3KK1A

Hiv-1 reverse transcriptase-dna complex with nuceotide inhibitor gs-9148-diphosphate bound in nucleotide site
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
555
structure length
555
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 148
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk1A05
1VSMA 3V6DB 4YR2A 3KK2A 4GW6A 3VQDA 4CHNA 1GOCA 5F8JA 3HKWA 3QYYA 3KTQA 2G8UA 4FCYA 2FVQA 4DL3A 1JLQB 5C24B 2GIQA 4ZTJA 3RB0A 4CFBA 4RW8B 1TAQA 2GV9A 2OPRB 2NUBA 3H5YA 4RNFA 3CDEA 1JLBA 3BQ1A 2AGQA 1UWBB 4KAZA 4NLRA 3V4IB 1J54A 1ZTWA 4R5PB 2B43A 1R0AA 4DS5A 4DTXA 1D5AA 3LDSA 4I2PB 2B4JA 2BE2A 1T05B 1K6YA 4FW1A 4IH7A 4YR3A 1ZBIA 3NGIA 1RDAA 1VRUA 3PR4A 2C2EA 3AVJA 2ITGA 2YV0X 3M8RA 2I1RA 3CJ0A 5HRRA 1Q9XA 1B92A 4J9RA 4IFVA 4EP5A 4FM0A 4QWCA 2RDIA 3PO4A 3IRXA 1S6PA 4DFKA 5HLFA 3MR3A 4W5TA 4Y2CA 4MKBA 1RBUA 3E01A 1TV6A 4NCGA 1RT7A 2BDPA 4CJKA 3OL6A 3K5MA 2ZE2A 3GIMA 3KLFA 2VG6A 3T19A 2IJFA 3H5XA 2OYQA 4GC6A 1FKPA 1LAVA 3CWJA 3ZT3A 4ZMMA 1A5XA 3S3NA 4CJVA 1N5YA 4N76A 2IC3B 1SKSA 4U7CA 2O5DA 5KFPA 4FLXA 4Q5VA 3BSAA 3CFOA 4PA1A 1X9WA 4TYAA 3FFIB 4F2SA 4B9SA 5JS1A 2HNZA 3TQ1A 3QINA 4ZVFA 3I8DA 3DRRB 4NYNA 3IGNA 3I0SA 2Y1IA 3KJVB 1XHZA 3RR7A 5KG0A 4IDKA 3LZJA 1T7PA 1CXUA 5CYQB 1FXXA 1JL2A 1IKWB 3DLEA 4J9OA 4CK2A 4WFZA 4Q8FA 4C8LA 4GC7A 4ECVA 3KLHB 4Z4EA 3CDWA 3TABA 4FJ5A 2YKMB 3DLRA 3TAEA 4KTWA 2GC8A 5KFEA 4R8UA 4CF8A 2KTQA 1L5UA 4NLSA 4KREA 3PX4A 2W9AA 4B9LA 4TXSA 5KFGA 4FLWA 4KKOA 2R8KA 3AVLA 4DL2A 2P1JA 1SL1A 3VQEA 1NKCA 3OYEA 4H4MA 3N6MA 4CHQA 4CEAA 2R8HA 1Q8IA 4K4VA 2YHBA 3KMSA 4RW6A 3QIOA 3TVKA 4H54A 4ID5A 5L9XA 4O3QA 3DOLA 1QHTA 4ZP8A 3C6UA 4EO6A 3DLHA 3HSTB 4RNHA 1HPZA 1RT1A 1S10A 2IM0A 2P5OA 1S1XB 5KFTA 2W9BB 4K50A 3U3YA 4URSA 1HNVB 3SV3A 4FJIA 2P5GA 3OL9A 3BR9A 3T5JA 4O3RA 3G6YA 1TL1B 1LWCB 1XWLA 5KFSA 4IG0A 4KV8B 3S3MA 1JXLA 4F4XA 4NYZA 4FJ7A 2YNIA 4RW9B 2B5JA 4QWDA 3DI6A 3VQ8A 4QWAA 4TY9A 1TKZB 3GV5B 4JS4A 1IH7A 3MEGB 5SWMA 1CZ9A 3QLHA 2VG7B 5KGXA 3OLBA 4ID1A 2ZKUA 3OS2A 3OJUA 3NBPA 4RW4A 4NLWA 4AHCA 3O3FA 2YNGA 4DF4A 3T5LA 1JIHA 4FLUA 4ECYA 1SV5A 5L1JA 4ECUA 3NL0A 4FK0A 2UVVA 2QE5A 4Y34A 4IG3A 1N6QB 3ZT0A 2W9CA 4ZVHA 5KFJA 2WHOA 3KK3B 2BQUA 5KRSA 3HPGA 4J2EA 1RCHA 4O4RA 2F8TA 3BREA 4BDPA 4J9QA 2GBZA 3SQ0A 1L3TA 4Z4HA 2RKIB 2OPPB 4QWEA 3U3GA 3B6OA 4IRCA 1RTJA 2EHGA 4ZPAA 3GV8B 1HMVA 3G10A 2UUWA 2J6TA 5KG2A 4E7HA 4I7FB 1S1TB 1U49A 1A5WA 3NH2A 4FZYA 1VSHA 3P5JA 3C6TB 4DLEA 1RT2A 1G15A 2AX1A 1ZBUA 4KBIA 3PUFA 4X2BA 3FSIA 2IBKA 5KFQA 4CCHA 4FJNA 1D9FA 4ECZA 2R7YA 2WRMA 3M8SA 1VSEA 3H5UA 1SH0A 3NH0A 3B6PA 1RT4B 3DRSA 5KFMA 2JC0A 4DL4A 4JV2A 4OPKA 4J9NA 3OYFA 2FLLA 3MECA 2V9WA 2W8LA 4DL7A 4CJ5A 5HP1A 3SJJA 2AGPA 5KFNA 2ILZA 2JC1A 4YFUA 4OLBA 2X6SA 3V1OA 4B8CA 3QZ7A 3MXJA 1ZBFA 4CHYA 3TI0A 4ECXA 4HUEA 4J9PA 1SUQA 4RUAA 5KGWA 3RB4A 3LWLA 3HO1A 1WSIA 3V9SA 5J2MA 1X9MA 1HRHA 4ED1A 4FZZA 3QIPA 4CF1A 4NLDA 3V9WA 3IS9A 4TLRA 1IKYB 4CJRA 3PJXA 4O44B 4Q8EA 4DS4A 2I5JA 4FBTA 5KT5A 3O3HA 1S1WA 4XPEA 3SI8A 1A5VA 1TL3B 3HP6A 4E7IA 2VWKA 1MU2B 4M42A 3AA5X 3SQ4A 4K8ZA 4RW7A 3PV8A 4RG8A 1U4BA 1BQMA 4FJ8A 1T94A 3IAYA 3RAXA 1IKVA 4MH8A 4CIGA 2A1RA 3H98A 4CEDA 2KZMA 4LSNA 4FK4A 5KFXA 3M9NB 3MR2A 5DLGA 3AVFA 3HYFA 2VG5A 3HK2A 1NKBA 4I9LA 3KLVA 3OSPA 4N5SA 1YVUA 1W25A 1JLAA 3KHHA 5J2QB 4DTSA 5D3GB 1NHUA 2YHAA 1RT5A 4DTRA 1N4LA 1QUVA 2XGPA 2BE2B 2OZMA 4KHUA 3VQ9A 4HUFA 3SFGA 3TARA 4CHOA 4DQPA 1DTQB 3WNEA 4W5OA 3VQBA 4FJGA 5KT2A 1JLEB 3K5OA 4EBEA 4N41A 1T03A 4DTUA 3IRXB 3P83D 2X74A 1RTIB 5DGBA 4F2RA 1TV6B 2FJWA 1YTAA 2DFFA 3OYNA 4E89A 2HHTA 2ZE2B 2AWZA 2W7PA 3EZUA 1S5JA 3WNFA 4KHQA 4HYKA 1Z26A 5CY4A 2O4IA 2XGQA 1JLFA 3BQ0A 5KG4A 1HYSA 3M8QA 4ZHRA 3KLGA 3SPZA 1VSFA 3VQPA 1Z4UA 3KKRA 3MEDA 1RT6B 5KT7A 5CYMB 3VQ6A 3LZIA 4NRUA 1S0OA 4ICLB 3VQ5A 2ZD1A 1LWFA 1EKEA 3JYTB 3P1GA 3G6XA 1IKXB 5FDLB 1K1SA 3NAHA 2PYLA 3KLIA 5DQGA 1BI4A 3EPGA 2O4GA 1KTQA 4FJHA 3PJWA 3KHLA 1LW2B 3BJYA 4FK2A 4J2BA 2IAJB 4CGGA 2KW4A 2V4RA 5I42B 1UAXA 1HARA 2FJVA 1RDCA 2B6AB 3IG1A 1DTTB 4CJ3A 1QTMA 4ZP9A 3SQ1A 2YNHA 3CFPA 2J6SA 2XY5A 1QAJA 5KFFA 3OVNA 4KHSA 1J53A 4NCAA 3GIIA 1RDDA 4J2AA 2OPQA 2WOMA 3T5HA 3HVTB 3ISND 1X1PA 2X6NA 4ED0A 4NLGA 1HYZA 4OKKA 3HVWA 3ZSXA 3RMAA 4GVMA 3ITHB 4ZPDA 2FVPA 4CF0A 5HRPA 4DSIA 2XI2A 3PZPA 4DTPA 1S1VA 1F21A 3L2WA 1J9AA 1W9HA 5L1IA 1BL3A 3C6UB 4XO0A 1REVA 4OL8A 3UR0A 4PY5A 4O3PA 3QEXA 5KG6A 3THVA 2KQ2A 3AVAA 4B8AB 5KT4A 3CJ5A 3QGHA 4MK9A 3PW7A 5DGAA 2HHQA 2A1SA 1IO2A 1KLMA 4PQUB 4OLAA 4K4WA 4URQU 2HNYA 2D5RA 3TWHA 4IG0B 3D45A 3HVAA 4E1MA 3V9ZA 4DQQA 3VA0A 4F4YA 4NLQA 2B5JB 4CGJA 5DG8A 5EWFA 2Y1JA 4DG1A 4RNNA 3ZT2A 2C2DA 4Z0UA 3TR8A 4RU9A 4M45A 1HNIB 3RB6A 1C1CA 3CJ2A 4IRDA 5KI6A 5FROA 3DRPB 1QE1A 4I2QA 4RW4B 4Q45A 3KKSA 4O4GB 1NJXA 1BCOA 3V81B 4OJRA 5EU7A 4M3UA 3Q8QB 3OYKA 1OS5A 3S9HA 3VA3A 3LP1A 2IJNA 3OS0A 4GMJB 3NFAA 4FJKA 1C0UB 4F4WA 1JKHA 4FJMA 1U45A 3SPYA 3QEVA 1S1UB 4ZPCA 4WFYA 4DWIA 3HPHA 5K14B 2F8SA 3NDKA 1JLCB 2C2RA 2ASLA 3K57A 3AO3A 4DSFA 4OGEA 1U47A 5HBMB 3PW5A 1RBTA 1TKXB 1HMVB 2RF2B 3RAQA 4BWJA 1QSYA 5KFKA 2VA3A 1WNSA 1ZTTA 5KFIA 3VQAA 3LALA 3GIJA 2FVSA 2RPIA 5HRNA 1NJWA 4NYFA 2HMIA 2ZQBA 4WE1A 4O55A 4Z4GA 4QOZB 3KIOA 1C6VA 3V9UA 3PW2A 1WSFA 1SH2A 2VA2A 3PX6A 3K59A 5F8GA 3OYJA 1S97A 4ZVGA 4IRKA 3AO2A 1JLGB 3I5BA 4G1QA 4HVJA 2BANA 2WK4A 1C1BB 1XR5A 2QV6A 1RNHA 1DLOA 3MEEA 3OYIA 1RBVA 4LSLA 2G8VA 3HPOA 3OYDA 4LQ9A 3OYAA 3QIDA 3KHRA 3C95A 3M8PB 3NAEA 5KFCA 5KFRA 1FK9B 4JRQA 2YNFA 3LP2B 3DYAB 2JEJA 4K4YA 5KG1A 5F9NA 3CFRA 3M9MB 4KRFA 1N56A 4HCCA 2E6LA 5T7BA 2FLNA 3T1AA 1WN7A 2E9TA 1S1WB 1BQNB 1CXQA 4ZP6A 5C25A 3AVMA 3V9XA 4MIAA 4MFBA 4FS2A 1U09A 3L8BA 4ELUA 4KPYA 3OL7A 1EP4A 4DF8A 1RT3B 4ED8A 1B9DA 1W0HA 4K8XA 1S9GB 2OH2A 4FBUA 3QO9A 3DOKB 1YT3A 1EETA 3SNNA 5KFUA 2VG5B 1RTHB 1TKTA 3PHEA 3DMJB 1L3UA 5I3UB 1JLAB 5J2PA 1ZBHA 4Q0BA 3GILA 4KTQA 1HQEA 3QETA 4KFBA 1BIUA 1FKOB 1RT5B 2OPSA 3LPUA 3QZ8A 3UDLA 4IFYA 4PUOB 1ASUA 3RR8A 2WCXA 3ISNC 1XC9A 4KO0A 2JEGA 3KMQA 4CFDA 3LP0A 4FVMA 1S6QA 5L1LA 4IR9A 4DEZA 1BCMA 3V6DA 1RA6A 1U48A 2C28A 4OKEA 2X78A 4H4OB 1C1AA 4W5RA 1JLQA 4AHUA 4Q43A 3U6FA 4KHWA 3A2FA 1BGXT 4F3OA 2D7SA 5KG3A 5KFHA 4RW8A 4Z4IA 4JV0A 4IH6A 4O5BA 2OPRA 5HRSA 3TAMB 1JLFB 3H59A 4ZHRB 4JRPA 2UVWA 1UWBA 4Y2AA 3V4IA 1RTDB 3NKYA 4CJWA 4R5PA 3V6KA 3JSMB 4CEZA 4PWDB 1VSDA 4I2PA 4DFPA 1T05A 5KT6A 3UPFA 4DU4A 4B9VA 3Q8PB 3HM9A 3MXMA 4QWBA 2QKBA 2HWIA 5FRNA 2PZSA 1TKDA 1LWFB 4FJJA 3MFHA 4I9QA 1J5OB 2YKNB 4CJQA 3CJ4A 4B3OB 4LH4A 3I5AA 4HKQA 3O3GA 1EX4A 3H2LA 2D41A 3AVIA 2D0AA 1S9EB 3DLGB 3RRHA 2HNDB 3I0RA 3K2PA 3SI6A 1CZBA 4FM2A 4FLTA 1QS4A 4CERA 2R2UA 1T8EA 5J2NB 3AVNA 2LSNA 4CECA 4TY8B 1NOYA 2BQ3A 2E9ZA 4KB7A 4DTOA 4WZMA 2IC3A 3ZSRA 3EZ5A 1S49A 2OPQB 3QGIA 3OYGA 1C0TA 4M94A 2WOMB 1SH3A 1NJYA 4EO8A 3FFIA 2XCAA 3M9OB 2ETJA 2R2SA 1VSJA 3E51A 3DRRA 2FBYA 2JGUA 2HHXA 3AA3A 4OGCA 2QKKA 3HJFA 5CYQA 1IKWA 4IOBA 3OLAA 1ITGA 5KFVA 3L2RA 1SKWA 3AVHA 3HXMA 4DQSA 3IN5A 4YMEA 4M3XA 3KLHA 4FJXA 3V6JA 3L2UA 4CK1A 2YKMA 2EX3A 3AO1A 1K1QA 4E0DA 3ULDA 3KK2B 5EWEA 4F4ZA 4CEQA 1KLMB 4JV1A 3OYBA 4WXWA 3HT3A 2ASJA 5F8LA 5KFOA 4E1NA 4DQRA 1NNDA 4KTZA 4TQRA 4J9KA 2DTUA 1SKRA 3OYLA 2UUTA 4HUGA 3QNNA 5F8IA 3TAFA 1TQLA 3NAIA 2JEIA 1VK0A 1LW0A 4CHZA 1WSEA 4ECQA 4F8RA 4DFMA 1JLBB 2AX0A 4CJ4A 1LWEA 2P51A 1C1CB 2FBVA 2G8IA 4BE0A 3PY8A 4KHYA 2IOCA 1R0AB 3NGYA 1QE1B 1QQCA 4YNQA 2BRLA 2GUIA 2Z1HA 2PYJA 4B9MA 3O4NA 4CJSA 3QESA 2FJXA 3BSNA 1WSGA 1VRUB 1NHVA 2R8GA 3CYMA 4DMNA 1S1XA 2W9BA 1HNVA 4IFVB 2KFZA 3KD1E 4CJTA 1TL1A 1LWCA 1KVAA 4OPJA 3AVKA 1RBSA 4AHVA 1D9DA 1S6PB 5HLFB 4KV8A 2RN2A 4M3ZA 3KD5E 5HROA 2R8JA 3E01B 1NK4A 4FJLA 4NCGB 1RT7B 3QEWA 2G8WA 4RW9A 3BQ2A 3KLFB 4EZ6A 2VG6B 5KFZA 1TKZA 3FDSA 3MEGA 1KVBA 3GIKA 2VG7A 1FKPB 2IGIA 2WONA 3NCIA 2IM1A 1N5YB 1RYSA 3NF9A 3CM6A 4IKAA 1WNEA 4K4ZA 5KRTA 3GV7B 4IR1A 3QEIA 4J9LA 4WYLA 1N6QA 2HNZB 3Q8SB 4AILC 5C42A 1JX4A 4E7JA 2G8FA 1S9FA 3I0SB 2BQRA 4K4SA 3ZSVA 4B08A 4KB0A 4IDKB 2RKIA 4G1QB 3ZT4A 4HHTA 3DLEB 3QEPA 1DLOB 4HCBA 1QSSA 4CJLA 2CJQA 1S1TA 5F8NA 3SCXA 3WNGA 1NK5A 3BSCA 4FLYA 3C6TA 4ED7A 4DU3A 3CDUA 4ED3A 3RB3A 5DQIA 4N47A 1CSJA 4R8UB 4NLPA 2AGOA 1TK0A 3OYCA 2KFNA 4LD0A 3UQSA 3LANA 4DL5A 2E6MA 4KHRA 4CIEA 4ECRA 4LH5A 4KKOB 5FRMA 4UQGA 5EUHA 1QAIA 1HQUA 1RT4A 4DTNA 2DFEA 4H4MB 2Z1GA 3N6LA 4ELTA 5CZ2A 3HL8A 4MQ3A 3H4BA 4NLOA 2QXFA 3TAPA 4NLVA 4ED6A 4FW2A 4RW6B 4M41A 4AHSA 4ID5B 2V0NA 4Y1DA 3RWUA 2IM2A 3DOLB 4EBDA 3T5KA 1RDBA 2DY4A 4O3SA 3ZT1A 4F4KA 3KLEA 4B9NA 3SUPA 1HPZB 1TKTB 1RT1B 2R2TA 2ATLA 4RZRA 2AQ4A 5J2PB 4FM1A 1XR7A 3KOAA 3V6HA 3V1RA 3L2QA 3PO5A 1IKYA 3NF8A 3O4QA 4BDZA 4O44A 2R8IA 3KK1A 4J2DA 4FYDA 5KFLA 4WXOA 2UVUA 1TL3A 4KO0B 4E7LA 1U04A 4E19A 1MU2A 1KHWA 2CKWA 1ZYQA 4ELVA 4DTJA 3L3VA 2YNIB 4DU1A 2C22A 3DI6B 4W5QA 5DLFA 3BGRA 1D0EA 3QLHB 4O3NA 4FS1A 3OHBA 4O0JA 4QW9A 3PW0A 3PR5B 3NBPB 2XHBA 1L3VA 3NGDA 3OHAA 2YNGB 2AU0A 4DSKA 1SV5B 3AA2A 2WTFA 2HHUA 3D0PA 4IG3B 5J2QA 4QAGA 1RILA 3K5NA 1NJZA 2F8EX 2W9CB 4O3OA 4CJEA 3RBDA 4CFCA 5D3GA 2XCPA 4KB1A 3LPTA 1ASWA 4FXDA 3AA4A 5KFYA 4LQ3A 4R0EA 4RNMA 3H08A 2XY7A 1VSIA 2Z1JA 2IDOA 3HP9A 4ECTA 1TP7A 1I3AA 3IGVA 1RTJB 1DTQA 1TK5A 3OYMA 1JLEA 1RDRA 2XWYA 2D0BA 5KFWA 1UA1A 3ALYA 2BR0A 2DPJA 1KCFA 1RT2B 1RTIA 4CJUA 3OJSA 4KHNA 3I0RB 4CEFA 1ZETA 3F73A 4B9UA 3T3FA 4MIBA 4BE2A 3DRSB 2HB5A 1KLNA 4K4UA 1RT6A 5CYMA 3MECB 1X9SA 5HP1B 3NH1A 4ZTFA 4CJFA 1JXBA 1C0TB 4ICLA 3S3OA 3G0ZA 3SUQA 4NRTA 1GX5A 4TYBA 2OA8A 4J9MA 3JYTA 3DM2A 1IKXA 1SUQB 4KI6A 5FDLA 1TK8A 4MK7A 5J2MB 4CIFA 4KHMA 3AVBA 3QIPB 1KHVA 1S48A 3IS9B 3G86A 3GYNA 2HAIA 4M3TA 1LW2A 3RMBA 3G6VA 2IAJA 3BSOA 4AHTA 2XO7A 4WFXA 5I42A 3RMCA 3SUNA 2B6AA 2I5JB 1DTTA 4CGHA 5EWGA 5KTQA 3D28A 3LWMA 4NCBA 4FLZA 2HHSA 4RW7B 2ALZA 2HW3A 1YVFA 3TANA 3RTVA 4M3WA 1VSLA 4U6PA 1XHXA 1BQMB 2GIRA 4QPXA 4KSEB 4NLUA 1IKVB 4MKAA 5CZ1A 3HVTA 1VRTA 4LSNB 3ZSQA 4XIUA 5DQHA 1TVRA 3DLKA 4CHPA 3AVCA 4NLXA 3ITHA 3K5LA 4QW8A 1LW0B 2KZZA 5KFAA 3SZ2A 3MFIA 5J1EA 4CF2A 4EYHB 4H8KA 4KAIA 3CJ3A 4CJPA 1D1UA 5JS2A 3CVKA 3VN5A 1T3NA 1LWEB 2OZSA 2HVIA 2VWJA 3DLBA 2WB4A 4IKFA 2E4LA 2XRIA 5JUMA 1YTUA 5KT3A 1JL1A 5EDWA 3AO5A 4DFJA 2XY6A 4FJ9A 4NLYA 3K58A 4EYIB 2BRKA 4K4TA 1KVCA 5KG5A 1ASVA 2JLEA 4PQUA 4NLTA 2HHVA 3FQLA 4E7KA 1NK8A 4B9TA 3Q8RB 1T03B 5C24A 3VQSA 3OY9A 1GX6A 5HROB 2G8KA 3RBEA 1TAUA 1JXEA 2FBXA 4NZ0A 1WLJA 3ZSYA 3ZSOA 1HYSB 5DG7A 3M8QB 3H40A 1N48A 1GOBA 3KLGB 2WONB 1HNIA 4TQSA 4O0IA 3FQKA 1KRPA 5SZTA 3H5SA 3DRPA 3MEDB 2IMWP 2UVRA 1Z25A 3CO9A 1CLQA 3MR6A 4O4GA 4CEEA 3V81A 5T14A 3RMDA 1KFSA 1I39A 3SFUA 3F9KA 3SQ2A 3OL8A 4FZXC 2ZD1B 1WSHA 1VSKA 4JUZA 5C42B 1C0UA 3KLIB 1WAJA 2FLPA 1BI4B 4DSLA 1NKEA 1UOCA 4CGFA 3EPIA 1S1UA 1IM4A 4ED2A 5K14A 4EEYA 1JLCA 4BDYA 2FVRA 1RYRA 5HBMA 1BIZA 4IH5A 3SUOA 1TKXA 3IG1B 1LAWA 2HWHA 2RF2A 5JXSA 1RBRA 3L2VA 2YNHB 3HHKA 1NK6A 3TAGA 2JEFA 4N56A 1Y97A 4Z4FA 3MTKA 4WYWA 3OS1A 1D8YA 3VQCA 4DQIA 2EC0A 3QNOA 1RAJA 4C8NA 4ZVEA 4JLHA 2IM3A 4ZPBA 4RNOA 3AVGA 1HQUB 3NF7A 4Z4CA 4K4XA 4LY7A 3EYZA 1JLGA 1S1VB 3KJVA 1I6JA 3V1QA 3I5CA 3CIZA 2D3ZA 3NE6A 1C1BA 4F3TA 2XY8A 4DL6A 3OYHA 1REVB 4WZQA 5E41A 3KLEB 2HHWA 4CE9A 4IBNA 3M8PA 1XR6A 1S0NA 4AH9A 1WSJA 1FK9A 3LP2A 4Y1CA 2D0CA 3DYAA 3LAKA 3NMAA 3NHGA 3LAMA 3PVXA 2V4QA 3C94A 4C8KA 2HNYB 2Z1IA 3MAQA 2D3UA 3KK1B 4YR0A 4DSJA 4MK8A 1BQNA 4F50A 5C5JA 2FVCA 3L3UA 4M3RA 3SYZA 2Q3SA 1Q9YA 4DG1B 3BGRB 3VQQA 5DG9A 1RT3A 4CK3A 5DMRA 4FLVA 1QSLA 1S9GA 1KFDA 2F96A 3D5MA 3DOKA 4DTMA 4ECWA 4CGIA 4C8MA 3VQ4A 3MR5A 4I2QB 3H4DA 4G3IA 3CG7A 1KSPA 4IQXA 4CFAA 4CF9A 3ZSZA 1RTHA 4Y3CA 2W7OA 4URGA 1NOZA 4EZ9A 3DMJA 1S0MA 4J9SA 5I3UA 3LP1B 4HTUA 3CM5A 3NF6A 3BDPA 1NK9A 2BGGA 1FKOA 5KG7A 1JKHB 4YP3A 4PUOA 1ZBLA 4XPCA 1NK0A 4BE1A 2PY5A 4E3SA 2QK9A 5F8HA 1SL0A 4H4OA 3QERA 2ATQA 3NGZA 2FBTA 4BACA 1WAFA 3DDKA 3PW4A 3CQ8A 2HMIB 1S4FA 4M3YA 2W8KA 2ASDA 1BHLA 4WE1B 2HVHA 3ASMA 4KI4A 3HVRA 2DPIA 3RRGA 1XI1A 3TAMA 4CGDA 1L3SA 3ZCMA 4DLGA 1RTDA 3PX0A 3KK3A 1RA7A 4JS5A 3JSMA 3ICLA 3MF5A 4KE5A 4PWDA 4QCLA 5F9LA 5KFBA 2IA6A 4TSXA 3GQCA 4OKJA 3SV4A 4Q44A 3KHGA 1IG9A 4ZP7A 2OPPA 2IS3A 2BANB 3MXIA 3QGGA 2XI3A 2E9RX 3MEEB 5L1KA 3DM2B 1J5OA 4LSLB 2YKNA 4B3OA 2RDJA 4I7FA 4L8RB 4ECSA 4CESA 2ILYA 1LV5A 4YQWA 4OVLA 3VQ7A 3LP3A 3N6NA 1C0MA 2YNFB 1HJRA 1S9EA 3DLGA 2HNDA 3AO4A 5F8MA 3KNAA 4CEOA 5C25B 5J2NA 4MFBB 4C8OA 2W42A 2G8HA 4TY8A 5KFDA 3WNHA 1EXQA 4BWMA 4TN2A 4AHRA 1B9FA 1EP4B 3OSNA 1O1WA 2AJQA 3FRZA 3QO9B 1EETB 1VRTB 1NK7A 3ZSWA 3TAQA 2J6UA 1TVRB 2XC9A 3DLKB 1C2PA 4W5NA 5DK5A 4RUCA 1UA0A 5J1EB 2R2RA 3EY1A 4DSEA 1MMLA 4M95A 3UIQA 2FC0A 4Q0BB 1HQEB 4KFBB 1GOAA 1HYVA 2OPSB 4IFYB 3AV9A 4CEBA 4EBCA 2DFHA 1SL2A 1TGOA 3LP0B 1S6QB 4EP4A 1BISA
chains in the Genus database with same CATH superfamily
3V6DB 3CD7A 3KK2A 4YR2A 2DR8A 4CHNA 1GOCA 5FJ4A 1NBWA 4UT4A 3K0SA 3AA9A 4FCYA 7FDRA 2FVQA 4UW2A 1VBZA 4DL3A 1JLQB 1N34J 2MGZB 1APSA 3RB0A 4CFBA 3TSUA 4ZK7M 3ZX2A 2Z58B 3H5YA 3CDEA 3D1QA 3F0NA 4DV5F 3IBWA 3VMFB 4JI2K 2I0XA 4R5PB 3J7YU 1UMJA 4DS5A 1D5AA 1Y3JA 1Y11A 2HRUA 4ALZA 3QSYB 3CGIA 2KJWA 2C2EA 2UUAK 1N8RO 3GE9A 2FGCA 1RZMA 4IFVA 3MM9A 4ZDNA 3OW2R 4EP5A 4FM0A 2EK1A 3NG8A 4I6MB 4X62J 1S6PA 4DFKA 4X66J 4W5TA 3E01A 4YY3K 3OVSA 2W4PA 2V63A 4CJKA 1NWKA 5IQQA 2KO1A 2R7RA 3K5MA 2ZE2A 2BKNA 2IJFA 2YJEA 1Q82O 2J9CA 3H5XA 3ISZA 1PIEA 1JMTA 3CWJA 4CJVA 3HFVA 3W9HA 2IC3B 5C10A 5HVGA 5KFPA 2MLZA 4MYTA 1Y00A 4FWRA 2E7VA 4Z7CA 2PI5A 2GMJA 4DPUA 3IR6B 1NPKA 4ZVFA 5DO2A 2QXLA 2PE8A 4USHA 1T9WA 2GUPA 1IBLF 3NVKA 3A1YG 1XC3A 5BRHA 3Q22A 1JL2A 4UOCA 1RDWX 1OVQA 4EFHA 3DKDA 3UFCX 1D09B 4C8LA 1DBDA 2W6LA 1PBUA 4FJ5A 2GVDB 1ROFA 3AY0A 3R1HA 5A6WA 1Q95G 2CWKA 3DNCA 3NS6A 5KFGA 2NSBA 1SL1A 3VQEA 1K8AO 2O8DB 3D2EB 1NKCA 1OY9A 4CEAA 2R8HA 5AXMA 3TUJC 1DARA 3ULEA 4B3RF 5RUBA 4DN9A 3WX8A 3HSDA 3BF1A 3QIOA 2GQ2A 4O3QA 4E2FB 1YHQN 4ZP8A 4U7UK 3VGTA 3BDEA 1SVDA 1RT1A 4NYOA 1NSPA 2IM0A 3TW0A 2DBBA 2P5OA 4YB1P 5KFTA 3C46A 5AQKA 3W5YA 1HNVB 4FJIA 2M88A 3GCWP 1K73O 3G6YA 4DV2J 1KS2A 2QL9B 4KV8B 4BRMA 1PC4A 2HVEA 5FPDA 2YNIA 2C42A 3U1NA 4GVEA 2XYHB 1V5VA 4TY9A 4JS4A 1IH7A 3H6EA 4B3SJ 5KGXA 3OLBA 2CWXA 1RADB 3OS2A 2HAFA 3UR3C 1OH7A 4L3QA 1BA0A 3O3FA 2YNGA 4DF4A 1U02A 1QQMA 1X3NA 2QE5A 4IG3A 3ZT0A 1H2VZ 4ZVHA 3KK3B 5KRSA 4J2EA 1RCHA 4O4RA 2F8TA 2CQ3A 4YOTA 2OD6A 4Z4HA 3AFGA 3B6OA 2R7UA 4LF7J 4FDFA 1YBUA 2EHGA 4ZPAA 1R3NA 2UUWA 2J6TA 1PYSB 4X62K 3CD6N 4KIAA 5B09A 4X66K 5BR9A 3DFEA 3I9V9 4PQAA 1A5WA 3P5JA 3HLUA 2AX1A 2E5LJ 4KBIA 1ELOA 1F5AA 2IBKA 5KFQA 1D9FA 3DGPA 2R7YA 4L3NA 1NGGA 2WRMA 3VEWA 1VSEA 3H5UA 4PL7A 3POTB 4CI6A 4CLFA 5GAHU 1RQ0A 2DNMA 9ATCB 4DL4A 4J9NA 4B3MJ 3OYFA 2FLLA 1EARA 3CDBA 4CJ5A 5HP1A 2JC1A 4YFUA 4C1NK 4GV6A 1VQ9S 2A42A 1N54B 4RUAA 3Q24A 3IO1A 4KBOA 1YVNA 2LQ5A 5B0DA 3CB4A 5E84A 1HRHA 3I56N 2HK2A 3EE8A 3R9PA 3BN7A 4AD6A 2KDOA 4CJRA 5JVHL 4JD2B 1RAAB 2ZBQA 2DNOA 1HI8A 1TUYA 4Q8EA 2I5JA 1CS4A 1CJTB 2JLFA 4XPEA 1A5VA 2RVJA 2K8GA 3CJ9A 4O8KA 3SQ4A 4LF8J 4M5DA 3O4WA 3PV8A 4RG8A 3OUYB 1IBKJ 2LXIA 1O6XA 2F9DA 1U4BA 1X4BA 3O1BA 2BZ2A 3NOGA 1IKVA 2A1RA 2WFBA 4AYBD 3H98A 1SC1B 5IXUA 2M70A 3U1MA 1NKBA 4I9LA 1P1TA 1Y0HA 3Q8VA 1YVUA 1G99A 2B8PA 5DDOC 4DTSA 1NDLA 4BC7A 1JCFA 1IBMK 2DR5A 2QYCA 1RTZA 2XGPA 2GHWA 2JVRA 2UUBK 4I6AA 1SPBP 3TX8A 4KHUA 4BC9A 3SFGA 3TARA 3KJNB 4CHOA 2CNOB 5I4MA 4DV4J 3WNEA 4W5OA 4FJGA 4DV2K 5HO4A 2HF4A 2A6OA 4EBEA 1T03A 4IWVA 3P83D 3EJMA 1HBUA 1RTIB 4CZFA 1RJJA 1U2VA 3BN4A 2DFFA 3UKRA 4JI4K 1NSKL 2ZE2B 3VAIA 1HIYA 2O4IA 2XGQA 5KG4A 3SPZA 4OI0A 3PEJA 4IZ9A 3IRWP 4UOGA 3U9DA 3MEDA 1RT6B 2A2DA 3M8YA 3T6BA 2MYFA 5CYMB 4JP8A 2XHCA 4ICLB 4USJC 3EXYA 4A8FA 2PSZA 3MMAA 5FDLB 2NYHA 3NAHA 4A8QA 1BI4A 4FJHA 2V34A 3CJQA 3PJWA 3KHLA 2V69A 3BJYA 1M1KO 4CGGA 5LJ3Y 2V4RA 3BKFA 5I42B 1BMQB 2B6AB 3E8OA 3GYXB 1KVJA 3L7PA 4I56A 2J6SA 2XY5A 2CPDA 2Q0RA 1NSQA 2P9EA 4WJBA 1FEEA 1QAJA 5KFFA 4JI0F 1VQ8N 3HD2A 2V8HA 2FC9A 5BN8A 5BJRA 3L9ZA 2BACA 3QPIA 3D2WA 4C3LA 2BTFA 2YWHA 1KQKA 4ED0A 4NLGA 4OKKA 2RUGA 3HVWA 3ZSXA 3RMAA 4AQYJ 3JAMU 2QZ8A 2FVPA 4DSIA 5AQHA 4DTPA 3VV2B 3WEEB 3L2WA 5HK4A 1W9HA 5L1IA 2CPEA 4GV3A 2BJ8A 4DDFA 2OHDA 3AQPA 4IYQA 3BR8A 4JI3J 4RX6A 5KG6A 3THVA 1FJ7A 2AEFA 1F5CA 4D3HA 3CJ5A 3R27A 3PW7A 3TYTA 5DGAA 2HHQA 4ZITA 1S5ZA 2UUCJ 5GIPA 4OLAA 5AQNA 4K4WA 4ZVTB 4BS2A 4URQU 2NRVA 2HNYA 5F3TA 1YF5L 1A0OB 3TWHA 2I7PA 4LF8K 3CW2C 1IBKK 3HVAA 4E1MA 4CLZA 2E44A 4JHDB 4F4YA 4NLQA 4JKBA 3QT8A 4CGJA 5DG8A 5EWFA 1HJOA 3CNQP 2J0XA 2Q31A 2RQ4A 5E26A 1WG4A 1MN7A 3JQMA 4IRDA 1AB8A 5KI6A 5FROA 4Q7AA 2YPZA 1QE1A 2PMWA 3T69A 4Y00A 3WXIA 1BCOA 2CPFA 3V81B 4M3UA 1TFYA 2V2KA 3DXSX 3W8PA 5F0WA 2FC8A 4MLEA 5F3ZA 2IJNA 1KDNA 1S77D 1XQIA 1K9MO 3NFAA 2B4OA 1RWXB 1Q86O 1C0UB 4F4WA 4FJMA 3SPYA 1F0XA 3QEVA 3R9LA 4WFYA 4K2JA 3THXB 2C2RA 4DSFA 2ZJQL 4OGEA 5HBMB 1RBTA 5BN9A 2VQFJ 1TKXB 3EXCX 1YZ6A 1NJIT 4M63C 2OMOA 3R7BB 3EGNA 2RPIA 3QRQA 4NYFA 4H0VB 5JLFA 4WE1A 1RGVA 3CCVS 3CMAS 5HJYA 2VA2A 3PX6A 1DZ5A 1A7GE 1N34F 2AW0A 1TR0A 2F3JA 1RACB 3AO2A 3DDNA 1RAFB 2GX9A 5AQPA 1R27B 1UCNA 2BANA 2LLZA 3CJSA 4PHTX 1RBVA 5JMVA 3PTWA 3D6TB 5BRDA 2BM1A 4P10A 2MPUA 2O1PA 2V94A 5CD4A 5IT9Y 5KFCA 2CUYA 4BRQA 1FK9B 2H65B 3DYAB 1M1GA 3CFRA 3ZZUA 3KDNA 3O6WA 5T7BA 2E9TA 1BQNB 3FJ2A 2CH6A 2RJZA 3CXCM 2CGLA 1SJRA 3OL7A 1XTZA 4NWBA 1EP4A 3AHPA 2X51A 2OSRA 3FEXB 4ED8A 5F0UA 1YJ7A 1S9GB 2XSJB 4L6V3 1N33J 4AQYK 1YT3A 4IOAQ 1EETA 1RU1A 3SNNA 5AQYA 5KFUA 2DK2A 1KVIA 5FLXU 3DMJB 4XTTA 5I3UB 3ILLA 4IOXA 1YAGA 2DNNA 3IWNC 1ZBHA 4LSZB 4WFBQ 2VC0A 4JI3K 3QETA 4PWUA 4RWXA 3UD4P 1ZM9A 2WW8A 1CPZA 2MJNA 4PUOB 4MYUA 1P8GA 5AQJA 2QLFB 3QAEA 3KMQA 3UDVA 3LP0A 4FVMA 5L1LA 1FRLA 4ZVOB 2P9UA 1CJVB 4H4OB 1RAHB 4DHVA 3LF0A 2M52A 1OYDA 3KYLA 2LA4A 5FLXY 4DMZA 3A2FA 3WQPA 4KH4A 4IH6A 2OPRA 2NS1B 5HRSA 4OZ1A 3MMBB 2WZ1A 4JRPA 2UVWA 4DR4J 2MZJA 1N88A 5M2UA 1FXLA 4CJWA 3JSMB 4CEZA 1F60B 4PWDB 4I2PA 4DFPA 2D3OR 1T05A 5KT6A 3Q8PB 2QKBA 4FWKA 1MMDA 2PZSA 4FWSA 2KT2A 1TYQA 1TKDA 3MFHA 4I9QA 3MMAB 5D4NA 4LH4A 4HKQA 5CH7B 2W24A 3LW5C 2VQFK 3W2WA 1VK3A 1G4CA 4A5AA 3A4TA 3OVBA 4LRCA 1CZBA 4C0HA 1XNQK 4FLTA 1Q78A 2JVOA 1QS4A 3SQGB 4JI8J 3IWXA 1KR4A 3AVNA 3MPDA 2BQ3A 2E9ZA 4NXMF 1PG5B 2CQHA 3WX4A 1HWUA 3WQTA 4M94A 3G2XA 4GV9A 4A5BA 3M9OB 2DRBA 2LDIA 1QZ5A 2ETJA 4B3SF 2JGUA 5T7LB 3I96A 2QN6B 3HJFA 4J9UE 4EUVA 4IOBA 3HF5A 5KFVA 1SKWA 4M3XA 1U1PA 3CC2N 3L2UA 4CK1A 2YKMA 3BPSP 2EX3A 3AO1A 1YK9A 3DJCA 5D0HA 3ZTRA 5G4DA 4K5RA 3BZCA 3OYBA 1RWWB 5KFOA 3VAMA 4DQRA 2V2ZA 4KTZA 1W7WA 4LF7F 1SKRA 1YZ7A 2OUGA 1VK0A 4JKAA 4C6AA 3MMCA 3H3OB 1WSEA 4ECQA 2AX0A 2E5LF 3HFKA 4WF9L 2XMWA 2P51A 3CCLS 3PY8A 1H7XA 2IOCA 5H1SV 1NSAA 3G82B 3CCES 5GAEU 1QE1B 1U1LA 2VQEK 2GUIA 2LEPA 4P7TA 4DR6K 4JK9A 1RBAA 2UU9K 1BG3A 4B3MF 1VRUB 4L72B 4PAAA 2H1YA 1TL7A 2MHEA 1X60A 4DMNA 3SBGA 1BDGA 2XSFA 3G71N 3O9TA 3PHTA 4ED4A 4DV7K 1HHTP 3AVKA 2ZKTA 4B02A 3P5BP 2HK3A 4DBQA 1D9DA 2H5EA 4QYRA 2RN2A 4BC3A 1GMWD 5HROA 3KD5E 7AT1B 1NK4A 3I4HX 3JTNA 3OXGA 4KHPJ 3EGZA 3N4WA 4ZLLA 4DR7F 3KLFB 2VG6B 1VBYA 1EKRA 3N0VA 4ZLJA 1S59A 1TKZA 3VGLA 2C2OB 1KVBA 4TU9A 3GIKA 1FKPB 2IGIA 2WONA 1N5YB 3KUHA 1PJ6A 4PPDA 1E4FT 1VGYA 2K3IA 4OYXA 3TUPA 1WWHA 5B0FA 4CQ1A 5K8NA 4DR4K 1YRXA 4MIWA 3QEIA 4J9LA 2M3DA 3ZTPA 2HNZB 3PFOA 1S6UA 2DTJA 2QC3A 1SC4B 5C42A 2WSFC 4YHHF 2G8FA 3OXFA 4EI2A 4JV5K 1S9FA 2VPYB 2BQRA 5IC4B 5AFUH 5A2QY 4KB0A 3W3SA 2RKIA 1T9YA 4WK1A 4HHTA 3ET6B 1T3OA 2POKA 4JI7K 2L9NA 3WT0A 1NK5A 1EWQA 3C19A 2V4JA 2LXFA 5AQSA 2XB2D 6FDRA 4NLPA 3OYCA 4IEEA 3UQSA 3LANA 4ECRA 4KKOB 4DV4F 2KXFA 2AV5A 1EZZB 5EX0A 1QAIA 2DFEA 4WU2A 2U1AA 3N6LA 4OQJA 4ELTA 2G4BA 4NLOA 4K59A 5A8RB 4FW2A 2ATCB 4M41A 4LF5J 3JS9A 3BBFA 3VQTA 4EBDA 2QIFA 3ZT1A 4F4KA 3MCOA 4B9NA 1HPZB 2OP5A 1H6KX 4NPOA 2XEXA 1LOTB 3L2QA 3T1HJ 3J7AP 1IKYA 2XWXA 3O4QA 3KXDA 5F2RA 5B0BA 5KFLA 1BO5O 4E7LA 1ESVA 3CEDA 2EWSA 4E19A 1MU2A 1ZYQA 4ELVA 2HBLA 1YI2S 3DI6B 1YJ9S 3D3CJ 1RABB 3LGNA 3OHBA 1RWMB 4QW9A 4F04B 3E9PA 3VF2A 3WZ0A 3OHAA 1X3MA 2AU0A 5HL7Q 4DSKA 1Q8BA 3D0PA 3J8AA 3VERA 1YKWA 1NJZA 1FEHA 2F8EX 3J81j 3M1VB 2FSKA 3L6QA 4BQLA 2XCPA 2COLA 2NZTA 2YQ3A 3E3XA 2MZ1A 3AA4A 2MSSA 4LQ3A 4XDDA 3CF5Q 1VSIA 1Q53A 1TP7A 5D78A 3SBTA 3ETOA 2EXUA 4NA1A 5FIIA 3G4SS 1UA1A 3ALYA 4OYIA 2BR0A 1RT2B 4CW7B 1HNXJ 2VDHA 2VB6A 4CJUA 1Z2ZA 4QR1A 4KHNA 3LTOA 2LQ8A 2B7CB 2ZH7A 1BD6A 3LM2A 2MKKA 3F73A 1ZETA 4AXJA 3D7EO 4MIBA 2A40A 2MQOA 2UUCF 3O1WA 2QI2A 3GFZA 3PIPQ 3EX7B 4K4UA 2DNHA 2K1RA 3NH1A 4ZTFA 4XH1A 3S3OA 3G0ZA 3SUQA 3CT9A 1R43A 1SUQB 3M6GA 2E88A 2OEJA 1KHVA 2PT0A 2KKZA 1EAYC 3GYNA 2HAIA 1LW2A 2RHQB 1A9NB 3P96A 5HQ8A 1V5IB 4AHTA 4C0OC 2PBDA 3SUNA 3MAHA 4LF1A 1N8RT 3CJTA 2M8HA 2HHSA 3RBXA 1YVFA 3TANA 4B1UB 3HZGA 4OYPA 1Y64A 4OHVA 4M3WA 1YUWA 5AQVA 1XHXA 2AJ1A 4QPXA 4NLUA 2F8MA 2ASYA 3I32A 4OLPA 3AVCA 3ZZYA 1Q82T 3ITHA 3K5LA 3OVAA 2HZVA 4K2XA 3QBWA 4EYHB 4H8KA 2HFOA 4E98A 5CZXA 1D1UA 1HKGA 2L08A 3TSQA 3KJQB 1YDLA 4OYMA 9RUBA 2QLBB 3T6JA 4ZVRB 3T1HK 2F8HA 1YGYA 1OYEA 1V3SA 4Z2XA 1NDKA 4JOUA 1JWWA 5E33A 5E3AA 4E7KA 4B9TA 1UW4A 1UPMB 1HLWA 1VS3A 4CLSA 2Q0UA 5HROB 2KXNB 3RBEA 1EIYB 1JXEA 2FHJA 2NNWA 3TZXA 2KG1A 2VJUA 1N48A 1KC8T 1GOBA 3EKSA 1QVGM 4P2SA 2WONB 1M5SA 1X4DA 2B8QA 3PACA 1J27A 3H5SA 1Z25A 3GBTA 2FZKB 3N5BA 2Q6BA 4U8VA 1FW6A 4FZXC 3C7NB 2G2OA 2KKHA 3UE2A 5C42B 1N33F 1WAJA 3ID8A 1S1UA 3Q8UA 4OYWA 3WC0A 4YOWA 4ED2A 1YJNS 1JLCA 3CCMS 5AZIA 3RYLA 4BDYA 4KYZA 5BXIA 1AW0A 3I55N 1BIZA 3IG1B 1LAWA 2HWHA 1QDUB 4YDUC 2HQFA 2JH3A 1SKUB 4JKFA 1HNXK 3L2VA 2YNHB 3HHKA 1NK6A 2V4JB 4WFBL 4M63A 2FXUA 4C8ZA 4OJGA 1RSCA 5LY3A 4RU2A 4DQIA 4FP9A 1NO8A 3WQUA 2F7TA 4DUZJ 4MDBA 3QWPA 2QLJB 3MURP 2MZSA 4PABA 2ZH3A 1XMBA 4WFNQ 3W7BA 1S1VB 3GYGA 3VPZA 3CIZA 2D3ZA 3ZZTA 1ZBTA 4KGVB 4A2BA 2WVEA 1H74A 1LOUA 5HI7A 1TMMA 1D4XA 3CCQS 5K20B 4BVPA 4FN5A 4O0NA 1WSJA 2AF6A 4NASA 3LAKA 3NMAA 1YX2A 1U2RA 2V4QA 3O9QA 4C8KA 2AYEA 3R6MA 4BRKA 3MAQA 2AZ1A 2D3UA 4DSJA 4C8YA 1ZBSA 4F50A 5AQFA 4A8WA 3VESA 2UV8G 4HHJA 2JHEA 2DRDA 4FVCA 1Q9YA 4QBUA 3FC9A 4DG1B 2J8AA 3U27A 3Q83A 1RT3A 5AQZA 4FLVA 2F96A 3DOKA 4H4KA 4DTMA 1VQNN 4JI8F 5M1OA 2YH1A 2X1AA 3R2DJ 4G3IA 4K41A 4IQXA 4CFAA 1HBMB 1IWAA 1TMJA 3ZSZA 1RTHA 3BZQA 8ATCB 3P45B 1TZ0A 1VCTA 3BDPA 3N4QA 4CLWA 5KG7A 4YP3A 1SIWB 1T3VA 3VGSA 1KQSM 2Q66A 3TTFA 3MHYA 4E3SA 4WBFA 4QU6A 4BRLA 5IT9O 1R8BA 2A18A 1VLYA 4GKKF 2LDYA 1RP5A 1Z05A 3SAFA 4C97A 3PW4A 4IQMA 5CXTA 3I82A 1KBRA 2W8KA 1BHLA 1NHKL 4KI4A 3HVRA 3RRGA 2DGVA 3TAMA 3CJ1A 4H5NA 2N7CA 2OEMA 5H9EJ 3ICLA 4U7UD 4DV0J 2CPIA 2IA6A 1FRMA 3GQCA 3NCQA 3A13A 1HKBA 3DC2A 2R7SA 2IS3A 1PAEX 2LQ9A 2R7VA 2OANA 4W90B 3MEEB 3AOAA 3VR1A 1J5OA 4B3OA 1WG1A 1K8KB 2FTRA 4ECSA 3M6WA 3DAWA 2O8CA 4CESA 4HH1A 2ILYA 2Z2LA 3I8BA 5ADXH 2YNFB 2HF3A 4OX9F 1HJRA 1S9EA 3B82A 2HNDA 1BWEA 5C2FA 1Y5IB 4P2FA 5BYSA 3O44A 4H03B 3X1LB 5C25B 4LC9B 2G8HA 4TY8A 5KFDA 3C66A 1T9TA 4TN2A 2YBVA 1VQPN 3LDQA 4P6QA 3OSNA 1ZA1B 4DUZK 1AZSB 1W2BR 2MXYA 4EHTA 2HBQB 1U25A 2P9CA 4O8UA 3FRZA 3DXKA 3QO9B 4KHPF 1FX2A 2QA1A 4M7YA 2JWNA 3TAQA 3BGLA 2CNKB 4W5NA 2KT3A 3W66A 2E7WA 2GJIA 2ZF5O 2G13A 5BR8J 1MMLA 1RHUB 3A0IX 3UIQA 4Q0BB 2EC2A 4QIEA 3FBBA 1RI7A 1RWKB 1GOAA 4USMA 1HYVA 4ZN3A 3O8WA 4DKWA 4CEBA 4UF4A 1WORA 5CCMA 2K06A 1S6QB 1X5SA 1BISA 1I51B 2UXCJ 4GW6A 5F8JA 1VC5A 3QYYA 3THYB 4ANDA 4BR4A 2F40A 2GIQA 3W61A 3CMES 3L4QA 5D15A 2IA0A 5HN0A 4U7BA 1IWGA 4RW8B 4BC4A 4ZVSB 4J5OA 2P9NA 1JLBA 1UJ6A 3QGPA 2IVFB 3CCJS 1J54A 2B43A 2KHCA 1JK9B 2HBRB 5AQLA 5AQRA 4CO4A 4A8OA 4V1Ak 2NRHA 4YR3A 4I6WA 3VEYA 3SDEB 3AVJA 2ZWHA 2I9SA 1AUDA 2ITGA 1E6VA 5HRRA 1Q9XA 1B92A 4LF5F 2RDIA 3OR2A 3PO4A 3IRXA 2G0JA 4JI1F 2ZM6J 2FLOA 5MAOA 5IM0A 1FO1A 3NS5A 2BDPA 3D6RA 3LDPA 4UQTA 3L95X 1BA1A 2DD8S 2HZAA 3T1HF 4CBXA 4A46A 4MKYA 2MTLA 2R9LA 2RHKA 4UZBA 3DOMA 4BBYA 4C3MA 2BKPA 1SKSA 3WBZA 2O5DA 4PR6A 3LH2S 4Q5VA 4KRWA 2D69A 3BSAA 3CFOA 4C23A 2KVQE 4LR8A 2RDDA 4TYAA 4FPBA 3FFIB 1G7CB 4F2SA 2E66A 2P9LB 4KQZA 1VQ7N 2BUNA 4MKVA 3DRRB 4NYNA 3I0SA 2CPZA 1XHZA 2K2PA 3RR7A 1T7PA 3AJ1A 4FNIA 1FXXA 3CCSN 3DLEA 4JAXA 4LR7A 4J9OA 5THWA 3CQYA 5HL7L 4WU3A 3TJ9A 4Z4EA 2W4DA 2Q97A 2HWTA 4F9OA 3TAEA 1K9MT 2H4WB 4KTWA 5AXKA 1VQ5N 2QMWA 3WDOA 4R8UA 2P9SA 2KTQA 3BH7B 1X4CA 4Q2LA 4NLSA 4PKDB 3WIVA 2W9AA 4RR5A 4IO1A 3C2PA 1VQ6N 1ILYA 5JJBA 4DL2A 1SB6A 3EWGA 3OYEA 2GVZA 3CC4N 1FVSA 3THWB 4H4MA 3N6MA 4CHQA 3MPUB 5HAOA 4LBIA 1Q8IA 4YB5A 1HNXF 4ZPWR 2HGNA 3TVKA 4G6VB 1GTEA 1NNEA 4ID5A 3M2RA 3DOLA 3V4MA 1YJUA 2V50A 3C6UA 4USKA 3HSTB 2OAUA 4C0BA 5BR8K 1B70B 3PRBA 3MXHP 1HNWJ 1CG2A 2CNNB 4X64F 3Q86A 3W5XA 4CTAA 2Q1LA 1HBNA 3C14A 2G0IA 1T9VA 3MX2A 1R0BG 3U3YA 3OXLA 5A2QO 4CLPA 1S6OA 3OL9A 3O80A 3BR9A 3Q2TC 4QIVA 2HS3A 1TL1B 1LWCB 1XWLA 2RILA 1U8WA 3S3MA 1IR2A 2UXCK 1BXNA 2VODA 5GMDA 4FJ7A 2LKZA 4XAKA 1GLJO 4RW9B 4I64A 4QWDA 2HGMA 2HS0A 1YITS 3VGKA 3VQ8A 3GV5B 2DNYA 3MEGB 1DEJA 1KONA 1CZ9A 4DV1F 2GCFA 2H5IB 2LVWA 3C15A 2MY7A 2DXFA 5BYRA 3AH6A 3EUNA 4CZIA 4AHCA 1SV5A 5L1JA 4ZJQA 2F4VJ 1PILA 1MA9B 2JSXA 2R42A 3E9OA 1RCXB 2M8DB 1UFLA 4TU7A 2WHOA 1FWPA 5ETTA 4BDPA 4OJ3A 4B1XB 3BH6B 4H0XB 4QWEA 4IRCA 1OIAA 2W2PP 1RFQA 4IUFA 2QFIA 3G10A 1VIXA 2HLUA 1S1TB 2ZGZA 3CC7N 1URNA 1YXQA 3D1HA 1U49A 2DISA 4QR0A 3W2VB 2PA8D 1R8HA 1UAWA 3PUFA 2Z0GA 3FSIA 3HRGA 3JSBA 2CA9A 3CIPA 4G1IA 4ZS6A 1M1HA 3D6HB 3B6PA 4ED5A 3HHLB 3QNWB 1RT4B 3DRSA 5KFMA 4OPKA 3QBCA 2V9WA 4C48A 5AE1A 1RCOB 3DXKB 4DOZA 1SI9A 3QZ7A 1GMWA 1GTHA 1QJHA 5KGWA 2DCLA 2QT7A 2GX8A 3LWLA 3RB4A 3TUIC 3DXMB 4BRDA 3HO1A 2OLWA 5J2MA 2F5GA 1X9MA 3QIPA 4X65J 3IS9A 1G1XA 2O8EB 1UEKA 2XLJA 4O44B 3RU0A 2O8BB 2CG4A 2O67A 4FBTA 4NOHA 3SI8A 1N32J 1TL3B 3ZZZA 3QATA 1TUVA 4OIXA 1R6YA 4K8ZA 2XBPA 4RW7A 4EU0A 4IOCQ 3FZMA 1T9UA 4FJ8A 2CVIA 2YHWA 3IAYA 4DR3F 3RAXA 1T0TV 3H42A 4CIGA 5ETLA 4UY8O 1VQ9N 1WOQA 3AVFA 3HYFA 2VG5A 4ISEA 4X4UA 4N5SA 2O8FA 3MPVA 2B9EA 5LM7E 5D3GB 1I94J 1NHUA 2YHAA 1HNWK 1ZM2A 1VQMS 2IDEA 2QGFB 3NCPA 2RT3A 1TL4A 4JEPA 3VQ9A 5T41A 1XNRF 4HUFA 1ZM3A 1QHAA 1ATSA 1WTFA 1DTQB 1J5EJ 4V19S 4LVNP 3K5OA 2D0OA 2AJ0A 3OR2B 1HHSA 1WHWA 3IRXB 5ETMA 1U8SA 2X74A 4NI2A 1FDAA 4BG8A 5DGBA 2RRNA 2FJWA 2DHAA 1X5PA 3CPWR 3TPQA 2AWZA 3EZUA 4LRDA 5ELZA 4JI6J 1HWKA 4HYKA 1Z26A 1JLFA 5DM6Q 1HYSA 3OFEA 2G1DA 5A0YA 3KLGA 3VQPA 1Z4UA 2EEYA 3FFKB 3T9NA 5KT7A 1XUPO 1Q4RA 2F4VK 4H0TB 4KGZB 3L4IA 4K43A 2VF3A 1YJWS 1S0OA 3KVGA 2EKYA 3LQVA 3DRXA 2KLAA 4JK8A 1YLXA 2ZD1A 3RVCA 3ENAA 1EKEA 3JYTB 3P1GA 4C4WA 1IKXB 3M5RA 4DV3J 3FUYA 1K1SA 1H2TZ 3G96A 1KTQA 2P8IA 1W26A 1KNZA 2C3PA 4DV6F 4PXBA 1UPPA 4FK2A 3D7SB 2H4YB 1VC0A 1DKGD 4J2BA 3IBFB 2Y1LB 1HARA 2P5VA 3VEOA 2DNQA 1RDCA 1DTTB 4CJ3A 1QTMA 4ZP9A 3T1YF 3R5AA 4YDUA 3ZETA 3CFPA 4DCJB 3IAS9 2ZHOA 3KNGA 4E1JA 2CG8A 3NWGA 5HSPA 4FYYB 3OVNA 2MHNA 1GNKA 4J2AA 2OPQA 3IUCA 1HD0A 4QIGA 2YCHA 3IWLA 4WFAQ 2BH1A 3MM5A 2QA4N 5HRPA 4IXCA 1M90O 1F21A 1J9AA 4BR5A 1H98A 4ATNA 1BL3A 3BKTA 4IDHA 3C6UB 3PYEA 4XO0A 1REVA 1IJFB 4ZA1A 4PY5A 4X65K 3QEXA 4WKYA 4H5TA 1N5SA 5K8MA 1WSRA 3ZTSA 3O9SA 4DV0F 3QGHA 4A8KA 4MK9A 3VENA 2A1SA 4PQUB 1N32K 1Y3KA 2J0QD 3O9UA 2R7WA 4CZEA 2DGUA 3D45A 3AAWB 1SQEA 3PFEA 2W7AA 2YKQA 3UDEA 3VA0A 1AA1B 3BKUA 3R1LA 4RNNA 4K25A 2G0CA 2YH0A 5D6GA 4M45A 3MD1A 1HNIB 1C1CA 4F4AA 3C15B 2CPJA 3W9JA 2XNRA 3VTIA 4I2QA 1F2GA 5HANA 3Q8QB 3J81Y 3W5ZA 3OYKA 2CQIA 1I94K 1AFIA 5GMEA 3OS0A 4H5WA 2AJ4A 3OFFA 3HSCA 3D2FA 4TKTA 4QQBA 1JKHA 1U45A 4JKGA 2JRSA 5GADI 3UVJB 1P9YA 4DWIA 2F8SA 5K14B 4FKXA 3K57A 3JXOA 1U47A 4USIA 3WXLA 1QSYA 3O8MA 3J7YP 5KFKA 5KFIA 3VQAA 3A5NC 3LALA 2RMLA 2EG2A 3VZIA 1XMOK 3QJPA 3W1YC 4JI6K 1SJ3P 3DWLA 4Z4GA 4QOZB 1M5VC 3KIOA 3AARA 3V9UA 1HPMA 4M5GA 2UP1A 1HR0J 1WSFA 1SH2A 2K7KA 1HNZK 4WQ4C 1UZHA 3F56A 1S97A 4HWIA 2ZZMA 3CERA 5KOWA 5EX5A 2Q1NA 1JLGB 3UCGA 1KD1O 2QMUB 2NLWA 4G1QA 3DHWC 4LF6J 1YHQS 2WK4A 1RNHA 1DLOA 3GMGA 4P52A 3OYIA 4LSLA 2G8VA 3HPOA 4DUTA 3PLAA 3OYDA 2ZDPA 2DXDA 1Z6RA 4OMFG 3QIDA 3WXMB 2JJ4D 3M8PB 2DH8A 5KFRA 3LP2B 1XK8A 2NXJA 2JEJA 4H5RA 4K4YA 5KG1A 5F9NA 4HCCA 3VEZA 3L3CA 4F0MA 3T1AA 1WN7A 3FZLA 4ZP6A 3V9XA 2YKAA 3WHIA 4MFBA 3MM6A 2YPYA 3L8BA 4ELUA 3NS7B 4H5VA 2ZM6F 5BPMA 4DF8A 4KR0B 1B9DA 4K8XA 4P71A 4X4RA 1XBWA 5C2CA 4GRSA 3MMVA 4WTYA 2C2KB 4YN3B 1S7IA 3TZZA 2VG5B 2YXLA 2AHOB 2ZBRA 4OLOA 1N36K 1M5OC 3A12A 4ANCA 3VGMA 3PSIA 1WHVA 1HQEA 2BMBA 2YWWA 1FKOB 1VJWA 1BIUA 1BY9A 1DQAA 2OPSA 2X1FA 3ZTQA 4IFYA 3FLCO 4KO0A 4M8LA 4F26A 5HVHA 3HD1A 3V6DA 4F7VA 4HR2A 1IBCB 3CD6S 1C1AA 3AXMA 3PIOQ 1J6ZA 3JS6A 1FERA 1JLQA 3GG4A 2Z4PA 2N7YA 3BF3A 4Q43A 3ETMA 2DKOB 5KG3A 5KFHA 1U2FA 1NB7A 4O5BA 2HFSA 1RHJB 1DQ8A 1JLFB 4BRIA 2PFFB 1SJFA 4Y2AA 1RTDB 3NKYA 5ITHA 4R5PA 3V6KA 2VD3A 1VSDA 4L76A 1UEVA 2VGNA 4DU4A 4OX8A 3G6EN 1RLCL 2KXHA 3MXMA 4QWBA 2HWIA 5IWAF 1T6CA 3CJ4A 1S0VA 4DCPB 3I5AA 3JTOA 2VOPA 1CC8A 5D0GA 2NXEA 3I56S 4I6MA 3IFEA 3S6EA 2FB0A 1S22A 3AVIA 3RRHA 3I0RA 2I7NA 4FM2A 3C0BA 4NXNK 1T6DA 2R2UA 1T8EA 1FTRA 3ZETB 2MZTA 1Q81T 5J2NB 2FF3B 4CECA 3LGHA 2J0SD 2ZH6A 2IC3A 1RWPB 2OPQB 3M30B 4UUWA 3OYGA 1C0TA 3J7A1 2WVFA 2OEKA 3BGFA 3IKMA 2G2YA 3E51A 3VEXA 2FBYA 2VCPA 4G9ZA 5CD4H 4DHYA 1WD6A 4OGCA 3D66A 4JBCA 1HWJA 4BRHA 3MAAB 4DI6A 5GAHP 1I5OB 4HT5A 1AUSL 3JSYA 3HXMA 5K9FA 2L48A 3V6JA 2GVDA 2E2NA 4OV1A 4E0DA 3I31A 3FMBA 2GTDA 4I67A 1R8CA 4WIQA 1NZAA 4WXWA 4FOEA 3NP5A 3HT3A 2ASJA 4E1NA 3BV8A 5F0XA 4J9KA 2DTUA 1X7VA 1CULB 2NXNA 3R2CJ 3OTBA 3D2EA 1GXUA 3BO4A 2Q6CA 3MM7B 4USWA 2ZZNA 2BV3A 1QLNA 4M1KA 3ZEUB 4CJ4A 4P72A 1LWEA 1LFWA 2AKWB 3SEOA 1C1CB 2FBVA 2EW9A 1R0AB 2CZ9A 4WYBA 2J7WA 2BRLA 2VOOA 2Z1HA 4JI2J 2O01C 2QX0A 4CJSA 3QESA 3K2YA 1NHVA 2ZH2A 2PEHA 2ZC4A 3L4BC 1HHQA 1HNVA 4OHYA 3CO0P 3J80U 3KD1E 2UUAJ 3HZEA 2QG9B 4OPJA 2Z2ZA 1RBSA 4JKGB 1FT8A 5HLFB 4KV8A 4M3ZA 4WCEL 3ZX0A 4NCGB 1RT7B 4FJLA 5LSLA 1RAEB 4EZ6A 3U4LA 5F41A 3NCIA 3ZFVA 4ZPVR 3NF9A 1RU2A 2GW8A 3OTOJ 3MR7A 2QWNA 1N32F 3EEQA 2WTUA 2FY1A 1WNEA 3GL1A 2MQ8A 1WC6A 3FBCA 5KRTA 1U1RA 1KEKA 3GP9A 5DZ6A 3EGVA 2E5HA 3EICA 1F6TA 3Q8SB 1CZAN 4CNYA 1XEZA 2DR7A 3SCLE 1AT1B 2VBXA 5GAGI 4K4SA 5AE2A 4IDKB 2OTLN 4G1QB 3ZT4A 1DLOB 2ZJRQ 3CJRA 4HCBA 1WI6A 3CIMA 1I94F 4ED7A 2PFDA 4DU3A 3W62A 2GJ2A 3RB3A 2JZ5A 2QRRA 1XQSC 1SCJB 4FF2A 2MQLA 4MT1A 4DL5A 1YIJS 5C15A 4LH5A 4UQGA 1J5EF 4J91A 3M2VA 1OMSA 3POTA 1VQLN 1HQUA 1DAXA 3EKUA 4UOHA 3HL8A 1FWLA 2QXFA 3TAPA 4RW6B 4ID8A 1KQFB 3GLJA 2XMJA 3T5KA 2EG1A 1DT9A 2W4CA 4O3SA 2EFOA 1VRQC 4WQ5C 4P75A 1YJTA 4J37A 3SUPA 2CVEA 5DM6L 2R2TA 2VIHA 4B1VA 5HMXA 2KM8B 2Z2MA 1XR7A 2EFNA 3GFHA 3V1RA 2X7IA 3PO5A 1J2VA 3NF8A 4JD2A 4CLYA 2W2NP 3KHYA 3KK1A 2F65A 4FYDA 4J2DA 1CJTA 2UVUA 1Q7YT 4KO0B 4DV3F 1U04A 2B4UA 4OZJA 3G87A 2CKWA 4DTJA 4QYZJ 4CDIA 2NUUG 3OUYA 1RB0A 5DLFA 2HKEA 1AROP 1D0EA 3AB2B 4KH1B 1P1LA 3QLHB 4O3NA 2PMHA 4FS1A 3NBPB 1S12A 4PPZA 1EWRA 2A3JA 2J9EA 1PJ5A 2GO8A 1F2HA 4QAGA 3MCMA 2D1CA 3O6QA 2W9CB 4CJEA 3RBDA 3S01A 1F3VA 3WXKA 3GZ7A 4K0KJ 1SBRA 1UFWA 2RQMA 1RWOB 2CRLA 2P9IA 2XY7A 5LMNJ 1Q5VA 2Z1JA 3HP9A 3ATUA 1RTJB 1ULRA 5IFMA 2C2ZB 2WC9A 4NB4A 1Q5YA 1VJQA 1TK5A 1RDRA 3HI0A 2D0BA 4K7QA 5KFWA 2DNGA 4PEOA 2KHDA 1RTIA 2J7KA 1NU4A 4U67Q 2RH3A 4RKUC 3I0RB 4B3TK 1K47A 5IOLA 1BHNA 2HURA 4ZVPB 4LIWA 4ITSA 3UCZP 2P9PB 4PL8A 5AQUA 3OTOK 2HB5A 2H5JB 3CCUN 3W60A 1VQON 1RT6A 1H38A 5CYMA 3MECB 4ZLNA 4CJFA 1C0TB 4ICLA 2E1ZA 3HFZB 3HHEA 1CJKB 4NRTA 3PM9A 2OA8A 1FRIA 5LMUJ 3DM2A 4XDCA 5FDLA 1IQZA 1TK8A 1WF1A 3G4SN 4KHMA 1S48A 1SQFA 2OSQA 3G86A 4M3TA 1HW8A 4YOEA 3OBYA 3BSOA 2KH9A 2XO7A 5I42A 2B6AA 3FKBA 2JLGA 1R31A 4OYAA 5KTQA 3G8TA 3NGTA 4NCBA 3MI7X 1BWVA 1VSLA 4W92B 4JI5F 1BQMB 2GIRA 4KSEB 2VH7A 4MKAA 2FJBB 1JJ4A 5CZ1A 4LSNB 5CAAA 1M5PC 5DQHA 1TVRA 2FHKA 2DJWA 4QW8A 2HHHJ 1XMQK 3SZ2A 3MFIA 1R89A 3GCXP 2E1AA 4KAIA 3WEEA 2W2QP 3CJ3A 1NMDA 4CJPA 3VN5A 5JS2A 5AJ3K 1T3NA 3KK7A 1LWEB 2YX1A 2OZSA 2WB4A 5AQWA 4RL1A 1JCGA 1FD8A 2GNKA 1HR0F 1IBMJ 5EDWA 2MY8A 4DFJA 4BG9A 3GJTB 2XY6A 2UUBJ 4DR2J 1KVCA 1FJCA 1ASVA 5HQMA 1QVFR 2MSTA 5EGYA 4LF6F 3BM7A 2VONA 4HEA9 1GXLA 4QYZK 2DH7A 2V7ZA 2XTJP 2GIFA 3HX9A 4ZVQB 1H0HB 4JHDA 4NZ0A 2HRTA 4OI3A 1WLJA 3IBCB 3ZSYA 2M5YA 1RAIB 4DXLA 3M8QB 4JI4J 3H40A 3HOTA 4DR5K 3U8XA 2UVRA 2PDAA 4CEEA 4OZNA 3V81A 2BJ9A 4OPAA 2VKZG 1G6BA 2E29A 5KPTA 3B8HA 4A8XA 4K0KK 2CPHA 1U6ZA 1C0UA 3KLIB 3O08A 5LMNK 1VHFA 4AL5A 4CGFA 2AD9A 5AFUA 4FF1A 5AZJB 3THXA 2FVRA 4CO0A 5HBMA 4IH5A 1YRTA 1TKXA 3R5CA 4CIOA 1HWLA 2J76E 1WC4A 2OI2A 3CC2S 3MWTA 5DS7A 4X4VA 4F36A 1H72C 2XS2A 4N56A 2HFUA 4Z4FA 3M32B 1W2IA 2W01A 4HI1A 3IP0A 1D8YA 3J7ZT 3B4MA 2EC0A 3H45C 3U7JA 1TTHB 3D54A 3M2VB 2MEWA 3QRRA 4RNOA 3AVGA 1HQUB 2GMHA 4Z4CA 4WQ4A 3LDLA 4DU8A 4LY7A 3E1YA 3KJVA 1IJJA 5J1NA 3V1QA 2VZ9A 1YJNN 5LMUK 2ROGA 2VPZB 3J81O 1C4AA 2CDQA 3KDOA 4DL6A 5B08A 4F3MA 3NGSA 3UW1A 1CJUB 4IBNA 5JMNA 2GA7A 3D67A 1FK9A 1V4TA 5I9EB 3DYAA 2UXBK 3PCOB 2UXDJ 4R0JA 1L3KA 3BBBA 1YWXA 3KK1B 2A10A 2DEJA 1BQNA 2V2QA 3RW7A 4IJNA 4LFCK 2K3KA 1BU6O 3K9JA 4GKJF 2OGUA 3SYZA 2Q3SA 4JYAJ 5B0AA 1GFWB 3UN2A 2GQQA 2XSJA 1S9GA 2B7BB 3M6UA 2ZBCA 2VC1A 2HHHK 4C8MA 3MR5A 2HVDA 3CG7A 1KSPA 4CF9A 3LGMA 4MDAA 3HCXA 4KH0B 2QWPA 2W7OA 1KKHA 4URGA 1NOZA 3GU0A 3DMJA 2NPFA 3CCQN 1RHKB 4J9SA 5I3UA 3RAMA 3AGRA 3LP1B 4HTUA 3SSRA 1NK9A 1IM6A 2LEAA 2I8EA 2RAQA 4B1YB 1MLAA 2D1KA 1FRKA 4WKRA 4PUOA 3OR1A 4DR2K 5IV3A 2P9IB 1NK0A 4BE1A 3KUGA 1HWIA 3P49B 5F8HA 5GAEP 1SL0A 3PDNA 1CJVA 4H4OA 1ZXOA 1RAOA 2VICA 3M2UB 4V19J 7FD1A 3CQ8A 2XYGB 2HMIB 2ASDA 5ETOA 5CHIA 5C12A 3LPYA 2DPIA 4MO4A 3MMBA 4ETXA 1PGZA 5EY4A 3TO8A 3KZBA 2FY8A 5TKYA 3GDQA 3N01A 1GXTA 3PX0A 3JSMA 3MF5A 4KE5A 4PWDA 4C9DA 5EN1A 4OKJA 4UY8T 4Q44A 1IG9A 3TVZA 2OPPA 4LFAJ 1PJ7A 1JJ2R 2RU9A 3EM1A 2XI3A 5L1KA 3S7RA 3ZTOA 2NR0A 3DM2B 1UWAA 5I3PA 2RDJA 4L8RB 1WELA 4EAHD 3GWCA 4F67A 4LREA 4JI2F 3VAGA 2JFDA 1I1GA 2KU7A 2IHR1 1GAOA 2NYIA 1VQ4N 3SQGA 4BVOA 3KNAA 4NEZA 1FJEB 2ZDOA 2UUAF 3MX5A 4C8OA 2W42A 3ULHA 5LSOA 4BWMA 5BREA 1B9FA 1I3OB 1FD2A 5AQQA 1NGHA 3QJJA 1RK8A 2AT1B 4YY3F 1TVRB 3MUMP 1HI0P 2KHOA 4N8OA 3J7AN 1C2PA 4U9RA 2LA6A 1JB0C 3S8SA 2GJFA 4FWMA 3QT6A 5T7LA 3AOCA 4M95A 5AQOA 3AJDA 3RUBL 4KFBB 2RRBA 2MKHA 4FYWB 5A8KB 4A2AA 4OZLA 4EBCA 1CEZA 4AXIA 2DB1A 3TRGA 1SL2A 1TGOA 1FXRA 2FDNA 1O13A 4EP4A 2UXDK 5JLHA 3Q8YA 4HI2A 4RWTA 3KTQA 6FD1A 3HHNB 1B0PA 3RW6A 2DY9A 2WBRA 3QFHA 2PO4A 3JAMY 3OQ2A 2HQGA 4ZTJA 2ZJRL 4HLBA 4JYAK 4EK2A 1Q16B 3EDRB 1TAQA 2GV9A 2KL8A 4EIAA 1OQ3A 2NUBA 3OBIA 3B78A 2JDJA 1UWBB 1T11A 4QPTA 3V4IB 3TA0A 1Y5NB 4OX7A 1ZTWA 3G82A 4DTXA 1FWKA 1JQGA 2B4JA 2BE2A 4FW1A 4QU7A 1G2EA 1ZBIA 3HHLD 1VRUA 4CH0S 2I1RA 4J9RA 3I87A 2ZVIA 2P9GA 4XEIA 5HMWA 4OYBA 4B3RJ 4Y2CA 5KPZA 1OH5A 2DO0A 2A1BA 4F0KA 2MKYA 3KLFA 3D0HE 2VG6A 3T19A 2CFXA 1XNQJ 2OYQA 1FKPA 1LAVA 3ZT3A 4ZMMA 1N5YA 1FFSB 4PXEA 2YY3A 3OBWA 4OZ0A 4FLXA 3E66A 4PA1A 1X9WA 1UEUA 5JS1A 2G1HA 2HNZA 3CCRN 3QINA 3GSDA 2APOA 3I8DA 3DU5A 4HHHA 4LFAK 3KJVB 1RUSA 2R7QA 5KG0A 3LZJA 3LOUA 2VPXB 5CYQB 1IKWB 3ET6A 4CK2A 4WFZA 4X4TA 4Q8FA 4RPFA 4ECVA 3KLHB 3H90A 4QS8A 1TU0B 3TABA 1EX8A 3FVYA 2FSJA 4DV5K 4K0KF 2GC8A 5KFEA 1C0GA 3Q0AA 4KREA 3PX4A 3RGIA 5LMNF 3DCAA 4TXSA 4FLWA 4KKOA 2R8KA 4J9VA 2NZCA 1YJVA 1FDBA 2P1JA 4RUHA 2L9WA 2QW9A 3MCAB 4A47A 4X62F 4NA2A 2JFKA 4K4VA 2C3OA 4X66F 2YHBA 1YBAA 3KMSA 5A8RA 4H54A 4H4KC 3ADAC 5L9XA 4U67L 2XM3A 3BO2A 1QHTA 1ICEB 1P90A 3DLHA 2FD2A 4LT6A 1X8DA 1OH6A 1HPZA 4WQ5A 1S10A 1HI1A 2VQEJ 5FPEA 4DR6J 4G65A 2HYIB 3U02A 1S1XB 2W9BB 4K50A 2UU9J 4OO1J 3SV3A 3UWTA 2DITA 1NBEB 3T5JA 4DPTA 3VTHA 1QD1A 3OR1B 4IG0A 4FPAA 4DV7J 3ENQA 4RJVA 4YUDA 1NM1A 2B5JA 3DI6A 3QBXA 3PSFA 4QWAA 1IBLK 4HL9A 2VG7B 4C3KA 4ZPTR 1F9HA 1WF2A 4RW4A 4NLWA 1RLDA 5JVHQ 2FJAB 3GB0A 3T5LA 1JIHA 4FLUA 4CM0A 4ECUA 2VHGA 3NL0A 4FK0A 4CZMA 1O5JA 3IR7B 1N6QB 1HFEL 2E2OA 4NA3A 5KFJA 3M1VA 3TNVA 2WUSA 3HPGA 4A4JA 4DCOB 2Y8YA 3BREA 4J9QA 2GBZA 3SQ0A 5LL6d 1L3TA 4BC2A 3NRBA 1UFKA 4JV5J 2OPPB 1KQGB 3FSYA 2HHHF 3U3GA 3MM8B 2QYGA 3DRYA 4E7HA 4B3RK 5E0OA 1PO6A 4BC5A 4JI7J 4L75A 4FZYA 3C6TB 4DLEA 1RT2A 5ADXA 1G15A 2ZWOA 3F9MA 1IBMF 1KAZA 4X2BA 4M5NA 2UUBF 2IY5B 3HHLC 5LT5A 1WKKA 1ZPWX 3NH0A 2AYMA 1FA0A 3D4JA 4JB8B 2EBEA 1N5TA 3FZFA 4CLKA 4DV2F 2W8LA 4DL7A 2AGPA 3TX0A 4P9SA 1FNXH 2MKCA 2X6SA 4B8CA 1VQNS 2ZUAA 5HJXA 1ZBFA 4CHYA 3TI0A 4ECXA 1MNEA 4J9PA 4JI4F 1SUQA 2YX7A 3R8EA 1X4FA 5GADU 3H1VX 3V9SA 2JL9A 4ED1A 4FZZA 2E5IA 1S7HA 4CF1A 2C3UA 3PJXA 2VBWA 4NL5A 2NQPA 4DS4A 1B99A 2R4FA 1VC6A 1S1WA 5D8HB 3HP6A 4E7IA 2VWKA 1HBOB 3BBCA 3VHQA 3PG9A 5KQDA 4F3QA 4GMKA 4M5MA 4MH8A 2KZMA 5AR0A 4FYXB 3GFYA 3MR2A 2P9KB 5DRKA 1NAQA 3OSPA 2HBYB 1W25A 3ZZOA 2E8AA 1JLAA 1FFGB 1LCUA 5J2QB 1GLCG 2WVDA 2FIUA 3F41A 1TUGB 1N4LA 2DGWA 4ES2A 3MPYA 2GELA 3C16B 2BE2B 2ABYA 4JI0J 2OZMA 1XJWB 1AYEA 4DQPA 2OTJN 1S76D 3TOQA 3NLCA 5KT2A 1RWNB 5FPNA 1JLEB 3SSSA 1Y10A 1WSVA 1U1QA 2YWFA 3SLCA 4CO2A 1QUPA 1YTAA 4FSVA 2I2YA 1SIZA 4E89A 2HHTA 4CYUA 1S5JA 1K0VA 3WNFA 2QLWA 3GR1A 5CY4A 1NUEA 3BQ0A 1R6VA 2UV8A 2Q79A 4ZHRA 2A0FB 1VSFA 2UXDF 4Q2MA 3AA8A 1VQPS 2WAQD 3VF4A 2KI2A 2FZGB 3VQ6A 2NUHA 3LZIA 2XS5A 3SQOP 4LF8F 4HVZA 1IBKF 3VQ5A 1WC5A 1LWFA 5KPRA 3EMTA 3VVUA 2B9WA 3G6XA 3C7NA 2BJ1A 2I6WA 4L3KA 1E6YA 2DRAA 2CH5A 5DQGA 3EPGA 1HQ2A 4ZN1A 1PBAA 2XMUA 2IAJB 1GLLO 3EDQB 2KW4A 2FPHX 2DVIA 1M5HA 2ZZTA 3IG1A 2FQQB 2B3TB 4ER8A 3SQ1A 2YNHA 1LK5A 5MLCQ 2DNZA 1U1MA 5ETKA 4ZLPA 1J53A 2YQ1A 2NXUA 3GIIA 1RDDA 3KJFB 1V3ZA 1UL3A 2WOMA 3HVTB 2CQ0A 1X1PA 2IPOB 4FWLA 4P7VA 5ETPA 1UJ4A 3MWPA 2QEXS 4GVMA 3E2EA 4CF0A 2SXLA 2F9WA 2ROEA 1S1VA 2L3MA 2AJ2A 3CSKA 4HDHA 2L9DA 4ILJA 2F9JA 4OL8A 3UR0A 3FE1A 3SMPA 2YKOA 2V6AA 4O3PA 4C2MA 3I6PA 1SQGA 3GJQB 2DPNA 4PKGA 5KT4A 3K8WA 4WP8A 3TA1A 3SCJE 3ENWA 4OZ2A 2D4WA 2VFUA 1KLMA 4X4OA 1XERA 2WVBA 3MCNA 1WEZA 3FNNA 1P9QC 4LFAF 3VF0B 2R7OA 1Z1ZA 4IG0B 4PZVA 3ONQA 1NM2A 3GJSB 3G8QA 3V9ZA 3ENVA 1WEYA 2XYPB 4DQQA 4CLUA 4YS2A 4BR7A 2B5JB 4DG1A 3M6VA 1NH8A 2C2DA 3PJ9A 2XS7A 1V6HA 4Z0UA 3O3LA 2M9KA 2HGLA 4MO5A 5E3PA 3P4IA 3IMXA 3DRPB 3NOCA 4RW4B 4O4GB 1HBMA 1NJXA 5EU7A 4AL7A 4R79A 2EK6A 1ATNA 1HKCA 4USTA 1OS5A 3S9HA 2QWQA 2LMIA 1VQ7S 3H2VE 4GMJB 4JI0K 1FJGJ 4NO7A 4RCHA 2AP6A 1REGX 1AFJA 4GVBB 4ZPCA 2MQNA 4DZDA 4AQYF 3C6HA 3UKUB 3CCSS 2ASLA 2I38A 3VAJA 2DO4A 3KKFA 1KP6A 4UZCA 2RF2B 2VA3A 5LJVA 1WNSA 1ZTTA 1N0VC 1LFPA 1NJWA 1VQ5S 2OFGX 4JI3F 1MW7A 2DXEA 2ZQBA 4ERDA 5H9FK 1YBTA 4O55A 2AEJA 1SQKA 2RIJA 1C6VA 4LBPA 1VQ6S 4JNEA 5E3QA 3PW2A 3K59A 1VAZA 2IYGA 5F8GA 3CC4S 2GAGC 5LSRA 4ZVGA 5B0GA 3TQEA 4IRKA 2E1PA 4FOIA 4AM7A 1WC1A 4DX6A 1X9JA 1C1BB 2YJFA 1ACMB 2M2BA 3MEEA 2MB0B 5CQGA 5ADZA 1K8KA 4RO0A 2BW7A 3KHRA 2F1FA 1KC8O 2YNFA 2CAJA 3CE8A 1S72S 1HLUA 3M9MB 1N56A 2E6LA 2QSWA 1MWMA 2FLNA 5H1SQ 1S1WB 2PC6A 1WUUA 1NRKA 5C25A 3HHDA 3AVMA 4MIAA 1FX4A 1VBKA 1U09A 4FS2A 4B9QA 4KPYA 4QJVA 5AQGA 4ISFA 1AZSA 5D0EA 2X1GA 1U1NA 1W0HA 2IRXA 4FBUA 2OH2A 3MMJA 3QO9A 2VQFF 3FBEA 1XNQF 1RE1B 5CZVA 2RB7A 5GAGU 3PHEA 3TEGA 1JLAB 3V2UC 4ZCIA 3RJMB 2RS8A 3T41A 4Q0BA 4FWPA 5KOXA 4KTQA 5AXLA 3AQOA 4NZ6A 4GO7X 2DGXA 3LPUA 3L7OA 1NGCA 1ZS6A 2WCXA 4NXMJ 2Z30B 4FNHA 5ETRA 4ZJLA 3R7SB 4AF1A 2JEGA 3A3OB 4CFDA 1UVNA 1S6QA 1U0HB 3A8IA 3B54A 4ISGA 4DEZA 1B4SA 6AT1B 1U48A 2C28A 4OKEA 1N34K 4JKEA 3R1XA 3FK4A 3CC7S 3THYA 4DU7A 1MROB 3CUNA 4KY3A 2IFXA 3P31A 2KYXA 4KHWA 3MDQA 5EHHA 4DB3A 2YTCA 4RW8A 2H3GX 4CYUB 1NGFA 1VQKN 2N4DA 2X1BA 2JWLA 4ZHRB 2IMOA 1MWQA 4KGMA 2RSQA 2V67A 3NNHA 2AIRB 4B9VA 3WC2A 3HM9A 3HSJA 1K8AT 2PEBA 3MWBA 5FRNA 2V8DA 3SDEA 1FJGK 2VFRA 1LWFB 4TVAB 4K42A 1Y4ZB 4PXCA 2YKNB 2OD4A 1GQEA 1E6YB 4OZ3A 3MK6A 3GOIA 2FZCB 1WB9A 4IOAL 3MDFA 4UOFA 4WF9Q 2A2CA 2D41A 3DLGB 5LXRA 3SI6A 2HBMA 1FF2A 2P6SA 3OA9A 3CJKA 2VQEF 2BOPA 3I4PA 4DR6F 3RBZA 2AYBA 4CERA 3UO0A 1KXPA 2UU9F 2LSNA 3NXZA 3FZ2A 3GTYX 4CM2A 5CCLA 4JK7A 4DTOA 3JAMO 3ZSRA 1K73T 1NGEA 4DV7F 1S49A 2ZGYA 4NZ7A 3VAFA 2Y1RI 3FEZA 3R5BA 1WTBA 2E2QA 3W63A 2WOMB 4JKHA 2E5JA 3VF6A 4EO8A 1RDUA 1V9OA 3FFIA 1RXOB 3VWSA 2FHJD 2P9LA 5E3CA 4OZ5A 2R2SA 3DRRA 2NRXA 2GEMA 3AA3A 4CZLA 4DR7J 2GQCA 3P3DA 1EJ7L 4C11B 4BREA 2HFVA 2Y3YA 3T9ZA 3OLAA 3L2RA 1MSWD 3AVHA 4YOXA 4YMEA 3BO3A 4DR4F 4FJXA 1IR0A 4YOYA 3UN5A 1N52B 5EOYA 5K8OA 4LR9A 1FCAA 3KK2B 4QOTA 1KLMB 4O23A 3RG6A 4JV1A 4JV5F 2GHVC 2IVOA 3K7RA 1NNDA 1Z2LA 4YHHJ 2NRRA 1GT8A 3UNYA 2PIIA 1FI4A 2QWOA 2UUTA 2GWKA 2PAVA 3QNNA 2W6KA 4ILLA 3THWA 2JEIA 4JI7F 2OJ3A 4CHZA 2LU1A 1YTYA 4DFMA 1E3MA 1X4GA 1X5TA 2QTWA 2VU5A 3BEXA 5CHCB 4BE0A 4KHYA 1T02A 4N7TA 3P5TL 3NGYA 5LJWA 2E5GA 4YNQA 2PYJA 4B9MA 3O4NA 2N3LA 3HULA 2FJXA 2BXJA 4QR2A 3BSNA 4ILMA 4DX7A 1D3WA 3M8ZA 1SZ2A 4NXMK 4IFVB 3MM9B 4CJTA 2XO6A 1TL1A 1LWCA 1KVAA 4AHVA 1S6PB 4KJIA 2J9DE 2R8JA 3E01B 3DN9A 4BRCA 2XHWA 1VBXA 4CP5A 2NREA 4C1NI 3UNGC 4B3SK 2J0WA 4RW9A 2FJEB 3BQ2A 1KVKA 2CZ4A 3FDSA 4BROA 3MEGA 1O0PA 4HDGA 1X4EA 2E1YA 3M7VA