4CJSA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 55
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjsA00
1KFDA 4I2QA 1KVBA 2A1SA 4I2PA 3SZ2A 4DTXA 2HMIA 4B9SA 4FJNA 2IS3A 3TAGA 3RRGA 2XRIA 1RDAA 3VQPA 1C0TA 3TI0A 3OYHA 4DU4A 3T3FA 3OS2A 4CJEA 1WSHA 4DTMA 4IKFA 4FVMA 5DK5A 1HJRA 1WSIA 1GOAA 2XY5A 4K8ZA 1S1TA 1UOCA 3C94A 2DY4A 3SCXA 1QTMA 1QE1A 1KCFA 4JLHA 2PZSA 1C1CA 3NFAA 2VWJA 4F2RA 3KJVA 4ELVA 3KKSA 3OYMA 3SQ2A 3ITHA 1QSSA 3MXIA 3QIOA 1BGXT 3V1OA 2KZZA 2G8HA 3CG7A 1IKVA 4Q0BA 2IGIA 5HRRA 3OS0A 3P5JA 3SNNA 4FCYA 4JS5A 1NJWA 3PV8A 1D8YA 4OPJA 3ASMA 3L2RA 3SQ4A 1JKHA 1DTTA 4RW7A 1FKPA 4I9QA 1NJXA 3VA3A 2VG6A 2X6SA 3SUQA 4CERA 4BDPA 3T19A 1EP4A 3RWUA 4NCAA 3NF6A 2DFEA 4KTWA 2DTUA 3AVFA 4LH5A 4NCGA 2YNFA 1ASVA 4CGIA 4HHTA 5SZTA 1NJYA 3L2VA 3IRXA 4DMNA 3V9XA 4PQUA 2D5RA 3S3OA 4M3YA 2DFFA 2OPRA 4I7FA 3PO4A 4CJUA 4AHTA 4BWMA 5FRNA 3AVGA 3ZSQA 1KVAA 1VRUA 1WAFA 1EKEA 4O4GA 4PUOA 1QQCA 4DFMA 3ZT3A 4QCLA 2EX3A 3WNFA 1ZBFA 1RBTA 4YFUA 3DI6A 2WONA 3OVNA 4E3SA 4M3TA 4OLAA 4CHPA 1VSFA 4CJ5A 5D3GA 1Z25A 4LD0A 4ZTJA 1T8EA 3RMAA 4W5TA 4CHOA 2ZE2A 3CM5A 3VQEA 5KGWA 3O3GA 1RT1A 1UAXA 1S1WA 4H8KA 4CJTA 3DM2A 4CJSA 3QEXA 1NK7A 4CGFA 5E41A 1JLGA 1HYSA 4KHSA 3OYCA 3TARA 1YTUA 3RMCA 2GBZA 5HP1A 4EP4A 1TKTA 1BQMA 3CQ8A 3ZSOA 4B08A 2VG7A 4CEQA 3OYEA 4OJRA 4CHYA 1U04A 1WSFA 3NHGA 4DTSA 4DTRA 3LPTA 2B5JA 4F2SA 4CK1A 4N41A 3OYFA 1RDCA 1FKOA 4UQGA 2XY6A 4OKJA 4Z4EA 4RG8A 3VQ9A 3ZT0A 4W5NA 1TK5A 4E7KA 1U47A 1TAUA 4KFBA 1RCHA 2YNGA 3OYBA 2IOCA 1RTHA 1SL0A 3MECA 4N5SA 1FK9A 3NE6A 1TL3A 5J2NA 5DMRA 3TAPA 5I42A 1J5OA 1RTDA 3VQ8A 4OKKA 3KK2A 4IFYA 3KLFA 3KLHA 4Z4FA 3VQAA 4FJGA 4LY7A 2AJQA 2HHVA 2HNDA 2E6MA 1D5AA 3AVAA 4HTUA 1X9MA 1KTQA 4CHZA 1LV5A 4KHNA 4OVLA 3VQ6A 1D9DA 3ZSZA 3NGIA 3RR8A 1B9FA 4G1QA 3HJFA 1I3AA 4DF4A 1S1UA 4H4OA 3QNNA 2QK9A 1UWBA 4GMJB 3LP0A 1RT2A 3SYZA 1BI4A 2QKKA 4NYNA 1Q8IA 3HM9A 4OGEA 4J2BA 3B6OA 1TK0A 3ULDA 2OPPA 3DRPA 2D0CA 1WAJA 3DOLA 4O5BA 4CIGA 1QSLA 2F96A 3KD5E 5CZ2A 1RDBA 1CXQA 5HBMA 3OYAA 4CGJA 2W42A 3V9UA 3TANA 3TWHA 2IDOA 2HB5A 5KI6A 4OKEA 1VRTA 2RN2A 2Z1JA 4DQQA 3VQCA 4WE1A 4FLWA 4W5QA 3ZSXA 3M8PA 4C8MA 3OYGA 2E4LA 3HP6A 3AVIA 3DLEA 3SPZA 5KTQA 4E0DA 3KK1A 1TL1A 1BIUA 3QEVA 3RMBA 3AVMA 4N47A 1I39A 4FK2A 1S1VA 3AVKA 3U3GA 4DQPA 3MEEA 1C0UA 4M3UA 1HQEA 4M45A 3HO1A 2ATQA 2GV9A 2ZD1A 1HPZA 3CYMA 1RTJA 1SKSA 1BI4B 3VN5A 4FM1A 4DQIA 3U6FA 3K59A 4DG1A 1BISA 1HYVA 3AO4A 4KREA 4ICLA 1LW2A 3DRRA 4Z0UA 3RTVA 4DLEA 5CYMA 3TAEA 1VSDA 2BANA 4KHUA 2RF2A 2KTQA 1NK6A 4L8RB 3SQ0A 2KZMA 4E7JA 1VSJA 1VSLA 4CF0A 2FBTA 3K5OA 4Y1DA 4KHQA 2YNHA 4BE2A 1SKWA 1SKRA 4B9LA 4CGHA 4HVJA 4NCBA 3LAKA 3ZSVA 4CJPA 2O4GA 4CHQA 1KSPA 3RR7A 3TAFA 4FJKA 2FC0A 3HK2A 2HHUA 1IKXA 4DSJA 2QXFA 1WSGA 4FZYA 5I3UA 1O1WA 1QHTA 2VWKA 1RT6A 3QEWA 3NGZA 3I0RA 4BDZA 2VG5A 4GVMA 4E7LA 1S9GA 3AVHA 3HT3A 1T05A 3PY8A 4LH4A 4HUEA 1XHZA 5T7BA 3QINA 1TKXA 3BGRA 3LP3A 3VQBA 3SQ1A 4M41A 4Z4IA 3V9SA 4CGGA 2ETJA 3SUOA 2OPQA 1WLJA 3MXMA 3NAEA 3K57A 3ALYA 3DLRA 3MEDA 1NK4A 4E1MA 3KIOA 2PY5A 1S6PA 4DWIA 1DLOA 1JLBA 1ZBIA 3C95A 3G10A 1NKEA 1WSJA 1F21A 3ISNC 3KKRA 4CJQA 4J2EA 1A5VA 1IO2A 2YNIA 4FJJA 3VQDA 4R5PA 3OYNA 4CFCA 3DYAA 3SV4A 3S9HA 1BCMA 1RT3A 1CZBA 3M8QA 4FM2A 1T03A 1KRPA 1BCOA 3AO3A 4M3RA 4M42A 4Z4GA 2BGGA 1FXXA 1RT4A 1VSIA 1CXUA 2FBYA 5KGXA 4E7IA 2XY8A 4AHRA 5C42A 4JS4A 2Y1JA 4DTJA 4FJ8A 3TABA 5HLFA 3LALA 3ZSWA 4DF8A 2Z1HA 4HUFA 4KTQA 3KK3A 1ASUA 3VQ5A 3CFRA 4AILC 3L2WA 4O55A 1SL1A 4CEZA 1R0AA 3L3UA 1CLQA 4IDKA 2P51A 4OLBA 1UA1A 2KFNA 3V81A 1XHXA 4QAGA 4Z4CA 4DFJA 1NK5A 3KLIA 1RBSA 1X9WA 1NKBA 4B9TA 4LSLA 4CJ4A 3LANA 4NYFA 4EP5A 3KTQA 4HCBA 3NF7A 4CF9A 2HHXA 3NDKA 3NF9A 3DLKA 4C8NA 3DLGA 2YKNA 1WNSA 3SJJA 4I9LA 5HRPA 3VQ4A 2ZQBA 4CF2A 4FJ5A 4FXDA 2FBXA 3DLHA 5C24A 3AA2A 5J2PA 2GUIA 2HHQA 3THVA 1L3SA 4C8OA 3AA5X 4E89A 4CIEA 3K2PA 4J2DA 3P1GA 1N5YA 3IAYA 1DTQA 2NUBA 1TAQA 1ZBHA 4CJWA 4M3ZA 4DFKA 2HNZA 3AO1A 2JGUA 3PX0A 3OJSA 3T1AA 4XIUA 1RBUA 2EHGA 3V4IA 4FW1A 3SUNA 1S9EA 4LSNA 3LP1A 4DSFA 1S1XA 3HXMA 1W9HA 3C6UA 2G8KA 2G8FA 1J54A 4CEFA 2YV0X 3OYDA 2HHTA 4KV8A 4FLUA 1JL2A 3JSMA 4AHUA 4DU3A 3F9KA 4O44A 1TV6A 1ZBUA 4RW6A 4Q5VA 4FZXC 1U49A 2RKIA 1RILA 3I8DA 1L5UA 4KPYA 1U45A 4CJKA 3VA0A 1J9AA 3SV3A 2OA8A 4C8KA 1JXBA 3E01A 1GOCA 3LAMA 3TAQA 3VQ7A 3V9WA 2YKMA 1C1BA 3I0SA 4B8CA 1N6QA 3HP9A 4KRFA 3TR8A 4F8RA 3EY1A 4KHYA 3HL8A 1Z26A 4BACA 1IG9A 1JLAA 4CHNA 3L2QA 1YT3A 4CCHA 1S5JA 3NH2A 4CEOA 1TKZA 1MU2A 2B4JA 3TAMA 2O4IA 1BHLA 3WNGA 3QEPA 3V1RA 2BE2A 1D9FA 4FZZA 3K5LA 2OZSA 3PUFA 2P1JA 3M8SA 4DS5A 4B9VA 1X9SA 2X74A 3QLHA 4JRQA 2RPIA 1C6VA 1VK0A 5FROA 4E7HA 5EU7A 4DFPA 2G8UA 4M3XA 1VSMA 3SPYA 4ELUA 2JLEA 4PA1A 4CJVA 4RW8A 4CFBA 3HPOA 3QETA 2A1RA 3NH0A 4DSKA 1W0HA 4E19A 4DS4A 1HRHA 2YHAA 2I5JA 4CJLA 3AO5A 2Z1IA 2KFZA 4JRPA 3HPGA 3K58A 3KLEA 4BWJA 5CZ1A 4RW4A 1C0MA 2KQ2A 3ZSRA 3ZT1A 5KRTA 4DTNA 2BDPA 1RBRA 1SV5A 3ZCMA 4DSEA 1CZ9A 2HNYA 4CGDA 1GOBA 1ZBLA 4B9NA 4QOZB 4FLTA 2G8VA 4K8XA 4KI4A 3G0ZA 4DLGA 1IH7A 1S6QA 2QKBA 1NKCA 3K5MA 1RT7A 3O4NA 3QESA 1NOYA 4Z4HA 1RNHA 1YTAA 3EZ5A 3V9ZA 3FFIA 4CFDA 4W5OA 4M3WA 4FJLA 2XY7A 1RTIA 3WNEA 4DU1A 4B8AB 3AVNA 4KB1A 3OYIA 1WN7A 3RMDA 3HPHA 4YNQA 3KLGA 1SL2A 4EZ6A 1JL1A 1Q9YA 2IAJA 3CFPA 4ID5A 1TGOA 4DQRA 1IKYA 4FLZA 4DTUA 3DMJA 4AHVA 2XO7A 2F8TA 3U3YA 3SI6A 4AHSA 1L3VA 4KI6A 4ID1A 3LZJA 1HNIA 3AA3A 1K6YA 1NK0A 4FW2A 1LAWA 1JLFA 3QERA 1EETA 3MEGA 4MQ3A 4CIFA 3WNHA 3CM6A 3QEIA 1RDDA 2PYLA 4FJIA 4CEAA 3V1QA 2XHBA 3LPUA 4CECA 4PWDA 3IG1A 5C25A 4O0JA 4Y1CA 2HHSA 3BDPA 3B6PA 3ZSYA 3LWLA 2DFHA 3A2FA 4CF1A 4FJ9A 2D0BA 1JLEA 1KVCA 3L2UA 1HMVA 4DQSA 4FJHA 3MAQA 1L3UA 3DRSA 4CF8A 3PX6A 3ZT2A 1A5XA 3D45A 4DTOA 5J2QA 4BE0A 4AH9A 4ZTFA 5KRSA 4FM0A 2X6NA 3HYFA 5HROA 4BDYA 1JLCA 1SUQA 4HUGA 1HYZA 3SUPA 1JXEA 1QS4A 2KW4A 4CEBA 3D0PA 1T7PA 4GW6A 2R7YA 4FJ7A 1Y97A 1BL3A 1B92A 2Y1IA 3NGYA 3AA4A 3O3HA 1WSEA 1U4BA 4AHCA 4DSIA 3M8RA 1UA0A 1LWFA 1A5WA 2ITGA 4C8LA 3QO9A 4DSLA 4HCCA 3OYKA 4ZHRA 3AVLA 4DTPA 4IG3A 4CK3A 4OPKA 3IS9A 4O0IA 4FK0A 1LWCA 2Z1GA 3L8BA 5FRMA 5HRNA 4CEDA 1ITGA 1IKWA 1HQUA 1LW0A 3VQQA 2X78A 1YVUA 4IFVA 4CFAA 1NK9A 1QSYA 3PO5A 1G15A 3LP2A 4FJXA 2D0AA 3AV9A 2HVIA 1BIZA 4KKOA 4CJ3A 3AVCA 3OY9A 1RBVA 4FLYA 3AVJA 1TVRA 1XI1A 3PX4A 3L3VA 1VSHA 1U48A 1Q9XA 3ZT4A 4TSXA 4FYDA 2OYQA 4ELTA 1KFSA 5JS2A 1LAVA 4N56A 1X1PA 1TK8A 4FLVA 2LSNA 4B9UA 4F3OA 1KLMA 3QIPA 3NCIA 5J2MA 1REVA 4CJFA 1JLQA 4FJMA 4B3OA 5JS1A 4KB0A 3LWMA 2Q3SA 1J53A 4F3TA 4F4KA 4CESA 2WOMA 4CE9A 2IC3A 4H4MA 3O3FA 2P5OA 4FK4A 1KLNA 3HSTB 4KTZA 3K5NA 3HVRA 1XWLA 1XC9A 4RW9A 1RT5A 5HRSA 2G8IA 4CEEA 4E1NA 3KD1E 3EYZA 4CJRA 3OYLA 4PY5A 3HVTA 3OS1A 1HNVA 2E6LA 2B6AA 3F73A 4W5RA 4J2AA 3CFOA 4BE1A 5SWMA 3P83D 4IBNA 4FLXA 2G8WA 3NF8A 3H08A 4KHWA 2OPSA 1L3TA 5J1EA 3OYJA 4EZ9A 2HVHA 4IG0A 3QNOA 3AVBA 2FBVA 2OZMA 1ZYQA 3UIQA 1C1AA 1B9DA 1EX4A 4MFBA 5CY4A 3LZIA 3DLBA 1EXQA 3C6TA 3S3NA 1NOZA 2P5GA 4KAZA 2HHWA 4KO0A 3OJUA 1VSKA 1ASWA 1NJZA 5K14A 3JYTA 4OGCA 2PYJA 1TKDA 1LWEA 3MXJA 3O4QA 4B9MA 5FDLA 2YHBA 4CK2A 1VSEA 3RRHA 3V6DA 3NBPA 3AO2A 5CYQA 3LDSA 3S3MA 4N76A 1BQNA 2F8SA 3NH1A 2HW3A 3DOKA 1NK8A
chains in the Genus database with same CATH superfamily
4DTXA 2A1SA 4I2PA 4BRHA 3TAGA 4LF6K 2IVPA 2XRIA 3KVGA 3VQPA 3QBWA 4CJEA 4DTMA 2CGKA 2ZJPL 4IOCL 4BGBA 1QTMA 4A61A 2ZJRL 1XNQK 2GX9A 4JLHA 2PZSA 4B1VA 2O8FA 3D6RA 1YJWN 1C1CA 3NFAA 4ELVA 3OYMA 3SQ2A 3BZKA 3QIOA 1BGXT 3CG7A 3OS0A 2WUSA 4FCYA 4JS5A 1NJWA 1D8YA 4OPJA 5M1FA 3L2RA 4RW7A 4BC2A 4BRIA 4I9QA 1NJXA 4CZFA 4CERA 1EP4A 1NGBA 5F2RA 3RWUA 4NCAA 2DFEA 3QBXA 4KTWA 3AVFA 2YNFA 1ASVA 4HHTA 5SZTA 4LF9K 2D5RA 3M5RA 3GBTA 3PO4A 4CZGA 2P9SA 3AVGA 4BC3A 3U9ZA 1KVAA 3QFUA 3L0QA 4BRKA 1I94K 4PUOA 1QQCA 4DFMA 3ZT3A 3EZWA 3WNFA 3WXIA 4YFUA 4E3SA 4BR2A 4YOVA 3MN6A 1T8EA 1EWRA 4FLWA 4IEEA 4H8KA 4CJTA 1JLGA 1LCUA 1YTUA 1BA1A 5C12A 3ZSOA 3ZETA 1U04A 5B8HA 4DTRA 3LPTA 4FPAA 3OYFA 1RDCA 1Z05A 1FKOA 4UQGA 2UYTA 3TTCA 4E7KA 4KFBA 4H03B 4BR9A 4N5SA 5I42A 1J5OA 4AM7A 4OKKA 3KK2A 3KLFA 3Q7CA 3KLHA 4DV0K 3SBTA 4NLCA 4CW7B 1D5AA 1KTQA 3SAFA 4KHNA 4OVLA 1OH8A 4MDBA 1I3AA 4DF4A 4H4OA 4GMJB 3LDOA 1IBKK 4J2BA 4DHYA 2F9WA 1TK0A 2OPPA 1T3VA 3DXMB 3TWHA 2HB5A 4OKEA 4DQQA 4CI6A 3VQCA 4OX9K 3UB5A 2UUCK 4QS9A 2E4LA 3SPZA 2OTJN 4BG9A 1X3MA 1BIUA 5AZJB 2E88A 1S1VA 4WF9L 1BO5O 3KHYA 3HO1A 1XUPO 3DJCA 4FM1A 4DQIA 3U6FA 4BRLA 4ICLA 3O6WA 3RTVA 1VSDA 1NGCA 4CZIA 3R3LA 3BEXA 3ZX0A 4CF0A 4JKAA 2FBTA 4H5NA 4K41A 1SKRA 4HTLA 1JJ2M 1BG3A 3ZSVA 2KKZA 1ESVA 4BR4A 3TAFA 3HK2A 4H5WA 4I6MA 4DSJA 2QXFA 1WSGA 4FZYA 5HL7L 3GE1A 3ZYYX 3I0RA 4GVMA 1XQSC 3HT3A 4LH4A 3A5MC 1XHZA 3LP3A 3VQBA 4WFAL 5FPNA 4M41A 5GAHP 3SUOA 2OPQA 2YCHA 3NAEA 3MXMA 3MEDA 1DLOA 1JLBA 3G10A 1NKEA 4AM6A 3VF4A 4CJQA 1A5VA 1IO2A 1TYQB 3VQDA 4R5PA 4BVPA 3OYNA 1BCMA 1RT3A 3GL1A 5JICA 3CXCM 1T03A 4M3RA 4BVOA 2BTFA 3BF3A 4B1WB 1FXXA 3U8XA 2XY8A 4WQ4C 4JS4A 1VQ7N 3TABA 3ZSWA 4DF8A 4Y0WA 1ASUA 3L2WA 2YX6A 4CEZA 4NLBA 3N4PA 4IDKA 4OLBA 4QAGA 1NK5A 1X9WA 5JLFA 3LANA 4HCBA 4BRDA 3NF7A 4CF9A 2P9IB 2Q1NA 3SMPA 2YKNA 5HRPA 3VQ4A 4PKIA 4GV9A 4FXDA 5C24A 2HHQA 1L3SA 3MX5A 2W6KA 1VHXA 4WFNL 2PBDA 4PKGA 3A0IX 1DTQA 3CCSN 1MWMA 1ZBHA 2Q0UA 1NGIA 2W40A 4XIUA 3WXMB 1RBUA 3V4IA 3SUNA 1S9EA 1K8AO 3LP1A 3HXMA 1W9HA 2G8KA 2KHOA 4MDAA 3JSMA 3CMAN 3K9JA 4Z94A 2WC9A 4AHUA 1TV6A 3MX2A 4RW6A 1GLFO 1U49A 4PHTX 1RILA 4KPYA 4CJKA 3VA0A 1J9AA 3LAMA 1N6QA 1C1BA 3HP9A 4F8RA 1NLVA 3AARA 2GWKA 4OO1J 1TKZA 1BHLA 3V1RA 2BE2A 4OPHA 4B9VA 1X9SA 1Q7YO 4JRQA 1S72N 3S41A 2RPIA 1C6VA 5FROA 5BRFA 4E7HA 4DFPA 3VEOA 2E2PA 4M3XA 1ATSA 1W0HA 2UU9K 2FF6A 4DS4A 2O8BA 1T44A 5AZIA 2P9LA 4B3TK 5CZ1A 3VF6A 3ZSRA 1NNEA 3F9MA 3VERA 4DSEA 5KQDA 1ZBLA 4B9NA 2G8VA 3CJAA 1NOYA 3EZ5A 3FFIA 4M3WA 4W5OA 3WNEA 4DU1A 3VEXA 1SL2A 3KLGA 4DV7K 4DV4K 1GLEG 4JI0K 4ID5A 3UE5A 1IKYA 1M1KO 3SI6A 3FZKA 1L3VA 4KI6A 5AQLA 4ID1A 3THWB 3HI0A 1HNIA 4FWPA 4JHDA 1JLFA 3IMXA 3MN7A 4A57A 1J6ZA 3WNHA 3CM6A 3QEIA 4FSVA 2PYLA 4CEAA 3SMSA 3WQTA 3THYA 4PWDA 4O0JA 5AJ3K 2HHSA 5JLHA 2F4VK 2ZM6K 4CF1A 3L2UA 4FJHA 4GNIA 4CF8A 3PX6A 3D45A 1JLCA 1T7PA 1QS4A 2KW4A 4KBOA 1T6DA 3D0PA 4FJ7A 4FWNA 2V7YA 1Y97A 1BL3A 4WCEL 3NGYA 1YJNN 2QWOA 1DT9A 3O9UA 2ITGA 1WOQA 3QO9A 4HCCA 3AVLA 3HSCA 4FWQA 4CK3A 4DTPA 4FK0A 1LWCA 2NRWA 2CH5A 3KWGA 2NRXA 4YY3K 3ENHA 4ILHA 3L8BA 5HRNA 4CEDA 3O5BA 1E4GT 3VF2A 1NK9A 3PO5A 1Y64A 1HNXK 4KKOA 3AVCA 3NVKA 2P9KA 2ITMA 1IV0A 3RVCA 1U48A 4YDUC 1KAZA 2QWMA 4FLVA 5FPDA 4H0VB 4CJFA 1JLQA 2Q3SA 4F3TA 4CESA 3E9PA 4CE9A 4H4MA 3D2EB 2P5OA 4FK4A 3HSTB 3J7ZO 3K5NA 3HVRA 5BPNA 4AF1A 3EYZA 4CJRA 1T6CA 3HVTA 3OS1A 1HNVA 2Q36A 1K8KA 3OYJA 4K25A 5AFUH 5FLXO 3AVBA 3IKMA 1EX4A 3O8MA 4X66K 3DLBA 4H5VA 1NOZA 3CD6N 4ISFA 1VSKA 3CMEN 3JYTA 5E26A 1LWEA 4HWIA 3F2KA 4U7BA 2VGMA 5FDLA 4N76A 4NCBA 5CYQA 2D0OA 1BQNA 3UKRA 1KVBA 2HMIA 1W97L 3TI0A 3T3FA 2QI2A 4IKFA 4FVMA 4K42A 1WSIA 4RTFD 2D4WA 2UXCK 4IWVA 1QE1A 1KCFA 3KZBA 3ZX2A 4F2RA 3KJVA 3HZ6A 3KKSA 3MXIA 3J8AA 3MN9A 3V1OA 1IKVA 4LFCK 2IGIA 4O8UA 2F7TA 1IG8A 4H0XB 3PV8A 1WBDA 2ZF5O 2VG6A 3FZHA 4DV6K 4BDPA 3MN5A 3NF6A 2E1YA 5GAEP 4NCGA 3N4QA 2O8FB 1TUUA 3FLCO 4CGIA 3BY5A 3IRXA 4PQUA 3S3OA 4M3YA 2OPRA 4BROA 5A2QO 3ENBA 4CJUA 4AHTA 3TU5A 5FRNA 2YHXA 3ZSQA 1VRUA 3LM9A 4B3SK 3H46O 3I55N 4OLAA 5AQMA 4CHPA 5D3GA 4C1NK 3I33A 3RMAA 1IBMK 4CHOA 5BR8K 5KGWA 3QEXA 1XC3A 4H5RA 2O8EA 4CGFA 2YJEA 4EP4A 1BQMA 4B08A 4CEQA 1W2BM 3SAGA 3NHGA 2B5JA 2BUPA 2P9SB 3CJBA 4OKJA 5M1OA 4RG8A 2ASPA 2YNGA 3L4IA 1FK9A 3NE6A 5DMRA 3TPQA 3CPWM 4NB4A 4Z4FA 4BRGA 4FWKA 1X9MA 3VQ6A 1D9DA 4MLEA 3QNNA 2QK9A 4YOUA 4FPBA 4K43A 4B1UB 4OGEA 3O4WA 1NGFA 3DRPA 3B8AX 2D0CA 3KD5E 3DOLA 4CIGA 4H0OA 5CZ2A 5HBMA 3OYAA 4CZEA 3TANA 5KI6A 1VRTA 2Z1JA 3C65A 4WE1A 4CD3A 4W5QA 3M8PA 3HP6A 1HPMA 4E0DA 1KQSM 3CHWA 2QXLA 3AVMA 4N47A 1I39A 4DQPA 5GIPA 2GV9A 2ZD1A 1SKSA 3VN5A 3CCQN 2V52B 4DG1A 3OW2M 3VOVA 1LW2A 1HR0K 4JI7K 4BC4A 2JWLA 3TAEA 3SQ0A 3CJCA 3K5OA 4KHQA 4B9LA 3FZFA 4CGHA 4DCHA 2I7NA 3LAKA 4CHQA 4FWMA 3CF5L 2FC0A 1NGDA 2HHUA 3TSUA 1IKXA 2VWBA 4DB3A 3KK7A 1GLAG 3EN9A 3H3OB 1QHTA 3ZEUA 5BPLA 4BDZA 2VG5A 3DWLA 1V4TA 1OH6A 4DUYK 4E7LA 1IBLK 1S9GA 3AVHA 4FL9A 5GINA 1OVYA 3BGRA 1MDUB 2VCPA 2HF3A 4CGGA 2ETJA 5JS1A 3K57A 3DLRA 1ZBIA 2HOEA 3ID6A 3KIOA 1XNRK 4K0KK 1WSJA 1F21A 3UKUA 3RSEA 2AA4A 4I6MB 4FM2A 4Q0BA 1KRPA 3M6GA 4BRMA 5KPRA 1CXUA 2FBYA 3WUHA 1HKCA 1ATRA 4DTJA 3LALA 3CI5A 1SQKA 3F5TA 4HUFA 4KTQA 3KK3A 1JCEA 1SL1A 1LOTB 3OBYA 1CLQA 5GAGP 2KFNA 5C0YA 4DV2K 3V81A 5AQGA 3WT0A 3DXKA 1OH5A 1RBSA 3T69A 4LSLA 3H45C 4CJ4A 1WB9A 3KTQA 2A42A 3KWIA 3R6MA 2HHXA 2Q0RA 2NRVA 3NDKA 5AQJA 3DLGA 2Q97A 1ZXOA 2ZQBA 2FBXA 4PL8A 3THVA 1KAXA 4E89A 4CIEA 4OPAA 3IUCA 4J2DA 3CERA 1N34K 3EEQA 3WEEA 2QM1A 4EIAA 1RDWX 2HNZA 5EY4A 5HOOA 4YDUA 5LJVA 4FOIA 1S1XA 4V19S 2HHTA 2YJFA 3K9KA 4JNEA 5I9EB 3WXJA 4LF4K 4DU3A 2ZGZA 1H1VA 1ZBUA 3AAPA 4JK7A 4O44A 4YORA 3GG4A 4JKHA 1NMDA 3LDQA 4CD1A 1KD1O 1GOCA 3LDPA 3R1XA 3VQ7A 3V9WA 4A2BA 4KHYA 3HL8A 3OTOK 4BACA 3EE9A 1HNZK 4G9ZA 4CEOA 3J80O 1MU2A 4UY8O 4GY2B 3QEPA 4JV5K 5AR0A 2OZSA 1Q82O 3PUFA 3ULEB 3P38A 2A3ZA 2FLOA 2G8UA 4NO7A 4CJVA 3QETA 4DSKA 4CJ7A 2I5JA 2KFZA 3FR0A 1C0MA 3TTFA 3ZT1A 3ZCMA 2HNYA 1GOBA 4QOZB 4K8XA 4R79A 4KI4A 3G0ZA 1IH7A 3WXKA 2QKBA 3QESA 4CZMA 1X3NA 1RNHA 5LJWA 4CFDA 2XY7A 1Q18A 4DR7K 1GLJO 3AVNA 4KB1A 4YNQA 1RFQA 2H3GX 4JKCA 4EFHA 2DPNA 2IAJA 2O8BB 4DQRA 1TGOA 4DTUA 5AZIB 4AHVA 2P9LB 2VQEK 4FOEA 1K6YA 2P9UA 3MCAB 1NG9A 3OA9A 1EETA 4MQ3A 3NMUA 1TUYA 2NRHA 5LY3A 3V1QA 3LPUA 3IG1A 5BREA 4QS8A 1XMQK 3BDPA 3VETA 3LWLA 2D0BA 1KVCA 3CETA 3SBGA 1HMVA 4DQSA 1M90O 2HHHK 1KC8O 4BE0A 4AH9A 3G6EN 1VAZA 2KLAA 2HSTA 2X6NA 3QFPA 5HROA 1HYZA 3MMVA 1JXEA 4CEBA 3W3DA 4JHDB 4XH4A 1P90A 1WSEA 1C0GA 3M8RA 3THYB 1OH7A 4ZHRA 4CVNE 3CCJN 2UUAK 1IKWA 3VQQA 5EOYA 4JD2A 1YVUA 4CFAA 1NWKA 1G15A 4JKGA 1BIZA 4CJ3A 3CJ9A 3ULEA 3HBTA 3AVJA 1TVRA 1BOTO 1XI1A 3PX4A 4JI2K 1Q9XA 5AQOA 3ZT4A 5AQYA 4BREA 1NGGA 4GV6A 5JS2A 1LAVA 2LSNA 1NU0A 4F3OA 1KLMA 2FSKA 3O9SA 3QIPA 1REVA 4B3OA 4BGAA 4FWOA 4DV1K 1NM1A 4F4KA 3O3FA 4BR0A 4XEIA 4KTZA 5HRSA 1RT5A 4CBXA 4NXNK 4DR5K 3OYLA 2B6AA 4W5RA 2P9KB 4FLXA 4BE1A 4IBNA 1Q86O 2G8WA 2OPSA 5J1EA 2HVHA 1VQKN 1U6ZA 3UIQA 3LZIA 2IVNA 1EXQA 3S3NA 4KAZA 2VYPA 2UXDK 2HHWA 4KO0A 3OJUA 3PSFA 5AQFA 1GLBG 2PYJA 3MXJA 4YOWA 1YUWA 3A5OC 3S3MA 3NBPA 4DKWA 3NH1A 3DOKA 2OTLN 3SZ2A 4B9SA 2IS3A 5AQWA 3RRGA 1K8KB 1RDAA 3ENOA 1C0TA 4DU4A 3OS2A 1WSHA 5DK5A 1HJRA 2XY5A 4K8ZA 4U67L 1S1TA 1UOCA 3EO3A 3WXLA 1NGJA 3VMFB 3L6QA 5E84A 4X62K 4JKFA 1Q81O 4KH4A 3ITHA 1QSSA 1JCFA 3O08A 2YI1A 2KZZA 1YF5L 1BU6O 4LF7K 5HRRA 1GLCG 3UKRB 3P5JA 3E9OA 3ASMA 2OCEA 5LMUK 1OKJA 3OHRA 4XH1A 3CC2N 4DMNA 2P9NA 4JAXA 2DFFA 3IFRA 4BWMA 5M1KA 1QVGM 4IEIA 1EKEA 4O4GA 1NJIO 4C1NI 1VQ6N 1ZBFA 1RBTA 4M3TA 3DI6A 2WONA 2QWRA 1Z25A 2RHKA 2VGNA 3G4SN 2ZE2A 3CM5A 1RT1A 1NK7A 3DM2A 4FO0A 4CJSA 5E41A 4KHSA 3TARA 2GBZA 5F0XA 3M1FA 5F1XA 5HP1A 2ASOA 3FGUA 2VG7A 4OJRA 1WSFA 1K73O 4N41A 2XY6A 1QZ6A 4LF8K 1W7AA 4Z4EA 1SZ2A 5FPEA 1RCHA 5EVZA 1RTHA 4PL7A 1DEJA 4W5NA 1QQMA 3TAPA 1TL3A 5GIOA 3VQ8A 2OANA 3E66A 4IFYA 5M1QA 3VQAA 4FJGA 3CCRN 3J7AP 3SAHA 4HTUA 5DM6L 4CHZA 4B1ZA 1LV5A 3AAQA 2O8EB 1B9FA 4G1QA 2O8DA 3LP0A 1RT2A 3CIPA 1BI4A 2QKKA 4NYNA 3TSPA 3ULDA 2NLXA 5FPMA 2PFUA 1WAJA 1RDBA 3V9UA 4CZJA 2ZWHA 2IDOA 4FWSA 3EL2A 3ZSXA 4JK9A 2O8CA 3OYGA 5AQPA 3OBWA 3KK1A 1TL1A 3VESA 4X65K 4B1XB 4FK2A 3THXA 1QQNA 2WBNA 1C0UA 3MEEA 4M45A 4DUZK 3CYMA 2HBMA 3D2FA 5BN9A 3K59A 3VEVA 5AQHA 4M7XA 3FZLA 5CYMA 4DLEA 2BANA 4KHUA 1KXPA 2Q31A 4EHUA 2KZMA 4E7JA 1VSJA 1VSLA 2W41A 2YNHA 1E3MA 4HVJA 3CJ1A 4CJPA 4FJKA 2P9PA 3JAMO 4BRAA 5I3UA 3QEWA 1EQYA 1YIJN 4M7YA 4DQ8A 4B9QA 1T05A 1N36K 3QINA 1ILYA 3V9SA 4DWIA 1S6PA 3C95A 4GVEA 3KKRA 4JYAK 4RWTA 5GADP 2YNIA 3ATVA 2ASMA 4CFCA 3S9HA 2OA8A 1CZBA 3M8QA 2UUBK 2NZTA 4M42A 3ZEUB 1RT4A 1OVQA 4E7IA 4JI5K 2IIRA 4AHRA 2Y1JA 1R59O 5HLFA 4LFAK 5BN8A 2Z1HA 3CFRA 3VQ5A 4AILC 4DR1K 2D0PA 2NRTA 4O55A 3AY9A 4O5FA 2P51A 4BQLA 5BRHA 1YXQA 1XHXA 1NGEA 4DFJA 3UKUB 3KLIA 3RSEB 1NKBA 4B9TA 4EP5A 4NYFA 4A62A 4C8NA 3DLKA 1NMNA 4CF2A 3DLHA 3VGLA 1E4FT 2FF3B 2GUIA 2VQFK 5C10A 3K2PA 3P1GA 3IAYA 4CZHA 3T1YK 2NUBA 2CH6A 4M3ZA 5EX5A 4DFKA 4IO9L 1S3XA 2A40A 3O1WA 3AO1A 4A59A 2GELA 2JWKA 3OJSA 1ZBSA 3T1AA 3T1HK 2D1KA 3DXKB 2EHGA 5C15A 4LSNA 4DSFA 2G8FA 4CEFA 4KV8A 4LF5K 1XMOK 1JL2A 3F9KA 2RKIA 3I8DA 1L5UA 2ZJQL 3SV3A 3SLCA 3E01A 3A8YA 1MA9B 4B8CA 3WEEB 1HLUA 3TR8A 3EY1A 1Z26A 4BR5A 3L2QA 4IOAL 4CCHA 1S5JA 3CJ7A 3NH2A 2B4JA 2O4IA 3WNGA 3MWTA 1D9FA 3ID8A 3K5LA 2E2NA 3E9LA 3M8SA 3D7EO 2X74A 3QLHA 3HOTA 2J4RA 1O13A 1HKGA 5EU7A 4E1JA 4B3RK 5ADXA 4PA1A 4RW8A 4CFBA 3HPOA 2A1RA 4CZLA 3NH0A 1YJ9N 4E19A 2YHAA 4CJLA 3AO5A 2Z1IA 4JRPA 3K58A 1V4SA 2WFBA 1MWKA 4BWJA 4RW4A 4DTNA 2BDPA 4KH5A 1SV5A 1CZ9A 3DLLL 3MDQA 1BA0A 4H0PA 3O4NA 4Z4HA 1YTAA 3C7NA 5AQVA 4FJLA 1RTIA 1J5EK 4LC9B 3O80A 5CE3A 3OYIA 1WN7A 5AQQA 3RMDA 1RDUA 2HBKA 1Q9YA 3WQUA 3CFPA 4FLZA 4B3MK 3U3YA 4AHSA 3LZJA 3U9DA 1NK0A 4FW2A 5AQXA 4CIFA 4FJIA 1RDDA 5EXWA 2XHBA 5LMNK 1U2VA 3IDHA 4Y1CA 1HUXA 3B6PA 4BY9C 2DFHA 3A2FA 1L3UA 3ZT2A 3O1BA 1A5XA 4GKKK 5J2QA 3HYFA 4A5AA 3EKSA 4JK8A 2HMPA 4GW6A 2R7YA 2P9UB 3CCLN 3K0SA 3VEYA 3P31A 4WYBA 3O3HA 4C8LA 1A5WA 4DSLA 3OYKA 2IVOA 1DGKN 3BP8A 4O0IA 2ZGYA 2Z1GA 4JKBA 4LFBK 5JVHL 4BRFA 4GV3A 3VGMA 1HQUA 1LW0A 4IFVA 1G99A 4L3QA 4FJXA 2D0AA 3OY9A 4CZKA 4FLYA 2CGJA 4TSXA 1X9JA 4FYDA 4BC5A 4ELTA 1KFSA 4N56A 1X1PA 3J81O 1TK8A 4B9UA 3BF1A 1VQMN 3LL3A 3NCIA 5J2MA 4IJNA 1QQOA 3P39A 2GUPA 4JD2B 4C23A 4RW9A 2G8IA 4JKGB 3KD1E 1S22A 4PY5A 2GWJA 4JI3K 3F73A 1NGAA 3SK3A 4DR4K 3CFOA 5SWMA 5AQZA 2A5XA 1VQLN 4KHWA 1L3TA 3VENA 3QNOA 4WQ5C 1ZYQA 3QB0A 1B9DA 4MLHA 4ISEA 4MFBA 5CY4A 1WBBA 1EWQA 3L4QA 1ASWA 1YVNA 3CQXA 3O4QA 3M3ZA 4B9MA 5KPTA 1QVFM 3VGKA 3V6DA 5C2FA 3RRHA 3AO2A 5CR4A 1N32K 1NK8A 1SKWA 1KFDA 4I2QA 4FJNA 4DV3K 4DR3K 5AQIA 3OYHA 4CBUA 5CHIA 4H0TB 2DY4A 2HBLA 1GOAA 3C94A 5AQSA 3SCXA 4BR7A 2VWJA 1VQNN 3ZLJA 3CCUN 1SAZA 4BQZA 2G8HA 3PIPL 2PAVA 1FW6A 5ELZA 3SNNA 3HTVA 3SQ4A 4NXMK 1JKHA 1DTTA 2CGLA 1FKPA 4JKEA 3HOSA 3G71N 3VA3A 2X6SA 3SUQA 3T19A 2DTUA 4LH5A 1K9MO 1NJYA 4IDHA 2GEMA 3L2VA 3V9XA 4I7FA 4WFBL 1WAFA 4FWRA 1NGHA 4QCLA 2V51B 2EX3A 3VEWA 3OVNA 3FE1A 3MWPA 4JI4K 1VSFA 4CJ5A 4LD0A 4ZTJA 3TSQA 1Z6RA 4W5TA 1ZC6A 3VEZA 3VQEA 3O3GA 1UAXA 4FZZA 1S1WA 1HYSA 3OYCA 1N33K 5LL6Z 3RMCA 1TKTA 3CQ8A 5H1SQ 3OYEA 3LDNA 2P9NB 4CHYA 4O8KA 4DTSA 4F2SA 4CK1A 3DXMA 3VQ9A 3ZT0A 1TK5A 1U47A 1TAUA 3OYBA 2IOCA 1SL0A 3MECA 5FRMA 3JXUA 5J2NA 1RTDA 4LY7A 2AJQA 2HHVA 2HNDA 2E6MA 3AVAA 5AZJA 3ZSZA 3J7YP 3NGIA 1VQON 3PSIA 3HJFA 4H0YB 1S1UA 1UWBA 3ZX3A 3SYZA 1JCGA 1Q8IA 3HM9A 4IJAA 3B6OA 1GLLO 2UXBK 5M1PA 4O5BA 1QSLA 2F96A 1CXQA 4CGJA 2W42A 1D4XA 2RN2A 1N8RO 2Q2RA 3I56N 4C8MA 3AVIA 2FSJA 3DLEA 5KTQA 3QEVA 3RMBA 3AVKA 3U3GA 4M3UA 1HQEA 2ATQA 5M1NA 2O8DB 1HPZA 2A41A 1RTJA 2QWQA 3ATUA 1BI4B 4YOTA 4KH6A 1BISA 1HYVA 4GKJK 3AO4A 4KREA 3DRRA 4Z0UA 1VQPN 3CCVN 3CPEA 2RF2A 2KTQA 2EWSA 1NK6A 4L8RB 1HNWK 1IJJA 1DKGD 4Y1DA 1C0FA 2A6AA 4BE2A 3FFKB 3AGRA 2O8CB 5BRDA 4BG8A 4XH5A 1KSPA 2O4GA 3RR7A 1BWFO 1TYQA 2RE2A 3THXB 1O1WA 3D2FB 2VWKA 1RT6A 4JI6K 3NGZA 3O9RA 3PY8A 3C6AA 4HUEA 5T7BA 1TKXA 3TTDA 3SQ1A 4Z4IA 3EE8A 1NK4A 1FJGK 1WLJA 3RR8A 3H1VX 2PY5A 3ALYA 3PIOL 4E1MA 4MO5A 3ISNC 4J2EA 3A5LC 3MK6A 4FJJA 2P9PB 2P9IA 5BR9A 3DYAA 3SV4A 4Z4GA 2BGGA 1BCOA 3AO3A 3LDLA 3QDKA 1VSIA 5KGXA 3HRGA 4F9OA 3GOIA 5C42A 4FJ8A 2HBJA 1EO1A 2QWPA 3O9TA 1R0AA 3L3UA 1UA1A 4Z4CA 4X64K 5KPZA 2FSNA 3PLAA 5IT9O 3AGKA 4JI8K 3NF9A 1WNSA 3SJJA 1YITN 4I9LA 5C2DA 2WTUA 4FJ5A 3AA2A 5J2PA 4C8OA 3T7ZA 2E2QA 4DR2K 3AA5X 3EKUA 3VTHA 5BPMA 2W6LA 4IOXA 5TKWA 1N5YA 1TAQA 4CJWA 3NVMA 4IFEA 1YI2N 2QWNA 2JGUA 3PX0A 1VQ8N 4FW1A 1BUPA 3C6UA 1J54A 5AQUA 2YV0X 3OYDA 4H5TA 4FLUA 4A5BA 1QZ5A 4IXCA 4FZXC 4Q5VA 4RCHA 2YHYA 3A5NC 4IZ9A 1U45A 3H6EA 2GTDA 4AQYK 4C8KA 1JXBA 3TAQA 1QHAA 3CC7N 5IWAK 2YKMA 3C0BA 3I0SA 4KRFA 1VQ9N 3G25A 1IG9A 1JLAA 3E1YA 4CHNA 1YT3A 4A2AA 1HJOA 3TAMA 5JVGL 4WQ5A 2E20A 2AP1A 2NNWA 3DAWA 2P1JA 5MLCQ 4BRCA 4DS5A 3CQYA 1VK0A 1NBWA 1CZAN 1VSMA 2E8AA 3SPYA 2JLEA 4ELUA 1HRHA 1RGIA 4J8FA 3VTIA 3HPGA 2NRRA 4JI1K 3KLEA 5AQRA 3THWA 2KQ2A 4CBWA 5KRTA 1RBRA 4CGDA 2QTDA 4FLTA 4DV5K 3W0LA 4DLGA 1S6QA 3BUZB 4B1YB 3K5MA 1NKCA 1RT7A 2QEXN 4YHHK 3V9ZA 2QW9A 2I7PA 4B8AB 3R8EA 3O9QA 3HPHA 3HM8A 4M63C 4EZ6A 1JL1A 1HX1A 1P8ZA 3DMJA 2XO7A 2E5LK 2F8TA 4JN4A 3AA3A 5JMVA 1LAWA 3BZCA 3QERA 3R9PA 3MEGA 5ADXH 3H3NO 1HKBA 3CCMN 4CECA 5C25A 4PKHA 3C7NB 5DM7L 3ZSYA 1VQ5N 5KQ8A 4FJ9A 3CC4N 1JLEA 4WQ4A 1YAGA 3CCEN 3MAQA 3DRSA 4BRNA 4DTOA 4ZTFA 5KRSA 4FM0A 4BDYA 1SUQA 4HUGA 3SUPA 1SS6A 4BRPA 5AQNA 1B92A 2Y1IA 2BH1A 4DR6K 3AA4A 1U4BA 4AHCA 4DSIA 1UA0A 1LWFA 4EAHD 2QWLA 1U2VB 2E2OA 4IG3A 4OPKA 3IS9A 4BRQA 4KHPK 3JS6A 5AFUA 3QMLA 3D2EA 1ITGA 4YOYA 2NRZA 2X78A 1QSYA 3LP2A 3AV9A 2HVIA 3Q7BA 1RBVA 4YOXA 5TKYA 3L3VA 1VSHA 3QICA 1VQ4N 3FZMA 2OYQA 2QA4N 4QS7A 2FXUA 4EHTA 3GDQA 1WUAA 4FJMA 3I8BA 2HF4A 4KB0A 3LWMA 1J53A 4JEPA 2WOMA 2IC3A 3C6HA 3P4IA 1KLNA 1XC9A 1XWLA 4FVUA 3ZETB 4CEEA 3U4LA 4E1NA 4MO4A 3LM2A 4FWLA 2E6LA 4J2AA 3P83D 1BDGA 3NF8A 3H08A 5AQTA 4EZ9A 1YHQN 3SJHA 4IG0A 4IO8A 2YHWA 3H1QA 2FBVA 2OZMA 4ILJA 1C1AA 3C6TA 2E1ZA 2F9TA 1GLDG 2P5GA 4JKDA 1NJZA 5AQKA 5K14A 3MCPA 4OGCA 3VPZA 1TKDA 4ILGB 4CK2A 2YHBA 1VSEA 3LDSA 2F8SA 2V7ZA 2HW3A 1KAYA 1ATNA 4ISGA
chains in the Genus database with same CATH topology
1KFDA 4I2QA 1KVBA 2A1SA 4I2PA 3SZ2A 4DTXA 2HMIA 4B9SA 4FJNA 2IS3A 3TAGA 3RRGA 2XRIA 1RDAA 3VQPA 1C0TA 3TI0A 3OYHA 4DU4A 3T3FA 3OS2A 4CJEA 1WSHA 4DTMA 4IKFA 4FVMA 5DK5A 1HJRA 1WSIA 1GOAA 2XY5A 4K8ZA 1S1TA 1UOCA 3C94A 2DY4A 3SCXA 1QTMA 1QE1A 1KCFA 4JLHA 2PZSA 1C1CA 3NFAA 2VWJA 4F2RA 3KJVA 4ELVA 3KKSA 3OYMA 3SQ2A 3ITHA 1QSSA 3MXIA 3QIOA 1BGXT 3V1OA 2KZZA 2G8HA 3CG7A 1IKVA 4Q0BA 2IGIA 5HRRA 3OS0A 3P5JA 3SNNA 4FCYA 4JS5A 1NJWA 3PV8A 1D8YA 4OPJA 3ASMA 3L2RA 3SQ4A 1JKHA 1DTTA 4RW7A 1FKPA 4I9QA 1NJXA 3VA3A 2VG6A 2X6SA 3SUQA 4CERA 4BDPA 3T19A 1EP4A 3RWUA 4NCAA 3NF6A 2DFEA 4KTWA 2DTUA 3AVFA 4LH5A 4NCGA 2YNFA 1ASVA 4CGIA 4HHTA 5SZTA 1NJYA 3L2VA 3IRXA 4DMNA 3V9XA 4PQUA 2D5RA 3S3OA 4M3YA 2DFFA 2OPRA 4I7FA 3PO4A 4CJUA 4AHTA 4BWMA 5FRNA 3AVGA 3ZSQA 1KVAA 1VRUA 1WAFA 1EKEA 4O4GA 4PUOA 1QQCA 4DFMA 3ZT3A 4QCLA 2EX3A 3WNFA 1ZBFA 1RBTA 4YFUA 3DI6A 2WONA 3OVNA 4E3SA 4M3TA 4OLAA 4CHPA 1VSFA 4CJ5A 5D3GA 1Z25A 4LD0A 4ZTJA 1T8EA 3RMAA 4W5TA 4CHOA 2ZE2A 3CM5A 3VQEA 5KGWA 3O3GA 1RT1A 1UAXA 1S1WA 4H8KA 4CJTA 3DM2A 4CJSA 3QEXA 1NK7A 4CGFA 5E41A 1JLGA 1HYSA 4KHSA 3OYCA 3TARA 1YTUA 3RMCA 2GBZA 5HP1A 4EP4A 1TKTA 1BQMA 3CQ8A 3ZSOA 4B08A 2VG7A 4CEQA 3OYEA 4OJRA 4CHYA 1U04A 1WSFA 3NHGA 4DTSA 4DTRA 3LPTA 2B5JA 4F2SA 4CK1A 4N41A 3OYFA 1RDCA 1FKOA 4UQGA 2XY6A 4OKJA 4Z4EA 4RG8A 3VQ9A 3ZT0A 4W5NA 1TK5A 4E7KA 1U47A 1TAUA 4KFBA 1RCHA 2YNGA 3OYBA 2IOCA 1RTHA 1SL0A 3MECA 4N5SA 1FK9A 3NE6A 1TL3A 5J2NA 5DMRA 3TAPA 5I42A 1J5OA 1RTDA 3VQ8A 4OKKA 3KK2A 4IFYA 3KLFA 3KLHA 4Z4FA 3VQAA 4FJGA 4LY7A 2AJQA 2HHVA 2HNDA 2E6MA 1D5AA 3AVAA 4HTUA 1X9MA 1KTQA 4CHZA 1LV5A 4KHNA 4OVLA 3VQ6A 1D9DA 3ZSZA 3NGIA 3RR8A 1B9FA 4G1QA 3HJFA 1I3AA 4DF4A 1S1UA 4H4OA 3QNNA 2QK9A 1UWBA 4GMJB 3LP0A 1RT2A 3SYZA 1BI4A 2QKKA 4NYNA 1Q8IA 3HM9A 4OGEA 4J2BA 3B6OA 1TK0A 3ULDA 2OPPA 3DRPA 2D0CA 1WAJA 3DOLA 4O5BA 4CIGA 1QSLA 2F96A 3KD5E 5CZ2A 1RDBA 1CXQA 5HBMA 3OYAA 4CGJA 2W42A 3V9UA 3TANA 3TWHA 2IDOA 2HB5A 5KI6A 4OKEA 1VRTA 2RN2A 2Z1JA 4DQQA 3VQCA 4WE1A 4FLWA 4W5QA 3ZSXA 3M8PA 4C8MA 3OYGA 2E4LA 3HP6A 3AVIA 3DLEA 3SPZA 5KTQA 4E0DA 3KK1A 1TL1A 1BIUA 3QEVA 3RMBA 3AVMA 4N47A 1I39A 4FK2A 1S1VA 3AVKA 3U3GA 4DQPA 3MEEA 1C0UA 4M3UA 1HQEA 4M45A 3HO1A 2ATQA 2GV9A 2ZD1A 1HPZA 3CYMA 1RTJA 1SKSA 1BI4B 3VN5A 4FM1A 4DQIA 3U6FA 3K59A 4DG1A 1BISA 1HYVA 3AO4A 4KREA 4ICLA 1LW2A 3DRRA 4Z0UA 3RTVA 4DLEA 5CYMA 3TAEA 1VSDA 2BANA 4KHUA 2RF2A 2KTQA 1NK6A 4L8RB 3SQ0A 2KZMA 4E7JA 1VSJA 1VSLA 4CF0A 2FBTA 3K5OA 4Y1DA 4KHQA 2YNHA 4BE2A 1SKWA 1SKRA 4B9LA 4CGHA 4HVJA 4NCBA 3LAKA 3ZSVA 4CJPA 2O4GA 4CHQA 1KSPA 3RR7A 3TAFA 4FJKA 2FC0A 3HK2A 2HHUA 1IKXA 4DSJA 2QXFA 1WSGA 4FZYA 5I3UA 1O1WA 1QHTA 2VWKA 1RT6A 3QEWA 3NGZA 3I0RA 4BDZA 2VG5A 4GVMA 4E7LA 1S9GA 3AVHA 3HT3A 1T05A 3PY8A 4LH4A 4HUEA 1XHZA 5T7BA 3QINA 1TKXA 3BGRA 3LP3A 3VQBA 3SQ1A 4M41A 4Z4IA 3V9SA 4CGGA 2ETJA 3SUOA 2OPQA 1WLJA 3MXMA 3NAEA 3K57A 3ALYA 3DLRA 3MEDA 1NK4A 4E1MA 3KIOA 2PY5A 1S6PA 4DWIA 1DLOA 1JLBA 1ZBIA 3C95A 3G10A 1NKEA 1WSJA 1F21A 3ISNC 3KKRA 4CJQA 4J2EA 1A5VA 1IO2A 2YNIA 4FJJA 3VQDA 4R5PA 3OYNA 4CFCA 3DYAA 3SV4A 3S9HA 1BCMA 1RT3A 1CZBA 3M8QA 4FM2A 1T03A 1KRPA 1BCOA 3AO3A 4M3RA 4M42A 4Z4GA 2BGGA 1FXXA 1RT4A 1VSIA 1CXUA 2FBYA 5KGXA 4E7IA 2XY8A 4AHRA 5C42A 4JS4A 2Y1JA 4DTJA 4FJ8A 3TABA 5HLFA 3LALA 3ZSWA 4DF8A 2Z1HA 4HUFA 4KTQA 3KK3A 1ASUA 3VQ5A 3CFRA 4AILC 3L2WA 4O55A 1SL1A 4CEZA 1R0AA 3L3UA 1CLQA 4IDKA 2P51A 4OLBA 1UA1A 2KFNA 3V81A 1XHXA 4QAGA 4Z4CA 4DFJA 1NK5A 3KLIA 1RBSA 1X9WA 1NKBA 4B9TA 4LSLA 4CJ4A 3LANA 4NYFA 4EP5A 3KTQA 4HCBA 3NF7A 4CF9A 2HHXA 3NDKA 3NF9A 3DLKA 4C8NA 3DLGA 2YKNA 1WNSA 3SJJA 4I9LA 5HRPA 3VQ4A 2ZQBA 4CF2A 4FJ5A 4FXDA 2FBXA 3DLHA 5C24A 3AA2A 5J2PA 2GUIA 2HHQA 3THVA 1L3SA 4C8OA 3AA5X 4E89A 4CIEA 3K2PA 4J2DA 3P1GA 1N5YA 3IAYA 1DTQA 2NUBA 1TAQA 1ZBHA 4CJWA 4M3ZA 4DFKA 2HNZA 3AO1A 2JGUA 3PX0A 3OJSA 3T1AA 4XIUA 1RBUA 2EHGA 3V4IA 4FW1A 3SUNA 1S9EA 4LSNA 3LP1A 4DSFA 1S1XA 3HXMA 1W9HA 3C6UA 2G8KA 2G8FA 1J54A 4CEFA 2YV0X 3OYDA 2HHTA 4KV8A 4FLUA 1JL2A 3JSMA 4AHUA 4DU3A 3F9KA 4O44A 1TV6A 1ZBUA 4RW6A 4Q5VA 4FZXC 1U49A 2RKIA 1RILA 3I8DA 1L5UA 4KPYA 1U45A 4CJKA 3VA0A 1J9AA 3SV3A 2OA8A 4C8KA 1JXBA 3E01A 1GOCA 3LAMA 3TAQA 3VQ7A 3V9WA 2YKMA 1C1BA 3I0SA 4B8CA 1N6QA 3HP9A 4KRFA 3TR8A 4F8RA 3EY1A 4KHYA 3HL8A 1Z26A 4BACA 1IG9A 1JLAA 4CHNA 3L2QA 1YT3A 4CCHA 1S5JA 3NH2A 4CEOA 1TKZA 1MU2A 2B4JA 3TAMA 2O4IA 1BHLA 3WNGA 3QEPA 3V1RA 2BE2A 1D9FA 4FZZA 3K5LA 2OZSA 3PUFA 2P1JA 3M8SA 4DS5A 4B9VA 1X9SA 2X74A 3QLHA 4JRQA 2RPIA 1C6VA 1VK0A 5FROA 4E7HA 5EU7A 4DFPA 2G8UA 4M3XA 1VSMA 3SPYA 4ELUA 2JLEA 4PA1A 4CJVA 4RW8A 4CFBA 3HPOA 3QETA 2A1RA 3NH0A 4DSKA 1W0HA 4E19A 4DS4A 1HRHA 2YHAA 2I5JA 4CJLA 3AO5A 2Z1IA 2KFZA 4JRPA 3HPGA 3K58A 3KLEA 4BWJA 5CZ1A 4RW4A 1C0MA 2KQ2A 3ZSRA 3ZT1A 5KRTA 4DTNA 2BDPA 1RBRA 1SV5A 3ZCMA 4DSEA 1CZ9A 2HNYA 4CGDA 1GOBA 1ZBLA 4B9NA 4QOZB 4FLTA 2G8VA 4K8XA 4KI4A 3G0ZA 4DLGA 1IH7A 1S6QA 2QKBA 1NKCA 3K5MA 1RT7A 3O4NA 3QESA 1NOYA 4Z4HA 1RNHA 1YTAA 3EZ5A 3V9ZA 3FFIA 4CFDA 4W5OA 4M3WA 4FJLA 2XY7A 1RTIA 3WNEA 4DU1A 4B8AB 3AVNA 4KB1A 3OYIA 1WN7A 3RMDA 3HPHA 4YNQA 3KLGA 1SL2A 4EZ6A 1JL1A 1Q9YA 2IAJA 3CFPA 4ID5A 1TGOA 4DQRA 1IKYA 4FLZA 4DTUA 3DMJA 4AHVA 2XO7A 2F8TA 3U3YA 3SI6A 4AHSA 1L3VA 4KI6A 4ID1A 3LZJA 1HNIA 3AA3A 1K6YA 1NK0A 4FW2A 1LAWA 1JLFA 3QERA 1EETA 3MEGA 4MQ3A 4CIFA 3WNHA 3CM6A 3QEIA 1RDDA 2PYLA 4FJIA 4CEAA 3V1QA 2XHBA 3LPUA 4CECA 4PWDA 3IG1A 5C25A 4O0JA 4Y1CA 2HHSA 3BDPA 3B6PA 3ZSYA 3LWLA 2DFHA 3A2FA 4CF1A 4FJ9A 2D0BA 1JLEA 1KVCA 3L2UA 1HMVA 4DQSA 4FJHA 3MAQA 1L3UA 3DRSA 4CF8A 3PX6A 3ZT2A 1A5XA 3D45A 4DTOA 5J2QA 4BE0A 4AH9A 4ZTFA 5KRSA 4FM0A 2X6NA 3HYFA 5HROA 4BDYA 1JLCA 1SUQA 4HUGA 1HYZA 3SUPA 1JXEA 1QS4A 2KW4A 4CEBA 3D0PA 1T7PA 4GW6A 2R7YA 4FJ7A 1Y97A 1BL3A 1B92A 2Y1IA 3NGYA 3AA4A 3O3HA 1WSEA 1U4BA 4AHCA 4DSIA 3M8RA 1UA0A 1LWFA 1A5WA 2ITGA 4C8LA 3QO9A 4DSLA 4HCCA 3OYKA 4ZHRA 3AVLA 4DTPA 4IG3A 4CK3A 4OPKA 3IS9A 4O0IA 4FK0A 1LWCA 2Z1GA 3L8BA 5FRMA 5HRNA 4CEDA 1ITGA 1IKWA 1HQUA 1LW0A 3VQQA 2X78A 1YVUA 4IFVA 4CFAA 1NK9A 1QSYA 3PO5A 1G15A 3LP2A 4FJXA 2D0AA 3AV9A 2HVIA 1BIZA 4KKOA 4CJ3A 3AVCA 3OY9A 1RBVA 4FLYA 3AVJA 1TVRA 1XI1A 3PX4A 3L3VA 1VSHA 1U48A 1Q9XA 3ZT4A 4TSXA 4FYDA 2OYQA 4ELTA 1KFSA 5JS2A 1LAVA 4N56A 1X1PA 1TK8A 4FLVA 2LSNA 4B9UA 4F3OA 1KLMA 3QIPA 3NCIA 5J2MA 1REVA 4CJFA 1JLQA 4FJMA 4B3OA 5JS1A 4KB0A 3LWMA 2Q3SA 1J53A 4F3TA 4F4KA 4CESA 2WOMA 4CE9A 2IC3A 4H4MA 3O3FA 2P5OA 4FK4A 1KLNA 3HSTB 4KTZA 3K5NA 3HVRA 1XWLA 1XC9A 4RW9A 1RT5A 5HRSA 2G8IA 4CEEA 4E1NA 3KD1E 3EYZA 4CJRA 3OYLA 4PY5A 3HVTA 3OS1A 1HNVA 2E6LA 2B6AA 3F73A 4W5RA 4J2AA 3CFOA 4BE1A 5SWMA 3P83D 4IBNA 4FLXA 2G8WA 3NF8A 3H08A 4KHWA 2OPSA 1L3TA 5J1EA 3OYJA 4EZ9A 2HVHA 4IG0A 3QNOA 3AVBA 2FBVA 2OZMA 1ZYQA 3UIQA 1C1AA 1B9DA 1EX4A 4MFBA 5CY4A 3LZIA 3DLBA 1EXQA 3C6TA 3S3NA 1NOZA 2P5GA 4KAZA 2HHWA 4KO0A 3OJUA 1VSKA 1ASWA 1NJZA 5K14A 3JYTA 4OGCA 2PYJA 1TKDA 1LWEA 3MXJA 3O4QA 4B9MA 5FDLA 2YHBA 4CK2A 1VSEA 3RRHA 3V6DA 3NBPA 3AO2A 5CYQA 3LDSA 3S3MA 4N76A 1BQNA 2F8SA 3NH1A 2HW3A 3DOKA 1NK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFD A;  4I2Q A;  1KVB A;  2A1S A;  4I2P A;  3SZ2 A;  4DTX A;  2HMI A;  4B9S A;  4FJN A;  2IS3 A;  3TAG A;  3RRG A;  2XRI A;  1RDA A;  3VQP A;  1C0T A;  3TI0 A;  3OYH A;  4DU4 A;  3T3F A;  3OS2 A;  4CJE A;  1WSH A;  4DTM A;  4IKF A;  4FVM A;  5DK5 A;  1HJR A;  1WSI A;  1GOA A;  2XY5 A;  4K8Z A;  1S1T A;  1UOC A;  3C94 A;  2DY4 A;  3SCX A;  1QTM A;  1QE1 A;  1KCF A;  4JLH A;  2PZS A;  1C1C A;  3NFA A;  2VWJ A;  4F2R A;  3KJV A;  4ELV A;  3KKS A;  3OYM A;  3SQ2 A;  3ITH A;  1QSS A;  3MXI A;  3QIO A;  1BGX T;  3V1O A;  2KZZ A;  2G8H A;  3CG7 A;  1IKV A;  4Q0B A;  2IGI A;  5HRR A;  3OS0 A;  3P5J A;  3SNN A;  4FCY A;  4JS5 A;  1NJW A;  3PV8 A;  1D8Y A;  4OPJ A;  3ASM A;  3L2R A;  3SQ4 A;  1JKH A;  1DTT A;  4RW7 A;  1FKP A;  4I9Q A;  1NJX A;  3VA3 A;  2VG6 A;  2X6S A;  3SUQ A;  4CER A;  4BDP A;  3T19 A;  1EP4 A;  3RWU A;  4NCA A;  3NF6 A;  2DFE A;  4KTW A;  2DTU A;  3AVF A;  4LH5 A;  4NCG A;  2YNF A;  1ASV A;  4CGI A;  4HHT A;  5SZT A;  1NJY A;  3L2V A;  3IRX A;  4DMN A;  3V9X A;  4PQU A;  2D5R A;  3S3O A;  4M3Y A;  2DFF A;  2OPR A;  4I7F A;  3PO4 A;  4CJU A;  4AHT A;  4BWM A;  5FRN A;  3AVG A;  3ZSQ A;  1KVA A;  1VRU A;  1WAF A;  1EKE A;  4O4G A;  4PUO A;  1QQC A;  4DFM A;  3ZT3 A;  4QCL A;  2EX3 A;  3WNF A;  1ZBF A;  1RBT A;  4YFU A;  3DI6 A;  2WON A;  3OVN A;  4E3S A;  4M3T A;  4OLA A;  4CHP A;  1VSF A;  4CJ5 A;  5D3G A;  1Z25 A;  4LD0 A;  4ZTJ A;  1T8E A;  3RMA A;  4W5T A;  4CHO A;  2ZE2 A;  3CM5 A;  3VQE A;  5KGW A;  3O3G A;  1RT1 A;  1UAX A;  1S1W A;  4H8K A;  4CJT A;  3DM2 A;  4CJS A;  3QEX A;  1NK7 A;  4CGF A;  5E41 A;  1JLG A;  1HYS A;  4KHS A;  3OYC A;  3TAR A;  1YTU A;  3RMC A;  2GBZ A;  5HP1 A;  4EP4 A;  1TKT A;  1BQM A;  3CQ8 A;  3ZSO A;  4B08 A;  2VG7 A;  4CEQ A;  3OYE A;  4OJR A;  4CHY A;  1U04 A;  1WSF A;  3NHG A;  4DTS A;  4DTR A;  3LPT A;  2B5J A;  4F2S A;  4CK1 A;  4N41 A;  3OYF A;  1RDC A;  1FKO A;  4UQG A;  2XY6 A;  4OKJ A;  4Z4E A;  4RG8 A;  3VQ9 A;  3ZT0 A;  4W5N A;  1TK5 A;  4E7K A;  1U47 A;  1TAU A;  4KFB A;  1RCH A;  2YNG A;  3OYB A;  2IOC A;  1RTH A;  1SL0 A;  3MEC A;  4N5S A;  1FK9 A;  3NE6 A;  1TL3 A;  5J2N A;  5DMR A;  3TAP A;  5I42 A;  1J5O A;  1RTD A;  3VQ8 A;  4OKK A;  3KK2 A;  4IFY A;  3KLF A;  3KLH A;  4Z4F A;  3VQA A;  4FJG A;  4LY7 A;  2AJQ A;  2HHV A;  2HND A;  2E6M A;  1D5A A;  3AVA A;  4HTU A;  1X9M A;  1KTQ A;  4CHZ A;  1LV5 A;  4KHN A;  4OVL A;  3VQ6 A;  1D9D A;  3ZSZ A;  3NGI A;  3RR8 A;  1B9F A;  4G1Q A;  3HJF A;  1I3A A;  4DF4 A;  1S1U A;  4H4O A;  3QNN A;  2QK9 A;  1UWB A;  4GMJ B;  3LP0 A;  1RT2 A;  3SYZ A;  1BI4 A;  2QKK A;  4NYN A;  1Q8I A;  3HM9 A;  4OGE A;  4J2B A;  3B6O A;  1TK0 A;  3ULD A;  2OPP A;  3DRP A;  2D0C A;  1WAJ A;  3DOL A;  4O5B A;  4CIG A;  1QSL A;  2F96 A;  3KD5 E;  5CZ2 A;  1RDB A;  1CXQ A;  5HBM A;  3OYA A;  4CGJ A;  2W42 A;  3V9U A;  3TAN A;  3TWH A;  2IDO A;  2HB5 A;  5KI6 A;  4OKE A;  1VRT A;  2RN2 A;  2Z1J A;  4DQQ A;  3VQC A;  4WE1 A;  4FLW A;  4W5Q A;  3ZSX A;  3M8P A;  4C8M A;  3OYG A;  2E4L A;  3HP6 A;  3AVI A;  3DLE A;  3SPZ A;  5KTQ A;  4E0D A;  3KK1 A;  1TL1 A;  1BIU A;  3QEV A;  3RMB A;  3AVM A;  4N47 A;  1I39 A;  4FK2 A;  1S1V A;  3AVK A;  3U3G A;  4DQP A;  3MEE A;  1C0U A;  4M3U A;  1HQE A;  4M45 A;  3HO1 A;  2ATQ A;  2GV9 A;  2ZD1 A;  1HPZ A;  3CYM A;  1RTJ A;  1SKS A;  1BI4 B;  3VN5 A;  4FM1 A;  4DQI A;  3U6F A;  3K59 A;  4DG1 A;  1BIS A;  1HYV A;  3AO4 A;  4KRE A;  4ICL A;  1LW2 A;  3DRR A;  4Z0U A;  3RTV A;  4DLE A;  5CYM A;  3TAE A;  1VSD A;  2BAN A;  4KHU A;  2RF2 A;  2KTQ A;  1NK6 A;  4L8R B;  3SQ0 A;  2KZM A;  4E7J A;  1VSJ A;  1VSL A;  4CF0 A;  2FBT A;  3K5O A;  4Y1D A;  4KHQ A;  2YNH A;  4BE2 A;  1SKW A;  1SKR A;  4B9L A;  4CGH A;  4HVJ A;  4NCB A;  3LAK A;  3ZSV A;  4CJP A;  2O4G A;  4CHQ A;  1KSP A;  3RR7 A;  3TAF A;  4FJK A;  2FC0 A;  3HK2 A;  2HHU A;  1IKX A;  4DSJ A;  2QXF A;  1WSG A;  4FZY A;  5I3U A;  1O1W A;  1QHT A;  2VWK A;  1RT6 A;  3QEW A;  3NGZ A;  3I0R A;  4BDZ A;  2VG5 A;  4GVM A;  4E7L A;  1S9G A;  3AVH A;  3HT3 A;  1T05 A;  3PY8 A;  4LH4 A;  4HUE A;  1XHZ A;  5T7B A;  3QIN A;  1TKX A;  3BGR A;  3LP3 A;  3VQB A;  3SQ1 A;  4M41 A;  4Z4I A;  3V9S A;  4CGG A;  2ETJ A;  3SUO A;  2OPQ A;  1WLJ A;  3MXM A;  3NAE A;  3K57 A;  3ALY A;  3DLR A;  3MED A;  1NK4 A;  4E1M A;  3KIO A;  2PY5 A;  1S6P A;  4DWI A;  1DLO A;  1JLB A;  1ZBI A;  3C95 A;  3G10 A;  1NKE A;  1WSJ A;  1F21 A;  3ISN C;  3KKR A;  4CJQ A;  4J2E A;  1A5V A;  1IO2 A;  2YNI A;  4FJJ A;  3VQD A;  4R5P A;  3OYN A;  4CFC A;  3DYA A;  3SV4 A;  3S9H A;  1BCM A;  1RT3 A;  1CZB A;  3M8Q A;  4FM2 A;  1T03 A;  1KRP A;  1BCO A;  3AO3 A;  4M3R A;  4M42 A;  4Z4G A;  2BGG A;  1FXX A;  1RT4 A;  1VSI A;  1CXU A;  2FBY A;  5KGX A;  4E7I A;  2XY8 A;  4AHR A;  5C42 A;  4JS4 A;  2Y1J A;  4DTJ A;  4FJ8 A;  3TAB A;  5HLF A;  3LAL A;  3ZSW A;  4DF8 A;  2Z1H A;  4HUF A;  4KTQ A;  3KK3 A;  1ASU A;  3VQ5 A;  3CFR A;  4AIL C;  3L2W A;  4O55 A;  1SL1 A;  4CEZ A;  1R0A A;  3L3U A;  1CLQ A;  4IDK A;  2P51 A;  4OLB A;  1UA1 A;  2KFN A;  3V81 A;  1XHX A;  4QAG A;  4Z4C A;  4DFJ A;  1NK5 A;  3KLI A;  1RBS A;  1X9W A;  1NKB A;  4B9T A;  4LSL A;  4CJ4 A;  3LAN A;  4NYF A;  4EP5 A;  3KTQ A;  4HCB A;  3NF7 A;  4CF9 A;  2HHX A;  3NDK A;  3NF9 A;  3DLK A;  4C8N A;  3DLG A;  2YKN A;  1WNS A;  3SJJ A;  4I9L A;  5HRP A;  3VQ4 A;  2ZQB A;  4CF2 A;  4FJ5 A;  4FXD A;  2FBX A;  3DLH A;  5C24 A;  3AA2 A;  5J2P A;  2GUI A;  2HHQ A;  3THV A;  1L3S A;  4C8O A;  3AA5 X;  4E89 A;  4CIE A;  3K2P A;  4J2D A;  3P1G A;  1N5Y A;  3IAY A;  1DTQ A;  2NUB A;  1TAQ A;  1ZBH A;  4CJW A;  4M3Z A;  4DFK A;  2HNZ A;  3AO1 A;  2JGU A;  3PX0 A;  3OJS A;  3T1A A;  4XIU A;  1RBU A;  2EHG A;  3V4I A;  4FW1 A;  3SUN A;  1S9E A;  4LSN A;  3LP1 A;  4DSF A;  1S1X A;  3HXM A;  1W9H A;  3C6U A;  2G8K A;  2G8F A;  1J54 A;  4CEF A;  2YV0 X;  3OYD A;  2HHT A;  4KV8 A;  4FLU A;  1JL2 A;  3JSM A;  4AHU A;  4DU3 A;  3F9K A;  4O44 A;  1TV6 A;  1ZBU A;  4RW6 A;  4Q5V A;  4FZX C;  1U49 A;  2RKI A;  1RIL A;  3I8D A;  1L5U A;  4KPY A;  1U45 A;  4CJK A;  3VA0 A;  1J9A A;  3SV3 A;  2OA8 A;  4C8K A;  1JXB A;  3E01 A;  1GOC A;  3LAM A;  3TAQ A;  3VQ7 A;  3V9W A;  2YKM A;  1C1B A;  3I0S A;  4B8C A;  1N6Q A;  3HP9 A;  4KRF A;  3TR8 A;  4F8R A;  3EY1 A;  4KHY A;  3HL8 A;  1Z26 A;  4BAC A;  1IG9 A;  1JLA A;  4CHN A;  3L2Q A;  1YT3 A;  4CCH A;  1S5J A;  3NH2 A;  4CEO A;  1TKZ A;  1MU2 A;  2B4J A;  3TAM A;  2O4I A;  1BHL A;  3WNG A;  3QEP A;  3V1R A;  2BE2 A;  1D9F A;  4FZZ A;  3K5L A;  2OZS A;  3PUF A;  2P1J A;  3M8S A;  4DS5 A;  4B9V A;  1X9S A;  2X74 A;  3QLH A;  4JRQ A;  2RPI A;  1C6V A;  1VK0 A;  5FRO A;  4E7H A;  5EU7 A;  4DFP A;  2G8U A;  4M3X A;  1VSM A;  3SPY A;  4ELU A;  2JLE A;  4PA1 A;  4CJV A;  4RW8 A;  4CFB A;  3HPO A;  3QET A;  2A1R A;  3NH0 A;  4DSK A;  1W0H A;  4E19 A;  4DS4 A;  1HRH A;  2YHA A;  2I5J A;  4CJL A;  3AO5 A;  2Z1I A;  2KFZ A;  4JRP A;  3HPG A;  3K58 A;  3KLE A;  4BWJ A;  5CZ1 A;  4RW4 A;  1C0M A;  2KQ2 A;  3ZSR A;  3ZT1 A;  5KRT A;  4DTN A;  2BDP A;  1RBR A;  1SV5 A;  3ZCM A;  4DSE A;  1CZ9 A;  2HNY A;  4CGD A;  1GOB A;  1ZBL A;  4B9N A;  4QOZ B;  4FLT A;  2G8V A;  4K8X A;  4KI4 A;  3G0Z A;  4DLG A;  1IH7 A;  1S6Q A;  2QKB A;  1NKC A;  3K5M A;  1RT7 A;  3O4N A;  3QES A;  1NOY A;  4Z4H A;  1RNH A;  1YTA A;  3EZ5 A;  3V9Z A;  3FFI A;  4CFD A;  4W5O A;  4M3W A;  4FJL A;  2XY7 A;  1RTI A;  3WNE A;  4DU1 A;  4B8A B;  3AVN A;  4KB1 A;  3OYI A;  1WN7 A;  3RMD A;  3HPH A;  4YNQ A;  3KLG A;  1SL2 A;  4EZ6 A;  1JL1 A;  1Q9Y A;  2IAJ A;  3CFP A;  4ID5 A;  1TGO A;  4DQR A;  1IKY A;  4FLZ A;  4DTU A;  3DMJ A;  4AHV A;  2XO7 A;  2F8T A;  3U3Y A;  3SI6 A;  4AHS A;  1L3V A;  4KI6 A;  4ID1 A;  3LZJ A;  1HNI A;  3AA3 A;  1K6Y A;  1NK0 A;  4FW2 A;  1LAW A;  1JLF A;  3QER A;  1EET A;  3MEG A;  4MQ3 A;  4CIF A;  3WNH A;  3CM6 A;  3QEI A;  1RDD A;  2PYL A;  4FJI A;  4CEA A;  3V1Q A;  2XHB A;  3LPU A;  4CEC A;  4PWD A;  3IG1 A;  5C25 A;  4O0J A;  4Y1C A;  2HHS A;  3BDP A;  3B6P A;  3ZSY A;  3LWL A;  2DFH A;  3A2F A;  4CF1 A;  4FJ9 A;  2D0B A;  1JLE A;  1KVC A;  3L2U A;  1HMV A;  4DQS A;  4FJH A;  3MAQ A;  1L3U A;  3DRS A;  4CF8 A;  3PX6 A;  3ZT2 A;  1A5X A;  3D45 A;  4DTO A;  5J2Q A;  4BE0 A;  4AH9 A;  4ZTF A;  5KRS A;  4FM0 A;  2X6N A;  3HYF A;  5HRO A;  4BDY A;  1JLC A;  1SUQ A;  4HUG A;  1HYZ A;  3SUP A;  1JXE A;  1QS4 A;  2KW4 A;  4CEB A;  3D0P A;  1T7P A;  4GW6 A;  2R7Y A;  4FJ7 A;  1Y97 A;  1BL3 A;  1B92 A;  2Y1I A;  3NGY A;  3AA4 A;  3O3H A;  1WSE A;  1U4B A;  4AHC A;  4DSI A;  3M8R A;  1UA0 A;  1LWF A;  1A5W A;  2ITG A;  4C8L A;  3QO9 A;  4DSL A;  4HCC A;  3OYK A;  4ZHR A;  3AVL A;  4DTP A;  4IG3 A;  4CK3 A;  4OPK A;  3IS9 A;  4O0I A;  4FK0 A;  1LWC A;  2Z1G A;  3L8B A;  5FRM A;  5HRN A;  4CED A;  1ITG A;  1IKW A;  1HQU A;  1LW0 A;  3VQQ A;  2X78 A;  1YVU A;  4IFV A;  4CFA A;  1NK9 A;  1QSY A;  3PO5 A;  1G15 A;  3LP2 A;  4FJX A;  2D0A A;  3AV9 A;  2HVI A;  1BIZ A;  4KKO A;  4CJ3 A;  3AVC A;  3OY9 A;  1RBV A;  4FLY A;  3AVJ A;  1TVR A;  1XI1 A;  3PX4 A;  3L3V A;  1VSH A;  1U48 A;  1Q9X A;  3ZT4 A;  4TSX A;  4FYD A;  2OYQ A;  4ELT A;  1KFS A;  5JS2 A;  1LAV A;  4N56 A;  1X1P A;  1TK8 A;  4FLV A;  2LSN A;  4B9U A;  4F3O A;  1KLM A;  3QIP A;  3NCI A;  5J2M A;  1REV A;  4CJF A;  1JLQ A;  4FJM A;  4B3O A;  5JS1 A;  4KB0 A;  3LWM A;  2Q3S A;  1J53 A;  4F3T A;  4F4K A;  4CES A;  2WOM A;  4CE9 A;  2IC3 A;  4H4M A;  3O3F A;  2P5O A;  4FK4 A;  1KLN A;  3HST B;  4KTZ A;  3K5N A;  3HVR A;  1XWL A;  1XC9 A;  4RW9 A;  1RT5 A;  5HRS A;  2G8I A;  4CEE A;  4E1N A;  3KD1 E;  3EYZ A;  4CJR A;  3OYL A;  4PY5 A;  3HVT A;  3OS1 A;  1HNV A;  2E6L A;  2B6A A;  3F73 A;  4W5R A;  4J2A A;  3CFO A;  4BE1 A;  5SWM A;  3P83 D;  4IBN A;  4FLX A;  2G8W A;  3NF8 A;  3H08 A;  4KHW A;  2OPS A;  1L3T A;  5J1E A;  3OYJ A;  4EZ9 A;  2HVH A;  4IG0 A;  3QNO A;  3AVB A;  2FBV A;  2OZM A;  1ZYQ A;  3UIQ A;  1C1A A;  1B9D A;  1EX4 A;  4MFB A;  5CY4 A;  3LZI A;  3DLB A;  1EXQ A;  3C6T A;  3S3N A;  1NOZ A;  2P5G A;  4KAZ A;  2HHW A;  4KO0 A;  3OJU A;  1VSK A;  1ASW A;  1NJZ A;  5K14 A;  3JYT A;  4OGC A;  2PYJ A;  1TKD A;  1LWE A;  3MXJ A;  3O4Q A;  4B9M A;  5FDL A;  2YHB A;  4CK2 A;  1VSE A;  3RRH A;  3V6D A;  3NBP A;  3AO2 A;  5CYQ A;  3LDS A;  3S3M A;  4N76 A;  1BQN A;  2F8S A;  3NH1 A;  2HW3 A;  3DOK A;  1NK8 A; 
#chains in the Genus database with same CATH topology
 4DTX A;  2A1S A;  4I2P A;  4BRH A;  3TAG A;  4LF6 K;  2IVP A;  2XRI A;  3KVG A;  3VQP A;  3QBW A;  4CJE A;  4DTM A;  2CGK A;  2ZJP L;  4IOC L;  4BGB A;  1QTM A;  4A61 A;  2ZJR L;  1XNQ K;  2GX9 A;  4JLH A;  2PZS A;  4B1V A;  2O8F A;  3D6R A;  1YJW N;  1C1C A;  3NFA A;  4ELV A;  3OYM A;  3SQ2 A;  3BZK A;  3QIO A;  1BGX T;  3CG7 A;  3OS0 A;  2WUS A;  4FCY A;  4JS5 A;  1NJW A;  1D8Y A;  4OPJ A;  5M1F A;  3L2R A;  4RW7 A;  4BC2 A;  4BRI A;  4I9Q A;  1NJX A;  4CZF A;  4CER A;  1EP4 A;  1NGB A;  5F2R A;  3RWU A;  4NCA A;  2DFE A;  3QBX A;  4KTW A;  3AVF A;  2YNF A;  1ASV A;  4HHT A;  5SZT A;  4LF9 K;  2D5R A;  3M5R A;  3GBT A;  3PO4 A;  4CZG A;  2P9S A;  3AVG A;  4BC3 A;  3U9Z A;  1KVA A;  3QFU A;  3L0Q A;  4BRK A;  1I94 K;  4PUO A;  1QQC A;  4DFM A;  3ZT3 A;  3EZW A;  3WNF A;  3WXI A;  4YFU A;  4E3S A;  4BR2 A;  4YOV A;  3MN6 A;  1T8E A;  1EWR A;  4FLW A;  4IEE A;  4H8K A;  4CJT A;  1JLG A;  1LCU A;  1YTU A;  1BA1 A;  5C12 A;  3ZSO A;  3ZET A;  1U04 A;  5B8H A;  4DTR A;  3LPT A;  4FPA A;  3OYF A;  1RDC A;  1Z05 A;  1FKO A;  4UQG A;  2UYT A;  3TTC A;  4E7K A;  4KFB A;  4H03 B;  4BR9 A;  4N5S A;  5I42 A;  1J5O A;  4AM7 A;  4OKK A;  3KK2 A;  3KLF A;  3Q7C A;  3KLH A;  4DV0 K;  3SBT A;  4NLC A;  4CW7 B;  1D5A A;  1KTQ A;  3SAF A;  4KHN A;  4OVL A;  1OH8 A;  4MDB A;  1I3A A;  4DF4 A;  4H4O A;  4GMJ B;  3LDO A;  1IBK K;  4J2B A;  4DHY A;  2F9W A;  1TK0 A;  2OPP A;  1T3V A;  3DXM B;  3TWH A;  2HB5 A;  4OKE A;  4DQQ A;  4CI6 A;  3VQC A;  4OX9 K;  3UB5 A;  2UUC K;  4QS9 A;  2E4L A;  3SPZ A;  2OTJ N;  4BG9 A;  1X3M A;  1BIU A;  5AZJ B;  2E88 A;  1S1V A;  4WF9 L;  1BO5 O;  3KHY A;  3HO1 A;  1XUP O;  3DJC A;  4FM1 A;  4DQI A;  3U6F A;  4BRL A;  4ICL A;  3O6W A;  3RTV A;  1VSD A;  1NGC A;  4CZI A;  3R3L A;  3BEX A;  3ZX0 A;  4CF0 A;  4JKA A;  2FBT A;  4H5N A;  4K41 A;  1SKR A;  4HTL A;  1JJ2 M;  1BG3 A;  3ZSV A;  2KKZ A;  1ESV A;  4BR4 A;  3TAF A;  3HK2 A;  4H5W A;  4I6M A;  4DSJ A;  2QXF A;  1WSG A;  4FZY A;  5HL7 L;  3GE1 A;  3ZYY X;  3I0R A;  4GVM A;  1XQS C;  3HT3 A;  4LH4 A;  3A5M C;  1XHZ A;  3LP3 A;  3VQB A;  4WFA L;  5FPN A;  4M41 A;  5GAH P;  3SUO A;  2OPQ A;  2YCH A;  3NAE A;  3MXM A;  3MED A;  1DLO A;  1JLB A;  3G10 A;  1NKE A;  4AM6 A;  3VF4 A;  4CJQ A;  1A5V A;  1IO2 A;  1TYQ B;  3VQD A;  4R5P A;  4BVP A;  3OYN A;  1BCM A;  1RT3 A;  3GL1 A;  5JIC A;  3CXC M;  1T03 A;  4M3R A;  4BVO A;  2BTF A;  3BF3 A;  4B1W B;  1FXX A;  3U8X A;  2XY8 A;  4WQ4 C;  4JS4 A;  1VQ7 N;  3TAB A;  3ZSW A;  4DF8 A;  4Y0W A;  1ASU A;  3L2W A;  2YX6 A;  4CEZ A;  4NLB A;  3N4P A;  4IDK A;  4OLB A;  4QAG A;  1NK5 A;  1X9W A;  5JLF A;  3LAN A;  4HCB A;  4BRD A;  3NF7 A;  4CF9 A;  2P9I B;  2Q1N A;  3SMP A;  2YKN A;  5HRP A;  3VQ4 A;  4PKI A;  4GV9 A;  4FXD A;  5C24 A;  2HHQ A;  1L3S A;  3MX5 A;  2W6K A;  1VHX A;  4WFN L;  2PBD A;  4PKG A;  3A0I X;  1DTQ A;  3CCS N;  1MWM A;  1ZBH A;  2Q0U A;  1NGI A;  2W40 A;  4XIU A;  3WXM B;  1RBU A;  3V4I A;  3SUN A;  1S9E A;  1K8A O;  3LP1 A;  3HXM A;  1W9H A;  2G8K A;  2KHO A;  4MDA A;  3JSM A;  3CMA N;  3K9J A;  4Z94 A;  2WC9 A;  4AHU A;  1TV6 A;  3MX2 A;  4RW6 A;  1GLF O;  1U49 A;  4PHT X;  1RIL A;  4KPY A;  4CJK A;  3VA0 A;  1J9A A;  3LAM A;  1N6Q A;  1C1B A;  3HP9 A;  4F8R A;  1NLV A;  3AAR A;  2GWK A;  4OO1 J;  1TKZ A;  1BHL A;  3V1R A;  2BE2 A;  4OPH A;  4B9V A;  1X9S A;  1Q7Y O;  4JRQ A;  1S72 N;  3S41 A;  2RPI A;  1C6V A;  5FRO A;  5BRF A;  4E7H A;  4DFP A;  3VEO A;  2E2P A;  4M3X A;  1ATS A;  1W0H A;  2UU9 K;  2FF6 A;  4DS4 A;  2O8B A;  1T44 A;  5AZI A;  2P9L A;  4B3T K;  5CZ1 A;  3VF6 A;  3ZSR A;  1NNE A;  3F9M A;  3VER A;  4DSE A;  5KQD A;  1ZBL A;  4B9N A;  2G8V A;  3CJA A;  1NOY A;  3EZ5 A;  3FFI A;  4M3W A;  4W5O A;  3WNE A;  4DU1 A;  3VEX A;  1SL2 A;  3KLG A;  4DV7 K;  4DV4 K;  1GLE G;  4JI0 K;  4ID5 A;  3UE5 A;  1IKY A;  1M1K O;  3SI6 A;  3FZK A;  1L3V A;  4KI6 A;  5AQL A;  4ID1 A;  3THW B;  3HI0 A;  1HNI A;  4FWP A;  4JHD A;  1JLF A;  3IMX A;  3MN7 A;  4A57 A;  1J6Z A;  3WNH A;  3CM6 A;  3QEI A;  4FSV A;  2PYL A;  4CEA A;  3SMS A;  3WQT A;  3THY A;  4PWD A;  4O0J A;  5AJ3 K;  2HHS A;  5JLH A;  2F4V K;  2ZM6 K;  4CF1 A;  3L2U A;  4FJH A;  4GNI A;  4CF8 A;  3PX6 A;  3D45 A;  1JLC A;  1T7P A;  1QS4 A;  2KW4 A;  4KBO A;  1T6D A;  3D0P A;  4FJ7 A;  4FWN A;  2V7Y A;  1Y97 A;  1BL3 A;  4WCE L;  3NGY A;  1YJN N;  2QWO A;  1DT9 A;  3O9U A;  2ITG A;  1WOQ A;  3QO9 A;  4HCC A;  3AVL A;  3HSC A;  4FWQ A;  4CK3 A;  4DTP A;  4FK0 A;  1LWC A;  2NRW A;  2CH5 A;  3KWG A;  2NRX A;  4YY3 K;  3ENH A;  4ILH A;  3L8B A;  5HRN A;  4CED A;  3O5B A;  1E4G T;  3VF2 A;  1NK9 A;  3PO5 A;  1Y64 A;  1HNX K;  4KKO A;  3AVC A;  3NVK A;  2P9K A;  2ITM A;  1IV0 A;  3RVC A;  1U48 A;  4YDU C;  1KAZ A;  2QWM A;  4FLV A;  5FPD A;  4H0V B;  4CJF A;  1JLQ A;  2Q3S A;  4F3T A;  4CES A;  3E9P A;  4CE9 A;  4H4M A;  3D2E B;  2P5O A;  4FK4 A;  3HST B;  3J7Z O;  3K5N A;  3HVR A;  5BPN A;  4AF1 A;  3EYZ A;  4CJR A;  1T6C A;  3HVT A;  3OS1 A;  1HNV A;  2Q36 A;  1K8K A;  3OYJ A;  4K25 A;  5AFU H;  5FLX O;  3AVB A;  3IKM A;  1EX4 A;  3O8M A;  4X66 K;  3DLB A;  4H5V A;  1NOZ A;  3CD6 N;  4ISF A;  1VSK A;  3CME N;  3JYT A;  5E26 A;  1LWE A;  4HWI A;  3F2K A;  4U7B A;  2VGM A;  5FDL A;  4N76 A;  4NCB A;  5CYQ A;  2D0O A;  1BQN A;  3UKR A;  1KVB A;  2HMI A;  1W97 L;  3TI0 A;  3T3F A;  2QI2 A;  4IKF A;  4FVM A;  4K42 A;  1WSI A;  4RTF D;  2D4W A;  2UXC K;  4IWV A;  1QE1 A;  1KCF A;  3KZB A;  3ZX2 A;  4F2R A;  3KJV A;  3HZ6 A;  3KKS A;  3MXI A;  3J8A A;  3MN9 A;  3V1O A;  1IKV A;  4LFC K;  2IGI A;  4O8U A;  2F7T A;  1IG8 A;  4H0X B;  3PV8 A;  1WBD A;  2ZF5 O;  2VG6 A;  3FZH A;  4DV6 K;  4BDP A;  3MN5 A;  3NF6 A;  2E1Y A;  5GAE P;  4NCG A;  3N4Q A;  2O8F B;  1TUU A;  3FLC O;  4CGI A;  3BY5 A;  3IRX A;  4PQU A;  3S3O A;  4M3Y A;  2OPR A;  4BRO A;  5A2Q O;  3ENB A;  4CJU A;  4AHT A;  3TU5 A;  5FRN A;  2YHX A;  3ZSQ A;  1VRU A;  3LM9 A;  4B3S K;  3H46 O;  3I55 N;  4OLA A;  5AQM A;  4CHP A;  5D3G A;  4C1N K;  3I33 A;  3RMA A;  1IBM K;  4CHO A;  5BR8 K;  5KGW A;  3QEX A;  1XC3 A;  4H5R A;  2O8E A;  4CGF A;  2YJE A;  4EP4 A;  1BQM A;  4B08 A;  4CEQ A;  1W2B M;  3SAG A;  3NHG A;  2B5J A;  2BUP A;  2P9S B;  3CJB A;  4OKJ A;  5M1O A;  4RG8 A;  2ASP A;  2YNG A;  3L4I A;  1FK9 A;  3NE6 A;  5DMR A;  3TPQ A;  3CPW M;  4NB4 A;  4Z4F A;  4BRG A;  4FWK A;  1X9M A;  3VQ6 A;  1D9D A;  4MLE A;  3QNN A;  2QK9 A;  4YOU A;  4FPB A;  4K43 A;  4B1U B;  4OGE A;  3O4W A;  1NGF A;  3DRP A;  3B8A X;  2D0C A;  3KD5 E;  3DOL A;  4CIG A;  4H0O A;  5CZ2 A;  5HBM A;  3OYA A;  4CZE A;  3TAN A;  5KI6 A;  1VRT A;  2Z1J A;  3C65 A;  4WE1 A;  4CD3 A;  4W5Q A;  3M8P A;  3HP6 A;  1HPM A;  4E0D A;  1KQS M;  3CHW A;  2QXL A;  3AVM A;  4N47 A;  1I39 A;  4DQP A;  5GIP A;  2GV9 A;  2ZD1 A;  1SKS A;  3VN5 A;  3CCQ N;  2V52 B;  4DG1 A;  3OW2 M;  3VOV A;  1LW2 A;  1HR0 K;  4JI7 K;  4BC4 A;  2JWL A;  3TAE A;  3SQ0 A;  3CJC A;  3K5O A;  4KHQ A;  4B9L A;  3FZF A;  4CGH A;  4DCH A;  2I7N A;  3LAK A;  4CHQ A;  4FWM A;  3CF5 L;  2FC0 A;  1NGD A;  2HHU A;  3TSU A;  1IKX A;  2VWB A;  4DB3 A;  3KK7 A;  1GLA G;  3EN9 A;  3H3O B;  1QHT A;  3ZEU A;  5BPL A;  4BDZ A;  2VG5 A;  3DWL A;  1V4T A;  1OH6 A;  4DUY K;  4E7L A;  1IBL K;  1S9G A;  3AVH A;  4FL9 A;  5GIN A;  1OVY A;  3BGR A;  1MDU B;  2VCP A;  2HF3 A;  4CGG A;  2ETJ A;  5JS1 A;  3K57 A;  3DLR A;  1ZBI A;  2HOE A;  3ID6 A;  3KIO A;  1XNR K;  4K0K K;  1WSJ A;  1F21 A;  3UKU A;  3RSE A;  2AA4 A;  4I6M B;  4FM2 A;  4Q0B A;  1KRP A;  3M6G A;  4BRM A;  5KPR A;  1CXU A;  2FBY A;  3WUH A;  1HKC A;  1ATR A;  4DTJ A;  3LAL A;  3CI5 A;  1SQK A;  3F5T A;  4HUF A;  4KTQ A;  3KK3 A;  1JCE A;  1SL1 A;  1LOT B;  3OBY A;  1CLQ A;  5GAG P;  2KFN A;  5C0Y A;  4DV2 K;  3V81 A;  5AQG A;  3WT0 A;  3DXK A;  1OH5 A;  1RBS A;  3T69 A;  4LSL A;  3H45 C;  4CJ4 A;  1WB9 A;  3KTQ A;  2A42 A;  3KWI A;  3R6M A;  2HHX A;  2Q0R A;  2NRV A;  3NDK A;  5AQJ A;  3DLG A;  2Q97 A;  1ZXO A;  2ZQB A;  2FBX A;  4PL8 A;  3THV A;  1KAX A;  4E89 A;  4CIE A;  4OPA A;  3IUC A;  4J2D A;  3CER A;  1N34 K;  3EEQ A;  3WEE A;  2QM1 A;  4EIA A;  1RDW X;  2HNZ A;  5EY4 A;  5HOO A;  4YDU A;  5LJV A;  4FOI A;  1S1X A;  4V19 S;  2HHT A;  2YJF A;  3K9K A;  4JNE A;  5I9E B;  3WXJ A;  4LF4 K;  4DU3 A;  2ZGZ A;  1H1V A;  1ZBU A;  3AAP A;  4JK7 A;  4O44 A;  4YOR A;  3GG4 A;  4JKH A;  1NMD A;  3LDQ A;  4CD1 A;  1KD1 O;  1GOC A;  3LDP A;  3R1X A;  3VQ7 A;  3V9W A;  4A2B A;  4KHY A;  3HL8 A;  3OTO K;  4BAC A;  3EE9 A;  1HNZ K;  4G9Z A;  4CEO A;  3J80 O;  1MU2 A;  4UY8 O;  4GY2 B;  3QEP A;  4JV5 K;  5AR0 A;  2OZS A;  1Q82 O;  3PUF A;  3ULE B;  3P38 A;  2A3Z A;  2FLO A;  2G8U A;  4NO7 A;  4CJV A;  3QET A;  4DSK A;  4CJ7 A;  2I5J A;  2KFZ A;  3FR0 A;  1C0M A;  3TTF A;  3ZT1 A;  3ZCM A;  2HNY A;  1GOB A;  4QOZ B;  4K8X A;  4R79 A;  4KI4 A;  3G0Z A;  1IH7 A;  3WXK A;  2QKB A;  3QES A;  4CZM A;  1X3N A;  1RNH A;  5LJW A;  4CFD A;  2XY7 A;  1Q18 A;  4DR7 K;  1GLJ O;  3AVN A;  4KB1 A;  4YNQ A;  1RFQ A;  2H3G X;  4JKC A;  4EFH A;  2DPN A;  2IAJ A;  2O8B B;  4DQR A;  1TGO A;  4DTU A;  5AZI B;  4AHV A;  2P9L B;  2VQE K;  4FOE A;  1K6Y A;  2P9U A;  3MCA B;  1NG9 A;  3OA9 A;  1EET A;  4MQ3 A;  3NMU A;  1TUY A;  2NRH A;  5LY3 A;  3V1Q A;  3LPU A;  3IG1 A;  5BRE A;  4QS8 A;  1XMQ K;  3BDP A;  3VET A;  3LWL A;  2D0B A;  1KVC A;  3CET A;  3SBG A;  1HMV A;  4DQS A;  1M90 O;  2HHH K;  1KC8 O;  4BE0 A;  4AH9 A;  3G6E N;  1VAZ A;  2KLA A;  2HST A;  2X6N A;  3QFP A;  5HRO A;  1HYZ A;  3MMV A;  1JXE A;  4CEB A;  3W3D A;  4JHD B;  4XH4 A;  1P90 A;  1WSE A;  1C0G A;  3M8R A;  3THY B;  1OH7 A;  4ZHR A;  4CVN E;  3CCJ N;  2UUA K;  1IKW A;  3VQQ A;  5EOY A;  4JD2 A;  1YVU A;  4CFA A;  1NWK A;  1G15 A;  4JKG A;  1BIZ A;  4CJ3 A;  3CJ9 A;  3ULE A;  3HBT A;  3AVJ A;  1TVR A;  1BOT O;  1XI1 A;  3PX4 A;  4JI2 K;  1Q9X A;  5AQO A;  3ZT4 A;  5AQY A;  4BRE A;  1NGG A;  4GV6 A;  5JS2 A;  1LAV A;  2LSN A;  1NU0 A;  4F3O A;  1KLM A;  2FSK A;  3O9S A;  3QIP A;  1REV A;  4B3O A;  4BGA A;  4FWO A;  4DV1 K;  1NM1 A;  4F4K A;  3O3F A;  4BR0 A;  4XEI A;  4KTZ A;  5HRS A;  1RT5 A;  4CBX A;  4NXN K;  4DR5 K;  3OYL A;  2B6A A;  4W5R A;  2P9K B;  4FLX A;  4BE1 A;  4IBN A;  1Q86 O;  2G8W A;  2OPS A;  5J1E A;  2HVH A;  1VQK N;  1U6Z A;  3UIQ A;  3LZI A;  2IVN A;  1EXQ A;  3S3N A;  4KAZ A;  2VYP A;  2UXD K;  2HHW A;  4KO0 A;  3OJU A;  3PSF A;  5AQF A;  1GLB G;  2PYJ A;  3MXJ A;  4YOW A;  1YUW A;  3A5O C;  3S3M A;  3NBP A;  4DKW A;  3NH1 A;  3DOK A;  2OTL N;  3SZ2 A;  4B9S A;  2IS3 A;  5AQW A;  3RRG A;  1K8K B;  1RDA A;  3ENO A;  1C0T A;  4DU4 A;  3OS2 A;  1WSH A;  5DK5 A;  1HJR A;  2XY5 A;  4K8Z A;  4U67 L;  1S1T A;  1UOC A;  3EO3 A;  3WXL A;  1NGJ A;  3VMF B;  3L6Q A;  5E84 A;  4X62 K;  4JKF A;  1Q81 O;  4KH4 A;  3ITH A;  1QSS A;  1JCF A;  3O08 A;  2YI1 A;  2KZZ A;  1YF5 L;  1BU6 O;  4LF7 K;  5HRR A;  1GLC G;  3UKR B;  3P5J A;  3E9O A;  3ASM A;  2OCE A;  5LMU K;  1OKJ A;  3OHR A;  4XH1 A;  3CC2 N;  4DMN A;  2P9N A;  4JAX A;  2DFF A;  3IFR A;  4BWM A;  5M1K A;  1QVG M;  4IEI A;  1EKE A;  4O4G A;  1NJI O;  4C1N I;  1VQ6 N;  1ZBF A;  1RBT A;  4M3T A;  3DI6 A;  2WON A;  2QWR A;  1Z25 A;  2RHK A;  2VGN A;  3G4S N;  2ZE2 A;  3CM5 A;  1RT1 A;  1NK7 A;  3DM2 A;  4FO0 A;  4CJS A;  5E41 A;  4KHS A;  3TAR A;  2GBZ A;  5F0X A;  3M1F A;  5F1X A;  5HP1 A;  2ASO A;  3FGU A;  2VG7 A;  4OJR A;  1WSF A;  1K73 O;  4N41 A;  2XY6 A;  1QZ6 A;  4LF8 K;  1W7A A;  4Z4E A;  1SZ2 A;  5FPE A;  1RCH A;  5EVZ A;  1RTH A;  4PL7 A;  1DEJ A;  4W5N A;  1QQM A;  3TAP A;  1TL3 A;  5GIO A;  3VQ8 A;  2OAN A;  3E66 A;  4IFY A;  5M1Q A;  3VQA A;  4FJG A;  3CCR N;  3J7A P;  3SAH A;  4HTU A;  5DM6 L;  4CHZ A;  4B1Z A;  1LV5 A;  3AAQ A;  2O8E B;  1B9F A;  4G1Q A;  2O8D A;  3LP0 A;  1RT2 A;  3CIP A;  1BI4 A;  2QKK A;  4NYN A;  3TSP A;  3ULD A;  2NLX A;  5FPM A;  2PFU A;  1WAJ A;  1RDB A;  3V9U A;  4CZJ A;  2ZWH A;  2IDO A;  4FWS A;  3EL2 A;  3ZSX A;  4JK9 A;  2O8C A;  3OYG A;  5AQP A;  3OBW A;  3KK1 A;  1TL1 A;  3VES A;  4X65 K;  4B1X B;  4FK2 A;  3THX A;  1QQN A;  2WBN A;  1C0U A;  3MEE A;  4M45 A;  4DUZ K;  3CYM A;  2HBM A;  3D2F A;  5BN9 A;  3K59 A;  3VEV A;  5AQH A;  4M7X A;  3FZL A;  5CYM A;  4DLE A;  2BAN A;  4KHU A;  1KXP A;  2Q31 A;  4EHU A;  2KZM A;  4E7J A;  1VSJ A;  1VSL A;  2W41 A;  2YNH A;  1E3M A;  4HVJ A;  3CJ1 A;  4CJP A;  4FJK A;  2P9P A;  3JAM O;  4BRA A;  5I3U A;  3QEW A;  1EQY A;  1YIJ N;  4M7Y A;  4DQ8 A;  4B9Q A;  1T05 A;  1N36 K;  3QIN A;  1ILY A;  3V9S A;  4DWI A;  1S6P A;  3C95 A;  4GVE A;  3KKR A;  4JYA K;  4RWT A;  5GAD P;  2YNI A;  3ATV A;  2ASM A;  4CFC A;  3S9H A;  2OA8 A;  1CZB A;  3M8Q A;  2UUB K;  2NZT A;  4M42 A;  3ZEU B;  1RT4 A;  1OVQ A;  4E7I A;  4JI5 K;  2IIR A;  4AHR A;  2Y1J A;  1R59 O;  5HLF A;  4LFA K;  5BN8 A;  2Z1H A;  3CFR A;  3VQ5 A;  4AIL C;  4DR1 K;  2D0P A;  2NRT A;  4O55 A;  3AY9 A;  4O5F A;  2P51 A;  4BQL A;  5BRH A;  1YXQ A;  1XHX A;  1NGE A;  4DFJ A;  3UKU B;  3KLI A;  3RSE B;  1NKB A;  4B9T A;  4EP5 A;  4NYF A;  4A62 A;  4C8N A;  3DLK A;  1NMN A;  4CF2 A;  3DLH A;  3VGL A;  1E4F T;  2FF3 B;  2GUI A;  2VQF K;  5C10 A;  3K2P A;  3P1G A;  3IAY A;  4CZH A;  3T1Y K;  2NUB A;  2CH6 A;  4M3Z A;  5EX5 A;  4DFK A;  4IO9 L;  1S3X A;  2A40 A;  3O1W A;  3AO1 A;  4A59 A;  2GEL A;  2JWK A;  3OJS A;  1ZBS A;  3T1A A;  3T1H K;  2D1K A;  3DXK B;  2EHG A;  5C15 A;  4LSN A;  4DSF A;  2G8F A;  4CEF A;  4KV8 A;  4LF5 K;  1XMO K;  1JL2 A;  3F9K A;  2RKI A;  3I8D A;  1L5U A;  2ZJQ L;  3SV3 A;  3SLC A;  3E01 A;  3A8Y A;  1MA9 B;  4B8C A;  3WEE B;  1HLU A;  3TR8 A;  3EY1 A;  1Z26 A;  4BR5 A;  3L2Q A;  4IOA L;  4CCH A;  1S5J A;  3CJ7 A;  3NH2 A;  2B4J A;  2O4I A;  3WNG A;  3MWT A;  1D9F A;  3ID8 A;  3K5L A;  2E2N A;  3E9L A;  3M8S A;  3D7E O;  2X74 A;  3QLH A;  3HOT A;  2J4R A;  1O13 A;  1HKG A;  5EU7 A;  4E1J A;  4B3R K;  5ADX A;  4PA1 A;  4RW8 A;  4CFB A;  3HPO A;  2A1R A;  4CZL A;  3NH0 A;  1YJ9 N;  4E19 A;  2YHA A;  4CJL A;  3AO5 A;  2Z1I A;  4JRP A;  3K58 A;  1V4S A;  2WFB A;  1MWK A;  4BWJ A;  4RW4 A;  4DTN A;  2BDP A;  4KH5 A;  1SV5 A;  1CZ9 A;  3DLL L;  3MDQ A;  1BA0 A;  4H0P A;  3O4N A;  4Z4H A;  1YTA A;  3C7N A;  5AQV A;  4FJL A;  1RTI A;  1J5E K;  4LC9 B;  3O80 A;  5CE3 A;  3OYI A;  1WN7 A;  5AQQ A;  3RMD A;  1RDU A;  2HBK A;  1Q9Y A;  3WQU A;  3CFP A;  4FLZ A;  4B3M K;  3U3Y A;  4AHS A;  3LZJ A;  3U9D A;  1NK0 A;  4FW2 A;  5AQX A;  4CIF A;  4FJI A;  1RDD A;  5EXW A;  2XHB A;  5LMN K;  1U2V A;  3IDH A;  4Y1C A;  1HUX A;  3B6P A;  4BY9 C;  2DFH A;  3A2F A;  1L3U A;  3ZT2 A;  3O1B A;  1A5X A;  4GKK K;  5J2Q A;  3HYF A;  4A5A A;  3EKS A;  4JK8 A;  2HMP A;  4GW6 A;  2R7Y A;  2P9U B;  3CCL N;  3K0S A;  3VEY A;  3P31 A;  4WYB A;  3O3H A;  4C8L A;  1A5W A;  4DSL A;  3OYK A;  2IVO A;  1DGK N;  3BP8 A;  4O0I A;  2ZGY A;  2Z1G A;  4JKB A;  4LFB K;  5JVH L;  4BRF A;  4GV3 A;  3VGM A;  1HQU A;  1LW0 A;  4IFV A;  1G99 A;  4L3Q A;  4FJX A;  2D0A A;  3OY9 A;  4CZK A;  4FLY A;  2CGJ A;  4TSX A;  1X9J A;  4FYD A;  4BC5 A;  4ELT A;  1KFS A;  4N56 A;  1X1P A;  3J81 O;  1TK8 A;  4B9U A;  3BF1 A;  1VQM N;  3LL3 A;  3NCI A;  5J2M A;  4IJN A;  1QQO A;  3P39 A;  2GUP A;  4JD2 B;  4C23 A;  4RW9 A;  2G8I A;  4JKG B;  3KD1 E;  1S22 A;  4PY5 A;  2GWJ A;  4JI3 K;  3F73 A;  1NGA A;  3SK3 A;  4DR4 K;  3CFO A;  5SWM A;  5AQZ A;  2A5X A;  1VQL N;  4KHW A;  1L3T A;  3VEN A;  3QNO A;  4WQ5 C;  1ZYQ A;  3QB0 A;  1B9D A;  4MLH A;  4ISE A;  4MFB A;  5CY4 A;  1WBB A;  1EWQ A;  3L4Q A;  1ASW A;  1YVN A;  3CQX A;  3O4Q A;  3M3Z A;  4B9M A;  5KPT A;  1QVF M;  3VGK A;  3V6D A;  5C2F A;  3RRH A;  3AO2 A;  5CR4 A;  1N32 K;  1NK8 A;  1SKW A;  1KFD A;  4I2Q A;  4FJN A;  4DV3 K;  4DR3 K;  5AQI A;  3OYH A;  4CBU A;  5CHI A;  4H0T B;  2DY4 A;  2HBL A;  1GOA A;  3C94 A;  5AQS A;  3SCX A;  4BR7 A;  2VWJ A;  1VQN N;  3ZLJ A;  3CCU N;  1SAZ A;  4BQZ A;  2G8H A;  3PIP L;  2PAV A;  1FW6 A;  5ELZ A;  3SNN A;  3HTV A;  3SQ4 A;  4NXM K;  1JKH A;  1DTT A;  2CGL A;  1FKP A;  4JKE A;  3HOS A;  3G71 N;  3VA3 A;  2X6S A;  3SUQ A;  3T19 A;  2DTU A;  4LH5 A;  1K9M O;  1NJY A;  4IDH A;  2GEM A;  3L2V A;  3V9X A;  4I7F A;  4WFB L;  1WAF A;  4FWR A;  1NGH A;  4QCL A;  2V51 B;  2EX3 A;  3VEW A;  3OVN A;  3FE1 A;  3MWP A;  4JI4 K;  1VSF A;  4CJ5 A;  4LD0 A;  4ZTJ A;  3TSQ A;  1Z6R A;  4W5T A;  1ZC6 A;  3VEZ A;  3VQE A;  3O3G A;  1UAX A;  4FZZ A;  1S1W A;  1HYS A;  3OYC A;  1N33 K;  5LL6 Z;  3RMC A;  1TKT A;  3CQ8 A;  5H1S Q;  3OYE A;  3LDN A;  2P9N B;  4CHY A;  4O8K A;  4DTS A;  4F2S A;  4CK1 A;  3DXM A;  3VQ9 A;  3ZT0 A;  1TK5 A;  1U47 A;  1TAU A;  3OYB A;  2IOC A;  1SL0 A;  3MEC A;  5FRM A;  3JXU A;  5J2N A;  1RTD A;  4LY7 A;  2AJQ A;  2HHV A;  2HND A;  2E6M A;  3AVA A;  5AZJ A;  3ZSZ A;  3J7Y P;  3NGI A;  1VQO N;  3PSI A;  3HJF A;  4H0Y B;  1S1U A;  1UWB A;  3ZX3 A;  3SYZ A;  1JCG A;  1Q8I A;  3HM9 A;  4IJA A;  3B6O A;  1GLL O;  2UXB K;  5M1P A;  4O5B A;  1QSL A;  2F96 A;  1CXQ A;  4CGJ A;  2W42 A;  1D4X A;  2RN2 A;  1N8R O;  2Q2R A;  3I56 N;  4C8M A;  3AVI A;  2FSJ A;  3DLE A;  5KTQ A;  3QEV A;  3RMB A;  3AVK A;  3U3G A;  4M3U A;  1HQE A;  2ATQ A;  5M1N A;  2O8D B;  1HPZ A;  2A41 A;  1RTJ A;  2QWQ A;  3ATU A;  1BI4 B;  4YOT A;  4KH6 A;  1BIS A;  1HYV A;  4GKJ K;  3AO4 A;  4KRE A;  3DRR A;  4Z0U A;  1VQP N;  3CCV N;  3CPE A;  2RF2 A;  2KTQ A;  2EWS A;  1NK6 A;  4L8R B;  1HNW K;  1IJJ A;  1DKG D;  4Y1D A;  1C0F A;  2A6A A;  4BE2 A;  3FFK B;  3AGR A;  2O8C B;  5BRD A;  4BG8 A;  4XH5 A;  1KSP A;  2O4G A;  3RR7 A;  1BWF O;  1TYQ A;  2RE2 A;  3THX B;  1O1W A;  3D2F B;  2VWK A;  1RT6 A;  4JI6 K;  3NGZ A;  3O9R A;  3PY8 A;  3C6A A;  4HUE A;  5T7B A;  1TKX A;  3TTD A;  3SQ1 A;  4Z4I A;  3EE8 A;  1NK4 A;  1FJG K;  1WLJ A;  3RR8 A;  3H1V X;  2PY5 A;  3ALY A;  3PIO L;  4E1M A;  4MO5 A;  3ISN C;  4J2E A;  3A5L C;  3MK6 A;  4FJJ A;  2P9P B;  2P9I A;  5BR9 A;  3DYA A;  3SV4 A;  4Z4G A;  2BGG A;  1BCO A;  3AO3 A;  3LDL A;  3QDK A;  1VSI A;  5KGX A;  3HRG A;  4F9O A;  3GOI A;  5C42 A;  4FJ8 A;  2HBJ A;  1EO1 A;  2QWP A;  3O9T A;  1R0A A;  3L3U A;  1UA1 A;  4Z4C A;  4X64 K;  5KPZ A;  2FSN A;  3PLA A;  5IT9 O;  3AGK A;  4JI8 K;  3NF9 A;  1WNS A;  3SJJ A;  1YIT N;  4I9L A;  5C2D A;  2WTU A;  4FJ5 A;  3AA2 A;  5J2P A;  4C8O A;  3T7Z A;  2E2Q A;  4DR2 K;  3AA5 X;  3EKU A;  3VTH A;  5BPM A;  2W6L A;  4IOX A;  5TKW A;  1N5Y A;  1TAQ A;  4CJW A;  3NVM A;  4IFE A;  1YI2 N;  2QWN A;  2JGU A;  3PX0 A;  1VQ8 N;  4FW1 A;  1BUP A;  3C6U A;  1J54 A;  5AQU A;  2YV0 X;  3OYD A;  4H5T A;  4FLU A;  4A5B A;  1QZ5 A;  4IXC A;  4FZX C;  4Q5V A;  4RCH A;  2YHY A;  3A5N C;  4IZ9 A;  1U45 A;  3H6E A;  2GTD A;  4AQY K;  4C8K A;  1JXB A;  3TAQ A;  1QHA A;  3CC7 N;  5IWA K;  2YKM A;  3C0B A;  3I0S A;  4KRF A;  1VQ9 N;  3G25 A;  1IG9 A;  1JLA A;  3E1Y A;  4CHN A;  1YT3 A;  4A2A A;  1HJO A;  3TAM A;  5JVG L;  4WQ5 A;  2E20 A;  2AP1 A;  2NNW A;  3DAW A;  2P1J A;  5MLC Q;  4BRC A;  4DS5 A;  3CQY A;  1VK0 A;  1NBW A;  1CZA N;  1VSM A;  2E8A A;  3SPY A;  2JLE A;  4ELU A;  1HRH A;  1RGI A;  4J8F A;  3VTI A;  3HPG A;  2NRR A;  4JI1 K;  3KLE A;  5AQR A;  3THW A;  2KQ2 A;  4CBW A;  5KRT A;  1RBR A;  4CGD A;  2QTD A;  4FLT A;  4DV5 K;  3W0L A;  4DLG A;  1S6Q A;  3BUZ B;  4B1Y B;  3K5M A;  1NKC A;  1RT7 A;  2QEX N;  4YHH K;  3V9Z A;  2QW9 A;  2I7P A;  4B8A B;  3R8E A;  3O9Q A;  3HPH A;  3HM8 A;  4M63 C;  4EZ6 A;  1JL1 A;  1HX1 A;  1P8Z A;  3DMJ A;  2XO7 A;  2E5L K;  2F8T A;  4JN4 A;  3AA3 A;  5JMV A;  1LAW A;  3BZC A;  3QER A;  3R9P A;  3MEG A;  5ADX H;  3H3N O;  1HKB A;  3CCM N;  4CEC A;  5C25 A;  4PKH A;  3C7N B;  5DM7 L;  3ZSY A;  1VQ5 N;  5KQ8 A;  4FJ9 A;  3CC4 N;  1JLE A;  4WQ4 A;  1YAG A;  3CCE N;  3MAQ A;  3DRS A;  4BRN A;  4DTO A;  4ZTF A;  5KRS A;  4FM0 A;  4BDY A;  1SUQ A;  4HUG A;  3SUP A;  1SS6 A;  4BRP A;  5AQN A;  1B92 A;  2Y1I A;  2BH1 A;  4DR6 K;  3AA4 A;  1U4B A;  4AHC A;  4DSI A;  1UA0 A;  1LWF A;  4EAH D;  2QWL A;  1U2V B;  2E2O A;  4IG3 A;  4OPK A;  3IS9 A;  4BRQ A;  4KHP K;  3JS6 A;  5AFU A;  3QML A;  3D2E A;  1ITG A;  4YOY A;  2NRZ A;  2X78 A;  1QSY A;  3LP2 A;  3AV9 A;  2HVI A;  3Q7B A;  1RBV A;  4YOX A;  5TKY A;  3L3V A;  1VSH A;  3QIC A;  1VQ4 N;  3FZM A;  2OYQ A;  2QA4 N;  4QS7 A;  2FXU A;  4EHT A;  3GDQ A;  1WUA A;  4FJM A;  3I8B A;  2HF4 A;  4KB0 A;  3LWM A;  1J53 A;  4JEP A;  2WOM A;  2IC3 A;  3C6H A;  3P4I A;  1KLN A;  1XC9 A;  1XWL A;  4FVU A;  3ZET B;  4CEE A;  3U4L A;  4E1N A;  4MO4 A;  3LM2 A;  4FWL A;  2E6L A;  4J2A A;  3P83 D;  1BDG A;  3NF8 A;  3H08 A;  5AQT A;  4EZ9 A;  1YHQ N;  3SJH A;  4IG0 A;  4IO8 A;  2YHW A;  3H1Q A;  2FBV A;  2OZM A;  4ILJ A;  1C1A A;  3C6T A;  2E1Z A;  2F9T A;  1GLD G;  2P5G A;  4JKD A;  1NJZ A;  5AQK A;  5K14 A;  3MCP A;  4OGC A;  3VPZ A;  1TKD A;  4ILG B;  4CK2 A;  2YHB A;  1VSE A;  3LDS A;  2F8S A;  2V7Z A;  2HW3 A;  1KAY A;  1ATN A;  4ISG A; 
#chains in the Genus database with same CATH homology
 1KFD A;  4I2Q A;  1KVB A;  2A1S A;  4I2P A;  3SZ2 A;  4DTX A;  2HMI A;  4B9S A;  4FJN A;  2IS3 A;  3TAG A;  3RRG A;  2XRI A;  1RDA A;  3VQP A;  1C0T A;  3TI0 A;  3OYH A;  4DU4 A;  3T3F A;  3OS2 A;  4CJE A;  1WSH A;  4DTM A;  4IKF A;  4FVM A;  5DK5 A;  1HJR A;  1WSI A;  1GOA A;  2XY5 A;  4K8Z A;  1S1T A;  1UOC A;  3C94 A;  2DY4 A;  3SCX A;  1QTM A;  1QE1 A;  1KCF A;  4JLH A;  2PZS A;  1C1C A;  3NFA A;  2VWJ A;  4F2R A;  3KJV A;  4ELV A;  3KKS A;  3OYM A;  3SQ2 A;  3ITH A;  1QSS A;  3MXI A;  3QIO A;  1BGX T;  3V1O A;  2KZZ A;  2G8H A;  3CG7 A;  1IKV A;  4Q0B A;  2IGI A;  5HRR A;  3OS0 A;  3P5J A;  3SNN A;  4FCY A;  4JS5 A;  1NJW A;  3PV8 A;  1D8Y A;  4OPJ A;  3ASM A;  3L2R A;  3SQ4 A;  1JKH A;  1DTT A;  4RW7 A;  1FKP A;  4I9Q A;  1NJX A;  3VA3 A;  2VG6 A;  2X6S A;  3SUQ A;  4CER A;  4BDP A;  3T19 A;  1EP4 A;  3RWU A;  4NCA A;  3NF6 A;  2DFE A;  4KTW A;  2DTU A;  3AVF A;  4LH5 A;  4NCG A;  2YNF A;  1ASV A;  4CGI A;  4HHT A;  5SZT A;  1NJY A;  3L2V A;  3IRX A;  4DMN A;  3V9X A;  4PQU A;  2D5R A;  3S3O A;  4M3Y A;  2DFF A;  2OPR A;  4I7F A;  3PO4 A;  4CJU A;  4AHT A;  4BWM A;  5FRN A;  3AVG A;  3ZSQ A;  1KVA A;  1VRU A;  1WAF A;  1EKE A;  4O4G A;  4PUO A;  1QQC A;  4DFM A;  3ZT3 A;  4QCL A;  2EX3 A;  3WNF A;  1ZBF A;  1RBT A;  4YFU A;  3DI6 A;  2WON A;  3OVN A;  4E3S A;  4M3T A;  4OLA A;  4CHP A;  1VSF A;  4CJ5 A;  5D3G A;  1Z25 A;  4LD0 A;  4ZTJ A;  1T8E A;  3RMA A;  4W5T A;  4CHO A;  2ZE2 A;  3CM5 A;  3VQE A;  5KGW A;  3O3G A;  1RT1 A;  1UAX A;  1S1W A;  4H8K A;  4CJT A;  3DM2 A;  4CJS A;  3QEX A;  1NK7 A;  4CGF A;  5E41 A;  1JLG A;  1HYS A;  4KHS A;  3OYC A;  3TAR A;  1YTU A;  3RMC A;  2GBZ A;  5HP1 A;  4EP4 A;  1TKT A;  1BQM A;  3CQ8 A;  3ZSO A;  4B08 A;  2VG7 A;  4CEQ A;  3OYE A;  4OJR A;  4CHY A;  1U04 A;  1WSF A;  3NHG A;  4DTS A;  4DTR A;  3LPT A;  2B5J A;  4F2S A;  4CK1 A;  4N41 A;  3OYF A;  1RDC A;  1FKO A;  4UQG A;  2XY6 A;  4OKJ A;  4Z4E A;  4RG8 A;  3VQ9 A;  3ZT0 A;  4W5N A;  1TK5 A;  4E7K A;  1U47 A;  1TAU A;  4KFB A;  1RCH A;  2YNG A;  3OYB A;  2IOC A;  1RTH A;  1SL0 A;  3MEC A;  4N5S A;  1FK9 A;  3NE6 A;  1TL3 A;  5J2N A;  5DMR A;  3TAP A;  5I42 A;  1J5O A;  1RTD A;  3VQ8 A;  4OKK A;  3KK2 A;  4IFY A;  3KLF A;  3KLH A;  4Z4F A;  3VQA A;  4FJG A;  4LY7 A;  2AJQ A;  2HHV A;  2HND A;  2E6M A;  1D5A A;  3AVA A;  4HTU A;  1X9M A;  1KTQ A;  4CHZ A;  1LV5 A;  4KHN A;  4OVL A;  3VQ6 A;  1D9D A;  3ZSZ A;  3NGI A;  3RR8 A;  1B9F A;  4G1Q A;  3HJF A;  1I3A A;  4DF4 A;  1S1U A;  4H4O A;  3QNN A;  2QK9 A;  1UWB A;  4GMJ B;  3LP0 A;  1RT2 A;  3SYZ A;  1BI4 A;  2QKK A;  4NYN A;  1Q8I A;  3HM9 A;  4OGE A;  4J2B A;  3B6O A;  1TK0 A;  3ULD A;  2OPP A;  3DRP A;  2D0C A;  1WAJ A;  3DOL A;  4O5B A;  4CIG A;  1QSL A;  2F96 A;  3KD5 E;  5CZ2 A;  1RDB A;  1CXQ A;  5HBM A;  3OYA A;  4CGJ A;  2W42 A;  3V9U A;  3TAN A;  3TWH A;  2IDO A;  2HB5 A;  5KI6 A;  4OKE A;  1VRT A;  2RN2 A;  2Z1J A;  4DQQ A;  3VQC A;  4WE1 A;  4FLW A;  4W5Q A;  3ZSX A;  3M8P A;  4C8M A;  3OYG A;  2E4L A;  3HP6 A;  3AVI A;  3DLE A;  3SPZ A;  5KTQ A;  4E0D A;  3KK1 A;  1TL1 A;  1BIU A;  3QEV A;  3RMB A;  3AVM A;  4N47 A;  1I39 A;  4FK2 A;  1S1V A;  3AVK A;  3U3G A;  4DQP A;  3MEE A;  1C0U A;  4M3U A;  1HQE A;  4M45 A;  3HO1 A;  2ATQ A;  2GV9 A;  2ZD1 A;  1HPZ A;  3CYM A;  1RTJ A;  1SKS A;  1BI4 B;  3VN5 A;  4FM1 A;  4DQI A;  3U6F A;  3K59 A;  4DG1 A;  1BIS A;  1HYV A;  3AO4 A;  4KRE A;  4ICL A;  1LW2 A;  3DRR A;  4Z0U A;  3RTV A;  4DLE A;  5CYM A;  3TAE A;  1VSD A;  2BAN A;  4KHU A;  2RF2 A;  2KTQ A;  1NK6 A;  4L8R B;  3SQ0 A;  2KZM A;  4E7J A;  1VSJ A;  1VSL A;  4CF0 A;  2FBT A;  3K5O A;  4Y1D A;  4KHQ A;  2YNH A;  4BE2 A;  1SKW A;  1SKR A;  4B9L A;  4CGH A;  4HVJ A;  4NCB A;  3LAK A;  3ZSV A;  4CJP A;  2O4G A;  4CHQ A;  1KSP A;  3RR7 A;  3TAF A;  4FJK A;  2FC0 A;  3HK2 A;  2HHU A;  1IKX A;  4DSJ A;  2QXF A;  1WSG A;  4FZY A;  5I3U A;  1O1W A;  1QHT A;  2VWK A;  1RT6 A;  3QEW A;  3NGZ A;  3I0R A;  4BDZ A;  2VG5 A;  4GVM A;  4E7L A;  1S9G A;  3AVH A;  3HT3 A;  1T05 A;  3PY8 A;  4LH4 A;  4HUE A;  1XHZ A;  5T7B A;  3QIN A;  1TKX A;  3BGR A;  3LP3 A;  3VQB A;  3SQ1 A;  4M41 A;  4Z4I A;  3V9S A;  4CGG A;  2ETJ A;  3SUO A;  2OPQ A;  1WLJ A;  3MXM A;  3NAE A;  3K57 A;  3ALY A;  3DLR A;  3MED A;  1NK4 A;  4E1M A;  3KIO A;  2PY5 A;  1S6P A;  4DWI A;  1DLO A;  1JLB A;  1ZBI A;  3C95 A;  3G10 A;  1NKE A;  1WSJ A;  1F21 A;  3ISN C;  3KKR A;  4CJQ A;  4J2E A;  1A5V A;  1IO2 A;  2YNI A;  4FJJ A;  3VQD A;  4R5P A;  3OYN A;  4CFC A;  3DYA A;  3SV4 A;  3S9H A;  1BCM A;  1RT3 A;  1CZB A;  3M8Q A;  4FM2 A;  1T03 A;  1KRP A;  1BCO A;  3AO3 A;  4M3R A;  4M42 A;  4Z4G A;  2BGG A;  1FXX A;  1RT4 A;  1VSI A;  1CXU A;  2FBY A;  5KGX A;  4E7I A;  2XY8 A;  4AHR A;  5C42 A;  4JS4 A;  2Y1J A;  4DTJ A;  4FJ8 A;  3TAB A;  5HLF A;  3LAL A;  3ZSW A;  4DF8 A;  2Z1H A;  4HUF A;  4KTQ A;  3KK3 A;  1ASU A;  3VQ5 A;  3CFR A;  4AIL C;  3L2W A;  4O55 A;  1SL1 A;  4CEZ A;  1R0A A;  3L3U A;  1CLQ A;  4IDK A;  2P51 A;  4OLB A;  1UA1 A;  2KFN A;  3V81 A;  1XHX A;  4QAG A;  4Z4C A;  4DFJ A;  1NK5 A;  3KLI A;  1RBS A;  1X9W A;  1NKB A;  4B9T A;  4LSL A;  4CJ4 A;  3LAN A;  4NYF A;  4EP5 A;  3KTQ A;  4HCB A;  3NF7 A;  4CF9 A;  2HHX A;  3NDK A;  3NF9 A;  3DLK A;  4C8N A;  3DLG A;  2YKN A;  1WNS A;  3SJJ A;  4I9L A;  5HRP A;  3VQ4 A;  2ZQB A;  4CF2 A;  4FJ5 A;  4FXD A;  2FBX A;  3DLH A;  5C24 A;  3AA2 A;  5J2P A;  2GUI A;  2HHQ A;  3THV A;  1L3S A;  4C8O A;  3AA5 X;  4E89 A;  4CIE A;  3K2P A;  4J2D A;  3P1G A;  1N5Y A;  3IAY A;  1DTQ A;  2NUB A;  1TAQ A;  1ZBH A;  4CJW A;  4M3Z A;  4DFK A;  2HNZ A;  3AO1 A;  2JGU A;  3PX0 A;  3OJS A;  3T1A A;  4XIU A;  1RBU A;  2EHG A;  3V4I A;  4FW1 A;  3SUN A;  1S9E A;  4LSN A;  3LP1 A;  4DSF A;  1S1X A;  3HXM A;  1W9H A;  3C6U A;  2G8K A;  2G8F A;  1J54 A;  4CEF A;  2YV0 X;  3OYD A;  2HHT A;  4KV8 A;  4FLU A;  1JL2 A;  3JSM A;  4AHU A;  4DU3 A;  3F9K A;  4O44 A;  1TV6 A;  1ZBU A;  4RW6 A;  4Q5V A;  4FZX C;  1U49 A;  2RKI A;  1RIL A;  3I8D A;  1L5U A;  4KPY A;  1U45 A;  4CJK A;  3VA0 A;  1J9A A;  3SV3 A;  2OA8 A;  4C8K A;  1JXB A;  3E01 A;  1GOC A;  3LAM A;  3TAQ A;  3VQ7 A;  3V9W A;  2YKM A;  1C1B A;  3I0S A;  4B8C A;  1N6Q A;  3HP9 A;  4KRF A;  3TR8 A;  4F8R A;  3EY1 A;  4KHY A;  3HL8 A;  1Z26 A;  4BAC A;  1IG9 A;  1JLA A;  4CHN A;  3L2Q A;  1YT3 A;  4CCH A;  1S5J A;  3NH2 A;  4CEO A;  1TKZ A;  1MU2 A;  2B4J A;  3TAM A;  2O4I A;  1BHL A;  3WNG A;  3QEP A;  3V1R A;  2BE2 A;  1D9F A;  4FZZ A;  3K5L A;  2OZS A;  3PUF A;  2P1J A;  3M8S A;  4DS5 A;  4B9V A;  1X9S A;  2X74 A;  3QLH A;  4JRQ A;  2RPI A;  1C6V A;  1VK0 A;  5FRO A;  4E7H A;  5EU7 A;  4DFP A;  2G8U A;  4M3X A;  1VSM A;  3SPY A;  4ELU A;  2JLE A;  4PA1 A;  4CJV A;  4RW8 A;  4CFB A;  3HPO A;  3QET A;  2A1R A;  3NH0 A;  4DSK A;  1W0H A;  4E19 A;  4DS4 A;  1HRH A;  2YHA A;  2I5J A;  4CJL A;  3AO5 A;  2Z1I A;  2KFZ A;  4JRP A;  3HPG A;  3K58 A;  3KLE A;  4BWJ A;  5CZ1 A;  4RW4 A;  1C0M A;  2KQ2 A;  3ZSR A;  3ZT1 A;  5KRT A;  4DTN A;  2BDP A;  1RBR A;  1SV5 A;  3ZCM A;  4DSE A;  1CZ9 A;  2HNY A;  4CGD A;  1GOB A;  1ZBL A;  4B9N A;  4QOZ B;  4FLT A;  2G8V A;  4K8X A;  4KI4 A;  3G0Z A;  4DLG A;  1IH7 A;  1S6Q A;  2QKB A;  1NKC A;  3K5M A;  1RT7 A;  3O4N A;  3QES A;  1NOY A;  4Z4H A;  1RNH A;  1YTA A;  3EZ5 A;  3V9Z A;  3FFI A;  4CFD A;  4W5O A;  4M3W A;  4FJL A;  2XY7 A;  1RTI A;  3WNE A;  4DU1 A;  4B8A B;  3AVN A;  4KB1 A;  3OYI A;  1WN7 A;  3RMD A;  3HPH A;  4YNQ A;  3KLG A;  1SL2 A;  4EZ6 A;  1JL1 A;  1Q9Y A;  2IAJ A;  3CFP A;  4ID5 A;  1TGO A;  4DQR A;  1IKY A;  4FLZ A;  4DTU A;  3DMJ A;  4AHV A;  2XO7 A;  2F8T A;  3U3Y A;  3SI6 A;  4AHS A;  1L3V A;  4KI6 A;  4ID1 A;  3LZJ A;  1HNI A;  3AA3 A;  1K6Y A;  1NK0 A;  4FW2 A;  1LAW A;  1JLF A;  3QER A;  1EET A;  3MEG A;  4MQ3 A;  4CIF A;  3WNH A;  3CM6 A;  3QEI A;  1RDD A;  2PYL A;  4FJI A;  4CEA A;  3V1Q A;  2XHB A;  3LPU A;  4CEC A;  4PWD A;  3IG1 A;  5C25 A;  4O0J A;  4Y1C A;  2HHS A;  3BDP A;  3B6P A;  3ZSY A;  3LWL A;  2DFH A;  3A2F A;  4CF1 A;  4FJ9 A;  2D0B A;  1JLE A;  1KVC A;  3L2U A;  1HMV A;  4DQS A;  4FJH A;  3MAQ A;  1L3U A;  3DRS A;  4CF8 A;  3PX6 A;  3ZT2 A;  1A5X A;  3D45 A;  4DTO A;  5J2Q A;  4BE0 A;  4AH9 A;  4ZTF A;  5KRS A;  4FM0 A;  2X6N A;  3HYF A;  5HRO A;  4BDY A;  1JLC A;  1SUQ A;  4HUG A;  1HYZ A;  3SUP A;  1JXE A;  1QS4 A;  2KW4 A;  4CEB A;  3D0P A;  1T7P A;  4GW6 A;  2R7Y A;  4FJ7 A;  1Y97 A;  1BL3 A;  1B92 A;  2Y1I A;  3NGY A;  3AA4 A;  3O3H A;  1WSE A;  1U4B A;  4AHC A;  4DSI A;  3M8R A;  1UA0 A;  1LWF A;  1A5W A;  2ITG A;  4C8L A;  3QO9 A;  4DSL A;  4HCC A;  3OYK A;  4ZHR A;  3AVL A;  4DTP A;  4IG3 A;  4CK3 A;  4OPK A;  3IS9 A;  4O0I A;  4FK0 A;  1LWC A;  2Z1G A;  3L8B A;  5FRM A;  5HRN A;  4CED A;  1ITG A;  1IKW A;  1HQU A;  1LW0 A;  3VQQ A;  2X78 A;  1YVU A;  4IFV A;  4CFA A;  1NK9 A;  1QSY A;  3PO5 A;  1G15 A;  3LP2 A;  4FJX A;  2D0A A;  3AV9 A;  2HVI A;  1BIZ A;  4KKO A;  4CJ3 A;  3AVC A;  3OY9 A;  1RBV A;  4FLY A;  3AVJ A;  1TVR A;  1XI1 A;  3PX4 A;  3L3V A;  1VSH A;  1U48 A;  1Q9X A;  3ZT4 A;  4TSX A;  4FYD A;  2OYQ A;  4ELT A;  1KFS A;  5JS2 A;  1LAV A;  4N56 A;  1X1P A;  1TK8 A;  4FLV A;  2LSN A;  4B9U A;  4F3O A;  1KLM A;  3QIP A;  3NCI A;  5J2M A;  1REV A;  4CJF A;  1JLQ A;  4FJM A;  4B3O A;  5JS1 A;  4KB0 A;  3LWM A;  2Q3S A;  1J53 A;  4F3T A;  4F4K A;  4CES A;  2WOM A;  4CE9 A;  2IC3 A;  4H4M A;  3O3F A;  2P5O A;  4FK4 A;  1KLN A;  3HST B;  4KTZ A;  3K5N A;  3HVR A;  1XWL A;  1XC9 A;  4RW9 A;  1RT5 A;  5HRS A;  2G8I A;  4CEE A;  4E1N A;  3KD1 E;  3EYZ A;  4CJR A;  3OYL A;  4PY5 A;  3HVT A;  3OS1 A;  1HNV A;  2E6L A;  2B6A A;  3F73 A;  4W5R A;  4J2A A;  3CFO A;  4BE1 A;  5SWM A;  3P83 D;  4IBN A;  4FLX A;  2G8W A;  3NF8 A;  3H08 A;  4KHW A;  2OPS A;  1L3T A;  5J1E A;  3OYJ A;  4EZ9 A;  2HVH A;  4IG0 A;  3QNO A;  3AVB A;  2FBV A;  2OZM A;  1ZYQ A;  3UIQ A;  1C1A A;  1B9D A;  1EX4 A;  4MFB A;  5CY4 A;  3LZI A;  3DLB A;  1EXQ A;  3C6T A;  3S3N A;  1NOZ A;  2P5G A;  4KAZ A;  2HHW A;  4KO0 A;  3OJU A;  1VSK A;  1ASW A;  1NJZ A;  5K14 A;  3JYT A;  4OGC A;  2PYJ A;  1TKD A;  1LWE A;  3MXJ A;  3O4Q A;  4B9M A;  5FDL A;  2YHB A;  4CK2 A;  1VSE A;  3RRH A;  3V6D A;  3NBP A;  3AO2 A;  5CYQ A;  3LDS A;  3S3M A;  4N76 A;  1BQN A;  2F8S A;  3NH1 A;  2HW3 A;  3DOK A;  1NK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...