3KK1A

Hiv-1 reverse transcriptase-dna complex with nuceotide inhibitor gs-9148-diphosphate bound in nucleotide site
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
555
structure length
555
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
total genus 148
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk1A05
1EP4B 3RTVA 5KRTA 2G8VA 4IG0A 3PUFA 1QSSA 4MQ3A 4CJSA 4J9LA 2BANB 4O3QA 3NGZA 3RR8A 4Q8EA 4URGA 1C0TB 3DOLA 2KZZA 2YKMA 3KHLA 4DTSA 2AGOA 4QW8A 3L2QA 4B3OB 4KBIA 4H4MA 4KO0B 2IC3A 3EPIA 1FK9B 3TAFA 4ED3A 3DOKB 1J9AA 3CIZA 3LP1B 4RNHA 1N6QB 2KTQA 3H08A 3FDSA 2A1SA 3DLRA 1YTAA 2R8JA 5J2QA 2VG7A 4DL6A 1RT3B 4H4OB 4FW2A 2FVRA 3L2RA 2HHSA 1WSEA 2JEGA 5KFHA 1JXEA 3M9NB 3WNEA 3KTQA 3OYAA 4CJ5A 1WSHA 4HKQA 4O4RA 2VG7B 4DL3A 4WFZA 1BI4B 4E7JA 5KFWA 3KLEB 3TVKA 2IMWP 4ECWA 1VRUA 2RDIA 3SUNA 3OYEA 3QEXA 2UVWA 1RBRA 2JC1A 3SYZA 3CJ3A 3K5OA 1JLEA 3NDKA 5KG6A 1X9MA 1QE1A 3OL8A 3VQDA 2B6AB 3HP6A 3L3VA 5CZ1A 2ILZA 2O4IA 4RZRA 4FVMA 3K5NA 3ICLA 5KFTA 4BACA 4N5SA 5J2NB 3DRRB 3KHRA 3AV9A 1REVB 4PWDA 2HHUA 4IRCA 2WCXA 4BE0A 1XR5A 5EWFA 4NRUA 4JV2A 2BE2A 4CEDA 4OLBA 1RDAA 4Y3CA 4DG1B 2B6AA 4NLVA 1VSMA 4FJIA 3RAXA 2XY8A 2PYLA 2ASDA 2JEFA 4PWDB 4B9VA 3ALYA 2XCPA 5DQGA 1LWFB 4CJTA 3RAQA 1TK5A 4NRTA 4DG1A 4KHMA 3KJVB 3LZIA 2HNDA 4NCAA 4K4UA 4ZPCA 3M8PA 3TANA 3AA3A 4NLGA 4CECA 2Z1GA 2E9ZA 4KHSA 5L1JA 4CK3A 3ZT2A 4WYLA 3NL0A 4E7LA 1RTIA 1HYZA 2D3ZA 5KG1A 3BREA 1OS5A 1S10A 1BIUA 2XCAA 2J6TA 3EPGA 4DFJA 1Q8IA 4M3WA 4E1MA 2B4JA 3RR7A 3GV5B 2C2EA 3HXMA 2FLLA 3ASMA 1N5YB 4XPEA 3TABA 1KVAA 4WFXA 3NCIA 4ECRA 4NLDA 3OS1A 4IQXA 1Z26A 3TAEA 4B9NA 3M8RA 1IKVA 3ZSWA 4LSLA 4ZPAA 1HYSB 3TAMB 2E9TA 3IS9B 2D0AA 3K57A 4QWAA 1RT7A 4BDPA 2J6SA 3SPYA 3OYFA 1EKEA 1WSJA 1ITGA 4F4XA 5F9NA 1C1BB 3QETA 4DSIA 4DTXA 4ZP9A 3PW2A 3MECA 1YVUA 1LWEB 3O4NA 4CJVA 2YHBA 3V81B 2ATQA 1KCFA 1KSPA 3NGDA 1FXXA 3GQCA 3BSNA 3RMCA 4E19A 1LW2A 3ZSVA 3SPZA 3ZCMA 3V9WA 4C8NA 2WK4A 1UAXA 2EHGA 1X9WA 1C0UB 4DMNA 2HHXA 1MU2B 1DTTA 5KFGA 4OVLA 4W5NA 3NGYA 3OYIA 4CHYA 4G1QB 4J9NA 5DG7A 4HUGA 1QAJA 3OJUA 4M45A 1JIHA 4IBNA 1C0UA 3CYMA 4RW8A 2W9AA 4MKBA 4K4SA 1VSJA 4EZ9A 1JLQB 1JL1A 1NK4A 4WXWA 4DQQA 4IH7A 3OYBA 4FXDA 3HVWA 3VQ5A 4YMEA 3V9XA 3OYNA 4Z4CA 2E6MA 1CXUA 4MK8A 1VRUB 5CY4A 4J2EA 4TXSA 5KFUA 2UVVA 1TKXB 2DFHA 2YKNB 2V4QA 1U4BA 4ECXA 4G3IA 3V6DB 4CFBA 4QWCA 1RAJA 4W5RA 1NOZA 3QIPA 3DRRA 4ZP8A 2JEIA 3H5YA 3HPGA 1NKCA 2HW3A 1TKXA 1T94A 3DLHA 1RT2A 2G8UA 1A5VA 5FDLA 4LSNA 1LV5A 1HNVA 4K4TA 3NH0A 3AO3A 2JEJA 1B9DA 5C24A 5F8NA 4KPYA 2FJVA 2IDOA 4NLPA 4Y2AA 4B8CA 4Q0BA 1D1UA 3DI6B 4CHZA 3QEVA 3MTKA 1SL1A 5KT4A 3DOKA 3PR4A 3AVKA 4UQGA 3RB4A 4EYHB 3AVFA 3LP1A 4B9LA 2HWHA 2X6SA 3KLVA 4CFCA 4KHRA 3CM5A 1RT4B 1B9FA 1IKXA 1VSLA 3NF8A 1QS4A 1EP4A 1JLFB 4CJRA 1I39A 3DLBA 1KFDA 1NNDA 3DRSB 3DLGB 4ID5B 2JGUA 3HKWA 1HARA 2OPPA 1C0TA 3DOLB 4OL8A 3CJ4A 2ZE2A 1XR6A 2W8LA 3PX0A 4EEYA 1UA0A 1RBVA 5DLGA 5I3UA 3AVJA 2G8FA 3HHKA 4LSLB 4KHYA 3QERA 5J1EB 4O4GA 3E01B 3MFHA 1QUVA 5T14A 5FROA 3PY8A 3AO2A 1C2PA 2QKKA 1WN7A 2DTUA 1K1SA 1JLBB 3OL9A 3JSMB 1SL0A 1YT3A 4DTMA 5FRMA 3CJ0A 1WAFA 4KHNA 2BRLA 1QE1B 4KI4A 3MECB 2YNFB 2FBVA 4J9RA 1EETA 1ZBUA 4IH5A 2XWYA 4DL2A 2IAJA 3FFIB 4E7HA 4CEEA 4F3OA 4RUAA 3RBEA 2AGQA 3P1GA 4TYAA 2I1RA 4ED1A 5SZTA 4KREA 1X9SA 3OHAA 1RTDB 1RDDA 4CGDA 2VWJA 1T05B 4NLXA 1HPZB 4O3NA 1BQMA 3FFIA 3SCXA 3AVCA 2QXFA 3MR2A 4CESA 2HMIA 4DL4A 4DTNA 2IM3A 2F8TA 4NYZA 2FJWA 4RNFA 4FCYA 4IDKA 5J2NA 1NK9A 3DMJB 4DTRA 3SUPA 1HPZA 4JRPA 2HHWA 5KFKA 2ITGA 3MEDB 2D41A 4CHQA 3I0RA 3CG7A 1SH0A 2AJQA 4J9SA 2GUIA 4CK1A 3IG1A 4YNQA 3OYJA 1SUQA 3DLKB 4Q44A 3G86A 3UIQA 1DTQA 1QQCA 3HVTA 3KMSA 4JS5A 4W5TA 5EWGA 4DS5A 3H5SA 4M3RA 4QWEA 1NKEA 4LD0A 2YKNA 1WSFA 3WNHA 2R8KA 3ISND 2UUTA 4RNOA 3QNOA 3TAQA 2BQRA 1HYVA 1DTQB 2OPRB 4E7KA 2IBKA 1CXQA 1I3AA 4RW4B 3V9ZA 4FJJA 5HROA 2AWZA 1ZETA 3OYDA 2YHAA 5KFMA 3KNAA 3WNGA 1LWCA 5HP1B 1IKWA 2V9WA 1HQUB 2RN2A 4FLXA 4FJ8A 3VQAA 3LP2B 3SV3A 5J2PA 1S1VA 3GIIA 3PW0A 3BGRA 2IM2A 4QW9A 4K8XA 5F9LA 4CF2A 3D45A 3G6VA 3I0SB 3LALA 4R5PB 3OSNA 3N6LA 1S48A 1VSIA 2VG5A 1NHUA 4CHPA 4Q0BB 4NCGA 5KG0A 1LWCB 5HP1A 2OYQA 3ZSZA 3CO9A 1WAJA 2DY4A 4IG0B 4DL7A 5KFSA 4I9QA 4CGHA 4JV0A 4TN2A 3P83D 1J53A 1VSHA 4DFPA 4M41A 4K50A 3T1AA 1HMVA 3KK2A 4B08A 1JLFA 3GV8B 3GYNA 2VG6A 3O3FA 4M3UA 4OKJA 4NYNA 5DMRA 4F2SA 3TWHA 1CZ9A 4O44B 5KFVA 4Q45A 4K8ZA 2R2SA 2XGQA 4KAIA 2WOMA 4NLQA 2BQ3A 4I2PB 4RW8B 4CF8A 4K4WA 4ED7A 3DLEA 4O55A 1ZYQA 3QO9B 1JLQA 4URSA 1FKPA 5HRPA 4KB0A 4YP3A 4ZP6A 3K5LA 5CYMA 1DLOB 4ID1A 2KFNA 1NK8A 3ZSQA 2XY7A 3LANA 1L3UA 1RT5B 1S6PA 2RKIB 1BHLA 3ITHA 1UWBA 3PW4A 1JL2A 3RMAA 1C6VA 5HLFA 3DM2B 4I9LA 3OYLA 1TP7A 3AO4A 1S1WA 4J2DA 2R8GA 2J6UA 4KTQA 4M94A 5EU7A 3T5LA 4BDYA 2R2TA 4J2BA 2NUBA 2VWKA 4B9TA 4FS1A 1D9DA 1U04A 4MFBB 5KGXA 4OKKA 3L2VA 5JUMA 1S1XB 5KT7A 2A1RA 4CJWA 4LH4A 3B6OA 3SJJA 4PQUA 3QINA 4ED6A 1HQEA 3LP0A 3PX6A 3ZSOA 4FBUA 4MIAA 2ILYA 1EXQA 4MFBA 2VA2A 1XC9A 4ZVEA 5KFJA 3HO1A 5T7BA 3M8QB 1S1XA 1TAUA 3NE6A 3KLGB 3MFIA 2P1JA 3OSPA 4N47A 3QZ7A 3PO5A 3UPFA 4KKOB 1KLNA 3ZT3A 2YV0X 1S6QB 2RF2B 2P5GA 4ED0A 4C8KA 5HRNA 5F8JA 4KV8B 4RW7A 5KFXA 2Y1IA 3SI8A 2W7OA 3CDUA 3SQ0A 1SV5A 3KKSA 2ZE2B 2UVRA 4QCLA 2HHVA 1TK8A 3PHEA 2YNGA 4K4VA 4O0JA 3VQ6A 3E01A 2AQ4A 3Q8SB 3K58A 5I42B 3OL6A 2GC8A 2BGGA 1RTJB 5KT5A 5KFLA 1S4FA 1GX5A 4ZTFA 1A5XA 2YNGB 1NHVA 3QIDA 4RG8A 2OPSA 3DRSA 4CJFA 3T5KA 2C22A 4NLWA 2W7PA 3M8PB 4KTZA 3NBPA 4CGFA 4R8UA 4CFDA 3M9MB 4DQRA 4DF8A 4PA1A 3I0SA 4R5PA 1TL1A 3S3OA 2Z1IA 1L3SA 4OLAA 4FLVA 1T03B 1XR7A 2G8WA 4DSKA 4JUZA 4DQSA 2ETJA 1ZBIA 3QGGA 5F8IA 1BCMA 3RB3A 2DPJA 3CM6A 3DYAA 3NF6A 4O4GB 3S3NA 3KIOA 4R0EA 3E51A 4JRQA 4FJLA 5C25B 3NH1A 1JLGB 2RPIA 4C8MA 1KTQA 1HNIB 1TL3A 1QHTA 4N56A 1QTMA 1J54A 3CJ5A 4FZZA 1HJRA 4ECUA 3OHBA 3TAGA 3HK2A 2YNFA 1XI1A 1S9GB 4CHNA 5DGBA 1GOAA 2IJFA 4DTPA 1SKSA 3LPTA 3V6HA 2X78A 3VA3A 3IAYA 3KK1B 3OLBA 2I5JA 5F8LA 3V1QA 2Z1HA 3PV8A 3VQQA 3BJYA 4ZPBA 4DF4A 4I2QB 2G8IA 4PUOB 1NK0A 4FJHA 3MEEA 1WSIA 3VQ4A 5HLFB 3V1RA 3DM2A 1JLCB 4FM2A 3KK1A 4E7IA 1KVBA 1VSKA 2HMIB 4DU1A 1LW2B 3TQ1A 3N6NA 3EYZA 1BGXT 2D0CA 3K5MA 4PUOA 1S1TA 4J2AA 2Q3SA 1JLCA 2FVCA 4TQSA 1TKDA 2V4RA 1N56A 4HCBA 1S1VB 4O3OA 3C6TB 4DL5A 1S1TB 1TV6A 4FJGA 3AVIA 3RRGA 3M8SA 1Q9XA 5DQHA 3EZ5A 1G15A 2IGIA 4NLUA 4GC7A 3I5CA 3TI0A 1U45A 1RDBA 2GV9A 5FDLB 5DGAA 4RW9A 4Y1DA 3QYYA 4RUCA 2QE5A 3D0PA 4RNNA 1IG9A 3NAIA 1IKYB 4RW6B 5C5JA 4F4WA 1S6QA 5L1LA 4ECQA 4NLYA 4ZP7A 4W5OA 3LWMA 4OPJA 3HM9A 1ZBFA 1HYSA 3ZSXA 4YR2A 4KV8A 4RW7B 3PR5B 2P51A 1IM4A 4QOZB 4FM0A 4FK4A 5KFNA 4WE1A 2IOCA 1IKYA 2CJQA 4TY8B 4ZHRA 4NCGB 1Y97A 2YNHB 4TSXA 4H4MB 2IC3B 4CF1A 1JXLA 1FKOA 1XWLA 3UR0A 4ID5A 4IR1A 4J9OA 4FJNA 5I42A 1TKZB 2B5JB 4DS4A 4C8LA 4BWMA 2YNHA 3K59A 2XHBA 4Q43A 4KRFA 1FKOB 5K14B 5J1EA 3U3YA 2BANA 4LH5A 2KW4A 2D3UA 4FLTA 4CCHA 4EP4A 2B5JA 2YKMB 4B8AB 4ZVGA 3AVGA 2WHOA 2ZQBA 4CF9A 3JSMA 3RRHA 4FJ5A 3L2UA 4F4ZA 1N4LA 2QV6A 4AH9A 2EX3A 5KFFA 3NF7A 3HSTB 3LPUA 4FZYA 1QAIA 2IJNA 4K4YA 1RT1A 1VSEA 4CJPA 3C95A 1SH2A 3MR6A 4Y2CA 3KLIA 4OKEA 4DTUA 1S9EA 2HNYB 4FW1A 2RDJA 4I7FA 4F50A 2GBZA 1HNIA 1TL3B 2W8KA 2W42A 4ECSA 3PVXA 3CFOA 1SH3A 5KTQA 4BE1A 4RU9A 4IFYA 4ZVFA 4GVMA 1RT3A 5KG7A 1BCOA 1WLJA 3LP3A 4AHTA 1RTHA 4CE9A 3I5BA 4NZ0A 5KT6A 1S49A 2BR0A 2IS3A 2RF2A 4Q5VA 4L8RB 1T3NA 3LWLA 4U6PA 3LAMA 3ISNC 3OVNA 2XRIA 3RMBA 4OJRA 4CJ3A 4CJQA 3AO1A 3JYTB 3KLEA 3KOAA 2D7SA 4ECZA 4HTUA 4M3YA 4F3TA 3LP0B 1SV5B 3F73A 3S9HA 3SQ1A 3QGHA 4GMJB 4O3SA 4OGCA 3AVBA 3BDPA 3HJFA 2KQ2A 4B9SA 4LSNB 2ASJA 1SKWA 1MMLA 4B9UA 4F4YA 3K2PA 4F4KA 1BL3A 3T5HA 4KAZA 1BQMB 3FQKA 2ASLA 3NF9A 1XHZA 4AHRA 1RTIB 3NKYA 1JKHA 3KK3B 1NJWA 2E4LA 3C6UB 3EY1A 5F8MA 4DSEA 2AX0A 1RDCA 3CQ8A 4CIEA 2JLEA 4IDKB 3C6TA 1R0AA 4J9QA 3MXJA 1RT4A 4JS4A 4C8OA 4B9MA 4Y1CA 3KK3A 1C1CB 3MEGB 4LQ9A 5J2PB 3LZJA 4WZQA 2OPPB 3HVTB 5KG5A 4NLTA 1R0AB 4ECYA 4CEFA 4AHUA 1KHVA 4OPKA 1WSGA 4HUFA 3MEGA 1N48A 4PY5A 4R8UB 1LWEA 3KHHA 3V9SA 1S5JA 1TL1B 3D5MA 4ZHRB 1ZBHA 2XO7A 4DLEA 5HRRA 4EO8A 1KRPA 1IKWB 1HQUA 4BWJA 3MR5A 4CEZA 4Z4HA 4FLYA 2HB5A 4FJ9A 4AILC 3VQ9A 1RBUA 3VA0A 1RT7B 1TKZA 5KFQA 1GOBA 4ICLA 4ELUA 1LAVA 2V0NA 1MU2A 5J2MA 2IM1A 3V1OA 1HRHA 2KZMA 2C28A 3RB0A 1U09A 3RB6A 2OZSA 1S9GA 4CFAA 4ECTA 1IH7A 4ED2A 4IFVB 1N6QA 4M3TA 4NLSA 1RCHA 2PYJA 3Q8QB 5KT2A 3G6YA 3BQ2A 4LY7A 4DFKA 2G8KA 4J9MA 1QSYA 1WNSA 4RNMA 2FJXA 1JX4A 2E6LA 3AVHA 1B92A 4MK9A 2HAIA 2WONA 2D5RA 5DQIA 3KLIB 4FLZA 4Z4EA 4O3RA 4N76A 3OYCA 3TAPA 3TARA 4I7FB 3IGVA 5KFOA 3VQEA 4KI6A 3AA2A 2B43A 5KI6A 2HVHA 4DFMA 3BSAA 2R2UA 3NAEA 1K1QA 3HPHA 3PZPA 1YTUA 5KFPA 1RA7A 2QK9A 1HQEB 5SWMA 4ZVHA 3OL7A 1ASWA 4FS2A 2W9BA 4WXOA 3MXMA 4EO6A 3CDEA 4M42A 4DU3A 1RT2B 2FBTA 1U49A 3QNNA 4Z4GA 1BQNA 2CKWA 3AA5X 2DFFA 4E1NA 2OPRA 4CIGA 3KHGA 3HL8A 2AU0A 3VQPA 4EBCA 1REVA 3C94A 4IKAA 5F8GA 4O3PA 3AVAA 3HT3A 1S97A 3H98A 4JLHA 4YR3A 3H4DA 3A2FA 1BQNB 4M3XA 1NKBA 1ASUA 3UQSA 1O1WA 2HNZB 5EWEA 4E0DA 3DRPA 3NHGA 2VG5B 1VSDA 3V4IA 3LAKA 4CGJA 4WZMA 1JKHB 3MAQA 1SL2A 3M8QA 4CJEA 1S0NA 4DSLA 5KT3A 4CGIA 1JLAA 4TYBA 4CF0A 4F8RA 2LSNA 4CK2A 3OS2A 4WE1B 4GC6A 1QSLA 3RWUA 1KLMB 3OYKA 1NK6A 3DI6A 5L1KA 4ED8A 2VG6B 2BQUA 2VA3A 4IG3B 2HHTA 4FLWA 2DFEA 3QIOA 5HRSA 3ZT0A 4WYWA 4HYKA 4KE5A 2AGPA 3GV7B 3MXIA 4DSJA 3B6PA 3KLHB 3SV4A 2GIRA 3QLHA 3NAHA 2C2RA 5K14A 1KHWA 1IO2A 4DTJA 4QWDA 3GIJA 3TAMA 2F96A 1EX4A 1D5AA 4HCCA 1RT5A 1S6PB 2RKIA 5C25A 1RTHB 2IAJB 1NJYA 3RBDA 3L3UA 2XY6A 2FBYA 2ZKUA 4ECVA 1XHXA 3QLHB 1C1BA 1ZBLA 1Z25A 4KSEB 3NBPB 4GW6A 1RT1B 4H4OA 1JXBA 2ZD1B 5DG8A 5L9XA 5CZ2A 3ULDA 1RA6A 1T05A 1NK5A 3T5JA 4IRKA 4CJ4A 3KMQA 2I5JB 1ZTTA 4KB7A 3PO4A 4ZMMA 3CDWA 1BI4A 3SNNA 3PW7A 5HBMB 3OYHA 1C0MA 2F8SA 3IGNA 4KFBA 3MF5A 3OLAA 3CWJA 2C2DA 1TQLA 3MEDA 4KHWA 1JLEB 1LWFA 4NLOA 4IRDA 2Z1JA 4TQRA 3GILA 3T3FA 1KVCA 3JYTA 1RYRA 1TKTA 1TAQA 3VN5A 5HBMA 4KKOA 3QEWA 3S3MA 4IKFA 3FRZA 2R2RA 2OPQB 3QESA 4W5QA 3O3HA 4WFYA 4E89A 1TKTB 3HYFA 1X1PA 4X2BA 1W0HA 1S0MA 3AVLA 4CEOA 2HVIA 3DMJA 1TV6B 3KLFB 2XC9A 1RBSA 5EUHA 2X6NA 3L2WA 4NLRA 1LW0A 3QEIA 2HNDB 2FLNA 2ATLA 3FSIA 4DQPA 2PZSA 3SQ2A 2WTFA 4FZXC 4ELTA 1NOYA 2IA6A 1RNHA 2E9RX 1RTJA 3LDSA 1S9FA 4Z0UA 2W9CB 2D0BA 4KB1A 4DEZA 1CLQA 1CZBA 1C1CA 4DTOA 2BRKA 4ZTJA 3I5AA 2OPSB 5D3GB 5KG4A 4YFUA 5C42B 4H8KA 1CSJA 4CEBA 5KFDA 2KFZA 4XIUA 4RW4A 1YVFA 3VQSA 2HNZA 5JS1A 3GIMA 3V81A 4EZ6A 1N5YA 1T03A 4ICLB 4DQIA 1UA1A 1TGOA 1RT6A 2Y1JA 1W9HA 2QKBA 3U6FA 1T8EA 5DLFA 3IS9A 1JLAB 4HHTA 1T7PA 3V6KA 3NMAA 1JLGA 2P5OA 1L5UA 4Z4FA 3HVRA 4CHOA 3AO5A 3BR9A 4J9KA 4H54A 2OA8A 1VRTB 1DLOA 3HPOA 3CJ2A 5KFIA 1UWBB 1HMVB 3PJXA 4EP5A 1KFSA 3KLHA 3H5XA 5F8HA 1S1WB 3CVKA 3KKRA 4EBDA 4DU4A 3RMDA 3WNFA 4HUEA 1BISA 2IM0A 5J2QB 4NYFA 1U48A 4I2QA 4O44A 1VK0A 1L3TA 4M3ZA 1ASVA 2WOMB 5KFBA 4I2PA 3V9UA 1A5WA 4MH8A 5KRSA 1DTTB 4KO0A 3D28A 3QO9A 2X74A 3QGIA 1TK0A 4KTWA 5CYMB 4URQU 3CFPA 2ZD1A 1Z4UA 2R8HA 4PQUB 1EETB 4FJKA 2O5DA 4F2RA 1I6JA 2JC0A 3G0ZA 3OYMA 2UVUA 3AA4A 5KFYA 2HWIA 3KD1E 4CEAA 4Y34A 4FJ7A 4FJXA 1RTDA 3V4IB 2GIQA 3EZUA 1GOCA 1NK7A 3BQ0A 4E3SA 4IFYB 2R8IA 2DPIA 5KFEA 3OS0A 4XPCA 1KLMA 3NH2A 1D8YA 1IKXB 1L3VA 1S1UA 1RYSA 2YNIA 1J5OA 1VSFA 5KG2A 4ELVA 3C6UA 4YR0A 3HVAA 4IG3A 3KLGA 1BIZA 3DLGA 1HNVB 1SUQB 3DLKA 1GX6A 2XI2A 4TY9A 4K4XA 2FVPA 4TY8A 3OY9A 4O0IA 3KLFA 2BE2B 2FVQA 1J5OB 1SKRA 3ZSYA 3G6XA 1RDRA 5FRNA 4EYIB 1D0EA 4BDZA 4AHSA 1RBTA 4Z4IA 5HROB 4Q8FA 4U7CA 3MR3A 4B3OA 3OYGA 1ZTWA 1W25A 1JLBA 3I8DA 3SQ4A 3N6MA 4JV1A 3QZ8A 1FK9A 1Q9YA 1F21A 4NCBA 4N41A 3DYAB 3KJVA 3BSOA 3SI6A 3LP2A 4IH6A 4TLRA 3BGRB 4CJKA 4FK0A 4MIBA 3F9KA 2OH2A 1UOCA 4MK7A 5KGWA 3ZT4A 5I3UB 3U3GA 4J9PA 4FLUA 3BSCA 4XO0A 4FBTA 5EDWA 4DWIA 5CYQA 2UUWA 3FQLA 3BQ1A 1NJZA 3VQ7A 4KFBB 1S9EB 2HNYA 3PW5A 3GIKA 3P5JA 1IKVB 3THVA 2XY5A 4YQWA 4LQ3A 3M9OB 2PY5A 4ZPDA 3ZSRA 3SFGA 1VRTA 2XI3A 4QWBA 4CIFA 5CYQB 2R7YA 3H4BA 3KD5E 4IFVA 5KG3A 2FBXA 3MEEB 2OPQA 4QPXA 3H5UA 4CGGA 3ZT1A 3NFAA 3VQCA 1FKPB 5KFAA 3IG1B 3QEPA 4G1QA 3HP9A 4MKAA 3H2LA 2FVSA 2FC0A 1D9FA 2WB4A 4BE2A 3ITHB 3SUOA 3VQ8A 4M95A 3TR8A 5J2MB 2EC0A 3Q8RB 3V6JA 2ALZA 4K4ZA 5DK5A 2BDPA 4KHUA 3DDKA 4IR9A 4EBEA 2HHQA 3SFUA 3PJWA 2W9CA 1S0OA 3I0RB 1NJXA 3OJSA 2W9BB 4AHVA 4KHQA 3PX4A 5D3GA 4CERA 4AHCA 3V6DA 5DG9A 4FK2A 3AVNA 3Q8PB 4RW9B 2WONB 2OZMA 4DLGA 4CJLA 5L1IA 3SZ2A 3QIPB 3IN5A 4RW6A 1TVRA 4O5BA 3G10A 1U47A 3VQBA 3T19A 3UDLA 1LW0B 2FLPA 5JXSA 3SUQA 2G8HA 4FM1A 3O3GA 3O4QA 3IRXA 4QAGA 5E41A 3NGIA 5C24B 4FYDA 3CFRA 2O4GA 3DRPB 5JS2A 4FJMA 1TVRB 3L8BA 4IOBA 1RILA 3H40A 3KK2B 4DSFA 1S1UB 2WRMA 2YNIB 1LAWA 5KFZA 5KFRA 4CEQA 5C42A 4CJUA 1K6YA 3AVMA 3IRXB 2XGPA 4OGEA 1WNEA 3H59A 2F8EX 2AX1A 5KFCA 1C1AA 4HVJA 1RT6B 3DLEB
chains in the Genus database with same CATH superfamily
3PUFA 1UTAA 4QYRA 4CJSA 2B4VA 1MWQA 1J5EK 4ISGA 4IUFA 3O9TA 3RR8A 2QA4N 5AQTA 3SSRA 1UL3A 4DTSA 1SVDA 2MQQA 5AFUH 5DM7L 4B3OB 2OGUA 2ROGA 3KJNB 2P9SB 2OTJN 2RSQA 3J7ZO 4K59A 4L72B 5DM6L 1HBMB 4ED3A 4GY2B 4BRQA 4ANCA 3LP1B 2ACMA 3DRXA 2QLFB 3H08A 2DT9A 4DV2K 4GKKK 4DV3K 3DLRA 1YBTA 3DN9A 2PFFB 1LFWA 1O8BA 1OY9A 1RT3B 3EGNA 4GKJK 1PSDA 4DHVA 5A8RA 4ERDA 2JEGA 4DB3A 1JXEA 4C48A 4Y65A 1KS2A 4KHPJ 5HANA 4OHVA 3ET6A 1CJTB 4O4RA 4QIWD 2VG7B 5M2UA 1VQPS 4E7JA 3NWGA 3C16A 3KLEB 4OHWA 2J0QD 1CPZA 2MMYA 1VRUA 3BEGB 4HHUA 2BH1A 3OYEA 3C65A 4YHHJ 4IYQA 4CTAB 1MDUB 4USJC 3FVYA 1X9MA 1HFEL 5CZ1A 3EE3A 4OLOA 2A42A 2D1KA 2ILZA 2O4IA 3VR1A 4RZRA 1XK8A 4HH0A 3QRRA 1QZ5A 4IRCA 1UPMB 1XR5A 1ZZFA 3I6PA 1QY7A 3VVUA 1VSMA 2FJBB 3VF6A 4FXWA 3D68A 2PYLA 2UUCF 3CPWM 2JEFA 4GKJJ 2V94A 1RLDA 4WCEQ 2GO9A 4NRTA 1RWVB 2AJ1A 4DG1A 3IFEA 4KHMA 3AGRA 2CYYA 1EZZB 4ZPCA 4NB4A 2DISA 4K2XA 4NLGA 4F04B 4CECA 2E9ZA 1NMEB 3D0IE 4E7LA 4ZCLA 4DV4J 1UVNA 1RTZA 2D3ZA 3BREA 3THTA 1S10A 2MZTA 1VDHA 3TJ8A 1WG5A 1SC6A 2DB1A 1N5YB 3TABA 1KVAA 1B64A 3OS1A 1X4AA 2BJEA 1ZPWX 4ZPAA 2VFSA 2D0AA 3E2EA 4YOYA 4DR3F 4ZDNA 1D3WA 2RQCA 5K8MA 5F9NA 3ZO7A 3M3ZA 5JICA 4LFAK 2PAVA 1IBMK 4NLCA 5D77A 5I3QA 4CJVA 2YHBA 4ATNA 4OFZA 2ATQA 5A8WA 4CZHA 3W2WA 3IRWP 4LF4F 4E19A 5GAGI 2NXEA 3PFOA 2G0CA 1VQ5N 2SXLA 4PL8A 2YHXA 2WK4A 2ZGYA 1UAXA 2VBYA 4RLEA 3S41A 1DQ8A 3TU5A 1MU2B 5B0GA 4OVLA 4ZCIA 4W5NA 1XEZA 2KT2A 3SDEA 2EBGA 3NGYA 2GTDA 1YJVA 1N5VA 2ZH1A 3CCRS 2X1AA 1FERA 3OJUA 4M45A 1JIHA 4IBNA 7FD1A 3OXFA 3RRKA 2YWWA 2V68A 5KPRA 5LM7E 2R7QA 1FD2A 5H9FJ 4B17A 3IMXA 4WXWA 4JV5J 2W2NP 4FXDA 2FF3B 2K7JA 2L3MA 2ZJQL 4OV1A 4UOFA 4DV6F 5KFUA 2UVVA 2G9OA 1U4BA 4ECXA 1NHKL 1VQ4S 2VD3A 3V6DB 3B54A 2M52A 2JEIA 3H5YA 1WC1A 3HPGA 2HW3A 3J7Z5 2E5HA 2V8VA 2G8UA 4LSNA 2P9LA 4IOXA 5C24A 2PBDA 2YXLA 5F8NA 2E5LF 4NLPA 4OZ0A 4B8CA 1ZH5A 5A76A 1B3TA 3DNCA 2ZM6K 4WK1A 1WKLA 3IR6B 3DOKA 2JJ4D 3MAAA 3PR4A 4EYHB 4PHTX 1N52B 4KHRA 3CM5A 1B9FA 1IKXA 2DHHA 3H7HB 3MUTP 1CLFA 2BJ9A 4ETXA 1BMQB 2UUBK 3K2YA 3DLGB 4ID5B 3UN5A 1QAXA 3WEEB 2DGOA 3AJ1A 4ANDA 3PX0A 4D3HA 3F56A 3DAWA 2RHQB 5DLGA 3AVJA 4ZOSA 3QERA 1R6YA 3R5CA 1PBUA 3WXJA 3AXKA 2C2ZB 1P27B 1WOSA 3G25A 3O80A 5HVHA 3GOIA 3OL9A 3JSMB 1SL0A 1YT3A 4A2BA 4DV1K 1NH7A 1RAAB 3MD3A 1H2TZ 5F1XA 1VC6A 4KHNA 1QE1B 4ZN3A 2FB0A 2JNJA 3SAFA 4F4AA 2X1FA 3ZZZA 1OVYA 3FZLA 1X4BA 4L3KA 3FFIB 4E7HA 2NPIA 4CEEA 4F3OA 2AGQA 4L76A 3P1GA 4TYAA 3KUGA 1UVMA 2I1RA 4ED1A 3OHAA 4DV3J 1RTDB 4CZCA 2RJZA 1T05B 2VWJA 4GKKF 3O5TB 3FBFA 4O3NA 3FFIA 1GT8A 3G8SA 4DUYK 1DY3A 3MR2A 3JQJA 2E88A 4A5AA 2IM3A 3NCQA 4FYWB 2H5EA 4LR7A 4LF5F 2FJWA 4RNFA 4FCYA 3DXMA 2HHWA 5KFKA 2ITGA 3MEDB 2AJQA 2BKNA 3H90A 2GUIA 2O1PA 2ZHAA 3EN9A 4CZGA 2FHKA 1SUQA 5HL7Q 4LFAJ 4JS5A 3DXMB 1F5AA 2P8IA 6FDRA 4WFAQ 3O9SA 3C46A 1H2UX 2YKNA 2RQKA 1YXQA 1WSFA 3UKUB 3WNHA 2L08A 2R8KA 3ISND 2UUTA 1HYVA 3VAKA 2OPRB 4E7KA 2CH5A 4RW4B 4BBYA 2CZVC 1TUGB 1FJ7A 5HP1B 4FLXA 1HQUB 2RN2A 1K8KA 4LR8A 1OY6A 1DT9A 1HWUA 4YDXA 5J2PA 1O0PA 5LSRA 1S1VA 1H98A 2EVZA 3PW0A 2FC9A 3LALA 4M8LA 3UE5A 5BPNA 1VSIA 1NHUA 4ES2A 4CHPA 2MQNA 1LWCB 3AAWB 4DL7A 2XO6A 2JH3A 5KFSA 4JV0A 5ETSA 2LEAA 1ZM2A 1NDKA 2KL8A 3AJ2A 1JLFA 1J27A 3GV8B 2QLWA 4M3UA 4F2SA 4OKJA 2XMMA 1ELOA 2RHSB 4O44B 3NNAA 2BKOA 1VC5A 3MHYA 2BQ3A 3VTHA 2E2QA 4ED7A 3DLEA 4DPXA 4C23A 4JI5J 1OQ3A 4BCAA 4ID1A 3PTWA 2B0GA 1U6FA 4P6QA 2XY7A 2F7VA 3ITHA 4C11B 1UWBA 5HLFA 2P9SA 2QGFB 4WTYA 1NPRA 5BN9A 4J2DA 2QWOA 4KTQA 5AQFA 5JLFA 3D0HE 2BUNA 2V34A 2R2TA 3ZFVA 3TTFA 4FS1A 3J81U 3R5AA 3QRQA 4YY3F 4MFBB 3UFCX 2G1HA 2DEJA 5JUMA 1S1XB 2NCKL 4C1NK 2R7RA 3DXKA 2NXCA 3DU5A 4PQUA 3QINA 2D3O1 4NASA 3PX6A 3ZSOA 4MIAA 2V69A 3CHWA 3ID6A 4XDDA 2VA2A 4ZVEA 3HO1A 1K0TA 1S1XA 1MN9A 2P1JA 2HHHF 3DCAA 1KQGB 3UPFA 2V51B 1KLNA 1S6QB 2MQMA 2KYXA 4MT1A 1MROA 3KHYA 4F3QA 4W98A 2FHJD 5HRNA 2IDEA 2W7OA 1M5KC 4DV6K 2K8GA 2GVZB 1SV5A 1ESVA 1UVKA 2UVRA 2HHVA 3M05A 1VQ8S 2DY9A 4O0JA 3E01A 1T9XA 1BE4A 3Q8SB 3K58A 4UOGA 3NEKA 2GC8A 2VQFJ 4DUYJ 4B9QA 2DNMA 4LREA 5DM6Q 5THWA 2GQ2A 1S4FA 1TMJA 2LQBA 1SCJB 1A5XA 3U4LA 3UCUP 2OPSA 2C22A 3CCWA 4NLWA 2W7PA 2QG9B 4CFDA 3M9MB 1RU2A 1R7IA 4BR5A 2GGPA 1HJOA 3S3OA 1L3SA 3VEWA 3BKFA 2G8WA 4CT8A 4DQSA 5LXYA 1SC1B 2NUUG 3W2VB 3O4WA 4BRGA 3S3NA 3PYEA 1WC0A 4QR1A 2QWNA 3CDBA 5HJXA 3H46O 3GCWP 4BC2A 5GAHU 4N56A 4NPOA 2DHXA 2V2KA 3LGNA 4JHDB 1P9YA 1ATNA 3EVMA 3K0JA 5DGBA 4N8NA 2QYCA 2IJFA 1I94J 2V52B 3HZGA 2G0IA 4I6YA 2RDDA 3PV8A 4AL6A 3VQQA 3CIMA 3HCXA 4DF4A 1RAIB 5KQ8A 2PE8A 4B3SK 3MN6A 1K73O 3V1RA 4OHYA 4E7IA 4OZLA 1VSKA 2HMIB 3S8SA 3CD7A 3VCDA 3NGRA 3TQ1A 2HRUA 4LBHA 4FF3A 3K5MA 3GP9A 5FPMA 2DGXA 2PSZA 3ZC4A 2EK6A 2Q3SA 5D4LA 1M5PC 1BD6A 2J8SA 4TQSA 3UD4P 3QATA 3TNVA 3R7BB 1UFKA 1OH8A 4WFNQ 2FIUA 4HCBA 3CJKB 1VRQC 2VKRA 4M5LA 2NZCA 5E7OB 1TV6A 5GINA 2VC0A 3AVIA 3DU6A 2VBWA 1HIYA 4KBOA 2IGIA 5M1OA 5F2RA 4P2MA 1U26A 4IEEA 1HBNB 2GV9A 1KQKA 1GEHA 4U7UD 5FDLB 5DGAA 3Q83A 1QZ6A 4YDDB 4RUCA 5C5JA 4RW6B 4JOUA 5JVGL 2HQDA 1HL6A 4YOTA 1OMSA 5L1LA 4W5OA 1U1LA 1S0VA 1G3OA 4X64F 2WZ1A 2ZJPQ 2ZHOA 4HR2A 1TUUA 4IXCA 4KV8A 4RW7B 1YITS 3SLCA 3CC2N 4FK4A 2B8PA 5C2CA 4NA1A 4WE1A 5LJ5Y 1IKYA 4ZHRA 5AQOA 4B1UB 4F0HA 4OQJA 3TSUA 2KXFA 4TSXA 3ENQA 2HS3A 4P7TA 4OV6A 1XMOF 2W2MP 1FKOA 5J1NA 4QR0A 1IM6A 3P5TL 4J91A 5I42A 4OIXA 2Z2ZA 2GX8A 4BVPA 1VQOS 3PKYA 4C8LA 4TLQA 3R27A 2JWLA 2WVFA 3K59A 2MKIA 2DK2A 2WBNA 2O8CA 4Q43A 3A4TA 5DDOC 4KRFA 3U3YA 4LH5A 2HVDA 2DD8S 4K0KF 1VQ6S 3H2UB 4EP4A 4HL9A 4B8AB 3OXGA 2ZQBA 1U0SA 4ZVRB 4ZCMA 4FKXA 5AJ3F 2QV6A 4CO4A 4F4ZA 4LF1A 5ETLA 2EX3A 5KFFA 1QAIA 4K4YA 1LXJA 1KONA 1VSEA 1XUPO 2BZ2A 2VFRA 1O6XA 4YORA 4FNHA 2HNYB 1WEZA 5A8KB 2GBZA 2CPIA 3FR0A 4ECSA 3KUEA 2P9UA 4TVAB 4ZVFA 3KJFB 4DV1F 3MCOA 4H4KA 2IY5B 4CM0A 2KLAA 2H48B 2QTWA 2IS3A 2RF2A 3P6YC 1X0PA 4IZ9A 4L8RB 1UMJA 3ATVA 3ISNC 3QAUA 2OELA 3Q8VA 4CJQA 3AO1A 2R7OA 3JAMY 4I0WA 2ASOA 1W7WA 2XZTB 2EFPA 2D7SA 3U1MA 4MDBA 4HTUA 4ISEA 1OKJA 3VMFB 4QIVA 3EEQA 4F7VA 3LA0A 1UFLA 3CJSA 4O3SA 4OGCA 3QBWA 4V19S 1XERA 4B9SA 2HQ3A 3K0SA 4F4KA 4KH4A 1HWKA 3TTDA 5LJWA 1Q16B 1HR0K 1FWLA 4WKRA 3EY1A 1K9MT 3CCLN 4NMXA 1P9QC 2CIMA 1YJ7A 3VV2B 4CIEA 2JLEA 2CNNB 2GHWA 3HHNB 3FBEA 5KAKA 4CBWA 3LDOA 2XMKA 3EDQB 4B9MA 2MY7A 3W5YA 4Y1CA 1Q8KA 1C1CB 1K8KB 3PCOB 5A6PA 3JTPA 3LZJA 3Q22A 5KG5A 4V19X 3OT9A 3BGLA 2QL9B 4HVZA 3IA0A 4UY8O 4AHUA 3BPSP 1Q8BA 3HZEA 4HUFA 4ILMA 4R8UB 3FMWA 3CCQN 4KHPK 4PXCA 1S5JA 1TL1B 3NOGA 2CUYA 2O67A 2AP1A 3DC2A 4DLEA 1HQUA 2J8AA 1OH7A 1YF5L 1N34F 2RIJA 2R9LA 1WTBA 3W65A 4AILC 3C15A 2KT3A 1RBUA 1Q81O 2E5LK 1NJIO 1VYAA 3CW2C 3NGKA 2GCFA 1Q5VA 1ITPA 5TKWA 4JI6K 1GLFO 3V1OA 2EWSA 1HRHA 2KZMA 1W2BM 3CT9A 1U09A 1CG2A 1S9GA 3Q8UA 3HMJG 2QEXN 1O5JA 1PYOB 5KOXA 2D69A 5KT2A 1UAWA 3BQ2A 4DMZA 3VAIA 4LY7A 3CJ7A 1VQ7S 4RNMA 3M30B 2FJXA 4DPUA 4EUVA 1J5EJ 3AVHA 4JI7K 2N4CA 2RUGA 1XNRJ 2HAIA 3DDNA 4YOEA 1OPZA 1RISA 1M1KO 4Z4EA 4N76A 2V2QA 2QA4G 2NXJA 2AV5A 3MCSA 5GAHP 5LXRA 2A40A 2R2UA 3NAEA 1CC7A 3BZQA 4CW7B 1RA7A 4RWXA 5D0RA 2MQLA 4X66J 3KDNA 3CDEA 2UXCK 2FBTA 2CQBA 1FXLA 4K43A 1BQNA 2ADBA 2A6MA 2OPRA 4USHA 3UI3A 2K1RA 2YJFA 1NPKA 3MPYA 2I6WA 4IKAA 1Q53A 3HM8A 3W66A 4JLHA 1BQNB 2DJWA 3HFVA 3J8AA 3DXKB 4ZIWA 4NXNK 3ILJA 1O1WA 4RR5A 2K1RB 4ES3A 1NZ8A 3Q86A 1JKHB 3HD2A 1HBMA 3BKUA 1G1XA 4DSLA 1B0TA 2IBOA 3UNGC 4A8YA 5AZJA 3CJ9A 3FGUA 4DPYA 2CPZA 3ADAC 3DI6A 1GMWD 4TU9A 5L1KA 1N33K 2XSFA 2V8GA 2VG6B 2VA3A 4ISFA 2HHTA 3ZT0A 3EZOA 4HYKA 4DN9A 1UJ5A 2OUGA 4X84A 1FXRA 4IWVA 3SV4A 3J80Y 1A0OB 3NAHA 3BO3A 2DNGA 4DTJA 4USKA 3THXA 3TAMA 2EG1A 2F4VJ 1MSWD 2FC8A 5EHHA 2GFFA 2LKZA 3W62A 5C25A 1YBUA 2GMLA 3BF1A 2IAJB 2XY6A 4ECVA 5C2FA 2PFUA 1ZBLA 4IJAA 1WC3A 3SBTA 1Z25A 4EFHA 4GW6A 1FEEA 4UOCA 2ZUGA 5DG8A 1DZ5A 2UU9K 3CC2S 1WOQA 1NK5A 5K8OA 3KMQA 2I5JB 1ZTTA 4ZMMA 3SNNA 2P9CA 1PAEX 1C0MA 3IGNA 4BHQA 2ZC3A 1DQAA 1TQLA 4IO9L 2BEFA 4ZCKA 4IRDA 2Z1JA 3T3FA 1EJ7L 4FKYA 1RYRA 2KDOA 1TAQA 3VOVA 5ETQA 2C42A 2DXEA 2KXNB 3EE9A 2QSWA 2HIQA 4EU0A 4IKFA 1EARA 2OPQB 5B0CA 5HAOA 3QESA 4WFYA 4E89A 2J0XA 4XEIA 4IOCL 1YIJN 3TZWA 2QI2A 4OYBA 1RXOB 1W0HA 4LF7J 1S0MA 4J37A 3DLLQ 2HVIA 2QC3A 5BR8K 1TV6B 3TZXA 5F0XA 4IO1A 2DBBA 2XC9A 1RBSA 2X6NA 2E2NA 4NLRA 3MMAB 1T9WA 3F5TA 3ONQA 1KR4A 3FSIA 2ATLA 4DQPA 2HFUA 2OIHA 1S6UA 1VQNS 2E5IA 2IA6A 1GXLA 2E9RX 5FPNA 1ZS6A 1RFQA 5M2PA 4MO4A 5GADP 4Z0UA 4C8ZA 4BR0A 2MYFA 2PO4A 4YUDA 2OPSB 1QQOA 2DIUA 5KG4A 1CSJA 4CEBA 5AXLA 4DPTA 5F0UA 5KFDA 2HNZA 3D1HA 4ZLJA 3V81A 1E3MA 2GW8A 1TGOA 1N88A 5IWAJ 4UY8T 3VHQA 1F9HA 2KJWA 2BBEA 2Y1JA 1W9HA 3SAGA 3U6FA 5GADU 3UVJA 2ZHBA 3V6KA 5ELZA 2B56A 1G99A 1VQ9S 4PXBA 4WP9A 3HVRA 4CHOA 1BY9A 4P72A 4B3MF 3GFYA 4V1Ak 2OA8A 1K47A 1NRKA 2A2DA 2MQPA 4RBUA 3ID8A 3OTOJ 2OEKA 1XMOK 1K9MO 4B3RJ 5HQ8A 1U1MA 1W97L 3PJXA 1KFSA 1S1WB 2XYPB 1X4EA 3RMDA 4UZCA 4OI2A 1FWKA 3OVBA 1EX8A 5J2QB 1BISA 4NYFA 1CS4B 4I2QA 3IWXA 1L3TA 3VERA 3HHEA 3OBWA 2ZJPL 5ETKA 2RRBA 4I2PA 1A5WA 1WKKA 5LL6Z 3QO9A 1UW4A 3MN5A 1V5IB 2E5GA 3BP8A 5AJ3K 5E3AA 3CJBA 2GQQA 3NS6A 4ILGB 1RP5A 1X4HA 5DDRC 5KFYA 1B70B 3MD1A 5ADZA 2UP1A 1IWGA 1MWMA 4Y34A 2DRAA 2E29A 4FJXA 2ZJRQ 3B78A 4JI3K 4X4PA 1NK7A 2P9KB 3MN7A 1XNRK 1VHXA 4JI5F 3NRBA 4P71A 2R8IA 5KFEA 3CPEA 1GTHA 4LRFA 3LOUA 1FJGF 4XPCA 4DR7J 1B99A 1HNZJ 3NH2A 5CYJA 1IKXB 1FKAF 4UUWA 2YNIA 2ZH4A 4PABA 3HVAA 3PEHA 2XMUA 3DLGA 4AYBD 1J2VA 1SUQB 5KQDA 1BLUA 2BX6A 4TY9A 3A5LC 4OX6A 4A62A 4RWTA 2CRLA 1WWHA 1AZSB 1CJVA 1J5OB 2LXIA 3LQVA 5E3PA 1PAUB 4FWMA 2O8BA 1D0EA 3OFEA 1X4GA 4DZDA 2NNWA 1UJ6A 4NO7A 4FWQA 4CO1A 3SQ4A 1GH8A 1SS6A 4UZBA 1FK9A 1R0BG 4NCBA 3DYAB 3KJVA 5CXTA 3SI6A 4TLRA 5KOWA 2CQCA 2VQEK 5HK4A 4DCOB 4MIBA 3V4MA 3EX7B 2FZGB 1UOCA 3ZNJ1 4JI6J 5I3UB 1KNZA 3EM1A 3ZEUB 4AUKA 3BSCA 4XO0A 4FBTA 4PZVA 4DWIA 4RKUC 1APSA 2O01C 2UUWA 4PG7A 5B0AA 2YH1A 2HVZA 3AODA 3BQ1A 4KFBB 2FZCB 2WSEC 1HNWK 4HDGA 3P5JA 4DR4J 2V50A 2COLA 5HMYA 3ZYYX 3DLLL 3RAMA 3M9OB 3IUCA 4LFCJ 3ZSRA 3SFGA 4IFVA 3CC4N 2QM1A 2I2YA 2W2OP 4CGGA 3LF0A 4A8MP 2MHEA 1M1HA 4G1QA 3HP9A 3H2LA 2ZKTA 5LJVA 3ITHB 5IM0A 3TR8A 2EC0A 3W2WB 1WF2A 3V6JA 4K4ZA 1NNEA 5DK5A 2Q31A 3CE8A 4DR2K 1FE0A 1OIAA 2IHR1 4EBEA 5IXUA 1V4SA 3EZWA 1FDDA 2HHQA 4DV7F 2HAFA 2RUSA 2L41A 2W9CA 1S0OA 3W9IA 4USVA 3PX4A 5IQ6A 2Z57B 5D3GA 4I6WA 1LWXA 5DG9A 2CJAA 3H20A 1BUPA 4DLGA 3SZ2A 5EXWA 3IN5A 2W24A 1U47A 1HHSA 1CEZA 3G8TA 4WK3A 1ZAXA 2HBKA 2FLPA 5JXSA 4PAAA 2DGVA 3O3GA 1FA0A 2C3UA 3OBIA 2OJ3A 1CULA 3CFRA 3DRPB 2BXJA 2UXDF 3KJQB 4USTA 3H40A 3D6HB 3H3OB 1HUXA 4DSFA 1S1UB 2CQDA 2AJ2A 1RHUB 4CEQA 3T9ZA 3AVMA 3IRXB 3CCES 1WNEA 2CGJA 4QR2A 2AX1A 4LRBA 4HVJA 3M6GA 2G8VA 2LXFA 2F3JA 2BANB 5KPTA 3R7NB 3R9LA 4URGA 1C0TB 3DOLA 2V8PA 2KZZA 3CC4S 3KHLA 1R8CA 2AGOA 4CNZA 4QW8A 3GLJA 2AP6A 1TUVA 1N32K 1SQKA 3PRBA 4OPHA 4KO0B 3EPIA 2HSEB 3TAFA 5HJYA 3DOKB 4QS8A 1PGZA 3PSIA 1CC8A 1JCGA 1YRUA 3UDEA 4I67A 2GA7A 2A1SA 4HWIA 1U6ZA 3N0VA 1YTAA 1U24A 2VG7A 3CCJN 4NX9A 2FVRA 4YOWA 3WNEA 3CERA 1HNZK 4HKQA 1FO1A 2JX2A 3QFHA 2DVIA 4PPZA 3TVKA 3M8WA 2LECA 2D1CA 2HHHK 2UU9F 3K5OA 1JLEA 4EI2A 1QE1A 3QJLA 3VQDA 1UVJA 4X62F 3JQKA 2VCPA 2C2NA 2Q6BA 3AXMA 3ICLA 4FVMA 4K7QA 5HQLA 4BACA 3KHRA 2LQ8A 2LEBA 2HHUA 2QMWA 4NRUA 5EWFA 1RDAA 3MM9A 4DG1B 2WBRA 2B6AA 2YWFA 3MK6A 4GNIA 3W63A 2HOEA 3NCRA 3RAXA 2NQPA 2XY8A 4ZVUB 2FXUA 2ASDA 1MG7A 4S0MA 4PWDB 4B9VA 3HI9A 2ZF5O 3ALYA 3SMSA 1F0XA 4PKIA 1UWAA 1Q95G 3LZIA 3AA3A 2Z1GA 4CK3A 2ROEA 4DCHA 1OJ4A 4WYLA 1RWUA 3NL0A 1HYZA 1OS5A 4UTGA 1IV0A 2W6LA 3EPGA 2BYCA 1FFGB 4M3WA 3GV5B 3K9KA 2FLLA 4XPEA 2EG2A 4CZJA 3NCIA 4WFXA 4CIOA 4ECRA 3OFGA 1TL4A 5C2GA 3M8RA 1IKVA 3ZSWA 3BBCA 1KC8O 1DJ0A 3TAMB 5ETNA 2ASPA 1CJKB 2E9TA 3IS9B 3E9LA 1BXNA 4RBTA 3O3LA 1EWQA 1VAZA 3OYFA 3RBXA 1DKGD 1DFDA 1EKEA 1WSJA 1ITGA 1LKZA 4JI7F 4OHZA 1XMQK 2ZJRL 1C1BB 2EXUA 4DSIA 3WDOA 4DTXA 4ZP9A 1VHFA 3MECA 1YVUA 4USIA 3O4NA 4Q2LA 3I82A 3LPYA 3QQCD 3N79A 3V81B 4OYMA 3PYDA 3I31A 3T9NA 3NGDA 3GQCA 3Q8YA 3BSNA 2CQ0A 1FI4A 1LK7A 1KVJA 3CD0A 5M2RA 5C2DA 3M1VA 1YLXA 4C8NA 4CQ1A 4BRIA 2CDRB 3RJMB 3J80U 4FF2A 3ZZTA 3D2WA 3B8AX 1U0HB 5AE1A 1OY8A 3J81Y 1F2GA 3MMCB 2N82B 4J9NA 2E2OA 3M1FA 3Q2TC 1FDNA 1S5ZA 3CYMA 1NCLA 4FNIA 3QT7A 4OYAA 2HEKA 4EZ9A 2QA1A 5IOLA 1FRHA 4NXNF 2Z2LA 3DFEA 2HRYA 4QJVA 4DQQA 3OYBA 5GVQA 1IVZA 2W4CA 4BQZA 3VQ5A 4YMEA 1RAEB 3JAMU 4ZPWR 3P49B 4Q2MA 4MK8A 1VRUB 3HX9A 4ZPTR 3H6EA 4ZPVR 2DFHA 3R7SB 2DPNA 2BJDA 4A57A 4X4QA 1FX2A 1R43A 3LGHA 3EXCX 4BS2A 1GTEA 3QIPA 5BYQA 2P2CB 3FJ2A 5E33A 4OZNA 1XMQJ 1G7CB 3JQMA 2QXLA 4N77A 1HX1A 5FDLA 3VAGA 3AO3A 2IDOA 2LVWA 4JI7J 4H0PA 2O8EA 2H3GX 1KAXA 1SL1A 3TA1A 3VEZA 5GAGP 3AVKA 2XWXA 3RB4A 1I1GA 1F2HA 4B9LA 2LLZA 2HWHA 5ETMA 3KLVA 4DJBA 4CFCA 2O8EB 3K8VA 3TA0A 1VSLA 1WF0A 1RACB 1EP4A 4CJRA 3H42A 3DLBA 1KFDA 4WPAA 4QS7A 5BJRA 3DRSB 2A18A 2OMLA 2JGUA 3HKWA 1VQMN 2F63A 4O8KA 2ZE2A 1XR6A 2NSCA 2W8LA 1RBVA 1NLKL 3UKRB 5I3UA 2EFOA 3HHKA 4KHYA 3M4XA 3MFHA 2B7BB 5T14A 2JFKA 4LT6A 3PY8A 3AO2A 4CO3A 4P74A 3IMQJ 2ZWPA 3RGIA 1TUYA 1JLBB 2V7ZA 1QUPA 3SSQA 3MUMP 2MB0B 2BRLA 2UXCF 3P39A 5C0YA 3W7BA 4KI4A 3T1YF 4BG9A 3HHDA 2GVDB 2XWYA 4DL2A 5A8KA 3A13A 4IQMA 2WAQD 3BDEA 2M7SA 4BRDA 2DIVA 3W9JA 2WSCC 2KH9A 1DQ9A 1X9SA 4KREA 3CSKA 4CGDA 4FYXB 1IWAA 2M70A 3SCXA 2QXFA 5MLCV 4YB1P 2NR0A 1LOTB 3TSQA 3R6LB 4DTNA 4DR1J 1ZZNA 1EWRA 3M2RB 1N0VC 5D0GA 4IDKA 2ZC4A 2XMVA 4DU8A 3DMJB 4DTRA 4XDCA 2IVOA 2YQ0A 4CHQA 3PKMA 5FPDA 5IT4A 4CK1A 5E84A 3OYJA 4DV7J 2W40A 1EKSA 3G86A 3UIQA 4BR7A 1RLCL 1E4GT 2I9SA 4M3RA 2F9WA 1V9OA 1H1VA 1VQON 1AUSL 4LD0A 4BLGA 3TAQA 4RNOA 1DTQB 1CXQA 3V9ZA 4FJJA 3GJRB 2YHAA 3UCGA 3WNGA 1LWCA 2V9WA 1IKWA 4B1WB 2HZAA 4FJ8A 1M1KT 1M5SA 1UEKA 3JB9k 1E6VB 3G6VA 3I0SB 3SMPA 1VBKA 3ENVA 2Z8QA 2VOPA 4IOAQ 4Q0BB 3A0IX 5KG0A 5I3PA 3HD1A 2DO4A 4CGHA 2AEFA 2F1FA 1EQMA 4HH1A 2RAQA 4KGKA 4DFPA 5BREA 4K50A 3W5XA 3T1AA 2RMLA 2K2PA 3KWGA 2OTJS 3FKBA 3FZMA 2W2QP 3IWNC 2VG6A 1FX4A 4MYUA 5D0EA 3TWHA 3HJVA 4PWWA 3HT0A 5KFVA 5AQVA 2WOMA 4NLQA 2XTJP 4WJBA 2LDYA 3E9OA 4RW8B 4CF8A 3IBFB 1M90T 2LQ9A 2R7WA 1ZYQA 4P2SA 1ATRA 2NRTA 5G0RB 1JLQA 3NOCA 4ZP6A 2FGCA 1NK8A 4MIWA 3P4UB 5BR8F 3PW4A 1JL2A 3RMAA 4CM2A 3OYLA 1FDAA 1TP7A 2GZOA 2HG4A 3OHRA 1KAYA 5EU7A 1U1RA 4J2BA 1PBAA 2VWKA 2LFVA 4B9TA 2DRBA 5DDPC 1D9DA 1U1QA 5D0HA 4OKKA 3H25A 2XS7A 2FTRA 3O9UA 2K3KA 3B6OA 3SJJA 1B4SA 4ED6A 3UR3C 3LP0A 5BPMA 1WHVA 3CETA 1U1NA 3U7JA 4KPCA 5K5MA 1TAUA 3WXLA 5AFUA 2CQ2A 4KIAA 1Q86O 3OSPA 2F9TA 2E1ZA 5F3TA 3ZT3A 4X62K 1HWJA 2RF2B 4I68A 4F67A 2DNYA 4ZN1A 1QVGR 2P5GA 2CG4A 4JI4K 2RB7A 3R3LA 1YITN 2U1AA 1VOMA 4B3RK 4IO8A 4IFEA 3SQ0A 4HT5A 5IQQA 2Y1RI 3GG1A 5H9FK 3KKSA 4LF5K 1WOOA 4QCLA 4FWKA 4WF9Q 1TK8A 3PHEA 1N36J 2DNKA 3OL6A 3MOZA 4DV7K 3QT8A 2BGGA 4W90B 1G6BA 3C66A 4LF2A 1GX5A 2I0XA 3M6XA 3CDAA 4RG8A 4PYAA 1EB0A 3T5KA 4OI0A 1NPPA 4CGFA 3CCRN 3WXKA 3M7VA 4R5PA 3HTVA 4OLAA 3HFZB 1SAZA 4BRHA 4JUZA 1X9JA 3QGGA 5F8IA 1BCMA 3QAEA 3CM6A 4A8OA 4AE5A 4O4GB 3KIOA 3CCSN 4I69A 5C10A 3G96A 4JRQA 5AQXA 4FJLA 5C25B 5DO2A 3CD6S 2GEMA 5JVHQ 4JKEA 4DV4K 4C8MA 1KTQA 2E5JA 1HNIB 2VWBA 3CJ5A 1GLCG 4FZZA 2GQCA 5E3QA 3U1NA 3TUPA 3TAGA 2ZBIA 4CHNA 1VC0A 2IIHA 3V6HA 2BTFA 2M8HA 2X78A 1PC5A 4P10A 5EY4A 2PT0A 3SBMA 3IAYA 3KK1B 5FLXO 4YS2A 2I5JA 5F8LA 2LXUA 2B51A 1WHXA 2M2BA 2AYBA 1GLEG 4LRDA 4FZVA 4HEA9 4I2QB 2NXNA 1YJ9S 1QVFR 4LFBK 2XNRA 2KM8B 4FJHA 3MEEA 5A0YA 3VQ4A 5HLFB 4TKTA 2XMJA 3CCVN 1JLCB 4FM2A 3KK1A 1KVBA 1BWFO 4QPTA 3T1YK 3TWZA 5GIOA 1PKUA 1HKAA 2D0CA 3LPEA 2GELA 3LW5C 1KQSR 1JLCA 2FVCA 1TKDA 4NWBA 2YQ3A 2V4RA 2CQIA 1N56A 3AOAA 5M1QA 4FPAA 3C6TB 3DGVA 3UD3P 2W41A 4DL5A 1S1TB 3M2UA 5IT9O 3RRGA 3M8SA 5DQHA 3BUZB 4MKVA 4YB5A 2VKZG 3TJAA 1U45A 3OTOF 3L7PA 1XIQA 2GAGC 2CPXA 3MR7A 3FZ2A 3HSJA 3C6AA 2QE5A 1MMDA 4LSZB 3D0PA 1WDDA 2H5IB 1IKYB 1S6QA 3POTA 4G1PA 4ECQA 1NSAA 3HHLA 1ZBFA 5IZHA 4JKAA 1VCTA 4RUBA 4LIWA 3J7YI 4LRAA 3LDPA 1ACMB 1Y4ZB 4YR2A 3F9MA 1HHTP 4DV2F 3J80O 2YWEA 5KFNA 4TY8B 4C3LA 5IWAF 1Y97A 2YNHB 3FSXA 3GPAA 3RVCA 4LF4K 1CQNA 2V4JA 2DGWA 1C4CA 4IR1A 2M9KA 3EL2A 4DS4A 2FSKA 1SKUB 2KJVA 1VQLN 5IC6B 2YNHA 2KYZA 3K5PA 2A0FB 2VDIA 5G4DA 4ZLLA 2F8HA 4CCHA 2MLYA 2B5JA 3MWPA 3AVGA 1E6YB 4Y6IA 1HWLA 1OYDA 4U9RA 4FZYA 1RT1A 2PIIA 3H1QA 3RUBL 4H4KC 5D4NA 3VALA 2OCEA 3OBYA 2GVDA 4NZ7A 3O2IA 3QSIA 4I7FA 2UXCJ 1TL3B 1YJUA 4UT4A 4WF9L 5KTQA 4C8YA 4NXMJ 5KG7A 2MQOA 4TNOA 1ROFA 5FLXU 2QWPA 3I5BA 4NZ0A 3E66A 4Q5VA 5L8RC 1T3NA 3LWLA 3LAMA 2H65B 4J5OA 2CVEA 1VQ5S 3QNWB 2CXEA 3I9V9 2DNQA 1VQYA 2MY8A 2YPZA 3CPWR 1NXIA 3KLEA 3OFFA 3M2RA 2KU7A 1CBKA 3F73A 4CLLA 2CVIA 2MEWA 3AVBA 3I9ZA 3BDPA 4EIAA 2KQ2A 2PC6A 2ASJA 2O8BB 4B9UA 3K2PA 2JLGA 3X3UA 1BL3A 4KAZA 1BQMB 3NF9A 2JZ5A 3LO3A 3NKYA 1NJWA 3QJJA 4C1NI 2V8HA 2J0SD 1NGEA 2AX0A 4CLPA 2B9XA 2LDIA 4IDKB 2RQMA 4J9QA 2IRXA 3A12A 1AZSA 1OVQA 1RT4A 4C8OA 4C97A 3KK3A 5T7LA 3UDCA 4LQ9A 1WELA 2QZ8A 2MKSA 4H03B 1TL7A 2FLOA 5CD4H 3G2XA 1X8DA 4FVUA 2O8DB 5AQRA 1G4CA 2Z4PA 4LMZA 4F25A 1YJWS 3A3PB 4ILHA 1OH6A 2B4UA 4UF4A 2N7YA 3WQTA 3V9SA 4E8UA 2RE2A 3D5MA 3O08A 2XO7A 3OPKA 5AT1B 5HRRA 1KRPA 1IKWB 4BWJA 1LXNA 2B9EA 4Z4HA 2ZEJA 2J76E 4LF9F 4FJ9A 3N4WA 2BE9B 3VAJA 4OI1A 1RT7B 1VLYA 2MZQA 4LFBJ 1GOBA 2CWXA 3AT1B 5IM0B 2A6OA 2V0NA 1MU2A 3WIVA 4H0YB 1ATSA 3V5RA 4UOHA 3RB0A 1KN6A 3UVJB 3LGMA 2J7WA 4ECTA 3THYA 1IH7A 4IFVB 1N8RT 8RUCA 3D6TB 2W4PA 4X65F 4QIFA 4J9MA 1GLBG 3GMGA 2B7CB 3P31A 2E6LA 2MPUA 4OO1J 2E7VA 2WONA 2D5RA 3H8YA 2WFBA 3BB5A 3KLIB 1OH5A 3TAPA 3IGVA 4PRFA 3ULHA 3LDQA 2V2VA 2HVHA 4DX8H 2HURA 1S99A 2F9DA 3PZPA 2CNOB 3CQYA 4O5FA 3MPUB 4WXOA 2HBJA 2AEMA 2N3LA 4NI2A 1RT2B 1U49A 3QNNA 4HHJA 2DFFA 2CPHA 4CIGA 5F0WA 3KHGA 3HL8A 3VQPA 2KI2A 5AQLA 5CHCB 2F4VF 1REVA 3C94A 3MWBA 4O0NA 1X4FA 3PFEA 1B0PA 4YR3A 3H4DA 3A2FA 1XNQF 4CZLA 1TYQB 1FRJA 1NKBA 4RU2A 1BU6O 3CCMS 1ASUA 2V63A 4M5MA 5D78A 4UQTA 4P73A 3DRPA 1LNQA 2VG5B 1U7LA 4H5VA 3CCLS 4CGJA 2VPZB 4WZMA 3D6FB 4M5KA 2G2YA 4CF0A 8ATCB 3TZYA 4ZLNA 1RQ0A 4FPBA 4WE1B 2E20A 2Y0BB 4KH6A 4A8SA 2P9GA 3EUNA 1MN7A 2DTJA 4FLWA 2DFEA 3QIOA 3NVKA 4WYWA 2VQFF 5CQGA 3IBCB 3ZZOA 3G87A 4KE5A 5CAAA 3W3DA 3C0BA 3GV7B 4DSJA 3MXIA 3KLHB 1YDLA 2GIRA 3QLHA 4CYUA 4FWRA 5K14A 1IO2A 2ZNZA 3X1LB 4QWDA 3CB4A 1EAYC 3Q0AA 3ZX2A 1RT5A 1S6PB 3CJCA 4OZ2A 1RTHB 4DR6F 2HGNA 2QTDA 3MTJA 1SIZA 1Q86T 2FBYA 2MGZB 3WQPA 1QQNA 3QLHB 1C1BA 4J9UE 4JI0F 4KSEB 2Q6CA 4CLSA 3K89A 3L0QA 3C15B 5L9XA 3A8KA 3BH7B 3ULDA 2CQHA 4Z37A 3PIPL 1T05A 1D8ZA 2XB2D 3QMQA 3TJ9A 1CVJA 4CJ4A 3MX2A 3ZEUA 4YDUA 4KB7A 1M1GA 3CDWA 2JFDA 4LFCF 3THWB 3M1VB 2FHMA 2W7AA 3OYHA 2F8SA 4KFBA 2CPYA 3WQUA 3VQTA 3W60A 1JLEB 2IJRA 4L6V3 3HSDA 4NLOA 4CD3A 3GILA 3JYTA 4FYVB 2AEJA 3NGUA 4AXJA 2X51A 3CCEN 3UDVA 3RSEA 5T41A 3AB2B 4A8WA 3OD2A 4BY9C 3OA9A 1TKTB 1M90O 3ULEA 1VIOA 2HFOA 4IOCQ 4CEOA 5AQQA 3ENBA 1QDUB 2G1DA 5A0YB 1HBOA 2E2PA 4FPIA 4DX6A 2FLNA 4WFNL 4K8RA 4D3GA 1NGGA 1NOYA 4OYWA 1GXUA 2FHOB 3NNCA 2KHDA 3LDSA 1RJJA 2BVZA 5DDQC 1T0TV 5GAEU 1BA0A 3BPDA 1CZBA 5C12A 1Q79A 3A1YG 1VQKN 3I5AA 4QU7A 4YFUA 5C42B 5E0OA 4H8KA 2VJVA 2D0PA 4GVBA 2KFZA 4XIUA 4RW4A 4C0HA 5JS1A 2GWJA 4ICLB 3E3XA 3SK3A 1RT6A 4M5DB 3GB0A 4MDAA 4DV2J 5CCLA 4AQYF 3IS9A 3CD6N 3NMAA 4JK7A 4QIGA 3WC2A 1L5UA 3TUIC 3AO5A 4J9KA 4H54A 5CCMA 1X60A 4I1TA 2KG1A 1VRTB 1DLOA 2RQ4A 2LA4A 3TTCA 1U8WA 3CJ2A 3D0GE 2VB6A 1HMVB 1RDWX 3H5XA 3CVKA 4EBDA 2ZH7A 4JKBA 2IM0A 3CGIA 4KH5A 3EKSA 4LRCA 4O44A 3L09A 3VTIA 1U0HA 4KO0A 5AXNA 1RWOB 1RCXB 3QGIA 1KTVA 5CYMB 4N8OA 1HWIA 2ZD1A 1Z4UA 2R8HA 4PQUB 1EETB 4BROA 2HZCA 1GMUA 1IBLK 1U25A 1RWNB 1VIXA 2O5DA 3PYFA 4NEYA 1I6JA 2RS8A 1FEHA 3TP2A 4B3RF 3N4PA 2QLJB 2G0JA 4X66F 2J9CA 4OPAA 3AA4A 1WKJA 3M32B 4G1IA 3DOMA 3QFPA 2HBMA 2DXFA 3V4IB 3EZUA 3O9QA 1GOCA 2RD5C 3CCUS 4H0OA 4E3SA 4YHHK 5JVHL 2QLBB 5AR0A 5LOQA 4BC3A 3A3OB 4AT1B 1DGKN 4X4VA 4JK8A 2XULA 1JJ4A 3OS0A 4ZJOA 1T11A 4BC4A 5ETRA 1D8YA 1N33J 2DYAA 1J5OA 5JMNA 4ELVA 3MDFA 3HZ6A 3KLGA 1UVLA 1WEXA 3U27A 1Y0HA 2HRTA 4K4XA 4TY8A 2YKAA 2ATCB 4M5NA 1Y10A 4O0IA 3KLFA 3U9DA 1C0GA 2V9KA 3ZSYA 4DUZF 5C7PA 2YWHA 3O6WA 3ENHA 4A5BA 1Y5LB 1YJTA 2CQ3A 1HBUB 3C14B 5GAHI 4PKDB 4B3OA 3OYGA 1W25A 1IJFB 4LR9A 1JLBA 3O5BA 5E3RA 3N6MA 3U8XA 1Q9YA 5EX5A 1XNQK 3JXUA 4IH6A 4DL0C 1VGYA 4CJKA 4C3MA 2BACA 4FK0A 3F9KA 3GR0A 1X31C 4CDIA 4H5TA 5KGWA 2Y0SD 1NGDA 2XS2A 3UNYA 2L48A 3A5MC 4NA3A 1ZAWA 1S4EA 1NJZA 3PW5A 3M6UA 2IVYA 1EHWA 2HF4A 1X4CA 2CJXB 2GO8A 4YQWA 4CD1A 4GO5X 5IFMA 5CYQB 2YHYA 2KVQE 3QDKA 3ZTPA 4BC9A 2FBXA 3P4IA 3UCZP 2C3OA 4DPOA 2FDNA 1PJ6A 5L9NA 1LQ9A 4MKAA 2FVSA 1HI1A 4WU3A 3VQ8A 4M95A 2QT7A 3O8WA 3Q8RB 2ALZA 3SXLA 2EWHA 3WBZA 1Q82O 2BDPA 3DDKA 4IR9A 5DJBA 2VODA 4AM6A 5E26A 4X64K 4C98A 5DZ7A 3PJWA 3BZKA 1YVNA 2PEHA 3TX8A 3GFZA 3I0RB 1DHMA 2E1MC 4KHQA 1OWXA 1F3VA 1YG0A 3AVNA 3Q8PB 2PI4A 4RW9B 2WONB 2OZMA 2Y9HA 1NBEB 4LVOP 5CA5A 4CRJA 4RW6A 3QT6A 2BW2A 3WXMB 2E1PA 3VQBA 3EMTA 3LL3A 3UDLA 3MMAA 2G8HA 4FM1A 3GR1A 5M1NA 3IRXA 5GADI 3G6EN 5C24B 1HI0P 2YJEA 2O4GA 4IOBA 4K0KK 4IOAL 4WFAL 1KC8T 3O1WA 2WRMA 2YNIB 5KFRA 2A5XA 1SQGA 2F9JA 2N4DA 3IR5B 3VAFA 4OGEA 3H59A 7FDRA 2UXBF 2F8EX 4ALZA 2F4FA 1T9UA 3KZBA 3VPZA 2K3IA 2WUSA 1H2VZ 3RTVA 5KRTA 1QSSA 4MQ3A 4J9LA 2Q66A 2Y8WA 3FLCO 1W26A 3NGZA 4Q8EA 2OTLN 5E5NA 2FUG9 2YKMA 3L2QA 4A61A 4KBIA 4NOHA 5RUBA 1Z05A 4H4MA 2IC3A 1FK9B 3CUNA 3RG6A 1NO8A 1J9AA 1QLNA 3CIZA 4OI3A 1YBAA 1Q4RA 4RTFD 1N6QB 3DKDA 2KTQA 3FDSA 3K17A 2XG8A 4DBQA 3GE9A 2P9UB 2R8JA 4EGLA 1VQKS 4DL6A 3L2RA 2DNPA 2CQ1A 2HHSA 1JMTA 2XSJA 1IBKJ 5KFHA 2ZH8A 3M9NB 1T3OA 2HFVA 3DRYA 4OZ3A 3OYAA 2CQPA 4EAHD 4KRWA 4WFZA 1UZHA 1RGIA 5KFWA 3MCAB 3AARA 4ECWA 1LK5A 2RDIA 3VETA 4QBUA 3EO3A 1X5TA 3CJ3A 1UEUA 1T95A 1WF1A 3FCHA 3NDKA 4FF1A 4ANEA 3PIOQ 1NB7A 2B6AB 3BF3A 3HP6A 4Z7CA 1KD1O 5C15A 1FFSB 3DHXA 4N5SA 5J2NB 3DRRB 2HLUA 4ZVQB 2LU1A 3OR1B 4WFBL 1REVB 4PWDA 2Y1LB 4JI4F 2WCXA 4BE0A 4JV2A 5TKYA 4Y3CA 2EK1A 4KH0B 4Y28C 4NLVA 3TEGA 2NRWA 2YWGA 2YKQA 1NGCA 4JI2F 2CG8A 2R7UA 2YQ1A 2XCPA 2D0OA 5DQGA 4LBPA 1F9EB 4NCAA 4K4UA 2R7VA 3R1XA 4LUBA 4JI3F 1R8AA 5L1JA 4QU6A 5HMZA 1RTIA 3CNQP 3R97A 3UN2A 2XCAA 2J6TA 3R3TA 4AL7A 1ULRA 2QYGA 2ZH6A 4DFJA 1Q8IA 3G9CA 4E1MA 3RR7A 4OLPA 4P2XA 3ASMA 1Z26A 2Q36A 2B3TB 3AY0A 1WDTA 4B1ZA 4LSLA 2BJ7A 5H9EK 4QOTA 2ZOMA 2HBRB 4I6MA 1IJEB 4HI1A 1LOUA 3K57A 2LQ5A 1RSCA 4OJ1A 4F4XA 3VGMA 1WC5A 2HLTA 5HN0A 2P9EA 4OX9J 2E1YA 5DZ6A 3KK7A 2AIRB 1OQ6A 3PW2A 1LWEB 1E6VA 2QA4S 2CDQA 3T6BA 3CJQA 3O1BA 3AD8C 3HFKA 4AM7A 1QAYA 3D3BJ 1FXXA 1FJEB 3MMCA 3RMCA 3SPZA 3A5NC 1O51A 3ZCMA 4U95A 4WTOB 1XQSC 2OHDA 2UUAK 1HI8A 2R7XA 1Y11A 2DGQA 1X9WA 2EHGA 3DXSX 2DNOA 4MMOA 5BRDA 1DTTA 2W01A 5KFGA 1VHIA 3CQXA 3OYIA 4CHYA 1N32F 4G1QB 3J7AN 1PYSB 5DG7A 4C7QA 1C0UA 4GV6A 4CJ7A 4MKBA 4K4SA 5ETPA 1JLQB 1JL1A 1P1LA 3AY9A 1SC3B 1IJJA 2DEIA 2ZVIA 4DV5J 3HVWA 3OYNA 4Z4CA 4XH4A 2E6MA 4C11A 5CY4A 4E2FB 3TYTA 5FD1A 2VPYB 4U8VA 3OTOK 1TKXB 3HHLB 3TUJC 3CEDA 3VESA 1OYEA 2Q3PA 4G3IA 1TFWA 5AQZA 4CFBA 4QWCA 3SJHA 4W5RA 4F9OA 4ZP8A 2GJIA 2BW7A 5LMNJ 1NKCA 1TKXA 1T94A 2PI5A 3R1LA 4NYOA 1A5VA 5BR8J 3IAM9 5IWAK 3NH0A 2JEJA 4LC9B 2FJVA 3FEXB 4Y2AA 3L6QA 1MWKA 1D1UA 1BA1A 3ZNUA 3DI6B 3G71N 3MTKA 1RAHB 3LP1A 2KN4A 3IP0A 1YI2N 4KHPF 3C19A 5HO4A 5ADXA 1RT4B 4ZJLA 5B0BA 3NF8A 3LH2S 2PMWA 4J90A 3G4SS 4H5RA 4JI3J 1HARA 2OPPA 3LM9A 3ILLA 2CZ4A 3G8QA 2MHNA 3CJ4A 4C0BA 2M0GB 1MMNA 3IWLA 4EEYA 2P9IB 2W6KA 4JKHA 3UE2A 1YJWN 4RCHA 4ETZA 3E01B 2HK2A 2D9OA 1V5VA 2H3EB 1XC3A 4KJIA 4JEPA 1C2PA 2QKKA 1WN7A 2DTUA 1K1SA 5D4OA 4BRNA 4CH1A 1OPIA 3GSDA 3MURP 2UUAJ 1E6YA 4CLFA 3OW2R 2MDAA 2D9PA 3CJ0A 3UO0A 1DRZA 1WAFA 3AQPA 2IVNA 4O23A 2YNFB 1JXVA 1FW6A 2FBVA 4K5RA 1EETA 1ZBUA 4IH5A 5A6WA 5GIPA 2MKJA 1N34K 2M3DA 1E4FT 1WD6A 1U2FA 3FEYB 3OFHA 3C16B 5SZTA 1S12A 3BM7A 1RDDA 4ITSA 3I56S 1CJUA 3OUYA 4NLXA 2QJ3A 1HPZB 3AHPA 1BQMA 3OTCA 5LMNF 3IFRA 5AQYA 4JD2A 2HMIA 4DL4A 2DHGA 1VQMS 5B0FA 3JS9A 3NNHA 4CZKA 2RE1A 1Y3KA 1HPZA 4JRPA 4FP9A 2GAHC 4HHHA 1JQGA 2MSTA 1WG4A 2D41A 2VU5A 4DU7A 2F4VK 3I0RA 2C2KB 3CG7A 3D7SB 3L7UA 3ZLJA 3N01A 3DLKB 1F60B 2HSTA 4Q44A 3MM5B 1DTQA 4NXNJ 2LEPA 4XTTA 3KMSA 1ZBTA 1Q7LB 4W5TA 5EWGA 3H5SA 2NRRA 1P8ZA 4QWEA 1NKEA 3D2FA 5IV4A 1OSCA 4EWTA 2RU9A 3NG8A 5L38A 3C2PA 1GK8A 5CZVA 2IBKA 1NBWA 1IBLF 5HROA 5B0EA 1DARA 1ZETA 3OYDA 5KFMA 5AQUA 4P7VA 4DZ6A 1RWKB 4G6VB 4X66K 3VQAA 5JVGQ 3LP2B 4JP8A 1RBOB 5K9FA 1Q82T 2DNHA 4C6AA 4JI0K 2VZ9A 2R3VA 4ZJQA 3GIIA 2IM2A 4QW9A 4CF2A 3D45A 4E98A 1IR2A 2GGPB 2VQFK 3N6LA 1S48A 2VG5A 2ASMA 4BR4A 4NCGA 3TA2A 3CC7N 5IV3A 3ZSZA 1WAJA 4IG0B 1WJ9A 2XMTA 4OYZA 4I9QA 4TN2A 4XK8C 3SEOA 3KWMA 4OX9F 4M41A 2LYVA 1YIJS 2GV1A 4HDHA 3MM6B 1S72N 3KYLA 2O8CB 3A3NB 3GYNA 1WHWA 4W4MA 4NYNA 4RJVA 1PJ7A 4K8ZA 1SI9A 2UYTA 5HL7L 4KAIA 1M5VC 1R89A 3BGOP 4I2PB 3P38A 1I94F 3D2EB 3B4DA 4DUZK 3JTOA 4MO5A 3FZKA 1FKPA 2NYIA 4KB0A 2M8DB 3L9ZA 3K5LA 4BREA 1FJGJ 2YHWA 2E5LJ 3ZSQA 1L3UA 5BRHA 1RT5B 1S6PA 2DITA 3DM2B 1UJ4A 1U2VB 3VENA 3AO4A 2DR9A 4M94A 1H7XA 5AQIA 4BDYA 1R8HA 3AB4B 2NUBA 2MQ8A 3D6MB 2KHOA 2BE7D 3B4MA 3ZZRA 1B7FA 3SMZA 5A2QU 3L2VA 2A1RA 3R8EA 4ZLPA 4CJWA 3AAPA 3IAS9 4A47A 3JXOA 2DH8A 3D4JA 3AA8A 2OI2A 3WZ0A 2DY1A 4OZJA 4KQZA 2C1EB 3WX4A 2E1CA 3OR1A 1V3RA 4ID8A 3R6MA 1NGIA 1XC9A 2QWMA 1RDUA 5KFJA 1R3NA 3MFIA 3GYXB 3C6HA 4HTIA 1DAXA 3PO5A 1WOPA 4DI6A 2Z58B 5CHIA 1SJQA 2OAUA 5HOOA 3DHWC 2KRBA 4ED0A 3J81O 2P9PA 4FPRA 2HQFA 5F8JA 4KV8B 4RW7A 5KFXA 2Y1IA 2WVBA 3SI8A 2QFIA 5KPZA 3ULEB 4I6AA 2LP4A 4A46A 3T41A 4C4WA 1YZ7A 2Q0UA 3MPWA 2YNGA 1FT8A 3N4QA 4CYUB 5CABA 1X7VA 3ETOA 2Z0GA 3D67A 5I42B 3RBZA 5KT5A 1RBAA 2H9ZA 1VK8A 2WW8A 4RPFA 2YNGB 1NHVA 3MDQA 3AAQA 3P8BB 4JI1F 4CJFA 4KTZA 3VGTA 4R8UA 4A8XA 4DQRA 3O8MA 3KG4A 3CJRA 3GJQB 4PA1A 4ZVSB 2Z1IA 1T03B 4FDFA 5LT5A 4DSKA 1P6TA 2ETJA 3RB3A 4BR9A 2XNQA 3S6EA 2DPJA 3VZHA 3DYAA 3NF6A 1FRLA 3SBGA 3R5GA 5BPLA 1VBYA 1WB9A 4R0EA 2ZVSA 2VL1A 1JLGB 4LF8J 4KYZA 4B1YB 4ER8A 1RHQB 4WP3A 1RCOB 2UXBJ 4LFCK 1VI7A 4NE9C 5EX3A 3G71S 3GJTB 3EVOA 4ECUA 1NM1A 4JYAJ 2F40A 1XI1A 4OYPA 1S9GB 4FSVA 2O66A 2ZITA 3OV7A 2RRAA 1RU1A 3VA3A 3DGPB 2OKQA 1GMWA 2D4WA 3OLBA 3V1QA 1VQ7N 1ZM3A 3NWRA 2Z1HA 3CF5L 3BJYA 4ZPBA 2MZSA 2H51B 2G8IA 2FQQB 1NUEA 1FHTA 3ILOA 3TRGA 3I55N 4DU1A 3UKUA 1XNQJ 3N6NA 3JS6A 3EYZA 1BGXT 2RH3A 1IR0A 2WBMA 1NDPA 1Z2LA 3IBWA 3HOSA 1S1TA 2CNKB 1VFJA 3RSEB 1YAGA 3NLCA 4PKGA 3PLAA 1KVIA 1NG9A 5HQMA 1YTYA 4DDFA 4JI0J 4PXEA 1K44A 1IUJA 1NJIT 2E44A 5LMNK 4FJGA 3AD9C 3NP5A 4H0VB 1T9VA 2EPIA 4KH1B 3WUHA 5GAEI 2VONA 1KWMA 1RDBA 3CD5A 4ZIVA 4DR7K 3G82A 4RNNA 1IG9A 3NAIA 3VGVA 2WW4A 4NLYA 3LWMA 4USMA 2CNLB 1NB2A 4CLYA 1MROB 1AYEA 1XMQF 1IR1A 3HHLD 4NEZA 1A7GE 4GVBB 3PR5B 2P51A 1IM4A 1R8PA 1CULB 2E66A 2CJQA 4WQ4C 1EKRA 1MLAA 2VPWB 5BRFA 2KKZA 3T69A 4H5WA 1JXLA 1B0VA 1XWLA 4PG8A 4C0OC 4J9OA 2X7IA 4AXIA 4PKHA 1TKZB 2B5JB 2BJ3A 4QZVB 4CLUA 1PG5B 1SC4B 2XHBA 5H1SV 1Y64A 4DR4K 1VJQA 4JI4J 2EC2A 1FNOA 2PD1A 3ZTRA 2G4BA 4FLTA 5CR4A 4PG6A 1KOOA 1YRXA 3W1YC 3FE1A 4ZVGA 1REGX 4LF6F 2H1YA 1RAFB 4CF9A 5EOYA 2ZBRA 3L2UA 1N4LA 4AH9A 3ET6B 3NF7A 4PG4A 3HSTB 3LPUA 2W4DA 4L74A 4OMFG 4CJPA 3C95A 5MAOA 1SH2A 3PG9A 2ASYA 2RDJA 2Z2YB 4F50A 4PCQA 4JV5K 5HMWA 2W42A 1IBKF 3CFOA 4HI2A 4Q7AA 2KRRA 4GVMA 3H2VE 1RT3A 5H9EJ 1BCOA 4I64A 2EFVA 1HHQA 4CZIA 2EFQA 5B08A 2X3DA 4CE9A 1JNRB 5AQHA 2BR0A 1JCFA 4DQ8A 1X3MA 3NMRA 2P6SA 3OVNA 4JD2B 4UUXA 4CZEA 3GTYX 4K25A 3KOAA 3EVWA 5CZXA 3UD5A 4ECZA 4M3YA 3LP0B 4X65J 2OANA 5AQNA 3Q89A 3SQ1A 5B0DA 2J9DA 4GMJB 3ZTSA 3FBCA 2A3ZA 4A8QA 3E1YA 3TW0A 4DR6J 1SKWA 5D8HB 1MMLA 2J5AA 4F4YA 3UW1A 4X4UA 2ZZMA 1JB0C 3T5HA 3FQKA 4M7XA 1XHZA 4LFBF 3GZ7A 3KK3B 1RAOA 2HHPA 2E4LA 3OW2M 1YRTA 3D1QA 4U8YA 3SAHA 1FFWB 3ZZYA 2KFYA 5F8MA 4CO0A 5BXIA 4XAKA 1RDCA 1IXKA 2HF3A 1VQNN 3C6TA 5AZJB 3D7EO 4LF9J 4JS4A 4L3QA 1WC4A 4FF4A 2LU2A 3MEGB 1CJKA 2OPPB 2JVOA 1GNKA 4NLTA 1QJHA 5I9EB 4LF5J 4ECYA 4WU2A 2HBYB 3L4QA 1KXPA 4CVNE 4OPKA 2CPDA 3FSYA 3MEGA 4PY5A 1ZM4A 3GWCA 3O44A 2MTLA 1Z2ZA 4ZKAA 2HKEA 2L9WA 4ZHRB 2DGSA