3KK1A

Hiv-1 reverse transcriptase-dna complex with nuceotide inhibitor gs-9148-diphosphate bound in nucleotide site
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
555
structure length
555
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
total genus 148
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk1A05
2XC9A 3CWJA 3SFGA 1ITGA 3MEEA 5KFYA 4CHOA 3CQ8A 4CJ5A 3VQCA 3LP3A 3M8SA 1JX4A 3AVLA 5EU7A 3MEGA 3E01B 1U48A 5FDLA 4B9VA 4OKJA 1T05B 3PZPA 3KLHA 4ECXA 1N5YA 3KHHA 3NF6A 3BREA 4NLRA 1LW0A 5KG0A 4ZP7A 2CJQA 4IQXA 3SFUA 3NKYA 3DOLA 3GQCA 3AA4A 2O4IA 2IOCA 1GOAA 3AVNA 3V6KA 1CZBA 1L3SA 1S9GB 2KTQA 3VQ4A 4QW9A 3DM2B 2R8JA 4O3RA 2I5JB 4E3SA 1BCOA 2X6NA 3PW2A 5I42B 3V9XA 4RW6B 2DFEA 2IM0A 3NF7A 4FJHA 2VA2A 3NGDA 3CJ3A 4K8XA 1YVUA 2IM3A 1IH7A 3NHGA 3H2LA 3U6FA 3KKRA 4O3QA 1RT7B 1S1TB 5KFPA 2EX3A 3OYLA 4FJJA 2PYJA 2IC3A 3IGVA 2AQ4A 4IR9A 3Q8QB 1DLOB 1TVRB 3KOAA 1CXQA 1BL3A 3HP6A 4Y34A 4KHQA 3H5SA 4DMNA 4FJLA 2WOMB 2VG6B 2OH2A 2VG7B 3TAFA 5KG1A 1NOZA 5DQIA 1NJXA 4RU9A 2XCAA 4XPEA 1C1CB 4IRCA 3PJXA 4KHMA 3RB0A 2XY5A 3MECA 3QEPA 1LWCB 3FQLA 1IKWB 4HCCA 4IDKB 4O3OA 2F96A 3TR8A 3HKWA 3OYJA 5F8IA 4ZPCA 4KE5A 5HP1A 3CVKA 3I0RA 4ED1A 4PQUB 3GIIA 4BWJA 3PR4A 2UVVA 4ECYA 3B6OA 3NBPB 5DLFA 2JC0A 1LAVA 4ZTJA 5F8JA 4F50A 1S9EB 4L8RB 4KB7A 2J6UA 1REVA 3VQ8A 4CJFA 3PO4A 5KFZA 3TAEA 5J2QB 3KLEA 1UWBB 3ZT1A 4F4ZA 2VG5B 3DRRA 5DQHA 3QIOA 1J54A 1QUVA 3M8PA 4H4MB 3L8BA 1LWEB 2IM1A 3M8RA 3HPOA 4ZVFA 2HHUA 3IRXB 3LP2A 4ZTFA 1JXLA 4PWDA 3ALYA 2IA6A 5DG7A 1RDBA 2WK4A 5F9NA 3C6UB 1T7PA 3OYKA 4K4SA 1IKYB 4RUCA 2BE2B 4E19A 1ASVA 4CCHA 4CF2A 2GIRA 2Z1HA 1U45A 3O3HA 1GX6A 4DTXA 1LWFA 4FW2A 4E0DA 2G8KA 4YR3A 4MIBA 4QCLA 4KO0A 4QWAA 1S0NA 2IDOA 3OS1A 3JYTA 2O4GA 1XI1A 1RILA 4NLQA 1BI4B 1WSEA 4IRKA 1MMLA 3QGHA 5EWEA 4ZPBA 3I0SA 3CM5A 5DG9A 3PUFA 4CGJA 3OYAA 2HNDA 5CYMB 3L2QA 4E7JA 3WNEA 1RT2A 1XC9A 1TL1A 2J6SA 4Q8EA 1WSJA 2P5GA 1JLEB 3KTQA 1VSHA 4GC7A 1T3NA 5EWFA 2D0AA 3M9MB 1C2PA 2V0NA 4ED0A 1ZETA 4HUFA 2IS3A 2R8GA 3G6XA 4IOBA 1YT3A 1RBTA 4Z4HA 4N76A 4CHPA 1RT4A 2HHXA 3DLGA 4JUZA 4J9LA 4EBCA 5KFXA 4DS4A 4BDYA 4DG1B 1Q9YA 5KFQA 3RB3A 4Z4IA 3DRSA 5CYMA 2FBYA 4JLHA 4WFZA 1JLGB 1HPZB 3ZSVA 4E1MA 1C6VA 5C5JA 3OVNA 4QPXA 4RW8B 1S1VA 1HYSB 1RT5A 1QE1A 2HW3A 4KTZA 1BI4A 1R0AB 3SUPA 4DEZA 1SV5B 2OZMA 1JLGA 3GIKA 4DSKA 4EBEA 1G15A 1SKWA 1JLFB 5J1EB 1X9SA 2RF2A 5KRSA 2R2TA 3KJVB 4IH5A 3GILA 1TV6A 2E9ZA 3SV3A 1RDAA 1I3AA 1RYSA 1RBUA 1RT7A 4OL8A 3G86A 4BE1A 3H4DA 4HTUA 3KLVA 4FK2A 1FK9A 3MR3A 4CGGA 1RBRA 2E4LA 1S1TA 1WSFA 2F8SA 1BQNB 3KD1E 4RW9A 2AU0A 3BGRA 3UIQA 1NK6A 4XO0A 5KFKA 4DSJA 4BE2A 1VRTB 3QIDA 2BQUA 3FRZA 4NLVA 1IKXB 3BR9A 2QXFA 4K4XA 4AHUA 1MU2A 3RMDA 3ITHB 1A5XA 4M45A 1RTIB 4RW9B 3HL8A 4O3NA 3JYTB 4O0IA 3AO3A 4DSLA 3FFIA 1VSFA 4FLXA 4BACA 1IO2A 4KTWA 4DFPA 4ED2A 4HVJA 4JS4A 4FM2A 1WAJA 2IMWP 2B4JA 3AA2A 1NKCA 5F8LA 4J2EA 2UVWA 3NH1A 1S6PB 5KG6A 1Z4UA 2RF2B 3CDWA 3MEGB 4NLDA 4KAIA 2XRIA 4NRTA 4KB1A 4B9SA 3VQDA 2YNGB 4CGHA 4C8MA 3VQ7A 4TYBA 4B3OB 2W9BB 4IFVA 4CHQA 4DSEA 3DMJB 4M3ZA 4TY8A 4KHUA 1U09A 3LALA 5KT2A 1LWCA 3LPUA 3MEEB 3VN5A 2ASDA 4E7HA 2AWZA 4EZ6A 5HRRA 2HNYB 3BSCA 3KK2A 5HBMA 4B9NA 4RNFA 1I6JA 3NDKA 3NCIA 3KLEB 3F9KA 2JEIA 3L3VA 4FVMA 3DRPA 4HHTA 3DLGB 4Z4FA 3RBDA 3TANA 3RAQA 4B9UA 5C42A 3V4IA 2W7OA 1FKOA 3SQ0A 4MFBA 1NJWA 4CJQA 4AHCA 5DG8A 1TL1B 2JEFA 4BDZA 2ZKUA 4RNOA 1NKBA 3VQAA 4GC6A 1TP7A 3P83D 4DQQA 4FJKA 4KV8A 3TAPA 4DTOA 3MR6A 2ITGA 5HROA 4FK4A 4CE9A 2QV6A 3ZSOA 3O3GA 4ECZA 5L1LA 3HJFA 4FXDA 1IKVA 2WTFA 4O4GA 4KI6A 3WNGA 4AILC 1BQMB 3T5LA 1RTJA 5F8NA 1D1UA 4IG0A 4QWEA 4DL3A 1DTTB 1HQEB 2XI2A 2JEGA 3H40A 4NYZA 3DLEA 1J5OA 1S4FA 2VWJA 2HNZA 4DFJA 3UDLA 3CJ0A 4CECA 2Z1GA 4MKBA 3C6TA 2HVIA 4ELVA 3DLRA 2W9CB 2JEJA 2R8KA 2XY8A 4EP4A 3RB6A 2HVHA 1EKEA 3SZ2A 5HRNA 2YNIB 3KLGA 3AA3A 2D7SA 1VSDA 4RG8A 4O55A 5C24A 4H4OB 4I9QA 3VQ5A 3RMBA 4NLWA 3AO1A 5KFFA 3UQSA 4YR2A 5HROB 1REVB 4FW1A 4B08A 3H5UA 4N41A 4MIAA 4EBDA 3OS0A 3M8QA 2PZSA 4FLTA 3BGRB 5KFVA 4DQSA 4Z4EA 3SQ4A 2HWIA 4CEBA 1JLCB 2FLPA 4EEYA 5KTQA 2D41A 5CYQB 4B9TA 4LSLA 3V81B 3PY8A 1TAQA 1FKPA 1ZTWA 3AA5X 4CEAA 1S10A 5KGWA 4URSA 3KHLA 4DWIA 1SKSA 1U04A 2YKMB 2QKBA 1T8EA 4HCBA 5J2MA 3PVXA 1EX4A 5KFWA 4CJ3A 2W42A 4YP3A 3T3FA 3LZJA 3K5OA 5KFNA 2E6LA 3PW5A 3ISND 3LWMA 2YKNA 2G8VA 1QE1B 2OPPB 4ZP6A 2OPRA 4RW4B 3MECB 1HARA 4YR0A 3Q8RB 3CFOA 4AHVA 2ZQBA 4KO0B 4Q0BB 2RKIA 2ATLA 1CXUA 3B6PA 4BWMA 3PX6A 3KD5E 4J9NA 1ZTTA 3RR8A 3RMAA 3QZ7A 5KG4A 5F8HA 2VG5A 3CIZA 4IRDA 5FRMA 3AVCA 4KPYA 2G8FA 5SWMA 2C22A 3GV5B 3PR5B 2R2RA 4WE1A 4J9QA 5HRSA 1ZBIA 3DDKA 2FJWA 4LSNA 4H54A 1RTDA 3VA0A 2ZD1B 3NBPA 1K6YA 4OPKA 1KCFA 5EDWA 1RAJA 4CEFA 2VWKA 4RW6A 4FJ5A 4DTJA 4KB0A 3OYMA 4W5QA 1QAJA 2UVRA 2KW4A 4R5PA 4FM1A 1S1UB 4C8KA 2G8HA 3AO5A 3C94A 4YQWA 2AGOA 3QIPA 4DU4A 4IDKA 1ZBLA 3D5MA 4KAZA 4DF4A 2V4QA 1S9FA 5KG2A 4W5NA 1TKDA 3Q8SB 1KVCA 4I9LA 4J2AA 4LSNB 5DGAA 2R2SA 4DL4A 3SV4A 4FLYA 4OVLA 4DL7A 4K4ZA 2ALZA 1FXXA 1S6PA 3CJ4A 1HMVA 3GYNA 4KKOA 5L1KA 3KLIB 4M41A 4CJVA 3VQ6A 1C1BB 4KREA 4NYNA 1B9DA 4CK1A 3GIJA 1DTQB 4K8ZA 2KQ2A 2Y1IA 3QYYA 1Q8IA 2B6AA 4LSLB 4ID5A 3V81A 4NCAA 4AHSA 3M8QB 2BANB 4W5RA 2D0CA 3HVWA 1MU2B 2GC8A 3JSMB 5HLFB 3AVFA 1XR7A 3QGIA 4KBIA 3NL0A 1OS5A 4M3TA 5KT6A 4LQ9A 4FLWA 2DPIA 3A2FA 3VQ9A 3KNAA 1KFSA 3SPYA 1XHZA 4NLYA 1JKHA 1NJZA 4LQ3A 2LSNA 1Z26A 3ULDA 1J53A 3P5JA 5J2QA 1EETB 1Z25A 3P1GA 2DY4A 5KFAA 4UQGA 3N6MA 5DMRA 2WRMA 3HK2A 3NAIA 4U7CA 4QOZB 1RA7A 3H98A 2FLNA 1SH3A 2AX1A 4O4RA 4U6PA 3QEXA 3RWUA 4KHYA 4FJIA 2HNYA 4KHWA 1YTAA 4RW4A 1DTTA 1HQEA 4Q43A 3ZT2A 5CZ2A 1S1XB 4ZPDA 3PX4A 4FJ7A 4DTPA 3NAEA 4J2DA 2YNIA 4RW8A 1HYSA 1S1WB 1KHVA 4GMJB 4N47A 4CJ4A 4ED8A 3ASMA 3HVTB 4RW7A 3G10A 1CSJA 4CEDA 4DF8A 3C6TB 1HJRA 3T5KA 3EY1A 5FRNA 3AVMA 3V9ZA 4PUOA 5L1IA 3L2WA 1T05A 3H08A 4K4TA 3E01A 4I2QA 1F21A 4CERA 1JLAB 4IG0B 4ZHRA 3OL9A 2HHVA 5JS2A 5L9XA 1BHLA 4DFMA 1QSSA 4NLTA 3BQ1A 2YHAA 4CJTA 3M9NB 3VQEA 4WZQA 3HPHA 2KFZA 5I42A 2ZE2B 1BISA 3OLAA 3CDEA 4G3IA 2F8TA 3QEIA 2Z1JA 3SUQA 3EYZA 3SYZA 3BSAA 2BR0A 4DQRA 5J2NA 1NHUA 4J9PA 4C8OA 3LP1B 4ID5B 1LW2B 4I2QB 1GX5A 3ZCMA 1UA0A 4MFBB 1JLBB 1TKTB 1ZBUA 4ZVHA 2IM2A 2D3ZA 1HQUA 4Q5VA 4ZVEA 5KFEA 2ATQA 4DU1A 3RB4A 4I7FA 5I3UA 2W9CA 1X9WA 1LW0B 4I2PA 2OPSA 1SV5A 2R8HA 4W5TA 1JLBA 3FFIB 3HVTA 4RW7B 2RDIA 4NLPA 5E41A 4FLVA 3HYFA 4PY5A 3SUOA 4JRQA 1RTJB 4E1NA 3IRXA 4EP5A 1TK8A 4J9MA 4ZVGA 2VA3A 3HXMA 3OYGA 4B9MA 4M3YA 1IG9A 4K50A 1JL1A 3IN5A 1ASWA 4MK7A 4LH5A 4YFUA 2IBKA 3NFAA 4LY7A 4F4XA 3HPGA 2R7YA 4ECTA 4DU3A 3LDSA 4KTQA 3ZT3A 1TK0A 3OYIA 4E7IA 2QK9A 3OL6A 1N4LA 1RT6B 3AO4A 2YNHA 4F8RA 1B9FA 4MH8A 2FJXA 4WYLA 2I5JA 1ASUA 3TAMA 4R8UA 3OHAA 1C1CA 1WSIA 5JUMA 5F8GA 1Q9XA 4ECSA 1RT3A 3S3NA 4CK3A 3AVKA 2WHOA 3ZSWA 1C0UA 3G6YA 1N6QB 4AHTA 5DLGA 3DLBA 3BQ2A 1C1BA 1EXQA 1RBSA 1RTHB 2G8IA 1VRUA 4CIGA 4FYDA 1HRHA 4FBTA 4O0JA 1SH0A 3LP2B 3HHKA 3EPIA 4W5OA 1S1VB 4K4VA 1NKEA 1NNDA 3SI8A 5D3GA 2AJQA 4DL5A 4IBNA 2A1SA 1BCMA 5C25A 1IM4A 2G8UA 5KT5A 4CJLA 1RBVA 4TN2A 2E6MA 4NLGA 3UR0A 4K4UA 4ZMMA 1QS4A 4C8NA 1FKOB 4QAGA 1YTUA 1DTQA 3KJVA 2PY5A 5C42B 3V4IB 3I0RB 1JLEA 4Y1CA 3G0ZA 5KFDA 1S0MA 1N6QA 3CDUA 3C95A 4E7KA 4URQU 2YNFB 4J9SA 2RKIB 1WSGA 1TL3B 1WN7A 3V6DA 4M95A 3IG1A 4MK8A 4HUEA 1R0AA 3H5XA 2XY6A 5CY4A 3M9OB 2XI3A 4CGFA 3OLBA 4F2RA 4LH4A 4TY8B 3OL7A 4DTNA 3KHRA 2PYLA 1VSLA 4OLBA 2Y1JA 3IG1B 1T03B 3ZSQA 3ZT0A 3RRGA 4KHSA 2FBXA 3KLFA 1TK5A 4WYWA 4FCYA 1NOYA 1NK7A 4ED6A 3H4BA 3HVAA 4DG1A 5I3UB 3PJWA 4Y2CA 5DK5A 1S9EA 1S48A 1RT4B 1RTDB 3O4QA 5KG5A 2CKWA 4KFBA 3IS9A 3E51A 1RT1B 1JKHB 3OJSA 3AVHA 1SL0A 5KFCA 1EETA 4IKFA 2R8IA 4TQSA 2ASLA 4BDPA 3RBEA 3OYBA 1S1UA 2C2EA 4R5PB 3G6VA 1HYVA 4WFYA 4F4YA 1TKZA 3BQ0A 2F8EX 1D5AA 2OYQA 4Q8FA 1LAWA 4OGEA 1S9GA 1KVBA 4RNHA 4CJKA 4OGCA 2GIQA 3QNOA 4QWCA 3V1OA 2B6AB 3VQQA 4F3TA 2XCPA 4ECWA 3PW0A 1RYRA 1LWFB 4CJSA 4KI4A 1VSJA 5KI6A 1W25A 2JGUA 4H8KA 3TVKA 4RZRA 4RNMA 2FBTA 4JV0A 4B8CA 1S6QB 3PO5A 2DTUA 4QWBA 1T94A 3TAMB 3WNHA 4CFBA 3ITHA 4CF1A 4URGA 4X2BA 1LWEA 3GIMA 2ILYA 2OPQB 3K57A 3LAKA 4M94A 2XGPA 2RN2A 1HPZA 1JIHA 4DS5A 2XHBA 4FK0A 1UWBA 2YNFA 1KSPA 2W9AA 3LZIA 4EO6A 5J2MB 1RT1A 2J6TA 4HKQA 1WSHA 3RAXA 3LANA 4NLSA 1JLAA 5J2PB 4CF8A 2FLLA 3AVIA 3D28A 4DLGA 4Y3CA 4B8AB 1RDRA 2FC0A 1C0MA 5KFBA 5HP1B 3ISNC 1KLMB 4CEEA 3TQ1A 2X6SA 1TAUA 2Q3SA 3CG7A 5KT7A 1UOCA 4IH6A 3MXMA 3TABA 2FVCA 2KZZA 1C0UB 3DI6B 4MK9A 1C1AA 3DMJA 4CHYA 3I5BA 2W8LA 3MAQA 3CJ2A 2E9RX 2O5DA 1X1PA 4CFDA 3FSIA 3HT3A 1S1XA 2IJNA 4RUAA 1ZBFA 4CEOA 2XY7A 5EWGA 3T19A 2WCXA 3DI6A 1RDCA 1U4BA 2I1RA 4FZZA 4ICLA 3AV9A 3L2VA 4I7FB 1BIZA 3N6LA 1N5YB 2YKMA 4NLOA 2GV9A 2KFNA 4Y2AA 1HMVB 4Q45A 3DLEB 1J5OB 4ELUA 1D0EA 1TKXA 3LP1A 3AO2A 4ZP8A 4NZ0A 4NCGA 2HHTA 3SI6A 5KFLA 1TGOA 1X9MA 2V9WA 3LWLA 1NK4A 4NLUA 2GBZA 2IGIA 4KSEB 3GV8B 1QHTA 2HNDB 1JL2A 4FJGA 4KHNA 2BRLA 3IAYA 5C24B 1UAXA 4IG3B 5KFSA 4NCGB 4HUGA 1N48A 3QESA 4Q44A 2IAJA 1W0HA 4TYAA 1B92A 3MR5A 2W9BA 1NJYA 4NYFA 1XWLA 4F4KA 2KZMA 2HAIA 1TV6B 4KFBB 1L3VA 1RTHA 4PUOB 1EP4A 5KFRA 3QNNA 2R2UA 3DLHA 3SNNA 4CIEA 4CGIA 2WONA 3LPTA 3SQ1A 4Z0UA 3KK3A 5KFMA 1SL1A 3T5HA 4OPJA 1RT3B 3KIOA 1T03A 1C0TB 1BQMA 3KK2B 3I5AA 2DPJA 4O44B 5KFGA 1CLQA 2HHWA 1SH2A 4CEZA 4HYKA 3GV7B 1GOCA 1IKVB 4KV8B 3AVBA 4AH9A 3U3GA 3NH2A 4DSIA 3OYNA 3HP9A 2GUIA 1RT6A 3OYFA 1WLJA 1KLMA 3NGYA 3ICLA 1HYZA 1KTQA 2RDJA 5KFTA 2DFHA 4NLXA 3H5YA 4ECUA 2UUTA 3RTVA 3NE6A 1BIUA 4PQUA 2BQ3A 3HSTB 4DQIA 4M42A 1SUQB 3H59A 3QO9B 1VSMA 5J2NB 3CO9A 1A5VA 2IJFA 3MFHA 5KG3A 4ECRA 4WXWA 4DFKA 1JXBA 5T14A 3T5JA 3KMQA 3V1RA 4IH7A 1VK0A 3QEWA 4Y1DA 3DM2A 4B3OA 4CJRA 4IKAA 5KG7A 1RCHA 5KFHA 3KLGB 4XIUA 5KFIA 4IFYA 4FM0A 1N56A 2C28A 3TAGA 4N56A 1TL3A 4WFXA 1RNHA 2ETJA 1HNVB 3O3FA 3I5CA 4F3OA 3QINA 1K1SA 2P1JA 3OHBA 2BRKA 1VSIA 1HQUB 2OPSB 4Z4GA 2HNZB 2YV0X 1FKPB 1HNVA 3KK1A 5HRPA 3DYAB 1EP4B 3ZSXA 4ZPAA 4PA1A 4CK2A 4M3XA 2NUBA 3VQPA 1WNSA 3VA3A 3F73A 4O4GB 4H4MA 2FVQA 4TXSA 3MF5A 3OS2A 1RTIA 3Q8PB 1W9HA 3QEVA 4JRPA 3UPFA 2Z1IA 4JV1A 3PW7A 4FJMA 3QGGA 3CFPA 1HNIA 3DLKB 3OY9A 4CEQA 3ZSRA 4DTUA 4KRFA 4FZYA 5KFUA 2HMIB 2BQRA 1S6QA 1KRPA 4EYIB 4NCBA 2ZD1A 2FVSA 4CFCA 3ZSYA 1L3UA 2A1RA 4MQ3A 2W7PA 1S5JA 3KLHB 1JLFA 3KLFB 3MXJA 4KKOB 2BE2A 3C6UA 4QW8A 3CFRA 2OPRB 4ICLB 2UUWA 2FJVA 4Q0BA 4N5SA 1RT5B 2B43A 4CGDA 2HWHA 1KFDA 1ZYQA 4IFVB 3K59A 2YKNB 1DLOA 1TVRA 2VG7A 4TY9A 1K1QA 3D45A 4R0EA 3CM6A 1SKRA 3DRRB 1ZBHA 3RRHA 3V6DB 3K58A 1I39A 3V9UA 4CF0A 4YNQA 3N6NA 5DGBA 1VSKA 3S3MA 1KLNA 1IKYA 1NK5A 4KHRA 2FVPA 4WE1B 3DOKA 2OZSA 3L2RA 3WNFA 4BE0A 3V1QA 5KT4A 3TAQA 1TKZB 4B9LA 2IAJB 2BDPA 1TQLA 4ZP9A 1WAFA 4ED3A 2BGGA 3NH0A 2ILZA 4H4OA 4CFAA 2OPQA 2W8KA 3CYMA 3I0SB 2BANA 4CJWA 3NF9A 3FDSA 2YHBA 3IGNA 3OSPA 3JSMA 5HLFA 1D9DA 1IKWA 3NMAA 1Y97A 2HHQA 2OPPA 4O44A 4CHZA 1D9FA 1U49A 4FS1A 3OYEA 1C0TA 3LAMA 4NRUA 2XWYA 2G8WA 4DL6A 2D5RA 3OSNA 1YVFA 2D0BA 3SUNA 3TI0A 2DFFA 3S9HA 5KGXA 3BSNA 2AGQA 2HB5A 4IFYB 3SQ2A 5FDLB 4FJXA 1S97A 3TWHA 1S0OA 3QLHB 3BSOA 3V6HA 5F9LA 4J9OA 1LV5A 4FJ8A 4EO8A 3OYHA 3QIPB 1HNIB 3DLKA 3O4NA 4O3PA 4WZMA 3S3OA 2JC1A 1NK8A 5C25B 2XO7A 4FLUA 1L3TA 2ZE2A 5KT3A 3V9WA 4GW6A 3OYDA 3M8PB 1XR5A 5L1JA 3NAHA 3PX0A 3DOKB 3PHEA 3QO9A 3OJUA 2X74A 1QTMA 4FS2A 4RNNA 3AVAA 2QKKA 3TARA 3KK1B 4O3SA 1QSYA 5J2PA 2P5OA 4JS5A 2EHGA 2V4RA 4F2SA 3BDPA 3THVA 4DQPA 2ASJA 3V6JA 4OKKA 3D0PA 4FJNA 4TSXA 4DL2A 3ZT4A 4J9KA 3PW4A 1U47A 4DTRA 3LP0B 4G1QB 3EZUA 3KHGA 3L2UA 5T7BA 5HBMB 1VSEA 1RDDA 3OL8A 2AGPA 1UA1A 5KRTA 2EC0A 2C2RA 3NGZA 4AHRA 2YNGA 5JXSA 5KFOA 2QE5A 3DYAA 4QWDA 3LP0A 2WOMA 1JLQB 3K5MA 5F8MA 3DRSB 4Z4CA 1VRUB 4ECVA 3V9SA 1QSLA 2RPIA 1XHXA 2VG6A 1O1WA 4TLRA 2AX0A 3AVJA 4TQRA 3KLIA 2UVUA 4DTSA 3KK3B 3SJJA 1CZ9A 2FBVA 4EZ9A 3ZSZA 1RA6A 2X78A 1LW2A 3MR2A 1QAIA 3I8DA 1KHWA 3SPZA 1JLCA 3MEDB 2IC3B 2OA8A 3VQBA 5EUHA 4CF9A 4EYHB 4IG3A 5CYQA 3QZ8A 4GVMA 5DQGA 2HMIA 4FBUA 4ED7A 3RMCA 4FZXC 2C2DA 2HHSA 3K2PA 5D3GB 3K5LA 1NHVA 4CJPA 4M3UA 2FVRA 3NF8A 2B5JB 5K14A 4CIFA 4F4WA 4XPCA 4K4WA 1TKXB 1BQNA 1GOBA 3KMSA 3QLHA 3DOLB 3PV8A 4CJEA 1FK9B 1JXEA 1A5WA 3HM9A 4OLAA 4CHNA 3HVRA 3L3UA 5SZTA 4E89A 4J2BA 4CESA 4YMEA 1NK9A 3NGIA 4J9RA 3VQSA 2WONB 5FROA 4C8LA 2D3UA 1J9AA 1S49A 4O5BA 1SL2A 2XGQA 2E9TA 4LD0A 3QERA 4JV2A 3MFIA 4M3WA 1JLQA 3BJYA 2WB4A 3FQKA 4PWDB 4R8UB 5KFJA 4ELTA 1S1WA 3HO1A 4FLZA 3U3YA 5CZ1A 4DSFA 4MKAA 3MTKA 4IR1A 4OKEA 4G1QA 3CJ5A 1IKXA 3QETA 1L5UA 3AVGA 4FJ9A 2YNHB 3EPGA 4I2PB 1SUQA 4OJRA 4ECQA 3IS9B 1WNEA 3OYCA 3MEDA 4ZHRB 1TKTA 4DLEA 4WXOA 1NK0A 3DRPB 2JLEA 3RR7A 1QQCA 2P51A 3EZ5A 3SCXA 1D8YA 3KKSA 4M3RA 2B5JA 5K14B 5J1EA 1KVAA 4K4YA 4DTMA 4E7LA 3K5NA 1XR6A 1RT2B 1VRTA 3MXIA 5JS1A 4ID1A 4CJUA 3T1AA 1BGXT
chains in the Genus database with same CATH superfamily
1MG7A 4C23A 1BWFO 4PG5A 4OYOA 3WUHA 4FZVA 4CHOA 3J80Y 3A8IA 1U48A 5FDLA 3DGPA 1FRKA 2CJYB 3VERA 4DV1J 1N5YA 2QA4N 1LW0A 2BABA 2QWOA 1UVIA 2J0WA 5AQLA 2Y8WA 2YPZA 4IJNA 4PQAA 4NA1A 4ZVUB 4LF6J 2CPJA 3H20A 1H6KX 1Y5LB 3B8HA 4U8VA 5I42B 3V9XA 1EHWA 3BR8A 2DFEA 5AT1B 1WG1A 3NGDA 3W65A 2U2FA 2XHWA 3R27A 3FR0A 2PT0A 4IOXA 4CLPA 5GAGU 3OYLA 4DV6F 4FJJA 4YOXA 2EC2A 1WKLA 3VGMA 3M1FA 2FF6A 3NOCA 1VR6A 4NZ6A 2F5GA 3A4TA 3H5SA 1SJQA 1R6VA 4DMNA 1GT8A 4C7QA 2DNHA 2P6TA 2L9WA 3DN9A 4LF6F 2AEFA 4OJGA 5K5MA 2XY5A 4IRCA 3KK7A 2F96A 3TR8A 4DV6K 1ESVA 1M5PC 2DNLA 3AAPA 4KE5A 3ZETA 3CVKA 3I0RA 1LFWA 2V52B 4DBQA 1HBOA 4M5KA 4ZPVR 1E3MA 4ECYA 5EVZA 5G0RA 3CMQA 5CD4A 3NBPB 3NNCA 2JC0A 1H72C 2QYGA 1LAVA 1TR0A 1ZA2B 4AM6A 4ZLPA 4FWNA 3RBXA 2J6UA 1REVA 3VQ8A 3DAWA 4K5RA 5IV4A 1Q78A 3ZT1A 4G1PA 4ZKAA 3QIOA 2PD1A 1SPBP 3K89A 1I3OB 1O5JA 3HPOA 3LF0A 1JJCB 5FIIA 1T44A 2CQ2A 1JXLA 1TZ0A 5M1KA 2IA6A 4H5VA 2WK4A 2HRYA 4OYWA 1T7PA 3C6UB 1IKYB 2J9DE 5AQPA 2BE2B 3UDVA 1ASVA 3TZZA 5JJBA 4CF2A 5DS7A 4X66K 1Q81O 2GMHA 1CQMA 4FW2A 1WKKA 2WW8A 4ISFA 4KO0A 4JI5J 3EKUA 7FDRA 2KKZA 4H0XB 1WSEA 2UUCK 1WSRA 5EWEA 4ZOSA 1XNQJ 2QLJB 4X65J 2NRTA 1YITN 5AZIA 5MLCQ 4CGJA 2HNDA 4C11B 5CYMB 4E7JA 3VEYA 3WNEA 3SMSA 3O5BA 3QRPA 2OJ3A 3AQOA 3IBWA 1TL4A 4MLHA 2HQDA 1SQFA 3WT0A 3KTQA 2GQ2A 4DR2J 3WC0A 4GC7A 5IC4B 2HBLA 2D0AA 1C2PA 2V0NA 1ZETA 3H0PA 2JHEA 2R8GA 3G6XA 1KOHA 2CDRB 4CHPA 2DIUA 1YAGA 1RT4A 4JUZA 2BEFA 4J9LA 2Q36A 4BDYA 1Q9YA 1SJRA 1JLGB 2DVIA 4E1MA 4CO1A 4ID8A 4CLWA 1VS3A 4QPXA 2MLZA 2IVPA 3D0HE 4IFEA 2VC0A 3W66A 3TX8A 1S7HA 4ZN3A 1BI4A 3H42A 3ZTOA 1JLGA 4NYPA 2IY5B 2ZC3A 2VGMA 1SC3B 5J1EB 2RF2A 5KRSA 4ZIWA 1DURA 3J7Z5 3BF4A 2VQFF 1NSAA 1GK8A 4NPOA 4BY9C 4A62A 1TV6A 5BPNA 2E1AA 2GV1A 4BRIA 1RT7A 3MZIA 3G82A 2UUBK 2E5IA 2VJUA 5DO2A 1S1TA 2E66A 2LEAA 1WSFA 1LXJA 2NRHA 3M32A 4X66F 4IZ9A 4RW9A 2AU0A 1NK6A 3HHDA 5KFKA 1IKXB 1CPZA 1MU2A 1MWKA 4F9OA 2BE7D 1TUYA 3FBCA 2MKKA 5RUBA 4C3KA 1RTIB 4BRMA 2HZAA 4A5BA 2HAFA 4O3NA 3AO3A 2P9EA 1DQ8A 2U1AA 1FX4A 4KTWA 4DFPA 4JS4A 4FM2A 2HFSA 3CD6S 2P9NB 2ZVSA 3F44A 1P6TA 5AQFA 3PFEA 1NKCA 5HQLA 4DCHA 4J2EA 4PPDA 3L3CA 5E3CA 4NLDA 2D9PA 3ZEUA 2XEXA 4KB1A 2IVMA 2CPHA 1Q95G 1T3OA 1RAGB 1RISA 4PEOA 1RABB 1K73T 1U09A 1LWCA 2ASDA 3QATA 3M6WA 3BS9A 5HBMA 1M1KO 3GZ7A 1SJFA 1ZXOA 4ISGA 4LREA 4JNEA 3NDKA 3R6LB 2A6OA 2QI2A 2E44A 4FVMA 5AJ3K 3DLGB 3RBDA 3TU5A 1JJ4A 3MHYA 1CJVA 4FF3A 4B9UA 5C42A 3V4IA 4IOAQ 1Q7YT 1GXTA 3CQXA 4AHCA 1T9YA 1YZ7A 1T11A 2RE2A 1MWZA 5ETNA 1RTZA 4BDZA 4RNOA 1XQIA 1S72N 3DDIA 4ENOA 3J8AA 4DTOA 2QRRA 2LVWA 2NQPA 3MM5B 5EX5A 3L95X 3O3GA 1PGZA 3FSYA 4M5HA 2WAQD 5F0WA 2AA4A 3ZX0A 1RKIA 1B64A 5F8NA 1D1UA 3M7VA 4E2FB 4DL3A 7FD1A 2IRYA 3EUNA 3H40A 4K0KJ 4H4KA 1J5OA 1S4FA 3FZFA 1TUGB 2DNOA 4EHTA 4DFJA 2A0FB 2NR0A 4GKJK 3W5XA 4Z37A 2DH7A 2ZH5A 1MDUB 4DPYA 3VF4A 3KLGA 1M1KT 1XMQK 1NWKA 3AA3A 1RWKB 1VSDA 3CCVS 4KH4A 5C24A 3BEGB 4I9QA 3VQ5A 3QWUA 2ZJQL 4ZLJA 1NM1A 2AD9A 4YR2A 3H5UA 4OI2A 2XG8A 3LM9A 4MIAA 3M8QA 4BRPA 4FLTA 4QYRA 3SQ4A 3UN2A 4EEYA 3V81B 1ILYA 4X64F 3S7RA 2GA7A 3JS9A 5JLHA 3IUCA 3KHLA 1T8EA 3HBTA 5M1PA 4HCBA 3PVXA 3GJSB 3NEKA 1FFSB 2VDHA 1FNXH 2WVFA 2CJKA 3K5OA 2E6LA 3PW5A 1CVJA 3VAGA 4Y6IA 3LWMA 5EN1A 2G8VA 1QE1B 1BC6A 3CJSA 5JMNA 1UPMB 4RW4B 1F9HA 4YR0A 3CFOA 2QMUB 1CXUA 3PX6A 2MGZB 2KM8B 4JI5K 4J9NA 2RRBA 3T69A 1NGEA 3AVCA 4BR2A 2L9DA 3JQMA 2NRZA 3Q8YA 2FJDB 2R7RA 2PGCA 3F5TA 3GV5B 4RBVA 2FZKB 4DCJB 4J9QA 4LSNA 4H54A 2VBWA 3VA0A 4FWLA 3GE9A 3NBPA 5ETVA 3JQKA 4OPKA 1RAJA 2NXJA 4CEFA 1D4XA 4KB0A 3QMQA 4W5QA 3GR1A 2NZCA 4ZLNA 5KPRA 3E2EA 4FWOA 2WTUA 3FZHA 2G8HA 3EGVA 3D7EO 3QIPA 1WG4A 1ZBLA 4CLKA 3D5MA 4DF4A 3FBEA 3GJRB 5KG2A 2I0XA 2VYPA 1LQ9A 1ZZFA 1TKDA 3Q8SB 2BJ3A 1DBDA 4A8YA 2R2SA 4CO2A 3SV4A 3FCVA 4IDHA 4FLYA 4G65A 4NXMK 2RHSB 2ALZA 4M41A 4WK3A 4KREA 4BQLA 4CK1A 2CGLA 3GIJA 1XQSC 4K8ZA 2KQ2A 1ZA1B 3UVJB 4LVNP 2YQ0A 2N4DA 1M90O 4H5WA 4XTTA 1RU2A 3AA8A 1NU0A 3HM8A 4W5RA 4NA2A 3A5OC 3CJRA 2MZRA 3RAMA 2J8AA 4KYZA 3QGIA 3EKSA 4DV0K 4FLWA 4PYAA 1NB2A 2LSNA 1YJWS 4NXNK 5GADP 4P10A 3W7BA 2K2PA 2DY4A 3CCMS 5DMRA 1RI7A 1VQ7N 5A8RA 1GLJO 4U7CA 3TOQA 2ITMA 4NXNF 1X5PA 1FI4A 3BH6B 4F36A 1WUAA 4O4RA 3CO0P 1PG5B 1S72S 4Q43A 4UOGA 2ACYA 3T9NA 4LF7F 1VHIA 1MMNA 2G0IA 1OMSA 1U2FA 2GJIA 2P8IA 1OVYA 3NAEA 2BJDA 4J2DA 4RW8A 3NY0A 4CJ4A 3ASMA 4RW7A 3B78A 2J76E 4GV9A 4JI7F 4LR9A 4DF8A 3C6TB 1HJRA 4IXCA 3UKRA 5CHCB 2VCPA 2DGOA 3AVMA 3OFGA 2YQ3A 3L2WA 1T05A 3H08A 2N7CA 4K4TA 1RFQA 2ATCB 5K8NA 2KB2A 4ZHRA 1FVQA 2BW2A 4LF2A 3GU0A 1QSSA 3GYGA 3ENBA 4ZLLA 4WZQA 3HPHA 1NSPA 1SXLA 2Q66A 3OLAA 3CDEA 4OJ1A 2X1AA 2Z1JA 2GO8A 5HQ8A 3EYZA 3SYZA 2OTJN 1ICEB 3BSAA 1U1NA 2RHQB 4ZVSB 3G82B 2YBVA 2P9KB 5E0OA 2E5LF 2OCEA 1GX5A 4TVAB 5AQQA 1DGKN 2DT9A 1TKTB 2KDOA 2ZJRL 5B0BA 3A0IX 2BJEA 4KHPF 1HQUA 4ZVPB 4Q5VA 4LRFA 2ZH4A 4B9QA 3IBCB 5HVGA 5KFEA 5I3UA 1WC3A 2W9CA 1X9WA 4OIXA 3BGOP 5LL6Z 1N33J 3BO2A 2IVYA 2Q43A 3VQTA 2D0PA 2P9LA 5E3PA 4FLVA 4J9UE 4PY5A 4JRQA 2IPOB 3IRXA 3LL3A 1VQ9S 1DHMA 3FE1A 5ETOA 1BLUA 3VGLA 4CNYA 3OYGA 3PJ9A 2YVSA 4B9MA 4M3YA 2ZEJA 1IG9A 4RWWA 4WIQA 3HOTA 2G13A 2VPWB 4LF7J 2DEIA 1ASWA 3JAMO 4LH5A 2QSWA 4GV6A 4YFUA 3NFAA 2R7YA 1HNWJ 5AZJB 4DR4K 4CLZA 3ZYYX 3CD0A 3ZT3A 1BWVA 3OYIA 1MN9A 3CERA 2CH5A 4K2XA 4GKKK 2O8DA 4USHA 1G6BA 3LGHA 2Z0GA 4ES1A 1C1CA 5HMZA 3OR1A 3AT1B 1OH7A 1N32F 3S3NA 3K7RA 2V50A 2NS1B 1C0UA 2XLIA 1AFIA 2RQMA 3MWBA 5T41A 3C19A 2D74B 4B1XB 5HN0A 1NSKL 1WC5A 4BRHA 2HZVA 4NXMF 1VLYA 2O1PA 4RTFD 4IUFA 2A3JA 2ZH1A 5D0HA 2E5GA 4Y2KA 2DHSA 1EQYA 4GVLA 5B0CA 4NLCA 3CSKA 3TNVA 1UETA 3OBYA 1IWGA 1RQ0A 3OR1B 1OKJA 3KXDA 4W5OA 1YUWA 2Q97A 1NKEA 1NNDA 2OSRA 1HNWF 4ZVOB 2EFVA 4UOHA 4IBNA 2KT3A 2QTDA 3D3BJ 1R7IA 5C25A 2O01C 4B3SJ 3EE9A 3M2RA 3CCUS 1X4AA 1X5TA 3WQTA 4K4UA 3VAFA 1U8WA 1MN7A 1FKOB 2VPYB 1YTUA 1DTQA 4F0MA 3KJVA 3PYGA 3IO1A 2KHCA 1JLEA 2P9UA 5KFDA 4C1NI 5M2RA 3OTDA 3OXGA 2ASYA 3R6GB 4AL6A 1S0MA 4BRGA 4R25A 3EZWA 4URQU 5C2CA 1NGAA 2MKSA 2XY6A 2F8HA 2QEXS 2CPYA 2C3UA 2XI3A 4CGFA 5HSPA 4F2RA 4LH4A 5BR9A 4TY8B 1SBRA 3KHRA 1VSLA 2ZJPL 3CF5Q 4IOCL 2PN6A 2VQEJ 3P5BP 2XSJB 1BU6O 2NZTA 3RRGA 3ZT0A 1IBMK 1CJTB 4FCYA 4QIGA 1NK7A 2H51B 4KH0B 1VIOA 4UTGA 1RHUB 5DK5A 1S48A 3AA9A 1KKHA 3OHRA 4FF2A 3GG0A 2CKWA 4KFBA 4UUXA 1U1RA 1RDWX 1BUXA 4P7VA 1JKHB 1DRZA 3OJSA 3RW6A 5KFCA 5H9EJ 2OKQA 1U6ZA 4U96A 1FTRA 4GVEA 5CABA 2R8IA 2ASLA 1NZ8A 3RBEA 2HBJA 5GAGP 1OH6A 2C2OB 4LBHA 4LF5J 1HR0F 4UQTA 3HOSA 3G6VA 2UXCJ 4WFYA 3VVTA 4F4YA 1XMQF 3ILIA 2F8EX 2OYQA 4LF4J 4MMOA 1YK9A 1KVBA 1JJHA 3K8VA 2AIRB 1JCGA 2B6AB 1FE4A 3PW0A 1Y5NB 4I4BA 3E9LA 4PPZA 2JVRA 4BGAA 3AH6A 1T0TV 4CJSA 1REGX 1W25A 4FPRA 4AUKA 1K9MT 3V4MA 4H8KA 1FXRA 4RZRA 1XNRK 1NGBA 2DTUA 3WNHA 1VQ8N 4DV3J 2MDAA 2B56A 4X2BA 4BR4A 2ILYA 4RBTA 4M94A 2HFZA 2YNFA 1KSPA 2DKOB 4JI8J 3FNNA 4QR0A 2HKEA 1NG9A 1RT1A 4NLSA 2XZWA 4D3HA 2XS2A 4CF8A 3AVIA 4DLGA 2O8FA 2COLA 4WFBQ 3ISNC 4CEEA 2X6SA 2F65A 3SAFA 3GG4A 3W2WB 2KG1A 5F3ZA 3P38A 2KZZA 3SSSA 2XSFA 1LCUA 1VQ5N 1NRKA 3DMJA 4CHYA 2CJXB 2MKIA 4DOZA 4GKKF 2CPFA 3FSIA 3HT3A 5E33A 2XY7A 4QOTA 1WB9A 4A57A 1TYQB 5HAOA 2GVZA 2ZNZA 3L2VA 3OUYA 4WP9A 3O3LA 2MJNA 3N6LA 4NLOA 4YHHF 4AQYK 4J7CA 2GV9A 4UUWA 4Y2AA 1IBKK 5MAOA 1YQHA 4ELUA 1SS6A 3C3LA 1GXLA 1TKXA 4P52A 5EXWA 3PEHA 2A10A 4NCGA 2BV3A 2MY8A 1MWMA 2CZVC 4NLUA 2GBZA 3NNAA 2IGIA 1WTFA 1QHTA 3M6XA 1U1PA 3MXHP 1JL2A 4H4KC 4ITSA 3JQJA 4BHQA 2IBOA 5BYSA 5H9FK 2QC3A 8ATCB 4PKGA 1N48A 1IUJA 3D54A 4Z7CA 1W0HA 2NUHA 2O8BB 2X1BA 4A8FA 3QFPA 2KZMA 1UAWA 3W64A 2UXBJ 3Q8UA 4DV5F 1RXOB 1EP4A 5A0YB 3VTHA 4USTA 2LXUA 3SNNA 3F56A 4LF9F 2FF3B 1SL1A 5FJ4A 2RQ4A 5HQMA 1E6YA 1I51B 4OPJA 2OD6A 4LJMA 1RT3B 1IV0A 2V7ZA 2MLYA 3SQGA 4O44B 2XYPB 5KFGA 2HHWA 1T9WA 4BS2A 4HYKA 2IIHA 1IKVB 4KV8B 2EFGA 3AVBA 1XNQK 3HP9A 4JK8A 4HL9A 3BYRA 3OYFA 1WLJA 5M1OA 1OH5A 4NE9C 3M05A 2GQQA 4NLXA 2V8DA 1J27A 5AQOA 4QR2A 2HLTA 4PQUA 1FWPA 3QB0A 3QO9B 3ENWA 2VIHA 4A8MP 1A5VA 2GX9A 3MFHA 5KG3A 1V3SA 3D6FB 4N8OA 4DFKA 5F2RA 3WQUA 1VBXA 3KMQA 3C14B 3V1RA 4IH7A 1I1GA 2QA2A 1RBAA 1I94F 3QEWA 1VRQC 4CJRA 3GDQA 5KG7A 2H1YA 5KFIA 4FYYB 2C28A 1TL3A 1RNHA 2ETJA 4DR6F 1AUSL 4F3OA 1K1SA 3TTDA 2P1JA 1WC6A 2BRKA 3U1LA 2VJVA 1HWLA 3G71S 1HQUB 4DV5K 4ANDA 5BPMA 2ZWOA 3PACA 4OHXA 3G2XA 3NWRA 3MN6A 1EP4B 5A0YA 2ZUGA 3ZSXA 4ZPAA 1AFJA 4CK2A 1Q7LB 1G3OA 3F73A 1U7LA 4H4MA 2OGUA 3OS2A 1RTIA 3HULA 1MA9B 2P9SB 5AQGA 3QEVA 1GLCG 1KTVA 3AARA 1W7WA 3J7ZT 2Z1IA 4JV1A 4CEQA 3CXCM 3CDBA 1W2BM 3ZSRA 4DTUA 2GNKA 4KRFA 3Q0AA 2HMIB 2KHOA 3TRGA 2Y3YA 2UXCK 2ZDOA 2ZD1A 3G8TA 2R7WA 3ET6B 4CFCA 4AQYJ 1RAFB 4MDAA 5JVHQ 1HBUA 2DNYA 1S5JA 3KLHB 3KLFB 4KKOB 2RQKA 4WFBL 4RU2A 1FJEB 1KVIA 4QW8A 3CFRA 2W41A 2FJVA 4QS9A 4Q0BA 4JD2A 2BYCA 2HHHJ 1RWPB 2NXUA 1ZYQA 3FKBA 2OMOA 4R0EA 3RRHA 3K58A 3BZCA 4CF0A 3W63A 3MI7X 4PL8A 4USUA 1IKYA 2QWQA 3OTOK 2GO9A 2BA9A 2FVPA 3IR7B 3L7OA 1F5BA 1WD6A 1EAYC 2OZSA 4CYUB 3WNFA 4BE0A 4X66J 3R2DJ 2X51A 5KT4A 4K7QA 5GMEA 3PG9A 4CFAA 1WWHA 1X5OA 4DR5K 1KVKA 1GMUA 3WXKA 3CYMA 5BYQA 3HF5A 3WXIA 2VQEK 2BANA 1PO6A 4CJWA 4LIRA 4J9VA 3OSPA 4QQBA 1VQ6N 1IKWA 3KG0A 3NMAA 1N5TA 3I55S 4CHZA 3C16B 3CCVN 3BO4A 3OYEA 4RUBA 2AYBA 1WBBA 3CC7S 1DY3A 4OLOA 5LSOA 4YOYA 2D0BA 4EFAC 3IXQA 3TI0A 5KGXA 2KJVA 3SQ2A 4FPIA 1Y3KA 4JI0J 1S97A 1R27B 1BQXA 4X4VA 1AB8A 4BQZA 4J9OA 2ZM6F 4O23A 4EO8A 4PG4A 3DLKA 4CTAB 3O4NA 1V5VA 4HACA 4DDFA 2HOEA 3CCJS 2GMJA 3UO0A 1X8DA 2XO7A 1L3TA 2W4CA 5KT3A 4KRWA 3V9WA 4H5NA 4JI8F 5M2UA 1XR5A 3BY5A 3CIPA 1VYAA 3PHEA 4CZEA 2X74A 1QTMA 3MWPA 3D6RA 2QKKA 3MCMA 4DR3K 2QM1A 1TMJA 3TARA 3KK1B 2BE9B 1NGFA 2P5OA 4J5OA 4V19J 4F2SA 4Y65A 4OV6A 4DQPA 2ASJA 3V6JA 3PSIA 4JKDA 3HHLA 2MKCA 4DL2A 1U47A 1D9AA 4G1QB 1FFGB 3EZUA 3D2WA 4CBXA 4G1IA 4KHPK 5T7BA 1RDDA 2EC0A 2CXEA 3NGZA 3DRYA 2KRBA 1VQPN 5JXSA 5KFOA 2FGCA 1HR0K 4QWDA 4C9DA 2EFQA 3K5MA 5FLXU 3TWZA 5F8MA 4P72A 2LMIA 3M2UB 3DLJA 3GTYX 5IZHA 2AX0A 3E66A 3KLIA 1TL5A 3KWMA 3SJJA 1CZ9A 2FBVA 2J0XA 2MMYA 1LW2A 1QAIA 3G8SA 4OYIA 3MEDB 2IC3B 2OA8A 3UN5A 1QVFM 4IG3A 3WHIA 1DKGD 3QZ8A 2VFRA 5DQGA 4M8LA 1XNRF 2ZBQA 3KUGA 4BR7A 2HHSA 3K2PA 1F3FA 4DR4J 4WQ4A 1F5CA 2C2KB 3NF8A 4JI7K 4XPCA 4BREA 1BQNA 2MY7A 3QLHA 3PV8A 3MN7A 3IMXA 5M1NA 2ZVIA 3HM9A 3D1HA 3L3UA 4E89A 3ZTSA 5IS2A 4N77A 4NLBA 4C6AA 2P6SA 3VQSA 5MLCV 2K1RB 2J5AA 4X62K 1E4GT 1ZAVA 5M1QA 1SL2A 2XNQA 2XGQA 1R0BG 4PYDA 2E9TA 3MOJB 1JLQA 1JXVA 3BJYA 2WB4A 3FQKA 3EO3A 5KFJA 1XC3A 3SQGB 2I6WA 4NEYA 4FLZA 5CZ1A 5SUHA 4MKAA 3UB5A 2M8DB 4G1QA 1M5SA 3CJ5A 3EE3A 3UD3P 2IVNA 4I2PB 1SUQA 2HEKA 4IJAA 8RUCA 3BGFA 1M5OC 1DJ0A 3SSRA 3BPDA 1UWAA 3UWTA 3C7NB 4A2AA 2ZWPA 1QQCA 2P9IA 3SIPB 1J2VA 2EWHA 4M3RA 2B5JA 5K14B 5J1EA 1HNZJ 2QEXN 3K5NA 3PFOA 3AXKA 2EBEA 1TYQA 1RZMA 1KEKA 4B1ZA 5JS1A 3TSUA 1I94J 2XULA 1BGXT 3W9JA 1VDHA 4OI3A 1C0GA 5KFYA 4CJ5A 1BHNA 2WBRA 3E01B 1AXQA 2QFIA 2GAGC 4ECXA 4YS2A 3NF6A 3M30B 3WC2A 4WFAL 3FGVA 1QJHA 3LPYA 1FWLA 3D4JA 3T1HJ 2CJQA 3SFUA 4XDCA 3UR3C 3NKYA 1VQLN 2AJ4A 2LXFA 3AVNA 4FWRA 4RWTA 1S9GB 2RH3A 5L38A 1MLAA 4QW9A 5BXIA 2R8JA 4O3RA 2I5JB 5GAHU 1BCOA 3HHNB 2JWNA 3ETOA 2CAJA 2Z8QA 4C8YA 9RUBA 4K8XA 1YVUA 3VOVA 4ZCLA 3U6FA 2QLWA 1RT7B 1IBMF 1RSCA 1F60B 2PYJA 2HF4A 2HIYA 2WC9A 3IGVA 4FF1A 2AQ4A 4M1KA 4IR9A 5CCMA 4X4OA 3F41A 3KOAA 2BUPA 4Y34A 5DZ7A 4FJLA 2VG6B 2OH2A 3O1BA 3UCGA 1NOZA 2QL9B 2VHGA 2NYHA 3RB0A 3FEXB 3MECA 3F2KA 3N0VA 1A7GE 4IDKB 2B7BB 4O3OA 3HKWA 1TUUA 3OYJA 3VAJA 2QTWA 5AJ3F 3F9MA 4ZPCA 5D4NA 4Z2XA 3SAGA 1Q82T 1Q7YO 3OBIA 2RT3A 3J81j 3MPYA 4A2BA 2RS2A 5DLFA 1HHTP 2DNRA 1PYSB 5CA5A 1QVGR 1ZOTA 5F8JA 4LFAJ 1X9JA 4CJFA 3PO4A 3FBFA 3WXLA 5J2QB 4MKYA 4F4ZA 3DRRA 1T9XA 1Y3JA 5AQNA 4JB8B 2R42A 4HACB 2MQOA 4YOUA 3M8PA 4H4MB 3L8BA 4DB3A 1WDTA 3M8RA 4ZVFA 3IRXB 3TZXA 5D4PA 3M32B 4OMFG 3ALYA 1TTHB 4YDDB 5DG7A 2CNKB 1SC1B 4DV0J 2P9LB 5F9NA 4K4SA 1RKJA 3OFFA 4HEA9 1CULA 4G6VB 2JFDA 2LP4A 4B3SF 1GX6A 1YF5L 4DTXA 2N3OA 1LWFA 5CAAA 2LQ8A 1ZM2A 1CULB 2ZHOA 4HT7A 4QWAA 3TUJC 3JYTA 2MQLA 4NLQA 1BI4B 3GG1A 4GVBB 2CGKA 1VC6A 1HWUA 1ZPWX 3OYAA 1I94K 3VZIA 3EDRB 1B4SA 5ETSA 4CQ1A 1WC1A 2WBNA 2B4OA 1XIQA 1RHJB 2DH9A 1Q18A 1JLEB 5E3QA 3SJHA 2DGSA 4HUFA 1HHQA 4BRFA 2J9CA 4DR5J 4BRKA 2GGPA 1VJWA 1RBTA 2ZOGA 4WK1A 4N76A 1PYTA 2VQEF 3TZYA 2HHXA 3DLGA 2HLUA 5LJ3Y 2DHHA 3DRSA 4QJVA 3GFHA 2FBYA 4JLHA 4WFZA 2XZTB 3MMAA 1C6VA 4KGZB 3BBBA 5C5JA 2HW3A 1WSVA 3I82A 4KTZA 4TNOA 3SUPA 4DEZA 1SV5B 5A76A 1VBYA 1SKWA 4RO0A 3H6EA 1CJUB 2QLXA 1KAYA 1YJWN 2Y1LB 3A3NB 3DXBA 4AL5A 2GTDA 4M63A 2RRAA 5IT0A 2ZM6K 3DOMA 2E9ZA 1RDAA 1RBUA 1RYSA 3G86A 2VD3A 4HTUA 4FK2A 4PXCA 4CGGA 1RBRA 1HUXA 1WF1A 2W25A 5HJXA 5AE2A 3Q2SC 1VRTB 3W3SA 2BQUA 4NLVA 3SAHA 1N8RT 2CNOB 4AHUA 3O9RA 2A6MA 4CTAA 4DR3J 5ADZA 1HBMB 2B9YA 3C46A 3ITHB 1YRUA 1TFWA 4RW9B 3JYTB 4O0IA 3JB9k 3FFIA 1RAIB 1VSFA 4BACA 3R5DA 5GIPA 1XN9A 2VPZB 4GKJF 2G2OA 2A6AA 2Z56B 4PWUA 1IQZA 2XS7A 2FJAB 3NH1A 4JKHA 2GMLA 3J7AP 3K9JA 4CGHA 2M3DA 4DPXA 4C8MA 3C16A 3VQ7A 4TYBA 4DSEA 3DXSX 3V5RA 3WEEA 4TY8A 1D09B 3NXZA 3AD9C 1LK5A 4E7HA 3O9TA 3BSCA 3HX9A 2GCFA 4WYBA 3DCAA 4HI1A 3WXJA 4NMXA 5IXUA 3L4IA 4GY2B 3KLEB 1APSA 4OI4A 4HHTA 3EE8A 4PG8A 3RAQA 1S3XA 4JI0F 2ZH2A 3PIPL 3KDNA 2RSQA 2W7OA 4MYTA 4WFNQ 1FKOA 3UCZP 3SQ0A 1WUUA 4MFBA 5A8KA 4CJQA 2P9PA 4RJVA 4JI0K 2UV8A 1TL7B 2CUYA 2ZKUA 3VQAA 4AE5A 3BYPA 4DQQA 1CJUA 3TAPA 3MR6A 4OPAA 3N28A 2XZDB 4YOVA 2QV6A 3ZSOA 1XERA 4FXDA 2WBMA 4DUZK 1NBEB 4CIOA 4DR7J 2CQCA 3HSDA 1IXKA 1ATNA 4AILC 3T5LA 4MKVA 4I56A 3FMBA 1DTTB 4M5DB 5AQJA 4NYZA 3DLEA 3S6EA 2FHMA 1AZSB 1WHYA 4QYZJ 5D0GA 2Z1GA 1NSQA 3DLRA 3KG1A 2CG8A 3RB6A 2WW4A 3ZTPA 1YGYA 1PSDA 1TU0B 4FYXB 3CCWA 2NRRA 1NXIA 2BMBA 2D7SA 3D66A 4O55A 2MZSA 4H4OB 3OW2M 4NLWA 5K8OA 2Q1LA 5KFFA 5HJYA 5E5NA 1CEZA 3CGIA 4U9RA 1VAZA 3UKUB 1T95A 4EBDA 2RU9A 2RRNA 3UI3A 3BGRB 2V8HA 4X84A 3CCSN 4CEBA 1JLCB 4B9TA 5H9FJ 3UDCA 3AA5X 1S10A 4URSA 3TUIC 2MKYA 4DWIA 5J2MA 1S77D 1UZDA 2DXDA 2H5IB 1U02A 1QVGM 3L9ZA 1ATRA 3T3FA 4DR4F 3BZKA 4BRQA 4LRCA 2HS0A 2E2OA 3EM1A 3ZLJA 2YKNA 2HBYB 1B3TA 4QS8A 3IFRA 2BVZA 4AD6A 4JI6K 4BVPA 1IBCB 3S1TA 1R89A 1JQGA 3C14A 3R5BA 4AHVA 4JI3J 3IKMA 1ZTTA 1MSWD 3RMAA 5KG4A 2VG5A 1VQ4S 4YDUC 1Q79A 1IR2A 1U0HA 5SWMA 2C22A 2PMZD 2R2RA 1VQMS 1N0UA 2FJWA 5AQKA 2ZD1B 2D9OA 1H74A 4X4RA 1OIAA 3AD7C 2VWKA 2FDNA 4RUHA 4DTJA 3OYMA 2KW4A 3OFEA 4XH5A 1SKUB 4R5PA 1UL3A 3CCJN 2I38A 2O8EA 1PAEX 4C8KA 2AGOA 3EVWA 4DU4A 2DD8S 4IDKA 3PRVA 2V4QA 1S9FA 3MDFA 2QSFA 3MCPA 1X3MA 5ETPA 3M2VB 5DGAA 5IQ6A 4DL4A 4DV0F 1HLWA 4USWA 3D67A 4OVLA 1EKSA 3SEOA 3EGZA 3U1NA 4CJVA 4YY3K 1BXNA 1UEKA 3WIUA 4A8OA 4KGMA 4UY8O 3IAS9 1P1TA 4CZCA 3D1OA 3HSGA 4LSLB 4ID5A 1QD1A 2R7UA 4NCAA 4JI4F 4YHHK 1R8BA 2D0CA 2PMHA 5HMWA 1MU2B 1T9VA 2IRUA 3JSMB 5HLFB 1T6CA 4FWQA 2VBYA 3U8XA 1OS5A 4M3TA 3OVBA 5KT6A 4LQ9A 1GNKA 3KNAA 5EY4A 3MMCA 4WFNL 1M5VC 1XHZA 2JH3A 1Z26A 1UJ5A 4B1WB 3FZMA 3KKFA 4P9SA 1R8AA 3AJ2A 3ET6A 5KFAA 4X4PA 4UZBA 2KXNB 4EFHA 1IM6A 3HK2A 4QOZB 1T02A 3EGNA 1RA7A 2FLNA 4JI3F 5D78A 2YKPA 3ZZYA 3BO3A 1U0HB 4U6PA 3RWUA 1PYOB 4V1Ak 5GADU 1QLNA 2HNYA 4KHWA 4Y2MA 1EQ0A 5CZ2A 4JV5K 1S1XB 4ZPDA 3PX4A 4DUYF 4DTPA 1T9TA 2WZ1A 5I3PA 2HFNA 1S1WB 3THWB 3MM8A 4N47A 4AF1A 4I1TA 3G10A 1CSJA 2YKQA 2H4YB 3T5KA 1WOSA 1N32K 3V9ZA 1LEOA 5L1IA 4YORA 5LT5A 1OO0B 2RJZA 3AAWB 4CERA 1JLAB 2Z58B 2J7KA 3TJ9A 5JS2A 2UZAA 4NLTA 1Q8KA 2AF6A 4DV7F 3I96A 3GWCA 2CQ4A 1JCFA 2E20A 4B3TF 1IVZA 5T7LA 3L09A 2BR0A 5J2NA 4DUYJ 2FHJD 4J9PA 3R7NB 4A8XA 3LP1B 4WCEQ 4ID5B 4ED5A 3ZCMA 1UA0A 1B70B 3CPWM 1WEYA 1RLDA 1ZBUA 2D3ZA 1M1GA 3A5MC 1QVFR 4IWVA 3RB4A 2HRUA 4ZJOA 1LW0B 3TVZA 3SCJE 2HQ3A 2AP1A 1SV5A 2DYAA 4XH1A 1F9FA 4UOFA 5IT9U 5M1FA 2AJFE 2RDIA 5E41A 2OUGA 3PM9A 3HYFA 4LUBA 4F02A 3SUOA 3DU5A 4J9MA 1U8SA 2VA3A 4KC5A 2DGTA 2XMMA 3QT6A 4FDFA 3AAQA 1B7YB 2V51B 3QFWA 2BXJA 5DM6L 1SAZA 1DQAA 2ROEA 3QBCA 3CF5L 3HPGA 2XMUA 4RR5A 4YEAA 4OPHA 1N4LA 3AO4A 2YNHA 1F5AA 3GJQB 4ZPWR 4WTOB 4R8UA 4ILMA 1NDCA 1J5EJ 2B7CB 2XMVA 3R5AA 3TO8A 1K0TA 3PSFA 2WHOA 3ZSWA 2AP6A 1NUEA 1YWXA 3L0QA 2CADA 4AHTA 5DLGA 3QBXA 3BQ2A 1UZHA 2G8IA 2K8GA 4FYDA 1Y5IB 1FRLA 4FBTA 5KAKA 4QR1A 2HHPA 2OELA 3LP2B 1K47A 2VWBA 1V6HA 3J7ZO 1K44A 2DNQA 4PKDB 2UU9F 1S1VB 4K4VA 2IYGA 5GAHI 2XMJA 5D3GA 2AJQA 2A1SA 1BCMA 1OY9A 1HJOA 2MLXA 1R43A 1HNZF 5KT5A 1B0PA 1H38A 2F9JA 4ILRA 2AMCB 3A1YG 2HMPA 4TN2A 3NGRA 4QPTA 4LFBF 4NLGA 4EMDA 4ZMMA 1QS4A 4OJ3A 5LMUJ 4FF4A 3HI0A 1CJKB 4DXLA 1F2GA 4M7YA 1HD1A 4A8KA 2ROGA 2ZUAA 2UXBK 1N6QA 3C95A 2Z2MA 2YNFB 2OSQA 1CZAN 4WKYA 1WN7A 4M95A 3CJ8A 4LMZA 1X7VA 2YH1A 5CY4A 4DCOB 5F0UA 3MM9B 3OLBA 4FP9A 1H7WA 1Y9OA 2CZ9A 4DTNA 4OLBA 2Z30B 2Y1JA 1N34J 1IG8A 1T03B 4L3NA 1AYEA 1HLUA 1TK5A 4JKCA 3H4BA 4DG1A 4H0VB 4HTIA 5A8RB 1EB0A 5BRFA 3AGRA 2Z2LA 5EGYA 4CZKA 2LYVA 3JS6A 3IS9A 1FRMA 2KG0A 3E51A 4H0YB 2QWRA 1Z05A 3AVHA 1EETA 1XMBA 1GLFO 3OYBA 1EQMA 1OPZA 3B8AX 1EZZB 4R5PB 2E1PA 1HYVA 4DR1K 3ZTQA 1TKZA 3FBBA 4Q8FA 4M63C 2OI2A 1S9GA 3JAMU 3Q86A 2A1BA 4JV5J 3QICA 3VQQA 1O13A 1UVLA 1YRTA 3QJPA 3Q23A 3FLCO 1R8PA 3A13A 2JGUA 4LFCK 3TVKA 1YJVA 1FX2A 4DX5A 2F7VA 4OX6A 3A8EA 3PO5A 4EHUA 1T94A 3TAMB 2G0JA 3O8MA 5LXRA 3ID8A 4CF1A 4URGA 1LWEA 2LU1A 3LAKA 2RN2A 2P9IB 3LZIA 1Q81T 2HRTA 1KQFB 3EMTA 5J2MB 4ZJLA 3J7YP 2J6TA 4KT0C 3RAXA 2C2MB 3LANA 1HFEL 1RAAB 4EGLA 2H48B 5ETKA 4ZVRB 4Q7AA 1SI9A 4KH5A 3W2VB 4PKIA 4JN4A 2FGOA 4PWWA 4C3MA 1C0MA 5KFBA 3CJKA 2W2QP 1DARA 1KLMB 2UUCJ 3QBWA 2Q3SA 3ENVA 2PMWA 4WP3A 3DI6B 4MK9A 5LSRA 4YOTA 3R1LA 3I5BA 1FCAA 3JSRA 2W8LA 1KP6A 4USMA 3CJ2A 2ZJQQ 3GFYA 5DDQC 2IJNA 1O8BA 3MAHA 4CZHA 3EJMA 5A8WA 4BRLA 1RDCA 4YB6A 2GVDB 4ICLA 3AV9A 2XWXA 3J80O 1QHAA 1BIZA 4KIAA 1N5YB 3RSEB 2KFNA 4JYAK 2QT7A 4Q45A 2XMKA 4BR0A 2RAQA 2MB0B 2BW7A 1YHQS 3GFZA 4DJBA 4NZ0A 3OW2R 2GS8A 2W4DA 1X9MA 3LWLA 1NK4A 1Q5YA 5LL6d 4KHNA 3BKFA 2EI5A 3IAYA 1VQMN 3BUZB 1UAXA 3DU6A 4NCGB 1UEVA 5LJWA 3L6QA 1ZBTA 4Q44A 1W7AA 2IAJA 2V7YA 2PBDA 3EWGA 1W97L 2W9BA 4LR8A 2Z57B 2HAIA 1TV6B 4LSZB 2O3DA 1L3VA 1RTHA 5KFRA 3QNNA 2E1YA 4CIEA 4CGIA 4X64K 4Z0UA 3JTOA 1JK9B 4L3KA 5K9FA 1NH8A 1V9OA 4LFAK 3T5HA 2DHGA 2D3O1 2WSEC 4OZJA 2HQCA 3KIOA 1C0TB 3KK2B 1N36K 4BC4A 2HFUA 3I5AA 2DPJA 4BC9A 2DH8A 2VU5A 1M5HA 4CEZA 3LTOA 1GOCA 1QQNA 4BR9A 5B0DA 3THYA 3NH2A 3CCSS 2Q3PA 1GLBG 2DY9A 4JHDA 1FVSA 2CPZA 1CBKA 1HQ2A 3ICLA 1KTQA 1XMOF 5KFTA 2DFHA 2A3ZA 2D0OA 4ECUA 3LDLA 2IVOA 2W7AA 1YHQN 4OZNA 4M42A 1VSMA 1Y4ZB 3CO9A 2CJAA 3VVUA 2GJFA 4PXEA 3W9IA 4ECRA 2W2OP 1NAQA 1O51A 1ZBSA 3CCQN 3MTJA 1HWIA 1NMEB 1BA0A 5T14A 2NSBA 1WC4A 4C2MA 3G4SS 2HF3A 5AZIB 2JZ5A 5THWA 2AZ1A 3UFCX 3MUTP 2VONA 1RCHA 5KFHA 3OR2B 3TPQA 2G1DA 4KGKA 2AYEA 1N56A 2VBZA 4UF4A 1HNVB 4DUTA 3I4HX 1VSIA 5B8HA 4DV1F 1UJ4A 4LF9K 2CQGA 3OTEA 2HNZB 2FY1A 4ER8A 2YV0X 2QXLA 5HRPA 1H3DA 3HKZD 1XUPO 5FD1A 3DYAB 3MMVA 1OWXA 5CHIA 5IWAJ 1WNSA 1HKCA 3VA3A 2MHNA 4O4GB 3M2RB 4K8RA 3NRBA 2FVQA 2G1HA 3MF5A 2UU9J 4ETZA 1HBMA 1W9HA 4JRPA 3UPFA 4FO0A 3PW7A 4FVCA 2R4FA 4FJMA 3QGGA 5BJRA 3CFPA 2PFUA 3Q7CA 5KFUA 1VHXA 1ZAWA 3T1YK 4PKHA 1KRPA 3CCRN 2VOOA 4EYIB 1KNZA 4RLEA 1L3UA 3ZSYA 4C98A 3NS6A 3MAAA 2W7PA 3TX0A 2HBZB 5AQTA 3BGUA 4CI6A 2OPRB 3M2UA 1RDUA 1HWKA 2CIMA 4PRFA 1KQKA 4N5SA 2B43A 2HWHA 1RWVB 1HWJA 2E2PA 1FW6A 1MWQA 3EVOA 2OHDA 1S6OA 3ZNUA 4JYAJ 1UVKA 1UVNA 2KXHA 4TY9A 1FJGK 3HSCA 4HVZA 4YNQA 3N6NA 5DGBA 1VSKA 5J1NA 3E9OA 3IM8A 2AJ2A 3DXKB 2W2PP 4E8UA 2PI5A 4IOCQ 2NUUG 5K8PA 4FXWA 3O44A 2ZH3A 5AQXA 1VQ8S 3GIRA 2CQPA 2YJFA 3V1QA 3TAQA 4C1NK 4ZP9A 4LF8F 3O2IA 1BUPA 3NH0A 2FHOB 2VASA 1HNWK 2W8KA 3NF9A 2CNLB 4R79A 2YHBA 3IGNA 2JWKA 2PA8D 3G71N 2DJWA 4WKRA 4RWXA 5HI7A 1RHMB 3LAMA 1KD1O 5C10A 2XWYA 2G8WA 2F8MA 1HHSA 3DFEA 1YVFA 4CLLA 4ILHA 2Y0SD 2E1MC 3SUNA 1Q86T 1U1KA 5D0RA 2DFFA 3W5ZA 4M5DA 4PXBA 4CRJA 4QU6A 2HB5A 4IFYB 4DHVA 1N34K 2UUBF 5FDLB 3DGPB 4FJXA 3W8PA 3BGLA 1S0OA 3QLHB 1V3RA 2C42A 3FUYA 4K41A 4RKUC 2AEMA 4B3RK 1W2IA 1HNIB 3LDOA 1UVMA 2AJ1A 3S3OA 2V67A 3OYDA 5CQGA 3C65A 4CP5A 3NAHA 3T1HF 1M5KC 2BKOA 2W1BA 3QO9A 3OJUA 3GONA 4FS2A 4RNNA 3GE1A 4LFCJ 5AE1A 2VKZG 1HBOB 3F0NA 1VMBA 1IBKF 2V4RA 4DR1J 3BDPA 4OKKA 4ZDNA 4FJNA 3C66A 2A18A 1KDNA 4J9KA 3PW4A 3CC4N 2FJBB 3LP0B 4OX9F 1NJIT 4FOEA 3JSBA 3OL8A 2AGPA 1UA1A 5AXLA 2YNGA 1GLAG 2ZBPA 2HURA 5CD4H 2DNZA 1N36J 2O66A 1VRUB 3V9SA 3T1HK 1PBUA 2RPIA 1XHXA 2VG6A 4YB5A 4TLRA 1A0OB 3AVJA 2UVUA 2KN4A 4DTSA 4EZ9A 1GMWA 1RA6A 1Q5VA 2X78A 2ZZTA 2KL8A 1KHWA 1JLCA 2CFXA 3K2YA 2EEYA 1K8AT 3UNGC 2Q0UA 4LFCF 1YLXA 4WQ5C 4OHWA 3RMCA 2QL7B 4CH0S 3UE5A 2MQMA 3NNHA 1YG0A 5TKYA 3NLCA 4M3UA 2B5JB 5K14A 2EFPA 2NYIA 4USVA 1TFYA 3BDEA 3PTWA 3SSQA 4CO5A 1TKXB 3KMSA 4CJEA 1HW9A 2ZNYA 2APOA 4OLAA 3RG6A 5SZTA 1UPPA 2H65B 5E84A 2OEKA 1NM2A 1NK9A 1VBKA 1OH8A 5FROA 4YOWA 3P3DA 2D3UA 4C8LA 2F9WA 4O0NA 3I87A 3ILOA 3M30A 2W6KA 1Q16B 2LQ5A 1Q8LA 4L74A 3MMBB 1VQYA 3DGVA 5D15A 2FHKA 3K8WA 3S41A 4JI1K 4BBYA 1NBWA 3AQPA 1N32J 2Q79A 4ILLA 3U3YA 4DSFA 1IBKJ 1OQ3A 4CH7A 2FQQB 4LRAA 1R31A 1VISA 1YJRA 3WX4A 2JDJA 1YSJA 2YH0A 2KVIA 3M8YA 4OJRA 3P5TL 3IS9B 2AHOB 1WNEA 1FRHA 3OYCA 5BR8J 4ZHRB 1RADB 2XHCA 3LDQA 1TKTA 1XMOJ 1KQGB 4WXOA 1NK0A 4P73A 3P31A 3DRPB 3B4MA 2P51A 1D8YA 2EFNA 3KKSA 3VZHA 4DZDA 3IMQJ 1FDBA 1X4FA 3VAHA 4OFZA 3WIVA 5A2QU 3T1AA 3VTIA 5AXMA 4CT9A 2XC9A 5JLFA 2ZF5O 3MPWA 3FZ2A 2O8CA 1AT1B 3CQ8A 5KOXA 3LP3A 3M8SA 3MEGA 1Q1KA 2D1KA 3QFUA 3T1YF 3HT0A 1T05B 3PZPA 5DM7Q 4OQJA 3KLHA 1S0VA 2XMTA 1MWYA 4H03B 3KWGA 4YUDA 5B09A 2N4CA 2C3OA 1WKJA 2O4IA 2M52A 1TUWA 2ZH7A 2Y0BB 1Y7PA 3V6KA 3ISZA 5JMVA 2KTQA 5T7LB 3VQ4A 2MYFA 4L75A 3GSIA 4E3SA 3H90A 3PW2A 1RHKB 4ATNA 4DR2K 3MM6A 2IM0A 3BBCA 3QMLA 3CJ3A 5A2QO 4DV4K 2RQCA 1IH7A 3NHGA 5F41A 4LF4F 3H2LA 2DRAA 3KKRA 4O3QA 3ZC4A 1S1TB 2EX3A 1ZH5A 3ULHA 2IC3A 3RBZA 4X65F 2HQFA 4P2MA 2HG4A 2LCWA 2J0SD 2UXDF 4JKGB 5DM7L 1DLOB 1TVRB 3HP6A 2LA6A 3R5JB 3EXYA 1VJQA 4XAKA 2WOMB 4P75A 1SJ3P 2R7OA 2VG7B 2EK1A 3UW1A 1JNZB 5KG1A 1NJXA 4RU9A 2XCAA 5L39A 3PJXA 4KHMA 4CWBA 2J4RA 4GV3A 3QEPA 3FQLA 3THWA 1IKWB 4HCCA 2HGNA 4JYAF 1PJ6A 3BN4A 3BZQA 5F8IA 4NI2A 4LF4K 4K2JA 3P4IA 4OI0A 2YY3A 4PQUB 4BWJA 4A8SA 3QGPA 5AQMA 2UVVA 5D6GA 2DR7A 3CMAN 3MAAB 3B6OA 3H3NO 1SC4B 5DRKA 3LQVA 2ROPA 4M5JA 4ZTJA 4JI2J 5LMNF 1S9EB 1PILA 3MD1A 4KB7A 4L8RB 5LY3A 3TAEA 5EHHA 4WTYA 1UW4A 4PL7A 2Z2YB 1AROP 5DQHA 5ELZA 4MTPA 1J54A 1QUVA 1FE0A 1K73O 4JI3K 3ZZRA 1WOOA 3A12A 1FESA 4ZTFA 4PWDA 2RB7A 4GKKJ 3D68A 4ED4A 1RDBA 3BN7A 3ZEUB 5IM0B 3HZGA 3M6GA 2MZJA 4RUCA 1U24A 3TQEA 3IDHA 1U45A 4C48A 4DI6A 2ZOMA 4E0DA 3GBTA 2B8QA 3OR2A 4MIBA 4QCLA 3FZLA 1S0NA 2UYTA 3OS1A 1Z1ZA 2O4GA 2HPUA 4NO7A 5GIOA 4DV5J 1MMLA 3QGHA 3AOAA 4ZPBA 3CM5A 1YJ9S 3CI5A 4M5NA 3CCMN 2FLOA 3K5PA 3MMAB 3RW7A 4DPOA 3M8WA 3OTOJ 3L2QA 1WC0A 1RT2A 1XC9A 1TL1A 2P9GA 2J6SA 3WXMB 2DCUB 4QU7A 4X4TA 5I4MA 4CYUA 4ED0A 1R8CA 4QYZK 2IS3A 3O1WA 4TKTA 3MURP 2RU3A 1ZS6A 4DR1F 4GKJJ 2J9DA 1YZ6A 4X4UA 4Z4HA 3CJ9A 3N5FA 3CJCA 2F4VF 1EO1A 4EBCA 4DS4A 2DNGA 3N9UC 5KFQA 3RB3A 4Z4IA 3ATVA 1Z6RA 4ZIVA 3VF2A 1HPZB 3ZSVA 1P8ZA 4CD1A 1R8HA 4OX9J 1HYSB 1S1VA 1RT5A 4UOCA 3QQCD 1X4EA 3WEEB 5CCLA 1X4GA 3GIKA 3UVJA 1OSDA 1F2HA 4NB4A 4WJBA 3MEKA 3TA2A 2YWGA 1X9SA 4OZ0A 2R2TA 3KJVB 2DTJA 1P1LA 3AOCA 5E2QA 3CXCR 3SV3A 4ZPTR 2OTJS 1QQOA 4YY3F 4BE1A 2F9DA 3IBFB 1FK9A 3MR3A 1IJJA 2E4LA 3NS7B 2F8SA 5AQZA 3D2FB 1RWOB 3BGRA 2FYXA 4DSJA 3QIDA 4C11A 1XMOK 2QXFA 4K4XA 2UUCF 4LC9B 4ZITA 2IJRA 2MZQA 3CD7A 1U1LA 3QNWB 3TZWA 1A5XA 4B3RF 4M45A 4H0TB 4FSVA 1JMTA 4HR2A 4FLXA 4LVOP 1IO2A 2JSXA 4ED2A 4HVJA 4I0WA 1WAJA 2IMWP 1NGJA 3N01A 2JX2A 3AA2A 5F8LA 5ETQA 2UVWA 1S6PB 5KG6A 3CDWA 4KAIA 2XRIA 3J7YU 5LMNK 4J90A 4CLYA 1X0FA 3CMEN 4A8WA 4B3OB 4CHQA 3RVCA 4M3ZA 4KHUA 3LALA 3POTA 2AWZA 2OTLN 1YDLA 4YDUA 4B9NA 3R1XA 1P8GA 2QIFA 3ZNJ1 2CGJA 5D8HB 1WOQA 4Z4FA 3TANA 4I67A 2OTLS 2DR5A 4H0OA 1UFKA 1NJWA 2E7WA 2ZH8A 4DX7A 3K0JA 2OO4A 4LT6A 3M8ZA 1TL1B 4P6QA 1Y64A 4IO8A 3FCHA 1ATSA 4GC6A 1TP7A 3OUYB 4FJKA 3ILLA 5D77A 1TUVA 2ITGA 5HROA 2XBPA 2VB6A 4FK4A 1V3ZA 4I6YA 4ECZA 2YWFA 3IRWP 3HJFA 3HD1A 1IKVA 2XLJA 3QAUA 1FD8A 4CZJA 4KI6A 5CZVA 3J7YI 1S22A 4MO5A 2EG2A 2HIQA 2R7VA 1IR0A 1HQEB 2XI2A 3R97A 2W4PA 2VWJA 4JKGA 3UDLA 2GELA 4MKBA 2HVIA 2UP1A 4ELVA 3PKMA 1A9NB 1FFWB 2W9CB 4HLBA 4NYOA 1RGVA 4EP4A 3KUHA 1EKEA 2G2ZA 3SZ2A 1K0VA 1ZC6A 5HRNA 2LFVA 4DUZJ 2F40A 3AJ1A 1E4FT 4OX9K 3RMBA 3I8BA 3AO1A 3UQSA 3THPA 2OANA 2HHHK 1WACA 2GW8A 5HROB 2YHXA 1REVB 4FW1A 3Q2TC 2MTLA 5KOWA 2UV8G 1QAYA 2PZSA 4Z4EA 4DQSA 2HWIA 2FLPA 2D41A 3CCUN 4LSLA 1IN0A 3NCPA 4OHYA 1TAQA 2CG4A 2QW9A 1FKPA 1Q0NA 3PNIA 1ZTWA 2DGVA 2IDEA 1U04A 3D2EA 2QKBA 2L9NA 5H1SV 1T9UA 3SBMA 3QJLA 2CNNB 2VKRA 1EX4A 1PBAA 3U1MA 5KFWA 4DV7K 1R3NA 3AD8C 3LZJA 5AQWA 2EXUA 3ISND 4EIAA 2PA3A 2RMLA 2J7UA 1WORA 2LA4A 4OJHA 2NLWA 2CQBA 4C0BA 4ZP6A 4HDHA 3MECB 1HARA 3R9PA 4PAAA 3BF1A 2ZQBA 4KO0B 2RKIA 4Y0WA 2M2BA 3RR8A 2KLAA 2P2CB 3QZ7A 4DMZA 3CIZA 4OZLA 4IRDA 2Q2RA 2XNRA 4WU2A 4CM0A 1LXNA 5HRSA 4K43A 1ZBIA 2Z4PA 3E3XA 4CT8A 1RTDA 1J5EF 4P2FA 1V4TA 1GTHA 2GUPA 2VC1A 4JHDB 1KCFA 5EDWA 2ZITA 3BEXA 2JLFA 3MM6B 5A6PA 1NGDA 4FJ5A 2K7KA 2IA0A 4OYBA 3CD6N 2W40A 3DRXA 3JXUA 4FM1A 2A42A 3US5A 4YQWA 3C94A 2EW9A 4C8ZA 4KAZA 4KGXB 1KXPA 2CVIA 4WIIA 3VAKA 4W5NA 3HRGA 4DPUA 1KVCA 4I9LA 4CM2A 1FDAA 2IRXA 3C2PA 2V9KA 3ILJA 4K4ZA 1FXXA 3Q22A 4KKOA 3KLIB 1C1BB 2CPDA 5LJ5Y 1B9DA 3IR6B 3KG4A 1DTQB 4JI4K 2CPIA 2HVEA 5AQSA 3QYYA 2RNEA 2B6AA 3H2UB 2Y9HA 2V69A 4MAKA 1UW9A 3ZX2A 2BANB 3ZFVA 3P45B 3HVWA 3I4PA 3CHWA 3AVFA 4JI6F 1XR7A 4KBIA 3NL0A 4LFBK 5AQIA 2ZGZA 4F67A 2HZCA 4HHJA 1C4CA 2DPIA 1RAEB 2DGWA 3BKTA 1KFSA 2GFFA 2J8SA 3ENOA 4LQ3A 1DT9A 5HO4A 3OVAA 3TA0A 5J2QA 1Z25A 1HKGA 5LOQA 1NEEA 3N6MA 1YITS 4YN3B 5GAGI 2EK6A 2WRMA 3NAIA 3PCOB 3TW0A 3TR5A 2FPHX 3SCKE 3U02A 3TSQA 2AX1A 1ZM3A 4DKWA 4MT1A 5LMUK 2GQCA 1RUSA 1S99A 3QEXA 3SDEA 4KHYA 4FJIA 2OEJA 3KZBA 2V4JA 4RW4A 1DTTA 2E5LJ 4DV2K 3JSYA 2QLFB 2FY8A 4LFBJ 2MGZA 2PC6A 3SXLA 1EWRA 4FJ7A 2YNIA 2H9ZA 3ULEB 4B17A 3W8GA 4W92B 4GMJB 2M0GB 3HHLD 1QQMA 2P5VA 1HD0A 5LMNJ 4I68A 1LOTB 2YX4A 4CEDA 2O8DB 3SDEB 1ACMB 1QZ6A 2BJ7A 1LFPA 4PABA 4ETXA 2VQFJ 2BJ1A 3LGMA 4IG0B 2BJ9A 2CPXA 1BHLA 2A2DA 4FN5A 3CMES 4L6V3 2XS5A 4F4AA 2LLZA 4CJTA 1F3VA 3M9NB 2ZBRA 3N5BA 4HHUA 2ZE2B 1BISA 5FPNA 2F8TA 3QEIA 1FD2A 1QTNB 4AL7A 3SUQA 3DNCA 3U4LA 4KJIA 3DHXA 3A8KA 1HA1A 2I9SA 4I2QB 2DITA 2EFOA 4MFBB 1JLBB 3S01A 1HW8A 4JKFA 2F1FA 4UW2A 3CJ7A 2ATQA 4MYUA 4DU1A 4LIWA 1U2RA 2CQIA 1WF2A 3CULA 3A8YA 3R3LA 1RWUA 3TJAA 4W5TA 1JLBA 2BKPA 3FFIB 2QWLA 3HVTA 4NLPA 4DV2F 1HNZK 4E1NA 1X4HA 2HYIB 1XJWB 4J37A 1WDDA 3T7ZA 1F6TA 4ZVGA 3HXMA 2J9EA 2X7IA 1FDNA 5IT9Y 3RGIA 2GWKA 4Z94A 1KVJA 3EGWB 1JL1A 3IN5A 3BB5A 3HSJA 1Q82O 4MK7A 2HVDA 5H1SQ 4BG9A 4OYXA 4F4XA 1CS4B 4J8FA 4DU3A 3LDSA 1N88A 1TK0A 4E7IA 4N8NA 2QK9A 2DHAA 2YX1A 3OL6A 3TJ8A 3B82A 1RT6B 1FKAF 4A48A 1B9FA 4MH8A 2FJXA 2QA4S 2GHPA 4WYLA 3MOZA 1VC0A 2HBKA 2OP5A 4KR0B 5IOLA 4C0OC 1RT3A 4DR6J 2G2YA 3OXLA 2XO6A 2D4WA 3UDEA 3W2WA 3G6YA 1BDGA 1N6QB 3KJFB 3R7SB 1HKAA 1KAZA 3DLBA 2X3DA 1VRUA 4CIGA 4K25A 4CZLA 3LPEA 2E29A 1OJ4A 2FD2A 4FWMA 3B6BA 3KWIA 3HHKA 1VQOS 2P9CA 3J81Y 2NREA 3CC2S 3SI8A 2FZCB 4DL5A 2DNKA 4FVUA 2AV5A 1F9EB 2KVQE 1X4DA 1OQ6A 1VBZA 4BRAA 2Q31A 4WWSA 1OYDA 4IOAL 4JAXA 2PSZA 5A2QY 2YXLA 5GAEI 2KH9A 3CD5A 3UR0A 2NZ4A 4DU7A 2YWKA 3NCRA 2ZGYA 2PY5A 3I0RB 3U27A 3G0ZA 4E7KA 5DDRC 3V6DA 3IG1A 2EKNA 4HUEA 3VAMA 1HR0J 3H5XA 2WVEA 1N8RO 3M9OB 3ZZ0A 5CE3A 2FJEB 3OL7A 2PYLA 3IG1B 3KFWX 3ZSQA 4Z7YA 4CH1A 2FBXA 3ZX3A 5U47A 1Y11A 4I6AA 3CNQP 1QM9A 1P90A 4ED6A 1NMNA 5I3UB 5EX0A 3CCES 4BRCA 4Y2CA 1RT4B 4X62F 1RTDB 3O4QA 5KG5A 5LJVA 1RT1B 4F7VA 2H3GX 3WDOA 4CDIA 2BZ2A 2C3PA 4IKFA 4TQSA 5AQHA 1V5IB 5GADI 3GYXB 3BQ0A 2QGFB 2DCLA 3TUZC 1LAWA 1S7IA 4CJKA 4OGCA 2GIQA 4DV7J 2E5LK 1N54B 2IFXA 4F3TA 3TEHB 3PIPQ 3LDPA 1G2EA 2DEJA 5A6WA 1YBTA 1ZM4A 1NH7A 4RNMA 4DHYA 3PLAA 1WHVA 3TYTA 4QWBA 4M5MA 2K06A 2DIVA 4CFBA 1UKUA 2LXIA 3SCIE 4EUVA 2GIFA 4JI2F 1ZZNA 3HCXA