4CJSA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjsA00
1Q9YA 1HNVA 3DLEA 2GUIA 3CG7A 1QE1A 2VG7A 4I2PA 3QNOA 3AA3A 4F3TA 2LSNA 4FK0A 5J2QA 3QEWA 3DOKA 3O3FA 1WAJA 4E89A 2P5OA 5FRMA 3BDPA 3NGIA 4CJWA 3SJJA 1NKCA 4MQ3A 1C1AA 1RT3A 4KREA 4RW9A 4DLEA 1TK8A 3HO1A 3DRSA 1A5WA 1DLOA 1GOCA 4CHZA 2IC3A 4FLXA 3SUPA 3AO4A 4LH4A 4CEOA 1EXQA 3K2PA 3S3MA 1D5AA 4DFMA 1U49A 4W5RA 1S1VA 4KTWA 1J54A 3QEPA 2OA8A 4LY7A 4M45A 4KPYA 3KKRA 4FXDA 5I3UA 2JLEA 2YV0X 4LH5A 3OYNA 3MXIA 3HVRA 3OYCA 4DFPA 4KTQA 2BANA 3VQBA 3SPZA 1U47A 2HHQA 4M3ZA 4E7JA 3DLKA 1SL2A 1YTUA 4NCBA 1VSJA 4RW8A 3PO4A 1RBVA 3DRRA 1KCFA 5CY4A 4B08A 3LWLA 1KTQA 1TK0A 4CJ4A 4IFVA 3AVAA 3PUFA 3OS2A 4G1QA 3FFIA 3RMAA 3DLRA 3OYHA 5C25A 4KV8A 3NH1A 5C42A 4J2EA 4DSEA 4FJLA 2DY4A 1HRHA 3SCXA 2D0AA 1BIUA 2X78A 3ASMA 1IKVA 2WONA 1NK0A 4W5NA 3ZT1A 4CIFA 1KSPA 4CGGA 5J2MA 4NCAA 3HYFA 3KLHA 3NHGA 2X74A 3L2QA 2DTUA 2BGGA 1JLEA 4AILC 3LALA 3I0RA 5CYMA 4CERA 1RTHA 4B9VA 3LAMA 2XY6A 4PY5A 2PYLA 1LAWA 1WLJA 3MXJA 4DTXA 3A2FA 5HRPA 3SYZA 5I42A 4F3OA 4M42A 3WNGA 3QIPA 1NK6A 3L8BA 3HPOA 3AVCA 1LV5A 3CYMA 1RTIA 1RTDA 3L2UA 3S3OA 1WSGA 3AA2A 3EYZA 3WNEA 2KFZA 3V81A 4CJFA 4BE0A 3LP1A 1MU2A 1C6VA 1RT1A 1S1WA 3CFRA 1EP4A 4CESA 3M8PA 1UOCA 3DRPA 4OJRA 4B9NA 2YNIA 4M3RA 3P83D 4HUEA 1S9GA 3KLIA 1VSHA 3H08A 4OLBA 2FBXA 3MXMA 3K58A 3NF8A 1BQNA 4WE1A 4CK3A 1ZBHA 4DTJA 4EZ6A 3CM6A 3AO2A 4M3XA 1Y97A 4EP4A 3NGZA 4I2QA 3HT3A 5FROA 1RT6A 2W42A 2RF2A 4HVJA 3LP0A 1L5UA 3L3VA 4E0DA 4E1MA 2XHBA 1IKYA 1NK7A 3DOLA 2F96A 5DK5A 4KKOA 1LWCA 2G8FA 3QINA 2IS3A 1IKXA 3K5NA 3SI6A 1VSIA 2A1RA 5FRNA 2HHTA 3O4NA 3VN5A 1XI1A 1RDCA 5SWMA 3QERA 3QESA 4JLHA 1HYZA 2YHAA 4W5OA 2X6NA 3G10A 3TAGA 4HHTA 1VK0A 2IAJA 4FW1A 2FBVA 1RCHA 4ID5A 3TR8A 3MAQA 1YT3A 2X6SA 1JXBA 4Z4CA 4O0IA 4CJ3A 3RMDA 1ZBLA 3DLHA 1KVAA 2YNGA 4RW7A 3CM5A 3RR8A 2VG5A 3O3HA 3SZ2A 3NF6A 3D0PA 3V9ZA 4DSJA 2QK9A 4FYDA 4CF8A 2RPIA 2VG6A 2XY8A 3ZSXA 2HNDA 3LAKA 5K14A 5HLFA 4QCLA 1UAXA 4CJRA 4CIEA 4K8ZA 1C1BA 2OPSA 1SKSA 3NE6A 4NCGA 4CF0A 4HTUA 4FCYA 2Y1IA 1XHZA 2G8UA 3OJUA 1SL0A 3VQDA 3AVIA 3OS0A 3I8DA 4F4KA 3PV8A 2KW4A 3OYLA 3KTQA 3KK1A 3SNNA 3C6UA 4DFKA 1HYSA 3SUNA 3VQ4A 1SKRA 4CEAA 4CJPA 4BDZA 1L3VA 2RKIA 1WNSA 5CYQA 4AHVA 4ELVA 3OJSA 2HHUA 2HVIA 4XIUA 2QXFA 2HNYA 1ITGA 3WNHA 3QEVA 3OS1A 1T05A 3M8RA 4DTUA 5KRTA 2DFHA 3OY9A 1RBUA 4DF8A 4CJEA 3TAFA 1SKWA 4E7IA 4AH9A 3QEIA 4OGEA 3AVBA 4CECA 2XRIA 3P5JA 3OYBA 3HJFA 4B3OA 3VA0A 4FK4A 1S5JA 1U04A 4CEDA 1VRTA 2IOCA 3V1RA 3RMCA 1UA0A 1ZYQA 1QS4A 3KK3A 4IKFA 1NK4A 1S1UA 1S6QA 3OYGA 1X9SA 4B9MA 3ZSYA 1HMVA 1EX4A 3P1GA 1X1PA 4OKEA 1BHLA 4CF2A 3HPGA 4DQRA 2XY7A 4Z4FA 1YVUA 1FKOA 3F9KA 5JS1A 4CJLA 3KK2A 3VQEA 3MEGA 1JXEA 3KJVA 4W5TA 4FM2A 2G8KA 4CJ5A 4Z4HA 4CFCA 1JL1A 1JLAA 3OYFA 4DWIA 5DMRA 4AHRA 1WSHA 3ZCMA 4EP5A 4CFBA 4CIGA 4FJMA 4KB0A 1KLNA 4CJQA 2HNZA 3SV4A 4DTSA 2D0CA 1NJXA 5JS2A 4ID1A 1U45A 1RDBA 3VA3A 1TL3A 1VSKA 3ZSOA 1R0AA 2ZQBA 1CZ9A 4C8KA 4C8LA 2E4LA 2ETJA 2BE2A 2FBTA 4KHUA 1TKXA 4C8OA 3AVHA 2NUBA 4AHTA 1VSDA 3THVA 2G8VA 4FZXC 1LWFA 1IG9A 1SUQA 3KLEA 1RDAA 4FJ9A 1RNHA 4KHYA 4CHYA 1KVBA 3HPHA 3AO1A 4ZTFA 1NKEA 4E3SA 1NOZA 3OYIA 5SZTA 2HMIA 2PZSA 2GBZA 4IBNA 4CHPA 4N5SA 2ATQA 1RDDA 3B6OA 2O4GA 1TVRA 3VQQA 3U3YA 1ZBFA 4YFUA 4N76A 1DTQA 1VSFA 5J2PA 3SQ1A 1NKBA 4ZHRA 4B8AB 4M3UA 4Z4EA 2Y1JA 3CQ8A 1HPZA 3M8SA 4I7FA 1TKTA 3HP9A 3B6PA 3IS9A 3JSMA 3NF7A 4OGCA 5T7BA 3HM9A 4DS5A 2B4JA 1EETA 5HP1A 1QTMA 2RN2A 3PY8A 4BE2A 2G8IA 4CGFA 3S9HA 4H8KA 4CEEA 2D5RA 4BE1A 2HHSA 1G15A 3K5OA 3NF9A 1X9MA 3IRXA 1O1WA 4FW2A 3SV3A 4KB1A 4Z4IA 4CFAA 3CFPA 4CHNA 2PYJA 4TSXA 1WSFA 4BDYA 2Z1JA 4DFJA 4DQIA 3L3UA 4DSKA 4B9UA 3KKSA 3RMBA 3PO5A 1Z25A 1BL3A 3SQ0A 3LPTA 4GMJB 4CJTA 3HSTB 3VQAA 3NBPA 4DSFA 2Z1IA 2Z1HA 4M3TA 3TANA 2EHGA 1HQUA 3ISNC 2WOMA 4E7LA 4O55A 4F2SA 2KZZA 1WAFA 2HB5A 1J5OA 5CZ1A 3TI0A 3ITHA 1TKZA 4FJXA 3NFAA 3NGYA 1GOBA 4FZZA 1RT4A 4R5PA 2Q3SA 3RTVA 1ASVA 1JLBA 2AJQA 3RRHA 1ASWA 4IFYA 4KTZA 1A5XA 3AVLA 4NYFA 4CGIA 1QSLA 3MEEA 2G8HA 4N41A 4OPJA 2R7YA 3LZIA 2Z1GA 2QKKA 4CGDA 3HXMA 3V6DA 3RWUA 3HP6A 3QETA 1ZBUA 4PQUA 4CEBA 3KLFA 1S9EA 4DTPA 1FXXA 4F8RA 2E6LA 1I3AA 1WSIA 5HRSA 4LSLA 5D3GA 1KVCA 4CK1A 2HHVA 4LD0A 4FLVA 4KAZA 1I39A 1UWBA 1EKEA 3HL8A 4LSNA 4OKJA 4JRPA 4OKKA 4Z0UA 4E7HA 3ZT4A 1VSEA 3K5MA 4BWJA 1RBSA 5HRRA 1YTAA 1XHXA 1NJWA 3JYTA 3TAQA 5HBMA 4RW6A 4OPKA 4I9QA 4H4OA 4CHQA 4KHSA 1JL2A 4NYNA 3ZSRA 4KHQA 4DTRA 3NAEA 3K57A 3ZT0A 3HK2A 4GVMA 4KI4A 4DQPA 3V9XA 3PX0A 4KFBA 3AV9A 1FK9A 1GOAA 1QQCA 3SQ4A 1J53A 4KRFA 4DLGA 2GV9A 5KRSA 4KHNA 4H4MA 4M41A 4FJGA 4KHWA 4YNQA 3SUQA 1NK8A 1U48A 1Q9XA 1CZBA 1T7PA 3AVJA 1T8EA 4DSIA 3QEXA 1BCOA 2IGIA 3F73A 4DMNA 1N6QA 4EZ9A 3UIQA 2YKMA 3ZSWA 2KQ2A 4DG1A 4I9LA 3OYKA 1D8YA 3LPUA 4FJNA 3ZSZA 1Z26A 4FJIA 1RT7A 3ZSQA 3DMJA 3VQ5A 4J2AA 3NDKA 2HW3A 4CFDA 1WSJA 4ZTJA 4Z4GA 4CGJA 4FLZA 4FJ7A 3KLGA 3AVFA 4CGHA 5J1EA 4K8XA 4OLAA 3DLGA 3CFOA 3C94A 3ALYA 1BCMA 4Q5VA 4DQQA 1BISA 4FLWA 1NOYA 4HCBA 3I0SA 4AHUA 4UQGA 1RBTA 2KFNA 3K59A 1JLGA 3KD1E 1K6YA 1L3TA 4CEQA 5KTQA 2B6AA 3TWHA 1JKHA 1SV5A 1TV6A 2OZMA 1HQEA 4FJHA 3ZT2A 3V1OA 3V9SA 3PX4A 3DLBA 4B8CA 4FLYA 2P1JA 2ZD1A 4DTNA 1HNIA 1TAQA 3DI6A 3VQ7A 1L3UA 4MFBA 2PY5A 4DSLA 4HUGA 1VRUA 1D9FA 3VQ8A 4RG8A 2HHXA 1VSMA 2A1SA 3AA5X 4C8MA 1BIZA 3T1AA 1HYVA 3RR7A 3NH0A 4CCHA 4ELUA 4DS4A 2FBYA 2YHBA 1X9WA 4FVMA 3SQ2A 1XWLA 1LWEA 1TK5A 2XO7A 4CJKA 3SPYA 1T03A 2DFFA 2YNHA 4FJ5A 2KTQA 1ZBIA 3MECA 4Y1CA 1TAUA 1SL1A 3D45A 3OYMA 3LP2A 4FLUA 1LW2A 4FJKA 1A5VA 1JLCA 1JLFA 2EX3A 2IDOA 3C95A 1DTTA 3NCIA 4JRQA 3HVTA 4O5BA 1REVA 2F8TA 4M3YA 1KLMA 3L2WA 5J2NA 1JLQA 4FZYA 4FK2A 1RT5A 4ICLA 3PX6A 1TL1A 4DF4A 2OPQA 2ZE2A 4IDKA 1CXQA 1RBRA 3LANA 4E1NA 3VQPA 1B9DA 3NH2A 3U6FA 1RT2A 3DM2A 4N47A 3TABA 3TARA 3S3NA 4CJVA 4Q0BA 4F2RA 3L2RA 1NK5A 1B9FA 2D0BA 1S1XA 3V9WA 3OYJA 1BGXT 4M3WA 3C6TA 4IG0A 4CHOA 4QAGA 3ZSVA 3LDSA 4FJ8A 5E41A 1J9AA 4FJJA 1C0UA 3OVNA 1NK9A 1IO2A 1IKWA 3KD5E 5HROA 1BI4A 3K5LA 2DFEA 4DU1A 1U4BA 1D9DA 1TGOA 3O4QA 2JGUA 3KIOA 4Y1DA 4CF1A 1BQMA 5HRNA 1RILA 2P5GA 3TAMA 5EU7A 1XC9A 3LP3A 3OYDA 4JS4A 2O4IA 4BACA 4O0JA 2YKNA 3LZJA 1S6PA 4PA1A 1QHTA 1B92A 1LW0A 3V1QA 3WNFA 2F8SA 4C8NA 3T19A 1FKPA 4CJSA 1Q8IA 1WSEA 1QSSA 2OYQA 1CXUA 1ASUA 3VQ9A 3AA4A 2I5JA 3IAYA 4KO0A 4J2BA 3AO5A 4CEFA 4J2DA 4FLTA 3ULDA 3OYAA 3E01A 3G0ZA 4E7KA 4DU3A 5FDLA 4CF9A 1C1CA 2QKBA 3QIOA 2ITGA 3L2VA 3RRGA 4HUFA 2P51A 1TKDA 4DTMA 3ZT3A 3EZ5A 4CEZA 1KFDA 2OPPA 2FC0A 4E19A 4JS5A 1NJZA 3V9UA 5KGXA 1N5YA 1LAVA 3QLHA 1WN7A 4OVLA 1L3SA 4HCCA 1C0TA 3AVKA 3EY1A 4PUOA 3V4IA 3LWMA 2XY5A 4CJUA 1QSYA 4B9TA 2OZSA 4AHCA 4FM0A 1W0HA 4DTOA 5C24A 2BDPA 3IG1A 1S1TA 4IG3A 3QNNA 2VWKA 3O3GA 2G8WA 4BDPA 4PWDA 1W9HA 2YNFA 3T3FA 1C0MA 3TAPA 4QOZB 2HVHA 4RW4A 4BWMA 2HHWA 1HJRA 1F21A 3MEDA 5CZ2A 4B9SA 1CLQA 4O4GA 1UA1A 4DQSA 1NJYA 3BGRA 1IH7A 5KGWA 1KRPA 2OPRA 3U3GA 2VWJA 3AVNA 4AHSA 4CE9A 3AO3A 1KFSA 3TAEA 4B9LA 4ELTA 4DU4A 1VSLA 4W5QA 1BI4B 4KI6A 3M8QA 4GW6A 4O44A 3DYAA 5KI6A 4CK2A 2E6MA 4N56A 3OYEA 3SUOA 3AVGA 3QO9A 3VQ6A 2KZMA 4L8RB 2B5JA 3VQCA 3AVMA 1RTJA 4FM1A
chains in the Genus database with same CATH superfamily
2P9IB 1HNVA 2O8CB 2GUIA 4I2PA 3QNOA 4F3TA 5JLFA 4CZLA 4CJWA 3JXUA 1RT3A 2NRVA 1I94K 1GOCA 4CHZA 1EXQA 1S22A 4X65K 4KH5A 3QEPA 4LY7A 3KKRA 4PKIA 2YV0X 3MXIA 4A62A 2F4VK 1U47A 2HHQA 5DM6L 3DLKA 4E7JA 3L6QA 4GKJK 4FSVA 4Y0WA 3CC4N 4BROA 3EN9A 2NRRA 3GBTA 4EAHD 2J4RA 5H1SQ 1VAZA 3O1WA 2X78A 1N32K 4KBOA 5MLCQ 3CMAN 2WONA 2JWLA 3MN5A 2OCEA 4A61A 4CIFA 4CGGA 1NG9A 3HYFA 3QBXA 2O8BB 3J8AA 1JLEA 4CERA 4IO9L 4PY5A 2PYLA 1WLJA 3SYZA 5CHIA 3UB5A 3THXB 4X66K 1HKGA 2D4WA 3L8BA 3THWB 3HPOA 3AVCA 3LDQA 3A5OC 3AA2A 2KFZA 3LP1A 1MU2A 1C6VA 4O5FA 3FGUA 1EP4A 3G25A 4CESA 4KHPK 1FJGK 3M8PA 3DRPA 2YHYA 1IJJA 4HUEA 3E1YA 1S9GA 4BR5A 2P9PB 4IDHA 3TSQA 4BRHA 3CM6A 3AO2A 4B9QA 4EP4A 4B1ZA 5FROA 3IDHA 4J8FA 3PIPL 3EL2A 3CIPA 4DV0K 1IKYA 4H0YB 2F96A 1HR0K 4MDBA 1LWCA 5AQQA 3QINA 1IKXA 1QZ5A 3K5NA 1VSIA 2A1RA 2HHTA 2D1KA 4JN4A 4K41A 4FWPA 1HYZA 2YHAA 3G10A 4JKAA 1VK0A 2FBVA 4ID5A 1QVFM 1YUWA 4Z4CA 3M5RA 4FWLA 4CJ3A 4DV6K 2ZJQL 1KVAA 2HBJA 5FPMA 2O8EB 5HLFA 4QCLA 4CJRA 5AQHA 4LF4K 1HUXA 2HBLA 4FOEA 1NNEA 2P9NB 3VQDA 5AQIA 3OYLA 3PV8A 3KTQA 3KK1A 4DV5K 2QWMA 3CQXA 4O8UA 4BRFA 4BDZA 5CYQA 4AHVA 2EWSA 1YHQN 4XIUA 2QA4N 1ITGA 3WNHA 1NWKA 1QQOA 1T05A 3F5TA 2V7ZA 5KRTA 1RBUA 1SKWA 4E7IA 3QEIA 3VF4A 2XRIA 3P5JA 3OYBA 3PIOL 2F7TA 3HJFA 5AQWA 1W97L 3F9MA 5FLXO 3VA0A 4GV6A 5AQPA 4CEDA 1VRTA 3ID8A 3V1RA 1ZYQA 3UKRA 4GKKK 1S1UA 3ZSYA 1Q82O 4AQYK 2P9UB 5M1NA 3WEEB 4LF7K 4IOAL 1YVUA 1FKOA 3CCVN 3F9KA 2VYPA 3KK2A 1NJIO 1JXEA 4W5TA 4CJ5A 4CFCA 2NRTA 2FSKA 4EP5A 3O08A 3A8YA 4CFBA 4IEIA 1NLVA 1D4XA 2FBTA 1TKXA 1HPMA 4C8OA 1LWFA 5BPLA 1IG9A 3TTFA 5BPMA 4JNEA 1KVBA 5KPTA 1QHAA 2QW9A 2PZSA 3WXIA 4N5SA 3U3YA 3KVGA 5E84A 1VSFA 5J2PA 4JKBA 4N76A 3UKUB 4Z4EA 1C0GA 3GDQA 4I7FA 1TKTA 3HP9A 2YJFA 5T7BA 4DS5A 1EETA 1QTMA 3PY8A 4CGFA 3ZETB 4R79A 2IIRA 1RDUA 3DJCA 4B3MK 3SV3A 4KB1A 5AR0A 4CFAA 5JVGL 4TSXA 2Z1JA 4DFJA 3L3UA 4A2BA 4DSKA 3K9JA 1BL3A 3KZBA 3LPTA 4GMJB 4CJTA 3HSTB 3VQAA 4DQ8A 4DSFA 2Z1IA 3T7ZA 2ZWHA 5BR9A 3TANA 5JMVA 4BVPA 4G9ZA 2W6LA 4O55A 2PAVA 4BG9A 4B1WB 5CZ1A 3RTVA 3RRHA 4X64K 3O8MA 4KTZA 3CJBA 4OPAA 2Z1GA 3QDKA 2QKKA 1P90A 2CH6A 2CH5A 4LF5K 1ZC6A 3BUZB 3MMVA 1S9EA 1FXXA 4BREA 5BN9A 1KVCA 1VQPN 2HHVA 4FLVA 4KAZA 1I39A 1UWBA 3HL8A 4LSNA 3OA9A 3OHRA 5EVZA 4Z0UA 5HRRA 4HTLA 3LDPA 4I9QA 4RW6A 4OPKA 3KWGA 3T69A 4KHQA 3HK2A 3PX0A 3ZEUA 1FK9A 1GOAA 1J53A 3O5BA 4BVOA 4IWVA 2YHWA 3JAMO 4M41A 5KRSA 4FJGA 4YNQA 2ZGYA 1U48A 1Q9XA 1XC3A 3QEXA 1BCOA 2IGIA 3F73A 1N6QA 2GUPA 3ZSWA 2KQ2A 4DG1A 2GWJA 2HW3A 1CZAN 3NDKA 4CFDA 4CZGA 4ILJA 4NLCA 4Z4GA 4FJ7A 1VQ7N 3AVFA 1MDUB 4H5NA 4K8XA 4Q5VA 1BISA 4DR7K 3I0SA 4AHUA 2KFNA 3K59A 3KD1E 1L3TA 3ZT2A 3V1OA 4IJAA 1W2BM 2IVNA 2FLOA 3DI6A 3U9DA 3H46O 3HZ6A 5BREA 2HHXA 4BRKA 1BIZA 3VPZA 3K9KA 1LWEA 3C6AA 2KTQA 2YNHA 3AAPA 4GNIA 4QS9A 1LW2A 5C2FA 1JLFA 1WUAA 4YOXA 2F8TA 4WQ5A 1OKJA 4DF4A 2OPQA 2ZE2A 4H0VB 4OX9K 3LANA 1J5EK 1B9DA 3U6FA 2H3GX 3TABA 1ATRA 2GELA 4CJVA 4Q0BA 1B9FA 1S1XA 4BY9C 4M3WA 3ZSVA 4FJJA 3OVNA 4JKCA 1NK9A 5EXWA 4H5WA 1GLJO 5HROA 3VERA 1U4BA 4A2AA 1TGOA 2JGUA 3KIOA 5HRNA 1RILA 4FWSA 3LP3A 4PA1A 2F8SA 3V1QA 2E5LK 2QWNA 3P38A 2P9LB 4U67L 4BR4A 1C0FA 1Q8IA 2OYQA 4JI1K 1CXUA 1ASUA 1BWFO 4WFAL 5BRDA 5F2RA 1KAXA 3IFRA 1NGJA 1GLDG 4CI6A 4JI8K 2RE2A 3E01A 3G0ZA 2E88A 4XH4A 2CGJA 2QKBA 3L2VA 4DTMA 3ZT3A 4I6MB 1KFDA 2FC0A 4MO5A 3CHWA 4HCCA 5KQDA 4PUOA 3SAHA 4FWOA 4CJUA 2Q1NA 4HWIA 1W0HA 1JCFA 1TYQA 4DTOA 4XEIA 3ZX0A 2QWQA 3ENBA 4QOZB 4K0KK 4BWMA 1CLQA 5CZ2A 3T1YK 3FZMA 3O9UA 1NGAA 1KRPA 4BRLA 4DU4A 4KI6A 4O44A 5AQGA 3AY9A 4H5TA 3C7NA 4PHTX 3WT0A 2B5JA 3THWA 3E66A 3CCJN 1QE1A 3WXJA 3QEWA 3VGMA 1E4GT 3FLCO 4E89A 2P5OA 1YF5L 5FRMA 4DUZK 3BDPA 3CMEN 3H45C 1C1AA 3ULEB 4DLEA 5KPRA 4IFEA 4JI2K 2IC3A 3SUPA 1NGGA 3K2PA 1U49A 4DFMA 1BU6O 4W5RA 1S1VA 4KTWA 4KPYA 2YHXA 1IBKK 5LJVA 3ATUA 4DFPA 4KTQA 2BANA 3NVMA 5AQYA 1VSJA 4B3TK 3PO4A 1DKGD 1RBVA 3QMLA 3J7YP 3LWLA 1KTQA 3MK6A 4NB4A 4WQ4C 4IFVA 1T3VA 3AVAA 3OS2A 2HBKA 3FFIA 4B1VA 5C42A 2DY4A 3HRGA 3SCXA 3EE8A 4IOXA 1NK0A 1IKVA 1KSPA 1IV0A 3KLHA 3NHGA 2X74A 2DTUA 4AILC 3I0RA 3OBYA 3LAMA 2XY6A 4FWKA 4JKGA 4M42A 5I42A 3A2FA 4OPHA 2UXDK 5GAGP 3DXMA 2ASOA 3ZETA 5AZIA 3VF6A 4CJFA 3MN6A 1UOCA 3AAQA 2YNIA 4M3RA 2O8BA 4LFBK 2I7PA 4FWRA 3NF8A 3G71N 4BRMA 4DV7K 4WE1A 1ZBHA 5AQLA 4EZ6A 1VQKN 4M3XA 1EO1A 1YXQA 2WTUA 2W41A 3NGZA 3HT3A 2W42A 2IVOA 2RF2A 1L5UA 1DEJA 2XHBA 1NK7A 3O9QA 4KKOA 2G8FA 4CZIA 2IS3A 1WBBA 3O4NA 3VN5A 3AGKA 3CCMN 2QWPA 4JLHA 4W5OA 3NVKA 3HBTA 2X6NA 1VQ8N 4HHTA 4FW1A 3TR8A 1LOTB 4WFNL 3MAQA 2X6SA 1NBWA 4BG8A 3DLHA 4DV4K 4B3SK 2VG5A 3D0PA 4DSJA 3V9ZA 2QK9A 3KWIA 1QQNA 4CF8A 4F9OA 3LAKA 1UAXA 4CIEA 1YJWN 4K8ZA 1C1BA 1SKSA 2Y1IA 3WEEA 2G8UA 3OS0A 3I8DA 4F4KA 4DCHA 3SNNA 4DFKA 1T44A 3SUNA 3VQ4A 1L3VA 2RKIA 1WNSA 1EWQA 2HHUA 2VQFK 4KH6A 3QEVA 3M8RA 2DFHA 3D7EO 3Q7CA 2UYTA 2VCPA 4DF8A 4YOUA 2Q31A 4B3OA 2KLAA 4BQLA 1SQKA 4IXCA 1U04A 2IOCA 1UA0A 3KK3A 4FPBA 3OYGA 1U2VB 1HMVA 2ZM6K 1EX4A 3ZYYX 4ILGB 4UY8O 4OKEA 3Q7BA 1HNXK 3MX5A 5LMNK 3KJVA 2G8KA 4M63C 3OYFA 3RSEA 1WSHA 2VGMA 3CCSN 4CIGA 1NJXA 2HNZA 1M1KO 1U45A 1VSKA 3H3OB 1P8ZA 2E4LA 2ETJA 4CD3A 3THVA 2NZTA 4JI4K 5TKYA 1SUQA 1SZ2A 4CHYA 3AO1A 4ZTFA 1NOZA 2WFBA 2GBZA 4CHPA 2ATQA 1N8RO 4YFUA 2O8FA 1DTQA 3SQ1A 4ZHRA 4B8AB 4M3UA 4JI3K 2D0OA 1HPZA 3M8SA 3FZHA 3NF7A 2B4JA 4FL9A 3WXLA 1NGBA 4BE1A 3IRXA 2PYJA 4CHNA 4DQIA 4YOYA 3ZLJA 4BQZA 3KKSA 3RMBA 3VGKA 3IUCA 4WYBA 3SQ0A 2Z1HA 4M3TA 5AQJA 1HQUA 1QQMA 3TI0A 4IO8A 2QTDA 1JLBA 4IFYA 3CCLN 4EHTA 3HXMA 3HP6A 3A0IX 4XH5A 1ZBUA 3QETA 4CEBA 4CZKA 3KLFA 2E6LA 1I3AA 5HRSA 4LSLA 4JYAK 4CK1A 4LD0A 4BC4A 4OKJA 2I7NA 3ZT4A 3K5MA 3E9PA 2F9WA 2QWRA 5JVHL 3K57A 5AQSA 4DQPA 3CQYA 3AV9A 1ATNA 2QWOA 4WFBL 1QQCA 2GV9A 1S3XA 4H4MA 3NMUA 4O8KA 3SUQA 3EO3A 3FFKB 3AVJA 4BC3A 1YIJN 3TU5A 4DMNA 2YKMA 3TSPA 2P9UA 1EWRA 4FJIA 3WXKA 3VQ5A 4J2AA 1WSJA 4ZTJA 4CGJA 2NLXA 5GADP 4OLAA 3SK3A 4PKHA 4UQGA 1RBTA 1JLGA 1K6YA 2NRHA 1JJ2M 3R1XA 3O9RA 4ISFA 4BR7A 4YOVA 3TWHA 1SV5A 1TV6A 1HQEA 2IVPA 3V9SA 3PX4A 4H0TB 4DTNA 1HNIA 2Q0UA 1TAQA 1G99A 1L3UA 2HF4A 2PY5A 4DSLA 2O8DA 3T1AA 3ULEA 1HYVA 3NH0A 1X9WA 2YHBA 4GVEA 4FVMA 1TK5A 3SPYA 2DFFA 4FJ5A 3O80A 4DKWA 3SBGA 1SL1A 3D45A 3OYMA 1KQSM 4CZJA 2IDOA 1DTTA 4O5BA 1REVA 4KH4A 5IT9O 3L2WA 4ICLA 1TL1A 2YJEA 1CXQA 1RBRA 4E1NA 4N47A 3ATVA 4F2RA 1Q18A 3L2RA 2D0BA 2P9KA 3THYA 1BGXT 3VGLA 3KK7A 3C6TA 5C0YA 5F1XA 5E41A 2F9TA 3LDNA 3N4QA 1IO2A 4MO4A 1D9DA 2P5GA 4Y1DA 2P9KB 1MWMA 1ZXOA 3CJ9A 5EU7A 3TAMA 1GLFO 3OYDA 4BACA 3LZJA 3D2EA 1QHTA 1B92A 3FE1A 3WNFA 4CJSA 2UUBK 2NRZA 4FWQA 5EOYA 3MCPA 2I5JA 1E3MA 4J2BA 5C12A 4JK9A 1VQNN 4H03B 1K8KB 3BZCA 3MWPA 1NGIA 3ULDA 3T1HK 3CJAA 3F2KA 4E7KA 2E2NA 5C10A 4JKGB 4CEZA 4E19A 2O8CA 4DR6K 1N5YA 1LAVA 3D2FB 3MN7A 3O4WA 1YVNA 2O8FB 3V4IA 3LWMA 1QSYA 4QS7A 5AQKA 1VQLN 3VEYA 3U4LA 4V19S 1C0MA 3TAPA 2ASMA 5BRHA 4AF1A 4O4GA 4DQSA 1VQ5N 2HSTA 3EZWA 3GG4A 5KGWA 2OPRA 3U3GA 4FPAA 2Q36A 4CCHA 3OYEA 5KI6A 4CZHA 3QO9A 3J7ZO 2GTDA 3VQ6A 4DHYA 1U6ZA 4EFHA 1Q9YA 3CG7A 2KHOA 2VG7A 4M7YA 4BRNA 2LSNA 5J2QA 3DOKA 2P9NA 1NKCA 4MQ3A 4KREA 4RW9A 1TK8A 3DRSA 1A5WA 3ENOA 1Z6RA 3R3LA 1QZ6A 4FLXA 3AO4A 3S3MA 1D5AA 2OA8A 4BRIA 3VTIA 1J54A 5I3UA 4NLBA 1FW6A 2JLEA 4BR2A 3HVRA 3SPZA 1ZBSA 4ISGA 4JI6K 3H1QA 4NCBA 4RW8A 5CY4A 3VEXA 4EHUA 3OTOK 4DR5K 3PUFA 4G1QA 3OYHA 1KAZA 1HRHA 5GAHP 2D0AA 4CW7B 1BIUA 3ASMA 3BEXA 5J2MA 4NCAA 3OW2M 1S72N 4IOCL 4LFCK 4K42A 3LALA 5CYMA 1LAWA 3MXJA 4M7XA 4DTXA 4E1JA 4F3OA 3L0QA 3QIPA 3M3ZA 5AQUA 1NK6A 1YI2N 1LV5A 1J6ZA 1RTIA 5FPDA 3SBTA 1WSGA 4K43A 3EE9A 3V81A 1S1WA 3CFRA 1Z05A 4B9NA 2P9LA 3KLIA 1VSHA 5BN8A 4DV3K 3DWLA 5IWAK 1X3NA 4DTJA 3FR0A 2OTLN 1WBDA 1Y97A 3MN9A 3H6EA 2RHKA 4JI5K 4HVJA 3U9ZA 3L3VA 4MDAA 4E1MA 2HMPA 3H3NO 1HNWK 2E2PA 5FPEA 3SI6A 1HKCA 3QERA 3UE5A 3QESA 1T6DA 3DXKA 3O9SA 3RSEB 3W0LA 4A59A 3TAGA 2A5XA 2BUPA 1Q7YO 4C1NK 4JAXA 1YT3A 1ZBLA 1JXBA 2P9SB 4O0IA 3RMDA 4WF9L 2YNGA 5GIOA 4B1UB 4FYDA 5AZJB 2HNDA 4BR0A 1BOTO 2GEMA 3UKUA 1U2VA 4DR3K 2FSJA 2OPSA 1Q81O 3C7NB 4NCGA 4CF0A 4HTUA 4FCYA 3OJUA 5AQXA 3AVIA 5EX5A 1RFQA 2GWKA 4I6MA 3C6UA 2FSNA 3IMXA 3OBWA 3HSCA 1HYSA 3PLAA 4CEAA 5AQRA 4JHDA 4ELVA 1T6CA 4NXMK 4CBUA 4MLHA 3J7AP 4EIAA 3C6HA 2KKZA 2FF6A 1V4TA 3OS1A 4DTUA 2ZJRL 1MA9B 4CJEA 3TAFA 4WQ5C 4AH9A 3AVBA 1S5JA 1S6QA 1WB9A 4DR1K 4B9MA 2HF3A 3LM2A 4YORA 3P1GA 5DM7L 4CVNE 5KQ8A 1BHLA 3O9TA 4DQRA 3HPGA 2XY7A 3WQUA 5I9EB 1NM1A 3VQEA 3MEGA 4FM2A 2AP1A 5DMRA 4AHRA 3ZCMA 3I33A 3W3DA 4FJMA 4KB0A 4CJQA 3SV4A 4DTSA 2D0CA 4ID1A 4C8KA 4C8LA 4DR4K 3ZSOA 2ZQBA 1CZ9A 2BE2A 1TUYA 3I56N 1IG8A 1VSDA 4AHTA 1GLBG 4L3QA 3KLEA 1RDAA 4FJ9A 1RNHA 4CZFA 1NKEA 2VWBA 1KAYA 4IBNA 2O8EA 1RDDA 4JKHA 1E4FT 1ZBFA 4XH1A 1NKBA 1BUPA 2WC9A 3CJ7A 3K0SA 3CQ8A 3IS9A 3JSMA 1OVYA 4YOWA 5HP1A 2E1ZA 3S9HA 3NF9A 1BG3A 3A5LC 3PSIA 2P9PA 4FW2A 1O1WA 4Z4IA 4JD2A 4BDYA 1TYQB 2WBNA 3CPEA 3PO5A 5JLHA 4FOIA 3NBPA 4YDUA 3THXA 4E7LA 2WOMA 5ADXA 1WAFA 2HB5A 2P9SA 3AGRA 2E20A 1TKZA 3ITHA 3TTDA 3NFAA 1VQ4N 4FJXA 2Q3SA 4FVUA 2O8DB 1ASVA 2AJQA 4JI0K 5BR8K 1ASWA 2G8HA 1QSLA 3MEEA 2YX6A 3RWUA 4JK8A 4PQUA 3J80O 4F8RA 1WSIA 5D3GA 4IZ9A 3JS6A 4E7HA 2JWKA 4BWJA 1YTAA 1XHXA 3VEVA 1NJWA 3JYTA 5HBMA 3FZLA 4JD2B 3QFUA 3EKUA 4KHSA 3EEQA 3L4QA 3ZSRA 3QB0A 3NAEA 4JV5K 3ZT0A 3LL3A 4GVMA 4BRAA 4KI4A 3V9XA 3VENA 3SQ4A 4KRFA 4DLGA 3M6GA 4KHNA 3E9LA 2E8AA 1CZBA 1IBMK 1T7PA 4RTFD 4EZ9A 3OYKA 1D8YA 4FJNA 3CCEN 1HJOA 4CGHA 5J1EA 3TSUA 3CFOA 4HCBA 1NOYA 4FLWA 5CE3A 1DT9A 2D0PA 4JKEA 3WUHA 4CEQA 1GLAG 2B6AA 5KTQA 4FJHA 2VGNA 4ILHA 3VQ7A 4MFBA 4BC5A 2PBDA 5LMUK 1VSMA 4C8MA 3J81O 3RR7A 4ELUA 2PFUA 2FBYA 2UXBK 1VQMN 1XWLA 1KXPA 2XO7A 1ZBIA 3MECA 3LP2A 4FLUA 1A5VA 1JLCA 2EX3A 3C95A 5M1KA 1N34K 4JRQA 3HVTA 2ZJPL 4M3YA 1KLMA 5AFUH 3P31A 1NU0A 1ATSA 3CCUN 4BGBA 4FZYA 3PX6A 2HOEA 5FPNA 3CCRN 3CERA 1RT2A 3DM2A 3TARA 2ZF5O 4BRQA 3V9WA 2QM1A 4FJ8A 4QAGA 3LDSA 3D2EB 1C0UA 5AQOA 3K5LA 4DU1A 5HOOA 2HBMA 4CF1A 1BA1A 1BQMA 3R6MA 1EQYA 1S6PA 1LW0A 4C8NA 4Z94A 1FKPA 1LCUA 1WSEA 1N36K 2NRXA 4H0XB 4KO0A 3SJHA 2QXLA 3AO5A 4CEFA 4J2DA 3OYAA 3D2FA 2UUAK 4CF9A 1C1CA 1GLCG 3MDQA 3RRGA 1NMNA 3DLLL 4HUFA 1TKDA 2OPPA 4JS5A 3V9UA 5KGXA 3QLHA 4OVLA 3U8XA 3AVKA 4QS8A 3C65A 2XY5A 4B9TA 2OZSA 4AHCA 4FM0A 1XMQK 2BDPA 3IG1A 1OH5A 1S1TA 4BRGA 1TUUA 4IG3A 2VWKA 3O3GA 3QNNA 2G8WA 1Y64A 5AQFA 2YNFA 3T3FA 4BDPA 4PWDA 1W7AA 5AZIB 4WQ4A 2HVHA 4PL8A 2HHWA 1HJRA 1F21A 4B9SA 1NJYA 2YI1A 1X3MA 3BGRA 5F0XA 1IH7A 3MX2A 2VWJA 3BZKA 3AO3A 1KFSA 5GINA 4B9LA 1BI4B 5JS1A 4N56A 3DYAA 2E6MA 3AVGA 2KZMA 4L8RB 4H0PA 4CGIA 3ZX2A 1H1VA 1RTJA 3OY9A 4FM1A 4FO0A 3CJCA 3MCAB 3DLEA 3A5NC 3AA3A 4FK0A 3TTCA 1OVQA 3O3FA 1WAJA 3NGIA 1ILYA 3SJJA 4K25A 2NRWA 3HO1A 1DLOA 4LH4A 4YDUC 4CEOA 1HNZK 4M45A 4FXDA 4LH5A 3OYNA 3LM9A 3OYCA 5C15A 1Q86O 3VQBA 4BRCA 4M3ZA 1SL2A 1YTUA 1XMOK 3DRRA 3HI0A 1KCFA 4B08A 1YAGA 1TK0A 3VF2A 3PSFA 4CJ4A 4PL7A 1YJ9N 3O6WA 3VMFB 3S41A 1K73O 4CBXA 3RMAA 4DUYK 3DLRA 5C25A 4KV8A 3NH1A 4J2EA 4DSEA 4FJLA 4MLEA 1BA0A 1VQ6N 3ZT1A 4W5NA 1YJNN 1M90O 2W40A 3WQTA 3L2QA 1VQON 2BGGA 4GV3A 1RTHA 4B9VA 3CETA 5ADXH 5HRPA 2FF3B 3WNGA 2E2OA 3CYMA 1RTDA 3L2UA 3S3OA 4JHDB 3EYZA 3WNEA 4LFAK 4BE0A 3LDLA 1RT1A 2BTFA 2ZGZA 3D6RA 4OJRA 3P83D 3H08A 4OLBA 2FBXA 3MXMA 3K58A 3AARA 1BQNA 4CK3A 1NGFA 5AZJA 4I2QA 1RT6A 4A57A 3LP0A 4E0DA 3DOLA 1XQSC 1RDWX 5DK5A 2CGKA 2A3ZA 4A5AA 3RVCA 1QVGM 1DGKN 5FRNA 4BGAA 1XI1A 3E9OA 2DPNA 1RDCA 5SWMA 2UUCK 1RGIA 1VQ9N 4H0OA 3ZX3A 2AA4A 4AM6A 4CD1A 3ID6A 2IAJA 1RCHA 2UU9K 3P4IA 3CF5L 5LY3A 3VETA 5TKWA 3RR8A 4RW7A 3CM5A 3O3HA 3SZ2A 3NF6A 2QWLA 2RPIA 2VG6A 2XY8A 3ZSXA 2FXUA 2P9IA 5K14A 1BO5O 3R9PA 3BP8A 3NE6A 4LC9B 1XHZA 5M1PA 1SL0A 1NGHA 5EY4A 1HKBA 2CGLA 5AQZA 2KW4A 5AQVA 1SKRA 3O1BA 4CJPA 4IJNA 1X9JA 3OJSA 2HVIA 2QXFA 2HNYA 2W6KA 3L4IA 3IKMA 4BR9A 3VEWA 4OGEA 4CECA 3EKSA 5AQMA 4FK4A 4YHHK 3RMCA 3CPWM 4IKFA 1QS4A 1NK4A 1X9SA 4H5RA 4C23A 4CJ7A 1X1PA 1WOQA 5A2QO 4CF2A 4Z4FA 2V7YA 4CJLA 4Z4HA 1JL1A 1JLAA 4DWIA 1BDGA 3CCQN 2E2QA 1KLNA 5JS2A 1O13A 1RDBA 3VA3A 1TL3A 1R0AA 1VHXA 4KHUA 2Q0RA 3AVHA 2A41A 2NUBA 4CZEA 4OO1J 2G8VA 4WCEL 2OANA 4FZXC 4KHYA 3HPHA 4E3SA 3OYIA 5SZTA 3HOTA 2HMIA 4DV2K 4X62K 4ISEA 2O4GA 3B6OA 1TVRA 3VQQA 3QFPA 3SMPA 1NMDA 3CJ1A 2Y1JA 1KC8O 5ELZA 3CXCM 4AM7A 3VTHA 4PKGA 3B6PA 4OGCA 5M1QA 3HM9A 2RN2A 3UKRB 3N4PA 4BE2A 1XNRK 2G8IA 4H8KA 4CEEA 1JCGA 2D5RA 2HHSA 1G15A 3K5OA 1X9MA 4YOTA 2WUSA 2GX9A 3CFPA 1WSFA 1GLLO 4LF6K 4B9UA 1MWKA 3DAWA 1Z25A 3G6EN 3R8EA 3HOSA 1IBLK 2EHGA 3ISNC 5GAEP 4F2SA 2KZZA 1J5OA 2BH1A 1GOBA 3NGYA 4FZZA 1RT4A 4R5PA 4FWMA 4JKDA 1A5XA 3AVLA 4NYFA 4N41A 4OPJA 2R7YA 3LZIA 3CD6N 4CGDA 3V6DA 1OH7A 3BF3A 2NNWA 4DTPA 3SMSA 2ASPA 3QICA 1EKEA 4U7BA 4JRPA 4OKKA 5E26A 3WXMB 1KD1O 4CBWA 1VSEA 1RBSA 4A5BA 5CR4A 1V4SA 3TAQA 3C0BA 4LF8K 4BC2A 4H4OA 1HLUA 4CHQA 3BY5A 1K8AO 3VESA 2ITMA 1JL2A 4NYNA 4DTRA 2V52B 1OH8A 4KFBA 2E1YA 5AQNA 3H1VX 5BPNA 4KHWA 3VEOA 4RWTA 1NK8A 1OH6A 4JKFA 1T8EA 4DSIA 2Q97A 3UIQA 4I9LA 5BRFA 3LPUA 3ZSZA 1Z26A 4NXNK 1RT7A 3HM8A 3DMJA 3ZSQA 5B8HA 3DXKB 4IEEA 4FLZA 3DXMB 3KLGA 3DLGA 4DQQA 3C94A 3ALYA 1BCMA 4BRPA 1K9MO 3SAFA 3CC7N 2HHHK 4GV9A 1GLEG 2OZMA 1JKHA 3GOIA 2VQEK 5C2DA 3DLBA 4B8CA 4FLYA 2P1JA 2ZD1A 2A6AA 3ZEUB 1NGDA 4HUGA 1VRUA 1D9FA 3VQ8A 4RG8A 4JI7K 2A1SA 3AA5X 3HTVA 4DS4A 5JICA 4DV1K 3SQ2A 3VOVA 1T03A 4CJKA 4DR2K 4Y1CA 4B1YB 1TAUA 3SAGA 4FJKA 5GIPA 1N33K 3NCIA 2A42A 2A40A 3FZKA 4LF9K 3ENHA 5J2NA 1JLQA 4FK2A 5M1OA 1ESVA 1RT5A 4IDKA 3A5MC 3VQPA 4B1XB 3NH2A 3S3NA 3VEZA 1NK5A 2OTJN 1JCEA 3OYJA 1XUPO 4IG0A 4CHOA 4NO7A 3QBWA 1J9AA 5AQTA 3GL1A 4JK7A 1IKWA 3KD5E 5LJWA 1BI4A 2DFEA 3O4QA 3G4SN 1XC9A 4JS4A 2O4IA 4O0JA 3BF1A 2YKNA 5HL7L 3T19A 5LL6Z 1QSSA 3VQ9A 3KHYA 3AA4A 3IAYA 4C1NI 3I8BA 5M1FA 1HX1A 4CZMA 1NGCA 4FLTA 3CC2N 4RCHA 4DU3A 5FDLA 3QIOA 2ITGA 2QEXN 3THYB 1SS6A 2P51A 2V51B 3EZ5A 1XNQK 1NJZA 4GY2B 1WN7A 1L3SA 1C0TA 3EY1A 4FWNA 1YITN 2QI2A 2Q2RA 4B3RK 5C24A 3GE1A 1R59O 3P39A 1W9HA 5KPZA 3CI5A 1NGEA 3MWTA 4RW4A 4H5VA 3I55N 3MEDA 1SAZA 2YCHA 1UA1A 2UXCK 5AFUA 1K8KA 3AVNA 4JEPA 3SLCA 4AHSA 4CE9A 4YY3K 3TAEA 4ELTA 1VSLA 3LDOA 4W5QA 3M8QA 4CK2A 3B8AX 3FZFA 4GW6A 3SUOA 4BRDA 5AJ3K 4DB3A 3M1FA 3VQCA 3AVMA 3TPQA
chains in the Genus database with same CATH topology
1Q9YA 1HNVA 3DLEA 2GUIA 3CG7A 1QE1A 2VG7A 4I2PA 3QNOA 3AA3A 4F3TA 2LSNA 4FK0A 5J2QA 3QEWA 3DOKA 3O3FA 1WAJA 4E89A 2P5OA 5FRMA 3BDPA 3NGIA 4CJWA 3SJJA 1NKCA 4MQ3A 1C1AA 1RT3A 4KREA 4RW9A 4DLEA 1TK8A 3HO1A 3DRSA 1A5WA 1DLOA 1GOCA 4CHZA 2IC3A 4FLXA 3SUPA 3AO4A 4LH4A 4CEOA 1EXQA 3K2PA 3S3MA 1D5AA 4DFMA 1U49A 4W5RA 1S1VA 4KTWA 1J54A 3QEPA 2OA8A 4LY7A 4M45A 4KPYA 3KKRA 4FXDA 5I3UA 2JLEA 2YV0X 4LH5A 3OYNA 3MXIA 3HVRA 3OYCA 4DFPA 4KTQA 2BANA 3VQBA 3SPZA 1U47A 2HHQA 4M3ZA 4E7JA 3DLKA 1SL2A 1YTUA 4NCBA 1VSJA 4RW8A 3PO4A 1RBVA 3DRRA 1KCFA 5CY4A 4B08A 3LWLA 1KTQA 1TK0A 4CJ4A 4IFVA 3AVAA 3PUFA 3OS2A 4G1QA 3FFIA 3RMAA 3DLRA 3OYHA 5C25A 4KV8A 3NH1A 5C42A 4J2EA 4DSEA 4FJLA 2DY4A 1HRHA 3SCXA 2D0AA 1BIUA 2X78A 3ASMA 1IKVA 2WONA 1NK0A 4W5NA 3ZT1A 4CIFA 1KSPA 4CGGA 5J2MA 4NCAA 3HYFA 3KLHA 3NHGA 2X74A 3L2QA 2DTUA 2BGGA 1JLEA 4AILC 3LALA 3I0RA 5CYMA 4CERA 1RTHA 4B9VA 3LAMA 2XY6A 4PY5A 2PYLA 1LAWA 1WLJA 3MXJA 4DTXA 3A2FA 5HRPA 3SYZA 5I42A 4F3OA 4M42A 3WNGA 3QIPA 1NK6A 3L8BA 3HPOA 3AVCA 1LV5A 3CYMA 1RTIA 1RTDA 3L2UA 3S3OA 1WSGA 3AA2A 3EYZA 3WNEA 2KFZA 3V81A 4CJFA 4BE0A 3LP1A 1MU2A 1C6VA 1RT1A 1S1WA 3CFRA 1EP4A 4CESA 3M8PA 1UOCA 3DRPA 4OJRA 4B9NA 2YNIA 4M3RA 3P83D 4HUEA 1S9GA 3KLIA 1VSHA 3H08A 4OLBA 2FBXA 3MXMA 3K58A 3NF8A 1BQNA 4WE1A 4CK3A 1ZBHA 4DTJA 4EZ6A 3CM6A 3AO2A 4M3XA 1Y97A 4EP4A 3NGZA 4I2QA 3HT3A 5FROA 1RT6A 2W42A 2RF2A 4HVJA 3LP0A 1L5UA 3L3VA 4E0DA 4E1MA 2XHBA 1IKYA 1NK7A 3DOLA 2F96A 5DK5A 4KKOA 1LWCA 2G8FA 3QINA 2IS3A 1IKXA 3K5NA 3SI6A 1VSIA 2A1RA 5FRNA 2HHTA 3O4NA 3VN5A 1XI1A 1RDCA 5SWMA 3QERA 3QESA 4JLHA 1HYZA 2YHAA 4W5OA 2X6NA 3G10A 3TAGA 4HHTA 1VK0A 2IAJA 4FW1A 2FBVA 1RCHA 4ID5A 3TR8A 3MAQA 1YT3A 2X6SA 1JXBA 4Z4CA 4O0IA 4CJ3A 3RMDA 1ZBLA 3DLHA 1KVAA 2YNGA 4RW7A 3CM5A 3RR8A 2VG5A 3O3HA 3SZ2A 3NF6A 3D0PA 3V9ZA 4DSJA 2QK9A 4FYDA 4CF8A 2RPIA 2VG6A 2XY8A 3ZSXA 2HNDA 3LAKA 5K14A 5HLFA 4QCLA 1UAXA 4CJRA 4CIEA 4K8ZA 1C1BA 2OPSA 1SKSA 3NE6A 4NCGA 4CF0A 4HTUA 4FCYA 2Y1IA 1XHZA 2G8UA 3OJUA 1SL0A 3VQDA 3AVIA 3OS0A 3I8DA 4F4KA 3PV8A 2KW4A 3OYLA 3KTQA 3KK1A 3SNNA 3C6UA 4DFKA 1HYSA 3SUNA 3VQ4A 1SKRA 4CEAA 4CJPA 4BDZA 1L3VA 2RKIA 1WNSA 5CYQA 4AHVA 4ELVA 3OJSA 2HHUA 2HVIA 4XIUA 2QXFA 2HNYA 1ITGA 3WNHA 3QEVA 3OS1A 1T05A 3M8RA 4DTUA 5KRTA 2DFHA 3OY9A 1RBUA 4DF8A 4CJEA 3TAFA 1SKWA 4E7IA 4AH9A 3QEIA 4OGEA 3AVBA 4CECA 2XRIA 3P5JA 3OYBA 3HJFA 4B3OA 3VA0A 4FK4A 1S5JA 1U04A 4CEDA 1VRTA 2IOCA 3V1RA 3RMCA 1UA0A 1ZYQA 1QS4A 3KK3A 4IKFA 1NK4A 1S1UA 1S6QA 3OYGA 1X9SA 4B9MA 3ZSYA 1HMVA 1EX4A 3P1GA 1X1PA 4OKEA 1BHLA 4CF2A 3HPGA 4DQRA 2XY7A 4Z4FA 1YVUA 1FKOA 3F9KA 5JS1A 4CJLA 3KK2A 3VQEA 3MEGA 1JXEA 3KJVA 4W5TA 4FM2A 2G8KA 4CJ5A 4Z4HA 4CFCA 1JL1A 1JLAA 3OYFA 4DWIA 5DMRA 4AHRA 1WSHA 3ZCMA 4EP5A 4CFBA 4CIGA 4FJMA 4KB0A 1KLNA 4CJQA 2HNZA 3SV4A 4DTSA 2D0CA 1NJXA 5JS2A 4ID1A 1U45A 1RDBA 3VA3A 1TL3A 1VSKA 3ZSOA 1R0AA 2ZQBA 1CZ9A 4C8KA 4C8LA 2E4LA 2ETJA 2BE2A 2FBTA 4KHUA 1TKXA 4C8OA 3AVHA 2NUBA 4AHTA 1VSDA 3THVA 2G8VA 4FZXC 1LWFA 1IG9A 1SUQA 3KLEA 1RDAA 4FJ9A 1RNHA 4KHYA 4CHYA 1KVBA 3HPHA 3AO1A 4ZTFA 1NKEA 4E3SA 1NOZA 3OYIA 5SZTA 2HMIA 2PZSA 2GBZA 4IBNA 4CHPA 4N5SA 2ATQA 1RDDA 3B6OA 2O4GA 1TVRA 3VQQA 3U3YA 1ZBFA 4YFUA 4N76A 1DTQA 1VSFA 5J2PA 3SQ1A 1NKBA 4ZHRA 4B8AB 4M3UA 4Z4EA 2Y1JA 3CQ8A 1HPZA 3M8SA 4I7FA 1TKTA 3HP9A 3B6PA 3IS9A 3JSMA 3NF7A 4OGCA 5T7BA 3HM9A 4DS5A 2B4JA 1EETA 5HP1A 1QTMA 2RN2A 3PY8A 4BE2A 2G8IA 4CGFA 3S9HA 4H8KA 4CEEA 2D5RA 4BE1A 2HHSA 1G15A 3K5OA 3NF9A 1X9MA 3IRXA 1O1WA 4FW2A 3SV3A 4KB1A 4Z4IA 4CFAA 3CFPA 4CHNA 2PYJA 4TSXA 1WSFA 4BDYA 2Z1JA 4DFJA 4DQIA 3L3UA 4DSKA 4B9UA 3KKSA 3RMBA 3PO5A 1Z25A 1BL3A 3SQ0A 3LPTA 4GMJB 4CJTA 3HSTB 3VQAA 3NBPA 4DSFA 2Z1IA 2Z1HA 4M3TA 3TANA 2EHGA 1HQUA 3ISNC 2WOMA 4E7LA 4O55A 4F2SA 2KZZA 1WAFA 2HB5A 1J5OA 5CZ1A 3TI0A 3ITHA 1TKZA 4FJXA 3NFAA 3NGYA 1GOBA 4FZZA 1RT4A 4R5PA 2Q3SA 3RTVA 1ASVA 1JLBA 2AJQA 3RRHA 1ASWA 4IFYA 4KTZA 1A5XA 3AVLA 4NYFA 4CGIA 1QSLA 3MEEA 2G8HA 4N41A 4OPJA 2R7YA 3LZIA 2Z1GA 2QKKA 4CGDA 3HXMA 3V6DA 3RWUA 3HP6A 3QETA 1ZBUA 4PQUA 4CEBA 3KLFA 1S9EA 4DTPA 1FXXA 4F8RA 2E6LA 1I3AA 1WSIA 5HRSA 4LSLA 5D3GA 1KVCA 4CK1A 2HHVA 4LD0A 4FLVA 4KAZA 1I39A 1UWBA 1EKEA 3HL8A 4LSNA 4OKJA 4JRPA 4OKKA 4Z0UA 4E7HA 3ZT4A 1VSEA 3K5MA 4BWJA 1RBSA 5HRRA 1YTAA 1XHXA 1NJWA 3JYTA 3TAQA 5HBMA 4RW6A 4OPKA 4I9QA 4H4OA 4CHQA 4KHSA 1JL2A 4NYNA 3ZSRA 4KHQA 4DTRA 3NAEA 3K57A 3ZT0A 3HK2A 4GVMA 4KI4A 4DQPA 3V9XA 3PX0A 4KFBA 3AV9A 1FK9A 1GOAA 1QQCA 3SQ4A 1J53A 4KRFA 4DLGA 2GV9A 5KRSA 4KHNA 4H4MA 4M41A 4FJGA 4KHWA 4YNQA 3SUQA 1NK8A 1U48A 1Q9XA 1CZBA 1T7PA 3AVJA 1T8EA 4DSIA 3QEXA 1BCOA 2IGIA 3F73A 4DMNA 1N6QA 4EZ9A 3UIQA 2YKMA 3ZSWA 2KQ2A 4DG1A 4I9LA 3OYKA 1D8YA 3LPUA 4FJNA 3ZSZA 1Z26A 4FJIA 1RT7A 3ZSQA 3DMJA 3VQ5A 4J2AA 3NDKA 2HW3A 4CFDA 1WSJA 4ZTJA 4Z4GA 4CGJA 4FLZA 4FJ7A 3KLGA 3AVFA 4CGHA 5J1EA 4K8XA 4OLAA 3DLGA 3CFOA 3C94A 3ALYA 1BCMA 4Q5VA 4DQQA 1BISA 4FLWA 1NOYA 4HCBA 3I0SA 4AHUA 4UQGA 1RBTA 2KFNA 3K59A 1JLGA 3KD1E 1K6YA 1L3TA 4CEQA 5KTQA 2B6AA 3TWHA 1JKHA 1SV5A 1TV6A 2OZMA 1HQEA 4FJHA 3ZT2A 3V1OA 3V9SA 3PX4A 3DLBA 4B8CA 4FLYA 2P1JA 2ZD1A 4DTNA 1HNIA 1TAQA 3DI6A 3VQ7A 1L3UA 4MFBA 2PY5A 4DSLA 4HUGA 1VRUA 1D9FA 3VQ8A 4RG8A 2HHXA 1VSMA 2A1SA 3AA5X 4C8MA 1BIZA 3T1AA 1HYVA 3RR7A 3NH0A 4CCHA 4ELUA 4DS4A 2FBYA 2YHBA 1X9WA 4FVMA 3SQ2A 1XWLA 1LWEA 1TK5A 2XO7A 4CJKA 3SPYA 1T03A 2DFFA 2YNHA 4FJ5A 2KTQA 1ZBIA 3MECA 4Y1CA 1TAUA 1SL1A 3D45A 3OYMA 3LP2A 4FLUA 1LW2A 4FJKA 1A5VA 1JLCA 1JLFA 2EX3A 2IDOA 3C95A 1DTTA 3NCIA 4JRQA 3HVTA 4O5BA 1REVA 2F8TA 4M3YA 1KLMA 3L2WA 5J2NA 1JLQA 4FZYA 4FK2A 1RT5A 4ICLA 3PX6A 1TL1A 4DF4A 2OPQA 2ZE2A 4IDKA 1CXQA 1RBRA 3LANA 4E1NA 3VQPA 1B9DA 3NH2A 3U6FA 1RT2A 3DM2A 4N47A 3TABA 3TARA 3S3NA 4CJVA 4Q0BA 4F2RA 3L2RA 1NK5A 1B9FA 2D0BA 1S1XA 3V9WA 3OYJA 1BGXT 4M3WA 3C6TA 4IG0A 4CHOA 4QAGA 3ZSVA 3LDSA 4FJ8A 5E41A 1J9AA 4FJJA 1C0UA 3OVNA 1NK9A 1IO2A 1IKWA 3KD5E 5HROA 1BI4A 3K5LA 2DFEA 4DU1A 1U4BA 1D9DA 1TGOA 3O4QA 2JGUA 3KIOA 4Y1DA 4CF1A 1BQMA 5HRNA 1RILA 2P5GA 3TAMA 5EU7A 1XC9A 3LP3A 3OYDA 4JS4A 2O4IA 4BACA 4O0JA 2YKNA 3LZJA 1S6PA 4PA1A 1QHTA 1B92A 1LW0A 3V1QA 3WNFA 2F8SA 4C8NA 3T19A 1FKPA 4CJSA 1Q8IA 1WSEA 1QSSA 2OYQA 1CXUA 1ASUA 3VQ9A 3AA4A 2I5JA 3IAYA 4KO0A 4J2BA 3AO5A 4CEFA 4J2DA 4FLTA 3ULDA 3OYAA 3E01A 3G0ZA 4E7KA 4DU3A 5FDLA 4CF9A 1C1CA 2QKBA 3QIOA 2ITGA 3L2VA 3RRGA 4HUFA 2P51A 1TKDA 4DTMA 3ZT3A 3EZ5A 4CEZA 1KFDA 2OPPA 2FC0A 4E19A 4JS5A 1NJZA 3V9UA 5KGXA 1N5YA 1LAVA 3QLHA 1WN7A 4OVLA 1L3SA 4HCCA 1C0TA 3AVKA 3EY1A 4PUOA 3V4IA 3LWMA 2XY5A 4CJUA 1QSYA 4B9TA 2OZSA 4AHCA 4FM0A 1W0HA 4DTOA 5C24A 2BDPA 3IG1A 1S1TA 4IG3A 3QNNA 2VWKA 3O3GA 2G8WA 4BDPA 4PWDA 1W9HA 2YNFA 3T3FA 1C0MA 3TAPA 4QOZB 2HVHA 4RW4A 4BWMA 2HHWA 1HJRA 1F21A 3MEDA 5CZ2A 4B9SA 1CLQA 4O4GA 1UA1A 4DQSA 1NJYA 3BGRA 1IH7A 5KGWA 1KRPA 2OPRA 3U3GA 2VWJA 3AVNA 4AHSA 4CE9A 3AO3A 1KFSA 3TAEA 4B9LA 4ELTA 4DU4A 1VSLA 4W5QA 1BI4B 4KI6A 3M8QA 4GW6A 4O44A 3DYAA 5KI6A 4CK2A 2E6MA 4N56A 3OYEA 3SUOA 3AVGA 3QO9A 3VQ6A 2KZMA 4L8RB 2B5JA 3VQCA 3AVMA 1RTJA 4FM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9Y A;  1HNV A;  3DLE A;  2GUI A;  3CG7 A;  1QE1 A;  2VG7 A;  4I2P A;  3QNO A;  3AA3 A;  4F3T A;  2LSN A;  4FK0 A;  5J2Q A;  3QEW A;  3DOK A;  3O3F A;  1WAJ A;  4E89 A;  2P5O A;  5FRM A;  3BDP A;  3NGI A;  4CJW A;  3SJJ A;  1NKC A;  4MQ3 A;  1C1A A;  1RT3 A;  4KRE A;  4RW9 A;  4DLE A;  1TK8 A;  3HO1 A;  3DRS A;  1A5W A;  1DLO A;  1GOC A;  4CHZ A;  2IC3 A;  4FLX A;  3SUP A;  3AO4 A;  4LH4 A;  4CEO A;  1EXQ A;  3K2P A;  3S3M A;  1D5A A;  4DFM A;  1U49 A;  4W5R A;  1S1V A;  4KTW A;  1J54 A;  3QEP A;  2OA8 A;  4LY7 A;  4M45 A;  4KPY A;  3KKR A;  4FXD A;  5I3U A;  2JLE A;  2YV0 X;  4LH5 A;  3OYN A;  3MXI A;  3HVR A;  3OYC A;  4DFP A;  4KTQ A;  2BAN A;  3VQB A;  3SPZ A;  1U47 A;  2HHQ A;  4M3Z A;  4E7J A;  3DLK A;  1SL2 A;  1YTU A;  4NCB A;  1VSJ A;  4RW8 A;  3PO4 A;  1RBV A;  3DRR A;  1KCF A;  5CY4 A;  4B08 A;  3LWL A;  1KTQ A;  1TK0 A;  4CJ4 A;  4IFV A;  3AVA A;  3PUF A;  3OS2 A;  4G1Q A;  3FFI A;  3RMA A;  3DLR A;  3OYH A;  5C25 A;  4KV8 A;  3NH1 A;  5C42 A;  4J2E A;  4DSE A;  4FJL A;  2DY4 A;  1HRH A;  3SCX A;  2D0A A;  1BIU A;  2X78 A;  3ASM A;  1IKV A;  2WON A;  1NK0 A;  4W5N A;  3ZT1 A;  4CIF A;  1KSP A;  4CGG A;  5J2M A;  4NCA A;  3HYF A;  3KLH A;  3NHG A;  2X74 A;  3L2Q A;  2DTU A;  2BGG A;  1JLE A;  4AIL C;  3LAL A;  3I0R A;  5CYM A;  4CER A;  1RTH A;  4B9V A;  3LAM A;  2XY6 A;  4PY5 A;  2PYL A;  1LAW A;  1WLJ A;  3MXJ A;  4DTX A;  3A2F A;  5HRP A;  3SYZ A;  5I42 A;  4F3O A;  4M42 A;  3WNG A;  3QIP A;  1NK6 A;  3L8B A;  3HPO A;  3AVC A;  1LV5 A;  3CYM A;  1RTI A;  1RTD A;  3L2U A;  3S3O A;  1WSG A;  3AA2 A;  3EYZ A;  3WNE A;  2KFZ A;  3V81 A;  4CJF A;  4BE0 A;  3LP1 A;  1MU2 A;  1C6V A;  1RT1 A;  1S1W A;  3CFR A;  1EP4 A;  4CES A;  3M8P A;  1UOC A;  3DRP A;  4OJR A;  4B9N A;  2YNI A;  4M3R A;  3P83 D;  4HUE A;  1S9G A;  3KLI A;  1VSH A;  3H08 A;  4OLB A;  2FBX A;  3MXM A;  3K58 A;  3NF8 A;  1BQN A;  4WE1 A;  4CK3 A;  1ZBH A;  4DTJ A;  4EZ6 A;  3CM6 A;  3AO2 A;  4M3X A;  1Y97 A;  4EP4 A;  3NGZ A;  4I2Q A;  3HT3 A;  5FRO A;  1RT6 A;  2W42 A;  2RF2 A;  4HVJ A;  3LP0 A;  1L5U A;  3L3V A;  4E0D A;  4E1M A;  2XHB A;  1IKY A;  1NK7 A;  3DOL A;  2F96 A;  5DK5 A;  4KKO A;  1LWC A;  2G8F A;  3QIN A;  2IS3 A;  1IKX A;  3K5N A;  3SI6 A;  1VSI A;  2A1R A;  5FRN A;  2HHT A;  3O4N A;  3VN5 A;  1XI1 A;  1RDC A;  5SWM A;  3QER A;  3QES A;  4JLH A;  1HYZ A;  2YHA A;  4W5O A;  2X6N A;  3G10 A;  3TAG A;  4HHT A;  1VK0 A;  2IAJ A;  4FW1 A;  2FBV A;  1RCH A;  4ID5 A;  3TR8 A;  3MAQ A;  1YT3 A;  2X6S A;  1JXB A;  4Z4C A;  4O0I A;  4CJ3 A;  3RMD A;  1ZBL A;  3DLH A;  1KVA A;  2YNG A;  4RW7 A;  3CM5 A;  3RR8 A;  2VG5 A;  3O3H A;  3SZ2 A;  3NF6 A;  3D0P A;  3V9Z A;  4DSJ A;  2QK9 A;  4FYD A;  4CF8 A;  2RPI A;  2VG6 A;  2XY8 A;  3ZSX A;  2HND A;  3LAK A;  5K14 A;  5HLF A;  4QCL A;  1UAX A;  4CJR A;  4CIE A;  4K8Z A;  1C1B A;  2OPS A;  1SKS A;  3NE6 A;  4NCG A;  4CF0 A;  4HTU A;  4FCY A;  2Y1I A;  1XHZ A;  2G8U A;  3OJU A;  1SL0 A;  3VQD A;  3AVI A;  3OS0 A;  3I8D A;  4F4K A;  3PV8 A;  2KW4 A;  3OYL A;  3KTQ A;  3KK1 A;  3SNN A;  3C6U A;  4DFK A;  1HYS A;  3SUN A;  3VQ4 A;  1SKR A;  4CEA A;  4CJP A;  4BDZ A;  1L3V A;  2RKI A;  1WNS A;  5CYQ A;  4AHV A;  4ELV A;  3OJS A;  2HHU A;  2HVI A;  4XIU A;  2QXF A;  2HNY A;  1ITG A;  3WNH A;  3QEV A;  3OS1 A;  1T05 A;  3M8R A;  4DTU A;  5KRT A;  2DFH A;  3OY9 A;  1RBU A;  4DF8 A;  4CJE A;  3TAF A;  1SKW A;  4E7I A;  4AH9 A;  3QEI A;  4OGE A;  3AVB A;  4CEC A;  2XRI A;  3P5J A;  3OYB A;  3HJF A;  4B3O A;  3VA0 A;  4FK4 A;  1S5J A;  1U04 A;  4CED A;  1VRT A;  2IOC A;  3V1R A;  3RMC A;  1UA0 A;  1ZYQ A;  1QS4 A;  3KK3 A;  4IKF A;  1NK4 A;  1S1U A;  1S6Q A;  3OYG A;  1X9S A;  4B9M A;  3ZSY A;  1HMV A;  1EX4 A;  3P1G A;  1X1P A;  4OKE A;  1BHL A;  4CF2 A;  3HPG A;  4DQR A;  2XY7 A;  4Z4F A;  1YVU A;  1FKO A;  3F9K A;  5JS1 A;  4CJL A;  3KK2 A;  3VQE A;  3MEG A;  1JXE A;  3KJV A;  4W5T A;  4FM2 A;  2G8K A;  4CJ5 A;  4Z4H A;  4CFC A;  1JL1 A;  1JLA A;  3OYF A;  4DWI A;  5DMR A;  4AHR A;  1WSH A;  3ZCM A;  4EP5 A;  4CFB A;  4CIG A;  4FJM A;  4KB0 A;  1KLN A;  4CJQ A;  2HNZ A;  3SV4 A;  4DTS A;  2D0C A;  1NJX A;  5JS2 A;  4ID1 A;  1U45 A;  1RDB A;  3VA3 A;  1TL3 A;  1VSK A;  3ZSO A;  1R0A A;  2ZQB A;  1CZ9 A;  4C8K A;  4C8L A;  2E4L A;  2ETJ A;  2BE2 A;  2FBT A;  4KHU A;  1TKX A;  4C8O A;  3AVH A;  2NUB A;  4AHT A;  1VSD A;  3THV A;  2G8V A;  4FZX C;  1LWF A;  1IG9 A;  1SUQ A;  3KLE A;  1RDA A;  4FJ9 A;  1RNH A;  4KHY A;  4CHY A;  1KVB A;  3HPH A;  3AO1 A;  4ZTF A;  1NKE A;  4E3S A;  1NOZ A;  3OYI A;  5SZT A;  2HMI A;  2PZS A;  2GBZ A;  4IBN A;  4CHP A;  4N5S A;  2ATQ A;  1RDD A;  3B6O A;  2O4G A;  1TVR A;  3VQQ A;  3U3Y A;  1ZBF A;  4YFU A;  4N76 A;  1DTQ A;  1VSF A;  5J2P A;  3SQ1 A;  1NKB A;  4ZHR A;  4B8A B;  4M3U A;  4Z4E A;  2Y1J A;  3CQ8 A;  1HPZ A;  3M8S A;  4I7F A;  1TKT A;  3HP9 A;  3B6P A;  3IS9 A;  3JSM A;  3NF7 A;  4OGC A;  5T7B A;  3HM9 A;  4DS5 A;  2B4J A;  1EET A;  5HP1 A;  1QTM A;  2RN2 A;  3PY8 A;  4BE2 A;  2G8I A;  4CGF A;  3S9H A;  4H8K A;  4CEE A;  2D5R A;  4BE1 A;  2HHS A;  1G15 A;  3K5O A;  3NF9 A;  1X9M A;  3IRX A;  1O1W A;  4FW2 A;  3SV3 A;  4KB1 A;  4Z4I A;  4CFA A;  3CFP A;  4CHN A;  2PYJ A;  4TSX A;  1WSF A;  4BDY A;  2Z1J A;  4DFJ A;  4DQI A;  3L3U A;  4DSK A;  4B9U A;  3KKS A;  3RMB A;  3PO5 A;  1Z25 A;  1BL3 A;  3SQ0 A;  3LPT A;  4GMJ B;  4CJT A;  3HST B;  3VQA A;  3NBP A;  4DSF A;  2Z1I A;  2Z1H A;  4M3T A;  3TAN A;  2EHG A;  1HQU A;  3ISN C;  2WOM A;  4E7L A;  4O55 A;  4F2S A;  2KZZ A;  1WAF A;  2HB5 A;  1J5O A;  5CZ1 A;  3TI0 A;  3ITH A;  1TKZ A;  4FJX A;  3NFA A;  3NGY A;  1GOB A;  4FZZ A;  1RT4 A;  4R5P A;  2Q3S A;  3RTV A;  1ASV A;  1JLB A;  2AJQ A;  3RRH A;  1ASW A;  4IFY A;  4KTZ A;  1A5X A;  3AVL A;  4NYF A;  4CGI A;  1QSL A;  3MEE A;  2G8H A;  4N41 A;  4OPJ A;  2R7Y A;  3LZI A;  2Z1G A;  2QKK A;  4CGD A;  3HXM A;  3V6D A;  3RWU A;  3HP6 A;  3QET A;  1ZBU A;  4PQU A;  4CEB A;  3KLF A;  1S9E A;  4DTP A;  1FXX A;  4F8R A;  2E6L A;  1I3A A;  1WSI A;  5HRS A;  4LSL A;  5D3G A;  1KVC A;  4CK1 A;  2HHV A;  4LD0 A;  4FLV A;  4KAZ A;  1I39 A;  1UWB A;  1EKE A;  3HL8 A;  4LSN A;  4OKJ A;  4JRP A;  4OKK A;  4Z0U A;  4E7H A;  3ZT4 A;  1VSE A;  3K5M A;  4BWJ A;  1RBS A;  5HRR A;  1YTA A;  1XHX A;  1NJW A;  3JYT A;  3TAQ A;  5HBM A;  4RW6 A;  4OPK A;  4I9Q A;  4H4O A;  4CHQ A;  4KHS A;  1JL2 A;  4NYN A;  3ZSR A;  4KHQ A;  4DTR A;  3NAE A;  3K57 A;  3ZT0 A;  3HK2 A;  4GVM A;  4KI4 A;  4DQP A;  3V9X A;  3PX0 A;  4KFB A;  3AV9 A;  1FK9 A;  1GOA A;  1QQC A;  3SQ4 A;  1J53 A;  4KRF A;  4DLG A;  2GV9 A;  5KRS A;  4KHN A;  4H4M A;  4M41 A;  4FJG A;  4KHW A;  4YNQ A;  3SUQ A;  1NK8 A;  1U48 A;  1Q9X A;  1CZB A;  1T7P A;  3AVJ A;  1T8E A;  4DSI A;  3QEX A;  1BCO A;  2IGI A;  3F73 A;  4DMN A;  1N6Q A;  4EZ9 A;  3UIQ A;  2YKM A;  3ZSW A;  2KQ2 A;  4DG1 A;  4I9L A;  3OYK A;  1D8Y A;  3LPU A;  4FJN A;  3ZSZ A;  1Z26 A;  4FJI A;  1RT7 A;  3ZSQ A;  3DMJ A;  3VQ5 A;  4J2A A;  3NDK A;  2HW3 A;  4CFD A;  1WSJ A;  4ZTJ A;  4Z4G A;  4CGJ A;  4FLZ A;  4FJ7 A;  3KLG A;  3AVF A;  4CGH A;  5J1E A;  4K8X A;  4OLA A;  3DLG A;  3CFO A;  3C94 A;  3ALY A;  1BCM A;  4Q5V A;  4DQQ A;  1BIS A;  4FLW A;  1NOY A;  4HCB A;  3I0S A;  4AHU A;  4UQG A;  1RBT A;  2KFN A;  3K59 A;  1JLG A;  3KD1 E;  1K6Y A;  1L3T A;  4CEQ A;  5KTQ A;  2B6A A;  3TWH A;  1JKH A;  1SV5 A;  1TV6 A;  2OZM A;  1HQE A;  4FJH A;  3ZT2 A;  3V1O A;  3V9S A;  3PX4 A;  3DLB A;  4B8C A;  4FLY A;  2P1J A;  2ZD1 A;  4DTN A;  1HNI A;  1TAQ A;  3DI6 A;  3VQ7 A;  1L3U A;  4MFB A;  2PY5 A;  4DSL A;  4HUG A;  1VRU A;  1D9F A;  3VQ8 A;  4RG8 A;  2HHX A;  1VSM A;  2A1S A;  3AA5 X;  4C8M A;  1BIZ A;  3T1A A;  1HYV A;  3RR7 A;  3NH0 A;  4CCH A;  4ELU A;  4DS4 A;  2FBY A;  2YHB A;  1X9W A;  4FVM A;  3SQ2 A;  1XWL A;  1LWE A;  1TK5 A;  2XO7 A;  4CJK A;  3SPY A;  1T03 A;  2DFF A;  2YNH A;  4FJ5 A;  2KTQ A;  1ZBI A;  3MEC A;  4Y1C A;  1TAU A;  1SL1 A;  3D45 A;  3OYM A;  3LP2 A;  4FLU A;  1LW2 A;  4FJK A;  1A5V A;  1JLC A;  1JLF A;  2EX3 A;  2IDO A;  3C95 A;  1DTT A;  3NCI A;  4JRQ A;  3HVT A;  4O5B A;  1REV A;  2F8T A;  4M3Y A;  1KLM A;  3L2W A;  5J2N A;  1JLQ A;  4FZY A;  4FK2 A;  1RT5 A;  4ICL A;  3PX6 A;  1TL1 A;  4DF4 A;  2OPQ A;  2ZE2 A;  4IDK A;  1CXQ A;  1RBR A;  3LAN A;  4E1N A;  3VQP A;  1B9D A;  3NH2 A;  3U6F A;  1RT2 A;  3DM2 A;  4N47 A;  3TAB A;  3TAR A;  3S3N A;  4CJV A;  4Q0B A;  4F2R A;  3L2R A;  1NK5 A;  1B9F A;  2D0B A;  1S1X A;  3V9W A;  3OYJ A;  1BGX T;  4M3W A;  3C6T A;  4IG0 A;  4CHO A;  4QAG A;  3ZSV A;  3LDS A;  4FJ8 A;  5E41 A;  1J9A A;  4FJJ A;  1C0U A;  3OVN A;  1NK9 A;  1IO2 A;  1IKW A;  3KD5 E;  5HRO A;  1BI4 A;  3K5L A;  2DFE A;  4DU1 A;  1U4B A;  1D9D A;  1TGO A;  3O4Q A;  2JGU A;  3KIO A;  4Y1D A;  4CF1 A;  1BQM A;  5HRN A;  1RIL A;  2P5G A;  3TAM A;  5EU7 A;  1XC9 A;  3LP3 A;  3OYD A;  4JS4 A;  2O4I A;  4BAC A;  4O0J A;  2YKN A;  3LZJ A;  1S6P A;  4PA1 A;  1QHT A;  1B92 A;  1LW0 A;  3V1Q A;  3WNF A;  2F8S A;  4C8N A;  3T19 A;  1FKP A;  4CJS A;  1Q8I A;  1WSE A;  1QSS A;  2OYQ A;  1CXU A;  1ASU A;  3VQ9 A;  3AA4 A;  2I5J A;  3IAY A;  4KO0 A;  4J2B A;  3AO5 A;  4CEF A;  4J2D A;  4FLT A;  3ULD A;  3OYA A;  3E01 A;  3G0Z A;  4E7K A;  4DU3 A;  5FDL A;  4CF9 A;  1C1C A;  2QKB A;  3QIO A;  2ITG A;  3L2V A;  3RRG A;  4HUF A;  2P51 A;  1TKD A;  4DTM A;  3ZT3 A;  3EZ5 A;  4CEZ A;  1KFD A;  2OPP A;  2FC0 A;  4E19 A;  4JS5 A;  1NJZ A;  3V9U A;  5KGX A;  1N5Y A;  1LAV A;  3QLH A;  1WN7 A;  4OVL A;  1L3S A;  4HCC A;  1C0T A;  3AVK A;  3EY1 A;  4PUO A;  3V4I A;  3LWM A;  2XY5 A;  4CJU A;  1QSY A;  4B9T A;  2OZS A;  4AHC A;  4FM0 A;  1W0H A;  4DTO A;  5C24 A;  2BDP A;  3IG1 A;  1S1T A;  4IG3 A;  3QNN A;  2VWK A;  3O3G A;  2G8W A;  4BDP A;  4PWD A;  1W9H A;  2YNF A;  3T3F A;  1C0M A;  3TAP A;  4QOZ B;  2HVH A;  4RW4 A;  4BWM A;  2HHW A;  1HJR A;  1F21 A;  3MED A;  5CZ2 A;  4B9S A;  1CLQ A;  4O4G A;  1UA1 A;  4DQS A;  1NJY A;  3BGR A;  1IH7 A;  5KGW A;  1KRP A;  2OPR A;  3U3G A;  2VWJ A;  3AVN A;  4AHS A;  4CE9 A;  3AO3 A;  1KFS A;  3TAE A;  4B9L A;  4ELT A;  4DU4 A;  1VSL A;  4W5Q A;  1BI4 B;  4KI6 A;  3M8Q A;  4GW6 A;  4O44 A;  3DYA A;  5KI6 A;  4CK2 A;  2E6M A;  4N56 A;  3OYE A;  3SUO A;  3AVG A;  3QO9 A;  3VQ6 A;  2KZM A;  4L8R B;  2B5J A;  3VQC A;  3AVM A;  1RTJ A;  4FM1 A; 
#chains in the Genus database with same CATH topology
 2P9I B;  1HNV A;  2O8C B;  2GUI A;  4I2P A;  3QNO A;  4F3T A;  5JLF A;  4CZL A;  4CJW A;  3JXU A;  1RT3 A;  2NRV A;  1I94 K;  1GOC A;  4CHZ A;  1EXQ A;  1S22 A;  4X65 K;  4KH5 A;  3QEP A;  4LY7 A;  3KKR A;  4PKI A;  2YV0 X;  3MXI A;  4A62 A;  2F4V K;  1U47 A;  2HHQ A;  5DM6 L;  3DLK A;  4E7J A;  3L6Q A;  4GKJ K;  4FSV A;  4Y0W A;  3CC4 N;  4BRO A;  3EN9 A;  2NRR A;  3GBT A;  4EAH D;  2J4R A;  5H1S Q;  1VAZ A;  3O1W A;  2X78 A;  1N32 K;  4KBO A;  5MLC Q;  3CMA N;  2WON A;  2JWL A;  3MN5 A;  2OCE A;  4A61 A;  4CIF A;  4CGG A;  1NG9 A;  3HYF A;  3QBX A;  2O8B B;  3J8A A;  1JLE A;  4CER A;  4IO9 L;  4PY5 A;  2PYL A;  1WLJ A;  3SYZ A;  5CHI A;  3UB5 A;  3THX B;  4X66 K;  1HKG A;  2D4W A;  3L8B A;  3THW B;  3HPO A;  3AVC A;  3LDQ A;  3A5O C;  3AA2 A;  2KFZ A;  3LP1 A;  1MU2 A;  1C6V A;  4O5F A;  3FGU A;  1EP4 A;  3G25 A;  4CES A;  4KHP K;  1FJG K;  3M8P A;  3DRP A;  2YHY A;  1IJJ A;  4HUE A;  3E1Y A;  1S9G A;  4BR5 A;  2P9P B;  4IDH A;  3TSQ A;  4BRH A;  3CM6 A;  3AO2 A;  4B9Q A;  4EP4 A;  4B1Z A;  5FRO A;  3IDH A;  4J8F A;  3PIP L;  3EL2 A;  3CIP A;  4DV0 K;  1IKY A;  4H0Y B;  2F96 A;  1HR0 K;  4MDB A;  1LWC A;  5AQQ A;  3QIN A;  1IKX A;  1QZ5 A;  3K5N A;  1VSI A;  2A1R A;  2HHT A;  2D1K A;  4JN4 A;  4K41 A;  4FWP A;  1HYZ A;  2YHA A;  3G10 A;  4JKA A;  1VK0 A;  2FBV A;  4ID5 A;  1QVF M;  1YUW A;  4Z4C A;  3M5R A;  4FWL A;  4CJ3 A;  4DV6 K;  2ZJQ L;  1KVA A;  2HBJ A;  5FPM A;  2O8E B;  5HLF A;  4QCL A;  4CJR A;  5AQH A;  4LF4 K;  1HUX A;  2HBL A;  4FOE A;  1NNE A;  2P9N B;  3VQD A;  5AQI A;  3OYL A;  3PV8 A;  3KTQ A;  3KK1 A;  4DV5 K;  2QWM A;  3CQX A;  4O8U A;  4BRF A;  4BDZ A;  5CYQ A;  4AHV A;  2EWS A;  1YHQ N;  4XIU A;  2QA4 N;  1ITG A;  3WNH A;  1NWK A;  1QQO A;  1T05 A;  3F5T A;  2V7Z A;  5KRT A;  1RBU A;  1SKW A;  4E7I A;  3QEI A;  3VF4 A;  2XRI A;  3P5J A;  3OYB A;  3PIO L;  2F7T A;  3HJF A;  5AQW A;  1W97 L;  3F9M A;  5FLX O;  3VA0 A;  4GV6 A;  5AQP A;  4CED A;  1VRT A;  3ID8 A;  3V1R A;  1ZYQ A;  3UKR A;  4GKK K;  1S1U A;  3ZSY A;  1Q82 O;  4AQY K;  2P9U B;  5M1N A;  3WEE B;  4LF7 K;  4IOA L;  1YVU A;  1FKO A;  3CCV N;  3F9K A;  2VYP A;  3KK2 A;  1NJI O;  1JXE A;  4W5T A;  4CJ5 A;  4CFC A;  2NRT A;  2FSK A;  4EP5 A;  3O08 A;  3A8Y A;  4CFB A;  4IEI A;  1NLV A;  1D4X A;  2FBT A;  1TKX A;  1HPM A;  4C8O A;  1LWF A;  5BPL A;  1IG9 A;  3TTF A;  5BPM A;  4JNE A;  1KVB A;  5KPT A;  1QHA A;  2QW9 A;  2PZS A;  3WXI A;  4N5S A;  3U3Y A;  3KVG A;  5E84 A;  1VSF A;  5J2P A;  4JKB A;  4N76 A;  3UKU B;  4Z4E A;  1C0G A;  3GDQ A;  4I7F A;  1TKT A;  3HP9 A;  2YJF A;  5T7B A;  4DS5 A;  1EET A;  1QTM A;  3PY8 A;  4CGF A;  3ZET B;  4R79 A;  2IIR A;  1RDU A;  3DJC A;  4B3M K;  3SV3 A;  4KB1 A;  5AR0 A;  4CFA A;  5JVG L;  4TSX A;  2Z1J A;  4DFJ A;  3L3U A;  4A2B A;  4DSK A;  3K9J A;  1BL3 A;  3KZB A;  3LPT A;  4GMJ B;  4CJT A;  3HST B;  3VQA A;  4DQ8 A;  4DSF A;  2Z1I A;  3T7Z A;  2ZWH A;  5BR9 A;  3TAN A;  5JMV A;  4BVP A;  4G9Z A;  2W6L A;  4O55 A;  2PAV A;  4BG9 A;  4B1W B;  5CZ1 A;  3RTV A;  3RRH A;  4X64 K;  3O8M A;  4KTZ A;  3CJB A;  4OPA A;  2Z1G A;  3QDK A;  2QKK A;  1P90 A;  2CH6 A;  2CH5 A;  4LF5 K;  1ZC6 A;  3BUZ B;  3MMV A;  1S9E A;  1FXX A;  4BRE A;  5BN9 A;  1KVC A;  1VQP N;  2HHV A;  4FLV A;  4KAZ A;  1I39 A;  1UWB A;  3HL8 A;  4LSN A;  3OA9 A;  3OHR A;  5EVZ A;  4Z0U A;  5HRR A;  4HTL A;  3LDP A;  4I9Q A;  4RW6 A;  4OPK A;  3KWG A;  3T69 A;  4KHQ A;  3HK2 A;  3PX0 A;  3ZEU A;  1FK9 A;  1GOA A;  1J53 A;  3O5B A;  4BVO A;  4IWV A;  2YHW A;  3JAM O;  4M41 A;  5KRS A;  4FJG A;  4YNQ A;  2ZGY A;  1U48 A;  1Q9X A;  1XC3 A;  3QEX A;  1BCO A;  2IGI A;  3F73 A;  1N6Q A;  2GUP A;  3ZSW A;  2KQ2 A;  4DG1 A;  2GWJ A;  2HW3 A;  1CZA N;  3NDK A;  4CFD A;  4CZG A;  4ILJ A;  4NLC A;  4Z4G A;  4FJ7 A;  1VQ7 N;  3AVF A;  1MDU B;  4H5N A;  4K8X A;  4Q5V A;  1BIS A;  4DR7 K;  3I0S A;  4AHU A;  2KFN A;  3K59 A;  3KD1 E;  1L3T A;  3ZT2 A;  3V1O A;  4IJA A;  1W2B M;  2IVN A;  2FLO A;  3DI6 A;  3U9D A;  3H46 O;  3HZ6 A;  5BRE A;  2HHX A;  4BRK A;  1BIZ A;  3VPZ A;  3K9K A;  1LWE A;  3C6A A;  2KTQ A;  2YNH A;  3AAP A;  4GNI A;  4QS9 A;  1LW2 A;  5C2F A;  1JLF A;  1WUA A;  4YOX A;  2F8T A;  4WQ5 A;  1OKJ A;  4DF4 A;  2OPQ A;  2ZE2 A;  4H0V B;  4OX9 K;  3LAN A;  1J5E K;  1B9D A;  3U6F A;  2H3G X;  3TAB A;  1ATR A;  2GEL A;  4CJV A;  4Q0B A;  1B9F A;  1S1X A;  4BY9 C;  4M3W A;  3ZSV A;  4FJJ A;  3OVN A;  4JKC A;  1NK9 A;  5EXW A;  4H5W A;  1GLJ O;  5HRO A;  3VER A;  1U4B A;  4A2A A;  1TGO A;  2JGU A;  3KIO A;  5HRN A;  1RIL A;  4FWS A;  3LP3 A;  4PA1 A;  2F8S A;  3V1Q A;  2E5L K;  2QWN A;  3P38 A;  2P9L B;  4U67 L;  4BR4 A;  1C0F A;  1Q8I A;  2OYQ A;  4JI1 K;  1CXU A;  1ASU A;  1BWF O;  4WFA L;  5BRD A;  5F2R A;  1KAX A;  3IFR A;  1NGJ A;  1GLD G;  4CI6 A;  4JI8 K;  2RE2 A;  3E01 A;  3G0Z A;  2E88 A;  4XH4 A;  2CGJ A;  2QKB A;  3L2V A;  4DTM A;  3ZT3 A;  4I6M B;  1KFD A;  2FC0 A;  4MO5 A;  3CHW A;  4HCC A;  5KQD A;  4PUO A;  3SAH A;  4FWO A;  4CJU A;  2Q1N A;  4HWI A;  1W0H A;  1JCF A;  1TYQ A;  4DTO A;  4XEI A;  3ZX0 A;  2QWQ A;  3ENB A;  4QOZ B;  4K0K K;  4BWM A;  1CLQ A;  5CZ2 A;  3T1Y K;  3FZM A;  3O9U A;  1NGA A;  1KRP A;  4BRL A;  4DU4 A;  4KI6 A;  4O44 A;  5AQG A;  3AY9 A;  4H5T A;  3C7N A;  4PHT X;  3WT0 A;  2B5J A;  3THW A;  3E66 A;  3CCJ N;  1QE1 A;  3WXJ A;  3QEW A;  3VGM A;  1E4G T;  3FLC O;  4E89 A;  2P5O A;  1YF5 L;  5FRM A;  4DUZ K;  3BDP A;  3CME N;  3H45 C;  1C1A A;  3ULE B;  4DLE A;  5KPR A;  4IFE A;  4JI2 K;  2IC3 A;  3SUP A;  1NGG A;  3K2P A;  1U49 A;  4DFM A;  1BU6 O;  4W5R A;  1S1V A;  4KTW A;  4KPY A;  2YHX A;  1IBK K;  5LJV A;  3ATU A;  4DFP A;  4KTQ A;  2BAN A;  3NVM A;  5AQY A;  1VSJ A;  4B3T K;  3PO4 A;  1DKG D;  1RBV A;  3QML A;  3J7Y P;  3LWL A;  1KTQ A;  3MK6 A;  4NB4 A;  4WQ4 C;  4IFV A;  1T3V A;  3AVA A;  3OS2 A;  2HBK A;  3FFI A;  4B1V A;  5C42 A;  2DY4 A;  3HRG A;  3SCX A;  3EE8 A;  4IOX A;  1NK0 A;  1IKV A;  1KSP A;  1IV0 A;  3KLH A;  3NHG A;  2X74 A;  2DTU A;  4AIL C;  3I0R A;  3OBY A;  3LAM A;  2XY6 A;  4FWK A;  4JKG A;  4M42 A;  5I42 A;  3A2F A;  4OPH A;  2UXD K;  5GAG P;  3DXM A;  2ASO A;  3ZET A;  5AZI A;  3VF6 A;  4CJF A;  3MN6 A;  1UOC A;  3AAQ A;  2YNI A;  4M3R A;  2O8B A;  4LFB K;  2I7P A;  4FWR A;  3NF8 A;  3G71 N;  4BRM A;  4DV7 K;  4WE1 A;  1ZBH A;  5AQL A;  4EZ6 A;  1VQK N;  4M3X A;  1EO1 A;  1YXQ A;  2WTU A;  2W41 A;  3NGZ A;  3HT3 A;  2W42 A;  2IVO A;  2RF2 A;  1L5U A;  1DEJ A;  2XHB A;  1NK7 A;  3O9Q A;  4KKO A;  2G8F A;  4CZI A;  2IS3 A;  1WBB A;  3O4N A;  3VN5 A;  3AGK A;  3CCM N;  2QWP A;  4JLH A;  4W5O A;  3NVK A;  3HBT A;  2X6N A;  1VQ8 N;  4HHT A;  4FW1 A;  3TR8 A;  1LOT B;  4WFN L;  3MAQ A;  2X6S A;  1NBW A;  4BG8 A;  3DLH A;  4DV4 K;  4B3S K;  2VG5 A;  3D0P A;  4DSJ A;  3V9Z A;  2QK9 A;  3KWI A;  1QQN A;  4CF8 A;  4F9O A;  3LAK A;  1UAX A;  4CIE A;  1YJW N;  4K8Z A;  1C1B A;  1SKS A;  2Y1I A;  3WEE A;  2G8U A;  3OS0 A;  3I8D A;  4F4K A;  4DCH A;  3SNN A;  4DFK A;  1T44 A;  3SUN A;  3VQ4 A;  1L3V A;  2RKI A;  1WNS A;  1EWQ A;  2HHU A;  2VQF K;  4KH6 A;  3QEV A;  3M8R A;  2DFH A;  3D7E O;  3Q7C A;  2UYT A;  2VCP A;  4DF8 A;  4YOU A;  2Q31 A;  4B3O A;  2KLA A;  4BQL A;  1SQK A;  4IXC A;  1U04 A;  2IOC A;  1UA0 A;  3KK3 A;  4FPB A;  3OYG A;  1U2V B;  1HMV A;  2ZM6 K;  1EX4 A;  3ZYY X;  4ILG B;  4UY8 O;  4OKE A;  3Q7B A;  1HNX K;  3MX5 A;  5LMN K;  3KJV A;  2G8K A;  4M63 C;  3OYF A;  3RSE A;  1WSH A;  2VGM A;  3CCS N;  4CIG A;  1NJX A;  2HNZ A;  1M1K O;  1U45 A;  1VSK A;  3H3O B;  1P8Z A;  2E4L A;  2ETJ A;  4CD3 A;  3THV A;  2NZT A;  4JI4 K;  5TKY A;  1SUQ A;  1SZ2 A;  4CHY A;  3AO1 A;  4ZTF A;  1NOZ A;  2WFB A;  2GBZ A;  4CHP A;  2ATQ A;  1N8R O;  4YFU A;  2O8F A;  1DTQ A;  3SQ1 A;  4ZHR A;  4B8A B;  4M3U A;  4JI3 K;  2D0O A;  1HPZ A;  3M8S A;  3FZH A;  3NF7 A;  2B4J A;  4FL9 A;  3WXL A;  1NGB A;  4BE1 A;  3IRX A;  2PYJ A;  4CHN A;  4DQI A;  4YOY A;  3ZLJ A;  4BQZ A;  3KKS A;  3RMB A;  3VGK A;  3IUC A;  4WYB A;  3SQ0 A;  2Z1H A;  4M3T A;  5AQJ A;  1HQU A;  1QQM A;  3TI0 A;  4IO8 A;  2QTD A;  1JLB A;  4IFY A;  3CCL N;  4EHT A;  3HXM A;  3HP6 A;  3A0I X;  4XH5 A;  1ZBU A;  3QET A;  4CEB A;  4CZK A;  3KLF A;  2E6L A;  1I3A A;  5HRS A;  4LSL A;  4JYA K;  4CK1 A;  4LD0 A;  4BC4 A;  4OKJ A;  2I7N A;  3ZT4 A;  3K5M A;  3E9P A;  2F9W A;  2QWR A;  5JVH L;  3K57 A;  5AQS A;  4DQP A;  3CQY A;  3AV9 A;  1ATN A;  2QWO A;  4WFB L;  1QQC A;  2GV9 A;  1S3X A;  4H4M A;  3NMU A;  4O8K A;  3SUQ A;  3EO3 A;  3FFK B;  3AVJ A;  4BC3 A;  1YIJ N;  3TU5 A;  4DMN A;  2YKM A;  3TSP A;  2P9U A;  1EWR A;  4FJI A;  3WXK A;  3VQ5 A;  4J2A A;  1WSJ A;  4ZTJ A;  4CGJ A;  2NLX A;  5GAD P;  4OLA A;  3SK3 A;  4PKH A;  4UQG A;  1RBT A;  1JLG A;  1K6Y A;  2NRH A;  1JJ2 M;  3R1X A;  3O9R A;  4ISF A;  4BR7 A;  4YOV A;  3TWH A;  1SV5 A;  1TV6 A;  1HQE A;  2IVP A;  3V9S A;  3PX4 A;  4H0T B;  4DTN A;  1HNI A;  2Q0U A;  1TAQ A;  1G99 A;  1L3U A;  2HF4 A;  2PY5 A;  4DSL A;  2O8D A;  3T1A A;  3ULE A;  1HYV A;  3NH0 A;  1X9W A;  2YHB A;  4GVE A;  4FVM A;  1TK5 A;  3SPY A;  2DFF A;  4FJ5 A;  3O80 A;  4DKW A;  3SBG A;  1SL1 A;  3D45 A;  3OYM A;  1KQS M;  4CZJ A;  2IDO A;  1DTT A;  4O5B A;  1REV A;  4KH4 A;  5IT9 O;  3L2W A;  4ICL A;  1TL1 A;  2YJE A;  1CXQ A;  1RBR A;  4E1N A;  4N47 A;  3ATV A;  4F2R A;  1Q18 A;  3L2R A;  2D0B A;  2P9K A;  3THY A;  1BGX T;  3VGL A;  3KK7 A;  3C6T A;  5C0Y A;  5F1X A;  5E41 A;  2F9T A;  3LDN A;  3N4Q A;  1IO2 A;  4MO4 A;  1D9D A;  2P5G A;  4Y1D A;  2P9K B;  1MWM A;  1ZXO A;  3CJ9 A;  5EU7 A;  3TAM A;  1GLF O;  3OYD A;  4BAC A;  3LZJ A;  3D2E A;  1QHT A;  1B92 A;  3FE1 A;  3WNF A;  4CJS A;  2UUB K;  2NRZ A;  4FWQ A;  5EOY A;  3MCP A;  2I5J A;  1E3M A;  4J2B A;  5C12 A;  4JK9 A;  1VQN N;  4H03 B;  1K8K B;  3BZC A;  3MWP A;  1NGI A;  3ULD A;  3T1H K;  3CJA A;  3F2K A;  4E7K A;  2E2N A;  5C10 A;  4JKG B;  4CEZ A;  4E19 A;  2O8C A;  4DR6 K;  1N5Y A;  1LAV A;  3D2F B;  3MN7 A;  3O4W A;  1YVN A;  2O8F B;  3V4I A;  3LWM A;  1QSY A;  4QS7 A;  5AQK A;  1VQL N;  3VEY A;  3U4L A;  4V19 S;  1C0M A;  3TAP A;  2ASM A;  5BRH A;  4AF1 A;  4O4G A;  4DQS A;  1VQ5 N;  2HST A;  3EZW A;  3GG4 A;  5KGW A;  2OPR A;  3U3G A;  4FPA A;  2Q36 A;  4CCH A;  3OYE A;  5KI6 A;  4CZH A;  3QO9 A;  3J7Z O;  2GTD A;  3VQ6 A;  4DHY A;  1U6Z A;  4EFH A;  1Q9Y A;  3CG7 A;  2KHO A;  2VG7 A;  4M7Y A;  4BRN A;  2LSN A;  5J2Q A;  3DOK A;  2P9N A;  1NKC A;  4MQ3 A;  4KRE A;  4RW9 A;  1TK8 A;  3DRS A;  1A5W A;  3ENO A;  1Z6R A;  3R3L A;  1QZ6 A;  4FLX A;  3AO4 A;  3S3M A;  1D5A A;  2OA8 A;  4BRI A;  3VTI A;  1J54 A;  5I3U A;  4NLB A;  1FW6 A;  2JLE A;  4BR2 A;  3HVR A;  3SPZ A;  1ZBS A;  4ISG A;  4JI6 K;  3H1Q A;  4NCB A;  4RW8 A;  5CY4 A;  3VEX A;  4EHU A;  3OTO K;  4DR5 K;  3PUF A;  4G1Q A;  3OYH A;  1KAZ A;  1HRH A;  5GAH P;  2D0A A;  4CW7 B;  1BIU A;  3ASM A;  3BEX A;  5J2M A;  4NCA A;  3OW2 M;  1S72 N;  4IOC L;  4LFC K;  4K42 A;  3LAL A;  5CYM A;  1LAW A;  3MXJ A;  4M7X A;  4DTX A;  4E1J A;  4F3O A;  3L0Q A;  3QIP A;  3M3Z A;  5AQU A;  1NK6 A;  1YI2 N;  1LV5 A;  1J6Z A;  1RTI A;  5FPD A;  3SBT A;  1WSG A;  4K43 A;  3EE9 A;  3V81 A;  1S1W A;  3CFR A;  1Z05 A;  4B9N A;  2P9L A;  3KLI A;  1VSH A;  5BN8 A;  4DV3 K;  3DWL A;  5IWA K;  1X3N A;  4DTJ A;  3FR0 A;  2OTL N;  1WBD A;  1Y97 A;  3MN9 A;  3H6E A;  2RHK A;  4JI5 K;  4HVJ A;  3U9Z A;  3L3V A;  4MDA A;  4E1M A;  2HMP A;  3H3N O;  1HNW K;  2E2P A;  5FPE A;  3SI6 A;  1HKC A;  3QER A;  3UE5 A;  3QES A;  1T6D A;  3DXK A;  3O9S A;  3RSE B;  3W0L A;  4A59 A;  3TAG A;  2A5X A;  2BUP A;  1Q7Y O;  4C1N K;  4JAX A;  1YT3 A;  1ZBL A;  1JXB A;  2P9S B;  4O0I A;  3RMD A;  4WF9 L;  2YNG A;  5GIO A;  4B1U B;  4FYD A;  5AZJ B;  2HND A;  4BR0 A;  1BOT O;  2GEM A;  3UKU A;  1U2V A;  4DR3 K;  2FSJ A;  2OPS A;  1Q81 O;  3C7N B;  4NCG A;  4CF0 A;  4HTU A;  4FCY A;  3OJU A;  5AQX A;  3AVI A;  5EX5 A;  1RFQ A;  2GWK A;  4I6M A;  3C6U A;  2FSN A;  3IMX A;  3OBW A;  3HSC A;  1HYS A;  3PLA A;  4CEA A;  5AQR A;  4JHD A;  4ELV A;  1T6C A;  4NXM K;  4CBU A;  4MLH A;  3J7A P;  4EIA A;  3C6H A;  2KKZ A;  2FF6 A;  1V4T A;  3OS1 A;  4DTU A;  2ZJR L;  1MA9 B;  4CJE A;  3TAF A;  4WQ5 C;  4AH9 A;  3AVB A;  1S5J A;  1S6Q A;  1WB9 A;  4DR1 K;  4B9M A;  2HF3 A;  3LM2 A;  4YOR A;  3P1G A;  5DM7 L;  4CVN E;  5KQ8 A;  1BHL A;  3O9T A;  4DQR A;  3HPG A;  2XY7 A;  3WQU A;  5I9E B;  1NM1 A;  3VQE A;  3MEG A;  4FM2 A;  2AP1 A;  5DMR A;  4AHR A;  3ZCM A;  3I33 A;  3W3D A;  4FJM A;  4KB0 A;  4CJQ A;  3SV4 A;  4DTS A;  2D0C A;  4ID1 A;  4C8K A;  4C8L A;  4DR4 K;  3ZSO A;  2ZQB A;  1CZ9 A;  2BE2 A;  1TUY A;  3I56 N;  1IG8 A;  1VSD A;  4AHT A;  1GLB G;  4L3Q A;  3KLE A;  1RDA A;  4FJ9 A;  1RNH A;  4CZF A;  1NKE A;  2VWB A;  1KAY A;  4IBN A;  2O8E A;  1RDD A;  4JKH A;  1E4F T;  1ZBF A;  4XH1 A;  1NKB A;  1BUP A;  2WC9 A;  3CJ7 A;  3K0S A;  3CQ8 A;  3IS9 A;  3JSM A;  1OVY A;  4YOW A;  5HP1 A;  2E1Z A;  3S9H A;  3NF9 A;  1BG3 A;  3A5L C;  3PSI A;  2P9P A;  4FW2 A;  1O1W A;  4Z4I A;  4JD2 A;  4BDY A;  1TYQ B;  2WBN A;  3CPE A;  3PO5 A;  5JLH A;  4FOI A;  3NBP A;  4YDU A;  3THX A;  4E7L A;  2WOM A;  5ADX A;  1WAF A;  2HB5 A;  2P9S A;  3AGR A;  2E20 A;  1TKZ A;  3ITH A;  3TTD A;  3NFA A;  1VQ4 N;  4FJX A;  2Q3S A;  4FVU A;  2O8D B;  1ASV A;  2AJQ A;  4JI0 K;  5BR8 K;  1ASW A;  2G8H A;  1QSL A;  3MEE A;  2YX6 A;  3RWU A;  4JK8 A;  4PQU A;  3J80 O;  4F8R A;  1WSI A;  5D3G A;  4IZ9 A;  3JS6 A;  4E7H A;  2JWK A;  4BWJ A;  1YTA A;  1XHX A;  3VEV A;  1NJW A;  3JYT A;  5HBM A;  3FZL A;  4JD2 B;  3QFU A;  3EKU A;  4KHS A;  3EEQ A;  3L4Q A;  3ZSR A;  3QB0 A;  3NAE A;  4JV5 K;  3ZT0 A;  3LL3 A;  4GVM A;  4BRA A;  4KI4 A;  3V9X A;  3VEN A;  3SQ4 A;  4KRF A;  4DLG A;  3M6G A;  4KHN A;  3E9L A;  2E8A A;  1CZB A;  1IBM K;  1T7P A;  4RTF D;  4EZ9 A;  3OYK A;  1D8Y A;  4FJN A;  3CCE N;  1HJO A;  4CGH A;  5J1E A;  3TSU A;  3CFO A;  4HCB A;  1NOY A;  4FLW A;  5CE3 A;  1DT9 A;  2D0P A;  4JKE A;  3WUH A;  4CEQ A;  1GLA G;  2B6A A;  5KTQ A;  4FJH A;  2VGN A;  4ILH A;  3VQ7 A;  4MFB A;  4BC5 A;  2PBD A;  5LMU K;  1VSM A;  4C8M A;  3J81 O;  3RR7 A;  4ELU A;  2PFU A;  2FBY A;  2UXB K;  1VQM N;  1XWL A;  1KXP A;  2XO7 A;  1ZBI A;  3MEC A;  3LP2 A;  4FLU A;  1A5V A;  1JLC A;  2EX3 A;  3C95 A;  5M1K A;  1N34 K;  4JRQ A;  3HVT A;  2ZJP L;  4M3Y A;  1KLM A;  5AFU H;  3P31 A;  1NU0 A;  1ATS A;  3CCU N;  4BGB A;  4FZY A;  3PX6 A;  2HOE A;  5FPN A;  3CCR N;  3CER A;  1RT2 A;  3DM2 A;  3TAR A;  2ZF5 O;  4BRQ A;  3V9W A;  2QM1 A;  4FJ8 A;  4QAG A;  3LDS A;  3D2E B;  1C0U A;  5AQO A;  3K5L A;  4DU1 A;  5HOO A;  2HBM A;  4CF1 A;  1BA1 A;  1BQM A;  3R6M A;  1EQY A;  1S6P A;  1LW0 A;  4C8N A;  4Z94 A;  1FKP A;  1LCU A;  1WSE A;  1N36 K;  2NRX A;  4H0X B;  4KO0 A;  3SJH A;  2QXL A;  3AO5 A;  4CEF A;  4J2D A;  3OYA A;  3D2F A;  2UUA K;  4CF9 A;  1C1C A;  1GLC G;  3MDQ A;  3RRG A;  1NMN A;  3DLL L;  4HUF A;  1TKD A;  2OPP A;  4JS5 A;  3V9U A;  5KGX A;  3QLH A;  4OVL A;  3U8X A;  3AVK A;  4QS8 A;  3C65 A;  2XY5 A;  4B9T A;  2OZS A;  4AHC A;  4FM0 A;  1XMQ K;  2BDP A;  3IG1 A;  1OH5 A;  1S1T A;  4BRG A;  1TUU A;  4IG3 A;  2VWK A;  3O3G A;  3QNN A;  2G8W A;  1Y64 A;  5AQF A;  2YNF A;  3T3F A;  4BDP A;  4PWD A;  1W7A A;  5AZI B;  4WQ4 A;  2HVH A;  4PL8 A;  2HHW A;  1HJR A;  1F21 A;  4B9S A;  1NJY A;  2YI1 A;  1X3M A;  3BGR A;  5F0X A;  1IH7 A;  3MX2 A;  2VWJ A;  3BZK A;  3AO3 A;  1KFS A;  5GIN A;  4B9L A;  1BI4 B;  5JS1 A;  4N56 A;  3DYA A;  2E6M A;  3AVG A;  2KZM A;  4L8R B;  4H0P A;  4CGI A;  3ZX2 A;  1H1V A;  1RTJ A;  3OY9 A;  4FM1 A;  4FO0 A;  3CJC A;  3MCA B;  3DLE A;  3A5N C;  3AA3 A;  4FK0 A;  3TTC A;  1OVQ A;  3O3F A;  1WAJ A;  3NGI A;  1ILY A;  3SJJ A;  4K25 A;  2NRW A;  3HO1 A;  1DLO A;  4LH4 A;  4YDU C;  4CEO A;  1HNZ K;  4M45 A;  4FXD A;  4LH5 A;  3OYN A;  3LM9 A;  3OYC A;  5C15 A;  1Q86 O;  3VQB A;  4BRC A;  4M3Z A;  1SL2 A;  1YTU A;  1XMO K;  3DRR A;  3HI0 A;  1KCF A;  4B08 A;  1YAG A;  1TK0 A;  3VF2 A;  3PSF A;  4CJ4 A;  4PL7 A;  1YJ9 N;  3O6W A;  3VMF B;  3S41 A;  1K73 O;  4CBX A;  3RMA A;  4DUY K;  3DLR A;  5C25 A;  4KV8 A;  3NH1 A;  4J2E A;  4DSE A;  4FJL A;  4MLE A;  1BA0 A;  1VQ6 N;  3ZT1 A;  4W5N A;  1YJN N;  1M90 O;  2W40 A;  3WQT A;  3L2Q A;  1VQO N;  2BGG A;  4GV3 A;  1RTH A;  4B9V A;  3CET A;  5ADX H;  5HRP A;  2FF3 B;  3WNG A;  2E2O A;  3CYM A;  1RTD A;  3L2U A;  3S3O A;  4JHD B;  3EYZ A;  3WNE A;  4LFA K;  4BE0 A;  3LDL A;  1RT1 A;  2BTF A;  2ZGZ A;  3D6R A;  4OJR A;  3P83 D;  3H08 A;  4OLB A;  2FBX A;  3MXM A;  3K58 A;  3AAR A;  1BQN A;  4CK3 A;  1NGF A;  5AZJ A;  4I2Q A;  1RT6 A;  4A57 A;  3LP0 A;  4E0D A;  3DOL A;  1XQS C;  1RDW X;  5DK5 A;  2CGK A;  2A3Z A;  4A5A A;  3RVC A;  1QVG M;  1DGK N;  5FRN A;  4BGA A;  1XI1 A;  3E9O A;  2DPN A;  1RDC A;  5SWM A;  2UUC K;  1RGI A;  1VQ9 N;  4H0O A;  3ZX3 A;  2AA4 A;  4AM6 A;  4CD1 A;  3ID6 A;  2IAJ A;  1RCH A;  2UU9 K;  3P4I A;  3CF5 L;  5LY3 A;  3VET A;  5TKW A;  3RR8 A;  4RW7 A;  3CM5 A;  3O3H A;  3SZ2 A;  3NF6 A;  2QWL A;  2RPI A;  2VG6 A;  2XY8 A;  3ZSX A;  2FXU A;  2P9I A;  5K14 A;  1BO5 O;  3R9P A;  3BP8 A;  3NE6 A;  4LC9 B;  1XHZ A;  5M1P A;  1SL0 A;  1NGH A;  5EY4 A;  1HKB A;  2CGL A;  5AQZ A;  2KW4 A;  5AQV A;  1SKR A;  3O1B A;  4CJP A;  4IJN A;  1X9J A;  3OJS A;  2HVI A;  2QXF A;  2HNY A;  2W6K A;  3L4I A;  3IKM A;  4BR9 A;  3VEW A;  4OGE A;  4CEC A;  3EKS A;  5AQM A;  4FK4 A;  4YHH K;  3RMC A;  3CPW M;  4IKF A;  1QS4 A;  1NK4 A;  1X9S A;  4H5R A;  4C23 A;  4CJ7 A;  1X1P A;  1WOQ A;  5A2Q O;  4CF2 A;  4Z4F A;  2V7Y A;  4CJL A;  4Z4H A;  1JL1 A;  1JLA A;  4DWI A;  1BDG A;  3CCQ N;  2E2Q A;  1KLN A;  5JS2 A;  1O13 A;  1RDB A;  3VA3 A;  1TL3 A;  1R0A A;  1VHX A;  4KHU A;  2Q0R A;  3AVH A;  2A41 A;  2NUB A;  4CZE A;  4OO1 J;  2G8V A;  4WCE L;  2OAN A;  4FZX C;  4KHY A;  3HPH A;  4E3S A;  3OYI A;  5SZT A;  3HOT A;  2HMI A;  4DV2 K;  4X62 K;  4ISE A;  2O4G A;  3B6O A;  1TVR A;  3VQQ A;  3QFP A;  3SMP A;  1NMD A;  3CJ1 A;  2Y1J A;  1KC8 O;  5ELZ A;  3CXC M;  4AM7 A;  3VTH A;  4PKG A;  3B6P A;  4OGC A;  5M1Q A;  3HM9 A;  2RN2 A;  3UKR B;  3N4P A;  4BE2 A;  1XNR K;  2G8I A;  4H8K A;  4CEE A;  1JCG A;  2D5R A;  2HHS A;  1G15 A;  3K5O A;  1X9M A;  4YOT A;  2WUS A;  2GX9 A;  3CFP A;  1WSF A;  1GLL O;  4LF6 K;  4B9U A;  1MWK A;  3DAW A;  1Z25 A;  3G6E N;  3R8E A;  3HOS A;  1IBL K;  2EHG A;  3ISN C;  5GAE P;  4F2S A;  2KZZ A;  1J5O A;  2BH1 A;  1GOB A;  3NGY A;  4FZZ A;  1RT4 A;  4R5P A;  4FWM A;  4JKD A;  1A5X A;  3AVL A;  4NYF A;  4N41 A;  4OPJ A;  2R7Y A;  3LZI A;  3CD6 N;  4CGD A;  3V6D A;  1OH7 A;  3BF3 A;  2NNW A;  4DTP A;  3SMS A;  2ASP A;  3QIC A;  1EKE A;  4U7B A;  4JRP A;  4OKK A;  5E26 A;  3WXM B;  1KD1 O;  4CBW A;  1VSE A;  1RBS A;  4A5B A;  5CR4 A;  1V4S A;  3TAQ A;  3C0B A;  4LF8 K;  4BC2 A;  4H4O A;  1HLU A;  4CHQ A;  3BY5 A;  1K8A O;  3VES A;  2ITM A;  1JL2 A;  4NYN A;  4DTR A;  2V52 B;  1OH8 A;  4KFB A;  2E1Y A;  5AQN A;  3H1V X;  5BPN A;  4KHW A;  3VEO A;  4RWT A;  1NK8 A;  1OH6 A;  4JKF A;  1T8E A;  4DSI A;  2Q97 A;  3UIQ A;  4I9L A;  5BRF A;  3LPU A;  3ZSZ A;  1Z26 A;  4NXN K;  1RT7 A;  3HM8 A;  3DMJ A;  3ZSQ A;  5B8H A;  3DXK B;  4IEE A;  4FLZ A;  3DXM B;  3KLG A;  3DLG A;  4DQQ A;  3C94 A;  3ALY A;  1BCM A;  4BRP A;  1K9M O;  3SAF A;  3CC7 N;  2HHH K;  4GV9 A;  1GLE G;  2OZM A;  1JKH A;  3GOI A;  2VQE K;  5C2D A;  3DLB A;  4B8C A;  4FLY A;  2P1J A;  2ZD1 A;  2A6A A;  3ZEU B;  1NGD A;  4HUG A;  1VRU A;  1D9F A;  3VQ8 A;  4RG8 A;  4JI7 K;  2A1S A;  3AA5 X;  3HTV A;  4DS4 A;  5JIC A;  4DV1 K;  3SQ2 A;  3VOV A;  1T03 A;  4CJK A;  4DR2 K;  4Y1C A;  4B1Y B;  1TAU A;  3SAG A;  4FJK A;  5GIP A;  1N33 K;  3NCI A;  2A42 A;  2A40 A;  3FZK A;  4LF9 K;  3ENH A;  5J2N A;  1JLQ A;  4FK2 A;  5M1O A;  1ESV A;  1RT5 A;  4IDK A;  3A5M C;  3VQP A;  4B1X B;  3NH2 A;  3S3N A;  3VEZ A;  1NK5 A;  2OTJ N;  1JCE A;  3OYJ A;  1XUP O;  4IG0 A;  4CHO A;  4NO7 A;  3QBW A;  1J9A A;  5AQT A;  3GL1 A;  4JK7 A;  1IKW A;  3KD5 E;  5LJW A;  1BI4 A;  2DFE A;  3O4Q A;  3G4S N;  1XC9 A;  4JS4 A;  2O4I A;  4O0J A;  3BF1 A;  2YKN A;  5HL7 L;  3T19 A;  5LL6 Z;  1QSS A;  3VQ9 A;  3KHY A;  3AA4 A;  3IAY A;  4C1N I;  3I8B A;  5M1F A;  1HX1 A;  4CZM A;  1NGC A;  4FLT A;  3CC2 N;  4RCH A;  4DU3 A;  5FDL A;  3QIO A;  2ITG A;  2QEX N;  3THY B;  1SS6 A;  2P51 A;  2V51 B;  3EZ5 A;  1XNQ K;  1NJZ A;  4GY2 B;  1WN7 A;  1L3S A;  1C0T A;  3EY1 A;  4FWN A;  1YIT N;  2QI2 A;  2Q2R A;  4B3R K;  5C24 A;  3GE1 A;  1R59 O;  3P39 A;  1W9H A;  5KPZ A;  3CI5 A;  1NGE A;  3MWT A;  4RW4 A;  4H5V A;  3I55 N;  3MED A;  1SAZ A;  2YCH A;  1UA1 A;  2UXC K;  5AFU A;  1K8K A;  3AVN A;  4JEP A;  3SLC A;  4AHS A;  4CE9 A;  4YY3 K;  3TAE A;  4ELT A;  1VSL A;  3LDO A;  4W5Q A;  3M8Q A;  4CK2 A;  3B8A X;  3FZF A;  4GW6 A;  3SUO A;  4BRD A;  5AJ3 K;  4DB3 A;  3M1F A;  3VQC A;  3AVM A;  3TPQ A; 
#chains in the Genus database with same CATH homology
 1Q9Y A;  1HNV A;  3DLE A;  2GUI A;  3CG7 A;  1QE1 A;  2VG7 A;  4I2P A;  3QNO A;  3AA3 A;  4F3T A;  2LSN A;  4FK0 A;  5J2Q A;  3QEW A;  3DOK A;  3O3F A;  1WAJ A;  4E89 A;  2P5O A;  5FRM A;  3BDP A;  3NGI A;  4CJW A;  3SJJ A;  1NKC A;  4MQ3 A;  1C1A A;  1RT3 A;  4KRE A;  4RW9 A;  4DLE A;  1TK8 A;  3HO1 A;  3DRS A;  1A5W A;  1DLO A;  1GOC A;  4CHZ A;  2IC3 A;  4FLX A;  3SUP A;  3AO4 A;  4LH4 A;  4CEO A;  1EXQ A;  3K2P A;  3S3M A;  1D5A A;  4DFM A;  1U49 A;  4W5R A;  1S1V A;  4KTW A;  1J54 A;  3QEP A;  2OA8 A;  4LY7 A;  4M45 A;  4KPY A;  3KKR A;  4FXD A;  5I3U A;  2JLE A;  2YV0 X;  4LH5 A;  3OYN A;  3MXI A;  3HVR A;  3OYC A;  4DFP A;  4KTQ A;  2BAN A;  3VQB A;  3SPZ A;  1U47 A;  2HHQ A;  4M3Z A;  4E7J A;  3DLK A;  1SL2 A;  1YTU A;  4NCB A;  1VSJ A;  4RW8 A;  3PO4 A;  1RBV A;  3DRR A;  1KCF A;  5CY4 A;  4B08 A;  3LWL A;  1KTQ A;  1TK0 A;  4CJ4 A;  4IFV A;  3AVA A;  3PUF A;  3OS2 A;  4G1Q A;  3FFI A;  3RMA A;  3DLR A;  3OYH A;  5C25 A;  4KV8 A;  3NH1 A;  5C42 A;  4J2E A;  4DSE A;  4FJL A;  2DY4 A;  1HRH A;  3SCX A;  2D0A A;  1BIU A;  2X78 A;  3ASM A;  1IKV A;  2WON A;  1NK0 A;  4W5N A;  3ZT1 A;  4CIF A;  1KSP A;  4CGG A;  5J2M A;  4NCA A;  3HYF A;  3KLH A;  3NHG A;  2X74 A;  3L2Q A;  2DTU A;  2BGG A;  1JLE A;  4AIL C;  3LAL A;  3I0R A;  5CYM A;  4CER A;  1RTH A;  4B9V A;  3LAM A;  2XY6 A;  4PY5 A;  2PYL A;  1LAW A;  1WLJ A;  3MXJ A;  4DTX A;  3A2F A;  5HRP A;  3SYZ A;  5I42 A;  4F3O A;  4M42 A;  3WNG A;  3QIP A;  1NK6 A;  3L8B A;  3HPO A;  3AVC A;  1LV5 A;  3CYM A;  1RTI A;  1RTD A;  3L2U A;  3S3O A;  1WSG A;  3AA2 A;  3EYZ A;  3WNE A;  2KFZ A;  3V81 A;  4CJF A;  4BE0 A;  3LP1 A;  1MU2 A;  1C6V A;  1RT1 A;  1S1W A;  3CFR A;  1EP4 A;  4CES A;  3M8P A;  1UOC A;  3DRP A;  4OJR A;  4B9N A;  2YNI A;  4M3R A;  3P83 D;  4HUE A;  1S9G A;  3KLI A;  1VSH A;  3H08 A;  4OLB A;  2FBX A;  3MXM A;  3K58 A;  3NF8 A;  1BQN A;  4WE1 A;  4CK3 A;  1ZBH A;  4DTJ A;  4EZ6 A;  3CM6 A;  3AO2 A;  4M3X A;  1Y97 A;  4EP4 A;  3NGZ A;  4I2Q A;  3HT3 A;  5FRO A;  1RT6 A;  2W42 A;  2RF2 A;  4HVJ A;  3LP0 A;  1L5U A;  3L3V A;  4E0D A;  4E1M A;  2XHB A;  1IKY A;  1NK7 A;  3DOL A;  2F96 A;  5DK5 A;  4KKO A;  1LWC A;  2G8F A;  3QIN A;  2IS3 A;  1IKX A;  3K5N A;  3SI6 A;  1VSI A;  2A1R A;  5FRN A;  2HHT A;  3O4N A;  3VN5 A;  1XI1 A;  1RDC A;  5SWM A;  3QER A;  3QES A;  4JLH A;  1HYZ A;  2YHA A;  4W5O A;  2X6N A;  3G10 A;  3TAG A;  4HHT A;  1VK0 A;  2IAJ A;  4FW1 A;  2FBV A;  1RCH A;  4ID5 A;  3TR8 A;  3MAQ A;  1YT3 A;  2X6S A;  1JXB A;  4Z4C A;  4O0I A;  4CJ3 A;  3RMD A;  1ZBL A;  3DLH A;  1KVA A;  2YNG A;  4RW7 A;  3CM5 A;  3RR8 A;  2VG5 A;  3O3H A;  3SZ2 A;  3NF6 A;  3D0P A;  3V9Z A;  4DSJ A;  2QK9 A;  4FYD A;  4CF8 A;  2RPI A;  2VG6 A;  2XY8 A;  3ZSX A;  2HND A;  3LAK A;  5K14 A;  5HLF A;  4QCL A;  1UAX A;  4CJR A;  4CIE A;  4K8Z A;  1C1B A;  2OPS A;  1SKS A;  3NE6 A;  4NCG A;  4CF0 A;  4HTU A;  4FCY A;  2Y1I A;  1XHZ A;  2G8U A;  3OJU A;  1SL0 A;  3VQD A;  3AVI A;  3OS0 A;  3I8D A;  4F4K A;  3PV8 A;  2KW4 A;  3OYL A;  3KTQ A;  3KK1 A;  3SNN A;  3C6U A;  4DFK A;  1HYS A;  3SUN A;  3VQ4 A;  1SKR A;  4CEA A;  4CJP A;  4BDZ A;  1L3V A;  2RKI A;  1WNS A;  5CYQ A;  4AHV A;  4ELV A;  3OJS A;  2HHU A;  2HVI A;  4XIU A;  2QXF A;  2HNY A;  1ITG A;  3WNH A;  3QEV A;  3OS1 A;  1T05 A;  3M8R A;  4DTU A;  5KRT A;  2DFH A;  3OY9 A;  1RBU A;  4DF8 A;  4CJE A;  3TAF A;  1SKW A;  4E7I A;  4AH9 A;  3QEI A;  4OGE A;  3AVB A;  4CEC A;  2XRI A;  3P5J A;  3OYB A;  3HJF A;  4B3O A;  3VA0 A;  4FK4 A;  1S5J A;  1U04 A;  4CED A;  1VRT A;  2IOC A;  3V1R A;  3RMC A;  1UA0 A;  1ZYQ A;  1QS4 A;  3KK3 A;  4IKF A;  1NK4 A;  1S1U A;  1S6Q A;  3OYG A;  1X9S A;  4B9M A;  3ZSY A;  1HMV A;  1EX4 A;  3P1G A;  1X1P A;  4OKE A;  1BHL A;  4CF2 A;  3HPG A;  4DQR A;  2XY7 A;  4Z4F A;  1YVU A;  1FKO A;  3F9K A;  5JS1 A;  4CJL A;  3KK2 A;  3VQE A;  3MEG A;  1JXE A;  3KJV A;  4W5T A;  4FM2 A;  2G8K A;  4CJ5 A;  4Z4H A;  4CFC A;  1JL1 A;  1JLA A;  3OYF A;  4DWI A;  5DMR A;  4AHR A;  1WSH A;  3ZCM A;  4EP5 A;  4CFB A;  4CIG A;  4FJM A;  4KB0 A;  1KLN A;  4CJQ A;  2HNZ A;  3SV4 A;  4DTS A;  2D0C A;  1NJX A;  5JS2 A;  4ID1 A;  1U45 A;  1RDB A;  3VA3 A;  1TL3 A;  1VSK A;  3ZSO A;  1R0A A;  2ZQB A;  1CZ9 A;  4C8K A;  4C8L A;  2E4L A;  2ETJ A;  2BE2 A;  2FBT A;  4KHU A;  1TKX A;  4C8O A;  3AVH A;  2NUB A;  4AHT A;  1VSD A;  3THV A;  2G8V A;  4FZX C;  1LWF A;  1IG9 A;  1SUQ A;  3KLE A;  1RDA A;  4FJ9 A;  1RNH A;  4KHY A;  4CHY A;  1KVB A;  3HPH A;  3AO1 A;  4ZTF A;  1NKE A;  4E3S A;  1NOZ A;  3OYI A;  5SZT A;  2HMI A;  2PZS A;  2GBZ A;  4IBN A;  4CHP A;  4N5S A;  2ATQ A;  1RDD A;  3B6O A;  2O4G A;  1TVR A;  3VQQ A;  3U3Y A;  1ZBF A;  4YFU A;  4N76 A;  1DTQ A;  1VSF A;  5J2P A;  3SQ1 A;  1NKB A;  4ZHR A;  4B8A B;  4M3U A;  4Z4E A;  2Y1J A;  3CQ8 A;  1HPZ A;  3M8S A;  4I7F A;  1TKT A;  3HP9 A;  3B6P A;  3IS9 A;  3JSM A;  3NF7 A;  4OGC A;  5T7B A;  3HM9 A;  4DS5 A;  2B4J A;  1EET A;  5HP1 A;  1QTM A;  2RN2 A;  3PY8 A;  4BE2 A;  2G8I A;  4CGF A;  3S9H A;  4H8K A;  4CEE A;  2D5R A;  4BE1 A;  2HHS A;  1G15 A;  3K5O A;  3NF9 A;  1X9M A;  3IRX A;  1O1W A;  4FW2 A;  3SV3 A;  4KB1 A;  4Z4I A;  4CFA A;  3CFP A;  4CHN A;  2PYJ A;  4TSX A;  1WSF A;  4BDY A;  2Z1J A;  4DFJ A;  4DQI A;  3L3U A;  4DSK A;  4B9U A;  3KKS A;  3RMB A;  3PO5 A;  1Z25 A;  1BL3 A;  3SQ0 A;  3LPT A;  4GMJ B;  4CJT A;  3HST B;  3VQA A;  3NBP A;  4DSF A;  2Z1I A;  2Z1H A;  4M3T A;  3TAN A;  2EHG A;  1HQU A;  3ISN C;  2WOM A;  4E7L A;  4O55 A;  4F2S A;  2KZZ A;  1WAF A;  2HB5 A;  1J5O A;  5CZ1 A;  3TI0 A;  3ITH A;  1TKZ A;  4FJX A;  3NFA A;  3NGY A;  1GOB A;  4FZZ A;  1RT4 A;  4R5P A;  2Q3S A;  3RTV A;  1ASV A;  1JLB A;  2AJQ A;  3RRH A;  1ASW A;  4IFY A;  4KTZ A;  1A5X A;  3AVL A;  4NYF A;  4CGI A;  1QSL A;  3MEE A;  2G8H A;  4N41 A;  4OPJ A;  2R7Y A;  3LZI A;  2Z1G A;  2QKK A;  4CGD A;  3HXM A;  3V6D A;  3RWU A;  3HP6 A;  3QET A;  1ZBU A;  4PQU A;  4CEB A;  3KLF A;  1S9E A;  4DTP A;  1FXX A;  4F8R A;  2E6L A;  1I3A A;  1WSI A;  5HRS A;  4LSL A;  5D3G A;  1KVC A;  4CK1 A;  2HHV A;  4LD0 A;  4FLV A;  4KAZ A;  1I39 A;  1UWB A;  1EKE A;  3HL8 A;  4LSN A;  4OKJ A;  4JRP A;  4OKK A;  4Z0U A;  4E7H A;  3ZT4 A;  1VSE A;  3K5M A;  4BWJ A;  1RBS A;  5HRR A;  1YTA A;  1XHX A;  1NJW A;  3JYT A;  3TAQ A;  5HBM A;  4RW6 A;  4OPK A;  4I9Q A;  4H4O A;  4CHQ A;  4KHS A;  1JL2 A;  4NYN A;  3ZSR A;  4KHQ A;  4DTR A;  3NAE A;  3K57 A;  3ZT0 A;  3HK2 A;  4GVM A;  4KI4 A;  4DQP A;  3V9X A;  3PX0 A;  4KFB A;  3AV9 A;  1FK9 A;  1GOA A;  1QQC A;  3SQ4 A;  1J53 A;  4KRF A;  4DLG A;  2GV9 A;  5KRS A;  4KHN A;  4H4M A;  4M41 A;  4FJG A;  4KHW A;  4YNQ A;  3SUQ A;  1NK8 A;  1U48 A;  1Q9X A;  1CZB A;  1T7P A;  3AVJ A;  1T8E A;  4DSI A;  3QEX A;  1BCO A;  2IGI A;  3F73 A;  4DMN A;  1N6Q A;  4EZ9 A;  3UIQ A;  2YKM A;  3ZSW A;  2KQ2 A;  4DG1 A;  4I9L A;  3OYK A;  1D8Y A;  3LPU A;  4FJN A;  3ZSZ A;  1Z26 A;  4FJI A;  1RT7 A;  3ZSQ A;  3DMJ A;  3VQ5 A;  4J2A A;  3NDK A;  2HW3 A;  4CFD A;  1WSJ A;  4ZTJ A;  4Z4G A;  4CGJ A;  4FLZ A;  4FJ7 A;  3KLG A;  3AVF A;  4CGH A;  5J1E A;  4K8X A;  4OLA A;  3DLG A;  3CFO A;  3C94 A;  3ALY A;  1BCM A;  4Q5V A;  4DQQ A;  1BIS A;  4FLW A;  1NOY A;  4HCB A;  3I0S A;  4AHU A;  4UQG A;  1RBT A;  2KFN A;  3K59 A;  1JLG A;  3KD1 E;  1K6Y A;  1L3T A;  4CEQ A;  5KTQ A;  2B6A A;  3TWH A;  1JKH A;  1SV5 A;  1TV6 A;  2OZM A;  1HQE A;  4FJH A;  3ZT2 A;  3V1O A;  3V9S A;  3PX4 A;  3DLB A;  4B8C A;  4FLY A;  2P1J A;  2ZD1 A;  4DTN A;  1HNI A;  1TAQ A;  3DI6 A;  3VQ7 A;  1L3U A;  4MFB A;  2PY5 A;  4DSL A;  4HUG A;  1VRU A;  1D9F A;  3VQ8 A;  4RG8 A;  2HHX A;  1VSM A;  2A1S A;  3AA5 X;  4C8M A;  1BIZ A;  3T1A A;  1HYV A;  3RR7 A;  3NH0 A;  4CCH A;  4ELU A;  4DS4 A;  2FBY A;  2YHB A;  1X9W A;  4FVM A;  3SQ2 A;  1XWL A;  1LWE A;  1TK5 A;  2XO7 A;  4CJK A;  3SPY A;  1T03 A;  2DFF A;  2YNH A;  4FJ5 A;  2KTQ A;  1ZBI A;  3MEC A;  4Y1C A;  1TAU A;  1SL1 A;  3D45 A;  3OYM A;  3LP2 A;  4FLU A;  1LW2 A;  4FJK A;  1A5V A;  1JLC A;  1JLF A;  2EX3 A;  2IDO A;  3C95 A;  1DTT A;  3NCI A;  4JRQ A;  3HVT A;  4O5B A;  1REV A;  2F8T A;  4M3Y A;  1KLM A;  3L2W A;  5J2N A;  1JLQ A;  4FZY A;  4FK2 A;  1RT5 A;  4ICL A;  3PX6 A;  1TL1 A;  4DF4 A;  2OPQ A;  2ZE2 A;  4IDK A;  1CXQ A;  1RBR A;  3LAN A;  4E1N A;  3VQP A;  1B9D A;  3NH2 A;  3U6F A;  1RT2 A;  3DM2 A;  4N47 A;  3TAB A;  3TAR A;  3S3N A;  4CJV A;  4Q0B A;  4F2R A;  3L2R A;  1NK5 A;  1B9F A;  2D0B A;  1S1X A;  3V9W A;  3OYJ A;  1BGX T;  4M3W A;  3C6T A;  4IG0 A;  4CHO A;  4QAG A;  3ZSV A;  3LDS A;  4FJ8 A;  5E41 A;  1J9A A;  4FJJ A;  1C0U A;  3OVN A;  1NK9 A;  1IO2 A;  1IKW A;  3KD5 E;  5HRO A;  1BI4 A;  3K5L A;  2DFE A;  4DU1 A;  1U4B A;  1D9D A;  1TGO A;  3O4Q A;  2JGU A;  3KIO A;  4Y1D A;  4CF1 A;  1BQM A;  5HRN A;  1RIL A;  2P5G A;  3TAM A;  5EU7 A;  1XC9 A;  3LP3 A;  3OYD A;  4JS4 A;  2O4I A;  4BAC A;  4O0J A;  2YKN A;  3LZJ A;  1S6P A;  4PA1 A;  1QHT A;  1B92 A;  1LW0 A;  3V1Q A;  3WNF A;  2F8S A;  4C8N A;  3T19 A;  1FKP A;  4CJS A;  1Q8I A;  1WSE A;  1QSS A;  2OYQ A;  1CXU A;  1ASU A;  3VQ9 A;  3AA4 A;  2I5J A;  3IAY A;  4KO0 A;  4J2B A;  3AO5 A;  4CEF A;  4J2D A;  4FLT A;  3ULD A;  3OYA A;  3E01 A;  3G0Z A;  4E7K A;  4DU3 A;  5FDL A;  4CF9 A;  1C1C A;  2QKB A;  3QIO A;  2ITG A;  3L2V A;  3RRG A;  4HUF A;  2P51 A;  1TKD A;  4DTM A;  3ZT3 A;  3EZ5 A;  4CEZ A;  1KFD A;  2OPP A;  2FC0 A;  4E19 A;  4JS5 A;  1NJZ A;  3V9U A;  5KGX A;  1N5Y A;  1LAV A;  3QLH A;  1WN7 A;  4OVL A;  1L3S A;  4HCC A;  1C0T A;  3AVK A;  3EY1 A;  4PUO A;  3V4I A;  3LWM A;  2XY5 A;  4CJU A;  1QSY A;  4B9T A;  2OZS A;  4AHC A;  4FM0 A;  1W0H A;  4DTO A;  5C24 A;  2BDP A;  3IG1 A;  1S1T A;  4IG3 A;  3QNN A;  2VWK A;  3O3G A;  2G8W A;  4BDP A;  4PWD A;  1W9H A;  2YNF A;  3T3F A;  1C0M A;  3TAP A;  4QOZ B;  2HVH A;  4RW4 A;  4BWM A;  2HHW A;  1HJR A;  1F21 A;  3MED A;  5CZ2 A;  4B9S A;  1CLQ A;  4O4G A;  1UA1 A;  4DQS A;  1NJY A;  3BGR A;  1IH7 A;  5KGW A;  1KRP A;  2OPR A;  3U3G A;  2VWJ A;  3AVN A;  4AHS A;  4CE9 A;  3AO3 A;  1KFS A;  3TAE A;  4B9L A;  4ELT A;  4DU4 A;  1VSL A;  4W5Q A;  1BI4 B;  4KI6 A;  3M8Q A;  4GW6 A;  4O44 A;  3DYA A;  5KI6 A;  4CK2 A;  2E6M A;  4N56 A;  3OYE A;  3SUO A;  3AVG A;  3QO9 A;  3VQ6 A;  2KZM A;  4L8R B;  2B5J A;  3VQC A;  3AVM A;  1RTJ A;  4FM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...