3KK1A

Hiv-1 reverse transcriptase-dna complex with nuceotide inhibitor gs-9148-diphosphate bound in nucleotide site
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
555
structure length
555
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 148
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk1A05
5KGXA 4O4RA 1BQMB 3V6KA 1N48A 4CJUA 2B6AA 3TAFA 1LV5A 3DI6B 3C6UA 3H59A 1IKXB 1JKHA 3H5SA 4W5TA 1S0NA 1J54A 4K4XA 2XGQA 4CF1A 4O3RA 3DRSB 4I2QB 1IKWA 2WOMB 4U7CA 1X9MA 4R5PA 2W9CB 2F8SA 1U47A 4ID5B 4Q43A 1TKXB 4RUAA 1KLNA 3PO4A 3D5MA 3VQ6A 1EP4A 2QK9A 4J2EA 2AGPA 3HPHA 1S0MA 2CJQA 4GC6A 4KHNA 1S1XA 2B6AB 2BE2A 4CEAA 1JKHB 4DS5A 4ZP7A 1RT1A 3KLGB 3AO2A 4PA1A 4FJ8A 2ASLA 2PYLA 2VG5A 3I5AA 5DLGA 4Y2AA 2E6MA 1ZBIA 2G8IA 3AV9A 1IKWB 3CDWA 5KG7A 3ZSYA 1GOCA 1RDAA 3AA5X 3LWMA 4R5PB 1JL2A 3QGGA 4KHQA 3OHBA 4NYFA 4ZVFA 3LAMA 3QIOA 3PHEA 4EP5A 1EP4B 3KIOA 4LQ9A 4PUOA 2HB5A 5L1KA 4NLYA 3N6NA 1C0TB 3AVBA 3HP9A 4K8XA 3TAEA 4E7HA 1S1XB 2BE2B 1BIUA 4ECZA 3C95A 3T1AA 4AHUA 1IG9A 3V1RA 1NKEA 4FLWA 4NYZA 4ID1A 2VG5B 5KFQA 3PJWA 3V4IA 4DFMA 1T7PA 4TYAA 1TL3A 4HCCA 4Y34A 1T05B 2V4RA 1DTTA 3OHAA 4NLDA 3PY8A 4FK4A 3VQ7A 4IFYA 4ZPDA 4PUOB 4KAIA 5DQGA 4C8NA 1S97A 4DQSA 1S9GA 1QE1A 3ZSRA 2W7OA 3RB0A 3U3YA 1RT3A 4FLZA 4RW7B 3S3NA 1HQUA 3Q8QB 4J9QA 4KTZA 4CHPA 5KFZA 1JLEA 1TL3B 4DTJA 2HMIA 4DLGA 1ZTTA 1RA7A 3IN5A 4E1MA 4TQRA 2GV9A 4CFDA 4C8OA 4KPYA 4IFYB 4J9PA 3NFAA 4KHSA 1S9GB 4EO6A 4YQWA 4K4TA 3CO9A 4K4YA 2XY7A 1LAVA 3HJFA 3KHLA 3SYZA 1NOZA 2BDPA 1K6YA 1HQUB 3VQDA 3FQLA 3TR8A 1R0AA 3ASMA 1C6VA 2Z1JA 3TAGA 2HHXA 3DRRA 2D0CA 3H08A 3AA2A 4LQ3A 1OS5A 4HUEA 2HMIB 4DSEA 2AGOA 5EWGA 3K5NA 4KB7A 4OPKA 3WNHA 4QOZB 1RAJA 3RRGA 4DTRA 3ZCMA 3NH2A 3KOAA 1L3VA 1S1TB 3QZ8A 1JXLA 3PZPA 4NLXA 2IA6A 4URGA 4W5NA 4J9NA 2R8KA 4TSXA 4FYDA 4IG0A 4Q44A 4OPJA 1VRUA 4O0JA 1DTQA 3LWLA 1BGXT 3I5CA 1UOCA 4QWEA 2HHUA 1LAWA 1TK8A 1TVRA 1RYSA 1ZTWA 4DU1A 1NJXA 3K57A 3PX6A 4LH5A 2VG6A 4LY7A 1NK9A 3L3UA 4OL8A 3O4QA 1JL1A 5J2QA 5KFSA 3L2UA 1KVAA 4CIGA 4KI6A 2KFZA 4AHVA 2Z1HA 4CEBA 4Y2CA 4F4YA 1YVUA 3TAMA 1S6PB 5KT4A 1GOAA 1EETA 2FVCA 3CYMA 4IG0B 3FRZA 1VRUB 1RBUA 3PW0A 4DSFA 2V0NA 4TY8A 4PY5A 3NBPA 1SL1A 2RKIA 3IGNA 3LZIA 1X9WA 3GIIA 5J2QB 1SH0A 3ZSXA 1SV5B 2YNGB 3O3GA 4DTPA 2BANB 3NH0A 5HRSA 3QEIA 3ZT0A 1S1UA 1VSJA 3JSMA 1N4LA 2W8LA 3LP0A 4DL7A 3V81B 2OZMA 3OYGA 4CJWA 4K4UA 2X78A 4UQGA 1QSYA 4TY8B 2IGIA 4QWCA 4MFBA 5I42A 3MR2A 1XHXA 2RKIB 3MFIA 4IQXA 1YT3A 4B9LA 4M42A 5SZTA 5D3GA 2ITGA 3AVKA 1KFDA 1I3AA 2YNIB 2YHAA 2ASDA 4HYKA 3OLBA 3SPYA 4M3WA 4ICLA 1CZ9A 2G8HA 3CJ5A 3L2QA 1RDDA 4RW9B 4B9UA 3A2FA 4K8ZA 4QWAA 1JLAA 3MFHA 1S1UB 3JSMB 2C22A 4L8RB 3LP0B 4DFJA 4FLTA 3NF6A 4N41A 4KAZA 4DQQA 4Z4EA 4MK8A 4RZRA 4RW4A 4Q8EA 5I42B 1CSJA 4CJEA 3VQQA 2R2UA 4CJSA 4FJ7A 3V6HA 4LSNA 1KVCA 2AX0A 4ICLB 2WK4A 2VG7B 1WNSA 2B5JA 4EZ9A 2RF2A 1SL2A 5KFIA 1VSLA 5L1JA 3BQ0A 3V1OA 5JXSA 3KK1A 5F8NA 5DMRA 1RTJB 4K4VA 3CWJA 3G6YA 3OJUA 3NCIA 3NHGA 3OYEA 5KTQA 5HP1B 1QUVA 4JUZA 1Q8IA 2OPPA 1NJWA 1WAJA 4TY9A 3ISNC 4NLUA 3OYFA 4CGFA 1LW0A 3H5XA 3AO4A 3V9UA 2Z1GA 4DG1B 1WNEA 4DTXA 4LSNB 3VQ4A 1T03B 4B08A 5KT3A 3TVKA 4FJKA 1KRPA 3M8PA 2ILYA 1GX6A 2B5JB 3QEVA 2G8FA 3V6JA 2FJXA 2UVVA 3S3OA 2RF2B 4URQU 3OYAA 4DTNA 4AH9A 3FQKA 3NGYA 4Q0BA 4CFCA 4IOBA 4IH6A 2ATLA 4F2SA 3MR6A 1YVFA 2RN2A 2OPPB 1JX4A 4B9NA 4M94A 4ED0A 1LW0B 5KFRA 5HROA 2QV6A 3CJ0A 3GV5B 4BWJA 4X2BA 3DLGB 4K4SA 1WSJA 3AVGA 1HNIB 3DYAA 3M8PB 3TANA 1RYRA 1NK8A 1WSFA 1RTDA 2WB4A 4PWDA 4BE0A 2JEGA 2QKBA 3SQ0A 5KFTA 3V6DA 2VWJA 2PYJA 2HWHA 3NF8A 4DSJA 3HO1A 5FRNA 3RMBA 3VN5A 2UVUA 1VSKA 5CZ1A 3V1QA 4B3OA 5KFFA 2FJVA 4FJIA 1NK7A 3MXJA 2YKNA 5HROB 1QSSA 1ASWA 3DMJA 2OYQA 5F8JA 2IJFA 3MEEB 2XY8A 5CY4A 3DYAB 5FDLA 3CVKA 5KT7A 3I0RA 1RTDB 1RT4A 1FXXA 4Z4CA 3HPGA 5KFVA 4H8KA 3QEPA 5E41A 4RUCA 2AQ4A 3V6DB 4ZMMA 2OPQB 4KB1A 3MEDB 2IM2A 4NLWA 4FW1A 4NYNA 1NJYA 2G8WA 4B3OB 5KFOA 3Q8RB 2D0AA 1FKOB 4Y1DA 4WZMA 4KTQA 2YKNB 4NLVA 3FDSA 3KLHA 3DMJB 3D0PA 2YV0X 1NHVA 1XR6A 1D9DA 3UPFA 2O4GA 5KFYA 5FDLB 1N5YB 2IC3A 4LH4A 1RT4B 3CFRA 3KLEA 3IRXA 4CJTA 5KFUA 3IG1A 3C6TB 1RCHA 5J2NA 4ECWA 4ZHRB 2JEFA 2HNYA 3QIDA 3VQCA 2BGGA 2FJWA 1DLOA 1B92A 4DU3A 1TAUA 4RNFA 4MK9A 4CEZA 5KRSA 4J9RA 1NNDA 5KFJA 3VQ9A 2D3UA 2W9BA 2ASJA 3B6PA 4CK1A 5T7BA 4E0DA 4N5SA 4E1NA 4OGEA 3PR5B 3CIZA 4EBCA 3MR3A 2IC3B 4ECQA 2ZQBA 3KLEB 4FBTA 2AX1A 3KTQA 4ZPAA 2D0BA 5J2NB 1W9HA 4DQRA 4CJRA 4KHWA 1JLBA 4HUGA 3TI0A 2Q3SA 4C8KA 2HNYB 1K1SA 3HVWA 4KHYA 1JLCA 2ZKUA 4OLAA 3LPTA 3OY9A 1RT6B 1XR5A 3C94A 4YP3A 4Z4HA 4ZP6A 4IR9A 1JIHA 5KFAA 5KG6A 4FVMA 1Q9YA 2W9BB 3GV7B 5CYMA 3LAKA 3ICLA 1ZBFA 4WZQA 3OYHA 1RA6A 4M41A 3C6UB 2FBVA 1IKVA 2O5DA 3E51A 1F21A 1HJRA 3AO5A 2VWKA 2C2RA 1BI4A 5DG9A 5JS2A 3AVCA 1JLCB 4ELTA 5KFEA 4EZ6A 3OYMA 1BQNA 3LPUA 1S9FA 3BR9A 5F8HA 4KFBA 4F3TA 4YMEA 2B4JA 4OLBA 3PW2A 3RMCA 5CYMB 3SQ2A 4WXOA 4ED6A 1I39A 4IDKA 1NOYA 2GIRA 4CHYA 4M3XA 4CGGA 4IH7A 3FSIA 3H2LA 3SUOA 3NDKA 5KG4A 5HRPA 2HHVA 2FC0A 1RT1B 4B9MA 3T5JA 1BI4B 4GW6A 4MH8A 4FLYA 2OPRA 1N6QA 4FJHA 5CYQA 3KK2A 4KHRA 1BQNB 4CCHA 3NGZA 3OS2A 4TQSA 3F9KA 3IS9A 4I9QA 2QXFA 4FK0A 4CECA 4DFPA 3HYFA 4O5BA 2JEIA 4KTWA 3G6XA 1L3TA 3DLBA 4MKBA 4CHNA 4ED8A 4CJ4A 2BRKA 3BQ1A 1CLQA 2E4LA 5J2MA 1CZBA 1VSFA 1IH7A 3ALYA 3OYKA 2YNFA 4I9LA 2OPRB 5KFLA 3NAIA 4R8UA 2CKWA 5FRMA 5CYQB 3V4IB 3KK2B 3SUNA 2A1RA 1EX4A 3OVNA 1DTTB 4K50A 2NUBA 3OYIA 4B8CA 3NH1A 4DL6A 4HKQA 2VA2A 2A1SA 1TP7A 3OYDA 3KD5E 2FLPA 4DSLA 1S48A 1QE1B 4CERA 4H54A 1RT3B 1JLFA 5J2MB 2IS3A 2XHBA 4CJQA 2KZZA 4JRQA 3V9SA 5C42A 2YNFB 3H98A 2KTQA 3RRHA 4R8UB 3S9HA 1I6JA 3TAPA 2R8IA 2P5GA 4AHCA 4FW2A 3VA0A 1JLEB 5EUHA 2FBYA 4DL2A 1S6QA 4E7IA 4DFKA 3KHHA 1MU2A 2QE5A 3JYTA 3AVLA 1RNHA 4OGCA 5L1IA 2HAIA 1JLFB 3QEWA 3CDEA 3PX4A 3V9XA 3SUPA 5C42B 1R0AB 4R0EA 4YR0A 3ZT3A 4DTOA 3QGHA 4G1QA 3K5OA 2D7SA 1GX5A 4ED2A 3DRRB 4E3SA 3CFOA 3KLVA 3M9NB 3KKRA 3NF9A 4Q8FA 3KLIA 4BWMA 3SJJA 1HYVA 1RT2A 1SUQA 3BSAA 2XWYA 1U4BA 4KRFA 4CHZA 2DY4A 1S6QB 1JXBA 3I0SA 4CJ5A 3EPGA 1MU2B 3UDLA 3JYTB 5J1EA 2AU0A 4YR3A 2UVRA 4NLQA 4FLVA 4RNOA 2FVSA 4ZVGA 2FBXA 2P1JA 4CEEA 3TAQA 3ULDA 1VSHA 1NHUA 2UVWA 5KFDA 4O4GA 2E6LA 4ED1A 1KHWA 1DTQB 3GIJA 4QWDA 3RB6A 4IFVA 5DGAA 1RT2B 1SUQB 3NGIA 1TVRB 4OVLA 2EHGA 4FJGA 3E01A 1D8YA 3I0SB 2VG6B 3AVNA 4MIBA 4RW8A 5J1EB 4OKKA 4CFAA 3LALA 3T19A 2IM0A 4CFBA 3M8RA 2W8KA 2XI3A 3TAMB 4E7KA 1KLMA 4BE1A 4O4GB 1EETB 3DLKA 4NLTA 1SH3A 2O4IA 1LWCA 3T5KA 2HVIA 3RR7A 4FZYA 2V9WA 4XO0A 4OKJA 3ZSOA 3NBPB 2BQUA 1QHTA 3E01B 2BR0A 3FFIA 4CEQA 4DLEA 2W7PA 4RW8B 1BHLA 4W5OA 4CHOA 3QLHA 4ZTJA 3SV4A 3TWHA 1ZYQA 3QETA 3PX0A 4KE5A 4JRPA 1BCOA 4IRCA 4WXWA 4IKFA 1C0UA 4URSA 1KLMB 1BCMA 3HPOA 5KGWA 3HXMA 4Z4GA 1C1CA 4Y3CA 2GUIA 2ZE2A 5I3UA 2FBTA 2X6NA 1LWCB 4FM0A 4LSLA 4OJRA 4TN2A 4CF8A 4QCLA 4MFBB 2IDOA 1JXEA 3VQ8A 5DQHA 2XRIA 1T94A 3L2VA 5D3GB 4OKEA 1VSDA 1ZBUA 1RBVA 4FLUA 3QERA 3DM2A 2YKMA 3VQBA 4CGDA 1SL0A 4I2PA 4FZXC 3QLHB 3H5UA 3AVMA 3PV8A 3GYNA 3H5YA 4B8AB 4HUFA 3CDUA 1YTUA 3HL8A 1JLAB 1HRHA 3AVFA 1QQCA 1HYSA 5KFGA 1C1CB 4JV2A 3BGRA 2IBKA 3MXIA 4NZ0A 1IKYA 3NAHA 4ZPCA 4LSLB 4PQUA 3M9OB 1XWLA 1Q9XA 4RW4B 3BSOA 3UQSA 3ZSZA 4CEFA 5HLFA 3QINA 2X74A 4JS5A 4GC7A 3BQ2A 2C2EA 3M9MB 1HPZA 2DFHA 4J9OA 2YKMB 3QIPA 4RW6A 3TARA 2ILZA 4I2PB 3OYNA 4CK3A 4RNNA 5C25A 1NK5A 1LW2A 1W25A 1EXQA 4ZVHA 1TL1A 4DF4A 4KHMA 5JUMA 1C1AA 5KFPA 3KLFA 3DLHA 3NE6A 3KK1B 3T5HA 2KZMA 5EWEA 4PQUB 1UA0A 2F96A 5KT6A 1JLQA 3CJ2A 1S4FA 3PVXA 3M8QA 3KHRA 4JV1A 5J2PA 2HHTA 4JLHA 4DSIA 2E9TA 3O3FA 3WNGA 1HPZB 4RW6B 3NL0A 3QIPB 4J2DA 3QEXA 1UWBA 3VA3A 4CF0A 1LW2B 4CGHA 3H40A 4J2AA 4K4WA 5HBMA 2XO7A 2XCPA 1TKTA 2XC9A 1G15A 4E89A 4J9KA 4EP4A 2JC1A 2HHQA 3MEGA 4Q0BB 3AVAA 3DLEA 1JLQB 3SUQA 5DG7A 5C24A 4EO8A 3M8QB 2OZSA 3U3GA 4CIFA 1W0HA 4FJJA 1MMLA 2G8UA 4DTSA 1KFSA 1RT5A 1UWBB 4DS4A 1T8EA 2Y1IA 4KB0A 4K4ZA 4PWDB 1RDBA 3ZSVA 2HNZA 5HBMB 1S0OA 2X6SA 1TKTB 2UUWA 3G86A 4FLXA 2ALZA 4KV8A 3G10A 3MEGB 4AHTA 3DOKA 3RWUA 3N6MA 4EBDA 1U49A 1L3SA 1XHZA 4WYWA 3VQSA 1XC9A 3HKWA 4QW8A 1D5AA 1ZBLA 1X9SA 3N6LA 4O3SA 4NCGA 4KBIA 5KG5A 2HWIA 4J9MA 1Z26A 4B9SA 3EZ5A 4Q5VA 4O3PA 3HT3A 4J9SA 4F4KA 3I0RB 3BREA 4H4MA 1VK0A 3OS1A 4F4XA 2HNZB 3LP2A 4CJFA 2FVRA 3ZT1A 4CEDA 4MIAA 4F4ZA 4KV8B 1RTIA 2RDJA 3B6OA 3DOKB 3CM6A 1T3NA 2J6UA 3KMSA 3QYYA 4CK2A 3OYLA 1RDRA 3BJYA 2DPIA 4E19A 2XCAA 4NCGB 3MTKA 3LP1A 2JC0A 3KLHB 3I5BA 3SFUA 1FKPA 1D0EA 4H4MB 3DRSA 4I2QA 2D41A 1C1BA 4YR2A 4FJ5A 3LP2B 3IRXB 2C2DA 5DQIA 5KFCA 4EEYA 3OSPA 3IG1B 3NGDA 2OH2A 1WSHA 4XPEA 3KHGA 1RTIB 2Y1JA 1LWEA 4KI4A 3RMAA 1DLOB 4B9VA 3QNOA 4N47A 2ATQA 1WSGA 3LP3A 4FJ9A 5KG3A 2W42A 3OL9A 1WN7A 3LP1B 3ITHA 5KFMA 3CM5A 3PW5A 3IGVA 1CXQA 2F8EX 4E7LA 4CEOA 4Z0UA 1FKPB 4MKAA 3KLGA 3Q8PB 4IRKA 3SNNA 1S10A 1C1BB 3GQCA 3OSNA 4YFUA 1L3UA 3ZSWA 3OJSA 1JLBB 4QAGA 1LWEB 4BE2A 2BRLA 4EBEA 1C0TA 4ZPBA 4NCBA 4ZP9A 1BL3A 4DU4A 3HVTA 4G3IA 3ITHB 3SCXA 3KJVA 5KFXA 3CFPA 1S9EA 2RPIA 1HQEA 2ZD1A 1IKVB 1T05A 4FS1A 4W5RA 2HHSA 1VSIA 1S1VA 3T3FA 1NK4A 4IBNA 2G8KA 4KFBB 3K5LA 3HVTB 4CJLA 1KSPA 3MECA 3M8SA 3KJVB 4RW7A 3DLRA 3EZUA 5F9LA 4IDKB 1A5WA 1S9EB 3NKYA 3L3VA 4Q45A 1HQEB 4O3OA 4FCYA 1GOBA 2VA3A 1KCFA 2EX3A 1J53A 3HM9A 3V9ZA 2ZD1B 2D3ZA 1ASUA 1IO2A 3QNNA 2D5RA 2R2SA 5F8MA 2R8JA 2DFFA 2W9AA 3IAYA 4YNQA 1S1VB 1N6QB 4O55A 1C2PA 1ASVA 3SPZA 1S5JA 3K2PA 4KHUA 4CIEA 3K58A 1ZBHA 2AWZA 3MECB 3GILA 3LDSA 3IS9B 3UR0A 3DOLA 1TQLA 3GV8B 4IH5A 4TYBA 2KQ2A 5DLFA 4ECXA 1LWFA 2RDIA 2Z1IA 1D9FA 4ECRA 2XI2A 1O1WA 1A5XA 4CF2A 2V4QA 3TQ1A 4F8RA 3KKSA 1J9AA 5KFKA 4J9LA 1BISA 4CJKA 3V9WA 2WRMA 1S1TA 4O44A 1XR7A 2R2TA 4H4OA 5F8GA 4ED7A 4ELVA 3DOLB 2FVQA 4CJPA 3LZJA 5DK5A 2UUTA 3K5MA 4DMNA 3ZT2A 1LWFB 3PUFA 1HNVA 3HSTB 2P51A 4RNMA 4ECYA 3P1GA 4BDPA 2AJQA 2IAJA 4FJNA 2F8TA 2OA8A 5KFWA 4Y1CA 4KO0A 2C28A 2DTUA 1RDCA 1J5OA 3OYBA 4IKAA 4HHTA 3BDPA 1HARA 1RT7A 4O44B 4CGJA 1KTQA 4H4OB 3QZ7A 4WYLA 2P5OA 1RTHA 1CXUA 1S6PA 2XGPA 1TAQA 2E9RX 1C0MA 1HNVB 4GMJB 4FJMA 2GBZA 1NKCA 4M3RA 3RAQA 3TABA 4AILC 3S3MA 1TK5A 2IAJB 2EC0A 3MF5A 3NAEA 4FXDA 4KO0B 4BDZA 1RBSA 4G1QB 2FVPA 5DGBA 1J5OB 3ZT4A 5K14A 2IM3A 3SFGA 3RAXA 3P5JA 4CE9A 4CGIA 3U6FA 1RBTA 4C8MA 1RT7B 4O0IA 1QS4A 1U45A 2JEJA 1SV5A 2YNGA 3KLIB 3BSNA 4M3YA 2BANA 4RU9A 4XPCA 4N76A 5KG0A 2XY6A 1RTHB 4LD0A 5KG1A 3KD1E 4NLSA 5F8LA 3HVAA 3K59A 1QAIA 5L9XA 2JLEA 4NLGA 3V81A 3PW4A 3RTVA 5F8IA 3DDKA 3MAQA 2BQRA 2IOCA 2J6SA 3HK2A 4CJVA 5K14B 2YNIA 3Q8SB 1XI1A 1SKWA 4J2BA 4IFVB 1TKZA 1Z25A 2E9ZA 4ECTA 1VSEA 1S1WA 4DQPA 4NCAA 4RW9A 1EKEA 4TLRA 1TGOA 4DQIA 5EWFA 3SQ4A 3QESA 1L5UA 3DRPA 1TKDA 3ZSQA 5CZ2A 4CF9A 3LANA 3PO5A 2I5JA 5C5JA 2OPSA 4IG3A 1WSIA 4IRDA 4DF8A 3RB3A 4Z4IA 4HTUA 3DLKB 3CG7A 3EYZA 1U09A 4NLOA 3NF7A 1TV6A 4CJ3A 1TKZB 2VG7A 5KFBA 1D1UA 1S1WB 3CJ4A 1X1PA 4E7JA 3FFIB 3O3HA 3RMDA 2KW4A 3OL6A 1HMVA 3DRPB 3SV3A 1RTJA 2ETJA 4DTMA 3GIMA 5HP1A 3BSCA 2I5JB 2HNDA 2OPSB 1QTMA 4IG3B 1C0UB 4FK2A 4DG1A 3T5LA 2ZE2B 1NKBA 1ITGA 5I3UB 3OYCA 3OL8A 4F2RA 4F4WA 4ECVA 1T03A 3AO1A 3AVJA 1TV6B 1IM4A 1U04A 3EY1A 4M95A 4DTUA 3PR4A 1KVBA 4AHRA 4ECUA 5FROA 5L1LA 1NJZA 4ECSA 1VRTA 4GVMA 4Z4FA 2R8HA 3WNFA 5KI6A 4NRTA 3G0ZA 1KHVA 4NLRA 1HMVB 3DM2B 5F9NA 3AA3A 1B9FA 1NK6A 2WTFA 4ED3A 2HNDB 3RB4A 3H4BA 2IMWP 3P83D 2GC8A 5KG2A 4BDYA 3QO9A 1VSMA 1HYSB 5HRNA 1REVA 1A5VA 3BGRB 2HVHA 3WNEA 3CQ8A 3DLGA 1QSLA 1IKYB 1QAJA 5T14A 1JLGA 3PJXA 1HNIA 5KRTA 1WAFA 1UAXA 5EDWA 4ELUA 2KFNA 3I8DA 1UA1A 3SZ2A 1NK0A 5HLFB 4DL4A 4FZZA 1VRTB 2I1RA 4JV0A 1ZETA 4ZP8A 4O3NA 4FBUA 2AGQA 4I7FA 5C25B 4M3TA 3L2RA 3VQ5A 4WFYA 3HVRA 3L2WA 2YNHA 4KSEB 3GIKA 3H4DA 4FS2A 2FLLA 3HP6A 2WHOA 1TL1B 4QW9A 3G6VA 2PY5A 3QO9B 3OL7A 3SI8A 4JS4A 3KLFB 2HHWA 1REVB 2GIQA 2YHBA 1FK9A 4WE1A 5DG8A 4MQ3A 4AHSA 5JS1A 4U6PA 1JLGB 3MEEA 4IR1A 3VQAA 4QPXA 1WLJA 3OS0A 2B43A 4TXSA 5KFNA 3KMQA 4M3UA 3O4NA 2J6TA 5J2PB 4HCBA 1Y97A 3HHKA 3EPIA 1S49A 2OPQA 3AVHA 4I7FB 4M45A 3MEDA 2WONA 3KK3A 3KNAA 3SQ1A 1N56A 2DFEA 4ZTFA 3VQEA 2YNHB 1RBRA 1FKOA 4RG8A 4C8LA 4NLPA 3RBDA 3QGIA 3SI6A 4HVJA 1FK9B 4FJXA 4WE1B 3AO3A 5SWMA 1YTAA 4EYHB 2R7YA 3OYJA 4EYIB 1TK0A 4KKOA 3DLEB 1K1QA 3MR5A 3F73A 1N5YA 4DSKA 5C24B 3MXMA 3NMAA 1WSEA 2FLNA 1B9DA 3C6TA 5KT2A 4ZVEA 5HRRA 4ZHRA 3D28A 2IJNA 4DL3A 5KT5A 3CJ3A 2PZSA 4FJLA 1SH2A 1RT5B 2WONB 3KK3B 3L8BA 4FM1A 3VQPA 4WFZA 1BIZA 2LSNA 2QKKA 4CESA 2WCXA 3THVA 4N56A 2G8VA 4RNHA 4XIUA 2R8GA 4WFXA 3RR8A 4M3ZA 4F3OA 1BQMA 4KKOB 3PW7A 3RBEA 1SKSA 4W5QA 4CHQA 3DI6A 3ISND 2JGUA 4DL5A 1IKXA 3AVIA 4B9TA 4QWBA 4MK7A 4DEZA 1HYZA 1SKRA 2XY5A 4FM2A 4O3QA 4BACA 4F50A 2R2RA 2WOMA 1RT6A 2IM1A 5EU7A 2HW3A 3UIQA 2W9CA 2DPJA 1U48A 4KREA 4NRUA 4ID5A 1Z4UA 1RILA 1TKXA 3D45A 4DWIA 3AA4A 3OLAA 5KFHA 2BQ3A
chains in the Genus database with same CATH superfamily
1WOQA 2HRYA 5C15A 4F7VA 1VQ7S 2B6AA 4HLBA 3ZYYX 3TAFA 1KXPA 1T95A 3H5SA 2HG4A 1VLOA 2DITA 4W5TA 3ZFVA 1YRTA 4J9UE 2XGQA 3KHYA 4CF1A 4I2QB 2QL9B 5U47A 4RWTA 3WEEA 2V68A 3ZEUA 4RUAA 2CA9A 3DGVA 4GKJK 2LKZA 2KM8C 3K17A 2BOAA 4ZIWA 5GIOA 2MZJA 4DS5A 4CEAA 1PCAA 4ZP7A 2DNHA 3KLGB 3GOIA 4USMA 2RE1A 4FJ8A 4NO7A 3I5AA 4ZOSA 5FLXY 1E4FT 2V9KA 2E6MA 3AV9A 5KG7A 1CZAN 3AA5X 1JL2A 3LGHA 4NYFA 1NUEA 3HFKA 4J90A 3LAMA 4JYAK 4LQ9A 3MI7X 5L1KA 3N6NA 1S1XB 2BE2B 1MW7A 1WELA 4KGKA 4FPRA 2DISA 4A8WA 3U1MA 5HL7Q 4WTYA 4DFMA 5ETVA 1TL3A 4HCCA 1WWHA 7FD1A 1IJFB 1ZH5A 3OBYA 1IQTA 2EG1A 3M7VA 4FVCA 4KHPJ 4WP9A 4LF5F 4PUOB 4WIQA 4P7TA 2ZWPA 1QE1A 3D7SB 3U3YA 3BF3A 3CCTA 4F0MA 1RQ0A 2L41A 3S3NA 1S7HA 2RNEA 3O8MA 1HPMA 3Q8QB 2DH8A 2ZZMA 3AH6A 2OSQA 2AYBA 4KTZA 2GFFA 4JP8A 2Q0RA 5E33A 1WOPA 4DLGA 2N82B 4U96A 3IN5A 4E1MA 5HVGA 1SC6A 3M6WA 2MMYA 3NFAA 3I31A 1NMEB 2P5VA 4KHSA 1S9GB 2C2ZB 4YQWA 4K4TA 4Y2MA 1I94K 2DGSA 2CYYA 3KHLA 3AOCA 1K6YA 4M5MA 5CCMA 3RGIA 3MMAB 3KDOA 3ASMA 1C6VA 1OY8A 3TAGA 2HHXA 5T7LA 2X3GA 4CZLA 4TKTA 4LQ3A 2HMIB 4DSEA 3DNCA 3MN5A 5EWGA 4KB7A 1BD6A 4QOZB 4CRJA 3D68A 3RG6A 4DTRA 3NH2A 3MWPA 3CD0A 1L3VA 2GVZA 3QZ8A 4A5BA 4FP9A 1HHQA 1RZMA 4BRIA 4JI2F 2CFXA 3HHDA 1E6VB 3FSYA 1OJ4A 1AUSL 2QWNA 2XSJB 2R8KA 4JB8B 5EX0A 3DC2A 1IM6A 4LR9A 3U02A 5JICA 4IG0A 4KBOA 4O0JA 1DTQA 4USWA 3LWLA 2R7VA 3I5CA 1GMWA 2WB1D 2MY8A 4EU0A 1LAWA 3UKUA 1ZTWA 1WI8A 1NJXA 5MAOA 4Z2XA 1YBUA 3K57A 3CHWA 4LH5A 2VG6A 3R1LA 4RL1A 3L3UA 3PIOQ 4OL8A 3PRBA 5J2QA 5KFSA 1HA1A 1KVAA 5J1NA 4KI6A 2P9CA 3MDFA 2Q6CA 2D4WA 1KOHA 2XMTA 5A2QU 2WBMA 3TAMA 3GLJA 1XNRJ 4DV4J 2VD3A 2CH5A 3CYMA 3J8AA 1YIJS 1RBUA 3GE1A 2YWWA 1LWXA 4P2FA 3PW0A 3D2EB 1FRMA 1VC0A 2CQ1A 3S01A 2RKIA 3Q89A 3IGNA 2RH3A 4KJIA 4PABA 2U1AA 2ADBA 4WCEQ 4DR3F 3NH0A 1CJVA 3WDOA 4KH5A 1F3VA 3K8VA 3Q22A 1JCFA 1S1UA 3T1HJ 1VSJA 1N4LA 2XO6A 1E4GT 4X4NA 4CJWA 4K4UA 4UQGA 2NRVA 4TY8B 2MGZA 1YT3A 2J0QD 5IWAJ 3VGVA 1DEJA 2PDAA 3G6ES 3C6HA 3FMWA 2B4PA 1U1KA 2F4FA 3W8PA 2P9KB 2ASDA 4DUZK 4HYKA 3OLBA 4ICLA 4WBFA 2KXNB 3L2QA 1JMTA 5AQMA 2HFUA 2AIRB 4DV0J 1JLAA 2OTJN 3JSMB 4L8RB 3LP0B 2RSQA 2QJ3A 4DFJA 2FXUA 1PSDA 4G1PA 4Z4EA 4G65A 4RZRA 1U2VB 4CVNE 1AB8A 1BDGA 4Q8EA 1BWEA 5I42B 1CSJA 4CJEA 3HHEA 3VQQA 2JRSA 2B9WA 2R2UA 4CJSA 3GMGA 2GEMA 4W92B 4ISEA 2WVDA 1KVCA 1SQKA 1KP6A 2V7YA 4NA1A 2NZTA 5D0RA 4X65J 2GAHC 1VOMA 2YKQA 3C8YA 4JKCA 3VENA 2RF2A 4M5DB 1VSLA 1OH8A 5L1JA 4H5WA 3KK1A 5F8NA 2CGKA 2H3EB 4DR2J 3G6YA 2VPYB 1B0TA 4KH1B 2EPIA 3OYEA 2FHJD 5KTQA 4ID8A 4UY8O 4O0NA 1N32J 2CG8A 1A9NB 4CGFA 3H5XA 3AO4A 1ROFA 3V9UA 3TTCA 3EN9A 3VQ4A 4B08A 2GO9A 4JI6F 1VQLS 4DR6K 1AUDA 4GV9A 3M8PA 1GX6A 2IIHA 1K8KA 4C1NK 3JSRA 3S3OA 3D6RA 3OYAA 4DTNA 1VAZA 4AH9A 2QWOA 5EX5A 4NMLA 1KKHA 4JI4J 3FQKA 2VH7A 5F3TA 1VQ9N 2ATLA 4IH6A 1MN9A 1X60A 3M2UA 5B0BA 2AF6A 3AY9A 2RN2A 2PA8D 4M94A 5CD4H 4L75A 3MAAA 1LW0B 5F1XA 4AFFA 3DJCA 2E7XA 2Z8QA 2WVEA 4LF8F 1IBMF 5C2FA 4X2BA 1NBWA 4RTFD 2AEJA 1WSJA 1M5SA 4MDAA 2HQIA 3SQGA 1WSFA 2BACA 4CM0A 1FJ7A 2MDAA 2JEGA 2BJ8A 1RCOB 3CCRS 3RRKA 3NF8A 4DSJA 3CMQA 3VN5A 1WG1A 1VSKA 2YX7A 4X66J 4DCPB 2FJVA 2DO4A 2QFJA 1AT1B 2YH0A 4B3MK 2MHNA 2W25A 1YJ9N 1ASWA 2XHWA 2ZH8A 3DMJA 2OYQA 3O8WA 2NPFA 4CI6A 5CY4A 4C48A 2XY8A 3DYAB 1WHYA 4K25A 3CVKA 3I0RA 5HJXA 4BREA 1BU6O 1FXXA 4Z4CA 3FGUA 1NPKA 4DX6A 3D2WA 4RUCA 2M52A 3V6DB 3EWGA 2OPQB 1Q4RA 2IM2A 3AB4B 1Q78A 3KUHA 2O8EB 2DR7A 2GNKA 1NJYA 4B3OB 2D0AA 4WZMA 2GJ2A 5L38A 2CPXA 2YV0X 3OR2B 3G71S 4CO2A 5M1OA 2O4GA 1RWWB 1N5YB 2VWBA 3B82A 1HNWJ 3PM9A 5DM6L 2KKHA 4KGMA 2HF4A 4ECWA 3N5BA 3VGUA 5A0YA 4JK8A 3MPUB 4FF4A 1N33J 4DU3A 4S0MA 1XK8A 4H0OA 1N88A 4IXCA 3O3LA 2MSSA 1YSJA 4IEEA 4DV7J 5KFJA 1WOSA 2K3IA 4QIVA 2YJEA 1WJ9A 3WQPA 3B6PA 2ZKTA 2KYZA 1XMOJ 2V2KA 3ADAC 2OELA 1Y0HA 3K8WA 4EBCA 2D0BA 5J2NB 5G0RA 4CJRA 4HUGA 1UTAA 3HVWA 1PKUA 2OEKA 3AHPA 3OBIA 1JLCA 2ZKUA 3EMTA 1UZDA 4P10A 3GE9A 4EAHD 2E1PA 1RT6B 1XR5A 4ZP6A 5KFAA 2B51A 1F1BB 3MMBB 2V8PA 2BJ7A 3M30B 2G2OA 4DDFA 3UO0A 3VGSA 1ZBFA 3W2WB 4OO1J 2QM1A 4LMZA 5GADP 4BRCA 4FDFA 3POTB 4LBIA 2E1CA 2VWKA 5CABA 3U4LA 2M8HA 4ELTA 3VGMA 3K89A 2NRWA 1UW9A 4YY3J 2ALYB 3ET6B 3PW2A 3RMCA 4EUVA 2L9NA 2OKQA 2PI4A 4OV6A 2FLOA 4ED6A 1I39A 4IDKA 4HVZA 4IH7A 3P96A 3LPYA 4U7BA 3H2LA 1C4CA 3SUOA 1U0HB 3CJRA 5KG4A 2HHVA 5HRPA 2FC0A 2P9EA 1BI4B 4H4KC 4MH8A 4FJHA 1N6QA 2Y0BB 4KHRA 1BQNB 2NRXA 3OFFA 1RGVA 2NRHA 3OS2A 4LFCK 2PT0A 3PDNA 4I9QA 3JS6A 4ATNA 2QXFA 4HI1A 2EWHA 4LFAJ 3MPWA 4RWWA 4A8YA 4CZMA 2JEIA 1L3TA 2RS2A 4ED8A 3VAKA 4CLKA 2A40A 3CJKB 1RWXB 4BRHA 3CJAA 4F0HA 1VSFA 1ZAXA 5DZ7A 3FEXB 3OYKA 3AOAA 3DXKA 5KFLA 2KJWA 3NAIA 2CKWA 5CYQB 2N4DA 3V4IB 2E88A 3KK2B 4CD1A 2A1RA 3AJ1A 3OT9A 5GMEA 1Q0NA 1U8SA 3DRYA 1EX4A 1DTTB 4K50A 1YHQS 1RU2A 1FJEB 4HKQA 3JTNA 2VA2A 2A1SA 1EARA 3OYDA 3KD5E 4JOUA 3SMSA 4A8QA 5GAGI 4J91A 3LL3A 3BBBA 3HCXA 1G6BA 4H54A 2XHBA 3EJMA 1W2BM 1PYOB 1IBLF 5C42A 2KTQA 2LQJA 2GA7A 5GIPA 1I6JA 2M9KA 3TAPA 4AHCA 4B3RJ 1JLEB 5IV4A 1TELA 1ATRA 2J0WA 4DL2A 4DFKA 4BLGA 1MU2A 2W4CA 5K20B 3JYTA 3NOCA 4OGCA 5L1IA 2HAIA 3TNVA 2D9PA 2J7UA 3V9XA 4M1KA 1KBRA 4G1QA 2ZH1A 3J80Y 2UUAJ 3CF5L 1RAHB 3KKRA 1F5BA 2ASMA 2EFVA 1VK8A 2E5GA 3FJ2A 1J5EK 2LCWA 4B1XB 3UKRA 4AQYF 2M70A 5EX3A 1S6QB 4DR5J 4XK8C 3F44A 3BH7B 2AJ0A 5J1EA 2ZJQL 1VMBA 1Q18A 1SC3B 2F9WA 4Y6IA 3QMLA 2Q36A 3L3CA 1VSHA 3S1TA 1NHUA 5DDPC 4JI1J 2E6LA 3VEZA 1VQ4N 4JI0J 4JKEA 3BF4A 3THYA 1H7XA 2FZCB 4JI5F 4USIA 3W65A 5AQWA 3W7BA 3D2FB 3NGIA 1QY7A 5AQSA 3VAFA 3AVNA 2V51B 1PAUB 1Q82O 3LALA 2DXFA 2IM0A 1ULRA 2IYGA 5A8WB 2DH7A 2E5JA 2H5IB 3CCVS 4BE1A 2DGTA 1MSWD 2PFDA 3ZC4A 3QJLA 1OMSA 4ZA1A 3ZSOA 1SQEA 2BVZA 3BYRA 4U7UD 2W7PA 1BHLA 1NH7A 4HACB 3RSEA 3MM8A 3QLHA 3JQKA 3O5BA 1X4BA 1C0UA 5M2RA 1FT8A 2QC3A 1X8DA 4URSA 1KLMB 2YI1A 2ZITA 3BPDA 1ZM2A 3SCKE 4MKVA 2X6NA 1LWCB 3Q8VA 4UY85 4CT9A 1P9QC 2DNQA 4B3SJ 1JCEA 5DQHA 1T94A 3U7JA 3QQCD 4HR2A 2ZOFA 1NGDA 4OKEA 1TL7A 2CPYA 2IRYA 4FLUA 3QERA 3DM2A 2YKMA 2OO4A 3MD3A 3L7OA 3GYNA 3TA0A 3C16A 1H72C 2PN6A 1HQ2A 1KC8T 1IG8A 2E1YA 1C1CB 4JV2A 4IYQA 2G0IA 4MT1A 4ZPCA 4DR7F 1XWLA 2HBLA 3BSOA 2YHWA 3MM7B 4CEFA 5EOYA 3HOSA 2BKNA 2C2EA 4KRWA 2DFHA 1EQMA 3TARA 4I2PB 1YJWN 1X4DA 3US5A 3TX8A 3EDRB 2E7WA 4OX7A 1Q7YO 5G4DA 2DYAA 2PC6A 3U9ZA 1RKIA 2J9DE 4H0XB 3GJSB 2A41A 5KT6A 3P49B 1N34F 4ZJLA 4JV1A 5J2PA 2HHTA 3O80A 4DSIA 4JLHA 2E9TA 3O3FA 1YBAA 5MLCV 1U24A 4JBCA 3E1YA 4LF7F 4Y2IA 2PMWA 2XULA 2XO7A 3TA2A 1F0XA 4E1JA 4E89A 3GZ7A 2JC1A 2XQCA 4LF4F 3MEGA 1S57A 4JD2A 4Q0BB 1UJ4A 3AVAA 3EE3A 4JKBA 3FZ2A 4A59A 1JLQB 5CXTA 2UXDF 2GHPA 2ZBIA 2EK1A 2O8DB 2ZHOA 3TZZA 3U3GA 4FJJA 3MXHP 4GKJJ 1QJHA 3VEOA 2W4DA 2WSEC 4X4TA 3ZSVA 3T9NA 5KPTA 1QQNA 1PGZA 4A5AA 3G10A 4XDDA 4AHTA 2XLIA 3RWUA 3QT8A 1EB0A 1HKGA 3HKWA 3A3OB 4O3SA 4DV1K 2G0CA 4MJKA 1VHIA 3SAFA 4Q5VA 4JYAJ 2GGPB 4F4KA 2FD2A 3BREA 3EXYA 2A3ZA 3OS1A 5BXIA 4F4XA 5M1QA 4CJFA 3AFGA 3ENOA 4ED5A 2Q1LA 4MIAA 4KV8B 5C2DA 2OGUA 2MJNA 2DNKA 1S72S 3B6OA 1RTZA 2FIUA 5C7PA 3IM9A 2P2CB 5HN0A 3DRXA 2YX1A 1RDRA 1R0BG 4NCGB 4WP3A 3MTKA 1Y5NB 5BREA 3DDIA 5AQPA 2DVIA 4W90B 3J7ZT 1D0EA 4WTOB 2E5LF 2GVDB 3G2XA 3O6WA 1RWNB 1U6FA 2VPWB 4YR2A 3NWGA 3LP2B 5KFCA 1R43A 3OSPA 3JXUA 5M2PA 3NGDA 2OH2A 1HKBA 3KHGA 1RTIB 1LWEA 3RMAA 2E66A 5HO4A 3QFPA 1XQIA 5LSRA 4DUYK 1PBUA 1WSGA 4RUHA 3O9TA 1JNRB 5EGYA 4NZ7A 2WBNA 2W42A 3AY0A 4DR4F 1W26A 5RUBA 3LP1B 3CM5A 3PW5A 4E7LA 1FKPB 4MKAA 1O13A 2F8MA 1Y3KA 1XNQF 4CQ1A 4IJNA 3P6YC 3GQCA 1CJTA 1I94J 1FO1A 4PG7A 4BE2A 1CJKA 5CZVA 4EBEA 1C0TA 2Y1RI 3QPIA 4ZPBA 4NCBA 3J81O 3P38A 5B08A 1DGKN 3E3XA 1RXOB 4KH6A 3PHTA 3FMBA 2FF6A 2CJKA 2RPIA 3CC4S 2OEJA 1HR0K 2ZD1A 5ETNA 1E3MA 1T05A 1VJWA 5GADU 5LL6d 1VQ7N 1VSIA 5HMXA 2HHPA 2CXEA 2IDEA 1GLEG 3P39A 4CO5A 1S1VA 3AD8C 1PJ6A 1QAYA 3OBWA 2I6WA 4BRKA 3HVTB 1RJJA 2WW8A 2YWFA 3HZ6A 1DHMA 3M8SA 2ZDPA 3DLRA 2CQ2A 2J9CA 1VQ8S 4Q45A 4PKDB 1HQEB 2DEIA 4FCYA 1M1KT 1KCFA 3WBZA 1X3MA 2RE2A 3QNNA 1Y3JA 2D5RA 1SC4B 5F8MA 3NGRA 2W9AA 4A48A 2YCHA 4YNQA 4M5GA 3SXLA 5LMUF 4DV3F 2ZM6F 2DHGA 1S5JA 7FDRA 4M5NA 2PMZD 3MD1A 5A6WA 3UNGC 2AWZA 3MECB 2DK2A 1SJ1A 1HBNB 2CJAA 2EK6A 2YHXA 3KKFA 1R27B 4CIOA 1FNOA 2XI2A 2V4QA 1Q95G 3D54A 4H4KA 2AJ2A 4WU2A 5LL6Z 2M7SA 4IOAL 1HBOA 4JI3F 3QBWA 4O44A 1XR7A 2R2TA 2V2ZA 4DPUA 4CJPA 2ZUAA 4B3TF 2A10A 3CW2C 3VEXA 4DMNA 3PUFA 3QFHA 3F41A 4DUZJ 5KFWA 3KG1A 3VGTA 2DTUA 3L4QA 3BKUA 3FCVA 1J5OA 3OYBA 2NZCA 2KU7A 4IKAA 1U1MA 4LF5K 1FRKA 2BJDA 1NLVA 1KTQA 1NM2A 3IUCA 1GFWB 1SJQA 3VESA 2P5OA 1MROB 1RP5A 4ZKAA 5E3AA 4PKHA 1S99A 2D1CA 1S6PA 2KB2A 3DKDA 1HNVB 4FJMA 3D1OA 5J1PA 3HFZB 1TL4A 3TABA 1Q16B 1UEUA 2IAJB 3CJ1A 2EC0A 3MF5A 5IQ6A 3NAEA 4FXDA 4GVBA 1RBSA 3QRRA 2XZTB 3RAXA 4DR1F 3P5JA 3DHWC 1XMQK 1QS4A 4BRLA 1FW6A 3BSNA 1WEXA 4LRAA 4RU9A 4PXBA 4XPCA 2ZUGA 2XY6A 1RTHB 3JSYA 1NU4A 1BE4A 3AOBA 3K59A 5L9XA 1O5JA 4FZVA 4BROA 1PJ5A 3R1HA 4MAKA 4DR6J 5HVFA 3VVUA 2J6SA 4AT1B 2Z2ZA 2YWEA 3C46A 2YNIA 3Q8SB 4WKYA 1TKZA 1G7CB 4IOCL 3OXGA 1VSEA 2VGMA 4CH1A 4CLWA 2POKA 4P52A 2AT1B 3ZTQA 3ULEA 4JI2K 1R8CA 1VQ6S 5EWFA 1RHKB 3ZSQA 5LY3A 5CZ2A 4FKXA 3O08A 1ZXOA 2CRLA 1Z2LA 1WSIA 4DF8A 3RB3A 4Z4IA 1LK5A 1WKLA 2VV5A 1UVLA 2FHKA 3ETMA 2HZCA 1HNZF 1TV6A 1U2CA 2B0GA 4QBUA 1YIJN 3CIPA 1OWXA 2VJUA 3CJ4A 3QSIA 2M4MA 3H6EA 4WF9Q 4HH1A 2QLJB 4DPXA 3BO2A 1Q81T 4B3MJ 3QRPA 2KW4A 3I6PA 3W61A 3DRPB 2IYIA 2ETJA 3CJCA 1NH8A 5DZ6A 2XMUA 2I5JB 4AL6A 1FDBA 3NNAA 3T5LA 1RB0A 2ZE2B 1ITGA 1H2TZ 1U04A 3JTOA 3EY1A 3C7NB 2HK2A 3IM8A 4BY9C 4ECSA 3CCUS 4DR3K 5HATA 1NSKL 4I68A 3WNFA 2J8SA 5KI6A 4NRTA 4BRFA 2RIJA 1WORA 2X1AA 2WTFA 3WXLA 4ED3A 2AZ3A 1RSCA 4NA2A 2EC2A 3QO9A 1IQZA 4MLHA 1A5VA 3ZZUA 1QSLA 3L95X 1I1GA 2B56A 1JLGA 4C2MA 5CAAA 4OYWA 3OPKA 2CQHA 3CXCR 4H0YB 4FWOA 2OFGX 1UA1A 4FWSA 3D1HA 2NRRA 1RAAB 2V8GA 3GJTB 5AQJA 4JV0A 1HI8A 4FBUA 1P6TA 5D15A 4M3TA 3Q8UA 3L2RA 3VQ5A 3W63A 3HP6A 4QW9A 2HBZB 3OTDA 4QPTA 1PJ7A 2Z2MA 3VPZA 5DG8A 3UCGA 3EVOA 4IR1A 3MEEA 2QIFA 4BR0A 4U67Q 1U1RA 2OHDA 1WLJA 4TXSA 4K5SA 5KFNA 4DHVA 4DHYA 5A8KB 4FNHA 3KMQA 3CCSS 1HWLA 4HCBA 5F3ZA 1QVGM 2UU9J 1FEHA 1S49A 3AVHA 4I7FB 4WFAQ 3MEDA 3KNAA 4F3MA 2MY7A 1K73T 2YNHB 2B8PA 2J0XA 5BYRA 4C7QA 3A5MC 2A0FB 3N4WA 1FKOA 4C8LA 4RG8A 3VETA 3P45B 3SI6A 1FK9B 1K9MO 4GKKF 1B7YB 5SWMA 4QS9A 3D3BJ 2XNRA 1VQ5S 3R6GB 2R7YA 2CQ4A 2AYMA 5F41A 3UW1A 4EYIB 4CJ7A 4P2XA 4JI6K 1S79A 3MXMA 3V5RA 1WSEA 1B9DA 1EQYA 4NXNF 5IM0A 5KT2A 4ZVEA 1R31A 5HRRA 4ZHRA 4CZIA 2PZSA 2HK3A 3DLLL 3KK3B 3L8BA 2WAQD 2DIUA 4OMFG 3R5DA 2IVMA 4HDGA 4WFZA 1BIZA 2QWQA 2XS2A 3TJ9A 4CT8A 3MR7A 2WCXA 2HBJA 3W0LA 4N56A 3M05A 4RNHA 2R8GA 4M3ZA 3CCRN 4LF8K 3VQTA 4PRFA 4F3OA 1T9XA 2V52B 4IO8A 1IBMK 2WFBA 2PEHA 2RQCA 4I1TA 3NNCA 4ENOA 4F67A 3ISND 2CQGA 4LFCJ 2G9OA 2BJ1A 1VBZA 1UP1A 4BR2A 3EGNA 1H74A 9RUBA 4ISFA 2CQ0A 4FM2A 2V69A 4O3QA 4F50A 2R2RA 3FK4A 4EIAA 2IM1A 2HW3A 2B9YA 4NRUA 2GCFA 4DWIA 1SQGA 3KWIA 5B0GA 5A2QY 5KFHA 4RX6A 1LV5A 3DI6B 3C6UA 3H59A 4DV5F 4BQLA 2MZRA 4OX6A 2UXBJ 4F26A 3M6XA 5FPDA 1QAXA 5C10A 2HVEA 1YDLA 5AZIB 4OHWA 3CJSA 2I0XA 2VYPA 2XS7A 4O3RA 4LC9B 2WOMB 1IR1A 1X7VA 3OXLA 2EEYA 2CZVC 1U47A 4Q43A 5D6GA 1U0SA 3BH6B 1FKAF 1KLNA 3PO4A 3D5MA 3R1XA 2HSEB 5IZHA 1FRJA 2JSXA 1C4AA 3ENBA 2AGPA 3HPHA 3M4XA 1SPBP 1S7IA 2KT2A 5I3PA 3UDEA 1S1XA 2BE2A 3HDSA 1N5SA 1JKHB 2B8QA 5AFUA 1CJUA 2ASLA 5ETRA 5DLGA 2XMKA 4Y2AA 1B64A 3OW2R 2O67A 1ZBIA 3ENHA 4CW7B 3U1NA 1B4SA 2OLWA 3LWMA 1RDAA 3VF6A 4FPBA 4WKRA 3J7ZO 3PKYA 4A2BA 3KIOA 4PUOA 2HB5A 3AVBA 3TAEA 2DY1A 1ZBSA 4E7HA 5I3QA 2H4YB 3GFXA 4AHUA 1IG9A 3NCRA 4Y65A 1J5EJ 1RCXB 1T0TV 1ZAWA 1F2HA 2QZ8A 2VG5B 5KFQA 3PJWA 2MEWA 4WP8A 4DPYA 1OPZA 3WQUA 2V4RA 3BGLA 4RBUA 3OHAA 3MMCB 4FK4A 3KYLA 4ZPDA 4C8NA 2P9LB 1Q8LA 2AP6A 5F0XA 1RHRB 4DQSA 1S9GA 3ATUA 1Y4ZB 3ZSRA 4KH0B 3RB0A 2QLBB 3MMAA 5JVGQ 4QJVA 2VBYA 3D0GE 2NQPA 2HMIA 3TQEA 1ZTTA 2ZWOA 4KPYA 4C8OA 2RDDA 2C3MA 4IFYB 1GEHA 4U95A 1K8AO 2YBVA 4ES3A 4J9VA 3H1VX 3CD6S 2MSTA 1E6VA 4M8LA 2BDPA 1HQUB 3FQLA 2HPUA 3TR8A 2XSJA 1TR0A 3SLCA 1FDNA 1KAZA 2PGCA 2D0CA 4L73A 4V19X 2P9IB 4HUEA 1HBMB 1P1TA 4A8XA 3HKZD 1K0TA 1RE1B 2JJ4D 2Y1LB 3RRGA 3CCJS 4RUBA 5AE3A 1NDPA 3KOAA 4F25A 1S1TB 1HWJA 3R9LA 1JXLA 3PZPA 1KAYA 5IV3A 4NLXA 2QA4G 2ZOGA 1YHQN 4B02A 1LOUA 2WSFC 3KNGA 4F04B 4OYXA 4QYZK 4I6YA 3W1YC 4BC4A 1BGXT 5TKYA 2Q79A 4QWEA 1CQMA 1X5PA 1G2EA 3SCJE 3O4QA 1EIYB 1WF1A 3L2UA 2R4FA 1T9WA 2Z1HA 3TEHB 3CJBA 1YVUA 2A18A 5KT4A 2F8HA 1IBLK 1EETA 2FVCA 3F5TA 2E1RA 4CLUA 4JKFA 4XH1A 2VUGA 2OI2A 4TY8A 2NCKL 4HH0A 5AZJB 5JVHL 1Y64A 1LCUA 2DPNA 2MB0B 1SIZA 3LZIA 3QGPA 2JWNA 1UFKA 2P9KA 1RBOB 2BKPA 1SH0A 1SV5B 2BANB 4WK1A 3VEWA 5HRSA 5IT9U 3CJ8A 3NWRA 1YJNS 1VBXA 1FCAA 1LNQA 3G9CA 3ZT0A 3R5GA 3JSMA 3AODA 2XEXA 3LP0A 2FHJA 1N36F 1QQOA 4OYAA 1WHVA 4MFBA 5I42A 2BE9B 3MR2A 4IQXA 4YUDA 2F4VF 2OP5A 4M42A 2FZGB 5D3GA 4JKAA 4AQYK 1I3AA 2YHAA 3CQYA 4AL5A 4M3WA 4A61A 4K0KF 2G8HA 3CJ5A 5EVZA 3GCWP 1AFJA 3SEOA 4ZIVA 4RW9B 4YOXA 3A2FA 2HLUA 4M5DA 4QWAA 1JCGA 3MFHA 4LBPA 2BH1A 3NS6A 3W5ZA 3CCWA 1NHKL 3EUNA 4YOUA 2OD4A 4RW4A 4JI5K 3QICA 3OTBA 2GWJA 1IVZA 2YWKA 3CCVN 4EI2A 2LDYA 3GSIA 4MMOA 3TA1A 2FDNA 3PSIA 1WNSA 4H03B 3TTDA 3KG0A 3DGPA 5KFIA 4DV1J 1VCTA 3BQ0A 4XH5A 5JXSA 2RHQB 5DMRA 3GONA 3NHGA 5HP1B 4JUZA 1Q8IA 3M2VB 4GMKA 4OYMA 4TY9A 5E0OA 2L48A 4NLUA 1LW0A 5D4LA 5BR9A 4DG1B 3P31A 1WNEA 2GX8A 4C0HA 1ZM3A 1T03B 5D4NA 5KT3A 4FJKA 4KY3A 1KRPA 2UUBF 2HBQB 2B5JB 5AE1A 3V6JA 2UVVA 2WW4A 3T7ZA 4CO0A 5HL7L 1HW9A 3I4HX 3O9SA 1CG2A 1O8BA 2FJAB 4F2SA 3MR6A 3Q24A 1JX4A 4B9NA 4NEYA 5KFRA 1GNKA 3GV5B 1OYEA 2J0SD 1N8RT 2F5GA 2KLAA 3DYAA 1NK8A 2CWXA 2YQ0A 3G4SN 4DUYJ 4PWDA 2DR6A 4ZS6A 4ZLPA 1DQ8A 1IWGA 4OLOA 2X1GA 3V6DA 3FZFA 2PYJA 3HO1A 3O1BA 5FRNA 2PD1A 3RMBA 3OFHA 2UVUA 5CZ1A 4DL0C 4OI2A 4B3OA 5KFFA 3M2RA 3OVSA 1WDDA 1NK7A 1WI6A 4DR7K 4P71A 1BA1A 1QSSA 1RBLA 3ZLJA 2JX2A 3CC7S 1RTDB 2CWKA 1CLFA 2AQ4A 2E2QA 1FNXH 2W7AA 2ZZTA 4FWPA 4FW1A 1SAZA 1HR0J 3Q8YA 4Y1DA 2VBZA 4KTQA 2RRBA 1YG0A 2Z30B 1T6DA 5DS7A 1RADB 4OYPA 1N34K 1NHVA 3CPWR 3H2UB 2HFNA 3UPFA 1HLUA 1RT4B 2CJXB 3CFRA 4LF7K 1O0PA 3IG1A 3C6TB 5J2NA 1JJ2R 2FJWA 1DLOA 1B92A 3VOVA 2W1BA 1FJCA 2OANA 1UVMA 4MK9A 2FSNA 4J9RA 5A8RB 2BJ9A 1MG7A 2UXDK 3NNHA 1Y5IB 1URRA 3PIOL 3M30A 1NJIT 4N5SA 4AYBD 3W2WA 4OGEA 3PR5B 3MR3A 4H5TA 2O1PA 4ECQA 3TSQA 3KLEB 3POTA 4ZPAA 2JLGA 2F3JA 3TI0A 1PBAA 4DMZA 2HNYB 4B1UB 4KHYA 4OLAA 3LPTA 2W2OP 4PKGA 2P6TA 4CLSA 3GFHA 2LECA 3C94A 5KPZA 4YP3A 4IR9A 1JIHA 4LVNP 2H1YA 1H7WA 2W9BB 3GV7B 3BZCA 1S72N 2Q43A 4WCEL 4BG8A 3U27A 1FFSB 3NGTA 1FFGB 4M41A 4MYTA 5AQGA 2DCLA 1U0HA 1PC4A 1IKVA 2QLFB 3ZETB 1F21A 3K2YA 1BI4A 1FA0A 5DG9A 2V8HA 4DV6F 4ANDA 4EZ6A 1BQNA 1MLAA 3WEEB 4F3TA 2B4JA 2YH1A 2PI5A 4CHYA 4NL5A 4CGGA 3T69A 2VB6A 3AQPA 1M5OC 4LF5J 2E5LK 1N5VA 2AW0A 4NLBA 1BO5O 3GR1A 2Y3YA 1S3XA 1P9YA 5CYQA 3KK2A 1RUSA 3BKTA 3ZZZA 3CO0P 4DOZA 4WWSA 4ITSA 4PCQA 3GYXB 4CECA 2P9PA 1BXNA 2CPJA 1KNZA 3RBXA 4AXJA 3D6MB 2GMHA 4KTWA 1XIQA 4MKBA 3L4BC 4CJ4A 3BQ1A 1CLQA 1XMQJ 2E4LA 1XNQK 1HW8A 4Q7AA 1CZBA 1IH7A 3ALYA 3F0NA 3AJ2A 3IR5B 5FLXO 1VQSA 1FDDA 2HHHF 3FFKB 3PLAA 2DHAA 3VEVA 6FD1A 3NH1A 1DQAA 4F02A 3TZXA 2A42A 2YHYA 1D3WA 2LQ9A 1S48A 4CWBA 2H54B 1QE1B 5EY4A 3CGIA 4H5NA 4PPDA 2Z4PA 5IT4A 2UUCF 3H0PA 1Y10A 3H98A 3TPQA 4X62F 1VQ8N 2R8IA 2P5GA 1XJWB 1FXDA 8RUCA 4JI2J 5BPNA 2F7TA 1VQOS 3WZ0A 5AJ3F 3HHLB 5BN8A 3H7HB 2QL5B 2I9SA 1KDNA 2YY3A 1S6QA 2J9EA 1NG9A 1NXIA 4CZJA 4A8SA 2P9NA 3AVLA 2AKWB 4ZK7M 4YOWA 5I9EB 1RNHA 1WKKA 1IWAA 4CP5A 2HQFA 3CDEA 4CBUA 2G1DA 2FUG9 1U2RA 3SUPA 3ZT3A 2M2BA 3QGHA 6AT1B 1DKGD 3P4UB 2DRBA 1MWQA 4B1VA 4E3SA 4C0BA 4UOFA 1V3ZA 4BG9A 3NF9A 5LMUK 4JKDA 4Q8FA 2OMOA 4KH4A 4DV3K 3HHLD 2ZM6K 3SJJA 4AUKA 4ZPVR 1EX8A 3PKMA 4YHHF 1ITPA 4CHZA 2BBEA 1MWZA 2V8VA 2YJFA 2LFVA 3D67A 3MDQA 4TLQA 5F0WA 4NLQA 2BABA 3TVZA 4RNOA 2FVSA 2FBXA 2PAVA 5A8WA 1UMJA 2UVWA 4BGAA 3I87A 4DR3J 2VQEK 4ED1A 4FVUA 1YVNA 1DTQB 3HFVA 2F1FA 1HD1A 4JI3K 2K06A 4IFVA 3A4TA 1Q5VA 4OVLA 4FJGA 2LLZA 1D8YA 3I0SB 2DGUA 2DR9A 2CNKB 2VL1A 4ILJA 2VG6B 4MIBA 4CZHA 2AMCB 4A57A 2LQ5A 4HACA 4B3TK 1T9VA 3TX0A 2A6OA 2W8KA 3TAMB 4E7KA 1KLMA 4O4GB 2XLJA 2O4IA 1LWCA 4FZYA 2KRBA 4XO0A 3THTA 1PIEA 4K43A 1QHTA 3CCQS 2Z0GA 2BR0A 3M5RA 2NRTA 4UY8T 4CEQA 1FTRA 3MTJA 4DLEA 2P9UA 1YZ6A 4RW8B 5D8HB 3J7AN 1ZBTA 4KGXB 4ZTJA 1LEOA 3SV4A 1ZYQA 2IVYA 2GMLA 1CJVB 2HFOA 4KE5A 2V7ZA 1UFWA 4IRCA 4WXWA 2JHEA 5AR0A 3VAMA 2YXLA 2VOPA 4BRQA 1BCMA 5KGWA 4Z4GA 1C1CA 1X4FA 2GUIA 5I3UA 1NMNA 4FM0A 3JS9A 1P27B 1OH5A 4OJRA 1FJGF 4TN2A 3MN7A 1X4HA 2MGZB 1GLLO 4CF8A 2K1RB 3MM7A 5LMNF 3L2VA 3G87A 3R8YA 4IO1A 3QBCA 4NI2B 1RBVA 2G0JA 4E8UA 2M0GB 4CLYA 4CGDA 4I2PA 2V2QA 5E2QA 5H9EK 3AVMA 1WC1A 3H5YA 3E9PA 4B8AB 4HUFA 1JNZB 2NRZA 1YTUA 4JI6J 3TEGA 4L3NA 1JLAB 3AVFA 1QQCA 1HYSA 2NUHA 4B3SF 4OZ3A 2B7BB 1U7LA 2FZKB 2IBKA 1VQ6N 5AQVA 4DPOA 4LSLB 4WFBQ 3M9OB 3CJ9A 1WF0A 3WXJA 1Q9XA 3SAHA 1PO6A 4OZ1A 5HLFA 2YTCA 4JS5A 3F2KA 3BQ2A 4R79A 4JI0K 4M5LA 2ILZA 3HOTA 4CK3A 4RNNA 5C25A 1NPPA 4LF8J 2JVRA 4ZVTB 1IBMJ 2KT3A 4DF4A 1TL1A 1WC4A 3VAJA 1GT8A 3MEKA 3EZWA 5KFPA 3KLFA 3CT9A 5ETQA 3NE6A 2G2YA 2V2VA 4PEOA 3KK1B 4JV5F 2IFXA 5HK4A 2IA0A 5ETMA 2F96A 1JLQA 5DRKA 3CJ2A 2BE7D 2E7VA 3Q23A 1HNZK 2DTJA 2O8DA 2XHCA 5BR8F 2D3O1 3S7RA 4H5VA 3NL0A 3QIPB 3QEXA 3VA3A 4CZCA 3B8AX 1LW2B 2XZWA 3H40A 1K8KB 1G15A 2UXCF 1Y7PA 4M63C 4EFHA 2QG9B 1R8AA 1LFPA 1B0PA 4O8KA 3MMVA 4LF9F 3CMEN 3PSFA 2MQ8A 3DLEA 3RYLA 2HVDA 3FZHA 5DG7A 1NGAA 3MAAB 5D0HA 4EO8A 3M8QB 2F9TA 5M2UA 1W0HA 1MMLA 2K2PA 3LOUA 1I3OB 1FXRA 2LEAA 4ANEA 1RT5A 1T8EA 2Y1IA 2GGPA 3SQGB 4K4ZA 1TUGB 4W98A 2M5YA 3PCOB 3M1VB 5GAEU 5FPMA 2DJWA 4KV8A 2ALZA 2QXLA 1WG4A 4FOEA 4G6VB 4C4WA 3VQSA 3R9PA 4GKJF 1IR0A 2DXEA 1ZC6A 4PG8A 3OA9A 2ZNYA 4NCGA 3PEJA 1S12A 4DXLA 4YEAA 4ZCIA 2NREA 3HT3A 2GVDA 2C2NA 4J9SA 3I0RB 1VK0A 4DI6A 1MDUB 2E20A 3LP2A 2FVRA 3CCSN 1RTIA 3VHQA 4EWTA 3OYLA 3KFWX 4C11A 3BJYA 2DPIA 2HS0A 1T44A 3LP1A 3I5BA 3CTRA 2MHEA 1KVKA 1KD1T 1FKPA 1LFWA 5BJRA 3SMPA 1H73A 1FWKA 4H4MB 1LKZA 1RI7A 2KO1A 3VAIA 2CPDA 4X84A 3DRSA 4EEYA 1M90O 3ILLA 4QR1A 2Y1JA 3CCLS 5A0YB 2LQ8A 3QNOA 3TWZA 2FTRA 4GKKK 4A8MP 1TUYA 4I6MA 3W64A 3OL9A 4CTAB 1REGX 2GQCA 3IGVA 4Z0UA 1M5VC 4LIWA 2MKKA 4NXNK 3SNNA 2MLZA 3ZX0A 3GTYX 2ZVIA 1C1BB 1VQMS 3OSNA 4OHVA 4YFUA 1FHTA 1RISA 5CCLA 3ZZYA 2XNQA 2BRLA 3RBZA 3VWSA 3BV8A 2KRRA 2RD5C 3HVTA 4P2SA 3WT0A 3R2CJ 3I33A 3ITHB 2WBRA 2BJEA 3QBXA 3B6BA 4X4QA 1HQEA 2E8AA 2PEBA 3EKUA 2C3PA 2C3OA 4W5RA 5GADI 1NJIO 4FWKA 3O1LA 5HVHA 2VF3A 2AD9A 3I4PA 3RVCA 4UZBA 4IBNA 4QYZJ 2BA9A 3SDEB 4Y00A 3MECA 3KJVB 4RW7A 1R3NA 3EZUA 5F9LA 2Z2YB 4DV5K 4IDKB 1HBNA 5M1PA 3L3VA 3TUJC 3CD5A 3FUYA 2VA3A 2EX3A 3HM9A 1J53A 3V9ZA 2D3ZA 1IO2A 1B7FA 3L09A 3QFUA 4ZLJA 1UEKA 2DFFA 2HGLA 2JWKA 1N6QB 1C2PA 1FRLA 3N4QA 1ASVA 3SPZA 1TUWA 1IBLJ 1WC6A 2HQGA 2FGOA 1AZSB 3D1QA 6FDRA 3LDSA 3HJVA 2NPIA 4G9ZA 3GV8B 1GTHA 2J76E 2DCUB 4IH5A 3JSBA 2DGQA 3VCDA 1UETA 2RDIA 2EWSA 2QI2A 3GL1A 1D9FA 1EWRA 2W01A 8ATCB 3GU0A 2CNNB 3SK3A 1WD6A 4CJKA 1OPIA 2KHCA 5AXMA 4ZPTR 1TL5A 1FWLA 3MUMP 2WRMA 2VHGA 3BN7A 3QJJA 2QYGA 5M1FA 3BEXA 4ED7A 3DOLB 2AA4A 2FVQA 3MX2A 4PZVA 4CDIA 3LZJA 5DK5A 2XMVA 2HKEA 4A2AA 5LJ3Y 2C3YA 2KDOA 1LWFB 2D69A 1HNVA 1WKJA 4AQYJ 4FF3A 4JKGA 3SBTA 4BDPA 2IAJA 5E3CA 4J7CA 2F8TA 2OA8A 1Q82T 5DJBA 2HAFA 3I55S 2LEBA 4O8UA 3MZIA 4N77A 5FD1A 5AXLA 1X3NA 1HARA 3C2PA 1FTCA 3QZ7A 4WYLA 2ZWHA 3LM2A 1RTHA 2L9DA 3R6MA 4JI5J 1KOOA 4MYUA 1TAQA 2E9RX 4DN0A 1G4CA 2ASYA 3RAQA 1UJ6A 3S3MA 5A76A 2LDIA 1D4XA 3VF2A 4KO0B 4G1QB 5ADZA 3CD6N 3ZT4A 3GIRA 2IM3A 3U6FA 2BW7A 4O0IA 1U45A 2JEJA 2YNGA 1FEEA 3BZKA 1EHWA 5KG0A 4LD0A 3PACA 2UP1A 4NLSA 2GQ2A 2MLXA 1JJHA 4KC5A 4X4SA 4Q2MA 1SI9A 2KFYA 1BLUA 3V81A 4OI6A 3CCJN 2AP1A 1F9FA 3ELHA 2KXFA 2F65A 1W7AA 3PW4A 3TTFA 1G1XA 5F8IA 4NWBA 3W9JA 3J7YP 4PR6A 2BQRA 1LOTB 4J8FA 3FBCA 3J80O 2O8BB 1HNXF 3I96A 1V4SA 3KUGA 2GTDA 3THYB 1XI1A 4IEIA 4YB7A 4ECTA 3MAHA 3I9ZA 2DHXA 4K7QA 4NCAA 3I32A 4P9SA 2CJYB 1Q1KA 4DQIA 3QSYB 2YX4A 3HD1A 1JB0C 3DRPA 3D9BA 3J81j 2J4RA 2BXJA 5HMWA 1VC6A 4D3GA 2I5JA 1RHJB 2KL8A 2OD6A 3CD7A 3QMQA 1DURA 2PFFB 4HTUA 4RO0A 1Q7YT 4NLOA 5B8HA 3FBEA 1KEKA 2VG7A 3CCZA 3C7NA 4OX9F 2ACMA 3I56S 4CO4A 3BN4A 3FRYA 3O3HA 4DR7J 3O9RA 3HTVA 2GMJA 3MM8B 1RTJA 4DTMA 1ZPVA 3GIMA 1IBKK 3BSCA 4YB1P 1QTMA 4IG3B 1C0UB 4FK2A 2KI2A 3O9UA 2VFTA 1HLWA 1BWFO 4JI7F 4USUA 5AQQA 1M1HA 3OYCA 4F2RA 4NA3A 1YJNN 2HRTA 8AT1B 1N54B 4B3MF 1IM4A 2XM3A 1WTBA 4QIWD 4M95A 1KVBA 1SJRA 4F3QA 4GVMA 1N0VC 2IHR1 4TNOA 4LBHA 3EO3A 3DU6A 3G0ZA 1Y5LB 1HMVB 3DM2B 1N34J 1HKCA 1B9FA 1NK6A 4ZLNA 2ITMA 2YX6A 1XUPO 3C16B 3TU5A 2IMWP 3P83D 3HSJA 2PBDA 1VSMA 1N36K 4LF7J 1FE0A 4N8OA 3O5TB 3DLGA 3AT1B 2DHHA 4LT6A 3WC2A 3ENWA 1HNIA 1SJFA 2AHOB 2HYIB 1ILYA 3R7SB 2KFNA 1NK0A 2ZGZA 4K0KK 4FZZA 1VRTB 3L9ZA 1WF2A 1A7GE 3N5FA 1ZETA 3IFRA 2AGQA 1TUVA 2UXDJ 1YWXA 4I7FA 1ZZNA 3QAEA 3BBFA 3HVRA 4F0KA 2YNHA 3E2EA 4KSEB 3A5OC 2Q97A 4FYVB 1YXQA 2WHOA 3R5JB 2V4JB 3GCXP 3OL7A 1DFDA 2N3LA 3PIPQ 2YHBA 2UYTA 3GG4A 1FK9A 3AD9C 2HBYB 5JS1A 1AA1B 4QPXA 3OS0A 1U1QA 4NX9A 2B43A 3TUPA 4M3UA 2V63A 3O4NA 5J2PB 4M7XA 1Y97A 4B1WB 4BRGA 2E2OA 2QWPA 3OD2A 3CULA 4GVEA 3KK3A 4ZTFA 4HWIA 3VQEA 4RLEA 2CQIA 3ZTRA 1XC3A 5AQNA 2ZDOA 1JJ4A 4NLPA 3QGIA 4HVJA 2AEMA 3MCPA 4FJXA 4WE1B 3AA9A 3H3NO 4JD2B 1YTAA 4HDHA 4EYHB 4FPIA 5IXUA 3IKMA 2L08A 3MR5A 3ISZA 4C3KA 4DSKA 4CI0B 3MM5B 2UUBK 1V9OA 4FWNA 4BR4A 2C3UA 2IJNA 4DL3A 1NGIA 3CJ3A 5T41A 1SH2A 2HIYA 5KPRA 2DNYA 1VQPN 3KJFB 2AV5A 2K7JA 2E5LJ 3PFEA 1ELOA 4ZCLA 2GAGC 4M63A 4CO1A 3CB4A 1LXNA 2QKKA 4XIUA 4L72B 4WFXA 3ZO7A 4OYBA 4NYPA 3VVTA 3PW7A 1U8WA 1CULA 3RBEA 5F0UA 3GFZA 4W5QA 4CHQA 3DI6A 2RT3A 4UOHA 2YVSA 1NAQA 4QWBA 2CZ9A 1SKRA 3HSDA 2XY5A 1RWUA 5IC6B 3CC7N 2WOMA 5EU7A 1WBDA 4KREA 3T6JA 1WSVA 1XNQJ 1PC5A 1RHUB 5KGXA 3IDHA 1BQMB 5K8MA 1NB2A 4CJUA 1VHFA 2BM1A 2C42A 1IKXB 2B9EA 1JKHA 3RW7A 3UE2A 4LFBF 1B0VA 4K4XA 4YN3B 5AXKA 4M5KA 5ITHA 2I2YA 1VGYA 4U7CA 2PO4A 2F8SA 4ID5B 2UU9K 2XYHB 1TKXB 4A46A 5KQ8A 2E44A 3BBCA 3FZLA 4NZ6A 5IT9Y 1CC7A 1TTHB 3IO1A 3HZGA 1FD2A 1RLDA 3DXMB 2Q1NA 4KHNA 4WYBA 5EHHA 1TFWA 5AQLA 5FPEA 3IWXA 2P9GA 1RT1A 2HOEA 4PA1A 3W9HA 2PYLA 2QSFA 2VG5A 3FLCO 4NB4A 4YOTA 1IKWB 3CDWA 1GOCA 5AFUH 3UDVA 1TFYA 3QDKA 4R5PB 3ILOA 1T9TA 2E1AA 3CCES 3QGGA 1CJTB 4P7VA 2ZBCA 1KD1O 3T1YF 3OHBA 3MMCA 3WIVA 1IBCB 2HS4A 3QIOA 1CEZA 2YKPA 3PHEA 4EP5A 1EP4B 2L9WA 2DNGA 2P9LA 5ETKA 3G8TA 1C0TB 2ZC4A 2O01C 3W2VA 3LDLA 3X1LB 4WF9L 5LMUJ 3C95A 4DV3J 3T1AA 2ZM6J 3OTEA 2ASOA 1V3SA 2HBKA 1NKEA 2JWLA 2WSCC 4MTPA 2UZAA 3IAM9 3FR0A 2VFSA 1SJ3P 3EL2A 1T05B 3AAQA 4ZVQB 3PY8A 3VQ7A 4IFYA 5DQGA 1S97A 2DNLA 1J5EF 3D3CJ 2VQEJ 3UCZP 3QT5A 1CS4B 3BKFA 2ZNZA 3UDCA 1WTFA 2WC9A 1RT3A 1VLYA 4FLZA 4JI3J 3SSRA 3BEGB 1HQUA 5AQTA 4E2FB 3TSPA 4J9QA 4CHPA 1NDCA 1T3OA 1G99A 3KJQB 3CEDA 4DV6K 1R59O 3HZEA 2P9IA 4CBWA 3GB0A 2UXBK 4K41A 2V34A 4L76A 1HBMA 2JVOA 4UUWA 4RBVA 4B3TJ 4TQRA 2GV9A 4CFDA 3AD7C 4BHQA 1WEZA 4J9PA 2OTLS 1VQNS 3M8WA 4KPCA 5CYJA 1ZPWX 2HFVA 3CO9A 2HQDA 4K4YA 3HJFA 1LAVA 3J7A1 1VR6A 1NOZA 4U8VA 1R0AA 2Z1JA 3CCMS 3HX9A 3THXB 4P74A 3DRRA 1KS2A 2APOA 3G8QA 2NXEA 2D3OR 1V5IB 1HUXA 4OPKA 3WNHA 2A5XA 3OTOK 4GNIA 1RAJA 1HBOB 1UCNA 4U67L 3ZCMA 4L74A 4USHA 2VJVA 1FRIA 5E3QA 2BMBA 5D4PA 3T9ZA 2ZBRA 4DR1J 3EGWB 4W5NA 4J9NA 4ILRA 4BC7A 3D6FB 4FWLA 4WFAL 3DFEA 3OUYB 4TSXA 2RQKA 2WVBA 4Q44A 3VALA 3BO4A 1KN6A 3G25A 2HQCA 4K5RA 1UOCA 4YDUC 5H9EJ 2HHUA 1TK8A 1YJ7A 1TVRA 5GAHP 1RYSA 1Q79A 3E8OA 1KR4A 4ANCA 5AQRA 3SCLE 4PL8A 4BR9A 1VQON 4F4YA 2OAUA 2RVJA 3C15B 3EVMA 2FHMA 4JN4A 2UUCK 3A8KA 1S6PB 1GOAA 1U1PA 4IZ9A 3FRZA 1VRUB 3IP0A 2Q66A 5ETSA 3CMAS 4ZVSB 4X62K 4HHJA 4DSFA 1GLFO 3LDPA 4H0PA 1U1OA 4GVBB 5AJ3K 3NBPA 1SL1A 2R3VA 1YLXA 3VZIA 2CQBA 2LU2A 4OI0A 3O3GA 1FESA 2GJIA 2RMLA 3QEIA 4JEPA 1X5OA 2IRXA 1HNZJ 5E3PA 4GRSA 1MN7A 2IRUA 1GXUA 4NASA 4DL7A 3Q7CA 2MTLA 4OYZA 3QT6A 2B4OA 1ZOTA 2PE8A 1DY3A 2O8CA 2IGIA 1XMBA 1UVJA 4QWCA 4OJ1A 1H0HB 4L3KA 3J7YU 5SZTA 4YHHK 2ITGA 2YNIB 5E84A 5AXNA 3LTOA 1HBUA 2R9LA 3ULEB 5LOQA 2C22A 5H9FK 4CZGA 1NPRA 3NF6A 4KAZA 4DQQA 3JQMA 3M2VA 4E98A 2JL9A 1RWVB 2J7WA 2W2PP 2ZFHA 1NGCA 4FJ7A 3V6HA 2VBXA 4V19S 1M5KC 2AX0A 3O9QA 1KQSM 2Q3PA 2B5JA 2H9ZA 4FWMA 2Z56B 4FWQA 1SL2A 3CCQN 4WFNQ 1NO8A 3V1OA 5IQQA 3Q0AA 4K4VA 2D74B 3IC1A 3G4SS 3ATVA 3OJUA 3NCIA 4GO5X 3R2DJ 1OIAA 1NJWA 2VIHA 1WAJA 3OYFA 5BYQA 4LSZB 2C2KB 4DTXA 4LSNB 2FJEB 3SIPB 2SXLA 3D0IE 1K9MT 3TVKA 2IVOA 4PXDA 1YJVA 5B0EA 3OW2M 4URQU 4Y0FA 2XLKA 3QB0A 3NGYA 3O1WA 2VQFF 1X4CA 4O5FA 2OPPB 4V19J 2X1FA 4ED0A 4ISGA 4ZVOB 4LUBA 2QV6A 3CJ0A 1GLDG 5LMNK 4OHYA 5D0EA 2XWXA 2FJBB 4K4SA 1UL3A 1RYRA 4GKKJ 1RTDA 2WB4A 1VIOA 3MK6A 4BE0A 1QQMA 5JVGL 2QKBA 3SQ0A 1X4GA 3U9DA 2VWJA 1O51A 4OI3A 2OEMA 3GBTA 4ILGB 4NXNJ 4FJIA 1EKRA 3MXJA 3DN9A 3Q83A 5HROB 2KVQE 1SCJB 2LA4A 1XBWA 4D3HA 2IJFA 3MEEB 4IWVA 1RT4A 4X64F 4OZ2A 3CJ7A 3HPGA 3QEPA 2ERRA 5E41A 3HI0A 3PYFA 3EE9A 3BGFA 3MEDB 5F2RA 1FXLA 4NYNA 3AGRA 2GUPA 4JV5K 2G8WA 3OR1B 1G3OA 1FKOB 3QWPA 2YKNB 2QMUB 4NLVA 2YPYA 3KLHA 1UJ5A 5BR8K 2HGNA 2BJ3A 2QX0A 4WK3A 5LSOA 2VOOA 3HLUA 3DCAA 1D9DA 5KFYA 1WACA 5FDLB 3R5BA 4LH4A 4MIWA 2ZVSA 3KLEA 3IRXA 4J37A 1VQKN 1I51B 4CJTA 3THPA 3BY5A 5SUHA 4ZHRB 2JEFA 2HNYA 3QIDA 3VQCA 3K0JA 3B4MA 1P8ZA 2DBBA 2VGNA 2BGGA 4DV5J 2UXCK 5DM7Q 4RNFA 3LQVA 4CEZA 4LF9K 1NNDA 3VQ9A 1CBKA 2D3UA 2W9BA 3QT7A 4LR8A 4LF1A 2AYEA 4USKA 3R97A 4CK1A 4OV1A 5T7BA 1M5HA 3MWTA 2IC3B 3THWA 3VEYA 3LDNA 3QJPA 4FBTA 3KTQA 2XYPB 5GMDA 4DV2F 3ZETA 4DQRA 3I8BA 4KHWA 1JLBA 2L3MA 4KIAA 3BUZB 3P8BB 5KG6A 1Q9YA 3VZHA 3KUEA 3LF0A 3LAKA 2W2MP 3P5TL 3ICLA 4WPAA 3OYHA 1RA6A 3TO8A 2E2PA 2U2FA 1HKAA 3C6UB 2FBVA 3ENQA 2ZGYA 2MZTA 2N7YA 1MMDA 3PXGa 3AVCA 5JS2A 1FWPA 3IWLA 2XTJP 1S9FA 3K9JA 2DGWA 3BR9A 4KFBA 2XBPA 1U6BA 1UWAA 4OLBA 2ROEA 1NSQA 5A2QO 5CYMB 2CPEA 1NOYA 2GIRA 2LA6A 1VK3A 4M3XA 1K47A 3CCLN 1RU1A 2KVIA 4AF1A 1E6YB 2I7PA 4DBQA 1WHWA 1K8AT 3IBWA 4USJC 1CJUB 4GW6A 5HQ8A 3R3LA 3C6AA 4IOXA 3MX5A 1IR2A 1FD8A 1Z05A 3IAS9 4CCHA 3JAMU 2D1KA 4TQSA 1N5TA 3IS9A 1VQMN 1VJQA 4FK0A 3C65A 2Y8WA 2RU3A 4CLLA 4O5BA 1YUWA 3L0QA 3DLBA 4CHNA 5B7WA 2BRKA 4K59A 2DR8A 1FI4A 4HTIA 1B3TA 4LF6F 2C1EB 4OJHA 4OZ0A 3CJQA 2VU5A 4U9RA 2OPRB 5ADXA 4ILMA 4IDHA 2XG8A 2HLTA 3HHLA 1NSPA 3NEKA 3M6GA 3X3UA 3OVNA 2VPZB 4B8CA 3HD2A 4DL6A 3M8ZA 1XMQF 3D0HE 1YJUA 1SIWB 4DSLA 1AROP 3L6QA 4IQMA 4CERA 1YGYA 2KJVA 5J2MB 2IS3A 1JQGA 3DLJA 1RWOB 4JRQA 1FVQA 2YNFB 4R8UB 3S9HA 1TMJA 5C2GA 3VA0A 3KWMA 5EUHA 2VKZG 5BPMA 4FL9A 2EKNA 5EN1A 3A8JA 1YRXA 4E7IA 1T9UA 3IBCB 2VDHA 3KK7A 3BR8A 2LXUA 2QE5A 3ZTSA 3B78A 1UAWA 1Y9OA 3QAUA 1JLFB 3QEWA 4YDXA 2W2QP 3W3DA 3A8IA 1YK9A 4YR0A 3K5OA 2VKRA 3LM9A 3W8GA 1OYDA 2EVZA 3H45C 3QNWB 2JLFA 4FNIA 4NXMF 3FBFA 3KLIA 2DD8S 5JMNA 4KRFA 1IBKJ 3MM6A 5LXRA 2R7XA 3I0SA 2RUGA 4CJ5A 1TYQB 1RBAA 2G1HA 2M3DA 3AAWB 2RRAA 3UDLA 1K44A 2MYFA 4Q2LA 3DHXA 3J81U 4C3MA 2UVRA 1T02A 3DXSX 1PYSB 2P8IA 2VDIA 2GV1A 4ZVGA 1H2VZ 3TAQA 2P1JA 4CEEA 1YJRA 2A2DA 5KFDA 4O4GA 3AXMA 3VV2B 2MQNA 3GIJA 3RB6A 2DO0A 5DGAA 1RT2B 1SUQB 4CLPA 4KGVB 5GAHU 3JTPA 1N36J 4RW8A 3I55N 2ZF5O 4OKKA 2CQ3A 3FVYA 4ZVPB 2F4VJ 2I38A 4JI8F 3M8RA 2QRRA 4F4AA 5L39A 4B9QA 4K0KJ 1EETB 2J9DA 2PSZA 3DLKA 4NLTA 4AE5A 1SH3A 4HHUA 4CM2A 3T5KA 4IJAA 3RR7A 3NXZA 2BV3A 3CPWM 5AQKA 2QGFB 4YDUA 2BQUA 3E01B 2K1RA 4OPHA 2KG0A 2NS1B 2DRAA 5KOXA 4FOIA 3FFIA 3MPYA 3OV7A 4WJBA 4NI2A 3HBTA 1JJ2M 3TWHA 4ALZA 3PX0A 4IKFA 2R7SA 3HXMA 3TZWA 4Y3CA 3E66A 3TRGA 5DDQC 4BRMA 4LSLA 3CQXA 2B7CB 4QCLA 3TUZC 4MFBB 3VQ8A 1JXEA 2XMAA 2W24A 1X5TA 5D3GB 1VYAA 3DOMA 3UD4P 2RHSB 1VSDA 1ZBUA 1UPMB 1SL0A 2V50A 3ULHA 4FZXC 3VERA 4OZLA 3GJRB 3H5UA 2W6KA 1H1VA 3J7AP 3CDUA 1BMQB 4LJMA 3HL8A 2NXUA 1HRHA 2UUBJ 5KFGA 1R0CB 1P8GA 3BGRA 4XAKA 4NZ0A 1IKYA 1HNXK 3NAHA 3U8XA 1OVQA 3G82A 3HSZA 2FGCA 4RW4B 3W3SA 1UPPA 2Y0SD 4GC7A 3CMES 3D66A 2XMWA 3QIPA 5FPNA 3OYNA 1NK5A 4WIIA 1LW2A 2ROGA 2CQDA 3IFEA