39A 4OPKA 3E1YA 4FJ7A 1J5EK 3CCSN 4K25A 4DU4A 1KFDA 1RDAA 4FJHA 1VQPN 1BQNA 3ZT0A 3V9XA 3SBTA 2UUBK 3ZX2A 2E20A 4FWLA 2HHQA 2YHYA 2YJEA 3H3NO 3IDHA 3AA3A 4F3TA 4JAXA 4C8OA 5I42A 2KFZA 2YV0X 3ZSWA 4FLTA 3AGKA 2P9NA 3DWLA 2YHBA 1U45A 4DSJA 5C2DA 1M1KO 5ELZA 4MLEA 4KPYA 1RT1A 3KZBA 3SAGA 4JS4A 4CJWA 2QM1A 3VTIA 2D5RA 1C1CA 3NAEA 2BTFA 4CD3A 2IGIA 4IJAA 4JHDA 3NCIA 5M1PA 1Q86O 4CJLA 1VRTA 2QWPA 4YOXA 2W42A 4BR4A 2O8EB 1C1AA 3N4QA 2HHVA 4NCBA 3TAGA 4C8NA 4I2QA 1OH5A 3H46O 3KD1E 1NNEA 3SYZA 1WAFA 4I2PA 4BR5A 2B4JA 3A5NC 4JEPA 3ZT3A 4NXNK 5FRMA 4CZMA 4YOWA 4KKOA 1RTDA 4LF9K 1WSJA 5AR0A 4O8UA 3R3LA 5LL6Z 2ITMA 1ESVA 1T3VA 4CF0A 1WNSA 4KTZA 3SUQA 1VQ8N 4DR6K 2O8FA 3QETA 2CH5A 2E2PA 3CD6N 4W5OA 3DOLA 3AAQA 4FWKA 3SJJA 2V7YA 3OYCA 4BR2A 4FJLA 4ILGB 4NO7A 1ZBFA 3NHGA 4BE1A 3THWA 3LDSA 4RW9A 5I3UA 4H8KA 3CJBA 2HW3A 2GWJA 4E1JA 2F8TA 4AHTA 3HM9A 4FWRA 3ID6A 3C7NB 5CYQA 4IKFA 4A5BA 1X9SA 4K8ZA 3DRRA 1EQYA 4JLHA 5BR9A 4PY5A 4JRQA 1NK8A 3U9DA 5AQUA 4BRLA 4NCAA 4CIEA 5M1NA 3DXMA 4RW6A 4DUYK 5JLHA 4LH4A 3VENA 4JKDA 2JWKA 2P9UA 4FLYA 2FSNA 2FBVA 4H5TA 4W5RA 1NK5A 4DUZK 3SQ0A 4B1YB 4FPBA 5GAGP 1RNHA 3CIPA 2ASPA 4L8RB 1QQCA 5A2QO 4FJ9A 3ZT1A 1VQ9N 3PUFA 2ZWHA 4Q0BA 3I8DA 3DRSA 4DU1A 4EHUA 2OZSA 3VF4A 4ZHRA 1HNZK 2KFNA 3OS0A 3QFUA 3K58A 3J7ZO 4JI5K 3DMJA 1NJIO 1Z26A 3A8YA 2VG7A 3DJCA 2HHUA 2HNYA 4PKIA 3NF8A 4RW7A 1OH6A 2HHWA 4FJ5A 4CZIA 2F8SA 4WFBL 1MWKA 4IDHA 2BH1A 4MDBA 4BE2A 2G8HA 4Y1CA 4Z4HA 3K9JA 4FJNA 2IAJA 2RKIA 4FJMA 1CXQA 4Z0UA 3FFIA 1E4GT 4GV3A 4FZXC 4BC4A 4CCHA 4J8FA 3KK2A 4KTQA 3D2FA 5JICA 3H1QA 1RBUA 3PIOL 3FGUA 4U67L 3RMCA 3CJCA 4M7YA 1TVRA 4CHOA 4BRIA 3MWPA 4E19A 3VQ7A 4FJXA 3ZETA 1IV0A 3M1FA 1EO1A 1HJOA 4IXCA 2RN2A 1NLVA 4M41A 3TAMA 1BWFO 2XO7A 3A0IX 1JL1A 1Q8IA 1A5WA 3NF6A 1JCFA 4N47A 3SLCA 5AQMA 3OTOK 3F9KA 2P9IA 1YAGA 1YVUA 2HNDA 4J2BA 2IIRA 4CGFA 4CJSA 3VEYA 2QWQA 4CF2A 4M45A 3MDQA 3MX2A 3O08A 1Q82O 1T44A 2RPIA 4JI3K 4XH4A 4Z94A 3VQCA 4CJVA 4DSFA 4FLZA 2Z1JA 3L2QA 3RMBA 5AQZA 3AVNA 3BUZB 1RDDA 2Y1IA 4RW8A 3BP8A 5C24A 4LFBK 2D0PA 3NGZA 4N41A 2XY8A 5AQOA 3VEWA 1VSIA 3FZHA 3SZ2A 3T3FA 1U2VA 4BC3A 1NGBA 4WFNL 4WCEL 1RGIA 3LM2A 4WQ5C 4CECA 4BC2A 4DV2K 1U49A 1ZBLA 1J54A 2ZGYA 4JKEA 4OKEA 2NNWA 3R1XA 2BUPA 3TSPA 3SCXA 1U4BA 3L6QA 3I0SA 1D8YA 2JGUA 3SJHA 3VQAA 2P9PA 2Z1IA 1FW6A 4KREA 5AQSA 4CHYA 2YHAA 3O9QA 3TWHA 2GUPA 1HNWK 1Q81O 1S1UA 3E9OA 1VQMN 3P1GA 3RSEA 4CHPA 4BE0A 3VF2A 4BRPA 1RTIA 4UY8O 5AQLA 4BREA 3C95A 1TKZA 4H4MA 2GELA 1IO2A 1XHZA 3TTFA 4CF8A 4HUEA 3HZ6A 3OYKA 2GBZA 3RWUA 2B5JA 3O5BA 5ADXA 1TGOA 3ATUA 4BG9A 3E9LA 3SQ4A 4YORA 3QBXA 2E5LK 1NGFA 4KI6A 4B1WB 4B1ZA 3KLFA 4CE9A 4H0OA 4IO9L 1HPMA 4FWQA 2VWJA 2G8UA 4DS4A 4JI7K 4GMJB 5LY3A 3NF7A 4KBOA 2R7YA 4DTMA 2IS3A 3P39A 4CJUA 3MEDA 3ZEUB 1RT5A 1NGGA 1XHXA 5SZTA 2VYPA 3CM5A 4BRKA 4OLBA 5IWAK 3VPZA 3ZSOA 2YKNA 3NDKA 3UIQA 2XY7A 3CQYA 5C10A 1M90O 3NVKA 4HWIA 3VN5A 1R0AA 3ENBA 4XEIA 1J6ZA 3QERA 3V81A 2DFEA 3ZSXA 3HP6A 2WBNA 1REVA 4LF8K 3GBTA 5EOYA 3MECA 4O8KA 4ELTA 5CZ2A 4F3OA 4EAHD 3D6RA 1GLDG 4DTJA 4EP4A 3V6DA 4MDAA 1SS6A 4DFPA 3T1YK 4IOAL 1BISA 3LDOA 4YHHK 2QTDA 3FFKB 4FPAA 5KPZA 1NK4A 4CFAA 1DLOA 2VGMA 4DS5A 3MCPA 3I33A 3KLGA 1G15A 4GY2B 2EWSA 2Z1GA 1BI4A 4CJTA 4A5AA 4KHWA 3KLIA 3CERA 3O9UA 3VGLA 3DLRA 3QMLA 1VQ4N 2ETJA 4YDUA 3BEXA 3JSMA 3EKUA 2YHXA 1TK0A 1ZBHA 3NMUA 3VQ4A 1HJRA 3T1AA 3K5MA 1YJNN 3KLEA 3HJFA 1X3NA 5KPRA 4BGAA 3AO4A 4CK2A 4JK9A 3K59A 5KPTA 5FDLA 4BRQA 4DR7K 3E66A 4JD2B 2Y1JA 2G8KA 2NRVA 3HP9A 4E7HA 3OYLA 2YNHA 1ATSA 3KKRA 5AQYA 4DSKA 2HHSA 3VESA 4DHYA 3IFRA 1VQ7N 5JS2A 3PX6A 3BF1A 3HBTA 1VHXA 4ICLA 1K8KB 4ILJA 1L3VA 3U3YA 4AILC 1QZ6A 4H0TB 3O3HA 3L2RA 3K0SA 3AA2A 3SAFA 2HHXA 3VTHA 3UE5A 3QEIA 3CJAA 4CHNA 3ZSZA 4MFBA 2QKBA 1HKGA 4H0YB 4RW4A 3QEVA 1LV5A 5JMVA 1BQMA 3S3MA 3L4QA 1FXXA 5I9EB 1ZYQA 3G71N 4PL7A 4E7KA 5F1XA 1GLBG 3F2KA 3JS6A 1EWQA 2I7PA 1HMVA 3SUNA 2FSKA 2B6AA 4H5RA 1G99A 2AP1A 4O4GA 2ZGZA 2Q1NA 3DLLL 4DR1K 3ASMA 4IOXA 2YCHA 5C42A 4FK4A 2P1JA 2KZMA 3HOTA 1H1VA 1S3XA 3KD5E 5FLXO 1XNQK 1IKVA 4IEEA 4DG1A 4IFEA 2P9KA 2P51A 1VQON 1ZBUA 4UQGA 4C23A 4WE1A 1NJZA 3VEZA 4FLUA 2ZF5O 5AQHA 2VG5A 3G6EN 1IBMK 5C15A 1T6CA 1TUYA 1YXQA 1KAXA 4JNEA 3EKSA 3QIPA 1MDUB 4LC9B 3K5LA 5HBMA 1T03A 1SQKA 2Q97A 1JLCA 3THXB 3OY9A 4Y0WA 3ZYYX 1JL2A 3QO9A 4DQRA 4W5QA 1NKBA 1WUAA 3WEEB 4DTRA 4OPHA 1Y64A 1NGHA 4CESA 4NYNA 3J8AA 3P4IA 4MO5A 1ATRA 1O13A 1X9MA 3O1BA 1GOBA 4F8RA 3KWIA 5KTQA 4CF9A 3MEEA 1VQNN 4X65K 5EXWA 2HVHA 3MN9A 4DFKA 4LSNA 2X6NA 3AO5A 3OW2M 3NH1A 4MQ3A 2XY5A 3ENHA 2ASMA 2HB5A 2HHHK 1QQMA 3TR8A 3C6HA 3H3OB 5AZJA 4B9UA 4CFCA 4YY3K 4CEAA 4DCHA 2KTQA 1HNIA 4FLVA 4DV6K 4NLCA 2FLOA 2HHTA 1QS4A 1NGAA 5C2FA 2P5GA 3KK7A 4B3SK 3LALA 1BCMA 2PFUA 3LL3A 3V1RA 4CZLA 3AVJA 3EL2A 4XH5A 5AFUA 5AZIA 3OA9A 3G25A 3W3DA 2KLAA 1JJ2M 4E7IA 4X66K 1NJXA 1XC3A 1QVGM 5E84A 1I3AA 4B8AB 4KHSA 4JKGB 1NMDA 4Z4IA 2D0CA 3RR7A 1JLAA 2ATQA 2OCEA 3CCJN 1JLBA 1IKYA 2F7TA 2E8AA 3EYZA 1WB9A 1JCGA 5FPNA 1C0GA 3H08A 3AAPA 3P5JA 1TK8A 3O1WA 3LZIA 4CW7B 4CEZA 3M8SA 3EZWA 2OPSA 1HYVA 5HRNA 2YHWA 4HTUA 4CEFA 5JVGL 4BC5A 2NRHA 1E4FT 2W6KA 1HUXA 4MO4A 4DR5K 4FM2A 2YKMA 3RTVA 4ELVA 3DXKB 3ATVA 4DKWA 4CJ3A 5DMRA 1NM1A 1VQLN 1C0TA 4HUGA 5AQNA 4B3TK 2KW4A 4AHCA 4CERA 3LDQA 2D0BA 1TK5A 3DYAA 4A61A 4DV5K 1XUPO 4CZGA 3QDKA 2O8DB 4B9VA 2P9SA 1ZBSA 3UB5A 3HO1A 1QE1A 5HOOA 4KHUA 5KQ8A 3D45A 1V4SA 5GIOA 1N5YA 1QQOA 1D9FA 3S9HA 1J53A 4C8KA 1OVQA 1EETA 4BRNA 1VQ6N 2FSJA 3VQEA 3RR8A 4YFUA 4L3QA 4B08A 4BG8A 4FWOA 5H1SQ 4M3XA 1HR0K 1HQEA 4KB0A 3AV9A 3SMSA 4K43A 1NGCA 1GLLO 2UXBK 2A1RA 1NBWA 3MX5A 1CZBA 4CZKA 2PZSA 2E2OA 3AVAA 3D2EB 1RDUA 3OJSA 3EY1A 5GAHP 2D0AA 4FM1A 2O8BB 1T6DA 4KAZA 4RCHA 2VWBA 3N4PA 3THVA 1MA9B 3SAHA 3HOSA 3KVGA 1S1WA 4AH9A 3CM6A 4Q5VA 1P8ZA 3HSCA 5JS1A 4F2SA 4CGJA 1MWMA 1IJJA 2FF6A 2KKZA 1HRHA 4PA1A 3VEOA 2V7ZA 3DI6A 1NU0A 4BDZA 2HSTA 3CCMN 1XMQK 1WLJA 2X78A 4FVMA 1NK9A 4DTXA 4W5NA 3M8QA 5CZ1A 4DSEA 4CEEA 3MXJA 4GVMA 4OJRA 3ZSQA 1UA0A 5HROA 3UKUA 3AO2A 3WXKA 2PYJA 3QEXA 1J9AA 3HXMA 4DR4K 3PIPL 3AVFA 4JI4K 1GOCA 4IO8A 5AQWA 3OYJA 4CBUA 1JLGA 4BWMA 3J7AP 3ULEA 1BA1A 2Z1HA 3BZCA 4H03B 1Z6RA 2GWKA 4OPJA 3M5RA 2V51B 3WXIA 4BRCA 3VQQA 4NB4A 4C8MA 1ZBIA 4JI2K 2RF2A 1U48A 4ID5A 2Q2RA 1KQSM 3VQ9A 1TYQA 4O5FA 2F9WA 2IVPA 5J2PA 1ILYA 3CFOA 1NMNA 5BPNA 5J1EA 1CXUA 1IH7A 2NRZA 1YF5L 2P9LB 3EE8A 4FYDA 1XMOK 3Q7CA 1SV5A 4EFHA 3P38A 5J2QA 2GV9A 4YOYA 2J4RA 3NGYA 3HK2A 4Z4GA 3F73A 1RBRA 3M8RA 1CLQA 3JYTA 1U04A 3EEQA 1KVBA 1S22A 4JI0K 2QWOA 2VWKA 3UKRA 4N76A 1IG8A 4FK0A 1HKBA 4WYBA 1VSFA 2E4LA 2Q3SA 2AJQA 2ZQBA 1A5XA 4BRGA 3CQXA 4A59A 2IOCA 4M3YA 1S6QA 1E3MA 5GIPA 4A2BA 4RWTA 3FZFA 1VQ5N 3AA5X 3AVHA 4LF7K 3O9RA 3GG4A 2QWNA 3WNEA 2DPNA 4JKFA 1NK7A 5F2RA 2P9NB 4DTOA 1VSMA 4FM0A 3D7EO 2F96A 5BN8A 3K57A 4DR2K 2D0OA 3LDNA 1QSYA 2WC9A 2PAVA 3SPYA 4LFAK 4AM7A 3SI6A 3A5OC 3KLHA 2A41A 3SBGA 5AQGA 2G8WA 5KGWA 2W6LA 3B6OA 4JHDB 1RT2A 1S1XA 1QHAA 4M3RA 2ZD1A 5FPMA 4PHTX 3KWGA 4LD0A 3OHRA 3ID8A 2NRTA 3WXLA 1EKEA 3TSQA 4DLEA 4DTNA 3EZ5A 3KTQA 3EE9A 3SMPA 1RDWX 3A5MC 1BL3A 2YI1A 4DWIA 3WUHA 1HNVA 4FOEA 4M3WA 3RRHA 2UUAK 4Z4EA 1HYZA 4GNIA 3DRPA 1SL2A 3THYA 4LY7A 1FKOA 1BG3A 2O8FB 1KVAA 4M3ZA 2XHBA 3CCLN 4E89A 3T69A 2VQEK 4FJIA 4AHSA 4FW1A 3JAMO 3TTDA 4DU3A 2UXDK 3SV3A 3F5TA 4OGEA 1N34K 1X1PA 1TAQA 3B6PA 3J7YP 1QQNA 4CJ7A 4LF4K 1B9DA 3THWB 1NKEA 1IKWA 3FLCO 5AQPA 4F4KA 1TL1A 2QKKA 4B9LA 5FROA 1OH8A 1XI1A 4KH4A 4DTPA 3NGIA 5HRRA 4KHNA 2O8CA 4HUFA 4E7JA 5BRHA 3HSTB 2X6SA 1ITGA 1WSIA 1RT7A 3O3FA 1YIJN 3R9PA 3AO1A 4JKAA 4B8CA 3VF6A 1SKWA 4DFMA 4I6MA 3DXMB 3CCQN 3EO3A 3CFPA 3GE1A 1CZ9A 2P9UB 4EP5A 2GTDA 4F9OA 2VGNA 1IKXA 4CVNE 3OYIA 4KO0A 3VQ6A 2BDPA 1IG9A 5EY4A 3MAQA 2IVOA 3VQBA 4TSXA 3O8MA 2WUSA 4K42A 4AM6A 4JYAK 2OPQA 3L0QA 4DQQA 5K14A 3KIOA 3LP2A 3MWTA 2I5JA 1LAWA 3QNOA 4LH5A 1HNXK 3ZSVA 5BRDA 3CF5L 4JRPA 4DF8A 4BDYA 1SAZA 3C65A 3AGRA 3ZSRA 3L2UA 3MXMA 4CIGA 3PY8A 3QICA 4CD1A 1UOCA 2DFFA 3AVBA 5AQJA 4JI6K 4JS5A 3CC4N 4Z4FA 1DEJA 2BGGA 4WQ5A 3QEWA 1NKCA 3V9UA 5E41A 3TAPA 4ZTJA 5BR8K 4O44A 3CCEN 4B1UB 4DTUA 1DKGD 1X9WA 3J80O 4CJQA 1WBDA 3TABA 3AVGA 2YNGA 3O4NA 3I56N 5AQXA 4DQPA 2OTLN 2Q0UA 1N8RO 3ALYA 1W7AA 3BDPA 4KHPK 3OYNA 4CJ4A 3D2FB 1VK0A 3H1VX 5CYMA 4XIUA 4JKCA 3HTVA 3MN5A 3ZETB 3BY5A 1JXBA 3FZKA 4FJJA 2O8EA 1T05A 2QK9A 4BY9C 4AF1A 3A5LC 3TAFA 5EU7A 3AVMA 2P9IB 4U7BA 4KH5A 1KFSA 4CGIA 5J2NA 4ISGA 5FPDA 2OANA 5HL7L 1NGEA 3VEXA 3C6AA 2YX6A 3U4LA 5CHIA 2IDOA 3TI0A 2OPRA 2FF3B 3CETA 3VQ5A 2KHOA
chains in the Genus database with same CATH topology
2UXCK 4YHHK 4LF7K 4JI1K 3J81O 4B3MK 4AQYK 5FLXO 1XMQK 1XNQK 1I94K 1HNZK 4LF5K 4DR3K 4CW7B 4JI8K 1N36K 4JI5K 1XNRK 2UUCK 4CVNE 4NXNK 4DR2K 1IBMK 2UU9K 4LFAK 4LF9K 4DR4K 4JI4K 4DR5K 1HNWK 5LL6Z 3J7AP 4B3RK 4JYAK 1IBKK 4DR6K 1FJGK 4OX9K 1HNXK 4V19S 4B3TK 4K0KK 2ZM6K 1N33K 4DV5K 4JI2K 4DR7K 2E5LK 4JI6K 1IBLK 1J5EK 3T1HK 5IT9O 4X62K 2UUAK 5BR8K 4JI7K 2F4VK 3J80O 3OTOK 4X65K 5AJ3K 2UUBK 4GKKK 1XMOK 4KHPK 1HR0K 4JV5K 5IWAK 2UXBK 4DV7K 1N32K 2HHHK 4NXMK 2VQEK 4JI3K 4YY3K 3JAMO 4DV6K 2UXDK 4DUYK 4X64K 4JI0K 4DV0K 1N34K 3J7YP 4LF4K 4B3SK 4DV3K 4DV1K 4LF8K 4LFBK 2VQFK 4DUZK 4GKJK 5LMNK 5LMUK 4LFCK 4DV4K 4X66K 4LF6K 5A2QO 3T1YK 4DV2K 4DR1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC K;  4YHH K;  4LF7 K;  4JI1 K;  3J81 O;  4B3M K;  4AQY K;  5FLX O;  1XMQ K;  1XNQ K;  1I94 K;  1HNZ K;  4LF5 K;  4DR3 K;  4CW7 B;  4JI8 K;  1N36 K;  4JI5 K;  1XNR K;  2UUC K;  4CVN E;  4NXN K;  4DR2 K;  1IBM K;  2UU9 K;  4LFA K;  4LF9 K;  4DR4 K;  4JI4 K;  4DR5 K;  1HNW K;  5LL6 Z;  3J7A P;  4B3R K;  4JYA K;  1IBK K;  4DR6 K;  1FJG K;  4OX9 K;  1HNX K;  4V19 S;  4B3T K;  4K0K K;  2ZM6 K;  1N33 K;  4DV5 K;  4JI2 K;  4DR7 K;  2E5L K;  4JI6 K;  1IBL K;  1J5E K;  3T1H K;  5IT9 O;  4X62 K;  2UUA K;  5BR8 K;  4JI7 K;  2F4V K;  3J80 O;  3OTO K;  4X65 K;  5AJ3 K;  2UUB K;  4GKK K;  1XMO K;  4KHP K;  1HR0 K;  4JV5 K;  5IWA K;  2UXB K;  4DV7 K;  1N32 K;  2HHH K;  4NXM K;  2VQE K;  4JI3 K;  4YY3 K;  3JAM O;  4DV6 K;  2UXD K;  4DUY K;  4X64 K;  4JI0 K;  4DV0 K;  1N34 K;  3J7Y P;  4LF4 K;  4B3S K;  4DV3 K;  4DV1 K;  4LF8 K;  4LFB K;  2VQF K;  4DUZ K;  4GKJ K;  5LMN K;  5LMU K;  4LFC K;  4DV4 K;  4X66 K;  4LF6 K;  5A2Q O;  3T1Y K;  4DV2 K;  4DR1 K; 
#chains in the Genus database with same CATH topology
 2JLE A;  4W5T A;  3CJ7 A;  2A1S A;  1YI2 N;  3J81 O;  3IKM A;  4NYF A;  3WQU A;  3S3N A;  1YTA A;  2FBY A;  3RVC A;  5JLF A;  2D1K A;  3O9S A;  3NVM A;  4CEB A;  2QEX N;  1NWK A;  3ISN C;  4CHZ A;  3VGM A;  2FXU A;  3DLH A;  3SUO A;  1U2V B;  3R8E A;  3QEP A;  3IAY A;  4KTW A;  2HF3 A;  3AVK A;  2HBM A;  3G0Z A;  4BR7 A;  2E6M A;  2GEM A;  3GL1 A;  3HL8 A;  4ID1 A;  1W9H A;  4QS7 A;  1LWE A;  2F9T A;  3C7N A;  3HM8 A;  1RDB A;  1HX1 A;  4E3S A;  4BVP A;  4K0K K;  3SQ1 A;  1P90 A;  1BUP A;  2CGL A;  1RBV A;  2P9P B;  2IC3 A;  4PQU A;  1BO5 O;  3G10 A;  4CK3 A;  4AHV A;  4JKB A;  3M8P A;  1F21 A;  3VET A;  3OS2 A;  1BIZ A;  2OA8 A;  1O1W A;  3I8B A;  4OLA A;  1RDC A;  2CGK A;  5AJ3 K;  3RSE B;  4NCG A;  4EHT A;  1X3M A;  2HMP A;  4FK2 A;  2FBT A;  4JN4 A;  5C25 A;  3OYF A;  3MN6 A;  4B1X B;  3TAE A;  5AQI A;  2A5X A;  3CCR N;  4OO1 J;  5SWM A;  3NFA A;  5LJV A;  1BIU A;  4O55 A;  2X74 A;  1EXQ A;  4QS8 A;  1SL1 A;  3FE1 A;  5MLC Q;  1VSJ A;  3PSI A;  1S72 N;  2Q36 A;  1B92 A;  3CXC M;  3PLA A;  3OBY A;  4N5S A;  1SUQ A;  1RTJ A;  1QTM A;  4GVE A;  2A40 A;  4QS9 A;  2YJF A;  3V9Z A;  1GLE G;  3KK3 A;  4LF6 K;  4MLH A;  4DQ8 A;  1WSE A;  3L2W A;  4DMN A;  1VSL A;  1BCO A;  4CJ5 A;  4JI1 K;  1NGD A;  2XRI A;  3MMV A;  4FZZ A;  3CHW A;  1JKH A;  4AQY K;  1Z25 A;  3ENO A;  1SL0 A;  1DTT A;  3U9Z A;  5F0X A;  1N6Q A;  3WXJ A;  1I94 K;  3BGR A;  4DR3 K;  5GIN A;  1DT9 A;  3ZSY A;  3ZCM A;  1XNR K;  4J2E A;  3CG7 A;  4ISF A;  3NE6 A;  5M1Q A;  1K6Y A;  3EN9 A;  1JCE A;  2W41 A;  4M3T A;  4CZJ A;  3PX0 A;  2DY4 A;  3OVN A;  4DF4 A;  1KRP A;  3HVR A;  3ZX3 A;  2QW9 A;  5GAE P;  1RT3 A;  1NK6 A;  3T7Z A;  2O4G A;  2WON A;  1XC9 A;  1RFQ A;  3ITH A;  5CE3 A;  3HPH A;  1UA1 A;  1VSH A;  3VQP A;  3LAK A;  2BE2 A;  1OH7 A;  4KFB A;  1KLN A;  4H5N A;  1KAY A;  2E88 A;  4WQ4 A;  3D0P A;  1BI4 B;  4CJR A;  3QB0 A;  5M1K A;  1SKR A;  5BPL A;  1KLM A;  1NGI A;  4H0X B;  1IBL K;  3B8A X;  4FWN A;  3O9T A;  2V52 B;  3BF3 A;  4X62 K;  1KC8 O;  1NJY A;  3DAW A;  4CED A;  4KHQ A;  3HT3 A;  4H4O A;  5HRP A;  2EHG A;  2CH6 A;  1ZC6 A;  3IG1 A;  4BAC A;  3OYB A;  4GKK K;  2FC0 A;  3Q7B A;  4CZE A;  5D3G A;  2D4W A;  2NZT A;  1K73 O;  4DSI A;  2HOE A;  4QAG A;  3OYE A;  4H5V A;  4IWV A;  4G9Z A;  1L3U A;  3MK6 A;  3ZT2 A;  1KSP A;  4B3O A;  1RT4 A;  3OBW A;  2HBK A;  2ZJP L;  3PO4 A;  4OKJ A;  3V1O A;  4CZF A;  4DV4 K;  3F9M A;  3CYM A;  3I55 N;  4CFB A;  1TKD A;  1JLQ A;  3AA4 A;  1NJW A;  2PYL A;  4FJK A;  1GOA A;  1TV6 A;  1ATN A;  3L3V A;  3HPO A;  3WNH A;  3CPE A;  3OYD A;  1XWL A;  1YJW N;  4FZY A;  1S9E A;  4KI4 A;  4A62 A;  1LWF A;  4HTL A;  2NRR A;  3TSU A;  1VAZ A;  1J5O A;  2RE2 A;  2KZZ A;  1WN7 A;  3TTC A;  1VQK N;  4IBN A;  4YOU A;  3ZEU A;  2YNF A;  3SV4 A;  3LDP A;  3RRG A;  4CJF A;  1LAV A;  3LPT A;  3CQ8 A;  1Q18 A;  1NG9 A;  4O5B A;  3OS1 A;  5KRT A;  3V4I A;  4BRH A;  3P31 A;  5JVH L;  4R5P A;  3CME N;  1YVN A;  4IOC L;  4Y1D A;  2P9K B;  4LSL A;  2EX3 A;  4B9Q A;  1GLF O;  2G8I A;  3O4W A;  5HLF A;  1LCU A;  1RCH A;  4OPA A;  3DM2 A;  5HP1 A;  4FXD A;  4CK1 A;  1FKP A;  4FWS A;  1L3T A;  4B1V A;  5AQV A;  3LDL A;  4EIA A;  4HCB A;  3FR0 A;  3QIO A;  4ISE A;  2VCP A;  3A2F A;  3LAN A;  3VA3 A;  4KHY A;  4E1N A;  4C1N K;  2UYT A;  4CI6 A;  4EZ9 A;  4E1M A;  5GAD P;  1WSH A;  3S3O A;  1N32 K;  4NXM K;  4YNQ A;  3QLH A;  1UAX A;  2YNI A;  3LP3 A;  1Q7Y O;  3CI5 A;  3HPG A;  4FSV A;  4PWD A;  3TPQ A;  2GX9 A;  1GLJ O;  3K5N A;  4BDP A;  1KVC A;  3PSF A;  3C6U A;  4DV3 K;  4DV1 K;  2QWR A;  3AVI A;  4CBW A;  3SK3 A;  5ADX H;  1VSE A;  3KHY A;  2E2Q A;  4AHU A;  3PO5 A;  4QOZ B;  2NRW A;  3NBP A;  2KQ2 A;  5LMU K;  4LFC K;  4JKH A;  2HBJ A;  1LOT B;  1SKS A;  1WAJ A;  4AHR A;  5J2M A;  4GV9 A;  3M3Z A;  1Q9X A;  2H3G X;  1RIL A;  3OJU A;  2UXC K;  1RBT A;  1S5J A;  4CEO A;  5FPE A;  3C0B A;  3AVC A;  5AZJ B;  4CJP A;  4B9S A;  4IDK A;  4CIF A;  2FBX A;  4FJG A;  1S9G A;  5E26 A;  3U6F A;  3SQ2 A;  4FLW A;  3VQ8 A;  3NF9 A;  1N36 K;  1EX4 A;  1YT3 A;  3E9P A;  4JD2 A;  2LSN A;  1TAU A;  2HBL A;  1TKX A;  1W2B M;  5EX5 A;  5AZI B;  3KK1 A;  1DTQ A;  3DLE A;  3GOI A;  3ZLJ A;  4XH1 A;  5KQD A;  3W0L A;  4PKG A;  2OZM A;  4PKH A;  4M7X A;  4F2R A;  4B3R K;  3DLG A;  3OYM A;  1FJG K;  1V4T A;  1D4X A;  1K8K A;  3DLB A;  2QI2 A;  4J2D A;  4C1N I;  1GLC G;  2ZM6 K;  1WSF A;  4M3U A;  4BRO A;  5CY4 A;  3NH2 A;  2NRX A;  1BGX T;  3U3G A;  2OPP A;  3M6G A;  4HHT A;  1HPZ A;  3IRX A;  1JXE A;  5M1F A;  2QXF A;  3CCV N;  5EVZ A;  2JWL A;  3R6M A;  1K8A O;  4IJN A;  3DOK A;  4CZH A;  4WFA L;  2QA4 N;  1ZXO A;  3ZX0 A;  1KXP A;  3TAN A;  5BPM A;  4JV5 K;  1Y97 A;  2OYQ A;  4IFV A;  1WSG A;  1NOZ A;  4YDU C;  1D5A A;  3L3U A;  3CFR A;  4FL9 A;  2P9S B;  1YHQ N;  1QHT A;  4DSL A;  3OYA A;  2ITG A;  3DLK A;  3CC2 N;  3VA0 A;  4RTF D;  3O6W A;  5BRE A;  1ASV A;  3IUC A;  4PUO A;  5BN9 A;  3AO3 A;  4BR0 A;  3SNN A;  4I9L A;  4M63 C;  4ELU A;  1QSS A;  4GKJ K;  4FW2 A;  5DM7 L;  2NLX A;  5LMN K;  1B9F A;  3TU5 A;  3LP0 A;  4H0P A;  4CF1 A;  2DTU A;  3LZJ A;  4QCL A;  3CC7 N;  3LP1 A;  1VSK A;  2VG6 A;  4CEQ A;  3BZK A;  1MU2 A;  1EWR A;  5B8H A;  4B3M K;  4BRF A;  1RBS A;  3PX4 A;  2G8V A;  1W0H A;  3THX A;  1D9D A;  4LF5 K;  1GLA G;  4WF9 L;  3SUP A;  3WEE A;  4FVU A;  3WQT A;  1BDG A;  2UUC K;  2HNZ A;  4IZ9 A;  4BRD A;  2WTU A;  1S1V A;  3O3G A;  2XY6 A;  4OKK A;  4BRM A;  4BQL A;  3ZT4 A;  4KRF A;  3WT0 A;  1TUU A;  1LWC A;  1CZA N;  1NGJ A;  4K41 A;  1L5U A;  1K9M O;  1IBK K;  1LW2 A;  4DTS A;  3CCU N;  3PV8 A;  4OX9 K;  1ASW A;  4CGD A;  4YOV A;  4HVJ A;  3G4S N;  1HYS A;  1C1B A;  4BGB A;  5KI6 A;  1N33 K;  4FWM A;  1W97 L;  5CR4 A;  2QWL A;  1BU6 O;  2ZE2 A;  1YTU A;  3UKU B;  3T1H K;  4C8L A;  4A57 A;  2E2N A;  3VQD A;  5IT9 O;  3C6T A;  4CJE A;  3I0R A;  4OVL A;  4R79 A;  1C0U A;  4FO0 A;  4BQZ A;  3L2V A;  5AQK A;  4N56 A;  3RMD A;  1QZ5 A;  1EP4 A;  1JLF A;  5AQT A;  3WNG A;  3ULE B;  5KGX A;  2GUI A;  3T19 A;  4Z4C A;  3AVL A;  3FZL A;  4JKG A;  4BVO A;  2IVN A;  4DV7 K;  3OYH A;  1DGK N;  3O80 A;  5HRS A;  2RHK A;  1XQS C;  4B9T A;  2ZJQ L;  3QBW A;  2A6A A;  3LWM A;  4FCY A;  2QWM A;  1TYQ B;  1X9J A;  4X64 K;  1C0M A;  1VSD A;  4FWP A;  4DV0 K;  3AY9 A;  3OYG A;  4O0I A;  4PL8 A;  3NH0 A;  2BAN A;  1U47 A;  1JLE A;  2E1Z A;  5FRN A;  5TKW A;  4HCC A;  3LAM A;  3SPZ A;  1RT6 A;  2WOM A;  1QVF M;  3QFP A;  3KJV A;  2P5O A;  4CGH A;  4M42 A;  3DXK A;  4CHQ A;  5DM6 L;  5LJW A;  4FOI A;  4I9Q A;  1T8E A;  1RTH A;  4H0V B;  1VRU A;  3IMX A;  3E01 A;  4B9M A;  3WNF A;  3LM9 A;  3K2P A;  3UKR B;  4GV6 A;  2O8D A;  4JI8 K;  4CJK A;  3HVT A;  2ZJR L;  3K5O A;  2PBD A;  4CBX A;  2UU9 K;  3H45 C;  3C94 A;  5KRS A;  3V1Q A;  1KAZ A;  5M1O A;  1TKT A;  4IG3 A;  3VMF B;  1QSL A;  2OTJ N;  1HKC A;  4KB1 A;  3LPU A;  3AAR A;  2QXL A;  3KKS A;  3HRG A;  3CJ9 A;  3K9K A;  4V19 S;  1Z05 A;  3JXU A;  3MXI A;  5AFU H;  4KH6 A;  5DK5 A;  4A2A A;  5C12 A;  2W40 A;  1OVY A;  3D2E A;  2G8F A;  3QIN A;  2HVI A;  4DQI A;  3FZM A;  2F4V K;  1OKJ A;  2O8B A;  4E7L A;  3O4Q A;  4K8X A;  1HLU A;  1S1T A;  5BRF A;  4EZ6 A;  3MCA B;  4H5W A;  4YOT A;  4DQS A;  1KD1 O;  2I7N A;  4WQ4 C;  4G1Q A;  4IEI A;  1BA0 A;  2A3Z A;  2A42 A;  4IFY A;  4JK7 A;  1A5V A;  2AA4 A;  2NUB A;  4DB3 A;  5AQR A;  1C6V A;  4FLX A;  3S41 A;  3QES A;  3WXM B;  1NK0 A;  4BR9 A;  3V9S A;  3H6E A;  2HF4 A;  3VEV A;  1UWB A;  1KCF A;  4CFD A;  4KV8 A;  4CGG A;  2ASO A;  4BWJ A;  4JK8 A;  1LW0 A;  3TAR A;  4DFJ A;  2VQF K;  3L8B A;  1SZ2 A;  1BHL A;  3THY B;  1T7P A;  1WOQ A;  1HQU A;  1NOY A;  4OGC A;  3LWL A;  4E0D A;  2E6L A;  5C0Y A;  5T7B A;  1WBB A;  4BRA A;  1Q9Y A;  3ULD A;  4I7F A;  3VGK A;  1ASU A;  4J2A A;  3U8X A;  2Q0R A;  2WFB A;  3CMA N;  1S6P A;  3VOV A;  3HYF A;  4ILH A;  1FK9 A;  2O4I A;  2HMI A;  4FJ8 A;  2E1Y A;  1YUW A;  2O8C B;  3GDQ A;  3CJ1 A;  2PY5 A;  3HI0 A;  3P83 D;  4ZTF A;  2CGJ A;  3L4I A;  3VER A;  2DFH A;  3RMA A;  4B9N A;  4DLG A;  1C0F A;  2Q31 A;  3TAQ A;  4O0J A;  1R59 O;  5AQQ A;  2P9L A;  4NLB A;  5TKY A;  4IG0 A;  3QNN A;  1KTQ A;  1BOT O;  4I6M B;  3IS9 A;  1L3S A;  3MEG A;  4GW6 A;  4RG8 A;  3MN7 A;  1TL3 A;  1YIT N;  3V9W A;  1YJ9 N;  5AQF A;  3CPW M;  1U6Z A;  1I39 A;  4OPK A;  3E1Y A;  4FJ7 A;  1J5E K;  3CCS N;  4K25 A;  4DU4 A;  1KFD A;  1RDA A;  4FJH A;  1VQP N;  1BQN A;  3ZT0 A;  3V9X A;  3SBT A;  2UUB K;  3ZX2 A;  2E20 A;  4FWL A;  2HHQ A;  2YHY A;  2YJE A;  3H3N O;  3IDH A;  3AA3 A;  4F3T A;  4JAX A;  4C8O A;  5I42 A;  2KFZ A;  2YV0 X;  3ZSW A;  4FLT A;  3AGK A;  2P9N A;  3DWL A;  2YHB A;  1U45 A;  4DSJ A;  5C2D A;  1M1K O;  5ELZ A;  4MLE A;  4KPY A;  1RT1 A;  3KZB A;  3SAG A;  4JS4 A;  4CJW A;  2QM1 A;  3VTI A;  2D5R A;  1C1C A;  3NAE A;  2BTF A;  4CD3 A;  2IGI A;  4IJA A;  4JHD A;  3NCI A;  5M1P A;  1Q86 O;  4CJL A;  1VRT A;  2QWP A;  4YOX A;  2W42 A;  4BR4 A;  2O8E B;  1C1A A;  3N4Q A;  2HHV A;  4NCB A;  3TAG A;  4C8N A;  4I2Q A;  1OH5 A;  3H46 O;  3KD1 E;  1NNE A;  3SYZ A;  1WAF A;  4I2P A;  4BR5 A;  2B4J A;  3A5N C;  4JEP A;  3ZT3 A;  4NXN K;  5FRM A;  4CZM A;  4YOW A;  4KKO A;  1RTD A;  4LF9 K;  1WSJ A;  5AR0 A;  4O8U A;  3R3L A;  5LL6 Z;  2ITM A;  1ESV A;  1T3V A;  4CF0 A;  1WNS A;  4KTZ A;  3SUQ A;  1VQ8 N;  4DR6 K;  2O8F A;  3QET A;  2CH5 A;  2E2P A;  3CD6 N;  4W5O A;  3DOL A;  3AAQ A;  4FWK A;  3SJJ A;  2V7Y A;  3OYC A;  4BR2 A;  4FJL A;  4ILG B;  4NO7 A;  1ZBF A;  3NHG A;  4BE1 A;  3THW A;  3LDS A;  4RW9 A;  5I3U A;  4H8K A;  3CJB A;  2HW3 A;  2GWJ A;  4E1J A;  2F8T A;  4AHT A;  3HM9 A;  4FWR A;  3ID6 A;  3C7N B;  5CYQ A;  4IKF A;  4A5B A;  1X9S A;  4K8Z A;  3DRR A;  1EQY A;  4JLH A;  5BR9 A;  4PY5 A;  4JRQ A;  1NK8 A;  3U9D A;  5AQU A;  4BRL A;  4NCA A;  4CIE A;  5M1N A;  3DXM A;  4RW6 A;  4DUY K;  5JLH A;  4LH4 A;  3VEN A;  4JKD A;  2JWK A;  2P9U A;  4FLY A;  2FSN A;  2FBV A;  4H5T A;  4W5R A;  1NK5 A;  4DUZ K;  3SQ0 A;  4B1Y B;  4FPB A;  5GAG P;  1RNH A;  3CIP A;  2ASP A;  4L8R B;  1QQC A;  5A2Q O;  4FJ9 A;  3ZT1 A;  1VQ9 N;  3PUF A;  2ZWH A;  4Q0B A;  3I8D A;  3DRS A;  4DU1 A;  4EHU A;  2OZS A;  3VF4 A;  4ZHR A;  1HNZ K;  2KFN A;  3OS0 A;  3QFU A;  3K58 A;  3J7Z O;  4JI5 K;  3DMJ A;  1NJI O;  1Z26 A;  3A8Y A;  2VG7 A;  3DJC A;  2HHU A;  2HNY A;  4PKI A;  3NF8 A;  4RW7 A;  1OH6 A;  2HHW A;  4FJ5 A;  4CZI A;  2F8S A;  4WFB L;  1MWK A;  4IDH A;  2BH1 A;  4MDB A;  4BE2 A;  2G8H A;  4Y1C A;  4Z4H A;  3K9J A;  4FJN A;  2IAJ A;  2RKI A;  4FJM A;  1CXQ A;  4Z0U A;  3FFI A;  1E4G T;  4GV3 A;  4FZX C;  4BC4 A;  4CCH A;  4J8F A;  3KK2 A;  4KTQ A;  3D2F A;  5JIC A;  3H1Q A;  1RBU A;  3PIO L;  3FGU A;  4U67 L;  3RMC A;  3CJC A;  4M7Y A;  1TVR A;  4CHO A;  4BRI A;  3MWP A;  4E19 A;  3VQ7 A;  4FJX A;  3ZET A;  1IV0 A;  3M1F A;  1EO1 A;  1HJO A;  4IXC A;  2RN2 A;  1NLV A;  4M41 A;  3TAM A;  1BWF O;  2XO7 A;  3A0I X;  1JL1 A;  1Q8I A;  1A5W A;  3NF6 A;  1JCF A;  4N47 A;  3SLC A;  5AQM A;  3OTO K;  3F9K A;  2P9I A;  1YAG A;  1YVU A;  2HND A;  4J2B A;  2IIR A;  4CGF A;  4CJS A;  3VEY A;  2QWQ A;  4CF2 A;  4M45 A;  3MDQ A;  3MX2 A;  3O08 A;  1Q82 O;  1T44 A;  2RPI A;  4JI3 K;  4XH4 A;  4Z94 A;  3VQC A;  4CJV A;  4DSF A;  4FLZ A;  2Z1J A;  3L2Q A;  3RMB A;  5AQZ A;  3AVN A;  3BUZ B;  1RDD A;  2Y1I A;  4RW8 A;  3BP8 A;  5C24 A;  4LFB K;  2D0P A;  3NGZ A;  4N41 A;  2XY8 A;  5AQO A;  3VEW A;  1VSI A;  3FZH A;  3SZ2 A;  3T3F A;  1U2V A;  4BC3 A;  1NGB A;  4WFN L;  4WCE L;  1RGI A;  3LM2 A;  4WQ5 C;  4CEC A;  4BC2 A;  4DV2 K;  1U49 A;  1ZBL A;  1J54 A;  2ZGY A;  4JKE A;  4OKE A;  2NNW A;  3R1X A;  2BUP A;  3TSP A;  3SCX A;  1U4B A;  3L6Q A;  3I0S A;  1D8Y A;  2JGU A;  3SJH A;  3VQA A;  2P9P A;  2Z1I A;  1FW6 A;  4KRE A;  5AQS A;  4CHY A;  2YHA A;  3O9Q A;  3TWH A;  2GUP A;  1HNW K;  1Q81 O;  1S1U A;  3E9O A;  1VQM N;  3P1G A;  3RSE A;  4CHP A;  4BE0 A;  3VF2 A;  4BRP A;  1RTI A;  4UY8 O;  5AQL A;  4BRE A;  3C95 A;  1TKZ A;  4H4M A;  2GEL A;  1IO2 A;  1XHZ A;  3TTF A;  4CF8 A;  4HUE A;  3HZ6 A;  3OYK A;  2GBZ A;  3RWU A;  2B5J A;  3O5B A;  5ADX A;  1TGO A;  3ATU A;  4BG9 A;  3E9L A;  3SQ4 A;  4YOR A;  3QBX A;  2E5L K;  1NGF A;  4KI6 A;  4B1W B;  4B1Z A;  3KLF A;  4CE9 A;  4H0O A;  4IO9 L;  1HPM A;  4FWQ A;  2VWJ A;  2G8U A;  4DS4 A;  4JI7 K;  4GMJ B;  5LY3 A;  3NF7 A;  4KBO A;  2R7Y A;  4DTM A;  2IS3 A;  3P39 A;  4CJU A;  3MED A;  3ZEU B;  1RT5 A;  1NGG A;  1XHX A;  5SZT A;  2VYP A;  3CM5 A;  4BRK A;  4OLB A;  5IWA K;  3VPZ A;  3ZSO A;  2YKN A;  3NDK A;  3UIQ A;  2XY7 A;  3CQY A;  5C10 A;  1M90 O;  3NVK A;  4HWI A;  3VN5 A;  1R0A A;  3ENB A;  4XEI A;  1J6Z A;  3QER A;  3V81 A;  2DFE A;  3ZSX A;  3HP6 A;  2WBN A;  1REV A;  4LF8 K;  3GBT A;  5EOY A;  3MEC A;  4O8K A;  4ELT A;  5CZ2 A;  4F3O A;  4EAH D;  3D6R A;  1GLD G;  4DTJ A;  4EP4 A;  3V6D A;  4MDA A;  1SS6 A;  4DFP A;  3T1Y K;  4IOA L;  1BIS A;  3LDO A;  4YHH K;  2QTD A;  3FFK B;  4FPA A;  5KPZ A;  1NK4 A;  4CFA A;  1DLO A;  2VGM A;  4DS5 A;  3MCP A;  3I33 A;  3KLG A;  1G15 A;  4GY2 B;  2EWS A;  2Z1G A;  1BI4 A;  4CJT A;  4A5A A;  4KHW A;  3KLI A;  3CER A;  3O9U A;  3VGL A;  3DLR A;  3QML A;  1VQ4 N;  2ETJ A;  4YDU A;  3BEX A;  3JSM A;  3EKU A;  2YHX A;  1TK0 A;  1ZBH A;  3NMU A;  3VQ4 A;  1HJR A;  3T1A A;  3K5M A;  1YJN N;  3KLE A;  3HJF A;  1X3N A;  5KPR A;  4BGA A;  3AO4 A;  4CK2 A;  4JK9 A;  3K59 A;  5KPT A;  5FDL A;  4BRQ A;  4DR7 K;  3E66 A;  4JD2 B;  2Y1J A;  2G8K A;  2NRV A;  3HP9 A;  4E7H A;  3OYL A;  2YNH A;  1ATS A;  3KKR A;  5AQY A;  4DSK A;  2HHS A;  3VES A;  4DHY A;  3IFR A;  1VQ7 N;  5JS2 A;  3PX6 A;  3BF1 A;  3HBT A;  1VHX A;  4ICL A;  1K8K B;  4ILJ A;  1L3V A;  3U3Y A;  4AIL C;  1QZ6 A;  4H0T B;  3O3H A;  3L2R A;  3K0S A;  3AA2 A;  3SAF A;  2HHX A;  3VTH A;  3UE5 A;  3QEI A;  3CJA A;  4CHN A;  3ZSZ A;  4MFB A;  2QKB A;  1HKG A;  4H0Y B;  4RW4 A;  3QEV A;  1LV5 A;  5JMV A;  1BQM A;  3S3M A;  3L4Q A;  1FXX A;  5I9E B;  1ZYQ A;  3G71 N;  4PL7 A;  4E7K A;  5F1X A;  1GLB G;  3F2K A;  3JS6 A;  1EWQ A;  2I7P A;  1HMV A;  3SUN A;  2FSK A;  2B6A A;  4H5R A;  1G99 A;  2AP1 A;  4O4G A;  2ZGZ A;  2Q1N A;  3DLL L;  4DR1 K;  3ASM A;  4IOX A;  2YCH A;  5C42 A;  4FK4 A;  2P1J A;  2KZM A;  3HOT A;  1H1V A;  1S3X A;  3KD5 E;  5FLX O;  1XNQ K;  1IKV A;  4IEE A;  4DG1 A;  4IFE A;  2P9K A;  2P51 A;  1VQO N;  1ZBU A;  4UQG A;  4C23 A;  4WE1 A;  1NJZ A;  3VEZ A;  4FLU A;  2ZF5 O;  5AQH A;  2VG5 A;  3G6E N;  1IBM K;  5C15 A;  1T6C A;  1TUY A;  1YXQ A;  1KAX A;  4JNE A;  3EKS A;  3QIP A;  1MDU B;  4LC9 B;  3K5L A;  5HBM A;  1T03 A;  1SQK A;  2Q97 A;  1JLC A;  3THX B;  3OY9 A;  4Y0W A;  3ZYY X;  1JL2 A;  3QO9 A;  4DQR A;  4W5Q A;  1NKB A;  1WUA A;  3WEE B;  4DTR A;  4OPH A;  1Y64 A;  1NGH A;  4CES A;  4NYN A;  3J8A A;  3P4I A;  4MO5 A;  1ATR A;  1O13 A;  1X9M A;  3O1B A;  1GOB A;  4F8R A;  3KWI A;  5KTQ A;  4CF9 A;  3MEE A;  1VQN N;  4X65 K;  5EXW A;  2HVH A;  3MN9 A;  4DFK A;  4LSN A;  2X6N A;  3AO5 A;  3OW2 M;  3NH1 A;  4MQ3 A;  2XY5 A;  3ENH A;  2ASM A;  2HB5 A;  2HHH K;  1QQM A;  3TR8 A;  3C6H A;  3H3O B;  5AZJ A;  4B9U A;  4CFC A;  4YY3 K;  4CEA A;  4DCH A;  2KTQ A;  1HNI A;  4FLV A;  4DV6 K;  4NLC A;  2FLO A;  2HHT A;  1QS4 A;  1NGA A;  5C2F A;  2P5G A;  3KK7 A;  4B3S K;  3LAL A;  1BCM A;  2PFU A;  3LL3 A;  3V1R A;  4CZL A;  3AVJ A;  3EL2 A;  4XH5 A;  5AFU A;  5AZI A;  3OA9 A;  3G25 A;  3W3D A;  2KLA A;  1JJ2 M;  4E7I A;  4X66 K;  1NJX A;  1XC3 A;  1QVG M;  5E84 A;  1I3A A;  4B8A B;  4KHS A;  4JKG B;  1NMD A;  4Z4I A;  2D0C A;  3RR7 A;  1JLA A;  2ATQ A;  2OCE A;  3CCJ N;  1JLB A;  1IKY A;  2F7T A;  2E8A A;  3EYZ A;  1WB9 A;  1JCG A;  5FPN A;  1C0G A;  3H08 A;  3AAP A;  3P5J A;  1TK8 A;  3O1W A;  3LZI A;  4CW7 B;  4CEZ A;  3M8S A;  3EZW A;  2OPS A;  1HYV A;  5HRN A;  2YHW A;  4HTU A;  4CEF A;  5JVG L;  4BC5 A;  2NRH A;  1E4F T;  2W6K A;  1HUX A;  4MO4 A;  4DR5 K;  4FM2 A;  2YKM A;  3RTV A;  4ELV A;  3DXK B;  3ATV A;  4DKW A;  4CJ3 A;  5DMR A;  1NM1 A;  1VQL N;  1C0T A;  4HUG A;  5AQN A;  4B3T K;  2KW4 A;  4AHC A;  4CER A;  3LDQ A;  2D0B A;  1TK5 A;  3DYA A;  4A61 A;  4DV5 K;  1XUP O;  4CZG A;  3QDK A;  2O8D B;  4B9V A;  2P9S A;  1ZBS A;  3UB5 A;  3HO1 A;  1QE1 A;  5HOO A;  4KHU A;  5KQ8 A;  3D45 A;  1V4S A;  5GIO A;  1N5Y A;  1QQO A;  1D9F A;  3S9H A;  1J53 A;  4C8K A;  1OVQ A;  1EET A;  4BRN A;  1VQ6 N;  2FSJ A;  3VQE A;  3RR8 A;  4YFU A;  4L3Q A;  4B08 A;  4BG8 A;  4FWO A;  5H1S Q;  4M3X A;  1HR0 K;  1HQE A;  4KB0 A;  3AV9 A;  3SMS A;  4K43 A;  1NGC A;  1GLL O;  2UXB K;  2A1R A;  1NBW A;  3MX5 A;  1CZB A;  4CZK A;  2PZS A;  2E2O A;  3AVA A;  3D2E B;  1RDU A;  3OJS A;  3EY1 A;  5GAH P;  2D0A A;  4FM1 A;  2O8B B;  1T6D A;  4KAZ A;  4RCH A;  2VWB A;  3N4P A;  3THV A;  1MA9 B;  3SAH A;  3HOS A;  3KVG A;  1S1W A;  4AH9 A;  3CM6 A;  4Q5V A;  1P8Z A;  3HSC A;  5JS1 A;  4F2S A;  4CGJ A;  1MWM A;  1IJJ A;  2FF6 A;  2KKZ A;  1HRH A;  4PA1 A;  3VEO A;  2V7Z A;  3DI6 A;  1NU0 A;  4BDZ A;  2HST A;  3CCM N;  1XMQ K;  1WLJ A;  2X78 A;  4FVM A;  1NK9 A;  4DTX A;  4W5N A;  3M8Q A;  5CZ1 A;  4DSE A;  4CEE A;  3MXJ A;  4GVM A;  4OJR A;  3ZSQ A;  1UA0 A;  5HRO A;  3UKU A;  3AO2 A;  3WXK A;  2PYJ A;  3QEX A;  1J9A A;  3HXM A;  4DR4 K;  3PIP L;  3AVF A;  4JI4 K;  1GOC A;  4IO8 A;  5AQW A;  3OYJ A;  4CBU A;  1JLG A;  4BWM A;  3J7A P;  3ULE A;  1BA1 A;  2Z1H A;  3BZC A;  4H03 B;  1Z6R A;  2GWK A;  4OPJ A;  3M5R A;  2V51 B;  3WXI A;  4BRC A;  3VQQ A;  4NB4 A;  4C8M A;  1ZBI A;  4JI2 K;  2RF2 A;  1U48 A;  4ID5 A;  2Q2R A;  1KQS M;  3VQ9 A;  1TYQ A;  4O5F A;  2F9W A;  2IVP A;  5J2P A;  1ILY A;  3CFO A;  1NMN A;  5BPN A;  5J1E A;  1CXU A;  1IH7 A;  2NRZ A;  1YF5 L;  2P9L B;  3EE8 A;  4FYD A;  1XMO K;  3Q7C A;  1SV5 A;  4EFH A;  3P38 A;  5J2Q A;  2GV9 A;  4YOY A;  2J4R A;  3NGY A;  3HK2 A;  4Z4G A;  3F73 A;  1RBR A;  3M8R A;  1CLQ A;  3JYT A;  1U04 A;  3EEQ A;  1KVB A;  1S22 A;  4JI0 K;  2QWO A;  2VWK A;  3UKR A;  4N76 A;  1IG8 A;  4FK0 A;  1HKB A;  4WYB A;  1VSF A;  2E4L A;  2Q3S A;  2AJQ A;  2ZQB A;  1A5X A;  4BRG A;  3CQX A;  4A59 A;  2IOC A;  4M3Y A;  1S6Q A;  1E3M A;  5GIP A;  4A2B A;  4RWT A;  3FZF A;  1VQ5 N;  3AA5 X;  3AVH A;  4LF7 K;  3O9R A;  3GG4 A;  2QWN A;  3WNE A;  2DPN A;  4JKF A;  1NK7 A;  5F2R A;  2P9N B;  4DTO A;  1VSM A;  4FM0 A;  3D7E O;  2F96 A;  5BN8 A;  3K57 A;  4DR2 K;  2D0O A;  3LDN A;  1QSY A;  2WC9 A;  2PAV A;  3SPY A;  4LFA K;  4AM7 A;  3SI6 A;  3A5O C;  3KLH A;  2A41 A;  3SBG A;  5AQG A;  2G8W A;  5KGW A;  2W6L A;  3B6O A;  4JHD B;  1RT2 A;  1S1X A;  1QHA A;  4M3R A;  2ZD1 A;  5FPM A;  4PHT X;  3KWG A;  4LD0 A;  3OHR A;  3ID8 A;  2NRT A;  3WXL A;  1EKE A;  3TSQ A;  4DLE A;  4DTN A;  3EZ5 A;  3KTQ A;  3EE9 A;  3SMP A;  1RDW X;  3A5M C;  1BL3 A;  2YI1 A;  4DWI A;  3WUH A;  1HNV A;  4FOE A;  4M3W A;  3RRH A;  2UUA K;  4Z4E A;  1HYZ A;  4GNI A;  3DRP A;  1SL2 A;  3THY A;  4LY7 A;  1FKO A;  1BG3 A;  2O8F B;  1KVA A;  4M3Z A;  2XHB A;  3CCL N;  4E89 A;  3T69 A;  2VQE K;  4FJI A;  4AHS A;  4FW1 A;  3JAM O;  3TTD A;  4DU3 A;  2UXD K;  3SV3 A;  3F5T A;  4OGE A;  1N34 K;  1X1P A;  1TAQ A;  3B6P A;  3J7Y P;  1QQN A;  4CJ7 A;  4LF4 K;  1B9D A;  3THW B;  1NKE A;  1IKW A;  3FLC O;  5AQP A;  4F4K A;  1TL1 A;  2QKK A;  4B9L A;  5FRO A;  1OH8 A;  1XI1 A;  4KH4 A;  4DTP A;  3NGI A;  5HRR A;  4KHN A;  2O8C A;  4HUF A;  4E7J A;  5BRH A;  3HST B;  2X6S A;  1ITG A;  1WSI A;  1RT7 A;  3O3F A;  1YIJ N;  3R9P A;  3AO1 A;  4JKA A;  4B8C A;  3VF6 A;  1SKW A;  4DFM A;  4I6M A;  3DXM B;  3CCQ N;  3EO3 A;  3CFP A;  3GE1 A;  1CZ9 A;  2P9U B;  4EP5 A;  2GTD A;  4F9O A;  2VGN A;  1IKX A;  4CVN E;  3OYI A;  4KO0 A;  3VQ6 A;  2BDP A;  1IG9 A;  5EY4 A;  3MAQ A;  2IVO A;  3VQB A;  4TSX A;  3O8M A;  2WUS A;  4K42 A;  4AM6 A;  4JYA K;  2OPQ A;  3L0Q A;  4DQQ A;  5K14 A;  3KIO A;  3LP2 A;  3MWT A;  2I5J A;  1LAW A;  3QNO A;  4LH5 A;  1HNX K;  3ZSV A;  5BRD A;  3CF5 L;  4JRP A;  4DF8 A;  4BDY A;  1SAZ A;  3C65 A;  3AGR A;  3ZSR A;  3L2U A;  3MXM A;  4CIG A;  3PY8 A;  3QIC A;  4CD1 A;  1UOC A;  2DFF A;  3AVB A;  5AQJ A;  4JI6 K;  4JS5 A;  3CC4 N;  4Z4F A;  1DEJ A;  2BGG A;  4WQ5 A;  3QEW A;  1NKC A;  3V9U A;  5E41 A;  3TAP A;  4ZTJ A;  5BR8 K;  4O44 A;  3CCE N;  4B1U B;  4DTU A;  1DKG D;  1X9W A;  3J80 O;  4CJQ A;  1WBD A;  3TAB A;  3AVG A;  2YNG A;  3O4N A;  3I56 N;  5AQX A;  4DQP A;  2OTL N;  2Q0U A;  1N8R O;  3ALY A;  1W7A A;  3BDP A;  4KHP K;  3OYN A;  4CJ4 A;  3D2F B;  1VK0 A;  3H1V X;  5CYM A;  4XIU A;  4JKC A;  3HTV A;  3MN5 A;  3ZET B;  3BY5 A;  1JXB A;  3FZK A;  4FJJ A;  2O8E A;  1T05 A;  2QK9 A;  4BY9 C;  4AF1 A;  3A5L C;  3TAF A;  5EU7 A;  3AVM A;  2P9I B;  4U7B A;  4KH5 A;  1KFS A;  4CGI A;  5J2N A;  4ISG A;  5FPD A;  2OAN A;  5HL7 L;  1NGE A;  3VEX A;  3C6A A;  2YX6 A;  3U4L A;  5CHI A;  2IDO A;  3TI0 A;  2OPR A;  2FF3 B;  3CET A;  3VQ5 A;  2KHO A; 
#chains in the Genus database with same CATH homology
 2UXC K;  4YHH K;  4LF7 K;  4JI1 K;  3J81 O;  4B3M K;  4AQY K;  5FLX O;  1XMQ K;  1XNQ K;  1I94 K;  1HNZ K;  4LF5 K;  4DR3 K;  4CW7 B;  4JI8 K;  1N36 K;  4JI5 K;  1XNR K;  2UUC K;  4CVN E;  4NXN K;  4DR2 K;  1IBM K;  2UU9 K;  4LFA K;  4LF9 K;  4DR4 K;  4JI4 K;  4DR5 K;  1HNW K;  5LL6 Z;  3J7A P;  4B3R K;  4JYA K;  1IBK K;  4DR6 K;  1FJG K;  4OX9 K;  1HNX K;  4V19 S;  4B3T K;  4K0K K;  2ZM6 K;  1N33 K;  4DV5 K;  4JI2 K;  4DR7 K;  2E5L K;  4JI6 K;  1IBL K;  1J5E K;  3T1H K;  5IT9 O;  4X62 K;  2UUA K;  5BR8 K;  4JI7 K;  2F4V K;  3J80 O;  3OTO K;  4X65 K;  5AJ3 K;  2UUB K;  4GKK K;  1XMO K;  4KHP K;  1HR0 K;  4JV5 K;  5IWA K;  2UXB K;  4DV7 K;  1N32 K;  2HHH K;  4NXM K;  2VQE K;  4JI3 K;  4YY3 K;  3JAM O;  4DV6 K;  2UXD K;  4DUY K;  4X64 K;  4JI0 K;  4DV0 K;  1N34 K;  3J7Y P;  4LF4 K;  4B3S K;  4DV3 K;  4DV1 K;  4LF8 K;  4LFB K;  2VQF K;  4DUZ K;  4GKJ K;  5LMN K;  5LMU K;  4LFC K;  4DV4 K;  4X66 K;  4LF6 K;  5A2Q O;  3T1Y K;  4DV2 K;  4DR1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...