4KTWA

Lactococcus phage 67 ruvc - apo form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
160
Chain Sequence
MKKILAINFSTASKKGEGTGYAFRKDGQVYVGSIKAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRNRKHSITLANCNGYFIGAIDGLVNGYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYCEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RuvC endonuclease
publication title Mutants of phage bIL67 RuvC with enhanced Holliday junction binding selectivity and resolution symmetry.
pubmed doi rcsb
source organism Lactococcus phage bil67
molecule tags Hydrolase
total genus 61
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07066 DUF3882 Lactococcus phage M3 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ktwA00
1ASVA 4HUFA 1S1TA 4AHRA 4CJTA 3OYFA 2F8SA 1U45A 3M8PA 5FRNA 3KLGA 4I9QA 4I2QA 3JYTA 4EP5A 3ZSOA 4KB0A 3HVTA 4DTOA 4CHOA 1VSHA 3RTVA 4BDYA 4XIUA 3ZT0A 3TAPA 4E19A 4E0DA 3THVA 1X9SA 2B5JA 5JS2A 4DFPA 2DFEA 3D0PA 4FJXA 3LALA 2D5RA 4DTUA 3S9HA 3MXIA 4FJHA 4DTNA 2IAJA 5KI6A 4FM0A 1JLBA 1TKDA 1NKBA 1SKWA 1QSYA 3PO5A 1ZBHA 1I3AA 4DSEA 3OVNA 2X6SA 4CEFA 4FJ8A 3S3MA 2WONA 4I9LA 3V9ZA 1LW0A 2YNGA 4RW8A 2B4JA 1ASUA 1B9DA 2HNDA 5FDLA 4QCLA 3KK2A 4J2BA 1BGXT 3DLRA 4O5BA 4OLAA 2HHTA 3B6OA 1NK9A 1RBRA 1QSSA 4C8MA 3M8RA 1U47A 2QK9A 1BISA 1LAWA 4RW4A 4WE1A 1S6QA 1FXXA 4CK2A 1KVCA 4FJGA 4W5OA 3LWMA 1RNHA 1S9EA 4CHNA 5J2NA 3PX6A 3QESA 3QO9A 3OYCA 1ASWA 1VSDA 2XY6A 3V1OA 3L2RA 3V9UA 4YFUA 4DQRA 4DTMA 1ZBLA 3AO2A 1RDCA 1FK9A 3OJSA 2Y1IA 4ZTJA 4DSLA 1VSIA 1EXQA 4Z4GA 1CLQA 5C25A 3L2QA 4JRPA 1K6YA 2QXFA 4FJIA 3CM5A 1Q8IA 3P5JA 3LZJA 1KLNA 2YKNA 2FBYA 3HM9A 3ISNC 2Z1JA 1QTMA 1RBUA 5C24A 3T3FA 4KRFA 1RT1A 2X6NA 4CHZA 3U3YA 3I8DA 5C42A 3DLBA 4LH5A 1KVBA 4PQUA 1J9AA 3TAQA 4HUEA 3SJJA 3HSTB 4FYDA 2A1RA 2R7YA 3KLIA 4CGJA 1RT2A 3KLEA 3OYHA 1WSEA 3T1AA 2W42A 4KHWA 1YTUA 4MQ3A 2YKMA 3DI6A 4GVMA 4Z0UA 4F2SA 4OLBA 4FVMA 4CJQA 1X9MA 4B9NA 3U6FA 3DLKA 1TKTA 3L3UA 3AO4A 2XRIA 1ZBIA 1HPZA 1U49A 3RR8A 4ZTFA 3LPTA 1FKPA 3ZSRA 2X78A 4E7LA 1HQUA 3OYIA 4EZ6A 1IKVA 3DOKA 4O55A 1KVAA 4RW7A 3WNFA 1U4BA 1NJXA 3PY8A 4FK0A 1RCHA 5DMRA 1IKWA 3MEGA 3DYAA 3O3GA 5HRRA 1B92A 1S5JA 2JGUA 4N5SA 2KQ2A 3SQ2A 3SPZA 3E01A 2Z1HA 4CJRA 3RMCA 4NYNA 3VQCA 4B9TA 3V1QA 3AA5X 4KPYA 2YNIA 2Z1IA 3PX0A 4CGDA 2E4LA 2HHWA 4M41A 4W5QA 4AILC 3NDKA 3LAKA 4CECA 4H4MA 4O0IA 3F9KA 1EP4A 3MEDA 5SZTA 4CK1A 2DY4A 3OYBA 4LSLA 4E7KA 3AA2A 3D45A 3RR7A 4B9UA 1CZBA 1BI4A 4DSFA 3NH1A 3HXMA 4CJ5A 1NKEA 3VA0A 3LP1A 4B9VA 2IS3A 1LWCA 3DRSA 4FJ5A 4KB1A 1LW2A 4L8RB 3H08A 3KK3A 5J2MA 1WLJA 4CIEA 1EX4A 4B8CA 2P51A 4DFMA 1TK0A 1RBTA 1UOCA 2KFZA 4C8KA 1SL0A 3ZT1A 1D9FA 4K8XA 1S1XA 3NFAA 3QEIA 1YVUA 1VSFA 4KHUA 3HP6A 3LP2A 3EY1A 2GV9A 3NH0A 1JLAA 1Q9XA 1JKHA 1TL1A 4FLXA 2E6LA 4CF8A 1FKOA 3L2WA 1TKXA 1S6PA 3SPYA 2RN2A 4Z4EA 1VRUA 4KFBA 3ZT2A 2HHQA 3C94A 1L5UA 3ZT3A 4M3TA 3SUOA 2BDPA 1TAUA 1ZBFA 4N47A 3AVMA 4CEOA 1VSMA 2P5GA 4MFBA 4KHYA 1C1BA 4PUOA 1S1UA 3O3HA 2YNHA 4FJLA 4FLUA 2GBZA 2RPIA 1QQCA 1S9GA 3IRXA 1RDBA 4DG1A 4M3XA 4BDPA 4ELVA 3HK2A 3KKRA 5EU7A 4DQSA 1S1WA 4RW6A 2G8WA 3NAEA 2HHUA 1HQEA 2LSNA 3CFPA 5I42A 4DFJA 1BQNA 1VSKA 3VQ6A 4DS5A 4FJ9A 4UQGA 4CJ3A 5J2QA 3MXMA 1WSJA 4CF2A 4CERA 3TR8A 3ZSYA 4DF8A 4O4GA 4C8OA 3SNNA 2PY5A 4I7FA 4J2AA 4PWDA 2D0CA 4JS4A 3CFOA 4CJWA 3KLFA 2KZMA 3AVFA 3TAMA 1HRHA 1RT4A 1RTJA 3LANA 5CYQA 4Z4CA 1YT3A 3KLHA 1RT3A 3AV9A 2IDOA 2OZMA 1IH7A 4FJ7A 1DLOA 3NF9A 4KAZA 2FBXA 3AVBA 2D0AA 2ZD1A 3AO3A 3U3GA 1JLEA 3AO1A 1HNVA 2BGGA 4OPKA 4OKKA 4RW9A 4DTRA 1NJZA 5KTQA 1YTAA 4NCAA 4F8RA 4CK3A 1ITGA 1BL3A 1GOCA 1EETA 2FBVA 4W5TA 4CFAA 3HT3A 4DTJA 5J1EA 4DQIA 3G10A 2B6AA 4FLTA 1NK8A 3VQ7A 5HRSA 1DTTA 2G8FA 3NF7A 1KLMA 4B9MA 3AA3A 4LH4A 1QHTA 3B6PA 2KZZA 1NOYA 4CEEA 4FK2A 5T7BA 4EP4A 4E7IA 3VQQA 2OPQA 3I0SA 3PUFA 1W0HA 3CYMA 3QIOA 1D9DA 2HHXA 4BDZA 3HJFA 4ZHRA 4M3UA 3DLGA 3PV8A 4CHPA 2ATQA 2IC3A 1LAVA 3HPGA 4CEDA 4FK4A 2HHSA 5KRSA 4KTZA 4F2RA 3ITHA 4IDKA 1SL2A 1BI4B 2OPRA 2Q3SA 3K57A 4JS5A 4DSJA 4KHQA 1Q9YA 4FJMA 4DQQA 4M3ZA 4PA1A 4AHTA 1RT6A 1RTIA 4DU4A 2VG6A 4DSIA 3KK1A 3QEXA 1C1AA 4CJPA 4OJRA 1GOBA 4FCYA 3QNNA 3HYFA 4OKJA 4CGIA 4CJFA 5FROA 4FM1A 1NK0A 1CXQA 1L3TA 4F3OA 4LY7A 2PYLA 4Z4FA 3QETA 1JXEA 4H4OA 4DLGA 1NK7A 3K5LA 1BHLA 3NF8A 1RILA 3OYLA 5KGWA 4FLVA 1C0UA 4IFYA 3PX4A 3LDSA 3V4IA 4EZ9A 1JL1A 4CJVA 4HTUA 3QEVA 3L2UA 5DK5A 1JLFA 1HNIA 1RT5A 4GW6A 4CEBA 4FW2A 5CY4A 3AVLA 4YNQA 4DFKA 4DU1A 4QOZB 3WNGA 1N6QA 1SKRA 3P83D 3EZ5A 1TK8A 2ZQBA 1T05A 1KRPA 2E6MA 1TK5A 1X9WA 4FJNA 1XC9A 2XY8A 4AH9A 3CQ8A 2OPSA 2QKKA 3OS0A 3AVKA 2OYQA 3OYDA 4N76A 3SUPA 4AHSA 4CIGA 1BIZA 1BCMA 4N56A 2I5JA 4Y1DA 4C8NA 1T03A 2DTUA 2HVHA 3LPUA 3L2VA 3ZSXA 3SYZA 1SL1A 1ZBUA 1REVA 4M3YA 4FM2A 3C6TA 1JXBA 4B3OA 3AVNA 3TABA 4NCBA 2VG5A 4C8LA 3QERA 1EKEA 1IO2A 2G8UA 2F96A 2KTQA 3CM6A 4IG3A 4CGGA 1W9HA 1NK5A 4KI6A 2ZE2A 5KRTA 3RMDA 4HCBA 2XHBA 1LWFA 3NH2A 3OYJA 3RRHA 3CG7A 2JLEA 4DS4A 3HPOA 4CJKA 1J5OA 2D0BA 1GOAA 3LP0A 4CFDA 5E41A 1RBSA 3MEEA 2P1JA 2OPPA 5CZ2A 3VQBA 4BE0A 3RRGA 3AVHA 1HYVA 3IG1A 4DLEA 2O4IA 4Q0BA 4JLHA 2EHGA 3AVCA 4DMNA 4G1QA 3KD5E 4W5NA 4OPJA 1J53A 3MECA 3V6DA 4DWIA 3NE6A 4FJKA 4F3TA 3AVJA 4R5PA 3LZIA 3ZT4A 4Q5VA 2HMIA 2G8VA 2WOMA 2DFHA 5J2PA 1CZ9A 4CJLA 1DTQA 3O4QA 1U04A 4FZZA 2RKIA 4AHUA 1NJYA 1Z25A 1T8EA 4I2PA 4E7HA 3QNOA 4BACA 3QINA 4CJ4A 1RDAA 3RMBA 2FC0A 3K5OA 3KD1E 4FZXC 4PY5A 2DFFA 1D8YA 3HL8A 4DF4A 1RTHA 4DTXA 2Z1GA 3TARA 3DOLA 4OGEA 1NJWA 1T7PA 3NHGA 3UIQA 4CE9A 2IOCA 3V9SA 2RF2A 4AHCA 1RTDA 2OA8A 1KFDA 1IKYA 3K59A 2QKBA 3OYGA 3OJUA 2G8HA 1QE1A 3AVGA 1ZYQA 1NKCA 4IBNA 3K5NA 1VSJA 3QEPA 3KTQA 2Y1JA 4J2EA 3M8SA 3F73A 5HP1A 2XO7A 1SV5A 1Y97A 4F4KA 5CZ1A 4ELUA 3VQDA 2G8IA 3AVAA 4CHYA 3I0RA 3NCIA 1C1CA 5CYMA 4W5RA 1L3SA 1WN7A 4KHNA 3T19A 1HYZA 4GMJB 3KJVA 3TI0A 2G8KA 1WAJA 4BWJA 3V1RA 3OYEA 3SV3A 3VQ4A 4M3WA 4FXDA 4BWMA 4KKOA 4TSXA 1LWEA 2FBTA 1QS4A 5HLFA 4IKFA 5I3UA 4CJUA 1I39A 3NBPA 4M3RA 4E1NA 3LWLA 4FJJA 1UA1A 3NGIA 1D5AA 3O4NA 1NK4A 3WNEA 4HVJA 3AVIA 4CHQA 3LP3A 3TWHA 3VQPA 1XI1A 1HYSA 2HB5A 5SWMA 4KO0A 3OYMA 2GUIA 3VA3A 3V9XA 2HW3A 4FLYA 2ITGA 3QLHA 3ZSVA 3V81A 2XY5A 1X1PA 2YNFA 3ASMA 3S3NA 4NYFA 4DTPA 5KGXA 1QSLA 1XHXA 2YHBA 3SUQA 1JLGA 3VQ5A 3AO5A 3ZSWA 1WSHA 4KHSA 1VSLA 5D3GA 4KV8A 1F21A 1VK0A 2VG7A 3OYNA 2KW4A 3SQ4A 1Z26A 3HPHA 2XY7A 1L3VA 3RWUA 1O1WA 4FZYA 4KREA 4N41A 3OYAA 3S3OA 1RT7A 1KFSA 4CJSA 2YV0X 1CXUA 1MU2A 3VN5A 4H8KA 3HVRA 2EX3A 1C0MA 1LV5A 4ELTA 4CF9A 4E7JA 3IAYA 4CGFA 4E1MA 3TAEA 4DSKA 3EYZA 4HCCA 3HP9A 3VQ8A 1JL2A 3ZCMA 2PZSA 1KCFA 4IG0A 2O4GA 1NK6A 3L3VA 1UA0A 4O0JA 3NGZA 3OYKA 3L8BA 1A5WA 3SQ0A 4E3SA 3LAMA 2HNZA 3OY9A 5K14A 4LSNA 4KI4A 4Y1CA 1IG9A 2HVIA 4DU3A 4O44A 4CIFA 4HHTA 1TGOA 4CCHA 1B9FA 1HMVA 4ID5A 1TVRA 3DLHA 1NOZA 3SI6A 1RBVA 2IGIA 3DMJA 1A5VA 3K2PA 5HRNA 1TKZA 3M8QA 4KTWA 1KSPA 2HHVA 1RDDA 4DTSA 1BIUA 1TV6A 3SCXA 1TL3A 3OS1A 4BE2A 4CJEA 1C0TA 2VWJA 4RG8A 4IFVA 4CF0A 3IS9A 4B08A 3ZSZA 4FLWA 1C6VA 4CEQA 4FW1A 4CEZA 3SV4A 1KTQA 4AHVA 4OKEA 3MXJA 3QIPA 1G15A 3WNHA 3DLEA 3VQ9A 3VQEA 1UAXA 1SUQA 3CFRA 3RMAA 3SQ1A 3FFIA 4CFCA 3DRRA 4CEAA 3TAFA 3KIOA 3NF6A 4E89A 3K58A 3P1GA 4LD0A 1BCOA 3DM2A 3ZSQA 4B9LA 4M42A 4J2DA 1VSEA 3V9WA 4DQPA 3C6UA 1XHZA 3BDPA 3PO4A 1A5XA 3TANA 3QEWA 2P5OA 3DRPA 4OGCA 4CGHA 1WAFA 3BGRA 1VRTA 1XWLA 3SZ2A 5HBMA 2PYJA 4Z4IA 5JS1A 3SUNA 1JLQA 1UWBA 2F8TA 1U48A 4CESA 2AJQA 4ID1A 1JLCA 1IKXA 4KTQA 3NGYA 3AA4A 2ETJA 2HNYA 4M45A 4CF1A 3O3FA 3OS2A 3K5MA 3ULDA 1SKSA 5FRMA 1HJRA 2BANA 2BE2A 1N5YA 1J54A 3KKSA 4ICLA 4K8ZA 3ALYA 1WNSA 1WSGA 1BQMA 1S1VA 1WSFA 2NUBA 4FLZA 2A1SA 1WSIA 4OVLA 3MAQA 4JRQA 4HUGA 3TAGA 1L3UA 3VQAA 5HRPA 5HROA 2VWKA 4QAGA 3G0ZA 4B8AB 4NCGA 4CFBA 3C95A 3A2FA 4BE1A 1R0AA 3JSMA 4B9SA 2KFNA 2OZSA 1TAQA 2YHAA 3HO1A 2X74A 4Z4HA
chains in the Genus database with same CATH superfamily
1ASVA 1NGEA 4CJTA 2F8SA 3D2FB 2Q1NA 4YDUA 3SMSA 2AP1A 3SAFA 4DTOA 4KB0A 4CHOA 1ATSA 1VSHA 3RTVA 3O8MA 4XIUA 3ZT0A 4B3TK 2GWJA 4FJXA 3LALA 3S9HA 3MXIA 4G9ZA 4FJHA 3UKUA 1JCEA 1EWQA 2BH1A 2KLAA 5F1XA 1XQSC 2X6SA 3CHWA 4CEFA 4JI1K 4RW8A 3RSEA 4XH5A 2HHTA 3DLRA 3B6OA 3M8RA 1WBDA 4RW4A 1LAWA 3TSQA 1FXXA 5M1QA 5JVHL 4A2AA 3BEXA 4FJGA 1S9EA 4CI6A 3QESA 3QO9A 1VSDA 2GWKA 4BRNA 3AO2A 1TYQB 1FK9A 3R6MA 3WT0A 1K6YA 4LF9K 3VOVA 3R9PA 2FBYA 4FWQA 1RBUA 5AQXA 3T3FA 3FZLA 5AQSA 4XH1A 3THWA 1N33K 2R7YA 4CGJA 3M6GA 2QWRA 2W42A 1YTUA 1JJ2M 4GVMA 4CJQA 4B9NA 3T7ZA 1GLCG 2XRIA 1HPZA 4YOUA 4CZFA 4DV6K 3LPTA 2E2QA 5AQFA 4A2BA 1VQ8N 3DOKA 3WNFA 1ESVA 4HTLA 1IKWA 5ADXH 2QXLA 1R59O 3FE1A 2KQ2A 4N5SA 1BA1A 1HPMA 4CJRA 4EHUA 5A2QO 3VQCA 3V1QA 2YNIA 2E4LA 3LAKA 1EP4A 3EKSA 2DY4A 4K42A 3OYBA 1EO1A 1RFQA 4LSLA 4E7KA 3RR7A 4B9UA 3HXMA 4CJ5A 3LP1A 4KB1A 1LWCA 4BRMA 3H08A 3KK3A 4B8CA 5AQZA 2P51A 4LF7K 2KFZA 5AQQA 4C8KA 1S1XA 4IO9L 2A6AA 1JLAA 1JKHA 1Y64A 1IBKK 3G6EN 1TKXA 4KFBA 4B9QA 2HHQA 1HNZK 3SLCA 1GLFO 3J8AA 4N47A 3AVMA 4MFBA 1YHQN 2O8BB 4IEEA 4JD2A 4JK8A 4Z94A 1RDBA 1KAYA 3HOSA 3KKRA 1S1WA 4RW6A 2I7NA 3NAEA 1HQEA 1RDWX 2P9KB 3VQ6A 5J2QA 3MXMA 5AR0A 3ZSYA 3SNNA 4K41A 2BTFA 2D0CA 4JS4A 3J7AP 2Q31A 3C0BA 2I7PA 5JICA 4RWTA 1HRHA 5GADP 1RT3A 3AV9A 4JK9A 2QWOA 1KQSM 2OZMA 1DLOA 3AO1A 1DGKN 3I33A 1WUAA 4H5TA 3W0LA 2FBVA 4DTJA 4CFAA 4JKFA 3H6EA 3F2KA 4GV9A 5GINA 4Y0WA 3VQ7A 5HRSA 1DTTA 3NF7A 4CD1A 4B9MA 3AA3A 4JI8K 2WC9A 3IFRA 1HKGA 3VQQA 1Q81O 1Z05A 1D9DA 4BDZA 3HJFA 4M3UA 1BG3A 2AA4A 2ATQA 2UUBK 1XUPO 5GIPA 5KRSA 4KTZA 4F2RA 4IDKA 2Q3SA 4KHQA 4AHTA 1RT6A 4BVPA 3QEXA 1C1AA 4OJRA 5FLXO 4FM1A 5AQYA 1NK0A 1CXQA 2PYLA 4LF6K 5FPEA 3Q7CA 3OYLA 1SZ2A 5KGWA 1C0UA 4IFYA 3PX4A 1WOQA 4EZ9A 4I6MB 4CJVA 2YHYA 5DK5A 1JLFA 4FW2A 1NGJA 4DFKA 4DU1A 3KWGA 1N6QA 1G99A 3MMVA 1T05A 1X9WA 1XC9A 3CQ8A 3OS0A 2OYQA 4C1NK 3SUPA 4AHSA 4DCHA 1T03A 3E9OA 1BUPA 4IDHA 3CCUN 5M1KA 2IIRA 4X62K 3JXUA 4JHDB 3ZSXA 2PBDA 4M3YA 2JWLA 3CCQN 3TABA 3BF1A 1IO2A 2F96A 4IG3A 1NK5A 3R3LA 4BRFA 3THYA 3ENBA 3OYJA 3GOIA 3CG7A 4DS4A 3HPOA 2FSKA 3QBXA 3LP0A 4B1YB 3TU5A 2P1JA 5CZ2A 1HYVA 5AZIA 4JI0K 1GLDG 3U4LA 4DR3K 3D2EB 1X3MA 4DMNA 4G1QA 3F9MA 4DWIA 3NE6A 4FJKA 3LZIA 1VQ5N 3A5MC 3VTHA 3VEOA 2OTLN 3CJCA 2G8VA 2WOMA 2DFHA 2F7TA 1IG8A 3IMXA 1VQMN 2NRXA 4FZZA 4AHUA 4I2PA 4BR9A 3KD1E 3HL8A 4DF4A 4DTXA 4GKKK 3S41A 3ZX2A 3V9SA 4ILHA 1DT9A 5M1FA 4LF4K 1NWKA 3K59A 4PL8A 3ZEUA 2NRHA 4JI4K 3OJUA 1QE1A 1ZXOA 5BRHA 4EHTA 1VSJA 4J2EA 2Q2RA 3EZWA 1SV5A 3CJ7A 3H3OB 4KHNA 4OPAA 3TSUA 3KJVA 1WAJA 3V1RA 4DQ8A 5C2DA 2NRVA 4TSXA 3CERA 5HLFA 4CZLA 1I39A 1TUYA 4OO1J 3LWLA 3EKUA 4FWRA 3TTCA 1D5AA 1OH8A 4FWPA 1E4FT 3H46O 4ISEA 1HYSA 2HB5A 2QM1A 3OYMA 2HW3A 3V9XA 2ITGA 3MCAB 1K8KB 3HRGA 2YNFA 5BN9A 3ASMA 4OLAA 2YHBA 3SUQA 1JLGA 3VQ5A 1SQKA 4KHSA 3LDQA 4KV8A 1F21A 3OYNA 2VG7A 5KPRA 4PWDA 5AQWA 3OYAA 1RT7A 3VTIA 3H3NO 5CE3A 1N34K 1CXUA 1MU2A 3VN5A 4DR6K 1JCFA 4C23A 4ELTA 4E1MA 3TAEA 3VEYA 3EYZA 4HCCA 3VQ8A 1NK6A 3L8BA 3PLAA 3LAMA 2HNZA 4LSNA 1IG9A 4ILGB 2IGIA 5HRNA 2HMPA 3P39A 4KTWA 4DTSA 2HHHK 3SCXA 3OS1A 4BGBA 4X64K 4YY3K 4CF0A 3IS9A 4BR4A 1C6VA 3SV4A 1KTQA 4AHVA 4YHHK 3PIPL 3VQEA 1UAXA 3BF3A 3FFIA 4CFCA 4CEAA 3NF6A 4LD0A 5AFUH 2HBJA 4J2DA 1VSEA 3V9WA 4DQPA 3PO4A 3O9SA 3QEWA 2P5OA 4MDAA 3BGRA 3VGKA 2PYJA 1QVFM 1U48A 3LDNA 1JLCA 4KTQA 3WEEA 1U6ZA 3OS2A 5CR4A 2BANA 2BE2A 1N5YA 1WNSA 1WSFA 2NUBA 2A1SA 4A61A 3CC4N 4JRQA 4HUGA 4WF9L 3VQAA 4NCGA 4BE1A 3A2FA 4B9SA 3O80A 3HO1A 2IVOA 2ITMA 3DAWA 3A5LC 4NLBA 4AHRA 4CW7B 3OYFA 3M8PA 4BRLA 4B1WB 4I9QA 4EP5A 1JCGA 3VERA 4BDYA 1X9JA 4E0DA 2NLXA 3THVA 1QQOA 1YIJN 4A57A 5JS2A 1WBBA 4DFPA 2O8FA 2DFEA 3D0PA 1TUUA 4DTUA 2V7ZA 4JKAA 3THWB 1JLBA 1NGGA 3KZBA 2VQEK 4DSEA 4I9LA 3CC2N 4QCLA 1M90O 1NG9A 1KC8O 3CCLN 1NK9A 4K0KK 3O9TA 4W5OA 4QS9A 3P31A 3WQTA 1ZBLA 4QS7A 4WFNL 4DSLA 1VSIA 1EXQA 1CLQA 3L2QA 2QXFA 2OCEA 3DWLA 1HJOA 1QTMA 3VETA 5C24A 2X6NA 4CHZA 3I8DA 3SJJA 1BO5O 4MDBA 1MWMA 3KLIA 1NGCA 3HOTA 3OYHA 4CZMA 1HNWK 4NO7A 2YKMA 4F2SA 5M1PA 3LM9A 3VF4A 4RCHA 5IWAK 1X9MA 5C0YA 3AO4A 1U49A 4ZTFA 3NVMA 1FKPA 3ZSRA 2ZJRL 1NJXA 4GNIA 4RW7A 4FK0A 1U4BA 5B8HA 5DMRA 3DYAA 1VQ9N 1S5JA 3SPZA 5BREA 2P9NA 4JD2B 4A5BA 2D0OA 4CGDA 4M41A 4AILC 3NDKA 3PSFA 4CECA 4CK1A 4CZKA 2QA4N 3AA2A 3FR0A 1CZBA 4DR5K 1BI4A 1V4TA 5ADXA 2YJFA 1LW2A 1Q18A 4FWKA 5J2MA 4BRKA 1NGIA 1EX4A 4CIEA 2P9IB 2YI1A 3QFPA 1EQYA 2E1YA 2YX6A 1EWRA 3QEIA 3CCEN 3LP2A 1GLJO 4PL7A 3NH0A 1Q9XA 4FL9A 4FLXA 2HBLA 4CF8A 1FKOA 3DJCA 4Z4EA 3SPYA 5AQGA 1L5UA 2BDPA 1KXPA 1ZBFA 2YHXA 5AQHA 5H1SQ 4DV1K 1C1BA 4LFBK 3EEQA 1S1UA 2YNHA 4E1JA 2E8AA 3ENOA 2GBZA 2QWMA 3HZ6A 1QQCA 3IRXA 4DG1A 4M3XA 3MX5A 4ELVA 2YHWA 4FWMA 2G8WA 3CI5A 2LSNA 3CFPA 3MN7A 4NXNK 1BQNA 1VSKA 4DV5K 5JMVA 1QHAA 4UQGA 3N4PA 1NM1A 2UUAK 4I7FA 3KLFA 4K43A 3TAMA 4Z4CA 1RTJA 4M7YA 3CMAN 3CCVN 1S72N 3AO3A 1JLEA 1HNVA 3I56N 3MX2A 4DTRA 5KTQA 5KQDA 1MWKA 3HT3A 1NK8A 5AQOA 2VYPA 2KZZA 4ISFA 1NOYA 5KQ8A 4H0PA 2E2NA 5T7BA 4E7IA 5AQNA 1W0HA 1NGBA 5HL7L 4CHPA 4FK4A 1LAVA 3HPGA 3ITHA 2OPRA 4DSJA 2RE2A 1Q9YA 4DQQA 4PA1A 5M1OA 4YDUC 4DKWA 4DSIA 1C0FA 4BC3A 4CJPA 3ZETA 4FCYA 3QNNA 1L3TA 4F3OA 5EVZA 1JXEA 4H4OA 1BHLA 3NF8A 4FLVA 4MO5A 3THYB 1JL1A 1HKBA 4PHTX 1OVQA 1T44A 5CY4A 3AVLA 2Q0UA 5AZIB 4QOZB 3WNGA 3EZ5A 5BPLA 2VQFK 3UKRB 5HOOA 1NU0A 1KRPA 2E6MA 3OTOK 2Q0RA 1TK5A 3A0IX 4FJNA 2XY8A 3FZMA 3THXA 2QKKA 1RGIA 3DXMB 2RHKA 4Y1DA 2DTUA 1SL1A 5AQIA 1E4GT 2NRTA 1ZBUA 4IO8A 3C6TA 1JXBA 5EXWA 4NCBA 4GV6A 4C8LA 1EKEA 4H0OA 2WTUA 1W9HA 2CH6A 3BP8A 4KI6A 1NJIO 4MLEA 4HCBA 4K25A 2XHBA 4L3QA 4CJ7A 2JLEA 2F9WA 4CFDA 4GVEA 3MEEA 4BE0A 2OPPA 4DLEA 3O9QA 3VGMA 4KH5A 2VGMA 1ILYA 3EO3A 3AVCA 3AAPA 4PKGA 3KWIA 3V6DA 1HKCA 5ELZA 4R79A 2UXBK 4H0TB 4JKCA 5LMNK 5J2PA 1Z6RA 2ZJPL 3O4QA 4BGAA 4CBUA 3QB0A 1NJYA 4E7HA 3QNOA 3OA9A 3RMBA 4FZXC 1XNQK 1D8YA 4JKHA 1RTHA 4DV3K 2Z1GA 3TARA 4CBWA 1NJWA 3UIQA 1T7PA 5DM7L 2OA8A 1XMOK 3CCMN 3OYGA 3CF5L 4B3RK 1OH7A 3O5BA 3QEPA 3F73A 2XO7A 1MA9B 2G8IA 3AVAA 3O1BA 4CHYA 3AGKA 3I0RA 1C1CA 5CYMA 1WN7A 1HYZA 4IJNA 2G8KA 2ASMA 2A42A 2GX9A 2VCPA 4BWMA 3J7YP 4JV5K 4NB4A 3A5OC 2JWKA 4M3RA 4E1NA 1UA1A 2D0PA 3O4NA 5I9EB 1NK4A 3WNEA 5JLFA 2KKZA 4CHQA 3TWHA 5SWMA 4FLYA 3QLHA 3CETA 3VEXA 2O8EA 4JI2K 3S3NA 1YAGA 2ASPA 3ULEB 3AO5A 3ZSWA 1VSLA 4RTFD 2KW4A 1Z26A 1QZ6A 3HPHA 3VPZA 4CJSA 3MCPA 3ZX0A 1CZAN 4WQ4A 4DR2K 1LV5A 3M5RA 2E20A 4CF9A 2P9PA 5JLHA 3IAYA 3CCSN 1JL2A 3ZCMA 3WEEB 2O4GA 3L3VA 3NGZA 3P38A 5K14A 1C0GA 1VQPN 4O44A 4CIFA 3NVKA 3DLHA 2E1ZA 1KSPA 1TL3A 4CJEA 1TYQA 3C6AA 4B08A 4FW1A 3MXJA 4KH6A 3DLEA 3TTDA 3VQ9A 2FSNA 3CFRA 3TAFA 3QICA 2O8FB 3SJHA 4BVOA 3SZ2A 4Z4IA 5HBMA 3SUNA 4A59A 1JLQA 2F8TA 1T6DA 4ID1A 3ENHA 4DV0K 3AA4A 2ETJA 2HNYA 4WQ5A 3K5MA 5C15A 5LL6Z 3KKSA 3ALYA 3TAGA 3C65A 5HRPA 2VWKA 4QAGA 2E88A 2A40A 3U8XA 3C95A 5TKYA 4B8AB 3K9KA 2YHAA 4FOEA 4Z4HA 4IZ9A 5BR9A 4CZGA 3E1YA 5FRNA 4YOXA 3MN6A 3JYTA 4YOVA 3HVTA 2GELA 3TAPA 3VF6A 2B5JA 2D5RA 1OH5A 4ISGA 4DTNA 2IAJA 3SBTA 5KI6A 4FM0A 1SKWA 3PO5A 1ZBHA 2WFBA 4IOCL 4BRDA 4FJ8A 2CH5A 1LW0A 2HNDA 1ASUA 3K9JA 1BGXT 4O5BA 1U2VA 1RBRA 1QSSA 4C8MA 2QK9A 2A5XA 1S6QA 3EL2A 3ID6A 4AF1A 4H5NA 4YOYA 1MDUB 4H5WA 3OYCA 1ASWA 5TKWA 3V1OA 3V9UA 5EOYA 4YFUA 4A62A 4BQLA 4ZTJA 1QVGM 4Z4GA 3DXKA 4JRPA 2O8BA 3CM5A 1Q8IA 5BRFA 3P5JA 1K9MO 2Z1JA 3CJAA 3ZX3A 2P9LA 3L4IA 1KAXA 1RT1A 4KRFA 1N32K 3G4SN 1V4SA 1KVBA 2P9KA 2V51B 4LH5A 4PQUA 2QI2A 3HSTB 2A1RA 3FLCO 3LDPA 1RT2A 3Q7BA 5AQLA 3KLEA 3T1AA 4KHWA 3FZFA 2Q97A 3MN9A 5E84A 3VEWA 2GUPA 4BREA 4FVMA 5GIOA 3U6FA 3DLKA 3WXKA 3O6WA 2HSTA 1ZBIA 3RR8A 1OH6A 4PKIA 5MLCQ 1GLEG 3VF2A 4F9OA 4EZ6A 3OYIA 2O8CA 3PY8A 1RCHA 1B92A 3SQ2A 3E9LA 3RMCA 4B9TA 3AA5X 4KPYA 1NGAA 3FGUA 3PX0A 4WCEL 4H4MA 1S3XA 3E66A 2IVPA 3F9KA 3MEDA 4M63C 3P4IA 3UKUB 5GAHP 2NRZA 4MLHA 3U9DA 4FJ5A 3OW2M 4IJAA 3RSEB 3G25A 4BC4A 1UOCA 3PSIA 4LC9B 3ZT1A 1D9FA 3TSPA 1YVUA 1FW6A 4KHUA 3EY1A 2GV9A 1OVYA 4H0YB 5FPMA 3L2WA 3J7ZO 4DUYK 1S6PA 4U67L 2RN2A 3C94A 2HBMA 3SUOA 3OBYA 2P5GA 4KHYA 4GKJK 4PUOA 3ATVA 1NMNA 4JNEA 1S22A 5AJ3K 3WXMB 1I94K 3HK2A 4FVUA 4DQSA 5F0XA 2HHUA 1HX1A 5KPTA 4FJ9A 4CJ3A 3SAGA 3TR8A 4KH4A 4JHDA 4O4GA 3AARA 3BY5A 3CFOA 3T1HK 4CJWA 3GL1A 2KZMA 2A41A 3WQUA 2O8DA 3GDQA 1J6ZA 2IDOA 3C6HA 4BG9A 4FJ7A 4H5VA 3ZETB 3NF9A 4KAZA 2FBXA 3U3GA 2D0AA 3AVBA 4JN4A 3CJ1A 2BGGA 4OPKA 5JVGL 4OKKA 4RW9A 1YTAA 4NCAA 4CK3A 1GOCA 1YF5L 3O1WA 2A3ZA 3G10A 4FO0A 2B6AA 3GE1A 3IUCA 2G8FA 1KLMA 1ATRA 3B6PA 1HR0K 2W40A 4CEEA 5AZJA 3THXB 2P9SA 2HHXA 3W3DA 2FF3B 4ZHRA 3DLGA 3PV8A 2IC3A 4CEDA 2NZTA 3CIPA 1XNRK 1O13A 3K57A 2E2OA 4M3ZA 3QFUA 3VGLA 3KK1A 4BRCA 4BR2A 2QWPA 4DB3A 3EE8A 3UB5A 4FWSA 2P9UA 1NGDA 3K5LA 3K0SA 1NLVA 3CD6N 3SAHA 3V4IA 3WXJA 3C7NA 3D6RA 3QEVA 2NNWA 1HNIA 1RT5A 4GW6A 4JKGA 4DR1K 4FPBA 4YNQA 1SKRA 1TK8A 4JYAK 4JKDA 3FZKA 2E5LK 4FSVA 4CVNE 2OPSA 3AVKA 4N76A 2D4WA 5BPNA 5LJWA 4N56A 2I5JA 2YJEA 4C8NA 2HVHA 3QMLA 3LPUA 3SYZA 4X66K 1K8KA 4B3OA 3AVNA 4BY9C 1HNXK 2VG5A 3M3ZA 2KTQA 3CM6A 4JKBA 3EN9A 5KRTA 2J4RA 3RRHA 1YVNA 3MWTA 5E41A 2OTJN 2HF3A 2E2PA 3RRGA 2F9TA 2O4IA 4IEIA 4JLHA 3LDLA 4LFCK 4W5NA 1J53A 3MECA 2KHOA 3AVJA 4R5PA 2OANA 2ZGZA 3RVCA 2HMIA 1CZ9A 3VENA 2ZJQL 4CJLA 1DTQA 2GTDA 1U04A 4BC2A 4B1XB 1Z25A 1DKGD 4JAXA 4GV3A 1RDAA 2FC0A 3K5OA 4PY5A 2DFFA 1KAZA 3J80O 2O8EB 3WUHA 3DOLA 4OGEA 3NHGA 3AAQA 1W7AA 2IOCA 2ZWHA 1RTDA 4AHCA 5BN8A 1IKYA 2GEMA 5AQTA 1LOTB 2QKBA 2G8HA 1NKCA 4IBNA 4JKEA 3KTQA 2Y1JA 2P9PB 4F4KA 4ELUA 4JEPA 3F5TA 4DV7K 3E9PA 2NRRA 3VQDA 1L3SA 3T19A 3TI0A 4GMJB 3MWPA 3OYEA 3AGRA 4FXDA 1LWEA 2FBTA 4CBXA 4B3SK 4IKFA 4CJUA 3KHYA 4FJJA 3NGIA 3M1FA 3B8AX 3AVIA 4KO0A 2GUIA 3U9ZA 3LL3A 3O08A 3V81A 2XY5A 1HLUA 4DTPA 5F2RA 3KVGA 1XHXA 4Q0BA 5AQJA 1WSHA 5D3GA 2IVNA 1VK0A 4JI6K 4AM6A 4BRIA 3SQ4A 3RWUA 3QBWA 4FZYA 5JS1A 3S3OA 4IOAL 2YV0X 2CGKA 3HVRA 2EX3A 3DLLL 1C0MA 3CJBA 4CGFA 3HP9A 2PZSA 1KCFA 1ATNA 1UA0A 3SQ0A 1QQMA 4E3SA 4CZJA 1NBWA 1VQLN 4KI4A 4DU3A 1TGOA 2V52B 1NMDA 4QS8A 1HMVA 2Q36A 1TVRA 4ID5A 3CCRN 1NOZA 3SI6A 4KHPK 4BR7A 1RBVA 1A5VA 2EWSA 2HHVA 1T6CA 1TV6A 4BE2A 3HTVA 2VWJA 3SMPA 4IFVA 2W6LA 3ZSZA 5AQVA 1G15A 1SUQA 2QTDA 3SQ1A 1W2BM 3KIOA 4M42A 5AQMA 3K58A 3P1GA 1BCOA 3BDPA 3TANA 4LF8K 3DRPA 4CGHA 1VRTA 2FXUA 3ZEUB 4BRGA 3CQXA 5AQKA 4CESA 5E26A 1IKXA 4CF1A 3O3FA 1SKSA 3LDOA 1HJRA 3L6QA 4ICLA 1BQMA 4B1ZA 4FLZA 1U2VB 1WSIA 4OVLA 3MAQA 4BROA 4C1NI 2UU9K 5HROA 3A5NC 3G0ZA 1R0AA 1VQ6N 3JSMA 3FFKB 1BU6O 1TAQA 2X74A 3GG4A 4H0VB 4HUFA 1S1TA 1U45A 3KLGA 4I2QA 3OHRA 3ZSOA 3DXKB 3HBTA 3VEVA 4BRAA 4E19A 2DPNA 4JI5K 1X9SA 2P9LB 4NLCA 5AQUA 3BZKA 1QSYA 4O5FA 1TKDA 1NKBA 1D4XA 3I8BA 1I3AA 3H1QA 3OVNA 3S3MA 2WONA 3V9ZA 2YNGA 3TTFA 2B4JA 1B9DA 3MK6A 5FDLA 2P9IA 4BC5A 4EAHD 3KK2A 4J2BA 1U47A 1KD1O 1BISA 5C10A 4DR4K 4WE1A 4CK2A 1KVCA 2WBNA 3LWMA 1RNHA 3VMFB 5EX5A 4CHNA 4ILJA 5J2NA 3PX6A 4GY2B 5EY4A 2XY6A 3L2RA 4WFAL 2O8CB 4WFBL 4DQRA 4DTMA 1HUXA 5AQRA 1RDCA 2ASOA 3D2FA 3OJSA 2Y1IA 5C25A 3D7EO 4XEIA 4FJIA 2VGNA 3LZJA 1KLNA 2QWNA 2YKNA 2F4VK 1RDUA 3HM9A 3ISNC 1IBLK 5KPZA 2QW9A 1XC3A 3U3YA 4JK7A 5C42A 3DLBA 1J9AA 3TAQA 4HUEA 4FYDA 2HOEA 4B3MK 1Q86O 2FSJA 1T3VA 1WSEA 1IV0A 1Q7YO 1M1KO 4MQ3A 3H1VX 3DI6A 4Z0UA 4OLBA 1TKTA 3L3UA 2NRWA 3A8YA 4FWLA 2X78A 4E7LA 1HQUA 1IKVA 4O55A 1KVAA 4H0XB 3MEGA 3O3GA 5HRRA 2JGUA 1Q82O 1N8RO 3E01A 2Z1HA 4LF5K 3JS6A 4NYNA 2Z1IA 3O4WA 2HHWA 4W5QA 1YJ9N 4O0IA 3MN5A 4B1UB 5SZTA 1P8ZA 2WUSA 4CZEA 3D45A 4DSFA 3T69A 3NH1A 1NKEA 3VA0A 4B9VA 2IS3A 3DRSA 4L8RB 3WXLA 1WLJA 3IKMA 2O8DB 4DFMA 2W41A 1RBTA 4WYBA 1TK0A 1SL0A 4K8XA 5AFUA 3LM2A 3NFAA 1VSFA 3HP6A 4YOTA 1TL1A 2E6LA 3HSCA 3T1YK 3QDKA 4WQ4C 1YITN 4YORA 2HF4A 3N4QA 1VRUA 3EE9A 3ZT2A 4DUZK 3ZT3A 4M3TA 1QZ5A 1TAUA 4FWNA 3BZCA 4CEOA 1VSMA 4U7BA 3UKRA 4A5AA 2FLOA 3O3HA 4FJLA 4FLUA 2RPIA 4BRPA 1S9GA 4BDPA 2YCHA 5EU7A 5AZJB 2P9SB 3DXMA 4DFJA 5I42A 1YJNN 5LY3A 4DS5A 2UUCK 4O8KA 1WSJA 4FPAA 4CF2A 4CERA 4DF8A 4C8OA 4J2AA 3HM8A 2PY5A 1DEJA 4IXCA 1OKJA 2W6KA 3AVFA 1VHXA 1RT4A 3VESA 3LANA 5CYQA 3KLHA 1YT3A 4KBOA 1IH7A 5BR8K 3SBGA 1GLAG 4DHYA 2P9UB 2ZD1A 3GBTA 5AQPA 2UYTA 3BUZB 1NJZA 3TPQA 3CMEN 5LJVA 1ITGA 3C7NB 1BL3A 1EETA 3O9UA 4W5TA 1K8AO 4FWOA 5M1NA 5J1EA 4DQIA 3HI0A 4JKGB 1E3MA 4WQ5C 4FLTA 4DV2K 4LFAK 3FZHA 4LH4A 1QHTA 2P9NB 4FK2A 2ZGYA 4EP4A 3L4QA 1VQON 2OPQA 3I0SA 3PUFA 2UXCK 3CYMA 3CJ9A 3QIOA 4M7XA 1YI2N 2H3GX 3IDHA 2HHSA 4X65K 5IT9O 4IWVA 1SL2A 1BI4B 4JS5A 4FJMA 2FF6A 1RTIA 4DU4A 2VG6A 4FOIA 1GOBA 4OPHA 3HYFA 4OKJA 4CGIA 4CJFA 5FROA 4Z4FA 4IOXA 4LY7A 3UE5A 3QETA 1NK7A 4DLGA 3ZLJA 2CGLA 3R1XA 1RILA 3LDSA 1BWFO 4HTUA 4JI3K 3L2UA 4CEBA 2BUPA 4BRQA 3JAMO 3P83D 4HWIA 2ZQBA 4AM7A 2D1KA 4AH9A 3OYDA 4CIGA 4BR5A 1BIZA 1BCMA 4AQYK 1BOTO 3VEZA 5LMUK 4J8FA 5GAGP 1P90A 3L2VA 1H1VA 1YUWA 1REVA 1K73O 4FM2A 3ULEA 3G71N 1QQNA 4H5RA 3QERA 2G8UA 4YOWA 4CGGA 4JI7K 5C2FA 4H03B 2HBKA 2ZE2A 3RMDA 4MO4A 1LWFA 3NH2A 3CC7N 4I6MA 4CJKA 3CXCM 1NGFA 1J5OA 1ZBSA 1GOAA 2D0BA 1RBSA 1J5EK 3VQBA 3KK7A 3AVHA 3IG1A 1W97L 5CHIA 2EHGA 1VQNN 4OX9K 3KD5E 4OPJA 4BR0A 2ZM6K 4F3TA 2V7YA 1X3NA 4DV4K 3ZT4A 4Q5VA 2RKIA 1IJJA 4XH4A 3CPEA 1T8EA 1IBMK 1GLLO 3QINA 4BACA 4CJ4A 4BG8A 4O8UA 4CE9A 2RF2A 3CQYA 3CCJN 1KFDA 3ID8A 1N36K 3SK3A 3ATUA 1VQKN 3AVGA 1ZYQA 3K5NA 3M8SA 5HP1A 1Y97A 5CZ1A 3WXIA 3I55N 3NCIA 3D2EA 4W5RA 1NNEA 4BWJA 5BRDA 3SV3A 3VQ4A 3CPWM 4M3WA 4KKOA 4CD3A 1SAZA 1QS4A 5I3UA 4PKHA 4BQZA 3NBPA 3MDQA 4EIAA 5FPDA 4HVJA 1XI1A 3LP3A 3VQPA 3VA3A 5DM6L 1BDGA 3ZSVA 4BRHA 1YJWN 1X1PA 4NXMK 3AY9A 1VAZA 4NYFA 2PFUA 5FPNA 5KGXA 1QSLA 4F8RA 1L3VA 3PIOL 4KREA 2XY7A 1O1WA 4N41A 1KFSA 5BPMA 1NGHA 4H8KA 4E7JA 4DSKA 4IG0A 4O0JA 3OYKA 1A5WA 3OY9A 1FJGK 4Y1CA 2HVIA 4HHTA 1VQ4N 4CCHA 1B9FA 3R8EA 3O9RA 3DMJA 2QWLA 3K2PA 2QEXN 1TKZA 3M8QA 1RDDA 1BIUA 1C0TA 4RG8A 5C12A 1SS6A 4FLWA 4CEQA 4CEZA 4OKEA 3QIPA 3WNHA 1BA0A 3ZYYX 3RMAA 3DRRA 4EFHA 4E89A 4B9LA 3ZSQA 3DM2A 3C6UA 1XHZA 1A5XA 1YXQA 4OGCA 1WAFA 4UY8O 3L0QA 1XWLA 1WB9A 2UXDK 3J81O 1UWBA 4CZHA 4DR7K 4B1VA 2AJQA 1GLBG 1LCUA 4CZIA 1XMQK 3NGYA 3ULDA 4M45A 2ZF5O 5FRMA 2VWBA 1VQ7N 1J54A 4K8ZA 4V19S 1WSGA 2PAVA 1S1VA 3H45C 1L3UA 3OBWA 4IFEA 4CFBA 2CGJA 2QWQA 1ZC6A 5GAEP 3NMUA 2OZSA 2KFNA
chains in the Genus database with same CATH topology
1ASVA 4HUFA 1S1TA 4AHRA 4CJTA 3OYFA 2F8SA 1U45A 3M8PA 5FRNA 3KLGA 4I9QA 4I2QA 3JYTA 4EP5A 3ZSOA 4KB0A 3HVTA 4DTOA 4CHOA 1VSHA 3RTVA 4BDYA 4XIUA 3ZT0A 3TAPA 4E19A 4E0DA 3THVA 1X9SA 2B5JA 5JS2A 4DFPA 2DFEA 3D0PA 4FJXA 3LALA 2D5RA 4DTUA 3S9HA 3MXIA 4FJHA 4DTNA 2IAJA 5KI6A 4FM0A 1JLBA 1TKDA 1NKBA 1SKWA 1QSYA 3PO5A 1ZBHA 1I3AA 4DSEA 3OVNA 2X6SA 4CEFA 4FJ8A 3S3MA 2WONA 4I9LA 3V9ZA 1LW0A 2YNGA 4RW8A 2B4JA 1ASUA 1B9DA 2HNDA 5FDLA 4QCLA 3KK2A 4J2BA 1BGXT 3DLRA 4O5BA 4OLAA 2HHTA 3B6OA 1NK9A 1RBRA 1QSSA 4C8MA 3M8RA 1U47A 2QK9A 1BISA 1LAWA 4RW4A 4WE1A 1S6QA 1FXXA 4CK2A 1KVCA 4FJGA 4W5OA 3LWMA 1RNHA 1S9EA 4CHNA 5J2NA 3PX6A 3QESA 3QO9A 3OYCA 1ASWA 1VSDA 2XY6A 3V1OA 3L2RA 3V9UA 4YFUA 4DQRA 4DTMA 1ZBLA 3AO2A 1RDCA 1FK9A 3OJSA 2Y1IA 4ZTJA 4DSLA 1VSIA 1EXQA 4Z4GA 1CLQA 5C25A 3L2QA 4JRPA 1K6YA 2QXFA 4FJIA 3CM5A 1Q8IA 3P5JA 3LZJA 1KLNA 2YKNA 2FBYA 3HM9A 3ISNC 2Z1JA 1QTMA 1RBUA 5C24A 3T3FA 4KRFA 1RT1A 2X6NA 4CHZA 3U3YA 3I8DA 5C42A 3DLBA 4LH5A 1KVBA 4PQUA 1J9AA 3TAQA 4HUEA 3SJJA 3HSTB 4FYDA 2A1RA 2R7YA 3KLIA 4CGJA 1RT2A 3KLEA 3OYHA 1WSEA 3T1AA 2W42A 4KHWA 1YTUA 4MQ3A 2YKMA 3DI6A 4GVMA 4Z0UA 4F2SA 4OLBA 4FVMA 4CJQA 1X9MA 4B9NA 3U6FA 3DLKA 1TKTA 3L3UA 3AO4A 2XRIA 1ZBIA 1HPZA 1U49A 3RR8A 4ZTFA 3LPTA 1FKPA 3ZSRA 2X78A 4E7LA 1HQUA 3OYIA 4EZ6A 1IKVA 3DOKA 4O55A 1KVAA 4RW7A 3WNFA 1U4BA 1NJXA 3PY8A 4FK0A 1RCHA 5DMRA 1IKWA 3MEGA 3DYAA 3O3GA 5HRRA 1B92A 1S5JA 2JGUA 4N5SA 2KQ2A 3SQ2A 3SPZA 3E01A 2Z1HA 4CJRA 3RMCA 4NYNA 3VQCA 4B9TA 3V1QA 3AA5X 4KPYA 2YNIA 2Z1IA 3PX0A 4CGDA 2E4LA 2HHWA 4M41A 4W5QA 4AILC 3NDKA 3LAKA 4CECA 4H4MA 4O0IA 3F9KA 1EP4A 3MEDA 5SZTA 4CK1A 2DY4A 3OYBA 4LSLA 4E7KA 3AA2A 3D45A 3RR7A 4B9UA 1CZBA 1BI4A 4DSFA 3NH1A 3HXMA 4CJ5A 1NKEA 3VA0A 3LP1A 4B9VA 2IS3A 1LWCA 3DRSA 4FJ5A 4KB1A 1LW2A 4L8RB 3H08A 3KK3A 5J2MA 1WLJA 4CIEA 1EX4A 4B8CA 2P51A 4DFMA 1TK0A 1RBTA 1UOCA 2KFZA 4C8KA 1SL0A 3ZT1A 1D9FA 4K8XA 1S1XA 3NFAA 3QEIA 1YVUA 1VSFA 4KHUA 3HP6A 3LP2A 3EY1A 2GV9A 3NH0A 1JLAA 1Q9XA 1JKHA 1TL1A 4FLXA 2E6LA 4CF8A 1FKOA 3L2WA 1TKXA 1S6PA 3SPYA 2RN2A 4Z4EA 1VRUA 4KFBA 3ZT2A 2HHQA 3C94A 1L5UA 3ZT3A 4M3TA 3SUOA 2BDPA 1TAUA 1ZBFA 4N47A 3AVMA 4CEOA 1VSMA 2P5GA 4MFBA 4KHYA 1C1BA 4PUOA 1S1UA 3O3HA 2YNHA 4FJLA 4FLUA 2GBZA 2RPIA 1QQCA 1S9GA 3IRXA 1RDBA 4DG1A 4M3XA 4BDPA 4ELVA 3HK2A 3KKRA 5EU7A 4DQSA 1S1WA 4RW6A 2G8WA 3NAEA 2HHUA 1HQEA 2LSNA 3CFPA 5I42A 4DFJA 1BQNA 1VSKA 3VQ6A 4DS5A 4FJ9A 4UQGA 4CJ3A 5J2QA 3MXMA 1WSJA 4CF2A 4CERA 3TR8A 3ZSYA 4DF8A 4O4GA 4C8OA 3SNNA 2PY5A 4I7FA 4J2AA 4PWDA 2D0CA 4JS4A 3CFOA 4CJWA 3KLFA 2KZMA 3AVFA 3TAMA 1HRHA 1RT4A 1RTJA 3LANA 5CYQA 4Z4CA 1YT3A 3KLHA 1RT3A 3AV9A 2IDOA 2OZMA 1IH7A 4FJ7A 1DLOA 3NF9A 4KAZA 2FBXA 3AVBA 2D0AA 2ZD1A 3AO3A 3U3GA 1JLEA 3AO1A 1HNVA 2BGGA 4OPKA 4OKKA 4RW9A 4DTRA 1NJZA 5KTQA 1YTAA 4NCAA 4F8RA 4CK3A 1ITGA 1BL3A 1GOCA 1EETA 2FBVA 4W5TA 4CFAA 3HT3A 4DTJA 5J1EA 4DQIA 3G10A 2B6AA 4FLTA 1NK8A 3VQ7A 5HRSA 1DTTA 2G8FA 3NF7A 1KLMA 4B9MA 3AA3A 4LH4A 1QHTA 3B6PA 2KZZA 1NOYA 4CEEA 4FK2A 5T7BA 4EP4A 4E7IA 3VQQA 2OPQA 3I0SA 3PUFA 1W0HA 3CYMA 3QIOA 1D9DA 2HHXA 4BDZA 3HJFA 4ZHRA 4M3UA 3DLGA 3PV8A 4CHPA 2ATQA 2IC3A 1LAVA 3HPGA 4CEDA 4FK4A 2HHSA 5KRSA 4KTZA 4F2RA 3ITHA 4IDKA 1SL2A 1BI4B 2OPRA 2Q3SA 3K57A 4JS5A 4DSJA 4KHQA 1Q9YA 4FJMA 4DQQA 4M3ZA 4PA1A 4AHTA 1RT6A 1RTIA 4DU4A 2VG6A 4DSIA 3KK1A 3QEXA 1C1AA 4CJPA 4OJRA 1GOBA 4FCYA 3QNNA 3HYFA 4OKJA 4CGIA 4CJFA 5FROA 4FM1A 1NK0A 1CXQA 1L3TA 4F3OA 4LY7A 2PYLA 4Z4FA 3QETA 1JXEA 4H4OA 4DLGA 1NK7A 3K5LA 1BHLA 3NF8A 1RILA 3OYLA 5KGWA 4FLVA 1C0UA 4IFYA 3PX4A 3LDSA 3V4IA 4EZ9A 1JL1A 4CJVA 4HTUA 3QEVA 3L2UA 5DK5A 1JLFA 1HNIA 1RT5A 4GW6A 4CEBA 4FW2A 5CY4A 3AVLA 4YNQA 4DFKA 4DU1A 4QOZB 3WNGA 1N6QA 1SKRA 3P83D 3EZ5A 1TK8A 2ZQBA 1T05A 1KRPA 2E6MA 1TK5A 1X9WA 4FJNA 1XC9A 2XY8A 4AH9A 3CQ8A 2OPSA 2QKKA 3OS0A 3AVKA 2OYQA 3OYDA 4N76A 3SUPA 4AHSA 4CIGA 1BIZA 1BCMA 4N56A 2I5JA 4Y1DA 4C8NA 1T03A 2DTUA 2HVHA 3LPUA 3L2VA 3ZSXA 3SYZA 1SL1A 1ZBUA 1REVA 4M3YA 4FM2A 3C6TA 1JXBA 4B3OA 3AVNA 3TABA 4NCBA 2VG5A 4C8LA 3QERA 1EKEA 1IO2A 2G8UA 2F96A 2KTQA 3CM6A 4IG3A 4CGGA 1W9HA 1NK5A 4KI6A 2ZE2A 5KRTA 3RMDA 4HCBA 2XHBA 1LWFA 3NH2A 3OYJA 3RRHA 3CG7A 2JLEA 4DS4A 3HPOA 4CJKA 1J5OA 2D0BA 1GOAA 3LP0A 4CFDA 5E41A 1RBSA 3MEEA 2P1JA 2OPPA 5CZ2A 3VQBA 4BE0A 3RRGA 3AVHA 1HYVA 3IG1A 4DLEA 2O4IA 4Q0BA 4JLHA 2EHGA 3AVCA 4DMNA 4G1QA 3KD5E 4W5NA 4OPJA 1J53A 3MECA 3V6DA 4DWIA 3NE6A 4FJKA 4F3TA 3AVJA 4R5PA 3LZIA 3ZT4A 4Q5VA 2HMIA 2G8VA 2WOMA 2DFHA 5J2PA 1CZ9A 4CJLA 1DTQA 3O4QA 1U04A 4FZZA 2RKIA 4AHUA 1NJYA 1Z25A 1T8EA 4I2PA 4E7HA 3QNOA 4BACA 3QINA 4CJ4A 1RDAA 3RMBA 2FC0A 3K5OA 3KD1E 4FZXC 4PY5A 2DFFA 1D8YA 3HL8A 4DF4A 1RTHA 4DTXA 2Z1GA 3TARA 3DOLA 4OGEA 1NJWA 1T7PA 3NHGA 3UIQA 4CE9A 2IOCA 3V9SA 2RF2A 4AHCA 1RTDA 2OA8A 1KFDA 1IKYA 3K59A 2QKBA 3OYGA 3OJUA 2G8HA 1QE1A 3AVGA 1ZYQA 1NKCA 4IBNA 3K5NA 1VSJA 3QEPA 3KTQA 2Y1JA 4J2EA 3M8SA 3F73A 5HP1A 2XO7A 1SV5A 1Y97A 4F4KA 5CZ1A 4ELUA 3VQDA 2G8IA 3AVAA 4CHYA 3I0RA 3NCIA 1C1CA 5CYMA 4W5RA 1L3SA 1WN7A 4KHNA 3T19A 1HYZA 4GMJB 3KJVA 3TI0A 2G8KA 1WAJA 4BWJA 3V1RA 3OYEA 3SV3A 3VQ4A 4M3WA 4FXDA 4BWMA 4KKOA 4TSXA 1LWEA 2FBTA 1QS4A 5HLFA 4IKFA 5I3UA 4CJUA 1I39A 3NBPA 4M3RA 4E1NA 3LWLA 4FJJA 1UA1A 3NGIA 1D5AA 3O4NA 1NK4A 3WNEA 4HVJA 3AVIA 4CHQA 3LP3A 3TWHA 3VQPA 1XI1A 1HYSA 2HB5A 5SWMA 4KO0A 3OYMA 2GUIA 3VA3A 3V9XA 2HW3A 4FLYA 2ITGA 3QLHA 3ZSVA 3V81A 2XY5A 1X1PA 2YNFA 3ASMA 3S3NA 4NYFA 4DTPA 5KGXA 1QSLA 1XHXA 2YHBA 3SUQA 1JLGA 3VQ5A 3AO5A 3ZSWA 1WSHA 4KHSA 1VSLA 5D3GA 4KV8A 1F21A 1VK0A 2VG7A 3OYNA 2KW4A 3SQ4A 1Z26A 3HPHA 2XY7A 1L3VA 3RWUA 1O1WA 4FZYA 4KREA 4N41A 3OYAA 3S3OA 1RT7A 1KFSA 4CJSA 2YV0X 1CXUA 1MU2A 3VN5A 4H8KA 3HVRA 2EX3A 1C0MA 1LV5A 4ELTA 4CF9A 4E7JA 3IAYA 4CGFA 4E1MA 3TAEA 4DSKA 3EYZA 4HCCA 3HP9A 3VQ8A 1JL2A 3ZCMA 2PZSA 1KCFA 4IG0A 2O4GA 1NK6A 3L3VA 1UA0A 4O0JA 3NGZA 3OYKA 3L8BA 1A5WA 3SQ0A 4E3SA 3LAMA 2HNZA 3OY9A 5K14A 4LSNA 4KI4A 4Y1CA 1IG9A 2HVIA 4DU3A 4O44A 4CIFA 4HHTA 1TGOA 4CCHA 1B9FA 1HMVA 4ID5A 1TVRA 3DLHA 1NOZA 3SI6A 1RBVA 2IGIA 3DMJA 1A5VA 3K2PA 5HRNA 1TKZA 3M8QA 4KTWA 1KSPA 2HHVA 1RDDA 4DTSA 1BIUA 1TV6A 3SCXA 1TL3A 3OS1A 4BE2A 4CJEA 1C0TA 2VWJA 4RG8A 4IFVA 4CF0A 3IS9A 4B08A 3ZSZA 4FLWA 1C6VA 4CEQA 4FW1A 4CEZA 3SV4A 1KTQA 4AHVA 4OKEA 3MXJA 3QIPA 1G15A 3WNHA 3DLEA 3VQ9A 3VQEA 1UAXA 1SUQA 3CFRA 3RMAA 3SQ1A 3FFIA 4CFCA 3DRRA 4CEAA 3TAFA 3KIOA 3NF6A 4E89A 3K58A 3P1GA 4LD0A 1BCOA 3DM2A 3ZSQA 4B9LA 4M42A 4J2DA 1VSEA 3V9WA 4DQPA 3C6UA 1XHZA 3BDPA 3PO4A 1A5XA 3TANA 3QEWA 2P5OA 3DRPA 4OGCA 4CGHA 1WAFA 3BGRA 1VRTA 1XWLA 3SZ2A 5HBMA 2PYJA 4Z4IA 5JS1A 3SUNA 1JLQA 1UWBA 2F8TA 1U48A 4CESA 2AJQA 4ID1A 1JLCA 1IKXA 4KTQA 3NGYA 3AA4A 2ETJA 2HNYA 4M45A 4CF1A 3O3FA 3OS2A 3K5MA 3ULDA 1SKSA 5FRMA 1HJRA 2BANA 2BE2A 1N5YA 1J54A 3KKSA 4ICLA 4K8ZA 3ALYA 1WNSA 1WSGA 1BQMA 1S1VA 1WSFA 2NUBA 4FLZA 2A1SA 1WSIA 4OVLA 3MAQA 4JRQA 4HUGA 3TAGA 1L3UA 3VQAA 5HRPA 5HROA 2VWKA 4QAGA 3G0ZA 4B8AB 4NCGA 4CFBA 3C95A 3A2FA 4BE1A 1R0AA 3JSMA 4B9SA 2KFNA 2OZSA 1TAQA 2YHAA 3HO1A 2X74A 4Z4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASV A;  4HUF A;  1S1T A;  4AHR A;  4CJT A;  3OYF A;  2F8S A;  1U45 A;  3M8P A;  5FRN A;  3KLG A;  4I9Q A;  4I2Q A;  3JYT A;  4EP5 A;  3ZSO A;  4KB0 A;  3HVT A;  4DTO A;  4CHO A;  1VSH A;  3RTV A;  4BDY A;  4XIU A;  3ZT0 A;  3TAP A;  4E19 A;  4E0D A;  3THV A;  1X9S A;  2B5J A;  5JS2 A;  4DFP A;  2DFE A;  3D0P A;  4FJX A;  3LAL A;  2D5R A;  4DTU A;  3S9H A;  3MXI A;  4FJH A;  4DTN A;  2IAJ A;  5KI6 A;  4FM0 A;  1JLB A;  1TKD A;  1NKB A;  1SKW A;  1QSY A;  3PO5 A;  1ZBH A;  1I3A A;  4DSE A;  3OVN A;  2X6S A;  4CEF A;  4FJ8 A;  3S3M A;  2WON A;  4I9L A;  3V9Z A;  1LW0 A;  2YNG A;  4RW8 A;  2B4J A;  1ASU A;  1B9D A;  2HND A;  5FDL A;  4QCL A;  3KK2 A;  4J2B A;  1BGX T;  3DLR A;  4O5B A;  4OLA A;  2HHT A;  3B6O A;  1NK9 A;  1RBR A;  1QSS A;  4C8M A;  3M8R A;  1U47 A;  2QK9 A;  1BIS A;  1LAW A;  4RW4 A;  4WE1 A;  1S6Q A;  1FXX A;  4CK2 A;  1KVC A;  4FJG A;  4W5O A;  3LWM A;  1RNH A;  1S9E A;  4CHN A;  5J2N A;  3PX6 A;  3QES A;  3QO9 A;  3OYC A;  1ASW A;  1VSD A;  2XY6 A;  3V1O A;  3L2R A;  3V9U A;  4YFU A;  4DQR A;  4DTM A;  1ZBL A;  3AO2 A;  1RDC A;  1FK9 A;  3OJS A;  2Y1I A;  4ZTJ A;  4DSL A;  1VSI A;  1EXQ A;  4Z4G A;  1CLQ A;  5C25 A;  3L2Q A;  4JRP A;  1K6Y A;  2QXF A;  4FJI A;  3CM5 A;  1Q8I A;  3P5J A;  3LZJ A;  1KLN A;  2YKN A;  2FBY A;  3HM9 A;  3ISN C;  2Z1J A;  1QTM A;  1RBU A;  5C24 A;  3T3F A;  4KRF A;  1RT1 A;  2X6N A;  4CHZ A;  3U3Y A;  3I8D A;  5C42 A;  3DLB A;  4LH5 A;  1KVB A;  4PQU A;  1J9A A;  3TAQ A;  4HUE A;  3SJJ A;  3HST B;  4FYD A;  2A1R A;  2R7Y A;  3KLI A;  4CGJ A;  1RT2 A;  3KLE A;  3OYH A;  1WSE A;  3T1A A;  2W42 A;  4KHW A;  1YTU A;  4MQ3 A;  2YKM A;  3DI6 A;  4GVM A;  4Z0U A;  4F2S A;  4OLB A;  4FVM A;  4CJQ A;  1X9M A;  4B9N A;  3U6F A;  3DLK A;  1TKT A;  3L3U A;  3AO4 A;  2XRI A;  1ZBI A;  1HPZ A;  1U49 A;  3RR8 A;  4ZTF A;  3LPT A;  1FKP A;  3ZSR A;  2X78 A;  4E7L A;  1HQU A;  3OYI A;  4EZ6 A;  1IKV A;  3DOK A;  4O55 A;  1KVA A;  4RW7 A;  3WNF A;  1U4B A;  1NJX A;  3PY8 A;  4FK0 A;  1RCH A;  5DMR A;  1IKW A;  3MEG A;  3DYA A;  3O3G A;  5HRR A;  1B92 A;  1S5J A;  2JGU A;  4N5S A;  2KQ2 A;  3SQ2 A;  3SPZ A;  3E01 A;  2Z1H A;  4CJR A;  3RMC A;  4NYN A;  3VQC A;  4B9T A;  3V1Q A;  3AA5 X;  4KPY A;  2YNI A;  2Z1I A;  3PX0 A;  4CGD A;  2E4L A;  2HHW A;  4M41 A;  4W5Q A;  4AIL C;  3NDK A;  3LAK A;  4CEC A;  4H4M A;  4O0I A;  3F9K A;  1EP4 A;  3MED A;  5SZT A;  4CK1 A;  2DY4 A;  3OYB A;  4LSL A;  4E7K A;  3AA2 A;  3D45 A;  3RR7 A;  4B9U A;  1CZB A;  1BI4 A;  4DSF A;  3NH1 A;  3HXM A;  4CJ5 A;  1NKE A;  3VA0 A;  3LP1 A;  4B9V A;  2IS3 A;  1LWC A;  3DRS A;  4FJ5 A;  4KB1 A;  1LW2 A;  4L8R B;  3H08 A;  3KK3 A;  5J2M A;  1WLJ A;  4CIE A;  1EX4 A;  4B8C A;  2P51 A;  4DFM A;  1TK0 A;  1RBT A;  1UOC A;  2KFZ A;  4C8K A;  1SL0 A;  3ZT1 A;  1D9F A;  4K8X A;  1S1X A;  3NFA A;  3QEI A;  1YVU A;  1VSF A;  4KHU A;  3HP6 A;  3LP2 A;  3EY1 A;  2GV9 A;  3NH0 A;  1JLA A;  1Q9X A;  1JKH A;  1TL1 A;  4FLX A;  2E6L A;  4CF8 A;  1FKO A;  3L2W A;  1TKX A;  1S6P A;  3SPY A;  2RN2 A;  4Z4E A;  1VRU A;  4KFB A;  3ZT2 A;  2HHQ A;  3C94 A;  1L5U A;  3ZT3 A;  4M3T A;  3SUO A;  2BDP A;  1TAU A;  1ZBF A;  4N47 A;  3AVM A;  4CEO A;  1VSM A;  2P5G A;  4MFB A;  4KHY A;  1C1B A;  4PUO A;  1S1U A;  3O3H A;  2YNH A;  4FJL A;  4FLU A;  2GBZ A;  2RPI A;  1QQC A;  1S9G A;  3IRX A;  1RDB A;  4DG1 A;  4M3X A;  4BDP A;  4ELV A;  3HK2 A;  3KKR A;  5EU7 A;  4DQS A;  1S1W A;  4RW6 A;  2G8W A;  3NAE A;  2HHU A;  1HQE A;  2LSN A;  3CFP A;  5I42 A;  4DFJ A;  1BQN A;  1VSK A;  3VQ6 A;  4DS5 A;  4FJ9 A;  4UQG A;  4CJ3 A;  5J2Q A;  3MXM A;  1WSJ A;  4CF2 A;  4CER A;  3TR8 A;  3ZSY A;  4DF8 A;  4O4G A;  4C8O A;  3SNN A;  2PY5 A;  4I7F A;  4J2A A;  4PWD A;  2D0C A;  4JS4 A;  3CFO A;  4CJW A;  3KLF A;  2KZM A;  3AVF A;  3TAM A;  1HRH A;  1RT4 A;  1RTJ A;  3LAN A;  5CYQ A;  4Z4C A;  1YT3 A;  3KLH A;  1RT3 A;  3AV9 A;  2IDO A;  2OZM A;  1IH7 A;  4FJ7 A;  1DLO A;  3NF9 A;  4KAZ A;  2FBX A;  3AVB A;  2D0A A;  2ZD1 A;  3AO3 A;  3U3G A;  1JLE A;  3AO1 A;  1HNV A;  2BGG A;  4OPK A;  4OKK A;  4RW9 A;  4DTR A;  1NJZ A;  5KTQ A;  1YTA A;  4NCA A;  4F8R A;  4CK3 A;  1ITG A;  1BL3 A;  1GOC A;  1EET A;  2FBV A;  4W5T A;  4CFA A;  3HT3 A;  4DTJ A;  5J1E A;  4DQI A;  3G10 A;  2B6A A;  4FLT A;  1NK8 A;  3VQ7 A;  5HRS A;  1DTT A;  2G8F A;  3NF7 A;  1KLM A;  4B9M A;  3AA3 A;  4LH4 A;  1QHT A;  3B6P A;  2KZZ A;  1NOY A;  4CEE A;  4FK2 A;  5T7B A;  4EP4 A;  4E7I A;  3VQQ A;  2OPQ A;  3I0S A;  3PUF A;  1W0H A;  3CYM A;  3QIO A;  1D9D A;  2HHX A;  4BDZ A;  3HJF A;  4ZHR A;  4M3U A;  3DLG A;  3PV8 A;  4CHP A;  2ATQ A;  2IC3 A;  1LAV A;  3HPG A;  4CED A;  4FK4 A;  2HHS A;  5KRS A;  4KTZ A;  4F2R A;  3ITH A;  4IDK A;  1SL2 A;  1BI4 B;  2OPR A;  2Q3S A;  3K57 A;  4JS5 A;  4DSJ A;  4KHQ A;  1Q9Y A;  4FJM A;  4DQQ A;  4M3Z A;  4PA1 A;  4AHT A;  1RT6 A;  1RTI A;  4DU4 A;  2VG6 A;  4DSI A;  3KK1 A;  3QEX A;  1C1A A;  4CJP A;  4OJR A;  1GOB A;  4FCY A;  3QNN A;  3HYF A;  4OKJ A;  4CGI A;  4CJF A;  5FRO A;  4FM1 A;  1NK0 A;  1CXQ A;  1L3T A;  4F3O A;  4LY7 A;  2PYL A;  4Z4F A;  3QET A;  1JXE A;  4H4O A;  4DLG A;  1NK7 A;  3K5L A;  1BHL A;  3NF8 A;  1RIL A;  3OYL A;  5KGW A;  4FLV A;  1C0U A;  4IFY A;  3PX4 A;  3LDS A;  3V4I A;  4EZ9 A;  1JL1 A;  4CJV A;  4HTU A;  3QEV A;  3L2U A;  5DK5 A;  1JLF A;  1HNI A;  1RT5 A;  4GW6 A;  4CEB A;  4FW2 A;  5CY4 A;  3AVL A;  4YNQ A;  4DFK A;  4DU1 A;  4QOZ B;  3WNG A;  1N6Q A;  1SKR A;  3P83 D;  3EZ5 A;  1TK8 A;  2ZQB A;  1T05 A;  1KRP A;  2E6M A;  1TK5 A;  1X9W A;  4FJN A;  1XC9 A;  2XY8 A;  4AH9 A;  3CQ8 A;  2OPS A;  2QKK A;  3OS0 A;  3AVK A;  2OYQ A;  3OYD A;  4N76 A;  3SUP A;  4AHS A;  4CIG A;  1BIZ A;  1BCM A;  4N56 A;  2I5J A;  4Y1D A;  4C8N A;  1T03 A;  2DTU A;  2HVH A;  3LPU A;  3L2V A;  3ZSX A;  3SYZ A;  1SL1 A;  1ZBU A;  1REV A;  4M3Y A;  4FM2 A;  3C6T A;  1JXB A;  4B3O A;  3AVN A;  3TAB A;  4NCB A;  2VG5 A;  4C8L A;  3QER A;  1EKE A;  1IO2 A;  2G8U A;  2F96 A;  2KTQ A;  3CM6 A;  4IG3 A;  4CGG A;  1W9H A;  1NK5 A;  4KI6 A;  2ZE2 A;  5KRT A;  3RMD A;  4HCB A;  2XHB A;  1LWF A;  3NH2 A;  3OYJ A;  3RRH A;  3CG7 A;  2JLE A;  4DS4 A;  3HPO A;  4CJK A;  1J5O A;  2D0B A;  1GOA A;  3LP0 A;  4CFD A;  5E41 A;  1RBS A;  3MEE A;  2P1J A;  2OPP A;  5CZ2 A;  3VQB A;  4BE0 A;  3RRG A;  3AVH A;  1HYV A;  3IG1 A;  4DLE A;  2O4I A;  4Q0B A;  4JLH A;  2EHG A;  3AVC A;  4DMN A;  4G1Q A;  3KD5 E;  4W5N A;  4OPJ A;  1J53 A;  3MEC A;  3V6D A;  4DWI A;  3NE6 A;  4FJK A;  4F3T A;  3AVJ A;  4R5P A;  3LZI A;  3ZT4 A;  4Q5V A;  2HMI A;  2G8V A;  2WOM A;  2DFH A;  5J2P A;  1CZ9 A;  4CJL A;  1DTQ A;  3O4Q A;  1U04 A;  4FZZ A;  2RKI A;  4AHU A;  1NJY A;  1Z25 A;  1T8E A;  4I2P A;  4E7H A;  3QNO A;  4BAC A;  3QIN A;  4CJ4 A;  1RDA A;  3RMB A;  2FC0 A;  3K5O A;  3KD1 E;  4FZX C;  4PY5 A;  2DFF A;  1D8Y A;  3HL8 A;  4DF4 A;  1RTH A;  4DTX A;  2Z1G A;  3TAR A;  3DOL A;  4OGE A;  1NJW A;  1T7P A;  3NHG A;  3UIQ A;  4CE9 A;  2IOC A;  3V9S A;  2RF2 A;  4AHC A;  1RTD A;  2OA8 A;  1KFD A;  1IKY A;  3K59 A;  2QKB A;  3OYG A;  3OJU A;  2G8H A;  1QE1 A;  3AVG A;  1ZYQ A;  1NKC A;  4IBN A;  3K5N A;  1VSJ A;  3QEP A;  3KTQ A;  2Y1J A;  4J2E A;  3M8S A;  3F73 A;  5HP1 A;  2XO7 A;  1SV5 A;  1Y97 A;  4F4K A;  5CZ1 A;  4ELU A;  3VQD A;  2G8I A;  3AVA A;  4CHY A;  3I0R A;  3NCI A;  1C1C A;  5CYM A;  4W5R A;  1L3S A;  1WN7 A;  4KHN A;  3T19 A;  1HYZ A;  4GMJ B;  3KJV A;  3TI0 A;  2G8K A;  1WAJ A;  4BWJ A;  3V1R A;  3OYE A;  3SV3 A;  3VQ4 A;  4M3W A;  4FXD A;  4BWM A;  4KKO A;  4TSX A;  1LWE A;  2FBT A;  1QS4 A;  5HLF A;  4IKF A;  5I3U A;  4CJU A;  1I39 A;  3NBP A;  4M3R A;  4E1N A;  3LWL A;  4FJJ A;  1UA1 A;  3NGI A;  1D5A A;  3O4N A;  1NK4 A;  3WNE A;  4HVJ A;  3AVI A;  4CHQ A;  3LP3 A;  3TWH A;  3VQP A;  1XI1 A;  1HYS A;  2HB5 A;  5SWM A;  4KO0 A;  3OYM A;  2GUI A;  3VA3 A;  3V9X A;  2HW3 A;  4FLY A;  2ITG A;  3QLH A;  3ZSV A;  3V81 A;  2XY5 A;  1X1P A;  2YNF A;  3ASM A;  3S3N A;  4NYF A;  4DTP A;  5KGX A;  1QSL A;  1XHX A;  2YHB A;  3SUQ A;  1JLG A;  3VQ5 A;  3AO5 A;  3ZSW A;  1WSH A;  4KHS A;  1VSL A;  5D3G A;  4KV8 A;  1F21 A;  1VK0 A;  2VG7 A;  3OYN A;  2KW4 A;  3SQ4 A;  1Z26 A;  3HPH A;  2XY7 A;  1L3V A;  3RWU A;  1O1W A;  4FZY A;  4KRE A;  4N41 A;  3OYA A;  3S3O A;  1RT7 A;  1KFS A;  4CJS A;  2YV0 X;  1CXU A;  1MU2 A;  3VN5 A;  4H8K A;  3HVR A;  2EX3 A;  1C0M A;  1LV5 A;  4ELT A;  4CF9 A;  4E7J A;  3IAY A;  4CGF A;  4E1M A;  3TAE A;  4DSK A;  3EYZ A;  4HCC A;  3HP9 A;  3VQ8 A;  1JL2 A;  3ZCM A;  2PZS A;  1KCF A;  4IG0 A;  2O4G A;  1NK6 A;  3L3V A;  1UA0 A;  4O0J A;  3NGZ A;  3OYK A;  3L8B A;  1A5W A;  3SQ0 A;  4E3S A;  3LAM A;  2HNZ A;  3OY9 A;  5K14 A;  4LSN A;  4KI4 A;  4Y1C A;  1IG9 A;  2HVI A;  4DU3 A;  4O44 A;  4CIF A;  4HHT A;  1TGO A;  4CCH A;  1B9F A;  1HMV A;  4ID5 A;  1TVR A;  3DLH A;  1NOZ A;  3SI6 A;  1RBV A;  2IGI A;  3DMJ A;  1A5V A;  3K2P A;  5HRN A;  1TKZ A;  3M8Q A;  4KTW A;  1KSP A;  2HHV A;  1RDD A;  4DTS A;  1BIU A;  1TV6 A;  3SCX A;  1TL3 A;  3OS1 A;  4BE2 A;  4CJE A;  1C0T A;  2VWJ A;  4RG8 A;  4IFV A;  4CF0 A;  3IS9 A;  4B08 A;  3ZSZ A;  4FLW A;  1C6V A;  4CEQ A;  4FW1 A;  4CEZ A;  3SV4 A;  1KTQ A;  4AHV A;  4OKE A;  3MXJ A;  3QIP A;  1G15 A;  3WNH A;  3DLE A;  3VQ9 A;  3VQE A;  1UAX A;  1SUQ A;  3CFR A;  3RMA A;  3SQ1 A;  3FFI A;  4CFC A;  3DRR A;  4CEA A;  3TAF A;  3KIO A;  3NF6 A;  4E89 A;  3K58 A;  3P1G A;  4LD0 A;  1BCO A;  3DM2 A;  3ZSQ A;  4B9L A;  4M42 A;  4J2D A;  1VSE A;  3V9W A;  4DQP A;  3C6U A;  1XHZ A;  3BDP A;  3PO4 A;  1A5X A;  3TAN A;  3QEW A;  2P5O A;  3DRP A;  4OGC A;  4CGH A;  1WAF A;  3BGR A;  1VRT A;  1XWL A;  3SZ2 A;  5HBM A;  2PYJ A;  4Z4I A;  5JS1 A;  3SUN A;  1JLQ A;  1UWB A;  2F8T A;  1U48 A;  4CES A;  2AJQ A;  4ID1 A;  1JLC A;  1IKX A;  4KTQ A;  3NGY A;  3AA4 A;  2ETJ A;  2HNY A;  4M45 A;  4CF1 A;  3O3F A;  3OS2 A;  3K5M A;  3ULD A;  1SKS A;  5FRM A;  1HJR A;  2BAN A;  2BE2 A;  1N5Y A;  1J54 A;  3KKS A;  4ICL A;  4K8Z A;  3ALY A;  1WNS A;  1WSG A;  1BQM A;  1S1V A;  1WSF A;  2NUB A;  4FLZ A;  2A1S A;  1WSI A;  4OVL A;  3MAQ A;  4JRQ A;  4HUG A;  3TAG A;  1L3U A;  3VQA A;  5HRP A;  5HRO A;  2VWK A;  4QAG A;  3G0Z A;  4B8A B;  4NCG A;  4CFB A;  3C95 A;  3A2F A;  4BE1 A;  1R0A A;  3JSM A;  4B9S A;  2KFN A;  2OZS A;  1TAQ A;  2YHA A;  3HO1 A;  2X74 A;  4Z4H A; 
#chains in the Genus database with same CATH topology
 1ASV A;  1NGE A;  4CJT A;  2F8S A;  3D2F B;  2Q1N A;  4YDU A;  3SMS A;  2AP1 A;  3SAF A;  4DTO A;  4KB0 A;  4CHO A;  1ATS A;  1VSH A;  3RTV A;  3O8M A;  4XIU A;  3ZT0 A;  4B3T K;  2GWJ A;  4FJX A;  3LAL A;  3S9H A;  3MXI A;  4G9Z A;  4FJH A;  3UKU A;  1JCE A;  1EWQ A;  2BH1 A;  2KLA A;  5F1X A;  1XQS C;  2X6S A;  3CHW A;  4CEF A;  4JI1 K;  4RW8 A;  3RSE A;  4XH5 A;  2HHT A;  3DLR A;  3B6O A;  3M8R A;  1WBD A;  4RW4 A;  1LAW A;  3TSQ A;  1FXX A;  5M1Q A;  5JVH L;  4A2A A;  3BEX A;  4FJG A;  1S9E A;  4CI6 A;  3QES A;  3QO9 A;  1VSD A;  2GWK A;  4BRN A;  3AO2 A;  1TYQ B;  1FK9 A;  3R6M A;  3WT0 A;  1K6Y A;  4LF9 K;  3VOV A;  3R9P A;  2FBY A;  4FWQ A;  1RBU A;  5AQX A;  3T3F A;  3FZL A;  5AQS A;  4XH1 A;  3THW A;  1N33 K;  2R7Y A;  4CGJ A;  3M6G A;  2QWR A;  2W42 A;  1YTU A;  1JJ2 M;  4GVM A;  4CJQ A;  4B9N A;  3T7Z A;  1GLC G;  2XRI A;  1HPZ A;  4YOU A;  4CZF A;  4DV6 K;  3LPT A;  2E2Q A;  5AQF A;  4A2B A;  1VQ8 N;  3DOK A;  3WNF A;  1ESV A;  4HTL A;  1IKW A;  5ADX H;  2QXL A;  1R59 O;  3FE1 A;  2KQ2 A;  4N5S A;  1BA1 A;  1HPM A;  4CJR A;  4EHU A;  5A2Q O;  3VQC A;  3V1Q A;  2YNI A;  2E4L A;  3LAK A;  1EP4 A;  3EKS A;  2DY4 A;  4K42 A;  3OYB A;  1EO1 A;  1RFQ A;  4LSL A;  4E7K A;  3RR7 A;  4B9U A;  3HXM A;  4CJ5 A;  3LP1 A;  4KB1 A;  1LWC A;  4BRM A;  3H08 A;  3KK3 A;  4B8C A;  5AQZ A;  2P51 A;  4LF7 K;  2KFZ A;  5AQQ A;  4C8K A;  1S1X A;  4IO9 L;  2A6A A;  1JLA A;  1JKH A;  1Y64 A;  1IBK K;  3G6E N;  1TKX A;  4KFB A;  4B9Q A;  2HHQ A;  1HNZ K;  3SLC A;  1GLF O;  3J8A A;  4N47 A;  3AVM A;  4MFB A;  1YHQ N;  2O8B B;  4IEE A;  4JD2 A;  4JK8 A;  4Z94 A;  1RDB A;  1KAY A;  3HOS A;  3KKR A;  1S1W A;  4RW6 A;  2I7N A;  3NAE A;  1HQE A;  1RDW X;  2P9K B;  3VQ6 A;  5J2Q A;  3MXM A;  5AR0 A;  3ZSY A;  3SNN A;  4K41 A;  2BTF A;  2D0C A;  4JS4 A;  3J7A P;  2Q31 A;  3C0B A;  2I7P A;  5JIC A;  4RWT A;  1HRH A;  5GAD P;  1RT3 A;  3AV9 A;  4JK9 A;  2QWO A;  1KQS M;  2OZM A;  1DLO A;  3AO1 A;  1DGK N;  3I33 A;  1WUA A;  4H5T A;  3W0L A;  2FBV A;  4DTJ A;  4CFA A;  4JKF A;  3H6E A;  3F2K A;  4GV9 A;  5GIN A;  4Y0W A;  3VQ7 A;  5HRS A;  1DTT A;  3NF7 A;  4CD1 A;  4B9M A;  3AA3 A;  4JI8 K;  2WC9 A;  3IFR A;  1HKG A;  3VQQ A;  1Q81 O;  1Z05 A;  1D9D A;  4BDZ A;  3HJF A;  4M3U A;  1BG3 A;  2AA4 A;  2ATQ A;  2UUB K;  1XUP O;  5GIP A;  5KRS A;  4KTZ A;  4F2R A;  4IDK A;  2Q3S A;  4KHQ A;  4AHT A;  1RT6 A;  4BVP A;  3QEX A;  1C1A A;  4OJR A;  5FLX O;  4FM1 A;  5AQY A;  1NK0 A;  1CXQ A;  2PYL A;  4LF6 K;  5FPE A;  3Q7C A;  3OYL A;  1SZ2 A;  5KGW A;  1C0U A;  4IFY A;  3PX4 A;  1WOQ A;  4EZ9 A;  4I6M B;  4CJV A;  2YHY A;  5DK5 A;  1JLF A;  4FW2 A;  1NGJ A;  4DFK A;  4DU1 A;  3KWG A;  1N6Q A;  1G99 A;  3MMV A;  1T05 A;  1X9W A;  1XC9 A;  3CQ8 A;  3OS0 A;  2OYQ A;  4C1N K;  3SUP A;  4AHS A;  4DCH A;  1T03 A;  3E9O A;  1BUP A;  4IDH A;  3CCU N;  5M1K A;  2IIR A;  4X62 K;  3JXU A;  4JHD B;  3ZSX A;  2PBD A;  4M3Y A;  2JWL A;  3CCQ N;  3TAB A;  3BF1 A;  1IO2 A;  2F96 A;  4IG3 A;  1NK5 A;  3R3L A;  4BRF A;  3THY A;  3ENB A;  3OYJ A;  3GOI A;  3CG7 A;  4DS4 A;  3HPO A;  2FSK A;  3QBX A;  3LP0 A;  4B1Y B;  3TU5 A;  2P1J A;  5CZ2 A;  1HYV A;  5AZI A;  4JI0 K;  1GLD G;  3U4L A;  4DR3 K;  3D2E B;  1X3M A;  4DMN A;  4G1Q A;  3F9M A;  4DWI A;  3NE6 A;  4FJK A;  3LZI A;  1VQ5 N;  3A5M C;  3VTH A;  3VEO A;  2OTL N;  3CJC A;  2G8V A;  2WOM A;  2DFH A;  2F7T A;  1IG8 A;  3IMX A;  1VQM N;  2NRX A;  4FZZ A;  4AHU A;  4I2P A;  4BR9 A;  3KD1 E;  3HL8 A;  4DF4 A;  4DTX A;  4GKK K;  3S41 A;  3ZX2 A;  3V9S A;  4ILH A;  1DT9 A;  5M1F A;  4LF4 K;  1NWK A;  3K59 A;  4PL8 A;  3ZEU A;  2NRH A;  4JI4 K;  3OJU A;  1QE1 A;  1ZXO A;  5BRH A;  4EHT A;  1VSJ A;  4J2E A;  2Q2R A;  3EZW A;  1SV5 A;  3CJ7 A;  3H3O B;  4KHN A;  4OPA A;  3TSU A;  3KJV A;  1WAJ A;  3V1R A;  4DQ8 A;  5C2D A;  2NRV A;  4TSX A;  3CER A;  5HLF A;  4CZL A;  1I39 A;  1TUY A;  4OO1 J;  3LWL A;  3EKU A;  4FWR A;  3TTC A;  1D5A A;  1OH8 A;  4FWP A;  1E4F T;  3H46 O;  4ISE A;  1HYS A;  2HB5 A;  2QM1 A;  3OYM A;  2HW3 A;  3V9X A;  2ITG A;  3MCA B;  1K8K B;  3HRG A;  2YNF A;  5BN9 A;  3ASM A;  4OLA A;  2YHB A;  3SUQ A;  1JLG A;  3VQ5 A;  1SQK A;  4KHS A;  3LDQ A;  4KV8 A;  1F21 A;  3OYN A;  2VG7 A;  5KPR A;  4PWD A;  5AQW A;  3OYA A;  1RT7 A;  3VTI A;  3H3N O;  5CE3 A;  1N34 K;  1CXU A;  1MU2 A;  3VN5 A;  4DR6 K;  1JCF A;  4C23 A;  4ELT A;  4E1M A;  3TAE A;  3VEY A;  3EYZ A;  4HCC A;  3VQ8 A;  1NK6 A;  3L8B A;  3PLA A;  3LAM A;  2HNZ A;  4LSN A;  1IG9 A;  4ILG B;  2IGI A;  5HRN A;  2HMP A;  3P39 A;  4KTW A;  4DTS A;  2HHH K;  3SCX A;  3OS1 A;  4BGB A;  4X64 K;  4YY3 K;  4CF0 A;  3IS9 A;  4BR4 A;  1C6V A;  3SV4 A;  1KTQ A;  4AHV A;  4YHH K;  3PIP L;  3VQE A;  1UAX A;  3BF3 A;  3FFI A;  4CFC A;  4CEA A;  3NF6 A;  4LD0 A;  5AFU H;  2HBJ A;  4J2D A;  1VSE A;  3V9W A;  4DQP A;  3PO4 A;  3O9S A;  3QEW A;  2P5O A;  4MDA A;  3BGR A;  3VGK A;  2PYJ A;  1QVF M;  1U48 A;  3LDN A;  1JLC A;  4KTQ A;  3WEE A;  1U6Z A;  3OS2 A;  5CR4 A;  2BAN A;  2BE2 A;  1N5Y A;  1WNS A;  1WSF A;  2NUB A;  2A1S A;  4A61 A;  3CC4 N;  4JRQ A;  4HUG A;  4WF9 L;  3VQA A;  4NCG A;  4BE1 A;  3A2F A;  4B9S A;  3O80 A;  3HO1 A;  2IVO A;  2ITM A;  3DAW A;  3A5L C;  4NLB A;  4AHR A;  4CW7 B;  3OYF A;  3M8P A;  4BRL A;  4B1W B;  4I9Q A;  4EP5 A;  1JCG A;  3VER A;  4BDY A;  1X9J A;  4E0D A;  2NLX A;  3THV A;  1QQO A;  1YIJ N;  4A57 A;  5JS2 A;  1WBB A;  4DFP A;  2O8F A;  2DFE A;  3D0P A;  1TUU A;  4DTU A;  2V7Z A;  4JKA A;  3THW B;  1JLB A;  1NGG A;  3KZB A;  2VQE K;  4DSE A;  4I9L A;  3CC2 N;  4QCL A;  1M90 O;  1NG9 A;  1KC8 O;  3CCL N;  1NK9 A;  4K0K K;  3O9T A;  4W5O A;  4QS9 A;  3P31 A;  3WQT A;  1ZBL A;  4QS7 A;  4WFN L;  4DSL A;  1VSI A;  1EXQ A;  1CLQ A;  3L2Q A;  2QXF A;  2OCE A;  3DWL A;  1HJO A;  1QTM A;  3VET A;  5C24 A;  2X6N A;  4CHZ A;  3I8D A;  3SJJ A;  1BO5 O;  4MDB A;  1MWM A;  3KLI A;  1NGC A;  3HOT A;  3OYH A;  4CZM A;  1HNW K;  4NO7 A;  2YKM A;  4F2S A;  5M1P A;  3LM9 A;  3VF4 A;  4RCH A;  5IWA K;  1X9M A;  5C0Y A;  3AO4 A;  1U49 A;  4ZTF A;  3NVM A;  1FKP A;  3ZSR A;  2ZJR L;  1NJX A;  4GNI A;  4RW7 A;  4FK0 A;  1U4B A;  5B8H A;  5DMR A;  3DYA A;  1VQ9 N;  1S5J A;  3SPZ A;  5BRE A;  2P9N A;  4JD2 B;  4A5B A;  2D0O A;  4CGD A;  4M41 A;  4AIL C;  3NDK A;  3PSF A;  4CEC A;  4CK1 A;  4CZK A;  2QA4 N;  3AA2 A;  3FR0 A;  1CZB A;  4DR5 K;  1BI4 A;  1V4T A;  5ADX A;  2YJF A;  1LW2 A;  1Q18 A;  4FWK A;  5J2M A;  4BRK A;  1NGI A;  1EX4 A;  4CIE A;  2P9I B;  2YI1 A;  3QFP A;  1EQY A;  2E1Y A;  2YX6 A;  1EWR A;  3QEI A;  3CCE N;  3LP2 A;  1GLJ O;  4PL7 A;  3NH0 A;  1Q9X A;  4FL9 A;  4FLX A;  2HBL A;  4CF8 A;  1FKO A;  3DJC A;  4Z4E A;  3SPY A;  5AQG A;  1L5U A;  2BDP A;  1KXP A;  1ZBF A;  2YHX A;  5AQH A;  5H1S Q;  4DV1 K;  1C1B A;  4LFB K;  3EEQ A;  1S1U A;  2YNH A;  4E1J A;  2E8A A;  3ENO A;  2GBZ A;  2QWM A;  3HZ6 A;  1QQC A;  3IRX A;  4DG1 A;  4M3X A;  3MX5 A;  4ELV A;  2YHW A;  4FWM A;  2G8W A;  3CI5 A;  2LSN A;  3CFP A;  3MN7 A;  4NXN K;  1BQN A;  1VSK A;  4DV5 K;  5JMV A;  1QHA A;  4UQG A;  3N4P A;  1NM1 A;  2UUA K;  4I7F A;  3KLF A;  4K43 A;  3TAM A;  4Z4C A;  1RTJ A;  4M7Y A;  3CMA N;  3CCV N;  1S72 N;  3AO3 A;  1JLE A;  1HNV A;  3I56 N;  3MX2 A;  4DTR A;  5KTQ A;  5KQD A;  1MWK A;  3HT3 A;  1NK8 A;  5AQO A;  2VYP A;  2KZZ A;  4ISF A;  1NOY A;  5KQ8 A;  4H0P A;  2E2N A;  5T7B A;  4E7I A;  5AQN A;  1W0H A;  1NGB A;  5HL7 L;  4CHP A;  4FK4 A;  1LAV A;  3HPG A;  3ITH A;  2OPR A;  4DSJ A;  2RE2 A;  1Q9Y A;  4DQQ A;  4PA1 A;  5M1O A;  4YDU C;  4DKW A;  4DSI A;  1C0F A;  4BC3 A;  4CJP A;  3ZET A;  4FCY A;  3QNN A;  1L3T A;  4F3O A;  5EVZ A;  1JXE A;  4H4O A;  1BHL A;  3NF8 A;  4FLV A;  4MO5 A;  3THY B;  1JL1 A;  1HKB A;  4PHT X;  1OVQ A;  1T44 A;  5CY4 A;  3AVL A;  2Q0U A;  5AZI B;  4QOZ B;  3WNG A;  3EZ5 A;  5BPL A;  2VQF K;  3UKR B;  5HOO A;  1NU0 A;  1KRP A;  2E6M A;  3OTO K;  2Q0R A;  1TK5 A;  3A0I X;  4FJN A;  2XY8 A;  3FZM A;  3THX A;  2QKK A;  1RGI A;  3DXM B;  2RHK A;  4Y1D A;  2DTU A;  1SL1 A;  5AQI A;  1E4G T;  2NRT A;  1ZBU A;  4IO8 A;  3C6T A;  1JXB A;  5EXW A;  4NCB A;  4GV6 A;  4C8L A;  1EKE A;  4H0O A;  2WTU A;  1W9H A;  2CH6 A;  3BP8 A;  4KI6 A;  1NJI O;  4MLE A;  4HCB A;  4K25 A;  2XHB A;  4L3Q A;  4CJ7 A;  2JLE A;  2F9W A;  4CFD A;  4GVE A;  3MEE A;  4BE0 A;  2OPP A;  4DLE A;  3O9Q A;  3VGM A;  4KH5 A;  2VGM A;  1ILY A;  3EO3 A;  3AVC A;  3AAP A;  4PKG A;  3KWI A;  3V6D A;  1HKC A;  5ELZ A;  4R79 A;  2UXB K;  4H0T B;  4JKC A;  5LMN K;  5J2P A;  1Z6R A;  2ZJP L;  3O4Q A;  4BGA A;  4CBU A;  3QB0 A;  1NJY A;  4E7H A;  3QNO A;  3OA9 A;  3RMB A;  4FZX C;  1XNQ K;  1D8Y A;  4JKH A;  1RTH A;  4DV3 K;  2Z1G A;  3TAR A;  4CBW A;  1NJW A;  3UIQ A;  1T7P A;  5DM7 L;  2OA8 A;  1XMO K;  3CCM N;  3OYG A;  3CF5 L;  4B3R K;  1OH7 A;  3O5B A;  3QEP A;  3F73 A;  2XO7 A;  1MA9 B;  2G8I A;  3AVA A;  3O1B A;  4CHY A;  3AGK A;  3I0R A;  1C1C A;  5CYM A;  1WN7 A;  1HYZ A;  4IJN A;  2G8K A;  2ASM A;  2A42 A;  2GX9 A;  2VCP A;  4BWM A;  3J7Y P;  4JV5 K;  4NB4 A;  3A5O C;  2JWK A;  4M3R A;  4E1N A;  1UA1 A;  2D0P A;  3O4N A;  5I9E B;  1NK4 A;  3WNE A;  5JLF A;  2KKZ A;  4CHQ A;  3TWH A;  5SWM A;  4FLY A;  3QLH A;  3CET A;  3VEX A;  2O8E A;  4JI2 K;  3S3N A;  1YAG A;  2ASP A;  3ULE B;  3AO5 A;  3ZSW A;  1VSL A;  4RTF D;  2KW4 A;  1Z26 A;  1QZ6 A;  3HPH A;  3VPZ A;  4CJS A;  3MCP A;  3ZX0 A;  1CZA N;  4WQ4 A;  4DR2 K;  1LV5 A;  3M5R A;  2E20 A;  4CF9 A;  2P9P A;  5JLH A;  3IAY A;  3CCS N;  1JL2 A;  3ZCM A;  3WEE B;  2O4G A;  3L3V A;  3NGZ A;  3P38 A;  5K14 A;  1C0G A;  1VQP N;  4O44 A;  4CIF A;  3NVK A;  3DLH A;  2E1Z A;  1KSP A;  1TL3 A;  4CJE A;  1TYQ A;  3C6A A;  4B08 A;  4FW1 A;  3MXJ A;  4KH6 A;  3DLE A;  3TTD A;  3VQ9 A;  2FSN A;  3CFR A;  3TAF A;  3QIC A;  2O8F B;  3SJH A;  4BVO A;  3SZ2 A;  4Z4I A;  5HBM A;  3SUN A;  4A59 A;  1JLQ A;  2F8T A;  1T6D A;  4ID1 A;  3ENH A;  4DV0 K;  3AA4 A;  2ETJ A;  2HNY A;  4WQ5 A;  3K5M A;  5C15 A;  5LL6 Z;  3KKS A;  3ALY A;  3TAG A;  3C65 A;  5HRP A;  2VWK A;  4QAG A;  2E88 A;  2A40 A;  3U8X A;  3C95 A;  5TKY A;  4B8A B;  3K9K A;  2YHA A;  4FOE A;  4Z4H A;  4IZ9 A;  5BR9 A;  4CZG A;  3E1Y A;  5FRN A;  4YOX A;  3MN6 A;  3JYT A;  4YOV A;  3HVT A;  2GEL A;  3TAP A;  3VF6 A;  2B5J A;  2D5R A;  1OH5 A;  4ISG A;  4DTN A;  2IAJ A;  3SBT A;  5KI6 A;  4FM0 A;  1SKW A;  3PO5 A;  1ZBH A;  2WFB A;  4IOC L;  4BRD A;  4FJ8 A;  2CH5 A;  1LW0 A;  2HND A;  1ASU A;  3K9J A;  1BGX T;  4O5B A;  1U2V A;  1RBR A;  1QSS A;  4C8M A;  2QK9 A;  2A5X A;  1S6Q A;  3EL2 A;  3ID6 A;  4AF1 A;  4H5N A;  4YOY A;  1MDU B;  4H5W A;  3OYC A;  1ASW A;  5TKW A;  3V1O A;  3V9U A;  5EOY A;  4YFU A;  4A62 A;  4BQL A;  4ZTJ A;  1QVG M;  4Z4G A;  3DXK A;  4JRP A;  2O8B A;  3CM5 A;  1Q8I A;  5BRF A;  3P5J A;  1K9M O;  2Z1J A;  3CJA A;  3ZX3 A;  2P9L A;  3L4I A;  1KAX A;  1RT1 A;  4KRF A;  1N32 K;  3G4S N;  1V4S A;  1KVB A;  2P9K A;  2V51 B;  4LH5 A;  4PQU A;  2QI2 A;  3HST B;  2A1R A;  3FLC O;  3LDP A;  1RT2 A;  3Q7B A;  5AQL A;  3KLE A;  3T1A A;  4KHW A;  3FZF A;  2Q97 A;  3MN9 A;  5E84 A;  3VEW A;  2GUP A;  4BRE A;  4FVM A;  5GIO A;  3U6F A;  3DLK A;  3WXK A;  3O6W A;  2HST A;  1ZBI A;  3RR8 A;  1OH6 A;  4PKI A;  5MLC Q;  1GLE G;  3VF2 A;  4F9O A;  4EZ6 A;  3OYI A;  2O8C A;  3PY8 A;  1RCH A;  1B92 A;  3SQ2 A;  3E9L A;  3RMC A;  4B9T A;  3AA5 X;  4KPY A;  1NGA A;  3FGU A;  3PX0 A;  4WCE L;  4H4M A;  1S3X A;  3E66 A;  2IVP A;  3F9K A;  3MED A;  4M63 C;  3P4I A;  3UKU B;  5GAH P;  2NRZ A;  4MLH A;  3U9D A;  4FJ5 A;  3OW2 M;  4IJA A;  3RSE B;  3G25 A;  4BC4 A;  1UOC A;  3PSI A;  4LC9 B;  3ZT1 A;  1D9F A;  3TSP A;  1YVU A;  1FW6 A;  4KHU A;  3EY1 A;  2GV9 A;  1OVY A;  4H0Y B;  5FPM A;  3L2W A;  3J7Z O;  4DUY K;  1S6P A;  4U67 L;  2RN2 A;  3C94 A;  2HBM A;  3SUO A;  3OBY A;  2P5G A;  4KHY A;  4GKJ K;  4PUO A;  3ATV A;  1NMN A;  4JNE A;  1S22 A;  5AJ3 K;  3WXM B;  1I94 K;  3HK2 A;  4FVU A;  4DQS A;  5F0X A;  2HHU A;  1HX1 A;  5KPT A;  4FJ9 A;  4CJ3 A;  3SAG A;  3TR8 A;  4KH4 A;  4JHD A;  4O4G A;  3AAR A;  3BY5 A;  3CFO A;  3T1H K;  4CJW A;  3GL1 A;  2KZM A;  2A41 A;  3WQU A;  2O8D A;  3GDQ A;  1J6Z A;  2IDO A;  3C6H A;  4BG9 A;  4FJ7 A;  4H5V A;  3ZET B;  3NF9 A;  4KAZ A;  2FBX A;  3U3G A;  2D0A A;  3AVB A;  4JN4 A;  3CJ1 A;  2BGG A;  4OPK A;  5JVG L;  4OKK A;  4RW9 A;  1YTA A;  4NCA A;  4CK3 A;  1GOC A;  1YF5 L;  3O1W A;  2A3Z A;  3G10 A;  4FO0 A;  2B6A A;  3GE1 A;  3IUC A;  2G8F A;  1KLM A;  1ATR A;  3B6P A;  1HR0 K;  2W40 A;  4CEE A;  5AZJ A;  3THX B;  2P9S A;  2HHX A;  3W3D A;  2FF3 B;  4ZHR A;  3DLG A;  3PV8 A;  2IC3 A;  4CED A;  2NZT A;  3CIP A;  1XNR K;  1O13 A;  3K57 A;  2E2O A;  4M3Z A;  3QFU A;  3VGL A;  3KK1 A;  4BRC A;  4BR2 A;  2QWP A;  4DB3 A;  3EE8 A;  3UB5 A;  4FWS A;  2P9U A;  1NGD A;  3K5L A;  3K0S A;  1NLV A;  3CD6 N;  3SAH A;  3V4I A;  3WXJ A;  3C7N A;  3D6R A;  3QEV A;  2NNW A;  1HNI A;  1RT5 A;  4GW6 A;  4JKG A;  4DR1 K;  4FPB A;  4YNQ A;  1SKR A;  1TK8 A;  4JYA K;  4JKD A;  3FZK A;  2E5L K;  4FSV A;  4CVN E;  2OPS A;  3AVK A;  4N76 A;  2D4W A;  5BPN A;  5LJW A;  4N56 A;  2I5J A;  2YJE A;  4C8N A;  2HVH A;  3QML A;  3LPU A;  3SYZ A;  4X66 K;  1K8K A;  4B3O A;  3AVN A;  4BY9 C;  1HNX K;  2VG5 A;  3M3Z A;  2KTQ A;  3CM6 A;  4JKB A;  3EN9 A;  5KRT A;  2J4R A;  3RRH A;  1YVN A;  3MWT A;  5E41 A;  2OTJ N;  2HF3 A;  2E2P A;  3RRG A;  2F9T A;  2O4I A;  4IEI A;  4JLH A;  3LDL A;  4LFC K;  4W5N A;  1J53 A;  3MEC A;  2KHO A;  3AVJ A;  4R5P A;  2OAN A;  2ZGZ A;  3RVC A;  2HMI A;  1CZ9 A;  3VEN A;  2ZJQ L;  4CJL A;  1DTQ A;  2GTD A;  1U04 A;  4BC2 A;  4B1X B;  1Z25 A;  1DKG D;  4JAX A;  4GV3 A;  1RDA A;  2FC0 A;  3K5O A;  4PY5 A;  2DFF A;  1KAZ A;  3J80 O;  2O8E B;  3WUH A;  3DOL A;  4OGE A;  3NHG A;  3AAQ A;  1W7A A;  2IOC A;  2ZWH A;  1RTD A;  4AHC A;  5BN8 A;  1IKY A;  2GEM A;  5AQT A;  1LOT B;  2QKB A;  2G8H A;  1NKC A;  4IBN A;  4JKE A;  3KTQ A;  2Y1J A;  2P9P B;  4F4K A;  4ELU A;  4JEP A;  3F5T A;  4DV7 K;  3E9P A;  2NRR A;  3VQD A;  1L3S A;  3T19 A;  3TI0 A;  4GMJ B;  3MWP A;  3OYE A;  3AGR A;  4FXD A;  1LWE A;  2FBT A;  4CBX A;  4B3S K;  4IKF A;  4CJU A;  3KHY A;  4FJJ A;  3NGI A;  3M1F A;  3B8A X;  3AVI A;  4KO0 A;  2GUI A;  3U9Z A;  3LL3 A;  3O08 A;  3V81 A;  2XY5 A;  1HLU A;  4DTP A;  5F2R A;  3KVG A;  1XHX A;  4Q0B A;  5AQJ A;  1WSH A;  5D3G A;  2IVN A;  1VK0 A;  4JI6 K;  4AM6 A;  4BRI A;  3SQ4 A;  3RWU A;  3QBW A;  4FZY A;  5JS1 A;  3S3O A;  4IOA L;  2YV0 X;  2CGK A;  3HVR A;  2EX3 A;  3DLL L;  1C0M A;  3CJB A;  4CGF A;  3HP9 A;  2PZS A;  1KCF A;  1ATN A;  1UA0 A;  3SQ0 A;  1QQM A;  4E3S A;  4CZJ A;  1NBW A;  1VQL N;  4KI4 A;  4DU3 A;  1TGO A;  2V52 B;  1NMD A;  4QS8 A;  1HMV A;  2Q36 A;  1TVR A;  4ID5 A;  3CCR N;  1NOZ A;  3SI6 A;  4KHP K;  4BR7 A;  1RBV A;  1A5V A;  2EWS A;  2HHV A;  1T6C A;  1TV6 A;  4BE2 A;  3HTV A;  2VWJ A;  3SMP A;  4IFV A;  2W6L A;  3ZSZ A;  5AQV A;  1G15 A;  1SUQ A;  2QTD A;  3SQ1 A;  1W2B M;  3KIO A;  4M42 A;  5AQM A;  3K58 A;  3P1G A;  1BCO A;  3BDP A;  3TAN A;  4LF8 K;  3DRP A;  4CGH A;  1VRT A;  2FXU A;  3ZEU B;  4BRG A;  3CQX A;  5AQK A;  4CES A;  5E26 A;  1IKX A;  4CF1 A;  3O3F A;  1SKS A;  3LDO A;  1HJR A;  3L6Q A;  4ICL A;  1BQM A;  4B1Z A;  4FLZ A;  1U2V B;  1WSI A;  4OVL A;  3MAQ A;  4BRO A;  4C1N I;  2UU9 K;  5HRO A;  3A5N C;  3G0Z A;  1R0A A;  1VQ6 N;  3JSM A;  3FFK B;  1BU6 O;  1TAQ A;  2X74 A;  3GG4 A;  4H0V B;  4HUF A;  1S1T A;  1U45 A;  3KLG A;  4I2Q A;  3OHR A;  3ZSO A;  3DXK B;  3HBT A;  3VEV A;  4BRA A;  4E19 A;  2DPN A;  4JI5 K;  1X9S A;  2P9L B;  4NLC A;  5AQU A;  3BZK A;  1QSY A;  4O5F A;  1TKD A;  1NKB A;  1D4X A;  3I8B A;  1I3A A;  3H1Q A;  3OVN A;  3S3M A;  2WON A;  3V9Z A;  2YNG A;  3TTF A;  2B4J A;  1B9D A;  3MK6 A;  5FDL A;  2P9I A;  4BC5 A;  4EAH D;  3KK2 A;  4J2B A;  1U47 A;  1KD1 O;  1BIS A;  5C10 A;  4DR4 K;  4WE1 A;  4CK2 A;  1KVC A;  2WBN A;  3LWM A;  1RNH A;  3VMF B;  5EX5 A;  4CHN A;  4ILJ A;  5J2N A;  3PX6 A;  4GY2 B;  5EY4 A;  2XY6 A;  3L2R A;  4WFA L;  2O8C B;  4WFB L;  4DQR A;  4DTM A;  1HUX A;  5AQR A;  1RDC A;  2ASO A;  3D2F A;  3OJS A;  2Y1I A;  5C25 A;  3D7E O;  4XEI A;  4FJI A;  2VGN A;  3LZJ A;  1KLN A;  2QWN A;  2YKN A;  2F4V K;  1RDU A;  3HM9 A;  3ISN C;  1IBL K;  5KPZ A;  2QW9 A;  1XC3 A;  3U3Y A;  4JK7 A;  5C42 A;  3DLB A;  1J9A A;  3TAQ A;  4HUE A;  4FYD A;  2HOE A;  4B3M K;  1Q86 O;  2FSJ A;  1T3V A;  1WSE A;  1IV0 A;  1Q7Y O;  1M1K O;  4MQ3 A;  3H1V X;  3DI6 A;  4Z0U A;  4OLB A;  1TKT A;  3L3U A;  2NRW A;  3A8Y A;  4FWL A;  2X78 A;  4E7L A;  1HQU A;  1IKV A;  4O55 A;  1KVA A;  4H0X B;  3MEG A;  3O3G A;  5HRR A;  2JGU A;  1Q82 O;  1N8R O;  3E01 A;  2Z1H A;  4LF5 K;  3JS6 A;  4NYN A;  2Z1I A;  3O4W A;  2HHW A;  4W5Q A;  1YJ9 N;  4O0I A;  3MN5 A;  4B1U B;  5SZT A;  1P8Z A;  2WUS A;  4CZE A;  3D45 A;  4DSF A;  3T69 A;  3NH1 A;  1NKE A;  3VA0 A;  4B9V A;  2IS3 A;  3DRS A;  4L8R B;  3WXL A;  1WLJ A;  3IKM A;  2O8D B;  4DFM A;  2W41 A;  1RBT A;  4WYB A;  1TK0 A;  1SL0 A;  4K8X A;  5AFU A;  3LM2 A;  3NFA A;  1VSF A;  3HP6 A;  4YOT A;  1TL1 A;  2E6L A;  3HSC A;  3T1Y K;  3QDK A;  4WQ4 C;  1YIT N;  4YOR A;  2HF4 A;  3N4Q A;  1VRU A;  3EE9 A;  3ZT2 A;  4DUZ K;  3ZT3 A;  4M3T A;  1QZ5 A;  1TAU A;  4FWN A;  3BZC A;  4CEO A;  1VSM A;  4U7B A;  3UKR A;  4A5A A;  2FLO A;  3O3H A;  4FJL A;  4FLU A;  2RPI A;  4BRP A;  1S9G A;  4BDP A;  2YCH A;  5EU7 A;  5AZJ B;  2P9S B;  3DXM A;  4DFJ A;  5I42 A;  1YJN N;  5LY3 A;  4DS5 A;  2UUC K;  4O8K A;  1WSJ A;  4FPA A;  4CF2 A;  4CER A;  4DF8 A;  4C8O A;  4J2A A;  3HM8 A;  2PY5 A;  1DEJ A;  4IXC A;  1OKJ A;  2W6K A;  3AVF A;  1VHX A;  1RT4 A;  3VES A;  3LAN A;  5CYQ A;  3KLH A;  1YT3 A;  4KBO A;  1IH7 A;  5BR8 K;  3SBG A;  1GLA G;  4DHY A;  2P9U B;  2ZD1 A;  3GBT A;  5AQP A;  2UYT A;  3BUZ B;  1NJZ A;  3TPQ A;  3CME N;  5LJV A;  1ITG A;  3C7N B;  1BL3 A;  1EET A;  3O9U A;  4W5T A;  1K8A O;  4FWO A;  5M1N A;  5J1E A;  4DQI A;  3HI0 A;  4JKG B;  1E3M A;  4WQ5 C;  4FLT A;  4DV2 K;  4LFA K;  3FZH A;  4LH4 A;  1QHT A;  2P9N B;  4FK2 A;  2ZGY A;  4EP4 A;  3L4Q A;  1VQO N;  2OPQ A;  3I0S A;  3PUF A;  2UXC K;  3CYM A;  3CJ9 A;  3QIO A;  4M7X A;  1YI2 N;  2H3G X;  3IDH A;  2HHS A;  4X65 K;  5IT9 O;  4IWV A;  1SL2 A;  1BI4 B;  4JS5 A;  4FJM A;  2FF6 A;  1RTI A;  4DU4 A;  2VG6 A;  4FOI A;  1GOB A;  4OPH A;  3HYF A;  4OKJ A;  4CGI A;  4CJF A;  5FRO A;  4Z4F A;  4IOX A;  4LY7 A;  3UE5 A;  3QET A;  1NK7 A;  4DLG A;  3ZLJ A;  2CGL A;  3R1X A;  1RIL A;  3LDS A;  1BWF O;  4HTU A;  4JI3 K;  3L2U A;  4CEB A;  2BUP A;  4BRQ A;  3JAM O;  3P83 D;  4HWI A;  2ZQB A;  4AM7 A;  2D1K A;  4AH9 A;  3OYD A;  4CIG A;  4BR5 A;  1BIZ A;  1BCM A;  4AQY K;  1BOT O;  3VEZ A;  5LMU K;  4J8F A;  5GAG P;  1P90 A;  3L2V A;  1H1V A;  1YUW A;  1REV A;  1K73 O;  4FM2 A;  3ULE A;  3G71 N;  1QQN A;  4H5R A;  3QER A;  2G8U A;  4YOW A;  4CGG A;  4JI7 K;  5C2F A;  4H03 B;  2HBK A;  2ZE2 A;  3RMD A;  4MO4 A;  1LWF A;  3NH2 A;  3CC7 N;  4I6M A;  4CJK A;  3CXC M;  1NGF A;  1J5O A;  1ZBS A;  1GOA A;  2D0B A;  1RBS A;  1J5E K;  3VQB A;  3KK7 A;  3AVH A;  3IG1 A;  1W97 L;  5CHI A;  2EHG A;  1VQN N;  4OX9 K;  3KD5 E;  4OPJ A;  4BR0 A;  2ZM6 K;  4F3T A;  2V7Y A;  1X3N A;  4DV4 K;  3ZT4 A;  4Q5V A;  2RKI A;  1IJJ A;  4XH4 A;  3CPE A;  1T8E A;  1IBM K;  1GLL O;  3QIN A;  4BAC A;  4CJ4 A;  4BG8 A;  4O8U A;  4CE9 A;  2RF2 A;  3CQY A;  3CCJ N;  1KFD A;  3ID8 A;  1N36 K;  3SK3 A;  3ATU A;  1VQK N;  3AVG A;  1ZYQ A;  3K5N A;  3M8S A;  5HP1 A;  1Y97 A;  5CZ1 A;  3WXI A;  3I55 N;  3NCI A;  3D2E A;  4W5R A;  1NNE A;  4BWJ A;  5BRD A;  3SV3 A;  3VQ4 A;  3CPW M;  4M3W A;  4KKO A;  4CD3 A;  1SAZ A;  1QS4 A;  5I3U A;  4PKH A;  4BQZ A;  3NBP A;  3MDQ A;  4EIA A;  5FPD A;  4HVJ A;  1XI1 A;  3LP3 A;  3VQP A;  3VA3 A;  5DM6 L;  1BDG A;  3ZSV A;  4BRH A;  1YJW N;  1X1P A;  4NXM K;  3AY9 A;  1VAZ A;  4NYF A;  2PFU A;  5FPN A;  5KGX A;  1QSL A;  4F8R A;  1L3V A;  3PIO L;  4KRE A;  2XY7 A;  1O1W A;  4N41 A;  1KFS A;  5BPM A;  1NGH A;  4H8K A;  4E7J A;  4DSK A;  4IG0 A;  4O0J A;  3OYK A;  1A5W A;  3OY9 A;  1FJG K;  4Y1C A;  2HVI A;  4HHT A;  1VQ4 N;  4CCH A;  1B9F A;  3R8E A;  3O9R A;  3DMJ A;  2QWL A;  3K2P A;  2QEX N;  1TKZ A;  3M8Q A;  1RDD A;  1BIU A;  1C0T A;  4RG8 A;  5C12 A;  1SS6 A;  4FLW A;  4CEQ A;  4CEZ A;  4OKE A;  3QIP A;  3WNH A;  1BA0 A;  3ZYY X;  3RMA A;  3DRR A;  4EFH A;  4E89 A;  4B9L A;  3ZSQ A;  3DM2 A;  3C6U A;  1XHZ A;  1A5X A;  1YXQ A;  4OGC A;  1WAF A;  4UY8 O;  3L0Q A;  1XWL A;  1WB9 A;  2UXD K;  3J81 O;  1UWB A;  4CZH A;  4DR7 K;  4B1V A;  2AJQ A;  1GLB G;  1LCU A;  4CZI A;  1XMQ K;  3NGY A;  3ULD A;  4M45 A;  2ZF5 O;  5FRM A;  2VWB A;  1VQ7 N;  1J54 A;  4K8Z A;  4V19 S;  1WSG A;  2PAV A;  1S1V A;  3H45 C;  1L3U A;  3OBW A;  4IFE A;  4CFB A;  2CGJ A;  2QWQ A;  1ZC6 A;  5GAE P;  3NMU A;  2OZS A;  2KFN A; 
#chains in the Genus database with same CATH homology
 1ASV A;  4HUF A;  1S1T A;  4AHR A;  4CJT A;  3OYF A;  2F8S A;  1U45 A;  3M8P A;  5FRN A;  3KLG A;  4I9Q A;  4I2Q A;  3JYT A;  4EP5 A;  3ZSO A;  4KB0 A;  3HVT A;  4DTO A;  4CHO A;  1VSH A;  3RTV A;  4BDY A;  4XIU A;  3ZT0 A;  3TAP A;  4E19 A;  4E0D A;  3THV A;  1X9S A;  2B5J A;  5JS2 A;  4DFP A;  2DFE A;  3D0P A;  4FJX A;  3LAL A;  2D5R A;  4DTU A;  3S9H A;  3MXI A;  4FJH A;  4DTN A;  2IAJ A;  5KI6 A;  4FM0 A;  1JLB A;  1TKD A;  1NKB A;  1SKW A;  1QSY A;  3PO5 A;  1ZBH A;  1I3A A;  4DSE A;  3OVN A;  2X6S A;  4CEF A;  4FJ8 A;  3S3M A;  2WON A;  4I9L A;  3V9Z A;  1LW0 A;  2YNG A;  4RW8 A;  2B4J A;  1ASU A;  1B9D A;  2HND A;  5FDL A;  4QCL A;  3KK2 A;  4J2B A;  1BGX T;  3DLR A;  4O5B A;  4OLA A;  2HHT A;  3B6O A;  1NK9 A;  1RBR A;  1QSS A;  4C8M A;  3M8R A;  1U47 A;  2QK9 A;  1BIS A;  1LAW A;  4RW4 A;  4WE1 A;  1S6Q A;  1FXX A;  4CK2 A;  1KVC A;  4FJG A;  4W5O A;  3LWM A;  1RNH A;  1S9E A;  4CHN A;  5J2N A;  3PX6 A;  3QES A;  3QO9 A;  3OYC A;  1ASW A;  1VSD A;  2XY6 A;  3V1O A;  3L2R A;  3V9U A;  4YFU A;  4DQR A;  4DTM A;  1ZBL A;  3AO2 A;  1RDC A;  1FK9 A;  3OJS A;  2Y1I A;  4ZTJ A;  4DSL A;  1VSI A;  1EXQ A;  4Z4G A;  1CLQ A;  5C25 A;  3L2Q A;  4JRP A;  1K6Y A;  2QXF A;  4FJI A;  3CM5 A;  1Q8I A;  3P5J A;  3LZJ A;  1KLN A;  2YKN A;  2FBY A;  3HM9 A;  3ISN C;  2Z1J A;  1QTM A;  1RBU A;  5C24 A;  3T3F A;  4KRF A;  1RT1 A;  2X6N A;  4CHZ A;  3U3Y A;  3I8D A;  5C42 A;  3DLB A;  4LH5 A;  1KVB A;  4PQU A;  1J9A A;  3TAQ A;  4HUE A;  3SJJ A;  3HST B;  4FYD A;  2A1R A;  2R7Y A;  3KLI A;  4CGJ A;  1RT2 A;  3KLE A;  3OYH A;  1WSE A;  3T1A A;  2W42 A;  4KHW A;  1YTU A;  4MQ3 A;  2YKM A;  3DI6 A;  4GVM A;  4Z0U A;  4F2S A;  4OLB A;  4FVM A;  4CJQ A;  1X9M A;  4B9N A;  3U6F A;  3DLK A;  1TKT A;  3L3U A;  3AO4 A;  2XRI A;  1ZBI A;  1HPZ A;  1U49 A;  3RR8 A;  4ZTF A;  3LPT A;  1FKP A;  3ZSR A;  2X78 A;  4E7L A;  1HQU A;  3OYI A;  4EZ6 A;  1IKV A;  3DOK A;  4O55 A;  1KVA A;  4RW7 A;  3WNF A;  1U4B A;  1NJX A;  3PY8 A;  4FK0 A;  1RCH A;  5DMR A;  1IKW A;  3MEG A;  3DYA A;  3O3G A;  5HRR A;  1B92 A;  1S5J A;  2JGU A;  4N5S A;  2KQ2 A;  3SQ2 A;  3SPZ A;  3E01 A;  2Z1H A;  4CJR A;  3RMC A;  4NYN A;  3VQC A;  4B9T A;  3V1Q A;  3AA5 X;  4KPY A;  2YNI A;  2Z1I A;  3PX0 A;  4CGD A;  2E4L A;  2HHW A;  4M41 A;  4W5Q A;  4AIL C;  3NDK A;  3LAK A;  4CEC A;  4H4M A;  4O0I A;  3F9K A;  1EP4 A;  3MED A;  5SZT A;  4CK1 A;  2DY4 A;  3OYB A;  4LSL A;  4E7K A;  3AA2 A;  3D45 A;  3RR7 A;  4B9U A;  1CZB A;  1BI4 A;  4DSF A;  3NH1 A;  3HXM A;  4CJ5 A;  1NKE A;  3VA0 A;  3LP1 A;  4B9V A;  2IS3 A;  1LWC A;  3DRS A;  4FJ5 A;  4KB1 A;  1LW2 A;  4L8R B;  3H08 A;  3KK3 A;  5J2M A;  1WLJ A;  4CIE A;  1EX4 A;  4B8C A;  2P51 A;  4DFM A;  1TK0 A;  1RBT A;  1UOC A;  2KFZ A;  4C8K A;  1SL0 A;  3ZT1 A;  1D9F A;  4K8X A;  1S1X A;  3NFA A;  3QEI A;  1YVU A;  1VSF A;  4KHU A;  3HP6 A;  3LP2 A;  3EY1 A;  2GV9 A;  3NH0 A;  1JLA A;  1Q9X A;  1JKH A;  1TL1 A;  4FLX A;  2E6L A;  4CF8 A;  1FKO A;  3L2W A;  1TKX A;  1S6P A;  3SPY A;  2RN2 A;  4Z4E A;  1VRU A;  4KFB A;  3ZT2 A;  2HHQ A;  3C94 A;  1L5U A;  3ZT3 A;  4M3T A;  3SUO A;  2BDP A;  1TAU A;  1ZBF A;  4N47 A;  3AVM A;  4CEO A;  1VSM A;  2P5G A;  4MFB A;  4KHY A;  1C1B A;  4PUO A;  1S1U A;  3O3H A;  2YNH A;  4FJL A;  4FLU A;  2GBZ A;  2RPI A;  1QQC A;  1S9G A;  3IRX A;  1RDB A;  4DG1 A;  4M3X A;  4BDP A;  4ELV A;  3HK2 A;  3KKR A;  5EU7 A;  4DQS A;  1S1W A;  4RW6 A;  2G8W A;  3NAE A;  2HHU A;  1HQE A;  2LSN A;  3CFP A;  5I42 A;  4DFJ A;  1BQN A;  1VSK A;  3VQ6 A;  4DS5 A;  4FJ9 A;  4UQG A;  4CJ3 A;  5J2Q A;  3MXM A;  1WSJ A;  4CF2 A;  4CER A;  3TR8 A;  3ZSY A;  4DF8 A;  4O4G A;  4C8O A;  3SNN A;  2PY5 A;  4I7F A;  4J2A A;  4PWD A;  2D0C A;  4JS4 A;  3CFO A;  4CJW A;  3KLF A;  2KZM A;  3AVF A;  3TAM A;  1HRH A;  1RT4 A;  1RTJ A;  3LAN A;  5CYQ A;  4Z4C A;  1YT3 A;  3KLH A;  1RT3 A;  3AV9 A;  2IDO A;  2OZM A;  1IH7 A;  4FJ7 A;  1DLO A;  3NF9 A;  4KAZ A;  2FBX A;  3AVB A;  2D0A A;  2ZD1 A;  3AO3 A;  3U3G A;  1JLE A;  3AO1 A;  1HNV A;  2BGG A;  4OPK A;  4OKK A;  4RW9 A;  4DTR A;  1NJZ A;  5KTQ A;  1YTA A;  4NCA A;  4F8R A;  4CK3 A;  1ITG A;  1BL3 A;  1GOC A;  1EET A;  2FBV A;  4W5T A;  4CFA A;  3HT3 A;  4DTJ A;  5J1E A;  4DQI A;  3G10 A;  2B6A A;  4FLT A;  1NK8 A;  3VQ7 A;  5HRS A;  1DTT A;  2G8F A;  3NF7 A;  1KLM A;  4B9M A;  3AA3 A;  4LH4 A;  1QHT A;  3B6P A;  2KZZ A;  1NOY A;  4CEE A;  4FK2 A;  5T7B A;  4EP4 A;  4E7I A;  3VQQ A;  2OPQ A;  3I0S A;  3PUF A;  1W0H A;  3CYM A;  3QIO A;  1D9D A;  2HHX A;  4BDZ A;  3HJF A;  4ZHR A;  4M3U A;  3DLG A;  3PV8 A;  4CHP A;  2ATQ A;  2IC3 A;  1LAV A;  3HPG A;  4CED A;  4FK4 A;  2HHS A;  5KRS A;  4KTZ A;  4F2R A;  3ITH A;  4IDK A;  1SL2 A;  1BI4 B;  2OPR A;  2Q3S A;  3K57 A;  4JS5 A;  4DSJ A;  4KHQ A;  1Q9Y A;  4FJM A;  4DQQ A;  4M3Z A;  4PA1 A;  4AHT A;  1RT6 A;  1RTI A;  4DU4 A;  2VG6 A;  4DSI A;  3KK1 A;  3QEX A;  1C1A A;  4CJP A;  4OJR A;  1GOB A;  4FCY A;  3QNN A;  3HYF A;  4OKJ A;  4CGI A;  4CJF A;  5FRO A;  4FM1 A;  1NK0 A;  1CXQ A;  1L3T A;  4F3O A;  4LY7 A;  2PYL A;  4Z4F A;  3QET A;  1JXE A;  4H4O A;  4DLG A;  1NK7 A;  3K5L A;  1BHL A;  3NF8 A;  1RIL A;  3OYL A;  5KGW A;  4FLV A;  1C0U A;  4IFY A;  3PX4 A;  3LDS A;  3V4I A;  4EZ9 A;  1JL1 A;  4CJV A;  4HTU A;  3QEV A;  3L2U A;  5DK5 A;  1JLF A;  1HNI A;  1RT5 A;  4GW6 A;  4CEB A;  4FW2 A;  5CY4 A;  3AVL A;  4YNQ A;  4DFK A;  4DU1 A;  4QOZ B;  3WNG A;  1N6Q A;  1SKR A;  3P83 D;  3EZ5 A;  1TK8 A;  2ZQB A;  1T05 A;  1KRP A;  2E6M A;  1TK5 A;  1X9W A;  4FJN A;  1XC9 A;  2XY8 A;  4AH9 A;  3CQ8 A;  2OPS A;  2QKK A;  3OS0 A;  3AVK A;  2OYQ A;  3OYD A;  4N76 A;  3SUP A;  4AHS A;  4CIG A;  1BIZ A;  1BCM A;  4N56 A;  2I5J A;  4Y1D A;  4C8N A;  1T03 A;  2DTU A;  2HVH A;  3LPU A;  3L2V A;  3ZSX A;  3SYZ A;  1SL1 A;  1ZBU A;  1REV A;  4M3Y A;  4FM2 A;  3C6T A;  1JXB A;  4B3O A;  3AVN A;  3TAB A;  4NCB A;  2VG5 A;  4C8L A;  3QER A;  1EKE A;  1IO2 A;  2G8U A;  2F96 A;  2KTQ A;  3CM6 A;  4IG3 A;  4CGG A;  1W9H A;  1NK5 A;  4KI6 A;  2ZE2 A;  5KRT A;  3RMD A;  4HCB A;  2XHB A;  1LWF A;  3NH2 A;  3OYJ A;  3RRH A;  3CG7 A;  2JLE A;  4DS4 A;  3HPO A;  4CJK A;  1J5O A;  2D0B A;  1GOA A;  3LP0 A;  4CFD A;  5E41 A;  1RBS A;  3MEE A;  2P1J A;  2OPP A;  5CZ2 A;  3VQB A;  4BE0 A;  3RRG A;  3AVH A;  1HYV A;  3IG1 A;  4DLE A;  2O4I A;  4Q0B A;  4JLH A;  2EHG A;  3AVC A;  4DMN A;  4G1Q A;  3KD5 E;  4W5N A;  4OPJ A;  1J53 A;  3MEC A;  3V6D A;  4DWI A;  3NE6 A;  4FJK A;  4F3T A;  3AVJ A;  4R5P A;  3LZI A;  3ZT4 A;  4Q5V A;  2HMI A;  2G8V A;  2WOM A;  2DFH A;  5J2P A;  1CZ9 A;  4CJL A;  1DTQ A;  3O4Q A;  1U04 A;  4FZZ A;  2RKI A;  4AHU A;  1NJY A;  1Z25 A;  1T8E A;  4I2P A;  4E7H A;  3QNO A;  4BAC A;  3QIN A;  4CJ4 A;  1RDA A;  3RMB A;  2FC0 A;  3K5O A;  3KD1 E;  4FZX C;  4PY5 A;  2DFF A;  1D8Y A;  3HL8 A;  4DF4 A;  1RTH A;  4DTX A;  2Z1G A;  3TAR A;  3DOL A;  4OGE A;  1NJW A;  1T7P A;  3NHG A;  3UIQ A;  4CE9 A;  2IOC A;  3V9S A;  2RF2 A;  4AHC A;  1RTD A;  2OA8 A;  1KFD A;  1IKY A;  3K59 A;  2QKB A;  3OYG A;  3OJU A;  2G8H A;  1QE1 A;  3AVG A;  1ZYQ A;  1NKC A;  4IBN A;  3K5N A;  1VSJ A;  3QEP A;  3KTQ A;  2Y1J A;  4J2E A;  3M8S A;  3F73 A;  5HP1 A;  2XO7 A;  1SV5 A;  1Y97 A;  4F4K A;  5CZ1 A;  4ELU A;  3VQD A;  2G8I A;  3AVA A;  4CHY A;  3I0R A;  3NCI A;  1C1C A;  5CYM A;  4W5R A;  1L3S A;  1WN7 A;  4KHN A;  3T19 A;  1HYZ A;  4GMJ B;  3KJV A;  3TI0 A;  2G8K A;  1WAJ A;  4BWJ A;  3V1R A;  3OYE A;  3SV3 A;  3VQ4 A;  4M3W A;  4FXD A;  4BWM A;  4KKO A;  4TSX A;  1LWE A;  2FBT A;  1QS4 A;  5HLF A;  4IKF A;  5I3U A;  4CJU A;  1I39 A;  3NBP A;  4M3R A;  4E1N A;  3LWL A;  4FJJ A;  1UA1 A;  3NGI A;  1D5A A;  3O4N A;  1NK4 A;  3WNE A;  4HVJ A;  3AVI A;  4CHQ A;  3LP3 A;  3TWH A;  3VQP A;  1XI1 A;  1HYS A;  2HB5 A;  5SWM A;  4KO0 A;  3OYM A;  2GUI A;  3VA3 A;  3V9X A;  2HW3 A;  4FLY A;  2ITG A;  3QLH A;  3ZSV A;  3V81 A;  2XY5 A;  1X1P A;  2YNF A;  3ASM A;  3S3N A;  4NYF A;  4DTP A;  5KGX A;  1QSL A;  1XHX A;  2YHB A;  3SUQ A;  1JLG A;  3VQ5 A;  3AO5 A;  3ZSW A;  1WSH A;  4KHS A;  1VSL A;  5D3G A;  4KV8 A;  1F21 A;  1VK0 A;  2VG7 A;  3OYN A;  2KW4 A;  3SQ4 A;  1Z26 A;  3HPH A;  2XY7 A;  1L3V A;  3RWU A;  1O1W A;  4FZY A;  4KRE A;  4N41 A;  3OYA A;  3S3O A;  1RT7 A;  1KFS A;  4CJS A;  2YV0 X;  1CXU A;  1MU2 A;  3VN5 A;  4H8K A;  3HVR A;  2EX3 A;  1C0M A;  1LV5 A;  4ELT A;  4CF9 A;  4E7J A;  3IAY A;  4CGF A;  4E1M A;  3TAE A;  4DSK A;  3EYZ A;  4HCC A;  3HP9 A;  3VQ8 A;  1JL2 A;  3ZCM A;  2PZS A;  1KCF A;  4IG0 A;  2O4G A;  1NK6 A;  3L3V A;  1UA0 A;  4O0J A;  3NGZ A;  3OYK A;  3L8B A;  1A5W A;  3SQ0 A;  4E3S A;  3LAM A;  2HNZ A;  3OY9 A;  5K14 A;  4LSN A;  4KI4 A;  4Y1C A;  1IG9 A;  2HVI A;  4DU3 A;  4O44 A;  4CIF A;  4HHT A;  1TGO A;  4CCH A;  1B9F A;  1HMV A;  4ID5 A;  1TVR A;  3DLH A;  1NOZ A;  3SI6 A;  1RBV A;  2IGI A;  3DMJ A;  1A5V A;  3K2P A;  5HRN A;  1TKZ A;  3M8Q A;  4KTW A;  1KSP A;  2HHV A;  1RDD A;  4DTS A;  1BIU A;  1TV6 A;  3SCX A;  1TL3 A;  3OS1 A;  4BE2 A;  4CJE A;  1C0T A;  2VWJ A;  4RG8 A;  4IFV A;  4CF0 A;  3IS9 A;  4B08 A;  3ZSZ A;  4FLW A;  1C6V A;  4CEQ A;  4FW1 A;  4CEZ A;  3SV4 A;  1KTQ A;  4AHV A;  4OKE A;  3MXJ A;  3QIP A;  1G15 A;  3WNH A;  3DLE A;  3VQ9 A;  3VQE A;  1UAX A;  1SUQ A;  3CFR A;  3RMA A;  3SQ1 A;  3FFI A;  4CFC A;  3DRR A;  4CEA A;  3TAF A;  3KIO A;  3NF6 A;  4E89 A;  3K58 A;  3P1G A;  4LD0 A;  1BCO A;  3DM2 A;  3ZSQ A;  4B9L A;  4M42 A;  4J2D A;  1VSE A;  3V9W A;  4DQP A;  3C6U A;  1XHZ A;  3BDP A;  3PO4 A;  1A5X A;  3TAN A;  3QEW A;  2P5O A;  3DRP A;  4OGC A;  4CGH A;  1WAF A;  3BGR A;  1VRT A;  1XWL A;  3SZ2 A;  5HBM A;  2PYJ A;  4Z4I A;  5JS1 A;  3SUN A;  1JLQ A;  1UWB A;  2F8T A;  1U48 A;  4CES A;  2AJQ A;  4ID1 A;  1JLC A;  1IKX A;  4KTQ A;  3NGY A;  3AA4 A;  2ETJ A;  2HNY A;  4M45 A;  4CF1 A;  3O3F A;  3OS2 A;  3K5M A;  3ULD A;  1SKS A;  5FRM A;  1HJR A;  2BAN A;  2BE2 A;  1N5Y A;  1J54 A;  3KKS A;  4ICL A;  4K8Z A;  3ALY A;  1WNS A;  1WSG A;  1BQM A;  1S1V A;  1WSF A;  2NUB A;  4FLZ A;  2A1S A;  1WSI A;  4OVL A;  3MAQ A;  4JRQ A;  4HUG A;  3TAG A;  1L3U A;  3VQA A;  5HRP A;  5HRO A;  2VWK A;  4QAG A;  3G0Z A;  4B8A B;  4NCG A;  4CFB A;  3C95 A;  3A2F A;  4BE1 A;  1R0A A;  3JSM A;  4B9S A;  2KFN A;  2OZS A;  1TAQ A;  2YHA A;  3HO1 A;  2X74 A;  4Z4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...