3KK1A

Hiv-1 reverse transcriptase-dna complex with nuceotide inhibitor gs-9148-diphosphate bound in nucleotide site
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
555
structure length
555
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 148
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk1A05
1C6VA 3HSTB 3JYTB 3KHRA 1IKWA 4DQIA 3H5XA 1LV5A 1HPZA 1RTDB 2HHXA 1ZBHA 1T8EA 4DLEA 2YNIA 4AHCA 1RDDA 5SZTA 1RT3B 4CECA 1JLGA 5KRSA 3H98A 3SUQA 2YKMB 4FLZA 3I0SB 1VSLA 4FJHA 4QOZB 3NHGA 4KHRA 5L9XA 1NHVA 4CFBA 4CK2A 4TYBA 3HVTA 4O3RA 1FKPA 2J6TA 1S9EB 5KFNA 4NLGA 1R0AB 5DGAA 3L3VA 3QEVA 4FZYA 2G8UA 1I6JA 1FK9A 3G6YA 3IS9B 4BDPA 1S1WA 3I5BA 4DSKA 3EZ5A 1T03A 1HNVA 1LWEB 4CGJA 4ED3A 3HYFA 3ZSWA 3TAFA 2RDJA 3RB0A 4ED0A 5I3UB 3H5UA 4WZQA 3P5JA 4FJ8A 1BIZA 3DRSB 5HBMB 1D1UA 3GQCA 2ZD1A 3K58A 2KFNA 5D3GA 3I5AA 2J6UA 3OVNA 4TQSA 3TAGA 3JYTA 2OPPB 3M8QA 1KVBA 2FVQA 1KLMB 3FQLA 3PR5B 2HNZA 3IRXB 3CQ8A 4DSEA 4IFVB 3V81B 5DK5A 4DMNA 1RT6B 3O4QA 3ITHB 1YVUA 3DLEB 3QINA 1XWLA 3MEDB 4OGCA 3AO2A 2RDIA 4O3QA 4ED8A 3OSNA 5L1LA 2I1RA 2ZQBA 4ECZA 1C0MA 2YKMA 3OS2A 4LH5A 2R2SA 2FBVA 3OS0A 4URQU 5FRNA 4FJ7A 5DQGA 3PW2A 4Q44A 2IM2A 1IH7A 4B9MA 4J9MA 3NGZA 3QO9B 2B6AB 1S9EA 3DOLB 4J2BA 1R0AA 4QPXA 4J9NA 2R2TA 1JL1A 3FRZA 4CJVA 4NCGB 4O55A 1RDCA 2FVCA 3IS9A 5KFLA 4RNFA 4CHOA 1BQMB 2HW3A 2R8JA 1LWEA 4ID1A 4H4MB 3N6MA 3QESA 4CEAA 1GX5A 3E01B 2CKWA 1L3SA 4EP4A 4YNQA 5HBMA 3DRRB 2VA2A 2B5JB 1S1TB 1ASUA 3AO3A 2YNGB 3QIOA 1VSEA 1C0UB 4PY5A 3GV5B 3DM2A 4JV0A 4K4UA 1XHXA 5KT2A 4CFCA 2OPPA 4TXSA 4AHTA 1KLMA 3AVGA 4HUEA 3IRXA 5HROA 3V9SA 4IFVA 2D3ZA 1LAWA 4QWEA 2F8TA 3CO9A 3OYGA 3NL0A 3ITHA 3M8SA 3DLEA 2FLPA 4WE1B 4Z4HA 3KLFB 4CIEA 1QE1B 5CZ2A 3QGIA 2IMWP 2W8LA 3GIMA 4EYIB 3CYMA 4OPKA 1QSYA 4B9VA 3QLHB 5FDLB 3OLBA 3AVKA 2JEFA 4KRFA 4W5QA 3TARA 1A5XA 4YR3A 3RB3A 1G15A 4MFBB 2ILZA 1BCMA 3KNAA 4MIBA 4F3OA 5KFYA 3TANA 3SJJA 3PX0A 1BQMA 1LW0B 5JXSA 3G6VA 3K57A 1YT3A 3K59A 3NF9A 1YTUA 4CE9A 1S0NA 4O0JA 4K50A 2R8GA 4FK4A 3E01A 5KGWA 1RAJA 4R5PB 4N41A 1HNIA 3DI6B 1TP7A 3VQ5A 1D8YA 2B5JA 1S1TA 3T1AA 4H54A 2YNGA 3OYAA 4EEYA 3CJ0A 4ZTFA 3LZJA 3OJSA 3SV3A 1C0UA 2VG6B 2ETJA 3AVHA 4C8KA 3KHHA 1RILA 3G86A 3C6TA 3RMBA 4DL3A 1T05B 2BQ3A 1NKBA 3OL6A 3ZSQA 1IKXB 3D28A 2KTQA 1HMVB 3G10A 4FLYA 3LP0A 2HHVA 1ZBLA 4DU1A 4QWBA 4WE1A 5KFGA 2RKIB 1RYRA 3IAYA 4KFBB 4DTJA 2WOMA 4IH5A 1HRHA 3QEIA 1U49A 3SQ2A 2VA3A 4KO0B 2WCXA 3OL9A 3HO1A 1NKCA 3V6DB 1X1PA 5KG4A 2O4GA 2BDPA 3HPOA 4FLWA 4E7JA 3AA5X 2NUBA 2X74A 4CEOA 2YHBA 1SUQB 3OYIA 2QKBA 3QIPA 4BDYA 2HNYB 4OVLA 1FKOB 1NNDA 3KKSA 3CFRA 1TL3A 4HVJA 4N5SA 4E7KA 1RTHA 1U04A 3OYEA 1NKEA 5KG3A 1WNSA 3PW4A 1LWFB 2VG6A 3VQ7A 4RW6B 4J9SA 3AA4A 3QEWA 1NJWA 4FK2A 1JLQB 4GC6A 2XI3A 1RBVA 5HRPA 2W9AA 4WFXA 3MTKA 4G1QA 1RT7B 5KT4A 1HMVA 3ZSXA 1J5OA 2RPIA 4K8XA 2XC9A 2FBYA 1N6QB 2RKIA 3LAKA 2HMIA 1BIUA 4KFBA 3LPTA 2O5DA 3VQCA 3OYDA 1DTQA 5KFIA 3OJUA 1XR5A 2JC1A 3L2WA 3CVKA 1J54A 3CM6A 4KO0A 1CZ9A 4BE2A 4NLRA 1KLNA 2E6MA 4Z0UA 1B9DA 3O4NA 3B6PA 2PYJA 4DTMA 4ED2A 2P1JA 5J2PB 2C2EA 1Z4UA 3IGVA 4ICLA 4RW4B 4RW7A 2FVPA 3MR3A 3M9MB 2DPIA 1ZTWA 1UWBB 1SKRA 5J2QB 1S6PB 3DMJA 1SKWA 4LQ9A 1S10A 1FKOA 1U45A 1QTMA 5SWMA 1U09A 5KFJA 1WSHA 4O44B 2XCAA 4BDZA 1S9FA 3VQAA 1JLFB 1I39A 1LWFA 3I0RA 3DLKA 3UQSA 2JEJA 2XY6A 1CLQA 3L2QA 4RW6A 4WYLA 3M8PB 4WXOA 1JLQA 5DLGA 3Q8PB 2XY5A 2UUWA 1N56A 4H4OB 3MFHA 1BCOA 2ITGA 3RAXA 3RTVA 4YP3A 3GV8B 4FS1A 3ICLA 2DY4A 4CJEA 4ECVA 2C28A 4BE1A 3PO4A 4LH4A 4CF8A 2AQ4A 3VQPA 4GVMA 4OPJA 1S1VB 5J2NA 3AO5A 2I5JA 1NOZA 4GW6A 1NK5A 1ASVA 2GIRA 3LPUA 4ZP9A 4E7HA 4QAGA 3QYYA 1NOYA 1RTIB 2KW4A 4CEEA 3HK2A 3NGYA 4RNOA 4ED7A 5KFPA 3VQ4A 4ID5B 3LWLA 5FRMA 3L2UA 4ZTJA 4M3TA 1BQNB 4ZPBA 1VSFA 4CGHA 4RW4A 4HCCA 4DL4A 4EO8A 1FXXA 1UWBA 4URSA 4ELVA 1TL1B 1X9SA 5I42B 3LP1B 2OZMA 4ZP7A 4PQUB 5KFWA 1JLAB 1S49A 2ZKUA 4UQGA 3TAMA 4FJIA 5KFVA 3SV4A 2FJXA 5KG6A 1C0TA 3EPGA 4Q45A 3Q8QB 2OH2A 3HVRA 4NRTA 3PX4A 2OPRA 4IH6A 4O4GB 1VK0A 4B9SA 4RUAA 5C25A 2JLEA 4XO0A 3RMDA 4KV8B 3M8PA 5J2MA 4IKAA 2HWHA 3RR7A 4H4OA 5JS2A 3P83D 3BSNA 1ZTTA 5DQIA 4O3OA 4IRCA 3H5YA 3KLHA 4CJ5A 4Q0BA 4ZP8A 3LP2A 3ISND 2VG7B 2VG5A 2D0CA 1KVCA 3KK1B 3MR6A 4ECSA 4U7CA 5KFHA 4OGEA 3MF5A 3M8RA 3SYZA 1GX6A 4Z4EA 1J53A 4KHUA 4IQXA 1VRUA 3RMCA 4ECRA 5K14B 4ID5A 3IG1A 4W5TA 1BQNA 3L2VA 2ATQA 4DU3A 3BREA 1C1BB 1SL0A 3KK3A 2WONA 1RBUA 4RG8A 1LAVA 1Q9XA 3AVIA 4N56A 1D0EA 4CGDA 1S1XA 3QEXA 1BL3A 1TL1A 4C8NA 5I42A 5F8LA 3RAQA 4E19A 3MECB 4PQUA 4ECTA 4DS5A 3P1GA 3SPZA 1JLAA 3HHKA 3DLGB 1VSJA 4RW9A 3HKWA 2HVHA 4NLQA 3C6UB 2EC0A 4I9LA 4K4ZA 3L8BA 1REVB 3V1OA 1EKEA 2A1SA 4DQSA 2WTFA 3VQ9A 1A5VA 4MKBA 4AHRA 2W7PA 3EYZA 3PY8A 1TKTB 1JXLA 2DFHA 4EZ9A 1UA0A 2VG7A 1TV6B 1UAXA 3ZT3A 3NBPB 1RT4B 4E0DA 3PW5A 2BRLA 4CK3A 3KLIB 1IO2A 5C24A 3JSMA 2G8HA 5K14A 2W7OA 1IKYB 4NLDA 4R8UA 3THVA 1RA6A 4NLWA 4CERA 4DFKA 4FM2A 2HWIA 1NHUA 1SH2A 5CZ1A 4YQWA 1JLBB 2UVWA 3HVAA 3B6OA 3DLHA 4FLXA 3H08A 2GIQA 5KG2A 5T14A 1IG9A 1JLCB 3I8DA 3DRPB 4ED1A 2E9TA 3QNOA 3QERA 3GIKA 4DL6A 3OYLA 2D7SA 1TKDA 3WNFA 1BI4A 1VSKA 2FJWA 1REVA 4CESA 4FW1A 2Z1GA 5DG8A 3QNNA 5EWFA 4DFPA 2HB5A 4DFJA 1RT5B 1RTDA 2OPSB 4NLOA 4CGIA 4QCLA 5KT7A 2BR0A 1TKTA 1SKSA 4EP5A 3VQDA 1RT3A 2HHUA 1S9GB 3RWUA 5KFFA 3OYCA 4W5OA 4O4RA 2XI2A 3K5MA 2J6SA 1C1AA 1GOAA 4IDKB 3UR0A 2V0NA 4DTOA 2CJQA 3I0SA 4Y1CA 1RDRA 3OYHA 4IG3B 4O3SA 3N6NA 4B08A 3NBPA 4I2PB 5EU7A 1RT4A 3SPYA 2AGOA 4RZRA 2ASJA 1TAUA 2QE5A 4KE5A 2P51A 4QWCA 1EX4A 4OJRA 4NLYA 4LSLB 4YMEA 2FVSA 3UDLA 2KQ2A 4KREA 4QW8A 3V6JA 3NE6A 5KI6A 1W25A 4FBTA 3DLBA 1JLCA 4I9QA 5I3UA 3DRPA 3DRSA 3TAEA 2ALZA 4QWDA 3H40A 1ZYQA 3L3UA 4FXDA 2XO7A 4IBNA 4K4XA 4BWJA 4MK8A 2E6LA 4B9TA 2IC3B 2HHWA 4CHNA 5KFEA 4DL5A 3ZT2A 3ISNC 3KLEB 4M3YA 2GC8A 3HL8A 2IM0A 4ECXA 3CFOA 1TK5A 2F8EX 1RT5A 4FM1A 2C2DA 2A1RA 4J2DA 2GBZA 3V81A 1SH3A 1RT6A 4ZVFA 2IBKA 4DSFA 1EXQA 4WFZA 1TK8A 1Z26A 3HT3A 3KHLA 1TKXB 1S9GA 4KI4A 3MEDA 4IH7A 4F8RA 1C1CB 3DYAB 5L1IA 3MAQA 1OS5A 3LAMA 5DG7A 4FJKA 4CEZA 3HVWA 5F8JA 3BQ0A 2OYQA 3T3FA 1S4FA 3BSCA 1QUVA 5EDWA 3QZ7A 3T5JA 3QO9A 2B6AA 1X9MA 4Y34A 3DOLA 1Q9YA 4B3OB 4L8RB 1S0OA 1HQEB 3ZSVA 3MEEB 3ZT1A 2UVVA 4LSLA 4NCGA 4WYWA 4K4SA 3H59A 4RUCA 5HP1B 3CWJA 3F9KA 4C8MA 2OA8A 5F8GA 3NH1A 1TKZB 4H4MA 4EBCA 3OL8A 4HUFA 1XHZA 2ASDA 2Z1IA 4ELTA 4NLUA 2XGQA 5CYQB 3DRRA 4Z4CA 3LDSA 2OZSA 3TAPA 3OHAA 2IC3A 4DSJA 1W0HA 4M41A 3PHEA 1QHTA 2C2RA 5EUHA 3CJ2A 3KMSA 1UA1A 1DLOB 2E9RX 4DL7A 1I3AA 3KLFA 5C5JA 1C1CA 4LY7A 2JC0A 4Y2AA 3DYAA 1QE1A 1TK0A 3KLGB 1NK9A 4PUOB 3K5OA 1MMLA 4NLPA 2G8IA 1KHVA 3LANA 2YKNB 3QLHA 5FDLA 4M94A 1JXBA 4NCBA 4HTUA 1EP4B 4XIUA 3HXMA 4MFBA 3V6KA 4KTZA 3SI6A 4FYDA 4AILC 3T19A 3SFUA 3AO1A 2FLLA 2W9CB 3E51A 4OKJA 2AWZA 5HP1A 1KHWA 3PR4A 1LW0A 3CJ3A 1VSHA 4Z4IA 1TKZA 3BGRB 4IRDA 1YTAA 2IAJB 3NDKA 4KSEB 4R5PA 3DI6A 3PO5A 3S3MA 5CYQA 1NK8A 2GV9A 1UOCA 2D0BA 3BSOA 4CJQA 3T5KA 4FZZA 4M45A 3AVAA 3C95A 2G8KA 4RNNA 3RMAA 3V4IB 1T05A 1IM4A 1HARA 1IKXA 4EYHB 4DF8A 4Y3CA 1YVFA 4AHVA 4NLVA 2BE2B 4FJJA 3QZ8A 5KFKA 3WNEA 1D5AA 1GOCA 4F4ZA 2IS3A 3AVLA 2RF2B 3KLGA 4IR1A 1HQUB 4PUOA 4NZ0A 3MXIA 3NAIA 2HHTA 3SUPA 1N5YB 1ASWA 2YKNA 3V6DA 4F4WA 1RDAA 3NH2A 5EWEA 2DFEA 1ZBFA 2O4IA 3RRGA 2V9WA 2BRKA 2AGPA 4ZPAA 1QSLA 1NJYA 3KIOA 4DTUA 1SUQA 1CSJA 3TR8A 2QK9A 3CIZA 2IJFA 4CIFA 4FLTA 4ECWA 2W8KA 1A5WA 4F4XA 3AVMA 2HNYA 4QWAA 2XGPA 4KHNA 3V9UA 4HKQA 3QGGA 4B9NA 1WAJA 2BANB 1WSIA 2EHGA 3V6HA 3U6FA 3TWHA 1WSGA 3OYJA 5KRTA 1U47A 3UIQA 5HLFB 4I7FB 1X9WA 4CJKA 3G0ZA 4TQRA 5C42B 4LQ3A 3HJFA 4BACA 1Y97A 3ZT4A 3PW7A 1LWCB 1NJXA 1HYSB 5KFDA 1VRTB 3G6XA 3SFGA 3ZT0A 3NH0A 3OYFA 3VQ6A 3TAQA 3Q8RB 1TAQA 1EETB 1RT7A 2HNDB 2VWJA 3RBEA 4EO6A 4TYAA 4CEBA 3CFPA 4DQPA 1XI1A 1BISA 3AA3A 4N76A 3KLVA 4B8AB 1N6QA 3PX6A 1HYVA 2RF2A 1HQUA 1RTJB 3KK2B 2G8WA 1WSFA 2IM3A 3VQSA 4IR9A 1SV5B 1JX4A 4J2EA 4JV2A 5CYMB 1QSSA 3HM9A 3SNNA 1BGXT 5J2PA 4FW2A 4M42A 1NK0A 3S3OA 4CEDA 4KHSA 1KCFA 3OYMA 4E7IA 5KFSA 3SUOA 1IKVB 5J2QA 4JV1A 1S6PA 4LD0A 4CFDA 1KVAA 3OHBA 3CJ5A 2OPQB 3CDEA 2BANA 3RB6A 2W9BB 2BQRA 4CF1A 4HCBA 4KKOB 4B9UA 3C94A 4RU9A 5HLFA 3FFIB 4I7FA 2FC0A 4O44A 1S1UB 2IGIA 4M3WA 1DTTB 5F8MA 5KG7A 1JLFA 4M95A 5EWGA 3CG7A 3VQ8A 3FDSA 3NCIA 3BDPA 4WXWA 3EZUA 4FLVA 3VA0A 1VRTA 4DLGA 2BGGA 4TN2A 3S9HA 2W42A 3KJVB 2HNDA 4DTSA 2P5OA 1N4LA 3U3YA 5E41A 1TQLA 4OKEA 4R0EA 1IKWB 3Q8SB 1S1VA 3QEPA 4ED6A 2AX0A 1HPZB 2DTUA 3KK2A 3SI8A 2QXFA 1U4BA 5KG1A 4M3ZA 2YNIB 1NK6A 1SV5A 4CFAA 1S97A 5CYMA 4RNMA 4KHQA 2ATLA 2V4QA 4Z4FA 2WHOA 2LSNA 1RTIA 4ZP6A 4F4YA 3AVBA 4C8OA 3A2FA 2IM1A 4X2BA 3OYNA 4DFMA 4JRQA 1CXUA 3QIDA 4KAZA 2KZZA 1JLGB 5F9NA 3EPIA 3HP6A 4H8KA 1RBRA 2IJNA 3CDUA 1IKVA 5KT6A 4ZVGA 3LP1A 4TLRA 2OPQA 3HVTB 1FKPB 2D5RA 4CJ4A 2PZSA 2W9BA 3NGDA 2XRIA 1XC9A 4DSIA 1RT1B 4K4WA 4FZXC 3NKYA 1S0MA 4FJNA 4KHMA 3K2PA 1S1UA 5KFUA 4Q8FA 5KG0A 3PVXA 3MXJA 4O4GA 2RN2A 2Z1JA 3M9NB 3TQ1A 4ECUA 4KV8A 1J9AA 2R8HA 1RBTA 3MXMA 4CJSA 4CEFA 4E1MA 2ZD1B 1S5JA 4N47A 2D0AA 3TVKA 2ZE2B 3KJVA 5D3GB 4DEZA 4IRKA 1NJZA 3PW0A 1N48A 4J9KA 3I5CA 3M8QB 3QGHA 4CHQA 5KFCA 3BJYA 3PUFA 3KK1A 2HNZB 4O3NA 3RBDA 2QKKA 4F2SA 4YR0A 3MR2A 1JL2A 4KB0A 3H4BA 1B92A 1TGOA 5HRNA 1KTQA 1WAFA 1NK4A 2R8KA 2P5GA 1C1BA 2FJVA 4FJ5A 2KFZA 3OS1A 4KI6A 3CJ4A 3FSIA 1BHLA 3MECA 4ZHRB 4KB1A 4OLBA 4IKFA 4K4TA 4I2QB 5KG5A 4YR2A 2YV0X 3DLGA 1RT2B 4YFUA 4FBUA 1RT1A 4F4KA 3AO4A 3D0PA 4C8LA 3O3FA 3KKRA 4DU4A 4MIAA 3KOAA 4K4YA 3C6UA 3HPHA 1QS4A 5HRRA 5J1EB 2PYLA 2VWKA 1ZBIA 4OL8A 5L1JA 3S3NA 4LSNB 5KFXA 5KGXA 4FJLA 1S6QB 3V9XA 3VQBA 1VSMA 3LZIA 4QW9A 3RR8A 1JIHA 2ZE2A 2R7YA 2XY8A 3VA3A 3DM2B 3ALYA 2WK4A 1K1SA 3DOKB 4NLTA 4ZPDA 3AVJA 1KFDA 1TV6A 5HROB 4CJWA 5F8NA 2IOCA 1L3TA 4PWDB 5CY4A 3KLIA 1WSEA 4IOBA 2YNHB 5KFTA 1IKYA 1O1WA 4DS4A 4DSLA 3PV8A 1NK7A 4IFYB 2XWYA 4Z4GA 4NCAA 3SCXA 2R2RA 1KFSA 1JLBA 4CCHA 3V1QA 4ZHRA 1JKHB 1Z25A 4I2QA 3NAHA 3V9WA 1RT2A 3SQ0A 4J9OA 2DPJA 2G8VA 1RDBA 5F8HA 4CGFA 4OLAA 5J1EA 4DL2A 3H2LA 4ECQA 4W5NA 4LSNA 1HNIB 2B4JA 2OPSA 1S6QA 3KHGA 1HYZA 4J9QA 3M9OB 3PJXA 4CJ3A 4U6PA 3VN5A 4CJFA 4HUGA 4CJLA 1WNEA 3H5SA 3DOKA 4IDKA 5FROA 3EY1A 3C6TB 4MK7A 3D5MA 4F50A 2B43A 4KHWA 3SUNA 4ZPCA 4IG3A 1RNHA 4KPYA 1L5UA 4I2PA 3NFAA 4PWDA 4DTNA 3LP0B 3WNGA 2YNHA 3K5LA 2AX1A 2AGQA 3LWMA 5DG9A 2UVUA 2WOMB 4JS4A 4F2RA 1XR7A 4IFYA 4FS2A 3GV7B 4DTXA 3O3HA 4NYNA 5KFRA 2AU0A 3O3GA 4O5BA 2DFFA 4JLHA 1JKHA 4XPCA 2AJQA 2BQUA 4AHUA 1D9FA 4J2AA 4WZMA 3AVFA 1C2PA 3WNHA 2F96A 3QIPB 3HP9A 2HHQA 4URGA 3OLAA 3SQ1A 2C22A 1JXEA 3KLEA 1TL3B 4HYKA 4DTRA 1RTHB 4F3TA 3TI0A 4RNHA 2V4RA 3GYNA 2QV6A 2IDOA 3ZSZA 5F9LA 4DWIA 1TKXA 3D45A 3RRHA 4G3IA 4JRPA 1Q8IA 1MU2B 2KZMA 4IG0B 4KHYA 3CM5A 5T7BA 1WSJA 4Y2CA 2UVRA 3AV9A 3LP3A 4NYFA 1ITGA 4M3UA 3CDWA 1W9HA 4G1QB 3N6LA 2D41A 4ZVHA 4M3RA 2FBTA 1J5OB 4CIGA 2HAIA 4RW8B 4B3OA 4CJUA 2YHAA 2HMIB 1HQEA 3MEEA 2JEGA 1DTQB 5KT5A 1B9FA 4CJTA 4J9PA 5KTQA 2D3UA 2IA6A 4ICLB 2WRMA 4RW7B 4XPEA 4TSXA 1TVRB 2Y1IA 4K8ZA 3AA2A 3QETA 3ASMA 3BSAA 1SL2A 4KTQA 3DMJB 4NYZA 3K5NA 1QAJA 3MR5A 4O3PA 4MKAA 3MFIA 3IGNA 4EBDA 3HPGA 1HJRA 1VSDA 1RA7A 2Y1JA 4FJGA 2FBXA 3KD1E 3IN5A 1DLOA 3DLKB 3I0RB 4CK1A 4PA1A 4E3SA 1MU2A 4IG0A 2E9ZA 2R2UA 3NAEA 4CF9A 4BWMA 3GILA 4J9RA 5KFZA 4NLXA 1EP4A 1T3NA 4RW8A 1L3UA 2G8FA 3NGIA 1QQCA 4CEQA 1CZBA 5J2NB 2I5JB 3KD5E 4FM0A 4ELUA 3VQQA 2W9CA 3ZCMA 1ZETA 1RCHA 4J9LA 3AVNA 4DF4A 4JS5A 1L3VA 1CXQA 3BGRA 5JUMA 3V9ZA 2IAJA 2JEIA 4Q8EA 4ZVEA 3RB4A 3MEGB 3DLRA 2XHBA 3AVCA 1TVRA 1U48A 4DTPA 3BQ2A 3U3GA 1KSPA 4CHZA 3FQKA 3UPFA 4CHPA 4EZ6A 2WB4A 4KB7A 4E1NA 3T5LA 4TY8B 1VSIA 2F8SA 3OSPA 3ZSYA 1K1QA 3TAMB 3V4IA 4TY9A 3DDKA 4NLSA 1C0TB 3KTQA 2UUTA 1T94A 1D9DA 2HHSA 4B9LA 2OPRB 4B8CA 2BE2A 5C25B 2ASLA 4MQ3A 1S48A 3OYBA 3VQEA 3SQ4A 5J2MB 5KFMA 4EBEA 5HRSA 1K6YA 1N5YA 3GIIA 4E89A 3KLHB 4E7LA 2FLNA 4Q5VA 2X6NA 4Q0BB 4JUZA 3LALA 3LP2B 4BE0A 1JLEB 2VG5B 4KTWA 1WLJA 3BQ1A 3ZSRA 1QAIA 4KAIA 2R8IA 2ILYA 2EX3A 2YNFB 1RYSA 1VRUB 2Z1HA 3IG1B 5F8IA 4DQQA 1RBSA 1LW2B 4FCYA 3L2RA 2FVRA 3MEGA 3KK3B 2WONB 4FLUA 4MH8A 4WFYA 4NRUA 4MK9A 1S1XB 4Y1DA 5C42A 2Q3SA 5DLFA 4AHSA 5L1KA 4Q43A 4TY8A 5DGBA 5KFOA 4CGGA 1LWCA 4OKKA 3NMAA 4RW9B 4KBIA 1HYSA 4CHYA 4DG1B 4FJ9A 2HVIA 4CJPA 4FK0A 1EETA 5KFAA 2XCPA 1SL1A 1WN7A 4AH9A 2PY5A 3PZPA 1RTJA 3NF7A 3ULDA 3PJWA 3OYKA 1KRPA 3ZSOA 2X78A 2JGUA 4FVMA 3SZ2A 3TABA 4CF0A 1JLEA 4ECYA 4FJMA 3NF6A 3V1RA 1GOBA 2XY7A 4K4VA 2E4LA 3BR9A 5KFQA 1XR6A 4DQRA 2YNFA 5C24B 3H4DA 5DMRA 5KFBA 3JSMB 4O0IA 4GMJB 4KKOA 1T7PA 1SH0A 1LW2A 3KMQA 4R8UB 4CF2A 5JS1A 3FFIA 1FK9B 1S1WB 1DTTA 1T03B 5KT3A 1HNVB 3OL7A 3NF8A 4W5RA 4GC7A 3F73A 1ZBUA 1F21A 5DQHA 4CJRA 3GIJA 4DG1A 2X6SA 4M3XA 4HHTA 3OY9A 2GUIA 1BI4B 4FJXA 3T5HA 4ZMMA
chains in the Genus database with same CATH superfamily
1C6VA 3TUIC 1BD6A 4WU2A 1NG9A 5JVGQ 5A8WA 2UXBF 1LOUA 4YUDA 1T8EA 4AHCA 4CLKA 3HHLB 3GFHA 2AJFE 4PEOA 2AEJA 2YWGA 1VQMN 2AYMA 1JLGA 3H98A 3SUQA 1OH7A 2YKMB 1Y9OA 1VSLA 4QOZB 4CW7B 1NHVA 4WK3A 4CK2A 2NRZA 2GAHC 1FKPA 5GINA 2VB6A 2F5GA 3NS7B 2RILA 2FHJD 4DZ6A 3QEVA 4FZYA 2G8UA 3JAMY 2E44A 3BZKA 3EZ5A 1T03A 3QT6A 4ED3A 2B9YA 4CO2A 3RB0A 5I3UB 3P5JA 5BR9A 4PWUA 1JNZB 1D1UA 4BRFA 4H0XB 2KFNA 3K58A 1T6DA 2EKYA 1S76D 3I5AA 5D0GA 4OI2A 2QWQA 3TX0A 3VF4A 4JB8B 3J80Y 5LSLA 3FE1A 3FQLA 2X1FA 4IFVB 5DK5A 1SC6A 4B3RF 4DMNA 3ITHB 1YVUA 3HSCA 2O8DA 3TJAA 1YBTA 4I6YA 2K1RB 2RDIA 4O3QA 2HG4A 4OX8A 4ED8A 2OANA 4EFAC 2ZDPA 2MQMA 2IVPA 4LH5A 2W4CA 5A2QO 2HZAA 3O44A 3R2CJ 5FRNA 2FSJA 5DQGA 1VQKN 2IM2A 1UL3A 3NGZA 2O8CA 3U02A 2MGZA 1UPMB 3MI7X 4AXIA 3ZETB 4QPXA 4J9NA 4EAHD 2R2TA 5L38A 3QWUA 3UDCA 3HSZA 1B99A 5AZJB 5KFLA 4RNFA 2R7WA 4M5MA 1BQMB 2HW3A 1XEZA 2C2ZB 4FPIA 2GV1A 4V19J 3S6EA 1ATNA 2AT1B 4YNQA 5AQIA 3AO3A 3QIOA 2ZHAA 4CZKA 1C0UB 4KH1B 1XHXA 5KT2A 5A6WA 2OPPA 3FZLA 4AHTA 3JS9A 2FDNA 3AVGA 1GT8A 5LL6d 5BPMA 2VASA 2HBQB 3C8YA 3CO9A 5M1QA 3OYGA 4LF6K 4V19X 5C10A 4AM7A 2UZAA 2RJZA 2QMUB 3BV8A 5F0UA 4QU7A 2GFFA 5GAHI 4OPKA 1B70B 4BHQA 5AQKA 4CLTA 1Y5IB 3GP9A 3AVKA 4BVOA 1A5XA 3PKMA 1G15A 5JVGL 2ILZA 1OY9A 2B4OA 3C2PA 3UI3A 3MPUB 5FD1A 3BKUA 4OV1A 2CDQA 3G6VA 4H5WA 1PIEA 1VHIA 3K59A 3NF9A 4O0JA 2R8GA 3M4XA 3T6BA 1RAJA 3DI6B 1TP7A 2QWRA 2RS8A 4K5SA 4M5HA 4ZTFA 4UOHA 1YXQA 2VG6B 2ETJA 4JI1K 2DPNA 4P71A 5HL7Q 3PRBA 3DDNA 3L7OA 2KU7A 1T05B 1CJKA 1NKBA 4ZPVR 4DV0K 3M3ZA 5IM0A 1CZAN 2HFVA 3D28A 2K06A 2KTQA 2XULA 4MKYA 1MWMA 2I38A 3SCJE 1G3OA 4DU1A 2XZWA 4U67Q 3CEDA 3B4DA 4YY3F 5KFGA 2RKIB 3W0LA 4DTJA 4MDAA 1U49A 2SXLA 4OZ1A 2JRSA 3HO1A 1H2TZ 3KG1A 1Y3JA 3HPOA 3N4QA 3AA5X 4DXLA 2NUBA 5GAHU 4DR5J 2BJ9A 3OYIA 4K59A 2Z57B 2I9SA 4KH5A 4GV6A 2HNYB 3MMBB 2DBBA 3VVUA 4DMZA 2FXUA 1NNDA 1HI1A 3MM8B 3CFRA 2NRVA 3MN9A 1KONA 3BPSP 1NLVA 3RW6A 4DPYA 1RAIB 2YCHA 2HK2A 1T9TA 2AJ1A 4DR4J 5MAOA 4J9SA 3K0JA 4FK2A 1JLQB 2ZNYA 3D1HA 4GC6A 2XI3A 5HRPA 4DV2J 1PC4A 4X4RA 2JFKA 2OEMA 3PEHA 1GXLA 2MY7A 5ETVA 2RQCA 4OYMA 2ZWPA 1RLDA 4BLGA 4U7BA 1N6QB 2CQGA 3TSQA 2G13A 4KFBA 4DR2F 1QVFM 4LR9A 2O5DA 3OYDA 1DTQA 2ZUGA 3W3SA 4P2FA 3ZNUA 1YX2A 5JMNA 1CZ9A 1KLNA 2E6MA 1WEXA 5MLCQ 5LY3A 4DTMA 5J2PB 1FFWB 1Z4UA 3J7AN 2PC6A 2QA4S 4ICLA 3PSIA 3W8GA 3DXSX 3M9MB 2DPIA 2CPFA 2EFPA 1U24A 1SKWA 1IUJA 5L39A 4LQ9A 1SBRA 4DV7F 3IKMA 3KG4A 5CD4H 1LK7A 1ICEB 1M5SA 1ZPWX 2Q79A 6AT1B 1T11A 3TX8A 1NSKL 5ETLA 2ZJRQ 4ERDA 1LWFA 4X66K 3DLKA 5K5MA 1CLQA 2VBWA 3NY0A 3MMVA 2OELA 3Q8PB 2GNKA 1HNWF 3MCOA 1AUSL 3MM9A 3MFHA 5I9EB 1N33K 2ADBA 1MNEA 5ELZA 3GV8B 3VAFA 4KJIA 5AQYA 2UU9F 5CXTA 3PYGA 4CJEA 1EZZB 3PO4A 2AQ4A 3VQPA 3CMEN 2NXEA 1S1VB 2OFGX 4JI1J 3D7EO 1RB0A 4HH1A 1ASVA 3EKSA 2PA3A 4Y0WA 2KJWA 1NOYA 4KH6A 3HK2A 3NGYA 5HL7L 1W26A 4JI7J 1YZ6A 4X4UA 3W2WB 4M3TA 1VSFA 4CGHA 4DL4A 5EOYA 2GVDA 1VAZA 1N34F 3AXMA 1UWBA 1NGFA 3AY9A 5I42B 3LP1B 3R6MA 5DDQC 3OV7A 4PQUB 4B1VA 4B3MK 2FZKB 4BC5A 1S49A 3IUCA 2DCLA 3O8WA 3CC7N 4CT9A 2VGNA 4N77A 3VZHA 3Q8QB 2OH2A 1X4CA 4HI2A 4OJ1A 3W60A 4B9SA 5C25A 5FPMA 4AL6A 4XO0A 3C15A 5J2MA 4IKAA 2AEMA 2CJYB 2LFVA 4H4OA 2QWNA 2PSZA 5JS2A 2K7KA 3OA9A 1ZTTA 3RZAA 5DQIA 4LREA 5U47A 4XEIA 1VCTA 4CJ5A 4HTLA 4LF1A 4ZP8A 4DU8A 1U7LA 1Y64A 2D0CA 1KVCA 3MR6A 1FA0A 4TU8A 2MJUA 3AOBA 1J53A 2DO4A 5EHHA 4IQXA 4ECRA 2UV8G 1PCAA 4P9SA 2VQFK 4BRKA 3ZTOA 4ES2A 4OX9J 1X31C 1CBKA 4IUFA 1UVLA 2OEKA 3NG8A 3W65A 1FRXA 4NMXA 1TUVA 3QEXA 4C8NA 3RAQA 4E19A 3P1GA 3SPZA 3HHKA 3HKWA 4NLQA 3OTOF 4DCJB 3JAMO 2MSTA 4CT8A 5IC4B 3VETA 1REVB 1RJJA 3CCQS 2FGCA 4DQSA 1XMOJ 1FJGF 3VQ9A 1A5VA 2POKA 3EWGA 3W2VB 4QJVA 4A8OA 3VENA 4EZ9A 4A8FA 3SAFA 3KZBA 3IFEA 3M2UA 2O8FA 2C3YA 5LT5A 3KYLA 1QTNB 3T1YK 3ZT3A 1RT4B 1N33J 2ZJRL 3WXKA 5AQSA 3KLIB 1AUDA 1IO2A 1N5SA 3M7VA 5K14A 2W7OA 1RAAB 4NLDA 2HOEA 3CDAA 1RA6A 3THVA 1YLXA 3KWGA 3NNHA 5CZ1A 2QLWA 3R97A 3WEEA 3H08A 2GIQA 2MQLA 2E5HA 2VGMA 2R7QA 3OFEA 2XBPA 2MTLA 3QERA 2DB1A 4QBUA 1H3DA 5T41A 3OYLA 1O5JA 4LF5F 1BI4A 3WNFA 4LF9K 2HLTA 1VBXA 2KH9A 1MROB 4KHPJ 5M1OA 5EWFA 2HB5A 3IP0A 4WKYA 1TFYA 2OPSB 4NLOA 3O9UA 5LMUF 3MCPA 2A2CA 5KT7A 2BR0A 4OX7A 4CLWA 4EP5A 3LDNA 3VQDA 1RT3A 5LSRA 2P9SA 3MMCB 3OYCA 3I56S 1IWGA 4W5OA 4O4RA 2XI2A 3K5MA 1WB9A 1GOAA 1QDUB 4IDKB 3UR0A 2V0NA 2KO1A 4C3MA 4Y1CA 1RDRA 3MOJB 4B08A 4O3SA 2EFNA 3SPYA 1TAUA 1OH6A 3CCZA 2PN6A 4KE5A 4QWCA 2QWLA 1W2IA 2ZBIA 2Q0RA 4ITSA 4CO1A 3KDNA 4LF2A 2MZ1A 2GGPB 4H03B 3HHLC 3KUHA 3TSPA 2A40A 5GAHP 1KVJA 4DPOA 2BXJA 2UXDK 3DGVA 1JLCA 3KUEA 3DU5A 1WOQA 1FNXH 5H9EJ 3CQXA 4FF4A 3TAEA 2DNHA 2ALZA 3H40A 2LEPA 3L3UA 2V4JA 2YWFA 4BWJA 3LO3A 4CHNA 2R7SA 3ZT2A 3ISNC 4OO1J 1UVIA 2KYXA 3HL8A 2IM0A 1WORA 2VU5A 3CFOA 1RT5A 4R0JA 4J2DA 2XYPB 3V81A 3SQGB 5EGYA 4ZVFA 2IBKA 2ZOFA 1VQ5S 1Z26A 3KHLA 1S9GA 3THYB 4WTOB 2OUGA 2ZGYA 5L1IA 3MAQA 3LAMA 4CYUB 1A9NB 2R7UA 3BF3A 1SIZA 4JI0J 2Q66A 5F8JA 2DEJA 2VFRA 1EKSA 3MPDA 1HKBA 1U0HB 2OSRA 1Q9YA 2B8QA 3ENOA 4L8RB 2J7WA 2HRTA 1HQEB 1RAOA 3FBCA 4JI5J 3ZT1A 4LT6A 1HD1A 4NCGA 1XBWA 4WYWA 4DUZJ 4RUCA 5HP1B 2B4UA 4QR1A 2MPUA 3NH1A 4H4MA 4EBCA 2VPWB 2CQ4A 2J5AA 1FKAF 2FHJA 4FF3A 2XGQA 3A3NB 3UO0A 5CYQB 1HHQA 3DRRA 3UDVA 1RAGB 4Z4CA 3LDSA 1DHMA 4BRCA 2IC3A 4DSJA 1YTYA 4JAXA 3GJTB 2E5IA 2RDDA 1RLCL 1VBKA 1C4AA 5AJ3K 3NMRA 3CJ2A 3ZYYX 1HWUA 5K20B 2QG9B 5C5JA 1JJHA 4GO7X 4Y2AA 3DYAA 3KLGB 1NK9A 2QTDA 2LP4A 1ZOTA 3LANA 4PWWA 4DR3K 1BWEA 4HTUA 4XIUA 1QAYA 5FPEA 4MJKA 3HXMA 4MFBA 1N32K 2RT3A 4OX6A 4FYDA 4DJBA 4PZVA 5HATA 2M2BA 2W9CB 2AWZA 1FI4A 2P9KA 1GMVA 1O0PA 3R8YA 3NDKA 4R5PA 4CH7A 3TTFA 5DJBA 2C3OA 3S3MA 4DR7K 4A8QA 3AHPA 2F9TA 4NLCA 3M2VB 4CJQA 3EMTA 3AVAA 3C95A 3EUNA 2G8KA 3GE9A 2QWMA 2V7YA 3QT8A 2MZRA 3RMAA 3V4IB 2UXDJ 3THPA 1HARA 4NI2A 1IKXA 1FRIA 3V2UC 4Y3CA 1DZ5A 4AHVA 5KFKA 3CCWA 1KAZA 4LF6F 3AVLA 3GYGA 2PEBA 1B4SA 4MYUA 1Y3KA 4PUOA 3S8SA 4LFAJ 1YI2S 1AYEA 1HA1A 3NH2A 3I33A 1ZBFA 2VFTA 1UJ4A 3QJLA 4EK2A 4ZPAA 3TR8A 2AIRB 4FLTA 3UR3C 2LQBA 2W8KA 4QWAA 2XGPA 1K44A 5IT9Y 4B9NA 2QX0A 1WAJA 2BANB 3FZ2A 4WP8A 2H4WB 4M5LA 5KPTA 5HMYA 3QFPA 3K9JA 3L4BC 1U47A 5IFMA 4P2SA 2KHDA 2ASOA 3IWLA 2DGOA 4LQ3A 4CI6A 3EVMA 2VF3A 3HI9A 3QJJA 3D7SB 4UOGA 2IDEA 3RRKA 4JI4K 5KFDA 1X4HA 3SFGA 3ZT0A 3E9PA 4DV0F 3AA3A 4N76A 3C14A 4B8AB 2DHXA 3PX6A 2UUBJ 2FHMA 2FYXA 2RF2A 2BM0A 1HQUA 2G8WA 3NWGA 1KQKA 2IM3A 1YVNA 3AXKA 1KD1T 1SV5B 3P39A 5D4NA 1RABB 4PXBA 4FW2A 2D3O1 2K2PA 1KCFA 4K0KJ 4E7IA 3SUOA 1S6PA 3OHBA 2HAFA 1RWKB 1KD1O 2H3GX 1VIOA 5CYJA 1YG0A 4B9UA 4RU9A 1UEVA 3FFIB 1BA0A 4O44A 4FWPA 1EQMA 4M3WA 5KG7A 1JLFA 5EWGA 3J7AP 3VQ8A 2YX1A 7FD1A 1B7FA 4WTYA 1FHTA 2H65B 1RWNB 1OQ6A 3R27A 3Q0AA 1WC1A 2NYHA 2GJFA 4YB7A 3P5TL 5FPDA 1VRTA 1NU0A 3NLCA 4HR2A 4TN2A 4LF7K 1F3VA 2GAGC 2C3UA 2IFXA 2OJ3A 3SK3A 2Z56B 4AXJA 4R0EA 3I55S 4WCEQ 2AX0A 2RHKA 2DTUA 1U1KA 4FWOA 5HOOA 3NGKA 3L7PA 5CYMA 2OMLA 1YIJS 4H0PA 4KHQA 4Z4FA 2WHOA 4ZP6A 4F4YA 3AVBA 3HZGA 2IM1A 2CWXA 3ZZOA 4JRQA 3G4SS 3CO0P 4DV5K 1Q16B 5F9NA 1JLGB 3W7BA 2IJNA 4OZJA 2DNQA 5KT6A 2CG4A 2N4CA 4UY8T 1FKPB 2D5RA 4M5GA 4XH4A 2YVSA 4DSIA 3TU5A 1RT1B 4CZEA 3GSDA 5CZXA 4FJNA 3CCVS 4KHMA 3K2PA 1S1UA 4FP9A 4DZDA 2G0CA 3MXJA 2RN2A 4EI2A 5BN8A 3IM8A 2YPZA 4KV8A 4K43A 2R8HA 1RBTA 1N36J 2YKQA 4X66F 4UY8O 3FZMA 1DFDA 4CEFA 1PYTA 4CQ1A 1S12A 4N47A 2D0AA 3TVKA 4CI0B 3AD9C 3C7NB 4J9KA 2IJRA 2RS2A 3HMJG 2FPHX 1VQ4N 4FPBA 3PUFA 2ROPA 2VZ9A 5K8MA 4WF9L 3IA0A 3IM9A 3JQMA 4D3HA 1X4AA 2O8DB 4KB0A 3R9PA 3AAQA 3OR2B 1KAYA 3DRYA 1Q4RA 1U1PA 4KI6A 1YJUA 3MUTP 1OY8A 2PEHA 1JJ2R 3DLGA 1RT2B 4YFUA 2VKZG 1GLAG 2VPYB 1TU0B 2MKSA 4MIAA 3D6FB 1RWUA 3OUYA 3HPHA 1RWPB 5CE3A 3QSYB 2HHHK 4X4TA 3TSUA 2F4FA 3TTDA 2NSCA 1QZ5A 1ZBIA 3T6JA 1UEKA 5KFXA 5KOWA 2DRAA 3DXKA 2MKYA 4WIIA 3VQBA 2RIJA 2LYVA 1UFWA 3AD8C 3RR8A 1KR4A 3A3PB 4CBUA 2G4BA 4ILJA 3DOKB 4CZJA 3W62A 2QMWA 4FL9A 3UCGA 1V3ZA 4DV4K 5GMKa 3OVBA 2IOCA 3D67A 4PWDB 1UAWA 3FBFA 1UZDA 1IKYA 4ZVQB 5DDOC 1O1WA 4DSLA 1NK7A 4F04B 1BU6O 2XHWA 4NCAA 1SQEA 2R2RA 2BE9B 3LDLA 2HFOA 4JHDB 1Y11A 2ACYA 1Z25A 3D3BJ 3TUZC 2CPIA 2HFUA 4J9UE 1Q8LA 2DPJA 4H0YB 2G8VA 1RDBA 5F8HA 5CD4A 1S7HA 4ZVRB 2NLXA 1T9YA 4PG8A 2F9JA 4AQYJ 1HYZA 4KBOA 4J9QA 5IC6B 3CTRA 4CJ3A 1VC5A 5JVHL 3K17A 3DC2A 1E3MA 1PAEX 4CJFA 3C6HA 1WNEA 2YKAA 4JKCA 1CJKB 2B43A 4KHWA 2IY5B 2M3DA 4ZPCA 1CC7A 3MX5A 5IM0B 2F7VA 4DI6A 5IS2A 2YNHA 3P38A 2G0IA 3VERA 2I7NA 5DG9A 2UVUA 4FS2A 1SPBP 2YQ3A 3MR7A 4DTXA 5KFRA 2E1YA 3NVKA 1NAQA 1KKHA 2AU0A 2BVZA 2J4RA 5BPLA 2V8DA 4O5BA 2B7BB 3OXFA 4HL9A 4L73A 1D9FA 4J2AA 3U9DA 2M8DB 3D0GE 2DNLA 3HP9A 2JL9A 2AD9A 1P9YA 5HJXA 2CAJA 1FEHA 1GMUA 4DTRA 4LF9F 5C2GA 2HF3A 1S79A 5AFUH 3JTNA 2V4RA 3R1HA 2VPXB 3CCRS 2HMPA 2QV6A 3ZSZA 3KUGA 4JK8A 4G3IA 4C98A 1IWAA 2KVQE 3GU0A 3HKZD 4NMLA 2DNNA 1WSJA 3A5NC 1H2UX 4Y2CA 2OTJN 2HBKA 2UVRA 3LP3A 1ITGA 3CCJN 2MQOA 3CDWA 4M3UA 5C2DA 2D41A 4ZVHA 2FBTA 1GH8A 2KI2A 4CIGA 2HAIA 4RW8B 5TKYA 2A1BA 3MEEA 1DTQB 2Y0BB 2HWTA 4HHUA 4DHYA 2D3UA 1DQ9A 1VQYA 3CJ8A 3OTBA 3KVGA 4XH5A 4ICLB 2OFHX 2WRMA 1FDBA 4XPEA 1RGIA 3BSAA 4ZCMA 4K25A 3GFYA 1UTAA 5IT9O 1VDHA 4DPXA 4MKAA 1VFJA 3MFIA 2HIQA 3CULA 3GOIA 4F26A 2OTLN 3E8OA 1VSDA 1AZSA 1RA7A 2Y1JA 4ENOA 4OI1A 2MKJA 3KD1E 3IN5A 1DLOA 3DLKB 1TZ0A 2DJWA 4IG0A 2O1PA 2R4FA 2HBMA 3PKYA 4OPAA 5KQ8A 4TU7A 5C12A 4NLXA 1X5PA 1WACA 4A8XA 2G8FA 4OI0A 2BV3A 3I8BA 4IOAQ 3OFGA 5AT1B 2DNZA 1FNOA 1TYQA 3KD5E 4BROA 2CQ2A 2C2KB 3VQQA 2V9KA 5AQTA 3AVNA 4DF4A 4LFBK 3BGRA 5JUMA 1Q5YA 5IQQA 2DKOB 4JP8A 3DLRA 1X5SA 2XHBA 1RHRB 1U48A 2EK1A 2HSTA 4JI2K 1FWPA 1NXIA 4KB7A 3N9UC 4ALZA 2MKKA 4JKAA 3OSPA 1YRTA 1K1QA 2NYIA 3RBZA 4NLBA 5K9FA 3DDKA 1TUGB 3KTQA 2UUTA 2ZBRA 3U1MA 1UZHA 3ZX3A 3PEJA 2CQ0A 5C25B 5AJ3F 2MSSA 3LPEA 3C15B 5J2MB 2R7TA 2GZOA 2C42A 4EBEA 2B4VA 3NEKA 5HRSA 1WF2A 3HZEA 3TA2A 2FLNA 4JUZA 2YPYA 2HRYA 4LRCA 4DR3F 2CPHA 4ZLLA 1EQ0A 2A6AA 1ZPVA 1N32F 3D66A 4Z37A 1SC3B 4BS2A 1J27A 4F3MA 3BH7B 4F3QA 1RBSA 1LW2B 2W41A 2L9WA 4WFYA 1U26A 1IJJA 4MK9A 5GMDA 2EG1A 2VV5A 5C42A 4AT1B 2DIUA 2E66A 5L1KA 4AHSA 4LF8K 4TY8A 5KFOA 1LWCA 3NXZA 4ZCLA 4KBIA 4X64J 4WFNL 3C46A 4L3KA 4RU2A 1PAUB 2P9GA 4BRIA 3HZ6A 2E1ZA 3GR1A 4GVBA 2JJ4D 4RBVA 3FBBA 2VICA 4FYXB 4AH9A 5L9NA 2XMVA 4LMZA 4OJ3A 4IO8A 2DNMA 5A2QU 4LF4F 2O8FB 2NXCA 2X78A 3MAHA 5BYRA 1NJIT 2R3VA 1T3VA 4CF0A 1OVQA 5C7PA 4BRPA 2MY8A 4FJMA 3V1RA 4HT5A 3QBWA 4DQRA 4RX6A 3K89A 1HBUA 2QW9A 2YQ0A 4ILRA 1NB7A 1NUEA 4CP5A 4YDUA 1S5ZA 1NJIO 5KT3A 2NR0A 3OL7A 3WEEB 3NF8A 4X62K 1RACB 5HSPA 4JBCA 2QYGA 5HQ8A 3LGMA 3F73A 2F9DA 2H4YB 2F3JA 2CG8A 3ZZRA 4DG1A 3P45B 2X6SA 1IVZA 1NH7A 1DY3A 4RWWA 3TO8A 2GUIA 1BI4B 4JI4F 4ZMMA 3HSTB 5H1SV 3NCQA 4ZVOB 1KEKA 2DHHA 3KHRA 4H0VB 1IKWA 4WFAQ 1ZH5A 1O8BA 2HHXA 1P8GA 4YOVA 4DLEA 3DHWC 4JYAK 1I1GA 5SZTA 4DUYJ 1RT3B 2GJIA 2P9SB 4C48A 3MCNA 1U2FA 4E8UA 1X4GA 4RL1A 1BXNA 4MO4A 5GAGI 3NHGA 4KHRA 1F9HA 4CFBA 1NGGA 4JI6K 5M1KA 3L7UA 3HVTA 2D74B 2WAQD 4AD6A 1PC5A 2PD1A 5CABA 4NLGA 4RTFD 2LXIA 1NMNA 3PYEA 2CXEA 2VCPA 4DCPB 5E26A 3IS9B 1S1WA 3I5BA 4DSKA 5H9FJ 4O8KA 1HNVA 3J8AA 2K3KA 4YS2A 3HYFA 3NNCA 4C0OC 3TAFA 3M1VA 2GHPA 2RDJA 5D0EA 4ED0A 4WZQA 3X3UA 1X4FA 5HBMB 1WC4A 2DNRA 1P9QC 3GQCA 4KGZB 2VJVA 1NGIA 5LJWA 2V4JB 1ZA1B 4HT7A 3M8QA 1KVBA 2A2DA 5HK4A 2PO4A 1K8KA 3IRXB 4DSEA 3V81B 4I0WA 4LC9B 3VEVA 4LFCJ 1XWLA 3AO2A 1UP1A 3HF5A 2OIHA 4P10A 2LCWA 3ZO7A 2ZNZA 5L1LA 2ZQBA 4ECZA 1C0MA 2YKMA 2BOAA 3OS2A 3TW0A 3TNVA 3P3DA 2R2SA 3W5ZA 4DV5F 4USKA 4URQU 3IO1A 2P9LB 1GXTA 4FJ7A 3TEHB 2WBRA 4J9MA 4A59A 5H1SQ 1YZ7A 3H0PA 3T69A 1X0PA 1JL1A 3AB4B 4QS8A 4CJVA 4NCGB 4O55A 3N4WA 3D68A 4W90B 3MTJA 1N54B 1BUXA 4H4MB 2FD2A 3QESA 1MW7A 2B8PA 5ADXH 2R7RA 3E01B 4WYBA 3V4MA 4EP4A 2MQPA 3DRRB 4I4BA 5DZ6A 2YNGB 3MGJA 1M5HA 4A4JA 4JV0A 2MKHA 1DRZA 1HR0K 1GXUA 3K8VA 4HUEA 4IFVA 3ITHA 3M8SA 2EFGA 1CULB 2HBLA 4X84A 4PG4A 4B3SK 2K1RA 4WE1B 4DCHA 4Z4HA 2NXUA 3K5PA 2OEJA 5CZ2A 4LRFA 2IMWP 1QSYA 4BGBA 2KRRA 3P49B 2HK3A 2Q36A 2JEFA 5AQUA 1UFKA 3IDHA 4YR3A 3RB3A 2WVEA 4B1YB 4MFBB 3SCIE 2D0OA 1WG5A 1BCMA 1W2BR 4NXMJ 4JN4A 4F3OA 3TANA 1ZM3A 4CWBA 3LOUA 3OVSA 1BQMA 1RBAA 5JXSA 1YT3A 4JI6J 4K50A 2P9KB 2O3DA 4JKBA 4FK4A 3AAPA 2HHHF 1UVJA 4R5PB 4N41A 1HNIA 2KDOA 4GVEA 4Y2IA 1D8YA 4H54A 4B3TK 3CJ0A 3CJTA 3SV3A 4ZLJA 2DH9A 1C0UA 4RBTA 1TUWA 4ZKAA 1EIYB 3AVHA 2H1YA 4NPOA 1F60B 2KJVA 3G86A 3L95X 4YOYA 3AODA 3QMLA 1IKXB 1F2HA 2GMJA 3SEOA 4CLLA 3CF5Q 3CNQP 4YORA 1ZBLA 3BZQA 2PFFB 4DV4F 4QWBA 2DNOA 3IAYA 4CRJA 1VQOS 5A6PA 4KO0B 2ZM6K 2WCXA 4P7TA 1NKCA 4WPAA 1BDGA 4F0MA 1K9MT 2K7JA 4DR4F 3ZLJA 5LMNJ 1S72S 4FYVB 2ZJPQ 2LU2A 4OHXA 1RWWB 3LDPA 1WF0A 3LF0A 4OVLA 5HVHA 1DAXA 1TL3A 4N5SA 4E7KA 1U04A 2HZCA 3OYEA 2BJDA 1K9MO 3HD2A 2VWBA 5KG3A 2YJFA 4EU0A 3WXIA 2VG6A 5E3AA 3CI5A 2F8MA 2V2VA 3SLCA 5E0OA 2L41A 1UVMA 1JK9B 4UOFA 2W9AA 4IZ9A 1U1MA 4G1QA 3VAKA 3AQOA 1KNZA 3ZSXA 2ZF5O 4K8XA 3EE9A 2RKIA 2LKZA 3LPTA 4USMA 5HAOA 5KFIA 1HR0J 1HBMA 2CNLB 3OW2M 3NS5A 2PYJA 3PIPQ 4ED2A 1XNQJ 4A47A 4RW7A 5D78A 2FVPA 1T9UA 4EHTA 1ZTWA 2E88A 1S6PB 4FYYB 1YHQN 4DPUA 4CLZA 1HHTP 3JAMU 3MM8A 4C1NI 3VAHA 2P9UB 2DK2A 2FC8A 1W7WA 4O44B 4BDZA 5HO4A 2XSFA 2KLAA 3O3LA 3O2IA 1CJVA 1N5VA 1JLFB 5KOXA 3Q89A 3UQSA 1IQTA 1S22A 4DQ8A 1XTZA 1JLQA 2XY5A 2XLJA 2F40A 1BCOA 4IQMA 4YP3A 3MEKA 3L4IA 2HS3A 3KJFB 1WTBA 3ICLA 2DY4A 4B3TJ 5BN9A 4BE1A 4LH4A 4GKJK 2OGUA 4OPJA 3IR6B 3ZZ0A 3QAUA 1I3OB 2NXNA 1WKLA 5J2NA 3MPWA 4X4SA 4DN9A 4GW6A 1GAOA 1YBUA 3LPUA 4F36A 4QAGA 3QSIA 2ZKTA 4JEPA 1CG2A 2CQHA 4ED7A 3OTDA 1RFQA 1HBNB 3LWLA 3EVWA 3Q8UA 4ZPBA 4FF2A 4HCCA 1E4FT 3ZZYA 5BYSA 5AXKA 2FLOA 4ELVA 3CF5L 2VBYA 3RJMB 4G65A 1T9WA 1JLAB 3TAMA 4FJIA 4BR2A 4USJC 3VEWA 3W8PA 3HVRA 1OKJA 1VC6A 1TL4A 3HI0A 2OPRA 1NGDA 3B6BA 3G6EN 2ZJPL 4YOXA 4X4VA 4KV8B 4PAAA 4C7QA 4QYZJ 4OX9F 2XB2D 2QRRA 5IT4A 2CH6A 4LVOP 2DYAA 3BSNA 1F9EB 3MM5B 4O3OA 2UYTA 2XHCA 3KLHA 1FDDA 2NPIA 2WZ1A 4Q0BA 2V6AA 3ZX0A 3LP2A 4I6WA 3ISND 4GKKF 3VF0B 1FJCA 2C1EB 4C4WA 1P1LA 4ECSA 4U7CA 4OGEA 3SYZA 4USWA 1GX6A 4Z4EA 1X4BA 4I6MA 4KHUA 1VRUA 2NLWA 4W5TA 3L2VA 1YJWS 4LFBF 1VIXA 3KK3A 2QA4G 1O51A 4RG8A 3LUYA 2RUSA 4ZN3A 2VD3A 1R8CA 5IT0A 4N56A 2E5LF 4DHVA 2RHQB 5I42A 5LSOA 4PQUA 2GS8A 2X51A 5CCMA 4DS5A 5GAGP 4YOWA 4JI2F 2KXFA 3DLGB 2YTCA 3DXMB 1VSJA 5THWA 1SJ1A 4O23A 1XQSC 4ILGB 3THWB 2HFZA 4I9LA 1RHMB 2VFVA 3PIPL 1Y5LB 3CUNA 8AT1B 2WTFA 2A5XA 4F9OA 4C0HA 4N7TA 1NWKA 1ZM2A 3MURP 3QBCA 3PY8A 1TKTB 2HIYA 1FNMA 2DFHA 1FJEB 4UF4A 1UA0A 4OI4A 2A6OA 2UUAK 3CCES 1RKJA 4FWQA 2HBYB 4I64A 2KHCA 4IYQA 3PFOA 2GQ2A 2GVZB 3ATVA 3PW5A 2BRLA 1SQKA 4K7QA 3N5FA 1IKYB 2BJEA 3MMAA 4R8UA 2W25A 2UXBJ 4MYTA 1J5EK 5ETPA 4DFKA 4CBXA 2HGMA 2XNRA 4USIA 2RUGA 4IFEA 3NOCA 3B6OA 3GBTA 4KGKA 2J0QD 5KG2A 1RUSA 4AF1A 3DRPB 3TA1A 4ED1A 2E9TA 3UE2A 3QNOA 3LGNA 2QT7A 3CSKA 2C2MB 1YRXA 4OZNA 4BG8A 4M7XA 2KN4A 2VDIA 1REVA 4CESA 4FOIA 4KR0B 1N0VC 1RTDA 4QCLA 3EM1A 1FXLA 3CXCM 3IFRA 4NA2A 2HVDA 3G82A 4LBHA 1SKSA 3L0QA 4J5OA 4FYWB 2LQ5A 1YWXA 4ZCKA 2J6SA 1GTHA 3ETOA 3GPAA 1C1AA 3CCUN 3BO3A 2J8AA 2BEFA 4I68A 4DTOA 2CJQA 4PHTX 1DEJA 3OYHA 2R42A 2W40A 2JHEA 1CC8A 1RT4A 1QVGR 2AGOA 4YY3K 3RAMA 3EGZA 3CJKB 3OVAA 3RGIA 4ZK7M 4B3RJ 4LSLB 2FVSA 3UDLA 3KXDA 3TWZA 1ZZNA 1GLEG 2KQ2A 5KI6A 3QPIA 3THXA 3DLBA 2YWWA 4X62F 2CJ9A 5M1PA 1WELA 2EWSA 2A6MA 2XO7A 3MM6B 5E7OB 1MN7A 4MK8A 1H2VZ 4IEEA 2B0GA 5JLFA 4OHVA 4E2FB 4ZIWA 1U2CA 1NBEB 4JI5F 2C2DA 2OSQA 2NRTA 1QAXA 1RE1B 3EXYA 4BR0A 4WFZA 1QQNA 4BR4A 4X65K 3MMCA 2BYCA 4JYAF 4F8RA 1D8ZA 1Q79A 3FLCO 3EZWA 2BTFA 1RDWX 1F1BB 5DG7A 1Y0HA 2WC9A 3THTA 2W2OP 3BQ0A 4MO5A 3BSCA 1QUVA 3QZ7A 3T5JA 3F0NA 2F63A 2B6AA 5AQFA 2GELA 1S0OA 2AA4A 1B0VA 3MEEB 3OHRA 1RGVA 2UVVA 2GGPA 4K4SA 1MMDA 3FC9A 3H59A 2EI5A 1Q86T 4C8MA 3BZCA 2XYGB 4CZHA 1Q1KA 2Z1IA 3CJQA 1BHNA 1TMJA 4DV7K 3JS6A 4P75A 2OZSA 3TAPA 4HI1A 3OHAA 2HBJA 1YQHA 2E1MC 2XSJA 2IYGA 4M41A 3PHEA 4BQZA 3GJRB 3I4HX 1PG5B 4J90A 4CD1A 1QHTA 2P9EA 3SQGA 1AZSB 3M2RA 4Q2MA 4BY9C 2E1RA 1UA1A 3THYA 1DLOB 1MMNA 2E9RX 1I3AA 3KLFA 1HNXK 4CZMA 1QE1A 1TK0A 5EX0A 1TR0A 3MZIA 4CYUA 5HVGA 1MMLA 1WTFA 2ZBCA 3EE8A 1NDCA 1Y7PA 1VQ7N 5FDLA 1XMQJ 2UP1A 1JXBA 1X7VA 2I8EA 1EX8A 3V6KA 4KTZA 3T19A 2HQGA 3SFUA 1TYQB 3AO1A 7FDRA 4OKJA 4YDXA 4ZOSA 5HP1A 5B0CA 1KHWA 2VUGA 3BGRB 1N34K 3SMSA 2Z2YB 3N01A 3I82A 1CJTA 3PO5A 5CYQA 4RJVA 2D0BA 1EJ7L 3CPEA 2HQFA 1S57A 4OI3A 2XS5A 4ZCIA 3HCXA 1IBKJ 3G25A 3QDKA 3SXLA 3FGVA 2HSEB 1CVJA 3ZFVA 3GONA 2IMOA 4WK1A 4FJJA 1D5AA 1GOCA 4F4ZA 4HHJA 1TUYA 3KLGA 2DXEA 4ZIVA 4B3SF 3NAIA 2KB2A 1VQNN 4QPTA 1ASWA 2ALYB 3AOCA 5EWEA 4M5DA 1IM6A 4CIOA 3RRGA 2V9WA 3QAEA 2ADCA 1QSLA 3KIOA 4DTUA 1W97L 2CZ4A 1UFLA 3IR7B 3JTPA 5GIOA 1YJNS 4KHNA 1VQ6N 1SI9A 3QGGA 3E3XA 5D4LA 4X4PA 1IBMF 3FFKB 1JCEA 2E2OA 5F1XA 2E5GA 1WSIA 3U6FA 3FJ2A 4DR2J 1HFEL 5HLFB 4I7FB 1X9WA 2W4PA 4DX8H 4ES3A 3M2VA 1UETA 5C42B 3CHWA 3BM7A 1FTCA 5AE3A 1D4XA 1Y97A 2UXCK 1LWCB 1T95A 3CERA 3IMXA 3OYFA 3VQ6A 2N3LA 5K8OA 3IAM9 1TAQA 4A48A 1RT7A 2HNDB 2VWJA 1WHYA 4GVBB 3CFPA 3WBZA 2DNPA 4JI3K 1HYVA 3CCLS 1H1VA 4YOEA 4JKEA 3KK2B 2XMMA 1WSFA 3M30A 2P6TA 2FTRA 4WU3A 4IR9A 3LTOA 1WUAA 4J2EA 1M90T 2ZM6F 5KAKA 1C0FA 5ITHA 1NK0A 4ANDA 4TU9A 4FXWA 3U1NA 4CEDA 2AW0A 1HNWJ 4KHSA 1V9OA 5KFSA 1IKVB 5J2QA 2CFXA 4LD0A 4HVZA 3MHYA 4P72A 2UU9J 1KVAA 3C19A 3CJ5A 3TTCA 5CZVA 2BANA 3QQCD 4IXCA 5CA5A 3CD5A 1XJWB 5AE1A 1HBUB 1M90O 1ZC6A 2IGIA 2L9DA 2YI1A 2OKQA 2YH0A 2KFYA 1FE4A 1SKUB 3KNGA 1RU2A 9RUBA 3FDSA 2QFIA 3NCIA 3BDPA 3EZUA 1Q82T 2VL1A 4FLVA 5DDPC 2QA2A 3AQPA 2WB1D 1N34J 4DLGA 2QIFA 2BGGA 5EVZA 2W42A 3I32A 3U3YA 2PGCA 1TQLA 4OKEA 1IKWB 4LBIA 5F3TA 4P52A 3VESA 3SI8A 2MEWA 4QIEA 2EXUA 1SV5A 1U0SA 1S97A 4LSZB 1Q82O 3SBGA 1NGAA 4C8OA 3WIUA 3A2FA 4DFMA 1RHQB 4IJAA 3HFVA 2WVCA 4QOTA 1J6ZA 3P8BB 2P2CB 4HEA9 2AKWB 3EPIA 4L72B 1RBRA 1W7AA 2RMLA 5KPRA 3CC2S 3CDUA 2V8PA 3PCOB 2G9OA 3ZEUB 3HVTB 3R5GA 4CJ4A 1VI7A 2XRIA 2A41A 2GHVC 2MB0B 4PXEA 1NZ8A 4K4WA 1DJ0A 4J8FA 5ADZA 2BKNA 3D2WA 2FJDB 4O4GA 3PXGa 2CPDA 3TQ1A 4ECUA 3SSQA 3M1VB 4CJSA 3M6WA 4G9ZA 4E1MA 1D9AA 3ID6A 2M9KA 2ZE2B 3ISZA 4LBPA 1R8PA 1Y5NB 4A8WA 1VQON 3DWLA 3M8QB 3QGHA 1FXRA 4CHQA 5KFCA 1K8KB 4OQJA 3H6EA 4O3NA 3OTOJ 3RBDA 4GKJF 2ZEJA 4OZ0A 2QKKA 4UTGA 4ZPTR 2E2PA 4PL7A 1HI8A 3MR2A 1JL2A 3H4BA 1B92A 1TGOA 3CIMA 1FJGJ 4KYZA 1YJ9N 2A3JA 2IRXA 3ETMA 1C1BA 2PI5A 2KFZA 4R79A 4JI8K 3CJ4A 1BHLA 4JV5K 4WKRA 4KH4A 4IKFA 4K4TA 2QEXS 1EAYC 4YR2A 2YV0X 4FBUA 1RT1A 4F4KA 4IWVA 3R7NB 3KKRA 4DU4A 4OZ2A 3CD0A 4UT4A 2GO8A 3AFGA 1GK8A 4ETXA 2VWKA 3S3NA 4LSNB 3W3DA 5KGXA 4DV3K 3CMQA 3IBWA 4MMOA 2V8VA 1S6QB 2X1AA 2GMHA 5BYQA 3V9XA 3WC0A 5K8PA 4HDGA 2R7YA 1VQ8N 2CNOB 2NZTA 1R7IA 1OWXA 2VQEK 3C7NA 2WK4A 1NGEA 1SXLA 3MN5A 3L4QA 1TV6A 1SJQA 5F8NA 3JB9k 1KBRA 1KQSR 4LF5J 2BMBA 1L3TA 1B0TA 1WSEA 4IOBA 2X1GA 3GB0A 3OR2A 3BY5A 3PV8A 4IFYB 5LMUJ 4MLHA 1V4SA 5CCLA 3SCXA 2K3IA 3EE3A 4CCHA 4BG9A 5C0YA 3D3CJ 1SQFA 1JKHB 3NAHA 3V9WA 1RT2A 6FDRA 5IT9U 3VAMA 5GADI 4J9OA 3P31A 4ZPWR 1IXKA 1R8AA 4BRDA 2CNKB 3T9NA 2AZ1A 1M1GA 2XTJP 4Z7YA 4W5NA 1HNIB 3SCLE 1RWXB 4DR1F 1VQ9S 1ZM4A 4U6PA 1IBCB 3H5SA 3DOKA 5F3ZA 5FROA 3EY1A 1TL7B 2HGLA 4MK7A 3D5MA 5BRHA 1U1NA 2NXJA 2UUAF 2KHOA 4KPYA 2KRBA 4B1UB 1B0PA 1LNQA 4PWDA 3TRGA 3WNGA 4RUBA 2ZH7A 2Q31A 2AX1A 1VR6A 3EN9A 2AGQA 1DBDA 5AZIB 1X9JA 5E33A 1TUUA 3BYPA 2CVEA 3PG9A 4IJNA 1J5EF 3C6AA 4JHDA 1V3RA 4A8SA 5J1NA 4XPCA 2CPJA 4AM6A 2GW8A 2BQUA 3CJAA 4AHUA 4WZMA 3MUVP 3WNHA 1XNRK 2F96A 3CJ9A 1TMMA 1E4GT 1FX2A 3CCMN 3R7SB 1BG3A 3KLEA 1TL3B 3S01A 2JX2A 2LU1A 2IDOA 3Q8VA 5D6GA 2A18A 3BP8A 4OYOA 5MLCV 1Q8IA 1MU2B 1T3OA 3ENVA 4L74A 2W2NP 2V34A 2LEBA 3AV9A 1SCJB 4NYFA 1APSA 1R43A 4G1QB 3ID8A 4M3RA 3A1YG 3VV2B 2MZJA 3JTOA 5F2RA 4K41A 3F41A 3R5AA 4GV9A 5KT5A 1HBMB 2VJUA 4CJTA 4HWIA 3A0IX 2QM1A 5JLHA 1YBAA 1PJ6A 2IVYA 2IA6A 3R5DA 4H4KC 1VBZA 4RW7B 1UPPA 3NOGA 4TSXA 1TVRB 3QETA 3ASMA 4EIAA 4NYZA 2VKRA 1QAJA 3MR5A 4ZVTB 2CQ3A 4ZVPB 5FLXY 3OFFA 3MXHP 2HPUA 1HJRA 2I6WA 3RYLA 2F9WA 2ZVSA 2GO9A 3CCEN 3R1XA 2V50A 1CJVB 4E98A 2FBXA 1VQPN 4U96A 5AQZA 3TA0A 4X65F 3UD3P 3BN4A 3TVZA 2AJ4A 5HI7A 4DV6K 4IOXA 2UUCF 2J0XA 5C15A 1KVIA 1WG4A 5KFZA 3W61A 2H48B 3TJ8A 1EP4A 2C3PA 4RW8A 1L3UA 3D2FA 3TPQA 1QQCA 4I56A 2WVBA 1CZBA 5J2NB 4FWKA 5E84A 3OFHA 4FM0A 5LJ5Y 3GG1A 4J9LA 3OBIA 2XZDB 2B9WA 1L3VA 2LDIA 2YH1A 1CXQA 4LF6J 1JQGA 2IAJA 2JEIA 3UVJA 3WXMB 3EX7B 3AVCA 3BQ2A 4PL8A 5D77A 3FEZA 3UPFA 4M5NA 1SJFA 3T5LA 5D0HA 1F2GA 1ATRA 1VSIA 2DNYA 2F8SA 2F8HA 2OD4A 2E7VA 3TAMB 4TY9A 2JVRA 1J2VA 4A2AA 5FJ4A 1U6BA 2Q2RA 4N8NA 4DU7A 1D9DA 2OPRB 4RWTA 2W4DA 2BE2A 4QIFA 4MQ3A 2L3MA 4C8ZA 3OYBA 3VQEA 3O5TB 2YHYA 1V4TA 3M1FA 4V1Ak 1HNXF 1GFWB 2HFSA 1N5YA 3T41A 1JB0C 3VPZA 3KLHB 2FGOA 3H20A 4E7LA 3A8JA 1LK5A 4Q0BB 4C3KA 2VH7A 4M8LA 3LP2B 4GV3A 1JLEB 5AXMA 4KTWA 1WLJA 3MMJA 3ZSRA 3MX2A 5ETOA 2R8IA 2ILYA 1RCOB 4I6MB 4PQAA 2QL7B 2EK6A 4DV0J 1VRUB 2M7SA 1AFIA 3M5RA 4FKXA 5F8IA 4DQQA 4GY2B 3H42A 3KK3B 3CMAN 3D1OA 4MH8A 3W63A 4Y1DA 5DLFA 3Q83A 1RHUB 4Q43A 4NWBA 1CQNA 2ASYA 5DGBA 4JKFA 4OKKA 5CHCB 3NMAA 1HYSA 3T7ZA 2HVIA 4ZVUB 4CJPA 5HJYA 5B0GA 4ZDNA 1EETA 5KFAA 3IAS9 2G1DA 1R31A 2PY5A 1RTJA 4PG5A 5AQPA 3AOAA 4FWLA 3RBXA 2PAVA 3G71N 2KKHA 3I96A 5A0YB 3ZSOA 4NXNK 3BGFA 2JGUA 3TABA 4C1NK 3Q7BA 3P6YC 3NF6A 2XY7A 1GOBA 3VGMA 2E4LA 3WQPA 2ATCB 5DMRA 2DRBA 2DGQA 4KKOA 1T7PA 1HKCA 1LW2A 3KMQA 3MMAB 4R8UB 1IBLF 1FK9B 3E9OA 4WIQA 2DRDA 5GAEI 2D1KA 2CQPA 3D6TB 2V8GA 3ZX2A 1Y10A 4PYAA 1F21A 4F7VA 2Z4PA 4WP9A 2UXCF 1WOOA 3R3TA 4HHTA 2QA1A 1HHSA 1MWYA 1Q7LB 1HUXA 3E2EA 3JYTB 2XMWA 4DQIA 1S4EA 4JK9A 3H5XA 1HPZA 1RTDB 2CZ9A 1ZBHA 4JI3F 3G82B 4OFZA 1VK3A 1HKGA 3L09A 4GO5X 2NRRA 3BBFA 4CECA 1PBUA 5KRSA 3M32A 4X66J 5KPZA 4P73A 2V94A 3J7ZT 4KGXB 3L9ZA 1R8HA 4HACA 2W7AA 1KOHA 3DLLQ 2E8AA 2J6TA 4L75A 2ZUAA 2PMWA 1S9EB 3AJ2A 1H38A 1R0AB 5DGAA 3L3VA 1ELOA 2Y1LB 3G6YA 3BYRA 1OSCA 3VZIA 2FZGB 1LWEB 3J7ZO 4XK8C 4FOEA 3THXB 3BGOP 3H5UA 3C16A 2Q3PA 4FJ8A 4HLBA 2IIHA 3TOQA 5GAEU 5ETKA 4MDBA 2ZD1A 4Y00A 3VF2A 2J6UA 3OVNA 4TQSA 2ZZNA 2VOPA 2OHDA 5IWAF 2FVQA 3HRGA 1KLMB 1RP5A 4B3MJ 4Y0FA 5DM6Q 3CQ8A 3AAWB 3GSIA 3D2EB 1R59O 4AFFA 4MKVA 2OCEA 3KHYA 4XTTA 3DLEB 3K9KA 3VVTA 3QINA 1S77D 3UDEA 3TZXA 2HFNA 4OGCA 3MM7B 4OJGA 3UD4P 3QBXA 4BCAA 2RVJA 2I1RA 1F0XA 4JD2A 4A2BA 4HTIA 3GG0A 2FSNA 2FBVA 3OS0A 2LECA 3H7HB 4HDHA 1JCFA 5M1NA 3JSBA 4Q44A 4B9MA 3RSEA 2D9OA 2RE1A 2B6AB 4U9RA 1NGJA 4J2BA 2YWKA 2B51A 3FRZA 1RDCA 2FVCA 3IS9A 4CHOA 2NZCA 2R8JA 1RAHB 3N6MA 1FRHA 5IXUA 4CEAA 3R9LA 3SSRA 3MD1A 2VQFJ 5HBMA 1VQSA 1OVYA 4EHUA 2KXHA 2B5JB 1S1TB 1ASUA 2V2KA 1WBDA 3CC7S 3R6LB 3GV5B 3DM2A 3CCLN 2XSJB 1ATSA 4TXSA 3IRXA 3V9SA 5B0EA 5E3CA 1LAWA 4QWEA 1I94K 3NL0A 3M2RB 3UN5A 3KLFB 4CIEA 3CETA 4CLUA 4CLFA 1QE1B 3QGIA 2W8LA 3CYMA 1NSAA 1OYEA 2KT5A 1MDUB 3WQUA 3I4PA 5ETQA 4LIRA 1ZM9A 4RLEA 2P9LA 5FDLB 4A8YA 1HI0P 3GJSB 4KRFA 3OBWA 4M1KA 4FWRA 4JI8F 4YHHK 3M6UA 1RDUA 4JV5F 3OR1B 3AB2B 3KNAA 1WSVA 4MIBA 1Q81T 4XDCA 4NB4A 3SJJA 3PX0A 3WC2A 3T1YJ 3BF4A 2ZOMA 1GTEA 1YTUA 2JH3A 3E01A 5KGWA 1KQGB 3J81O 1CJTB 3ONQA 3VGTA 4EMDA 3T1AA 2DT9A 2YNGA 1HLUA 4DV3F 5E3RA 3OJSA 3DLLL 2VPZB 2QGFB 4NO7A 1Q81O 3KHHA 5LMNF 2CGJA 3C6TA 3RMBA 1WWHA 2F4VK 1E6YB 2VQEF 3OL6A 4PPDA 3ZSQA 5FLXO 3UN3A 3O9QA 3GR0A 1HMVB 1CULA 2YQ1A 3LP0A 2E2NA 2XM3A 4WE1A 4ZJQA 4LF9J 1RYRA 2DGXA 3P4IA 2KKZA 4IH5A 3NS6A 1HRHA 3QEIA 3O9SA 3SQ2A 2VA3A 3OL9A 4UY85 3HDSA 4E7JA 4M5DB 2QLFB 1FXDA 3F56A 4CEOA 3UKUB 2YHBA 5DM6L 2ZWOA 3QIPA 5LXYA 3Q22A 2A42A 2XS2A 1FKOB 3KKSA 4ZLNA 4HVJA 4OHZA 3G2XA 1NKEA 1HNZK 1WNSA 2QLJB 2OO4A 3ULHA 3PW4A 4W92B 3GCWP 3VQ7A 2D0PA 3QRRA 4RW6B 3AA4A 1NJWA 2GEMA 3QEWA 1QHAA 4MIWA 1G1XA 1RBVA 3TZZA 3B78A 4G1PA 1ZS6A 3MTKA 1XMBA 2NCKL 1RT7B 1LXNA 3H8YA 3N79A 4OYZA 1SJRA 1XQIA 4I6AA 2O8BA 2FBYA 2HMIA 4IO9Q 1BIUA 2MDAA 5A8KA 2RNEA 3TVYA 4DR6K 3VQCA 3OJUA 2JC1A 3M30B 3CVKA 4LF4K 4KO0A 2AP6A 2QEXN 4Z0UA 1B9DA 3O4NA 4DBQA 3HT0A 3R2DJ 5AE2A 2H3EB 3IGVA 4RW4B 1GMWD 3NGSA 1YF5L 1SKRA 5JICA 5J2QB 2E2QA 3VTHA 2HQCA 3GZ7A 4DCOB 5B0AA 1XNRF 1QTMA 3DHXA 1QD1A 5IV3A 1U09A 2W1BA 1OPIA 2WVDA 5CH7B 1WSHA 1H98A 2DHAA 3J81j 4WF9Q 2LQJA 4QYRA 3ENQA 1S9FA 3VQAA 3TZYA 8RUCA 2JEJA 2XY6A 2OLWA 2WW8A 2Z8QA 4CJ7A 3M8PB 4WXOA 1QVFR 2QSFA 1SS6A 3RTVA 2GQCA 3MWTA 4FS1A 1FJ7A 3KFWX 2C28A 3O08A 4QU6A 3OBYA 3TR5A 2IRYA 4GVMA 3K0SA 1PYSB 4BC7A 2AYBA 2I5JA 2IVOA 1NOZA 1NK5A 4CLYA 3AGRA 2H5JB 4Y65A 4ZP9A 5LM7E 4DUTA 3QYYA 2MXYA 2KW4A 2B3TB 4CEEA 5AJ3J 4RNOA 3S7RA 5KFPA 4ID5B 2DCUB 5FRMA 4OHWA 3L2UA 1NU4A 1IG8A 1BQNB 3A8EA 4EO8A 3VEOA 2WBMA 1URRA 4A8KA 2DGUA 3IWXA 1TL1B 1X9SA 2FC9A 2AF6A 2CH5A 3S41A 3W9HA 4NA1A 5KFWA 4DR3J 4LUBA 1VQ9N 3WXLA 1WEZA 2P9UA 3UD5A 1JJ4A 3ULEA 4EWTA 1C0TA 2Q1LA 3EPGA 2B7CB 3BS9A 2KG0A 1N32J 4Q45A 1VC0A 4NRTA 5EY4A 4IH6A 4O4GB 3KG0A 3KWIA 4J9VA 1VK0A 4RUAA 4OYXA 5C2CA 5GAEP 1UVKA 1X5TA 2HWHA 2L08A 3RR7A 2M4MA 3R1LA 1SIWB 4ISGA 4IRCA 3H5YA 4DR7J 2HBZB 2J76E 4DV6F 2JVOA 2NRWA 3WHIA 2LQ9A 2CRLA 2VG7B 2JZ5A 1Q5VA 5KFHA 4K2JA 3NGTA 2OP5A 3M8WA 2IVNA 1HBNA 2QN6B 3ZTQA 3GYXB 1CEZA 3N0VA 4LJMA 4TNOA 3D6HB 4TVAB 3BREA 3JXUA 1C1BB 1RBUA 2Y8WA 1Q9XA 2QO3A 1HWJA 1D0EA 1S1XA 3VQTA 5JVHQ 3EGNA 4ECTA 1EQYA 1JLAA 4IO9L 4RW9A 1X60A 1LFPA 2O8EA 2MLYA 3VEZA 4J91A 2XMUA 2DY9A 1HKAA 1EKEA 2A1SA 3WIVA 5SUHA 4MKBA 3AJDA 1VMBA 4AHRA 2Q43A 2W7PA 1JXLA 3H2VE 1SB6A 2RQMA 3MM5A 3EEQA 2BJ1A 5HQMA 4M5KA 1NDPA 2CZVC 2CQ1A 1KTVA 3O6QA 2U1AA 4DL0C 1TV6B 2V5HG 3NBPB 1U25A 4JI4J 3HHEA 5C24A 2ZH1A 2DITA 1TFWA 4NLWA 3DGPB 4CERA 4FM2A 3OD2A 1NHUA 3CJCA 1SH2A 3H45C 2H5EA 4YQWA 5ETRA 2E1CA 3H1VX 3SBMA 2BJ8A 5T14A 3I8DA 2XWXA 1FDAA 3DXMA 3CCSS 3I31A 2ZH9A 4DL6A 2PI4A 2E7XA 1TKDA 3THWA 1VSKA 3R5JB 3FCHA 3SSSA 2G2ZA 4FW1A 2ASMA 2Z1GA 1QQMA 5DG8A 1T6CA 1WEYA 4DFPA 4DDFA 4AL7A 1TKTA 4DX6A 2I2YA 2V8HA 4DR5K 4J37A 2AJ2A 3KK7A 1URNA 2ZWHA 3KWMA 1TL5A 1U6FA 3I0SA 4AUKA 4WWSA 4NXNF 3N6NA 2GVZA 4RZRA 2ASJA 2J8SA 4B1XB 2QA4N 1IR2A 2HQIA 4LF7J 2P51A 4OI6A 4OJRA 2J9CA 4UZBA 3DXBA 2PT0A 4NLYA 2EFVA 1U1RA 3ZZUA 4YMEA 2DVIA 4DR4K 4KREA 4QW8A 3V6JA 1W25A 4LRDA 4DV2K 3F44A 3DRPA 3DRSA 5BR8F 4QWDA 4DV5J 1ZYQA 4IBNA 4K4XA 3NWRA 2BKOA 2E6LA 2HHWA 2ASPA 2LQ8A 1YSJA 3KLEB 2PFDA 2GC8A 1CJUA 2MKCA 3Q8YA 4ECXA 2F8EX 4DV1F 2A1RA 2GBZA 1SH3A 1RT6A 3BO4A 1EXQA 1N52B 1TK8A 3HT3A 4TKTA 3D9BA 4KI4A 3MEDA 4IH7A 3QFWA 1OH8A 3C66A 1C1CB 3BGLA 4C9DA 1OS5A 3PRVA 1XUPO 1YK9A 2OYQA 3T3FA 1S4FA 3PRDA 3Q7CA 5EDWA 3MCSA 3QO9A 1X9MA 3CJKA 2DR9A 3DOLA 4CNYA 2NREA 1HWIA 2QZ8A 3ZSVA 1WOPA 2DD8S 4LSLA 3NVMA 1EB0A 4QS9A 3W9JA 2N3OA 5F8GA 1TKZB 3OL8A 4HUFA 2ASDA 2NNWA 5FPNA 2NPFA 1GEHA 3AJ1A 3Q86A 1HWKA 2EBEA 4C8YA 1WJ9A 3MM6A 1XMQF 1W0HA 5F41A 3VAIA 2A0FB 1NPKA 3GFZA 1E6VB 2HZVA 2F1FA 2ZJQQ 4JI7K 2MQQA 4DL7A 4LY7A 2HHHJ 3T1HF 3CJ7A 1DKGD 2CJKA 3K5OA 2HHPA 5D8HB 1VQ4S 4NLPA 3BKTA 2G8IA 5B0FA 2YKNB 3QLHA 1HWLA 2A3ZA 4M94A 3LPYA 4BRMA 2BKPA 1NPPA 3CIPA 3UFCX 1EP4B 2BX6A 3D2FB 2AJ0A 4AILC 1IBKF 4OMFG 3GFXA 1KP6A 4CDIA 4WFNQ 2P9IB 5AQLA 2BUNA 3E51A 4FPAA 1LW0A 3CJ3A 2AYEA 4BVPA 2VFUA 2X3DA 4DV4J 3GDQA 4IRDA 2E5JA 1YTAA 5HQLA 2CGLA 3JQJA 2IAJB 4KSEB 3UVJB 4ZVSB 3TJ9A 1RHJB 2GV9A 3CCQN 3BSOA 3SMPA 4RNNA 3HSGA 3QT7A 1IM4A 4ED4A 1VK8A 2W24A 4OX9K 2HURA 2KT3A 2BE2B 3PIOQ 3WNEA 3PNIA 1I94F 1I5OB 4IR1A 1H7WA 3FEYB 4NZ0A 3MXIA 3QJPA 2HHTA 3SUPA 1LFWA 1N5YB 3V6DA 4F4WA 3EKUA 1RDAA 2N82B 2DFEA 4GKKK 2LA6A 1KXPA 1NJYA 2BE7D 1SUQA 2QK9A 3SDEB 2VONA 4ECWA 4YHHF 1A5WA 1WOSA 1FESA 3PLAA 3V9UA 1T9VA 1VS3A 1XMOK 4NYPA 2ZFHA 4S0MA 2EHGA 2CVIA 3TWHA 1NZAA 3FUYA 2E5LK 3OYJA 3UIQA 2ROGA 4G6VB 1JWWA 1K8AT 3WZ0A 4PABA 2BACA 1Q0NA 3R7BB 5GMEA 1NJXA 1HYSB 4ATNA 1IV0A 1S59A 3NH0A 3G6XA 3DOMB 3Q8RB 2W6LA 3I56N 1EETB 4B9QA 2F4VF 3N4PA 2CADA 4N8OA 4CEBA 4DQPA 1XI1A 1BISA 1K8AO 1XERA 3KLVA 3LM2A 2MQNA 1RADB 1FRMA 4B1ZA 1RTJB 1JX4A 2P8IA 4FVUA 2PFUA 1QSSA 1H7XA 3JSRA 3ENBA 3UB5A 2P9PB 3BEXA 2GWJA 1FF2A 3OYMA 3AH6A 2ZJQL 3HD1A 2QC3A 4ED5A 1MA9B