4KTWA

Lactococcus phage 67 ruvc - apo form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
160
Chain Sequence
MKKILAINFSTASKKGEGTGYAFRKDGQVYVGSIKAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRNRKHSITLANCNGYFIGAIDGLVNGYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYCEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RuvC endonuclease
publication title Mutants of phage bIL67 RuvC with enhanced Holliday junction binding selectivity and resolution symmetry.
pubmed doi rcsb
source organism Lactococcus phage bil67
total genus 61
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07066 DUF3882 Lactococcus phage M3 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ktwA00
1TKZA 2OPPA 3ZT4A 3HPHA 4CF2A 2AJQA 2DY4A 2BANA 2ITGA 3I0RA 3OYJA 1JLCA 3AA3A 4CJ4A 1J54A 3VQ6A 2HNYA 3KKRA 1RT6A 4N5SA 1LWCA 3D0PA 1NKBA 3LP0A 4IKFA 4M3XA 4F3TA 4J2DA 2HHXA 3MXIA 4RW8A 4FLXA 4MQ3A 1TK5A 4CEZA 2D0BA 3OYBA 3RMAA 3VQ8A 3VA0A 5HP1A 1C1BA 4OVLA 3ZCMA 4FLYA 3WNGA 4LSLA 1JLGA 4ZTJA 3QERA 1RTJA 4FZXC 3KD1E 4JS4A 4FLZA 5HBMA 2JGUA 3HO1A 3RMCA 3OYCA 4RW7A 5CZ2A 1SL1A 1VSIA 1FKOA 1TKXA 2P51A 4DQRA 3HL8A 2HHWA 1CXUA 1JKHA 3SQ2A 3SQ4A 5KGWA 3DLGA 1SV5A 2PYLA 3KIOA 1N6QA 4PUOA 1VSFA 3ZT2A 2OPQA 2DTUA 1X9WA 3CYMA 4HUFA 4H4OA 1NK0A 4KHUA 2WONA 5HRSA 4DSKA 3O4QA 4H4MA 4CK3A 2KQ2A 3ITHA 3V9WA 4CGIA 1QE1A 3V9XA 2P1JA 1RBVA 1TK0A 4CEEA 1JXEA 3NFAA 1RBRA 4ID1A 1T03A 2XY5A 3NBPA 3CFOA 3ZT1A 2O4GA 4I9LA 3NH1A 5J2NA 5J2QA 1WLJA 1ZBUA 3V9UA 3MXMA 1NJZA 3C6UA 4CGGA 4DTNA 4DQIA 4LSNA 2Z1GA 4E7IA 3QEXA 3TAFA 4W5QA 3CG7A 3PY8A 4KTQA 1YVUA 3I0SA 4JRPA 1WSJA 1HJRA 3SNNA 4AH9A 5KRTA 4Z4CA 1T8EA 3K57A 4CFCA 1BISA 3DLEA 3OY9A 3AVLA 3NF8A 4RW6A 3U3YA 1ASUA 4B9SA 2FBVA 2HHVA 3KTQA 3V1QA 3K59A 4FJHA 3V4IA 3THVA 3SPZA 4B8CA 1L3UA 5DK5A 3OJSA 3UIQA 1ZYQA 4CERA 4Q5VA 4CHQA 5C42A 3CFRA 3D45A 3PV8A 5J1EA 4DLGA 4DTPA 4FXDA 4DSIA 4O55A 4HCCA 3LP3A 1CXQA 4DTOA 4FJKA 1S6PA 3AVGA 1RT1A 1GOCA 2BE2A 2IS3A 2F8TA 4M42A 4O5BA 2HVIA 1B92A 3AVHA 3SUQA 4CGDA 2X6NA 3L3VA 4FLWA 4CJ5A 3CQ8A 2F96A 1RBTA 3OS1A 1TVRA 1QSSA 3K5OA 1HMVA 3P1GA 2VWKA 2W42A 3VQ9A 4Z4FA 3PX6A 2KTQA 3AVJA 3IG1A 1XC9A 2PZSA 4B3OA 3HP9A 4JLHA 1RDCA 1KFDA 3DM2A 2VG7A 1KFSA 3PO5A 3NGZA 4KHNA 5HROA 4H8KA 4KFBA 4EP4A 4CF0A 1WSGA 4NYFA 3DOLA 1ZBFA 4IG0A 3VQBA 1Y97A 4CJLA 4E1MA 2Z1JA 2OA8A 4FZYA 1FK9A 3KK1A 1RDAA 1U49A 1LAWA 3M8SA 4I2QA 3V9SA 5C25A 4CJ3A 1RBUA 4KKOA 3SZ2A 3LZIA 1NK4A 4MFBA 2YNGA 3MECA 1IKXA 5CZ1A 3LP2A 3NF9A 3E01A 1TKTA 1SKSA 3T3FA 1MU2A 4OKKA 3BGRA 1S9EA 4KHSA 3U6FA 4OLAA 2G8IA 1REVA 4OGEA 5KTQA 5E41A 3L2WA 3K58A 1D9DA 1EKEA 2OPRA 4QCLA 3TAMA 3U3GA 3O3FA 3KKSA 1JLAA 3NCIA 1SUQA 1T7PA 3AO2A 4DLEA 4E0DA 5HRRA 2IOCA 5C24A 4AHUA 2XY7A 1J53A 2XY6A 3OVNA 5KRSA 3K5MA 3V1RA 3QINA 4O0JA 1EETA 3T1AA 1BGXT 2YKMA 5CYQA 4BE0A 3RMBA 2LSNA 4DSJA 4FK2A 4CJFA 3OYAA 3NHGA 4F4KA 3DI6A 4EZ9A 1IKVA 2A1SA 3SQ0A 4FJGA 4IFVA 1CZ9A 4BE2A 1VSMA 4DQPA 4J2BA 1BCOA 4I7FA 4OKEA 4DSEA 1C6VA 1X1PA 4DWIA 4KPYA 4CFDA 3SYZA 1DLOA 1UOCA 3LAKA 4M3ZA 3VA3A 1KTQA 4Z0UA 4B9MA 1U47A 2R7YA 4DS4A 4CEQA 1U48A 5FRNA 4M3TA 4C8KA 3SUPA 4YFUA 4E19A 3AVMA 1CZBA 3OYFA 1IG9A 1KSPA 1S1WA 1Q9XA 2WOMA 4CGHA 2JLEA 4JRQA 3JYTA 1TAUA 1GOBA 1VSLA 2OZMA 2O4IA 3I8DA 3SJJA 1NJYA 3OYNA 3WNFA 3NGIA 3NF6A 5FROA 3L8BA 4DF8A 2OZSA 5J2PA 3OYEA 4Z4GA 3AO4A 1BIZA 2X78A 4AHCA 3RMDA 4N47A 1L5UA 4C8OA 4ELTA 4Y1CA 3L3UA 4KTWA 3PUFA 5I42A 1ASWA 3G10A 3QEVA 4LH5A 3NAEA 2FC0A 2X74A 1U4BA 4FJMA 4O4GA 4F3OA 1SL0A 1BQNA 4PWDA 1QSLA 2PY5A 4CJUA 1S6QA 1G15A 3EYZA 2RN2A 4FJJA 4DMNA 1FKPA 1C0UA 1RDBA 4BE1A 4DSFA 4DFJA 4PA1A 1D5AA 4AHSA 2QXFA 3SUNA 4HCBA 2HW3A 1BIUA 1BHLA 2QK9A 2PYJA 1IKWA 4E3SA 2YHBA 1S1XA 4DSLA 3HVRA 3CFPA 5SWMA 1JLEA 2G8UA 3ISNC 1NOZA 4CJVA 4CJPA 1LV5A 4K8XA 1L3SA 1KVAA 1WN7A 4RG8A 3M8QA 3G0ZA 2E4LA 1TK8A 2HHQA 3C95A 3ALYA 3K5LA 3NDKA 4FM0A 3QIPA 3H08A 2YKNA 5T7BA 3V81A 2XRIA 1XHZA 4B8AB 4BDYA 1NOYA 2D0CA 4DU4A 2I5JA 1SKWA 4FYDA 2FBYA 5KGXA 4FJIA 2IAJA 3TR8A 4K8ZA 3DYAA 5FDLA 1SKRA 2G8KA 4CE9A 2P5GA 4FK0A 3QIOA 4G1QA 3O3GA 4FLVA 2IC3A 3HPOA 5JS2A 4B9VA 3MEDA 4OPKA 3RRGA 4W5RA 3IS9A 4FJ7A 3SI6A 4FZZA 3AV9A 3ASMA 2KW4A 3MXJA 4WE1A 4CHZA 4IFYA 3L2RA 1TGOA 3HM9A 1RDDA 1SL2A 1HNVA 1Z25A 3DOKA 1RTHA 1R0AA 1BQMA 4W5OA 3CM6A 4B9UA 1NJWA 3L2QA 1WSFA 4KAZA 4GW6A 3AVFA 5KI6A 3OYDA 2KZMA 1C0TA 3ZT0A 2RF2A 3HVTA 4AHTA 3VQPA 3KLIA 5JS1A 1S1TA 1JXBA 2EHGA 4JS5A 2EX3A 4GMJB 4CJSA 4FJ5A 2E6MA 2ZD1A 4CEDA 4CFAA 3QESA 2A1RA 4E7LA 4I2PA 1IH7A 3HT3A 3LWLA 4CHPA 3HXMA 3S3OA 4B9NA 4KHWA 4HVJA 1JL1A 1NK6A 3TAGA 3VQAA 2YNIA 3ZSWA 3OS0A 2KFZA 1TAQA 2BGGA 1QTMA 3F73A 3DRRA 3ZSZA 2YNHA 3NH0A 1HQUA 3ZSVA 4KI4A 4PQUA 3ZSOA 1ITGA 1NJXA 4CIGA 2HVHA 4E89A 2FBTA 1BI4B 4CJEA 1IO2A 2IGIA 1C1AA 3ZSYA 1JLQA 1HRHA 4FM2A 1XHXA 5EU7A 1ZBLA 3QLHA 2Z1IA 1BI4A 4KREA 2F8SA 4FW2A 4GVMA 3MAQA 4AHVA 4F2SA 1VRTA 1VSDA 3AA2A 4DTSA 4CECA 1HYVA 4J2EA 3K2PA 4FW1A 1LAVA 1YT3A 1S1VA 5CY4A 5SZTA 4ELVA 3QEIA 2E6LA 2IDOA 1VSKA 1IKYA 2YNFA 3AO1A 3FFIA 1YTUA 4CJRA 4E7KA 1T05A 4CEOA 3AVKA 4E7JA 3ZSQA 3BDPA 4DTRA 3HYFA 1RCHA 4AHRA 3OJUA 1D9FA 1X9SA 3TAQA 4CF9A 4M3WA 1C0MA 3JSMA 5HLFA 2Q3SA 3EZ5A 2Y1IA 4DFKA 2QKKA 4IDKA 5FRMA 1I3AA 4KRFA 4OKJA 4DTUA 2KZZA 3AO5A 4LD0A 4DQSA 4F2RA 1TL3A 4R5PA 4BWJA 4PY5A 4CEBA 3HJFA 3AVIA 3M8RA 1D8YA 3IRXA 1EXQA 1KCFA 2DFHA 4ICLA 1RT4A 3S3NA 4DG1A 3HPGA 1WNSA 2B6AA 3RTVA 3KJVA 1A5VA 3VQEA 3QEPA 2GBZA 3SPYA 2ATQA 3B6PA 1VK0A 4KI6A 3OYMA 3DLRA 1C1CA 1KRPA 4F8RA 5HRPA 4DTXA 5I3UA 1DTQA 3RR7A 2DFEA 4FJNA 3ZSXA 2VG6A 2FBXA 4OGCA 1KVBA 2P5OA 2QKBA 4N56A 4HUEA 3SUOA 3WNHA 4CJKA 2G8WA 3AA5X 3M8PA 3OS2A 1FXXA 2G8HA 4AILC 3LPUA 1W0HA 4E1NA 4Z4HA 4NCAA 3TWHA 1NK7A 3L2VA 3K5NA 3SQ1A 3NF7A 1LW0A 4OLBA 4J2AA 4W5NA 5K14A 4FJ8A 4Z4IA 3O4NA 4O0IA 4KV8A 4E7HA 3RR8A 4C8LA 3LDSA 3OYHA 3TI0A 4HHTA 1X9MA 4CGFA 5J2MA 3KD5E 3ULDA 4ZHRA 4DU3A 1QQCA 1NKCA 1LWFA 5DMRA 4M3RA 3DRSA 3AO3A 3LALA 2VWJA 4KB1A 1NK5A 3LZJA 3QNOA 4FLTA 1BCMA 3AA4A 4UQGA 1DTTA 4B9LA 3VQ7A 4B9TA 1J5OA 1HYZA 4EZ6A 1K6YA 1JLFA 3CM5A 2Y1JA 4M45A 3NGYA 4FCYA 3LP1A 3TARA 1U45A 2ETJA 3DLBA 1RT5A 3V6DA 3S9HA 3C6TA 3TAEA 4LH4A 3ZT3A 3HP6A 1WSHA 4M3YA 3QEWA 1F21A 1RNHA 3LPTA 2G8FA 1UA0A 1GOAA 1S5JA 4CF8A 2NUBA 3LANA 4CF1A 4C8MA 3PO4A 1Z26A 3VQCA 1EX4A 2XY8A 1TKDA 4FJXA 4KHQA 4KHYA 4CGJA 1ASVA 1HQEA 3WNEA 1Q8IA 1YTAA 3AVNA 2XO7A 4DS5A 2HNDA 3A2FA 4IBNA 1BL3A 1NKEA 4CIEA 2OYQA 4FJ9A 1QS4A 2HB5A 1RT3A 4HTUA 4I9QA 3VN5A 3C94A 1HNIA 1WSIA 2BDPA 4IG3A 4FK4A 3LAMA 1I39A 4Y1DA 4CIFA 3OYKA 4BACA 4BDPA 2ZE2A 1VSJA 1KVCA 3NE6A 1RT2A 1S1UA 1EP4A 2HHTA 4RW4A 1RTIA 3V1OA 1J9AA 4CEFA 1WSEA 3PX0A 4RW9A 4YNQA 1Q9YA 1XI1A 4NYNA 3V9ZA 4ELUA 2HNZA 2ZQBA 3RRHA 4N41A 3OYIA 3OYLA 4BWMA 3O3HA 3MEEA 4CJTA 3KLHA 4DU1A 3P83D 2D5RA 4CK2A 1WAFA 1NK9A 4W5TA 1UAXA 4NCGA 4FVMA 3LWMA 1VRUA 4DFMA 4DFPA 4FJLA 4OPJA 4QOZB 4CFBA 3MEGA 4M41A 4CHYA 4B08A 1QHTA 4QAGA 2Z1HA 2B5JA 3T19A 4ID5A 4ZTFA 1B9FA 1WAJA 4NCBA 4LY7A 1VSEA 1JL2A 1RILA 3DRPA 4CHOA 3SV3A 4KB0A 4BDZA 2RKIA 1RTDA 4KTZA 1RBSA 4DF4A 1XWLA 2YHAA 4L8RB 2HHSA 3OYGA 4CJQA 3QETA 2XHBA 3HK2A 3KK3A 2B4JA 3SV4A 1A5XA 4FM1A 1NK8A 2KFNA 1S9GA 4DQQA 3RWUA 4CJWA 4DTMA 3TAPA 4M3UA 3VQ4A 4N76A 4Z4EA 3NH2A 3PX4A 3AVCA 4O44A 1TL1A 3B6OA 1ZBHA 3VQQA 3KLEA 4HUGA 1W9HA 3S3MA 4EP5A 3DLHA 3L2UA 3VQ5A 3ZSRA 1VSHA 1TV6A 3P5JA 4OJRA 4Q0BA 1O1WA 2GUIA 4CHNA 1HYSA 3DLKA 1CLQA 1UA1A 1N5YA 2RPIA 2VG5A 4DTJA 1KLMA 1RT7A 3TABA 3QO9A 3HSTB 2G8VA 3IAYA 4CEAA 1L3VA 3SCXA 2DFFA 4C8NA 3F9KA 1KLNA 3DMJA 3AVBA 1UWBA 3VQDA 4FLUA 4XIUA 1L3TA 1A5WA 1JLBA 4CK1A 2OPSA 2HMIA 4CCHA 1U04A 3AVAA 1B9DA 2GV9A 4TSXA 1ZBIA 5D3GA 2YV0X 3KLGA 1LWEA 1LW2A 4KO0A 2D0AA 2HHUA 2X6SA 3KK2A 5HRNA 5CYMA 3KLFA 1HPZA 1QSYA 3QNNA 4CESA 3TANA 3EY1A
chains in the Genus database with same CATH superfamily
3C6HA 4CF2A 1JLCA 4CJ4A 2HNYA 3KKRA 4N5SA 2P9NA 1HKBA 4M3XA 2HHXA 4CEZA 4H5VA 3WEEB 3OYBA 1C1BA 3QERA 2VQFK 4FZXC 4FLZA 1KD1O 3CCUN 2E2QA 2P9SB 2O8FA 3OYCA 3DXMB 1SL1A 4DQRA 3VPZA 1JKHA 5M1NA 5KGWA 4CVNE 3KIOA 1X9WA 3O9RA 4KHUA 3MMVA 4DSKA 4IZ9A 1YHQN 4Y0WA 4BR7A 2EWSA 2P9UB 3KVGA 3MN5A 5LJWA 1W97L 3ZT1A 2O4GA 3M3ZA 4I9LA 5J2QA 1NJZA 3LM9A 5AFUH 3C6UA 4CGGA 4DTNA 3ENOA 1NGGA 1RDUA 4HWIA 2NRWA 4W5QA 3CG7A 4CBUA 3PIPL 4JRPA 4O8KA 3F9MA 4KH5A 1QQNA 4Z4CA 4BR0A 1BISA 2E2NA 3OY9A 3AVLA 3THVA 1L3UA 1JJ2M 1ZYQA 2GELA 1OH5A 5C42A 1M90O 4XH1A 3I8BA 4A2BA 4CI6A 3MDQA 3PV8A 3LP3A 2UU9K 3AVGA 1GOCA 2IS3A 3THYA 2CH5A 3VERA 2ZJQL 3SUQA 4MDAA 3OS1A 1RBTA 1QSSA 1NGBA 1U6ZA 2E88A 4KBOA 3VQ9A 3O4WA 3EKUA 4G9ZA 3AVJA 3IG1A 4OPAA 3HP9A 4JLHA 3CJBA 3NGZA 4CF0A 1I94K 3VQBA 1Y97A 3IMXA 4IOXA 1JCEA 2OA8A 3KK1A 5M1PA 3HBTA 2HHHK 4JYAK 2J4RA 1RBUA 3O9TA 2KKZA 3EO3A 1NK4A 3EE9A 4MFBA 5CZ1A 1SKSA 4A62A 4CZGA 3T3FA 4KHSA 4CZMA 3I56N 4OGEA 2P9LA 4UY8O 3K58A 3MCPA 4DHYA 3U3GA 1T7PA 3AO2A 2E1ZA 5HRRA 2PAVA 1J53A 1IBLK 2XY6A 3THXB 4CZLA 3K5MA 4DSJA 4DV7K 2NRTA 5BPLA 1XUPO 4YOWA 4FK2A 3NHGA 4F4KA 2I7NA 3DI6A 5BRFA 1IKVA 5KPRA 3SQ0A 2RE2A 4JEPA 4BE2A 1HJOA 4OKEA 3U8XA 4WCEL 1Z05A 3VA3A 4Z0UA 5FRNA 3WUHA 3R6MA 4M3TA 3SUPA 4BC5A 1CZBA 4WFAL 1KSPA 3K9JA 3JYTA 1VQ4N 2OZMA 4DV2K 3FZMA 5FROA 3OYEA 3A5NC 4ELTA 2WBNA 4Y1CA 3J7ZO 3CD6N 3QEVA 1J5EK 2X74A 4FJMA 4JHDA 1GLJO 4DQ8A 1G15A 1RDBA 4BE1A 4DSFA 4U67L 2QXFA 1E4GT 4KH6A 4JKDA 3HOSA 5AQKA 2FSKA 4E3SA 4DR6K 3F2KA 2P9IA 4NB4A 2G8UA 4M7XA 5GINA 4K8XA 2GUPA 1L3SA 1KVAA 4RG8A 4BRDA 5T7BA 3H08A 2YKNA 3V81A 2XRIA 4BRMA 2D0CA 2F9WA 2I5JA 4FPAA 5AQVA 2FBYA 5FDLA 2G8KA 4FK0A 4G1QA 1Q81O 3HPOA 1WBDA 4OPKA 3RRGA 1ATRA 3SI6A 4FZZA 3ASMA 1LCUA 2P9KB 5AQLA 4CHZA 2GWKA 3DOKA 3HRGA 3JXUA 1KAXA 1BQMA 4W5OA 4B9UA 1NJWA 1WSFA 4KAZA 5KI6A 3AVFA 3UKRA 3GG4A 1QZ5A 1JXBA 3GBTA 4FJ5A 2E6MA 4CEDA 4I2PA 3HT3A 3LWLA 1JL1A 3TAGA 1W2BM 2KFZA 1QTMA 2UUAK 2YNHA 3NH0A 1HQUA 4KI4A 2CGLA 4FWPA 2FBTA 3OA9A 2QWLA 2WFBA 5AQMA 2IGIA 1C1AA 4IOCL 2F9TA 3QLHA 4BR9A 4KREA 2F8SA 4GVMA 4AHVA 4F2SA 2ZJRL 1VRTA 5MLCQ 4ISEA 1LOTB 5SZTA 4ELVA 3QEIA 2YNFA 1IKYA 2UXBK 1T05A 3A5MC 3BDPA 4FWQA 4JI1K 3ZSQA 3CCQN 4GKJK 3SMPA 3KZBA 1X9SA 1X3MA 2Q3SA 3EZ5A 2QKKA 1ATNA 5FPDA 3VEVA 4LD0A 1TL3A 4PY5A 2UXDK 3HJFA 3D7EO 1D8YA 1RT4A 3S3NA 4DG1A 4YHHK 1NGDA 3QEPA 3KJVA 2AP1A 1VK0A 3DLRA 2P9NB 2FBXA 4OGCA 2P5OA 5LL6Z 4EHUA 2F7TA 3WNHA 3SUOA 5JICA 2G8WA 1FXXA 1U2VA 1HR0K 3DWLA 3LPUA 1W0HA 4E1NA 3J8AA 3TWHA 4OLBA 4FJ8A 4Z4IA 3RR8A 3LDSA 4HHTA 1X9MA 2CGJA 3J7YP 1X9JA 4M3RA 3E9PA 3AO3A 4WQ4C 2OTLN 4WQ4A 4KB1A 1IJJA 2I7PA 4H0VB 4FLTA 1VQLN 4DB3A 1S72N 3AA4A 4UQGA 1DTTA 1SQKA 4B9TA 1J5OA 2NRZA 4M45A 2FLOA 5BN9A 1U45A 3MX2A 2ETJA 3DLBA 1T6CA 4JK7A 2E20A 1QQMA 4LH4A 4BROA 3LPTA 1FW6A 1S5JA 4CF8A 3PO4A 1OVYA 4FWRA 3VF4A 1HQEA 3AGKA 3WNEA 5LY3A 2QA4N 4M63C 3VGMA 2OYQA 4I9QA 4HTUA 1T3VA 3C94A 1HNIA 1GLDG 4IG3A 4BR2A 4A59A 4EHTA 3OYKA 4BACA 3DXKA 3NMUA 3NE6A 1KVCA 1Q82O 4BRFA 3THYB 4RW4A 1RTIA 4JD2B 1J9AA 4CEFA 1HNZK 4NYNA 1BOTO 2ZQBA 4E1JA 3O3HA 4DU1A 3P83D 5HL7L 4DFMA 4B3SK 4CFBA 1GLEG 4M41A 4CHYA 1QHTA 1ZBSA 2B5JA 4ZTFA 1WAJA 2QWMA 1K73O 4CHOA 3TSPA 3E9LA 3CCJN 3HOTA 1VQ9N 3SBGA 3KK3A 4BRNA 4FOIA 4FM1A 2KFNA 1S9GA 3RWUA 5F2RA 4N76A 3E66A 3B6OA 3KLEA 4HUGA 4DR4K 4IWVA 5AQPA 3VQ5A 3FLCO 1O1WA 3DLKA 1UA1A 1N5YA 2G8VA 3QO9A 3IAYA 3SCXA 4WQ5C 1Q7YO 4C8NA 3DMJA 4H5WA 3VGLA 3VQDA 1L3TA 4CCHA 2OPSA 3P31A 3AVAA 1B9DA 2GV9A 4TSXA 4CZJA 2YV0X 1BA0A 1LW2A 2V51B 2X6SA 5EY4A 3ZX0A 3KK2A 2Q2RA 3KLFA 1QSYA 3QNNA 4CESA 3TANA 4B1WB 2BANA 5C15A 3I0RA 5GAHP 3OYJA 5C2FA 4IKFA 4J2DA 3MXIA 4RW8A 4FLXA 4FWLA 2D0BA 3G4SN 5AQSA 3T69A 1RTJA 3O6WA 3KD1E 4B1VA 3ATVA 3VF2A 4QS7A 2JGUA 3HO1A 3CMEN 1VSIA 4H0XB 2HHWA 1CXUA 1E3MA 2IVOA 3SQ4A 4BQZA 3DLGA 3SQ2A 2PYLA 1N6QA 1VSFA 4YOYA 2H3GX 4FPBA 4JHDB 4M7YA 5HRSA 4H4MA 2F4VK 1QHAA 3V9XA 2O8DA 4CEEA 1BO5O 1RBRA 3NFAA 4ID1A 2VYPA 3TSQA 3NH1A 1WLJA 3V9UA 4DR1K 2P9IB 4LSNA 3QEXA 3ULEA 4KTQA 1YVUA 1WSJA 3K57A 3DLEA 4RW6A 2HHVA 3C7NA 4FO0A 5JLHA 3AY9A 3V1QA 3KTQA 3SPZA 3RVCA 4B8CA 4CBWA 2DPNA 5AQIA 4BREA 3D45A 5GAEP 4DTPA 4DSIA 4O55A 1CXQA 4FJKA 4JKBA 4LFAK 1RT1A 4J8FA 5GIOA 1YI2N 1JCFA 1B92A 2X6NA 3CF5L 4FLWA 3A5OC 3UKRB 1SZ2A 1TVRA 3K5OA 1WB9A 2AA4A 2VWKA 2W42A 4Z4FA 1KFDA 2VG7A 5BRHA 4EP4A 5E26A 2A5XA 1ZBFA 4FSVA 3CMAN 1YF5L 3AAQA 2ITMA 3MK6A 3Q7CA 4I2QA 3LZIA 3LP2A 3NF9A 1MU2A 4OKKA 3BGRA 1S9EA 4LF9K 4OLAA 1REVA 4QCLA 5KTQA 1S3XA 5E41A 1D9DA 2OPRA 3RSEB 3TTFA 4B9QA 3NCIA 1JLAA 1FJGK 4DLEA 5C24A 2XY7A 1EWRA 3GE1A 4DCHA 1YJNN 3ZETA 3V1RA 4PHTX 4O0JA 1EETA 1RFQA 2YKMA 5CYQA 1KAYA 4MO4A 1YAGA 1DGKN 4EZ9A 4IXCA 4JI3K 4KH4A 3LDQA 4DWIA 4IFEA 3I55N 4M3ZA 4JKGA 4K25A 2R7YA 2HBKA 2WC9A 5AQUA 4C8KA 3EZWA 4WFBL 3P4IA 4E19A 1S1WA 2WOMA 4CGHA 5AQZA 2IIRA 4H0OA 2O4IA 3I8DA 3SJJA 1NJYA 5AZJB 4GNIA 4DF8A 1U2VB 5J2PA 4Z4GA 4DR7K 3AO4A 4FJIA 4C8OA 3JS6A 4XH4A 3PUFA 1ASWA 2BH1A 1WOQA 3GDQA 4F3OA 3VEYA 4IOAL 4PWDA 1QSLA 2PY5A 1ILYA 4FJJA 1S6QA 4DMNA 4CZKA 1C0UA 3CJAA 2BTFA 4DFJA 3QBWA 3SUNA 1BIUA 1BHLA 2PYJA 3IKMA 1Z6RA 3CFPA 5E84A 4MLHA 3ISNC 1NOZA 1LV5A 2E1YA 1WN7A 2HHQA 3OW2M 3K5LA 3UKUA 3QIPA 1XHZA 4KHPK 3CXCM 3SLCA 5KGXA 2IAJA 3SAHA 3QIOA 4FLVA 2IC3A 5JS2A 4WE1A 2IVPA 1TGOA 1RDDA 1HNVA 3H45C 3MN7A 1RTHA 1MWKA 5GIPA 3DXKB 3DJCA 3ZT0A 1NGJA 3CJ1A 4H5TA 1HLUA 2YHWA 3HVTA 4AHTA 1XQSC 5AQGA 4NLBA 3VF6A 1KXPA 4BG8A 5BR8K 4CJSA 3QESA 4AM7A 4E7LA 4GV6A 4KHWA 2OTJN 5CHIA 2YNIA 3ZSWA 3SAFA 2CGKA 2BGGA 3OBYA 3J80O 3F73A 3W0LA 5KPTA 3ZSOA 4CZIA 4E89A 1BI4B 1IO2A 3ZSYA 4IDHA 1XHXA 2UYTA 2ZGZA 2QWRA 5FPNA 4F9OA 3CJ9A 4DTSA 1HYVA 2FXUA 1K8KB 2IDOA 2VGNA 3AO1A 1GLBG 3QFUA 4CJRA 2JWLA 4DTRA 1RCHA 4AHRA 3OJUA 1D9FA 3JSMA 5HLFA 4KRFA 4CZHA 2W6LA 3AO5A 4DQSA 4R5PA 4BWJA 4CEBA 3NVKA 4MLEA 4ICLA 3D2FA 1V4SA 1VQMN 1A5VA 4C23A 3SPYA 2O8EB 4B1YB 2HMPA 3VEXA 5HRPA 3RR7A 2YCHA 3ZSXA 1KVBA 2QKBA 3ZYYX 4HUEA 4BGAA 4CJKA 5IWAK 3M8PA 3S41A 4AILC 3BY5A 4Z4HA 5C0YA 3K5NA 3NF7A 1K8AO 3L4QA 2WUSA 3UB5A 3I33A 3CCVN 4O0IA 4E7HA 4C8LA 3TI0A 3OYHA 4CGFA 2D0PA 1NKCA 1LWFA 5H1SQ 4PL7A 3CQXA 3LALA 3H6EA 2VWJA 1TUUA 4JKHA 1TYQB 4RCHA 1BCMA 5ELZA 2CH6A 1MWMA 3ZX3A 1HYZA 1K6YA 1JLFA 3P38A 3FGUA 3NGYA 1RT5A 3ULEB 3V6DA 3C6TA 3ZT3A 4IO9L 1F21A 1RNHA 1WUAA 3LANA 3ENBA 3C7NB 3U9ZA 3VQCA 1Z26A 1DKGD 1TKDA 4FJXA 4GKKK 2NRVA 1HNXK 3TPQA 4JN4A 4FJ9A 3BZKA 5LMUK 2BDPA 4WFNL 4FK4A 2YHYA 3PSIA 4CIFA 3E1YA 2ZE2A 1XNQK 1EP4A 2GEMA 4H0PA 2HHTA 3V1OA 3ENHA 2A42A 4YNQA 1P8ZA 3OBWA 4ELUA 2HNZA 4N41A 3OYIA 3OYLA 2QWPA 3M6GA 2ZM6K 4CJTA 2D5RA 4CK2A 1NK9A 3LWMA 4OPJA 4QS8A 4CD1A 3F5TA 2QM1A 4NO7A 3T19A 3ZEUA 4H5RA 4ID5A 4DR3K 4LY7A 3VGKA 1RILA 3SV3A 2QXLA 5AQOA 2W6KA 4KTZA 3D2EB 4DF4A 2YHAA 4JI2K 3OYGA 4CJQA 2XHBA 5A2QO 3HK2A 2B4JA 2YJEA 3FFKB 4DQQA 4CJWA 2ASOA 4M3UA 3T1HK 3VQ4A 4JI4K 3PX4A 3AVCA 3LDPA 4AF1A 3C6AA 3VQQA 1ZBHA 2GTDA 1W9HA 3CCLN 3L2UA 1NMDA 4NXNK 2RPIA 2VG5A 5BN8A 4DTJA 1RT7A 4LFCK 1IBMK 3HSTB 1L3VA 2DFFA 2UUCK 4V19S 3MWPA 1UWBA 2A41A 4XIUA 1A5WA 1M1KO 5AZIA 1ZBIA 2NZTA 1ESVA 4JI5K 4WYBA 2D0AA 2Q0UA 4U7BA 2HHUA 2FF3B 2E2PA 3H1VX 2OPPA 5DM6L 3HPHA 2DY4A 1VQ8N 2P9PA 2ZWHA 4QS9A 4DV6K 4B1XB 3VQ6A 4F3TA 1RT6A 1LWCA 3D0PA 1NKBA 1BG3A 4B3MK 1TK5A 3T1YK 3RMAA 1YUWA 3VQ8A 3G6EN 4Z94A 2O8FB 4ZTJA 4DUZK 4JS4A 4FL9A 5HBMA 4LF7K 3RMCA 3SK3A 4RW7A 1VQNN 4A57A 1TKXA 2P9SA 1SV5A 4H0YB 3DXMA 4GV3A 2OPQA 1IBKK 2DTUA 3CYMA 1NK0A 4YY3K 2HF3A 3O4QA 4CK3A 2KQ2A 3ITHA 5BPMA 3V9WA 2P1JA 1RBVA 3WXMB 1TK0A 1T44A 4MDBA 2VQEK 1XMOK 3HM8A 4JI6K 1NM1A 3MXMA 2P9UA 4DQIA 3PY8A 3I0SA 3A0IX 1HJRA 3SNNA 3Q7BA 5KRTA 3LDNA 1EO1A 3HTVA 4CFCA 3U3YA 4B9SA 2FBVA 3N4PA 1QZ6A 2HF4A 3V4IA 1VAZA 4BC4A 3K9KA 4Q5VA 1Q18A 5J1EA 1W7AA 4X62K 4HCCA 4DTOA 1S6PA 4M42A 4O5BA 5AQJA 5C12A 4CGDA 1YJ9N 4BRQA 4NXMK 5ADXA 3CQ8A 2F96A 3AGRA 4CZEA 4BQLA 2W41A 3E9OA 4IEEA 3CJ7A 4B3RK 3EL2A 3GOIA 2FSJA 1XC9A 4B3OA 1GLCG 3CI5A 1OH6A 3DM2A 1KFSA 4KHNA 4BC3A 4BC2A 4E1MA 4IJNA 2JWKA 3VENA 4FZYA 4DV4K 1KAZA 4JI7K 1RDWX 1U49A 1LAWA 5LJVA 3V9SA 5M1QA 5C25A 3SZ2A 1T6DA 3QFPA 4PKGA 2YNGA 3MECA 1IKXA 2P9LB 2YJFA 3KWGA 4OO1J 5C2DA 1HPMA 3L2WA 3BZCA 3C0BA 3O3FA 2NLXA 3KKSA 2NRRA 4AHUA 5M1KA 3J81O 3QINA 4BRCA 3T1AA 1OKJA 3WQTA 3RMBA 3N4QA 4BE0A 3THXA 3DLLL 5JLFA 2A1SA 5JMVA 4IFVA 1V4TA 4JV5K 1CZ9A 1BCOA 4I7FA 3D2FB 3R8EA 2O8CA 1C6VA 4CFDA 3SYZA 1DLOA 4BVOA 1BWFO 1KTQA 4B9MA 3A5LC 1BA1A 1U47A 4DS4A 3TTCA 4YFUA 3AVMA 1IG9A 4JRQA 1VSLA 1X3NA 3WNFA 2OZSA 4AHCA 1L5UA 3L3UA 5I42A 1OH7A 4O4GA 4DUYK 1SL0A 4GY2B 4A61A 4CJUA 2RN2A 1FKPA 2UUBK 4PA1A 4AHSA 1N32K 1IKWA 2YHBA 1S1XA 4DSLA 4DR5K 5SWMA 1NJIO 4CW7B 3M8QA 2E4LA 3C95A 4PL8A 3NDKA 3C65A 4IJAA 4FM0A 4BDYA 1NOYA 4DU4A 1SKWA 2KLAA 4K8ZA 3DYAA 1SKRA 4CE9A 3MCAB 4I6MA 4K43A 4B9VA 3MEDA 3AV9A 5AQTA 3MXJA 4IFYA 3HM9A 1QQOA 1BDGA 1SL2A 1Z25A 1R0AA 4JNEA 3HI0A 3CM6A 3PLAA 3OYDA 2KZMA 2E2OA 1C0TA 4BR4A 3VQPA 1S1TA 2EHGA 5CE3A 4JS5A 2EX3A 2ZD1A 4BRIA 2A1RA 3WQUA 1IH7A 3L4IA 4CHPA 3HXMA 4B9NA 4HVJA 1NK6A 3VQAA 3B8AX 1TAQA 2QWQA 4ILHA 1ITGA 2HVHA 3PSFA 4LF6K 4B1ZA 1GLLO 1HRHA 1YIJN 5EU7A 1ZBLA 2HBMA 2IVNA 1XNRK 3AAPA 4FW2A 4ISGA 3MAQA 4X64K 3VTIA 3AA2A 1VSDA 4LC9B 1YVNA 1LAVA 1YT3A 4JKAA 5CY4A 1YITN 2E6LA 1VSKA 3FFIA 1YTUA 4E7KA 2Q97A 2NNWA 2WTUA 1NMNA 3VEOA 3AVKA 4JI8K 1IV0A 3CETA 4DFKA 2OANA 1I3AA 3CQYA 5FRMA 4OKJA 4F2RA 2Q36A 2ASMA 2GX9A 3IRXA 4DV1K 2VWBA 3O1WA 3HPGA 1WNSA 4DV0K 2B6AA 2P9PB 3O9SA 3RTVA 1HUXA 4GV9A 2GBZA 3WXIA 3B6PA 3OYMA 1KRPA 1MDUB 4YDUC 2VG6A 4YDUA 4N56A 5FLXO 2G8HA 4HTLA 3IUCA 1G99A 2W40A 4JAXA 3TSUA 4NCAA 1NK7A 3L2VA 3SQ1A 4J2AA 3BF3A 5K14A 2KHOA 2YX6A 4KV8A 3KD5E 3ULDA 4ZHRA 1QQCA 3DRSA 4FWOA 1N33K 5AQQA 3EEQA 3H3OB 1NGAA 3P39A 3VQ7A 4WF9L 4K42A 3TARA 3EKSA 2NRXA 5AQWA 4M3YA 1WSHA 4FWSA 4H5NA 3QEWA 1N8RO 1UA0A 4CF1A 4C8MA 4KHYA 1EX4A 2XY8A 1Q8IA 4DS5A 1MA9B 4C1NI 3A2FA 1NKEA 1BL3A 2HB5A 1RT3A 4LF8K 1BUPA 4BDPA 5GADP 1S1UA 1Y64A 1Q9YA 1XI1A 3MWTA 5FPEA 4BGBA 3V9ZA 1BU6O 1VQPN 4JD2A 3RRHA 3THWA 3CIPA 2VGMA 3QB0A 1WAFA 3O8MA 4FJLA 4NCGA 1VRUA 2FSNA 4B08A 4QAGA 4MO5A 2Z1HA 1C0GA 4EFHA 1B9FA 5TKYA 5AQXA 1JL2A 3MN9A 4BR5A 3BP8A 4BDZA 3PIOL 3ID8A 1RTDA 1TUYA 1RBSA 4PKIA 2HHSA 1S22A 3LDLA 5C10A 2QW9A 1A5XA 3IFRA 4IO8A 2ZJPL 4AQYK 4DTMA 3TAPA 2UXCK 2QWOA 2VCPA 5DM7L 3ZLJA 3NH2A 4O44A 1XMQK 4EP5A 3SMSA 4Q0BA 1TV6A 2ASPA 1VHXA 3CC7N 1KLMA 1RGIA 3VTHA 3FE1A 4CEAA 4YOVA 2HBJA 3H3NO 1NGEA 1JLBA 4CK1A 1U04A 4LFBK 5D3GA 1QVFM 4X66K 3KLGA 1LWEA 1NGCA 4K0KK 5TKWA 5HRNA 5CYMA 1HPZA 1TKZA 3ZT4A 1NGFA 2ITGA 1N36K 2O8CB 3AA3A 3MN6A 3CC2N 3O9QA 1J54A 4FWKA 4BRLA 3LP0A 4MQ3A 3VA0A 2HW3A 5HP1A 1NWKA 4OVLA 3ZCMA 4FLYA 3WNGA 4LSLA 1JLGA 3SBTA 3IDHA 1HKGA 5CZ2A 5M1OA 1FKOA 2P51A 3HL8A 2PFUA 4PUOA 3FZFA 3ZT2A 3HZ6A 4XEIA 4HUFA 4H4OA 3CPEA 5AQFA 1OH8A 5EOYA 2WONA 2O8DB 3VETA 1QE1A 4CGIA 3VEZA 4X65K 1NLVA 1QVGM 1JXEA 4IEIA 1T03A 2XY5A 3NBPA 3CFOA 1KQSM 5J2NA 1TAUA 3EE8A 1ZBUA 5M1FA 3L0QA 4JKFA 2Z1GA 4E7IA 3TAFA 4EAHD 4AH9A 1T8EA 3NF8A 1ASUA 1VQ7N 3K59A 4FJHA 5DK5A 3OJSA 3UIQA 4CERA 4CHQA 3CFRA 4A5AA 4DLGA 4FXDA 4I6MB 3QDKA 2BE2A 3O5BA 2F8TA 3BUZB 2HVIA 3AVHA 3L3VA 1EQYA 1CZAN 4CJ5A 1YJWN 3OTOK 4OX9K 4DR2K 5I9EB 1HMVA 3P1GA 1VQKN 2KTQA 3PX6A 2PZSA 1RDCA 3PO5A 5HROA 1GLFO 4H8KA 4KFBA 1WSGA 4NYFA 3DOLA 5JVGL 1NGIA 4IG0A 4CJLA 2Z1JA 1FK9A 3ID6A 3R9PA 1RDAA 2Q31A 3M8SA 1SS6A 4CJ3A 2QEXN 4KKOA 2D1KA 3SJHA 1ZXOA 4CJ7A 3LL3A 3R1XA 3O08A 3SAGA 3E01A 1TKTA 4GVEA 3U4LA 3QICA 5AJ3K 4FWMA 3U6FA 3T7ZA 2G8IA 1NBWA 1VQON 1EKEA 1Q86O 3TAMA 3ZETB 1SUQA 4E0DA 2O8BA 1J6ZA 5HOOA 3CPWM 2GWJA 3VEWA 3CCSN 2IOCA 3RSEA 1DEJA 1SAZA 4O8UA 3OVNA 5KRSA 2BUPA 5AQNA 1BGXT 2LSNA 5EX5A 3KHYA 4CJFA 3WXKA 3OYAA 5JVHL 3VOVA 3G71N 4FJGA 1C0FA 3CHWA 5AR0A 4J2BA 1VSMA 4DQPA 4DV3K 4JKGB 2V7YA 4DSEA 1X1PA 4KPYA 1XC3A 1UOCA 3LAKA 3AARA 4CEQA 1U48A 5AQHA 3WEEA 1YXQA 4EIAA 3OYFA 1Q9XA 2JLEA 1GOBA 4R79A 3OYNA 3CCEN 2E8AA 4FOEA 3NGIA 3NF6A 3L8BA 1ATSA 3DAWA 1BIZA 2X78A 3RMDA 4N47A 4LF4K 4KTWA 5AZJA 3G10A 3BEXA 3QBXA 4LH5A 2FC0A 3NAEA 1U4BA 3QMLA 1N34K 4JKCA 1BQNA 4JK8A 3A8YA 4YOTA 4RWTA 3EYZA 5B8HA 3LM2A 1H1VA 3ATUA 3ZX2A 3HSCA 1D5AA 4HCBA 3UE5A 4A2AA 2QK9A 3HVRA 1JLEA 4CZFA 4CJVA 3UKUB 4CJPA 3G0ZA 3FZHA 1TK8A 3ALYA 2RHKA 4PKHA 4B8AB 3VESA 1NNEA 4FYDA 3LDOA 3TR8A 3VMFB 2P5GA 3O3GA 5F0XA 4ISFA 4W5RA 3IS9A 4FJ7A 3K0SA 2KW4A 3L2RA 4DV5K 3BF1A 2PBDA 4XH5A 5EXWA 1KC8O 3L2QA 4GW6A 1VQ5N 4FWNA 2RF2A 5KPZA 1OVQA 3KLIA 5JS1A 3THWB 1VQ6N 4GMJB 4CFAA 5AQRA 3CCRN 3CERA 3G25A 5KQ8A 4JI0K 1JCGA 3S3OA 4YORA 5EVZA 5FPMA 3OS0A 3H1QA 4OPHA 3DRRA 3ZSZA 4BRGA 3ZSVA 2HOEA 4PQUA 1NJXA 4CIGA 4CJEA 5BREA 4H0TB 1JLQA 4FM2A 2FF6A 4B1UB 3MX5A 2Z1IA 1BI4A 5F1XA 3M1FA 1NGHA 4J2EA 4CECA 3K2PA 4C1NK 4FW1A 5BPNA 1S1VA 3JAMO 2E5LK 5GAGP 2NRHA 4BRHA 3D6RA 2A40A 3U9DA 2HBLA 1WBBA 4B3TK 4CEOA 1K8KA 4E7JA 3HYFA 4BG9A 3TAQA 4CF9A 4M3WA 1C0MA 1EWQA 4BVPA 2Y1IA 5ADXH 4IDKA 3J7AP 4A5BA 3O1BA 4DTUA 1GLAG 2KZZA 1ZC6A 4WQ5A 3AVIA 3M8RA 1EXQA 1KCFA 1HKCA 2DFHA 5LMNK 2ZGYA 4O5FA 3VQEA 2ATQA 4KI6A 1C1CA 4F8RA 1D4XA 4DTXA 5I3UA 1DTQA 1NU0A 2O8EA 2DFEA 4FJNA 3EN9A 2HSTA 4JK9A 3AA5X 3OS2A 3L6QA 4ILJA 1HX1A 5BR9A 2D0OA 1LW0A 4W5NA 3FR0A 2A3ZA 4DKWA 2Q0RA 3O4NA 5J2MA 3FZLA 4DU3A 4BRAA 5DMRA 5IT9O 3M5RA 1NK5A 3LZJA 5CR4A 3QNOA 4BRKA 3WXLA 3O80A 3TTDA 4B9LA 1IG8A 4EZ6A 3WXJA 1TYQA 3CM5A 3O9UA 2Y1JA 4FCYA 3LP1A 4FVUA 5BRDA 2V7ZA 3S9HA 3TAEA 3OHRA 3HP6A 3CCMN 1DT9A 3R3LA 2G8FA 1GOAA 2QWNA 2NUBA 4KHQA 1E4FT 3KWIA 4CGJA 4H03B 1ASVA 2OCEA 1YTAA 3AVNA 2XO7A 2HNDA 4IBNA 1K9MO 3WT0A 4CIEA 4CD3A 1QS4A 2P9KA 3VN5A 1WSIA 3LAMA 4Y1DA 1I39A 3GL1A 1VSJA 3KK7A 1RT2A 3W3DA 2QTDA 1WSEA 3PX0A 4RW9A 1NG9A 1P90A 4JKEA 5AQYA 2QI2A 4BWMA 3MEEA 3KLHA 4LF5K 4NLCA 3ZEUB 1UAXA 3FZKA 4FVMA 4W5TA 4QOZB 4DFPA 3MEGA 3TU5A 2YI1A 4NCBA 4BY9C 1VSEA 2YHXA 5KQDA 3DRPA 4KB0A 4K41A 1O13A 2ZF5O 3CJCA 2RKIA 2V52B 1XWLA 4L8RB 4L3QA 3QETA 1R59O 2Q1NA 2A6AA 4RTFD 3SV4A 2D4WA 3D2EA 1NK8A 1HNWK 4Z4EA 3CC4N 1TL1A 3S3MA 3DLHA 4BRPA 3NVMA 3ZSRA 1VSHA 3P5JA 4OJRA 1CLQA 2GUIA 4CHNA 1HYSA 2O8BB 4YOXA 3TABA 5AZIB 4ILGB 5AFUA 3F9KA 1KLNA 3AVBA 4FLUA 2AJQA 2HMIA 4CBXA 4KO0A 4AM6A 3H46O 4YOUA 3EY1A
chains in the Genus database with same CATH topology
1TKZA 2OPPA 3ZT4A 3HPHA 4CF2A 2AJQA 2DY4A 2BANA 2ITGA 3I0RA 3OYJA 1JLCA 3AA3A 4CJ4A 1J54A 3VQ6A 2HNYA 3KKRA 1RT6A 4N5SA 1LWCA 3D0PA 1NKBA 3LP0A 4IKFA 4M3XA 4F3TA 4J2DA 2HHXA 3MXIA 4RW8A 4FLXA 4MQ3A 1TK5A 4CEZA 2D0BA 3OYBA 3RMAA 3VQ8A 3VA0A 5HP1A 1C1BA 4OVLA 3ZCMA 4FLYA 3WNGA 4LSLA 1JLGA 4ZTJA 3QERA 1RTJA 4FZXC 3KD1E 4JS4A 4FLZA 5HBMA 2JGUA 3HO1A 3RMCA 3OYCA 4RW7A 5CZ2A 1SL1A 1VSIA 1FKOA 1TKXA 2P51A 4DQRA 3HL8A 2HHWA 1CXUA 1JKHA 3SQ2A 3SQ4A 5KGWA 3DLGA 1SV5A 2PYLA 3KIOA 1N6QA 4PUOA 1VSFA 3ZT2A 2OPQA 2DTUA 1X9WA 3CYMA 4HUFA 4H4OA 1NK0A 4KHUA 2WONA 5HRSA 4DSKA 3O4QA 4H4MA 4CK3A 2KQ2A 3ITHA 3V9WA 4CGIA 1QE1A 3V9XA 2P1JA 1RBVA 1TK0A 4CEEA 1JXEA 3NFAA 1RBRA 4ID1A 1T03A 2XY5A 3NBPA 3CFOA 3ZT1A 2O4GA 4I9LA 3NH1A 5J2NA 5J2QA 1WLJA 1ZBUA 3V9UA 3MXMA 1NJZA 3C6UA 4CGGA 4DTNA 4DQIA 4LSNA 2Z1GA 4E7IA 3QEXA 3TAFA 4W5QA 3CG7A 3PY8A 4KTQA 1YVUA 3I0SA 4JRPA 1WSJA 1HJRA 3SNNA 4AH9A 5KRTA 4Z4CA 1T8EA 3K57A 4CFCA 1BISA 3DLEA 3OY9A 3AVLA 3NF8A 4RW6A 3U3YA 1ASUA 4B9SA 2FBVA 2HHVA 3KTQA 3V1QA 3K59A 4FJHA 3V4IA 3THVA 3SPZA 4B8CA 1L3UA 5DK5A 3OJSA 3UIQA 1ZYQA 4CERA 4Q5VA 4CHQA 5C42A 3CFRA 3D45A 3PV8A 5J1EA 4DLGA 4DTPA 4FXDA 4DSIA 4O55A 4HCCA 3LP3A 1CXQA 4DTOA 4FJKA 1S6PA 3AVGA 1RT1A 1GOCA 2BE2A 2IS3A 2F8TA 4M42A 4O5BA 2HVIA 1B92A 3AVHA 3SUQA 4CGDA 2X6NA 3L3VA 4FLWA 4CJ5A 3CQ8A 2F96A 1RBTA 3OS1A 1TVRA 1QSSA 3K5OA 1HMVA 3P1GA 2VWKA 2W42A 3VQ9A 4Z4FA 3PX6A 2KTQA 3AVJA 3IG1A 1XC9A 2PZSA 4B3OA 3HP9A 4JLHA 1RDCA 1KFDA 3DM2A 2VG7A 1KFSA 3PO5A 3NGZA 4KHNA 5HROA 4H8KA 4KFBA 4EP4A 4CF0A 1WSGA 4NYFA 3DOLA 1ZBFA 4IG0A 3VQBA 1Y97A 4CJLA 4E1MA 2Z1JA 2OA8A 4FZYA 1FK9A 3KK1A 1RDAA 1U49A 1LAWA 3M8SA 4I2QA 3V9SA 5C25A 4CJ3A 1RBUA 4KKOA 3SZ2A 3LZIA 1NK4A 4MFBA 2YNGA 3MECA 1IKXA 5CZ1A 3LP2A 3NF9A 3E01A 1TKTA 1SKSA 3T3FA 1MU2A 4OKKA 3BGRA 1S9EA 4KHSA 3U6FA 4OLAA 2G8IA 1REVA 4OGEA 5KTQA 5E41A 3L2WA 3K58A 1D9DA 1EKEA 2OPRA 4QCLA 3TAMA 3U3GA 3O3FA 3KKSA 1JLAA 3NCIA 1SUQA 1T7PA 3AO2A 4DLEA 4E0DA 5HRRA 2IOCA 5C24A 4AHUA 2XY7A 1J53A 2XY6A 3OVNA 5KRSA 3K5MA 3V1RA 3QINA 4O0JA 1EETA 3T1AA 1BGXT 2YKMA 5CYQA 4BE0A 3RMBA 2LSNA 4DSJA 4FK2A 4CJFA 3OYAA 3NHGA 4F4KA 3DI6A 4EZ9A 1IKVA 2A1SA 3SQ0A 4FJGA 4IFVA 1CZ9A 4BE2A 1VSMA 4DQPA 4J2BA 1BCOA 4I7FA 4OKEA 4DSEA 1C6VA 1X1PA 4DWIA 4KPYA 4CFDA 3SYZA 1DLOA 1UOCA 3LAKA 4M3ZA 3VA3A 1KTQA 4Z0UA 4B9MA 1U47A 2R7YA 4DS4A 4CEQA 1U48A 5FRNA 4M3TA 4C8KA 3SUPA 4YFUA 4E19A 3AVMA 1CZBA 3OYFA 1IG9A 1KSPA 1S1WA 1Q9XA 2WOMA 4CGHA 2JLEA 4JRQA 3JYTA 1TAUA 1GOBA 1VSLA 2OZMA 2O4IA 3I8DA 3SJJA 1NJYA 3OYNA 3WNFA 3NGIA 3NF6A 5FROA 3L8BA 4DF8A 2OZSA 5J2PA 3OYEA 4Z4GA 3AO4A 1BIZA 2X78A 4AHCA 3RMDA 4N47A 1L5UA 4C8OA 4ELTA 4Y1CA 3L3UA 4KTWA 3PUFA 5I42A 1ASWA 3G10A 3QEVA 4LH5A 3NAEA 2FC0A 2X74A 1U4BA 4FJMA 4O4GA 4F3OA 1SL0A 1BQNA 4PWDA 1QSLA 2PY5A 4CJUA 1S6QA 1G15A 3EYZA 2RN2A 4FJJA 4DMNA 1FKPA 1C0UA 1RDBA 4BE1A 4DSFA 4DFJA 4PA1A 1D5AA 4AHSA 2QXFA 3SUNA 4HCBA 2HW3A 1BIUA 1BHLA 2QK9A 2PYJA 1IKWA 4E3SA 2YHBA 1S1XA 4DSLA 3HVRA 3CFPA 5SWMA 1JLEA 2G8UA 3ISNC 1NOZA 4CJVA 4CJPA 1LV5A 4K8XA 1L3SA 1KVAA 1WN7A 4RG8A 3M8QA 3G0ZA 2E4LA 1TK8A 2HHQA 3C95A 3ALYA 3K5LA 3NDKA 4FM0A 3QIPA 3H08A 2YKNA 5T7BA 3V81A 2XRIA 1XHZA 4B8AB 4BDYA 1NOYA 2D0CA 4DU4A 2I5JA 1SKWA 4FYDA 2FBYA 5KGXA 4FJIA 2IAJA 3TR8A 4K8ZA 3DYAA 5FDLA 1SKRA 2G8KA 4CE9A 2P5GA 4FK0A 3QIOA 4G1QA 3O3GA 4FLVA 2IC3A 3HPOA 5JS2A 4B9VA 3MEDA 4OPKA 3RRGA 4W5RA 3IS9A 4FJ7A 3SI6A 4FZZA 3AV9A 3ASMA 2KW4A 3MXJA 4WE1A 4CHZA 4IFYA 3L2RA 1TGOA 3HM9A 1RDDA 1SL2A 1HNVA 1Z25A 3DOKA 1RTHA 1R0AA 1BQMA 4W5OA 3CM6A 4B9UA 1NJWA 3L2QA 1WSFA 4KAZA 4GW6A 3AVFA 5KI6A 3OYDA 2KZMA 1C0TA 3ZT0A 2RF2A 3HVTA 4AHTA 3VQPA 3KLIA 5JS1A 1S1TA 1JXBA 2EHGA 4JS5A 2EX3A 4GMJB 4CJSA 4FJ5A 2E6MA 2ZD1A 4CEDA 4CFAA 3QESA 2A1RA 4E7LA 4I2PA 1IH7A 3HT3A 3LWLA 4CHPA 3HXMA 3S3OA 4B9NA 4KHWA 4HVJA 1JL1A 1NK6A 3TAGA 3VQAA 2YNIA 3ZSWA 3OS0A 2KFZA 1TAQA 2BGGA 1QTMA 3F73A 3DRRA 3ZSZA 2YNHA 3NH0A 1HQUA 3ZSVA 4KI4A 4PQUA 3ZSOA 1ITGA 1NJXA 4CIGA 2HVHA 4E89A 2FBTA 1BI4B 4CJEA 1IO2A 2IGIA 1C1AA 3ZSYA 1JLQA 1HRHA 4FM2A 1XHXA 5EU7A 1ZBLA 3QLHA 2Z1IA 1BI4A 4KREA 2F8SA 4FW2A 4GVMA 3MAQA 4AHVA 4F2SA 1VRTA 1VSDA 3AA2A 4DTSA 4CECA 1HYVA 4J2EA 3K2PA 4FW1A 1LAVA 1YT3A 1S1VA 5CY4A 5SZTA 4ELVA 3QEIA 2E6LA 2IDOA 1VSKA 1IKYA 2YNFA 3AO1A 3FFIA 1YTUA 4CJRA 4E7KA 1T05A 4CEOA 3AVKA 4E7JA 3ZSQA 3BDPA 4DTRA 3HYFA 1RCHA 4AHRA 3OJUA 1D9FA 1X9SA 3TAQA 4CF9A 4M3WA 1C0MA 3JSMA 5HLFA 2Q3SA 3EZ5A 2Y1IA 4DFKA 2QKKA 4IDKA 5FRMA 1I3AA 4KRFA 4OKJA 4DTUA 2KZZA 3AO5A 4LD0A 4DQSA 4F2RA 1TL3A 4R5PA 4BWJA 4PY5A 4CEBA 3HJFA 3AVIA 3M8RA 1D8YA 3IRXA 1EXQA 1KCFA 2DFHA 4ICLA 1RT4A 3S3NA 4DG1A 3HPGA 1WNSA 2B6AA 3RTVA 3KJVA 1A5VA 3VQEA 3QEPA 2GBZA 3SPYA 2ATQA 3B6PA 1VK0A 4KI6A 3OYMA 3DLRA 1C1CA 1KRPA 4F8RA 5HRPA 4DTXA 5I3UA 1DTQA 3RR7A 2DFEA 4FJNA 3ZSXA 2VG6A 2FBXA 4OGCA 1KVBA 2P5OA 2QKBA 4N56A 4HUEA 3SUOA 3WNHA 4CJKA 2G8WA 3AA5X 3M8PA 3OS2A 1FXXA 2G8HA 4AILC 3LPUA 1W0HA 4E1NA 4Z4HA 4NCAA 3TWHA 1NK7A 3L2VA 3K5NA 3SQ1A 3NF7A 1LW0A 4OLBA 4J2AA 4W5NA 5K14A 4FJ8A 4Z4IA 3O4NA 4O0IA 4KV8A 4E7HA 3RR8A 4C8LA 3LDSA 3OYHA 3TI0A 4HHTA 1X9MA 4CGFA 5J2MA 3KD5E 3ULDA 4ZHRA 4DU3A 1QQCA 1NKCA 1LWFA 5DMRA 4M3RA 3DRSA 3AO3A 3LALA 2VWJA 4KB1A 1NK5A 3LZJA 3QNOA 4FLTA 1BCMA 3AA4A 4UQGA 1DTTA 4B9LA 3VQ7A 4B9TA 1J5OA 1HYZA 4EZ6A 1K6YA 1JLFA 3CM5A 2Y1JA 4M45A 3NGYA 4FCYA 3LP1A 3TARA 1U45A 2ETJA 3DLBA 1RT5A 3V6DA 3S9HA 3C6TA 3TAEA 4LH4A 3ZT3A 3HP6A 1WSHA 4M3YA 3QEWA 1F21A 1RNHA 3LPTA 2G8FA 1UA0A 1GOAA 1S5JA 4CF8A 2NUBA 3LANA 4CF1A 4C8MA 3PO4A 1Z26A 3VQCA 1EX4A 2XY8A 1TKDA 4FJXA 4KHQA 4KHYA 4CGJA 1ASVA 1HQEA 3WNEA 1Q8IA 1YTAA 3AVNA 2XO7A 4DS5A 2HNDA 3A2FA 4IBNA 1BL3A 1NKEA 4CIEA 2OYQA 4FJ9A 1QS4A 2HB5A 1RT3A 4HTUA 4I9QA 3VN5A 3C94A 1HNIA 1WSIA 2BDPA 4IG3A 4FK4A 3LAMA 1I39A 4Y1DA 4CIFA 3OYKA 4BACA 4BDPA 2ZE2A 1VSJA 1KVCA 3NE6A 1RT2A 1S1UA 1EP4A 2HHTA 4RW4A 1RTIA 3V1OA 1J9AA 4CEFA 1WSEA 3PX0A 4RW9A 4YNQA 1Q9YA 1XI1A 4NYNA 3V9ZA 4ELUA 2HNZA 2ZQBA 3RRHA 4N41A 3OYIA 3OYLA 4BWMA 3O3HA 3MEEA 4CJTA 3KLHA 4DU1A 3P83D 2D5RA 4CK2A 1WAFA 1NK9A 4W5TA 1UAXA 4NCGA 4FVMA 3LWMA 1VRUA 4DFMA 4DFPA 4FJLA 4OPJA 4QOZB 4CFBA 3MEGA 4M41A 4CHYA 4B08A 1QHTA 4QAGA 2Z1HA 2B5JA 3T19A 4ID5A 4ZTFA 1B9FA 1WAJA 4NCBA 4LY7A 1VSEA 1JL2A 1RILA 3DRPA 4CHOA 3SV3A 4KB0A 4BDZA 2RKIA 1RTDA 4KTZA 1RBSA 4DF4A 1XWLA 2YHAA 4L8RB 2HHSA 3OYGA 4CJQA 3QETA 2XHBA 3HK2A 3KK3A 2B4JA 3SV4A 1A5XA 4FM1A 1NK8A 2KFNA 1S9GA 4DQQA 3RWUA 4CJWA 4DTMA 3TAPA 4M3UA 3VQ4A 4N76A 4Z4EA 3NH2A 3PX4A 3AVCA 4O44A 1TL1A 3B6OA 1ZBHA 3VQQA 3KLEA 4HUGA 1W9HA 3S3MA 4EP5A 3DLHA 3L2UA 3VQ5A 3ZSRA 1VSHA 1TV6A 3P5JA 4OJRA 4Q0BA 1O1WA 2GUIA 4CHNA 1HYSA 3DLKA 1CLQA 1UA1A 1N5YA 2RPIA 2VG5A 4DTJA 1KLMA 1RT7A 3TABA 3QO9A 3HSTB 2G8VA 3IAYA 4CEAA 1L3VA 3SCXA 2DFFA 4C8NA 3F9KA 1KLNA 3DMJA 3AVBA 1UWBA 3VQDA 4FLUA 4XIUA 1L3TA 1A5WA 1JLBA 4CK1A 2OPSA 2HMIA 4CCHA 1U04A 3AVAA 1B9DA 2GV9A 4TSXA 1ZBIA 5D3GA 2YV0X 3KLGA 1LWEA 1LW2A 4KO0A 2D0AA 2HHUA 2X6SA 3KK2A 5HRNA 5CYMA 3KLFA 1HPZA 1QSYA 3QNNA 4CESA 3TANA 3EY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKZ A;  2OPP A;  3ZT4 A;  3HPH A;  4CF2 A;  2AJQ A;  2DY4 A;  2BAN A;  2ITG A;  3I0R A;  3OYJ A;  1JLC A;  3AA3 A;  4CJ4 A;  1J54 A;  3VQ6 A;  2HNY A;  3KKR A;  1RT6 A;  4N5S A;  1LWC A;  3D0P A;  1NKB A;  3LP0 A;  4IKF A;  4M3X A;  4F3T A;  4J2D A;  2HHX A;  3MXI A;  4RW8 A;  4FLX A;  4MQ3 A;  1TK5 A;  4CEZ A;  2D0B A;  3OYB A;  3RMA A;  3VQ8 A;  3VA0 A;  5HP1 A;  1C1B A;  4OVL A;  3ZCM A;  4FLY A;  3WNG A;  4LSL A;  1JLG A;  4ZTJ A;  3QER A;  1RTJ A;  4FZX C;  3KD1 E;  4JS4 A;  4FLZ A;  5HBM A;  2JGU A;  3HO1 A;  3RMC A;  3OYC A;  4RW7 A;  5CZ2 A;  1SL1 A;  1VSI A;  1FKO A;  1TKX A;  2P51 A;  4DQR A;  3HL8 A;  2HHW A;  1CXU A;  1JKH A;  3SQ2 A;  3SQ4 A;  5KGW A;  3DLG A;  1SV5 A;  2PYL A;  3KIO A;  1N6Q A;  4PUO A;  1VSF A;  3ZT2 A;  2OPQ A;  2DTU A;  1X9W A;  3CYM A;  4HUF A;  4H4O A;  1NK0 A;  4KHU A;  2WON A;  5HRS A;  4DSK A;  3O4Q A;  4H4M A;  4CK3 A;  2KQ2 A;  3ITH A;  3V9W A;  4CGI A;  1QE1 A;  3V9X A;  2P1J A;  1RBV A;  1TK0 A;  4CEE A;  1JXE A;  3NFA A;  1RBR A;  4ID1 A;  1T03 A;  2XY5 A;  3NBP A;  3CFO A;  3ZT1 A;  2O4G A;  4I9L A;  3NH1 A;  5J2N A;  5J2Q A;  1WLJ A;  1ZBU A;  3V9U A;  3MXM A;  1NJZ A;  3C6U A;  4CGG A;  4DTN A;  4DQI A;  4LSN A;  2Z1G A;  4E7I A;  3QEX A;  3TAF A;  4W5Q A;  3CG7 A;  3PY8 A;  4KTQ A;  1YVU A;  3I0S A;  4JRP A;  1WSJ A;  1HJR A;  3SNN A;  4AH9 A;  5KRT A;  4Z4C A;  1T8E A;  3K57 A;  4CFC A;  1BIS A;  3DLE A;  3OY9 A;  3AVL A;  3NF8 A;  4RW6 A;  3U3Y A;  1ASU A;  4B9S A;  2FBV A;  2HHV A;  3KTQ A;  3V1Q A;  3K59 A;  4FJH A;  3V4I A;  3THV A;  3SPZ A;  4B8C A;  1L3U A;  5DK5 A;  3OJS A;  3UIQ A;  1ZYQ A;  4CER A;  4Q5V A;  4CHQ A;  5C42 A;  3CFR A;  3D45 A;  3PV8 A;  5J1E A;  4DLG A;  4DTP A;  4FXD A;  4DSI A;  4O55 A;  4HCC A;  3LP3 A;  1CXQ A;  4DTO A;  4FJK A;  1S6P A;  3AVG A;  1RT1 A;  1GOC A;  2BE2 A;  2IS3 A;  2F8T A;  4M42 A;  4O5B A;  2HVI A;  1B92 A;  3AVH A;  3SUQ A;  4CGD A;  2X6N A;  3L3V A;  4FLW A;  4CJ5 A;  3CQ8 A;  2F96 A;  1RBT A;  3OS1 A;  1TVR A;  1QSS A;  3K5O A;  1HMV A;  3P1G A;  2VWK A;  2W42 A;  3VQ9 A;  4Z4F A;  3PX6 A;  2KTQ A;  3AVJ A;  3IG1 A;  1XC9 A;  2PZS A;  4B3O A;  3HP9 A;  4JLH A;  1RDC A;  1KFD A;  3DM2 A;  2VG7 A;  1KFS A;  3PO5 A;  3NGZ A;  4KHN A;  5HRO A;  4H8K A;  4KFB A;  4EP4 A;  4CF0 A;  1WSG A;  4NYF A;  3DOL A;  1ZBF A;  4IG0 A;  3VQB A;  1Y97 A;  4CJL A;  4E1M A;  2Z1J A;  2OA8 A;  4FZY A;  1FK9 A;  3KK1 A;  1RDA A;  1U49 A;  1LAW A;  3M8S A;  4I2Q A;  3V9S A;  5C25 A;  4CJ3 A;  1RBU A;  4KKO A;  3SZ2 A;  3LZI A;  1NK4 A;  4MFB A;  2YNG A;  3MEC A;  1IKX A;  5CZ1 A;  3LP2 A;  3NF9 A;  3E01 A;  1TKT A;  1SKS A;  3T3F A;  1MU2 A;  4OKK A;  3BGR A;  1S9E A;  4KHS A;  3U6F A;  4OLA A;  2G8I A;  1REV A;  4OGE A;  5KTQ A;  5E41 A;  3L2W A;  3K58 A;  1D9D A;  1EKE A;  2OPR A;  4QCL A;  3TAM A;  3U3G A;  3O3F A;  3KKS A;  1JLA A;  3NCI A;  1SUQ A;  1T7P A;  3AO2 A;  4DLE A;  4E0D A;  5HRR A;  2IOC A;  5C24 A;  4AHU A;  2XY7 A;  1J53 A;  2XY6 A;  3OVN A;  5KRS A;  3K5M A;  3V1R A;  3QIN A;  4O0J A;  1EET A;  3T1A A;  1BGX T;  2YKM A;  5CYQ A;  4BE0 A;  3RMB A;  2LSN A;  4DSJ A;  4FK2 A;  4CJF A;  3OYA A;  3NHG A;  4F4K A;  3DI6 A;  4EZ9 A;  1IKV A;  2A1S A;  3SQ0 A;  4FJG A;  4IFV A;  1CZ9 A;  4BE2 A;  1VSM A;  4DQP A;  4J2B A;  1BCO A;  4I7F A;  4OKE A;  4DSE A;  1C6V A;  1X1P A;  4DWI A;  4KPY A;  4CFD A;  3SYZ A;  1DLO A;  1UOC A;  3LAK A;  4M3Z A;  3VA3 A;  1KTQ A;  4Z0U A;  4B9M A;  1U47 A;  2R7Y A;  4DS4 A;  4CEQ A;  1U48 A;  5FRN A;  4M3T A;  4C8K A;  3SUP A;  4YFU A;  4E19 A;  3AVM A;  1CZB A;  3OYF A;  1IG9 A;  1KSP A;  1S1W A;  1Q9X A;  2WOM A;  4CGH A;  2JLE A;  4JRQ A;  3JYT A;  1TAU A;  1GOB A;  1VSL A;  2OZM A;  2O4I A;  3I8D A;  3SJJ A;  1NJY A;  3OYN A;  3WNF A;  3NGI A;  3NF6 A;  5FRO A;  3L8B A;  4DF8 A;  2OZS A;  5J2P A;  3OYE A;  4Z4G A;  3AO4 A;  1BIZ A;  2X78 A;  4AHC A;  3RMD A;  4N47 A;  1L5U A;  4C8O A;  4ELT A;  4Y1C A;  3L3U A;  4KTW A;  3PUF A;  5I42 A;  1ASW A;  3G10 A;  3QEV A;  4LH5 A;  3NAE A;  2FC0 A;  2X74 A;  1U4B A;  4FJM A;  4O4G A;  4F3O A;  1SL0 A;  1BQN A;  4PWD A;  1QSL A;  2PY5 A;  4CJU A;  1S6Q A;  1G15 A;  3EYZ A;  2RN2 A;  4FJJ A;  4DMN A;  1FKP A;  1C0U A;  1RDB A;  4BE1 A;  4DSF A;  4DFJ A;  4PA1 A;  1D5A A;  4AHS A;  2QXF A;  3SUN A;  4HCB A;  2HW3 A;  1BIU A;  1BHL A;  2QK9 A;  2PYJ A;  1IKW A;  4E3S A;  2YHB A;  1S1X A;  4DSL A;  3HVR A;  3CFP A;  5SWM A;  1JLE A;  2G8U A;  3ISN C;  1NOZ A;  4CJV A;  4CJP A;  1LV5 A;  4K8X A;  1L3S A;  1KVA A;  1WN7 A;  4RG8 A;  3M8Q A;  3G0Z A;  2E4L A;  1TK8 A;  2HHQ A;  3C95 A;  3ALY A;  3K5L A;  3NDK A;  4FM0 A;  3QIP A;  3H08 A;  2YKN A;  5T7B A;  3V81 A;  2XRI A;  1XHZ A;  4B8A B;  4BDY A;  1NOY A;  2D0C A;  4DU4 A;  2I5J A;  1SKW A;  4FYD A;  2FBY A;  5KGX A;  4FJI A;  2IAJ A;  3TR8 A;  4K8Z A;  3DYA A;  5FDL A;  1SKR A;  2G8K A;  4CE9 A;  2P5G A;  4FK0 A;  3QIO A;  4G1Q A;  3O3G A;  4FLV A;  2IC3 A;  3HPO A;  5JS2 A;  4B9V A;  3MED A;  4OPK A;  3RRG A;  4W5R A;  3IS9 A;  4FJ7 A;  3SI6 A;  4FZZ A;  3AV9 A;  3ASM A;  2KW4 A;  3MXJ A;  4WE1 A;  4CHZ A;  4IFY A;  3L2R A;  1TGO A;  3HM9 A;  1RDD A;  1SL2 A;  1HNV A;  1Z25 A;  3DOK A;  1RTH A;  1R0A A;  1BQM A;  4W5O A;  3CM6 A;  4B9U A;  1NJW A;  3L2Q A;  1WSF A;  4KAZ A;  4GW6 A;  3AVF A;  5KI6 A;  3OYD A;  2KZM A;  1C0T A;  3ZT0 A;  2RF2 A;  3HVT A;  4AHT A;  3VQP A;  3KLI A;  5JS1 A;  1S1T A;  1JXB A;  2EHG A;  4JS5 A;  2EX3 A;  4GMJ B;  4CJS A;  4FJ5 A;  2E6M A;  2ZD1 A;  4CED A;  4CFA A;  3QES A;  2A1R A;  4E7L A;  4I2P A;  1IH7 A;  3HT3 A;  3LWL A;  4CHP A;  3HXM A;  3S3O A;  4B9N A;  4KHW A;  4HVJ A;  1JL1 A;  1NK6 A;  3TAG A;  3VQA A;  2YNI A;  3ZSW A;  3OS0 A;  2KFZ A;  1TAQ A;  2BGG A;  1QTM A;  3F73 A;  3DRR A;  3ZSZ A;  2YNH A;  3NH0 A;  1HQU A;  3ZSV A;  4KI4 A;  4PQU A;  3ZSO A;  1ITG A;  1NJX A;  4CIG A;  2HVH A;  4E89 A;  2FBT A;  1BI4 B;  4CJE A;  1IO2 A;  2IGI A;  1C1A A;  3ZSY A;  1JLQ A;  1HRH A;  4FM2 A;  1XHX A;  5EU7 A;  1ZBL A;  3QLH A;  2Z1I A;  1BI4 A;  4KRE A;  2F8S A;  4FW2 A;  4GVM A;  3MAQ A;  4AHV A;  4F2S A;  1VRT A;  1VSD A;  3AA2 A;  4DTS A;  4CEC A;  1HYV A;  4J2E A;  3K2P A;  4FW1 A;  1LAV A;  1YT3 A;  1S1V A;  5CY4 A;  5SZT A;  4ELV A;  3QEI A;  2E6L A;  2IDO A;  1VSK A;  1IKY A;  2YNF A;  3AO1 A;  3FFI A;  1YTU A;  4CJR A;  4E7K A;  1T05 A;  4CEO A;  3AVK A;  4E7J A;  3ZSQ A;  3BDP A;  4DTR A;  3HYF A;  1RCH A;  4AHR A;  3OJU A;  1D9F A;  1X9S A;  3TAQ A;  4CF9 A;  4M3W A;  1C0M A;  3JSM A;  5HLF A;  2Q3S A;  3EZ5 A;  2Y1I A;  4DFK A;  2QKK A;  4IDK A;  5FRM A;  1I3A A;  4KRF A;  4OKJ A;  4DTU A;  2KZZ A;  3AO5 A;  4LD0 A;  4DQS A;  4F2R A;  1TL3 A;  4R5P A;  4BWJ A;  4PY5 A;  4CEB A;  3HJF A;  3AVI A;  3M8R A;  1D8Y A;  3IRX A;  1EXQ A;  1KCF A;  2DFH A;  4ICL A;  1RT4 A;  3S3N A;  4DG1 A;  3HPG A;  1WNS A;  2B6A A;  3RTV A;  3KJV A;  1A5V A;  3VQE A;  3QEP A;  2GBZ A;  3SPY A;  2ATQ A;  3B6P A;  1VK0 A;  4KI6 A;  3OYM A;  3DLR A;  1C1C A;  1KRP A;  4F8R A;  5HRP A;  4DTX A;  5I3U A;  1DTQ A;  3RR7 A;  2DFE A;  4FJN A;  3ZSX A;  2VG6 A;  2FBX A;  4OGC A;  1KVB A;  2P5O A;  2QKB A;  4N56 A;  4HUE A;  3SUO A;  3WNH A;  4CJK A;  2G8W A;  3AA5 X;  3M8P A;  3OS2 A;  1FXX A;  2G8H A;  4AIL C;  3LPU A;  1W0H A;  4E1N A;  4Z4H A;  4NCA A;  3TWH A;  1NK7 A;  3L2V A;  3K5N A;  3SQ1 A;  3NF7 A;  1LW0 A;  4OLB A;  4J2A A;  4W5N A;  5K14 A;  4FJ8 A;  4Z4I A;  3O4N A;  4O0I A;  4KV8 A;  4E7H A;  3RR8 A;  4C8L A;  3LDS A;  3OYH A;  3TI0 A;  4HHT A;  1X9M A;  4CGF A;  5J2M A;  3KD5 E;  3ULD A;  4ZHR A;  4DU3 A;  1QQC A;  1NKC A;  1LWF A;  5DMR A;  4M3R A;  3DRS A;  3AO3 A;  3LAL A;  2VWJ A;  4KB1 A;  1NK5 A;  3LZJ A;  3QNO A;  4FLT A;  1BCM A;  3AA4 A;  4UQG A;  1DTT A;  4B9L A;  3VQ7 A;  4B9T A;  1J5O A;  1HYZ A;  4EZ6 A;  1K6Y A;  1JLF A;  3CM5 A;  2Y1J A;  4M45 A;  3NGY A;  4FCY A;  3LP1 A;  3TAR A;  1U45 A;  2ETJ A;  3DLB A;  1RT5 A;  3V6D A;  3S9H A;  3C6T A;  3TAE A;  4LH4 A;  3ZT3 A;  3HP6 A;  1WSH A;  4M3Y A;  3QEW A;  1F21 A;  1RNH A;  3LPT A;  2G8F A;  1UA0 A;  1GOA A;  1S5J A;  4CF8 A;  2NUB A;  3LAN A;  4CF1 A;  4C8M A;  3PO4 A;  1Z26 A;  3VQC A;  1EX4 A;  2XY8 A;  1TKD A;  4FJX A;  4KHQ A;  4KHY A;  4CGJ A;  1ASV A;  1HQE A;  3WNE A;  1Q8I A;  1YTA A;  3AVN A;  2XO7 A;  4DS5 A;  2HND A;  3A2F A;  4IBN A;  1BL3 A;  1NKE A;  4CIE A;  2OYQ A;  4FJ9 A;  1QS4 A;  2HB5 A;  1RT3 A;  4HTU A;  4I9Q A;  3VN5 A;  3C94 A;  1HNI A;  1WSI A;  2BDP A;  4IG3 A;  4FK4 A;  3LAM A;  1I39 A;  4Y1D A;  4CIF A;  3OYK A;  4BAC A;  4BDP A;  2ZE2 A;  1VSJ A;  1KVC A;  3NE6 A;  1RT2 A;  1S1U A;  1EP4 A;  2HHT A;  4RW4 A;  1RTI A;  3V1O A;  1J9A A;  4CEF A;  1WSE A;  3PX0 A;  4RW9 A;  4YNQ A;  1Q9Y A;  1XI1 A;  4NYN A;  3V9Z A;  4ELU A;  2HNZ A;  2ZQB A;  3RRH A;  4N41 A;  3OYI A;  3OYL A;  4BWM A;  3O3H A;  3MEE A;  4CJT A;  3KLH A;  4DU1 A;  3P83 D;  2D5R A;  4CK2 A;  1WAF A;  1NK9 A;  4W5T A;  1UAX A;  4NCG A;  4FVM A;  3LWM A;  1VRU A;  4DFM A;  4DFP A;  4FJL A;  4OPJ A;  4QOZ B;  4CFB A;  3MEG A;  4M41 A;  4CHY A;  4B08 A;  1QHT A;  4QAG A;  2Z1H A;  2B5J A;  3T19 A;  4ID5 A;  4ZTF A;  1B9F A;  1WAJ A;  4NCB A;  4LY7 A;  1VSE A;  1JL2 A;  1RIL A;  3DRP A;  4CHO A;  3SV3 A;  4KB0 A;  4BDZ A;  2RKI A;  1RTD A;  4KTZ A;  1RBS A;  4DF4 A;  1XWL A;  2YHA A;  4L8R B;  2HHS A;  3OYG A;  4CJQ A;  3QET A;  2XHB A;  3HK2 A;  3KK3 A;  2B4J A;  3SV4 A;  1A5X A;  4FM1 A;  1NK8 A;  2KFN A;  1S9G A;  4DQQ A;  3RWU A;  4CJW A;  4DTM A;  3TAP A;  4M3U A;  3VQ4 A;  4N76 A;  4Z4E A;  3NH2 A;  3PX4 A;  3AVC A;  4O44 A;  1TL1 A;  3B6O A;  1ZBH A;  3VQQ A;  3KLE A;  4HUG A;  1W9H A;  3S3M A;  4EP5 A;  3DLH A;  3L2U A;  3VQ5 A;  3ZSR A;  1VSH A;  1TV6 A;  3P5J A;  4OJR A;  4Q0B A;  1O1W A;  2GUI A;  4CHN A;  1HYS A;  3DLK A;  1CLQ A;  1UA1 A;  1N5Y A;  2RPI A;  2VG5 A;  4DTJ A;  1KLM A;  1RT7 A;  3TAB A;  3QO9 A;  3HST B;  2G8V A;  3IAY A;  4CEA A;  1L3V A;  3SCX A;  2DFF A;  4C8N A;  3F9K A;  1KLN A;  3DMJ A;  3AVB A;  1UWB A;  3VQD A;  4FLU A;  4XIU A;  1L3T A;  1A5W A;  1JLB A;  4CK1 A;  2OPS A;  2HMI A;  4CCH A;  1U04 A;  3AVA A;  1B9D A;  2GV9 A;  4TSX A;  1ZBI A;  5D3G A;  2YV0 X;  3KLG A;  1LWE A;  1LW2 A;  4KO0 A;  2D0A A;  2HHU A;  2X6S A;  3KK2 A;  5HRN A;  5CYM A;  3KLF A;  1HPZ A;  1QSY A;  3QNN A;  4CES A;  3TAN A;  3EY1 A; 
#chains in the Genus database with same CATH topology
 3C6H A;  4CF2 A;  1JLC A;  4CJ4 A;  2HNY A;  3KKR A;  4N5S A;  2P9N A;  1HKB A;  4M3X A;  2HHX A;  4CEZ A;  4H5V A;  3WEE B;  3OYB A;  1C1B A;  3QER A;  2VQF K;  4FZX C;  4FLZ A;  1KD1 O;  3CCU N;  2E2Q A;  2P9S B;  2O8F A;  3OYC A;  3DXM B;  1SL1 A;  4DQR A;  3VPZ A;  1JKH A;  5M1N A;  5KGW A;  4CVN E;  3KIO A;  1X9W A;  3O9R A;  4KHU A;  3MMV A;  4DSK A;  4IZ9 A;  1YHQ N;  4Y0W A;  4BR7 A;  2EWS A;  2P9U B;  3KVG A;  3MN5 A;  5LJW A;  1W97 L;  3ZT1 A;  2O4G A;  3M3Z A;  4I9L A;  5J2Q A;  1NJZ A;  3LM9 A;  5AFU H;  3C6U A;  4CGG A;  4DTN A;  3ENO A;  1NGG A;  1RDU A;  4HWI A;  2NRW A;  4W5Q A;  3CG7 A;  4CBU A;  3PIP L;  4JRP A;  4O8K A;  3F9M A;  4KH5 A;  1QQN A;  4Z4C A;  4BR0 A;  1BIS A;  2E2N A;  3OY9 A;  3AVL A;  3THV A;  1L3U A;  1JJ2 M;  1ZYQ A;  2GEL A;  1OH5 A;  5C42 A;  1M90 O;  4XH1 A;  3I8B A;  4A2B A;  4CI6 A;  3MDQ A;  3PV8 A;  3LP3 A;  2UU9 K;  3AVG A;  1GOC A;  2IS3 A;  3THY A;  2CH5 A;  3VER A;  2ZJQ L;  3SUQ A;  4MDA A;  3OS1 A;  1RBT A;  1QSS A;  1NGB A;  1U6Z A;  2E88 A;  4KBO A;  3VQ9 A;  3O4W A;  3EKU A;  4G9Z A;  3AVJ A;  3IG1 A;  4OPA A;  3HP9 A;  4JLH A;  3CJB A;  3NGZ A;  4CF0 A;  1I94 K;  3VQB A;  1Y97 A;  3IMX A;  4IOX A;  1JCE A;  2OA8 A;  3KK1 A;  5M1P A;  3HBT A;  2HHH K;  4JYA K;  2J4R A;  1RBU A;  3O9T A;  2KKZ A;  3EO3 A;  1NK4 A;  3EE9 A;  4MFB A;  5CZ1 A;  1SKS A;  4A62 A;  4CZG A;  3T3F A;  4KHS A;  4CZM A;  3I56 N;  4OGE A;  2P9L A;  4UY8 O;  3K58 A;  3MCP A;  4DHY A;  3U3G A;  1T7P A;  3AO2 A;  2E1Z A;  5HRR A;  2PAV A;  1J53 A;  1IBL K;  2XY6 A;  3THX B;  4CZL A;  3K5M A;  4DSJ A;  4DV7 K;  2NRT A;  5BPL A;  1XUP O;  4YOW A;  4FK2 A;  3NHG A;  4F4K A;  2I7N A;  3DI6 A;  5BRF A;  1IKV A;  5KPR A;  3SQ0 A;  2RE2 A;  4JEP A;  4BE2 A;  1HJO A;  4OKE A;  3U8X A;  4WCE L;  1Z05 A;  3VA3 A;  4Z0U A;  5FRN A;  3WUH A;  3R6M A;  4M3T A;  3SUP A;  4BC5 A;  1CZB A;  4WFA L;  1KSP A;  3K9J A;  3JYT A;  1VQ4 N;  2OZM A;  4DV2 K;  3FZM A;  5FRO A;  3OYE A;  3A5N C;  4ELT A;  2WBN A;  4Y1C A;  3J7Z O;  3CD6 N;  3QEV A;  1J5E K;  2X74 A;  4FJM A;  4JHD A;  1GLJ O;  4DQ8 A;  1G15 A;  1RDB A;  4BE1 A;  4DSF A;  4U67 L;  2QXF A;  1E4G T;  4KH6 A;  4JKD A;  3HOS A;  5AQK A;  2FSK A;  4E3S A;  4DR6 K;  3F2K A;  2P9I A;  4NB4 A;  2G8U A;  4M7X A;  5GIN A;  4K8X A;  2GUP A;  1L3S A;  1KVA A;  4RG8 A;  4BRD A;  5T7B A;  3H08 A;  2YKN A;  3V81 A;  2XRI A;  4BRM A;  2D0C A;  2F9W A;  2I5J A;  4FPA A;  5AQV A;  2FBY A;  5FDL A;  2G8K A;  4FK0 A;  4G1Q A;  1Q81 O;  3HPO A;  1WBD A;  4OPK A;  3RRG A;  1ATR A;  3SI6 A;  4FZZ A;  3ASM A;  1LCU A;  2P9K B;  5AQL A;  4CHZ A;  2GWK A;  3DOK A;  3HRG A;  3JXU A;  1KAX A;  1BQM A;  4W5O A;  4B9U A;  1NJW A;  1WSF A;  4KAZ A;  5KI6 A;  3AVF A;  3UKR A;  3GG4 A;  1QZ5 A;  1JXB A;  3GBT A;  4FJ5 A;  2E6M A;  4CED A;  4I2P A;  3HT3 A;  3LWL A;  1JL1 A;  3TAG A;  1W2B M;  2KFZ A;  1QTM A;  2UUA K;  2YNH A;  3NH0 A;  1HQU A;  4KI4 A;  2CGL A;  4FWP A;  2FBT A;  3OA9 A;  2QWL A;  2WFB A;  5AQM A;  2IGI A;  1C1A A;  4IOC L;  2F9T A;  3QLH A;  4BR9 A;  4KRE A;  2F8S A;  4GVM A;  4AHV A;  4F2S A;  2ZJR L;  1VRT A;  5MLC Q;  4ISE A;  1LOT B;  5SZT A;  4ELV A;  3QEI A;  2YNF A;  1IKY A;  2UXB K;  1T05 A;  3A5M C;  3BDP A;  4FWQ A;  4JI1 K;  3ZSQ A;  3CCQ N;  4GKJ K;  3SMP A;  3KZB A;  1X9S A;  1X3M A;  2Q3S A;  3EZ5 A;  2QKK A;  1ATN A;  5FPD A;  3VEV A;  4LD0 A;  1TL3 A;  4PY5 A;  2UXD K;  3HJF A;  3D7E O;  1D8Y A;  1RT4 A;  3S3N A;  4DG1 A;  4YHH K;  1NGD A;  3QEP A;  3KJV A;  2AP1 A;  1VK0 A;  3DLR A;  2P9N B;  2FBX A;  4OGC A;  2P5O A;  5LL6 Z;  4EHU A;  2F7T A;  3WNH A;  3SUO A;  5JIC A;  2G8W A;  1FXX A;  1U2V A;  1HR0 K;  3DWL A;  3LPU A;  1W0H A;  4E1N A;  3J8A A;  3TWH A;  4OLB A;  4FJ8 A;  4Z4I A;  3RR8 A;  3LDS A;  4HHT A;  1X9M A;  2CGJ A;  3J7Y P;  1X9J A;  4M3R A;  3E9P A;  3AO3 A;  4WQ4 C;  2OTL N;  4WQ4 A;  4KB1 A;  1IJJ A;  2I7P A;  4H0V B;  4FLT A;  1VQL N;  4DB3 A;  1S72 N;  3AA4 A;  4UQG A;  1DTT A;  1SQK A;  4B9T A;  1J5O A;  2NRZ A;  4M45 A;  2FLO A;  5BN9 A;  1U45 A;  3MX2 A;  2ETJ A;  3DLB A;  1T6C A;  4JK7 A;  2E20 A;  1QQM A;  4LH4 A;  4BRO A;  3LPT A;  1FW6 A;  1S5J A;  4CF8 A;  3PO4 A;  1OVY A;  4FWR A;  3VF4 A;  1HQE A;  3AGK A;  3WNE A;  5LY3 A;  2QA4 N;  4M63 C;  3VGM A;  2OYQ A;  4I9Q A;  4HTU A;  1T3V A;  3C94 A;  1HNI A;  1GLD G;  4IG3 A;  4BR2 A;  4A59 A;  4EHT A;  3OYK A;  4BAC A;  3DXK A;  3NMU A;  3NE6 A;  1KVC A;  1Q82 O;  4BRF A;  3THY B;  4RW4 A;  1RTI A;  4JD2 B;  1J9A A;  4CEF A;  1HNZ K;  4NYN A;  1BOT O;  2ZQB A;  4E1J A;  3O3H A;  4DU1 A;  3P83 D;  5HL7 L;  4DFM A;  4B3S K;  4CFB A;  1GLE G;  4M41 A;  4CHY A;  1QHT A;  1ZBS A;  2B5J A;  4ZTF A;  1WAJ A;  2QWM A;  1K73 O;  4CHO A;  3TSP A;  3E9L A;  3CCJ N;  3HOT A;  1VQ9 N;  3SBG A;  3KK3 A;  4BRN A;  4FOI A;  4FM1 A;  2KFN A;  1S9G A;  3RWU A;  5F2R A;  4N76 A;  3E66 A;  3B6O A;  3KLE A;  4HUG A;  4DR4 K;  4IWV A;  5AQP A;  3VQ5 A;  3FLC O;  1O1W A;  3DLK A;  1UA1 A;  1N5Y A;  2G8V A;  3QO9 A;  3IAY A;  3SCX A;  4WQ5 C;  1Q7Y O;  4C8N A;  3DMJ A;  4H5W A;  3VGL A;  3VQD A;  1L3T A;  4CCH A;  2OPS A;  3P31 A;  3AVA A;  1B9D A;  2GV9 A;  4TSX A;  4CZJ A;  2YV0 X;  1BA0 A;  1LW2 A;  2V51 B;  2X6S A;  5EY4 A;  3ZX0 A;  3KK2 A;  2Q2R A;  3KLF A;  1QSY A;  3QNN A;  4CES A;  3TAN A;  4B1W B;  2BAN A;  5C15 A;  3I0R A;  5GAH P;  3OYJ A;  5C2F A;  4IKF A;  4J2D A;  3MXI A;  4RW8 A;  4FLX A;  4FWL A;  2D0B A;  3G4S N;  5AQS A;  3T69 A;  1RTJ A;  3O6W A;  3KD1 E;  4B1V A;  3ATV A;  3VF2 A;  4QS7 A;  2JGU A;  3HO1 A;  3CME N;  1VSI A;  4H0X B;  2HHW A;  1CXU A;  1E3M A;  2IVO A;  3SQ4 A;  4BQZ A;  3DLG A;  3SQ2 A;  2PYL A;  1N6Q A;  1VSF A;  4YOY A;  2H3G X;  4FPB A;  4JHD B;  4M7Y A;  5HRS A;  4H4M A;  2F4V K;  1QHA A;  3V9X A;  2O8D A;  4CEE A;  1BO5 O;  1RBR A;  3NFA A;  4ID1 A;  2VYP A;  3TSQ A;  3NH1 A;  1WLJ A;  3V9U A;  4DR1 K;  2P9I B;  4LSN A;  3QEX A;  3ULE A;  4KTQ A;  1YVU A;  1WSJ A;  3K57 A;  3DLE A;  4RW6 A;  2HHV A;  3C7N A;  4FO0 A;  5JLH A;  3AY9 A;  3V1Q A;  3KTQ A;  3SPZ A;  3RVC A;  4B8C A;  4CBW A;  2DPN A;  5AQI A;  4BRE A;  3D45 A;  5GAE P;  4DTP A;  4DSI A;  4O55 A;  1CXQ A;  4FJK A;  4JKB A;  4LFA K;  1RT1 A;  4J8F A;  5GIO A;  1YI2 N;  1JCF A;  1B92 A;  2X6N A;  3CF5 L;  4FLW A;  3A5O C;  3UKR B;  1SZ2 A;  1TVR A;  3K5O A;  1WB9 A;  2AA4 A;  2VWK A;  2W42 A;  4Z4F A;  1KFD A;  2VG7 A;  5BRH A;  4EP4 A;  5E26 A;  2A5X A;  1ZBF A;  4FSV A;  3CMA N;  1YF5 L;  3AAQ A;  2ITM A;  3MK6 A;  3Q7C A;  4I2Q A;  3LZI A;  3LP2 A;  3NF9 A;  1MU2 A;  4OKK A;  3BGR A;  1S9E A;  4LF9 K;  4OLA A;  1REV A;  4QCL A;  5KTQ A;  1S3X A;  5E41 A;  1D9D A;  2OPR A;  3RSE B;  3TTF A;  4B9Q A;  3NCI A;  1JLA A;  1FJG K;  4DLE A;  5C24 A;  2XY7 A;  1EWR A;  3GE1 A;  4DCH A;  1YJN N;  3ZET A;  3V1R A;  4PHT X;  4O0J A;  1EET A;  1RFQ A;  2YKM A;  5CYQ A;  1KAY A;  4MO4 A;  1YAG A;  1DGK N;  4EZ9 A;  4IXC A;  4JI3 K;  4KH4 A;  3LDQ A;  4DWI A;  4IFE A;  3I55 N;  4M3Z A;  4JKG A;  4K25 A;  2R7Y A;  2HBK A;  2WC9 A;  5AQU A;  4C8K A;  3EZW A;  4WFB L;  3P4I A;  4E19 A;  1S1W A;  2WOM A;  4CGH A;  5AQZ A;  2IIR A;  4H0O A;  2O4I A;  3I8D A;  3SJJ A;  1NJY A;  5AZJ B;  4GNI A;  4DF8 A;  1U2V B;  5J2P A;  4Z4G A;  4DR7 K;  3AO4 A;  4FJI A;  4C8O A;  3JS6 A;  4XH4 A;  3PUF A;  1ASW A;  2BH1 A;  1WOQ A;  3GDQ A;  4F3O A;  3VEY A;  4IOA L;  4PWD A;  1QSL A;  2PY5 A;  1ILY A;  4FJJ A;  1S6Q A;  4DMN A;  4CZK A;  1C0U A;  3CJA A;  2BTF A;  4DFJ A;  3QBW A;  3SUN A;  1BIU A;  1BHL A;  2PYJ A;  3IKM A;  1Z6R A;  3CFP A;  5E84 A;  4MLH A;  3ISN C;  1NOZ A;  1LV5 A;  2E1Y A;  1WN7 A;  2HHQ A;  3OW2 M;  3K5L A;  3UKU A;  3QIP A;  1XHZ A;  4KHP K;  3CXC M;  3SLC A;  5KGX A;  2IAJ A;  3SAH A;  3QIO A;  4FLV A;  2IC3 A;  5JS2 A;  4WE1 A;  2IVP A;  1TGO A;  1RDD A;  1HNV A;  3H45 C;  3MN7 A;  1RTH A;  1MWK A;  5GIP A;  3DXK B;  3DJC A;  3ZT0 A;  1NGJ A;  3CJ1 A;  4H5T A;  1HLU A;  2YHW A;  3HVT A;  4AHT A;  1XQS C;  5AQG A;  4NLB A;  3VF6 A;  1KXP A;  4BG8 A;  5BR8 K;  4CJS A;  3QES A;  4AM7 A;  4E7L A;  4GV6 A;  4KHW A;  2OTJ N;  5CHI A;  2YNI A;  3ZSW A;  3SAF A;  2CGK A;  2BGG A;  3OBY A;  3J80 O;  3F73 A;  3W0L A;  5KPT A;  3ZSO A;  4CZI A;  4E89 A;  1BI4 B;  1IO2 A;  3ZSY A;  4IDH A;  1XHX A;  2UYT A;  2ZGZ A;  2QWR A;  5FPN A;  4F9O A;  3CJ9 A;  4DTS A;  1HYV A;  2FXU A;  1K8K B;  2IDO A;  2VGN A;  3AO1 A;  1GLB G;  3QFU A;  4CJR A;  2JWL A;  4DTR A;  1RCH A;  4AHR A;  3OJU A;  1D9F A;  3JSM A;  5HLF A;  4KRF A;  4CZH A;  2W6L A;  3AO5 A;  4DQS A;  4R5P A;  4BWJ A;  4CEB A;  3NVK A;  4MLE A;  4ICL A;  3D2F A;  1V4S A;  1VQM N;  1A5V A;  4C23 A;  3SPY A;  2O8E B;  4B1Y B;  2HMP A;  3VEX A;  5HRP A;  3RR7 A;  2YCH A;  3ZSX A;  1KVB A;  2QKB A;  3ZYY X;  4HUE A;  4BGA A;  4CJK A;  5IWA K;  3M8P A;  3S41 A;  4AIL C;  3BY5 A;  4Z4H A;  5C0Y A;  3K5N A;  3NF7 A;  1K8A O;  3L4Q A;  2WUS A;  3UB5 A;  3I33 A;  3CCV N;  4O0I A;  4E7H A;  4C8L A;  3TI0 A;  3OYH A;  4CGF A;  2D0P A;  1NKC A;  1LWF A;  5H1S Q;  4PL7 A;  3CQX A;  3LAL A;  3H6E A;  2VWJ A;  1TUU A;  4JKH A;  1TYQ B;  4RCH A;  1BCM A;  5ELZ A;  2CH6 A;  1MWM A;  3ZX3 A;  1HYZ A;  1K6Y A;  1JLF A;  3P38 A;  3FGU A;  3NGY A;  1RT5 A;  3ULE B;  3V6D A;  3C6T A;  3ZT3 A;  4IO9 L;  1F21 A;  1RNH A;  1WUA A;  3LAN A;  3ENB A;  3C7N B;  3U9Z A;  3VQC A;  1Z26 A;  1DKG D;  1TKD A;  4FJX A;  4GKK K;  2NRV A;  1HNX K;  3TPQ A;  4JN4 A;  4FJ9 A;  3BZK A;  5LMU K;  2BDP A;  4WFN L;  4FK4 A;  2YHY A;  3PSI A;  4CIF A;  3E1Y A;  2ZE2 A;  1XNQ K;  1EP4 A;  2GEM A;  4H0P A;  2HHT A;  3V1O A;  3ENH A;  2A42 A;  4YNQ A;  1P8Z A;  3OBW A;  4ELU A;  2HNZ A;  4N41 A;  3OYI A;  3OYL A;  2QWP A;  3M6G A;  2ZM6 K;  4CJT A;  2D5R A;  4CK2 A;  1NK9 A;  3LWM A;  4OPJ A;  4QS8 A;  4CD1 A;  3F5T A;  2QM1 A;  4NO7 A;  3T19 A;  3ZEU A;  4H5R A;  4ID5 A;  4DR3 K;  4LY7 A;  3VGK A;  1RIL A;  3SV3 A;  2QXL A;  5AQO A;  2W6K A;  4KTZ A;  3D2E B;  4DF4 A;  2YHA A;  4JI2 K;  3OYG A;  4CJQ A;  2XHB A;  5A2Q O;  3HK2 A;  2B4J A;  2YJE A;  3FFK B;  4DQQ A;  4CJW A;  2ASO A;  4M3U A;  3T1H K;  3VQ4 A;  4JI4 K;  3PX4 A;  3AVC A;  3LDP A;  4AF1 A;  3C6A A;  3VQQ A;  1ZBH A;  2GTD A;  1W9H A;  3CCL N;  3L2U A;  1NMD A;  4NXN K;  2RPI A;  2VG5 A;  5BN8 A;  4DTJ A;  1RT7 A;  4LFC K;  1IBM K;  3HST B;  1L3V A;  2DFF A;  2UUC K;  4V19 S;  3MWP A;  1UWB A;  2A41 A;  4XIU A;  1A5W A;  1M1K O;  5AZI A;  1ZBI A;  2NZT A;  1ESV A;  4JI5 K;  4WYB A;  2D0A A;  2Q0U A;  4U7B A;  2HHU A;  2FF3 B;  2E2P A;  3H1V X;  2OPP A;  5DM6 L;  3HPH A;  2DY4 A;  1VQ8 N;  2P9P A;  2ZWH A;  4QS9 A;  4DV6 K;  4B1X B;  3VQ6 A;  4F3T A;  1RT6 A;  1LWC A;  3D0P A;  1NKB A;  1BG3 A;  4B3M K;  1TK5 A;  3T1Y K;  3RMA A;  1YUW A;  3VQ8 A;  3G6E N;  4Z94 A;  2O8F B;  4ZTJ A;  4DUZ K;  4JS4 A;  4FL9 A;  5HBM A;  4LF7 K;  3RMC A;  3SK3 A;  4RW7 A;  1VQN N;  4A57 A;  1TKX A;  2P9S A;  1SV5 A;  4H0Y B;  3DXM A;  4GV3 A;  2OPQ A;  1IBK K;  2DTU A;  3CYM A;  1NK0 A;  4YY3 K;  2HF3 A;  3O4Q A;  4CK3 A;  2KQ2 A;  3ITH A;  5BPM A;  3V9W A;  2P1J A;  1RBV A;  3WXM B;  1TK0 A;  1T44 A;  4MDB A;  2VQE K;  1XMO K;  3HM8 A;  4JI6 K;  1NM1 A;  3MXM A;  2P9U A;  4DQI A;  3PY8 A;  3I0S A;  3A0I X;  1HJR A;  3SNN A;  3Q7B A;  5KRT A;  3LDN A;  1EO1 A;  3HTV A;  4CFC A;  3U3Y A;  4B9S A;  2FBV A;  3N4P A;  1QZ6 A;  2HF4 A;  3V4I A;  1VAZ A;  4BC4 A;  3K9K A;  4Q5V A;  1Q18 A;  5J1E A;  1W7A A;  4X62 K;  4HCC A;  4DTO A;  1S6P A;  4M42 A;  4O5B A;  5AQJ A;  5C12 A;  4CGD A;  1YJ9 N;  4BRQ A;  4NXM K;  5ADX A;  3CQ8 A;  2F96 A;  3AGR A;  4CZE A;  4BQL A;  2W41 A;  3E9O A;  4IEE A;  3CJ7 A;  4B3R K;  3EL2 A;  3GOI A;  2FSJ A;  1XC9 A;  4B3O A;  1GLC G;  3CI5 A;  1OH6 A;  3DM2 A;  1KFS A;  4KHN A;  4BC3 A;  4BC2 A;  4E1M A;  4IJN A;  2JWK A;  3VEN A;  4FZY A;  4DV4 K;  1KAZ A;  4JI7 K;  1RDW X;  1U49 A;  1LAW A;  5LJV A;  3V9S A;  5M1Q A;  5C25 A;  3SZ2 A;  1T6D A;  3QFP A;  4PKG A;  2YNG A;  3MEC A;  1IKX A;  2P9L B;  2YJF A;  3KWG A;  4OO1 J;  5C2D A;  1HPM A;  3L2W A;  3BZC A;  3C0B A;  3O3F A;  2NLX A;  3KKS A;  2NRR A;  4AHU A;  5M1K A;  3J81 O;  3QIN A;  4BRC A;  3T1A A;  1OKJ A;  3WQT A;  3RMB A;  3N4Q A;  4BE0 A;  3THX A;  3DLL L;  5JLF A;  2A1S A;  5JMV A;  4IFV A;  1V4T A;  4JV5 K;  1CZ9 A;  1BCO A;  4I7F A;  3D2F B;  3R8E A;  2O8C A;  1C6V A;  4CFD A;  3SYZ A;  1DLO A;  4BVO A;  1BWF O;  1KTQ A;  4B9M A;  3A5L C;  1BA1 A;  1U47 A;  4DS4 A;  3TTC A;  4YFU A;  3AVM A;  1IG9 A;  4JRQ A;  1VSL A;  1X3N A;  3WNF A;  2OZS A;  4AHC A;  1L5U A;  3L3U A;  5I42 A;  1OH7 A;  4O4G A;  4DUY K;  1SL0 A;  4GY2 B;  4A61 A;  4CJU A;  2RN2 A;  1FKP A;  2UUB K;  4PA1 A;  4AHS A;  1N32 K;  1IKW A;  2YHB A;  1S1X A;  4DSL A;  4DR5 K;  5SWM A;  1NJI O;  4CW7 B;  3M8Q A;  2E4L A;  3C95 A;  4PL8 A;  3NDK A;  3C65 A;  4IJA A;  4FM0 A;  4BDY A;  1NOY A;  4DU4 A;  1SKW A;  2KLA A;  4K8Z A;  3DYA A;  1SKR A;  4CE9 A;  3MCA B;  4I6M A;  4K43 A;  4B9V A;  3MED A;  3AV9 A;  5AQT A;  3MXJ A;  4IFY A;  3HM9 A;  1QQO A;  1BDG A;  1SL2 A;  1Z25 A;  1R0A A;  4JNE A;  3HI0 A;  3CM6 A;  3PLA A;  3OYD A;  2KZM A;  2E2O A;  1C0T A;  4BR4 A;  3VQP A;  1S1T A;  2EHG A;  5CE3 A;  4JS5 A;  2EX3 A;  2ZD1 A;  4BRI A;  2A1R A;  3WQU A;  1IH7 A;  3L4I A;  4CHP A;  3HXM A;  4B9N A;  4HVJ A;  1NK6 A;  3VQA A;  3B8A X;  1TAQ A;  2QWQ A;  4ILH A;  1ITG A;  2HVH A;  3PSF A;  4LF6 K;  4B1Z A;  1GLL O;  1HRH A;  1YIJ N;  5EU7 A;  1ZBL A;  2HBM A;  2IVN A;  1XNR K;  3AAP A;  4FW2 A;  4ISG A;  3MAQ A;  4X64 K;  3VTI A;  3AA2 A;  1VSD A;  4LC9 B;  1YVN A;  1LAV A;  1YT3 A;  4JKA A;  5CY4 A;  1YIT N;  2E6L A;  1VSK A;  3FFI A;  1YTU A;  4E7K A;  2Q97 A;  2NNW A;  2WTU A;  1NMN A;  3VEO A;  3AVK A;  4JI8 K;  1IV0 A;  3CET A;  4DFK A;  2OAN A;  1I3A A;  3CQY A;  5FRM A;  4OKJ A;  4F2R A;  2Q36 A;  2ASM A;  2GX9 A;  3IRX A;  4DV1 K;  2VWB A;  3O1W A;  3HPG A;  1WNS A;  4DV0 K;  2B6A A;  2P9P B;  3O9S A;  3RTV A;  1HUX A;  4GV9 A;  2GBZ A;  3WXI A;  3B6P A;  3OYM A;  1KRP A;  1MDU B;  4YDU C;  2VG6 A;  4YDU A;  4N56 A;  5FLX O;  2G8H A;  4HTL A;  3IUC A;  1G99 A;  2W40 A;  4JAX A;  3TSU A;  4NCA A;  1NK7 A;  3L2V A;  3SQ1 A;  4J2A A;  3BF3 A;  5K14 A;  2KHO A;  2YX6 A;  4KV8 A;  3KD5 E;  3ULD A;  4ZHR A;  1QQC A;  3DRS A;  4FWO A;  1N33 K;  5AQQ A;  3EEQ A;  3H3O B;  1NGA A;  3P39 A;  3VQ7 A;  4WF9 L;  4K42 A;  3TAR A;  3EKS A;  2NRX A;  5AQW A;  4M3Y A;  1WSH A;  4FWS A;  4H5N A;  3QEW A;  1N8R O;  1UA0 A;  4CF1 A;  4C8M A;  4KHY A;  1EX4 A;  2XY8 A;  1Q8I A;  4DS5 A;  1MA9 B;  4C1N I;  3A2F A;  1NKE A;  1BL3 A;  2HB5 A;  1RT3 A;  4LF8 K;  1BUP A;  4BDP A;  5GAD P;  1S1U A;  1Y64 A;  1Q9Y A;  1XI1 A;  3MWT A;  5FPE A;  4BGB A;  3V9Z A;  1BU6 O;  1VQP N;  4JD2 A;  3RRH A;  3THW A;  3CIP A;  2VGM A;  3QB0 A;  1WAF A;  3O8M A;  4FJL A;  4NCG A;  1VRU A;  2FSN A;  4B08 A;  4QAG A;  4MO5 A;  2Z1H A;  1C0G A;  4EFH A;  1B9F A;  5TKY A;  5AQX A;  1JL2 A;  3MN9 A;  4BR5 A;  3BP8 A;  4BDZ A;  3PIO L;  3ID8 A;  1RTD A;  1TUY A;  1RBS A;  4PKI A;  2HHS A;  1S22 A;  3LDL A;  5C10 A;  2QW9 A;  1A5X A;  3IFR A;  4IO8 A;  2ZJP L;  4AQY K;  4DTM A;  3TAP A;  2UXC K;  2QWO A;  2VCP A;  5DM7 L;  3ZLJ A;  3NH2 A;  4O44 A;  1XMQ K;  4EP5 A;  3SMS A;  4Q0B A;  1TV6 A;  2ASP A;  1VHX A;  3CC7 N;  1KLM A;  1RGI A;  3VTH A;  3FE1 A;  4CEA A;  4YOV A;  2HBJ A;  3H3N O;  1NGE A;  1JLB A;  4CK1 A;  1U04 A;  4LFB K;  5D3G A;  1QVF M;  4X66 K;  3KLG A;  1LWE A;  1NGC A;  4K0K K;  5TKW A;  5HRN A;  5CYM A;  1HPZ A;  1TKZ A;  3ZT4 A;  1NGF A;  2ITG A;  1N36 K;  2O8C B;  3AA3 A;  3MN6 A;  3CC2 N;  3O9Q A;  1J54 A;  4FWK A;  4BRL A;  3LP0 A;  4MQ3 A;  3VA0 A;  2HW3 A;  5HP1 A;  1NWK A;  4OVL A;  3ZCM A;  4FLY A;  3WNG A;  4LSL A;  1JLG A;  3SBT A;  3IDH A;  1HKG A;  5CZ2 A;  5M1O A;  1FKO A;  2P51 A;  3HL8 A;  2PFU A;  4PUO A;  3FZF A;  3ZT2 A;  3HZ6 A;  4XEI A;  4HUF A;  4H4O A;  3CPE A;  5AQF A;  1OH8 A;  5EOY A;  2WON A;  2O8D B;  3VET A;  1QE1 A;  4CGI A;  3VEZ A;  4X65 K;  1NLV A;  1QVG M;  1JXE A;  4IEI A;  1T03 A;  2XY5 A;  3NBP A;  3CFO A;  1KQS M;  5J2N A;  1TAU A;  3EE8 A;  1ZBU A;  5M1F A;  3L0Q A;  4JKF A;  2Z1G A;  4E7I A;  3TAF A;  4EAH D;  4AH9 A;  1T8E A;  3NF8 A;  1ASU A;  1VQ7 N;  3K59 A;  4FJH A;  5DK5 A;  3OJS A;  3UIQ A;  4CER A;  4CHQ A;  3CFR A;  4A5A A;  4DLG A;  4FXD A;  4I6M B;  3QDK A;  2BE2 A;  3O5B A;  2F8T A;  3BUZ B;  2HVI A;  3AVH A;  3L3V A;  1EQY A;  1CZA N;  4CJ5 A;  1YJW N;  3OTO K;  4OX9 K;  4DR2 K;  5I9E B;  1HMV A;  3P1G A;  1VQK N;  2KTQ A;  3PX6 A;  2PZS A;  1RDC A;  3PO5 A;  5HRO A;  1GLF O;  4H8K A;  4KFB A;  1WSG A;  4NYF A;  3DOL A;  5JVG L;  1NGI A;  4IG0 A;  4CJL A;  2Z1J A;  1FK9 A;  3ID6 A;  3R9P A;  1RDA A;  2Q31 A;  3M8S A;  1SS6 A;  4CJ3 A;  2QEX N;  4KKO A;  2D1K A;  3SJH A;  1ZXO A;  4CJ7 A;  3LL3 A;  3R1X A;  3O08 A;  3SAG A;  3E01 A;  1TKT A;  4GVE A;  3U4L A;  3QIC A;  5AJ3 K;  4FWM A;  3U6F A;  3T7Z A;  2G8I A;  1NBW A;  1VQO N;  1EKE A;  1Q86 O;  3TAM A;  3ZET B;  1SUQ A;  4E0D A;  2O8B A;  1J6Z A;  5HOO A;  3CPW M;  2GWJ A;  3VEW A;  3CCS N;  2IOC A;  3RSE A;  1DEJ A;  1SAZ A;  4O8U A;  3OVN A;  5KRS A;  2BUP A;  5AQN A;  1BGX T;  2LSN A;  5EX5 A;  3KHY A;  4CJF A;  3WXK A;  3OYA A;  5JVH L;  3VOV A;  3G71 N;  4FJG A;  1C0F A;  3CHW A;  5AR0 A;  4J2B A;  1VSM A;  4DQP A;  4DV3 K;  4JKG B;  2V7Y A;  4DSE A;  1X1P A;  4KPY A;  1XC3 A;  1UOC A;  3LAK A;  3AAR A;  4CEQ A;  1U48 A;  5AQH A;  3WEE A;  1YXQ A;  4EIA A;  3OYF A;  1Q9X A;  2JLE A;  1GOB A;  4R79 A;  3OYN A;  3CCE N;  2E8A A;  4FOE A;  3NGI A;  3NF6 A;  3L8B A;  1ATS A;  3DAW A;  1BIZ A;  2X78 A;  3RMD A;  4N47 A;  4LF4 K;  4KTW A;  5AZJ A;  3G10 A;  3BEX A;  3QBX A;  4LH5 A;  2FC0 A;  3NAE A;  1U4B A;  3QML A;  1N34 K;  4JKC A;  1BQN A;  4JK8 A;  3A8Y A;  4YOT A;  4RWT A;  3EYZ A;  5B8H A;  3LM2 A;  1H1V A;  3ATU A;  3ZX2 A;  3HSC A;  1D5A A;  4HCB A;  3UE5 A;  4A2A A;  2QK9 A;  3HVR A;  1JLE A;  4CZF A;  4CJV A;  3UKU B;  4CJP A;  3G0Z A;  3FZH A;  1TK8 A;  3ALY A;  2RHK A;  4PKH A;  4B8A B;  3VES A;  1NNE A;  4FYD A;  3LDO A;  3TR8 A;  3VMF B;  2P5G A;  3O3G A;  5F0X A;  4ISF A;  4W5R A;  3IS9 A;  4FJ7 A;  3K0S A;  2KW4 A;  3L2R A;  4DV5 K;  3BF1 A;  2PBD A;  4XH5 A;  5EXW A;  1KC8 O;  3L2Q A;  4GW6 A;  1VQ5 N;  4FWN A;  2RF2 A;  5KPZ A;  1OVQ A;  3KLI A;  5JS1 A;  3THW B;  1VQ6 N;  4GMJ B;  4CFA A;  5AQR A;  3CCR N;  3CER A;  3G25 A;  5KQ8 A;  4JI0 K;  1JCG A;  3S3O A;  4YOR A;  5EVZ A;  5FPM A;  3OS0 A;  3H1Q A;  4OPH A;  3DRR A;  3ZSZ A;  4BRG A;  3ZSV A;  2HOE A;  4PQU A;  1NJX A;  4CIG A;  4CJE A;  5BRE A;  4H0T B;  1JLQ A;  4FM2 A;  2FF6 A;  4B1U B;  3MX5 A;  2Z1I A;  1BI4 A;  5F1X A;  3M1F A;  1NGH A;  4J2E A;  4CEC A;  3K2P A;  4C1N K;  4FW1 A;  5BPN A;  1S1V A;  3JAM O;  2E5L K;  5GAG P;  2NRH A;  4BRH A;  3D6R A;  2A40 A;  3U9D A;  2HBL A;  1WBB A;  4B3T K;  4CEO A;  1K8K A;  4E7J A;  3HYF A;  4BG9 A;  3TAQ A;  4CF9 A;  4M3W A;  1C0M A;  1EWQ A;  4BVP A;  2Y1I A;  5ADX H;  4IDK A;  3J7A P;  4A5B A;  3O1B A;  4DTU A;  1GLA G;  2KZZ A;  1ZC6 A;  4WQ5 A;  3AVI A;  3M8R A;  1EXQ A;  1KCF A;  1HKC A;  2DFH A;  5LMN K;  2ZGY A;  4O5F A;  3VQE A;  2ATQ A;  4KI6 A;  1C1C A;  4F8R A;  1D4X A;  4DTX A;  5I3U A;  1DTQ A;  1NU0 A;  2O8E A;  2DFE A;  4FJN A;  3EN9 A;  2HST A;  4JK9 A;  3AA5 X;  3OS2 A;  3L6Q A;  4ILJ A;  1HX1 A;  5BR9 A;  2D0O A;  1LW0 A;  4W5N A;  3FR0 A;  2A3Z A;  4DKW A;  2Q0R A;  3O4N A;  5J2M A;  3FZL A;  4DU3 A;  4BRA A;  5DMR A;  5IT9 O;  3M5R A;  1NK5 A;  3LZJ A;  5CR4 A;  3QNO A;  4BRK A;  3WXL A;  3O80 A;  3TTD A;  4B9L A;  1IG8 A;  4EZ6 A;  3WXJ A;  1TYQ A;  3CM5 A;  3O9U A;  2Y1J A;  4FCY A;  3LP1 A;  4FVU A;  5BRD A;  2V7Z A;  3S9H A;  3TAE A;  3OHR A;  3HP6 A;  3CCM N;  1DT9 A;  3R3L A;  2G8F A;  1GOA A;  2QWN A;  2NUB A;  4KHQ A;  1E4F T;  3KWI A;  4CGJ A;  4H03 B;  1ASV A;  2OCE A;  1YTA A;  3AVN A;  2XO7 A;  2HND A;  4IBN A;  1K9M O;  3WT0 A;  4CIE A;  4CD3 A;  1QS4 A;  2P9K A;  3VN5 A;  1WSI A;  3LAM A;  4Y1D A;  1I39 A;  3GL1 A;  1VSJ A;  3KK7 A;  1RT2 A;  3W3D A;  2QTD A;  1WSE A;  3PX0 A;  4RW9 A;  1NG9 A;  1P90 A;  4JKE A;  5AQY A;  2QI2 A;  4BWM A;  3MEE A;  3KLH A;  4LF5 K;  4NLC A;  3ZEU B;  1UAX A;  3FZK A;  4FVM A;  4W5T A;  4QOZ B;  4DFP A;  3MEG A;  3TU5 A;  2YI1 A;  4NCB A;  4BY9 C;  1VSE A;  2YHX A;  5KQD A;  3DRP A;  4KB0 A;  4K41 A;  1O13 A;  2ZF5 O;  3CJC A;  2RKI A;  2V52 B;  1XWL A;  4L8R B;  4L3Q A;  3QET A;  1R59 O;  2Q1N A;  2A6A A;  4RTF D;  3SV4 A;  2D4W A;  3D2E A;  1NK8 A;  1HNW K;  4Z4E A;  3CC4 N;  1TL1 A;  3S3M A;  3DLH A;  4BRP A;  3NVM A;  3ZSR A;  1VSH A;  3P5J A;  4OJR A;  1CLQ A;  2GUI A;  4CHN A;  1HYS A;  2O8B B;  4YOX A;  3TAB A;  5AZI B;  4ILG B;  5AFU A;  3F9K A;  1KLN A;  3AVB A;  4FLU A;  2AJQ A;  2HMI A;  4CBX A;  4KO0 A;  4AM6 A;  3H46 O;  4YOU A;  3EY1 A; 
#chains in the Genus database with same CATH homology
 1TKZ A;  2OPP A;  3ZT4 A;  3HPH A;  4CF2 A;  2AJQ A;  2DY4 A;  2BAN A;  2ITG A;  3I0R A;  3OYJ A;  1JLC A;  3AA3 A;  4CJ4 A;  1J54 A;  3VQ6 A;  2HNY A;  3KKR A;  1RT6 A;  4N5S A;  1LWC A;  3D0P A;  1NKB A;  3LP0 A;  4IKF A;  4M3X A;  4F3T A;  4J2D A;  2HHX A;  3MXI A;  4RW8 A;  4FLX A;  4MQ3 A;  1TK5 A;  4CEZ A;  2D0B A;  3OYB A;  3RMA A;  3VQ8 A;  3VA0 A;  5HP1 A;  1C1B A;  4OVL A;  3ZCM A;  4FLY A;  3WNG A;  4LSL A;  1JLG A;  4ZTJ A;  3QER A;  1RTJ A;  4FZX C;  3KD1 E;  4JS4 A;  4FLZ A;  5HBM A;  2JGU A;  3HO1 A;  3RMC A;  3OYC A;  4RW7 A;  5CZ2 A;  1SL1 A;  1VSI A;  1FKO A;  1TKX A;  2P51 A;  4DQR A;  3HL8 A;  2HHW A;  1CXU A;  1JKH A;  3SQ2 A;  3SQ4 A;  5KGW A;  3DLG A;  1SV5 A;  2PYL A;  3KIO A;  1N6Q A;  4PUO A;  1VSF A;  3ZT2 A;  2OPQ A;  2DTU A;  1X9W A;  3CYM A;  4HUF A;  4H4O A;  1NK0 A;  4KHU A;  2WON A;  5HRS A;  4DSK A;  3O4Q A;  4H4M A;  4CK3 A;  2KQ2 A;  3ITH A;  3V9W A;  4CGI A;  1QE1 A;  3V9X A;  2P1J A;  1RBV A;  1TK0 A;  4CEE A;  1JXE A;  3NFA A;  1RBR A;  4ID1 A;  1T03 A;  2XY5 A;  3NBP A;  3CFO A;  3ZT1 A;  2O4G A;  4I9L A;  3NH1 A;  5J2N A;  5J2Q A;  1WLJ A;  1ZBU A;  3V9U A;  3MXM A;  1NJZ A;  3C6U A;  4CGG A;  4DTN A;  4DQI A;  4LSN A;  2Z1G A;  4E7I A;  3QEX A;  3TAF A;  4W5Q A;  3CG7 A;  3PY8 A;  4KTQ A;  1YVU A;  3I0S A;  4JRP A;  1WSJ A;  1HJR A;  3SNN A;  4AH9 A;  5KRT A;  4Z4C A;  1T8E A;  3K57 A;  4CFC A;  1BIS A;  3DLE A;  3OY9 A;  3AVL A;  3NF8 A;  4RW6 A;  3U3Y A;  1ASU A;  4B9S A;  2FBV A;  2HHV A;  3KTQ A;  3V1Q A;  3K59 A;  4FJH A;  3V4I A;  3THV A;  3SPZ A;  4B8C A;  1L3U A;  5DK5 A;  3OJS A;  3UIQ A;  1ZYQ A;  4CER A;  4Q5V A;  4CHQ A;  5C42 A;  3CFR A;  3D45 A;  3PV8 A;  5J1E A;  4DLG A;  4DTP A;  4FXD A;  4DSI A;  4O55 A;  4HCC A;  3LP3 A;  1CXQ A;  4DTO A;  4FJK A;  1S6P A;  3AVG A;  1RT1 A;  1GOC A;  2BE2 A;  2IS3 A;  2F8T A;  4M42 A;  4O5B A;  2HVI A;  1B92 A;  3AVH A;  3SUQ A;  4CGD A;  2X6N A;  3L3V A;  4FLW A;  4CJ5 A;  3CQ8 A;  2F96 A;  1RBT A;  3OS1 A;  1TVR A;  1QSS A;  3K5O A;  1HMV A;  3P1G A;  2VWK A;  2W42 A;  3VQ9 A;  4Z4F A;  3PX6 A;  2KTQ A;  3AVJ A;  3IG1 A;  1XC9 A;  2PZS A;  4B3O A;  3HP9 A;  4JLH A;  1RDC A;  1KFD A;  3DM2 A;  2VG7 A;  1KFS A;  3PO5 A;  3NGZ A;  4KHN A;  5HRO A;  4H8K A;  4KFB A;  4EP4 A;  4CF0 A;  1WSG A;  4NYF A;  3DOL A;  1ZBF A;  4IG0 A;  3VQB A;  1Y97 A;  4CJL A;  4E1M A;  2Z1J A;  2OA8 A;  4FZY A;  1FK9 A;  3KK1 A;  1RDA A;  1U49 A;  1LAW A;  3M8S A;  4I2Q A;  3V9S A;  5C25 A;  4CJ3 A;  1RBU A;  4KKO A;  3SZ2 A;  3LZI A;  1NK4 A;  4MFB A;  2YNG A;  3MEC A;  1IKX A;  5CZ1 A;  3LP2 A;  3NF9 A;  3E01 A;  1TKT A;  1SKS A;  3T3F A;  1MU2 A;  4OKK A;  3BGR A;  1S9E A;  4KHS A;  3U6F A;  4OLA A;  2G8I A;  1REV A;  4OGE A;  5KTQ A;  5E41 A;  3L2W A;  3K58 A;  1D9D A;  1EKE A;  2OPR A;  4QCL A;  3TAM A;  3U3G A;  3O3F A;  3KKS A;  1JLA A;  3NCI A;  1SUQ A;  1T7P A;  3AO2 A;  4DLE A;  4E0D A;  5HRR A;  2IOC A;  5C24 A;  4AHU A;  2XY7 A;  1J53 A;  2XY6 A;  3OVN A;  5KRS A;  3K5M A;  3V1R A;  3QIN A;  4O0J A;  1EET A;  3T1A A;  1BGX T;  2YKM A;  5CYQ A;  4BE0 A;  3RMB A;  2LSN A;  4DSJ A;  4FK2 A;  4CJF A;  3OYA A;  3NHG A;  4F4K A;  3DI6 A;  4EZ9 A;  1IKV A;  2A1S A;  3SQ0 A;  4FJG A;  4IFV A;  1CZ9 A;  4BE2 A;  1VSM A;  4DQP A;  4J2B A;  1BCO A;  4I7F A;  4OKE A;  4DSE A;  1C6V A;  1X1P A;  4DWI A;  4KPY A;  4CFD A;  3SYZ A;  1DLO A;  1UOC A;  3LAK A;  4M3Z A;  3VA3 A;  1KTQ A;  4Z0U A;  4B9M A;  1U47 A;  2R7Y A;  4DS4 A;  4CEQ A;  1U48 A;  5FRN A;  4M3T A;  4C8K A;  3SUP A;  4YFU A;  4E19 A;  3AVM A;  1CZB A;  3OYF A;  1IG9 A;  1KSP A;  1S1W A;  1Q9X A;  2WOM A;  4CGH A;  2JLE A;  4JRQ A;  3JYT A;  1TAU A;  1GOB A;  1VSL A;  2OZM A;  2O4I A;  3I8D A;  3SJJ A;  1NJY A;  3OYN A;  3WNF A;  3NGI A;  3NF6 A;  5FRO A;  3L8B A;  4DF8 A;  2OZS A;  5J2P A;  3OYE A;  4Z4G A;  3AO4 A;  1BIZ A;  2X78 A;  4AHC A;  3RMD A;  4N47 A;  1L5U A;  4C8O A;  4ELT A;  4Y1C A;  3L3U A;  4KTW A;  3PUF A;  5I42 A;  1ASW A;  3G10 A;  3QEV A;  4LH5 A;  3NAE A;  2FC0 A;  2X74 A;  1U4B A;  4FJM A;  4O4G A;  4F3O A;  1SL0 A;  1BQN A;  4PWD A;  1QSL A;  2PY5 A;  4CJU A;  1S6Q A;  1G15 A;  3EYZ A;  2RN2 A;  4FJJ A;  4DMN A;  1FKP A;  1C0U A;  1RDB A;  4BE1 A;  4DSF A;  4DFJ A;  4PA1 A;  1D5A A;  4AHS A;  2QXF A;  3SUN A;  4HCB A;  2HW3 A;  1BIU A;  1BHL A;  2QK9 A;  2PYJ A;  1IKW A;  4E3S A;  2YHB A;  1S1X A;  4DSL A;  3HVR A;  3CFP A;  5SWM A;  1JLE A;  2G8U A;  3ISN C;  1NOZ A;  4CJV A;  4CJP A;  1LV5 A;  4K8X A;  1L3S A;  1KVA A;  1WN7 A;  4RG8 A;  3M8Q A;  3G0Z A;  2E4L A;  1TK8 A;  2HHQ A;  3C95 A;  3ALY A;  3K5L A;  3NDK A;  4FM0 A;  3QIP A;  3H08 A;  2YKN A;  5T7B A;  3V81 A;  2XRI A;  1XHZ A;  4B8A B;  4BDY A;  1NOY A;  2D0C A;  4DU4 A;  2I5J A;  1SKW A;  4FYD A;  2FBY A;  5KGX A;  4FJI A;  2IAJ A;  3TR8 A;  4K8Z A;  3DYA A;  5FDL A;  1SKR A;  2G8K A;  4CE9 A;  2P5G A;  4FK0 A;  3QIO A;  4G1Q A;  3O3G A;  4FLV A;  2IC3 A;  3HPO A;  5JS2 A;  4B9V A;  3MED A;  4OPK A;  3RRG A;  4W5R A;  3IS9 A;  4FJ7 A;  3SI6 A;  4FZZ A;  3AV9 A;  3ASM A;  2KW4 A;  3MXJ A;  4WE1 A;  4CHZ A;  4IFY A;  3L2R A;  1TGO A;  3HM9 A;  1RDD A;  1SL2 A;  1HNV A;  1Z25 A;  3DOK A;  1RTH A;  1R0A A;  1BQM A;  4W5O A;  3CM6 A;  4B9U A;  1NJW A;  3L2Q A;  1WSF A;  4KAZ A;  4GW6 A;  3AVF A;  5KI6 A;  3OYD A;  2KZM A;  1C0T A;  3ZT0 A;  2RF2 A;  3HVT A;  4AHT A;  3VQP A;  3KLI A;  5JS1 A;  1S1T A;  1JXB A;  2EHG A;  4JS5 A;  2EX3 A;  4GMJ B;  4CJS A;  4FJ5 A;  2E6M A;  2ZD1 A;  4CED A;  4CFA A;  3QES A;  2A1R A;  4E7L A;  4I2P A;  1IH7 A;  3HT3 A;  3LWL A;  4CHP A;  3HXM A;  3S3O A;  4B9N A;  4KHW A;  4HVJ A;  1JL1 A;  1NK6 A;  3TAG A;  3VQA A;  2YNI A;  3ZSW A;  3OS0 A;  2KFZ A;  1TAQ A;  2BGG A;  1QTM A;  3F73 A;  3DRR A;  3ZSZ A;  2YNH A;  3NH0 A;  1HQU A;  3ZSV A;  4KI4 A;  4PQU A;  3ZSO A;  1ITG A;  1NJX A;  4CIG A;  2HVH A;  4E89 A;  2FBT A;  1BI4 B;  4CJE A;  1IO2 A;  2IGI A;  1C1A A;  3ZSY A;  1JLQ A;  1HRH A;  4FM2 A;  1XHX A;  5EU7 A;  1ZBL A;  3QLH A;  2Z1I A;  1BI4 A;  4KRE A;  2F8S A;  4FW2 A;  4GVM A;  3MAQ A;  4AHV A;  4F2S A;  1VRT A;  1VSD A;  3AA2 A;  4DTS A;  4CEC A;  1HYV A;  4J2E A;  3K2P A;  4FW1 A;  1LAV A;  1YT3 A;  1S1V A;  5CY4 A;  5SZT A;  4ELV A;  3QEI A;  2E6L A;  2IDO A;  1VSK A;  1IKY A;  2YNF A;  3AO1 A;  3FFI A;  1YTU A;  4CJR A;  4E7K A;  1T05 A;  4CEO A;  3AVK A;  4E7J A;  3ZSQ A;  3BDP A;  4DTR A;  3HYF A;  1RCH A;  4AHR A;  3OJU A;  1D9F A;  1X9S A;  3TAQ A;  4CF9 A;  4M3W A;  1C0M A;  3JSM A;  5HLF A;  2Q3S A;  3EZ5 A;  2Y1I A;  4DFK A;  2QKK A;  4IDK A;  5FRM A;  1I3A A;  4KRF A;  4OKJ A;  4DTU A;  2KZZ A;  3AO5 A;  4LD0 A;  4DQS A;  4F2R A;  1TL3 A;  4R5P A;  4BWJ A;  4PY5 A;  4CEB A;  3HJF A;  3AVI A;  3M8R A;  1D8Y A;  3IRX A;  1EXQ A;  1KCF A;  2DFH A;  4ICL A;  1RT4 A;  3S3N A;  4DG1 A;  3HPG A;  1WNS A;  2B6A A;  3RTV A;  3KJV A;  1A5V A;  3VQE A;  3QEP A;  2GBZ A;  3SPY A;  2ATQ A;  3B6P A;  1VK0 A;  4KI6 A;  3OYM A;  3DLR A;  1C1C A;  1KRP A;  4F8R A;  5HRP A;  4DTX A;  5I3U A;  1DTQ A;  3RR7 A;  2DFE A;  4FJN A;  3ZSX A;  2VG6 A;  2FBX A;  4OGC A;  1KVB A;  2P5O A;  2QKB A;  4N56 A;  4HUE A;  3SUO A;  3WNH A;  4CJK A;  2G8W A;  3AA5 X;  3M8P A;  3OS2 A;  1FXX A;  2G8H A;  4AIL C;  3LPU A;  1W0H A;  4E1N A;  4Z4H A;  4NCA A;  3TWH A;  1NK7 A;  3L2V A;  3K5N A;  3SQ1 A;  3NF7 A;  1LW0 A;  4OLB A;  4J2A A;  4W5N A;  5K14 A;  4FJ8 A;  4Z4I A;  3O4N A;  4O0I A;  4KV8 A;  4E7H A;  3RR8 A;  4C8L A;  3LDS A;  3OYH A;  3TI0 A;  4HHT A;  1X9M A;  4CGF A;  5J2M A;  3KD5 E;  3ULD A;  4ZHR A;  4DU3 A;  1QQC A;  1NKC A;  1LWF A;  5DMR A;  4M3R A;  3DRS A;  3AO3 A;  3LAL A;  2VWJ A;  4KB1 A;  1NK5 A;  3LZJ A;  3QNO A;  4FLT A;  1BCM A;  3AA4 A;  4UQG A;  1DTT A;  4B9L A;  3VQ7 A;  4B9T A;  1J5O A;  1HYZ A;  4EZ6 A;  1K6Y A;  1JLF A;  3CM5 A;  2Y1J A;  4M45 A;  3NGY A;  4FCY A;  3LP1 A;  3TAR A;  1U45 A;  2ETJ A;  3DLB A;  1RT5 A;  3V6D A;  3S9H A;  3C6T A;  3TAE A;  4LH4 A;  3ZT3 A;  3HP6 A;  1WSH A;  4M3Y A;  3QEW A;  1F21 A;  1RNH A;  3LPT A;  2G8F A;  1UA0 A;  1GOA A;  1S5J A;  4CF8 A;  2NUB A;  3LAN A;  4CF1 A;  4C8M A;  3PO4 A;  1Z26 A;  3VQC A;  1EX4 A;  2XY8 A;  1TKD A;  4FJX A;  4KHQ A;  4KHY A;  4CGJ A;  1ASV A;  1HQE A;  3WNE A;  1Q8I A;  1YTA A;  3AVN A;  2XO7 A;  4DS5 A;  2HND A;  3A2F A;  4IBN A;  1BL3 A;  1NKE A;  4CIE A;  2OYQ A;  4FJ9 A;  1QS4 A;  2HB5 A;  1RT3 A;  4HTU A;  4I9Q A;  3VN5 A;  3C94 A;  1HNI A;  1WSI A;  2BDP A;  4IG3 A;  4FK4 A;  3LAM A;  1I39 A;  4Y1D A;  4CIF A;  3OYK A;  4BAC A;  4BDP A;  2ZE2 A;  1VSJ A;  1KVC A;  3NE6 A;  1RT2 A;  1S1U A;  1EP4 A;  2HHT A;  4RW4 A;  1RTI A;  3V1O A;  1J9A A;  4CEF A;  1WSE A;  3PX0 A;  4RW9 A;  4YNQ A;  1Q9Y A;  1XI1 A;  4NYN A;  3V9Z A;  4ELU A;  2HNZ A;  2ZQB A;  3RRH A;  4N41 A;  3OYI A;  3OYL A;  4BWM A;  3O3H A;  3MEE A;  4CJT A;  3KLH A;  4DU1 A;  3P83 D;  2D5R A;  4CK2 A;  1WAF A;  1NK9 A;  4W5T A;  1UAX A;  4NCG A;  4FVM A;  3LWM A;  1VRU A;  4DFM A;  4DFP A;  4FJL A;  4OPJ A;  4QOZ B;  4CFB A;  3MEG A;  4M41 A;  4CHY A;  4B08 A;  1QHT A;  4QAG A;  2Z1H A;  2B5J A;  3T19 A;  4ID5 A;  4ZTF A;  1B9F A;  1WAJ A;  4NCB A;  4LY7 A;  1VSE A;  1JL2 A;  1RIL A;  3DRP A;  4CHO A;  3SV3 A;  4KB0 A;  4BDZ A;  2RKI A;  1RTD A;  4KTZ A;  1RBS A;  4DF4 A;  1XWL A;  2YHA A;  4L8R B;  2HHS A;  3OYG A;  4CJQ A;  3QET A;  2XHB A;  3HK2 A;  3KK3 A;  2B4J A;  3SV4 A;  1A5X A;  4FM1 A;  1NK8 A;  2KFN A;  1S9G A;  4DQQ A;  3RWU A;  4CJW A;  4DTM A;  3TAP A;  4M3U A;  3VQ4 A;  4N76 A;  4Z4E A;  3NH2 A;  3PX4 A;  3AVC A;  4O44 A;  1TL1 A;  3B6O A;  1ZBH A;  3VQQ A;  3KLE A;  4HUG A;  1W9H A;  3S3M A;  4EP5 A;  3DLH A;  3L2U A;  3VQ5 A;  3ZSR A;  1VSH A;  1TV6 A;  3P5J A;  4OJR A;  4Q0B A;  1O1W A;  2GUI A;  4CHN A;  1HYS A;  3DLK A;  1CLQ A;  1UA1 A;  1N5Y A;  2RPI A;  2VG5 A;  4DTJ A;  1KLM A;  1RT7 A;  3TAB A;  3QO9 A;  3HST B;  2G8V A;  3IAY A;  4CEA A;  1L3V A;  3SCX A;  2DFF A;  4C8N A;  3F9K A;  1KLN A;  3DMJ A;  3AVB A;  1UWB A;  3VQD A;  4FLU A;  4XIU A;  1L3T A;  1A5W A;  1JLB A;  4CK1 A;  2OPS A;  2HMI A;  4CCH A;  1U04 A;  3AVA A;  1B9D A;  2GV9 A;  4TSX A;  1ZBI A;  5D3G A;  2YV0 X;  3KLG A;  1LWE A;  1LW2 A;  4KO0 A;  2D0A A;  2HHU A;  2X6S A;  3KK2 A;  5HRN A;  5CYM A;  3KLF A;  1HPZ A;  1QSY A;  3QNN A;  4CES A;  3TAN A;  3EY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...