4KTWA

Lactococcus phage 67 ruvc - apo form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
160
Chain Sequence
MKKILAINFSTASKKGEGTGYAFRKDGQVYVGSIKAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRNRKHSITLANCNGYFIGAIDGLVNGYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYCEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RuvC endonuclease
publication title Mutants of phage bIL67 RuvC with enhanced Holliday junction binding selectivity and resolution symmetry.
pubmed doi rcsb
source organism Lactococcus phage bil67
molecule tags Hydrolase
total genus 61
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07066 DUF3882 Lactococcus phage M3 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ktwA00
4CJKA 1ZBHA 1LW2A 1REVA 3LAMA 3OYDA 4OVLA 1CZ9A 4KHWA 4FK4A 1VSLA 2HHXA 4DQQA 1RT1A 2YNGA 3DRSA 5HRNA 4DU1A 3HM9A 4FJ7A 2VWKA 3LANA 3M8PA 3V4IA 3T1AA 4FLYA 1UOCA 4RW4A 3ITHA 4CJRA 4E0DA 4CE9A 4DTXA 1UA0A 4C8LA 4FJ9A 4KI6A 3VQ6A 3L2QA 1IG9A 1VRUA 2HHUA 4CEFA 1S1XA 3OYBA 5CZ2A 1ZBLA 3PX0A 2HHTA 1WSJA 4DTRA 3ULDA 3V1OA 4KKOA 4ICLA 3SPYA 5E41A 4Z4GA 3VQDA 2FBYA 1RDBA 3L8BA 4GMJB 1N6QA 2X6NA 4LSLA 3WNHA 4CK1A 3NAEA 3QNNA 1KVCA 1LAWA 1YTAA 4B9LA 4DSLA 4DFKA 4DU4A 1S9EA 1TK5A 4CFCA 3K5OA 4PQUA 1BI4A 3O4QA 4CGGA 1BI4B 4DSFA 4AHUA 1R0AA 3E01A 1Q9YA 4I2PA 4KTQA 4AHCA 3LP3A 4HUGA 2XRIA 4FJXA 3G0ZA 3HJFA 4EZ6A 5KI6A 1JKHA 1BL3A 3PO5A 1XWLA 1X9WA 4HUFA 3AVGA 2BDPA 2X6SA 4DSKA 1RT3A 3D45A 3OYCA 3IRXA 4CEZA 3RMBA 3B6OA 1NJWA 4CJWA 3HK2A 1L3TA 3L3UA 4C8MA 3ZT1A 2BE2A 3KLGA 3HP6A 3TARA 1VSEA 3LALA 5K14A 2QKBA 4QCLA 3SQ0A 2IAJA 1CXUA 1HMVA 3C6UA 5KGWA 3VQPA 3HVTA 4BDZA 3A2FA 4PUOA 4B9UA 2KZMA 4BE1A 4FJ5A 4OKJA 4ZTFA 4CF1A 2JLEA 1WSIA 3LPTA 2YNIA 1U47A 1S5JA 4CHPA 4Z4HA 4DTJA 1U49A 3RR7A 1RDDA 1SUQA 3EZ5A 2GV9A 4IDKA 2XY5A 1D8YA 1ZBFA 1FKPA 1A5XA 1EP4A 1BQMA 4O4GA 3AV9A 1XHXA 4W5OA 1C6VA 1JLQA 1NOZA 3DRRA 3OY9A 2I5JA 4BE2A 1JL1A 1QSYA 1X9MA 1WSFA 2OPPA 3SJJA 4CJPA 4Z4IA 3ZCMA 2YHAA 4DTSA 1BIZA 4DS4A 2VWJA 3ZSRA 1IKXA 4DF8A 1RT7A 2RPIA 3DOKA 3O3HA 3QERA 1QSSA 5J2PA 4E1NA 4CERA 3TWHA 1XHZA 4OPKA 2PY5A 1TKDA 1U48A 3VN5A 3PUFA 5HBMA 3LDSA 4FM1A 3VQBA 3K5LA 2HNDA 3LZIA 1S6PA 1VSDA 1QS4A 2B4JA 1S1UA 4M3RA 3EY1A 1TKZA 1YT3A 3NH2A 1Z25A 4FJIA 1EKEA 4AHVA 3I8DA 4KO0A 1TKTA 1TK8A 2FC0A 2NUBA 1EX4A 1D9FA 1RTDA 3P5JA 4CGHA 3U3GA 3NGYA 1HNIA 1WLJA 3OVNA 3M8QA 2Z1GA 3AO4A 3MEDA 3NBPA 4Z4CA 3RMCA 4JRPA 5HRPA 3DLRA 4PY5A 4DG1A 1IKYA 4KV8A 4DMNA 1HNVA 1RTJA 5J2NA 4JLHA 3AO2A 1VSHA 5CZ1A 5HROA 1QE1A 4CEDA 3OYHA 3F9KA 4LH4A 1TGOA 2Z1HA 4N5SA 1C1AA 4CF2A 4DTPA 2HW3A 4CEOA 1UWBA 3LPUA 4DFMA 2F96A 1YVUA 3TI0A 2D0AA 2GBZA 3SUOA 3TR8A 1UA1A 4KHUA 4CIEA 3VQ8A 5I3UA 4CF9A 1DTQA 2ZQBA 4K8ZA 2O4IA 3HO1A 4J2AA 1TKXA 2IC3A 3ZSXA 4ELUA 4B8AB 1RT2A 3IS9A 3SUNA 3V9XA 2YKMA 3LZJA 3RMDA 3NGIA 4F4KA 4Z4FA 1GOAA 1LV5A 1X9SA 4AHTA 3PV8A 3QNOA 3QESA 2XO7A 4E7LA 1WAFA 1RBSA 2A1RA 1TAQA 3CYMA 3DM2A 3NFAA 2FBTA 3ZT4A 3HYFA 4CFDA 4O0JA 3SQ2A 3NE6A 2OA8A 4RW7A 4KFBA 3AVLA 3AVNA 4W5TA 3SNNA 1J5OA 3DRPA 4ID1A 4Q5VA 1N5YA 3PY8A 4CJSA 2XY7A 2VG5A 3SI6A 4BDYA 2YHBA 4FYDA 1RTIA 3KTQA 1ZBIA 4R5PA 4DQRA 4KHNA 3LP0A 3T19A 4Y1CA 1NK6A 4IBNA 4MFBA 3T3FA 2Y1JA 3SPZA 2F8SA 1HRHA 3CM6A 3ZSQA 3AVMA 2W42A 3QEXA 4G1QA 4AHRA 1SKSA 3QO9A 3NH1A 4DTNA 5C42A 4F3TA 4OGCA 3OS2A 4O55A 4XIUA 1I3AA 3TAFA 1JLEA 4FJKA 1ZBUA 3OJSA 3KLIA 4KPYA 2YKNA 3MECA 4E7HA 1C0TA 3DLHA 3PX6A 3RWUA 2OPRA 3KLHA 5J1EA 3LWMA 1YTUA 1KLMA 3AVCA 1LWCA 3ZSWA 4B9SA 1C0MA 4JRQA 1T05A 3ZSOA 3VQ9A 4CF8A 4CJ5A 3OYAA 5KGXA 3KK2A 3I0RA 1F21A 3L2VA 1L3VA 4PA1A 2DTUA 3OYMA 3RRHA 5JS2A 3KKSA 4M41A 3OYKA 4CJFA 4FZYA 4FCYA 3AVKA 5CYQA 2ATQA 4LY7A 1J53A 2IGIA 1KRPA 3QEVA 1JXBA 3O3GA 3MAQA 1KCFA 2QK9A 4FJMA 4IFYA 4IKFA 1TL3A 1KFDA 3MXJA 5HLFA 3K57A 4OKEA 4KAZA 4W5NA 1BCMA 4FLXA 3RTVA 4E7IA 1I39A 1KVAA 3MEGA 4FK0A 3DI6A 3VA0A 2D0CA 4Z0UA 2OPSA 4DTOA 1NK7A 4BE0A 2LSNA 1NKBA 4EZ9A 3HSTB 1IKWA 4LD0A 4DSIA 1KTQA 4CEQA 1KSPA 3OYFA 2E6LA 1J54A 3K5MA 3C94A 2Y1IA 3ZSVA 3UIQA 4H4MA 3AVFA 3TAPA 3HPOA 1VSFA 1CXQA 1Q9XA 1S1VA 2GUIA 4DTMA 1B9DA 1QHTA 3C6TA 4O0IA 1JLCA 3LP2A 3JYTA 2JGUA 4J2DA 3V9WA 3L2WA 1GOBA 3AVBA 1BCOA 1K6YA 1NKCA 2OZSA 3L2UA 1SL0A 4CJUA 3V6DA 2P5GA 4IG0A 4FLZA 2IDOA 4KRFA 4WE1A 4N76A 3FFIA 4M3WA 4KB1A 3NDKA 1JLFA 3TAGA 3RMAA 2O4GA 3NF9A 4BWMA 2FBXA 1BQNA 1VSJA 3DLEA 4CECA 1S1WA 4B8CA 1IO2A 4E7KA 4AILC 1U4BA 4B9VA 3VQAA 4M3ZA 1VSKA 1WSHA 3AO3A 4KREA 3HXMA 2G8VA 4GVMA 4CCHA 2WONA 2DFHA 2EX3A 3SQ1A 2XHBA 4NYFA 4L8RB 1A5WA 2HNZA 1S1TA 5DMRA 5HRSA 1LWFA 4QAGA 4OJRA 5CY4A 1KVBA 3S9HA 3THVA 5DK5A 4IG3A 4CEAA 2ZD1A 3SZ2A 3NH0A 2WOMA 1SL2A 4F3OA 4CF0A 2G8WA 4N41A 2RF2A 1C0UA 3OYGA 3V81A 4ELVA 4NCAA 4B9TA 3ISNC 4DLGA 1T7PA 4Z4EA 2G8FA 4E19A 4F8RA 4RW6A 4YNQA 5SZTA 2HNYA 3PX4A 2X74A 4YFUA 4M45A 3QEPA 4BDPA 4NCBA 5HRRA 2YNFA 3QIPA 3NF6A 3S3OA 4N47A 3M8RA 1FXXA 3DLBA 2AJQA 4RG8A 4H8KA 2PZSA 1HJRA 2DFFA 3WNEA 1HQUA 5KTQA 2P5OA 1DLOA 1S6QA 1NK0A 3SV4A 4CIGA 4JS5A 3HPGA 1CLQA 3L2RA 4CGIA 4EP4A 3RRGA 4CJVA 3NCIA 3CQ8A 2RKIA 3DYAA 2F8TA 3AVIA 4E89A 3ZSYA 1Y97A 1Q8IA 3DLGA 4CHZA 4C8OA 4Q0BA 4N56A 1FKOA 1SKRA 2G8IA 4CHQA 1HYVA 4FVMA 1D5AA 1ASUA 2G8HA 1W9HA 5KRTA 1B9FA 1U04A 2G8UA 2HHVA 1BHLA 1UAXA 4BWJA 4DQIA 3AO1A 3BDPA 5CYMA 1NJZA 3NHGA 1EETA 3KIOA 1JLBA 1WN7A 3KKRA 4M3XA 1A5VA 2DFEA 1RILA 4TSXA 2QXFA 3TAQA 2BGGA 1ITGA 2HMIA 3K5NA 4CK3A 1CZBA 4FZXC 1HYZA 4FLUA 1HYSA 4O44A 3D0PA 4HVJA 3MXIA 1GOCA 1HQEA 4DF4A 1RBVA 4FM2A 3AA3A 1WAJA 4CGFA 4KTWA 3HT3A 4LSNA 4NCGA 3S3MA 1KFSA 4E1MA 1NOYA 5J2QA 4DFPA 4M3YA 1D9DA 2Z1IA 4RW9A 3KD1E 4FLTA 3G10A 3TAEA 1B92A 3DLKA 4CJTA 2HVHA 1TVRA 3SUQA 2G8KA 1XI1A 1SV5A 3K2PA 4Y1DA 1WNSA 2OZMA 2XY8A 4B9NA 2OPQA 2Q3SA 5HP1A 4J2EA 3OS0A 5D3GA 2B6AA 4RW8A 1MU2A 3I0SA 5FRNA 3AVAA 3QIOA 3ALYA 1EXQA 2ETJA 2A1SA 3CG7A 5FDLA 1VSMA 4CIFA 3OYJA 5J2MA 3TAMA 4UQGA 3NF7A 3V9ZA 1ASWA 3OYEA 4C8KA 3V9SA 1LAVA 2D0BA 3O4NA 1NJXA 4DTUA 4DU3A 4FJNA 1ASVA 4FK2A 5FRMA 1C1BA 4HUEA 1RBUA 4CK2A 3QINA 3OS1A 4ZTJA 1BGXT 3KJVA 2ZE2A 4W5RA 4K8XA 1DTTA 3VQ4A 1FK9A 4H4OA 1BISA 3B6PA 4EP5A 3P1GA 3AA5X 3K58A 1T03A 1J9AA 1RT6A 3ZSZA 3NF8A 4CFBA 2PYLA 4B9MA 4KB0A 4CJLA 4I9QA 3MXMA 4CFAA 4FM0A 3AVHA 3NGZA 5FROA 4J2BA 4DSEA 1TK0A 1NKEA 4PWDA 3AA2A 3VQQA 4FW1A 3EYZA 3V1RA 1L5UA 4DSJA 3V1QA 4E7JA 3TABA 1TAUA 3ZT0A 4CHOA 3LP1A 1VSIA 4OGEA 1U45A 3HVRA 2IS3A 2P51A 4W5QA 4E3SA 3RR8A 3AA4A 4FW2A 2HB5A 2VG6A 3IG1A 1C1CA 3AO5A 3WNFA 3ZT3A 5C25A 1LWEA 3OYNA 4LH5A 3OJUA 1IKVA 4C8NA 4KHQA 2P1JA 1VRTA 2OYQA 4BACA 4JS4A 3SUPA 1XC9A 3AVJA 1RCHA 2E4LA 3SYZA 4NYNA 4B08A 3CFPA 4IFVA 4CHYA 5KRSA 3V9UA 3TANA 2XY6A 1IH7A 1L3SA 5SWMA 3LWLA 4I7FA 4I9LA 4FZZA 4ELTA 3C95A 4MQ3A 4DQSA 1JLGA 1S9GA 3K59A 1NJYA 2HHWA 4FLWA 2RN2A 3QLHA 4CJ4A 2KZZA 1O1WA 1W0HA 4DWIA 4M3TA 3SV3A 2KFNA 1KLNA 4CJEA 4FJLA 3VQEA 4OLBA 2KFZA 4KHYA 1Z26A 3ASMA 3KLEA 4FJ8A 2HHQA 2VG7A 4CEEA 3CFRA 4CGJA 4KI4A 4F2SA 3LAKA 1TL1A 2BANA 1G15A 1WSGA 1QQCA 3P83D 3VQ5A 1WSEA 4CHNA 4FJGA 3S3NA 1NK4A 1RDCA 4O5BA 2FBVA 3ZT2A 3F73A 1NK8A 2DY4A 2B5JA 4HCCA 1RDAA 2E6MA 3DOLA 3SCXA 4HCBA 1L3UA 4QOZB 1HPZA 4CGDA 5T7BA 1JLAA 3SQ4A 3U3YA 3WNGA 4FLVA 2D5RA 2IOCA 5EU7A 2X78A 1JL2A 2HVIA 3OYIA 4HTUA 1ZYQA 3H08A 2PYJA 3OYLA 4DLEA 4CJQA 1T8EA 2KTQA 4KTZA 3PO4A 3M8SA 2HHSA 4DFJA 3JSMA 1RTHA 3HP9A 3O3FA 4GW6A 1NK9A 3CFOA 4OLAA 1LW0A 4CJ3A 4F2RA 1RBTA 4KHSA 4FXDA 1RNHA 4OKKA 3IAYA 1BIUA 1JXEA 4ID5A 2YV0X 2YNHA 4AH9A 4CEBA 2KW4A 4HHTA 4OPJA 2ITGA 2KQ2A 5C24A 3MEEA 4FJHA 5I42A 3HPHA 3VA3A 4CESA 4FJJA 4DQPA 3KLFA 3KK3A 1NK5A 4DS5A 4M3UA 1TV6A 4I2QA 3HL8A 4M42A 1SKWA 2EHGA 3QEIA 1QSLA 4ZHRA 3DMJA 1VK0A 4AHSA 2QKKA 1RT4A 3QEWA 3KD5E 4B3OA 5JS1A 3U6FA 3VQCA 3L3VA 1X1PA 1RT5A 3CM5A 2Z1JA 3QETA 1RBRA 2R7YA 1QTMA 1SL1A 3VQ7A 3BGRA 3KK1A
chains in the Genus database with same CATH superfamily
3LAMA 4NB4A 4BC4A 1VSLA 3DRSA 3V4IA 4KH5A 4BRQA 1M1KO 4C8LA 4KI6A 3L2QA 3HOTA 2HOEA 3SMSA 2HHTA 1WSJA 4DR1K 4BRNA 4KKOA 1J5EK 3SPYA 4I6MB 4Z4GA 5BR8K 1VQON 3CHWA 3NAEA 4LSLA 5C2FA 5HOOA 1VQ6N 4PQUA 2P9KA 1W97L 3O1BA 5MLCQ 4GV9A 3VGKA 1R0AA 1QQNA 4CVNE 4KTQA 3LP3A 4HUGA 2XRIA 4FJXA 3G0ZA 1DKGD 1BL3A 1X9WA 1L3TA 4C8MA 5AQJA 3ZT1A 1VSEA 3HRGA 4FPBA 5K14A 3SQ0A 1CXUA 1HMVA 5KGWA 2OANA 1TYQA 3K0SA 4FJ5A 4OKJA 2YNIA 1NGDA 1S5JA 4CHPA 3EZ5A 1HKGA 4A2BA 1BQMA 1XHXA 1N32K 1C6VA 2I5JA 3GDQA 5BREA 3O80A 4JKHA 1X9MA 4DV3K 2OPPA 4CJPA 4Z4IA 3ZCMA 4DS4A 2VWJA 4H5RA 5AQNA 2RPIA 3UKRA 1QSSA 4QS9A 4E1NA 4H5WA 1XHZA 3IUCA 1WUAA 1FW6A 1U48A 3VN5A 4JI0K 1Z05A 4GY2B 3LDSA 3H3OB 3LZIA 1VSDA 2O8EA 5LJWA 4JKDA 1YT3A 1E3MA 3VPZA 4NXNK 1TKTA 4NLCA 1TK8A 5LMUK 4L3QA 3NGYA 3OVNA 2HBMA 2YJFA 5HRPA 1GLJO 1HNVA 1RTJA 5HROA 3I56N 1NGJA 4WFBL 1GLDG 2Z1HA 4DR6K 1UWBA 1U2VA 2F96A 3TI0A 1UA1A 1V4SA 4CIEA 2ZQBA 2F7TA 4X64K 4BR7A 1GLCG 2YKMA 3LDQA 3VTHA 1WAFA 1RBSA 4QS7A 3CYMA 2A40A 3VERA 1NNEA 1YVNA 3AVNA 1J5OA 1N5YA 4CJSA 2VG5A 3R3LA 1IBLK 4Z94A 1RTIA 4R5PA 3I8BA 4DQRA 1ZXOA 3T19A 5F0XA 3SPZA 5BR9A 1HRHA 1YITN 2O8FB 4BR4A 3AVMA 2W42A 4G1QA 2Q0RA 3OBWA 1SKSA 5C0YA 3QO9A 4XH1A 4DTNA 5C42A 1NGAA 4EIAA 4OPAA 3UKUA 4M7YA 1ATNA 3H3NO 2UXBK 3KLIA 1LOTB 4RTFD 4BRGA 3MECA 5BPMA 3OA9A 1NJIO 4ISFA 2OPRA 5J1EA 1VQ5N 1LWCA 3ZSWA 1C0MA 3OYAA 5KGXA 3I0RA 3ZEUB 1L3VA 2DTUA 4BC2A 3OYMA 3RRHA 4M41A 1XUPO 4FCYA 3AVKA 1X9JA 4LY7A 2ATQA 1KRPA 3DXMA 2I7NA 1T3VA 1Q7YO 3THWB 4IKFA 4KBOA 3K57A 4OKEA 1BCMA 4FLXA 5M1OA 2D0OA 1I39A 3MEGA 3DI6A 2CGLA 1NK7A 2OPSA 4FSVA 2P9LA 2LSNA 4JN4A 3HSTB 1IKWA 1KSPA 2E6LA 4H4MA 3HPOA 1CXQA 4JK7A 1RDUA 1S1VA 4DTMA 4X62K 3L2WA 4KHPK 1BCOA 3PSFA 3V6DA 2IDOA 4N76A 4KB1A 1Y64A 3O8MA 1JLFA 3TAGA 2O4GA 1U4BA 3VQAA 1WSHA 2V52B 3FZFA 2G8VA 3L4IA 3SQ1A 1A5WA 5HRSA 1LWFA 4A59A 4QAGA 1KVBA 4BG8A 3S9HA 4IG3A 4CEAA 3U4LA 2HBJA 1SL2A 4F3OA 4CF0A 2RF2A 4FWQA 4JI1K 4RW6A 3KVGA 3PX4A 2KKZA 4YFUA 3F5TA 4N47A 1FXXA 2AJQA 2PZSA 5KTQA 3SV4A 3SBTA 3HPGA 2D1KA 1CLQA 2F8TA 3RRGA 2RKIA 3DYAA 5AZJA 1NMNA 3D2EB 4CHZA 4Q0BA 2JWLA 3HTVA 1FKOA 3E9OA 2ZJPL 1SKRA 4JKGB 3EL2A 5KRTA 2G8UA 2HHVA 1UAXA 4DQIA 5CYMA 4K43A 4AF1A 3NHGA 3KIOA 3D2FA 4V19S 1JLBA 3NVKA 3PIPL 2ZJRL 1SS6A 3TAQA 2QXFA 1ITGA 4FZXC 1CZBA 1HYSA 1OH7A 4IWVA 4B1UB 4BRPA 4NCGA 4O5FA 1NOYA 4LFBK 3TTCA 2ASMA 4RW9A 4CJTA 3CQYA 3HOSA 2Q3SA 5AQIA 5HP1A 5BRHA 2VQEK 4BREA 1K8AO 3A5NC 3VF2A 1HJOA 3K9KA 4B9QA 4WF9L 2A1SA 4CIFA 4UQGA 3NF7A 4CD1A 4JHDA 5ELZA 2PFUA 2F9TA 3O4NA 4CZEA 4DTUA 4FJNA 4HUEA 4H0OA 4K8XA 3OS1A 1BGXT 3KJVA 2ZE2A 4MDBA 2O8DA 2FSJA 1TUUA 5AQWA 4EP5A 4FWSA 3P1GA 3K58A 1T03A 1VQLN 3NF8A 3MXMA 4CFAA 5H1SQ 1K8KA 5FROA 4H5NA 3G6EN 4DSEA 3NVMA 2F4VK 4FW1A 3ENHA 3V1RA 3EYZA 3V1QA 4B1YB 4IXCA 2P9IB 1U45A 4OGEA 2P51A 1U6ZA 2GWJA 3ZT3A 3WNFA 4FOEA 4LF4K 1N34K 2VYPA 3WEEA 2UUCK 3MDQA 4KHQA 3ZX3A 3CJAA 1VQPN 4YDUA 3SYZA 4HWIA 1K73O 3TANA 1L3SA 3TSQA 3KWIA 4ELTA 3C95A 2WFBA 1NJYA 2FSNA 3SAHA 4EHTA 2KZZA 1O1WA 1W0HA 3N4QA 2Q97A 4JAXA 4DWIA 4FJLA 4OLBA 4KHYA 3ASMA 4JKBA 4CGJA 2QWPA 1TL1A 3P83D 1QQCA 1NK8A 3F73A 3H6EA 4HCBA 1L3UA 1OH6A 3FFKB 2IIRA 5A2QO 1ZYQA 3FZKA 3OYLA 4DLEA 2KTQA 4Y0WA 2CGKA 4KTZA 2HHSA 4DFJA 5KPTA 5KQDA 4IJNA 4CBUA 3O9SA 4F2RA 1RNHA 3DWLA 1BIUA 1NM1A 4JK8A 5FLXO 4U7BA 1HKCA 3ATVA 1R59O 3HI0A 3AAPA 2KW4A 2A6AA 3ULEB 1D4XA 1KAYA 1XNRK 5C24A 5AJ3K 3VA3A 3HSCA 3KLFA 3KK3A 3W3DA 4DS5A 4BRDA 3CMEN 3HL8A 1SKWA 4A5BA 4ZHRA 1JCGA 4ISEA 1VK0A 1BA1A 1RT4A 1IBMK 4CZMA 4IEIA 3U6FA 5JS1A 3VEXA 2R7YA 1QTMA 2PBDA 4CJKA 1ZBHA 1REVA 4OVLA 4KHWA 1ZC6A 2YNGA 5HRNA 3J7AP 2VWKA 3LANA 3M8PA 5GAEP 4PHTX 2VCPA 1BUPA 4CE9A 4PKIA 4DTXA 1UA0A 1VRUA 4FWLA 2HHUA 3BUZB 3OYBA 5HL7L 1TUYA 3WXMB 3C0BA 3IFRA 5BRFA 4BRFA 4I6MA 4ICLA 5E41A 3CCEN 3N4PA 3L8BA 3H1QA 1N6QA 3QNNA 4CK1A 4DR7K 4DFKA 1S9EA 4X65K 1TK5A 3O4QA 1BI4B 4FWKA 4DSFA 4AHUA 2D4WA 5ADXA 4DV5K 2V7YA 3Q7BA 4EZ6A 1Q86O 2E1ZA 3OYCA 3RMBA 2Q2RA 3HK2A 4QCLA 3J80O 3THYB 1N33K 3C6UA 1S3XA 4MO5A 4BE1A 3WXJA 2ZGYA 3O9QA 2O8CB 4Z4HA 4B9UA 4KRFA 4O8KA 1SUQA 1D8YA 4IDKA 1WB9A 1A5XA 1EP4A 3EKUA 3AV9A 1JLQA 1S22A 3DRRA 3O5BA 2VQFK 4DV0K 4PKGA 3SJJA 4BROA 4DTSA 2YHAA 5AQYA 1IKXA 4DF8A 1WOQA 3CPEA 4CERA 4OPKA 4UY8O 4FM1A 3K5LA 2HNDA 4M3RA 3EY1A 3NH2A 3UE5A 4FJIA 3I8DA 3FLCO 2Q36A 5C10A 1D9FA 4DUYK 4FL9A 1HNIA 5E26A 3M8QA 2Z1GA 3AO4A 3VGMA 2GELA 4CZHA 3WXLA 4KV8A 3VETA 3EO3A 3LM9A 1N8RO 1NBWA 4CEDA 3OYHA 3QDKA 4LH4A 1DGKN 4N5SA 4DTPA 2FF6A 4LF9K 1YVUA 3AY9A 4FWNA 2AA4A 2D0AA 1DTQA 3A5LC 4ELUA 3THXB 2NNWA 3IS9A 4Z4FA 2D0PA 4K25A 1LV5A 3LDNA 1X9SA 4G9ZA 4FPAA 4B1WB 3QNOA 2NRVA 2ASPA 3DM2A 2FBTA 3HYFA 3SQ2A 4O0JA 3IMXA 4HTLA 1EO1A 1BO5O 4W5TA 4DHYA 3DRPA 1H1VA 1O13A 2XY7A 3SI6A 2YHBA 4FYDA 3VEWA 3G71N 3CJ9A 4MFBA 3CCRN 2O8FA 3C7NB 3BZKA 3QEXA 4AHRA 3NH1A 5GAGP 3OS2A 2E2PA 4XIUA 5JLFA 4YOUA 3VEOA 3OJSA 2A41A 2FSKA 3MN7A 3DLHA 1BG3A 3A8YA 2WUSA 3LDOA 1T05A 1NGBA 1QQMA 3VQ9A 4CJ5A 3ZEUA 1F21A 1NU0A 1G99A 3AGKA 4JKEA 5JS2A 3OYKA 4FZYA 3E66A 3R1XA 5CYQA 1J53A 2IGIA 2CGJA 1OVQA 3O3GA 3THWA 4A61A 4FJMA 1TL3A 5HLFA 4IZ9A 1I94K 5GIPA 4OO1J 1P8ZA 4LF7K 2AP1A 4FK0A 5AQGA 5M1FA 2D0CA 4Z0UA 1NKBA 2A42A 4EZ9A 4LD0A 2NRWA 3OYFA 3ZSVA 3AVFA 3O9TA 4K41A 5AQXA 5B8HA 1QHTA 4O0IA 1JLCA 2JGUA 2GWKA 3AVBA 3S41A 2OZSA 1SL0A 4CJUA 4C1NK 2P5GA 4IG0A 4FLZA 4M7XA 4WE1A 4BG9A 3FFIA 4M3WA 2FBXA 1BQNA 1VSJA 4JNEA 4CECA 4B9VA 4AILC 5BN9A 3R6MA 1E4GT 2W6KA 3AO3A 3VENA 4KREA 4GVMA 2WONA 2EX3A 3C6AA 4OJRA 4IOAL 5DK5A 3NH0A 2HF4A 2E2QA 2NRZA 4DR4K 4XEIA 3ISNC 4Z4EA 3IDHA 3MX2A 3MWTA 4F8RA 4YNQA 5ADXH 3VF4A 5HRRA 2YNFA 3S3OA 4BC3A 3M8RA 4YORA 4H8KA 2DFFA 1DLOA 1S6QA 3BEXA 4CIGA 1VQ9N 3AVIA 4IFEA 4JKCA 1NWKA 3ZSYA 4LF8K 1SZ2A 1Y97A 3D2EA 4N56A 3O1WA 4CHQA 3JS6A 5BPNA 1ASUA 2NRRA 4EHUA 4DR3K 1BHLA 3MCPA 3AO1A 3BDPA 2PAVA 4MO4A 1NJZA 2IVOA 1EETA 1WBBA 3QB0A 2BGGA 4AM6A 4JKAA 2HMIA 1VHXA 3T7ZA 3MX5A 5BN8A 4BRAA 3CETA 1WAJA 3HT3A 4DFPA 1T6DA 4M3YA 3QMLA 2Z1IA 3HZ6A 3SLCA 3DLKA 3GBTA 2G8KA 4Y1DA 2VWBA 2OPQA 1HPMA 3OS0A 5D3GA 2B6AA 3I0SA 2QW9A 1NG9A 1EXQA 2NZTA 3GG4A 2ETJA 3E1YA 5J2MA 3OYEA 4OPHA 1LAVA 4DU3A 1ASVA 1BA0A 2HSTA 2W41A 3QINA 1W7AA 3F2KA 3VQ4A 1FK9A 3C65A 4PL7A 2P9KB 3B6PA 4ISGA 3AA5X 2BH1A 1J9AA 1RT6A 2PYLA 4KB0A 5FPMA 4CJLA 4FM0A 3WQUA 1WBDA 3CCLN 3AVHA 1TK0A 4PWDA 4H5VA 4DSJA 3SAGA 2QWNA 3O4WA 4WQ5C 2P9IA 2QWMA 3T69A 3HVRA 4E3SA 4FW2A 2HB5A 5AQMA 3OYNA 1IKVA 2P9SA 4ILHA 4DUZK 4BACA 1XC9A 1XNQK 3AVJA 2E4LA 5AQVA 1Q82O 1HR0K 2XY6A 1IH7A 3LWLA 3NMUA 5JVHL 4FZZA 1EWRA 2E2NA 3K59A 2HHWA 1YAGA 4M3TA 1KD1O 4GV6A 4BVPA 3KLEA 2HHQA 2VG7A 4BR2A 5GAHP 3LAKA 4NO7A 3VQ5A 1G15A 1EWQA 5AQRA 4FJGA 1RDCA 2FBVA 3ZT2A 2DY4A 1QQOA 4U67L 4HCCA 2E6MA 4GKJK 3CJ1A 1ZBSA 4M63C 3SQ4A 3WNGA 4IOCL 5IT9O 3OW2M 4FLVA 2D5RA 2HVIA 3CXCM 1GLAG 3OYIA 4OX9K 3H08A 4BRKA 3OHRA 5F2RA 1HX1A 3R9PA 4PL8A 1RTHA 4GW6A 1NK9A 3CFOA 5BRDA 1LW0A 4KHSA 4H5TA 3IAYA 1JXEA 3CD6N 1HUXA 1YIJN 3SBGA 4A2AA 5CE3A 1BU6O 4HHTA 4OPJA 4DCHA 2I7PA 2KQ2A 2EWSA 3MEEA 5I42A 4CESA 2NRXA 2P9UB 1TV6A 4I2QA 3DLLL 4CZIA 5C2DA 2QKKA 3QEWA 4MLEA 2NLXA 1X1PA 1BOTO 3WXKA 1SL1A 3BGRA 3OYDA 2QTDA 1CZ9A 4FK4A 2YHXA 5EOYA 4DQQA 2UU9K 4CJRA 2V7ZA 3VQ6A 1GLFO 1IG9A 1NGCA 4FWOA 3CC4N 3HBTA 2HF3A 5EXWA 3V1OA 1Z6RA 2FBYA 3TU5A 4GMJB 3EEQA 1LAWA 2ZGZA 4DSLA 4DKWA 3K5OA 1BI4A 4JKFA 4CGGA 1HKBA 4A62A 3ZETB 5AQKA 4YOYA 1JKHA 2BDPA 4DSKA 2QXLA 3D45A 1RDWX 3B6OA 1NJWA 4CJWA 2HHHK 3CCSN 4FO0A 3P39A 1YHQN 2IAJA 1JCFA 2WBNA 3ZYYX 3HVTA 1YF5L 3A2FA 5JMVA 5AZIB 2JLEA 4GNIA 5KPZA 2O8CA 3EE9A 1U47A 2P9LB 1RDDA 2XY5A 5GINA 2GV9A 4JYAK 1ZBFA 1FKPA 4O4GA 2V51B 2ZF5O 3OY9A 2UUBK 4BE2A 3UB5A 1W2BM 3CC2N 1FJGK 1QZ5A 5AQSA 3EZWA 3TWHA 3B8AX 2PY5A 5HBMA 1MDUB 3A5MC 4PKHA 1QS4A 2CH6A 1S1UA 2RHKA 4BR0A 1EKEA 4AHVA 4KO0A 4RCHA 2FC0A 2NUBA 1OVYA 3P5JA 3ZX0A 4GKKK 1WLJA 3NBPA 3MEDA 3RMCA 4FWMA 1JJ2M 3DLRA 3JAMO 1IKYA 4H0TB 5J2NA 4WQ5A 4IEEA 1VSHA 5CZ1A 4JV5K 1TGOA 4CF2A 4CEOA 3LPUA 3P31A 4DFMA 3GL1A 2GBZA 3SUOA 3FZHA 2H3GX 4KHUA 3J7YP 3VQ8A 4K8ZA 3THXA 4J2AA 3VOVA 3AGRA 4B8AB 1RT2A 3SUNA 4F4KA 5EX5A 4YY3K 3V9XA 3DXKB 1GOAA 1QVFM 3QESA 2XO7A 4E7LA 4KH4A 2QWQA 1MWKA 3NE6A 3U9ZA 4RW7A 4FVUA 3AVLA 3SNNA 4Q5VA 3RSEB 3PY8A 1ATSA 2FLOA 3EN9A 3CC7N 4B3RK 1C0FA 3KTQA 1ZBIA 2QEXN 2O8BB 4H03B 4KHNA 3L6QA 4Y1CA 1NK6A 4IBNA 3C7NA 2Y1JA 5AQLA 1GLBG 5AR0A 4BGAA 4OGCA 4O55A 4NLBA 1I3AA 4FJKA 1ZBUA 1SQKA 4KPYA 1YXQA 1GLLO 2NRHA 3RWUA 3ID8A 3LDLA 4J8FA 3LWMA 3T1HK 4QS8A 1YTUA 3AVCA 4JRQA 3ZSOA 4CF8A 4JI2K 3KK2A 4JEPA 1JCEA 4PA1A 3VEZA 3KKSA 1IBKK 4CJFA 4JHDB 2HMPA 4IJAA 1JXBA 1KCFA 3T1YK 4IFYA 4YOWA 1VQ8N 2ZJQL 1CZAN 3TTFA 4DV7K 3R8EA 3RTVA 4E7IA 5JVGL 3FR0A 3ENOA 3MMVA 3HM8A 3VA0A 2YI1A 4DTOA 5GIOA 4CEQA 3K5MA 3C94A 2Y1IA 3D7EO 3TAPA 1VSFA 4ILJA 4EAHD 3LP2A 4F9OA 3JYTA 3P38A 5KPRA 3V9WA 1GOBA 3L2UA 3PSIA 5AFUA 4BRLA 2ITMA 3NF9A 3DLEA 4B8CA 1IO2A 2YX6A 1NGHA 1VSKA 1Q18A 4BY9C 2XHBA 4NYFA 2HNZA 2ZD1A 1OH5A 2G8WA 4N41A 3OYGA 3V81A 4A57A 4ELVA 4B9TA 4DLGA 5AQTA 5DM6L 5SZTA 2GX9A 2HNYA 2OTJN 4M45A 4LC9B 3DLBA 3NF6A 2GEMA 4RG8A 4DR5K 1HJRA 1DEJA 2P5OA 3CJBA 1NK0A 5M1KA 1X3MA 3L2RA 4CGIA 4CJVA 3CQ8A 5DM7L 2FXUA 3O08A 1Q8IA 1QHAA 4C8OA 3MN9A 5LJVA 2JWKA 4BVOA 1W9HA 5EY4A 1U04A 5AQQA 4FWRA 1NMDA 1WN7A 2UXDK 5LMNK 1A5VA 2DFEA 4TSXA 2W6LA 4YOTA 3K5NA 3IKMA 4FLUA 5FPDA 4O44A 3D0PA 4B3MK 1RBVA 4FM2A 3AA3A 1EQYA 3MN6A 4JD2B 3WUHA 3H1VX 3ATUA 4LSNA 1KFSA 4X66K 2OCEA 5TKWA 3VESA 3G10A 1TVRA 3SUQA 1IV0A 4MDAA 2OZMA 1WNSA 3EE8A 4DV4K 1XMQK 1MU2A 3CERA 3LL3A 4CD3A 3QIOA 4BQZA 1HNWK 3CG7A 5FDLA 1VSMA 3OYJA 3TAMA 4C8KA 2D0BA 1NJXA 3ZLJA 1XQSC 4FK2A 4CJ7A 5FRMA 2NRTA 1RBUA 4CK2A 2ZM6K 4ZTJA 1ATRA 3QFUA 4W5RA 2YJEA 3FGUA 3J8AA 3BP8A 3C6HA 3ZSZA 2P9NB 4CFBA 1ESVA 4I9QA 4MLHA 3NGZA 3GOIA 4J2BA 5AQHA 3AA2A 3VQQA 1L5UA 3TABA 1TAUA 3ZT0A 2E8AA 3LP1A 2WTUA 2IS3A 4W5QA 3AA4A 5GADP 2VG6A 5C25A 1DT9A 4LH5A 4IOXA 4C8NA 2P1JA 1VRTA 3SUPA 4B08A 3V9UA 4IFVA 4CHYA 4BR9A 1LCUA 3K9JA 4I9LA 1JLGA 1S9GA 2Q0UA 3QLHA 4LFCK 3KHYA 2KFNA 1KLNA 4H0XB 1E4FT 4FJ8A 4JI6K 3A5OC 4CEEA 2YCHA 4AM7A 3CFRA 4KI4A 3D6RA 5IWAK 4F2SA 1WSGA 4CHNA 5E84A 1WSEA 3CCJN 3S3NA 1YUWA 1KC8O 3E9PA 4O5BA 3O9RA 3TPQA 2P9PB 3DOLA 5F1XA 4CGDA 4JK9A 3BF3A 3G25A 4AQYK 2IOCA 5EU7A 1JL2A 4B1ZA 5BPLA 4LFAK 4CBWA 1VQ7N 1T8EA 3QBWA 3M8SA 3JSMA 1NGFA 2HBLA 4FXDA 4JKGA 1ILYA 4JI5K 5EVZA 2F9WA 4YOXA 2YNHA 4AH9A 4CEBA 2QI2A 1RFQA 4FJHA 4FJJA 4H0PA 4DQPA 2P9UA 3ID6A 3F9MA 4BRMA 2QA4N 2EHGA 3QEIA 1QSLA 2J4RA 4AHSA 3OTOK 3VQCA 3L3VA 2CH5A 5AQUA 4B1XB 2BTFA 2Z1JA 4BDPA 3VQ7A 3RVCA 5AFUH 2GTDA 3KK1A 1LW2A 3M5RA 2HHXA 1RT1A 2O4IA 4DU1A 4FJ7A 3HM9A 3T1AA 2BUPA 1VAZA 1QZ6A 1UOCA 4RW4A 3ITHA 4FLYA 4E0DA 4FJ9A 1MA9B 4CEFA 1S1XA 5CZ2A 1ZBLA 3PX0A 4DV6K 3FE1A 4DTRA 3ULDA 3CCMN 4YDUC 3VQDA 1RDBA 3SJHA 4WFAL 4RWTA 1VQNN 2X6NA 3WNHA 1KVCA 1YTAA 4B9LA 3L4QA 4DU4A 5LY3A 4CFCA 5CR4A 3U8XA 3ZETA 1KAXA 4R79A 3E01A 1Q9YA 4I2PA 2FF3B 4AHCA 3O9UA 3HJFA 5KI6A 3PO5A 1XWLA 3CMAN 4HUFA 3AVGA 2X6SA 4CZJA 1RT3A 3IRXA 4CEZA 3L3UA 3KWGA 5TKYA 2BE2A 3KLGA 3HP6A 3TARA 3H46O 3LALA 2QKBA 1K9MO 3VQPA 4DV2K 4BDZA 4PUOA 1TYQB 2KZMA 3SAFA 5AZIA 4ZTFA 4WQ4C 4CF1A 1C0GA 1WSIA 3LPTA 1VQ4N 4DTJA 1U49A 3RR7A 3DJCA 5KQ8A 2UXCK 4W5OA 1NOZA 1JL1A 5CHIA 1QSYA 1WSFA 3LDPA 2E2OA 1BIZA 5C15A 3ZSRA 1RT7A 3DOKA 3O3HA 3QERA 3CCQN 3UKRB 5J2PA 4BC5A 3CCVN 4BRHA 4DV1K 1GLEG 1TKDA 1NGEA 3PUFA 3CCUN 3ENBA 3JXUA 3VQBA 3VMFB 1S6PA 3CIPA 1N36K 2O8EB 2B4JA 1TKZA 1Z25A 1J6ZA 1HLUA 3TSUA 1EX4A 1RTDA 4CGHA 3U3GA 4ILGB 4Z4CA 4JRPA 3SMPA 4PY5A 4DG1A 4DMNA 4JLHA 3AO2A 5FPNA 1QE1A 5JICA 3F9KA 1C1AA 2HW3A 3BF1A 3ULEA 1U2VB 4JI4K 3TTDA 4IDHA 3TR8A 4B1VA 5M1PA 3FZLA 5I3UA 4CF9A 3HO1A 1TKXA 2IC3A 3ZSXA 3J81O 3KZBA 4BR5A 3DXKA 3RMDA 3LZJA 3NGIA 1HNZK 4AHTA 3PV8A 1YJWN 1IJJA 2A1RA 1TAQA 3CJ7A 3NFAA 3WXIA 3ZT4A 4CFDA 2OA8A 4IO9L 4KFBA 3RSEA 3KK7A 4ID1A 4CZFA 2O8BA 4BDYA 2YHYA 3LP0A 2F8SA 3T3FA 3CM6A 3ZSQA 1MWMA 3E9LA 4H0VB 4F3TA 3VF6A 3I55N 3QBXA 2YHWA 3TAFA 1JLEA 3UKUB 1XC3A 2YKNA 4E7HA 1NLVA 1C0TA 3PX6A 2DPNA 3KLHA 3M6GA 1KLMA 4EFHA 4B9SA 5FRNA 2KFZA 5AQPA 3L2VA 3VEYA 3P4IA 4DR2K 1VQMN 1BDGA 3BZCA 4CZGA 3W0LA 3MK6A 4BGBA 3VTIA 3CQXA 3WT0A 3QEVA 3DXMB 3OBYA 3MAQA 3FZMA 1KQSM 2QK9A 3WQTA 1KFDA 3MXJA 3THYA 4LF5K 5C12A 4KAZA 4W5NA 1VQKN 4DQ8A 1KVAA 3TSPA 3LM2A 4BE0A 1BWFO 4DSIA 1KTQA 2KLAA 1J54A 4YHHK 3UIQA 3VGLA 4IO8A 1YJ9N 3EKSA 1Q9XA 2GUIA 1B9DA 3C6TA 1KXPA 4XH5A 1NGGA 4J2DA 1YI2N 3PIOL 1NKCA 1K6YA 2P9SB 1NGIA 3NDKA 2E1YA 3M1FA 3RMAA 4BWMA 4E7KA 1S1WA 1M90O 4M3ZA 3QICA 3HXMA 1T44A 3AARA 4CCHA 5AQZA 2DFHA 4L8RB 1S1TA 5DMRA 5CY4A 3THVA 3SZ2A 4KH6A 2KHOA 2WOMA 1SAZA 3CPWM 2ZWHA 1C0UA 4NCAA 3MN5A 3SK3A 1T7PA 2G8FA 4E19A 3QEPA 2X74A 1IG8A 4NCBA 4WFNL 3QIPA 4O8UA 1OH8A 3WNEA 1HQUA 1S72N 4JS5A 2W40A 4WQ4A 4EP4A 3NCIA 5AZJB 4E89A 4BRCA 3DLGA 3BY5A 2G8IA 1HYVA 4FVMA 1D5AA 2G8HA 3QFPA 1B9FA 4B3TK 4B3SK 4BWJA 1OKJA 2A3ZA 5LL6Z 2E20A 3D2FB 3KKRA 4M3XA 1RILA 4CK3A 1HYZA 4CZLA 4HVJA 4C1NI 4FOIA 4DB3A 1GOCA 3MXIA 1YJNN 1HQEA 5JLHA 4DF4A 4JD2A 4CGFA 4KTWA 4GV3A 3S3MA 2A5XA 4E1MA 5J2QA 1D9DA 3KD1E 4FLTA 1P90A 3TAEA 1B92A 2HVHA 1XI1A 1SV5A 3VEVA 3K2PA 2IVPA 2XY8A 3G4SN 4B9NA 4J2EA 4WCEL 4RW8A 2OTLN 2RE2A 3AVAA 4K0KK 3ALYA 3PLAA 3CJCA 3J7ZO 3V9ZA 1ASWA 3H45C 4CI6A 3V9SA 3O6WA 4LF6K 1C1BA 5AQOA 4A5AA 2IVNA 3CF5L 1QVGM 3GE1A 1DTTA 4H4OA 1BISA 2O8DB 3CI5A 2E5LK 4XH4A 4B9MA 2P9NA 4JI8K 5I9EB 4JI3K 4BQLA 2WC9A 3I33A 1K8KB 3L0QA 4CZKA 1NKEA 2QWOA 2GUPA 2VGMA 4E7JA 4CHOA 2Q31A 1VSIA 1XMOK 4CBXA 3RR8A 2QWRA 3IG1A 4WYBA 1C1CA 3AO5A 1LWEA 4NXMK 3OJUA 3WEEB 1KAZA 2OYQA 5AQFA 3M3ZA 4JS4A 1RCHA 4NYNA 2E88A 3CFPA 5KRSA 5SWMA 4I7FA 4FWPA 4MQ3A 3Q7CA 4DQSA 4E1JA 4YOVA 4FLWA 3U9DA 2RN2A 4CJ4A 4H0YB 4C23A 3SV3A 4CJEA 3VQEA 1Z26A 4JI7K 5M1QA 2VGNA 2BANA 5FPEA 4BRIA 2QWLA 3DAWA 1NK4A 3MCAB 2QM1A 2P9PA 2B5JA 2UYTA 4K42A 1RDAA 3A0IX 3SCXA 3AAQA 1Q81O 4QOZB 1HPZA 5T7BA 1JLAA 3U3YA 3MWPA 3ZX2A 2X78A 4HTUA 2PYJA 4CJQA 3PO4A 3HP9A 3O3FA 2UUAK 4OLAA 4CW7B 4CJ3A 1RBTA 5M1NA 4OKKA 1T6CA 4ID5A 4GVEA 1HNXK 2YV0X 1RGIA 2ITGA 1X3NA 2HBKA 3HPHA 1V4TA 1NK5A 4M3UA 4M42A 3DMJA 3KD5E 4B3OA 1RT5A 3CM5A 2Q1NA 3QETA 1RBRA 2ASOA
chains in the Genus database with same CATH topology
4CJKA 1ZBHA 1LW2A 1REVA 3LAMA 3OYDA 4OVLA 1CZ9A 4KHWA 4FK4A 1VSLA 2HHXA 4DQQA 1RT1A 2YNGA 3DRSA 5HRNA 4DU1A 3HM9A 4FJ7A 2VWKA 3LANA 3M8PA 3V4IA 3T1AA 4FLYA 1UOCA 4RW4A 3ITHA 4CJRA 4E0DA 4CE9A 4DTXA 1UA0A 4C8LA 4FJ9A 4KI6A 3VQ6A 3L2QA 1IG9A 1VRUA 2HHUA 4CEFA 1S1XA 3OYBA 5CZ2A 1ZBLA 3PX0A 2HHTA 1WSJA 4DTRA 3ULDA 3V1OA 4KKOA 4ICLA 3SPYA 5E41A 4Z4GA 3VQDA 2FBYA 1RDBA 3L8BA 4GMJB 1N6QA 2X6NA 4LSLA 3WNHA 4CK1A 3NAEA 3QNNA 1KVCA 1LAWA 1YTAA 4B9LA 4DSLA 4DFKA 4DU4A 1S9EA 1TK5A 4CFCA 3K5OA 4PQUA 1BI4A 3O4QA 4CGGA 1BI4B 4DSFA 4AHUA 1R0AA 3E01A 1Q9YA 4I2PA 4KTQA 4AHCA 3LP3A 4HUGA 2XRIA 4FJXA 3G0ZA 3HJFA 4EZ6A 5KI6A 1JKHA 1BL3A 3PO5A 1XWLA 1X9WA 4HUFA 3AVGA 2BDPA 2X6SA 4DSKA 1RT3A 3D45A 3OYCA 3IRXA 4CEZA 3RMBA 3B6OA 1NJWA 4CJWA 3HK2A 1L3TA 3L3UA 4C8MA 3ZT1A 2BE2A 3KLGA 3HP6A 3TARA 1VSEA 3LALA 5K14A 2QKBA 4QCLA 3SQ0A 2IAJA 1CXUA 1HMVA 3C6UA 5KGWA 3VQPA 3HVTA 4BDZA 3A2FA 4PUOA 4B9UA 2KZMA 4BE1A 4FJ5A 4OKJA 4ZTFA 4CF1A 2JLEA 1WSIA 3LPTA 2YNIA 1U47A 1S5JA 4CHPA 4Z4HA 4DTJA 1U49A 3RR7A 1RDDA 1SUQA 3EZ5A 2GV9A 4IDKA 2XY5A 1D8YA 1ZBFA 1FKPA 1A5XA 1EP4A 1BQMA 4O4GA 3AV9A 1XHXA 4W5OA 1C6VA 1JLQA 1NOZA 3DRRA 3OY9A 2I5JA 4BE2A 1JL1A 1QSYA 1X9MA 1WSFA 2OPPA 3SJJA 4CJPA 4Z4IA 3ZCMA 2YHAA 4DTSA 1BIZA 4DS4A 2VWJA 3ZSRA 1IKXA 4DF8A 1RT7A 2RPIA 3DOKA 3O3HA 3QERA 1QSSA 5J2PA 4E1NA 4CERA 3TWHA 1XHZA 4OPKA 2PY5A 1TKDA 1U48A 3VN5A 3PUFA 5HBMA 3LDSA 4FM1A 3VQBA 3K5LA 2HNDA 3LZIA 1S6PA 1VSDA 1QS4A 2B4JA 1S1UA 4M3RA 3EY1A 1TKZA 1YT3A 3NH2A 1Z25A 4FJIA 1EKEA 4AHVA 3I8DA 4KO0A 1TKTA 1TK8A 2FC0A 2NUBA 1EX4A 1D9FA 1RTDA 3P5JA 4CGHA 3U3GA 3NGYA 1HNIA 1WLJA 3OVNA 3M8QA 2Z1GA 3AO4A 3MEDA 3NBPA 4Z4CA 3RMCA 4JRPA 5HRPA 3DLRA 4PY5A 4DG1A 1IKYA 4KV8A 4DMNA 1HNVA 1RTJA 5J2NA 4JLHA 3AO2A 1VSHA 5CZ1A 5HROA 1QE1A 4CEDA 3OYHA 3F9KA 4LH4A 1TGOA 2Z1HA 4N5SA 1C1AA 4CF2A 4DTPA 2HW3A 4CEOA 1UWBA 3LPUA 4DFMA 2F96A 1YVUA 3TI0A 2D0AA 2GBZA 3SUOA 3TR8A 1UA1A 4KHUA 4CIEA 3VQ8A 5I3UA 4CF9A 1DTQA 2ZQBA 4K8ZA 2O4IA 3HO1A 4J2AA 1TKXA 2IC3A 3ZSXA 4ELUA 4B8AB 1RT2A 3IS9A 3SUNA 3V9XA 2YKMA 3LZJA 3RMDA 3NGIA 4F4KA 4Z4FA 1GOAA 1LV5A 1X9SA 4AHTA 3PV8A 3QNOA 3QESA 2XO7A 4E7LA 1WAFA 1RBSA 2A1RA 1TAQA 3CYMA 3DM2A 3NFAA 2FBTA 3ZT4A 3HYFA 4CFDA 4O0JA 3SQ2A 3NE6A 2OA8A 4RW7A 4KFBA 3AVLA 3AVNA 4W5TA 3SNNA 1J5OA 3DRPA 4ID1A 4Q5VA 1N5YA 3PY8A 4CJSA 2XY7A 2VG5A 3SI6A 4BDYA 2YHBA 4FYDA 1RTIA 3KTQA 1ZBIA 4R5PA 4DQRA 4KHNA 3LP0A 3T19A 4Y1CA 1NK6A 4IBNA 4MFBA 3T3FA 2Y1JA 3SPZA 2F8SA 1HRHA 3CM6A 3ZSQA 3AVMA 2W42A 3QEXA 4G1QA 4AHRA 1SKSA 3QO9A 3NH1A 4DTNA 5C42A 4F3TA 4OGCA 3OS2A 4O55A 4XIUA 1I3AA 3TAFA 1JLEA 4FJKA 1ZBUA 3OJSA 3KLIA 4KPYA 2YKNA 3MECA 4E7HA 1C0TA 3DLHA 3PX6A 3RWUA 2OPRA 3KLHA 5J1EA 3LWMA 1YTUA 1KLMA 3AVCA 1LWCA 3ZSWA 4B9SA 1C0MA 4JRQA 1T05A 3ZSOA 3VQ9A 4CF8A 4CJ5A 3OYAA 5KGXA 3KK2A 3I0RA 1F21A 3L2VA 1L3VA 4PA1A 2DTUA 3OYMA 3RRHA 5JS2A 3KKSA 4M41A 3OYKA 4CJFA 4FZYA 4FCYA 3AVKA 5CYQA 2ATQA 4LY7A 1J53A 2IGIA 1KRPA 3QEVA 1JXBA 3O3GA 3MAQA 1KCFA 2QK9A 4FJMA 4IFYA 4IKFA 1TL3A 1KFDA 3MXJA 5HLFA 3K57A 4OKEA 4KAZA 4W5NA 1BCMA 4FLXA 3RTVA 4E7IA 1I39A 1KVAA 3MEGA 4FK0A 3DI6A 3VA0A 2D0CA 4Z0UA 2OPSA 4DTOA 1NK7A 4BE0A 2LSNA 1NKBA 4EZ9A 3HSTB 1IKWA 4LD0A 4DSIA 1KTQA 4CEQA 1KSPA 3OYFA 2E6LA 1J54A 3K5MA 3C94A 2Y1IA 3ZSVA 3UIQA 4H4MA 3AVFA 3TAPA 3HPOA 1VSFA 1CXQA 1Q9XA 1S1VA 2GUIA 4DTMA 1B9DA 1QHTA 3C6TA 4O0IA 1JLCA 3LP2A 3JYTA 2JGUA 4J2DA 3V9WA 3L2WA 1GOBA 3AVBA 1BCOA 1K6YA 1NKCA 2OZSA 3L2UA 1SL0A 4CJUA 3V6DA 2P5GA 4IG0A 4FLZA 2IDOA 4KRFA 4WE1A 4N76A 3FFIA 4M3WA 4KB1A 3NDKA 1JLFA 3TAGA 3RMAA 2O4GA 3NF9A 4BWMA 2FBXA 1BQNA 1VSJA 3DLEA 4CECA 1S1WA 4B8CA 1IO2A 4E7KA 4AILC 1U4BA 4B9VA 3VQAA 4M3ZA 1VSKA 1WSHA 3AO3A 4KREA 3HXMA 2G8VA 4GVMA 4CCHA 2WONA 2DFHA 2EX3A 3SQ1A 2XHBA 4NYFA 4L8RB 1A5WA 2HNZA 1S1TA 5DMRA 5HRSA 1LWFA 4QAGA 4OJRA 5CY4A 1KVBA 3S9HA 3THVA 5DK5A 4IG3A 4CEAA 2ZD1A 3SZ2A 3NH0A 2WOMA 1SL2A 4F3OA 4CF0A 2G8WA 4N41A 2RF2A 1C0UA 3OYGA 3V81A 4ELVA 4NCAA 4B9TA 3ISNC 4DLGA 1T7PA 4Z4EA 2G8FA 4E19A 4F8RA 4RW6A 4YNQA 5SZTA 2HNYA 3PX4A 2X74A 4YFUA 4M45A 3QEPA 4BDPA 4NCBA 5HRRA 2YNFA 3QIPA 3NF6A 3S3OA 4N47A 3M8RA 1FXXA 3DLBA 2AJQA 4RG8A 4H8KA 2PZSA 1HJRA 2DFFA 3WNEA 1HQUA 5KTQA 2P5OA 1DLOA 1S6QA 1NK0A 3SV4A 4CIGA 4JS5A 3HPGA 1CLQA 3L2RA 4CGIA 4EP4A 3RRGA 4CJVA 3NCIA 3CQ8A 2RKIA 3DYAA 2F8TA 3AVIA 4E89A 3ZSYA 1Y97A 1Q8IA 3DLGA 4CHZA 4C8OA 4Q0BA 4N56A 1FKOA 1SKRA 2G8IA 4CHQA 1HYVA 4FVMA 1D5AA 1ASUA 2G8HA 1W9HA 5KRTA 1B9FA 1U04A 2G8UA 2HHVA 1BHLA 1UAXA 4BWJA 4DQIA 3AO1A 3BDPA 5CYMA 1NJZA 3NHGA 1EETA 3KIOA 1JLBA 1WN7A 3KKRA 4M3XA 1A5VA 2DFEA 1RILA 4TSXA 2QXFA 3TAQA 2BGGA 1ITGA 2HMIA 3K5NA 4CK3A 1CZBA 4FZXC 1HYZA 4FLUA 1HYSA 4O44A 3D0PA 4HVJA 3MXIA 1GOCA 1HQEA 4DF4A 1RBVA 4FM2A 3AA3A 1WAJA 4CGFA 4KTWA 3HT3A 4LSNA 4NCGA 3S3MA 1KFSA 4E1MA 1NOYA 5J2QA 4DFPA 4M3YA 1D9DA 2Z1IA 4RW9A 3KD1E 4FLTA 3G10A 3TAEA 1B92A 3DLKA 4CJTA 2HVHA 1TVRA 3SUQA 2G8KA 1XI1A 1SV5A 3K2PA 4Y1DA 1WNSA 2OZMA 2XY8A 4B9NA 2OPQA 2Q3SA 5HP1A 4J2EA 3OS0A 5D3GA 2B6AA 4RW8A 1MU2A 3I0SA 5FRNA 3AVAA 3QIOA 3ALYA 1EXQA 2ETJA 2A1SA 3CG7A 5FDLA 1VSMA 4CIFA 3OYJA 5J2MA 3TAMA 4UQGA 3NF7A 3V9ZA 1ASWA 3OYEA 4C8KA 3V9SA 1LAVA 2D0BA 3O4NA 1NJXA 4DTUA 4DU3A 4FJNA 1ASVA 4FK2A 5FRMA 1C1BA 4HUEA 1RBUA 4CK2A 3QINA 3OS1A 4ZTJA 1BGXT 3KJVA 2ZE2A 4W5RA 4K8XA 1DTTA 3VQ4A 1FK9A 4H4OA 1BISA 3B6PA 4EP5A 3P1GA 3AA5X 3K58A 1T03A 1J9AA 1RT6A 3ZSZA 3NF8A 4CFBA 2PYLA 4B9MA 4KB0A 4CJLA 4I9QA 3MXMA 4CFAA 4FM0A 3AVHA 3NGZA 5FROA 4J2BA 4DSEA 1TK0A 1NKEA 4PWDA 3AA2A 3VQQA 4FW1A 3EYZA 3V1RA 1L5UA 4DSJA 3V1QA 4E7JA 3TABA 1TAUA 3ZT0A 4CHOA 3LP1A 1VSIA 4OGEA 1U45A 3HVRA 2IS3A 2P51A 4W5QA 4E3SA 3RR8A 3AA4A 4FW2A 2HB5A 2VG6A 3IG1A 1C1CA 3AO5A 3WNFA 3ZT3A 5C25A 1LWEA 3OYNA 4LH5A 3OJUA 1IKVA 4C8NA 4KHQA 2P1JA 1VRTA 2OYQA 4BACA 4JS4A 3SUPA 1XC9A 3AVJA 1RCHA 2E4LA 3SYZA 4NYNA 4B08A 3CFPA 4IFVA 4CHYA 5KRSA 3V9UA 3TANA 2XY6A 1IH7A 1L3SA 5SWMA 3LWLA 4I7FA 4I9LA 4FZZA 4ELTA 3C95A 4MQ3A 4DQSA 1JLGA 1S9GA 3K59A 1NJYA 2HHWA 4FLWA 2RN2A 3QLHA 4CJ4A 2KZZA 1O1WA 1W0HA 4DWIA 4M3TA 3SV3A 2KFNA 1KLNA 4CJEA 4FJLA 3VQEA 4OLBA 2KFZA 4KHYA 1Z26A 3ASMA 3KLEA 4FJ8A 2HHQA 2VG7A 4CEEA 3CFRA 4CGJA 4KI4A 4F2SA 3LAKA 1TL1A 2BANA 1G15A 1WSGA 1QQCA 3P83D 3VQ5A 1WSEA 4CHNA 4FJGA 3S3NA 1NK4A 1RDCA 4O5BA 2FBVA 3ZT2A 3F73A 1NK8A 2DY4A 2B5JA 4HCCA 1RDAA 2E6MA 3DOLA 3SCXA 4HCBA 1L3UA 4QOZB 1HPZA 4CGDA 5T7BA 1JLAA 3SQ4A 3U3YA 3WNGA 4FLVA 2D5RA 2IOCA 5EU7A 2X78A 1JL2A 2HVIA 3OYIA 4HTUA 1ZYQA 3H08A 2PYJA 3OYLA 4DLEA 4CJQA 1T8EA 2KTQA 4KTZA 3PO4A 3M8SA 2HHSA 4DFJA 3JSMA 1RTHA 3HP9A 3O3FA 4GW6A 1NK9A 3CFOA 4OLAA 1LW0A 4CJ3A 4F2RA 1RBTA 4KHSA 4FXDA 1RNHA 4OKKA 3IAYA 1BIUA 1JXEA 4ID5A 2YV0X 2YNHA 4AH9A 4CEBA 2KW4A 4HHTA 4OPJA 2ITGA 2KQ2A 5C24A 3MEEA 4FJHA 5I42A 3HPHA 3VA3A 4CESA 4FJJA 4DQPA 3KLFA 3KK3A 1NK5A 4DS5A 4M3UA 1TV6A 4I2QA 3HL8A 4M42A 1SKWA 2EHGA 3QEIA 1QSLA 4ZHRA 3DMJA 1VK0A 4AHSA 2QKKA 1RT4A 3QEWA 3KD5E 4B3OA 5JS1A 3U6FA 3VQCA 3L3VA 1X1PA 1RT5A 3CM5A 2Z1JA 3QETA 1RBRA 2R7YA 1QTMA 1SL1A 3VQ7A 3BGRA 3KK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJK A;  1ZBH A;  1LW2 A;  1REV A;  3LAM A;  3OYD A;  4OVL A;  1CZ9 A;  4KHW A;  4FK4 A;  1VSL A;  2HHX A;  4DQQ A;  1RT1 A;  2YNG A;  3DRS A;  5HRN A;  4DU1 A;  3HM9 A;  4FJ7 A;  2VWK A;  3LAN A;  3M8P A;  3V4I A;  3T1A A;  4FLY A;  1UOC A;  4RW4 A;  3ITH A;  4CJR A;  4E0D A;  4CE9 A;  4DTX A;  1UA0 A;  4C8L A;  4FJ9 A;  4KI6 A;  3VQ6 A;  3L2Q A;  1IG9 A;  1VRU A;  2HHU A;  4CEF A;  1S1X A;  3OYB A;  5CZ2 A;  1ZBL A;  3PX0 A;  2HHT A;  1WSJ A;  4DTR A;  3ULD A;  3V1O A;  4KKO A;  4ICL A;  3SPY A;  5E41 A;  4Z4G A;  3VQD A;  2FBY A;  1RDB A;  3L8B A;  4GMJ B;  1N6Q A;  2X6N A;  4LSL A;  3WNH A;  4CK1 A;  3NAE A;  3QNN A;  1KVC A;  1LAW A;  1YTA A;  4B9L A;  4DSL A;  4DFK A;  4DU4 A;  1S9E A;  1TK5 A;  4CFC A;  3K5O A;  4PQU A;  1BI4 A;  3O4Q A;  4CGG A;  1BI4 B;  4DSF A;  4AHU A;  1R0A A;  3E01 A;  1Q9Y A;  4I2P A;  4KTQ A;  4AHC A;  3LP3 A;  4HUG A;  2XRI A;  4FJX A;  3G0Z A;  3HJF A;  4EZ6 A;  5KI6 A;  1JKH A;  1BL3 A;  3PO5 A;  1XWL A;  1X9W A;  4HUF A;  3AVG A;  2BDP A;  2X6S A;  4DSK A;  1RT3 A;  3D45 A;  3OYC A;  3IRX A;  4CEZ A;  3RMB A;  3B6O A;  1NJW A;  4CJW A;  3HK2 A;  1L3T A;  3L3U A;  4C8M A;  3ZT1 A;  2BE2 A;  3KLG A;  3HP6 A;  3TAR A;  1VSE A;  3LAL A;  5K14 A;  2QKB A;  4QCL A;  3SQ0 A;  2IAJ A;  1CXU A;  1HMV A;  3C6U A;  5KGW A;  3VQP A;  3HVT A;  4BDZ A;  3A2F A;  4PUO A;  4B9U A;  2KZM A;  4BE1 A;  4FJ5 A;  4OKJ A;  4ZTF A;  4CF1 A;  2JLE A;  1WSI A;  3LPT A;  2YNI A;  1U47 A;  1S5J A;  4CHP A;  4Z4H A;  4DTJ A;  1U49 A;  3RR7 A;  1RDD A;  1SUQ A;  3EZ5 A;  2GV9 A;  4IDK A;  2XY5 A;  1D8Y A;  1ZBF A;  1FKP A;  1A5X A;  1EP4 A;  1BQM A;  4O4G A;  3AV9 A;  1XHX A;  4W5O A;  1C6V A;  1JLQ A;  1NOZ A;  3DRR A;  3OY9 A;  2I5J A;  4BE2 A;  1JL1 A;  1QSY A;  1X9M A;  1WSF A;  2OPP A;  3SJJ A;  4CJP A;  4Z4I A;  3ZCM A;  2YHA A;  4DTS A;  1BIZ A;  4DS4 A;  2VWJ A;  3ZSR A;  1IKX A;  4DF8 A;  1RT7 A;  2RPI A;  3DOK A;  3O3H A;  3QER A;  1QSS A;  5J2P A;  4E1N A;  4CER A;  3TWH A;  1XHZ A;  4OPK A;  2PY5 A;  1TKD A;  1U48 A;  3VN5 A;  3PUF A;  5HBM A;  3LDS A;  4FM1 A;  3VQB A;  3K5L A;  2HND A;  3LZI A;  1S6P A;  1VSD A;  1QS4 A;  2B4J A;  1S1U A;  4M3R A;  3EY1 A;  1TKZ A;  1YT3 A;  3NH2 A;  1Z25 A;  4FJI A;  1EKE A;  4AHV A;  3I8D A;  4KO0 A;  1TKT A;  1TK8 A;  2FC0 A;  2NUB A;  1EX4 A;  1D9F A;  1RTD A;  3P5J A;  4CGH A;  3U3G A;  3NGY A;  1HNI A;  1WLJ A;  3OVN A;  3M8Q A;  2Z1G A;  3AO4 A;  3MED A;  3NBP A;  4Z4C A;  3RMC A;  4JRP A;  5HRP A;  3DLR A;  4PY5 A;  4DG1 A;  1IKY A;  4KV8 A;  4DMN A;  1HNV A;  1RTJ A;  5J2N A;  4JLH A;  3AO2 A;  1VSH A;  5CZ1 A;  5HRO A;  1QE1 A;  4CED A;  3OYH A;  3F9K A;  4LH4 A;  1TGO A;  2Z1H A;  4N5S A;  1C1A A;  4CF2 A;  4DTP A;  2HW3 A;  4CEO A;  1UWB A;  3LPU A;  4DFM A;  2F96 A;  1YVU A;  3TI0 A;  2D0A A;  2GBZ A;  3SUO A;  3TR8 A;  1UA1 A;  4KHU A;  4CIE A;  3VQ8 A;  5I3U A;  4CF9 A;  1DTQ A;  2ZQB A;  4K8Z A;  2O4I A;  3HO1 A;  4J2A A;  1TKX A;  2IC3 A;  3ZSX A;  4ELU A;  4B8A B;  1RT2 A;  3IS9 A;  3SUN A;  3V9X A;  2YKM A;  3LZJ A;  3RMD A;  3NGI A;  4F4K A;  4Z4F A;  1GOA A;  1LV5 A;  1X9S A;  4AHT A;  3PV8 A;  3QNO A;  3QES A;  2XO7 A;  4E7L A;  1WAF A;  1RBS A;  2A1R A;  1TAQ A;  3CYM A;  3DM2 A;  3NFA A;  2FBT A;  3ZT4 A;  3HYF A;  4CFD A;  4O0J A;  3SQ2 A;  3NE6 A;  2OA8 A;  4RW7 A;  4KFB A;  3AVL A;  3AVN A;  4W5T A;  3SNN A;  1J5O A;  3DRP A;  4ID1 A;  4Q5V A;  1N5Y A;  3PY8 A;  4CJS A;  2XY7 A;  2VG5 A;  3SI6 A;  4BDY A;  2YHB A;  4FYD A;  1RTI A;  3KTQ A;  1ZBI A;  4R5P A;  4DQR A;  4KHN A;  3LP0 A;  3T19 A;  4Y1C A;  1NK6 A;  4IBN A;  4MFB A;  3T3F A;  2Y1J A;  3SPZ A;  2F8S A;  1HRH A;  3CM6 A;  3ZSQ A;  3AVM A;  2W42 A;  3QEX A;  4G1Q A;  4AHR A;  1SKS A;  3QO9 A;  3NH1 A;  4DTN A;  5C42 A;  4F3T A;  4OGC A;  3OS2 A;  4O55 A;  4XIU A;  1I3A A;  3TAF A;  1JLE A;  4FJK A;  1ZBU A;  3OJS A;  3KLI A;  4KPY A;  2YKN A;  3MEC A;  4E7H A;  1C0T A;  3DLH A;  3PX6 A;  3RWU A;  2OPR A;  3KLH A;  5J1E A;  3LWM A;  1YTU A;  1KLM A;  3AVC A;  1LWC A;  3ZSW A;  4B9S A;  1C0M A;  4JRQ A;  1T05 A;  3ZSO A;  3VQ9 A;  4CF8 A;  4CJ5 A;  3OYA A;  5KGX A;  3KK2 A;  3I0R A;  1F21 A;  3L2V A;  1L3V A;  4PA1 A;  2DTU A;  3OYM A;  3RRH A;  5JS2 A;  3KKS A;  4M41 A;  3OYK A;  4CJF A;  4FZY A;  4FCY A;  3AVK A;  5CYQ A;  2ATQ A;  4LY7 A;  1J53 A;  2IGI A;  1KRP A;  3QEV A;  1JXB A;  3O3G A;  3MAQ A;  1KCF A;  2QK9 A;  4FJM A;  4IFY A;  4IKF A;  1TL3 A;  1KFD A;  3MXJ A;  5HLF A;  3K57 A;  4OKE A;  4KAZ A;  4W5N A;  1BCM A;  4FLX A;  3RTV A;  4E7I A;  1I39 A;  1KVA A;  3MEG A;  4FK0 A;  3DI6 A;  3VA0 A;  2D0C A;  4Z0U A;  2OPS A;  4DTO A;  1NK7 A;  4BE0 A;  2LSN A;  1NKB A;  4EZ9 A;  3HST B;  1IKW A;  4LD0 A;  4DSI A;  1KTQ A;  4CEQ A;  1KSP A;  3OYF A;  2E6L A;  1J54 A;  3K5M A;  3C94 A;  2Y1I A;  3ZSV A;  3UIQ A;  4H4M A;  3AVF A;  3TAP A;  3HPO A;  1VSF A;  1CXQ A;  1Q9X A;  1S1V A;  2GUI A;  4DTM A;  1B9D A;  1QHT A;  3C6T A;  4O0I A;  1JLC A;  3LP2 A;  3JYT A;  2JGU A;  4J2D A;  3V9W A;  3L2W A;  1GOB A;  3AVB A;  1BCO A;  1K6Y A;  1NKC A;  2OZS A;  3L2U A;  1SL0 A;  4CJU A;  3V6D A;  2P5G A;  4IG0 A;  4FLZ A;  2IDO A;  4KRF A;  4WE1 A;  4N76 A;  3FFI A;  4M3W A;  4KB1 A;  3NDK A;  1JLF A;  3TAG A;  3RMA A;  2O4G A;  3NF9 A;  4BWM A;  2FBX A;  1BQN A;  1VSJ A;  3DLE A;  4CEC A;  1S1W A;  4B8C A;  1IO2 A;  4E7K A;  4AIL C;  1U4B A;  4B9V A;  3VQA A;  4M3Z A;  1VSK A;  1WSH A;  3AO3 A;  4KRE A;  3HXM A;  2G8V A;  4GVM A;  4CCH A;  2WON A;  2DFH A;  2EX3 A;  3SQ1 A;  2XHB A;  4NYF A;  4L8R B;  1A5W A;  2HNZ A;  1S1T A;  5DMR A;  5HRS A;  1LWF A;  4QAG A;  4OJR A;  5CY4 A;  1KVB A;  3S9H A;  3THV A;  5DK5 A;  4IG3 A;  4CEA A;  2ZD1 A;  3SZ2 A;  3NH0 A;  2WOM A;  1SL2 A;  4F3O A;  4CF0 A;  2G8W A;  4N41 A;  2RF2 A;  1C0U A;  3OYG A;  3V81 A;  4ELV A;  4NCA A;  4B9T A;  3ISN C;  4DLG A;  1T7P A;  4Z4E A;  2G8F A;  4E19 A;  4F8R A;  4RW6 A;  4YNQ A;  5SZT A;  2HNY A;  3PX4 A;  2X74 A;  4YFU A;  4M45 A;  3QEP A;  4BDP A;  4NCB A;  5HRR A;  2YNF A;  3QIP A;  3NF6 A;  3S3O A;  4N47 A;  3M8R A;  1FXX A;  3DLB A;  2AJQ A;  4RG8 A;  4H8K A;  2PZS A;  1HJR A;  2DFF A;  3WNE A;  1HQU A;  5KTQ A;  2P5O A;  1DLO A;  1S6Q A;  1NK0 A;  3SV4 A;  4CIG A;  4JS5 A;  3HPG A;  1CLQ A;  3L2R A;  4CGI A;  4EP4 A;  3RRG A;  4CJV A;  3NCI A;  3CQ8 A;  2RKI A;  3DYA A;  2F8T A;  3AVI A;  4E89 A;  3ZSY A;  1Y97 A;  1Q8I A;  3DLG A;  4CHZ A;  4C8O A;  4Q0B A;  4N56 A;  1FKO A;  1SKR A;  2G8I A;  4CHQ A;  1HYV A;  4FVM A;  1D5A A;  1ASU A;  2G8H A;  1W9H A;  5KRT A;  1B9F A;  1U04 A;  2G8U A;  2HHV A;  1BHL A;  1UAX A;  4BWJ A;  4DQI A;  3AO1 A;  3BDP A;  5CYM A;  1NJZ A;  3NHG A;  1EET A;  3KIO A;  1JLB A;  1WN7 A;  3KKR A;  4M3X A;  1A5V A;  2DFE A;  1RIL A;  4TSX A;  2QXF A;  3TAQ A;  2BGG A;  1ITG A;  2HMI A;  3K5N A;  4CK3 A;  1CZB A;  4FZX C;  1HYZ A;  4FLU A;  1HYS A;  4O44 A;  3D0P A;  4HVJ A;  3MXI A;  1GOC A;  1HQE A;  4DF4 A;  1RBV A;  4FM2 A;  3AA3 A;  1WAJ A;  4CGF A;  4KTW A;  3HT3 A;  4LSN A;  4NCG A;  3S3M A;  1KFS A;  4E1M A;  1NOY A;  5J2Q A;  4DFP A;  4M3Y A;  1D9D A;  2Z1I A;  4RW9 A;  3KD1 E;  4FLT A;  3G10 A;  3TAE A;  1B92 A;  3DLK A;  4CJT A;  2HVH A;  1TVR A;  3SUQ A;  2G8K A;  1XI1 A;  1SV5 A;  3K2P A;  4Y1D A;  1WNS A;  2OZM A;  2XY8 A;  4B9N A;  2OPQ A;  2Q3S A;  5HP1 A;  4J2E A;  3OS0 A;  5D3G A;  2B6A A;  4RW8 A;  1MU2 A;  3I0S A;  5FRN A;  3AVA A;  3QIO A;  3ALY A;  1EXQ A;  2ETJ A;  2A1S A;  3CG7 A;  5FDL A;  1VSM A;  4CIF A;  3OYJ A;  5J2M A;  3TAM A;  4UQG A;  3NF7 A;  3V9Z A;  1ASW A;  3OYE A;  4C8K A;  3V9S A;  1LAV A;  2D0B A;  3O4N A;  1NJX A;  4DTU A;  4DU3 A;  4FJN A;  1ASV A;  4FK2 A;  5FRM A;  1C1B A;  4HUE A;  1RBU A;  4CK2 A;  3QIN A;  3OS1 A;  4ZTJ A;  1BGX T;  3KJV A;  2ZE2 A;  4W5R A;  4K8X A;  1DTT A;  3VQ4 A;  1FK9 A;  4H4O A;  1BIS A;  3B6P A;  4EP5 A;  3P1G A;  3AA5 X;  3K58 A;  1T03 A;  1J9A A;  1RT6 A;  3ZSZ A;  3NF8 A;  4CFB A;  2PYL A;  4B9M A;  4KB0 A;  4CJL A;  4I9Q A;  3MXM A;  4CFA A;  4FM0 A;  3AVH A;  3NGZ A;  5FRO A;  4J2B A;  4DSE A;  1TK0 A;  1NKE A;  4PWD A;  3AA2 A;  3VQQ A;  4FW1 A;  3EYZ A;  3V1R A;  1L5U A;  4DSJ A;  3V1Q A;  4E7J A;  3TAB A;  1TAU A;  3ZT0 A;  4CHO A;  3LP1 A;  1VSI A;  4OGE A;  1U45 A;  3HVR A;  2IS3 A;  2P51 A;  4W5Q A;  4E3S A;  3RR8 A;  3AA4 A;  4FW2 A;  2HB5 A;  2VG6 A;  3IG1 A;  1C1C A;  3AO5 A;  3WNF A;  3ZT3 A;  5C25 A;  1LWE A;  3OYN A;  4LH5 A;  3OJU A;  1IKV A;  4C8N A;  4KHQ A;  2P1J A;  1VRT A;  2OYQ A;  4BAC A;  4JS4 A;  3SUP A;  1XC9 A;  3AVJ A;  1RCH A;  2E4L A;  3SYZ A;  4NYN A;  4B08 A;  3CFP A;  4IFV A;  4CHY A;  5KRS A;  3V9U A;  3TAN A;  2XY6 A;  1IH7 A;  1L3S A;  5SWM A;  3LWL A;  4I7F A;  4I9L A;  4FZZ A;  4ELT A;  3C95 A;  4MQ3 A;  4DQS A;  1JLG A;  1S9G A;  3K59 A;  1NJY A;  2HHW A;  4FLW A;  2RN2 A;  3QLH A;  4CJ4 A;  2KZZ A;  1O1W A;  1W0H A;  4DWI A;  4M3T A;  3SV3 A;  2KFN A;  1KLN A;  4CJE A;  4FJL A;  3VQE A;  4OLB A;  2KFZ A;  4KHY A;  1Z26 A;  3ASM A;  3KLE A;  4FJ8 A;  2HHQ A;  2VG7 A;  4CEE A;  3CFR A;  4CGJ A;  4KI4 A;  4F2S A;  3LAK A;  1TL1 A;  2BAN A;  1G15 A;  1WSG A;  1QQC A;  3P83 D;  3VQ5 A;  1WSE A;  4CHN A;  4FJG A;  3S3N A;  1NK4 A;  1RDC A;  4O5B A;  2FBV A;  3ZT2 A;  3F73 A;  1NK8 A;  2DY4 A;  2B5J A;  4HCC A;  1RDA A;  2E6M A;  3DOL A;  3SCX A;  4HCB A;  1L3U A;  4QOZ B;  1HPZ A;  4CGD A;  5T7B A;  1JLA A;  3SQ4 A;  3U3Y A;  3WNG A;  4FLV A;  2D5R A;  2IOC A;  5EU7 A;  2X78 A;  1JL2 A;  2HVI A;  3OYI A;  4HTU A;  1ZYQ A;  3H08 A;  2PYJ A;  3OYL A;  4DLE A;  4CJQ A;  1T8E A;  2KTQ A;  4KTZ A;  3PO4 A;  3M8S A;  2HHS A;  4DFJ A;  3JSM A;  1RTH A;  3HP9 A;  3O3F A;  4GW6 A;  1NK9 A;  3CFO A;  4OLA A;  1LW0 A;  4CJ3 A;  4F2R A;  1RBT A;  4KHS A;  4FXD A;  1RNH A;  4OKK A;  3IAY A;  1BIU A;  1JXE A;  4ID5 A;  2YV0 X;  2YNH A;  4AH9 A;  4CEB A;  2KW4 A;  4HHT A;  4OPJ A;  2ITG A;  2KQ2 A;  5C24 A;  3MEE A;  4FJH A;  5I42 A;  3HPH A;  3VA3 A;  4CES A;  4FJJ A;  4DQP A;  3KLF A;  3KK3 A;  1NK5 A;  4DS5 A;  4M3U A;  1TV6 A;  4I2Q A;  3HL8 A;  4M42 A;  1SKW A;  2EHG A;  3QEI A;  1QSL A;  4ZHR A;  3DMJ A;  1VK0 A;  4AHS A;  2QKK A;  1RT4 A;  3QEW A;  3KD5 E;  4B3O A;  5JS1 A;  3U6F A;  3VQC A;  3L3V A;  1X1P A;  1RT5 A;  3CM5 A;  2Z1J A;  3QET A;  1RBR A;  2R7Y A;  1QTM A;  1SL1 A;  3VQ7 A;  3BGR A;  3KK1 A; 
#chains in the Genus database with same CATH topology
 3LAM A;  4NB4 A;  4BC4 A;  1VSL A;  3DRS A;  3V4I A;  4KH5 A;  4BRQ A;  1M1K O;  4C8L A;  4KI6 A;  3L2Q A;  3HOT A;  2HOE A;  3SMS A;  2HHT A;  1WSJ A;  4DR1 K;  4BRN A;  4KKO A;  1J5E K;  3SPY A;  4I6M B;  4Z4G A;  5BR8 K;  1VQO N;  3CHW A;  3NAE A;  4LSL A;  5C2F A;  5HOO A;  1VQ6 N;  4PQU A;  2P9K A;  1W97 L;  3O1B A;  5MLC Q;  4GV9 A;  3VGK A;  1R0A A;  1QQN A;  4CVN E;  4KTQ A;  3LP3 A;  4HUG A;  2XRI A;  4FJX A;  3G0Z A;  1DKG D;  1BL3 A;  1X9W A;  1L3T A;  4C8M A;  5AQJ A;  3ZT1 A;  1VSE A;  3HRG A;  4FPB A;  5K14 A;  3SQ0 A;  1CXU A;  1HMV A;  5KGW A;  2OAN A;  1TYQ A;  3K0S A;  4FJ5 A;  4OKJ A;  2YNI A;  1NGD A;  1S5J A;  4CHP A;  3EZ5 A;  1HKG A;  4A2B A;  1BQM A;  1XHX A;  1N32 K;  1C6V A;  2I5J A;  3GDQ A;  5BRE A;  3O80 A;  4JKH A;  1X9M A;  4DV3 K;  2OPP A;  4CJP A;  4Z4I A;  3ZCM A;  4DS4 A;  2VWJ A;  4H5R A;  5AQN A;  2RPI A;  3UKR A;  1QSS A;  4QS9 A;  4E1N A;  4H5W A;  1XHZ A;  3IUC A;  1WUA A;  1FW6 A;  1U48 A;  3VN5 A;  4JI0 K;  1Z05 A;  4GY2 B;  3LDS A;  3H3O B;  3LZI A;  1VSD A;  2O8E A;  5LJW A;  4JKD A;  1YT3 A;  1E3M A;  3VPZ A;  4NXN K;  1TKT A;  4NLC A;  1TK8 A;  5LMU K;  4L3Q A;  3NGY A;  3OVN A;  2HBM A;  2YJF A;  5HRP A;  1GLJ O;  1HNV A;  1RTJ A;  5HRO A;  3I56 N;  1NGJ A;  4WFB L;  1GLD G;  2Z1H A;  4DR6 K;  1UWB A;  1U2V A;  2F96 A;  3TI0 A;  1UA1 A;  1V4S A;  4CIE A;  2ZQB A;  2F7T A;  4X64 K;  4BR7 A;  1GLC G;  2YKM A;  3LDQ A;  3VTH A;  1WAF A;  1RBS A;  4QS7 A;  3CYM A;  2A40 A;  3VER A;  1NNE A;  1YVN A;  3AVN A;  1J5O A;  1N5Y A;  4CJS A;  2VG5 A;  3R3L A;  1IBL K;  4Z94 A;  1RTI A;  4R5P A;  3I8B A;  4DQR A;  1ZXO A;  3T19 A;  5F0X A;  3SPZ A;  5BR9 A;  1HRH A;  1YIT N;  2O8F B;  4BR4 A;  3AVM A;  2W42 A;  4G1Q A;  2Q0R A;  3OBW A;  1SKS A;  5C0Y A;  3QO9 A;  4XH1 A;  4DTN A;  5C42 A;  1NGA A;  4EIA A;  4OPA A;  3UKU A;  4M7Y A;  1ATN A;  3H3N O;  2UXB K;  3KLI A;  1LOT B;  4RTF D;  4BRG A;  3MEC A;  5BPM A;  3OA9 A;  1NJI O;  4ISF A;  2OPR A;  5J1E A;  1VQ5 N;  1LWC A;  3ZSW A;  1C0M A;  3OYA A;  5KGX A;  3I0R A;  3ZEU B;  1L3V A;  2DTU A;  4BC2 A;  3OYM A;  3RRH A;  4M41 A;  1XUP O;  4FCY A;  3AVK A;  1X9J A;  4LY7 A;  2ATQ A;  1KRP A;  3DXM A;  2I7N A;  1T3V A;  1Q7Y O;  3THW B;  4IKF A;  4KBO A;  3K57 A;  4OKE A;  1BCM A;  4FLX A;  5M1O A;  2D0O A;  1I39 A;  3MEG A;  3DI6 A;  2CGL A;  1NK7 A;  2OPS A;  4FSV A;  2P9L A;  2LSN A;  4JN4 A;  3HST B;  1IKW A;  1KSP A;  2E6L A;  4H4M A;  3HPO A;  1CXQ A;  4JK7 A;  1RDU A;  1S1V A;  4DTM A;  4X62 K;  3L2W A;  4KHP K;  1BCO A;  3PSF A;  3V6D A;  2IDO A;  4N76 A;  4KB1 A;  1Y64 A;  3O8M A;  1JLF A;  3TAG A;  2O4G A;  1U4B A;  3VQA A;  1WSH A;  2V52 B;  3FZF A;  2G8V A;  3L4I A;  3SQ1 A;  1A5W A;  5HRS A;  1LWF A;  4A59 A;  4QAG A;  1KVB A;  4BG8 A;  3S9H A;  4IG3 A;  4CEA A;  3U4L A;  2HBJ A;  1SL2 A;  4F3O A;  4CF0 A;  2RF2 A;  4FWQ A;  4JI1 K;  4RW6 A;  3KVG A;  3PX4 A;  2KKZ A;  4YFU A;  3F5T A;  4N47 A;  1FXX A;  2AJQ A;  2PZS A;  5KTQ A;  3SV4 A;  3SBT A;  3HPG A;  2D1K A;  1CLQ A;  2F8T A;  3RRG A;  2RKI A;  3DYA A;  5AZJ A;  1NMN A;  3D2E B;  4CHZ A;  4Q0B A;  2JWL A;  3HTV A;  1FKO A;  3E9O A;  2ZJP L;  1SKR A;  4JKG B;  3EL2 A;  5KRT A;  2G8U A;  2HHV A;  1UAX A;  4DQI A;  5CYM A;  4K43 A;  4AF1 A;  3NHG A;  3KIO A;  3D2F A;  4V19 S;  1JLB A;  3NVK A;  3PIP L;  2ZJR L;  1SS6 A;  3TAQ A;  2QXF A;  1ITG A;  4FZX C;  1CZB A;  1HYS A;  1OH7 A;  4IWV A;  4B1U B;  4BRP A;  4NCG A;  4O5F A;  1NOY A;  4LFB K;  3TTC A;  2ASM A;  4RW9 A;  4CJT A;  3CQY A;  3HOS A;  2Q3S A;  5AQI A;  5HP1 A;  5BRH A;  2VQE K;  4BRE A;  1K8A O;  3A5N C;  3VF2 A;  1HJO A;  3K9K A;  4B9Q A;  4WF9 L;  2A1S A;  4CIF A;  4UQG A;  3NF7 A;  4CD1 A;  4JHD A;  5ELZ A;  2PFU A;  2F9T A;  3O4N A;  4CZE A;  4DTU A;  4FJN A;  4HUE A;  4H0O A;  4K8X A;  3OS1 A;  1BGX T;  3KJV A;  2ZE2 A;  4MDB A;  2O8D A;  2FSJ A;  1TUU A;  5AQW A;  4EP5 A;  4FWS A;  3P1G A;  3K58 A;  1T03 A;  1VQL N;  3NF8 A;  3MXM A;  4CFA A;  5H1S Q;  1K8K A;  5FRO A;  4H5N A;  3G6E N;  4DSE A;  3NVM A;  2F4V K;  4FW1 A;  3ENH A;  3V1R A;  3EYZ A;  3V1Q A;  4B1Y B;  4IXC A;  2P9I B;  1U45 A;  4OGE A;  2P51 A;  1U6Z A;  2GWJ A;  3ZT3 A;  3WNF A;  4FOE A;  4LF4 K;  1N34 K;  2VYP A;  3WEE A;  2UUC K;  3MDQ A;  4KHQ A;  3ZX3 A;  3CJA A;  1VQP N;  4YDU A;  3SYZ A;  4HWI A;  1K73 O;  3TAN A;  1L3S A;  3TSQ A;  3KWI A;  4ELT A;  3C95 A;  2WFB A;  1NJY A;  2FSN A;  3SAH A;  4EHT A;  2KZZ A;  1O1W A;  1W0H A;  3N4Q A;  2Q97 A;  4JAX A;  4DWI A;  4FJL A;  4OLB A;  4KHY A;  3ASM A;  4JKB A;  4CGJ A;  2QWP A;  1TL1 A;  3P83 D;  1QQC A;  1NK8 A;  3F73 A;  3H6E A;  4HCB A;  1L3U A;  1OH6 A;  3FFK B;  2IIR A;  5A2Q O;  1ZYQ A;  3FZK A;  3OYL A;  4DLE A;  2KTQ A;  4Y0W A;  2CGK A;  4KTZ A;  2HHS A;  4DFJ A;  5KPT A;  5KQD A;  4IJN A;  4CBU A;  3O9S A;  4F2R A;  1RNH A;  3DWL A;  1BIU A;  1NM1 A;  4JK8 A;  5FLX O;  4U7B A;  1HKC A;  3ATV A;  1R59 O;  3HI0 A;  3AAP A;  2KW4 A;  2A6A A;  3ULE B;  1D4X A;  1KAY A;  1XNR K;  5C24 A;  5AJ3 K;  3VA3 A;  3HSC A;  3KLF A;  3KK3 A;  3W3D A;  4DS5 A;  4BRD A;  3CME N;  3HL8 A;  1SKW A;  4A5B A;  4ZHR A;  1JCG A;  4ISE A;  1VK0 A;  1BA1 A;  1RT4 A;  1IBM K;  4CZM A;  4IEI A;  3U6F A;  5JS1 A;  3VEX A;  2R7Y A;  1QTM A;  2PBD A;  4CJK A;  1ZBH A;  1REV A;  4OVL A;  4KHW A;  1ZC6 A;  2YNG A;  5HRN A;  3J7A P;  2VWK A;  3LAN A;  3M8P A;  5GAE P;  4PHT X;  2VCP A;  1BUP A;  4CE9 A;  4PKI A;  4DTX A;  1UA0 A;  1VRU A;  4FWL A;  2HHU A;  3BUZ B;  3OYB A;  5HL7 L;  1TUY A;  3WXM B;  3C0B A;  3IFR A;  5BRF A;  4BRF A;  4I6M A;  4ICL A;  5E41 A;  3CCE N;  3N4P A;  3L8B A;  3H1Q A;  1N6Q A;  3QNN A;  4CK1 A;  4DR7 K;  4DFK A;  1S9E A;  4X65 K;  1TK5 A;  3O4Q A;  1BI4 B;  4FWK A;  4DSF A;  4AHU A;  2D4W A;  5ADX A;  4DV5 K;  2V7Y A;  3Q7B A;  4EZ6 A;  1Q86 O;  2E1Z A;  3OYC A;  3RMB A;  2Q2R A;  3HK2 A;  4QCL A;  3J80 O;  3THY B;  1N33 K;  3C6U A;  1S3X A;  4MO5 A;  4BE1 A;  3WXJ A;  2ZGY A;  3O9Q A;  2O8C B;  4Z4H A;  4B9U A;  4KRF A;  4O8K A;  1SUQ A;  1D8Y A;  4IDK A;  1WB9 A;  1A5X A;  1EP4 A;  3EKU A;  3AV9 A;  1JLQ A;  1S22 A;  3DRR A;  3O5B A;  2VQF K;  4DV0 K;  4PKG A;  3SJJ A;  4BRO A;  4DTS A;  2YHA A;  5AQY A;  1IKX A;  4DF8 A;  1WOQ A;  3CPE A;  4CER A;  4OPK A;  4UY8 O;  4FM1 A;  3K5L A;  2HND A;  4M3R A;  3EY1 A;  3NH2 A;  3UE5 A;  4FJI A;  3I8D A;  3FLC O;  2Q36 A;  5C10 A;  1D9F A;  4DUY K;  4FL9 A;  1HNI A;  5E26 A;  3M8Q A;  2Z1G A;  3AO4 A;  3VGM A;  2GEL A;  4CZH A;  3WXL A;  4KV8 A;  3VET A;  3EO3 A;  3LM9 A;  1N8R O;  1NBW A;  4CED A;  3OYH A;  3QDK A;  4LH4 A;  1DGK N;  4N5S A;  4DTP A;  2FF6 A;  4LF9 K;  1YVU A;  3AY9 A;  4FWN A;  2AA4 A;  2D0A A;  1DTQ A;  3A5L C;  4ELU A;  3THX B;  2NNW A;  3IS9 A;  4Z4F A;  2D0P A;  4K25 A;  1LV5 A;  3LDN A;  1X9S A;  4G9Z A;  4FPA A;  4B1W B;  3QNO A;  2NRV A;  2ASP A;  3DM2 A;  2FBT A;  3HYF A;  3SQ2 A;  4O0J A;  3IMX A;  4HTL A;  1EO1 A;  1BO5 O;  4W5T A;  4DHY A;  3DRP A;  1H1V A;  1O13 A;  2XY7 A;  3SI6 A;  2YHB A;  4FYD A;  3VEW A;  3G71 N;  3CJ9 A;  4MFB A;  3CCR N;  2O8F A;  3C7N B;  3BZK A;  3QEX A;  4AHR A;  3NH1 A;  5GAG P;  3OS2 A;  2E2P A;  4XIU A;  5JLF A;  4YOU A;  3VEO A;  3OJS A;  2A41 A;  2FSK A;  3MN7 A;  3DLH A;  1BG3 A;  3A8Y A;  2WUS A;  3LDO A;  1T05 A;  1NGB A;  1QQM A;  3VQ9 A;  4CJ5 A;  3ZEU A;  1F21 A;  1NU0 A;  1G99 A;  3AGK A;  4JKE A;  5JS2 A;  3OYK A;  4FZY A;  3E66 A;  3R1X A;  5CYQ A;  1J53 A;  2IGI A;  2CGJ A;  1OVQ A;  3O3G A;  3THW A;  4A61 A;  4FJM A;  1TL3 A;  5HLF A;  4IZ9 A;  1I94 K;  5GIP A;  4OO1 J;  1P8Z A;  4LF7 K;  2AP1 A;  4FK0 A;  5AQG A;  5M1F A;  2D0C A;  4Z0U A;  1NKB A;  2A42 A;  4EZ9 A;  4LD0 A;  2NRW A;  3OYF A;  3ZSV A;  3AVF A;  3O9T A;  4K41 A;  5AQX A;  5B8H A;  1QHT A;  4O0I A;  1JLC A;  2JGU A;  2GWK A;  3AVB A;  3S41 A;  2OZS A;  1SL0 A;  4CJU A;  4C1N K;  2P5G A;  4IG0 A;  4FLZ A;  4M7X A;  4WE1 A;  4BG9 A;  3FFI A;  4M3W A;  2FBX A;  1BQN A;  1VSJ A;  4JNE A;  4CEC A;  4B9V A;  4AIL C;  5BN9 A;  3R6M A;  1E4G T;  2W6K A;  3AO3 A;  3VEN A;  4KRE A;  4GVM A;  2WON A;  2EX3 A;  3C6A A;  4OJR A;  4IOA L;  5DK5 A;  3NH0 A;  2HF4 A;  2E2Q A;  2NRZ A;  4DR4 K;  4XEI A;  3ISN C;  4Z4E A;  3IDH A;  3MX2 A;  3MWT A;  4F8R A;  4YNQ A;  5ADX H;  3VF4 A;  5HRR A;  2YNF A;  3S3O A;  4BC3 A;  3M8R A;  4YOR A;  4H8K A;  2DFF A;  1DLO A;  1S6Q A;  3BEX A;  4CIG A;  1VQ9 N;  3AVI A;  4IFE A;  4JKC A;  1NWK A;  3ZSY A;  4LF8 K;  1SZ2 A;  1Y97 A;  3D2E A;  4N56 A;  3O1W A;  4CHQ A;  3JS6 A;  5BPN A;  1ASU A;  2NRR A;  4EHU A;  4DR3 K;  1BHL A;  3MCP A;  3AO1 A;  3BDP A;  2PAV A;  4MO4 A;  1NJZ A;  2IVO A;  1EET A;  1WBB A;  3QB0 A;  2BGG A;  4AM6 A;  4JKA A;  2HMI A;  1VHX A;  3T7Z A;  3MX5 A;  5BN8 A;  4BRA A;  3CET A;  1WAJ A;  3HT3 A;  4DFP A;  1T6D A;  4M3Y A;  3QML A;  2Z1I A;  3HZ6 A;  3SLC A;  3DLK A;  3GBT A;  2G8K A;  4Y1D A;  2VWB A;  2OPQ A;  1HPM A;  3OS0 A;  5D3G A;  2B6A A;  3I0S A;  2QW9 A;  1NG9 A;  1EXQ A;  2NZT A;  3GG4 A;  2ETJ A;  3E1Y A;  5J2M A;  3OYE A;  4OPH A;  1LAV A;  4DU3 A;  1ASV A;  1BA0 A;  2HST A;  2W41 A;  3QIN A;  1W7A A;  3F2K A;  3VQ4 A;  1FK9 A;  3C65 A;  4PL7 A;  2P9K B;  3B6P A;  4ISG A;  3AA5 X;  2BH1 A;  1J9A A;  1RT6 A;  2PYL A;  4KB0 A;  5FPM A;  4CJL A;  4FM0 A;  3WQU A;  1WBD A;  3CCL N;  3AVH A;  1TK0 A;  4PWD A;  4H5V A;  4DSJ A;  3SAG A;  2QWN A;  3O4W A;  4WQ5 C;  2P9I A;  2QWM A;  3T69 A;  3HVR A;  4E3S A;  4FW2 A;  2HB5 A;  5AQM A;  3OYN A;  1IKV A;  2P9S A;  4ILH A;  4DUZ K;  4BAC A;  1XC9 A;  1XNQ K;  3AVJ A;  2E4L A;  5AQV A;  1Q82 O;  1HR0 K;  2XY6 A;  1IH7 A;  3LWL A;  3NMU A;  5JVH L;  4FZZ A;  1EWR A;  2E2N A;  3K59 A;  2HHW A;  1YAG A;  4M3T A;  1KD1 O;  4GV6 A;  4BVP A;  3KLE A;  2HHQ A;  2VG7 A;  4BR2 A;  5GAH P;  3LAK A;  4NO7 A;  3VQ5 A;  1G15 A;  1EWQ A;  5AQR A;  4FJG A;  1RDC A;  2FBV A;  3ZT2 A;  2DY4 A;  1QQO A;  4U67 L;  4HCC A;  2E6M A;  4GKJ K;  3CJ1 A;  1ZBS A;  4M63 C;  3SQ4 A;  3WNG A;  4IOC L;  5IT9 O;  3OW2 M;  4FLV A;  2D5R A;  2HVI A;  3CXC M;  1GLA G;  3OYI A;  4OX9 K;  3H08 A;  4BRK A;  3OHR A;  5F2R A;  1HX1 A;  3R9P A;  4PL8 A;  1RTH A;  4GW6 A;  1NK9 A;  3CFO A;  5BRD A;  1LW0 A;  4KHS A;  4H5T A;  3IAY A;  1JXE A;  3CD6 N;  1HUX A;  1YIJ N;  3SBG A;  4A2A A;  5CE3 A;  1BU6 O;  4HHT A;  4OPJ A;  4DCH A;  2I7P A;  2KQ2 A;  2EWS A;  3MEE A;  5I42 A;  4CES A;  2NRX A;  2P9U B;  1TV6 A;  4I2Q A;  3DLL L;  4CZI A;  5C2D A;  2QKK A;  3QEW A;  4MLE A;  2NLX A;  1X1P A;  1BOT O;  3WXK A;  1SL1 A;  3BGR A;  3OYD A;  2QTD A;  1CZ9 A;  4FK4 A;  2YHX A;  5EOY A;  4DQQ A;  2UU9 K;  4CJR A;  2V7Z A;  3VQ6 A;  1GLF O;  1IG9 A;  1NGC A;  4FWO A;  3CC4 N;  3HBT A;  2HF3 A;  5EXW A;  3V1O A;  1Z6R A;  2FBY A;  3TU5 A;  4GMJ B;  3EEQ A;  1LAW A;  2ZGZ A;  4DSL A;  4DKW A;  3K5O A;  1BI4 A;  4JKF A;  4CGG A;  1HKB A;  4A62 A;  3ZET B;  5AQK A;  4YOY A;  1JKH A;  2BDP A;  4DSK A;  2QXL A;  3D45 A;  1RDW X;  3B6O A;  1NJW A;  4CJW A;  2HHH K;  3CCS N;  4FO0 A;  3P39 A;  1YHQ N;  2IAJ A;  1JCF A;  2WBN A;  3ZYY X;  3HVT A;  1YF5 L;  3A2F A;  5JMV A;  5AZI B;  2JLE A;  4GNI A;  5KPZ A;  2O8C A;  3EE9 A;  1U47 A;  2P9L B;  1RDD A;  2XY5 A;  5GIN A;  2GV9 A;  4JYA K;  1ZBF A;  1FKP A;  4O4G A;  2V51 B;  2ZF5 O;  3OY9 A;  2UUB K;  4BE2 A;  3UB5 A;  1W2B M;  3CC2 N;  1FJG K;  1QZ5 A;  5AQS A;  3EZW A;  3TWH A;  3B8A X;  2PY5 A;  5HBM A;  1MDU B;  3A5M C;  4PKH A;  1QS4 A;  2CH6 A;  1S1U A;  2RHK A;  4BR0 A;  1EKE A;  4AHV A;  4KO0 A;  4RCH A;  2FC0 A;  2NUB A;  1OVY A;  3P5J A;  3ZX0 A;  4GKK K;  1WLJ A;  3NBP A;  3MED A;  3RMC A;  4FWM A;  1JJ2 M;  3DLR A;  3JAM O;  1IKY A;  4H0T B;  5J2N A;  4WQ5 A;  4IEE A;  1VSH A;  5CZ1 A;  4JV5 K;  1TGO A;  4CF2 A;  4CEO A;  3LPU A;  3P31 A;  4DFM A;  3GL1 A;  2GBZ A;  3SUO A;  3FZH A;  2H3G X;  4KHU A;  3J7Y P;  3VQ8 A;  4K8Z A;  3THX A;  4J2A A;  3VOV A;  3AGR A;  4B8A B;  1RT2 A;  3SUN A;  4F4K A;  5EX5 A;  4YY3 K;  3V9X A;  3DXK B;  1GOA A;  1QVF M;  3QES A;  2XO7 A;  4E7L A;  4KH4 A;  2QWQ A;  1MWK A;  3NE6 A;  3U9Z A;  4RW7 A;  4FVU A;  3AVL A;  3SNN A;  4Q5V A;  3RSE B;  3PY8 A;  1ATS A;  2FLO A;  3EN9 A;  3CC7 N;  4B3R K;  1C0F A;  3KTQ A;  1ZBI A;  2QEX N;  2O8B B;  4H03 B;  4KHN A;  3L6Q A;  4Y1C A;  1NK6 A;  4IBN A;  3C7N A;  2Y1J A;  5AQL A;  1GLB G;  5AR0 A;  4BGA A;  4OGC A;  4O55 A;  4NLB A;  1I3A A;  4FJK A;  1ZBU A;  1SQK A;  4KPY A;  1YXQ A;  1GLL O;  2NRH A;  3RWU A;  3ID8 A;  3LDL A;  4J8F A;  3LWM A;  3T1H K;  4QS8 A;  1YTU A;  3AVC A;  4JRQ A;  3ZSO A;  4CF8 A;  4JI2 K;  3KK2 A;  4JEP A;  1JCE A;  4PA1 A;  3VEZ A;  3KKS A;  1IBK K;  4CJF A;  4JHD B;  2HMP A;  4IJA A;  1JXB A;  1KCF A;  3T1Y K;  4IFY A;  4YOW A;  1VQ8 N;  2ZJQ L;  1CZA N;  3TTF A;  4DV7 K;  3R8E A;  3RTV A;  4E7I A;  5JVG L;  3FR0 A;  3ENO A;  3MMV A;  3HM8 A;  3VA0 A;  2YI1 A;  4DTO A;  5GIO A;  4CEQ A;  3K5M A;  3C94 A;  2Y1I A;  3D7E O;  3TAP A;  1VSF A;  4ILJ A;  4EAH D;  3LP2 A;  4F9O A;  3JYT A;  3P38 A;  5KPR A;  3V9W A;  1GOB A;  3L2U A;  3PSI A;  5AFU A;  4BRL A;  2ITM A;  3NF9 A;  3DLE A;  4B8C A;  1IO2 A;  2YX6 A;  1NGH A;  1VSK A;  1Q18 A;  4BY9 C;  2XHB A;  4NYF A;  2HNZ A;  2ZD1 A;  1OH5 A;  2G8W A;  4N41 A;  3OYG A;  3V81 A;  4A57 A;  4ELV A;  4B9T A;  4DLG A;  5AQT A;  5DM6 L;  5SZT A;  2GX9 A;  2HNY A;  2OTJ N;  4M45 A;  4LC9 B;  3DLB A;  3NF6 A;  2GEM A;  4RG8 A;  4DR5 K;  1HJR A;  1DEJ A;  2P5O A;  3CJB A;  1NK0 A;  5M1K A;  1X3M A;  3L2R A;  4CGI A;  4CJV A;  3CQ8 A;  5DM7 L;  2FXU A;  3O08 A;  1Q8I A;  1QHA A;  4C8O A;  3MN9 A;  5LJV A;  2JWK A;  4BVO A;  1W9H A;  5EY4 A;  1U04 A;  5AQQ A;  4FWR A;  1NMD A;  1WN7 A;  2UXD K;  5LMN K;  1A5V A;  2DFE A;  4TSX A;  2W6L A;  4YOT A;  3K5N A;  3IKM A;  4FLU A;  5FPD A;  4O44 A;  3D0P A;  4B3M K;  1RBV A;  4FM2 A;  3AA3 A;  1EQY A;  3MN6 A;  4JD2 B;  3WUH A;  3H1V X;  3ATU A;  4LSN A;  1KFS A;  4X66 K;  2OCE A;  5TKW A;  3VES A;  3G10 A;  1TVR A;  3SUQ A;  1IV0 A;  4MDA A;  2OZM A;  1WNS A;  3EE8 A;  4DV4 K;  1XMQ K;  1MU2 A;  3CER A;  3LL3 A;  4CD3 A;  3QIO A;  4BQZ A;  1HNW K;  3CG7 A;  5FDL A;  1VSM A;  3OYJ A;  3TAM A;  4C8K A;  2D0B A;  1NJX A;  3ZLJ A;  1XQS C;  4FK2 A;  4CJ7 A;  5FRM A;  2NRT A;  1RBU A;  4CK2 A;  2ZM6 K;  4ZTJ A;  1ATR A;  3QFU A;  4W5R A;  2YJE A;  3FGU A;  3J8A A;  3BP8 A;  3C6H A;  3ZSZ A;  2P9N B;  4CFB A;  1ESV A;  4I9Q A;  4MLH A;  3NGZ A;  3GOI A;  4J2B A;  5AQH A;  3AA2 A;  3VQQ A;  1L5U A;  3TAB A;  1TAU A;  3ZT0 A;  2E8A A;  3LP1 A;  2WTU A;  2IS3 A;  4W5Q A;  3AA4 A;  5GAD P;  2VG6 A;  5C25 A;  1DT9 A;  4LH5 A;  4IOX A;  4C8N A;  2P1J A;  1VRT A;  3SUP A;  4B08 A;  3V9U A;  4IFV A;  4CHY A;  4BR9 A;  1LCU A;  3K9J A;  4I9L A;  1JLG A;  1S9G A;  2Q0U A;  3QLH A;  4LFC K;  3KHY A;  2KFN A;  1KLN A;  4H0X B;  1E4F T;  4FJ8 A;  4JI6 K;  3A5O C;  4CEE A;  2YCH A;  4AM7 A;  3CFR A;  4KI4 A;  3D6R A;  5IWA K;  4F2S A;  1WSG A;  4CHN A;  5E84 A;  1WSE A;  3CCJ N;  3S3N A;  1YUW A;  1KC8 O;  3E9P A;  4O5B A;  3O9R A;  3TPQ A;  2P9P B;  3DOL A;  5F1X A;  4CGD A;  4JK9 A;  3BF3 A;  3G25 A;  4AQY K;  2IOC A;  5EU7 A;  1JL2 A;  4B1Z A;  5BPL A;  4LFA K;  4CBW A;  1VQ7 N;  1T8E A;  3QBW A;  3M8S A;  3JSM A;  1NGF A;  2HBL A;  4FXD A;  4JKG A;  1ILY A;  4JI5 K;  5EVZ A;  2F9W A;  4YOX A;  2YNH A;  4AH9 A;  4CEB A;  2QI2 A;  1RFQ A;  4FJH A;  4FJJ A;  4H0P A;  4DQP A;  2P9U A;  3ID6 A;  3F9M A;  4BRM A;  2QA4 N;  2EHG A;  3QEI A;  1QSL A;  2J4R A;  4AHS A;  3OTO K;  3VQC A;  3L3V A;  2CH5 A;  5AQU A;  4B1X B;  2BTF A;  2Z1J A;  4BDP A;  3VQ7 A;  3RVC A;  5AFU H;  2GTD A;  3KK1 A;  1LW2 A;  3M5R A;  2HHX A;  1RT1 A;  2O4I A;  4DU1 A;  4FJ7 A;  3HM9 A;  3T1A A;  2BUP A;  1VAZ A;  1QZ6 A;  1UOC A;  4RW4 A;  3ITH A;  4FLY A;  4E0D A;  4FJ9 A;  1MA9 B;  4CEF A;  1S1X A;  5CZ2 A;  1ZBL A;  3PX0 A;  4DV6 K;  3FE1 A;  4DTR A;  3ULD A;  3CCM N;  4YDU C;  3VQD A;  1RDB A;  3SJH A;  4WFA L;  4RWT A;  1VQN N;  2X6N A;  3WNH A;  1KVC A;  1YTA A;  4B9L A;  3L4Q A;  4DU4 A;  5LY3 A;  4CFC A;  5CR4 A;  3U8X A;  3ZET A;  1KAX A;  4R79 A;  3E01 A;  1Q9Y A;  4I2P A;  2FF3 B;  4AHC A;  3O9U A;  3HJF A;  5KI6 A;  3PO5 A;  1XWL A;  3CMA N;  4HUF A;  3AVG A;  2X6S A;  4CZJ A;  1RT3 A;  3IRX A;  4CEZ A;  3L3U A;  3KWG A;  5TKY A;  2BE2 A;  3KLG A;  3HP6 A;  3TAR A;  3H46 O;  3LAL A;  2QKB A;  1K9M O;  3VQP A;  4DV2 K;  4BDZ A;  4PUO A;  1TYQ B;  2KZM A;  3SAF A;  5AZI A;  4ZTF A;  4WQ4 C;  4CF1 A;  1C0G A;  1WSI A;  3LPT A;  1VQ4 N;  4DTJ A;  1U49 A;  3RR7 A;  3DJC A;  5KQ8 A;  2UXC K;  4W5O A;  1NOZ A;  1JL1 A;  5CHI A;  1QSY A;  1WSF A;  3LDP A;  2E2O A;  1BIZ A;  5C15 A;  3ZSR A;  1RT7 A;  3DOK A;  3O3H A;  3QER A;  3CCQ N;  3UKR B;  5J2P A;  4BC5 A;  3CCV N;  4BRH A;  4DV1 K;  1GLE G;  1TKD A;  1NGE A;  3PUF A;  3CCU N;  3ENB A;  3JXU A;  3VQB A;  3VMF B;  1S6P A;  3CIP A;  1N36 K;  2O8E B;  2B4J A;  1TKZ A;  1Z25 A;  1J6Z A;  1HLU A;  3TSU A;  1EX4 A;  1RTD A;  4CGH A;  3U3G A;  4ILG B;  4Z4C A;  4JRP A;  3SMP A;  4PY5 A;  4DG1 A;  4DMN A;  4JLH A;  3AO2 A;  5FPN A;  1QE1 A;  5JIC A;  3F9K A;  1C1A A;  2HW3 A;  3BF1 A;  3ULE A;  1U2V B;  4JI4 K;  3TTD A;  4IDH A;  3TR8 A;  4B1V A;  5M1P A;  3FZL A;  5I3U A;  4CF9 A;  3HO1 A;  1TKX A;  2IC3 A;  3ZSX A;  3J81 O;  3KZB A;  4BR5 A;  3DXK A;  3RMD A;  3LZJ A;  3NGI A;  1HNZ K;  4AHT A;  3PV8 A;  1YJW N;  1IJJ A;  2A1R A;  1TAQ A;  3CJ7 A;  3NFA A;  3WXI A;  3ZT4 A;  4CFD A;  2OA8 A;  4IO9 L;  4KFB A;  3RSE A;  3KK7 A;  4ID1 A;  4CZF A;  2O8B A;  4BDY A;  2YHY A;  3LP0 A;  2F8S A;  3T3F A;  3CM6 A;  3ZSQ A;  1MWM A;  3E9L A;  4H0V B;  4F3T A;  3VF6 A;  3I55 N;  3QBX A;  2YHW A;  3TAF A;  1JLE A;  3UKU B;  1XC3 A;  2YKN A;  4E7H A;  1NLV A;  1C0T A;  3PX6 A;  2DPN A;  3KLH A;  3M6G A;  1KLM A;  4EFH A;  4B9S A;  5FRN A;  2KFZ A;  5AQP A;  3L2V A;  3VEY A;  3P4I A;  4DR2 K;  1VQM N;  1BDG A;  3BZC A;  4CZG A;  3W0L A;  3MK6 A;  4BGB A;  3VTI A;  3CQX A;  3WT0 A;  3QEV A;  3DXM B;  3OBY A;  3MAQ A;  3FZM A;  1KQS M;  2QK9 A;  3WQT A;  1KFD A;  3MXJ A;  3THY A;  4LF5 K;  5C12 A;  4KAZ A;  4W5N A;  1VQK N;  4DQ8 A;  1KVA A;  3TSP A;  3LM2 A;  4BE0 A;  1BWF O;  4DSI A;  1KTQ A;  2KLA A;  1J54 A;  4YHH K;  3UIQ A;  3VGL A;  4IO8 A;  1YJ9 N;  3EKS A;  1Q9X A;  2GUI A;  1B9D A;  3C6T A;  1KXP A;  4XH5 A;  1NGG A;  4J2D A;  1YI2 N;  3PIO L;  1NKC A;  1K6Y A;  2P9S B;  1NGI A;  3NDK A;  2E1Y A;  3M1F A;  3RMA A;  4BWM A;  4E7K A;  1S1W A;  1M90 O;  4M3Z A;  3QIC A;  3HXM A;  1T44 A;  3AAR A;  4CCH A;  5AQZ A;  2DFH A;  4L8R B;  1S1T A;  5DMR A;  5CY4 A;  3THV A;  3SZ2 A;  4KH6 A;  2KHO A;  2WOM A;  1SAZ A;  3CPW M;  2ZWH A;  1C0U A;  4NCA A;  3MN5 A;  3SK3 A;  1T7P A;  2G8F A;  4E19 A;  3QEP A;  2X74 A;  1IG8 A;  4NCB A;  4WFN L;  3QIP A;  4O8U A;  1OH8 A;  3WNE A;  1HQU A;  1S72 N;  4JS5 A;  2W40 A;  4WQ4 A;  4EP4 A;  3NCI A;  5AZJ B;  4E89 A;  4BRC A;  3DLG A;  3BY5 A;  2G8I A;  1HYV A;  4FVM A;  1D5A A;  2G8H A;  3QFP A;  1B9F A;  4B3T K;  4B3S K;  4BWJ A;  1OKJ A;  2A3Z A;  5LL6 Z;  2E20 A;  3D2F B;  3KKR A;  4M3X A;  1RIL A;  4CK3 A;  1HYZ A;  4CZL A;  4HVJ A;  4C1N I;  4FOI A;  4DB3 A;  1GOC A;  3MXI A;  1YJN N;  1HQE A;  5JLH A;  4DF4 A;  4JD2 A;  4CGF A;  4KTW A;  4GV3 A;  3S3M A;  2A5X A;  4E1M A;  5J2Q A;  1D9D A;  3KD1 E;  4FLT A;  1P90 A;  3TAE A;  1B92 A;  2HVH A;  1XI1 A;  1SV5 A;  3VEV A;  3K2P A;  2IVP A;  2XY8 A;  3G4S N;  4B9N A;  4J2E A;  4WCE L;  4RW8 A;  2OTL N;  2RE2 A;  3AVA A;  4K0K K;  3ALY A;  3PLA A;  3CJC A;  3J7Z O;  3V9Z A;  1ASW A;  3H45 C;  4CI6 A;  3V9S A;  3O6W A;  4LF6 K;  1C1B A;  5AQO A;  4A5A A;  2IVN A;  3CF5 L;  1QVG M;  3GE1 A;  1DTT A;  4H4O A;  1BIS A;  2O8D B;  3CI5 A;  2E5L K;  4XH4 A;  4B9M A;  2P9N A;  4JI8 K;  5I9E B;  4JI3 K;  4BQL A;  2WC9 A;  3I33 A;  1K8K B;  3L0Q A;  4CZK A;  1NKE A;  2QWO A;  2GUP A;  2VGM A;  4E7J A;  4CHO A;  2Q31 A;  1VSI A;  1XMO K;  4CBX A;  3RR8 A;  2QWR A;  3IG1 A;  4WYB A;  1C1C A;  3AO5 A;  1LWE A;  4NXM K;  3OJU A;  3WEE B;  1KAZ A;  2OYQ A;  5AQF A;  3M3Z A;  4JS4 A;  1RCH A;  4NYN A;  2E88 A;  3CFP A;  5KRS A;  5SWM A;  4I7F A;  4FWP A;  4MQ3 A;  3Q7C A;  4DQS A;  4E1J A;  4YOV A;  4FLW A;  3U9D A;  2RN2 A;  4CJ4 A;  4H0Y B;  4C23 A;  3SV3 A;  4CJE A;  3VQE A;  1Z26 A;  4JI7 K;  5M1Q A;  2VGN A;  2BAN A;  5FPE A;  4BRI A;  2QWL A;  3DAW A;  1NK4 A;  3MCA B;  2QM1 A;  2P9P A;  2B5J A;  2UYT A;  4K42 A;  1RDA A;  3A0I X;  3SCX A;  3AAQ A;  1Q81 O;  4QOZ B;  1HPZ A;  5T7B A;  1JLA A;  3U3Y A;  3MWP A;  3ZX2 A;  2X78 A;  4HTU A;  2PYJ A;  4CJQ A;  3PO4 A;  3HP9 A;  3O3F A;  2UUA K;  4OLA A;  4CW7 B;  4CJ3 A;  1RBT A;  5M1N A;  4OKK A;  1T6C A;  4ID5 A;  4GVE A;  1HNX K;  2YV0 X;  1RGI A;  2ITG A;  1X3N A;  2HBK A;  3HPH A;  1V4T A;  1NK5 A;  4M3U A;  4M42 A;  3DMJ A;  3KD5 E;  4B3O A;  1RT5 A;  3CM5 A;  2Q1N A;  3QET A;  1RBR A;  2ASO A; 
#chains in the Genus database with same CATH homology
 4CJK A;  1ZBH A;  1LW2 A;  1REV A;  3LAM A;  3OYD A;  4OVL A;  1CZ9 A;  4KHW A;  4FK4 A;  1VSL A;  2HHX A;  4DQQ A;  1RT1 A;  2YNG A;  3DRS A;  5HRN A;  4DU1 A;  3HM9 A;  4FJ7 A;  2VWK A;  3LAN A;  3M8P A;  3V4I A;  3T1A A;  4FLY A;  1UOC A;  4RW4 A;  3ITH A;  4CJR A;  4E0D A;  4CE9 A;  4DTX A;  1UA0 A;  4C8L A;  4FJ9 A;  4KI6 A;  3VQ6 A;  3L2Q A;  1IG9 A;  1VRU A;  2HHU A;  4CEF A;  1S1X A;  3OYB A;  5CZ2 A;  1ZBL A;  3PX0 A;  2HHT A;  1WSJ A;  4DTR A;  3ULD A;  3V1O A;  4KKO A;  4ICL A;  3SPY A;  5E41 A;  4Z4G A;  3VQD A;  2FBY A;  1RDB A;  3L8B A;  4GMJ B;  1N6Q A;  2X6N A;  4LSL A;  3WNH A;  4CK1 A;  3NAE A;  3QNN A;  1KVC A;  1LAW A;  1YTA A;  4B9L A;  4DSL A;  4DFK A;  4DU4 A;  1S9E A;  1TK5 A;  4CFC A;  3K5O A;  4PQU A;  1BI4 A;  3O4Q A;  4CGG A;  1BI4 B;  4DSF A;  4AHU A;  1R0A A;  3E01 A;  1Q9Y A;  4I2P A;  4KTQ A;  4AHC A;  3LP3 A;  4HUG A;  2XRI A;  4FJX A;  3G0Z A;  3HJF A;  4EZ6 A;  5KI6 A;  1JKH A;  1BL3 A;  3PO5 A;  1XWL A;  1X9W A;  4HUF A;  3AVG A;  2BDP A;  2X6S A;  4DSK A;  1RT3 A;  3D45 A;  3OYC A;  3IRX A;  4CEZ A;  3RMB A;  3B6O A;  1NJW A;  4CJW A;  3HK2 A;  1L3T A;  3L3U A;  4C8M A;  3ZT1 A;  2BE2 A;  3KLG A;  3HP6 A;  3TAR A;  1VSE A;  3LAL A;  5K14 A;  2QKB A;  4QCL A;  3SQ0 A;  2IAJ A;  1CXU A;  1HMV A;  3C6U A;  5KGW A;  3VQP A;  3HVT A;  4BDZ A;  3A2F A;  4PUO A;  4B9U A;  2KZM A;  4BE1 A;  4FJ5 A;  4OKJ A;  4ZTF A;  4CF1 A;  2JLE A;  1WSI A;  3LPT A;  2YNI A;  1U47 A;  1S5J A;  4CHP A;  4Z4H A;  4DTJ A;  1U49 A;  3RR7 A;  1RDD A;  1SUQ A;  3EZ5 A;  2GV9 A;  4IDK A;  2XY5 A;  1D8Y A;  1ZBF A;  1FKP A;  1A5X A;  1EP4 A;  1BQM A;  4O4G A;  3AV9 A;  1XHX A;  4W5O A;  1C6V A;  1JLQ A;  1NOZ A;  3DRR A;  3OY9 A;  2I5J A;  4BE2 A;  1JL1 A;  1QSY A;  1X9M A;  1WSF A;  2OPP A;  3SJJ A;  4CJP A;  4Z4I A;  3ZCM A;  2YHA A;  4DTS A;  1BIZ A;  4DS4 A;  2VWJ A;  3ZSR A;  1IKX A;  4DF8 A;  1RT7 A;  2RPI A;  3DOK A;  3O3H A;  3QER A;  1QSS A;  5J2P A;  4E1N A;  4CER A;  3TWH A;  1XHZ A;  4OPK A;  2PY5 A;  1TKD A;  1U48 A;  3VN5 A;  3PUF A;  5HBM A;  3LDS A;  4FM1 A;  3VQB A;  3K5L A;  2HND A;  3LZI A;  1S6P A;  1VSD A;  1QS4 A;  2B4J A;  1S1U A;  4M3R A;  3EY1 A;  1TKZ A;  1YT3 A;  3NH2 A;  1Z25 A;  4FJI A;  1EKE A;  4AHV A;  3I8D A;  4KO0 A;  1TKT A;  1TK8 A;  2FC0 A;  2NUB A;  1EX4 A;  1D9F A;  1RTD A;  3P5J A;  4CGH A;  3U3G A;  3NGY A;  1HNI A;  1WLJ A;  3OVN A;  3M8Q A;  2Z1G A;  3AO4 A;  3MED A;  3NBP A;  4Z4C A;  3RMC A;  4JRP A;  5HRP A;  3DLR A;  4PY5 A;  4DG1 A;  1IKY A;  4KV8 A;  4DMN A;  1HNV A;  1RTJ A;  5J2N A;  4JLH A;  3AO2 A;  1VSH A;  5CZ1 A;  5HRO A;  1QE1 A;  4CED A;  3OYH A;  3F9K A;  4LH4 A;  1TGO A;  2Z1H A;  4N5S A;  1C1A A;  4CF2 A;  4DTP A;  2HW3 A;  4CEO A;  1UWB A;  3LPU A;  4DFM A;  2F96 A;  1YVU A;  3TI0 A;  2D0A A;  2GBZ A;  3SUO A;  3TR8 A;  1UA1 A;  4KHU A;  4CIE A;  3VQ8 A;  5I3U A;  4CF9 A;  1DTQ A;  2ZQB A;  4K8Z A;  2O4I A;  3HO1 A;  4J2A A;  1TKX A;  2IC3 A;  3ZSX A;  4ELU A;  4B8A B;  1RT2 A;  3IS9 A;  3SUN A;  3V9X A;  2YKM A;  3LZJ A;  3RMD A;  3NGI A;  4F4K A;  4Z4F A;  1GOA A;  1LV5 A;  1X9S A;  4AHT A;  3PV8 A;  3QNO A;  3QES A;  2XO7 A;  4E7L A;  1WAF A;  1RBS A;  2A1R A;  1TAQ A;  3CYM A;  3DM2 A;  3NFA A;  2FBT A;  3ZT4 A;  3HYF A;  4CFD A;  4O0J A;  3SQ2 A;  3NE6 A;  2OA8 A;  4RW7 A;  4KFB A;  3AVL A;  3AVN A;  4W5T A;  3SNN A;  1J5O A;  3DRP A;  4ID1 A;  4Q5V A;  1N5Y A;  3PY8 A;  4CJS A;  2XY7 A;  2VG5 A;  3SI6 A;  4BDY A;  2YHB A;  4FYD A;  1RTI A;  3KTQ A;  1ZBI A;  4R5P A;  4DQR A;  4KHN A;  3LP0 A;  3T19 A;  4Y1C A;  1NK6 A;  4IBN A;  4MFB A;  3T3F A;  2Y1J A;  3SPZ A;  2F8S A;  1HRH A;  3CM6 A;  3ZSQ A;  3AVM A;  2W42 A;  3QEX A;  4G1Q A;  4AHR A;  1SKS A;  3QO9 A;  3NH1 A;  4DTN A;  5C42 A;  4F3T A;  4OGC A;  3OS2 A;  4O55 A;  4XIU A;  1I3A A;  3TAF A;  1JLE A;  4FJK A;  1ZBU A;  3OJS A;  3KLI A;  4KPY A;  2YKN A;  3MEC A;  4E7H A;  1C0T A;  3DLH A;  3PX6 A;  3RWU A;  2OPR A;  3KLH A;  5J1E A;  3LWM A;  1YTU A;  1KLM A;  3AVC A;  1LWC A;  3ZSW A;  4B9S A;  1C0M A;  4JRQ A;  1T05 A;  3ZSO A;  3VQ9 A;  4CF8 A;  4CJ5 A;  3OYA A;  5KGX A;  3KK2 A;  3I0R A;  1F21 A;  3L2V A;  1L3V A;  4PA1 A;  2DTU A;  3OYM A;  3RRH A;  5JS2 A;  3KKS A;  4M41 A;  3OYK A;  4CJF A;  4FZY A;  4FCY A;  3AVK A;  5CYQ A;  2ATQ A;  4LY7 A;  1J53 A;  2IGI A;  1KRP A;  3QEV A;  1JXB A;  3O3G A;  3MAQ A;  1KCF A;  2QK9 A;  4FJM A;  4IFY A;  4IKF A;  1TL3 A;  1KFD A;  3MXJ A;  5HLF A;  3K57 A;  4OKE A;  4KAZ A;  4W5N A;  1BCM A;  4FLX A;  3RTV A;  4E7I A;  1I39 A;  1KVA A;  3MEG A;  4FK0 A;  3DI6 A;  3VA0 A;  2D0C A;  4Z0U A;  2OPS A;  4DTO A;  1NK7 A;  4BE0 A;  2LSN A;  1NKB A;  4EZ9 A;  3HST B;  1IKW A;  4LD0 A;  4DSI A;  1KTQ A;  4CEQ A;  1KSP A;  3OYF A;  2E6L A;  1J54 A;  3K5M A;  3C94 A;  2Y1I A;  3ZSV A;  3UIQ A;  4H4M A;  3AVF A;  3TAP A;  3HPO A;  1VSF A;  1CXQ A;  1Q9X A;  1S1V A;  2GUI A;  4DTM A;  1B9D A;  1QHT A;  3C6T A;  4O0I A;  1JLC A;  3LP2 A;  3JYT A;  2JGU A;  4J2D A;  3V9W A;  3L2W A;  1GOB A;  3AVB A;  1BCO A;  1K6Y A;  1NKC A;  2OZS A;  3L2U A;  1SL0 A;  4CJU A;  3V6D A;  2P5G A;  4IG0 A;  4FLZ A;  2IDO A;  4KRF A;  4WE1 A;  4N76 A;  3FFI A;  4M3W A;  4KB1 A;  3NDK A;  1JLF A;  3TAG A;  3RMA A;  2O4G A;  3NF9 A;  4BWM A;  2FBX A;  1BQN A;  1VSJ A;  3DLE A;  4CEC A;  1S1W A;  4B8C A;  1IO2 A;  4E7K A;  4AIL C;  1U4B A;  4B9V A;  3VQA A;  4M3Z A;  1VSK A;  1WSH A;  3AO3 A;  4KRE A;  3HXM A;  2G8V A;  4GVM A;  4CCH A;  2WON A;  2DFH A;  2EX3 A;  3SQ1 A;  2XHB A;  4NYF A;  4L8R B;  1A5W A;  2HNZ A;  1S1T A;  5DMR A;  5HRS A;  1LWF A;  4QAG A;  4OJR A;  5CY4 A;  1KVB A;  3S9H A;  3THV A;  5DK5 A;  4IG3 A;  4CEA A;  2ZD1 A;  3SZ2 A;  3NH0 A;  2WOM A;  1SL2 A;  4F3O A;  4CF0 A;  2G8W A;  4N41 A;  2RF2 A;  1C0U A;  3OYG A;  3V81 A;  4ELV A;  4NCA A;  4B9T A;  3ISN C;  4DLG A;  1T7P A;  4Z4E A;  2G8F A;  4E19 A;  4F8R A;  4RW6 A;  4YNQ A;  5SZT A;  2HNY A;  3PX4 A;  2X74 A;  4YFU A;  4M45 A;  3QEP A;  4BDP A;  4NCB A;  5HRR A;  2YNF A;  3QIP A;  3NF6 A;  3S3O A;  4N47 A;  3M8R A;  1FXX A;  3DLB A;  2AJQ A;  4RG8 A;  4H8K A;  2PZS A;  1HJR A;  2DFF A;  3WNE A;  1HQU A;  5KTQ A;  2P5O A;  1DLO A;  1S6Q A;  1NK0 A;  3SV4 A;  4CIG A;  4JS5 A;  3HPG A;  1CLQ A;  3L2R A;  4CGI A;  4EP4 A;  3RRG A;  4CJV A;  3NCI A;  3CQ8 A;  2RKI A;  3DYA A;  2F8T A;  3AVI A;  4E89 A;  3ZSY A;  1Y97 A;  1Q8I A;  3DLG A;  4CHZ A;  4C8O A;  4Q0B A;  4N56 A;  1FKO A;  1SKR A;  2G8I A;  4CHQ A;  1HYV A;  4FVM A;  1D5A A;  1ASU A;  2G8H A;  1W9H A;  5KRT A;  1B9F A;  1U04 A;  2G8U A;  2HHV A;  1BHL A;  1UAX A;  4BWJ A;  4DQI A;  3AO1 A;  3BDP A;  5CYM A;  1NJZ A;  3NHG A;  1EET A;  3KIO A;  1JLB A;  1WN7 A;  3KKR A;  4M3X A;  1A5V A;  2DFE A;  1RIL A;  4TSX A;  2QXF A;  3TAQ A;  2BGG A;  1ITG A;  2HMI A;  3K5N A;  4CK3 A;  1CZB A;  4FZX C;  1HYZ A;  4FLU A;  1HYS A;  4O44 A;  3D0P A;  4HVJ A;  3MXI A;  1GOC A;  1HQE A;  4DF4 A;  1RBV A;  4FM2 A;  3AA3 A;  1WAJ A;  4CGF A;  4KTW A;  3HT3 A;  4LSN A;  4NCG A;  3S3M A;  1KFS A;  4E1M A;  1NOY A;  5J2Q A;  4DFP A;  4M3Y A;  1D9D A;  2Z1I A;  4RW9 A;  3KD1 E;  4FLT A;  3G10 A;  3TAE A;  1B92 A;  3DLK A;  4CJT A;  2HVH A;  1TVR A;  3SUQ A;  2G8K A;  1XI1 A;  1SV5 A;  3K2P A;  4Y1D A;  1WNS A;  2OZM A;  2XY8 A;  4B9N A;  2OPQ A;  2Q3S A;  5HP1 A;  4J2E A;  3OS0 A;  5D3G A;  2B6A A;  4RW8 A;  1MU2 A;  3I0S A;  5FRN A;  3AVA A;  3QIO A;  3ALY A;  1EXQ A;  2ETJ A;  2A1S A;  3CG7 A;  5FDL A;  1VSM A;  4CIF A;  3OYJ A;  5J2M A;  3TAM A;  4UQG A;  3NF7 A;  3V9Z A;  1ASW A;  3OYE A;  4C8K A;  3V9S A;  1LAV A;  2D0B A;  3O4N A;  1NJX A;  4DTU A;  4DU3 A;  4FJN A;  1ASV A;  4FK2 A;  5FRM A;  1C1B A;  4HUE A;  1RBU A;  4CK2 A;  3QIN A;  3OS1 A;  4ZTJ A;  1BGX T;  3KJV A;  2ZE2 A;  4W5R A;  4K8X A;  1DTT A;  3VQ4 A;  1FK9 A;  4H4O A;  1BIS A;  3B6P A;  4EP5 A;  3P1G A;  3AA5 X;  3K58 A;  1T03 A;  1J9A A;  1RT6 A;  3ZSZ A;  3NF8 A;  4CFB A;  2PYL A;  4B9M A;  4KB0 A;  4CJL A;  4I9Q A;  3MXM A;  4CFA A;  4FM0 A;  3AVH A;  3NGZ A;  5FRO A;  4J2B A;  4DSE A;  1TK0 A;  1NKE A;  4PWD A;  3AA2 A;  3VQQ A;  4FW1 A;  3EYZ A;  3V1R A;  1L5U A;  4DSJ A;  3V1Q A;  4E7J A;  3TAB A;  1TAU A;  3ZT0 A;  4CHO A;  3LP1 A;  1VSI A;  4OGE A;  1U45 A;  3HVR A;  2IS3 A;  2P51 A;  4W5Q A;  4E3S A;  3RR8 A;  3AA4 A;  4FW2 A;  2HB5 A;  2VG6 A;  3IG1 A;  1C1C A;  3AO5 A;  3WNF A;  3ZT3 A;  5C25 A;  1LWE A;  3OYN A;  4LH5 A;  3OJU A;  1IKV A;  4C8N A;  4KHQ A;  2P1J A;  1VRT A;  2OYQ A;  4BAC A;  4JS4 A;  3SUP A;  1XC9 A;  3AVJ A;  1RCH A;  2E4L A;  3SYZ A;  4NYN A;  4B08 A;  3CFP A;  4IFV A;  4CHY A;  5KRS A;  3V9U A;  3TAN A;  2XY6 A;  1IH7 A;  1L3S A;  5SWM A;  3LWL A;  4I7F A;  4I9L A;  4FZZ A;  4ELT A;  3C95 A;  4MQ3 A;  4DQS A;  1JLG A;  1S9G A;  3K59 A;  1NJY A;  2HHW A;  4FLW A;  2RN2 A;  3QLH A;  4CJ4 A;  2KZZ A;  1O1W A;  1W0H A;  4DWI A;  4M3T A;  3SV3 A;  2KFN A;  1KLN A;  4CJE A;  4FJL A;  3VQE A;  4OLB A;  2KFZ A;  4KHY A;  1Z26 A;  3ASM A;  3KLE A;  4FJ8 A;  2HHQ A;  2VG7 A;  4CEE A;  3CFR A;  4CGJ A;  4KI4 A;  4F2S A;  3LAK A;  1TL1 A;  2BAN A;  1G15 A;  1WSG A;  1QQC A;  3P83 D;  3VQ5 A;  1WSE A;  4CHN A;  4FJG A;  3S3N A;  1NK4 A;  1RDC A;  4O5B A;  2FBV A;  3ZT2 A;  3F73 A;  1NK8 A;  2DY4 A;  2B5J A;  4HCC A;  1RDA A;  2E6M A;  3DOL A;  3SCX A;  4HCB A;  1L3U A;  4QOZ B;  1HPZ A;  4CGD A;  5T7B A;  1JLA A;  3SQ4 A;  3U3Y A;  3WNG A;  4FLV A;  2D5R A;  2IOC A;  5EU7 A;  2X78 A;  1JL2 A;  2HVI A;  3OYI A;  4HTU A;  1ZYQ A;  3H08 A;  2PYJ A;  3OYL A;  4DLE A;  4CJQ A;  1T8E A;  2KTQ A;  4KTZ A;  3PO4 A;  3M8S A;  2HHS A;  4DFJ A;  3JSM A;  1RTH A;  3HP9 A;  3O3F A;  4GW6 A;  1NK9 A;  3CFO A;  4OLA A;  1LW0 A;  4CJ3 A;  4F2R A;  1RBT A;  4KHS A;  4FXD A;  1RNH A;  4OKK A;  3IAY A;  1BIU A;  1JXE A;  4ID5 A;  2YV0 X;  2YNH A;  4AH9 A;  4CEB A;  2KW4 A;  4HHT A;  4OPJ A;  2ITG A;  2KQ2 A;  5C24 A;  3MEE A;  4FJH A;  5I42 A;  3HPH A;  3VA3 A;  4CES A;  4FJJ A;  4DQP A;  3KLF A;  3KK3 A;  1NK5 A;  4DS5 A;  4M3U A;  1TV6 A;  4I2Q A;  3HL8 A;  4M42 A;  1SKW A;  2EHG A;  3QEI A;  1QSL A;  4ZHR A;  3DMJ A;  1VK0 A;  4AHS A;  2QKK A;  1RT4 A;  3QEW A;  3KD5 E;  4B3O A;  5JS1 A;  3U6F A;  3VQC A;  3L3V A;  1X1P A;  1RT5 A;  3CM5 A;  2Z1J A;  3QET A;  1RBR A;  2R7Y A;  1QTM A;  1SL1 A;  3VQ7 A;  3BGR A;  3KK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...