4CJSA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjsA00
2ZD1A 1LAVA 2BGGA 3C6TA 5K14A 4M3WA 4CGJA 3ZT0A 4CEAA 3LANA 3I0RA 4CJRA 1N5YA 2OPRA 2HVHA 1QSLA 5HBMA 1RBVA 3WNEA 5HRSA 4IG0A 4NYNA 1WAFA 4CJVA 3HVRA 2ZQBA 3RMCA 4M3TA 2KZMA 3NGIA 3DMJA 3NF9A 1NKBA 4DSKA 3QEIA 4KB0A 2R7YA 4DQRA 1I3AA 3L3VA 4CFCA 4PWDA 1EXQA 3ITHA 2EHGA 4Z0UA 3RWUA 4OKKA 5J2PA 3M8SA 4BDZA 1U49A 2DFHA 5CYQA 1SL0A 4M3UA 1ASWA 4KHWA 3B6OA 3AVKA 3AVNA 3TAMA 4CEEA 1QSYA 3OYNA 3RRHA 5FDLA 1VRTA 1NK5A 3T19A 3KLHA 3NAEA 4DSLA 3U3YA 4ELTA 3PY8A 1JLCA 3DRPA 4QOZB 1S9GA 4OLBA 4CHQA 4IBNA 3K2PA 3THVA 1TGOA 4CJLA 4CJ3A 4CHOA 4DG1A 3TARA 4Z4HA 5FRNA 1NJZA 4NYFA 3QEVA 3L2RA 4M45A 4E7LA 1NJWA 2DTUA 3VQQA 3MEDA 4GVMA 3SV3A 4B9TA 3VQBA 4QCLA 2W42A 4CGFA 1DTQA 1KFDA 3D45A 3HYFA 4KKOA 4W5QA 2RKIA 3ZT1A 4FZXC 4E0DA 3AVGA 2KZZA 3JYTA 3WNGA 3OYGA 3VQ4A 4FLUA 2FBTA 2HNYA 2Z1GA 3T3FA 1S1VA 3HVTA 3PV8A 4CCHA 3ZSWA 4B9LA 3KLEA 1JLQA 4RW7A 4B9SA 2ETJA 2OPSA 2A1SA 3M8QA 3G10A 3VQ5A 4FW1A 1J9AA 3CFPA 4HUEA 3LAMA 4C8KA 5FRMA 1BI4B 1RDDA 4CJPA 4RW6A 4F3TA 2E4LA 3QO9A 1YTAA 5HP1A 1DTTA 3ZT4A 4FJKA 3HP9A 4I2QA 3F73A 3QEXA 3PO5A 2IS3A 3AVJA 3QINA 4AILC 5HRPA 1B9DA 3ZSXA 4M3YA 3DLGA 4TSXA 1TL1A 4DU4A 4B9MA 2RF2A 3IRXA 4CF1A 3DLRA 3SUNA 3IG1A 3DRSA 4O0JA 4FVMA 4N47A 4MFBA 4CEBA 4CIFA 3L2UA 4FM1A 3QESA 4FK4A 5E41A 3LWLA 4F2SA 3VA0A 4W5TA 3OYDA 1GOCA 1WSJA 3SQ0A 4K8XA 3C6UA 4CGIA 1ITGA 1GOAA 1C6VA 3KKSA 1WSIA 3NFAA 4QAGA 1BIUA 2FBVA 4IG3A 4JS4A 1JL2A 4H4MA 4OPJA 4FXDA 3D0PA 3VQDA 4FCYA 4RW9A 1VRUA 1HRHA 3DI6A 4CERA 2XO7A 4FM0A 4DTOA 4CEQA 2G8WA 4C8OA 4IKFA 2VG5A 4IFYA 2P5GA 2GBZA 4CHZA 1KVAA 4E19A 2HHXA 1W0HA 1TKDA 1L5UA 4B9VA 4ZTFA 4Q0BA 1NJYA 4E3SA 3DOKA 3VA3A 2OYQA 4PA1A 4Y1DA 1RT3A 3CFOA 4ELUA 4E1NA 3VQ7A 4AHRA 1DLOA 1XHZA 3HJFA 2JLEA 1U48A 2X78A 2PY5A 4KI6A 3MEGA 4DSIA 4H4OA 1NK0A 3HSTB 1VSFA 3OYMA 3K58A 4NCBA 1IKYA 4PY5A 4OGCA 3VQCA 3RRGA 4FJ9A 2QK9A 1CZBA 3MXMA 3V9SA 4E7HA 3SQ1A 1T8EA 4OJRA 4KRFA 4LSNA 4CEZA 4Y1CA 3TABA 2WOMA 1BCMA 4DWIA 2D0CA 2HVIA 5J2QA 4CK1A 4XIUA 5KGWA 4M3ZA 4B3OA 4CK3A 4FK0A 4LSLA 4DSEA 4DQPA 1ZBHA 4GMJB 4OLAA 4N41A 1WSGA 3V9XA 2BDPA 4CJEA 4W5OA 1SL1A 4ID5A 1JXEA 3QIPA 3AVFA 4W5NA 3SYZA 3SNNA 4KHNA 3V1QA 4CFAA 4AHSA 3OS0A 4DLGA 1X9SA 3S9HA 4CEDA 2IAJA 3RR8A 4ZTJA 4JRQA 4FLXA 2Y1IA 3P5JA 3LP0A 5SWMA 3SCXA 3QLHA 1JL1A 2O4IA 1KLMA 4OPKA 2YNIA 3AVMA 3CQ8A 1X9MA 4O0IA 4CGHA 3TR8A 2I5JA 4O44A 4LH4A 2ATQA 5C24A 3OYCA 1Q9XA 4LY7A 4Z4IA 3MXIA 1QQCA 4FYDA 1UA0A 4DFMA 3PUFA 1UA1A 4LH5A 3KTQA 3HPHA 2RPIA 1LW2A 4AHCA 4RW4A 1S1WA 1RT7A 3ZSQA 2NUBA 1NK8A 4CJKA 1NKEA 4KHUA 3OYEA 3WNHA 2KFNA 2HHUA 3AA2A 4CJSA 3EYZA 3SQ4A 4FJJA 4J2AA 1Z25A 3AVHA 1BL3A 2ITGA 4NCAA 1SV5A 2KFZA 3AO1A 4BWMA 3AA5X 3VQAA 2O4GA 1S6PA 3U3GA 3LALA 1VSMA 1HMVA 4CHNA 1F21A 2YKMA 1LV5A 5J1EA 1O1WA 4HCCA 3TANA 1YT3A 1RCHA 2F96A 3DLEA 4ZHRA 2Q3SA 5I3UA 1VSIA 3LPTA 4MQ3A 2Y1JA 1JXBA 2GUIA 2PYJA 2OA8A 2B5JA 3M8RA 2IDOA 4M41A 1KTQA 1XC9A 3L2WA 3TAFA 2G8VA 1NK4A 2HHTA 1IO2A 4AHUA 3NF6A 1A5XA 3QERA 1KVBA 4JS5A 5CZ1A 3ZSVA 3DLKA 4CF8A 4DFKA 4CECA 1HPZA 4BWJA 1X1PA 2OPPA 1K6YA 1U4BA 1HYSA 1JLBA 2OZSA 4W5RA 1UOCA 3SUPA 3LDSA 5C42A 3RTVA 2LSNA 1BQMA 3VQ9A 3HPOA 4FM2A 3DOLA 4KFBA 4RG8A 1IKXA 3FFIA 3V1RA 4EZ9A 1LW0A 3NF8A 4BE2A 5DMRA 1LWFA 4CFDA 1HNVA 4CF2A 1B9FA 2YKNA 3RMAA 3TAQA 4CJUA 1D5AA 1Z26A 3F9KA 4B9NA 1BHLA 1T7PA 3ZT3A 5FROA 2P1JA 4B9UA 2G8IA 3V9UA 4BE1A 1RT4A 4CJTA 4HTUA 3AO2A 4Z4GA 1QHTA 2QKBA 3ZCMA 2QXFA 3KD5E 1KRPA 3LZJA 3L3UA 3OYBA 1R0AA 1NK6A 4F2RA 4FZYA 2AJQA 1SL2A 5I42A 4I9LA 5CYMA 1QTMA 3CG7A 3C94A 4B08A 2A1RA 5D3GA 4DMNA 1T03A 4KTQA 2WONA 1CLQA 3AO5A 2HNZA 4WE1A 1LWCA 3K57A 1ZBUA 3B6PA 1JLFA 1WSHA 1HNIA 1NOZA 3AVIA 4DQIA 1HQUA 1TVRA 4O5BA 1C1AA 4KHYA 3NGYA 1VSDA 4C8MA 4CEFA 5HROA 4KAZA 4DQQA 3P83D 3ASMA 1U45A 2PZSA 3O4NA 2PYLA 1VSLA 4KTWA 1ZBIA 3EY1A 3SZ2A 1VK0A 2HW3A 2DY4A 1RTJA 1S1XA 5HRRA 3O3GA 2HNDA 1XHXA 2X74A 1CXUA 1CZ9A 4HCBA 1S9EA 1IKVA 2XRIA 3KK1A 4Z4FA 1FK9A 1BI4A 5DK5A 1C0TA 3TAPA 1S6QA 1YVUA 1L3VA 2OPQA 3NH1A 5C25A 3SQ2A 4KTZA 4O4GA 2XHBA 3QETA 3AVBA 4CJ5A 2OZMA 4EP5A 4CESA 4JRPA 3KLIA 1RTDA 3RMBA 2VWKA 3V1OA 3MEEA 4Z4CA 4DTUA 1GOBA 1KFSA 4CF0A 3V4IA 1S5JA 1JKHA 1JLGA 1WSEA 2E6MA 2FBYA 4N5SA 3OJUA 2P51A 3MAQA 3PX4A 1Q9YA 3ZSYA 4FJ8A 2YHAA 4J2DA 4AHVA 1MU2A 1TKTA 4AHTA 4CK2A 3OYIA 4DF8A 3AV9A 3KLGA 1TK0A 2HHWA 4FLYA 1G15A 1BIZA 5J2MA 3M8PA 1RBSA 3LP1A 5KTQA 4OVLA 1J53A 3LPUA 2RN2A 2XY7A 3S3NA 1FKOA 3LAKA 4E1MA 1XI1A 4KPYA 1ASUA 2QKKA 3DLHA 4IDKA 2VG7A 3QNOA 4NCGA 3HPGA 4FJNA 3LWMA 3HO1A 1KLNA 3AO3A 4CIEA 4DTJA 1JLEA 1UAXA 4M3XA 3OY9A 1EX4A 4KB1A 4G1QA 2GV9A 3T1AA 1C0MA 3PO4A 4FJLA 1YTUA 4CJ4A 3VQPA 5KGXA 3HT3A 1BISA 2D5RA 3OVNA 4IFVA 4ICLA 3ZT2A 4UQGA 2XY5A 4FW2A 2B6AA 4DLEA 4CHYA 3A2FA 4CIGA 3KJVA 4DU3A 2ZE2A 3IAYA 1RBUA 1WSFA 4LD0A 3SV4A 1TAQA 4PQUA 3VN5A 4HUFA 1RDBA 3LZIA 4E89A 4FK2A 1L3UA 5HLFA 2KQ2A 2IOCA 3CYMA 1RBRA 2Z1JA 1S1UA 2G8HA 4FJMA 1HQEA 5KRTA 4BE0A 1VSKA 4CE9A 2Z1IA 1SUQA 1A5VA 3L2QA 3V9WA 3SJJA 4ELVA 3NDKA 4R5PA 1CXQA 1RBTA 3AA3A 1QSSA 4I9QA 4M3RA 5CZ2A 3NE6A 3QIOA 3MXJA 4FLVA 4CEOA 3MECA 2YNFA 3AVLA 4Z4EA 4AH9A 3I8DA 3SUOA 5EU7A 5HRNA 4CFBA 4EP4A 4OGEA 4E7IA 1IG9A 4O55A 1IH7A 1VSHA 3ZSOA 3DM2A 1KCFA 3NH0A 3S3MA 3NBPA 3OYHA 1LWEA 1WNSA 1KSPA 3I0SA 1A5WA 3AA4A 4OKJA 3DLBA 3DRRA 4CF9A 3L2VA 2G8KA 2F8SA 4EZ6A 1RDAA 4KHQA 1RT5A 4DSJA 3VQEA 1BGXT 3QEWA 1FXXA 1L3TA 4CJWA 1TKXA 1C1CA 1EKEA 1TL3A 2G8UA 4KHSA 3OYKA 3OJSA 1REVA 4BACA 3IS9A 3SI6A 3KLFA 3V81A 3L8BA 3UIQA 3CFRA 3JSMA 4C8LA 3KD1E 4FJ7A 3HL8A 3EZ5A 1NJXA 1J5OA 1W9HA 2HB5A 3OS2A 3H08A 1SKWA 3DYAA 2YV0X 3OYFA 3U6FA 1HJRA 1B92A 4PUOA 4CGGA 4FJGA 4C8NA 2KTQA 3QNNA 3ZSRA 4DTSA 2P5OA 3E01A 5T7BA 2JGUA 2XY8A 1VSJA 3RMDA 1U04A 4DF4A 3TAEA 3SUQA 3TAGA 1RTHA 4OKEA 4FZZA 1RT6A 3O4QA 4E7KA 1NOYA 4F3OA 3TI0A 4YNQA 4HUGA 1TKZA 3NCIA 4N76A 3LP3A 3OS1A 4FJHA 4BDYA 1NKCA 1EETA 1L3SA 3ISNC 3AVCA 1KVCA 3VQ8A 2G8FA 5JS1A 4KREA 4YFUA 3BDPA 1C0UA 3NH2A 4DFPA 4H8KA 3V9ZA 3O3HA 3NF7A 2B4JA 1I39A 2BANA 4FLWA 1BQNA 5JS2A 3TWHA 2YNHA 3OYJA 3V6DA 2HHQA 4DS5A 2D0AA 3PX6A 4CJFA 3RR7A 5KI6A 3ULDA 3NHGA 1TK5A 4CHPA 1UWBA 1LAWA 2IGIA 2X6NA 1T05A 5KRSA 1J54A 3WNFA 2FBXA 1SKRA 2KW4A 1RILA 4I2PA 4DS4A 3P1GA 1RT2A 1ZBLA 2YHBA 3QEPA 3KKRA 4RW8A 4DTRA 4DTPA 1NK9A 3K5LA 1BCOA 3AO4A 1TK8A 5CY4A 1IKWA 4E7JA 2D0BA 2EX3A 2FC0A 2HHVA 1WLJA 5SZTA 3NGZA 1TAUA 4FJXA 5J2NA 1FKPA 2DFFA 3SPZA 1HYZA 3CM6A 3K5MA 4K8ZA 3C95A 1QS4A 3VQ6A 4FLTA 3OYAA 3O3FA 1N6QA 4M42A 1Y97A 4Q5VA 2E6LA 4I7FA 4CGDA 4HHTA 2F8TA 4CJQA 4DQSA 1D9FA 1VSEA 3HP6A 1C1BA 1HYVA 4FLZA 3K5OA 2VWJA 4BDPA 4KV8A 4DTNA 3KK3A 2IC3A 1WAJA 1Q8IA 2X6SA 4GW6A 3G0ZA 3LP2A 4DTMA 3ALYA 3KIOA 4DFJA 4DSFA 4FJ5A 3HK2A 3KK2A 1X9WA 1ASVA 4N56A 3SPYA 1D8YA 3OYLA 4KO0A 4JLHA 1RTIA 3K59A 1ZYQA 2HHSA 4KI4A 1RT1A 3HXMA 2XY6A 1D9DA 3ZSZA 1QE1A 4L8RB 2YNGA 4F4KA 1JLAA 1SKSA 4DTXA 1TV6A 2VG6A 4B8AB 3PX0A 1U47A 4ID1A 4J2EA 3K5NA 3CM5A 1NK7A 2Z1HA 2HMIA 1RNHA 3HM9A 3S3OA 4F8RA 4J2BA 1EP4A 1XWLA 2BE2A 4HVJA 1WN7A 4DU1A 4FJIA 1S1TA 3AVAA 3BGRA 1RDCA 1ZBFA 4B8CA 2DFEA
chains in the Genus database with same CATH superfamily
4IO8A 5K14A 5CR4A 5FPMA 4CEAA 3LANA 4CJRA 3A0IX 1N5YA 2HVHA 1QSLA 3WNEA 4NYNA 3HVRA 4B1WB 2ZQBA 5GAHP 3P4IA 2KZMA 4MLHA 3QEIA 1I3AA 5AQNA 4CFCA 3L6QA 1SL0A 1ASWA 2NRWA 3H1VX 3R9PA 3B6OA 4XH5A 4CEEA 4DSLA 3L0QA 4OLBA 4DR3K 5F0XA 5GIOA 4CJ3A 4DG1A 1LCUA 2QWPA 1NJZA 3QEVA 3L2RA 3ZX2A 4M63C 2DPNA 3MEDA 3VETA 4KKOA 4JKFA 2RKIA 3SLCA 3TSPA 3AVGA 3KLEA 4KHPK 1JLQA 4RW7A 5AQKA 3D7EO 2OPSA 4AM7A 3G10A 3VQ5A 4HUEA 3CFPA 3LAMA 3TTCA 5FRMA 5AFUH 4CJPA 4JI7K 1RGIA 2F7TA 1KAYA 4X66K 3BUZB 3HP9A 4I2QA 3F73A 3QEXA 4AILC 5HRPA 1B9DA 2NNWA 4FWQA 3ZSXA 4TSXA 4B9MA 3ZEUB 1IV0A 1N33K 4FM1A 2OTJN 1XNRK 3LWLA 2CGKA 1GLAG 1WSJA 3SQ0A 4CJ7A 4CGIA 1ITGA 2ZJPL 4JS4A 3A5MC 3C0BA 3VQDA 2G8WA 5AQGA 4C8OA 4B1ZA 3OBYA 1L5UA 3TU5A 2O8EA 1S22A 2HBMA 1MA9B 2IVPA 4AHRA 2JLEA 1U48A 3M3ZA 3HSTB 4BRGA 3K58A 1IKYA 4OGCA 3VQCA 3RRGA 3U9DA 1NJIO 1CZBA 3MXMA 3WUHA 3V9SA 4FJ9A 4OJRA 1K73O 3TABA 2WOMA 4O5FA 1KQSM 4CK1A 5KGWA 2FF3B 4M3ZA 4B3OA 4DSEA 1BDGA 4GV9A 3V9XA 3N4QA 4ID5A 2RHKA 3SNNA 4CFAA 5BRHA 1X9SA 3S9HA 3RR8A 2A40A 3VGKA 4ZTJA 1KAXA 4Y0WA 4JRQA 4FLXA 2Y1IA 3SCXA 3QLHA 1JL1A 3H45C 2O8BB 1X3MA 2I5JA 4O44A 4LH4A 4PHTX 3MDQA 3OYCA 4LY7A 3MXIA 2FSNA 4DFMA 1RDWX 1UA1A 4FL9A 2UXBK 2P9SB 4E1JA 1LW2A 3HBTA 1TYQA 4CJKA 1NKEA 2KFNA 3EYZA 4CJSA 1VAZA 1NGEA 3I33A 1SV5A 5GAEP 3AO1A 1KXPA 3PIOL 1U2VA 4CHNA 4HCCA 3LDNA 1YT3A 1RCHA 2F96A 4WQ5C 3LPTA 3CCEN 1WOQA 1JXBA 2GUIA 3TSUA 3M8RA 2NRVA 3CJAA 1DKGD 3J8AA 4BR0A 3F5TA 3HRGA 4R79A 1IO2A 4AHUA 4GVEA 3DLKA 3KZBA 4W5RA 1UOCA 1FW6A 4YDUC 3VQ9A 1Z26A 1M90O 1BHLA 1T7PA 2P1JA 5AQRA 1RT4A 2NRXA 3L4QA 4BG9A 4HTUA 4BC2A 4Z4GA 1E4FT 1QHTA 3B8AX 2A3ZA 2FLOA 2QXFA 5AQOA 4BRDA 3KD5E 3K0SA 2WUSA 1R0AA 2NRRA 2AJQA 5ADXH 5I42A 4DMNA 2O8CB 2HNZA 4QS8A 3AVIA 4YOYA 3UE5A 4KHYA 1VQON 1VSDA 2YJFA 4CEFA 5HROA 2O8FB 1MWKA 4X62K 3P83D 4DQQA 4B1YB 3EY1A 1XHXA 4NXMK 3CPWM 1BI4A 5DK5A 1YVNA 5GADP 3RVCA 1S6QA 1YVUA 3NH1A 5C25A 3THYA 4EP5A 4MDBA 4JRPA 3KLIA 4JNEA 3RMBA 1YF5L 3MEEA 1KFSA 4K25A 4RCHA 1YJNN 1S5JA 2P9IB 3MAQA 1WSEA 2P51A 5FPEA 5AQHA 4GKJK 2IIRA 4J2DA 4CK2A 1NU0A 3OYIA 4DF8A 2VCPA 1TK0A 4BREA 3H3NO 1G15A 1BIZA 3RSEA 1WUAA 4PKIA 2F4VK 2KKZA 5I9EB 4E1MA 1ASUA 2BUPA 4JKGA 5E84A 3WXIA 4NCGA 4FJNA 4JKAA 3LL3A 3QB0A 2P9UA 5DM7L 2NRTA 1JLEA 4DTJA 4IEEA 2E2QA 3T1AA 1YTUA 3PO4A 3VQPA 1RDUA 3OVNA 3ZT2A 2P9KA 3FZFA 4DU3A 3A2FA 3KJVA 3IAYA 2VGMA 3VTHA 3HSCA 1L3UA 3CYMA 1J5EK 1VSKA 1SUQA 4ELVA 5C0YA 3AA3A 4ISFA 4ILJA 3H1QA 1NBWA 3AVLA 4Z4EA 3I8DA 1WBDA 3DXKA 4X65K 4CFBA 4E7IA 4OGEA 3WT0A 3ZSOA 3DM2A 3MWPA 4OKJA 3DRRA 3H3OB 3L2VA 2F8SA 4EZ6A 4F9OA 1RT5A 4DSJA 3QEWA 1GLCG 2G8UA 1TL3A 4KHSA 1E3MA 3O1BA 1VQ8N 4KBOA 3KLFA 1K8KA 4JV5K 4C8LA 1NJXA 1RFQA 2HB5A 3H08A 2YV0X 3OYFA 3U6FA 1B92A 2IVNA 4FJGA 3UKRA 3QNNA 2P5OA 4XH4A 3ZX3A 4OKEA 3FFKB 3O4QA 3R6MA 2QWNA 4IZ9A 2ZF5O 2J4RA 3TI0A 4N76A 3LP3A 3OS1A 4FJHA 1P8ZA 4JHDA 4BDYA 3ISNC 3UB5A 2PBDA 3VQ8A 4KREA 2E8AA 4JKBA 1C0UA 3ATUA 3NH2A 4AQYK 4H8KA 3V9ZA 3BF3A 4FLWA 1OH8A 5JS2A 2HHQA 1EWQA 1JCGA 4CJFA 3RR7A 4BC3A 3Q7BA 3NHGA 4H0OA 2FBXA 4JI8K 4I2PA 2YHBA 1ZC6A 4YDUA 1NK9A 3K5LA 3AO4A 3DJCA 2I7PA 2P9LA 4GV6A 4B3TK 4E7JA 2D0BA 5IT9O 1WLJA 3NVMA 5J2NA 2NLXA 3KWGA 4K8ZA 2QWLA 5AZIB 3UKUA 4EHUA 4M42A 1MDUB 4Q5VA 2E6LA 1NGBA 2F8TA 4DQSA 3ATVA 2HMPA 5KQDA 3K5OA 2VWJA 4BDPA 4CD1A 4DTNA 2YCHA 3KK3A 3LP2A 4EFHA 4DTMA 3ALYA 3BEXA 4FJ5A 4DSFA 3HK2A 4FOIA 3VF6A 5FPNA 4KI4A 3HXMA 2VQEK 2XY6A 4M7YA 3ZSZA 1ESVA 4F4KA 1JLAA 4B8AB 5TKWA 3CM5A 1C0GA 1HX1A 2HMIA 4HVJA 4DU1A 3VQ7A 4BRNA 1LAVA 1OH6A 3C6TA 4CGJA 3CMEN 3ZT0A 1QQOA 1QZ6A 5HBMA 1RBVA 5M1NA 5GINA 3KHYA 4BRQA 2ASMA 4KB0A 3CF5L 3OA9A 2FSJA 4DQRA 4Z0UA 4ILHA 5J2PA 1U49A 1S3XA 5CYQA 1EO1A 4JKDA 3AVKA 4FWNA 5LMUK 3OYNA 5FDLA 5AQFA 1JLCA 2HSTA 4IBNA 3K2PA 1N36K 4CHOA 3TARA 2HBKA 5AQJA 4M45A 4IDHA 3VQQA 4GVMA 3E66A 4CGFA 3CCLN 1VQKN 4FZXC 3ZT1A 2HHHK 5KPTA 3OYGA 3CJ9A 3T3FA 1QHAA 3HVTA 1XQSC 2W40A 2ETJA 3GBTA 1W97L 4KH4A 3K9JA 2QM1A 1BI4B 1RDDA 4RW6A 3QO9A 1YTAA 3T69A 5BRFA 1DTTA 3ZT4A 4U7BA 3E9OA 2ZGYA 5AR0A 2IS3A 3OTOK 3QINA 2O8DA 3EN9A 1O13A 1BG3A 1TL1A 4DU4A 5LJVA 3FZHA 4BY9C 2QWOA 1NLVA 4FVMA 4N47A 4MFBA 3L2UA 1IBKK 1N8RO 3RSEB 1W2BM 3ID8A 4EHTA 1DT9A 1GOAA 3NFAA 4QAGA 4JKGB 3LDPA 3BF1A 4FXDA 2D0PA 4OPJA 3DI6A 4RWTA 4BR2A 4CEQA 4ILGB 1ZXOA 2GBZA 4CHZA 1VQLN 1W0HA 2E1ZA 3T1YK 1TKDA 4H0PA 3TTDA 4ZTFA 4Q0BA 4E3SA 3DOKA 4BGAA 4IOAL 4PA1A 4Y1DA 4E1NA 2P9KB 1XHZA 3A5LC 4CZKA 4KI6A 4DSIA 1WB9A 4CZIA 5AZJA 4IO9L 1T8EA 3SQ1A 1XC3A 2ZWHA 4LSNA 3VEXA 1BCMA 5HL7L 3IFRA 5J2QA 4XIUA 4CK3A 4LSLA 4YOWA 4W5OA 4W5NA 3SYZA 2QXLA 3V1QA 3O5BA 4LF9K 3VOVA 4CEDA 3EZWA 4BGBA 3P5JA 3LP0A 5SWMA 2O4IA 4OPKA 3AVMA 1U6ZA 4DV4K 3TR8A 1NGDA 2ATQA 4AM6A 4FYDA 3CC4N 1YUWA 1NMDA 4B1XB 3ENHA 5M1FA 1JCFA 3T1HK 1K8KB 1NWKA 1NK8A 1E4GT 3I55N 3WXLA 3AA2A 4K43A 5KQ8A 1VQPN 2ITGA 4QS9A 5A2QO 3AA5X 3LALA 1VSMA 4JKEA 1O1WA 4I6MB 3TANA 3DLEA 5I3UA 2PYJA 2OA8A 5BREA 1SS6A 1XC9A 4IEIA 4BR5A 3NF6A 1A5XA 5CZ1A 3ZSVA 3MN6A 4CECA 2RE2A 3DXMA 2Q31A 1HPZA 2YHYA 3ZETB 4ISGA 1HYSA 1JLBA 4MLEA 1FJGK 5C42A 3RTVA 3HPOA 4JI5K 3DOLA 4EZ9A 4RG8A 1IKXA 4BE2A 5DMRA 1LWFA 4CF2A 1D5AA 3F9KA 3MX5A 1LOTB 1NGCA 2D4WA 2GEMA 4B9UA 4DV6K 2P9LB 3AO2A 4YOTA 1VHXA 5LJWA 1DGKN 3ZCMA 1KRPA 4K41A 3L3UA 4LFBK 3BZKA 4BRLA 3UKUB 1YXQA 4FZYA 4LF8K 4I9LA 1QTMA 3C94A 4B08A 5D3GA 4KTQA 2WONA 3O9SA 4BG8A 5LMNK 1WSHA 1HNIA 1OKJA 2WBNA 4O5BA 4PKHA 4BRIA 3NGYA 1SAZA 1U45A 5DM6L 3CC2N 1VQNN 5M1QA 3MCPA 2HW3A 3C6HA 4B3SK 4NLCA 2D0OA 2HNDA 2XRIA 4GNIA 1FK9A 1C0TA 3CJBA 3TAPA 4H0XB 1IJJA 2P9PB 3QETA 3WEEB 4CESA 4DUZK 1RTDA 3THWB 2VWKA 3V1OA 1GOBA 2UUAK 4CF0A 3V4IA 3FGUA 1JLGA 5M1PA 1GLJO 4BVOA 4FJ8A 1VQ7N 3LM2A 4BVPA 1TKTA 3GDQA 3TPQA 3A8YA 3AGRA 5J2MA 3HM8A 2ZJQL 3LP1A 4OVLA 3LPUA 2XY7A 3S3NA 1W7AA 3D2FA 3LAKA 1XI1A 4KPYA 1NG9A 2E2PA 4IDKA 3QNOA 5E26A 4FOEA 3FZKA 1BA0A 1KLNA 5AQIA 5AQZA 2HF4A 4M3XA 4FO0A 4KB1A 4G1QA 1KC8O 2UXCK 4CJ4A 5KGXA 3HT3A 1IBLK 1BISA 4ICLA 2XY5A 4CHYA 4CIGA 4LD0A 3SV4A 4PQUA 4HUFA 4E89A 5KRTA 4CE9A 2Z1IA 3L2QA 3SJJA 2YX6A 3KVGA 3NDKA 1RBTA 4M3RA 3VESA 3G25A 4AH9A 4BRCA 5AQLA 5BPMA 3EE8A 3FR0A 3SAHA 3MMVA 4O55A 1IH7A 1YHQN 4U67L 3NH0A 3QFUA 4LF7K 3S3MA 1T44A 3NBPA 3TSQA 3OYHA 1WNSA 4PKGA 3AA4A 4JD2A 3HTVA 1C1CA 1EKEA 3OJSA 4H5WA 4CZMA 3EZ5A 1JJ2M 3NVKA 4CW7B 4H5NA 3VENA 3ZSRA 2ZJRL 3JAMO 4H5TA 5AQXA 5T7BA 1VSJA 3RMDA 1BO5O 2WTUA 4MO4A 2P9NA 3CCSN 4E7KA 2A41A 4F3OA 4BRHA 1GLBG 1NKCA 1EETA 3AVCA 3SK3A 2UXDK 3D2EA 1KD1O 3MN9A 4DFPA 3BDPA 1Q7YO 3O3HA 3NF7A 3V6DA 3TWHA 4A5AA 3LDOA 1QVGM 3EE9A 3O08A 2W41A 1TK5A 3KK7A 2IVOA 2IGIA 2KHOA 1RILA 3P1GA 4CBUA 4WQ4C 1BCOA 1Q86O 2CGJA 2FC0A 2JWLA 1GLFO 3CCRN 3SBGA 3NGZA 4FJXA 2DFFA 3K5MA 3C95A 4FLTA 4LF6K 4DCHA 3O3FA 1N6QA 4B1VA 1NGAA 4I7FA 1Q82O 2E2NA 4L3QA 3HP6A 2Q36A 1C1BA 4FLZA 4KV8A 2A6AA 1VQ4N 2IC3A 4GW6A 3G0ZA 3BP8A 3KIOA 4JI6K 3KK2A 4DR7K 1NM1A 3SPYA 1D8YA 3P38A 2HHSA 1QE1A 4L8RB 3LDQA 4DTXA 1TV6A 3PX0A 4J2EA 4ID1A 1SZ2A 3HM9A 4F8RA 4LFAK 2BE2A 3ZYYX 3I56N 1S1TA 3G4SN 3AVAA 1RDCA 1ZBFA 1SL1A 2DFEA 3ENBA 5F2RA 4M3WA 4B1UB 3DXMB 4FSVA 4A5BA 4A62A 1WAFA 4CJVA 5C15A 4M3TA 3NGIA 3DMJA 3NF9A 1NKBA 3ID6A 2GUPA 4PWDA 1EXQA 3ITHA 4OKKA 3F9MA 3M8SA 5BR8K 2DFHA 4M3UA 3VEYA 1K8AO 4KHWA 3AVNA 5C2FA 1JCEA 3RRHA 1NK5A 3KLHA 3NAEA 4C1NK 3U8XA 1S9GA 1GLLO 2NZTA 1TGOA 3AAQA 4CJLA 3LDLA 5FRNA 4NYFA 2QWRA 2DTUA 2FF6A 4QCLA 3VQBA 3MCAB 1KFDA 2QTDA 3J7AP 3D45A 3HYFA 5IWAK 1VQ6N 2KZZA 3JYTA 3VQ4A 4FLUA 3PV8A 2HNYA 2Z1GA 3Q7CA 4FPBA 4B9SA 3CHWA 2A1SA 3M8QA 4BRMA 4C8KA 1J9AA 3MX2A 2O8EB 4YOXA 4JEPA 4WQ5A 2YHXA 3W3DA 3VGMA 5JVGL 1ZBSA 3PO5A 3VF4A 4CZEA 1YIJN 5AFUA 4M3YA 5H1SQ 2UYTA 3BZCA 3IRXA 3R8EA 1EQYA 1QQNA 2GX9A 3DLRA 4CF1A 5AQWA 4O0JA 4DV1K 4CEBA 3QESA 4CIFA 3M1FA 2ASOA 5E41A 3WQUA 3VA0A 4W5TA 3EL2A 3OYDA 1GOCA 1VQMN 4KH6A 3C6UA 3KKSA 1BIUA 2FBVA 1VRUA 4IKFA 4IFYA 3CJ1A 3VTIA 4E19A 2HHXA 1ATNA 4B9VA 1NJYA 3VA3A 2OYQA 2V7YA 3CFOA 4ELUA 1TYQB 4LF5K 2PY5A 1D4XA 3P39A 3MEGA 3EO3A 4H4OA 2QEXN 4CZFA 3J7ZO 2YJEA 3OYMA 3MWTA 4NCBA 2HBJA 3IUCA 4KRFA 4DR6K 4CEZA 3SJHA 3CJCA 1U2VB 3GL1A 4BRKA 4CZGA 4FK0A 3ZEUA 4DQPA 4OLAA 2ASPA 2BDPA 3GG4A 4CJEA 4EIAA 3IMXA 2UUBK 3OBWA 3QIPA 3AVFA 3OS0A 4DLGA 4IXCA 4IJNA 4X64K 3O8MA 3W0LA 2YNIA 4WQ4A 3AAPA 3C7NA 2WFBA 5C24A 4Z4IA 1QQCA 1UA0A 3PUFA 4LH5A 3HPHA 2GWKA 4RW4A 1S1WA 4DV0K 1RT7A 3ZSQA 2JWKA 2NUBA 3OYEA 3CMAN 3VPZA 1BL3A 3O1WA 2KFZA 3VQAA 2YI1A 4WFAL 2QWMA 3O6WA 4FWKA 3U3GA 2FSKA 5BPLA 5J1EA 4A57A 2BH1A 1HNXK 4ZHRA 1VSIA 4MQ3A 4FVUA 2IDOA 4M41A 3TTFA 4Z94A 3QERA 1KVBA 1HUXA 1V4SA 4DFKA 3PIPL 4BWJA 5BPNA 1X1PA 1U4BA 5ELZA 2OZSA 3SUPA 4QS7A 3VEZA 4G9ZA 1GLEG 2LSNA 2P9SA 2YHWA 4JI1K 3FFIA 3V1RA 2UUCK 2BGGA 4EAHD 3NF8A 4CFDA 1B9FA 2YKNA 4CJUA 4B9NA 3ZT3A 5FROA 3V9UA 3THYB 4CZJA 3FLCO 2VGNA 4BC5A 2V7ZA 3QFPA 3OYBA 1NK6A 3L4IA 1SL2A 1T6CA 3VEWA 2E1YA 2E5LK 3K57A 4K42A 1ZBUA 3B6PA 4OX9K 1NOZA 4DQIA 1HQUA 5AQTA 4C8MA 1K9MO 2BTFA 3F2KA 5AQSA 3ASMA 4KAZA 3THXA 2PZSA 5ADXA 2E2OA 5GAGP 2PYLA 1VSLA 3LM9A 4KTWA 2P9UB 1ZBIA 3SZ2A 1VK0A 2F9TA 2DY4A 4FWSA 3O3GA 1CXUA 4Z4FA 1IKVA 3SMPA 3QBWA 3J7YP 1L3VA 2OPQA 1WBBA 2I7NA 4JK9A 4CJ5A 3ZLJA 3CCVN 1YAGA 3O9UA 4Z4CA 4CVNE 1IBMK 4UY8O 2E6MA 2ZGZA 2FBYA 1BU6O 3ZSYA 5FLXO 1MU2A 4AHTA 2E88A 3AV9A 1MWMA 3DXKB 4XH1A 3M8PA 1RBSA 1QVFM 5KTQA 4JI4K 3CD6N 4B9QA 2QKKA 1XNQK 3DLHA 3CXCM 2O8FA 4JI2K 2VG7A 1Z05A 3LWMA 3AO3A 4CIEA 3MK6A 1YJWN 3KWIA 2W6KA 5B8HA 4BR4A 2GV9A 1C0MA 5AQQA 5JVHL 4FJLA 4DR4K 4IFVA 2D5RA 4UQGA 4FW2A 2B6AA 4DLEA 2ZE2A 4GKKK 1RBUA 1WSFA 1SQKA 1RDBA 5GIPA 1S1UA 4YY3K 3UKRB 2P9IA 5AQMA 3V9WA 4YHHK 3ZX0A 4R5PA 1CXQA 4I9QA 4RTFD 5CZ2A 3DLLL 4CEOA 1HKCA 3MECA 2YNFA 4IWVA 4AF1A 3SUOA 5HRNA 2KLAA 4EP4A 4JHDB 4A2BA 1BOTO 1KCFA 4HTLA 5CHIA 3HOTA 3I0SA 3DLBA 1RDAA 3O4WA 1Y64A 4KHQA 1BGXT 4CJWA 1GLDG 3L8BA 3CFRA 3JSMA 4FJ7A 3HL8A 1ATRA 4IOXA 1HKBA 3OS2A 1SKWA 3DYAA 3O9QA 3WXKA 5C12A 1HJRA 2NRZA 1S72N 4C8NA 2KTQA 3E01A 4LC9B 2XY8A 4FWPA 4DF4A 3SUQA 5F1XA 3TAGA 4FZZA 1RT6A 1Q81O 3DAWA 2HBLA 1NOYA 4YNQA 4HUGA 3NCIA 4JI0K 2CH5A 3CIPA 4WF9L 2G8FA 4YFUA 3ENOA 3T7ZA 2HOEA 2B4JA 1I39A 2BANA 4CD3A 3U9ZA 2YNHA 3OYJA 4DS5A 3PLAA 4BQLA 3ULDA 5EVZA 1NGHA 2X6NA 4FWLA 1T05A 5KRSA 1J54A 1SKRA 4DS4A 1RT2A 1ZBLA 3QMLA 1EWRA 3H46O 5EX5A 4RW8A 4DTRA 4DTPA 1TK8A 4J8FA 5CY4A 1IKWA 2EX3A 2HHVA 1NGJA 5SZTA 3CCUN 1TAUA 4H5VA 1FKPA 1HYZA 3CM6A 1NGFA 3C7NB 3E9PA 5AQYA 4HHTA 4CJQA 1D9FA 1VSEA 2VQFK 5LY3A 1N34K 5JLFA 4A61A 4LFCK 5KPZA 3G71N 4DUYK 4ISEA 5AQUA 3CQXA 1ASVA 3QICA 4IOCL 3OYLA 4KO0A 1RTIA 1BUPA 1C0FA 1D9DA 2NRHA 1SKSA 3IKMA 2VG6A 1J6ZA 3OHRA 2QWQA 3K5NA 2QW9A 2Z1HA 4WFBL 1RNHA 4WCEL 1EP4A 1XWLA 2VYPA 3IDHA 3N4PA 1CZAN 4V19S 4FK4A 4N56A 4B8CA 3CJ7A 3WQTA 2ZD1A 3EKSA 3R3LA 3I0RA 3EKUA 5AQPA 2OPRA 5AZIA 5C10A 5HRSA 4IG0A 3RMCA 3GE1A 4DSKA 4DV5K 2ITMA 2R7YA 5KPRA 3D6RA 4DR2K 4H0YB 3L3VA 5MLCQ 2EHGA 3RWUA 2GELA 4BDZA 4JK8A 4WFNL 3TAMA 4DV3K 1XMQK 1QSYA 4DR1K 5JLHA 3G6EN 2O8DB 3A5OC 3GOIA 1VRTA 3T19A 4NLBA 2EWSA 3U3YA 4ELTA 3PY8A 4CZLA 1N32K 3DRPA 4QOZB 4CHQA 1HNWK 3M6GA 3K9KA 3THVA 1Q18A 3QDKA 4Z4HA 4H0VB 4E7LA 1NJWA 1I94K 3SV3A 4B9TA 2W42A 1DTQA 4W5QA 4E0DA 3CI5A 2CGLA 3WNGA 2FBTA 3THXB 1S1VA 4CCHA 4B9LA 3ZSWA 2E20A 1OH5A 2CH6A 3S41A 4NB4A 4FW1A 2QA4N 2GWJA 2E4LA 4F3TA 2Q97A 3E9LA 1P90A 5HP1A 1YITN 4FJKA 5AZJB 3FE1A 3AVJA 1TUUA 3VEOA 4NO7A 3DLGA 2QI2A 4PL8A 2RF2A 3ULEA 3SUNA 3IG1A 3DRSA 2PFUA 2F9WA 1T3VA 3CCJN 4F2SA 4K8XA 5EXWA 1C6VA 1WSIA 4IG3A 1JL2A 1X3NA 4H4MA 3D0PA 4FCYA 3JXUA 4RW9A 4CERA 1HRHA 2XO7A 4FM0A 4DTOA 3HJFA 2VG5A 4BRFA 4HWIA 2P5GA 1KVAA 2Q0UA 2H3GX 3VEVA 5TKYA 4B3MK 1RT3A 4FPAA 3VERA 1DLOA 2X78A 1NK0A 4YORA 1VSFA 2A5XA 4OPHA 1HPMA 4PY5A 1G99A 3EEQA 2QK9A 5AJ3K 4JKCA 4E7HA 3AGKA 4Y1CA 4DWIA 2HVIA 2W6LA 2D0CA 1OH7A 3J80O 2OANA 1ZBHA 4GMJB 4C23A 4N41A 1WSGA 1VQ5N 4IFEA 1JXEA 4O8UA 1BWFO 4IJAA 4KHNA 4AHSA 4YOVA 2IAJA 1V4TA 5M1KA 4YOUA 5M1OA 3MN7A 1DEJA 1KLMA 5LL6Z 3CQ8A 4OO1J 1X9MA 4O0IA 4CGHA 4GY2B 4BR7A 1Q9XA 3P31A 3J81O 3KTQA 2RPIA 4M7XA 4AHCA 3QBXA 4KHUA 1NNEA 3WNHA 3U4LA 3WXJA 3SQ4A 4FJJA 4J2AA 2HHUA 1Z25A 3AVHA 1R59O 3WXMB 4NCAA 4BWMA 5EOYA 3H6EA 2O4GA 1S6PA 4CI6A 1HMVA 3CQYA 1F21A 2Q2RA 2YKMA 3I8BA 4BROA 1LV5A 2HF3A 4JN4A 2Q3SA 2Y1JA 3CETA 3NMUA 2B5JA 2UU9K 2V52B 1KTQA 3L2WA 3TAFA 2G8VA 3CC7N 3SBTA 3CCQN 1NK4A 2AP1A 2HHTA 4DB3A 4DQ8A 1HKGA 3A5NC 4JS5A 4CF8A 3CERA 2OCEA 4H03B 2OPPA 1K6YA 4DV7K 5HOOA 3LDSA 4BRPA 1BQMA 1OVYA 3O80A 4FM2A 4H5RA 4KFBA 3DWLA 1LW0A 3SAFA 3RMAA 1HNVA 3TAQA 3O9RA 2G8IA 4BE1A 4CJTA 4DV2K 4LF4K 2QKBA 3BY5A 3LZJA 4BR9A 3OW2M 4I6MA 3SAGA 4F2RA 4A2AA 5CYMA 3CG7A 5BRDA 2A1RA 4MO5A 4JAXA 1T03A 4DR5K 1CLQA 3AO5A 4WE1A 1LWCA 1JLFA 3M5RA 3D2FB 2AA4A 1TVRA 5JMVA 1C1AA 3AY9A 3ZETA 2OTLN 3HZ6A 1KAZA 3O4NA 1RTJA 5HRRA 1S1XA 4FWRA 4HCBA 2X74A 1CZ9A 1S9EA 3KK1A 4CZHA 5C2DA 3PSIA 3SQ2A 3CCMN 4KTZA 4O4GA 4WYBA 2XHBA 3AVBA 2OZMA 3VGLA 4DTUA 3AARA 1JKHA 4N5SA 4FWMA 3OJUA 3PX4A 1Q9YA 2YHAA 4BC4A 1VQ9N 4O8KA 4AHVA 3KLGA 2HHWA 4FLYA 5BN8A 1J53A 2RN2A 1FKOA 4FWOA 5BN9A 1T6DA 1ATSA 4H0TB 1M1KO 1NMNA 3HPGA 4JD2B 4JI3K 3HO1A 2GTDA 3PSFA 1UAXA 3OY9A 1EX4A 1HR0K 3C6AA 4BQZA 2VWBA 4MDAA 2P9PA 2PAVA 1TAQA 3WEEA 3VN5A 3LZIA 4FK2A 3THWA 1IG8A 2KQ2A 2IOCA 5HLFA 1RBRA 2Z1JA 2G8HA 3O9TA 4FJMA 1HQEA 4BE0A 1BA1A 1QZ5A 3R1XA 1A5VA 5JICA 1QSSA 2P9NB 3NE6A 3QIOA 3MXJA 4FLVA 1OVQA 3VMFB 1X9JA 5EU7A 3FZMA 3CPEA 1IG9A 1XMOK 1VSHA 3FZLA 5AQVA 1LWEA 1KSPA 1YJ9N 1A5WA 4C1NI 3D2EB 4CF9A 2G8KA 2WC9A 2O8BA 3VQEA 1QQMA 1L3TA 1FXXA 1TKXA 3OYKA 1REVA 4BACA 1HLUA 3IS9A 3SI6A 3V81A 2Q1NA 3ULEB 3UIQA 3KD1E 4CBXA 1W9HA 1J5OA 4BRAA 4PUOA 4CGGA 3JS6A 4JKHA 4DTSA 2FXUA 2JGUA 1U04A 1NGIA 3TAEA 1RTHA 4CBWA 1Z6RA 3VF2A 4JK7A 4NXNK 1TKZA 1L3SA 4K0KK 1KVCA 5JS1A 4XEIA 1BQNA 4DKWA 2D0AA 3PX6A 5KI6A 4CHPA 1UWBA 1LAWA 4A59A 3WNFA 4DHYA 2KW4A 4KH5A 1ILYA 3QEPA 3KKRA 2ZM6K 3SMSA 4PL7A 4OPAA 5EY4A 1XUPO 1TUYA 1NGGA 3SPZA 3VQ6A 1QS4A 3OYAA 1HJOA 1Y97A 3C65A 3E1YA 4CGDA 5CE3A 2O8CA 1HNZK 1HYVA 5FPDA 4JYAK 5BR9A 2V51B 1WAJA 1Q8IA 2X6SA 4DFJA 4GV3A 2Q0RA 1X9WA 4B3RK 2D1KA 4JLHA 3K59A 1ZYQA 1RT1A 2YNGA 1U47A 2A42A 3MN5A 1NK7A 3HI0A 3HOSA 3S3OA 4J2BA 1H1VA 4FJIA 1WN7A 1YI2N 3BGRA
chains in the Genus database with same CATH topology
2ZD1A 1LAVA 2BGGA 3C6TA 5K14A 4M3WA 4CGJA 3ZT0A 4CEAA 3LANA 3I0RA 4CJRA 1N5YA 2OPRA 2HVHA 1QSLA 5HBMA 1RBVA 3WNEA 5HRSA 4IG0A 4NYNA 1WAFA 4CJVA 3HVRA 2ZQBA 3RMCA 4M3TA 2KZMA 3NGIA 3DMJA 3NF9A 1NKBA 4DSKA 3QEIA 4KB0A 2R7YA 4DQRA 1I3AA 3L3VA 4CFCA 4PWDA 1EXQA 3ITHA 2EHGA 4Z0UA 3RWUA 4OKKA 5J2PA 3M8SA 4BDZA 1U49A 2DFHA 5CYQA 1SL0A 4M3UA 1ASWA 4KHWA 3B6OA 3AVKA 3AVNA 3TAMA 4CEEA 1QSYA 3OYNA 3RRHA 5FDLA 1VRTA 1NK5A 3T19A 3KLHA 3NAEA 4DSLA 3U3YA 4ELTA 3PY8A 1JLCA 3DRPA 4QOZB 1S9GA 4OLBA 4CHQA 4IBNA 3K2PA 3THVA 1TGOA 4CJLA 4CJ3A 4CHOA 4DG1A 3TARA 4Z4HA 5FRNA 1NJZA 4NYFA 3QEVA 3L2RA 4M45A 4E7LA 1NJWA 2DTUA 3VQQA 3MEDA 4GVMA 3SV3A 4B9TA 3VQBA 4QCLA 2W42A 4CGFA 1DTQA 1KFDA 3D45A 3HYFA 4KKOA 4W5QA 2RKIA 3ZT1A 4FZXC 4E0DA 3AVGA 2KZZA 3JYTA 3WNGA 3OYGA 3VQ4A 4FLUA 2FBTA 2HNYA 2Z1GA 3T3FA 1S1VA 3HVTA 3PV8A 4CCHA 3ZSWA 4B9LA 3KLEA 1JLQA 4RW7A 4B9SA 2ETJA 2OPSA 2A1SA 3M8QA 3G10A 3VQ5A 4FW1A 1J9AA 3CFPA 4HUEA 3LAMA 4C8KA 5FRMA 1BI4B 1RDDA 4CJPA 4RW6A 4F3TA 2E4LA 3QO9A 1YTAA 5HP1A 1DTTA 3ZT4A 4FJKA 3HP9A 4I2QA 3F73A 3QEXA 3PO5A 2IS3A 3AVJA 3QINA 4AILC 5HRPA 1B9DA 3ZSXA 4M3YA 3DLGA 4TSXA 1TL1A 4DU4A 4B9MA 2RF2A 3IRXA 4CF1A 3DLRA 3SUNA 3IG1A 3DRSA 4O0JA 4FVMA 4N47A 4MFBA 4CEBA 4CIFA 3L2UA 4FM1A 3QESA 4FK4A 5E41A 3LWLA 4F2SA 3VA0A 4W5TA 3OYDA 1GOCA 1WSJA 3SQ0A 4K8XA 3C6UA 4CGIA 1ITGA 1GOAA 1C6VA 3KKSA 1WSIA 3NFAA 4QAGA 1BIUA 2FBVA 4IG3A 4JS4A 1JL2A 4H4MA 4OPJA 4FXDA 3D0PA 3VQDA 4FCYA 4RW9A 1VRUA 1HRHA 3DI6A 4CERA 2XO7A 4FM0A 4DTOA 4CEQA 2G8WA 4C8OA 4IKFA 2VG5A 4IFYA 2P5GA 2GBZA 4CHZA 1KVAA 4E19A 2HHXA 1W0HA 1TKDA 1L5UA 4B9VA 4ZTFA 4Q0BA 1NJYA 4E3SA 3DOKA 3VA3A 2OYQA 4PA1A 4Y1DA 1RT3A 3CFOA 4ELUA 4E1NA 3VQ7A 4AHRA 1DLOA 1XHZA 3HJFA 2JLEA 1U48A 2X78A 2PY5A 4KI6A 3MEGA 4DSIA 4H4OA 1NK0A 3HSTB 1VSFA 3OYMA 3K58A 4NCBA 1IKYA 4PY5A 4OGCA 3VQCA 3RRGA 4FJ9A 2QK9A 1CZBA 3MXMA 3V9SA 4E7HA 3SQ1A 1T8EA 4OJRA 4KRFA 4LSNA 4CEZA 4Y1CA 3TABA 2WOMA 1BCMA 4DWIA 2D0CA 2HVIA 5J2QA 4CK1A 4XIUA 5KGWA 4M3ZA 4B3OA 4CK3A 4FK0A 4LSLA 4DSEA 4DQPA 1ZBHA 4GMJB 4OLAA 4N41A 1WSGA 3V9XA 2BDPA 4CJEA 4W5OA 1SL1A 4ID5A 1JXEA 3QIPA 3AVFA 4W5NA 3SYZA 3SNNA 4KHNA 3V1QA 4CFAA 4AHSA 3OS0A 4DLGA 1X9SA 3S9HA 4CEDA 2IAJA 3RR8A 4ZTJA 4JRQA 4FLXA 2Y1IA 3P5JA 3LP0A 5SWMA 3SCXA 3QLHA 1JL1A 2O4IA 1KLMA 4OPKA 2YNIA 3AVMA 3CQ8A 1X9MA 4O0IA 4CGHA 3TR8A 2I5JA 4O44A 4LH4A 2ATQA 5C24A 3OYCA 1Q9XA 4LY7A 4Z4IA 3MXIA 1QQCA 4FYDA 1UA0A 4DFMA 3PUFA 1UA1A 4LH5A 3KTQA 3HPHA 2RPIA 1LW2A 4AHCA 4RW4A 1S1WA 1RT7A 3ZSQA 2NUBA 1NK8A 4CJKA 1NKEA 4KHUA 3OYEA 3WNHA 2KFNA 2HHUA 3AA2A 4CJSA 3EYZA 3SQ4A 4FJJA 4J2AA 1Z25A 3AVHA 1BL3A 2ITGA 4NCAA 1SV5A 2KFZA 3AO1A 4BWMA 3AA5X 3VQAA 2O4GA 1S6PA 3U3GA 3LALA 1VSMA 1HMVA 4CHNA 1F21A 2YKMA 1LV5A 5J1EA 1O1WA 4HCCA 3TANA 1YT3A 1RCHA 2F96A 3DLEA 4ZHRA 2Q3SA 5I3UA 1VSIA 3LPTA 4MQ3A 2Y1JA 1JXBA 2GUIA 2PYJA 2OA8A 2B5JA 3M8RA 2IDOA 4M41A 1KTQA 1XC9A 3L2WA 3TAFA 2G8VA 1NK4A 2HHTA 1IO2A 4AHUA 3NF6A 1A5XA 3QERA 1KVBA 4JS5A 5CZ1A 3ZSVA 3DLKA 4CF8A 4DFKA 4CECA 1HPZA 4BWJA 1X1PA 2OPPA 1K6YA 1U4BA 1HYSA 1JLBA 2OZSA 4W5RA 1UOCA 3SUPA 3LDSA 5C42A 3RTVA 2LSNA 1BQMA 3VQ9A 3HPOA 4FM2A 3DOLA 4KFBA 4RG8A 1IKXA 3FFIA 3V1RA 4EZ9A 1LW0A 3NF8A 4BE2A 5DMRA 1LWFA 4CFDA 1HNVA 4CF2A 1B9FA 2YKNA 3RMAA 3TAQA 4CJUA 1D5AA 1Z26A 3F9KA 4B9NA 1BHLA 1T7PA 3ZT3A 5FROA 2P1JA 4B9UA 2G8IA 3V9UA 4BE1A 1RT4A 4CJTA 4HTUA 3AO2A 4Z4GA 1QHTA 2QKBA 3ZCMA 2QXFA 3KD5E 1KRPA 3LZJA 3L3UA 3OYBA 1R0AA 1NK6A 4F2RA 4FZYA 2AJQA 1SL2A 5I42A 4I9LA 5CYMA 1QTMA 3CG7A 3C94A 4B08A 2A1RA 5D3GA 4DMNA 1T03A 4KTQA 2WONA 1CLQA 3AO5A 2HNZA 4WE1A 1LWCA 3K57A 1ZBUA 3B6PA 1JLFA 1WSHA 1HNIA 1NOZA 3AVIA 4DQIA 1HQUA 1TVRA 4O5BA 1C1AA 4KHYA 3NGYA 1VSDA 4C8MA 4CEFA 5HROA 4KAZA 4DQQA 3P83D 3ASMA 1U45A 2PZSA 3O4NA 2PYLA 1VSLA 4KTWA 1ZBIA 3EY1A 3SZ2A 1VK0A 2HW3A 2DY4A 1RTJA 1S1XA 5HRRA 3O3GA 2HNDA 1XHXA 2X74A 1CXUA 1CZ9A 4HCBA 1S9EA 1IKVA 2XRIA 3KK1A 4Z4FA 1FK9A 1BI4A 5DK5A 1C0TA 3TAPA 1S6QA 1YVUA 1L3VA 2OPQA 3NH1A 5C25A 3SQ2A 4KTZA 4O4GA 2XHBA 3QETA 3AVBA 4CJ5A 2OZMA 4EP5A 4CESA 4JRPA 3KLIA 1RTDA 3RMBA 2VWKA 3V1OA 3MEEA 4Z4CA 4DTUA 1GOBA 1KFSA 4CF0A 3V4IA 1S5JA 1JKHA 1JLGA 1WSEA 2E6MA 2FBYA 4N5SA 3OJUA 2P51A 3MAQA 3PX4A 1Q9YA 3ZSYA 4FJ8A 2YHAA 4J2DA 4AHVA 1MU2A 1TKTA 4AHTA 4CK2A 3OYIA 4DF8A 3AV9A 3KLGA 1TK0A 2HHWA 4FLYA 1G15A 1BIZA 5J2MA 3M8PA 1RBSA 3LP1A 5KTQA 4OVLA 1J53A 3LPUA 2RN2A 2XY7A 3S3NA 1FKOA 3LAKA 4E1MA 1XI1A 4KPYA 1ASUA 2QKKA 3DLHA 4IDKA 2VG7A 3QNOA 4NCGA 3HPGA 4FJNA 3LWMA 3HO1A 1KLNA 3AO3A 4CIEA 4DTJA 1JLEA 1UAXA 4M3XA 3OY9A 1EX4A 4KB1A 4G1QA 2GV9A 3T1AA 1C0MA 3PO4A 4FJLA 1YTUA 4CJ4A 3VQPA 5KGXA 3HT3A 1BISA 2D5RA 3OVNA 4IFVA 4ICLA 3ZT2A 4UQGA 2XY5A 4FW2A 2B6AA 4DLEA 4CHYA 3A2FA 4CIGA 3KJVA 4DU3A 2ZE2A 3IAYA 1RBUA 1WSFA 4LD0A 3SV4A 1TAQA 4PQUA 3VN5A 4HUFA 1RDBA 3LZIA 4E89A 4FK2A 1L3UA 5HLFA 2KQ2A 2IOCA 3CYMA 1RBRA 2Z1JA 1S1UA 2G8HA 4FJMA 1HQEA 5KRTA 4BE0A 1VSKA 4CE9A 2Z1IA 1SUQA 1A5VA 3L2QA 3V9WA 3SJJA 4ELVA 3NDKA 4R5PA 1CXQA 1RBTA 3AA3A 1QSSA 4I9QA 4M3RA 5CZ2A 3NE6A 3QIOA 3MXJA 4FLVA 4CEOA 3MECA 2YNFA 3AVLA 4Z4EA 4AH9A 3I8DA 3SUOA 5EU7A 5HRNA 4CFBA 4EP4A 4OGEA 4E7IA 1IG9A 4O55A 1IH7A 1VSHA 3ZSOA 3DM2A 1KCFA 3NH0A 3S3MA 3NBPA 3OYHA 1LWEA 1WNSA 1KSPA 3I0SA 1A5WA 3AA4A 4OKJA 3DLBA 3DRRA 4CF9A 3L2VA 2G8KA 2F8SA 4EZ6A 1RDAA 4KHQA 1RT5A 4DSJA 3VQEA 1BGXT 3QEWA 1FXXA 1L3TA 4CJWA 1TKXA 1C1CA 1EKEA 1TL3A 2G8UA 4KHSA 3OYKA 3OJSA 1REVA 4BACA 3IS9A 3SI6A 3KLFA 3V81A 3L8BA 3UIQA 3CFRA 3JSMA 4C8LA 3KD1E 4FJ7A 3HL8A 3EZ5A 1NJXA 1J5OA 1W9HA 2HB5A 3OS2A 3H08A 1SKWA 3DYAA 2YV0X 3OYFA 3U6FA 1HJRA 1B92A 4PUOA 4CGGA 4FJGA 4C8NA 2KTQA 3QNNA 3ZSRA 4DTSA 2P5OA 3E01A 5T7BA 2JGUA 2XY8A 1VSJA 3RMDA 1U04A 4DF4A 3TAEA 3SUQA 3TAGA 1RTHA 4OKEA 4FZZA 1RT6A 3O4QA 4E7KA 1NOYA 4F3OA 3TI0A 4YNQA 4HUGA 1TKZA 3NCIA 4N76A 3LP3A 3OS1A 4FJHA 4BDYA 1NKCA 1EETA 1L3SA 3ISNC 3AVCA 1KVCA 3VQ8A 2G8FA 5JS1A 4KREA 4YFUA 3BDPA 1C0UA 3NH2A 4DFPA 4H8KA 3V9ZA 3O3HA 3NF7A 2B4JA 1I39A 2BANA 4FLWA 1BQNA 5JS2A 3TWHA 2YNHA 3OYJA 3V6DA 2HHQA 4DS5A 2D0AA 3PX6A 4CJFA 3RR7A 5KI6A 3ULDA 3NHGA 1TK5A 4CHPA 1UWBA 1LAWA 2IGIA 2X6NA 1T05A 5KRSA 1J54A 3WNFA 2FBXA 1SKRA 2KW4A 1RILA 4I2PA 4DS4A 3P1GA 1RT2A 1ZBLA 2YHBA 3QEPA 3KKRA 4RW8A 4DTRA 4DTPA 1NK9A 3K5LA 1BCOA 3AO4A 1TK8A 5CY4A 1IKWA 4E7JA 2D0BA 2EX3A 2FC0A 2HHVA 1WLJA 5SZTA 3NGZA 1TAUA 4FJXA 5J2NA 1FKPA 2DFFA 3SPZA 1HYZA 3CM6A 3K5MA 4K8ZA 3C95A 1QS4A 3VQ6A 4FLTA 3OYAA 3O3FA 1N6QA 4M42A 1Y97A 4Q5VA 2E6LA 4I7FA 4CGDA 4HHTA 2F8TA 4CJQA 4DQSA 1D9FA 1VSEA 3HP6A 1C1BA 1HYVA 4FLZA 3K5OA 2VWJA 4BDPA 4KV8A 4DTNA 3KK3A 2IC3A 1WAJA 1Q8IA 2X6SA 4GW6A 3G0ZA 3LP2A 4DTMA 3ALYA 3KIOA 4DFJA 4DSFA 4FJ5A 3HK2A 3KK2A 1X9WA 1ASVA 4N56A 3SPYA 1D8YA 3OYLA 4KO0A 4JLHA 1RTIA 3K59A 1ZYQA 2HHSA 4KI4A 1RT1A 3HXMA 2XY6A 1D9DA 3ZSZA 1QE1A 4L8RB 2YNGA 4F4KA 1JLAA 1SKSA 4DTXA 1TV6A 2VG6A 4B8AB 3PX0A 1U47A 4ID1A 4J2EA 3K5NA 3CM5A 1NK7A 2Z1HA 2HMIA 1RNHA 3HM9A 3S3OA 4F8RA 4J2BA 1EP4A 1XWLA 2BE2A 4HVJA 1WN7A 4DU1A 4FJIA 1S1TA 3AVAA 3BGRA 1RDCA 1ZBFA 4B8CA 2DFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZD1 A;  1LAV A;  2BGG A;  3C6T A;  5K14 A;  4M3W A;  4CGJ A;  3ZT0 A;  4CEA A;  3LAN A;  3I0R A;  4CJR A;  1N5Y A;  2OPR A;  2HVH A;  1QSL A;  5HBM A;  1RBV A;  3WNE A;  5HRS A;  4IG0 A;  4NYN A;  1WAF A;  4CJV A;  3HVR A;  2ZQB A;  3RMC A;  4M3T A;  2KZM A;  3NGI A;  3DMJ A;  3NF9 A;  1NKB A;  4DSK A;  3QEI A;  4KB0 A;  2R7Y A;  4DQR A;  1I3A A;  3L3V A;  4CFC A;  4PWD A;  1EXQ A;  3ITH A;  2EHG A;  4Z0U A;  3RWU A;  4OKK A;  5J2P A;  3M8S A;  4BDZ A;  1U49 A;  2DFH A;  5CYQ A;  1SL0 A;  4M3U A;  1ASW A;  4KHW A;  3B6O A;  3AVK A;  3AVN A;  3TAM A;  4CEE A;  1QSY A;  3OYN A;  3RRH A;  5FDL A;  1VRT A;  1NK5 A;  3T19 A;  3KLH A;  3NAE A;  4DSL A;  3U3Y A;  4ELT A;  3PY8 A;  1JLC A;  3DRP A;  4QOZ B;  1S9G A;  4OLB A;  4CHQ A;  4IBN A;  3K2P A;  3THV A;  1TGO A;  4CJL A;  4CJ3 A;  4CHO A;  4DG1 A;  3TAR A;  4Z4H A;  5FRN A;  1NJZ A;  4NYF A;  3QEV A;  3L2R A;  4M45 A;  4E7L A;  1NJW A;  2DTU A;  3VQQ A;  3MED A;  4GVM A;  3SV3 A;  4B9T A;  3VQB A;  4QCL A;  2W42 A;  4CGF A;  1DTQ A;  1KFD A;  3D45 A;  3HYF A;  4KKO A;  4W5Q A;  2RKI A;  3ZT1 A;  4FZX C;  4E0D A;  3AVG A;  2KZZ A;  3JYT A;  3WNG A;  3OYG A;  3VQ4 A;  4FLU A;  2FBT A;  2HNY A;  2Z1G A;  3T3F A;  1S1V A;  3HVT A;  3PV8 A;  4CCH A;  3ZSW A;  4B9L A;  3KLE A;  1JLQ A;  4RW7 A;  4B9S A;  2ETJ A;  2OPS A;  2A1S A;  3M8Q A;  3G10 A;  3VQ5 A;  4FW1 A;  1J9A A;  3CFP A;  4HUE A;  3LAM A;  4C8K A;  5FRM A;  1BI4 B;  1RDD A;  4CJP A;  4RW6 A;  4F3T A;  2E4L A;  3QO9 A;  1YTA A;  5HP1 A;  1DTT A;  3ZT4 A;  4FJK A;  3HP9 A;  4I2Q A;  3F73 A;  3QEX A;  3PO5 A;  2IS3 A;  3AVJ A;  3QIN A;  4AIL C;  5HRP A;  1B9D A;  3ZSX A;  4M3Y A;  3DLG A;  4TSX A;  1TL1 A;  4DU4 A;  4B9M A;  2RF2 A;  3IRX A;  4CF1 A;  3DLR A;  3SUN A;  3IG1 A;  3DRS A;  4O0J A;  4FVM A;  4N47 A;  4MFB A;  4CEB A;  4CIF A;  3L2U A;  4FM1 A;  3QES A;  4FK4 A;  5E41 A;  3LWL A;  4F2S A;  3VA0 A;  4W5T A;  3OYD A;  1GOC A;  1WSJ A;  3SQ0 A;  4K8X A;  3C6U A;  4CGI A;  1ITG A;  1GOA A;  1C6V A;  3KKS A;  1WSI A;  3NFA A;  4QAG A;  1BIU A;  2FBV A;  4IG3 A;  4JS4 A;  1JL2 A;  4H4M A;  4OPJ A;  4FXD A;  3D0P A;  3VQD A;  4FCY A;  4RW9 A;  1VRU A;  1HRH A;  3DI6 A;  4CER A;  2XO7 A;  4FM0 A;  4DTO A;  4CEQ A;  2G8W A;  4C8O A;  4IKF A;  2VG5 A;  4IFY A;  2P5G A;  2GBZ A;  4CHZ A;  1KVA A;  4E19 A;  2HHX A;  1W0H A;  1TKD A;  1L5U A;  4B9V A;  4ZTF A;  4Q0B A;  1NJY A;  4E3S A;  3DOK A;  3VA3 A;  2OYQ A;  4PA1 A;  4Y1D A;  1RT3 A;  3CFO A;  4ELU A;  4E1N A;  3VQ7 A;  4AHR A;  1DLO A;  1XHZ A;  3HJF A;  2JLE A;  1U48 A;  2X78 A;  2PY5 A;  4KI6 A;  3MEG A;  4DSI A;  4H4O A;  1NK0 A;  3HST B;  1VSF A;  3OYM A;  3K58 A;  4NCB A;  1IKY A;  4PY5 A;  4OGC A;  3VQC A;  3RRG A;  4FJ9 A;  2QK9 A;  1CZB A;  3MXM A;  3V9S A;  4E7H A;  3SQ1 A;  1T8E A;  4OJR A;  4KRF A;  4LSN A;  4CEZ A;  4Y1C A;  3TAB A;  2WOM A;  1BCM A;  4DWI A;  2D0C A;  2HVI A;  5J2Q A;  4CK1 A;  4XIU A;  5KGW A;  4M3Z A;  4B3O A;  4CK3 A;  4FK0 A;  4LSL A;  4DSE A;  4DQP A;  1ZBH A;  4GMJ B;  4OLA A;  4N41 A;  1WSG A;  3V9X A;  2BDP A;  4CJE A;  4W5O A;  1SL1 A;  4ID5 A;  1JXE A;  3QIP A;  3AVF A;  4W5N A;  3SYZ A;  3SNN A;  4KHN A;  3V1Q A;  4CFA A;  4AHS A;  3OS0 A;  4DLG A;  1X9S A;  3S9H A;  4CED A;  2IAJ A;  3RR8 A;  4ZTJ A;  4JRQ A;  4FLX A;  2Y1I A;  3P5J A;  3LP0 A;  5SWM A;  3SCX A;  3QLH A;  1JL1 A;  2O4I A;  1KLM A;  4OPK A;  2YNI A;  3AVM A;  3CQ8 A;  1X9M A;  4O0I A;  4CGH A;  3TR8 A;  2I5J A;  4O44 A;  4LH4 A;  2ATQ A;  5C24 A;  3OYC A;  1Q9X A;  4LY7 A;  4Z4I A;  3MXI A;  1QQC A;  4FYD A;  1UA0 A;  4DFM A;  3PUF A;  1UA1 A;  4LH5 A;  3KTQ A;  3HPH A;  2RPI A;  1LW2 A;  4AHC A;  4RW4 A;  1S1W A;  1RT7 A;  3ZSQ A;  2NUB A;  1NK8 A;  4CJK A;  1NKE A;  4KHU A;  3OYE A;  3WNH A;  2KFN A;  2HHU A;  3AA2 A;  4CJS A;  3EYZ A;  3SQ4 A;  4FJJ A;  4J2A A;  1Z25 A;  3AVH A;  1BL3 A;  2ITG A;  4NCA A;  1SV5 A;  2KFZ A;  3AO1 A;  4BWM A;  3AA5 X;  3VQA A;  2O4G A;  1S6P A;  3U3G A;  3LAL A;  1VSM A;  1HMV A;  4CHN A;  1F21 A;  2YKM A;  1LV5 A;  5J1E A;  1O1W A;  4HCC A;  3TAN A;  1YT3 A;  1RCH A;  2F96 A;  3DLE A;  4ZHR A;  2Q3S A;  5I3U A;  1VSI A;  3LPT A;  4MQ3 A;  2Y1J A;  1JXB A;  2GUI A;  2PYJ A;  2OA8 A;  2B5J A;  3M8R A;  2IDO A;  4M41 A;  1KTQ A;  1XC9 A;  3L2W A;  3TAF A;  2G8V A;  1NK4 A;  2HHT A;  1IO2 A;  4AHU A;  3NF6 A;  1A5X A;  3QER A;  1KVB A;  4JS5 A;  5CZ1 A;  3ZSV A;  3DLK A;  4CF8 A;  4DFK A;  4CEC A;  1HPZ A;  4BWJ A;  1X1P A;  2OPP A;  1K6Y A;  1U4B A;  1HYS A;  1JLB A;  2OZS A;  4W5R A;  1UOC A;  3SUP A;  3LDS A;  5C42 A;  3RTV A;  2LSN A;  1BQM A;  3VQ9 A;  3HPO A;  4FM2 A;  3DOL A;  4KFB A;  4RG8 A;  1IKX A;  3FFI A;  3V1R A;  4EZ9 A;  1LW0 A;  3NF8 A;  4BE2 A;  5DMR A;  1LWF A;  4CFD A;  1HNV A;  4CF2 A;  1B9F A;  2YKN A;  3RMA A;  3TAQ A;  4CJU A;  1D5A A;  1Z26 A;  3F9K A;  4B9N A;  1BHL A;  1T7P A;  3ZT3 A;  5FRO A;  2P1J A;  4B9U A;  2G8I A;  3V9U A;  4BE1 A;  1RT4 A;  4CJT A;  4HTU A;  3AO2 A;  4Z4G A;  1QHT A;  2QKB A;  3ZCM A;  2QXF A;  3KD5 E;  1KRP A;  3LZJ A;  3L3U A;  3OYB A;  1R0A A;  1NK6 A;  4F2R A;  4FZY A;  2AJQ A;  1SL2 A;  5I42 A;  4I9L A;  5CYM A;  1QTM A;  3CG7 A;  3C94 A;  4B08 A;  2A1R A;  5D3G A;  4DMN A;  1T03 A;  4KTQ A;  2WON A;  1CLQ A;  3AO5 A;  2HNZ A;  4WE1 A;  1LWC A;  3K57 A;  1ZBU A;  3B6P A;  1JLF A;  1WSH A;  1HNI A;  1NOZ A;  3AVI A;  4DQI A;  1HQU A;  1TVR A;  4O5B A;  1C1A A;  4KHY A;  3NGY A;  1VSD A;  4C8M A;  4CEF A;  5HRO A;  4KAZ A;  4DQQ A;  3P83 D;  3ASM A;  1U45 A;  2PZS A;  3O4N A;  2PYL A;  1VSL A;  4KTW A;  1ZBI A;  3EY1 A;  3SZ2 A;  1VK0 A;  2HW3 A;  2DY4 A;  1RTJ A;  1S1X A;  5HRR A;  3O3G A;  2HND A;  1XHX A;  2X74 A;  1CXU A;  1CZ9 A;  4HCB A;  1S9E A;  1IKV A;  2XRI A;  3KK1 A;  4Z4F A;  1FK9 A;  1BI4 A;  5DK5 A;  1C0T A;  3TAP A;  1S6Q A;  1YVU A;  1L3V A;  2OPQ A;  3NH1 A;  5C25 A;  3SQ2 A;  4KTZ A;  4O4G A;  2XHB A;  3QET A;  3AVB A;  4CJ5 A;  2OZM A;  4EP5 A;  4CES A;  4JRP A;  3KLI A;  1RTD A;  3RMB A;  2VWK A;  3V1O A;  3MEE A;  4Z4C A;  4DTU A;  1GOB A;  1KFS A;  4CF0 A;  3V4I A;  1S5J A;  1JKH A;  1JLG A;  1WSE A;  2E6M A;  2FBY A;  4N5S A;  3OJU A;  2P51 A;  3MAQ A;  3PX4 A;  1Q9Y A;  3ZSY A;  4FJ8 A;  2YHA A;  4J2D A;  4AHV A;  1MU2 A;  1TKT A;  4AHT A;  4CK2 A;  3OYI A;  4DF8 A;  3AV9 A;  3KLG A;  1TK0 A;  2HHW A;  4FLY A;  1G15 A;  1BIZ A;  5J2M A;  3M8P A;  1RBS A;  3LP1 A;  5KTQ A;  4OVL A;  1J53 A;  3LPU A;  2RN2 A;  2XY7 A;  3S3N A;  1FKO A;  3LAK A;  4E1M A;  1XI1 A;  4KPY A;  1ASU A;  2QKK A;  3DLH A;  4IDK A;  2VG7 A;  3QNO A;  4NCG A;  3HPG A;  4FJN A;  3LWM A;  3HO1 A;  1KLN A;  3AO3 A;  4CIE A;  4DTJ A;  1JLE A;  1UAX A;  4M3X A;  3OY9 A;  1EX4 A;  4KB1 A;  4G1Q A;  2GV9 A;  3T1A A;  1C0M A;  3PO4 A;  4FJL A;  1YTU A;  4CJ4 A;  3VQP A;  5KGX A;  3HT3 A;  1BIS A;  2D5R A;  3OVN A;  4IFV A;  4ICL A;  3ZT2 A;  4UQG A;  2XY5 A;  4FW2 A;  2B6A A;  4DLE A;  4CHY A;  3A2F A;  4CIG A;  3KJV A;  4DU3 A;  2ZE2 A;  3IAY A;  1RBU A;  1WSF A;  4LD0 A;  3SV4 A;  1TAQ A;  4PQU A;  3VN5 A;  4HUF A;  1RDB A;  3LZI A;  4E89 A;  4FK2 A;  1L3U A;  5HLF A;  2KQ2 A;  2IOC A;  3CYM A;  1RBR A;  2Z1J A;  1S1U A;  2G8H A;  4FJM A;  1HQE A;  5KRT A;  4BE0 A;  1VSK A;  4CE9 A;  2Z1I A;  1SUQ A;  1A5V A;  3L2Q A;  3V9W A;  3SJJ A;  4ELV A;  3NDK A;  4R5P A;  1CXQ A;  1RBT A;  3AA3 A;  1QSS A;  4I9Q A;  4M3R A;  5CZ2 A;  3NE6 A;  3QIO A;  3MXJ A;  4FLV A;  4CEO A;  3MEC A;  2YNF A;  3AVL A;  4Z4E A;  4AH9 A;  3I8D A;  3SUO A;  5EU7 A;  5HRN A;  4CFB A;  4EP4 A;  4OGE A;  4E7I A;  1IG9 A;  4O55 A;  1IH7 A;  1VSH A;  3ZSO A;  3DM2 A;  1KCF A;  3NH0 A;  3S3M A;  3NBP A;  3OYH A;  1LWE A;  1WNS A;  1KSP A;  3I0S A;  1A5W A;  3AA4 A;  4OKJ A;  3DLB A;  3DRR A;  4CF9 A;  3L2V A;  2G8K A;  2F8S A;  4EZ6 A;  1RDA A;  4KHQ A;  1RT5 A;  4DSJ A;  3VQE A;  1BGX T;  3QEW A;  1FXX A;  1L3T A;  4CJW A;  1TKX A;  1C1C A;  1EKE A;  1TL3 A;  2G8U A;  4KHS A;  3OYK A;  3OJS A;  1REV A;  4BAC A;  3IS9 A;  3SI6 A;  3KLF A;  3V81 A;  3L8B A;  3UIQ A;  3CFR A;  3JSM A;  4C8L A;  3KD1 E;  4FJ7 A;  3HL8 A;  3EZ5 A;  1NJX A;  1J5O A;  1W9H A;  2HB5 A;  3OS2 A;  3H08 A;  1SKW A;  3DYA A;  2YV0 X;  3OYF A;  3U6F A;  1HJR A;  1B92 A;  4PUO A;  4CGG A;  4FJG A;  4C8N A;  2KTQ A;  3QNN A;  3ZSR A;  4DTS A;  2P5O A;  3E01 A;  5T7B A;  2JGU A;  2XY8 A;  1VSJ A;  3RMD A;  1U04 A;  4DF4 A;  3TAE A;  3SUQ A;  3TAG A;  1RTH A;  4OKE A;  4FZZ A;  1RT6 A;  3O4Q A;  4E7K A;  1NOY A;  4F3O A;  3TI0 A;  4YNQ A;  4HUG A;  1TKZ A;  3NCI A;  4N76 A;  3LP3 A;  3OS1 A;  4FJH A;  4BDY A;  1NKC A;  1EET A;  1L3S A;  3ISN C;  3AVC A;  1KVC A;  3VQ8 A;  2G8F A;  5JS1 A;  4KRE A;  4YFU A;  3BDP A;  1C0U A;  3NH2 A;  4DFP A;  4H8K A;  3V9Z A;  3O3H A;  3NF7 A;  2B4J A;  1I39 A;  2BAN A;  4FLW A;  1BQN A;  5JS2 A;  3TWH A;  2YNH A;  3OYJ A;  3V6D A;  2HHQ A;  4DS5 A;  2D0A A;  3PX6 A;  4CJF A;  3RR7 A;  5KI6 A;  3ULD A;  3NHG A;  1TK5 A;  4CHP A;  1UWB A;  1LAW A;  2IGI A;  2X6N A;  1T05 A;  5KRS A;  1J54 A;  3WNF A;  2FBX A;  1SKR A;  2KW4 A;  1RIL A;  4I2P A;  4DS4 A;  3P1G A;  1RT2 A;  1ZBL A;  2YHB A;  3QEP A;  3KKR A;  4RW8 A;  4DTR A;  4DTP A;  1NK9 A;  3K5L A;  1BCO A;  3AO4 A;  1TK8 A;  5CY4 A;  1IKW A;  4E7J A;  2D0B A;  2EX3 A;  2FC0 A;  2HHV A;  1WLJ A;  5SZT A;  3NGZ A;  1TAU A;  4FJX A;  5J2N A;  1FKP A;  2DFF A;  3SPZ A;  1HYZ A;  3CM6 A;  3K5M A;  4K8Z A;  3C95 A;  1QS4 A;  3VQ6 A;  4FLT A;  3OYA A;  3O3F A;  1N6Q A;  4M42 A;  1Y97 A;  4Q5V A;  2E6L A;  4I7F A;  4CGD A;  4HHT A;  2F8T A;  4CJQ A;  4DQS A;  1D9F A;  1VSE A;  3HP6 A;  1C1B A;  1HYV A;  4FLZ A;  3K5O A;  2VWJ A;  4BDP A;  4KV8 A;  4DTN A;  3KK3 A;  2IC3 A;  1WAJ A;  1Q8I A;  2X6S A;  4GW6 A;  3G0Z A;  3LP2 A;  4DTM A;  3ALY A;  3KIO A;  4DFJ A;  4DSF A;  4FJ5 A;  3HK2 A;  3KK2 A;  1X9W A;  1ASV A;  4N56 A;  3SPY A;  1D8Y A;  3OYL A;  4KO0 A;  4JLH A;  1RTI A;  3K59 A;  1ZYQ A;  2HHS A;  4KI4 A;  1RT1 A;  3HXM A;  2XY6 A;  1D9D A;  3ZSZ A;  1QE1 A;  4L8R B;  2YNG A;  4F4K A;  1JLA A;  1SKS A;  4DTX A;  1TV6 A;  2VG6 A;  4B8A B;  3PX0 A;  1U47 A;  4ID1 A;  4J2E A;  3K5N A;  3CM5 A;  1NK7 A;  2Z1H A;  2HMI A;  1RNH A;  3HM9 A;  3S3O A;  4F8R A;  4J2B A;  1EP4 A;  1XWL A;  2BE2 A;  4HVJ A;  1WN7 A;  4DU1 A;  4FJI A;  1S1T A;  3AVA A;  3BGR A;  1RDC A;  1ZBF A;  4B8C A;  2DFE A; 
#chains in the Genus database with same CATH topology
 4IO8 A;  5K14 A;  5CR4 A;  5FPM A;  4CEA A;  3LAN A;  4CJR A;  3A0I X;  1N5Y A;  2HVH A;  1QSL A;  3WNE A;  4NYN A;  3HVR A;  4B1W B;  2ZQB A;  5GAH P;  3P4I A;  2KZM A;  4MLH A;  3QEI A;  1I3A A;  5AQN A;  4CFC A;  3L6Q A;  1SL0 A;  1ASW A;  2NRW A;  3H1V X;  3R9P A;  3B6O A;  4XH5 A;  4CEE A;  4DSL A;  3L0Q A;  4OLB A;  4DR3 K;  5F0X A;  5GIO A;  4CJ3 A;  4DG1 A;  1LCU A;  2QWP A;  1NJZ A;  3QEV A;  3L2R A;  3ZX2 A;  4M63 C;  2DPN A;  3MED A;  3VET A;  4KKO A;  4JKF A;  2RKI A;  3SLC A;  3TSP A;  3AVG A;  3KLE A;  4KHP K;  1JLQ A;  4RW7 A;  5AQK A;  3D7E O;  2OPS A;  4AM7 A;  3G10 A;  3VQ5 A;  4HUE A;  3CFP A;  3LAM A;  3TTC A;  5FRM A;  5AFU H;  4CJP A;  4JI7 K;  1RGI A;  2F7T A;  1KAY A;  4X66 K;  3BUZ B;  3HP9 A;  4I2Q A;  3F73 A;  3QEX A;  4AIL C;  5HRP A;  1B9D A;  2NNW A;  4FWQ A;  3ZSX A;  4TSX A;  4B9M A;  3ZEU B;  1IV0 A;  1N33 K;  4FM1 A;  2OTJ N;  1XNR K;  3LWL A;  2CGK A;  1GLA G;  1WSJ A;  3SQ0 A;  4CJ7 A;  4CGI A;  1ITG A;  2ZJP L;  4JS4 A;  3A5M C;  3C0B A;  3VQD A;  2G8W A;  5AQG A;  4C8O A;  4B1Z A;  3OBY A;  1L5U A;  3TU5 A;  2O8E A;  1S22 A;  2HBM A;  1MA9 B;  2IVP A;  4AHR A;  2JLE A;  1U48 A;  3M3Z A;  3HST B;  4BRG A;  3K58 A;  1IKY A;  4OGC A;  3VQC A;  3RRG A;  3U9D A;  1NJI O;  1CZB A;  3MXM A;  3WUH A;  3V9S A;  4FJ9 A;  4OJR A;  1K73 O;  3TAB A;  2WOM A;  4O5F A;  1KQS M;  4CK1 A;  5KGW A;  2FF3 B;  4M3Z A;  4B3O A;  4DSE A;  1BDG A;  4GV9 A;  3V9X A;  3N4Q A;  4ID5 A;  2RHK A;  3SNN A;  4CFA A;  5BRH A;  1X9S A;  3S9H A;  3RR8 A;  2A40 A;  3VGK A;  4ZTJ A;  1KAX A;  4Y0W A;  4JRQ A;  4FLX A;  2Y1I A;  3SCX A;  3QLH A;  1JL1 A;  3H45 C;  2O8B B;  1X3M A;  2I5J A;  4O44 A;  4LH4 A;  4PHT X;  3MDQ A;  3OYC A;  4LY7 A;  3MXI A;  2FSN A;  4DFM A;  1RDW X;  1UA1 A;  4FL9 A;  2UXB K;  2P9S B;  4E1J A;  1LW2 A;  3HBT A;  1TYQ A;  4CJK A;  1NKE A;  2KFN A;  3EYZ A;  4CJS A;  1VAZ A;  1NGE A;  3I33 A;  1SV5 A;  5GAE P;  3AO1 A;  1KXP A;  3PIO L;  1U2V A;  4CHN A;  4HCC A;  3LDN A;  1YT3 A;  1RCH A;  2F96 A;  4WQ5 C;  3LPT A;  3CCE N;  1WOQ A;  1JXB A;  2GUI A;  3TSU A;  3M8R A;  2NRV A;  3CJA A;  1DKG D;  3J8A A;  4BR0 A;  3F5T A;  3HRG A;  4R79 A;  1IO2 A;  4AHU A;  4GVE A;  3DLK A;  3KZB A;  4W5R A;  1UOC A;  1FW6 A;  4YDU C;  3VQ9 A;  1Z26 A;  1M90 O;  1BHL A;  1T7P A;  2P1J A;  5AQR A;  1RT4 A;  2NRX A;  3L4Q A;  4BG9 A;  4HTU A;  4BC2 A;  4Z4G A;  1E4F T;  1QHT A;  3B8A X;  2A3Z A;  2FLO A;  2QXF A;  5AQO A;  4BRD A;  3KD5 E;  3K0S A;  2WUS A;  1R0A A;  2NRR A;  2AJQ A;  5ADX H;  5I42 A;  4DMN A;  2O8C B;  2HNZ A;  4QS8 A;  3AVI A;  4YOY A;  3UE5 A;  4KHY A;  1VQO N;  1VSD A;  2YJF A;  4CEF A;  5HRO A;  2O8F B;  1MWK A;  4X62 K;  3P83 D;  4DQQ A;  4B1Y B;  3EY1 A;  1XHX A;  4NXM K;  3CPW M;  1BI4 A;  5DK5 A;  1YVN A;  5GAD P;  3RVC A;  1S6Q A;  1YVU A;  3NH1 A;  5C25 A;  3THY A;  4EP5 A;  4MDB A;  4JRP A;  3KLI A;  4JNE A;  3RMB A;  1YF5 L;  3MEE A;  1KFS A;  4K25 A;  4RCH A;  1YJN N;  1S5J A;  2P9I B;  3MAQ A;  1WSE A;  2P51 A;  5FPE A;  5AQH A;  4GKJ K;  2IIR A;  4J2D A;  4CK2 A;  1NU0 A;  3OYI A;  4DF8 A;  2VCP A;  1TK0 A;  4BRE A;  3H3N O;  1G15 A;  1BIZ A;  3RSE A;  1WUA A;  4PKI A;  2F4V K;  2KKZ A;  5I9E B;  4E1M A;  1ASU A;  2BUP A;  4JKG A;  5E84 A;  3WXI A;  4NCG A;  4FJN A;  4JKA A;  3LL3 A;  3QB0 A;  2P9U A;  5DM7 L;  2NRT A;  1JLE A;  4DTJ A;  4IEE A;  2E2Q A;  3T1A A;  1YTU A;  3PO4 A;  3VQP A;  1RDU A;  3OVN A;  3ZT2 A;  2P9K A;  3FZF A;  4DU3 A;  3A2F A;  3KJV A;  3IAY A;  2VGM A;  3VTH A;  3HSC A;  1L3U A;  3CYM A;  1J5E K;  1VSK A;  1SUQ A;  4ELV A;  5C0Y A;  3AA3 A;  4ISF A;  4ILJ A;  3H1Q A;  1NBW A;  3AVL A;  4Z4E A;  3I8D A;  1WBD A;  3DXK A;  4X65 K;  4CFB A;  4E7I A;  4OGE A;  3WT0 A;  3ZSO A;  3DM2 A;  3MWP A;  4OKJ A;  3DRR A;  3H3O B;  3L2V A;  2F8S A;  4EZ6 A;  4F9O A;  1RT5 A;  4DSJ A;  3QEW A;  1GLC G;  2G8U A;  1TL3 A;  4KHS A;  1E3M A;  3O1B A;  1VQ8 N;  4KBO A;  3KLF A;  1K8K A;  4JV5 K;  4C8L A;  1NJX A;  1RFQ A;  2HB5 A;  3H08 A;  2YV0 X;  3OYF A;  3U6F A;  1B92 A;  2IVN A;  4FJG A;  3UKR A;  3QNN A;  2P5O A;  4XH4 A;  3ZX3 A;  4OKE A;  3FFK B;  3O4Q A;  3R6M A;  2QWN A;  4IZ9 A;  2ZF5 O;  2J4R A;  3TI0 A;  4N76 A;  3LP3 A;  3OS1 A;  4FJH A;  1P8Z A;  4JHD A;  4BDY A;  3ISN C;  3UB5 A;  2PBD A;  3VQ8 A;  4KRE A;  2E8A A;  4JKB A;  1C0U A;  3ATU A;  3NH2 A;  4AQY K;  4H8K A;  3V9Z A;  3BF3 A;  4FLW A;  1OH8 A;  5JS2 A;  2HHQ A;  1EWQ A;  1JCG A;  4CJF A;  3RR7 A;  4BC3 A;  3Q7B A;  3NHG A;  4H0O A;  2FBX A;  4JI8 K;  4I2P A;  2YHB A;  1ZC6 A;  4YDU A;  1NK9 A;  3K5L A;  3AO4 A;  3DJC A;  2I7P A;  2P9L A;  4GV6 A;  4B3T K;  4E7J A;  2D0B A;  5IT9 O;  1WLJ A;  3NVM A;  5J2N A;  2NLX A;  3KWG A;  4K8Z A;  2QWL A;  5AZI B;  3UKU A;  4EHU A;  4M42 A;  1MDU B;  4Q5V A;  2E6L A;  1NGB A;  2F8T A;  4DQS A;  3ATV A;  2HMP A;  5KQD A;  3K5O A;  2VWJ A;  4BDP A;  4CD1 A;  4DTN A;  2YCH A;  3KK3 A;  3LP2 A;  4EFH A;  4DTM A;  3ALY A;  3BEX A;  4FJ5 A;  4DSF A;  3HK2 A;  4FOI A;  3VF6 A;  5FPN A;  4KI4 A;  3HXM A;  2VQE K;  2XY6 A;  4M7Y A;  3ZSZ A;  1ESV A;  4F4K A;  1JLA A;  4B8A B;  5TKW A;  3CM5 A;  1C0G A;  1HX1 A;  2HMI A;  4HVJ A;  4DU1 A;  3VQ7 A;  4BRN A;  1LAV A;  1OH6 A;  3C6T A;  4CGJ A;  3CME N;  3ZT0 A;  1QQO A;  1QZ6 A;  5HBM A;  1RBV A;  5M1N A;  5GIN A;  3KHY A;  4BRQ A;  2ASM A;  4KB0 A;  3CF5 L;  3OA9 A;  2FSJ A;  4DQR A;  4Z0U A;  4ILH A;  5J2P A;  1U49 A;  1S3X A;  5CYQ A;  1EO1 A;  4JKD A;  3AVK A;  4FWN A;  5LMU K;  3OYN A;  5FDL A;  5AQF A;  1JLC A;  2HST A;  4IBN A;  3K2P A;  1N36 K;  4CHO A;  3TAR A;  2HBK A;  5AQJ A;  4M45 A;  4IDH A;  3VQQ A;  4GVM A;  3E66 A;  4CGF A;  3CCL N;  1VQK N;  4FZX C;  3ZT1 A;  2HHH K;  5KPT A;  3OYG A;  3CJ9 A;  3T3F A;  1QHA A;  3HVT A;  1XQS C;  2W40 A;  2ETJ A;  3GBT A;  1W97 L;  4KH4 A;  3K9J A;  2QM1 A;  1BI4 B;  1RDD A;  4RW6 A;  3QO9 A;  1YTA A;  3T69 A;  5BRF A;  1DTT A;  3ZT4 A;  4U7B A;  3E9O A;  2ZGY A;  5AR0 A;  2IS3 A;  3OTO K;  3QIN A;  2O8D A;  3EN9 A;  1O13 A;  1BG3 A;  1TL1 A;  4DU4 A;  5LJV A;  3FZH A;  4BY9 C;  2QWO A;  1NLV A;  4FVM A;  4N47 A;  4MFB A;  3L2U A;  1IBK K;  1N8R O;  3RSE B;  1W2B M;  3ID8 A;  4EHT A;  1DT9 A;  1GOA A;  3NFA A;  4QAG A;  4JKG B;  3LDP A;  3BF1 A;  4FXD A;  2D0P A;  4OPJ A;  3DI6 A;  4RWT A;  4BR2 A;  4CEQ A;  4ILG B;  1ZXO A;  2GBZ A;  4CHZ A;  1VQL N;  1W0H A;  2E1Z A;  3T1Y K;  1TKD A;  4H0P A;  3TTD A;  4ZTF A;  4Q0B A;  4E3S A;  3DOK A;  4BGA A;  4IOA L;  4PA1 A;  4Y1D A;  4E1N A;  2P9K B;  1XHZ A;  3A5L C;  4CZK A;  4KI6 A;  4DSI A;  1WB9 A;  4CZI A;  5AZJ A;  4IO9 L;  1T8E A;  3SQ1 A;  1XC3 A;  2ZWH A;  4LSN A;  3VEX A;  1BCM A;  5HL7 L;  3IFR A;  5J2Q A;  4XIU A;  4CK3 A;  4LSL A;  4YOW A;  4W5O A;  4W5N A;  3SYZ A;  2QXL A;  3V1Q A;  3O5B A;  4LF9 K;  3VOV A;  4CED A;  3EZW A;  4BGB A;  3P5J A;  3LP0 A;  5SWM A;  2O4I A;  4OPK A;  3AVM A;  1U6Z A;  4DV4 K;  3TR8 A;  1NGD A;  2ATQ A;  4AM6 A;  4FYD A;  3CC4 N;  1YUW A;  1NMD A;  4B1X B;  3ENH A;  5M1F A;  1JCF A;  3T1H K;  1K8K B;  1NWK A;  1NK8 A;  1E4G T;  3I55 N;  3WXL A;  3AA2 A;  4K43 A;  5KQ8 A;  1VQP N;  2ITG A;  4QS9 A;  5A2Q O;  3AA5 X;  3LAL A;  1VSM A;  4JKE A;  1O1W A;  4I6M B;  3TAN A;  3DLE A;  5I3U A;  2PYJ A;  2OA8 A;  5BRE A;  1SS6 A;  1XC9 A;  4IEI A;  4BR5 A;  3NF6 A;  1A5X A;  5CZ1 A;  3ZSV A;  3MN6 A;  4CEC A;  2RE2 A;  3DXM A;  2Q31 A;  1HPZ A;  2YHY A;  3ZET B;  4ISG A;  1HYS A;  1JLB A;  4MLE A;  1FJG K;  5C42 A;  3RTV A;  3HPO A;  4JI5 K;  3DOL A;  4EZ9 A;  4RG8 A;  1IKX A;  4BE2 A;  5DMR A;  1LWF A;  4CF2 A;  1D5A A;  3F9K A;  3MX5 A;  1LOT B;  1NGC A;  2D4W A;  2GEM A;  4B9U A;  4DV6 K;  2P9L B;  3AO2 A;  4YOT A;  1VHX A;  5LJW A;  1DGK N;  3ZCM A;  1KRP A;  4K41 A;  3L3U A;  4LFB K;  3BZK A;  4BRL A;  3UKU B;  1YXQ A;  4FZY A;  4LF8 K;  4I9L A;  1QTM A;  3C94 A;  4B08 A;  5D3G A;  4KTQ A;  2WON A;  3O9S A;  4BG8 A;  5LMN K;  1WSH A;  1HNI A;  1OKJ A;  2WBN A;  4O5B A;  4PKH A;  4BRI A;  3NGY A;  1SAZ A;  1U45 A;  5DM6 L;  3CC2 N;  1VQN N;  5M1Q A;  3MCP A;  2HW3 A;  3C6H A;  4B3S K;  4NLC A;  2D0O A;  2HND A;  2XRI A;  4GNI A;  1FK9 A;  1C0T A;  3CJB A;  3TAP A;  4H0X B;  1IJJ A;  2P9P B;  3QET A;  3WEE B;  4CES A;  4DUZ K;  1RTD A;  3THW B;  2VWK A;  3V1O A;  1GOB A;  2UUA K;  4CF0 A;  3V4I A;  3FGU A;  1JLG A;  5M1P A;  1GLJ O;  4BVO A;  4FJ8 A;  1VQ7 N;  3LM2 A;  4BVP A;  1TKT A;  3GDQ A;  3TPQ A;  3A8Y A;  3AGR A;  5J2M A;  3HM8 A;  2ZJQ L;  3LP1 A;  4OVL A;  3LPU A;  2XY7 A;  3S3N A;  1W7A A;  3D2F A;  3LAK A;  1XI1 A;  4KPY A;  1NG9 A;  2E2P A;  4IDK A;  3QNO A;  5E26 A;  4FOE A;  3FZK A;  1BA0 A;  1KLN A;  5AQI A;  5AQZ A;  2HF4 A;  4M3X A;  4FO0 A;  4KB1 A;  4G1Q A;  1KC8 O;  2UXC K;  4CJ4 A;  5KGX A;  3HT3 A;  1IBL K;  1BIS A;  4ICL A;  2XY5 A;  4CHY A;  4CIG A;  4LD0 A;  3SV4 A;  4PQU A;  4HUF A;  4E89 A;  5KRT A;  4CE9 A;  2Z1I A;  3L2Q A;  3SJJ A;  2YX6 A;  3KVG A;  3NDK A;  1RBT A;  4M3R A;  3VES A;  3G25 A;  4AH9 A;  4BRC A;  5AQL A;  5BPM A;  3EE8 A;  3FR0 A;  3SAH A;  3MMV A;  4O55 A;  1IH7 A;  1YHQ N;  4U67 L;  3NH0 A;  3QFU A;  4LF7 K;  3S3M A;  1T44 A;  3NBP A;  3TSQ A;  3OYH A;  1WNS A;  4PKG A;  3AA4 A;  4JD2 A;  3HTV A;  1C1C A;  1EKE A;  3OJS A;  4H5W A;  4CZM A;  3EZ5 A;  1JJ2 M;  3NVK A;  4CW7 B;  4H5N A;  3VEN A;  3ZSR A;  2ZJR L;  3JAM O;  4H5T A;  5AQX A;  5T7B A;  1VSJ A;  3RMD A;  1BO5 O;  2WTU A;  4MO4 A;  2P9N A;  3CCS N;  4E7K A;  2A41 A;  4F3O A;  4BRH A;  1GLB G;  1NKC A;  1EET A;  3AVC A;  3SK3 A;  2UXD K;  3D2E A;  1KD1 O;  3MN9 A;  4DFP A;  3BDP A;  1Q7Y O;  3O3H A;  3NF7 A;  3V6D A;  3TWH A;  4A5A A;  3LDO A;  1QVG M;  3EE9 A;  3O08 A;  2W41 A;  1TK5 A;  3KK7 A;  2IVO A;  2IGI A;  2KHO A;  1RIL A;  3P1G A;  4CBU A;  4WQ4 C;  1BCO A;  1Q86 O;  2CGJ A;  2FC0 A;  2JWL A;  1GLF O;  3CCR N;  3SBG A;  3NGZ A;  4FJX A;  2DFF A;  3K5M A;  3C95 A;  4FLT A;  4LF6 K;  4DCH A;  3O3F A;  1N6Q A;  4B1V A;  1NGA A;  4I7F A;  1Q82 O;  2E2N A;  4L3Q A;  3HP6 A;  2Q36 A;  1C1B A;  4FLZ A;  4KV8 A;  2A6A A;  1VQ4 N;  2IC3 A;  4GW6 A;  3G0Z A;  3BP8 A;  3KIO A;  4JI6 K;  3KK2 A;  4DR7 K;  1NM1 A;  3SPY A;  1D8Y A;  3P38 A;  2HHS A;  1QE1 A;  4L8R B;  3LDQ A;  4DTX A;  1TV6 A;  3PX0 A;  4J2E A;  4ID1 A;  1SZ2 A;  3HM9 A;  4F8R A;  4LFA K;  2BE2 A;  3ZYY X;  3I56 N;  1S1T A;  3G4S N;  3AVA A;  1RDC A;  1ZBF A;  1SL1 A;  2DFE A;  3ENB A;  5F2R A;  4M3W A;  4B1U B;  3DXM B;  4FSV A;  4A5B A;  4A62 A;  1WAF A;  4CJV A;  5C15 A;  4M3T A;  3NGI A;  3DMJ A;  3NF9 A;  1NKB A;  3ID6 A;  2GUP A;  4PWD A;  1EXQ A;  3ITH A;  4OKK A;  3F9M A;  3M8S A;  5BR8 K;  2DFH A;  4M3U A;  3VEY A;  1K8A O;  4KHW A;  3AVN A;  5C2F A;  1JCE A;  3RRH A;  1NK5 A;  3KLH A;  3NAE A;  4C1N K;  3U8X A;  1S9G A;  1GLL O;  2NZT A;  1TGO A;  3AAQ A;  4CJL A;  3LDL A;  5FRN A;  4NYF A;  2QWR A;  2DTU A;  2FF6 A;  4QCL A;  3VQB A;  3MCA B;  1KFD A;  2QTD A;  3J7A P;  3D45 A;  3HYF A;  5IWA K;  1VQ6 N;  2KZZ A;  3JYT A;  3VQ4 A;  4FLU A;  3PV8 A;  2HNY A;  2Z1G A;  3Q7C A;  4FPB A;  4B9S A;  3CHW A;  2A1S A;  3M8Q A;  4BRM A;  4C8K A;  1J9A A;  3MX2 A;  2O8E B;  4YOX A;  4JEP A;  4WQ5 A;  2YHX A;  3W3D A;  3VGM A;  5JVG L;  1ZBS A;  3PO5 A;  3VF4 A;  4CZE A;  1YIJ N;  5AFU A;  4M3Y A;  5H1S Q;  2UYT A;  3BZC A;  3IRX A;  3R8E A;  1EQY A;  1QQN A;  2GX9 A;  3DLR A;  4CF1 A;  5AQW A;  4O0J A;  4DV1 K;  4CEB A;  3QES A;  4CIF A;  3M1F A;  2ASO A;  5E41 A;  3WQU A;  3VA0 A;  4W5T A;  3EL2 A;  3OYD A;  1GOC A;  1VQM N;  4KH6 A;  3C6U A;  3KKS A;  1BIU A;  2FBV A;  1VRU A;  4IKF A;  4IFY A;  3CJ1 A;  3VTI A;  4E19 A;  2HHX A;  1ATN A;  4B9V A;  1NJY A;  3VA3 A;  2OYQ A;  2V7Y A;  3CFO A;  4ELU A;  1TYQ B;  4LF5 K;  2PY5 A;  1D4X A;  3P39 A;  3MEG A;  3EO3 A;  4H4O A;  2QEX N;  4CZF A;  3J7Z O;  2YJE A;  3OYM A;  3MWT A;  4NCB A;  2HBJ A;  3IUC A;  4KRF A;  4DR6 K;  4CEZ A;  3SJH A;  3CJC A;  1U2V B;  3GL1 A;  4BRK A;  4CZG A;  4FK0 A;  3ZEU A;  4DQP A;  4OLA A;  2ASP A;  2BDP A;  3GG4 A;  4CJE A;  4EIA A;  3IMX A;  2UUB K;  3OBW A;  3QIP A;  3AVF A;  3OS0 A;  4DLG A;  4IXC A;  4IJN A;  4X64 K;  3O8M A;  3W0L A;  2YNI A;  4WQ4 A;  3AAP A;  3C7N A;  2WFB A;  5C24 A;  4Z4I A;  1QQC A;  1UA0 A;  3PUF A;  4LH5 A;  3HPH A;  2GWK A;  4RW4 A;  1S1W A;  4DV0 K;  1RT7 A;  3ZSQ A;  2JWK A;  2NUB A;  3OYE A;  3CMA N;  3VPZ A;  1BL3 A;  3O1W A;  2KFZ A;  3VQA A;  2YI1 A;  4WFA L;  2QWM A;  3O6W A;  4FWK A;  3U3G A;  2FSK A;  5BPL A;  5J1E A;  4A57 A;  2BH1 A;  1HNX K;  4ZHR A;  1VSI A;  4MQ3 A;  4FVU A;  2IDO A;  4M41 A;  3TTF A;  4Z94 A;  3QER A;  1KVB A;  1HUX A;  1V4S A;  4DFK A;  3PIP L;  4BWJ A;  5BPN A;  1X1P A;  1U4B A;  5ELZ A;  2OZS A;  3SUP A;  4QS7 A;  3VEZ A;  4G9Z A;  1GLE G;  2LSN A;  2P9S A;  2YHW A;  4JI1 K;  3FFI A;  3V1R A;  2UUC K;  2BGG A;  4EAH D;  3NF8 A;  4CFD A;  1B9F A;  2YKN A;  4CJU A;  4B9N A;  3ZT3 A;  5FRO A;  3V9U A;  3THY B;  4CZJ A;  3FLC O;  2VGN A;  4BC5 A;  2V7Z A;  3QFP A;  3OYB A;  1NK6 A;  3L4I A;  1SL2 A;  1T6C A;  3VEW A;  2E1Y A;  2E5L K;  3K57 A;  4K42 A;  1ZBU A;  3B6P A;  4OX9 K;  1NOZ A;  4DQI A;  1HQU A;  5AQT A;  4C8M A;  1K9M O;  2BTF A;  3F2K A;  5AQS A;  3ASM A;  4KAZ A;  3THX A;  2PZS A;  5ADX A;  2E2O A;  5GAG P;  2PYL A;  1VSL A;  3LM9 A;  4KTW A;  2P9U B;  1ZBI A;  3SZ2 A;  1VK0 A;  2F9T A;  2DY4 A;  4FWS A;  3O3G A;  1CXU A;  4Z4F A;  1IKV A;  3SMP A;  3QBW A;  3J7Y P;  1L3V A;  2OPQ A;  1WBB A;  2I7N A;  4JK9 A;  4CJ5 A;  3ZLJ A;  3CCV N;  1YAG A;  3O9U A;  4Z4C A;  4CVN E;  1IBM K;  4UY8 O;  2E6M A;  2ZGZ A;  2FBY A;  1BU6 O;  3ZSY A;  5FLX O;  1MU2 A;  4AHT A;  2E88 A;  3AV9 A;  1MWM A;  3DXK B;  4XH1 A;  3M8P A;  1RBS A;  1QVF M;  5KTQ A;  4JI4 K;  3CD6 N;  4B9Q A;  2QKK A;  1XNQ K;  3DLH A;  3CXC M;  2O8F A;  4JI2 K;  2VG7 A;  1Z05 A;  3LWM A;  3AO3 A;  4CIE A;  3MK6 A;  1YJW N;  3KWI A;  2W6K A;  5B8H A;  4BR4 A;  2GV9 A;  1C0M A;  5AQQ A;  5JVH L;  4FJL A;  4DR4 K;  4IFV A;  2D5R A;  4UQG A;  4FW2 A;  2B6A A;  4DLE A;  2ZE2 A;  4GKK K;  1RBU A;  1WSF A;  1SQK A;  1RDB A;  5GIP A;  1S1U A;  4YY3 K;  3UKR B;  2P9I A;  5AQM A;  3V9W A;  4YHH K;  3ZX0 A;  4R5P A;  1CXQ A;  4I9Q A;  4RTF D;  5CZ2 A;  3DLL L;  4CEO A;  1HKC A;  3MEC A;  2YNF A;  4IWV A;  4AF1 A;  3SUO A;  5HRN A;  2KLA A;  4EP4 A;  4JHD B;  4A2B A;  1BOT O;  1KCF A;  4HTL A;  5CHI A;  3HOT A;  3I0S A;  3DLB A;  1RDA A;  3O4W A;  1Y64 A;  4KHQ A;  1BGX T;  4CJW A;  1GLD G;  3L8B A;  3CFR A;  3JSM A;  4FJ7 A;  3HL8 A;  1ATR A;  4IOX A;  1HKB A;  3OS2 A;  1SKW A;  3DYA A;  3O9Q A;  3WXK A;  5C12 A;  1HJR A;  2NRZ A;  1S72 N;  4C8N A;  2KTQ A;  3E01 A;  4LC9 B;  2XY8 A;  4FWP A;  4DF4 A;  3SUQ A;  5F1X A;  3TAG A;  4FZZ A;  1RT6 A;  1Q81 O;  3DAW A;  2HBL A;  1NOY A;  4YNQ A;  4HUG A;  3NCI A;  4JI0 K;  2CH5 A;  3CIP A;  4WF9 L;  2G8F A;  4YFU A;  3ENO A;  3T7Z A;  2HOE A;  2B4J A;  1I39 A;  2BAN A;  4CD3 A;  3U9Z A;  2YNH A;  3OYJ A;  4DS5 A;  3PLA A;  4BQL A;  3ULD A;  5EVZ A;  1NGH A;  2X6N A;  4FWL A;  1T05 A;  5KRS A;  1J54 A;  1SKR A;  4DS4 A;  1RT2 A;  1ZBL A;  3QML A;  1EWR A;  3H46 O;  5EX5 A;  4RW8 A;  4DTR A;  4DTP A;  1TK8 A;  4J8F A;  5CY4 A;  1IKW A;  2EX3 A;  2HHV A;  1NGJ A;  5SZT A;  3CCU N;  1TAU A;  4H5V A;  1FKP A;  1HYZ A;  3CM6 A;  1NGF A;  3C7N B;  3E9P A;  5AQY A;  4HHT A;  4CJQ A;  1D9F A;  1VSE A;  2VQF K;  5LY3 A;  1N34 K;  5JLF A;  4A61 A;  4LFC K;  5KPZ A;  3G71 N;  4DUY K;  4ISE A;  5AQU A;  3CQX A;  1ASV A;  3QIC A;  4IOC L;  3OYL A;  4KO0 A;  1RTI A;  1BUP A;  1C0F A;  1D9D A;  2NRH A;  1SKS A;  3IKM A;  2VG6 A;  1J6Z A;  3OHR A;  2QWQ A;  3K5N A;  2QW9 A;  2Z1H A;  4WFB L;  1RNH A;  4WCE L;  1EP4 A;  1XWL A;  2VYP A;  3IDH A;  3N4P A;  1CZA N;  4V19 S;  4FK4 A;  4N56 A;  4B8C A;  3CJ7 A;  3WQT A;  2ZD1 A;  3EKS A;  3R3L A;  3I0R A;  3EKU A;  5AQP A;  2OPR A;  5AZI A;  5C10 A;  5HRS A;  4IG0 A;  3RMC A;  3GE1 A;  4DSK A;  4DV5 K;  2ITM A;  2R7Y A;  5KPR A;  3D6R A;  4DR2 K;  4H0Y B;  3L3V A;  5MLC Q;  2EHG A;  3RWU A;  2GEL A;  4BDZ A;  4JK8 A;  4WFN L;  3TAM A;  4DV3 K;  1XMQ K;  1QSY A;  4DR1 K;  5JLH A;  3G6E N;  2O8D B;  3A5O C;  3GOI A;  1VRT A;  3T19 A;  4NLB A;  2EWS A;  3U3Y A;  4ELT A;  3PY8 A;  4CZL A;  1N32 K;  3DRP A;  4QOZ B;  4CHQ A;  1HNW K;  3M6G A;  3K9K A;  3THV A;  1Q18 A;  3QDK A;  4Z4H A;  4H0V B;  4E7L A;  1NJW A;  1I94 K;  3SV3 A;  4B9T A;  2W42 A;  1DTQ A;  4W5Q A;  4E0D A;  3CI5 A;  2CGL A;  3WNG A;  2FBT A;  3THX B;  1S1V A;  4CCH A;  4B9L A;  3ZSW A;  2E20 A;  1OH5 A;  2CH6 A;  3S41 A;  4NB4 A;  4FW1 A;  2QA4 N;  2GWJ A;  2E4L A;  4F3T A;  2Q97 A;  3E9L A;  1P90 A;  5HP1 A;  1YIT N;  4FJK A;  5AZJ B;  3FE1 A;  3AVJ A;  1TUU A;  3VEO A;  4NO7 A;  3DLG A;  2QI2 A;  4PL8 A;  2RF2 A;  3ULE A;  3SUN A;  3IG1 A;  3DRS A;  2PFU A;  2F9W A;  1T3V A;  3CCJ N;  4F2S A;  4K8X A;  5EXW A;  1C6V A;  1WSI A;  4IG3 A;  1JL2 A;  1X3N A;  4H4M A;  3D0P A;  4FCY A;  3JXU A;  4RW9 A;  4CER A;  1HRH A;  2XO7 A;  4FM0 A;  4DTO A;  3HJF A;  2VG5 A;  4BRF A;  4HWI A;  2P5G A;  1KVA A;  2Q0U A;  2H3G X;  3VEV A;  5TKY A;  4B3M K;  1RT3 A;  4FPA A;  3VER A;  1DLO A;  2X78 A;  1NK0 A;  4YOR A;  1VSF A;  2A5X A;  4OPH A;  1HPM A;  4PY5 A;  1G99 A;  3EEQ A;  2QK9 A;  5AJ3 K;  4JKC A;  4E7H A;  3AGK A;  4Y1C A;  4DWI A;  2HVI A;  2W6L A;  2D0C A;  1OH7 A;  3J80 O;  2OAN A;  1ZBH A;  4GMJ B;  4C23 A;  4N41 A;  1WSG A;  1VQ5 N;  4IFE A;  1JXE A;  4O8U A;  1BWF O;  4IJA A;  4KHN A;  4AHS A;  4YOV A;  2IAJ A;  1V4T A;  5M1K A;  4YOU A;  5M1O A;  3MN7 A;  1DEJ A;  1KLM A;  5LL6 Z;  3CQ8 A;  4OO1 J;  1X9M A;  4O0I A;  4CGH A;  4GY2 B;  4BR7 A;  1Q9X A;  3P31 A;  3J81 O;  3KTQ A;  2RPI A;  4M7X A;  4AHC A;  3QBX A;  4KHU A;  1NNE A;  3WNH A;  3U4L A;  3WXJ A;  3SQ4 A;  4FJJ A;  4J2A A;  2HHU A;  1Z25 A;  3AVH A;  1R59 O;  3WXM B;  4NCA A;  4BWM A;  5EOY A;  3H6E A;  2O4G A;  1S6P A;  4CI6 A;  1HMV A;  3CQY A;  1F21 A;  2Q2R A;  2YKM A;  3I8B A;  4BRO A;  1LV5 A;  2HF3 A;  4JN4 A;  2Q3S A;  2Y1J A;  3CET A;  3NMU A;  2B5J A;  2UU9 K;  2V52 B;  1KTQ A;  3L2W A;  3TAF A;  2G8V A;  3CC7 N;  3SBT A;  3CCQ N;  1NK4 A;  2AP1 A;  2HHT A;  4DB3 A;  4DQ8 A;  1HKG A;  3A5N C;  4JS5 A;  4CF8 A;  3CER A;  2OCE A;  4H03 B;  2OPP A;  1K6Y A;  4DV7 K;  5HOO A;  3LDS A;  4BRP A;  1BQM A;  1OVY A;  3O80 A;  4FM2 A;  4H5R A;  4KFB A;  3DWL A;  1LW0 A;  3SAF A;  3RMA A;  1HNV A;  3TAQ A;  3O9R A;  2G8I A;  4BE1 A;  4CJT A;  4DV2 K;  4LF4 K;  2QKB A;  3BY5 A;  3LZJ A;  4BR9 A;  3OW2 M;  4I6M A;  3SAG A;  4F2R A;  4A2A A;  5CYM A;  3CG7 A;  5BRD A;  2A1R A;  4MO5 A;  4JAX A;  1T03 A;  4DR5 K;  1CLQ A;  3AO5 A;  4WE1 A;  1LWC A;  1JLF A;  3M5R A;  3D2F B;  2AA4 A;  1TVR A;  5JMV A;  1C1A A;  3AY9 A;  3ZET A;  2OTL N;  3HZ6 A;  1KAZ A;  3O4N A;  1RTJ A;  5HRR A;  1S1X A;  4FWR A;  4HCB A;  2X74 A;  1CZ9 A;  1S9E A;  3KK1 A;  4CZH A;  5C2D A;  3PSI A;  3SQ2 A;  3CCM N;  4KTZ A;  4O4G A;  4WYB A;  2XHB A;  3AVB A;  2OZM A;  3VGL A;  4DTU A;  3AAR A;  1JKH A;  4N5S A;  4FWM A;  3OJU A;  3PX4 A;  1Q9Y A;  2YHA A;  4BC4 A;  1VQ9 N;  4O8K A;  4AHV A;  3KLG A;  2HHW A;  4FLY A;  5BN8 A;  1J53 A;  2RN2 A;  1FKO A;  4FWO A;  5BN9 A;  1T6D A;  1ATS A;  4H0T B;  1M1K O;  1NMN A;  3HPG A;  4JD2 B;  4JI3 K;  3HO1 A;  2GTD A;  3PSF A;  1UAX A;  3OY9 A;  1EX4 A;  1HR0 K;  3C6A A;  4BQZ A;  2VWB A;  4MDA A;  2P9P A;  2PAV A;  1TAQ A;  3WEE A;  3VN5 A;  3LZI A;  4FK2 A;  3THW A;  1IG8 A;  2KQ2 A;  2IOC A;  5HLF A;  1RBR A;  2Z1J A;  2G8H A;  3O9T A;  4FJM A;  1HQE A;  4BE0 A;  1BA1 A;  1QZ5 A;  3R1X A;  1A5V A;  5JIC A;  1QSS A;  2P9N B;  3NE6 A;  3QIO A;  3MXJ A;  4FLV A;  1OVQ A;  3VMF B;  1X9J A;  5EU7 A;  3FZM A;  3CPE A;  1IG9 A;  1XMO K;  1VSH A;  3FZL A;  5AQV A;  1LWE A;  1KSP A;  1YJ9 N;  1A5W A;  4C1N I;  3D2E B;  4CF9 A;  2G8K A;  2WC9 A;  2O8B A;  3VQE A;  1QQM A;  1L3T A;  1FXX A;  1TKX A;  3OYK A;  1REV A;  4BAC A;  1HLU A;  3IS9 A;  3SI6 A;  3V81 A;  2Q1N A;  3ULE B;  3UIQ A;  3KD1 E;  4CBX A;  1W9H A;  1J5O A;  4BRA A;  4PUO A;  4CGG A;  3JS6 A;  4JKH A;  4DTS A;  2FXU A;  2JGU A;  1U04 A;  1NGI A;  3TAE A;  1RTH A;  4CBW A;  1Z6R A;  3VF2 A;  4JK7 A;  4NXN K;  1TKZ A;  1L3S A;  4K0K K;  1KVC A;  5JS1 A;  4XEI A;  1BQN A;  4DKW A;  2D0A A;  3PX6 A;  5KI6 A;  4CHP A;  1UWB A;  1LAW A;  4A59 A;  3WNF A;  4DHY A;  2KW4 A;  4KH5 A;  1ILY A;  3QEP A;  3KKR A;  2ZM6 K;  3SMS A;  4PL7 A;  4OPA A;  5EY4 A;  1XUP O;  1TUY A;  1NGG A;  3SPZ A;  3VQ6 A;  1QS4 A;  3OYA A;  1HJO A;  1Y97 A;  3C65 A;  3E1Y A;  4CGD A;  5CE3 A;  2O8C A;  1HNZ K;  1HYV A;  5FPD A;  4JYA K;  5BR9 A;  2V51 B;  1WAJ A;  1Q8I A;  2X6S A;  4DFJ A;  4GV3 A;  2Q0R A;  1X9W A;  4B3R K;  2D1K A;  4JLH A;  3K59 A;  1ZYQ A;  1RT1 A;  2YNG A;  1U47 A;  2A42 A;  3MN5 A;  1NK7 A;  3HI0 A;  3HOS A;  3S3O A;  4J2B A;  1H1V A;  4FJI A;  1WN7 A;  1YI2 N;  3BGR A; 
#chains in the Genus database with same CATH homology
 2ZD1 A;  1LAV A;  2BGG A;  3C6T A;  5K14 A;  4M3W A;  4CGJ A;  3ZT0 A;  4CEA A;  3LAN A;  3I0R A;  4CJR A;  1N5Y A;  2OPR A;  2HVH A;  1QSL A;  5HBM A;  1RBV A;  3WNE A;  5HRS A;  4IG0 A;  4NYN A;  1WAF A;  4CJV A;  3HVR A;  2ZQB A;  3RMC A;  4M3T A;  2KZM A;  3NGI A;  3DMJ A;  3NF9 A;  1NKB A;  4DSK A;  3QEI A;  4KB0 A;  2R7Y A;  4DQR A;  1I3A A;  3L3V A;  4CFC A;  4PWD A;  1EXQ A;  3ITH A;  2EHG A;  4Z0U A;  3RWU A;  4OKK A;  5J2P A;  3M8S A;  4BDZ A;  1U49 A;  2DFH A;  5CYQ A;  1SL0 A;  4M3U A;  1ASW A;  4KHW A;  3B6O A;  3AVK A;  3AVN A;  3TAM A;  4CEE A;  1QSY A;  3OYN A;  3RRH A;  5FDL A;  1VRT A;  1NK5 A;  3T19 A;  3KLH A;  3NAE A;  4DSL A;  3U3Y A;  4ELT A;  3PY8 A;  1JLC A;  3DRP A;  4QOZ B;  1S9G A;  4OLB A;  4CHQ A;  4IBN A;  3K2P A;  3THV A;  1TGO A;  4CJL A;  4CJ3 A;  4CHO A;  4DG1 A;  3TAR A;  4Z4H A;  5FRN A;  1NJZ A;  4NYF A;  3QEV A;  3L2R A;  4M45 A;  4E7L A;  1NJW A;  2DTU A;  3VQQ A;  3MED A;  4GVM A;  3SV3 A;  4B9T A;  3VQB A;  4QCL A;  2W42 A;  4CGF A;  1DTQ A;  1KFD A;  3D45 A;  3HYF A;  4KKO A;  4W5Q A;  2RKI A;  3ZT1 A;  4FZX C;  4E0D A;  3AVG A;  2KZZ A;  3JYT A;  3WNG A;  3OYG A;  3VQ4 A;  4FLU A;  2FBT A;  2HNY A;  2Z1G A;  3T3F A;  1S1V A;  3HVT A;  3PV8 A;  4CCH A;  3ZSW A;  4B9L A;  3KLE A;  1JLQ A;  4RW7 A;  4B9S A;  2ETJ A;  2OPS A;  2A1S A;  3M8Q A;  3G10 A;  3VQ5 A;  4FW1 A;  1J9A A;  3CFP A;  4HUE A;  3LAM A;  4C8K A;  5FRM A;  1BI4 B;  1RDD A;  4CJP A;  4RW6 A;  4F3T A;  2E4L A;  3QO9 A;  1YTA A;  5HP1 A;  1DTT A;  3ZT4 A;  4FJK A;  3HP9 A;  4I2Q A;  3F73 A;  3QEX A;  3PO5 A;  2IS3 A;  3AVJ A;  3QIN A;  4AIL C;  5HRP A;  1B9D A;  3ZSX A;  4M3Y A;  3DLG A;  4TSX A;  1TL1 A;  4DU4 A;  4B9M A;  2RF2 A;  3IRX A;  4CF1 A;  3DLR A;  3SUN A;  3IG1 A;  3DRS A;  4O0J A;  4FVM A;  4N47 A;  4MFB A;  4CEB A;  4CIF A;  3L2U A;  4FM1 A;  3QES A;  4FK4 A;  5E41 A;  3LWL A;  4F2S A;  3VA0 A;  4W5T A;  3OYD A;  1GOC A;  1WSJ A;  3SQ0 A;  4K8X A;  3C6U A;  4CGI A;  1ITG A;  1GOA A;  1C6V A;  3KKS A;  1WSI A;  3NFA A;  4QAG A;  1BIU A;  2FBV A;  4IG3 A;  4JS4 A;  1JL2 A;  4H4M A;  4OPJ A;  4FXD A;  3D0P A;  3VQD A;  4FCY A;  4RW9 A;  1VRU A;  1HRH A;  3DI6 A;  4CER A;  2XO7 A;  4FM0 A;  4DTO A;  4CEQ A;  2G8W A;  4C8O A;  4IKF A;  2VG5 A;  4IFY A;  2P5G A;  2GBZ A;  4CHZ A;  1KVA A;  4E19 A;  2HHX A;  1W0H A;  1TKD A;  1L5U A;  4B9V A;  4ZTF A;  4Q0B A;  1NJY A;  4E3S A;  3DOK A;  3VA3 A;  2OYQ A;  4PA1 A;  4Y1D A;  1RT3 A;  3CFO A;  4ELU A;  4E1N A;  3VQ7 A;  4AHR A;  1DLO A;  1XHZ A;  3HJF A;  2JLE A;  1U48 A;  2X78 A;  2PY5 A;  4KI6 A;  3MEG A;  4DSI A;  4H4O A;  1NK0 A;  3HST B;  1VSF A;  3OYM A;  3K58 A;  4NCB A;  1IKY A;  4PY5 A;  4OGC A;  3VQC A;  3RRG A;  4FJ9 A;  2QK9 A;  1CZB A;  3MXM A;  3V9S A;  4E7H A;  3SQ1 A;  1T8E A;  4OJR A;  4KRF A;  4LSN A;  4CEZ A;  4Y1C A;  3TAB A;  2WOM A;  1BCM A;  4DWI A;  2D0C A;  2HVI A;  5J2Q A;  4CK1 A;  4XIU A;  5KGW A;  4M3Z A;  4B3O A;  4CK3 A;  4FK0 A;  4LSL A;  4DSE A;  4DQP A;  1ZBH A;  4GMJ B;  4OLA A;  4N41 A;  1WSG A;  3V9X A;  2BDP A;  4CJE A;  4W5O A;  1SL1 A;  4ID5 A;  1JXE A;  3QIP A;  3AVF A;  4W5N A;  3SYZ A;  3SNN A;  4KHN A;  3V1Q A;  4CFA A;  4AHS A;  3OS0 A;  4DLG A;  1X9S A;  3S9H A;  4CED A;  2IAJ A;  3RR8 A;  4ZTJ A;  4JRQ A;  4FLX A;  2Y1I A;  3P5J A;  3LP0 A;  5SWM A;  3SCX A;  3QLH A;  1JL1 A;  2O4I A;  1KLM A;  4OPK A;  2YNI A;  3AVM A;  3CQ8 A;  1X9M A;  4O0I A;  4CGH A;  3TR8 A;  2I5J A;  4O44 A;  4LH4 A;  2ATQ A;  5C24 A;  3OYC A;  1Q9X A;  4LY7 A;  4Z4I A;  3MXI A;  1QQC A;  4FYD A;  1UA0 A;  4DFM A;  3PUF A;  1UA1 A;  4LH5 A;  3KTQ A;  3HPH A;  2RPI A;  1LW2 A;  4AHC A;  4RW4 A;  1S1W A;  1RT7 A;  3ZSQ A;  2NUB A;  1NK8 A;  4CJK A;  1NKE A;  4KHU A;  3OYE A;  3WNH A;  2KFN A;  2HHU A;  3AA2 A;  4CJS A;  3EYZ A;  3SQ4 A;  4FJJ A;  4J2A A;  1Z25 A;  3AVH A;  1BL3 A;  2ITG A;  4NCA A;  1SV5 A;  2KFZ A;  3AO1 A;  4BWM A;  3AA5 X;  3VQA A;  2O4G A;  1S6P A;  3U3G A;  3LAL A;  1VSM A;  1HMV A;  4CHN A;  1F21 A;  2YKM A;  1LV5 A;  5J1E A;  1O1W A;  4HCC A;  3TAN A;  1YT3 A;  1RCH A;  2F96 A;  3DLE A;  4ZHR A;  2Q3S A;  5I3U A;  1VSI A;  3LPT A;  4MQ3 A;  2Y1J A;  1JXB A;  2GUI A;  2PYJ A;  2OA8 A;  2B5J A;  3M8R A;  2IDO A;  4M41 A;  1KTQ A;  1XC9 A;  3L2W A;  3TAF A;  2G8V A;  1NK4 A;  2HHT A;  1IO2 A;  4AHU A;  3NF6 A;  1A5X A;  3QER A;  1KVB A;  4JS5 A;  5CZ1 A;  3ZSV A;  3DLK A;  4CF8 A;  4DFK A;  4CEC A;  1HPZ A;  4BWJ A;  1X1P A;  2OPP A;  1K6Y A;  1U4B A;  1HYS A;  1JLB A;  2OZS A;  4W5R A;  1UOC A;  3SUP A;  3LDS A;  5C42 A;  3RTV A;  2LSN A;  1BQM A;  3VQ9 A;  3HPO A;  4FM2 A;  3DOL A;  4KFB A;  4RG8 A;  1IKX A;  3FFI A;  3V1R A;  4EZ9 A;  1LW0 A;  3NF8 A;  4BE2 A;  5DMR A;  1LWF A;  4CFD A;  1HNV A;  4CF2 A;  1B9F A;  2YKN A;  3RMA A;  3TAQ A;  4CJU A;  1D5A A;  1Z26 A;  3F9K A;  4B9N A;  1BHL A;  1T7P A;  3ZT3 A;  5FRO A;  2P1J A;  4B9U A;  2G8I A;  3V9U A;  4BE1 A;  1RT4 A;  4CJT A;  4HTU A;  3AO2 A;  4Z4G A;  1QHT A;  2QKB A;  3ZCM A;  2QXF A;  3KD5 E;  1KRP A;  3LZJ A;  3L3U A;  3OYB A;  1R0A A;  1NK6 A;  4F2R A;  4FZY A;  2AJQ A;  1SL2 A;  5I42 A;  4I9L A;  5CYM A;  1QTM A;  3CG7 A;  3C94 A;  4B08 A;  2A1R A;  5D3G A;  4DMN A;  1T03 A;  4KTQ A;  2WON A;  1CLQ A;  3AO5 A;  2HNZ A;  4WE1 A;  1LWC A;  3K57 A;  1ZBU A;  3B6P A;  1JLF A;  1WSH A;  1HNI A;  1NOZ A;  3AVI A;  4DQI A;  1HQU A;  1TVR A;  4O5B A;  1C1A A;  4KHY A;  3NGY A;  1VSD A;  4C8M A;  4CEF A;  5HRO A;  4KAZ A;  4DQQ A;  3P83 D;  3ASM A;  1U45 A;  2PZS A;  3O4N A;  2PYL A;  1VSL A;  4KTW A;  1ZBI A;  3EY1 A;  3SZ2 A;  1VK0 A;  2HW3 A;  2DY4 A;  1RTJ A;  1S1X A;  5HRR A;  3O3G A;  2HND A;  1XHX A;  2X74 A;  1CXU A;  1CZ9 A;  4HCB A;  1S9E A;  1IKV A;  2XRI A;  3KK1 A;  4Z4F A;  1FK9 A;  1BI4 A;  5DK5 A;  1C0T A;  3TAP A;  1S6Q A;  1YVU A;  1L3V A;  2OPQ A;  3NH1 A;  5C25 A;  3SQ2 A;  4KTZ A;  4O4G A;  2XHB A;  3QET A;  3AVB A;  4CJ5 A;  2OZM A;  4EP5 A;  4CES A;  4JRP A;  3KLI A;  1RTD A;  3RMB A;  2VWK A;  3V1O A;  3MEE A;  4Z4C A;  4DTU A;  1GOB A;  1KFS A;  4CF0 A;  3V4I A;  1S5J A;  1JKH A;  1JLG A;  1WSE A;  2E6M A;  2FBY A;  4N5S A;  3OJU A;  2P51 A;  3MAQ A;  3PX4 A;  1Q9Y A;  3ZSY A;  4FJ8 A;  2YHA A;  4J2D A;  4AHV A;  1MU2 A;  1TKT A;  4AHT A;  4CK2 A;  3OYI A;  4DF8 A;  3AV9 A;  3KLG A;  1TK0 A;  2HHW A;  4FLY A;  1G15 A;  1BIZ A;  5J2M A;  3M8P A;  1RBS A;  3LP1 A;  5KTQ A;  4OVL A;  1J53 A;  3LPU A;  2RN2 A;  2XY7 A;  3S3N A;  1FKO A;  3LAK A;  4E1M A;  1XI1 A;  4KPY A;  1ASU A;  2QKK A;  3DLH A;  4IDK A;  2VG7 A;  3QNO A;  4NCG A;  3HPG A;  4FJN A;  3LWM A;  3HO1 A;  1KLN A;  3AO3 A;  4CIE A;  4DTJ A;  1JLE A;  1UAX A;  4M3X A;  3OY9 A;  1EX4 A;  4KB1 A;  4G1Q A;  2GV9 A;  3T1A A;  1C0M A;  3PO4 A;  4FJL A;  1YTU A;  4CJ4 A;  3VQP A;  5KGX A;  3HT3 A;  1BIS A;  2D5R A;  3OVN A;  4IFV A;  4ICL A;  3ZT2 A;  4UQG A;  2XY5 A;  4FW2 A;  2B6A A;  4DLE A;  4CHY A;  3A2F A;  4CIG A;  3KJV A;  4DU3 A;  2ZE2 A;  3IAY A;  1RBU A;  1WSF A;  4LD0 A;  3SV4 A;  1TAQ A;  4PQU A;  3VN5 A;  4HUF A;  1RDB A;  3LZI A;  4E89 A;  4FK2 A;  1L3U A;  5HLF A;  2KQ2 A;  2IOC A;  3CYM A;  1RBR A;  2Z1J A;  1S1U A;  2G8H A;  4FJM A;  1HQE A;  5KRT A;  4BE0 A;  1VSK A;  4CE9 A;  2Z1I A;  1SUQ A;  1A5V A;  3L2Q A;  3V9W A;  3SJJ A;  4ELV A;  3NDK A;  4R5P A;  1CXQ A;  1RBT A;  3AA3 A;  1QSS A;  4I9Q A;  4M3R A;  5CZ2 A;  3NE6 A;  3QIO A;  3MXJ A;  4FLV A;  4CEO A;  3MEC A;  2YNF A;  3AVL A;  4Z4E A;  4AH9 A;  3I8D A;  3SUO A;  5EU7 A;  5HRN A;  4CFB A;  4EP4 A;  4OGE A;  4E7I A;  1IG9 A;  4O55 A;  1IH7 A;  1VSH A;  3ZSO A;  3DM2 A;  1KCF A;  3NH0 A;  3S3M A;  3NBP A;  3OYH A;  1LWE A;  1WNS A;  1KSP A;  3I0S A;  1A5W A;  3AA4 A;  4OKJ A;  3DLB A;  3DRR A;  4CF9 A;  3L2V A;  2G8K A;  2F8S A;  4EZ6 A;  1RDA A;  4KHQ A;  1RT5 A;  4DSJ A;  3VQE A;  1BGX T;  3QEW A;  1FXX A;  1L3T A;  4CJW A;  1TKX A;  1C1C A;  1EKE A;  1TL3 A;  2G8U A;  4KHS A;  3OYK A;  3OJS A;  1REV A;  4BAC A;  3IS9 A;  3SI6 A;  3KLF A;  3V81 A;  3L8B A;  3UIQ A;  3CFR A;  3JSM A;  4C8L A;  3KD1 E;  4FJ7 A;  3HL8 A;  3EZ5 A;  1NJX A;  1J5O A;  1W9H A;  2HB5 A;  3OS2 A;  3H08 A;  1SKW A;  3DYA A;  2YV0 X;  3OYF A;  3U6F A;  1HJR A;  1B92 A;  4PUO A;  4CGG A;  4FJG A;  4C8N A;  2KTQ A;  3QNN A;  3ZSR A;  4DTS A;  2P5O A;  3E01 A;  5T7B A;  2JGU A;  2XY8 A;  1VSJ A;  3RMD A;  1U04 A;  4DF4 A;  3TAE A;  3SUQ A;  3TAG A;  1RTH A;  4OKE A;  4FZZ A;  1RT6 A;  3O4Q A;  4E7K A;  1NOY A;  4F3O A;  3TI0 A;  4YNQ A;  4HUG A;  1TKZ A;  3NCI A;  4N76 A;  3LP3 A;  3OS1 A;  4FJH A;  4BDY A;  1NKC A;  1EET A;  1L3S A;  3ISN C;  3AVC A;  1KVC A;  3VQ8 A;  2G8F A;  5JS1 A;  4KRE A;  4YFU A;  3BDP A;  1C0U A;  3NH2 A;  4DFP A;  4H8K A;  3V9Z A;  3O3H A;  3NF7 A;  2B4J A;  1I39 A;  2BAN A;  4FLW A;  1BQN A;  5JS2 A;  3TWH A;  2YNH A;  3OYJ A;  3V6D A;  2HHQ A;  4DS5 A;  2D0A A;  3PX6 A;  4CJF A;  3RR7 A;  5KI6 A;  3ULD A;  3NHG A;  1TK5 A;  4CHP A;  1UWB A;  1LAW A;  2IGI A;  2X6N A;  1T05 A;  5KRS A;  1J54 A;  3WNF A;  2FBX A;  1SKR A;  2KW4 A;  1RIL A;  4I2P A;  4DS4 A;  3P1G A;  1RT2 A;  1ZBL A;  2YHB A;  3QEP A;  3KKR A;  4RW8 A;  4DTR A;  4DTP A;  1NK9 A;  3K5L A;  1BCO A;  3AO4 A;  1TK8 A;  5CY4 A;  1IKW A;  4E7J A;  2D0B A;  2EX3 A;  2FC0 A;  2HHV A;  1WLJ A;  5SZT A;  3NGZ A;  1TAU A;  4FJX A;  5J2N A;  1FKP A;  2DFF A;  3SPZ A;  1HYZ A;  3CM6 A;  3K5M A;  4K8Z A;  3C95 A;  1QS4 A;  3VQ6 A;  4FLT A;  3OYA A;  3O3F A;  1N6Q A;  4M42 A;  1Y97 A;  4Q5V A;  2E6L A;  4I7F A;  4CGD A;  4HHT A;  2F8T A;  4CJQ A;  4DQS A;  1D9F A;  1VSE A;  3HP6 A;  1C1B A;  1HYV A;  4FLZ A;  3K5O A;  2VWJ A;  4BDP A;  4KV8 A;  4DTN A;  3KK3 A;  2IC3 A;  1WAJ A;  1Q8I A;  2X6S A;  4GW6 A;  3G0Z A;  3LP2 A;  4DTM A;  3ALY A;  3KIO A;  4DFJ A;  4DSF A;  4FJ5 A;  3HK2 A;  3KK2 A;  1X9W A;  1ASV A;  4N56 A;  3SPY A;  1D8Y A;  3OYL A;  4KO0 A;  4JLH A;  1RTI A;  3K59 A;  1ZYQ A;  2HHS A;  4KI4 A;  1RT1 A;  3HXM A;  2XY6 A;  1D9D A;  3ZSZ A;  1QE1 A;  4L8R B;  2YNG A;  4F4K A;  1JLA A;  1SKS A;  4DTX A;  1TV6 A;  2VG6 A;  4B8A B;  3PX0 A;  1U47 A;  4ID1 A;  4J2E A;  3K5N A;  3CM5 A;  1NK7 A;  2Z1H A;  2HMI A;  1RNH A;  3HM9 A;  3S3O A;  4F8R A;  4J2B A;  1EP4 A;  1XWL A;  2BE2 A;  4HVJ A;  1WN7 A;  4DU1 A;  4FJI A;  1S1T A;  3AVA A;  3BGR A;  1RDC A;  1ZBF A;  4B8C A;  2DFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...